1T2KA

Structure of the dna binding domains of irf3, atf-2 and jun bound to dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
110
Chain Sequence
TPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 31-MER
publication title Crystal structure of ATF-2/c-Jun and IRF-3 bound to the interferon-beta enhancer.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t2kA01
3DEUA 3I64A 2EB7A 2M1BA 1L3LA 4M6YA 2A3SA 2VODA 4ZYEA 4ON0A 3B73A 3BROA 4MQ9F 2YR2A 3AAFA 1HW2A 3BY6A 5DDGA 4M9XA 4OIOF 4U0VA 4P9FA 2L4MA 4IF4A 3CO6C 1OYWA 1LDKB 1J7KA 4G7ZF 2DPDA 5FO5A 2DK5A 2GWRA 4KMUX 2JTVA 3F6OA 1B4AA 1YW9A 3R60A 3DF8A 2H09A 1BN5A 4LLNA 4Q5SF 4UNOA 2EFOA 1YLFA 2OU2A 1BIAA 1G6NA 1QGPA 4EMSA 2ZXJA 2VONA 2RQPA 3OOPA 2MC3A 5LHGA 1C0WA 5IT9Z 3KE2A 3SXYA 3QPHA 4HF1A 4U0WA 4A0YA 2JZYA 3PQJA 1WRJA 3DPLC 1AWCA 4KICA 5KK1A 1REPC 1ZRDA 2VN2A 3KEQA 2OAZA 3FM5A 1ZLKA 2O61A 3E6BA 1T39A 1JE8A 3HSFA 1I27A 4UUVA 3BWGA 4M74A 3GFIA 2RC4A 3I71A 2P6TA 2UWMA 2LF8A 1ODDA 2COMA 1XD7A 2LSOA 4HLYA 1YW7A 2XKPA 5D5VB 3KP7A 4HOBA 4ZYDA 3TDZC 3HRUA 3CUOA 1BOAA 1B1BA 2UXNA 5K5QA 5L3FA 1HKTA 2EJRA 5H6QA 2KRFA 2F5FA 2K4BA 2EFQA 3K1MA 4LFUA 3V8LA 4RGXA 2DT5A 1IXSB 1G4DA 3CLOA 1T98A 1ZLJA 3FX3A 2H6BA 4HAMA 2R3SA 4KIFA 1KQ9A 3K69A 1P4AA 1BI0A 1U3EM 4IRIA 5D8KB 4CZZA 3BJAA 2KIUA 2M87A 3KP3A 4N0BA 5KVRA 1Z9CA 1MGTA 1PP7U 4I0BA 3JAMZ 3GLXA 3M9AA 3BDDA 3JTHA 1P4XA 1ZN2A 3F22A 1PP8F 4UVCA 5HDGA 2YX4A 4RB3C 5LLQA 5ERIA 3WTSC 1I1GA 4L5IA 2QWWA 1ZGJA 3ISPA 1IN4A 2NS0A 1ULYA 5L3CA 2XAJA 3MWMA 4L9NA 5DCMA 3IKTA 4HDVA 4WXCA 1UB9A 2ZNZA 4EJOA 2D2WA 2PFBA 3HSEA 1S7AA 2BE5F 4WXDA 3KP6A 3EYYA 3JAMK 2ZBKA 2HWVA 1HKSA 5J8CA 1S7OA 2VBYA 1EH7A 2XAFA 2HYFA 3LQRA 1YFHA 1G3YA 2OQGA 4RGUA 1S6LA 2Q2EA 4XLNF 3TO6A 1F4KA 4LG0A 2F5DA 1YG2A 4KMFA 2MLKA 4M72A 2H94A 3REOA 5JI6A 3G3ZA 3E3VA 2HYGD 3U1DA 1K78B 4CHUA 4L18B 4OIQF 2ZFWA 4HX4A 5L3EA 3N4MA 3MCZA 2RDPA 2VT3A 1TLHB 5FFZA 4MQVA 4JBAA 3L7WA 4P9UA 3HUGA 5EEHA 3IHUA 4GGGA 1A04A 2MD5A 2ESHA 2ISYA 3K1PA 3ZPLA 3DPTA 1ONVA 2Y75A 1G3SA 4YIIA 4E70A 3HOSA 4JQFA 1XGMA 3ROUA 2DW4A 5F6FA 4LK0F 1SD4A 2IW5A 2FSWA 1V4RA 3N97A 1ZHFA 4ENMA 3GFJA 2F2EA 4EJTA 1Z1DA 1RIOH 2IVMA 1EH8A 4RGSA 1IN8A 2OA4A 2L3DA 3KFWX 4A6EA 1XSVA 1IN6A 4GO1A 5E1XA 4LB6B 2MH2A 3QU6A 1O3TA 2JPBA 3PQKA 1NHAA 2GA2A 3CTAA 3K1NA 3GZ5A 1LEBA 4A5MA 2QQ9A 3KP2A 4XLPF 3RDIA 2DFIA 2WC2A 2L01A 3FMRA 4K2EA 1BI3A 4EJVA 4M71A 4G6QA 2DPUA 3TO7A 5H6RA 1FWZA 4LJZF 2QENA 4CGZA 2CO5A 3F21A 2VC0A 4KIGA 2FMYA 3P9IA 3F8MA 2YX7A 3L09A 3GFMA 1ZH5A 1TQIA 1HW5A 2G7HA 1U8RA 1ZRCA 1OYYA 2IA2A 3WTZA 2PQ8A 4EVIA 1J59A 4ENJA 2RVCA 3GZ6A 3R6SA 5L3DA 4FX4A 1U2WA 1X3UA 5TRDA 1T0FA 4IRHA 1VTNC 5CLSA 1FSEA 3RKYA 5JFRA 4A5NA 2EFPA 2V9VA 2GA1A 1ZREA 5LGNA 5FFXA 3V8JA 4YFXF 2GXBA 1UFMA 1XN7A 1UHMA 2EV6A 3GF2A 1KU3A 3I58A 3IWFA 2BEOA 3QAHA 2JRTA 3BOQA 3HRMA 1LNWA 3ELKA 4G7HF 3HHHA 4IRGA 2L02A 4OMZA 4Q48A 4EJUA 5JR3A 4EM0B 3CDHA 4LD5A 4IXAA 3VB2A 3DQVC 3H3ZA 2XROA 3J7AO 3RYRA 1IXCA 2K02A 1B59A 4WWCA 2VE9A 1KGSA 4KYWA 2VT2A 4HW0A 1JGSA 4B8XA 1OR7A 3R61A 1ZRFA 2DI3A 1KU9A 2VBZA 2O3FA 1GXQA 1Z7UA 2XASA 2E1CA 5E18F 5AIPA 3TOAA 4YG2F 3VEPA 3ZN1A 2Z3YA 2Z5UA 3WG9A 1HSJA 2W25A 3KZZA 3GYHX 3B02A 2XHKA 3H92A 3P9KA 3JSPA 3PFIA 2DO7A 3H3UA 1FP2A 3LA3A 3TKYA 1OPCA 5JVTA 2W57A 2BYVE 1T38A 3I5UA 2FF4A 1IRFA 2W84A 1D5VA 4RB2C 3JSOA 1MJ9A 1Z6RA 2K86A 4G7OF 3MFKA 2PMUA 4R1HA 1XMKA 1XGNA 4RS8A 1U5TA 2F5CA 2UXXA 2W24A 4O6JA 4BQAA 2PBIA 2H6CA 1W7PA 4N9HA 2EA2A 1R00A 3J80Z 2IA0A 4FT8A 2Z33A 2E1NA 2DK8A 1DUXC 2HR3A 2CG4A 5LHHA 2VE8A 1XGOA 3C1DA 1KQ0A 3RTRA 4ZZLA 2CW0F 1SMYF 2ZO4A 4ESFA 1W4MA 5ILUA 3V8KA 1YQAA 4L0YB 1QZZA 3ZP5A 4JK1X 2M5WA 2V1XA 4G6DA 1O3SA 5FLXK 2A5YB 2D1VA 2RNJA 1YS6A 2EWNA 4OU0A 4A0XA 2FU4A 4I01A 3V4GA 4GYIA 3J80K 2FBIA 4OIRF 1DDNA 1USSA 3EETA 3WTWC 2YU3A 2D1HA 3BJOA 1CF7A 4U7BA 2XIGA 3HHGA 4NQWA 4BHBA 3WTXC 5DYMA 4QLCU 2EFNA 4MGRA 1B9MA 1YYVA 4A6DA 5HS7A 2CQKA 1FOKA 1IZ1A 2J5OA 4CDGA 1ZAOA 2XAGA 4CYDA 2GQQA 1G3WA 5K5OA 2NYXA 3ULQB 1SD6A 5D6FA 4RGRA 2ZJ2A 4GYGA 5CJ9A 1QZYA 3D0SA 2MH9A 3DFGA 5ICFA 1D3YA 2B0LA 2FEZA 5DCMB 4U88A 3M8FA 3C7JA 5HLHA 3O6BB 1F9NA 3CUQA 2Y48A 2ZMEA 3BJ6A 3CJNA 3ZMUA 1O3RA 1T2KA 5HVQC 1R5GA 1OKRA 1HKQA 4M9SA 5HS9A 4QWQA 1FSHA 4KDPA 2XV4S 1BM9A 3LAJA 3FM3A 4WXHA 1D8JA 3W6JB 4CICA 3KCCA 4NHJA 2A61A 4UVBA 5ILVA 1ON1A 5E1WA 1YTYA 1FYKA 1UHWA 3GUDA 3DP7A 4MHGA 4G8XA 2JPCA 4Q47A 3OV8A 4WF2A 4KNYA 2JSCA 4Y17A 3SZTA 3C18A 4UV8A 1RUNA 4Z2YA 1S29A 1U6GA 1IN7A 2IRFG 2WWYA 1U5TC 1USTA 1Z05A 4MNUA 2ZKZA 1FPQA 5TJJA 2ELHA 2KKOA 4O5VA 3WU0A 2QLZA 4UXNA 1H0MA 1I6XA 5CVRA 2DU9A 1Y0UA 2MBFA 2V79A 2DAOA 2YPRA 2HKXA 1V3FA 2CWEA 3R0AA 1SAXA 3P9CA 5E17F 1P92A 1U78A 3SHFA 3W6KB 4MTEA 4HF2A 2P8TA 1KA8A 4D0PA 4WK8F 1MDMB 2L54A 1OMIA 4UHTA 4HQEA 1YS7A 2HGCA 4HA8A 4L9TA 5HDNA 1IN5A 3I59A 1PUEE 4HLXA 3WGHA 3BP8A 3I53A 1ZGAA 2XAHA 4I02A 1FLIA 2P5KA 5E8GA 3V7SA 1LEAA 1IXRC 1O7LA 2IT0A 3C3WA 1J75A 2LNBA 3K9TA 1QNTA 5HOOA 1TQMA 2OD5A 2RV8A 3HTUA 2DQLA 3WGGA 4RB1A 3G73A 3E5UA 2EFWA 1J0RA 2UZKA 2VC1A 1WSUA 4M9ZA 1K6OA 2HZTA 5LEJA 5ICGA 1RNLA 3U2RA 1E17A 2NNYA 1K78A 2OZUA 2FBHA 5DD8A 4G9YA 1JXSA 4F7ZA 3ECOA 2LF7A 1IUYA 3FZVA 4B09A 2IP2A 3GW2A 3K2ZA 1B6AA 5D6EA 1SFUA 3F6VA 3CUQC 3WU1B 2OBPA 2CFXA 2C6YA 3WODF 4Y15A 3ERED 2A6HF 2PEXA 5L3GA 2MLGA 1WKMA 2QZ8A 4H0EA 2EA4A 4TV7A 4P55A 1YW8A 2QVOA 4BHPA 2IA1A 3F72A 1R36A 2EV5A 5CVIA 3NEUA 2M30A 1TQPA 1K7AA 3FXUA 4L5JA 2QUFA 3BZ6A 1QQIA 4ZYGA 2PN6A 4S04A 2AS5F 1FX7A 5J6XA 3KETA 4KUMA 3F8FA 3M8EA 4EQQA 1JHFA 2RN7A 5BMZA 2BV6A 4I2OA 3MEXA 2KJBA 4BH9A 4LB5A 2P4WA 3T8TA 2GIVA 2HTJA 4XSXF 3LAPA 2V1UA 3NRVA 5F64A 5LGTA 5E8IA 3HRTA 5ICEA 4KIBA 2O03A 4OMYA 2QBYA 2DLLA 1QPMA 1TW3A 3F8BA 1S3JA 4GXOA 1JHHA 1CGPA 2IJLA 4MTDA 3O3KA 3V7RA 1UCRA 1IF1A 1XMAA 3R4KA 4KT5C 1MJAA 3CO7C 3RKWA 5FD6A 2KIFA 3IWZA 3RJPA 2FRHA 5CVUA 2AXLA 1R23A 3KZYA 3DV8A 2RKHA 1XCBA 3JW4A 3TO9A 5D5XB 4ETSA 1WQ2A 4PCQA 2O0YA 2ETHA 5DUKA 1WI9A 4PGGA 3HIFA 4RAZA 3RPQA 4MEXF 3MQ0A 2PG4A 3M7GA 1BI2A 2P7CB 5BPIA 5K1YA 2KIMA 1GXPA 1ZYRF 4AIHA 2WV0A 4BNCA 6PAXA 1WWXA 2NAZA 1FY7A 1J5YA 2DTRA 3GWZA 2P7VB 1FYMA 3ZQ7A 2VBWA 3WTTC 1ZG5A 1RUOA 1BBYA 2D45A 1I1SA 1K79A 3LA7A 3E6DA 3QU3A 2A68F 4AIKA 1FZPB 4ZH4F 4YIFA 3NQOA 4U7DA 3TDUC 3GX4X 2PI0A 1ZARA 1TTYA 3VFZA 4Q4ZF 4UVAA 3KLNA 5FLXZ 2ZCWA 2G7UA 4FX0A 1ON2A 1KU2A 3MAJA 5AIQA 3J81K 3KEOA 2HDCA 3BPXA 2HS5A 3LQQA 3FHZA 2L4AA 2CGPA 1CF7B 2XGXA 5HLGA 3QOPA 2VBXA 2YSRA 5L3BA 2BGCA 1SD5A 3I54A 1XGSA 2XAQA 5ILSA 5LHIA 2QQAA 3TOBA 5BS6A 2DBBA 3F8CA 5ICCA 4S05A 1J9IA 4HX8A 5IT3A 2PJPA 3ML6A 4DNCA 4XBFA 3E6CC 1H9GA 4L9JA 2PLYA 2R7DA 4PDKA 5LGUA 5F1RA 4PZJA 5ED4A 4IVNA 3QP6A 1L0OC 4DQ2A 2CYYA 1MJBA 3Q5FA 5LEKA 4WCGA 4O3MA 4HBLA 3FF5A 4OINF 1BI1A 2IPQX 3CUQB 1Z91A 4N9IA 1YO5C 1BIBA 2EV0A 2HKOA 3LA2A 2ZMEB 3FMSA 1IRGA 4I09A 4KN7X 2XKOA 2TDXA 1O7FA 1EV7A 5LBQA 1LDDA 3F3XA 2M8EA 4HV5A 3QP5A 1TBXA 3BPVA 3HOTA 2VOOA 2GXGA 1TNSA 4EV0A 1PDNC 4GCVA 3EYIA 5IT9K 3FMQA 1E2XA 3IKVA 5CYVA 3WE3A 4NB5A 4R79A 4LLGF 5CVVA 2LKPA 5D8LB 3GO5A 1S8NA 3JTGA 1F5TA 5DCFA 1P6RA 3E5XA 1BC8C 2FMLA 5FGMA 3P7NA 2A69F 1XSDA 4FHTA 1STZA 2XRNA 2K7LA 1HSTA 4RAYA 2F5EA 3IL2A 1XCVA 1AOYA 5EEGA 3ABUA 1P2FA 2V6CA 2Z99A 3ECHA 4BHCA 2FQ3A 3IC7A 3QRFF 1R1UA 2XVCA 2FBKA 2VXZA 2P5LC 2HEOA 4LG0B 1DP7P 2R7FA 2FE3A 2V1DA 5E20A 3V7CA 2O8XA 3RIRA 4BYYA 3SFZA 3RI4A 1O57A 4ESJA 1DPRA 3L00A 3R0JA 3ABTA 3WTVC 1R1TA 1I5ZA 3ZMZA 4PGHA 4IHTA 4XRFA 3LFKA 5HDKA 2MA3A 1R1VA 1XDUA 3K0LA 3I59B 5BOXA 4EM1A 3GXOA 2STTA 1HW1A 3KLOA 2HQNA 2HOEA 5DEQA 1XSXA 4ZYHA 4LK1F 3FXQA 3F8NA 2FXAA 1FC3A 3T0YA 4HF0A 3L9FA 3SZPA 2FNPA 2E7WA 3EDPA 3EQLF 4YFKF 4IPAA 2WTEA 4A0ZA 5FD5A 5BPDA 2ACJA 3RKXA 4R8HA 4XSZF 1R5HA 3Q9VA 1DPUA 4LLLA 1KYWA 4IJAA 4M73A 4U0YA 2H27A 3S2WA 1SMTA 2E7XA 2LDUA 1IAWA 4UV9A 5E1ZB 3L2CA 2ADUA 2P6SA 5A2QZ 4KFCA 4HX7A 1F1ZA 1RI7A 3IRQA 1HXDA 1LVAA 2GZWA 3LSTA 2M45A 3HYIA 2DQRA 1FT9A 3WTYC 1J2XA 5DD4A 1H9TA 4RB0A 3VODA 3U9GA 2OQRA 1EH6A 3COAC 4HDUA 1O3QA 2G9WA 1W5TA 3RYPA 1XDSA 4EGZA 3MZYA 3ZMVA 5BQTA 2A07F 2X4HA 3WTUC 1HQCA 2XUBA 1XB4A 4OIPF 5A2QK 4BXUA 5H20A 1MDMA 1P4WA 4HV6A 3RPUA 2ESNA 2FA5A 1MKMA 4P96A 3FXRA 4MEYF 5J8FA 3FWEA 1D8KA 4KA4A 4LGWA 3F23A 1ZG1A 1Q1HA 2Y0MA 4EGYA 1TW2A 3T1BA 2QBYB 3WE2A 1MD0A 1QO0D 2FNAA 3WGIA 2HTSA 3T8RA 3ZMTA 1TNTA 1OYIA 2Z9OA 2EK5A 4CXFA 2NNNA 2CSOA 3I4PA 2A6EF 2ISZA 3HSRA 3GEZA 2P5VA 5D4SA 2QQBA 1LJ9A 3HTSB 4A12A 4M6XA 4HYEA 4ZZDA 3I0TA 1W7PD 1R7JA 3QPTA 1LDJA 4P5OA 1T6SA 2J5PA 1FP1D 3TQNA 2VOPA 2STWA 3GFLA 3VOEA 4I7HA 1HBXG 2RGVA 4L9VA 1GHCA 5DV5A 4OOIA 2FOKA 4EM2A 2JT1A 3LWFA 3ZMDA 1R58A 2Q0OA 3IRRA 1FYLA 4WX9A 4ENKA 4HZFA 3HRSA 1BJAA 4EJWA 3T5XA 3SQNA 5K5RA 4LMYA 2O6GE 2K27A 4A2UA 3KP5A 1FNNA 5D4RA 1R22A 4Y13A 2ZNYA 5HLIA 1KU7A 1B9NA 5AONA 4G94A 1SFXA 4ASNA 3ZMSA 1IW7F 1FBQA 3E97A 4ESBA 4L0ZB 4AVPA 2NRAC 1G3TA 1Z6TA 1BC7C 5FB2A 2PMHA 1YIOA 3O2PE 1U5TB 2W85A 3MZHA 1SFEA 3ZN0A 5D5UB 3DKWA 2OZ6A 3D5LA 3M1EA 4IHSA 2HFHA 1W7PB 4I0AA 2QYOA 3Q9SA 3J81Z 1FBUA 2BBYA 2KJCA 3GVAA 1SD7A 3E6MA 4I98B 4ENNA 5LRSA 3TGNA 1ZG3A 2Q8KA 1FBSA 5HS8A 1KQ8A 5DUIA 1MZBA 4CO8A 5LRRA 4BAYA 2K4JA 2GAUA 4YFNF 2QM3A 1KYZA 1QBJA 3EUHA 5CVJA 3KP4A 1GVJA 4KN4X 3E5QA 2HQRA 1LB2A 4AD9A 1RZ4A 1W5SA 2X0LA 3DXJF 4AIJA 4AWXB 5D5WB 1LQ1A 5JHUA 4HQMA
chains in the Genus database with same CATH superfamily
3DEUA 2LC2A 3I64A 2EB7A 2M1BA 4XRSA 1L3LA 4M6YA 2A3SA 2VODA 4B3XA 3RSNA 2HDWA 4ZYEA 4CH7A 1GUUA 2QQ8A 3C2GA 5EGOB 4C2TA 2PMZA 1WCMJ 4ON0A 3B73A 4IOCF 3BROA 3MVPA 4MQ9F 2YR2A 3AAFA 1HW2A 1DU6A 3BY6A 3SDGA 5DDGA 4UUTA 4M9XA 2E71A 2V26A 5E3LA 1SVOA 4OIOF 1JUSA 2X85A 4U0VA 4P9FA 2L4MA 4IF4A 1OQYA 4X1EA 3IP4B 3CO6C 2R0QC 1OYWA 2CUJA 1H89C 1LDKB 2W00A 3MD2A 1J7KA 2XC7A 2JUGA 5M5WJ 2Y30A 2E2HJ 1QVTA 4G7ZF 4NQWB 2DPDA 5FO5A 3CD6I 2DK5A 2GWRA 2DOAA 4KMUX 2JTVA 1WH5A 3F6OA 1YI2I 1B4AA 1YW9A 1LFPA 3R60A 3DF8A 2IBDA 2H09A 1BN5A 1ETXA 4CCKA 1PUFB 1QVUA 1VQPI 4LLNA 4Q5SF 3CJRB 4UNOA 2EFOA 1YLFA 2OU2A 4NNJA 3RKQA 2LREA 1BIAA 1G6NA 2DJIA 3GTOJ 2JVGA 5B1BH 1D5YA 1JKOC 1QGPA 4EMSA 2ZXJA 2I5UA 2VONA 2RQPA 2BY3A 3DLLF 3BCBA 3OOPA 1FOXA 1VI0A 5EZHA 3CCLI 2MC3A 5LHGA 1C0WA 5IT9Z 3KE2A 3SXYA 3QPHA 4DGWB 4HF1A 2Y0SA 4U0WA 4A0YA 2JZYA 1ETQA 2K40A 3PQJA 4CCMA 1WRJA 3DPLC 1AWCA 4KICA 5KK1A 4P1WA 1REPC 1ZRDA 3BTIA 4XLEA 3L2VA 2QSHX 3N05A 1TP4A 2VN2A 3KEQA 2TRTA 2IGMA 1ETWA 2OF7A 1U9OA 3OMYA 2OAZA 3FM5A 1ZLKA 1UG0A 2O61A 2M4GA 4EEFG 3E6BA 1T39A 1JE8A 3HSFA 3RCOA 1I27A 1NG7A 4UUVA 5FKMA 3BWGA 2L7ZA 4RA2A 3IV5A 2WBMA 4DZJA 4M74A 1H88C 4XRSG 3AFHA 3GFIA 2R7RA 2RC4A 3I71A 2P6TA 2WA0A 2UWMA 2LF8A 2HOSA 1ODDA 1JKPC 2YU9J 2COMA 1XD7A 1ETYA 2LSOA 3KEYA 1YW7A 2XKPA 5LFAA 1PJRA 4HLYA 1YITI 1YRNB 1YJWI 3BQYA 5D5VB 3KP7A 2CV0A 3CP2A 1W36D 4W97A 1BW5A 2CUZA 4UUSA 3SEZA 4HOBA 3AG4H 2EIJH 4E6KG 3SZGA 2BVLA 4ZYDA 3HL2A 3TDZC 1Y39A 1YIJI 3HRUA 3RZOJ 5GPCA 3CUOA 1BOAA 2LRDA 3BQZA 1B1BA 2VQHA 2UXNA 3ESWB 2BY1A 2ECBA 5E79C 5K5QA 3A2KA 5L3FA 1HKTA 2EJRA 2E5NA 4NC8A 5H6QA 2KRFA 2F5FA 4PJJA 3QYEA 4BL0B 2K4BA 4FCYA 2EFQA 2LKXA 1M1EB 3K1MA 1TWFJ 4LFUA 3V8LA 2DODA 4RGXA 5JLWA 3HJEA 1ORKA 2DT5A 1IXSB 2E1OA 1G4DA 3CLOA 3NWTA 4BJTA 2HXOA 1ZKGA 2QF7A 1T98A 1ZLJA 2K9LA 5DM6F 5GPAA 2JMWA 2LH9A 2H6BA 3FX3A 4HAMA 2R3SA 3M07A 4KIFA 4KJZA 1KQ9A 3PO2J 3K69A 3GTGJ 4KT6A 1P4AA 3G6EI 1BI0A 1WJ5A 2K5CA 1U3EM 4IRIA 2VKEA 5D8KB 3GTQJ 4CZZA 3K4KA 2L9NA 3BJAA 4XN3A 2MD0A 2KIUA 4DW6A 2KHMA 5J4VA 1HA8A 2M87A 4KISA 3KP3A 2A5WA 2ZC2A 4N0BA 4PSWA 5KVRA 1Z9CA 5B3SH 2NVTJ 1AKHA 1GV2A 4XONA 1MGTA 4BDZA 1PP7U 1BJZA 4ZDPA 2NVYJ 4I0BA 3JAMZ 2MFZA 3GLXA 3M9AA 3BDDA 2FD5A 3JTHA 1P4XA 1ZN2A 3F22A 2R7QA 