1HLVA

Crystal structure of cenp-b(1-129) complexed with the cenp-b box dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
131
structure length
131
Chain Sequence
MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASNGWLDRFRRRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords CENP-B BOX DNA
publication title Crystal structure of the CENP-B protein-DNA complex: the DNA-binding domains of CENP-B induce kinks in the CENP-B box DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2000-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04218 CENP-B_N CENP-B N-terminal DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1hlvA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1hlvA01
4BBSJ 2CQXA 4XICA 1P7JA 1T56A 2LR8A 2QF7A 3L1PA 1JTXA 4XRSA 2M34A 3HOVJ 3JRDA 2GBYA 3BTLA 2EZLA 1F36A 4DZJA 3I4NJ 3LOCA 4B4CA 5GPAA 4XRSG 5IPAA 2CQQA 2VKEA 4AUXA 3G1MA 1WCMJ 5M3FJ 1ZR4A 3HBLA 1LFUP 3PO3J 3ZQHA 3GTPJ 3BR6A 3JRIA 2CU7A 1H88C 4JYKA 5J1YA 5IYCJ 2DA4A 1LE8A 3S14J 2LY9A 4DZPA 2CRGA 3ZQFA 2M0CA 4Y7NJ 3GTQJ 2DA5A 4UUTA 1U78A 3CQZJ 3TP3A 2JA8J 1XC5A 1GV2A 3FISA 2EBIA 2VPRA 4M6VA 2O8KA 1DU6A 2CUFA 1BW6A 2XB5A 1HOMA 1OCPA 1HCRA 4C3JJ 2DMTA 4JX4A 2COBA 2M2EA 3C2BA 4MIMA 2DA2A 3BQZA 3H3VK 1OFCX 4QSHA 2NS7A 3RKQA 2CJJA 1WPKA 2NVQJ 2H8RA 1B72B 2GLOA 2L7MP 2Y30A 1JKQC 2XPWA 1IDYA 2HYJA 4IHYA 1IG7A 5EGOB 2R5YB 2E2JJ 3K2AA 2WV1A 2MW8A 1E3OC 2K9NA 1ZQ3P 1RPWA 4C3HJ 2DMQA 5M3MJ 3PO2J 4DYQA 3BT9A 1FIPA 1MH3A 3S16J 1UG2A 2IEKA 2LK2A 3TP0A 3BR0A 4X6AJ 2KT0A 3A01A 3FKIJ 2TRTA 3BG9A 3S17J 2L9RA 5FLMJ 2FJ1A 3JR9A 5E3NA 2YU9J 5E3OA 3ZQLA 2ID3A 1WH7A 2FD5A 1JGGA 1FEXA 5EEAA 2LFBA 5F0FA 5F1JA 1BL0A 9ANTA 4IHXA 1JT6A 1HLVA 2R7ZJ 2LKXA 5M5WJ 3QPSA 1XS9A 2EZHA 3Q0VA 3GTKJ 4IEJA 2E2HJ 3LSPA 5IOZA 1MBKA 1NK2P 1TC3C 3HOYJ 2DA6A 4J19A 2NS8A 1G2HA 3GTMJ 3FIWA 1X2MA 1VNDA 1BA5A 4D7NA 4IHWA 1EF4A 2YUSA 3BR5A 3IV5A 2R93J 2K9SA 3F0CA 1K83J 5BNGA 3HGYA 5C44J 1VF9A 3G1LA 1BJZA 5IP9J 2MG4A 2DN0A 4D7MA 5J1UA 1XG1A 2JK3A 2FQ4A 2EZKA 3JRGA 2L0KA 1Y1WJ 4C2MJ 3GTGJ 3ZQGA 4LOCA 1PUFA 1ETVA 1VI0A 4M3FA 1DU0A 3UKGA 3B6CA 4DYRA 2Y31A 5C4JJ 3ZQCA 3HOXJ 1X58A 5DS9A 2JN6A 1HF0A 4M3EA 3JRHA 5E3MA 1T33A 4JX5A 4B3AA 4QIWN 3HEFA 1U8BA 2ECCA 1YRNA 1F43A 4BY1J 1GV5A 1A5JA 4GFBA 1JT0A 2XPUA 2KDZA 1RR7A 2ZB9A 2LVSA 3DCFA 1LFBA 3IH4A 4M3DA 1H8AC 4A69C 3JRAA 2M8GX 3JREA 3HDDA 4FE7A 3TW6A 4D5FA 3JRBA 1Z0XA 1RESA 1JTYA 1ZK8A 3RZDJ 5GP9A 2L7ZA 3MKLA 1H89C 2EZIA 2E1OA 5K7FA 2IAIA 3S1NJ 2N8GA 1QVTA 3BR1A 2K9QA 2AO9A 1B8IA 1Q1VA 2OPTA 2JMWA 4Y52J 1TWAJ 2W48A 3HKZN 5FKLA 3CDLA 2LD5A 1FTZA 2NVXJ 4JX6A 2M9HA 3GBGA 1FIAA 5DTDA 4NDLA 4A93J 1MH4A 1TWGJ 1ZGWA 1ZR2A 3FK6A 5FKNA 4A3LJ 5IYBJ 5FJ8J 5K7HA 5E3LA 4RDUA 3VPRA 4A3GJ 1I6HJ 4CYCA 2D5VA 4UUSA 1NTCA 1ETQA 3A01B 2I10A 1ETWA 2MSYA 3G1OA 2R92J 3W6VA 1Z77A 2LP0A 5JLXA 1ZTRA 1MSFC 2X9DA 4HNVA 4DYCA 2DA1A 2XGCA 2EH3A 4AYBN 2JWTA 3HM5A 2X6OA 2DMNA 1JKOC 1K61A 2HOSA 4MFEA 5C4XJ 2VI6A 3WHBA 2P81A 1AHDP 3CCYA 3LNQA 2XB0X 1GDTA 2JA5J 2RAEA 5F0HA 2E2IJ 4ABZA 2R5ZA 2Y9ZA 2VKVA 1FJLA 2IBDA 1D5YA 1TWCJ 1RETA 5FKMA 4S0HB 4DW6A 2R0QC 3S2HJ 3RQIA 4W97A 1MBGA 2XSDC 1JKPC 3ZOBA 3OOUA 1QRYA 3S1RJ 3NAUA 5EG0A 1WGXA 1Y1VJ 2DTZA 3M3YJ 2TCTA 2AHQA 2X48A 1PUFB 1RKTA 3IH2A 1WI3A 1TWHJ 1OCTC 2JA7J 4FCYA 3S1QJ 3DEWA 5IP6A 5M5XJ 2NVTJ 4BKXA 5EZGA 3ZQIA 5F27A 2HQ5A 4MO7A 2CUEA 2B63J 2GM4A 2DMUA 3NARA 1YRNB 5F08A 3RZOJ 5J3LA 2PMZN 1TWFJ 1U9OA 3I4MJ 3M4OJ 3OSGA 1MBFA 4BXXJ 1W0UA 3S2DJ 4MLOA 4A3BJ 3PM1A 2Y2ZA 1MBHA 1QPIA 1LE8B 3HGGA 1W0TA 4A3EJ 1X2NA 5FKOA 2YS9A 1IV6A 2MGQA 4FISA 1SFOJ 2HXIA 2NOGA 2ID6A 3CMYA 3S1MJ 1APLC 4A3IJ 4BBRJ 2ME6A 3BTIA 1AKHA 4W1UA 4D5CA 2O9LA 4A3JJ 1ORKA 2ME0A 3MN2A 3MVPA 2XPVA 3BR3A 3A02A 3HOUJ 5M5YJ 5EF6A 2L7FP 3Q3SA 4X1EA 5HODA 3H0GJ 1CQTA 5K7ZA 1MSEC 2K40A 4CYCB 3GTOJ 2FX0A 4MFDA 1FTTA 4V2GA 4UUSB 3TEDA 2HOTA 4XIDA 1MBEA 1P7IA 1MNMC 5FLVA 1IRZA 2NVYJ 3OSFA 1VFCA 4JP0A 2DA3A 1ENHA 1GVDA 1JUMA 3QPLA 3SDGA 1I3QJ 3BTJA 3FK7A 2VUMJ 4XK4A 5J1RA 4L5EA 4FE4A 1ETYA 2O7OA 3LSGA 1ITYA 2HXOA 2JJ7A 4AC0A 3Q0WA 5FKKA 1IDZA 4M3GA 3S15J 4A3KJ 1GT0C 5F0CA 1I50J 2R5ZB 5IYDJ 2E19A 2Y9YA 4FTHA 2Y0SN 5IOYA 2HI3A 2XRLA 1SANA 5JLWA 5IP7J 2QCOA 3O8GA 2XGDA 3JRFA 4C3IJ 4A3MJ 4QTRA 5EZHA 3GTLJ 2H1KA 2DMPA 5EG0B 1O4XA 1OJLA 2DJNA 3TW7A 3K7AJ 1ZKGA 4M3BA 3HOWJ 4I6ZA 2HDDA 1R9TJ 2DA7A 3HB9A 1A6IA 3B6AA 2ELKA 4A3DJ 5EDNA 3WHCA 1AU7A 1ETOA 1ETXA 1B72A 1QVUA 4IHVA 3SFIA 4RBOA 5GPCA 3A03A 1BW5A 3BG3A 3OIOA 5EGOA 3LSRA 2R5YA 3LSJA 2HOAA 4V2FA 4G12A 2EQRA 2JA6J 2G0EA 4A3FJ 4EEFG 3Q0UA 1IC8A 3HOZJ 2LLKA 1JKRC 3BQYA 3JRCA 1MBJA 1GUUA 1HDDC 1IGNA 1ETKA 3BTCA 3QQAA 4I76A 2WB1N 1WH5A 1JUSA 4A3CJ 5EYRA 2ECBA 1UMQA 3BG5A 4BY7J 3D1NI 1AKHB 1JUPA 4XRMA 3E7LA 2OF7A 3IH3A 2WAQN 5C3EJ 1IUFA 1S7EA 1JJ6C 4B1RA 1RKWA 2XGEA 1POGA 3BR2A 5F04A 2LTPA 1IJWC 1U9NA 1UHSA 1B8IB 1JJ8C 1HDPA 1NK3P 3GTJJ 3O8HA 3SJMA
chains in the Genus database with same CATH superfamily
1YX5A 2EB7A 3S3OA 3WTXC 1MNDA 2VJ4A 2KJCA 1WJEA 2OU2A 4F52A 3OYFA 3HOVJ 2JSPA 1ZH5A 2RREA 4LLGF 2GBYA 5JR3A 2EZLA 3FXRA 1UFMA 4YIFA 2V4JC 1WI9A 3SFZA 2CSOA 1WJDA 3HBLA 4EMSA 1NG7A 3ZQHA 4P96A 2HPIA 3GTPJ 3JRIA 2CU7A 3C18A 1XPXA 4XLFA 1H88C 5J1YA 5IYCJ 4ENMA 4L9NA 3E6CC 2DXIA 2FSWA 4U7DA 4B43A 4DZPA 2M7BA 2BVMA 3EDPA 1LDJA 3GTQJ 5FO5A 1U78A 4FASD 1FOWA 2EILH 2PJRB 1NH3A 1RIOH 4A5MA 3M1EA 2V1XA 4PJJA 2XASA 4BQQA 3WTWC 1BW6A 2XB5A 2P7VB 2VBWA 2M2EA 4JX4A 2M87A 2NRAC 4H0EA 5CYVA 4MIMA 4G9YA 4XONA 1MMGA 5DD8A 3HRUA 2F48A 3K2ZA 2PG4A 2HVQA 2HS5A 2X6XA 1W5CC 5D4RA 1ERDA 4NUBA 1OFCX 2G7UA 3QPHA 2F5FA 4R8HA 5ERIA 1IV8A 2GQQA 2F4IA 3U9GA 3FKJA 4XMYA 2CJJA 5TGTA 2VT3A 3F8MA 4CCJA 1U2WA 1KONA 2E5ZA 3KZYA 4MEYF 1B72B 4LIVA 1FMWA 5KAIC 4BH9A 1Y0NA 2FBIA 4IHYA 4FX0A 5FD5A 2MLGA 3S93A 2IS2A 5KK1A 5EGOB 3L2RA 2AXTC 1IXSB 3GFJA 4HV5A 4BS9A 2DYRH 1E3OC 1ZQ3P 3AG3H 5GAEJ 2HZTA 3DV8A 2X0LA 3FM3A 3H92A 3QU3A 4UY8I 4ITVA 5JHUA 2R7SA 2P6SA 2CUJA 2DOAA 2EV5A 2ZJRF 2LK2A 2CS3A 2UV1A 2UXNA 5K5RA 2J5OA 4B3XA 3FKIJ 3A01A 3SXYA 4FQGA 1FNNA 1R4MB 4E7SA 2L9RA 2VIXA 2FJ1A 4BEHA 3JR9A 1OCCH 4RS8A 2A5WA 1WH7A 2FD5A 4IZZA 3OIPA 5EEAA 4WXCA 4KJZA 3KYDB 3OOPA 4XNFA 2OCCH 2R7ZJ 3MCZA 2LF8A 4BXUA 3LSPA 3VWBA 1MBKA 2DA6A 2XAFA 1XGOA 2DT5A 2KMUA 3GTMJ 1BA5A 2QQBA 1J7KA 3D5RC 4HX4A 2YUSA 1OYIA 4II2A 3WGHA 1EJ9A 4C2TA 5H6QA 2M45A 2K9SA 1D0XA 2ZMEB 1K83J 1GVJA 2IP2A 4J01A 4XLAA 5C44J 1I1SA 1MMNA 1T08B 4CZZA 3DP7A 3RPQA 2MG4A 5CJ9A 2UXXA 4XBFA 4D7MA 5J1UA 3OS0A 1L3LA 2MC3A 2BZTA 5TJJA 2FQ4A 3O2PE 4C2MJ 5D5WB 1K78B 1J59A 4LOCA 3KP7A 3BLYA 1HW1A 5E1XA 4DYRA 2ACJA 3CCRI 3R0AA 2XAGA 2Y48A 4D1QA 2L7KA 1HF0A 2Z2SB 1TT0A 3F8FA 4QIWN 2K3PA 2ECCA 4Q47A 1F43A 2XDVA 1N78A 1D1AA 1GV5A 2XPUA 5BMZA 1RR7A 2LKPA 2IJLA 4D0PA 3I0TA 5L3EA 1LFBA 3IH4A 3FXQA 3VFZA 2CFOA 3QYEA 4I98B 3TOAA 2QSGX 4UVAA 1HKQA 1T0FA 3B02A 3HDDA 2EK5A 4D5FA 2FBHA 2PN6A 4GYIA 3LAJA 2XAJA 1ZK8A 1ZG3A 4LJZF 2DW4A 4BNCA 1H89C 2VC0A 2EZIA 2YX4A 1H0MA 3KYCB 5FFZA 5J6XA 5ILUA 1BR2A 2FQ3A 2VQGA 1BOBA 4B48A 1B8IA 1DDNA 3RQ4A 2OPTA 1DUXC 4ANJA 3OYHA 3V8JA 3E97A 3CDLA 1FTZA 5DYMA 4EATA 2M9HA 3CCEI 1Z6TA 1G8XA 1EH8A 3EUHA 1ZGWA 1K6OA 3EETA 2BOLA 2E36A 2JVGA 2GOMA 2IRFG 2E1NA 1SAUA 4A3LJ 2A61A 1HSTA 2V1NA 2ICWG 1R23A 1FWZA 5K7HA 4ZYDA 4RDUA 4HLYA 1SD4A 3OYMA 4CYCA 1VTNC 4UUSA 3ROUA 1T95A 2XF5A 4IXAA 3WE3A 1XSVA 3ISPA 1O7FA 3BCBA 3ZMTA 2K85A 2H8WA 4L0ZB 2MSYA 3FXOA 2FOWA 1TNTA 1FYKA 1JHFA 2F6CA 2M7AA 5JLXA 1PP7U 1MSFC 1BM9A 1PVEA 2JSCA 2ZJPF 3DWLE 4F93B 2JRTA 3EQLF 2KDOA 2VBYA 2DMNA 4CXFA 1YYVA 1K61A 4M71A 2CG4A 3J7ZI 1I1GA 1W7PB 4M9XA 1AHDP 4EJVA 1IRXA 2E7XA 3S32A 4WWCA 2DDBA 4BU2A 1R5GA 5F0HA 1BBYA 5IY5H 2R5ZA 1AOYA 2Y9ZA 1FJLA 2IBDA 3L9FA 1DGRM 4N4NB 2IT0A 2TDXA 2QQ8A 4CCLA 4MTDA 4S0HB 3H5RA 1YQAA 1WRJA 1T8IA 5HLHA 3L2UA 2CYYA 3OOUA 4XN3A 3WTUC 1QRYA 3KEQA 3S1RJ 2DBBA 3NAUA 1MJ9A 3GFMA 2DTZA 3M3YJ 4RAYA 2TCTA 3KFWX 3ERMA 2AHQA 4RB1A 1GXQA 4BHBA 3DEUA 1TQPA 1WI3A 1OCTC 3S1QJ 4PFPA 3DEWA 4CSWA 4XORA 5M5XJ 1IXRC 4BKXA 1SC7A 1X1AA 4BHPA 5D8KB 2DFIA 4HF0A 2HR3A 2KIMA 1LQ1A 3S3MA 5L3FA 5F08A 2Z16A 1TWFJ 2EFOA 3WODF 2GZWA 3I4MJ 4IQJA 3H3UA 3GO5A 2DYSH 2E1MC 1E3PA 3ASOH 3QYBA 2HYGD 4WK8F 1S3JA 4ESBA 2M1BA 1DGWY 2WAFA 2ISYA 4G8XA 5LEKA 4UB8C 2BY1A 5AIQA 2YS9A 4M9ZA 4FISA 1G3WA 3I59B 2Q8KA 2CW7A 1R49A 2WY7Q 2NOGA 3R4KA 2ZMEC 4PSWA 3OYIA 2DI3A 3CC4I 2CGPA 4BBRJ 3DKXA 3RKYA 4F55A 4BL0B 1Z1DA 2BW3A 4PGHA 3X2QH 2DFHA 5D6EA 3I56I 3U1DA 2K86A 4KIFA 4OMYA 2XUBA 1MDMA 3HOUJ 5ICCA 5HODA 1MW7A 3TEDA 3RJPA 3MFKA 1IUYA 1MNMC 5FLVA 1EV7A 4L9JA 1WQ2A 2H6CA 1VFCA 4JP0A 3FHZA 3HXLA 4MHGA 5CVRA 4MQ9F 3BTJA 3FK7A 4XK4A 4U0YA 4KYWA 1X4OA 2O61A 1A6QA 3K4LA 4PCQA 4FE4A 3V42A 2BHYA 1ETYA 1E0EA 2O7OA 2HKXA 