1T2KA

Structure of the dna binding domains of irf3, atf-2 and jun bound to dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
110
Chain Sequence
TPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ATF-2/c-Jun and IRF-3 bound to the interferon-beta enhancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords 31-MER
total genus 27
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t2kA01
4FT8A 2HZTA 4M9ZA 2HTJA 1J75A 3D0SA 4MEXF 1F5TA 2RDPA 4CO8A 2D45A 1SD6A 2KIMA 3ZMTA 1XGOA 3C1DA 1R1TA 2H6BA 2QYOA 4A5NA 3DF8A 1DPUA 5E1WA 1KQ9A 4IRIA 4UV9A 3VEPA 1A04A 2GXGA 3ECOA 1G3YA 1MZBA 4KYWA 4KT5C 4RB2C 1YS7A 3MZHA 3CUQC 3BPXA 1ZREA 3MCZA 3RKWA 4A5MA 1MJ9A 3HSRA 4LB5A 2GZWA 4HZFA 1SD4A 2V1DA 4LLLA 4UVAA 2IP2A 3H92A 1I1GA 2G9WA 3F8NA 2EFNA 4M71A 4L18B 1GHCA 2DO7A 3IHUA 2QBYB 1FWZA 5E8GA 3WTVC 2XUBA 3D5LA 5CVUA 3RTRA 2J5PA 1O3SA 1WWXA 1IXSB 4CDGA 1TNTA 5DEQA 2EFPA 3TO9A 3F21A 3HIFA 3PQKA 2RGVA 2L01A 4UV8A 1T6SA 2NAZA 4A0XA 4YFKF 3IRQA 3OOPA 2P5LC 5IT3A 2FF4A 4ESJA 4IRHA 4HLXA 4IXAA 1FYLA 2QQAA 2M30A 1Y0UA 2E1CA 1NHAA 4U0WA 1JXSA 1WQ2A 3Q9VA 2WWYA 3DEUA 1U2WA 5ILUA 4OOIA 2H6CA 1ZH5A 5D6FA 4AD9A 4CXFA 4HF0A 1OYYA 4Z2YA 4I2OA 2K4JA 2FA5A 2HYFA 2ZO4A 3ZN0A 1U8RA 2ZMEB 4NQWA 1Z05A 4L9JA 3E5UA 5ED4A 2KRFA 4D0PA 1QNTA 1EH7A 2H09A 5K1YA 5BS6A 3VODA 2FBHA 2Y75A 4M72A 1MDMB 3MAJA 1Z1DA 2ZCWA 4RS8A 4NHJA 1O7FA 5AIQA 4KIGA 3KP6A 3KP7A 4BXUA 1ZG1A 2DQLA 2TDXA 2W84A 2QUFA 1LNWA 3BZ6A 3ROUA 5JHUA 1H9TA 2ISYA 2Q2EA 4A6EA 1K79A 1BOAA 2EWNA 3FXRA 1I6XA 1ONVA 1H9GA 1KYWA 3K1NA 1F9NA 3BJOA 5FD6A 3I59A 1DUXC 2VT2A 2LSOA 2P6TA 3GXOA 1R22A 4JQFA 2ZFWA 5L3FA 2NRAC 3V8KA 1L3LA 2ISZA 3F8MA 2XAQA 4O6JA 4WXDA 3ERED 1U5TB 5EEHA 2W57A 4KICA 3K2ZA 1XSXA 3SZTA 1QZYA 4L9VA 4YIFA 1PUEE 4G8XA 3FM5A 5LGNA 3I54A 4ZYHA 1WRJA 1B9MA 1FPQA 3BJ6A 2K02A 2M45A 2EJRA 3RYRA 1TTYA 3TQNA 4ETSA 1S6LA 2J5OA 3E6BA 5DCFA 4GCVA 3WU1B 2KIUA 1FBSA 1STZA 1FLIA 3RDIA 2DPDA 3RKXA 2A69F 5E1ZB 1B1BA 3MEXA 1FT9A 1W5TA 2OBPA 3WODF 2VODA 3ZP5A 3DV8A 5K5QA 4EGZA 5FD5A 1IXCA 5LEKA 3E6CC 3I0TA 1YQAA 3I4PA 3SXYA 2CYYA 2DLLA 4R8HA 1TQPA 2BV6A 2ACJA 3ZMZA 1XMKA 3W6KB 4M9XA 4AWXB 2HR3A 2VBWA 2JZYA 2IJLA 3GFJA 2XROA 5DCMB 2HS5A 2EV0A 2HQRA 1UCRA 5D8KB 4LJZF 4QWQA 1XGMA 4HV6A 2RVCA 1LVAA 2KJBA 1Q1HA 3TGNA 2IW5A 4G6QA 3P9IA 1D5VA 3DPTA 3VOEA 1TLHB 3P9CA 1QQIA 4A0YA 1DDNA 3B73A 4I7HA 4MEYF 3SHFA 4OU0A 1VTNC 3RYPA 1BIAA 2E7XA 2ETHA 4HA8A 4HDVA 3W6JB 2CW0F 2FOKA 2DI3A 2NNYA 3CUOA 4O5VA 1O57A 4YIIA 2LF7A 2YX7A 2FMLA 4ZYDA 2K86A 5F6FA 1OYWA 3G73A 2PLYA 3F23A 2P8TA 3JSPA 2CSOA 3ZMDA 4IF4A 4EV0A 4A6DA 3FXUA 3HRTA 4XSXF 3ELKA 5E20A 3IL2A 3DPLC 4R1HA 3GFIA 1BJAA 3FM3A 1YG2A 1LB2A 3EUHA 1HSJA 1MDMA 3K0LA 2A61A 3BP8A 1TW2A 2ZNZA 3L7WA 5BQTA 4CHUA 2VN2A 3J81Z 4L0ZB 4KIFA 1O3TA 1KU2A 2O8XA 2VXZA 2WTEA 3ABUA 4LMYA 1UHMA 1V4RA 2OQRA 3M8FA 1BIBA 3H3UA 2VBXA 1W7PB 3FWEA 4I02A 1OKRA 4B8XA 1W7PD 3SFZA 3M9AA 2VE9A 2IT0A 2X4HA 5DV5A 3JW4A 3KZZA 3KZYA 4RGSA 1YYVA 5J8FA 1QPMA 1USSA 4AIJA 4EGYA 4ASNA 3KP5A 1K7AA 3BROA 5DUIA 1XGSA 4RGUA 1KU7A 3EQLF 3CUQA 1WSUA 2YPRA 2P7CB 4GYIA 3GEZA 2OZ6A 2QVOA 1BC8C 4HAMA 3DP7A 2XHKA 2V1XA 1FZPB 5ERIA 4EM2A 1HQCA 2UXNA 2GA1A 3QRFF 4EJOA 4KN4X 5FFZA 3VFZA 1AOYA 3KLOA 1E2XA 4XLNF 4WCGA 2A07F 4BQAA 3T8RA 3LQQA 3MWMA 3KFWX 3HHHA 1PP7U 3HTSB 2FBKA 1KA8A 4WXCA 5DCMA 4OIQF 3RPUA 2YX4A 2ZMEA 1ZAOA 1H0MA 3TOAA 2D1VA 2O0YA 2OD5A 2DQRA 1W5SA 1W7PA 5DUKA 5H6QA 4MTDA 1GXPA 2RQPA 4FX4A 4KFCA 2K7LA 2M87A 2H27A 2V79A 3U9GA 1HXDA 1RUNA 4GGGA 3T0YA 2VC0A 2UXXA 3MFKA 3WTTC 2MBFA 1IRFA 2P6SA 3AAFA 2Z3YA 3F8FA 3LQRA 4LD5A 2ELHA 2XAHA 4EM0B 2V6CA 1U78A 3OV8A 5K5OA 2MC3A 3GFLA 3CO6C 3EYYA 1XDSA 1CF7B 2YSRA 2L54A 2RKHA 2ZKZA 1RUOA 1LDKB 1P4AA 2R7DA 3R61A 3P7NA 5D5VB 2QQBA 3WGHA 1L0OC 2BYVE 3O6BB 2FSWA 3FZVA 1LEBA 2CO5A 2MLKA 1JHFA 2DTRA 2AS5F 2P7VB 4OIRF 1SD5A 3KP2A 4XRFA 5HLGA 3HSEA 3TDUC 4EMSA 3GW2A 5H6RA 5LHIA 3B02A 1I1SA 2JPCA 1C0WA 3KP3A 1HW5A 2YU3A 1X3UA 1HKSA 5BPDA 1BM9A 1GVJA 1J2XA 2XAFA 2MD5A 3LAJA 5A2QK 1O7LA 2PQ8A 2UZKA 1XMAA 3KCCA 4I01A 5FGMA 2FMYA 2FE3A 2RV8A 4M73A 5F64A 4G9YA 3IRRA 2UWMA 2ESHA 2VT3A 4I0BA 3NRVA 1G3WA 4CGZA 1S7AA 4IPAA 2WV0A 2ZJ2A 1ZYRF 2BE5F 1SFUA 3WTXC 1ZLKA 4Y13A 4KA4A 4PCQA 3BPVA 3T1BA 3CO7C 3I64A 4MQ9F 1U5TC 4IRGA 2P5VA 2VBZA 2FRHA 2GAUA 3WE2A 5L3BA 5F1RA 4WK8F 2XV4S 1F1ZA 2XIGA 2A68F 1BC7C 4HBLA 4CYDA 5D8LB 3LSTA 4OMZA 1ZARA 2OZUA 3I59B 4HW0A 2BGCA 4O3MA 5HDKA 1ZRDA 4I09A 4KDPA 2QM3A 1PP8F 1T98A 4EJVA 5LHGA 4GYGA 2M5WA 3K1MA 1OR7A 3R60A 4LG0B 5D5XB 2AXLA 3GX4X 1BBYA 5JI6A 1S8NA 4EM1A 3RPQA 4CICA 2HEOA 2PJPA 2EA2A 4L9NA 4WWCA 3IWZA 5H20A 3V7SA 5ICCA 5CLSA 1K78A 1Z6TA 1CGPA 2VOOA 2GA2A 1K6OA 3TKYA 4LLGF 1SFEA 2XAJA 3KEOA 4MTEA 5HLHA 4PGGA 4MGRA 1SFXA 3V8JA 2V1UA 4G94A 4Q4ZF 4KUMA 2D2WA 4U0YA 5DD8A 2STTA 3E97A 4DQ2A 4U0VA 2DAOA 1WKMA 2MA3A 3VB2A 3WTZA 3F6OA 2BEOA 5KK1A 1OMIA 2IRFG 3HOTA 2O6GE 1YW7A 5DD4A 2EV6A 1ULYA 2H94A 5TRDA 4S05A 1T2KA 1J7KA 2GIVA 1YW9A 3TO6A 4Q47A 3CTAA 4EVIA 4DNCA 3L9FA 5K5RA 1R1VA 4LK1F 2NS0A 1FSHA 3ECHA 3T5XA 4CZZA 1RIOH 4BYYA 1D8JA 1XSVA 5E8IA 1R5GA 2PG4A 4HF2A 5ILVA 2W85A 3FXQA 3C3WA 3RKYA 1P4WA 3JTHA 1FX7A 2M1BA 4LB6B 1TNSA 1ZRCA 4QLCU 2W24A 3RI4A 2GXBA 3HUGA 4GXOA 3I53A 3L00A 3GVAA 1BI1A 5AONA 2JRTA 2CG4A 2LDUA 3FMQA 4HYEA 4S04A 4BH9A 3FX3A 2EA4A 1Z6RA 4KMUX 3WG9A 2QBYA 2STWA 3WTSC 3L09A 2GQQA 2JPBA 1Z91A 2OQGA 4OINF 2PI0A 2R7FA 1IN4A 3I5UA 2QLZA 2A5YB 1DPRA 3M1EA 1XDUA 5LHHA 2ZXJA 4UUVA 1E17A 3E5XA 1BN5A 1FC3A 1SMTA 1Z7UA 1EH6A 4A0ZA 3J80K 3U2RA 1YO5C 1J5YA 1FNNA 3HSFA 4UHTA 3LAPA 3MZYA 3IKTA 3E6DA 1IZ1A 3Q5FA 4ENKA 4BAYA 4B09A 3V8LA 3BDDA 4LFUA 4G7OF 3TDZC 3O3KA 4HDUA 3QOPA 4MQVA 4FHTA 1KYZA 3DKWA 4P9UA 2G7HA 2Y0MA 5E17F 3ZMUA 3C7JA 2WC2A 3HTUA 1JGSA 4KN7X 2Z5UA 2Z9OA 1RZ4A 3L2CA 1RNLA 3F22A 2HDCA 1BI3A 5BPIA 4JK1X 3WU0A 4G7HF 5BMZA 2W25A 1ZG3A 1B59A 1B9NA 4ON0A 3GUDA 1W4MA 2L4AA 2EK5A 3JAMZ 1TQIA 5DDGA 4F7ZA 3S2WA 1R36A 1CF7A 3LA2A 4A2UA 5ICEA 5IT9Z 1R00A 3Q9SA 3R4KA 1USTA 1O3RA 3COAC 5CVIA 2EFWA 3QP5A 1P4XA 4L5JA 4Q5SF 2DPUA 3PFIA 2ZBKA 1MGTA 3N4MA 5JR3A 3T8TA 3J7AO 1FY7A 5FFXA 4BNCA 4PDKA 3HOSA 5L3CA 2L4MA 4P55A 2DT5A 1ZG5A 2CFXA 2XRNA 3ZN1A 3CDHA 5CVJA 2IA1A 3EYIA 3SQNA 2K27A 4UVCA 1YTYA 1REPC 1SD7A 4OIOF 3RIRA 2VE8A 2HKXA 2B0LA 3QP6A 1UHWA 1R7JA 1T0FA 4HLYA 2DK5A 1ON2A 4AIKA 1LQ1A 3REOA 1FOKA 1IXRC 2M8EA 4UXNA 2DW4A 2P4WA 2F5EA 2NYXA 1IF1A 3N97A 1IAWA 3WGGA 3KE2A 3LFKA 4A12A 2O03A 4R79A 3I71A 1I27A 4KMFA 2DU9A 2HWVA 3CJNA 5J6XA 3F8BA 1GXQA 3EETA 2P5KA 1OYIA 4YFXF 1K78B 3V7RA 2IVMA 2OA4A 2PEXA 1YIOA 1OPCA 4HX8A 3WTUC 2EFQA 3NEUA 1FSEA 4KIBA 2HYGD 2MH9A 4M6XA 3R6SA 4IHSA 1I5ZA 4GO1A 2XKOA 3J81K 2RN7A 2MLGA 2C6YA 2KIFA 3E5QA 3BJAA 2F2EA 2E1NA 4Y17A 4HQMA 3LA3A 1MJBA 5E18F 1UFMA 2EFOA 3ZMVA 1IW7F 5HS9A 1HKTA 3QU6A 3F6VA 1R23A 5D4SA 4RGRA 1AWCA 4UNOA 4Q48A 1IN8A 3ZPLA 2XGXA 4EJTA 4M6YA 2L3DA 3WTWC 1ZN2A 5TJJA 1R5HA 5LEJA 1T38A 1HW2A 1S29A 1B6AA 1XN7A 1P6RA 1S3JA 2DBBA 1JE8A 4RB1A 1PDNC 1U6GA 5D5WB 1P92A 4ZZLA 2ESNA 3ZMSA 4KNYA 3MQ0A 4K2EA 3SZPA 1TBXA 2V9VA 2F5DA 4PZJA 3GZ6A 1O3QA 2XVCA 1WI9A 4U88A 3CUQB 3ULQB 1YFHA 2A3SA 4H0EA 4G6DA 5HOOA 2CQKA 5L3DA 4XBFA 5J8CA 1UB9A 4EJUA 4UVBA 4ESFA 2HGCA 5FB2A 1KU3A 3G3ZA 2VBYA 3F3XA 4XSZF 3GWZA 3I58A 1KGSA 2KKOA 2QENA 3ML6A 1XCVA 3PQJA 2IA0A 1ZRFA 4ZH4F 4L5IA 1Z9CA 4M9SA 4HF1A 2L02A 5JVTA 4OIPF 5E1XA 1P2FA 2LF8A 2CWEA 3HYIA 2Y48A 5LLQA 4Y15A 3C18A 2RNJA 3DXJF 3IKVA 5ICGA 1T39A 1IRGA 4ENJA 3BOQA 3JTGA 4FX0A 3F8CA 3GZ5A 1QBJA 2IPQX 2R3SA 2E7WA 1BI2A 4ENMA 4LG0A 1FBQA 5LRSA 1ZGJA 4YG2F 3KLNA 4NB5A 1FYKA 4MNUA 1YLFA 2HKOA 4JBAA 1QGPA 4P5OA 1KQ8A 4IHTA 1F4KA 2KJCA 4ZZDA 4RAYA 1HKQA 4OMYA 1LJ9A 5CYVA 2O3FA 3TOBA 3QPHA 3K69A 2Q8KA 5L3EA 2JT1A 1G3SA 1SMYF 2XKPA 2HTSA 3WE3A 2Q0OA 4RB0A 5HS7A 1XGNA 3FHZA 1J0RA 5AIPA 2Z33A 3HRMA 5CVRA 5HVQC 2FBIA 1IN6A 3QPTA 3U1DA 5DYMA 4HV5A 5ICFA 1ODDA 2FXAA 5LRRA 2ZNYA 4XLPF 2FU4A 1HW1A 4IJAA 2A6HF 3FF5A 3P9KA 1QZZA 4HQEA 1IN5A 1FYMA 1LDDA 2FNPA 4P96A 4L9TA 3FMSA 5D6EA 1YW8A 4U7DA 4RGXA 1HBXG 3V4GA 1KU9A 4N0BA 1G6NA 1FP1D 2IA2A 1KQ0A 5HDGA 4ENNA 3GLXA 5D4RA 3WGIA 4ZYEA 4RB3C 3NQOA 4PGHA 2OAZA 3BWGA 4BHCA 4TV7A 3M8EA 3K9TA 4LK0F 3J80Z 3QU3A 6PAXA 1RI7A 1EH8A 2FNAA 4P9FA 3E6MA 4AVPA 1R58A 1R1UA 3HHGA 2JTVA 4I0AA 1ZGAA 3RJPA 1FBUA 3HRUA 3GYHX 3KP4A 5BOXA 4YFNF 2RC4A 1MJAA 2VOPA 1JHHA 3CLOA 5ILSA 2LNBA 1G3TA 3TO7A 1J59A 4N9HA 4G7ZF 2DK8A 3V7CA 3R0JA 3F72A 2ADUA 2QWWA 3H3ZA 1ON1A 5CVVA 2XAGA 4U7BA 1J9IA 2X0LA 2PBIA 4E70A 5IT9K 4ZYGA 3ABTA 3M7GA 1D8KA 3R0AA 5LGUA 3BY6A 4M74A 2K4BA 4ESBA 1ZLJA 4BHPA 1TW3A 1LDJA 3LWFA 4L0YB 1DP7P 2YR2A 2DFIA 5EEGA 1XSDA 4WXHA 2QZ8A 5L3GA 2FEZA 2QQ9A 3EDPA 1SAXA 3O2PE 4HOBA 3GFMA 3GO5A 2XASA 1S7OA 4N9IA 5FO5A 2PMUA 2BBYA 4LLNA 3DFGA 1B4AA 2F5FA 4LGWA 5D5UB 2EV5A 3HRSA 5FLXK 5CJ9A 2PN6A 5LBQA 3WTYC 4MHGA 1MD0A 2G7UA 3DQVC 2NNNA 4I98B 1EV7A 5HDNA 5HS8A 4EQQA 2PMHA 3K1PA 3ZQ7A 2PFBA 1IN7A 2FQ3A 1XD7A 1ZHFA 5A2QZ 4EJWA 5KVRA 4WF2A 2O61A 5HLIA 2EB7A 3QAHA 2HOEA 1IUYA 1D3YA 1BI0A 2HFHA 3IC7A 3JSOA 2D1HA 1XCBA 3KETA 2Z99A 4IVNA 1QO0D 1HSTA 2JSCA 3JAMK 2LKPA 3IWFA 1V3FA 1G4DA 1LEAA 2A6EF 5JFRA 1MKMA 4HX7A 3E3VA 1XB4A 4HX4A 2HQNA 1U5TA 3LA7A 4WX9A 1U3EM 1YS6A 2VC1A 3GF2A 5FLXZ 2CGPA 2COMA 3FMRA 2VONA 5LGTA 2F5CA 1TQMA 2GWRA 1FP2A 3KEQA 4AIHA 2OU2A 4RAZA 3ISPA 2MH2A 4BHBA
chains in the Genus database with same CATH superfamily
4B3XA 4FT8A 5F1JA 2HZTA 4M9ZA 2HTJA 5DM7F 1MBGA 2BW3B 1OISA 4AUXA 1J75A 3D0SA 2XGCA 2CMPA 1GVDA 3PNTA 1RESA 2RDPA 4NBQA 4CO8A 2D45A 4CCNA 3OYHA 1SD6A 2EIMH 2W82A 2KIMA 2LBFA 1UG0A 3ZMTA 3JRFA 1XGOA 4XLEA 1N75A 3K10A 3C1DA 1R1TA 2H6BA 2QYOA 4A5NA 2IS2A 1D1BA 3OS1A 2X51A 3DF8A 1DPUA 2A05A 1HCRA 5E1WA 3NAUA 2OC6A 1KQ9A 4IRIA 1WZ2A 4DOZA 4C3JJ 4UV9A 3VEPA 1A04A 1I6HJ 1U9NA 2GXGA 3H36A 2K40A 3P5JA 1NG6A 3ECOA 1G3YA 1MZBA 2GOMA 3W2AA 2AQFA 3A01B 1ZK8A 4KYWA 3GTOJ 4KT5C 2DYSH 3CCUI 1RR8C 3BR1A 5FROA 4RB2C 2XGDA 4XLFA 1YS7A 3MZHA 3CUQC 1A36A 4BJTA 3BPXA 1ZREA 2AHQA 3LSMA 2B9SA 3MCZA 4E4HA 3WHBA 2IGMA 3RKWA 2NVYJ 3B6AA 1MJ9A 4A5MA 2NOJB 3S93A 3HSRA 2QSGX 4LB5A 2GZWA 4HZFA 1SD4A 2DA4A 2EZLA 2V1DA 2F4IA 4LLLA 4UVAA 2IP2A 3H92A 1I1GA 5LFAA 2G9WA 1QHHD 3F8NA 2OUMA 2EFNA 2MGQA 4M71A 4L18B 1B8IB 2DO7A 1GHCA 3L2RA 3IHUA 2QBYB 2DT6A 4OAZA 1FWZA 3DKXA 5E8GA 1TZLA 3WTVC 3U1KA 3GTQJ 2XUBA 3KEYA 3D5LA 1XPXA 4B44A 5CVUA 1OCZH 2XRLA 1ETQA 3RTRA 2QF7A 2J5PA 3QQAA 1O3SA 1WWXA 2CU7A 1VQMI 1IXSB 5IYDJ 1WVRA 4CDGA 1TNTA 1YJNI 4C9YA 5DEQA 4DZJA 2EFPA 2F4MB 1VQ4I 3TO9A 3F21A 2JN6A 3HIFA 1F5TA 3PQKA 2RGVA 1JTYA 1ZTRA 2L01A 4UV8A 1VQ6I 1T6SA 1ZR2A 2LY9A 2L7FP 2NAZA 2QKMB 3Q0UA 4A0XA 3L2VA 4YFKF 3IRQA 3OOPA 2P5LC 5IT3A 3Q0WA 2FF4A 2VQCA 4IRHA 4ESJA 4HLXA 4A3GJ 3LMMA 2K9SA 4IXAA 2QQAA 2M30A 4II3A 4KITB 2HQ5A 1FYLA 2OV7A 1Y0UA 2E1CA 2Y30A 2E1OA 3H5NA 1NHAA 1R6RA 2ZXHA 1F36A 4U0WA 4DIQA 1IG7A 1JXSA 4FE7A 2BHZA 3JRAA 1WQ2A 3S1RJ 1LUJB 3N05A 3Q9VA 3DEUA 2WWYA 1U2WA 2E36A 5ILUA 2DA7A 1BA5A 3LSIA 2H6CA 4OOIA 4HRIA 4PSWA 3DCFA 3OYCA 2FOWA 1ZH5A 5D6FA 4AD9A 4CXFA 4HF0A 3JRDA 1OYYA 4Z2YA 4I2OA 2K4JA 2OCEA 4L5EA 2FA5A 2R5YB 1WJDA 2HYJA 2HYFA 2ZO4A 3ZN0A 3FHNA 1U8RA 2ZMEB 4NQWA 3BR2A 1Z05A 1GDTA 3I3LA 4L9JA 2CUJA 5HLTA 1E0EA 3E5UA 5ED4A 4RDUA 2KRFA 5LD2C 2W7NA 1MSEC 4JX4A 4D0PA 1QNTA 3S8PA 1EH7A 2H09A 3FBIB 2XPWA 3A4CA 3KPHA 1WFXA 2LY2A 5K1YA 5BS6A 5M3FJ 4ZC3A 3VODA 3ZCOA 3CCSI 2FBHA 1I39A 2Y75A 4M72A 3OYDA 1MDMB 1MMAA 3MAJA 1ZQ3P 1Z0XA 1Z1DA 2ZCWA 4RS8A 2IBDA 4Y3OA 5KAFC 4NHJA 1O7FA 5AIQA 1PUFA 4KIGA 3CC7I 3H5AA 4YRVA 4PSXA 5J47A 3KP6A 3ZQGA 4UB8C 4BU2A 3KP7A 4BXUA 1ETKA 1ZG1A 2DQLA 2BW3A 2DA3A 2TDXA 2W84A 4HEA2 3LSRA 2QUFA 4E7HA 