1T2KA

Structure of the dna binding domains of irf3, atf-2 and jun bound to dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
110
Chain Sequence
TPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ATF-2/c-Jun and IRF-3 bound to the interferon-beta enhancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords 31-MER
total genus 27
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t2kA01
3GYHX 2KKOA 3E3VA 4RB3C 2TDXA 3CO7C 4A6DA 3KP4A 3ECHA 4MNUA 1SD4A 3I5UA 2M5WA 2O3FA 1FBSA 3JAMZ 3SZPA 4HQMA 2RC4A 2ACJA 3GZ6A 3TO6A 5H20A 1R00A 1WKMA 2DAOA 4EM0B 5HS7A 4A0YA 4OOIA 4G94A 3M1EA 1P4AA 4KN4X 5LLQA 4ASNA 5K5QA 1IXRC 2J5OA 4HA8A 4LLLA 4R79A 1WQ2A 3GWZA 4M9SA 1A04A 4KIGA 3FWEA 3WU1B 4G7HF 4IHTA 2ESNA 4CDGA 2PQ8A 4G8XA 2ZNZA 2HGCA 1R5HA 3W6KB 3FHZA 4BHBA 4ZYHA 4WK8F 3ZQ7A 5LGTA 1ZN2A 2JTVA 2YSRA 3CUOA 1YS7A 2X4HA 2EFPA 2VBXA 2XRNA 4HYEA 3JTGA 3F8NA 1USTA 2L54A 1LEAA 5L3EA 4YIIA 2MC3A 1PP8F 1GXPA 1B9NA 5DEQA 3IKVA 1ZARA 4LG0B 2UXNA 2COMA 4WX9A 4JBAA 2M1BA 3ERED 1SD5A 4I09A 4KA4A 1HKTA 2DBBA 3KETA 3P9CA 3TDUC 3E6CC 3E6BA 4GXOA 4GYGA 1E17A 5HDNA 1I1SA 5F1RA 3IL2A 4KN7X 2OD5A 2A69F 2OQGA 3ABTA 4HF0A 4A5MA 5HS9A 2EV0A 2QQAA 4Y15A 1XSDA 2IT0A 2PEXA 2KRFA 4OU0A 1HBXG 1YTYA 1J5YA 3RYPA 3F6VA 2ZCWA 4ENJA 4EGYA 1OYYA 3VB2A 5E17F 1O57A 1BI2A 1KU9A 1YFHA 4A2UA 4ZZLA 4EJTA 3O3KA 3DV8A 1RUOA 4A6EA 2EK5A 2X0LA 1VTNC 1IRGA 3QP5A 2QYOA 2RVCA 2FEZA 5FLXZ 1AWCA 2QUFA 2HDCA 1UHWA 2VC0A 3GO5A 2ZMEB 3LAJA 3C7JA 1D8JA 3FMRA 4YFKF 1PDNC 3WTSC 3F8FA 5BOXA 3GFMA 5DV5A 1GXQA 2EB7A 2CFXA 3I53A 1I5ZA 2DPDA 2XROA 2NNYA 2A6HF 2Z99A 1QPMA 2GA2A 5ICEA 3IRQA 1F9NA 2D1VA 4IRGA 3SQNA 3HSRA 2UZKA 4IPAA 2FQ3A 4PCQA 2YX4A 5DUIA 5HLGA 2CGPA 4M72A 3SXYA 4D0PA 2FMLA 4ZH4F 4BHCA 1MZBA 5BS6A 3IC7A 2PMHA 5ILUA 2D1HA 4KICA 1U78A 3CTAA 2HKOA 1USSA 1FYKA 3QPTA 1G3WA 2A07F 2M8EA 5FFXA 2VE9A 3LAPA 1CGPA 2H09A 2W25A 3KP3A 2VC1A 4P9UA 3EYIA 1MD0A 2Y0MA 1REPC 2FMYA 2MLKA 1L3LA 2B0LA 3ZMSA 2LKPA 1RUNA 3MZYA 4U88A 3DXJF 1FP2A 2QENA 1R23A 1YG2A 2STWA 2P5KA 1QGPA 4IF4A 2VBYA 1BC7C 2Q8KA 4I01A 2YX7A 2CO5A 2Z3YA 1BI1A 1YW7A 2Z33A 1Z05A 4OIPF 4M6YA 4AVPA 3J7AO 4IJAA 1J0RA 5HDKA 1XCBA 2HYFA 3LA2A 4RAYA 3HRMA 4OMYA 4A0ZA 5E20A 2FOKA 1HW1A 2MD5A 2HS5A 1DDNA 4LG0A 5LGUA 5DCMA 4ESJA 1DUXC 1T0FA 5KK1A 1TBXA 1IN7A 2EFQA 2J5PA 3H3ZA 5ICCA 5EEGA 2CSOA 1FZPB 4O3MA 2XKOA 5FGMA 4WCGA 2H27A 2BBYA 1HW5A 5IT3A 2QVOA 2QZ8A 1Z9CA 1J2XA 5FO5A 2CYYA 3BJAA 1AOYA 2OA4A 2RQPA 5LHGA 3BZ6A 3LA3A 1B6AA 4HW0A 3GW2A 3V4GA 1KQ8A 4LB5A 2AXLA 3ZPLA 1W7PD 1LQ1A 4WWCA 1U5TA 3GVAA 4IHSA 1B9MA 3K9TA 2VOPA 4ESBA 2GIVA 4GGGA 3V8LA 5HVQC 3F8BA 4YG2F 1C0WA 2HOEA 4UUVA 2XAJA 3TO7A 4RB0A 4HDVA 4RB1A 4WXCA 2IA0A 2FNPA 3TDZC 1BJAA 2EA2A 4GCVA 3WTVC 3BP8A 3GEZA 1ZRDA 3JSOA 5E1XA 4Y17A 3RI4A 1R1VA 1G3TA 1RZ4A 1S7OA 4UVBA 5H6RA 1XSXA 4ZYEA 3HUGA 1OYWA 1UHMA 5ERIA 1LDDA 3KLOA 2FXAA 4YIFA 3GUDA 1O3TA 2VT3A 1UB9A 2ESHA 5L3FA 4A5NA 2P4WA 2F5FA 2KIMA 5BMZA 2PFBA 1EH7A 1LNWA 2XKPA 2FRHA 1TW3A 2ZO4A 3CUQB 4JQFA 2XVCA 3BWGA 3NEUA 4LLNA 4KFCA 2HYGD 3U1DA 3B73A 1FC3A 1W4MA 2NAZA 3SZTA 3KZZA 3F23A 3KP2A 1KU2A 1QBJA 3I58A 3IWFA 3BPXA 2F5DA 3WU0A 2ISYA 1R58A 5AONA 4GYIA 3V8KA 1XN7A 2K27A 2LF7A 3S2WA 1QQIA 4EVIA 3VODA 2K02A 1Z7UA 2M30A 2G7UA 3BPVA 1ZGJA 1RNLA 5FFZA 4MTDA 1YYVA 5DD4A 2O0YA 4QLCU 3T8TA 2Q2EA 2QBYB 3E97A 1G3SA 1LDKB 5L3DA 3MAJA 1ON1A 2OQRA 2QWWA 2P6SA 2PG4A 5CVUA 4CYDA 1SMTA 3H3UA 1BI3A 3K69A 1P4XA 2MLGA 1F4KA 1J59A 4AIKA 2E7XA 2G9WA 1MJ9A 6PAXA 5L3GA 2G7HA 3U2RA 5IT9Z 1JHHA 4UVCA 2MH2A 3CUQC 2O61A 1I27A 1IZ1A 1ZG3A 4BH9A 4H0EA 4AIJA 4I0BA 3KEOA 5DCMB 1LEBA 4P96A 3DF8A 3J80Z 3F6OA 4LGWA 2IW5A 4ESFA 1KU3A 3REOA 5KVRA 1GHCA 3M8FA 1I6XA 3FF5A 3QRFF 1WRJA 4MTEA 5D8LB 4BQAA 1JHFA 2EJRA 2GA1A 3N4MA 5DDGA 1KGSA 4KMFA 4ENNA 5D8KB 1RI7A 3K2ZA 1T2KA 3C3WA 2WWYA 2M87A 5CYVA 1TQPA 2DQLA 3WG9A 1BC8C 2VONA 2OBPA 4I02A 4Q5SF 3KCCA 4LFUA 3K0LA 4XSXF 1T38A 1D3YA 2XUBA 2DK8A 1U8RA 2ZKZA 2IRFG 4ENMA 2UXXA 2AS5F 1FP1D 3EDPA 2Y48A 3D5LA 2RGVA 1O3SA 2A5YB 3TO9A 1IN6A 2FA5A 3HIFA 1TNSA 2EV6A 2P6TA 3V7RA 1O7LA 4LD5A 2DW4A 1BOAA 1ON2A 2IVMA 1IXSB 4LK0F 2NRAC 3J80K 1ZRCA 2H94A 3P9IA 1HXDA 5HLIA 2IPQX 5BQTA 4A12A 3JSPA 4EQQA 2STTA 5JFRA 3H92A 3E6DA 1CF7A 4HDUA 5IT9K 4HV6A 4M71A 2JSCA 4PGGA 5A2QZ 1DP7P 2WTEA 1YS6A 1HW2A 1MJAA 1IXCA 1Z1DA 2CG4A 5DD8A 3FXUA 3R6SA 2W24A 1K78A 4Q47A 2XASA 3VEPA 1WWXA 4AWXB 5E1ZB 2FBHA 4L18B 5J8FA 4KT5C 1Z6TA 1P92A 1Z91A 2ZMEA 3LQRA 3WGIA 3WGHA 1U3EM 3FMSA 3HSEA 5D5UB 3DPLC 3ZN1A 4EGZA 4OIOF 3PQKA 2PN6A 4S04A 1TQIA 3WTXC 4IXAA 4Q4ZF 3GX4X 5DCFA 2GQQA 5DYMA 4BAYA 1TNTA 1ZYRF 4F7ZA 3F21A 3RPUA 2Z9OA 3FXQA 3MCZA 3GF2A 1JGSA 2HTSA 2A3SA 5LEKA 4MHGA 3R0AA 3ZP5A 3RKYA 5J8CA 3KZYA 4PGHA 1T98A 3ECOA 1BM9A 3IWZA 4DQ2A 4G9YA 4HX8A 1B59A 2L3DA 3RIRA 1GVJA 1P2FA 1TLHB 5D4SA 5TJJA 1HKSA 3LFKA 1X3UA 3RKXA 2Z5UA 1S7AA 2ZNYA 3EQLF 3LA7A 3L09A 1B1BA 2E7WA 5CLSA 2LDUA 4EJOA 4M6XA 3K1MA 2EV5A 2KIUA 3HHHA 3ISPA 1S6LA 2NS0A 2F5CA 2Q0OA 3KEQA 4UHTA 3QPHA 2P5LC 2BYVE 2QLZA 2E1NA 1XDUA 3FMQA 2EA4A 1SFUA 5BPIA 5D6EA 2JZYA 4G6QA 3GXOA 2ETHA 4I2OA 1Z6RA 1XGMA 5J6XA 2DO7A 3L7WA 3I54A 2K4BA 2E1CA 2V1DA 2M45A 1YQAA 1F1ZA 4KDPA 3CDHA 4LJZF 2YPRA 4CHUA 3AAFA 3MWMA 3WTWC 1IN8A 4EMSA 5D4RA 4HF2A 2R3SA 4Q48A 4B8XA 1FT9A 1F5TA 2DPUA 4FT8A 4HOBA 5EEHA 4OIQF 1SFEA 2XIGA 3I0TA 2BGCA 3P7NA 3SFZA 4HF1A 1OPCA 5D6FA 4XBFA 4RS8A 4M73A 3EUHA 4M9ZA 3SHFA 3WTUC 1G4DA 2VT2A 2V1UA 1L0OC 1EH8A 3F3XA 1FWZA 3DFGA 3HRTA 4I0AA 4FHTA 3WGGA 3WTYC 4KUMA 1FNNA 4L5IA 1TQMA 4O6JA 3FM5A 3WTZA 3JW4A 3M8EA 4MQ9F 3O2PE 1LDJA 4GO1A 2LF8A 2RKHA 4TV7A 1P6RA 3TKYA 1FYLA 3TOBA 1ONVA 1V4RA 5CVIA 3U9GA 4U0WA 1KYZA 1KA8A 4ON0A 3GLXA 4UV8A 1BN5A 4LMYA 4YFNF 2XAHA 2PBIA 1D8KA 1G3YA 2A61A 4IRIA 2JRTA 2K4JA 3ZMZA 2HZTA 2V79A 2W85A 3F22A 3M7GA 2ISZA 4N9HA 3MQ0A 3HRSA 4HBLA 1XMKA 5JVTA 2KIFA 3KLNA 2DI3A 1JE8A 2MA3A 3HRUA 2VXZA 3BOQA 2V9VA 3I4PA 3ROUA 2HQNA 4RGXA 4R1HA 2EFWA 1UFMA 2DFIA 3HTUA 1IUYA 1K7AA 4NHJA 4EM1A 3LSTA 1ZAOA 1FYMA 3IKTA 2HKXA 1R1TA 4XLPF 3HTSB 4XLNF 1SD7A 2H6BA 4RGRA 4BHPA 2JPCA 1E2XA 4CZZA 5K1YA 3M9AA 4U0YA 1ZG1A 4KIBA 1FSHA 4PDKA 2QQ9A 1R1UA 4XRFA 2OAZA 1XGNA 3KFWX 1ZHFA 2FBIA 1HSTA 3D0SA 4KMUX 3RKWA 2XAFA 5A2QK 1OR7A 2F2EA 1K78B 1KQ9A 1YW8A 1U5TB 3COAC 3B02A 2EWNA 2DTRA 1YLFA 1Q1HA 1W5TA 4MQVA 1KYWA 3ZMUA 2K7LA 3L9FA 1O7FA 3R60A 4NQWA 2RNJA 2IJLA 2HWVA 3BJOA 4L0YB 2ADUA 3TQNA 2QBYA 2CWEA 2HFHA 4G6DA 2L4AA 3RJPA 2BE5F 4HAMA 4N0BA 5FLXK 4KIFA 2O03A 3ZMVA 3KP7A 1ZLJA 4YFXF 1LJ9A 1P4WA 3E6MA 3T0YA 2L02A 3GFJA 2ZFWA 2Y75A 4I7HA 2YR2A 4CICA 4B09A 2DK5A 3OOPA 4UNOA 2ZBKA 4LLGF 3HOTA 2UWMA 4PZJA 3FZVA 3ML6A 4HV5A 5CVVA 2EFOA 5ILVA 2W57A 5L3BA 4Y13A 1UCRA 3DPTA 4UVAA 1LB2A 4MGRA 3T5XA 3VFZA 3DQVC 3I59B 3C18A 1XDSA 1T39A 3RYRA 3E5UA 5LGNA 4G7OF 2VBWA 4RAZA 2GZWA 2RN7A 1ULYA 4L9NA 1B4AA 5JHUA 3O6BB 4OIRF 3G3ZA 1S8NA 2GAUA 2D45A 1XGSA 1J9IA 1XD7A 2IA2A 3MEXA 4FX0A 3RPQA 2C6YA 2IA1A 2PI0A 2LSOA 5ICGA 3WE3A 1ZLKA 1HSJA 5ICFA 2VOOA 2F5EA 2XV4S 4P55A 1QZYA 2OU2A 3J81Z 1KQ0A 2XAGA 3I71A 1ZGAA 4HZFA 2CQKA 2VODA 5E8GA 1EH6A 3R0JA 4EJVA 1DPUA 1LVAA 3BDDA 4M74A 2BV6A 3KE2A 3BJ6A 4L9TA 2CW0F 4HQEA 2L4MA 2FF4A 2O8XA 2OZ6A 3F8CA 3ULQB 4BYYA 3MFKA 2HEOA 4ETSA 3JAMK 3K1NA 4R8HA 5JI6A 3BROA 3QP6A 1KU7A 5LRSA 4U7DA 2PLYA 5K5OA 5CVRA 3GZ5A 2R7DA 5CVJA 1XSVA 1PUEE 1XMAA 5FB2A 4E70A 4L9VA 3Q9SA 1BBYA 3T1BA 1ZG5A 1H9TA 4KNYA 3TOAA 1JXSA 4KYWA 5FD5A 3EETA 3WE2A 1DPRA 3ZMDA 3GFIA 1EV7A 4LK1F 2RV8A 4IRHA 2IP2A 2D2WA 1BI0A 4RGSA 3PQJA 5D5VB 4L0ZB 3EYYA 3V8JA 2DT5A 1O3RA 1MJBA 2XHKA 4U0VA 1YO5C 2PJPA 3ELKA 1IW7F 1R7JA 1FPQA 4ENKA 5BPDA 1R36A 1MDMB 1ZRFA 5HLHA 4WXDA 2K86A 1ZH5A 1ODDA 3J81K 4ZZDA 1WSUA 1W7PB 4JK1X 4WF2A 2GXBA 1TW2A 2P5VA 1T6SA 4M9XA 2KJBA 4O5VA 3ZN0A 2XAQA 2EFNA 3HYIA 1D5VA 5E18F 1I1GA 1Y0UA 3V7SA 3BY6A 4RB2C 1FX7A 5LRRA 2GXGA 2QM3A 3V7CA 5D5WB 1OYIA 5K5RA 3QOPA 3CJNA 3TGNA 3VOEA 1IN5A 3IRRA 1WI9A 1IF1A 1W7PA 2P7CB 3CUQA 1U6GA 2XGXA 3QU6A 1FOKA 5LBQA 4EJUA 4HLYA 2FNAA 5AIPA 1CF7B 2WC2A 3G73A 1FBQA 3K1PA 2O6GE 1ZREA 4HX7A 1K6OA 4CGZA 1MDMA 3KP5A 2HR3A 1S3JA 2DQRA 3P9KA 1V3FA 1OMIA 2MBFA 4QWQA 3LQQA 1IAWA 2ZJ2A 5LHHA 3CLOA 1FY7A 3L2CA 2HQRA 4Z2YA 1YIOA 3NQOA 4AD9A 2PMUA 3RTRA 3GFLA 5HDGA 4L5JA 2R7FA 1J75A 4OINF 3JTHA 4LB6B 2KJCA 4AIHA 4ZYGA 1SMYF 3MZHA 1QZZA 4UV9A 1PP7U 5E1WA 2VN2A 1H0MA 2LNBA 2QQBA 1STZA 4XSZF 4MEXF 2P7VB 3Q9VA 3E5QA 4EV0A 1BIAA 2H6CA 4EJWA 4DNCA 3ABUA 5ED4A 2MH9A 5HS8A 1FLIA 2A68F 5DUKA 5H6QA 1K79A 1FSEA 1O3QA 1R5GA 5F64A 2NYXA 3HSFA 1J7KA 1HQCA 1H9GA 3ZMTA 5AIQA 1RIOH 4OMZA 1W5SA 2FU4A 3Q5FA 3IHUA 1XGOA 4G7ZF 3F72A 2W84A 3QAHA 4S05A 4MEYF 1R22A 4NB5A 1U2WA 1MKMA 2A6EF 2ELHA 4L9JA 5D5XB 3HHGA 1QNTA 5JR3A 2HTJA 3DEUA 3WTTC 1OKRA 3OV8A 2GWRA 3L00A 3QU3A 1IRFA 4BNCA 2JT1A 2V6CA 2YU3A 2JPBA 3N97A 2OZUA 3R61A 4I98B 4IVNA 4RGUA 2RDPA 5LEJA 1BIBA 4CO8A 1S29A 3DKWA 2DLLA 1SFXA 2V1XA 4P5OA 4WXHA 2DU9A 2VBZA 4UXNA 1G6NA 2WV0A 3FX3A 1TTYA 4BXUA 3DP7A 3FM3A 3W6JB 4U7BA 1QO0D 1XCVA 2FSWA 5CJ9A 2L01A 2VE8A 1MGTA 1YW9A 4P9FA 4EM2A 3WODF 4K2EA 1U5TC 3LWFA 1NHAA 3I59A 1FBUA 5HOOA 2BEOA 3I64A 3RDIA 3E5XA 3FXRA 5ILSA 3KP6A 3NRVA 3T8RA 5FD6A 2FBKA 1XB4A 4ZYDA 2P8TA 1SAXA 3F8MA 2NNNA 3PFIA 4N9IA 4CXFA 2ZXJA 4HX4A 1IN4A 3C1DA 4HLXA 5E8IA 5F6FA 4FX4A 5TRDA 3HOSA 3R4KA 2FE3A 1SD6A 1HKQA 3CO6C 5LHIA 4A0XA 5L3CA
chains in the Genus database with same CATH superfamily
4GFBA 1E3PA 3PUFA 1NK3P 3GYHX 1IDYA 1ZK8A 2JA2A 2KKOA 2CUFA 2K9NA 3E3VA 3AG1H 2YUSA 2ZXIA 4RB3C 3BLYA 2TDXA 3CO7C 3G71I 2IAIA 4A6DA 3KP4A 1TWCJ 3ECHA 5IYCJ 3OSGA 5CQGA 4MNUA 3LL7A 4X6AJ 1SD4A 3I5UA 2H1KA 4CCMA 3HGYA 2LLKA 2M5WA 1MIJA 2ZXHA 3OMYA 3RCOA 2O3FA 4BU2A 1V5EA 3ZXSA 1FBSA 5KAFC 3JAMZ 2A05A 3SZPA 4HQMA 2R4GA 2RC4A 3K4CA 2ACJA 2DMUA 3GZ6A 2PX9A 2FX0A 3TO6A 5H20A 3GTKJ 1R00A 1WKMA 2DAOA 1SVOA 4EM0B 5HS7A 4A0YA 4Y7NJ 1BR4A 4OOIA 4G94A 5FLVA 3M1EA 1VQ8I 3PFYA 1P4AA 1VQ5I 4KN4X 2X48A 1R5ID 1OCOH 3TMOA 4AVZA 4ASNA 5LLQA 1K4SA 3JRIA 5K5QA 3OYLA 2OTJI 1IXRC 2J5OA 4HA8A 4LLLA 4R79A 1WQ2A 3GWZA 4M9SA 3GTGJ 2R5ZB 1A04A 2HQAA 4KIGA 3FWEA 3WU1B 4G7HF 4IHTA 2E71A 4DGWB 2ESNA 4CDGA 2PQ8A 4G8XA 4M3GA 2XB5A 2ZNZA 3JREA 2HGCA 4UB6C 1I50J 1OISA 3J7YJ 1F36A 1R5HA 3W6KB 3FHZA 4BHBA 3QWLA 5J1UA 2VJ4A 3K4MA 4RM3A 4ZYHA 1S72I 4MO7A 4WK8F 2XSDC 3ZQ7A 1UHSA 3DU6A 2XB0X 5DTDA 5LGTA 3W2VA 1X3WB 3MMYB 1ZN2A 2JTVA 3FXOA 3LSMA 2YSRA 3CUOA 1LFPA 1YS7A 2X4HA 2EFPA 2VBXA 3OYCA 3BCAA 2XRNA 4HYEA 3JTGA 3F8NA 1USTA 4LOCA 3PIPF 2L54A 1B72B 3OIOA 1LE8A 1ETOA 1LEAA 5L3EA 3CD6I 4IOAF 4YIIA 3HL2A 4UY8I 2MC3A 2A5WA 3TP0A 1PP8F 1B8IA 1XPXA 5J1RA 1IRXA 2GLOA 3CZ6A 1N25A 4CYCA 1GXPA 1B9NA 3GTQJ 2I8DA 5DEQA 3IKVA 1ZARA 1TWGJ 1TZLA 4DBRA 2HPMA 4BJTA 4LG0B 2UXNA 2COMA 4E7ZA 3S17J 4WX9A 2OJED 4UUSB 4JBAA 2M1BA 3ERED 1SD5A 4I09A 4KA4A 1HKTA 2MFZA 3TP3A 2XF6A 3SEZA 2DBBA 3KETA 3P9CA 3TDUC 3LSRA 2COBA 1YIJI 2L2OA 3E6CC 3E6BA 4GXOA 4GYGA 1E17A 3BG3A 2O8KA 5HDNA 1I1SA 5F1RA 1JT6A 3IL2A 1M1EB 2IXSA 3DBHB 4KN7X 4CSWA 2B7EA 2OD5A 5M3MJ 2A69F 2X85A 2CRGA 2OQGA 3ABTA 4HF0A 4A5MA 2M34A 1T95A 4PUSA 2QA4I 2BOLA 4G6TB 5HS9A 2EV0A 2QQAA 4Y15A 4Y4RA 1XSDA 1Y6IA 2IT0A 2PEXA 2X51A 1T8IA 3BG9A 1UAAA 2KRFA 1B8IB 5EG0A 4OU0A 1HBXG 1YTYA 1J5YA 3RYPA 3ZQFA 5GPAA 2QSHX 2W1OA 3F6VA 2ZCWA 4ENJA 2AQEA 3CMMA 4RLFA 4EGYA 3CCJI 1POGA 1OYYA 3VB2A 4PFPA 4XL9A 1WVRA 5E17F 2M0MA 2NVYJ 1O57A 1BI2A 1VZ0A 3GMEA 1KU9A 2CW7A 1YFHA 3GTLJ 4A2UA 4ZZLA 3M07A 4EJTA 3O3KA 3BTJA 3DV8A 1RUOA 4B4CA 2XRLA 4A6EA 2EK5A 2F4OB 1W36C 2X0LA 4MLOA 4C2UA 3O8GA 3RKQA 1OR7C 3S8PA 1JKQC 2DT6A 3U21A 2L9RA 1VTNC 3BQYA 1IRGA 3QP5A 4HNUA 2QYOA 2RVCA 3GTMJ 3UKGA 2FEZA 1TL8A 5FLXZ 1BOBA 1W1WE 