2NVYJ

Rna polymerase ii form ii in 150 mm mn+2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2nvyJ00
2FD5A 2HXOA 2LY9A 3HGGA 1JKOC 2FX0A 1H89C 2JJ7A 2YS9A 2XB5A 3ZQLA 4A3DJ 3M4OJ 1ETWA 4M3DA 3MKLA 3OSFA 4UUSB 3HOWJ 4A3CJ 2E2IJ 4XK4A 3Q0VA 2Y9YA 3Q0UA 1K83J 1QVTA 3VPRA 5F04A 2DA1A 5FJ8J 3BR3A 1MSFC 3S15J 1JUMA 4FE7A 4DYCA 2VUMJ 2IAIA 3JRFA 3A01A 2JA8J 1F43A 3A01B 1Q1VA 1B8IA 3FIWA 1JKPC 1IDYA 2H1KA 1B8IB 5J1YA 3HEFA 4D7MA 5EG0B 5IP9J 5IOZA 4X1EA 3S1NJ 1RKWA 2JA5J 5GPAA 1BW5A 5DTDA 5JLXA 2LKXA 3GTMJ 1HDPA 1OFCX 1K61A 4C3JJ 2K9NA 3S16J 2Y0SN 2XB0X 2EZLA 3A03A 1P7IA 4ABZA 2D5VA 1B72A 1OJLA 1VI0A 1MBFA 1TWHJ 2CUFA 2COBA 4C2MJ 2X6OA 1B72B 4XIDA 4A3GJ 4MFDA 2K9QA 2NS8A 5FKNA 3M3YJ 2LD5A 1HLVA 3JRDA 3LSGA 1GV5A 1JTXA 4FTHA 1ETKA 2B63J 4MLOA 5C4JJ 2GM4A 1ETYA 3MN2A 2DMTA 4EEFG 2HOSA 3L1PA 2LVSA 3JRAA 5J1RA 2AO9A 3LNQA 2JA7J 1DU6A 3A02A 3BR6A 2JK3A 2ME0A 3ZOBA 3G1LA 4A3FJ 5F0CA 3G1MA 3OOUA 4QTRA 1X58A 3GTQJ 2VI6A 5EZGA 3O8GA 2E2JJ 3HBLA 3I4NJ 1P7JA 2R92J 1QVUA 2M0CA 4C3HJ 1TWGJ 2CRGA 2XGDA 2HQ5A 4A3MJ 3G1OA 1UG2A 1ZGWA 3HKZN 2L0KA 1JTYA 3Q3SA 2Y2ZA 2IBDA 1U9NA 3QPSA 4MO7A 4D5CA 4BBSJ 4W97A 4B4CA 2O9LA 5F08A 3BG9A 3RKQA 4I76A 3PO2J 2LTPA 1E3OC 2AHQA 1MNMC 1X2NA 3ZQFA 5FLMJ 5EGOA 2NVXJ 1IDZA 1JKQC 5EGOB 3HOXJ 2EZKA 1D5YA 3FKIJ 2WB1N 3IH3A 2X48A 4LOCA 2O8KA 3B6AA 3S14J 3LSJA 3FISA 4CYCA 4RBOA 4CYCB 5E3LA 2JA6J 3S1QJ 2LP0A 2DJNA 2CQQA 1GDTA 1LE8A 3GTKJ 1LE8B 2LR8A 3BG5A 1JJ8C 2WAQN 1Z77A 2TRTA 9ANTA 2O7OA 3C2BA 1GT0C 2VKEA 2LFBA 2MGQA 3TW6A 3JR9A 4XRMA 2K9SA 2OPTA 4W1UA 5IP7J 5K7FA 4IHXA 1GVDA 3PO3J 3TEDA 1FTZA 4XICA 1CQTA 4Y52J 5FKLA 1T33A 1ETVA 3H0GJ 3WHCA 1FJLA 5F1JA 1ZR2A 2DA5A 4X6AJ 3S1RJ 2ID6A 3GBGA 2N8GA 1BA5A 2YUSA 2NOGA 4L5EA 1IV6A 4M3GA 1RETA 2L7ZA 3BTLA 2CU7A 1JUPA 4AC0A 3B6CA 1EF4A 2NVQJ 2M8GX 1WPKA 3BQZA 5M5XJ 4A3EJ 1TWAJ 1MSEC 1W0TA 1F36A 1U9OA 4UUTA 5J1UA 1A5JA 3S1MJ 2G0EA 4RDUA 2W48A 4NDLA 2DA4A 1AHDP 1JKRC 4S0HB 1H88C 5E3OA 5GP9A 3BTIA 5F27A 3BR5A 2K40A 2XPUA 1MBJA 2EH3A 1SFOJ 3GTJJ 1JJ6C 2E19A 4IEJA 4IHYA 3GTOJ 1Z0XA 2NVYJ 1SANA 3HOZJ 1I6HJ 2DA2A 3JRIA 2YU9J 4B1RA 3JRGA 1Y1VJ 3CMYA 2HOTA 3JREA 2E2HJ 1IRZA 4HNVA 1AU7A 2EZHA 3SDGA 5EF6A 3SJMA 4A3IJ 3GTPJ 4FCYA 5J3LA 2H8RA 2R0QC 5E3MA 3W6VA 3PM1A 2VKVA 4M3FA 5C3EJ 2ECBA 4XRSA 4BBRJ 2L9RA 5DS9A 4A69C 2LLKA 2Y30A 5EYRA 3HM5A 1XG1A 2R5YA 3FK7A 2R5YB 5M3MJ 3FK6A 2FJ1A 4JYKA 5EZHA 2XPWA 1ZQ3P 1UHSA 1YRNA 5EDNA 1YRNB 3I4MJ 4M6VA 3IH2A 1LFUP 2IEKA 4V2GA 4JX6A 1UMQA 1WH5A 1Y1WJ 4I6ZA 5IYDJ 3BT9A 2XPVA 1RESA 3BR2A 3K2AA 5K7ZA 5FLVA 1IGNA 2R93J 2DMUA 1HCRA 2NVTJ 3ZQGA 4C3IJ 3BTJA 2R5ZA 2R5ZB 4FE4A 1DU0A 2HDDA 3LOCA 1I3QJ 1MBGA 1HDDC 2VPRA 2DA6A 2EBIA 3ZQCA 2DA3A 5FKOA 1ETOA 1ORKA 3BR0A 1TWFJ 1ZTRA 2M34A 2P81A 4A3KJ 3NAUA 4JX5A 3TP0A 2HOAA 3DCFA 1MH3A 4QIWN 5JLWA 1NK3P 5FKKA 5M3FJ 2XGEA 1IG7A 3RQIA 3ZQHA 1U78A 1QRYA 3S2DJ 1G2HA 4XRSG 4M3EA 4D5FA 3H3VK 2WV1A 1JUSA 1ENHA 4DW6A 1FIAA 1RR7A 5F0FA 5F0HA 3D1NI 2PMZN 2L7MP 5M5WJ 1BL0A 2JMWA 1MH4A 3E7LA 4BKXA 1FIPA 4DYRA 1MBHA 3HOVJ 1R9TJ 4A93J 5IYBJ 4MIMA 3HOUJ 3JRHA 3S17J 3UKGA 1JT0A 2LK2A 3ZQIA 3NARA 3LSRA 2QCOA 1RKTA 4UUSA 1BJZA 5GPCA 2EZIA 3OSGA 1PUFA 4M3BA 2RAEA 4BY1J 5HODA 2Y9ZA 1PUFB 3BTCA 2JN6A 1HOMA 4D7NA 1NK2P 3IH4A 2MSYA 2HYJA 3HGYA 4V2FA 1WGXA 3QQAA 4DZPA 1U8BA 4FISA 1IUFA 1JGGA 2GLOA 2FQ4A 1LFBA 1ZKGA 1HF0A 1S7EA 4AUXA 5EG0A 2DMQA 3JRCA 4JP0A 5IPAA 4A3JJ 2GBYA 2ID3A 2M9HA 1MBKA 2L7FP 1APLC 5IOYA 1FTTA 1GUUA 1WCMJ 1VNDA 3CQZJ 3K7AJ 3WHBA 4IHWA 2ZB9A 5E3NA 3HDDA 1I50J 2M2EA 1X2MA 1T56A 3OIOA 1ETQA 3LSPA 1WH7A 2R7ZJ 1ETXA 1FEXA 2QF7A 4G12A 2Y31A 4QSHA 1POGA 1XC5A 2XGCA 3O8HA 1AKHA 2DTZA 1AKHB 5EEAA 3BQYA 5IP6A 3RZDJ 2CUEA 3HB9A 4DZJA 4BXXJ 3CCYA 3F0CA 1O4XA 2DN0A 2KDZA 1ITYA 3RZOJ 1MBEA 1BW6A 4GFBA 4IHVA 1NTCA 5K7HA 1A6IA 2ME6A 4Y7NJ 2XRLA 2HI3A 3MVPA 4BY7J 1XS9A 2ECCA 4DYQA 5IYCJ 4AYBN 3BG3A 1GV2A 2KT0A 3TP3A 3GTLJ 1OCPA 3GTGJ 2JWTA 1IC8A 2DA7A 3QPLA 3HOYJ 1OCTC 2EQRA 2MW8A 1ZK8A 2DMPA 1RPWA 3Q0WA 1VF9A 2I10A 5FKMA 1TC3C 3TW7A 2CQXA 2OF7A 3BR1A 2MG4A 3CDLA 3SFIA 2ELKA 4MFEA 2XSDC 3IV5A 1W0UA 4A3LJ 1H8AC 2E1OA 1ZR4A 1TWCJ 1JT6A 4JX4A 2DMNA 2HXIA 2NS7A 4A3BJ 1QPIA 2CJJA 3DEWA 2X9DA 1WI3A 5C4XJ 5BNGA 5C44J 4J19A 3S2HJ 1IJWC 3JRBA 2TCTA 5M5YJ 1VFCA 4B3AA
chains in the Genus database with same CATH superfamily
2FD5A 2Q0OA 4OIPF 4ZYHA 2OQGA 2A69F 1OCRH 5D8KB 4OAYA 4EGYA 5CVVA 3M4OJ 4M3DA 3ASNH 4BS9A 4LLNA 3MKLA 4UUSB 2YSRA 1MNDA 2V6CA 4LK1F 3GCMA 3BC8A 4KIGA 2M30A 5DUIA 2AS5F 4I98B 1YLFA 1IXCA 2DA1A 4M73A 1ZRFA 3S15J 2MC4A 2IAIA 1WI9A 3PUFA 3JRFA 2K5CA 3DTKA 3CJNA 1KU9A 2H1KA 1D1AA 3OIPA 4OOIA 4RMNA 5J1YA 2W85A 4D7MA 1UAAA 4K2EA 2A3SA 1B59A 3SDBA 1ZG5A 2JA5J 2W24A 2DBBA 2QSFX 3K1MA 1J2XA 3BP8A 3ZCOA 3EUHA 1MMNA 3VYUB 1OFCX 4C3JJ 1SVMA 3A03A 1SAUA 3JAMZ 4MQVA 4QLCU 4PFOA 1FOYA 1B72A 1VI0A 4C2MJ 1TWHJ 1B72B 2COBA 2X6OA 3HRTA 4A3GJ 2K9QA 2IW5A 3OWTA 3K1NA 2D1VA 3HKZA 5B1AH 5FLXZ 2M87A 4M74A 2X1CA 3E5QA 3X2QH 1GV5A 3IWFA 3MEXA 3WTVC 2M7BA 2R3SA 2XRNA 1ETYA 4PFPA 4G8XA 2LDUA 1YE9A 1XDSA 3DPLC 2QKLB 3CF2A 3L1PA 2ZXHA 1YQAA 3E5XA 1MDMB 3V8KA 3L2RA 1RZ4A 3LA2A 3BR6A 2JK3A 2ME0A 5H6QA 3ZOBA 1N75A 2W84A 4HQMA 1X58A 1LEAA 4CO8A 2ISYA 4NUBA 1ZRDA 3I4NJ 3J7ZI 2RC4A 3D5SC 2XGDA 5CJ9A 5ED4A 2QVOA 4Q4ZF 3SXYA 1ZGWA 1FLIA 2F6CA 2XSJC 3BDDA 1JTYA 1SFXA 5HLIA 5KAIC 2PBIA 3MZHA 1FBQA 4GYGA 2EWNA 2HVQA 4MO7A 4D5CA 1YIOA 2CS3A 2XAGA 3RPQA 3OYHA 4BBSJ 4W97A 2IGOA 2D2WA 4I76A 3KP6A 2VC1A 5F64A 3FM5A 5BPIA 2R7DA 1P92A 2LTPA 1EH8A 1UHMA 1WJFA 3RDIA 2HDCA 4EJUA 3M7GA 1BOAA 4BYYA 3S2WA 2RV8A 1BOBA 1XSVA 4L9JA 3ZQFA 5FLMJ 1IAWA 4XRFA 3M8JA 2NVXJ 5E17F 4BNCA 2ZCWA 2ETHA 1VQ5I 5E8IA 1D5YA 3IH3A 2X48A 3GVAA 4II2A 1WJCA 3LSJA 1Z7UA 1IXRC 4Q47A 2M7AA 2YX4A 1K79A 3TO7A 1U3EM 3L09A 4AVZA 5LRRA 3VEPA 1FNNA 3GTKJ 3I0TA 2LR8A 2RNGA 1SD5A 1YG2A 2DYSH 2ZFWA 3LQQA 3TDZC 2Z33A 1GT0C 2VKEA 1JXSA 2ZMEC 5K7FA 1O3RA 2PJPA 5H20A 3QWLA 3L2WA 2OZUA 1S9HA 2HU9A 4XICA 5FKLA 4AVPA 1CQTA 4Y52J 1K6OA 4BQOA 1MMGA 5F1JA 5AIPA 1BIBA 2BE5F 2FQ3A 2OA4A 3KEOA 3TO9A 1IN5A 5HLGA 2STTA 2MC3A 4ZDLA 2OTLI 3W3CA 2P0WA 2X0LA 1F4KA 2QQ9A 1IV6A 1LVKA 2V9KA 1RETA 5HNHA 1U8RA 4KN4X 4HSRA 5DDGA 3K4LA 5K1YA 2HTJA 3J7YJ 1WPKA 1T08B 1MSEC 1U9OA 4UUTA 5J1UA 2KIFA 4IOCF 2G0EA 4G6TB 4RDUA 4Y17A 2EINH 2W48A 4NDLA 3I3LA 4HDVA 3H5RA 1ULYA 3E6DA 2R7RA 4G6DA 1T8IA 2HZDA 3COAC 1U5TA 1U5TB 2EH3A 2Z5UA 3O3KA 4C9YA 2K86A 1JJ6C 3BZKA 1PJRA 4IHYA 1AWCA 5H2FC 2KP6A 4XR6A 3ZN0A 1OPCA 2XUBA 1S7AA 2DA2A 3V8JA 3CMYA 1Z6RA 2QSHX 2YU9J 1I6HJ 2E2HJ 2DU9A 5TJJA 2OCEA 3PIPF 2XC7A 1IN4A 3K10A 3LFUA 2HKXA 5EF6A 3SJMA 2H1LA 1VQ4I 2IA1A 3GX4X 1PP8F 2H8RA 3ZMTA 2B0LA 2M45A 1EH7A 2DW4A 3W6VA 2VKVA 4M3FA 5C3EJ 2VKHA 2FBIA 4BHCA 4A6EA 3K9TA 5FGMA 2ECBA 4XRSA 4KT6A 1Z7LA 4BACA 2E5NA 2UWMA 4A69C 4WX9A 2R5YA 4LJZF 2R5YB 1TLHB 1W1WE 2A6TA 4A5MA 2FJ1A 5EZHA 3BROA 4KUMA 5HLHA 1Q1HA 4XLAA 1MMSA 3C1DA 1DPUA 3CP8A 1YI2I 1K4SA 2LY1A 3WU0A 2R4GA 1TW3A 1ZLKA 2CH0A 3I71A 1Y1WJ 3BG6A 4I7HA 3GFJA 3G73A 4ENJA 1WJ5A 2PJRB 5IYDJ 3BR2A 5IT3A 5FLVA 3KYCB 1ZH5A 1B4AA 3FDYA 4C2UA 2PMZA 2OC6A 4ON0A 1TQMA 1Y0UA 3ASOH 2MH2A 1MW7A 2DLLA 4FE4A 3QP6A 4CYDA 1YS7A 5ICFA 4YIRX 5LRSA 3I54A 1SD7A 3MD2A 3MKWB 4HG2A 1G3SA 3BR0A 1TL8A 4BAYA 1ZLJA 3ZXSA 3S93A 4E4HA 3IRQA 5JLWA 2F5VA 3DXJF 1BM9A 3QU6A 1KU2A 3ZQHA 4BEHA 4BEHB 2BEOA 1EH6A 1BJAA 2KISA 3S2DJ 4HX8A 3BLYA 1BI3A 2KRHA 4D5FA 1G3WA 3FMRA 4IQ4A 3HZJA 5F0HA 1FIAA 3RCOA 2DPUA 3CMAI 5M5WJ 1W5CC 2JMWA 1MH4A 3EYIA 3FXKA 5DUKA 2VIXA 5BQTA 1KQ9A 1FIPA 3DU6A 1MBHA 2JA2A 1X19A 1XGSA 4BJTA 1R9TJ 3HOVJ 3JCUC 1ERDA 2HS5A 2LK2A 1R4NB 1G3TA 4JK1X 3LSRA 3BJOA 3OYIA 1BJZA 3SEQA 4TV7A 3OSGA 4M3BA 5HODA 3BTCA 1FZPB 5A2QK 3SZGA 3VOEA 2E34A 5GTHC 3QQAA 3DBLB 1W7PA 4KIFA 1W7PB 1RC9A 1SD6A 3CMEI 2ADUA 2E1MB 4AU7A 4F7ZA 1ZKGA 5ILSA 4D1QA 4O3MA 4LG3A 3CCEI 2GA2A 5EG0A 3QYEA 3JRCA 4A3JJ 2GBYA 3BWGA 1P4XA 4RB1A 1X1PA 3FMQA 1GUUA 1UJ8A 4HA8A 2BHYA 1WCMJ 3CQZJ 2IS6A 3WHBA 4IHWA 1BR1A 1MJBA 4RAGA 1T0FA 3AKZA 2QM3A 5TISC 2C6YA 1X1DA 2LOOA 2M4GA 3CZ6A 1T56A 2R7ZJ 1KA8A 1Z6TA 1OCOH 1GHCA 3P9CA 3OIQA 5D5XB 4QSHA 2HEOA 1H9GA 4Y15A 1TNSA 4ESJA 2PLYA 1H0MA 3T0YA 3KEYA 5BMZA 3HB9A 1RIOH 4HF1A 5CVIA 4BQNA 4P9FA 2VQHA 1O4XA 3AG1H 4CHUA 2Z1DA 4KMFA 2V4JC 4GRIA 3PJRA 1MBEA 1BW6A 2HGCA 3QPTA 4DBRA 1NTCA 2E71A 2ME6A 2XRLA 3K70C 3G6EI 4EGZA 2E7XA 2VBZA 4LD5A 1XS9A 4DYQA 2DXIA 2P8TA 2AQFA 1ZGAA 3BG3A 1GV2A 3GTLJ 3TP3A 4ZJZA 5FO5A 3GTGJ 5BPDA 2JWTA 4IHSA 1IC8A 1P2FA 3H9GA 2HYGD 3QPLA 3HOYJ 1OCTC 2XDVA 1VQKI 2R7FA 4IRGA 1ZK8A 1LDDA 3Q0WA 4IF4A 2FUG2 1HW5A 4UNOA 1WQ2A 1Z3XA 1XCBA 4EQQA 2VJIA 2Z99A 3N97A 1RUNA 2LNBA 1LDJA 1BI2A 