3R0AA

Possible transcriptional regulator from methanosarcina mazei go1 (gi 21227196)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
120
Chain Sequence
b'SNAMIDFACKEFKVEDVIKCALNLTKADLNVMKSFLNEPDRWIDTDALSKSLKLDVSTVQRSVKKLHEKEILQRSQQNLDGGGYVYIYKIYSKNQIRNIIQKIVQSWADRLGQELKEWEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator
molecule tags Transcription regulator
source organism Methanosarcina mazei
publication title Possible transcriptional regulator from Methanosarcina mazei Go1 (gi 21227196)
rcsb
total genus 33
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3r0aA00
4HF0A 3D0SA 4ESJA 1BC7C 3ECOA 1XGSA 5LRRA 3AAFA 5CYVA 2DBBA 5HS8A 3HRSA 1MD0A 3TDZC 3DPTA 2HWVA 2XRNA 4MTEA 4O3MA 3VFZA 2UXXA 1JGSA 2UZKA 2WTEA 2IPQX 3QAHA 2JPBA 4LG0B 1IRFA 4ZYDA 1Z05A 3EYYA 2HYGD 4UVCA 5FGMA 4EGYA 3WTTC 4EM1A 1R7JA 3R60A 1REPC 5IT9K 4BHPA 3HTUA 3RTRA 3CUQB 4A0XA 3QPTA 2K4JA 5BS6A 1ZG3A 2HTJA 1YTYA 4MQ9F 2TDXA 3FX3A 4LMYA 1LDJA 2GA2A 4MTDA 5K1YA 1DUXC 1XGMA 5DCMA 4I01A 2NRAC 4RGXA 1GXPA 4AWXB 1PP8F 1FBSA 2DI3A 4L5JA 2H6CA 4I0BA 2EFOA 2HZTA 1U3EM 3ERED 3BY6A 2LF8A 5DEQA 5K5RA 3HIFA 4JK1X 3FMRA 4XLPF 5F1RA 1ZG5A 2VN2A 1XCVA 3JAMZ 2QBYA 4BHBA 2QBYB 1KQ8A 2JZYA 3R4KA 5HLIA 3MZYA 3T0YA 2V79A 3FMSA 2RQPA 5IT3A 2Z99A 4IRGA 2XHKA 1J59A 3SHFA 4Y13A 3GFMA 1R58A 4KDPA 3P9KA 3VEPA 2XV4S 4HA8A 1MJ9A 1SD6A 2CG4A 3SQNA 1ZLKA 3HRUA 2EA4A 3FXUA 3SXYA 3E5UA 1F5TA 1FYMA 4FX4A 2ZMEB 2ADUA 3GEZA 1P2FA 3LA2A 4A0ZA 2LNBA 5EEHA 1HW5A 1E17A 1BI2A 3ZMTA 4AVPA 1UHWA 2ETHA 3WU0A 5JHUA 1P4XA 4RB0A 1ON2A 2C6YA 4LD5A 5BPIA 3ABTA 3KEQA 2JSCA 2HDCA 1ZGAA 3BWGA 5LGNA 2FSWA 5DUKA 4Z2YA 2DTRA 4PGGA 2ACJA 4Q5SF 3ZMUA 3V8KA 4WF2A 1E2XA 4A5NA 1X3UA 1MKMA 3VB2A 2O03A 1LEAA 3V7CA 1B1BA 3K69A 4ENNA 5ICGA 1SMTA 4HV6A 1EH7A 3HHHA 2OQGA 4CHUA 2DT5A 3F8CA 1L3LA 1QZZA 3JTGA 5DCMB 3TDUC 2K02A 3K9TA 2BYVE 1W5SA 3V7SA 1TQMA 1H0MA 1I27A 4MNUA 2P6TA 5HDKA 3COAC 2PQ8A 4R8HA 2RVCA 2K27A 5D5VB 4BQAA 2FNPA 1YW9A 2L4AA 3O6BB 3DPLC 2QQ9A 2Z5UA 3BROA 3KP5A 4WK8F 2M45A 4BH9A 2EFNA 5CLSA 4N9IA 4WX9A 4OU0A 1LJ9A 1XD7A 3WGIA 4DNCA 5LGUA 1J2XA 1IN5A 3HTSB 2E1CA 3L00A 3IKTA 5L3EA 2Q2EA 2LF7A 4B8XA 1T2KA 2MD5A 3QOPA 4U88A 3W6JB 2B0LA 1HQCA 5CVUA 4P55A 3BZ6A 4YIIA 1R22A 2IRFG 1ZHFA 3KZZA 4CGZA 5D8KB 3E6DA 2IW5A 5J8CA 2M5WA 2G9WA 3EYIA 1U8RA 1XN7A 3O2PE 5DD4A 2OA4A 3LAJA 3WTUC 2L4MA 2OBPA 4IVNA 4CYDA 4HX7A 2WV0A 3EETA 1I1GA 4MEYF 4MGRA 3IRRA 3JW4A 2A69F 1QO0D 3IWFA 4UVBA 4L9NA 2VE9A 3V8JA 2XAJA 4NQWA 4F7ZA 2KIMA 4G6QA 4Y17A 3DEUA 3M8FA 5FFXA 4LB5A 4UHTA 4EM2A 2VODA 5IT9Z 1G3WA 2VONA 2CGPA 3U1DA 2EA2A 3VOEA 1R1UA 1F4KA 3ROUA 3T8TA 3FHZA 2GQQA 1ZYRF 1BJAA 2XGXA 4OIQF 3IHUA 2OZUA 1T0FA 3TOAA 1DPUA 3C18A 4Q4ZF 1R23A 4QLCU 2VT3A 4G9YA 1ZN2A 1FLIA 1JE8A 4ZYEA 4EQQA 3NQOA 1T98A 2GAUA 3F8NA 5TRDA 2CO5A 3SZPA 3LAPA 2Q0OA 4KT5C 4N9HA 3N97A 4HOBA 1H9TA 2H27A 1EH6A 1MZBA 5FFZA 1F9NA 1ZRDA 4BYYA 2PG4A 2A6EF 2QWWA 2HKOA 3I0TA 1KU7A 4LJZF 2F2EA 1D8JA 4OINF 4A12A 3QU3A 2G7HA 1IXSB 1TNTA 4YIFA 1ZREA 4UNOA 2A5YB 5LRSA 4S04A 2EK5A 3GF2A 2ESNA 3WGHA 4KIBA 1P4WA 4GCVA 4KIFA 2D2WA 2BBYA 2EFPA 4HX8A 3RYRA 1KU3A 2XASA 4KN4X 2OZ6A 2MC3A 3KP4A 2EV0A 5HLGA 2OAZA 3BOQA 1BBYA 1XGOA 5AIQA 3J80K 4GXOA 1QPMA 2P7VB 2PFBA 1SFXA 1Z9CA 2W85A 1IAWA 3C3WA 1KGSA 3F72A 4R1HA 3JSPA 1O57A 1FOKA 4G7ZF 2OU2A 3FWEA 2P5VA 1OYYA 3FF5A 2M1BA 2IP2A 5L3CA 2W25A 3R6SA 5JVTA 1S6LA 1XMKA 1OPCA 2JPCA 3PFIA 3L09A 5HS7A 1DPRA 2GWRA 1FSHA 3FM5A 4LLGF 2O0YA 2KJCA 1KYZA 4Q47A 5AONA 1ZRCA 2BE5F 1ZG1A 2M8EA 3ZN0A 3OOPA 4CDGA 2KIFA 1FBUA 2ZJ2A 1J75A 5LEKA 4ENJA 3P7NA 1BN5A 4GYIA 4HAMA 1I1SA 3REOA 2W84A 2V9VA 2EV6A 1W5TA 1UB9A 1J7KA 2MLGA 4EGZA 4L0ZB 4P9UA 2BEOA 1W4MA 3WTSC 5J6XA 3P9CA 5E20A 2HQRA 2NNYA 3V4GA 3WTVC 3EDPA 3DXJF 2AS5F 1IUYA 4KA4A 1USSA 2ESHA 2ELHA 3KP3A 5LHHA 1G3YA 5JI6A 2PLYA 2A61A 4KNYA 1FP2A 2A3SA 1B59A 4KIGA 3BP8A 2STTA 3TQNA 5KK1A 4H0EA 1K7AA 3ZMVA 4M9ZA 5LHGA 4HDUA 1HXDA 5D4RA 2DPUA 1JHFA 1LNWA 2HS5A 2HYFA 1EV7A 1MJBA 1PP7U 2NNNA 4RAYA 2G7UA 2DW4A 1FP1D 3Q9VA 5EEGA 3L7WA 2RV8A 1TNSA 1R5HA 4HQEA 2EWNA 3ELKA 4G6DA 4JBAA 4MEXF 4FT8A 1XDSA 4ENKA 1QQIA 2ZNYA 1FY7A 2GXGA 2YX7A 1D8KA 4A6EA 2VBZA 5D5XB 3ZQ7A 2CFXA 1J0RA 3P9IA 2VOOA 1YLFA 2FXAA 2R7FA 4M71A 1L0OC 2QLZA 1HKSA 3N4MA 3BDDA 2HQNA 2FEZA 2F5CA 4G94A 4EMSA 3DF8A 1IRGA 2M87A 2ZCWA 5LEJA 2XAHA 3MQ0A 4ON0A 5HDGA 5CVVA 1XSXA 4BHCA 3CUOA 1RUOA 4U7DA 2K4BA 4ZYHA 2RN7A 2QVOA 3I64A 3MFKA 1ODDA 1FNNA 3CUQC 3V7RA 1RIOH 5CJ9A 2A07F 1W7PD 1V4RA 2KIUA 1CF7B 5CVRA 3I59B 4IHSA 1R5GA 1BIBA 4OOIA 1B4AA 3FZVA 2PN6A 4AIHA 3FM3A 2VBXA 5E17F 2ZNZA 4M74A 1OYIA 1U5TC 2XKOA 3TO6A 5E8GA 1V3FA 5FB2A 3G3ZA 3NRVA 4A5MA 3ZMDA 2D45A 5BMZA 5HOOA 2P6SA 5H6RA 2FBKA 3F8BA 2EFWA 2AXLA 2BGCA 2F5DA 2JRTA 5E18F 3T1BA 4UUVA 5HVQC 3HHGA 2PI0A 1XMAA 4QWQA 2NYXA 2UXNA 5ICFA 1TQPA 3LWFA 1FPQA 5F6FA 1MJAA 1IXRC 3F22A 4M73A 2HR3A 4HX4A 1TW2A 5D8LB 3KP7A 3GFLA 5ICEA 5D5UB 4S05A 4R79A 2YPRA 5CVIA 4G8XA 4LLLA 1FYLA 4P5OA 3WG9A 1A04A 3GFJA 4I98B 1B9MA 1U5TA 4RGUA 5LLQA 2V1DA 3LA3A 2J5OA 3KLOA 2FMLA 4L18B 3CLOA 1K78B 1U6GA 3HUGA 2K86A 2MA3A 1S7AA 3EUHA 5BQTA 1FWZA 2OQRA 2GXBA 4HDVA 3T8RA 1RNLA 2PMHA 2DU9A 2QYOA 4LB6B 2DPDA 2DLLA 1SD7A 1IN4A 3CDHA 2HGCA 3KETA 2HOEA 1Z6TA 1BOAA 4XBFA 3WE2A 3HYIA 3K2ZA 1XDUA 3CJNA 1LB2A 2L54A 4YG2F 2Y0MA 2YR2A 4LGWA 1RZ4A 4FHTA 1BI0A 1NHAA 3WTWC 5DYMA 2OD5A 3BJAA 3IRQA 3F8FA 2K7LA 2VOPA 4ENMA 2QQBA 3FXQA 5HS9A 3H3ZA 1USTA 3DFGA 3E5QA 2W57A 4CICA 4HLXA 1MGTA 2A68F 2QUFA 4ZYGA 2VXZA 2D1VA 1IN8A 4P9FA 4G7OF 2KKOA 5KVRA 2YU3A 1AWCA 3ZMSA 5L3FA 5L3BA 3M8EA 1FZPB 1UHMA 2FMYA 4WWCA 3J7AO 2RDPA 5HLHA 3F6OA 1P92A 2KJBA 3ZP5A 2YX4A 4WXHA 1MDMB 1LDDA 1WWXA 1C0WA 5F64A 1UFMA 1QNTA 2P8TA 1CGPA 2HFHA 5L3GA 4EVIA 4OIPF 3QRFF 4UXNA 4ZH4F 2LKPA 2DK5A 3WGGA 2MH9A 4BNCA 2QZ8A 4HW0A 4EJVA 5D5WB 1TTYA 4LFUA 1XB4A 1BM9A 2EFQA 3JAMK 3QPHA 5K5OA 1YW8A 2NS0A 1VTNC 3I71A 3Q5FA 1YFHA 1YS7A 2O6GE 3F23A 3CTAA 5FD5A 2EV5A 2XVCA 4LG0A 1S8NA 2V1XA 3F3XA 2CW0F 1FBQA 2Z9OA 3BJ6A 2VBYA 3F21A 2Y48A 1IN7A 2DQRA 1BC8C 4HF2A 2HTSA 5DUIA 1U78A 2FNAA 3LQQA 3RYPA 4Q48A 3FMQA 1SMYF 4I09A 1AOYA 3I5UA 4I7HA 4WXCA 3WTXC 3MEXA 1KA8A 3O3KA 5DDGA 3H3UA 1IZ1A 3WTYC 1HSTA 5CVJA 2RKHA 2DFIA 5DV5A 1Z1DA 2ZO4A 1SD4A 3ZN1A 3I58A 4MQVA 1Q1HA 1S29A 3C1DA 4IPAA 3I4PA 4RGRA 1YG2A 5E1XA 1HW2A 5ILVA 1Y0UA 2MBFA 4IF4A 1ZARA 1TLHB 2FU4A 1K79A 3E5XA 4XLNF 2JTVA 4EJWA 5D4SA 3CO7C 4ASNA 4JQFA 2JT1A 3SZTA 1OKRA 4M6YA 2COMA 2HEOA 2WC2A 3KFWX 3PQKA 2PEXA 1ZGJA 4LLNA 3F8MA 1Z7UA 3GXOA 4IJAA 1OMIA 3K1NA 4I0AA 4OMYA 1OR7A 4PGHA 2EB7A 2L01A 3PQJA 4U7BA 4M9XA 3HSEA 2L02A 1FC3A 2IVMA 1D5VA 3GWZA 3OV8A 1JXSA 3M1EA 5DD8A 1RUNA 1XCBA 5JR3A 4I02A 3U2RA 4ZZDA 3DQVC 3G73A 5ED4A 3IL2A 3WE3A 3RPUA 1I6XA 4HBLA 3L2CA 4N0BA 2P7CB 3WTZA 3I54A 1W7PA 5LGTA 4RS8A 3F6VA 4A2UA 5LBQA 5LHIA 4GO1A 5E1WA 2CYYA 1BI1A 2IA0A 3BJOA 1P4AA 5J8FA 3HOTA 2H94A 5BOXA 2Z3YA 3B73A 5D6FA 1DDNA 4P96A 2XROA 1I5ZA 3W6KB 3ML6A 1Z91A 1HBXG 3MCZA 1QBJA 5H6QA 3WU1B 3IWZA 4B09A 3RJPA 1FYKA 3SFZA 1RI7A 4A6DA 3LA7A 5DCFA 1FX7A 2IJLA 1JHHA 2VT2A 4LK0F 4L0YB 5FLXZ 4TV7A 5K5QA 4XRFA 4ETSA 3LSTA 3DKWA 3HOSA 3M9AA 4BAYA 3BPXA 3ABUA 3GLXA 1R00A 4E70A 4YFNF 2R3SA 3NEUA 2XIGA 4AIKA 2Y75A 4U0VA 