3OYIA 3OYDA 1MH3A 2QUFA 1AWCA 3A1YA 2HDCA 1UHWA 2VC0A 3GO5A 2LY2A 2ZMEB 1O4XA 3LAJA 3C7JA 4JOMA 2UV1A 2NVUB 2MG4A 1D8JA 3RPUD 4C3IJ 2R7RA 1D1CA 3ONQA 3FXMA 4AC0A 4B43A 3FMRA 4YFKF 1PDNC 4NC8A 3WTSC 3F8FA 2ZJRF 5BOXA 3GFMA 2FOWA 5DV5A 2GBYA 1GXQA 3G4SI 2EB7A 1R4MB 2CFXA 3I53A 3PNYA 1I5ZA 5E79C 3A0HC 5F0CA 4E7LA 2DPDA 3QPSA 2HOTA 2XROA 4E7SA 2E5ZA 2LC2A 2NNYA 4W97A 2HVSA 2A6HF 2X6YA 2Z99A 1QPMA 2GA2A 5ICEA 1JKOC 1IGNA 3IRQA 1F9NA 2D1VA 2VJJA 2Y0SA 4HSTA 4IKFA 4IRGA 4BUPA 3SQNA 3HSRA 2DDAA 2UZKA 2OCCH 4IPAA 2FQ3A 4PCQA 2ZJPF 1JGGA 4BJ6C 2YX4A 5DUIA 5HLGA 1J09A 4M72A 2CGPA 3SXYA 2MABA 4D0PA 2QGUA 2FMLA 4ZH4F 5FROA 3HEFA 4BHCA 2L7MP 3PUBA 4E7IA 1MZBA 5BS6A 3IC7A 2PMHA 3W3CA 3TW6A 5ILUA 3PO3J 4A3BJ 3NWSA 2D1HA 4KICA 1U78A 3PSIA 3CTAA 2HKOA 1USSA 1RESA 3ZQIA 3LSJA 4NUBA 1R6RA 1FYKA 3QPTA 3H5AA 3CCEI 5E3LA 1G3WA 2A07F 2M8EA 1RETA 5FFXA 2VE9A 1VQ7I 1I39A 2QSFX 1Y39A 3LAPA 3CCRI 3ERMA 1CGPA 2H09A 2W25A 3KP3A 2VC1A 4P9UA 3DBLB 2Y0MA 1MD0A 3EYIA 1REPC 2FMYA 3A0BC 3KPHA 2MLKA 2XGCA 1L3LA 2B0LA 3ZMSA 5DM6F 5FRNA 2LKPA 1RUNA 1VQOI 3MZYA 4U88A 3NAUA 1FOYA 3VYRB 3DXJF 2P0WA 3H9JA 2RAEA 1FP2A 2QENA 5LFAA 5FKLA 1R23A 1YG2A 2R7SA 1HA8A 2STWA 4A3GJ 2P5KA 4IQ4A 2E35A 1QGPA 4IF4A 4YELA 1TP4A 2OCEA 2VBYA 5EG0B 4RA2A 3PSFA 1BC7C 2V1NA 2Q8KA 4I01A 2YX7A 4F92B 1WJDA 2OTLI 2CO5A 2WV1A 3SDGA 2Z3YA 3DTKA 3OS0A 1BI1A 1YW7A 2CQQA 3ASOH 3BG5A 1Z67A 2Z33A 3MZ8A 3OYAA 3QYFA 1Z05A 4OIPF 4M6YA 4PJNA 3FK7A 1U0JA 4B3AA 4AVPA 4D9JA 2WAEA 4DZPA 4F52A 2DOAA 3J7AO 5IYDJ 2E19A 4IJAA 1J0RA 4NC6A 5HDKA 1XCBA 2HYFA 3LA2A 1DQUA 4HRIA 1BW6A 4RAYA 3A01B 3HRMA 4OMYA 1D1BA 4A0ZA 1WJBA 2FOKA 1HW1A 2FJ1A 3QPLA 5E20A 2MD5A 2HS5A 1DDNA 3ZGKA 1OCTC 5FKNA 4LG0A 5J3LA 5LGUA 1BA5A 3HG9A 2XF7A 5K7HA 3Q3SA 2JJ7A 4Y33A 1K83J 3HOYJ 3M8JA 2AXTC 5DCMA 1I6HJ 4ESJA 1DUXC 2R5ZA 1T0FA 5KK1A 2DOFA 1TBXA 4XRMA 1IN7A 2EFQA 2J5PA 3H3ZA 5ICCA 4LIVA 2E36A 3CP8A 3LNQA 5EEGA 2CSOA 5LD2C 1FZPB 4C9YA 2VQCA 4O3MA 1OCPA 2XKOA 4I99C 3DPUA 5FGMA 4WCGA 2K40A 2NVQJ 2BBYA 2H27A 3AKZA 1HW5A 5IT3A 2L9NA 1ETXA 5HNFA 1DU6A 2QVOA 2QZ8A 1Z9CA 1J2XA 5FO5A 2CYYA 3BJAA 1AOYA 2DA6A 2OA4A 3K4JA 1YI2I 2RQPA 5LHGA 3L2RA 3BZ6A 2JA7J 3LA3A 2LY1A 2CV2A 2IEKA 1B6AA 3W2WA 4HW0A 1A35A 2X6WA 3GW2A 5B1AH 1ZGWA 3V4GA 1KQ8A 4LB5A 2XAUA 2AXLA 2DA5A 3KYDB 2L7ZA 2CQ7A 3ZPLA 5JLWA 2JMWA 1CQTA 2CV0A 1W7PD 1QPIA 1LQ1A 4WWCA 4B44A 4HNTA 2LKXA 4FTHA 3CDIA 4ZTFA 3KYCB 2Y69H 1U5TA 2LK2A 4A3LJ 4M3FA 3GVAA 4IHSA 1B9MA 3K9TA 1WJCA 2ELKA 2VOPA 2KIQA 4ESBA 2DYSH 2GIVA 4GGGA 1JJ6C 1PUFA 3V8LA 5HVQC 3F8BA 3IUOA 3CCLI 4YG2F 1VI0A 1C0WA 2HOEA 4UUVA 2OPTA 4UB8C 3VYTB 1JUSA 1WJ5A 2XAJA 4M6VA 3TO7A 3OOUA 1VQ4I 4RB0A 4JYKA 4HDVA 2KRCA 3W6VA 4RB1A 2WAQA 4WXCA 2IA0A 2FNPA 3TDZC 2ME0A 1VQLI 1BJAA 1FTTA 2IGMA 2EA2A 3J7AY 4GCVA 3WTVC 3BP8A 2L0KA 3GEZA 1ZRDA 2X1EA 3JSOA 1QZEA 5E1XA 1D5YA 4Y17A 3RI4A 2HYJA 3D1NI 3C2HA 1R1VA 4F93B 3H0DA 1G3TA 1RZ4A 1S7OA 4UVBA 4B48A 5H6RA 1OQYA 1XSXA 4ZYEA 3HUGA 2W82A 1OYWA 1UHMA 4BE0A 5ERIA 1LDDA 3KLOA 3HGGA 2V7FA 1B72A 3A03A 2ECCA 2FXAA 2IGNA 4YIFA 3GUDA 3MKLA 1O3TA 2VT3A 2JVGA 1UB9A 2Y9YA 2ESHA 5L3FA 4A5NA 1Y0NA 2P4WA 2F5FA 2KIMA 5BMZA 2PFBA 1EH7A 1LNWA 3CCUI 1LVKA 2XKPA 2FRHA 4BBRJ 1TW3A 3S1MJ 3JRDA 2QKMB 2WB1N 2K9MA 2ZO4A 3CUQB 4Y3OA 4BKXA 3CC4I 1MBGA 1JTXA 3AG4H 4XLCA 3OYJA 3TEDA 4JQFA 2XVCA 3BWGA 3NEUA 4LLNA 1GT0C 4KFCA 2HYGD 3U1DA 1FOWA 2WA0A 3EUAA 4F55A 1YJ9I 3B73A 4XOPA 1FC3A 1W4MA 2NAZA 3SZTA 4B1RA 3KZZA 4XICA 1AKHA 4JX4A 1X3ZB 2X6XA 3F23A 3WU2C 3F9KA 3KP2A 1KU2A 3EUKL 1QBJA 3I58A 3IWFA 3BPXA 3AL0C 2X6OA 2D5VA 2F5DA 3WU0A 2ISYA 2Z16A 1R58A 1G2HA 2MSYA 5AONA 4GYIA 3V8KA 3BC8A 1XN7A 3CLQA 3FKJA 2K27A 2LF7A 3NWTA 2BY0A 2EPFA 3H9GA 4PJLA 3S2WA 2O5RA 4RLQA 5IOYA 1QQIA 3L2WA 5GPCA 4EVIA 3VODA 2KP6A 2AO9A 2TRTA 2K02A 1Z7UA 2M30A 3MKZA 2G7UA 3BPVA 1ZGJA 1RNLA 4C3HJ 5FFZA 4MTDA 4BE2A 1YYVA 2DXIA 5DD4A 2E34A 2O0YA 4QLCU 2ZB9A 3T8TA 2Q2EA 2V9PA 4FE4A 2QBYB 3E97A 3DEEA 1G3SA 1LDKB 5L3DA 3MAJA 1JUMA 1ON1A 2OQRA 2QWWA 2JRMA 2P6SA 2PG4A 1ZQ3P 1APLC 5CVUA 1TC3C 2CU7A 4CYDA 1LUJB 2LBFB 1SMTA 2H1LA 3H3UA 5IP6A 3HOZJ 2I10A 4UUTA 2E60A 1BI3A 2M7AA 3K69A 3HZJA 4HPQA 1P4XA 3OYBA 2Y30A 5GP9A 2H8WA 2MLGA 1F4KA 4Z6YA 1J59A 2BHZA 4AIKA 2E7XA 2G9WA 1MJ9A 6PAXA 3RQ4A 5FKMA 5L3GA 3HOUJ 2G7HA 3U2RA 1G8XA 5IT9Z 5JLXA 1JHHA 4UVCA 2MH2A 3CUQC 4D1QA 1I27A 2O61A 1IZ1A 1ZG3A 2VJ5A 4BH9A 3IP4B 3FBNB 4DBQA 2VJIA 3FHNA 2R0QC 4H0EA 4AIJA 1EA3A 4I0BA 3BZCA 5DM7F 3KEOA 5DCMB 2V6EA 4P96A 3DF8A 3J80Z 1LEBA 3F6OA 9ANTA 4LGWA 1VNDA 1DP3A 2IW5A 5IP7J 4IZZA 1Z3YA 2ZJQF 1H89C 3BR3A 3WHBA 2JUGA 2HU9A 3GCMA 3H5RA 4ESFA 4F91B 1KU3A 3REOA 5FKKA 3RSNA 2DN0A 5KVRA 1X2MA 1W0TA 1GHCA 5CKTA 3M8FA 1I6XA 3FF5A 3QRFF 2VASA 1MSFC 1WZ2A 1WRJA 4MTEA 5D8LB 4J00A 4BQAA 1JHFA 3OYKA 3GTOJ 2EJRA 2GA1A 3N4MA 3S1QJ 3G1OA 4LITA 2QSGX 1Y8RB 2VI6A 5HODA 2OC6A 5DDGA 1KGSA 3DBRB 4XONA 4E7KA 4KMFA 1JJ8C 2LR8A 4ENNA 2ECBA 1FTZA 5D8KB 2DFHA 4JP0A 2R7XA 3BTLA 5IPAA 1RI7A 2HPIA 3I55I 4HEA2 3K2ZA 2BY3A 1T2KA 3C3WA 2WWYA 1MMDA 2K3FA 2M87A 5CYVA 1TQPA 2DQLA 3WG9A 1BC8C 3HB9A 2VONA 4X1EA 2OBPA 4I02A 1OCRH 4Q5SF 2ME6A 5JVGF 3KCCA 4LFUA 3K0LA 4XSXF 1SFKA 2VIXA 1T38A 1D3YA 2XUBA 2DK8A 2XPWA 5F1JA 1U8RA 2ZKZA 2IRFG 3PO2J 4ENMA 2UXXA 3OYGA 3ZQGA 3N05A 2ZXWH 2AS5F 1FP1D 3EDPA 2Y48A 2O7OA 3D5LA 2ZSIB 2JN6A 3FBIB 2KZVA 5K7ZA 2XSJC 2VXDA 2RGVA 1O3SA 5IYBJ 2A5YB 2GOMA 4XRSA 4PFOA 3TO9A 4BQQA 2A6TA 2CS3A 2R5YB 2RREA 1VQKI 3LSPA 5BNGA 1IN6A 2EH3A 2HOSA 2FA5A 2V4JC 3E1SA 3LMMA 3PL8A 3HIFA 1TNSA 2EV6A 1DU0A 2P6TA 3V7RA 1O7LA 3M4OJ 2QCOA 4LD5A 2DW4A 1BOAA 1ON2A 2DYRH 2XPUA 1EKEA 2IVMA 2LRDA 3S32A 5DS9A 2KQRA 1IXSB 4LK0F 2NRAC 3J80K 1ETQA 1GDTA 2AHQA 1ZRCA 2H94A 2HNHA 3P9IA 1HXDA 2EQRA 2HZDA 2XGDA 2BVMA 3KEYA 4B3XA 5KHDA 3JRAA 3IH2A 5HLIA 2IPQX 3I56I 2MW8A 5BQTA 4A12A 1IRZA 3JSPA 4EQQA 1H88C 2BVLA 5JFRA 4PJJA 2STTA 1X4OA 3H92A 3E6DA 1MBEA 1CF7A 4AU7A 4HDUA 1HDDC 1XTAA 5IT9K 3CJQB 4A3JJ 1MBJA 4HV6A 3S93A 4M71A 2JSCA 4PGGA 5A2QZ 1DP7P 2WTEA 1YS6A 1HW2A 1HC8A 3ZQCA 1MJAA 1YRNA 2OF7A 1IXCA 1Z1DA 4XKCA 2CG4A 2M4KA 1ETKA 3FXUA 5DD8A 3R6SA 4FASD 1FMWA 2ZSHB 1WJEA 3WG7H 3HKZA 3SJMA 3A2KA 2W24A 1WH5A 1JKPC 2PMZN 1V54H 4Q47A 1K78A 2XASA 2KMUA 3VEPA 1WWXA 3ABLH 3GTJJ 2HDWA 4AWXB 2QF7A 5E1ZB 2FBHA 5GAGJ 2VQHA 3K4BA 4L18B 5J8FA 5K7FA 4KT5C 4BJ5C 1Z6TA 3BG7A 4C30A 5FRMA 4A93J 1P92A 4AYBN 4W1UA 1Z91A 2ZMEA 3LQRA 1X1AA 3WGIA 3WGHA 1U3EM 3FMSA 3ZQLA 3HSEA 1AKHB 2X1CA 4BL0B 5D5UB 1P7IA 3G1MA 3CJTB 3DPLC 3ZN1A 2VKDA 4EGZA 4OIOF 2QKLB 3M3YJ 3PQKA 2PN6A 2NVTJ 1Z0XA 4S04A 1D0YA 1TQIA 4XK4A 3WTXC 4IXAA 1W0UA 3CQZJ 3V42A 4Q4ZF 1BR1A 3LSGA 4UUSA 3GX4X 5DCFA 1LFBA 2GQQA 5DYMA 2DJIA 1U9OA 3DLAA 4BAYA 4FCYA 4IL6C 1TNTA 1ZYRF 1NG6A 4E6KG 2FD5A 3RPUA 4F7ZA 3F21A 2Z9OA 2PJRA 1IV8A 3FXQA 5GADJ 1QHHD 3S1RJ 3MCZA 3GF2A 1JGSA 2HTSA 2A3SA 5CQEA 4MHGA 5LEKA 3R0AA 1IJWC 3IV5A 3ZP5A 1R4NB 3FXJA 4NC7A 3RKYA 3DWLE 4OAZA 5J8CA 3F0CA 3KZYA 2K9QA 3HOWJ 2CW8A 4PGHA 4XNFA 1X19A 1X1BA 1T98A 1XX5A 3ECOA 1X4PA 1BW5A 1BM9A 3IWZA 4DQ2A 4G9YA 1X58A 4HX8A 1B59A 1ETVA 4ZYAA 2L3DA 3RIRA 1E3HA 1GVJA 1P2FA 3BR5A 1TLHB 5D4SA 4F3QA 1ZR4A 5TJJA 4CCOA 1HKSA 4IQJA 2E1OA 3LFKA 1X3UA 2E2IJ 2ZC2A 2DCEA 1A36A 1E3OC 3RKXA 2Z5UA 1SC7A 1S7AA 2ZNYA 3EQLF 3LA7A 3B6AA 1YE9A 3L09A 1B1BA 2E7WA 1FEXA 1Z3XA 3LSKA 5CLSA 3DTEA 2LDUA 4EJOA 2KFDA 4XKBA 4M6XA 2K5CA 5F27A 5IY5H 3K1MA 2EV5A 2KIUA 2CUJA 3HHHA 3ISPA 1NK2P 2Z2SB 1S6LA 2NS0A 3S14J 2F5CA 2Q0OA 1R9TJ 3KEQA 3BR0A 3A02A 4UHTA 5F08A 2NS8A 1E0EA 3QPHA 3OYHA 2P5LC 4BBSJ 3SYTA 1ZKGA 2BYVE 5FJ8J 2LFBA 3S2HJ 3FXLA 2QLZA 3DU5A 2E1NA 1XDUA 3FMQA 5B3SH 5F0HA 5JHFA 2EA4A 1SFUA 1SFOJ 1KZHA 5BPIA 3C2GA 1MSEC 5D6EA 1MBKA 2IBDA 2JZYA 4G6QA 1YHQI 4XLEA 1ERDA 3K70C 2DOEA 2QQ8A 3GXOA 1XC5A 2ETHA 4I2OA 4FETA 4XQFA 1Z6RA 3OL3A 1XGMA 5J6XA 2DO7A 5EGOA 3L7WA 4D7NA 3I54A 3DKXA 1XG1A 2K4BA 2E1CA 1ZR2A 2V1DA 2M45A 1YQAA 1EJ9A 1F1ZA 2VPRA 2X1DA 3CDHA 4KDPA 2L7KA 3DTIA 2XGEA 4LJZF 2YPRA 4XM3A 2BW3B 4CHUA 3AAFA 3K4KA 2JQ7A 3MWMA 4CUGA 3WTWC 1IN8A 3FK6A 4EMSA 3K2AA 4XOTA 3ABMH 2HVQA 5D4RA 4HF2A 2R3SA 4ZDLA 4Q48A 4B8XA 3OSFA 1V5GA 1FT9A 1F5TA 2DPUA 3SEQA 4FT8A 3ZR8X 1HOMA 4HOBA 2VKEA 3CCQI 1T0FC 3OYMA 5EEHA 1EF4A 4OIQF 5C4XJ 2R93J 2P81A 1SFEA 2XIGA 3I0TA 2BGCA 3P7NA 3SFZA 4HF1A 2VL8A 3CCYA 1OPCA 3GBGA 3JRGA 5D6FA 4XBFA 1HF0A 4RS8A 4M73A 5HNHA 4RM2A 3BTIA 2R7WA 3EUHA 4OWRB 4M9ZA 1RR7A 1WPKA 3OS1A 3SHFA 3WTUC 1G4DA 2VT2A 2V1UA 2ID6A 3H5NA 1L0OC 4BDZA 1EH8A 4GDFA 2NOJB 3F3XA 1FWZA 3DFGA 3HRTA 3I4MJ 4I0AA 4FHTA 3WGGA 1VQNI 3WTYC 1MMSA 3KZIC 1NG7A 4LG3A 2CFOA 4KT6A 3HKZN 4KUMA 4CCKA 1FNNA 3I9V2 2F5VA 4L5IA 1TQMA 1Z77A 4O6JA 3FM5A 4DYRA 1WJAA 3WTZA 3JW4A 5J4YA 2RNGA 3M8EA 4MQ9F 2CV1A 3O2PE 1LDJA 4GO1A 2LF8A 3RQIA 2DMNA 1UMQA 3VYSB 2EZKA 2RKHA 4TV7A 4AYBA 1P6RA 3TKYA 3K4LA 1FYLA 3TOBA 4CCJA 4A3DJ 1ONVA 2KRHA 1V4RA 1GVDA 4II2A 5CVIA 1SVMA 3AFHA 4U0WA 1KYZA 1KA8A 3U9GA 1VFCA 1A6IA 2HDDA 3LSHA 4ON0A 2V9KA 4XLHA 3GLXA 4UV8A 1BN5A 4LMYA 2F48A 4YFNF 3I4NJ 1OLTA 2XAHA 2PBIA 3S1NJ 4DW6A 4FQGA 1XS9A 1D8KA 1G3YA 1ORKA 2A61A 4IRIA 3L1PA 2JRTA 2K4JA 2WAFA 3CJRB 3HDDA 3FDYA 3FKIJ 2KPMA 3ZMZA 2HZTA 2V79A 3H1CA 2F6CA 2W85A 3F22A 2M7BA 3M7GA 1G59A 2MYSA 2DFFA 4BEHA 2ISZA 1V55H 4N9HA 3MQ0A 1MBFA 4EEFG 3OYEA 3HRSA 4HBLA 1XMKA 5JVTA 4AIDA 4BQOA 1Y56A 2KIFA 1MNEA 2BXZA 2Y0SN 3KLNA 3HPGA 2DI3A 1JE8A 2M4GA 2MA3A 4A3MJ 2BXYA 2F4IA 3HRUA 3IAM2 2VXZA 1X2NA 5KNLA 3S3NA 3BOQA 3OR1C 3M1CA 2V9VA 1LE8B 2GIZA 3I4PA 3KX2A 2R7VA 3ROUA 2HQNA 5C3EJ 3DKYA 4RGXA 2G0EA 3E0JB 3OL4A 4R1HA 2EFWA 3BTCA 1WH7A 1UFMA 2W48A 2DFIA 3HTUA 1IUYA 1K7AA 4NHJA 4EM1A 3LSTA 1UELB 4ANJA 1F43A 5CPRB 1ZAOA 1FYMA 2R7OA 1D0XA 2HKXA 3IKTA 1ETWA 1R1TA 4C2MJ 2DJNA 4XLPF 1LKXA 4MFEA 2VQGA 1UZCA 3DLLF 3HTSB 1T56A 4XLNF 5C44J 1SD7A 2H6BA 4RGRA 2ELJA 1JT0A 4BHPA 2JPCA 3WHCA 3OS2A 1FMVA 1E2XA 4CZZA 3ESWB 4JX6A 2BW3A 4KITB 5K1YA 3M9AA 4U0YA 3ZOBA 4I6ZA 4HSRA 1S5LC 3ZQHA 2HXOA 1ZG1A 4IEJA 4KIBA 1FSHA 4PDKA 1FJLA 4ZTJA 2QQ9A 1R1UA 4XRFA 3JRBA 2JA5J 3FISA 2M2EA 2OAZA 3DCFA 4YIRX 3TL4X 1XGNA 3KFWX 1ZHFA 4C3JJ 4A3KJ 2NXNB 2FBIA 1HSTA 1TT5B 3D0SA 4KMUX 3RKWA 3CCSI 2XPVA 2XAFA 5A2QK 1OR7A 2F2EA 4FISA 1K78B 1KQ9A 1YW8A 1IV6A 3JR9A 1U5TB 3COAC 3B02A 4IHXA 2EWNA 2DTRA 3JRFA 1YLFA 1Q1HA 3ZQQA 1GLNA 1W5TA 2E1MB 4MQVA 1KYWA 2JSPA 4DYQA 3ZMUA 1WJFA 5EF6A 2K7LA 3L9FA 1QA6A 1O7FA 3S3OA 3R60A 4NQWA 2RNJA 2IJLA 2HWVA 3D5RC 3BJOA 2EZLA 3SFIA 4L0YB 2ADUA 3TQNA 3CCMI 2QBYA 3LFUA 1V5FA 1PJRA 4AM3A 2CWEA 1ETYA 1OFCX 2HFHA 2DFEA 4G6DA 2L4AA 4II3A 1SAUA 1WGXA 3RJPA 2BE5F 4HAMA 5EZGA 2EIKH 4N0BA 5FLXK 3EPZA 4KIFA 2O03A 3ZMVA 1ENHA 3KP7A 3ZRGA 2H8RA 1ZLJA 4YFXF 1LJ9A 1P4WA 4A3IJ 3E6MA 5EYRA 1AHDP 4CA0A 1QRYA 2L9SA 3OY9A 4XMYA 3T0YA 1N75A 4PJMA 2L02A 2WB1A 4XORA 2R7UA 3A4CA 3GFJA 2ZFWA 2Y75A 4E7JA 1Z7LA 3OR2C 4I7HA 2YR2A 4CICA 3Q0WA 2UUZA 4B09A 3VPRA 4N4NB 2DK5A 2CQNA 4D5FA 3JRHA 3OOPA 3SZGA 1MMGA 4UNOA 4AUXA 2ZBKA 3AL0B 4LLGF 3PNVA 4OAYA 3HOTA 5F04A 2UWMA 4PZJA 3FZVA 4XIDA 1VF9A 3ML6A 4HV5A 5CVVA 4QIWN 2EFOA 1GV2A 3FIWA 5ILVA 1LFUP 2W57A 2DA1A 2IS2A 5L3BA 4Y13A 1S7EA 1VQ9I 1UCRA 2VUMJ 3DPTA 4UVAA 1LB2A 4MGRA 1P9QC 2XF5A 2CQXA 3T5XA 1OCCH 3VFZA 2F4MB 3DQVC 3I59B 3EUHC 3PM1A 1PUFB 3C18A 1XDSA 2K9LA 1T39A 3RYRA 3E5UA 5LGNA 4G7OF 3OIPA 4L5EA 2IGKA 2LREA 2VBWA 3MD2A 3HUGB 2GZWA 2RN7A 4RAZA 1ULYA 4L9NA 3KYLA 2E2JJ 1B4AA 5JHUA 4D5CA 4PK4A 1BJZA 4PSXA 3O6BB 4OIRF 3G3ZA 2PMZA 1S8NA 2GAUA 2D45A 1K6YA 1YX5A 5J1YA 2EBIA 1BR2A 1XGSA 4DJAA 1J9IA 1XD7A 2IA2A 2LVSA 4XLAA 5M5YJ 3MEXA 3H0GJ 1PVEA 4FX0A 3RPQA 3QODA 3S15J 2C6YA 4MFDA 3UNGC 1IO2A 2HOAA 4NQWB 2DA2A 2IA1A 3X2QH 2ZFUA 3JRCA 2PI0A 5J47A 2LSOA 4RAGA 4HNVA 3TBIA 2Q2EB 5TISC 