2NVYJ

Rna polymerase ii form ii in 150 mm mn+2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2nvyJ00
2O9LA 1IC8A 3PO2J 2HOTA 1ZGWA 2VKEA 1AU7A 3LSPA 2YUSA 5M5WJ 3HOVJ 2EH3A 4JYKA 3K2AA 5J1RA 1HLVA 2ID6A 2LD5A 1BJZA 2LR8A 4X1EA 2E1OA 4RDUA 1MSEC 2X48A 1YRNA 5F27A 1JGGA 3S2DJ 1BA5A 2NVYJ 3HKZN 3GTMJ 2DA5A 1Q1VA 3A01A 5FKOA 5F1JA 3I4NJ 4G12A 3S2HJ 4GFBA 1WCMJ 2L7FP 3ZQLA 1AHDP 1WGXA 4D5FA 2GM4A 2LKXA 2GBYA 2HOAA 4M3BA 1XG1A 3G1LA 1HDPA 2XB5A 2EZIA 3S1NJ 5IOZA 2W48A 1TC3C 5E3LA 2Y2ZA 5J1YA 3RQIA 1XC5A 2CJJA 3A02A 3BR2A 3HGGA 2E2IJ 4A3BJ 3OOUA 4A93J 1RPWA 1JKOC 2M34A 1MBEA 1FIPA 1JKQC 4C2MJ 1HF0A 3LSJA 2M0CA 1UG2A 2L0KA 4HNVA 2DA2A 4DYRA 2Y0SN 3O8HA 2M2EA 1F43A 4BY7J 2E19A 5F0CA 1A6IA 1H89C 5EG0A 2XRLA 1QPIA 5FKMA 1FJLA 2EQRA 2CUEA 5GPAA 1LE8A 3GTJJ 2IAIA 2JK3A 1VF9A 4LOCA 3S14J 4X6AJ 1MBJA 3CDLA 2Y9ZA 4MIMA 1ITYA 1F36A 2R5YB 1BL0A 1P7JA 3H0GJ 3S16J 1ETYA 2CUFA 5E3OA 2XSDC 3SFIA 1T33A 2R7ZJ 2WB1N 4MO7A 2DMTA 5M3FJ 1IRZA 3BR6A 5K7HA 1MSFC 3S1QJ 3S1RJ 1ZQ3P 3A01B 1U8BA 1VFCA 2ME0A 3JRFA 3JRDA 1SFOJ 5F0HA 3MKLA 3GTLJ 4XIDA 1GT0C 2JWTA 1RKTA 4QSHA 4IHXA 4C3JJ 3F0CA 3RKQA 5C3EJ 1AKHA 1ETXA 5IP6A 4BXXJ 3LSRA 5K7ZA 2DMPA 5M5XJ 4MFDA 4D7NA 3DEWA 2NVQJ 1JUPA 1A5JA 4IHVA 2D5VA 2JA7J 2OF7A 4A3JJ 1GV5A 3B6CA 3MN2A 2CQQA 3TP0A 5M5YJ 3I4MJ 3TEDA 1ORKA 5FJ8J 2DA7A 1HOMA 5EGOB 1X2NA 1JTYA 1WH7A 3PM1A 5BNGA 3NAUA 1U9OA 2NS7A 5IP9J 2NVTJ 1JT0A 4XRSG 1MBHA 3GTKJ 2IEKA 3HOUJ 2I10A 5FLVA 3JRBA 3HBLA 3GTOJ 2N8GA 3BQYA 2G0EA 4BY1J 3ZQIA 4BKXA 3GTQJ 1DU0A 1LE8B 1FIAA 5C4XJ 1ZR2A 1QVTA 2KT0A 4DZJA 3JRAA 2FJ1A 4UUSA 1LFBA 3FISA 4IHWA 5DTDA 4CYCA 1ETVA 1IJWC 3FKIJ 5C44J 1WI3A 2R5ZA 3HGYA 2R0QC 4DYCA 1WPKA 1MNMC 2EZLA 2MG4A 2Y30A 2HQ5A 4B3AA 5F04A 1OCTC 1QRYA 1B8IA 1JTXA 3BR5A 3BG3A 1PUFB 4B4CA 2CQXA 1Z77A 1ETQA 1JJ8C 4FE4A 1TWHJ 2DA6A 5JLWA 1B72A 2O8KA 4XRMA 2NS8A 2RAEA 5IYDJ 2ID3A 2WV1A 2VKVA 3BR1A 1ZR4A 2H8RA 5IOYA 3M3YJ 2LK2A 3A03A 5IYBJ 3IV5A 1RKWA 1MH3A 2XGEA 4B1RA 1FTZA 3FK6A 2Y9YA 4C3IJ 1IG7A 2E2HJ 1P7IA 1TWAJ 2JMWA 4JP0A 3W6VA 3PO3J 2JA5J 3CQZJ 5M3MJ 2JA8J 3JRGA 4ABZA 4A3EJ 1JKRC 3HOZJ 4W1UA 2K9NA 3Q0UA 3D1NI 1EF4A 2XPWA 1RESA 3HOWJ 3ZQCA 1K83J 4FISA 5J1UA 4A69C 2EZKA 3Q0VA 1ZTRA 5DS9A 2QF7A 3LNQA 2L7MP 4FTHA 3IH2A 4RBOA 1I3QJ 1OCPA 1YRNB 5FKNA 1S7EA 1GV2A 1Z0XA 4S0HB 1VNDA 3BT9A 3B6AA 2EZHA 1X58A 1ETWA 5F08A 2LVSA 2ECBA 1VI0A 1JUSA 4AC0A 3BTJA 2YS9A 2DA1A 1TWFJ 1TWGJ 1OFCX 2X6OA 2NOGA 2COBA 4XRSA 4XICA 1NK2P 3BTCA 3BTIA 2H1KA 1SANA 2M9HA 5EYRA 3ZOBA 2LLKA 1GVDA 3GBGA 1E3OC 1ENHA 1JKPC 1ETOA 4MLOA 1UHSA 5FLMJ 2R92J 4Y52J 2FX0A 4D7MA 1UMQA 2ECCA 2K40A 2LP0A 2KDZA 2DN0A 1W0UA 4NDLA 2TRTA 5FKLA 5K7FA 3SJMA 3M4OJ 4M3FA 2OPTA 3HDDA 3WHCA 3FIWA 3TW6A 1MBFA 3L1PA 4A3FJ 1D5YA 2HYJA 2XB0X 5EG0B 1MBKA 3BQZA 3ZQGA 5EEAA 3SDGA 2EBIA 5E3NA 4M3GA 2XGCA 5F0FA 5HODA 3BG5A 3FK7A 1ZKGA 2VPRA 4A3KJ 2XPUA 2Y31A 2IBDA 2DMNA 2HXOA 2P81A 3K7AJ 4DZPA 5EF6A 3LSGA 1NK3P 2DMUA 1OJLA 1O4XA 3GTGJ 5FKKA 1MBGA 1U9NA 2VUMJ 2M8GX 1RR7A 4C3HJ 3BG9A 2HI3A 5J3LA 1R9TJ 1DU6A 2R5YA 4A3LJ 4I6ZA 2B63J 2K9QA 3HEFA 4JX5A 3RZOJ 5GP9A 2DA3A 1AKHB 4EEFG 1JUMA 3IH3A 3GTPJ 3BTLA 4IHYA 2X9DA 2ZB9A 3HOYJ 2AHQA 4A3GJ 3OIOA 2FD5A 2FQ4A 1TWCJ 3BR0A 2QCOA 3S17J 1Y1VJ 4Y7NJ 5E3MA 4A3CJ 4FE7A 4A3IJ 1FTTA 1IUFA 3Q3SA 4IEJA 4W97A 2ELKA 2PMZN 2O7OA 1I6HJ 4V2FA 4A3MJ 1K61A 2E2JJ 1POGA 5JLXA 2VI6A 5IYCJ 4I76A 1Y1WJ 5IP7J 3JRIA 3DCFA 2JN6A 3TW7A 1HDDC 2HXIA 2JA6J 1H8AC 1H88C 5EGOA 2XPVA 3CMYA 3O8GA 1FEXA 2DTZA 2LTPA 4L5EA 3H3VK 3Q0WA 1CQTA 3OSFA 1G2HA 4AYBN 4UUSB 2CU7A 3MVPA 3G1MA 4CYCB 2LY9A 4DYQA 3QPLA 3QQAA 2R5ZB 2ME6A 1ETKA 4D5CA 4QIWN 1XS9A 2JJ7A 3LOCA 4M3DA 3JRCA 4BBSJ 1QVUA 1ZK8A 1BW6A 1MH4A 3HM5A 1LFUP 4DW6A 1B8IB 4M3EA 1IDYA 3JR9A 1BW5A 2L9RA 3ZQFA 2LFBA 5EZHA 1IGNA 3IH4A 1IDZA 1RETA 1T56A 1B72B 2HOSA 2CRGA 2WAQN 3HB9A 1NTCA 3JRHA 2DMQA 5C4JJ 3HOXJ 4UUTA 3JREA 1GDTA 2DA4A 1PUFA 5EDNA 4JX6A 2MGQA 3C2BA 3CCYA 3TP3A 1U78A 1GUUA 4XK4A 2MSYA 1W0TA 1IV6A 3S1MJ 1WH5A 4AUXA 3G1OA 2TCTA 1JT6A 4BBRJ 4FCYA 1HCRA 3RZDJ 2AO9A 2L7ZA 4A3DJ 3VPRA 1APLC 4J19A 3ZQHA 4M6VA 5GPCA 4JX4A 2MW8A 3NARA 9ANTA 1X2MA 3BR3A 1JJ6C 5IPAA 3OSGA 3QPSA 4MFEA 2K9SA 3S15J 2XGDA 3E7LA 3UKGA 1I50J 2YU9J 2NVXJ 2DJNA 2HDDA 4QTRA 2GLOA 5EZGA 4V2GA 3WHBA 2R93J
chains in the Genus database with same CATH superfamily
2O9LA 4ZYEA 1ZGWA 3VODA 3LSPA 3L2CA 3BOQA 2R7RA 2HU9A 3H3UA 4JYKA 2FXAA 3MKWB 5J1RA 5D5XB 5DD8A 5LFAA 4UNOA 2LD5A 4JQFA 5JVTA 5L3GA 1MSEC 2X48A 2JSCA 2MD0A 3FX3A 4FX0A 5D8KB 3GTMJ 2ADUA 3JSOA 3MWMA 3J7AY 3S32A 1QO0D 3D0SA 3LFUA 3QWLA 4EMSA 4GFBA 1WCMJ 2WY7Q 2VQGA 3DBLB 1WGXA 2COMA 1DGWY 2DOEA 4D5FA 1R49A 5E17F 3HOTA 2ZJQF 2HOAA 1VQ6I 2O3FA 1XG1A 1P4AA 3G1LA 4EGZA 3GFMA 5FRMA 4O6JA 3LA7A 3CCVI 1HDPA 4G6QA 4II2A 3PUBA 3KYCB 4XLPF 2XB5A 2EZIA 5IOZA 4UV8A 4UVCA 5E3LA 3FDYA 1TC3C 3ROUA 3L2QA 2M87A 4RMNA 2CJJA 3T8TA 1SD6A 3SZGA 4EJVA 1K78B 1YFHA 2ZO4A 3HGGA 2E2IJ 1RPWA 1ZG3A 3RJPA 5J4YA 5D4RA 2M34A 3I59A 2P5KA 1JKQC 4U88A 1HF0A 4NHJA 2IS2A 3WTZA 3LQQA 4M71A 5KVRA 2M0CA 3L2RA 2MABA 3U21A 4IHSA 2L0KA 3QPHA 1BI3A 3FMSA 4P1WA 1F43A 4OIRF 3HXLA 4B3XA 1HSTA 2GWRA 2F5CA 2JPBA 4C30A 1Y39A 2G9WA 3HL2A 2XRLA 3P9IA 3U9GA 3IUOA 1HW1A 2ELHA 2O03A 2OU2A 4X6AJ 5J8FA 1QGPA 2O5RA 3GF2A 2DQRA 3SFIA 1O3SA 1T33A 1RIOH 2CUJA 2E1NA 1WJEA 2FA5A 2IPQX 4FHTA 4RB0A 5DUKA 2DMTA 3OYDA 2Q1ZB 2CQKA 5M3FJ 1IRZA 1MSFC 4UVBA 3S1RJ 3A01B 1U8BA 1VFCA 1BIAA 3C7JA 1B6AA 4YFNF 1SFOJ 4HSTA 2DAOA 2L2OA 3F6OA 2CMPA 2O0YA 3GTLJ 2K3FA 3M8FA 5J47A 3TOBA 1S3JA 3H36A 1RKTA 4QSHA 3ZCOA 4E7IA 4A0YA 3FZVA 1TLHB 4C3JJ 3GX4X 3RKQA 5DCMA 1AKHA 5IP6A 2V1DA 5M5XJ 4MFDA 4D7NA 1WZ2A 2GQQA 3G6EI 4HEA2 1T8IA 4UB6C 1JUPA 3LAPA 3PNYA 2VBWA 4Z6YA 4BACA 2D5VA 2MBFA 3HPHA 1T0FC 2OF7A 1SFXA 1T0FA 3OV8A 2QBYA 3TP0A 3FXQA 5M5YJ 1ORKA 2DA7A 1HOMA 1UB9A 5EGOB 2JRMA 3PM1A 1LJ9A 4Y33A 4D9JA 2A3SA 1OQYA 1T38A 2R7FA 4HF0A 3GTKJ 3K4BA 3M8EA 1G3TA 2KFDA 2W57A 4HAMA 2RGVA 2YR2A 3CUOA 5L3EA 2K7LA 2IJLA 2LF7A 4WK8F 3ZQIA 2WADA 3H9QA 3BC8A 1DU0A 3RI4A 1LEAA 1OMIA 3HG9A 2BW3B 1WJ5A 1LE8B 1G3YA 3FMQA 3QAHA 5ICCA 4HV5A 1ODDA 3K70D 1ZREA 2PI0A 2NOJB 3QYBA 5HDKA 4H0EA 1ZG5A 4KJZA 3TKYA 4I2OA 1YW7A 2UXXA 4DZJA 3K1MA 2L9NA 4UUSA 2CWEA 4HX7A 5DTDA 1Z7LA 1ETVA 3DXJF 3G2BA 1L0OC 4G7ZF 2RVCA 5C44J 2R5ZA 1WI3A 4CXFA 3HGYA 3MFKA 1GLNA 2MC3A 1D5VA 5HVQC 1MNMC 2KHMA 2HQ5A 1OCTC 5TISC 5K5OA 1QRYA 3GXOA 1YJWI 2VODA 2ZXWH 3BG3A 3BR5A 3BJAA 5A2QZ 3H5RA 1T6SA 2DA6A 1BR1A 3OYBA 3MD2A 5K5QA 2XAUA 4XRMA 5IYDJ 3F23A 1X1BA 2VKVA 3V7RA 3BR1A 3WU1B 2XSJC 5CQEA 3M3YJ 3RKXA 3WU0A 2OAZA 1GXQA 2M8EA 2XGEA 5DYMA 4A2UA 1G3SA 2KJBA 1F1ZA 4MHGA 1G6NA 4RM3A 2UZKA 3WGHA 1XSVA 1I3AA 4J01A 2Y9YA 3HOSA 3TL4X 1Y6IA 3W6VA 3PO3J 4JP0A 1G8XA 2JA5J 3CQZJ 3HSEA 4PFOA 3JRGA 4BQAA 2VOOA 3MQ0A 1JKRC 1MMDA 1L3LA 3E6MA 2FE3A 4N9HA 2BBYA 2L01A 1HSJA 3HOWJ 3ZQCA 1H9TA 2X4HA 2P0WA 3NRVA 4A69C 4BS9A 3VB2A 1CGPA 3F3XA 4L9TA 5F6FA 2QKLB 3IH2A 3C18A 1YS7A 4NQWB 2ZXHA 4GCVA 2A69F 1GXPA 3E6CC 2VQLA 1MKMA 2HQRA 1S7EA 4KN7X 3F72A 1EA3A 1GV2A 3ZGKA 1FMVA 3J80K 2E36A 3BT9A 3B6AA 4LD5A 1UELB 2EZHA 2VBZA 4L0YB 1X58A 4HX8A 1R7JA 3K69A 1R58A 3DBRB 3A0HC 5BPIA 1OCZH 1XX5A 2EFOA 3BTJA 4LK0F 5GADJ 2YS9A 3PIPF 2H94A 1VQOI 2P5VA 3PFYA 3IHUA 4IRIA 2L54A 4G6TB 3D5SC 4N9IA 5JR3A 2HTSA 4XICA 3MEXA 5LD2C 4OIOF 2V1XA 3BTCA 3LQRA 5EYRA 4QLCU 4E7SA 1RR8C 3BP8A 1JKPC 4XKCA 3EYIA 5HLIA 1ETOA 3E0JB 5LHHA 5FLMJ 1BN5A 2VOPA 2VPLA 3IRQA 2QQBA 4FT8A 4PGHA 5BQTA 3LA2A 2K40A 4D0PA 1H0MA 3KP2A 3QODA 4H4KC 4OAZA 3SJMA 4XN3A 3F21A 4ANJA 2GIZA 4OOIA 4BUPA 2OPTA 2VT2A 2E60A 3FIWA 5HLGA 2VIXA 4ASNA 2M7BA 2R7UA 2IA0A 3L1PA 2X1EA 2E5NA 5LEKA 5EG0B 3BQZA 3ZQGA 5EEAA 1HC8A 1V5FA 2AQFA 1IXSB 3ZN1A 4AD9A 3CLOA 3BG5A 4KIFA 3PUFA 3K1NA 2HYFA 2VPRA 4A3KJ 2XPUA 2CG4A 2IBDA 1LNWA 2HXOA 3K7AJ 3ERED 5EF6A 2VQCA 3TO9A 2K3PA 3G71I 5AIPA 4RGUA 1OJLA 1X19A 1O4XA 2VUMJ 4B47A 4OWRB 4P9UA 1O3RA 2VBXA 2M45A 3BG9A 5J3LA 1V4RA 4X0GA 2R5YA 3CP8A 3DU6A 2QWWA 4Y15A 3HUGA 3OYCA 4KYWA 3Q9VA 3GLXA 3UR3C 3BWGA 3K4JA 4AM3A 1YTYA 3R4KA 4UV9A 1JUMA 2BE5F 3IH3A 3GTPJ 3P9KA 4U0YA 4IHYA 5D5VB 3ISPA 2EV0A 3HOYJ 3HJEA 2AHQA 4BEHA 4A3GJ 2FD5A 5LGNA 1TWCJ 2XF6A 1UG0A 3GZ5A 5H6RA 3SZTA 1X4OA 4HF2A 3IRRA 3A4CA 3ABTA 2AXTC 1S5LC 1T98A 4Y17A 1G4DA 3C2GA 1RNLA 1YLFA 3Q3SA 3CMMA 4W97A 2IS4A 4YIRX 2L02A 1D0ZA 4V2FA 3V8JA 2VT3A 2QLZA 3RPQA 4A3MJ 1FZPB 3A2KA 2XIGA 5CQGA 1LB2A 3E6DA 2XV4S 4I76A 1SD4A 5IP7J 1BC7C 2LG4A 3DCFA 2GIVA 1E0EA 4JBAA 1HDDC 2P7VB 3KYLA 3ZMTA 1H8AC 1DDNA 1H88C 1IUYA 2ZC2A 1FYKA 1HW5A 1VQNI 1UJ8A 1EH7A 3CMYA 3CCMI 2BZTA 3P7NA 2KRFA 4EGYA 2R3SA 1W7PD 2HPIA 1S7OA 2BHYA 3CJNA 1A31A 3AFHA 1EJ9A 