4D5CA 1LNWA 2OCCH 3H3VK 3BZ6A 3ROUA 3OR1C 5JHUA 2UUZA 2L9NA 2LC2A 1H9TA 2ISYA 2Q2EA 5EYRA 4A6EA 3RZDJ 1BOAA 2CJJA 2EWNA 2Y0SA 1K79A 2BY3A 2Y31A 3DWLE 4XOPA 2E19A 3O8HA 3FXRA 1WI3A 1I6XA 5E79C 1ONVA 2YS9A 2ZFUA 3TP0A 1H9GA 1KYWA 5EJCA 1YRNA 3HGYA 3K1NA 1F9NA 5EGOB 2IXSA 3BJOA 5FD6A 3I59A 3OYGA 3GZNB 1D1AA 2PJRB 1DUXC 2VT2A 2LSOA 4B4CA 2P6TA 4MIMA 3QOEA 3GCMA 3GXOA 3C2HA 1R22A 1DQUA 4JQFA 2ZFWA 3SDGA 5L3FA 1HLVA 3V8KA 2NRAC 1LVKA 1L3LA 2JSPA 2ISZA 3FXKA 3F8MA 1VNDA 2XAQA 4O6JA 4WXDA 4RA2A 3ERED 2QA4I 1N77A 1U5TB 2TRTA 1D1CA 3BTIA 5EEHA 2W57A 2JK3A 4CCJA 4D9JA 5IYCJ 4KICA 3CD6I 3K2ZA 1X4OA 1XSXA 3SZTA 1TWHJ 1QZYA 2LLKA 3TMOA 5FRNA 1LE8A 2R5YA 4L9VA 4YIFA 2LTPA 3FIWA 1PUEE 3A0HC 1P7IA 4BXXJ 4G8XA 3FM5A 2PMZN 5LGNA 3KZIC 3I54A 1R71A 2VKHA 1HOMA 3F9KA 4ZYHA 1WRJA 1B9MA 1FPQA 3BJ6A 4D5FA 2K02A 2X1EA 3K4KA 4IHVA 1MMNA 2M45A 2JA8J 2JA7J 2VUMJ 1WH5A 3CCQI 2VKEA 2EJRA 3RYRA 1TTYA 1Z3YA 3TQNA 4ETSA 2M8GX 1S6LA 2J5OA 1ETWA 3E6BA 5DCFA 3ZOBA 2FQ4A 2WAEA 2CQQA 2DMQA 4GCVA 5FRMA 1Q1VA 2L7KA 5FKOA 2CUZA 3BZKA 3A02A 3WU1B 1BW6A 3BR6A 2HQAA 1JGGA 1MH3A 2KIUA 2VASA 4E7ZA 3OWTA 1APLC 3WHCA 3H5RA 1SVMA 1FBSA 2V7FA 1STZA 3OYNA 3S1QJ 1FLIA 3RDIA 2DPDA 3G71I 3KX2A 1R4MB 3RKXA 2WV1A 2A69F 5KHDA 5E1ZB 1B1BA 1Z67A 3MEXA 1FT9A 1W5TA 2M2EA 2OBPA 3VYSB 3WODF 2VODA 4A69C 3ZP5A 3DV8A 4E6KG 5K5QA 2HVRA 4EGZA 3W6VA 3SZGA 5FD5A 3VYRB 2COBA 5IOZA 4PK4A 1PVEA 1IXCA 2PMZA 5LEKA 3E6CC 3M4OJ 2JA2A 3IH2A 3I0TA 1YQAA 3BR0A 3I4PA 3ZXSA 3SXYA 5IP6A 3HG9A 3NWSA 2DA5A 2PX9A 2UV1A 2CYYA 4M3EA 1X1PA 2DLLA 2Y9YA 3K2AA 4R8HA 1TQPA 2BV6A 2LOOA 4RLQA 2E2IJ 2KZGA 2E1MB 2ACJA 1GV5A 3ZMZA 1XMKA 3W6KB 4M9XA 5M5YJ 3LOCA 2LVSA 3HGGA 4XLCA 1WJ5A 4AWXB 1W36D 3IAS2 3CF5F 2HR3A 1VQ7I 2V9KA 3BTLA 2VBWA 3RSNA 2MFZA 2JZYA 2IJLA 2VQHA 4ZDOA 4JOMA 1YX3A 3GFJA 2XROA 2FJ1A 2K9QA 5DCMB 2HS5A 2EV0A 2HQRA 1UCRA 5D8KB 4LJZF 2CFOA 1XGMA 4HV6A 4QWQA 2RVCA 1LVAA 2KJBA 5GP9A 1Q1HA 2LFBA 2F48A 2KRHA 2WY7Q 5FKKA 3TGNA 2IW5A 2ID3A 3CC4I 4G6QA 3S2HJ 3CMMA 2OTLI 3CCRI 3P9IA 4M6VA 1D5VA 3DPTA 3VOEA 2I10A 1TLHB 3P9CA 1OLTA 1QQIA 4A0YA 2X1CA 1E3OC 5F27A 1RKWA 1DDNA 3B73A 4I7HA 2XPVA 5B66C 1O4XA 2R7ZJ 4MEYF 1TWCJ 3SHFA 4OU0A 4A3IJ 1VTNC 4C2TA 4FE4A 1BIAA 2E7XA 2ETHA 3RYPA 4HA8A 1CQTA 4HDVA 1T56A 3W6JB 2CW0F 2FOKA 3OL3A 2NOGA 2DI3A 5K7HA 2NNYA 1DP3A 3CUOA 2WY8Q 4O5VA 4DGWB 1O57A 2AO9A 3MZ8A 4YIIA 4BL0B 3HZJA 2LF7A 1A5JA 4FQGA 4IL6C 5EDNA 2YX7A 2GLOA 2FMLA 3KYLA 4ZYDA 1WJEA 4KISA 2M4GA 5J3LA 5KCMA 1Y0NA 2K86A 5F6FA 1OYWA 4IHXA 3G73A 2PLYA 3F23A 2P8TA 3JSPA 3DEEA 1EKEA 5F04A 2CSOA 3ZMDA 4IF4A 4NDLA 4EV0A 4A6DA 3FXUA 3HRTA 3CCMI 4XSXF 3ELKA 2R5ZB 5E20A 4XLAA 3IL2A 3DPLC 3ZGKA 4R1HA 1MBEA 2YUSA 2DJIA 2IAIA 2KL4A 3GFIA 1BJAA 3FM3A 1YG2A 1LB2A 3WU2C 3ZQCA 1V54H 3EUHA 1HSJA 2XC7A 4ABZA 3J7YJ 3DTIA 1MDMA 2CQXA 3K0LA 1VQ5I 2A61A 3BP8A 1TW2A 2ZNZA 2ZSIB 3L7WA 2R7TA 1Y6IA 2JRMA 5BQTA 5H2FC 4CHUA 2VN2A 2EZKA 3J81Z 2BHYA 3AG1H 4L0ZB 4KIFA 1O3TA 2VQGA 1KU2A 2WADA 2O8XA 4DZPA 2VXZA 3S3OA 2WTEA 3ABUA 4LMYA 3M8JA 1LKXA 1X3ZB 2DMTA 1UHMA 1V4RA 2OQRA 3M8FA 1BIBA 3H3UA 2VBXA 4MFEA 1W7PB 2NXNB 3E7LA 2HPMA 3FWEA 2L7ZA 4I02A 1OKRA 4MO7A 4PJJA 4RM3A 2A5WA 4B8XA 4J01A 1W7PD 3SFZA 3HOVJ 1TP4A 3M9AA 2VE9A 4LITA 2IT0A 2X4HA 4B47A 4M3FA 5BNGA 5JLWA 4QPOA 5DV5A 4S0HB 3JW4A 2JVGA 3KZZA 3KZYA 3HPGA 4RGSA 5GAGJ 3BG5A 1YYVA 5J8FA 1QPMA 1USSA 1QZEA 2X48A 4YIRX 1S5LC 5EG0A 2BVMA 3K4MA 4AIJA 4EGYA 4ASNA 3KP5A 1K7AA 1V5FA 3BROA 3FXLA 4JP0A 5DUIA 1XGSA 4RGUA 1KU7A 2F4OB 3EQLF 3CUQA 2RREA 1WSUA 2YPRA 2P7CB 1R9TJ 4GYIA 3GEZA 5J1UA 2OZ6A 2QVOA 1JKQC 4HAMA 3DP7A 2XHKA 1BC8C 2ELJA 4XRSA 2E5ZA 2V1XA 1FZPB 2B7EA 2HVSA 2DA6A 3OMYA 5ERIA 3DEWA 4EM2A 2CW7A 1HQCA 5KNLA 4Y52J 2UXNA 2E2JJ 3QYEA 3KYCB 2GA1A 3QRFF 4EJOA 4KN4X 5FFZA 3VFZA 3CF2A 1AOYA 3KLOA 3CCEI 1E2XA 4XLNF 3RKQA 2LKXA 1BW5A 4XONA 1WHUA 4WCGA 2A07F 1ETYA 4BQAA 3T8RA 1JT0A 4PFPA 3LQQA 3MWMA 2EINH 1LFPA 2VPRA 2W48A 4XRMA 3KFWX 3HHHA 1D0YA 1Y39A 1PP7U 3HTSB 1BJZA 2FBKA 1Z21A 1KA8A 4WXCA 5DCMA 3LNQA 1WJCA 4OIQF 1LFUP 3B6CA 3RPUA 2YX4A 2ZMEA 1ZAOA 3MD2A 1H0MA 3PO2J 3TOAA 2M7BA 3JRHA 2D1VA 2O0YA 2L9RA 3K4BA 2OD5A 4NC6A 2CH0A 2DQRA 1ACIA 1W5SA 1W7PA 5DUKA 5H6QA 4MTDA 1VQ9I 1GXPA 2RQPA 4FX4A 4KFCA 2NS7A 2K7LA 2M87A 4B1RA 2H27A 1V55H 1T8IA 2V79A 3OOUA 3U21A 2D5VA 3U9GA 1HXDA 1RUNA 4GGGA 1ITYA 1QRYA 4XNFA 2FX0A 2HZDA 1DU0A 3T0YA 3BCBA 4YEJA 2VC0A 2UXXA 3MFKA 4IQ4A 3WTTC 4PJMA 2MBFA 1IRFA 2A6TA 1W36C 2AQEA 2P6SA 3ZQFA 3AAFA 2Z3YA 3LSHA 2WAQN 3CDIA 3F8FA 4BKXA 4A3MJ 3LQRA 4LD5A 1ZELA 2ELHA 2XAHA 2MG4A 4EM0B 2V6CA 1RPWA 1FIPA 3I9V2 1U78A 3OV8A 5K5OA 2MC3A 3GFLA 3CO6C 3EYYA 1XDSA 3CMYA 1CF7B 1IV8A 2KMUA 2YSRA 5IY5H 2L54A 2CQNA 2RKHA 2ZKZA 2Z16A 1AKHB 3CJQB 1RUOA 1LDKB 1P4AA 2R7DA 3R61A 2R7WA 3P7NA 5D5VB 2QQBA 2VQLA 3WGHA 2HXIA 1L0OC 2BYVE 4IO9F 3PUBA 3A2KA 3O6BB 4XK4A 3E0JB 3PIOF 2FSWA 3FZVA 1LEBA 2CO5A 2MLKA 1JHFA 4B48A 2R7QA 2DTRA 2BVLA 3FK6A 4QIWN 1UELB 2N8GA 1MH4A 2AS5F 1Z7LA 3HB9A 3LSGA 5EGOA 2P7VB 4OIRF 1SD5A 3KP2A 4XRFA 1J09A 2HOAA 5HLGA 2R93J 3DTEA 3HSEA 3TDUC 4EEFG 4Y7NJ 1NG7A 4EMSA 1NK2P 3KIOA 1OCOH 4LG3A 3ZQQA 3GW2A 3PM1A 2R4GA 1SFOJ 5H6RA 2RNGA 5LHIA 3B02A 1I1SA 2JPCA 1C0WA 1D5YA 1JI8A 4EATA 2LD5A 3KP3A 2CW8A 1HW5A 2YU3A 4MFDA 1X3UA 2P81A 2IGKA 4OAYA 4BE2A 1ZR4A 2CS3A 1HKSA 5GTIC 5BPDA 1BM9A 1GVJA 1J2XA 2XAFA 4II2A 1HA8A 1IO2A 2MD5A 2LKSA 3LAJA 3I4MJ 3BC8A 5DM6F 5B1BH 4A3JJ 5A2QK 1YITI 2B63J 2ELKA 3FXMA 3OY9A 2L7MP 3OL4A 1ZGWA 3JRIA 1O7LA 2PQ8A 2LK2A 2UZKA 3BTJA 4PJ0C 1XMAA 3KCCA 4I01A 3OSFA 4F52A 2HOTA 2V9PA 3NWTA 3PNYA 5FGMA 2FMYA 2FE3A 2RV8A 1WJBA 3CMEI 3LSPA 1SC7A 4M73A 5F64A 4IKFA 3BQYA 4BY1J 3D5RC 4G9YA 3IRRA 2UWMA 1T08B 2ESHA 2VT3A 1FTTA 2DCEA 3AG2H 3ASNH 3NRVA 2DOEA 4I0BA 1G3WA 4CGZA 1S7AA 4IX7A 4IPAA 2XGEA 2WV0A 2ZJ2A 1ZYRF 2R7SA 2BE5F 3G6EI 2DXIA 1SFUA 3WTXC 3AG4H 5M5XJ 3HKZA 1ZLKA 3TP3A 5M5WJ 1HDDC 4Y13A 3QODA 4KA4A 4BDZA 4PCQA 3BPVA 3CCJI 3T1BA 1KZHA 3HOYJ 1LPQA 3CO7C 3I64A 2NVXJ 3OS2A 4MQ9F 1U5TC 3ONQA 3OYAA 1DGRM 4E7LA 1R4NB 4IRGA 2P5VA 2VBZA 2FRHA 5JLXA 2GAUA 3WE2A 4AU7A 5L3BA 5F1RA 4WK8F 4CH7A 1OCCH 2XV4S 1V5GA 1F1ZA 2XIGA 3UR3C 2A68F 1BC7C 3LSKA 4HBLA 4CYDA 5D8LB 1ETXA 3NARA 2RQQA 5C44J 3LSTA 4OMZA 1ZARA 2OZUA 3I59B 4HW0A 3S1MJ 1GT0C 2L5QA 4C3IJ 2BGCA 4E7IA 4O3MA 3S3NA 2NVUB 1GUUA 3W2VA 5HDKA 1ZRDA 4I09A 4F91B 4C2UA 3JRCA 2K85A 4I99C 4KDPA 5F0FA 2QM3A 1PP8F 1T98A 3OYJA 2M7AA 1X58A 4EJVA 5LHGA 3AL0C 2HI3A 4GYGA 2M5WA 2QSFX 2XAUA 4OWRB 2YU9J 3K1MA 9ANTA 1OR7A 3R60A 3S14J 2KQRA 4LG0B 1ZKGA 5D5XB 2AXLA 5FLMJ 3GX4X 4CCOA 3FK7A 3C2BA 1T0FC 2ECCA 1I50J 1BBYA 5JI6A 1S8NA 4EM1A 4C30A 3QYBA 3RPQA 1YHQI 2ZJQF 4CICA 4V2GA 1K83J 1PJRA 2HEOA 2HDWA 2QSHX 2PJPA 1PYVA 2EA2A 4L9NA 1G2HA 4WWCA 3IWZA 5H20A 3V7SA 3LL7A 5ICCA 3DU5A 2KLOA 5CLSA 1K78A 1Z6TA 3VSLA 4UUSA 2IS1A 2M4KA 4AIDA 1CGPA 4XIDA 2MC4A 4XKCA 2VOOA 3K4CA 4Z6YA 1B72A 2GA2A 3I4NJ 2V26A 1K6OA 3TKYA 1SAUA 4LLGF 1G8XA 3MKWB 1SFEA 2XAJA 5C4JJ 3KEOA 1TWAJ 4MTEA 5EF6A 3CC2I 3ABLH 5HLHA 4PGGA 1Z3XA 4BBSJ 1X19A 4MGRA 1SFXA 3V8JA 3RPUD 4BXFA 1X4PA 2Z1DA 2V1UA 1TWGJ 4G94A 2V1NA 4BGDA 3S16J 4Q4ZF 4KUMA 3W2WA 5HNFA 3HBLA 2D2WA 4PJLA 1VQ8I 3H0GJ 4U0YA 2KZVA 5DD8A 2STTA 3E97A 3BT9A 4AM3A 2EQRA 4AC0A 4DQ2A 5IYBJ 4U0VA 2DAOA 1WKMA 2MA3A 2EIKH 3VB2A 3CESA 3WTZA 3F6OA 2HNHA 2R7VA 4ANJA 4ZJZA 2BEOA 4ITVA 5KK1A 1OMIA 1EF4A 2IRFG 3HOTA 1VQOI 3Q3SA 2O6GE 2DOAA 4XN0A 3BQZA 1YW7A 1TT5B 3DU6A 3DPUA 5DD4A 1UJ8A 5C3EJ 1MNDA 4RMNA 3G1LA 3DTKA 2EV6A 1TT0A 1ULYA 1D0XA 2H94A 5TRDA 4S05A 1T2KA 1K4TA 1J7KA 2GIVA 2KFDA 1W1WE 5F08A 2XSJC 1YW9A 3TO6A 4Q47A 3CTAA 4EVIA 2LYCA 4DNCA 3MMYB 3L9FA 5K5RA 1R1VA 4LK1F 2NS0A 2VKVA 1FSHA 2R7OA 3CCLI 3ECHA 3T5XA 4CZZA 1RIOH 4GFBA 4BYYA 3RCOA 3SDBA 4A3FJ 3JREA 1D8JA 1XSVA 5E8IA 1R5GA 3OYLA 2PG4A 3CZ6A 4XKVA 4HF2A 5ILVA 3TEDA 2KDZA 1AHDP 2W85A 2ID6A 3FXQA 3H35A 4RAFA 3C3WA 3S3MA 2JMWA 3RKYA 3JCUC 2E60A 4QPQA 1P4WA 3JTHA 3G1MA 1XS9A 1M1EB 3HXLA 1FX7A 2ZB9A 5FKNA 2XF6A 3MKLA 2M1BA 4LB6B 3SYTA 1TNSA 2XF7A 3OIOA 1HF0A 1ZRCA 4QLCU 2VJJA 2W24A 3RI4A 1BL0A 1MBFA 2GXBA 3HUGA 3M1CA 1R49A 4GXOA 2M0MA 1IDZA 3I53A 3L00A 3GVAA 1BI1A 5AONA 4D1QA 2DA2A 2K3PA 3K70C 2EPFA 3QWLA 4YELA 2DFFA 2MW8A 2JRTA 2CG4A 2GM4A 3FKJA 3S17J 3DKYA 2LDUA 4P1WA 4NNJA 5GPAA 3DBLB 3FMQA 2H1LA 4HYEA 4S04A 4BH9A 1BOBA 2IGNA 4I6ZA 3FX3A 4D7MA 2EA4A 3HOXJ 1Z6RA 1YI2I 2M9HA 4KMUX 1FOWA 3WG9A 3L1PA 2STWA 2QBYA 3WTSC 3L09A 1B72B 1MIJA 1BR4A 2GQQA 2JPBA 1Z91A 2OQGA 4OINF 3QPLA 2PI0A 2R7FA 4B3AA 2VJ4A 1IN4A 1XG1A 3I5UA 3UKGA 2QLZA 2A5YB 4M3BA 1DPRA 4DBRA 3M1EA 1XDUA 5LHHA 2ZXJA 4UUVA 1E17A 1LFBA 3E5XA 3BG7A 2VPLA 2FD5A 4XLHA 1BN5A 1FC3A 1XX5A 2K9LA 2G0EA 2E5NA 4D7NA 1SMTA 2CV1A 1Z7UA 1EH6A 4A0ZA 3J80K 1IJWC 3ZR8X 4RAGA 3PFYA 3ESWB 3U2RA 2ZXWH 4F55A 1HC8A 1YO5C 4XKWA 1FOXA 1XMXA 2O7OA 5TGTA 1J5YA 4DYQA 1A35A 1FNNA 3HSFA 4UHTA 3LAPA 3BLYA 3CP2A 3MZYA 3IKTA 4IOCF 3E6DA 1IZ1A 4NC8A 3VSKA 1YX5A 2KT0A 4GRIA 4BAYA 5IOYA 4ENKA 1U0JA 4B09A 3BCAA 3V8LA 3BDDA 4LFUA 4G7OF 3TDZC 3O3KA 4HDUA 3QOPA 4MQVA 4FHTA 3RQ4A 2O9LA 1KYZA 3DKWA 1OQYA 1JJ6C 4P9UA 2G7HA 2Y0MA 5E17F 3ZMUA 3C7JA 2WC2A 3HTUA 4M3DA 1JGSA 1JUSA 2Z5UA 4KN7X 2Z9OA 1RZ4A 2QGUA 3L2CA 1RNLA 5CKTA 2F6CA 3F22A 2HDCA 1BI3A 5BPIA 4JK1X 2E1MC 3HL2A 3OR2C 1GLNA 4DYRA 2JA6J 3S1NJ 4AYBA 2KIQA 3WU0A 3BTCA 4G7HF 3BR5A 5BMZA 2W25A 1ZG3A 1FTZA 1B59A 1B9NA 4A3KJ 4ON0A 3GUDA 4FCYA 2ZXIA 1W4MA 2TCTA 2L4AA 2EK5A 3IP4B 3JAMZ 1TQIA 3E1SA 5DDGA 2NS8A 4F7ZA 3S2WA 1R36A 1W5CC 3LA2A 4UUTA 4BACA 4FTHA 1CF7A 4A2UA 2EILH 3J7ZI 1VQPI 1X1CA 5ICEA 2ME0A 4DYCA 1S7EA 5IT9Z 1R00A 3Q9SA 3R4KA 2CUFA 1USTA 5HNHA 2ZJPF 4E7KA 3COAC 1O3RA 5CVIA 2FUG2 2EFWA 1A6QA 1P4XA 3QP5A 5B1AH 5GAEJ 2OJED 3HJEA 4L5JA 3GTKJ 3RZOJ 1XTAA 3CP8A 4XICA 3EPZA 3CCVI 3OYMA 4Q5SF 4BUPA 2KHMA 3PFIA 2DPUA 2ZBKA 3JRBA 2WB1A 2BZTA 4X1EA 1MGTA 2MABA 3N4MA 4CA0A 2VXDA 5JR3A 3LSJA 3UNGC 3T8TA 3OYIA 3J7AO 3HKZN 1FY7A 3PO3J 5FFXA 3SFIA 2DT7B 1Y8RB 1H88C 2EZIA 4BNCA 2HOSA 3EUHC 2X9DA 2VKDA 1N25A 4PDKA 3HOSA 5L3CA 5EZHA 2ECBA 3AL0B 2L4MA 1ERDA 1AU7A 2E35A 1I3AA 4P55A 5CPRB 2DT5A 2EZHA 4CYCA 1ZG5A 1KONA 2CFXA 2XRNA 4G6TB 4C2MJ 4CUGA 1DU6A 2XPUA 1PUFB 3ZN1A 3CDHA 2X1DA 5CVJA 2IA1A 3EYIA 3SQNA 2K27A 4UVCA 1YTYA 1REPC 1SD7A 4OIOF 3O8GA 3J7AY 3BG6A 3RIRA 2VE8A 1RETA 2HKXA 3L2WA 2B0LA 4CCMA 1EJ9A 1RC9A 3QP6A 1UHWA 1R7JA 4HNVA 2DFHA 1T0FA 4HLYA 2DK5A 3SJMA 1ON2A 4AIKA 1LQ1A 3REOA 2V4JC 1FOKA 1IXRC 2M8EA 1UMQA 4UXNA 2DW4A 5JVGF 2P4WA 3I56I 5M3MJ 4DJAA 3GTMJ 2F5EA 1MMSA 4PUSA 1QPIA 2NYXA 2CV2A 3CMAI 2OF7A 1T33A 3N97A 1IF1A 1IAWA 4HSTA 3WGGA 3KE2A 3LFKA 3K70D 1ETOA 4A12A 2O03A 3ZQIA 4R79A 3I71A 1I27A 4KMFA 2DU9A 2JUCA 2HWVA 1TL8A 1NTCA 3CJNA 5J6XA 3F8BA 2Y9ZA 4RM2A 1FMVA 1SVOA 1VI0A 1GXQA 3EETA 2P5KA 1OYIA 3L2QA 4YFXF 4RBOA 1K78B 5F0CA 1VZ0A 3V7RA 1JUMA 1VFCA 2IVMA 5HODA 3PL8A 2OA4A 4XQFA 2PEXA 1YIOA 1OPCA 1QVTA 4HX8A 1B8IA 3WTUC 2EFQA 1SFKA 1Y56A 1H89C 3ABKH 1JKOC 2VB6A 3NEUA 1FSEA 3FKIJ 2HVQA 4KIBA 2HYGD 2MH9A 4M6XA 1YOVB 3R6SA 2JVHA 3IV5A 4IHSA 1I5ZA 1JJ8C 3HOUJ 1X2MA 3K4LA 2K9NA 5GTHC 4GO1A 4JX6A 2XKOA 3J81K 2RN7A 5GPCA 3I55I 2ZMEC 1WJAA 2WA0A 1I3QJ 3VYTB 1JKPC 3GTPJ 2MLGA 2C6YA 2KIFA 1MW7A 3E5QA 3BJAA 2F2EA 4G12A 2E1NA 2CRGA 4BE1A 1IC8A 4Y17A 4HQMA 2CV0A 3LA3A 2H8RA 3IUOA 4A3CJ 1MJBA 5E18F 1UFMA 2EFOA 3ZMVA 5E3OA 4BQQA 3WG7H 1IW7F 2XF5A 2F5VA 1RR7A 5HS9A 1Y1WJ 1F43A 1HKTA 3QU6A 3F6VA 2LH9A 1RKTA 2WB1N 1YIJI 1N78A 1R23A 5D4SA 2ZC2A 2XSDC 3CLQA 4RGRA 1AWCA 1OCRH 1WPKA 4UNOA 4BDYA 3M3YJ 4Q48A 1IN8A 1G59A 3PJRA 3ZPLA 2XGXA 3AKZA 4EJTA 1IRZA 3G1OA 2IS6A 4M6YA 2VJ5A 2L3DA 5KAIC 2BY1A 3WTWC 1VQNI 3TL4X 1MSFC 3ABMH 1ZN2A 5E3MA 5TJJA 3Q5FA 2HU9A 1R5HA 1NK3P 2LR8A 3H9QA 