3VSKA 2IS6A 5ICGA 2X9DA 3WE3A 1ZLKA 2HVRA 1FIAA 2VB6A 2OUMA 1HSJA 4NDLA 2WAQN 5ICFA 3GZNB 4DIQA 2KDZA 1IUFA 2VOOA 2KHMA 1X1PA 2LD5A 2EIJH 2F5EA 1P7JA 2XV4S 2LYCA 4P55A 2EILH 1QZYA 4V19K 2OU2A 1DGRM 2M3AA 3OYFA 4BGDA 4IHWA 4XLFA 2R5YA 3J81Z 1QVUA 1KQ0A 2HI3A 3ASNH 2KZGA 3W2AA 2XAGA 3I71A 1I3AA 1ZGAA 4HZFA 2CQKA 3CMAI 2VODA 1W5CC 5E8GA 2LBFA 1EH6A 2JA6J 1FOXA 1GUUA 4M3BA 2B9SA 3R0JA 2DA7A 4EJVA 2E5NA 1DPUA 2CJJA 3E7LA 4ZDPA 4B47A 4V2FA 1LVAA 3BDDA 4M74A 2BV6A 3QQAA 3KE2A 3BJ6A 4G12A 4L9TA 1I3QJ 2V26A 1WCMJ 1U8BA 2CW0F 4HQEA 5KCMA 5B66C 5M5WJ 2L4MA 2CUZA 1ITYA 3BR1A 2FF4A 5EJCA 2O8XA 4PSWA 2OZ6A 3F8CA 2KT0A 3ULQB 2AQFA 1JKRC 4BYYA 3K70D 1H8AC 3DEWA 3MFKA 2HEOA 4ETSA 3JAMK 3IH4A 3K1NA 4R8HA 5JI6A 3BROA 2L7FP 4CH7A 3QP6A 1KU7A 4BS9A 5LRSA 3GTPJ 4U7DA 2PLYA 1QVTA 4N4OB 2R92J 5K5OA 5CVRA 2KISA 3GLLA 2LMDA 3P5JA 3S3MA 2VKVA 1XMXA 3GZ5A 3QYBA 1WHUA 2R7DA 5CVJA 2GXAA 4GRIA 1XSVA 1NTCA 5M5XJ 3CDLA 5IP9J 3MN2A 2MD0A 1PUEE 1XMAA 5H2FC 4E70A 4U87A 4L9VA 2WBMA 5FB2A 3Q9SA 1BBYA 1A5JA 3T1BA 1ZG5A 1H9TA 3PIOF 2E1MC 4BEHB 4KNYA 3TOAA 3HXLA 4BACA 1JXSA 4XN0A 3CMEI 4KYWA 5FD5A 4IHYA 3EETA 1QHGA 3WE2A 3HOXJ 1DPRA 2DMPA 3ZMDA 3GFIA 3CC7I 2DMTA 1N77A 1EV7A 4LK1F 3S16J 4E4HA 2RV8A 4X0GA 4IRHA 2IP2A 5B5EC 4IOCF 1N78A 2D2WA 3UR3C 1BI0A 4RGSA 3PQJA 5D5VB 1GV5A 1SANA 3HPHA 3BR2A 4L0ZB 3EYYA 3V8JA 2DT5A 3K7AJ 1HDPA 1KONA 4XRSG 1O3RA 1MJBA 2XHKA 4U0VA 3L2QA 1YO5C 3BR6A 2PJPA 4A3FJ 3ELKA 1VQMI 1IW7F 4CZCA 1R7JA 1RPWA 1FPQA 2WY8Q 4ENKA 5BPDA 1R36A 1MDMB 3H35A 1YRNB 1ZRFA 5HLHA 4WXDA 3S2DJ 2YS9A 2K86A 1ZH5A 3HC7A 4MIMA 2HQ5A 4JX5A 1ODDA 3VWBA 2Q1ZB 2Y2ZA 3Q0VA 3J81K 2RQQA 3KIOA 1QU3A 4ZZDA 1WSUA 4I76A 4DZJA 2R7TA 3MKYB 1W7PB 4JK1X 1MNDA 4D7MA 2R7ZJ 4WF2A 2GXBA 1OCZH 2M9HA 4BY7J 1TW2A 2P5VA 1JI8A 4QPQA 1T6SA 4M9XA 2KJBA 4O5VA 3ZN0A 3CC2I 2W00A 2KDOA 2XAQA 1SVLA 2EFNA 2JK3A 3AG3H 3HYIA 1U9NA 4ZC3A 1D5VA 2JUCA 1Y1WJ 5E18F 2L9VA 5KAIC 1I1GA 4FE7A 1VQ6I 2Y9ZA 4CYCB 1Y0UA 3V7SA 2FQ4A 2XC7A 3BY6A 1PYVA 4RB2C 4J01A 1FX7A 2M0CA 2N8GA 5LRRA 2VLAA 2BY2A 2GXGA 4YRVA 2QM3A 2EZHA 3V7CA 5D5WB 2R7QA 1OYIA 5K5RA 1K4TA 3CCVI 2K85A 1X1DA 3QOPA 3CJNA 4BE1A 4M3DA 5EEAA 1RKTA 3TGNA 2DA3A 3VOEA 2DDBA 3VSLA 1IN5A 1ZTRA 2HXIA 1TT0A 3C2BA 2LOOA 3IRRA 3K10A 1WI9A 3BZKA 1IF1A 1W7PA 2P7CB 3CUQA 1U6GA 2XGXA 3QU6A 2CMPA 3CF2A 1DGWY 1FOKA 5LBQA 4BXFA 1OJLA 4EJUA 4HLYA 4E7HA 2FNAA 3SDBA 5AIPA 1CF7B 2KLOA 2WC2A 3G73A 1FBQA 3K1PA 3OWTA 2O6GE 3U1KA 4HX7A 1ZREA 2W7NA 3LOCA 1K6OA 1MDMA 4CGZA 1Z21A 3TW7A 3KP5A 2HR3A 4DOZA 1S3JA 2DQRA 3P9KA 1V3FA 3VYUB 3ZCOA 3MVPA 1OMIA 1ZELA 5GAEJ 5EGOB 2MBFA 3HJEA 2Y31A 4QWQA 3LQQA 1IAWA 2IGOA 2L5QA 2VQLA 2ZJ2A 3CLOA 5LHHA 2QEXI 4IO9F 3O8HA 1FY7A 3L2CA 1YITI 2HQRA 4ZJZA 4YEJA 3IH3A 3AG2H 1UG0A 2LY9A 1RKWA 1K61A 3OIQA 4Z2YA 1YX3A 1D1AA 1YIOA 3NQOA 3L2UA 1D0ZA 4AD9A 2PMUA 3RZDJ 4XR6A 3RTRA 2IS4A 3HBLA 3GFLA 3CF5F 5HDGA 4J19A 4L5JA 4DYCA 2TCTA 2R7FA 2I5UA 1HLVA 1IDZA 5IOZA 1YJWI 4OINF 3JTHA 1J75A 4LB6B 3H3VK 2KJCA 4RDUA 4AIHA 4ZYGA 4XKVA 1SMYF 3MZHA 1QZZA 4UV9A 3OYNA 2WY7Q 1PP7U 3K4NA 5E1WA 2VN2A 1Y8QB 4Y52J 2DT7B 1H0MA 3QOEA 2LNBA 2QQBA 1STZA 4NBQA 2KL4A 2LKSA 4XN3A 4XSZF 5F0FA 4C2TA 4MEXF 2P7VB 3Q9VA 4NNJA 3HM5A 1S9HA 3E5QA 4EV0A 2LP0A 1IG7A 1BIAA 2H6CA 4EJWA 4QTRA 4DNCA 4V2GA 1Q1VA 3ABUA 5ED4A 2MH9A 2BZTA 2B63J 4IX7A 1WI3A 5HS8A 4QPOA 4A69C 1FLIA 1MH4A 2VKHA 2A68F 3QYEA 5DUKA 5H6QA 3J7ZI 4A3EJ 1ACIA 2E2HJ 1K79A 1FSEA 4PJ0C 2FUG2 1O3QA 3K6GA 1MNMC 4ABZA 2VPLA 1R5GA 4RMNA 2NYXA 5F64A 3HSFA 1RR8C 2O9LA 4QSHA 1MMAA 1J7KA 3VDXA 1HQCA 1H9GA 2NS7A 3ZMTA 2K9SA 5AIQA 5FLMJ 1RIOH 3CP2A 4OMZA 2NVXJ 5E3OA 1W5SA 2FU4A 3Q5FA 3IHUA 3L2VA 1XGOA 1SEUA 4G7ZF 3H9QA 4KJZA 1W36D 3F72A 2DODA 2W4SA 2W84A 3QAHA 4S05A 5C4JJ 3CMYA 1Y1VJ 4MEYF 1R22A 1UJ8A 2CUEA 5J4VA 4NB5A 1U2WA 3PNTA 1IC8A 5B1BH 1MKMA 5EZHA 2A6EF 1HCRA 2ELHA 4L9JA 5D5XB 3HHGA 4BDYA 1QNTA 5JR3A 1VQPI 1LPQA 2HTJA 2EIMH 1FIPA 3DEUA 1A31A 3WTTC 1OKRA 1TWHJ 2MGQA 3OV8A 2GWRA 3L00A 3QU3A 1IRFA 3I3LA 4BNCA 2JT1A 2V6CA 1TWFJ 2YU3A 2YU9J 2JPBA 5GTIC 3A01A 3N97A 2OZUA 3R61A 4I98B 4IVNA 4LIUA 4RGUA 2Z1DA 2GOXB 2RDPA 5LEJA 1BIBA 2LG4A 5E3NA 2BHYA 4CO8A 4ITVA 4M3EA 4H4KC 3G1LA 1S29A 4S0HB 1JTYA 3DKWA 2DLLA 1SFXA 2V1XA 4BY1J 4P5OA 2ZMEC 4WXHA 5E3MA 3MKWB 1AA7A 1YOVB 4CCNA 1A6QA 2DU9A 2LH9A 1MBHA 2VBZA 1JUPA 2K3PA 4UXNA 4RAFA 2ID3A 4A3CJ 1G6NA 2WV0A 2DA4A 2CH0A 2DTZA 3FX3A 1TTYA 1UG2A 1X1CA 4BXUA 2GM4A 3DP7A 3FM3A 3PJRA 4ZDOA 5GAHJ 3W6JB 4U7BA 5FKOA 2MC4A 2IS1A 1QO0D 1XCVA 2M8GX 3D5SC 2FSWA 5CJ9A 4EATA 2L01A 2VE8A 3HOVJ 3BCBA 1MGTA 1YW9A 1AU7A 4P9FA 4EM2A 3WODF 1WFXA 4K2EA 3H36A 3Q0UA 1MMNA 3G6EI 1RRJA 5HLTA 1U5TC 3LWFA 3ABKH 5TGTA 2PJRB 1NHAA 3I59A 2OV7A 4BXXJ 1TWAJ 1FBUA 4P1WA 5HOOA 2JA8J 2BEOA 1BL0A 3RZOJ 2EINH 3I64A 3RDIA 2ICWG 3E5XA 1R71A 3IAS2 1R49A 3FXRA 1T08B 2JWTA 5ILSA 3CESA 2EZIA 3KP6A 2DMQA 3NRVA 3T8RA 5FD6A 2JVHA 2FBKA 1XB4A 1MW7A 4ZYDA 3BG6A 2BY1A 3BQZA 1NH3A 2P8TA 1RC9A 5EDNA 1SAXA 3F8MA 4KISA 2NNNA 3PFIA 4N9IA 4CXFA 2ZXJA 2LTPA 4BQNA 4HX4A 2WADA 1YJNI 4HG2A 3B6CA 4RBOA 1IN4A 3NARA 3C1DA 4HLXA 5E8IA 5M3FJ 3LSIA 5F6FA 3G2BA 5J40A 4FX4A 5TRDA 5GTHC 3FXKA 3HOSA 3R4KA 2FE3A 2XDVA 1SD6A 1HKQA 4XKWA 3BT9A 3CO6C 2NOGA 4IHVA 5LHIA 1T33A 3JCUC 4A0XA 4CCLA 5L3CA
chains in the Genus database with same CATH topology
3GYHX 2KKOA 3E3VA 4RB3C 2TDXA 3CO7C 4A6DA 3KP4A 3ECHA 4MNUA 1SD4A 3I5UA 2M5WA 2O3FA 1FBSA 3JAMZ 3SZPA 4HQMA 2RC4A 2ACJA 3GZ6A 3TO6A 5H20A 1R00A 1WKMA 2DAOA 4EM0B 5HS7A 4A0YA 4OOIA 4G94A 3M1EA 1P4AA 4KN4X 5LLQA 4ASNA 5K5QA 1IXRC 2J5OA 4HA8A 4LLLA 4R79A 1WQ2A 3GWZA 4M9SA 1A04A 4KIGA 3FWEA 3WU1B 4G7HF 4IHTA 2ESNA 4CDGA 2PQ8A 4G8XA 2ZNZA 2HGCA 1R5HA 3W6KB 3FHZA 4BHBA 4ZYHA 4WK8F 3ZQ7A 5LGTA 1ZN2A 2JTVA 2YSRA 3CUOA 1YS7A 2X4HA 2EFPA 2VBXA 2XRNA 4HYEA 3JTGA 3F8NA 1USTA 2L54A 1LEAA 5L3EA 4YIIA 2MC3A 1PP8F 1GXPA 1B9NA 5DEQA 3IKVA 1ZARA 4LG0B 2UXNA 2COMA 4WX9A 4JBAA 2M1BA 3ERED 1SD5A 4I09A 4KA4A 1HKTA 2DBBA 3KETA 3P9CA 3TDUC 3E6CC 3E6BA 4GXOA 4GYGA 1E17A 5HDNA 1I1SA 5F1RA 3IL2A 4KN7X 2OD5A 2A69F 2OQGA 3ABTA 4HF0A 4A5MA 5HS9A 2EV0A 2QQAA 4Y15A 1XSDA 2IT0A 2PEXA 2KRFA 4OU0A 1HBXG 1YTYA 1J5YA 3RYPA 3F6VA 2ZCWA 4ENJA 4EGYA 1OYYA 3VB2A 5E17F 1O57A 1BI2A 1KU9A 1YFHA 4A2UA 4ZZLA 4EJTA 3O3KA 3DV8A 1RUOA 4A6EA 2EK5A 2X0LA 1VTNC 1IRGA 3QP5A 2QYOA 2RVCA 2FEZA 5FLXZ 1AWCA 2QUFA 2HDCA 1UHWA 2VC0A 3GO5A 2ZMEB 3LAJA 3C7JA 1D8JA 3FMRA 4YFKF 1PDNC 3WTSC 3F8FA 5BOXA 3GFMA 5DV5A 1GXQA 2EB7A 2CFXA 3I53A 1I5ZA 2DPDA 2XROA 2NNYA 2A6HF 2Z99A 1QPMA 2GA2A 5ICEA 3IRQA 1F9NA 2D1VA 4IRGA 3SQNA 3HSRA 2UZKA 4IPAA 2FQ3A 4PCQA 2YX4A 5DUIA 5HLGA 2CGPA 4M72A 3SXYA 4D0PA 2FMLA 4ZH4F 4BHCA 1MZBA 5BS6A 3IC7A 2PMHA 5ILUA 2D1HA 4KICA 1U78A 3CTAA 2HKOA 1USSA 1FYKA 3QPTA 1G3WA 2A07F 2M8EA 5FFXA 2VE9A 3LAPA 1CGPA 2H09A 2W25A 3KP3A 2VC1A 4P9UA 3EYIA 1MD0A 2Y0MA 1REPC 2FMYA 2MLKA 1L3LA 2B0LA 3ZMSA 2LKPA 1RUNA 3MZYA 4U88A 3DXJF 1FP2A 2QENA 1R23A 1YG2A 2STWA 2P5KA 1QGPA 4IF4A 2VBYA 1BC7C 2Q8KA 4I01A 2YX7A 2CO5A 2Z3YA 1BI1A 1YW7A 2Z33A 1Z05A 4OIPF 4M6YA 4AVPA 3J7AO 4IJAA 1J0RA 5HDKA 1XCBA 2HYFA 3LA2A 4RAYA 3HRMA 4OMYA 4A0ZA 5E20A 2FOKA 1HW1A 2MD5A 2HS5A 1DDNA 4LG0A 5LGUA 5DCMA 4ESJA 1DUXC 1T0FA 5KK1A 1TBXA 1IN7A 2EFQA 2J5PA 3H3ZA 5ICCA 5EEGA 2CSOA 1FZPB 4O3MA 2XKOA 5FGMA 4WCGA 2H27A 2BBYA 1HW5A 5IT3A 2QVOA 2QZ8A 1Z9CA 1J2XA 5FO5A 2CYYA 3BJAA 1AOYA 2OA4A 2RQPA 5LHGA 3BZ6A 3LA3A 1B6AA 4HW0A 3GW2A 3V4GA 1KQ8A 4LB5A 2AXLA 3ZPLA 1W7PD 1LQ1A 4WWCA 1U5TA 3GVAA 4IHSA 1B9MA 3K9TA 2VOPA 4ESBA 2GIVA 4GGGA 3V8LA 5HVQC 3F8BA 4YG2F 1C0WA 2HOEA 4UUVA 2XAJA 3TO7A 4RB0A 4HDVA 4RB1A 4WXCA 2IA0A 2FNPA 3TDZC 1BJAA 2EA2A 4GCVA 3WTVC 3BP8A 3GEZA 1ZRDA 3JSOA 5E1XA 4Y17A 3RI4A 1R1VA 1G3TA 1RZ4A 1S7OA 4UVBA 5H6RA 1XSXA 4ZYEA 3HUGA 1OYWA 1UHMA 5ERIA 1LDDA 3KLOA 2FXAA 4YIFA 3GUDA 1O3TA 2VT3A 1UB9A 2ESHA 5L3FA 4A5NA 2P4WA 2F5FA 2KIMA 5BMZA 2PFBA 1EH7A 1LNWA 2XKPA 2FRHA 1TW3A 2ZO4A 3CUQB 4JQFA 2XVCA 3BWGA 3NEUA 4LLNA 4KFCA 2HYGD 3U1DA 3B73A 1FC3A 1W4MA 2NAZA 3SZTA 3KZZA 3F23A 3KP2A 1KU2A 1QBJA 3I58A 3IWFA 3BPXA 2F5DA 3WU0A 2ISYA 1R58A 5AONA 4GYIA 3V8KA 1XN7A 2K27A 2LF7A 3S2WA 1QQIA 4EVIA 3VODA 2K02A 1Z7UA 2M30A 2G7UA 3BPVA 1ZGJA 1RNLA 5FFZA 4MTDA 1YYVA 5DD4A 2O0YA 4QLCU 3T8TA 2Q2EA 2QBYB 3E97A 1G3SA 1LDKB 5L3DA 3MAJA 1ON1A 2OQRA 2QWWA 2P6SA 2PG4A 5CVUA 4CYDA 1SMTA 3H3UA 1BI3A 3K69A 1P4XA 2MLGA 1F4KA 1J59A 4AIKA 2E7XA 2G9WA 1MJ9A 6PAXA 5L3GA 2G7HA 3U2RA 5IT9Z 1JHHA 4UVCA 2MH2A 3CUQC 2O61A 1I27A 1IZ1A 1ZG3A 4BH9A 4H0EA 4AIJA 4I0BA 3KEOA 5DCMB 1LEBA 4P96A 3DF8A 3J80Z 3F6OA 4LGWA 2IW5A 4ESFA 1KU3A 3REOA 5KVRA 1GHCA 3M8FA 1I6XA 3FF5A 3QRFF 1WRJA 4MTEA 5D8LB 4BQAA 1JHFA 2EJRA 2GA1A 3N4MA 5DDGA 1KGSA 4KMFA 4ENNA 5D8KB 1RI7A 3K2ZA 1T2KA 3C3WA 2WWYA 2M87A 5CYVA 1TQPA 2DQLA 3WG9A 1BC8C 2VONA 2OBPA 4I02A 4Q5SF 3KCCA 4LFUA 3K0LA 4XSXF 1T38A 1D3YA 2XUBA 2DK8A 1U8RA 2ZKZA 2IRFG 4ENMA 2UXXA 2AS5F 1FP1D 3EDPA 2Y48A 3D5LA 2RGVA 1O3SA 2A5YB 3TO9A 1IN6A 2FA5A 3HIFA 1TNSA 2EV6A 2P6TA 3V7RA 1O7LA 4LD5A 2DW4A 1BOAA 1ON2A 2IVMA 1IXSB 4LK0F 2NRAC 3J80K 1ZRCA 2H94A 3P9IA 1HXDA 5HLIA 2IPQX 5BQTA 4A12A 3JSPA 4EQQA 2STTA 5JFRA 3H92A 3E6DA 1CF7A 4HDUA 5IT9K 4HV6A 4M71A 2JSCA 4PGGA 5A2QZ 1DP7P 2WTEA 1YS6A 1HW2A 1MJAA 1IXCA 1Z1DA 2CG4A 5DD8A 3FXUA 3R6SA 2W24A 1K78A 4Q47A 2XASA 3VEPA 1WWXA 4AWXB 5E1ZB 2FBHA 4L18B 5J8FA 4KT5C 1Z6TA 1P92A 1Z91A 2ZMEA 3LQRA 3WGIA 3WGHA 1U3EM 3FMSA 3HSEA 5D5UB 3DPLC 3ZN1A 4EGZA 4OIOF 3PQKA 2PN6A 4S04A 1TQIA 3WTXC 4IXAA 4Q4ZF 3GX4X 5DCFA 2GQQA 5DYMA 4BAYA 1TNTA 1ZYRF 4F7ZA 3F21A 3RPUA 2Z9OA 3FXQA 3MCZA 3GF2A 1JGSA 2HTSA 2A3SA 5LEKA 4MHGA 3R0AA 3ZP5A 3RKYA 5J8CA 3KZYA 4PGHA 1T98A 3ECOA 1BM9A 3IWZA 4DQ2A 4G9YA 4HX8A 1B59A 2L3DA 3RIRA 1GVJA 1P2FA 1TLHB 5D4SA 5TJJA 1HKSA 3LFKA 1X3UA 3RKXA 2Z5UA 1S7AA 2ZNYA 3EQLF 3LA7A 3L09A 1B1BA 2E7WA 5CLSA 2LDUA 4EJOA 4M6XA 3K1MA 2EV5A 2KIUA 3HHHA 3ISPA 1S6LA 2NS0A 2F5CA 2Q0OA 3KEQA 4UHTA 3QPHA 2P5LC 2BYVE 2QLZA 2E1NA 1XDUA 3FMQA 2EA4A 1SFUA 5BPIA 5D6EA 2JZYA 4G6QA 3GXOA 2ETHA 4I2OA 1Z6RA 1XGMA 5J6XA 2DO7A 3L7WA 3I54A 2K4BA 2E1CA 2V1DA 2M45A 1YQAA 1F1ZA 4KDPA 3CDHA 4LJZF 2YPRA 4CHUA 3AAFA 3MWMA 3WTWC 1IN8A 4EMSA 5D4RA 4HF2A 2R3SA 4Q48A 4B8XA 1FT9A 1F5TA 2DPUA 4FT8A 4HOBA 5EEHA 4OIQF 1SFEA 2XIGA 3I0TA 2BGCA 3P7NA 3SFZA 4HF1A 1OPCA 5D6FA 4XBFA 4RS8A 4M73A 3EUHA 4M9ZA 3SHFA 3WTUC 1G4DA 2VT2A 2V1UA 1L0OC 1EH8A 3F3XA 1FWZA 3DFGA 3HRTA 4I0AA 4FHTA 3WGGA 3WTYC 4KUMA 1FNNA 4L5IA 1TQMA 4O6JA 3FM5A 3WTZA 3JW4A 3M8EA 4MQ9F 3O2PE 1LDJA 4GO1A 2LF8A 2RKHA 4TV7A 1P6RA 3TKYA 1FYLA 3TOBA 1ONVA 1V4RA 5CVIA 3U9GA 4U0WA 1KYZA 1KA8A 4ON0A 3GLXA 4UV8A 1BN5A 4LMYA 4YFNF 2XAHA 2PBIA 1D8KA 1G3YA 2A61A 4IRIA 2JRTA 2K4JA 3ZMZA 2HZTA 2V79A 2W85A 3F22A 3M7GA 2ISZA 4N9HA 3MQ0A 3HRSA 4HBLA 1XMKA 5JVTA 2KIFA 3KLNA 2DI3A 1JE8A 2MA3A 3HRUA 2VXZA 3BOQA 2V9VA 3I4PA 3ROUA 2HQNA 4RGXA 4R1HA 2EFWA 1UFMA 2DFIA 3HTUA 1IUYA 1K7AA 4NHJA 4EM1A 3LSTA 1ZAOA 1FYMA 3IKTA 2HKXA 1R1TA 4XLPF 3HTSB 4XLNF 1SD7A 2H6BA 4RGRA 4BHPA 2JPCA 1E2XA 4CZZA 5K1YA 3M9AA 4U0YA 1ZG1A 4KIBA 1FSHA 4PDKA 2QQ9A 1R1UA 4XRFA 2OAZA 1XGNA 3KFWX 1ZHFA 2FBIA 1HSTA 3D0SA 4KMUX 3RKWA 2XAFA 5A2QK 1OR7A 2F2EA 1K78B 1KQ9A 1YW8A 1U5TB 3COAC 3B02A 2EWNA 2DTRA 1YLFA 1Q1HA 1W5TA 4MQVA 1KYWA 3ZMUA 2K7LA 3L9FA 1O7FA 3R60A 4NQWA 2RNJA 2IJLA 2HWVA 3BJOA 4L0YB 2ADUA 3TQNA 2QBYA 2CWEA 2HFHA 4G6DA 2L4AA 3RJPA 2BE5F 4HAMA 4N0BA 5FLXK 4KIFA 2O03A 3ZMVA 3KP7A 1ZLJA 4YFXF 1LJ9A 1P4WA 3E6MA 3T0YA 2L02A 3GFJA 2ZFWA 2Y75A 4I7HA 2YR2A 4CICA 4B09A 2DK5A 3OOPA 4UNOA 2ZBKA 4LLGF 3HOTA 2UWMA 4PZJA 3FZVA 3ML6A 4HV5A 5CVVA 2EFOA 5ILVA 2W57A 5L3BA 4Y13A 1UCRA 3DPTA 4UVAA 1LB2A 4MGRA 3T5XA 3VFZA 3DQVC 3I59B 3C18A 1XDSA 1T39A 