1PP8F 4UVCA 3RPUD 1DP3A 5HDGA 2YX4A 4RB3C 4BGDA 5LLQA 3OS0A 1OISA 5ERIA 3PNVA 3WTSC 1F43A 1I1GA 1MBFA 4L5IA 1R4MB 2QWWA 1ZGJA 2LY9A 1SFKA 1P7IA 2DT7B 3LNQA 3KYDB 3ISPA 1IN4A 4ZYAA 4RM2A 2NS0A 1ULYA 5L3CA 4PUSA 2QKMB 2XAJA 1TZLA 4IHWA 3MWMA 1JKRC 4L9NA 4I6ZA 2KISA 4JX5A 5DCMA 3IKTA 4HDVA 4WXCA 1MH3A 1UB9A 3VSKA 2ZNZA 3OYEA 4EJOA 2D2WA 2PFBA 2E2IJ 4LG3A 3HSEA 1S7AA 2BE5F 3H3VK 3VYUB 4WXDA 3KP6A 2ECCA 5FRNA 4Y7NJ 4HSRA 1D1CA 3EYYA 3JAMK 1BR1A 2HWVA 2ZBKA 1HKSA 3TP3A 3A0BC 5J8CA 3FBNB 2VIXA 5FKNA 1S7OA 1WH7A 2MSYA 2VBYA 2VB6A 1B8IA 1VQ6I 2ME0A 1FTTA 1EH7A 2XAFA 3LL7A 2HYFA 3LQRA 1YFHA 3Q0VA 1G3YA 2JA2A 1W0UA 2OQGA 4RGUA 3EPZA 1W5CC 2W1OA 3KPHA 3WG7H 2Y2ZA 1S6LA 2Q2EA 2F6CA 1B72B 4XLNF 2R7UA 2ICWG 3TO6A 2VUMJ 1XPXA 4BS9A 1F4KA 4LG0A 3BCAA 3KYCB 2XF6A 3QPSA 5DS9A 2F5DA 2CFOA 1YG2A 4KMFA 1G2HA 2MLKA 4LIUA 4M72A 2H94A 1EKEA 3J7ZI 3K70D 3REOA 5JI6A 3G3ZA 3E3VA 4M6VA 2HYGD 5EZGA 3H5AA 3U1DA 4F93B 1K78B 4CHUA 4DZPA 4L18B 2EQRA 4OIQF 1TWCJ 2ZFWA 4HX4A 4C3JJ 5L3EA 2VLAA 3MCZA 3N4MA 2RDPA 2VT3A 3HOXJ 1TLHB 2DN0A 4D1QA 3HOUJ 5FFZA 1VQKI 4MQVA 4JBAA 4QSHA 2DYSH 2JRMA 1Y1VJ 3OIQA 3L7WA 3HUGA 4P9UA 5EEHA 3HDDA 3DBHB 1JT0A 5KNLA 3IHUA 3GTJJ 3ZQLA 4GGGA 1A04A 2MD5A 2XPUA 1X4PA 2ESHA 2K9QA 2ISYA 1N25A 4J19A 3K1PA 1SC7A 3ZPLA 4B4CA 2HOTA 3ASNH 3DPTA 1ONVA 4U87A 2JA5J 2Y75A 4DIQA 2CQQA 1G3SA 4XOTA 2KQRA 4YIIA 2NS7A 4E70A 2K85A 3HOSA 4JQFA 1XGMA 2WADA 3ROUA 2DFFA 2DW4A 4AYBN 1R6RA 5F6FA 1JI8A 4LK0F 1SD4A 4QPQA 2IW5A 2FSWA 1V4RA 3N97A 1ZHFA 3FKIJ 3CMYA 4ENMA 3GFJA 2F2EA 4EJTA 2V6EA 9ANTA 1Z1DA 1RIOH 2IVMA 1EH8A 4RGSA 1Y8RB 1SANA 1IN8A 2OA4A 2L3DA 3KFWX 4A6EA 1Z67A 4A3GJ 4JX6A 4D5FA 1XSVA 3IH4A 4XKVA 1PVEA 1T08B 1IN6A 4GO1A 5E1XA 2XSDC 3D5SC 4LB6B 2LP0A 2MH2A 2EZKA 3JRIA 1ERDA 3LSRA 3QU6A 4D7NA 1O3TA 3LSKA 2JPBA 3PQKA 3S3MA 1NHAA 3ONQA 2YUSA 3WHCA 1X4OA 3K7AJ 2GA2A 3ERMA 1E0EA 3ABMH 3CTAA 1A6QA 3K1NA 5F04A 2HPMA 3GZ5A 1LEBA 4A5MA 1RPWA 2QQ9A 5IYDJ 1AA7A 2LKSA 3KP2A 2M0MA 5FJ8J 3RDIA 4XLPF 2DFIA 2WC2A 1WFXA 2L01A 5F1JA 1UELB 2MG4A 3FMRA 1AU7A 1X3ZB 4K2EA 1OCPA 1BI3A 4N4NB 2WAQN 1VFCA 4EJVA 2ZFUA 1YOVB 2L9RA 3ZR8X 4M71A 4PJMA 4G6QA 2DPUA 4F55A 3TO7A 4DOZA 2K3PA 5H6RA 3S2HJ 1KONA 4ZTFA 2OCEA 3G2BA 2IS2A 2Y69H 1FWZA 4LJZF 3DKXA 2PJRA 1TC3C 2QENA 4CGZA 2CO5A 5KAIC 5CQEA 4CYCB 2XB5A 3F21A 2VC0A 3VSLA 3BG6A 3OL3A 4IKFA 2DXIA 4OAYA 4KIGA 2FMYA 4QTRA 3P9IA 1D0XA 3F8MA 2YX7A 2Y9ZA 3L09A 3GFMA 1ZH5A 3ZOBA 1TQIA 4PJNA 4UB6C 1HW5A 2G7HA 1U8RA 5GTHC 1ZRCA 1OYYA 4AVZA 3HOVJ 2IA2A 1MNEA 3WTZA 2PQ8A 3RQIA 4XKBA 4EVIA 2R5ZB 2L5QA 2V9KA 1HC8A 2ZB9A 4CZCA 3JRAA 1J59A 2MC4A 4ENJA 2HPIA 2M0CA 2RVCA 3GZ6A 3R6SA 3M4OJ 5L3DA 4FX4A 1U2WA 1X3UA 2VKDA 2QKLB 3HC7A 1BR4A 1X1DA 3G71I 3TL4X 2X9DA 1T0FA 5TRDA 4IRHA 2XGCA 1VTNC 5CLSA 1FSEA 3RKYA 5JFRA 4A5NA 2EFPA 2V9VA 2GA1A 1IJWC 2X1CA 3OWTA 1ZREA 5LGNA 5FFXA 3V8JA 2HNHA 4YFXF 2AO9A 2EILH 1UFMA 2GXBA 3IUOA 1XN7A 1A35A 2R7XA 1UHMA 2EV6A 3HOWJ 3GF2A 1KU3A 1GVDA 2CUEA 3I58A 3IWFA 4A3MJ 2BEOA 2EH3A 4A3DJ 4JYKA 3QAHA 4RLQA 2E2JJ 3PIPF 4BE1A 2DA3A 2JRTA 3DEEA 4W1UA 3QOEA 3BOQA 3HRMA 1LNWA 5J1UA 3ELKA 2VI6A 4G7HF 3HHHA 1JUPA 4IRGA 2L02A 4OMZA 1A5JA 4Q48A 3K4CA 2L7MP 2HVQA 1ITYA 4EJUA 3A01A 5JR3A 4EM0B 1MMGA 3CDHA 4HEA2 2XGEA 1T33A 4LD5A 4IXAA 3VB2A 1J09A 3DQVC 3H3ZA 1WJFA 2XROA 2K3FA 3TW7A 4BEHB 5IP6A 2R7WA 3J7AO 5HNFA 3RYRA 1IXCA 1K4TA 2K02A 1R9TJ 1IO2A 1V54H 2DMPA 3AG2H 4S0HB 1B59A 3OYCA 3GTLJ 4WWCA 2VE9A 1Q1VA 1KGSA 1JJ6C 4KYWA 1V5GA 1R49A 2VT2A 3IAS2 4XL9A 5DTDA 4HW0A 2FOWA 1IRZA 1JGSA 4B8XA 1OR7A 5JLXA 3R61A 3BR2A 2BY2A 3BC8A 1ZRFA 2DI3A 4BQQA 4J00A 1JTYA 2OPTA 1KU9A 2VBZA 3CF5F 1MMDA 1MBEA 3OOUA 4GDFA 3MKWB 1APLC 3LSJA 2O3FA 1GXQA 4BBSJ 1Z7UA 4RDUA 1VQ7I 4BACA 3RQ4A 5C4XJ 3S3OA 2XASA 4BDYA 2E1CA 1I3AA 5E18F 3B6AA 5AIPA 3TOAA 4YG2F 1VZ0A 1WHUA 4XM3A 4RAFA 3FK7A 2EPFA 3HEFA 3VEPA 3ZN1A 2Z3YA 2Z5UA 3WG9A 1HSJA 2W25A 3KZZA 3GYHX 2DTZA 3B02A 1HCRA 2XHKA 3H92A 3P9KA 3JSPA 2R5YB 3PFIA 2DO7A 3H3UA 2L9VA 1GT0C 1FP2A 3CDIA 3LA3A 2F48A 3OR2C 3TKYA 1OPCA 2DFEA 5JVTA 2W57A 2GLOA 2BYVE 1T38A 3DTIA 4IHXA 4CCJA 1XMXA 3I5UA 1R71A 2FF4A 1IRFA 2W84A 1D5VA 2E5ZA 4RB2C 3JSOA 4X6AJ 1MJ9A 3O8HA 1I39A 1Z6RA 2UV1A 2JWTA 3ZQFA 5K7ZA 2K86A 4G7OF 4RM3A 3MFKA 2PMUA 4R1HA 2HXIA 3KX2A 1XMKA 1XGNA 2KDOA 4RS8A 1U5TA 5LD2C 5JHFA 5B66C 2F5CA 2UXXA 2W24A 4O6JA 4E7JA 4BQAA 2LG4A 2PBIA 2H6CA 4DBQA 1X2NA 2CQNA 1W7PA 2AXTC 4N9HA 2EA2A 1R00A 4C30A 4B1RA 3J80Z 3OYFA 2KZGA 2IA0A 3FXJA 4FT8A 2CU7A 1ZK8A 2Z33A 2E1NA 2DK8A 2RAEA 1DUXC 2HR3A 4C3IJ 2CG4A 3PUFA 2CQ7A 5LHHA 2VE8A 1XGOA 2E34A 1LVKA 2JJ7A 3C1DA 1BL0A 1KQ0A 3RTRA 4ZZLA 2CW0F 1SMYF 2HI3A 2ZO4A 4ESFA 4UUSB 2EZIA 3M3YJ 1W4MA 5ILUA 3V8KA 1YQAA 1SFOJ 4IQJA 4L0YB 1QZZA 3ZP5A 3CZ6A 4QPOA 2ELJA 4F3QA 4JK1X 3OYLA 2M5WA 1VQ8I 3F0CA 2KRHA 2E1MB 2V1XA 4G6DA 1O3SA 4DJAA 5FLXK 4IEJA 4Y52J 4A3KJ 3FHNA 1WZ2A 1JGGA 2A5YB 2UUZA 2D1VA 3KZIC 2DA1A 2RNJA 1YS6A 3MN2A 2EWNA 3SDBA 1QU3A 2BZTA 4OU0A 4A0XA 2FU4A 4I01A 3ZQGA 3H1CA 2DMTA 3HGGA 2E35A 4GYIA 3V4GA 3OYNA 3J80K 2FBIA 4OIRF 1DDNA 1N78A 1USSA 5GTIC 3EETA 3WTWC 3HOYJ 1T0FC 2CW7A 4XORA 3WU2C 3JR9A 2YU3A 2IAIA 4PSXA 4ZTJA 2D1HA 3BJOA 1CF7A 4U7BA 2WB1N 2XIGA 2WAEA 1G8XA 2W82A 3BR5A 4F91B 4BQNA 3HHGA 3CCEI 2E19A 3H9QA 4HRIA 3G1OA 4NQWA 4BHBA 1VQ4I 3CCSI 5EG0B 3WTXC 5DYMA 4QLCU 5FROA 2EFNA 4MGRA 1AKHB 4NDLA 1B9MA 1YYVA 4A6DA 5C4JJ 2O8KA 4A3EJ 5HS7A 1PUFA 3A03A 2CQKA 1BA5A 1TT5B 1FOKA 1IZ1A 3ASOH 2J5OA 5HNHA 4CDGA 3L2WA 1ZAOA 2X1DA 4XLFA 2XAGA 4CYDA 1EJ9A 2GQQA 1G3WA 1JUMA 2ELKA 5K5OA 3OSGA 3CC4I 2NYXA 3ULQB 2GOMA 1SD6A 3H9GA 2WAFA 5D6FA 1D1BA 4RGRA 2IGOA 1E3PA 2MGQA 2ZJ2A 4GYGA 5CJ9A 1S9HA 1NG6A 2ZXWH 1JJ8C 1VF9A 2LY1A 1QZYA 2NXNB 3D0SA 1MMNA 2MH9A 3DFGA 3QQAA 1D3YA 2B0LA 2FEZA 5ICFA 1W0TA 2XPVA 5DCMB 4U88A 1GDTA 3M8FA 3JRCA 3C7JA 3S32A 5HLHA 3O6BB 1F9NA 3HB9A 3PL8A 5EJCA 3W3CA 3CUQA 1OR7C 2Y48A 3ZXSA 2ZMEA 2VKVA 3CJNA 3BJ6A 3ZMUA 1O3RA 1T2KA 2X6XA 1CQTA 1MNDA 2AQFA 2B63J 5HVQC 1R5GA 5M3FJ 1OKRA 1TWGJ 4D7MA 1HKQA 4M9SA 1MBHA 5HS9A 1OCRH 3CCMI 2EIKH 4QWQA 1FSHA 3HGYA 1B8IB 4DYQA 4KDPA 1T56A 2XV4S 4CUGA 1BM9A 3A02A 3LAJA 3FM3A 2R93J 4WXHA 1D8JA 3W6JB 4CICA 3MKYB 3KCCA 1A6IA 3ZCOA 2LTPA 2Q2EB 4NHJA 3CC7I 2A61A 4UVBA 3K4MA 5ILVA 1PYVA 1ON1A 1GV5A 4CSWA 1QZEA 2FQ4A 3SYTA 2XF5A 3GTMJ 5BNGA 5E1WA 1YTYA 1FYKA 2K9SA 3BG9A 1UHWA 3GUDA 3DP7A 4MHGA 4V19K 4G8XA 2JPCA 3HZJA 4Q47A 4PFOA 3OV8A 3FXOA 4WF2A 3QYFA 4KNYA 2JSCA 1YJ9I 3S1QJ 4Y17A 3SZTA 1TT0A 3C18A 3M8JA 2LBFB 1K6YA 3DWLE 2EZLA 4UV8A 3BTJA 2NOGA 4ZJZA 3HUGB 1N77A 1RUNA 2FX0A 1FEXA 4Z2YA 4XQFA 3EUKL 1S29A 1HF0A 3JCUC 1U6GA 3PFYA 3CMMA 1IN7A 2IRFG 1MW7A 5H2FC 5E3NA 2ZXHA 2WWYA 4E7HA 1U5TC 1USTA 1WJAA 4DBRA 5IYCJ 1D0ZA 1Z05A 1KZHA 1WJDA 4MNUA 2ZKZA 1FPQA 1DGRM 5TJJA 5F0HA 4UY8I 1K61A 2ELHA 2KKOA 4O5VA 1HOMA 1VQOI 4AIDA 3BR1A 3WU0A 2QLZA 4UXNA 1H0MA 1I6XA 3JRHA 2KPMA 3M1CA 5CVRA 2DU9A 1Y0UA 2M9HA 2TCTA 3DTEA 3OL4A 3BR0A 1MSEC 2LD5A 3PJRA 1FOWA 1FJLA 2MBFA 4YEJA 2NVXJ 2V79A 1Y0NA 2DAOA 1TWHJ 2YPRA 2IS1A 5F27A 2P0WA 2X6YA 1OCTC 1LE8B 1V5EA 2HKXA 5M5YJ 3KYLA 1V3FA 5EF6A 2CWEA 3R0AA 4CCOA 1SAXA 3P9CA 5E17F 3Q3SA 2DCEA 2NVQJ 3AL0B 3PSFA 1P92A 2EBIA 3JRBA 1OCCH 1U78A 1K4SA 3SHFA 3W6KB 4MTEA 4HF2A 2P8TA 1KA8A 3BR3A 4BBRJ 4D0PA 3SFIA 4WK8F 2VL8A 1MDMB 2L54A 4J01A 1OMIA 2F4OB 2W48A 1T95A 4GRIA 3DU5A 4GFBA 4UHTA 1YX3A 2WV1A 4ZC3A 4HQEA 2CV2A 1YS7A 2HGCA 4HA8A 4E7KA 2KP6A 4L9TA 3H36A 1IN5A 3I59A 4BUPA 5HDNA 3FIWA 3DCFA 3OYKA 1PUEE 4HLXA 1ENHA 3WGHA 3BP8A 3TW6A 3I53A 3S1RJ 1ZGAA 3QODA 2CJJA 5GAEJ 2XAHA 4I02A 1FLIA 2R4GA 2P5KA 5E8GA 3V7SA 3ABLH 4F92B 2CMPA 4II2A 1HDDC 1LEAA 1IXRC 1O7LA 2IT0A 3C3WA 3PUBA 2PJRB 3VDXA 1J75A 4XNFA 4C2UA 4MIMA 2I10A 2LNBA 3G1MA 3K9TA 3ZQIA 1QNTA 3JRDA 5HOOA 1TQMA 1X19A 2OD5A 1JT6A 2RV8A 1RESA 2DQLA 3HTUA 4XLAA 3WGGA 2D5VA 4RB1A 3LMMA 1B72A 1ZGWA 3G73A 3E5UA 4PFPA 2EFWA 2DJNA 1J0RA 4FETA 2UZKA 3OYBA 1WGXA 2B7EA 2VC1A 4LIVA 1TL8A 1WSUA 5CKTA 1OCZH 4M9ZA 1K6OA 2HZTA 5LEJA 5ICGA 1RNLA 3LOCA 3PM1A 3U2RA 4M3BA 1SVMA 2NNYA 1K78A 2OZUA 1E17A 2FBHA 5DD8A 2DA6A 4G9YA 1JXSA 4F7ZA 1X58A 3S1NJ 3NAUA 3ECOA 2BW3B 3OSFA 2LF7A 1IUYA 3FZVA 4B09A 2IP2A 3GW2A 3K2ZA 1B6AA 1Y1WJ 5D6EA 4HG2A 1WVRA 4BJ6C 3F6VA 1SFUA 4AYBA 3FISA 1LKXA 4XMYA 3CUQC 3WU1B 2OBPA 2CFXA 4B44A 3D5RC 2C6YA 2CUFA 2ZMEC 2NS8A 4BE2A 3WODF 1V55H 4Y15A 3ERED 2LR8A 5IOYA 2A6HF 2PEXA 4CA0A 2QGUA 5L3GA 2MLGA 2V1NA 1WKMA 1OJLA 2QZ8A 1RKWA 4H0EA 2EA4A 3C2BA 1P9QC 4TV7A 4HNTA 4P55A 1YW8A 2Z2SB 2QVOA 5EEAA 5J1YA 4DYCA 4BHPA 1X2MA 2F4IA 2IA1A 3K6GA 2M7AA 3F72A 5M3MJ 4I99C 4LITA 1R36A 2EV5A 4AUXA 1LFBA 3L2UA 1VQ5I 5CVIA 3NEUA 3CJTB 2M30A 1TQPA 1K7AA 3FXUA 4L5JA 2QUFA 1HLVA 3BZ6A 5DM7F 1QQIA 4ZYGA 2PN6A 4C2MJ 4S04A 4A3BJ 2AS5F 2O5RA 1FX7A 4DYRA 1SAUA 5J6XA 2BHYA 2DA2A 3KETA 4KUMA 3F8FA 3M8EA 4EQQA 3QYBA 1JHFA 2QCOA 2L7KA 2RN7A 3BR6A 5BMZA 1ETVA 2BV6A 2DDAA 1QA6A 4I2OA 3MEXA 2KJBA 2WAQA 4BH9A 1Z3XA 2H1LA 5F0CA 3W6VA 2P4WA 4LB5A 3GLLA 4H4KC 3PNYA 3T8TA 4BQOA 2GIVA 2HTJA 4XSXF 3LAPA 3CJQB 2V1UA 3NRVA 5KHDA 3HKZN 5F64A 1I6HJ 1MBKA 5LGTA 2AQEA 5E8IA 3GTPJ 2JA6J 1MMSA 1W1WE 3HRTA 3OS2A 5ICEA 4RMNA 5J3LA 3LSGA 4KIBA 3OYJA 2O03A 4OMYA 1YJNI 2QBYA 4FTHA 2VJJA 5HLTA 2DLLA 1QPMA 1TW3A 1Z0XA 2GIZA 3MKZA 3F8BA 1S3JA 4D9JA 1UMQA 3BTCA 4GXOA 3MZ8A 2VJ4A 4QIWN 1JHHA 1CGPA 2IJLA 4MTDA 4B48A 3B6CA 2P81A 2V7FA 1Z3YA 3O3KA 3W2VA 3V7RA 1UCRA 1IF1A 3L1PA 3H9JA 3O8GA 1XMAA 1MSFC 4PK4A 2VJIA 3R4KA 4KT5C 4RBOA 3BG7A 1MJAA 3CO7C 1YX5A 3Q0UA 1F36A 2R7TA 2MABA 3RKWA 2IXSA 5IP9J 5FD6A 2GOXB 2KIFA 2IGNA 3IWZA 3RJPA 2FRHA 5J4YA 5CVUA 2ZXIA 2AXLA 2X6WA 2H8RA 1R23A 3KZYA 4G6TB 2LY2A 2XDVA 2DOEA 2RKHA 1XCBA 2XB0X 3DV8A 3JW4A 3TO9A 5D5XB 4ETSA 4IOAF 3TP0A 1OLTA 1P7JA 4YELA 3VYTB 3H35A 3DKYA 2Y9YA 2R5ZA 1WQ2A 4PCQA 2O0YA 2V9PA 2ETHA 2XRLA 5DUKA 1WI9A 4PGGA 3HIFA 2CQXA 2M34A 4RAZA 3RPQA 3J7YJ 4MEXF 2PX9A 2YS9A 3MQ0A 2HVSA 1IG7A 2PG4A 4OAZA 3M7GA 4UB8C 1BI2A 2P7CB 1IRXA 2JK3A 5BPIA 5FRMA 5K1YA 3DTKA 1FTZA 2KIMA 1GXPA 1ZYRF 2VPRA 4AIHA 2WV0A 3ZQQA 3FXKA 4E7IA 4BNCA 6PAXA 1WWXA 3ZQCA 1T8IA 2PMZN 3GMEA 2NAZA 1FY7A 3F9KA 1J5YA 2DTRA 2ME6A 2DOFA 2N8GA 1BR2A 3GWZA 1G59A 1FMWA 3OYDA 3HPGA 2P7VB 1IC8A 1FYMA 4XLHA 3ZQ7A 2VBWA 1ETOA 2EIMH 1WPKA 2XGDA 5IY5H 4M3GA 1ETKA 3WTTC 1ZG5A 1RUOA 1BBYA 1D1AA 2E36A 2D45A 3AL0C 1I1SA 1K79A 3LA7A 3E6DA 1LUJB 2R92J 3W2WA 3QU3A 4Z6YA 2A68F 1AHDP 4AIKA 3KIOA 3I4MJ 1FZPB 4ZH4F 2GXAA 5FKOA 1A31A 1R5ID 4YIFA 4V2GA 2GBYA 3NQOA 2KL4A 4U7DA 4YRVA 1GLNA 3TDUC 2EINH 3GX4X 2V4JC 2PI0A 2DA5A 3OYHA 1ZARA 3BT9A 4A3JJ 2JA7J 1TTYA 2M4KA 3VFZA 4Q4ZF 4UVAA 2DFHA 3QPLA 4MO7A 2OV7A 1E3OC 3BTLA 3KLNA 3CMEI 1HDPA 2OJED 5FLXZ 2ZCWA 2G7UA 4FX0A 1ON2A 1KU2A 1BOBA 3MAJA 5AIQA 4B43A 3J81K 5E3MA 3KEOA 5FLMJ 2X6OA 5F0FA 2L9SA 1D0YA 2WY8Q 2M8GX 2Y0SN 3BPXA 3E1SA 4NC7A 2HS5A 3LQQA 3OY9A 1MNMC 2HDCA 3FHZA 3FDYA 1X3WB 2FJ1A 2IS6A 2L4AA 5IYBJ 2CGPA 1LFUP 1CF7B 3L2QA 2XGXA 5KCMA 5HLGA 3QOPA 1S7EA 3AG3H 2VBXA 2OCCH 1IV8A 2YSRA 4A3LJ 2XAUA 5L3BA 2RQQA 2BGCA 1SD5A 2O9LA 3I54A 1XGSA 2XAQA 5E3OA 2BHZA 1MBJA 5ILSA 3TMOA 2QQAA 5LHIA 2BXYA 3TOBA 5BS6A 2DBBA 3WHBA 2DMQA 3F8CA 3CCUI 5ICCA 4S05A 4AU7A 5J1RA 1J9IA 3S17J 2A6TA 4HX8A 4Y4RA 2R5YA 3UKGA 4XICA 5IT3A 2EZHA 2PJPA 4G12A 3ML6A 1IDYA 1X1AA 4DNCA 4XBFA 1IDZA 1UHSA 4XKCA 3A0HC 3LSMA 3E6CC 1H9GA 3K4LA 5HODA 1RR7A 4L9JA 2PLYA 2LMDA 1ZELA 2R7DA 3L2RA 1JKQC 4PDKA 5LGUA 5F1RA 3K4JA 2OTJI 5M5XJ 2GM4A 4PZJA 5ED4A 2KFDA 4IVNA 3TBIA 1UAAA 5EGOA 2M7BA 3UNGC 3OS1A 4AM3A 3QP6A 3BLYA 1L0OC 3SEQA 2CYYA 2X51A 4DQ2A 1MJBA 3Q5FA 5LEKA 4WCGA 4O3MA 3FF5A 4HBLA 2CV1A 4OINF 3CUQB 1BI1A 2IPQX 1Z91A 1XTAA 4N9IA 1YO5C 1BIBA 3HOZJ 2EV0A 2HKOA 4Y33A 3LA2A 2ZMEB 3FMSA 