1QZZA 4HLYA 4FETA 3O2PE 1R23A 3VFZA 4CYCB 4NC8A 3LFKA 3QQAA 5KAIC 5KNLA 1XS9A 2JJ7A 4M3DA 4D1QA 3JRCA 2ISZA 6PAXA 4IXAA 4CHUA 1XGMA 1ZK8A 3HM5A 1LFUP 3RCOA 1B8IB 1BW5A 3JR9A 3V8LA 1J2XA 3H9JA 1IDZA 1B72B 5FROA 2QUFA 5J4VA 3J7YJ 2JZYA 2DMQA 1KA8A 2VJ4A 3K0LA 2A6TA 4RLQA 4E7JA 5AONA 1EV7A 2DA4A 5ICFA 3X2QH 1JI8A 2KMUA 2PBIA 3FXMA 3HRUA 2MGQA 3CCYA 3TP3A 2P6TA 1YO5C 4YIIA 1PDNC 3TOAA 3FXUA 1IV6A 1WHUA 1IN4A 2BOLA 2A68F 5KAFC 1VQLI 2HYGD 1WFXA 1KU7A 4M9XA 2TCTA 2E34A 2NS0A 1P4XA 4FCYA 2DFIA 1J59A 3JW4A 1ON1A 4CDGA 4NNJA 4DBRA 1W1WE 2MW8A 1S9HA 1WWXA 3TO6A 1E3PA 3NARA 2L4MA 1X2MA 4G6DA 9ANTA 1JJ6C 3HTSB 5IPAA 3BCAA 4DNCA 1QNTA 2E7WA 2K9SA 1I50J 2YU9J 3F8CA 2DJNA 4IRGA 2HDDA 2MLKA 3WHBA 1WJDA 4RB2C 4L9NA 2YUSA 3T1BA 5BMZA 5M5WJ 2PLYA 2W1OA 4WXDA 3K2AA 1BJZA 2D45A 4RDUA 1YRNA 1JGGA 3IWFA 3UNGC 3S2DJ 5IT9Z 1BA5A 1TQPA 1U0JA 3L2UA 4XLEA 4I98B 4UXNA 3HHHA 5LHIA 1Q1VA 3OWTA 4XKVA 1JXSA 1FSHA 5E1ZB 5F1JA 4U87A 3SQNA 1B4AA 3ZQLA 1X1PA 4BNCA 5ICGA 2LKXA 2RKHA 2GBYA 1YJNI 2X1DA 1BC8C 2L5QA 3CP2A 3DPLC 1IAWA 1WI9A 1LVKA 3MCZA 4GRIA 4CZCA 1CF7B 3QPTA 3C3WA 1XC5A 3AL0B 1RUOA 2MC4A 3CMEI 2WB1A 2PFBA 4AIJA 3LSHA 3F8FA 1VQ4I 4A3BJ 3OOUA 4A93J 2EFNA 3A1YA 3TDZC 1W5SA 3S3NA 1RRJA 2E1MC 1BOAA 2YSRA 4XLFA 2O8XA 2FNPA 1A35A 1ZGJA 5HNFA 1UG2A 2DCEA 3V8KA 5CVRA 2ZNZA 5ICEA 4XLHA 2BHZA 2DT5A 3FXRA 2M2EA 5D4SA 2E19A 1A6IA 4UHTA 1Z91A 2QSFX 2KP6A 1W36D 4IJAA 1FJLA 2E35A 5GPAA 3U1KA 4WF2A 3GTJJ 1LDJA 3L2VA 3S14J 3WTXC 2HNHA 3RTRA 3WTUC 4MIMA 2Y9ZA 2MYSA 2LBFB 2ZBKA 3H5AA 2IGOA 2WB1N 3IKVA 5ED4A 4MO7A 4EM2A 1HBXG 3M7GA 4QPOA 2VASA 5IT3A 1ZQ3P 2OD5A 2PG4A 4U7DA 3MKLA 3EYYA 3R0AA 1V3FA 2QGUA 1RUNA 1WJCA 3M07A 4IHXA 2DPUA 2OQRA 1IRXA 1ETXA 4BXXJ 1BR2A 4YFXF 2L4AA 3DKYA 3R60A 2DFEA 1O3QA 3OIPA 2F4IA 1N25A 2K4BA 2K02A 1A6QA 3S3MA 1X1CA 2CO5A 1S7AA 2IP2A 1A5JA 1OYIA 3CCSI 4E7LA 4IHVA 5TJJA 1KYZA 1KQ0A 1GV5A 3B6CA 2CV0A 4BXUA 3I4MJ 2GA1A 1JTYA 2ICWG 4G8XA 3NAUA 3AL0C 2H6CA 2NS7A 2V9KA 4MNUA 4XRSG 1VTNC 3WTSC 3ONQA 5FLVA 3TO7A 4DGWB 1T95A 3RSNA 1P2FA 3V7SA 2MA3A 2ZXJA 4E7HA 2IW5A 4A0ZA 5B3SH 2X6WA 2EA4A 4HDUA 3MZHA 1LPQA 2KIUA 3MKYB 4LITA 1ZR2A 2X1CA 4LGWA 3KX2A 2DLLA 1FP1D 3F8MA 2FJ1A 1LFBA 1R6RA 3FISA 1KQ8A 1MMAA 2F5VA 3R0JA 4KMFA 3AKZA 4G7OF 5DUIA 4DYCA 1LEBA 1XGOA 2MG4A 2Y30A 1Y8RB 2XROA 4YG2F 2P5LC 4CSWA 4GDFA 1D1AA 2DK8A 4GO1A 4PDKA 1YI2I 2CQXA 1DQUA 1IXRC 2XAGA 2XAJA 4AIKA 2FSWA 1IN8A 2H09A 4EATA 3CCRI 5IY5H 2WV1A 1XD7A 2HQNA 4PJNA 1U8RA 5IOYA 3CO7C 1N75A 1OR7C 2K85A 3FBNB 2MH9A 3MZ8A 2LREA 3CUQB 4RAZA 1OR7A 4IQJA 3H0DA 3KZYA 1TP4A 4CH7A 1J5YA 1JGSA 2VC1A 1Z9CA 1FTZA 1MMNA 3W2VA 3JTGA 3K4KA 1LDDA 4CCKA 1W5CC 4KT6A 4CO8A 5M3MJ 4ABZA 2DYSH 1UHMA 1J75A 4W1UA 2K9NA 2DOFA 2LNBA 3Q0UA 2JRTA 2XPWA 4IPAA 1RESA 3M9AA 4FISA 4WX9A 1SMTA 3K4CA 4F52A 1FBUA 3JTHA 3Q0VA 4RM2A 4S05A 5E8IA 2FBIA 3CTAA 1Z7UA 4PJLA 4XKBA 3CJQB 2HVQA 1MDMB 2KL4A 4EM0B 2M7AA 3BZKA 4IKFA 1OCPA 1YX5A 2KLOA 5JFRA 1YQAA 3ZR8X 4S0HB 3SDBA 3DTKA 3ZMVA 5FB2A 2E1CA 3GLLA 4JOMA 2EIJH 1UZCA 3GZNB 5F08A 5F1RA 3RPUD 3DP7A 1JUSA 1KYWA 1OFCX 2ELJA 1TT0A 3DKWA 4I09A 3VOEA 1E3HA 1BOBA 2COBA 3BROA 3J80Z 3CJRB 2JPCA 4XRSA 5HLTA 2WAEA 2K5CA 3RDIA 1WJAA 1SVOA 3BTIA 3FMRA 4Y13A 4AIHA 2BGCA 4BYYA 3QOEA 3BJ6A 1Q1HA 3GBGA 4CA0A 5GAGJ 2O6GE 4QPQA 5FFXA 4EM1A 4MLOA 1K6YA 1W7PB 4UY8I 1U5TB 2LKPA 3F8BA 3DLLF 1P92A 4XORA 3AG3H 3RYRA 1HQCA 2Y75A 1R1VA 1VZ0A 3DEUA 3CZ6A 2FX0A 4D7MA 1UMQA 2ECCA 4G9YA 4PZJA 3OYIA 1OCCH 1SD5A 4KIBA 3KYDB 2UUZA 5FD5A 2QQAA 1O57A 4LG0A 2KISA 4LLGF 2QSGX 3ZRGA 4HBLA 4BE1A 3HDDA 1ZGAA 2CV1A 5ILUA 3G4SI 1K78A 2XB0X 3DWLE 1BI2A 3SDGA 5E3NA 2DPDA 4M3GA 4XNFA 2FF4A 3COAC 1OLTA 2W4SA 2D1HA 1F9NA 4YEJA 3S8PA 2B0LA 2CH0A 3H92A 1ZKGA 1FYMA 2Y31A 1P6RA 4I02A 4RGSA 2F4OB 2ZXIA 4DZPA 2XVCA 3K4MA 3GO5A 4NB5A 1NK3P 3GTGJ 1A04A 5FKKA 1U9NA 2PJRB 2DU9A 1RR7A 2HPMA 3BPXA 1G3WA 1DU6A 3FHNA 3NEUA 4C2TA 2BVMA 4NUBA 2K9QA 4IOAF 1ZHFA 2QEXI 2RN7A 2W00A 4P55A 3ZQ7A 4KA4A 3E6BA 2KZVA 5GP9A 5F64A 2XC7A 1XSDA 1SVMA 2R7SA 4PCQA 3K10A 2OCEA 5JVGF 3CC7I 3L00A 5CPRB 1TT5B 2NVUB 4L0ZB 1IXCA 2WC2A 5TGTA 3ABMH 1F4KA 3I55I 3CJTB 4CGZA 1ZN2A 1Y1VJ 2PMUA 4HNUA 4A3CJ 5E18F 2NRAC 5FLXK 4AYBA 3M8JA 1IUFA 1REPC 4RAGA 5LEJA 2AS5F 2O7OA 4ENJA 2PMHA 1I6HJ 4RA2A 5GAEJ 1J09A 3KZZA 5IYCJ 5JLXA 2VXDA 2XF7A 2QVOA 2ACJA 3KE2A 3I56I 2Z3YA 2IS1A 2EFQA 2JN6A 2L9VA 3E97A 1J7KA 3CD6I 2JA6J 2E5ZA 5HS8A 3IAM2 4HOBA 4LB5A 1IW7F 2M5WA 5EGOA 4F3QA 3OYNA 2XPVA 3KCCA 4E7ZA 1BJAA 1X3UA 3OR1C 2DTZA 1R5HA 2Z9OA 5CYVA 5B1AH 4GXOA 3OSFA 1SVLA 4E4HA 4AYBN 5DV5A 1VQ9I 4ESFA 3N97A 3G1MA 3OYKA 3IWZA 2J5OA 2LY9A 4DYQA 3QPLA 1W4MA 3E5QA 3EUKL 3ECHA 4DIQA 3OS0A 4N4OB 3REOA 4QIWN 2BW3A 3WU2C 4RAYA 3WTTC 1ZLKA 3JAMK 3BZCA 5LRRA 4MEXF 3ECOA 4HYEA 3OYFA 3HPGA 3HB9A 3DEEA 2ZNYA 3S2WA 3F6VA 3K4LA 3JREA 3KEOA 1GDTA 1SFKA 1S6LA 5GAHJ 1A36A 4JX6A 4BJTA 3OYLA 1U78A 4XQFA 2Z33A 2JQ7A 4F91B 2M0MA 2ZJPF 2F6CA 4XK4A 3R6SA 2MSYA 3BY6A 2DT6A 3S1MJ 2V9VA 3HHGA 1FSEA 2QQ8A 4HG2A 4XBFA 1IN6A 2HVSA 1QZEA 2HKOA 1U3EM 3WTWC 2J5PA 1HCRA 2V6EA 5HS9A 4L5IA 3TDUC 4KNYA 2HDCA 2AO9A 3HKZA 3VPRA 4M6VA 1X4PA 1VQMI 2IA1A 1Z05A 2VKHA 4AWXB 3W2AA 1KGSA 2W25A 1YIJI 3OSGA 1FY7A 2VC0A 4MFEA 3S15J 3B73A 3HRSA 2GLOA 1OYWA 4V2GA 2R93J 5H6QA 1IC8A 3PO2J 2HOTA 2VKEA 1AU7A 2NNNA 2E7XA 2KIFA 3CCUI 3E5XA 1ONVA 3CF5F 2L9SA 4CCJA 1FPQA 2ID6A 3QRFF 3MKZA 2EV6A 4NQWA 3KEQA 2LR8A 5HS7A 4X1EA 2XKOA 2OCCH 2H6BA 2NVYJ 3HKZN 2V4JC 3FKJA 1USTA 4EV0A 1WVRA 4XSZF 5FKOA 4DQ2A 2W7NA 2NXNB 2W24A 4LJZF 5CLSA 2UWMA 2ZMEB 3S2HJ 1EH8A 3GW2A 2P6SA 2L7FP 1AHDP 1XDSA 1NG7A 1VQ5I 2Y0SA 4LLNA 4RB3C 1WKMA 4AIDA 2TDXA 3BLYA 2FOKA 5LRSA 2KPMA 2LC2A 3E3VA 2WV0A 2Y2ZA 3FXKA 3I5UA 3RQIA 4ZJZA 1G59A 3WGGA 3AG4H 3A02A 3O3KA 4E6KG 4ZH4F 3BR2A 4EJOA 4QWQA 3DU5A 2X85A 1TZLA 1MBEA 2DTRA 4C2MJ 4BE2A 3FXOA 2YPRA 1KU2A 4HNVA 2DA2A 2EA2A 1M1EB 2H27A 1FX7A 2Y0SN 3CCJI 2ZSIB 2DW4A 3BZ6A 5JHUA 1X1DA 2VBYA 1XGNA 5EG0A 2RC4A 2JTVA 5FKMA 2CUEA 3T0YA 3ASNH 1VF9A 1FOXA 3U1DA 2FQ3A 1DUXC 1TQIA 1YW9A 1F36A 1BL0A 1P7JA 4IQ4A 4UUVA 3S16J 5E3OA 2CUFA 3JSPA 2CW8A 2R7ZJ 1IRGA 3I54A 2Q8KA 1MD0A 3BR6A 5K7HA 3S1QJ 3ZPLA 3VYUB 2GA2A 1R36A 2ME0A 4M6YA 3JRDA 2LDUA 3WG7H 1MW7A 2IGNA 4CCNA 3TBIA 2M30A 4CUGA 2VN2A 2STWA 3DQVC 4LB6B 2K27A 4HA8A 3BDDA 3H35A 2OTLI 4U0VA 1BR4A 3L7WA 4WWCA 1N77A 4XLAA 1MIJA 3HRMA 2LOOA 2JVHA 3QOPA 5HOOA 2VQHA 3ELKA 1YE9A 3C1DA 1VQ8I 3H3ZA 2JA7J 4I0BA 4A3JJ 2FMYA 2GOXB 2Q2EB 4GYGA 2ISYA 1ULYA 2GXAA 3VYSB 3MN2A 1SAUA 4CCMA 5FJ8J 1PP7U 2W82A 4EQQA 5DCFA 4ENKA 5BNGA 3B02A 3KFWX 5IP9J 1JT0A 4XSXF 1IN7A 4ZTJA 2DDBA 3FXJA 2IEKA 3HOUJ 2I10A 2XASA 5D5WB 3S3OA 1R1TA 5LBQA 2R7DA 4WCGA 2PJPA 3EDPA 3HBLA 4HQMA 2EIMH 4BY1J 3HIFA 4BKXA 1FYLA 2XAHA 3KP6A 2DODA 1FIAA 1UCRA 2OUMA 5C4XJ 3PNTA 1QVTA 2KT0A 4AU7A 3SHFA 3LAJA 2JA2A 2XF5A 3SEZA 2YX7A 4LG3A 5E20A 4ZDOA 3L2WA 1JHFA 4F92B 4Q4ZF 4CYCA 1XCBA 5D6EA 1IJWC 3EUHC 5BOXA 1QHHD 2E71A 1KONA 1Z6RA 3EUHA 2BXYA 2EZLA 1I1SA 4TV7A 1B8IA 2K4JA 1U6GA 3HSFA 1JE8A 1PUFB 4B4CA 3GFLA 4HNTA 4HZFA 4BDYA 5JLWA 5FD6A 1B72A 2O8KA 3A0BC 3ABLH 4L5JA 1B9NA 2RAEA 3PSFA 4UVAA 5CKTA 2H8RA 4PSWA 1QA6A 1I6XA 1SAXA 3GZ6A 2LK2A 3A03A 3IV5A 1MH3A 4B1RA 1LQ1A 5HDGA 3FK6A 4BHBA 4MGRA 2MLGA 2YU3A 1IG7A 2Z16A 2M3AA 1TWAJ 3KLNA 3W6KB 1D8KA 2V26A 4A3EJ 2ZKZA 1EF4A 3OYGA 4K2EA 3ZXSA 4A6EA 4ENNA 3IL2A 2H1LA 3K1PA 1KQ9A 1K83J 1WQ2A 3U2RA 2KJCA 4LIVA 1R4MB 3OY9A 2RV8A 4ON0A 4M9SA 4Q47A 2ESNA 2AXLA 3DTIA 3LNQA 1F5TA 2L7MP 2BV6A 4FTHA 4BQNA 4IVNA 1BI1A 2M4GA 1BBYA 4RBOA 1I3QJ 1I5ZA 1MMGA 1V55H 2K86A 2RREA 5CVIA 1Z0XA 2ETHA 2P7CB 2D2WA 4E7KA 2XHKA 1VNDA 4M74A 1IV8A 1FC3A 5L3CA 1XB4A 3LA3A 5L3DA 2V1NA 2DJIA 2XKPA 5B1BH 2R7XA 1R4NB 2GAUA 2LVSA 4IX7A 3FWEA 1VI0A 4AC0A 2R7OA 5AIQA 4YIFA 4U7BA 1SEUA 1B9MA 4Q48A 2DA1A 1TWFJ 4KITB 2QA4I 1R22A 2X6OA 2NOGA 4F93B 3ZP5A 4PSXA 2R7TA 5CVJA 2V9PA 4WXHA 1X3WB 2KRHA 1XMAA 4U0WA 2H1KA 1SANA 1MNDA 4IHTA 1QZYA 2LLKA 1GVDA 3KLOA 1ENHA 1D1BA 2F48A 3BG7A 3PJRA 1PJRA 3KPHA 2F5EA 1I1GA 3J7ZI 4F55A 2R92J 2LP0A 2DN0A 3I59B 5ILSA 1W0UA 2Y0MA 1T39A 2TRTA 5FKLA 5K7FA 3K70C 5TRDA 1CF7A 1WRJA 2RQQA 3W6JB 2L7KA 5GTIC 4EJUA 4M72A 1IRFA 3WHCA 3PQJA 2VKDA 1B1BA 2GXBA 2JT1A 3VEPA 3PNVA 4A5NA 1D5YA 4ZYHA 1MBKA 2DO7A 3QYFA 3JCUC 2EBIA 3N05A 5F0FA 5HODA 2XAFA 5CVVA 3OYMA 5E1XA 3FK7A 2LKSA 3D5LA 3GMEA 4G7HF 5LGUA 1ZRDA 3TGNA 1DPRA 1XPXA 2P81A 1TTYA 5J6XA 2MD5A 2DDAA 3DFGA 1VQ7I 4PGGA 3RKWA 3OYHA 2VLAA 1LFPA 1MBGA 2DT7B 2HI3A 4KT5C 1R9TJ 4OINF 5BPDA 4A3LJ 4I6ZA 2LBFA 2YX4A 2A6HF 2FU4A 3P9CA 3SXYA 4HSRA 1C0WA 3IP4B 5DCMB 3GVAA 2DA3A 2HGCA 4Y4RA 1AKHB 4BE0A 3J81Z 3BTLA 1FBSA 2G7HA 2HVRA 2HS5A 1QPMA 3S93A 5L3FA 