3R0AA

Possible transcriptional regulator from methanosarcina mazei go1 (gi 21227196)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
120
Chain Sequence
SNAMIDFACKEFKVEDVIKCALNLTKADLNVMKSFLNEPDRWIDTDALSKSLKLDVSTVQRSVKKLHEKEILQRSQQNLDGGGYVYIYKIYSKNQIRNIIQKIVQSWADRLGQELKEWEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Possible transcriptional regulator from Methanosarcina mazei Go1 (gi 21227196)
rcsb
source organism Methanosarcina mazei
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator
total genus 33
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3r0aA00
1HW2A 2J5OA 4YIFA 3N97A 5BS6A 1S3JA 3SZTA 2ZJ2A 3V8LA 2DI3A 3QPHA 1BN5A 1FBSA 2VBXA 1U5TA 4GYIA 5D8KB 3WTWC 2X4HA 2DT5A 4L9TA 3HOTA 3KP3A 1BIAA 4R79A 1HKTA 3F8BA 3L9FA 2QZ8A 4BNCA 2HDCA 2GWRA 4MEXF 4LJZF 4UHTA 5EEGA 4EJOA 3LA2A 2CG4A 5K5QA 3ERED 1UCRA 3RI4A 3MZHA 4R8HA 4AD9A 4WXHA 3JW4A 2EWNA 2Y48A 3KP6A 2KIUA 2VC1A 3CUQC 1EV7A 1FX7A 3IWZA 3WODF 5L3BA 3OOPA 3K69A 3MEXA 2COMA 2M5WA 4MQVA 2DO7A 3NRVA 2FXAA 2FNPA 3DP7A 3VFZA 4CZZA 3FMRA 1Y0UA 1V3FA 2HEOA 1U8RA 1O3RA 1KYWA 1ZHFA 1P92A 1R00A 5D4RA 2R3SA 1BI0A 2XHKA 1DP7P 4EVIA 3IKVA 2QBYA 2G7HA 4KMUX 1LDKB 4HYEA 1LB2A 3CO7C 4N9IA 3ABTA 5LGUA 1TNSA 5DCMB 3GFIA 1MZBA 3J81Z 1KQ8A 5E1WA 3LA3A 1F4KA 1D3YA 1L0OC 3DXJF 4CDGA 3L7WA 4OMYA 2LNBA 4KICA 1UFMA 2NRAC 5DUIA 2WC2A 3WG9A 1TW3A 3G3ZA 4Q5SF 3F23A 3CO6C 1R5GA 2IA0A 5H6QA 3T5XA 3WU0A 4ZYHA 3M9AA 3M8EA 1ZG1A 4XRFA 2Z99A 4Y13A 1S8NA 3K1NA 2XAGA 2DPUA 4PDKA 1F5TA 4BAYA 3ROUA 3HUGA 1R1VA 3BOQA 4MGRA 2V1UA 4EMSA 4ENMA 3HRUA 3WTZA 2H27A 4OIRF 2NAZA 4LLNA 3V7SA 1U78A 2PG4A 5LEJA 2P5KA 3KCCA 2Z3YA 1P4WA 4D0PA 1ZYRF 1WWXA 2OA4A 1D5VA 2HTJA 2FNAA 4U0VA 4KA4A 1U3EM 5HDKA 1JHFA 2VT2A 4UV8A 5HDNA 3DV8A 2CYYA 3O6BB 4KN4X 2RQPA 4IJAA 3RDIA 3SQNA 2VBWA 2F2EA 1FT9A 3HIFA 3QOPA 4EM2A 1SD6A 4EJVA 1CGPA 3GFMA 4ON0A 1S29A 1ZARA 4I09A 2RDPA 2DQRA 1O3SA 2OZ6A 3FMSA 1SFXA 5LGNA 3WU1B 1Q1HA 4I0BA 2F5DA 3HRMA 5DDGA 2LF8A 3GLXA 2H94A 1IRGA 4EV0A 5LHHA 3V7RA 1HXDA 2WV0A 2KIMA 2XAHA 3P9KA 5L3GA 1FLIA 2FE3A 4RGUA 3WE2A 1UHMA 3D0SA 1FWZA 3ZMSA 4L5JA 1OYWA 3M8FA 4PCQA 5FLXK 1IN7A 1Z6TA 2EFNA 1MDMA 4LMYA 2HQRA 3J81K 1NHAA 2ZXJA 3O2PE 4WXCA 1T39A 3TOBA 1MDMB 2K4BA 4EGZA 2RVCA 1FZPB 3C7JA 1JXSA 1S6LA 1K7AA 1WSUA 3P7NA 1QNTA 3F6VA 3W6JB 1FP2A 1SFEA 2IJLA 2YX7A 5E1XA 1TLHB 5HLHA 2BEOA 3V8JA 4UVCA 1KGSA 4LG0B 1T0FA 3I0TA 1Z6RA 4LLLA 3ZQ7A 5D5WB 4G7OF 4EM0B 1XSXA 3R61A 3G73A 2D2WA 3Q5FA 3VOEA 2P5LC 4AIJA 2MLKA 2IRFG 1J9IA 2M30A 2PBIA 4IRHA 4L18B 1ONVA 2FU4A 5K1YA 3EDPA 5ICFA 4Z2YA 5CVUA 2DLLA 2RV8A 2QM3A 2EFWA 3DF8A 5LHIA 3D5LA 5KK1A 1FBUA 1HKSA 1XMKA 2V79A 2FQ3A 2EV5A 2XVCA 3JTHA 4HX4A 2GA2A 4ENJA 3F22A 2V9VA 1YW7A 1J75A 1S7AA 3HTSB 2K86A 5HS8A 4BQAA 1FY7A 3IKTA 1R58A 2VOOA 1SAXA 3R0AA 1ON2A 4HW0A 4L5IA 3HOSA 4M71A 3JAMK 2DU9A 1CF7B 2YX4A 5J8CA 2Z33A 5FFXA 4YIIA 3VODA 1FPQA 2JPBA 4AWXB 1ZLKA 1XDSA 3ZMTA 2CO5A 1R1UA 5AONA 2KJBA 2WWYA 2LF7A 4LFUA 1KU7A 2GQQA 3B02A 4KNYA 1IXSB 3BWGA 2A07F 3QP5A 4M6YA 1Z1DA 1RIOH 1T98A 3MZYA 4GYGA 2EV0A 1D8JA 4XSZF 5H6RA 1I1GA 2FMLA 5FGMA 4QLCU 2CGPA 2CWEA 5CJ9A 4WX9A 3KFWX 2VE9A 1MGTA 2EJRA 4I2OA 3REOA 2R7FA 5BQTA 3M7GA 2VXZA 4DQ2A 4HLYA 5L3EA 4HA8A 3ZN0A 2PI0A 1IN4A 4MNUA 1DPRA 4E70A 5E1ZB 2E7XA 3KP5A 3T8TA 2XAFA 4UUVA 2W85A 2IP2A 3WTTC 2L4AA 2Z9OA 4ZYGA 1KQ9A 3TKYA 5DCFA 4CYDA 2FOKA 2P7VB 3S2WA 2BYVE 5HLGA 3J80K 3E3VA 4A0YA 2XUBA 2HR3A 2OZUA 2M87A 5L3DA 2YU3A 4MHGA 1IZ1A 3WTYC 1SD5A 5ICCA 3FM5A 4S05A 4Y15A 4HDUA 1R7JA 4UXNA 1QO0D 4HQEA 3ZMUA 2ESNA 2QLZA 3BPXA 3TO9A 3P9IA 3E5XA 1K6OA 4M9SA 1XGOA 3M1EA 1BI3A 1FSEA 2W25A 2P8TA 3EYIA 3HSRA 4MQ9F 1LQ1A 2D45A 2P7CB 1G3YA 3FHZA 2JTVA 4LLGF 4A2UA 3GYHX 4RGXA 2QENA 4UVAA 2OBPA 4XSXF 3W6KB 4EJWA 1O7LA 1HW1A 4A12A 2OAZA 3JAMZ 5JFRA 1XGMA 1RNLA 1O7FA 4ENNA 4KIFA 4PGGA 2HKOA 2L54A 1QZYA 4IXAA 2FSWA 5HOOA 2ESHA 5FB2A 1OYIA 2FBKA 3MQ0A 4NQWA 3F21A 4I01A 4DNCA 4LK1F 2PQ8A 3U2RA 2JT1A 2D1VA 1I1SA 3TDZC 3LQQA 2GIVA 4L0ZB 2A6EF 5A2QK 3ELKA 3KZZA 2NNNA 2ETHA 4ASNA 3I59A 3K2ZA 3K0LA 1YS6A 3P9CA 4KMFA 4OINF 5JVTA 5KVRA 2A69F 2RNJA 2KKOA 4HZFA 2VN2A 2XAJA 1STZA 2JRTA 1LEAA 1BM9A 1G6NA 4BYYA 1Z91A 3KE2A 2K27A 1U5TB 4KYWA 1QGPA 4Q47A 3R6SA 4M6XA 2FBIA 3FMQA 4LG0A 4YFNF 4EJUA 1O3TA 4B8XA 1KU9A 3WGGA 2A6HF 2P6TA 2A68F 2YR2A 3MCZA 1H9GA 2E1CA 3GEZA 1JHHA 2ZMEA 3BPVA 4G7HF 1ZAOA 3BP8A 3FF5A 3TOAA 3OV8A 1J5YA 1U5TC 4IHSA 2QUFA 1J2XA 3C18A 5ICEA 3DFGA 1T38A 4A0ZA 4L9JA 5EEHA 3WGHA 2PN6A 1MD0A 5LRSA 1IN5A 2HYGD 4ZZDA 2ISYA 1GVJA 3R4KA 3I53A 2STTA 2IW5A 4FT8A 1W7PD 3FXUA 3F8CA 4HV5A 1Z9CA 1HQCA 4BHPA 5FD5A 5BMZA 1KQ0A 1IXRC 2Y75A 1FYLA 1X3UA 1WKMA 4CGZA 1TQPA 5DV5A 1B1BA 2F5EA 4B09A 2ZBKA 2C6YA 1A04A 2KJCA 1YYVA 1SMYF 5DYMA 5FLXZ 5LBQA 2OQGA 2OQRA 4RB3C 3F72A 3QRFF 5K5OA 2ZMEB 5HLIA 3FWEA 5LHGA 4ETSA 3R60A 3N4MA 1XDUA 2A5YB 3GFLA 1FYKA 2UXNA 1TBXA 1USTA 3CJNA 2MD5A 1J0RA 4OIQF 5DCMA 2ACJA 2HKXA 2QQBA 3I64A 5E8GA 3F3XA 4FX0A 4U7DA 3B73A 4ESFA 4NHJA 5LEKA 3KP7A 4A6DA 1IN6A 2V6CA 3LAJA 3R0JA 4GCVA 1S7OA 5ICGA 1ZG5A 3QPTA 4P9FA 3BDDA 3CUQA 3GFJA 2QBYB 2VC0A 4CXFA 2IA2A 4YG2F 4KDPA 1ZRCA 2RN7A 1FNNA 2L4MA 3F6OA 4NB5A 5J6XA 5ERIA 4G6QA 4EGYA 5CVJA 4ZZLA 5FFZA 1ZRFA 5CVRA 4RS8A 3PFIA 2XV4S 3I58A 3BJ6A 4N0BA 4RGRA 1BJAA 3EYYA 2XIGA 5D4SA 4KIBA 4EQQA 3NQOA 5LGTA 3V4GA 2EFOA 3IRQA 4OOIA 1JE8A 3HRSA 3ULQB 2PMHA 2XROA 3T1BA 1ZRDA 4XLNF 1AWCA 4XBFA 3COAC 3K1MA 1E17A 2JZYA 1HW5A 3FX3A 2L3DA 1OMIA 1W7PA 3CUOA 2FA5A 5ILUA 1LJ9A 3GXOA 3QU3A 3QU6A 2H6CA 3CLOA 2MC3A 1UHWA 5TRDA 1BIBA 2PEXA 2VT3A 1TQIA 1B4AA 1LEBA 1FP1D 4U0WA 4LB5A 2XAQA 1XD7A 2O03A 2AXLA 4KIGA 5AIPA 4EJTA 4IVNA 2EA4A 4BXUA 4RB2C 3FXRA 3GZ6A 3SFZA 3JSOA 2O61A 3SXYA 1W7PB 5BOXA 1BC8C 4FHTA 2ZKZA 2HTSA 2QWWA 5D6EA 1P4AA 4JBAA 2K7LA 4AIHA 3I71A 2VOPA 3O3KA 3E5QA 5LRRA 1LVAA 4BHCA 1RI7A 2LSOA 3KEQA 2IPQX 3WTUC 3E6DA 3WGIA 1USSA 2DW4A 2EA2A 1SD4A 3MFKA 3QP6A 4FX4A 2DQLA 4A0XA 2O8XA 4ESBA 3TO6A 1HSTA 1OPCA 4U0YA 1XSVA 5J8FA 4OU0A 1PUEE 2RKHA 4P55A 3DPLC 1PP8F 4P5OA 2RGVA 2RC4A 2M45A 3V8KA 1DDNA 2A3SA 3IC7A 3ZMVA 1YLFA 1RUOA 5D6FA 1KYZA 1WQ2A 3RKXA 5D5XB 4WXDA 4UVBA 2F5CA 2Q2EA 4HF2A 2M8EA 4A5NA 4ZYEA 3TO7A 2KIFA 1MJBA 5LLQA 3RIRA 3ZMZA 5CLSA 5F64A 2H09A 3LWFA 3I4PA 1W4MA 4OIPF 4WF2A 2AS5F 4HBLA 1FOKA 2HGCA 4P96A 4U7BA 1OYYA 1EH7A 3ML6A 1KU2A 5H20A 3L09A 1RZ4A 1XCVA 4GO1A 3RTRA 1QQIA 2L02A 5DEQA 1OR7A 3GUDA 1B9NA 3U1DA 3GO5A 4GGGA 1TW2A 1XGNA 5HS7A 3RYPA 1XGSA 1K79A 3EUHA 2CFXA 4JQFA 1I5ZA 2EFQA 1ZG3A 3EQLF 3HSEA 1IUYA 4RAYA 3VB2A 1OKRA 1R22A 3TDUC 1FSHA 1ZLJA 5IT3A 2KRFA 4ZH4F 5D5UB 2CSOA 4H0EA 3ZP5A 4HX8A 5BPDA 1J7KA 1T6SA 3ZPLA 4KFCA 2FMYA 2STWA 1QPMA 5JI6A 1R1TA 3J7AO 2ZNYA 2V1DA 2A61A 3RJPA 4YFXF 3ABUA 2VBYA 1YQAA 3JSPA 2K02A 1ZN2A 3IL2A 3KETA 3GF2A 1W5TA 2FBHA 4P9UA 2VONA 2Q0OA 3I5UA 3J80Z 1BI2A 2EV6A 2HOEA 1FC3A 1IXCA 5DUKA 3WTXC 3K1PA 5FD6A 3C3WA 2HFHA 4A5MA 1EH8A 2P4WA 2W84A 4HX7A 1O57A 3BROA 2X0LA 2QVOA 2DK5A 3H3ZA 5HDGA 3Q9SA 1QZZA 4HQMA 2WTEA 2PLYA 4WWCA 3MWMA 3RPQA 2QYOA 1ON1A 1C0WA 1B6AA 4MTEA 2EK5A 4R1HA 2JSCA 3CTAA 2VBZA 1AOYA 3TGNA 4KUMA 2E1NA 3LAPA 3H92A 4KT5C 2Y0MA 3GX4X 4MEYF 1GHCA 4PGHA 1BOAA 2DK8A 2EFPA 3ECHA 1WI9A 3KZYA 2MBFA 1G3SA 3LQRA 1XMAA 3L00A 4OMZA 3GW2A 1B9MA 2MH2A 2E7WA 2YPRA 5AIQA 2MLGA 5BPIA 3F8MA 1IAWA 1SMTA 3KLNA 4A6EA 1YFHA 1GXQA 5E17F 4I02A 2ZCWA 4CHUA 1L3LA 3KP2A 1G3WA 1XCBA 2UZKA 5FO5A 1JGSA 3F8FA 5CYVA 4ESJA 1B59A 4LB6B 3E6MA 1W5SA 5TJJA 4I98B 4YFKF 1BBYA 4IF4A 3SHFA 1KU3A 1HKQA 4HF1A 4WCGA 3JTGA 4F7ZA 3HSFA 1YS7A 2O6GE 1XB4A 2QQ9A 4HLXA 1P4XA 1TTYA 1EH6A 4JK1X 1BC7C 1UB9A 1P6RA 2L01A 1F9NA 2R7DA 1MKMA 4HAMA 5L3FA 3ISPA 3PQJA 3IHUA 1YG2A 2XRNA 1ZREA 5DD4A 5E8IA 3FZVA 5L3CA 4AIKA 1YW8A 3U9GA 3AAFA 2GXBA 1FYMA 1KA8A 3I59B 4UV9A 1SD7A 1IRFA 1MJ9A 3HHHA 1ODDA 1GXPA 1XN7A 4G8XA 1ZGJA 1ZGAA 1F1ZA 2O0YA 2G9WA 2Q8KA 2FEZA 2PJPA 5A2QZ 4K2EA 2V1XA 2VE8A 2DPDA 3GWZA 2HS5A 3KEOA 2BBYA 4IRGA 3GVAA 4M9XA 3HYIA 2XKOA 4O3MA 4RGSA 3KP4A 3V7CA 2UWMA 3CDHA 1G3TA 2GAUA 4M73A 3MAJA 4CO8A 5D8LB 1H0MA 4G9YA 5F1RA 1WRJA 2MH9A 5D5VB 2PMUA 5CVVA 2NNYA 1V4RA 2QQAA 1I27A 1SFUA 1R5HA 3ZN1A 1ULYA 1DPUA 2ZO4A 3L2CA 4CICA 3VEPA 3H3UA 3QAHA 1XSDA 2ADUA 3C1DA 3ZMDA 4Y17A 1HBXG 1CF7A 2HZTA 5DD8A 3KLOA 1IN8A 1U6GA 1R23A 1LNWA 2DBBA 5CVIA 5ILSA 4RB1A 4RB0A 5HVQC 3LSTA 4OIOF 1TNTA 1DUXC 3CUQB 3T8RA 1G4DA 2DAOA 2D1HA 1YTYA 4U88A 3E6CC 2NYXA 2HYFA 2F5FA 2VODA 3RPUA 4O6JA 2ISZA 1MJAA 2GXGA 3WE3A 4EM1A 2TDXA 4L0YB 5E18F 1E2XA 3DKWA 2O3FA 2LDUA 1K78B 5K5RA 3WTSC 3E5UA 4S04A 5HS9A 3T0YA 3LFKA 2CQKA 4GXOA 4Q48A 1Z7UA 1H9TA 3DQVC 1ZH5A 2GA1A 1YIOA 3HHGA 4HF0A 1T2KA 3EETA 1D8KA 2DFIA 4MTDA 4M72A 4ENKA 4XLPF 4UNOA 1R36A 1O3QA 4G94A 2YSRA 3ECOA 2H6BA 1IF1A 2P6SA 4LK0F 3SZPA 5F6FA 4IHTA 5ED4A 2ZFWA 1BI1A 3BJOA 5IT9K 4HOBA 1VTNC 2EB7A 4ZYDA 5JHUA 3WTVC 2J5PA 1PDNC 4TV7A 4PZJA 2IA1A 4QWQA 4O5VA 1PP7U 1K78A 2NS0A 1P2FA 2P5VA 2PFBA 3HRTA 3BZ6A 2OD5A 5E20A 2IVMA 3E6BA 4G6DA 3HTUA 4AVPA 4WK8F 4M9ZA 4LGWA 2LKPA 2ZNZA 4RAZA 2XGXA 2Z5UA 3DPTA 2W57A 1J59A 6PAXA 1Z05A 4IPAA 4I7HA 1HSJA 2BGCA 2HWVA 2JPCA 1I6XA 3IWFA 3DEUA 2G7UA 3F8NA 1LDJA 4LD5A 2CW0F 2M1BA 3BJAA 3IRRA 2IT0A 3FXQA 5ILVA 5IT9Z 4IRIA 1IW7F 2DTRA 2FF4A 1REPC 3E97A 4N9HA 1YO5C 1QBJA 2OU2A 3BY6A 1U2WA 2BV6A 2MA3A 2FRHA 4L9NA 1FBQA 4Q4ZF 4M74A 4KN7X 2W24A 3I54A 3PQKA 4BHBA 1YW9A 2HQNA 1TQMA 3NEUA 3TQNA 4BH9A 5JR3A 2K4JA 3K9TA 2GZWA 4HV6A 2B0LA 3RKYA 3LA7A 3GZ5A 4I0AA 3RYRA 3RKWA 3FM3A 1LDDA 4HDVA 3Q9VA 2XKPA 4G7ZF 1RUNA 2ELHA 2BE5F 2XASA 2UXXA 4L9VA
chains in the Genus database with same CATH superfamily
3K6GA 1HW2A 3VYSB 2J5OA 2R5YB 4YIFA 3KYDB 5BS6A 2ZSHB 3N97A 1S3JA 3LSKA 5EJCA 3SZTA 2JA5J 1B72A 2BVLA 3FBNB 2W1OA 2ZJ2A 3V8LA 2DI3A 5J40A 3QPHA 1BN5A 3ABMH 4PSWA 1FBSA 2VBXA 1U5TA 4GYIA 2Y9YA 2XGEA 4CCLA 4W97A 5D8KB 3WTWC 2X4HA 2DT5A 2FX0A 4L9TA 3HOTA 3KP3A 1BIAA 4R79A 1N75A 1Y0NA 1HKTA 3F8BA 3L9FA 2ICWG 1ETOA 2QZ8A 3Q3SA 4BNCA 4FE4A 2HDCA 2R7OA 4XLFA 2GWRA 5DTDA 4MEXF 3D5RC 2O7OA 3LMMA 2YU9J 3I3LA 4LJZF 1JKOC 1ENHA 4UHTA 1ACIA 5EEGA 2NXNB 4EJOA 2TRTA 3LA2A 2CG4A 1R9TJ 2R0QC 2LTPA 5K5QA 3ERED 1DU0A 1UCRA 4S0HB 2WB1N 2JSPA 3RI4A 3MZHA 4R8HA 4AD9A 3IAS2 3ASNH 4WXHA 2M4KA 1HA8A 3JW4A 2EWNA 1FMVA 1P7IA 2CUZA 1MBJA 2E19A 2Y48A 1XS9A 3KP6A 3OIQA 2KIUA 2E60A 2VC1A 2W4SA 3CUQC 1EV7A 1LE8B 4G12A 4C2UA 1FX7A 4G6TB 2XDVA 4IHWA 1Z3XA 3H35A 1TWFJ 3GZNB 3IWZA 1RKWA 4M3GA 5F1JA 2HXOA 3WODF 5L3BA 3OOPA 3K69A 3HPHA 1NG6A 4XKCA 3MEXA 1RC9A 4B3XA 2COMA 2M5WA 2LBFA 2DO7A 4MQVA 1YITI 1SFOJ 2QA4I 1FMWA 1BA5A 3NRVA 2FXAA 2F4MB 4XLCA 2FNPA 3DP7A 3VFZA 5FRMA 2XPUA 1A31A 3HC7A 2BY1A 2LBFB 4CZZA 1EJ9A 1IRXA 3FMRA 1Y0UA 1V3FA 2HEOA 3ZQFA 1R6RA 1U8RA 1O3RA 1KYWA 1WJEA 1ZHFA 4DBQA 4V2GA 1IDYA 5KNLA 1P92A 1R00A 2DYSH 2E1MB 2ZXHA 5D4RA 3OYAA 1DP3A 1D0YA 2IGKA 2R3SA 3G71I 1BI0A 3OR2C 3CCQI 2XHKA 5M5XJ 1WPKA 1DP7P 4EVIA 4C9YA 3IKVA 2QBYA 4AYBN 2VIXA 2BZTA 2G7HA 4KMUX 4A3MJ 1LE8A 3A1YA 3BG9A 4PFPA 2HDDA 3RSNA 1LDKB 4HYEA 1X1PA 1LB2A 3CO7C 4N9IA 3ABTA 5LGUA 1TNSA 5DCMB 4KISA 3GFIA 2L9VA 1MZBA 5F0CA 4B3AA 3CJRB 2KMUA 1IO2A 3J81Z 1KQ8A 5E1WA 2NVTJ 4C3HJ 4M3FA 3LA3A 1F4KA 1D3YA 3OL4A 1L0OC 2L5QA 3DXJF 4CDGA 2EZHA 3L7WA 3E7LA 4OMYA 4BQOA 2NS7A 2LNBA 2K3PA 4KICA 1UFMA 2NRAC 4GFBA 5DUIA 2WC2A 3WG9A 3FXKA 1DQUA 1TW3A 3G3ZA 4Q5SF 2I8DA 3F23A 4X0GA 1ZR2A 3CO6C 1JTYA 2XGDA 1R5GA 2IXSA 2IA0A 4JX4A 1ZELA 3D5SC 5H6QA 2PJRB 1MMAA 2G0EA 3T5XA 1S5LC 3M8JA 3WU0A 4ZYHA 3BG3A 1R49A 1D1BA 1OJLA 1OISA 3A0BC 1LPQA 2LRDA 3M9AA 3M8EA 4PSXA 2YS9A 4XRFA 1ZG1A 2VJJA 2Z99A 5HLTA 3OYLA 4Y13A 1VQ5I 1S8NA 3JCUC 3K1NA 2XAGA 4DIQA 1MMDA 2RNGA 3SJMA 2DPUA 4PDKA 1T56A 3RCOA 1NH3A 1F5TA 1T33A 1TP4A 4BAYA 