1FY7A 4DBQA 2ELKA 3CCQI 4GGGA 4LLGF 4MFEA 1M1EB 1Z3YA 1PDNC 3AG4H 2VPLA 4A3LJ 3FBIB 3B73A 3I53A 4M72A 3SFZA 3OYGA 2XV4S 1JT6A 3G3ZA 2X1DA 3S3NA 2DMNA 2HXIA 2NS7A 1QPIA 3KLOA 2CJJA 4P9UA 5L3CA 3LAPA 2X9DA 3H1CA 4MNUA 3HOTA 1QBJA 3A2KA 1B1BA 4HV6A 4EMSA 1YW7A 4YEJA 4HPQA 5ICGA 5C4XJ 4J19A 3S2HJ 1IJWC 3JRBA 5LEJA 4HYEA 1XSXA 3GFLA 5M5YJ 3DKYA 5J8CA 5F6FA 2IGKA 4XSZF 1Y8QB 1LNWA 2LY9A 5DM6F 2FX0A 1W4MA 3AG3H 2JJ7A 2V6EA 3KPHA 1YW9A 2XB5A 2LYCA 2W82A 3ZGKA 2EIKH 3G2BA 1NG6A 2VOPA 2F2EA 2HDWA 1KZHA 1T95A 3CD6I 2DT6A 4XK4A 5LHHA 4J01A 2EV0A 3Q0UA 3M8FA 3VPRA 5F04A 3GZNB 2NNNA 4DYCA 3FXOA 3WGIA 2LY2A 3F8CA 2ZJRF 2JA8J 1F43A 4P96A 1WRJA 1R1TA 2GA1A 4BGDA 1B8IA 1HKSA 1IDYA 3FF5A 3PNTA 3RYPA 1B8IB 1R36A 2DPDA 2FNAA 4NC6A 3VYTB 3MMYB 1BW5A 5DTDA 1OQYA 1X1BA 2PFBA 1D1BA 5CQGA 3S16J 3PFYA 1LJ9A 2XB0X 3HSFA 1P7IA 1LPQA 4ZYAA 2X6XA 3E6BA 5EEHA 1ON2A 2KZGA 2CUFA 1IO2A 3VWBA 1HW2A 3M3YJ 3AFHA 4S04A 2QQAA 3MCZA 2BGCA 3JRDA 4UVBA 2BXZA 1G6NA 4YELA 2B63J 2B9SA 4JQFA 5KVRA 3HRSA 2LH9A 3K6GA 2IP2A 3EQLF 1SFEA 3CCVI 4CGZA 1V4RA 3F9KA 1SAXA 2AO9A 4GDFA 2CMPA 5FRMA 3A02A 2P5KA 3VYSB 4GXOA 2DOEA 5L3GA 2DT5A 1IXSB 3G1LA 4MQ9F 4XQFA 2QBYA 1VQLI 2JPBA 2VE9A 2QBYB 4MTEA 3GTQJ 1E3HA 3HBLA 3EUAA 2O61A 5FD6A 1TT5B 2E7WA 3V4GA 1HXDA 4C3HJ 1TWGJ 2A68F 2HQ5A 4PK4A 1FBSA 1BIAA 1UG2A 5E18F 5HLTA 2IGMA 4A2UA 5D5UB 3QU3A 2DO7A 2Y2ZA 4RB0A 3CTAA 1VQ6I 1U9NA 3K0LA 4L5IA 3R6SA 4LITA 2LG4A 3BPXA 5F08A 3BG9A 2O9LA 1TT0A 3ZMZA 3CCLI 3IP4B 1LKXA 2WBMA 2FNPA 3SHFA 3F8MA 4F91B 1QA6A 3IL2A 2KJCA 4I0AA 1XGNA 4N9IA 1LB2A 2X6WA 4QPQA 1MNMC 5EGOA 1IDZA 4B47A 1K6YA 2CV0A 5EGOB 1BC8C 2EZKA 4CCLA 3FKIJ 2WB1N 3KZYA 2WTEA 4L9VA 3CJQB 3B6AA 4CYCA 1V5FA 4YFXF 3GLXA 4RBOA 4CYCB 5DD8A 2CGPA 2JA6J 3S1QJ 2JVGA 2LP0A 2EILH 5LGTA 2OAZA 4UY8I 1IRFA 1HW1A 3OYMA 3OYCA 4PJNA 3T5XA 2WAQN 4XKCA 2GIZA 2O7OA 2LFBA 2A6EF 2MGQA 3EUHC 3TW6A 4IVNA 4EATA 4BUPA 4XRMA 4IHXA 1IZ1A 1QQIA 1XDUA 2EA2A 5E8GA 5JHUA 2A05A 2L54A 1K7AA 1UB9A 3ZMUA 2DJIA 3BG7A 1IW7F 1ETVA 3H0GJ 5L3BA 4ENNA 1FJLA 2IGNA 2RN7A 3H5NA 4HX4A 5B1BH 3BZCA 1ZR2A 2DA5A 1WZ2A 3MFKA 4C2TA 1ZELA 2ID6A 3GBGA 3N05A 2N8GA 3CLOA 3CO6C 2IS4A 1BA5A 2IA2A 4CH7A 4OIQF 3FX3A 5HNFA 4IL6C 3KP4A 3V7CA 2IA0A 3FBNB 5LGUA 2FE3A 1J5YA 3BTLA 2LC2A 3DFGA 4XLNF 1JUPA 4XOTA 3EUKL 1A6QA 4XONA 2M8GX 1MJAA 3BQZA 4A3EJ 1TWAJ 3TL4X 1TQIA 1EKEA 3ZMSA 4IKFA 3FM3A 2PX9A 2P6TA 1A5JA 4DQ2A 2DA4A 5GAEJ 2BVLA 1TQPA 3WU2C 2QUFA 4RB2C 1FYMA 5E20A 2XPUA 3GWZA 1MBJA 4BXFA 3GO5A 4UVAA 5FROA 2VN2A 4P55A 1GVJA 2GWRA 2K4JA 3GTJJ 4E7SA 4IEJA 3GTOJ 3F8NA 1Z0XA 2HNHA 1HSJA 1R5ID 2NNYA 1O57A 2EIMH 2MLGA 1USSA 3JRGA 2HOTA 2JSPA 4ZTFA 3JREA 4BHBA 3HRMA 1ODDA 3CESA 2GQQA 4A6DA 4U7DA 1AU7A 2FEZA 4F93B 2DQRA 3KEQA 3DLLF 1QHHD 5ICCA 3PM1A 3F6OA 1R00A 3DEEA 4E70A 2KZVA 3KYLA 1DGWY 2L9RA 2VONA 3GW2A 4EM0B 5JI6A 5DS9A 2BYVE 2DK5A 2LLKA 2RNJA 2Y30A 5EYRA 3SQNA 1O3QA 3HTSB 1XG1A 1G8XA 2OJED 3FK7A 4NNJA 5M3MJ 1STZA 1MGTA 1K78A 4N9HA 2EB7A 1K78B 2Y75A 4RGRA 1VQPI 1IRXA 1WJBA 2P5LC 2ZC2A 4UUVA 4BJ6C 2X51A 1WJAA 3RTRA 2E36A 2IEKA 4L9TA 4RAZA 4KYWA 3LAJA 1UCRA 1A31A 1QPMA 1B6AA 3HOSA 2XPVA 3JSOA 4LIVA 3IKTA 2XIGA 2DMUA 3K4CA 1C0WA 4PUSA 2R7QA 2JVHA 2CSOA 4PJLA 3OMYA 3HHHA 3BTJA 5IT9Z 3RIRA 1BN5A 1G59A 1I1GA 1HA8A 2L9VA 4HOBA 4KIBA 2VT3A 3LOCA 5HOOA 2R7WA 1YTYA 1I3QJ 1MBGA 4IPAA 4IOAF 2VPRA 2EBIA 3ZQCA 3F22A 1R7JA 2VQCA 5FKOA 4RA2A 1ORKA 2CG4A 2ESHA 4KJZA 3GEZA 2IXSA 4UHTA 4LGWA 1FP2A 3NAUA 4JX5A 2E60A 2HOAA 1GLNA 3DCFA 1O3TA 4QIWN 2R7TA 3IC7A 5FKKA 1R58A 3GXOA 2EK5A 1IG7A 5K5QA 3IAM2 2EFWA 1E3PA 4B8XA 1O3SA 5B66C 3HPGA 1QRYA 2IJLA 1FSEA 2HVRA 1TP4A 3CDHA 1U5TC 2W00A 4HRIA 2H6BA 3OL3A 4ANJA 4DW6A 1RR7A 1ONVA 2OQRA 2VT2A 4A0ZA 5HDNA 5E1WA 3DQVC 2VBYA 4LMYA 4PSWA 3JW4A 4HF0A 3E7LA 4BKXA 4PJJA 3L2QA 5LFAA 1I27A 4EJVA 1J0RA 3S17J 6PAXA 5BOXA 2DK8A 1JT0A 3R61A 2QWWA 3ZQIA 1T6SA 4CCKA 3CCSI 1D0XA 2QCOA 3WU1B 1RKTA 2A5YB 5GPCA 2EZIA 2QGUA 2PQ8A 3LMMA 3J80K 1HOMA 4WF2A 3OYDA 1NK2P 3IH4A 4V2FA 3SZPA 2Q1ZB 3KCCA 4YFNF 1U8BA 2DT7B 2LREA 2WY7Q 2CUJA 2XF5A 3PL8A 4ZYEA 1N78A 1AA7A 1LFBA 1HF0A 1OCCH 2B7EA 4BU2A 3F8BA 3CUQC 5IPAA 3H0DA 3R0AA 1E17A 3ULQB 3CUOA 2KL4A 2O8XA 4E7IA 2QLZA 4FX0A 4HZFA 2MLKA 1O7LA 2DOAA 3RQ4A 4AIDA 3NQOA 3HDDA 1I50J 2M2EA 1EV7A 3LSHA 1Y56A 4YRVA 1WH7A 4NB5A 2FMLA 1EJ9A 2K27A 1FPQA 1OCZH 2BY2A 4F92B 2Z2SB 2KQRA 4BQAA 2EV5A 3CO7C 4YG2F 2QF7A 4UV9A 2G7UA 3O8HA 4M9XA 1VQOI 1DGRM 1AKHA 1WSUA 1OR7A 2DTZA 1AKHB 3JAMK 2EPFA 2CUEA 3W6KB 3CUQA 3OOPA 2RQPA 4G6QA 3CUQB 3CCYA 3F0CA 2DN0A 2E35A 4XLHA 4E7KA 2K3PA 3H3ZA 2HKOA 1N25A 3O6BB 1A35A 1A6IA 1DDNA 3RYRA 4BY7J 2HI3A 1SMYF 1CF7A 4G7OF 2ECCA 4HF2A 1DQUA 1CF7B 4AYBN 1Z9CA 1S72I 2OCCH 1OCPA 1T38A 4HDUA 1GXQA 4FHTA 4RM2A 2EQRA 1Y6IA 2EFOA 5HS9A 4ZDOA 4KISA 2I10A 4I99C 3K4NA 3AG2H 5D8LB 5CQEA 1TC3C 1UZCA 4BE1A 2MG4A 1XMXA 4ZZDA 3SFIA 5D5VB 3BJ6A 3LA7A 4RGSA 1X4OA 5J40A 3KYDB 4NQWA 3E1SA 4B43A 4UXNA 3ECHA 3H5AA 3H9QA 1H8AC 4X0GA 1ZR4A 1TWCJ 2L2OA 1UHWA 3T8TA 2WA0A 2F4MB 3S3OA 3CCRI 4DJAA 2E1MC 4P5OA 5LD2C 1ZGJA 2V9PA 3KLNA 4XLFA 4BH9A 5HDKA 4L5JA 3C7JA 4XOPA 1EA3A 5BNGA 2X4HA 3FWEA 1JI8A 4XKBA 2OTJI 1I6XA 1MNEA 4B3AA 3QYFA 3DKXA 4LG0A 4ZH4F 4E7ZA 4LG0B 1FOXA 2HXOA 3HGGA 4UB8C 3A1YA 1HBXG 1QZYA 2KIMA 1JKOC 3U1KA 5B3SH 3CMMA 1H89C 2YS9A 2A5WA 1YO5C 2XKOA 1T0FC 1XGMA 3L7WA 3E3VA 1ZARA 2XAUA 3HOWJ 4RB3C 4I09A 2BY1A 2A07F 2H94A 4LLLA 3G4SI 1J75A 1P4WA 1OISA 1W36D 1K83J 4ASNA 1QVTA 2KPMA 4IHTA 4D9JA 4HNTA 2BVMA 4FX4A 1MSFC 4AIKA 5FJ8J 1JUMA 4GCVA 3A0BC 4NC7A 3A01A 2L7KA 3D5RC 5CPRB 2XAHA 1Q1VA 3KZIC 2VBXA 3QODA 3WGGA 5E79C 2H09A 3A01B 2VJJA 4M6YA 2EFQA 1OYIA 4IO9F 3BPVA 5EG0B 5IP9J 2HQNA 1ZAOA 3S1NJ 2CV1A 1RKWA 3K1PA 1VZ0A 1FWZA 2JRMA 5JLXA 1T2KA 3OY9A 4ZZLA 3GTMJ 4R79A 1HDPA 2K9NA 2Y0SN 2EZLA 2D5VA 4RM3A 3HJEA 1OJLA 2VOOA 1MBFA 2ACJA 3DWLE 1D0YA 3GUDA 2NS8A 2O0YA 4ESBA 5FKNA 3ZPLA 1FSHA 1O7FA 2K9MA 5IY5H 2K85A 2DFHA 5KK1A 2MFZA 3LSGA 2ISZA 2M0MA 3J81Z 1JTXA 4PGGA 4FTHA 1Z21A 1ETKA 4KN7X 1B9NA 2GM4A 1Z91A 2Y48A 3DU5A 3MN2A 2DMTA 1W5TA 2XAQA 2QSGX 4EEFG 3G71I 3I9V2 5L3EA 2O3FA 2KDOA 2LVSA 3JRAA 5J8FA 5J1RA 3OS2A 3LA3A 3K4JA 3LNQA 2JA7J 1DU6A 1ZREA 3GYHX 1VQ7I 3G1MA 5CYVA 2L9NA 4QTRA 4B48A 2VI6A 5EZGA 3O8GA 4Y4RA 4EJTA 2R92J 2FRHA 2XKPA 2WB1A 4QWQA 2V1DA 2CRGA 3E5UA 3EETA 2E1CA 4A3MJ 4EJWA 1V3FA 1X3WB 3HTUA 1Y0NA 3Q3SA 4O6JA 1I5ZA 2IBDA 2R7SA 1FOKA 3CCUI 2BBYA 3QPSA 2P7CB 1XTAA 2WAQA 3OYLA 1X1CA 1IF1A 3Q9SA 1IN7A 4OIRF 4GYIA 3L2UA 3RKQA 4JOMA 1D0ZA 2GXBA 4E7LA 5K5RA 2VE8A 3M8EA 1SVLA 5LEKA 4XLEA 2JSCA 3LFKA 3NEUA 2ZKZA 5KCMA 2EJRA 1R23A 2PG4A 2WC2A 2GAUA 5JVGF 1E3OC 1X2NA 3RKXA 2MABA 4H4KC 4CCMA 4CCNA 2HVSA 1E0EA 2M8EA 3CC7I 1S3JA 4LOCA 1HKQA 2O8KA 1IRGA 3S14J 5ILVA 3CC4I 4U0YA 3OYNA 5E3LA 1Z67A 5DEQA 2DOFA 3FXMA 1FT9A 4PSXA 3FKJA 1GDTA 2KMUA 3BG5A 3FXQA 1R22A 3KE2A 5LBQA 3K4MA 1S7OA 3V7SA 4BXUA 4HV5A 3JR9A 2MA3A 2MYSA 2OPTA 3LQRA 4PDKA 5IP7J 1GVDA 3E6MA 3TEDA 3I58A 3K4KA 2ZBKA 1RRJA 2F5CA 3OS0A 1T33A 5FB2A 2OV7A 1RUOA 2HYFA 4NBQA 3HYIA 3ZRGA 2K9LA 3SYTA 3VODA 2JQ7A 3S1RJ 1R49A 3WTWC 4CA0A 4IJAA 2O03A 4ZDPA 4LB5A 1TTYA 3TOAA 4L5EA 4M3GA 1YS6A 4XMYA 3O2PE 2DQLA 1X3ZB 2CU7A 5FRNA 2F4IA 3DF8A 4LIUA 2QKMB 4AC0A 1EF4A 1BC7C 3GZ6A 1ZG1A 5M5XJ 3M07A 1W0TA 3OYAA 1F36A 2YR2A 1VTNC 3PSIA 1H9TA 3HSRA 1KU3A 3F6VA 3R60A 2OD5A 2L5QA 2PEXA 2PN6A 1FX7A 4FETA 1AHDP 1P6RA 1JKRC 5E3OA 5GP9A 1MKMA 3BR5A 4BDZA 2JTVA 3JTGA 2K40A 2M5WA 2FA5A 3MQ0A 4Q48A 4Y33A 1JGSA 5D4RA 1SFOJ 4PJ0C 4WXHA 2W1OA 2E19A 2W25A 2YPRA 4I01A 3FMSA 3F8FA 3HRUA 3OYKA 3RPUD 1SANA 1YX5A 3HOZJ 1YJNI 3JRIA 4OMZA 3KP5A 5ILUA 2FBHA 2LKPA 4CCOA 1NHAA 1X1AA 4PJMA 3VB2A 2KFDA 2EFNA 4ESFA 2H8WA 3GTPJ 4PZJA 4FCYA 1J09A 1SMTA 5KAFC 5E3MA 3BOQA 1B9MA 2LF8A 2QZ8A 2W7NA 4AIHA 2RDPA 1MZBA 2GOMA 4OINF 1S8NA 3PFIA 2NAZA 1HQCA 4HX7A 2ZXIA 4BBRJ 2CQKA 1V5GA 1U2WA 4F3QA 4FASD 3I64A 5DCMA 4PGHA 3HC7A 5DCMB 2AQEA 3FK6A 2RREA 5ICEA 4KNYA 4JYKA 1XGOA 1DPRA 2XPWA 5E1XA 4HSTA 4OMYA 2L3DA 2GXGA 2VBWA 5LHGA 3ZMVA 1UHSA 1V54H 4I0BA 2QEXI 1YRNA 3DBHB 3W2WA 5EDNA 1YRNB 4AM3A 4D0PA 1LFUP 4V2GA 3HHGA 1SFKA 2I5UA 2LBFA 4JX6A 2LBFB 1X3UA 4I6ZA 2LRDA 4MEXF 3W2VA 1RESA 3F23A 2R93J 4ENMA 1PP7U 3V8LA 4H0EA 1PVEA 4C3IJ 4HW0A 4JBAA 3ZMDA 2R5ZA 4IRIA 3KP2A 4EVIA 2R5ZB 1DU0A 3PUBA 2F5FA 2X85A 3BZ6A 1YHQI 1ON1A 2DODA 3OV8A 1HDDC 3PNVA 2NRAC 2Q2EA 1BI0A 4CDGA 2Q2EB 1YFHA 1TWFJ 1ZTRA 2P81A 2WY8Q 4BQQA 3TP0A 1W5SA 3PIOF 1E2XA 2W57A 5JR3A 2L01A 4BJ5C 3OYJA 4G7HF 1D5VA 2ZXJA 3ABMH 4NC8A 1U78A 1G2HA 1R5HA 4NHJA 1QGPA 2FSWA 4XRSG 3ABLH 4M3EA 4WWCA 3WGHA 1ENHA 3J80Z 4C30A 4RGUA 2BOLA 1K4TA 2EA4A 2H6CA 1RNLA 2JZYA 1BL0A 1I3AA 4DYRA 