2FQ4A 1Y56A 3BR0A 4HF1A 5BS6A 1QBJA 1STZA 1HKTA 5D5UB 2FMLA 4Y7NJ 5E3MA 4FE7A 3ZMZA 2F2EA 1K4TA 1SMYF 4I0AA 4IF4A 4IEJA 3TMOA 2CQNA 3ULQB 2QBYB 2ELKA 3OR2C 4PJJA 2WTEA 1YJ9I 3OOPA 2X6YA 1H9GA 1K61A 3NQOA 2E2JJ 2EINH 2VI6A 4BGDA 1UHWA 4Z2YA 3G73A 1ZRFA 2VB6A 4LG0B 2HOEA 1Y1WJ 1IN5A 3JRIA 2CSOA 1V5GA 3I4PA 2DXIA 4ZDLA 1PUEE 2RDPA 5FLXZ 1S29A 2L3DA 1ZRCA 2CFOA 5K1YA 2DFFA 2W85A 2JUCA 4XONA 3OS2A 1DGRM 2PN6A 3LSKA 4O3MA 2UXNA 3EETA 2R7WA 4AVZA 4IL6C 1FEXA 3KETA 2A05A 2WAFA 4PJ0C 3V7CA 4ZZLA 4CYDA 3Q0WA 1CQTA 3K2ZA 1TL8A 4UUSB 2CU7A 4B09A 1V54H 3CCEI 3V4GA 4ZYDA 2HKXA 2R5ZB 2ME6A 1ETKA 1JHHA 1QQIA 3ZMSA 1D1CA 3GWZA 3O6BB 5LGTA 1K79A 3CESA 4M3EA 1IDYA 2IGKA 3K4NA 4BDZA 1TNTA 3G3ZA 3FM3A 2L9RA 3LWFA 1LKXA 4AVPA 2LFBA 3IH4A 1RETA 1R00A 2CRGA 1OPCA 1NTCA 3WODF 1YIOA 2ZFWA 1LUJB 5C4JJ 4UUTA 3ESWB 1SFEA 2FOWA 2Y48A 4HQEA 3JAMZ 3CDIA 3FBIB 3HZJA 1XN7A 4M6XA 2AQEA 1W0TA 2FUG2 2DQLA 4HDVA 1I39A 1WH5A 4AUXA 1QHGA 4ZDPA 3CUQC 4BHCA 3L9FA 2GZWA 3CUQA 2OTJI 2KIQA 3RQ4A 5HNHA 3PFIA 2EFWA 3GUDA 1XDUA 4MEYF 1APLC 4J19A 3ZQHA 5DM6F 1VQPI 4LFUA 1Z21A 4LIUA 1N78A 3F22A 3AG2H 4PJMA 3BR3A 3VDXA 1MMSA 2LF8A 3FM5A 3ZMDA 4IRHA 3QPSA 2XGDA 3E7LA 4KMUX 3UKGA 2EV5A 3CC4I 3WE3A 2NVXJ 3H5NA 3QU3A 4I99C 2DOAA 5EZGA 3H1CA 4BQOA 5DM7F 3I71A 4XKWA 1VQKI 1DPUA 4PFPA 1TBXA 2R7QA 2XGXA 4ESBA 5DEQA 3J81K 2LMDA 5KK1A 2XRNA 2UV1A 4JK1X 3GCMA 4I7HA 2VJ5A 3HOVJ 2EH3A 5LLQA 1NG6A 1HLVA 4CICA 1KU9A 5FGMA 1MDMA 2E1OA 3CCQI 2VL8A 1KZHA 2EWNA 3KEYA 5F27A 4ZYGA 2IRFG 4R1HA 3OS1A 2PQ8A 4OAYA 2DA5A 1YG2A 3A01A 2VJIA 1J9IA 4MQ9F 3W3CA 2OQGA 3I4NJ 2P8TA 4G12A 4CZZA 1ERDA 3OL3A 2C6YA 4V19K 2JSPA 1XMKA 2GM4A 2IVMA 4LLLA 5E1WA 3ABKH 5FRNA 3OYAA 4M3BA 5H20A 5J8CA 2VJJA 2WWYA 1B59A 2CFXA 2EIKH 2DK5A 2BY2A 2M4KA 4KFCA 2MH2A 3IAS2 1P4WA 3KP3A 4CCOA 1RI7A 3S1NJ 4A0XA 4ZTFA 4XMYA 3R61A 2W48A 4BHPA 4BXFA 3VWBA 5J1YA 1SD7A 1U5TC 3VYRB 4A12A 1RC9A 2HDWA 1W7PA 2EK5A 1U5TA 4A5MA 1SFUA 3I0TA 4M73A 3AG1H 2B7EA 1AOYA 1FNNA 2R7VA 2OA4A 3SYTA 1XGSA 2OJED 3Q5FA 1JKOC 3KP7A 1FIPA 1LDKB 3P5JA 2RQPA 3LSJA 3RIRA 1ACIA 4E70A 2LRDA 5FO5A 2X51A 1HXDA 2A07F 4DYRA 2BY3A 3O8HA 4BY7J 2MFZA 4CCLA 3GFIA 4YELA 3CCLI 5F0CA 1H89C 5FFZA 1QPIA 2WBMA 2EQRA 3I58A 1Y0NA 5HLHA 1LE8A 3CLQA 5D8LB 2IAIA 2JK3A 4RLFA 4LOCA 4IOCF 1MBJA 2KDOA 2QYOA 2RNJA 3CDLA 3KP4A 1YHQI 1ITYA 2HR3A 5E8GA 2R5YB 3H0GJ 1ETYA 2XSDC 3DKXA 3WE2A 1GVJA 5KHDA 1R71A 3I64A 4XLNF 3HUGB 3VSKA 4C9YA 5EEHA 3NWTA 4Y3OA 2PJRA 5K5RA 1TQMA 2IGMA 2QZ8A 3ERMA 2IA2A 2X6XA 3JRFA 2BY1A 5F0HA 2QKMB 4G94A 4BEHB 5GTHC 2JVGA 2F5DA 4XIDA 4ESJA 1GT0C 2JWTA 2STTA 1BM9A 3LSIA 3F0CA 1E2XA 5C3EJ 3E5UA 4ZC3A 4R8HA 5K7ZA 2DMPA 3LSRA 1SC7A 3FXLA 3OYJA 2Z2SB 1GHCA 3PQKA 2BVLA 3DEWA 2NVQJ 3ABUA 2ZJRF 2D1VA 4MTDA 3MZYA 1D0XA 3ASOH 4RB1A 1WJBA 4B8XA 4DJAA 3C2HA 3BPVA 1E17A 4L9JA 2CQQA 3D5RC 1OCOH 3FF5A 3TEDA 2F4MB 1ZARA 1X2NA 1WH7A 2H8WA 4M9ZA 4RS8A 5DD4A 4Q5SF 1U9OA 1WSUA 2NVTJ 3PL8A 1QU3A 1MBHA 2NYXA 3QP5A 1FP2A 3JRBA 1J0RA 5EJCA 2PX9A 2DFHA 3GTOJ 4BAYA 2N8GA 3BQYA 2G0EA 2HTJA 1EKEA 3GTQJ 5JHFA 4EJTA 4NBQA 4N0BA 3WG9A 3DF8A 2VE9A 1OKRA 4UB8C 3GYHX 1OISA 5A2QK 3JRAA 4P96A 1Y0UA 2EFPA 4IHWA 1DP3A 2IS6A 3FKIJ 2LY1A 2R0QC 1FOKA 3BJOA 2V6CA 1WPKA 3CC2I 4LK1F 4B3AA 1BI0A 5F04A 4YRVA 2GOMA 1ZG1A 1JTXA 1O7LA 3HTUA 1AWCA 1YOVB 1ETQA 1Z77A 2M1BA 4FE4A 1JJ8C 1TWHJ 4PUSA 4RGRA 4KN4X 3IC7A 3M1CA 2IT0A 1W5TA 2CUZA 4HRIA 1Z1DA 2NS8A 3Q9SA 2ID3A 4L18B 2ZFUA 3BCBA 1D3YA 1ZR4A 4FASD 3KP5A 2FNAA 2HEOA 3OYEA 4MTEA 5IYBJ 1RKWA 1Z3YA 4GGGA 1W36C 4C3IJ 1NH3A 2E2HJ 1P7IA 2JMWA 1YYVA 1O3TA 1EH6A 2EB7A 4O5VA 5J40A 1K7AA 2JA8J 1UFMA 1IF1A 4OMZA 4S04A 3HOZJ 2A5YB 1Z3XA 3OIQA 3ZQQA 3D1NI 2P4WA 2FBHA 4HX4A 4XOPA 4HPQA 2BEOA 5DDGA 5J1UA 2CYYA 3LL7A 2EZKA 3H9GA 2G7UA 3ZMUA 3I53A 4KIGA 1ZTRA 5DS9A 4B43A 2F5FA 2CW0F 2QF7A 4P9FA 2IXSA 1X3ZB 4NC6A 1R5GA 2ZCWA 5FKNA 1YRNB 1ZLJA 3K6GA 1FBQA 5EEGA 1FT9A 4R79A 1LVAA 2QSHX 2Z1DA 1MGTA 2DI3A 2OZUA 3WTVC 4IZZA 1XMXA 4XL9A 1ETWA 1FOWA 2ECBA 3CO6C 2BY0A 1K6OA 2X0LA 3NWSA 2LY2A 1TWGJ 2OV7A 2WA0A 1HA8A 2VONA 2CGPA 2I5UA 1S8NA 1MJ9A 1Y8QB 2KQRA 2Y69H 3M1EA 1NK2P 2ZMEC 4RGXA 1PYVA 2M9HA 2ZMEA 3ZOBA 5E79C 1D8JA 3F9KA 1E3OC 3DPUA 2A61A 2DBBA 3DPTA 4RAFA 1UHSA 3EUAA 1YW8A 2KZGA 2V7FA 4BH9A 1RZ4A 3I3LA 4Y52J 2Z5UA 3ML6A 2Q0OA 3LSMA 2KDZA 1Z6TA 4J00A 3DBHB 1WJFA 4NDLA 2B9SA 3PIOF 5ERIA 3M4OJ 2E1MB 4M3FA 1ZH5A 2K9LA 4HW0A 3VSLA 2FRHA 3DTEA 3EQLF 2ZJ2A 4EVIA 3WTYC 3AAFA 3L09A 2NAZA 3RKYA 3SZPA 3TW6A 2CV2A 1HW2A 1K4SA 2CQ7A 3ZN0A 1MBFA 4A3FJ 2HYJA 4XM3A 2GXGA 4DOZA 2DYRH 2XGCA 2KRCA 3HYIA 4BQQA 3GEZA 4FQGA 1ZELA 1YX3A 2HWVA 3VYTB 2QQ9A 3CDHA 2BXZA 3MAJA 3OMYA 3T5XA 4LMYA 3QU6A 2DMNA 4ENMA 1V5EA 3LSGA 5D6FA 2DMUA 1ZAOA 2EILH 5B66C 4BL0B 4FX4A 2ESHA 2M8GX 2PMZA 4YFKF 3J7AO 4C3HJ 2V1UA 1PVEA 4II3A 4DBQA 4GYIA 4N4NB 4KUMA 5KCMA 4P5OA 2B63J 2A6EF 3HEFA 1O7FA 2LH9A 4JX5A 4BU2A 4ITVA 3RZOJ 1P9QC 4XOTA 1YITI 3K9TA 4EEFG 3WGIA 1R5ID 2W84A 3TQNA 1X1AA 1UAAA 2X9DA 2ZB9A 3GFJA 3EPZA 3OIOA 2RNGA 2QCOA 3S17J 3HRTA 2HZDA 3DLAA 4BJ5C 1T08B 4MQVA 1HKSA 1NHAA 4A3IJ 1XSXA 1FTTA 2EJRA 2PMZN 1DP7P 2OBPA 5B5EC 1TW3A 5JI6A 4PK4A 1POGA 4OMYA 2HZTA 1ZYRF 2EPFA 3CMAI 3N4MA 3RYPA 2Q2EA 3TW7A 2O61A 2HXIA 5H2FC 1S72I 1FWZA 2HQAA 3F8NA 2OC6A 2WAQA 1ON2A 1OCRH 4WXCA 1USSA 3HC7A 3QP6A 3RPUA 2FEZA 1BIBA 2I8DA 5CJ9A 4XR6A 3O8GA 3KIOA 2LTPA 1U2WA 3BG6A 4C2UA 1FOYA 2Z99A 4L5EA 1TNSA 3I9V2 3H3VK 1T2KA 1G2HA 2V79A 3CF2A 2PEXA 3MMYB 4KICA 3MVPA 4KISA 5HDNA 3PSIA 2KKOA 1XTAA 4D5CA 2KIMA 4IO9F 5CVUA 3LOCA 2QENA 4BBSJ 1MJAA 1IO2A 4OU0A 1QVUA 2CW7A 1BW6A 1MH4A 2FBKA 4DW6A 1Z67A 1D0YA 2BYVE 2A5WA 2XDVA 4XLCA 3ZQFA 4B44A 5EZHA 2XUBA 2WY8Q 3OL4A 4ETSA 1KU3A 1IGNA 1T56A 2HOSA 3DV8A 2WAQN 4XRFA 3JRHA 1YS6A 3HOXJ 1R1UA 3SEQA 1IZ1A 3T8RA 1PP8F 3IKTA 2NNYA 1MZBA 3LSTA 1PUFA 5EDNA 1MJBA 4OIPF 3C2BA 2K9MA 1GUUA 2OZ6A 1MNEA 3V42A 4ZYAA 3E1SA 3FHZA 4EJWA 4F7ZA 2QM3A 3KZIC 4I01A 1AA7A 2LSOA 5LHGA 4ZZDA 1OYYA 3QYEA 3G1OA 1JT6A 2ZSHB 4NC7A 2JUGA 4HLXA 4A6DA 4BBRJ 4XN0A 3RZDJ 1XCVA 4OIQF 1HKQA 2L7ZA 4A3DJ 2VE8A 1FMWA 3SFZA 3W2WA 2CS3A 2XAQA 2HFHA 4JX4A 5GPCA 1TW2A 4HV6A 2LYCA 5L3BA 4B48A 4KDPA 2R4GA 3HSRA 1I27A 3LMMA 4QTRA 5ILVA 4L9VA 4BJ6C 5IT9K 2VXZA 1FLIA
chains in the Genus database with same CATH topology
2O9LA 1IC8A 3PO2J 2HOTA 1ZGWA 2VKEA 1AU7A 3LSPA 2YUSA 5M5WJ 3HOVJ 2EH3A 4JYKA 3K2AA 5J1RA 1HLVA 2ID6A 2LD5A 1BJZA 2LR8A 4X1EA 2E1OA 4RDUA 1MSEC 2X48A 1YRNA 5F27A 1JGGA 3S2DJ 1BA5A 2NVYJ 3HKZN 3GTMJ 2DA5A 1Q1VA 3A01A 5FKOA 5F1JA 3I4NJ 4G12A 3S2HJ 4GFBA 1WCMJ 2L7FP 3ZQLA 1AHDP 1WGXA 4D5FA 2GM4A 2LKXA 2GBYA 2HOAA 4M3BA 1XG1A 3G1LA 1HDPA 2XB5A 2EZIA 3S1NJ 5IOZA 2W48A 1TC3C 5E3LA 2Y2ZA 5J1YA 3RQIA 1XC5A 2CJJA 3A02A 3BR2A 3HGGA 2E2IJ 4A3BJ 3OOUA 4A93J 1RPWA 1JKOC 2M34A 1MBEA 1FIPA 1JKQC 4C2MJ 1HF0A 3LSJA 2M0CA 1UG2A 2L0KA 4HNVA 2DA2A 4DYRA 2Y0SN 3O8HA 2M2EA 1F43A 4BY7J 2E19A 5F0CA 1A6IA 1H89C 5EG0A 2XRLA 1QPIA 5FKMA 1FJLA 2EQRA 2CUEA 5GPAA 1LE8A 3GTJJ 2IAIA 2JK3A 1VF9A 4LOCA 3S14J 4X6AJ 1MBJA 3CDLA 2Y9ZA 4MIMA 1ITYA 1F36A 2R5YB 1BL0A 1P7JA 3H0GJ 3S16J 1ETYA 2CUFA 5E3OA 2XSDC 3SFIA 1T33A 2R7ZJ 2WB1N 4MO7A 2DMTA 5M3FJ 1IRZA 3BR6A 5K7HA 1MSFC 3S1QJ 3S1RJ 1ZQ3P 3A01B 1U8BA 1VFCA 2ME0A 3JRFA 3JRDA 1SFOJ 5F0HA 3MKLA 3GTLJ 4XIDA 1GT0C 2JWTA 1RKTA 4QSHA 4IHXA 4C3JJ 3F0CA 3RKQA 5C3EJ 1AKHA 1ETXA 5IP6A 4BXXJ 3LSRA 5K7ZA 2DMPA 5M5XJ 4MFDA 4D7NA 3DEWA 2NVQJ 1JUPA 1A5JA 4IHVA 2D5VA 2JA7J 2OF7A 4A3JJ 1GV5A 3B6CA 3MN2A 2CQQA 3TP0A 5M5YJ 3I4MJ 3TEDA 1ORKA 5FJ8J 2DA7A 1HOMA 5EGOB 1X2NA 1JTYA 1WH7A 3PM1A 5BNGA 3NAUA 1U9OA 2NS7A 5IP9J 2NVTJ 1JT0A 4XRSG 1MBHA 3GTKJ 2IEKA 3HOUJ 2I10A 5FLVA 3JRBA 3HBLA 3GTOJ 2N8GA 3BQYA 2G0EA 4BY1J 3ZQIA 4BKXA 3GTQJ 1DU0A 1LE8B 1FIAA 5C4XJ 1ZR2A 1QVTA 2KT0A 4DZJA 3JRAA 2FJ1A 4UUSA 1LFBA 3FISA 4IHWA 5DTDA 4CYCA 1ETVA 1IJWC 3FKIJ 5C44J 1WI3A 2R5ZA 3HGYA 2R0QC 4DYCA 1WPKA 1MNMC 2EZLA 2MG4A 2Y30A 2HQ5A 4B3AA 5F04A 1OCTC 1QRYA 1B8IA 1JTXA 3BR5A 3BG3A 1PUFB 4B4CA 2CQXA 1Z77A 1ETQA 1JJ8C 4FE4A 1TWHJ 2DA6A 5JLWA 1B72A 2O8KA 4XRMA 2NS8A 2RAEA 5IYDJ 2ID3A 2WV1A 2VKVA 3BR1A 1ZR4A 2H8RA 5IOYA 3M3YJ 2LK2A 3A03A 5IYBJ 3IV5A 1RKWA 1MH3A 2XGEA 4B1RA 1FTZA 3FK6A 2Y9YA 4C3IJ 1IG7A 2E2HJ 1P7IA 1TWAJ 2JMWA 4JP0A 3W6VA 3PO3J 2JA5J 3CQZJ 5M3MJ 2JA8J 3JRGA 4ABZA 4A3EJ 1JKRC 3HOZJ 4W1UA 2K9NA 3Q0UA 3D1NI 1EF4A 2XPWA 1RESA 3HOWJ 3ZQCA 1K83J 4FISA 5J1UA 4A69C 2EZKA 3Q0VA 1ZTRA 5DS9A 2QF7A 3LNQA 2L7MP 4FTHA 3IH2A 4RBOA 1I3QJ 1OCPA 1YRNB 5FKNA 1S7EA 1GV2A 1Z0XA 4S0HB 1VNDA 3BT9A 3B6AA 2EZHA 1X58A 1ETWA 5F08A 2LVSA 2ECBA 1VI0A 1JUSA 4AC0A 3BTJA 2YS9A 2DA1A 1TWFJ 1TWGJ 1OFCX 2X6OA 2NOGA 2COBA 4XRSA 4XICA 1NK2P 3BTCA 3BTIA 2H1KA 