1T2KA

Structure of the dna binding domains of irf3, atf-2 and jun bound to dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
110
Chain Sequence
TPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 31-MER
publication title Crystal structure of ATF-2/c-Jun and IRF-3 bound to the interferon-beta enhancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 27
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t2kA01
2QQAA 3FMSA 3ZMZA 2UZKA 3CUQA 3P9IA 4HYEA 4ZYHA 1R7JA 3LQQA 4FT8A 3GFIA 1XDSA 2VT3A 3IWZA 2FXAA 4TV7A 2PI0A 2XV4S 2ACJA 5E17F 3QP5A 3CO6C 2EFPA 5EEHA 2O3FA 4EJVA 2JSCA 3T8TA 3E5UA 2RGVA 4HLXA 4I01A 3GZ5A 3ABTA 3I71A 1R22A 3DQVC 4HAMA 4G8XA 2DO7A 1Y0UA 3ECHA 3BJAA 4KIGA 3OV8A 4EJUA 1NHAA 3FX3A 3K9TA 2QM3A 1R58A 2FA5A 3ZP5A 3EDPA 4BNCA 4EJTA 4HW0A 1ULYA 1ZHFA 5J8FA 2OQRA 4GYGA 2XKPA 2R3SA 2FF4A 2W57A 1E17A 3E3VA 5ICGA 1Z91A 2FEZA 2Z99A 4ESJA 4U88A 2A07F 1ON2A 2OZUA 4EJOA 2ISZA 4ENKA 4BHPA 2XASA 4GXOA 3CDHA 3EYYA 3GVAA 1JE8A 1WSUA 2A68F 2V1XA 4EJWA 1G3WA 1ZRFA 2M45A 3FMRA 3QAHA 1EH8A 1J2XA 5L3CA 2VXZA 3KEQA 1B9MA 4HQMA 4XBFA 3DEUA 1QO0D 4R1HA 4RGRA 1DUXC 2UXNA 2F5CA 4M9XA 1WRJA 2P6TA 3ELKA 1S3JA 2FE3A 3SXYA 4HDUA 1LDKB 2HKOA 5KVRA 1HKSA 5F64A 3KE2A 4LLLA 2D45A 5JHUA 5LGUA 4LMYA 1H0MA 1SD6A 2MLKA 3KP2A 1S7OA 4G9YA 2NYXA 2Q8KA 1CGPA 4OIQF 5A2QK 1V4RA 5F6FA 2EA2A 4L9VA 1B59A 2X0LA 4L9TA 5ERIA 1XSXA 1O7LA 3O3KA 2GQQA 1FSEA 3RYPA 1SD4A 3HSFA 4G7OF 5D8LB 2JPBA 3LFKA 2COMA 5IT9K 2H09A 5HOOA 2ZNZA 3RI4A 1YIOA 1JHFA 1Z05A 2OBPA 5CVRA 2MBFA 5AONA 2V9VA 4KT5C 2A6EF 2L02A 3I0TA 2K4JA 5J6XA 1O3TA 4KIBA 1O3QA 2KJCA 3G73A 3BWGA 2WC2A 3TO7A 2LF8A 3R0JA 4L9JA 3M7GA 2HQNA 3I4PA 2MH2A 5DCMB 2EFQA 1BJAA 1BN5A 3CUQC 3CUQB 3WTSC 3L00A 1BIAA 2IA0A 3GLXA 4UVCA 3B73A 3R4KA 3FZVA 3C18A 4CDGA 1L3LA 4MQVA 4N9IA 4ZH4F 1KU9A 4KA4A 1S7AA 3DPLC 2DBBA 2O61A 4O6JA 1F9NA 3LA2A 2GXGA 5JR3A 3WGIA 2EA4A 1YW8A 4HV5A 4WWCA 3IKTA 2HOEA 1Q1HA 3TO9A 2D1VA 5HVQC 1REPC 5L3FA 1TW2A 4HF1A 3RTRA 1FZPB 3E6DA 1SMTA 3HTUA 4LLNA 5EEGA 4ZZDA 1K78A 4FX4A 2V1UA 3Q9VA 4XSXF 3EYIA 2XAJA 3ECOA 3TDZC 2HGCA 5L3GA 3WTWC 1FBUA 1HSTA 3RKWA 3GW2A 3DPTA 1GHCA 2XGXA 2IA1A 1P4AA 4B09A 5L3EA 2HTSA 3COAC 5FFZA 2L3DA 1QGPA 4G7HF 2H94A 2D1HA 3JAMZ 5BS6A 3AAFA 2BYVE 3P9CA 1OYIA 1OR7A 3TQNA 3K69A 1I6XA 4L18B 1FC3A 3FXQA 3F8NA 3CJNA 1LNWA 1G6NA 3WGGA 3K2ZA 2G7HA 3FXUA 1EH6A 3RKYA 2DAOA 1SAXA 3ABUA 2OQGA 3MEXA 3T5XA 2IPQX 3GEZA 3SZPA 1F1ZA 3DFGA 4GYIA 1J5YA 1R1TA 4MTDA 2YSRA 2E7WA 2GA1A 1HW1A 1TQIA 2KRFA 1ZYRF 2ETHA 2NAZA 5AIPA 1P4WA 1XGMA 3JW4A 5H20A 4BYYA 1TQPA 1TQMA 4Q48A 5HDKA 1D3YA 3ZMSA 2DTRA 2K02A 2DQLA 5KK1A 2RKHA 2IA2A 3KP6A 3H3ZA 1XGSA 2VBZA 4HX4A 2QBYB 2EWNA 2DLLA 4S05A 3GFJA 2AXLA 4UV8A 2F5DA 2YX4A 1R5GA 2BGCA 1BOAA 2ZXJA 1XSDA 2A69F 3HSEA 3O2PE 4RGSA 2K4BA 1L0OC 3RPQA 3FHZA 3F8BA 1LDJA 2G7UA 3GX4X 3VOEA 1FP2A 4WXDA 3BP8A 1S8NA 3I54A 2VC0A 3IKVA 2IJLA 1E2XA 1VTNC 1QQIA 1SFUA 3GO5A 2LKPA 1R23A 4UHTA 2BBYA 2XIGA 2PLYA 2W85A 1U2WA 1Z1DA 4CICA 1SMYF 1WI9A 5LGNA 4KIFA 2ZMEA 2ZNYA 1KGSA 4WK8F 4HX8A 2IVMA 4N0BA 2CYYA 1QZZA 1KQ8A 3IRQA 4Z2YA 4WF2A 3FM5A 2HR3A 3QPTA 2F5FA 4MHGA 2YX7A 4MGRA 4ZYEA 3HYIA 3ZN1A 1Z6RA 5K5QA 1XCBA 1ZN2A 1P4XA 2W84A 4S04A 3N4MA 3HHHA 3GZ6A 1T0FA 4Q47A 3GFMA 3PQJA 4IRGA 3ML6A 1YW7A 1FPQA 4WX9A 4ESBA 3ZMUA 4A2UA 2ZJ2A 1ON1A 5ED4A 1K78B 2PN6A 3HOTA 2Z9OA 1D8JA 4DQ2A 2VE9A 1ZREA 4JK1X 1P6RA 2XAGA 2GWRA 3J81Z 1I27A 2FMLA 1A04A 2YU3A 2HEOA 3NEUA 1WQ2A 4CGZA 1LB2A 1SFXA 2ZKZA 5CYVA 1XMAA 2PQ8A 2IT0A 1FBQA 4YFNF 3D5LA 4IXAA 5DUIA 1BM9A 4D0PA 1TLHB 4AIJA 2ZBKA 1RI7A 3PFIA 2J5PA 2B0LA 4PGGA 4YFXF 4ENJA 3C1DA 1XN7A 5D8KB 3F8MA 2HDCA 1YFHA 3D0SA 3KP4A 3RKXA 5DCFA 1G3YA 4JQFA 5K1YA 4K2EA 2M5WA 1ZGJA 2R7FA 5DD8A 4MEYF 1FSHA 4PDKA 4PGHA 2FBKA 3ZPLA 2MC3A 4P96A 4UXNA 3BOQA 5L3BA 1I5ZA 2P8TA 1MKMA 4L5IA 1MGTA 3GFLA 5ILUA 4MNUA 1IAWA 5FO5A 3M9AA 2IRFG 4P9FA 3ZMTA 3E6CC 4LJZF 2OA4A 2DPUA 1MD0A 2CG4A 3FMQA 2EV6A 2Q2EA 1HSJA 4AIKA 2J5OA 3IC7A 1ZG3A 1XDUA 2KKOA 5K5RA 3CO7C 3VFZA 1PUEE 5DYMA 2PJPA 3PQKA 4RGUA 4EM2A 4G6DA 1I1SA 4EGYA 1LEAA 1BC7C 4NB5A 4JBAA 2V1DA 3HRSA 4M71A 4KUMA 5LRSA 1V3FA 4U0WA 4AWXB 1USTA 3CUOA 1T39A 1ZARA 3WTTC 4UVAA 4HF2A 3FM3A 3KCCA 3CTAA 5DEQA 1ODDA 2ZMEB 2JTVA 1FLIA 3E6MA 1DPUA 4IHSA 3SQNA 4U0YA 5L3DA 2CW0F 1RUNA 3HIFA 3JAMK 1W4MA 3KEOA 4BHBA 2D2WA 3WODF 2NNNA 1ZAOA 2O6GE 5LEJA 1CF7A 3TOBA 1C0WA 3G3ZA 3WTYC 5H6RA 3F8CA 5BQTA 2GAUA 2M87A 2XAHA 2QUFA 2XAFA 4H0EA 3T1BA 3R60A 5BPIA 1RIOH 1XGOA 3W6KB 2XRNA 2LDUA 4M73A 3MZHA 3SZTA 4KMUX 2P5KA 3WE3A 1WKMA 4OIPF 4KN4X 3LA7A 2QQ9A 4LB6B 1EV7A 1J9IA 4M72A 5AIQA 3QOPA 4CYDA 1R1VA 3GUDA 4M9ZA 4UV9A 2KJBA 3JTHA 1JHHA 1YQAA 3M8FA 1TNSA 4WXCA 5ICCA 2YR2A 4U0VA 4FX0A 2WWYA 1OMIA 1KQ9A 5DV5A 1WWXA 3EUHA 4YG2F 2K86A 5LHHA 3E5XA 3L9FA 3L09A 2ZO4A 5D4SA 3QRFF 2QQBA 1I1GA 3MCZA 5FFXA 5D5UB 3EQLF 1SD5A 4BQAA 4YIFA 2P5LC 4G6QA 4BAYA 5DD4A 4LGWA 1FOKA 2CGPA 1IXCA 2BV6A 3KZYA 5E20A 1OYYA 2K7LA 6PAXA 4M6XA 3QU3A 4WXHA 2F2EA 4XLNF 1LQ1A 4ETSA 1MJAA 3F23A 2YPRA 2XVCA 2K27A 1HKQA 1UHWA 2X4HA 3CLOA 1FT9A 3J80Z 1FYLA 3RJPA 2VN2A 4RB0A 1IN8A 3I59A 3TDUC 4LG0A 2Z3YA 1LDDA 3HRTA 3Q9SA 1MZBA 4OMYA 2M8EA 3FF5A 1T6SA 3V4GA 2IP2A 1FYKA 5LGTA 1IXRC 3IWFA 4E70A 3HSRA 3Q5FA 4Y15A 1T38A 3ISPA 3VODA 3MWMA 2PEXA 3F8FA 5D6EA 2VBXA 4QWQA 4PZJA 1J59A 5ILSA 3I5UA 1ZH5A 1HKTA 5HS8A 4FHTA 3C3WA 2DQRA 3HUGA 1BBYA 4EMSA 3J81K 4KDPA 1ZRDA 2NRAC 3M8EA 2EJRA 3KFWX 2MH9A 2XROA 2L54A 4XLPF 2A61A 3DP7A 4I0AA 1J75A 1ZGAA 4M9SA 4L0ZB 1P2FA 1W5SA 2CWEA 4CXFA 3WU0A 1BI1A 2RQPA 5FB2A 3JSOA 2VOPA 1IRGA 1XMKA 2ADUA 1J7KA 2DFIA 3V7RA 5FLXZ 3RDIA 1QBJA 5BOXA 1ZG5A 1CF7B 3BY6A 5CVUA 3WE2A 1G4DA 2FOKA 2JT1A 2HYFA 4KFCA 4LLGF 3L2CA 3LAJA 3F22A 4P9UA 3K1MA 3QPHA 3TO6A 1K79A 1F4KA 4EM1A 1ZLKA 4HQEA 5CJ9A 4M6YA 5D4RA 4A12A 4A0XA 3JTGA 1DDNA 3KLNA 4HOBA 3V8JA 3WTVC 1KA8A 4UNOA 3F6OA 2QVOA 4I7HA 1UHMA 5HDNA 4RAYA 3U1DA 1R1UA 1AWCA 1PP7U 2R7DA 3BZ6A 5FD6A 4MQ9F 2ISYA 1MJ9A 5ICFA 1IW7F 4Q4ZF 3I58A 4GCVA 5BMZA 2P5VA 2VBWA 3H3UA 1U3EM 4ENNA 2GA2A 3TGNA 1YYVA 3LSTA 2FSWA 2VC1A 4KYWA 4HF0A 4CO8A 2P7VB 4ASNA 3WTUC 4CZZA 4Y17A 4O3MA 1D8KA 2JPCA 1GVJA 3T0YA 3BJOA 4EV0A 1KU3A 2BEOA 4QLCU 4Q5SF 5IT3A 3LWFA 5E18F 2FMYA 2G9WA 1ZLJA 4ENMA 4EGZA 1H9TA 4LB5A 1YTYA 2OZ6A 2M1BA 5E1XA 2STWA 5HLIA 3TOAA 4OMZA 2QYOA 2EV0A 2HZTA 1O7FA 2UXXA 3V7CA 3GF2A 3HHGA 5E1ZB 5H6QA 1OKRA 1LJ9A 4AD9A 1YLFA 2PBIA 1ONVA 5DUKA 1KU7A 5E1WA 2EV5A 5DCMA 3V8KA 4OINF 3I59B 2KIUA 2DK8A 4LG0B 1FBSA 1H9GA 4IVNA 3VB2A 4RAZA 3KP3A 2F5EA 4HBLA 2HFHA 4I02A 5ICEA 2ZFWA 5E8IA 4EVIA 4LK1F 1EH7A 1GXQA 4HA8A 2LNBA 3WGHA 1GXPA 2HKXA 2C6YA 1IXSB 4KMFA 2Y0MA 3LQRA 1FYMA 4U7DA 1XB4A 5LLQA 3ZMVA 1YG2A 2A6HF 1BI3A 3IHUA 5E8GA 4RS8A 4IJAA 2ZCWA 2ESHA 1G3TA 4A5MA 4U7BA 5LEKA 2V79A 3WU1B 2L4MA 4LK0F 4RB1A 1MJBA 3MQ0A 1U8RA 3S2WA 2STTA 5DDGA 5FGMA 4HX7A 2UWMA 5D5WB 3ZQ7A 3O6BB 3NQOA 1LEBA 3HTSB 3K1NA 2ELHA 2DPDA 1B4AA 1ZG1A 1YS6A 4O5VA 1KU2A 4LFUA 2VOOA 3H92A 3B02A 1KQ0A 2EFNA 3EETA 3TKYA 4XSZF 2GXBA 1FY7A 3F21A 3NRVA 4EM0B 4A6DA 1G3SA 2P7CB 1HXDA 1OPCA 5FD5A 1Z6TA 3KP5A 5CVIA 4KICA 4NQWA 3E97A 3RYRA 2HTJA 4A0YA 1B9NA 1MDMA 3WTXC 3HOSA 4RB3C 3DV8A 3QU6A 3DKWA 2FU4A 4UUVA 4IPAA 3LA3A 1K7AA 1XCVA 1OYWA 4BHCA 2MA3A 3WG9A 1BI0A 1Z9CA 2XKOA 4PCQA 2P6SA 1ZRCA 4YFKF 5K5OA 3BPXA 3RPUA 1STZA 4I09A 2RVCA 2HYGD 3J80K 2OU2A 4G94A 2O0YA 2GZWA 1K6OA 3M1EA 1SFEA 2QLZA 3BJ6A 3N97A 2EB7A 2H27A 2H6CA 4IHTA 2DI3A 1KYZA 4OU0A 3P7NA 3RIRA 1B1BA 1U5TA 2QBYA 1YO5C 2XHKA 5D6FA 1QNTA 1USSA 4F7ZA 2W24A 2CQKA 4RB2C 2FBIA 2GIVA 2DW4A 3FXRA 4YIIA 2MLGA 1BI2A 1QZYA 1IRFA 2EK5A 4B8XA 3ZMDA 4A5NA 3SFZA 4IRHA 1PDNC 4HZFA 1FWZA 2VBYA 5TJJA 1HW2A 3BDDA 5HLHA 3KZZA 3V8LA 4MEXF 4HLYA 1TNTA 5ILVA 1T2KA 3SHFA 2FNAA 4HV6A 1IN4A 1TW3A 4BH9A 2L4AA 1R5HA 3J7AO 4XRFA 4WCGA 3BPVA 5FLXK 5TRDA 2EFWA 2H6BA 4IRIA 3LAPA 2DT5A 2RNJA 2DU9A 1W7PA 3E5QA 3I64A 5JFRA 1JXSA 3W6JB 2P4WA 2L01A 4Y13A 1R00A 2TDXA 3L7WA 3QP6A 4OIRF 3WTZA 5D5XB 1YW9A 3IL2A 4DNCA 2FBHA 4BXUA 1J0RA 4N9HA 2RC4A 4CHUA 4OOIA 3R0AA 3HRUA 1TBXA 2HQRA 1RUOA 1F5TA 1P92A 1U78A 1RNLA 2PFBA 5BPDA 3IRRA 3F6VA 2E1CA 2RV8A 5LHGA 2RN7A 1KYWA 2LSOA 2Z33A 4I98B 4A6EA 4GO1A 2A3SA 2Z5UA 1IZ1A 2PMHA 4M74A 4I2OA 3ERED 1R36A 2ESNA 4P5OA 3VEPA 4I0BA 5A2QZ 1O3SA 1DPRA 2FQ3A 2LF7A 3MAJA 2Q0OA 5HS7A 4NHJA 3ULQB 1FX7A 4L9NA 3HRMA 2PG4A 4ESFA 1IF1A 1TTYA 1PP8F 2IW5A 5HDGA 1MDMB 1XSVA 1RZ4A 5IT9Z 4IF4A 3C7JA 4L0YB 4L5JA 5HS9A 1DP7P 1BIBA 1JGSA 4ON0A 4R79A 3MZYA 2HWVA 3MFKA 3U2RA 4GGGA 4KN7X 4AIHA 1QPMA 4ZYGA 3KETA 1U5TC 3I53A 1U5TB 4A0ZA 1S6LA 3DF8A 1SD7A 2WTEA 2CO5A 1HBXG 1U6GA 4EQQA 3KP7A 3FWEA 1IN6A 1X3UA 2NNYA 5LHIA 2PMUA 2VE8A 4LD5A 5D5VB 1D5VA 1O3RA 4OIOF 2FNPA 2E7XA 1IN7A 2V6CA 2XUBA 1HQCA 3BROA 2QENA 1Z7UA 2CFXA 3OOPA 2NS0A 2BE5F 3U9GA 2EFOA 3GWZA 2QWWA 2KIFA 2KIMA 1O57A 5JI6A 3F72A 5LBQA 3REOA 1BC8C 1S29A 2RDPA 4G7ZF 1LVAA 3DXJF 3ROUA 3GYHX 5F1RA 2VODA 1UCRA 2W25A 4RGXA 2A5YB 5CLSA 2OD5A 4MTEA 1W7PB 2Y48A 3K1PA 4ZZLA 1FNNA 4AVPA 3JSPA 1B6AA 1UFMA 1FP1D 2XAQA 2CSOA 2Y75A 1XGNA 1W5TA 4KNYA 4HDVA 2AS5F 2DK5A 3GXOA 2JZYA 3R61A 5JVTA 2O03A 1AOYA 5J8CA 1UB9A 3K0LA 3P9KA 2O8XA 1YS7A 4P55A 1W7PD 2OAZA 1XD7A 2WV0A 3F3XA 1IUYA 5CVVA 3KLOA 4ZYDA 2VT2A 1IN5A 2JRTA 3V7SA 1T98A 2MD5A 2VONA 3T8RA 1HW5A 2M30A 5HLGA 3R6SA 3ZN0A 4UVBA 2QZ8A 2FRHA 5CVJA 3E6BA 4R8HA 2E1NA 5LRRA 2HS5A
chains in the Genus database with same CATH superfamily
2R7QA 2QQAA 4AU7A 3FMSA 3ZMZA 2UZKA 5TGTA 3PIOF 2EZIA 3ZQFA 3WG7H 3CUQA 4BQQA 1Z77A 3P9IA 4HYEA 4ZYHA 1R7JA 2W7NA 3LQQA 4CSWA 1OCCH 2LTPA 4FT8A 4X6AJ 3GFIA 1YHQI 1XDSA 2VT3A 3IWZA 3ZQCA 2FXAA 2XF7A 3FDYA 4M3BA 4TV7A 1MBGA 2D5VA 1R71A 1HOMA 2PI0A 2XV4S 3QQAA 3AG2H 2ACJA 2VKDA 5E17F 2CQQA 3QP5A 3G4SI 1YITI 4C2MJ 3CO6C 2BHYA 2EFPA 2LFBA 3PSIA 5EEHA 2X85A 2O3FA 4EJVA 2JSCA 1FIAA 1WCMJ 2HXOA 2H1LA 3T8TA 3A02A 3E5UA 3LOCA 5C3EJ 1MMAA 3DLLF 2RGVA 4DZJA 1ERDA 3PSFA 4HLXA 1WJFA 2VPRA 4I01A 3GZ5A 2IS6A 3ABTA 3HKZN 3I71A 1R22A 1Z3YA 2V9KA 4BJ5C 5J47A 3DQVC 2CW8A 2HQ5A 4HAMA 4G8XA 4ZDOA 1WJBA 2DO7A 2L7FP 1Y0UA 2R7TA 4KITB 5FLVA 3DKYA 3ECHA 3BJAA 4KIGA 2YU9J 5EZGA 3NAUA 3OV8A 5GTIC 4EJUA 5DTDA 1NHAA 3FX3A 3K9TA 2QM3A 1E3HA 1R58A 2DJNA 2DT7B 1A6QA 2FA5A 2W4SA 5M5YJ 1SVMA 3Q0UA 3ZP5A 3RQ4A 2HU9A 3EDPA 2BHZA 4A3JJ 4BNCA 4EJTA 2XPVA 3A0HC 5IYDJ 4HW0A 1ULYA 1ZHFA 5J8FA 3G6EI 2OQRA 3EPZA 4GYGA 4BDZA 2XKPA 4Y3OA 2R3SA 2X51A 1BR1A 2FF4A 5IOZA 4I99C 2W57A 1E17A 3PUBA 4B1RA 3E3VA 4PJLA 5ICGA 4LG3A 1Z91A 2FEZA 2Z99A 4CH7A 1VQMI 4BL0B 2FX0A 3D1NI 4ESJA 1MIJA 4U88A 3H0DA 2KMUA 2X1CA 4BKXA 1ON2A 2A07F 4BXXJ 2LKXA 2OZUA 2BW3B 1YI2I 4EJOA 2AO9A 2ISZA 1G8XA 4ENKA 3ZRGA 4BHPA 3H3VK 2XASA 2E5ZA 4GXOA 4UB8C 3CDHA 3EYYA 3GVAA 2X48A 1JE8A 2E60A 1WSUA 2AHQA 2A68F 4XRMA 3ABLH 2V1XA 1BW5A 4EJWA 1G3WA 2DA7A 1Z0XA 3JCUC 3BTJA 1ZRFA 1XX5A 2M45A 4BXFA 1GUUA 1Y8RB 4IX7A 1X3ZB 2MD0A 3M3YJ 3FMRA 3QAHA 1A6IA 2HDDA 3K4JA 1EH8A 5CQEA 3IV5A 1J2XA 3AL0C 5GPAA 5L3CA 2HOSA 2VXZA 3AL0B 3KEQA 1B9MA 4HQMA 4XBFA 3DEUA 1QO0D 4R1HA 4RGRA 4AM3A 2LP0A 3G71I 1DUXC 2UXNA 2F5CA 3BR3A 1WRJA 4M9XA 2P6TA 3ELKA 1S3JA 2FE3A 3ZQGA 2XSJC 3SXYA 5B3SH 4HDUA 1Z7LA 2LLKA 5DM6F 2DXIA 1LFUP 1LDKB 2HKOA 5KVRA 1HKSA 4PUSA 1K4TA 2L0KA 1OCZH 3KE2A 5F64A 4LLLA 1TWHJ 2KT0A 2D45A 4B47A 1S7EA 1T56A 4QTRA 4CYCA 2R7VA 5FKLA 1U8BA 1QA6A 3BG7A 3MN2A 2XRLA 5JHUA 2I5UA 5LGUA 2RQQA 2GOXB 3S3OA 2DT6A 2KLOA 2IS4A 4LMYA 4BGDA 1HDPA 1H0MA 1SD6A 3HOXJ 2MLKA 3CF5F 3KP2A 2QSHX 1S7OA 4G9YA 2NYXA 2Q8KA 3VPRA 1CGPA 4OIQF 5A2QK 1V4RA 2MC4A 3DKXA 5F6FA 2EA2A 3LSPA 3BR5A 4L9VA 1B59A 2LBFA 1JTXA 2X0LA 5IP6A 4CCLA 2HI3A 3KYDB 4L9TA 5ERIA 3G1MA 5GAGJ 5E79C 1XSXA 2ME0A 1O7LA 