4V19K 3W6JB 4II3A 2YX7A 3HOUJ 4XBFA 3N4MA 1WJDA 3PSFA 3JSPA 4ENKA 2HQRA 3AL0B 3DEUA 2BY0A 3H3UA 4UUSA 2HQAA 1LDKB 1P4AA 1F9NA 2CV2A 4BY1J 3TKYA 2JN6A 3ML6A 4XLCA 2WAEA 2MSYA 4MEYF 3HGYA 2KIUA 2Z3YA 1WGXA 4PCQA 5L3FA 2NS0A 2VLAA 4FISA 5CVRA 3H9JA 4OAZA 1JGGA 3K70D 4Z2YA 2WWYA 2FQ4A 4GO1A 2X1EA 1J9IA 2LSOA 2AXLA 4AUXA 2ZSHB 2DMQA 1XCVA 2HFHA 5HS8A 1MJ9A 4G7ZF 3ELKA 2BY3A 3D0SA 1MMAA 1MBKA 2M9HA 3KX2A 2KRFA 5IOYA 1D8JA 1FTTA 3OS1A 2M4KA 3HL2A 2MD0A 3K7AJ 2ZO4A 4CZZA 1LFPA 1VQ8I 1KYWA 4N0BA 3WODF 2KIQA 4XKWA 2ZNYA 2ZB9A 4L0YB 2CFXA 1F1ZA 3IRRA 2JRTA 1X2MA 2NVUB 4AYBA 3KETA 4KDPA 2F4OB 2COMA 3IAS2 5HDGA 3LSPA 4XM3A 2XROA 1PYVA 1FEXA 4YIIA 2LMDA 1USTA 2M3AA 3PNYA 3GFMA 3ROUA 4G12A 2Y31A 1POGA 1X4PA 1XC5A 2XGCA 1FMWA 1R1UA 1OMIA 3CDIA 3P9KA 5DM7F 2JUCA 2WAFA 2P5VA 4IX7A 2DCEA 3C18A 3NWTA 3U9GA 4CSWA 1MDMA 4N4NB 4CXFA 2GOXB 2KDZA 5KHDA 2BV6A 1W36C 1GXPA 3H92A 3QRFF 4GFBA 4A12A 4XKVA 1VQMI 4IHVA 4E7JA 4M9ZA 4M71A 3V42A 1V55H 1SEUA 2EIJH 4YIFA 3MVPA 2KJBA 4KFCA 3KZZA 5IYCJ 5E1ZB 2KRCA 3KFWX 1FP1D 2KT0A 3GLLA 2DA7A 1ZG3A 3ABTA 3KIOA 3LSMA 1ACIA 2MW8A 1J59A 1DP7P 3E6CC 5JVTA 2Q8KA 3WTTC 5CVUA 3WG9A 3F3XA 2V1UA 4O5VA 3TW7A 4RGXA 1N77A 3BR1A 2OF7A 3F21A 3ERED 3CDLA 4Y13A 3DKWA 1HSTA 3FXLA 3TQNA 2HZTA 3IV5A 3K4BA 4XL9A 2CYYA 4OU0A 2E1OA 3ECOA 4IRHA 5BS6A 4JX4A 1QHGA 1U0JA 4A3BJ 2QYOA 2VKDA 3OR2C 3I56I 2FF4A 2UV1A 2JT1A 5A2QZ 4A0XA 2TCTA 2IVMA 2R7OA 4IZZA 1YJ9I 1KU7A 4CUGA 5TRDA 2BW3A 3DPTA 5J4YA 2BW3B 2DI3A 2UZKA 2Y0SA 2EV6A 3ABUA 3ZQLA 1LQ1A 4A3DJ 1ETWA 3S8PA 4HLXA 3L2CA 3OSFA 2IS1A 4A3CJ 3L2VA 2JUGA 3I59A 2FMYA 2E2IJ 3Q0VA 3I59B 2Y9YA 3ZN1A 1S29A 3SZTA 1FYKA 4Q5SF 2DFIA 2MH9A 3BR3A 4I02A 4FE7A 4U87A 3WTUC 5EEGA 2VUMJ 1XMAA 3IWZA 4LK0F 5LLQA 1OR7C 3KP3A 3CJRB 3HUGA 2D1HA 3HUGB 3FIWA 5CVJA 1JKPC 3EYYA 3HEFA 3D5LA 5IOZA 4X1EA 4WXCA 3VDXA 2BXYA 2FU4A 5GPAA 3IUOA 2LKXA 2K7LA 4KT5C 2X6YA 4DIQA 2HPIA 3BY6A 3A0HC 2ZMEA 1K61A 3FZVA 4LB6B 2ZMEB 3DTEA 2VC0A 2CO5A 4ABZA 4E6KG 3AAFA 2ZJQF 4B09A 2ICWG 3U2RA 4XIDA 5F1RA 4MFDA 1F5TA 4IQJA 1REPC 3ABKH 1WKMA 2ELHA 2VJ4A 4U88A 4G94A 5D4SA 2LD5A 2LF7A 2ZSIB 1TW2A 3ESWB 4Z6YA 1HLVA 2FOWA 3QOEA 3E0JB 2DFEA 2KLOA 4MLOA 5C4JJ 1JHFA 1QZZA 2JPCA 1FMVA 2XHKA 2HOSA 4EM1A 2L02A 3CLQA 1ZN2A 3RKWA 3J7AO 4BE0A 3WTSC 3CF5F 4A3FJ 2HR3A 2PI0A 1D1CA 3GZ5A 5F0CA 3OOUA 5FLXK 4MHGA 2E2JJ 2FOKA 5ERIA 4F52A 1P7JA 4WCGA 1QVUA 5GTIC 2M0CA 2MD5A 1KQ8A 1XSDA 3G1OA 3TDUC 3BJAA 2P4WA 3HKZN 2P6SA 5JHFA 2L0KA 3U21A 3QPHA 4WXDA 2ZJPF 4A0YA 4HAMA 2HTSA 4XN0A 4EV0A 4KITB 4B4CA 2ZXWH 1QZEA 2UXNA 3HXLA 4FQGA 3NWSA 2FBKA 2RGVA 3PO2J 2LKSA 4U7BA 2XASA 4NQWB 3J7AY 4ZYDA 2PJRA 3DLAA 5J6XA 4AD9A 2IPQX 2AHQA 2DDBA 1JKQC 1IN8A 1KONA 3HOXJ 2J5PA 3LL7A 4L9NA 3MZ8A 5DYMA 3FISA 1S6LA 2PMHA 5DCFA 2DJNA 2QQ8A 2IT0A 2CQQA 2ELJA 2P7VB 4HNUA 3ISPA 4QPOA 1LE8A 3VYRB 1LE8B 3FHNA 1JJ8C 1UG0A 1XX5A 1Z77A 2TRTA 5D6EA 9ANTA 1R4MB 2VQLA 3C2BA 3TGNA 4BDYA 2NOJB 1NG7A 3OYBA 2K9SA 4W1UA 3K69A 5IT9K 4M9SA 5CLSA 3LSIA 4BE2A 3PO3J 1FTZA 1D8KA 1Z1DA 3WE3A 1SFUA 3WHCA 4FT8A 1BR4A 2R7VA 2QQBA 5D6FA 4L18B 4A5NA 3P9IA 4X6AJ 3TBIA 1LVAA 3VFZA 1IN6A 1MMDA 1I1SA 2A6HF 4BL0B 3S32A 1XMKA 2YUSA 4B44A 2NOGA 3NRVA 3RPUA 5L3DA 2GZWA 2L7ZA 3HPHA 5FFXA 2HOEA 4XSXF 3CP2A 2IS2A 4M6XA 5LGNA 2DYRH 3B6CA 1KGSA 3CJTB 2NVQJ 2CQNA 1HC8A 3RI4A 4R8HA 3MWMA 1XPXA 2VB6A 2VXDA 3BCAA 1SVOA 5GAGJ 3S1MJ 2Y69H 1G4DA 4S0HB 2HWVA 1H88C 2F48A 4HBLA 4MTDA 2ZFUA 3RSNA 1A04A 3BTIA 3WE2A 2BZTA 5F27A 3T8RA 1ZHFA 3Q9VA 5FD5A 1YYVA 2GXAA 2VL8A 4DOZA 4P1WA 5KNLA 2V79A 3LWFA 1FC3A 1OLTA 4KICA 3L9FA 5CKTA 2NVYJ 4Y3OA 3B02A 3DTIA 3TO6A 4F55A 2O6GE 1WWXA 4XLPF 3I55I 4B1RA 1Y1VJ 1IRZA 1QNTA 3VSKA 3PQKA 4HNVA 2H27A 5FFZA 1TZLA 1WHUA 2EZHA 3ZQ7A 3SDGA 4S05A 2E5ZA 1P9QC 4A3IJ 1R6RA 4IXAA 3T1BA 5J3LA 3OYEA 1FBUA 2A61A 2OZ6A 4DGWB 3WTYC 1L0OC 2R0QC 2VODA 2W4SA 2KKOA 4RS8A 3I4PA 2KHMA 3H35A 1OYWA 4ZC3A 4AWXB 1DP3A 1KQ0A 1XN7A 3W2AA 2VJ5A 4UV8A 5K5OA 4I2OA 3MAJA 3HM5A 1L3LA 3FXJA 2OUMA 2MBFA 1OKRA 1WFXA 5GAHJ 1S5LC 1ZQ3P 4G9YA 3TOBA 2F5EA 2Z9OA 2TDXA 1SD4A 2M1BA 3GFIA 2L4MA 2CWEA 1MD0A 3I4MJ 3M1EA 2V1XA 1G3YA 2VXZA 3IH2A 2K3FA 4M6VA 3ZP5A 4OIOF 1Y8RB 3LSKA 2ESNA 1UMQA 1WH5A 3M9AA 3KP7A 5EJCA 3BT9A 3V7RA 5K7ZA 3K2AA 2NYXA 2RKHA 5HVQC 1IGNA 3FXUA 1HCRA 2HPMA 3QYBA 2NVTJ 5TGTA 3ZQGA 2NXNB 2DAOA 1Y39A 1IV8A 3ERMA 2XAJA 3TMOA 5J4VA 3UNGC 2CQ7A 3HSEA 1U6GA 3A4CA 2HDDA 5JFRA 1BI1A 4CZCA 4E7HA 1UELB 2DA6A 3OR1C 2DA3A 4CCJA 2ZNZA 1ETOA 1IUYA 2M34A 3LSTA 4RLFA 2CFOA 3GF2A 1MIJA 1XD7A 4A3KJ 2QA4I 1MH3A 1NK3P 5M3FJ 4MGRA 2XGEA 3RQIA 3FHZA 1VQ9I 1A36A 2DDAA 4OWRB 3FXRA 2UUZA 1KYZA 4UB6C 2IRFG 1HKTA 3CCJI 3H3VK 1CGPA 2D45A 1YJWI 1I39A 2DTRA 2WV1A 3OL4A 1JUSA 4HLYA 1V5EA 3UR3C 5F0FA 3WG7H 3D1NI 1XB4A 2PMZN 2L7MP 1NH3A 4WK8F 3VSLA 1R1VA 2Z16A 5LHIA 2F5DA 4A93J 5IYBJ 4MIMA 3JRHA 3DBRB 3UKGA 3DV8A 1TNTA 2O5RA 1YX3A 2STWA 1BBYA 2UXXA 3NARA 3ZR8X 3CCMI 5B5EC 3F72A 1PUFA 3C2GA 2RAEA 5GADJ 1ZYRF 4KMUX 2Y9ZA 1PUFB 1YIJI 2GIVA 4D7NA 3EDPA 2HYJA 3IHUA 4DZPA 4EM2A 3MKYB 3E97A 1BR2A 4HEA2 4XNFA 1IUFA 3IKVA 4DNCA 3QOPA 5DD4A 2GLOA 2BHZA 5AIQA 2QENA 1S7EA 3WTXC 3ZQQA 2EFPA 4JP0A 1TBXA 1LEBA 1T39A 4U0WA 4KA4A 2G7HA 2ID3A 4AIJA 1DUXC 1YW8A 2L7FP 1APLC 3R0JA 3EPZA 1ZRCA 2R7XA 1VNDA 4BHPA 2I8DA 3H36A 4J00A 1J7KA 2G9WA 5E3NA 4ZYGA 1R71A 3HG9A 2CUZA 1R5GA 4ITVA 3PQJA 1FOWA 3DPUA 3I5UA 3OIOA 1ETQA 1JHHA 2L9SA 2RVCA 2V9VA 1ETXA 2RQQA 3JTHA 4EJOA 1W7PD 5H6RA 1AOYA 2ZJ2A 2XAFA 4XORA 1FYLA 1PUEE 2CW0F 5EEAA 2XGXA 3C3WA 3BQYA 5IP6A 2Y0MA 3RZDJ 3C2HA 4RLQA 4RAFA 1RR8C 2VQGA 3P5JA 4DZJA 4BXXJ 3ONQA 2WV0A 1WVRA 3R4KA 2CW8A 4HQEA 4ZTJA 1ITYA 3RZOJ 2DFFA 3WTZA 4R1HA 3J81K 5AONA 4UVCA 5K7HA 2WADA 1YOVB 1QU3A 2V7FA 4Y7NJ 2OU2A 1VQNI 3RJPA 4LFUA 2OBPA 2FXAA 3Q5FA 2J5OA 3L00A 2V1NA 3REOA 3CC2I 3DP7A 1JE8A 5HS7A 3GMEA 2XVCA 3BCBA 3MZYA 4B3XA 4N4OB 3OYFA 3QP5A 2DMPA 1RPWA 1VF9A 5FKMA 4ETSA 1WJEA 2YU3A 3QAHA 2CQXA 2V26A 3AL0C 1SC7A 2PMUA 2CW7A 3HIFA 4U0VA 4CICA 3MKZA 2E1NA 2L4AA 1YITI 2XSDC 1UFMA 3P7NA 1W0UA 2K4BA 4YFKF 5J47A 2K02A 1Z05A 3SEZA 2XF7A 1LUJB 1D3YA 3DEWA 3RKYA 5DV5A 5D5WB 1WI3A 4RAYA 2R7UA 3M1CA 5C44J 1RI7A 1T98A 4XN3A 3U1DA 2AXTC 2VASA 3K2ZA 4L0ZB 1VFCA 1OYYA 1QO0D 2XF6A 3S3MA
chains in the Genus database with same CATH topology
2FD5A 2HXOA 2LY9A 3HGGA 1JKOC 2FX0A 1H89C 2JJ7A 2YS9A 2XB5A 3ZQLA 4A3DJ 3M4OJ 1ETWA 4M3DA 3MKLA 3OSFA 4UUSB 3HOWJ 4A3CJ 2E2IJ 4XK4A 3Q0VA 2Y9YA 3Q0UA 1K83J 1QVTA 3VPRA 5F04A 2DA1A 5FJ8J 3BR3A 1MSFC 3S15J 1JUMA 4FE7A 4DYCA 2VUMJ 2IAIA 3JRFA 3A01A 2JA8J 1F43A 3A01B 1Q1VA 1B8IA 3FIWA 1JKPC 1IDYA 2H1KA 1B8IB 5J1YA 3HEFA 4D7MA 5EG0B 5IP9J 5IOZA 4X1EA 3S1NJ 1RKWA 2JA5J 5GPAA 1BW5A 5DTDA 5JLXA 2LKXA 3GTMJ 1HDPA 1OFCX 1K61A 4C3JJ 2K9NA 3S16J 2Y0SN 2XB0X 2EZLA 3A03A 1P7IA 4ABZA 2D5VA 1B72A 1OJLA 1VI0A 1MBFA 1TWHJ 2CUFA 2COBA 4C2MJ 2X6OA 1B72B 4XIDA 4A3GJ 4MFDA 2K9QA 2NS8A 5FKNA 3M3YJ 2LD5A 1HLVA 3JRDA 3LSGA 1GV5A 1JTXA 4FTHA 1ETKA 2B63J 4MLOA 5C4JJ 2GM4A 1ETYA 3MN2A 2DMTA 4EEFG 2HOSA 3L1PA 2LVSA 3JRAA 5J1RA 2AO9A 3LNQA 2JA7J 1DU6A 3A02A 3BR6A 2JK3A 2ME0A 3ZOBA 3G1LA 4A3FJ 5F0CA 3G1MA 3OOUA 4QTRA 1X58A 3GTQJ 2VI6A 5EZGA 3O8GA 2E2JJ 3HBLA 3I4NJ 1P7JA 2R92J 1QVUA 2M0CA 4C3HJ 1TWGJ 2CRGA 2XGDA 2HQ5A 4A3MJ 3G1OA 1UG2A 1ZGWA 3HKZN 2L0KA 1JTYA 3Q3SA 2Y2ZA 2IBDA 1U9NA 3QPSA 4MO7A 4D5CA 4BBSJ 4W97A 4B4CA 2O9LA 5F08A 3BG9A 3RKQA 4I76A 3PO2J 2LTPA 1E3OC 2AHQA 1MNMC 1X2NA 3ZQFA 5FLMJ 5EGOA 2NVXJ 1IDZA 1JKQC 5EGOB 3HOXJ 2EZKA 1D5YA 3FKIJ 2WB1N 3IH3A 2X48A 4LOCA 2O8KA 3B6AA 3S14J 3LSJA 3FISA 4CYCA 4RBOA 4CYCB 5E3LA 2JA6J 3S1QJ 2LP0A 2DJNA 2CQQA 1GDTA 1LE8A 3GTKJ 1LE8B 2LR8A 3BG5A 1JJ8C 2WAQN 1Z77A 2TRTA 9ANTA 2O7OA 3C2BA 1GT0C 2VKEA 2LFBA 2MGQA 3TW6A 3JR9A 4XRMA 2K9SA 2OPTA 4W1UA 5IP7J 5K7FA 4IHXA 1GVDA 3PO3J 3TEDA 1FTZA 4XICA 1CQTA 4Y52J 5FKLA 1T33A 1ETVA 3H0GJ 3WHCA 1FJLA 5F1JA 1ZR2A 2DA5A 4X6AJ 3S1RJ 2ID6A 3GBGA 2N8GA 1BA5A 2YUSA 2NOGA 4L5EA 1IV6A 4M3GA 1RETA 2L7ZA 3BTLA 2CU7A 1JUPA 4AC0A 3B6CA 1EF4A 2NVQJ 2M8GX 1WPKA 3BQZA 5M5XJ 4A3EJ 1TWAJ 1MSEC 1W0TA 1F36A 1U9OA 4UUTA 5J1UA 1A5JA 3S1MJ 2G0EA 4RDUA 2W48A 4NDLA 2DA4A 1AHDP 1JKRC 4S0HB 1H88C 5E3OA 5GP9A 3BTIA 5F27A 3BR5A 2K40A 2XPUA 1MBJA 2EH3A 1SFOJ 3GTJJ 1JJ6C 2E19A 4IEJA 4IHYA 3GTOJ 1Z0XA 2NVYJ 1SANA 3HOZJ 1I6HJ 2DA2A 3JRIA 2YU9J 4B1RA 3JRGA 1Y1VJ 3CMYA 2HOTA 3JREA 2E2HJ 1IRZA 4HNVA 1AU7A 2EZHA 3SDGA 5EF6A 3SJMA 4A3IJ 3GTPJ 4FCYA 5J3LA 2H8RA 2R0QC 5E3MA 3W6VA 3PM1A 2VKVA 4M3FA 5C3EJ 2ECBA 4XRSA 4BBRJ 2L9RA 5DS9A 4A69C 2LLKA 2Y30A 5EYRA 3HM5A 1XG1A 2R5YA 3FK7A 2R5YB 5M3MJ 3FK6A 2FJ1A 4JYKA 5EZHA 2XPWA 1ZQ3P 1UHSA 1YRNA 5EDNA 1YRNB 3I4MJ 4M6VA 3IH2A 1LFUP 2IEKA 4V2GA 4JX6A 