1SANA 2M9HA 5EYRA 3ZOBA 2LLKA 1GVDA 3GBGA 1E3OC 1ENHA 1JKPC 1ETOA 4MLOA 1UHSA 5FLMJ 2R92J 4Y52J 2FX0A 4D7MA 1UMQA 2ECCA 2K40A 2LP0A 2KDZA 2DN0A 1W0UA 4NDLA 2TRTA 5FKLA 5K7FA 3SJMA 3M4OJ 4M3FA 2OPTA 3HDDA 3WHCA 3FIWA 3TW6A 1MBFA 3L1PA 4A3FJ 1D5YA 2HYJA 2XB0X 5EG0B 1MBKA 3BQZA 3ZQGA 5EEAA 3SDGA 2EBIA 5E3NA 4M3GA 2XGCA 5F0FA 5HODA 3BG5A 3FK7A 1ZKGA 2VPRA 4A3KJ 2XPUA 2Y31A 2IBDA 2DMNA 2HXOA 2P81A 3K7AJ 4DZPA 5EF6A 3LSGA 1NK3P 2DMUA 1OJLA 1O4XA 3GTGJ 5FKKA 1MBGA 1U9NA 2VUMJ 2M8GX 1RR7A 4C3HJ 3BG9A 2HI3A 5J3LA 1R9TJ 1DU6A 2R5YA 4A3LJ 4I6ZA 2B63J 2K9QA 3HEFA 4JX5A 3RZOJ 5GP9A 2DA3A 1AKHB 4EEFG 1JUMA 3IH3A 3GTPJ 3BTLA 4IHYA 2X9DA 2ZB9A 3HOYJ 2AHQA 4A3GJ 3OIOA 2FD5A 2FQ4A 1TWCJ 3BR0A 2QCOA 3S17J 1Y1VJ 4Y7NJ 5E3MA 4A3CJ 4FE7A 4A3IJ 1FTTA 1IUFA 3Q3SA 4IEJA 4W97A 2ELKA 2PMZN 2O7OA 1I6HJ 4V2FA 4A3MJ 1K61A 2E2JJ 1POGA 5JLXA 2VI6A 5IYCJ 4I76A 1Y1WJ 5IP7J 3JRIA 3DCFA 2JN6A 3TW7A 1HDDC 2HXIA 2JA6J 1H8AC 1H88C 5EGOA 2XPVA 3CMYA 3O8GA 1FEXA 2DTZA 2LTPA 4L5EA 3H3VK 3Q0WA 1CQTA 3OSFA 1G2HA 4AYBN 4UUSB 2CU7A 3MVPA 3G1MA 4CYCB 2LY9A 4DYQA 3QPLA 3QQAA 2R5ZB 2ME6A 1ETKA 4D5CA 4QIWN 1XS9A 2JJ7A 3LOCA 4M3DA 3JRCA 4BBSJ 1QVUA 1ZK8A 1BW6A 1MH4A 3HM5A 1LFUP 4DW6A 1B8IB 4M3EA 1IDYA 3JR9A 1BW5A 2L9RA 3ZQFA 2LFBA 5EZHA 1IGNA 3IH4A 1IDZA 1RETA 1T56A 1B72B 2HOSA 2CRGA 2WAQN 3HB9A 1NTCA 3JRHA 2DMQA 5C4JJ 3HOXJ 4UUTA 3JREA 1GDTA 2DA4A 1PUFA 5EDNA 4JX6A 2MGQA 3C2BA 3CCYA 3TP3A 1U78A 1GUUA 4XK4A 2MSYA 1W0TA 1IV6A 3S1MJ 1WH5A 4AUXA 3G1OA 2TCTA 1JT6A 4BBRJ 4FCYA 1HCRA 3RZDJ 2AO9A 2L7ZA 4A3DJ 3VPRA 1APLC 4J19A 3ZQHA 4M6VA 5GPCA 4JX4A 2MW8A 3NARA 9ANTA 1X2MA 3BR3A 1JJ6C 5IPAA 3OSGA 3QPSA 4MFEA 2K9SA 3S15J 2XGDA 3E7LA 3UKGA 1I50J 2YU9J 2NVXJ 2DJNA 2HDDA 4QTRA 2GLOA 5EZGA 4V2GA 3WHBA 2R93J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9L A;  1IC8 A;  3PO2 J;  2HOT A;  1ZGW A;  2VKE A;  1AU7 A;  3LSP A;  2YUS A;  5M5W J;  3HOV J;  2EH3 A;  4JYK A;  3K2A A;  5J1R A;  1HLV A;  2ID6 A;  2LD5 A;  1BJZ A;  2LR8 A;  4X1E A;  2E1O A;  4RDU A;  1MSE C;  2X48 A;  1YRN A;  5F27 A;  1JGG A;  3S2D J;  1BA5 A;  2NVY J;  3HKZ N;  3GTM J;  2DA5 A;  1Q1V A;  3A01 A;  5FKO A;  5F1J A;  3I4N J;  4G12 A;  3S2H J;  4GFB A;  1WCM J;  2L7F P;  3ZQL A;  1AHD P;  1WGX A;  4D5F A;  2GM4 A;  2LKX A;  2GBY A;  2HOA A;  4M3B A;  1XG1 A;  3G1L A;  1HDP A;  2XB5 A;  2EZI A;  3S1N J;  5IOZ A;  2W48 A;  1TC3 C;  5E3L A;  2Y2Z A;  5J1Y A;  3RQI A;  1XC5 A;  2CJJ A;  3A02 A;  3BR2 A;  3HGG A;  2E2I J;  4A3B J;  3OOU A;  4A93 J;  1RPW A;  1JKO C;  2M34 A;  1MBE A;  1FIP A;  1JKQ C;  4C2M J;  1HF0 A;  3LSJ A;  2M0C A;  1UG2 A;  2L0K A;  4HNV A;  2DA2 A;  4DYR A;  2Y0S N;  3O8H A;  2M2E A;  1F43 A;  4BY7 J;  2E19 A;  5F0C A;  1A6I A;  1H89 C;  5EG0 A;  2XRL A;  1QPI A;  5FKM A;  1FJL A;  2EQR A;  2CUE A;  5GPA A;  1LE8 A;  3GTJ J;  2IAI A;  2JK3 A;  1VF9 A;  4LOC A;  3S14 J;  4X6A J;  1MBJ A;  3CDL A;  2Y9Z A;  4MIM A;  1ITY A;  1F36 A;  2R5Y B;  1BL0 A;  1P7J A;  3H0G J;  3S16 J;  1ETY A;  2CUF A;  5E3O A;  2XSD C;  3SFI A;  1T33 A;  2R7Z J;  2WB1 N;  4MO7 A;  2DMT A;  5M3F J;  1IRZ A;  3BR6 A;  5K7H A;  1MSF C;  3S1Q J;  3S1R J;  1ZQ3 P;  3A01 B;  1U8B A;  1VFC A;  2ME0 A;  3JRF A;  3JRD A;  1SFO J;  5F0H A;  3MKL A;  3GTL J;  4XID A;  1GT0 C;  2JWT A;  1RKT A;  4QSH A;  4IHX A;  4C3J J;  3F0C A;  3RKQ A;  5C3E J;  1AKH A;  1ETX A;  5IP6 A;  4BXX J;  3LSR A;  5K7Z A;  2DMP A;  5M5X J;  4MFD A;  4D7N A;  3DEW A;  2NVQ J;  1JUP A;  1A5J A;  4IHV A;  2D5V A;  2JA7 J;  2OF7 A;  4A3J J;  1GV5 A;  3B6C A;  3MN2 A;  2CQQ A;  3TP0 A;  5M5Y J;  3I4M J;  3TED A;  1ORK A;  5FJ8 J;  2DA7 A;  1HOM A;  5EGO B;  1X2N A;  1JTY A;  1WH7 A;  3PM1 A;  5BNG A;  3NAU A;  1U9O A;  2NS7 A;  5IP9 J;  2NVT J;  1JT0 A;  4XRS G;  1MBH A;  3GTK J;  2IEK A;  3HOU J;  2I10 A;  5FLV A;  3JRB A;  3HBL A;  3GTO J;  2N8G A;  3BQY A;  2G0E A;  4BY1 J;  3ZQI A;  4BKX A;  3GTQ J;  1DU0 A;  1LE8 B;  1FIA A;  5C4X J;  1ZR2 A;  1QVT A;  2KT0 A;  4DZJ A;  3JRA A;  2FJ1 A;  4UUS A;  1LFB A;  3FIS A;  4IHW A;  5DTD A;  4CYC A;  1ETV A;  1IJW C;  3FKI J;  5C44 J;  1WI3 A;  2R5Z A;  3HGY A;  2R0Q C;  4DYC A;  1WPK A;  1MNM C;  2EZL A;  2MG4 A;  2Y30 A;  2HQ5 A;  4B3A A;  5F04 A;  1OCT C;  1QRY A;  1B8I A;  1JTX A;  3BR5 A;  3BG3 A;  1PUF B;  4B4C A;  2CQX A;  1Z77 A;  1ETQ A;  1JJ8 C;  4FE4 A;  1TWH J;  2DA6 A;  5JLW A;  1B72 A;  2O8K A;  4XRM A;  2NS8 A;  2RAE A;  5IYD J;  2ID3 A;  2WV1 A;  2VKV A;  3BR1 A;  1ZR4 A;  2H8R A;  5IOY A;  3M3Y J;  2LK2 A;  3A03 A;  5IYB J;  3IV5 A;  1RKW A;  1MH3 A;  2XGE A;  4B1R A;  1FTZ A;  3FK6 A;  2Y9Y A;  4C3I J;  1IG7 A;  2E2H J;  1P7I A;  1TWA J;  2JMW A;  4JP0 A;  3W6V A;  3PO3 J;  2JA5 J;  3CQZ J;  5M3M J;  2JA8 J;  3JRG A;  4ABZ A;  4A3E J;  1JKR C;  3HOZ J;  4W1U A;  2K9N A;  3Q0U A;  3D1N I;  1EF4 A;  2XPW A;  1RES A;  3HOW J;  3ZQC A;  1K83 J;  4FIS A;  5J1U A;  4A69 C;  2EZK A;  3Q0V A;  1ZTR A;  5DS9 A;  2QF7 A;  3LNQ A;  2L7M P;  4FTH A;  3IH2 A;  4RBO A;  1I3Q J;  1OCP A;  1YRN B;  5FKN A;  1S7E A;  1GV2 A;  1Z0X A;  4S0H B;  1VND A;  3BT9 A;  3B6A A;  2EZH A;  1X58 A;  1ETW A;  5F08 A;  2LVS A;  2ECB A;  1VI0 A;  1JUS A;  4AC0 A;  3BTJ A;  2YS9 A;  2DA1 A;  1TWF J;  1TWG J;  1OFC X;  2X6O A;  2NOG A;  2COB A;  4XRS A;  4XIC A;  1NK2 P;  3BTC A;  3BTI A;  2H1K A;  1SAN A;  2M9H A;  5EYR A;  3ZOB A;  2LLK A;  1GVD A;  3GBG A;  1E3O C;  1ENH A;  1JKP C;  1ETO A;  4MLO A;  1UHS A;  5FLM J;  2R92 J;  4Y52 J;  2FX0 A;  4D7M A;  1UMQ A;  2ECC A;  2K40 A;  2LP0 A;  2KDZ A;  2DN0 A;  1W0U A;  4NDL A;  2TRT A;  5FKL A;  5K7F A;  3SJM A;  3M4O J;  4M3F A;  2OPT A;  3HDD A;  3WHC A;  3FIW A;  3TW6 A;  1MBF A;  3L1P A;  4A3F J;  1D5Y A;  2HYJ A;  2XB0 X;  5EG0 B;  1MBK A;  3BQZ A;  3ZQG A;  5EEA A;  3SDG A;  2EBI A;  5E3N A;  4M3G A;  2XGC A;  5F0F A;  5HOD A;  3BG5 A;  3FK7 A;  1ZKG A;  2VPR A;  4A3K J;  2XPU A;  2Y31 A;  2IBD A;  2DMN A;  2HXO A;  2P81 A;  3K7A J;  4DZP A;  5EF6 A;  3LSG A;  1NK3 P;  2DMU A;  1OJL A;  1O4X A;  3GTG J;  5FKK A;  1MBG A;  1U9N A;  2VUM J;  2M8G X;  1RR7 A;  4C3H J;  3BG9 A;  2HI3 A;  5J3L A;  1R9T J;  1DU6 A;  2R5Y A;  4A3L J;  4I6Z A;  2B63 J;  2K9Q A;  3HEF A;  4JX5 A;  3RZO J;  5GP9 A;  2DA3 A;  1AKH B;  4EEF G;  1JUM A;  3IH3 A;  3GTP J;  3BTL A;  4IHY A;  2X9D A;  2ZB9 A;  3HOY J;  2AHQ A;  4A3G J;  3OIO A;  2FD5 A;  2FQ4 A;  1TWC J;  3BR0 A;  2QCO A;  3S17 J;  1Y1V J;  4Y7N J;  5E3M A;  4A3C J;  4FE7 A;  4A3I J;  1FTT A;  1IUF A;  3Q3S A;  4IEJ A;  4W97 A;  2ELK A;  2PMZ N;  2O7O A;  1I6H J;  4V2F A;  4A3M J;  1K61 A;  2E2J J;  1POG A;  5JLX A;  2VI6 A;  5IYC J;  4I76 A;  1Y1W J;  5IP7 J;  3JRI A;  3DCF A;  2JN6 A;  3TW7 A;  1HDD C;  2HXI A;  2JA6 J;  1H8A C;  1H88 C;  5EGO A;  2XPV A;  3CMY A;  3O8G A;  1FEX A;  2DTZ A;  2LTP A;  4L5E A;  3H3V K;  3Q0W A;  1CQT A;  3OSF A;  1G2H A;  4AYB N;  4UUS B;  2CU7 A;  3MVP A;  3G1M A;  4CYC B;  2LY9 A;  4DYQ A;  3QPL A;  3QQA A;  2R5Z B;  2ME6 A;  1ETK A;  4D5C A;  4QIW N;  1XS9 A;  2JJ7 A;  3LOC A;  4M3D A;  3JRC A;  4BBS J;  1QVU A;  1ZK8 A;  1BW6 A;  1MH4 A;  3HM5 A;  1LFU P;  4DW6 A;  1B8I B;  4M3E A;  1IDY A;  3JR9 A;  1BW5 A;  2L9R A;  3ZQF A;  2LFB A;  5EZH A;  1IGN A;  3IH4 A;  1IDZ A;  1RET A;  1T56 A;  1B72 B;  2HOS A;  2CRG A;  2WAQ N;  3HB9 A;  1NTC A;  3JRH A;  2DMQ A;  5C4J J;  3HOX J;  4UUT A;  3JRE A;  1GDT A;  2DA4 A;  1PUF A;  5EDN A;  4JX6 A;  2MGQ A;  3C2B A;  3CCY A;  3TP3 A;  1U78 A;  1GUU A;  4XK4 A;  2MSY A;  1W0T A;  1IV6 A;  3S1M J;  1WH5 A;  4AUX A;  3G1O A;  2TCT A;  1JT6 A;  4BBR J;  4FCY A;  1HCR A;  3RZD J;  2AO9 A;  2L7Z A;  4A3D J;  3VPR A;  1APL C;  4J19 A;  3ZQH A;  4M6V A;  5GPC A;  4JX4 A;  2MW8 A;  3NAR A;  9ANT A;  1X2M A;  3BR3 A;  1JJ6 C;  5IPA A;  3OSG A;  3QPS A;  4MFE A;  2K9S A;  3S15 J;  2XGD A;  3E7L A;  3UKG A;  1I50 J;  2YU9 J;  2NVX J;  2DJN A;  2HDD A;  4QTR A;  2GLO A;  5EZG A;  4V2G A;  3WHB A;  2R93 J; 
#chains in the Genus database with same CATH topology