3K70C 1IRGA 2H8WA 4I09A 4KN7X 4XOPA 2XKOA 2LYCA 3H0DA 1WJCA 2TDXA 2W4SA 1O7FA 1RC9A 1EV7A 5LBQA 1LDDA 3W2AA 3F3XA 2OTLI 2M8EA 4HV5A 3VYRB 3S93A 3C2HA 3QP5A 3CCVI 2CW8A 1TBXA 2BXZA 2OUMA 2LFBA 3BPVA 2ID6A 1RRJA 3HOTA 2ZSIB 1YE9A 2VOOA 1NH3A 2GXGA 1TNSA 3K10A 4EV0A 4A93J 1PDNC 4GCVA 5FKLA 3EYIA 5IT9K 3FMQA 2R7VA 3IH3A 5GADJ 1OCOH 1E2XA 3HPHA 3IKVA 5CYVA 2M3AA 2L7FP 4HPQA 3WE3A 5B5EC 3CCQI 4NB5A 4RAGA 2KIQA 4JP0A 4R79A 2H1KA 4FE7A 2FUG2 3BG5A 4LLGF 2F5VA 5C44J 5CVVA 4HSTA 3CESA 2LKPA 2KZVA 5J47A 2VKHA 5D8LB 5IOZA 2IS4A 2NVUB 5GP9A 3PIOF 3GO5A 1S8NA 2L0KA 1FOYA 3JTGA 1F5TA 4ZDOA 2KLOA 5DCFA 1P6RA 2VQGA 3GBGA 2WB1A 3E5XA 1NK3P 3DU6A 1UJ8A 3P5JA 1BC8C 2FMLA 4M3FA 5FGMA 1UG2A 3P7NA 4Y3OA 3PO3J 2A69F 1XSDA 1K83J 3K4BA 1IUFA 3FBIB 1X1PA 4PJ0C 1BW6A 2VQCA 3IAM2 2LVSA 3PSIA 1STZA 4FHTA 2XRNA 2K7LA 4BJ5C 1HSTA 4RAYA 2F5EA 3IL2A 1XCVA 4IHVA 1AOYA 3NARA 1MBGA 5EEGA 1XX5A 1P2FA 3ABUA 3BZKA 2V6CA 2Z99A 2DYRH 3ECHA 1YRNA 4BHCA 2FQ3A 3IC7A 4X0GA 3QRFF 1R1UA 3HG9A 3LSPA 2KRCA 2XVCA 2DA7A 2CH0A 3JRGA 2FBKA 4M3DA 2VXZA 2P5LC 1TWAJ 2HEOA 1O4XA 5CPRB 4LG0B 5EG0A 2R7FA 1DP7P 1NK2P 2B9SA 2FE3A 3FXMA 2ID3A 1I3QJ 2I8DA 4ZDLA 4BKXA 2V1DA 4NC6A 3EUHC 5E20A 3V7CA 2O8XA 3RIRA 4BYYA 3SFZA 3RI4A 1O57A 4ESJA 5B1AH 2M2EA 3AKZA 1DPRA 3L00A 3CP8A 1YHQI 1Z77A 2JQ7A 3ZRGA 3R0JA 4A3CJ 3ABTA 2VXDA 5FKKA 3WTVC 1R1TA 2BY0A 1I5ZA 3ZMZA 4PGHA 2QSGX 4NBQA 4IHTA 1Z21A 3LSIA 4XRFA 3LFKA 5HDKA 4AC0A 2OC6A 3CCJI 3CCRI 2MA3A 1R1VA 1XDUA 4A3FJ 3G4SI 3K0LA 2CRGA 2VASA 2DMNA 3MMYB 4HNUA 3I59B 5BOXA 2XSJC 3NWSA 3U21A 2JSPA 5EYRA 3VYSB 3A4CA 2ZJRF 2R7ZJ 1ZTRA 4EM1A 3GXOA 2STTA 1HW1A 3E0JB 3QWLA 3KLOA 4C3HJ 5KAFC 4B3AA 2HQNA 2DDBA 2HOEA 3RZDJ 5DEQA 4XIDA 3D1NI 1XSXA 4ZYHA 3I4NJ 3U1KA 4LK1F 2AHQA 3FXQA 3F8NA 2FXAA 4JOMA 1VQ9I 1FC3A 3T0YA 4KITB 1VNDA 2ZSHB 4HF0A 1Z7LA 3L9FA 4RLFA 3SZPA 2FNPA 3TEDA 1MMAA 1X1CA 2E7WA 3EDPA 3JREA 4E7SA 2DT6A 3EQLF 4YFKF 1U9NA 4IPAA 4MFEA 3DBLB 4E7LA 2WTEA 3HBLA 1XC5A 3OIOA 4A0ZA 5FD5A 5BPDA 2ACJA 2HU9A 3RKXA 3OYIA 4R8HA 2HQAA 4XSZF 1R5HA 1S72I 4HNVA 3CQZJ 2RREA 3I9V2 1SEUA 5EDNA 3Q9VA 1DPUA 4BXFA 2BVMA 2QA4I 2WY7Q 4LLLA 5K7HA 2DMUA 1KYWA 4IJAA 4M73A 3SJMA 4U0YA 2H27A 4M3EA 4XKWA 1U8BA 1Y56A 2LBFA 3S2WA 4IHYA 3GZNB 3H5NA 1SMTA 3VPRA 2KT0A 4A3IJ 2E7XA 2LDUA 3J7AY 2LK2A 1MH4A 1VQNI 1RKTA 1NTCA 4UV9A 1IAWA 1RR8C 5E1ZB 1VQMI 3CMAI 3L2CA 2ADUA 2P6SA 5A2QZ 4KFCA 4HX7A 1F1ZA 1RI7A 4XR6A 3IRQA 1HXDA 1LVAA 2GZWA 3LSTA 3HM5A 3Q0WA 4A69C 2M45A 4BE0A 3HYIA 2DQRA 2VJ5A 1FT9A 3WTYC 1J2XA 3S2DJ 5DD4A 1H9TA 4LOCA 1U0JA 4RB0A 1IGNA 2HYJA 1QPIA 3VODA 1RETA 3U9GA 2OQRA 1EH6A 3COAC 2LOOA 4HDUA 4F52A 2DA4A 1O3QA 2JA8J 2G9WA 3K2AA 3OYGA 3OYAA 3MKLA 2ZJQF 1W5TA 1LE8A 1DU0A 3RYPA 1XDSA 1EF4A 2JN6A 1S5LC 5J40A 4EGZA 3MZYA 4FASD 2E1MC 2XF7A 3ZMVA 5BQTA 4IQ4A 2A07F 1QHHD 2X4HA 3WTUC 3I55I 2W7NA 1HQCA 2XUBA 3G1LA 1XB4A 5JVGF 4OIPF 4ANJA 3FK6A 5A2QK 4PJLA 5K7FA 4FE4A 4MFDA 4BXUA 5H20A 2HOAA 1X1BA 1MDMA 2K9NA 1P4WA 1V5FA 4HV6A 2VPLA 3RPUA 3A1YA 4YIRX 3S15J 4IZZA 2ESNA 2MW8A 2FA5A 1MKMA 4P96A 3FXRA 4MEYF 4FQGA 1ACIA 5J8FA 3FWEA 1D8KA 4LGWA 2XPWA 3F23A 5TISC 2VQLA 4KA4A 1ZG1A 1Q1HA 3S14J 2Y0MA 4EGYA 3I56I 3CLQA 1TW2A 3IH2A 4XK4A 3T1BA 4B47A 2QBYB 1JTXA 3WE2A 4BY7J 1MD0A 1QO0D 2FNAA 1SVLA 3WGIA 2R7SA 2X48A 2HTSA 2E60A 3T8RA 3ZMTA 1TNTA 1OYIA 4FISA 5GAHJ 2Z9OA 2EK5A 5CQGA 2CS3A 4CXFA 3DEWA 2NNNA 2CSOA 3H5RA 1I50J 3I4PA 1A36A 3CCYA 2A6EF 2ISZA 2RNGA 3A01B 4BY1J 3HSRA 4II3A 4I76A 2JUCA 3GEZA 2P5VA 5D4SA 2QQBA 1LJ9A 3HTSB 2IEKA 4XN0A 4M6XA 4A12A 4HYEA 4ZZDA 1QHGA 3I0TA 1ZR4A 1W7PD 5F08A 2QEXI 3I3LA 1R7JA 3QPTA 5IPAA 3CF2A 1LDJA 1EA3A 2L2OA 4CCNA 4P5OA 1T6SA 2J5PA 1FP1D 3BZCA 3TQNA 3S1MJ 2VOPA 3GCMA 2STWA 3DPUA 4MLOA 3ZGKA 4C9YA 4CCLA 3ABKH 3GFLA 3VOEA 4E4HA 4ITVA 2ZJPF 2BW3A 3X2QH 3DBRB 4I7HA 3S3NA 1HBXG 3S8PA 2RGVA 4L9VA 1GHCA 1FIPA 4NUBA 5DV5A 1Y8QB 4OOIA 2FOKA 4EM2A 2JT1A 4N4OB 3LWFA 1WI3A 1R58A 2Q0OA 3ZMDA 3IRRA 1FYLA 4WX9A 4ENKA 2HQ5A 4HZFA 3HRSA 3V42A 5C3EJ 5GAGJ 1BJAA 3UR3C 4EJWA 5IP7J 3T5XA 3SQNA 4XRMA 5K5RA 2G0EA 4LMYA 1DGWY 3OR1C 4JX4A 2K27A 2O6GE 4A2UA 4CYCA 3KP5A 2A05A 2IGKA 1FNNA 3LFUA 3EUAA 4EATA 1LPQA 4V2FA 5D4RA 1UZCA 1ZQ3P 2R7OA 4E7ZA 1R22A 3LSHA 1FMVA 4Y13A 2KDZA 1OFCX 3OYMA 2QSFX 2ZNYA 5HLIA 1KU7A 3HXLA 1VQLI 1B9NA 5AONA 4XLCA 4G94A 1SFXA 4ASNA 3ZMSA 3HKZA 1IW7F 3PNTA 1FBQA 1MIJA 2KMUA 3E97A 4ESBA 4BU2A 1POGA 4L0ZB 4AVPA 3ZQHA 2NRAC 1G3TA 4ABZA 3S16J 1Z6TA 1BC7C 3AG1H 1W36C 3FXLA 5FB2A 1XG1A 2PMHA 1YIOA 2MYSA 1QRYA 2Y31A 1ZR2A 1E3HA 3CDLA 5FLVA 3O2PE 1U5TB 2W85A 3MZHA 1SFEA 2JVHA 4D5CA 1FIAA 3ZN0A 5D5UB 3DKWA 2OZ6A 2NOJB 4IO9F 3D5LA 1WJBA 3M1EA 4IHSA 2BOLA 2HFHA 1W7PB 4I0AA 3GTKJ 2QYOA 3Q9SA 3J81Z 1FBUA 2BBYA 2KJCA 3GVAA 3JRFA 1SD7A 3E6MA 4I98B 4ENNA 2Q1ZB 5LRSA 1IV6A 3TGNA 1ZG3A 2Q8KA 1FBSA 5HS8A 1KQ8A 5DUIA 4BXXJ 3K4NA 1MZBA 4CO8A 5LRRA 4BAYA 2F4MB 2K4JA 2COBA 1DQUA 5TGTA 2O7OA 1XS9A 2Z16A 4L5EA 1H8AC 2GAUA 4YFNF 2QM3A 3H0GJ 1KYZA 3E7LA 1QBJA 2HVRA 1N75A 3EUHA 5CVJA 2Z1DA 3KP4A 2K9MA 4IL6C 1GVJA 4KN4X 2HZDA 3E5QA 1Y6IA 2X1EA 4IX7A 2HQRA 1R4NB 1LB2A 3FKJA 4AD9A 2LLKA 1RZ4A 1W5SA 1WJEA 4OWRB 3BG3A 2X0LA 3DXJF 4AIJA 4AWXB 5D5WB 3CC2I 3DLAA 1LQ1A 4BEHA 2HDDA 5JHUA 3OIPA 4HQMA 3VWBA
chains in the Genus database with same CATH topology
3DEUA 3I64A 2EB7A 2M1BA 1L3LA 4M6YA 2A3SA 2VODA 4ZYEA 4ON0A 3B73A 3BROA 4MQ9F 2YR2A 3AAFA 1HW2A 3BY6A 5DDGA 4M9XA 4OIOF 4U0VA 4P9FA 2L4MA 4IF4A 3CO6C 1OYWA 1LDKB 1J7KA 4G7ZF 2DPDA 5FO5A 2DK5A 2GWRA 4KMUX 2JTVA 3F6OA 1B4AA 1YW9A 3R60A 3DF8A 2H09A 1BN5A 4LLNA 4Q5SF 4UNOA 2EFOA 1YLFA 2OU2A 1BIAA 1G6NA 1QGPA 4EMSA 2ZXJA 2VONA 2RQPA 3OOPA 2MC3A 5LHGA 1C0WA 5IT9Z 3KE2A 3SXYA 3QPHA 4HF1A 4U0WA 4A0YA 2JZYA 3PQJA 1WRJA 3DPLC 1AWCA 4KICA 5KK1A 1REPC 1ZRDA 2VN2A 3KEQA 2OAZA 3FM5A 1ZLKA 2O61A 3E6BA 1T39A 1JE8A 3HSFA 1I27A 4UUVA 3BWGA 4M74A 3GFIA 2RC4A 3I71A 2P6TA 2UWMA 2LF8A 1ODDA 2COMA 1XD7A 2LSOA 4HLYA 1YW7A 2XKPA 5D5VB 3KP7A 4HOBA 4ZYDA 3TDZC 3HRUA 3CUOA 1BOAA 1B1BA 2UXNA 5K5QA 5L3FA 1HKTA 2EJRA 5H6QA 2KRFA 2F5FA 2K4BA 2EFQA 3K1MA 4LFUA 3V8LA 4RGXA 2DT5A 1IXSB 1G4DA 3CLOA 1T98A 1ZLJA 3FX3A 2H6BA 4HAMA 2R3SA 4KIFA 1KQ9A 3K69A 1P4AA 1BI0A 1U3EM 4IRIA 5D8KB 4CZZA 3BJAA 2KIUA 2M87A 3KP3A 4N0BA 5KVRA 1Z9CA 1MGTA 1PP7U 4I0BA 3JAMZ 3GLXA 3M9AA 3BDDA 3JTHA 1P4XA 1ZN2A 3F22A 1PP8F 4UVCA 5HDGA 2YX4A 4RB3C 5LLQA 5ERIA 3WTSC 1I1GA 4L5IA 2QWWA 1ZGJA 3ISPA 1IN4A 2NS0A 1ULYA 5L3CA 2XAJA 3MWMA 4L9NA 5DCMA 3IKTA 4HDVA 4WXCA 1UB9A 2ZNZA 4EJOA 2D2WA 2PFBA 3HSEA 1S7AA 2BE5F 4WXDA 3KP6A 3EYYA 3JAMK 2ZBKA 2HWVA 1HKSA 5J8CA 1S7OA 2VBYA 1EH7A 2XAFA 2HYFA 3LQRA 1YFHA 1G3YA 2OQGA 4RGUA 1S6LA 2Q2EA 4XLNF 3TO6A 1F4KA 4LG0A 2F5DA 1YG2A 4KMFA 2MLKA 4M72A 2H94A 3REOA 5JI6A 3G3ZA 3E3VA 2HYGD 3U1DA 1K78B 4CHUA 4L18B 4OIQF 2ZFWA 4HX4A 5L3EA 3N4MA 3MCZA 2RDPA 2VT3A 1TLHB 5FFZA 4MQVA 4JBAA 3L7WA 4P9UA 3HUGA 5EEHA 3IHUA 4GGGA 1A04A 2MD5A 2ESHA 2ISYA 3K1PA 3ZPLA 3DPTA 1ONVA 2Y75A 1G3SA 4YIIA 4E70A 3HOSA 4JQFA 1XGMA 3ROUA 2DW4A 5F6FA 4LK0F 1SD4A 2IW5A 2FSWA 1V4RA 3N97A 1ZHFA 4ENMA 3GFJA 2F2EA 4EJTA 1Z1DA 1RIOH 2IVMA 1EH8A 4RGSA 1IN8A 2OA4A 2L3DA 3KFWX 4A6EA 1XSVA 1IN6A 4GO1A 5E1XA 4LB6B 2MH2A 3QU6A 1O3TA 2JPBA 3PQKA 1NHAA 2GA2A 3CTAA 3K1NA 3GZ5A 1LEBA 4A5MA 2QQ9A 3KP2A 4XLPF 3RDIA 2DFIA 2WC2A 2L01A 3FMRA 4K2EA 1BI3A 4EJVA 4M71A 4G6QA 2DPUA 3TO7A 5H6RA 1FWZA 4LJZF 2QENA 4CGZA 2CO5A 3F21A 2VC0A 4KIGA 2FMYA 3P9IA 3F8MA 2YX7A 3L09A 3GFMA 1ZH5A 1TQIA 1HW5A 2G7HA 1U8RA 1ZRCA 1OYYA 2IA2A 3WTZA 2PQ8A 4EVIA 1J59A 4ENJA 2RVCA 3GZ6A 3R6SA 5L3DA 4FX4A 1U2WA 1X3UA 5TRDA 1T0FA 4IRHA 1VTNC 5CLSA 1FSEA 3RKYA 5JFRA 4A5NA 2EFPA 2V9VA 2GA1A 1ZREA 5LGNA 5FFXA 3V8JA 4YFXF 2GXBA 1UFMA 1XN7A 1UHMA 2EV6A 3GF2A 1KU3A 3I58A 3IWFA 2BEOA 3QAHA 2JRTA 3BOQA 3HRMA 1LNWA 3ELKA 4G7HF 3HHHA 4IRGA 2L02A 4OMZA 4Q48A 4EJUA 5JR3A 4EM0B 3CDHA 4LD5A 4IXAA 3VB2A 3DQVC 3H3ZA 2XROA 3J7AO 3RYRA 1IXCA 2K02A 1B59A 4WWCA 2VE9A 1KGSA 4KYWA 2VT2A 4HW0A 1JGSA 4B8XA 1OR7A 3R61A 1ZRFA 2DI3A 1KU9A 2VBZA 2O3FA 1GXQA 1Z7UA 2XASA 2E1CA 5E18F 5AIPA 3TOAA 4YG2F 3VEPA 3ZN1A 2Z3YA 2Z5UA 3WG9A 1HSJA 2W25A 3KZZA 3GYHX 3B02A 2XHKA 3H92A 3P9KA 3JSPA 3PFIA 2DO7A 3H3UA 1FP2A 3LA3A 3TKYA 1OPCA 5JVTA 2W57A 2BYVE 1T38A 3I5UA 2FF4A 1IRFA 2W84A 1D5VA 4RB2C 3JSOA 1MJ9A 1Z6RA 2K86A 4G7OF 3MFKA 2PMUA 4R1HA 1XMKA 1XGNA 4RS8A 1U5TA 2F5CA 2UXXA 2W24A 4O6JA 4BQAA 2PBIA 2H6CA 1W7PA 4N9HA 2EA2A 1R00A 3J80Z 2IA0A 4FT8A 2Z33A 2E1NA 2DK8A 1DUXC 2HR3A 2CG4A 5LHHA 2VE8A 1XGOA 3C1DA 1KQ0A 3RTRA 4ZZLA 2CW0F 1SMYF 2ZO4A 4ESFA 1W4MA 5ILUA 3V8KA 1YQAA 4L0YB 1QZZA 3ZP5A 4JK1X 2M5WA 2V1XA 4G6DA 1O3SA 5FLXK 2A5YB 2D1VA 2RNJA 1YS6A 2EWNA 4OU0A 4A0XA 2FU4A 4I01A 3V4GA 4GYIA 3J80K 2FBIA 4OIRF 1DDNA 1USSA 3EETA 3WTWC 2YU3A 2D1HA 3BJOA 1CF7A 4U7BA 2XIGA 3HHGA 4NQWA 4BHBA 3WTXC 5DYMA 4QLCU 2EFNA 4MGRA 1B9MA 1YYVA 4A6DA 5HS7A 2CQKA 1FOKA 1IZ1A 2J5OA 4CDGA 1ZAOA 2XAGA 4CYDA 2GQQA 1G3WA 5K5OA 2NYXA 3ULQB 1SD6A 5D6FA 4RGRA 2ZJ2A 4GYGA 5CJ9A 1QZYA 3D0SA 2MH9A 3DFGA 5ICFA 1D3YA 2B0LA 2FEZA 5DCMB 4U88A 3M8FA 3C7JA 5HLHA 3O6BB 1F9NA 3CUQA 2Y48A 2ZMEA 3BJ6A 3CJNA 3ZMUA 1O3RA 1T2KA 5HVQC 1R5GA 1OKRA 1HKQA 4M9SA 5HS9A 4QWQA 1FSHA 4KDPA 2XV4S 1BM9A 3LAJA 3FM3A 4WXHA 1D8JA 3W6JB 4CICA 3KCCA 4NHJA 2A61A 4UVBA 5ILVA 1ON1A 5E1WA 1YTYA 1FYKA 1UHWA 3GUDA 3DP7A 4MHGA 4G8XA 2JPCA 4Q47A 3OV8A 4WF2A 4KNYA 2JSCA 4Y17A 3SZTA 3C18A 4UV8A 1RUNA 4Z2YA 1S29A 1U6GA 1IN7A 2IRFG 2WWYA 1U5TC 1USTA 1Z05A 4MNUA 2ZKZA 1FPQA 5TJJA 2ELHA 2KKOA 4O5VA 3WU0A 2QLZA 4UXNA 1H0MA 1I6XA 5CVRA 2DU9A 1Y0UA 2MBFA 2V79A 2DAOA 2YPRA 2HKXA 1V3FA 2CWEA 3R0AA 1SAXA 3P9CA 5E17F 1P92A 1U78A 3SHFA 3W6KB 4MTEA 4HF2A 2P8TA 1KA8A 4D0PA 4WK8F 1MDMB 2L54A 1OMIA 4UHTA 4HQEA 1YS7A 2HGCA 4HA8A 4L9TA 5HDNA 1IN5A 3I59A 1PUEE 4HLXA 3WGHA 3BP8A 3I53A 1ZGAA 2XAHA 4I02A 1FLIA 2P5KA 5E8GA 3V7SA 1LEAA 1IXRC 1O7LA 2IT0A 3C3WA 1J75A 2LNBA 3K9TA 1QNTA 5HOOA 1TQMA 2OD5A 2RV8A 3HTUA 2DQLA 3WGGA 4RB1A 3G73A 3E5UA 2EFWA 1J0RA 2UZKA 2VC1A 1WSUA 4M9ZA 1K6OA 2HZTA 5LEJA 5ICGA 1RNLA 3U2RA 1E17A 2NNYA 1K78A 2OZUA 2FBHA 5DD8A 4G9YA 1JXSA 4F7ZA 3ECOA 2LF7A 1IUYA 3FZVA 4B09A 2IP2A 3GW2A 3K2ZA 1B6AA 5D6EA 1SFUA 3F6VA 3CUQC 3WU1B 2OBPA 2CFXA 2C6YA 3WODF 4Y15A 3ERED 2A6HF 2PEXA 5L3GA 2MLGA 1WKMA 2QZ8A 4H0EA 2EA4A 4TV7A 4P55A 1YW8A 2QVOA 4BHPA 2IA1A 3F72A 1R36A 2EV5A 5CVIA 3NEUA 2M30A 1TQPA 1K7AA 3FXUA 4L5JA 2QUFA 3BZ6A 1QQIA 4ZYGA 2PN6A 4S04A 2AS5F 1FX7A 5J6XA 3KETA 4KUMA 3F8FA 3M8EA 4EQQA 1JHFA 2RN7A 5BMZA 2BV6A 4I2OA 3MEXA 2KJBA 4BH9A 4LB5A 2P4WA 3T8TA 2GIVA 2HTJA 4XSXF 3LAPA 2V1UA 3NRVA 5F64A 5LGTA 5E8IA 3HRTA 5ICEA 4KIBA 2O03A 4OMYA 2QBYA 2DLLA 1QPMA 1TW3A 3F8BA 1S3JA 4GXOA 1JHHA 1CGPA 2IJLA 4MTDA 3O3KA 3V7RA 1UCRA 1IF1A 1XMAA 3R4KA 4KT5C 1MJAA 3CO7C 3RKWA 5FD6A 2KIFA 3IWZA 3RJPA 2FRHA 5CVUA 2AXLA 1R23A 3KZYA 3DV8A 2RKHA 1XCBA 3JW4A 3TO9A 5D5XB 4ETSA 1WQ2A 4PCQA 2O0YA 2ETHA 5DUKA 1WI9A 4PGGA 3HIFA 4RAZA 3RPQA 4MEXF 3MQ0A 2PG4A 3M7GA 1BI2A 2P7CB 5BPIA 5K1YA 2KIMA 1GXPA 1ZYRF 4AIHA 2WV0A 4BNCA 6PAXA 1WWXA 2NAZA 1FY7A 1J5YA 2DTRA 3GWZA 2P7VB 1FYMA 3ZQ7A 2VBWA 3WTTC 1ZG5A 1RUOA 1BBYA 2D45A 1I1SA 1K79A 3LA7A 3E6DA 3QU3A 2A68F 4AIKA 1FZPB 4ZH4F 4YIFA 3NQOA 4U7DA 3TDUC 3GX4X 2PI0A 1ZARA 1TTYA 3VFZA 4Q4ZF 4UVAA 3KLNA 5FLXZ 2ZCWA 2G7UA 4FX0A 1ON2A 1KU2A 3MAJA 5AIQA 3J81K 3KEOA 2HDCA 3BPXA 2HS5A 3LQQA 3FHZA 2L4AA 2CGPA 1CF7B 2XGXA 5HLGA 3QOPA 2VBXA 2YSRA 5L3BA 2BGCA 1SD5A 3I54A 1XGSA 2XAQA 5ILSA 5LHIA 2QQAA 3TOBA 5BS6A 2DBBA 3F8CA 5ICCA 4S05A 1J9IA 4HX8A 5IT3A 2PJPA 3ML6A 4DNCA 4XBFA 3E6CC 1H9GA 4L9JA 2PLYA 2R7DA 4PDKA 5LGUA 5F1RA 4PZJA 5ED4A 4IVNA 3QP6A 1L0OC 4DQ2A 2CYYA 1MJBA 3Q5FA 5LEKA 4WCGA 4O3MA 4HBLA 3FF5A 4OINF 