1HLVA

Crystal structure of cenp-b(1-129) complexed with the cenp-b box dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
131
structure length
131
Chain Sequence
MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASNGWLDRFRRRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CENP-B BOX DNA
publication title Crystal structure of the CENP-B protein-DNA complex: the DNA-binding domains of CENP-B induce kinks in the CENP-B box DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 40
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2000-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04218 CENP-B_N CENP-B N-terminal DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1hlvA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1hlvA01
3JRDA 5IP7J 2Y9YA 3GTGJ 3PO3J 4FTHA 1ORKA 1QRYA 4JYKA 1XG1A 3BR2A 2E2IJ 2NVTJ 3WHBA 5F27A 3HOYJ 3S2DJ 2M8GX 3LOCA 5IYCJ 5IYBJ 3M4OJ 3TEDA 2HXIA 1VI0A 2DMQA 2XB0X 5EG0B 1TWAJ 2HOAA 4DYRA 1B72B 1ITYA 1JUPA 2Y9ZA 5FKNA 2LP0A 3O8HA 2H1KA 3S14J 1Z77A 2DN0A 4G12A 1AKHA 3RQIA 5C4JJ 2MG4A 3GTLJ 1EF4A 5IP9J 1BL0A 3BT9A 3IH2A 2CQQA 3Q0UA 2XB5A 3HGYA 2LKXA 4A3KJ 2DMUA 2FQ4A 2XRLA 4A3DJ 5IOZA 2JA8J 1MBEA 3IH4A 4D7MA 3CMYA 2HOSA 1APLC 2R0QC 2ELKA 2DA6A 5FLVA 3OSGA 1GVDA 4C3JJ 1BW6A 1G2HA 3H3VK 1HF0A 3O8GA 2GLOA 2VUMJ 3ZQLA 1U9NA 4FCYA 2B63J 2EZLA 1JTXA 4BY1J 3B6AA 2GBYA 5GPCA 4AC0A 1B72A 3QQAA 4XRSG 2TRTA 1POGA 2KDZA 1ZK8A 3E7LA 2LFBA 5J3LA 4DW6A 4JX6A 1ETWA 2CQXA 2DA2A 5FKMA 2COBA 4LOCA 1HDDC 3LSRA 1WI3A 5BNGA 1ETVA 4UUSB 4XRMA 2OF7A 2TCTA 4NDLA 1ZGWA 1AHDP 3S17J 2AHQA 3BR1A 3TW6A 3BQYA 3S2HJ 4X1EA 4M3EA 3HOVJ 3FIWA 4MFDA 5IYDJ 1ETOA 4A3IJ 4IHWA 3JRAA 1IV6A 2HXOA 5C3EJ 4BBSJ 2DA1A 3BTCA 4BXXJ 1TWFJ 1MBKA 2DMTA 3JRBA 1MNMC 2ME0A 1ETYA 1X58A 3S1RJ 1P7JA 5M5XJ 3H0GJ 1XC5A 9ANTA 1VFCA 2D5VA 1MH3A 3NAUA 2NOGA 3JREA 1GDTA 3D1NI 2E2HJ 3WHCA 3PM1A 1WH5A 1K61A 4BBRJ 3BR0A 1QVUA 1T33A 1JT6A 2RAEA 3A03A 1Z0XA 4J19A 1WGXA 3FK7A 4M6VA 2K40A 5DS9A 1Y1VJ 3ZOBA 2CUFA 4RBOA 3HOWJ 1JJ6C 2CRGA 3OSFA 4IHXA 1JT0A 1JGGA 2OPTA 3FKIJ 3S1MJ 2E2JJ 5M5YJ 2XPUA 2R92J 3HBLA 2XPVA 1WPKA 3JRHA 4DZJA 3TW7A 3JRGA 3G1MA 1SFOJ 1O4XA 4FISA 1LFUP 5FKKA 2PMZN 2JA7J 1JTYA 5EEAA 2EBIA 4XK4A 4AUXA 5EYRA 5K7ZA 3BTIA 2G0EA 2QCOA 3SJMA 1K83J 3Q0VA 4DYCA 2LR8A 5EDNA 2XSDC 1YRNB 2JJ7A 2MSYA 5F0CA 1X2NA 2FJ1A 3QPLA 3NARA 4ABZA 2MGQA 3HM5A 2NVQJ 2EZIA 4UUTA 1XS9A 1TWGJ 2L7FP 4I6ZA 1MSFC 3B6CA 2DJNA 3I4NJ 4Y7NJ 1DU6A 1IDYA 1VF9A 1JKQC 1JKOC 3HOXJ 1UHSA 4A3MJ 1F36A 2CU7A 3F0CA 1IUFA 1IDZA 2N8GA 3DCFA 5EGOB 3FISA 1Y1WJ 5F08A 1HDPA 3ZQCA 1S7EA 3RZOJ 2VKEA 1WH7A 3BG9A 2Y2ZA 1P7IA 2DTZA 3CDLA 1OJLA 3LSJA 3OIOA 2P81A 5M3MJ 4HNVA 1LE8B 3LNQA 5EG0A 2M34A 3JRIA 2L0KA 3RKQA 5K7HA 3LSGA 1IC8A 2I10A 1HLVA 1YRNA 4A3CJ 1JUSA 3K2AA 4D7NA 2O8KA 2HDDA 5GP9A 2K9NA 2WV1A 2JA5J 5IOYA 3M3YJ 4JX5A 4A3FJ 2IAIA 3GTOJ 1ETQA 3CQZJ 3CCYA 2HYJA 5E3OA 4B4CA 2XGEA 2AO9A 3GBGA 2JWTA 2EH3A 1PUFB 3Q0WA 1RPWA 3BTJA 5E3NA 3HEFA 4D5CA 2YU9J 2DA4A 3A02A 4M3BA 1LE8A 1BA5A 4IHYA 3L1PA 1GV5A 2DA3A 2YUSA 4B1RA 2NVXJ 2R93J 1A6IA 1IJWC 5E3LA 1MBGA 1IRZA 3JRFA 2HQ5A 3VPRA 1UMQA 4A3BJ 3HOZJ 4X6AJ 1ZTRA 1UG2A 1W0TA 2R5ZB 4UUSA 1TWCJ 4V2GA 5M5WJ 1H88C 2HI3A 2LY9A 4MIMA 2O7OA 2LD5A 2L7ZA 1H89C 3ZQIA 2ZB9A 5C44J 4XRSA 1FEXA 3A01B 5F04A 4EEFG 3BR3A 2X9DA 4M3FA 4RDUA 4DZPA 1PUFA 5FKOA 5JLXA 3PO2J 2XGDA 3I4MJ 4W1UA 1FJLA 4CYCB 4IEJA 1WCMJ 5J1UA 5EZHA 3HKZN 1BJZA 2M2EA 4W97A 4A3LJ 2JA6J 2ME6A 1I3QJ 2DMPA 2E1OA 2E19A 4JX4A 1B8IB 3HDDA 4QTRA 3BG3A 1H8AC 3TP3A 3MVPA 2R5ZA 1U78A 1T56A 3GTMJ 2R5YB 1AKHB 4XIDA 5M3FJ 5K7FA 2CUEA 4D5FA 2O9LA 1ENHA 3GTKJ 1QVTA 3K7AJ 2L7MP 4XICA 5IP6A 1JKPC 5IPAA 2R7ZJ 2LVSA 2WAQN 1FIAA 2Y31A 1X2MA 1HOMA 4CYCA 3BR6A 4C2MJ 1NTCA 3ZQHA 4A3JJ 1IGNA 1RKTA 3OOUA 1RETA 1GT0C 2M0CA 2LTPA 2EQRA 1CQTA 2W48A 1JUMA 1A5JA 1B8IA 2JMWA 5F0FA 3GTPJ 3G1LA 1R9TJ 1D5YA 5J1YA 5E3MA 1ETKA 1ZKGA 2VPRA 4MLOA 4QSHA 5EF6A 4A69C 3BR5A 3G1OA 3TP0A 3ZQFA 2R5YA 4L5EA 1FTZA 1TC3C 2H8RA 1ZQ3P 5C4XJ 1AU7A 1FTTA 2GM4A 1TWHJ 1Q1VA 4A3GJ 1OCPA 3IH3A 1HCRA 2X6OA 1IG7A 1W0UA 1ETXA 3IV5A 3FK6A 3BG5A 1VNDA 3S1NJ 4V2FA 1ZR2A 2NVYJ 3LSPA 1U8BA 4MFEA 2Y30A 2JN6A 4BY7J 2FX0A 2QF7A 1JJ8C 3JRCA 1SANA 2ID3A 2YS9A 1I50J 1MBHA 2FD5A 1NK3P 2ECCA 5EGOA 1ZR4A 4MO7A 2LK2A 1DU0A 2ECBA 4FE7A 3W6VA 3MN2A 2LLKA 2NS8A 2XPWA 2MW8A 4M3DA 3MKLA 2WB1N 2CJJA 2Y0SN 3HGGA 1OCTC 4A93J 3S1QJ 4C3HJ 2ID6A 1I6HJ 1E3OC 2L9RA 2EZKA 3QPSA 5F1JA 2KT0A 4C3IJ 2IEKA 4IHVA 2NS7A 4Y52J 2IBDA 4FE4A 3JR9A 1RR7A 2DA7A 3BTLA 3SFIA 2HOTA 2X48A 1RKWA 5FLMJ 2VKVA 1MSEC 4GFBA 5F0HA 2DA5A 4JP0A 3S15J 4QIWN 1GV2A 5EZGA 5JLWA 3ZQGA 1NK2P 1F43A 3UKGA 4M3GA 2DMNA 1LFBA 1FIPA 2K9QA 3C2BA 3GTQJ 4BKXA 2JK3A 5FJ8J 1RESA 1JKRC 4DYQA 5HODA 4B3AA 2VI6A 3HOUJ 5GPAA 1OFCX 4S0HB 4A3EJ 4I76A 3DEWA 4AYBN 5FKLA 1MH4A 2M9HA 2XGCA 1QPIA 3SDGA 2EZHA 3BQZA 1MBFA 1U9OA 5J1RA 2K9SA 3HB9A 3S16J 5DTDA 3GTJJ 1GUUA 1BW5A 3A01A 1MBJA 3RZDJ 3Q3SA
chains in the Genus database with same CATH superfamily
4HEA2 3GTGJ 1XSVA 4FTHA 3PQKA 3JSOA 2VBWA 2YX4A 3KLNA 4EGYA 3WTUC 4LB5A 4FHTA 2NVTJ 2Q0OA 1WRJA 5F27A 3HOYJ 4OOIA 3B02A 3S3MA 5KCMA 3S2DJ 3WU0A 1KONA 5IYCJ 1OCCH 5IYBJ 4CCJA 1F5TA 1VI0A 2DMQA 3R60A 1D3YA 1RUNA 1D8KA 4RGSA 5EG0B 4RB3C 3HZJA 2XAJA 2MH9A 3SZTA 5DCMA 3TO7A 2LP0A 2PMUA 4HV5A 2E1NA 2H1KA 3S14J 3RQIA 1BL0A 1D0XA 3IH2A 4HOBA 2CQQA 4E7SA 3HGYA 1YJWI 2LKXA 1IN7A 1SD7A 3AG4H 2XRLA 1WJDA 5HDNA 5IOZA 3I55I 4RB0A 1QBJA 2KRCA 1A31A 4A3DJ 2YPRA 4D7MA 2XHKA 5D4SA 1APLC 3O6BB 4MHGA 3ZMZA 2R0QC 3SQNA 3DKXA 2GQQA 2DA6A 1QA6A 1IN4A 1OYWA 1G2HA 2JPCA 2PEXA 1UB9A 3MWMA 2GLOA 2VC1A 2VUMJ 2ETHA 3ZQLA 1T0FA 2DO7A 4G6QA 2EZLA 5HVQC 3B6AA 2XKPA 2DQRA 3OYLA 1X1CA 1XPXA 1PYVA 2AQEA 5CLSA 3T0YA 2KDZA 4BUPA 2BOLA 4RAGA 5K5QA 4KICA 4G94A 2CQXA 1P4WA 3LSTA 3DEEA 1KU7A 1I3AA 3LSRA 1WI3A 1H9TA 2OQRA 2E1MB 3MZHA 4E7IA 4IOAF 2BXYA 2OF7A 3GZ5A 3CLOA 1JXSA 3TW6A 3CLQA 2VJIA 3TL4X 5E1XA 3BQYA 3IWFA 3OYDA 2W1OA 1XD7A 3H0DA 4M3EA 4A5MA 3HOVJ 3FIWA 5ICFA 3FXQA 2JSPA 4A3IJ 3ABLH 3ECHA 3FKJA 3K70C 1SVMA 1SEUA 3VDXA 1N25A 5DCFA 3RPUD 1U6GA 5C3EJ 4BBSJ 1R5GA 4ZC3A 5LBQA 4IL6C 2VE8A 3JRBA 3D5RC 1MNMC 2PMZA 3K4LA 2DDAA 1Z6TA 4BEHA 2YR2A 4Y4RA 5M5XJ 2Z99A 4AIHA 2M7BA 2DFHA 1IN8A 3DKYA 3DPTA 5E20A 4GDFA 3CO7C 5HNFA 4XKVA 2ZXIA 1S8NA 2R7SA 4PCQA 1PJRA 2UZKA 1GDTA 1BR1A 3PM1A 1K61A 4BBRJ 1D8JA 3BR0A 4S04A 1SVOA 2XROA 2RREA 1HKSA 3OS0A 3FZVA 1VQ4I 4J19A 5HNHA 1Y1VJ 4RBOA 4P9FA 2LF7A 1WJCA 2QWWA 4BH9A 2L9SA 5ILVA 5D5VB 4IHXA 1P6RA 3VEPA 3WG7H 2A3SA 4BHCA 3DP7A 3FKIJ 1Z3XA 2E2JJ 4KIBA 2VQGA 4ZZLA 5M5YJ 5B1AH 1E3PA 2R92J 4QPOA 5HDGA 3V4GA 3HBLA 2LG4A 2JRTA 1MGTA 2XPVA 4IHTA 5J40A 4DZJA 3CUQA 3JRGA 2R7OA 2QBYA 2XAGA 2M87A 2KJBA 4JQFA 4XM3A 2HWVA 5LGUA 5FKKA 1ZG5A 1FBUA 3DTKA 4UB8C 2LBFB 2JA7J 3F23A 1ZN2A 3DEUA 3FXRA 4X0GA 2P5LC 2CUJA 5H20A 3V7CA 1N77A 2OCEA 2UWMA 2OTJI 2HEOA 3OS2A 2VXDA 1AA7A 4DYCA 3M07A 4E7JA 4MEYF 2JJ7A 3F21A 3VOEA 3V8JA 1MNEA 1X2NA 2EV6A 4UUTA 3SZGA 4AIJA 1MSFC 3LL7A 4KMUX 2EINH 4CZZA 4A3MJ 2CU7A 2IXSA 2KMUA 3H9QA 2HZDA 2DT7B 3FISA 2K27A 1BI3A 2QGUA 1MZBA 2DFFA 3FXLA 2VKEA 3OS1A 3ABKH 1T95A 1P7IA 2DTZA 1OJLA 1V3FA 3KP2A 1TW2A 3BOQA 5K5OA 2DU9A 1RC9A 4CCMA 3JRIA 2L0KA 4IRGA 2I10A 1YRNA 1U8RA 4ETSA 2DPUA 4N0BA 1UCRA 2K9NA 2WV1A 2MC4A 1IRXA 2JA5J 3ABTA 5IOYA 5D6FA 4IO9F 2XC7A 1GHCA 4A3FJ 2IAIA 2JVHA 2L9VA 1JI8A 5D5XB 2GAUA 2PJRA 4P1WA 1BIBA 3HKZA 2LKPA 4HF0A 5E3OA 2E60A 5E79C 1CGPA 4KJZA 1IN5A 1HSTA 2EH3A 4KFCA 3FXMA 3T8RA 2OQGA 1TQPA 2DA4A 4Q48A 4B8XA 2DT6A 3KZYA 3I5UA 4BS9A 1WHUA 5D5WB 3L1PA 4U7BA 4ZJZA 4B1RA 5E3LA 1MBGA 2KZGA 3H5AA 3JRFA 2HQ5A 2I5UA 2LNBA 4X6AJ 4A3BJ 1BC7C 1WZ2A 3PFIA 1MDMB 3K6GA 3GEZA 4PDKA 2BY0A 4UUSA 4LK1F 1TWCJ 1U5TB 2WAQA 5M5WJ 2HI3A 1Y56A 2LY9A 1DDNA 2HTSA 3HC7A 4BDYA 2LD5A 2MFZA 2L7ZA 3I9V2 2EFQA 3BJ6A 2A05A 3ZQIA 4IF4A 5GADJ 4Q4ZF 1W5CC 1IN6A 1SFKA 2YU3A 2ACJA 4G8XA 1M1EB 3TDUC 5FKOA 4BE1A 1DP3A 2KRHA 2RNJA 2XGDA 1P4XA 3CZ6A 4HW0A 5D4RA 4W1UA 3L00A 1ZYRF 2PN6A 2PX9A 4Y33A 4HLXA 4LMYA 3L7WA 2JUCA 2ME6A 2F5EA 1K6OA 4L9NA 1FMVA 4JX4A 3ZMTA 2OCCH 3HDDA 4BDZA 1ZGJA 2HVRA 5FROA 1X1BA 2WAFA 2CW0F 2IGOA 3LSIA 3Q5FA 1XDSA 2D1VA 3I56I 3BG3A 1ACIA 3OYHA 3CD6I 2ISZA 3W6KB 4E7KA 1PVEA 2FMLA 4A0YA 3GTMJ 2GA1A 4GYIA 4XIDA 4H4KC 4L18B 2FE3A 4HNUA 3BZKA 4MNUA 5M3FJ 3DF8A 3HPGA 2W57A 4M74A 1BC8C 2O9LA 3GTKJ 3GXOA 2H6CA 3CO6C 5HLIA 3W2WA 1VQOI 4PSXA 2CWEA 4CH7A 3KEQA 2R7VA 1X2MA 4I01A 2KISA 3BR6A 1E2XA 1NTCA 3PFYA 4NQWB 3REOA 3ZQHA 3ZQ7A 5E8IA 4C2MJ 4Y13A 3RI4A 2STWA 3S93A 2LTPA 1D1AA 2EQRA 2W48A 2IVMA 1X3UA 3OR1C 2XAQA 2GXAA 2L7KA 3CMMA 3V42A 1D5YA 4XBFA 4RAFA 4EJVA 1ZKGA 3J80Z 3GLXA 4ZDPA 3CCUI 2X6WA 4A69C 1QPMA 4M9ZA 1X4OA 1R1TA 3G1OA 3TP0A 