1FLIA 4GGGA 2XAHA 2HQNA 3ZMUA 1VQ4I 2LOOA 2ZFWA 1X1BA 4A3KJ 3ERED 1GT0C 3KP6A 3LSTA 5L3CA 2X1DA 2FUG2 2QZ8A 2MD5A 4DIQA 4EM2A 1J5YA 4FTHA 2EFNA 2YU3A 3Q5FA 1Y56A 2Y0SN 5IOYA 5JLWA 2LBFB 3ZN0A 1TTYA 3CCLI 4ESJA 4M73A 3JRFA 2IVMA 3OYJA 2E34A 4A3MJ 5D5XB 2G7HA 4NQWB 3HRSA 5J8FA 2GIVA 4U87A 3BZ6A 4B8XA 4XOPA 1R4NB 4IRIA 2V79A 3KP2A 3QP5A 2DA7A 2HZDA 4BYYA 4ZDOA 1HSJA 4HF1A 4AIHA 3C7JA 1MMSA 3RTRA 5GAHJ 5EDNA 1ACIA 3H5AA 4ENJA 2IPQX 2L9SA 1XCBA 2GXAA 5TRDA 3Q9SA 3A03A 4PJ0C 1YG2A 3DPUA 3SEQA 5DCMA 3AG1H 3CUQA 2W24A 3FWEA 2R7DA 2R5YA 2HOAA 2B9SA 4G12A 2HDWA 2GXGA 3ABUA 5J4YA 1IC8A 3OYDA 3GZNB 2V1DA 4CZCA 1MBJA 4B47A 2NXNB 2NNYA 5E79C 1GUUA 1UELB 1FC3A 1IGNA 1RZ4A 3OV8A 5GAGJ 4PGGA 2DPUA 4A3CJ 1V4RA 1YIOA 4NBQA 3DU6A 4LB6B 1UMQA 4BY7J 3F8CA 2LKSA 1JUPA 4HAMA 1YTYA 2OF7A 2WA0A 5LLQA 5HNFA 1XGSA 2WAQN 5C3EJ 1P4WA 4O6JA 1IUFA 2ZCWA 4RAZA 1JJ6C 1RKWA 3CUOA 4CH7A 3BR2A 5F04A 1PJRA 1U9NA 4XKVA 1UHSA 1FY7A 3OR1C 2Z1DA 1PYVA 1HDPA 4WF2A 2CMPA 3T0YA 3K0LA 4M6YA 3KLOA 4A0XA 3HYIA 4BBSJ 3CDHA 5JVTA 1T56A 1S7AA 2LR8A 2QF7A 1U5TA 2XSJC 1E2XA 4LIUA 3SEZA 5B1AH 3L1PA 3RSNA 1OCOH 4YFNF 4XRSA 5BOXA 1NG6A 3MZYA 2M34A 1B9NA 4IPAA 3W2WA 3DEEA 3RPUD 5BQTA 4IX7A 2RDPA 3BTLA 3GW2A 1KU2A 2JPCA 2FEZA 2CH0A 4DZJA 3LOCA 5DD4A 3J7YJ 2KISA 2VBXA 3HHGA 2VKEA 5E17F 1UZCA 3G1MA 1ZR4A 1Z91A 5E20A 2PEXA 2Q1ZB 4PUSA 1LKXA 3BR6A 4R79A 3BDDA 4JYKA 4XL9A 2KPMA 1FOKA 4BJTA 1LE8A 2RNGA 3W6JB 2LY9A 3H0DA 2P5KA 2M0CA 2V9VA 3HUGB 1WFXA 5LEJA 4AVPA 1MGTA 4UUTA 3DLAA 2JA8J 2M4GA 2DAOA 1P4AA 4PZJA 2MD0A 2QKMB 2EBIA 1Z05A 2KZGA 3I53A 2O8KA 2NAZA 3NWSA 2M8EA 1UHWA 1HOMA 1OCPA 3LAPA 1HCRA 3AL0B 4FT8A 4OAZA 1IN5A 1F9NA 1E3HA 1I5ZA 4BHCA 2LY1A 4HOBA 4AVZA 2DA2A 4E7LA 2FU4A 3QPTA 3T1BA 3WU0A 3L00A 2L2OA 1YOVB 4QPOA 4QSHA 2NS7A 4ENKA 1WPKA 1G3SA 3FMSA 1YJWI 2H8RA 3VDXA 5H20A 2MH2A 3FDYA 1SEUA 2GLOA 2OA4A 1IDYA 2A6TA 1YX3A 4EJUA 4YRVA 3CJNA 2E60A 1USTA 5HNHA 2CW8A 4L18B 2H09A 2WV1A 1VQOI 2IS1A 2K9NA 1RPWA 2WBMA 1IZ1A 2OAZA 4HNTA 4RAGA 4U0VA 1KQ8A 1X3UA 3GYHX 3K1PA 4HDUA 3FXJA 1B59A 3TP0A 3MKWB 3TOBA 4BQAA 3S17J 3OYCA 5FLMJ 3WU1B 2UUZA 5L3GA 3NQOA 3OYEA 1FEXA 1HQCA 2LFBA 1OMIA 3HZJA 5F0FA 5F1JA 4HX7A 9ANTA 4IHXA 1EA3A 5B1BH 1HLVA 3M8FA 3F8BA 3OYGA 1XS9A 3Q0VA 1V5FA 4EJOA 2BY2A 3M7GA 4IEJA 2X51A 2E2HJ 4GXOA 1TC3C 1NK2P 3DLLF 1Y39A 5LHGA 5HDNA 4J19A 3A0BC 2VT2A 2A5YB 3L7WA 3ZQQA 1ZRFA 1BIAA 1G2HA 4IVNA 4D7NA 4QLCU 5DCFA 1OR7A 5E1WA 4B09A 1FP2A 4P9UA 1X3ZB 2DOEA 3H1CA 3SYTA 1Z7UA 5ED4A 4S05A 4UVCA 1VF9A 3BZCA 1A35A 2XKOA 2P8TA 3QODA 2CO5A 2EZKA 2FRHA 3GTGJ 2KZVA 4YIRX 3BCAA 3CO7C 4KMFA 3VSKA 3BJAA 3UKGA 3B6CA 1DU0A 5C4JJ 1HKSA 1R5HA 1X58A 2GIZA 2VE9A 3QOPA 2WADA 3F22A 1T33A 4JX5A 3HEFA 4C2UA 1JE8A 2Y69H 1K4SA 1REPC 4XKCA 2ZXHA 4ZYHA 1X3WB 2K3FA 2KJBA 3RPUA 1JT0A 4ZC3A 2LVSA 4IRGA 2Y0MA 5EEGA 4HLXA 2DFFA 1XSXA 3JRAA 3JREA 3CO6C 1Z0XA 2VQLA 5E8IA 1RESA 1JTYA 2IXSA 3CCJI 3MKLA 4U88A 1H9GA 1MNEA 2JRMA 4JQFA 2K9QA 3L2WA 3MWMA 4RA2A 5E18F 5HLTA 2RGVA 5FKLA 2M4KA 5CQEA 2LD5A 2ESHA 3GBGA 4CCOA 5DTDA 1MH4A 2NNNA 3HTUA 4IKFA 1X1DA 2OC6A 5F64A 3DFGA 2JVHA 3HKZA 1WJBA 4HPQA 4GDFA 1I6XA 2CQKA 3T5XA 4OINF 2FE3A 3VPRA 1I6HJ 4JBAA 2DCEA 3LFUA 1ETQA 3TO7A 1JHHA 5K5OA 2F4OB 2MBFA 2RVCA 3SZGA 3A01B 5ILVA 3RDIA 2LF7A 4BEHB 1A36A 2YPRA 2R92J 1QBJA 4YELA 4KMUX 1OYWA 2X9DA 1Y6IA 2IGOA 5D6FA 4DYCA 2ZJQF 1SD6A 4E7KA 3Q9VA 2ZSHB 3OL4A 4LK1F 2VQCA 3HM5A 1D3YA 2XIGA 2X6OA 3HPGA 3CF2A 2P7CB 2VPLA 2ZC2A 5C4XJ 2P81A 4RMNA 4KITB 2DU9A 3BJ6A 3HSFA 1OPCA 2W4SA 3BP8A 2X4HA 2QBYA 2L9VA 2VKVA 1IN7A 4I99C 3U21A 4UV8A 1VQKI 1B6AA 3A0HC 1TWCJ 1RETA 3OL3A 1RI7A 1C0WA 4EJWA 3S2HJ 1Y0UA 4CCKA 4KNYA 1MBGA 2IS4A 3ZOBA 5JFRA 3E5XA 4RGUA 2FMLA 3ZMVA 1WGXA 3R6SA 2P5LC 3QRFF 2LREA 4XM3A 2PJPA 2X48A 4F92B 3JCUC 2QQAA 3KIOA 4FETA 2JA7J 2M0MA 1KA8A 4ZZLA 5AONA 3PJRA 3FXKA 3H9QA 1W7PD 1XMKA 4RLFA 5EZGA 3F3XA 3SHFA 3ZQIA 4WXHA 5F27A 4MO7A 3TDUC 2B63J 1Z6RA 2GM4A 2HYFA 3IUOA 3WG7H 2PMZN 1SVLA 3MAJA 4IO9F 5BPIA 2GXBA 1MBFA 3CJRB 1W0UA 4HG2A 3A2KA 2DLLA 3HGGA 2WB1A 3LSKA 1BC8C 3F23A 3LQRA 2V26A 5FKOA 1NHAA 1BOAA 3WU2C 3IHUA 1DPUA 2PFBA 3DXJF 3CJQB 4Y33A 4BQOA 2QSFX 4KIGA 1ZAOA 1YS6A 2E7WA 2RN7A 5K5QA 3CMYA 4EGZA 4G6DA 3VOEA 1LUJB 3DBRB 4ZH4F 4I01A 3ZR8X 4D5CA 2PLYA 4N9IA 3SZTA 1Z9CA 2FNPA 1UAAA 1RNLA 2AXLA 4L9VA 2W82A 3P9KA 3REOA 1T2KA 2XPVA 3HOSA 4BE0A 4Z2YA 1QQIA 5EF6A 3Q3SA 4X1EA 4ZYAA 1MSEC 3BY6A 3GTOJ 2K40A 4CYCB 1FTTA 4MFDA 2EV0A 3E6MA 4UUSB 4E7HA 4NC8A 2MABA 3JTHA 2IGMA 3FXMA 4Q5SF 3DF8A 2DA3A 1ENHA 3KLNA 2BV6A 3CMMA 2OQRA 1MMAA 2BGCA 3IP4B 3GUDA 3WE2A 1DPRA 2DFEA 1JGSA 1SFUA 2YX7A 1SFEA 2H1LA 3HPHA 4AU7A 3CC7I 5FKKA 3W2AA 4M3GA 4UHTA 1SAXA 3S15J 2HTSA 2IA1A 4I09A 2WTEA 3P7NA 1VQ8I 1O3TA 2F5DA 4KA4A 5F0CA 1K4TA 2W00A 2V6CA 4IOCF 4OIQF 2R5ZB 2JZYA 1IRGA 4NB5A 1LDKB 3PFYA 3EYYA 4RGXA 2HI3A 2A69F 5IP7J 2H6BA 3O8GA 2XGDA 2EIKH 4GYGA 5EZHA 3UNGC 3BZKA 3NEUA 3GTLJ 2HVRA 1XDUA 2DMPA 3M9AA 4Y3OA 2GWRA 2DPDA 1JI8A 3E6BA 4IF4A 4CHUA 4PFOA 5FLXK 1ZKGA 4M3BA 3ML6A 2ZJ2A 4E4HA 3HOWJ 2GAUA 3J7AY 1SD5A 3ZMSA 2CWEA 4I02A 2FMYA 2X1EA 2ELKA 3TBIA 3BPXA 3WHCA 2VOOA 1D1CA 1J9IA 3DPLC 1YE9A 3HSEA 4IHVA 4RBOA 3GZ5A 3QYFA 1BW5A 2QM3A 3BG3A 3OIOA 1ON1A 3NWTA 1R36A 2Z33A 3RI4A 4FHTA 3CCQI 3M8EA 2RV8A 2BBYA 2K02A 4O5VA 4ZTJA 2L9NA 4CDGA 1Z3XA 1T39A 5E1ZB 4ZTFA 1MIJA 3H3ZA 4EEFG 2LLKA 3BQYA 4BQNA 1ZG5A 2PMHA 4EJTA 1I39A 1Z3YA 4LMYA 1FSHA 3EUAA 1JUSA 3J81K 1IN6A 3F21A 4DQ2A 4M72A 2X85A 3HRMA 2QYOA 2L5QA 4CYDA 2EFPA 4EM1A 3OMYA 2BW3B 4G94A 3IH3A 4L9TA 3AG2H 2KRHA 1LB2A 3M07A 2DO7A 4CCNA 1S7EA 5GADJ 5H2FC 2RKHA 4B1RA 2VODA 1MDMB 1POGA 1IJWC 3S3NA 3HTSB 4ZYGA 3IKTA 1FOYA 1YIJI 1JJ8C 3DKWA 1MKMA 3PIPF 3GTJJ 4AD9A 1WVRA 4XICA 2K4JA 1P7JA 3J7AO 5GTIC 2L01A 4WXDA 1JXSA 1KQ0A 3JRDA 4XSZF 3TKYA 2BXZA 1K6YA 3LSHA 1FZPB 5FLXZ 1F36A 4RGSA 2EIJH 1HKTA 3BG7A 1LVAA 3RKXA 4B4CA 4AIKA 5IPAA 2CQQA 2ZNZA 1LDDA 4AUXA 3V7SA 1T6SA 1WCMJ 3PO3J 3PUFA 3DBHB 3CD6I 1W36C 1W4MA 2DJIA 5JVGF 1P2FA 3IAM2 3CJTB 3BJOA 4Y7NJ 4M74A 1J09A 2E71A 5HS8A 2MH9A 2DA5A 4EQQA 3TP3A 1GV2A 4OIPF 3FISA 2VC1A 4KFCA 4PDKA 4XLCA 1B9MA 1UHMA 2VPRA 3CTAA 2XRNA 3DKYA 1ONVA 3F6VA 4RLQA 4LG3A 3G2BA 3W3CA 4L5JA 5B66C 2K7LA 3QU6A 2DMTA 3CLQA 3C2BA 5LRSA 3KP4A 1J0RA 1YJNI 1M1EB 1S8NA 1ZHFA 3BQZA 3J81Z 3WTYC 3H3VK 2O5RA 3RKQA 1R00A 3PFIA 3IKVA 2EJRA 4U0WA 2EFQA 2NVUB 3S8PA 3GEZA 4MNUA 1ZG1A 1JKQC 2XPWA 2HYJA 4U7BA 5DCMB 4KISA 2VL8A 3CUQB 3K69A 1IG7A 3H9JA 1Y8QB 1GLNA 2VJIA 2R5YB 4P1WA 2E2JJ 1HBXG 3K2AA 3P9CA 4K2EA 2EINH 3MQ0A 5J4VA 1OLTA 4C3HJ 2DMQA 3ESWB 3PO2J 2FXAA 1X19A 2FOKA 3SQNA 4JK1X 4DYQA 2XROA 1MH3A 3OR2C 3OS2A 4IQ4A 2IEKA 5HS7A 4A12A 4X6AJ 2KT0A 2P0WA 3ZQ7A 1CF7A 5KCMA 2TRTA 3BG9A 3C2GA 4HNUA 1K7AA 3N05A 1F4KA 5E3OA 2CV2A 3ZQLA 2ID3A 3G73A 3GF2A 1BJAA 3I58A 1BL0A 1B1BA 2A3SA 3PNVA 4Y17A 1BR4A 2K5CA 2ZSIB 2LKXA 2V7FA 2STTA 2EZHA 4LB5A 4UB6C 5IOZA 1FP1D 2HEOA 1H9TA 2NS8A 3DTKA 3HIFA 4QWQA 1X2MA 1VNDA 4ZZDA 4IHWA 4L0YB 1EF4A 4PK4A 4KT6A 5DUIA 4I0BA 1U5TB 3IV5A 4HYEA 2NS0A 3LA7A 2BXYA 2CUZA 1VQNI 5ICGA 4UNOA 1N25A 4MTEA 1WJ5A 3PSFA 5IP9J 2XKPA 2LH9A 1WJFA 1S7OA 2JK3A 3CMAI 3ZGKA 4XRFA 4YIIA 2R7RA 2L0KA 1Y1WJ 3L2CA 3ZQGA 1PUFA 3K70D 2Q2EA 5FB2A 2Y31A 4HA8A 2DK8A 2O6GE 5DS9A 3GLLA 1U3EM 4BGDA 3OIQA 2EA2A 1Z21A 4P55A 4CICA 3JRHA 4B3AA 2WAEA 2Z99A 1U8BA 2KHMA 3ABKH 3KETA 1YRNA 4BY1J 3ECOA 2JQ7A 1A5JA 2OTLI 4ON0A 2KDZA 4E7IA 3CC2I 3F9KA 2GA2A 1VQPI 1H8AC 4A69C 4LG0A 2KL4A 2M8GX 3DU5A 4FE7A 1YFHA 3V8LA 3JRBA 2PMUA 2VJ5A 1FBQA 1CGPA 1TLHB 2Y75A 3RZDJ 2J5PA 2L7ZA 3TO9A 1WSUA 2E1OA 5K7FA 4HRIA 2IAIA 4HF2A 3S1NJ 1QVTA 1EKEA 4ETSA 3CDIA 3ABLH 5D5VB 2AO9A 3WG9A 1HC8A 1Q1VA 4Y52J 5E8GA 3HKZN 3M8JA 2A6EF 3WGGA 2OCEA 3FX3A 4YFKF 2NVXJ 5EJCA 1FIAA 2VB6A 3PNTA 4NDLA 4A93J 2COMA 1TWGJ 3ZXSA 3OYNA 1BI0A 1Z67A 2VN2A 5FKNA 2MA3A 3FHNA 5IYBJ 1TW3A 1S29A 2I5UA 4XKWA 2IA0A 3LFKA 5E3LA 5B5EC 4H4KC 4OOIA 1Q1HA 3BROA 3K4MA 1NTCA 2LYCA 4UUVA 4LFUA 4KUMA 3KYLA 5HLGA 1LPQA 1FOXA 4Q4ZF 2KIQA 3G1OA 1S5LC 4DJAA 3W6VA 1G6NA 1Z77A 3OYLA 1ZTRA 4N0BA 2DA1A 1BN5A 2EH3A 1SMYF 4ENNA 2JWTA 1ODDA 1TZLA 2ELJA 5LD2C 1OISA 4AIJA 1JKOC 1GXPA 3KZIC 2HOSA 3LSIA 2R4GA 3JTGA 4RM2A 2E35A 3KEYA 2XF7A 2Y0SA 2HVSA 3JSOA 2XB0X 4AYBA 1P6RA 3GCMA 4DNCA 4YFXF 2RAEA 2JA5J 2DT6A 4A0YA 1TQIA 2FNAA 3GLXA 3R60A 3WGIA 3ZP5A 3AG4H 5FKMA 2HWVA 3CUQC 4BDYA 1X1PA 1QPMA 1U6GA 1YW8A 3RQIA 3W2VA 4AWXB 5J8CA 2XSDC 2W7NA 1VQLI 3H5NA 2IGNA 2EIMH 1D0YA 5D4SA 1IAWA 1VQ5I 5EG0A 4BJ6C 2M5WA 1Y1VJ 4II3A 3RYRA 3WTVC 2Z5UA 2IS6A 1FSEA 2VQHA 3IH2A 1BI3A 1TWHJ 4FCYA 3BOQA 5FGMA 5IP6A 4ZJZA 2NVTJ 2QLZA 4KN4X 1ZLJA 3VEPA 1TP4A 2V9PA 2HQ5A 3K1NA 3U2RA 3DBLB 3F6OA 1U8RA 1FBSA 3BPVA 2DMUA 3CCSI 1XGMA 5DM6F 1PP8F 1IW7F 1TW2A 3VSLA 5B3SH 