1BI1A 2IPQX 3CUQB 1Z91A 4N9IA 1YO5C 1BIBA 2EV0A 2HKOA 3LA2A 2ZMEB 3FMSA 1IRGA 4I09A 4KN7X 2XKOA 2TDXA 1O7FA 1EV7A 5LBQA 1LDDA 3F3XA 2M8EA 4HV5A 3QP5A 1TBXA 3BPVA 3HOTA 2VOOA 2GXGA 1TNSA 4EV0A 1PDNC 4GCVA 3EYIA 5IT9K 3FMQA 1E2XA 3IKVA 5CYVA 3WE3A 4NB5A 4R79A 4LLGF 5CVVA 2LKPA 5D8LB 3GO5A 1S8NA 3JTGA 1F5TA 5DCFA 1P6RA 3E5XA 1BC8C 2FMLA 5FGMA 3P7NA 2A69F 1XSDA 4FHTA 1STZA 2XRNA 2K7LA 1HSTA 4RAYA 2F5EA 3IL2A 1XCVA 1AOYA 5EEGA 3ABUA 1P2FA 2V6CA 2Z99A 3ECHA 4BHCA 2FQ3A 3IC7A 3QRFF 1R1UA 2XVCA 2FBKA 2VXZA 2P5LC 2HEOA 4LG0B 1DP7P 2R7FA 2FE3A 2V1DA 5E20A 3V7CA 2O8XA 3RIRA 4BYYA 3SFZA 3RI4A 1O57A 4ESJA 1DPRA 3L00A 3R0JA 3ABTA 3WTVC 1R1TA 1I5ZA 3ZMZA 4PGHA 4IHTA 4XRFA 3LFKA 5HDKA 2MA3A 1R1VA 1XDUA 3K0LA 3I59B 5BOXA 4EM1A 3GXOA 2STTA 1HW1A 3KLOA 2HQNA 2HOEA 5DEQA 1XSXA 4ZYHA 4LK1F 3FXQA 3F8NA 2FXAA 1FC3A 3T0YA 4HF0A 3L9FA 3SZPA 2FNPA 2E7WA 3EDPA 3EQLF 4YFKF 4IPAA 2WTEA 4A0ZA 5FD5A 5BPDA 2ACJA 3RKXA 4R8HA 4XSZF 1R5HA 3Q9VA 1DPUA 4LLLA 1KYWA 4IJAA 4M73A 4U0YA 2H27A 3S2WA 1SMTA 2E7XA 2LDUA 1IAWA 4UV9A 5E1ZB 3L2CA 2ADUA 2P6SA 5A2QZ 4KFCA 4HX7A 1F1ZA 1RI7A 3IRQA 1HXDA 1LVAA 2GZWA 3LSTA 2M45A 3HYIA 2DQRA 1FT9A 3WTYC 1J2XA 5DD4A 1H9TA 4RB0A 3VODA 3U9GA 2OQRA 1EH6A 3COAC 4HDUA 1O3QA 2G9WA 1W5TA 3RYPA 1XDSA 4EGZA 3MZYA 3ZMVA 5BQTA 2A07F 2X4HA 3WTUC 1HQCA 2XUBA 1XB4A 4OIPF 5A2QK 4BXUA 5H20A 1MDMA 1P4WA 4HV6A 3RPUA 2ESNA 2FA5A 1MKMA 4P96A 3FXRA 4MEYF 5J8FA 3FWEA 1D8KA 4KA4A 4LGWA 3F23A 1ZG1A 1Q1HA 2Y0MA 4EGYA 1TW2A 3T1BA 2QBYB 3WE2A 1MD0A 1QO0D 2FNAA 3WGIA 2HTSA 3T8RA 3ZMTA 1TNTA 1OYIA 2Z9OA 2EK5A 4CXFA 2NNNA 2CSOA 3I4PA 2A6EF 2ISZA 3HSRA 3GEZA 2P5VA 5D4SA 2QQBA 1LJ9A 3HTSB 4A12A 4M6XA 4HYEA 4ZZDA 3I0TA 1W7PD 1R7JA 3QPTA 1LDJA 4P5OA 1T6SA 2J5PA 1FP1D 3TQNA 2VOPA 2STWA 3GFLA 3VOEA 4I7HA 1HBXG 2RGVA 4L9VA 1GHCA 5DV5A 4OOIA 2FOKA 4EM2A 2JT1A 3LWFA 3ZMDA 1R58A 2Q0OA 3IRRA 1FYLA 4WX9A 4ENKA 4HZFA 3HRSA 1BJAA 4EJWA 3T5XA 3SQNA 5K5RA 4LMYA 2O6GE 2K27A 4A2UA 3KP5A 1FNNA 5D4RA 1R22A 4Y13A 2ZNYA 5HLIA 1KU7A 1B9NA 5AONA 4G94A 1SFXA 4ASNA 3ZMSA 1IW7F 1FBQA 3E97A 4ESBA 4L0ZB 4AVPA 2NRAC 1G3TA 1Z6TA 1BC7C 5FB2A 2PMHA 1YIOA 3O2PE 1U5TB 2W85A 3MZHA 1SFEA 3ZN0A 5D5UB 3DKWA 2OZ6A 3D5LA 3M1EA 4IHSA 2HFHA 1W7PB 4I0AA 2QYOA 3Q9SA 3J81Z 1FBUA 2BBYA 2KJCA 3GVAA 1SD7A 3E6MA 4I98B 4ENNA 5LRSA 3TGNA 1ZG3A 2Q8KA 1FBSA 5HS8A 1KQ8A 5DUIA 1MZBA 4CO8A 5LRRA 4BAYA 2K4JA 2GAUA 4YFNF 2QM3A 1KYZA 1QBJA 3EUHA 5CVJA 3KP4A 1GVJA 4KN4X 3E5QA 2HQRA 1LB2A 4AD9A 1RZ4A 1W5SA 2X0LA 3DXJF 4AIJA 4AWXB 5D5WB 1LQ1A 5JHUA 4HQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEU A;  3I64 A;  2EB7 A;  2M1B A;  1L3L A;  4M6Y A;  2A3S A;  2VOD A;  4ZYE A;  4ON0 A;  3B73 A;  3BRO A;  4MQ9 F;  2YR2 A;  3AAF A;  1HW2 A;  3BY6 A;  5DDG A;  4M9X A;  4OIO F;  4U0V A;  4P9F A;  2L4M A;  4IF4 A;  3CO6 C;  1OYW A;  1LDK B;  1J7K A;  4G7Z F;  2DPD A;  5FO5 A;  2DK5 A;  2GWR A;  4KMU X;  2JTV A;  3F6O A;  1B4A A;  1YW9 A;  3R60 A;  3DF8 A;  2H09 A;  1BN5 A;  4LLN A;  4Q5S F;  4UNO A;  2EFO A;  1YLF A;  2OU2 A;  1BIA A;  1G6N A;  1QGP A;  4EMS A;  2ZXJ A;  2VON A;  2RQP A;  3OOP A;  2MC3 A;  5LHG A;  1C0W A;  5IT9 Z;  3KE2 A;  3SXY A;  3QPH A;  4HF1 A;  4U0W A;  4A0Y A;  2JZY A;  3PQJ A;  1WRJ A;  3DPL C;  1AWC A;  4KIC A;  5KK1 A;  1REP C;  1ZRD A;  2VN2 A;  3KEQ A;  2OAZ A;  3FM5 A;  1ZLK A;  2O61 A;  3E6B A;  1T39 A;  1JE8 A;  3HSF A;  1I27 A;  4UUV A;  3BWG A;  4M74 A;  3GFI A;  2RC4 A;  3I71 A;  2P6T A;  2UWM A;  2LF8 A;  1ODD A;  2COM A;  1XD7 A;  2LSO A;  4HLY A;  1YW7 A;  2XKP A;  5D5V B;  3KP7 A;  4HOB A;  4ZYD A;  3TDZ C;  3HRU A;  3CUO A;  1BOA A;  1B1B A;  2UXN A;  5K5Q A;  5L3F A;  1HKT A;  2EJR A;  5H6Q A;  2KRF A;  2F5F A;  2K4B A;  2EFQ A;  3K1M A;  4LFU A;  3V8L A;  4RGX A;  2DT5 A;  1IXS B;  1G4D A;  3CLO A;  1T98 A;  1ZLJ A;  3FX3 A;  2H6B A;  4HAM A;  2R3S A;  4KIF A;  1KQ9 A;  3K69 A;  1P4A A;  1BI0 A;  1U3E M;  4IRI A;  5D8K B;  4CZZ A;  3BJA A;  2KIU A;  2M87 A;  3KP3 A;  4N0B A;  5KVR A;  1Z9C A;  1MGT A;  1PP7 U;  4I0B A;  3JAM Z;  3GLX A;  3M9A A;  3BDD A;  3JTH A;  1P4X A;  1ZN2 A;  3F22 A;  1PP8 F;  4UVC A;  5HDG A;  2YX4 A;  4RB3 C;  5LLQ A;  5ERI A;  3WTS C;  1I1G A;  4L5I A;  2QWW A;  1ZGJ A;  3ISP A;  1IN4 A;  2NS0 A;  1ULY A;  5L3C A;  2XAJ A;  3MWM A;  4L9N A;  5DCM A;  3IKT A;  4HDV A;  4WXC A;  1UB9 A;  2ZNZ A;  4EJO A;  2D2W A;  2PFB A;  3HSE A;  1S7A A;  2BE5 F;  4WXD A;  3KP6 A;  3EYY A;  3JAM K;  2ZBK A;  2HWV A;  1HKS A;  5J8C A;  1S7O A;  2VBY A;  1EH7 A;  2XAF A;  2HYF A;  3LQR A;  1YFH A;  1G3Y A;  2OQG A;  4RGU A;  1S6L A;  2Q2E A;  4XLN F;  3TO6 A;  1F4K A;  4LG0 A;  2F5D A;  1YG2 A;  4KMF A;  2MLK A;  4M72 A;  2H94 A;  3REO A;  5JI6 A;  3G3Z A;  3E3V A;  2HYG D;  3U1D A;  1K78 B;  4CHU A;  4L18 B;  4OIQ F;  2ZFW A;  4HX4 A;  5L3E A;  3N4M A;  3MCZ A;  2RDP A;  2VT3 A;  1TLH B;  5FFZ A;  4MQV A;  4JBA A;  3L7W A;  4P9U A;  3HUG A;  5EEH A;  3IHU A;  4GGG A;  1A04 A;  2MD5 A;  2ESH A;  2ISY A;  3K1P A;  3ZPL A;  3DPT A;  1ONV A;  2Y75 A;  1G3S A;  4YII A;  4E70 A;  3HOS A;  4JQF A;  1XGM A;  3ROU A;  2DW4 A;  5F6F A;  4LK0 F;  1SD4 A;  2IW5 A;  2FSW A;  1V4R A;  3N97 A;  1ZHF A;  4ENM A;  3GFJ A;  2F2E A;  4EJT A;  1Z1D A;  1RIO H;  2IVM A;  1EH8 A;  4RGS A;  1IN8 A;  2OA4 A;  2L3D A;  3KFW X;  4A6E A;  1XSV A;  1IN6 A;  4GO1 A;  5E1X A;  4LB6 B;  2MH2 A;  3QU6 A;  1O3T A;  2JPB A;  3PQK A;  1NHA A;  2GA2 A;  3CTA A;  3K1N A;  3GZ5 A;  1LEB A;  4A5M A;  2QQ9 A;  3KP2 A;  4XLP F;  3RDI A;  2DFI A;  2WC2 A;  2L01 A;  3FMR A;  4K2E A;  1BI3 A;  4EJV A;  4M71 A;  4G6Q A;  2DPU A;  3TO7 A;  5H6R A;  1FWZ A;  4LJZ F;  2QEN A;  4CGZ A;  2CO5 A;  3F21 A;  2VC0 A;  4KIG A;  2FMY A;  3P9I A;  3F8M A;  2YX7 A;  3L09 A;  3GFM A;  1ZH5 A;  1TQI A;  1HW5 A;  2G7H A;  1U8R A;  1ZRC A;  1OYY A;  2IA2 A;  3WTZ A;  2PQ8 A;  4EVI A;  1J59 A;  4ENJ A;  2RVC A;  3GZ6 A;  3R6S A;  5L3D A;  4FX4 A;  1U2W A;  1X3U A;  5TRD A;  1T0F A;  4IRH A;  1VTN C;  5CLS A;  1FSE A;  3RKY A;  5JFR A;  4A5N A;  2EFP A;  2V9V A;  2GA1 A;  1ZRE A;  5LGN A;  5FFX A;  3V8J A;  4YFX F;  2GXB A;  1UFM A;  1XN7 A;  1UHM A;  2EV6 A;  3GF2 A;  1KU3 A;  3I58 A;  3IWF A;  2BEO A;  3QAH A;  2JRT A;  3BOQ A;  3HRM A;  1LNW A;  3ELK A;  4G7H F;  3HHH A;  4IRG A;  2L02 A;  4OMZ A;  4Q48 A;  4EJU A;  5JR3 A;  4EM0 B;  3CDH A;  4LD5 A;  4IXA A;  3VB2 A;  3DQV C;  3H3Z A;  2XRO A;  3J7A O;  3RYR A;  1IXC A;  2K02 A;  1B59 A;  4WWC A;  2VE9 A;  1KGS A;  4KYW A;  2VT2 A;  4HW0 A;  1JGS A;  4B8X A;  1OR7 A;  3R61 A;  1ZRF A;  2DI3 A;  1KU9 A;  2VBZ A;  2O3F A;  1GXQ A;  1Z7U A;  2XAS A;  2E1C A;  5E18 F;  5AIP A;  3TOA A;  4YG2 F;  3VEP A;  3ZN1 A;  2Z3Y A;  2Z5U A;  3WG9 A;  1HSJ A;  2W25 A;  3KZZ A;  3GYH X;  3B02 A;  2XHK A;  3H92 A;  3P9K A;  3JSP A;  3PFI A;  2DO7 A;  3H3U A;  1FP2 A;  3LA3 A;  3TKY A;  1OPC A;  5JVT A;  2W57 A;  2BYV E;  1T38 A;  3I5U A;  2FF4 A;  1IRF A;  2W84 A;  1D5V A;  4RB2 C;  3JSO A;  1MJ9 A;  1Z6R A;  2K86 A;  4G7O F;  3MFK A;  2PMU A;  4R1H A;  1XMK A;  1XGN A;  4RS8 A;  1U5T A;  2F5C A;  2UXX A;  2W24 A;  4O6J A;  4BQA A;  2PBI A;  2H6C A;  1W7P A;  4N9H A;  2EA2 A;  1R00 A;  3J80 Z;  2IA0 A;  4FT8 A;  2Z33 A;  2E1N A;  2DK8 A;  1DUX C;  2HR3 A;  2CG4 A;  5LHH A;  2VE8 A;  1XGO A;  3C1D A;  1KQ0 A;  3RTR A;  4ZZL A;  2CW0 F;  1SMY F;  2ZO4 A;  4ESF A;  1W4M A;  5ILU A;  3V8K A;  1YQA A;  4L0Y B;  1QZZ A;  3ZP5 A;  4JK1 X;  2M5W A;  2V1X A;  4G6D A;  1O3S A;  5FLX K;  2A5Y B;  2D1V A;  2RNJ A;  1YS6 A;  2EWN A;  4OU0 A;  4A0X A;  2FU4 A;  4I01 A;  3V4G A;  4GYI A;  3J80 K;  2FBI A;  4OIR F;  1DDN A;  1USS A;  3EET A;  3WTW C;  2YU3 A;  2D1H A;  3BJO A;  1CF7 A;  4U7B A;  2XIG A;  3HHG A;  4NQW A;  4BHB A;  3WTX C;  5DYM A;  4QLC U;  2EFN A;  4MGR A;  1B9M A;  1YYV A;  4A6D A;  5HS7 A;  2CQK A;  1FOK A;  1IZ1 A;  2J5O A;  4CDG A;  1ZAO A;  2XAG A;  4CYD A;  2GQQ A;  1G3W A;  5K5O A;  2NYX A;  3ULQ B;  1SD6 A;  5D6F A;  4RGR A;  2ZJ2 A;  4GYG A;  5CJ9 A;  1QZY A;  3D0S A;  2MH9 A;  3DFG A;  5ICF A;  1D3Y A;  2B0L A;  2FEZ A;  5DCM B;  4U88 A;  3M8F A;  3C7J A;  5HLH A;  3O6B B;  1F9N A;  3CUQ A;  2Y48 A;  2ZME A;  3BJ6 A;  3CJN A;  3ZMU A;  1O3R A;  1T2K A;  5HVQ C;  1R5G A;  1OKR A;  1HKQ A;  4M9S A;  5HS9 A;  4QWQ A;  1FSH A;  4KDP A;  2XV4 S;  1BM9 A;  3LAJ A;  3FM3 A;  4WXH A;  1D8J A;  3W6J B;  4CIC A;  3KCC A;  4NHJ A;  2A61 A;  4UVB A;  5ILV A;  1ON1 A;  5E1W A;  1YTY A;  1FYK A;  1UHW A;  3GUD A;  3DP7 A;  4MHG A;  4G8X A;  2JPC A;  4Q47 A;  3OV8 A;  4WF2 A;  4KNY A;  2JSC A;  4Y17 A;  3SZT A;  3C18 A;  4UV8 A;  1RUN A;  4Z2Y A;  1S29 A;  1U6G A;  1IN7 A;  2IRF G;  2WWY A;  1U5T C;  1UST A;  1Z05 A;  4MNU A;  2ZKZ A;  1FPQ A;  5TJJ A;  2ELH A;  2KKO A;  4O5V A;  3WU0 A;  2QLZ A;  4UXN A;  1H0M A;  1I6X A;  5CVR A;  2DU9 A;  1Y0U A;  2MBF A;  2V79 A;  2DAO A;  2YPR A;  2HKX A;  1V3F A;  2CWE A;  3R0A A;  1SAX A;  3P9C A;  5E17 F;  1P92 A;  1U78 A;  3SHF A;  3W6K B;  4MTE A;  4HF2 A;  2P8T A;  1KA8 A;  4D0P A;  4WK8 F;  1MDM B;  2L54 A;  1OMI A;  4UHT A;  4HQE A;  1YS7 A;  2HGC A;  4HA8 A;  4L9T A;  5HDN A;  1IN5 A;  3I59 A;  1PUE E;  4HLX A;  3WGH A;  3BP8 A;  3I53 A;  1ZGA A;  2XAH A;  4I02 A;  1FLI A;  2P5K A;  5E8G A;  3V7S A;  1LEA A;  1IXR C;  1O7L A;  2IT0 A;  3C3W A;  1J75 A;  2LNB A;  3K9T A;  1QNT A;  5HOO A;  1TQM A;  2OD5 A;  2RV8 A;  3HTU A;  2DQL A;  3WGG A;  4RB1 A;  3G73 A;  3E5U A;  2EFW A;  1J0R A;  2UZK A;  2VC1 A;  1WSU A;  4M9Z A;  1K6O A;  2HZT A;  5LEJ A;  5ICG A;  1RNL A;  3U2R A;  1E17 A;  2NNY A;  1K78 A;  2OZU A;  2FBH A;  5DD8 A;  4G9Y A;  1JXS A;  4F7Z A;  3ECO A;  2LF7 A;  1IUY A;  3FZV A;  4B09 A;  2IP2 A;  3GW2 A;  3K2Z A;  1B6A A;  5D6E A;  1SFU A;  3F6V A;  3CUQ C;  3WU1 B;  2OBP A;  2CFX A;  2C6Y A;  3WOD F;  4Y15 A;  3ERE D;  2A6H F;  2PEX A;  5L3G A;  2MLG A;  1WKM A;  2QZ8 A;  4H0E A;  2EA4 A;  4TV7 A;  4P55 A;  1YW8 A;  2QVO A;  4BHP A;  2IA1 A;  3F72 A;  1R36 A;  2EV5 A;  5CVI A;  3NEU A;  2M30 A;  1TQP A;  1K7A A;  3FXU A;  4L5J A;  2QUF A;  3BZ6 A;  1QQI A;  4ZYG A;  2PN6 A;  4S04 A;  2AS5 F;  1FX7 A;  5J6X A;  3KET A;  4KUM A;  3F8F A;  3M8E A;  4EQQ A;  1JHF A;  2RN7 A;  5BMZ A;  2BV6 A;  4I2O A;  3MEX A;  2KJB A;  4BH9 A;  4LB5 A;  2P4W A;  3T8T A;  2GIV A;  2HTJ A;  4XSX F;  3LAP A;  2V1U A;  3NRV A;  5F64 A;  5LGT A;  5E8I A;  3HRT A;  5ICE A;  4KIB A;  2O03 A;  4OMY A;  2QBY A;  2DLL A;  1QPM A;  1TW3 A;  3F8B A;  1S3J A;  4GXO A;  1JHH A;  1CGP A;  2IJL A;  4MTD A;  3O3K A;  3V7R A;  1UCR A;  1IF1 A;  1XMA A;  3R4K A;  4KT5 C;  1MJA A;  3CO7 C;  3RKW A;  5FD6 A;  2KIF A;  3IWZ A;  3RJP A;  2FRH A;  5CVU A;  2AXL A;  1R23 A;  3KZY A;  3DV8 A;  2RKH A;  1XCB A;  3JW4 A;  3TO9 A;  5D5X B;  4ETS A;  1WQ2 A;  4PCQ A;  2O0Y A;  2ETH A;  5DUK A;  1WI9 A;  4PGG A;  3HIF A;  4RAZ A;  3RPQ A;  4MEX F;  3MQ0 A;  2PG4 A;  3M7G A;  1BI2 A;  2P7C B;  5BPI A;  5K1Y A;  2KIM A;  1GXP A;  1ZYR F;  4AIH A;  2WV0 A;  4BNC A;  6PAX A;  1WWX A;  2NAZ A;  1FY7 A;  1J5Y A;  2DTR A;  3GWZ A;  2P7V B;  1FYM A;  3ZQ7 A;  2VBW A;  3WTT C;  1ZG5 A;  1RUO A;  1BBY A;  2D45 A;  1I1S A;  1K79 A;  3LA7 A;  3E6D A;  3QU3 A;  2A68 F;  4AIK A;  1FZP B;  4ZH4 F;  4YIF A;  3NQO A;  4U7D A;  3TDU C;  3GX4 X;  2PI0 A;  1ZAR A;  1TTY A;  3VFZ A;  4Q4Z F;  4UVA A;  3KLN A;  5FLX Z;  2ZCW A;  2G7U A;  4FX0 A;  1ON2 A;  1KU2 A;  3MAJ A;  5AIQ A;  3J81 K;  3KEO A;  2HDC A;  3BPX A;  2HS5 A;  3LQQ A;  3FHZ A;  2L4A A;  2CGP