3O3KA 3K4CA 2GQQA 1FSEA 1X1DA 3RYPA 1SD4A 3HSFA 1BA5A 4G7OF 4EEFG 5D8LB 3ZQQA 2BVMA 2JPBA 3LFKA 4HEA2 2COMA 4EATA 5IT9K 1TWAJ 2YUSA 3I55I 2EZKA 1E0EA 2H09A 5HOOA 3W3CA 2ZNZA 3RI4A 1YIOA 1JHFA 2MG4A 2DA6A 3H35A 3A01A 2VL8A 9ANTA 2EPFA 2V9PA 1Z05A 2OBPA 3P5JA 5CVRA 1V5EA 2M4KA 2MBFA 1R49A 5AONA 2V9VA 5F0FA 4KT5C 3OSGA 2A6EF 2ICWG 2L02A 3H5RA 3I0TA 2K4JA 5J6XA 1O3TA 4KIBA 1O3QA 2CQXA 3OYGA 2KJCA 3G73A 3BWGA 2WC2A 3TO7A 3TW7A 2LF8A 1D1CA 5J4VA 3R0JA 1VQ7I 3J7AY 3H5AA 4L9JA 3M7GA 1LVKA 2HQNA 2NOGA 3HM5A 3I4PA 3CCQI 5H2FC 2MH2A 4HRIA 1WJCA 5DCMB 2EFQA 5M5XJ 4NDLA 4XOPA 2XPUA 1BJAA 1BN5A 3CUQC 1NTCA 3CUQB 3WTSC 3L00A 1BIAA 4Y7NJ 3JRBA 2IA0A 3GLXA 4UVCA 3ESWB 3B73A 2ID3A 5F1JA 3R4KA 3FZVA 3K4MA 5HLTA 2NVQJ 3C18A 4CDGA 1L3LA 4MQVA 4N9IA 4ZH4F 5FROA 2ZJQF 4PSXA 2GLOA 1KU9A 1ZELA 4KA4A 1OQYA 1S7AA 3DPLC 2DBBA 2O61A 1UMQA 3HG9A 4O6JA 1F9NA 3LA2A 2F6CA 5K7HA 2GXGA 2WBMA 5JR3A 2DMPA 3KYCB 3WGIA 2EA4A 3ZQHA 1YW8A 3L1PA 3FXLA 1V54H 4HV5A 2NVTJ 4WWCA 2R5ZB 3IKTA 3CC4I 3C2GA 2LY1A 2HOEA 1CQTA 2DFEA 2FD5A 2HXIA 1Q1HA 4HNVA 3TO9A 2D1VA 5HVQC 1REPC 5L3FA 1TW2A 2Y0SA 4HF1A 1GV5A 4MO7A 3RTRA 3E6DA 1FZPB 2RREA 1TT0A 2R7SA 4M3DA 3CCEI 2R7OA 1SMTA 3HTUA 4LLNA 3QYBA 5EEGA 4ZZDA 2R5YA 1K78A 4Y52J 4FX4A 2WY8Q 3KIOA 2V1UA 3FK6A 3Q9VA 4XSXF 3EYIA 3VYUB 5EG0A 1R5ID 2XAJA 3CMEI 3ECOA 2CV0A 3TDZC 2ZSIB 3S14J 2AQFA 2HGCA 5L3GA 3WTWC 1FBUA 1HSTA 2P0WA 1QZEA 3RKWA 4AVZA 4BQNA 3GW2A 3DPTA 1GHCA 3OYHA 2XGXA 4X1EA 2IA1A 1ETYA 4D7MA 1P4AA 4B09A 2E1OA 5L3EA 2WB1A 2HTSA 2ZC2A 4XRSA 3L2RA 1AA7A 1Y56A 2COBA 3COAC 5J1RA 3OYNA 2HPIA 5FFZA 2L3DA 1QGPA 1X1BA 4G7HF 2H94A 2D1HA 1VQOI 3JAMZ 1WH7A 1X19A 1V55H 2VXDA 2CW7A 4C3IJ 5BS6A 3AAFA 2BYVE 3P9CA 1OYIA 1OR7A 3TQNA 1EJ9A 2M0CA 3K69A 2MGQA 1I6XA 3DCFA 4XLCA 4L18B 1FC3A 3FXQA 3F8NA 3CJNA 4XORA 4W97A 3LNQA 1LNWA 3RCOA 2O9LA 5E3OA 1G6NA 3WGGA 2K9LA 3K2ZA 2LK2A 2G7HA 3FXUA 2ZXWH 1YRNA 3IUOA 1EH6A 3RKYA 2DAOA 1SAXA 1UJ8A 2ZSHB 4UB6C 1S9HA 3ABUA 1I3QJ 4RM3A 3BZCA 3LFUA 2OQGA 4E7JA 2QCOA 4XLFA 3MEXA 5IYBJ 4F91B 3T5XA 2IPQX 3GEZA 3SZPA 1F1ZA 3DFGA 1OISA 4GYIA 2DA5A 2LOOA 3A1YA 1J5YA 1HA8A 1FOWA 1IDZA 1R1TA 4NNJA 4MTDA 3QPLA 2YSRA 2OC6A 3GLLA 5CQGA 2E7WA 2GA1A 3BLYA 1HW1A 1TQIA 2KRFA 2NVUB 3BG3A 5B1AH 1ZYRF 2ETHA 2NAZA 2HVQA 5AIPA 1P4WA 1XGMA 3JW4A 2VJ5A 5H20A 2K5CA 2Z1DA 4BYYA 3CF2A 1TQPA 1TQMA 4Q48A 5HDKA 1D3YA 3DLAA 5F0HA 1V5FA 3ZMSA 3ZR8X 2DTRA 2VJJA 2K02A 4IEJA 1E3PA 2DQLA 4A3GJ 5KK1A 5DM7F 2B7EA 3VSLA 4XQFA 2RKHA 1JJ8C 2IA2A 1GT0C 3MKZA 3KP6A 3H3ZA 1XGSA 4XL9A 1G2HA 3FKIJ 4XM3A 4E7HA 2VBZA 4HX4A 4X0GA 2QBYB 2EWNA 3S1NJ 2DLLA 3SYTA 4S05A 3GFJA 2HVRA 3HGGA 2AXLA 4UV8A 2CS3A 3AG3H 1FEXA 4D1QA 1WZ2A 2F5DA 3ZQLA 2LBFB 2YX4A 1R5GA 1IGNA 2O7OA 3RZDJ 3D5SC 2BGCA 1BOAA 2ZXJA 3HOWJ 1XSDA 2A69F 3HSEA 1ENHA 2L2OA 3O2PE 4RGSA 5M3FJ 4XLEA 3VDXA 2K4BA 1L0OC 4C3HJ 1LKXA 3RPQA 4FQGA 4E7IA 3FHZA 3S3MA 3F8BA 1LDJA 2F48A 5C4XJ 2G7UA 3LSMA 3GX4X 1MW7A 2LC2A 4XKBA 3PO2J 3VOEA 1FP2A 2Y30A 3BP8A 4WXDA 1S8NA 3I54A 5J1UA 5TISC 2VC0A 4MFEA 3LSRA 3IKVA 3MVPA 2IJLA 1E2XA 4QPOA 1VTNC 1QQIA 1SFUA 3H9JA 3K4NA 3GO5A 2LKPA 1R23A 4F3QA 4UHTA 4JX5A 2ZXIA 3BCBA 2BBYA 3OYIA 3S1QJ 3LSJA 2XIGA 2OUMA 3HKZA 4IZZA 4IO9F 2VASA 2W85A 2PLYA 5FRMA 1U2WA 1Z1DA 4CICA 1SMYF 1WI9A 5LGNA 4KIFA 3BTIA 2ZMEA 2ZNYA 2R4GA 1D1BA 1KGSA 2LG4A 3HGYA 2BY1A 2BY0A 2XB5A 4WK8F 2CMPA 4LOCA 2E2HJ 1RR8C 3TBIA 3QODA 2ZB9A 1LFPA 4HX8A 5FJ8J 2IVMA 3DU5A 3J7YJ 4N0BA 2CYYA 1QZZA 1OLTA 3CMMA 3K4LA 1KQ8A 1OJLA 2HPMA 4L5EA 3IRQA 4Z2YA 3S3NA 2A5WA 1IC8A 4WF2A 3OS0A 4N4OB 3FM5A 2HR3A 1IV6A 2OCEA 3QPTA 3WHBA 2F5FA 2IBDA 3GTJJ 4MHGA 2YX7A 4MGRA 4ZYEA 3HYIA 3ZN1A 4OWRB 1Z6RA 2RNGA 1D5YA 5K5QA 1XCBA 2OV7A 4S0HB 5GAEJ 3OIPA 3RZOJ 1ZN2A 3E7LA 1P4XA 5FKNA 4JOMA 4QPQA 1MNMC 2W84A 1S5LC 4S04A 3N4MA 2H1KA 2KRCA 3AFHA 3HHHA 1T0FA 4Q47A 3GFMA 5HODA 3GZ6A 5JVGF 3PQJA 4IRGA 2LR8A 3QOEA 3ML6A 2IS2A 1J09A 1YW7A 3B6CA 3BQYA 5E3LA 1FPQA 4WX9A 4ESBA 2EILH 3ZMUA 4RBOA 4AYBN 4A2UA 2ZFUA 1ETKA 2DA3A 3K70C 1APLC 2ZJ2A 1ON1A 2R5YB 4UUTA 3Q0WA 5ED4A 1K78B 2PN6A 3HOTA 1ZTRA 2Z9OA 1D8JA 4DQ2A 2VE9A 1ZREA 2V6EA 2W82A 4JK1X 1P6RA 5CPRB 2XAGA 2GWRA 3J81Z 1PUFA 1I27A 2FMLA 5EG0B 1A04A 2YU3A 2K3PA 4ABZA 2HEOA 2F5VA 3NEUA 3H0GJ 3IH2A 1WQ2A 3CMYA 4CGZA 1FMVA 1ZK8A 2VJ4A 2AQEA 3BC8A 4W1UA 1N25A 1LB2A 1SFXA 1AKHA 5FRNA 1BR2A 1U9OA 3BG9A 2ZKZA 5CYVA 1XMAA 2PQ8A 3IAS2 4YIRX 1MBHA 2IT0A 3AKZA 1FBQA 2X6XA 4YFNF 3GBGA 3D5LA 3KX2A 1TT5B 4IXAA 3H9QA 3OIQA 5DUIA 1BM9A 4D0PA 1TLHB 1K61A 4DJAA 1H89C 1OR7C 2XSDC 4AIJA 2ZBKA 1RI7A 2FQ4A 3PFIA 3I4NJ 2J5PA 2B0LA 4B4CA 1BW6A 4PGGA 2DTZA 4YFXF 2E34A 3CCYA 4CCMA 4LITA 3LSHA 1ZQ3P 3MKYB 3GTMJ 2XDVA 4ENJA 3C1DA 4CCJA 1YRNB 1XN7A 3OOUA 1LPQA 5D8KB 2X6WA 3F8MA 2HDCA 2JQ7A 1YFHA 3D0SA 3KP4A 3RKXA 5DCFA 4DZPA 1G3YA 2CJJA 2X6OA 4JQFA 5K1YA 1OCPA 4XKCA 4K2EA 4PK4A 1DU0A 2M5WA 5IY5H 1ZGJA 3BCAA 4A3IJ 1N77A 2R7FA 5DD8A 1DP3A 4MEYF 1IRZA 3HB9A 1FSHA 4PDKA 4PGHA 2FBKA 1D0YA 1UG0A 3K10A 3ZPLA 1D0ZA 2MC3A 4P96A 4UXNA 3FXKA 1VQKI 4ZDPA 3BOQA 5FKMA 5L3BA 4II2A 1I5ZA 4HSRA 3ZQIA 5F27A 4MLOA 4XIDA 3M8JA 2P8TA 1MKMA 2FJ1A 2K40A 3G1LA 2KL4A 2LD5A 4L5IA 1MGTA 2DOAA 3GFLA 1B8IA 2FOWA 5ILUA 4MNUA 3PNVA 2WAQA 1IAWA 5FO5A 3M9AA 4A3BJ 2IRFG 5IP9J 3GMEA 4P9FA 4F92B 4CCKA 3CCVI 1VQNI 3L2UA 1V5GA 2LVSA 1VQ8I 3ZMTA 3E6CC 4LJZF 3FXJA 2OA4A 4KISA 2DPUA 1NK3P 2CUFA 1MD0A 2CG4A 3FMQA 1A31A 4NC6A 2EV6A 3V42A 2XF6A 2Q2EA 1HSJA 2ID6A 4AIKA 2J5OA 3IC7A 1ZG3A 1XDUA 2I8DA 3E1SA 2KKOA 5K5RA 2XB0X 3ASOH 3CO7C 3VFZA 5M3MJ 4A69C 1JTYA 5GAHJ 3EUKL 5DYMA 1PUEE 3FIWA 3OS2A 3LSIA 4AIDA 3L2QA 2PJPA 3PQKA 4RGUA 3WU2C 4G6DA 4EM2A 5EGOA 1I1SA 4EGYA 5IOYA 1T33A 1LEAA 1BC7C 4NB5A 4C9YA 2JA8J 4JBAA 3FBIB 2V1DA 1HCRA 2WV1A 3HRSA 2R93J 4XK4A 4M71A 4KUMA 5LRSA 1QU3A 3QPSA 2CV2A 1V3FA 4U0WA 4AWXB 1X1AA 1USTA 4N4NB 2DYRH 3CUOA 3ONQA 1UELB 1T39A 1ZARA 3WTTC 2IGKA 4UVAA 4HF2A 1EKEA 3FM3A 1B72A 3MKLA 3KCCA 1WJEA 3DBRB 3CTAA 5IP7J 2ZMEC 4DBQA 1RKWA 5DEQA 1ODDA 2X1EA 2ZMEB 5B66C 2JTVA 1FLIA 2NOJB 2KDOA 3E6MA 1N78A 1DPUA 4IHSA 2JA7J 1JJ6C 4P1WA 1VF9A 3SQNA 4U0YA 5L3DA 2CW0F 1RUNA 1PYVA 3HIFA 2KZVA 4A3CJ 4XLHA 3JAMK 3C2HA 3BR1A 2LH9A 2GXAA 1W4MA 3KEOA 4BHBA 2D2WA 3WODF 2NNNA 3OMYA 3CJQB 1ZAOA 3PM1A 2O6GE 3K4BA 3QYEA 3BQZA 5LEJA 5JLWA 1P7JA 4DGWB 1CF7A 3TOBA 1C0WA 3G3ZA 3WTYC 3DBHB 1RR7A 5H6RA 3F8CA 4U87A 5J4YA 5BQTA 2K9SA 4XNFA 3SZGA 3BR6A 2GAUA 2M87A 2XAHA 2QUFA 2XAFA 3GZNB 4H0EA 3JRDA 4OAZA 3T1BA 3R60A 2Z2SB 4DW6A 5BPIA 1T0FC 2VKEA 1ETQA 1JUSA 1X3WB 2KPMA 1FTZA 3CCUI 2X9DA 1RIOH 4XKWA 1XGOA 3W6KB 4BEHA 4DBRA 2XRNA 2LDUA 4M73A 1BJZA 2VI6A 3MZHA 4D5CA 2IGOA 3OYJA 3SZTA 2WAQN 4KMUX 3L2VA 1MNDA 2GIZA 2P5KA 3SJMA 3WE3A 2E2IJ 1WKMA 4OIPF 2W48A 4KN4X 5J1YA 3S32A 2XGEA 3FKJA 3CJTB 3LA7A 4BU2A 2QQ9A 2K3FA 4LB6B 4DIQA 3OY9A 1XC5A 1EV7A 1VZ0A 1Y1VJ 1J9IA 4M72A 1R9TJ 3RKQA 5AIQA 3QOPA 4Y4RA 4CYDA 5J3LA 3CP8A 1LUJB 2Y9ZA 4XN3A 5HNHA 1R1VA 3JRIA 3GUDA 4M9ZA 4UV9A 2KJBA 3JTHA 1IO2A 3K7AJ 1JHHA 1YQAA 3M8FA 4PJ0C 1TNSA 4WXCA 1WGXA 2EBIA 5ICCA 2JK3A 2YR2A 2LY9A 4U0VA 4D9JA 3K2AA 4FX0A 3A03A 1VFCA 2WWYA 1OMIA 1KQ9A 5DV5A 1WWXA 3EUHA 4YG2F 2ELKA 2K86A 2JVHA 2VQCA 3SEZA 1PJRA 4UUSA 5LHHA 4XLAA 2NS8A 3E5XA 3L9FA 2QSFX 3L09A 2ZO4A 3Q3SA 4FE4A 1R4NB 5D4SA 2DFHA 1Y0NA 4E4HA 3QRFF 1QHHD 3KZIC 2XGDA 2QQBA 1I1GA 2KHMA 4V19K 1TC3C 3MCZA 4A93J 4B3AA 2R7XA 5FFXA 3U1KA 5D5UB 4C30A 1SD5A 3EQLF 4BQAA 4YIFA 4BE0A 2P5LC 4G6QA 2LYCA 5DD4A 2BY2A 1RESA 4LGWA 4BAYA 5DS9A 3ERMA 1FOKA 2CGPA 3RSNA 1IXCA 1PVEA 2BV6A 3CC2I 2O5RA 4J01A 3KZYA 3J7ZI 5E20A 1OYYA 3IAM2 1SAUA 2K7LA 1KZHA 3OR2C 5KAIC 3SFIA 4E6KG 6PAXA 1VQPI 2LREA 4M6XA 3QU3A 4WXHA 2F2EA 5BNGA 4Z6YA 2A6TA 3HXLA 4RDUA 3HOVJ 3G1OA 4DYRA 2KDZA 5LFAA 4XLNF 2WAFA 2ZXHA 3QYFA 1LQ1A 2PJRA 4ETSA 1MJAA 2DDBA 3GTGJ 3F23A 2YPRA 2XVCA 2K27A 2Q1ZB 1HKQA 4A3FJ 3OS1A 1UHWA 2X4HA 3CLOA 1FT9A 3J80Z 2JWTA 1FYLA 5KNLA 1HLVA 3RJPA 2VN2A 2ZJRF 5KAFC 2DN0A 4RB0A 1IN8A 2F4IA 3I59A 1ZR2A 1U9NA 3B6AA 4HNTA 2AXTC 2M7AA 3TDUC 1MBEA 4LG0A 3VYRB 3HOUJ 2Z3YA 2JN6A 1W1WE 3VYTB 1LDDA 4GRIA 2V4JC 3HRTA 3Q9SA 1MZBA 4OMYA 3DBLB 2M8EA 3FF5A 1T6SA 3V4GA 2NS7A 1IV8A 2IP2A 4CCNA 5LGTA 1FYKA 1IXRC 4IHXA 5C44J 2B63J 3IWFA 4E70A 2OTLI 1FTTA 3HSRA 3Q5FA 4Y15A 1T38A 3ISPA 3VODA 3MWMA 4ITVA 2HNHA 3OYEA 3S15J 3BTCA 2PEXA 3F8FA 5D6EA 2O8KA 1RRJA 1TWGJ 1GVDA 2QKLB 2VBXA 2ELJA 1MH3A 4H4KC 2IS1A 4QWQA 3HOZJ 4PZJA 5EEAA 1J59A 5ILSA 3I5UA 1ZH5A 1HKTA 4HPQA 5HS8A 3H9GA 1Z67A 4FHTA 3C3WA 4MIMA 2DQRA 2BY3A 3HUGA 1BBYA 4EMSA 3J81K 3KPHA 4KDPA 1FOXA 1ZRDA 4B43A 2NRAC 3PFYA 3M8EA 1VI0A 2Z16A 2EJRA 3KFWX 1Q1VA 2MH9A 4BUPA 3ABMH 2XROA 4HNUA 2L54A 5FKOA 1W0TA 4D5FA 4AYBA 2KISA 3MD2A 2YS9A 3VWBA 4XLPF 2A61A 3AG4H 3DP7A 1JKPC 4CYCB 4I0AA 4ZDLA 1J75A 2QGUA 3M07A 4I76A 1ZGAA 3BTLA 4M9SA 4PJMA 4L0ZB 1P2FA 2VLAA 1W5SA 2CWEA 4CXFA 3WU0A 2E1MC 1BI1A 2E1MB 2RQPA 1JT0A 5FB2A 3JSOA 1OCTC 2VOPA 2LRDA 1IRGA 1XMKA 2ADUA 2JUGA 1J7KA 5GADJ 1DQUA 1MMDA 2DFIA 2QSGX 3SDBA 3V7RA 5FLXZ 3RDIA 1XMXA 1QBJA 5BOXA 1ZG5A 1CF7B 2GM4A 2VIXA 3HDDA 3BY6A 4IHWA 5CVUA 3WE2A 1G4DA 4B44A 3OYAA 2VUMJ 1ETWA 2FOKA 3N05A 2JT1A 2Y9YA 3JREA 4ZTFA 2HYFA 4IKFA 4KFCA 4LLGF 4XONA 3L2CA 3LAJA 3Q0VA 3F22A 2M9HA 4P9UA 1RETA 4DYCA 3K1MA 3QPHA 3DWLE 3TO6A 4CZCA 2XAUA 1K79A 1WI3A 2DA2A 2VB6A 1F4KA 5IYCJ 4EM1A 1ZLKA 4HQEA 5CJ9A 3IP4B 4M6YA 5D4RA 4A12A 4A0XA 3JTGA 1DDNA 3KLNA 2CRGA 4BEHB 3A01B 4NC7A 4HOBA 3V8JA 4C2UA 2V7FA 3WTVC 2UV1A 1KA8A 4UNOA 2VKHA 5GTHC 3F6OA 3TP0A 3S1RJ 2QVOA 2R7WA 1SEUA 4I7HA 3LSKA 2M34A 1ETVA 1K6YA 1XS9A 4XKVA 1UHMA 5HDNA 3I4MJ 4RAYA 3U1DA 1R1UA 1AWCA 1PP7U 1H8AC 3OYDA 4ZJZA 1P9QC 2R7DA 3BZ6A 5FD6A 1NH3A 5JHFA 4MQ9F 2RAEA 4BJTA 2ISYA 2R92J 1MJ9A 5ICFA 1IW7F 1IUFA 4Q4ZF 3I58A 4GCVA 5EF6A 5BMZA 2P5VA 2VBWA 3E0JB 3H3UA 1U3EM 4ENNA 1BR4A 2GA2A 4OAYA 3TGNA 1ITYA 2BZTA 1YX5A 4IHYA 3DTKA 1YYVA 3LSTA 2FSWA 2W1OA 3S2HJ 2VC1A 4KYWA 2EIMH 4HF0A 4CO8A 2P7VB 3EUHC 4ASNA 3WTUC 4CZZA 2JMWA 4Y17A 2HDWA 1YE9A 1ETOA 1MNEA 3GCMA 4UUSB 4O3MA 3ZCOA 1D8KA 3LL7A 4FTHA 2JPCA 5F04A 4PJNA 1SVOA 1GVJA 1DGWY 3T0YA 3BJOA 5E3NA 5JLXA 4EV0A 4CCOA 3NWTA 1KU3A 3IH3A 2BEOA 4QLCU 4Q5SF 3JRAA 2QF7A 5IT3A 3LWFA 4XRSG 2L7MP 4YRVA 4B48A 4QIWN 5EDNA 5E18F 1POGA 1A36A 2FMYA 2G9WA 1O4XA 4BY7J 2DMTA 1ZLJA 1GLNA 4ENMA 1IRXA 3W2VA 4EGZA 1H9TA 3A0BC 4LB5A 2EZLA 2MSYA 2CUJA 1I39A 4FETA 1YTYA 2OZ6A 2M1BA 5E1XA 2STWA 5HLIA 2KQRA 3TOAA 4OMZA 2QYOA 2EV0A 4XN0A 2V1NA 4HSTA 4BDYA 2HZTA 1O7FA 1UHSA 2JUCA 1JGGA 3PUFA 4RLQA 2UXXA 3V7CA 3CCMI 1VQ9I 2K9QA 1M1EB 2HYJA 3GF2A 3HHGA 1AHDP 3ASNH 2M2EA 5E1ZB 4BQOA 2JSPA 5H6QA 1OKRA 1LJ9A 3OYCA 2PJRB 4AD9A 2ME6A 1YLFA 2PBIA 1ONVA 1JUPA 5DUKA 1KU7A 3HPHA 5E1WA 2EV5A 1XG1A 1IDYA 5DCMA 3K70D 1DU6A 3V8KA 4OINF 3I59B 2KIUA 5B1BH 2PMZN 2DK8A 4LG0B 3OL4A 1ACIA 1FBSA 1WJAA 3HZJA 1H9GA 2PX9A 2L9RA 4IVNA 3CCJI 3VB2A 3SDGA 4RAZA 2IAIA 3KP3A 2F5EA 3K6GA 4HBLA 3JR9A 3TW6A 2HFHA 4I02A 5ICEA 2ZFWA 5E8IA 4EVIA 2LMDA 2OF7A 1OCOH 3FISA 4LK1F 3K4KA 1X1PA 1EH7A 1GXQA 4HA8A 2LNBA 3WGHA 2GBYA 1GXPA 2HKXA 4A3EJ 2C6YA 2ECCA 2K85A 1FIPA 2Y69H 1IXSB 3MZ8A 1HF0A 3H36A 3S2DJ 1VQLI 4KMFA 4YEJA 2Y0MA 4KJZA 3A4CA 1RKTA 3LQRA 1FYMA 2MW8A 4IQ4A 4U7DA 2IXSA 1XB4A 2M7BA 1QVUA 5LLQA 2R5ZA 3ZMVA 3MKWB 1YG2A 2A6HF 1BI3A 3IHUA 5E8GA 3HUGB 4RS8A 2BVLA 4IJAA 4ANJA 4IQJA 2ZCWA 2XPWA 2ESHA 1G3TA 4A5MA 4U7BA 2CQNA 3O8HA 4NC8A 4PJJA 5LEKA 2QKMB 1LE8A 2V79A 3WU1B 2L4MA 3JRFA 4LK0F 4RB1A 3OYFA 2F4OB 1JT6A 1MJBA 3MQ0A 1U8RA 3OYBA 3S2WA 2STTA 4KT6A 5DDGA 1YOVB 5FGMA 3OWTA 4YELA 5KHDA 4XR6A 2CH0A 4HX7A 2UWMA 3ZOBA 5D5WB 1ZR4A 3ZQ7A 1MSFC 3O6BB 3NQOA 3OIOA 1LEBA 4E7ZA 3HTSB 3K1NA 2ELHA 3W2WA 1B4AA 1Y8QB 2DPDA 1ZG1A 2DMUA 1VQ6I 1YS6A 4O5VA 1KU2A 4LFUA 