1KYWA 2PI0A 4I7HA 5DUKA 2HQAA 1D0ZA 3GMEA 3S2DJ 2R7FA 1T98A 4A3BJ 4HSTA 5L3BA 1LVKA 1W0TA 4A3EJ 1F5TA 2BE5F 2PX9A 2MGQA 2ZNYA 1ON2A 2VLAA 1SFOJ 2HXIA 1QZZA 2ID6A 2XF6A 2XC7A 2WAQA 1APLC 5CVIA 5CVUA 3JAMK 1P92A 5IT3A 3NRVA 1AKHA 4W1UA 2C6YA 3HG9A 1VQ7I 2LC2A 3E1SA 4XLPF 1F1ZA 1OYYA 3A4CA 3A02A 1VZ0A 2QA4I 1VQMI 1FX7A 2KKOA 2L7FP 3C1DA 4RGRA 1CQTA 5K7ZA 2CV0A 1S9HA 2FX0A 2RQQA 4V2GA 3QP6A 4Y4RA 5DDGA 4UVBA 3LMMA 1IRZA 3OS1A 2LRDA 2NVYJ 1W36D 4NC7A 2L3DA 4YEJA 5AIPA 1GVDA 3LWFA 2JPBA 2ESNA 3QPLA 3SDGA 1TL8A 1IN8A 1T38A 1FYMA 3I71A 3G4SI 1ZN2A 1LNWA 3IWZA 2ZXJA 1FMVA 2VONA 1ITYA 2HXOA 2JJ7A 4AC0A 3Q0WA 4E6KG 1KU9A 2FA5A 4XLHA 5F1RA 5GTHC 1I50J 5IYDJ 2QBYB 2E19A 3MZ8A 2VBZA 2Y9YA 3WTZA 5DM7F 4BAYA 4WCGA 4BUPA 3G3ZA 4S04A 2XRLA 3AL0C 2XVCA 3FXLA 4X0GA 3UR3C 2PJRA 3FBNB 2A6HF 2OJED 4QTRA 2HU9A 2ELHA 2A05A 3F72A 2QSHX 4DBRA 1VQ9I 3KE2A 4TV7A 1FBUA 1OJLA 3FXUA 4P9FA 3TW7A 4IOAF 3KP3A 2ZXIA 4ZDLA 3K4CA 3HB9A 3JAMZ 4HQEA 1OCRH 1XB4A 3D5SC 2IA2A 3FZVA 1MMDA 3O6BB 3PNYA 4A3DJ 2EWNA 2R7VA 1KGSA 1AU7A 2P4WA 1ETXA 1B72A 1R7JA 2DTRA 4LK0F 3PSIA 3SFIA 2VXZA 1MZBA 2EV6A 4HQMA 2AQEA 4IHTA 4J00A 4L5IA 5EGOA 1ZGJA 3LSJA 4V2FA 3J80K 1G3YA 2LG4A 2XHKA 3CZ6A 2KQRA 2JA6J 2NYXA 2B0LA 2B7EA 1D1BA 5CKTA 3PQJA 1O7LA 3JRCA 3CCMI 1R5ID 2R7WA 2E1MB 1SFXA 1HDDC 3K6GA 2KRCA 4HX8A 4ASNA 4XLNF 4NNJA 1ETKA 3BTCA 3ABMH 1OR7C 2YSRA 3QQAA 4I76A 3CF5F 2R7TA 1WH5A 2XV4S 4GCVA 4NC6A 2L4MA 3D5LA 1SFKA 3K4BA 4A6DA 3K70C 2CV1A 3BG5A 3D1NI 3K4KA 3V8KA 1LJ9A 2F5CA 1G3TA 3E7LA 4G6TB 3K9TA 5CLSA 3K4JA 3P9IA 3FMQA 2XGEA 3ZRGA 2UWMA 3DTIA 1ZGAA 2LTPA 5HLIA 4I0AA 5HDKA 4KT5C 4Y15A 1B8IB 1U0JA 2O3FA 4LD5A 1NK3P 1BI2A 3K4NA 2K27A 2E5NA 3MEXA 2CQXA 2HTJA 3DPTA 5ICFA 1YITI 4DOZA 3E3VA 1JTXA 4Z6YA 4GRIA 1XX5A 1KU3A 1AA7A 1KU7A 2ZMEA 4XR6A 5A2QK 3T8RA 3COAC 2A68F 3E5UA 3I4NJ 3EUKL 5L3DA 2GA1A 2AQFA 5GPAA 2VKHA 4XRSG 5DEQA 1W5TA 3LL7A 4XOTA 5M3FJ 1LFUP 1X4PA 2OD5A 3FF5A 2EFWA 1K78A 1O57A 3AAFA 1O3SA 2CFXA 4XKBA 2R3SA 2XAQA 2DA4A 1E17A 2O8XA 1R1UA 1YJ9I 3LQQA 3S14J 4G7ZF 3KPHA 1UJ8A 2R7UA 1V55H 4HBLA 2CRGA 3ZQFA 3J80Z 1XDSA 3CQZJ 2WY8Q 3OY9A 1XC5A 4A0ZA 2OZ6A 3I55I 2LDUA 2BY0A 3IRQA 2STWA 2O0YA 3E5QA 3HC7A 4PJNA 4M6VA 1DU6A 2CUFA 3HOTA 5LHHA 1R58A 2QKLB 2R7XA 4C3JJ 3BC8A 2COBA 2HFHA 2CW0F 3PIOF 4IL6C 1IO2A 1KQ9A 3KCCA 2DK5A 4RAFA 3ELKA 4RB3C 4BDZA 4CCMA 2R7OA 1KYZA 1OCZH 4A2UA 2QQ9A 3TO6A 4F7ZA 3A1YA 2NVQJ 1XMAA 3GFLA 2V6EA 2ETHA 1USSA 2L7MP 1QU3A 2RC4A 2Y30A 1R22A 1S6LA 3PL8A 2WC2A 3C2HA 5KHDA 3MKYB 1Y8RB 4RM3A 3PQKA 2MW8A 1D8JA 4G6QA 4NHJA 5M3MJ 1R6RA 3I9V2 3VODA 1S72I 3LA3A 1DP3A 4IHSA 1XN7A 3BT9A 2F5VA 1FIPA 5LGNA 3S16J 1XCVA 1UG2A 2LMDA 3U1KA 5A2QZ 3BR0A 1SVMA 4P5OA 4UV9A 2Z9OA 1STZA 1PUEE 2PQ8A 2EPFA 5E3NA 4A5NA 1MJAA 2YU9J 1BIBA 2KIFA 1SMTA 2MC4A 1JGGA 4HSRA 2ADUA 3ULQB 2JUGA 5KVRA 2HNHA 3GVAA 3LA2A 3OYAA 1JT6A 4G7HF 2RNJA 5M5WJ 3KX2A 1N75A 3QPSA 1QA6A 5FD6A 3GTKJ 1QZEA 3I5UA 3V4GA 5LGUA 1A31A 1YW7A 1ZREA 1RUNA 3HOYJ 1IN4A 2CQ7A 1W7PA 2QGUA 3I64A 2V1UA 2MLKA 4BACA 1LEAA 1RR8C 3FIWA 3CMEI 3ZMDA 1V5GA 2LNBA 2Q0OA 3F8NA 4AM3A 2CQNA 3BR5A 1P4XA 4I2OA 5EEHA 1QGPA 2R93J 1OQYA 1O3RA 4E7ZA 3TL4X 3F0CA 3IL2A 2UZKA 3MMYB 4OAYA 5BNGA 4ESFA 3HGYA 5ICEA 3G1LA 1TQMA 4LLLA 1BJZA 3ECHA 4HEA2 4GO1A 2DN0A 1XG1A 4IRHA 3RKWA 3JRGA 1BC7C 2L4AA 3HL2A 1QHHD 3L2VA 2QUFA 5DV5A 4OMZA 5HOOA 1ETVA 1VI0A 4M3FA 1R1VA 1X1CA 2W85A 3ZQCA 4HV6A 4XLEA 2AS5F 5D5UB 5CVJA 3HOXJ 3CP2A 1FPQA 2XAUA 2JN6A 2PMZA 2V9KA 4M3EA 3DTEA 1WZ2A 5E3MA 3D0SA 4EV0A 1R71A 1B4AA 1EH7A 4OWRB 3TQNA 1XD7A 1T0FC 4CGZA 2X1CA 2F5EA 4Q48A 5LRRA 5LFAA 1PDNC 1BR1A 3G6EI 4GFBA 3ZMZA 2ZO4A 2OUMA 2ZB9A 3IRRA 5BPDA 3DCFA 1ZYRF 3DQVC 4M3DA 4IJAA 1I3AA 3GWZA 4XSXF 3ZN1A 2OV7A 1DP7P 3TW6A 3ZCOA 3QAHA 2MFZA 4RB2C 2D1HA 1YW9A 2DOFA 5LBQA 5GP9A 5FFXA 3KP5A 4MEXF 2JUCA 1WKMA 3OYKA 5J47A 3L09A 4EVIA 2WV0A 2N8GA 3BR1A 3ONQA 3L2QA 2O03A 3I59A 1XSDA 4E7JA 2Z3YA 2ISZA 4XQFA 3EUHC 5FRNA 2JMWA 1TWAJ 2W48A 1O3QA 3KZZA 2HGCA 4JX6A 2D2WA 4C30A 2PBIA 4HZFA 3HJEA 1SVOA 2L02A 3E6DA 1ZR2A 2BHZA 2BVLA 3FK6A 2LY2A 3SDBA 3I3LA 1W5SA 1V3FA 5FJ8J 2GOXB 3B73A 1D8KA 4A3GJ 1YI2I 5LHIA 4F3QA 5J40A 5FROA 2D5VA 1YHQI 4ZDPA 3GXOA 2JT1A 1IXCA 1UCRA 1J75A 1CF7B 4AIDA 2I10A 3ABTA 2FF4A 1ETWA 2DDAA 3ASNH 1QNTA 3OWTA 4PJLA 1SD7A 3TMOA 2LP0A 4MGRA 1P9QC 2H94A 2M30A 4Y13A 4HNVA 2XGCA 4R1HA 4O3MA 3QWLA 2W84A 4AYBN 1MD0A 5LGTA 2QENA 3OYBA 1OKRA 3SZPA 4MFEA 2HKOA 2FBKA 2VI6A 5CQGA 3WHBA 2DT7B 3CCYA 3VYRB 3LNQA 1GDTA 1IF1A 5HS9A 1TNSA 1HW5A 3N97A 3WTSC 2E2IJ 4ABZA 1HA8A 3VB2A 3CCUI 1ZELA 1D5YA 2LBFA 2WWYA 2KP6A 1DQUA 3M1CA 4DW6A 1HW2A 2R0QC 4W97A 2RQPA 1JKPC 2DODA 1WHUA 3K1MA 4BE2A 2P6TA 2YR2A 3CLOA 4NQWA 3KEOA 2BY3A 5IT9K 2F2EA 1EH6A 4N9HA 3MD2A 1FT9A 1PUFB 2I8DA 1RKTA 3E0JB 3RCOA 2Q2EB 5F6FA 3G71I 3BWGA 3GZ6A 2LSOA 2W25A 1K79A 3QOEA 3H9GA 3IWFA 2CUEA 3H35A 3TGNA 3O3KA 1ZARA 3NARA 1G4DA 1YRNB 3RZOJ 5J3LA 3W6KB 1U9OA 1D5VA 3M4OJ 1YS7A 4OIRF 3OSGA 3FBIB 3HHHA 3IC7A 4BXXJ 4M9SA 4LG0B 4MLOA 4BJ5C 3I4PA 3PM1A 2Y2ZA 4QPQA 1MBHA 2QVOA 2HPMA 1QPIA 4LLNA 2F4MB 1XMXA 2KRFA 1LE8B 5CPRB 4ZYEA 2JTVA 4LITA 3BG6A 1X2NA 2HOEA 1BI1A 5JI6A 4BE1A 1IV6A 1N77A 2VKDA 1WJAA 3S1MJ 4A3IJ 4KICA 4M6XA 2ME6A 3BTIA 1ZRDA 4YG2F 3JSPA 5BS6A 1QZYA 2O9LA 4A3JJ 1ORKA 5HDGA 2ME0A 3MN2A 3MVPA 1XTAA 2IW5A 3T8TA 2EA4A 3R0JA 3BR3A 5ILSA 5D8LB 5M5YJ 4N4OB 4V19K 2QEXI 3H0GJ 3HRTA 2QWWA 1HXDA 3MKZA 2HOTA 1WJCA 4PSXA 4XIDA 1MBEA 2W57A 1KZHA 1P7IA 2BYVE 3OSFA 3ZPLA 3EYIA 2K4BA 2HDCA 2R7QA 3IAS2 3EPZA 1JUMA 2A07F 1UG0A 2D1VA 1I3QJ 5IT9Z 2VUMJ 4JOMA 3WTTC 5J1RA 4A6EA 4LGWA 3N4MA 2OQGA 4KDPA 1WWXA 4L5EA 1MJBA 3R61A 4XN0A 2K9MA 3LSGA 4RB0A 4F91B 2KLOA 1RC9A 1IDZA 3VYUB 4WX9A 3LSMA 2X6YA 1RRJA 3P5JA 3HSRA 1ZLKA 4DGWB 3RYPA 2XGXA 2L54A 4BXFA 3GFIA 2ZFUA 2KIUA 2OBPA 3CCVI 2E1CA 3HUGA 4CUGA 1LEBA 2ZBKA 4PJMA 3K10A 4G7OF 1SANA 2QCOA 3JW4A 1L0OC 2VASA 3VYSB 4C3IJ 2P5VA 5HVQC 2H1KA 5EG0B 1TBXA 2VXDA 1O4XA 4FX4A 4UXNA 2DJNA 1LFPA 5CVVA 2X6WA 2HQRA 3V7CA 3FM5A 3K7AJ 1VQ6I 4HW0A 1AWCA 2BEOA 3I54A 3TDZC 4KIBA 2MYSA 4I6ZA 5KNLA 1R9TJ 2HDDA 1A6IA 3H36A 3B6AA 3S2WA 2H27A 2NOJB 5H6RA 1ETOA 1QVUA 5JHFA 1UB9A 5FRMA 4CO8A 4B44A 5GPCA 1J2XA 4E70A 2D45A 1ULYA 1IRFA 4CA0A 2ZXWH 2DQRA 2DQLA 3LSRA 2JA2A 5KAFC 1RUOA 3VYTB 5TISC 1W1WE 1QHGA 2EQRA 4KN7X 3PUBA 4OU0A 1QO0D 2VJJA 1R1TA 4MQVA 4DBQA 2G0EA 1GHCA 4A3FJ 1TT5B 4EGYA 3Q0UA 3HOZJ 1JKRC 2W1OA 2K9LA 6PAXA 3C3WA 5K1YA 1V5EA 2WB1N 2OZUA 1YLFA 3RIRA 1A04A 1I27A 2G9WA 3CESA 5EYRA 4OIOF 2ECBA 1Z7LA 4C9YA 3FMRA 1V54H 1AKHB 2VOPA 2M3AA 4XRMA 2IGKA 2KFDA 2VE8A 2ZKZA 4EM0B 3V7RA 3CP8A 1YO5C 1XGNA 1G59A 3AKZA 1U5TC 1FYLA 4D9JA 2OTJI 1ZRCA 3GX4X 3MZHA 4HDVA 3AFHA 3O8HA 3SJMA
chains in the Genus database with same CATH topology
4BBSJ 2CQXA 4XICA 1P7JA 1T56A 2LR8A 2QF7A 3L1PA 1JTXA 4XRSA 2M34A 3HOVJ 3JRDA 2GBYA 3BTLA 2EZLA 1F36A 4DZJA 3I4NJ 3LOCA 4B4CA 5GPAA 4XRSG 5IPAA 2CQQA 2VKEA 4AUXA 3G1MA 1WCMJ 5M3FJ 1ZR4A 3HBLA 1LFUP 3PO3J 3ZQHA 3GTPJ 3BR6A 3JRIA 2CU7A 1H88C 4JYKA 5J1YA 5IYCJ 2DA4A 1LE8A 3S14J 2LY9A 4DZPA 2CRGA 3ZQFA 2M0CA 4Y7NJ 3GTQJ 2DA5A 4UUTA 1U78A 3CQZJ 3TP3A 2JA8J 1XC5A 1GV2A 3FISA 2EBIA 2VPRA 4M6VA 2O8KA 1DU6A 2CUFA 1BW6A 2XB5A 1HOMA 1OCPA 1HCRA 4C3JJ 2DMTA 4JX4A 2COBA 2M2EA 3C2BA 4MIMA 2DA2A 3BQZA 3H3VK 1OFCX 4QSHA 2NS7A 3RKQA 2CJJA 1WPKA 2NVQJ 2H8RA 1B72B 2GLOA 2L7MP 2Y30A 1JKQC 2XPWA 1IDYA 2HYJA 4IHYA 1IG7A 5EGOB 2R5YB 2E2JJ 3K2AA 2WV1A 2MW8A 1E3OC 2K9NA 1ZQ3P 1RPWA 4C3HJ 2DMQA 5M3MJ 3PO2J 4DYQA 3BT9A 1FIPA 1MH3A 3S16J 1UG2A 2IEKA 2LK2A 3TP0A 3BR0A 4X6AJ 2KT0A 3A01A 3FKIJ 2TRTA 3BG9A 3S17J 2L9RA 5FLMJ 2FJ1A 3JR9A 5E3NA 2YU9J 5E3OA 3ZQLA 2ID3A 1WH7A 2FD5A 1JGGA 1FEXA 5EEAA 2LFBA 5F0FA 5F1JA 1BL0A 9ANTA 4IHXA 1JT6A 1HLVA 2R7ZJ 2LKXA 5M5WJ 3QPSA 1XS9A 2EZHA 3Q0VA 3GTKJ 4IEJA 2E2HJ 3LSPA 5IOZA 1MBKA 1NK2P 1TC3C 3HOYJ 2DA6A 4J19A 2NS8A 1G2HA 3GTMJ 3FIWA 1X2MA 1VNDA 1BA5A 4D7NA 4IHWA 1EF4A 2YUSA 3BR5A 3IV5A 2R93J 2K9SA 3F0CA 1K83J 5BNGA 3HGYA 5C44J 1VF9A 3G1LA 1BJZA 5IP9J 2MG4A 2DN0A 4D7MA 5J1UA 1XG1A 2JK3A 2FQ4A 2EZKA 3JRGA 2L0KA 1Y1WJ 4C2MJ 3GTGJ 3ZQGA 4LOCA 1PUFA 1ETVA 1VI0A 4M3FA 1DU0A 3UKGA 3B6CA 4DYRA 2Y31A 5C4JJ 3ZQCA 3HOXJ 1X58A 5DS9A 2JN6A 1HF0A 4M3EA 3JRHA 5E3MA 1T33A 4JX5A 4B3AA 4QIWN 3HEFA 1U8BA 2ECCA 1YRNA 1F43A 4BY1J 1GV5A 1A5JA 4GFBA 1JT0A 2XPUA 2KDZA 1RR7A 2ZB9A 2LVSA 3DCFA 1LFBA 3IH4A 4M3DA 1H8AC 4A69C 3JRAA 2M8GX 3JREA 3HDDA 4FE7A 3TW6A 4D5FA 3JRBA 1Z0XA 1RESA 1JTYA 1ZK8A 3RZDJ 5GP9A 2L7ZA 3MKLA 1H89C 2EZIA 2E1OA 5K7FA 2IAIA 3S1NJ 2N8GA 1QVTA 3BR1A 2K9QA 2AO9A 1B8IA 1Q1VA 2OPTA 2JMWA 4Y52J 1TWAJ 2W48A 3HKZN 5FKLA 3CDLA 2LD5A 1FTZA 2NVXJ 4JX6A 2M9HA 3GBGA 1FIAA 5DTDA 4NDLA 4A93J 1MH4A 1TWGJ 1ZGWA 1ZR2A 3FK6A 5FKNA 4A3LJ 5IYBJ 5FJ8J 