3ROUA 3IH4A 2KDZA 1NTCA 1OCZH 3HUGA 1R1VA 2WAQA 3BOQA 5IYBJ 2ZFUA 4MGRA 2V1UA 4EMSA 4ENMA 1B8IA 2E1MC 3BR6A 3HRUA 3WTZA 2H27A 4OIRF 2R7RA 3CMAI 2NAZA 4LLNA 3V7SA 1U78A 1I3QJ 4ZYAA 2PG4A 5LEJA 2P5KA 1Q1VA 5GP9A 3OS1A 3KCCA 5FKNA 2Z3YA 1P4WA 4W1UA 4D0PA 1ZYRF 2GOXB 1WWXA 2OA4A 1OR7C 3GTLJ 1D5VA 2HTJA 3FBIB 1Y1VJ 2FNAA 3GTJJ 4U0VA 4DYQA 4KA4A 5IP9J 3KIOA 1U3EM 5HDKA 1JHFA 3G2BA 2VT2A 4F55A 2Q1ZB 3BCAA 2KQRA 3JRHA 4UV8A 5B1BH 3DV8A 5HDNA 2CYYA 3O6BB 5DS9A 4KN4X 4PJLA 2RQPA 4BQQA 4IJAA 4Y33A 3RDIA 1JUPA 2BHZA 3SQNA 4A3IJ 1TWHJ 2VBWA 2F2EA 1FTZA 1FT9A 2V26A 3OIOA 3HIFA 4AC0A 4BJTA 4FISA 2KFDA 3QOPA 2HZDA 3W3CA 4EM2A 4XKWA 3FK6A 1SD6A 2IS2A 4EJVA 2D5VA 1CGPA 2AO9A 3DLLF 3GFMA 3I56I 1S29A 1ZARA 4I09A 4ON0A 2RDPA 1IUFA 2DQRA 2IS1A 4E7LA 5E3NA 5F04A 4RAFA 3AG2H 1O3SA 3HOXJ 2OZ6A 3FMSA 4IZZA 1X58A 1HOMA 4RBOA 1IGNA 1SFXA 2OV7A 4FTHA 5LGNA 2V9PA 3WU1B 1Q1HA 2PMZA 3KEYA 4I0BA 2F5DA 3PUFA 4Y3OA 2X1CA 4BUPA 3O8HA 4QPQA 3HRMA 3CCMI 4NQWB 3FKIJ 4BY1J 1BJZA 5DDGA 3K7AJ 2LF8A 3GLXA 2H94A 3OY9A 1IRGA 4EV0A 1JJ8C 3LOCA 5IP7J 3V7RA 5LHHA 3CC7I 4JP0A 1HXDA 2WV0A 2KIMA 4BBRJ 2XAHA 3LNQA 3P9KA 3BTJA 5L3GA 1FLIA 2FE3A 4RGUA 4MO7A 3WE2A 5FROA 3CJQB 1UHMA 3D0SA 3OWTA 3PO2J 2L9SA 1WJAA 1FWZA 2RQQA 3PM1A 3L2UA 5M3MJ 3ZMSA 4L5JA 2DFEA 4FASD 2H8RA 4DYRA 1OYWA 5EZHA 3HOZJ 2CRGA 2WA0A 3M8FA 1RKTA 4PCQA 5GAGJ 1JT0A 3M07A 5FLXK 1IN7A 2Z2SB 3TP0A 1MH4A 3OOUA 1Z6TA 3DEEA 3VDXA 2QSGX 2EFNA 1MDMA 4LMYA 2HQRA 3J81K 1U9NA 2BW3A 1NHAA 2ZXJA 3O2PE 2L2OA 4WXCA 3OSFA 1T39A 5J1RA 4RAGA 3HL2A 3TOBA 1MDMB 2K4BA 2L7FP 1EF4A 3H0GJ 4EGZA 2E2IJ 4L5EA 4D5CA 2RVCA 2ELKA 3C7JA 1FZPB 4BEHB 1JXSA 1S6LA 1K7AA 4NC7A 3QPLA 1WSUA 2JK3A 2Q2EB 3H3VK 4RA2A 3P7NA 4AIDA 1QNTA 5B3SH 2WB1A 2WAQN 3F6VA 3I4NJ 3W6JB 2DDBA 1FP2A 1SFEA 2IJLA 2YX7A 1MIJA 2LP0A 5E1XA 4ZDLA 2VPLA 1TLHB 2JA8J 4QIWN 2XF5A 2VJ5A 4M6VA 5HLHA 4IL6C 2CQ7A 2BEOA 3V8JA 3DBLB 2NVYJ 2XB0X 4UVCA 1ERDA 1KGSA 2DJNA 4C3JJ 4LG0B 1T0FA 3I0TA 3DEWA 1Z6RA 3PO3J 3H5RA 4LLLA 3CDLA 3ZQ7A 5D5WB 2XGCA 4EM0B 1XSXA 3R61A 3G73A 2D2WA 4G7OF 3Q5FA 3VOEA 2P5LC 4AIJA 2MLKA 2IRFG 1SAUA 2L0KA 2M30A 1J9IA 2PBIA 1SC7A 3F9KA 4KJZA 2V7FA 4IRHA 4L18B 1ONVA 2L7KA 2FU4A 3UNGC 3EDPA 4DW6A 5K1YA 1AU7A 5ICFA 4Z2YA 3OYMA 3AG4H 5CVUA 2DLLA 2RV8A 2QM3A 3CCEI 3PNVA 3LFUA 4IX7A 2EFWA 3KYCB 2X51A 3DF8A 5LHIA 3D5LA 5KK1A 2EIMH 1FBUA 1HKSA 5LD2C 9ANTA 2DA6A 1D1CA 1VQKI 1XMKA 2V79A 1VQLI 2FQ3A 2EV5A 2XVCA 3JTHA 4HX4A 2GA2A 3ZOBA 2KT0A 4ENJA 3F22A 2V9VA 1YW7A 1J75A 3AG1H 1FOWA 1S7AA 2IGNA 4UUTA 3QYFA 1KONA 4HEA2 1IV6A 2OCEA 1JUSA 3HTSB 1FOXA 2K86A 5HS8A 4BQAA 1VQNI 1FY7A 3IKTA 2A6TA 2HI3A 1R58A 2VOOA 1SAXA 3R0AA 2R7WA 1ON2A 1FIPA 4HW0A 2H1LA 3OYHA 1UMQA 3EUHC 3ZQHA 2JN6A 5B66C 4L5IA 3HOSA 4M71A 1ZTRA 2LG4A 3H9QA 3JAMK 1K83J 4XRSA 2DN0A 5F0FA 2DODA 3OYCA 2DU9A 2E1OA 1CF7B 2YX4A 2QSFX 2K40A 5J8CA 1BL0A 1OCTC 2Z33A 5FFXA 4YIIA 3VODA 1FPQA 1Y8QB 1M1EB 2JPBA 3GTQJ 2M9HA 4AWXB 1ZLKA 1XDSA 3ZMTA 2CO5A 1R1UA 5AONA 2KJBA 2WWYA 1RESA 2LF7A 4LFUA 2DFFA 1KU7A 2GQQA 3B02A 2DOEA 1IRZA 4KNYA 3I55I 1IXSB 3BWGA 5FKKA 4J19A 3ZRGA 2NOGA 2QCOA 2A07F 3QP5A 4M6YA 4JOMA 1HLVA 1Z1DA 3J7AY 1H88C 2JUCA 1T98A 1FOYA 3MZYA 4GYGA 2EV0A 1RIOH 2DFHA 1D8JA 2DA5A 4XSZF 3BQYA 1W36C 4D5FA 4N4OB 1K6YA 4XKVA 5H6RA 2W48A 3RKQA 1I1GA 2FMLA 4II3A 5FGMA 4QLCU 2CGPA 2BY0A 2CWEA 2N8GA 5CJ9A 4WX9A 3KFWX 2CFOA 3CF2A 2VE9A 1RR8C 1F43A 2F5VA 3SFIA 3CMMA 1MGTA 1I3AA 2EJRA 2Z1DA 4I2OA 4J00A 5KHDA 5M5WJ 1IC8A 3REOA 3S1QJ 1YX3A 2R7FA 5BQTA 4IQJA 3S14J 3M7GA 2VXZA 4DQ2A 4NNJA 4HLYA 5L3EA 4BXXJ 4HA8A 2R92J 2CMPA 3G1OA 1SVLA 3ZN0A 3ZR8X 2E2JJ 3RPUD 2PI0A 1IN4A 1WFXA 4MNUA 3IH3A 1DPRA 1TT0A 3ZGKA 4E70A 1MNMC 5E1ZB 2E7XA 1RETA 3KP5A 1T0FC 3T8TA 2XAFA 4UUVA 1VQMI 2W85A 2IP2A 3WTTC 2XSJC 3S32A 3EUKL 2L4AA 2Z9OA 2R7QA 3HOUJ 2EINH 1W36D 4ZYGA 1KQ9A 3TKYA 2DMPA 4E7IA 2LC2A 5DCFA 4CYDA 2FOKA 5KCMA 4CH7A 1XC5A 2P7VB 1XG1A 1Z67A 2Y69H 4PJJA 3S2WA 2HQ5A 2BYVE 1SVMA 2I10A 5HLGA 1N25A 3J80K 3E3VA 1D0XA 2X6XA 4A0YA 2XUBA 1X4OA 2HR3A 2OZUA 3RQIA 4A3EJ 2M87A 5L3DA 2YU3A 2LY2A 1QZEA 4MHGA 1IZ1A 2OPTA 4QSHA 1RRJA 3WTYC 1SD5A 1D5YA 2QGUA 5ICCA 3FM5A 3Q0UA 4S05A 3BZCA 3IP4B 4Y15A 4HDUA 3GTKJ 2KL4A 1R7JA 4UXNA 1QO0D 4HG2A 3C2BA 4HQEA 3KZIC 3ZMUA 2ESNA 3CD6I 2QLZA 3BPXA 3LSMA 4PUSA 1BW5A 4LITA 3TO9A 2DT6A 2LKSA 3P9IA 3E5XA 1K6OA 4M9SA 1XGOA 3M1EA 5GTHC 1BI3A 1R5ID 3PSFA 3GTPJ 1FSEA 2W25A 2EZKA 2P8TA 3PFYA 4HPQA 3EYIA 3HSRA 2EH3A 4HSTA 4MQ9F 1LQ1A 2D45A 2P7CB 1G3YA 2WADA 3FHZA 2JTVA 2LK2A 1VF9A 4LLGF 1VQ4I 4A2UA 3GYHX 2CV1A 4RGXA 2QENA 3LSJA 2VXDA 4UVAA 2IEKA 5FRNA 2OBPA 4XSXF 3VWBA 3W6KB 4EJWA 2KHMA 1OCOH 4F52A 1O7LA 4M3EA 4PJ0C 4P1WA 1HW1A 4PK4A 4A12A 3CF5F 2OAZA 3JAMZ 5JFRA 2CH0A 1XGMA 4H4KC 1RNLA 3O8GA 1O7FA 2LY9A 1UJ8A 4KIFA 4PGGA 2DMUA 2HKOA 2L54A 4ENNA 4IOAF 1QZYA 2BOLA 4BY7J 4IXAA 1X1CA 1OCRH 2FSWA 3TW6A 5HOOA 2ESHA 4DOZA 5FB2A 5HNHA 2ID3A 1MMNA 1OYIA 1PUFA 2FBKA 3MQ0A 4NQWA 3F21A 2KZVA 4I01A 3HGGA 4DNCA 4LK1F 4E7HA 2LLKA 3OYJA 2ZJRF 2PQ8A 3S93A 1K4TA 3U2RA 2JT1A 2D1VA 2F6CA 1I1SA 2BVMA 3TDZC 1BR1A 3LQQA 3PNTA 1UELB 2GIVA 3QWLA 2GXAA 4L0ZB 1E3OC 2A6EF 5A2QK 3ELKA 3KZZA 2ZSIB 5E3OA 2NNNA 3CCLI 2NVQJ 4A3JJ 3CDIA 2ETHA 2GM4A 2K9MA 4ASNA 3A01A 3I59A 4FETA 3K10A 3WHBA 1A6QA 3QYBA 2LH9A 4BGDA 2VUMJ 4BBSJ 1JKPC 3K2ZA 4XICA 3CCUI 3K0LA 1YS6A 4OWRB 3GBGA 3P9CA 1LVKA 2LR8A 2XAUA 1JTXA 3E1SA 1QPIA 2JQ7A 2L9RA 4KMFA 4OINF 1X4PA 1AKHA 5JVTA 5KVRA 1UG0A 2A69F 2RNJA 2KKOA 4HZFA 2VN2A 2A05A 2XAJA 3K4NA 1STZA 3M1CA 3OR1C 2L7ZA 3H5AA 2JRTA 3CQZJ 1LEAA 2AQEA 1BM9A 3H0DA 3AL0C 2JVGA 1N78A 1MBKA 1G6NA 3BR1A 1Z91A 4BYYA 4XORA 2KZGA 1G8XA 3KE2A 2K27A 1U5TB 4KYWA 1QGPA 4Q47A 3JRBA 3BT9A 3R6SA 4RMNA 4M6XA 3DPUA 2QQ8A 1ETQA 3IUOA 3W2WA 2FBIA 4IHYA 1PUFB 4U87A 3S2DJ 3FMQA 4LG0A 2MABA 4YFNF 4C30A 4Y7NJ 4EJUA 1O3TA 2CV0A 2M7AA 4B8XA 1KU9A 3FDYA 3WGGA 3M3YJ 1JKRC 2A6HF 2P6TA 2A68F 3PNYA 2DTZA 2YR2A 3MCZA 1H9GA 3CLQA 5M3FJ 5FJ8J 2E1CA 3DTEA 3GEZA 1JHHA 2V9KA 3LSPA 2ZMEA 3BPVA 4G7HF 4A3BJ 1ZAOA 3BP8A 1IDZA 2M4GA 3FF5A 4YELA 1EKEA 3TOAA 3OV8A 4YRVA 1VQ8I 1BR2A 2COBA 2ELJA 1J5YA 4A3DJ 2FD5A 1U5TC 4IHSA 3ZXSA 2QUFA 2VJIA 1J2XA 5EGOA 4QPOA 3C18A 2R93J 5ICEA 3DFGA 1T38A 4A0ZA 4L9JA 5EEHA 2IS6A 3WGHA 3KPHA 2PN6A 1VI0A 3JREA 5LFAA 1TC3C 1MD0A 5LRSA 1IN5A 5J1YA 2HYGD 4ZZDA 2ISYA 1GVJA 2CU7A 3R4KA 1HDPA 3I53A 2STTA 1MBEA 2IW5A 4FT8A 1W7PD 3FXUA 2X1DA 5E79C 3IAM2 4LG3A 1OLTA 1ZQ3P 1MSFC 3F8CA 4HV5A 1Z9CA 1WZ2A 1HQCA 3ONQA 4BHPA 3ERMA 5C4XJ 5FD5A 2RREA 3OYFA 1VQ9I 5BMZA 4ZTJA 2LFBA 2JRMA 1DGRM 1KQ0A 4PJMA 1IXRC 2Y75A 4F92B 1FYLA 1X3UA 1WKMA 4CGZA 1TQPA 4PFOA 1B1BA 3FIWA 5DV5A 2F5EA 4B09A 2ZBKA 2C6YA 3S17J 1A04A 2KJCA 3DBRB 1YYVA 1SMYF 1R4MB 2KLOA 2M0MA 5DYMA 5FLXZ 3H1CA 5LBQA 2OQGA 5TGTA 2OQRA 5K7ZA 4MIMA 4RB3C 2YUSA 1VQOI 4FE7A 2VL8A 3F72A 3QRFF 2PX9A 5K5OA 1T08B 2ZMEB 2GIZA 3ZQGA 4BJ6C 3I9V2 2O5RA 5HLIA 3FWEA 5LHGA 5BNGA 3RZOJ 4ETSA 3R60A 3N4MA 1B8IB 3K4CA 1W5CC 2CW8A 1WJDA 3C2HA 4J01A 1XDUA 2A5YB 2VJ4A 5IPAA 3GFLA 4ZC3A 1FYKA 2UXNA 1TBXA 1USTA 2UUZA 3CJNA 3PL8A 3JRIA 3K4JA 3VPRA 1I6HJ 2MD5A 4PJNA 1J0RA 2FOWA 3H5NA 3LSRA 4OIQF 5DCMA 3FXJA 3HXLA 3V42A 2ACJA 2HKXA 2QQBA 3I64A 3OS2A 3QYEA 1WVRA 3F3XA 5E8GA 4FX0A 4U7DA 3B73A 4ESFA 4NHJA 1HF0A 5GADJ 5LEKA 3ZQLA 3KP7A 4A6DA 1IN6A 2CW7A 5JHFA 2V6CA 5CPRB 3LAJA 3R0JA 1VQ7I 3S1NJ 4A3LJ 4GCVA 1S7OA 5ICGA 2DA1A 1ZG5A 1PYVA 3QPTA 4P9FA 3BDDA 3CUQA 1ETKA 2HPIA 2XPVA 5J4VA 3GFJA 2E5ZA 2QBYB 2VC0A 1TWCJ 2AQFA 5IP6A 4CXFA 4EEFG 4C2TA 1VQ6I 3W2AA 2IA2A 4YG2F 2PMZN 4HNUA 4KDPA 3MN2A 1ZRCA 2CUEA 1YRNA 1SANA 4XMYA 2RN7A 1FNNA 4CCOA 2L4MA 3F6OA 4ABZA 4NB5A 3A03A 5J6XA 5ERIA 4XLHA 4G6QA 3HOWJ 1MBGA 1YE9A 2AHQA 4EGYA 1UG2A 4IKFA 3DLAA 2X6YA 3MVPA 5CVJA 3SDBA 4XN0A 5F08A 3OS0A 4A3FJ 4ZZLA 4XOTA 1PJRA 1TZLA 5FFZA 1FEXA 3AKZA 2HPMA 1ZRFA 1OFCX 4CA0A 3HEFA 2BXZA 5CVRA 4RS8A 1QA6A 3G4SI 4F91B 5JVGF 3PFIA 3K2AA 2IBDA 4CYCB 2XV4S 4XLEA 3CCVI 3I58A 3BJ6A 4N0BA 4RGRA 1WJFA 2JUGA 1BJAA 3EYYA 1DU6A 2XIGA 5D4SA 2CQXA 3B6CA 3JRGA 4KIBA 4F93B 4EQQA 4D7MA 5IOZA 1DGWY 3NQOA 3V4GA 5LGTA 3W2VA 4E7ZA 5K7FA 2EFOA 3FK7A 3IRQA 4OOIA 1JE8A 2CS3A 3HRSA 1ETVA 4B48A 3ULQB 1J09A 1CQTA 2PMHA 2XROA 3T1BA 1Y56A 2M3AA 1ZRDA 2DMQA 5JLWA 2E2HJ 4XLNF 2JA6J 1H8AC 1ETWA 1AWCA 2ZJPF 2BY3A 1WJ5A 5IOYA 4XBFA 1XTAA 1EA3A 1ITYA 3COAC 3K1MA 1IG7A 3MZ8A 4BL0B 2JZYA 1E17A 4E6KG 2F4OB 3DU5A 5F0HA 1HW5A 3FX3A 2L3DA 3VYUB 1OMIA 4GDFA 3BTIA 2Z16A 1W7PA 3CUOA 2P0WA 3L2VA 2FA5A 2CUJA 3OYBA 3VSKA 5ILUA 1LJ9A 3GXOA 2DYRH 3QU3A 3QU6A 3MKWB 2H6CA 2JVHA 1NK2P 3CLOA 2X48A 2MC3A 2XPWA 1UHWA 5M5YJ 2VPRA 5TRDA 1BIBA 2PEXA 2VT3A 3VSLA 1TQIA 2R4GA 1WJBA 1B4AA 1LEBA 1FP1D 4U0WA 5EG0A 2LD5A 1X1BA 4MFDA 4LB5A 1WGXA 2XAQA 4XQFA 3IV5A 1XD7A 2R5ZB 4AVZA 5EG0B 2O03A 2K9SA 2AXLA 2KP6A 2VKVA 4KIGA 5AIPA 4EJTA 4BJ5C 3BR0A 4IVNA 5EDNA 3DTKA 3FXLA 2EA4A 4BXUA 4XRMA 2FUG2 4RB2C 3FXRA 3GZ6A 1YX5A 4HRIA 3SFZA 3JSOA 2O61A 3NWSA 3SXYA 1W7PB 5H2FC 5BOXA 1BC8C 3MKZA 4FHTA 5GPAA 2XRLA 2X85A 3FKJA 4X6AJ 2ZKZA 2HTSA 1GV5A 2QWWA 5D6EA 1P4AA 4XR6A 1JT6A 4JBAA 2K7LA 1T95A 4AIHA 1UAAA 3I71A 2VOPA 3O3KA 4C2MJ 3E5QA 4CCMA 5LRRA 1LVAA 4BHCA 1RI7A 2LSOA 2X9DA 3EPZA 2OC6A 3KEQA 2IPQX 3WTUC 3E6DA 3BCBA 3TW7A 3HKZN 3WGIA 2HOAA 3FHNA 5J4YA 4HNVA 4HNTA 2MGQA 2XF7A 1USSA 2DW4A 2EA2A 1Y1WJ 1SD4A 3MFKA 3BZKA 3QP6A 3BR3A 4FX4A 2DQLA 4A0XA 2DA2A 2O8XA 2VQCA 4ESBA 1SEUA 3U21A 1WJCA 1E3HA 2CV2A 3TO6A 1HSTA 1OPCA 4U0YA 1MMGA 1XSVA 2V4JC 5J8FA 1AA7A 4OU0A 5K7HA 3HDDA 4XL9A 1PUEE 2RKHA 4P55A 3DPLC 1PP8F 4P5OA 3S16J 2M8GX 3CP8A 1G59A 2RGVA 1BR4A 4DJAA 4BE0A 2RC4A 2I5UA 2M7BA 3CP2A 3DKXA 2M45A 3V8KA 1DDNA 2W00A 2A3SA 2K5CA 3AFHA 4NC6A 3IC7A 5EGOB 3ZMVA 3K70C 1YLFA 1RUOA 5D6FA 1KYZA 3HKZA 1WQ2A 1BW6A 2E36A 3RKXA 5D5XB 4WXDA 4OAYA 4BE2A 4DGWB 4Z6YA 4UVBA 2F5CA 1U9OA 3MD2A 2Q2EA 2R5YA 2DA7A 3FXMA 4HF2A 2ZB9A 4RLFA 2M8EA 3S15J 4A5NA 4ZYEA 4B43A 3TO7A 5EZGA 2KIFA 1MJBA 2OJED 3JRDA 5LLQA 2VQGA 2XF6A 3RIRA 3ZMZA 2GBYA 5CLSA 2Y0SN 4CCNA 5F64A 4I6ZA 2H09A 5CQGA 2DJIA 3OYIA 1JI8A 3LWFA 3I4PA 1W4MA 4WF2A 2CQNA 2AS5F 4OIPF 4HBLA 2Y31A 1FOKA 1W1WE 1QVUA 5B5EC 2HGCA 4P96A 3OYGA 1I39A 4U7BA 1OYYA 1EH7A 4BS9A 3GTGJ 3ML6A 1KU2A 3LL7A 5H20A 3BTLA 3L09A 1RZ4A 4UB8C 1XCVA 4GO1A 3DWLE 3RTRA 3OIPA 1QQIA 3SZGA 2L02A 5DEQA 1OR7A 3GUDA 1B9NA 2JWTA 3GO5A 3U1DA 3BQZA 4F3QA 1JJ6C 4GGGA 1TW2A 1XGNA 5HS7A 1WCMJ 4V2FA 1XGSA 3RYPA 4XNFA 3W6VA 3H9GA 1HDDC 1K79A 3EUHA 4ZDOA 3A4CA 2CFXA 2H8WA 2MSYA 3CCJI 3CCSI 4JQFA 1ZGWA 2GLOA 2OF7A 3RZDJ 1OQYA 2M2EA 3CZ6A 1I5ZA 1S7EA 2Y0SA 2EFQA 3S1RJ 1SVOA 1ETXA 1ZG3A 3EQLF 3HSEA 3K4LA 4RAYA 4XLAA 4A3KJ 2NVXJ 3VB2A 1IUYA 1OKRA 1R22A 5CKTA 3TDUC 1FSHA 3CCYA 1ZLJA 2KRFA 4ZH4F 5IT3A 5D5UB 2CSOA 1YOVB 4JYKA 4H0EA 2E35A 3ZP5A 4HX8A 4EATA 5BPDA 1J7KA 1T6SA 3ZPLA 4KFCA 3GTOJ 1LFUP 2FMYA 1K4SA 1U8BA 2IGOA 2STWA 1QPMA 5JI6A 1R1TA 3J7AO 2ZNYA 2V1DA 2KISA 3AL0B 2A61A 2VQLA 3RJPA 4YFXF 2LKXA 2MD0A 1W0UA 3ABUA 2VBYA 1YQAA 5J3LA 2CQQA 2P81A 3JSPA 2B7EA 2K02A 1TWGJ 1GT0C 3B6AA 1ZN2A 3IL2A 5EYRA 1X19A 2QKMB 3KETA 3GF2A 3HUGB 1TWAJ 2XC7A 1W5TA 2FBHA 4P9UA 3NWTA 2DA3A 3ABKH 2VONA 2ZC2A 2Q0OA 3I5UA 3J80Z 3IH2A 3L2QA 3CC2I 4MLOA 1BI2A 2EV6A 2WV1A 2HOEA 2VKHA 3H9JA 1FC3A 3DU6A 4D1QA 1IXCA 2R7XA 3FISA 3F0CA 3RQ4A 5DUKA 3WTXC 1I50J 1ETYA 3K1PA 5FD6A 3C3WA 3QODA 4IEJA 5JLXA 2HFHA 4A5MA 1WH7A 2FQ4A 1EH8A 3Q0VA 4E4HA 3PUBA 1Z21A 2P4WA 1F36A 2JMWA 2BY2A 2VI6A 1X2MA 2KIQA 2W84A 4HX7A 3CMYA 1O57A 1FJLA 3BROA 1P9QC 3PSIA 2X0LA 2QVOA 2LREA 2JA7J 1MMSA 2DK5A 3H3ZA 3UKGA 2KDOA 1HCRA 5HDGA 2VB6A 4GRIA 1MBHA 3DTIA 3Q9SA 1QZZA 3HBLA 4HQMA 2F4IA 2WTEA 4D9JA 3S3OA 3K4MA 2PLYA 2PJRA 3KX2A 4WWCA 2V6EA 4NDLA 3MWMA 4QTRA 4XONA 3RPQA 4BDYA 2QYOA 1H89C 1ON1A 