2FRHA 1IW7F 3FXRA 1WKMA 4KICA 4HLYA 3E3VA 3K1MA 3ZMZA 3GFIA 4RB3C 4HZFA 5BPDA 1BI3A 2E1NA 3L9FA 5A2QZ 1WRJA 1F1ZA 3R0JA 1B9NA 2O8XA 3TO9A 2F5EA 3MWMA 1WSUA 4D0PA 2W24A 1LQ1A 2IT0A 2IA2A 4PZJA 4XSXF 4BXUA 1Z6RA 4U0YA 5ICCA 4HF1A 3QU6A 4KUMA 1SFEA 1YIOA 2MLKA 1YW7A 3M7GA 3DV8A 2H09A 4PDKA 5E1ZB 2J5PA 1KQ0A 4L9VA 4L9JA 3HSRA 3ZPLA 4EM0B 2VC0A 1OYWA 1R1TA 3LFKA 4RAZA 2UWMA 4AIJA 1J9IA 3ULQB 2VC1A 2FA5A 4KFCA 3RDIA 4A0YA 1QZYA 4UV9A 3R61A 1ULYA 2ISZA 2FQ3A 2ZMEA 1P6RA 1B6AA 1WI9A 1KQ9A 2DQLA 3J81Z 2XAQA 3JTHA 1XSDA 2CQKA 4L9TA 1HSJA 4EV0A 3RKWA 3GZ5A 3TKYA 2P5KA 4O5VA 2BV6A 2GA1A 2CWEA 5ILUA 1EH8A 2FBIA 3EQLF 1YS6A 4FX0A 2Q8KA 2O3FA 1BIAA 3IKVA 2HKXA 1IXCA 2X0LA 1U2WA 1LDKB 3GYHX 2ISYA 3MAJA 4CZZA 2H6BA 1O7FA 4HV5A 3T5XA 4IHTA 3KP6A 4RB2C 1SAXA 3GW2A 1QGPA 3RKYA 4ESFA 2QM3A 2KRFA 1T38A 3U9GA 3QP6A 2VBWA 3BPVA 2DK8A 1O3RA 1ON1A 4M72A 2XUBA 1PUEE 4OMZA 3IC7A 4KMFA 1MDMA 5AIPA 1IF1A 2X4HA 3J80Z 1ZH5A 3GVAA 1TW3A 3LQRA 4IXAA 5FO5A 3KEOA 4PCQA 3ECHA 1K6OA 1SFUA 3RKXA 4NB5A 5A2QK 3GZ6A 3RPQA 1TBXA 3KZYA 2RC4A 4WCGA 1YQAA 4K2EA 2FOKA 2LSOA 4UVAA 4G7HF 3S2WA 2IA1A 4NHJA 1G6NA 1U5TB 2ZBKA 3RIRA 2WWYA 1G4DA 1O3SA 3I53A 4I2OA 2RGVA 3HRTA 4WXDA 5ERIA 4AD9A 2YSRA 1J5YA 5FLXK 3TOBA 3HSFA 3Q9SA 2O61A 3D5LA 4M6XA 1R36A 2DO7A 4ZZLA 4EJTA 1ONVA 1K78A 5HDNA 4KMUX 4L5IA 1GXQA 4LK1F 4OIRF 1LVAA 1FSEA 1G3SA 2VE8A 1DP7P 1G3TA 1FT9A 4MHGA 5TJJA 3TGNA 3R0AA 3E6BA 3KE2A 2Z33A 3DP7A 5H20A 4OIOF 3GO5A 2QQAA 4CO8A 2XAFA 1ZLJA 1D3YA 3K0LA 1HW1A 4HYEA 4UV8A 4XSZF 3JSOA 2ZXJA 2ZFWA 1KU2A 3CUQA 4GYGA 2XAGA 1O3QA 5L3DA 4YFXF 1R1VA 1T6SA 3KCCA 4YFKF 2XKPA 4GGGA 1GVJA 2LDUA 2FF4A 2NAZA 4DQ2A 3CO6C 2QENA 3WODF 2M30A 3E97A 2ZKZA 1IN6A 4KYWA 1SD5A 1O3TA 2D1HA 4ESBA 2R7DA 2EJRA 2P5LC 4EJUA 3RI4A 1HKTA 3VODA 5JFRA 2F5FA 4CXFA 1UCRA 1STZA 3GX4X 2A6HF 3I59A 2P4WA 3B02A 2FE3A 2FBHA 5ILSA 1CF7A 4HQMA 1H9GA 1KU9A 2PBIA 1KYWA 1YO5C 4Y15A 1W7PB 3ISPA 4M9SA 2E7WA 2RNJA 2STWA 2E7XA 5E8IA 1ZRFA 4IRIA 4IRHA 3C7JA 3TO7A 1T39A 2L3DA 1HKQA 2GIVA 2DAOA 3V8LA 3MZHA 2MH2A 1LEBA 3K1PA 3H92A 5D6EA 3J81K 1XSVA 4O6JA 2PJPA 1PDNC 1S3JA 3QP5A 2GZWA 3GUDA 1GHCA 4KN7X 1XGNA 1ZAOA 3KLNA 1YYVA 4EJOA 2V1UA 4RB1A 1S7OA 3HRMA 3E6MA 1O7LA 1WQ2A 2PMUA 3E6CC 2V6CA 3KP2A 6PAXA 4RGSA 1TQIA 4U0WA 5FD6A 2CSOA
chains in the Genus database with same CATH superfamily
2L0KA 4HF0A 1ACIA 1BR1A 4IOCF 1VQ4I 3K4NA 3D0SA 3V42A 4ESJA 3JRBA 3BR2A 3ECOA 1BC7C 4FE4A 1XGSA 5LRRA 4BXFA 5B1AH 3AAFA 3BZCA 5CYVA 2DBBA 5F27A 5HS8A 5FROA 2OTJI 2HDWA 3HRSA 1MD0A 3TDZC 1TL8A 3DPTA 2HWVA 2IGOA 2EIMH 2XRNA 4MTEA 4O3MA 3VFZA 2UXXA 1JGSA 3FBIB 1ITYA 2DA1A 1UG2A 2JJ7A 2WTEA 2UZKA 2IPQX 3QAHA 2JPBA 4H4KC 4LG0B 4D7NA 1IRFA 4ZYDA 2HNHA 5IY5H 1Z05A 2K9SA 3EYYA 4RAFA 2HYGD 2KISA 4UVCA 5FGMA 3BTJA 4EGYA 4JOMA 4F55A 3WTTC 4EM1A 1OCRH 2DMPA 1R7JA 2IGMA 1U0JA 3R60A 3PL8A 1REPC 5IT9K 4BHPA 4DJAA 3S17J 3AL0B 1TC3C 3HTUA 3RTRA 1I50J 2CS3A 3ASOH 2CW8A 3CUQB 4A0XA 3QPTA 4FE7A 2K4JA 4JX4A 5BS6A 3HPHA 1ZG3A 2CQNA 1IDYA 2HTJA 1YTYA 4B3XA 4MQ9F 5M5XJ 2TDXA 3FX3A 4LMYA 1LDJA 4BE2A 2IGNA 1V5EA 2GA2A 4MTDA 5K1YA 1ZELA 4JX5A 1QZEA 2BY1A 1DUXC 1XGMA 5DCMA 3Q0UA 4I01A 1EF4A 1IRZA 2NRAC 4OWRB 3OYLA 2IEKA 4RGXA 1GXPA 3G2BA 4AWXB 1PP8F 1D0YA 2ZC2A 3HZJA 4A3JJ 2E19A 1FBSA 1JT0A 1SVLA 2DI3A 1MMDA 4FQGA 4L5JA 2H6CA 3OSFA 4XORA 4I0BA 2EFOA 2HZTA 3FISA 3RPUD 1U3EM 3ERED 3BY6A 1SFOJ 3MZ8A 2AHQA 2K9QA 2LF8A 1IGNA 5DEQA 3A2KA 5K5RA 2CFOA 3HIFA 3WHBA 4JK1X 3FMRA 4XLPF 5F1RA 2AXTC 3KYDB 1ZG5A 2VN2A 1RR7A 4YRVA 1XCVA 3JAMZ 1T56A 2VJIA 2QBYA 4BHBA 3LSHA 4CYCB 3OS2A 3L2WA 3S2HJ 2QBYB 4Y7NJ 1KQ8A 2JZYA 3R4KA 5HLIA 2R7RA 1RKTA 3MZYA 4G12A 3T0YA 2V79A 4E7ZA 3K70D 3FMSA 2RQPA 5B3SH 2X6OA 5IT3A 4A3IJ 2HU9A 2DA3A 2Z99A 4IRGA 2XHKA 5F1JA 3CCRI 4IHVA 1J59A 3LSMA 3SHFA 4Y13A 3C2BA 3GFMA 1R58A 5EG0A 2NS8A 3TEDA 2HZDA 3P9KA 4KDPA 3VEPA 3BR3A 3CF5F 4RLQA 4PSXA 2XV4S 4HA8A 1MJ9A 1SD6A 2CH0A 3L2VA 2CG4A 4BEHB 2JK3A 3SQNA 1ZLKA 3HRUA 2EA4A 5FKLA 3FXUA 1ENHA 3SXYA 3E5UA 1F5TA 2BOLA 2KT0A 2GOXB 2DMUA 3OSGA 1FYMA 4FX4A 2ZMEB 2ADUA 2JA6J 3GEZA 4A3FJ 1P2FA 3LA2A 4A0ZA 3JRIA 2X1EA 2BVMA 4EEFG 1I39A 2LNBA 5EEHA 3OYCA 5JVGF 4XNFA 3MKZA 4HEA2 1HW5A 1E17A 1BI2A 3ZMTA 4AVPA 1Y1WJ 1UHWA 4DZJA 1JGGA 2ETHA 3WU0A 1H8AC 2XGCA 5JHUA 1P4XA 4RB0A 1B8IA 1ON2A 2C6YA 4CUGA 4I76A 2JQ7A 2XSDC 4LD5A 2CMPA 5BPIA 3ABTA 3KEQA 2JSCA 2HDCA 2BXYA 1ZGAA 3BWGA 3IV5A 3FXLA 3LMMA 3O8GA 5LGNA 3OYEA 2KDZA 3ZQQA 2OCCH 3HC7A 2ELJA 2FSWA 5DUKA 2M34A 4Z2YA 2DTRA 2E34A 5GAGJ 1R49A 4PGGA 4HSTA 2ACJA 2GXAA 4Q5SF 3ZMUA 4A3CJ 4ZDLA 3V8KA 5CKTA 1TT5B 5M5YJ 4WF2A 5TISC 1E2XA 4A5NA 2OV7A 4PJLA 1X3UA 3G4SI 1MKMA 3VB2A 2O03A 3E1SA 3GTJJ 2KHMA 3MKLA 5EG0B 1LEAA 3V7CA 1B1BA 3K69A 1MSEC 4ENNA 5ICGA 4BJTA 1MSFC 1OCCH 5KAIC 1SMTA 1ETOA 4HV6A 1EH7A 2Y0SN 3HHHA 2OQGA 1Y39A 3ESWB 4CHUA 2O8KA 1Y56A 1RR8C 3HDDA 2DT5A 3LOCA 4OAYA 3SEQA 2L9SA 3F8CA 1L3LA 2H1LA 1QZZA 1JKOC 1YRNA 3JTGA 5DCMB 1H88C 3TDUC 4J19A 2DT7B 3L2RA 4DBQA 2K02A 3JRCA 3K9TA 3G1OA 3ZXSA 4V2GA 2LOOA 2BYVE 1W5SA 3V7SA 1TQMA 4DGWB 4F52A 2E1MB 1H0MA 1I27A 4MNUA 2P6TA 4XKCA 5HDKA 5F0HA 3COAC 2EH3A 2PQ8A 2QKLB 2RVCA 4R8HA 5BNGA 1BL0A 3W6VA 4AM3A 3DTKA 2K27A 3JRFA 5D5VB 4BQAA 2FNPA 3BLYA 3NWSA 4ZJZA 4M3BA 1YW9A 2L4AA 3O6BB 3PNVA 3K2AA 1X4OA 3DPLC 1K61A 2QQ9A 2MSYA 2Z5UA 3BROA 3KP5A 3UKGA 3AG3H 4WK8F 2OPTA 3DTEA 2M45A 4BH9A 2EFNA 5CLSA 2OJED 2BW3A 2XB0X 4E6KG 4N9IA 4DBRA 1MBHA 4WX9A 3CDLA 4OU0A 1IJWC 2DA4A 1LJ9A 1XD7A 3WGIA 3HOZJ 1D0XA 2LMDA 4DNCA 2JUGA 5LGUA 2CRGA 4ZDPA 1J2XA 3CC7I 1IN5A 1ZQ3P 3HTSB 2E1CA 2ZJRF 3S3OA 3L00A 3IKTA 5L3EA 2QCOA 1UELB 2Q2EA 2BZTA 2LF7A 5F0FA 4B8XA 3OYGA 1T2KA 4IHXA 3HOVJ 2MD5A 3QOPA 4U88A 1Y8RB 2K5CA 4UB6C 3W6JB 2ID3A 2B0LA 1HQCA 1E3HA 2L7FP 2WBMA 4N4OB 3HKZA 5CVUA 4P55A 3BZ6A 1TT0A 1OLTA 3OOUA 5J40A 1NK2P 4J01A 3L2UA 4YIIA 1R22A 2IRFG 1ZHFA 2LD5A 1VZ0A 3KZZA 1SVMA 4C2UA 4CGZA 5D8KB 3E6DA 2IW5A 1D5YA 3OWTA 3CD6I 5J8CA 4PFPA 2M5WA 4HSRA 5EF6A 2G9WA 2PMZA 3EYIA 1U8RA 4IZZA 2X85A 2BY3A 1XN7A 3O2PE 3MKYB 3HUGB 2HQAA 5J47A 5DD4A 3JRDA 2OA4A 3LAJA 4XN0A 1B72A 4ZTJA 3WTUC 5JHFA 2L4MA 2K3FA 2OBPA 5FRMA 1POGA 3N05A 4IVNA 4CYDA 4HX7A 2F6CA 4XONA 2CU7A 3JR9A 2WV0A 3EETA 1I1GA 4RA2A 4MEYF 4MGRA 1ETYA 3IRRA 5IYCJ 2DMNA 4UUSA 3ZQIA 3JW4A 2A69F 1QO0D 2EILH 2XRLA 4G6TB 4CCMA 2E1OA 4GDFA 2R5YB 1UMQA 1SEUA 3S3NA 2X6XA 3IWFA 1OISA 3KIOA 1GV5A 3B6AA 1PYVA 2DYRH 4UVBA 2CUEA 3MMYB 3KEYA 4HNTA 3CDIA 2NVUB 1NG6A 4L9NA 4NQWB 2VE9A 4ZC3A 3V8JA 2ID6A 2XAJA 4NQWA 4F7ZA 3KZIC 1ORKA 2LK2A 1Y1VJ 3JRAA 3I56I 2EPFA 2KIMA 3DLAA 4G6QA 4Y17A 2DT6A 3DEUA 3M8FA 5FFXA 4RM3A 3EUKL 1JI8A 4L5EA 2DA6A 3J7YJ 4MFDA 3U1KA 2HPMA 4LB5A 4UHTA 4LITA 4EM2A 2VODA 5IT9Z 1AHDP 3NWTA 1G3WA 3BZKA 4B3AA 2VONA 3BCAA 2CGPA 1IO2A 2LP0A 3BTIA 3U1DA 2EA2A 3VOEA 1R1UA 1F4KA 3ROUA 2PJRA 3T8TA 5CQGA 3FHZA 1XC5A 2GQQA 3JREA 3PO2J 1ZYRF 2D5VA 4BL0B 1BJAA 2XGXA 4OIQF 4BE1A 1PUFB 2XF6A 4E4HA 3IHUA 1OCZH 1LPQA 2OZUA 2UUZA 3S8PA 1T0FA 3TOAA 1DPUA 1YX3A 4HPQA 3C18A 4Q4ZF 1R23A 4QLCU 3AKZA 2VT3A 2R5YA 3PSFA 4E7JA 4G9YA 3M1CA 1BR4A 1ZN2A 3Q3SA 2BW3B 1FLIA 1JE8A 2I5UA 4EQQA 4ZYEA 1T98A 2WAEA 2KZGA 2GAUA 3F8NA 3NQOA 4FETA 3ZR8X 4E7SA 2CO5A 5TRDA 3DKYA 1ZR2A 3SZPA 3LAPA 4E7LA 2OF7A 4XOTA 4W97A 3OY9A 