5K7HA 5E3LA 4RDUA 3VPRA 4A3GJ 1I6HJ 4CYCA 2D5VA 4UUSA 1NTCA 1ETQA 3A01B 2I10A 1ETWA 2MSYA 3G1OA 2R92J 3W6VA 1Z77A 2LP0A 5JLXA 1ZTRA 1MSFC 2X9DA 4HNVA 4DYCA 2DA1A 2XGCA 2EH3A 4AYBN 2JWTA 3HM5A 2X6OA 2DMNA 1JKOC 1K61A 2HOSA 4MFEA 5C4XJ 2VI6A 3WHBA 2P81A 1AHDP 3CCYA 3LNQA 2XB0X 1GDTA 2JA5J 2RAEA 5F0HA 2E2IJ 4ABZA 2R5ZA 2Y9ZA 2VKVA 1FJLA 2IBDA 1D5YA 1TWCJ 1RETA 5FKMA 4S0HB 4DW6A 2R0QC 3S2HJ 3RQIA 4W97A 1MBGA 2XSDC 1JKPC 3ZOBA 3OOUA 1QRYA 3S1RJ 3NAUA 5EG0A 1WGXA 1Y1VJ 2DTZA 3M3YJ 2TCTA 2AHQA 2X48A 1PUFB 1RKTA 3IH2A 1WI3A 1TWHJ 1OCTC 2JA7J 4FCYA 3S1QJ 3DEWA 5IP6A 5M5XJ 2NVTJ 4BKXA 5EZGA 3ZQIA 5F27A 2HQ5A 4MO7A 2CUEA 2B63J 2GM4A 2DMUA 3NARA 1YRNB 5F08A 3RZOJ 5J3LA 2PMZN 1TWFJ 1U9OA 3I4MJ 3M4OJ 3OSGA 1MBFA 4BXXJ 1W0UA 3S2DJ 4MLOA 4A3BJ 3PM1A 2Y2ZA 1MBHA 1QPIA 1LE8B 3HGGA 1W0TA 4A3EJ 1X2NA 5FKOA 2YS9A 1IV6A 2MGQA 4FISA 1SFOJ 2HXIA 2NOGA 2ID6A 3CMYA 3S1MJ 1APLC 4A3IJ 4BBRJ 2ME6A 3BTIA 1AKHA 4W1UA 4D5CA 2O9LA 4A3JJ 1ORKA 2ME0A 3MN2A 3MVPA 2XPVA 3BR3A 3A02A 3HOUJ 5M5YJ 5EF6A 2L7FP 3Q3SA 4X1EA 5HODA 3H0GJ 1CQTA 5K7ZA 1MSEC 2K40A 4CYCB 3GTOJ 2FX0A 4MFDA 1FTTA 4V2GA 4UUSB 3TEDA 2HOTA 4XIDA 1MBEA 1P7IA 1MNMC 5FLVA 1IRZA 2NVYJ 3OSFA 1VFCA 4JP0A 2DA3A 1ENHA 1GVDA 1JUMA 3QPLA 3SDGA 1I3QJ 3BTJA 3FK7A 2VUMJ 4XK4A 5J1RA 4L5EA 4FE4A 1ETYA 2O7OA 3LSGA 1ITYA 2HXOA 2JJ7A 4AC0A 3Q0WA 5FKKA 1IDZA 4M3GA 3S15J 4A3KJ 1GT0C 5F0CA 1I50J 2R5ZB 5IYDJ 2E19A 2Y9YA 4FTHA 2Y0SN 5IOYA 2HI3A 2XRLA 1SANA 5JLWA 5IP7J 2QCOA 3O8GA 2XGDA 3JRFA 4C3IJ 4A3MJ 4QTRA 5EZHA 3GTLJ 2H1KA 2DMPA 5EG0B 1O4XA 1OJLA 2DJNA 3TW7A 3K7AJ 1ZKGA 4M3BA 3HOWJ 4I6ZA 2HDDA 1R9TJ 2DA7A 3HB9A 1A6IA 3B6AA 2ELKA 4A3DJ 5EDNA 3WHCA 1AU7A 1ETOA 1ETXA 1B72A 1QVUA 4IHVA 3SFIA 4RBOA 5GPCA 3A03A 1BW5A 3BG3A 3OIOA 5EGOA 3LSRA 2R5YA 3LSJA 2HOAA 4V2FA 4G12A 2EQRA 2JA6J 2G0EA 4A3FJ 4EEFG 3Q0UA 1IC8A 3HOZJ 2LLKA 1JKRC 3BQYA 3JRCA 1MBJA 1GUUA 1HDDC 1IGNA 1ETKA 3BTCA 3QQAA 4I76A 2WB1N 1WH5A 1JUSA 4A3CJ 5EYRA 2ECBA 1UMQA 3BG5A 4BY7J 3D1NI 1AKHB 1JUPA 4XRMA 3E7LA 2OF7A 3IH3A 2WAQN 5C3EJ 1IUFA 1S7EA 1JJ6C 4B1RA 1RKWA 2XGEA 1POGA 3BR2A 5F04A 2LTPA 1IJWC 1U9NA 1UHSA 1B8IB 1JJ8C 1HDPA 1NK3P 3GTJJ 3O8HA 3SJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBS J;  2CQX A;  4XIC A;  1P7J A;  1T56 A;  2LR8 A;  2QF7 A;  3L1P A;  1JTX A;  4XRS A;  2M34 A;  3HOV J;  3JRD A;  2GBY A;  3BTL A;  2EZL A;  1F36 A;  4DZJ A;  3I4N J;  3LOC A;  4B4C A;  5GPA A;  4XRS G;  5IPA A;  2CQQ A;  2VKE A;  4AUX A;  3G1M A;  1WCM J;  5M3F J;  1ZR4 A;  3HBL A;  1LFU P;  3PO3 J;  3ZQH A;  3GTP J;  3BR6 A;  3JRI A;  2CU7 A;  1H88 C;  4JYK A;  5J1Y A;  5IYC J;  2DA4 A;  1LE8 A;  3S14 J;  2LY9 A;  4DZP A;  2CRG A;  3ZQF A;  2M0C A;  4Y7N J;  3GTQ J;  2DA5 A;  4UUT A;  1U78 A;  3CQZ J;  3TP3 A;  2JA8 J;  1XC5 A;  1GV2 A;  3FIS A;  2EBI A;  2VPR A;  4M6V A;  2O8K A;  1DU6 A;  2CUF A;  1BW6 A;  2XB5 A;  1HOM A;  1OCP A;  1HCR A;  4C3J J;  2DMT A;  4JX4 A;  2COB A;  2M2E A;  3C2B A;  4MIM A;  2DA2 A;  3BQZ A;  3H3V K;  1OFC X;  4QSH A;  2NS7 A;  3RKQ A;  2CJJ A;  1WPK A;  2NVQ J;  2H8R A;  1B72 B;  2GLO A;  2L7M P;  2Y30 A;  1JKQ C;  2XPW A;  1IDY A;  2HYJ A;  4IHY A;  1IG7 A;  5EGO B;  2R5Y B;  2E2J J;  3K2A A;  2WV1 A;  2MW8 A;  1E3O C;  2K9N A;  1ZQ3 P;  1RPW A;  4C3H J;  2DMQ A;  5M3M J;  3PO2 J;  4DYQ A;  3BT9 A;  1FIP A;  1MH3 A;  3S16 J;  1UG2 A;  2IEK A;  2LK2 A;  3TP0 A;  3BR0 A;  4X6A J;  2KT0 A;  3A01 A;  3FKI J;  2TRT A;  3BG9 A;  3S17 J;  2L9R A;  5FLM J;  2FJ1 A;  3JR9 A;  5E3N A;  2YU9 J;  5E3O A;  3ZQL A;  2ID3 A;  1WH7 A;  2FD5 A;  1JGG A;  1FEX A;  5EEA A;  2LFB A;  5F0F A;  5F1J A;  1BL0 A;  9ANT A;  4IHX A;  1JT6 A;  1HLV A;  2R7Z J;  2LKX A;  5M5W J;  3QPS A;  1XS9 A;  2EZH A;  3Q0V A;  3GTK J;  4IEJ A;  2E2H J;  3LSP A;  5IOZ A;  1MBK A;  1NK2 P;  1TC3 C;  3HOY J;  2DA6 A;  4J19 A;  2NS8 A;  1G2H A;  3GTM J;  3FIW A;  1X2M A;  1VND A;  1BA5 A;  4D7N A;  4IHW A;  1EF4 A;  2YUS A;  3BR5 A;  3IV5 A;  2R93 J;  2K9S A;  3F0C A;  1K83 J;  5BNG A;  3HGY A;  5C44 J;  1VF9 A;  3G1L A;  1BJZ A;  5IP9 J;  2MG4 A;  2DN0 A;  4D7M A;  5J1U A;  1XG1 A;  2JK3 A;  2FQ4 A;  2EZK A;  3JRG A;  2L0K A;  1Y1W J;  4C2M J;  3GTG J;  3ZQG A;  4LOC A;  1PUF A;  1ETV A;  1VI0 A;  4M3F A;  1DU0 A;  3UKG A;  3B6C A;  4DYR A;  2Y31 A;  5C4J J;  3ZQC A;  3HOX J;  1X58 A;  5DS9 A;  2JN6 A;  1HF0 A;  4M3E A;  3JRH A;  5E3M A;  1T33 A;  4JX5 A;  4B3A A;  4QIW N;  3HEF A;  1U8B A;  2ECC A;  1YRN A;  1F43 A;  4BY1 J;  1GV5 A;  1A5J A;  4GFB A;  1JT0 A;  2XPU A;  2KDZ A;  1RR7 A;  2ZB9 A;  2LVS A;  3DCF A;  1LFB A;  3IH4 A;  4M3D A;  1H8A C;  4A69 C;  3JRA A;  2M8G X;  3JRE A;  3HDD A;  4FE7 A;  3TW6 A;  4D5F A;  3JRB A;  1Z0X A;  1RES A;  1JTY A;  1ZK8 A;  3RZD J;  5GP9 A;  2L7Z A;  3MKL A;  1H89 C;  2EZI A;  2E1O A;  5K7F A;  2IAI A;  3S1N J;  2N8G A;  1QVT A;  3BR1 A;  2K9Q A;  2AO9 A;  1B8I A;  1Q1V A;  2OPT A;  2JMW A;  4Y52 J;  1TWA J;  2W48 A;  3HKZ N;  5FKL A;  3CDL A;  2LD5 A;  1FTZ A;  2NVX J;  4JX6 A;  2M9H A;  3GBG A;  1FIA A;  5DTD A;  4NDL A;  4A93 J;  1MH4 A;  1TWG J;  1ZGW A;  1ZR2 A;  3FK6 A;  5FKN A;  4A3L J;  5IYB J;  5FJ8 J;  5K7H A;  5E3L A;  4RDU A;  3VPR A;  4A3G J;  1I6H J;  4CYC A;  2D5V A;  4UUS A;  1NTC A;  1ETQ A;  3A01 B;  2I10 A;  1ETW A;  2MSY A;  3G1O A;  2R92 J;  3W6V A;  1Z77 A;  2LP0 A;  5JLX A;  1ZTR A;  1MSF C;  2X9D A;  4HNV A;  4DYC A;  2DA1 A;  2XGC A;  2EH3 A;  4AYB N;  2JWT A;  3HM5 A;  2X6O A;  2DMN A;  1JKO C;  1K61 A;  2HOS A;  4MFE A;  5C4X J;  2VI6 A;  3WHB A;  2P81 A;  1AHD P;  3CCY A;  3LNQ A;  2XB0 X;  1GDT A;  2JA5 J;  2RAE A;  5F0H A;  2E2I J;  4ABZ A;  2R5Z A;  2Y9Z A;  2VKV A;  1FJL A;  2IBD A;  1D5Y A;  1TWC J;  1RET A;  5FKM A;  4S0H B;  4DW6 A;  2R0Q C;  3S2H J;  3RQI A;  4W97 A;  1MBG A;  2XSD C;  1JKP C;  3ZOB A;  3OOU A;  1QRY A;  3S1R J;  3NAU A;  5EG0 A;  1WGX A;  1Y1V J;  2DTZ A;  3M3Y J;  2TCT A;  2AHQ A;  2X48 A;  1PUF B;  1RKT A;  3IH2 A;  1WI3 A;  1TWH J;  1OCT C;  2JA7 J;  4FCY A;  3S1Q J;  3DEW A;  5IP6 A;  5M5X J;  2NVT J;  4BKX A;  5EZG A;  3ZQI A;  5F27 A;  2HQ5 A;  4MO7 A;  2CUE A;  2B63 J;  2GM4 A;  2DMU A;  3NAR A;  1YRN B;  5F08 A;  3RZO J;  5J3L A;  2PMZ N;  1TWF J;  1U9O A;  3I4M J;  3M4O J;  3OSG A;  1MBF A;  4BXX J;  1W0U A;  3S2D J;  4MLO A;  4A3B J;  3PM1 A;  2Y2Z A;  1MBH A;  1QPI A;  1LE8 B;  3HGG A;  1W0T A;  4A3E J;  1X2N A;  5FKO A;  2YS9 A;  1IV6 A;  2MGQ A;  4FIS A;  1SFO J;  2HXI A;  2NOG A;  2ID6 A;  3CMY A;  3S1M J;  1APL C;  4A3I J;  4BBR J;  2ME6 A;  3BTI A;  1AKH A;  4W1U A;  4D5C A;  2O9L A;  4A3J J;  1ORK A;  2ME0 A;  3MN2 A;  3MVP A;  2XPV A;  3BR3 A;  3A02 A;  3HOU J;  5M5Y J;  5EF6 A;  2L7F P;  3Q3S A;  4X1E A;  5HOD A;  3H0G J;  1CQT A;  5K7Z A;  1MSE C;  2K40 A;  4CYC B;  3GTO J;  2FX0 A;  4MFD A;  1FTT A;  4V2G A;  4UUS B;  3TED A;  2HOT A;  4XID A;  1MBE A;  1P7I A;  1MNM C;  5FLV A;  1IRZ A;  2NVY J;  3OSF A;  1VFC A;  4JP0 A;  2DA3 A;  1ENH A;  1GVD A;  1JUM A;  3QPL A;  3SDG A;  1I3Q J;  3BTJ A;  3FK7 A;  2VUM J;  4XK4 A;  5J1R A;  4L5E A;  4FE4 A;  1ETY A;  2O7O A;  3LSG A;  1ITY A;  2HXO A;  2JJ7 A;  4AC0 A;  3Q0W A;  5FKK A;  1IDZ A;  4M3G A;  3S15 J;  4A3K J;  1GT0 C;  5F0C A;  1I50 J;  2R5Z B;  5IYD J;  2E19 A;  2Y9Y A;  4FTH A;  2Y0S N;  5IOY A;  2HI3 A;  2XRL A;  1SAN A;  5JLW A;  5IP7 J;  2QCO A;  3O8G A;  2XGD A;  3JRF A;  4C3I J;  4A3M J;  4QTR A;  5EZH A;  3GTL J;  2H1K A;  2DMP A;  5EG0 B;  1O4X A;  1OJL A;  2DJN A;  3TW7 A;  3K7A J;  1ZKG A;  4M3B A;  3HOW J;  4I6Z A;  2HDD A;  1R9T J;  2DA7 A;  3HB9 A;  1A6I A;  3B6A A;  2ELK A;  4A3D J;  5EDN A;  3WHC A;  1AU7 A;  1ETO A;  1ETX A;  1B72 A;  1QVU A;  4IHV A;  3SFI A;  4RBO A;  5GPC A;  3A03 A;  1BW5 A;  3BG3 A;  3OIO A;  5EGO A;  3LSR A;  2R5Y A;  3LSJ A;  2HOA A;  4V2F A;  4G12 A;  2EQR A;  2JA6 J;  2G0E A;  4A3F J;  4EEF G;  3Q0U A;  1IC8 A;  3HOZ J;  2LLK A;  1JKR C;  3BQY A;  3JRC A;  1MBJ A;  1GUU A;  1HDD C;  1IGN A;  1ETK A;  3BTC A;  3QQA A;  4I76 A;  2WB1 N;  1WH5 A;  1JUS A;  4A3C J;  5EYR A;  2ECB A;  1UMQ A;  3BG5 A;  4BY7 J;  3D1N I;  1AKH B;  1JUP A;  4XRM A;  3E7L A;  2OF7 A;  3IH3 A;  2WAQ N;  5C3E J;  1IUF A;  1S7E A;  1JJ6 C;  4B1R A;  1RKW A;  2XGE A;  1POG A;  3BR2 A;  5F04 A;  2LTP A;  1IJW C;  1U9N A;  1UHS A;  1B8I B;  1JJ8 C;  1HDP A;  1NK3 P;  3GTJ J;  3O8H A;  3SJM A; 
#chains in the Genus database with same CATH topology