1C0WA 2HYJA 1B6AA 4MTEA 2EK5A 3U1KA 3ABLH 3L2WA 4R1HA 2JSCA 2MFZA 3OYDA 3K70D 3CTAA 2VLAA 4XM3A 1VNDA 3QOEA 2KPMA 5HNFA 2VBZA 3BG7A 1AOYA 1X1AA 3HJEA 3SDGA 3TGNA 2HQAA 4B47A 3A0HC 2R7SA 2E5NA 4KUMA 3CMEI 2E1NA 3LAPA 3H92A 3C2GA 4KT5C 4A3CJ 2K9QA 1LFPA 2HXIA 2W82A 2Y0MA 3SEZA 3GX4X 4MEYF 1GHCA 4PGHA 4B1RA 4JX5A 1Z7LA 1BOAA 2DK8A 2EFPA 3NARA 3ECHA 2X6OA 1WI9A 3KZYA 2MBFA 1G3SA 1JGGA 3LQRA 3JRAA 1XMAA 3L00A 4JX6A 4OMZA 2H1KA 3GW2A 1X1DA 4UUSB 1B9MA 2MH2A 2E7WA 2EIKH 2YPRA 5AIQA 1QU3A 5KAFC 1V55H 2MLGA 2V1NA 5BPIA 3F8MA 3G6EI 2ECCA 1IAWA 2WAEA 1SMTA 3KLNA 4RM2A 4A6EA 1YFHA 1GXQA 1QHHD 1XPXA 2R7ZJ 5E17F 4I02A 2ZCWA 4DYCA 1GLNA 3HPGA 1LFBA 4CHUA 3HZJA 2LYCA 1L3LA 3KP2A 1G3WA 1XCBA 2VKDA 2UZKA 5FO5A 3SEQA 3J7YJ 1JGSA 3F8FA 4RLQA 5CYVA 4YIRX 4ESJA 1YJWI 3QQAA 2K9NA 1B59A 4ANJA 1TL8A 5C3EJ 4CCJA 4LB6B 3E6MA 2HDWA 2VASA 2KRHA 4E7JA 1W5SA 3H36A 4IOCF 5TJJA 3E0JB 4I98B 4Y4RA 4YFKF 4CZCA 3HOYJ 3K4BA 1BBYA 4IF4A 3SHFA 1KU3A 1HKQA 4I99C 4HF1A 5EF6A 1O4XA 1V5EA 4BEHA 4UUSA 3WHCA 1POGA 1R4NB 4WCGA 3JTGA 4BKXA 3G1MA 1LUJB 4F7ZA 3HSFA 4A3GJ 1VQPI 1YS7A 2O6GE 1AKHB 1XB4A 2QQ9A 3CJTB 4HLXA 4DZJA 5B1AH 1P4XA 2QF7A 1TTYA 1EH6A 4JK1X 1BC7C 1WI3A 1UB9A 5FLMJ 1P6RA 1APLC 2ECBA 2L01A 4XKBA 1F9NA 2R7DA 4I76A 1MKMA 1SFKA 4HAMA 5L3FA 1OCCH 2QKLB 2HNHA 2IGMA 3ISPA 3PQJA 3IHUA 1AHDP 3I4MJ 2K85A 1MSEC 1D1AA 2EBIA 1YG2A 2QEXI 1IV8A 2XRNA 2AXTC 2DOAA 1ZREA 5DD4A 5E8IA 1JKQC 3PJRA 3OSGA 3FZVA 5L3CA 2UV1A 4AIKA 2A5WA 2WY7Q 2O9LA 1YW8A 3P5JA 3U9GA 2E71A 3AAFA 2DOFA 2GXBA 2Y9ZA 3DCFA 5FKLA 1FYMA 3S3MA 1KA8A 3I59B 1QVTA 5E3MA 4UV9A 3DBHB 4MFEA 2DDAA 3HHHA 1SD7A 1IRFA 1MJ9A 3DKYA 3N05A 1Z3YA 1ODDA 3QPSA 1UZCA 1GXPA 4BQNA 1XN7A 3GLLA 4OAZA 2ZXIA 2KRCA 4G8XA 1ZGJA 2LVSA 1V54H 2ID6A 3GCMA 3SYTA 1ZGAA 2HVQA 1F1ZA 2O0YA 3LSGA 2MG4A 3TL4X 2G9WA 5IYCJ 2Q8KA 1YIJI 2F48A 3ESWB 2WBMA 2WAFA 3Q0WA 2FEZA 2PJPA 4BDZA 1X3WB 4C3IJ 2R7VA 2ME6A 5A2QZ 4K2EA 2V1XA 2DA4A 2VE8A 2DPDA 3GWZA 2HS5A 3BLYA 3KEOA 3ZQQA 4NUBA 2EQRA 4RDUA 3WG7H 2BBYA 4IRGA 4AM3A 4XIDA 3GVAA 4M9XA 4X1EA 2M0CA 3HYIA 3AG3H 1NK3P 2XKOA 1YHQI 4A69C 5FLVA 2HVSA 4O3MA 4RGSA 3KP4A 5FKOA 3V7CA 3X2QH 2UWMA 2EZIA 3OMYA 1A35A 3WU2C 1FTTA 3CDHA 1G3TA 2GAUA 1GDTA 2OTLI 3A2KA 3OL3A 4M73A 3MAJA 4CO8A 5D8LB 2K3FA 1H0MA 4N4NB 4B44A 4G9YA 5F1RA 1WRJA 2MH9A 4M3DA 2PMUA 5CVVA 5D5VB 3UR3C 2NNYA 5EEAA 1V4RA 2QQAA 1RR7A 1A6IA 1XMXA 1I27A 1S72I 2OCCH 1SFUA 3CCRI 1OCPA 4LOCA 4V19K 3MKLA 1FIAA 1R5HA 1YJ9I 5GAEJ 1WH5A 4CSWA 4AYBA 3S3NA 3ZN1A 1ULYA 1DPUA 1E0EA 2ZO4A 3L2CA 1QHGA 2QSHX 4CICA 1K61A 2LY1A 3H3UA 3QAHA 3VEPA 4KT6A 1XSDA 1MW7A 3C1DA 2ADUA 3ZMDA 2LOOA 4Y17A 5HODA 1HBXG 1CF7A 4CUGA 2HZTA 5DD8A 3OYKA 3M4OJ 3KLOA 4IO9F 2RAEA 3CESA 3G1LA 2Y30A 1IN8A 1Y39A 1U6GA 1R23A 1LNWA 1RPWA 2DBBA 5CVIA 5ILSA 4RB1A 2B9SA 4RB0A 5HVQC 1A36A 4XN3A 3LSTA 3KYLA 4BE1A 3ZCOA 4Y52J 3HB9A 1D0ZA 4OIOF 1TNTA 1DUXC 3CUQB 3T8RA 1G4DA 2DAOA 1TT5B 1Y6IA 2D1HA 1YTYA 1YI2I 4U88A 2NVUB 3S8PA 3E6CC 2NYXA 3JR9A 2HYFA 2F5FA 2TCTA 2EZLA 3L1PA 3J7ZI 4UY8I 1E3PA 2VODA 3OYNA 3RPUA 4O6JA 2ISZA 2DMTA 1MJAA 2GXGA 3WE3A 4EM1A 2TDXA 1YRNB 4L0YB 5E18F 1E2XA 3DKWA 2O3FA 2R7TA 2LDUA 1K78B 2Y2ZA 1HC8A 4KITB 5GAHJ 3TP3A 5K5RA 1T8IA 3GMEA 3WTSC 4AUXA 2E34A 3E5UA 4M3BA 5HS9A 3T0YA 3LFKA 4CCKA 4S04A 2CQKA 4GXOA 4Q48A 1Z7UA 1ZKGA 4LIUA 3TBIA 1H9TA 3DQVC 1XX5A 1ZH5A 2GA1A 1YIOA 3HHGA 4HF0A 1T2KA 4DZPA 1R71A 2FJ1A 3EETA 3LSIA 2WY8Q 3BG6A 4CYCA 1D8KA 2DFIA 4MTDA 3EUAA 4M72A 2BXYA 4ENKA 4XLPF 5IY5H 4UNOA 1GVDA 1R36A 2JJ7A 1O3QA 2K9LA 1VZ0A 3HM5A 4G94A 1G2HA 2YSRA 3BTCA 3ECOA 4XRSG 4DBRA 4BXFA 2H6BA 1YJNI 1BOBA 3OYEA 2HU9A 1IF1A 2NOJB 1W0TA 2P6SA 4LIVA 3BR2A 3CC4I 3L2RA 2ZJQF 4LK0F 3SZPA 5F6FA 4IHTA 4IQ4A 5ED4A 3BG5A 2ZFWA 1BI1A 3BJOA 5IT9K 4RM3A 4HOBA 2EB7A 1VTNC 2HVRA 1MNEA 2ME0A 1N77A 4ZYDA 1ORKA 5JHUA 1MNDA 1S9HA 3TEDA 5J47A 3WTVC 1LKXA 2J5PA 5KAIC 1PDNC 2DT7B 2B63J 4IHXA 4TV7A 4PZJA 5GPCA 2IA1A 4QWQA 1PVEA 4O5VA 1PP7U 4BACA 1K78A 2NS0A 1P2FA 2P5VA 2PFBA 3HRTA 2IS4A 5F27A 2GOMA 5FKMA 3BZ6A 1IJWC 1P7JA 1U0JA 2OD5A 1KZHA 5E20A 2IAIA 2IVMA 3E6BA 4FQGA 3JRCA 2DXIA 1UHSA 1ZR4A 4G6DA 2MYSA 1A5JA 1JUMA 1X3ZB 3HTUA 4AVPA 4WK8F 4BU2A 4M9ZA 4ZTFA 4LGWA 3HOVJ 1Y8RB 2LKPA 2ZMEC 2ZNZA 2XB5A 3LSHA 2CUFA 5DM6F 4RAZA 2XGXA 2EILH 2Z5UA 2EPFA 3BR5A 3DPTA 2OUMA 2W57A 1J59A 2NS8A 6PAXA 2DCEA 4A93J 1Z05A 4IPAA 4I7HA 1HSJA 2BGCA 2HWVA 2JPCA 4E7KA 3VYRB 1X2NA 4ITVA 1NG7A 5J1UA 3TMOA 2MW8A 1V5GA 1I6XA 2DMNA 3IWFA 2JA2A 3DEUA 2ZXWH 5C44J 2L7MP 2R5ZA 2G7UA 3F8NA 3MMYB 3MKYB 3JRFA 1LDJA 2W7NA 4LD5A 3K4KA 2CW0F 2M1BA 4FCYA 3BJAA 3IRRA 4B4CA 1VFCA 2R7UA 3HG9A 2BHYA 3FXQA 3BC8A 5ILVA 2IT0A 3PIOF 2L9NA 5IT9Z 2VQHA 3D1NI 4IRIA 3A02A 1IW7F 1ZK8A 1GUUA 4XOPA 2OTJI 5E3LA 2CJJA 2DTRA 3ASOH 3GTMJ 4IHVA 4II2A 2FF4A 1REPC 3E97A 4N9HA 2EIJH 4NC8A 1YO5C 1MH3A 3ZQIA 2HOTA 2X6WA 1QBJA 2OU2A 3VYTB 2M34A 2X1EA 3BY6A 1QRYA 1U2WA 4UB6C 4HSRA 2BV6A 2MA3A 1GV2A 2FRHA 4L9NA 1Z77A 2HOSA 4YEJA 1B72B 1FBQA 4NBQA 4Q4ZF 4M74A 4KN7X 2MC4A 5C4JJ 2W24A 3I54A 5GTIC 2XSDC 3PQKA 4BHBA 1YW9A 2HQNA 1TQMA 5CQEA 3S1MJ 3NEUA 3TQNA 4BH9A 5IYDJ 3NAUA 2K4JA 5JR3A 3K9TA 3HGYA 3ZQCA 2O8KA 2GZWA 4XK4A 4HV6A 1Z0XA 1V5FA 2B0LA 3RKYA 4E7SA 3A01B 5DM7F 3LA7A 3GZ5A 3S2HJ 4I0AA 3RYRA 2VKEA 5TISC 3RKWA 3PIPF 2BW3B 1LDDA 3FM3A 4ZJZA 4HDVA 3Q9VA 2XKPA 2LMDA 4ZDPA 1MBFA 4G7ZF 1RUNA 3FXOA 4AU7A 2ELHA 4D7NA 1WHUA 2BE5F 2XASA 2UXXA 4L9VA
chains in the Genus database with same CATH topology
1HW2A 2J5OA 4YIFA 3N97A 5BS6A 1S3JA 3SZTA 2ZJ2A 3V8LA 2DI3A 3QPHA 1BN5A 1FBSA 2VBXA 1U5TA 4GYIA 5D8KB 3WTWC 2X4HA 2DT5A 4L9TA 3HOTA 3KP3A 1BIAA 4R79A 1HKTA 3F8BA 3L9FA 2QZ8A 4BNCA 2HDCA 2GWRA 4MEXF 4LJZF 4UHTA 5EEGA 4EJOA 3LA2A 2CG4A 5K5QA 3ERED 1UCRA 3RI4A 3MZHA 4R8HA 4AD9A 4WXHA 3JW4A 2EWNA 2Y48A 3KP6A 2KIUA 2VC1A 3CUQC 1EV7A 1FX7A 3IWZA 3WODF 5L3BA 3OOPA 3K69A 3MEXA 2COMA 2M5WA 4MQVA 2DO7A 3NRVA 2FXAA 2FNPA 3DP7A 3VFZA 4CZZA 3FMRA 1Y0UA 1V3FA 2HEOA 1U8RA 1O3RA 1KYWA 1ZHFA 1P92A 1R00A 5D4RA 2R3SA 1BI0A 2XHKA 1DP7P 4EVIA 3IKVA 2QBYA 2G7HA 4KMUX 1LDKB 4HYEA 1LB2A 3CO7C 4N9IA 3ABTA 5LGUA 1TNSA 5DCMB 3GFIA 1MZBA 3J81Z 1KQ8A 5E1WA 3LA3A 1F4KA 1D3YA 1L0OC 3DXJF 4CDGA 3L7WA 4OMYA 2LNBA 4KICA 1UFMA 2NRAC 5DUIA 2WC2A 3WG9A 1TW3A 3G3ZA 4Q5SF 3F23A 3CO6C 1R5GA 2IA0A 5H6QA 3T5XA 3WU0A 4ZYHA 3M9AA 3M8EA 1ZG1A 4XRFA 2Z99A 4Y13A 1S8NA 3K1NA 2XAGA 2DPUA 4PDKA 1F5TA 4BAYA 3ROUA 3HUGA 1R1VA 3BOQA 4MGRA 2V1UA 4EMSA 4ENMA 3HRUA 3WTZA 2H27A 4OIRF 2NAZA 4LLNA 3V7SA 1U78A 2PG4A 5LEJA 2P5KA 3KCCA 2Z3YA 1P4WA 4D0PA 1ZYRF 1WWXA 2OA4A 1D5VA 2HTJA 2FNAA 4U0VA 4KA4A 1U3EM 5HDKA 1JHFA 2VT2A 4UV8A 5HDNA 3DV8A 2CYYA 3O6BB 4KN4X 2RQPA 4IJAA 3RDIA 3SQNA 2VBWA 2F2EA 1FT9A 3HIFA 3QOPA 4EM2A 1SD6A 4EJVA 1CGPA 3GFMA 4ON0A 1S29A 1ZARA 4I09A 2RDPA 2DQRA 1O3SA 2OZ6A 3FMSA 1SFXA 5LGNA 3WU1B 1Q1HA 4I0BA 2F5DA 3HRMA 5DDGA 2LF8A 3GLXA 2H94A 1IRGA 4EV0A 5LHHA 3V7RA 1HXDA 2WV0A 2KIMA 2XAHA 3P9KA 5L3GA 1FLIA 2FE3A 4RGUA 3WE2A 1UHMA 3D0SA 1FWZA 3ZMSA 4L5JA 1OYWA 3M8FA 4PCQA 5FLXK 1IN7A 1Z6TA 2EFNA 1MDMA 4LMYA 2HQRA 3J81K 1NHAA 2ZXJA 3O2PE 4WXCA 1T39A 3TOBA 1MDMB 2K4BA 4EGZA 2RVCA 1FZPB 3C7JA 1JXSA 1S6LA 1K7AA 1WSUA 3P7NA 1QNTA 3F6VA 3W6JB 1FP2A 1SFEA 2IJLA 2YX7A 5E1XA 1TLHB 5HLHA 2BEOA 3V8JA 4UVCA 1KGSA 4LG0B 1T0FA 3I0TA 1Z6RA 4LLLA 3ZQ7A 5D5WB 4G7OF 4EM0B 1XSXA 3R61A 3G73A 2D2WA 3Q5FA 3VOEA 2P5LC 4AIJA 2MLKA 2IRFG 1J9IA 2M30A 2PBIA 4IRHA 4L18B 1ONVA 2FU4A 5K1YA 3EDPA 5ICFA 4Z2YA 5CVUA 2DLLA 2RV8A 2QM3A 2EFWA 3DF8A 5LHIA 3D5LA 5KK1A 1FBUA 1HKSA 1XMKA 2V79A 2FQ3A 2EV5A 2XVCA 3JTHA 4HX4A 2GA2A 4ENJA 3F22A 2V9VA 1YW7A 1J75A 1S7AA 3HTSB 2K86A 5HS8A 4BQAA 1FY7A 3IKTA 1R58A 2VOOA 1SAXA 3R0AA 1ON2A 4HW0A 4L5IA 3HOSA 4M71A 3JAMK 2DU9A 1CF7B 2YX4A 5J8CA 2Z33A 5FFXA 4YIIA 3VODA 1FPQA 2JPBA 4AWXB 1ZLKA 1XDSA 3ZMTA 2CO5A 1R1UA 5AONA 2KJBA 2WWYA 2LF7A 4LFUA 1KU7A 2GQQA 3B02A 4KNYA 1IXSB 3BWGA 2A07F 3QP5A 4M6YA 1Z1DA 1RIOH 1T98A 3MZYA 4GYGA 2EV0A 1D8JA 4XSZF 5H6RA 1I1GA 2FMLA 5FGMA 4QLCU 2CGPA 2CWEA 5CJ9A 4WX9A 3KFWX 2VE9A 1MGTA 2EJRA 4I2OA 3REOA 2R7FA 5BQTA 3M7GA 2VXZA 4DQ2A 4HLYA 5L3EA 4HA8A 3ZN0A 2PI0A 1IN4A 4MNUA 1DPRA 4E70A 5E1ZB 2E7XA 3KP5A 3T8TA 2XAFA 4UUVA 2W85A 2IP2A 3WTTC 2L4AA 2Z9OA 4ZYGA 1KQ9A 3TKYA 5DCFA 4CYDA 2FOKA 2P7VB 3S2WA 2BYVE 5HLGA 3J80K 3E3VA 4A0YA 2XUBA 2HR3A 2OZUA 2M87A 5L3DA 2YU3A 4MHGA 1IZ1A 3WTYC 1SD5A 5ICCA 3FM5A 4S05A 4Y15A 4HDUA 1R7JA 4UXNA 1QO0D 4HQEA 3ZMUA 2ESNA 2QLZA 3BPXA 3TO9A 3P9IA 3E5XA 1K6OA 4M9SA 1XGOA 3M1EA 1BI3A 1FSEA 2W25A 2P8TA 3EYIA 3HSRA 4MQ9F 1LQ1A 2D45A 2P7CB 1G3YA 3FHZA 2JTVA 4LLGF 4A2UA 3GYHX 4RGXA 2QENA 4UVAA 2OBPA 4XSXF 3W6KB 4EJWA 1O7LA 1HW1A 4A12A 2OAZA 3JAMZ 5JFRA 1XGMA 1RNLA 1O7FA 4ENNA 4KIFA 4PGGA 2HKOA 2L54A 1QZYA 4IXAA 2FSWA 5HOOA 2ESHA 5FB2A 1OYIA 2FBKA 3MQ0A 4NQWA 3F21A 4I01A 4DNCA 4LK1F 2PQ8A 3U2RA 2JT1A 2D1VA 1I1SA 3TDZC 3LQQA 2GIVA 4L0ZB 2A6EF 5A2QK 3ELKA 3KZZA 2NNNA 2ETHA 4ASNA 3I59A 3K2ZA 3K0LA 1YS6A 3P9CA 4KMFA 4OINF 5JVTA 5KVRA 2A69F 2RNJA 2KKOA 4HZFA 2VN2A 2XAJA 1STZA 2JRTA 1LEAA 1BM9A 1G6NA 4BYYA 1Z91A 3KE2A 2K27A 1U5TB 4KYWA 1QGPA 4Q47A 3R6SA 4M6XA 2FBIA 3FMQA 4LG0A 4YFNF 4EJUA 1O3TA 4B8XA 1KU9A 3WGGA 2A6HF 2P6TA 2A68F 2YR2A 3MCZA 1H9GA 2E1CA 3GEZA 1JHHA 2ZMEA 3BPVA 4G7HF 1ZAOA 3BP8A 3FF5A 3TOAA 3OV8A 1J5YA 1U5TC 4IHSA 2QUFA 1J2XA 3C18A 5ICEA 3DFGA 1T38A 4A0ZA 4L9JA 5EEHA 3WGHA 2PN6A 1MD0A 5LRSA 1IN5A 2HYGD 4ZZDA 2ISYA 1GVJA 3R4KA 3I53A 2STTA 2IW5A 4FT8A 1W7PD 3FXUA 3F8CA 4HV5A 1Z9CA 1HQCA 4BHPA 5FD5A 5BMZA 1KQ0A 1IXRC 2Y75A 1FYLA 1X3UA 1WKMA 4CGZA 1TQPA 5DV5A 1B1BA 2F5EA 4B09A 2ZBKA 2C6YA 1A04A 2KJCA 1YYVA 1SMYF 5DYMA 5FLXZ 5LBQA 2OQGA 2OQRA 4RB3C 3F72A 3QRFF 5K5OA 2ZMEB 5HLIA 3FWEA 5LHGA 4ETSA 3R60A 3N4MA 1XDUA 2A5YB 3GFLA 1FYKA 2UXNA 1TBXA 1USTA 3CJNA 2MD5A 1J0RA 4OIQF 5DCMA 2ACJA 2HKXA 2QQBA 3I64A 5E8GA 3F3XA 4FX0A 4U7DA 3B73A 4ESFA 4NHJA 5LEKA 3KP7A 4A6DA 1IN6A 2V6CA 3LAJA 3R0JA 4GCVA 1S7OA 5ICGA 1ZG5A 3QPTA 4P9FA 3BDDA 3CUQA 3GFJA 2QBYB 2VC0A 4CXFA 2IA2A 4YG2F 4KDPA 1ZRCA 2RN7A 1FNNA 2L4MA 3F6OA 4NB5A 5J6XA 5ERIA 4G6QA 4EGYA 5CVJA 4ZZLA 5FFZA 1ZRFA 5CVRA 4RS8A 3PFIA 2XV4S 3I58A 3BJ6A 4N0BA 4RGRA 1BJAA 3EYYA 2XIGA 5D4SA 4KIBA 4EQQA 3NQOA 5LGTA 3V4GA 2EFOA 3IRQA 4OOIA 1JE8A 3HRSA 3ULQB 2PMHA 2XROA 3T1BA 1ZRDA 4XLNF 1AWCA 4XBFA 3COAC 3K1MA 1E17A 2JZYA 1HW5A 3FX3A 2L3DA 1OMIA 1W7PA 3CUOA 2FA5A 5ILUA 1LJ9A 3GXOA 3QU3A 3QU6A 2H6CA 3CLOA 2MC3A 1UHWA 5TRDA 1BIBA 2PEXA 2VT3A 1TQIA 1B4AA 1LEBA 1FP1D 4U0WA 4LB5A 2XAQA 1XD7A 2O03A 2AXLA 4KIGA 5AIPA 4EJTA 4IVNA 2EA4A 4BXUA 4RB2C 3FXRA 3GZ6A 3SFZA 3JSOA 2O61A 3SXYA 1W7PB 5BOXA 1BC8C 4FHTA 2ZKZA 2HTSA 2QWWA 5D6EA 1P4AA 4JBAA 2K7LA 4AIHA 3I71A 2VOPA 3O3KA 3E5QA 5LRRA 1LVAA 4BHCA 1RI7A 2LSOA 3KEQA 2IPQX 3WTUC 3E6DA 3WGIA 1USSA 2DW4A 2EA2A 1SD4A 3MFKA 3QP6A 4FX4A 2DQLA 4A0XA 2O8XA 4ESBA 3TO6A 1HSTA 1OPCA 4U0YA 1XSVA 5J8FA 4OU0A 1PUEE 2RKHA 4P55A 3DPLC 1PP8F 4P5OA 2RGVA 2RC4A 2M45A 3V8KA 1DDNA 2A3SA 3IC7A 3ZMVA 1YLFA 1RUOA 5D6FA 1KYZA 1WQ2A 3RKXA 5D5XB 4WXDA 4UVBA 2F5CA 2Q2EA 4HF2A 2M8EA 4A5NA 4ZYEA 3TO7A 2KIFA 1MJBA 5LLQA 3RIRA 3ZMZA 5CLSA 5F64A 2H09A 3LWFA 3I4PA 1W4MA 4OIPF 4WF2A 2AS5F 4HBLA 1FOKA 2HGCA 4P96A 4U7BA 1OYYA 1EH7A 3ML6A 1KU2A 5H20A 3L09A 1RZ4A 1XCVA 4GO1A 3RTRA 1QQIA 2L02A 5DEQA 1OR7A 3GUDA 1B9NA 3U1DA 3GO5A 4GGGA 1TW2A 1XGNA 5HS7A 3RYPA 1XGSA 1K79A 3EUHA 2CFXA 4JQFA 1I5ZA 2EFQA 1ZG3A 3EQLF 3HSEA 1IUYA 4RAYA 3VB2A 1OKRA 1R22A 3TDUC 1FSHA 1ZLJA 5IT3A 2KRFA 4ZH4F 5D5UB 2CSOA 4H0EA 3ZP5A 4HX8A 5BPDA 1J7KA 1T6SA 3ZPLA 4KFCA 2FMYA 2STWA 1QPMA 5JI6A 1R1TA 3J7AO 2ZNYA 2V1DA 2A61A 3RJPA 4YFXF 3ABUA 2VBYA 1YQAA 3JSPA 2K02A 1ZN2A 3IL2A 3KETA 3GF2A 1W5TA 2FBHA 4P9UA 2VONA 2Q0OA 3I5UA 3J80Z 1BI2A 2EV6A 