2VOOA 3H92A 2UUZA 3DTIA 4DOZA 3HJEA 4CUGA 2DA4A 3B02A 2GOMA 1KQ0A 3NARA 1XTAA 2EFNA 3EETA 1FMWA 3D5RC 4IHVA 1H88C 2WAEA 2MABA 3BR0A 2M8GX 3JRGA 3TKYA 4XSZF 2GXBA 3S16J 4PSWA 1FY7A 1SANA 3F21A 4A3LJ 3NRVA 2R7UA 1A5JA 3UNGC 4EM0B 3OYMA 4ZC3A 2KIQA 3GTOJ 4A6DA 1G3SA 2P7CB 2E71A 1HXDA 1OPCA 2CFOA 5FD5A 1Z6TA 2F4MB 3KP5A 5CVIA 1X4OA 4KICA 4NQWA 1WPKA 3E97A 3RYRA 2HTJA 4A0YA 1MBFA 1B9NA 1MDMA 3CJRB 3WTXC 3HOSA 4RB3C 3DV8A 2L9VA 3QU6A 3DKWA 2FU4A 3CLQA 2HOAA 4UUVA 4IPAA 3LA3A 1K7AA 2MFZA 4A3KJ 1XCVA 1MBKA 2H8RA 2KRHA 1OYWA 3CCLI 3GTQJ 4BHCA 2MA3A 2M4GA 2QA4I 3ABKH 3WG9A 1BI0A 1Z9CA 1T95A 2XKOA 4PCQA 4RAGA 2P6SA 1ZRCA 4YFKF 4RLFA 5K5OA 3BPXA 3RPUA 4CA0A 2CV1A 1BOBA 1STZA 2QEXI 2LKSA 4I09A 2RVCA 4J19A 2HYGD 2I10A 3I9V2 4F52A 3J80K 2X1DA 2OU2A 4G94A 2O0YA 2GZWA 3W2AA 1K6OA 3M1EA 1SFEA 2QLZA 3BJ6A 4V2FA 4D7NA 3G2BA 3N97A 2EB7A 3ZXSA 2H27A 3HEFA 1EF4A 4V2GA 2BXYA 2H6CA 4IHTA 2DI3A 1D1AA 1KYZA 4OU0A 3TMOA 3P7NA 3RIRA 4A3MJ 1YIJI 3S8PA 1B1BA 4IL6C 4C3JJ 3DTEA 1U5TA 3AG1H 2QBYA 1W0UA 5J40A 5EYRA 1YO5C 2JA6J 1MBJA 4NBQA 1F36A 2XHKA 2WADA 1JUMA 5GPCA 3OYKA 5D6FA 4G12A 1QNTA 1USSA 4F7ZA 2W24A 2CQKA 4RB2C 2FBIA 2P81A 1TZLA 2GIVA 3BG6A 2DW4A 3FXRA 1JKOC 4YIIA 4Y33A 4ZTJA 2MLGA 1WJDA 1BI2A 1QZYA 1ORKA 1IRFA 2EK5A 1WHUA 4B8XA 1JI8A 3ZMDA 4A5NA 1OCRH 3SFZA 4IRHA 1PDNC 4XICA 4HZFA 1FWZA 2VBYA 5TJJA 1E3OC 1HW2A 1HDDC 3BDDA 1PUFB 5HLHA 1VNDA 1YX3A 3KZZA 3V8LA 4MEXF 1W36C 4PFOA 2DMNA 1JKQC 4HLYA 2W00A 1X1CA 2OCCH 3DEEA 3I3LA 3MMYB 3A2KA 1TNTA 5ILVA 1AKHB 2TRTA 3TL4X 1T2KA 3SHFA 1QHGA 2FNAA 4HV6A 5E3MA 4A3DJ 2Y31A 1IN4A 1TW3A 4RM2A 4BH9A 2L4AA 3M4OJ 1R5HA 1GV2A 2XF5A 3J7AO 4XRFA 5K7FA 4WCGA 1WH5A 3TEDA 3BPVA 5CKTA 5FLXK 5TRDA 1K83J 2KP6A 4II3A 2EFWA 2H6BA 1D0XA 1MMGA 4IRIA 5F08A 3LAPA 2DT5A 2E2JJ 2KFDA 2RNJA 1I6HJ 2IEKA 1WVRA 1W7PA 2DU9A 3E5QA 3I64A 3LSGA 5JFRA 1JXSA 2E36A 2XC7A 3W6JB 2IGNA 2P4WA 1YJWI 2L01A 1TL8A 2EZHA 1W36D 4Y13A 2K9NA 1R00A 2TDXA 3L7WA 1IJWC 1QPIA 1EA3A 3QP6A 3BR2A 4OIRF 1G59A 3C2BA 3WTZA 5D5XB 1YW9A 3IL2A 1NG6A 2NVYJ 4DNCA 2FBHA 4BE1A 4BXUA 2OTJI 1MMSA 1JKRC 2EIJH 1J0RA 1R4MB 3OYLA 1UG2A 4N9HA 2DODA 3CMAI 5EZHA 2RC4A 4CHUA 4BY1J 4OOIA 2L7KA 3HC7A 3TP3A 3OSFA 3R0AA 3HRUA 1TBXA 2HQRA 1SFOJ 4IOCF 3KEYA 2EIKH 1GDTA 1RUOA 4IOAF 2VQHA 4C2TA 4E7LA 3QWLA 2HVSA 1F5TA 1P92A 4JX6A 1U78A 4ZYAA 1RNLA 4GDFA 3CCRI 5B5EC 1OFCX 2PFBA 4XMYA 1S72I 4FISA 1LE8B 3PL8A 5BPDA 1B8IB 3H5NA 3IRRA 3F6VA 2E1CA 1MH4A 2BXZA 4JX4A 2RV8A 2EINH 5LHGA 2RN7A 1KYWA 2LSOA 5F0CA 2Z33A 2K9MA 4AUXA 3UKGA 1WFXA 1ZGWA 3JRHA 2EQRA 2V26A 4I98B 1I3AA 4GO1A 4A6EA 2A3SA 2Z5UA 1TWCJ 1IZ1A 2L9SA 2PMHA 1TWFJ 1SFKA 4M74A 3S1MJ 1DGRM 4I2OA 2JJ7A 2Q2EB 1R36A 3ERED 2E35A 2ESNA 4P5OA 2DFFA 3VEPA 4I0BA 2M3AA 3OR1C 1X2MA 3I56I 5A2QZ 4G6TB 3GTPJ 1O3SA 2CUZA 1DPRA 1AU7A 4PFPA 3CESA 2FQ3A 4BJ6C 2LF7A 4FASD 3FXOA 2ZJPF 1Z21A 3MAJA 2CQ7A 2QQ8A 2Q0OA 5EGOB 5HS7A 4NHJA 3UR3C 3ULQB 1QVTA 1FX7A 2HZDA 5HNFA 4L9NA 3HRMA 4GFBA 2NXNB 4NQWB 2PG4A 4ESFA 3H1CA 2OPTA 1IF1A 1TTYA 1PP8F 2IW5A 3OL3A 5HDGA 2DMQA 1MDMB 2HOTA 1XSVA 3M1CA 2L9NA 1N75A 1RZ4A 3X2QH 1HC8A 4E7SA 5LD2C 1P7IA 4DYQA 5IT9Z 1B72B 4IF4A 2CUEA 3C7JA 4BS9A 4L0YB 4L5JA 3BG5A 3W6VA 5HS9A 1DP7P 1RC9A 2G0EA 2DCEA 1BIBA 2WY7Q 2R7ZJ 1I50J 1FOYA 4FCYA 4E7KA 1SVLA 1JGSA 4ON0A 2DOEA 3PNYA 4JP0A 2E19A 4R79A 1MSEC 3WHCA 1KONA 3DPUA 3MZYA 2TCTA 4FE7A 2MYSA 2HWVA 3MFKA 4JYKA 2BOLA 3U2RA 2JA5J 1A35A 2E5NA 4GGGA 4KN7X 2X6YA 4AIHA 4NUBA 3CQZJ 1W5CC 1T08B 2VJIA 1QPMA 1TP4A 4RA2A 2DJIA 4ZYGA 3KETA 3SEQA 2LY2A 2WA0A 2R7RA 1U5TC 3S17J 1X4PA 3I53A 4RAFA 1U5TB 4A0ZA 1S6LA 3DF8A 1SD7A 2WTEA 4B3XA 2PMZA 1WJ5A 2CO5A 2BW3A 2DA1A 2DDAA 3RPUD 1HBXG 1U6GA 5M5WJ 4I6ZA 4EQQA 3KP7A 1MMNA 3FWEA 2XGCA 1IN6A 1X3UA 4QSHA 2NNYA 1QRYA 3GTKJ 5LHIA 2PMUA 2VE8A 4LD5A 2VPLA 2Y0SN 5D5VB 1D5VA 5IPAA 1O3RA 1F43A 4AC0A 2B9SA 3HBLA 2L5QA 3DEWA 1NG7A 4J00A 4F93B 4OIOF 3KYLA 2FNPA 5FKKA 2E7XA 3VSKA 1IN7A 1LFBA 1X58A 2V6CA 1NK2P 2XUBA 1HQCA 3BROA 2QENA 3ZGKA 2NVXJ 5FLMJ 1BL0A 2A05A 3VYSB 1Z7UA 1IG7A 2CFXA 3OOPA 2NS0A 2BE5F 2Y2ZA 3U9GA 1R6RA 3F0CA 3F9KA 2IGMA 2N8GA 2EFOA 3GWZA 3NWSA 2CU7A 2QWWA 1VQ5I 2KIFA 2KIMA 2ECBA 1O57A 2WB1N 5C4JJ 3RQIA 4M6VA 2KZGA 5JI6A 1XPXA 3CP2A 4BBRJ 3F72A 4F55A 5LBQA 1T8IA 3PO3J 3REOA 2HQAA 1BC8C 1S29A 2RDPA 4G7ZF 1LVAA 3EUAA 3DXJF 2R0QC 3ROUA 4BE2A 3PJRA 1UAAA 5EJCA 3GYHX 5F1RA 2VODA 1UCRA 2W25A 4RGXA 1U0JA 1ETXA 3HOYJ 2A5YB 3FK7A 5CLSA 2OD5A 3GTLJ 2VKVA 4MTEA 1SC7A 1W7PB 2Y48A 3K1PA 4MFDA 4UY8I 4ZZLA 3S93A 3L2WA 1FNNA 4AVPA 3JSPA 1Y39A 1ZKGA 1UZCA 1B6AA 1Z3XA 1UFMA 1FP1D 2H8WA 2DOFA 2OJED 1X2NA 2XAQA 2CSOA 4RMNA 2Y75A 4LIVA 1XGNA 4M3GA 1W5TA 3HL2A 4KNYA 4HDVA 5K7ZA 2AS5F 1Y6IA 2DK5A 3PIPF 2JVGA 3GXOA 3CD6I 2JZYA 3JRCA 3R61A 1RPWA 5JVTA 4M3FA 2L7ZA 2O03A 3IH4A 1AOYA 5J8CA 1YJ9I 1UB9A 3FHNA 3HPGA 2JRMA 3K0LA 3P9KA 3CCSI 1YJNI 2O8XA 4BBSJ 1YS7A 3CDIA 4P55A 1W7PD 2OAZA 4HG2A 3FXMA 1XD7A 1Y1WJ 4M3EA 2WV0A 3F3XA 1IUYA 5CVVA 3KLOA 2VQLA 3FBNB 3CC7I 3BT9A 3CDLA 2JA2A 4ZYDA 3LMMA 2VT2A 1IN5A 2JRTA 3DU6A 2VQGA 1K4SA 3CZ6A 3V7SA 1T98A 2MD5A 2VONA 2M0MA 3T8RA 4BACA 1HW5A 1FJLA 2M30A 4LIUA 5HLGA 4XOTA 3BZKA 3R6SA 2FUG2 5KCMA 4UVBA 3ZN0A 2QZ8A 1VQ4I 2FRHA 3PNTA 5CVJA 3E6BA 4R8HA 2EH3A 2DYSH 2E1NA 5LRRA 5GP9A 3U21A 2HS5A 3O8GA
chains in the Genus database with same CATH topology
2QQAA 3FMSA 3ZMZA 2UZKA 3CUQA 3P9IA 4HYEA 4ZYHA 1R7JA 3LQQA 4FT8A 3GFIA 1XDSA 2VT3A 3IWZA 2FXAA 4TV7A 2PI0A 2XV4S 2ACJA 5E17F 3QP5A 3CO6C 2EFPA 5EEHA 2O3FA 4EJVA 2JSCA 3T8TA 3E5UA 2RGVA 4HLXA 4I01A 3GZ5A 3ABTA 3I71A 1R22A 3DQVC 4HAMA 4G8XA 2DO7A 1Y0UA 3ECHA 3BJAA 4KIGA 3OV8A 4EJUA 1NHAA 3FX3A 3K9TA 2QM3A 1R58A 2FA5A 3ZP5A 3EDPA 4BNCA 4EJTA 4HW0A 1ULYA 1ZHFA 5J8FA 2OQRA 4GYGA 2XKPA 2R3SA 2FF4A 2W57A 1E17A 3E3VA 5ICGA 1Z91A 2FEZA 2Z99A 4ESJA 4U88A 2A07F 1ON2A 2OZUA 4EJOA 2ISZA 4ENKA 4BHPA 2XASA 4GXOA 3CDHA 3EYYA 3GVAA 1JE8A 1WSUA 2A68F 2V1XA 4EJWA 1G3WA 1ZRFA 2M45A 3FMRA 3QAHA 1EH8A 1J2XA 5L3CA 2VXZA 3KEQA 1B9MA 4HQMA 4XBFA 3DEUA 1QO0D 4R1HA 4RGRA 1DUXC 2UXNA 2F5CA 4M9XA 1WRJA 2P6TA 3ELKA 1S3JA 2FE3A 3SXYA 4HDUA 1LDKB 2HKOA 5KVRA 1HKSA 5F64A 3KE2A 4LLLA 2D45A 5JHUA 5LGUA 4LMYA 1H0MA 1SD6A 2MLKA 3KP2A 1S7OA 4G9YA 2NYXA 2Q8KA 1CGPA 4OIQF 5A2QK 1V4RA 5F6FA 2EA2A 4L9VA 1B59A 2X0LA 4L9TA 5ERIA 1XSXA 1O7LA 3O3KA 2GQQA 1FSEA 3RYPA 1SD4A 3HSFA 4G7OF 5D8LB 2JPBA 3LFKA 2COMA 5IT9K 2H09A 5HOOA 2ZNZA 3RI4A 1YIOA 1JHFA 1Z05A 2OBPA 5CVRA 2MBFA 5AONA 2V9VA 4KT5C 2A6EF 2L02A 3I0TA 2K4JA 5J6XA 1O3TA 4KIBA 1O3QA 2KJCA 3G73A 3BWGA 2WC2A 3TO7A 2LF8A 3R0JA 4L9JA 3M7GA 2HQNA 3I4PA 2MH2A 5DCMB 2EFQA 1BJAA 1BN5A 3CUQC 3CUQB 3WTSC 3L00A 1BIAA 2IA0A 3GLXA 4UVCA 3B73A 3R4KA 3FZVA 3C18A 4CDGA 1L3LA 4MQVA 4N9IA 4ZH4F 1KU9A 4KA4A 1S7AA 3DPLC 2DBBA 2O61A 4O6JA 1F9NA 3LA2A 2GXGA 5JR3A 3WGIA 2EA4A 1YW8A 4HV5A 4WWCA 3IKTA 2HOEA 1Q1HA 3TO9A 2D1VA 5HVQC 1REPC 5L3FA 1TW2A 4HF1A 3RTRA 1FZPB 3E6DA 1SMTA 3HTUA 4LLNA 5EEGA 4ZZDA 1K78A 4FX4A 2V1UA 3Q9VA 4XSXF 3EYIA 2XAJA 3ECOA 3TDZC 2HGCA 5L3GA 3WTWC 1FBUA 1HSTA 3RKWA 3GW2A 3DPTA 1GHCA 2XGXA 2IA1A 1P4AA 4B09A 5L3EA 2HTSA 3COAC 5FFZA 2L3DA 1QGPA 4G7HF 2H94A 2D1HA 3JAMZ 5BS6A 3AAFA 2BYVE 3P9CA 1OYIA 1OR7A 3TQNA 3K69A 1I6XA 4L18B 1FC3A 3FXQA 3F8NA 3CJNA 1LNWA 1G6NA 3WGGA 3K2ZA 2G7HA 3FXUA 1EH6A 3RKYA 2DAOA 1SAXA 3ABUA 2OQGA 3MEXA 3T5XA 2IPQX 3GEZA 3SZPA 1F1ZA 3DFGA 4GYIA 1J5YA 1R1TA 4MTDA 2YSRA 2E7WA 2GA1A 1HW1A 1TQIA 2KRFA 1ZYRF 2ETHA 2NAZA 5AIPA 1P4WA 1XGMA 3JW4A 5H20A 4BYYA 1TQPA 1TQMA 4Q48A 5HDKA 1D3YA 3ZMSA 2DTRA 2K02A 2DQLA 5KK1A 2RKHA 2IA2A 3KP6A 3H3ZA 1XGSA 2VBZA 4HX4A 2QBYB 2EWNA 2DLLA 4S05A 3GFJA 2AXLA 4UV8A 2F5DA 2YX4A 1R5GA 2BGCA 1BOAA 2ZXJA 1XSDA 2A69F 3HSEA 3O2PE 4RGSA 2K4BA 1L0OC 3RPQA 3FHZA 3F8BA 1LDJA 2G7UA 3GX4X 3VOEA 1FP2A 4WXDA 3BP8A 1S8NA 3I54A 2VC0A 3IKVA 2IJLA 1E2XA 1VTNC 1QQIA 1SFUA 3GO5A 2LKPA 1R23A 4UHTA 2BBYA 2XIGA 2PLYA 2W85A 1U2WA 1Z1DA 4CICA 1SMYF 1WI9A 5LGNA 4KIFA 2ZMEA 2ZNYA 1KGSA 4WK8F 4HX8A 2IVMA 4N0BA 2CYYA 1QZZA 1KQ8A 3IRQA 4Z2YA 4WF2A 3FM5A 2HR3A 3QPTA 2F5FA 4MHGA 2YX7A 4MGRA 4ZYEA 3HYIA 3ZN1A 1Z6RA 5K5QA 1XCBA 1ZN2A 1P4XA 2W84A 4S04A 3N4MA 3HHHA 3GZ6A 1T0FA 4Q47A 3GFMA 3PQJA 4IRGA 3ML6A 1YW7A 1FPQA 4WX9A 4ESBA 3ZMUA 4A2UA 2ZJ2A 1ON1A 5ED4A 1K78B 2PN6A 3HOTA 2Z9OA 1D8JA 4DQ2A 2VE9A 1ZREA 4JK1X 1P6RA 2XAGA 2GWRA 3J81Z 1I27A 2FMLA 1A04A 2YU3A 2HEOA 3NEUA 1WQ2A 4CGZA 1LB2A 1SFXA 2ZKZA 5CYVA 1XMAA 2PQ8A 2IT0A 1FBQA 4YFNF 3D5LA 4IXAA 5DUIA 1BM9A 4D0PA 1TLHB 4AIJA 2ZBKA 1RI7A 3PFIA 2J5PA 2B0LA 4PGGA 4YFXF 4ENJA 3C1DA 1XN7A 5D8KB 3F8MA 2HDCA 1YFHA 3D0SA 3KP4A 3RKXA 5DCFA 1G3YA 4JQFA 5K1YA 4K2EA 2M5WA 1ZGJA 2R7FA 5DD8A 4MEYF 1FSHA 4PDKA 4PGHA 2FBKA 3ZPLA 2MC3A 4P96A 4UXNA 3BOQA 5L3BA 1I5ZA 2P8TA 1MKMA 4L5IA 1MGTA 3GFLA 5ILUA 4MNUA 1IAWA 5FO5A 3M9AA 2IRFG 4P9FA 3ZMTA 3E6CC 4LJZF 2OA4A 2DPUA 1MD0A 2CG4A 3FMQA 2EV6A 2Q2EA 1HSJA 4AIKA 2J5OA 3IC7A 1ZG3A 1XDUA 2KKOA 5K5RA 3CO7C 3VFZA 1PUEE 5DYMA 2PJPA 3PQKA 4RGUA 4EM2A 4G6DA 1I1SA 4EGYA 1LEAA 1BC7C 4NB5A 4JBAA 2V1DA 3HRSA 4M71A 4KUMA 5LRSA 1V3FA 4U0WA 4AWXB 1USTA 3CUOA 1T39A 1ZARA 3WTTC 4UVAA 4HF2A 3FM3A 3KCCA 3CTAA 5DEQA 1ODDA 2ZMEB 2JTVA 1FLIA 3E6MA 1DPUA 4IHSA 3SQNA 4U0YA 5L3DA 2CW0F 1RUNA 3HIFA 3JAMK 1W4MA 3KEOA 4BHBA 2D2WA 3WODF 2NNNA 1ZAOA 2O6GE 5LEJA 1CF7A 3TOBA 1C0WA 3G3ZA 3WTYC 5H6RA 3F8CA 5BQTA 2GAUA 2M87A 2XAHA 2QUFA 2XAFA 4H0EA 3T1BA 3R60A 5BPIA 1RIOH 1XGOA 3W6KB 2XRNA 2LDUA 4M73A 3MZHA 3SZTA 4KMUX 2P5KA 3WE3A 1WKMA 4OIPF 4KN4X 3LA7A 2QQ9A 4LB6B 1EV7A 1J9IA 4M72A 5AIQA 3QOPA 4CYDA 1R1VA 3GUDA 4M9ZA 4UV9A 2KJBA 3JTHA 1JHHA 1YQAA 3M8FA 1TNSA 4WXCA 5ICCA 2YR2A 4U0VA 4FX0A 2WWYA 1OMIA 1KQ9A 5DV5A 1WWXA 3EUHA 4YG2F 2K86A 5LHHA 3E5XA 3L9FA 3L09A 2ZO4A 5D4SA 3QRFF 2QQBA 1I1GA 3MCZA 5FFXA 5D5UB 3EQLF 1SD5A 4BQAA 4YIFA 2P5LC 4G6QA 4BAYA 5DD4A 4LGWA 1FOKA 2CGPA 1IXCA 2BV6A 3KZYA 5E20A 1OYYA 2K7LA 6PAXA 4M6XA 3QU3A 4WXHA 2F2EA 4XLNF 1LQ1A 4ETSA 1MJAA 3F23A 2YPRA 2XVCA 2K27A 1HKQA 1UHWA 2X4HA 3CLOA 1FT9A 3J80Z 1FYLA 3RJPA 2VN2A 4RB0A 1IN8A 3I59A 3TDUC 4LG0A 2Z3YA 1LDDA 3HRTA 3Q9SA 1MZBA 4OMYA 2M8EA 3FF5A 1T6SA 3V4GA 2IP2A 1FYKA 5LGTA 1IXRC 3IWFA 4E70A 3HSRA 3Q5FA 4Y15A 1T38A 3ISPA 3VODA 3MWMA 2PEXA 3F8FA 5D6EA 2VBXA 4QWQA 4PZJA 1J59A 5ILSA 3I5UA 1ZH5A 1HKTA 5HS8A 4FHTA 3C3WA 2DQRA 3HUGA 1BBYA 4EMSA 3J81K 4KDPA 1ZRDA 2NRAC 3M8EA 2EJRA 3KFWX 2MH9A 2XROA 2L54A 4XLPF 2A61A 3DP7A 4I0AA 1J75A 1ZGAA 4M9SA 4L0ZB 1P2FA 1W5SA 2CWEA 4CXFA 3WU0A 1BI1A 2RQPA 5FB2A 3JSOA 2VOPA 1IRGA 1XMKA 2ADUA 1J7KA 2DFIA 3V7RA 5FLXZ 3RDIA 1QBJA 5BOXA 1ZG5A 1CF7B 3BY6A 5CVUA 3WE2A 1G4DA 2FOKA 2JT1A 2HYFA 4KFCA 4LLGF 3L2CA 3LAJA 3F22A 4P9UA 3K1MA 3QPHA 3TO6A 1K79A 1F4KA 4EM1A 1ZLKA 4HQEA 5CJ9A 4M6YA 5D4RA 4A12A 4A0XA 3JTGA 1DDNA 3KLNA 4HOBA 3V8JA 3WTVC 1KA8A 4UNOA 3F6OA 2QVOA 4I7HA 1UHMA 5HDNA 4RAYA 3U1DA 1R1UA 1AWCA 1PP7U 2R7DA 3BZ6A 5FD6A 4MQ9F 2ISYA 1MJ9A 5ICFA 1IW7F 4Q4ZF 3I58A 4GCVA 5BMZA 2P5VA 2VBWA 3H3UA 1U3EM 4ENNA 2GA2A 3TGNA 1YYVA 3LSTA 2FSWA 2VC1A 4KYWA 4HF0A 4CO8A 2P7VB 4ASNA 3WTUC 4CZZA 4Y17A 4O3MA 1D8KA 2JPCA 1GVJA 3T0YA 3BJOA 4EV0A 1KU3A 2BEOA 4QLCU 4Q5SF 5IT3A 3LWFA 5E18F 2FMYA 2G9WA 1ZLJA 4ENMA 4EGZA 1H9TA 4LB5A 1YTYA 2OZ6A 2M1BA 5E1XA 2STWA 5HLIA 3TOAA 4OMZA 2QYOA 2EV0A 2HZTA 1O7FA 2UXXA 3V7CA 3GF2A 3HHGA 5E1ZB 5H6QA 1OKRA 1LJ9A 4AD9A 1YLFA 2PBIA 1ONVA 5DUKA 1KU7A 5E1WA 2EV5A 5DCMA 3V8KA 4OINF 3I59B 2KIUA 2DK8A 4LG0B 1FBSA 1H9GA 4IVNA 3VB2A 4RAZA 3KP3A 2F5EA 4HBLA 2HFHA 4I02A 5ICEA 2ZFWA 5E8IA 4EVIA 4LK1F 1EH7A 1GXQA 4HA8A 2LNBA 3WGHA 1GXPA 2HKXA 2C6YA 1IXSB 4KMFA 2Y0MA 3LQRA 1FYMA 4U7DA 1XB4A 5LLQA 3ZMVA 1YG2A 2A6HF 1BI3A 3IHUA 5E8GA 4RS8A 4IJAA 2ZCWA 2ESHA 1G3TA 4A5MA 4U7BA 5LEKA 