A;  1CF7 B;  2XGX A;  5HLG A;  3QOP A;  2VBX A;  2YSR A;  5L3B A;  2BGC A;  1SD5 A;  3I54 A;  1XGS A;  2XAQ A;  5ILS A;  5LHI A;  2QQA A;  3TOB A;  5BS6 A;  2DBB A;  3F8C A;  5ICC A;  4S05 A;  1J9I A;  4HX8 A;  5IT3 A;  2PJP A;  3ML6 A;  4DNC A;  4XBF A;  3E6C C;  1H9G A;  4L9J A;  2PLY A;  2R7D A;  4PDK A;  5LGU A;  5F1R A;  4PZJ A;  5ED4 A;  4IVN A;  3QP6 A;  1L0O C;  4DQ2 A;  2CYY A;  1MJB A;  3Q5F A;  5LEK A;  4WCG A;  4O3M A;  4HBL A;  3FF5 A;  4OIN F;  1BI1 A;  2IPQ X;  3CUQ B;  1Z91 A;  4N9I A;  1YO5 C;  1BIB A;  2EV0 A;  2HKO A;  3LA2 A;  2ZME B;  3FMS A;  1IRG A;  4I09 A;  4KN7 X;  2XKO A;  2TDX A;  1O7F A;  1EV7 A;  5LBQ A;  1LDD A;  3F3X A;  2M8E A;  4HV5 A;  3QP5 A;  1TBX A;  3BPV A;  3HOT A;  2VOO A;  2GXG A;  1TNS A;  4EV0 A;  1PDN C;  4GCV A;  3EYI A;  5IT9 K;  3FMQ A;  1E2X A;  3IKV A;  5CYV A;  3WE3 A;  4NB5 A;  4R79 A;  4LLG F;  5CVV A;  2LKP A;  5D8L B;  3GO5 A;  1S8N A;  3JTG A;  1F5T A;  5DCF A;  1P6R A;  3E5X A;  1BC8 C;  2FML A;  5FGM A;  3P7N A;  2A69 F;  1XSD A;  4FHT A;  1STZ A;  2XRN A;  2K7L A;  1HST A;  4RAY A;  2F5E A;  3IL2 A;  1XCV A;  1AOY A;  5EEG A;  3ABU A;  1P2F A;  2V6C A;  2Z99 A;  3ECH A;  4BHC A;  2FQ3 A;  3IC7 A;  3QRF F;  1R1U A;  2XVC A;  2FBK A;  2VXZ A;  2P5L C;  2HEO A;  4LG0 B;  1DP7 P;  2R7F A;  2FE3 A;  2V1D A;  5E20 A;  3V7C A;  2O8X A;  3RIR A;  4BYY A;  3SFZ A;  3RI4 A;  1O57 A;  4ESJ A;  1DPR A;  3L00 A;  3R0J A;  3ABT A;  3WTV C;  1R1T A;  1I5Z A;  3ZMZ A;  4PGH A;  4IHT A;  4XRF A;  3LFK A;  5HDK A;  2MA3 A;  1R1V A;  1XDU A;  3K0L A;  3I59 B;  5BOX A;  4EM1 A;  3GXO A;  2STT A;  1HW1 A;  3KLO A;  2HQN A;  2HOE A;  5DEQ A;  1XSX A;  4ZYH A;  4LK1 F;  3FXQ A;  3F8N A;  2FXA A;  1FC3 A;  3T0Y A;  4HF0 A;  3L9F A;  3SZP A;  2FNP A;  2E7W A;  3EDP A;  3EQL F;  4YFK F;  4IPA A;  2WTE A;  4A0Z A;  5FD5 A;  5BPD A;  2ACJ A;  3RKX A;  4R8H A;  4XSZ F;  1R5H A;  3Q9V A;  1DPU A;  4LLL A;  1KYW A;  4IJA A;  4M73 A;  4U0Y A;  2H27 A;  3S2W A;  1SMT A;  2E7X A;  2LDU A;  1IAW A;  4UV9 A;  5E1Z B;  3L2C A;  2ADU A;  2P6S A;  5A2Q Z;  4KFC A;  4HX7 A;  1F1Z A;  1RI7 A;  3IRQ A;  1HXD A;  1LVA A;  2GZW A;  3LST A;  2M45 A;  3HYI A;  2DQR A;  1FT9 A;  3WTY C;  1J2X A;  5DD4 A;  1H9T A;  4RB0 A;  3VOD A;  3U9G A;  2OQR A;  1EH6 A;  3COA C;  4HDU A;  1O3Q A;  2G9W A;  1W5T A;  3RYP A;  1XDS A;  4EGZ A;  3MZY A;  3ZMV A;  5BQT A;  2A07 F;  2X4H A;  3WTU C;  1HQC A;  2XUB A;  1XB4 A;  4OIP F;  5A2Q K;  4BXU A;  5H20 A;  1MDM A;  1P4W A;  4HV6 A;  3RPU A;  2ESN A;  2FA5 A;  1MKM A;  4P96 A;  3FXR A;  4MEY F;  5J8F A;  3FWE A;  1D8K A;  4KA4 A;  4LGW A;  3F23 A;  1ZG1 A;  1Q1H A;  2Y0M A;  4EGY A;  1TW2 A;  3T1B A;  2QBY B;  3WE2 A;  1MD0 A;  1QO0 D;  2FNA A;  3WGI A;  2HTS A;  3T8R A;  3ZMT A;  1TNT A;  1OYI A;  2Z9O A;  2EK5 A;  4CXF A;  2NNN A;  2CSO A;  3I4P A;  2A6E F;  2ISZ A;  3HSR A;  3GEZ A;  2P5V A;  5D4S A;  2QQB A;  1LJ9 A;  3HTS B;  4A12 A;  4M6X A;  4HYE A;  4ZZD A;  3I0T A;  1W7P D;  1R7J A;  3QPT A;  1LDJ A;  4P5O A;  1T6S A;  2J5P A;  1FP1 D;  3TQN A;  2VOP A;  2STW A;  3GFL A;  3VOE A;  4I7H A;  1HBX G;  2RGV A;  4L9V A;  1GHC A;  5DV5 A;  4OOI A;  2FOK A;  4EM2 A;  2JT1 A;  3LWF A;  3ZMD A;  1R58 A;  2Q0O A;  3IRR A;  1FYL A;  4WX9 A;  4ENK A;  4HZF A;  3HRS A;  1BJA A;  4EJW A;  3T5X A;  3SQN A;  5K5R A;  4LMY A;  2O6G E;  2K27 A;  4A2U A;  3KP5 A;  1FNN A;  5D4R A;  1R22 A;  4Y13 A;  2ZNY A;  5HLI A;  1KU7 A;  1B9N A;  5AON A;  4G94 A;  1SFX A;  4ASN A;  3ZMS A;  1IW7 F;  1FBQ A;  3E97 A;  4ESB A;  4L0Z B;  4AVP A;  2NRA C;  1G3T A;  1Z6T A;  1BC7 C;  5FB2 A;  2PMH A;  1YIO A;  3O2P E;  1U5T B;  2W85 A;  3MZH A;  1SFE A;  3ZN0 A;  5D5U B;  3DKW A;  2OZ6 A;  3D5L A;  3M1E A;  4IHS A;  2HFH A;  1W7P B;  4I0A A;  2QYO A;  3Q9S A;  3J81 Z;  1FBU A;  2BBY A;  2KJC A;  3GVA A;  1SD7 A;  3E6M A;  4I98 B;  4ENN A;  5LRS A;  3TGN A;  1ZG3 A;  2Q8K A;  1FBS A;  5HS8 A;  1KQ8 A;  5DUI A;  1MZB A;  4CO8 A;  5LRR A;  4BAY A;  2K4J A;  2GAU A;  4YFN F;  2QM3 A;  1KYZ A;  1QBJ A;  3EUH A;  5CVJ A;  3KP4 A;  1GVJ A;  4KN4 X;  3E5Q A;  2HQR A;  1LB2 A;  4AD9 A;  1RZ4 A;  1W5S A;  2X0L A;  3DXJ F;  4AIJ A;  4AWX B;  5D5W B;  1LQ1 A;  5JHU A;  4HQM A; 
#chains in the Genus database with same CATH topology
 3DEU A;  2LC2 A;  3I64 A;  2EB7 A;  2M1B A;  4XRS A;  1L3L A;  4M6Y A;  2A3S A;  2VOD A;  4B3X A;  3RSN A;  2HDW A;  4ZYE A;  4CH7 A;  1GUU A;  2QQ8 A;  3C2G A;  5EGO B;  4C2T A;  2PMZ A;  1WCM J;  4ON0 A;  3B73 A;  4IOC F;  3BRO A;  3MVP A;  4MQ9 F;  2YR2 A;  3AAF A;  1HW2 A;  1DU6 A;  3BY6 A;  3SDG A;  5DDG A;  4UUT A;  4M9X A;  2E71 A;  2V26 A;  5E3L A;  1SVO A;  4OIO F;  1JUS A;  2X85 A;  4U0V A;  4P9F A;  2L4M A;  4IF4 A;  1OQY A;  4X1E A;  3IP4 B;  3CO6 C;  2R0Q C;  1OYW A;  2CUJ A;  1H89 C;  1LDK B;  2W00 A;  3MD2 A;  1J7K A;  2XC7 A;  2JUG A;  5M5W J;  2Y30 A;  2E2H J;  1QVT A;  4G7Z F;  4NQW B;  2DPD A;  5FO5 A;  3CD6 I;  2DK5 A;  2GWR A;  2DOA A;  4KMU X;  2JTV A;  1WH5 A;  3F6O A;  1YI2 I;  1B4A A;  1YW9 A;  1LFP A;  3R60 A;  3DF8 A;  2IBD A;  2H09 A;  1BN5 A;  1ETX A;  4CCK A;  1PUF B;  1QVU A;  1VQP I;  4LLN A;  4Q5S F;  3CJR B;  4UNO A;  2EFO A;  1YLF A;  2OU2 A;  4NNJ A;  3RKQ A;  2LRE A;  1BIA A;  1G6N A;  2DJI A;  3GTO J;  2JVG A;  5B1B H;  1D5Y A;  1JKO C;  1QGP A;  4EMS A;  2ZXJ A;  2I5U A;  2VON A;  2RQP A;  2BY3 A;  3DLL F;  3BCB A;  3OOP A;  1FOX A;  1VI0 A;  5EZH A;  3CCL I;  2MC3 A;  5LHG A;  1C0W A;  5IT9 Z;  3KE2 A;  3SXY A;  3QPH A;  4DGW B;  4HF1 A;  2Y0S A;  4U0W A;  4A0Y A;  2JZY A;  1ETQ A;  2K40 A;  3PQJ A;  4CCM A;  1WRJ A;  3DPL C;  1AWC A;  4KIC A;  5KK1 A;  4P1W A;  1REP C;  1ZRD A;  3BTI A;  4XLE A;  3L2V A;  2QSH X;  3N05 A;  1TP4 A;  2VN2 A;  3KEQ A;  2TRT A;  2IGM A;  1ETW A;  2OF7 A;  1U9O A;  3OMY A;  2OAZ A;  3FM5 A;  1ZLK A;  1UG0 A;  2O61 A;  2M4G A;  4EEF G;  3E6B A;  1T39 A;  1JE8 A;  3HSF A;  3RCO A;  1I27 A;  1NG7 A;  4UUV A;  5FKM A;  3BWG A;  2L7Z A;  4RA2 A;  3IV5 A;  2WBM A;  4DZJ A;  4M74 A;  1H88 C;  4XRS G;  3AFH A;  3GFI A;  2R7R A;  2RC4 A;  3I71 A;  2P6T A;  2WA0 A;  2UWM A;  2LF8 A;  2HOS A;  1ODD A;  1JKP C;  2YU9 J;  2COM A;  1XD7 A;  1ETY A;  2LSO A;  3KEY A;  1YW7 A;  2XKP A;  5LFA A;  1PJR A;  4HLY A;  1YIT I;  1YRN B;  1YJW I;  3BQY A;  5D5V B;  3KP7 A;  2CV0 A;  3CP2 A;  1W36 D;  4W97 A;  1BW5 A;  2CUZ A;  4UUS A;  3SEZ A;  4HOB A;  3AG4 H;  2EIJ H;  4E6K G;  3SZG A;  2BVL A;  4ZYD A;  3HL2 A;  3TDZ C;  1Y39 A;  1YIJ I;  3HRU A;  3RZO J;  5GPC A;  3CUO A;  1BOA A;  2LRD A;  3BQZ A;  1B1B A;  2VQH A;  2UXN A;  3ESW B;  2BY1 A;  2ECB A;  5E79 C;  5K5Q A;  3A2K A;  5L3F A;  1HKT A;  2EJR A;  2E5N A;  4NC8 A;  5H6Q A;  2KRF A;  2F5F A;  4PJJ A;  3QYE A;  4BL0 B;  2K4B A;  4FCY A;  2EFQ A;  2LKX A;  1M1E B;  3K1M A;  1TWF J;  4LFU A;  3V8L A;  2DOD A;  4RGX A;  5JLW A;  3HJE A;  1ORK A;  2DT5 A;  1IXS B;  2E1O A;  1G4D A;  3CLO A;  3NWT A;  4BJT A;  2HXO A;  1ZKG A;  2QF7 A;  1T98 A;  1ZLJ A;  2K9L A;  5DM6 F;  5GPA A;  2JMW A;  2LH9 A;  2H6B A;  3FX3 A;  4HAM A;  2R3S A;  3M07 A;  4KIF A;  4KJZ A;  1KQ9 A;  3PO2 J;  3K69 A;  3GTG J;  4KT6 A;  1P4A A;  3G6E I;  1BI0 A;  1WJ5 A;  2K5C A;  1U3E M;  4IRI A;  2VKE A;  5D8K B;  3GTQ J;  4CZZ A;  3K4K A;  2L9N A;  3BJA A;  4XN3 A;  2MD0 A;  2KIU A;  4DW6 A;  2KHM A;  5J4V A;  1HA8 A;  2M87 A;  4KIS A;  3KP3 A;  2A5W A;  2ZC2 A;  4N0B A;  4PSW A;  5KVR A;  1Z9C A;  5B3S H;  2NVT J;  1AKH A;  1GV2 A;  4XON A;  1MGT A;  4BDZ A;  1PP7 U;  1BJZ A;  4ZDP A;  2NVY J;  4I0B A;  3JAM Z;  2MFZ A;  3GLX A;  3M9A A;  3BDD A;  2FD5 A;  3JTH A;  1P4X A;  1ZN2 A;  3F22 A;  2R7Q A;  1PP8 F;  4UVC A;  3RPU D;  1DP3 A;  5HDG A;  2YX4 A;  4RB3 C;  4BGD A;  5LLQ A;  3OS0 A;  1OIS A;  5ERI A;  3PNV A;  3WTS C;  1F43 A;  1I1G A;  1MBF A;  4L5I A;  1R4M B;  2QWW A;  1ZGJ A;  2LY9 A;  1SFK A;  1P7I A;  2DT7 B;  3LNQ A;  3KYD B;  3ISP A;  1IN4 A;  4ZYA A;  4RM2 A;  2NS0 A;  1ULY A;  5L3C A;  4PUS A;  2QKM B;  2XAJ A;  1TZL A;  4IHW A;  3MWM A;  1JKR C;  4L9N A;  4I6Z A;  2KIS A;  4JX5 A;  5DCM A;  3IKT A;  4HDV A;  4WXC A;  1MH3 A;  1UB9 A;  3VSK A;  2ZNZ A;  3OYE A;  4EJO A;  2D2W A;  2PFB A;  2E2I J;  4LG3 A;  3HSE A;  1S7A A;  2BE5 F;  3H3V K;  3VYU B;  4WXD A;  3KP6 A;  2ECC A;  5FRN A;  4Y7N J;  4HSR A;  1D1C A;  3EYY A;  3JAM K;  1BR1 A;  2HWV A;  2ZBK A;  1HKS A;  3TP3 A;  3A0B C;  5J8C A;  3FBN B;  2VIX A;  5FKN A;  1S7O A;  1WH7 A;  2MSY A;  2VBY A;  2VB6 A;  1B8I A;  1VQ6 I;  2ME0 A;  1FTT A;  1EH7 A;  2XAF A;  3LL7 A;  2HYF A;  3LQR A;  1YFH A;  3Q0V A;  1G3Y A;  2JA2 A;  1W0U A;  2OQG A;  4RGU A;  3EPZ A;  1W5C C;  2W1O A;  3KPH A;  3WG7 H;  2Y2Z A;  1S6L A;  2Q2E A;  2F6C A;  1B72 B;  4XLN F;  2R7U A;  2ICW G;  3TO6 A;  2VUM J;  1XPX A;  4BS9 A;  1F4K A;  4LG0 A;  3BCA A;  3KYC B;  2XF6 A;  3QPS A;  5DS9 A;  2F5D A;  2CFO A;  1YG2 A;  4KMF A;  1G2H A;  2MLK A;  4LIU A;  4M72 A;  2H94 A;  1EKE A;  3J7Z I;  3K70 D;  3REO A;  5JI6 A;  3G3Z A;  3E3V A;  4M6V A;  2HYG D;  5EZG A;  3H5A A;  3U1D A;  4F93 B;  1K78 B;  4CHU A;  4DZP A;  4L18 B;  2EQR A;  4OIQ F;  1TWC J;  2ZFW A;  4HX4 A;  4C3J J;  5L3E A;  2VLA A;  3MCZ A;  3N4M A;  2RDP A;  2VT3 A;  3HOX J;  1TLH B;  2DN0 A;  4D1Q A;  3HOU J;  5FFZ A;  1VQK I;  4MQV A;  4JBA A;  4QSH A;  2DYS H;  2JRM A;  1Y1V J;  3OIQ A;  3L7W A;  3HUG A;  4P9U A;  5EEH A;  3HDD A;  3DBH B;  1JT0 A;  5KNL A;  3IHU A;  3GTJ J;  3ZQL A;  4GGG A;  1A04 A;  2MD5 A;  2XPU A;  1X4P A;  2ESH A;  2K9Q A;  2ISY A;  1N25 A;  4J19 A;  3K1P A;  1SC7 A;  3ZPL A;  4B4C A;  2HOT A;  3ASN H;  3DPT A;  1ONV A;  4U87 A;  2JA5 J;  2Y75 A;  4DIQ A;  2CQQ A;  1G3S A;  4XOT A;  2KQR A;  4YII A;  2NS7 A;  4E70 A;  2K85 A;  3HOS A;  4JQF A;  1XGM A;  2WAD A;  3ROU A;  2DFF A;  2DW4 A;  4AYB N;  1R6R A;  5F6F A;  1JI8 A;  4LK0 F;  1SD4 A;  4QPQ A;  2IW5 A;  2FSW A;  1V4R A;  3N97 A;  1ZHF A;  3FKI J;  3CMY A;  4ENM A;  3GFJ A;  2F2E A;  4EJT A;  2V6E A;  9ANT A;  1Z1D A;  1RIO H;  2IVM A;  1EH8 A;  4RGS A;  1Y8R B;  1SAN A;  1IN8 A;  2OA4 A;  2L3D A;  3KFW X;  4A6E A;  1Z67 A;  4A3G J;  4JX6 A;  4D5F A;  1XSV A;  3IH4 A;  4XKV A;  1PVE A;  1T08 B;  1IN6 A;  4GO1 A;  5E1X A;  2XSD C;  3D5S C;  4LB6 B;  2LP0 A;  2MH2 A;  2EZK A;  3JRI A;  1ERD A;  3LSR A;  3QU6 A;  4D7N A;  1O3T A;  3LSK A;  2JPB A;  3PQK A;  3S3M A;  1NHA A;  3ONQ A;  2YUS A;  3WHC A;  1X4O A;  3K7A J;  2GA2 A;  3ERM A;  1E0E A;  3ABM H;  3CTA A;  1A6Q A;  3K1N A;  5F04 A;  2HPM A;  3GZ5 A;  1LEB A;  4A5M A;  1RPW A;  2QQ9 A;  5IYD J;  1AA7 A;  2LKS A;  3KP2 A;  2M0M A;  5FJ8 J;  3RDI A;  4XLP F;  2DFI A;  2WC2 A;  1WFX A;  2L01 A;  5F1J A;  1UEL B;  2MG4 A;  3FMR A;  1AU7 A;  1X3Z B;  4K2E A;  1OCP A;  1BI3 A;  4N4N B;  2WAQ N;  1VFC A;  4EJV A;  2ZFU A;  1YOV B;  2L9R A;  3ZR8 X;  4M71 A;  4PJM A;  4G6Q A;  2DPU A;  4F55 A;  3TO7 A;  4DOZ A;  2K3P A;  5H6R A;  3S2H J;  1KON A;  4ZTF A;  2OCE A;  3G2B A;  2IS2 A;  2Y69 H;  1FWZ A;  4LJZ F;  3DKX A;  2PJR A;  1TC3 C;  2QEN A;  4CGZ A;  2CO5 A;  5KAI C;  5CQE A;  4CYC B;  2XB5 A;  3F21 A;  2VC0 A;  3VSL A;  3BG6 A;  3OL3 A;  4IKF A;  2DXI A;  4OAY A;  4KIG A;  2FMY A;  4QTR A;  3P9I A;  1D0X A;  3F8M A;  2YX7 A;  2Y9Z A;  3L09 A;  3GFM A;  1ZH5 A;  3ZOB A;  1TQI A;  4PJN A;  4UB6 C;  1HW5 A;  2G7H A;  1U8R A;  5GTH C;  1ZRC A;  1OYY A;  4AVZ A;  3HOV J;  2IA2 A;  1MNE A;  3WTZ A;  2PQ8 A;  3RQI A;  4XKB A;  4EVI