2EPFA 2GXBA 2FMYA 2DOEA 2X51A 1J7KA 2P6TA 1ZQ3P 2VOPA 2EWNA 1U0JA 1AU7A 2DOFA 1TWHJ 3RKWA 5CVJA 1K4TA 2GM4A 3IH3A 4C9YA 5L3GA 1IG7A 2EV5A 4NBQA 3BG5A 4BGDA 2X4HA 4XORA 2B9SA 2PI0A 4C2TA 1LDJA 4V2FA 2BW3B 5B3SH 1OR7A 2X85A 3H3ZA 3LSPA 5CPRB 3GFMA 2XUBA 2Y30A 1VQKI 2BGCA 2JN6A 4EVIA 2WC2A 4GO1A 1SANA 2ID3A 3NEUA 2YS9A 2F48A 3GF2A 5ILSA 1I50J 4A6EA 5DM7F 1H0MA 2LKSA 2EFOA 1FP1D 2Z1DA 1IF1A 2ESHA 3GZNB 5LHIA 3MN2A 3W2AA 2V6CA 3L9FA 3FBIB 2XPWA 3I59A 4AYBA 5D6EA 4M3DA 2MBFA 3K4MA 4U87A 3HUGB 4BE2A 2WB1N 1I39A 1OCTC 3F6OA 3SZPA 2BBYA 5IT9Z 2P5KA 3L09A 4C3HJ 1HW2A 3TOBA 4R79A 3CC2I 2Z33A 1V5FA 4J01A 3OR2C 4C3IJ 2IEKA 2NS7A 4PFOA 3K4KA 3SFIA 4QLCU 1FLIA 1VQLI 2QQAA 1TNTA 1HKTA 2P6SA 2VKVA 2F5FA 1JHFA 1FBQA 3IHUA 2NXNB 1ZREA 2DW4A 2DA5A 1X3WB 2K3FA 2UV1A 2DK8A 2OZUA 3VSKA 4Z6YA 3K1PA 3ZN1A 1GV2A 3EUHC 2V1UA 5EZGA 2CS3A 3N05A 3UKGA 1X1PA 3FXUA 3DBRB 1LFBA 2HNHA 4UVCA 3H9JA 4GCVA 3TO6A 3KP4A 3U1KA 3SFZA 3SEZA 3RKYA 5FJ8J 1RESA 2EV0A 1JKRC 4DYQA 1KYZA 1OISA 1MJAA 2ADUA 4P55A 4B3AA 4H0EA 1T8IA 1N75A 1X1AA 3FF5A 3KIOA 3UR3C 1OFCX 1XX5A 4RB2C 1D5VA 4PJ0C 4A3EJ 2LMDA 3F8MA 4OU0A 4JOMA 4DBQA 2QQBA 3RKXA 2M9HA 3G2BA 5KAIC 3CJQB 2AXTC 1QPIA 5CKTA 2VBYA 2EZHA 1J59A 1SD5A 2WBMA 1X19A 3KP7A 5DTDA 3PUFA 1I5ZA 1YYVA 2LREA 3K9TA 5ICGA 3LA3A 1MBJA 3RZDJ 3Q3SA 2V9VA 4FETA 2HVQA 2CMPA 4ZDLA 3AL0C 1WJ5A 2ZNZA 2AQFA 2JQ7A 3FMQA 3OYBA 3V7SA 4EQQA 5FLXZ 2HZTA 3WHBA 2G7UA 2KRFA 2P8TA 3KX2A 2KJCA 2M8GX 2VBZA 3W2VA 2MLGA 4O5VA 2ZXHA 1R1VA 1DQUA 4LLNA 1HQCA 5DM6F 3DLLF 4B3XA 4DYRA 1ITYA 2XIGA 3BWGA 1JUPA 2XVCA 4YRVA 3L2WA 4XN3A 4NC8A 2L3DA 5IT3A 2Y9ZA 4D9JA 3TDZC 5DD8A 3GTLJ 2MG4A 3LWFA 2KPMA 2JTVA 2XAFA 1D1BA 5ICEA 5BPIA 1WJFA 3VYSB 3OYKA 4A3KJ 1HSJA 2DMUA 2EFNA 3J80K 1YI2I 2W85A 3G3ZA 1G3WA 1MBEA 1YX3A 3HHGA 5GAHJ 4NB5A 3BPVA 1A36A 4IOCF 2HOSA 1J9IA 2UUZA 3C2HA 4XLEA 2V6EA 1KA8A 3RJPA 2ZFUA 2IGNA 2R7XA 2O03A 4OIQF 4EJUA 4IJAA 1HF0A 2VC0A 4CCOA 5HLTA 2M45A 1U9NA 4FCYA 1DGRM 3K1NA 3VYTB 5KVRA 1H9GA 2VJJA 4IRIA 2VQCA 4HV6A 2MLKA 3I53A 1O7LA 3AL0B 2JT1A 3OL3A 2LFBA 5J3LA 4FX0A 4DW6A 2RKHA 1CF7A 2E5ZA 2IA0A 1PP8F 4N9IA 1HDDC 1K4SA 2HDCA 4PZJA 4RAYA 3VFZA 2ELHA 1KYWA 4F91B 1ZLJA 1V55H 3S17J 2O0YA 2TCTA 1AHDP 2AHQA 4AIKA 2CV1A 4ZYDA 5KK1A 2X1CA 1OQYA 3BJOA 3M8EA 1DGWY 5IT9K 1V5EA 4IHWA 3JRAA 2WTEA 4AU7A 1S29A 3CUOA 3GO5A 1EH7A 1XGOA 4BXXJ 2RV8A 1MBKA 4YFNF 2H09A 4XN0A 4OAYA 2WADA 1QNTA 2LYCA 1FOYA 1X58A 4M9XA 1HA8A 1P7JA 4II2A 5ILUA 3H0GJ 3AFHA 3PUBA 2WY8Q 1VFCA 4G6TB 3OOPA 4FX4A 1UAAA 3E0JB 3NAUA 3JREA 2GWRA 4C30A 1HBXG 3QYBA 2VJ5A 3D1NI 3WHCA 3TMOA 1QVUA 3DV8A 3ZR8X 4M71A 4HLYA 2EIKH 1VQ6I 3FK7A 4M6VA 2VODA 2KP6A 1J5YA 5J4VA 1J75A 2V1DA 1J09A 1R58A 5KHDA 2CRGA 3ZN0A 3PNYA 3O2PE 1HW1A 2F5CA 2XPUA 4CXFA 2PG4A 4L9JA 3ASOH 4LIVA 3ROUA 1YX5A 4OWRB 2CFXA 2HOEA 3NWSA 4XKWA 3JRHA 2R7WA 2WY7Q 3G1MA 2H1LA 3A0BC 4I02A 4BJTA 1D0ZA 1XTAA 2E1MC 3H3UA 1O4XA 2BV6A 2DFIA 2DODA 1G3TA 1MD0A 2EBIA 2IGKA 3ZMVA 1KU3A 3BTIA 2G0EA 4Q47A 4HSTA 2QCOA 2Y0MA 2IJLA 3SJMA 5FLXK 4LG0A 3DBHB 1I6XA 2FJ1A 3QPLA 2EB7A 2NNNA 1V4RA 3NARA 1ULYA 4NHJA 2FBHA 4I6ZA 1HC8A 1O3SA 2HKOA 3B6CA 1B6AA 2DJNA 2NYXA 1FOXA 1X3ZB 1YHQI 4CUGA 2R7UA 1F36A 2ZJPF 2Q1ZB 4ASNA 1IUFA 1YLFA 2WB1A 1YJNI 2H27A 3WODF 4A0XA 2FEZA 1K79A 5B5EC 4L0ZB 1HDPA 2M0MA 1S7AA 1XN7A 1S7EA 2QVOA 3BC8A 5DEQA 1Y0UA 3OIOA 2LBFA 1ZRCA 2P81A 5M3MJ 5D5UB 1MKMA 4EMSA 4DBRA 4HNVA 3OYIA 1LUJB 1T38A 3VWBA 2ZKZA 2UXXA 3L2UA 1BN5A 2HDWA 4Y17A 3WGIA 4E7ZA 2VJ4A 3LSGA 1IC8A 3DTEA 1ON1A 1EH6A 1SMTA 1YS7A 3K2AA 2V9KA 4D7NA 2O8KA 2HYFA 5AIQA 5EEGA 3CP8A 3M3YJ 4CHUA 4KNYA 1V5GA 1LEAA 2DOAA 3WTTC 4ZDOA 3Q9SA 2X6YA 4HX7A 3CCQI 3CQZJ 4I0BA 3IWZA 2HFHA 5ED4A 5FRNA 2KDOA 4LB6B 4HF2A 2DTRA 2HYJA 2NNYA 3WE2A 1UFMA 3ZGKA 1O7FA 4CCLA 2AS5F 1EJ9A 1IRFA 1PUFB 2VE9A 1RPWA 3BTJA 4U0VA 4PSWA 5E3NA 3HEFA 1ZLKA 4M3BA 1SAUA 3G73A 4BQQA 2BY2A 1GV5A 2DA3A 1K7AA 3K1MA 4CCKA 3W6JB 1PDNC 1XMXA 4YG2F 4IHSA 3K69A 3Q9VA 1IRZA 4B09A 1MJBA 4A6DA 2H6BA 3VODA 1W0TA 2M7AA 3F6VA 2D45A 1H88C 3I3LA 4MIMA 3KYDB 4BJ6C 3CESA 2O61A 2R4GA 3RQ4A 2OUMA 3CCSI 5CJ9A 1H89C 3WGHA 2FOKA 2P4WA 1XSXA 3QP5A 5C44J 3R4KA 1W36D 5F04A 4M3FA 2X9DA 5HS9A 5H2FC 1HXDA 5JLXA 1VQNI 3PO2J 3RSNA 1R36A 4F52A 3H5NA 4WX9A 3I4MJ 1Y6IA 4CYCB 2K9MA 1SMYF 1WCMJ 4RMNA 4HDVA 5J1UA 5EZHA 4UHTA 4A3LJ 2CQNA 4LJZF 3FBNB 3L2RA 2K7LA 3H9GA 4LK0F 2E19A 1MW7A 3RTRA 1W7PA 4QTRA 4YFXF 3D5SC 1E0EA 2I8DA 1MDMA 1NHAA 2EK5A 3M7GA 2OV7A 2F4OB 3MVPA 5DCMB 2NAZA 1T56A 1LDDA 4I09A 3MEXA 1WJBA 4KIGA 1MMNA 4RGUA 2V79A 5K7FA 1P9QC 4D5FA 1XB4A 2X6XA 4XLNF 1DPRA 1A35A 1WKMA 3HSFA 3OYGA 4HQEA 1B9NA 2F5VA 5IPAA 2QSHX 2HQRA 2R7ZJ 2Y31A 3T5XA 1W1WE 2MA3A 5FO5A 5GAEJ 3EUKL 1RETA 4CSWA 1GT0C 2M0CA 2WWYA 1FYLA 5KNLA 1JUMA 2GIVA 5LEJA 3GTPJ 3G1LA 2DK5A 5J1YA 2DAOA 2R7RA 3O3KA 4AM3A 3M9AA 2W82A 1TZLA 3I0TA 1BJAA 3BR5A 3ZQFA 5A2QZ 2NOJB 4L5EA 4KA4A 4L5IA 3E6BA 1U5TC 2QSFX 2EIMH 1FTTA 5LHHA 1FPQA 1Q1VA 2P0WA 1HCRA 4PFPA 1W0UA 4MQ9F 1VNDA 5LGNA 4HRIA 1XCVA 5CVIA 1Z21A 2NVYJ 2G7HA 4NQWA 2L5QA 2FRHA 3CP2A 1QZYA 1Z05A 2FU4A 3EETA 4XLCA 4BY7J 4IVNA 2FX0A 1DUXC 3JRCA 2M8EA 2RGVA 2R7QA 3D0SA 4A2UA 4JBAA 2FD5A 1NK3P 1RNLA 1E17A 3HTUA 5L3DA 5EGOA 1KQ9A 3F8CA 1R7JA 2MD5A 2GIZA 3EQLF 4HX4A 2L01A 1ZELA 3MFKA 2FNPA 2LLKA 2NS8A 3IRRA 4E70A 4AVPA 2IGMA 2LY2A 1MJ9A 3WTVC 3MKLA 4ZTJA 2BXZA 2Y0SN 3QPHA 5L3FA 4A93J 2W4SA 3DWLE 3P9IA 4I99C 2FXAA 1E3OC 5FFXA 3TKYA 4ENNA 5F1JA 1FYMA 2BW3A 4Y52J 1OYIA 4FE4A 4XL9A 2DA7A 3TO9A 1RUOA 2X48A 3ASNH 4P96A 4LGWA 4XKCA 5F0HA 4YELA 3ZMUA 1BR2A 4XLAA 1KU2A 1P4AA 2UXNA 3GX4X 3S15J 3GWZA 4QIWN 3DU6A 1F43A 1NK2P 3WTYC 2DMNA 1F9NA 3HG9A 1S9HA 3MZYA 4Z2YA 4OIRF 2Q8KA 2M4KA 3GTQJ 5TISC 3HUGA 4XQFA 1VTNC 2QZ8A 5DUIA 4WWCA 5HODA 4BL0B 3HOUJ 2V7FA 3K4NA 5L3EA 4F55A 5GPAA 2GZWA 3C1DA 1ZRDA 4I76A 3DEWA 3ZPLA 3LAJA 1MH4A 2KIUA 4ANJA 2KZVA 3RPQA 1K78B 4ESBA 2K3PA 1BI0A 2PJPA 1L3LA 4BHBA 3RCOA 5LRRA 2K9SA 3HB9A 4B44A 5J4YA 3HSRA 3E3VA 1L0OC 2D2WA 5DYMA 3LA7A 3A01A 3HRMA 1FZPB 3JRDA 2XKOA 5IP7J 1R5ID 2Y9YA 3PO3J 2BY3A 4BACA 4ENJA 2E2IJ 1WI9A 4QPQA 4CYDA 4L5JA 2IPQX 1A04A 4WK8F 3HOTA 1IXSB 1WVRA 1ONVA 3M4OJ 1Z67A 3SYTA 3V8KA 2HXIA 4PJJA 4WCGA 4V19K 3HRUA 5AONA 4ZZDA 2B7EA 5LEKA 2HOAA 2P5VA 2IS1A 1B72B 1TT5B 5BMZA 2EFPA 1LQ1A 2QKMB 2DN0A 3ECOA 4G12A 2KL4A 3TOAA 5C4JJ 1AKHA 3J7AO 1EF4A 4CA0A 5HLGA 3KPHA 2CO5A 4LG3A 2XB5A 1IW7F 4R1HA 3G4SI 1MMGA 2QA4I 4WXHA 3IH4A 3DKWA 2V9PA 4CDGA 5A2QK 3FXKA 3OSGA 2Z5UA 2K85A 3JSPA 2QSGX 3PIOF 2OU2A 2FOWA 3OV8A 2IA1A 2RC4A 3O8GA 1WJEA 3K70D 2FBKA 2ICWG 3K10A 4LLGF 4PGGA 2DI3A 2VOOA 3KYLA 1SVLA 3MQ0A 3EUHA 1YS6A 4FT8A 1GVJA 3KZIC 3PL8A 5BQTA 2ELJA 4XLHA 3T8TA 4XOPA 3MKZA 5CQEA 1ZK8A 4EJTA 3E7LA 2BHYA 1T08B 2E34A 4ZYGA 2ZC2A 2P7CB 2WV0A 5FKMA 4Y3OA 3I4PA 1G6NA 1K6YA 2COBA 3DU5A 4LOCA 4I98B 1FT9A 5BNGA 2DYSH 1ETVA 4UUSB 2GA2A 2ZSIB 1IO2A 2W25A 2R3SA 4XRMA 4G7HF 3IAM2 1R5HA 4HYEA 4NDLA 1QZZA 2D1HA 1R71A 4FASD 5EEHA 3PSFA 2VL8A 3KP3A 2R7TA 5E8GA 2VKDA 3E5UA 5IYDJ 2QQ9A 1ETOA 2BE5F 1YW7A 1Z9CA 3BROA 3RIRA 2F2EA 5GAGJ 2DA1A 3QYFA 1Y0NA 1TWFJ 3WGGA 2EJRA 3TQNA 2ME0A 1DP7P 3S1RJ 1WQ2A 5CYVA 2XF5A 1OMIA 1YG2A 3MKYB 2OC6A 2Z16A 2XSJC 3AG3H 1XC5A 2DFEA 9ANTA 4XONA 1R49A 1YOVB 3QU3A 3EUAA 2FA5A 3DQVC 2NOGA 1R6RA 3FHZA 1WH5A 2CYYA 2MYSA 5B1BH 5FD6A 2RAEA 1JT6A 3A03A 5E1ZB 4F3QA 1FOWA 1Z0XA 5DD4A 5HOOA 1ZRFA 1WGXA 1Y8RB 1W4MA 3TGNA 5DS9A 2BVMA 2QM3A 5H6QA 2QYOA 2V4JC 1AWCA 3J81Z 4CZCA 4N9HA 2L2OA 2YSRA 3JAMZ 1W7PD 2DT5A 4N4NB 4B43A 1WPKA 3HPHA 1VZ0A 3TW7A 3LQQA 1SFOJ 1IXCA 3LQRA 4FISA 1RR8C 1TBXA 2PMZN 3E6DA 4CGZA 4BXUA 5EEAA 1VQ8I 4AUXA 5EYRA 3ZMDA 2ZFWA 1FY7A 5K7ZA 4M6XA 5FFZA 4E7LA 1B1BA 3FXOA 2KHMA 5EDNA 2XSDC 1Z91A 4XMYA 1STZA 3E6MA 5F0CA 3S2WA 4ABZA 2CSOA 2MGQA 3HM5A 5HS8A 1TWGJ 2KIFA 1BR4A 2Q2EB 2CG4A 4B48A 2ZSHB 2L4MA 1TP4A 3U9GA 3I4NJ 3L2VA 1DU6A 1JKOC 3HOXJ 2LSOA 2BEOA 4BU2A 3CF2A 1D1CA 3F0CA 3KLOA 1TLHB 5J8FA 2L9NA 2Y0SA 4XSXF 3WTXC 3DCFA 2HPIA 1U3EM 2ZMEC 3P9KA 4ZYAA 3FM5A 2C6YA 4ENMA 3LA2A 3ZQCA 3IUOA 2Z3YA 2XAHA 5E1WA 4EV0A 3CDLA 1XGNA 3LSJA 1XMKA 3SEQA 1LE8B 3IL2A 4D0PA 5EG0A 2M34A 4AIDA 5BOXA 3CJTB 4KN7X 2XGXA 3C7JA 3RKQA 5K7HA 2VIXA 3LFKA 4A3CJ 1JUSA 2HQAA 4OMYA 5ICCA 3FDYA 4JX5A 3CMAI 3ZQQA 1J0RA 4XKBA 3GTOJ 1D0YA 2XDVA 2ZCWA 3CCMI 3WTZA 4BQOA 4KN4X 4BQAA 4EATA 4UNOA 2NVUB 4RS8A 2J5PA 2XGEA 4MTDA 4U0YA 3GBGA 3HSEA 2DXIA 2HVSA 2G9WA 2JWTA 2LH9A 3Q0WA 4D5CA 3F22A 2YU9J 3EYYA 1FMWA 1LEBA 3NQOA 4HX8A 1Y8QB 3F9KA 1WFXA 4BHPA 2YUSA 1V54H 4MQVA 1W5TA 4GYGA 1A6IA 2WAEA 5E18F 2NRAC 1O3QA 2KFDA 5TJJA 3OL4A 2ZMEB 3HOZJ 3BG6A 4CICA 4MEXF 2O8XA 1ZTRA 3GFLA 1IUYA 1UG2A 5ERIA 1HW5A 4HPQA 2R5ZB 2F6CA 4V2GA 3DTIA 5FRMA 5K5RA 2O7OA 2KKOA 3W3CA 2VBXA 3R0AA 3U1DA 1GXQA 4L9VA 3C3WA 2ZB9A 