2V79A 3WU1B 2L4MA 4LK0F 4RB1A 1MJBA 3MQ0A 1U8RA 3S2WA 2STTA 5DDGA 5FGMA 4HX7A 2UWMA 5D5WB 3ZQ7A 3O6BB 3NQOA 1LEBA 3HTSB 3K1NA 2ELHA 2DPDA 1B4AA 1ZG1A 1YS6A 4O5VA 1KU2A 4LFUA 2VOOA 3H92A 3B02A 1KQ0A 2EFNA 3EETA 3TKYA 4XSZF 2GXBA 1FY7A 3F21A 3NRVA 4EM0B 4A6DA 1G3SA 2P7CB 1HXDA 1OPCA 5FD5A 1Z6TA 3KP5A 5CVIA 4KICA 4NQWA 3E97A 3RYRA 2HTJA 4A0YA 1B9NA 1MDMA 3WTXC 3HOSA 4RB3C 3DV8A 3QU6A 3DKWA 2FU4A 4UUVA 4IPAA 3LA3A 1K7AA 1XCVA 1OYWA 4BHCA 2MA3A 3WG9A 1BI0A 1Z9CA 2XKOA 4PCQA 2P6SA 1ZRCA 4YFKF 5K5OA 3BPXA 3RPUA 1STZA 4I09A 2RVCA 2HYGD 3J80K 2OU2A 4G94A 2O0YA 2GZWA 1K6OA 3M1EA 1SFEA 2QLZA 3BJ6A 3N97A 2EB7A 2H27A 2H6CA 4IHTA 2DI3A 1KYZA 4OU0A 3P7NA 3RIRA 1B1BA 1U5TA 2QBYA 1YO5C 2XHKA 5D6FA 1QNTA 1USSA 4F7ZA 2W24A 2CQKA 4RB2C 2FBIA 2GIVA 2DW4A 3FXRA 4YIIA 2MLGA 1BI2A 1QZYA 1IRFA 2EK5A 4B8XA 3ZMDA 4A5NA 3SFZA 4IRHA 1PDNC 4HZFA 1FWZA 2VBYA 5TJJA 1HW2A 3BDDA 5HLHA 3KZZA 3V8LA 4MEXF 4HLYA 1TNTA 5ILVA 1T2KA 3SHFA 2FNAA 4HV6A 1IN4A 1TW3A 4BH9A 2L4AA 1R5HA 3J7AO 4XRFA 4WCGA 3BPVA 5FLXK 5TRDA 2EFWA 2H6BA 4IRIA 3LAPA 2DT5A 2RNJA 2DU9A 1W7PA 3E5QA 3I64A 5JFRA 1JXSA 3W6JB 2P4WA 2L01A 4Y13A 1R00A 2TDXA 3L7WA 3QP6A 4OIRF 3WTZA 5D5XB 1YW9A 3IL2A 4DNCA 2FBHA 4BXUA 1J0RA 4N9HA 2RC4A 4CHUA 4OOIA 3R0AA 3HRUA 1TBXA 2HQRA 1RUOA 1F5TA 1P92A 1U78A 1RNLA 2PFBA 5BPDA 3IRRA 3F6VA 2E1CA 2RV8A 5LHGA 2RN7A 1KYWA 2LSOA 2Z33A 4I98B 4A6EA 4GO1A 2A3SA 2Z5UA 1IZ1A 2PMHA 4M74A 4I2OA 3ERED 1R36A 2ESNA 4P5OA 3VEPA 4I0BA 5A2QZ 1O3SA 1DPRA 2FQ3A 2LF7A 3MAJA 2Q0OA 5HS7A 4NHJA 3ULQB 1FX7A 4L9NA 3HRMA 2PG4A 4ESFA 1IF1A 1TTYA 1PP8F 2IW5A 5HDGA 1MDMB 1XSVA 1RZ4A 5IT9Z 4IF4A 3C7JA 4L0YB 4L5JA 5HS9A 1DP7P 1BIBA 1JGSA 4ON0A 4R79A 3MZYA 2HWVA 3MFKA 3U2RA 4GGGA 4KN7X 4AIHA 1QPMA 4ZYGA 3KETA 1U5TC 3I53A 1U5TB 4A0ZA 1S6LA 3DF8A 1SD7A 2WTEA 2CO5A 1HBXG 1U6GA 4EQQA 3KP7A 3FWEA 1IN6A 1X3UA 2NNYA 5LHIA 2PMUA 2VE8A 4LD5A 5D5VB 1D5VA 1O3RA 4OIOF 2FNPA 2E7XA 1IN7A 2V6CA 2XUBA 1HQCA 3BROA 2QENA 1Z7UA 2CFXA 3OOPA 2NS0A 2BE5F 3U9GA 2EFOA 3GWZA 2QWWA 2KIFA 2KIMA 1O57A 5JI6A 3F72A 5LBQA 3REOA 1BC8C 1S29A 2RDPA 4G7ZF 1LVAA 3DXJF 3ROUA 3GYHX 5F1RA 2VODA 1UCRA 2W25A 4RGXA 2A5YB 5CLSA 2OD5A 4MTEA 1W7PB 2Y48A 3K1PA 4ZZLA 1FNNA 4AVPA 3JSPA 1B6AA 1UFMA 1FP1D 2XAQA 2CSOA 2Y75A 1XGNA 1W5TA 4KNYA 4HDVA 2AS5F 2DK5A 3GXOA 2JZYA 3R61A 5JVTA 2O03A 1AOYA 5J8CA 1UB9A 3K0LA 3P9KA 2O8XA 1YS7A 4P55A 1W7PD 2OAZA 1XD7A 2WV0A 3F3XA 1IUYA 5CVVA 3KLOA 4ZYDA 2VT2A 1IN5A 2JRTA 3V7SA 1T98A 2MD5A 2VONA 3T8RA 1HW5A 2M30A 5HLGA 3R6SA 3ZN0A 4UVBA 2QZ8A 2FRHA 5CVJA 3E6BA 4R8HA 2E1NA 5LRRA 2HS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQA A;  3FMS A;  3ZMZ A;  2UZK A;  3CUQ A;  3P9I A;  4HYE A;  4ZYH A;  1R7J A;  3LQQ A;  4FT8 A;  3GFI A;  1XDS A;  2VT3 A;  3IWZ A;  2FXA A;  4TV7 A;  2PI0 A;  2XV4 S;  2ACJ A;  5E17 F;  3QP5 A;  3CO6 C;  2EFP A;  5EEH A;  2O3F A;  4EJV A;  2JSC A;  3T8T A;  3E5U A;  2RGV A;  4HLX A;  4I01 A;  3GZ5 A;  3ABT A;  3I71 A;  1R22 A;  3DQV C;  4HAM A;  4G8X A;  2DO7 A;  1Y0U A;  3ECH A;  3BJA A;  4KIG A;  3OV8 A;  4EJU A;  1NHA A;  3FX3 A;  3K9T A;  2QM3 A;  1R58 A;  2FA5 A;  3ZP5 A;  3EDP A;  4BNC A;  4EJT A;  4HW0 A;  1ULY A;  1ZHF A;  5J8F A;  2OQR A;  4GYG A;  2XKP A;  2R3S A;  2FF4 A;  2W57 A;  1E17 A;  3E3V A;  5ICG A;  1Z91 A;  2FEZ A;  2Z99 A;  4ESJ A;  4U88 A;  2A07 F;  1ON2 A;  2OZU A;  4EJO A;  2ISZ A;  4ENK A;  4BHP A;  2XAS A;  4GXO A;  3CDH A;  3EYY A;  3GVA A;  1JE8 A;  1WSU A;  2A68 F;  2V1X A;  4EJW A;  1G3W A;  1ZRF A;  2M45 A;  3FMR A;  3QAH A;  1EH8 A;  1J2X A;  5L3C A;  2VXZ A;  3KEQ A;  1B9M A;  4HQM A;  4XBF A;  3DEU A;  1QO0 D;  4R1H A;  4RGR A;  1DUX C;  2UXN A;  2F5C A;  4M9X A;  1WRJ A;  2P6T A;  3ELK A;  1S3J A;  2FE3 A;  3SXY A;  4HDU A;  1LDK B;  2HKO A;  5KVR A;  1HKS A;  5F64 A;  3KE2 A;  4LLL A;  2D45 A;  5JHU A;  5LGU A;  4LMY A;  1H0M A;  1SD6 A;  2MLK A;  3KP2 A;  1S7O A;  4G9Y A;  2NYX A;  2Q8K A;  1CGP A;  4OIQ F;  5A2Q K;  1V4R A;  5F6F A;  2EA2 A;  4L9V A;  1B59 A;  2X0L A;  4L9T A;  5ERI A;  1XSX A;  1O7L A;  3O3K A;  2GQQ A;  1FSE A;  3RYP A;  1SD4 A;  3HSF A;  4G7O F;  5D8L B;  2JPB A;  3LFK A;  2COM A;  5IT9 K;  2H09 A;  5HOO A;  2ZNZ A;  3RI4 A;  1YIO A;  1JHF A;  1Z05 A;  2OBP A;  5CVR A;  2MBF A;  5AON A;  2V9V A;  4KT5 C;  2A6E F;  2L02 A;  3I0T A;  2K4J A;  5J6X A;  1O3T A;  4KIB A;  1O3Q A;  2KJC A;  3G73 A;  3BWG A;  2WC2 A;  3TO7 A;  2LF8 A;  3R0J A;  4L9J A;  3M7G A;  2HQN A;  3I4P A;  2MH2 A;  5DCM B;  2EFQ A;  1BJA A;  1BN5 A;  3CUQ C;  3CUQ B;  3WTS C;  3L00 A;  1BIA A;  2IA0 A;  3GLX A;  4UVC A;  3B73 A;  3R4K A;  3FZV A;  3C18 A;  4CDG A;  1L3L A;  4MQV A;  4N9I A;  4ZH4 F;  1KU9 A;  4KA4 A;  1S7A A;  3DPL C;  2DBB A;  2O61 A;  4O6J A;  1F9N A;  3LA2 A;  2GXG A;  5JR3 A;  3WGI A;  2EA4 A;  1YW8 A;  4HV5 A;  4WWC A;  3IKT A;  2HOE A;  1Q1H A;  3TO9 A;  2D1V A;  5HVQ C;  1REP C;  5L3F A;  1TW2 A;  4HF1 A;  3RTR A;  1FZP B;  3E6D A;  1SMT A;  3HTU A;  4LLN A;  5EEG A;  4ZZD A;  1K78 A;  4FX4 A;  2V1U A;  3Q9V A;  4XSX F;  3EYI A;  2XAJ A;  3ECO A;  3TDZ C;  2HGC A;  5L3G A;  3WTW C;  1FBU A;  1HST A;  3RKW A;  3GW2 A;  3DPT A;  1GHC A;  2XGX A;  2IA1 A;  1P4A A;  4B09 A;  5L3E A;  2HTS A;  3COA C;  5FFZ A;  2L3D A;  1QGP A;  4G7H F;  2H94 A;  2D1H A;  3JAM Z;  5BS6 A;  3AAF A;  2BYV E;  3P9C A;  1OYI A;  1OR7 A;  3TQN A;  3K69 A;  1I6X A;  4L18 B;  1FC3 A;  3FXQ A;  3F8N A;  3CJN A;  1LNW A;  1G6N A;  3WGG A;  3K2Z A;  2G7H A;  3FXU A;  1EH6 A;  3RKY A;  2DAO A;  1SAX A;  3ABU A;  2OQG A;  3MEX A;  3T5X A;  2IPQ X;  3GEZ A;  3SZP A;  1F1Z A;  3DFG A;  4GYI A;  1J5Y A;  1R1T A;  4MTD A;  2YSR A;  2E7W A;  2GA1 A;  1HW1 A;  1TQI A;  2KRF A;  1ZYR F;  2ETH A;  2NAZ A;  5AIP A;  1P4W A;  1XGM A;  3JW4 A;  5H20 A;  4BYY A;  1TQP A;  1TQM A;  4Q48 A;  5HDK A;  1D3Y A;  3ZMS A;  2DTR A;  2K02 A;  2DQL A;  5KK1 A;  2RKH A;  2IA2 A;  3KP6 A;  3H3Z A;  1XGS A;  2VBZ A;  4HX4 A;  2QBY B;  2EWN A;  2DLL A;  4S05 A;  3GFJ A;  2AXL A;  4UV8 A;  2F5D A;  2YX4 A;  1R5G A;  2BGC A;  1BOA A;  2ZXJ A;  1XSD A;  2A69 F;  3HSE A;  3O2P E;  4RGS A;  2K4B A;  1L0O C;  3RPQ A;  3FHZ A;  3F8B A;  1LDJ A;  2G7U A;  3GX4 X;  3VOE A;  1FP2 A;  4WXD A;  3BP8 A;  1S8N A;  3I54 A;  2VC0 A;  3IKV A;  2IJL A;  1E2X A;  1VTN C;  1QQI A;  1SFU A;  3GO5 A;  2LKP A;  1R23 A;  4UHT A;  2BBY A;  2XIG A;  2PLY A;  2W85 A;  1U2W A;  1Z1D A;  4CIC A;  1SMY F;  1WI9 A;  5LGN A;  4KIF A;  2ZME A;  2ZNY A;  1KGS A;  4WK8 F;  4HX8 A;  2IVM A;  4N0B A;  2CYY A;  1QZZ A;  1KQ8 A;  3IRQ A;  4Z2Y A;  4WF2 A;  3FM5 A;  2HR3 A;  3QPT A;  2F5F A;  4MHG A;  2YX7 A;  4MGR A;  4ZYE A;  3HYI A;  3ZN1 A;  1Z6R A;  5K5Q A;  1XCB A;  1ZN2 A;  1P4X A;  2W84 A;  4S04 A;  3N4M A;  3HHH A;  3GZ6 A;  1T0F A;  4Q47 A;  3GFM A;  3PQJ A;  4IRG A;  3ML6 A;  1YW7 A;  1FPQ A;  4WX9 A;  4ESB A;  3ZMU A;  4A2U A;  2ZJ2 A;  1ON1 A;  5ED4 A;  1K78 B;  2PN6 A;  3HOT A;  2Z9O A;  1D8J A;  4DQ2 A;  2VE9 A;  1ZRE A;  4JK1 X;  1P6R A;  2XAG A;  2GWR A;  3J81 Z;  1I27 A;  2FML A;  1A04 A;  2YU3 A;  2HEO A;  3NEU A;  1WQ2 A;  4CGZ A;  1LB2 A;  1SFX A;  2ZKZ A;  5CYV A;  1XMA A;  2PQ8 A;  2IT0 A;  1FBQ A;  4YFN F;  3D5L A;  4IXA A;  5DUI A;  1BM9 A;  4D0P A;  1TLH B;  4AIJ A;  2ZBK A;  1RI7 A;  3PFI A;  2J5P A;  2B0L A;  4PGG A;  4YFX F;  4ENJ A;  3C1D A;  1XN7 A;  5D8K B;  3F8M A;  2HDC A;  1YFH A;  3D0S A;  3KP4 A;  3RKX A;  5DCF A;  1G3Y A;  4JQF A;  5K1Y A;  4K2E A;  2M5W A;  1ZGJ A;  2R7F A;  5DD8 A;  4MEY F;  1FSH A;  4PDK A;  4PGH A;  2FBK A;  3ZPL A;  2MC3 A;  4P96 A;  4UXN A;  3BOQ A;  5L3B A;  1I5Z A;  2P8T A;  1MKM A;  4L5I A;  1MGT A;  3GFL A;  5ILU A;  4MNU A;  1IAW A;  5FO5 A;  3M9A A;  2IRF G;  4P9F A;  3ZMT A;  3E6C C;  4LJZ F;  2OA4 A;  2DPU A;  1MD0 A;  2CG4 A;  3FMQ A;  2EV6 A;  2Q2E A;  1HSJ A;  4AIK A;  2J5O A;  3IC7 A;  1ZG3 A;  1XDU A;  2KKO A;  5K5R A;  3CO7 C;  3VFZ A;  1PUE E;  5DYM A;  2PJP A;  3PQK A;  4RGU A;  4EM2 A;  4G6D A;  1I1S A;  4EGY A;  1LEA A;  1BC7 C;  4NB5 A;  4JBA A;  2V1D A;  3HRS A;  4M71 A;  4KUM A;  5LRS A;  1V3F A;  4U0W A;  4AWX B;  1UST A;  3CUO A;  1T39 A;  1ZAR A;  3WTT C;  4UVA A;  4HF2 A;  3FM3 A;  3KCC A;  3CTA A;  5DEQ A;  1ODD A;  2ZME B;  2JTV A;  1FLI A;  3E6M A;  1DPU A;  4IHS A;  3SQN A;  4U0Y A;  5L3D A;  2CW0 F;  1RUN A;  3HIF A;  3JAM K;  1W4M A;  3KEO A;  4BHB A;  2D2W A;  3WOD F;  2NNN A;  1ZAO A;  2O6G E;  5LEJ A;  1CF7 A;  3TOB A;  1C0W A;  3G3Z A;  3WTY C;  5H6R A;  3F8C A;  5BQT A;  2GAU A;  2M87 A;  2XAH A;  2QUF A;  2XAF A;  4H0E A;  3T1B A;  3R60 A;  5BPI A;  1RIO H;  1XGO A;  3W6K B;  2XRN A;  2LDU A;  4M73 A;  3MZH A;  3SZT A;  4KMU X;  2P5K A;  3WE3 A;  1WKM A;  4OIP F;  4KN4 X;  3LA7 A;  2QQ9 A;  4LB6 B;  1EV7 A;  1J9I A;  4M72 A;  5AIQ A;  3QOP A;  4CYD A;  1R1V A;  3GUD A;  4M9Z A;  4UV9 A;  2KJB A;  3JTH A;  1JHH A;  1YQA A;  3M8F A;  1TNS A;  4WXC A;  5ICC A;  2YR2 A;  4U0V A;  4FX0 A;  2WWY A;  1OMI A;  1KQ9 A;  5DV5 A;  1WWX A;  3EUH A;  4YG2 F;  2K86 A;  5LHH A;  3E5X A;  3L9F A;  3L09 A;  2ZO4 A;  5D4S A;  3QRF F;  2QQB A;  1I1G A;  3MCZ A;  5FFX A;  5D5U B;  3EQL F;  1SD5 A;  4BQA A;  4YIF A;  2P5L C;  4G6Q A;  4BAY A;  5DD4 A;  4LGW A;  1FOK A;  2CGP A;  1IXC A;  2BV6 A;  3KZY A;  5E20 A;  1OYY A;  2K7L A;  6PAX A;  4M6X A;  3QU3 A;  4WXH A;  2F2E A;  4XLN F;  1LQ1 A;  4ETS A;  1MJA A;  3F23 A;  2YPR A;  2XVC A;  2K27 A;  1HKQ A;  1UHW A;  2X4H A;  3CLO A;  1FT9 A;  3J80 Z;  1FYL A;  3RJP A;  2VN2 A;  4RB0 A;  1IN8 A;  3I59 A;  3TDU C;  4LG0 A;  2Z3Y A;  1LDD A;  3HRT A;  3Q9S A;  1MZB A;  4OMY A;  2M8E A;  3FF5 A;  1T6S A;  3V4G A;  2IP2 A;  1FYK A;  5LGT A;  1IXR C;  3IWF A;  4E70 A;  3HSR A;  3Q5F A;  4Y15 A;  1T38 A;  3ISP A;  3VOD A;  3MWM A;  2PEX A;  3F8F A;  5D6E A;  2VBX A;  4QWQ A;  4PZJ A;  1J59 A;  5ILS A;  3I5U A;  1ZH5 A;  1HKT A;  5HS8 A;  4FHT A;  3C3W A;  2DQR A;  3HUG A;  1BBY A;  4EMS A;  3J81 K;  4KDP A;  1ZRD A;  2NRA C;  3M8E A;  2EJR A;  3KFW X;  2MH9 A;  2XRO A;  2L54 A;  4XLP F;  2A61 A;  3DP7 A;  4I0A A;  1J75 A;  1ZGA A;  4M9S A;  4L0Z B;  1P2F A;  1W5S A;  2CWE A;  4CXF A;  3WU0 A;  1BI1 A;  2RQP A;  5FB2 A;  3JSO A;  2VOP A;  1IRG A;  1XMK A;  2ADU A;  1J7K A;  2DFI A;  3V7R A;  5FLX Z;  3RDI A;  1QBJ A;  5BOX A;  1ZG5 A;  1CF7 B;  3BY6 A;  5CVU A;  3WE2 A;  1G4D A;  2FOK A;  2JT1 A;  2HYF A;  4KFC A;  4LLG F;  3L2C A;  3LAJ A;  3F22 A;  4P9U A;  3K1M A;  3QPH A;  3TO6 A;  1K79 A;  1F4K A;  4EM1 A;  1ZLK A;  4HQE A;  5CJ9 A;  4M6Y A;  5D4R A;  4A12 A;  4A0X A;  3JTG A;  1DDN A;  3KLN A;  4HOB A;  3V8J A;  3WTV C;  1KA8 A;  4UNO A;  3F6O A;  2QVO A;  4I7H A;  1UHM A;  5HDN A;  4RAY A;  3U1D A;  1R1U A;  1AWC A;  1PP7 U;  2R7D A;  3BZ6 A;  5FD6 A;  4MQ9 F;  2ISY A;  1MJ9 A;  5ICF A;  1IW7 F;  4Q4Z F;  3I58 A;  4GCV A;  5BMZ A;  2P5V A;  2VBW A;  3H3U A;  1U3E M;  4ENN A;  2GA2 A;  3TGN A;  1YYV A;  3LST A;  2FSW A;  2VC1 A;  4KYW A;  4HF0 A;  4CO8 A;  2P7V B;  4ASN A;  3WTU C;  4CZZ A;  4Y17 A;  4O3M A;  1D8K A;  2JPC A;  1GVJ A;  3T0Y A;  3BJO A;  4EV0 A;  1KU3 A;  2BEO A;  4QLC U;  4Q5S F;  5IT3 A;  3LWF A;  5E18 F;  2FMY A;  2G9W A;  1ZLJ A;  4ENM A;  4EGZ A;  1H9T A;  4LB5 A;  1YTY A;  2OZ6 A;  2M1B A;  5E1X A;  2STW A;  5HLI A;  3TOA A;  4OMZ A;  2QYO A;  2EV0 A;  2HZT A;  1O7F A;  2UXX A;  3V7C A;  3GF2 A;  3HHG A;  5E1Z B;  5H6Q A;  1OKR A;  1LJ9 A;  4AD9 A;  1YLF A;  2PBI A;  1ONV A;  5DUK A;  1KU7 A;  5E1W A;  2EV5 A;  5DCM A;  3V8K A;  4OIN F;  3I59 