3RYRA 3E5UA 5LGNA 4G7OF 2VBWA 4RAZA 2GZWA 2RN7A 1ULYA 4L9NA 1B4AA 5JHUA 3O6BB 4OIRF 3G3ZA 1S8NA 2GAUA 2D45A 1XGSA 1J9IA 1XD7A 2IA2A 3MEXA 4FX0A 3RPQA 2C6YA 2IA1A 2PI0A 2LSOA 5ICGA 3WE3A 1ZLKA 1HSJA 5ICFA 2VOOA 2F5EA 2XV4S 4P55A 1QZYA 2OU2A 3J81Z 1KQ0A 2XAGA 3I71A 1ZGAA 4HZFA 2CQKA 2VODA 5E8GA 1EH6A 3R0JA 4EJVA 1DPUA 1LVAA 3BDDA 4M74A 2BV6A 3KE2A 3BJ6A 4L9TA 2CW0F 4HQEA 2L4MA 2FF4A 2O8XA 2OZ6A 3F8CA 3ULQB 4BYYA 3MFKA 2HEOA 4ETSA 3JAMK 3K1NA 4R8HA 5JI6A 3BROA 3QP6A 1KU7A 5LRSA 4U7DA 2PLYA 5K5OA 5CVRA 3GZ5A 2R7DA 5CVJA 1XSVA 1PUEE 1XMAA 5FB2A 4E70A 4L9VA 3Q9SA 1BBYA 3T1BA 1ZG5A 1H9TA 4KNYA 3TOAA 1JXSA 4KYWA 5FD5A 3EETA 3WE2A 1DPRA 3ZMDA 3GFIA 1EV7A 4LK1F 2RV8A 4IRHA 2IP2A 2D2WA 1BI0A 4RGSA 3PQJA 5D5VB 4L0ZB 3EYYA 3V8JA 2DT5A 1O3RA 1MJBA 2XHKA 4U0VA 1YO5C 2PJPA 3ELKA 1IW7F 1R7JA 1FPQA 4ENKA 5BPDA 1R36A 1MDMB 1ZRFA 5HLHA 4WXDA 2K86A 1ZH5A 1ODDA 3J81K 4ZZDA 1WSUA 1W7PB 4JK1X 4WF2A 2GXBA 1TW2A 2P5VA 1T6SA 4M9XA 2KJBA 4O5VA 3ZN0A 2XAQA 2EFNA 3HYIA 1D5VA 5E18F 1I1GA 1Y0UA 3V7SA 3BY6A 4RB2C 1FX7A 5LRRA 2GXGA 2QM3A 3V7CA 5D5WB 1OYIA 5K5RA 3QOPA 3CJNA 3TGNA 3VOEA 1IN5A 3IRRA 1WI9A 1IF1A 1W7PA 2P7CB 3CUQA 1U6GA 2XGXA 3QU6A 1FOKA 5LBQA 4EJUA 4HLYA 2FNAA 5AIPA 1CF7B 2WC2A 3G73A 1FBQA 3K1PA 2O6GE 1ZREA 4HX7A 1K6OA 4CGZA 1MDMA 3KP5A 2HR3A 1S3JA 2DQRA 3P9KA 1V3FA 1OMIA 2MBFA 4QWQA 3LQQA 1IAWA 2ZJ2A 5LHHA 3CLOA 1FY7A 3L2CA 2HQRA 4Z2YA 1YIOA 3NQOA 4AD9A 2PMUA 3RTRA 3GFLA 5HDGA 4L5JA 2R7FA 1J75A 4OINF 3JTHA 4LB6B 2KJCA 4AIHA 4ZYGA 1SMYF 3MZHA 1QZZA 4UV9A 1PP7U 5E1WA 2VN2A 1H0MA 2LNBA 2QQBA 1STZA 4XSZF 4MEXF 2P7VB 3Q9VA 3E5QA 4EV0A 1BIAA 2H6CA 4EJWA 4DNCA 3ABUA 5ED4A 2MH9A 5HS8A 1FLIA 2A68F 5DUKA 5H6QA 1K79A 1FSEA 1O3QA 1R5GA 5F64A 2NYXA 3HSFA 1J7KA 1HQCA 1H9GA 3ZMTA 5AIQA 1RIOH 4OMZA 1W5SA 2FU4A 3Q5FA 3IHUA 1XGOA 4G7ZF 3F72A 2W84A 3QAHA 4S05A 4MEYF 1R22A 4NB5A 1U2WA 1MKMA 2A6EF 2ELHA 4L9JA 5D5XB 3HHGA 1QNTA 5JR3A 2HTJA 3DEUA 3WTTC 1OKRA 3OV8A 2GWRA 3L00A 3QU3A 1IRFA 4BNCA 2JT1A 2V6CA 2YU3A 2JPBA 3N97A 2OZUA 3R61A 4I98B 4IVNA 4RGUA 2RDPA 5LEJA 1BIBA 4CO8A 1S29A 3DKWA 2DLLA 1SFXA 2V1XA 4P5OA 4WXHA 2DU9A 2VBZA 4UXNA 1G6NA 2WV0A 3FX3A 1TTYA 4BXUA 3DP7A 3FM3A 3W6JB 4U7BA 1QO0D 1XCVA 2FSWA 5CJ9A 2L01A 2VE8A 1MGTA 1YW9A 4P9FA 4EM2A 3WODF 4K2EA 1U5TC 3LWFA 1NHAA 3I59A 1FBUA 5HOOA 2BEOA 3I64A 3RDIA 3E5XA 3FXRA 5ILSA 3KP6A 3NRVA 3T8RA 5FD6A 2FBKA 1XB4A 4ZYDA 2P8TA 1SAXA 3F8MA 2NNNA 3PFIA 4N9IA 4CXFA 2ZXJA 4HX4A 1IN4A 3C1DA 4HLXA 5E8IA 5F6FA 4FX4A 5TRDA 3HOSA 3R4KA 2FE3A 1SD6A 1HKQA 3CO6C 5LHIA 4A0XA 5L3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYH X;  2KKO A;  3E3V A;  4RB3 C;  2TDX A;  3CO7 C;  4A6D A;  3KP4 A;  3ECH A;  4MNU A;  1SD4 A;  3I5U A;  2M5W A;  2O3F A;  1FBS A;  3JAM Z;  3SZP A;  4HQM A;  2RC4 A;  2ACJ A;  3GZ6 A;  3TO6 A;  5H20 A;  1R00 A;  1WKM A;  2DAO A;  4EM0 B;  5HS7 A;  4A0Y A;  4OOI A;  4G94 A;  3M1E A;  1P4A A;  4KN4 X;  5LLQ A;  4ASN A;  5K5Q A;  1IXR C;  2J5O A;  4HA8 A;  4LLL A;  4R79 A;  1WQ2 A;  3GWZ A;  4M9S A;  1A04 A;  4KIG A;  3FWE A;  3WU1 B;  4G7H F;  4IHT A;  2ESN A;  4CDG A;  2PQ8 A;  4G8X A;  2ZNZ A;  2HGC A;  1R5H A;  3W6K B;  3FHZ A;  4BHB A;  4ZYH A;  4WK8 F;  3ZQ7 A;  5LGT A;  1ZN2 A;  2JTV A;  2YSR A;  3CUO A;  1YS7 A;  2X4H A;  2EFP A;  2VBX A;  2XRN A;  4HYE A;  3JTG A;  3F8N A;  1UST A;  2L54 A;  1LEA A;  5L3E A;  4YII A;  2MC3 A;  1PP8 F;  1GXP A;  1B9N A;  5DEQ A;  3IKV A;  1ZAR A;  4LG0 B;  2UXN A;  2COM A;  4WX9 A;  4JBA A;  2M1B A;  3ERE D;  1SD5 A;  4I09 A;  4KA4 A;  1HKT A;  2DBB A;  3KET A;  3P9C A;  3TDU C;  3E6C C;  3E6B A;  4GXO A;  4GYG A;  1E17 A;  5HDN A;  1I1S A;  5F1R A;  3IL2 A;  4KN7 X;  2OD5 A;  2A69 F;  2OQG A;  3ABT A;  4HF0 A;  4A5M A;  5HS9 A;  2EV0 A;  2QQA A;  4Y15 A;  1XSD A;  2IT0 A;  2PEX A;  2KRF A;  4OU0 A;  1HBX G;  1YTY A;  1J5Y A;  3RYP A;  3F6V A;  2ZCW A;  4ENJ A;  4EGY A;  1OYY A;  3VB2 A;  5E17 F;  1O57 A;  1BI2 A;  1KU9 A;  1YFH A;  4A2U A;  4ZZL A;  4EJT A;  3O3K A;  3DV8 A;  1RUO A;  4A6E A;  2EK5 A;  2X0L A;  1VTN C;  1IRG A;  3QP5 A;  2QYO A;  2RVC A;  2FEZ A;  5FLX Z;  1AWC A;  2QUF A;  2HDC A;  1UHW A;  2VC0 A;  3GO5 A;  2ZME B;  3LAJ A;  3C7J A;  1D8J A;  3FMR A;  4YFK F;  1PDN C;  3WTS C;  3F8F A;  5BOX A;  3GFM A;  5DV5 A;  1GXQ A;  2EB7 A;  2CFX A;  3I53 A;  1I5Z A;  2DPD A;  2XRO A;  2NNY A;  2A6H F;  2Z99 A;  1QPM A;  2GA2 A;  5ICE A;  3IRQ A;  1F9N A;  2D1V A;  4IRG A;  3SQN A;  3HSR A;  2UZK A;  4IPA A;  2FQ3 A;  4PCQ A;  2YX4 A;  5DUI A;  5HLG A;  2CGP A;  4M72 A;  3SXY A;  4D0P A;  2FML A;  4ZH4 F;  4BHC A;  1MZB A;  5BS6 A;  3IC7 A;  2PMH A;  5ILU A;  2D1H A;  4KIC A;  1U78 A;  3CTA A;  2HKO A;  1USS A;  1FYK A;  3QPT A;  1G3W A;  2A07 F;  2M8E A;  5FFX A;  2VE9 A;  3LAP A;  1CGP A;  2H09 A;  2W25 A;  3KP3 A;  2VC1 A;  4P9U A;  3EYI A;  1MD0 A;  2Y0M A;  1REP C;  2FMY A;  2MLK A;  1L3L A;  2B0L A;  3ZMS A;  2LKP A;  1RUN A;  3MZY A;  4U88 A;  3DXJ F;  1FP2 A;  2QEN A;  1R23 A;  1YG2 A;  2STW A;  2P5K A;  1QGP A;  4IF4 A;  2VBY A;  1BC7 C;  2Q8K A;  4I01 A;  2YX7 A;  2CO5 A;  2Z3Y A;  1BI1 A;  1YW7 A;  2Z33 A;  1Z05 A;  4OIP F;  4M6Y A;  4AVP A;  3J7A O;  4IJA A;  1J0R A;  5HDK A;  1XCB A;  2HYF A;  3LA2 A;  4RAY A;  3HRM A;  4OMY A;  4A0Z A;  5E20 A;  2FOK A;  1HW1 A;  2MD5 A;  2HS5 A;  1DDN A;  4LG0 A;  5LGU A;  5DCM A;  4ESJ A;  1DUX C;  1T0F A;  5KK1 A;  1TBX A;  1IN7 A;  2EFQ A;  2J5P A;  3H3Z A;  5ICC A;  5EEG A;  2CSO A;  1FZP B;  4O3M A;  2XKO A;  5FGM A;  4WCG A;  2H27 A;  2BBY A;  1HW5 A;  5IT3 A;  2QVO A;  2QZ8 A;  1Z9C A;  1J2X A;  5FO5 A;  2CYY A;  3BJA A;  1AOY A;  2OA4 A;  2RQP A;  5LHG A;  3BZ6 A;  3LA3 A;  1B6A A;  4HW0 A;  3GW2 A;  3V4G A;  1KQ8 A;  4LB5 A;  2AXL A;  3ZPL A;  1W7P D;  1LQ1 A;  4WWC A;  1U5T A;  3GVA A;  4IHS A;  1B9M A;  3K9T A;  2VOP A;  4ESB A;  2GIV A;  4GGG A;  3V8L A;  5HVQ C;  3F8B A;  4YG2 F;  1C0W A;  2HOE A;  4UUV A;  2XAJ A;  3TO7 A;  4RB0 A;  4HDV A;  4RB1 A;  4WXC A;  2IA0 A;  2FNP A;  3TDZ C;  1BJA A;  2EA2 A;  4GCV A;  3WTV C;  3BP8 A;  3GEZ A;  1ZRD A;  3JSO A;  5E1X A;  4Y17 A;  3RI4 A;  1R1V A;  1G3T A;  1RZ4 A;  1S7O A;  4UVB A;  5H6R A;  1XSX A;  4ZYE A;  3HUG A;  1OYW A;  1UHM A;  5ERI A;  1LDD A;  3KLO A;  2FXA A;  4YIF A;  3GUD A;  1O3T A;  2VT3 A;  1UB9 A;  2ESH A;  5L3F A;  4A5N A;  2P4W A;  2F5F A;  2KIM A;  5BMZ A;  2PFB A;  1EH7 A;  1LNW A;  2XKP A;  2FRH A;  1TW3 A;  2ZO4 A;  3CUQ B;  4JQF A;  2XVC A;  3BWG A;  3NEU A;  4LLN A;  4KFC A;  2HYG D;  3U1D A;  3B73 A;  1FC3 A;  1W4M A;  2NAZ A;  3SZT A;  3KZZ A;  3F23 A;  3KP2 A;  1KU2 A;  1QBJ A;  3I58 A;  3IWF A;  3BPX A;  2F5D A;  3WU0 A;  2ISY A;  1R58 A;  5AON A;  4GYI A;  3V8K A;  1XN7 A;  2K27 A;  2LF7 A;  3S2W A;  1QQI A;  4EVI A;  3VOD A;  2K02 A;  1Z7U A;  2M30 A;  2G7U A;  3BPV A;  1ZGJ A;  1RNL A;  5FFZ A;  4MTD A;  1YYV A;  5DD4 A;  2O0Y A;  4QLC U;  3T8T A;  2Q2E A;  2QBY B;  3E97 A;  1G3S A;  1LDK B;  5L3D A;  3MAJ A;  1ON1 A;  2OQR A;  2QWW A;  2P6S A;  2PG4 A;  5CVU A;  4CYD A;  1SMT A;  3H3U A;  1BI3 A;  3K69 A;  1P4X A;  2MLG A;  1F4K A;  1J59 A;  4AIK A;  2E7X A;  2G9W A;  1MJ9 A;  6PAX A;  5L3G A;  2G7H A;  3U2R A;  5IT9 Z;  1JHH A;  4UVC A;  2MH2 A;  3CUQ C;  2O61 A;  1I27 A;  1IZ1 A;  1ZG3 A;  4BH9 A;  4H0E A;  4AIJ A;  4I0B A;  3KEO A;  5DCM B;  1LEB A;  4P96 A;  3DF8 A;  3J80 Z;  3F6O A;  4LGW A;  2IW5 A;  4ESF A;  1KU3 A;  3REO A;  5KVR A;  1GHC A;  3M8F A;  1I6X A;  3FF5 A;  3QRF F;  1WRJ A;  4MTE A;  5D8L B;  4BQA A;  1JHF A;  2EJR A;  2GA1 A;  3N4M A;  5DDG A;  1KGS A;  4KMF A;  4ENN A;  5D8K B;  1RI7 A;  3K2Z A;  1T2K A;  3C3W A;  2WWY A;  2M87 A;  5CYV A;  1TQP A;  2DQL A;  3WG9 A;  1BC8 C;  2VON A;  2OBP A;  4I02 A;  4Q5S F;  3KCC A;  4LFU A;  3K0L A;  4XSX F;  1T38 A;  1D3Y A;  2XUB A;  2DK8 A;  1U8R A;  2ZKZ A;  2IRF G;  4ENM A;  2UXX A;  2AS5 F;  1FP1 D;  3EDP A;  2Y48 A;  3D5L A;  2RGV A;  1O3S A;  2A5Y B;  3TO9 A;  1IN6 A;  2FA5 A;  3HIF A;  1TNS A;  2EV6 A;  2P6T A;  3V7R A;  1O7L A;  4LD5 A;  2DW4 A;  1BOA A;  1ON2 A;  2IVM A;  1IXS B;  4LK0 F;  2NRA C;  3J80 K;  1ZRC A;  2H94 A;  3P9I A;  1HXD A;  5HLI A;  2IPQ X;  5BQT A;  4A12 A;  3JSP A;  4EQQ A;  2STT A;  5JFR A;  3H92 A;  3E6D A;  1CF7 A;  4HDU A;  5IT9 K;  4HV6 A;  4M71 A;  2JSC A;  4PGG A;  5A2Q Z;  1DP7 P;  2WTE A;  1YS6 A;  1HW2 A;  1MJA A;  1IXC A;  1Z1D A;  2CG4 A;  5DD8 A;  3FXU A;  3R6S A;  2W24 A;  1K78 A;  4Q47 A;  2XAS A;  3VEP A;  1WWX A;  4AWX B;  5E1Z B;  2FBH A;  4L18 B;  5J8F A;  4KT5 C;  1Z6T A;  1P92 A;  1Z91 A;  2ZME A;  3LQR A;  3WGI A;  3WGH A;  1U3E M;  3FMS A;  3HSE A;  5D5U B;  3DPL C;  3ZN1 A;  4EGZ A;  4OIO F;  3PQK A;  2PN6 A;  4S04 A;  1TQI A;  3WTX C;  4IXA A;  4Q4Z F;  3GX4 X;  5DCF A;  2GQQ A;  5DYM A;  4BAY A;  1TNT A;  1ZYR F;  4F7Z A;  3F21 A;  3RPU A;  2Z9O A;  3FXQ A;  3MCZ A;  3GF2 A;  1JGS A;  2HTS A;  2A3S A;  5LEK A;  4MHG A;  3R0A A;  3ZP5 A;  3RKY A;  5J8C A;  3KZY A;  4PGH A;  1T98 A;  3ECO A;  1BM9 A;  3IWZ A;  4DQ2 A;  4G9Y A;  4HX8 A;  1B59 A;  2L3D A;  3RIR A;  1GVJ A;  1P2F A;  1TLH B;  5D4S A;  5TJJ A;  1HKS A;  3LFK A;  1X3U A;  3RKX A;  2Z5U A;  1S7A A;  2ZNY A;  3EQL F;  3LA7 A;  3L09 A;  1B1B A;  2E7W A;  5CLS A;  2LDU A;  4EJO A;  4M6X A;  3K1M A;  2EV5 A;  2KIU A;  3HHH A;  3ISP A;  1S6L A;  2NS0 A;  2F5C A;  2Q0O A;  3KEQ A;  4UHT A;  3QPH A;  2P5L C;  2BYV E;  2QLZ A;  2E1N A;  1XDU A;  3FMQ A;  2EA4 A;  1SFU A;  5BPI A;  5D6E A;  2JZY A;  4G6Q A;  3GXO A;  2ETH A;  4I2O A;  1Z6R A;  1XGM A;  5J6X A;  2DO7 A;  3L7W A;  3I54 A;  2K4B A;  2E1C A;  2V1D A;  2M45 A;  1YQA A;  1F1Z A;  4KDP A;  3CDH A;  4LJZ F;  2YPR A;  4CHU A;  3AAF A;  3MWM A;  3WTW C;  1IN8 A;  4EMS A;  5D4R A;  4HF2 A;  2R3S A;  4Q48 A;  4B8X A;  1FT9 A;  1F5T A;  2DPU A;  4FT8 A;  4HOB A;  5EEH A;  4OIQ F;  1SFE A;  2XIG A;  3I0T A;  2BGC A;  3P7N A;  3SFZ A;  4HF1 A;  1OPC A;  5D6F A;  4XBF A;  4RS8 A;  4M73 A;  3EUH A;  4M9Z A;  3SHF A;  3WTU C;  1G4D A;  2VT2 A;  2V1U A;  1L0O C;  1EH8 A;  3F3X A;  1FWZ A;  3DFG A;  3HRT A;  4I0A A;  4FHT A;  3WGG A;  3WTY C;  4KUM A;  1FNN A;  4L5I A;  1TQM A;  4O6J A;  3FM5 A;  3WTZ A;  3JW4 A;  3M8E A;  4MQ9 F;  3O2P E;  1LDJ A;  4GO1 A;  2LF8 A;  2RKH A;  4TV7 A;  1P6R A;  3TKY A;  1FYL A;  3TOB A;  1ONV A;  1V4R A;  5CVI A;  3U9G A;  4U0W A;  1KYZ A;  1KA8 A;  4ON0 A;  3GLX A;  4UV8 A;  1BN5 A;  4LMY A;  4YFN F;  2XAH A;  2PBI A;  1D8K A;  1G3Y A;  2A61 A;  4IRI A;  2JRT A;  2K4J A;  3ZMZ A;  2HZT A;  2V79 A;  2W85 A;  3F22 A;  3M7G A;  2ISZ A;  4N9H A;  3MQ0 A;  3HRS A;  4HBL A;  1XMK A;  5JVT A;  2KIF A;  3KLN A;  2DI3 A;  1JE8 A;  2MA3 A;  3HRU A;  2VXZ A;  3BOQ A;  2V9V A;  3I4P A;  3ROU A;  2HQN A;  4RGX A;  4R1H A;  2EFW A;  1UFM A;  2DFI A;  3HTU A;  1IUY A;  1K7A A;  4NHJ A;  4EM1 A;  3LST A;  1ZAO A;  1FYM A;  3IKT A;  2HKX A;  1R1T A;  4XLP F;  3HTS B;  4XLN F;  1SD7 A;  2H6B A;  4RGR A;  4BHP A;  2JPC A;  1E2X A;  4CZZ A;  5K1Y A;  3M9A A;  4U0Y A;  1ZG1 A;  4KIB A;  1FSH A;  4PDK A;  2QQ9 A;  1R1U A;  4XRF A;  2OAZ A;  1XGN A;  3KFW X;  1ZHF A;  2FBI A;  1HST A;  3D0S A;  4KMU X;  3RKW A;  2XAF A;  5A2Q K;  1OR7 A;  2F2E A;  1K78 B;  1KQ9 A;  1YW8 A;  1U5T B;  3COA C;  3B02 A;  2EWN A;  2DTR A;  1YLF A;  1Q1H A;  1W5T A;  4MQV A;  1KYW A;  3ZMU A;  2K7L A;  3L9F A;  1O7F A;  3R60 A;  4NQW A;  2RNJ A;  2IJL A;  2HWV A;  3BJO A;  4L0Y B;  2ADU A;  3TQN A;  2QBY A;  2CWE A;  2HFH A;  4G6D A;  2L4A A;  3RJP A;  2BE5 