1UMQA 1WH5A 1Y1WJ 4I6ZA 5IYDJ 3BT9A 2XPVA 1RESA 3BR2A 3K2AA 5K7ZA 5FLVA 1IGNA 2R93J 2DMUA 1HCRA 2NVTJ 3ZQGA 4C3IJ 3BTJA 2R5ZA 2R5ZB 4FE4A 1DU0A 2HDDA 3LOCA 1I3QJ 1MBGA 1HDDC 2VPRA 2DA6A 2EBIA 3ZQCA 2DA3A 5FKOA 1ETOA 1ORKA 3BR0A 1TWFJ 1ZTRA 2M34A 2P81A 4A3KJ 3NAUA 4JX5A 3TP0A 2HOAA 3DCFA 1MH3A 4QIWN 5JLWA 1NK3P 5FKKA 5M3FJ 2XGEA 1IG7A 3RQIA 3ZQHA 1U78A 1QRYA 3S2DJ 1G2HA 4XRSG 4M3EA 4D5FA 3H3VK 2WV1A 1JUSA 1ENHA 4DW6A 1FIAA 1RR7A 5F0FA 5F0HA 3D1NI 2PMZN 2L7MP 5M5WJ 1BL0A 2JMWA 1MH4A 3E7LA 4BKXA 1FIPA 4DYRA 1MBHA 3HOVJ 1R9TJ 4A93J 5IYBJ 4MIMA 3HOUJ 3JRHA 3S17J 3UKGA 1JT0A 2LK2A 3ZQIA 3NARA 3LSRA 2QCOA 1RKTA 4UUSA 1BJZA 5GPCA 2EZIA 3OSGA 1PUFA 4M3BA 2RAEA 4BY1J 5HODA 2Y9ZA 1PUFB 3BTCA 2JN6A 1HOMA 4D7NA 1NK2P 3IH4A 2MSYA 2HYJA 3HGYA 4V2FA 1WGXA 3QQAA 4DZPA 1U8BA 4FISA 1IUFA 1JGGA 2GLOA 2FQ4A 1LFBA 1ZKGA 1HF0A 1S7EA 4AUXA 5EG0A 2DMQA 3JRCA 4JP0A 5IPAA 4A3JJ 2GBYA 2ID3A 2M9HA 1MBKA 2L7FP 1APLC 5IOYA 1FTTA 1GUUA 1WCMJ 1VNDA 3CQZJ 3K7AJ 3WHBA 4IHWA 2ZB9A 5E3NA 3HDDA 1I50J 2M2EA 1X2MA 1T56A 3OIOA 1ETQA 3LSPA 1WH7A 2R7ZJ 1ETXA 1FEXA 2QF7A 4G12A 2Y31A 4QSHA 1POGA 1XC5A 2XGCA 3O8HA 1AKHA 2DTZA 1AKHB 5EEAA 3BQYA 5IP6A 3RZDJ 2CUEA 3HB9A 4DZJA 4BXXJ 3CCYA 3F0CA 1O4XA 2DN0A 2KDZA 1ITYA 3RZOJ 1MBEA 1BW6A 4GFBA 4IHVA 1NTCA 5K7HA 1A6IA 2ME6A 4Y7NJ 2XRLA 2HI3A 3MVPA 4BY7J 1XS9A 2ECCA 4DYQA 5IYCJ 4AYBN 3BG3A 1GV2A 2KT0A 3TP3A 3GTLJ 1OCPA 3GTGJ 2JWTA 1IC8A 2DA7A 3QPLA 3HOYJ 1OCTC 2EQRA 2MW8A 1ZK8A 2DMPA 1RPWA 3Q0WA 1VF9A 2I10A 5FKMA 1TC3C 3TW7A 2CQXA 2OF7A 3BR1A 2MG4A 3CDLA 3SFIA 2ELKA 4MFEA 2XSDC 3IV5A 1W0UA 4A3LJ 1H8AC 2E1OA 1ZR4A 1TWCJ 1JT6A 4JX4A 2DMNA 2HXIA 2NS7A 4A3BJ 1QPIA 2CJJA 3DEWA 2X9DA 1WI3A 5C4XJ 5BNGA 5C44J 4J19A 3S2HJ 1IJWC 3JRBA 2TCTA 5M5YJ 1VFCA 4B3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FD5 A;  2HXO A;  2LY9 A;  3HGG A;  1JKO C;  2FX0 A;  1H89 C;  2JJ7 A;  2YS9 A;  2XB5 A;  3ZQL A;  4A3D J;  3M4O J;  1ETW A;  4M3D A;  3MKL A;  3OSF A;  4UUS B;  3HOW J;  4A3C J;  2E2I J;  4XK4 A;  3Q0V A;  2Y9Y A;  3Q0U A;  1K83 J;  1QVT A;  3VPR A;  5F04 A;  2DA1 A;  5FJ8 J;  3BR3 A;  1MSF C;  3S15 J;  1JUM A;  4FE7 A;  4DYC A;  2VUM J;  2IAI A;  3JRF A;  3A01 A;  2JA8 J;  1F43 A;  3A01 B;  1Q1V A;  1B8I A;  3FIW A;  1JKP C;  1IDY A;  2H1K A;  1B8I B;  5J1Y A;  3HEF A;  4D7M A;  5EG0 B;  5IP9 J;  5IOZ A;  4X1E A;  3S1N J;  1RKW A;  2JA5 J;  5GPA A;  1BW5 A;  5DTD A;  5JLX A;  2LKX A;  3GTM J;  1HDP A;  1OFC X;  1K61 A;  4C3J J;  2K9N A;  3S16 J;  2Y0S N;  2XB0 X;  2EZL A;  3A03 A;  1P7I A;  4ABZ A;  2D5V A;  1B72 A;  1OJL A;  1VI0 A;  1MBF A;  1TWH J;  2CUF A;  2COB A;  4C2M J;  2X6O A;  1B72 B;  4XID A;  4A3G J;  4MFD A;  2K9Q A;  2NS8 A;  5FKN A;  3M3Y J;  2LD5 A;  1HLV A;  3JRD A;  3LSG A;  1GV5 A;  1JTX A;  4FTH A;  1ETK A;  2B63 J;  4MLO A;  5C4J J;  2GM4 A;  1ETY A;  3MN2 A;  2DMT A;  4EEF G;  2HOS A;  3L1P A;  2LVS A;  3JRA A;  5J1R A;  2AO9 A;  3LNQ A;  2JA7 J;  1DU6 A;  3A02 A;  3BR6 A;  2JK3 A;  2ME0 A;  3ZOB A;  3G1L A;  4A3F J;  5F0C A;  3G1M A;  3OOU A;  4QTR A;  1X58 A;  3GTQ J;  2VI6 A;  5EZG A;  3O8G A;  2E2J J;  3HBL A;  3I4N J;  1P7J A;  2R92 J;  1QVU A;  2M0C A;  4C3H J;  1TWG J;  2CRG A;  2XGD A;  2HQ5 A;  4A3M J;  3G1O A;  1UG2 A;  1ZGW A;  3HKZ N;  2L0K A;  1JTY A;  3Q3S A;  2Y2Z A;  2IBD A;  1U9N A;  3QPS A;  4MO7 A;  4D5C A;  4BBS J;  4W97 A;  4B4C A;  2O9L A;  5F08 A;  3BG9 A;  3RKQ A;  4I76 A;  3PO2 J;  2LTP A;  1E3O C;  2AHQ A;  1MNM C;  1X2N A;  3ZQF A;  5FLM J;  5EGO A;  2NVX J;  1IDZ A;  1JKQ C;  5EGO B;  3HOX J;  2EZK A;  1D5Y A;  3FKI J;  2WB1 N;  3IH3 A;  2X48 A;  4LOC A;  2O8K A;  3B6A A;  3S14 J;  3LSJ A;  3FIS A;  4CYC A;  4RBO A;  4CYC B;  5E3L A;  2JA6 J;  3S1Q J;  2LP0 A;  2DJN A;  2CQQ A;  1GDT A;  1LE8 A;  3GTK J;  1LE8 B;  2LR8 A;  3BG5 A;  1JJ8 C;  2WAQ N;  1Z77 A;  2TRT A;  9ANT A;  2O7O A;  3C2B A;  1GT0 C;  2VKE A;  2LFB A;  2MGQ A;  3TW6 A;  3JR9 A;  4XRM A;  2K9S A;  2OPT A;  4W1U A;  5IP7 J;  5K7F A;  4IHX A;  1GVD A;  3PO3 J;  3TED A;  1FTZ A;  4XIC A;  1CQT A;  4Y52 J;  5FKL A;  1T33 A;  1ETV A;  3H0G J;  3WHC A;  1FJL A;  5F1J A;  1ZR2 A;  2DA5 A;  4X6A J;  3S1R J;  2ID6 A;  3GBG A;  2N8G A;  1BA5 A;  2YUS A;  2NOG A;  4L5E A;  1IV6 A;  4M3G A;  1RET A;  2L7Z A;  3BTL A;  2CU7 A;  1JUP A;  4AC0 A;  3B6C A;  1EF4 A;  2NVQ J;  2M8G X;  1WPK A;  3BQZ A;  5M5X J;  4A3E J;  1TWA J;  1MSE C;  1W0T A;  1F36 A;  1U9O A;  4UUT A;  5J1U A;  1A5J A;  3S1M J;  2G0E A;  4RDU A;  2W48 A;  4NDL A;  2DA4 A;  1AHD P;  1JKR C;  4S0H B;  1H88 C;  5E3O A;  5GP9 A;  3BTI A;  5F27 A;  3BR5 A;  2K40 A;  2XPU A;  1MBJ A;  2EH3 A;  1SFO J;  3GTJ J;  1JJ6 C;  2E19 A;  4IEJ A;  4IHY A;  3GTO J;  1Z0X A;  2NVY J;  1SAN A;  3HOZ J;  1I6H J;  2DA2 A;  3JRI A;  2YU9 J;  4B1R A;  3JRG A;  1Y1V J;  3CMY A;  2HOT A;  3JRE A;  2E2H J;  1IRZ A;  4HNV A;  1AU7 A;  2EZH A;  3SDG A;  5EF6 A;  3SJM A;  4A3I J;  3GTP J;  4FCY A;  5J3L A;  2H8R A;  2R0Q C;  5E3M A;  3W6V A;  3PM1 A;  2VKV A;  4M3F A;  5C3E J;  2ECB A;  4XRS A;  4BBR J;  2L9R A;  5DS9 A;  4A69 C;  2LLK A;  2Y30 A;  5EYR A;  3HM5 A;  1XG1 A;  2R5Y A;  3FK7 A;  2R5Y B;  5M3M J;  3FK6 A;  2FJ1 A;  4JYK A;  5EZH A;  2XPW A;  1ZQ3 P;  1UHS A;  1YRN A;  5EDN A;  1YRN B;  3I4M J;  4M6V A;  3IH2 A;  1LFU P;  2IEK A;  4V2G A;  4JX6 A;  1UMQ A;  1WH5 A;  1Y1W J;  4I6Z A;  5IYD J;  3BT9 A;  2XPV A;  1RES A;  3BR2 A;  3K2A A;  5K7Z A;  5FLV A;  1IGN A;  2R93 J;  2DMU A;  1HCR A;  2NVT J;  3ZQG A;  4C3I J;  3BTJ A;  2R5Z A;  2R5Z B;  4FE4 A;  1DU0 A;  2HDD A;  3LOC A;  1I3Q J;  1MBG A;  1HDD C;  2VPR A;  2DA6 A;  2EBI A;  3ZQC A;  2DA3 A;  5FKO A;  1ETO A;  1ORK A;  3BR0 A;  1TWF J;  1ZTR A;  2M34 A;  2P81 A;  4A3K J;  3NAU A;  4JX5 A;  3TP0 A;  2HOA A;  3DCF A;  1MH3 A;  4QIW N;  5JLW A;  1NK3 P;  5FKK A;  5M3F J;  2XGE A;  1IG7 A;  3RQI A;  3ZQH A;  1U78 A;  1QRY A;  3S2D J;  1G2H A;  4XRS G;  4M3E A;  4D5F A;  3H3V K;  2WV1 A;  1JUS A;  1ENH A;  4DW6 A;  1FIA A;  1RR7 A;  5F0F A;  5F0H A;  3D1N I;  2PMZ N;  2L7M P;  5M5W J;  1BL0 A;  2JMW A;  1MH4 A;  3E7L A;  4BKX A;  1FIP A;  4DYR A;  1MBH A;  3HOV J;  1R9T J;  4A93 J;  5IYB J;  4MIM A;  3HOU J;  3JRH A;  3S17 J;  3UKG A;  1JT0 A;  2LK2 A;  3ZQI A;  3NAR A;  3LSR A;  2QCO A;  1RKT A;  4UUS A;  1BJZ A;  5GPC A;  2EZI A;  3OSG A;  1PUF A;  4M3B A;  2RAE A;  4BY1 J;  5HOD A;  2Y9Z A;  1PUF B;  3BTC A;  2JN6 A;  1HOM A;  4D7N A;  1NK2 P;  3IH4 A;  2MSY A;  2HYJ A;  3HGY A;  4V2F A;  1WGX A;  3QQA A;  4DZP A;  1U8B A;  4FIS A;  1IUF A;  1JGG A;  2GLO A;  2FQ4 A;  1LFB A;  1ZKG A;  1HF0 A;  1S7E A;  4AUX A;  5EG0 A;  2DMQ A;  3JRC A;  4JP0 A;  5IPA A;  4A3J J;  2GBY A;  2ID3 A;  2M9H A;  1MBK A;  2L7F P;  1APL C;  5IOY A;  1FTT A;  1GUU A;  1WCM J;  1VND A;  3CQZ J;  3K7A J;  3WHB A;  4IHW A;  2ZB9 A;  5E3N A;  3HDD A;  1I50 J;  2M2E A;  1X2M A;  1T56 A;  3OIO A;  1ETQ A;  3LSP A;  1WH7 A;  2R7Z J;  1ETX A;  1FEX A;  2QF7 A;  4G12 A;  2Y31 A;  4QSH A;  1POG A;  1XC5 A;  2XGC A;  3O8H A;  1AKH A;  2DTZ A;  1AKH B;  5EEA A;  3BQY A;  5IP6 A;  3RZD J;  2CUE A;  3HB9 A;  4DZJ A;  4BXX J;  3CCY A;  3F0C A;  1O4X A;  2DN0 A;  2KDZ A;  1ITY A;  3RZO J;  1MBE A;  1BW6 A;  4GFB A;  4IHV A;  1NTC A;  5K7H A;  1A6I A;  2ME6 A;  4Y7N J;  2XRL A;  2HI3 A;  3MVP A;  4BY7 J;  1XS9 A;  2ECC A;  4DYQ A;  5IYC J;  4AYB N;  3BG3 A;  1GV2 A;  2KT0 A;  3TP3 A;  3GTL J;  1OCP A;  3GTG J;  2JWT A;  1IC8 A;  2DA7 A;  3QPL A;  3HOY J;  1OCT C;  2EQR A;  2MW8 A;  1ZK8 A;  2DMP A;  1RPW A;  3Q0W A;  1VF9 A;  2I10 A;  5FKM A;  1TC3 C;  3TW7 A;  2CQX A;  2OF7 A;  3BR1 A;  2MG4 A;  3CDL A;  3SFI A;  2ELK A;  4MFE A;  2XSD C;  3IV5 A;  1W0U A;  4A3L J;  1H8A C;  2E1O A;  1ZR4 A;  1TWC J;  1JT6 A;  4JX4 A;  2DMN A;  2HXI A;  2NS7 A;  4A3B J;  1QPI A;  2CJJ A;  3DEW A;  2X9D A;  1WI3 A;  5C4X J;  5BNG A;  5C44 J;  4J19 A;  3S2H J;  1IJW C;  3JRB A;  2TCT A;  5M5Y J;  1VFC A;  4B3A A; 
#chains in the Genus database with same CATH topology