B;  2KIU A;  2DK8 A;  4LG0 B;  1FBS A;  1H9G A;  4IVN A;  3VB2 A;  4RAZ A;  3KP3 A;  2F5E A;  4HBL A;  2HFH A;  4I02 A;  5ICE A;  2ZFW A;  5E8I A;  4EVI A;  4LK1 F;  1EH7 A;  1GXQ A;  4HA8 A;  2LNB A;  3WGH A;  1GXP A;  2HKX A;  2C6Y A;  1IXS B;  4KMF A;  2Y0M A;  3LQR A;  1FYM A;  4U7D A;  1XB4 A;  5LLQ A;  3ZMV A;  1YG2 A;  2A6H F;  1BI3 A;  3IHU A;  5E8G A;  4RS8 A;  4IJA A;  2ZCW A;  2ESH A;  1G3T A;  4A5M A;  4U7B A;  5LEK A;  2V79 A;  3WU1 B;  2L4M A;  4LK0 F;  4RB1 A;  1MJB A;  3MQ0 A;  1U8R A;  3S2W A;  2STT A;  5DDG A;  5FGM A;  4HX7 A;  2UWM A;  5D5W B;  3ZQ7 A;  3O6B B;  3NQO A;  1LEB A;  3HTS B;  3K1N A;  2ELH A;  2DPD A;  1B4A A;  1ZG1 A;  1YS6 A;  4O5V A;  1KU2 A;  4LFU A;  2VOO A;  3H92 A;  3B02 A;  1KQ0 A;  2EFN A;  3EET A;  3TKY A;  4XSZ F;  2GXB A;  1FY7 A;  3F21 A;  3NRV A;  4EM0 B;  4A6D A;  1G3S A;  2P7C B;  1HXD A;  1OPC A;  5FD5 A;  1Z6T A;  3KP5 A;  5CVI A;  4KIC A;  4NQW A;  3E97 A;  3RYR A;  2HTJ A;  4A0Y A;  1B9N A;  1MDM A;  3WTX C;  3HOS A;  4RB3 C;  3DV8 A;  3QU6 A;  3DKW A;  2FU4 A;  4UUV A;  4IPA A;  3LA3 A;  1K7A A;  1XCV A;  1OYW A;  4BHC A;  2MA3 A;  3WG9 A;  1BI0 A;  1Z9C A;  2XKO A;  4PCQ A;  2P6S A;  1ZRC A;  4YFK F;  5K5O A;  3BPX A;  3RPU A;  1STZ A;  4I09 A;  2RVC A;  2HYG D;  3J80 K;  2OU2 A;  4G94 A;  2O0Y A;  2GZW A;  1K6O A;  3M1E A;  1SFE A;  2QLZ A;  3BJ6 A;  3N97 A;  2EB7 A;  2H27 A;  2H6C A;  4IHT A;  2DI3 A;  1KYZ A;  4OU0 A;  3P7N A;  3RIR A;  1B1B A;  1U5T A;  2QBY A;  1YO5 C;  2XHK A;  5D6F A;  1QNT A;  1USS A;  4F7Z A;  2W24 A;  2CQK A;  4RB2 C;  2FBI A;  2GIV A;  2DW4 A;  3FXR A;  4YII A;  2MLG A;  1BI2 A;  1QZY A;  1IRF A;  2EK5 A;  4B8X A;  3ZMD A;  4A5N A;  3SFZ A;  4IRH A;  1PDN C;  4HZF A;  1FWZ A;  2VBY A;  5TJJ A;  1HW2 A;  3BDD A;  5HLH A;  3KZZ A;  3V8L A;  4MEX F;  4HLY A;  1TNT A;  5ILV A;  1T2K A;  3SHF A;  2FNA A;  4HV6 A;  1IN4 A;  1TW3 A;  4BH9 A;  2L4A A;  1R5H A;  3J7A O;  4XRF A;  4WCG A;  3BPV A;  5FLX K;  5TRD A;  2EFW A;  2H6B A;  4IRI A;  3LAP A;  2DT5 A;  2RNJ A;  2DU9 A;  1W7P A;  3E5Q A;  3I64 A;  5JFR A;  1JXS A;  3W6J B;  2P4W A;  2L01 A;  4Y13 A;  1R00 A;  2TDX A;  3L7W A;  3QP6 A;  4OIR F;  3WTZ A;  5D5X B;  1YW9 A;  3IL2 A;  4DNC A;  2FBH A;  4BXU A;  1J0R A;  4N9H A;  2RC4 A;  4CHU A;  4OOI A;  3R0A A;  3HRU A;  1TBX A;  2HQR A;  1RUO A;  1F5T A;  1P92 A;  1U78 A;  1RNL A;  2PFB A;  5BPD A;  3IRR A;  3F6V A;  2E1C A;  2RV8 A;  5LHG A;  2RN7 A;  1KYW A;  2LSO A;  2Z33 A;  4I98 B;  4A6E A;  4GO1 A;  2A3S A;  2Z5U A;  1IZ1 A;  2PMH A;  4M74 A;  4I2O A;  3ERE D;  1R36 A;  2ESN A;  4P5O A;  3VEP A;  4I0B A;  5A2Q Z;  1O3S A;  1DPR A;  2FQ3 A;  2LF7 A;  3MAJ A;  2Q0O A;  5HS7 A;  4NHJ A;  3ULQ B;  1FX7 A;  4L9N A;  3HRM A;  2PG4 A;  4ESF A;  1IF1 A;  1TTY A;  1PP8 F;  2IW5 A;  5HDG A;  1MDM B;  1XSV A;  1RZ4 A;  5IT9 Z;  4IF4 A;  3C7J A;  4L0Y B;  4L5J A;  5HS9 A;  1DP7 P;  1BIB A;  1JGS A;  4ON0 A;  4R79 A;  3MZY A;  2HWV A;  3MFK A;  3U2R A;  4GGG A;  4KN7 X;  4AIH A;  1QPM A;  4ZYG A;  3KET A;  1U5T C;  3I53 A;  1U5T B;  4A0Z A;  1S6L A;  3DF8 A;  1SD7 A;  2WTE A;  2CO5 A;  1HBX G;  1U6G A;  4EQQ A;  3KP7 A;  3FWE A;  1IN6 A;  1X3U A;  2NNY A;  5LHI A;  2PMU A;  2VE8 A;  4LD5 A;  5D5V B;  1D5V A;  1O3R A;  4OIO F;  2FNP A;  2E7X A;  1IN7 A;  2V6C A;  2XUB A;  1HQC A;  3BRO A;  2QEN A;  1Z7U A;  2CFX A;  3OOP A;  2NS0 A;  2BE5 F;  3U9G A;  2EFO A;  3GWZ A;  2QWW A;  2KIF A;  2KIM A;  1O57 A;  5JI6 A;  3F72 A;  5LBQ A;  3REO A;  1BC8 C;  1S29 A;  2RDP A;  4G7Z F;  1LVA A;  3DXJ F;  3ROU A;  3GYH X;  5F1R A;  2VOD A;  1UCR A;  2W25 A;  4RGX A;  2A5Y B;  5CLS A;  2OD5 A;  4MTE A;  1W7P B;  2Y48 A;  3K1P A;  4ZZL A;  1FNN A;  4AVP A;  3JSP A;  1B6A A;  1UFM A;  1FP1 D;  2XAQ A;  2CSO A;  2Y75 A;  1XGN A;  1W5T A;  4KNY A;  4HDV A;  2AS5 F;  2DK5 A;  3GXO A;  2JZY A;  3R61 A;  5JVT A;  2O03 A;  1AOY A;  5J8C A;  1UB9 A;  3K0L A;  3P9K A;  2O8X A;  1YS7 A;  4P55 A;  1W7P D;  2OAZ A;  1XD7 A;  2WV0 A;  3F3X A;  1IUY A;  5CVV A;  3KLO A;  4ZYD A;  2VT2 A;  1IN5 A;  2JRT A;  3V7S A;  1T98 A;  2MD5 A;  2VON A;  3T8R A;  1HW5 A;  2M30 A;  5HLG A;  3R6S A;  3ZN0 A;  4UVB A;  2QZ8 A;  2FRH A;  5CVJ A;  3E6B A;  4R8H A;  2E1N A;  5LRR A;  2HS5 A; 
#chains in the Genus database with same CATH topology
 2R7Q A;  2QQA A;  4AU7 A;  3FMS A;  3ZMZ A;  2UZK A;  5TGT A;  3PIO F;  2EZI A;  3ZQF A;  3WG7 H;  3CUQ A;  4BQQ A;  1Z77 A;  3P9I A;  4HYE A;  4ZYH A;  1R7J A;  2W7N A;  3LQQ A;  4CSW A;  1OCC H;  2LTP A;  4FT8 A;  4X6A J;  3GFI A;  1YHQ I;  1XDS A;  2VT3 A;  3IWZ A;  3ZQC A;  2FXA A;  2XF7 A;  3FDY A;  4M3B A;  4TV7 A;  1MBG A;  2D5V A;  1R71 A;  1HOM A;  2PI0 A;  2XV4 S;  3QQA A;  3AG2 H;  2ACJ A;  2VKD A;  5E17 F;  2CQQ A;  3QP5 A;  3G4S I;  1YIT I;  4C2M J;  3CO6 C;  2BHY A;  2EFP A;  2LFB A;  3PSI A;  5EEH A;  2X85 A;  2O3F A;  4EJV A;  2JSC A;  1FIA A;  1WCM J;  2HXO A;  2H1L A;  3T8T A;  3A02 A;  3E5U A;  3LOC A;  5C3E J;  1MMA A;  3DLL F;  2RGV A;  4DZJ A;  1ERD A;  3PSF A;  4HLX A;  1WJF A;  2VPR A;  4I01 A;  3GZ5 A;  2IS6 A;  3ABT A;  3HKZ N;  3I71 A;  1R22 A;  1Z3Y A;  2V9K A;  4BJ5 C;  5J47 A;  3DQV C;  2CW8 A;  2HQ5 A;  4HAM A;  4G8X A;  4ZDO A;  1WJB A;  2DO7 A;  2L7F P;  1Y0U A;  2R7T A;  4KIT B;  5FLV A;  3DKY A;  3ECH A;  3BJA A;  4KIG A;  2YU9 J;  5EZG A;  3NAU A;  3OV8 A;  5GTI C;  4EJU A;  5DTD A;  1NHA A;  3FX3 A;  3K9T A;  2QM3 A;  1E3H A;  1R58 A;  2DJN A;  2DT7 B;  1A6Q A;  2FA5 A;  2W4S A;  5M5Y J;  1SVM A;  3Q0U A;  3ZP5 A;  3RQ4 A;  2HU9 A;  3EDP A;  2BHZ A;  4A3J J;  4BNC A;  4EJT A;  2XPV A;  3A0H C;  5IYD J;  4HW0 A;  1ULY A;  1ZHF A;  5J8F A;  3G6E I;  2OQR A;  3EPZ A;  4GYG A;  4BDZ A;  2XKP A;  4Y3O A;  2R3S A;  2X51 A;  1BR1 A;  2FF4 A;  5IOZ A;  4I99 C;  2W57 A;  1E17 A;  3PUB A;  4B1R A;  3E3V A;  4PJL A;  5ICG A;  4LG3 A;  1Z91 A;  2FEZ A;  2Z99 A;  4CH7 A;  1VQM I;  4BL0 B;  2FX0 A;  3D1N I;  4ESJ A;  1MIJ A;  4U88 A;  3H0D A;  2KMU A;  2X1C A;  4BKX A;  1ON2 A;  2A07 F;  4BXX J;  2LKX A;  2OZU A;  2BW3 B;  1YI2 I;  4EJO A;  2AO9 A;  2ISZ A;  1G8X A;  4ENK A;  3ZRG A;  4BHP A;  3H3V K;  2XAS A;  2E5Z A;  4GXO A;  4UB8 C;  3CDH A;  3EYY A;  3GVA A;  2X48 A;  1JE8 A;  2E60 A;  1WSU A;  2AHQ A;  2A68 F;  4XRM A;  3ABL H;  2V1X A;  1BW5 A;  4EJW A;  1G3W A;  2DA7 A;  1Z0X A;  3JCU C;  3BTJ A;  1ZRF A;  1XX5 A;  2M45 A;  4BXF A;  1GUU A;  1Y8R B;  4IX7 A;  1X3Z B;  2MD0 A;  3M3Y J;  3FMR A;  3QAH A;  1A6I A;  2HDD A;  3K4J A;  1EH8 A;  5CQE A;  3IV5 A;  1J2X A;  3AL0 C;  5GPA A;  5L3C A;  2HOS A;  2VXZ A;  3AL0 B;  3KEQ A;  1B9M A;  4HQM A;  4XBF A;  3DEU A;  1QO0 D;  4R1H A;  4RGR A;  4AM3 A;  2LP0 A;  3G71 I;  1DUX C;  2UXN A;  2F5C A;  3BR3 A;  1WRJ A;  4M9X A;  2P6T A;  3ELK A;  1S3J A;  2FE3 A;  3ZQG A;  2XSJ C;  3SXY A;  5B3S H;  4HDU A;  1Z7L A;  2LLK A;  5DM6 F;  2DXI A;  1LFU P;  1LDK B;  2HKO A;  5KVR A;  1HKS A;  4PUS A;  1K4T A;  2L0K A;  1OCZ H;  3KE2 A;  5F64 A;  4LLL A;  1TWH J;  2KT0 A;  2D45 A;  4B47 A;  1S7E A;  1T56 A;  4QTR A;  4CYC A;  2R7V A;  5FKL A;  1U8B A;  1QA6 A;  3BG7 A;  3MN2 A;  2XRL A;  5JHU A;  2I5U A;  5LGU A;  2RQQ A;  2GOX B;  3S3O A;  2DT6 A;  2KLO A;  2IS4 A;  4LMY A;  4BGD A;  1HDP A;  1H0M A;  1SD6 A;  3HOX J;  2MLK A;  3CF5 F;  3KP2 A;  2QSH X;  1S7O A;  4G9Y A;  2NYX A;  2Q8K A;  3VPR A;  1CGP A;  4OIQ F;  5A2Q K;  1V4R A;  2MC4 A;  3DKX A;  5F6F A;  2EA2 A;  3LSP A;  3BR5 A;  4L9V A;  1B59 A;  2LBF A;  1JTX A;  2X0L A;  5IP6 A;  4CCL A;  2HI3 A;  3KYD B;  4L9T A;  5ERI A;  3G1M A;  5GAG J;  5E79 C;  1XSX A;  2ME0 A;  1O7L A;  3O3K A;  3K4C A;  2GQQ A;  1FSE A;  1X1D A;  3RYP A;  1SD4 A;  3HSF A;  1BA5 A;  4G7O F;  4EEF G;  5D8L B;  3ZQQ A;  2BVM A;  2JPB A;  3LFK A;  4HEA 2;  2COM A;  4EAT A;  5IT9 K;  1TWA J;  2YUS A;  3I55 I;  2EZK A;  1E0E A;  2H09 A;  5HOO A;  3W3C A;  2ZNZ A;  3RI4 A;  1YIO A;  1JHF A;  2MG4 A;  2DA6 A;  3H35 A;  3A01 A;  2VL8 A;  9ANT A;  2EPF A;  2V9P A;  1Z05 A;  2OBP A;  3P5J A;  5CVR A;  1V5E A;  2M4K A;  2MBF A;  1R49 A;  5AON A;  2V9V A;  5F0F A;  4KT5 C;  3OSG A;  2A6E F;  2ICW G;  2L02 A;  3H5R A;  3I0T A;  2K4J A;  5J6X A;  1O3T A;  4KIB A;  1O3Q A;  2CQX A;  3OYG A;  2KJC A;  3G73 A;  3BWG A;  2WC2 A;  3TO7 A;  3TW7 A;  2LF8 A;  1D1C A;  5J4V A;  3R0J A;  1VQ7 I;  3J7A Y;  3H5A A;  4L9J A;  3M7G A;  1LVK A;  2HQN A;  2NOG A;  3HM5 A;  3I4P A;  3CCQ I;  5H2F C;  2MH2 A;  4HRI A;  1WJC A;  5DCM B;  2EFQ A;  5M5X J;  4NDL A;  4XOP A;  2XPU A;  1BJA A;  1BN5 A;  3CUQ C;  1NTC A;  3CUQ B;  3WTS C;  3L00 A;  1BIA A;  4Y7N J;  3JRB A;  2IA0 A;  3GLX A;  4UVC A;  3ESW B;  3B73 A;  2ID3 A;  5F1J A;  3R4K A;  3FZV A;  3K4M A;  5HLT A;  2NVQ J;  3C18 A;  4CDG A;  1L3L A;  4MQV A;  4N9I A;  4ZH4 F;  5FRO A;  2ZJQ F;  4PSX A;  2GLO A;  1KU9 A;  1ZEL A;  4KA4 A;  1OQY A;  1S7A A;  3DPL C;  2DBB A;  2O61 A;  1UMQ A;  3HG9 A;  4O6J A;  1F9N A;  3LA2 A;  2F6C A;  5K7H A;  2GXG A;  2WBM A;  5JR3 A;  2DMP A;  3KYC B;  3WGI A;  2EA4 A;  3ZQH A;  1YW8 A;  3L1P A;  3FXL A;  1V54 H;  4HV5 A;  2NVT J;  4WWC A;  2R5Z B;  3IKT A;  3CC4 I;  3C2G A;  2LY1 A;  2HOE A;  1CQT A;  2DFE A;  2FD5 A;  2HXI A;  1Q1H A;  4HNV A;  3TO9 A;  2D1V A;  5HVQ C;  1REP C;  5L3F A;  1TW2 A;  2Y0S A;  4HF1 A;  1GV5 A;  4MO7 A;  3RTR A;  3E6D A;  1FZP B;  2RRE A;  1TT0 A;  2R7S A;  4M3D A;  3CCE I;  2R7O A;  1SMT A;  3HTU A;  4LLN A;  3QYB A;  5EEG A;  4ZZD A;  2R5Y A;  1K78 A;  4Y52 J;  4FX4 A;  2WY8 Q;  3KIO A;  2V1U A;  3FK6 A;  3Q9V A;  4XSX F;  3EYI A;  3VYU B;  5EG0 A;  1R5I D;  2XAJ A;  3CME I;  3ECO A;  2CV0 A;  3TDZ C;  2ZSI B;  3S14 J;  2AQF A;  2HGC A;  5L3G A;  3WTW C;  1FBU A;  1HST A;  2P0W A;  1QZE A;  3RKW A;  4AVZ A;  4BQN A;  3GW2 A;  3DPT A;  1GHC A;  3OYH A;  2XGX A;  4X1E A;  2IA1 A;  1ETY A;  4D7M A;  1P4A A;  4B09 A;  2E1O A;  5L3E A;  2WB1 A;  2HTS A;  2ZC2 A;  4XRS A;  3L2R A;  1AA7 A;  1Y56 A;  2COB A;  3COA C;  5J1R A;  3OYN A;  2HPI A;  5FFZ A;  2L3D A;  1QGP A;  1X1B A;  4G7H F;  2H94 A;  2D1H A;  1VQO I;  3JAM Z;  1WH7 A;  1X19 A;  1V55 H;  2VXD A;  2CW7 A;  4C3I J;  5BS6 A;  3AAF A;  2BYV E;  3P9C A;  1OYI A;  1OR7 A;  3TQN A;  1EJ9 A;  2M0C A;  3K69 A;  2MGQ A;  1I6X A;  3DCF A;  4XLC A;  4L18 B;  1FC3 A;  3FXQ A;  3F8N A;  3CJN A;  4XOR A;  4W97 A;  3LNQ A;  1LNW A;  3RCO A;  2O9L A;  5E3O A;  1G6N A;  3WGG A;  2K9L A;  3K2Z A;  2LK2 A;  2G7H A;  3FXU A;  2ZXW H;  1YRN A;  3IUO A;  1EH6 A;  3RKY A;  2DAO A;  1SAX A;  1UJ8 A;  2ZSH B;  4UB6 C;  1S9H A;  3ABU A;  1I3Q J;  4RM3 A;  3BZC A;  3LFU A;  2OQG A;  4E7J A;  2QCO A;  4XLF A;  3MEX A;  5IYB J;  4F91 B;  3T5X A;  2IPQ X;  3GEZ A;  3SZP A;  1F1Z A;  3DFG A;  1OIS A;  4GYI A;  2DA5 A;  2LOO A;  3A1Y A;  1J5Y A;  1HA8 A;  1FOW A;  1IDZ A;  1R1T A;  4NNJ A;  4MTD A;  3QPL A;  2YSR A;  2OC6 A;  3GLL A;  5CQG A;  2E7W A;  2GA1 A;  3BLY A;  1HW1 A;  1TQI A;  2KRF A;  2NVU B;  3BG3 A;  5B1A H;  1ZYR F;  2ETH A;  2NAZ A;  2HVQ A;  5AIP A;  1P4W A;  1XGM A;  3JW4 A;  2VJ5 A;  5H20 A;  2K5C A;  2Z1D A;  4BYY A;  3CF2 A;  1TQP A;  1TQM A;  4Q48 A;  5HDK A;  1D3Y A;  3DLA A;  5F0H A;  1V5F A;  3ZMS A;  3ZR8 X;  2DTR A;  2VJJ A;  2K02 A;  4IEJ A;  1E3P A;  2DQL A;  4A3G J;  5KK1 A;  5DM7 F;  2B7E A;  3VSL A;  4XQF A;  2RKH A;  1JJ8 C;  2IA2 A;  1GT0 C;  3MKZ A;  3KP6 A;  3H3Z A;  1XGS A;  4XL9 A;  1G2H A;  3FKI J;  4XM3 A;  4E7H A;  2VBZ A;  4HX4 A;  4X0G A;  2QBY B;  2EWN