2KISA 3HOZJ 2K5CA 5LEJA 3Q0VA 1T38A 1HW2A 2VI6A 1S29A 5JHFA 4CZCA 1B6AA 1XN7A 1P6RA 2BY2A 2ME6A 3HDDA 1S3JA 2DBBA 2QCOA 4FISA 1IV6A 2DDBA 4PFOA 2X6WA 2DMNA 4RB1A 1JE8A 4CCKA 1PDNC 1U6GA 3S15J 5D5WB 4KT6A 1P92A 2M3AA 4ZZLA 2ESNA 3RQIA 3ZMSA 4KNYA 4LOCA 3MQ0A 2ICWG 4XM3A 4K2EA 3HUGB 1OR7C 2KRCA 3SZPA 4F93B 5IPAA 1TBXA 2MSYA 2JWTA 5F0HA 1YJ9I 2V9VA 1X1BA 2F5DA 4PZJA 2CQ7A 3MN2A 2M0CA 3PUFA 3TW6A 4BE0A 4ZTFA 3GZ6A 5J1YA 1O3QA 2XVCA 1FJLA 1WI9A 4U88A 3CUQB 3ULQB 2W00A 1YFHA 2A3SA 2Y2ZA 4H0EA 4G6DA 5HOOA 2GXAA 2CQKA 5L3DA 4XBFA 3HPHA 3M07A 5J8CA 1UB9A 4EJUA 3FDYA 4BEHA 4A93J 4UVBA 4ESFA 3OYBA 4DW6A 2HGCA 2LY1A 5FB2A 2RAEA 1KU3A 3G3ZA 2VBYA 3F3XA 4NQWB 5J4VA 4XSZF 1GV2A 3GWZA 3I58A 3CCYA 3OYEA 1KGSA 2L9SA 5CQEA 2KKOA 2QENA 3ML6A 1XCVA 3GMEA 3PQJA 4LIVA 4J00A 3ASOH 1QU3A 1U9OA 2IA0A 1ZRFA 4FETA 4ZH4F 2I8DA 4L5IA 4X0GA 1FMWA 1Z9CA 4M9SA 4HF1A 2LBFB 2DMUA 3ERMA 4Y4RA 4ZDLA 4RLFA 3TBIA 2L02A 3FISA 4HNTA 5JVTA 4XN3A 4OIPF 5E1XA 1P2FA 2LF8A 2CWEA 3FXJA 4HPQA 3HYIA 4F92B 4CSWA 2Y48A 5LLQA 4Y15A 3C18A 2RNJA 3DXJF 1SVLA 3IKVA 5ICGA 5FJ8J 1T39A 1IRGA 4ENJA 1MBHA 2H8WA 1Y8QB 3BOQA 3JTGA 2R7UA 4FX0A 4H4KC 3F8CA 3GZ5A 4AYBN 1QBJA 3GLLA 1MBKA 2IPQX 3K7AJ 2R3SA 4I76A 1EA3A 2XB0X 4LIUA 3OIPA 4UY8I 5EZGA 5J1RA 2XDVA 2DFEA 3IAM2 2E7WA 1BI2A 1UHSA 3G2BA 4ENMA 1QHGA 1P9QC 2JA5J 4LG0A 3IH4A 2K9MA 1FBQA 1E3PA 1WJFA 4XOTA 5LRSA 1ZGJA 5CQGA 3H1CA 4YG2F 3GTLJ 3KLNA 4NB5A 2V6EA 1FYKA 4MNUA 1ENHA 3KYDB 3GTGJ 1YLFA 2HKOA 1DGWY 1QGPA 4JBAA 3K4NA 4P5OA 1KQ8A 4IHTA 2L9VA 1F4KA 3K4JA 2KJCA 4ZZDA 4RAYA 5FKMA 1HKQA 4OMYA 1LJ9A 2Z2SB 5CYVA 1IRXA 4V19K 2O3FA 3TOBA 2O8KA 3QPHA 1QA6A 4F3QA 3LFUA 3MKYB 3K69A 2KP6A 2Q8KA 1BR2A 1D0ZA 5L3EA 2ZSHB 2CUEA 1G3SA 2JT1A 1SMYF 4V2FA 1LE8B 2XKPA 2HTSA 3WE3A 4UB6C 3OYFA 2Q0OA 4RB0A 4A3DJ 4DBQA 5HS7A 1XGNA 3FHZA 1J0RA 1TC3C 4A3EJ 1ORKA 5AIPA 2Z33A 2AXTC 2DA1A 3HRMA 5CVRA 5HVQC 4CCLA 2FBIA 1IN6A 3QPTA 3X2QH 3U1DA 5K7FA 5DYMA 3VWBA 4HV5A 5ICFA 3QYFA 1ODDA 2FXAA 2HPIA 5LRRA 4U87A 3DLLF 2ZNYA 4E7JA 4FASD 4XLPF 1JUPA 1OCPA 2FU4A 3HEFA 2WAQA 1NH3A 4BQOA 1HW1A 4BJ6C 1FOYA 4IJAA 2A6HF 2XB5A 3FF5A 4C3HJ 3P9KA 1QZZA 2GBYA 4HQEA 2EBIA 5B5EC 1IN5A 1FYMA 3A1YA 1LDDA 2FNPA 3DBHB 4P96A 4L9TA 3ZQLA 1AKHA 2HDDA 2LREA 2BXYA 3FMSA 4QTRA 1SEUA 5D6EA 1YW8A 4U7DA 4GDFA 4RGXA 1ETVA 3V4GA 1KU9A 3IH3A 1HBXG 4N0BA 1G6NA 2VL8A 4PJNA 1FP1D 1TWFJ 2X85A 2IA2A 1KQ0A 1K61A 4W97A 5HDGA 2DN0A 3W3CA 5B3SH 1A6IA 4ENNA 1UAAA 2MYSA 2IS4A 3GLXA 1VF9A 4ZDPA 4NC7A 5D4RA 3WGIA 3ZQHA 3CDLA 3D5SC 1MNMC 4ZYEA 2NVQJ 4XL9A 3PIPF 4RB3C 3NQOA 4PGHA 5GAHJ 2DDAA 2LRDA 3D1NI 2OAZA 3BWGA 2Q1ZB 2R92J 4BHCA 4TV7A 3M8EA 1S72I 3K9TA 4LK0F 3J80Z 4X6AJ 2QEXI 3QU3A 5EG0B 2LP0A 6PAXA 3H0DA 1RI7A 3G4SI 1EH8A 2WAFA 2FNAA 4P9FA 3E6MA 4N4NB 4AVPA 2E34A 1R58A 1R1UA 3V42A 3HHGA 2JTVA 1IDYA 4XMYA 4I0AA 3PNVA 3OS0A 2Y0SN 3SEQA 1ZGAA 4JX5A 4BS9A 3VPRA 2VLAA 4IHYA 3RJPA 4CYCB 1FBUA 3HRUA 1JTXA 1YE9A 1WH7A 3FBNB 1JKRC 1K4SA 3GYHX 1MMGA 3KP4A 3OSGA 1S9HA 5BOXA 4YFNF 3A01A 2RC4A 1MJAA 2VOPA 1JHHA 2DTZA 3CLOA 1VQLI 5ILSA 1MNEA 2H1KA 3PSIA 4HG2A 2LNBA 2R7RA 2X6XA 2IGOA 4BY7J 2KPMA 3C2GA 1G3TA 2EH3A 4IEJA 3TO7A 5IP7J 1YRNB 1J59A 3CJTB 3MVPA 4N9HA 4G7ZF 2DK8A 3V7CA 2DOFA 3R0JA 2BY0A 5J4YA 3F72A 2ADUA 2O5RA 3A0BC 3VDXA 2ZJRF 3HM5A 1Z77A 4BJ5C 2QWWA 3BG9A 3H3ZA 3BR3A 1BR1A 2QKLB 1ON1A 5CVVA 4MLOA 3JRGA 2DYRH 2XAGA 5FKLA 4U7BA 2L0KA 1J9IA 2VJIA 2X0LA 1A31A 1SANA 3AFHA 2PBIA 4E70A 1HDPA 5IT9K 4ZYGA 3ABTA 2EIJH 3VYUB 3M7GA 1D8KA 2BXZA 4JYKA 3R0AA 5LGUA 3BY6A 4M74A 2E71A 2K4BA 4ESBA 1FEXA 5GADJ 3OYKA 1W0TA 1ZLJA 4BHPA 4B43A 1TW3A 5TISC 1LDJA 3DLAA 3LWFA 4L0YB 1YJWI 1MBJA 1DP7P 5FLVA 2YR2A 4BQNA 2PJRA 2K3FA 2DFIA 3DBRB 3OIQA 5EEGA 2R7XA 2BOLA 1XSDA 4WXHA 2QZ8A 5L3GA 2FEZA 1X1AA 1IGNA 2LMDA 1WCMJ 5J40A 4BBRJ 1X2NA 2QQ9A 4HSRA 5IP9J 5DS9A 1OJLA 3CJRB 3EDPA 3PSFA 4Y33A 4UUSB 2VIXA 3O2PE 2MD0A 1SAXA 3L2UA 4HOBA 3GFMA 1UZCA 3GO5A 2XASA 3H9GA 1S7OA 2OTJI 2I5UA 4N9IA 5FO5A 2PMUA 2GOXB 3S2DJ 3GBGA 3AG3H 2BBYA 2NVTJ 1OFCX 4LLNA 3DFGA 1B4AA 1QVUA 2F5FA 4LGWA 2X6OA 4IQJA 2LG4A 3H9JA 5D5UB 2EV5A 2WBMA 3HRSA 3ZRGA 3GTJJ 1FIAA 5FLXK 2DJNA 1K6YA 4QSHA 5CJ9A 3BZCA 5DTDA 5E3NA 2PN6A 2R0QC 5LBQA 3WTYC 1JT6A 5EEAA 5K7ZA 4MHGA 2JQ7A 2Y69H 1MD0A 2G7UA 3EUAA 2QQ8A 1AA7A 2DMPA 1MMDA 5E3LA 3DQVC 1WGXA 4A3LJ 2W1OA 2NNNA 2P0WA 4I98B 1P7JA 1EV7A 1R5ID 5HDNA 1E3HA 5HS8A 1W0UA 4EQQA 2PMHA 3K1PA 3ZQ7A 2PFBA 1X3WB 1IN7A 2FQ3A 1XD7A 1Y1VJ 1ZHFA 3SEZA 5A2QZ 4EJWA 5C4XJ 5KVRA 4WF2A 2O61A 5HLIA 2IEKA 4XORA 4AVZA 2EB7A 3QAHA 2HOEA 1IUYA 1D3YA 1BI0A 2HFHA 2Q2EB 4IHWA 1RRJA 3IC7A 4HNUA 3JSOA 2D1HA 1XCBA 2JJ7A 3QPSA 1POGA 3F0CA 4BEHB 1V5EA 4IZZA 3KETA 2Z99A 4IVNA 1QO0D 2KDOA 1HSTA 1X1DA 2JSCA 4MEXF 3JAMK 2LKPA 3IWFA 3JR9A 1VQKI 4ZTJA 3MKZA 2E2HJ 3S32A 3K6GA 1H8AC 1T95A 1V3FA 1G4DA 3EUKL 2GIZA 3CQZJ 4M3GA 1LEAA 2A6EF 5JFRA 1MKMA 4HX7A 3E3VA 1XB4A 4HX4A 2HQNA 4XKBA 3FXOA 1U5TA 1XC5A 2DODA 1U8BA 2L2OA 3LA7A 4WX9A 4E7SA 1U3EM 2HXOA 1YS6A 2VC1A 2W4SA 3GF2A 5FLXZ 4KJZA 2X6YA 2CGPA 2COMA 3FMRA 3A03A 1UG2A 2OPTA 2VONA 5LGTA 3BG3A 4NUBA 2M34A 2F5CA 4N4OB 4XRSG 4IOAF 4W1UA 1TQMA 2GWRA 2R5ZA 4J19A 2JUGA 1FP2A 4XR6A 3HOWJ 3KEQA 4AIHA 3TW7A 1OCTC 2OU2A 4RAZA 3ISPA 4ZYAA 4A3BJ 3HC7A 2MH2A 4BHBA 1IUFA
chains in the Genus database with same CATH topology
4FT8A 2HZTA 4M9ZA 2HTJA 1J75A 3D0SA 4MEXF 1F5TA 2RDPA 4CO8A 2D45A 1SD6A 2KIMA 3ZMTA 1XGOA 3C1DA 1R1TA 2H6BA 2QYOA 4A5NA 3DF8A 1DPUA 5E1WA 1KQ9A 4IRIA 4UV9A 3VEPA 1A04A 2GXGA 3ECOA 1G3YA 1MZBA 4KYWA 4KT5C 4RB2C 1YS7A 3MZHA 3CUQC 3BPXA 1ZREA 3MCZA 3RKWA 4A5MA 1MJ9A 3HSRA 4LB5A 2GZWA 4HZFA 1SD4A 2V1DA 4LLLA 4UVAA 2IP2A 3H92A 1I1GA 2G9WA 3F8NA 2EFNA 4M71A 4L18B 1GHCA 2DO7A 3IHUA 2QBYB 1FWZA 5E8GA 3WTVC 2XUBA 3D5LA 5CVUA 3RTRA 2J5PA 1O3SA 1WWXA 1IXSB 4CDGA 1TNTA 5DEQA 2EFPA 3TO9A 3F21A 3HIFA 3PQKA 2RGVA 2L01A 4UV8A 1T6SA 2NAZA 4A0XA 4YFKF 3IRQA 3OOPA 2P5LC 5IT3A 2FF4A 4ESJA 4IRHA 4HLXA 4IXAA 1FYLA 2QQAA 2M30A 1Y0UA 2E1CA 1NHAA 4U0WA 1JXSA 1WQ2A 3Q9VA 2WWYA 3DEUA 1U2WA 5ILUA 4OOIA 2H6CA 1ZH5A 5D6FA 4AD9A 4CXFA 4HF0A 1OYYA 4Z2YA 4I2OA 2K4JA 2FA5A 2HYFA 2ZO4A 3ZN0A 1U8RA 2ZMEB 4NQWA 1Z05A 4L9JA 3E5UA 5ED4A 2KRFA 4D0PA 1QNTA 1EH7A 2H09A 5K1YA 5BS6A 3VODA 2FBHA 2Y75A 4M72A 1MDMB 3MAJA 1Z1DA 2ZCWA 4RS8A 4NHJA 1O7FA 5AIQA 4KIGA 3KP6A 3KP7A 4BXUA 1ZG1A 2DQLA 2TDXA 2W84A 2QUFA 1LNWA 3BZ6A 3ROUA 5JHUA 1H9TA 2ISYA 2Q2EA 4A6EA 1K79A 1BOAA 2EWNA 3FXRA 1I6XA 1ONVA 1H9GA 1KYWA 3K1NA 1F9NA 3BJOA 5FD6A 3I59A 1DUXC 2VT2A 2LSOA 2P6TA 3GXOA 1R22A 4JQFA 2ZFWA 5L3FA 2NRAC 3V8KA 1L3LA 2ISZA 3F8MA 2XAQA 4O6JA 4WXDA 3ERED 1U5TB 5EEHA 2W57A 4KICA 3K2ZA 1XSXA 3SZTA 1QZYA 4L9VA 4YIFA 1PUEE 4G8XA 3FM5A 5LGNA 3I54A 4ZYHA 1WRJA 1B9MA 1FPQA 3BJ6A 2K02A 2M45A 2EJRA 3RYRA 1TTYA 3TQNA 4ETSA 1S6LA 2J5OA 3E6BA 5DCFA 4GCVA 3WU1B 2KIUA 1FBSA 1STZA 1FLIA 3RDIA 2DPDA 3RKXA 2A69F 5E1ZB 1B1BA 3MEXA 1FT9A 1W5TA 2OBPA 3WODF 2VODA 3ZP5A 3DV8A 5K5QA 4EGZA 5FD5A 1IXCA 5LEKA 3E6CC 3I0TA 1YQAA 3I4PA 3SXYA 2CYYA 2DLLA 4R8HA 1TQPA 2BV6A 2ACJA 3ZMZA 1XMKA 3W6KB 4M9XA 4AWXB 2HR3A 2VBWA 2JZYA 2IJLA 3GFJA 2XROA 5DCMB 2HS5A 2EV0A 2HQRA 1UCRA 5D8KB 4LJZF 4QWQA 1XGMA 4HV6A 2RVCA 1LVAA 2KJBA 1Q1HA 3TGNA 2IW5A 4G6QA 3P9IA 1D5VA 3DPTA 3VOEA 1TLHB 3P9CA 1QQIA 4A0YA 1DDNA 3B73A 4I7HA 4MEYF 3SHFA 4OU0A 1VTNC 3RYPA 1BIAA 2E7XA 2ETHA 4HA8A 4HDVA 3W6JB 2CW0F 2FOKA 2DI3A 2NNYA 3CUOA 4O5VA 1O57A 4YIIA 2LF7A 2YX7A 2FMLA 4ZYDA 2K86A 5F6FA 1OYWA 3G73A 2PLYA 3F23A 2P8TA 3JSPA 2CSOA 3ZMDA 4IF4A 4EV0A 4A6DA 3FXUA 3HRTA 4XSXF 3ELKA 5E20A 3IL2A 3DPLC 4R1HA 3GFIA 1BJAA 3FM3A 1YG2A 1LB2A 3EUHA 1HSJA 1MDMA 3K0LA 2A61A 3BP8A 1TW2A 2ZNZA 3L7WA 5BQTA 4CHUA 2VN2A 3J81Z 4L0ZB 4KIFA 1O3TA 1KU2A 2O8XA 2VXZA 2WTEA 3ABUA 4LMYA 1UHMA 1V4RA 2OQRA 3M8FA 1BIBA 3H3UA 2VBXA 1W7PB 3FWEA 4I02A 1OKRA 4B8XA 1W7PD 3SFZA 3M9AA 2VE9A 2IT0A 2X4HA 5DV5A 3JW4A 3KZZA 3KZYA 4RGSA 1YYVA 5J8FA 1QPMA 1USSA 4AIJA 4EGYA 4ASNA 3KP5A 1K7AA 3BROA 5DUIA 1XGSA 4RGUA 1KU7A 3EQLF 3CUQA 1WSUA 2YPRA 2P7CB 4GYIA 3GEZA 2OZ6A 2QVOA 1BC8C 4HAMA 3DP7A 2XHKA 2V1XA 1FZPB 5ERIA 4EM2A 1HQCA 2UXNA 2GA1A 3QRFF 4EJOA 4KN4X 5FFZA 3VFZA 1AOYA 3KLOA 1E2XA 4XLNF 4WCGA 2A07F 4BQAA 3T8RA 3LQQA 3MWMA 3KFWX 3HHHA 1PP7U 3HTSB 2FBKA 1KA8A 4WXCA 5DCMA 4OIQF 3RPUA 2YX4A 2ZMEA 1ZAOA 1H0MA 3TOAA 2D1VA 2O0YA 2OD5A 2DQRA 1W5SA 1W7PA 5DUKA 5H6QA 4MTDA 1GXPA 2RQPA 4FX4A 4KFCA 2K7LA 2M87A 2H27A 2V79A 3U9GA 1HXDA 1RUNA 4GGGA 3T0YA 2VC0A 2UXXA 3MFKA 3WTTC 2MBFA 1IRFA 2P6SA 3AAFA 2Z3YA 3F8FA 3LQRA 4LD5A 2ELHA 2XAHA 4EM0B 2V6CA 1U78A 3OV8A 5K5OA 2MC3A 3GFLA 3CO6C 3EYYA 1XDSA 1CF7B 2YSRA 2L54A 2RKHA 2ZKZA 1RUOA 1LDKB 1P4AA 2R7DA 3R61A 3P7NA 5D5VB 2QQBA 3WGHA 1L0OC 2BYVE 3O6BB 2FSWA 3FZVA 1LEBA 2CO5A 2MLKA 1JHFA 2DTRA 2AS5F 2P7VB 4OIRF 1SD5A 3KP2A 4XRFA 5HLGA 3HSEA 3TDUC 4EMSA 3GW2A 5H6RA 5LHIA 3B02A 1I1SA 2JPCA 1C0WA 3KP3A 1HW5A 2YU3A 1X3UA 1HKSA 5BPDA 1BM9A 1GVJA 1J2XA 2XAFA 2MD5A 3LAJA 5A2QK 1O7LA 2PQ8A 2UZKA 1XMAA 3KCCA 4I01A 5FGMA 2FMYA 2FE3A 2RV8A 4M73A 5F64A 4G9YA 3IRRA 2UWMA 2ESHA 2VT3A 4I0BA 3NRVA 1G3WA 4CGZA 1S7AA 4IPAA 2WV0A 2ZJ2A 1ZYRF 2BE5F 1SFUA 3WTXC 1ZLKA 4Y13A 4KA4A 4PCQA 3BPVA 3T1BA 3CO7C 3I64A 4MQ9F 1U5TC 4IRGA 2P5VA 2VBZA 2FRHA 2GAUA 3WE2A 5L3BA 5F1RA 4WK8F 2XV4S 1F1ZA 2XIGA 2A68F 1BC7C 4HBLA 4CYDA 5D8LB 3LSTA 4OMZA 1ZARA 2OZUA 3I59B 4HW0A 2BGCA 4O3MA 5HDKA 1ZRDA 4I09A 4KDPA 2QM3A 1PP8F 1T98A 4EJVA 5LHGA 4GYGA 2M5WA 3K1MA 1OR7A 3R60A 4LG0B 5D5XB 2AXLA 3GX4X 1BBYA 5JI6A 1S8NA 4EM1A 3RPQA 4CICA 2HEOA 2PJPA 2EA2A 4L9NA 4WWCA 3IWZA 5H20A 3V7SA 5ICCA 5CLSA 1K78A 1Z6TA 1CGPA 2VOOA 2GA2A 1K6OA 3TKYA 4LLGF 1SFEA 2XAJA 3KEOA 4MTEA 5HLHA 4PGGA 4MGRA 1SFXA 3V8JA 2V1UA 4G94A 4Q4ZF 4KUMA 2D2WA 4U0YA 5DD8A 2STTA 3E97A 4DQ2A 4U0VA 2DAOA 1WKMA 2MA3A 3VB2A 3WTZA 3F6OA 2BEOA 5KK1A 1OMIA 2IRFG 3HOTA 2O6GE 1YW7A 5DD4A 2EV6A 1ULYA 2H94A 5TRDA 4S05A 1T2KA 1J7KA 2GIVA 1YW9A 3TO6A 4Q47A 3CTAA 4EVIA 4DNCA 3L9FA 5K5RA 1R1VA 4LK1F 2NS0A 1FSHA 3ECHA 3T5XA 4CZZA 1RIOH 4BYYA 1D8JA 1XSVA 5E8IA 1R5GA 2PG4A 4HF2A 5ILVA 2W85A 3FXQA 3C3WA 3RKYA 1P4WA 3JTHA 1FX7A 2M1BA 4LB6B 1TNSA 1ZRCA 4QLCU 2W24A 3RI4A 2GXBA 3HUGA 4GXOA 3I53A 3L00A 3GVAA 1BI1A 5AONA 2JRTA 2CG4A 2LDUA 3FMQA 4HYEA 4S04A 4BH9A 3FX3A 2EA4A 1Z6RA 4KMUX 3WG9A 2QBYA 2STWA 3WTSC 3L09A 2GQQA 2JPBA 1Z91A 2OQGA 4OINF 2PI0A 2R7FA 1IN4A 3I5UA 2QLZA 2A5YB 1DPRA 3M1EA 1XDUA 5LHHA 2ZXJA 4UUVA 1E17A 3E5XA 1BN5A 1FC3A 1SMTA 1Z7UA 1EH6A 4A0ZA 3J80K 3U2RA 1YO5C 1J5YA 1FNNA 3HSFA 4UHTA 3LAPA 3MZYA 3IKTA 3E6DA 1IZ1A 3Q5FA 4ENKA 4BAYA 4B09A 3V8LA 3BDDA 4LFUA 4G7OF 3TDZC 3O3KA 4HDUA 3QOPA 4MQVA 4FHTA 1KYZA 3DKWA 4P9UA 2G7HA 2Y0MA 5E17F 3ZMUA 3C7JA 2WC2A 3HTUA 1JGSA 4KN7X 2Z5UA 2Z9OA 1RZ4A 3L2CA 1RNLA 3F22A 2HDCA 1BI3A 5BPIA 4JK1X 3WU0A 4G7HF 5BMZA 2W25A 1ZG3A 1B59A 1B9NA 4ON0A 3GUDA 1W4MA 2L4AA 2EK5A 3JAMZ 1TQIA 5DDGA 4F7ZA 3S2WA 1R36A 1CF7A 3LA2A 4A2UA 5ICEA 5IT9Z 1R00A 3Q9SA 3R4KA 1USTA 1O3RA 3COAC 5CVIA 2EFWA 3QP5A 1P4XA 4L5JA 4Q5SF 2DPUA 3PFIA 2ZBKA 1MGTA 3N4MA 5JR3A 3T8TA 3J7AO 1FY7A 5FFXA 4BNCA 4PDKA 3HOSA 5L3CA 2L4MA 4P55A 2DT5A 1ZG5A 2CFXA 2XRNA 3ZN1A 3CDHA 5CVJA 2IA1A 3EYIA 3SQNA 2K27A 4UVCA 1YTYA 1REPC 1SD7A 4OIOF 3RIRA 2VE8A 2HKXA 2B0LA 3QP6A 1UHWA 1R7JA 1T0FA 4HLYA 2DK5A 1ON2A 4AIKA 1LQ1A 3REOA 1FOKA 1IXRC 2M8EA 4UXNA 2DW4A 2P4WA 2F5EA 2NYXA 1IF1A 3N97A 1IAWA 3WGGA 3KE2A 3LFKA 4A12A 2O03A 4R79A 3I71A 1I27A 4KMFA 2DU9A 2HWVA 3CJNA 5J6XA 3F8BA 1GXQA 3EETA 2P5KA 1OYIA 4YFXF 1K78B 3V7RA 2IVMA 2OA4A 2PEXA 1YIOA 1OPCA 4HX8A 3WTUC 2EFQA 3NEUA 1FSEA 4KIBA 2HYGD 2MH9A 4M6XA 3R6SA 4IHSA 1I5ZA 4GO1A 2XKOA 3J81K 2RN7A 2MLGA 2C6YA 2KIFA 3E5QA 3BJAA 2F2EA 2E1NA 4Y17A 4HQMA 3LA3A 1MJBA 5E18F 1UFMA 