F;  4HAM A;  4N0B A;  5FLX K;  4KIF A;  2O03 A;  3ZMV A;  3KP7 A;  1ZLJ A;  4YFX F;  1LJ9 A;  1P4W A;  3E6M A;  3T0Y A;  2L02 A;  3GFJ A;  2ZFW A;  2Y75 A;  4I7H A;  2YR2 A;  4CIC A;  4B09 A;  2DK5 A;  3OOP A;  4UNO A;  2ZBK A;  4LLG F;  3HOT A;  2UWM A;  4PZJ A;  3FZV A;  3ML6 A;  4HV5 A;  5CVV A;  2EFO A;  5ILV A;  2W57 A;  5L3B A;  4Y13 A;  1UCR A;  3DPT A;  4UVA A;  1LB2 A;  4MGR A;  3T5X A;  3VFZ A;  3DQV C;  3I59 B;  3C18 A;  1XDS A;  1T39 A;  3RYR A;  3E5U A;  5LGN A;  4G7O F;  2VBW A;  4RAZ A;  2GZW A;  2RN7 A;  1ULY A;  4L9N A;  1B4A A;  5JHU A;  3O6B B;  4OIR F;  3G3Z A;  1S8N A;  2GAU A;  2D45 A;  1XGS A;  1J9I A;  1XD7 A;  2IA2 A;  3MEX A;  4FX0 A;  3RPQ A;  2C6Y A;  2IA1 A;  2PI0 A;  2LSO A;  5ICG A;  3WE3 A;  1ZLK A;  1HSJ A;  5ICF A;  2VOO A;  2F5E A;  2XV4 S;  4P55 A;  1QZY A;  2OU2 A;  3J81 Z;  1KQ0 A;  2XAG A;  3I71 A;  1ZGA A;  4HZF A;  2CQK A;  2VOD A;  5E8G A;  1EH6 A;  3R0J A;  4EJV A;  1DPU A;  1LVA A;  3BDD A;  4M74 A;  2BV6 A;  3KE2 A;  3BJ6 A;  4L9T A;  2CW0 F;  4HQE A;  2L4M A;  2FF4 A;  2O8X A;  2OZ6 A;  3F8C A;  3ULQ B;  4BYY A;  3MFK A;  2HEO A;  4ETS A;  3JAM K;  3K1N A;  4R8H A;  5JI6 A;  3BRO A;  3QP6 A;  1KU7 A;  5LRS A;  4U7D A;  2PLY A;  5K5O A;  5CVR A;  3GZ5 A;  2R7D A;  5CVJ A;  1XSV A;  1PUE E;  1XMA A;  5FB2 A;  4E70 A;  4L9V A;  3Q9S A;  1BBY A;  3T1B A;  1ZG5 A;  1H9T A;  4KNY A;  3TOA A;  1JXS A;  4KYW A;  5FD5 A;  3EET A;  3WE2 A;  1DPR A;  3ZMD A;  3GFI A;  1EV7 A;  4LK1 F;  2RV8 A;  4IRH A;  2IP2 A;  2D2W A;  1BI0 A;  4RGS A;  3PQJ A;  5D5V B;  4L0Z B;  3EYY A;  3V8J A;  2DT5 A;  1O3R A;  1MJB A;  2XHK A;  4U0V A;  1YO5 C;  2PJP A;  3ELK A;  1IW7 F;  1R7J A;  1FPQ A;  4ENK A;  5BPD A;  1R36 A;  1MDM B;  1ZRF A;  5HLH A;  4WXD A;  2K86 A;  1ZH5 A;  1ODD A;  3J81 K;  4ZZD A;  1WSU A;  1W7P B;  4JK1 X;  4WF2 A;  2GXB A;  1TW2 A;  2P5V A;  1T6S A;  4M9X A;  2KJB A;  4O5V A;  3ZN0 A;  2XAQ A;  2EFN A;  3HYI A;  1D5V A;  5E18 F;  1I1G A;  1Y0U A;  3V7S A;  3BY6 A;  4RB2 C;  1FX7 A;  5LRR A;  2GXG A;  2QM3 A;  3V7C A;  5D5W B;  1OYI A;  5K5R A;  3QOP A;  3CJN A;  3TGN A;  3VOE A;  1IN5 A;  3IRR A;  1WI9 A;  1IF1 A;  1W7P A;  2P7C B;  3CUQ A;  1U6G A;  2XGX A;  3QU6 A;  1FOK A;  5LBQ A;  4EJU A;  4HLY A;  2FNA A;  5AIP A;  1CF7 B;  2WC2 A;  3G73 A;  1FBQ A;  3K1P A;  2O6G E;  1ZRE A;  4HX7 A;  1K6O A;  4CGZ A;  1MDM A;  3KP5 A;  2HR3 A;  1S3J A;  2DQR A;  3P9K A;  1V3F A;  1OMI A;  2MBF A;  4QWQ A;  3LQQ A;  1IAW A;  2ZJ2 A;  5LHH A;  3CLO A;  1FY7 A;  3L2C A;  2HQR A;  4Z2Y A;  1YIO A;  3NQO A;  4AD9 A;  2PMU A;  3RTR A;  3GFL A;  5HDG A;  4L5J A;  2R7F A;  1J75 A;  4OIN F;  3JTH A;  4LB6 B;  2KJC A;  4AIH A;  4ZYG A;  1SMY F;  3MZH A;  1QZZ A;  4UV9 A;  1PP7 U;  5E1W A;  2VN2 A;  1H0M A;  2LNB A;  2QQB A;  1STZ A;  4XSZ F;  4MEX F;  2P7V B;  3Q9V A;  3E5Q A;  4EV0 A;  1BIA A;  2H6C A;  4EJW A;  4DNC A;  3ABU A;  5ED4 A;  2MH9 A;  5HS8 A;  1FLI A;  2A68 F;  5DUK A;  5H6Q A;  1K79 A;  1FSE A;  1O3Q A;  1R5G A;  5F64 A;  2NYX A;  3HSF A;  1J7K A;  1HQC A;  1H9G A;  3ZMT A;  5AIQ A;  1RIO H;  4OMZ A;  1W5S A;  2FU4 A;  3Q5F A;  3IHU A;  1XGO A;  4G7Z F;  3F72 A;  2W84 A;  3QAH A;  4S05 A;  4MEY F;  1R22 A;  4NB5 A;  1U2W A;  1MKM A;  2A6E F;  2ELH A;  4L9J A;  5D5X B;  3HHG A;  1QNT A;  5JR3 A;  2HTJ A;  3DEU A;  3WTT C;  1OKR A;  3OV8 A;  2GWR A;  3L00 A;  3QU3 A;  1IRF A;  4BNC A;  2JT1 A;  2V6C A;  2YU3 A;  2JPB A;  3N97 A;  2OZU A;  3R61 A;  4I98 B;  4IVN A;  4RGU A;  2RDP A;  5LEJ A;  1BIB A;  4CO8 A;  1S29 A;  3DKW A;  2DLL A;  1SFX A;  2V1X A;  4P5O A;  4WXH A;  2DU9 A;  2VBZ A;  4UXN A;  1G6N A;  2WV0 A;  3FX3 A;  1TTY A;  4BXU A;  3DP7 A;  3FM3 A;  3W6J B;  4U7B A;  1QO0 D;  1XCV A;  2FSW A;  5CJ9 A;  2L01 A;  2VE8 A;  1MGT A;  1YW9 A;  4P9F A;  4EM2 A;  3WOD F;  4K2E A;  1U5T C;  3LWF A;  1NHA A;  3I59 A;  1FBU A;  5HOO A;  2BEO A;  3I64 A;  3RDI A;  3E5X A;  3FXR A;  5ILS A;  3KP6 A;  3NRV A;  3T8R A;  5FD6 A;  2FBK A;  1XB4 A;  4ZYD A;  2P8T A;  1SAX A;  3F8M A;  2NNN A;  3PFI A;  4N9I A;  4CXF A;  2ZXJ A;  4HX4 A;  1IN4 A;  3C1D A;  4HLX A;  5E8I A;  5F6F A;  4FX4 A;  5TRD A;  3HOS A;  3R4K A;  2FE3 A;  1SD6 A;  1HKQ A;  3CO6 C;  5LHI A;  4A0X A;  5L3C A; 
#chains in the Genus database with same CATH topology
 4GFB A;  1E3P A;  3PUF A;  1NK3 P;  3GYH X;  1IDY A;  1ZK8 A;  2JA2 A;  2KKO A;  2CUF A;  2K9N A;  3E3V A;  3AG1 H;  2YUS A;  2ZXI A;  4RB3 C;  3BLY A;  2TDX A;  3CO7 C;  3G71 I;  2IAI A;  4A6D A;  3KP4 A;  1TWC J;  3ECH A;  5IYC J;  3OSG A;  5CQG A;  4MNU A;  3LL7 A;  4X6A J;  1SD4 A;  3I5U A;  2H1K A;  4CCM A;  3HGY A;  2LLK A;  2M5W A;  1MIJ A;  2ZXH A;  3OMY A;  3RCO A;  2O3F A;  4BU2 A;  1V5E A;  3ZXS A;  1FBS A;  5KAF C;  3JAM Z;  2A05 A;  3SZP A;  4HQM A;  2R4G A;  2RC4 A;  3K4C A;  2ACJ A;  2DMU A;  3GZ6 A;  2PX9 A;  2FX0 A;  3TO6 A;  5H20 A;  3GTK J;  1R00 A;  1WKM A;  2DAO A;  1SVO A;  4EM0 B;  5HS7 A;  4A0Y A;  4Y7N J;  1BR4 A;  4OOI A;  4G94 A;  5FLV A;  3M1E A;  1VQ8 I;  3PFY A;  1P4A A;  1VQ5 I;  4KN4 X;  2X48 A;  1R5I D;  1OCO H;  3TMO A;  4AVZ A;  4ASN A;  5LLQ A;  1K4S A;  3JRI A;  5K5Q A;  3OYL A;  2OTJ I;  1IXR C;  2J5O A;  4HA8 A;  4LLL A;  4R79 A;  1WQ2 A;  3GWZ A;  4M9S A;  3GTG J;  2R5Z B;  1A04 A;  2HQA A;  4KIG A;  3FWE A;  3WU1 B;  4G7H F;  4IHT A;  2E71 A;  4DGW B;  2ESN A;  4CDG A;  2PQ8 A;  4G8X A;  4M3G A;  2XB5 A;  2ZNZ A;  3JRE A;  2HGC A;  4UB6 C;  1I50 J;  1OIS A;  3J7Y J;  1F36 A;  1R5H A;  3W6K B;  3FHZ A;  4BHB A;  3QWL A;  5J1U A;  2VJ4 A;  3K4M A;  4RM3 A;  4ZYH A;  1S72 I;  4MO7 A;  4WK8 F;  2XSD C;  3ZQ7 A;  1UHS A;  3DU6 A;  2XB0 X;  5DTD A;  5LGT A;  3W2V A;  1X3W B;  3MMY B;  1ZN2 A;  2JTV A;  3FXO A;  3LSM A;  2YSR A;  3CUO A;  1LFP A;  1YS7 A;  2X4H A;  2EFP A;  2VBX A;  3OYC A;  3BCA A;  2XRN A;  4HYE A;  3JTG A;  3F8N A;  1UST A;  4LOC A;  3PIP F;  2L54 A;  1B72 B;  3OIO A;  1LE8 A;  1ETO A;  1LEA A;  5L3E A;  3CD6 I;  4IOA F;  4YII A;  3HL2 A;  4UY8 I;  2MC3 A;  2A5W A;  3TP0 A;  1PP8 F;  1B8I A;  1XPX A;  5J1R A;  1IRX A;  2GLO A;  3CZ6 A;  1N25 A;  4CYC A;  1GXP A;  1B9N A;  3GTQ J;  2I8D A;  5DEQ A;  3IKV A;  1ZAR A;  1TWG J;  1TZL A;  4DBR A;  2HPM A;  4BJT A;  4LG0 B;  2UXN A;  2COM A;  4E7Z A;  3S17 J;  4WX9 A;  2OJE D;  4UUS B;  4JBA A;  2M1B A;  3ERE D;  1SD5 A;  4I09 A;  4KA4 A;  1HKT A;  2MFZ A;  3TP3 A;  2XF6 A;  3SEZ A;  2DBB A;  3KET A;  3P9C A;  3TDU C;  3LSR A;  2COB A;  1YIJ I;  2L2O A;  3E6C C;  3E6B A;  4GXO A;  4GYG A;  1E17 A;  3BG3 A;  2O8K A;  5HDN A;  1I1S A;  5F1R A;  1JT6 A;  3IL2 A;  1M1E B;  2IXS A;  3DBH B;  4KN7 X;  4CSW A;  2B7E A;  2OD5 A;  5M3M J;  2A69 F;  2X85 A;  2CRG A;  2OQG A;  3ABT A;  4HF0 A;  4A5M A;  2M34 A;  1T95 A;  4PUS A;  2QA4 I;  2BOL A;  4G6T B;  5HS9 A;  2EV0 A;  2QQA A;  4Y15 A;  4Y4R A;  1XSD A;  1Y6I A;  2IT0 A;  2PEX A;  2X51 A;  1T8I A;  3BG9 A;  1UAA A;  2KRF A;  1B8I B;  5EG0 A;  4OU0 A;  1HBX G;  1YTY A;  1J5Y A;  3RYP A;  3ZQF A;  5GPA A;  2QSH X;  2W1O A;  3F6V A;  2ZCW A;  4ENJ A;  2AQE A;  3CMM A;  4RLF A;  4EGY A;  3CCJ I;  1POG A;  1OYY A;  3VB2 A;  4PFP A;  4XL9 A;  1WVR A;  5E17 F;  2M0M A;  2NVY J;  1O57 A;  1BI2 A;  1VZ0 A;  3GME A;  1KU9 A;  2CW7 A;  1YFH A;  3GTL J;  4A2U A;  4ZZL A;  3M07 A;  4EJT A;  3O3K A;  3BTJ A;  3DV8 A;  1RUO A;  4B4C A;  2XRL A;  4A6E A;  2EK5 A;  2F4O B;  1W36 C;  2X0L A;  4MLO A;  4C2U A;  3O8G A;  3RKQ A;  1OR7 C;  3S8P A;  1JKQ C;  2DT6 A;  3U21 A;  2L9R A;  1VTN C;  3BQY A;  1IRG A;  3QP5 A;  4HNU A;  2QYO A;  2RVC A;  3GTM J;  3UKG A;  2FEZ A;  1TL8 A;  5FLX Z;  1BOB A;  1W1W E;  3OYI A;  3OYD A;  1MH3 A;  2QUF A;  1AWC A;  3A1Y A;  2HDC A;  1UHW A;  2VC0 A;  3GO5 A;  2LY2 A;  2ZME B;  1O4X A;  3LAJ A;  3C7J A;  4JOM A;  2UV1 A;  2NVU B;  2MG4 A;  1D8J A;  3RPU D;  4C3I J;  2R7R A;  1D1C A;  3ONQ A;  3FXM A;  4AC0 A;  4B43 A;  3FMR A;  4YFK F;  1PDN C;  4NC8 A;  3WTS C;  3F8F A;  2ZJR F;  5BOX A;  3GFM A;  2FOW A;  5DV5 A;  2GBY A;  1GXQ A;  3G4S I;  2EB7 A;  1R4M B;  2CFX A;  3I53 A;  3PNY A;  1I5Z A;  5E79 C;  3A0H C;  5F0C A;  4E7L A;  2DPD A;  3QPS A;  2HOT A;  2XRO A;  4E7S A;  2E5Z A;  2LC2 A;  2NNY A;  4W97 A;  2HVS A;  2A6H F;  2X6Y A;  2Z99 A;  1QPM A;  2GA2 A;  5ICE A;  1JKO C;  1IGN A;  3IRQ A;  1F9N A;  2D1V A;  2VJJ A;  2Y0S A;  4HST A;  4IKF A;  4IRG A;  4BUP A;  3SQN A;  3HSR A;  2DDA A;  2UZK A;  2OCC H;  4IPA A;  2FQ3 A;  4PCQ A;  2ZJP F;  1JGG A;  4BJ6 C;  2YX4 A;  5DUI A;  5HLG A;  1J09 A;  4M72 A;  2CGP A;  3SXY A;  2MAB A;  4D0P A;  2QGU A;  2FML A;  4ZH4 F;  5FRO A;  3HEF A;  4BHC A;  2L7M P;  3PUB A;  4E7I A;  1MZB A;  5BS6 A;  3IC7 A;  2PMH A;  3W3C A;  3TW6 A;  5ILU A;  3PO3 J;  4A3B J;  3NWS A;  2D1H A;  4KIC A;  1U78 A;  3PSI A;  3CTA A;  2HKO A;  1USS A;  1RES A;  3ZQI A;  3LSJ A;  4NUB A;  1R6R A;  1FYK A;  3QPT A;  3H5A A;  3CCE I;  5E3L A;  1G3W A;  2A07 F;  2M8E A;  1RET A;  5FFX A;  2VE9 A;  1VQ7 I;  1I39 A;  2QSF X;  1Y39 A;  3LAP A;  3CCR I;  3ERM A;  1CGP A;  2H09 A;  2W25 A;  3KP3 A;  2VC1 A;  4P9U A;  3DBL B;  2Y0M A;  1MD0 A;  3EYI A;  1REP C;  2FMY A;  3A0B C;  3KPH A;  2MLK A;  2XGC A;  1L3L A;  2B0L A;  3ZMS A;  5DM6 F;  5FRN A;  2LKP A;  1RUN A;  1VQO I;  3MZY A;  4U88 A;  3NAU A;  1FOY A;  3VYR B;  3DXJ F;  2P0W A;  3H9J A;  2RAE A;  1FP2 A;  2QEN A;  5LFA A;  5FKL A;  1R23 A;  1YG2 A;  2R7S A;  1HA8 A;  2STW A;  4A3G J;  2P5K A;  4IQ4 A;  2E35 A;  1QGP A;  4IF4 A;  4YEL A;  1TP4 A;  2OCE A;  2VBY A;  5EG0 B;  4RA2 A;  3PSF A;  1BC7 C;  2V1N A;  2Q8K A;  4I01 A;  2YX7 A;  4F92 B;  1WJD A;  2OTL I;  2CO5 A;  2WV1 A;  3SDG A;  2Z3Y A;  3DTK A;  3OS0 A;  1BI1 A;  1YW7 A;  2CQQ A;  3ASO H;  3BG5 A;  1Z67 A;  2Z33 A;  3MZ8 A;  3OYA A;  3QYF A;  1Z05 A;  4OIP F;  4M6Y A;  4PJN A;  3FK7 A;  1U0J A;  4B3A A;  4AVP A;  4D9J A;  2WAE A;  4DZP A;  4F52 A;  2DOA A;  3J7A O;  5IYD J;  2E19 A;  4IJA A;  1J0R A;  4NC6 A;  5HDK A;  1XCB A;  2HYF A;  3LA2 A;  1DQU A;  4HRI A;  1BW6 A;  4RAY A;  3A01 B;  3HRM A;  4OMY A;  1D1B A;  4A0Z A;  1WJB A;  2FOK A;  1HW1 A;  2FJ1 A;  3QPL A;  5E20 A;  2MD5 A;  2HS5 A;  1DDN A;  3ZGK A;  1OCT C;  5FKN A;  4LG0 A;  5J3L A;  5LGU A;  1BA5 A;  3HG9 A;  2XF7 A;  5K7H A;  3Q3S A;  2JJ7 A;  4Y33 A;  1K83 J;  3HOY J;  3M8J A;  2AXT C;  5DCM A;  1I6H J;  4ESJ A;  1DUX C;  2R5Z A;  1T0F A;  5KK1 A;  2DOF A;  1TBX A;  4XRM A;  1IN7 A;  2EFQ A;  2J5P A;  3H3Z A;  5ICC A;  4LIV A;  2E36 A;  3CP8 A;  3LNQ A;  5EEG A;  2CSO A;  5LD2 C;  1FZP B;  4C9Y A;  2VQC A;  4O3M A;  1OCP A;  2XKO A;  4I99 C;  3DPU A;  5FGM A;  4WCG A;  2K40 A;  2NVQ J;  2BBY A;  2H27 A;  3AKZ A;  1HW5 A;  5IT3 A;  2L9N A;  1ETX A;  5HNF A;  1DU6 A;  2QVO A;  2QZ8 A;  1Z9C A;  1J2X A;  5FO5 A;  2CYY A;  3BJA A;  1AOY A;  2DA6 A;  2OA4 A;  3K4J A;  1YI2 I;  2RQP A;  5LHG A;  3L2R A;  3BZ6 A;  2JA7 J;  3LA3 A;  2LY1 A;  2CV2 A;  2IEK A;  1B6A A;  3W2W A;  4HW0 A;  1A35 A;  2X6W A;  3GW2 A;  5B1A H;  1ZGW A;  3V4G A;  1KQ8 A;  4LB5 A;  2XAU A;  2AXL A;  2DA5 A;  3KYD B;  2L7Z A;  2CQ7 A;  3ZPL A;  5JLW A;  2JMW A;  1CQT A;  2CV0 A;  1W7P D;  1QPI A;  1LQ1 A;  4WWC A;  4B44 A;  4HNT A;  2LKX A;  4FTH A;  3CDI A;  4ZTF A;  3KYC B;  2Y69 H;  1U5T A;  2LK2 A;  4A3L J;  4M3F A;  3GVA A;  4IHS A;  1B9M A;  3K9T A;  1WJC A;  2ELK A;  2VOP A;  2KIQ A;  4ESB A;  2DYS H;  2GIV A;  4GGG A;  1JJ6 C;  1PUF A;  3V8L A;  5HVQ C;  3F8B A;  3IUO A;  3CCL I;  4YG2 