1ETQA 2Q0OA 2VPRA 4KT5C 4N9HA 4HOBA 3N97A 3K4CA 1H9TA 3ZOBA 5EYRA 3AG1H 2H27A 1EH6A 1VQKI 2LBFA 1E3PA 1MZBA 2JA8J 5FFZA 2UV1A 1F9NA 1ZRDA 4BYYA 2PG4A 3GMEA 5J1UA 3A1YA 1UAAA 2Y69H 2A6EF 2QWWA 2JA7J 2HKOA 3I0TA 1KU7A 4LJZF 2F2EA 3TMOA 1D8JA 4OINF 3I55I 2E1MC 2W1OA 1LUJB 2DDBA 2GBYA 4A12A 3QU3A 1S5LC 3CCEI 1X3ZB 1IG7A 2G7HA 1IXSB 1K83J 1AKHB 2CW7A 3DEEA 4BE0A 1Z77A 1TNTA 1ZTRA 4YIFA 1ZREA 4HG2A 1OFCX 4UNOA 2A5YB 5LRSA 4S04A 2VIXA 1FOWA 2MW8A 2EK5A 3GF2A 2ESNA 2NS7A 3QPLA 1WH7A 1QPIA 3BR0A 3WGHA 1S72I 2OTLI 3J7AY 4KIBA 1P4WA 3W2AA 4GCVA 3BC8A 4KIFA 4D5FA 2CV2A 2D2WA 2BBYA 2EFPA 4HX8A 3RYRA 1KU3A 4FASD 2XASA 4A3KJ 4B43A 3A02A 2AQFA 3H5AA 3TL4X 4BGDA 4KN4X 2OZ6A 4FCYA 2MC3A 1ETWA 2VI6A 3KP4A 1JUPA 1JKPC 1G8XA 4X1EA 3FXJA 3DKXA 4XRSA 2DDAA 2EV0A 5E3MA 3H3VK 1XTAA 3PUBA 2FUG2 5HLGA 2OAZA 1KZHA 3BOQA 3TP0A 1N77A 1BBYA 1XGOA 1HDDC 5AIQA 3J80K 4C3JJ 4GXOA 2ZJQF 2QEXI 1QPMA 2P7VB 1MBFA 1VFCA 2PFBA 1SFXA 3ZQGA 1Z9CA 2W85A 1IAWA 3C3WA 4B47A 3HGGA 2ZJPF 3Q0WA 1KGSA 3GZNB 1U9OA 3G1MA 3F72A 4R1HA 3U21A 3FXOA 2DMQA 3JSPA 1O57A 1FOKA 4X0GA 4G7ZF 2OU2A 3FWEA 2QSFX 3TP3A 2R0QC 4EATA 3AG4H 2P5VA 1OYYA 3FF5A 2M1BA 2IP2A 5L3CA 1LFPA 2W25A 1W36C 3R6SA 5JVTA 1S6LA 1XMKA 1FTTA 4BJ6C 1LFUP 1OPCA 1F36A 2JPCA 3PFIA 2HOSA 3L09A 5HS7A 3SFIA 1DPRA 4XRMA 2GWRA 2Y0SA 1FSHA 3FM5A 3WU2C 4LLGF 2O0YA 2KJCA 1KYZA 2NXNB 4Q47A 5AONA 1ZRCA 2BE5F 3OS1A 4Y52J 1ZG1A 2M8EA 3QOEA 3ZN0A 3FBNB 3OOPA 4CH7A 4CDGA 2DJIA 2KIFA 5J4YA 3OIOA 1FBUA 4UB8C 2DJNA 2W00A 1HC8A 2ZJ2A 1QHGA 4C3HJ 2R7VA 3BG5A 4XKWA 1VQ5I 1J75A 5LEKA 4HNVA 4ENJA 3P7NA 5GADJ 1BN5A 1UG0A 3LSKA 4GYIA 4HAMA 4IX7A 1I1SA 3REOA 3M07A 2W84A 3G1LA 2V9VA 4MFEA 2EV6A 1W5TA 1T33A 2EINH 1UB9A 2HQ5A 3RQIA 2ZB9A 1E3OC 1J7KA 1X3WB 5KCMA 5CPRB 2VJJA 2MLGA 4XMYA 3H9JA 4EGZA 2E5ZA 2IS4A 3FK6A 4L0ZB 2WY7Q 4IQ4A 4P9UA 2BEOA 1W4MA 3WTSC 3QYFA 5J6XA 3GTQJ 3C2GA 3BQYA 3P9CA 1V5FA 5E20A 2HQRA 2NNYA 3K4KA 5DTDA 3V4GA 4ZTFA 3WTVC 1T8IA 3QYEA 3DCFA 3CJQB 1BJZA 1X58A 2R4GA 3HJEA 2ELKA 2M8GX 4CCJA 3EDPA 2BY0A 3DXJF 2AS5F 1IUYA 1BW5A 4B44A 2GIZA 4KA4A 1USSA 2ESHA 3FK7A 4BEHA 4A3GJ 2ELHA 3WHCA 3OR1C 1BR2A 2HVSA 3KP3A 1MH4A 4B48A 4V2FA 5LHHA 1G3YA 3EUAA 5JI6A 3VYTB 3I3LA 2XC7A 2KIQA 2PLYA 2A61A 4KNYA 3CCJI 1FP2A 4AYBA 2IS1A 3BT9A 2L7ZA 4RDUA 2NVYJ 2A3SA 3CP8A 1B59A 3TBIA 4KIGA 3BP8A 3LSRA 4BACA 2STTA 4QTRA 3TQNA 5KK1A 4H0EA 2VJ4A 4XLFA 1K7AA 4CYCA 3ZMVA 3OYKA 4M9ZA 1VQ8I 5KAFC 3GTKJ 3BG6A 5LHGA 4HDUA 1HXDA 5FRNA 5D4RA 2DPUA 2V9KA 4A3LJ 2M2EA 1JHFA 2NVXJ 3A01A 1LNWA 4P1WA 3X2QH 3EPZA 2CUJA 2HS5A 2HYFA 3CCVI 3OYMA 2DTZA 1EV7A 1MJBA 1PP7U 2NNNA 4RAYA 4D9JA 2G7UA 2DW4A 1FP1D 3Q9VA 1FTZA 3MD2A 5EEGA 5E79C 3L7WA 2COBA 2RV8A 4CSWA 1XMXA 1ZKGA 2MGQA 1TNSA 1R5HA 4DW6A 4HQEA 1FIPA 2EWNA 3ELKA 4G6DA 4JBAA 4MEXF 4FT8A 1XDSA 1OQYA 4CA0A 4ENKA 1QQIA 2ZNYA 1FY7A 2GXGA 2YX7A 4HRIA 1D8KA 1SVOA 1VQNI 4A6EA 4XLCA 1W0TA 2VBZA 3TW7A 5D5XB 3ZQ7A 2CFXA 1J0RA 3P9IA 1JTXA 2VOOA 3HM5A 3GLLA 1YLFA 2FXAA 2R7FA 3K7AJ 3QPSA 2ZXHA 1I3QJ 2NVTJ 4M71A 1L0OC 5KHDA 2QLZA 1NK3P 1HKSA 3N4MA 3BDDA 3CP2A 2QSGX 2HQNA 3VWBA 2FEZA 2F5CA 3IH3A 4M3EA 4G94A 4EMSA 3DF8A 2V6EA 1IRGA 2M87A 2ZCWA 5LEJA 2CJJA 2XAHA 3MQ0A 1S7EA 4ON0A 5HDGA 5CVVA 1XSXA 2F4IA 4D1QA 4IEJA 3QQAA 4BHCA 3HOYJ 4E7KA 5GAEJ 3CUOA 2M0CA 4UY8I 2RREA 3IP4B 1RUOA 4U7DA 2JA2A 1V54H 3ASNH 2K4BA 4ZYHA 2RN7A 4A3MJ 1A5JA 1B72B 5GTIC 3GTMJ 2QVOA 1X2MA 3I64A 3K4LA 3MFKA 1ODDA 3S2DJ 1FNNA 1R4MB 3CUQC 1KONA 3K4MA 1NG7A 1XG1A 3V7RA 3HL2A 4XL9A 2IGKA 1RIOH 5GP9A 5CJ9A 2F4OB 3C2HA 2A07F 1W7PD 1V4RA 2O7OA 2KIUA 1CF7B 3CMMA 5CVRA 1VQPI 3K4JA 4AC0A 3MVPA 3PUFA 1HCRA 3I59B 4IHSA 1R5GA 2A6TA 4NC7A 3OL4A 1BIBA 4OOIA 1DQUA 4E7HA 1VF9A 4NDLA 1B4AA 4J00A 1MBKA 3FZVA 1FOYA 1W5CC 2CQ7A 2PN6A 4AIHA 3FM3A 5M3FJ 3HOWJ 2EFWA 2VBXA 3RKQA 1I6HJ 2LKSA 4XR6A 5E17F 2ZNZA 4M74A 1OCPA 1OYIA 4D5CA 1U5TC 2XKOA 3ZQFA 3TO6A 3OYJA 1G59A 5E8GA 3PFYA 1V3FA 5FB2A 1HDPA 3CMAI 3ZQCA 3G3ZA 3BCBA 3NRVA 3DLLF 4A5MA 5DM6F 2GLOA 4RLFA 3ZMDA 2D45A 5BMZA 5EDNA 2WB1N 5HOOA 2P6SA 1I3AA 3S15J 1FEXA 2FOWA 3CMEI 5H6RA 1AU7A 4PJJA 2FBKA 2R7ZJ 1Z3XA 1PVEA 3F8BA 2WY8Q 2AXLA 2BGCA 2F5DA 2FJ1A 2JRTA 3SDGA 5E18F 1IRXA 3EUHC 3KYLA 4PJMA 3T1BA 3WG7H 4UUVA 5HVQC 2HYJA 1H89C 3H35A 3HHGA 2PI0A 1XMAA 2M9HA 4QWQA 3AFHA 1TWCJ 2NYXA 2QF7A 1IV6A 2UXNA 5B1BH 5ICFA 3OYIA 3RZDJ 2VB6A 4BY7J 2XPVA 1TQPA 3LWFA 1R6RA 1FPQA 3ONQA 5F6FA 1MJAA 1IXRC 3F22A 4M73A 2HR3A 4HX4A 1TW2A 5D8LB 3KP7A 3CCSI 3GFLA 5ICEA 5M3MJ 3IAS2 2R7SA 5D5UB 4S05A 2BXZA 2QGUA 4R79A 2YPRA 5CVIA 4G8XA 4LLLA 1FYLA 4P5OA 3H9GA 3WG9A 1A04A 3GFJA 4I98B 4PFOA 4BJ5C 1W1WE 2AQEA 3RQ4A 2DCEA 5DS9A 1B9MA 1FOXA 1U5TA 4RGUA 4U87A 5LLQA 3DBRB 4JP0A 2X6YA 2V1DA 3LA3A 3OL3A 3OYFA 3FKIJ 2J5OA 3PO3J 3KLOA 2E2IJ 2FMLA 3ABLH 4L18B 3CLOA 1K78B 1VQ7I 2VUMJ 1MNEA 2HXIA 1U6GA 3HUGA 3CC4I 2K86A 2MA3A 2EIJH 3PSIA 5FKNA 4YELA 4LIVA 1S7AA 2RNGA 3EUHA 5BQTA 1FWZA 4IOAF 2OQRA 2GXBA 3S16J 4HDVA 1ETVA 1TWAJ 3T8RA 1GLNA 1RNLA 2PMHA 2DU9A 2QYOA 3HEFA 4LB6B 3PJRA 2LR8A 2DPDA 4CCLA 2DLLA 3S1MJ 1SD7A 3DU5A 1IN4A 5IYBJ 3CDHA 3HXLA 3MN2A 2HGCA 1OR7C 4PK4A 3KETA 2HOEA 4NC8A 4XK4A 5J4VA 1Z6TA 2E71A 3CCLI 4AIDA 1BOAA 3F0CA 4XBFA 3WE2A 3HYIA 3RCOA 3K2ZA 1XDUA 2ICWG 2XB5A 3CJNA 3ERMA 2X51A 1LB2A 1JT6A 3ZGKA 2L54A 4YG2F 2Y0MA 2YR2A 4LGWA 1RZ4A 4DYQA 1DU0A 2HI3A 4FHTA 3M4OJ 2LLKA 3DTIA 2LFBA 3NAUA 5IOYA 1BI0A 1NHAA 5TGTA 3GTGJ 3WTWC 5DYMA 1YJWI 2OD5A 3BJAA 1GV2A 1MH3A 3IRQA 3F8FA 4QPOA 2K7LA 2VOPA 4ENMA 2QQBA 3G6EI 4BXXJ 3FXQA 3VYSB 5HS9A 3H3ZA 1USTA 3DFGA 2R92J 3E5QA 2NOJB 5FKOA 1MMGA 2W57A 2VKEA 1R9TJ 4CICA 2E2JJ 1D1CA 2M7AA 2CUZA 4HLXA 2Y30A 1MGTA 2A68F 2K40A 2QUFA 4ZYGA 1VQMI 2VXZA 2D1VA 1IN8A 2OUMA 4P9FA 4G7OF 2KKOA 2KRHA 5KVRA 2YU3A 4UUTA 3ZMSA 5L3FA 1AWCA 1YOVB 5L3BA 4BY1J 2HVQA 4YIRX 3M8EA 3G71I 1FZPB 1D1BA 5J1RA 1UHMA 3PIOF 4ITVA 2FMYA 4F92B 1DGRM 4WWCA 3J7AO 5FLMJ 2RDPA 3W2WA 4II3A 5IP6A 5HLHA 3F6OA 1P92A 2X9DA 1A6IA 2N8GA 2VQGA 3OS0A 2KJBA 2VL8A 3CCUI 3ZP5A 3VSKA 2YX4A 4WXHA 2JVGA 2V1NA 1MDMB 2DA7A 2RAEA 4II2A 1BA5A 3QODA 4A69C 1LDDA 4QSHA 1WWXA 1C0WA 5F64A 1UFMA 1QNTA 4BKXA 2DA5A 2P8TA 1CGPA 2HVRA 2HFHA 4ABZA 5L3GA 4EVIA 4OIPF 1GVDA 3QRFF 4UXNA 1JKRC 2H8WA 4ZH4F 2LKPA 3BR5A 5DM7F 2LYCA 3JRHA 1X2NA 2DK5A 3A4CA 1IUFA 4MIMA 3WGGA 2GM4A 4NC6A 2MH9A 2DA2A 4BNCA 1MBEA 2R7QA 3D1NI 2QZ8A 4JX6A 1UJ8A 5FKKA 4HW0A 1QRYA 1Y8QB 5H2FC 4EJVA 1W0UA 3OYBA 5D5WB 1TTYA 1B8IB 2WADA 4LFUA 1TZLA 5EGOA 1XB4A 1BM9A 2EFQA 1WVRA 2YUSA 2WAQN 2R5ZA 2M0MA 3JAMK 2EZHA 3QPHA 1WI3A 5K5OA 4CCOA 1BW6A 2LY1A 1YW8A 2NS0A 1VTNC 3I71A 3Q5FA 2KPMA 1YFHA 5EZHA 4A93J 3BG9A 1YJNI 2KZVA 3PNTA 1YS7A 2O6GE 2VKHA 3F23A 3CTAA 4KT6A 5FD5A 1JJ8C 2EV5A 2XVCA 3J7ZI 5IYDJ 2VKDA 5JLWA 1FJLA 4BDZA 4LG0A 1S8NA 2V1XA 2FD5A 1OCTC 3F3XA 2CW0F 2KL4A 1HF0A 1X1AA 5K7HA 1FBQA 2Z9OA 1UHSA 3BJ6A 2VBYA 2ZSHB 1HA8A 5GPAA 2QA4I 5GTHC 3VDXA 1K4TA 3F21A 1YHQI 4F91B 2LBFB 3S3MA 2VKVA 2Y48A 1N25A 1IN7A 2DQRA 1BC8C 4HF2A 2DOEA 3BTLA 2R7UA 1VQOI 2HTSA 1E0EA 5DUIA 2L2OA 1U78A 2FNAA 2WA0A 3LQQA 3RYPA 4Q48A 4M6VA 5LD2C 2KMUA 3FMQA 1SMYF 5E3LA 5E3NA 1WJBA 5IP7J 2JA5J 4I09A 1IV8A 1AOYA 3I5UA 2E2HJ 4I7HA 2V7FA 2MYSA 4WXCA 2CQQA 3WTXC 2JN6A 3MEXA 1KA8A 5GPCA 2BHYA 2KDOA 3O3KA 5DDGA 3H3UA 2E35A 1IZ1A 