2RN7A 4EGZA 3HHHA 2PLYA 1LPQA 4EEFG 3L2QA 1Z6RA 4RDUA 4RLQA 1PUFA 2F5DA 2E7WA 4HQMA 1QQIA 4M9SA 1FJLA 4KDPA 2L54A 3HKZN 2M2EA 3K4JA 4HAMA 5L3CA 1J2XA 1P92A 3KE2A 4UVBA 5GTIC 1VQMI 2KQRA 1XSDA 2K02A 2DMPA 1B8IB 3S3NA 1MIJA 3KP6A 1EH8A 1SD4A 4IPAA 1H8AC 1BBYA 3TP3A 4UUVA 3BJAA 4BYYA 2O3FA 5HDKA 2R5YB 1ZARA 4PJLA 2Y75A 3J81K 2IS6A 2MH2A 3H92A 2CUEA 3CCVI 1ENHA 3PIPF 3K7AJ 1KGSA 3JAMK 3OIQA 4ON0A 2COMA 3I71A 3AKZA 2LVSA 2QKLB 2WAQN 1LB2A 1HOMA 4CYCA 1Z7UA 4F7ZA 3MZ8A 1YW9A 1RKTA 3DFGA 3OIPA 3A2KA 5LFAA 1CQTA 3DXJF 1XGMA 1A5JA 2MD0A 3P9CA 3WG9A 2JMWA 2M30A 2Z2SB 5E3MA 1ETKA 2VPRA 2HS5A 4JK1X 5EF6A 3F3XA 4RLFA 4EM2A 1TTYA 4RB1A 1YFHA 1TC3C 3OYAA 1R4MB 1CF7B 3ZCOA 3SXYA 4XNFA 4A3GJ 2KIQA 1OCPA 3CJNA 1IV8A 1ETXA 2K4JA 3IV5A 4CO8A 1SD6A 1MMDA 4G9YA 4G6DA 3A4CA 4LIUA 3F8FA 3KFWX 3AG1H 3KEYA 4MFEA 1U8BA 2HGCA 3A0HC 1I1SA 3EDPA 2Y48A 2QF7A 1ZH5A 2A68F 2HDDA 5J8CA 2ZJQF 4YIIA 1MBHA 2RQQA 1HKQA 3G6EI 4U0WA 2CV2A 2ECCA 4KIFA 3OY9A 3P5JA 4HG2A 3R61A 2V1NA 4XLPF 2LK2A 4FE7A 3W6VA 3ULQB 4CCNA 4ESFA 5CVUA 2MW8A 1TT0A 2HQNA 2CW8A 1FX7A 3CCRI 1YO5C 4I2OA 5CVVA 3HGGA 4J00A 2W24A 3S1QJ 2ID6A 4AD9A 1N78A 2L9RA 2A69F 1RI7A 2EZKA 3OYMA 2OD5A 1IXRC 3ABUA 4IHVA 4EM0B 3CMEI 3IP4B 3JR9A 2QLZA 5BS6A 2HOTA 2PQ8A 2LY1A 1RKWA 4OAZA 5FLMJ 1T98A 1MSEC 3RYRA 4GFBA 2VN2A 1SFXA 2JPBA 4E7HA 3E5XA 3HRSA 1UJ8A 4P9UA 5F64A 1T0FC 4JP0A 1XDUA 1RIOH 3BP8A 4KMFA 3CTAA 3KZZA 3ZQGA 3V7RA 3ZXSA 3HTSB 3J7AY 1FIPA 5HLHA 2K9QA 3C2BA 3OYFA 4LLLA 2H8WA 5JVTA 2VPLA 5HS7A 2XV4S 1T39A 2A5YB 4R8HA 2CH0A 3HYIA 1SFEA 3HRTA 1TW3A 5F1RA 1OPCA 3M1CA 4M6YA 1QGPA 4UY8I 4AYBN 1R22A 3OMYA 1BOAA 3IAS2 3LSKA 4GRIA 1FSHA 1U5TA 4LG0B 3BCAA 2XGCA 2ZJ2A 3LFUA 2DPDA 3BQZA 5D8KB 2VT3A 1W5SA 1U9OA 3FMRA 3FHNA 3WU1B 4KITB 3WTSC 1FSEA 1GUUA 1QO0D 2FF4A 3GFJA 2L02A 4XOTA 2RDPA 4HBLA 2JSCA 4L0YB 2VT2A 4A12A 1QU3A 3KCCA 3QOEA 4HA8A 4O3MA 2E35A 2K86A 4RGXA 2RNGA 4U88A 2CW7A 2MABA 1ORKA 1QRYA 2OBPA 4OIOF 4E6KG 4JYKA 1XG1A 3HOSA 3BR2A 4NC6A 1F4KA 3IKVA 1FNNA 4RM3A 2FQ3A 3LOCA 2ZJRF 2QEXI 3TEDA 2X0LA 4HDUA 3OWTA 4BQNA 4E4HA 4KISA 2XB0X 5DUKA 1G8XA 1TWAJ 1USTA 2H94A 5BPDA 1OYYA 5FKNA 4PJNA 4DJAA 3O8HA 4IQ4A 4UB6C 3K4BA 1Z77A 1K78A 5IP9J 1MMSA 4UV9A 3BT9A 3CC4I 3NWTA 3Q0UA 1T6SA 3GMEA 4DOZA 2FQ4A 3ZMSA 2A6EF 2JA8J 3CMYA 4ZTFA 4XLFA 2OTLI 1KQ8A 2IW5A 3QWLA 2ELKA 1O57A 5B66C 4D1QA 2CQ7A 2WA0A 3QODA 5H6RA 5FLVA 3DBLB 3RYPA 1GVDA 3BZCA 4C3JJ 1LDKB 1BW6A 4P5OA 2PMHA 1ODDA 2RVCA 3H1CA 3R6SA 3H3VK 4IRHA 1LVAA 1XGSA 3CUQC 5LD2C 3F72A 1A6QA 2B63J 3N4MA 1XMAA 4DGWB 1JTXA 3B73A 5GPCA 2GBYA 4BY1J 5E17F 2FNAA 3HIFA 2F4IA 4AC0A 1B72A 2XAUA 2L4AA 4LFUA 3QQAA 4DIQA 3MCZA 2TRTA 3E97A 1POGA 2DJIA 4XRSG 5DV5A 3OYNA 4FQGA 2B0LA 4JX6A 1ETWA 3E1SA 1R00A 4BEHB 5FD5A 2DA2A 4ZYHA 4A0ZA 5D8LB 5JR3A 1YW8A 2Y69H 3S3OA 4BAYA 2A07F 3DLAA 2XF7A 3H5RA 2XASA 3F8BA 3SDBA 3NRVA 5LRSA 1O3RA 1ZGWA 1FC3A 3M8FA 2EFWA 3BR1A 1DPUA 2BZTA 2LRDA 3MMYB 4ZYEA 3VB2A 3S2HJ 3X2QH 2LF8A 3UNGC 4X1EA 4IX7A 4DQ2A 4MFDA 1I1GA 3IKTA 4B47A 2ISYA 1IV6A 2HXOA 1UHMA 3WU2C 3BTCA 2J5OA 5IY5H 2HR3A 2XRNA 3GZ6A 2V1XA 2M3AA 3PNTA 2VKHA 2XF6A 3LMMA 2E7XA 5J6XA 2DMTA 3FWEA 3HL2A 3CDIA 1NH3A 1ETYA 4UVAA 3H35A 3HJEA 1W7PB 4G7OF 4ESJA 2DDBA 4WF2A 5EJCA 2IS4A 1QHGA 4XSZF 1S72I 3CUQB 2QBYB 4UV8A 4YEJA 2D5VA 1MH3A 3CJRB 4UXNA 3OYCA 2E2HJ 1VQPI 1UG0A 3ELKA 1T33A 3HXLA 1FP2A 2K4BA 4PGHA 1JE8A 1KU9A 3A1YA 3IC7A 1GXPA 3CCEI 2K40A 2HPMA 3KYCB 1EV7A 3ZOBA 2CUFA 3HOWJ 5AIPA 1JJ6C 3OSFA 2QENA 1JT0A 2VXZA 1JGGA 1IRGA 2OPTA 4OIPF 4YIRX 4IKFA 3S1MJ 2IT0A 4K2EA 3JTGA 1ON2A 4ZH4F 3CCJI 2IP2A 1KQ0A 5FGMA 3MD2A 3D5LA 2VONA 3K2ZA 2ZBKA 4F92B 3KP5A 2QQ8A 3DPLC 4N4OB 2JA2A 3U2RA 4ENKA 1YE9A 2EA2A 2HKXA 4BJ5C 4HNTA 1LFUP 3I58A 3COAC 1JTYA 4NC7A 1UELB 4XK4A 5JHUA 4S05A 4C2UA 1LKXA 1K83J 3Q0VA 1UHWA 2LR8A 1YRNB 1MNDA 4NNJA 3U21A 3L2CA 1OCOH 4KT5C 1FBSA 2MSYA 4Y15A 1S7OA 3BG7A 3JTHA 2EZIA 2NVQJ 3ISPA 2L7FP 1XS9A 3CDHA 4BXFA 4Y7NJ 1IDYA 1VF9A 1YIJI 1JKQC 4MGRA 1REPC 1UHSA 2NS0A 4RGRA 2PJRB 3WTWC 1IDZA 1R23A 2LOOA 1I27A 2JVGA 2N8GA 3R0JA 5FB2A 4KT6A 5EGOB 1Y1WJ 1WSUA 5F08A 1PUEE 2CV0A 3RZOJ 2ZO4A 2CFOA 3BG9A 1RZ4A 1WH7A 2Y2ZA 3BDDA 2P7VB 3PJRA 2E36A 4HF1A 2K9LA 4PUSA 3LNQA 1X4PA 1LVKA 2GXGA 1BIAA 3AG2H 1HLVA 1Z7LA 3VSLA 1YIOA 3K0LA 5GP9A 4WXCA 1VQ7I 3ESWB 3CF5F 4EJOA 2GOXB 5LGTA 3SHFA 2YX7A 4HSRA 2Q2EA 3V8LA 2HU9A 2FUG2 2GOMA 3ABMH 4OINF 1ETQA 2BY1A 2K5CA 4NUBA 2EIJH 3CCYA 4B4CA 2M1BA 4IXAA 2AO9A 3I54A 2ESNA 3IRQA 3FXJA 4AVZA 2E1CA 1VQ9I 5CQGA 6PAXA 3A02A 3RPUA 3G71I 3WE3A 3JCUC 1LE8A 1BA5A 4IHYA 1LJ9A 2VLAA 5F6FA 2ZXJA 4L9TA 1G59A 3DPUA 3GYHX 1UZCA 3PNVA 4XRFA 4EM1A 2NVXJ 2R93J 1VQ5I 1IJWC 3F8NA 1X1DA 3VPRA 1UMQA 1TL8A 1PP7U 1OR7C 1G4DA 2BHZA 1U2WA 3RDIA 2IRFG 4KUMA 3GW2A 2FBIA 2OA4A 1YJ9I 4PJMA 1G3SA 1OLTA 4II3A 4XRSA 1FEXA 2R7FA 1QZEA 2E71A 3A01B 3BR3A 4YFKF 4HZFA 4DZPA 3ERMA 3BY6A 3LSHA 2AXLA 1JGSA 4MTEA 4YIFA 1O3TA 2STTA 3QPTA 4IEJA 2VASA 2VB6A 1BJZA 3FX3A 4GGGA 4W97A 2JA6J 2V26A 3ZP5A 4IZZA 3BZ6A 1EA3A 1XCBA 1BI2A 1BM9A 3BPXA 1I3QJ 2E1OA 2W00A 1TQIA 3E5QA 2ZMEA 2W7NA 2LDUA 4I7HA 1TNSA 3QAHA 1ZG1A 5JFRA 2JUGA 3J7YJ 1U78A 2R5ZA 5CVRA 1ZG3A 1OKRA 1C0WA 3GUDA 1ZHFA 5GTHC 3VYUB 1AKHB 5JHFA 2JZYA 2QUFA 5DDGA 3LAPA 4RA2A 1YITI 1QVTA 2L7MP 1W36C 1YQAA 2DCEA 4DNCA 4XICA 5IP6A 3AAFA 2CGPA 1JKPC 4QWQA 1BOBA 2FSWA 2EILH 1FIAA 4OMZA 2A6TA 1IGNA 4A3JJ 2Z9OA 2RQPA 3OOUA 3J7ZI 1NG6A 4LITA 2KIMA 2MC3A 3P7NA 4O6JA 3KEOA 4GXOA 1B8IA 4M72A 5F0FA 2PBIA 1USSA 4TV7A 1R9TJ 1P2FA 1IZ1A 4MLOA 3BCBA 4QSHA 4PK4A 1B4AA 2DLLA 3LSMA 1G3YA 4F93B 1T2KA 3MAJA 2BVLA 2R5YA 4G7ZF 1FTZA 1JHHA 2H8RA 2IA2A 3I59B 2DQLA 3PQJA 2OJED 5C4XJ 1WWXA 4EJWA 2X6OA 4KYWA 2HYGD 1R4NB 1KZHA 1Y39A 3FK6A 3S1NJ 3M1EA 3JW4A 1GLNA 3E6CC 1ZR2A 3GFIA 1SAXA 3K4CA 1ZGAA 3PSIA 3I64A 2OZ6A 4IQJA 1E3HA 1OCRH 1YTYA 1JJ8C 2DBBA 3CCLI 5J47A 4I0AA 1TQMA 2ZXWH 1ZR4A 2CUZA 4MO7A 2F4MB 1DU0A 2ECBA 2X1DA 3QYEA 3C18A 3GVAA 1LNWA 1Z3YA 3H36A 1Z1DA 1QHHD 1S3JA 3FMSA 5LHGA 2CJJA 3CC7I 3KETA 3OYJA 3S8PA 2HTJA 1I6HJ 3ONQA 3QP6A 3QPSA 1S6LA 2KT0A 5JVGF 1FOKA 4WXDA 3ERED 3QRFF 2TDXA 2IBDA 2KLOA 5LLQA 2O5RA 2ZNYA 5JI6A 1RR7A 3BTLA 2X1EA 1LFPA 3GCMA 2LC2A 2CQKA 3VYRB 1WJAA 4BNCA 5TGTA 2M5WA 2A6HF 2BYVE 1Q1HA 2VQHA 3ZRGA 3M8JA 1R1UA 2O6GE 2E5NA 1NG7A 3N97A 2PFBA 3MKWB 2A61A 5JLWA 1OCZH 1B59A 1BI1A 1F1ZA 4ITVA 4M3GA 3TBIA 2JRMA 2IS2A 1ERDA 2R7DA 5L3BA 1FYKA 2M4GA 4RAZA 3EYIA 1SC7A 4BKXA 5K1YA 2DYRH 2JK3A 3C2GA 4U7DA 2EA4A 2VI6A 1EKEA 2W84A 1S5LC 4Q5SF 3S32A 2VQLA 4S0HB 3QU6A 4A5NA 5FKLA 4M73A 5KAFC 3OYEA 4LD5A 3T1BA 1ZAOA 1MMAA 3EPZA 2OAZA 3SDGA 5TRDA 4XR6A 1SFUA 1IAWA 4AWXB 4RM2A 1MBFA 3GLLA 3QOPA 3ML6A 5J1RA 3S16J 4BE0A 1B9MA 3FM3A 3GTJJ 2A5WA 1BW5A 1AOYA 3BLYA 1FWZA 1RRJA
chains in the Genus database with same CATH topology
3JRDA 5IP7J 2Y9YA 3GTGJ 3PO3J 4FTHA 1ORKA 1QRYA 4JYKA 1XG1A 3BR2A 2E2IJ 2NVTJ 3WHBA 5F27A 3HOYJ 3S2DJ 2M8GX 3LOCA 5IYCJ 5IYBJ 3M4OJ 3TEDA 2HXIA 1VI0A 2DMQA 2XB0X 5EG0B 1TWAJ 2HOAA 4DYRA 1B72B 1ITYA 1JUPA 2Y9ZA 5FKNA 2LP0A 3O8HA 2H1KA 3S14J 1Z77A 2DN0A 4G12A 1AKHA 3RQIA 5C4JJ 2MG4A 3GTLJ 1EF4A 5IP9J 1BL0A 3BT9A 3IH2A 2CQQA 3Q0UA 2XB5A 3HGYA 2LKXA 4A3KJ 2DMUA 2FQ4A 2XRLA 4A3DJ 5IOZA 2JA8J 1MBEA 3IH4A 4D7MA 3CMYA 2HOSA 1APLC 2R0QC 2ELKA 2DA6A 5FLVA 3OSGA 1GVDA 4C3JJ 1BW6A 1G2HA 3H3VK 1HF0A 3O8GA 2GLOA 2VUMJ 3ZQLA 1U9NA 4FCYA 2B63J 2EZLA 1JTXA 4BY1J 3B6AA 2GBYA 5GPCA 4AC0A 1B72A 3QQAA 4XRSG 2TRTA 1POGA 2KDZA 1ZK8A 3E7LA 2LFBA 5J3LA 4DW6A 4JX6A 1ETWA 2CQXA 2DA2A 5FKMA 2COBA 4LOCA 1HDDC 3LSRA 1WI3A 5BNGA 1ETVA 4UUSB 4XRMA 2OF7A 2TCTA 4NDLA 1ZGWA 1AHDP 3S17J 2AHQA 3BR1A 3TW6A 3BQYA 3S2HJ 4X1EA 4M3EA 3HOVJ 3FIWA 4MFDA 5IYDJ 1ETOA 4A3IJ 4IHWA 3JRAA 1IV6A 2HXOA 5C3EJ 4BBSJ 2DA1A 3BTCA 4BXXJ 1TWFJ 1MBKA 2DMTA 3JRBA 1MNMC 2ME0A 1ETYA 1X58A 3S1RJ 1P7JA 5M5XJ 3H0GJ 1XC5A 9ANTA 1VFCA 2D5VA 1MH3A 3NAUA 2NOGA 3JREA 1GDTA 3D1NI 2E2HJ 3WHCA 3PM1A 1WH5A 1K61A 4BBRJ 3BR0A 1QVUA 1T33A 1JT6A 2RAEA 3A03A 1Z0XA 4J19A 1WGXA 3FK7A 4M6VA 2K40A 5DS9A 1Y1VJ 3ZOBA 2CUFA 4RBOA 3HOWJ 1JJ6C 2CRGA 3OSFA 4IHXA 1JT0A 1JGGA 2OPTA 3FKIJ 3S1MJ 2E2JJ 5M5YJ 2XPUA 2R92J 3HBLA 2XPVA 1WPKA 3JRHA 4DZJA 3TW7A 3JRGA 3G1MA 1SFOJ 1O4XA 4FISA 1LFUP 5FKKA 2PMZN 2JA7J 1JTYA 5EEAA 2EBIA 4XK4A 4AUXA 5EYRA 5K7ZA 3BTIA 2G0EA 2QCOA 3SJMA 1K83J 3Q0VA 4DYCA 2LR8A 5EDNA 2XSDC 1YRNB 2JJ7A 2MSYA 5F0CA 1X2NA 2FJ1A 3QPLA 3NARA 4ABZA 2MGQA 3HM5A 2NVQJ 2EZIA 4UUTA 1XS9A 1TWGJ 2L7FP 4I6ZA 1MSFC 3B6CA 2DJNA 3I4NJ 4Y7NJ 1DU6A 1IDYA 1VF9A 1JKQC 1JKOC 3HOXJ 1UHSA 4A3MJ 1F36A 2CU7A 3F0CA 1IUFA 1IDZA 2N8GA 3DCFA 5EGOB 3FISA 1Y1WJ 5F08A 1HDPA 3ZQCA 1S7EA 3RZOJ 2VKEA 1WH7A 3BG9A 2Y2ZA 1P7IA 2DTZA 3CDLA 1OJLA 3LSJA 3OIOA 2P81A 5M3MJ 4HNVA 1LE8B 3LNQA 5EG0A 2M34A 3JRIA 2L0KA 3RKQA 