2EFOA 3ZMVA 1IW7F 5HS9A 1HKTA 3QU6A 3F6VA 1R23A 5D4SA 4RGRA 1AWCA 4UNOA 4Q48A 1IN8A 3ZPLA 2XGXA 4EJTA 4M6YA 2L3DA 3WTWC 1ZN2A 5TJJA 1R5HA 5LEJA 1T38A 1HW2A 1S29A 1B6AA 1XN7A 1P6RA 1S3JA 2DBBA 1JE8A 4RB1A 1PDNC 1U6GA 5D5WB 1P92A 4ZZLA 2ESNA 3ZMSA 4KNYA 3MQ0A 4K2EA 3SZPA 1TBXA 2V9VA 2F5DA 4PZJA 3GZ6A 1O3QA 2XVCA 1WI9A 4U88A 3CUQB 3ULQB 1YFHA 2A3SA 4H0EA 4G6DA 5HOOA 2CQKA 5L3DA 4XBFA 5J8CA 1UB9A 4EJUA 4UVBA 4ESFA 2HGCA 5FB2A 1KU3A 3G3ZA 2VBYA 3F3XA 4XSZF 3GWZA 3I58A 1KGSA 2KKOA 2QENA 3ML6A 1XCVA 3PQJA 2IA0A 1ZRFA 4ZH4F 4L5IA 1Z9CA 4M9SA 4HF1A 2L02A 5JVTA 4OIPF 5E1XA 1P2FA 2LF8A 2CWEA 3HYIA 2Y48A 5LLQA 4Y15A 3C18A 2RNJA 3DXJF 3IKVA 5ICGA 1T39A 1IRGA 4ENJA 3BOQA 3JTGA 4FX0A 3F8CA 3GZ5A 1QBJA 2IPQX 2R3SA 2E7WA 1BI2A 4ENMA 4LG0A 1FBQA 5LRSA 1ZGJA 4YG2F 3KLNA 4NB5A 1FYKA 4MNUA 1YLFA 2HKOA 4JBAA 1QGPA 4P5OA 1KQ8A 4IHTA 1F4KA 2KJCA 4ZZDA 4RAYA 1HKQA 4OMYA 1LJ9A 5CYVA 2O3FA 3TOBA 3QPHA 3K69A 2Q8KA 5L3EA 2JT1A 1G3SA 1SMYF 2XKPA 2HTSA 3WE3A 2Q0OA 4RB0A 5HS7A 1XGNA 3FHZA 1J0RA 5AIPA 2Z33A 3HRMA 5CVRA 5HVQC 2FBIA 1IN6A 3QPTA 3U1DA 5DYMA 4HV5A 5ICFA 1ODDA 2FXAA 5LRRA 2ZNYA 4XLPF 2FU4A 1HW1A 4IJAA 2A6HF 3FF5A 3P9KA 1QZZA 4HQEA 1IN5A 1FYMA 1LDDA 2FNPA 4P96A 4L9TA 3FMSA 5D6EA 1YW8A 4U7DA 4RGXA 1HBXG 3V4GA 1KU9A 4N0BA 1G6NA 1FP1D 2IA2A 1KQ0A 5HDGA 4ENNA 3GLXA 5D4RA 3WGIA 4ZYEA 4RB3C 3NQOA 4PGHA 2OAZA 3BWGA 4BHCA 4TV7A 3M8EA 3K9TA 4LK0F 3J80Z 3QU3A 6PAXA 1RI7A 1EH8A 2FNAA 4P9FA 3E6MA 4AVPA 1R58A 1R1UA 3HHGA 2JTVA 4I0AA 1ZGAA 3RJPA 1FBUA 3HRUA 3GYHX 3KP4A 5BOXA 4YFNF 2RC4A 1MJAA 2VOPA 1JHHA 3CLOA 5ILSA 2LNBA 1G3TA 3TO7A 1J59A 4N9HA 4G7ZF 2DK8A 3V7CA 3R0JA 3F72A 2ADUA 2QWWA 3H3ZA 1ON1A 5CVVA 2XAGA 4U7BA 1J9IA 2X0LA 2PBIA 4E70A 5IT9K 4ZYGA 3ABTA 3M7GA 1D8KA 3R0AA 5LGUA 3BY6A 4M74A 2K4BA 4ESBA 1ZLJA 4BHPA 1TW3A 1LDJA 3LWFA 4L0YB 1DP7P 2YR2A 2DFIA 5EEGA 1XSDA 4WXHA 2QZ8A 5L3GA 2FEZA 2QQ9A 3EDPA 1SAXA 3O2PE 4HOBA 3GFMA 3GO5A 2XASA 1S7OA 4N9IA 5FO5A 2PMUA 2BBYA 4LLNA 3DFGA 1B4AA 2F5FA 4LGWA 5D5UB 2EV5A 3HRSA 5FLXK 5CJ9A 2PN6A 5LBQA 3WTYC 4MHGA 1MD0A 2G7UA 3DQVC 2NNNA 4I98B 1EV7A 5HDNA 5HS8A 4EQQA 2PMHA 3K1PA 3ZQ7A 2PFBA 1IN7A 2FQ3A 1XD7A 1ZHFA 5A2QZ 4EJWA 5KVRA 4WF2A 2O61A 5HLIA 2EB7A 3QAHA 2HOEA 1IUYA 1D3YA 1BI0A 2HFHA 3IC7A 3JSOA 2D1HA 1XCBA 3KETA 2Z99A 4IVNA 1QO0D 1HSTA 2JSCA 3JAMK 2LKPA 3IWFA 1V3FA 1G4DA 1LEAA 2A6EF 5JFRA 1MKMA 4HX7A 3E3VA 1XB4A 4HX4A 2HQNA 1U5TA 3LA7A 4WX9A 1U3EM 1YS6A 2VC1A 3GF2A 5FLXZ 2CGPA 2COMA 3FMRA 2VONA 5LGTA 2F5CA 1TQMA 2GWRA 1FP2A 3KEQA 4AIHA 2OU2A 4RAZA 3ISPA 2MH2A 4BHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FT8 A;  2HZT A;  4M9Z A;  2HTJ A;  1J75 A;  3D0S A;  4MEX F;  1F5T A;  2RDP A;  4CO8 A;  2D45 A;  1SD6 A;  2KIM A;  3ZMT A;  1XGO A;  3C1D A;  1R1T A;  2H6B A;  2QYO A;  4A5N A;  3DF8 A;  1DPU A;  5E1W A;  1KQ9 A;  4IRI A;  4UV9 A;  3VEP A;  1A04 A;  2GXG A;  3ECO A;  1G3Y A;  1MZB A;  4KYW A;  4KT5 C;  4RB2 C;  1YS7 A;  3MZH A;  3CUQ C;  3BPX A;  1ZRE A;  3MCZ A;  3RKW A;  4A5M A;  1MJ9 A;  3HSR A;  4LB5 A;  2GZW A;  4HZF A;  1SD4 A;  2V1D A;  4LLL A;  4UVA A;  2IP2 A;  3H92 A;  1I1G A;  2G9W A;  3F8N A;  2EFN A;  4M71 A;  4L18 B;  1GHC A;  2DO7 A;  3IHU A;  2QBY B;  1FWZ A;  5E8G A;  3WTV C;  2XUB A;  3D5L A;  5CVU A;  3RTR A;  2J5P A;  1O3S A;  1WWX A;  1IXS B;  4CDG A;  1TNT A;  5DEQ A;  2EFP A;  3TO9 A;  3F21 A;  3HIF A;  3PQK A;  2RGV A;  2L01 A;  4UV8 A;  1T6S A;  2NAZ A;  4A0X A;  4YFK F;  3IRQ A;  3OOP A;  2P5L C;  5IT3 A;  2FF4 A;  4ESJ A;  4IRH A;  4HLX A;  4IXA A;  1FYL A;  2QQA A;  2M30 A;  1Y0U A;  2E1C A;  1NHA A;  4U0W A;  1JXS A;  1WQ2 A;  3Q9V A;  2WWY A;  3DEU A;  1U2W A;  5ILU A;  4OOI A;  2H6C A;  1ZH5 A;  5D6F A;  4AD9 A;  4CXF A;  4HF0 A;  1OYY A;  4Z2Y A;  4I2O A;  2K4J A;  2FA5 A;  2HYF A;  2ZO4 A;  3ZN0 A;  1U8R A;  2ZME B;  4NQW A;  1Z05 A;  4L9J A;  3E5U A;  5ED4 A;  2KRF A;  4D0P A;  1QNT A;  1EH7 A;  2H09 A;  5K1Y A;  5BS6 A;  3VOD A;  2FBH A;  2Y75 A;  4M72 A;  1MDM B;  3MAJ A;  1Z1D A;  2ZCW A;  4RS8 A;  4NHJ A;  1O7F A;  5AIQ A;  4KIG A;  3KP6 A;  3KP7 A;  4BXU A;  1ZG1 A;  2DQL A;  2TDX A;  2W84 A;  2QUF A;  1LNW A;  3BZ6 A;  3ROU A;  5JHU A;  1H9T A;  2ISY A;  2Q2E A;  4A6E A;  1K79 A;  1BOA A;  2EWN A;  3FXR A;  1I6X A;  1ONV A;  1H9G A;  1KYW A;  3K1N A;  1F9N A;  3BJO A;  5FD6 A;  3I59 A;  1DUX C;  2VT2 A;  2LSO A;  2P6T A;  3GXO A;  1R22 A;  4JQF A;  2ZFW A;  5L3F A;  2NRA C;  3V8K A;  1L3L A;  2ISZ A;  3F8M A;  2XAQ A;  4O6J A;  4WXD A;  3ERE D;  1U5T B;  5EEH A;  2W57 A;  4KIC A;  3K2Z A;  1XSX A;  3SZT A;  1QZY A;  4L9V A;  4YIF A;  1PUE E;  4G8X A;  3FM5 A;  5LGN A;  3I54 A;  4ZYH A;  1WRJ A;  1B9M A;  1FPQ A;  3BJ6 A;  2K02 A;  2M45 A;  2EJR A;  3RYR A;  1TTY A;  3TQN A;  4ETS A;  1S6L A;  2J5O A;  3E6B A;  5DCF A;  4GCV A;  3WU1 B;  2KIU A;  1FBS A;  1STZ A;  1FLI A;  3RDI A;  2DPD A;  3RKX A;  2A69 F;  5E1Z B;  1B1B A;  3MEX A;  1FT9 A;  1W5T A;  2OBP A;  3WOD F;  2VOD A;  3ZP5 A;  3DV8 A;  5K5Q A;  4EGZ A;  5FD5 A;  1IXC A;  5LEK A;  3E6C C;  3I0T A;  1YQA A;  3I4P A;  3SXY A;  2CYY A;  2DLL A;  4R8H A;  1TQP A;  2BV6 A;  2ACJ A;  3ZMZ A;  1XMK A;  3W6K B;  4M9X A;  4AWX B;  2HR3 A;  2VBW A;  2JZY A;  2IJL A;  3GFJ A;  2XRO A;  5DCM B;  2HS5 A;  2EV0 A;  2HQR A;  1UCR A;  5D8K B;  4LJZ F;  4QWQ A;  1XGM A;  4HV6 A;  2RVC A;  1LVA A;  2KJB A;  1Q1H A;  3TGN A;  2IW5 A;  4G6Q A;  3P9I A;  1D5V A;  3DPT A;  3VOE A;  1TLH B;  3P9C A;  1QQI A;  4A0Y A;  1DDN A;  3B73 A;  4I7H A;  4MEY F;  3SHF A;  4OU0 A;  1VTN C;  3RYP A;  1BIA A;  2E7X A;  2ETH A;  4HA8 A;  4HDV A;  3W6J B;  2CW0 F;  2FOK A;  2DI3 A;  2NNY A;  3CUO A;  4O5V A;  1O57 A;  4YII A;  2LF7 A;  2YX7 A;  2FML A;  4ZYD A;  2K86 A;  5F6F A;  1OYW A;  3G73 A;  2PLY A;  3F23 A;  2P8T A;  3JSP A;  2CSO A;  3ZMD A;  4IF4 A;  4EV0 A;  4A6D A;  3FXU A;  3HRT A;  4XSX F;  3ELK A;  5E20 A;  3IL2 A;  3DPL C;  4R1H A;  3GFI A;  1BJA A;  3FM3 A;  1YG2 A;  1LB2 A;  3EUH A;  1HSJ A;  1MDM A;  3K0L A;  2A61 A;  3BP8 A;  1TW2 A;  2ZNZ A;  3L7W A;  5BQT A;  4CHU A;  2VN2 A;  3J81 Z;  4L0Z B;  4KIF A;  1O3T A;  1KU2 A;  2O8X A;  2VXZ A;  2WTE A;  3ABU A;  4LMY A;  1UHM A;  1V4R A;  2OQR A;  3M8F A;  1BIB A;  3H3U A;  2VBX A;  1W7P B;  3FWE A;  4I02 A;  1OKR A;  4B8X A;  1W7P D;  3SFZ A;  3M9A A;  2VE9 A;  2IT0 A;  2X4H A;  5DV5 A;  3JW4 A;  3KZZ A;  3KZY A;  4RGS A;  1YYV A;  5J8F A;  1QPM A;  1USS A;  4AIJ A;  4EGY A;  4ASN A;  3KP5 A;  1K7A A;  3BRO A;  5DUI A;  1XGS A;  4RGU A;  1KU7 A;  3EQL F;  3CUQ A;  1WSU A;  2YPR A;  2P7C B;  4GYI A;  3GEZ A;  2OZ6 A;  2QVO A;  1BC8 C;  4HAM A;  3DP7 A;  2XHK A;  2V1X A;  1FZP B;  5ERI A;  4EM2 A;  1HQC A;  2UXN A;  2GA1 A;  3QRF F;  4EJO A;  4KN4 X;  5FFZ A;  3VFZ A;  1AOY A;  3KLO A;  1E2X A;  4XLN F;  4WCG A;  2A07 F;  4BQA A;  3T8R A;  3LQQ A;  3MWM A;  3KFW X;  3HHH A;  1PP7 U;  3HTS B;  2FBK A;  1KA8 A;  4WXC A;  5DCM A;  4OIQ F;  3RPU A;  2YX4 A;  2ZME A;  1ZAO A;  1H0M A;  3TOA A;  2D1V A;  2O0Y A;  2OD5 A;  2DQR A;  1W5S A;  1W7P A;  5DUK A;  5H6Q A;  4MTD A;  1GXP A;  2RQP A;  4FX4 A;  4KFC A;  2K7L A;  2M87 A;  2H27 A;  2V79 A;  3U9G A;  1HXD A;  1RUN A;  4GGG A;  3T0Y A;  2VC0 A;  2UXX A;  3MFK A;  3WTT C;  2MBF A;  1IRF A;  2P6S A;  3AAF A;  2Z3Y A;  3F8F A;  3LQR A;  4LD5 A;  2ELH A;  2XAH A;  4EM0 B;  2V6C A;  1U78 A;  3OV8 A;  5K5O A;  2MC3 A;  3GFL A;  3CO6 C;  3EYY A;  1XDS A;  1CF7 B;  2YSR A;  2L54 A;  2RKH A;  2ZKZ A;  1RUO A;  1LDK B;  1P4A A;  2R7D A;  3R61 A;  3P7N A;  5D5V B;  2QQB A;  3WGH A;  1L0O C;  2BYV E;  3O6B B;  2FSW A;  3FZV A;  1LEB A;  2CO5 A;  2MLK A;  1JHF A;  2DTR A;  2AS5 F;  2P7V B;  4OIR F;  1SD5 A;  3KP2 A;  4XRF A;  5HLG A;  3HSE A;  3TDU C;  4EMS A;  3GW2 A;  5H6R A;  5LHI A;  3B02 A;  1I1S A;  2JPC A;  1C0W A;  3KP3 A;  1HW5 A;  2YU3 A;  1X3U A;  1HKS A;  5BPD A;  1BM9 A;  1GVJ A;  1J2X A;  2XAF A;  2MD5 A;  3LAJ A;  5A2Q K;  1O7L A;  2PQ8 A;  2UZK A;  1XMA A;  3KCC A;  4I01 A;  5FGM A;  2FMY A;  2FE3 A;  2RV8 A;  4M73 A;  5F64 A;  4G9Y A;  3IRR A;  2UWM A;  2ESH A;  2VT3 A;  4I0B A;  3NRV A;  1G3W A;  4CGZ A;  1S7A A;  4IPA A;  2WV0 A;  2ZJ2 A;  1ZYR F;  2BE5 F;  1SFU A;  3WTX C;  1ZLK A;  4Y13 A;  4KA4 A;  4PCQ A;  3BPV A;  3T1B A;  3CO7 C;  3I64 A;  4MQ9 F;  1U5T C;  4IRG A;  2P5V A;  2VBZ A;  2FRH A;  2GAU A;  3WE2 A;  5L3B A;  5F1R A;  4WK8 F;  2XV4 S;  1F1Z A;  2XIG A;  2A68 F;  1BC7 C;  4HBL A;  4CYD A;  5D8L B;  3LST A;  4OMZ A;  1ZAR A;  2OZU A;  3I59 B;  4HW0 A;  2BGC A;  4O3M A;  5HDK A;  1ZRD A;  4I09 A;  4KDP A;  2QM3 A;  1PP8 F;  1T98 A;  4EJV A;  5LHG A;  4GYG A;  2M5W A;  3K1M A;  1OR7 A;  3R60 A;  4LG0 B;  5D5X B;  2AXL A;  3GX4 X;  1BBY A;  5JI6 A;  1S8N A;  4EM1 A;  3RPQ A;  4CIC A;  2HEO A;  2PJP A;  2EA2 A;  4L9N A;  4WWC A;  3IWZ A;  5H20 A;  3V7S A;  5ICC A;  5CLS A;  1K78 A;  1Z6T A;  1CGP A;  2VOO A;  2GA2 A;  1K6O A;  3TKY A;  4LLG F;  1SFE A;  2XAJ A;  3KEO A;  4MTE A;  5HLH A;  4PGG A;  4MGR A;  1SFX A;  3V8J A;  2V1U A;  4G94 A;  4Q4Z F;  4KUM A;  2D2W A;  4U0Y A;  5DD8 A;  2STT A;  3E97 A;  4DQ2 A;  4U0V A;  2DAO A;  1WKM A;  2MA3 A;  3VB2 A;  3WTZ A;  3F6O A;  2BEO A;  5KK1 A;  1OMI A;  2IRF G;  3HOT A;  2O6G E;  1YW7 A;  5DD4 A;  2EV6 A;  1ULY A;  2H94 A;  5TRD A;  4S05 A;  1T2K A;  1J7K A;  2GIV A;  1YW9 A;  3TO6 A;  4Q47 A;  3CTA A;  4EVI A;  4DNC A;  3L9F A;  5K5R A;  1R1V A;  4LK1 F;  2NS0 A;  1FSH A;  3ECH A;  3T5X A;  4CZZ A;  1RIO H;  4BYY A;  1D8J A;  1XSV A;  5E8I A;  1R5G A;  2PG4 A;  4HF2 A;  5ILV A;  2W85 A;  3FXQ A;  3C3W A;  3RKY A;  1P4W A;  3JTH A;  1FX7 A;  2M1B A;  4LB6 B;  1TNS A;  1ZRC A;  4QLC U;  2W24 A;  3RI4 A;  2GXB A;  3HUG A;  4GXO A;  3I53 A;  3L00 A;  3GVA A;  1BI1 A;  5AON A;  2JRT A;  2CG4 A;  2LDU A;  3FMQ A;  4HYE A;  4S04 A;  4BH9 A;  3FX3 A;  2EA4 A;  1Z6R A;  4KMU X;  3WG9 A;  2QBY A;  2STW A;  3WTS C;  3L09 A;  2GQQ A;  2JPB A;  1Z91 A;  2OQG A;  4OIN F;  2PI0 A;  2R7F A;  1IN4 A;  3I5U A;  2QLZ A;  2A5Y B;  1DPR A;  3M1E A;  1XDU A;  5LHH A;  2ZXJ A;  4UUV A;  1E17 A;  3E5X A;  1BN5 A;  1FC3 A;  1SMT A;  1Z7U A;  1EH6 A;  4A0Z A;  3J80 K;  3U2R A;  1YO5 C;  1J5Y A;  1FNN A;  3HSF A;  4UHT A;  3LAP A;  3MZY A;  3IKT A;  3E6D A;  1IZ1 A;  3Q5F A;  4ENK A;  4BAY A;  4B09 A;  3V8L A;  3BDD A;  4LFU A;  4G7O F;  3TDZ C;  3O3K A;  4HDU A;  3QOP A;  4MQV A;  4FHT A;  1KYZ A;  3DKW A;  4P9U A;  2G7H A;  2Y0M A;  5E17 F;  3ZMU A;  3C7J A;  2WC2 A;  3HTU A;  1JGS A;  4KN7 X;  2Z5U A;  2Z9O A;  1RZ4 A;  3L2C A;  1RNL A;  3F22 A;  2HDC A;  1BI3 A;  5BPI A;  4JK1 X;  3WU0 A;  4G7H F;  5BMZ A;  2W25 A;  1ZG3 A;  1B59 A;  1B9N A;  4ON0 A;  3GUD A;  1W4M A;  2L4A A;  2EK5 A;  3JAM Z;  1TQI A;  5DDG A;  4F7Z A;  3S2W A;  1R36 A;  1CF7 A;  3LA2 A;  4A2U A;  5ICE A;  5IT9 Z;  1R00 A;  3Q9S A;  3R4K A;  1UST A;  1O3R A;  3COA C;  5CVI A;  2EFW A;  3QP5 A;  1P4X A;  4L5J A;  4Q5S F;  2DPU A;  3PFI A;  2ZBK A;  1MGT A;  3N4M A;  5JR3 A;  3T8T A;  3J7A O;  1FY7 A;  5FFX A;  4BNC A;  4PDK A;  3HOS A;  5L3C A;  2L4M A;  4P55 A;  2DT5 A;  1ZG5 A;  2CFX A;  2XRN A;  3ZN1 A;  3CDH A;  5CVJ A;  2IA1 A;  3EYI A;  3SQN A;  2K27 A;  4UVC A;  1YTY A;  1REP C;  1SD7 A;  4OIO F;  3RIR A;  2VE8 A;  2HKX A;  2B0L A;  3QP6 A;  1UHW A;  1R7J A;  1T0F A;  4HLY A;  2DK5 A;  1ON2 A;  4AIK A;  1LQ1 A;  3REO A;  1FOK A;  1IXR C;  2M8E A;  4UXN A;  2DW4 A;  2P4W A;  2F5E A;  2NYX A;  1IF1 A;  3N97 A;  1IAW A;  3WGG A;  3KE2 A;  3LFK A;  4A12 A;  2O03 