 2FD5 A;  2Q0O A;  4OIP F;  4ZYH A;  2OQG A;  2A69 F;  1OCR H;  5D8K B;  4OAY A;  4EGY A;  5CVV A;  3M4O J;  4M3D A;  3ASN H;  4BS9 A;  4LLN A;  3MKL A;  4UUS B;  2YSR A;  1MND A;  2V6C A;  4LK1 F;  3GCM A;  3BC8 A;  4KIG A;  2M30 A;  5DUI A;  2AS5 F;  4I98 B;  1YLF A;  1IXC A;  2DA1 A;  4M73 A;  1ZRF A;  3S15 J;  2MC4 A;  2IAI A;  1WI9 A;  3PUF A;  3JRF A;  2K5C A;  3DTK A;  3CJN A;  1KU9 A;  2H1K A;  1D1A A;  3OIP A;  4OOI A;  4RMN A;  5J1Y A;  2W85 A;  4D7M A;  1UAA A;  4K2E A;  2A3S A;  1B59 A;  3SDB A;  1ZG5 A;  2JA5 J;  2W24 A;  2DBB A;  2QSF X;  3K1M A;  1J2X A;  3BP8 A;  3ZCO A;  3EUH A;  1MMN A;  3VYU B;  1OFC X;  4C3J J;  1SVM A;  3A03 A;  1SAU A;  3JAM Z;  4MQV A;  4QLC U;  4PFO A;  1FOY A;  1B72 A;  1VI0 A;  4C2M J;  1TWH J;  1B72 B;  2COB A;  2X6O A;  3HRT A;  4A3G J;  2K9Q A;  2IW5 A;  3OWT A;  3K1N A;  2D1V A;  3HKZ A;  5B1A H;  5FLX Z;  2M87 A;  4M74 A;  2X1C A;  3E5Q A;  3X2Q H;  1GV5 A;  3IWF A;  3MEX A;  3WTV C;  2M7B A;  2R3S A;  2XRN A;  1ETY A;  4PFP A;  4G8X A;  2LDU A;  1YE9 A;  1XDS A;  3DPL C;  2QKL B;  3CF2 A;  3L1P A;  2ZXH A;  1YQA A;  3E5X A;  1MDM B;  3V8K A;  3L2R A;  1RZ4 A;  3LA2 A;  3BR6 A;  2JK3 A;  2ME0 A;  5H6Q A;  3ZOB A;  1N75 A;  2W84 A;  4HQM A;  1X58 A;  1LEA A;  4CO8 A;  2ISY A;  4NUB A;  1ZRD A;  3I4N J;  3J7Z I;  2RC4 A;  3D5S C;  2XGD A;  5CJ9 A;  5ED4 A;  2QVO A;  4Q4Z F;  3SXY A;  1ZGW A;  1FLI A;  2F6C A;  2XSJ C;  3BDD A;  1JTY A;  1SFX A;  5HLI A;  5KAI C;  2PBI A;  3MZH A;  1FBQ A;  4GYG A;  2EWN A;  2HVQ A;  4MO7 A;  4D5C A;  1YIO A;  2CS3 A;  2XAG A;  3RPQ A;  3OYH A;  4BBS J;  4W97 A;  2IGO A;  2D2W A;  4I76 A;  3KP6 A;  2VC1 A;  5F64 A;  3FM5 A;  5BPI A;  2R7D A;  1P92 A;  2LTP A;  1EH8 A;  1UHM A;  1WJF A;  3RDI A;  2HDC A;  4EJU A;  3M7G A;  1BOA A;  4BYY A;  3S2W A;  2RV8 A;  1BOB A;  1XSV A;  4L9J A;  3ZQF A;  5FLM J;  1IAW A;  4XRF A;  3M8J A;  2NVX J;  5E17 F;  4BNC A;  2ZCW A;  2ETH A;  1VQ5 I;  5E8I A;  1D5Y A;  3IH3 A;  2X48 A;  3GVA A;  4II2 A;  1WJC A;  3LSJ A;  1Z7U A;  1IXR C;  4Q47 A;  2M7A A;  2YX4 A;  1K79 A;  3TO7 A;  1U3E M;  3L09 A;  4AVZ A;  5LRR A;  3VEP A;  1FNN A;  3GTK J;  3I0T A;  2LR8 A;  2RNG A;  1SD5 A;  1YG2 A;  2DYS H;  2ZFW A;  3LQQ A;  3TDZ C;  2Z33 A;  1GT0 C;  2VKE A;  1JXS A;  2ZME C;  5K7F A;  1O3R A;  2PJP A;  5H20 A;  3QWL A;  3L2W A;  2OZU A;  1S9H A;  2HU9 A;  4XIC A;  5FKL A;  4AVP A;  1CQT A;  4Y52 J;  1K6O A;  4BQO A;  1MMG A;  5F1J A;  5AIP A;  1BIB A;  2BE5 F;  2FQ3 A;  2OA4 A;  3KEO A;  3TO9 A;  1IN5 A;  5HLG A;  2STT A;  2MC3 A;  4ZDL A;  2OTL I;  3W3C A;  2P0W A;  2X0L A;  1F4K A;  2QQ9 A;  1IV6 A;  1LVK A;  2V9K A;  1RET A;  5HNH A;  1U8R A;  4KN4 X;  4HSR A;  5DDG A;  3K4L A;  5K1Y A;  2HTJ A;  3J7Y J;  1WPK A;  1T08 B;  1MSE C;  1U9O A;  4UUT A;  5J1U A;  2KIF A;  4IOC F;  2G0E A;  4G6T B;  4RDU A;  4Y17 A;  2EIN H;  2W48 A;  4NDL A;  3I3L A;  4HDV A;  3H5R A;  1ULY A;  3E6D A;  2R7R A;  4G6D A;  1T8I A;  2HZD A;  3COA C;  1U5T A;  1U5T B;  2EH3 A;  2Z5U A;  3O3K A;  4C9Y A;  2K86 A;  1JJ6 C;  3BZK A;  1PJR A;  4IHY A;  1AWC A;  5H2F C;  2KP6 A;  4XR6 A;  3ZN0 A;  1OPC A;  2XUB A;  1S7A A;  2DA2 A;  3V8J A;  3CMY A;  1Z6R A;  2QSH X;  2YU9 J;  1I6H J;  2E2H J;  2DU9 A;  5TJJ A;  2OCE A;  3PIP F;  2XC7 A;  1IN4 A;  3K10 A;  3LFU A;  2HKX A;  5EF6 A;  3SJM A;  2H1L A;  1VQ4 I;  2IA1 A;  3GX4 X;  1PP8 F;  2H8R A;  3ZMT A;  2B0L A;  2M45 A;  1EH7 A;  2DW4 A;  3W6V A;  2VKV A;  4M3F A;  5C3E J;  2VKH A;  2FBI A;  4BHC A;  4A6E A;  3K9T A;  5FGM A;  2ECB A;  4XRS A;  4KT6 A;  1Z7L A;  4BAC A;  2E5N A;  2UWM A;  4A69 C;  4WX9 A;  2R5Y A;  4LJZ F;  2R5Y B;  1TLH B;  1W1W E;  2A6T A;  4A5M A;  2FJ1 A;  5EZH A;  3BRO A;  4KUM A;  5HLH A;  1Q1H A;  4XLA A;  1MMS A;  3C1D A;  1DPU A;  3CP8 A;  1YI2 I;  1K4S A;  2LY1 A;  3WU0 A;  2R4G A;  1TW3 A;  1ZLK A;  2CH0 A;  3I71 A;  1Y1W J;  3BG6 A;  4I7H A;  3GFJ A;  3G73 A;  4ENJ A;  1WJ5 A;  2PJR B;  5IYD J;  3BR2 A;  5IT3 A;  5FLV A;  3KYC B;  1ZH5 A;  1B4A A;  3FDY A;  4C2U A;  2PMZ A;  2OC6 A;  4ON0 A;  1TQM A;  1Y0U A;  3ASO H;  2MH2 A;  1MW7 A;  2DLL A;  4FE4 A;  3QP6 A;  4CYD A;  1YS7 A;  5ICF A;  4YIR X;  5LRS A;  3I54 A;  1SD7 A;  3MD2 A;  3MKW B;  4HG2 A;  1G3S A;  3BR0 A;  1TL8 A;  4BAY A;  1ZLJ A;  3ZXS A;  3S93 A;  4E4H A;  3IRQ A;  5JLW A;  2F5V A;  3DXJ F;  1BM9 A;  3QU6 A;  1KU2 A;  3ZQH A;  4BEH A;  4BEH B;  2BEO A;  1EH6 A;  1BJA A;  2KIS A;  3S2D J;  4HX8 A;  3BLY A;  1BI3 A;  2KRH A;  4D5F A;  1G3W A;  3FMR A;  4IQ4 A;  3HZJ A;  5F0H A;  1FIA A;  3RCO A;  2DPU A;  3CMA I;  5M5W J;  1W5C C;  2JMW A;  1MH4 A;  3EYI A;  3FXK A;  5DUK A;  2VIX A;  5BQT A;  1KQ9 A;  1FIP A;  3DU6 A;  1MBH A;  2JA2 A;  1X19 A;  1XGS A;  4BJT A;  1R9T J;  3HOV J;  3JCU C;  1ERD A;  2HS5 A;  2LK2 A;  1R4N B;  1G3T A;  4JK1 X;  3LSR A;  3BJO A;  3OYI A;  1BJZ A;  3SEQ A;  4TV7 A;  3OSG A;  4M3B A;  5HOD A;  3BTC A;  1FZP B;  5A2Q K;  3SZG A;  3VOE A;  2E34 A;  5GTH C;  3QQA A;  3DBL B;  1W7P A;  4KIF A;  1W7P B;  1RC9 A;  1SD6 A;  3CME I;  2ADU A;  2E1M B;  4AU7 A;  4F7Z A;  1ZKG A;  5ILS A;  4D1Q A;  4O3M A;  4LG3 A;  3CCE I;  2GA2 A;  5EG0 A;  3QYE A;  3JRC A;  4A3J J;  2GBY A;  3BWG A;  1P4X A;  4RB1 A;  1X1P A;  3FMQ A;  1GUU A;  1UJ8 A;  4HA8 A;  2BHY A;  1WCM J;  3CQZ J;  2IS6 A;  3WHB A;  4IHW A;  1BR1 A;  1MJB A;  4RAG A;  1T0F A;  3AKZ A;  2QM3 A;  5TIS C;  2C6Y A;  1X1D A;  2LOO A;  2M4G A;  3CZ6 A;  1T56 A;  2R7Z J;  1KA8 A;  1Z6T A;  1OCO H;  1GHC A;  3P9C A;  3OIQ A;  5D5X B;  4QSH A;  2HEO A;  1H9G A;  4Y15 A;  1TNS A;  4ESJ A;  2PLY A;  1H0M A;  3T0Y A;  3KEY A;  5BMZ A;  3HB9 A;  1RIO H;  4HF1 A;  5CVI A;  4BQN A;  4P9F A;  2VQH A;  1O4X A;  3AG1 H;  4CHU A;  2Z1D A;  4KMF A;  2V4J C;  4GRI A;  3PJR A;  1MBE A;  1BW6 A;  2HGC A;  3QPT A;  4DBR A;  1NTC A;  2E71 A;  2ME6 A;  2XRL A;  3K70 C;  3G6E I;  4EGZ A;  2E7X A;  2VBZ A;  4LD5 A;  1XS9 A;  4DYQ A;  2DXI A;  2P8T A;  2AQF A;  1ZGA A;  3BG3 A;  1GV2 A;  3GTL J;  3TP3 A;  4ZJZ A;  5FO5 A;  3GTG J;  5BPD A;  2JWT A;  4IHS A;  1IC8 A;  1P2F A;  3H9G A;  2HYG D;  3QPL A;  3HOY J;  1OCT C;  2XDV A;  1VQK I;  2R7F A;  4IRG A;  1ZK8 A;  1LDD A;  3Q0W A;  4IF4 A;  2FUG 2;  1HW5 A;  4UNO A;  1WQ2 A;  1Z3X A;  1XCB A;  4EQQ A;  2VJI A;  2Z99 A;  3N97 A;  1RUN A;  2LNB A;  1LDJ A;  1BI2 A;  1FY7 A;  4DBQ A;  2ELK A;  3CCQ I;  4GGG A;  4LLG F;  4MFE A;  1M1E B;  1Z3Y A;  1PDN C;  3AG4 H;  2VPL A;  4A3L J;  3FBI B;  3B73 A;  3I53 A;  4M72 A;  3SFZ A;  3OYG A;  2XV4 S;  1JT6 A;  3G3Z A;  2X1D A;  3S3N A;  2DMN A;  2HXI A;  2NS7 A;  1QPI A;  3KLO A;  2CJJ A;  4P9U A;  5L3C A;  3LAP A;  2X9D A;  3H1C A;  4MNU A;  3HOT A;  1QBJ A;  3A2K A;  1B1B A;  4HV6 A;  4EMS A;  1YW7 A;  4YEJ A;  4HPQ A;  5ICG A;  5C4X J;  4J19 A;  3S2H J;  1IJW C;  3JRB A;  5LEJ A;  4HYE A;  1XSX A;  3GFL A;  5M5Y J;  3DKY A;  5J8C A;  5F6F A;  2IGK A;  4XSZ F;  1Y8Q B;  1LNW A;  2LY9 A;  5DM6 F;  2FX0 A;  1W4M A;  3AG3 H;  2JJ7 A;  2V6E A;  3KPH A;  1YW9 A;  2XB5 A;  2LYC A;  2W82 A;  3ZGK A;  2EIK H;  3G2B A;  1NG6 A;  2VOP A;  2F2E A;  2HDW A;  1KZH A;  1T95 A;  3CD6 I;  2DT6 A;  4XK4 A;  5LHH A;  4J01 A;  2EV0 A;  3Q0U A;  3M8F A;  3VPR A;  5F04 A;  3GZN B;  2NNN A;  4DYC A;  3FXO A;  3WGI A;  2LY2 A;  3F8C A;  2ZJR F;  2JA8 J;  1F43 A;  4P96 A;  1WRJ A;  1R1T A;  2GA1 A;  4BGD A;  1B8I A;  1HKS A;  1IDY A;  3FF5 A;  3PNT A;  3RYP A;  1B8I B;  1R36 A;  2DPD A;  2FNA A;  4NC6 A;  3VYT B;  3MMY B;  1BW5 A;  5DTD A;  1OQY A;  1X1B A;  2PFB A;  1D1B A;  5CQG A;  3S16 J;  3PFY A;  1LJ9 A;  2XB0 X;  3HSF A;  1P7I A;  1LPQ A;  4ZYA A;  2X6X A;  3E6B A;  5EEH A;  1ON2 A;  2KZG A;  2CUF A;  1IO2 A;  3VWB A;  1HW2 A;  3M3Y J;  3AFH A;  4S04 A;  2QQA A;  3MCZ A;  2BGC A;  3JRD A;  4UVB A;  2BXZ A;  1G6N A;  4YEL A;  2B63 J;  2B9S A;  4JQF A;  5KVR A;  3HRS A;  2LH9 A;  3K6G A;  2IP2 A;  3EQL F;  1SFE A;  3CCV I;  4CGZ A;  1V4R A;  3F9K A;  1SAX A;  2AO9 A;  4GDF A;  2CMP A;  5FRM A;  3A02 A;  2P5K A;  3VYS B;  4GXO A;  2DOE A;  5L3G A;  2DT5 A;  1IXS B;  3G1L A;  4MQ9 F;  4XQF A;  2QBY A;  1VQL I;  2JPB A;  2VE9 A;  2QBY B;  4MTE A;  3GTQ J;  1E3H A;  3HBL A;  3EUA A;  2O61 A;  5FD6 A;  1TT5 B;  2E7W A;  3V4G A;  1HXD A;  4C3H J;  1TWG J;  2A68 F;  2HQ5 A;  4PK4 A;  1FBS A;  1BIA A;  1UG2 A;  5E18 F;  5HLT A;  2IGM A;  4A2U A;  5D5U B;  3QU3 A;  2DO7 A;  2Y2Z A;  4RB0 A;  3CTA A;  1VQ6 I;  1U9N A;  3K0L A;  4L5I A;  3R6S A;  4LIT A;  2LG4 A;  3BPX A;  5F08 A;  3BG9 A;  2O9L A;  1TT0 A;  3ZMZ A;  3CCL I;  3IP4 B;  1LKX A;  2WBM A;  2FNP A;  3SHF A;  3F8M A;  4F91 B;  1QA6 A;  3IL2 A;  2KJC A;  4I0A A;  1XGN A;  4N9I A;  1LB2 A;  2X6W A;  4QPQ A;  1MNM C;  5EGO A;  1IDZ A;  4B47 A;  1K6Y A;  2CV0 A;  5EGO B;  1BC8 C;  2EZK A;  4CCL A;  3FKI J;  2WB1 N;  3KZY A;  2WTE A;  4L9V A;  3CJQ B;  3B6A A;  4CYC A;  1V5F A;  4YFX F;  3GLX A;  4RBO A;  4CYC B;  5DD8 A;  2CGP A;  2JA6 J;  3S1Q J;  2JVG A;  2LP0 A;  2EIL H;  5LGT A;  