5K7HA 3LSGA 1IC8A 2I10A 1HLVA 1YRNA 4A3CJ 1JUSA 3K2AA 4D7NA 2O8KA 2HDDA 5GP9A 2K9NA 2WV1A 2JA5J 5IOYA 3M3YJ 4JX5A 4A3FJ 2IAIA 3GTOJ 1ETQA 3CQZJ 3CCYA 2HYJA 5E3OA 4B4CA 2XGEA 2AO9A 3GBGA 2JWTA 2EH3A 1PUFB 3Q0WA 1RPWA 3BTJA 5E3NA 3HEFA 4D5CA 2YU9J 2DA4A 3A02A 4M3BA 1LE8A 1BA5A 4IHYA 3L1PA 1GV5A 2DA3A 2YUSA 4B1RA 2NVXJ 2R93J 1A6IA 1IJWC 5E3LA 1MBGA 1IRZA 3JRFA 2HQ5A 3VPRA 1UMQA 4A3BJ 3HOZJ 4X6AJ 1ZTRA 1UG2A 1W0TA 2R5ZB 4UUSA 1TWCJ 4V2GA 5M5WJ 1H88C 2HI3A 2LY9A 4MIMA 2O7OA 2LD5A 2L7ZA 1H89C 3ZQIA 2ZB9A 5C44J 4XRSA 1FEXA 3A01B 5F04A 4EEFG 3BR3A 2X9DA 4M3FA 4RDUA 4DZPA 1PUFA 5FKOA 5JLXA 3PO2J 2XGDA 3I4MJ 4W1UA 1FJLA 4CYCB 4IEJA 1WCMJ 5J1UA 5EZHA 3HKZN 1BJZA 2M2EA 4W97A 4A3LJ 2JA6J 2ME6A 1I3QJ 2DMPA 2E1OA 2E19A 4JX4A 1B8IB 3HDDA 4QTRA 3BG3A 1H8AC 3TP3A 3MVPA 2R5ZA 1U78A 1T56A 3GTMJ 2R5YB 1AKHB 4XIDA 5M3FJ 5K7FA 2CUEA 4D5FA 2O9LA 1ENHA 3GTKJ 1QVTA 3K7AJ 2L7MP 4XICA 5IP6A 1JKPC 5IPAA 2R7ZJ 2LVSA 2WAQN 1FIAA 2Y31A 1X2MA 1HOMA 4CYCA 3BR6A 4C2MJ 1NTCA 3ZQHA 4A3JJ 1IGNA 1RKTA 3OOUA 1RETA 1GT0C 2M0CA 2LTPA 2EQRA 1CQTA 2W48A 1JUMA 1A5JA 1B8IA 2JMWA 5F0FA 3GTPJ 3G1LA 1R9TJ 1D5YA 5J1YA 5E3MA 1ETKA 1ZKGA 2VPRA 4MLOA 4QSHA 5EF6A 4A69C 3BR5A 3G1OA 3TP0A 3ZQFA 2R5YA 4L5EA 1FTZA 1TC3C 2H8RA 1ZQ3P 5C4XJ 1AU7A 1FTTA 2GM4A 1TWHJ 1Q1VA 4A3GJ 1OCPA 3IH3A 1HCRA 2X6OA 1IG7A 1W0UA 1ETXA 3IV5A 3FK6A 3BG5A 1VNDA 3S1NJ 4V2FA 1ZR2A 2NVYJ 3LSPA 1U8BA 4MFEA 2Y30A 2JN6A 4BY7J 2FX0A 2QF7A 1JJ8C 3JRCA 1SANA 2ID3A 2YS9A 1I50J 1MBHA 2FD5A 1NK3P 2ECCA 5EGOA 1ZR4A 4MO7A 2LK2A 1DU0A 2ECBA 4FE7A 3W6VA 3MN2A 2LLKA 2NS8A 2XPWA 2MW8A 4M3DA 3MKLA 2WB1N 2CJJA 2Y0SN 3HGGA 1OCTC 4A93J 3S1QJ 4C3HJ 2ID6A 1I6HJ 1E3OC 2L9RA 2EZKA 3QPSA 5F1JA 2KT0A 4C3IJ 2IEKA 4IHVA 2NS7A 4Y52J 2IBDA 4FE4A 3JR9A 1RR7A 2DA7A 3BTLA 3SFIA 2HOTA 2X48A 1RKWA 5FLMJ 2VKVA 1MSEC 4GFBA 5F0HA 2DA5A 4JP0A 3S15J 4QIWN 1GV2A 5EZGA 5JLWA 3ZQGA 1NK2P 1F43A 3UKGA 4M3GA 2DMNA 1LFBA 1FIPA 2K9QA 3C2BA 3GTQJ 4BKXA 2JK3A 5FJ8J 1RESA 1JKRC 4DYQA 5HODA 4B3AA 2VI6A 3HOUJ 5GPAA 1OFCX 4S0HB 4A3EJ 4I76A 3DEWA 4AYBN 5FKLA 1MH4A 2M9HA 2XGCA 1QPIA 3SDGA 2EZHA 3BQZA 1MBFA 1U9OA 5J1RA 2K9SA 3HB9A 3S16J 5DTDA 3GTJJ 1GUUA 1BW5A 3A01A 1MBJA 3RZDJ 3Q3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRD A;  5IP7 J;  2Y9Y A;  3GTG J;  3PO3 J;  4FTH A;  1ORK A;  1QRY A;  4JYK A;  1XG1 A;  3BR2 A;  2E2I J;  2NVT J;  3WHB A;  5F27 A;  3HOY J;  3S2D J;  2M8G X;  3LOC A;  5IYC J;  5IYB J;  3M4O J;  3TED A;  2HXI A;  1VI0 A;  2DMQ A;  2XB0 X;  5EG0 B;  1TWA J;  2HOA A;  4DYR A;  1B72 B;  1ITY A;  1JUP A;  2Y9Z A;  5FKN A;  2LP0 A;  3O8H A;  2H1K A;  3S14 J;  1Z77 A;  2DN0 A;  4G12 A;  1AKH A;  3RQI A;  5C4J J;  2MG4 A;  3GTL J;  1EF4 A;  5IP9 J;  1BL0 A;  3BT9 A;  3IH2 A;  2CQQ A;  3Q0U A;  2XB5 A;  3HGY A;  2LKX A;  4A3K J;  2DMU A;  2FQ4 A;  2XRL A;  4A3D J;  5IOZ A;  2JA8 J;  1MBE A;  3IH4 A;  4D7M A;  3CMY A;  2HOS A;  1APL C;  2R0Q C;  2ELK A;  2DA6 A;  5FLV A;  3OSG A;  1GVD A;  4C3J J;  1BW6 A;  1G2H A;  3H3V K;  1HF0 A;  3O8G A;  2GLO A;  2VUM J;  3ZQL A;  1U9N A;  4FCY A;  2B63 J;  2EZL A;  1JTX A;  4BY1 J;  3B6A A;  2GBY A;  5GPC A;  4AC0 A;  1B72 A;  3QQA A;  4XRS G;  2TRT A;  1POG A;  2KDZ A;  1ZK8 A;  3E7L A;  2LFB A;  5J3L A;  4DW6 A;  4JX6 A;  1ETW A;  2CQX A;  2DA2 A;  5FKM A;  2COB A;  4LOC A;  1HDD C;  3LSR A;  1WI3 A;  5BNG A;  1ETV A;  4UUS B;  4XRM A;  2OF7 A;  2TCT A;  4NDL A;  1ZGW A;  1AHD P;  3S17 J;  2AHQ A;  3BR1 A;  3TW6 A;  3BQY A;  3S2H J;  4X1E A;  4M3E A;  3HOV J;  3FIW A;  4MFD A;  5IYD J;  1ETO A;  4A3I J;  4IHW A;  3JRA A;  1IV6 A;  2HXO A;  5C3E J;  4BBS J;  2DA1 A;  3BTC A;  4BXX J;  1TWF J;  1MBK A;  2DMT A;  3JRB A;  1MNM C;  2ME0 A;  1ETY A;  1X58 A;  3S1R J;  1P7J A;  5M5X J;  3H0G J;  1XC5 A;  9ANT A;  1VFC A;  2D5V A;  1MH3 A;  3NAU A;  2NOG A;  3JRE A;  1GDT A;  3D1N I;  2E2H J;  3WHC A;  3PM1 A;  1WH5 A;  1K61 A;  4BBR J;  3BR0 A;  1QVU A;  1T33 A;  1JT6 A;  2RAE A;  3A03 A;  1Z0X A;  4J19 A;  1WGX A;  3FK7 A;  4M6V A;  2K40 A;  5DS9 A;  1Y1V J;  3ZOB A;  2CUF A;  4RBO A;  3HOW J;  1JJ6 C;  2CRG A;  3OSF A;  4IHX A;  1JT0 A;  1JGG A;  2OPT A;  3FKI J;  3S1M J;  2E2J J;  5M5Y J;  2XPU A;  2R92 J;  3HBL A;  2XPV A;  1WPK A;  3JRH A;  4DZJ A;  3TW7 A;  3JRG A;  3G1M A;  1SFO J;  1O4X A;  4FIS A;  1LFU P;  5FKK A;  2PMZ N;  2JA7 J;  1JTY A;  5EEA A;  2EBI A;  4XK4 A;  4AUX A;  5EYR A;  5K7Z A;  3BTI A;  2G0E A;  2QCO A;  3SJM A;  1K83 J;  3Q0V A;  4DYC A;  2LR8 A;  5EDN A;  2XSD C;  1YRN B;  2JJ7 A;  2MSY A;  5F0C A;  1X2N A;  2FJ1 A;  3QPL A;  3NAR A;  4ABZ A;  2MGQ A;  3HM5 A;  2NVQ J;  2EZI A;  4UUT A;  1XS9 A;  1TWG J;  2L7F P;  4I6Z A;  1MSF C;  3B6C A;  2DJN A;  3I4N J;  4Y7N J;  1DU6 A;  1IDY A;  1VF9 A;  1JKQ C;  1JKO C;  3HOX J;  1UHS A;  4A3M J;  1F36 A;  2CU7 A;  3F0C A;  1IUF A;  1IDZ A;  2N8G A;  3DCF A;  5EGO B;  3FIS A;  1Y1W J;  5F08 A;  1HDP A;  3ZQC A;  1S7E A;  3RZO J;  2VKE A;  1WH7 A;  3BG9 A;  2Y2Z A;  1P7I A;  2DTZ A;  3CDL A;  1OJL A;  3LSJ A;  3OIO A;  2P81 A;  5M3M J;  4HNV A;  1LE8 B;  3LNQ A;  5EG0 A;  2M34 A;  3JRI A;  2L0K A;  3RKQ A;  5K7H A;  3LSG A;  1IC8 A;  2I10 A;  1HLV A;  1YRN A;  4A3C J;  1JUS A;  3K2A A;  4D7N A;  2O8K A;  2HDD A;  5GP9 A;  2K9N A;  2WV1 A;  2JA5 J;  5IOY A;  3M3Y J;  4JX5 A;  4A3F J;  2IAI A;  3GTO J;  1ETQ A;  3CQZ J;  3CCY A;  2HYJ A;  5E3O A;  4B4C A;  2XGE A;  2AO9 A;  3GBG A;  2JWT A;  2EH3 A;  1PUF B;  3Q0W A;  1RPW A;  3BTJ A;  5E3N A;  3HEF A;  4D5C A;  2YU9 J;  2DA4 A;  3A02 A;  4M3B A;  1LE8 A;  1BA5 A;  4IHY A;  3L1P A;  1GV5 A;  2DA3 A;  2YUS A;  4B1R A;  2NVX J;  2R93 J;  1A6I A;  1IJW C;  5E3L A;  1MBG A;  1IRZ A;  3JRF A;  2HQ5 A;  3VPR A;  1UMQ A;  4A3B J;  3HOZ J;  4X6A J;  1ZTR A;  1UG2 A;  1W0T A;  2R5Z B;  4UUS A;  1TWC J;  4V2G A;  5M5W J;  1H88 C;  2HI3 A;  2LY9 A;  4MIM A;  2O7O A;  2LD5 A;  2L7Z A;  1H89 C;  3ZQI A;  2ZB9 A;  5C44 J;  4XRS A;  1FEX A;  3A01 B;  5F04 A;  4EEF G;  3BR3 A;  2X9D A;  4M3F A;  4RDU A;  4DZP A;  1PUF A;  5FKO A;  5JLX A;  3PO2 J;  2XGD A;  3I4M J;  4W1U A;  1FJL A;  4CYC B;  4IEJ A;  1WCM J;  5J1U A;  5EZH A;  3HKZ N;  1BJZ A;  2M2E A;  4W97 A;  4A3L J;  2JA6 J;  2ME6 A;  1I3Q J;  2DMP A;  2E1O A;  2E19 A;  4JX4 A;  1B8I B;  3HDD A;  4QTR A;  3BG3 A;  1H8A C;  3TP3 A;  3MVP A;  2R5Z A;  1U78 A;  1T56 A;  3GTM J;  2R5Y B;  1AKH B;  4XID A;  5M3F J;  5K7F A;  2CUE A;  4D5F A;  2O9L A;  1ENH A;  3GTK J;  1QVT A;  3K7A J;  2L7M P;  4XIC A;  5IP6 A;  1JKP C;  5IPA A;  2R7Z J;  2LVS A;  2WAQ N;  1FIA A;  2Y31 A;  1X2M A;  1HOM A;  4CYC A;  3BR6 A;  4C2M J;  1NTC A;  3ZQH A;  4A3J J;  1IGN A;  1RKT A;  3OOU A;  1RET A;  1GT0 C;  2M0C A;  2LTP A;  2EQR A;  1CQT A;  2W48 A;  1JUM A;  1A5J A;  1B8I A;  2JMW A;  5F0F A;  3GTP J;  3G1L A;  1R9T J;  1D5Y A;  5J1Y A;  5E3M A;  1ETK A;  1ZKG A;  2VPR A;  4MLO A;  4QSH A;  5EF6 A;  4A69 C;  3BR5 A;  3G1O A;  3TP0 A;  3ZQF A;  2R5Y A;  4L5E A;  1FTZ A;  1TC3 C;  2H8R A;  1ZQ3 P;  5C4X J;  1AU7 A;  1FTT A;  2GM4 A;  1TWH J;  1Q1V A;  4A3G J;  1OCP A;  3IH3 A;  1HCR A;  2X6O A;  1IG7 A;  1W0U A;  1ETX A;  3IV5 A;  3FK6 A;  3BG5 A;  1VND A;  3S1N J;  4V2F A;  1ZR2 A;  2NVY J;  3LSP A;  1U8B A;  4MFE A;  2Y30 A;  2JN6 A;  4BY7 J;  2FX0 A;  2QF7 A;  1JJ8 C;  3JRC A;  1SAN A;  2ID3 A;  2YS9 A;  1I50 J;  1MBH A;  2FD5 A;  1NK3 P;  2ECC A;  5EGO A;  1ZR4 A;  4MO7 A;  2LK2 A;  1DU0 A;  2ECB A;  4FE7 A;  3W6V A;  3MN2 A;  2LLK A;  2NS8 A;  2XPW A;  2MW8 A;  4M3D A;  3MKL A;  2WB1 N;  2CJJ A;  2Y0S N;  3HGG A;  1OCT C;  4A93 J;  3S1Q J;  4C3H J;  2ID6 A;  1I6H J;  1E3O C;  2L9R A;  2EZK A;  3QPS A;  5F1J A;  2KT0 A;  4C3I J;  2IEK A;  4IHV A;  2NS7 A;  4Y52 J;  2IBD A;  4FE4 A;  3JR9 A;  1RR7 A;  2DA7 A;  3BTL A;  3SFI A;  2HOT A;  2X48 A;  1RKW A;  5FLM J;  2VKV A;  1MSE C;  4GFB A;  5F0H A;  2DA5 A;  4JP0 A;  3S15 J;  4QIW N;  1GV2 A;  5EZG A;  5JLW A;  3ZQG A;  1NK2 P;  1F43 A;  3UKG A;  4M3G A;  2DMN A;  1LFB A;  1FIP A;  2K9Q A;  3C2B A;  3GTQ J;  4BKX A;  2JK3 A;  5FJ8 J;  1RES A;  1JKR C;  4DYQ A;  5HOD A;  4B3A A;  2VI6 A;  3HOU J;  5GPA A;  1OFC X;  4S0H B;  4A3E J;  4I76 A;  3DEW A;  4AYB N;  5FKL A;  1MH4 A;  2M9H A;  2XGC A;  1QPI A;  3SDG A;  2EZH A;  3BQZ A;  1MBF A;  1U9O A;  5J1R A;  2K9S A;  3HB9 A;  3S16 J;  5DTD A;  3GTJ J;  1GUU A;  1BW5 A;  3A01 A;  1MBJ A;  3RZD J;  3Q3S A; 
#chains in the Genus database with same CATH topology