A;  2R5Z B;  2L5Q A;  2V9K A;  1HC8 A;  2ZB9 A;  4CZC A;  3JRA A;  1J59 A;  2MC4 A;  4ENJ A;  2HPI A;  2M0C A;  2RVC A;  3GZ6 A;  3R6S A;  3M4O J;  5L3D A;  4FX4 A;  1U2W A;  1X3U A;  2VKD A;  2QKL B;  3HC7 A;  1BR4 A;  1X1D A;  3G71 I;  3TL4 X;  2X9D A;  1T0F A;  5TRD A;  4IRH A;  2XGC A;  1VTN C;  5CLS A;  1FSE A;  3RKY A;  5JFR A;  4A5N A;  2EFP A;  2V9V A;  2GA1 A;  1IJW C;  2X1C A;  3OWT A;  1ZRE A;  5LGN A;  5FFX A;  3V8J A;  2HNH A;  4YFX F;  2AO9 A;  2EIL H;  1UFM A;  2GXB A;  3IUO A;  1XN7 A;  1A35 A;  2R7X A;  1UHM A;  2EV6 A;  3HOW J;  3GF2 A;  1KU3 A;  1GVD A;  2CUE A;  3I58 A;  3IWF A;  4A3M J;  2BEO A;  2EH3 A;  4A3D J;  4JYK A;  3QAH A;  4RLQ A;  2E2J J;  3PIP F;  4BE1 A;  2DA3 A;  2JRT A;  3DEE A;  4W1U A;  3QOE A;  3BOQ A;  3HRM A;  1LNW A;  5J1U A;  3ELK A;  2VI6 A;  4G7H F;  3HHH A;  1JUP A;  4IRG A;  2L02 A;  4OMZ A;  1A5J A;  4Q48 A;  3K4C A;  2L7M P;  2HVQ A;  1ITY A;  4EJU A;  3A01 A;  5JR3 A;  4EM0 B;  1MMG A;  3CDH A;  4HEA 2;  2XGE A;  1T33 A;  4LD5 A;  4IXA A;  3VB2 A;  1J09 A;  3DQV C;  3H3Z A;  1WJF A;  2XRO A;  2K3F A;  3TW7 A;  4BEH B;  5IP6 A;  2R7W A;  3J7A O;  5HNF A;  3RYR A;  1IXC A;  1K4T A;  2K02 A;  1R9T J;  1IO2 A;  1V54 H;  2DMP A;  3AG2 H;  4S0H B;  1B59 A;  3OYC A;  3GTL J;  4WWC A;  2VE9 A;  1Q1V A;  1KGS A;  1JJ6 C;  4KYW A;  1V5G A;  1R49 A;  2VT2 A;  3IAS 2;  4XL9 A;  5DTD A;  4HW0 A;  2FOW A;  1IRZ A;  1JGS A;  4B8X A;  1OR7 A;  5JLX A;  3R61 A;  3BR2 A;  2BY2 A;  3BC8 A;  1ZRF A;  2DI3 A;  4BQQ A;  4J00 A;  1JTY A;  2OPT A;  1KU9 A;  2VBZ A;  3CF5 F;  1MMD A;  1MBE A;  3OOU A;  4GDF A;  3MKW B;  1APL C;  3LSJ A;  2O3F A;  1GXQ A;  4BBS J;  1Z7U A;  4RDU A;  1VQ7 I;  4BAC A;  3RQ4 A;  5C4X J;  3S3O A;  2XAS A;  4BDY A;  2E1C A;  1I3A A;  5E18 F;  3B6A A;  5AIP A;  3TOA A;  4YG2 F;  1VZ0 A;  1WHU A;  4XM3 A;  4RAF A;  3FK7 A;  2EPF A;  3HEF A;  3VEP A;  3ZN1 A;  2Z3Y A;  2Z5U A;  3WG9 A;  1HSJ A;  2W25 A;  3KZZ A;  3GYH X;  2DTZ A;  3B02 A;  1HCR A;  2XHK A;  3H92 A;  3P9K A;  3JSP A;  2R5Y B;  3PFI A;  2DO7 A;  3H3U A;  2L9V A;  1GT0 C;  1FP2 A;  3CDI A;  3LA3 A;  2F48 A;  3OR2 C;  3TKY A;  1OPC A;  2DFE A;  5JVT A;  2W57 A;  2GLO A;  2BYV E;  1T38 A;  3DTI A;  4IHX A;  4CCJ A;  1XMX A;  3I5U A;  1R71 A;  2FF4 A;  1IRF A;  2W84 A;  1D5V A;  2E5Z A;  4RB2 C;  3JSO A;  4X6A J;  1MJ9 A;  3O8H A;  1I39 A;  1Z6R A;  2UV1 A;  2JWT A;  3ZQF A;  5K7Z A;  2K86 A;  4G7O F;  4RM3 A;  3MFK A;  2PMU A;  4R1H A;  2HXI A;  3KX2 A;  1XMK A;  1XGN A;  2KDO A;  4RS8 A;  1U5T A;  5LD2 C;  5JHF A;  5B66 C;  2F5C A;  2UXX A;  2W24 A;  4O6J A;  4E7J A;  4BQA A;  2LG4 A;  2PBI A;  2H6C A;  4DBQ A;  1X2N A;  2CQN A;  1W7P A;  2AXT C;  4N9H A;  2EA2 A;  1R00 A;  4C30 A;  4B1R A;  3J80 Z;  3OYF A;  2KZG A;  2IA0 A;  3FXJ A;  4FT8 A;  2CU7 A;  1ZK8 A;  2Z33 A;  2E1N A;  2DK8 A;  2RAE A;  1DUX C;  2HR3 A;  4C3I J;  2CG4 A;  3PUF A;  2CQ7 A;  5LHH A;  2VE8 A;  1XGO A;  2E34 A;  1LVK A;  2JJ7 A;  3C1D A;  1BL0 A;  1KQ0 A;  3RTR A;  4ZZL A;  2CW0 F;  1SMY F;  2HI3 A;  2ZO4 A;  4ESF A;  4UUS B;  2EZI A;  3M3Y J;  1W4M A;  5ILU A;  3V8K A;  1YQA A;  1SFO J;  4IQJ A;  4L0Y B;  1QZZ A;  3ZP5 A;  3CZ6 A;  4QPO A;  2ELJ A;  4F3Q A;  4JK1 X;  3OYL A;  2M5W A;  1VQ8 I;  3F0C A;  2KRH A;  2E1M B;  2V1X A;  4G6D A;  1O3S A;  4DJA A;  5FLX K;  4IEJ A;  4Y52 J;  4A3K J;  3FHN A;  1WZ2 A;  1JGG A;  2A5Y B;  2UUZ A;  2D1V A;  3KZI C;  2DA1 A;  2RNJ A;  1YS6 A;  3MN2 A;  2EWN A;  3SDB A;  1QU3 A;  2BZT A;  4OU0 A;  4A0X A;  2FU4 A;  4I01 A;  3ZQG A;  3H1C A;  2DMT A;  3HGG A;  2E35 A;  4GYI A;  3V4G A;  3OYN A;  3J80 K;  2FBI A;  4OIR F;  1DDN A;  1N78 A;  1USS A;  5GTI C;  3EET A;  3WTW C;  3HOY J;  1T0F C;  2CW7 A;  4XOR A;  3WU2 C;  3JR9 A;  2YU3 A;  2IAI A;  4PSX A;  4ZTJ A;  2D1H A;  3BJO A;  1CF7 A;  4U7B A;  2WB1 N;  2XIG A;  2WAE A;  1G8X A;  2W82 A;  3BR5 A;  4F91 B;  4BQN A;  3HHG A;  3CCE I;  2E19 A;  3H9Q A;  4HRI A;  3G1O A;  4NQW A;  4BHB A;  1VQ4 I;  3CCS I;  5EG0 B;  3WTX C;  5DYM A;  4QLC U;  5FRO A;  2EFN A;  4MGR A;  1AKH B;  4NDL A;  1B9M A;  1YYV A;  4A6D A;  5C4J J;  2O8K A;  4A3E J;  5HS7 A;  1PUF A;  3A03 A;  2CQK A;  1BA5 A;  1TT5 B;  1FOK A;  1IZ1 A;  3ASO H;  2J5O A;  5HNH A;  4CDG A;  3L2W A;  1ZAO A;  2X1D A;  4XLF A;  2XAG A;  4CYD A;  1EJ9 A;  2GQQ A;  1G3W A;  1JUM A;  2ELK A;  5K5O A;  3OSG A;  3CC4 I;  2NYX A;  3ULQ B;  2GOM A;  1SD6 A;  3H9G A;  2WAF A;  5D6F A;  1D1B A;  4RGR A;  2IGO A;  1E3P A;  2MGQ A;  2ZJ2 A;  4GYG A;  5CJ9 A;  1S9H A;  1NG6 A;  2ZXW H;  1JJ8 C;  1VF9 A;  2LY1 A;  1QZY A;  2NXN B;  3D0S A;  1MMN A;  2MH9 A;  3DFG A;  3QQA A;  1D3Y A;  2B0L A;  2FEZ A;  5ICF A;  1W0T A;  2XPV A;  5DCM B;  4U88 A;  1GDT A;  3M8F A;  3JRC A;  3C7J A;  3S32 A;  5HLH A;  3O6B B;  1F9N A;  3HB9 A;  3PL8 A;  5EJC A;  3W3C A;  3CUQ A;  1OR7 C;  2Y48 A;  3ZXS A;  2ZME A;  2VKV A;  3CJN A;  3BJ6 A;  3ZMU A;  1O3R A;  1T2K A;  2X6X A;  1CQT A;  1MND A;  2AQF A;  2B63 J;  5HVQ C;  1R5G A;  5M3F J;  1OKR A;  1TWG J;  4D7M A;  1HKQ A;  4M9S A;  1MBH A;  5HS9 A;  1OCR H;  3CCM I;  2EIK H;  4QWQ A;  1FSH A;  3HGY A;  1B8I B;  4DYQ A;  4KDP A;  1T56 A;  2XV4 S;  4CUG A;  1BM9 A;  3A02 A;  3LAJ A;  3FM3 A;  2R93 J;  4WXH A;  1D8J A;  3W6J B;  4CIC A;  3MKY B;  3KCC A;  1A6I A;  3ZCO A;  2LTP A;  2Q2E B;  4NHJ A;  3CC7 I;  2A61 A;  4UVB A;  3K4M A;  5ILV A;  1PYV A;  1ON1 A;  1GV5 A;  4CSW A;  1QZE A;  2FQ4 A;  3SYT A;  2XF5 A;  3GTM J;  5BNG A;  5E1W A;  1YTY A;  1FYK A;  2K9S A;  3BG9 A;  1UHW A;  3GUD A;  3DP7 A;  4MHG A;  4V19 K;  4G8X A;  2JPC A;  3HZJ A;  4Q47 A;  4PFO A;  3OV8 A;  3FXO A;  4WF2 A;  3QYF A;  4KNY A;  2JSC A;  1YJ9 I;  3S1Q J;  4Y17 A;  3SZT A;  1TT0 A;  3C18 A;  3M8J A;  2LBF B;  1K6Y A;  3DWL E;  2EZL A;  4UV8 A;  3BTJ A;  2NOG A;  4ZJZ A;  3HUG B;  1N77 A;  1RUN A;  2FX0 A;  1FEX A;  4Z2Y A;  4XQF A;  3EUK L;  1S29 A;  1HF0 A;  3JCU C;  1U6G A;  3PFY A;  3CMM A;  1IN7 A;  2IRF G;  1MW7 A;  5H2F C;  5E3N A;  2ZXH A;  2WWY A;  4E7H A;  1U5T C;  1UST A;  1WJA A;  4DBR A;  5IYC J;  1D0Z A;  1Z05 A;  1KZH A;  1WJD A;  4MNU A;  2ZKZ A;  1FPQ A;  1DGR M;  5TJJ A;  5F0H A;  4UY8 I;  1K61 A;  2ELH A;  2KKO A;  4O5V A;  1HOM A;  1VQO I;  4AID A;  3BR1 A;  3WU0 A;  2QLZ A;  4UXN A;  1H0M A;  1I6X A;  3JRH A;  2KPM A;  3M1C A;  5CVR A;  2DU9 A;  1Y0U A;  2M9H A;  2TCT A;  3DTE A;  3OL4 A;  3BR0 A;  1MSE C;  2LD5 A;  3PJR A;  1FOW A;  1FJL A;  2MBF A;  4YEJ A;  2NVX J;  2V79 A;  1Y0N A;  2DAO A;  1TWH J;  2YPR A;  2IS1 A;  5F27 A;  2P0W A;  2X6Y A;  1OCT C;  1LE8 B;  1V5E A;  2HKX A;  5M5Y J;  3KYL A;  1V3F A;  5EF6 A;  2CWE A;  3R0A A;  4CCO A;  1SAX A;  3P9C A;  5E17 F;  3Q3S A;  2DCE A;  2NVQ J;  3AL0 B;  3PSF A;  1P92 A;  2EBI A;  3JRB A;  1OCC H;  1U78 A;  1K4S A;  3SHF A;  3W6K B;  4MTE A;  4HF2 A;  2P8T A;  1KA8 A;  3BR3 A;  4BBR J;  4D0P A;  3SFI A;  4WK8 F;  2VL8 A;  1MDM B;  2L54 A;  4J01 A;  1OMI A;  2F4O B;  2W48 A;  1T95 A;  4GRI A;  3DU5 A;  4GFB A;  4UHT A;  1YX3 A;  2WV1 A;  4ZC3 A;  4HQE A;  2CV2 A;  1YS7 A;  2HGC A;  4HA8 A;  4E7K A;  2KP6 A;  4L9T A;  3H36 A;  1IN5 A;  3I59 A;  4BUP A;  5HDN A;  3FIW A;  3DCF A;  3OYK A;  1PUE E;  4HLX A;  1ENH A;  3WGH A;  3BP8 A;  3TW6 A;  3I53 A;  3S1R J;  1ZGA A;  3QOD A;  2CJJ A;  5GAE J;  2XAH A;  4I02 A;  1FLI A;  2R4G A;  2P5K A;  5E8G A;  3V7S A;  3ABL H;  4F92 B;  2CMP A;  4II2 A;  1HDD C;  1LEA A;  1IXR C;  1O7L A;  2IT0 A;  3C3W A;  3PUB A;  2PJR B;  3VDX A;  1J75 A;  4XNF A;  4C2U A;  4MIM A;  2I10 A;  2LNB A;  3G1M A;  3K9T A;  3ZQI A;  1QNT A;  3JRD A;  5HOO A;  1TQM A;  1X19 A;  2OD5 A;  1JT6 A;  2RV8 A;  1RES A;  2DQL A;  3HTU A;  4XLA A;  3WGG A;  2D5V A;  4RB1 A;  3LMM A;  1B72 A;  1ZGW A;  3G73 A;  3E5U A;  4PFP A;  2EFW A;  2DJN A;  1J0R A;  4FET A;  2UZK A;  3OYB A;  1WGX A;  2B7E A;  2VC1 A;  4LIV A;  1TL8 A;  1WSU A;  5CKT A;  1OCZ H;  4M9Z A;  1K6O A;  2HZT A;  5LEJ A;  5ICG A;  1RNL A;  3LOC A;  3PM1 A;  3U2R A;  4M3B A;  1SVM A;  2NNY A;  1K78 A;  2OZU A;  1E17 A;  2FBH A;  5DD8 A;  2DA6 A;  4G9Y A;  1JXS A;  4F7Z A;  1X58 A;  3S1N J;  3NAU A;  3ECO A;  2BW3 B;  3OSF A;  2LF7 A;  1IUY A;  3FZV A;  4B09 A;  2IP2 A;  3GW2 A;  3K2Z A;  1B6A A;  1Y1W J;  5D6E A;  4HG2 A;  1WVR A;  4BJ6 C;  3F6V A;  1SFU A;  4AYB A;  3FIS A;  1LKX A;  4XMY A;  3CUQ C;  3WU1 B;  2OBP A;  2CFX A;  4B44 A;  3D5R C;  2C6Y A;  2CUF A;  2ZME C;  2NS8 A;  4BE2 A;  3WOD F;  1V55 H;  4Y15 A;  3ERE D;  2LR8 A;  5IOY A;  2A6H F;  2PEX A;  4CA0 A;  2QGU A;  5L3G A;  2MLG A;  2V1N A;  1WKM A;  1OJL A;  2QZ8 A;  1RKW A;  4H0E A;  2EA4 A;  3C2B A;  1P9Q C;  4TV7 A;  4HNT A;  4P55 A;  1YW8 A;  2Z2S B;  2QVO A;  5EEA A;  5J1Y A;  4DYC A;  4BHP A;  1X2M A;  2F4I A;  2IA1 A;  3K6G A;  2M7A A;  3F72 A;  5M3M J;  4I99 C;  4LIT A;  1R36 A;  2EV5 A;  4AUX A;  1LFB A;  3L2U A;  1VQ5 I;  5CVI A;  3NEU A;  3CJT B;  2M30 A;  1TQP A;  1K7A A;  3FXU A;  4L5J A;  2QUF A;  1HLV A;  3BZ6 A;  5DM7 F;  1QQI A;  4ZYG A;  2PN6 A;  4C2M J;  4S04 A;  4A3B J;  2AS5 F;  2O5R A;  1FX7 A;  4DYR A;  1SAU A;  5J6X A;  2BHY A;  2DA2 A;  3KET A;  4KUM A;  3F8F A;  3M8E A;  4EQQ A;  3QYB A;  1JHF A;  2QCO A;  2L7K A;  2RN7 A;  3BR6 A;  5BMZ A;  1ETV A;  2BV6 A;  2DDA A;  1QA6 A;  4I2O A;  3MEX A;  2KJB A;  2WAQ A;  4BH9 A;  1Z3X A;  2H1L A;  5F0C A;  3W6V A;  2P4W A;  4LB5 A;  3GLL A;  4H4K C;  3PNY A;  3T8T A;  4BQO A;  2GIV A;  2HTJ A;  4XSX F;  3LAP A;  3CJQ B;  2V1U A;  3NRV A;  5KHD A;  3HKZ N;  5F64 A;  1I6H J;  1MBK A;  5LGT A;  2AQE A;  5E8I A;  3GTP J;  2JA6 J;  1MMS A;  1W1W E;  3HRT A;  3OS2 A;  5ICE A;  4RMN A;  5J3L A;  3LSG A;  4KIB A;  3OYJ A;  2O03 A;  4OMY A;  1YJN I;  2QBY A;  4FTH A;  2VJJ A;  5HLT A;  2DLL A;  1QPM A;  1TW3 A;  1Z0X A;  2GIZ A;  3MKZ A;  3F8B A;  1S3J A;  4D9J A;  1UMQ A;  3BTC A;  4GXO A;  3MZ8 A;  2VJ4 A;  4QIW N;  1JHH A;  1CGP A;  2IJL A;  4MTD A;  4B48 A;  3B6C A;  2P81 A;  2V7F A;  1Z3Y A;  3O3K A;  3W2V A;  3V7R A;  1UCR A;  1IF1 A;  3L1P A;  3H9J A;  3O8G A;  1XMA A;  1MSF C;  4PK4 A;  2VJI A;  3R4K A;  4KT5 C;  4RBO A;  3BG7 A;  1MJA A;  3CO7 C;  1YX5 A;  3Q0U A;  1F36 A;  2R7T A;  2MAB A;  3RKW A;  2IXS A;  5IP9 J;  5FD6 A;  2GOX B;  2KIF A;  2IGN A;  3IWZ A;  3RJP A;  2FRH A;  5J4Y A;  5CVU A;  2ZXI A;  2AXL A;  2X6W A;  2H8R A;  1R23 A;  3KZY A;  4G6T B;  2LY2 A;  2XDV A;  2DOE A;  2RKH A;  1XCB A;  2XB0 X;  3DV8 A;  3JW4 A;  3TO9 A;  5D5X B;  4ETS A;  4IOA F;  3TP0 A;  1OLT A;  1P7J A;  4YEL A;  3VYT B;  3H35 A;  3DKY A;  2Y9Y A;  2R5Z A;  1WQ2 A;  4PCQ A;  2O0Y A;  2V9P A;  2ETH A;  2XRL A;  5DUK A;  1WI9 A;  4PGG A;  3HIF A;  2CQX A;  2M34 A;  4RAZ A;  3RPQ A;  3J7Y J;  4MEX F;  2PX9 A;  2YS9 A;  3MQ0 A;  2HVS A;  1IG7 A;  2PG4 A;  4OAZ A;  3M7G A;  4UB8 C;  1BI2 A;  2P7C B;  1IRX A;  2JK3 A;  5BPI A;  5FRM A;  5K1Y A;  3DTK A;  1FTZ A;  2KIM A;  1GXP A;  1ZYR F;  2VPR A;  4AIH A;  2WV0 A;  3ZQQ A;  3FXK A;  4E7I A;  4BNC A;  6PAX A;  1WWX A;  3ZQC A;  1T8I A;  2PMZ N;  3GME A;  2NAZ A;  1FY7 A;  3F9K A;  1J5Y A;  2DTR A;  2ME6 A;  2DOF A;  2N8G A;  1BR2 A;  3GWZ A;  1G59 A;  1FMW A;  3OYD A;  3HPG A;  2P7V B;  1IC8 A;  1FYM A;  4XLH A;  3ZQ7 A;  2VBW A;  1ETO A;  2EIM H;  1WPK A;  2XGD A;  5IY5 H;  4M3G A;  1ETK A;  3WTT C;  1ZG5 A;  1RUO A;  1BBY A;  1D1A A;  2E36 A;  2D45 A;  3AL0 C;  1I1S A;  1K79 A;  3LA7 A;  3E6D A;  1LUJ B;  2R92 J;  3W2W A;  3QU3 A;  4Z6Y A;  