5F04A 2EQRA 3WTYC 1HSTA 3FDYA 5CVJA 5K7FA 2RKHA 3FXMA 3SZGA 2Y9ZA 3H0GJ 2DFIA 2W82A 4AUXA 5DV5A 1Z1DA 2MC4A 2ZO4A 9ANTA 1SD4A 3ZN1A 5KNLA 3I58A 4MQVA 1Q1HA 1S29A 3C1DA 4IPAA 1UZCA 3I4PA 4RGRA 1YG2A 1WJ5A 5IOZA 2JVHA 5E1XA 1HW2A 5ILVA 1Y0UA 3ZQLA 2MBFA 4IF4A 1ZARA 1TLHB 2FU4A 2FQ4A 3DU6A 1K79A 2IXSA 2OCEA 2HXOA 4QPQA 3E5XA 2VJ5A 4XLNF 2WAFA 2JTVA 5B5EC 2EBIA 2RQQA 2LRDA 4EJWA 3H5NA 2ZMEC 3CESA 4NBQA 4LOCA 5D4SA 2F48A 4JQFA 4ASNA 3CO7C 1JUMA 3CCMI 2JT1A 3SZTA 5F0CA 2M4GA 1OKRA 3SYTA 1LE8A 4M6YA 1Q1VA 4C9YA 1P7JA 2L7MP 2LC2A 2COMA 2HEOA 2WC2A 3RZOJ 3KFWX 3PQKA 1RC9A 2PEXA 1YIJI 1ZGJA 1VQ6I 2BY2A 4LLNA 3F8MA 1RESA 1Z7UA 3GXOA 4IJAA 4QIWN 1IC8A 1OMIA 2F4MB 3SEZA 1S9HA 3K1NA 4I0AA 1P7IA 3BQZA 4OMYA 1OR7A 4PGHA 5C3EJ 2EB7A 2L01A 3PQJA 4U7BA 4M9XA 2PJRB 1JTYA 3GTPJ 1VNDA 4MO7A 4C3IJ 2CQXA 2L02A 2XSJC 3HSEA 1N75A 1FC3A 3PM1A 1RRJA 2IVMA 1VQ9I 1D5VA 3GWZA 2VXDA 2DFHA 3OV8A 3CCQI 2MD0A 1JXSA 3M1EA 4ZYAA 3W3CA 5DD8A 1RUNA 1QVTA 1XCBA 3VPRA 5JR3A 2IS6A 4I02A 4XKVA 3U2RA 2K9NA 1A31A 4IHYA 4ZZDA 4IO9F 1OJLA 1JJ6C 1DGWY 1ERDA 2X1DA 3DQVC 3G73A 2R93J 1N78A 2DMTA 4PSWA 3S93A 5ED4A 3IL2A 3WE3A 4KJZA 3RPUA 3CZ6A 1MW7A 1PUFA 1I6XA 4HBLA 3L2CA 2QQ8A 3DBLB 4N0BA 5FLVA 2P7CB 1GUUA 3I54A 3WTZA 1W7PA 2P0WA 4Y33A 1Y6IA 4FTHA 2NVQJ 5LGTA 4RS8A 3RSNA 3LSPA 3F6VA 4JYKA 1Z21A 4A2UA 4DOZA 5LBQA 1M1EB 4XN3A 5LHIA 4GO1A 5E1WA 1BI1A 2CYYA 2IA0A 2M7BA 4RM2A 4IKFA 3BJOA 1PJRA 3OYHA 1SAUA 1P4AA 5J8FA 1WHUA 3QYBA 1SFKA 3HOTA 2H94A 5BOXA 2L9VA 2Z3YA 3GTOJ 3P5JA 3B73A 3H9QA 5D6FA 1DDNA 4ZDOA 1X1PA 4BS9A 4XKBA 3FKJA 2HOAA 2ZXIA 4P96A 3OIPA 2XROA 1I5ZA 3W6KB 3ML6A 1JKQC 1Z91A 1HBXG 3MCZA 2V26A 1QBJA 1WFXA 1WJCA 5H6QA 3WU1B 3IWZA 4B09A 3CCYA 3HOUJ 2B63J 2ME6A 1IDZA 3RJPA 5GAHJ 1FYKA 4RAGA 3SFZA 1RI7A 4A6DA 2XGDA 3LA7A 5DCFA 2F5VA 1FX7A 2IJLA 1JHHA 2VT2A 4LK0F 2R7TA 2K3PA 2DFFA 2L9NA 4L0YB 5FLXZ 1ETXA 4TV7A 5K5QA 3SJMA 4M3FA 2DYSH 4XRFA 4M3GA 4ETSA 3LSTA 4DZPA 3DKWA 2JMWA 3HOSA 3M9AA 3E7LA 4BAYA 2HOTA 3BPXA 3ABUA 2L9RA 3GLXA 1R00A 4E70A 3DPUA 4YFNF 2DFEA 4FISA 4XLAA 3F9KA 2R3SA 3NEUA 2I10A 3L1PA 2XGEA 4DYRA 3AL0C 2XIGA 3K6GA 2Y75A 4AIKA 4U0VA 2FRHA 4BQNA 5K7ZA 2R7WA 5C4XJ 3K70C 1IW7F 4IL6C 3FXRA 3LL7A 1WKMA 4KICA 4BU2A 2DXIA 1VI0A 2YS9A 1TWHJ 1U9NA 4HLYA 3E3VA 3K1MA 3ZMZA 3GFIA 4RB3C 1VQLI 4HZFA 5BPDA 3AG2H 1BI3A 2E1NA 3L9FA 5A2QZ 1WRJA 5E3OA 5JLXA 2H1KA 1F1ZA 3R0JA 4Z6YA 1B9NA 2O8XA 3TO9A 3H5RA 2F5EA 3MWMA 1WSUA 2IAIA 4N4NB 4D0PA 2W24A 1LQ1A 5IP9J 1CQTA 3HOXJ 3NARA 2IT0A 2I8DA 5CQEA 1APLC 2IA2A 4PZJA 4XSXF 4BXUA 1W36D 1Z6RA 3LFUA 4U0YA 5ICCA 4HF1A 1OCOH 3ZRGA 3QU6A 4KUMA 1SFEA 2Y2ZA 4CCKA 3S1NJ 2X6WA 1YIOA 2MLKA 1YW7A 3M7GA 4W1UA 3DV8A 2H09A 4PDKA 5E1ZB 4E7IA 2J5PA 2XDVA 1KQ0A 1YITI 2R7OA 4HNUA 2LH9A 5FKMA 1O4XA 4L9VA 4L9JA 2HDDA 2K9MA 3HSRA 3ZPLA 1J09A 3ABMH 4EM0B 2VC0A 1OYWA 3SDBA 1R1TA 1MIJA 3CJTB 3LFKA 4RAZA 2UWMA 3FXKA 1LVKA 4AIJA 2Q2EB 1J9IA 3ULQB 1YJ9I 2VC1A 3JRGA 3OMYA 2FA5A 4RMNA 1FIAA 4KFCA 4X6AJ 3RDIA 4XRSG 4IHWA 4A0YA 1QZYA 4UV9A 3R61A 1ULYA 2ISZA 2FQ3A 1LE8B 3BTCA 1FMVA 2VQCA 2ZMEA 2WAQA 1FMWA 3ZQHA 4S0HB 1YE9A 4NUBA 2WV1A 2Z1DA 2HPIA 4Y3OA 1P6RA 1B6AA 1WI9A 1KQ9A 2DQLA 3J81Z 2M4KA 2R5ZB 2XAQA 4Y4RA 3JTHA 1XSDA 2E36A 2CQKA 4L9TA 5EZGA 5EGOB 3M8JA 1HSJA 3PIPF 4EV0A 3RKWA 3GZ5A 5C44J 3H36A 3GTLJ 3TKYA 1TWFJ 2MG4A 2P5KA 3I9V2 4I6ZA 3A01B 1R71A 4AYBN 4O5VA 2BV6A 3E0JB 2GA1A 5HLTA 4YEJA 3HG9A 2CWEA 5F08A 3CMYA 2O9LA 4KITB 4XQFA 1RETA 4M3DA 5ILUA 2DODA 3S14J 1YRNB 4PJNA 1EH8A 2CV0A 2BHZA 2FBIA 1WJFA 3A03A 3EQLF 1MBJA 1YS6A 4KISA 4FX0A 2Q8KA 2O3FA 1YI2I 3LSGA 1BIAA 3IKVA 2LVSA 4GRIA 2HKXA 1IXCA 2X0LA 1U2WA 4MLOA 5B66C 2KRCA 1K6YA 1LDKB 3GYHX 4B4CA 1DP3A 2ISYA 3MAJA 4CZZA 2Y9YA 2ZFUA 1V55H 1GT0C 2H6BA 1O7FA 2QSHX 3FIWA 2A5WA 4HV5A 3T5XA 4XOPA 4IHTA 2KQRA 4AU7A 2W4SA 2XF7A 3UNGC 4CZCA 3KP6A 1YX5A 2Z16A 2G0EA 1ZK8A 3ABKH 4RB2C 4B1RA 1T08B 1SAXA 4DIQA 4XIDA 3GW2A 2BVLA 3TW6A 1WJEA 1QGPA 1WH5A 5EEAA 3RKYA 4ESFA 2QM3A 1XPXA 1Z67A 2KRFA 1T38A 1ZR4A 3U9GA 3QP6A 4XLEA 2VBWA 2ME0A 2E5NA 4LG3A 1D0ZA 3BPVA 2DK8A 2VLAA 1O3RA 2MABA 3HPGA 3OR2C 3K4BA 2ECBA 1ON1A 2EZKA 1WPKA 1Z0XA 2LG4A 4M72A 4AVZA 1EJ9A 2YU9J 1QU3A 2XUBA 1PUEE 4OMZA 5EJCA 3IC7A 4KMFA 5HNFA 1MDMA 5AIPA 3I4NJ 3A0BC 1IF1A 2CUFA 2LREA 2X4HA 1ZGWA 1QVUA 2VASA 4A3BJ 3J80Z 1X1DA 1ZH5A 3BR1A 1AKHA 3GVAA 1TW3A 3LQRA 4GFBA 4IXAA 5FO5A 1T95A 2P81A 3KEOA 4PCQA 1X1CA 3ECHA 1K6OA 1SFUA 3M3YJ 3BG3A 3RKXA 3S1RJ 3LSJA 4NB5A 5A2QK 2DN0A 2JSPA 1A6QA 3GZ6A 2VQHA 3RPQA 1TBXA 3KZYA 2RC4A 4BQOA 4WCGA 1YQAA 2CV1A 1Z7LA 2E60A 1A35A 3CQZJ 2NOGA 1AA7A 2FOKA 2LSOA 4K2EA 4OAZA 4UVAA 5J3LA 4G7HF 3S2WA 2IA1A 3KYCB 4NHJA 1G6NA 1U5TB 2ZBKA 3RIRA 3CLQA 2WWYA 1G4DA 1D1AA 2ZSIB 1TP4A 2Q1ZB 1O3SA 2PMZN 3I53A 2B9SA 2EZLA 4I2OA 4PUSA 2RGVA 3HRTA 4WXDA 5ERIA 3VYUB 4AD9A 3H1CA 2YSRA 1J5YA 2TRTA 5FLXK 3TOBA 3HSFA 3Q9SA 2KP6A 3IH4A 2O61A 3D5LA 3BR6A 4M6XA 1XS9A 1R36A 2DO7A 4ZZLA 5LFAA 4EJTA 1WJDA 1ONVA 1R5ID 1K78A 3QWLA 5HDNA 4KMUX 2XPUA 1EKEA 2OC6A 4L5IA 1GXQA 4LK1F 4OIRF 4RBOA 5J1YA 1LVAA 4A3EJ 1FSEA 1G3SA 2VE8A 3BG7A 1DP7P 1XX5A 1G3TA 1FT9A 1K4SA 3KX2A 3O8HA 2VPLA 4MHGA 5TJJA 3TGNA 2JRMA 3R0AA 3E6BA 5IPAA 2Y31A 3KE2A 1T0FC 3L2QA 2Z33A 3DP7A 4NNJA 5H20A 4BBRJ 4OIOF 2R7XA 4C30A 3HGYA 4C2MJ 3GO5A 2ZXWH 2QQAA 4CO8A 2XAFA 1ZLJA 2V4JC 2DOAA 1D3YA 3DBHB 3GCMA 3OYNA 2JWTA 2QKMB 3K0LA 1MMAA 1HW1A 3CC2I 4BQQA 4HYEA 4UV8A 4XSZF 2A05A 2VQLA 3IH2A 3H0DA 2V9PA 4BBSJ 1V5GA 2K9LA 3JSOA 2ZXJA 1NTCA 1KU2A 2ZFWA 1JUSA 1TWGJ 3CUQA 3PNYA 4GYGA 5HODA 2XAGA 1O3QA 3S1QJ 3D5RC 4V19K 5L3DA 1HOMA 3HB9A 4YFXF 1R1VA 2KFDA 1T6SA 3KCCA 3FHNA 1NH3A 2DOFA 4YFKF 2XKPA 4GGGA 2K85A 1MNMC 1GVJA 2LDUA 2Z2SB 3DWLE 2FF4A 4C2TA 2NAZA 4DQ2A 3LNQA 4XM3A 1WZ2A 3CO6C 2M3AA 2H8RA 2QENA 3WODF 2M30A 3E97A 2ZKZA 4BDYA 1IN6A 4KYWA 3Q0VA 1SD5A 1O3TA 1HLVA 2AO9A 2D1HA 4ESBA 2R7DA 1RKWA 3ZCOA 2EJRA 2P5LC 4EJUA 3OYAA 3RI4A 1HKTA 3VODA 1SANA 3OIQA 1QA6A 5JFRA 2F5FA 4CXFA 1UCRA 1STZA 4F93B 4I99C 1EA3A 1X19A 2KLOA 2W7NA 1RPWA 1WCMJ 2A6HF 3GX4X 3I59A 1U8BA 2P4WA 3B02A 2FE3A 3B6CA 2LY9A 2FBHA 5ILSA 1CF7A 4UUSB 4HQMA 2PBIA 1H9GA 1KU9A 1MMNA 2X48A 1KYWA 1X4PA 3JCUC 3VYRB 2GOMA 4XICA 1YO5C 2L5QA 4Y15A 1W7PB 3VSLA 1Y0NA 3ISPA 2LTPA 1WGXA 3GBGA 4M9SA 2E7WA 2RNJA 1R4NB 2E7XA 5E8IA 1ZRFA 2STWA 1DU6A 2MFZA 4ANJA 4IRIA 2LKXA 2EIKH 2B7EA 1ETKA 4IRHA 2LY2A 2O5RA 3C7JA 3KPHA 5M5WJ 3TO7A 1G2HA 4A3DJ 1MNDA 2JUCA 3CF2A 1T39A 2L3DA 1HKQA 2GIVA 2DAOA 3V8LA 3MZHA 2MH2A 3W2VA 1QHHD 2IS2A 4IQJA 1LEBA 3K1PA 3D5SC 3H92A 5D6EA 3J81K 3OYDA 1F43A 1XSVA 4O6JA 2PJPA 2XPWA 2WB1A 3LSIA 1PDNC 3I4MJ 2IBDA 4XLHA 1P9QC 1S3JA 3QP5A 3GUDA 2GZWA 1GHCA 3A0HC 2L7KA 3UR3C 4KN7X 2ECCA 4PJ0C 4CCNA 4D7MA 1X1BA 1XGNA 1ZAOA 3KLNA 5FJ8J 2XF5A 1LFBA 1YYVA 3CJRB 2PX9A 5C4JJ 1LKXA 2FX0A 1WJAA 1MBGA 2EZIA 1MMSA 4DYCA 4EJOA 2V1UA 4RB1A 5HNHA 1S7OA 2TCTA 2X1CA 3HKZN 3S32A 3HRMA 1GDTA 4BUPA 3IUOA 3HBLA 1SC7A 3MKWB 3E6MA 4LIUA 1O7LA 1WQ2A 2PMUA 3DEWA 3E6CC 2V6CA 3IAM2 3KP2A 4F3QA 6PAXA 3K10A 4RGSA 1TQIA 1Z3YA 4U0WA 1A36A 5FD6A 2W48A 2CSOA 2XAUA 1BOBA
chains in the Genus database with same CATH topology