A;  4R79 A;  3I71 A;  1I27 A;  4KMF A;  2DU9 A;  2HWV A;  3CJN A;  5J6X A;  3F8B A;  1GXQ A;  3EET A;  2P5K A;  1OYI A;  4YFX F;  1K78 B;  3V7R A;  2IVM A;  2OA4 A;  2PEX A;  1YIO A;  1OPC A;  4HX8 A;  3WTU C;  2EFQ A;  3NEU A;  1FSE A;  4KIB A;  2HYG D;  2MH9 A;  4M6X A;  3R6S A;  4IHS A;  1I5Z A;  4GO1 A;  2XKO A;  3J81 K;  2RN7 A;  2MLG A;  2C6Y A;  2KIF A;  3E5Q A;  3BJA A;  2F2E A;  2E1N A;  4Y17 A;  4HQM A;  3LA3 A;  1MJB A;  5E18 F;  1UFM A;  2EFO A;  3ZMV A;  1IW7 F;  5HS9 A;  1HKT A;  3QU6 A;  3F6V A;  1R23 A;  5D4S A;  4RGR A;  1AWC A;  4UNO A;  4Q48 A;  1IN8 A;  3ZPL A;  2XGX A;  4EJT A;  4M6Y A;  2L3D A;  3WTW C;  1ZN2 A;  5TJJ A;  1R5H A;  5LEJ A;  1T38 A;  1HW2 A;  1S29 A;  1B6A A;  1XN7 A;  1P6R A;  1S3J A;  2DBB A;  1JE8 A;  4RB1 A;  1PDN C;  1U6G A;  5D5W B;  1P92 A;  4ZZL A;  2ESN A;  3ZMS A;  4KNY A;  3MQ0 A;  4K2E A;  3SZP A;  1TBX A;  2V9V A;  2F5D A;  4PZJ A;  3GZ6 A;  1O3Q A;  2XVC A;  1WI9 A;  4U88 A;  3CUQ B;  3ULQ B;  1YFH A;  2A3S A;  4H0E A;  4G6D A;  5HOO A;  2CQK A;  5L3D A;  4XBF A;  5J8C A;  1UB9 A;  4EJU A;  4UVB A;  4ESF A;  2HGC A;  5FB2 A;  1KU3 A;  3G3Z A;  2VBY A;  3F3X A;  4XSZ F;  3GWZ A;  3I58 A;  1KGS A;  2KKO A;  2QEN A;  3ML6 A;  1XCV A;  3PQJ A;  2IA0 A;  1ZRF A;  4ZH4 F;  4L5I A;  1Z9C A;  4M9S A;  4HF1 A;  2L02 A;  5JVT A;  4OIP F;  5E1X A;  1P2F A;  2LF8 A;  2CWE A;  3HYI A;  2Y48 A;  5LLQ A;  4Y15 A;  3C18 A;  2RNJ A;  3DXJ F;  3IKV A;  5ICG A;  1T39 A;  1IRG A;  4ENJ A;  3BOQ A;  3JTG A;  4FX0 A;  3F8C A;  3GZ5 A;  1QBJ A;  2IPQ X;  2R3S A;  2E7W A;  1BI2 A;  4ENM A;  4LG0 A;  1FBQ A;  5LRS A;  1ZGJ A;  4YG2 F;  3KLN A;  4NB5 A;  1FYK A;  4MNU A;  1YLF A;  2HKO A;  4JBA A;  1QGP A;  4P5O A;  1KQ8 A;  4IHT A;  1F4K A;  2KJC A;  4ZZD A;  4RAY A;  1HKQ A;  4OMY A;  1LJ9 A;  5CYV A;  2O3F A;  3TOB A;  3QPH A;  3K69 A;  2Q8K A;  5L3E A;  2JT1 A;  1G3S A;  1SMY F;  2XKP A;  2HTS A;  3WE3 A;  2Q0O A;  4RB0 A;  5HS7 A;  1XGN A;  3FHZ A;  1J0R A;  5AIP A;  2Z33 A;  3HRM A;  5CVR A;  5HVQ C;  2FBI A;  1IN6 A;  3QPT A;  3U1D A;  5DYM A;  4HV5 A;  5ICF A;  1ODD A;  2FXA A;  5LRR A;  2ZNY A;  4XLP F;  2FU4 A;  1HW1 A;  4IJA A;  2A6H F;  3FF5 A;  3P9K A;  1QZZ A;  4HQE A;  1IN5 A;  1FYM A;  1LDD A;  2FNP A;  4P96 A;  4L9T A;  3FMS A;  5D6E A;  1YW8 A;  4U7D A;  4RGX A;  1HBX G;  3V4G A;  1KU9 A;  4N0B A;  1G6N A;  1FP1 D;  2IA2 A;  1KQ0 A;  5HDG A;  4ENN A;  3GLX A;  5D4R A;  3WGI A;  4ZYE A;  4RB3 C;  3NQO A;  4PGH A;  2OAZ A;  3BWG A;  4BHC A;  4TV7 A;  3M8E A;  3K9T A;  4LK0 F;  3J80 Z;  3QU3 A;  6PAX A;  1RI7 A;  1EH8 A;  2FNA A;  4P9F A;  3E6M A;  4AVP A;  1R58 A;  1R1U A;  3HHG A;  2JTV A;  4I0A A;  1ZGA A;  3RJP A;  1FBU A;  3HRU A;  3GYH X;  3KP4 A;  5BOX A;  4YFN F;  2RC4 A;  1MJA A;  2VOP A;  1JHH A;  3CLO A;  5ILS A;  2LNB A;  1G3T A;  3TO7 A;  1J59 A;  4N9H A;  4G7Z F;  2DK8 A;  3V7C A;  3R0J A;  3F72 A;  2ADU A;  2QWW A;  3H3Z A;  1ON1 A;  5CVV A;  2XAG A;  4U7B A;  1J9I A;  2X0L A;  2PBI A;  4E70 A;  5IT9 K;  4ZYG A;  3ABT A;  3M7G A;  1D8K A;  3R0A A;  5LGU A;  3BY6 A;  4M74 A;  2K4B A;  4ESB A;  1ZLJ A;  4BHP A;  1TW3 A;  1LDJ A;  3LWF A;  4L0Y B;  1DP7 P;  2YR2 A;  2DFI A;  5EEG A;  1XSD A;  4WXH A;  2QZ8 A;  5L3G A;  2FEZ A;  2QQ9 A;  3EDP A;  1SAX A;  3O2P E;  4HOB A;  3GFM A;  3GO5 A;  2XAS A;  1S7O A;  4N9I A;  5FO5 A;  2PMU A;  2BBY A;  4LLN A;  3DFG A;  1B4A A;  2F5F A;  4LGW A;  5D5U B;  2EV5 A;  3HRS A;  5FLX K;  5CJ9 A;  2PN6 A;  5LBQ A;  3WTY C;  4MHG A;  1MD0 A;  2G7U A;  3DQV C;  2NNN A;  4I98 B;  1EV7 A;  5HDN A;  5HS8 A;  4EQQ A;  2PMH A;  3K1P A;  3ZQ7 A;  2PFB A;  1IN7 A;  2FQ3 A;  1XD7 A;  1ZHF A;  5A2Q Z;  4EJW A;  5KVR A;  4WF2 A;  2O61 A;  5HLI A;  2EB7 A;  3QAH A;  2HOE A;  1IUY A;  1D3Y A;  1BI0 A;  2HFH A;  3IC7 A;  3JSO A;  2D1H A;  1XCB A;  3KET A;  2Z99 A;  4IVN A;  1QO0 D;  1HST A;  2JSC A;  3JAM K;  2LKP A;  3IWF A;  1V3F A;  1G4D A;  1LEA A;  2A6E F;  5JFR A;  1MKM A;  4HX7 A;  3E3V A;  1XB4 A;  4HX4 A;  2HQN A;  1U5T A;  3LA7 A;  4WX9 A;  1U3E M;  1YS6 A;  2VC1 A;  3GF2 A;  5FLX Z;  2CGP A;  2COM A;  3FMR A;  2VON A;  5LGT A;  2F5C A;  1TQM A;  2GWR A;  1FP2 A;  3KEQ A;  4AIH A;  2OU2 A;  4RAZ A;  3ISP A;  2MH2 A;  4BHB A; 
#chains in the Genus database with same CATH topology
 4B3X A;  4FT8 A;  5F1J A;  2HZT A;  4M9Z A;  2HTJ A;  5DM7 F;  1MBG A;  2BW3 B;  1OIS A;  4AUX A;  1J75 A;  3D0S A;  2XGC A;  2CMP A;  1GVD A;  3PNT A;  1RES A;  2RDP A;  4NBQ A;  4CO8 A;  2D45 A;  4CCN A;  3OYH A;  1SD6 A;  2EIM H;  2W82 A;  2KIM A;  2LBF A;  1UG0 A;  3ZMT A;  3JRF A;  1XGO A;  4XLE A;  1N75 A;  3K10 A;  3C1D A;  1R1T A;  2H6B A;  2QYO A;  4A5N A;  2IS2 A;  1D1B A;  3OS1 A;  2X51 A;  3DF8 A;  1DPU A;  2A05 A;  1HCR A;  5E1W A;  3NAU A;  2OC6 A;  1KQ9 A;  4IRI A;  1WZ2 A;  4DOZ A;  4C3J J;  4UV9 A;  3VEP A;  1A04 A;  1I6H J;  1U9N A;  2GXG A;  3H36 A;  2K40 A;  3P5J A;  1NG6 A;  3ECO A;  1G3Y A;  1MZB A;  2GOM A;  3W2A A;  2AQF A;  3A01 B;  1ZK8 A;  4KYW A;  3GTO J;  4KT5 C;  2DYS H;  3CCU I;  1RR8 C;  3BR1 A;  5FRO A;  4RB2 C;  2XGD A;  4XLF A;  1YS7 A;  3MZH A;  3CUQ C;  1A36 A;  4BJT A;  3BPX A;  1ZRE A;  2AHQ A;  3LSM A;  2B9S A;  3MCZ A;  4E4H A;  3WHB A;  2IGM A;  3RKW A;  2NVY J;  3B6A A;  1MJ9 A;  4A5M A;  2NOJ B;  3S93 A;  3HSR A;  2QSG X;  4LB5 A;  2GZW A;  4HZF A;  1SD4 A;  2DA4 A;  2EZL A;  2V1D A;  2F4I A;  4LLL A;  4UVA A;  2IP2 A;  3H92 A;  1I1G A;  5LFA A;  2G9W A;  1QHH D;  3F8N A;  2OUM A;  2EFN A;  2MGQ A;  4M71 A;  4L18 B;  1B8I B;  2DO7 A;  1GHC A;  3L2R A;  3IHU A;  2QBY B;  2DT6 A;  4OAZ A;  1FWZ A;  3DKX A;  5E8G A;  1TZL A;  3WTV C;  3U1K A;  3GTQ J;  2XUB A;  3KEY A;  3D5L A;  1XPX A;  4B44 A;  5CVU A;  1OCZ H;  2XRL A;  1ETQ A;  3RTR A;  2QF7 A;  2J5P A;  3QQA A;  1O3S A;  1WWX A;  2CU7 A;  1VQM I;  1IXS B;  5IYD J;  1WVR A;  4CDG A;  1TNT A;  1YJN I;  4C9Y A;  5DEQ A;  4DZJ A;  2EFP A;  2F4M B;  1VQ4 I;  3TO9 A;  3F21 A;  2JN6 A;  3HIF A;  1F5T A;  3PQK A;  2RGV A;  1JTY A;  1ZTR A;  2L01 A;  4UV8 A;  1VQ6 I;  1T6S A;  1ZR2 A;  2LY9 A;  2L7F P;  2NAZ A;  2QKM B;  3Q0U A;  4A0X A;  3L2V A;  4YFK F;  3IRQ A;  3OOP A;  2P5L C;  5IT3 A;  3Q0W A;  2FF4 A;  2VQC A;  4IRH A;  4ESJ A;  4HLX A;  4A3G J;  3LMM A;  2K9S A;  4IXA A;  2QQA A;  2M30 A;  4II3 A;  4KIT B;  2HQ5 A;  1FYL A;  2OV7 A;  1Y0U A;  2E1C A;  2Y30 A;  2E1O A;  3H5N A;  1NHA A;  1R6R A;  2ZXH A;  1F36 A;  4U0W A;  4DIQ A;  1IG7 A;  1JXS A;  4FE7 A;  2BHZ A;  3JRA A;  1WQ2 A;  3S1R J;  1LUJ B;  3N05 A;  3Q9V A;  3DEU A;  2WWY A;  1U2W A;  2E36 A;  5ILU A;  2DA7 A;  1BA5 A;  3LSI A;  2H6C A;  4OOI A;  4HRI A;  4PSW A;  3DCF A;  3OYC A;  2FOW A;  1ZH5 A;  5D6F A;  4AD9 A;  4CXF A;  4HF0 A;  3JRD A;  1OYY A;  4Z2Y A;  4I2O A;  2K4J A;  2OCE A;  4L5E A;  2FA5 A;  2R5Y B;  1WJD A;  2HYJ A;  2HYF A;  2ZO4 A;  3ZN0 A;  3FHN A;  1U8R A;  2ZME B;  4NQW A;  3BR2 A;  1Z05 A;  1GDT A;  3I3L A;  4L9J A;  2CUJ A;  5HLT A;  1E0E A;  3E5U A;  5ED4 A;  4RDU A;  2KRF A;  5LD2 C;  2W7N A;  1MSE C;  4JX4 A;  4D0P A;  1QNT A;  3S8P A;  1EH7 A;  2H09 A;  3FBI B;  2XPW A;  3A4C A;  3KPH A;  1WFX A;  2LY2 A;  5K1Y A;  5BS6 A;  5M3F J;  4ZC3 A;  3VOD A;  3ZCO A;  3CCS I;  2FBH A;  1I39 A;  2Y75 A;  4M72 A;  3OYD A;  1MDM B;  1MMA A;  3MAJ A;  1ZQ3 P;  1Z0X A;  1Z1D A;  2ZCW A;  4RS8 A;  2IBD A;  4Y3O A;  5KAF C;  4NHJ A;  1O7F A;  5AIQ A;  1PUF A;  4KIG A;  3CC7 I;  3H5A A;  4YRV A;  4PSX A;  5J47 A;  3KP6 A;  3ZQG A;  4UB8 C;  4BU2 A;  3KP7 A;  4BXU A;  1ETK A;  1ZG1 A;  2DQL A;  2BW3 A;  2DA3 A;  2TDX A;  2W84 A;  4HEA 2;  3LSR A;  2QUF A;  4E7H A;  4D5C A;  1LNW A;  2OCC H;  3H3V K;  3BZ6 A;  3ROU A;  3OR1 C;  5JHU A;  2UUZ A;  2L9N A;  2LC2 A;  1H9T A;  2ISY A;  2Q2E A;  5EYR A;  4A6E A;  3RZD J;  1BOA A;  2CJJ A;  2EWN A;  2Y0S A;  1K79 A;  2BY3 A;  2Y31 A;  3DWL E;  4XOP A;  2E19 A;  3O8H A;  3FXR A;  1WI3 A;  1I6X A;  5E79 C;  1ONV A;  2YS9 A;  2ZFU A;  3TP0 A;  1H9G A;  1KYW A;  5EJC A;  1YRN A;  3HGY A;  3K1N A;  1F9N A;  5EGO B;  2IXS A;  3BJO A;  5FD6 A;  3I59 A;  3OYG A;  3GZN B;  1D1A A;  2PJR B;  1DUX C;  2VT2 A;  2LSO A;  4B4C A;  2P6T A;  4MIM A;  3QOE A;  3GCM A;  3GXO A;  3C2H A;  1R22 A;  1DQU A;  4JQF A;  2ZFW A;  3SDG A;  5L3F A;  1HLV A;  3V8K A;  2NRA C;  1LVK A;  1L3L A;  2JSP A;  2ISZ A;  3FXK A;  3F8M A;  1VND A;  2XAQ A;  4O6J A;  4WXD A;  4RA2 A;  3ERE D;  2QA4 I;  1N77 A;  1U5T B;  2TRT A;  1D1C A;  3BTI A;  5EEH A;  2W57 A;  2JK3 A;  4CCJ A;  4D9J A;  5IYC J;  4KIC A;  3CD6 I;  3K2Z A;  1X4O A;  1XSX A;  3SZT A;  1TWH J;  1QZY A;  2LLK A;  3TMO A;  5FRN A;  1LE8 A;  2R5Y A;  4L9V A;  4YIF A;  2LTP A;  3FIW A;  1PUE E;  3A0H C;  1P7I A;  4BXX J;  4G8X A;  3FM5 A;  2PMZ N;  5LGN A;  3KZI C;  3I54 A;  1R71 A;  2VKH A;  1HOM A;  3F9K A;  4ZYH A;  1WRJ A;  1B9M A;  1FPQ A;  3BJ6 A;  4D5F A;  2K02 A;  2X1E A;  3K4K A;  4IHV A;  1MMN A;  2M45 A;  2JA8 J;  2JA7 J;  2VUM J;  1WH5 A;  3CCQ I;  2VKE A;  2EJR A;  3RYR A;  1TTY A;  1Z3Y A;  3TQN A;  4ETS A;  2M8G X;  1S6L A;  2J5O A;  1ETW A;  3E6B A;  5DCF A;  3ZOB A;  2FQ4 A;  2WAE A;  2CQQ A;  2DMQ A;  4GCV A;  5FRM A;  1Q1V A;  2L7K A;  5FKO A;  2CUZ A;  3BZK A;  3A02 A;  3WU1 B;  1BW6 A;  3BR6 A;  2HQA A;  1JGG A;  1MH3 A;  2KIU A;  2VAS A;  4E7Z A;  3OWT A;  1APL C;  3WHC A;  3H5R A;  1SVM A;  1FBS A;  2V7F A;  1STZ A;  3OYN A;  3S1Q J;  1FLI A;  3RDI A;  2DPD A;  3G71 I;  3KX2 A;  1R4M B;  3RKX A;  2WV1 A;  2A69 F;  5KHD A;  5E1Z B;  1B1B A;  1Z67 A;  3MEX A;  1FT9 A;  1W5T A;  2M2E A;  2OBP A;  3VYS B;  3WOD F;  2VOD A;  4A69 C;  3ZP5 A;  3DV8 A;  4E6K G;  5K5Q A;  2HVR A;  4EGZ A;  3W6V A;  3SZG A;  5FD5 A;  3VYR B;  2COB A;  5IOZ A;  4PK4 A;  1PVE A;  1IXC A;  2PMZ A;  5LEK A;  3E6C C;  3M4O J;  2JA2 A;  3IH2 A;  3I0T A;  1YQA A;  3BR0 A;  3I4P A;  3ZXS A;  3SXY A;  5IP6 A;  3HG9 A;  3NWS A;  2DA5 A;  2PX9 A;  2UV1 A;  2CYY A;  4M3E A;  1X1P A;  2DLL A;  2Y9Y A;  3K2A A;  4R8H A;  1TQP A;  2BV6 A;  2LOO A;  4RLQ A;  2E2I J;  2KZG A;  2E1M B;  2ACJ A;  1GV5 A;  3ZMZ A;  1XMK A;  3W6K B;  4M9X A;  5M5Y J;  3LOC A;  2LVS A;  3HGG A;  4XLC A;  1WJ5 A;  4AWX B;  1W36 D;  3IAS 2;  3CF5 F;  2HR3 A;  1VQ7 I;  2V9K A;  3BTL A;  2VBW A;  3RSN A;  2MFZ A;  2JZY A;  2IJL A;  2VQH A;  4ZDO A;  4JOM A;  1YX3 A;  3GFJ A;  2XRO A;  2FJ1 A;  2K9Q A;  5DCM B;  2HS5 A;  2EV0 A;  2HQR A;  1UCR A;  5D8K B;  4LJZ F;  2CFO A;  1XGM A;  4HV6 A;  4QWQ A;  2RVC A;  1LVA A;  2KJB A;  5GP9 A;  1Q1H A;  2LFB A;  2F48 A;  2KRH A;  2WY7 Q;  5FKK A;  3TGN A;  2IW5 A;  2ID3 A;  3CC4 I;  4G6Q A;  3S2H J;  3CMM A;  2OTL I;  3CCR I;  3P9I A;  4M6V A;  1D5V A;  3DPT A;  3VOE A;  2I10 A;  1TLH B;  3P9C A;  1OLT A;  1QQI A;  4A0Y A;  2X1C A;  1E3O C;  5F27 A;  1RKW A;  1DDN A;  3B73 A;  4I7H A;  2XPV A;  5B66 C;  1O4X A;  2R7Z J;  4MEY F;  1TWC J;  3SHF A;  4OU0 A;  4A3I J;  1VTN C;  4C2T A;  4FE4 A;  1BIA A;  2E7X A;  2ETH A;  3RYP A;  4HA8 A;  1CQT A;  4HDV A;  1T56 A;  3W6J B;  2CW0 F;  2FOK A;  3OL3 A;  2NOG A;  2DI3 A;  5K7H A;  2NNY A;  1DP3 A;  3CUO A;  2WY8 Q;  4O5V A;  4DGW B;  1O57 A;  2AO9 A;  3MZ8 A;  4YII A;  4BL0 B;  3HZJ A;  2LF7 A;  1A5J A;  4FQG A;  4IL6 C;  5EDN A;  2YX7 A;  2GLO A;  2FML A;  3KYL A;  4ZYD A;  1WJE A;  4KIS A;  2M4G A;  5J3L A;  5KCM A;  1Y0N A;  2K86 A;  5F6F A;  1OYW A;  4IHX A;  3G73 A;  2PLY A;  3F23 A;  2P8T A;  3JSP A;  3DEE A;  1EKE A;  5F04 A;  2CSO A;  3ZMD