 4HEA 2;  3GTG J;  1XSV A;  4FTH A;  3PQK A;  3JSO A;  2VBW A;  2YX4 A;  3KLN A;  4EGY A;  3WTU C;  4LB5 A;  4FHT A;  2NVT J;  2Q0O A;  1WRJ A;  5F27 A;  3HOY J;  4OOI A;  3B02 A;  3S3M A;  5KCM A;  3S2D J;  3WU0 A;  1KON A;  5IYC J;  1OCC H;  5IYB J;  4CCJ A;  1F5T A;  1VI0 A;  2DMQ A;  3R60 A;  1D3Y A;  1RUN A;  1D8K A;  4RGS A;  5EG0 B;  4RB3 C;  3HZJ A;  2XAJ A;  2MH9 A;  3SZT A;  5DCM A;  3TO7 A;  2LP0 A;  2PMU A;  4HV5 A;  2E1N A;  2H1K A;  3S14 J;  3RQI A;  1BL0 A;  1D0X A;  3IH2 A;  4HOB A;  2CQQ A;  4E7S A;  3HGY A;  1YJW I;  2LKX A;  1IN7 A;  1SD7 A;  3AG4 H;  2XRL A;  1WJD A;  5HDN A;  5IOZ A;  3I55 I;  4RB0 A;  1QBJ A;  2KRC A;  1A31 A;  4A3D J;  2YPR A;  4D7M A;  2XHK A;  5D4S A;  1APL C;  3O6B B;  4MHG A;  3ZMZ A;  2R0Q C;  3SQN A;  3DKX A;  2GQQ A;  2DA6 A;  1QA6 A;  1IN4 A;  1OYW A;  1G2H A;  2JPC A;  2PEX A;  1UB9 A;  3MWM A;  2GLO A;  2VC1 A;  2VUM J;  2ETH A;  3ZQL A;  1T0F A;  2DO7 A;  4G6Q A;  2EZL A;  5HVQ C;  3B6A A;  2XKP A;  2DQR A;  3OYL A;  1X1C A;  1XPX A;  1PYV A;  2AQE A;  5CLS A;  3T0Y A;  2KDZ A;  4BUP A;  2BOL A;  4RAG A;  5K5Q A;  4KIC A;  4G94 A;  2CQX A;  1P4W A;  3LST A;  3DEE A;  1KU7 A;  1I3A A;  3LSR A;  1WI3 A;  1H9T A;  2OQR A;  2E1M B;  3MZH A;  4E7I A;  4IOA F;  2BXY A;  2OF7 A;  3GZ5 A;  3CLO A;  1JXS A;  3TW6 A;  3CLQ A;  2VJI A;  3TL4 X;  5E1X A;  3BQY A;  3IWF A;  3OYD A;  2W1O A;  1XD7 A;  3H0D A;  4M3E A;  4A5M A;  3HOV J;  3FIW A;  5ICF A;  3FXQ A;  2JSP A;  4A3I J;  3ABL H;  3ECH A;  3FKJ A;  3K70 C;  1SVM A;  1SEU A;  3VDX A;  1N25 A;  5DCF A;  3RPU D;  1U6G A;  5C3E J;  4BBS J;  1R5G A;  4ZC3 A;  5LBQ A;  4IL6 C;  2VE8 A;  3JRB A;  3D5R C;  1MNM C;  2PMZ A;  3K4L A;  2DDA A;  1Z6T A;  4BEH A;  2YR2 A;  4Y4R A;  5M5X J;  2Z99 A;  4AIH A;  2M7B A;  2DFH A;  1IN8 A;  3DKY A;  3DPT A;  5E20 A;  4GDF A;  3CO7 C;  5HNF A;  4XKV A;  2ZXI A;  1S8N A;  2R7S A;  4PCQ A;  1PJR A;  2UZK A;  1GDT A;  1BR1 A;  3PM1 A;  1K61 A;  4BBR J;  1D8J A;  3BR0 A;  4S04 A;  1SVO A;  2XRO A;  2RRE A;  1HKS A;  3OS0 A;  3FZV A;  1VQ4 I;  4J19 A;  5HNH A;  1Y1V J;  4RBO A;  4P9F A;  2LF7 A;  1WJC A;  2QWW A;  4BH9 A;  2L9S A;  5ILV A;  5D5V B;  4IHX A;  1P6R A;  3VEP A;  3WG7 H;  2A3S A;  4BHC A;  3DP7 A;  3FKI J;  1Z3X A;  2E2J J;  4KIB A;  2VQG A;  4ZZL A;  5M5Y J;  5B1A H;  1E3P A;  2R92 J;  4QPO A;  5HDG A;  3V4G A;  3HBL A;  2LG4 A;  2JRT A;  1MGT A;  2XPV A;  4IHT A;  5J40 A;  4DZJ A;  3CUQ A;  3JRG A;  2R7O A;  2QBY A;  2XAG A;  2M87 A;  2KJB A;  4JQF A;  4XM3 A;  2HWV A;  5LGU A;  5FKK A;  1ZG5 A;  1FBU A;  3DTK A;  4UB8 C;  2LBF B;  2JA7 J;  3F23 A;  1ZN2 A;  3DEU A;  3FXR A;  4X0G A;  2P5L C;  2CUJ A;  5H20 A;  3V7C A;  1N77 A;  2OCE A;  2UWM A;  2OTJ I;  2HEO A;  3OS2 A;  2VXD A;  1AA7 A;  4DYC A;  3M07 A;  4E7J A;  4MEY F;  2JJ7 A;  3F21 A;  3VOE A;  3V8J A;  1MNE A;  1X2N A;  2EV6 A;  4UUT A;  3SZG A;  4AIJ A;  1MSF C;  3LL7 A;  4KMU X;  2EIN H;  4CZZ A;  4A3M J;  2CU7 A;  2IXS A;  2KMU A;  3H9Q A;  2HZD A;  2DT7 B;  3FIS A;  2K27 A;  1BI3 A;  2QGU A;  1MZB A;  2DFF A;  3FXL A;  2VKE A;  3OS1 A;  3ABK H;  1T95 A;  1P7I A;  2DTZ A;  1OJL A;  1V3F A;  3KP2 A;  1TW2 A;  3BOQ A;  5K5O A;  2DU9 A;  1RC9 A;  4CCM A;  3JRI A;  2L0K A;  4IRG A;  2I10 A;  1YRN A;  1U8R A;  4ETS A;  2DPU A;  4N0B A;  1UCR A;  2K9N A;  2WV1 A;  2MC4 A;  1IRX A;  2JA5 J;  3ABT A;  5IOY A;  5D6F A;  4IO9 F;  2XC7 A;  1GHC A;  4A3F J;  2IAI A;  2JVH A;  2L9V A;  1JI8 A;  5D5X B;  2GAU A;  2PJR A;  4P1W A;  1BIB A;  3HKZ A;  2LKP A;  4HF0 A;  5E3O A;  2E60 A;  5E79 C;  1CGP A;  4KJZ A;  1IN5 A;  1HST A;  2EH3 A;  4KFC A;  3FXM A;  3T8R A;  2OQG A;  1TQP A;  2DA4 A;  4Q48 A;  4B8X A;  2DT6 A;  3KZY A;  3I5U A;  4BS9 A;  1WHU A;  5D5W B;  3L1P A;  4U7B A;  4ZJZ A;  4B1R A;  5E3L A;  1MBG A;  2KZG A;  3H5A A;  3JRF A;  2HQ5 A;  2I5U A;  2LNB A;  4X6A J;  4A3B J;  1BC7 C;  1WZ2 A;  3PFI A;  1MDM B;  3K6G A;  3GEZ A;  4PDK A;  2BY0 A;  4UUS A;  4LK1 F;  1TWC J;  1U5T B;  2WAQ A;  5M5W J;  2HI3 A;  1Y56 A;  2LY9 A;  1DDN A;  2HTS A;  3HC7 A;  4BDY A;  2LD5 A;  2MFZ A;  2L7Z A;  3I9V 2;  2EFQ A;  3BJ6 A;  2A05 A;  3ZQI A;  4IF4 A;  5GAD J;  4Q4Z F;  1W5C C;  1IN6 A;  1SFK A;  2YU3 A;  2ACJ A;  4G8X A;  1M1E B;  3TDU C;  5FKO A;  4BE1 A;  1DP3 A;  2KRH A;  2RNJ A;  2XGD A;  1P4X A;  3CZ6 A;  4HW0 A;  5D4R A;  4W1U A;  3L00 A;  1ZYR F;  2PN6 A;  2PX9 A;  4Y33 A;  4HLX A;  4LMY A;  3L7W A;  2JUC A;  2ME6 A;  2F5E A;  1K6O A;  4L9N A;  1FMV A;  4JX4 A;  3ZMT A;  2OCC H;  3HDD A;  4BDZ A;  1ZGJ A;  2HVR A;  5FRO A;  1X1B A;  2WAF A;  2CW0 F;  2IGO A;  3LSI A;  3Q5F A;  1XDS A;  2D1V A;  3I56 I;  3BG3 A;  1ACI A;  3OYH A;  3CD6 I;  2ISZ A;  3W6K B;  4E7K A;  1PVE A;  2FML A;  4A0Y A;  3GTM J;  2GA1 A;  4GYI A;  4XID A;  4H4K C;  4L18 B;  2FE3 A;  4HNU A;  3BZK A;  4MNU A;  5M3F J;  3DF8 A;  3HPG A;  2W57 A;  4M74 A;  1BC8 C;  2O9L A;  3GTK J;  3GXO A;  2H6C A;  3CO6 C;  5HLI A;  3W2W A;  1VQO I;  4PSX A;  2CWE A;  4CH7 A;  3KEQ A;  2R7V A;  1X2M A;  4I01 A;  2KIS A;  3BR6 A;  1E2X A;  1NTC A;  3PFY A;  4NQW B;  3REO A;  3ZQH A;  3ZQ7 A;  5E8I A;  4C2M J;  4Y13 A;  3RI4 A;  2STW A;  3S93 A;  2LTP A;  1D1A A;  2EQR A;  2W48 A;  2IVM A;  1X3U A;  3OR1 C;  2XAQ A;  2GXA A;  2L7K A;  3CMM A;  3V42 A;  1D5Y A;  4XBF A;  4RAF A;  4EJV A;  1ZKG A;  3J80 Z;  3GLX A;  4ZDP A;  3CCU I;  2X6W A;  4A69 C;  1QPM A;  4M9Z A;  1X4O A;  1R1T A;  3G1O A;  3TP0 A;  2EPF A;  2GXB A;  2FMY A;  2DOE A;  2X51 A;  1J7K A;  2P6T A;  1ZQ3 P;  2VOP A;  2EWN A;  1U0J A;  1AU7 A;  2DOF A;  1TWH J;  3RKW A;  5CVJ A;  1K4T A;  2GM4 A;  3IH3 A;  4C9Y A;  5L3G A;  1IG7 A;  2EV5 A;  4NBQ A;  3BG5 A;  4BGD A;  2X4H A;  4XOR A;  2B9S A;  2PI0 A;  4C2T A;  1LDJ A;  4V2F A;  2BW3 B;  5B3S H;  1OR7 A;  2X85 A;  3H3Z A;  3LSP A;  5CPR B;  3GFM A;  2XUB A;  2Y30 A;  1VQK I;  2BGC A;  2JN6 A;  4EVI A;  2WC2 A;  4GO1 A;  1SAN A;  2ID3 A;  3NEU A;  2YS9 A;  2F48 A;  3GF2 A;  5ILS A;  1I50 J;  4A6E A;  5DM7 F;  1H0M A;  2LKS A;  2EFO A;  1FP1 D;  2Z1D A;  1IF1 A;  2ESH A;  3GZN B;  5LHI A;  3MN2 A;  3W2A A;  2V6C A;  3L9F A;  3FBI B;  2XPW A;  3I59 A;  4AYB A;  5D6E A;  4M3D A;  2MBF A;  3K4M A;  4U87 A;  3HUG B;  4BE2 A;  2WB1 N;  1I39 A;  1OCT C;  3F6O A;  3SZP A;  2BBY A;  5IT9 Z;  2P5K A;  3L09 A;  4C3H J;  1HW2 A;  3TOB A;  4R79 A;  3CC2 I;  2Z33 A;  1V5F A;  4J01 A;  3OR2 C;  4C3I J;  2IEK A;  2NS7 A;  4PFO A;  3K4K A;  3SFI A;  4QLC U;  1FLI A;  1VQL I;  2QQA A;  1TNT A;  1HKT A;  2P6S A;  2VKV A;  2F5F A;  1JHF A;  1FBQ A;  3IHU A;  2NXN B;  1ZRE A;  2DW4 A;  2DA5 A;  1X3W B;  2K3F A;  2UV1 A;  2DK8 A;  2OZU A;  3VSK A;  4Z6Y A;  3K1P A;  3ZN1 A;  1GV2 A;  3EUH C;  2V1U A;  5EZG A;  2CS3 A;  3N05 A;  3UKG A;  1X1P A;  3FXU A;  3DBR B;  1LFB A;  2HNH A;  4UVC A;  3H9J A;  4GCV A;  3TO6 A;  3KP4 A;  3U1K A;  3SFZ A;  3SEZ A;  3RKY A;  5FJ8 J;  1RES A;  2EV0 A;  1JKR C;  4DYQ A;  1KYZ A;  1OIS A;  1MJA A;  2ADU A;  4P55 A;  4B3A A;  4H0E A;  1T8I A;  1N75 A;  1X1A A;  3FF5 A;  3KIO A;  3UR3 C;  1OFC X;  1XX5 A;  4RB2 C;  1D5V A;  4PJ0 C;  4A3E J;  2LMD A;  3F8M A;  4OU0 A;  4JOM A;  4DBQ A;  2QQB A;  3RKX A;  2M9H A;  3G2B A;  5KAI C;  3CJQ B;  2AXT C;  1QPI A;  5CKT A;  2VBY A;  2EZH A;  1J59 A;  1SD5 A;  2WBM A;  1X19 A;  3KP7 A;  5DTD A;  3PUF A;  1I5Z A;  1YYV A;  2LRE A;  3K9T A;  5ICG A;  3LA3 A;  1MBJ A;  3RZD J;  3Q3S A;  2V9V A;  4FET A;  2HVQ A;  2CMP A;  4ZDL A;  3AL0 C;  1WJ5 A;  2ZNZ A;  2AQF A;  2JQ7 A;  3FMQ A;  3OYB A;  3V7S A;  4EQQ A;  5FLX Z;  2HZT A;  3WHB A;  2G7U A;  2KRF A;  2P8T A;  3KX2 A;  2KJC A;  2M8G X;  2VBZ A;  3W2V A;  2MLG A;  4O5V A;  2ZXH A;  1R1V A;  1DQU A;  4LLN A;  1HQC A;  5DM6 F;  3DLL F;  4B3X A;  4DYR A;  1ITY A;  2XIG A;  3BWG A;  1JUP A;  2XVC A;  4YRV A;  3L2W A;  4XN3 A;  4NC8 A;  2L3D A;  5IT3 A;  2Y9Z A;  4D9J A;  3TDZ C;  5DD8 A;  3GTL J;  2MG4 A;  3LWF A;  2KPM A;  2JTV A;  2XAF A;  1D1B A;  5ICE A;  5BPI A;  1WJF A;  3VYS B;  3OYK A;  4A3K J;  1HSJ A;  2DMU A;  2EFN A;  3J80 K;  1YI2 I;  2W85 A;  3G3Z A;  1G3W A;  1MBE A;  1YX3 A;  3HHG A;  5GAH J;  4NB5 A;  3BPV A;  1A36 A;  4IOC F;  2HOS A;  1J9I A;  2UUZ A;  3C2H A;  4XLE A;  2V6E A;  1KA8 A;  3RJP A;  2ZFU A;  2IGN A;  2R7X A;  2O03 A;  4OIQ F;  4EJU A;  4IJA A;  1HF0 A;  2VC0 A;  4CCO A;  5HLT A;  2M45 A;  1U9N A;  4FCY A;  1DGR M;  3K1N A;  3VYT B;  5KVR A;  1H9G A;  2VJJ A;  4IRI A;  2VQC A;  4HV6 A;  2MLK A;  3I53 A;  1O7L A;  3AL0 B;  2JT1 A;  3OL3 A;  2LFB A;  5J3L A;  4FX0 A;  4DW6 A;  2RKH A;  1CF7 A;  2E5Z A;  2IA0 A;  1PP8 F;  4N9I A;  1HDD C;  1K4S A;  2HDC A;  4PZJ A;  4RAY A;  3VFZ A;  2ELH A;  1KYW A;  4F91 B;  1ZLJ A;  1V55 H;  3S17 J;  2O0Y A;  2TCT A;  