4HF0A 3D0SA 4ESJA 1BC7C 3ECOA 1XGSA 5LRRA 3AAFA 5CYVA 2DBBA 5HS8A 3HRSA 1MD0A 3TDZC 3DPTA 2HWVA 2XRNA 4MTEA 4O3MA 3VFZA 2UXXA 1JGSA 2UZKA 2WTEA 2IPQX 3QAHA 2JPBA 4LG0B 1IRFA 4ZYDA 1Z05A 3EYYA 2HYGD 4UVCA 5FGMA 4EGYA 3WTTC 4EM1A 1R7JA 3R60A 1REPC 5IT9K 4BHPA 3HTUA 3RTRA 3CUQB 4A0XA 3QPTA 2K4JA 5BS6A 1ZG3A 2HTJA 1YTYA 4MQ9F 2TDXA 3FX3A 4LMYA 1LDJA 2GA2A 4MTDA 5K1YA 1DUXC 1XGMA 5DCMA 4I01A 2NRAC 4RGXA 1GXPA 4AWXB 1PP8F 1FBSA 2DI3A 4L5JA 2H6CA 4I0BA 2EFOA 2HZTA 1U3EM 3ERED 3BY6A 2LF8A 5DEQA 5K5RA 3HIFA 4JK1X 3FMRA 4XLPF 5F1RA 1ZG5A 2VN2A 1XCVA 3JAMZ 2QBYA 4BHBA 2QBYB 1KQ8A 2JZYA 3R4KA 5HLIA 3MZYA 3T0YA 2V79A 3FMSA 2RQPA 5IT3A 2Z99A 4IRGA 2XHKA 1J59A 3SHFA 4Y13A 3GFMA 1R58A 4KDPA 3P9KA 3VEPA 2XV4S 4HA8A 1MJ9A 1SD6A 2CG4A 3SQNA 1ZLKA 3HRUA 2EA4A 3FXUA 3SXYA 3E5UA 1F5TA 1FYMA 4FX4A 2ZMEB 2ADUA 3GEZA 1P2FA 3LA2A 4A0ZA 2LNBA 5EEHA 1HW5A 1E17A 1BI2A 3ZMTA 4AVPA 1UHWA 2ETHA 3WU0A 5JHUA 1P4XA 4RB0A 1ON2A 2C6YA 4LD5A 5BPIA 3ABTA 3KEQA 2JSCA 2HDCA 1ZGAA 3BWGA 5LGNA 2FSWA 5DUKA 4Z2YA 2DTRA 4PGGA 2ACJA 4Q5SF 3ZMUA 3V8KA 4WF2A 1E2XA 4A5NA 1X3UA 1MKMA 3VB2A 2O03A 1LEAA 3V7CA 1B1BA 3K69A 4ENNA 5ICGA 1SMTA 4HV6A 1EH7A 3HHHA 2OQGA 4CHUA 2DT5A 3F8CA 1L3LA 1QZZA 3JTGA 5DCMB 3TDUC 2K02A 3K9TA 2BYVE 1W5SA 3V7SA 1TQMA 1H0MA 1I27A 4MNUA 2P6TA 5HDKA 3COAC 2PQ8A 4R8HA 2RVCA 2K27A 5D5VB 4BQAA 2FNPA 1YW9A 2L4AA 3O6BB 3DPLC 2QQ9A 2Z5UA 3BROA 3KP5A 4WK8F 2M45A 4BH9A 2EFNA 5CLSA 4N9IA 4WX9A 4OU0A 1LJ9A 1XD7A 3WGIA 4DNCA 5LGUA 1J2XA 1IN5A 3HTSB 2E1CA 3L00A 3IKTA 5L3EA 2Q2EA 2LF7A 4B8XA 1T2KA 2MD5A 3QOPA 4U88A 3W6JB 2B0LA 1HQCA 5CVUA 4P55A 3BZ6A 4YIIA 1R22A 2IRFG 1ZHFA 3KZZA 4CGZA 5D8KB 3E6DA 2IW5A 5J8CA 2M5WA 2G9WA 3EYIA 1U8RA 1XN7A 3O2PE 5DD4A 2OA4A 3LAJA 3WTUC 2L4MA 2OBPA 4IVNA 4CYDA 4HX7A 2WV0A 3EETA 1I1GA 4MEYF 4MGRA 3IRRA 3JW4A 2A69F 1QO0D 3IWFA 4UVBA 4L9NA 2VE9A 3V8JA 2XAJA 4NQWA 4F7ZA 2KIMA 4G6QA 4Y17A 3DEUA 3M8FA 5FFXA 4LB5A 4UHTA 4EM2A 2VODA 5IT9Z 1G3WA 2VONA 2CGPA 3U1DA 2EA2A 3VOEA 1R1UA 1F4KA 3ROUA 3T8TA 3FHZA 2GQQA 1ZYRF 1BJAA 2XGXA 4OIQF 3IHUA 2OZUA 1T0FA 3TOAA 1DPUA 3C18A 4Q4ZF 1R23A 4QLCU 2VT3A 4G9YA 1ZN2A 1FLIA 1JE8A 4ZYEA 4EQQA 3NQOA 1T98A 2GAUA 3F8NA 5TRDA 2CO5A 3SZPA 3LAPA 2Q0OA 4KT5C 4N9HA 3N97A 4HOBA 1H9TA 2H27A 1EH6A 1MZBA 5FFZA 1F9NA 1ZRDA 4BYYA 2PG4A 2A6EF 2QWWA 2HKOA 3I0TA 1KU7A 4LJZF 2F2EA 1D8JA 4OINF 4A12A 3QU3A 2G7HA 1IXSB 1TNTA 4YIFA 1ZREA 4UNOA 2A5YB 5LRSA 4S04A 2EK5A 3GF2A 2ESNA 3WGHA 4KIBA 1P4WA 4GCVA 4KIFA 2D2WA 2BBYA 2EFPA 4HX8A 3RYRA 1KU3A 2XASA 4KN4X 2OZ6A 2MC3A 3KP4A 2EV0A 5HLGA 2OAZA 3BOQA 1BBYA 1XGOA 5AIQA 3J80K 4GXOA 1QPMA 2P7VB 2PFBA 1SFXA 1Z9CA 2W85A 1IAWA 3C3WA 1KGSA 3F72A 4R1HA 3JSPA 1O57A 1FOKA 4G7ZF 2OU2A 3FWEA 2P5VA 1OYYA 3FF5A 2M1BA 2IP2A 5L3CA 2W25A 3R6SA 5JVTA 1S6LA 1XMKA 1OPCA 2JPCA 3PFIA 3L09A 5HS7A 1DPRA 2GWRA 1FSHA 3FM5A 4LLGF 2O0YA 2KJCA 1KYZA 4Q47A 5AONA 1ZRCA 2BE5F 1ZG1A 2M8EA 3ZN0A 3OOPA 4CDGA 2KIFA 1FBUA 2ZJ2A 1J75A 5LEKA 4ENJA 3P7NA 1BN5A 4GYIA 4HAMA 1I1SA 3REOA 2W84A 2V9VA 2EV6A 1W5TA 1UB9A 1J7KA 2MLGA 4EGZA 4L0ZB 4P9UA 2BEOA 1W4MA 3WTSC 5J6XA 3P9CA 5E20A 2HQRA 2NNYA 3V4GA 3WTVC 3EDPA 3DXJF 2AS5F 1IUYA 4KA4A 1USSA 2ESHA 2ELHA 3KP3A 5LHHA 1G3YA 5JI6A 2PLYA 2A61A 4KNYA 1FP2A 2A3SA 1B59A 4KIGA 3BP8A 2STTA 3TQNA 5KK1A 4H0EA 1K7AA 3ZMVA 4M9ZA 5LHGA 4HDUA 1HXDA 5D4RA 2DPUA 1JHFA 1LNWA 2HS5A 2HYFA 1EV7A 1MJBA 1PP7U 2NNNA 4RAYA 2G7UA 2DW4A 1FP1D 3Q9VA 5EEGA 3L7WA 2RV8A 1TNSA 1R5HA 4HQEA 2EWNA 3ELKA 4G6DA 4JBAA 4MEXF 4FT8A 1XDSA 4ENKA 1QQIA 2ZNYA 1FY7A 2GXGA 2YX7A 1D8KA 4A6EA 2VBZA 5D5XB 3ZQ7A 2CFXA 1J0RA 3P9IA 2VOOA 1YLFA 2FXAA 2R7FA 4M71A 1L0OC 2QLZA 1HKSA 3N4MA 3BDDA 2HQNA 2FEZA 2F5CA 4G94A 4EMSA 3DF8A 1IRGA 2M87A 2ZCWA 5LEJA 2XAHA 3MQ0A 4ON0A 5HDGA 5CVVA 1XSXA 4BHCA 3CUOA 1RUOA 4U7DA 2K4BA 4ZYHA 2RN7A 2QVOA 3I64A 3MFKA 1ODDA 1FNNA 3CUQC 3V7RA 1RIOH 5CJ9A 2A07F 1W7PD 1V4RA 2KIUA 1CF7B 5CVRA 3I59B 4IHSA 1R5GA 1BIBA 4OOIA 1B4AA 3FZVA 2PN6A 4AIHA 3FM3A 2VBXA 5E17F 2ZNZA 4M74A 1OYIA 1U5TC 2XKOA 3TO6A 5E8GA 1V3FA 5FB2A 3G3ZA 3NRVA 4A5MA 3ZMDA 2D45A 5BMZA 5HOOA 2P6SA 5H6RA 2FBKA 3F8BA 2EFWA 2AXLA 2BGCA 2F5DA 2JRTA 5E18F 3T1BA 4UUVA 5HVQC 3HHGA 2PI0A 1XMAA 4QWQA 2NYXA 2UXNA 5ICFA 1TQPA 3LWFA 1FPQA 5F6FA 1MJAA 1IXRC 3F22A 4M73A 2HR3A 4HX4A 1TW2A 5D8LB 3KP7A 3GFLA 5ICEA 5D5UB 4S05A 4R79A 2YPRA 5CVIA 4G8XA 4LLLA 1FYLA 4P5OA 3WG9A 1A04A 3GFJA 4I98B 1B9MA 1U5TA 4RGUA 5LLQA 2V1DA 3LA3A 2J5OA 3KLOA 2FMLA 4L18B 3CLOA 1K78B 1U6GA 3HUGA 2K86A 2MA3A 1S7AA 3EUHA 5BQTA 1FWZA 2OQRA 2GXBA 4HDVA 3T8RA 1RNLA 2PMHA 2DU9A 2QYOA 4LB6B 2DPDA 2DLLA 1SD7A 1IN4A 3CDHA 2HGCA 3KETA 2HOEA 1Z6TA 1BOAA 4XBFA 3WE2A 3HYIA 3K2ZA 1XDUA 3CJNA 1LB2A 2L54A 4YG2F 2Y0MA 2YR2A 4LGWA 1RZ4A 4FHTA 1BI0A 1NHAA 3WTWC 5DYMA 2OD5A 3BJAA 3IRQA 3F8FA 2K7LA 2VOPA 4ENMA 2QQBA 3FXQA 5HS9A 3H3ZA 1USTA 3DFGA 3E5QA 2W57A 4CICA 4HLXA 1MGTA 2A68F 2QUFA 4ZYGA 2VXZA 2D1VA 1IN8A 4P9FA 4G7OF 2KKOA 5KVRA 2YU3A 1AWCA 3ZMSA 5L3FA 5L3BA 3M8EA 1FZPB 1UHMA 2FMYA 4WWCA 3J7AO 2RDPA 5HLHA 3F6OA 1P92A 2KJBA 3ZP5A 2YX4A 4WXHA 1MDMB 1LDDA 1WWXA 1C0WA 5F64A 1UFMA 1QNTA 2P8TA 1CGPA 2HFHA 5L3GA 4EVIA 4OIPF 3QRFF 4UXNA 4ZH4F 2LKPA 2DK5A 3WGGA 2MH9A 4BNCA 2QZ8A 4HW0A 4EJVA 5D5WB 1TTYA 4LFUA 1XB4A 1BM9A 2EFQA 3JAMK 3QPHA 5K5OA 1YW8A 2NS0A 1VTNC 3I71A 3Q5FA 1YFHA 1YS7A 2O6GE 3F23A 3CTAA 5FD5A 2EV5A 2XVCA 4LG0A 1S8NA 2V1XA 3F3XA 2CW0F 1FBQA 2Z9OA 3BJ6A 2VBYA 3F21A 2Y48A 1IN7A 2DQRA 1BC8C 4HF2A 2HTSA 5DUIA 1U78A 2FNAA 3LQQA 3RYPA 4Q48A 3FMQA 1SMYF 4I09A 1AOYA 3I5UA 4I7HA 4WXCA 3WTXC 3MEXA 1KA8A 3O3KA 5DDGA 3H3UA 1IZ1A 3WTYC 1HSTA 5CVJA 2RKHA 2DFIA 5DV5A 1Z1DA 2ZO4A 1SD4A 3ZN1A 3I58A 4MQVA 1Q1HA 1S29A 3C1DA 4IPAA 3I4PA 4RGRA 1YG2A 5E1XA 1HW2A 5ILVA 1Y0UA 2MBFA 4IF4A 1ZARA 1TLHB 2FU4A 1K79A 3E5XA 4XLNF 2JTVA 4EJWA 5D4SA 3CO7C 4ASNA 4JQFA 2JT1A 3SZTA 1OKRA 4M6YA 2COMA 2HEOA 2WC2A 3KFWX 3PQKA 2PEXA 1ZGJA 4LLNA 3F8MA 1Z7UA 3GXOA 4IJAA 1OMIA 3K1NA 4I0AA 4OMYA 1OR7A 4PGHA 2EB7A 2L01A 3PQJA 4U7BA 4M9XA 3HSEA 2L02A 1FC3A 2IVMA 1D5VA 3GWZA 3OV8A 1JXSA 3M1EA 5DD8A 1RUNA 1XCBA 5JR3A 4I02A 3U2RA 4ZZDA 3DQVC 3G73A 5ED4A 3IL2A 3WE3A 3RPUA 1I6XA 4HBLA 3L2CA 4N0BA 2P7CB 3WTZA 3I54A 1W7PA 5LGTA 4RS8A 3F6VA 4A2UA 5LBQA 5LHIA 4GO1A 5E1WA 2CYYA 1BI1A 2IA0A 3BJOA 1P4AA 5J8FA 3HOTA 2H94A 5BOXA 2Z3YA 3B73A 5D6FA 1DDNA 4P96A 2XROA 1I5ZA 3W6KB 3ML6A 1Z91A 1HBXG 3MCZA 1QBJA 5H6QA 3WU1B 3IWZA 4B09A 3RJPA 1FYKA 3SFZA 1RI7A 4A6DA 3LA7A 5DCFA 1FX7A 2IJLA 1JHHA 2VT2A 4LK0F 4L0YB 5FLXZ 4TV7A 5K5QA 4XRFA 4ETSA 3LSTA 3DKWA 3HOSA 3M9AA 4BAYA 3BPXA 3ABUA 3GLXA 1R00A 4E70A 4YFNF 2R3SA 3NEUA 2XIGA 4AIKA 2Y75A 4U0VA 2FRHA 1IW7F 3FXRA 1WKMA 4KICA 4HLYA 3E3VA 3K1MA 3ZMZA 3GFIA 4RB3C 4HZFA 5BPDA 1BI3A 2E1NA 3L9FA 5A2QZ 1WRJA 1F1ZA 3R0JA 1B9NA 2O8XA 3TO9A 2F5EA 3MWMA 1WSUA 4D0PA 2W24A 1LQ1A 2IT0A 2IA2A 4PZJA 4XSXF 4BXUA 1Z6RA 4U0YA 5ICCA 4HF1A 3QU6A 4KUMA 1SFEA 1YIOA 2MLKA 1YW7A 3M7GA 3DV8A 2H09A 4PDKA 5E1ZB 2J5PA 1KQ0A 4L9VA 4L9JA 3HSRA 3ZPLA 4EM0B 2VC0A 1OYWA 1R1TA 3LFKA 4RAZA 2UWMA 4AIJA 1J9IA 3ULQB 2VC1A 2FA5A 4KFCA 3RDIA 4A0YA 1QZYA 4UV9A 3R61A 1ULYA 2ISZA 2FQ3A 2ZMEA 1P6RA 1B6AA 1WI9A 1KQ9A 2DQLA 3J81Z 2XAQA 3JTHA 1XSDA 2CQKA 4L9TA 1HSJA 4EV0A 3RKWA 3GZ5A 3TKYA 2P5KA 4O5VA 2BV6A 2GA1A 2CWEA 5ILUA 1EH8A 2FBIA 3EQLF 1YS6A 4FX0A 2Q8KA 2O3FA 1BIAA 3IKVA 2HKXA 1IXCA 2X0LA 1U2WA 1LDKB 3GYHX 2ISYA 3MAJA 4CZZA 2H6BA 