A;  4IF4 A;  4NDL A;  4EV0 A;  4A6D A;  3FXU A;  3HRT A;  3CCM I;  4XSX F;  3ELK A;  2R5Z B;  5E20 A;  4XLA A;  3IL2 A;  3DPL C;  3ZGK A;  4R1H A;  1MBE A;  2YUS A;  2DJI A;  2IAI A;  2KL4 A;  3GFI A;  1BJA A;  3FM3 A;  1YG2 A;  1LB2 A;  3WU2 C;  3ZQC A;  1V54 H;  3EUH A;  1HSJ A;  2XC7 A;  4ABZ A;  3J7Y J;  3DTI A;  1MDM A;  2CQX A;  3K0L A;  1VQ5 I;  2A61 A;  3BP8 A;  1TW2 A;  2ZNZ A;  2ZSI B;  3L7W A;  2R7T A;  1Y6I A;  2JRM A;  5BQT A;  5H2F C;  4CHU A;  2VN2 A;  2EZK A;  3J81 Z;  2BHY A;  3AG1 H;  4L0Z B;  4KIF A;  1O3T A;  2VQG A;  1KU2 A;  2WAD A;  2O8X A;  4DZP A;  2VXZ A;  3S3O A;  2WTE A;  3ABU A;  4LMY A;  3M8J A;  1LKX A;  1X3Z B;  2DMT A;  1UHM A;  1V4R A;  2OQR A;  3M8F A;  1BIB A;  3H3U A;  2VBX A;  4MFE A;  1W7P B;  2NXN B;  3E7L A;  2HPM A;  3FWE A;  2L7Z A;  4I02 A;  1OKR A;  4MO7 A;  4PJJ A;  4RM3 A;  2A5W A;  4B8X A;  4J01 A;  1W7P D;  3SFZ A;  3HOV J;  1TP4 A;  3M9A A;  2VE9 A;  4LIT A;  2IT0 A;  2X4H A;  4B47 A;  4M3F A;  5BNG A;  5JLW A;  4QPO A;  5DV5 A;  4S0H B;  3JW4 A;  2JVG A;  3KZZ A;  3KZY A;  3HPG A;  4RGS A;  5GAG J;  3BG5 A;  1YYV A;  5J8F A;  1QPM A;  1USS A;  1QZE A;  2X48 A;  4YIR X;  1S5L C;  5EG0 A;  2BVM A;  3K4M A;  4AIJ A;  4EGY A;  4ASN A;  3KP5 A;  1K7A A;  1V5F A;  3BRO A;  3FXL A;  4JP0 A;  5DUI A;  1XGS A;  4RGU A;  1KU7 A;  2F4O B;  3EQL F;  3CUQ A;  2RRE A;  1WSU A;  2YPR A;  2P7C B;  1R9T J;  4GYI A;  3GEZ A;  5J1U A;  2OZ6 A;  2QVO A;  1JKQ C;  4HAM A;  3DP7 A;  2XHK A;  1BC8 C;  2ELJ A;  4XRS A;  2E5Z A;  2V1X A;  1FZP B;  2B7E A;  2HVS A;  2DA6 A;  3OMY A;  5ERI A;  3DEW A;  4EM2 A;  2CW7 A;  1HQC A;  5KNL A;  4Y52 J;  2UXN A;  2E2J J;  3QYE A;  3KYC B;  2GA1 A;  3QRF F;  4EJO A;  4KN4 X;  5FFZ A;  3VFZ A;  3CF2 A;  1AOY A;  3KLO A;  3CCE I;  1E2X A;  4XLN F;  3RKQ A;  2LKX A;  1BW5 A;  4XON A;  1WHU A;  4WCG A;  2A07 F;  1ETY A;  4BQA A;  3T8R A;  1JT0 A;  4PFP A;  3LQQ A;  3MWM A;  2EIN H;  1LFP A;  2VPR A;  2W48 A;  4XRM A;  3KFW X;  3HHH A;  1D0Y A;  1Y39 A;  1PP7 U;  3HTS B;  1BJZ A;  2FBK A;  1Z21 A;  1KA8 A;  4WXC A;  5DCM A;  3LNQ A;  1WJC A;  4OIQ F;  1LFU P;  3B6C A;  3RPU A;  2YX4 A;  2ZME A;  1ZAO A;  3MD2 A;  1H0M A;  3PO2 J;  3TOA A;  2M7B A;  3JRH A;  2D1V A;  2O0Y A;  2L9R A;  3K4B A;  2OD5 A;  4NC6 A;  2CH0 A;  2DQR A;  1ACI A;  1W5S A;  1W7P A;  5DUK A;  5H6Q A;  4MTD A;  1VQ9 I;  1GXP A;  2RQP A;  4FX4 A;  4KFC A;  2NS7 A;  2K7L A;  2M87 A;  4B1R A;  2H27 A;  1V55 H;  1T8I A;  2V79 A;  3OOU A;  3U21 A;  2D5V A;  3U9G A;  1HXD A;  1RUN A;  4GGG A;  1ITY A;  1QRY A;  4XNF A;  2FX0 A;  2HZD A;  1DU0 A;  3T0Y A;  3BCB A;  4YEJ A;  2VC0 A;  2UXX A;  3MFK A;  4IQ4 A;  3WTT C;  4PJM A;  2MBF A;  1IRF A;  2A6T A;  1W36 C;  2AQE A;  2P6S A;  3ZQF A;  3AAF A;  2Z3Y A;  3LSH A;  2WAQ N;  3CDI A;  3F8F A;  4BKX A;  4A3M J;  3LQR A;  4LD5 A;  1ZEL A;  2ELH A;  2XAH A;  2MG4 A;  4EM0 B;  2V6C A;  1RPW A;  1FIP A;  3I9V 2;  1U78 A;  3OV8 A;  5K5O A;  2MC3 A;  3GFL A;  3CO6 C;  3EYY A;  1XDS A;  3CMY A;  1CF7 B;  1IV8 A;  2KMU A;  2YSR A;  5IY5 H;  2L54 A;  2CQN A;  2RKH A;  2ZKZ A;  2Z16 A;  1AKH B;  3CJQ B;  1RUO A;  1LDK B;  1P4A A;  2R7D A;  3R61 A;  2R7W A;  3P7N A;  5D5V B;  2QQB A;  2VQL A;  3WGH A;  2HXI A;  1L0O C;  2BYV E;  4IO9 F;  3PUB A;  3A2K A;  3O6B B;  4XK4 A;  3E0J B;  3PIO F;  2FSW A;  3FZV A;  1LEB A;  2CO5 A;  2MLK A;  1JHF A;  4B48 A;  2R7Q A;  2DTR A;  2BVL A;  3FK6 A;  4QIW N;  1UEL B;  2N8G A;  1MH4 A;  2AS5 F;  1Z7L A;  3HB9 A;  3LSG A;  5EGO A;  2P7V B;  4OIR F;  1SD5 A;  3KP2 A;  4XRF A;  1J09 A;  2HOA A;  5HLG A;  2R93 J;  3DTE A;  3HSE A;  3TDU C;  4EEF G;  4Y7N J;  1NG7 A;  4EMS A;  1NK2 P;  3KIO A;  1OCO H;  4LG3 A;  3ZQQ A;  3GW2 A;  3PM1 A;  2R4G A;  1SFO J;  5H6R A;  2RNG A;  5LHI A;  3B02 A;  1I1S A;  2JPC A;  1C0W A;  1D5Y A;  1JI8 A;  4EAT A;  2LD5 A;  3KP3 A;  2CW8 A;  1HW5 A;  2YU3 A;  4MFD A;  1X3U A;  2P81 A;  2IGK A;  4OAY A;  4BE2 A;  1ZR4 A;  2CS3 A;  1HKS A;  5GTI C;  5BPD A;  1BM9 A;  1GVJ A;  1J2X A;  2XAF A;  4II2 A;  1HA8 A;  1IO2 A;  2MD5 A;  2LKS A;  3LAJ A;  3I4M J;  3BC8 A;  5DM6 F;  5B1B H;  4A3J J;  5A2Q K;  1YIT I;  2B63 J;  2ELK A;  3FXM A;  3OY9 A;  2L7M P;  3OL4 A;  1ZGW A;  3JRI A;  1O7L A;  2PQ8 A;  2LK2 A;  2UZK A;  3BTJ A;  4PJ0 C;  1XMA A;  3KCC A;  4I01 A;  3OSF A;  4F52 A;  2HOT A;  2V9P A;  3NWT A;  3PNY A;  5FGM A;  2FMY A;  2FE3 A;  2RV8 A;  1WJB A;  3CME I;  3LSP A;  1SC7 A;  4M73 A;  5F64 A;  4IKF A;  3BQY A;  4BY1 J;  3D5R C;  4G9Y A;  3IRR A;  2UWM A;  1T08 B;  2ESH A;  2VT3 A;  1FTT A;  2DCE A;  3AG2 H;  3ASN H;  3NRV A;  2DOE A;  4I0B A;  1G3W A;  4CGZ A;  1S7A A;  4IX7 A;  4IPA A;  2XGE A;  2WV0 A;  2ZJ2 A;  1ZYR F;  2R7S A;  2BE5 F;  3G6E I;  2DXI A;  1SFU A;  3WTX C;  3AG4 H;  5M5X J;  3HKZ A;  1ZLK A;  3TP3 A;  5M5W J;  1HDD C;  4Y13 A;  3QOD A;  4KA4 A;  4BDZ A;  4PCQ A;  3BPV A;  3CCJ I;  3T1B A;  1KZH A;  3HOY J;  1LPQ A;  3CO7 C;  3I64 A;  2NVX J;  3OS2 A;  4MQ9 F;  1U5T C;  3ONQ A;  3OYA A;  1DGR M;  4E7L A;  1R4N B;  4IRG A;  2P5V A;  2VBZ A;  2FRH A;  5JLX A;  2GAU A;  3WE2 A;  4AU7 A;  5L3B A;  5F1R A;  4WK8 F;  4CH7 A;  1OCC H;  2XV4 S;  1V5G A;  1F1Z A;  2XIG A;  3UR3 C;  2A68 F;  1BC7 C;  3LSK A;  4HBL A;  4CYD A;  5D8L B;  1ETX A;  3NAR A;  2RQQ A;  5C44 J;  3LST A;  4OMZ A;  1ZAR A;  2OZU A;  3I59 B;  4HW0 A;  3S1M J;  1GT0 C;  2L5Q A;  4C3I J;  2BGC A;  4E7I A;  4O3M A;  3S3N A;  2NVU B;  1GUU A;  3W2V A;  5HDK A;  1ZRD A;  4I09 A;  4F91 B;  4C2U A;  3JRC A;  2K85 A;  4I99 C;  4KDP A;  5F0F A;  2QM3 A;  1PP8 F;  1T98 A;  3OYJ A;  2M7A A;  1X58 A;  4EJV A;  5LHG A;  3AL0 C;  2HI3 A;  4GYG A;  2M5W A;  2QSF X;  2XAU A;  4OWR B;  2YU9 J;  3K1M A;  9ANT A;  1OR7 A;  3R60 A;  3S14 J;  2KQR A;  4LG0 B;  1ZKG A;  5D5X B;  2AXL A;  5FLM J;  3GX4 X;  4CCO A;  3FK7 A;  3C2B A;  1T0F C;  2ECC A;  1I50 J;  1BBY A;  5JI6 A;  1S8N A;  4EM1 A;  4C30 A;  3QYB A;  3RPQ A;  1YHQ I;  2ZJQ F;  4CIC A;  4V2G A;  1K83 J;  1PJR A;  2HEO A;  2HDW A;  2QSH X;  2PJP A;  1PYV A;  2EA2 A;  4L9N A;  1G2H A;  4WWC A;  3IWZ A;  5H20 A;  3V7S A;  3LL7 A;  5ICC A;  3DU5 A;  2KLO A;  5CLS A;  1K78 A;  1Z6T A;  3VSL A;  4UUS A;  2IS1 A;  2M4K A;  4AID A;  1CGP A;  4XID A;  2MC4 A;  4XKC A;  2VOO A;  3K4C A;  4Z6Y A;  1B72 A;  2GA2 A;  3I4N J;  2V26 A;  1K6O A;  3TKY A;  1SAU A;  4LLG F;  1G8X A;  3MKW B;  1SFE A;  2XAJ A;  5C4J J;  3KEO A;  1TWA J;  4MTE A;  5EF6 A;  3CC2 I;  3ABL H;  5HLH A;  4PGG A;  1Z3X A;  4BBS J;  1X19 A;  4MGR A;  1SFX A;  3V8J A;  3RPU D;  4BXF A;  1X4P A;  2Z1D A;  2V1U A;  1TWG J;  4G94 A;  2V1N A;  4BGD A;  3S16 J;  4Q4Z F;  4KUM A;  3W2W A;  5HNF A;  3HBL A;  2D2W A;  4PJL A;  1VQ8 I;  3H0G J;  4U0Y A;  2KZV A;  5DD8 A;  2STT A;  3E97 A;  3BT9 A;  4AM3 A;  2EQR A;  4AC0 A;  4DQ2 A;  5IYB J;  4U0V A;  2DAO A;  1WKM A;  2MA3 A;  2EIK H;  3VB2 A;  3CES A;  3WTZ A;  3F6O A;  2HNH A;  2R7V A;  4ANJ A;  4ZJZ A;  2BEO A;  4ITV A;  5KK1 A;  1OMI A;  1EF4 A;  2IRF G;  3HOT A;  1VQO I;  3Q3S A;  2O6G E;  2DOA A;  4XN0 A;  3BQZ A;  1YW7 A;  1TT5 B;  3DU6 A;  3DPU A;  5DD4 A;  1UJ8 A;  5C3E J;  1MND A;  4RMN A;  3G1L A;  3DTK A;  2EV6 A;  1TT0 A;  1ULY A;  1D0X A;  2H94 A;  5TRD A;  4S05 A;  1T2K A;  1K4T A;  1J7K A;  2GIV A;  2KFD A;  1W1W E;  5F08 A;  2XSJ C;  1YW9 A;  3TO6 A;  4Q47 A;  3CTA A;  4EVI A;  2LYC A;  4DNC A;  3MMY B;  3L9F A;  5K5R A;  1R1V A;  4LK1 F;  2NS0 A;  2VKV A;  1FSH A;  2R7O A;  3CCL I;  3ECH A;  3T5X A;  4CZZ A;  1RIO H;  4GFB A;  4BYY A;  3RCO A;  3SDB A;  4A3F J;  3JRE A;  1D8J A;  1XSV A;  5E8I A;  1R5G A;  3OYL A;  2PG4 A;  3CZ6 A;  4XKV A;  4HF2 A;  5ILV A;  3TED A;  2KDZ A;  1AHD P;  2W85 A;  2ID6 A;  3FXQ A;  3H35 A;  4RAF A;  3C3W A;  3S3M A;  2JMW A;  3RKY A;  3JCU C;  2E60 A;  4QPQ A;  1P4W A;  3JTH A;  3G1M A;  1XS9 A;  1M1E B;  3HXL A;  1FX7 A;  2ZB9 A;  5FKN A;  2XF6 A;  3MKL A;  2M1B A;  4LB6 B;  3SYT A;  1TNS A;  2XF7 A;  3OIO A;  1HF0 A;  1ZRC A;  4QLC U;  2VJJ A;  2W24 A;  3RI4 A;  1BL0 A;  1MBF A;  2GXB A;  3HUG A;  3M1C A;  1R49 A;  4GXO A;  2M0M A;  1IDZ A;  3I53 A;  3L00 A;  3GVA A;  1BI1 A;  5AON A;  4D1Q A;  2DA2 A;  2K3P A;  3K70 C;  2EPF A;  3QWL A;  4YEL A;  2DFF A;  2MW8 A;  2JRT A;  2CG4 A;  2GM4 A;  3FKJ A;  3S17 J;  3DKY A;  2LDU A;  4P1W A;  4NNJ A;  5GPA A;  3DBL B;  3FMQ A;  2H1L A;  4HYE A;  4S04 A;  4BH9 A;  1BOB A;  2IGN A;  4I6Z A;  3FX3 A;  4D7M A;  2EA4 A;  3HOX J;  1Z6R A;  1YI2 I;  2M9H A;  4KMU X;  1FOW A;  3WG9 A;  3L1P A;  2STW A;  2QBY A;  3WTS C;  3L09 A;  1B72 B;  1MIJ A;  1BR4 A;  2GQQ A;  2JPB A;  1Z91 A;  2OQG A;  4OIN F;  3QPL A;  2PI0 A;  2R7F A;  4B3A A;  2VJ4 A;  1IN4 A;  1XG1 A;  3I5U A;  3UKG A;  2QLZ A;  2A5Y B;  4M3B A;  1DPR A;  4DBR A;  3M1E A;  1XDU A;  5LHH A;  2ZXJ A;  4UUV A;  1E17 A;  1LFB A;  3E5X A;  3BG7 A;  2VPL A;  2FD5 A;  4XLH A;  1BN5 A;  1FC3 A;  1XX5 A;  2K9L A;  2G0E A;  2E5N A;  4D7N A;  1SMT A;  2CV1 A;  1Z7U A;  1EH6 A;  4A0Z A;  3J80 K;  1IJW C;  3ZR8 X;  4RAG A;  3PFY A;  3ESW B;  3U2R A;  2ZXW H;  4F55 A;  1HC8 A;  1YO5 C;  4XKW A;  1FOX A;  1XMX A;  2O7O A;  5TGT A;  1J5Y A;  4DYQ A;  1A35 A;  1FNN A;  3HSF A;  4UHT A;  3LAP A;  3BLY A;  3CP2 A;  3MZY A;  3IKT A;  4IOC F;  3E6D A;  1IZ1 A;  4NC8 A;  3VSK A;  1YX5 A;  2KT0 A;  4GRI A;  4BAY A;  5IOY A;  4ENK A;  1U0J A;  4B09 A;  3BCA A;  3V8L A;  3BDD A;  4LFU A;  4G7O F;  3TDZ C;  3O3K A;  4HDU A;  3QOP A;  4MQV A;  4FHT A;  3RQ4 A;  2O9L A;  1KYZ A;  3DKW A;  1OQY A;  1JJ6 C;  4P9U A;  2G7H A;  2Y0M A;  5E17 F;  3ZMU A;  3C7J A;  2WC2 A;  3HTU A;  4M3D A;  1JGS A;  1JUS A;  2Z5U A;  4KN7 X;  2Z9O A;  1RZ4 A;  2QGU A;  3L2C A;  1RNL A;  5CKT A;  2F6C A;  3F22 A;  2HDC A;  1BI3 A;  5BPI A;  4JK1 X;  2E1M C;  3HL2 A;  3OR2 C;  1GLN A;  4DYR A;  2JA6 J;  3S1N J;  4AYB A;  2KIQ A;  3WU0 A;  3BTC A;  4G7H F;  3BR5 A;  5BMZ A;  2W25 A;  1ZG3 A;  1FTZ A;  1B59 A;  1B9N A;  4A3K J;  4ON0 A;  3GUD A;  4FCY A;  2ZXI A;  1W4M A;  2TCT A;  2L4A A;  2EK5 A;  3IP4 B;  3JAM Z;  1TQI A;  3E1S A;  5DDG A;  2NS8 A;  4F7Z A;  3S2W A;  1R36 A;  1W5C C;  3LA2 A;  4UUT A;  4BAC A;  4FTH A;  1CF7 A;  4A2U A;  2EIL H;  3J7Z I;  1VQP I;  1X1C A;  5ICE A;  2ME0 A;  4DYC A;  1S7E A;  5IT9 Z;  1R00 A;  3Q9S A;  3R4K A;  2CUF A;  1UST A;  5HNH A;  2ZJP F;  4E7K A;  3COA C;  1O3R A;  5CVI A;  2FUG 2;  2EFW A;  1A6Q A;  1P4X A;  3QP5 A;  5B1A H;  5GAE J;  2OJE D;  3HJE A;  4L5J A;  3GTK J;  3RZO J;  1XTA A;  3CP8 A;  4XIC A;  3EPZ A;  3CCV I;  3OYM A;  4Q5S F;  4BUP A;  2KHM A;  3PFI A;  2DPU A;  2ZBK A;  3JRB A;  2WB1 A;  2BZT A;  4X1E A;  1MGT A;  2MAB A;  3N4M A;  4CA0 A;  2VXD A;  5JR3 A;  3LSJ A;  3UNG C;  3T8T A;  3OYI A;  3J7A O;  3HKZ N;  1FY7 A;  3PO3 J;  5FFX A;  3SFI A;  2DT7 B;  1Y8R B;  1H88 C;  2EZI A;  4BNC A;  2HOS A;  3EUH C;  2X9D A;  2VKD A;  1N25 A;  4PDK A;  3HOS A;  5L3C A;  5EZH A;  2ECB A;  3AL0 B;  2L4M A;  1ERD A;  1AU7 A;  2E35 A;  1I3A A;  4P55 A;  5CPR B;  2DT5 A;  2EZH A;  4CYC A;  1ZG5 A;  1KON A;  2CFX A;  2XRN A;  4G6T B;  4C2M J;  4CUG A;  1DU6 A;  2XPU A;  1PUF B;  3ZN1 A;  3CDH A;  2X1D A;  5CVJ A;  2IA1 A;  3EYI A;  3SQN A;  2K27 A;  4UVC A;  1YTY A;  1REP C;  1SD7 A;  4OIO F;  3O8G A;  3J7A Y;  3BG6 A;  3RIR A;  2VE8 A;  1RET A;  2HKX A;  3L2W A;  2B0L A;  4CCM A;  1EJ9 A;  1RC9 A;  3QP6 A;  1UHW A;  1R7J A;  4HNV A;  2DFH A;  1T0F A;  4HLY A;  2DK5 A;  3SJM A;  1ON2 A;  