 1YX5 A;  2EB7 A;  3S3O A;  3WTX C;  1MND A;  2VJ4 A;  2KJC A;  1WJE A;  2OU2 A;  4F52 A;  3OYF A;  3HOV J;  2JSP A;  1ZH5 A;  2RRE A;  4LLG F;  2GBY A;  5JR3 A;  2EZL A;  3FXR A;  1UFM A;  4YIF A;  2V4J C;  1WI9 A;  3SFZ A;  2CSO A;  1WJD A;  3HBL A;  4EMS A;  1NG7 A;  3ZQH A;  4P96 A;  2HPI A;  3GTP J;  3JRI A;  2CU7 A;  3C18 A;  1XPX A;  4XLF A;  1H88 C;  5J1Y A;  5IYC J;  4ENM A;  4L9N A;  3E6C C;  2DXI A;  2FSW A;  4U7D A;  4B43 A;  4DZP A;  2M7B A;  2BVM A;  3EDP A;  1LDJ A;  3GTQ J;  5FO5 A;  1U78 A;  4FAS D;  1FOW A;  2EIL H;  2PJR B;  1NH3 A;  1RIO H;  4A5M A;  3M1E A;  2V1X A;  4PJJ A;  2XAS A;  4BQQ A;  3WTW C;  1BW6 A;  2XB5 A;  2P7V B;  2VBW A;  2M2E A;  4JX4 A;  2M87 A;  2NRA C;  4H0E A;  5CYV A;  4MIM A;  4G9Y A;  4XON A;  1MMG A;  5DD8 A;  3HRU A;  2F48 A;  3K2Z A;  2PG4 A;  2HVQ A;  2HS5 A;  2X6X A;  1W5C C;  5D4R A;  1ERD A;  4NUB A;  1OFC X;  2G7U A;  3QPH A;  2F5F A;  4R8H A;  5ERI A;  1IV8 A;  2GQQ A;  2F4I A;  3U9G A;  3FKJ A;  4XMY A;  2CJJ A;  5TGT A;  2VT3 A;  3F8M A;  4CCJ A;  1U2W A;  1KON A;  2E5Z A;  3KZY A;  4MEY F;  1B72 B;  4LIV A;  1FMW A;  5KAI C;  4BH9 A;  1Y0N A;  2FBI A;  4IHY A;  4FX0 A;  5FD5 A;  2MLG A;  3S93 A;  2IS2 A;  5KK1 A;  5EGO B;  3L2R A;  2AXT C;  1IXS B;  3GFJ A;  4HV5 A;  4BS9 A;  2DYR H;  1E3O C;  1ZQ3 P;  3AG3 H;  5GAE J;  2HZT A;  3DV8 A;  2X0L A;  3FM3 A;  3H92 A;  3QU3 A;  4UY8 I;  4ITV A;  5JHU A;  2R7S A;  2P6S A;  2CUJ A;  2DOA A;  2EV5 A;  2ZJR F;  2LK2 A;  2CS3 A;  2UV1 A;  2UXN A;  5K5R A;  2J5O A;  4B3X A;  3FKI J;  3A01 A;  3SXY A;  4FQG A;  1FNN A;  1R4M B;  4E7S A;  2L9R A;  2VIX A;  2FJ1 A;  4BEH A;  3JR9 A;  1OCC H;  4RS8 A;  2A5W A;  1WH7 A;  2FD5 A;  4IZZ A;  3OIP A;  5EEA A;  4WXC A;  4KJZ A;  3KYD B;  3OOP A;  4XNF A;  2OCC H;  2R7Z J;  3MCZ A;  2LF8 A;  4BXU A;  3LSP A;  3VWB A;  1MBK A;  2DA6 A;  2XAF A;  1XGO A;  2DT5 A;  2KMU A;  3GTM J;  1BA5 A;  2QQB A;  1J7K A;  3D5R C;  4HX4 A;  2YUS A;  1OYI A;  4II2 A;  3WGH A;  1EJ9 A;  4C2T A;  5H6Q A;  2M45 A;  2K9S A;  1D0X A;  2ZME B;  1K83 J;  1GVJ A;  2IP2 A;  4J01 A;  4XLA A;  5C44 J;  1I1S A;  1MMN A;  1T08 B;  4CZZ A;  3DP7 A;  3RPQ A;  2MG4 A;  5CJ9 A;  2UXX A;  4XBF A;  4D7M A;  5J1U A;  3OS0 A;  1L3L A;  2MC3 A;  2BZT A;  5TJJ A;  2FQ4 A;  3O2P E;  4C2M J;  5D5W B;  1K78 B;  1J59 A;  4LOC A;  3KP7 A;  3BLY A;  1HW1 A;  5E1X A;  4DYR A;  2ACJ A;  3CCR I;  3R0A A;  2XAG A;  2Y48 A;  4D1Q A;  2L7K A;  1HF0 A;  2Z2S B;  1TT0 A;  3F8F A;  4QIW N;  2K3P A;  2ECC A;  4Q47 A;  1F43 A;  2XDV A;  1N78 A;  1D1A A;  1GV5 A;  2XPU A;  5BMZ A;  1RR7 A;  2LKP A;  2IJL A;  4D0P A;  3I0T A;  5L3E A;  1LFB A;  3IH4 A;  3FXQ A;  3VFZ A;  2CFO A;  3QYE A;  4I98 B;  3TOA A;  2QSG X;  4UVA A;  1HKQ A;  1T0F A;  3B02 A;  3HDD A;  2EK5 A;  4D5F A;  2FBH A;  2PN6 A;  4GYI A;  3LAJ A;  2XAJ A;  1ZK8 A;  1ZG3 A;  4LJZ F;  2DW4 A;  4BNC A;  1H89 C;  2VC0 A;  2EZI A;  2YX4 A;  1H0M A;  3KYC B;  5FFZ A;  5J6X A;  5ILU A;  1BR2 A;  2FQ3 A;  2VQG A;  1BOB A;  4B48 A;  1B8I A;  1DDN A;  3RQ4 A;  2OPT A;  1DUX C;  4ANJ A;  3OYH A;  3V8J A;  3E97 A;  3CDL A;  1FTZ A;  5DYM A;  4EAT A;  2M9H A;  3CCE I;  1Z6T A;  1G8X A;  1EH8 A;  3EUH A;  1ZGW A;  1K6O A;  3EET A;  2BOL A;  2E36 A;  2JVG A;  2GOM A;  2IRF G;  2E1N A;  1SAU A;  4A3L J;  2A61 A;  1HST A;  2V1N A;  2ICW G;  1R23 A;  1FWZ A;  5K7H A;  4ZYD A;  4RDU A;  4HLY A;  1SD4 A;  3OYM A;  4CYC A;  1VTN C;  4UUS A;  3ROU A;  1T95 A;  2XF5 A;  4IXA A;  3WE3 A;  1XSV A;  3ISP A;  1O7F A;  3BCB A;  3ZMT A;  2K85 A;  2H8W A;  4L0Z B;  2MSY A;  3FXO A;  2FOW A;  1TNT A;  1FYK A;  1JHF A;  2F6C A;  2M7A A;  5JLX A;  1PP7 U;  1MSF C;  1BM9 A;  1PVE A;  2JSC A;  2ZJP F;  3DWL E;  4F93 B;  2JRT A;  3EQL F;  2KDO A;  2VBY A;  2DMN A;  4CXF A;  1YYV A;  1K61 A;  4M71 A;  2CG4 A;  3J7Z I;  1I1G A;  1W7P B;  4M9X A;  1AHD P;  4EJV A;  1IRX A;  2E7X A;  3S32 A;  4WWC A;  2DDB A;  4BU2 A;  1R5G A;  5F0H A;  1BBY A;  5IY5 H;  2R5Z A;  1AOY A;  2Y9Z A;  1FJL A;  2IBD A;  3L9F A;  1DGR M;  4N4N B;  2IT0 A;  2TDX A;  2QQ8 A;  4CCL A;  4MTD A;  4S0H B;  3H5R A;  1YQA A;  1WRJ A;  1T8I A;  5HLH A;  3L2U A;  2CYY A;  3OOU A;  4XN3 A;  3WTU C;  1QRY A;  3KEQ A;  3S1R J;  2DBB A;  3NAU A;  1MJ9 A;  3GFM A;  2DTZ A;  3M3Y J;  4RAY A;  2TCT A;  3KFW X;  3ERM A;  2AHQ A;  4RB1 A;  1GXQ A;  4BHB A;  3DEU A;  1TQP A;  1WI3 A;  1OCT C;  3S1Q J;  4PFP A;  3DEW A;  4CSW A;  4XOR A;  5M5X J;  1IXR C;  4BKX A;  1SC7 A;  1X1A A;  4BHP A;  5D8K B;  2DFI A;  4HF0 A;  2HR3 A;  2KIM A;  1LQ1 A;  3S3M A;  5L3F A;  5F08 A;  2Z16 A;  1TWF J;  2EFO A;  3WOD F;  2GZW A;  3I4M J;  4IQJ A;  3H3U A;  3GO5 A;  2DYS H;  2E1M C;  1E3P A;  3ASO H;  3QYB A;  2HYG D;  4WK8 F;  1S3J A;  4ESB A;  2M1B A;  1DGW Y;  2WAF A;  2ISY A;  4G8X A;  5LEK A;  4UB8 C;  2BY1 A;  5AIQ A;  2YS9 A;  4M9Z A;  4FIS A;  1G3W A;  3I59 B;  2Q8K A;  2CW7 A;  1R49 A;  2WY7 Q;  2NOG A;  3R4K A;  2ZME C;  4PSW A;  3OYI A;  2DI3 A;  3CC4 I;  2CGP A;  4BBR J;  3DKX A;  3RKY A;  4F55 A;  4BL0 B;  1Z1D A;  2BW3 A;  4PGH A;  3X2Q H;  2DFH A;  5D6E A;  3I56 I;  3U1D A;  2K86 A;  4KIF A;  4OMY A;  2XUB A;  1MDM A;  3HOU J;  5ICC A;  5HOD A;  1MW7 A;  3TED A;  3RJP A;  3MFK A;  1IUY A;  1MNM C;  5FLV A;  1EV7 A;  4L9J A;  1WQ2 A;  2H6C A;  1VFC A;  4JP0 A;  3FHZ A;  3HXL A;  4MHG A;  5CVR A;  4MQ9 F;  3BTJ A;  3FK7 A;  4XK4 A;  4U0Y A;  4KYW A;  1X4O A;  2O61 A;  1A6Q A;  3K4L A;  4PCQ A;  4FE4 A;  3V42 A;  2BHY A;  1ETY A;  1E0E A;  2O7O A;  2HKX A;  1FLI A;  4GGG A;  2XAH A;  2HQN A;  3ZMU A;  1VQ4 I;  2LOO A;  2ZFW A;  1X1B A;  4A3K J;  3ERE D;  1GT0 C;  3KP6 A;  3LST A;  5L3C A;  2X1D A;  2FUG 2;  2QZ8 A;  2MD5 A;  4DIQ A;  4EM2 A;  1J5Y A;  4FTH A;  2EFN A;  2YU3 A;  3Q5F A;  1Y56 A;  2Y0S N;  5IOY A;  5JLW A;  2LBF B;  3ZN0 A;  1TTY A;  3CCL I;  4ESJ A;  4M73 A;  3JRF A;  2IVM A;  3OYJ A;  2E34 A;  4A3M J;  5D5X B;  2G7H A;  4NQW B;  3HRS A;  5J8F A;  2GIV A;  4U87 A;  3BZ6 A;  4B8X A;  4XOP A;  1R4N B;  4IRI A;  2V79 A;  3KP2 A;  3QP5 A;  2DA7 A;  2HZD A;  4BYY A;  4ZDO A;  1HSJ A;  4HF1 A;  4AIH A;  3C7J A;  1MMS A;  3RTR A;  5GAH J;  5EDN A;  1ACI A;  3H5A A;  4ENJ A;  2IPQ X;  2L9S A;  1XCB A;  2GXA A;  5TRD A;  3Q9S A;  3A03 A;  4PJ0 C;  1YG2 A;  3DPU A;  3SEQ A;  5DCM A;  3AG1 H;  3CUQ A;  2W24 A;  3FWE A;  2R7D A;  2R5Y A;  2HOA A;  2B9S A;  4G12 A;  2HDW A;  2GXG A;  3ABU A;  5J4Y A;  1IC8 A;  3OYD A;  3GZN B;  2V1D A;  4CZC A;  1MBJ A;  4B47 A;  2NXN B;  2NNY A;  5E79 C;  1GUU A;  1UEL B;  1FC3 A;  1IGN A;  1RZ4 A;  3OV8 A;  5GAG J;  4PGG A;  2DPU A;  4A3C J;  1V4R A;  1YIO A;  4NBQ A;  3DU6 A;  4LB6 B;  1UMQ A;  4BY7 J;  3F8C A;  2LKS A;  1JUP A;  4HAM A;  1YTY A;  2OF7 A;  2WA0 A;  5LLQ A;  5HNF A;  1XGS A;  2WAQ N;  5C3E J;  1P4W A;  4O6J A;  1IUF A;  2ZCW A;  4RAZ A;  1JJ6 C;  1RKW A;  3CUO A;  4CH7 A;  3BR2 A;  5F04 A;  1PJR A;  1U9N A;  4XKV A;  1UHS A;  1FY7 A;  3OR1 C;  2Z1D A;  1PYV A;  1HDP A;  4WF2 A;  2CMP A;  3T0Y A;  3K0L A;  4M6Y A;  3KLO A;  4A0X A;  3HYI A;  4BBS J;  3CDH A;  5JVT A;  1T56 A;  1S7A A;  2LR8 A;  2QF7 A;  1U5T A;  2XSJ C;  1E2X A;  4LIU A;  3SEZ A;  5B1A H;  3L1P A;  3RSN A;  1OCO H;  4YFN F;  4XRS A;  5BOX A;  1NG6 A;  3MZY A;  2M34 A;  1B9N A;  4IPA A;  3W2W A;  3DEE A;  3RPU D;  5BQT A;  4IX7 A;  2RDP A;  3BTL A;  3GW2 A;  1KU2 A;  2JPC A;  2FEZ A;  2CH0 A;  4DZJ A;  3LOC A;  5DD4 A;  3J7Y J;  2KIS A;  2VBX A;  3HHG A;  2VKE A;  5E17 F;  1UZC A;  3G1M A;  1ZR4 A;  1Z91 A;  5E20 A;  2PEX A;  2Q1Z B;  4PUS A;  1LKX A;  3BR6 A;  4R79 A;  3BDD A;  4JYK A;  4XL9 A;  2KPM A;  1FOK A;  4BJT A;  1LE8 A;  2RNG A;  3W6J B;  2LY9 A;  3H0D A;  2P5K A;  2M0C A;  2V9V A;  3HUG B;  1WFX A;  5LEJ A;  4AVP A;  1MGT A;  4UUT A;  3DLA A;  2JA8 J;  2M4G A;  2DAO A;  1P4A A;  4PZJ A;  2MD0 A;  2QKM B;  2EBI A;  1Z05 A;  2KZG A;  3I53 A;  2O8K A;  2NAZ A;  3NWS A;  2M8E A;  1UHW A;  1HOM A;  1OCP A;  3LAP A;  1HCR A;  3AL0 B;  4FT8 A;  4OAZ A;  1IN5 A;  1F9N A;  1E3H A;  1I5Z A;  4BHC A;  2LY1 A;  4HOB A;  4AVZ A;  2DA2 A;  4E7L A;  2FU4 A;  3QPT A;  3T1B A;  3WU0 A;  3L00 A;  2L2O A;  1YOV B;  4QPO A;  4QSH A;  2NS7 A;  4ENK A;  1WPK A;  1G3S A;  3FMS A;  1YJW I;  2H8R A;  3VDX A;  5H20 A;  2MH2 A;  3FDY A;  1SEU A;  2GLO A;  2OA4 A;  1IDY A;  2A6T A;  1YX3 A;  4EJU A;  4YRV A;  3CJN A;  2E60 A;  1UST A;  5HNH A;  2CW8 A;  4L18 B;  2H09 A;  2WV1 A;  1VQO I;  2IS1 A;  2K9N A;  1RPW A;  2WBM A;  1IZ1 A;  2OAZ A;  4HNT A;  4RAG A;  4U0V A;  1KQ8 A;  1X3U A;  3GYH X;  3K1P A;  4HDU A;  3FXJ A;  1B59 A;  3TP0 A;  3MKW B;  3TOB A;  4BQA A;  3S17 J;  3OYC A;  5FLM J;  3WU1 B;  2UUZ A;  5L3G A;  3NQO A;  3OYE A;  1FEX A;  1HQC A;  2LFB A;  1OMI A;  3HZJ A;  5F0F A;  