A;  3S1N J;  2DLL A;  3SYT A;  4S05 A;  3GFJ A;  2HVR A;  3HGG A;  2AXL A;  4UV8 A;  2CS3 A;  3AG3 H;  1FEX A;  4D1Q A;  1WZ2 A;  2F5D A;  3ZQL A;  2LBF B;  2YX4 A;  1R5G A;  1IGN A;  2O7O A;  3RZD J;  3D5S C;  2BGC A;  1BOA A;  2ZXJ A;  3HOW J;  1XSD A;  2A69 F;  3HSE A;  1ENH A;  2L2O A;  3O2P E;  4RGS A;  5M3F J;  4XLE A;  3VDX A;  2K4B A;  1L0O C;  4C3H J;  1LKX A;  3RPQ A;  4FQG A;  4E7I A;  3FHZ A;  3S3M A;  3F8B A;  1LDJ A;  2F48 A;  5C4X J;  2G7U A;  3LSM A;  3GX4 X;  1MW7 A;  2LC2 A;  4XKB A;  3PO2 J;  3VOE A;  1FP2 A;  2Y30 A;  3BP8 A;  4WXD A;  1S8N A;  3I54 A;  5J1U A;  5TIS C;  2VC0 A;  4MFE A;  3LSR A;  3IKV A;  3MVP A;  2IJL A;  1E2X A;  4QPO A;  1VTN C;  1QQI A;  1SFU A;  3H9J A;  3K4N A;  3GO5 A;  2LKP A;  1R23 A;  4F3Q A;  4UHT A;  4JX5 A;  2ZXI A;  3BCB A;  2BBY A;  3OYI A;  3S1Q J;  3LSJ A;  2XIG A;  2OUM A;  3HKZ A;  4IZZ A;  4IO9 F;  2VAS A;  2W85 A;  2PLY A;  5FRM A;  1U2W A;  1Z1D A;  4CIC A;  1SMY F;  1WI9 A;  5LGN A;  4KIF A;  3BTI A;  2ZME A;  2ZNY A;  2R4G A;  1D1B A;  1KGS A;  2LG4 A;  3HGY A;  2BY1 A;  2BY0 A;  2XB5 A;  4WK8 F;  2CMP A;  4LOC A;  2E2H J;  1RR8 C;  3TBI A;  3QOD A;  2ZB9 A;  1LFP A;  4HX8 A;  5FJ8 J;  2IVM A;  3DU5 A;  3J7Y J;  4N0B A;  2CYY A;  1QZZ A;  1OLT A;  3CMM A;  3K4L A;  1KQ8 A;  1OJL A;  2HPM A;  4L5E A;  3IRQ A;  4Z2Y A;  3S3N A;  2A5W A;  1IC8 A;  4WF2 A;  3OS0 A;  4N4O B;  3FM5 A;  2HR3 A;  1IV6 A;  2OCE A;  3QPT A;  3WHB A;  2F5F A;  2IBD A;  3GTJ J;  4MHG A;  2YX7 A;  4MGR A;  4ZYE A;  3HYI A;  3ZN1 A;  4OWR B;  1Z6R A;  2RNG A;  1D5Y A;  5K5Q A;  1XCB A;  2OV7 A;  4S0H B;  5GAE J;  3OIP A;  3RZO J;  1ZN2 A;  3E7L A;  1P4X A;  5FKN A;  4JOM A;  4QPQ A;  1MNM C;  2W84 A;  1S5L C;  4S04 A;  3N4M A;  2H1K A;  2KRC A;  3AFH A;  3HHH A;  1T0F A;  4Q47 A;  3GFM A;  5HOD A;  3GZ6 A;  5JVG F;  3PQJ A;  4IRG A;  2LR8 A;  3QOE A;  3ML6 A;  2IS2 A;  1J09 A;  1YW7 A;  3B6C A;  3BQY A;  5E3L A;  1FPQ A;  4WX9 A;  4ESB A;  2EIL H;  3ZMU A;  4RBO A;  4AYB N;  4A2U A;  2ZFU A;  1ETK A;  2DA3 A;  3K70 C;  1APL C;  2ZJ2 A;  1ON1 A;  2R5Y B;  4UUT A;  3Q0W A;  5ED4 A;  1K78 B;  2PN6 A;  3HOT A;  1ZTR A;  2Z9O A;  1D8J A;  4DQ2 A;  2VE9 A;  1ZRE A;  2V6E A;  2W82 A;  4JK1 X;  1P6R A;  5CPR B;  2XAG A;  2GWR A;  3J81 Z;  1PUF A;  1I27 A;  2FML A;  5EG0 B;  1A04 A;  2YU3 A;  2K3P A;  4ABZ A;  2HEO A;  2F5V A;  3NEU A;  3H0G J;  3IH2 A;  1WQ2 A;  3CMY A;  4CGZ A;  1FMV A;  1ZK8 A;  2VJ4 A;  2AQE A;  3BC8 A;  4W1U A;  1N25 A;  1LB2 A;  1SFX A;  1AKH A;  5FRN A;  1BR2 A;  1U9O A;  3BG9 A;  2ZKZ A;  5CYV A;  1XMA A;  2PQ8 A;  3IAS 2;  4YIR X;  1MBH A;  2IT0 A;  3AKZ A;  1FBQ A;  2X6X A;  4YFN F;  3GBG A;  3D5L A;  3KX2 A;  1TT5 B;  4IXA A;  3H9Q A;  3OIQ A;  5DUI A;  1BM9 A;  4D0P A;  1TLH B;  1K61 A;  4DJA A;  1H89 C;  1OR7 C;  2XSD C;  4AIJ A;  2ZBK A;  1RI7 A;  2FQ4 A;  3PFI A;  3I4N J;  2J5P A;  2B0L A;  4B4C A;  1BW6 A;  4PGG A;  2DTZ A;  4YFX F;  2E34 A;  3CCY A;  4CCM A;  4LIT A;  3LSH A;  1ZQ3 P;  3MKY B;  3GTM J;  2XDV A;  4ENJ A;  3C1D A;  4CCJ A;  1YRN B;  1XN7 A;  3OOU A;  1LPQ A;  5D8K B;  2X6W A;  3F8M A;  2HDC A;  2JQ7 A;  1YFH A;  3D0S A;  3KP4 A;  3RKX A;  5DCF A;  4DZP A;  1G3Y A;  2CJJ A;  2X6O A;  4JQF A;  5K1Y A;  1OCP A;  4XKC A;  4K2E A;  4PK4 A;  1DU0 A;  2M5W A;  5IY5 H;  1ZGJ A;  3BCA A;  4A3I J;  1N77 A;  2R7F A;  5DD8 A;  1DP3 A;  4MEY F;  1IRZ A;  3HB9 A;  1FSH A;  4PDK A;  4PGH A;  2FBK A;  1D0Y A;  1UG0 A;  3K10 A;  3ZPL A;  1D0Z A;  2MC3 A;  4P96 A;  4UXN A;  3FXK A;  1VQK I;  4ZDP A;  3BOQ A;  5FKM A;  5L3B A;  4II2 A;  1I5Z A;  4HSR A;  3ZQI A;  5F27 A;  4MLO A;  4XID A;  3M8J A;  2P8T A;  1MKM A;  2FJ1 A;  2K40 A;  3G1L A;  2KL4 A;  2LD5 A;  4L5I A;  1MGT A;  2DOA A;  3GFL A;  1B8I A;  2FOW A;  5ILU A;  4MNU A;  3PNV A;  2WAQ A;  1IAW A;  5FO5 A;  3M9A A;  4A3B J;  2IRF G;  5IP9 J;  3GME A;  4P9F A;  4F92 B;  4CCK A;  3CCV I;  1VQN I;  3L2U A;  1V5G A;  2LVS A;  1VQ8 I;  3ZMT A;  3E6C C;  4LJZ F;  3FXJ A;  2OA4 A;  4KIS A;  2DPU A;  1NK3 P;  2CUF A;  1MD0 A;  2CG4 A;  3FMQ A;  1A31 A;  4NC6 A;  2EV6 A;  3V42 A;  2XF6 A;  2Q2E A;  1HSJ A;  2ID6 A;  4AIK A;  2J5O A;  3IC7 A;  1ZG3 A;  1XDU A;  2I8D A;  3E1S A;  2KKO A;  5K5R A;  2XB0 X;  3ASO H;  3CO7 C;  3VFZ A;  5M3M J;  4A69 C;  1JTY A;  5GAH J;  3EUK L;  5DYM A;  1PUE E;  3FIW A;  3OS2 A;  3LSI A;  4AID A;  3L2Q A;  2PJP A;  3PQK A;  4RGU A;  3WU2 C;  4G6D A;  4EM2 A;  5EGO A;  1I1S A;  4EGY A;  5IOY A;  1T33 A;  1LEA A;  1BC7 C;  4NB5 A;  4C9Y A;  2JA8 J;  4JBA A;  3FBI B;  2V1D A;  1HCR A;  2WV1 A;  3HRS A;  2R93 J;  4XK4 A;  4M71 A;  4KUM A;  5LRS A;  1QU3 A;  3QPS A;  2CV2 A;  1V3F A;  4U0W A;  4AWX B;  1X1A A;  1UST A;  4N4N B;  2DYR H;  3CUO A;  3ONQ A;  1UEL B;  1T39 A;  1ZAR A;  3WTT C;  2IGK A;  4UVA A;  4HF2 A;  1EKE A;  3FM3 A;  1B72 A;  3MKL A;  3KCC A;  1WJE A;  3DBR B;  3CTA A;  5IP7 J;  2ZME C;  4DBQ A;  1RKW A;  5DEQ A;  1ODD A;  2X1E A;  2ZME B;  5B66 C;  2JTV A;  1FLI A;  2NOJ B;  2KDO A;  3E6M A;  1N78 A;  1DPU A;  4IHS A;  2JA7 J;  1JJ6 C;  4P1W A;  1VF9 A;  3SQN A;  4U0Y A;  5L3D A;  2CW0 F;  1RUN A;  1PYV A;  3HIF A;  2KZV A;  4A3C J;  4XLH A;  3JAM K;  3C2H A;  3BR1 A;  2LH9 A;  2GXA A;  1W4M A;  3KEO A;  4BHB A;  2D2W A;  3WOD F;  2NNN A;  3OMY A;  3CJQ B;  1ZAO A;  3PM1 A;  2O6G E;  3K4B A;  3QYE A;  3BQZ A;  5LEJ A;  5JLW A;  1P7J A;  4DGW B;  1CF7 A;  3TOB A;  1C0W A;  3G3Z A;  3WTY C;  3DBH B;  1RR7 A;  5H6R A;  3F8C A;  4U87 A;  5J4Y A;  5BQT A;  2K9S A;  4XNF A;  3SZG A;  3BR6 A;  2GAU A;  2M87 A;  2XAH A;  2QUF A;  2XAF A;  3GZN B;  4H0E A;  3JRD A;  4OAZ A;  3T1B A;  3R60 A;  2Z2S B;  4DW6 A;  5BPI A;  1T0F C;  2VKE A;  1ETQ A;  1JUS A;  1X3W B;  2KPM A;  1FTZ A;  3CCU I;  2X9D A;  1RIO H;  4XKW A;  1XGO A;  3W6K B;  4BEH A;  4DBR A;  2XRN A;  2LDU A;  4M73 A;  1BJZ A;  2VI6 A;  3MZH A;  4D5C A;  2IGO A;  3OYJ A;  3SZT A;  2WAQ N;  4KMU X;  3L2V A;  1MND A;  2GIZ A;  2P5K A;  3SJM A;  3WE3 A;  2E2I J;  1WKM A;  4OIP F;  2W48 A;  4KN4 X;  5J1Y A;  3S32 A;  2XGE A;  3FKJ A;  3CJT B;  3LA7 A;  4BU2 A;  2QQ9 A;  2K3F A;  4LB6 B;  4DIQ A;  3OY9 A;  1XC5 A;  1EV7 A;  1VZ0 A;  1Y1V J;  1J9I A;  4M72 A;  1R9T J;  3RKQ A;  5AIQ A;  3QOP A;  4Y4R A;  4CYD A;  5J3L A;  3CP8 A;  1LUJ B;  2Y9Z A;  4XN3 A;  5HNH A;  1R1V A;  3JRI A;  3GUD A;  4M9Z A;  4UV9 A;  2KJB A;  3JTH A;  1IO2 A;  3K7A J;  1JHH A;  1YQA A;  3M8F A;  4PJ0 C;  1TNS A;  4WXC A;  1WGX A;  2EBI A;  5ICC A;  2JK3 A;  2YR2 A;  2LY9 A;  4U0V A;  4D9J A;  3K2A A;  4FX0 A;  3A03 A;  1VFC A;  2WWY A;  1OMI A;  1KQ9 A;  5DV5 A;  1WWX A;  3EUH A;  4YG2 F;  2ELK A;  2K86 A;  2JVH A;  2VQC A;  3SEZ A;  1PJR A;  4UUS A;  5LHH A;  4XLA A;  2NS8 A;  3E5X A;  3L9F A;  2QSF X;  3L09 A;  2ZO4 A;  3Q3S A;  4FE4 A;  1R4N B;  5D4S A;  2DFH A;  1Y0N A;  4E4H A;  3QRF F;  1QHH D;  3KZI C;  2XGD A;  2QQB A;  1I1G A;  2KHM A;  4V19 K;  1TC3 C;  3MCZ A;  4A93 J;  4B3A A;  2R7X A;  5FFX A;  3U1K A;  5D5U B;  4C30 A;  1SD5 A;  3EQL F;  4BQA A;  4YIF A;  4BE0 A;  2P5L C;  4G6Q A;  2LYC A;  5DD4 A;  2BY2 A;  1RES A;  4LGW A;  4BAY A;  5DS9 A;  3ERM A;  1FOK A;  2CGP A;  3RSN A;  1IXC A;  1PVE A;  2BV6 A;  3CC2 I;  2O5R A;  4J01 A;  3KZY A;  3J7Z I;  5E20 A;  1OYY A;  3IAM 2;  1SAU A;  2K7L A;  1KZH A;  3OR2 C;  5KAI C;  3SFI A;  4E6K G;  6PAX A;  1VQP I;  2LRE A;  4M6X A;  3QU3 A;  4WXH A;  2F2E A;  5BNG A;  4Z6Y A;  2A6T A;  3HXL A;  4RDU A;  3HOV J;  3G1O A;  4DYR A;  2KDZ A;  5LFA A;  4XLN F;  2WAF A;  2ZXH A;  3QYF A;  1LQ1 A;  2PJR A;  4ETS A;  1MJA A;  2DDB A;  3GTG J;  3F23 A;  2YPR A;  2XVC A;  2K27 A;  2Q1Z B;  1HKQ A;  4A3F J;  3OS1 A;  1UHW A;  2X4H A;  3CLO A;  1FT9 A;  3J80 Z;  2JWT A;  1FYL A;  5KNL A;  1HLV A;  3RJP A;  2VN2 A;  2ZJR F;  5KAF C;  2DN0 A;  4RB0 A;  1IN8 A;  2F4I A;  3I59 A;  1ZR2 A;  1U9N A;  3B6A A;  4HNT A;  2AXT C;  2M7A A;  3TDU C;  1MBE A;  4LG0 A;  3VYR B;  3HOU J;  2Z3Y A;  2JN6 A;  1W1W E;  3VYT B;  1LDD A;  4GRI A;  2V4J C;  3HRT A;  3Q9S A;  1MZB A;  4OMY A;  3DBL B;  2M8E A;  3FF5 A;  1T6S A;  3V4G A;  2NS7 A;  1IV8 A;  2IP2 A;  4CCN A;  5LGT A;  1FYK A;  1IXR C;  4IHX A;  5C44 J;  2B63 J;  3IWF A;  4E70 A;  2OTL I;  1FTT A;  3HSR A;  3Q5F A;  4Y15 A;  1T38 A;  3ISP A;  3VOD A;  3MWM A;  4ITV A;  2HNH A;  3OYE A;  3S15 J;  3BTC A;  2PEX A;  3F8F A;  5D6E A;  2O8K A;  1RRJ A;  1TWG J;  1GVD A;  2QKL B;  2VBX A;  2ELJ A;  1MH3 A;  4H4K C;  2IS1 A;  4QWQ A;  3HOZ J;  4PZJ A;  5EEA A;  1J59 A;  5ILS A;  3I5U A;  1ZH5 A;  1HKT A;  4HPQ A;  5HS8 A;  3H9G A;  1Z67 A;  4FHT A;  3C3W A;  4MIM A;  2DQR A;  2BY3 A;  3HUG A;  1BBY A;  4EMS A;  3J81 K;  3KPH A;  4KDP A;  1FOX A;  1ZRD A;  4B43 A;  2NRA C;  3PFY A;  3M8E A;  1VI0 A;  2Z16 A;  2EJR A;  3KFW X;  1Q1V A;  2MH9 A;  4BUP A;  3ABM H;  2XRO A;  4HNU A;  2L54 A;  5FKO A;  1W0T A;  4D5F A;  4AYB A;  2KIS A;  3MD2 A;  2YS9 A;  3VWB A;  4XLP F;  2A61 A;  3AG4 H;  3DP7 A;  1JKP C;  4CYC B;  4I0A A;  4ZDL A;  1J75 A;  2QGU A;  3M07 A;  4I76 A;  1ZGA A;  3BTL A;  4M9S A;  4PJM A;  4L0Z B;  1P2F A;  2VLA A;  1W5S A;  2CWE A;  4CXF A;  3WU0 A;  2E1M C;  1BI1 A;  2E1M B;  2RQP A;  1JT0 A;  5FB2 A;  3JSO A;  1OCT C;  2VOP A;  2LRD A;  1IRG A;  1XMK A;  2ADU A;  2JUG A;  1J7K A;  5GAD J;  1DQU A;  1MMD A;  2DFI A;  2QSG X;  3SDB A;  3V7R A;  5FLX Z;  3RDI A;  1XMX A;  1QBJ A;  5BOX A;  1ZG5 A;  1CF7 B;  2GM4 A;  2VIX A;  3HDD A;  3BY6 A;  4IHW A;  5CVU A;  3WE2 A;  1G4D A;  4B44 A;  3OYA A;  2VUM J;  1ETW A;  2FOK A;  3N05 A;  2JT1 A;  2Y9Y A;  3JRE A;  4ZTF A;  2HYF A;  4IKF A;  4KFC A;  4LLG F;  4XON A;  3L2C A;  3LAJ A;  3Q0V A;  3F22 A;  2M9H A;  4P9U A;  1RET A;  4DYC A;  3K1M A;  3QPH A;  3DWL E;  3TO6 A;  4CZC A;  2XAU A;  1K79 A;  1WI3 A;  2DA2 A;  2VB6 A;  1F4K A;  5IYC J;  4EM1 A;  1ZLK A;  4HQE A;  5CJ9 A;  3IP4 B;  4M6Y A;  5D4R A;  4A12 A;  4A0X A;  3JTG A;  1DDN A;  3KLN A;  2CRG A;  4BEH B;  3A01 B;  4NC7 A;  4HOB A;  3V8J A;  4C2U A;  2V7F A;  3WTV C;  2UV1 A;  1KA8 A;  4UNO A;  2VKH A;  5GTH C;  3F6O A;  3TP0 A;  3S1R J;  2QVO A;  2R7W A;  1SEU A;  4I7H A;  3LSK A;  2M34 A;  1ETV A;  1K6Y A;  1XS9 A;  4XKV A;  1UHM A;  5HDN A;  3I4M J;  4RAY A;  3U1D A;  1R1U A;  1AWC A;  1PP7 U;  1H8A C;  3OYD A;  4ZJZ A;  1P9Q C;  2R7D A;  3BZ6 A;  5FD6 A;  1NH3 A;  5JHF A;  4MQ9 F;  2RAE A;  4BJT A;  2ISY A;  2R92 J;  1MJ9 A;  5ICF A;  1IW7 F;  1IUF A;  4Q4Z F;  3I58 A;  4GCV A;  5EF6 A;  5BMZ A;  2P5V A;  2VBW A;  3E0J B;  3H3U A;  1U3E M;  4ENN A;  1BR4 A;  2GA2 A;  4OAY A;  3TGN A;  1ITY A;  2BZT A;  1YX5 A;  4IHY A;  3DTK A;  1YYV A;  3LST A;  2FSW A;  2W1O A;  3S2H J;  2VC1 A;  4KYW A;  2EIM H;  4HF0 A;  4CO8 A;  2P7V B;  3EUH C;  4ASN A;  3WTU C;  4CZZ A;  2JMW A;  4Y17 A;  2HDW A;  1YE9 A;  1ETO A;  1MNE A;  3GCM A;  4UUS B;  4O3M A;  3ZCO A;  1D8K A;  3LL7 A;  4FTH A;  2JPC A;  5F04 A;  4PJN A;  1SVO A;  1GVJ A;  1DGW Y;  3T0Y A;  3BJO A;  5E3N A;  5JLX A;  4EV0 A;  4CCO A;  3NWT A;  1KU3 A;  3IH3 A;  2BEO A;  4QLC U;  4Q5S F;  3JRA A;  2QF7 A;  5IT3 A;  3LWF A;  4XRS G;  2L7M P;  4YRV A;  4B48 A;  4QIW N;  5EDN A;  5E18 F;  1POG A;  1A36 A;  2FMY A;  2G9W A;  1O4X A;  4BY7 J;  2DMT A;  1ZLJ A;  1GLN A;  4ENM A;  1IRX A;  3W2V A;  4EGZ A;  1H9T A;  3A0B C;  4LB5 A;  2EZL A;  2MSY A;  2CUJ A;  1I39 A;  4FET A;  1YTY A;  2OZ6 A;  2M1B A;  5E1X A;  2STW A;  5HLI A;  2KQR A;  3TOA A;  4OMZ A;  2QYO A;  2EV0 