2HOEA 1FC3A 1IXCA 5DUKA 3WTXC 3K1PA 5FD6A 3C3WA 2HFHA 4A5MA 1EH8A 2P4WA 2W84A 4HX7A 1O57A 3BROA 2X0LA 2QVOA 2DK5A 3H3ZA 5HDGA 3Q9SA 1QZZA 4HQMA 2WTEA 2PLYA 4WWCA 3MWMA 3RPQA 2QYOA 1ON1A 1C0WA 1B6AA 4MTEA 2EK5A 4R1HA 2JSCA 3CTAA 2VBZA 1AOYA 3TGNA 4KUMA 2E1NA 3LAPA 3H92A 4KT5C 2Y0MA 3GX4X 4MEYF 1GHCA 4PGHA 1BOAA 2DK8A 2EFPA 3ECHA 1WI9A 3KZYA 2MBFA 1G3SA 3LQRA 1XMAA 3L00A 4OMZA 3GW2A 1B9MA 2MH2A 2E7WA 2YPRA 5AIQA 2MLGA 5BPIA 3F8MA 1IAWA 1SMTA 3KLNA 4A6EA 1YFHA 1GXQA 5E17F 4I02A 2ZCWA 4CHUA 1L3LA 3KP2A 1G3WA 1XCBA 2UZKA 5FO5A 1JGSA 3F8FA 5CYVA 4ESJA 1B59A 4LB6B 3E6MA 1W5SA 5TJJA 4I98B 4YFKF 1BBYA 4IF4A 3SHFA 1KU3A 1HKQA 4HF1A 4WCGA 3JTGA 4F7ZA 3HSFA 1YS7A 2O6GE 1XB4A 2QQ9A 4HLXA 1P4XA 1TTYA 1EH6A 4JK1X 1BC7C 1UB9A 1P6RA 2L01A 1F9NA 2R7DA 1MKMA 4HAMA 5L3FA 3ISPA 3PQJA 3IHUA 1YG2A 2XRNA 1ZREA 5DD4A 5E8IA 3FZVA 5L3CA 4AIKA 1YW8A 3U9GA 3AAFA 2GXBA 1FYMA 1KA8A 3I59B 4UV9A 1SD7A 1IRFA 1MJ9A 3HHHA 1ODDA 1GXPA 1XN7A 4G8XA 1ZGJA 1ZGAA 1F1ZA 2O0YA 2G9WA 2Q8KA 2FEZA 2PJPA 5A2QZ 4K2EA 2V1XA 2VE8A 2DPDA 3GWZA 2HS5A 3KEOA 2BBYA 4IRGA 3GVAA 4M9XA 3HYIA 2XKOA 4O3MA 4RGSA 3KP4A 3V7CA 2UWMA 3CDHA 1G3TA 2GAUA 4M73A 3MAJA 4CO8A 5D8LB 1H0MA 4G9YA 5F1RA 1WRJA 2MH9A 5D5VB 2PMUA 5CVVA 2NNYA 1V4RA 2QQAA 1I27A 1SFUA 1R5HA 3ZN1A 1ULYA 1DPUA 2ZO4A 3L2CA 4CICA 3VEPA 3H3UA 3QAHA 1XSDA 2ADUA 3C1DA 3ZMDA 4Y17A 1HBXG 1CF7A 2HZTA 5DD8A 3KLOA 1IN8A 1U6GA 1R23A 1LNWA 2DBBA 5CVIA 5ILSA 4RB1A 4RB0A 5HVQC 3LSTA 4OIOF 1TNTA 1DUXC 3CUQB 3T8RA 1G4DA 2DAOA 2D1HA 1YTYA 4U88A 3E6CC 2NYXA 2HYFA 2F5FA 2VODA 3RPUA 4O6JA 2ISZA 1MJAA 2GXGA 3WE3A 4EM1A 2TDXA 4L0YB 5E18F 1E2XA 3DKWA 2O3FA 2LDUA 1K78B 5K5RA 3WTSC 3E5UA 4S04A 5HS9A 3T0YA 3LFKA 2CQKA 4GXOA 4Q48A 1Z7UA 1H9TA 3DQVC 1ZH5A 2GA1A 1YIOA 3HHGA 4HF0A 1T2KA 3EETA 1D8KA 2DFIA 4MTDA 4M72A 4ENKA 4XLPF 4UNOA 1R36A 1O3QA 4G94A 2YSRA 3ECOA 2H6BA 1IF1A 2P6SA 4LK0F 3SZPA 5F6FA 4IHTA 5ED4A 2ZFWA 1BI1A 3BJOA 5IT9K 4HOBA 1VTNC 2EB7A 4ZYDA 5JHUA 3WTVC 2J5PA 1PDNC 4TV7A 4PZJA 2IA1A 4QWQA 4O5VA 1PP7U 1K78A 2NS0A 1P2FA 2P5VA 2PFBA 3HRTA 3BZ6A 2OD5A 5E20A 2IVMA 3E6BA 4G6DA 3HTUA 4AVPA 4WK8F 4M9ZA 4LGWA 2LKPA 2ZNZA 4RAZA 2XGXA 2Z5UA 3DPTA 2W57A 1J59A 6PAXA 1Z05A 4IPAA 4I7HA 1HSJA 2BGCA 2HWVA 2JPCA 1I6XA 3IWFA 3DEUA 2G7UA 3F8NA 1LDJA 4LD5A 2CW0F 2M1BA 3BJAA 3IRRA 2IT0A 3FXQA 5ILVA 5IT9Z 4IRIA 1IW7F 2DTRA 2FF4A 1REPC 3E97A 4N9HA 1YO5C 1QBJA 2OU2A 3BY6A 1U2WA 2BV6A 2MA3A 2FRHA 4L9NA 1FBQA 4Q4ZF 4M74A 4KN7X 2W24A 3I54A 3PQKA 4BHBA 1YW9A 2HQNA 1TQMA 3NEUA 3TQNA 4BH9A 5JR3A 2K4JA 3K9TA 2GZWA 4HV6A 2B0LA 3RKYA 3LA7A 3GZ5A 4I0AA 3RYRA 3RKWA 3FM3A 1LDDA 4HDVA 3Q9VA 2XKPA 4G7ZF 1RUNA 2ELHA 2BE5F 2XASA 2UXXA 4L9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HW2 A;  2J5O A;  4YIF A;  3N97 A;  5BS6 A;  1S3J A;  3SZT A;  2ZJ2 A;  3V8L A;  2DI3 A;  3QPH A;  1BN5 A;  1FBS A;  2VBX A;  1U5T A;  4GYI A;  5D8K B;  3WTW C;  2X4H A;  2DT5 A;  4L9T A;  3HOT A;  3KP3 A;  1BIA A;  4R79 A;  1HKT A;  3F8B A;  3L9F A;  2QZ8 A;  4BNC A;  2HDC A;  2GWR A;  4MEX F;  4LJZ F;  4UHT A;  5EEG A;  4EJO A;  3LA2 A;  2CG4 A;  5K5Q A;  3ERE D;  1UCR A;  3RI4 A;  3MZH A;  4R8H A;  4AD9 A;  4WXH A;  3JW4 A;  2EWN A;  2Y48 A;  3KP6 A;  2KIU A;  2VC1 A;  3CUQ C;  1EV7 A;  1FX7 A;  3IWZ A;  3WOD F;  5L3B A;  3OOP A;  3K69 A;  3MEX A;  2COM A;  2M5W A;  4MQV A;  2DO7 A;  3NRV A;  2FXA A;  2FNP A;  3DP7 A;  3VFZ A;  4CZZ A;  3FMR A;  1Y0U A;  1V3F A;  2HEO A;  1U8R A;  1O3R A;  1KYW A;  1ZHF A;  1P92 A;  1R00 A;  5D4R A;  2R3S A;  1BI0 A;  2XHK A;  1DP7 P;  4EVI A;  3IKV A;  2QBY A;  2G7H A;  4KMU X;  1LDK B;  4HYE A;  1LB2 A;  3CO7 C;  4N9I A;  3ABT A;  5LGU A;  1TNS A;  5DCM B;  3GFI A;  1MZB A;  3J81 Z;  1KQ8 A;  5E1W A;  3LA3 A;  1F4K A;  1D3Y A;  1L0O C;  3DXJ F;  4CDG A;  3L7W A;  4OMY A;  2LNB A;  4KIC A;  1UFM A;  2NRA C;  5DUI A;  2WC2 A;  3WG9 A;  1TW3 A;  3G3Z A;  4Q5S F;  3F23 A;  3CO6 C;  1R5G A;  2IA0 A;  5H6Q A;  3T5X A;  3WU0 A;  4ZYH A;  3M9A A;  3M8E A;  1ZG1 A;  4XRF A;  2Z99 A;  4Y13 A;  1S8N A;  3K1N A;  2XAG A;  2DPU A;  4PDK A;  1F5T A;  4BAY A;  3ROU A;  3HUG A;  1R1V A;  3BOQ A;  4MGR A;  2V1U A;  4EMS A;  4ENM A;  3HRU A;  3WTZ A;  2H27 A;  4OIR F;  2NAZ A;  4LLN A;  3V7S A;  1U78 A;  2PG4 A;  5LEJ A;  2P5K A;  3KCC A;  2Z3Y A;  1P4W A;  4D0P A;  1ZYR F;  1WWX A;  2OA4 A;  1D5V A;  2HTJ A;  2FNA A;  4U0V A;  4KA4 A;  1U3E M;  5HDK A;  1JHF A;  2VT2 A;  4UV8 A;  5HDN A;  3DV8 A;  2CYY A;  3O6B B;  4KN4 X;  2RQP A;  4IJA A;  3RDI A;  3SQN A;  2VBW A;  2F2E A;  1FT9 A;  3HIF A;  3QOP A;  4EM2 A;  1SD6 A;  4EJV A;  1CGP A;  3GFM A;  4ON0 A;  1S29 A;  1ZAR A;  4I09 A;  2RDP A;  2DQR A;  1O3S A;  2OZ6 A;  3FMS A;  1SFX A;  5LGN A;  3WU1 B;  1Q1H A;  4I0B A;  2F5D A;  3HRM A;  5DDG A;  2LF8 A;  3GLX A;  2H94 A;  1IRG A;  4EV0 A;  5LHH A;  3V7R A;  1HXD A;  2WV0 A;  2KIM A;  2XAH A;  3P9K A;  5L3G A;  1FLI A;  2FE3 A;  4RGU A;  3WE2 A;  1UHM A;  3D0S A;  1FWZ A;  3ZMS A;  4L5J A;  1OYW A;  3M8F A;  4PCQ A;  5FLX K;  1IN7 A;  1Z6T A;  2EFN A;  1MDM A;  4LMY A;  2HQR A;  3J81 K;  1NHA A;  2ZXJ A;  3O2P E;  4WXC A;  1T39 A;  3TOB A;  1MDM B;  2K4B A;  4EGZ A;  2RVC A;  1FZP B;  3C7J A;  1JXS A;  1S6L A;  1K7A A;  1WSU A;  3P7N A;  1QNT A;  3F6V A;  3W6J B;  1FP2 A;  1SFE A;  2IJL A;  2YX7 A;  5E1X A;  1TLH B;  5HLH A;  2BEO A;  3V8J A;  4UVC A;  1KGS A;  4LG0 B;  1T0F A;  3I0T A;  1Z6R A;  4LLL A;  3ZQ7 A;  5D5W B;  4G7O F;  4EM0 B;  1XSX A;  3R61 A;  3G73 A;  2D2W A;  3Q5F A;  3VOE A;  2P5L C;  4AIJ A;  2MLK A;  2IRF G;  1J9I A;  2M30 A;  2PBI A;  4IRH A;  4L18 B;  1ONV A;  2FU4 A;  5K1Y A;  3EDP A;  5ICF A;  4Z2Y A;  5CVU A;  2DLL A;  2RV8 A;  2QM3 A;  2EFW A;  3DF8 A;  5LHI A;  3D5L A;  5KK1 A;  1FBU A;  1HKS A;  1XMK A;  2V79 A;  2FQ3 A;  2EV5 A;  2XVC A;  3JTH A;  4HX4 A;  2GA2 A;  4ENJ A;  3F22 A;  2V9V A;  1YW7 A;  1J75 A;  1S7A A;  3HTS B;  2K86 A;  5HS8 A;  4BQA A;  1FY7 A;  3IKT A;  1R58 A;  2VOO A;  1SAX A;  3R0A A;  1ON2 A;  4HW0 A;  4L5I A;  3HOS A;  4M71 A;  3JAM K;  2DU9 A;  1CF7 B;  2YX4 A;  5J8C A;  2Z33 A;  5FFX A;  4YII A;  3VOD A;  1FPQ A;  2JPB A;  4AWX B;  1ZLK A;  1XDS A;  3ZMT A;  2CO5 A;  1R1U A;  5AON A;  2KJB A;  2WWY A;  2LF7 A;  4LFU A;  1KU7 A;  2GQQ A;  3B02 A;  4KNY A;  1IXS B;  3BWG A;  2A07 F;  3QP5 A;  4M6Y A;  1Z1D A;  1RIO H;  1T98 A;  3MZY A;  4GYG A;  2EV0 A;  1D8J A;  4XSZ F;  5H6R A;  1I1G A;  2FML A;  5FGM A;  4QLC U;  2CGP A;  2CWE A;  5CJ9 A;  4WX9 A;  3KFW X;  2VE9 A;  1MGT A;  2EJR A;  4I2O A;  3REO A;  2R7F A;  5BQT A;  3M7G A;  2VXZ A;  4DQ2 A;  4HLY A;  5L3E A;  4HA8 A;  3ZN0 A;  2PI0 A;  1IN4 A;  4MNU A;  1DPR A;  4E70 A;  5E1Z B;  2E7X A;  3KP5 A;  3T8T A;  2XAF A;  4UUV A;  2W85 A;  2IP2 A;  3WTT C;  2L4A A;  2Z9O A;  4ZYG A;  1KQ9 A;  3TKY A;  5DCF A;  4CYD A;  2FOK A;  2P7V B;  3S2W A;  2BYV E;  5HLG A;  3J80 K;  3E3V A;  4A0Y A;  2XUB A;  2HR3 A;  2OZU A;  2M87 A;  5L3D A;  2YU3 A;  4MHG A;  1IZ1 A;  3WTY C;  1SD5 A;  5ICC A;  3FM5 A;  4S05 A;  4Y15 A;  4HDU A;  1R7J A;  4UXN A;  1QO0 D;  4HQE A;  3ZMU A;  2ESN A;  2QLZ A;  3BPX A;  3TO9 A;  3P9I A;  3E5X A;  1K6O A;  4M9S A;  1XGO A;  3M1E A;  1BI3 A;  1FSE A;  2W25 A;  2P8T A;  3EYI A;  3HSR A;  4MQ9 F;  1LQ1 A;  2D45 A;  2P7C B;  1G3Y A;  3FHZ A;  2JTV A;  4LLG F;  4A2U A;  3GYH X;  4RGX A;  2QEN A;  4UVA A;  2OBP A;  4XSX F;  3W6K B;  4EJW A;  1O7L A;  1HW1 A;  4A12 A;  2OAZ A;  3JAM Z;  5JFR A;  1XGM A;  1RNL A;  1O7F A;  4ENN A;  4KIF A;  4PGG A;  2HKO A;  2L54 A;  1QZY A;  4IXA A;  2FSW A;  5HOO A;  2ESH A;  5FB2 A;  1OYI A;  2FBK A;  3MQ0 A;  4NQW A;  3F21 A;  4I01 A;  4DNC A;  4LK1 F;  2PQ8 A;  3U2R A;  2JT1 A;  2D1V A;  1I1S A;  3TDZ C;  3LQQ A;  2GIV A;  4L0Z B;  2A6E F;  5A2Q K;  3ELK A;  3KZZ A;  2NNN A;  2ETH A;  4ASN A;  3I59 A;  3K2Z A;  3K0L A;  1YS6 A;  3P9C A;  4KMF A;  4OIN F;  5JVT A;  5KVR A;  2A69 F;  2RNJ A;  2KKO A;  4HZF A;  2VN2 A;  2XAJ A;  1STZ A;  2JRT A;  1LEA A;  1BM9 A;  1G6N A;  4BYY A;  1Z91 A;  3KE2 A;  2K27 A;  1U5T B;  4KYW A;  1QGP A;  4Q47 A;  3R6S A;  4M6X A;  2FBI A;  3FMQ A;  4LG0 A;  4YFN F;  4EJU A;  1O3T A;  4B8X A;  1KU9 A;  3WGG A;  2A6H F;  2P6T A;  2A68 F;  2YR2 A;  3MCZ A;  1H9G A;  2E1C A;  3GEZ A;  1JHH A;  2ZME A;  3BPV A;  4G7H F;  1ZAO A;  3BP8 A;  3FF5 A;  3TOA A;  3OV8 A;  1J5Y A;  1U5T C;  4IHS A;  2QUF A;  1J2X A;  3C18 A;  5ICE A;  3DFG A;  1T38 A;  4A0Z A;  4L9J A;  5EEH A;  3WGH A;  2PN6 A;  1MD0 A;  5LRS A;  1IN5 A;  2HYG D;  4ZZD A;  2ISY A;  1GVJ A;  3R4K A;  3I53 A;  2STT A;  2IW5 A;  4FT8 A;  1W7P D;  3FXU A;  3F8C A;  4HV5 A;  1Z9C A;  1HQC A;  4BHP A;  5FD5 A;  5BMZ A;  1KQ0 A;  1IXR C;  2Y75 A;  1FYL A;  1X3U A;  1WKM A;  4CGZ A;  1TQP A;  5DV5 A;  1B1B A;  2F5E A;  4B09 A;  2ZBK A;  2C6Y A;  1A04 A;  2KJC A;  1YYV A;  1SMY F;  5DYM A;  5FLX Z;  5LBQ A;  2OQG A;  2OQR A;  4RB3 C;  3F72 A;  3QRF F;  5K5O A;  2ZME B;  5HLI A;  3FWE A;  5LHG A;  4ETS A;  3R60 A;  3N4M A;  1XDU A;  2A5Y B;  3GFL A;  1FYK A;  2UXN A;  1TBX A;  1UST A;  3CJN A;  2MD5 A;  1J0R A;  4OIQ F;  5DCM A;  2ACJ A;  2HKX A;  2QQB A;  3I64 A;  5E8G A;  3F3X A;  4FX0 A;  4U7D A;  3B73 A;  4ESF A;  4NHJ A;  5LEK A;  3KP7 A;  4A6D A;  1IN6 A;  2V6C A;  3LAJ A;  3R0J A;  4GCV A;  1S7O A;  5ICG A;  1ZG5 A;  3QPT A;  4P9F A;  3BDD A;  3CUQ A;  3GFJ A;  2QBY B;  2VC0 A;  4CXF A;  2IA2 A;  4YG2 F;  4KDP A;  1ZRC A;  2RN7 A;  1FNN A;  2L4M A;  3F6O A;  4NB5 A;  5J6X A;  5ERI A;  4G6Q A;  4EGY A;  5CVJ A;  4ZZL A;  5FFZ A;  1ZRF A;  5CVR A;  4RS8 A;  3PFI A;  2XV4 S;  3I58 A;  3BJ6 A;  4N0B A;  4RGR A;  1BJA A;  3EYY A;  2XIG A;  5D4S A;  4KIB A;  4EQQ A;  3NQO A;  5LGT A;  3V4G A;  2EFO A;  3IRQ A;  4OOI A;  1JE8 A;  3HRS A;  3ULQ B;  2PMH A;  2XRO A;  3T1B A;  1ZRD A;  4XLN F;  1AWC A;  4XBF A;  3COA C;  3K1M A;  1E17 A;  2JZY A;  1HW5 A;  3FX3 A;  2L3D A;  1OMI A;  1W7P A;  3CUO A;  2FA5 A;  5ILU A;  1LJ9 A;  3GXO A;  3QU3 A;  3QU6 A;  2H6C A;  3CLO A;  2MC3 A;  1UHW A;  5TRD A;  1BIB A;  2PEX A;  2VT3 A;  1TQI A;  1B4A A;  1LEB A;  1FP1 D;  4U0W A;  4LB5 A;  2XAQ A;  1XD7 A;  2O03 A;  2AXL A;  4KIG A;  5AIP A;  4EJT A;  4IVN A;  2EA4 A;  4BXU A;  4RB2 C;  3FXR A;  3GZ6 A;  3SFZ A;  3JSO A;  2O61 A;  3SXY A;  1W7P B;  5BOX A;  1BC8 C;  4FHT A;  2ZKZ A;  2HTS A;  2QWW A;  5D6E A;  1P4A A;  4JBA A;  2K7L A;  4AIH A;  3I71 A;  2VOP A;  3O3K A;  3E5Q A;  5LRR A;  1LVA A;  4BHC A;  1RI7 A;  2LSO A;  3KEQ A;  2IPQ X;  3WTU C;  3E6D A;  3WGI A;  1USS A;  2DW4 A;  2EA2 A;  1SD4 A;  3MFK A;  3QP6 A;  4FX4 A;  2DQL A;  4A0X A;  2O8X A;  4ESB A;  3TO6 A;  1HST A;  1OPC A;  4U0Y A;  1XSV A;  5J8F A;  4OU0 A;  1PUE E;  2RKH A;  4P55 A;  3DPL C;  1PP8 F;  4P5O A;  2RGV A;  2RC4 A;  2M45 A;  3V8K A;  1DDN A;  2A3S A;  3IC7 A;  3ZMV A;  1YLF A;  1RUO A;  5D6F A;  1KYZ A;  1WQ2 A;  3RKX A;  5D5X B;  4WXD A;  4UVB A;  2F5C A;  2Q2E A;  4HF2 A;  2M8E A;  4A5N A;  4ZYE A;  3TO7 A;  2KIF A;  1MJB A;  5LLQ A;  3RIR A;  3ZMZ A;  5CLS A;  5F64 A;  2H09 A;  3LWF A;  3I4P A;  1W4M A;  4OIP F;  4WF2 A;  2AS5 F;  4HBL A;  1FOK A;  2HGC A;  4P96 A;  4U7B A;  1OYY A;  1EH7 A;  3ML6 A;  1KU2 A;  5H20 A;  3L09 A;  1RZ4 A;  1XCV A;  4GO1 A;  3RTR A;  1QQI A;  2L02 A;  5DEQ A;  1OR7 A;  3GUD A;  1B9N A;  3U1D A;  3GO5 A;  4GGG A;  1TW2 A;  1XGN A;  5HS7 A;  3RYP A;  1XGS A;  1K79 A;  3EUH A;  2CFX A;  4JQF A;  1I5Z A;  2EFQ A;  1ZG3 A;  3EQL F;  3HSE A;  1IUY A;  4RAY A;  3VB2 A;  1OKR A;  1R22 A;  3TDU C;  1FSH A;  1ZLJ A;  5IT3 