5F1J A;  4HX7 A;  9ANT A;  4IHX A;  1EA3 A;  5B1B H;  1HLV A;  3M8F A;  3F8B A;  3OYG A;  1XS9 A;  3Q0V A;  1V5F A;  4EJO A;  2BY2 A;  3M7G A;  4IEJ A;  2X51 A;  2E2H J;  4GXO A;  1TC3 C;  1NK2 P;  3DLL F;  1Y39 A;  5LHG A;  5HDN A;  4J19 A;  3A0B C;  2VT2 A;  2A5Y B;  3L7W A;  3ZQQ A;  1ZRF A;  1BIA A;  1G2H A;  4IVN A;  4D7N A;  4QLC U;  5DCF A;  1OR7 A;  5E1W A;  4B09 A;  1FP2 A;  4P9U A;  1X3Z B;  2DOE A;  3H1C A;  3SYT A;  1Z7U A;  5ED4 A;  4S05 A;  4UVC A;  1VF9 A;  3BZC A;  1A35 A;  2XKO A;  2P8T A;  3QOD A;  2CO5 A;  2EZK A;  2FRH A;  3GTG J;  2KZV A;  4YIR X;  3BCA A;  3CO7 C;  4KMF A;  3VSK A;  3BJA A;  3UKG A;  3B6C A;  1DU0 A;  5C4J J;  1HKS A;  1R5H A;  1X58 A;  2GIZ A;  2VE9 A;  3QOP A;  2WAD A;  3F22 A;  1T33 A;  4JX5 A;  3HEF A;  4C2U A;  1JE8 A;  2Y69 H;  1K4S A;  1REP C;  4XKC A;  2ZXH A;  4ZYH A;  1X3W B;  2K3F A;  2KJB A;  3RPU A;  1JT0 A;  4ZC3 A;  2LVS A;  4IRG A;  2Y0M A;  5EEG A;  4HLX A;  2DFF A;  1XSX A;  3JRA A;  3JRE A;  3CO6 C;  1Z0X A;  2VQL A;  5E8I A;  1RES A;  1JTY A;  2IXS A;  3CCJ I;  3MKL A;  4U88 A;  1H9G A;  1MNE A;  2JRM A;  4JQF A;  2K9Q A;  3L2W A;  3MWM A;  4RA2 A;  5E18 F;  5HLT A;  2RGV A;  5FKL A;  2M4K A;  5CQE A;  2LD5 A;  2ESH A;  3GBG A;  4CCO A;  5DTD A;  1MH4 A;  2NNN A;  3HTU A;  4IKF A;  1X1D A;  2OC6 A;  5F64 A;  3DFG A;  2JVH A;  3HKZ A;  1WJB A;  4HPQ A;  4GDF A;  1I6X A;  2CQK A;  3T5X A;  4OIN F;  2FE3 A;  3VPR A;  1I6H J;  4JBA A;  2DCE A;  3LFU A;  1ETQ A;  3TO7 A;  1JHH A;  5K5O A;  2F4O B;  2MBF A;  2RVC A;  3SZG A;  3A01 B;  5ILV A;  3RDI A;  2LF7 A;  4BEH B;  1A36 A;  2YPR A;  2R92 J;  1QBJ A;  4YEL A;  4KMU X;  1OYW A;  2X9D A;  1Y6I A;  2IGO A;  5D6F A;  4DYC A;  2ZJQ F;  1SD6 A;  4E7K A;  3Q9V A;  2ZSH B;  3OL4 A;  4LK1 F;  2VQC A;  3HM5 A;  1D3Y A;  2XIG A;  2X6O A;  3HPG A;  3CF2 A;  2P7C B;  2VPL A;  2ZC2 A;  5C4X J;  2P81 A;  4RMN A;  4KIT B;  2DU9 A;  3BJ6 A;  3HSF A;  1OPC A;  2W4S A;  3BP8 A;  2X4H A;  2QBY A;  2L9V A;  2VKV A;  1IN7 A;  4I99 C;  3U21 A;  4UV8 A;  1VQK I;  1B6A A;  3A0H C;  1TWC J;  1RET A;  3OL3 A;  1RI7 A;  1C0W A;  4EJW A;  3S2H J;  1Y0U A;  4CCK A;  4KNY A;  1MBG A;  2IS4 A;  3ZOB A;  5JFR A;  3E5X A;  4RGU A;  2FML A;  3ZMV A;  1WGX A;  3R6S A;  2P5L C;  3QRF F;  2LRE A;  4XM3 A;  2PJP A;  2X48 A;  4F92 B;  3JCU C;  2QQA A;  3KIO A;  4FET A;  2JA7 J;  2M0M A;  1KA8 A;  4ZZL A;  5AON A;  3PJR A;  3FXK A;  3H9Q A;  1W7P D;  1XMK A;  4RLF A;  5EZG A;  3F3X A;  3SHF A;  3ZQI A;  4WXH A;  5F27 A;  4MO7 A;  3TDU C;  2B63 J;  1Z6R A;  2GM4 A;  2HYF A;  3IUO A;  3WG7 H;  2PMZ N;  1SVL A;  3MAJ A;  4IO9 F;  5BPI A;  2GXB A;  1MBF A;  3CJR B;  1W0U A;  4HG2 A;  3A2K A;  2DLL A;  3HGG A;  2WB1 A;  3LSK A;  1BC8 C;  3F23 A;  3LQR A;  2V26 A;  5FKO A;  1NHA A;  1BOA A;  3WU2 C;  3IHU A;  1DPU A;  2PFB A;  3DXJ F;  3CJQ B;  4Y33 A;  4BQO A;  2QSF X;  4KIG A;  1ZAO A;  1YS6 A;  2E7W A;  2RN7 A;  5K5Q A;  3CMY A;  4EGZ A;  4G6D A;  3VOE A;  1LUJ B;  3DBR B;  4ZH4 F;  4I01 A;  3ZR8 X;  4D5C A;  2PLY A;  4N9I A;  3SZT A;  1Z9C A;  2FNP A;  1UAA A;  1RNL A;  2AXL A;  4L9V A;  2W82 A;  3P9K A;  3REO A;  1T2K A;  2XPV A;  3HOS A;  4BE0 A;  4Z2Y A;  1QQI A;  5EF6 A;  3Q3S A;  4X1E A;  4ZYA A;  1MSE C;  3BY6 A;  3GTO J;  2K40 A;  4CYC B;  1FTT A;  4MFD A;  2EV0 A;  3E6M A;  4UUS B;  4E7H A;  4NC8 A;  2MAB A;  3JTH A;  2IGM A;  3FXM A;  4Q5S F;  3DF8 A;  2DA3 A;  1ENH A;  3KLN A;  2BV6 A;  3CMM A;  2OQR A;  1MMA A;  2BGC A;  3IP4 B;  3GUD A;  3WE2 A;  1DPR A;  2DFE A;  1JGS A;  1SFU A;  2YX7 A;  1SFE A;  2H1L A;  3HPH A;  4AU7 A;  3CC7 I;  5FKK A;  3W2A A;  4M3G A;  4UHT A;  1SAX A;  3S15 J;  2HTS A;  2IA1 A;  4I09 A;  2WTE A;  3P7N A;  1VQ8 I;  1O3T A;  2F5D A;  4KA4 A;  5F0C A;  1K4T A;  2W00 A;  2V6C A;  4IOC F;  4OIQ F;  2R5Z B;  2JZY A;  1IRG A;  4NB5 A;  1LDK B;  3PFY A;  3EYY A;  4RGX A;  2HI3 A;  2A69 F;  5IP7 J;  2H6B A;  3O8G A;  2XGD A;  2EIK H;  4GYG A;  5EZH A;  3UNG C;  3BZK A;  3NEU A;  3GTL J;  2HVR A;  1XDU A;  2DMP A;  3M9A A;  4Y3O A;  2GWR A;  2DPD A;  1JI8 A;  3E6B A;  4IF4 A;  4CHU A;  4PFO A;  5FLX K;  1ZKG A;  4M3B A;  3ML6 A;  2ZJ2 A;  4E4H A;  3HOW J;  2GAU A;  3J7A Y;  1SD5 A;  3ZMS A;  2CWE A;  4I02 A;  2FMY A;  2X1E A;  2ELK A;  3TBI A;  3BPX A;  3WHC A;  2VOO A;  1D1C A;  1J9I A;  3DPL C;  1YE9 A;  3HSE A;  4IHV A;  4RBO A;  3GZ5 A;  3QYF A;  1BW5 A;  2QM3 A;  3BG3 A;  3OIO A;  1ON1 A;  3NWT A;  1R36 A;  2Z33 A;  3RI4 A;  4FHT A;  3CCQ I;  3M8E A;  2RV8 A;  2BBY A;  2K02 A;  4O5V A;  4ZTJ A;  2L9N A;  4CDG A;  1Z3X A;  1T39 A;  5E1Z B;  4ZTF A;  1MIJ A;  3H3Z A;  4EEF G;  2LLK A;  3BQY A;  4BQN A;  1ZG5 A;  2PMH A;  4EJT A;  1I39 A;  1Z3Y A;  4LMY A;  1FSH A;  3EUA A;  1JUS A;  3J81 K;  1IN6 A;  3F21 A;  4DQ2 A;  4M72 A;  2X85 A;  3HRM A;  2QYO A;  2L5Q A;  4CYD A;  2EFP A;  4EM1 A;  3OMY A;  2BW3 B;  4G94 A;  3IH3 A;  4L9T A;  3AG2 H;  2KRH A;  1LB2 A;  3M07 A;  2DO7 A;  4CCN A;  1S7E A;  5GAD J;  5H2F C;  2RKH A;  4B1R A;  2VOD A;  1MDM B;  1POG A;  1IJW C;  3S3N A;  3HTS B;  4ZYG A;  3IKT A;  1FOY A;  1YIJ I;  1JJ8 C;  3DKW A;  1MKM A;  3PIP F;  3GTJ J;  4AD9 A;  1WVR A;  4XIC A;  2K4J A;  1P7J A;  3J7A O;  5GTI C;  2L01 A;  4WXD A;  1JXS A;  1KQ0 A;  3JRD A;  4XSZ F;  3TKY A;  2BXZ A;  1K6Y A;  3LSH A;  1FZP B;  5FLX Z;  1F36 A;  4RGS A;  2EIJ H;  1HKT A;  3BG7 A;  1LVA A;  3RKX A;  4B4C A;  4AIK A;  5IPA A;  2CQQ A;  2ZNZ A;  1LDD A;  4AUX A;  3V7S A;  1T6S A;  1WCM J;  3PO3 J;  3PUF A;  3DBH B;  3CD6 I;  1W36 C;  1W4M A;  2DJI A;  5JVG F;  1P2F A;  3IAM 2;  3CJT B;  3BJO A;  4Y7N J;  4M74 A;  1J09 A;  2E71 A;  5HS8 A;  2MH9 A;  2DA5 A;  4EQQ A;  3TP3 A;  1GV2 A;  4OIP F;  3FIS A;  2VC1 A;  4KFC A;  4PDK A;  4XLC A;  1B9M A;  1UHM A;  2VPR A;  3CTA A;  2XRN A;  3DKY A;  1ONV A;  3F6V A;  4RLQ A;  4LG3 A;  3G2B A;  3W3C A;  4L5J A;  5B66 C;  2K7L A;  3QU6 A;  2DMT A;  3CLQ A;  3C2B A;  5LRS A;  3KP4 A;  1J0R A;  1YJN I;  1M1E B;  1S8N A;  1ZHF A;  3BQZ A;  3J81 Z;  3WTY C;  3H3V K;  2O5R A;  3RKQ A;  1R00 A;  3PFI A;  3IKV A;  2EJR A;  4U0W A;  2EFQ A;  2NVU B;  3S8P A;  3GEZ A;  4MNU A;  1ZG1 A;  1JKQ C;  2XPW A;  2HYJ A;  4U7B A;  5DCM B;  4KIS A;  2VL8 A;  3CUQ B;  3K69 A;  1IG7 A;  3H9J A;  1Y8Q B;  1GLN A;  2VJI A;  2R5Y B;  4P1W A;  2E2J J;  1HBX G;  3K2A A;  3P9C A;  4K2E A;  2EIN H;  3MQ0 A;  5J4V A;  1OLT A;  4C3H J;  2DMQ A;  3ESW B;  3PO2 J;  2FXA A;  1X19 A;  2FOK A;  3SQN A;  4JK1 X;  4DYQ A;  2XRO A;  1MH3 A;  3OR2 C;  3OS2 A;  4IQ4 A;  2IEK A;  5HS7 A;  4A12 A;  4X6A J;  2KT0 A;  2P0W A;  3ZQ7 A;  1CF7 A;  5KCM A;  2TRT A;  3BG9 A;  3C2G A;  4HNU A;  1K7A A;  3N05 A;  1F4K A;  5E3O A;  2CV2 A;  3ZQL A;  2ID3 A;  3G73 A;  3GF2 A;  1BJA A;  3I58 A;  1BL0 A;  1B1B A;  2A3S A;  3PNV A;  4Y17 A;  1BR4 A;  2K5C A;  2ZSI B;  2LKX A;  2V7F A;  2STT A;  2EZH A;  4LB5 A;  4UB6 C;  5IOZ A;  1FP1 D;  2HEO A;  1H9T A;  2NS8 A;  3DTK A;  3HIF A;  4QWQ A;  1X2M A;  1VND A;  4ZZD A;  4IHW A;  4L0Y B;  1EF4 A;  4PK4 A;  4KT6 A;  5DUI A;  4I0B A;  1U5T B;  3IV5 A;  4HYE A;  2NS0 A;  3LA7 A;  2BXY A;  2CUZ A;  1VQN I;  5ICG A;  4UNO A;  1N25 A;  4MTE A;  1WJ5 A;  3PSF A;  5IP9 J;  2XKP A;  2LH9 A;  1WJF A;  1S7O A;  2JK3 A;  3CMA I;  3ZGK A;  4XRF A;  4YII A;  2R7R A;  2L0K A;  1Y1W J;  3L2C A;  3ZQG A;  1PUF A;  3K70 D;  2Q2E A;  5FB2 A;  2Y31 A;  4HA8 A;  2DK8 A;  2O6G E;  5DS9 A;  3GLL A;  1U3E M;  4BGD A;  3OIQ A;  2EA2 A;  1Z21 A;  4P55 A;  4CIC A;  3JRH A;  4B3A A;  2WAE A;  2Z99 A;  1U8B A;  2KHM A;  3ABK H;  3KET A;  1YRN A;  4BY1 J;  3ECO A;  2JQ7 A;  1A5J A;  2OTL I;  4ON0 A;  2KDZ A;  4E7I A;  3CC2 I;  3F9K A;  2GA2 A;  1VQP I;  1H8A C;  4A69 C;  4LG0 A;  2KL4 A;  2M8G X;  3DU5 A;  4FE7 A;  1YFH A;  3V8L A;  3JRB A;  2PMU A;  2VJ5 A;  1FBQ A;  1CGP A;  1TLH B;  2Y75 A;  3RZD J;  2J5P A;  2L7Z A;  3TO9 A;  1WSU A;  2E1O A;  5K7F A;  4HRI A;  2IAI A;  4HF2 A;  3S1N J;  1QVT A;  1EKE A;  4ETS A;  3CDI A;  3ABL H;  5D5V B;  2AO9 A;  3WG9 A;  1HC8 A;  1Q1V A;  4Y52 J;  5E8G A;  3HKZ N;  3M8J A;  2A6E F;  3WGG A;  2OCE A;  3FX3 A;  4YFK F;  2NVX J;  5EJC A;  1FIA A;  2VB6 A;  3PNT A;  4NDL A;  4A93 J;  2COM A;  1TWG J;  3ZXS A;  3OYN A;  1BI0 A;  1Z67 A;  2VN2 A;  5FKN A;  2MA3 A;  3FHN A;  5IYB J;  1TW3 A;  1S29 A;  2I5U A;  4XKW A;  2IA0 A;  3LFK A;  5E3L A;  5B5E C;  4H4K C;  4OOI A;  1Q1H A;  3BRO A;  3K4M A;  1NTC A;  2LYC A;  4UUV A;  4LFU A;  4KUM A;  3KYL A;  5HLG A;  1LPQ A;  1FOX A;  4Q4Z F;  2KIQ A;  3G1O A;  1S5L C;  4DJA A;  3W6V A;  1G6N A;  1Z77 