F;  1VI0 A;  1C0W A;  2HOE A;  4UUV A;  2OPT A;  4UB8 C;  3VYT B;  1JUS A;  1WJ5 A;  2XAJ A;  4M6V A;  3TO7 A;  3OOU A;  1VQ4 I;  4RB0 A;  4JYK A;  4HDV A;  2KRC A;  3W6V A;  4RB1 A;  2WAQ A;  4WXC A;  2IA0 A;  2FNP A;  3TDZ C;  2ME0 A;  1VQL I;  1BJA A;  1FTT A;  2IGM A;  2EA2 A;  3J7A Y;  4GCV A;  3WTV C;  3BP8 A;  2L0K A;  3GEZ A;  1ZRD A;  2X1E A;  3JSO A;  1QZE A;  5E1X A;  1D5Y A;  4Y17 A;  3RI4 A;  2HYJ A;  3D1N I;  3C2H A;  1R1V A;  4F93 B;  3H0D A;  1G3T A;  1RZ4 A;  1S7O A;  4UVB A;  4B48 A;  5H6R A;  1OQY A;  1XSX A;  4ZYE A;  3HUG A;  2W82 A;  1OYW A;  1UHM A;  4BE0 A;  5ERI A;  1LDD A;  3KLO A;  3HGG A;  2V7F A;  1B72 A;  3A03 A;  2ECC A;  2FXA A;  2IGN A;  4YIF A;  3GUD A;  3MKL A;  1O3T A;  2VT3 A;  2JVG A;  1UB9 A;  2Y9Y A;  2ESH A;  5L3F A;  4A5N A;  1Y0N A;  2P4W A;  2F5F A;  2KIM A;  5BMZ A;  2PFB A;  1EH7 A;  1LNW A;  3CCU I;  1LVK A;  2XKP A;  2FRH A;  4BBR J;  1TW3 A;  3S1M J;  3JRD A;  2QKM B;  2WB1 N;  2K9M A;  2ZO4 A;  3CUQ B;  4Y3O A;  4BKX A;  3CC4 I;  1MBG A;  1JTX A;  3AG4 H;  4XLC A;  3OYJ A;  3TED A;  4JQF A;  2XVC A;  3BWG A;  3NEU A;  4LLN A;  1GT0 C;  4KFC A;  2HYG D;  3U1D A;  1FOW A;  2WA0 A;  3EUA A;  4F55 A;  1YJ9 I;  3B73 A;  4XOP A;  1FC3 A;  1W4M A;  2NAZ A;  3SZT A;  4B1R A;  3KZZ A;  4XIC A;  1AKH A;  4JX4 A;  1X3Z B;  2X6X A;  3F23 A;  3WU2 C;  3F9K A;  3KP2 A;  1KU2 A;  3EUK L;  1QBJ A;  3I58 A;  3IWF A;  3BPX A;  3AL0 C;  2X6O A;  2D5V A;  2F5D A;  3WU0 A;  2ISY A;  2Z16 A;  1R58 A;  1G2H A;  2MSY A;  5AON A;  4GYI A;  3V8K A;  3BC8 A;  1XN7 A;  3CLQ A;  3FKJ A;  2K27 A;  2LF7 A;  3NWT A;  2BY0 A;  2EPF A;  3H9G A;  4PJL A;  3S2W A;  2O5R A;  4RLQ A;  5IOY A;  1QQI A;  3L2W A;  5GPC A;  4EVI A;  3VOD A;  2KP6 A;  2AO9 A;  2TRT A;  2K02 A;  1Z7U A;  2M30 A;  3MKZ A;  2G7U A;  3BPV A;  1ZGJ A;  1RNL A;  4C3H J;  5FFZ A;  4MTD A;  4BE2 A;  1YYV A;  2DXI A;  5DD4 A;  2E34 A;  2O0Y A;  4QLC U;  2ZB9 A;  3T8T A;  2Q2E A;  2V9P A;  4FE4 A;  2QBY B;  3E97 A;  3DEE A;  1G3S A;  1LDK B;  5L3D A;  3MAJ A;  1JUM A;  1ON1 A;  2OQR A;  2QWW A;  2JRM A;  2P6S A;  2PG4 A;  1ZQ3 P;  1APL C;  5CVU A;  1TC3 C;  2CU7 A;  4CYD A;  1LUJ B;  2LBF B;  1SMT A;  2H1L A;  3H3U A;  5IP6 A;  3HOZ J;  2I10 A;  4UUT A;  2E60 A;  1BI3 A;  2M7A A;  3K69 A;  3HZJ A;  4HPQ A;  1P4X A;  3OYB A;  2Y30 A;  5GP9 A;  2H8W A;  2MLG A;  1F4K A;  4Z6Y A;  1J59 A;  2BHZ A;  4AIK A;  2E7X A;  2G9W A;  1MJ9 A;  6PAX A;  3RQ4 A;  5FKM A;  5L3G A;  3HOU J;  2G7H A;  3U2R A;  1G8X A;  5IT9 Z;  5JLX A;  1JHH A;  4UVC A;  2MH2 A;  3CUQ C;  4D1Q A;  1I27 A;  2O61 A;  1IZ1 A;  1ZG3 A;  2VJ5 A;  4BH9 A;  3IP4 B;  3FBN B;  4DBQ A;  2VJI A;  3FHN A;  2R0Q C;  4H0E A;  4AIJ A;  1EA3 A;  4I0B A;  3BZC A;  5DM7 F;  3KEO A;  5DCM B;  2V6E A;  4P96 A;  3DF8 A;  3J80 Z;  1LEB A;  3F6O A;  9ANT A;  4LGW A;  1VND A;  1DP3 A;  2IW5 A;  5IP7 J;  4IZZ A;  1Z3Y A;  2ZJQ F;  1H89 C;  3BR3 A;  3WHB A;  2JUG A;  2HU9 A;  3GCM A;  3H5R A;  4ESF A;  4F91 B;  1KU3 A;  3REO A;  5FKK A;  3RSN A;  2DN0 A;  5KVR A;  1X2M A;  1W0T A;  1GHC A;  5CKT A;  3M8F A;  1I6X A;  3FF5 A;  3QRF F;  2VAS A;  1MSF C;  1WZ2 A;  1WRJ A;  4MTE A;  5D8L B;  4J00 A;  4BQA A;  1JHF A;  3OYK A;  3GTO J;  2EJR A;  2GA1 A;  3N4M A;  3S1Q J;  3G1O A;  4LIT A;  2QSG X;  1Y8R B;  2VI6 A;  5HOD A;  2OC6 A;  5DDG A;  1KGS A;  3DBR B;  4XON A;  4E7K A;  4KMF A;  1JJ8 C;  2LR8 A;  4ENN A;  2ECB A;  1FTZ A;  5D8K B;  2DFH A;  4JP0 A;  2R7X A;  3BTL A;  5IPA A;  1RI7 A;  2HPI A;  3I55 I;  4HEA 2;  3K2Z A;  2BY3 A;  1T2K A;  3C3W A;  2WWY A;  1MMD A;  2K3F A;  2M87 A;  5CYV A;  1TQP A;  2DQL A;  3WG9 A;  1BC8 C;  3HB9 A;  2VON A;  4X1E A;  2OBP A;  4I02 A;  1OCR H;  4Q5S F;  2ME6 A;  5JVG F;  3KCC A;  4LFU A;  3K0L A;  4XSX F;  1SFK A;  2VIX A;  1T38 A;  1D3Y A;  2XUB A;  2DK8 A;  2XPW A;  5F1J A;  1U8R A;  2ZKZ A;  2IRF G;  3PO2 J;  4ENM A;  2UXX A;  3OYG A;  3ZQG A;  3N05 A;  2ZXW H;  2AS5 F;  1FP1 D;  3EDP A;  2Y48 A;  2O7O A;  3D5L A;  2ZSI B;  2JN6 A;  3FBI B;  2KZV A;  5K7Z A;  2XSJ C;  2VXD A;  2RGV A;  1O3S A;  5IYB J;  2A5Y B;  2GOM A;  4XRS A;  4PFO A;  3TO9 A;  4BQQ A;  2A6T A;  2CS3 A;  2R5Y B;  2RRE A;  1VQK I;  3LSP A;  5BNG A;  1IN6 A;  2EH3 A;  2HOS A;  2FA5 A;  2V4J C;  3E1S A;  3LMM A;  3PL8 A;  3HIF A;  1TNS A;  2EV6 A;  1DU0 A;  2P6T A;  3V7R A;  1O7L A;  3M4O J;  2QCO A;  4LD5 A;  2DW4 A;  1BOA A;  1ON2 A;  2DYR H;  2XPU A;  1EKE A;  2IVM A;  2LRD A;  3S32 A;  5DS9 A;  2KQR A;  1IXS B;  4LK0 F;  2NRA C;  3J80 K;  1ETQ A;  1GDT A;  2AHQ A;  1ZRC A;  2H94 A;  2HNH A;  3P9I A;  1HXD A;  2EQR A;  2HZD A;  2XGD A;  2BVM A;  3KEY A;  4B3X A;  5KHD A;  3JRA A;  3IH2 A;  5HLI A;  2IPQ X;  3I56 I;  2MW8 A;  5BQT A;  4A12 A;  1IRZ A;  3JSP A;  4EQQ A;  1H88 C;  2BVL A;  5JFR A;  4PJJ A;  2STT A;  1X4O A;  3H92 A;  3E6D A;  1MBE A;  1CF7 A;  4AU7 A;  4HDU A;  1HDD C;  1XTA A;  5IT9 K;  3CJQ B;  4A3J J;  1MBJ A;  4HV6 A;  3S93 A;  4M71 A;  2JSC A;  4PGG A;  5A2Q Z;  1DP7 P;  2WTE A;  1YS6 A;  1HW2 A;  1HC8 A;  3ZQC A;  1MJA A;  1YRN A;  2OF7 A;  1IXC A;  1Z1D A;  4XKC A;  2CG4 A;  2M4K A;  1ETK A;  3FXU A;  5DD8 A;  3R6S A;  4FAS D;  1FMW A;  2ZSH B;  1WJE A;  3WG7 H;  3HKZ A;  3SJM A;  3A2K A;  2W24 A;  1WH5 A;  1JKP C;  2PMZ N;  1V54 H;  4Q47 A;  1K78 A;  2XAS A;  2KMU A;  3VEP A;  1WWX A;  3ABL H;  3GTJ J;  2HDW A;  4AWX B;  2QF7 A;  5E1Z B;  2FBH A;  5GAG J;  2VQH A;  3K4B A;  4L18 B;  5J8F A;  5K7F A;  4KT5 C;  4BJ5 C;  1Z6T A;  3BG7 A;  4C30 A;  5FRM A;  4A93 J;  1P92 A;  4AYB N;  4W1U A;  1Z91 A;  2ZME A;  3LQR A;  1X1A A;  3WGI A;  3WGH A;  1U3E M;  3FMS A;  3ZQL A;  3HSE A;  1AKH B;  2X1C A;  4BL0 B;  5D5U B;  1P7I A;  3G1M A;  3CJT B;  3DPL C;  3ZN1 A;  2VKD A;  4EGZ A;  4OIO F;  2QKL B;  3M3Y J;  3PQK A;  2PN6 A;  2NVT J;  1Z0X A;  4S04 A;  1D0Y A;  1TQI A;  4XK4 A;  3WTX C;  4IXA A;  1W0U A;  3CQZ J;  3V42 A;  4Q4Z F;  1BR1 A;  3LSG A;  4UUS A;  3GX4 X;  5DCF A;  1LFB A;  2GQQ A;  5DYM A;  2DJI A;  1U9O A;  3DLA A;  4BAY A;  4FCY A;  4IL6 C;  1TNT A;  1ZYR F;  1NG6 A;  4E6K G;  2FD5 A;  3RPU A;  4F7Z A;  3F21 A;  2Z9O A;  2PJR A;  1IV8 A;  3FXQ A;  5GAD J;  1QHH D;  3S1R J;  3MCZ A;  3GF2 A;  1JGS A;  2HTS A;  2A3S A;  5CQE A;  4MHG A;  5LEK A;  3R0A A;  1IJW C;  3IV5 A;  3ZP5 A;  1R4N B;  3FXJ A;  4NC7 A;  3RKY A;  3DWL E;  4OAZ A;  5J8C A;  3F0C A;  3KZY A;  2K9Q A;  3HOW J;  2CW8 A;  4PGH A;  4XNF A;  1X19 A;  1X1B A;  1T98 A;  1XX5 A;  3ECO A;  1X4P A;  1BW5 A;  1BM9 A;  3IWZ A;  4DQ2 A;  4G9Y A;  1X58 A;  4HX8 A;  1B59 A;  1ETV A;  4ZYA A;  2L3D A;  3RIR A;  1E3H A;  1GVJ A;  1P2F A;  3BR5 A;  1TLH B;  5D4S A;  4F3Q A;  1ZR4 A;  5TJJ A;  4CCO A;  1HKS A;  4IQJ A;  2E1O A;  3LFK A;  1X3U A;  2E2I J;  2ZC2 A;  2DCE A;  1A36 A;  1E3O C;  3RKX A;  2Z5U A;  1SC7 A;  1S7A A;  2ZNY A;  3EQL F;  3LA7 A;  3B6A A;  1YE9 A;  3L09 A;  1B1B A;  2E7W A;  1FEX A;  1Z3X A;  3LSK A;  5CLS A;  3DTE A;  2LDU A;  4EJO A;  2KFD A;  4XKB A;  4M6X A;  2K5C A;  5F27 A;  5IY5 H;  3K1M A;  2EV5 A;  2KIU A;  2CUJ A;  3HHH A;  3ISP A;  1NK2 P;  2Z2S B;  1S6L A;  2NS0 A;  3S14 J;  2F5C A;  2Q0O A;  1R9T J;  3KEQ A;  3BR0 A;  3A02 A;  4UHT A;  5F08 A;  2NS8 A;  1E0E A;  3QPH A;  3OYH A;  2P5L C;  4BBS J;  3SYT A;  1ZKG A;  2BYV E;  5FJ8 J;  2LFB A;  3S2H J;  3FXL A;  2QLZ A;  3DU5 A;  2E1N A;  1XDU A;  3FMQ A;  5B3S H;  5F0H A;  5JHF A;  2EA4 A;  1SFU A;  1SFO J;  1KZH A;  5BPI A;  3C2G A;  1MSE C;  5D6E A;  1MBK A;  2IBD A;  2JZY A;  4G6Q A;  1YHQ I;  4XLE A;  1ERD A;  3K70 C;  2DOE A;  2QQ8 A;  3GXO A;  1XC5 A;  2ETH A;  4I2O A;  4FET A;  4XQF A;  1Z6R A;  3OL3 A;  1XGM A;  5J6X A;  2DO7 A;  5EGO A;  3L7W A;  4D7N A;  3I54 A;  3DKX A;  1XG1 A;  2K4B A;  2E1C A;  1ZR2 A;  2V1D A;  2M45 A;  1YQA A;  1EJ9 A;  1F1Z A;  2VPR A;  2X1D A;  3CDH A;  4KDP A;  2L7K A;  3DTI A;  2XGE A;  4LJZ F;  2YPR A;  4XM3 A;  2BW3 B;  4CHU A;  3AAF A;  3K4K A;  2JQ7 A;  3MWM A;  4CUG A;  3WTW C;  1IN8 A;  3FK6 A;  4EMS A;  3K2A A;  4XOT A;  3ABM H;  2HVQ A;  5D4R A;  4HF2 A;  2R3S A;  4ZDL A;  4Q48 A;  4B8X A;  3OSF A;  1V5G A;  1FT9 A;  1F5T A;  2DPU A;  3SEQ A;  4FT8 A;  3ZR8 X;  1HOM A;  4HOB A;  2VKE A;  3CCQ I;  1T0F C;  3OYM A;  5EEH A;  1EF4 A;  4OIQ F;  5C4X J;  2R93 J;  2P81 A;  1SFE A;  2XIG A;  3I0T A;  2BGC A;  3P7N A;  3SFZ A;  4HF1 A;  2VL8 A;  3CCY A;  1OPC A;  3GBG A;  3JRG A;  5D6F A;  4XBF A;  1HF0 A;  4RS8 A;  4M73 A;  5HNH A;  4RM2 A;  3BTI A;  2R7W A;  3EUH A;  4OWR B;  4M9Z A;  1RR7 A;  1WPK A;  3OS1 A;  3SHF A;  3WTU C;  1G4D A;  2VT2 A;  2V1U A;  2ID6 A;  3H5N A;  1L0O C;  4BDZ A;  1EH8 A;  4GDF A;  2NOJ B;  3F3X A;  1FWZ A;  3DFG A;  3HRT A;  3I4M J;  4I0A A;  4FHT A;  3WGG A;  1VQN I;  3WTY C;  1MMS A;  3KZI C;  1NG7 A;  4LG3 A;  2CFO A;  4KT6 A;  3HKZ N;  4KUM A;  4CCK A;  1FNN A;  3I9V 2;  2F5V A;  4L5I A;  1TQM A;  1Z77 A;  4O6J A;  3FM5 A;  4DYR A;  1WJA A;  3WTZ A;  3JW4 A;  5J4Y A;  2RNG A;  3M8E A;  4MQ9 F;  2CV1 A;  3O2P E;  1LDJ A;  4GO1 A;  2LF8 A;  3RQI A;  2DMN A;  1UMQ A;  3VYS B;  2EZK A;  2RKH A;  4TV7 A;  4AYB A;  1P6R A;  3TKY A;  3K4L A;  1FYL A;  3TOB A;  4CCJ A;  4A3D J;  1ONV A;  2KRH A;  1V4R A;  1GVD A;  4II2 A;  5CVI A;  1SVM A;  3AFH A;  4U0W A;  1KYZ A;  1KA8 A;  3U9G A;  1VFC A;  1A6I A;  2HDD A;  3LSH A;  4ON0 A;  2V9K A;  4XLH A;  3GLX A;  4UV8 A;  1BN5 A;  4LMY A;  2F48 A;  4YFN F;  3I4N J;  1OLT A;  2XAH A;  2PBI A;  3S1N J;  4DW6 A;  4FQG A;  1XS9 A;  1D8K A;  1G3Y A;  1ORK A;  2A61 A;  4IRI A;  3L1P A;  2JRT A;  2K4J A;  2WAF A;  3CJR B;  3HDD A;  3FDY A;  3FKI J;  2KPM A;  3ZMZ A;  2HZT A;  2V79 A;  3H1C A;  2F6C A;  2W85 A;  3F22 A;  2M7B A;  3M7G A;  1G59 A;  2MYS A;  2DFF A;  4BEH A;  2ISZ A;  1V55 H;  4N9H A;  3MQ0 A;  1MBF A;  4EEF G;  3OYE A;  3HRS A;  4HBL A;  1XMK A;  5JVT A;  4AID A;  4BQO A;  1Y56 A;  2KIF A;  1MNE A;  2BXZ A;  2Y0S N;  3KLN A;  3HPG A;  2DI3 A;  1JE8 A;  2M4G A;  2MA3 A;  4A3M J;  2BXY A;  2F4I A;  3HRU A;  3IAM 2;  2VXZ A;  1X2N A;  5KNL A;  3S3N A;  3BOQ A;  3OR1 C;  3M1C A;  2V9V A;  1LE8 B;  2GIZ A;  3I4P A;  3KX2 A;  2R7V A;  3ROU A;  2HQN A;  5C3E J;  3DKY A;  4RGX A;  2G0E A;  3E0J B;  3OL4 A;  4R1H A;  2EFW A;  3BTC A;  1WH7 A;  1UFM A;  2W48 A;  2DFI A;  3HTU A;  1IUY A;  1K7A A;  4NHJ A;  4EM1 A;  3LST A;  1UEL B;  4ANJ A;  1F43 A;  5CPR B;  1ZAO A;  1FYM A;  2R7O A;  1D0X A;  2HKX A;  3IKT A;  1ETW A;  1R1T A;  4C2M J;  2DJN A;  4XLP F;  1LKX A;  4MFE A;  2VQG A;  1UZC A;  3DLL F;  3HTS B;  1T56 A;  4XLN F;  5C44 J;  1SD7 A;  2H6B A;  4RGR A;  2ELJ A;  1JT0 A;  4BHP A;  2JPC A;  3WHC A;  3OS2 A;  1FMV A;  1E2X A;  4CZZ A;  3ESW B;  4JX6 A;  2BW3 A;  4KIT B;  5K1Y A;  3M9A A;  4U0Y A;  3ZOB A;  4I6Z A;  4HSR A;  1S5L C;  3ZQH A;  2HXO A;  1ZG1 A;  4IEJ A;  4KIB A;  1FSH A;  4PDK A;  1FJL A;  4ZTJ A;  2QQ9 A;  1R1U A;  4XRF A;  3JRB A;  2JA5 J;  3FIS A;  2M2E A;  2OAZ A;  3DCF A;  4YIR X;  3TL4 X;  1XGN A;  3KFW X;  1ZHF A;  4C3J J;  4A3K J;  2NXN B;  2FBI A;  1HST A;  1TT5 B;  3D0S A;  4KMU X;  3RKW A;  3CCS I;  2XPV A;  2XAF A;  5A2Q K;  1OR7 A;  2F2E A;  4FIS A;  1K78 B;  1KQ9 A;  1YW8 A;  1IV6 A;  3JR9 A;  1U5T B;  3COA C;  3B02 A;  4IHX A;  2EWN A;  2DTR A;  3JRF A;  1YLF A;  1Q1H A;  3ZQQ A;  1GLN A;  1W5T A;  2E1M B;  4MQV A;  1KYW A;  2JSP A;  4DYQ A;  3ZMU A;  1WJF A;  5EF6 A;  2K7L A;  3L9F A;  1QA6 A;  1O7F A;  3S3O A;  3R60 A;  4NQW A;  2RNJ A;  