A;  2KRF A;  4ZH4 F;  5D5U B;  2CSO A;  4H0E A;  3ZP5 A;  4HX8 A;  5BPD A;  1J7K A;  1T6S A;  3ZPL A;  4KFC A;  2FMY A;  2STW A;  1QPM A;  5JI6 A;  1R1T A;  3J7A O;  2ZNY A;  2V1D A;  2A61 A;  3RJP A;  4YFX F;  3ABU A;  2VBY A;  1YQA A;  3JSP A;  2K02 A;  1ZN2 A;  3IL2 A;  3KET A;  3GF2 A;  1W5T A;  2FBH A;  4P9U A;  2VON A;  2Q0O A;  3I5U A;  3J80 Z;  1BI2 A;  2EV6 A;  2HOE A;  1FC3 A;  1IXC A;  5DUK A;  3WTX C;  3K1P A;  5FD6 A;  3C3W A;  2HFH A;  4A5M A;  1EH8 A;  2P4W A;  2W84 A;  4HX7 A;  1O57 A;  3BRO A;  2X0L A;  2QVO A;  2DK5 A;  3H3Z A;  5HDG A;  3Q9S A;  1QZZ A;  4HQM A;  2WTE A;  2PLY A;  4WWC A;  3MWM A;  3RPQ A;  2QYO A;  1ON1 A;  1C0W A;  1B6A A;  4MTE A;  2EK5 A;  4R1H A;  2JSC A;  3CTA A;  2VBZ A;  1AOY A;  3TGN A;  4KUM A;  2E1N A;  3LAP A;  3H92 A;  4KT5 C;  2Y0M A;  3GX4 X;  4MEY F;  1GHC A;  4PGH A;  1BOA A;  2DK8 A;  2EFP A;  3ECH A;  1WI9 A;  3KZY A;  2MBF A;  1G3S A;  3LQR A;  1XMA A;  3L00 A;  4OMZ A;  3GW2 A;  1B9M A;  2MH2 A;  2E7W A;  2YPR A;  5AIQ A;  2MLG A;  5BPI A;  3F8M A;  1IAW A;  1SMT A;  3KLN A;  4A6E A;  1YFH A;  1GXQ A;  5E17 F;  4I02 A;  2ZCW A;  4CHU A;  1L3L A;  3KP2 A;  1G3W A;  1XCB A;  2UZK A;  5FO5 A;  1JGS A;  3F8F A;  5CYV A;  4ESJ A;  1B59 A;  4LB6 B;  3E6M A;  1W5S A;  5TJJ A;  4I98 B;  4YFK F;  1BBY A;  4IF4 A;  3SHF A;  1KU3 A;  1HKQ A;  4HF1 A;  4WCG A;  3JTG A;  4F7Z A;  3HSF A;  1YS7 A;  2O6G E;  1XB4 A;  2QQ9 A;  4HLX A;  1P4X A;  1TTY A;  1EH6 A;  4JK1 X;  1BC7 C;  1UB9 A;  1P6R A;  2L01 A;  1F9N A;  2R7D A;  1MKM A;  4HAM A;  5L3F A;  3ISP A;  3PQJ A;  3IHU A;  1YG2 A;  2XRN A;  1ZRE A;  5DD4 A;  5E8I A;  3FZV A;  5L3C A;  4AIK A;  1YW8 A;  3U9G A;  3AAF A;  2GXB A;  1FYM A;  1KA8 A;  3I59 B;  4UV9 A;  1SD7 A;  1IRF A;  1MJ9 A;  3HHH A;  1ODD A;  1GXP A;  1XN7 A;  4G8X A;  1ZGJ A;  1ZGA A;  1F1Z A;  2O0Y A;  2G9W A;  2Q8K A;  2FEZ A;  2PJP A;  5A2Q Z;  4K2E A;  2V1X A;  2VE8 A;  2DPD A;  3GWZ A;  2HS5 A;  3KEO A;  2BBY A;  4IRG A;  3GVA A;  4M9X A;  3HYI A;  2XKO A;  4O3M A;  4RGS A;  3KP4 A;  3V7C A;  2UWM A;  3CDH A;  1G3T A;  2GAU A;  4M73 A;  3MAJ A;  4CO8 A;  5D8L B;  1H0M A;  4G9Y A;  5F1R A;  1WRJ A;  2MH9 A;  5D5V B;  2PMU A;  5CVV A;  2NNY A;  1V4R A;  2QQA A;  1I27 A;  1SFU A;  1R5H A;  3ZN1 A;  1ULY A;  1DPU A;  2ZO4 A;  3L2C A;  4CIC A;  3VEP A;  3H3U A;  3QAH A;  1XSD A;  2ADU A;  3C1D A;  3ZMD A;  4Y17 A;  1HBX G;  1CF7 A;  2HZT A;  5DD8 A;  3KLO A;  1IN8 A;  1U6G A;  1R23 A;  1LNW A;  2DBB A;  5CVI A;  5ILS A;  4RB1 A;  4RB0 A;  5HVQ C;  3LST A;  4OIO F;  1TNT A;  1DUX C;  3CUQ B;  3T8R A;  1G4D A;  2DAO A;  2D1H A;  1YTY A;  4U88 A;  3E6C C;  2NYX A;  2HYF A;  2F5F A;  2VOD A;  3RPU A;  4O6J A;  2ISZ A;  1MJA A;  2GXG A;  3WE3 A;  4EM1 A;  2TDX A;  4L0Y B;  5E18 F;  1E2X A;  3DKW A;  2O3F A;  2LDU A;  1K78 B;  5K5R A;  3WTS C;  3E5U A;  4S04 A;  5HS9 A;  3T0Y A;  3LFK A;  2CQK A;  4GXO A;  4Q48 A;  1Z7U A;  1H9T A;  3DQV C;  1ZH5 A;  2GA1 A;  1YIO A;  3HHG A;  4HF0 A;  1T2K A;  3EET A;  1D8K A;  2DFI A;  4MTD A;  4M72 A;  4ENK A;  4XLP F;  4UNO A;  1R36 A;  1O3Q A;  4G94 A;  2YSR A;  3ECO A;  2H6B A;  1IF1 A;  2P6S A;  4LK0 F;  3SZP A;  5F6F A;  4IHT A;  5ED4 A;  2ZFW A;  1BI1 A;  3BJO A;  5IT9 K;  4HOB A;  1VTN C;  2EB7 A;  4ZYD A;  5JHU A;  3WTV C;  2J5P A;  1PDN C;  4TV7 A;  4PZJ A;  2IA1 A;  4QWQ A;  4O5V A;  1PP7 U;  1K78 A;  2NS0 A;  1P2F A;  2P5V A;  2PFB A;  3HRT A;  3BZ6 A;  2OD5 A;  5E20 A;  2IVM A;  3E6B A;  4G6D A;  3HTU A;  4AVP A;  4WK8 F;  4M9Z A;  4LGW A;  2LKP A;  2ZNZ A;  4RAZ A;  2XGX A;  2Z5U A;  3DPT A;  2W57 A;  1J59 A;  6PAX A;  1Z05 A;  4IPA A;  4I7H A;  1HSJ A;  2BGC A;  2HWV A;  2JPC A;  1I6X A;  3IWF A;  3DEU A;  2G7U A;  3F8N A;  1LDJ A;  4LD5 A;  2CW0 F;  2M1B A;  3BJA A;  3IRR A;  2IT0 A;  3FXQ A;  5ILV A;  5IT9 Z;  4IRI A;  1IW7 F;  2DTR A;  2FF4 A;  1REP C;  3E97 A;  4N9H A;  1YO5 C;  1QBJ A;  2OU2 A;  3BY6 A;  1U2W A;  2BV6 A;  2MA3 A;  2FRH A;  4L9N A;  1FBQ A;  4Q4Z F;  4M74 A;  4KN7 X;  2W24 A;  3I54 A;  3PQK A;  4BHB A;  1YW9 A;  2HQN A;  1TQM A;  3NEU A;  3TQN A;  4BH9 A;  5JR3 A;  2K4J A;  3K9T A;  2GZW A;  4HV6 A;  2B0L A;  3RKY A;  3LA7 A;  3GZ5 A;  4I0A A;  3RYR A;  3RKW A;  3FM3 A;  1LDD A;  4HDV A;  3Q9V A;  2XKP A;  4G7Z F;  1RUN A;  2ELH A;  2BE5 F;  2XAS A;  2UXX A;  4L9V A; 
#chains in the Genus database with same CATH topology
 3K6G A;  1HW2 A;  3VYS B;  2J5O A;  2R5Y B;  4YIF A;  3KYD B;  5BS6 A;  2ZSH B;  3N97 A;  1S3J A;  3LSK A;  5EJC A;  3SZT A;  2JA5 J;  1B72 A;  2BVL A;  3FBN B;  2W1O A;  2ZJ2 A;  3V8L A;  2DI3 A;  5J40 A;  3QPH A;  1BN5 A;  3ABM H;  4PSW A;  1FBS A;  2VBX A;  1U5T A;  4GYI A;  2Y9Y A;  2XGE A;  4CCL A;  4W97 A;  5D8K B;  3WTW C;  2X4H A;  2DT5 A;  2FX0 A;  4L9T A;  3HOT A;  3KP3 A;  1BIA A;  4R79 A;  1N75 A;  1Y0N A;  1HKT A;  3F8B A;  3L9F A;  2ICW G;  1ETO A;  2QZ8 A;  3Q3S A;  4BNC A;  4FE4 A;  2HDC A;  2R7O A;  4XLF A;  2GWR A;  5DTD A;  4MEX F;  3D5R C;  2O7O A;  3LMM A;  2YU9 J;  3I3L A;  4LJZ F;  1JKO C;  1ENH A;  4UHT A;  1ACI A;  5EEG A;  2NXN B;  4EJO A;  2TRT A;  3LA2 A;  2CG4 A;  1R9T J;  2R0Q C;  2LTP A;  5K5Q A;  3ERE D;  1DU0 A;  1UCR A;  4S0H B;  2WB1 N;  2JSP A;  3RI4 A;  3MZH A;  4R8H A;  4AD9 A;  3IAS 2;  3ASN H;  4WXH A;  2M4K A;  1HA8 A;  3JW4 A;  2EWN A;  1FMV A;  1P7I A;  2CUZ A;  1MBJ A;  2E19 A;  2Y48 A;  1XS9 A;  3KP6 A;  3OIQ A;  2KIU A;  2E60 A;  2VC1 A;  2W4S A;  3CUQ C;  1EV7 A;  1LE8 B;  4G12 A;  4C2U A;  1FX7 A;  4G6T B;  2XDV A;  4IHW A;  1Z3X A;  3H35 A;  1TWF J;  3GZN B;  3IWZ A;  1RKW A;  4M3G A;  5F1J A;  2HXO A;  3WOD F;  5L3B A;  3OOP A;  3K69 A;  3HPH A;  1NG6 A;  4XKC A;  3MEX A;  1RC9 A;  4B3X A;  2COM A;  2M5W A;  2LBF A;  2DO7 A;  4MQV A;  1YIT I;  1SFO J;  2QA4 I;  1FMW A;  1BA5 A;  3NRV A;  2FXA A;  2F4M B;  4XLC A;  2FNP A;  3DP7 A;  3VFZ A;  5FRM A;  2XPU A;  1A31 A;  3HC7 A;  2BY1 A;  2LBF B;  4CZZ A;  1EJ9 A;  1IRX A;  3FMR A;  1Y0U A;  1V3F A;  2HEO A;  3ZQF A;  1R6R A;  1U8R A;  1O3R A;  1KYW A;  1WJE A;  1ZHF A;  4DBQ A;  4V2G A;  1IDY A;  5KNL A;  1P92 A;  1R00 A;  2DYS H;  2E1M B;  2ZXH A;  5D4R A;  3OYA A;  1DP3 A;  1D0Y A;  2IGK A;  2R3S A;  3G71 I;  1BI0 A;  3OR2 C;  3CCQ I;  2XHK A;  5M5X J;  1WPK A;  1DP7 P;  4EVI A;  4C9Y A;  3IKV A;  2QBY A;  4AYB N;  2VIX A;  2BZT A;  2G7H A;  4KMU X;  4A3M J;  1LE8 A;  3A1Y A;  3BG9 A;  4PFP A;  2HDD A;  3RSN A;  1LDK B;  4HYE A;  1X1P A;  1LB2 A;  3CO7 C;  4N9I A;  3ABT A;  5LGU A;  1TNS A;  5DCM B;  4KIS A;  3GFI A;  2L9V A;  1MZB A;  5F0C A;  4B3A A;  3CJR B;  2KMU A;  1IO2 A;  3J81 Z;  1KQ8 A;  5E1W A;  2NVT J;  4C3H J;  4M3F A;  3LA3 A;  1F4K A;  1D3Y A;  3OL4 A;  1L0O C;  2L5Q A;  3DXJ F;  4CDG A;  2EZH A;  3L7W A;  3E7L A;  4OMY A;  4BQO A;  2NS7 A;  2LNB A;  2K3P A;  4KIC A;  1UFM A;  2NRA C;  4GFB A;  5DUI A;  2WC2 A;  3WG9 A;  3FXK A;  1DQU A;  1TW3 A;  3G3Z A;  4Q5S F;  2I8D A;  3F23 A;  4X0G A;  1ZR2 A;  3CO6 C;  1JTY A;  2XGD A;  1R5G A;  2IXS A;  2IA0 A;  4JX4 A;  1ZEL A;  3D5S C;  5H6Q A;  2PJR B;  1MMA A;  2G0E A;  3T5X A;  1S5L C;  3M8J A;  3WU0 A;  4ZYH A;  3BG3 A;  1R49 A;  1D1B A;  1OJL A;  1OIS A;  3A0B C;  1LPQ A;  2LRD A;  3M9A A;  3M8E A;  4PSX A;  2YS9 A;  4XRF A;  1ZG1 A;  2VJJ A;  2Z99 A;  5HLT A;  3OYL A;  4Y13 A;  1VQ5 I;  1S8N A;  3JCU C;  3K1N A;  2XAG A;  4DIQ A;  1MMD A;  2RNG A;  3SJM A;  2DPU A;  4PDK A;  1T56 A;  3RCO A;  1NH3 A;  1F5T A;  1T33 A;  1TP4 A;  4BAY A;  3ROU A;  3IH4 A;  2KDZ A;  1NTC A;  1OCZ H;  3HUG A;  1R1V A;  2WAQ A;  3BOQ A;  5IYB J;  2ZFU A;  4MGR A;  2V1U A;  4EMS A;  4ENM A;  1B8I A;  2E1M C;  3BR6 A;  3HRU A;  3WTZ A;  2H27 A;  4OIR F;  2R7R A;  3CMA I;  2NAZ A;  4LLN A;  3V7S A;  1U78 A;  1I3Q J;  4ZYA A;  2PG4 A;  5LEJ A;  2P5K A;  1Q1V A;  5GP9 A;  3OS1 A;  3KCC A;  5FKN A;  2Z3Y A;  1P4W A;  4W1U A;  4D0P A;  1ZYR F;  2GOX B;  1WWX A;  2OA4 A;  1OR7 C;  3GTL J;  1D5V A;  2HTJ A;  3FBI B;  1Y1V J;  2FNA A;  3GTJ J;  4U0V A;  4DYQ A;  4KA4 A;  5IP9 J;  3KIO A;  1U3E M;  5HDK A;  1JHF A;  3G2B A;  2VT2 A;  4F55 A;  2Q1Z B;  3BCA A;  2KQR A;  3JRH A;  4UV8 A;  5B1B H;  3DV8 A;  5HDN A;  2CYY A;  3O6B B;  5DS9 A;  4KN4 X;  4PJL A;  2RQP A;  4BQQ A;  4IJA A;  4Y33 A;  3RDI A;  1JUP A;  2BHZ A;  3SQN A;  4A3I J;  1TWH J;  2VBW A;  2F2E A;  1FTZ A;  1FT9 A;  2V26 A;  3OIO A;  3HIF A;  4AC0 A;  4BJT A;  4FIS A;  2KFD A;  3QOP A;  2HZD A;  3W3C A;  4EM2 A;  4XKW A;  3FK6 A;  1SD6 A;  2IS2 A;  4EJV A;  2D5V A;  1CGP A;  2AO9 A;  3DLL F;  3GFM A;  3I56 I;  1S29 A;  1ZAR A;  4I09 A;  4ON0 A;  2RDP A;  1IUF A;  2DQR A;  2IS1 A;  4E7L A;  5E3N A;  5F04 A;  4RAF A;  3AG2 H;  1O3S A;  3HOX J;  2OZ6 A;  3FMS A;  4IZZ A;  1X58 A;  1HOM A;  4RBO A;  1IGN A;  1SFX A;  2OV7 A;  4FTH A;  5LGN A;  2V9P A;  3WU1 B;  1Q1H A;  2PMZ A;  3KEY A;  4I0B A;  2F5D A;  3PUF A;  4Y3O A;  2X1C A;  4BUP A;  3O8H A;  4QPQ A;  3HRM A;  3CCM I;  4NQW B;  3FKI J;  4BY1 J;  1BJZ A;  5DDG A;  3K7A J;  2LF8 A;  3GLX A;  2H94 A;  3OY9 A;  1IRG A;  4EV0 A;  1JJ8 C;  3LOC A;  5IP7 J;  3V7R A;  5LHH A;  3CC7 I;  4JP0 A;  1HXD A;  2WV0 A;  2KIM A;  4BBR J;  2XAH A;  3LNQ A;  3P9K A;  3BTJ A;  5L3G A;  1FLI A;  2FE3 A;  4RGU A;  4MO7 A;  3WE2 A;  5FRO A;  3CJQ B;  1UHM A;  3D0S A;  3OWT A;  3PO2 J;  2L9S A;  1WJA A;  1FWZ A;  2RQQ A;  3PM1 A;  3L2U A;  5M3M J;  3ZMS A;  4L5J A;  2DFE A;  4FAS D;  2H8R A;  4DYR A;  1OYW A;  5EZH A;  3HOZ J;  2CRG A;  2WA0 A;  3M8F A;  1RKT A;  4PCQ A;  5GAG J;  1JT0 A;  3M07 A;  5FLX K;  1IN7 A;  2Z2S B;  3TP0 A;  1MH4 A;  3OOU A;  1Z6T A;  3DEE A;  3VDX A;  2QSG X;  2EFN A;  1MDM A;  4LMY A;  2HQR A;  3J81 K;  1U9N A;  2BW3 A;  1NHA A;  2ZXJ A;  3O2P E;  2L2O A;  4WXC A;  3OSF A;  1T39 A;  5J1R A;  4RAG A;  3HL2 A;  3TOB A;  1MDM B;  2K4B A;  2L7F P;  1EF4 A;  3H0G J;  4EGZ A;  2E2I J;  4L5E A;  4D5C A;  2RVC A;  2ELK A;  3C7J A;  1FZP B;  4BEH B;  1JXS A;  1S6L A;  1K7A A;  4NC7 A;  3QPL A;  1WSU A;  2JK3 A;  2Q2E B;  3H3V K;  4RA2 A;  3P7N A;  4AID A;  1QNT A;  5B3S H;  2WB1 A;  2WAQ N;  3F6V A;  3I4N J;  3W6J B;  2DDB A;  1FP2 A;  1SFE A;  2IJL A;  2YX7 A;  1MIJ A;  2LP0 A;  5E1X A;  4ZDL A;  2VPL A;  1TLH B;  2JA8 J;  4QIW N;  2XF5 A;  2VJ5 A;  4M6V A;  5HLH A;  4IL6 C;  2CQ7 A;  2BEO A;  3V8J A;  3DBL B;  2NVY J;  2XB0 X;  4UVC A;  1ERD A;  1KGS A;  2DJN A;  4C3J J;  4LG0 B;  1T0F A;  3I0T A;  3DEW A;  1Z6R A;  3PO3 J;  3H5R A;  4LLL A;  3CDL A;  3ZQ7 A;  5D5W B;  2XGC A;  4EM0 B;  1XSX A;  3R61 A;  3G73 A;  2D2W A;  4G7O F;  3Q5F A;  3VOE A;  2P5L C;  4AIJ A;  2MLK A;  2IRF G;  1SAU A;  2L0K A;  2M30 A;  1J9I A;  2PBI A;  1SC7 A;  3F9K A;  4KJZ A;  2V7F A;  4IRH A;  4L18 B;  1ONV A;  2L7K A;  2FU4 A;  3UNG C;  3EDP A;  4DW6 A;  5K1Y A;  1AU7 A;  5ICF A;  4Z2Y A;  3OYM A;  3AG4 H;  5CVU A;  2DLL A;  2RV8 A;  2QM3 A;  3CCE I;  3PNV A;  3LFU A;  4IX7 A;  2EFW A;  3KYC B;  2X51 A;  3DF8 A;  5LHI A;  3D5L A;  5KK1 A;  2EIM H;  1FBU A;  1HKS A;  5LD2 C;  9ANT A;  2DA6 A;  1D1C A;  1VQK I;  1XMK A;  2V79 A;  1VQL I;  2FQ3 A;  2EV5 A;  2XVC A;  3JTH A;  4HX4 A;  2GA2 A;  3ZOB A;  2KT0 A;  4ENJ A;  3F22 A;  2V9V A;  1YW7 A;  1J75 A;  3AG1 H;  1FOW A;  1S7A A;  2IGN A;  4UUT A;  3QYF A;  1KON A;  4HEA 2;  1IV6 A;  2OCE A;  1JUS A;  3HTS B;  1FOX A;  2K86 A;  5HS8 A;  4BQA A;  1VQN I;  1FY7 A;  3IKT A;  2A6T A;  2HI3 A;  1R58 A;  2VOO A;  1SAX A;  3R0A A;  2R7W A;  1ON2 A;  1FIP A;  4HW0 A;  2H1L A;  3OYH