2A68 F;  1AHD P;  4AIK A;  3KIO A;  3I4M J;  1FZP B;  4ZH4 F;  2GXA A;  5FKO A;  1A31 A;  1R5I D;  4YIF A;  4V2G A;  2GBY A;  3NQO A;  2KL4 A;  4U7D A;  4YRV A;  1GLN A;  3TDU C;  2EIN H;  3GX4 X;  2V4J C;  2PI0 A;  2DA5 A;  3OYH A;  1ZAR A;  3BT9 A;  4A3J J;  2JA7 J;  1TTY A;  2M4K A;  3VFZ A;  4Q4Z F;  4UVA A;  2DFH A;  3QPL A;  4MO7 A;  2OV7 A;  1E3O C;  3BTL A;  3KLN A;  3CME I;  1HDP A;  2OJE D;  5FLX Z;  2ZCW A;  2G7U A;  4FX0 A;  1ON2 A;  1KU2 A;  1BOB A;  3MAJ A;  5AIQ A;  4B43 A;  3J81 K;  5E3M A;  3KEO A;  5FLM J;  2X6O A;  5F0F A;  2L9S A;  1D0Y A;  2WY8 Q;  2M8G X;  2Y0S N;  3BPX A;  3E1S A;  4NC7 A;  2HS5 A;  3LQQ A;  3OY9 A;  1MNM C;  2HDC A;  3FHZ A;  3FDY A;  1X3W B;  2FJ1 A;  2IS6 A;  2L4A A;  5IYB J;  2CGP A;  1LFU P;  1CF7 B;  3L2Q A;  2XGX A;  5KCM A;  5HLG A;  3QOP A;  1S7E A;  3AG3 H;  2VBX A;  2OCC H;  1IV8 A;  2YSR A;  4A3L J;  2XAU A;  5L3B A;  2RQQ A;  2BGC A;  1SD5 A;  2O9L A;  3I54 A;  1XGS A;  2XAQ A;  5E3O A;  2BHZ A;  1MBJ A;  5ILS A;  3TMO A;  2QQA A;  5LHI A;  2BXY A;  3TOB A;  5BS6 A;  2DBB A;  3WHB A;  2DMQ A;  3F8C A;  3CCU I;  5ICC A;  4S05 A;  4AU7 A;  5J1R A;  1J9I A;  3S17 J;  2A6T A;  4HX8 A;  4Y4R A;  2R5Y A;  3UKG A;  4XIC A;  5IT3 A;  2EZH A;  2PJP A;  4G12 A;  3ML6 A;  1IDY A;  1X1A A;  4DNC A;  4XBF A;  1IDZ A;  1UHS A;  4XKC A;  3A0H C;  3LSM A;  3E6C C;  1H9G A;  3K4L A;  5HOD A;  1RR7 A;  4L9J A;  2PLY A;  2LMD A;  1ZEL A;  2R7D A;  3L2R A;  1JKQ C;  4PDK A;  5LGU A;  5F1R A;  3K4J A;  2OTJ I;  5M5X J;  2GM4 A;  4PZJ A;  5ED4 A;  2KFD A;  4IVN A;  3TBI A;  1UAA A;  5EGO A;  2M7B A;  3UNG C;  3OS1 A;  4AM3 A;  3QP6 A;  3BLY A;  1L0O C;  3SEQ A;  2CYY A;  2X51 A;  4DQ2 A;  1MJB A;  3Q5F A;  5LEK A;  4WCG A;  4O3M A;  3FF5 A;  4HBL A;  2CV1 A;  4OIN F;  3CUQ B;  1BI1 A;  2IPQ X;  1Z91 A;  1XTA A;  4N9I A;  1YO5 C;  1BIB A;  3HOZ J;  2EV0 A;  2HKO A;  4Y33 A;  3LA2 A;  2ZME B;  3FMS A;  3K70 C;  1IRG A;  2H8W A;  4I09 A;  4KN7 X;  4XOP A;  2XKO A;  2LYC A;  3H0D A;  1WJC A;  2TDX A;  2W4S A;  1O7F A;  1RC9 A;  1EV7 A;  5LBQ A;  1LDD A;  3W2A A;  3F3X A;  2OTL I;  2M8E A;  4HV5 A;  3VYR B;  3S93 A;  3C2H A;  3QP5 A;  3CCV I;  2CW8 A;  1TBX A;  2BXZ A;  2OUM A;  2LFB A;  3BPV A;  2ID6 A;  1RRJ A;  3HOT A;  2ZSI B;  1YE9 A;  2VOO A;  1NH3 A;  2GXG A;  1TNS A;  3K10 A;  4EV0 A;  4A93 J;  1PDN C;  4GCV A;  5FKL A;  3EYI A;  5IT9 K;  3FMQ A;  2R7V A;  3IH3 A;  5GAD J;  1OCO H;  1E2X A;  3HPH A;  3IKV A;  5CYV A;  2M3A A;  2L7F P;  4HPQ A;  3WE3 A;  5B5E C;  3CCQ I;  4NB5 A;  4RAG A;  2KIQ A;  4JP0 A;  4R79 A;  2H1K A;  4FE7 A;  2FUG 2;  3BG5 A;  4LLG F;  2F5V A;  5C44 J;  5CVV A;  4HST A;  3CES A;  2LKP A;  2KZV A;  5J47 A;  2VKH A;  5D8L B;  5IOZ A;  2IS4 A;  2NVU B;  5GP9 A;  3PIO F;  3GO5 A;  1S8N A;  2L0K A;  1FOY A;  3JTG A;  1F5T A;  4ZDO A;  2KLO A;  5DCF A;  1P6R A;  2VQG A;  3GBG A;  2WB1 A;  3E5X A;  1NK3 P;  3DU6 A;  1UJ8 A;  3P5J A;  1BC8 C;  2FML A;  4M3F A;  5FGM A;  1UG2 A;  3P7N A;  4Y3O A;  3PO3 J;  2A69 F;  1XSD A;  1K83 J;  3K4B A;  1IUF A;  3FBI B;  1X1P A;  4PJ0 C;  1BW6 A;  2VQC A;  3IAM 2;  2LVS A;  3PSI A;  1STZ A;  4FHT A;  2XRN A;  2K7L A;  4BJ5 C;  1HST A;  4RAY A;  2F5E A;  3IL2 A;  1XCV A;  4IHV A;  1AOY A;  3NAR A;  1MBG A;  5EEG A;  1XX5 A;  1P2F A;  3ABU A;  3BZK A;  2V6C A;  2Z99 A;  2DYR H;  3ECH A;  1YRN A;  4BHC A;  2FQ3 A;  3IC7 A;  4X0G A;  3QRF F;  1R1U A;  3HG9 A;  3LSP A;  2KRC A;  2XVC A;  2DA7 A;  2CH0 A;  3JRG A;  2FBK A;  4M3D A;  2VXZ A;  2P5L C;  1TWA J;  2HEO A;  1O4X A;  5CPR B;  4LG0 B;  5EG0 A;  2R7F A;  1DP7 P;  1NK2 P;  2B9S A;  2FE3 A;  3FXM A;  2ID3 A;  1I3Q J;  2I8D A;  4ZDL A;  4BKX A;  2V1D A;  4NC6 A;  3EUH C;  5E20 A;  3V7C A;  2O8X A;  3RIR A;  4BYY A;  3SFZ A;  3RI4 A;  1O57 A;  4ESJ A;  5B1A H;  2M2E A;  3AKZ A;  1DPR A;  3L00 A;  3CP8 A;  1YHQ I;  1Z77 A;  2JQ7 A;  3ZRG A;  3R0J A;  4A3C J;  3ABT A;  2VXD A;  5FKK A;  3WTV C;  1R1T A;  2BY0 A;  1I5Z A;  3ZMZ A;  4PGH A;  2QSG X;  4NBQ A;  4IHT A;  1Z21 A;  3LSI A;  4XRF A;  3LFK A;  5HDK A;  4AC0 A;  2OC6 A;  3CCJ I;  3CCR I;  2MA3 A;  1R1V A;  1XDU A;  4A3F J;  3G4S I;  3K0L A;  2CRG A;  2VAS A;  2DMN A;  3MMY B;  4HNU A;  3I59 B;  5BOX A;  2XSJ C;  3NWS A;  3U21 A;  2JSP A;  5EYR A;  3VYS B;  3A4C A;  2ZJR F;  2R7Z J;  1ZTR A;  4EM1 A;  3GXO A;  2STT A;  1HW1 A;  3E0J B;  3QWL A;  3KLO A;  4C3H J;  5KAF C;  4B3A A;  2HQN A;  2DDB A;  2HOE A;  3RZD J;  5DEQ A;  4XID A;  3D1N I;  1XSX A;  4ZYH A;  3I4N J;  3U1K A;  4LK1 F;  2AHQ A;  3FXQ A;  3F8N A;  2FXA A;  4JOM A;  1VQ9 I;  1FC3 A;  3T0Y A;  4KIT B;  1VND A;  2ZSH B;  4HF0 A;  1Z7L A;  3L9F A;  4RLF A;  3SZP A;  2FNP A;  3TED A;  1MMA A;  1X1C A;  2E7W A;  3EDP A;  3JRE A;  4E7S A;  2DT6 A;  3EQL F;  4YFK F;  1U9N A;  4IPA A;  4MFE A;  3DBL B;  4E7L A;  2WTE A;  3HBL A;  1XC5 A;  3OIO A;  4A0Z A;  5FD5 A;  5BPD A;  2ACJ A;  2HU9 A;  3RKX A;  3OYI A;  4R8H A;  2HQA A;  4XSZ F;  1R5H A;  1S72 I;  4HNV A;  3CQZ J;  2RRE A;  3I9V 2;  1SEU A;  5EDN A;  3Q9V A;  1DPU A;  4BXF A;  2BVM A;  2QA4 I;  2WY7 Q;  4LLL A;  5K7H A;  2DMU A;  1KYW A;  4IJA A;  4M73 A;  3SJM A;  4U0Y A;  2H27 A;  4M3E A;  4XKW A;  1U8B A;  1Y56 A;  2LBF A;  3S2W A;  4IHY A;  3GZN B;  3H5N A;  1SMT A;  3VPR A;  2KT0 A;  4A3I J;  2E7X A;  2LDU A;  3J7A Y;  2LK2 A;  1MH4 A;  1VQN I;  1RKT A;  1NTC A;  4UV9 A;  1IAW A;  1RR8 C;  5E1Z B;  1VQM I;  3CMA I;  3L2C A;  2ADU A;  2P6S A;  5A2Q Z;  4KFC A;  4HX7 A;  1F1Z A;  1RI7 A;  4XR6 A;  3IRQ A;  1HXD A;  1LVA A;  2GZW A;  3LST A;  3HM5 A;  3Q0W A;  4A69 C;  2M45 A;  4BE0 A;  3HYI A;  2DQR A;  2VJ5 A;  1FT9 A;  3WTY C;  1J2X A;  3S2D J;  5DD4 A;  1H9T A;  4LOC A;  1U0J A;  4RB0 A;  1IGN A;  2HYJ A;  1QPI A;  3VOD A;  1RET A;  3U9G A;  2OQR A;  1EH6 A;  3COA C;  2LOO A;  4HDU A;  4F52 A;  2DA4 A;  1O3Q A;  2JA8 J;  2G9W A;  3K2A A;  3OYG A;  3OYA A;  3MKL A;  2ZJQ F;  1W5T A;  1LE8 A;  1DU0 A;  3RYP A;  1XDS A;  1EF4 A;  2JN6 A;  1S5L C;  5J40 A;  4EGZ A;  3MZY A;  4FAS D;  2E1M C;  2XF7 A;  3ZMV A;  5BQT A;  4IQ4 A;  2A07 F;  1QHH D;  2X4H A;  3WTU C;  3I55 I;  2W7N A;  1HQC A;  2XUB A;  3G1L A;  1XB4 A;  5JVG F;  4OIP F;  4ANJ A;  3FK6 A;  5A2Q K;  4PJL A;  5K7F A;  4FE4 A;  4MFD A;  4BXU A;  5H20 A;  2HOA A;  1X1B A;  1MDM A;  2K9N A;  1P4W A;  1V5F A;  4HV6 A;  2VPL A;  3RPU A;  3A1Y A;  4YIR X;  3S15 J;  4IZZ A;  2ESN A;  2MW8 A;  2FA5 A;  1MKM A;  4P96 A;  3FXR A;  4MEY F;  4FQG A;  1ACI A;  5J8F A;  3FWE A;  1D8K A;  4LGW A;  2XPW A;  3F23 A;  5TIS C;  2VQL A;  4KA4 A;  1ZG1 A;  1Q1H A;  3S14 J;  2Y0M A;  4EGY A;  3I56 I;  3CLQ A;  1TW2 A;  3IH2 A;  4XK4 A;  3T1B A;  4B47 A;  2QBY B;  1JTX A;  3WE2 A;  4BY7 J;  1MD0 A;  1QO0 D;  2FNA A;  1SVL A;  3WGI A;  2R7S A;  2X48 A;  2HTS A;  2E60 A;  3T8R A;  3ZMT A;  1TNT A;  1OYI A;  4FIS A;  5GAH J;  2Z9O A;  2EK5 A;  5CQG A;  2CS3 A;  4CXF A;  3DEW A;  2NNN A;  2CSO A;  3H5R A;  1I50 J;  3I4P A;  1A36 A;  3CCY A;  2A6E F;  2ISZ A;  2RNG A;  3A01 B;  4BY1 J;  3HSR A;  4II3 A;  4I76 A;  2JUC A;  3GEZ A;  2P5V A;  5D4S A;  2QQB A;  1LJ9 A;  3HTS B;  2IEK A;  4XN0 A;  4M6X A;  4A12 A;  4HYE A;  4ZZD A;  1QHG A;  3I0T A;  1ZR4 A;  1W7P D;  5F08 A;  2QEX I;  3I3L A;  1R7J A;  3QPT A;  5IPA A;  3CF2 A;  1LDJ A;  1EA3 A;  2L2O A;  4CCN A;  4P5O A;  1T6S A;  2J5P A;  1FP1 D;  3BZC A;  3TQN A;  3S1M J;  2VOP A;  3GCM A;  2STW A;  3DPU A;  4MLO A;  3ZGK A;  4C9Y A;  4CCL A;  3ABK H;  3GFL A;  3VOE A;  4E4H A;  4ITV A;  2ZJP F;  2BW3 A;  3X2Q H;  3DBR B;  4I7H A;  3S3N A;  1HBX G;  3S8P A;  2RGV A;  4L9V A;  1GHC A;  1FIP A;  4NUB A;  5DV5 A;  1Y8Q B;  4OOI A;  2FOK A;  4EM2 A;  2JT1 A;  4N4O B;  3LWF A;  1WI3 A;  1R58 A;  2Q0O A;  3ZMD A;  3IRR A;  1FYL A;  4WX9 A;  4ENK A;  2HQ5 A;  4HZF A;  3HRS A;  3V42 A;  5C3E J;  5GAG J;  1BJA A;  3UR3 C;  4EJW A;  5IP7 J;  3T5X A;  3SQN A;  4XRM A;  5K5R A;  2G0E A;  4LMY A;  1DGW Y;  3OR1 C;  4JX4 A;  2K27 A;  2O6G E;  4A2U A;  4CYC A;  3KP5 A;  2A05 A;  2IGK A;  1FNN A;  3LFU A;  3EUA A;  4EAT A;  1LPQ A;  4V2F A;  5D4R A;  1UZC A;  1ZQ3 P;  2R7O A;  4E7Z A;  1R22 A;  3LSH A;  1FMV A;  4Y13 A;  2KDZ A;  1OFC X;  3OYM A;  2QSF X;  2ZNY A;  5HLI A;  1KU7 A;  3HXL A;  1VQL I;  1B9N A;  5AON A;  4XLC A;  4G94 A;  1SFX A;  4ASN A;  3ZMS A;  3HKZ A;  1IW7 F;  3PNT A;  1FBQ A;  1MIJ A;  2KMU A;  3E97 A;  4ESB A;  4BU2 A;  1POG A;  4L0Z B;  4AVP A;  3ZQH A;  2NRA C;  1G3T A;  4ABZ A;  3S16 J;  1Z6T A;  1BC7 C;  3AG1 H;  1W36 C;  3FXL A;  5FB2 A;  1XG1 A;  2PMH A;  1YIO A;  2MYS A;  1QRY A;  2Y31 A;  1ZR2 A;  1E3H A;  3CDL A;  5FLV A;  3O2P E;  1U5T B;  2W85 A;  3MZH A;  1SFE A;  2JVH A;  4D5C A;  1FIA A;  3ZN0 A;  5D5U B;  3DKW A;  2OZ6 A;  2NOJ B;  4IO9 F;  3D5L A;  1WJB A;  3M1E A;  4IHS A;  2BOL A;  2HFH A;  1W7P B;  4I0A A;  3GTK J;  2QYO A;  3Q9S A;  3J81 Z;  1FBU A;  2BBY A;  2KJC A;  3GVA A;  3JRF A;  1SD7 A;  3E6M A;  4I98 B;  4ENN A;  2Q1Z B;  5LRS A;  1IV6 A;  3TGN A;  1ZG3 A;  2Q8K A;  1FBS A;  5HS8 A;  1KQ8 A;  5DUI A;  4BXX J;  3K4N A;  1MZB A;  4CO8 A;  5LRR A;  4BAY A;  2F4M B;  2K4J A;  2COB A;  1DQU A;  5TGT A;  2O7O A;  1XS9 A;  2Z16 A;  4L5E A;  1H8A C;  2GAU A;  4YFN F;  2QM3 A;  3H0G J;  1KYZ A;  3E7L A;  1QBJ A;  2HVR A;  1N75 A;  3EUH A;  5CVJ A;  2Z1D A;  3KP4 A;  2K9M A;  4IL6 C;  1GVJ A;  4KN4 X;  2HZD A;  3E5Q A;  1Y6I A;  2X1E A;  4IX7 A;  2HQR A;  1R4N B;  1LB2 A;  3FKJ A;  4AD9 A;  2LLK A;  1RZ4 A;  1W5S A;  1WJE A;  4OWR B;  3BG3 A;  2X0L A;  3DXJ F;  4AIJ A;  4AWX B;  5D5W B;  3CC2 I;  3DLA A;  1LQ1 A;  4BEH A;  2HDD A;  5JHU A;  3OIP A;  4HQM A;  3VWB A; 
#chains in the Genus database with same CATH homology
 3DEU A;  3I64 A;  2EB7 A;  2M1B A;  1L3L A;  4M6Y A;  2A3S A;  2VOD A;  4ZYE A;  4ON0 A;  3B73 A;  3BRO A;  4MQ9 F;  2YR2 A;  3AAF A;  1HW2 A;  3BY6 A;  5DDG A;  4M9X A;  4OIO F;  4U0V A;  4P9F A;  2L4M A;  4IF4 A;  3CO6 C;  1OYW A;  1LDK B;  1J7K A;  4G7Z F;  2DPD A;  5FO5 A;  2DK5 A;  2GWR A;  4KMU X;  2JTV A;  3F6O A;  1B4A A;  1YW9 A;  3R60 A;  3DF8 A;  2H09 A;  1BN5 A;  4LLN A;  4Q5S F;  4UNO A;  2EFO A;  1YLF A;  2OU2 A;  1BIA A;  1G6N A;  1QGP A;  4EMS A;  2ZXJ A;  2VON A;  2RQP A;  3OOP A;  2MC3 A;  5LHG A;  1C0W A;  5IT9 Z;  3KE2 A;  3SXY A;  3QPH A;  4HF1 A;  4U0W A;  4A0Y A;  2JZY A;  3PQJ A;  1WRJ A;  3DPL C;  1AWC A;  4KIC A;  5KK1 A;  1REP C;  1ZRD A;  2VN2 A;  3KEQ A;  2OAZ A;  3FM5 A;  1ZLK A;  2O61 A;  3E6B A;  1T39 A;  1JE8 A;  3HSF A;  1I27 A;  4UUV A;  3BWG A;  4M74 A;  3GFI A;  2RC4 A;  3I71 A;  2P6T A;  2UWM A;  2LF8 A;  1ODD A;  2COM A;  1XD7 A;  2LSO A;  4HLY A;  1YW7 A;  2XKP A;  5D5V B;  3KP7 A;  4HOB A;  4ZYD A;  3TDZ C;  3HRU A;  3CUO A;  1BOA A;  1B1B A;  2UXN A;  5K5Q A;  5L3F A;  1HKT A;  2EJR A;  5H6Q A;  2KRF A;  2F5F A;  2K4B A;  2EFQ A;  3K1M A;  4LFU A;  3V8L A;  4RGX A;  2DT5 A;  1IXS B;  1G4D A;  3CLO A;  1T98 A;  1ZLJ A;  3FX3 A;  2H6B A;  4HAM A;  2R3S A;  4KIF A;  1KQ9 A;  3K69 A;  1P4A A;  1BI0 A;  1U3E M;  4IRI A;  5D8K B;  4CZZ A;  3BJA A;  2KIU A;  2M87 A;  3KP3 A;  4N0B A;  5KVR A;  1Z9C A;  1MGT A;  1PP7 U;  4I0B A;  3JAM Z;  3GLX A;  3M9A A;  3BDD A;  3JTH A;  1P4X A;  1ZN2 A;  3F22 A;  1PP8 F;  4UVC A;  5HDG A;  2YX4 A;  4RB3 C;  5LLQ A;  5ERI A;  3WTS C;  1I1G A;  4L5I A;  2QWW A;  1ZGJ A;  3ISP A;  1IN4 A;  2NS0 A;  1ULY A;  5L3C A;  2XAJ A;  3MWM A;  4L9N A;  5DCM A;  3IKT A;  4HDV A;  