 2O9L A;  4ZYE A;  1ZGW A;  3VOD A;  3LSP A;  3L2C A;  3BOQ A;  2R7R A;  2HU9 A;  3H3U A;  4JYK A;  2FXA A;  3MKW B;  5J1R A;  5D5X B;  5DD8 A;  5LFA A;  4UNO A;  2LD5 A;  4JQF A;  5JVT A;  5L3G A;  1MSE C;  2X48 A;  2JSC A;  2MD0 A;  3FX3 A;  4FX0 A;  5D8K B;  3GTM J;  2ADU A;  3JSO A;  3MWM A;  3J7A Y;  3S32 A;  1QO0 D;  3D0S A;  3LFU A;  3QWL A;  4EMS A;  4GFB A;  1WCM J;  2WY7 Q;  2VQG A;  3DBL B;  1WGX A;  2COM A;  1DGW Y;  2DOE A;  4D5F A;  1R49 A;  5E17 F;  3HOT A;  2ZJQ F;  2HOA A;  1VQ6 I;  2O3F A;  1XG1 A;  1P4A A;  3G1L A;  4EGZ A;  3GFM A;  5FRM A;  4O6J A;  3LA7 A;  3CCV I;  1HDP A;  4G6Q A;  4II2 A;  3PUB A;  3KYC B;  4XLP F;  2XB5 A;  2EZI A;  5IOZ A;  4UV8 A;  4UVC A;  5E3L A;  3FDY A;  1TC3 C;  3ROU A;  3L2Q A;  2M87 A;  4RMN A;  2CJJ A;  3T8T A;  1SD6 A;  3SZG A;  4EJV A;  1K78 B;  1YFH A;  2ZO4 A;  3HGG A;  2E2I J;  1RPW A;  1ZG3 A;  3RJP A;  5J4Y A;  5D4R A;  2M34 A;  3I59 A;  2P5K A;  1JKQ C;  4U88 A;  1HF0 A;  4NHJ A;  2IS2 A;  3WTZ A;  3LQQ A;  4M71 A;  5KVR A;  2M0C A;  3L2R A;  2MAB A;  3U21 A;  4IHS A;  2L0K A;  3QPH A;  1BI3 A;  3FMS A;  4P1W A;  1F43 A;  4OIR F;  3HXL A;  4B3X A;  1HST A;  2GWR A;  2F5C A;  2JPB A;  4C30 A;  1Y39 A;  2G9W A;  3HL2 A;  2XRL A;  3P9I A;  3U9G A;  3IUO A;  1HW1 A;  2ELH A;  2O03 A;  2OU2 A;  4X6A J;  5J8F A;  1QGP A;  2O5R A;  3GF2 A;  2DQR A;  3SFI A;  1O3S A;  1T33 A;  1RIO H;  2CUJ A;  2E1N A;  1WJE A;  2FA5 A;  2IPQ X;  4FHT A;  4RB0 A;  5DUK A;  2DMT A;  3OYD A;  2Q1Z B;  2CQK A;  5M3F J;  1IRZ A;  1MSF C;  4UVB A;  3S1R J;  3A01 B;  1U8B A;  1VFC A;  1BIA A;  3C7J A;  1B6A A;  4YFN F;  1SFO J;  4HST A;  2DAO A;  2L2O A;  3F6O A;  2CMP A;  2O0Y A;  3GTL J;  2K3F A;  3M8F A;  5J47 A;  3TOB A;  1S3J A;  3H36 A;  1RKT A;  4QSH A;  3ZCO A;  4E7I A;  4A0Y A;  3FZV A;  1TLH B;  4C3J J;  3GX4 X;  3RKQ A;  5DCM A;  1AKH A;  5IP6 A;  2V1D A;  5M5X J;  4MFD A;  4D7N A;  1WZ2 A;  2GQQ A;  3G6E I;  4HEA 2;  1T8I A;  4UB6 C;  1JUP A;  3LAP A;  3PNY A;  2VBW A;  4Z6Y A;  4BAC A;  2D5V A;  2MBF A;  3HPH A;  1T0F C;  2OF7 A;  1SFX A;  1T0F A;  3OV8 A;  2QBY A;  3TP0 A;  3FXQ A;  5M5Y J;  1ORK A;  2DA7 A;  1HOM A;  1UB9 A;  5EGO B;  2JRM A;  3PM1 A;  1LJ9 A;  4Y33 A;  4D9J A;  2A3S A;  1OQY A;  1T38 A;  2R7F A;  4HF0 A;  3GTK J;  3K4B A;  3M8E A;  1G3T A;  2KFD A;  2W57 A;  4HAM A;  2RGV A;  2YR2 A;  3CUO A;  5L3E A;  2K7L A;  2IJL A;  2LF7 A;  4WK8 F;  3ZQI A;  2WAD A;  3H9Q A;  3BC8 A;  1DU0 A;  3RI4 A;  1LEA A;  1OMI A;  3HG9 A;  2BW3 B;  1WJ5 A;  1LE8 B;  1G3Y A;  3FMQ A;  3QAH A;  5ICC A;  4HV5 A;  1ODD A;  3K70 D;  1ZRE A;  2PI0 A;  2NOJ B;  3QYB A;  5HDK A;  4H0E A;  1ZG5 A;  4KJZ A;  3TKY A;  4I2O A;  1YW7 A;  2UXX A;  4DZJ A;  3K1M A;  2L9N A;  4UUS A;  2CWE A;  4HX7 A;  5DTD A;  1Z7L A;  1ETV A;  3DXJ F;  3G2B A;  1L0O C;  4G7Z F;  2RVC A;  5C44 J;  2R5Z A;  1WI3 A;  4CXF A;  3HGY A;  3MFK A;  1GLN A;  2MC3 A;  1D5V A;  5HVQ C;  1MNM C;  2KHM A;  2HQ5 A;  1OCT C;  5TIS C;  5K5O A;  1QRY A;  3GXO A;  1YJW I;  2VOD A;  2ZXW H;  3BG3 A;  3BR5 A;  3BJA A;  5A2Q Z;  3H5R A;  1T6S A;  2DA6 A;  1BR1 A;  3OYB A;  3MD2 A;  5K5Q A;  2XAU A;  4XRM A;  5IYD J;  3F23 A;  1X1B A;  2VKV A;  3V7R A;  3BR1 A;  3WU1 B;  2XSJ C;  5CQE A;  3M3Y J;  3RKX A;  3WU0 A;  2OAZ A;  1GXQ A;  2M8E A;  2XGE A;  5DYM A;  4A2U A;  1G3S A;  2KJB A;  1F1Z A;  4MHG A;  1G6N A;  4RM3 A;  2UZK A;  3WGH A;  1XSV A;  1I3A A;  4J01 A;  2Y9Y A;  3HOS A;  3TL4 X;  1Y6I A;  3W6V A;  3PO3 J;  4JP0 A;  1G8X A;  2JA5 J;  3CQZ J;  3HSE A;  4PFO A;  3JRG A;  4BQA A;  2VOO A;  3MQ0 A;  1JKR C;  1MMD A;  1L3L A;  3E6M A;  2FE3 A;  4N9H A;  2BBY A;  2L01 A;  1HSJ A;  3HOW J;  3ZQC A;  1H9T A;  2X4H A;  2P0W A;  3NRV A;  4A69 C;  4BS9 A;  3VB2 A;  1CGP A;  3F3X A;  4L9T A;  5F6F A;  2QKL B;  3IH2 A;  3C18 A;  1YS7 A;  4NQW B;  2ZXH A;  4GCV A;  2A69 F;  1GXP A;  3E6C C;  2VQL A;  1MKM A;  2HQR A;  1S7E A;  4KN7 X;  3F72 A;  1EA3 A;  1GV2 A;  3ZGK A;  1FMV A;  3J80 K;  2E36 A;  3BT9 A;  3B6A A;  4LD5 A;  1UEL B;  2EZH A;  2VBZ A;  4L0Y B;  1X58 A;  4HX8 A;  1R7J A;  3K69 A;  1R58 A;  3DBR B;  3A0H C;  5BPI A;  1OCZ H;  1XX5 A;  2EFO A;  3BTJ A;  4LK0 F;  5GAD J;  2YS9 A;  3PIP F;  2H94 A;  1VQO I;  2P5V A;  3PFY A;  3IHU A;  4IRI A;  2L54 A;  4G6T B;  3D5S C;  4N9I A;  5JR3 A;  2HTS A;  4XIC A;  3MEX A;  5LD2 C;  4OIO F;  2V1X A;  3BTC A;  3LQR A;  5EYR A;  4QLC U;  4E7S A;  1RR8 C;  3BP8 A;  1JKP C;  4XKC A;  3EYI A;  5HLI A;  1ETO A;  3E0J B;  5LHH A;  5FLM J;  1BN5 A;  2VOP A;  2VPL A;  3IRQ A;  2QQB A;  4FT8 A;  4PGH A;  5BQT A;  3LA2 A;  2K40 A;  4D0P A;  1H0M A;  3KP2 A;  3QOD A;  4H4K C;  4OAZ A;  3SJM A;  4XN3 A;  3F21 A;  4ANJ A;  2GIZ A;  4OOI A;  4BUP A;  2OPT A;  2VT2 A;  2E60 A;  3FIW A;  5HLG A;  2VIX A;  4ASN A;  2M7B A;  2R7U A;  2IA0 A;  3L1P A;  2X1E A;  2E5N A;  5LEK A;  5EG0 B;  3BQZ A;  3ZQG A;  5EEA A;  1HC8 A;  1V5F A;  2AQF A;  1IXS B;  3ZN1 A;  4AD9 A;  3CLO A;  3BG5 A;  4KIF A;  3PUF A;  3K1N A;  2HYF A;  2VPR A;  4A3K J;  2XPU A;  2CG4 A;  2IBD A;  1LNW A;  2HXO A;  3K7A J;  3ERE D;  5EF6 A;  2VQC A;  3TO9 A;  2K3P A;  3G71 I;  5AIP A;  4RGU A;  1OJL A;  1X19 A;  1O4X A;  2VUM J;  4B47 A;  4OWR B;  4P9U A;  1O3R A;  2VBX A;  2M45 A;  3BG9 A;  5J3L A;  1V4R A;  4X0G A;  2R5Y A;  3CP8 A;  3DU6 A;  2QWW A;  4Y15 A;  3HUG A;  3OYC A;  4KYW A;  3Q9V A;  3GLX A;  3UR3 C;  3BWG A;  3K4J A;  4AM3 A;  1YTY A;  3R4K A;  4UV9 A;  1JUM A;  2BE5 F;  3IH3 A;  3GTP J;  3P9K A;  4U0Y A;  4IHY A;  5D5V B;  3ISP A;  2EV0 A;  3HOY J;  3HJE A;  2AHQ A;  4BEH A;  4A3G J;  2FD5 A;  5LGN A;  1TWC J;  2XF6 A;  1UG0 A;  3GZ5 A;  5H6R A;  3SZT A;  1X4O A;  4HF2 A;  3IRR A;  3A4C A;  3ABT A;  2AXT C;  1S5L C;  1T98 A;  4Y17 A;  1G4D A;  3C2G A;  1RNL A;  1YLF A;  3Q3S A;  3CMM A;  4W97 A;  2IS4 A;  4YIR X;  2L02 A;  1D0Z A;  4V2F A;  3V8J A;  2VT3 A;  2QLZ A;  3RPQ A;  4A3M J;  1FZP B;  3A2K A;  2XIG A;  5CQG A;  1LB2 A;  3E6D A;  2XV4 S;  4I76 A;  1SD4 A;  5IP7 J;  1BC7 C;  2LG4 A;  3DCF A;  2GIV A;  1E0E A;  4JBA A;  1HDD C;  2P7V B;  3KYL A;  3ZMT A;  1H8A C;  1DDN A;  1H88 C;  1IUY A;  2ZC2 A;  1FYK A;  1HW5 A;  1VQN I;  1UJ8 A;  1EH7 A;  3CMY A;  3CCM I;  2BZT A;  3P7N A;  2KRF A;  4EGY A;  2R3S A;  1W7P D;  2HPI A;  1S7O A;  2BHY A;  3CJN A;  1A31 A;  3AFH A;  1EJ9 A;  1QZZ A;  4HLY A;  4FET A;  3O2P E;  1R23 A;  3VFZ A;  4CYC B;  4NC8 A;  3LFK A;  3QQA A;  5KAI C;  5KNL A;  1XS9 A;  2JJ7 A;  4M3D A;  4D1Q A;  3JRC A;  2ISZ A;  6PAX A;  4IXA A;  4CHU A;  1XGM A;  1ZK8 A;  3HM5 A;  1LFU P;  3RCO A;  1B8I B;  1BW5 A;  3JR9 A;  3V8L A;  1J2X A;  3H9J A;  1IDZ A;  1B72 B;  5FRO A;  2QUF A;  5J4V A;  3J7Y J;  2JZY A;  2DMQ A;  1KA8 A;  2VJ4 A;  3K0L A;  2A6T A;  4RLQ A;  4E7J A;  5AON A;  1EV7 A;  2DA4 A;  5ICF A;  3X2Q H;  1JI8 A;  2KMU A;  2PBI A;  3FXM A;  3HRU A;  2MGQ A;  3CCY A;  3TP3 A;  2P6T A;  1YO5 C;  4YII A;  1PDN C;  3TOA A;  3FXU A;  1IV6 A;  1WHU A;  1IN4 A;  2BOL A;  2A68 F;  5KAF C;  1VQL I;  2HYG D;  1WFX A;  1KU7 A;  4M9X A;  2TCT A;  2E34 A;  2NS0 A;  1P4X A;  4FCY A;  2DFI A;  1J59 A;  3JW4 A;  1ON1 A;  4CDG A;  4NNJ A;  4DBR A;  1W1W E;  2MW8 A;  1S9H A;  1WWX A;  3TO6 A;  1E3P A;  3NAR A;  2L4M A;  1X2M A;  4G6D A;  9ANT A;  1JJ6 C;  3HTS B;  5IPA A;  3BCA A;  4DNC A;  1QNT A;  2E7W A;  2K9S A;  1I50 J;  2YU9 J;  3F8C A;  2DJN A;  4IRG A;  2HDD A;  2MLK A;  3WHB A;  1WJD A;  4RB2 C;  4L9N A;  2YUS A;  3T1B A;  5BMZ A;  5M5W J;  2PLY A;  2W1O A;  4WXD A;  3K2A A;  1BJZ A;  2D45 A;  4RDU A;  1YRN A;  1JGG A;  3IWF A;  3UNG C;  3S2D J;  5IT9 Z;  1BA5 A;  1TQP A;  1U0J A;  3L2U A;  4XLE A;  4I98 B;  4UXN A;  3HHH A;  5LHI A;  1Q1V A;  3OWT A;  4XKV A;  1JXS A;  1FSH A;  5E1Z B;  5F1J A;  4U87 A;  3SQN A;  1B4A A;  3ZQL A;  1X1P A;  4BNC A;  5ICG A;  2LKX A;  2RKH A;  2GBY A;  1YJN I;  2X1D A;  1BC8 C;  2L5Q A;  3CP2 A;  3DPL C;  1IAW A;  1WI9 A;  1LVK A;  3MCZ A;  4GRI A;  4CZC A;  1CF7 B;  3QPT A;  3C3W A;  1XC5 A;  3AL0 B;  1RUO A;  2MC4 A;  3CME I;  2WB1 A;  2PFB A;  4AIJ A;  3LSH A;  3F8F A;  1VQ4 I;  4A3B J;  3OOU A;  4A93 J;  2EFN A;  3A1Y A;  3TDZ C;  1W5S A;  3S3N A;  1RRJ A;  2E1M C;  1BOA A;  2YSR A;  4XLF A;  2O8X A;  2FNP A;  1A35 A;  1ZGJ A;  5HNF A;  1UG2 A;  2DCE A;  3V8K A;  5CVR A;  2ZNZ A;  5ICE A;  4XLH A;  2BHZ A;  2DT5 A;  3FXR A;  2M2E A;  5D4S A;  2E19 A;  1A6I A;  4UHT A;  1Z91 A;  2QSF X;  2KP6 A;  1W36 D;  4IJA A;  1FJL A;  2E35 A;  5GPA A;  3U1K A;  4WF2 A;  3GTJ J;  1LDJ A;  3L2V A;  3S14 J;  3WTX C;  2HNH A;  3RTR A;  3WTU C;  4MIM A;  2Y9Z A;  2MYS A;  2LBF B;  2ZBK A;  3H5A A;  2IGO A;  2WB1 N;  3IKV A;  5ED4 A;  4MO7 A;  4EM2 A;  1HBX G;  3M7G A;  4QPO A;  2VAS A;  5IT3 A;  1ZQ3 P;  2OD5 A;  2PG4 A;  4U7D A;  3MKL A;  3EYY A;  3R0A A;  1V3F A;  2QGU A;  1RUN A;  1WJC A;  3M07 A;  4IHX A;  2DPU A;  2OQR A;  1IRX A;  1ETX A;  4BXX J;  1BR2 A;  4YFX F;  2L4A A;  3DKY A;  3R60 A;  2DFE A;  1O3Q A;  3OIP A;  2F4I A;  