A;  1UMQ A;  3EUH C;  3ZQH A;  2JN6 A;  5B66 C;  4L5I A;  3HOS A;  4M71 A;  1ZTR A;  2LG4 A;  3H9Q A;  3JAM K;  1K83 J;  4XRS A;  2DN0 A;  5F0F A;  2DOD A;  3OYC A;  2DU9 A;  2E1O A;  1CF7 B;  2YX4 A;  2QSF X;  2K40 A;  5J8C A;  1BL0 A;  1OCT C;  2Z33 A;  5FFX A;  4YII A;  3VOD A;  1FPQ A;  1Y8Q B;  1M1E B;  2JPB A;  3GTQ J;  2M9H A;  4AWX B;  1ZLK A;  1XDS A;  3ZMT A;  2CO5 A;  1R1U A;  5AON A;  2KJB A;  2WWY A;  1RES A;  2LF7 A;  4LFU A;  2DFF A;  1KU7 A;  2GQQ A;  3B02 A;  2DOE A;  1IRZ A;  4KNY A;  3I55 I;  1IXS B;  3BWG A;  5FKK A;  4J19 A;  3ZRG A;  2NOG A;  2QCO A;  2A07 F;  3QP5 A;  4M6Y A;  4JOM A;  1HLV A;  1Z1D A;  3J7A Y;  1H88 C;  2JUC A;  1T98 A;  1FOY A;  3MZY A;  4GYG A;  2EV0 A;  1RIO H;  2DFH A;  1D8J A;  2DA5 A;  4XSZ F;  3BQY A;  1W36 C;  4D5F A;  4N4O B;  1K6Y A;  4XKV A;  5H6R A;  2W48 A;  3RKQ A;  1I1G A;  2FML A;  4II3 A;  5FGM A;  4QLC U;  2CGP A;  2BY0 A;  2CWE A;  2N8G A;  5CJ9 A;  4WX9 A;  3KFW X;  2CFO A;  3CF2 A;  2VE9 A;  1RR8 C;  1F43 A;  2F5V A;  3SFI A;  3CMM A;  1MGT A;  1I3A A;  2EJR A;  2Z1D A;  4I2O A;  4J00 A;  5KHD A;  5M5W J;  1IC8 A;  3REO A;  3S1Q J;  1YX3 A;  2R7F A;  5BQT A;  4IQJ A;  3S14 J;  3M7G A;  2VXZ A;  4DQ2 A;  4NNJ A;  4HLY A;  5L3E A;  4BXX J;  4HA8 A;  2R92 J;  2CMP A;  3G1O A;  1SVL A;  3ZN0 A;  3ZR8 X;  2E2J J;  3RPU D;  2PI0 A;  1IN4 A;  1WFX A;  4MNU A;  3IH3 A;  1DPR A;  1TT0 A;  3ZGK A;  4E70 A;  1MNM C;  5E1Z B;  2E7X A;  1RET A;  3KP5 A;  1T0F C;  3T8T A;  2XAF A;  4UUV A;  1VQM I;  2W85 A;  2IP2 A;  3WTT C;  2XSJ C;  3S32 A;  3EUK L;  2L4A A;  2Z9O A;  2R7Q A;  3HOU J;  2EIN H;  1W36 D;  4ZYG A;  1KQ9 A;  3TKY A;  2DMP A;  4E7I A;  2LC2 A;  5DCF A;  4CYD A;  2FOK A;  5KCM A;  4CH7 A;  1XC5 A;  2P7V B;  1XG1 A;  1Z67 A;  2Y69 H;  4PJJ A;  3S2W A;  2HQ5 A;  2BYV E;  1SVM A;  2I10 A;  5HLG A;  1N25 A;  3J80 K;  3E3V A;  1D0X A;  2X6X A;  4A0Y A;  2XUB A;  1X4O A;  2HR3 A;  2OZU A;  3RQI A;  4A3E J;  2M87 A;  5L3D A;  2YU3 A;  2LY2 A;  1QZE A;  4MHG A;  1IZ1 A;  2OPT A;  4QSH A;  1RRJ A;  3WTY C;  1SD5 A;  1D5Y A;  2QGU A;  5ICC A;  3FM5 A;  3Q0U A;  4S05 A;  3BZC A;  3IP4 B;  4Y15 A;  4HDU A;  3GTK J;  2KL4 A;  1R7J A;  4UXN A;  1QO0 D;  4HG2 A;  3C2B A;  4HQE A;  3KZI C;  3ZMU A;  2ESN A;  3CD6 I;  2QLZ A;  3BPX A;  3LSM A;  4PUS A;  1BW5 A;  4LIT A;  3TO9 A;  2DT6 A;  2LKS A;  3P9I A;  3E5X A;  1K6O A;  4M9S A;  1XGO A;  3M1E A;  5GTH C;  1BI3 A;  1R5I D;  3PSF A;  3GTP J;  1FSE A;  2W25 A;  2EZK A;  2P8T A;  3PFY A;  4HPQ A;  3EYI A;  3HSR A;  2EH3 A;  4HST A;  4MQ9 F;  1LQ1 A;  2D45 A;  2P7C B;  1G3Y A;  2WAD A;  3FHZ A;  2JTV A;  2LK2 A;  1VF9 A;  4LLG F;  1VQ4 I;  4A2U A;  3GYH X;  2CV1 A;  4RGX A;  2QEN A;  3LSJ A;  2VXD A;  4UVA A;  2IEK A;  5FRN A;  2OBP A;  4XSX F;  3VWB A;  3W6K B;  4EJW A;  2KHM A;  1OCO H;  4F52 A;  1O7L A;  4M3E A;  4PJ0 C;  4P1W A;  1HW1 A;  4PK4 A;  4A12 A;  3CF5 F;  2OAZ A;  3JAM Z;  5JFR A;  2CH0 A;  1XGM A;  4H4K C;  1RNL A;  3O8G A;  1O7F A;  2LY9 A;  1UJ8 A;  4KIF A;  4PGG A;  2DMU A;  2HKO A;  2L54 A;  4ENN A;  4IOA F;  1QZY A;  2BOL A;  4BY7 J;  4IXA A;  1X1C A;  1OCR H;  2FSW A;  3TW6 A;  5HOO A;  2ESH A;  4DOZ A;  5FB2 A;  5HNH A;  2ID3 A;  1MMN A;  1OYI A;  1PUF A;  2FBK A;  3MQ0 A;  4NQW A;  3F21 A;  2KZV A;  4I01 A;  3HGG A;  4DNC A;  4LK1 F;  4E7H A;  2LLK A;  3OYJ A;  2ZJR F;  2PQ8 A;  3S93 A;  1K4T A;  3U2R A;  2JT1 A;  2D1V A;  2F6C A;  1I1S A;  2BVM A;  3TDZ C;  1BR1 A;  3LQQ A;  3PNT A;  1UEL B;  2GIV A;  3QWL A;  2GXA A;  4L0Z B;  1E3O C;  2A6E F;  5A2Q K;  3ELK A;  3KZZ A;  2ZSI B;  5E3O A;  2NNN A;  3CCL I;  2NVQ J;  4A3J J;  3CDI A;  2ETH A;  2GM4 A;  2K9M A;  4ASN A;  3A01 A;  3I59 A;  4FET A;  3K10 A;  3WHB A;  1A6Q A;  3QYB A;  2LH9 A;  4BGD A;  2VUM J;  4BBS J;  1JKP C;  3K2Z A;  4XIC A;  3CCU I;  3K0L A;  1YS6 A;  4OWR B;  3GBG A;  3P9C A;  1LVK A;  2LR8 A;  2XAU A;  1JTX A;  3E1S A;  1QPI A;  2JQ7 A;  2L9R A;  4KMF A;  4OIN F;  1X4P A;  1AKH A;  5JVT A;  5KVR A;  1UG0 A;  2A69 F;  2RNJ A;  2KKO A;  4HZF A;  2VN2 A;  2A05 A;  2XAJ A;  3K4N A;  1STZ A;  3M1C A;  3OR1 C;  2L7Z A;  3H5A A;  2JRT A;  3CQZ J;  1LEA A;  2AQE A;  1BM9 A;  3H0D A;  3AL0 C;  2JVG A;  1N78 A;  1MBK A;  1G6N A;  3BR1 A;  1Z91 A;  4BYY A;  4XOR A;  2KZG A;  1G8X A;  3KE2 A;  2K27 A;  1U5T B;  4KYW A;  1QGP A;  4Q47 A;  3JRB A;  3BT9 A;  3R6S A;  4RMN A;  4M6X A;  3DPU A;  2QQ8 A;  1ETQ A;  3IUO A;  3W2W A;  2FBI A;  4IHY A;  1PUF B;  4U87 A;  3S2D J;  3FMQ A;  4LG0 A;  2MAB A;  4YFN F;  4C30 A;  4Y7N J;  4EJU A;  1O3T A;  2CV0 A;  2M7A A;  4B8X A;  1KU9 A;  3FDY A;  3WGG A;  3M3Y J;  1JKR C;  2A6H F;  2P6T A;  2A68 F;  3PNY A;  2DTZ A;  2YR2 A;  3MCZ A;  1H9G A;  3CLQ A;  5M3F J;  5FJ8 J;  2E1C A;  3DTE A;  3GEZ A;  1JHH A;  2V9K A;  3LSP A;  2ZME A;  3BPV A;  4G7H F;  4A3B J;  1ZAO A;  3BP8 A;  1IDZ A;  2M4G A;  3FF5 A;  4YEL A;  1EKE A;  3TOA A;  3OV8 A;  4YRV A;  1VQ8 I;  1BR2 A;  2COB A;  2ELJ A;  1J5Y A;  4A3D J;  2FD5 A;  1U5T C;  4IHS A;  3ZXS A;  2QUF A;  2VJI A;  1J2X A;  5EGO A;  4QPO A;  3C18 A;  2R93 J;  5ICE A;  3DFG A;  1T38 A;  4A0Z A;  4L9J A;  5EEH A;  2IS6 A;  3WGH A;  3KPH A;  2PN6 A;  1VI0 A;  3JRE A;  5LFA A;  1TC3 C;  1MD0 A;  5LRS A;  1IN5 A;  5J1Y A;  2HYG D;  4ZZD A;  2ISY A;  1GVJ A;  2CU7 A;  3R4K A;  1HDP A;  3I53 A;  2STT A;  1MBE A;  2IW5 A;  4FT8 A;  1W7P D;  3FXU A;  2X1D A;  5E79 C;  3IAM 2;  4LG3 A;  1OLT A;  1ZQ3 P;  1MSF C;  3F8C A;  4HV5 A;  1Z9C A;  1WZ2 A;  1HQC A;  3ONQ A;  4BHP A;  3ERM A;  5C4X J;  5FD5 A;  2RRE A;  3OYF A;  1VQ9 I;  5BMZ A;  4ZTJ A;  2LFB A;  2JRM A;  1DGR M;  1KQ0 A;  4PJM A;  1IXR C;  2Y75 A;  4F92 B;  1FYL A;  1X3U A;  1WKM A;  4CGZ A;  1TQP A;  4PFO A;  1B1B A;  3FIW A;  5DV5 A;  2F5E A;  4B09 A;  2ZBK A;  2C6Y A;  3S17 J;  1A04 A;  2KJC A;  3DBR B;  1YYV A;  1SMY F;  1R4M B;  2KLO A;  2M0M A;  5DYM A;  5FLX Z;  3H1C A;  5LBQ A;  2OQG A;  5TGT A;  2OQR A;  5K7Z A;  4MIM A;  4RB3 C;  2YUS A;  1VQO I;  4FE7 A;  2VL8 A;  3F72 A;  3QRF F;  2PX9 A;  5K5O A;  1T08 B;  2ZME B;  2GIZ A;  3ZQG A;  4BJ6 C;  3I9V 2;  2O5R A;  5HLI A;  3FWE A;  5LHG A;  5BNG A;  3RZO J;  4ETS A;  3R60 A;  3N4M A;  1B8I B;  3K4C A;  1W5C C;  2CW8 A;  1WJD A;  3C2H A;  4J01 A;  1XDU A;  2A5Y B;  2VJ4 A;  5IPA A;  3GFL A;  4ZC3 A;  1FYK A;  2UXN A;  1TBX A;  1UST A;  2UUZ A;  3CJN A;  3PL8 A;  3JRI A;  3K4J A;  3VPR A;  1I6H J;  2MD5 A;  4PJN A;  1J0R A;  2FOW A;  3H5N A;  3LSR A;  4OIQ F;  5DCM A;  3FXJ A;  3HXL A;  3V42 A;  2ACJ A;  2HKX A;  2QQB A;  3I64 A;  3OS2 A;  3QYE A;  1WVR A;  3F3X A;  5E8G A;  4FX0 A;  4U7D A;  3B73 A;  4ESF A;  4NHJ A;  1HF0 A;  5GAD J;  5LEK A;  3ZQL A;  3KP7 A;  4A6D A;  1IN6 A;  2CW7 A;  5JHF A;  2V6C A;  5CPR B;  3LAJ A;  3R0J A;  1VQ7 I;  3S1N J;  4A3L J;  4GCV A;  1S7O A;  5ICG A;  2DA1 A;  1ZG5 A;  1PYV A;  3QPT A;  4P9F A;  3BDD A;  3CUQ A;  1ETK A;  2HPI A;  2XPV A;  5J4V A;  3GFJ A;  2E5Z A;  2QBY B;  2VC0 A;  1TWC J;  2AQF A;  5IP6 A;  4CXF A;  4EEF G;  4C2T A;  1VQ6 I;  3W2A A;  2IA2 A;  4YG2 F;  2PMZ N;  4HNU A;  4KDP A;  3MN2 A;  1ZRC A;  2CUE A;  1YRN A;  1SAN A;  4XMY A;  2RN7 A;  1FNN A;  4CCO A;  2L4M A;  3F6O A;  4ABZ A;  4NB5 A;  3A03 A;  5J6X A;  5ERI A;  4XLH A;  4G6Q A;  3HOW J;  1MBG A;  1YE9 A;  2AHQ A;  4EGY A;  1UG2 A;  4IKF A;  3DLA A;  2X6Y A;  3MVP A;  5CVJ A;  3SDB A;  4XN0 A;  5F08 A;  3OS0 A;  4A3F J;  4ZZL A;  4XOT A;  1PJR A;  1TZL A;  5FFZ A;  1FEX A;  3AKZ A;  2HPM A;  1ZRF A;  1OFC X;  4CA0 A;  3HEF A;  2BXZ A;  5CVR A;  4RS8 A;  1QA6 A;  3G4S I;  4F91 B;  5JVG F;  3PFI A;  3K2A A;  2IBD A;  4CYC B;  2XV4 S;  4XLE A;  3CCV I;  3I58 A;  3BJ6 A;  4N0B A;  4RGR A;  1WJF A;  2JUG A;  1BJA A;  3EYY A;  1DU6 A;  2XIG A;  5D4S A;  2CQX A;  3B6C A;  3JRG A;  4KIB A;  4F93 B;  4EQQ A;  4D7M A;  5IOZ A;  1DGW Y;  3NQO A;  3V4G A;  5LGT A;  3W2V A;  4E7Z A;  5K7F A;  2EFO A;  3FK7 A;  3IRQ A;  4OOI A;  1JE8 A;  2CS3 A;  3HRS A;  1ETV A;  4B48 A;  3ULQ B;  1J09 A;  1CQT A;  2PMH A;  2XRO A;  3T1B A;  1Y56 A;  2M3A A;  1ZRD A;  2DMQ A;  5JLW A;  2E2H J;  4XLN F;  2JA6 J;  1H8A C;  1ETW A;  1AWC A;  2ZJP F;  2BY3 A;  1WJ5 A;  5IOY A;  4XBF A;  1XTA A;  1EA3 A;  1ITY A;  3COA C;  3K1M A;  1IG7 A;  3MZ8 A;  4BL0 B;  2JZY A;  1E17 A;  4E6K G;  2F4O B;  3DU5 A;  5F0H A;  1HW5 A;  3FX3 A;  2L3D A;  3VYU B;  1OMI A;  4GDF A;  3BTI A;  2Z16 A;  1W7P A;  3CUO A;  2P0W A;  3L2V A;  2FA5 A;  2CUJ A;  3OYB A;  3VSK A;  5ILU A;  1LJ9 A;  3GXO A;  2DYR H;  3QU3 A;  3QU6 A;  3MKW B;  2H6C A;  2JVH A;  1NK2 P;  3CLO A;  2X48 A;  2MC3 A;  2XPW A;  1UHW A;  5M5Y J;  2VPR A;  5TRD A;  1BIB A;  2PEX A;  2VT3 A;  3VSL A;  1TQI A;  2R4G A;  1WJB A;  1B4A A;  1LEB A;  1FP1 D;  4U0W A;  5EG0 A;  2LD5 A;  1X1B A;  4MFD A;  4LB5 A;  1WGX A;  2XAQ A;  4XQF A;  3IV5 A;  1XD7 A;  2R5Z B;  4AVZ A;  5EG0 B;  2O03 A;  2K9S A;  2AXL A;  2KP6 A;  2VKV A;  4KIG A;  5AIP A;  4EJT A;  4BJ5 C;  3BR0 A;  4IVN A;  5EDN A;  3DTK A;  3FXL A;  2EA4 A;  4BXU A;  4XRM A;  2FUG 2;  4RB2 C;  3FXR A;  3GZ6 A;  1YX5 A;  4HRI A;  3SFZ A;  3JSO A;  2O61 A;  3NWS A;  3SXY A;  1W7P B;  5H2F C;  5BOX A;  1BC8 C;  3MKZ A;  4FHT A;  5GPA A;  2XRL A;  2X85 A;  3FKJ A;  4X6A J;  2ZKZ A;  2HTS A;  1GV5 A;  2QWW A;  5D6E A;  1P4A A;  4XR6 A;  1JT6 A;  4JBA A;  2K7L A;  1T95 A;  4AIH A;  1UAA A;  3I71 A;  2VOP A;  3O3K A;  4C2M J;  3E5Q A;  4CCM A;  5LRR A;  1LVA A;  4BHC A;  1RI7 A;  2LSO A;  2X9D A;  3EPZ A;  2OC6 A;  3KEQ A;  2IPQ X;  3WTU C;  3E6D A;  3BCB A;  3TW7 A;  3HKZ N;  3WGI A;  2HOA A;  3FHN A;  5J4Y A;  4HNV A;  4HNT A;  2MGQ A;  2XF7 A;  1USS A;  2DW4 A;  2EA2 A;  1Y1W J;  1SD4 A;  3MFK A;  3BZK A;  3QP6 A;  3BR3 A;  4FX4 A;  2DQL A;  4A0X A;  2DA2 A;  2O8X A;  2VQC A;  4ESB A;  1SEU A;  3U21 A;  1WJC A;  1E3H A;  2CV2 A;  3TO6 A;  1HST A;  1OPC A;  4U0Y A;  1MMG A;  1XSV A;  2V4J C;  5J8F A;  1AA7 A;  4OU0 A;  5K7H A;  3HDD A;  4XL9 A;  1PUE E;  2RKH A;  4P55 A;  3DPL C;  1PP8 F;  4P5O A;  3S16 J;  2M8G X;  3CP8 A;  1G59 A;  2RGV A;  1BR4 A;  4DJA A;  4BE0 A;  2RC4 A;  2I5U A;  2M7B A;  3CP2 A;  3DKX A;  2M45 A;  3V8K A;  1DDN A;  2W00 A;  2A3S A;  2K5C A;  3AFH A;  4NC6 A;  3IC7 A;  5EGO B;  3ZMV A;  3K70 C;  1YLF A;  1RUO A;  5D6F A;  1KYZ A;  3HKZ A;  1WQ2 A;  1BW6 A;  2E36 A;  3RKX A;  5D5X B;  4WXD A;  4OAY A;  4BE2 A;  4DGW B;  4Z6Y A;  4UVB A;  2F5C A;  1U9O A;  3MD2 A;  2Q2E A;  2R5Y A;  2DA7 A;  3FXM A;  4HF2 A;  2ZB9 A;  4RLF A;  2M8E A;  3S15 J;  4A5N A;  4ZYE A;  4B43 A;  3TO7 A;  5EZG A;  2KIF A;  1MJB A;  2OJE D;  3JRD A;  5LLQ A;  2VQG A;  2XF6 A;  3RIR A;  3ZMZ A;  2GBY A;  5CLS A;  2Y0S N;  4CCN A;  5F64 A;  4I6Z A;  2H09 A;  5CQG A;  2DJI A;  3OYI A;  1JI8 A;  3LWF A;  3I4P A;  1W4M A;  4WF2 A;  2CQN A;  2AS5 F;  4OIP F;  4HBL A;  2Y31 A;  1FOK A;  1W1W E;  1QVU A;  5B5E C;  2HGC A;  4P96 A;  3OYG A;  1I39 A;  4U7B A;  1OYY A;  1EH7 A;  4BS9 A;  3GTG J;  3ML6 A;  1KU2 A;  3LL7 A;  5H20 A;  3BTL A;  3L09 A;  1RZ4 A;  4UB8 C;  1XCV A;  4GO1 A;  3DWL E;  3RTR A;  3OIP A;  1QQI A;  3SZG A;  2L02 A;  5DEQ A;  1OR7 A;  3GUD A;  1B9N A;  2JWT A;  3GO5 A;  3U1D A;  3BQZ A;  4F3Q A;  1JJ6 C;  4GGG A;  1TW2 A;  1XGN A;  5HS7 A;  1WCM J;  4V2F A;  1XGS A;  3RYP A;  4XNF A;  3W6V A;  3H9G A;  1HDD C;  1K79 A;  3EUH A;  4ZDO A;  3A4C A;  2CFX A;  2H8W A;  2MSY A;  3CCJ I;  3CCS I;  4JQF A;  1ZGW A;  2GLO A;  2OF7 A;  3RZD J;  1OQY A;  2M2E A;  3CZ6 A;  