2OAZ A;  4UY8 I;  1IRF A;  1HW1 A;  3OYM A;  3OYC A;  4PJN A;  3T5X A;  2WAQ N;  4XKC A;  2GIZ A;  2O7O A;  2LFB A;  2A6E F;  2MGQ A;  3EUH C;  3TW6 A;  4IVN A;  4EAT A;  4BUP A;  4XRM A;  4IHX A;  1IZ1 A;  1QQI A;  1XDU A;  2EA2 A;  5E8G A;  5JHU A;  2A05 A;  2L54 A;  1K7A A;  1UB9 A;  3ZMU A;  2DJI A;  3BG7 A;  1IW7 F;  1ETV A;  3H0G J;  5L3B A;  4ENN A;  1FJL A;  2IGN A;  2RN7 A;  3H5N A;  4HX4 A;  5B1B H;  3BZC A;  1ZR2 A;  2DA5 A;  1WZ2 A;  3MFK A;  4C2T A;  1ZEL A;  2ID6 A;  3GBG A;  3N05 A;  2N8G A;  3CLO A;  3CO6 C;  2IS4 A;  1BA5 A;  2IA2 A;  4CH7 A;  4OIQ F;  3FX3 A;  5HNF A;  4IL6 C;  3KP4 A;  3V7C A;  2IA0 A;  3FBN B;  5LGU A;  2FE3 A;  1J5Y A;  3BTL A;  2LC2 A;  3DFG A;  4XLN F;  1JUP A;  4XOT A;  3EUK L;  1A6Q A;  4XON A;  2M8G X;  1MJA A;  3BQZ A;  4A3E J;  1TWA J;  3TL4 X;  1TQI A;  1EKE A;  3ZMS A;  4IKF A;  3FM3 A;  2PX9 A;  2P6T A;  1A5J A;  4DQ2 A;  2DA4 A;  5GAE J;  2BVL A;  1TQP A;  3WU2 C;  2QUF A;  4RB2 C;  1FYM A;  5E20 A;  2XPU A;  3GWZ A;  1MBJ A;  4BXF A;  3GO5 A;  4UVA A;  5FRO A;  2VN2 A;  4P55 A;  1GVJ A;  2GWR A;  2K4J A;  3GTJ J;  4E7S A;  4IEJ A;  3GTO J;  3F8N A;  1Z0X A;  2HNH A;  1HSJ A;  1R5I D;  2NNY A;  1O57 A;  2EIM H;  2MLG A;  1USS A;  3JRG A;  2HOT A;  2JSP A;  4ZTF A;  3JRE A;  4BHB A;  3HRM A;  1ODD A;  3CES A;  2GQQ A;  4A6D A;  4U7D A;  1AU7 A;  2FEZ A;  4F93 B;  2DQR A;  3KEQ A;  3DLL F;  1QHH D;  5ICC A;  3PM1 A;  3F6O A;  1R00 A;  3DEE A;  4E70 A;  2KZV A;  3KYL A;  1DGW Y;  2L9R A;  2VON A;  3GW2 A;  4EM0 B;  5JI6 A;  5DS9 A;  2BYV E;  2DK5 A;  2LLK A;  2RNJ A;  2Y30 A;  5EYR A;  3SQN A;  1O3Q A;  3HTS B;  1XG1 A;  1G8X A;  2OJE D;  3FK7 A;  4NNJ A;  5M3M J;  1STZ A;  1MGT A;  1K78 A;  4N9H A;  2EB7 A;  1K78 B;  2Y75 A;  4RGR A;  1VQP I;  1IRX A;  1WJB A;  2P5L C;  2ZC2 A;  4UUV A;  4BJ6 C;  2X51 A;  1WJA A;  3RTR A;  2E36 A;  2IEK A;  4L9T A;  4RAZ A;  4KYW A;  3LAJ A;  1UCR A;  1A31 A;  1QPM A;  1B6A A;  3HOS A;  2XPV A;  3JSO A;  4LIV A;  3IKT A;  2XIG A;  2DMU A;  3K4C A;  1C0W A;  4PUS A;  2R7Q A;  2JVH A;  2CSO A;  4PJL A;  3OMY A;  3HHH A;  3BTJ A;  5IT9 Z;  3RIR A;  1BN5 A;  1G59 A;  1I1G A;  1HA8 A;  2L9V A;  4HOB A;  4KIB A;  2VT3 A;  3LOC A;  5HOO A;  2R7W A;  1YTY A;  1I3Q J;  1MBG A;  4IPA A;  4IOA F;  2VPR A;  2EBI A;  3ZQC A;  3F22 A;  1R7J A;  2VQC A;  5FKO A;  4RA2 A;  1ORK A;  2CG4 A;  2ESH A;  4KJZ A;  3GEZ A;  2IXS A;  4UHT A;  4LGW A;  1FP2 A;  3NAU A;  4JX5 A;  2E60 A;  2HOA A;  1GLN A;  3DCF A;  1O3T A;  4QIW N;  2R7T A;  3IC7 A;  5FKK A;  1R58 A;  3GXO A;  2EK5 A;  1IG7 A;  5K5Q A;  3IAM 2;  2EFW A;  1E3P A;  4B8X A;  1O3S A;  5B66 C;  3HPG A;  1QRY A;  2IJL A;  1FSE A;  2HVR A;  1TP4 A;  3CDH A;  1U5T C;  2W00 A;  4HRI A;  2H6B A;  3OL3 A;  4ANJ A;  4DW6 A;  1RR7 A;  1ONV A;  2OQR A;  2VT2 A;  4A0Z A;  5HDN A;  5E1W A;  3DQV C;  2VBY A;  4LMY A;  4PSW A;  3JW4 A;  4HF0 A;  3E7L A;  4BKX A;  4PJJ A;  3L2Q A;  5LFA A;  1I27 A;  4EJV A;  1J0R A;  3S17 J;  6PAX A;  5BOX A;  2DK8 A;  1JT0 A;  3R61 A;  2QWW A;  3ZQI A;  1T6S A;  4CCK A;  3CCS I;  1D0X A;  2QCO A;  3WU1 B;  1RKT A;  2A5Y B;  5GPC A;  2EZI A;  2QGU A;  2PQ8 A;  3LMM A;  3J80 K;  1HOM A;  4WF2 A;  3OYD A;  1NK2 P;  3IH4 A;  4V2F A;  3SZP A;  2Q1Z B;  3KCC A;  4YFN F;  1U8B A;  2DT7 B;  2LRE A;  2WY7 Q;  2CUJ A;  2XF5 A;  3PL8 A;  4ZYE A;  1N78 A;  1AA7 A;  1LFB A;  1HF0 A;  1OCC H;  2B7E A;  4BU2 A;  3F8B A;  3CUQ C;  5IPA A;  3H0D A;  3R0A A;  1E17 A;  3ULQ B;  3CUO A;  2KL4 A;  2O8X A;  4E7I A;  2QLZ A;  4FX0 A;  4HZF A;  2MLK A;  1O7L A;  2DOA A;  3RQ4 A;  4AID A;  3NQO A;  3HDD A;  1I50 J;  2M2E A;  1EV7 A;  3LSH A;  1Y56 A;  4YRV A;  1WH7 A;  4NB5 A;  2FML A;  1EJ9 A;  2K27 A;  1FPQ A;  1OCZ H;  2BY2 A;  4F92 B;  2Z2S B;  2KQR A;  4BQA A;  2EV5 A;  3CO7 C;  4YG2 F;  2QF7 A;  4UV9 A;  2G7U A;  3O8H A;  4M9X A;  1VQO I;  1DGR M;  1AKH A;  1WSU A;  1OR7 A;  2DTZ A;  1AKH B;  3JAM K;  2EPF A;  2CUE A;  3W6K B;  3CUQ A;  3OOP A;  2RQP A;  4G6Q A;  3CUQ B;  3CCY A;  3F0C A;  2DN0 A;  2E35 A;  4XLH A;  4E7K A;  2K3P A;  3H3Z A;  2HKO A;  1N25 A;  3O6B B;  1A35 A;  1A6I A;  1DDN A;  3RYR A;  4BY7 J;  2HI3 A;  1SMY F;  1CF7 A;  4G7O F;  2ECC A;  4HF2 A;  1DQU A;  1CF7 B;  4AYB N;  1Z9C A;  1S72 I;  2OCC H;  1OCP A;  1T38 A;  4HDU A;  1GXQ A;  4FHT A;  4RM2 A;  2EQR A;  1Y6I A;  2EFO A;  5HS9 A;  4ZDO A;  4KIS A;  2I10 A;  4I99 C;  3K4N A;  3AG2 H;  5D8L B;  5CQE A;  1TC3 C;  1UZC A;  4BE1 A;  2MG4 A;  1XMX A;  4ZZD A;  3SFI A;  5D5V B;  3BJ6 A;  3LA7 A;  4RGS A;  1X4O A;  5J40 A;  3KYD B;  4NQW A;  3E1S A;  4B43 A;  4UXN A;  3ECH A;  3H5A A;  3H9Q A;  1H8A C;  4X0G A;  1ZR4 A;  1TWC J;  2L2O A;  1UHW A;  3T8T A;  2WA0 A;  2F4M B;  3S3O A;  3CCR I;  4DJA A;  2E1M C;  4P5O A;  5LD2 C;  1ZGJ A;  2V9P A;  3KLN A;  4XLF A;  4BH9 A;  5HDK A;  4L5J A;  3C7J A;  4XOP A;  1EA3 A;  5BNG A;  2X4H A;  3FWE A;  1JI8 A;  4XKB A;  2OTJ I;  1I6X A;  1MNE A;  4B3A A;  3QYF A;  3DKX A;  4LG0 A;  4ZH4 F;  4E7Z A;  4LG0 B;  1FOX A;  2HXO A;  3HGG A;  4UB8 C;  3A1Y A;  1HBX G;  1QZY A;  2KIM A;  1JKO C;  3U1K A;  5B3S H;  3CMM A;  1H89 C;  2YS9 A;  2A5W A;  1YO5 C;  2XKO A;  1T0F C;  1XGM A;  3L7W A;  3E3V A;  1ZAR A;  2XAU A;  3HOW J;  4RB3 C;  4I09 A;  2BY1 A;  2A07 F;  2H94 A;  4LLL A;  3G4S I;  1J75 A;  1P4W A;  1OIS A;  1W36 D;  1K83 J;  4ASN A;  1QVT A;  2KPM A;  4IHT A;  4D9J A;  4HNT A;  2BVM A;  4FX4 A;  1MSF C;  4AIK A;  5FJ8 J;  1JUM A;  4GCV A;  3A0B C;  4NC7 A;  3A01 A;  2L7K A;  3D5R C;  5CPR B;  2XAH A;  1Q1V A;  3KZI C;  2VBX A;  3QOD A;  3WGG A;  5E79 C;  2H09 A;  3A01 B;  2VJJ A;  4M6Y A;  2EFQ A;  1OYI A;  4IO9 F;  3BPV A;  5EG0 B;  5IP9 J;  2HQN A;  1ZAO A;  3S1N J;  2CV1 A;  1RKW A;  3K1P A;  1VZ0 A;  1FWZ A;  2JRM A;  5JLX A;  1T2K A;  3OY9 A;  4ZZL A;  3GTM J;  4R79 A;  1HDP A;  2K9N A;  2Y0S N;  2EZL A;  2D5V A;  4RM3 A;  3HJE A;  1OJL A;  2VOO A;  1MBF A;  2ACJ A;  3DWL E;  1D0Y A;  3GUD A;  2NS8 A;  2O0Y A;  4ESB A;  5FKN A;  3ZPL A;  1FSH A;  1O7F A;  2K9M A;  5IY5 H;  2K85 A;  2DFH A;  5KK1 A;  2MFZ A;  3LSG A;  2ISZ A;  2M0M A;  3J81 Z;  1JTX A;  4PGG A;  4FTH A;  1Z21 A;  1ETK A;  4KN7 X;  1B9N A;  2GM4 A;  1Z91 A;  2Y48 A;  3DU5 A;  3MN2 A;  2DMT A;  1W5T A;  2XAQ A;  2QSG X;  4EEF G;  3G71 I;  3I9V 2;  5L3E A;  2O3F A;  2KDO A;  2LVS A;  3JRA A;  5J8F A;  5J1R A;  3OS2 A;  3LA3 A;  3K4J A;  3LNQ A;  2JA7 J;  1DU6 A;  1ZRE A;  3GYH X;  1VQ7 I;  3G1M A;  5CYV A;  2L9N A;  4QTR A;  4B48 A;  2VI6 A;  5EZG A;  3O8G A;  4Y4R A;  4EJT A;  2R92 J;  2FRH A;  2XKP A;  2WB1 A;  4QWQ A;  2V1D A;  2CRG A;  3E5U A;  3EET A;  2E1C A;  4A3M J;  4EJW A;  1V3F A;  1X3W B;  3HTU A;  1Y0N A;  3Q3S A;  4O6J A;  1I5Z A;  2IBD A;  2R7S A;  1FOK A;  3CCU I;  2BBY A;  3QPS A;  2P7C B;  1XTA A;  2WAQ A;  3OYL A;  1X1C A;  1IF1 A;  3Q9S A;  1IN7 A;  4OIR F;  4GYI A;  3L2U A;  3RKQ A;  4JOM A;  1D0Z A;  2GXB A;  4E7L A;  5K5R A;  2VE8 A;  3M8E A;  1SVL A;  5LEK A;  4XLE A;  2JSC A;  3LFK A;  3NEU A;  2ZKZ A;  5KCM A;  2EJR A;  1R23 A;  2PG4 A;  2WC2 A;  2GAU A;  5JVG F;  1E3O C;  1X2N A;  3RKX A;  2MAB A;  4H4K C;  4CCM A;  4CCN A;  2HVS A;  1E0E A;  2M8E A;  3CC7 I;  1S3J A;  4LOC A;  1HKQ A;  2O8K A;  1IRG A;  3S14 J;  5ILV A;  3CC4 I;  4U0Y A;  3OYN A;  5E3L A;  1Z67 A;  5DEQ A;  2DOF A;  3FXM A;  1FT9 A;  4PSX A;  3FKJ A;  1GDT A;  2KMU A;  3BG5 A;  3FXQ A;  1R22 A;  3KE2 A;  5LBQ A;  3K4M A;  1S7O A;  3V7S A;  4BXU A;  4HV5 A;  3JR9 A;  2MA3 A;  2MYS A;  2OPT A;  3LQR A;  4PDK A;  5IP7 J;  1GVD A;  3E6M A;  3TED A;  3I58 A;  3K4K A;  2ZBK A;  1RRJ A;  2F5C A;  3OS0 A;  1T33 A;  5FB2 A;  2OV7 A;  1RUO A;  2HYF A;  4NBQ A;  3HYI A;  3ZRG A;  2K9L A;  3SYT A;  3VOD A;  2JQ7 A;  3S1R J;  1R49 A;  3WTW C;  4CA0 A;  4IJA A;  2O03 A;  4ZDP A;  4LB5 A;  1TTY A;  3TOA A;  4L5E A;  4M3G A;  1YS6 A;  4XMY A;  3O2P E;  2DQL A;  1X3Z B;  2CU7 A;  5FRN A;  2F4I A;  3DF8 A;  4LIU A;  2QKM B;  4AC0 A;  1EF4 A;  1BC7 C;  3GZ6 A;  1ZG1 A;  5M5X J;  3M07 A;  1W0T A;  3OYA A;  1F36 A;  2YR2 A;  1VTN C;  3PSI A;  1H9T A;  3HSR A;  1KU3 A;  3F6V A;  3R60 A;  2OD5 A;  2L5Q A;  2PEX A;  2PN6 A;  1FX7 A;  4FET A;  1AHD P;  1P6R A;  1JKR C;  5E3O A;  5GP9 A;  1MKM A;  3BR5 A;  4BDZ A;  2JTV A;  3JTG A;  2K40 A;  2M5W A;  2FA5 A;  3MQ0 A;  4Q48 A;  4Y33 A;  1JGS A;  5D4R A;  1SFO J;  4PJ0 C;  4WXH A;  2W1O A;  2E19 A;  2W25 A;  2YPR A;  4I01 A;  3FMS A;  3F8F A;  3HRU A;  3OYK A;  3RPU D;  1SAN A;  