A;  3OYL A;  1ZTR A;  4N0B A;  2DA1 A;  1BN5 A;  2EH3 A;  1SMY F;  4ENN A;  2JWT A;  1ODD A;  1TZL A;  2ELJ A;  5LD2 C;  1OIS A;  4AIJ A;  1JKO C;  1GXP A;  3KZI C;  2HOS A;  3LSI A;  2R4G A;  3JTG A;  4RM2 A;  2E35 A;  3KEY A;  2XF7 A;  2Y0S A;  2HVS A;  3JSO A;  2XB0 X;  4AYB A;  1P6R A;  3GCM A;  4DNC A;  4YFX F;  2RAE A;  2JA5 J;  2DT6 A;  4A0Y A;  1TQI A;  2FNA A;  3GLX A;  3R60 A;  3WGI A;  3ZP5 A;  3AG4 H;  5FKM A;  2HWV A;  3CUQ C;  4BDY A;  1X1P A;  1QPM A;  1U6G A;  1YW8 A;  3RQI A;  3W2V A;  4AWX B;  5J8C A;  2XSD C;  2W7N A;  1VQL I;  3H5N A;  2IGN A;  2EIM H;  1D0Y A;  5D4S A;  1IAW A;  1VQ5 I;  5EG0 A;  4BJ6 C;  2M5W A;  1Y1V J;  4II3 A;  3RYR A;  3WTV C;  2Z5U A;  2IS6 A;  1FSE A;  2VQH A;  3IH2 A;  1BI3 A;  1TWH J;  4FCY A;  3BOQ A;  5FGM A;  5IP6 A;  4ZJZ A;  2NVT J;  2QLZ A;  4KN4 X;  1ZLJ A;  3VEP A;  1TP4 A;  2V9P A;  2HQ5 A;  3K1N A;  3U2R A;  3DBL B;  3F6O A;  1U8R A;  1FBS A;  3BPV A;  2DMU A;  3CCS I;  1XGM A;  5DM6 F;  1PP8 F;  1IW7 F;  1TW2 A;  3VSL A;  5B3S H;  1KYW A;  2PI0 A;  4I7H A;  5DUK A;  2HQA A;  1D0Z A;  3GME A;  3S2D J;  2R7F A;  1T98 A;  4A3B J;  4HST A;  5L3B A;  1LVK A;  1W0T A;  4A3E J;  1F5T A;  2BE5 F;  2PX9 A;  2MGQ A;  2ZNY A;  1ON2 A;  2VLA A;  1SFO J;  2HXI A;  1QZZ A;  2ID6 A;  2XF6 A;  2XC7 A;  2WAQ A;  1APL C;  5CVI A;  5CVU A;  3JAM K;  1P92 A;  5IT3 A;  3NRV A;  1AKH A;  4W1U A;  2C6Y A;  3HG9 A;  1VQ7 I;  2LC2 A;  3E1S A;  4XLP F;  1F1Z A;  1OYY A;  3A4C A;  3A02 A;  1VZ0 A;  2QA4 I;  1VQM I;  1FX7 A;  2KKO A;  2L7F P;  3C1D A;  4RGR A;  1CQT A;  5K7Z A;  2CV0 A;  1S9H A;  2FX0 A;  2RQQ A;  4V2G A;  3QP6 A;  4Y4R A;  5DDG A;  4UVB A;  3LMM A;  1IRZ A;  3OS1 A;  2LRD A;  2NVY J;  1W36 D;  4NC7 A;  2L3D A;  4YEJ A;  5AIP A;  1GVD A;  3LWF A;  2JPB A;  2ESN A;  3QPL A;  3SDG A;  1TL8 A;  1IN8 A;  1T38 A;  1FYM A;  3I71 A;  3G4S I;  1ZN2 A;  1LNW A;  3IWZ A;  2ZXJ A;  1FMV A;  2VON A;  1ITY A;  2HXO A;  2JJ7 A;  4AC0 A;  3Q0W A;  4E6K G;  1KU9 A;  2FA5 A;  4XLH A;  5F1R A;  5GTH C;  1I50 J;  5IYD J;  2QBY B;  2E19 A;  3MZ8 A;  2VBZ A;  2Y9Y A;  3WTZ A;  5DM7 F;  4BAY A;  4WCG A;  4BUP A;  3G3Z A;  4S04 A;  2XRL A;  3AL0 C;  2XVC A;  3FXL A;  4X0G A;  3UR3 C;  2PJR A;  3FBN B;  2A6H F;  2OJE D;  4QTR A;  2HU9 A;  2ELH A;  2A05 A;  3F72 A;  2QSH X;  4DBR A;  1VQ9 I;  3KE2 A;  4TV7 A;  1FBU A;  1OJL A;  3FXU A;  4P9F A;  3TW7 A;  4IOA F;  3KP3 A;  2ZXI A;  4ZDL A;  3K4C A;  3HB9 A;  3JAM Z;  4HQE A;  1OCR H;  1XB4 A;  3D5S C;  2IA2 A;  3FZV A;  1MMD A;  3O6B B;  3PNY A;  4A3D J;  2EWN A;  2R7V A;  1KGS A;  1AU7 A;  2P4W A;  1ETX A;  1B72 A;  1R7J A;  2DTR A;  4LK0 F;  3PSI A;  3SFI A;  2VXZ A;  1MZB A;  2EV6 A;  4HQM A;  2AQE A;  4IHT A;  4J00 A;  4L5I A;  5EGO A;  1ZGJ A;  3LSJ A;  4V2F A;  3J80 K;  1G3Y A;  2LG4 A;  2XHK A;  3CZ6 A;  2KQR A;  2JA6 J;  2NYX A;  2B0L A;  2B7E A;  1D1B A;  5CKT A;  3PQJ A;  1O7L A;  3JRC A;  3CCM I;  1R5I D;  2R7W A;  2E1M B;  1SFX A;  1HDD C;  3K6G A;  2KRC A;  4HX8 A;  4ASN A;  4XLN F;  4NNJ A;  1ETK A;  3BTC A;  3ABM H;  1OR7 C;  2YSR A;  3QQA A;  4I76 A;  3CF5 F;  2R7T A;  1WH5 A;  2XV4 S;  4GCV A;  4NC6 A;  2L4M A;  3D5L A;  1SFK A;  3K4B A;  4A6D A;  3K70 C;  2CV1 A;  3BG5 A;  3D1N I;  3K4K A;  3V8K A;  1LJ9 A;  2F5C A;  1G3T A;  3E7L A;  4G6T B;  3K9T A;  5CLS A;  3K4J A;  3P9I A;  3FMQ A;  2XGE A;  3ZRG A;  2UWM A;  3DTI A;  1ZGA A;  2LTP A;  5HLI A;  4I0A A;  5HDK A;  4KT5 C;  4Y15 A;  1B8I B;  1U0J A;  2O3F A;  4LD5 A;  1NK3 P;  1BI2 A;  3K4N A;  2K27 A;  2E5N A;  3MEX A;  2CQX A;  2HTJ A;  3DPT A;  5ICF A;  1YIT I;  4DOZ A;  3E3V A;  1JTX A;  4Z6Y A;  4GRI A;  1XX5 A;  1KU3 A;  1AA7 A;  1KU7 A;  2ZME A;  4XR6 A;  5A2Q K;  3T8R A;  3COA C;  2A68 F;  3E5U A;  3I4N J;  3EUK L;  5L3D A;  2GA1 A;  2AQF A;  5GPA A;  2VKH A;  4XRS G;  5DEQ A;  1W5T A;  3LL7 A;  4XOT A;  5M3F J;  1LFU P;  1X4P A;  2OD5 A;  3FF5 A;  2EFW A;  1K78 A;  1O57 A;  3AAF A;  1O3S A;  2CFX A;  4XKB A;  2R3S A;  2XAQ A;  2DA4 A;  1E17 A;  2O8X A;  1R1U A;  1YJ9 I;  3LQQ A;  3S14 J;  4G7Z F;  3KPH A;  1UJ8 A;  2R7U A;  1V55 H;  4HBL A;  2CRG A;  3ZQF A;  3J80 Z;  1XDS A;  3CQZ J;  2WY8 Q;  3OY9 A;  1XC5 A;  4A0Z A;  2OZ6 A;  3I55 I;  2LDU A;  2BY0 A;  3IRQ A;  2STW A;  2O0Y A;  3E5Q A;  3HC7 A;  4PJN A;  4M6V A;  1DU6 A;  2CUF A;  3HOT A;  5LHH A;  1R58 A;  2QKL B;  2R7X A;  4C3J J;  3BC8 A;  2COB A;  2HFH A;  2CW0 F;  3PIO F;  4IL6 C;  1IO2 A;  1KQ9 A;  3KCC A;  2DK5 A;  4RAF A;  3ELK A;  4RB3 C;  4BDZ A;  4CCM A;  2R7O A;  1KYZ A;  1OCZ H;  4A2U A;  2QQ9 A;  3TO6 A;  4F7Z A;  3A1Y A;  2NVQ J;  1XMA A;  3GFL A;  2V6E A;  2ETH A;  1USS A;  2L7M P;  1QU3 A;  2RC4 A;  2Y30 A;  1R22 A;  1S6L A;  3PL8 A;  2WC2 A;  3C2H A;  5KHD A;  3MKY B;  1Y8R B;  4RM3 A;  3PQK A;  2MW8 A;  1D8J A;  4G6Q A;  4NHJ A;  5M3M J;  1R6R A;  3I9V 2;  3VOD A;  1S72 I;  3LA3 A;  1DP3 A;  4IHS A;  1XN7 A;  3BT9 A;  2F5V A;  1FIP A;  5LGN A;  3S16 J;  1XCV A;  1UG2 A;  2LMD A;  3U1K A;  5A2Q Z;  3BR0 A;  1SVM A;  4P5O A;  4UV9 A;  2Z9O A;  1STZ A;  1PUE E;  2PQ8 A;  2EPF A;  5E3N A;  4A5N A;  1MJA A;  2YU9 J;  1BIB A;  2KIF A;  1SMT A;  2MC4 A;  1JGG A;  4HSR A;  2ADU A;  3ULQ B;  2JUG A;  5KVR A;  2HNH A;  3GVA A;  3LA2 A;  3OYA A;  1JT6 A;  4G7H F;  2RNJ A;  5M5W J;  3KX2 A;  1N75 A;  3QPS A;  1QA6 A;  5FD6 A;  3GTK J;  1QZE A;  3I5U A;  3V4G A;  5LGU A;  1A31 A;  1YW7 A;  1ZRE A;  1RUN A;  3HOY J;  1IN4 A;  2CQ7 A;  1W7P A;  2QGU A;  3I64 A;  2V1U A;  2MLK A;  4BAC A;  1LEA A;  1RR8 C;  3FIW A;  3CME I;  3ZMD A;  1V5G A;  2LNB A;  2Q0O A;  3F8N A;  4AM3 A;  2CQN A;  3BR5 A;  1P4X A;  4I2O A;  5EEH A;  1QGP A;  2R93 J;  1OQY A;  1O3R A;  4E7Z A;  3TL4 X;  3F0C A;  3IL2 A;  2UZK A;  3MMY B;  4OAY A;  5BNG A;  4ESF A;  3HGY A;  5ICE A;  3G1L A;  1TQM A;  4LLL A;  1BJZ A;  3ECH A;  4HEA 2;  4GO1 A;  2DN0 A;  1XG1 A;  4IRH A;  3RKW A;  3JRG A;  1BC7 C;  2L4A A;  3HL2 A;  1QHH D;  3L2V A;  2QUF A;  5DV5 A;  4OMZ A;  5HOO A;  1ETV A;  1VI0 A;  4M3F A;  1R1V A;  1X1C A;  2W85 A;  3ZQC A;  4HV6 A;  4XLE A;  2AS5 F;  5D5U B;  5CVJ A;  3HOX J;  3CP2 A;  1FPQ A;  2XAU A;  2JN6 A;  2PMZ A;  2V9K A;  4M3E A;  3DTE A;  1WZ2 A;  5E3M A;  3D0S A;  4EV0 A;  1R71 A;  1B4A A;  1EH7 A;  4OWR B;  3TQN A;  1XD7 A;  1T0F C;  4CGZ A;  2X1C A;  2F5E A;  4Q48 A;  5LRR A;  5LFA A;  1PDN C;  1BR1 A;  3G6E I;  4GFB A;  3ZMZ A;  2ZO4 A;  2OUM A;  2ZB9 A;  3IRR A;  5BPD A;  3DCF A;  1ZYR F;  3DQV C;  4M3D A;  4IJA A;  1I3A A;  3GWZ A;  4XSX F;  3ZN1 A;  2OV7 A;  1DP7 P;  3TW6 A;  3ZCO A;  3QAH A;  2MFZ A;  4RB2 C;  2D1H A;  1YW9 A;  2DOF A;  5LBQ A;  5GP9 A;  5FFX A;  3KP5 A;  4MEX F;  2JUC A;  1WKM A;  3OYK A;  5J47 A;  3L09 A;  4EVI A;  2WV0 A;  2N8G A;  3BR1 A;  3ONQ A;  3L2Q A;  2O03 A;  3I59 A;  1XSD A;  4E7J A;  2Z3Y A;  2ISZ A;  4XQF A;  3EUH C;  5FRN A;  2JMW A;  1TWA J;  2W48 A;  1O3Q A;  3KZZ A;  2HGC A;  4JX6 A;  2D2W A;  4C30 A;  2PBI A;  4HZF A;  3HJE A;  1SVO A;  2L02 A;  3E6D A;  1ZR2 A;  2BHZ A;  2BVL A;  3FK6 A;  2LY2 A;  3SDB A;  3I3L A;  1W5S A;  1V3F A;  5FJ8 J;  2GOX B;  3B73 A;  1D8K A;  4A3G J;  1YI2 I;  5LHI A;  4F3Q A;  5J40 A;  5FRO A;  2D5V A;  1YHQ I;  4ZDP A;  3GXO A;  2JT1 A;  1IXC A;  1UCR A;  1J75 A;  1CF7 B;  4AID A;  2I10 A;  3ABT A;  2FF4 A;  1ETW A;  2DDA A;  3ASN H;  1QNT A;  3OWT A;  4PJL A;  1SD7 A;  3TMO A;  2LP0 A;  4MGR A;  1P9Q C;  2H94 A;  2M30 A;  4Y13 A;  4HNV A;  2XGC A;  4R1H A;  4O3M A;  3QWL A;  2W84 A;  4AYB N;  1MD0 A;  5LGT A;  2QEN A;  3OYB A;  1OKR A;  3SZP A;  4MFE A;  2HKO A;  2FBK A;  2VI6 A;  5CQG A;  3WHB A;  2DT7 B;  3CCY A;  3VYR B;  3LNQ A;  1GDT A;  1IF1 A;  5HS9 A;  1TNS A;  1HW5 A;  3N97 A;  3WTS C;  2E2I J;  4ABZ A;  1HA8 A;  3VB2 A;  3CCU I;  1ZEL A;  1D5Y A;  2LBF A;  2WWY A;  2KP6 A;  1DQU A;  3M1C A;  4DW6 A;  1HW2 A;  2R0Q C;  4W97 A;  2RQP A;  1JKP C;  2DOD A;  1WHU A;  3K1M A;  4BE2 A;  2P6T A;  2YR2 A;  3CLO A;  4NQW A;  3KEO A;  2BY3 A;  5IT9 K;  2F2E A;  1EH6 A;  4N9H A;  3MD2 A;  1FT9 A;  1PUF B;  2I8D A;  1RKT A;  3E0J B;  3RCO A;  2Q2E B;  5F6F A;  3G71 I;  3BWG A;  3GZ6 A;  2LSO A;  2W25 A;  1K79 A;  3QOE A;  3H9G A;  3IWF A;  2CUE A;  3H35 A;  3TGN A;  3O3K A;  1ZAR A;  3NAR A;  1G4D A;  1YRN B;  3RZO J;  5J3L A;  3W6K B;  1U9O A;  1D5V A;  3M4O J;  1YS7 A;  4OIR F;  3OSG A;  3FBI B;  3HHH A;  3IC7 A;  4BXX J;  4M9S A;  4LG0 B;  4MLO A;  4BJ5 C;  3I4P A;  3PM1 A;  2Y2Z A;  4QPQ A;  1MBH A;  2QVO A;  2HPM A;  1QPI A;  4LLN A;  2F4M B;  1XMX A;  2KRF A;  1LE8 B;  5CPR B;  4ZYE A;  2JTV