A;  4XN0 A;  2V1N A;  4HST A;  4BDY A;  2HZT A;  1O7F A;  1UHS A;  2JUC A;  1JGG A;  3PUF A;  4RLQ A;  2UXX A;  3V7C A;  3CCM I;  1VQ9 I;  2K9Q A;  1M1E B;  2HYJ A;  3GF2 A;  3HHG A;  1AHD P;  3ASN H;  2M2E A;  5E1Z B;  4BQO A;  2JSP A;  5H6Q A;  1OKR A;  1LJ9 A;  3OYC A;  2PJR B;  4AD9 A;  2ME6 A;  1YLF A;  2PBI A;  1ONV A;  1JUP A;  5DUK A;  1KU7 A;  3HPH A;  5E1W A;  2EV5 A;  1XG1 A;  1IDY A;  5DCM A;  3K70 D;  1DU6 A;  3V8K A;  4OIN F;  3I59 B;  2KIU A;  5B1B H;  2PMZ N;  2DK8 A;  4LG0 B;  3OL4 A;  1ACI A;  1FBS A;  1WJA A;  3HZJ A;  1H9G A;  2PX9 A;  2L9R A;  4IVN A;  3CCJ I;  3VB2 A;  3SDG A;  4RAZ A;  2IAI A;  3KP3 A;  2F5E A;  3K6G A;  4HBL A;  3JR9 A;  3TW6 A;  2HFH A;  4I02 A;  5ICE A;  2ZFW A;  5E8I A;  4EVI A;  2LMD A;  2OF7 A;  1OCO H;  3FIS A;  4LK1 F;  3K4K A;  1X1P A;  1EH7 A;  1GXQ A;  4HA8 A;  2LNB A;  3WGH A;  2GBY A;  1GXP A;  2HKX A;  4A3E J;  2C6Y A;  2ECC A;  2K85 A;  1FIP A;  2Y69 H;  1IXS B;  3MZ8 A;  1HF0 A;  3H36 A;  3S2D J;  1VQL I;  4KMF A;  4YEJ A;  2Y0M A;  4KJZ A;  3A4C A;  1RKT A;  3LQR A;  1FYM A;  2MW8 A;  4IQ4 A;  4U7D A;  2IXS A;  1XB4 A;  2M7B A;  1QVU A;  5LLQ A;  2R5Z A;  3ZMV A;  3MKW B;  1YG2 A;  2A6H F;  1BI3 A;  3IHU A;  5E8G A;  3HUG B;  4RS8 A;  2BVL A;  4IJA A;  4ANJ A;  4IQJ A;  2ZCW A;  2XPW A;  2ESH A;  1G3T A;  4A5M A;  4U7B A;  2CQN A;  3O8H A;  4NC8 A;  4PJJ A;  5LEK A;  2QKM B;  1LE8 A;  2V79 A;  3WU1 B;  2L4M A;  3JRF A;  4LK0 F;  4RB1 A;  3OYF A;  2F4O B;  1JT6 A;  1MJB A;  3MQ0 A;  1U8R A;  3OYB A;  3S2W A;  2STT A;  4KT6 A;  5DDG A;  1YOV B;  5FGM A;  3OWT A;  4YEL A;  5KHD A;  4XR6 A;  2CH0 A;  4HX7 A;  2UWM A;  3ZOB A;  5D5W B;  1ZR4 A;  3ZQ7 A;  1MSF C;  3O6B B;  3NQO A;  3OIO A;  1LEB A;  4E7Z A;  3HTS B;  3K1N A;  2ELH A;  3W2W A;  1B4A A;  1Y8Q B;  2DPD A;  1ZG1 A;  2DMU A;  1VQ6 I;  1YS6 A;  4O5V A;  1KU2 A;  4LFU A;  2VOO A;  3H92 A;  2UUZ A;  3DTI A;  4DOZ A;  3HJE A;  4CUG A;  2DA4 A;  3B02 A;  2GOM A;  1KQ0 A;  3NAR A;  1XTA A;  2EFN A;  3EET A;  1FMW A;  3D5R C;  4IHV A;  1H88 C;  2WAE A;  2MAB A;  3BR0 A;  2M8G X;  3JRG A;  3TKY A;  4XSZ F;  2GXB A;  3S16 J;  4PSW A;  1FY7 A;  1SAN A;  3F21 A;  4A3L J;  3NRV A;  2R7U A;  1A5J A;  3UNG C;  4EM0 B;  3OYM A;  4ZC3 A;  2KIQ A;  3GTO J;  4A6D A;  1G3S A;  2P7C B;  2E71 A;  1HXD A;  1OPC A;  2CFO A;  5FD5 A;  1Z6T A;  2F4M B;  3KP5 A;  5CVI A;  1X4O A;  4KIC A;  4NQW A;  1WPK A;  3E97 A;  3RYR A;  2HTJ A;  4A0Y A;  1MBF A;  1B9N A;  1MDM A;  3CJR B;  3WTX C;  3HOS A;  4RB3 C;  3DV8 A;  2L9V A;  3QU6 A;  3DKW A;  2FU4 A;  3CLQ A;  2HOA A;  4UUV A;  4IPA A;  3LA3 A;  1K7A A;  2MFZ A;  4A3K J;  1XCV A;  1MBK A;  2H8R A;  2KRH A;  1OYW A;  3CCL I;  3GTQ J;  4BHC A;  2MA3 A;  2M4G A;  2QA4 I;  3ABK H;  3WG9 A;  1BI0 A;  1Z9C A;  1T95 A;  2XKO A;  4PCQ A;  4RAG A;  2P6S A;  1ZRC A;  4YFK F;  4RLF A;  5K5O A;  3BPX A;  3RPU A;  4CA0 A;  2CV1 A;  1BOB A;  1STZ A;  2QEX I;  2LKS A;  4I09 A;  2RVC A;  4J19 A;  2HYG D;  2I10 A;  3I9V 2;  4F52 A;  3J80 K;  2X1D A;  2OU2 A;  4G94 A;  2O0Y A;  2GZW A;  3W2A A;  1K6O A;  3M1E A;  1SFE A;  2QLZ A;  3BJ6 A;  4V2F A;  4D7N A;  3G2B A;  3N97 A;  2EB7 A;  3ZXS A;  2H27 A;  3HEF A;  1EF4 A;  4V2G A;  2BXY A;  2H6C A;  4IHT A;  2DI3 A;  1D1A A;  1KYZ A;  4OU0 A;  3TMO A;  3P7N A;  3RIR A;  4A3M J;  1YIJ I;  3S8P A;  1B1B A;  4IL6 C;  4C3J J;  3DTE A;  1U5T A;  3AG1 H;  2QBY A;  1W0U A;  5J40 A;  5EYR A;  1YO5 C;  2JA6 J;  1MBJ A;  4NBQ A;  1F36 A;  2XHK A;  2WAD A;  1JUM A;  5GPC A;  3OYK A;  5D6F A;  4G12 A;  1QNT A;  1USS A;  4F7Z A;  2W24 A;  2CQK A;  4RB2 C;  2FBI A;  2P81 A;  1TZL A;  2GIV A;  3BG6 A;  2DW4 A;  3FXR A;  1JKO C;  4YII A;  4Y33 A;  4ZTJ A;  2MLG A;  1WJD A;  1BI2 A;  1QZY A;  1ORK A;  1IRF A;  2EK5 A;  1WHU A;  4B8X A;  1JI8 A;  3ZMD A;  4A5N A;  1OCR H;  3SFZ A;  4IRH A;  1PDN C;  4XIC A;  4HZF A;  1FWZ A;  2VBY A;  5TJJ A;  1E3O C;  1HW2 A;  1HDD C;  3BDD A;  1PUF B;  5HLH A;  1VND A;  1YX3 A;  3KZZ A;  3V8L A;  4MEX F;  1W36 C;  4PFO A;  2DMN A;  1JKQ C;  4HLY A;  2W00 A;  1X1C A;  2OCC H;  3DEE A;  3I3L A;  3MMY B;  3A2K A;  1TNT A;  5ILV A;  1AKH B;  2TRT A;  3TL4 X;  1T2K A;  3SHF A;  1QHG A;  2FNA A;  4HV6 A;  5E3M A;  4A3D J;  2Y31 A;  1IN4 A;  1TW3 A;  4RM2 A;  4BH9 A;  2L4A A;  3M4O J;  1R5H A;  1GV2 A;  2XF5 A;  3J7A O;  4XRF A;  5K7F A;  4WCG A;  1WH5 A;  3TED A;  3BPV A;  5CKT A;  5FLX K;  5TRD A;  1K83 J;  2KP6 A;  4II3 A;  2EFW A;  2H6B A;  1D0X A;  1MMG A;  4IRI A;  5F08 A;  3LAP A;  2DT5 A;  2E2J J;  2KFD A;  2RNJ A;  1I6H J;  2IEK A;  1WVR A;  1W7P A;  2DU9 A;  3E5Q A;  3I64 A;  3LSG A;  5JFR A;  1JXS A;  2E36 A;  2XC7 A;  3W6J B;  2IGN A;  2P4W A;  1YJW I;  2L01 A;  1TL8 A;  2EZH A;  1W36 D;  4Y13 A;  2K9N A;  1R00 A;  2TDX A;  3L7W A;  1IJW C;  1QPI A;  1EA3 A;  3QP6 A;  3BR2 A;  4OIR F;  1G59 A;  3C2B A;  3WTZ A;  5D5X B;  1YW9 A;  3IL2 A;  1NG6 A;  2NVY J;  4DNC A;  2FBH A;  4BE1 A;  4BXU A;  2OTJ I;  1MMS A;  1JKR C;  2EIJ H;  1J0R A;  1R4M B;  3OYL A;  1UG2 A;  4N9H A;  2DOD A;  3CMA I;  5EZH A;  2RC4 A;  4CHU A;  4BY1 J;  4OOI A;  2L7K A;  3HC7 A;  3TP3 A;  3OSF A;  3R0A A;  3HRU A;  1TBX A;  2HQR A;  1SFO J;  4IOC F;  3KEY A;  2EIK H;  1GDT A;  1RUO A;  4IOA F;  2VQH A;  4C2T A;  4E7L A;  3QWL A;  2HVS A;  1F5T A;  1P92 A;  4JX6 A;  1U78 A;  4ZYA A;  1RNL A;  4GDF A;  3CCR I;  5B5E C;  1OFC X;  2PFB A;  4XMY A;  1S72 I;  4FIS A;  1LE8 B;  3PL8 A;  5BPD A;  1B8I B;  3H5N A;  3IRR A;  3F6V A;  2E1C A;  1MH4 A;  2BXZ A;  4JX4 A;  2RV8 A;  2EIN H;  5LHG A;  2RN7 A;  1KYW A;  2LSO A;  5F0C A;  2Z33 A;  2K9M A;  4AUX A;  3UKG A;  1WFX A;  1ZGW A;  3JRH A;  2EQR A;  2V26 A;  4I98 B;  1I3A A;  4GO1 A;  4A6E A;  2A3S A;  2Z5U A;  1TWC J;  1IZ1 A;  2L9S A;  2PMH A;  1TWF J;  1SFK A;  4M74 A;  3S1M J;  1DGR M;  4I2O A;  2JJ7 A;  2Q2E B;  1R36 A;  3ERE D;  2E35 A;  2ESN A;  4P5O A;  2DFF A;  3VEP A;  4I0B A;  2M3A A;  3OR1 C;  1X2M A;  3I56 I;  5A2Q Z;  4G6T B;  3GTP J;  1O3S A;  2CUZ A;  1DPR A;  1AU7 A;  4PFP A;  3CES A;  2FQ3 A;  4BJ6 C;  2LF7 A;  4FAS D;  3FXO A;  2ZJP F;  1Z21 A;  3MAJ A;  2CQ7 A;  2QQ8 A;  2Q0O A;  5EGO B;  5HS7 A;  4NHJ A;  3UR3 C;  3ULQ B;  1QVT A;  1FX7 A;  2HZD A;  5HNF A;  4L9N A;  3HRM A;  4GFB A;  2NXN B;  4NQW B;  2PG4 A;  4ESF A;  3H1C A;  2OPT A;  1IF1 A;  1TTY A;  1PP8 F;  2IW5 A;  3OL3 A;  5HDG A;  2DMQ A;  1MDM B;  2HOT A;  1XSV A;  3M1C A;  2L9N A;  1N75 A;  1RZ4 A;  3X2Q H;  1HC8 A;  4E7S A;  5LD2 C;  1P7I A;  4DYQ A;  5IT9 Z;  1B72 B;  4IF4 A;  2CUE A;  3C7J A;  4BS9 A;  4L0Y B;  4L5J A;  3BG5 A;  3W6V A;  5HS9 A;  1DP7 P;  1RC9 A;  2G0E A;  2DCE A;  1BIB A;  2WY7 Q;  2R7Z J;  1I50 J;  1FOY A;  4FCY A;  4E7K A;  1SVL A;  1JGS A;  4ON0 A;  2DOE A;  3PNY A;  4JP0 A;  2E19 A;  4R79 A;  1MSE C;  3WHC A;  1KON A;  3DPU A;  3MZY A;  2TCT A;  4FE7 A;  2MYS A;  2HWV A;  3MFK A;  4JYK A;  2BOL A;  3U2R A;  2JA5 J;  1A35 A;  2E5N A;  4GGG A;  4KN7 X;  2X6Y A;  4AIH A;  4NUB A;  3CQZ J;  1W5C C;  1T08 B;  2VJI A;  1QPM A;  1TP4 A;  4RA2 A;  2DJI A;  4ZYG A;  3KET A;  3SEQ A;  2LY2 A;  2WA0 A;  2R7R A;  1U5T C;  3S17 J;  1X4P A;  3I53 A;  4RAF A;  1U5T B;  4A0Z A;  1S6L A;  3DF8 A;  1SD7 A;  2WTE A;  4B3X A;  2PMZ A;  1WJ5 A;  2CO5 A;  2BW3 A;  2DA1 A;  2DDA A;  3RPU D;  1HBX G;  1U6G A;  5M5W J;  4I6Z A;  4EQQ A;  3KP7 A;  1MMN A;  3FWE A;  2XGC A;  1IN6 A;  1X3U A;  4QSH A;  2NNY A;  1QRY A;  3GTK J;  5LHI A;  2PMU A;  2VE8 A;  4LD5 A;  2VPL A;  2Y0S N;  5D5V B;  1D5V A;  5IPA A;  1O3R A;  1F43 A;  4AC0 A;  2B9S A;  3HBL A;  2L5Q A;  3DEW A;  1NG7 A;  4J00 A;  4F93 B;  4OIO F;  3KYL A;  2FNP A;  5FKK A;  2E7X A;  3VSK A;  1IN7 A;  1LFB A;  1X58 A;  2V6C A;  1NK2 P;  2XUB A;  1HQC A;  3BRO A;  2QEN A;  3ZGK A;  2NVX J;  5FLM J;  1BL0 A;  2A05 A;  3VYS B;  1Z7U A;  1IG7 A;  2CFX A;  3OOP A;  2NS0 A;  2BE5 F;  2Y2Z A;  3U9G A;  1R6R A;  3F0C A;  3F9K A;  2IGM A;  2N8G A;  2EFO A;  3GWZ A;  3NWS A;  2CU7 A;  2QWW A;  1VQ5 I;  2KIF A;  2KIM A;  2ECB A;  1O57 A;  2WB1 N;  5C4J J;  3RQI A;  4M6V A;  2KZG A;  5JI6 A;  1XPX A;  3CP2 A;  4BBR J;  3F72 A;  4F55 A;  5LBQ A;  1T8I A;  3PO3 J;  3REO A;  2HQA A;  1BC8 C;  1S29 A;  2RDP A;  4G7Z F;  1LVA A;  3EUA A;  3DXJ F;  2R0Q C;  3ROU A;  4BE2 A;  3PJR A;  1UAA A;  5EJC A;  3GYH X;  5F1R A;  2VOD A;  1UCR A;  2W25 A;  4RGX A;  1U0J A;  1ETX A;  3HOY J;  2A5Y B;  3FK7 A;  5CLS A;  2OD5 A;  3GTL J;  2VKV A;  4MTE A;  1SC7 A;  1W7P B;  2Y48 A;  3K1P A;  4MFD A;  4UY8 I;  4ZZL A;  3S93 A;  3L2W A;  1FNN A;  4AVP A;  3JSP A;  1Y39 A;  1ZKG A;  1UZC A;  1B6A A;  1Z3X A;  1UFM A;  1FP1 D;  2H8W A;  2DOF A;  2OJE D;  1X2N A;  2XAQ A;  2CSO A;  4RMN A;  2Y75 A;  4LIV A;  1XGN A;  4M3G A;  1W5T A;  3HL2 A;  4KNY A;  4HDV A;  5K7Z A;  2AS5 F;  1Y6I A;  2DK5 A;  3PIP F;  2JVG A;  3GXO A;  3CD6 I;  2JZY A;  3JRC A;  3R61 A;  1RPW A;  5JVT A;  4M3F A;  2L7Z A;  2O03 A;  3IH4 A;  1AOY A;  5J8C A;  1YJ9 I;  1UB9 A;  3FHN A;  3HPG A;  2JRM A;  3K0L A;  3P9K A;  3CCS I;  1YJN I;  2O8X A;  4BBS J;  1YS7 A;  3CDI A;  4P55 A;  1W7P D;  2OAZ A;  4HG2 A;  3FXM A;  1XD7 A;  1Y1W J;  4M3E A;  2WV0 A;  3F3X A;  1IUY A;  5CVV A;  3KLO A;  2VQL A;  3FBN B;  3CC7 I;  3BT9 A;  3CDL A;  2JA2 A;  4ZYD A;  3LMM A;  2VT2 A;  1IN5 A;  2JRT A;  3DU6 A;  2VQG A;  1K4S A;  3CZ6 A;  3V7S A;  1T98 A;  2MD5 A;  2VON A;  2M0M A;  3T8R A;  4BAC A;  1HW5 A;  1FJL A;  2M30 A;  4LIU A;  5HLG A;  4XOT A;  3BZK A;  3R6S A;  2FUG 2;  5KCM A;  4UVB A;  3ZN0 A;  2QZ8 A;  1VQ4 I;  2FRH A;  3PNT A;  5CVJ A;  3E6B A;  4R8H A;  2EH3 A;  2DYS H;  2E1N A;  5LRR A;  5GP9 A;  3U21 A;  2HS5 A;  3O8G A; 
#chains in the Genus database with same CATH homology
 2QQA A;  3FMS A;  3ZMZ A;  2UZK A;  3CUQ A;  3P9I A;  4HYE A;  4ZYH A;  1R7J A;  3LQQ A;  4FT8 A;  3GFI A;  1XDS A;  2VT3 A;  3IWZ A;  2FXA A;  4TV7 A;  2PI0 A;  2XV4 S;  2ACJ A;  5E17 F;  3QP5 A;  3CO6 C;  2EFP A;  5EEH A;  2O3F A;  4EJV A;  2JSC A;  3T8T A;  3E5U A;  2RGV A;  4HLX A;  4I01 A;  3GZ5 A;  3ABT A;  3I71 A;  1R22 A;  3DQV C;  4HAM A;  4G8X A;  2DO7 A;  1Y0U A;  3ECH A;  3BJA A;  4KIG A;  3OV8 A;  4EJU A;  1NHA A;  3FX3 A;  3K9T A;  2QM3 A;  1R58 A;  2FA5 A;  3ZP5 A;  3EDP A;  4BNC A;  4EJT A;  4HW0 A;  1ULY A;  1ZHF A;  5J8F A;  2OQR A;  4GYG A;  2XKP A;  2R3S A;  2FF4 A;  2W57 A;  1E17 A;  3E3V A;  5ICG A;  1Z91 A;  2FEZ A;  2Z99 A;  4ESJ A;  4U88 A;  2A07 F;  1ON2 A;  2OZU A;  4EJO A;  2ISZ A;  4ENK A;  4BHP A;  2XAS A;  4GXO A;  3CDH A;  3EYY A;  3GVA A;  1JE8 A;  1WSU A;  2A68 F;  2V1X A;  4EJW A;  1G3W A;  1ZRF A;  2M45 A;  3FMR A;  3QAH A;  1EH8 A;  1J2X A;  5L3C A;  2VXZ A;  3KEQ A;  1B9M A;  4HQM A;  4XBF A;  3DEU A;  1QO0 D;  4R1H A;  4RGR A;  1DUX C;  2UXN A;  2F5C A;  4M9X A;  1WRJ A;  2P6T A;  3ELK A;  1S3J A;  2FE3 A;  3SXY A;  4HDU A;  1LDK B;  2HKO A;  5KVR A;  1HKS A;  5F64 A;  3KE2 A;  4LLL A;  2D45 A;  5JHU A;  5LGU A;  4LMY A;  1H0M A;  1SD6 A;  2MLK A;  3KP2 A;  1S7O A;  4G9Y A;  2NYX A;  2Q8K A;  1CGP A;  4OIQ F;  5A2Q K;  1V4R A;  5F6F A;  2EA2 A;  4L9V A;  1B59 A;  2X0L A;  4L9T A;  5ERI A;  1XSX A;  1O7L A;  3O3K A;  2GQQ A;  1FSE A;  3RYP A;  1SD4 A;  3HSF A;  4G7O F;  5D8L B;  2JPB A;  3LFK A;  2COM A;  5IT9 K;  2H09 A;  5HOO A;  2ZNZ A;  3RI4 A;  1YIO A;  1JHF A;  1Z05 A;  2OBP A;  5CVR A;  2MBF A;  5AON A;  2V9V A;  4KT5 C;  2A6E F;  2L02 A;  3I0T A;  2K4J A;  5J6X A;  1O3T A;  4KIB A;  1O3Q