1N25 A;  2K4B A;  2K02 A;  1A6Q A;  3S3M A;  1X1C A;  2CO5 A;  1S7A A;  2IP2 A;  1A5J A;  1OYI A;  3CCS I;  4E7L A;  4IHV A;  5TJJ A;  1KYZ A;  1KQ0 A;  1GV5 A;  3B6C A;  2CV0 A;  4BXU A;  3I4M J;  2GA1 A;  1JTY A;  2ICW G;  4G8X A;  3NAU A;  3AL0 C;  2H6C A;  2NS7 A;  2V9K A;  4MNU A;  4XRS G;  1VTN C;  3WTS C;  3ONQ A;  5FLV A;  3TO7 A;  4DGW B;  1T95 A;  3RSN A;  1P2F A;  3V7S A;  2MA3 A;  2ZXJ A;  4E7H A;  2IW5 A;  4A0Z A;  5B3S H;  2X6W A;  2EA4 A;  4HDU A;  3MZH A;  1LPQ A;  2KIU A;  3MKY B;  4LIT A;  1ZR2 A;  2X1C A;  4LGW A;  3KX2 A;  2DLL A;  1FP1 D;  3F8M A;  2FJ1 A;  1LFB A;  1R6R A;  3FIS A;  1KQ8 A;  1MMA A;  2F5V A;  3R0J A;  4KMF A;  3AKZ A;  4G7O F;  5DUI A;  4DYC A;  1LEB A;  1XGO A;  2MG4 A;  2Y30 A;  1Y8R B;  2XRO A;  4YG2 F;  2P5L C;  4CSW A;  4GDF A;  1D1A A;  2DK8 A;  4GO1 A;  4PDK A;  1YI2 I;  2CQX A;  1DQU A;  1IXR C;  2XAG A;  2XAJ A;  4AIK A;  2FSW A;  1IN8 A;  2H09 A;  4EAT A;  3CCR I;  5IY5 H;  2WV1 A;  1XD7 A;  2HQN A;  4PJN A;  1U8R A;  5IOY A;  3CO7 C;  1N75 A;  1OR7 C;  2K85 A;  3FBN B;  2MH9 A;  3MZ8 A;  2LRE A;  3CUQ B;  4RAZ A;  1OR7 A;  4IQJ A;  3H0D A;  3KZY A;  1TP4 A;  4CH7 A;  1J5Y A;  1JGS A;  2VC1 A;  1Z9C A;  1FTZ A;  1MMN A;  3W2V A;  3JTG A;  3K4K A;  1LDD A;  4CCK A;  1W5C C;  4KT6 A;  4CO8 A;  5M3M J;  4ABZ A;  2DYS H;  1UHM A;  1J75 A;  4W1U A;  2K9N A;  2DOF A;  2LNB A;  3Q0U A;  2JRT A;  2XPW A;  4IPA A;  1RES A;  3M9A A;  4FIS A;  4WX9 A;  1SMT A;  3K4C A;  4F52 A;  1FBU A;  3JTH A;  3Q0V A;  4RM2 A;  4S05 A;  5E8I A;  2FBI A;  3CTA A;  1Z7U A;  4PJL A;  4XKB A;  3CJQ B;  2HVQ A;  1MDM B;  2KL4 A;  4EM0 B;  2M7A A;  3BZK A;  4IKF A;  1OCP A;  1YX5 A;  2KLO A;  5JFR A;  1YQA A;  3ZR8 X;  4S0H B;  3SDB A;  3DTK A;  3ZMV A;  5FB2 A;  2E1C A;  3GLL A;  4JOM A;  2EIJ H;  1UZC A;  3GZN B;  5F08 A;  5F1R A;  3RPU D;  3DP7 A;  1JUS A;  1KYW A;  1OFC X;  2ELJ A;  1TT0 A;  3DKW A;  4I09 A;  3VOE A;  1E3H A;  1BOB A;  2COB A;  3BRO A;  3J80 Z;  3CJR B;  2JPC A;  4XRS A;  5HLT A;  2WAE A;  2K5C A;  3RDI A;  1WJA A;  1SVO A;  3BTI A;  3FMR A;  4Y13 A;  4AIH A;  2BGC A;  4BYY A;  3QOE A;  3BJ6 A;  1Q1H A;  3GBG A;  4CA0 A;  5GAG J;  2O6G E;  4QPQ A;  5FFX A;  4EM1 A;  4MLO A;  1K6Y A;  1W7P B;  4UY8 I;  1U5T B;  2LKP A;  3F8B A;  3DLL F;  1P92 A;  4XOR A;  3AG3 H;  3RYR A;  1HQC A;  2Y75 A;  1R1V A;  1VZ0 A;  3DEU A;  3CZ6 A;  2FX0 A;  4D7M A;  1UMQ A;  2ECC A;  4G9Y A;  4PZJ A;  3OYI A;  1OCC H;  1SD5 A;  4KIB A;  3KYD B;  2UUZ A;  5FD5 A;  2QQA A;  1O57 A;  4LG0 A;  2KIS A;  4LLG F;  2QSG X;  3ZRG A;  4HBL A;  4BE1 A;  3HDD A;  1ZGA A;  2CV1 A;  5ILU A;  3G4S I;  1K78 A;  2XB0 X;  3DWL E;  1BI2 A;  3SDG A;  5E3N A;  2DPD A;  4M3G A;  4XNF A;  2FF4 A;  3COA C;  1OLT A;  2W4S A;  2D1H A;  1F9N A;  4YEJ A;  3S8P A;  2B0L A;  2CH0 A;  3H92 A;  1ZKG A;  1FYM A;  2Y31 A;  1P6R A;  4I02 A;  4RGS A;  2F4O B;  2ZXI A;  4DZP A;  2XVC A;  3K4M A;  3GO5 A;  4NB5 A;  1NK3 P;  3GTG J;  1A04 A;  5FKK A;  1U9N A;  2PJR B;  2DU9 A;  1RR7 A;  2HPM A;  3BPX A;  1G3W A;  1DU6 A;  3FHN A;  3NEU A;  4C2T A;  2BVM A;  4NUB A;  2K9Q A;  4IOA F;  1ZHF A;  2QEX I;  2RN7 A;  2W00 A;  4P55 A;  3ZQ7 A;  4KA4 A;  3E6B A;  2KZV A;  5GP9 A;  5F64 A;  2XC7 A;  1XSD A;  1SVM A;  2R7S A;  4PCQ A;  3K10 A;  2OCE A;  5JVG F;  3CC7 I;  3L00 A;  5CPR B;  1TT5 B;  2NVU B;  4L0Z B;  1IXC A;  2WC2 A;  5TGT A;  3ABM H;  1F4K A;  3I55 I;  3CJT B;  4CGZ A;  1ZN2 A;  1Y1V J;  2PMU A;  4HNU A;  4A3C J;  5E18 F;  2NRA C;  5FLX K;  4AYB A;  3M8J A;  1IUF A;  1REP C;  4RAG A;  5LEJ A;  2AS5 F;  2O7O A;  4ENJ A;  2PMH A;  1I6H J;  4RA2 A;  5GAE J;  1J09 A;  3KZZ A;  5IYC J;  5JLX A;  2VXD A;  2XF7 A;  2QVO A;  2ACJ A;  3KE2 A;  3I56 I;  2Z3Y A;  2IS1 A;  2EFQ A;  2JN6 A;  2L9V A;  3E97 A;  1J7K A;  3CD6 I;  2JA6 J;  2E5Z A;  5HS8 A;  3IAM 2;  4HOB A;  4LB5 A;  1IW7 F;  2M5W A;  5EGO A;  4F3Q A;  3OYN A;  2XPV A;  3KCC A;  4E7Z A;  1BJA A;  1X3U A;  3OR1 C;  2DTZ A;  1R5H A;  2Z9O A;  5CYV A;  5B1A H;  4GXO A;  3OSF A;  1SVL A;  4E4H A;  4AYB N;  5DV5 A;  1VQ9 I;  4ESF A;  3N97 A;  3G1M A;  3OYK A;  3IWZ A;  2J5O A;  2LY9 A;  4DYQ A;  3QPL A;  1W4M A;  3E5Q A;  3EUK L;  3ECH A;  4DIQ A;  3OS0 A;  4N4O B;  3REO A;  4QIW N;  2BW3 A;  3WU2 C;  4RAY A;  3WTT C;  1ZLK A;  3JAM K;  3BZC A;  5LRR A;  4MEX F;  3ECO A;  4HYE A;  3OYF A;  3HPG A;  3HB9 A;  3DEE A;  2ZNY A;  3S2W A;  3F6V A;  3K4L A;  3JRE A;  3KEO A;  1GDT A;  1SFK A;  1S6L A;  5GAH J;  1A36 A;  4JX6 A;  4BJT A;  3OYL A;  1U78 A;  4XQF A;  2Z33 A;  2JQ7 A;  4F91 B;  2M0M A;  2ZJP F;  2F6C A;  4XK4 A;  3R6S A;  2MSY A;  3BY6 A;  2DT6 A;  3S1M J;  2V9V A;  3HHG A;  1FSE A;  2QQ8 A;  4HG2 A;  4XBF A;  1IN6 A;  2HVS A;  1QZE A;  2HKO A;  1U3E M;  3WTW C;  2J5P A;  1HCR A;  2V6E A;  5HS9 A;  4L5I A;  3TDU C;  4KNY A;  2HDC A;  2AO9 A;  3HKZ A;  3VPR A;  4M6V A;  1X4P A;  1VQM I;  2IA1 A;  1Z05 A;  2VKH A;  4AWX B;  3W2A A;  1KGS A;  2W25 A;  1YIJ I;  3OSG A;  1FY7 A;  2VC0 A;  4MFE A;  3S15 J;  3B73 A;  3HRS A;  2GLO A;  1OYW A;  4V2G A;  2R93 J;  5H6Q A;  1IC8 A;  3PO2 J;  2HOT A;  2VKE A;  1AU7 A;  2NNN A;  2E7X A;  2KIF A;  3CCU I;  3E5X A;  1ONV A;  3CF5 F;  2L9S A;  4CCJ A;  1FPQ A;  2ID6 A;  3QRF F;  3MKZ A;  2EV6 A;  4NQW A;  3KEQ A;  2LR8 A;  5HS7 A;  4X1E A;  2XKO A;  2OCC H;  2H6B A;  2NVY J;  3HKZ N;  2V4J C;  3FKJ A;  1UST A;  4EV0 A;  1WVR A;  4XSZ F;  5FKO A;  4DQ2 A;  2W7N A;  2NXN B;  2W24 A;  4LJZ F;  5CLS A;  2UWM A;  2ZME B;  3S2H J;  1EH8 A;  3GW2 A;  2P6S A;  2L7F P;  1AHD P;  1XDS A;  1NG7 A;  1VQ5 I;  2Y0S A;  4LLN A;  4RB3 C;  1WKM A;  4AID A;  2TDX A;  3BLY A;  2FOK A;  5LRS A;  2KPM A;  2LC2 A;  3E3V A;  2WV0 A;  2Y2Z A;  3FXK A;  3I5U A;  3RQI A;  4ZJZ A;  1G59 A;  3WGG A;  3AG4 H;  3A02 A;  3O3K A;  4E6K G;  4ZH4 F;  3BR2 A;  4EJO A;  4QWQ A;  3DU5 A;  2X85 A;  1TZL A;  1MBE A;  2DTR A;  4C2M J;  4BE2 A;  3FXO A;  2YPR A;  1KU2 A;  4HNV A;  2DA2 A;  2EA2 A;  1M1E B;  2H27 A;  1FX7 A;  2Y0S N;  3CCJ I;  2ZSI B;  2DW4 A;  3BZ6 A;  5JHU A;  1X1D A;  2VBY A;  1XGN A;  5EG0 A;  2RC4 A;  2JTV A;  5FKM A;  2CUE A;  3T0Y A;  3ASN H;  1VF9 A;  1FOX A;  3U1D A;  2FQ3 A;  1DUX C;  1TQI A;  1YW9 A;  1F36 A;  1BL0 A;  1P7J A;  4IQ4 A;  4UUV A;  3S16 J;  5E3O A;  2CUF A;  3JSP A;  2CW8 A;  2R7Z J;  1IRG A;  3I54 A;  2Q8K A;  1MD0 A;  3BR6 A;  5K7H A;  3S1Q J;  3ZPL A;  3VYU B;  2GA2 A;  1R36 A;  2ME0 A;  4M6Y A;  3JRD A;  2LDU A;  3WG7 H;  1MW7 A;  2IGN A;  4CCN A;  3TBI A;  2M30 A;  4CUG A;  2VN2 A;  2STW A;  3DQV C;  4LB6 B;  2K27 A;  4HA8 A;  3BDD A;  3H35 A;  2OTL I;  4U0V A;  1BR4 A;  3L7W A;  4WWC A;  1N77 A;  4XLA A;  1MIJ A;  3HRM A;  2LOO A;  2JVH A;  3QOP A;  5HOO A;  2VQH A;  3ELK A;  1YE9 A;  3C1D A;  1VQ8 I;  3H3Z A;  2JA7 J;  4I0B A;  4A3J J;  2FMY A;  2GOX B;  2Q2E B;  4GYG A;  2ISY A;  1ULY A;  2GXA A;  3VYS B;  3MN2 A;  1SAU A;  4CCM A;  5FJ8 J;  1PP7 U;  2W82 A;  4EQQ A;  5DCF A;  4ENK A;  5BNG A;  3B02 A;  3KFW X;  5IP9 J;  1JT0 A;  4XSX F;  1IN7 A;  4ZTJ A;  2DDB A;  3FXJ A;  2IEK A;  3HOU J;  2I10 A;  2XAS A;  5D5W B;  3S3O A;  1R1T A;  5LBQ A;  2R7D A;  4WCG A;  2PJP A;  3EDP A;  3HBL A;  4HQM A;  2EIM H;  4BY1 J;  3HIF A;  4BKX A;  1FYL A;  2XAH A;  3KP6 A;  2DOD A;  1FIA A;  1UCR A;  2OUM A;  5C4X J;  3PNT A;  1QVT A;  2KT0 A;  4AU7 A;  3SHF A;  3LAJ A;  2JA2 A;  2XF5 A;  3SEZ A;  2YX7 A;  4LG3 A;  5E20 A;  4ZDO A;  3L2W A;  1JHF A;  4F92 B;  4Q4Z F;  4CYC A;  1XCB A;  5D6E A;  1IJW C;  3EUH C;  5BOX A;  1QHH D;  2E71 A;  1KON A;  1Z6R A;  3EUH A;  2BXY A;  2EZL A;  1I1S A;  4TV7 A;  1B8I A;  2K4J A;  1U6G A;  3HSF A;  1JE8 A;  1PUF B;  4B4C A;  3GFL A;  4HNT A;  4HZF A;  4BDY A;  5JLW A;  5FD6 A;  1B72 A;  2O8K A;  3A0B C;  3ABL H;  4L5J A;  1B9N A;  2RAE A;  3PSF A;  4UVA A;  5CKT A;  2H8R A;  4PSW A;  1QA6 A;  1I6X A;  1SAX A;  3GZ6 A;  2LK2 A;  3A03 A;  3IV5 A;  1MH3 A;  4B1R A;  1LQ1 A;  5HDG A;  3FK6 A;  4BHB A;  4MGR A;  2MLG A;  2YU3 A;  1IG7 A;  2Z16 A;  2M3A A;  1TWA J;  3KLN A;  3W6K B;  1D8K A;  2V26 A;  4A3E J;  2ZKZ A;  1EF4 A;  3OYG A;  4K2E A;  3ZXS A;  4A6E A;  4ENN A;  3IL2 A;  2H1L A;  3K1P A;  1KQ9 A;  1K83 J;  1WQ2 A;  3U2R A;  2KJC A;  4LIV A;  1R4M B;  3OY9 A;  2RV8 A;  4ON0 A;  4M9S A;  4Q47 A;  2ESN A;  2AXL A;  3DTI A;  3LNQ A;  1F5T A;  2L7M P;  2BV6 A;  4FTH A;  4BQN A;  4IVN A;  1BI1 A;  2M4G A;  1BBY A;  4RBO A;  1I3Q J;  1I5Z A;  1MMG A;  1V55 H;  2K86 A;  2RRE A;  5CVI A;  1Z0X A;  