2IJL A;  2HWV A;  3D5R C;  3BJO A;  2EZL A;  3SFI A;  4L0Y B;  2ADU A;  3TQN A;  3CCM I;  2QBY A;  3LFU A;  1V5F A;  1PJR A;  4AM3 A;  2CWE A;  1ETY A;  1OFC X;  2HFH A;  2DFE A;  4G6D A;  2L4A A;  4II3 A;  1SAU A;  1WGX A;  3RJP A;  2BE5 F;  4HAM A;  5EZG A;  2EIK H;  4N0B A;  5FLX K;  3EPZ A;  4KIF A;  2O03 A;  3ZMV A;  1ENH A;  3KP7 A;  3ZRG A;  2H8R A;  1ZLJ A;  4YFX F;  1LJ9 A;  1P4W A;  4A3I J;  3E6M A;  5EYR A;  1AHD P;  4CA0 A;  1QRY A;  2L9S A;  3OY9 A;  4XMY A;  3T0Y A;  1N75 A;  4PJM A;  2L02 A;  2WB1 A;  4XOR A;  2R7U A;  3A4C A;  3GFJ A;  2ZFW A;  2Y75 A;  4E7J A;  1Z7L A;  3OR2 C;  4I7H A;  2YR2 A;  4CIC A;  3Q0W A;  2UUZ A;  4B09 A;  3VPR A;  4N4N B;  2DK5 A;  2CQN A;  4D5F A;  3JRH A;  3OOP A;  3SZG A;  1MMG A;  4UNO A;  4AUX A;  2ZBK A;  3AL0 B;  4LLG F;  3PNV A;  4OAY A;  3HOT A;  5F04 A;  2UWM A;  4PZJ A;  3FZV A;  4XID A;  1VF9 A;  3ML6 A;  4HV5 A;  5CVV A;  4QIW N;  2EFO A;  1GV2 A;  3FIW A;  5ILV A;  1LFU P;  2W57 A;  2DA1 A;  2IS2 A;  5L3B A;  4Y13 A;  1S7E A;  1VQ9 I;  1UCR A;  2VUM J;  3DPT A;  4UVA A;  1LB2 A;  4MGR A;  1P9Q C;  2XF5 A;  2CQX A;  3T5X A;  1OCC H;  3VFZ A;  2F4M B;  3DQV C;  3I59 B;  3EUH C;  3PM1 A;  1PUF B;  3C18 A;  1XDS A;  2K9L A;  1T39 A;  3RYR A;  3E5U A;  5LGN A;  4G7O F;  3OIP A;  4L5E A;  2IGK A;  2LRE A;  2VBW A;  3MD2 A;  3HUG B;  2GZW A;  2RN7 A;  4RAZ A;  1ULY A;  4L9N A;  3KYL A;  2E2J J;  1B4A A;  5JHU A;  4D5C A;  4PK4 A;  1BJZ A;  4PSX A;  3O6B B;  4OIR F;  3G3Z A;  2PMZ A;  1S8N A;  2GAU A;  2D45 A;  1K6Y A;  1YX5 A;  5J1Y A;  2EBI A;  1BR2 A;  1XGS A;  4DJA A;  1J9I A;  1XD7 A;  2IA2 A;  2LVS A;  4XLA A;  5M5Y J;  3MEX A;  3H0G J;  1PVE A;  4FX0 A;  3RPQ A;  3QOD A;  3S15 J;  2C6Y A;  4MFD A;  3UNG C;  1IO2 A;  2HOA A;  4NQW B;  2DA2 A;  2IA1 A;  3X2Q H;  2ZFU A;  3JRC A;  2PI0 A;  5J47 A;  2LSO A;  4RAG A;  4HNV A;  3TBI A;  2Q2E B;  5TIS C;  3VSK A;  2IS6 A;  5ICG A;  2X9D A;  3WE3 A;  1ZLK A;  2HVR A;  1FIA A;  2VB6 A;  2OUM A;  1HSJ A;  4NDL A;  2WAQ N;  5ICF A;  3GZN B;  4DIQ A;  2KDZ A;  1IUF A;  2VOO A;  2KHM A;  1X1P A;  2LD5 A;  2EIJ H;  2F5E A;  1P7J A;  2XV4 S;  2LYC A;  4P55 A;  2EIL H;  1QZY A;  4V19 K;  2OU2 A;  1DGR M;  2M3A A;  3OYF A;  4BGD A;  4IHW A;  4XLF A;  2R5Y A;  3J81 Z;  1QVU A;  1KQ0 A;  2HI3 A;  3ASN H;  2KZG A;  3W2A A;  2XAG A;  3I71 A;  1I3A A;  1ZGA A;  4HZF A;  2CQK A;  3CMA I;  2VOD A;  1W5C C;  5E8G A;  2LBF A;  1EH6 A;  2JA6 J;  1FOX A;  1GUU A;  4M3B A;  2B9S A;  3R0J A;  2DA7 A;  4EJV A;  2E5N A;  1DPU A;  2CJJ A;  3E7L A;  4ZDP A;  4B47 A;  4V2F A;  1LVA A;  3BDD A;  4M74 A;  2BV6 A;  3QQA A;  3KE2 A;  3BJ6 A;  4G12 A;  4L9T A;  1I3Q J;  2V26 A;  1WCM J;  1U8B A;  2CW0 F;  4HQE A;  5KCM A;  5B66 C;  5M5W J;  2L4M A;  2CUZ A;  1ITY A;  3BR1 A;  2FF4 A;  5EJC A;  2O8X A;  4PSW A;  2OZ6 A;  3F8C A;  2KT0 A;  3ULQ B;  2AQF A;  1JKR C;  4BYY A;  3K70 D;  1H8A C;  3DEW A;  3MFK A;  2HEO A;  4ETS A;  3JAM K;  3IH4 A;  3K1N A;  4R8H A;  5JI6 A;  3BRO A;  2L7F P;  4CH7 A;  3QP6 A;  1KU7 A;  4BS9 A;  5LRS A;  3GTP J;  4U7D A;  2PLY A;  1QVT A;  4N4O B;  2R92 J;  5K5O A;  5CVR A;  2KIS A;  3GLL A;  2LMD A;  3P5J A;  3S3M A;  2VKV A;  1XMX A;  3GZ5 A;  3QYB A;  1WHU A;  2R7D A;  5CVJ A;  2GXA A;  4GRI A;  1XSV A;  1NTC A;  5M5X J;  3CDL A;  5IP9 J;  3MN2 A;  2MD0 A;  1PUE E;  1XMA A;  5H2F C;  4E70 A;  4U87 A;  4L9V A;  2WBM A;  5FB2 A;  3Q9S A;  1BBY A;  1A5J A;  3T1B A;  1ZG5 A;  1H9T A;  3PIO F;  2E1M C;  4BEH B;  4KNY A;  3TOA A;  3HXL A;  4BAC A;  1JXS A;  4XN0 A;  3CME I;  4KYW A;  5FD5 A;  4IHY A;  3EET A;  1QHG A;  3WE2 A;  3HOX J;  1DPR A;  2DMP A;  3ZMD A;  3GFI A;  3CC7 I;  2DMT A;  1N77 A;  1EV7 A;  4LK1 F;  3S16 J;  4E4H A;  2RV8 A;  4X0G A;  4IRH A;  2IP2 A;  5B5E C;  4IOC F;  1N78 A;  2D2W A;  3UR3 C;  1BI0 A;  4RGS A;  3PQJ A;  5D5V B;  1GV5 A;  1SAN A;  3HPH A;  3BR2 A;  4L0Z B;  3EYY A;  3V8J A;  2DT5 A;  3K7A J;  1HDP A;  1KON A;  4XRS G;  1O3R A;  1MJB A;  2XHK A;  4U0V A;  3L2Q A;  1YO5 C;  3BR6 A;  2PJP A;  4A3F J;  3ELK A;  1VQM I;  1IW7 F;  4CZC A;  1R7J A;  1RPW A;  1FPQ A;  2WY8 Q;  4ENK A;  5BPD A;  1R36 A;  1MDM B;  3H35 A;  1YRN B;  1ZRF A;  5HLH A;  4WXD A;  3S2D J;  2YS9 A;  2K86 A;  1ZH5 A;  3HC7 A;  4MIM A;  2HQ5 A;  4JX5 A;  1ODD A;  3VWB A;  2Q1Z B;  2Y2Z A;  3Q0V A;  3J81 K;  2RQQ A;  3KIO A;  1QU3 A;  4ZZD A;  1WSU A;  4I76 A;  4DZJ A;  2R7T A;  3MKY B;  1W7P B;  4JK1 X;  1MND A;  4D7M A;  2R7Z J;  4WF2 A;  2GXB A;  1OCZ H;  2M9H A;  4BY7 J;  1TW2 A;  2P5V A;  1JI8 A;  4QPQ A;  1T6S A;  4M9X A;  2KJB A;  4O5V A;  3ZN0 A;  3CC2 I;  2W00 A;  2KDO A;  2XAQ A;  1SVL A;  2EFN A;  2JK3 A;  3AG3 H;  3HYI A;  1U9N A;  4ZC3 A;  1D5V A;  2JUC A;  1Y1W J;  5E18 F;  2L9V A;  5KAI C;  1I1G A;  4FE7 A;  1VQ6 I;  2Y9Z A;  4CYC B;  1Y0U A;  3V7S A;  2FQ4 A;  2XC7 A;  3BY6 A;  1PYV A;  4RB2 C;  4J01 A;  1FX7 A;  2M0C A;  2N8G A;  5LRR A;  2VLA A;  2BY2 A;  2GXG A;  4YRV A;  2QM3 A;  2EZH A;  3V7C A;  5D5W B;  2R7Q A;  1OYI A;  5K5R A;  1K4T A;  3CCV I;  2K85 A;  1X1D A;  3QOP A;  3CJN A;  4BE1 A;  4M3D A;  5EEA A;  1RKT A;  3TGN A;  2DA3 A;  3VOE A;  2DDB A;  3VSL A;  1IN5 A;  1ZTR A;  2HXI A;  1TT0 A;  3C2B A;  2LOO A;  3IRR A;  3K10 A;  1WI9 A;  3BZK A;  1IF1 A;  1W7P A;  2P7C B;  3CUQ A;  1U6G A;  2XGX A;  3QU6 A;  2CMP A;  3CF2 A;  1DGW Y;  1FOK A;  5LBQ A;  4BXF A;  1OJL A;  4EJU A;  4HLY A;  4E7H A;  2FNA A;  3SDB A;  5AIP A;  1CF7 B;  2KLO A;  2WC2 A;  3G73 A;  1FBQ A;  3K1P A;  3OWT A;  2O6G E;  3U1K A;  4HX7 A;  1ZRE A;  2W7N A;  3LOC A;  1K6O A;  1MDM A;  4CGZ A;  1Z21 A;  3TW7 A;  3KP5 A;  2HR3 A;  4DOZ A;  1S3J A;  2DQR A;  3P9K A;  1V3F A;  3VYU B;  3ZCO A;  3MVP A;  1OMI A;  1ZEL A;  5GAE J;  5EGO B;  2MBF A;  3HJE A;  2Y31 A;  4QWQ A;  3LQQ A;  1IAW A;  2IGO A;  2L5Q A;  2VQL A;  2ZJ2 A;  3CLO A;  5LHH A;  2QEX I;  4IO9 F;  3O8H A;  1FY7 A;  3L2C A;  1YIT I;  2HQR A;  4ZJZ A;  4YEJ A;  3IH3 A;  3AG2 H;  1UG0 A;  2LY9 A;  1RKW A;  1K61 A;  3OIQ A;  4Z2Y A;  1YX3 A;  1D1A A;  1YIO A;  3NQO A;  3L2U A;  1D0Z A;  4AD9 A;  2PMU A;  3RZD J;  4XR6 A;  3RTR A;  2IS4 A;  3HBL A;  3GFL A;  3CF5 F;  5HDG A;  4J19 A;  4L5J A;  4DYC A;  2TCT A;  2R7F A;  2I5U A;  1HLV A;  1IDZ A;  5IOZ A;  1YJW I;  4OIN F;  3JTH A;  1J75 A;  4LB6 B;  3H3V K;  2KJC A;  4RDU A;  4AIH A;  4ZYG A;  4XKV A;  1SMY F;  3MZH A;  1QZZ A;  4UV9 A;  3OYN A;  2WY7 Q;  1PP7 U;  3K4N A;  5E1W A;  2VN2 A;  1Y8Q B;  4Y52 J;  2DT7 B;  1H0M A;  3QOE A;  2LNB A;  2QQB A;  1STZ A;  4NBQ A;  2KL4 A;  2LKS A;  4XN3 A;  4XSZ F;  5F0F A;  4C2T A;  4MEX F;  2P7V B;  3Q9V A;  4NNJ A;  3HM5 A;  1S9H A;  3E5Q A;  4EV0 A;  2LP0 A;  1IG7 A;  1BIA A;  2H6C A;  4EJW A;  4QTR A;  4DNC A;  4V2G A;  1Q1V A;  3ABU A;  5ED4 A;  2MH9 A;  2BZT A;  2B63 J;  4IX7 A;  1WI3 A;  5HS8 A;  4QPO A;  4A69 C;  1FLI A;  1MH4 A;  2VKH A;  2A68 F;  3QYE A;  5DUK A;  5H6Q A;  3J7Z I;  4A3E J;  1ACI A;  2E2H J;  1K79 A;  1FSE A;  4PJ0 C;  2FUG 2;  1O3Q A;  3K6G A;  1MNM C;  4ABZ A;  2VPL A;  1R5G A;  4RMN A;  2NYX A;  5F64 A;  3HSF A;  1RR8 C;  2O9L A;  4QSH A;  1MMA A;  1J7K A;  3VDX A;  1HQC A;  1H9G A;  2NS7 A;  3ZMT A;  2K9S A;  5AIQ A;  5FLM J;  1RIO H;  3CP2 A;  4OMZ A;  2NVX J;  5E3O A;  1W5S A;  2FU4 A;  3Q5F A;  3IHU A;  3L2V A;  1XGO A;  1SEU A;  4G7Z F;  3H9Q A;  4KJZ A;  1W36 D;  3F72 A;  2DOD A;  2W4S A;  2W84 A;  3QAH A;  4S05 A;  5C4J J;  3CMY A;  1Y1V J;  4MEY F;  1R22 A;  1UJ8 A;  2CUE A;  5J4V A;  4NB5 A;  1U2W A;  3PNT A;  1IC8 A;  5B1B H;  1MKM A;  5EZH A;  2A6E F;  1HCR A;  2ELH A;  4L9J A;  5D5X B;  3HHG A;  4BDY A;  1QNT A;  5JR3 A;  1VQP I;  1LPQ A;  2HTJ A;  2EIM H;  1FIP A;  3DEU A;  1A31 A;  3WTT C;  1OKR A;  1TWH J;  2MGQ A;  3OV8 A;  2GWR A;  3L00 A;  3QU3 A;  1IRF A;  3I3L A;  4BNC A;  2JT1 A;  2V6C A;  1TWF J;  2YU3 A;  2YU9 J;  2JPB A;  5GTI C;  3A01 A;  3N97 A;  2OZU A;  3R61 A;  4I98 B;  4IVN A;  4LIU A;  4RGU A;  2Z1D A;  2GOX B;  2RDP A;  5LEJ A;  1BIB A;  2LG4 A;  5E3N A;  2BHY A;  4CO8 A;  4ITV A;  4M3E A;  4H4K C;  3G1L A;  1S29 A;  4S0H B;  1JTY A;  3DKW A;  2DLL A;  1SFX A;  2V1X A;  4BY1 J;  4P5O A;  2ZME C;  4WXH A;  5E3M A;  3MKW B;  1AA7 A;  1YOV B;  4CCN A;  1A6Q A;  2DU9 A;  2LH9 A;  1MBH A;  2VBZ A;  1JUP A;  2K3P A;  4UXN A;  4RAF A;  2ID3 A;  4A3C J;  1G6N A;  2WV0 A;  2DA4 A;  2CH0 A;  2DTZ A;  3FX3 A;  1TTY A;  1UG2 A;  1X1C A;  4BXU A;  2GM4 A;  3DP7 A;  3FM3 A;  3PJR A;  4ZDO A;  5GAH J;  3W6J B;  4U7B A;  5FKO A;  2MC4 A;  2IS1 A;  1QO0 D;  1XCV A;  2M8G X;  3D5S C;  2FSW A;  5CJ9 A;  4EAT A;  2L01 A;  2VE8 A;  3HOV J;  3BCB A;  1MGT A;  1YW9 A;  1AU7 A;  4P9F A;  4EM2 A;  3WOD F;  1WFX A;  4K2E A;  3H36 A;  3Q0U A;  1MMN A;  3G6E I;  1RRJ A;  5HLT A;  1U5T C;  3LWF A;  3ABK H;  5TGT A;  2PJR B;  1NHA A;  3I59 A;  2OV7 A;  4BXX J;  1TWA J;  1FBU A;  4P1W A;  5HOO A;  2JA8 J;  2BEO A;  1BL0 A;  3RZO J;  2EIN H;  3I64 A;  3RDI A;  2ICW G;  3E5X A;  1R71 A;  3IAS 2;  1R49 A;  3FXR A;  1T08 B;  2JWT A;  5ILS A;  3CES A;  2EZI A;  3KP6 A;  2DMQ A;  3NRV A;  3T8R A;  5FD6 A;  2JVH A;  2FBK A;  1XB4 A;  1MW7 A;  4ZYD A;  3BG6 A;  2BY1 A;  3BQZ A;  1NH3 A;  2P8T A;  1RC9 A;  5EDN A;  1SAX A;  3F8M A;  4KIS A;  2NNN A;  3PFI A;  4N9I A;  4CXF A;  2ZXJ A;  2LTP A;  4BQN A;  4HX4 A;  2WAD A;  1YJN I;  4HG2 A;  3B6C A;  4RBO A;  1IN4 A;  3NAR A;  3C1D A;  4HLX A;  5E8I A;  5M3F J;  3LSI A;  5F6F A;  3G2B A;  5J40 A;  4FX4 A;  5TRD A;  5GTH C;  3FXK A;  3HOS A;  3R4K A;  2FE3 A;  2XDV A;  1SD6 A;  1HKQ A;  4XKW A;  3BT9 A;  3CO6 C;  2NOG A;  4IHV A;  5LHI A;  1T33 A;  3JCU C;  4A0X A;  4CCL A;  5L3C A; 
#chains in the Genus database with same CATH homology
 3GYH X;  2KKO A;  3E3V A;  4RB3 C;  2TDX A;  3CO7 C;  4A6D A;  3KP4 A;  3ECH A;  4MNU A;  1SD4 A;  3I5U A;  2M5W A;  2O3F A;  1FBS A;  3JAM Z;  3SZP A;  4HQM A;  2RC4 A;  2ACJ A;  3GZ6 A;  3TO6 A;  5H20 A;  1R00 A;  1WKM A;  2DAO A;  4EM0 B;  5HS7 A;  4A0Y A;  4OOI A;  4G94 A;  3M1E A;  1P4A A;  4KN4 X;  5LLQ A;  4ASN A;  5K5Q A;  1IXR C;  2J5O A;  4HA8 A;  4LLL A;  4R79 A;  1WQ2 A;  3GWZ A;  4M9S A;  1A04 A;  4KIG A;  3FWE A;  3WU1 B;  4G7H F;  4IHT A;  2ESN A;  4CDG A;  2PQ8 A;  4G8X A;  2ZNZ A;  2HGC A;  1R5H A;  3W6K B;  3FHZ A;  4BHB A;  4ZYH A;  4WK8 F;  3ZQ7 A;  5LGT A;  1ZN2 A;  2JTV A;  2YSR A;  3CUO A;  1YS7 A;  2X4H A;  2EFP A;  2VBX A;  2XRN A;  4HYE A;  3JTG A;  3F8N A;  1UST A;  2L54 A;  1LEA A;  5L3E A;  4YII A;  2MC3 A;  1PP8 F;  1GXP A;  1B9N A;  5DEQ A;  3IKV A;  1ZAR A;  4LG0 B;  2UXN A;  2COM A;  4WX9 A;  4JBA A;  2M1B A;  3ERE D;  1SD5 A;  4I09 A;  4KA4 A;  1HKT A;  2DBB A;  3KET A;  3P9C A;  3TDU C;  3E6C C;  3E6B A;  4GXO A;  4GYG A;  1E17 A;  5HDN A;  1I1S A;  5F1R A;  3IL2 A;  4KN7 X;  2OD5 A;  2A69 F;  2OQG A;  3ABT A;  4HF0 A;  4A5M A;  5HS9 A;  2EV0 A;  2QQA A;  4Y15 A;  1XSD A;  2IT0 A;  2PEX A;  2KRF A;  4OU0 A;  1HBX G;  1YTY A;  1J5Y A;  3RYP A;  3F6V A;  2ZCW A;  4ENJ A;  4EGY A;  1OYY A;  3VB2 A;  5E17 F;  1O57 A;  1BI2 A;  1KU9 A;  1YFH A;  4A2U A;  4ZZL A;  4EJT A;  3O3K A;  3DV8 A;  1RUO A;  4A6E A;  2EK5 A;  2X0L A;  1VTN C;  1IRG A;  3QP5 A;  2QYO A;  2RVC A;  2FEZ A;  5FLX Z;  1AWC A;  2QUF A;  2HDC A;  1UHW A;  2VC0 A;  3GO5 A;  2ZME B;  3LAJ A;  3C7J A;  1D8J A;  3FMR A;  4YFK F;  1PDN C;  3WTS C;  3F8F A;  5BOX A;  3GFM A;  5DV5 A;  1GXQ A;  2EB7 A;  2CFX A;  3I53 A;  1I5Z A;  2DPD A;  2XRO