1AHD P;  2AHQ A;  4AIK A;  2CV1 A;  4ZYD A;  5KK1 A;  2X1C A;  1OQY A;  3BJO A;  3M8E A;  1DGW Y;  5IT9 K;  1V5E A;  4IHW A;  3JRA A;  2WTE A;  4AU7 A;  1S29 A;  3CUO A;  3GO5 A;  1EH7 A;  1XGO A;  4BXX J;  2RV8 A;  1MBK A;  4YFN F;  2H09 A;  4XN0 A;  4OAY A;  2WAD A;  1QNT A;  2LYC A;  1FOY A;  1X58 A;  4M9X A;  1HA8 A;  1P7J A;  4II2 A;  5ILU A;  3H0G J;  3AFH A;  3PUB A;  2WY8 Q;  1VFC A;  4G6T B;  3OOP A;  4FX4 A;  1UAA A;  3E0J B;  3NAU A;  3JRE A;  2GWR A;  4C30 A;  1HBX G;  3QYB A;  2VJ5 A;  3D1N I;  3WHC A;  3TMO A;  1QVU A;  3DV8 A;  3ZR8 X;  4M71 A;  4HLY A;  2EIK H;  1VQ6 I;  3FK7 A;  4M6V A;  2VOD A;  2KP6 A;  1J5Y A;  5J4V A;  1J75 A;  2V1D A;  1J09 A;  1R58 A;  5KHD A;  2CRG A;  3ZN0 A;  3PNY A;  3O2P E;  1HW1 A;  2F5C A;  2XPU A;  4CXF A;  2PG4 A;  4L9J A;  3ASO H;  4LIV A;  3ROU A;  1YX5 A;  4OWR B;  2CFX A;  2HOE A;  3NWS A;  4XKW A;  3JRH A;  2R7W A;  2WY7 Q;  3G1M A;  2H1L A;  3A0B C;  4I02 A;  4BJT A;  1D0Z A;  1XTA A;  2E1M C;  3H3U A;  1O4X A;  2BV6 A;  2DFI A;  2DOD A;  1G3T A;  1MD0 A;  2EBI A;  2IGK A;  3ZMV A;  1KU3 A;  3BTI A;  2G0E A;  4Q47 A;  4HST A;  2QCO A;  2Y0M A;  2IJL A;  3SJM A;  5FLX K;  4LG0 A;  3DBH B;  1I6X A;  2FJ1 A;  3QPL A;  2EB7 A;  2NNN A;  1V4R A;  3NAR A;  1ULY A;  4NHJ A;  2FBH A;  4I6Z A;  1HC8 A;  1O3S A;  2HKO A;  3B6C A;  1B6A A;  2DJN A;  2NYX A;  1FOX A;  1X3Z B;  1YHQ I;  4CUG A;  2R7U A;  1F36 A;  2ZJP F;  2Q1Z B;  4ASN A;  1IUF A;  1YLF A;  2WB1 A;  1YJN I;  2H27 A;  3WOD F;  4A0X A;  2FEZ A;  1K79 A;  5B5E C;  4L0Z B;  1HDP A;  2M0M A;  1S7A A;  1XN7 A;  1S7E A;  2QVO A;  3BC8 A;  5DEQ A;  1Y0U A;  3OIO A;  2LBF A;  1ZRC A;  2P81 A;  5M3M J;  5D5U B;  1MKM A;  4EMS A;  4DBR A;  4HNV A;  3OYI A;  1LUJ B;  1T38 A;  3VWB A;  2ZKZ A;  2UXX A;  3L2U A;  1BN5 A;  2HDW A;  4Y17 A;  3WGI A;  4E7Z A;  2VJ4 A;  3LSG A;  1IC8 A;  3DTE A;  1ON1 A;  1EH6 A;  1SMT A;  1YS7 A;  3K2A A;  2V9K A;  4D7N A;  2O8K A;  2HYF A;  5AIQ A;  5EEG A;  3CP8 A;  3M3Y J;  4CHU A;  4KNY A;  1V5G A;  1LEA A;  2DOA A;  3WTT C;  4ZDO A;  3Q9S A;  2X6Y A;  4HX7 A;  3CCQ I;  3CQZ J;  4I0B A;  3IWZ A;  2HFH A;  5ED4 A;  5FRN A;  2KDO A;  4LB6 B;  4HF2 A;  2DTR A;  2HYJ A;  2NNY A;  3WE2 A;  1UFM A;  3ZGK A;  1O7F A;  4CCL A;  2AS5 F;  1EJ9 A;  1IRF A;  1PUF B;  2VE9 A;  1RPW A;  3BTJ A;  4U0V A;  4PSW A;  5E3N A;  3HEF A;  1ZLK A;  4M3B A;  1SAU A;  3G73 A;  4BQQ A;  2BY2 A;  1GV5 A;  2DA3 A;  1K7A A;  3K1M A;  4CCK A;  3W6J B;  1PDN C;  1XMX A;  4YG2 F;  4IHS A;  3K69 A;  3Q9V A;  1IRZ A;  4B09 A;  1MJB A;  4A6D A;  2H6B A;  3VOD A;  1W0T A;  2M7A A;  3F6V A;  2D45 A;  1H88 C;  3I3L A;  4MIM A;  3KYD B;  4BJ6 C;  3CES A;  2O61 A;  2R4G A;  3RQ4 A;  2OUM A;  3CCS I;  5CJ9 A;  1H89 C;  3WGH A;  2FOK A;  2P4W A;  1XSX A;  3QP5 A;  5C44 J;  3R4K A;  1W36 D;  5F04 A;  4M3F A;  2X9D A;  5HS9 A;  5H2F C;  1HXD A;  5JLX A;  1VQN I;  3PO2 J;  3RSN A;  1R36 A;  4F52 A;  3H5N A;  4WX9 A;  3I4M J;  1Y6I A;  4CYC B;  2K9M A;  1SMY F;  1WCM J;  4RMN A;  4HDV A;  5J1U A;  5EZH A;  4UHT A;  4A3L J;  2CQN A;  4LJZ F;  3FBN B;  3L2R A;  2K7L A;  3H9G A;  4LK0 F;  2E19 A;  1MW7 A;  3RTR A;  1W7P A;  4QTR A;  4YFX F;  3D5S C;  1E0E A;  2I8D A;  1MDM A;  1NHA A;  2EK5 A;  3M7G A;  2OV7 A;  2F4O B;  3MVP A;  5DCM B;  2NAZ A;  1T56 A;  1LDD A;  4I09 A;  3MEX A;  1WJB A;  4KIG A;  1MMN A;  4RGU A;  2V79 A;  5K7F A;  1P9Q C;  4D5F A;  1XB4 A;  2X6X A;  4XLN F;  1DPR A;  1A35 A;  1WKM A;  3HSF A;  3OYG A;  4HQE A;  1B9N A;  2F5V A;  5IPA A;  2QSH X;  2HQR A;  2R7Z J;  2Y31 A;  3T5X A;  1W1W E;  2MA3 A;  5FO5 A;  5GAE J;  3EUK L;  1RET A;  4CSW A;  1GT0 C;  2M0C A;  2WWY A;  1FYL A;  5KNL A;  1JUM A;  2GIV A;  5LEJ A;  3GTP J;  3G1L A;  2DK5 A;  5J1Y A;  2DAO A;  2R7R A;  3O3K A;  4AM3 A;  3M9A A;  2W82 A;  1TZL A;  3I0T A;  1BJA A;  3BR5 A;  3ZQF A;  5A2Q Z;  2NOJ B;  4L5E A;  4KA4 A;  4L5I A;  3E6B A;  1U5T C;  2QSF X;  2EIM H;  1FTT A;  5LHH A;  1FPQ A;  1Q1V A;  2P0W A;  1HCR A;  4PFP A;  1W0U A;  4MQ9 F;  1VND A;  5LGN A;  4HRI A;  1XCV A;  5CVI A;  1Z21 A;  2NVY J;  2G7H A;  4NQW A;  2L5Q A;  2FRH A;  3CP2 A;  1QZY A;  1Z05 A;  2FU4 A;  3EET A;  4XLC A;  4BY7 J;  4IVN A;  2FX0 A;  1DUX C;  3JRC A;  2M8E A;  2RGV A;  2R7Q A;  3D0S A;  4A2U A;  4JBA A;  2FD5 A;  1NK3 P;  1RNL A;  1E17 A;  3HTU A;  5L3D A;  5EGO A;  1KQ9 A;  3F8C A;  1R7J A;  2MD5 A;  2GIZ A;  3EQL F;  4HX4 A;  2L01 A;  1ZEL A;  3MFK A;  2FNP A;  2LLK A;  2NS8 A;  3IRR A;  4E70 A;  4AVP A;  2IGM A;  2LY2 A;  1MJ9 A;  3WTV C;  3MKL A;  4ZTJ A;  2BXZ A;  2Y0S N;  3QPH A;  5L3F A;  4A93 J;  2W4S A;  3DWL E;  3P9I A;  4I99 C;  2FXA A;  1E3O C;  5FFX A;  3TKY A;  4ENN A;  5F1J A;  1FYM A;  2BW3 A;  4Y52 J;  1OYI A;  4FE4 A;  4XL9 A;  2DA7 A;  3TO9 A;  1RUO A;  2X48 A;  3ASN H;  4P96 A;  4LGW A;  4XKC A;  5F0H A;  4YEL A;  3ZMU A;  1BR2 A;  4XLA A;  1KU2 A;  1P4A A;  2UXN A;  3GX4 X;  3S15 J;  3GWZ A;  4QIW N;  3DU6 A;  1F43 A;  1NK2 P;  3WTY C;  2DMN A;  1F9N A;  3HG9 A;  1S9H A;  3MZY A;  4Z2Y A;  4OIR F;  2Q8K A;  2M4K A;  3GTQ J;  5TIS C;  3HUG A;  4XQF A;  1VTN C;  2QZ8 A;  5DUI A;  4WWC A;  5HOD A;  4BL0 B;  3HOU J;  2V7F A;  3K4N A;  5L3E A;  4F55 A;  5GPA A;  2GZW A;  3C1D A;  1ZRD A;  4I76 A;  3DEW A;  3ZPL A;  3LAJ A;  1MH4 A;  2KIU A;  4ANJ A;  2KZV A;  3RPQ A;  1K78 B;  4ESB A;  2K3P A;  1BI0 A;  2PJP A;  1L3L A;  4BHB A;  3RCO A;  5LRR A;  2K9S A;  3HB9 A;  4B44 A;  5J4Y A;  3HSR A;  3E3V A;  1L0O C;  2D2W A;  5DYM A;  3LA7 A;  3A01 A;  3HRM A;  1FZP B;  3JRD A;  2XKO A;  5IP7 J;  1R5I D;  2Y9Y A;  3PO3 J;  2BY3 A;  4BAC A;  4ENJ A;  2E2I J;  1WI9 A;  4QPQ A;  4CYD A;  4L5J A;  2IPQ X;  1A04 A;  4WK8 F;  3HOT A;  1IXS B;  1WVR A;  1ONV A;  3M4O J;  1Z67 A;  3SYT A;  3V8K A;  2HXI A;  4PJJ A;  4WCG A;  4V19 K;  3HRU A;  5AON A;  4ZZD A;  2B7E A;  5LEK A;  2HOA A;  2P5V A;  2IS1 A;  1B72 B;  1TT5 B;  5BMZ A;  2EFP A;  1LQ1 A;  2QKM B;  2DN0 A;  3ECO A;  4G12 A;  2KL4 A;  3TOA A;  5C4J J;  1AKH A;  3J7A O;  1EF4 A;  4CA0 A;  5HLG A;  3KPH A;  2CO5 A;  4LG3 A;  2XB5 A;  1IW7 F;  4R1H A;  3G4S I;  1MMG A;  2QA4 I;  4WXH A;  3IH4 A;  3DKW A;  2V9P A;  4CDG A;  5A2Q K;  3FXK A;  3OSG A;  2Z5U A;  2K85 A;  3JSP A;  2QSG X;  3PIO F;  2OU2 A;  2FOW A;  3OV8 A;  2IA1 A;  2RC4 A;  3O8G A;  1WJE A;  3K70 D;  2FBK A;  2ICW G;  3K10 A;  4LLG F;  4PGG A;  2DI3 A;  2VOO A;  3KYL A;  1SVL A;  3MQ0 A;  3EUH A;  1YS6 A;  4FT8 A;  1GVJ A;  3KZI C;  3PL8 A;  5BQT A;  2ELJ A;  4XLH A;  3T8T A;  4XOP A;  3MKZ A;  5CQE A;  1ZK8 A;  4EJT A;  3E7L A;  2BHY A;  1T08 B;  2E34 A;  4ZYG A;  2ZC2 A;  2P7C B;  2WV0 A;  5FKM A;  4Y3O A;  3I4P A;  1G6N A;  1K6Y A;  2COB A;  3DU5 A;  4LOC A;  4I98 B;  1FT9 A;  5BNG A;  2DYS H;  1ETV A;  4UUS B;  2GA2 A;  2ZSI B;  1IO2 A;  2W25 A;  2R3S A;  4XRM A;  4G7H F;  3IAM 2;  1R5H A;  4HYE A;  4NDL A;  1QZZ A;  2D1H A;  1R71 A;  4FAS D;  5EEH A;  3PSF A;  2VL8 A;  3KP3 A;  2R7T A;  5E8G A;  2VKD A;  3E5U A;  5IYD J;  2QQ9 A;  1ETO A;  2BE5 F;  1YW7 A;  1Z9C A;  3BRO A;  3RIR A;  2F2E A;  5GAG J;  2DA1 A;  3QYF A;  1Y0N A;  1TWF J;  3WGG A;  2EJR A;  3TQN A;  2ME0 A;  1DP7 P;  3S1R J;  1WQ2 A;  5CYV A;  2XF5 A;  1OMI A;  1YG2 A;  3MKY B;  2OC6 A;  2Z16 A;  2XSJ C;  3AG3 H;  1XC5 A;  2DFE A;  9ANT A;  4XON A;  1R49 A;  1YOV B;  3QU3 A;  3EUA A;  2FA5 A;  3DQV C;  2NOG A;  1R6R A;  3FHZ A;  1WH5 A;  2CYY A;  2MYS A;  5B1B H;  5FD6 A;  2RAE A;  1JT6 A;  3A03 A;  5E1Z B;  4F3Q A;  1FOW A;  1Z0X A;  5DD4 A;  5HOO A;  1ZRF A;  1WGX A;  1Y8R B;  1W4M A;  3TGN A;  5DS9 A;  2BVM A;  2QM3 A;  5H6Q A;  2QYO A;  2V4J C;  1AWC A;  3J81 Z;  4CZC A;  4N9H A;  2L2O A;  2YSR A;  3JAM Z;  1W7P D;  2DT5 A;  4N4N B;  4B43 A;  1WPK A;  3HPH A;  1VZ0 A;  3TW7 A;  3LQQ A;  1SFO J;  1IXC A;  3LQR A;  4FIS A;  1RR8 C;  1TBX A;  2PMZ N;  3E6D A;  4CGZ A;  4BXU A;  5EEA A;  1VQ8 I;  4AUX A;  5EYR A;  3ZMD A;  2ZFW A;  1FY7 A;  5K7Z A;  4M6X A;  5FFZ A;  4E7L A;  1B1B A;  3FXO A;  2KHM A;  5EDN A;  2XSD C;  1Z91 A;  4XMY A;  1STZ A;  3E6M A;  5F0C A;  3S2W A;  4ABZ A;  2CSO A;  2MGQ A;  3HM5 A;  5HS8 A;  1TWG J;  2KIF A;  1BR4 A;  2Q2E B;  2CG4 A;  4B48 A;  2ZSH B;  2L4M A;  1TP4 A;  3U9G A;  3I4N J;  3L2V A;  1DU6 A;  1JKO C;  3HOX J;  2LSO A;  2BEO A;  4BU2 A;  3CF2 A;  1D1C A;  3F0C A;  3KLO A;  1TLH B;  5J8F A;  2L9N A;  2Y0S A;  4XSX F;  3WTX C;  3DCF A;  2HPI A;  1U3E M;  2ZME C;  3P9K A;  4ZYA A;  3FM5 A;  2C6Y A;  4ENM A;  3LA2 A;  3ZQC A;  3IUO A;  2Z3Y A;  2XAH A;  5E1W A;  4EV0 A;  3CDL A;  1XGN A;  3LSJ A;  