1YX5 A;  3HOZ J;  1YJN I;  3JRI A;  4OMZ A;  3KP5 A;  5ILU A;  2FBH A;  2LKP A;  4CCO A;  1NHA A;  1X1A A;  4PJM A;  3VB2 A;  2KFD A;  2EFN A;  4ESF A;  2H8W A;  3GTP J;  4PZJ A;  4FCY A;  1J09 A;  1SMT A;  5KAF C;  5E3M A;  3BOQ A;  1B9M A;  2LF8 A;  2QZ8 A;  2W7N A;  4AIH A;  2RDP A;  1MZB A;  2GOM A;  4OIN F;  1S8N A;  3PFI A;  2NAZ A;  1HQC A;  4HX7 A;  2ZXI A;  4BBR J;  2CQK A;  1V5G A;  1U2W A;  4F3Q A;  4FAS D;  3I64 A;  5DCM A;  4PGH A;  3HC7 A;  5DCM B;  2AQE A;  3FK6 A;  2RRE A;  5ICE A;  4KNY A;  4JYK A;  1XGO A;  1DPR A;  2XPW A;  5E1X A;  4HST A;  4OMY A;  2L3D A;  2GXG A;  2VBW A;  5LHG A;  3ZMV A;  1UHS A;  1V54 H;  4I0B A;  2QEX I;  1YRN A;  3DBH B;  3W2W A;  5EDN A;  1YRN B;  4AM3 A;  4D0P A;  1LFU P;  4V2G A;  3HHG A;  1SFK A;  2I5U A;  2LBF A;  4JX6 A;  2LBF B;  1X3U A;  4I6Z A;  2LRD A;  4MEX F;  3W2V A;  1RES A;  3F23 A;  2R93 J;  4ENM A;  1PP7 U;  3V8L A;  4H0E A;  1PVE A;  4C3I J;  4HW0 A;  4JBA A;  3ZMD A;  2R5Z A;  4IRI A;  3KP2 A;  4EVI A;  2R5Z B;  1DU0 A;  3PUB A;  2F5F A;  2X85 A;  3BZ6 A;  1YHQ I;  1ON1 A;  2DOD A;  3OV8 A;  1HDD C;  3PNV A;  2NRA C;  2Q2E A;  1BI0 A;  4CDG A;  2Q2E B;  1YFH A;  1TWF J;  1ZTR A;  2P81 A;  2WY8 Q;  4BQQ A;  3TP0 A;  1W5S A;  3PIO F;  1E2X A;  2W57 A;  5JR3 A;  2L01 A;  4BJ5 C;  3OYJ A;  4G7H F;  1D5V A;  2ZXJ A;  3ABM H;  4NC8 A;  1U78 A;  1G2H A;  1R5H A;  4NHJ A;  1QGP A;  2FSW A;  4XRS G;  3ABL H;  4M3E A;  4WWC A;  3WGH A;  1ENH A;  3J80 Z;  4C30 A;  4RGU A;  2BOL A;  1K4T A;  2EA4 A;  2H6C A;  1RNL A;  2JZY A;  1BL0 A;  1I3A A;  4DYR A;  4V19 K;  3W6J B;  4II3 A;  2YX7 A;  3HOU J;  4XBF A;  3N4M A;  1WJD A;  3PSF A;  3JSP A;  4ENK A;  2HQR A;  3AL0 B;  3DEU A;  2BY0 A;  3H3U A;  4UUS A;  2HQA A;  1LDK B;  1P4A A;  1F9N A;  2CV2 A;  4BY1 J;  3TKY A;  2JN6 A;  3ML6 A;  4XLC A;  2WAE A;  2MSY A;  4MEY F;  3HGY A;  2KIU A;  2Z3Y A;  1WGX A;  4PCQ A;  5L3F A;  2NS0 A;  2VLA A;  4FIS A;  5CVR A;  3H9J A;  4OAZ A;  1JGG A;  3K70 D;  4Z2Y A;  2WWY A;  2FQ4 A;  4GO1 A;  2X1E A;  1J9I A;  2LSO A;  2AXL A;  4AUX A;  2ZSH B;  2DMQ A;  1XCV A;  2HFH A;  5HS8 A;  1MJ9 A;  4G7Z F;  3ELK A;  2BY3 A;  3D0S A;  1MMA A;  1MBK A;  2M9H A;  3KX2 A;  2KRF A;  5IOY A;  1D8J A;  1FTT A;  3OS1 A;  2M4K A;  3HL2 A;  2MD0 A;  3K7A J;  2ZO4 A;  4CZZ A;  1LFP A;  1VQ8 I;  1KYW A;  4N0B A;  3WOD F;  2KIQ A;  4XKW A;  2ZNY A;  2ZB9 A;  4L0Y B;  2CFX A;  1F1Z A;  3IRR A;  2JRT A;  1X2M A;  2NVU B;  4AYB A;  3KET A;  4KDP A;  2F4O B;  2COM A;  3IAS 2;  5HDG A;  3LSP A;  4XM3 A;  2XRO A;  1PYV A;  1FEX A;  4YII A;  2LMD A;  1UST A;  2M3A A;  3PNY A;  3GFM A;  3ROU A;  4G12 A;  2Y31 A;  1POG A;  1X4P A;  1XC5 A;  2XGC A;  1FMW A;  1R1U A;  1OMI A;  3CDI A;  3P9K A;  5DM7 F;  2JUC A;  2WAF A;  2P5V A;  4IX7 A;  2DCE A;  3C18 A;  3NWT A;  3U9G A;  4CSW A;  1MDM A;  4N4N B;  4CXF A;  2GOX B;  2KDZ A;  5KHD A;  2BV6 A;  1W36 C;  1GXP A;  3H92 A;  3QRF F;  4GFB A;  4A12 A;  4XKV A;  1VQM I;  4IHV A;  4E7J A;  4M9Z A;  4M71 A;  3V42 A;  1V55 H;  1SEU A;  2EIJ H;  4YIF A;  3MVP A;  2KJB A;  4KFC A;  3KZZ A;  5IYC J;  5E1Z B;  2KRC A;  3KFW X;  1FP1 D;  2KT0 A;  3GLL A;  2DA7 A;  1ZG3 A;  3ABT A;  3KIO A;  3LSM A;  1ACI A;  2MW8 A;  1J59 A;  1DP7 P;  3E6C C;  5JVT A;  2Q8K A;  3WTT C;  5CVU A;  3WG9 A;  3F3X A;  2V1U A;  4O5V A;  3TW7 A;  4RGX A;  1N77 A;  3BR1 A;  2OF7 A;  3F21 A;  3ERE D;  3CDL A;  4Y13 A;  3DKW A;  1HST A;  3FXL A;  3TQN A;  2HZT A;  3IV5 A;  3K4B A;  4XL9 A;  2CYY A;  4OU0 A;  2E1O A;  3ECO A;  4IRH A;  5BS6 A;  4JX4 A;  1QHG A;  1U0J A;  4A3B J;  2QYO A;  2VKD A;  3OR2 C;  3I56 I;  2FF4 A;  2UV1 A;  2JT1 A;  5A2Q Z;  4A0X A;  2TCT A;  2IVM A;  2R7O A;  4IZZ A;  1YJ9 I;  1KU7 A;  4CUG A;  5TRD A;  2BW3 A;  3DPT A;  5J4Y A;  2BW3 B;  2DI3 A;  2UZK A;  2Y0S A;  2EV6 A;  3ABU A;  3ZQL A;  1LQ1 A;  4A3D J;  1ETW A;  3S8P A;  4HLX A;  3L2C A;  3OSF A;  2IS1 A;  4A3C J;  3L2V A;  2JUG A;  3I59 A;  2FMY A;  2E2I J;  3Q0V A;  3I59 B;  2Y9Y A;  3ZN1 A;  1S29 A;  3SZT A;  1FYK A;  4Q5S F;  2DFI A;  2MH9 A;  3BR3 A;  4I02 A;  4FE7 A;  4U87 A;  3WTU C;  5EEG A;  2VUM J;  1XMA A;  3IWZ A;  4LK0 F;  5LLQ A;  1OR7 C;  3KP3 A;  3CJR B;  3HUG A;  2D1H A;  3HUG B;  3FIW A;  5CVJ A;  1JKP C;  3EYY A;  3HEF A;  3D5L A;  5IOZ A;  4X1E A;  4WXC A;  3VDX A;  2BXY A;  2FU4 A;  5GPA A;  3IUO A;  2LKX A;  2K7L A;  4KT5 C;  2X6Y A;  4DIQ A;  2HPI A;  3BY6 A;  3A0H C;  2ZME A;  1K61 A;  3FZV A;  4LB6 B;  2ZME B;  3DTE A;  2VC0 A;  2CO5 A;  4ABZ A;  4E6K G;  3AAF A;  2ZJQ F;  4B09 A;  2ICW G;  3U2R A;  4XID A;  5F1R A;  4MFD A;  1F5T A;  4IQJ A;  1REP C;  3ABK H;  1WKM A;  2ELH A;  2VJ4 A;  4U88 A;  4G94 A;  5D4S A;  2LD5 A;  2LF7 A;  2ZSI B;  1TW2 A;  3ESW B;  4Z6Y A;  1HLV A;  2FOW A;  3QOE A;  3E0J B;  2DFE A;  2KLO A;  4MLO A;  5C4J J;  1JHF A;  1QZZ A;  2JPC A;  1FMV A;  2XHK A;  2HOS A;  4EM1 A;  2L02 A;  3CLQ A;  1ZN2 A;  3RKW A;  3J7A O;  4BE0 A;  3WTS C;  3CF5 F;  4A3F J;  2HR3 A;  2PI0 A;  1D1C A;  3GZ5 A;  5F0C A;  3OOU A;  5FLX K;  4MHG A;  2E2J J;  2FOK A;  5ERI A;  4F52 A;  1P7J A;  4WCG A;  1QVU A;  5GTI C;  2M0C A;  2MD5 A;  1KQ8 A;  1XSD A;  3G1O A;  3TDU C;  3BJA A;  2P4W A;  3HKZ N;  2P6S A;  5JHF A;  2L0K A;  3U21 A;  3QPH A;  4WXD A;  2ZJP F;  4A0Y A;  4HAM A;  2HTS A;  4XN0 A;  4EV0 A;  4KIT B;  4B4C A;  2ZXW H;  1QZE A;  2UXN A;  3HXL A;  4FQG A;  3NWS A;  2FBK A;  2RGV A;  3PO2 J;  2LKS A;  4U7B A;  2XAS A;  4NQW B;  3J7A Y;  4ZYD A;  2PJR A;  3DLA A;  5J6X A;  4AD9 A;  2IPQ X;  2AHQ A;  2DDB A;  1JKQ C;  1IN8 A;  1KON A;  3HOX J;  2J5P A;  3LL7 A;  4L9N A;  3MZ8 A;  5DYM A;  3FIS A;  1S6L A;  2PMH A;  5DCF A;  2DJN A;  2QQ8 A;  2IT0 A;  2CQQ A;  2ELJ A;  2P7V B;  4HNU A;  3ISP A;  4QPO A;  1LE8 A;  3VYR B;  1LE8 B;  3FHN A;  1JJ8 C;  1UG0 A;  1XX5 A;  1Z77 A;  2TRT A;  5D6E A;  9ANT A;  1R4M B;  2VQL A;  3C2B A;  3TGN A;  4BDY A;  2NOJ B;  1NG7 A;  3OYB A;  2K9S A;  4W1U A;  3K69 A;  5IT9 K;  4M9S A;  5CLS A;  3LSI A;  4BE2 A;  3PO3 J;  1FTZ A;  1D8K A;  1Z1D A;  3WE3 A;  1SFU A;  3WHC A;  4FT8 A;  1BR4 A;  2R7V A;  2QQB A;  5D6F A;  4L18 B;  4A5N A;  3P9I A;  4X6A J;  3TBI A;  1LVA A;  3VFZ A;  1IN6 A;  1MMD A;  1I1S A;  2A6H F;  4BL0 B;  3S32 A;  1XMK A;  2YUS A;  4B44 A;  2NOG A;  3NRV A;  3RPU A;  5L3D A;  2GZW A;  2L7Z A;  3HPH A;  5FFX A;  2HOE A;  4XSX F;  3CP2 A;  2IS2 A;  4M6X A;  5LGN A;  2DYR H;  3B6C A;  1KGS A;  3CJT B;  2NVQ J;  2CQN A;  1HC8 A;  3RI4 A;  4R8H A;  3MWM A;  1XPX A;  2VB6 A;  2VXD A;  3BCA A;  1SVO A;  5GAG J;  3S1M J;  2Y69 H;  1G4D A;  4S0H B;  2HWV A;  1H88 C;  2F48 A;  4HBL A;  4MTD A;  2ZFU A;  3RSN A;  1A04 A;  3BTI A;  3WE2 A;  2BZT A;  5F27 A;  3T8R A;  1ZHF A;  3Q9V A;  5FD5 A;  1YYV A;  2GXA A;  2VL8 A;  4DOZ A;  4P1W A;  5KNL A;  2V79 A;  3LWF A;  1FC3 A;  1OLT A;  4KIC A;  3L9F A;  5CKT A;  2NVY J;  4Y3O A;  3B02 A;  3DTI A;  3TO6 A;  4F55 A;  2O6G E;  1WWX A;  4XLP F;  3I55 I;  4B1R A;  1Y1V J;  1IRZ A;  1QNT A;  3VSK A;  3PQK A;  4HNV A;  2H27 A;  5FFZ A;  1TZL A;  1WHU A;  2EZH A;  3ZQ7 A;  3SDG A;  4S05 A;  2E5Z A;  1P9Q C;  4A3I J;  1R6R A;  4IXA A;  3T1B A;  5J3L A;  3OYE A;  1FBU A;  2A61 A;  2OZ6 A;  4DGW B;  3WTY C;  1L0O C;  2R0Q C;  2VOD A;  2W4S A;  2KKO A;  4RS8 A;  3I4P A;  2KHM A;  3H35 A;  1OYW A;  4ZC3 A;  4AWX B;  1DP3 A;  1KQ0 A;  1XN7 A;  3W2A A;  2VJ5 A;  4UV8 A;  5K5O A;  4I2O A;  3MAJ A;  3HM5 A;  1L3L A;  3FXJ A;  2OUM A;  2MBF A;  1OKR A;  1WFX A;  5GAH J;  1S5L C;  1ZQ3 P;  4G9Y A;  3TOB A;  2F5E A;  2Z9O A;  2TDX A;  1SD4 A;  2M1B A;  3GFI A;  2L4M A;  2CWE A;  1MD0 A;  3I4M J;  3M1E A;  2V1X A;  1G3Y A;  2VXZ A;  3IH2 A;  2K3F A;  4M6V A;  3ZP5 A;  4OIO F;  1Y8R B;  3LSK A;  2ESN A;  1UMQ A;  1WH5 A;  3M9A A;  3KP7 A;  5EJC A;  3BT9 A;  3V7R A;  5K7Z A;  3K2A A;  2NYX A;  2RKH A;  5HVQ C;  1IGN A;  3FXU A;  1HCR A;  2HPM A;  3QYB A;  2NVT J;  5TGT A;  3ZQG A;  2NXN B;  2DAO A;  1Y39 A;  1IV8 A;  3ERM A;  2XAJ A;  3TMO A;  5J4V A;  3UNG C;  2CQ7 A;  3HSE A;  1U6G A;  3A4C A;  2HDD A;  5JFR A;  1BI1 A;  4CZC A;  4E7H A;  1UEL B;  2DA6 A;  3OR1 C;  2DA3 A;  4CCJ A;  2ZNZ A;  1ETO A;  1IUY A;  2M34 A;  3LST A;  4RLF A;  2CFO A;  3GF2 A;  1MIJ A;  1XD7 A;  4A3K J;  2QA4 I;  1MH3 A;  1NK3 P;  5M3F J;  4MGR A;  2XGE A;  3RQI A;  3FHZ A;  1VQ9 I;  1A36 A;  2DDA A;  4OWR B;  3FXR A;  2UUZ A;  1KYZ A;  4UB6 C;  2IRF G;  1HKT A;  3CCJ I;  3H3V K;  1CGP A;  2D45 A;  1YJW I;  1I39 A;  2DTR A;  