4AIK A;  1LQ1 A;  3REO A;  2V4J C;  1FOK A;  1IXR C;  2M8E A;  1UMQ A;  4UXN A;  2DW4 A;  5JVG F;  2P4W A;  3I56 I;  5M3M J;  4DJA A;  3GTM J;  2F5E A;  1MMS A;  4PUS A;  1QPI A;  2NYX A;  2CV2 A;  3CMA I;  2OF7 A;  1T33 A;  3N97 A;  1IF1 A;  1IAW A;  4HST A;  3WGG A;  3KE2 A;  3LFK A;  3K70 D;  1ETO A;  4A12 A;  2O03 A;  3ZQI A;  4R79 A;  3I71 A;  1I27 A;  4KMF A;  2DU9 A;  2JUC A;  2HWV A;  1TL8 A;  1NTC A;  3CJN A;  5J6X A;  3F8B A;  2Y9Z A;  4RM2 A;  1FMV A;  1SVO A;  1VI0 A;  1GXQ A;  3EET A;  2P5K A;  1OYI A;  3L2Q A;  4YFX F;  4RBO A;  1K78 B;  5F0C A;  1VZ0 A;  3V7R A;  1JUM A;  1VFC A;  2IVM A;  5HOD A;  3PL8 A;  2OA4 A;  4XQF A;  2PEX A;  1YIO A;  1OPC A;  1QVT A;  4HX8 A;  1B8I A;  3WTU C;  2EFQ A;  1SFK A;  1Y56 A;  1H89 C;  3ABK H;  1JKO C;  2VB6 A;  3NEU A;  1FSE A;  3FKI J;  2HVQ A;  4KIB A;  2HYG D;  2MH9 A;  4M6X A;  1YOV B;  3R6S A;  2JVH A;  3IV5 A;  4IHS A;  1I5Z A;  1JJ8 C;  3HOU J;  1X2M A;  3K4L A;  2K9N A;  5GTH C;  4GO1 A;  4JX6 A;  2XKO A;  3J81 K;  2RN7 A;  5GPC A;  3I55 I;  2ZME C;  1WJA A;  2WA0 A;  1I3Q J;  3VYT B;  1JKP C;  3GTP J;  2MLG A;  2C6Y A;  2KIF A;  1MW7 A;  3E5Q A;  3BJA A;  2F2E A;  4G12 A;  2E1N A;  2CRG A;  4BE1 A;  1IC8 A;  4Y17 A;  4HQM A;  2CV0 A;  3LA3 A;  2H8R A;  3IUO A;  4A3C J;  1MJB A;  5E18 F;  1UFM A;  2EFO A;  3ZMV A;  5E3O A;  4BQQ A;  3WG7 H;  1IW7 F;  2XF5 A;  2F5V A;  1RR7 A;  5HS9 A;  1Y1W J;  1F43 A;  1HKT A;  3QU6 A;  3F6V A;  2LH9 A;  1RKT A;  2WB1 N;  1YIJ I;  1N78 A;  1R23 A;  5D4S A;  2ZC2 A;  2XSD C;  3CLQ A;  4RGR A;  1AWC A;  1OCR H;  1WPK A;  4UNO A;  4BDY A;  3M3Y J;  4Q48 A;  1IN8 A;  1G59 A;  3PJR A;  3ZPL A;  2XGX A;  3AKZ A;  4EJT A;  1IRZ A;  3G1O A;  2IS6 A;  4M6Y A;  2VJ5 A;  2L3D A;  5KAI C;  2BY1 A;  3WTW C;  1VQN I;  3TL4 X;  1MSF C;  3ABM H;  1ZN2 A;  5E3M A;  5TJJ A;  3Q5F A;  2HU9 A;  1R5H A;  1NK3 P;  2LR8 A;  3H9Q A;  2KIS A;  3HOZ J;  2K5C A;  5LEJ A;  3Q0V A;  1T38 A;  1HW2 A;  2VI6 A;  1S29 A;  5JHF A;  4CZC A;  1B6A A;  1XN7 A;  1P6R A;  2BY2 A;  2ME6 A;  3HDD A;  1S3J A;  2DBB A;  2QCO A;  4FIS A;  1IV6 A;  2DDB A;  4PFO A;  2X6W A;  2DMN A;  4RB1 A;  1JE8 A;  4CCK A;  1PDN C;  1U6G A;  3S15 J;  5D5W B;  4KT6 A;  1P92 A;  2M3A A;  4ZZL A;  2ESN A;  3RQI A;  3ZMS A;  4KNY A;  4LOC A;  3MQ0 A;  2ICW G;  4XM3 A;  4K2E A;  3HUG B;  1OR7 C;  2KRC A;  3SZP A;  4F93 B;  5IPA A;  1TBX A;  2MSY A;  2JWT A;  5F0H A;  1YJ9 I;  2V9V A;  1X1B A;  2F5D A;  4PZJ A;  2CQ7 A;  3MN2 A;  2M0C A;  3PUF A;  3TW6 A;  4BE0 A;  4ZTF A;  3GZ6 A;  5J1Y A;  1O3Q A;  2XVC A;  1FJL A;  1WI9 A;  4U88 A;  3CUQ B;  3ULQ B;  2W00 A;  1YFH A;  2A3S A;  2Y2Z A;  4H0E A;  4G6D A;  5HOO A;  2GXA A;  2CQK A;  5L3D A;  4XBF A;  3HPH A;  3M07 A;  5J8C A;  1UB9 A;  4EJU A;  3FDY A;  4BEH A;  4A93 J;  4UVB A;  4ESF A;  3OYB A;  4DW6 A;  2HGC A;  2LY1 A;  5FB2 A;  2RAE A;  1KU3 A;  3G3Z A;  2VBY A;  3F3X A;  4NQW B;  5J4V A;  4XSZ F;  1GV2 A;  3GWZ A;  3I58 A;  3CCY A;  3OYE A;  1KGS A;  2L9S A;  5CQE A;  2KKO A;  2QEN A;  3ML6 A;  1XCV A;  3GME A;  3PQJ A;  4LIV A;  4J00 A;  3ASO H;  1QU3 A;  1U9O A;  2IA0 A;  1ZRF A;  4FET A;  4ZH4 F;  2I8D A;  4L5I A;  4X0G A;  1FMW A;  1Z9C A;  4M9S A;  4HF1 A;  2LBF B;  2DMU A;  3ERM A;  4Y4R A;  4ZDL A;  4RLF A;  3TBI A;  2L02 A;  3FIS A;  4HNT A;  5JVT A;  4XN3 A;  4OIP F;  5E1X A;  1P2F A;  2LF8 A;  2CWE A;  3FXJ A;  4HPQ A;  3HYI A;  4F92 B;  4CSW A;  2Y48 A;  5LLQ A;  4Y15 A;  3C18 A;  2RNJ A;  3DXJ F;  1SVL A;  3IKV A;  5ICG A;  5FJ8 J;  1T39 A;  1IRG A;  4ENJ A;  1MBH A;  2H8W A;  1Y8Q B;  3BOQ A;  3JTG A;  2R7U A;  4FX0 A;  4H4K C;  3F8C A;  3GZ5 A;  4AYB N;  1QBJ A;  3GLL A;  1MBK A;  2IPQ X;  3K7A J;  2R3S A;  4I76 A;  1EA3 A;  2XB0 X;  4LIU A;  3OIP A;  4UY8 I;  5EZG A;  5J1R A;  2XDV A;  2DFE A;  3IAM 2;  2E7W A;  1BI2 A;  1UHS A;  3G2B A;  4ENM A;  1QHG A;  1P9Q C;  2JA5 J;  4LG0 A;  3IH4 A;  2K9M A;  1FBQ A;  1E3P A;  1WJF A;  4XOT A;  5LRS A;  1ZGJ A;  5CQG A;  3H1C A;  4YG2 F;  3GTL J;  3KLN A;  4NB5 A;  2V6E A;  1FYK A;  4MNU A;  1ENH A;  3KYD B;  3GTG J;  1YLF A;  2HKO A;  1DGW Y;  1QGP A;  4JBA A;  3K4N A;  4P5O A;  1KQ8 A;  4IHT A;  2L9V A;  1F4K A;  3K4J A;  2KJC A;  4ZZD A;  4RAY A;  5FKM A;  1HKQ A;  4OMY A;  1LJ9 A;  2Z2S B;  5CYV A;  1IRX A;  4V19 K;  2O3F A;  3TOB A;  2O8K A;  3QPH A;  1QA6 A;  4F3Q A;  3LFU A;  3MKY B;  3K69 A;  2KP6 A;  2Q8K A;  1BR2 A;  1D0Z A;  5L3E A;  2ZSH B;  2CUE A;  1G3S A;  2JT1 A;  1SMY F;  4V2F A;  1LE8 B;  2XKP A;  2HTS A;  3WE3 A;  4UB6 C;  3OYF A;  2Q0O A;  4RB0 A;  4A3D J;  4DBQ A;  5HS7 A;  1XGN A;  3FHZ A;  1J0R A;  1TC3 C;  4A3E J;  1ORK A;  5AIP A;  2Z33 A;  2AXT C;  2DA1 A;  3HRM A;  5CVR A;  5HVQ C;  4CCL A;  2FBI A;  1IN6 A;  3QPT A;  3X2Q H;  3U1D A;  5K7F A;  5DYM A;  3VWB A;  4HV5 A;  5ICF A;  3QYF A;  1ODD A;  2FXA A;  2HPI A;  5LRR A;  4U87 A;  3DLL F;  2ZNY A;  4E7J A;  4FAS D;  4XLP F;  1JUP A;  1OCP A;  2FU4 A;  3HEF A;  2WAQ A;  1NH3 A;  4BQO A;  1HW1 A;  4BJ6 C;  1FOY A;  4IJA A;  2A6H F;  2XB5 A;  3FF5 A;  4C3H J;  3P9K A;  1QZZ A;  2GBY A;  4HQE A;  2EBI A;  5B5E C;  1IN5 A;  1FYM A;  3A1Y A;  1LDD A;  2FNP A;  3DBH B;  4P96 A;  4L9T A;  3ZQL A;  1AKH A;  2HDD A;  2LRE A;  2BXY A;  3FMS A;  4QTR A;  1SEU A;  5D6E A;  1YW8 A;  4U7D A;  4GDF A;  4RGX A;  1ETV A;  3V4G A;  1KU9 A;  3IH3 A;  1HBX G;  4N0B A;  1G6N A;  2VL8 A;  4PJN A;  1FP1 D;  1TWF J;  2X85 A;  2IA2 A;  1KQ0 A;  1K61 A;  4W97 A;  5HDG A;  2DN0 A;  3W3C A;  5B3S H;  1A6I A;  4ENN A;  1UAA A;  2MYS A;  2IS4 A;  3GLX A;  1VF9 A;  4ZDP A;  4NC7 A;  5D4R A;  3WGI A;  3ZQH A;  3CDL A;  3D5S C;  1MNM C;  4ZYE A;  2NVQ J;  4XL9 A;  3PIP F;  4RB3 C;  3NQO A;  4PGH A;  5GAH J;  2DDA A;  2LRD A;  3D1N I;  2OAZ A;  3BWG A;  2Q1Z B;  2R92 J;  4BHC A;  4TV7 A;  3M8E A;  1S72 I;  3K9T A;  4LK0 F;  3J80 Z;  4X6A J;  2QEX I;  3QU3 A;  5EG0 B;  2LP0 A;  6PAX A;  3H0D A;  1RI7 A;  3G4S I;  1EH8 A;  2WAF A;  2FNA A;  4P9F A;  3E6M A;  4N4N B;  4AVP A;  2E34 A;  1R58 A;  1R1U A;  3V42 A;  3HHG A;  2JTV A;  1IDY A;  4XMY A;  4I0A A;  3PNV A;  3OS0 A;  2Y0S N;  3SEQ A;  1ZGA A;  4JX5 A;  4BS9 A;  3VPR A;  2VLA A;  4IHY A;  3RJP A;  4CYC B;  1FBU A;  3HRU A;  1JTX A;  1YE9 A;  1WH7 A;  3FBN B;  1JKR C;  1K4S A;  3GYH X;  1MMG A;  3KP4 A;  3OSG A;  1S9H A;  5BOX A;  4YFN F;  3A01 A;  2RC4 A;  1MJA A;  2VOP A;  1JHH A;  2DTZ A;  3CLO A;  1VQL I;  5ILS A;  1MNE A;  2H1K A;  3PSI A;  4HG2 A;  2LNB A;  2R7R A;  2X6X A;  2IGO A;  4BY7 J;  2KPM A;  3C2G A;  1G3T A;  2EH3 A;  4IEJ A;  3TO7 A;  5IP7 J;  1YRN B;  1J59 A;  3CJT B;  3MVP A;  4N9H A;  4G7Z F;  2DK8 A;  3V7C A;  2DOF A;  3R0J A;  2BY0 A;  5J4Y A;  3F72 A;  2ADU A;  2O5R A;  3A0B C;  3VDX A;  2ZJR F;  3HM5 A;  1Z77 A;  4BJ5 C;  2QWW A;  3BG9 A;  3H3Z A;  3BR3 A;  1BR1 A;  2QKL B;  1ON1 A;  5CVV A;  4MLO A;  3JRG A;  2DYR H;  2XAG A;  5FKL A;  4U7B A;  2L0K A;  1J9I A;  2VJI A;  2X0L A;  1A31 A;  1SAN A;  3AFH A;  2PBI A;  4E70 A;  1HDP A;  5IT9 K;  4ZYG A;  3ABT A;  2EIJ H;  3VYU B;  3M7G A;  1D8K A;  2BXZ A;  4JYK A;  3R0A A;  5LGU A;  3BY6 A;  4M74 A;  2E71 A;  2K4B A;  4ESB A;  1FEX A;  5GAD J;  3OYK A;  1W0T A;  1ZLJ A;  4BHP A;  4B43 A;  1TW3 A;  5TIS C;  1LDJ A;  3DLA A;  3LWF A;  4L0Y B;  1YJW I;  1MBJ A;  1DP7 P;  5FLV A;  2YR2 A;  4BQN A;  2PJR A;  2K3F A;  2DFI A;  3DBR B;  3OIQ A;  5EEG A;  2R7X A;  2BOL A;  1XSD A;  4WXH A;  2QZ8 A;  5L3G A;  2FEZ A;  1X1A A;  1IGN A;  2LMD A;  1WCM J;  5J40 A;  4BBR J;  1X2N A;  2QQ9 A;  4HSR A;  5IP9 J;  5DS9 A;  1OJL A;  3CJR B;  3EDP A;  3PSF A;  4Y33 A;  4UUS B;  2VIX A;  3O2P E;  2MD0 A;  1SAX A;  3L2U A;  4HOB A;  3GFM A;  1UZC A;  3GO5 A;  2XAS A;  3H9G A;  1S7O A;  2OTJ I;  2I5U A;  4N9I A;  5FO5 A;  2PMU A;  2GOX B;  3S2D J;  3GBG A;  3AG3 H;  2BBY A;  2NVT J;  1OFC X;  4LLN A;  3DFG A;  1B4A A;  1QVU A;  2F5F A;  4LGW A;  2X6O A;  4IQJ A;  2LG4 A;  3H9J A;  5D5U B;  2EV5 A;  2WBM A;  3HRS A;  3ZRG A;  3GTJ J;  1FIA A;  5FLX K;  2DJN A;  1K6Y A;  4QSH A;  5CJ9 A;  3BZC A;  5DTD A;  5E3N A;  2PN6 A;  2R0Q C;  5LBQ A;  3WTY C;  1JT6 A;  5EEA A;  5K7Z A;  4MHG A;  2JQ7 A;  2Y69 H;  1MD0 A;  2G7U A;  3EUA A;  2QQ8 A;  1AA7 A;  2DMP A;  1MMD A;  5E3L A;  3DQV C;  1WGX A;  4A3L J;  2W1O A;  2NNN A;  2P0W A;  4I98 B;  1P7J A;  1EV7 A;  1R5I D;  5HDN A;  1E3H A;  5HS8 A;  1W0U A;  4EQQ A;  2PMH A;  3K1P A;  3ZQ7 A;  2PFB A;  1X3W B;  1IN7 A;  2FQ3 A;  1XD7 A;  1Y1V J;  1ZHF A;  3SEZ A;  5A2Q Z;  4EJW A;  5C4X J;  5KVR A;  4WF2 A;  2O61 A;  5HLI A;  2IEK A;  4XOR A;  4AVZ A;  2EB7 A;  3QAH A;  2HOE A;  1IUY A;  1D3Y A;  1BI0 A;  2HFH A;  2Q2E B;  4IHW A;  1RRJ A;  3IC7 A;  4HNU A;  3JSO A;  2D1H A;  1XCB A;  2JJ7 A;  3QPS A;  1POG A;  3F0C A;  4BEH B;  1V5E A;  4IZZ A;  3KET A;  2Z99 A;  4IVN A;  1QO0 D;  2KDO A;  1HST A;  1X1D A;  2JSC A;  4MEX F;  3JAM K;  2LKP A;  3IWF A;  3JR9 A;  1VQK I;  4ZTJ A;  3MKZ A;  2E2H J;  3S32 A;  3K6G A;  1H8A C;  1T95 A;  1V3F A;  1G4D A;  3EUK L;  2GIZ A;  3CQZ J;  4M3G A;  1LEA A;  2A6E F;  5JFR A;  1MKM A;  4HX7 A;  3E3V A;  1XB4 A;  4HX4 A;  2HQN A;  4XKB A;  3FXO A;  1U5T A;  1XC5 A;  2DOD A;  1U8B A;  2L2O A;  3LA7 A;  4WX9 A;  4E7S A;  1U3E M;  2HXO A;  1YS6 A;  2VC1 A;  2W4S A;  3GF2 A;  5FLX Z;  4KJZ A;  2X6Y A;  2CGP A;  2COM A;  3FMR A;  3A03 A;  1UG2 A;  2OPT A;  2VON A;  5LGT A;  3BG3 A;  4NUB A;  2M34 A;  2F5C A;  4N4O B;  4XRS G;  4IOA F;  4W1U A;  1TQM A;  2GWR A;  2R5Z A;  4J19 A;  2JUG A;  1FP2 A;  4XR6 A;  3HOW J;  3KEQ A;  4AIH A;  3TW7 A;  1OCT C;  2OU2 A;  4RAZ A;  3ISP A;  4ZYA A;  4A3B J;  3HC7 A;  2MH2 A;  4BHB A;  1IUF A; 
#chains in the Genus database with same CATH homology
 4FT8 A;  2HZT A;  4M9Z A;  2HTJ A;  1J75 A;  3D0S A;  4MEX F;  1F5T A;  2RDP A;  4CO8 A;  2D45 A;  1SD6 A;  2KIM A;  3ZMT A;  1XGO A;  3C1D A;  1R1T A;  2H6B A;  2QYO A;  4A5N A;  3DF8 A;  1DPU A;  5E1W A;  1KQ9 A;  4IRI A;  4UV9 A;  3VEP A;  1A04 A;  2GXG A;  3ECO A;  1G3Y A;  1MZB A;  4KYW A;  4KT5 C;  4RB2 C;  1YS7 A;  3MZH A;  3CUQ C;  3BPX A;  1ZRE A;  3MCZ A;  3RKW A;  4A5M A;  1MJ9 A;  3HSR A;  4LB5 A;  2GZW A;  4HZF A;  1SD4 A;  2V1D A;  4LLL A;  4UVA A;  2IP2 A;  3H92 A;  1I1G A;  2G9W A;  3F8N A;  2EFN A;  4M71 A;  4L18 B;  1GHC A;  2DO7 A;  3IHU A;  2QBY B;  1FWZ A;  5E8G A;  3WTV C;  2XUB A;  3D5L A;  5CVU A;  3RTR A;  2J5P A;  1O3S A;  1WWX A;  1IXS B;  4CDG A;  1TNT A;  5DEQ A;  2EFP A;  3TO9 A;  3F21 A;  3HIF A;  3PQK A;  2RGV A;  2L01 A;  4UV8 A;  1T6S A;  2NAZ A;  4A0X A;  4YFK F;  3IRQ A;  3OOP A;  2P5L C;  5IT3 A;  2FF4 A;  4ESJ A;  4IRH A;  4HLX A;  4IXA A;  1FYL A;  2QQA A;  2M30 A;  1Y0U A;  2E1C A;  1NHA A;  4U0W A;  1JXS A;  1WQ2 A;  3Q9V A;  2WWY A;  3DEU A;  1U2W A;  5ILU A;  4OOI A;  2H6C A;  1ZH5 A;  5D6F A;  4AD9 A;  4CXF A;  4HF0 A;  1OYY A;  4Z2Y A;  4I2O A;  2K4J A;  2FA5 A;  2HYF A;  2ZO4 A;  3ZN0 A;  1U8R A;  2ZME B;  4NQW A;  1Z05 A;  4L9J A;  3E5U A;  5ED4 A;  2KRF A;  4D0P A;  1QNT A;  1EH7 A;  2H09 A;  5K1Y A;  5BS6 A;  3VOD A;  2FBH A;  2Y75 A;  4M72 A;  1MDM B;  3MAJ A;  1Z1D A;  2ZCW A;  4RS8 A;  4NHJ A;  1O7F A;  5AIQ A;  4KIG A;  3KP6 A;  3KP7 A;  4BXU A;  1ZG1 A;  2DQL A;  2TDX A;  2W84 A;  2QUF A;  1LNW A;  3BZ6 A;  3ROU A;  5JHU A;  1H9T A;  2ISY A;  2Q2E A;  4A6E A;  1K79 A;  1BOA A;  2EWN A;  3FXR A;  1I6X A;  1ONV A;  1H9G A;  1KYW A;  3K1N A;  1F9N A;  3BJO A;  5FD6 A;  3I59 A;  1DUX