1O7FA 4HV5A 3T5XA 4IHTA 3KP6A 4RB2C 1SAXA 3GW2A 1QGPA 3RKYA 4ESFA 2QM3A 2KRFA 1T38A 3U9GA 3QP6A 2VBWA 3BPVA 2DK8A 1O3RA 1ON1A 4M72A 2XUBA 1PUEE 4OMZA 3IC7A 4KMFA 1MDMA 5AIPA 1IF1A 2X4HA 3J80Z 1ZH5A 3GVAA 1TW3A 3LQRA 4IXAA 5FO5A 3KEOA 4PCQA 3ECHA 1K6OA 1SFUA 3RKXA 4NB5A 5A2QK 3GZ6A 3RPQA 1TBXA 3KZYA 2RC4A 4WCGA 1YQAA 4K2EA 2FOKA 2LSOA 4UVAA 4G7HF 3S2WA 2IA1A 4NHJA 1G6NA 1U5TB 2ZBKA 3RIRA 2WWYA 1G4DA 1O3SA 3I53A 4I2OA 2RGVA 3HRTA 4WXDA 5ERIA 4AD9A 2YSRA 1J5YA 5FLXK 3TOBA 3HSFA 3Q9SA 2O61A 3D5LA 4M6XA 1R36A 2DO7A 4ZZLA 4EJTA 1ONVA 1K78A 5HDNA 4KMUX 4L5IA 1GXQA 4LK1F 4OIRF 1LVAA 1FSEA 1G3SA 2VE8A 1DP7P 1G3TA 1FT9A 4MHGA 5TJJA 3TGNA 3R0AA 3E6BA 3KE2A 2Z33A 3DP7A 5H20A 4OIOF 3GO5A 2QQAA 4CO8A 2XAFA 1ZLJA 1D3YA 3K0LA 1HW1A 4HYEA 4UV8A 4XSZF 3JSOA 2ZXJA 2ZFWA 1KU2A 3CUQA 4GYGA 2XAGA 1O3QA 5L3DA 4YFXF 1R1VA 1T6SA 3KCCA 4YFKF 2XKPA 4GGGA 1GVJA 2LDUA 2FF4A 2NAZA 4DQ2A 3CO6C 2QENA 3WODF 2M30A 3E97A 2ZKZA 1IN6A 4KYWA 1SD5A 1O3TA 2D1HA 4ESBA 2R7DA 2EJRA 2P5LC 4EJUA 3RI4A 1HKTA 3VODA 5JFRA 2F5FA 4CXFA 1UCRA 1STZA 3GX4X 2A6HF 3I59A 2P4WA 3B02A 2FE3A 2FBHA 5ILSA 1CF7A 4HQMA 1H9GA 1KU9A 2PBIA 1KYWA 1YO5C 4Y15A 1W7PB 3ISPA 4M9SA 2E7WA 2RNJA 2STWA 2E7XA 5E8IA 1ZRFA 4IRIA 4IRHA 3C7JA 3TO7A 1T39A 2L3DA 1HKQA 2GIVA 2DAOA 3V8LA 3MZHA 2MH2A 1LEBA 3K1PA 3H92A 5D6EA 3J81K 1XSVA 4O6JA 2PJPA 1PDNC 1S3JA 3QP5A 2GZWA 3GUDA 1GHCA 4KN7X 1XGNA 1ZAOA 3KLNA 1YYVA 4EJOA 2V1UA 4RB1A 1S7OA 3HRMA 3E6MA 1O7LA 1WQ2A 2PMUA 3E6CC 2V6CA 3KP2A 6PAXA 4RGSA 1TQIA 4U0WA 5FD6A 2CSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HF0 A;  3D0S A;  4ESJ A;  1BC7 C;  3ECO A;  1XGS A;  5LRR A;  3AAF A;  5CYV A;  2DBB A;  5HS8 A;  3HRS A;  1MD0 A;  3TDZ C;  3DPT A;  2HWV A;  2XRN A;  4MTE A;  4O3M A;  3VFZ A;  2UXX A;  1JGS A;  2UZK A;  2WTE A;  2IPQ X;  3QAH A;  2JPB A;  4LG0 B;  1IRF A;  4ZYD A;  1Z05 A;  3EYY A;  2HYG D;  4UVC A;  5FGM A;  4EGY A;  3WTT C;  4EM1 A;  1R7J A;  3R60 A;  1REP C;  5IT9 K;  4BHP A;  3HTU A;  3RTR A;  3CUQ B;  4A0X A;  3QPT A;  2K4J A;  5BS6 A;  1ZG3 A;  2HTJ A;  1YTY A;  4MQ9 F;  2TDX A;  3FX3 A;  4LMY A;  1LDJ A;  2GA2 A;  4MTD A;  5K1Y A;  1DUX C;  1XGM A;  5DCM A;  4I01 A;  2NRA C;  4RGX A;  1GXP A;  4AWX B;  1PP8 F;  1FBS A;  2DI3 A;  4L5J A;  2H6C A;  4I0B A;  2EFO A;  2HZT A;  1U3E M;  3ERE D;  3BY6 A;  2LF8 A;  5DEQ A;  5K5R A;  3HIF A;  4JK1 X;  3FMR A;  4XLP F;  5F1R A;  1ZG5 A;  2VN2 A;  1XCV A;  3JAM Z;  2QBY A;  4BHB A;  2QBY B;  1KQ8 A;  2JZY A;  3R4K A;  5HLI A;  3MZY A;  3T0Y A;  2V79 A;  3FMS A;  2RQP A;  5IT3 A;  2Z99 A;  4IRG A;  2XHK A;  1J59 A;  3SHF A;  4Y13 A;  3GFM A;  1R58 A;  4KDP A;  3P9K A;  3VEP A;  2XV4 S;  4HA8 A;  1MJ9 A;  1SD6 A;  2CG4 A;  3SQN A;  1ZLK A;  3HRU A;  2EA4 A;  3FXU A;  3SXY A;  3E5U A;  1F5T A;  1FYM A;  4FX4 A;  2ZME B;  2ADU A;  3GEZ A;  1P2F A;  3LA2 A;  4A0Z A;  2LNB A;  5EEH A;  1HW5 A;  1E17 A;  1BI2 A;  3ZMT A;  4AVP A;  1UHW A;  2ETH A;  3WU0 A;  5JHU A;  1P4X A;  4RB0 A;  1ON2 A;  2C6Y A;  4LD5 A;  5BPI A;  3ABT A;  3KEQ A;  2JSC A;  2HDC A;  1ZGA A;  3BWG A;  5LGN A;  2FSW A;  5DUK A;  4Z2Y A;  2DTR A;  4PGG A;  2ACJ A;  4Q5S F;  3ZMU A;  3V8K A;  4WF2 A;  1E2X A;  4A5N A;  1X3U A;  1MKM A;  3VB2 A;  2O03 A;  1LEA A;  3V7C A;  1B1B A;  3K69 A;  4ENN A;  5ICG A;  1SMT A;  4HV6 A;  1EH7 A;  3HHH A;  2OQG A;  4CHU A;  2DT5 A;  3F8C A;  1L3L A;  1QZZ A;  3JTG A;  5DCM B;  3TDU C;  2K02 A;  3K9T A;  2BYV E;  1W5S A;  3V7S A;  1TQM A;  1H0M A;  1I27 A;  4MNU A;  2P6T A;  5HDK A;  3COA C;  2PQ8 A;  4R8H A;  2RVC A;  2K27 A;  5D5V B;  4BQA A;  2FNP A;  1YW9 A;  2L4A A;  3O6B B;  3DPL C;  2QQ9 A;  2Z5U A;  3BRO A;  3KP5 A;  4WK8 F;  2M45 A;  4BH9 A;  2EFN A;  5CLS A;  4N9I A;  4WX9 A;  4OU0 A;  1LJ9 A;  1XD7 A;  3WGI A;  4DNC A;  5LGU A;  1J2X A;  1IN5 A;  3HTS B;  2E1C A;  3L00 A;  3IKT A;  5L3E A;  2Q2E A;  2LF7 A;  4B8X A;  1T2K A;  2MD5 A;  3QOP A;  4U88 A;  3W6J B;  2B0L A;  1HQC A;  5CVU A;  4P55 A;  3BZ6 A;  4YII A;  1R22 A;  2IRF G;  1ZHF A;  3KZZ A;  4CGZ A;  5D8K B;  3E6D A;  2IW5 A;  5J8C A;  2M5W A;  2G9W A;  3EYI A;  1U8R A;  1XN7 A;  3O2P E;  5DD4 A;  2OA4 A;  3LAJ A;  3WTU C;  2L4M A;  2OBP A;  4IVN A;  4CYD A;  4HX7 A;  2WV0 A;  3EET A;  1I1G A;  4MEY F;  4MGR A;  3IRR A;  3JW4 A;  2A69 F;  1QO0 D;  3IWF A;  4UVB A;  4L9N A;  2VE9 A;  3V8J A;  2XAJ A;  4NQW A;  4F7Z A;  2KIM A;  4G6Q A;  4Y17 A;  3DEU A;  3M8F A;  5FFX A;  4LB5 A;  4UHT A;  4EM2 A;  2VOD A;  5IT9 Z;  1G3W A;  2VON A;  2CGP A;  3U1D A;  2EA2 A;  3VOE A;  1R1U A;  1F4K A;  3ROU A;  3T8T A;  3FHZ A;  2GQQ A;  1ZYR F;  1BJA A;  2XGX A;  4OIQ F;  3IHU A;  2OZU A;  1T0F A;  3TOA A;  1DPU A;  3C18 A;  4Q4Z F;  1R23 A;  4QLC U;  2VT3 A;  4G9Y A;  1ZN2 A;  1FLI A;  1JE8 A;  4ZYE A;  4EQQ A;  3NQO A;  1T98 A;  2GAU A;  3F8N A;  5TRD A;  2CO5 A;  3SZP A;  3LAP A;  2Q0O A;  4KT5 C;  4N9H A;  3N97 A;  4HOB A;  1H9T A;  2H27 A;  1EH6 A;  1MZB A;  5FFZ A;  1F9N A;  1ZRD A;  4BYY A;  2PG4 A;  2A6E F;  2QWW A;  2HKO A;  3I0T A;  1KU7 A;  4LJZ F;  2F2E A;  1D8J A;  4OIN F;  4A12 A;  3QU3 A;  2G7H A;  1IXS B;  1TNT A;  4YIF A;  1ZRE A;  4UNO A;  2A5Y B;  5LRS A;  4S04 A;  2EK5 A;  3GF2 A;  2ESN A;  3WGH A;  4KIB A;  1P4W A;  4GCV A;  4KIF A;  2D2W A;  2BBY A;  2EFP A;  4HX8 A;  3RYR A;  1KU3 A;  2XAS A;  4KN4 X;  2OZ6 A;  2MC3 A;  3KP4 A;  2EV0 A;  5HLG A;  2OAZ A;  3BOQ A;  1BBY A;  1XGO A;  5AIQ A;  3J80 K;  4GXO A;  1QPM A;  2P7V B;  2PFB A;  1SFX A;  1Z9C A;  2W85 A;  1IAW A;  3C3W A;  1KGS A;  3F72 A;  4R1H A;  3JSP A;  1O57 A;  1FOK A;  4G7Z F;  2OU2 A;  3FWE A;  2P5V A;  1OYY A;  3FF5 A;  2M1B A;  2IP2 A;  5L3C A;  2W25 A;  3R6S A;  5JVT A;  1S6L A;  1XMK A;  1OPC A;  2JPC A;  3PFI A;  3L09 A;  5HS7 A;  1DPR A;  2GWR A;  1FSH A;  3FM5 A;  4LLG F;  2O0Y A;  2KJC A;  1KYZ A;  4Q47 A;  5AON A;  1ZRC A;  2BE5 F;  1ZG1 A;  2M8E A;  3ZN0 A;  3OOP A;  4CDG A;  2KIF A;  1FBU A;  2ZJ2 A;  1J75 A;  5LEK A;  4ENJ A;  3P7N A;  1BN5 A;  4GYI A;  4HAM A;  1I1S A;  3REO A;  2W84 A;  2V9V A;  2EV6 A;  1W5T A;  1UB9 A;  1J7K A;  2MLG A;  4EGZ A;  4L0Z B;  4P9U A;  2BEO A;  1W4M A;  3WTS C;  5J6X A;  3P9C A;  5E20 A;  2HQR A;  2NNY A;  3V4G A;  3WTV C;  3EDP A;  3DXJ F;  2AS5 F;  1IUY A;  4KA4 A;  1USS A;  2ESH A;  2ELH A;  3KP3 A;  5LHH A;  1G3Y A;  5JI6 A;  2PLY A;  2A61 A;  4KNY A;  1FP2 A;  2A3S A;  1B59 A;  4KIG A;  3BP8 A;  2STT A;  3TQN A;  5KK1 A;  4H0E A;  1K7A A;  3ZMV A;  4M9Z A;  5LHG A;  4HDU A;  1HXD A;  5D4R A;  2DPU A;  1JHF A;  1LNW A;  2HS5 A;  2HYF A;  1EV7 A;  1MJB A;  1PP7 U;  2NNN A;  4RAY A;  2G7U A;  2DW4 A;  1FP1 D;  3Q9V A;  5EEG A;  3L7W A;  2RV8 A;  1TNS A;  1R5H A;  4HQE A;  2EWN A;  3ELK A;  4G6D A;  4JBA A;  4MEX F;  4FT8 A;  1XDS A;  4ENK A;  1QQI A;  2ZNY A;  1FY7 A;  2GXG A;  2YX7 A;  1D8K A;  4A6E A;  2VBZ A;  5D5X B;  3ZQ7 A;  2CFX A;  1J0R A;  3P9I A;  2VOO A;  1YLF A;  2FXA A;  2R7F A;  4M71 A;  1L0O C;  2QLZ A;  1HKS A;  3N4M A;  3BDD A;  2HQN A;  2FEZ A;  2F5C A;  4G94 A;  4EMS A;  3DF8 A;  1IRG A;  2M87 A;  2ZCW A;  5LEJ A;  2XAH A;  3MQ0 A;  4ON0 A;  5HDG A;  5CVV A;  