2WV1 A;  3OL4 A;  1JUS A;  4HLY A;  1V5E A;  3UR3 C;  5F0F A;  3WG7 H;  3D1N I;  1XB4 A;  2PMZ N;  2L7M P;  1NH3 A;  4WK8 F;  3VSL A;  1R1V A;  2Z16 A;  5LHI A;  2F5D A;  4A93 J;  5IYB J;  4MIM A;  3JRH A;  3DBR B;  3UKG A;  3DV8 A;  1TNT A;  2O5R A;  1YX3 A;  2STW A;  1BBY A;  2UXX A;  3NAR A;  3ZR8 X;  3CCM I;  5B5E C;  3F72 A;  1PUF A;  3C2G A;  2RAE A;  5GAD J;  1ZYR F;  4KMU X;  2Y9Z A;  1PUF B;  1YIJ I;  2GIV A;  4D7N A;  3EDP A;  2HYJ A;  3IHU A;  4DZP A;  4EM2 A;  3MKY B;  3E97 A;  1BR2 A;  4HEA 2;  4XNF A;  1IUF A;  3IKV A;  4DNC A;  3QOP A;  5DD4 A;  2GLO A;  2BHZ A;  5AIQ A;  2QEN A;  1S7E A;  3WTX C;  3ZQQ A;  2EFP A;  4JP0 A;  1TBX A;  1LEB A;  1T39 A;  4U0W A;  4KA4 A;  2G7H A;  2ID3 A;  4AIJ A;  1DUX C;  1YW8 A;  2L7F P;  1APL C;  3R0J A;  3EPZ A;  1ZRC A;  2R7X A;  1VND A;  4BHP A;  2I8D A;  3H36 A;  4J00 A;  1J7K A;  2G9W A;  5E3N A;  4ZYG A;  1R71 A;  3HG9 A;  2CUZ A;  1R5G A;  4ITV A;  3PQJ A;  1FOW A;  3DPU A;  3I5U A;  3OIO A;  1ETQ A;  1JHH A;  2L9S A;  2RVC A;  2V9V A;  1ETX A;  2RQQ A;  3JTH A;  4EJO A;  1W7P D;  5H6R A;  1AOY A;  2ZJ2 A;  2XAF A;  4XOR A;  1FYL A;  1PUE E;  2CW0 F;  5EEA A;  2XGX A;  3C3W A;  3BQY A;  5IP6 A;  2Y0M A;  3RZD J;  3C2H A;  4RLQ A;  4RAF A;  1RR8 C;  2VQG A;  3P5J A;  4DZJ A;  4BXX J;  3ONQ A;  2WV0 A;  1WVR A;  3R4K A;  2CW8 A;  4HQE A;  4ZTJ A;  1ITY A;  3RZO J;  2DFF A;  3WTZ A;  4R1H A;  3J81 K;  5AON A;  4UVC A;  5K7H A;  2WAD A;  1YOV B;  1QU3 A;  2V7F A;  4Y7N J;  2OU2 A;  1VQN I;  3RJP A;  4LFU A;  2OBP A;  2FXA A;  3Q5F A;  2J5O A;  3L00 A;  2V1N A;  3REO A;  3CC2 I;  3DP7 A;  1JE8 A;  5HS7 A;  3GME A;  2XVC A;  3BCB A;  3MZY A;  4B3X A;  4N4O B;  3OYF A;  3QP5 A;  2DMP A;  1RPW A;  1VF9 A;  5FKM A;  4ETS A;  1WJE A;  2YU3 A;  3QAH A;  2CQX A;  2V26 A;  3AL0 C;  1SC7 A;  2PMU A;  2CW7 A;  3HIF A;  4U0V A;  4CIC A;  3MKZ A;  2E1N A;  2L4A A;  1YIT I;  2XSD C;  1UFM A;  3P7N A;  1W0U A;  2K4B A;  4YFK F;  5J47 A;  2K02 A;  1Z05 A;  3SEZ A;  2XF7 A;  1LUJ B;  1D3Y A;  3DEW A;  3RKY A;  5DV5 A;  5D5W B;  1WI3 A;  4RAY A;  2R7U A;  3M1C A;  5C44 J;  1RI7 A;  1T98 A;  4XN3 A;  3U1D A;  2AXT C;  2VAS A;  3K2Z A;  4L0Z B;  1VFC A;  1OYY A;  1QO0 D;  2XF6 A;  3S3M A; 
#chains in the Genus database with same CATH homology
 2FD5 A;  2HXO A;  2LY9 A;  3HGG A;  1JKO C;  2FX0 A;  1H89 C;  2JJ7 A;  2YS9 A;  2XB5 A;  3ZQL A;  4A3D J;  3M4O J;  1ETW A;  4M3D A;  3MKL A;  3OSF A;  4UUS B;  3HOW J;  4A3C J;  2E2I J;  4XK4 A;  3Q0V A;  2Y9Y A;  3Q0U A;  1K83 J;  1QVT A;  3VPR A;  5F04 A;  2DA1 A;  5FJ8 J;  3BR3 A;  1MSF C;  3S15 J;  1JUM A;  4FE7 A;  4DYC A;  2VUM J;  2IAI A;  3JRF A;  3A01 A;  2JA8 J;  1F43 A;  3A01 B;  1Q1V A;  1B8I A;  3FIW A;  1JKP C;  1IDY A;  2H1K A;  1B8I B;  5J1Y A;  3HEF A;  4D7M A;  5EG0 B;  5IP9 J;  5IOZ A;  4X1E A;  3S1N J;  1RKW A;  2JA5 J;  5GPA A;  1BW5 A;  5DTD A;  5JLX A;  2LKX A;  3GTM J;  1HDP A;  1OFC X;  1K61 A;  4C3J J;  2K9N A;  3S16 J;  2Y0S N;  2XB0 X;  2EZL A;  3A03 A;  1P7I A;  4ABZ A;  2D5V A;  1B72 A;  1OJL A;  1VI0 A;  1MBF A;  1TWH J;  2CUF A;  2COB A;  4C2M J;  2X6O A;  1B72 B;  4XID A;  4A3G J;  4MFD A;  2K9Q A;  2NS8 A;  5FKN A;  3M3Y J;  2LD5 A;  1HLV A;  3JRD A;  3LSG A;  1GV5 A;  1JTX A;  4FTH A;  1ETK A;  2B63 J;  4MLO A;  5C4J J;  2GM4 A;  1ETY A;  3MN2 A;  2DMT A;  4EEF G;  2HOS A;  3L1P A;  2LVS A;  3JRA A;  5J1R A;  2AO9 A;  3LNQ A;  2JA7 J;  1DU6 A;  3A02 A;  3BR6 A;  2JK3 A;  2ME0 A;  3ZOB A;  3G1L A;  4A3F J;  5F0C A;  3G1M A;  3OOU A;  4QTR A;  1X58 A;  3GTQ J;  2VI6 A;  5EZG A;  3O8G A;  2E2J J;  3HBL A;  3I4N J;  1P7J A;  2R92 J;  1QVU A;  2M0C A;  4C3H J;  1TWG J;  2CRG A;  2XGD A;  2HQ5 A;  4A3M J;  3G1O A;  1UG2 A;  1ZGW A;  3HKZ N;  2L0K A;  1JTY A;  3Q3S A;  2Y2Z A;  2IBD A;  1U9N A;  3QPS A;  4MO7 A;  4D5C A;  4BBS J;  4W97 A;  4B4C A;  2O9L A;  5F08 A;  3BG9 A;  3RKQ A;  4I76 A;  3PO2 J;  2LTP A;  1E3O C;  2AHQ A;  1MNM C;  1X2N A;  3ZQF A;  5FLM J;  5EGO A;  2NVX J;  1IDZ A;  1JKQ C;  5EGO B;  3HOX J;  2EZK A;  1D5Y A;  3FKI J;  2WB1 N;  3IH3 A;  2X48 A;  4LOC A;  2O8K A;  3B6A A;  3S14 J;  3LSJ A;  3FIS A;  4CYC A;  4RBO A;  4CYC B;  5E3L A;  2JA6 J;  3S1Q J;  2LP0 A;  2DJN A;  2CQQ A;  1GDT A;  1LE8 A;  3GTK J;  1LE8 B;  2LR8 A;  3BG5 A;  1JJ8 C;  2WAQ N;  1Z77 A;  2TRT A;  9ANT A;  2O7O A;  3C2B A;  1GT0 C;  2VKE A;  2LFB A;  2MGQ A;  3TW6 A;  3JR9 A;  4XRM A;  2K9S A;  2OPT A;  4W1U A;  5IP7 J;  5K7F A;  4IHX A;  1GVD A;  3PO3 J;  3TED A;  1FTZ A;  4XIC A;  1CQT A;  4Y52 J;  5FKL A;  1T33 A;  1ETV A;  3H0G J;  3WHC A;  1FJL A;  5F1J A;  1ZR2 A;  2DA5 A;  4X6A J;  3S1R J;  2ID6 A;  3GBG A;  2N8G A;  1BA5 A;  2YUS A;  2NOG A;  4L5E A;  1IV6 A;  4M3G A;  1RET A;  2L7Z A;  3BTL A;  2CU7 A;  1JUP A;  4AC0 A;  3B6C A;  1EF4 A;  2NVQ J;  2M8G X;  1WPK A;  3BQZ A;  5M5X J;  4A3E J;  1TWA J;  1MSE C;  1W0T A;  1F36 A;  1U9O A;  4UUT A;  5J1U A;  1A5J A;  3S1M J;  2G0E A;  4RDU A;  2W48 A;  4NDL A;  2DA4 A;  1AHD P;  1JKR C;  4S0H B;  1H88 C;  5E3O A;  5GP9 A;  3BTI A;  5F27 A;  3BR5 A;  2K40 A;  2XPU A;  1MBJ A;  2EH3 A;  1SFO J;  3GTJ J;  1JJ6 C;  2E19 A;  4IEJ A;  4IHY A;  3GTO J;  1Z0X A;  2NVY J;  1SAN A;  3HOZ J;  1I6H J;  2DA2 A;  3JRI A;  2YU9 J;  4B1R A;  3JRG A;  1Y1V J;  3CMY A;  2HOT A;  3JRE A;  2E2H J;  1IRZ A;  4HNV A;  1AU7 A;  2EZH A;  3SDG A;  5EF6 A;  3SJM A;  4A3I J;  3GTP J;  4FCY A;  5J3L A;  2H8R A;  2R0Q C;  5E3M A;  3W6V A;  3PM1 A;  2VKV A;  4M3F A;  5C3E J;  2ECB A;  4XRS A;  4BBR J;  2L9R A;  5DS9 A;  4A69 C;  2LLK A;  2Y30 A;  5EYR A;  3HM5 A;  1XG1 A;  2R5Y A;  3FK7 A;  2R5Y B;  5M3M J;  3FK6 A;  2FJ1 A;  4JYK A;  5EZH A;  2XPW A;  1ZQ3 P;  1UHS A;  1YRN A;  5EDN A;  1YRN B;  3I4M J;  4M6V A;  3IH2 A;  1LFU P;  2IEK A;  4V2G A;  4JX6 A;  1UMQ A;  1WH5 A;  1Y1W J;  4I6Z A;  5IYD J;  3BT9 A;  2XPV A;  1RES A;  3BR2 A;  3K2A A;  5K7Z A;  5FLV A;  1IGN A;  2R93 J;  2DMU A;  1HCR A;  2NVT J;  3ZQG A;  4C3I J;  3BTJ A;  2R5Z A;  2R5Z B;  4FE4 A;  1DU0 A;  2HDD A;  3LOC A;  1I3Q J;  1MBG A;  1HDD C;  2VPR A;  2DA6 A;  2EBI A;  3ZQC A;  2DA3 A;  5FKO A;  1ETO A;  1ORK A;  3BR0 A;  1TWF J;  1ZTR A;  2M34 A;  2P81 A;  4A3K J;  3NAU A;  4JX5 A;  3TP0 A;  2HOA A;  3DCF A;  1MH3 A;  4QIW N;  5JLW A;  1NK3 P;  5FKK A;  5M3F J;  2XGE A;  1IG7 A;  3RQI A;  3ZQH A;  1U78 A;  1QRY A;  3S2D J;  1G2H A;  4XRS G;  4M3E A;  4D5F A;  3H3V K;  2WV1 A;  1JUS A;  1ENH A;  4DW6 A;  1FIA A;  1RR7 A;  5F0F A;  5F0H A;  3D1N I;  2PMZ N;  2L7M P;  5M5W J;  1BL0 A;  2JMW A;  1MH4 A;  3E7L A;  4BKX A;  1FIP A;  4DYR A;  1MBH A;  3HOV J;  1R9T J;  4A93 J;  5IYB J;  4MIM A;  3HOU J;  3JRH A;  3S17 J;  3UKG A;  1JT0 A;  2LK2 A;  3ZQI A;  3NAR A;  3LSR A;  2QCO A;  1RKT A;  4UUS A;  1BJZ A;  5GPC A;  2EZI A;  3OSG A;  1PUF A;  4M3B A;  2RAE A;  4BY1 J;  5HOD A;  2Y9Z A;  1PUF B;  3BTC A;  2JN6 A;  1HOM A;  4D7N A;  1NK2 P;  3IH4 A;  2MSY A;  2HYJ A;  3HGY A;  4V2F A;  1WGX A;  3QQA A;  4DZP A;  1U8B A;  4FIS A;  1IUF A;  1JGG A;  2GLO A;  2FQ4 A;  1LFB A;  1ZKG A;  1HF0 A;  1S7E A;  4AUX A;  5EG0 A;  2DMQ A;  3JRC A;  4JP0 A;  5IPA A;  4A3J J;  2GBY A;  2ID3 A;  2M9H A;  1MBK A;  2L7F P;  1APL C;  5IOY A;  1FTT A;  1GUU A;  1WCM J;  1VND A;  3CQZ J;  3K7A J;  3WHB A;  4IHW A;  2ZB9 A;  5E3N A;  3HDD A;  1I50 J;  2M2E A;  1X2M A;  1T56 A;  3OIO A;  1ETQ A;  3LSP A;  1WH7 A;  2R7Z J;  1ETX A;  1FEX A;  2QF7 A;  4G12 A;  2Y31 A;  4QSH A;  1POG A;  1XC5 A;  2XGC A;  3O8H A;  1AKH A;  2DTZ A;  1AKH B;  5EEA A;  3BQY A;  5IP6 A;  3RZD J;  2CUE A;  3HB9 A;  4DZJ A;  4BXX J;  3CCY A;  3F0C A;  1O4X A;  2DN0 A;  2KDZ A;  1ITY A;  3RZO J;  1MBE A;  1BW6 A;  4GFB A;  4IHV A;  1NTC A;  5K7H A;  1A6I A;  2ME6 A;  4Y7N J;  2XRL A;  2HI3 A;  3MVP A;  4BY7 J;  1XS9 A;  2ECC A;  4DYQ A;  5IYC J;  4AYB N;  3BG3 A;  1GV2 A;  2KT0 A;  3TP3 A;  3GTL J;  1OCP A;  3GTG J;  2JWT A;  1IC8 A;  2DA7 A;  3QPL A;  3HOY J;  1OCT C;  2EQR A;  2MW8 A;  1ZK8 A;  2DMP A;  1RPW A;  3Q0W A;  1VF9 A;  2I10 A;  5FKM A;  1TC3 C;  3TW7 A;  2CQX A;  2OF7 A;  3BR1 A;  2MG4 A;  3CDL A;  3SFI A;  2ELK A;  4MFE A;  2XSD C;  3IV5 A;  1W0U A;  4A3L J;  1H8A C;  2E1O A;  1ZR4 A;  1TWC J;  1JT6 A;  4JX4 A;  2DMN A;  2HXI A;  2NS7 A;  4A3B J;  1QPI A;  2CJJ A;  3DEW A;  2X9D A;  1WI3 A;  5C4X J;  5BNG A;  5C44 J;  4J19 A;  3S2H J;  1IJW C;  3JRB A;  2TCT A;  5M5Y J;  1VFC A;  4B3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...