1XMK A;  3SEQ A;  1LE8 B;  3IL2 A;  4D0P A;  5EG0 A;  2M34 A;  4AID A;  5BOX A;  3CJT B;  4KN7 X;  2XGX A;  3C7J A;  3RKQ A;  5K7H A;  2VIX A;  3LFK A;  4A3C J;  1JUS A;  2HQA A;  4OMY A;  5ICC A;  3FDY A;  4JX5 A;  3CMA I;  3ZQQ A;  1J0R A;  4XKB A;  3GTO J;  1D0Y A;  2XDV A;  2ZCW A;  3CCM I;  3WTZ A;  4BQO A;  4KN4 X;  4BQA A;  4EAT A;  4UNO A;  2NVU B;  4RS8 A;  2J5P A;  2XGE A;  4MTD A;  4U0Y A;  3GBG A;  3HSE A;  2DXI A;  2HVS A;  2G9W A;  2JWT A;  2LH9 A;  3Q0W A;  4D5C A;  3F22 A;  2YU9 J;  3EYY A;  1FMW A;  1LEB A;  3NQO A;  4HX8 A;  1Y8Q B;  3F9K A;  1WFX A;  4BHP A;  2YUS A;  1V54 H;  4MQV A;  1W5T A;  4GYG A;  1A6I A;  2WAE A;  5E18 F;  2NRA C;  1O3Q A;  2KFD A;  5TJJ A;  3OL4 A;  2ZME B;  3HOZ J;  3BG6 A;  4CIC A;  4MEX F;  2O8X A;  1ZTR A;  3GFL A;  1IUY A;  1UG2 A;  5ERI A;  1HW5 A;  4HPQ A;  2R5Z B;  2F6C A;  4V2G A;  3DTI A;  5FRM A;  5K5R A;  2O7O A;  2KKO A;  3W3C A;  2VBX A;  3R0A A;  3U1D A;  1GXQ A;  4L9V A;  3C3W A;  2ZB9 A;  2RN7 A;  4EGZ A;  3HHH A;  2PLY A;  1LPQ A;  4EEF G;  3L2Q A;  1Z6R A;  4RDU A;  4RLQ A;  1PUF A;  2F5D A;  2E7W A;  4HQM A;  1QQI A;  4M9S A;  1FJL A;  4KDP A;  2L54 A;  3HKZ N;  2M2E A;  3K4J A;  4HAM A;  5L3C A;  1J2X A;  1P92 A;  3KE2 A;  4UVB A;  5GTI C;  1VQM I;  2KQR A;  1XSD A;  2K02 A;  2DMP A;  1B8I B;  3S3N A;  1MIJ A;  3KP6 A;  1EH8 A;  1SD4 A;  4IPA A;  1H8A C;  1BBY A;  3TP3 A;  4UUV A;  3BJA A;  4BYY A;  2O3F A;  5HDK A;  2R5Y B;  1ZAR A;  4PJL A;  2Y75 A;  3J81 K;  2IS6 A;  2MH2 A;  3H92 A;  2CUE A;  3CCV I;  1ENH A;  3PIP F;  3K7A J;  1KGS A;  3JAM K;  3OIQ A;  4ON0 A;  2COM A;  3I71 A;  3AKZ A;  2LVS A;  2QKL B;  2WAQ N;  1LB2 A;  1HOM A;  4CYC A;  1Z7U A;  4F7Z A;  3MZ8 A;  1YW9 A;  1RKT A;  3DFG A;  3OIP A;  3A2K A;  5LFA A;  1CQT A;  3DXJ F;  1XGM A;  1A5J A;  2MD0 A;  3P9C A;  3WG9 A;  2JMW A;  2M30 A;  2Z2S B;  5E3M A;  1ETK A;  2VPR A;  2HS5 A;  4JK1 X;  5EF6 A;  3F3X A;  4RLF A;  4EM2 A;  1TTY A;  4RB1 A;  1YFH A;  1TC3 C;  3OYA A;  1R4M B;  1CF7 B;  3ZCO A;  3SXY A;  4XNF A;  4A3G J;  2KIQ A;  1OCP A;  3CJN A;  1IV8 A;  1ETX A;  2K4J A;  3IV5 A;  4CO8 A;  1SD6 A;  1MMD A;  4G9Y A;  4G6D A;  3A4C A;  4LIU A;  3F8F A;  3KFW X;  3AG1 H;  3KEY A;  4MFE A;  1U8B A;  2HGC A;  3A0H C;  1I1S A;  3EDP A;  2Y48 A;  2QF7 A;  1ZH5 A;  2A68 F;  2HDD A;  5J8C A;  2ZJQ F;  4YII A;  1MBH A;  2RQQ A;  1HKQ A;  3G6E I;  4U0W A;  2CV2 A;  2ECC A;  4KIF A;  3OY9 A;  3P5J A;  4HG2 A;  3R61 A;  2V1N A;  4XLP F;  2LK2 A;  4FE7 A;  3W6V A;  3ULQ B;  4CCN A;  4ESF A;  5CVU A;  2MW8 A;  1TT0 A;  2HQN A;  2CW8 A;  1FX7 A;  3CCR I;  1YO5 C;  4I2O A;  5CVV A;  3HGG A;  4J00 A;  2W24 A;  3S1Q J;  2ID6 A;  4AD9 A;  1N78 A;  2L9R A;  2A69 F;  1RI7 A;  2EZK A;  3OYM A;  2OD5 A;  1IXR C;  3ABU A;  4IHV A;  4EM0 B;  3CME I;  3IP4 B;  3JR9 A;  2QLZ A;  5BS6 A;  2HOT A;  2PQ8 A;  2LY1 A;  1RKW A;  4OAZ A;  5FLM J;  1T98 A;  1MSE C;  3RYR A;  4GFB A;  2VN2 A;  1SFX A;  2JPB A;  4E7H A;  3E5X A;  3HRS A;  1UJ8 A;  4P9U A;  5F64 A;  1T0F C;  4JP0 A;  1XDU A;  1RIO H;  3BP8 A;  4KMF A;  3CTA A;  3KZZ A;  3ZQG A;  3V7R A;  3ZXS A;  3HTS B;  3J7A Y;  1FIP A;  5HLH A;  2K9Q A;  3C2B A;  3OYF A;  4LLL A;  2H8W A;  5JVT A;  2VPL A;  5HS7 A;  2XV4 S;  1T39 A;  2A5Y B;  4R8H A;  2CH0 A;  3HYI A;  1SFE A;  3HRT A;  1TW3 A;  5F1R A;  1OPC A;  3M1C A;  4M6Y A;  1QGP A;  4UY8 I;  4AYB N;  1R22 A;  3OMY A;  1BOA A;  3IAS 2;  3LSK A;  4GRI A;  1FSH A;  1U5T A;  4LG0 B;  3BCA A;  2XGC A;  2ZJ2 A;  3LFU A;  2DPD A;  3BQZ A;  5D8K B;  2VT3 A;  1W5S A;  1U9O A;  3FMR A;  3FHN A;  3WU1 B;  4KIT B;  3WTS C;  1FSE A;  1GUU A;  1QO0 D;  2FF4 A;  3GFJ A;  2L02 A;  4XOT A;  2RDP A;  4HBL A;  2JSC A;  4L0Y B;  2VT2 A;  4A12 A;  1QU3 A;  3KCC A;  3QOE A;  4HA8 A;  4O3M A;  2E35 A;  2K86 A;  4RGX A;  2RNG A;  4U88 A;  2CW7 A;  2MAB A;  1ORK A;  1QRY A;  2OBP A;  4OIO F;  4E6K G;  4JYK A;  1XG1 A;  3HOS A;  3BR2 A;  4NC6 A;  1F4K A;  3IKV A;  1FNN A;  4RM3 A;  2FQ3 A;  3LOC A;  2ZJR F;  2QEX I;  3TED A;  2X0L A;  4HDU A;  3OWT A;  4BQN A;  4E4H A;  4KIS A;  2XB0 X;  5DUK A;  1G8X A;  1TWA J;  1UST A;  2H94 A;  5BPD A;  1OYY A;  5FKN A;  4PJN A;  4DJA A;  3O8H A;  4IQ4 A;  4UB6 C;  3K4B A;  1Z77 A;  1K78 A;  5IP9 J;  1MMS A;  4UV9 A;  3BT9 A;  3CC4 I;  3NWT A;  3Q0U A;  1T6S A;  3GME A;  4DOZ A;  2FQ4 A;  3ZMS A;  2A6E F;  2JA8 J;  3CMY A;  4ZTF A;  4XLF A;  2OTL I;  1KQ8 A;  2IW5 A;  3QWL A;  2ELK A;  1O57 A;  5B66 C;  4D1Q A;  2CQ7 A;  2WA0 A;  3QOD A;  5H6R A;  5FLV A;  3DBL B;  3RYP A;  1GVD A;  3BZC A;  4C3J J;  1LDK B;  1BW6 A;  4P5O A;  2PMH A;  1ODD A;  2RVC A;  3H1C A;  3R6S A;  3H3V K;  4IRH A;  1LVA A;  1XGS A;  3CUQ C;  5LD2 C;  3F72 A;  1A6Q A;  2B63 J;  3N4M A;  1XMA A;  4DGW B;  1JTX A;  3B73 A;  5GPC A;  2GBY A;  4BY1 J;  5E17 F;  2FNA A;  3HIF A;  2F4I A;  4AC0 A;  1B72 A;  2XAU A;  2L4A A;  4LFU A;  3QQA A;  4DIQ A;  3MCZ A;  2TRT A;  3E97 A;  1POG A;  2DJI A;  4XRS G;  5DV5 A;  3OYN A;  4FQG A;  2B0L A;  4JX6 A;  1ETW A;  3E1S A;  1R00 A;  4BEH B;  5FD5 A;  2DA2 A;  4ZYH A;  4A0Z A;  5D8L B;  5JR3 A;  1YW8 A;  2Y69 H;  3S3O A;  4BAY A;  2A07 F;  3DLA A;  2XF7 A;  3H5R A;  2XAS A;  3F8B A;  3SDB A;  3NRV A;  5LRS A;  1O3R A;  1ZGW A;  1FC3 A;  3M8F A;  2EFW A;  3BR1 A;  1DPU A;  2BZT A;  2LRD A;  3MMY B;  4ZYE A;  3VB2 A;  3S2H J;  3X2Q H;  2LF8 A;  3UNG C;  4X1E A;  4IX7 A;  4DQ2 A;  4MFD A;  1I1G A;  3IKT A;  4B47 A;  2ISY A;  1IV6 A;  2HXO A;  1UHM A;  3WU2 C;  3BTC A;  2J5O A;  5IY5 H;  2HR3 A;  2XRN A;  3GZ6 A;  2V1X A;  2M3A A;  3PNT A;  2VKH A;  2XF6 A;  3LMM A;  2E7X A;  5J6X A;  2DMT A;  3FWE A;  3HL2 A;  3CDI A;  1NH3 A;  1ETY A;  4UVA A;  3H35 A;  3HJE A;  1W7P B;  4G7O F;  4ESJ A;  2DDB A;  4WF2 A;  5EJC A;  2IS4 A;  1QHG A;  4XSZ F;  1S72 I;  3CUQ B;  2QBY B;  4UV8 A;  4YEJ A;  2D5V A;  1MH3 A;  3CJR B;  4UXN A;  3OYC A;  2E2H J;  1VQP I;  1UG0 A;  3ELK A;  1T33 A;  3HXL A;  1FP2 A;  2K4B A;  4PGH A;  1JE8 A;  1KU9 A;  3A1Y A;  3IC7 A;  1GXP A;  3CCE I;  2K40 A;  2HPM A;  3KYC B;  1EV7 A;  3ZOB A;  2CUF A;  3HOW J;  5AIP A;  1JJ6 C;  3OSF A;  2QEN A;  1JT0 A;  2VXZ A;  1JGG A;  1IRG A;  2OPT A;  4OIP F;  4YIR X;  4IKF A;  3S1M J;  2IT0 A;  4K2E A;  3JTG A;  1ON2 A;  4ZH4 F;  3CCJ I;  2IP2 A;  1KQ0 A;  5FGM A;  3MD2 A;  3D5L A;  2VON A;  3K2Z A;  2ZBK A;  4F92 B;  3KP5 A;  2QQ8 A;  3DPL C;  4N4O B;  2JA2 A;  3U2R A;  4ENK A;  1YE9 A;  2EA2 A;  2HKX A;  4BJ5 C;  4HNT A;  1LFU P;  3I58 A;  3COA C;  1JTY A;  4NC7 A;  1UEL B;  4XK4 A;  5JHU A;  4S05 A;  4C2U A;  1LKX A;  1K83 J;  3Q0V A;  1UHW A;  2LR8 A;  1YRN B;  1MND A;  4NNJ A;  3U21 A;  3L2C A;  1OCO H;  4KT5 C;  1FBS A;  2MSY A;  4Y15 A;  1S7O A;  3BG7 A;  3JTH A;  2EZI A;  2NVQ J;  3ISP A;  2L7F P;  1XS9 A;  3CDH A;  4BXF A;  4Y7N J;  1IDY A;  1VF9 A;  1YIJ I;  1JKQ C;  4MGR A;  1REP C;  1UHS A;  2NS0 A;  4RGR A;  2PJR B;  3WTW C;  1IDZ A;  1R23 A;  2LOO A;  1I27 A;  2JVG A;  2N8G A;  3R0J A;  5FB2 A;  4KT6 A;  5EGO B;  1Y1W J;  1WSU A;  5F08 A;  1PUE E;  2CV0 A;  3RZO J;  2ZO4 A;  2CFO A;  3BG9 A;  1RZ4 A;  1WH7 A;  2Y2Z A;  3BDD A;  2P7V B;  3PJR A;  2E36 A;  4HF1 A;  2K9L A;  4PUS A;  3LNQ A;  1X4P A;  1LVK A;  2GXG A;  1BIA A;  3AG2 H;  1HLV A;  1Z7L A;  3VSL A;  1YIO A;  3K0L A;  5GP9 A;  4WXC A;  1VQ7 I;  3ESW B;  3CF5 F;  4EJO A;  2GOX B;  5LGT A;  3SHF A;  2YX7 A;  4HSR A;  2Q2E A;  3V8L A;  2HU9 A;  2FUG 2;  2GOM A;  3ABM H;  4OIN F;  1ETQ A;  2BY1 A;  2K5C A;  4NUB A;  2EIJ H;  3CCY A;  4B4C A;  2M1B A;  4IXA A;  2AO9 A;  3I54 A;  2ESN A;  3IRQ A;  3FXJ A;  4AVZ A;  2E1C A;  1VQ9 I;  5CQG A;  6PAX A;  3A02 A;  3RPU A;  3G71 I;  3WE3 A;  3JCU C;  1LE8 A;  1BA5 A;  4IHY A;  1LJ9 A;  2VLA A;  5F6F A;  2ZXJ A;  4L9T A;  1G59 A;  3DPU A;  3GYH X;  1UZC A;  3PNV A;  4XRF A;  4EM1 A;  2NVX J;  2R93 J;  1VQ5 I;  1IJW C;  3F8N A;  1X1D A;  3VPR A;  1UMQ A;  1TL8 A;  1PP7 U;  1OR7 C;  1G4D A;  2BHZ A;  1U2W A;  3RDI A;  2IRF G;  4KUM A;  3GW2 A;  2FBI A;  2OA4 A;  1YJ9 I;  4PJM A;  1G3S A;  1OLT A;  4II3 A;  4XRS A;  1FEX A;  2R7F A;  1QZE A;  2E71 A;  3A01 B;  3BR3 A;  4YFK F;  4HZF A;  4DZP A;  3ERM A;  3BY6 A;  3LSH A;  2AXL A;  1JGS A;  4MTE A;  4YIF A;  1O3T A;  2STT A;  3QPT A;  4IEJ A;  2VAS A;  2VB6 A;  1BJZ A;  3FX3 A;  4GGG A;  4W97 A;  2JA6 J;  2V26 A;  3ZP5 A;  4IZZ A;  3BZ6 A;  1EA3 A;  1XCB A;  1BI2 A;  1BM9 A;  3BPX A;  1I3Q J;  2E1O A;  2W00 A;  1TQI A;  3E5Q A;  2ZME A;  2W7N A;  2LDU A;  4I7H A;  1TNS A;  3QAH A;  1ZG1 A;  5JFR A;  2JUG A;  3J7Y J;  1U78 A;  2R5Z