A;  4LIT A;  3BG6 A;  1X2N A;  2HOE A;  1BI1 A;  5JI6 A;  4BE1 A;  1IV6 A;  1N77 A;  2VKD A;  1WJA A;  3S1M J;  4A3I J;  4KIC A;  4M6X A;  2ME6 A;  3BTI A;  1ZRD A;  4YG2 F;  3JSP A;  5BS6 A;  1QZY A;  2O9L A;  4A3J J;  1ORK A;  5HDG A;  2ME0 A;  3MN2 A;  3MVP A;  1XTA A;  2IW5 A;  3T8T A;  2EA4 A;  3R0J A;  3BR3 A;  5ILS A;  5D8L B;  5M5Y J;  4N4O B;  4V19 K;  2QEX I;  3H0G J;  3HRT A;  2QWW A;  1HXD A;  3MKZ A;  2HOT A;  1WJC A;  4PSX A;  4XID A;  1MBE A;  2W57 A;  1KZH A;  1P7I A;  2BYV E;  3OSF A;  3ZPL A;  3EYI A;  2K4B A;  2HDC A;  2R7Q A;  3IAS 2;  3EPZ A;  1JUM A;  2A07 F;  1UG0 A;  2D1V A;  1I3Q J;  5IT9 Z;  2VUM J;  4JOM A;  3WTT C;  5J1R A;  4A6E A;  4LGW A;  3N4M A;  2OQG A;  4KDP A;  1WWX A;  4L5E A;  1MJB A;  3R61 A;  4XN0 A;  2K9M A;  3LSG A;  4RB0 A;  4F91 B;  2KLO A;  1RC9 A;  1IDZ A;  3VYU B;  4WX9 A;  3LSM A;  2X6Y A;  1RRJ A;  3P5J A;  3HSR A;  1ZLK A;  4DGW B;  3RYP A;  2XGX A;  2L54 A;  4BXF A;  3GFI A;  2ZFU A;  2KIU A;  2OBP A;  3CCV I;  2E1C A;  3HUG A;  4CUG A;  1LEB A;  2ZBK A;  4PJM A;  3K10 A;  4G7O F;  1SAN A;  2QCO A;  3JW4 A;  1L0O C;  2VAS A;  3VYS B;  4C3I J;  2P5V A;  5HVQ C;  2H1K A;  5EG0 B;  1TBX A;  2VXD A;  1O4X A;  4FX4 A;  4UXN A;  2DJN A;  1LFP A;  5CVV A;  2X6W A;  2HQR A;  3V7C A;  3FM5 A;  3K7A J;  1VQ6 I;  4HW0 A;  1AWC A;  2BEO A;  3I54 A;  3TDZ C;  4KIB A;  2MYS A;  4I6Z A;  5KNL A;  1R9T J;  2HDD A;  1A6I A;  3H36 A;  3B6A A;  3S2W A;  2H27 A;  2NOJ B;  5H6R A;  1ETO A;  1QVU A;  5JHF A;  1UB9 A;  5FRM A;  4CO8 A;  4B44 A;  5GPC A;  1J2X A;  4E70 A;  2D45 A;  1ULY A;  1IRF A;  4CA0 A;  2ZXW H;  2DQR A;  2DQL A;  3LSR A;  2JA2 A;  5KAF C;  1RUO A;  3VYT B;  5TIS C;  1W1W E;  1QHG A;  2EQR A;  4KN7 X;  3PUB A;  4OU0 A;  1QO0 D;  2VJJ A;  1R1T A;  4MQV A;  4DBQ A;  2G0E A;  1GHC A;  4A3F J;  1TT5 B;  4EGY A;  3Q0U A;  3HOZ J;  1JKR C;  2W1O A;  2K9L A;  6PAX A;  3C3W A;  5K1Y A;  1V5E A;  2WB1 N;  2OZU A;  1YLF A;  3RIR A;  1A04 A;  1I27 A;  2G9W A;  3CES A;  5EYR A;  4OIO F;  2ECB A;  1Z7L A;  4C9Y A;  3FMR A;  1V54 H;  1AKH B;  2VOP A;  2M3A A;  4XRM A;  2IGK A;  2KFD A;  2VE8 A;  2ZKZ A;  4EM0 B;  3V7R A;  3CP8 A;  1YO5 C;  1XGN A;  1G59 A;  3AKZ A;  1U5T C;  1FYL A;  4D9J A;  2OTJ I;  1ZRC A;  3GX4 X;  3MZH A;  4HDV A;  3AFH A;  3O8H A;  3SJM A; 
#chains in the Genus database with same CATH homology
 4BBS J;  2CQX A;  4XIC A;  1P7J A;  1T56 A;  2LR8 A;  2QF7 A;  3L1P A;  1JTX A;  4XRS A;  2M34 A;  3HOV J;  3JRD A;  2GBY A;  3BTL A;  2EZL A;  1F36 A;  4DZJ A;  3I4N J;  3LOC A;  4B4C A;  5GPA A;  4XRS G;  5IPA A;  2CQQ A;  2VKE A;  4AUX A;  3G1M A;  1WCM J;  5M3F J;  1ZR4 A;  3HBL A;  1LFU P;  3PO3 J;  3ZQH A;  3GTP J;  3BR6 A;  3JRI A;  2CU7 A;  1H88 C;  4JYK A;  5J1Y A;  5IYC J;  2DA4 A;  1LE8 A;  3S14 J;  2LY9 A;  4DZP A;  2CRG A;  3ZQF A;  2M0C A;  4Y7N J;  3GTQ J;  2DA5 A;  4UUT A;  1U78 A;  3CQZ J;  3TP3 A;  2JA8 J;  1XC5 A;  1GV2 A;  3FIS A;  2EBI A;  2VPR A;  4M6V A;  2O8K A;  1DU6 A;  2CUF A;  1BW6 A;  2XB5 A;  1HOM A;  1OCP A;  1HCR A;  4C3J J;  2DMT A;  4JX4 A;  2COB A;  2M2E A;  3C2B A;  4MIM A;  2DA2 A;  3BQZ A;  3H3V K;  1OFC X;  4QSH A;  2NS7 A;  3RKQ A;  2CJJ A;  1WPK A;  2NVQ J;  2H8R A;  1B72 B;  2GLO A;  2L7M P;  2Y30 A;  1JKQ C;  2XPW A;  1IDY A;  2HYJ A;  4IHY A;  1IG7 A;  5EGO B;  2R5Y B;  2E2J J;  3K2A A;  2WV1 A;  2MW8 A;  1E3O C;  2K9N A;  1ZQ3 P;  1RPW A;  4C3H J;  2DMQ A;  5M3M J;  3PO2 J;  4DYQ A;  3BT9 A;  1FIP A;  1MH3 A;  3S16 J;  1UG2 A;  2IEK A;  2LK2 A;  3TP0 A;  3BR0 A;  4X6A J;  2KT0 A;  3A01 A;  3FKI J;  2TRT A;  3BG9 A;  3S17 J;  2L9R A;  5FLM J;  2FJ1 A;  3JR9 A;  5E3N A;  2YU9 J;  5E3O A;  3ZQL A;  2ID3 A;  1WH7 A;  2FD5 A;  1JGG A;  1FEX A;  5EEA A;  2LFB A;  5F0F A;  5F1J A;  1BL0 A;  9ANT A;  4IHX A;  1JT6 A;  1HLV A;  2R7Z J;  2LKX A;  5M5W J;  3QPS A;  1XS9 A;  2EZH A;  3Q0V A;  3GTK J;  4IEJ A;  2E2H J;  3LSP A;  5IOZ A;  1MBK A;  1NK2 P;  1TC3 C;  3HOY J;  2DA6 A;  4J19 A;  2NS8 A;  1G2H A;  3GTM J;  3FIW A;  1X2M A;  1VND A;  1BA5 A;  4D7N A;  4IHW A;  1EF4 A;  2YUS A;  3BR5 A;  3IV5 A;  2R93 J;  2K9S A;  3F0C A;  1K83 J;  5BNG A;  3HGY A;  5C44 J;  1VF9 A;  3G1L A;  1BJZ A;  5IP9 J;  2MG4 A;  2DN0 A;  4D7M A;  5J1U A;  1XG1 A;  2JK3 A;  2FQ4 A;  2EZK A;  3JRG A;  2L0K A;  1Y1W J;  4C2M J;  3GTG J;  3ZQG A;  4LOC A;  1PUF A;  1ETV A;  1VI0 A;  4M3F A;  1DU0 A;  3UKG A;  3B6C A;  4DYR A;  2Y31 A;  5C4J J;  3ZQC A;  3HOX J;  1X58 A;  5DS9 A;  2JN6 A;  1HF0 A;  4M3E A;  3JRH A;  5E3M A;  1T33 A;  4JX5 A;  4B3A A;  4QIW N;  3HEF A;  1U8B A;  2ECC A;  1YRN A;  1F43 A;  4BY1 J;  1GV5 A;  1A5J A;  4GFB A;  1JT0 A;  2XPU A;  2KDZ A;  1RR7 A;  2ZB9 A;  2LVS A;  3DCF A;  1LFB A;  3IH4 A;  4M3D A;  1H8A C;  4A69 C;  3JRA A;  2M8G X;  3JRE A;  3HDD A;  4FE7 A;  3TW6 A;  4D5F A;  3JRB A;  1Z0X A;  1RES A;  1JTY A;  1ZK8 A;  3RZD J;  5GP9 A;  2L7Z A;  3MKL A;  1H89 C;  2EZI A;  2E1O A;  5K7F A;  2IAI A;  3S1N J;  2N8G A;  1QVT A;  3BR1 A;  2K9Q A;  2AO9 A;  1B8I A;  1Q1V A;  2OPT A;  2JMW A;  4Y52 J;  1TWA J;  2W48 A;  3HKZ N;  5FKL A;  3CDL A;  2LD5 A;  1FTZ A;  2NVX J;  4JX6 A;  2M9H A;  3GBG A;  1FIA A;  5DTD A;  4NDL A;  4A93 J;  1MH4 A;  1TWG J;  1ZGW A;  1ZR2 A;  3FK6 A;  5FKN A;  4A3L J;  5IYB J;  5FJ8 J;  5K7H A;  5E3L A;  4RDU A;  3VPR A;  4A3G J;  1I6H J;  4CYC A;  2D5V A;  4UUS A;  1NTC A;  1ETQ A;  3A01 B;  2I10 A;  1ETW A;  2MSY A;  3G1O A;  2R92 J;  3W6V A;  1Z77 A;  2LP0 A;  5JLX A;  1ZTR A;  1MSF C;  2X9D A;  4HNV A;  4DYC A;  2DA1 A;  2XGC A;  2EH3 A;  4AYB N;  2JWT A;  3HM5 A;  2X6O A;  2DMN A;  1JKO C;  1K61 A;  2HOS A;  4MFE A;  5C4X J;  2VI6 A;  3WHB A;  2P81 A;  1AHD P;  3CCY A;  3LNQ A;  2XB0 X;  1GDT A;  2JA5 J;  2RAE A;  5F0H A;  2E2I J;  4ABZ A;  2R5Z A;  2Y9Z A;  2VKV A;  1FJL A;  2IBD A;  1D5Y A;  1TWC J;  1RET A;  5FKM A;  4S0H B;  4DW6 A;  2R0Q C;  3S2H J;  3RQI A;  4W97 A;  1MBG A;  2XSD C;  1JKP C;  3ZOB A;  3OOU A;  1QRY A;  3S1R J;  3NAU A;  5EG0 A;  1WGX A;  1Y1V J;  2DTZ A;  3M3Y J;  2TCT A;  2AHQ A;  2X48 A;  1PUF B;  1RKT A;  3IH2 A;  1WI3 A;  1TWH J;  1OCT C;  2JA7 J;  4FCY A;  3S1Q J;  3DEW A;  5IP6 A;  5M5X J;  2NVT J;  4BKX A;  5EZG A;  3ZQI A;  5F27 A;  2HQ5 A;  4MO7 A;  2CUE A;  2B63 J;  2GM4 A;  2DMU A;  3NAR A;  1YRN B;  5F08 A;  3RZO J;  5J3L A;  2PMZ N;  1TWF J;  1U9O A;  3I4M J;  3M4O J;  3OSG A;  1MBF A;  4BXX J;  1W0U A;  3S2D J;  4MLO A;  4A3B J;  3PM1 A;  2Y2Z A;  1MBH A;  1QPI A;  1LE8 B;  3HGG A;  1W0T A;  4A3E J;  1X2N A;  5FKO A;  2YS9 A;  1IV6 A;  2MGQ A;  4FIS A;  1SFO J;  2HXI A;  2NOG A;  2ID6 A;  3CMY A;  3S1M J;  1APL C;  4A3I J;  4BBR J;  2ME6 A;  3BTI A;  1AKH A;  4W1U A;  4D5C A;  2O9L A;  4A3J J;  1ORK A;  2ME0 A;  3MN2 A;  3MVP A;  2XPV A;  3BR3 A;  3A02 A;  3HOU J;  5M5Y J;  5EF6 A;  2L7F P;  3Q3S A;  4X1E A;  5HOD A;  3H0G J;  1CQT A;  5K7Z A;  1MSE C;  2K40 A;  4CYC B;  3GTO J;  2FX0 A;  4MFD A;  1FTT A;  4V2G A;  4UUS B;  3TED A;  2HOT A;  4XID A;  1MBE A;  1P7I A;  1MNM C;  5FLV A;  1IRZ A;  2NVY J;  3OSF A;  1VFC A;  4JP0 A;  2DA3 A;  1ENH A;  1GVD A;  1JUM A;  3QPL A;  3SDG A;  1I3Q J;  3BTJ A;  3FK7 A;  2VUM J;  4XK4 A;  5J1R A;  4L5E A;  4FE4 A;  1ETY A;  2O7O A;  3LSG A;  1ITY A;  2HXO A;  2JJ7 A;  4AC0 A;  3Q0W A;  5FKK A;  1IDZ A;  4M3G A;  3S15 J;  4A3K J;  1GT0 C;  5F0C A;  1I50 J;  2R5Z B;  5IYD J;  2E19 A;  2Y9Y A;  4FTH A;  2Y0S N;  5IOY A;  2HI3 A;  2XRL A;  1SAN A;  5JLW A;  5IP7 J;  2QCO A;  3O8G A;  2XGD A;  3JRF A;  4C3I J;  4A3M J;  4QTR A;  5EZH A;  3GTL J;  2H1K A;  2DMP A;  5EG0 B;  1O4X A;  1OJL A;  2DJN A;  3TW7 A;  3K7A J;  1ZKG A;  4M3B A;  3HOW J;  4I6Z A;  2HDD A;  1R9T J;  2DA7 A;  3HB9 A;  1A6I A;  3B6A A;  2ELK A;  4A3D J;  5EDN A;  3WHC A;  1AU7 A;  1ETO A;  1ETX A;  1B72 A;  1QVU A;  4IHV A;  3SFI A;  4RBO A;  5GPC A;  3A03 A;  1BW5 A;  3BG3 A;  3OIO A;  5EGO A;  3LSR A;  2R5Y A;  3LSJ A;  2HOA A;  4V2F A;  4G12 A;  2EQR A;  2JA6 J;  2G0E A;  4A3F J;  4EEF G;  3Q0U A;  1IC8 A;  3HOZ J;  2LLK A;  1JKR C;  3BQY A;  3JRC A;  1MBJ A;  1GUU A;  1HDD C;  1IGN A;  1ETK A;  3BTC A;  3QQA A;  4I76 A;  2WB1 N;  1WH5 A;  1JUS A;  4A3C J;  5EYR A;  2ECB A;  1UMQ A;  3BG5 A;  4BY7 J;  3D1N I;  1AKH B;  1JUP A;  4XRM A;  3E7L A;  2OF7 A;  3IH3 A;  2WAQ N;  5C3E J;  1IUF A;  1S7E A;  1JJ6 C;  4B1R A;  1RKW A;  2XGE A;  1POG A;  3BR2 A;  5F04 A;  2LTP A;  1IJW C;  1U9N A;  1UHS A;  1B8I B;  1JJ8 C;  1HDP A;  1NK3 P;  3GTJ J;  3O8H A;  3SJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...