1I5Z A;  1S7E A;  2Y0S A;  2EFQ A;  3S1R J;  1SVO A;  1ETX A;  1ZG3 A;  3EQL F;  3HSE A;  3K4L A;  4RAY A;  4XLA A;  4A3K J;  2NVX J;  3VB2 A;  1IUY A;  1OKR A;  1R22 A;  5CKT A;  3TDU C;  1FSH A;  3CCY A;  1ZLJ A;  2KRF A;  4ZH4 F;  5IT3 A;  5D5U B;  2CSO A;  1YOV B;  4JYK A;  4H0E A;  2E35 A;  3ZP5 A;  4HX8 A;  4EAT A;  5BPD A;  1J7K A;  1T6S A;  3ZPL A;  4KFC A;  3GTO J;  1LFU P;  2FMY A;  1K4S A;  1U8B A;  2IGO A;  2STW A;  1QPM A;  5JI6 A;  1R1T A;  3J7A O;  2ZNY A;  2V1D A;  2KIS A;  3AL0 B;  2A61 A;  2VQL A;  3RJP A;  4YFX F;  2LKX A;  2MD0 A;  1W0U A;  3ABU A;  2VBY A;  1YQA A;  5J3L A;  2CQQ A;  2P81 A;  3JSP A;  2B7E A;  2K02 A;  1TWG J;  1GT0 C;  3B6A A;  1ZN2 A;  3IL2 A;  5EYR A;  1X19 A;  2QKM B;  3KET A;  3GF2 A;  3HUG B;  1TWA J;  2XC7 A;  1W5T A;  2FBH A;  4P9U A;  3NWT A;  2DA3 A;  3ABK H;  2VON A;  2ZC2 A;  2Q0O A;  3I5U A;  3J80 Z;  3IH2 A;  3L2Q A;  3CC2 I;  4MLO A;  1BI2 A;  2EV6 A;  2WV1 A;  2HOE A;  2VKH A;  3H9J A;  1FC3 A;  3DU6 A;  4D1Q A;  1IXC A;  2R7X A;  3FIS A;  3F0C A;  3RQ4 A;  5DUK A;  3WTX C;  1I50 J;  1ETY A;  3K1P A;  5FD6 A;  3C3W A;  3QOD A;  4IEJ A;  5JLX A;  2HFH A;  4A5M A;  1WH7 A;  2FQ4 A;  1EH8 A;  3Q0V A;  4E4H A;  3PUB A;  1Z21 A;  2P4W A;  1F36 A;  2JMW A;  2BY2 A;  2VI6 A;  1X2M A;  2KIQ A;  2W84 A;  4HX7 A;  3CMY A;  1O57 A;  1FJL A;  3BRO A;  1P9Q C;  3PSI A;  2X0L A;  2QVO A;  2LRE A;  2JA7 J;  1MMS A;  2DK5 A;  3H3Z A;  3UKG A;  2KDO A;  1HCR A;  5HDG A;  2VB6 A;  4GRI A;  1MBH A;  3DTI A;  3Q9S A;  1QZZ A;  3HBL A;  4HQM A;  2F4I A;  2WTE A;  4D9J A;  3S3O A;  3K4M A;  2PLY A;  2PJR A;  3KX2 A;  4WWC A;  2V6E A;  4NDL A;  3MWM A;  4QTR A;  4XON A;  3RPQ A;  4BDY A;  2QYO A;  1H89 C;  1ON1 A;  1C0W A;  2HYJ A;  1B6A A;  4MTE A;  2EK5 A;  3U1K A;  3ABL H;  3L2W A;  4R1H A;  2JSC A;  2MFZ A;  3OYD A;  3K70 D;  3CTA A;  2VLA A;  4XM3 A;  1VND A;  3QOE A;  2KPM A;  5HNF A;  2VBZ A;  3BG7 A;  1AOY A;  1X1A A;  3HJE A;  3SDG A;  3TGN A;  2HQA A;  4B47 A;  3A0H C;  2R7S A;  2E5N A;  4KUM A;  3CME I;  2E1N A;  3LAP A;  3H92 A;  3C2G A;  4KT5 C;  4A3C J;  2K9Q A;  1LFP A;  2HXI A;  2W82 A;  2Y0M A;  3SEZ A;  3GX4 X;  4MEY F;  1GHC A;  4PGH A;  4B1R A;  4JX5 A;  1Z7L A;  1BOA A;  2DK8 A;  2EFP A;  3NAR A;  3ECH A;  2X6O A;  1WI9 A;  3KZY A;  2MBF A;  1G3S A;  1JGG A;  3LQR A;  3JRA A;  1XMA A;  3L00 A;  4JX6 A;  4OMZ A;  2H1K A;  3GW2 A;  1X1D A;  4UUS B;  1B9M A;  2MH2 A;  2E7W A;  2EIK H;  2YPR A;  5AIQ A;  1QU3 A;  5KAF C;  1V55 H;  2MLG A;  2V1N A;  5BPI A;  3F8M A;  3G6E I;  2ECC A;  1IAW A;  2WAE A;  1SMT A;  3KLN A;  4RM2 A;  4A6E A;  1YFH A;  1GXQ A;  1QHH D;  1XPX A;  2R7Z J;  5E17 F;  4I02 A;  2ZCW A;  4DYC A;  1GLN A;  3HPG A;  1LFB A;  4CHU A;  3HZJ A;  2LYC A;  1L3L A;  3KP2 A;  1G3W A;  1XCB A;  2VKD A;  2UZK A;  5FO5 A;  3SEQ A;  3J7Y J;  1JGS A;  3F8F A;  4RLQ A;  5CYV A;  4YIR X;  4ESJ A;  1YJW I;  3QQA A;  2K9N A;  1B59 A;  4ANJ A;  1TL8 A;  5C3E J;  4CCJ A;  4LB6 B;  3E6M A;  2HDW A;  2VAS A;  2KRH A;  4E7J A;  1W5S A;  3H36 A;  4IOC F;  5TJJ A;  3E0J B;  4I98 B;  4Y4R A;  4YFK F;  4CZC A;  3HOY J;  3K4B A;  1BBY A;  4IF4 A;  3SHF A;  1KU3 A;  1HKQ A;  4I99 C;  4HF1 A;  5EF6 A;  1O4X A;  1V5E A;  4BEH A;  4UUS A;  3WHC A;  1POG A;  1R4N B;  4WCG A;  3JTG A;  4BKX A;  3G1M A;  1LUJ B;  4F7Z A;  3HSF A;  4A3G J;  1VQP I;  1YS7 A;  2O6G E;  1AKH B;  1XB4 A;  2QQ9 A;  3CJT B;  4HLX A;  4DZJ A;  5B1A H;  1P4X A;  2QF7 A;  1TTY A;  1EH6 A;  4JK1 X;  1BC7 C;  1WI3 A;  1UB9 A;  5FLM J;  1P6R A;  1APL C;  2ECB A;  2L01 A;  4XKB A;  1F9N A;  2R7D A;  4I76 A;  1MKM A;  1SFK A;  4HAM A;  5L3F A;  1OCC H;  2QKL B;  2HNH A;  2IGM A;  3ISP A;  3PQJ A;  3IHU A;  1AHD P;  3I4M J;  2K85 A;  1MSE C;  1D1A A;  2EBI A;  1YG2 A;  2QEX I;  1IV8 A;  2XRN A;  2AXT C;  2DOA A;  1ZRE A;  5DD4 A;  5E8I A;  1JKQ C;  3PJR A;  3OSG A;  3FZV A;  5L3C A;  2UV1 A;  4AIK A;  2A5W A;  2WY7 Q;  2O9L A;  1YW8 A;  3P5J A;  3U9G A;  2E71 A;  3AAF A;  2DOF A;  2GXB A;  2Y9Z A;  3DCF A;  5FKL A;  1FYM A;  3S3M A;  1KA8 A;  3I59 B;  1QVT A;  5E3M A;  4UV9 A;  3DBH B;  4MFE A;  2DDA A;  3HHH A;  1SD7 A;  1IRF A;  1MJ9 A;  3DKY A;  3N05 A;  1Z3Y A;  1ODD A;  3QPS A;  1UZC A;  1GXP A;  4BQN A;  1XN7 A;  3GLL A;  4OAZ A;  2ZXI A;  2KRC A;  4G8X A;  1ZGJ A;  2LVS A;  1V54 H;  2ID6 A;  3GCM A;  3SYT A;  1ZGA A;  2HVQ A;  1F1Z A;  2O0Y A;  3LSG A;  2MG4 A;  3TL4 X;  2G9W A;  5IYC J;  2Q8K A;  1YIJ I;  2F48 A;  3ESW B;  2WBM A;  2WAF A;  3Q0W A;  2FEZ A;  2PJP A;  4BDZ A;  1X3W B;  4C3I J;  2R7V A;  2ME6 A;  5A2Q Z;  4K2E A;  2V1X A;  2DA4 A;  2VE8 A;  2DPD A;  3GWZ A;  2HS5 A;  3BLY A;  3KEO A;  3ZQQ A;  4NUB A;  2EQR A;  4RDU A;  3WG7 H;  2BBY A;  4IRG A;  4AM3 A;  4XID A;  3GVA A;  4M9X A;  4X1E A;  2M0C A;  3HYI A;  3AG3 H;  1NK3 P;  2XKO A;  1YHQ I;  4A69 C;  5FLV A;  2HVS A;  4O3M A;  4RGS A;  3KP4 A;  5FKO A;  3V7C A;  3X2Q H;  2UWM A;  2EZI A;  3OMY A;  1A35 A;  3WU2 C;  1FTT A;  3CDH A;  1G3T A;  2GAU A;  1GDT A;  2OTL I;  3A2K A;  3OL3 A;  4M73 A;  3MAJ A;  4CO8 A;  5D8L B;  2K3F A;  1H0M A;  4N4N B;  4B44 A;  4G9Y A;  5F1R A;  1WRJ A;  2MH9 A;  4M3D A;  2PMU A;  5CVV A;  5D5V B;  3UR3 C;  2NNY A;  5EEA A;  1V4R A;  2QQA A;  1RR7 A;  1A6I A;  1XMX A;  1I27 A;  1S72 I;  2OCC H;  1SFU A;  3CCR I;  1OCP A;  4LOC A;  4V19 K;  3MKL A;  1FIA A;  1R5H A;  1YJ9 I;  5GAE J;  1WH5 A;  4CSW A;  4AYB A;  3S3N A;  3ZN1 A;  1ULY A;  1DPU A;  1E0E A;  2ZO4 A;  3L2C A;  1QHG A;  2QSH X;  4CIC A;  1K61 A;  2LY1 A;  3H3U A;  3QAH A;  3VEP A;  4KT6 A;  1XSD A;  1MW7 A;  3C1D A;  2ADU A;  3ZMD A;  2LOO A;  4Y17 A;  5HOD A;  1HBX G;  1CF7 A;  4CUG A;  2HZT A;  5DD8 A;  3OYK A;  3M4O J;  3KLO A;  4IO9 F;  2RAE A;  3CES A;  3G1L A;  2Y30 A;  1IN8 A;  1Y39 A;  1U6G A;  1R23 A;  1LNW A;  1RPW A;  2DBB A;  5CVI A;  5ILS A;  4RB1 A;  2B9S A;  4RB0 A;  5HVQ C;  1A36 A;  4XN3 A;  3LST A;  3KYL A;  4BE1 A;  3ZCO A;  4Y52 J;  3HB9 A;  1D0Z A;  4OIO F;  1TNT A;  1DUX C;  3CUQ B;  3T8R A;  1G4D A;  2DAO A;  1TT5 B;  1Y6I A;  2D1H A;  1YTY A;  1YI2 I;  4U88 A;  2NVU B;  3S8P A;  3E6C C;  2NYX A;  3JR9 A;  2HYF A;  2F5F A;  2TCT A;  2EZL A;  3L1P A;  3J7Z I;  4UY8 I;  1E3P A;  2VOD A;  3OYN A;  3RPU A;  4O6J A;  2ISZ A;  2DMT A;  1MJA A;  2GXG A;  3WE3 A;  4EM1 A;  2TDX A;  1YRN B;  4L0Y B;  5E18 F;  1E2X A;  3DKW A;  2O3F A;  2R7T A;  2LDU A;  1K78 B;  2Y2Z A;  1HC8 A;  4KIT B;  5GAH J;  3TP3 A;  5K5R A;  1T8I A;  3GME A;  3WTS C;  4AUX A;  2E34 A;  3E5U A;  4M3B A;  5HS9 A;  3T0Y A;  3LFK A;  4CCK A;  4S04 A;  2CQK A;  4GXO A;  4Q48 A;  1Z7U A;  1ZKG A;  4LIU A;  3TBI A;  1H9T A;  3DQV C;  1XX5 A;  1ZH5 A;  2GA1 A;  1YIO A;  3HHG A;  4HF0 A;  1T2K A;  4DZP A;  1R71 A;  2FJ1 A;  3EET A;  3LSI A;  2WY8 Q;  3BG6 A;  4CYC A;  1D8K A;  2DFI A;  4MTD A;  3EUA A;  4M72 A;  2BXY A;  4ENK A;  4XLP F;  5IY5 H;  4UNO A;  1GVD A;  1R36 A;  2JJ7 A;  1O3Q A;  2K9L A;  1VZ0 A;  3HM5 A;  4G94 A;  1G2H A;  2YSR A;  3BTC A;  3ECO A;  4XRS G;  4DBR A;  4BXF A;  2H6B A;  1YJN I;  1BOB A;  3OYE A;  2HU9 A;  1IF1 A;  2NOJ B;  1W0T A;  2P6S A;  4LIV A;  3BR2 A;  3CC4 I;  3L2R A;  2ZJQ F;  4LK0 F;  3SZP A;  5F6F A;  4IHT A;  4IQ4 A;  5ED4 A;  3BG5 A;  2ZFW A;  1BI1 A;  3BJO A;  5IT9 K;  4RM3 A;  4HOB A;  2EB7 A;  1VTN C;  2HVR A;  1MNE A;  2ME0 A;  1N77 A;  4ZYD A;  1ORK A;  5JHU A;  1MND A;  1S9H A;  3TED A;  5J47 A;  3WTV C;  1LKX A;  2J5P A;  5KAI C;  1PDN C;  2DT7 B;  2B63 J;  4IHX A;  4TV7 A;  4PZJ A;  5GPC A;  2IA1 A;  4QWQ A;  1PVE A;  4O5V A;  1PP7 U;  4BAC A;  1K78 A;  2NS0 A;  1P2F A;  2P5V A;  2PFB A;  3HRT A;  2IS4 A;  5F27 A;  2GOM A;  5FKM A;  3BZ6 A;  1IJW C;  1P7J A;  1U0J A;  2OD5 A;  1KZH A;  5E20 A;  2IAI A;  2IVM A;  3E6B A;  4FQG A;  3JRC A;  2DXI A;  1UHS A;  1ZR4 A;  4G6D A;  2MYS A;  1A5J A;  1JUM A;  1X3Z B;  3HTU A;  4AVP A;  4WK8 F;  4BU2 A;  4M9Z A;  4ZTF A;  4LGW A;  3HOV J;  1Y8R B;  2LKP A;  2ZME C;  2ZNZ A;  2XB5 A;  3LSH A;  2CUF A;  5DM6 F;  4RAZ A;  2XGX A;  2EIL H;  2Z5U A;  2EPF A;  3BR5 A;  3DPT A;  2OUM A;  2W57 A;  1J59 A;  2NS8 A;  6PAX A;  2DCE A;  4A93 J;  1Z05 A;  4IPA A;  4I7H A;  1HSJ A;  2BGC A;  2HWV A;  2JPC A;  4E7K A;  3VYR B;  1X2N A;  4ITV A;  1NG7 A;  5J1U A;  3TMO A;  2MW8 A;  1V5G A;  1I6X A;  2DMN A;  3IWF A;  2JA2 A;  3DEU A;  2ZXW H;  5C44 J;  2L7M P;  2R5Z A;  2G7U A;  3F8N A;  3MMY B;  3MKY B;  3JRF A;  1LDJ A;  2W7N A;  4LD5 A;  3K4K A;  2CW0 F;  2M1B A;  4FCY A;  3BJA A;  3IRR A;  4B4C A;  1VFC A;  2R7U A;  3HG9 A;  2BHY A;  3FXQ A;  3BC8 A;  5ILV A;  2IT0 A;  3PIO F;  2L9N A;  5IT9 Z;  2VQH A;  3D1N I;  4IRI A;  3A02 A;  1IW7 F;  1ZK8 A;  1GUU A;  4XOP A;  2OTJ I;  5E3L A;  2CJJ A;  2DTR A;  3ASO H;  3GTM J;  4IHV A;  4II2 A;  2FF4 A;  1REP C;  3E97 A;  4N9H A;  2EIJ H;  4NC8 A;  1YO5 C;  1MH3 A;  3ZQI A;  2HOT A;  2X6W A;  1QBJ A;  2OU2 A;  3VYT B;  2M34 A;  2X1E A;  3BY6 A;  1QRY A;  1U2W A;  4UB6 C;  4HSR A;  2BV6 A;  2MA3 A;  1GV2 A;  2FRH A;  4L9N A;  1Z77 A;  2HOS A;  4YEJ A;  1B72 B;  1FBQ A;  4NBQ A;  4Q4Z F;  4M74 A;  4KN7 X;  2MC4 A;  5C4J J;  2W24 A;  3I54 A;  5GTI C;  2XSD C;  3PQK A;  4BHB A;  1YW9 A;  2HQN A;  1TQM A;  5CQE A;  3S1M J;  3NEU A;  3TQN A;  4BH9 A;  5IYD J;  3NAU A;  2K4J A;  5JR3 A;  3K9T A;  3HGY A;  3ZQC A;  2O8K A;  2GZW A;  4XK4 A;  4HV6 A;  1Z0X A;  1V5F A;  2B0L A;  3RKY A;  4E7S A;  3A01 B;  5DM7 F;  3LA7 A;  3GZ5 A;  3S2H J;  4I0A A;  3RYR A;  2VKE A;  5TIS C;  3RKW A;  3PIP F;  2BW3 B;  1LDD A;  3FM3 A;  4ZJZ A;  4HDV A;  3Q9V A;  2XKP A;  2LMD A;  4ZDP A;  1MBF A;  4G7Z F;  1RUN A;  3FXO A;  4AU7 A;  2ELH A;  4D7N A;  1WHU A;  2BE5 F;  2XAS A;  2UXX A;  4L9V A; 
#chains in the Genus database with same CATH homology