A;  5CVR A;  1ZG3 A;  1OKR A;  1C0W A;  3GUD A;  1ZHF A;  5GTH C;  3VYU B;  1AKH B;  5JHF A;  2JZY A;  2QUF A;  5DDG A;  3LAP A;  4RA2 A;  1YIT I;  1QVT A;  2L7M P;  1W36 C;  1YQA A;  2DCE A;  4DNC A;  4XIC A;  5IP6 A;  3AAF A;  2CGP A;  1JKP C;  4QWQ A;  1BOB A;  2FSW A;  2EIL H;  1FIA A;  4OMZ A;  2A6T A;  1IGN A;  4A3J J;  2Z9O A;  2RQP A;  3OOU A;  3J7Z I;  1NG6 A;  4LIT A;  2KIM A;  2MC3 A;  3P7N A;  4O6J A;  3KEO A;  4GXO A;  1B8I A;  4M72 A;  5F0F A;  2PBI A;  1USS A;  4TV7 A;  1R9T J;  1P2F A;  1IZ1 A;  4MLO A;  3BCB A;  4QSH A;  4PK4 A;  1B4A A;  2DLL A;  3LSM A;  1G3Y A;  4F93 B;  1T2K A;  3MAJ A;  2BVL A;  2R5Y A;  4G7Z F;  1FTZ A;  1JHH A;  2H8R A;  2IA2 A;  3I59 B;  2DQL A;  3PQJ A;  2OJE D;  5C4X J;  1WWX A;  4EJW A;  2X6O A;  4KYW A;  2HYG D;  1R4N B;  1KZH A;  1Y39 A;  3FK6 A;  3S1N J;  3M1E A;  3JW4 A;  1GLN A;  3E6C C;  1ZR2 A;  3GFI A;  1SAX A;  3K4C A;  1ZGA A;  3PSI A;  3I64 A;  2OZ6 A;  4IQJ A;  1E3H A;  1OCR H;  1YTY A;  1JJ8 C;  2DBB A;  3CCL I;  5J47 A;  4I0A A;  1TQM A;  2ZXW H;  1ZR4 A;  2CUZ A;  4MO7 A;  2F4M B;  1DU0 A;  2ECB A;  2X1D A;  3QYE A;  3C18 A;  3GVA A;  1LNW A;  1Z3Y A;  3H36 A;  1Z1D A;  1QHH D;  1S3J A;  3FMS A;  5LHG A;  2CJJ A;  3CC7 I;  3KET A;  3OYJ A;  3S8P A;  2HTJ A;  1I6H J;  3ONQ A;  3QP6 A;  3QPS A;  1S6L A;  2KT0 A;  5JVG F;  1FOK A;  4WXD A;  3ERE D;  3QRF F;  2TDX A;  2IBD A;  2KLO A;  5LLQ A;  2O5R A;  2ZNY A;  5JI6 A;  1RR7 A;  3BTL A;  2X1E A;  1LFP A;  3GCM A;  2LC2 A;  2CQK A;  3VYR B;  1WJA A;  4BNC A;  5TGT A;  2M5W A;  2A6H F;  2BYV E;  1Q1H A;  2VQH A;  3ZRG A;  3M8J A;  1R1U A;  2O6G E;  2E5N A;  1NG7 A;  3N97 A;  2PFB A;  3MKW B;  2A61 A;  5JLW A;  1OCZ H;  1B59 A;  1BI1 A;  1F1Z A;  4ITV A;  4M3G A;  3TBI A;  2JRM A;  2IS2 A;  1ERD A;  2R7D A;  5L3B A;  1FYK A;  2M4G A;  4RAZ A;  3EYI A;  1SC7 A;  4BKX A;  5K1Y A;  2DYR H;  2JK3 A;  3C2G A;  4U7D A;  2EA4 A;  2VI6 A;  1EKE A;  2W84 A;  1S5L C;  4Q5S F;  3S32 A;  2VQL A;  4S0H B;  3QU6 A;  4A5N A;  5FKL A;  4M73 A;  5KAF C;  3OYE A;  4LD5 A;  3T1B A;  1ZAO A;  1MMA A;  3EPZ A;  2OAZ A;  3SDG A;  5TRD A;  4XR6 A;  1SFU A;  1IAW A;  4AWX B;  4RM2 A;  1MBF A;  3GLL A;  3QOP A;  3ML6 A;  5J1R A;  3S16 J;  4BE0 A;  1B9M A;  3FM3 A;  3GTJ J;  2A5W A;  1BW5 A;  1AOY A;  3BLY A;  1FWZ A;  1RRJ A; 
#chains in the Genus database with same CATH homology
 3JRD A;  5IP7 J;  2Y9Y A;  3GTG J;  3PO3 J;  4FTH A;  1ORK A;  1QRY A;  4JYK A;  1XG1 A;  3BR2 A;  2E2I J;  2NVT J;  3WHB A;  5F27 A;  3HOY J;  3S2D J;  2M8G X;  3LOC A;  5IYC J;  5IYB J;  3M4O J;  3TED A;  2HXI A;  1VI0 A;  2DMQ A;  2XB0 X;  5EG0 B;  1TWA J;  2HOA A;  4DYR A;  1B72 B;  1ITY A;  1JUP A;  2Y9Z A;  5FKN A;  2LP0 A;  3O8H A;  2H1K A;  3S14 J;  1Z77 A;  2DN0 A;  4G12 A;  1AKH A;  3RQI A;  5C4J J;  2MG4 A;  3GTL J;  1EF4 A;  5IP9 J;  1BL0 A;  3BT9 A;  3IH2 A;  2CQQ A;  3Q0U A;  2XB5 A;  3HGY A;  2LKX A;  4A3K J;  2DMU A;  2FQ4 A;  2XRL A;  4A3D J;  5IOZ A;  2JA8 J;  1MBE A;  3IH4 A;  4D7M A;  3CMY A;  2HOS A;  1APL C;  2R0Q C;  2ELK A;  2DA6 A;  5FLV A;  3OSG A;  1GVD A;  4C3J J;  1BW6 A;  1G2H A;  3H3V K;  1HF0 A;  3O8G A;  2GLO A;  2VUM J;  3ZQL A;  1U9N A;  4FCY A;  2B63 J;  2EZL A;  1JTX A;  4BY1 J;  3B6A A;  2GBY A;  5GPC A;  4AC0 A;  1B72 A;  3QQA A;  4XRS G;  2TRT A;  1POG A;  2KDZ A;  1ZK8 A;  3E7L A;  2LFB A;  5J3L A;  4DW6 A;  4JX6 A;  1ETW A;  2CQX A;  2DA2 A;  5FKM A;  2COB A;  4LOC A;  1HDD C;  3LSR A;  1WI3 A;  5BNG A;  1ETV A;  4UUS B;  4XRM A;  2OF7 A;  2TCT A;  4NDL A;  1ZGW A;  1AHD P;  3S17 J;  2AHQ A;  3BR1 A;  3TW6 A;  3BQY A;  3S2H J;  4X1E A;  4M3E A;  3HOV J;  3FIW A;  4MFD A;  5IYD J;  1ETO A;  4A3I J;  4IHW A;  3JRA A;  1IV6 A;  2HXO A;  5C3E J;  4BBS J;  2DA1 A;  3BTC A;  4BXX J;  1TWF J;  1MBK A;  2DMT A;  3JRB A;  1MNM C;  2ME0 A;  1ETY A;  1X58 A;  3S1R J;  1P7J A;  5M5X J;  3H0G J;  1XC5 A;  9ANT A;  1VFC A;  2D5V A;  1MH3 A;  3NAU A;  2NOG A;  3JRE A;  1GDT A;  3D1N I;  2E2H J;  3WHC A;  3PM1 A;  1WH5 A;  1K61 A;  4BBR J;  3BR0 A;  1QVU A;  1T33 A;  1JT6 A;  2RAE A;  3A03 A;  1Z0X A;  4J19 A;  1WGX A;  3FK7 A;  4M6V A;  2K40 A;  5DS9 A;  1Y1V J;  3ZOB A;  2CUF A;  4RBO A;  3HOW J;  1JJ6 C;  2CRG A;  3OSF A;  4IHX A;  1JT0 A;  1JGG A;  2OPT A;  3FKI J;  3S1M J;  2E2J J;  5M5Y J;  2XPU A;  2R92 J;  3HBL A;  2XPV A;  1WPK A;  3JRH A;  4DZJ A;  3TW7 A;  3JRG A;  3G1M A;  1SFO J;  1O4X A;  4FIS A;  1LFU P;  5FKK A;  2PMZ N;  2JA7 J;  1JTY A;  5EEA A;  2EBI A;  4XK4 A;  4AUX A;  5EYR A;  5K7Z A;  3BTI A;  2G0E A;  2QCO A;  3SJM A;  1K83 J;  3Q0V A;  4DYC A;  2LR8 A;  5EDN A;  2XSD C;  1YRN B;  2JJ7 A;  2MSY A;  5F0C A;  1X2N A;  2FJ1 A;  3QPL A;  3NAR A;  4ABZ A;  2MGQ A;  3HM5 A;  2NVQ J;  2EZI A;  4UUT A;  1XS9 A;  1TWG J;  2L7F P;  4I6Z A;  1MSF C;  3B6C A;  2DJN A;  3I4N J;  4Y7N J;  1DU6 A;  1IDY A;  1VF9 A;  1JKQ C;  1JKO C;  3HOX J;  1UHS A;  4A3M J;  1F36 A;  2CU7 A;  3F0C A;  1IUF A;  1IDZ A;  2N8G A;  3DCF A;  5EGO B;  3FIS A;  1Y1W J;  5F08 A;  1HDP A;  3ZQC A;  1S7E A;  3RZO J;  2VKE A;  1WH7 A;  3BG9 A;  2Y2Z A;  1P7I A;  2DTZ A;  3CDL A;  1OJL A;  3LSJ A;  3OIO A;  2P81 A;  5M3M J;  4HNV A;  1LE8 B;  3LNQ A;  5EG0 A;  2M34 A;  3JRI A;  2L0K A;  3RKQ A;  5K7H A;  3LSG A;  1IC8 A;  2I10 A;  1HLV A;  1YRN A;  4A3C J;  1JUS A;  3K2A A;  4D7N A;  2O8K A;  2HDD A;  5GP9 A;  2K9N A;  2WV1 A;  2JA5 J;  5IOY A;  3M3Y J;  4JX5 A;  4A3F J;  2IAI A;  3GTO J;  1ETQ A;  3CQZ J;  3CCY A;  2HYJ A;  5E3O A;  4B4C A;  2XGE A;  2AO9 A;  3GBG A;  2JWT A;  2EH3 A;  1PUF B;  3Q0W A;  1RPW A;  3BTJ A;  5E3N A;  3HEF A;  4D5C A;  2YU9 J;  2DA4 A;  3A02 A;  4M3B A;  1LE8 A;  1BA5 A;  4IHY A;  3L1P A;  1GV5 A;  2DA3 A;  2YUS A;  4B1R A;  2NVX J;  2R93 J;  1A6I A;  1IJW C;  5E3L A;  1MBG A;  1IRZ A;  3JRF A;  2HQ5 A;  3VPR A;  1UMQ A;  4A3B J;  3HOZ J;  4X6A J;  1ZTR A;  1UG2 A;  1W0T A;  2R5Z B;  4UUS A;  1TWC J;  4V2G A;  5M5W J;  1H88 C;  2HI3 A;  2LY9 A;  4MIM A;  2O7O A;  2LD5 A;  2L7Z A;  1H89 C;  3ZQI A;  2ZB9 A;  5C44 J;  4XRS A;  1FEX A;  3A01 B;  5F04 A;  4EEF G;  3BR3 A;  2X9D A;  4M3F A;  4RDU A;  4DZP A;  1PUF A;  5FKO A;  5JLX A;  3PO2 J;  2XGD A;  3I4M J;  4W1U A;  1FJL A;  4CYC B;  4IEJ A;  1WCM J;  5J1U A;  5EZH A;  3HKZ N;  1BJZ A;  2M2E A;  4W97 A;  4A3L J;  2JA6 J;  2ME6 A;  1I3Q J;  2DMP A;  2E1O A;  2E19 A;  4JX4 A;  1B8I B;  3HDD A;  4QTR A;  3BG3 A;  1H8A C;  3TP3 A;  3MVP A;  2R5Z A;  1U78 A;  1T56 A;  3GTM J;  2R5Y B;  1AKH B;  4XID A;  5M3F J;  5K7F A;  2CUE A;  4D5F A;  2O9L A;  1ENH A;  3GTK J;  1QVT A;  3K7A J;  2L7M P;  4XIC A;  5IP6 A;  1JKP C;  5IPA A;  2R7Z J;  2LVS A;  2WAQ N;  1FIA A;  2Y31 A;  1X2M A;  1HOM A;  4CYC A;  3BR6 A;  4C2M J;  1NTC A;  3ZQH A;  4A3J J;  1IGN A;  1RKT A;  3OOU A;  1RET A;  1GT0 C;  2M0C A;  2LTP A;  2EQR A;  1CQT A;  2W48 A;  1JUM A;  1A5J A;  1B8I A;  2JMW A;  5F0F A;  3GTP J;  3G1L A;  1R9T J;  1D5Y A;  5J1Y A;  5E3M A;  1ETK A;  1ZKG A;  2VPR A;  4MLO A;  4QSH A;  5EF6 A;  4A69 C;  3BR5 A;  3G1O A;  3TP0 A;  3ZQF A;  2R5Y A;  4L5E A;  1FTZ A;  1TC3 C;  2H8R A;  1ZQ3 P;  5C4X J;  1AU7 A;  1FTT A;  2GM4 A;  1TWH J;  1Q1V A;  4A3G J;  1OCP A;  3IH3 A;  1HCR A;  2X6O A;  1IG7 A;  1W0U A;  1ETX A;  3IV5 A;  3FK6 A;  3BG5 A;  1VND A;  3S1N J;  4V2F A;  1ZR2 A;  2NVY J;  3LSP A;  1U8B A;  4MFE A;  2Y30 A;  2JN6 A;  4BY7 J;  2FX0 A;  2QF7 A;  1JJ8 C;  3JRC A;  1SAN A;  2ID3 A;  2YS9 A;  1I50 J;  1MBH A;  2FD5 A;  1NK3 P;  2ECC A;  5EGO A;  1ZR4 A;  4MO7 A;  2LK2 A;  1DU0 A;  2ECB A;  4FE7 A;  3W6V A;  3MN2 A;  2LLK A;  2NS8 A;  2XPW A;  2MW8 A;  4M3D A;  3MKL A;  2WB1 N;  2CJJ A;  2Y0S N;  3HGG A;  1OCT C;  4A93 J;  3S1Q J;  4C3H J;  2ID6 A;  1I6H J;  1E3O C;  2L9R A;  2EZK A;  3QPS A;  5F1J A;  2KT0 A;  4C3I J;  2IEK A;  4IHV A;  2NS7 A;  4Y52 J;  2IBD A;  4FE4 A;  3JR9 A;  1RR7 A;  2DA7 A;  3BTL A;  3SFI A;  2HOT A;  2X48 A;  1RKW A;  5FLM J;  2VKV A;  1MSE C;  4GFB A;  5F0H A;  2DA5 A;  4JP0 A;  3S15 J;  4QIW N;  1GV2 A;  5EZG A;  5JLW A;  3ZQG A;  1NK2 P;  1F43 A;  3UKG A;  4M3G A;  2DMN A;  1LFB A;  1FIP A;  2K9Q A;  3C2B A;  3GTQ J;  4BKX A;  2JK3 A;  5FJ8 J;  1RES A;  1JKR C;  4DYQ A;  5HOD A;  4B3A A;  2VI6 A;  3HOU J;  5GPA A;  1OFC X;  4S0H B;  4A3E J;  4I76 A;  3DEW A;  4AYB N;  5FKL A;  1MH4 A;  2M9H A;  2XGC A;  1QPI A;  3SDG A;  2EZH A;  3BQZ A;  1MBF A;  1U9O A;  5J1R A;  2K9S A;  3HB9 A;  3S16 J;  5DTD A;  3GTJ J;  1GUU A;  1BW5 A;  3A01 A;  1MBJ A;  3RZD J;  3Q3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...