A;  2NNY A;  2A6H F;  2Z99 A;  1QPM A;  2GA2 A;  5ICE A;  3IRQ A;  1F9N A;  2D1V A;  4IRG A;  3SQN A;  3HSR A;  2UZK A;  4IPA A;  2FQ3 A;  4PCQ A;  2YX4 A;  5DUI A;  5HLG A;  2CGP A;  4M72 A;  3SXY A;  4D0P A;  2FML A;  4ZH4 F;  4BHC A;  1MZB A;  5BS6 A;  3IC7 A;  2PMH A;  5ILU A;  2D1H A;  4KIC A;  1U78 A;  3CTA A;  2HKO A;  1USS A;  1FYK A;  3QPT A;  1G3W A;  2A07 F;  2M8E A;  5FFX A;  2VE9 A;  3LAP A;  1CGP A;  2H09 A;  2W25 A;  3KP3 A;  2VC1 A;  4P9U A;  3EYI A;  1MD0 A;  2Y0M A;  1REP C;  2FMY A;  2MLK A;  1L3L A;  2B0L A;  3ZMS A;  2LKP A;  1RUN A;  3MZY A;  4U88 A;  3DXJ F;  1FP2 A;  2QEN A;  1R23 A;  1YG2 A;  2STW A;  2P5K A;  1QGP A;  4IF4 A;  2VBY A;  1BC7 C;  2Q8K A;  4I01 A;  2YX7 A;  2CO5 A;  2Z3Y A;  1BI1 A;  1YW7 A;  2Z33 A;  1Z05 A;  4OIP F;  4M6Y A;  4AVP A;  3J7A O;  4IJA A;  1J0R A;  5HDK A;  1XCB A;  2HYF A;  3LA2 A;  4RAY A;  3HRM A;  4OMY A;  4A0Z A;  5E20 A;  2FOK A;  1HW1 A;  2MD5 A;  2HS5 A;  1DDN A;  4LG0 A;  5LGU A;  5DCM A;  4ESJ A;  1DUX C;  1T0F A;  5KK1 A;  1TBX A;  1IN7 A;  2EFQ A;  2J5P A;  3H3Z A;  5ICC A;  5EEG A;  2CSO A;  1FZP B;  4O3M A;  2XKO A;  5FGM A;  4WCG A;  2H27 A;  2BBY A;  1HW5 A;  5IT3 A;  2QVO A;  2QZ8 A;  1Z9C A;  1J2X A;  5FO5 A;  2CYY A;  3BJA A;  1AOY A;  2OA4 A;  2RQP A;  5LHG A;  3BZ6 A;  3LA3 A;  1B6A A;  4HW0 A;  3GW2 A;  3V4G A;  1KQ8 A;  4LB5 A;  2AXL A;  3ZPL A;  1W7P D;  1LQ1 A;  4WWC A;  1U5T A;  3GVA A;  4IHS A;  1B9M A;  3K9T A;  2VOP A;  4ESB A;  2GIV A;  4GGG A;  3V8L A;  5HVQ C;  3F8B A;  4YG2 F;  1C0W A;  2HOE A;  4UUV A;  2XAJ A;  3TO7 A;  4RB0 A;  4HDV A;  4RB1 A;  4WXC A;  2IA0 A;  2FNP A;  3TDZ C;  1BJA A;  2EA2 A;  4GCV A;  3WTV C;  3BP8 A;  3GEZ A;  1ZRD A;  3JSO A;  5E1X A;  4Y17 A;  3RI4 A;  1R1V A;  1G3T A;  1RZ4 A;  1S7O A;  4UVB A;  5H6R A;  1XSX A;  4ZYE A;  3HUG A;  1OYW A;  1UHM A;  5ERI A;  1LDD A;  3KLO A;  2FXA A;  4YIF A;  3GUD A;  1O3T A;  2VT3 A;  1UB9 A;  2ESH A;  5L3F A;  4A5N A;  2P4W A;  2F5F A;  2KIM A;  5BMZ A;  2PFB A;  1EH7 A;  1LNW A;  2XKP A;  2FRH A;  1TW3 A;  2ZO4 A;  3CUQ B;  4JQF A;  2XVC A;  3BWG A;  3NEU A;  4LLN A;  4KFC A;  2HYG D;  3U1D A;  3B73 A;  1FC3 A;  1W4M A;  2NAZ A;  3SZT A;  3KZZ A;  3F23 A;  3KP2 A;  1KU2 A;  1QBJ A;  3I58 A;  3IWF A;  3BPX A;  2F5D A;  3WU0 A;  2ISY A;  1R58 A;  5AON A;  4GYI A;  3V8K A;  1XN7 A;  2K27 A;  2LF7 A;  3S2W A;  1QQI A;  4EVI A;  3VOD A;  2K02 A;  1Z7U A;  2M30 A;  2G7U A;  3BPV A;  1ZGJ A;  1RNL A;  5FFZ A;  4MTD A;  1YYV A;  5DD4 A;  2O0Y A;  4QLC U;  3T8T A;  2Q2E A;  2QBY B;  3E97 A;  1G3S A;  1LDK B;  5L3D A;  3MAJ A;  1ON1 A;  2OQR A;  2QWW A;  2P6S A;  2PG4 A;  5CVU A;  4CYD A;  1SMT A;  3H3U A;  1BI3 A;  3K69 A;  1P4X A;  2MLG A;  1F4K A;  1J59 A;  4AIK A;  2E7X A;  2G9W A;  1MJ9 A;  6PAX A;  5L3G A;  2G7H A;  3U2R A;  5IT9 Z;  1JHH A;  4UVC A;  2MH2 A;  3CUQ C;  2O61 A;  1I27 A;  1IZ1 A;  1ZG3 A;  4BH9 A;  4H0E A;  4AIJ A;  4I0B A;  3KEO A;  5DCM B;  1LEB A;  4P96 A;  3DF8 A;  3J80 Z;  3F6O A;  4LGW A;  2IW5 A;  4ESF A;  1KU3 A;  3REO A;  5KVR A;  1GHC A;  3M8F A;  1I6X A;  3FF5 A;  3QRF F;  1WRJ A;  4MTE A;  5D8L B;  4BQA A;  1JHF A;  2EJR A;  2GA1 A;  3N4M A;  5DDG A;  1KGS A;  4KMF A;  4ENN A;  5D8K B;  1RI7 A;  3K2Z A;  1T2K A;  3C3W A;  2WWY A;  2M87 A;  5CYV A;  1TQP A;  2DQL A;  3WG9 A;  1BC8 C;  2VON A;  2OBP A;  4I02 A;  4Q5S F;  3KCC A;  4LFU A;  3K0L A;  4XSX F;  1T38 A;  1D3Y A;  2XUB A;  2DK8 A;  1U8R A;  2ZKZ A;  2IRF G;  4ENM A;  2UXX A;  2AS5 F;  1FP1 D;  3EDP A;  2Y48 A;  3D5L A;  2RGV A;  1O3S A;  2A5Y B;  3TO9 A;  1IN6 A;  2FA5 A;  3HIF A;  1TNS A;  2EV6 A;  2P6T A;  3V7R A;  1O7L A;  4LD5 A;  2DW4 A;  1BOA A;  1ON2 A;  2IVM A;  1IXS B;  4LK0 F;  2NRA C;  3J80 K;  1ZRC A;  2H94 A;  3P9I A;  1HXD A;  5HLI A;  2IPQ X;  5BQT A;  4A12 A;  3JSP A;  4EQQ A;  2STT A;  5JFR A;  3H92 A;  3E6D A;  1CF7 A;  4HDU A;  5IT9 K;  4HV6 A;  4M71 A;  2JSC A;  4PGG A;  5A2Q Z;  1DP7 P;  2WTE A;  1YS6 A;  1HW2 A;  1MJA A;  1IXC A;  1Z1D A;  2CG4 A;  5DD8 A;  3FXU A;  3R6S A;  2W24 A;  1K78 A;  4Q47 A;  2XAS A;  3VEP A;  1WWX A;  4AWX B;  5E1Z B;  2FBH A;  4L18 B;  5J8F A;  4KT5 C;  1Z6T A;  1P92 A;  1Z91 A;  2ZME A;  3LQR A;  3WGI A;  3WGH A;  1U3E M;  3FMS A;  3HSE A;  5D5U B;  3DPL C;  3ZN1 A;  4EGZ A;  4OIO F;  3PQK A;  2PN6 A;  4S04 A;  1TQI A;  3WTX C;  4IXA A;  4Q4Z F;  3GX4 X;  5DCF A;  2GQQ A;  5DYM A;  4BAY A;  1TNT A;  1ZYR F;  4F7Z A;  3F21 A;  3RPU A;  2Z9O A;  3FXQ A;  3MCZ A;  3GF2 A;  1JGS A;  2HTS A;  2A3S A;  5LEK A;  4MHG A;  3R0A A;  3ZP5 A;  3RKY A;  5J8C A;  3KZY A;  4PGH A;  1T98 A;  3ECO A;  1BM9 A;  3IWZ A;  4DQ2 A;  4G9Y A;  4HX8 A;  1B59 A;  2L3D A;  3RIR A;  1GVJ A;  1P2F A;  1TLH B;  5D4S A;  5TJJ A;  1HKS A;  3LFK A;  1X3U A;  3RKX A;  2Z5U A;  1S7A A;  2ZNY A;  3EQL F;  3LA7 A;  3L09 A;  1B1B A;  2E7W A;  5CLS A;  2LDU A;  4EJO A;  4M6X A;  3K1M A;  2EV5 A;  2KIU A;  3HHH A;  3ISP A;  1S6L A;  2NS0 A;  2F5C A;  2Q0O A;  3KEQ A;  4UHT A;  3QPH A;  2P5L C;  2BYV E;  2QLZ A;  2E1N A;  1XDU A;  3FMQ A;  2EA4 A;  1SFU A;  5BPI A;  5D6E A;  2JZY A;  4G6Q A;  3GXO A;  2ETH A;  4I2O A;  1Z6R A;  1XGM A;  5J6X A;  2DO7 A;  3L7W A;  3I54 A;  2K4B A;  2E1C A;  2V1D A;  2M45 A;  1YQA A;  1F1Z A;  4KDP A;  3CDH A;  4LJZ F;  2YPR A;  4CHU A;  3AAF A;  3MWM A;  3WTW C;  1IN8 A;  4EMS A;  5D4R A;  4HF2 A;  2R3S A;  4Q48 A;  4B8X A;  1FT9 A;  1F5T A;  2DPU A;  4FT8 A;  4HOB A;  5EEH A;  4OIQ F;  1SFE A;  2XIG A;  3I0T A;  2BGC A;  3P7N A;  3SFZ A;  4HF1 A;  1OPC A;  5D6F A;  4XBF A;  4RS8 A;  4M73 A;  3EUH A;  4M9Z A;  3SHF A;  3WTU C;  1G4D A;  2VT2 A;  2V1U A;  1L0O C;  1EH8 A;  3F3X A;  1FWZ A;  3DFG A;  3HRT A;  4I0A A;  4FHT A;  3WGG A;  3WTY C;  4KUM A;  1FNN A;  4L5I A;  1TQM A;  4O6J A;  3FM5 A;  3WTZ A;  3JW4 A;  3M8E A;  4MQ9 F;  3O2P E;  1LDJ A;  4GO1 A;  2LF8 A;  2RKH A;  4TV7 A;  1P6R A;  3TKY A;  1FYL A;  3TOB A;  1ONV A;  1V4R A;  5CVI A;  3U9G A;  4U0W A;  1KYZ A;  1KA8 A;  4ON0 A;  3GLX A;  4UV8 A;  1BN5 A;  4LMY A;  4YFN F;  2XAH A;  2PBI A;  1D8K A;  1G3Y A;  2A61 A;  4IRI A;  2JRT A;  2K4J A;  3ZMZ A;  2HZT A;  2V79 A;  2W85 A;  3F22 A;  3M7G A;  2ISZ A;  4N9H A;  3MQ0 A;  3HRS A;  4HBL A;  1XMK A;  5JVT A;  2KIF A;  3KLN A;  2DI3 A;  1JE8 A;  2MA3 A;  3HRU A;  2VXZ A;  3BOQ A;  2V9V A;  3I4P A;  3ROU A;  2HQN A;  4RGX A;  4R1H A;  2EFW A;  1UFM A;  2DFI A;  3HTU A;  1IUY A;  1K7A A;  4NHJ A;  4EM1 A;  3LST A;  1ZAO A;  1FYM A;  3IKT A;  2HKX A;  1R1T A;  4XLP F;  3HTS B;  4XLN F;  1SD7 A;  2H6B A;  4RGR A;  4BHP A;  2JPC A;  1E2X A;  4CZZ A;  5K1Y A;  3M9A A;  4U0Y A;  1ZG1 A;  4KIB A;  1FSH A;  4PDK A;  2QQ9 A;  1R1U A;  4XRF A;  2OAZ A;  1XGN A;  3KFW X;  1ZHF A;  2FBI A;  1HST A;  3D0S A;  4KMU X;  3RKW A;  2XAF A;  5A2Q K;  1OR7 A;  2F2E A;  1K78 B;  1KQ9 A;  1YW8 A;  1U5T B;  3COA C;  3B02 A;  2EWN A;  2DTR A;  1YLF A;  1Q1H A;  1W5T A;  4MQV A;  1KYW A;  3ZMU A;  2K7L A;  3L9F A;  1O7F A;  3R60 A;  4NQW A;  2RNJ A;  2IJL A;  2HWV A;  3BJO A;  4L0Y B;  2ADU A;  3TQN A;  2QBY A;  2CWE A;  2HFH A;  4G6D A;  2L4A A;  3RJP A;  2BE5 F;  4HAM A;  4N0B A;  5FLX K;  4KIF A;  2O03 A;  3ZMV A;  3KP7 A;  1ZLJ A;  4YFX F;  1LJ9 A;  1P4W A;  3E6M A;  3T0Y A;  2L02 A;  3GFJ A;  2ZFW A;  2Y75 A;  4I7H A;  2YR2 A;  4CIC A;  4B09 A;  2DK5 A;  3OOP A;  4UNO A;  2ZBK A;  4LLG F;  3HOT A;  2UWM A;  4PZJ A;  3FZV A;  3ML6 A;  4HV5 A;  5CVV A;  2EFO A;  5ILV A;  2W57 A;  5L3B A;  4Y13 A;  1UCR A;  3DPT A;  4UVA A;  1LB2 A;  4MGR A;  3T5X A;  3VFZ A;  3DQV C;  3I59 B;  3C18 A;  1XDS A;  1T39 A;  3RYR A;  3E5U A;  5LGN A;  4G7O F;  2VBW A;  4RAZ A;  2GZW A;  2RN7 A;  1ULY A;  4L9N A;  1B4A A;  5JHU A;  3O6B B;  4OIR F;  3G3Z A;  1S8N A;  2GAU A;  2D45 A;  1XGS A;  1J9I A;  1XD7 A;  2IA2 A;  3MEX A;  4FX0 A;  3RPQ A;  2C6Y A;  2IA1 A;  2PI0 A;  2LSO A;  5ICG A;  3WE3 A;  1ZLK A;  1HSJ A;  5ICF A;  2VOO A;  2F5E A;  2XV4 S;  4P55 A;  1QZY A;  2OU2 A;  3J81 Z;  1KQ0 A;  2XAG A;  3I71 A;  1ZGA A;  4HZF A;  2CQK A;  2VOD A;  5E8G A;  1EH6 A;  3R0J A;  4EJV A;  1DPU A;  1LVA A;  3BDD A;  4M74 A;  2BV6 A;  3KE2 A;  3BJ6 A;  4L9T A;  2CW0 F;  4HQE A;  2L4M A;  2FF4 A;  2O8X A;  2OZ6 A;  3F8C A;  3ULQ B;  4BYY A;  3MFK A;  2HEO A;  4ETS A;  3JAM K;  3K1N A;  4R8H A;  5JI6 A;  3BRO A;  3QP6 A;  1KU7 A;  5LRS A;  4U7D A;  2PLY A;  5K5O A;  5CVR A;  3GZ5 A;  2R7D A;  5CVJ A;  1XSV A;  1PUE E;  1XMA A;  5FB2 A;  4E70 A;  4L9V A;  3Q9S A;  1BBY A;  3T1B A;  1ZG5 A;  1H9T A;  4KNY A;  3TOA A;  1JXS A;  4KYW A;  5FD5 A;  3EET A;  3WE2 A;  1DPR A;  3ZMD A;  3GFI A;  1EV7 A;  4LK1 F;  2RV8 A;  4IRH A;  2IP2 A;  2D2W A;  1BI0 A;  4RGS A;  3PQJ A;  5D5V B;  4L0Z B;  3EYY A;  3V8J A;  2DT5 A;  1O3R A;  1MJB A;  2XHK A;  4U0V A;  1YO5 C;  2PJP A;  3ELK A;  1IW7 F;  1R7J A;  1FPQ A;  4ENK A;  5BPD A;  1R36 A;  1MDM B;  1ZRF A;  5HLH A;  4WXD A;  2K86 A;  1ZH5 A;  1ODD A;  3J81 K;  4ZZD A;  1WSU A;  1W7P B;  4JK1 X;  4WF2 A;  2GXB A;  1TW2 A;  2P5V A;  1T6S A;  4M9X A;  2KJB A;  4O5V A;  3ZN0 A;  2XAQ A;  2EFN A;  3HYI A;  1D5V A;  5E18 F;  1I1G A;  1Y0U A;  3V7S A;  3BY6 A;  4RB2 C;  1FX7 A;  5LRR A;  2GXG A;  2QM3 A;  3V7C A;  5D5W B;  1OYI A;  5K5R A;  3QOP A;  3CJN A;  3TGN A;  3VOE A;  1IN5 A;  3IRR A;  1WI9 A;  1IF1 A;  1W7P A;  2P7C B;  3CUQ A;  1U6G A;  2XGX A;  3QU6 A;  1FOK A;  5LBQ A;  4EJU A;  4HLY A;  2FNA A;  5AIP A;  1CF7 B;  2WC2 A;  3G73 A;  1FBQ A;  3K1P A;  2O6G E;  1ZRE A;  4HX7 A;  1K6O A;  4CGZ A;  1MDM A;  3KP5 A;  2HR3 A;  1S3J A;  2DQR A;  3P9K A;  1V3F A;  1OMI A;  2MBF A;  4QWQ A;  3LQQ A;  1IAW A;  2ZJ2 A;  5LHH A;  3CLO A;  1FY7 A;  3L2C A;  2HQR A;  4Z2Y A;  1YIO A;  3NQO A;  4AD9 A;  2PMU A;  3RTR A;  3GFL A;  5HDG A;  4L5J A;  2R7F A;  1J75 A;  4OIN F;  3JTH A;  4LB6 B;  2KJC A;  4AIH A;  4ZYG A;  1SMY F;  3MZH A;  1QZZ A;  4UV9 A;  1PP7 U;  5E1W A;  2VN2 A;  1H0M A;  2LNB A;  2QQB A;  1STZ A;  4XSZ F;  4MEX F;  2P7V B;  3Q9V A;  3E5Q A;  4EV0 A;  1BIA A;  2H6C A;  4EJW A;  4DNC A;  3ABU A;  5ED4 A;  2MH9 A;  5HS8 A;  1FLI A;  2A68 F;  5DUK A;  5H6Q A;  1K79 A;  1FSE A;  1O3Q A;  1R5G A;  5F64 A;  2NYX A;  3HSF A;  1J7K A;  1HQC A;  1H9G A;  3ZMT A;  5AIQ A;  1RIO H;  4OMZ A;  1W5S A;  2FU4 A;  3Q5F A;  3IHU A;  1XGO A;  4G7Z F;  3F72 A;  2W84 A;  3QAH A;  4S05 A;  4MEY F;  1R22 A;  4NB5 A;  1U2W A;  1MKM A;  2A6E F;  2ELH A;  4L9J A;  5D5X B;  3HHG A;  1QNT A;  5JR3 A;  2HTJ A;  3DEU A;  3WTT C;  1OKR A;  3OV8 A;  2GWR A;  3L00 A;  3QU3 A;  1IRF A;  4BNC A;  2JT1 A;  2V6C A;  2YU3 A;  2JPB A;  3N97 A;  2OZU A;  3R61 A;  4I98 B;  4IVN A;  4RGU A;  2RDP A;  5LEJ A;  1BIB A;  4CO8 A;  1S29 A;  3DKW A;  2DLL A;  1SFX A;  2V1X A;  4P5O A;  4WXH A;  2DU9 A;  2VBZ A;  4UXN A;  1G6N A;  2WV0 A;  3FX3 A;  1TTY A;  4BXU A;  3DP7 A;  3FM3 A;  3W6J B;  4U7B A;  1QO0 D;  1XCV A;  2FSW A;  5CJ9 A;  2L01 A;  2VE8 A;  1MGT A;  1YW9 A;  4P9F A;  4EM2 A;  3WOD F;  4K2E A;  1U5T C;  3LWF A;  1NHA A;  3I59 A;  1FBU A;  5HOO A;  2BEO A;  3I64 A;  3RDI A;  3E5X A;  3FXR A;  5ILS A;  3KP6 A;  3NRV A;  3T8R A;  5FD6 A;  2FBK A;  1XB4 A;  4ZYD A;  2P8T A;  1SAX A;  3F8M A;  2NNN A;  3PFI A;  4N9I A;  4CXF A;  2ZXJ A;  4HX4 A;  1IN4 A;  3C1D A;  4HLX A;  5E8I A;  5F6F A;  4FX4 A;  5TRD A;  3HOS A;  3R4K A;  2FE3 A;  1SD6 A;  1HKQ A;  3CO6 C;  5LHI A;  4A0X A;  5L3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...