2ETH A;  2P7C B;  2D2W A;  4E7K A;  2XHK A;  1VND A;  4M74 A;  1IV8 A;  1FC3 A;  5L3C A;  1XB4 A;  3LA3 A;  5L3D A;  2V1N A;  2DJI A;  2XKP A;  5B1B H;  2R7X A;  1R4N B;  2GAU A;  2LVS A;  4IX7 A;  3FWE A;  1VI0 A;  4AC0 A;  2R7O A;  5AIQ A;  4YIF A;  4U7B A;  1SEU A;  1B9M A;  4Q48 A;  2DA1 A;  1TWF J;  4KIT B;  2QA4 I;  1R22 A;  2X6O A;  2NOG A;  4F93 B;  3ZP5 A;  4PSX A;  2R7T A;  5CVJ A;  2V9P A;  4WXH A;  1X3W B;  2KRH A;  1XMA A;  4U0W A;  2H1K A;  1SAN A;  1MND A;  4IHT A;  1QZY A;  2LLK A;  1GVD A;  3KLO A;  1ENH A;  1D1B A;  2F48 A;  3BG7 A;  3PJR A;  1PJR A;  3KPH A;  2F5E A;  1I1G A;  3J7Z I;  4F55 A;  2R92 J;  2LP0 A;  2DN0 A;  3I59 B;  5ILS A;  1W0U A;  2Y0M A;  1T39 A;  2TRT A;  5FKL A;  5K7F A;  3K70 C;  5TRD A;  1CF7 A;  1WRJ A;  2RQQ A;  3W6J B;  2L7K A;  5GTI C;  4EJU A;  4M72 A;  1IRF A;  3WHC A;  3PQJ A;  2VKD A;  1B1B A;  2GXB A;  2JT1 A;  3VEP A;  3PNV A;  4A5N A;  1D5Y A;  4ZYH A;  1MBK A;  2DO7 A;  3QYF A;  3JCU C;  2EBI A;  3N05 A;  5F0F A;  5HOD A;  2XAF A;  5CVV A;  3OYM A;  5E1X A;  3FK7 A;  2LKS A;  3D5L A;  3GME A;  4G7H F;  5LGU A;  1ZRD A;  3TGN A;  1DPR A;  1XPX A;  2P81 A;  1TTY A;  5J6X A;  2MD5 A;  2DDA A;  3DFG A;  1VQ7 I;  4PGG A;  3RKW A;  3OYH A;  2VLA A;  1LFP A;  1MBG A;  2DT7 B;  2HI3 A;  4KT5 C;  1R9T J;  4OIN F;  5BPD A;  4A3L J;  4I6Z A;  2LBF A;  2YX4 A;  2A6H F;  2FU4 A;  3P9C A;  3SXY A;  4HSR A;  1C0W A;  3IP4 B;  5DCM B;  3GVA A;  2DA3 A;  2HGC A;  4Y4R A;  1AKH B;  4BE0 A;  3J81 Z;  3BTL A;  1FBS A;  2G7H A;  2HVR A;  2HS5 A;  1QPM A;  3S93 A;  5L3F A;  2FQ4 A;  1Y56 A;  3BR0 A;  4HF1 A;  5BS6 A;  1QBJ A;  1STZ A;  1HKT A;  5D5U B;  2FML A;  4Y7N J;  5E3M A;  4FE7 A;  3ZMZ A;  2F2E A;  1K4T A;  1SMY F;  4I0A A;  4IF4 A;  4IEJ A;  3TMO A;  2CQN A;  3ULQ B;  2QBY B;  2ELK A;  3OR2 C;  4PJJ A;  2WTE A;  1YJ9 I;  3OOP A;  2X6Y A;  1H9G A;  1K61 A;  3NQO A;  2E2J J;  2EIN H;  2VI6 A;  4BGD A;  1UHW A;  4Z2Y A;  3G73 A;  1ZRF A;  2VB6 A;  4LG0 B;  2HOE A;  1Y1W J;  1IN5 A;  3JRI A;  2CSO A;  1V5G A;  3I4P A;  2DXI A;  4ZDL A;  1PUE E;  2RDP A;  5FLX Z;  1S29 A;  2L3D A;  1ZRC A;  2CFO A;  5K1Y A;  2DFF A;  2W85 A;  2JUC A;  4XON A;  3OS2 A;  1DGR M;  2PN6 A;  3LSK A;  4O3M A;  2UXN A;  3EET A;  2R7W A;  4AVZ A;  4IL6 C;  1FEX A;  3KET A;  2A05 A;  2WAF A;  4PJ0 C;  3V7C A;  4ZZL A;  4CYD A;  3Q0W A;  1CQT A;  3K2Z A;  1TL8 A;  4UUS B;  2CU7 A;  4B09 A;  1V54 H;  3CCE I;  3V4G A;  4ZYD A;  2HKX A;  2R5Z B;  2ME6 A;  1ETK A;  1JHH A;  1QQI A;  3ZMS A;  1D1C A;  3GWZ A;  3O6B B;  5LGT A;  1K79 A;  3CES A;  4M3E A;  1IDY A;  2IGK A;  3K4N A;  4BDZ A;  1TNT A;  3G3Z A;  3FM3 A;  2L9R A;  3LWF A;  1LKX A;  4AVP A;  2LFB A;  3IH4 A;  1RET A;  1R00 A;  2CRG A;  1OPC A;  1NTC A;  3WOD F;  1YIO A;  2ZFW A;  1LUJ B;  5C4J J;  4UUT A;  3ESW B;  1SFE A;  2FOW A;  2Y48 A;  4HQE A;  3JAM Z;  3CDI A;  3FBI B;  3HZJ A;  1XN7 A;  4M6X A;  2AQE A;  1W0T A;  2FUG 2;  2DQL A;  4HDV A;  1I39 A;  1WH5 A;  4AUX A;  1QHG A;  4ZDP A;  3CUQ C;  4BHC A;  3L9F A;  2GZW A;  3CUQ A;  2OTJ I;  2KIQ A;  3RQ4 A;  5HNH A;  3PFI A;  2EFW A;  3GUD A;  1XDU A;  4MEY F;  1APL C;  4J19 A;  3ZQH A;  5DM6 F;  1VQP I;  4LFU A;  1Z21 A;  4LIU A;  1N78 A;  3F22 A;  3AG2 H;  4PJM A;  3BR3 A;  3VDX A;  1MMS A;  2LF8 A;  3FM5 A;  3ZMD A;  4IRH A;  3QPS A;  2XGD A;  3E7L A;  4KMU X;  3UKG A;  2EV5 A;  3CC4 I;  3WE3 A;  2NVX J;  3H5N A;  3QU3 A;  4I99 C;  2DOA A;  5EZG A;  3H1C A;  4BQO A;  5DM7 F;  3I71 A;  4XKW A;  1VQK I;  1DPU A;  4PFP A;  1TBX A;  2R7Q A;  2XGX A;  4ESB A;  5DEQ A;  3J81 K;  2LMD A;  5KK1 A;  2XRN A;  2UV1 A;  4JK1 X;  3GCM A;  4I7H A;  2VJ5 A;  3HOV J;  2EH3 A;  5LLQ A;  1NG6 A;  1HLV A;  4CIC A;  1KU9 A;  5FGM A;  1MDM A;  2E1O A;  3CCQ I;  2VL8 A;  1KZH A;  2EWN A;  3KEY A;  5F27 A;  4ZYG A;  2IRF G;  4R1H A;  3OS1 A;  2PQ8 A;  4OAY A;  2DA5 A;  1YG2 A;  3A01 A;  2VJI A;  1J9I A;  4MQ9 F;  3W3C A;  2OQG A;  3I4N J;  2P8T A;  4G12 A;  4CZZ A;  1ERD A;  3OL3 A;  2C6Y A;  4V19 K;  2JSP A;  1XMK A;  2GM4 A;  2IVM A;  4LLL A;  5E1W A;  3ABK H;  5FRN A;  3OYA A;  4M3B A;  5H20 A;  5J8C A;  2VJJ A;  2WWY A;  1B59 A;  2CFX A;  2EIK H;  2DK5 A;  2BY2 A;  2M4K A;  4KFC A;  2MH2 A;  3IAS 2;  1P4W A;  3KP3 A;  4CCO A;  1RI7 A;  3S1N J;  4A0X A;  4ZTF A;  4XMY A;  3R61 A;  2W48 A;  4BHP A;  4BXF A;  3VWB A;  5J1Y A;  1SD7 A;  1U5T C;  3VYR B;  4A12 A;  1RC9 A;  2HDW A;  1W7P A;  2EK5 A;  1U5T A;  4A5M A;  1SFU A;  3I0T A;  4M73 A;  3AG1 H;  2B7E A;  1AOY A;  1FNN A;  2R7V A;  2OA4 A;  3SYT A;  1XGS A;  2OJE D;  3Q5F A;  1JKO C;  3KP7 A;  1FIP A;  1LDK B;  3P5J A;  2RQP A;  3LSJ A;  3RIR A;  1ACI A;  4E70 A;  2LRD A;  5FO5 A;  2X51 A;  1HXD A;  2A07 F;  4DYR A;  2BY3 A;  3O8H A;  4BY7 J;  2MFZ A;  4CCL A;  3GFI A;  4YEL A;  3CCL I;  5F0C A;  1H89 C;  5FFZ A;  1QPI A;  2WBM A;  2EQR A;  3I58 A;  1Y0N A;  5HLH A;  1LE8 A;  3CLQ A;  5D8L B;  2IAI A;  2JK3 A;  4RLF A;  4LOC A;  4IOC F;  1MBJ A;  2KDO A;  2QYO A;  2RNJ A;  3CDL A;  3KP4 A;  1YHQ I;  1ITY A;  2HR3 A;  5E8G A;  2R5Y B;  3H0G J;  1ETY A;  2XSD C;  3DKX A;  3WE2 A;  1GVJ A;  5KHD A;  1R71 A;  3I64 A;  4XLN F;  3HUG B;  3VSK A;  4C9Y A;  5EEH A;  3NWT A;  4Y3O A;  2PJR A;  5K5R A;  1TQM A;  2IGM A;  2QZ8 A;  3ERM A;  2IA2 A;  2X6X A;  3JRF A;  2BY1 A;  5F0H A;  2QKM B;  4G94 A;  4BEH B;  5GTH C;  2JVG A;  2F5D A;  4XID A;  4ESJ A;  1GT0 C;  2JWT A;  2STT A;  1BM9 A;  3LSI A;  3F0C A;  1E2X A;  5C3E J;  3E5U A;  4ZC3 A;  4R8H A;  5K7Z A;  2DMP A;  3LSR A;  1SC7 A;  3FXL A;  3OYJ A;  2Z2S B;  1GHC A;  3PQK A;  2BVL A;  3DEW A;  2NVQ J;  3ABU A;  2ZJR F;  2D1V A;  4MTD A;  3MZY A;  1D0X A;  3ASO H;  4RB1 A;  1WJB A;  4B8X A;  4DJA A;  3C2H A;  3BPV A;  1E17 A;  4L9J A;  2CQQ A;  3D5R C;  1OCO H;  3FF5 A;  3TED A;  2F4M B;  1ZAR A;  1X2N A;  1WH7 A;  2H8W A;  4M9Z A;  4RS8 A;  5DD4 A;  4Q5S F;  1U9O A;  1WSU A;  2NVT J;  3PL8 A;  1QU3 A;  1MBH A;  2NYX A;  3QP5 A;  1FP2 A;  3JRB A;  1J0R A;  5EJC A;  2PX9 A;  2DFH A;  3GTO J;  4BAY A;  2N8G A;  3BQY A;  2G0E A;  2HTJ A;  1EKE A;  3GTQ J;  5JHF A;  4EJT A;  4NBQ A;  4N0B A;  3WG9 A;  3DF8 A;  2VE9 A;  1OKR A;  4UB8 C;  3GYH X;  1OIS A;  5A2Q K;  3JRA A;  4P96 A;  1Y0U A;  2EFP A;  4IHW A;  1DP3 A;  2IS6 A;  3FKI J;  2LY1 A;  2R0Q C;  1FOK A;  3BJO A;  2V6C A;  1WPK A;  3CC2 I;  4LK1 F;  4B3A A;  1BI0 A;  5F04 A;  4YRV A;  2GOM A;  1ZG1 A;  1JTX A;  1O7L A;  3HTU A;  1AWC A;  1YOV B;  1ETQ A;  1Z77 A;  2M1B A;  4FE4 A;  1JJ8 C;  1TWH J;  4PUS A;  4RGR A;  4KN4 X;  3IC7 A;  3M1C A;  2IT0 A;  1W5T A;  2CUZ A;  4HRI A;  1Z1D A;  2NS8 A;  3Q9S A;  2ID3 A;  4L18 B;  2ZFU A;  3BCB A;  1D3Y A;  1ZR4 A;  4FAS D;  3KP5 A;  2FNA A;  2HEO A;  3OYE A;  4MTE A;  5IYB J;  1RKW A;  1Z3Y A;  4GGG A;  1W36 C;  4C3I J;  1NH3 A;  2E2H J;  1P7I A;  2JMW A;  1YYV A;  1O3T A;  1EH6 A;  2EB7 A;  4O5V A;  5J40 A;  1K7A A;  2JA8 J;  1UFM A;  1IF1 A;  4OMZ A;  4S04 A;  3HOZ J;  2A5Y B;  1Z3X A;  3OIQ A;  3ZQQ A;  3D1N I;  2P4W A;  2FBH A;  4HX4 A;  4XOP A;  4HPQ A;  2BEO A;  5DDG A;  5J1U A;  2CYY A;  3LL7 A;  2EZK A;  3H9G A;  2G7U A;  3ZMU A;  3I53 A;  4KIG A;  1ZTR A;  5DS9 A;  4B43 A;  2F5F A;  2CW0 F;  2QF7 A;  4P9F A;  2IXS A;  1X3Z B;  4NC6 A;  1R5G A;  2ZCW A;  5FKN A;  1YRN B;  1ZLJ A;  3K6G A;  1FBQ A;  5EEG A;  1FT9 A;  4R79 A;  1LVA A;  2QSH X;  2Z1D A;  1MGT A;  2DI3 A;  2OZU A;  3WTV C;  4IZZ A;  1XMX A;  4XL9 A;  1ETW A;  1FOW A;  2ECB A;  3CO6 C;  2BY0 A;  1K6O A;  2X0L A;  3NWS A;  2LY2 A;  1TWG J;  2OV7 A;  2WA0 A;  1HA8 A;  2VON A;  2CGP A;  2I5U A;  1S8N A;  1MJ9 A;  1Y8Q B;  2KQR A;  2Y69 H;  3M1E A;  1NK2 P;  2ZME C;  4RGX A;  1PYV A;  2M9H A;  2ZME A;  3ZOB A;  5E79 C;  1D8J A;  3F9K A;  1E3O C;  3DPU A;  2A61 A;  2DBB A;  3DPT A;  4RAF A;  1UHS A;  3EUA A;  1YW8 A;  2KZG A;  2V7F A;  4BH9 A;  1RZ4 A;  3I3L A;  4Y52 J;  2Z5U A;  3ML6 A;  2Q0O A;  3LSM A;  2KDZ A;  1Z6T A;  4J00 A;  3DBH B;  1WJF A;  4NDL A;  2B9S A;  3PIO F;  5ERI A;  3M4O J;  2E1M B;  4M3F A;  1ZH5 A;  2K9L A;  4HW0 A;  3VSL A;  2FRH A;  3DTE A;  3EQL F;  2ZJ2 A;  4EVI A;  3WTY C;  3AAF A;  3L09 A;  2NAZ A;  3RKY A;  3SZP A;  3TW6 A;  2CV2 A;  1HW2 A;  1K4S A;  2CQ7 A;  3ZN0 A;  1MBF A;  4A3F J;  2HYJ A;  4XM3 A;  2GXG A;  4DOZ A;  2DYR H;  2XGC A;  2KRC A;  3HYI A;  4BQQ A;  3GEZ A;  4FQG A;  1ZEL A;  1YX3 A;  2HWV A;  3VYT B;  2QQ9 A;  3CDH A;  2BXZ A;  3MAJ A;  3OMY A;  3T5X A;  4LMY A;  3QU6 A;  2DMN A;  4ENM A;  