1XSX A;  4BHC A;  3CUO A;  1RUO A;  4U7D A;  2K4B A;  4ZYH A;  2RN7 A;  2QVO A;  3I64 A;  3MFK A;  1ODD A;  1FNN A;  3CUQ C;  3V7R A;  1RIO H;  5CJ9 A;  2A07 F;  1W7P D;  1V4R A;  2KIU A;  1CF7 B;  5CVR A;  3I59 B;  4IHS A;  1R5G A;  1BIB A;  4OOI A;  1B4A A;  3FZV A;  2PN6 A;  4AIH A;  3FM3 A;  2VBX A;  5E17 F;  2ZNZ A;  4M74 A;  1OYI A;  1U5T C;  2XKO A;  3TO6 A;  5E8G A;  1V3F A;  5FB2 A;  3G3Z A;  3NRV A;  4A5M A;  3ZMD A;  2D45 A;  5BMZ A;  5HOO A;  2P6S A;  5H6R A;  2FBK A;  3F8B A;  2EFW A;  2AXL A;  2BGC A;  2F5D A;  2JRT A;  5E18 F;  3T1B A;  4UUV A;  5HVQ C;  3HHG A;  2PI0 A;  1XMA A;  4QWQ A;  2NYX A;  2UXN A;  5ICF A;  1TQP A;  3LWF A;  1FPQ A;  5F6F A;  1MJA A;  1IXR C;  3F22 A;  4M73 A;  2HR3 A;  4HX4 A;  1TW2 A;  5D8L B;  3KP7 A;  3GFL A;  5ICE A;  5D5U B;  4S05 A;  4R79 A;  2YPR A;  5CVI A;  4G8X A;  4LLL A;  1FYL A;  4P5O A;  3WG9 A;  1A04 A;  3GFJ A;  4I98 B;  1B9M A;  1U5T A;  4RGU A;  5LLQ A;  2V1D A;  3LA3 A;  2J5O A;  3KLO A;  2FML A;  4L18 B;  3CLO A;  1K78 B;  1U6G A;  3HUG A;  2K86 A;  2MA3 A;  1S7A A;  3EUH A;  5BQT A;  1FWZ A;  2OQR A;  2GXB A;  4HDV A;  3T8R A;  1RNL A;  2PMH A;  2DU9 A;  2QYO A;  4LB6 B;  2DPD A;  2DLL A;  1SD7 A;  1IN4 A;  3CDH A;  2HGC A;  3KET A;  2HOE A;  1Z6T A;  1BOA A;  4XBF A;  3WE2 A;  3HYI A;  3K2Z A;  1XDU A;  3CJN A;  1LB2 A;  2L54 A;  4YG2 F;  2Y0M A;  2YR2 A;  4LGW A;  1RZ4 A;  4FHT A;  1BI0 A;  1NHA A;  3WTW C;  5DYM A;  2OD5 A;  3BJA A;  3IRQ A;  3F8F A;  2K7L A;  2VOP A;  4ENM A;  2QQB A;  3FXQ A;  5HS9 A;  3H3Z A;  1UST A;  3DFG A;  3E5Q A;  2W57 A;  4CIC A;  4HLX A;  1MGT A;  2A68 F;  2QUF A;  4ZYG A;  2VXZ A;  2D1V A;  1IN8 A;  4P9F A;  4G7O F;  2KKO A;  5KVR A;  2YU3 A;  1AWC A;  3ZMS A;  5L3F A;  5L3B A;  3M8E A;  1FZP B;  1UHM A;  2FMY A;  4WWC A;  3J7A O;  2RDP A;  5HLH A;  3F6O A;  1P92 A;  2KJB A;  3ZP5 A;  2YX4 A;  4WXH A;  1MDM B;  1LDD A;  1WWX A;  1C0W A;  5F64 A;  1UFM A;  1QNT A;  2P8T A;  1CGP A;  2HFH A;  5L3G A;  4EVI A;  4OIP F;  3QRF F;  4UXN A;  4ZH4 F;  2LKP A;  2DK5 A;  3WGG A;  2MH9 A;  4BNC A;  2QZ8 A;  4HW0 A;  4EJV A;  5D5W B;  1TTY A;  4LFU A;  1XB4 A;  1BM9 A;  2EFQ A;  3JAM K;  3QPH A;  5K5O A;  1YW8 A;  2NS0 A;  1VTN C;  3I71 A;  3Q5F A;  1YFH A;  1YS7 A;  2O6G E;  3F23 A;  3CTA A;  5FD5 A;  2EV5 A;  2XVC A;  4LG0 A;  1S8N A;  2V1X A;  3F3X A;  2CW0 F;  1FBQ A;  2Z9O A;  3BJ6 A;  2VBY A;  3F21 A;  2Y48 A;  1IN7 A;  2DQR A;  1BC8 C;  4HF2 A;  2HTS A;  5DUI A;  1U78 A;  2FNA A;  3LQQ A;  3RYP A;  4Q48 A;  3FMQ A;  1SMY F;  4I09 A;  1AOY A;  3I5U A;  4I7H A;  4WXC A;  3WTX C;  3MEX A;  1KA8 A;  3O3K A;  5DDG A;  3H3U A;  1IZ1 A;  3WTY C;  1HST A;  5CVJ A;  2RKH A;  2DFI A;  5DV5 A;  1Z1D A;  2ZO4 A;  1SD4 A;  3ZN1 A;  3I58 A;  4MQV A;  1Q1H A;  1S29 A;  3C1D A;  4IPA A;  3I4P A;  4RGR A;  1YG2 A;  5E1X A;  1HW2 A;  5ILV A;  1Y0U A;  2MBF A;  4IF4 A;  1ZAR A;  1TLH B;  2FU4 A;  1K79 A;  3E5X A;  4XLN F;  2JTV A;  4EJW A;  5D4S A;  3CO7 C;  4ASN A;  4JQF A;  2JT1 A;  3SZT A;  1OKR A;  4M6Y A;  2COM A;  2HEO A;  2WC2 A;  3KFW X;  3PQK A;  2PEX A;  1ZGJ A;  4LLN A;  3F8M A;  1Z7U A;  3GXO A;  4IJA A;  1OMI A;  3K1N A;  4I0A A;  4OMY A;  1OR7 A;  4PGH A;  2EB7 A;  2L01 A;  3PQJ A;  4U7B A;  4M9X A;  3HSE A;  2L02 A;  1FC3 A;  2IVM A;  1D5V A;  3GWZ A;  3OV8 A;  1JXS A;  3M1E A;  5DD8 A;  1RUN A;  1XCB A;  5JR3 A;  4I02 A;  3U2R A;  4ZZD A;  3DQV C;  3G73 A;  5ED4 A;  3IL2 A;  3WE3 A;  3RPU A;  1I6X A;  4HBL A;  3L2C A;  4N0B A;  2P7C B;  3WTZ A;  3I54 A;  1W7P A;  5LGT A;  4RS8 A;  3F6V A;  4A2U A;  5LBQ A;  5LHI A;  4GO1 A;  5E1W A;  2CYY A;  1BI1 A;  2IA0 A;  3BJO A;  1P4A A;  5J8F A;  3HOT A;  2H94 A;  5BOX A;  2Z3Y A;  3B73 A;  5D6F A;  1DDN A;  4P96 A;  2XRO A;  1I5Z A;  3W6K B;  3ML6 A;  1Z91 A;  1HBX G;  3MCZ A;  1QBJ A;  5H6Q A;  3WU1 B;  3IWZ A;  4B09 A;  3RJP A;  1FYK A;  3SFZ A;  1RI7 A;  4A6D A;  3LA7 A;  5DCF A;  1FX7 A;  2IJL A;  1JHH A;  2VT2 A;  4LK0 F;  4L0Y B;  5FLX Z;  4TV7 A;  5K5Q A;  4XRF A;  4ETS A;  3LST A;  3DKW A;  3HOS A;  3M9A A;  4BAY A;  3BPX A;  3ABU A;  3GLX A;  1R00 A;  4E70 A;  4YFN F;  2R3S A;  3NEU A;  2XIG A;  4AIK A;  2Y75 A;  4U0V A;  2FRH A;  1IW7 F;  3FXR A;  1WKM A;  4KIC A;  4HLY A;  3E3V A;  3K1M A;  3ZMZ A;  3GFI A;  4RB3 C;  4HZF A;  5BPD A;  1BI3 A;  2E1N A;  3L9F A;  5A2Q Z;  1WRJ A;  1F1Z A;  3R0J A;  1B9N A;  2O8X A;  3TO9 A;  2F5E A;  3MWM A;  1WSU A;  4D0P A;  2W24 A;  1LQ1 A;  2IT0 A;  2IA2 A;  4PZJ A;  4XSX F;  4BXU A;  1Z6R A;  4U0Y A;  5ICC A;  4HF1 A;  3QU6 A;  4KUM A;  1SFE A;  1YIO A;  2MLK A;  1YW7 A;  3M7G A;  3DV8 A;  2H09 A;  4PDK A;  5E1Z B;  2J5P A;  1KQ0 A;  4L9V A;  4L9J A;  3HSR A;  3ZPL A;  4EM0 B;  2VC0 A;  1OYW A;  1R1T A;  3LFK A;  4RAZ A;  2UWM A;  4AIJ A;  1J9I A;  3ULQ B;  2VC1 A;  2FA5 A;  4KFC A;  3RDI A;  4A0Y A;  1QZY A;  4UV9 A;  3R61 A;  1ULY A;  2ISZ A;  2FQ3 A;  2ZME A;  1P6R A;  1B6A A;  1WI9 A;  1KQ9 A;  2DQL A;  3J81 Z;  2XAQ A;  3JTH A;  1XSD A;  2CQK A;  4L9T A;  1HSJ A;  4EV0 A;  3RKW A;  3GZ5 A;  3TKY A;  2P5K A;  4O5V A;  2BV6 A;  2GA1 A;  2CWE A;  5ILU A;  1EH8 A;  2FBI A;  3EQL F;  1YS6 A;  4FX0 A;  2Q8K A;  2O3F A;  1BIA A;  3IKV A;  2HKX A;  1IXC A;  2X0L A;  1U2W A;  1LDK B;  3GYH X;  2ISY A;  3MAJ A;  4CZZ A;  2H6B A;  1O7F A;  4HV5 A;  3T5X A;  4IHT A;  3KP6 A;  4RB2 C;  1SAX A;  3GW2 A;  1QGP A;  3RKY A;  4ESF A;  2QM3 A;  2KRF A;  1T38 A;  3U9G A;  3QP6 A;  2VBW A;  3BPV A;  2DK8 A;  1O3R A;  1ON1 A;  4M72 A;  2XUB A;  1PUE E;  4OMZ A;  3IC7 A;  4KMF A;  1MDM A;  5AIP A;  1IF1 A;  2X4H A;  3J80 Z;  1ZH5 A;  3GVA A;  1TW3 A;  3LQR A;  4IXA A;  5FO5 A;  3KEO A;  4PCQ A;  3ECH A;  1K6O A;  1SFU A;  3RKX A;  4NB5 A;  5A2Q K;  3GZ6 A;  3RPQ A;  1TBX A;  3KZY A;  2RC4 A;  4WCG A;  1YQA A;  4K2E A;  2FOK A;  2LSO A;  4UVA A;  4G7H F;  3S2W A;  2IA1 A;  4NHJ A;  1G6N A;  1U5T B;  2ZBK A;  3RIR A;  2WWY A;  1G4D A;  1O3S A;  3I53 A;  4I2O A;  2RGV A;  3HRT A;  4WXD A;  5ERI A;  4AD9 A;  2YSR A;  1J5Y A;  5FLX K;  3TOB A;  3HSF A;  3Q9S A;  2O61 A;  3D5L A;  4M6X A;  1R36 A;  2DO7 A;  4ZZL A;  4EJT A;  1ONV A;  1K78 A;  5HDN A;  4KMU X;  4L5I A;  1GXQ A;  4LK1 F;  4OIR F;  1LVA A;  1FSE A;  1G3S A;  2VE8 A;  1DP7 P;  1G3T A;  1FT9 A;  4MHG A;  5TJJ A;  3TGN A;  3R0A A;  3E6B A;  3KE2 A;  2Z33 A;  3DP7 A;  5H20 A;  4OIO F;  3GO5 A;  2QQA A;  4CO8 A;  2XAF A;  1ZLJ A;  1D3Y A;  3K0L A;  1HW1 A;  4HYE A;  4UV8 A;  4XSZ F;  3JSO A;  2ZXJ A;  2ZFW A;  1KU2 A;  3CUQ A;  4GYG A;  2XAG A;  1O3Q A;  5L3D A;  4YFX F;  1R1V A;  1T6S A;  3KCC A;  4YFK F;  2XKP A;  4GGG A;  1GVJ A;  2LDU A;  2FF4 A;  2NAZ A;  4DQ2 A;  3CO6 C;  2QEN A;  3WOD F;  2M30 A;  3E97 A;  2ZKZ A;  1IN6 A;  4KYW A;  1SD5 A;  1O3T A;  2D1H A;  4ESB A;  2R7D A;  2EJR A;  2P5L C;  4EJU A;  3RI4 A;  1HKT A;  3VOD A;  5JFR A;  2F5F A;  4CXF A;  1UCR A;  1STZ A;  3GX4 X;  2A6H F;  3I59 A;  2P4W A;  3B02 A;  2FE3 A;  2FBH A;  5ILS A;  1CF7 A;  4HQM A;  1H9G A;  1KU9 A;  2PBI A;  1KYW A;  1YO5 C;  4Y15 A;  1W7P B;  3ISP A;  4M9S A;  2E7W A;  2RNJ A;  2STW A;  2E7X A;  5E8I A;  1ZRF A;  4IRI A;  4IRH A;  3C7J A;  3TO7 A;  1T39 A;  2L3D A;  1HKQ A;  2GIV A;  2DAO A;  3V8L A;  3MZH A;  2MH2 A;  1LEB A;  3K1P A;  3H92 A;  5D6E A;  3J81 K;  1XSV A;  4O6J A;  2PJP A;  1PDN C;  1S3J A;  3QP5 A;  2GZW A;  3GUD A;  1GHC A;  4KN7 X;  1XGN A;  1ZAO A;  3KLN A;  1YYV A;  4EJO A;  2V1U A;  4RB1 A;  1S7O A;  3HRM A;  3E6M A;  1O7L A;  1WQ2 A;  2PMU A;  3E6C C;  2V6C A;  3KP2 A;  6PAX A;  4RGS A;  1TQI A;  4U0W A;  5FD6 A;  2CSO A; 