4WXC A;  1UB9 A;  2ZNZ A;  4EJO A;  2D2W A;  2PFB A;  3HSE A;  1S7A A;  2BE5 F;  4WXD A;  3KP6 A;  3EYY A;  3JAM K;  2ZBK A;  2HWV A;  1HKS A;  5J8C A;  1S7O A;  2VBY A;  1EH7 A;  2XAF A;  2HYF A;  3LQR A;  1YFH A;  1G3Y A;  2OQG A;  4RGU A;  1S6L A;  2Q2E A;  4XLN F;  3TO6 A;  1F4K A;  4LG0 A;  2F5D A;  1YG2 A;  4KMF A;  2MLK A;  4M72 A;  2H94 A;  3REO A;  5JI6 A;  3G3Z A;  3E3V A;  2HYG D;  3U1D A;  1K78 B;  4CHU A;  4L18 B;  4OIQ F;  2ZFW A;  4HX4 A;  5L3E A;  3N4M A;  3MCZ A;  2RDP A;  2VT3 A;  1TLH B;  5FFZ A;  4MQV A;  4JBA A;  3L7W A;  4P9U A;  3HUG A;  5EEH A;  3IHU A;  4GGG A;  1A04 A;  2MD5 A;  2ESH A;  2ISY A;  3K1P A;  3ZPL A;  3DPT A;  1ONV A;  2Y75 A;  1G3S A;  4YII A;  4E70 A;  3HOS A;  4JQF A;  1XGM A;  3ROU A;  2DW4 A;  5F6F A;  4LK0 F;  1SD4 A;  2IW5 A;  2FSW A;  1V4R A;  3N97 A;  1ZHF A;  4ENM A;  3GFJ A;  2F2E A;  4EJT A;  1Z1D A;  1RIO H;  2IVM A;  1EH8 A;  4RGS A;  1IN8 A;  2OA4 A;  2L3D A;  3KFW X;  4A6E A;  1XSV A;  1IN6 A;  4GO1 A;  5E1X A;  4LB6 B;  2MH2 A;  3QU6 A;  1O3T A;  2JPB A;  3PQK A;  1NHA A;  2GA2 A;  3CTA A;  3K1N A;  3GZ5 A;  1LEB A;  4A5M A;  2QQ9 A;  3KP2 A;  4XLP F;  3RDI A;  2DFI A;  2WC2 A;  2L01 A;  3FMR A;  4K2E A;  1BI3 A;  4EJV A;  4M71 A;  4G6Q A;  2DPU A;  3TO7 A;  5H6R A;  1FWZ A;  4LJZ F;  2QEN A;  4CGZ A;  2CO5 A;  3F21 A;  2VC0 A;  4KIG A;  2FMY A;  3P9I A;  3F8M A;  2YX7 A;  3L09 A;  3GFM A;  1ZH5 A;  1TQI A;  1HW5 A;  2G7H A;  1U8R A;  1ZRC A;  1OYY A;  2IA2 A;  3WTZ A;  2PQ8 A;  4EVI A;  1J59 A;  4ENJ A;  2RVC A;  3GZ6 A;  3R6S A;  5L3D A;  4FX4 A;  1U2W A;  1X3U A;  5TRD A;  1T0F A;  4IRH A;  1VTN C;  5CLS A;  1FSE A;  3RKY A;  5JFR A;  4A5N A;  2EFP A;  2V9V A;  2GA1 A;  1ZRE A;  5LGN A;  5FFX A;  3V8J A;  4YFX F;  2GXB A;  1UFM A;  1XN7 A;  1UHM A;  2EV6 A;  3GF2 A;  1KU3 A;  3I58 A;  3IWF A;  2BEO A;  3QAH A;  2JRT A;  3BOQ A;  3HRM A;  1LNW A;  3ELK A;  4G7H F;  3HHH A;  4IRG A;  2L02 A;  4OMZ A;  4Q48 A;  4EJU A;  5JR3 A;  4EM0 B;  3CDH A;  4LD5 A;  4IXA A;  3VB2 A;  3DQV C;  3H3Z A;  2XRO A;  3J7A O;  3RYR A;  1IXC A;  2K02 A;  1B59 A;  4WWC A;  2VE9 A;  1KGS A;  4KYW A;  2VT2 A;  4HW0 A;  1JGS A;  4B8X A;  1OR7 A;  3R61 A;  1ZRF A;  2DI3 A;  1KU9 A;  2VBZ A;  2O3F A;  1GXQ A;  1Z7U A;  2XAS A;  2E1C A;  5E18 F;  5AIP A;  3TOA A;  4YG2 F;  3VEP A;  3ZN1 A;  2Z3Y A;  2Z5U A;  3WG9 A;  1HSJ A;  2W25 A;  3KZZ A;  3GYH X;  3B02 A;  2XHK A;  3H92 A;  3P9K A;  3JSP A;  3PFI A;  2DO7 A;  3H3U A;  1FP2 A;  3LA3 A;  3TKY A;  1OPC A;  5JVT A;  2W57 A;  2BYV E;  1T38 A;  3I5U A;  2FF4 A;  1IRF A;  2W84 A;  1D5V A;  4RB2 C;  3JSO A;  1MJ9 A;  1Z6R A;  2K86 A;  4G7O F;  3MFK A;  2PMU A;  4R1H A;  1XMK A;  1XGN A;  4RS8 A;  1U5T A;  2F5C A;  2UXX A;  2W24 A;  4O6J A;  4BQA A;  2PBI A;  2H6C A;  1W7P A;  4N9H A;  2EA2 A;  1R00 A;  3J80 Z;  2IA0 A;  4FT8 A;  2Z33 A;  2E1N A;  2DK8 A;  1DUX C;  2HR3 A;  2CG4 A;  5LHH A;  2VE8 A;  1XGO A;  3C1D A;  1KQ0 A;  3RTR A;  4ZZL A;  2CW0 F;  1SMY F;  2ZO4 A;  4ESF A;  1W4M A;  5ILU A;  3V8K A;  1YQA A;  4L0Y B;  1QZZ A;  3ZP5 A;  4JK1 X;  2M5W A;  2V1X A;  4G6D A;  1O3S A;  5FLX K;  2A5Y B;  2D1V A;  2RNJ A;  1YS6 A;  2EWN A;  4OU0 A;  4A0X A;  2FU4 A;  4I01 A;  3V4G A;  4GYI A;  3J80 K;  2FBI A;  4OIR F;  1DDN A;  1USS A;  3EET A;  3WTW C;  2YU3 A;  2D1H A;  3BJO A;  1CF7 A;  4U7B A;  2XIG A;  3HHG A;  4NQW A;  4BHB A;  3WTX C;  5DYM A;  4QLC U;  2EFN A;  4MGR A;  1B9M A;  1YYV A;  4A6D A;  5HS7 A;  2CQK A;  1FOK A;  1IZ1 A;  2J5O A;  4CDG A;  1ZAO A;  2XAG A;  4CYD A;  2GQQ A;  1G3W A;  5K5O A;  2NYX A;  3ULQ B;  1SD6 A;  5D6F A;  4RGR A;  2ZJ2 A;  4GYG A;  5CJ9 A;  1QZY A;  3D0S A;  2MH9 A;  3DFG A;  5ICF A;  1D3Y A;  2B0L A;  2FEZ A;  5DCM B;  4U88 A;  3M8F A;  3C7J A;  5HLH A;  3O6B B;  1F9N A;  3CUQ A;  2Y48 A;  2ZME A;  3BJ6 A;  3CJN A;  3ZMU A;  1O3R A;  1T2K A;  5HVQ C;  1R5G A;  1OKR A;  1HKQ A;  4M9S A;  5HS9 A;  4QWQ A;  1FSH A;  4KDP A;  2XV4 S;  1BM9 A;  3LAJ A;  3FM3 A;  4WXH A;  1D8J A;  3W6J B;  4CIC A;  3KCC A;  4NHJ A;  2A61 A;  4UVB A;  5ILV A;  1ON1 A;  5E1W A;  1YTY A;  1FYK A;  1UHW A;  3GUD A;  3DP7 A;  4MHG A;  4G8X A;  2JPC A;  4Q47 A;  3OV8 A;  4WF2 A;  4KNY A;  2JSC A;  4Y17 A;  3SZT A;  3C18 A;  4UV8 A;  1RUN A;  4Z2Y A;  1S29 A;  1U6G A;  1IN7 A;  2IRF G;  2WWY A;  1U5T C;  1UST A;  1Z05 A;  4MNU A;  2ZKZ A;  1FPQ A;  5TJJ A;  2ELH A;  2KKO A;  4O5V A;  3WU0 A;  2QLZ A;  4UXN A;  1H0M A;  1I6X A;  5CVR A;  2DU9 A;  1Y0U A;  2MBF A;  2V79 A;  2DAO A;  2YPR A;  2HKX A;  1V3F A;  2CWE A;  3R0A A;  1SAX A;  3P9C A;  5E17 F;  1P92 A;  1U78 A;  3SHF A;  3W6K B;  4MTE A;  4HF2 A;  2P8T A;  1KA8 A;  4D0P A;  4WK8 F;  1MDM B;  2L54 A;  1OMI A;  4UHT A;  4HQE A;  1YS7 A;  2HGC A;  4HA8 A;  4L9T A;  5HDN A;  1IN5 A;  3I59 A;  1PUE E;  4HLX A;  3WGH A;  3BP8 A;  3I53 A;  1ZGA A;  2XAH A;  4I02 A;  1FLI A;  2P5K A;  5E8G A;  3V7S A;  1LEA A;  1IXR C;  1O7L A;  2IT0 A;  3C3W A;  1J75 A;  2LNB A;  3K9T A;  1QNT A;  5HOO A;  1TQM A;  2OD5 A;  2RV8 A;  3HTU A;  2DQL A;  3WGG A;  4RB1 A;  3G73 A;  3E5U A;  2EFW A;  1J0R A;  2UZK A;  2VC1 A;  1WSU A;  4M9Z A;  1K6O A;  2HZT A;  5LEJ A;  5ICG A;  1RNL A;  3U2R A;  1E17 A;  2NNY A;  1K78 A;  2OZU A;  2FBH A;  5DD8 A;  4G9Y A;  1JXS A;  4F7Z A;  3ECO A;  2LF7 A;  1IUY A;  3FZV A;  4B09 A;  2IP2 A;  3GW2 A;  3K2Z A;  1B6A A;  5D6E A;  1SFU A;  3F6V A;  3CUQ C;  3WU1 B;  2OBP A;  2CFX A;  2C6Y A;  3WOD F;  4Y15 A;  3ERE D;  2A6H F;  2PEX A;  5L3G A;  2MLG A;  1WKM A;  2QZ8 A;  4H0E A;  2EA4 A;  4TV7 A;  4P55 A;  1YW8 A;  2QVO A;  4BHP A;  2IA1 A;  3F72 A;  1R36 A;  2EV5 A;  5CVI A;  3NEU A;  2M30 A;  1TQP A;  1K7A A;  3FXU A;  4L5J A;  2QUF A;  3BZ6 A;  1QQI A;  4ZYG A;  2PN6 A;  4S04 A;  2AS5 F;  1FX7 A;  5J6X A;  3KET A;  4KUM A;  3F8F A;  3M8E A;  4EQQ A;  1JHF A;  2RN7 A;  5BMZ A;  2BV6 A;  4I2O A;  3MEX A;  2KJB A;  4BH9 A;  4LB5 A;  2P4W A;  3T8T A;  2GIV A;  2HTJ A;  4XSX F;  3LAP A;  2V1U A;  3NRV A;  5F64 A;  5LGT A;  5E8I A;  3HRT A;  5ICE A;  4KIB A;  2O03 A;  4OMY A;  2QBY A;  2DLL A;  1QPM A;  1TW3 A;  3F8B A;  1S3J A;  4GXO A;  1JHH A;  1CGP A;  2IJL A;  4MTD A;  3O3K A;  3V7R A;  1UCR A;  1IF1 A;  1XMA A;  3R4K A;  4KT5 C;  1MJA A;  3CO7 C;  3RKW A;  5FD6 A;  2KIF A;  3IWZ A;  3RJP A;  2FRH A;  5CVU A;  2AXL A;  1R23 A;  3KZY A;  3DV8 A;  2RKH A;  1XCB A;  3JW4 A;  3TO9 A;  5D5X B;  4ETS A;  1WQ2 A;  4PCQ A;  2O0Y A;  2ETH A;  5DUK A;  1WI9 A;  4PGG A;  3HIF A;  4RAZ A;  3RPQ A;  4MEX F;  3MQ0 A;  2PG4 A;  3M7G A;  1BI2 A;  2P7C B;  5BPI A;  5K1Y A;  2KIM A;  1GXP A;  1ZYR F;  4AIH A;  2WV0 A;  4BNC A;  6PAX A;  1WWX A;  2NAZ A;  1FY7 A;  1J5Y A;  2DTR A;  3GWZ A;  2P7V B;  1FYM A;  3ZQ7 A;  2VBW A;  3WTT C;  1ZG5 A;  1RUO A;  1BBY A;  2D45 A;  1I1S A;  1K79 A;  3LA7 A;  3E6D A;  3QU3 A;  2A68 F;  4AIK A;  1FZP B;  4ZH4 F;  4YIF A;  3NQO A;  4U7D A;  3TDU C;  3GX4 X;  2PI0 A;  1ZAR A;  1TTY A;  3VFZ A;  4Q4Z F;  4UVA A;  3KLN A;  5FLX Z;  2ZCW A;  2G7U A;  4FX0 A;  1ON2 A;  1KU2 A;  3MAJ A;  5AIQ A;  3J81 K;  3KEO A;  2HDC A;  3BPX A;  2HS5 A;  3LQQ A;  3FHZ A;  2L4A A;  2CGP A;  1CF7 B;  2XGX A;  5HLG A;  3QOP A;  2VBX A;  2YSR A;  5L3B A;  2BGC A;  1SD5 A;  3I54 A;  1XGS A;  2XAQ A;  5ILS A;  5LHI A;  2QQA A;  3TOB A;  5BS6 A;  2DBB A;  3F8C A;  5ICC A;  4S05 A;  1J9I A;  4HX8 A;  5IT3 A;  2PJP A;  3ML6 A;  4DNC A;  4XBF A;  3E6C C;  1H9G A;  4L9J A;  2PLY A;  2R7D A;  4PDK A;  5LGU A;  5F1R A;  4PZJ A;  5ED4 A;  4IVN A;  3QP6 A;  1L0O C;  4DQ2 A;  2CYY A;  1MJB A;  3Q5F A;  5LEK A;  4WCG A;  4O3M A;  4HBL A;  3FF5 A;  4OIN F;  1BI1 A;  2IPQ X;  3CUQ B;  1Z91 A;  4N9I A;  1YO5 C;  1BIB A;  2EV0 A;  2HKO A;  3LA2 A;  2ZME B;  3FMS A;  1IRG A;  4I09 A;  4KN7 X;  2XKO A;  2TDX A;  1O7F A;  1EV7 A;  5LBQ A;  1LDD A;  3F3X A;  2M8E A;  4HV5 A;  3QP5 A;  1TBX A;  3BPV A;  3HOT A;  2VOO A;  2GXG A;  1TNS A;  4EV0 A;  1PDN C;  4GCV A;  3EYI A;  5IT9 K;  3FMQ A;  1E2X A;  3IKV A;  5CYV A;  3WE3 A;  4NB5 A;  4R79 A;  4LLG F;  5CVV A;  2LKP A;  5D8L B;  3GO5 A;  1S8N A;  3JTG A;  1F5T A;  5DCF A;  1P6R A;  3E5X A;  1BC8 C;  2FML A;  5FGM A;  3P7N A;  2A69 F;  1XSD A;  4FHT A;  1STZ A;  2XRN A;  2K7L A;  1HST A;  4RAY A;  2F5E A;  3IL2 A;  1XCV A;  1AOY A;  5EEG A;  3ABU A;  1P2F A;  2V6C A;  2Z99 A;  3ECH A;  4BHC A;  2FQ3 A;  3IC7 A;  3QRF F;  1R1U A;  2XVC A;  2FBK A;  2VXZ A;  2P5L C;  2HEO A;  4LG0 B;  1DP7 P;  2R7F A;  2FE3 A;  2V1D A;  5E20 A;  3V7C A;  2O8X A;  3RIR A;  4BYY A;  3SFZ A;  3RI4 A;  1O57 A;  4ESJ A;  1DPR A;  3L00 A;  3R0J A;  3ABT A;  3WTV C;  1R1T A;  1I5Z A;  3ZMZ A;  4PGH A;  4IHT A;  4XRF A;  3LFK A;  5HDK A;  2MA3 A;  1R1V A;  1XDU A;  3K0L A;  3I59 B;  5BOX A;  4EM1 A;  3GXO A;  2STT A;  1HW1 A;  3KLO A;  2HQN A;  2HOE A;  5DEQ A;  1XSX A;  4ZYH A;  4LK1 F;  3FXQ A;  3F8N A;  2FXA A;  1FC3 A;  3T0Y A;  4HF0 A;  3L9F A;  3SZP A;  2FNP A;  2E7W A;  3EDP A;  3EQL F;  4YFK F;  4IPA A;  2WTE A;  4A0Z A;  5FD5 A;  5BPD A;  2ACJ A;  3RKX A;  4R8H A;  4XSZ F;  1R5H A;  3Q9V A;  1DPU A;  4LLL A;  1KYW A;  4IJA A;  4M73 A;  4U0Y A;  2H27 A;  3S2W A;  1SMT A;  2E7X A;  2LDU A;  1IAW A;  4UV9 A;  5E1Z B;  3L2C A;  2ADU A;  2P6S A;  5A2Q Z;  4KFC A;  4HX7 A;  1F1Z A;  1RI7 A;  3IRQ A;  1HXD A;  1LVA A;  2GZW A;  3LST A;  2M45 A;  3HYI A;  2DQR A;  1FT9 A;  3WTY C;  1J2X A;  5DD4 A;  1H9T A;  4RB0 A;  3VOD A;  3U9G A;  2OQR A;  1EH6 A;  3COA C;  4HDU A;  1O3Q A;  2G9W A;  1W5T A;  3RYP A;  1XDS A;  4EGZ A;  3MZY A;  3ZMV A;  5BQT A;  2A07 F;  2X4H A;  3WTU C;  1HQC A;  2XUB A;  1XB4 A;  4OIP F;  5A2Q K;  4BXU A;  5H20 A;  1MDM A;  1P4W A;  4HV6 A;  3RPU A;  2ESN A;  2FA5 A;  1MKM A;  4P96 A;  3FXR A;  4MEY F;  5J8F A;  3FWE A;  1D8K A;  4KA4 A;  4LGW A;  3F23 A;  1ZG1 A;  1Q1H A;  2Y0M A;  4EGY A;  1TW2 A;  3T1B A;  2QBY B;  3WE2 A;  1MD0 A;  1QO0 D;  2FNA A;  3WGI A;  2HTS A;  3T8R A;  3ZMT A;  1TNT A;  1OYI A;  2Z9O A;  2EK5 A;  4CXF A;  2NNN A;  2CSO A;  3I4P A;  2A6E F;  2ISZ A;  3HSR A;  3GEZ A;  2P5V A;  5D4S A;  2QQB A;  1LJ9 A;  3HTS B;  4A12 A;  4M6X A;  4HYE A;  4ZZD A;  3I0T A;  1W7P D;  1R7J A;  3QPT A;  1LDJ A;  4P5O A;  1T6S A;  2J5P A;  1FP1 D;  3TQN A;  2VOP A;  2STW A;  3GFL A;  3VOE A;  4I7H A;  1HBX G;  2RGV A;  4L9V A;  1GHC A;  5DV5 A;  4OOI A;  2FOK A;  4EM2 A;  2JT1 A;  3LWF A;  3ZMD A;  1R58 A;  2Q0O A;  3IRR A;  1FYL A;  4WX9 A;  4ENK A;  4HZF A;  3HRS A;  1BJA A;  4EJW A;  3T5X A;  3SQN A;  5K5R A;  4LMY A;  2O6G E;  2K27 A;  4A2U A;  3KP5 A;  1FNN A;  5D4R A;  1R22 A;  4Y13 A;  2ZNY A;  5HLI A;  1KU7 A;  1B9N A;  5AON A;  4G94 A;  1SFX A;  4ASN A;  3ZMS A;  1IW7 F;  1FBQ A;  3E97 A;  4ESB A;  4L0Z B;  4AVP A;  2NRA C;  1G3T A;  1Z6T A;  1BC7 C;  5FB2 A;  2PMH A;  1YIO A;  3O2P E;  1U5T B;  2W85 A;  3MZH A;  1SFE A;  3ZN0 A;  5D5U B;  3DKW A;  2OZ6 A;  3D5L A;  3M1E A;  4IHS A;  2HFH A;  1W7P B;  4I0A A;  2QYO A;  3Q9S A;  3J81 Z;  1FBU A;  2BBY A;  2KJC A;  3GVA A;  1SD7 A;  3E6M A;  4I98 B;  4ENN A;  5LRS A;  3TGN A;  1ZG3 A;  2Q8K A;  1FBS A;  5HS8 A;  1KQ8 A;  5DUI A;  1MZB A;  4CO8 A;  5LRR A;  4BAY A;  2K4J A;  2GAU A;  4YFN F;  2QM3 A;  1KYZ A;  1QBJ A;  3EUH A;  5CVJ A;  3KP4 A;  1GVJ A;  4KN4 X;  3E5Q A;  2HQR A;  1LB2 A;  4AD9 A;  1RZ4 A;  1W5S A;  2X0L A;  3DXJ F;  4AIJ A;  4AWX B;  5D5W B;  1LQ1 A;  5JHU A;  4HQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...