1V5E A;  3LSG A;  5D6F A;  2DMU A;  1ZAO A;  2EIL H;  5B66 C;  4BL0 B;  4FX4 A;  2ESH A;  2M8G X;  2PMZ A;  4YFK F;  3J7A O;  4C3H J;  2V1U A;  1PVE A;  4II3 A;  4DBQ A;  4GYI A;  4N4N B;  4KUM A;  5KCM A;  4P5O A;  2B63 J;  2A6E F;  3HEF A;  1O7F A;  2LH9 A;  4JX5 A;  4BU2 A;  4ITV A;  3RZO J;  1P9Q C;  4XOT A;  1YIT I;  3K9T A;  4EEF G;  3WGI A;  1R5I D;  2W84 A;  3TQN A;  1X1A A;  1UAA A;  2X9D A;  2ZB9 A;  3GFJ A;  3EPZ A;  3OIO A;  2RNG A;  2QCO A;  3S17 J;  3HRT A;  2HZD A;  3DLA A;  4BJ5 C;  1T08 B;  4MQV A;  1HKS A;  1NHA A;  4A3I J;  1XSX A;  1FTT A;  2EJR A;  2PMZ N;  1DP7 P;  2OBP A;  5B5E C;  1TW3 A;  5JI6 A;  4PK4 A;  1POG A;  4OMY A;  2HZT A;  1ZYR F;  2EPF A;  3CMA I;  3N4M A;  3RYP A;  2Q2E A;  3TW7 A;  2O61 A;  2HXI A;  5H2F C;  1S72 I;  1FWZ A;  2HQA A;  3F8N A;  2OC6 A;  2WAQ A;  1ON2 A;  1OCR H;  4WXC A;  1USS A;  3HC7 A;  3QP6 A;  3RPU A;  2FEZ A;  1BIB A;  2I8D A;  5CJ9 A;  4XR6 A;  3O8G A;  3KIO A;  2LTP A;  1U2W A;  3BG6 A;  4C2U A;  1FOY A;  2Z99 A;  4L5E A;  1TNS A;  3I9V 2;  3H3V K;  1T2K A;  1G2H A;  2V79 A;  3CF2 A;  2PEX A;  3MMY B;  4KIC A;  3MVP A;  4KIS A;  5HDN A;  3PSI A;  2KKO A;  1XTA A;  4D5C A;  2KIM A;  4IO9 F;  5CVU A;  3LOC A;  2QEN A;  4BBS J;  1MJA A;  1IO2 A;  4OU0 A;  1QVU A;  2CW7 A;  1BW6 A;  1MH4 A;  2FBK A;  4DW6 A;  1Z67 A;  1D0Y A;  2BYV E;  2A5W A;  2XDV A;  4XLC A;  3ZQF A;  4B44 A;  5EZH A;  2XUB A;  2WY8 Q;  3OL4 A;  4ETS A;  1KU3 A;  1IGN A;  1T56 A;  2HOS A;  3DV8 A;  2WAQ N;  4XRF A;  3JRH A;  1YS6 A;  3HOX J;  1R1U A;  3SEQ A;  1IZ1 A;  3T8R A;  1PP8 F;  3IKT A;  2NNY A;  1MZB A;  3LST A;  1PUF A;  5EDN A;  1MJB A;  4OIP F;  3C2B A;  2K9M A;  1GUU A;  2OZ6 A;  1MNE A;  3V42 A;  4ZYA A;  3E1S A;  3FHZ A;  4EJW A;  4F7Z A;  2QM3 A;  3KZI C;  4I01 A;  1AA7 A;  2LSO A;  5LHG A;  4ZZD A;  1OYY A;  3QYE A;  3G1O A;  1JT6 A;  2ZSH B;  4NC7 A;  2JUG A;  4HLX A;  4A6D A;  4BBR J;  4XN0 A;  3RZD J;  1XCV A;  4OIQ F;  1HKQ A;  2L7Z A;  4A3D J;  2VE8 A;  1FMW A;  3SFZ A;  3W2W A;  2CS3 A;  2XAQ A;  2HFH A;  4JX4 A;  5GPC A;  1TW2 A;  4HV6 A;  2LYC A;  5L3B A;  4B48 A;  4KDP A;  2R4G A;  3HSR A;  1I27 A;  3LMM A;  4QTR A;  5ILV A;  4L9V A;  4BJ6 C;  5IT9 K;  2VXZ A;  1FLI A; 
#chains in the Genus database with same CATH homology
 2O9L A;  1IC8 A;  3PO2 J;  2HOT A;  1ZGW A;  2VKE A;  1AU7 A;  3LSP A;  2YUS A;  5M5W J;  3HOV J;  2EH3 A;  4JYK A;  3K2A A;  5J1R A;  1HLV A;  2ID6 A;  2LD5 A;  1BJZ A;  2LR8 A;  4X1E A;  2E1O A;  4RDU A;  1MSE C;  2X48 A;  1YRN A;  5F27 A;  1JGG A;  3S2D J;  1BA5 A;  2NVY J;  3HKZ N;  3GTM J;  2DA5 A;  1Q1V A;  3A01 A;  5FKO A;  5F1J A;  3I4N J;  4G12 A;  3S2H J;  4GFB A;  1WCM J;  2L7F P;  3ZQL A;  1AHD P;  1WGX A;  4D5F A;  2GM4 A;  2LKX A;  2GBY A;  2HOA A;  4M3B A;  1XG1 A;  3G1L A;  1HDP A;  2XB5 A;  2EZI A;  3S1N J;  5IOZ A;  2W48 A;  1TC3 C;  5E3L A;  2Y2Z A;  5J1Y A;  3RQI A;  1XC5 A;  2CJJ A;  3A02 A;  3BR2 A;  3HGG A;  2E2I J;  4A3B J;  3OOU A;  4A93 J;  1RPW A;  1JKO C;  2M34 A;  1MBE A;  1FIP A;  1JKQ C;  4C2M J;  1HF0 A;  3LSJ A;  2M0C A;  1UG2 A;  2L0K A;  4HNV A;  2DA2 A;  4DYR A;  2Y0S N;  3O8H A;  2M2E A;  1F43 A;  4BY7 J;  2E19 A;  5F0C A;  1A6I A;  1H89 C;  5EG0 A;  2XRL A;  1QPI A;  5FKM A;  1FJL A;  2EQR A;  2CUE A;  5GPA A;  1LE8 A;  3GTJ J;  2IAI A;  2JK3 A;  1VF9 A;  4LOC A;  3S14 J;  4X6A J;  1MBJ A;  3CDL A;  2Y9Z A;  4MIM A;  1ITY A;  1F36 A;  2R5Y B;  1BL0 A;  1P7J A;  3H0G J;  3S16 J;  1ETY A;  2CUF A;  5E3O A;  2XSD C;  3SFI A;  1T33 A;  2R7Z J;  2WB1 N;  4MO7 A;  2DMT A;  5M3F J;  1IRZ A;  3BR6 A;  5K7H A;  1MSF C;  3S1Q J;  3S1R J;  1ZQ3 P;  3A01 B;  1U8B A;  1VFC A;  2ME0 A;  3JRF A;  3JRD A;  1SFO J;  5F0H A;  3MKL A;  3GTL J;  4XID A;  1GT0 C;  2JWT A;  1RKT A;  4QSH A;  4IHX A;  4C3J J;  3F0C A;  3RKQ A;  5C3E J;  1AKH A;  1ETX A;  5IP6 A;  4BXX J;  3LSR A;  5K7Z A;  2DMP A;  5M5X J;  4MFD A;  4D7N A;  3DEW A;  2NVQ J;  1JUP A;  1A5J A;  4IHV A;  2D5V A;  2JA7 J;  2OF7 A;  4A3J J;  1GV5 A;  3B6C A;  3MN2 A;  2CQQ A;  3TP0 A;  5M5Y J;  3I4M J;  3TED A;  1ORK A;  5FJ8 J;  2DA7 A;  1HOM A;  5EGO B;  1X2N A;  1JTY A;  1WH7 A;  3PM1 A;  5BNG A;  3NAU A;  1U9O A;  2NS7 A;  5IP9 J;  2NVT J;  1JT0 A;  4XRS G;  1MBH A;  3GTK J;  2IEK A;  3HOU J;  2I10 A;  5FLV A;  3JRB A;  3HBL A;  3GTO J;  2N8G A;  3BQY A;  2G0E A;  4BY1 J;  3ZQI A;  4BKX A;  3GTQ J;  1DU0 A;  1LE8 B;  1FIA A;  5C4X J;  1ZR2 A;  1QVT A;  2KT0 A;  4DZJ A;  3JRA A;  2FJ1 A;  4UUS A;  1LFB A;  3FIS A;  4IHW A;  5DTD A;  4CYC A;  1ETV A;  1IJW C;  3FKI J;  5C44 J;  1WI3 A;  2R5Z A;  3HGY A;  2R0Q C;  4DYC A;  1WPK A;  1MNM C;  2EZL A;  2MG4 A;  2Y30 A;  2HQ5 A;  4B3A A;  5F04 A;  1OCT C;  1QRY A;  1B8I A;  1JTX A;  3BR5 A;  3BG3 A;  1PUF B;  4B4C A;  2CQX A;  1Z77 A;  1ETQ A;  1JJ8 C;  4FE4 A;  1TWH J;  2DA6 A;  5JLW A;  1B72 A;  2O8K A;  4XRM A;  2NS8 A;  2RAE A;  5IYD J;  2ID3 A;  2WV1 A;  2VKV A;  3BR1 A;  1ZR4 A;  2H8R A;  5IOY A;  3M3Y J;  2LK2 A;  3A03 A;  5IYB J;  3IV5 A;  1RKW A;  1MH3 A;  2XGE A;  4B1R A;  1FTZ A;  3FK6 A;  2Y9Y A;  4C3I J;  1IG7 A;  2E2H J;  1P7I A;  1TWA J;  2JMW A;  4JP0 A;  3W6V A;  3PO3 J;  2JA5 J;  3CQZ J;  5M3M J;  2JA8 J;  3JRG A;  4ABZ A;  4A3E J;  1JKR C;  3HOZ J;  4W1U A;  2K9N A;  3Q0U A;  3D1N I;  1EF4 A;  2XPW A;  1RES A;  3HOW J;  3ZQC A;  1K83 J;  4FIS A;  5J1U A;  4A69 C;  2EZK A;  3Q0V A;  1ZTR A;  5DS9 A;  2QF7 A;  3LNQ A;  2L7M P;  4FTH A;  3IH2 A;  4RBO A;  1I3Q J;  1OCP A;  1YRN B;  5FKN A;  1S7E A;  1GV2 A;  1Z0X A;  4S0H B;  1VND A;  3BT9 A;  3B6A A;  2EZH A;  1X58 A;  1ETW A;  5F08 A;  2LVS A;  2ECB A;  1VI0 A;  1JUS A;  4AC0 A;  3BTJ A;  2YS9 A;  2DA1 A;  1TWF J;  1TWG J;  1OFC X;  2X6O A;  2NOG A;  2COB A;  4XRS A;  4XIC A;  1NK2 P;  3BTC A;  3BTI A;  2H1K A;  1SAN A;  2M9H A;  5EYR A;  3ZOB A;  2LLK A;  1GVD A;  3GBG A;  1E3O C;  1ENH A;  1JKP C;  1ETO A;  4MLO A;  1UHS A;  5FLM J;  2R92 J;  4Y52 J;  2FX0 A;  4D7M A;  1UMQ A;  2ECC A;  2K40 A;  2LP0 A;  2KDZ A;  2DN0 A;  1W0U A;  4NDL A;  2TRT A;  5FKL A;  5K7F A;  3SJM A;  3M4O J;  4M3F A;  2OPT A;  3HDD A;  3WHC A;  3FIW A;  3TW6 A;  1MBF A;  3L1P A;  4A3F J;  1D5Y A;  2HYJ A;  2XB0 X;  5EG0 B;  1MBK A;  3BQZ A;  3ZQG A;  5EEA A;  3SDG A;  2EBI A;  5E3N A;  4M3G A;  2XGC A;  5F0F A;  5HOD A;  3BG5 A;  3FK7 A;  1ZKG A;  2VPR A;  4A3K J;  2XPU A;  2Y31 A;  2IBD A;  2DMN A;  2HXO A;  2P81 A;  3K7A J;  4DZP A;  5EF6 A;  3LSG A;  1NK3 P;  2DMU A;  1OJL A;  1O4X A;  3GTG J;  5FKK A;  1MBG A;  1U9N A;  2VUM J;  2M8G X;  1RR7 A;  4C3H J;  3BG9 A;  2HI3 A;  5J3L A;  1R9T J;  1DU6 A;  2R5Y A;  4A3L J;  4I6Z A;  2B63 J;  2K9Q A;  3HEF A;  4JX5 A;  3RZO J;  5GP9 A;  2DA3 A;  1AKH B;  4EEF G;  1JUM A;  3IH3 A;  3GTP J;  3BTL A;  4IHY A;  2X9D A;  2ZB9 A;  3HOY J;  2AHQ A;  4A3G J;  3OIO A;  2FD5 A;  2FQ4 A;  1TWC J;  3BR0 A;  2QCO A;  3S17 J;  1Y1V J;  4Y7N J;  5E3M A;  4A3C J;  4FE7 A;  4A3I J;  1FTT A;  1IUF A;  3Q3S A;  4IEJ A;  4W97 A;  2ELK A;  2PMZ N;  2O7O A;  1I6H J;  4V2F A;  4A3M J;  1K61 A;  2E2J J;  1POG A;  5JLX A;  2VI6 A;  5IYC J;  4I76 A;  1Y1W J;  5IP7 J;  3JRI A;  3DCF A;  2JN6 A;  3TW7 A;  1HDD C;  2HXI A;  2JA6 J;  1H8A C;  1H88 C;  5EGO A;  2XPV A;  3CMY A;  3O8G A;  1FEX A;  2DTZ A;  2LTP A;  4L5E A;  3H3V K;  3Q0W A;  1CQT A;  3OSF A;  1G2H A;  4AYB N;  4UUS B;  2CU7 A;  3MVP A;  3G1M A;  4CYC B;  2LY9 A;  4DYQ A;  3QPL A;  3QQA A;  2R5Z B;  2ME6 A;  1ETK A;  4D5C A;  4QIW N;  1XS9 A;  2JJ7 A;  3LOC A;  4M3D A;  3JRC A;  4BBS J;  1QVU A;  1ZK8 A;  1BW6 A;  1MH4 A;  3HM5 A;  1LFU P;  4DW6 A;  1B8I B;  4M3E A;  1IDY A;  3JR9 A;  1BW5 A;  2L9R A;  3ZQF A;  2LFB A;  5EZH A;  1IGN A;  3IH4 A;  1IDZ A;  1RET A;  1T56 A;  1B72 B;  2HOS A;  2CRG A;  2WAQ N;  3HB9 A;  1NTC A;  3JRH A;  2DMQ A;  5C4J J;  3HOX J;  4UUT A;  3JRE A;  1GDT A;  2DA4 A;  1PUF A;  5EDN A;  4JX6 A;  2MGQ A;  3C2B A;  3CCY A;  3TP3 A;  1U78 A;  1GUU A;  4XK4 A;  2MSY A;  1W0T A;  1IV6 A;  3S1M J;  1WH5 A;  4AUX A;  3G1O A;  2TCT A;  1JT6 A;  4BBR J;  4FCY A;  1HCR A;  3RZD J;  2AO9 A;  2L7Z A;  4A3D J;  3VPR A;  1APL C;  4J19 A;  3ZQH A;  4M6V A;  5GPC A;  4JX4 A;  2MW8 A;  3NAR A;  9ANT A;  1X2M A;  3BR3 A;  1JJ6 C;  5IPA A;  3OSG A;  3QPS A;  4MFE A;  2K9S A;  3S15 J;  2XGD A;  3E7L A;  3UKG A;  1I50 J;  2YU9 J;  2NVX J;  2DJN A;  2HDD A;  4QTR A;  2GLO A;  5EZG A;  4V2G A;  3WHB A;  2R93 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...