C;  2VT2 A;  2LSO A;  2P6T A;  3GXO A;  1R22 A;  4JQF A;  2ZFW A;  5L3F A;  2NRA C;  3V8K A;  1L3L A;  2ISZ A;  3F8M A;  2XAQ A;  4O6J A;  4WXD A;  3ERE D;  1U5T B;  5EEH A;  2W57 A;  4KIC A;  3K2Z A;  1XSX A;  3SZT A;  1QZY A;  4L9V A;  4YIF A;  1PUE E;  4G8X A;  3FM5 A;  5LGN A;  3I54 A;  4ZYH A;  1WRJ A;  1B9M A;  1FPQ A;  3BJ6 A;  2K02 A;  2M45 A;  2EJR A;  3RYR A;  1TTY A;  3TQN A;  4ETS A;  1S6L A;  2J5O A;  3E6B A;  5DCF A;  4GCV A;  3WU1 B;  2KIU A;  1FBS A;  1STZ A;  1FLI A;  3RDI A;  2DPD A;  3RKX A;  2A69 F;  5E1Z B;  1B1B A;  3MEX A;  1FT9 A;  1W5T A;  2OBP A;  3WOD F;  2VOD A;  3ZP5 A;  3DV8 A;  5K5Q A;  4EGZ A;  5FD5 A;  1IXC A;  5LEK A;  3E6C C;  3I0T A;  1YQA A;  3I4P A;  3SXY A;  2CYY A;  2DLL A;  4R8H A;  1TQP A;  2BV6 A;  2ACJ A;  3ZMZ A;  1XMK A;  3W6K B;  4M9X A;  4AWX B;  2HR3 A;  2VBW A;  2JZY A;  2IJL A;  3GFJ A;  2XRO A;  5DCM B;  2HS5 A;  2EV0 A;  2HQR A;  1UCR A;  5D8K B;  4LJZ F;  4QWQ A;  1XGM A;  4HV6 A;  2RVC A;  1LVA A;  2KJB A;  1Q1H A;  3TGN A;  2IW5 A;  4G6Q A;  3P9I A;  1D5V A;  3DPT A;  3VOE A;  1TLH B;  3P9C A;  1QQI A;  4A0Y A;  1DDN A;  3B73 A;  4I7H A;  4MEY F;  3SHF A;  4OU0 A;  1VTN C;  3RYP A;  1BIA A;  2E7X A;  2ETH A;  4HA8 A;  4HDV A;  3W6J B;  2CW0 F;  2FOK A;  2DI3 A;  2NNY A;  3CUO A;  4O5V A;  1O57 A;  4YII A;  2LF7 A;  2YX7 A;  2FML A;  4ZYD A;  2K86 A;  5F6F A;  1OYW A;  3G73 A;  2PLY A;  3F23 A;  2P8T A;  3JSP A;  2CSO A;  3ZMD A;  4IF4 A;  4EV0 A;  4A6D A;  3FXU A;  3HRT A;  4XSX F;  3ELK A;  5E20 A;  3IL2 A;  3DPL C;  4R1H A;  3GFI A;  1BJA A;  3FM3 A;  1YG2 A;  1LB2 A;  3EUH A;  1HSJ A;  1MDM A;  3K0L A;  2A61 A;  3BP8 A;  1TW2 A;  2ZNZ A;  3L7W A;  5BQT A;  4CHU A;  2VN2 A;  3J81 Z;  4L0Z B;  4KIF A;  1O3T A;  1KU2 A;  2O8X A;  2VXZ A;  2WTE A;  3ABU A;  4LMY A;  1UHM A;  1V4R A;  2OQR A;  3M8F A;  1BIB A;  3H3U A;  2VBX A;  1W7P B;  3FWE A;  4I02 A;  1OKR A;  4B8X A;  1W7P D;  3SFZ A;  3M9A A;  2VE9 A;  2IT0 A;  2X4H A;  5DV5 A;  3JW4 A;  3KZZ A;  3KZY A;  4RGS A;  1YYV A;  5J8F A;  1QPM A;  1USS A;  4AIJ A;  4EGY A;  4ASN A;  3KP5 A;  1K7A A;  3BRO A;  5DUI A;  1XGS A;  4RGU A;  1KU7 A;  3EQL F;  3CUQ A;  1WSU A;  2YPR A;  2P7C B;  4GYI A;  3GEZ A;  2OZ6 A;  2QVO A;  1BC8 C;  4HAM A;  3DP7 A;  2XHK A;  2V1X A;  1FZP B;  5ERI A;  4EM2 A;  1HQC A;  2UXN A;  2GA1 A;  3QRF F;  4EJO A;  4KN4 X;  5FFZ A;  3VFZ A;  1AOY A;  3KLO A;  1E2X A;  4XLN F;  4WCG A;  2A07 F;  4BQA A;  3T8R A;  3LQQ A;  3MWM A;  3KFW X;  3HHH A;  1PP7 U;  3HTS B;  2FBK A;  1KA8 A;  4WXC A;  5DCM A;  4OIQ F;  3RPU A;  2YX4 A;  2ZME A;  1ZAO A;  1H0M A;  3TOA A;  2D1V A;  2O0Y A;  2OD5 A;  2DQR A;  1W5S A;  1W7P A;  5DUK A;  5H6Q A;  4MTD A;  1GXP A;  2RQP A;  4FX4 A;  4KFC A;  2K7L A;  2M87 A;  2H27 A;  2V79 A;  3U9G A;  1HXD A;  1RUN A;  4GGG A;  3T0Y A;  2VC0 A;  2UXX A;  3MFK A;  3WTT C;  2MBF A;  1IRF A;  2P6S A;  3AAF A;  2Z3Y A;  3F8F A;  3LQR A;  4LD5 A;  2ELH A;  2XAH A;  4EM0 B;  2V6C A;  1U78 A;  3OV8 A;  5K5O A;  2MC3 A;  3GFL A;  3CO6 C;  3EYY A;  1XDS A;  1CF7 B;  2YSR A;  2L54 A;  2RKH A;  2ZKZ A;  1RUO A;  1LDK B;  1P4A A;  2R7D A;  3R61 A;  3P7N A;  5D5V B;  2QQB A;  3WGH A;  1L0O C;  2BYV E;  3O6B B;  2FSW A;  3FZV A;  1LEB A;  2CO5 A;  2MLK A;  1JHF A;  2DTR A;  2AS5 F;  2P7V B;  4OIR F;  1SD5 A;  3KP2 A;  4XRF A;  5HLG A;  3HSE A;  3TDU C;  4EMS A;  3GW2 A;  5H6R A;  5LHI A;  3B02 A;  1I1S A;  2JPC A;  1C0W A;  3KP3 A;  1HW5 A;  2YU3 A;  1X3U A;  1HKS A;  5BPD A;  1BM9 A;  1GVJ A;  1J2X A;  2XAF A;  2MD5 A;  3LAJ A;  5A2Q K;  1O7L A;  2PQ8 A;  2UZK A;  1XMA A;  3KCC A;  4I01 A;  5FGM A;  2FMY A;  2FE3 A;  2RV8 A;  4M73 A;  5F64 A;  4G9Y A;  3IRR A;  2UWM A;  2ESH A;  2VT3 A;  4I0B A;  3NRV A;  1G3W A;  4CGZ A;  1S7A A;  4IPA A;  2WV0 A;  2ZJ2 A;  1ZYR F;  2BE5 F;  1SFU A;  3WTX C;  1ZLK A;  4Y13 A;  4KA4 A;  4PCQ A;  3BPV A;  3T1B A;  3CO7 C;  3I64 A;  4MQ9 F;  1U5T C;  4IRG A;  2P5V A;  2VBZ A;  2FRH A;  2GAU A;  3WE2 A;  5L3B A;  5F1R A;  4WK8 F;  2XV4 S;  1F1Z A;  2XIG A;  2A68 F;  1BC7 C;  4HBL A;  4CYD A;  5D8L B;  3LST A;  4OMZ A;  1ZAR A;  2OZU A;  3I59 B;  4HW0 A;  2BGC A;  4O3M A;  5HDK A;  1ZRD A;  4I09 A;  4KDP A;  2QM3 A;  1PP8 F;  1T98 A;  4EJV A;  5LHG A;  4GYG A;  2M5W A;  3K1M A;  1OR7 A;  3R60 A;  4LG0 B;  5D5X B;  2AXL A;  3GX4 X;  1BBY A;  5JI6 A;  1S8N A;  4EM1 A;  3RPQ A;  4CIC A;  2HEO A;  2PJP A;  2EA2 A;  4L9N A;  4WWC A;  3IWZ A;  5H20 A;  3V7S A;  5ICC A;  5CLS A;  1K78 A;  1Z6T A;  1CGP A;  2VOO A;  2GA2 A;  1K6O A;  3TKY A;  4LLG F;  1SFE A;  2XAJ A;  3KEO A;  4MTE A;  5HLH A;  4PGG A;  4MGR A;  1SFX A;  3V8J A;  2V1U A;  4G94 A;  4Q4Z F;  4KUM A;  2D2W A;  4U0Y A;  5DD8 A;  2STT A;  3E97 A;  4DQ2 A;  4U0V A;  2DAO A;  1WKM A;  2MA3 A;  3VB2 A;  3WTZ A;  3F6O A;  2BEO A;  5KK1 A;  1OMI A;  2IRF G;  3HOT A;  2O6G E;  1YW7 A;  5DD4 A;  2EV6 A;  1ULY A;  2H94 A;  5TRD A;  4S05 A;  1T2K A;  1J7K A;  2GIV A;  1YW9 A;  3TO6 A;  4Q47 A;  3CTA A;  4EVI A;  4DNC A;  3L9F A;  5K5R A;  1R1V A;  4LK1 F;  2NS0 A;  1FSH A;  3ECH A;  3T5X A;  4CZZ A;  1RIO H;  4BYY A;  1D8J A;  1XSV A;  5E8I A;  1R5G A;  2PG4 A;  4HF2 A;  5ILV A;  2W85 A;  3FXQ A;  3C3W A;  3RKY A;  1P4W A;  3JTH A;  1FX7 A;  2M1B A;  4LB6 B;  1TNS A;  1ZRC A;  4QLC U;  2W24 A;  3RI4 A;  2GXB A;  3HUG A;  4GXO A;  3I53 A;  3L00 A;  3GVA A;  1BI1 A;  5AON A;  2JRT A;  2CG4 A;  2LDU A;  3FMQ A;  4HYE A;  4S04 A;  4BH9 A;  3FX3 A;  2EA4 A;  1Z6R A;  4KMU X;  3WG9 A;  2QBY A;  2STW A;  3WTS C;  3L09 A;  2GQQ A;  2JPB A;  1Z91 A;  2OQG A;  4OIN F;  2PI0 A;  2R7F A;  1IN4 A;  3I5U A;  2QLZ A;  2A5Y B;  1DPR A;  3M1E A;  1XDU A;  5LHH A;  2ZXJ A;  4UUV A;  1E17 A;  3E5X A;  1BN5 A;  1FC3 A;  1SMT A;  1Z7U A;  1EH6 A;  4A0Z A;  3J80 K;  3U2R A;  1YO5 C;  1J5Y A;  1FNN A;  3HSF A;  4UHT A;  3LAP A;  3MZY A;  3IKT A;  3E6D A;  1IZ1 A;  3Q5F A;  4ENK A;  4BAY A;  4B09 A;  3V8L A;  3BDD A;  4LFU A;  4G7O F;  3TDZ C;  3O3K A;  4HDU A;  3QOP A;  4MQV A;  4FHT A;  1KYZ A;  3DKW A;  4P9U A;  2G7H A;  2Y0M A;  5E17 F;  3ZMU A;  3C7J A;  2WC2 A;  3HTU A;  1JGS A;  4KN7 X;  2Z5U A;  2Z9O A;  1RZ4 A;  3L2C A;  1RNL A;  3F22 A;  2HDC A;  1BI3 A;  5BPI A;  4JK1 X;  3WU0 A;  4G7H F;  5BMZ A;  2W25 A;  1ZG3 A;  1B59 A;  1B9N A;  4ON0 A;  3GUD A;  1W4M A;  2L4A A;  2EK5 A;  3JAM Z;  1TQI A;  5DDG A;  4F7Z A;  3S2W A;  1R36 A;  1CF7 A;  3LA2 A;  4A2U A;  5ICE A;  5IT9 Z;  1R00 A;  3Q9S A;  3R4K A;  1UST A;  1O3R A;  3COA C;  5CVI A;  2EFW A;  3QP5 A;  1P4X A;  4L5J A;  4Q5S F;  2DPU A;  3PFI A;  2ZBK A;  1MGT A;  3N4M A;  5JR3 A;  3T8T A;  3J7A O;  1FY7 A;  5FFX A;  4BNC A;  4PDK A;  3HOS A;  5L3C A;  2L4M A;  4P55 A;  2DT5 A;  1ZG5 A;  2CFX A;  2XRN A;  3ZN1 A;  3CDH A;  5CVJ A;  2IA1 A;  3EYI A;  3SQN A;  2K27 A;  4UVC A;  1YTY A;  1REP C;  1SD7 A;  4OIO F;  3RIR A;  2VE8 A;  2HKX A;  2B0L A;  3QP6 A;  1UHW A;  1R7J A;  1T0F A;  4HLY A;  2DK5 A;  1ON2 A;  4AIK A;  1LQ1 A;  3REO A;  1FOK A;  1IXR C;  2M8E A;  4UXN A;  2DW4 A;  2P4W A;  2F5E A;  2NYX A;  1IF1 A;  3N97 A;  1IAW A;  3WGG A;  3KE2 A;  3LFK A;  4A12 A;  2O03 A;  4R79 A;  3I71 A;  1I27 A;  4KMF A;  2DU9 A;  2HWV A;  3CJN A;  5J6X A;  3F8B A;  1GXQ A;  3EET A;  2P5K A;  1OYI A;  4YFX F;  1K78 B;  3V7R A;  2IVM A;  2OA4 A;  2PEX A;  1YIO A;  1OPC A;  4HX8 A;  3WTU C;  2EFQ A;  3NEU A;  1FSE A;  4KIB A;  2HYG D;  2MH9 A;  4M6X A;  3R6S A;  4IHS A;  1I5Z A;  4GO1 A;  2XKO A;  3J81 K;  2RN7 A;  2MLG A;  2C6Y A;  2KIF A;  3E5Q A;  3BJA A;  2F2E A;  2E1N A;  4Y17 A;  4HQM A;  3LA3 A;  1MJB A;  5E18 F;  1UFM A;  2EFO A;  3ZMV A;  1IW7 F;  5HS9 A;  1HKT A;  3QU6 A;  3F6V A;  1R23 A;  5D4S A;  4RGR A;  1AWC A;  4UNO A;  4Q48 A;  1IN8 A;  3ZPL A;  2XGX A;  4EJT A;  4M6Y A;  2L3D A;  3WTW C;  1ZN2 A;  5TJJ A;  1R5H A;  5LEJ A;  1T38 A;  1HW2 A;  1S29 A;  1B6A A;  1XN7 A;  1P6R A;  1S3J A;  2DBB A;  1JE8 A;  4RB1 A;  1PDN C;  1U6G A;  5D5W B;  1P92 A;  4ZZL A;  2ESN A;  3ZMS A;  4KNY A;  3MQ0 A;  4K2E A;  3SZP A;  1TBX A;  2V9V A;  2F5D A;  4PZJ A;  3GZ6 A;  1O3Q A;  2XVC A;  1WI9 A;  4U88 A;  3CUQ B;  3ULQ B;  1YFH A;  2A3S A;  4H0E A;  4G6D A;  5HOO A;  2CQK A;  5L3D A;  4XBF A;  5J8C A;  1UB9 A;  4EJU A;  4UVB A;  4ESF A;  2HGC A;  5FB2 A;  1KU3 A;  3G3Z A;  2VBY A;  3F3X A;  4XSZ F;  3GWZ A;  3I58 A;  1KGS A;  2KKO A;  2QEN A;  3ML6 A;  1XCV A;  3PQJ A;  2IA0 A;  1ZRF A;  4ZH4 F;  4L5I A;  1Z9C A;  4M9S A;  4HF1 A;  2L02 A;  5JVT A;  4OIP F;  5E1X A;  1P2F A;  2LF8 A;  2CWE A;  3HYI A;  2Y48 A;  5LLQ A;  4Y15 A;  3C18 A;  2RNJ A;  3DXJ F;  3IKV A;  5ICG A;  1T39 A;  1IRG A;  4ENJ A;  3BOQ A;  3JTG A;  4FX0 A;  3F8C A;  3GZ5 A;  1QBJ A;  2IPQ X;  2R3S A;  2E7W A;  1BI2 A;  4ENM A;  4LG0 A;  1FBQ A;  5LRS A;  1ZGJ A;  4YG2 F;  3KLN A;  4NB5 A;  1FYK A;  4MNU A;  1YLF A;  2HKO A;  4JBA A;  1QGP A;  4P5O A;  1KQ8 A;  4IHT A;  1F4K A;  2KJC A;  4ZZD A;  4RAY A;  1HKQ A;  4OMY A;  1LJ9 A;  5CYV A;  2O3F A;  3TOB A;  3QPH A;  3K69 A;  2Q8K A;  5L3E A;  2JT1 A;  1G3S A;  1SMY F;  2XKP A;  2HTS A;  3WE3 A;  2Q0O A;  4RB0 A;  5HS7 A;  1XGN A;  3FHZ A;  1J0R A;  5AIP A;  2Z33 A;  3HRM A;  5CVR A;  5HVQ C;  2FBI A;  1IN6 A;  3QPT A;  3U1D A;  5DYM A;  4HV5 A;  5ICF A;  1ODD A;  2FXA A;  5LRR A;  2ZNY A;  4XLP F;  2FU4 A;  1HW1 A;  4IJA A;  2A6H F;  3FF5 A;  3P9K A;  1QZZ A;  4HQE A;  1IN5 A;  1FYM A;  1LDD A;  2FNP A;  4P96 A;  4L9T A;  3FMS A;  5D6E A;  1YW8 A;  4U7D A;  4RGX A;  1HBX G;  3V4G A;  1KU9 A;  4N0B A;  1G6N A;  1FP1 D;  2IA2 A;  1KQ0 A;  5HDG A;  4ENN A;  3GLX A;  5D4R A;  3WGI A;  4ZYE A;  4RB3 C;  3NQO A;  4PGH A;  2OAZ A;  3BWG A;  4BHC A;  4TV7 A;  3M8E A;  3K9T A;  4LK0 F;  3J80 Z;  3QU3 A;  6PAX A;  1RI7 A;  1EH8 A;  2FNA A;  4P9F A;  3E6M A;  4AVP A;  1R58 A;  1R1U A;  3HHG A;  2JTV A;  4I0A A;  1ZGA A;  3RJP A;  1FBU A;  3HRU A;  3GYH X;  3KP4 A;  5BOX A;  4YFN F;  2RC4 A;  1MJA A;  2VOP A;  1JHH A;  3CLO A;  5ILS A;  2LNB A;  1G3T A;  3TO7 A;  1J59 A;  4N9H A;  4G7Z F;  2DK8 A;  3V7C A;  3R0J A;  3F72 A;  2ADU A;  2QWW A;  3H3Z A;  1ON1 A;  5CVV A;  2XAG A;  4U7B A;  1J9I A;  2X0L A;  2PBI A;  4E70 A;  5IT9 K;  4ZYG A;  3ABT A;  3M7G A;  1D8K A;  3R0A A;  5LGU A;  3BY6 A;  4M74 A;  2K4B A;  4ESB A;  1ZLJ A;  4BHP A;  1TW3 A;  1LDJ A;  3LWF A;  4L0Y B;  1DP7 P;  2YR2 A;  2DFI A;  5EEG A;  1XSD A;  4WXH A;  2QZ8 A;  5L3G A;  2FEZ A;  2QQ9 A;  3EDP A;  1SAX A;  3O2P E;  4HOB A;  3GFM A;  3GO5 A;  2XAS A;  1S7O A;  4N9I A;  5FO5 A;  2PMU A;  2BBY A;  4LLN A;  3DFG A;  1B4A A;  2F5F A;  4LGW A;  5D5U B;  2EV5 A;  3HRS A;  5FLX K;  5CJ9 A;  2PN6 A;  5LBQ A;  3WTY C;  4MHG A;  1MD0 A;  2G7U A;  3DQV C;  2NNN A;  4I98 B;  1EV7 A;  5HDN A;  5HS8 A;  4EQQ A;  2PMH A;  3K1P A;  3ZQ7 A;  2PFB A;  1IN7 A;  2FQ3 A;  1XD7 A;  1ZHF A;  5A2Q Z;  4EJW A;  5KVR A;  4WF2 A;  2O61 A;  5HLI A;  2EB7 A;  3QAH A;  2HOE A;  1IUY A;  1D3Y A;  1BI0 A;  2HFH A;  3IC7 A;  3JSO A;  2D1H A;  1XCB A;  3KET A;  2Z99 A;  4IVN A;  1QO0 D;  1HST A;  2JSC A;  3JAM K;  2LKP A;  3IWF A;  1V3F A;  1G4D A;  1LEA A;  2A6E F;  5JFR A;  1MKM A;  4HX7 A;  3E3V A;  1XB4 A;  4HX4 A;  2HQN A;  1U5T A;  3LA7 A;  4WX9 A;  1U3E M;  1YS6 A;  2VC1 A;  3GF2 A;  5FLX Z;  2CGP A;  2COM A;  3FMR A;  2VON A;  5LGT A;  2F5C A;  1TQM A;  2GWR A;  1FP2 A;  3KEQ A;  4AIH A;  2OU2 A;  4RAZ A;  3ISP A;  2MH2 A;  4BHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...