 1HW2 A;  2J5O A;  4YIF A;  3N97 A;  5BS6 A;  1S3J A;  3SZT A;  2ZJ2 A;  3V8L A;  2DI3 A;  3QPH A;  1BN5 A;  1FBS A;  2VBX A;  1U5T A;  4GYI A;  5D8K B;  3WTW C;  2X4H A;  2DT5 A;  4L9T A;  3HOT A;  3KP3 A;  1BIA A;  4R79 A;  1HKT A;  3F8B A;  3L9F A;  2QZ8 A;  4BNC A;  2HDC A;  2GWR A;  4MEX F;  4LJZ F;  4UHT A;  5EEG A;  4EJO A;  3LA2 A;  2CG4 A;  5K5Q A;  3ERE D;  1UCR A;  3RI4 A;  3MZH A;  4R8H A;  4AD9 A;  4WXH A;  3JW4 A;  2EWN A;  2Y48 A;  3KP6 A;  2KIU A;  2VC1 A;  3CUQ C;  1EV7 A;  1FX7 A;  3IWZ A;  3WOD F;  5L3B A;  3OOP A;  3K69 A;  3MEX A;  2COM A;  2M5W A;  4MQV A;  2DO7 A;  3NRV A;  2FXA A;  2FNP A;  3DP7 A;  3VFZ A;  4CZZ A;  3FMR A;  1Y0U A;  1V3F A;  2HEO A;  1U8R A;  1O3R A;  1KYW A;  1ZHF A;  1P92 A;  1R00 A;  5D4R A;  2R3S A;  1BI0 A;  2XHK A;  1DP7 P;  4EVI A;  3IKV A;  2QBY A;  2G7H A;  4KMU X;  1LDK B;  4HYE A;  1LB2 A;  3CO7 C;  4N9I A;  3ABT A;  5LGU A;  1TNS A;  5DCM B;  3GFI A;  1MZB A;  3J81 Z;  1KQ8 A;  5E1W A;  3LA3 A;  1F4K A;  1D3Y A;  1L0O C;  3DXJ F;  4CDG A;  3L7W A;  4OMY A;  2LNB A;  4KIC A;  1UFM A;  2NRA C;  5DUI A;  2WC2 A;  3WG9 A;  1TW3 A;  3G3Z A;  4Q5S F;  3F23 A;  3CO6 C;  1R5G A;  2IA0 A;  5H6Q A;  3T5X A;  3WU0 A;  4ZYH A;  3M9A A;  3M8E A;  1ZG1 A;  4XRF A;  2Z99 A;  4Y13 A;  1S8N A;  3K1N A;  2XAG A;  2DPU A;  4PDK A;  1F5T A;  4BAY A;  3ROU A;  3HUG A;  1R1V A;  3BOQ A;  4MGR A;  2V1U A;  4EMS A;  4ENM A;  3HRU A;  3WTZ A;  2H27 A;  4OIR F;  2NAZ A;  4LLN A;  3V7S A;  1U78 A;  2PG4 A;  5LEJ A;  2P5K A;  3KCC A;  2Z3Y A;  1P4W A;  4D0P A;  1ZYR F;  1WWX A;  2OA4 A;  1D5V A;  2HTJ A;  2FNA A;  4U0V A;  4KA4 A;  1U3E M;  5HDK A;  1JHF A;  2VT2 A;  4UV8 A;  5HDN A;  3DV8 A;  2CYY A;  3O6B B;  4KN4 X;  2RQP A;  4IJA A;  3RDI A;  3SQN A;  2VBW A;  2F2E A;  1FT9 A;  3HIF A;  3QOP A;  4EM2 A;  1SD6 A;  4EJV A;  1CGP A;  3GFM A;  4ON0 A;  1S29 A;  1ZAR A;  4I09 A;  2RDP A;  2DQR A;  1O3S A;  2OZ6 A;  3FMS A;  1SFX A;  5LGN A;  3WU1 B;  1Q1H A;  4I0B A;  2F5D A;  3HRM A;  5DDG A;  2LF8 A;  3GLX A;  2H94 A;  1IRG A;  4EV0 A;  5LHH A;  3V7R A;  1HXD A;  2WV0 A;  2KIM A;  2XAH A;  3P9K A;  5L3G A;  1FLI A;  2FE3 A;  4RGU A;  3WE2 A;  1UHM A;  3D0S A;  1FWZ A;  3ZMS A;  4L5J A;  1OYW A;  3M8F A;  4PCQ A;  5FLX K;  1IN7 A;  1Z6T A;  2EFN A;  1MDM A;  4LMY A;  2HQR A;  3J81 K;  1NHA A;  2ZXJ A;  3O2P E;  4WXC A;  1T39 A;  3TOB A;  1MDM B;  2K4B A;  4EGZ A;  2RVC A;  1FZP B;  3C7J A;  1JXS A;  1S6L A;  1K7A A;  1WSU A;  3P7N A;  1QNT A;  3F6V A;  3W6J B;  1FP2 A;  1SFE A;  2IJL A;  2YX7 A;  5E1X A;  1TLH B;  5HLH A;  2BEO A;  3V8J A;  4UVC A;  1KGS A;  4LG0 B;  1T0F A;  3I0T A;  1Z6R A;  4LLL A;  3ZQ7 A;  5D5W B;  4G7O F;  4EM0 B;  1XSX A;  3R61 A;  3G73 A;  2D2W A;  3Q5F A;  3VOE A;  2P5L C;  4AIJ A;  2MLK A;  2IRF G;  1J9I A;  2M30 A;  2PBI A;  4IRH A;  4L18 B;  1ONV A;  2FU4 A;  5K1Y A;  3EDP A;  5ICF A;  4Z2Y A;  5CVU A;  2DLL A;  2RV8 A;  2QM3 A;  2EFW A;  3DF8 A;  5LHI A;  3D5L A;  5KK1 A;  1FBU A;  1HKS A;  1XMK A;  2V79 A;  2FQ3 A;  2EV5 A;  2XVC A;  3JTH A;  4HX4 A;  2GA2 A;  4ENJ A;  3F22 A;  2V9V A;  1YW7 A;  1J75 A;  1S7A A;  3HTS B;  2K86 A;  5HS8 A;  4BQA A;  1FY7 A;  3IKT A;  1R58 A;  2VOO A;  1SAX A;  3R0A A;  1ON2 A;  4HW0 A;  4L5I A;  3HOS A;  4M71 A;  3JAM K;  2DU9 A;  1CF7 B;  2YX4 A;  5J8C A;  2Z33 A;  5FFX A;  4YII A;  3VOD A;  1FPQ A;  2JPB A;  4AWX B;  1ZLK A;  1XDS A;  3ZMT A;  2CO5 A;  1R1U A;  5AON A;  2KJB A;  2WWY A;  2LF7 A;  4LFU A;  1KU7 A;  2GQQ A;  3B02 A;  4KNY A;  1IXS B;  3BWG A;  2A07 F;  3QP5 A;  4M6Y A;  1Z1D A;  1RIO H;  1T98 A;  3MZY A;  4GYG A;  2EV0 A;  1D8J A;  4XSZ F;  5H6R A;  1I1G A;  2FML A;  5FGM A;  4QLC U;  2CGP A;  2CWE A;  5CJ9 A;  4WX9 A;  3KFW X;  2VE9 A;  1MGT A;  2EJR A;  4I2O A;  3REO A;  2R7F A;  5BQT A;  3M7G A;  2VXZ A;  4DQ2 A;  4HLY A;  5L3E A;  4HA8 A;  3ZN0 A;  2PI0 A;  1IN4 A;  4MNU A;  1DPR A;  4E70 A;  5E1Z B;  2E7X A;  3KP5 A;  3T8T A;  2XAF A;  4UUV A;  2W85 A;  2IP2 A;  3WTT C;  2L4A A;  2Z9O A;  4ZYG A;  1KQ9 A;  3TKY A;  5DCF A;  4CYD A;  2FOK A;  2P7V B;  3S2W A;  2BYV E;  5HLG A;  3J80 K;  3E3V A;  4A0Y A;  2XUB A;  2HR3 A;  2OZU A;  2M87 A;  5L3D A;  2YU3 A;  4MHG A;  1IZ1 A;  3WTY C;  1SD5 A;  5ICC A;  3FM5 A;  4S05 A;  4Y15 A;  4HDU A;  1R7J A;  4UXN A;  1QO0 D;  4HQE A;  3ZMU A;  2ESN A;  2QLZ A;  3BPX A;  3TO9 A;  3P9I A;  3E5X A;  1K6O A;  4M9S A;  1XGO A;  3M1E A;  1BI3 A;  1FSE A;  2W25 A;  2P8T A;  3EYI A;  3HSR A;  4MQ9 F;  1LQ1 A;  2D45 A;  2P7C B;  1G3Y A;  3FHZ A;  2JTV A;  4LLG F;  4A2U A;  3GYH X;  4RGX A;  2QEN A;  4UVA A;  2OBP A;  4XSX F;  3W6K B;  4EJW A;  1O7L A;  1HW1 A;  4A12 A;  2OAZ A;  3JAM Z;  5JFR A;  1XGM A;  1RNL A;  1O7F A;  4ENN A;  4KIF A;  4PGG A;  2HKO A;  2L54 A;  1QZY A;  4IXA A;  2FSW A;  5HOO A;  2ESH A;  5FB2 A;  1OYI A;  2FBK A;  3MQ0 A;  4NQW A;  3F21 A;  4I01 A;  4DNC A;  4LK1 F;  2PQ8 A;  3U2R A;  2JT1 A;  2D1V A;  1I1S A;  3TDZ C;  3LQQ A;  2GIV A;  4L0Z B;  2A6E F;  5A2Q K;  3ELK A;  3KZZ A;  2NNN A;  2ETH A;  4ASN A;  3I59 A;  3K2Z A;  3K0L A;  1YS6 A;  3P9C A;  4KMF A;  4OIN F;  5JVT A;  5KVR A;  2A69 F;  2RNJ A;  2KKO A;  4HZF A;  2VN2 A;  2XAJ A;  1STZ A;  2JRT A;  1LEA A;  1BM9 A;  1G6N A;  4BYY A;  1Z91 A;  3KE2 A;  2K27 A;  1U5T B;  4KYW A;  1QGP A;  4Q47 A;  3R6S A;  4M6X A;  2FBI A;  3FMQ A;  4LG0 A;  4YFN F;  4EJU A;  1O3T A;  4B8X A;  1KU9 A;  3WGG A;  2A6H F;  2P6T A;  2A68 F;  2YR2 A;  3MCZ A;  1H9G A;  2E1C A;  3GEZ A;  1JHH A;  2ZME A;  3BPV A;  4G7H F;  1ZAO A;  3BP8 A;  3FF5 A;  3TOA A;  3OV8 A;  1J5Y A;  1U5T C;  4IHS A;  2QUF A;  1J2X A;  3C18 A;  5ICE A;  3DFG A;  1T38 A;  4A0Z A;  4L9J A;  5EEH A;  3WGH A;  2PN6 A;  1MD0 A;  5LRS A;  1IN5 A;  2HYG D;  4ZZD A;  2ISY A;  1GVJ A;  3R4K A;  3I53 A;  2STT A;  2IW5 A;  4FT8 A;  1W7P D;  3FXU A;  3F8C A;  4HV5 A;  1Z9C A;  1HQC A;  4BHP A;  5FD5 A;  5BMZ A;  1KQ0 A;  1IXR C;  2Y75 A;  1FYL A;  1X3U A;  1WKM A;  4CGZ A;  1TQP A;  5DV5 A;  1B1B A;  2F5E A;  4B09 A;  2ZBK A;  2C6Y A;  1A04 A;  2KJC A;  1YYV A;  1SMY F;  5DYM A;  5FLX Z;  5LBQ A;  2OQG A;  2OQR A;  4RB3 C;  3F72 A;  3QRF F;  5K5O A;  2ZME B;  5HLI A;  3FWE A;  5LHG A;  4ETS A;  3R60 A;  3N4M A;  1XDU A;  2A5Y B;  3GFL A;  1FYK A;  2UXN A;  1TBX A;  1UST A;  3CJN A;  2MD5 A;  1J0R A;  4OIQ F;  5DCM A;  2ACJ A;  2HKX A;  2QQB A;  3I64 A;  5E8G A;  3F3X A;  4FX0 A;  4U7D A;  3B73 A;  4ESF A;  4NHJ A;  5LEK A;  3KP7 A;  4A6D A;  1IN6 A;  2V6C A;  3LAJ A;  3R0J A;  4GCV A;  1S7O A;  5ICG A;  1ZG5 A;  3QPT A;  4P9F A;  3BDD A;  3CUQ A;  3GFJ A;  2QBY B;  2VC0 A;  4CXF A;  2IA2 A;  4YG2 F;  4KDP A;  1ZRC A;  2RN7 A;  1FNN A;  2L4M A;  3F6O A;  4NB5 A;  5J6X A;  5ERI A;  4G6Q A;  4EGY A;  5CVJ A;  4ZZL A;  5FFZ A;  1ZRF A;  5CVR A;  4RS8 A;  3PFI A;  2XV4 S;  3I58 A;  3BJ6 A;  4N0B A;  4RGR A;  1BJA A;  3EYY A;  2XIG A;  5D4S A;  4KIB A;  4EQQ A;  3NQO A;  5LGT A;  3V4G A;  2EFO A;  3IRQ A;  4OOI A;  1JE8 A;  3HRS A;  3ULQ B;  2PMH A;  2XRO A;  3T1B A;  1ZRD A;  4XLN F;  1AWC A;  4XBF A;  3COA C;  3K1M A;  1E17 A;  2JZY A;  1HW5 A;  3FX3 A;  2L3D A;  1OMI A;  1W7P A;  3CUO A;  2FA5 A;  5ILU A;  1LJ9 A;  3GXO A;  3QU3 A;  3QU6 A;  2H6C A;  3CLO A;  2MC3 A;  1UHW A;  5TRD A;  1BIB A;  2PEX A;  2VT3 A;  1TQI A;  1B4A A;  1LEB A;  1FP1 D;  4U0W A;  4LB5 A;  2XAQ A;  1XD7 A;  2O03 A;  2AXL A;  4KIG A;  5AIP A;  4EJT A;  4IVN A;  2EA4 A;  4BXU A;  4RB2 C;  3FXR A;  3GZ6 A;  3SFZ A;  3JSO A;  2O61 A;  3SXY A;  1W7P B;  5BOX A;  1BC8 C;  4FHT A;  2ZKZ A;  2HTS A;  2QWW A;  5D6E A;  1P4A A;  4JBA A;  2K7L A;  4AIH A;  3I71 A;  2VOP A;  3O3K A;  3E5Q A;  5LRR A;  1LVA A;  4BHC A;  1RI7 A;  2LSO A;  3KEQ A;  2IPQ X;  3WTU C;  3E6D A;  3WGI A;  1USS A;  2DW4 A;  2EA2 A;  1SD4 A;  3MFK A;  3QP6 A;  4FX4 A;  2DQL A;  4A0X A;  2O8X A;  4ESB A;  3TO6 A;  1HST A;  1OPC A;  4U0Y A;  1XSV A;  5J8F A;  4OU0 A;  1PUE E;  2RKH A;  4P55 A;  3DPL C;  1PP8 F;  4P5O A;  2RGV A;  2RC4 A;  2M45 A;  3V8K A;  1DDN A;  2A3S A;  3IC7 A;  3ZMV A;  1YLF A;  1RUO A;  5D6F A;  1KYZ A;  1WQ2 A;  3RKX A;  5D5X B;  4WXD A;  4UVB A;  2F5C A;  2Q2E A;  4HF2 A;  2M8E A;  4A5N A;  4ZYE A;  3TO7 A;  2KIF A;  1MJB A;  5LLQ A;  3RIR A;  3ZMZ A;  5CLS A;  5F64 A;  2H09 A;  3LWF A;  3I4P A;  1W4M A;  4OIP F;  4WF2 A;  2AS5 F;  4HBL A;  1FOK A;  2HGC A;  4P96 A;  4U7B A;  1OYY A;  1EH7 A;  3ML6 A;  1KU2 A;  5H20 A;  3L09 A;  1RZ4 A;  1XCV A;  4GO1 A;  3RTR A;  1QQI A;  2L02 A;  5DEQ A;  1OR7 A;  3GUD A;  1B9N A;  3U1D A;  3GO5 A;  4GGG A;  1TW2 A;  1XGN A;  5HS7 A;  3RYP A;  1XGS A;  1K79 A;  3EUH A;  2CFX A;  4JQF A;  1I5Z A;  2EFQ A;  1ZG3 A;  3EQL F;  3HSE A;  1IUY A;  4RAY A;  3VB2 A;  1OKR A;  1R22 A;  3TDU C;  1FSH A;  1ZLJ A;  5IT3 A;  2KRF A;  4ZH4 F;  5D5U B;  2CSO A;  4H0E A;  3ZP5 A;  4HX8 A;  5BPD A;  1J7K A;  1T6S A;  3ZPL A;  4KFC A;  2FMY A;  2STW A;  1QPM A;  5JI6 A;  1R1T A;  3J7A O;  2ZNY A;  2V1D A;  2A61 A;  3RJP A;  4YFX F;  3ABU A;  2VBY A;  1YQA A;  3JSP A;  2K02 A;  1ZN2 A;  3IL2 A;  3KET A;  3GF2 A;  1W5T A;  2FBH A;  4P9U A;  2VON A;  2Q0O A;  3I5U A;  3J80 Z;  1BI2 A;  2EV6 A;  2HOE A;  1FC3 A;  1IXC A;  5DUK A;  3WTX C;  3K1P A;  5FD6 A;  3C3W A;  2HFH A;  4A5M A;  1EH8 A;  2P4W A;  2W84 A;  4HX7 A;  1O57 A;  3BRO A;  2X0L A;  2QVO A;  2DK5 A;  3H3Z A;  5HDG A;  3Q9S A;  1QZZ A;  4HQM A;  2WTE A;  2PLY A;  4WWC A;  3MWM A;  3RPQ A;  2QYO A;  1ON1 A;  1C0W A;  1B6A A;  4MTE A;  2EK5 A;  4R1H A;  2JSC A;  3CTA A;  2VBZ A;  1AOY A;  3TGN A;  4KUM A;  2E1N A;  3LAP A;  3H92 A;  4KT5 C;  2Y0M A;  3GX4 X;  4MEY F;  1GHC A;  4PGH A;  1BOA A;  2DK8 A;  2EFP A;  3ECH A;  1WI9 A;  3KZY A;  2MBF A;  1G3S A;  3LQR A;  1XMA A;  3L00 A;  4OMZ A;  3GW2 A;  1B9M A;  2MH2 A;  2E7W A;  2YPR A;  5AIQ A;  2MLG A;  5BPI A;  3F8M A;  1IAW A;  1SMT A;  3KLN A;  4A6E A;  1YFH A;  1GXQ A;  5E17 F;  4I02 A;  2ZCW A;  4CHU A;  1L3L A;  3KP2 A;  1G3W A;  1XCB A;  2UZK A;  5FO5 A;  1JGS A;  3F8F A;  5CYV A;  4ESJ A;  1B59 A;  4LB6 B;  3E6M A;  1W5S A;  5TJJ A;  4I98 B;  4YFK F;  1BBY A;  4IF4 A;  3SHF A;  1KU3 A;  1HKQ A;  4HF1 A;  4WCG A;  3JTG A;  4F7Z A;  3HSF A;  1YS7 A;  2O6G E;  1XB4 A;  2QQ9 A;  4HLX A;  1P4X A;  1TTY A;  1EH6 A;  4JK1 X;  1BC7 C;  1UB9 A;  1P6R A;  2L01 A;  1F9N A;  2R7D A;  1MKM A;  4HAM A;  5L3F A;  3ISP A;  3PQJ A;  3IHU A;  1YG2 A;  2XRN A;  1ZRE A;  5DD4 A;  5E8I A;  3FZV A;  5L3C A;  4AIK A;  1YW8 A;  3U9G A;  3AAF A;  2GXB A;  1FYM A;  1KA8 A;  3I59 B;  4UV9 A;  1SD7 A;  1IRF A;  1MJ9 A;  3HHH A;  1ODD A;  1GXP A;  1XN7 A;  4G8X A;  1ZGJ A;  1ZGA A;  1F1Z A;  2O0Y A;  2G9W A;  2Q8K A;  2FEZ A;  2PJP A;  5A2Q Z;  4K2E A;  2V1X A;  2VE8 A;  2DPD A;  3GWZ A;  2HS5 A;  3KEO A;  2BBY A;  4IRG A;  3GVA A;  4M9X A;  3HYI A;  2XKO A;  4O3M A;  4RGS A;  3KP4 A;  3V7C A;  2UWM A;  3CDH A;  1G3T A;  2GAU A;  4M73 A;  3MAJ A;  4CO8 A;  5D8L B;  1H0M A;  4G9Y A;  5F1R A;  1WRJ A;  2MH9 A;  5D5V B;  2PMU A;  5CVV A;  2NNY A;  1V4R A;  2QQA A;  1I27 A;  1SFU A;  1R5H A;  3ZN1 A;  1ULY A;  1DPU A;  2ZO4 A;  3L2C A;  4CIC A;  3VEP A;  3H3U A;  3QAH A;  1XSD A;  2ADU A;  3C1D A;  3ZMD A;  4Y17 A;  1HBX G;  1CF7 A;  2HZT A;  5DD8 A;  3KLO A;  1IN8 A;  1U6G A;  1R23 A;  1LNW A;  2DBB A;  5CVI A;  5ILS A;  4RB1 A;  4RB0 A;  5HVQ C;  3LST A;  4OIO F;  1TNT A;  1DUX C;  3CUQ B;  3T8R A;  1G4D A;  2DAO A;  2D1H A;  1YTY A;  4U88 A;  3E6C C;  2NYX A;  2HYF A;  2F5F A;  2VOD A;  3RPU A;  4O6J A;  2ISZ A;  1MJA A;  2GXG A;  3WE3 A;  4EM1 A;  2TDX A;  4L0Y B;  5E18 F;  1E2X A;  3DKW A;  2O3F A;  2LDU A;  1K78 B;  5K5R A;  3WTS C;  3E5U A;  4S04 A;  5HS9 A;  3T0Y A;  3LFK A;  2CQK A;  4GXO A;  4Q48 A;  1Z7U A;  1H9T A;  3DQV C;  1ZH5 A;  2GA1 A;  1YIO A;  3HHG A;  4HF0 A;  1T2K A;  3EET A;  1D8K A;  2DFI A;  4MTD A;  4M72 A;  4ENK A;  4XLP F;  4UNO A;  1R36 A;  1O3Q A;  4G94 A;  2YSR A;  3ECO A;  2H6B A;  1IF1 A;  2P6S A;  4LK0 F;  3SZP A;  5F6F A;  4IHT A;  5ED4 A;  2ZFW A;  1BI1 A;  3BJO A;  5IT9 K;  4HOB A;  1VTN C;  2EB7 A;  4ZYD A;  5JHU A;  3WTV C;  2J5P A;  1PDN C;  4TV7 A;  4PZJ A;  2IA1 A;  4QWQ A;  4O5V A;  1PP7 U;  1K78 A;  2NS0 A;  1P2F A;  2P5V A;  2PFB A;  3HRT A;  3BZ6 A;  2OD5 A;  5E20 A;  2IVM A;  3E6B A;  4G6D A;  3HTU A;  4AVP A;  4WK8 F;  4M9Z A;  4LGW A;  2LKP A;  2ZNZ A;  4RAZ A;  2XGX A;  2Z5U A;  3DPT A;  2W57 A;  1J59 A;  6PAX A;  1Z05 A;  4IPA A;  4I7H A;  1HSJ A;  2BGC A;  2HWV A;  2JPC A;  1I6X A;  3IWF A;  3DEU A;  2G7U A;  3F8N A;  1LDJ A;  4LD5 A;  2CW0 F;  2M1B A;  3BJA A;  3IRR A;  2IT0 A;  3FXQ A;  5ILV A;  5IT9 Z;  4IRI A;  1IW7 F;  2DTR A;  2FF4 A;  1REP C;  3E97 A;  4N9H A;  1YO5 C;  1QBJ A;  2OU2 A;  3BY6 A;  1U2W A;  2BV6 A;  2MA3 A;  2FRH A;  4L9N A;  1FBQ A;  4Q4Z F;  4M74 A;  4KN7 X;  2W24 A;  3I54 A;  3PQK A;  4BHB A;  1YW9 A;  2HQN A;  1TQM A;  3NEU A;  3TQN A;  4BH9 A;  5JR3 A;  2K4J A;  3K9T A;  2GZW A;  4HV6 A;  2B0L A;  3RKY A;  3LA7 A;  3GZ5 A;  4I0A A;  3RYR A;  3RKW A;  3FM3 A;  1LDD A;  4HDV A;  3Q9V A;  2XKP A;  4G7Z F;  1RUN A;  2ELH A;  2BE5 F;  2XAS A;  2UXX A;  4L9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...