A;  2KJC A;  3G73 A;  3BWG A;  2WC2 A;  3TO7 A;  2LF8 A;  3R0J A;  4L9J A;  3M7G A;  2HQN A;  3I4P A;  2MH2 A;  5DCM B;  2EFQ A;  1BJA A;  1BN5 A;  3CUQ C;  3CUQ B;  3WTS C;  3L00 A;  1BIA A;  2IA0 A;  3GLX A;  4UVC A;  3B73 A;  3R4K A;  3FZV A;  3C18 A;  4CDG A;  1L3L A;  4MQV A;  4N9I A;  4ZH4 F;  1KU9 A;  4KA4 A;  1S7A A;  3DPL C;  2DBB A;  2O61 A;  4O6J A;  1F9N A;  3LA2 A;  2GXG A;  5JR3 A;  3WGI A;  2EA4 A;  1YW8 A;  4HV5 A;  4WWC A;  3IKT A;  2HOE A;  1Q1H A;  3TO9 A;  2D1V A;  5HVQ C;  1REP C;  5L3F A;  1TW2 A;  4HF1 A;  3RTR A;  1FZP B;  3E6D A;  1SMT A;  3HTU A;  4LLN A;  5EEG A;  4ZZD A;  1K78 A;  4FX4 A;  2V1U A;  3Q9V A;  4XSX F;  3EYI A;  2XAJ A;  3ECO A;  3TDZ C;  2HGC A;  5L3G A;  3WTW C;  1FBU A;  1HST A;  3RKW A;  3GW2 A;  3DPT A;  1GHC A;  2XGX A;  2IA1 A;  1P4A A;  4B09 A;  5L3E A;  2HTS A;  3COA C;  5FFZ A;  2L3D A;  1QGP A;  4G7H F;  2H94 A;  2D1H A;  3JAM Z;  5BS6 A;  3AAF A;  2BYV E;  3P9C A;  1OYI A;  1OR7 A;  3TQN A;  3K69 A;  1I6X A;  4L18 B;  1FC3 A;  3FXQ A;  3F8N A;  3CJN A;  1LNW A;  1G6N A;  3WGG A;  3K2Z A;  2G7H A;  3FXU A;  1EH6 A;  3RKY A;  2DAO A;  1SAX A;  3ABU A;  2OQG A;  3MEX A;  3T5X A;  2IPQ X;  3GEZ A;  3SZP A;  1F1Z A;  3DFG A;  4GYI A;  1J5Y A;  1R1T A;  4MTD A;  2YSR A;  2E7W A;  2GA1 A;  1HW1 A;  1TQI A;  2KRF A;  1ZYR F;  2ETH A;  2NAZ A;  5AIP A;  1P4W A;  1XGM A;  3JW4 A;  5H20 A;  4BYY A;  1TQP A;  1TQM A;  4Q48 A;  5HDK A;  1D3Y A;  3ZMS A;  2DTR A;  2K02 A;  2DQL A;  5KK1 A;  2RKH A;  2IA2 A;  3KP6 A;  3H3Z A;  1XGS A;  2VBZ A;  4HX4 A;  2QBY B;  2EWN A;  2DLL A;  4S05 A;  3GFJ A;  2AXL A;  4UV8 A;  2F5D A;  2YX4 A;  1R5G A;  2BGC A;  1BOA A;  2ZXJ A;  1XSD A;  2A69 F;  3HSE A;  3O2P E;  4RGS A;  2K4B A;  1L0O C;  3RPQ A;  3FHZ A;  3F8B A;  1LDJ A;  2G7U A;  3GX4 X;  3VOE A;  1FP2 A;  4WXD A;  3BP8 A;  1S8N A;  3I54 A;  2VC0 A;  3IKV A;  2IJL A;  1E2X A;  1VTN C;  1QQI A;  1SFU A;  3GO5 A;  2LKP A;  1R23 A;  4UHT A;  2BBY A;  2XIG A;  2PLY A;  2W85 A;  1U2W A;  1Z1D A;  4CIC A;  1SMY F;  1WI9 A;  5LGN A;  4KIF A;  2ZME A;  2ZNY A;  1KGS A;  4WK8 F;  4HX8 A;  2IVM A;  4N0B A;  2CYY A;  1QZZ A;  1KQ8 A;  3IRQ A;  4Z2Y A;  4WF2 A;  3FM5 A;  2HR3 A;  3QPT A;  2F5F A;  4MHG A;  2YX7 A;  4MGR A;  4ZYE A;  3HYI A;  3ZN1 A;  1Z6R A;  5K5Q A;  1XCB A;  1ZN2 A;  1P4X A;  2W84 A;  4S04 A;  3N4M A;  3HHH A;  3GZ6 A;  1T0F A;  4Q47 A;  3GFM A;  3PQJ A;  4IRG A;  3ML6 A;  1YW7 A;  1FPQ A;  4WX9 A;  4ESB A;  3ZMU A;  4A2U A;  2ZJ2 A;  1ON1 A;  5ED4 A;  1K78 B;  2PN6 A;  3HOT A;  2Z9O A;  1D8J A;  4DQ2 A;  2VE9 A;  1ZRE A;  4JK1 X;  1P6R A;  2XAG A;  2GWR A;  3J81 Z;  1I27 A;  2FML A;  1A04 A;  2YU3 A;  2HEO A;  3NEU A;  1WQ2 A;  4CGZ A;  1LB2 A;  1SFX A;  2ZKZ A;  5CYV A;  1XMA A;  2PQ8 A;  2IT0 A;  1FBQ A;  4YFN F;  3D5L A;  4IXA A;  5DUI A;  1BM9 A;  4D0P A;  1TLH B;  4AIJ A;  2ZBK A;  1RI7 A;  3PFI A;  2J5P A;  2B0L A;  4PGG A;  4YFX F;  4ENJ A;  3C1D A;  1XN7 A;  5D8K B;  3F8M A;  2HDC A;  1YFH A;  3D0S A;  3KP4 A;  3RKX A;  5DCF A;  1G3Y A;  4JQF A;  5K1Y A;  4K2E A;  2M5W A;  1ZGJ A;  2R7F A;  5DD8 A;  4MEY F;  1FSH A;  4PDK A;  4PGH A;  2FBK A;  3ZPL A;  2MC3 A;  4P96 A;  4UXN A;  3BOQ A;  5L3B A;  1I5Z A;  2P8T A;  1MKM A;  4L5I A;  1MGT A;  3GFL A;  5ILU A;  4MNU A;  1IAW A;  5FO5 A;  3M9A A;  2IRF G;  4P9F A;  3ZMT A;  3E6C C;  4LJZ F;  2OA4 A;  2DPU A;  1MD0 A;  2CG4 A;  3FMQ A;  2EV6 A;  2Q2E A;  1HSJ A;  4AIK A;  2J5O A;  3IC7 A;  1ZG3 A;  1XDU A;  2KKO A;  5K5R A;  3CO7 C;  3VFZ A;  1PUE E;  5DYM A;  2PJP A;  3PQK A;  4RGU A;  4EM2 A;  4G6D A;  1I1S A;  4EGY A;  1LEA A;  1BC7 C;  4NB5 A;  4JBA A;  2V1D A;  3HRS A;  4M71 A;  4KUM A;  5LRS A;  1V3F A;  4U0W A;  4AWX B;  1UST A;  3CUO A;  1T39 A;  1ZAR A;  3WTT C;  4UVA A;  4HF2 A;  3FM3 A;  3KCC A;  3CTA A;  5DEQ A;  1ODD A;  2ZME B;  2JTV A;  1FLI A;  3E6M A;  1DPU A;  4IHS A;  3SQN A;  4U0Y A;  5L3D A;  2CW0 F;  1RUN A;  3HIF A;  3JAM K;  1W4M A;  3KEO A;  4BHB A;  2D2W A;  3WOD F;  2NNN A;  1ZAO A;  2O6G E;  5LEJ A;  1CF7 A;  3TOB A;  1C0W A;  3G3Z A;  3WTY C;  5H6R A;  3F8C A;  5BQT A;  2GAU A;  2M87 A;  2XAH A;  2QUF A;  2XAF A;  4H0E A;  3T1B A;  3R60 A;  5BPI A;  1RIO H;  1XGO A;  3W6K B;  2XRN A;  2LDU A;  4M73 A;  3MZH A;  3SZT A;  4KMU X;  2P5K A;  3WE3 A;  1WKM A;  4OIP F;  4KN4 X;  3LA7 A;  2QQ9 A;  4LB6 B;  1EV7 A;  1J9I A;  4M72 A;  5AIQ A;  3QOP A;  4CYD A;  1R1V A;  3GUD A;  4M9Z A;  4UV9 A;  2KJB A;  3JTH A;  1JHH A;  1YQA A;  3M8F A;  1TNS A;  4WXC A;  5ICC A;  2YR2 A;  4U0V A;  4FX0 A;  2WWY A;  1OMI A;  1KQ9 A;  5DV5 A;  1WWX A;  3EUH A;  4YG2 F;  2K86 A;  5LHH A;  3E5X A;  3L9F A;  3L09 A;  2ZO4 A;  5D4S A;  3QRF F;  2QQB A;  1I1G A;  3MCZ A;  5FFX A;  5D5U B;  3EQL F;  1SD5 A;  4BQA A;  4YIF A;  2P5L C;  4G6Q A;  4BAY A;  5DD4 A;  4LGW A;  1FOK A;  2CGP A;  1IXC A;  2BV6 A;  3KZY A;  5E20 A;  1OYY A;  2K7L A;  6PAX A;  4M6X A;  3QU3 A;  4WXH A;  2F2E A;  4XLN F;  1LQ1 A;  4ETS A;  1MJA A;  3F23 A;  2YPR A;  2XVC A;  2K27 A;  1HKQ A;  1UHW A;  2X4H A;  3CLO A;  1FT9 A;  3J80 Z;  1FYL A;  3RJP A;  2VN2 A;  4RB0 A;  1IN8 A;  3I59 A;  3TDU C;  4LG0 A;  2Z3Y A;  1LDD A;  3HRT A;  3Q9S A;  1MZB A;  4OMY A;  2M8E A;  3FF5 A;  1T6S A;  3V4G A;  2IP2 A;  1FYK A;  5LGT A;  1IXR C;  3IWF A;  4E70 A;  3HSR A;  3Q5F A;  4Y15 A;  1T38 A;  3ISP A;  3VOD A;  3MWM A;  2PEX A;  3F8F A;  5D6E A;  2VBX A;  4QWQ A;  4PZJ A;  1J59 A;  5ILS A;  3I5U A;  1ZH5 A;  1HKT A;  5HS8 A;  4FHT A;  3C3W A;  2DQR A;  3HUG A;  1BBY A;  4EMS A;  3J81 K;  4KDP A;  1ZRD A;  2NRA C;  3M8E A;  2EJR A;  3KFW X;  2MH9 A;  2XRO A;  2L54 A;  4XLP F;  2A61 A;  3DP7 A;  4I0A A;  1J75 A;  1ZGA A;  4M9S A;  4L0Z B;  1P2F A;  1W5S A;  2CWE A;  4CXF A;  3WU0 A;  1BI1 A;  2RQP A;  5FB2 A;  3JSO A;  2VOP A;  1IRG A;  1XMK A;  2ADU A;  1J7K A;  2DFI A;  3V7R A;  5FLX Z;  3RDI A;  1QBJ A;  5BOX A;  1ZG5 A;  1CF7 B;  3BY6 A;  5CVU A;  3WE2 A;  1G4D A;  2FOK A;  2JT1 A;  2HYF A;  4KFC A;  4LLG F;  3L2C A;  3LAJ A;  3F22 A;  4P9U A;  3K1M A;  3QPH A;  3TO6 A;  1K79 A;  1F4K A;  4EM1 A;  1ZLK A;  4HQE A;  5CJ9 A;  4M6Y A;  5D4R A;  4A12 A;  4A0X A;  3JTG A;  1DDN A;  3KLN A;  4HOB A;  3V8J A;  3WTV C;  1KA8 A;  4UNO A;  3F6O A;  2QVO A;  4I7H A;  1UHM A;  5HDN A;  4RAY A;  3U1D A;  1R1U A;  1AWC A;  1PP7 U;  2R7D A;  3BZ6 A;  5FD6 A;  4MQ9 F;  2ISY A;  1MJ9 A;  5ICF A;  1IW7 F;  4Q4Z F;  3I58 A;  4GCV A;  5BMZ A;  2P5V A;  2VBW A;  3H3U A;  1U3E M;  4ENN A;  2GA2 A;  3TGN A;  1YYV A;  3LST A;  2FSW A;  2VC1 A;  4KYW A;  4HF0 A;  4CO8 A;  2P7V B;  4ASN A;  3WTU C;  4CZZ A;  4Y17 A;  4O3M A;  1D8K A;  2JPC A;  1GVJ A;  3T0Y A;  3BJO A;  4EV0 A;  1KU3 A;  2BEO A;  4QLC U;  4Q5S F;  5IT3 A;  3LWF A;  5E18 F;  2FMY A;  2G9W A;  1ZLJ A;  4ENM A;  4EGZ A;  1H9T A;  4LB5 A;  1YTY A;  2OZ6 A;  2M1B A;  5E1X A;  2STW A;  5HLI A;  3TOA A;  4OMZ A;  2QYO A;  2EV0 A;  2HZT A;  1O7F A;  2UXX A;  3V7C A;  3GF2 A;  3HHG A;  5E1Z B;  5H6Q A;  1OKR A;  1LJ9 A;  4AD9 A;  1YLF A;  2PBI A;  1ONV A;  5DUK A;  1KU7 A;  5E1W A;  2EV5 A;  5DCM A;  3V8K A;  4OIN F;  3I59 B;  2KIU A;  2DK8 A;  4LG0 B;  1FBS A;  1H9G A;  4IVN A;  3VB2 A;  4RAZ A;  3KP3 A;  2F5E A;  4HBL A;  2HFH A;  4I02 A;  5ICE A;  2ZFW A;  5E8I A;  4EVI A;  4LK1 F;  1EH7 A;  1GXQ A;  4HA8 A;  2LNB A;  3WGH A;  1GXP A;  2HKX A;  2C6Y A;  1IXS B;  4KMF A;  2Y0M A;  3LQR A;  1FYM A;  4U7D A;  1XB4 A;  5LLQ A;  3ZMV A;  1YG2 A;  2A6H F;  1BI3 A;  3IHU A;  5E8G A;  4RS8 A;  4IJA A;  2ZCW A;  2ESH A;  1G3T A;  4A5M A;  4U7B A;  5LEK A;  2V79 A;  3WU1 B;  2L4M A;  4LK0 F;  4RB1 A;  1MJB A;  3MQ0 A;  1U8R A;  3S2W A;  2STT A;  5DDG A;  5FGM A;  4HX7 A;  2UWM A;  5D5W B;  3ZQ7 A;  3O6B B;  3NQO A;  1LEB A;  3HTS B;  3K1N A;  2ELH A;  2DPD A;  1B4A A;  1ZG1 A;  1YS6 A;  4O5V A;  1KU2 A;  4LFU A;  2VOO A;  3H92 A;  3B02 A;  1KQ0 A;  2EFN A;  3EET A;  3TKY A;  4XSZ F;  2GXB A;  1FY7 A;  3F21 A;  3NRV A;  4EM0 B;  4A6D A;  1G3S A;  2P7C B;  1HXD A;  1OPC A;  5FD5 A;  1Z6T A;  3KP5 A;  5CVI A;  4KIC A;  4NQW A;  3E97 A;  3RYR A;  2HTJ A;  4A0Y A;  1B9N A;  1MDM A;  3WTX C;  3HOS A;  4RB3 C;  3DV8 A;  3QU6 A;  3DKW A;  2FU4 A;  4UUV A;  4IPA A;  3LA3 A;  1K7A A;  1XCV A;  1OYW A;  4BHC A;  2MA3 A;  3WG9 A;  1BI0 A;  1Z9C A;  2XKO A;  4PCQ A;  2P6S A;  1ZRC A;  4YFK F;  5K5O A;  3BPX A;  3RPU A;  1STZ A;  4I09 A;  2RVC A;  2HYG D;  3J80 K;  2OU2 A;  4G94 A;  2O0Y A;  2GZW A;  1K6O A;  3M1E A;  1SFE A;  2QLZ A;  3BJ6 A;  3N97 A;  2EB7 A;  2H27 A;  2H6C A;  4IHT A;  2DI3 A;  1KYZ A;  4OU0 A;  3P7N A;  3RIR A;  1B1B A;  1U5T A;  2QBY A;  1YO5 C;  2XHK A;  5D6F A;  1QNT A;  1USS A;  4F7Z A;  2W24 A;  2CQK A;  4RB2 C;  2FBI A;  2GIV A;  2DW4 A;  3FXR A;  4YII A;  2MLG A;  1BI2 A;  1QZY A;  1IRF A;  2EK5 A;  4B8X A;  3ZMD A;  4A5N A;  3SFZ A;  4IRH A;  1PDN C;  4HZF A;  1FWZ A;  2VBY A;  5TJJ A;  1HW2 A;  3BDD A;  5HLH A;  3KZZ A;  3V8L A;  4MEX F;  4HLY A;  1TNT A;  5ILV A;  1T2K A;  3SHF A;  2FNA A;  4HV6 A;  1IN4 A;  1TW3 A;  4BH9 A;  2L4A A;  1R5H A;  3J7A O;  4XRF A;  4WCG A;  3BPV A;  5FLX K;  5TRD A;  2EFW A;  2H6B A;  4IRI A;  3LAP A;  2DT5 A;  2RNJ A;  2DU9 A;  1W7P A;  3E5Q A;  3I64 A;  5JFR A;  1JXS A;  3W6J B;  2P4W A;  2L01 A;  4Y13 A;  1R00 A;  2TDX A;  3L7W A;  3QP6 A;  4OIR F;  3WTZ A;  5D5X B;  1YW9 A;  3IL2 A;  4DNC A;  2FBH A;  4BXU A;  1J0R A;  4N9H A;  2RC4 A;  4CHU A;  4OOI A;  3R0A A;  3HRU A;  1TBX A;  2HQR A;  1RUO A;  1F5T A;  1P92 A;  1U78 A;  1RNL A;  2PFB A;  5BPD A;  3IRR A;  3F6V A;  2E1C A;  2RV8 A;  5LHG A;  2RN7 A;  1KYW A;  2LSO A;  2Z33 A;  4I98 B;  4A6E A;  4GO1 A;  2A3S A;  2Z5U A;  1IZ1 A;  2PMH A;  4M74 A;  4I2O A;  3ERE D;  1R36 A;  2ESN A;  4P5O A;  3VEP A;  4I0B A;  5A2Q Z;  1O3S A;  1DPR A;  2FQ3 A;  2LF7 A;  3MAJ A;  2Q0O A;  5HS7 A;  4NHJ A;  3ULQ B;  1FX7 A;  4L9N A;  3HRM A;  2PG4 A;  4ESF A;  1IF1 A;  1TTY A;  1PP8 F;  2IW5 A;  5HDG A;  1MDM B;  1XSV A;  1RZ4 A;  5IT9 Z;  4IF4 A;  3C7J A;  4L0Y B;  4L5J A;  5HS9 A;  1DP7 P;  1BIB A;  1JGS A;  4ON0 A;  4R79 A;  3MZY A;  2HWV A;  3MFK A;  3U2R A;  4GGG A;  4KN7 X;  4AIH A;  1QPM A;  4ZYG A;  3KET A;  1U5T C;  3I53 A;  1U5T B;  4A0Z A;  1S6L A;  3DF8 A;  1SD7 A;  2WTE A;  2CO5 A;  1HBX G;  1U6G A;  4EQQ A;  3KP7 A;  3FWE A;  1IN6 A;  1X3U A;  2NNY A;  5LHI A;  2PMU A;  2VE8 A;  4LD5 A;  5D5V B;  1D5V A;  1O3R A;  4OIO F;  2FNP A;  2E7X A;  1IN7 A;  2V6C A;  2XUB A;  1HQC A;  3BRO A;  2QEN A;  1Z7U A;  2CFX A;  3OOP A;  2NS0 A;  2BE5 F;  3U9G A;  2EFO A;  3GWZ A;  2QWW A;  2KIF A;  2KIM A;  1O57 A;  5JI6 A;  3F72 A;  5LBQ A;  3REO A;  1BC8 C;  1S29 A;  2RDP A;  4G7Z F;  1LVA A;  3DXJ F;  3ROU A;  3GYH X;  5F1R A;  2VOD A;  1UCR A;  2W25 A;  4RGX A;  2A5Y B;  5CLS A;  2OD5 A;  4MTE A;  1W7P B;  2Y48 A;  3K1P A;  4ZZL A;  1FNN A;  4AVP A;  3JSP A;  1B6A A;  1UFM A;  1FP1 D;  2XAQ A;  2CSO A;  2Y75 A;  1XGN A;  1W5T A;  4KNY A;  4HDV A;  2AS5 F;  2DK5 A;  3GXO A;  2JZY A;  3R61 A;  5JVT A;  2O03 A;  1AOY A;  5J8C A;  1UB9 A;  3K0L A;  3P9K A;  2O8X A;  1YS7 A;  4P55 A;  1W7P D;  2OAZ A;  1XD7 A;  2WV0 A;  3F3X A;  1IUY A;  5CVV A;  3KLO A;  4ZYD A;  2VT2 A;  1IN5 A;  2JRT A;  3V7S A;  1T98 A;  2MD5 A;  2VON A;  3T8R A;  1HW5 A;  2M30 A;  5HLG A;  3R6S A;  3ZN0 A;  4UVB A;  2QZ8 A;  2FRH A;  5CVJ A;  3E6B A;  4R8H A;  2E1N A;  5LRR A;  2HS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...