#chains in the Genus database with same CATH topology
 2L0K A;  4HF0 A;  1ACI A;  1BR1 A;  4IOC F;  1VQ4 I;  3K4N A;  3D0S A;  3V42 A;  4ESJ A;  3JRB A;  3BR2 A;  3ECO A;  1BC7 C;  4FE4 A;  1XGS A;  5LRR A;  4BXF A;  5B1A H;  3AAF A;  3BZC A;  5CYV A;  2DBB A;  5F27 A;  5HS8 A;  5FRO A;  2OTJ I;  2HDW A;  3HRS A;  1MD0 A;  3TDZ C;  1TL8 A;  3DPT A;  2HWV A;  2IGO A;  2EIM H;  2XRN A;  4MTE A;  4O3M A;  3VFZ A;  2UXX A;  1JGS A;  3FBI B;  1ITY A;  2DA1 A;  1UG2 A;  2JJ7 A;  2WTE A;  2UZK A;  2IPQ X;  3QAH A;  2JPB A;  4H4K C;  4LG0 B;  4D7N A;  1IRF A;  4ZYD A;  2HNH A;  5IY5 H;  1Z05 A;  2K9S A;  3EYY A;  4RAF A;  2HYG D;  2KIS A;  4UVC A;  5FGM A;  3BTJ A;  4EGY A;  4JOM A;  4F55 A;  3WTT C;  4EM1 A;  1OCR H;  2DMP A;  1R7J A;  2IGM A;  1U0J A;  3R60 A;  3PL8 A;  1REP C;  5IT9 K;  4BHP A;  4DJA A;  3S17 J;  3AL0 B;  1TC3 C;  3HTU A;  3RTR A;  1I50 J;  2CS3 A;  3ASO H;  2CW8 A;  3CUQ B;  4A0X A;  3QPT A;  4FE7 A;  2K4J A;  4JX4 A;  5BS6 A;  3HPH A;  1ZG3 A;  2CQN A;  1IDY A;  2HTJ A;  1YTY A;  4B3X A;  4MQ9 F;  5M5X J;  2TDX A;  3FX3 A;  4LMY A;  1LDJ A;  4BE2 A;  2IGN A;  1V5E A;  2GA2 A;  4MTD A;  5K1Y A;  1ZEL A;  4JX5 A;  1QZE A;  2BY1 A;  1DUX C;  1XGM A;  5DCM A;  3Q0U A;  4I01 A;  1EF4 A;  1IRZ A;  2NRA C;  4OWR B;  3OYL A;  2IEK A;  4RGX A;  1GXP A;  3G2B A;  4AWX B;  1PP8 F;  1D0Y A;  2ZC2 A;  3HZJ A;  4A3J J;  2E19 A;  1FBS A;  1JT0 A;  1SVL A;  2DI3 A;  1MMD A;  4FQG A;  4L5J A;  2H6C A;  3OSF A;  4XOR A;  4I0B A;  2EFO A;  2HZT A;  3FIS A;  3RPU D;  1U3E M;  3ERE D;  3BY6 A;  1SFO J;  3MZ8 A;  2AHQ A;  2K9Q A;  2LF8 A;  1IGN A;  5DEQ A;  3A2K A;  5K5R A;  2CFO A;  3HIF A;  3WHB A;  4JK1 X;  3FMR A;  4XLP F;  5F1R A;  2AXT C;  3KYD B;  1ZG5 A;  2VN2 A;  1RR7 A;  4YRV A;  1XCV A;  3JAM Z;  1T56 A;  2VJI A;  2QBY A;  4BHB A;  3LSH A;  4CYC B;  3OS2 A;  3L2W A;  3S2H J;  2QBY B;  4Y7N J;  1KQ8 A;  2JZY A;  3R4K A;  5HLI A;  2R7R A;  1RKT A;  3MZY A;  4G12 A;  3T0Y A;  2V79 A;  4E7Z A;  3K70 D;  3FMS A;  2RQP A;  5B3S H;  2X6O A;  5IT3 A;  4A3I J;  2HU9 A;  2DA3 A;  2Z99 A;  4IRG A;  2XHK A;  5F1J A;  3CCR I;  4IHV A;  1J59 A;  3LSM A;  3SHF A;  4Y13 A;  3C2B A;  3GFM A;  1R58 A;  5EG0 A;  2NS8 A;  3TED A;  2HZD A;  3P9K A;  4KDP A;  3VEP A;  3BR3 A;  3CF5 F;  4RLQ A;  4PSX A;  2XV4 S;  4HA8 A;  1MJ9 A;  1SD6 A;  2CH0 A;  3L2V A;  2CG4 A;  4BEH B;  2JK3 A;  3SQN A;  1ZLK A;  3HRU A;  2EA4 A;  5FKL A;  3FXU A;  1ENH A;  3SXY A;  3E5U A;  1F5T A;  2BOL A;  2KT0 A;  2GOX B;  2DMU A;  3OSG A;  1FYM A;  4FX4 A;  2ZME B;  2ADU A;  2JA6 J;  3GEZ A;  4A3F J;  1P2F A;  3LA2 A;  4A0Z A;  3JRI A;  2X1E A;  2BVM A;  4EEF G;  1I39 A;  2LNB A;  5EEH A;  3OYC A;  5JVG F;  4XNF A;  3MKZ A;  4HEA 2;  1HW5 A;  1E17 A;  1BI2 A;  3ZMT A;  4AVP A;  1Y1W J;  1UHW A;  4DZJ A;  1JGG A;  2ETH A;  3WU0 A;  1H8A C;  2XGC A;  5JHU A;  1P4X A;  4RB0 A;  1B8I A;  1ON2 A;  2C6Y A;  4CUG A;  4I76 A;  2JQ7 A;  2XSD C;  4LD5 A;  2CMP A;  5BPI A;  3ABT A;  3KEQ A;  2JSC A;  2HDC A;  2BXY A;  1ZGA A;  3BWG A;  3IV5 A;  3FXL A;  3LMM A;  3O8G A;  5LGN A;  3OYE A;  2KDZ A;  3ZQQ A;  2OCC H;  3HC7 A;  2ELJ A;  2FSW A;  5DUK A;  2M34 A;  4Z2Y A;  2DTR A;  2E34 A;  5GAG J;  1R49 A;  4PGG A;  4HST A;  2ACJ A;  2GXA A;  4Q5S F;  3ZMU A;  4A3C J;  4ZDL A;  3V8K A;  5CKT A;  1TT5 B;  5M5Y J;  4WF2 A;  5TIS C;  1E2X A;  4A5N A;  2OV7 A;  4PJL A;  1X3U A;  3G4S I;  1MKM A;  3VB2 A;  2O03 A;  3E1S A;  3GTJ J;  2KHM A;  3MKL A;  5EG0 B;  1LEA A;  3V7C A;  1B1B A;  3K69 A;  1MSE C;  4ENN A;  5ICG A;  4BJT A;  1MSF C;  1OCC H;  5KAI C;  1SMT A;  1ETO A;  4HV6 A;  1EH7 A;  2Y0S N;  3HHH A;  2OQG A;  1Y39 A;  3ESW B;  4CHU A;  2O8K A;  1Y56 A;  1RR8 C;  3HDD A;  2DT5 A;  3LOC A;  4OAY A;  3SEQ A;  2L9S A;  3F8C A;  1L3L A;  2H1L A;  1QZZ A;  1JKO C;  1YRN A;  3JTG A;  5DCM B;  1H88 C;  3TDU C;  4J19 A;  2DT7 B;  3L2R A;  4DBQ A;  2K02 A;  3JRC A;  3K9T A;  3G1O A;  3ZXS A;  4V2G A;  2LOO A;  2BYV E;  1W5S A;  3V7S A;  1TQM A;  4DGW B;  4F52 A;  2E1M B;  1H0M A;  1I27 A;  4MNU A;  2P6T A;  4XKC A;  5HDK A;  5F0H A;  3COA C;  2EH3 A;  2PQ8 A;  2QKL B;  2RVC A;  4R8H A;  5BNG A;  1BL0 A;  3W6V A;  4AM3 A;  3DTK A;  2K27 A;  3JRF A;  5D5V B;  4BQA A;  2FNP A;  3BLY A;  3NWS A;  4ZJZ A;  4M3B A;  1YW9 A;  2L4A A;  3O6B B;  3PNV A;  3K2A A;  1X4O A;  3DPL C;  1K61 A;  2QQ9 A;  2MSY A;  2Z5U A;  3BRO A;  3KP5 A;  3UKG A;  3AG3 H;  4WK8 F;  2OPT A;  3DTE A;  2M45 A;  4BH9 A;  2EFN A;  5CLS A;  2OJE D;  2BW3 A;  2XB0 X;  4E6K G;  4N9I A;  4DBR A;  1MBH A;  4WX9 A;  3CDL A;  4OU0 A;  1IJW C;  2DA4 A;  1LJ9 A;  1XD7 A;  3WGI A;  3HOZ J;  1D0X A;  2LMD A;  4DNC A;  2JUG A;  5LGU A;  2CRG A;  4ZDP A;  1J2X A;  3CC7 I;  1IN5 A;  1ZQ3 P;  3HTS B;  2E1C A;  2ZJR F;  3S3O A;  3L00 A;  3IKT A;  5L3E A;  2QCO A;  1UEL B;  2Q2E A;  2BZT A;  2LF7 A;  5F0F A;  4B8X A;  3OYG A;  1T2K A;  4IHX A;  3HOV J;  2MD5 A;  3QOP A;  4U88 A;  1Y8R B;  2K5C A;  4UB6 C;  3W6J B;  2ID3 A;  2B0L A;  1HQC A;  1E3H A;  2L7F P;  2WBM A;  4N4O B;  3HKZ A;  5CVU A;  4P55 A;  3BZ6 A;  1TT0 A;  1OLT A;  3OOU A;  5J40 A;  1NK2 P;  4J01 A;  3L2U A;  4YII A;  1R22 A;  2IRF G;  1ZHF A;  2LD5 A;  1VZ0 A;  3KZZ A;  1SVM A;  4C2U A;  4CGZ A;  5D8K B;  3E6D A;  2IW5 A;  1D5Y A;  3OWT A;  3CD6 I;  5J8C A;  4PFP A;  2M5W A;  4HSR A;  5EF6 A;  2G9W A;  2PMZ A;  3EYI A;  1U8R A;  4IZZ A;  2X85 A;  2BY3 A;  1XN7 A;  3O2P E;  3MKY B;  3HUG B;  2HQA A;  5J47 A;  5DD4 A;  3JRD A;  2OA4 A;  3LAJ A;  4XN0 A;  1B72 A;  4ZTJ A;  3WTU C;  5JHF A;  2L4M A;  2K3F A;  2OBP A;  5FRM A;  1POG A;  3N05 A;  4IVN A;  4CYD A;  4HX7 A;  2F6C A;  4XON A;  2CU7 A;  3JR9 A;  2WV0 A;  3EET A;  1I1G A;  4RA2 A;  4MEY F;  4MGR A;  1ETY A;  3IRR A;  5IYC J;  2DMN A;  4UUS A;  3ZQI A;  3JW4 A;  2A69 F;  1QO0 D;  2EIL H;  2XRL A;  4G6T B;  4CCM A;  2E1O A;  4GDF A;  2R5Y B;  1UMQ A;  1SEU A;  3S3N A;  2X6X A;  3IWF A;  1OIS A;  3KIO A;  1GV5 A;  3B6A A;  1PYV A;  2DYR H;  4UVB A;  2CUE A;  3MMY B;  3KEY A;  4HNT A;  3CDI A;  2NVU B;  1NG6 A;  4L9N A;  4NQW B;  2VE9 A;  4ZC3 A;  3V8J A;  2ID6 A;  2XAJ A;  4NQW A;  4F7Z A;  3KZI C;  1ORK A;  2LK2 A;  1Y1V J;  3JRA A;  3I56 I;  2EPF A;  2KIM A;  3DLA A;  4G6Q A;  4Y17 A;  2DT6 A;  3DEU A;  3M8F A;  5FFX A;  4RM3 A;  3EUK L;  1JI8 A;  4L5E A;  2DA6 A;  3J7Y J;  4MFD A;  3U1K A;  2HPM A;  4LB5 A;  4UHT A;  4LIT A;  4EM2 A;  2VOD A;  5IT9 Z;  1AHD P;  3NWT A;  1G3W A;  3BZK A;  4B3A A;  2VON A;  3BCA A;  2CGP A;  1IO2 A;  2LP0 A;  3BTI A;  3U1D A;  2EA2 A;  3VOE A;  1R1U A;  1F4K A;  3ROU A;  2PJR A;  3T8T A;  5CQG A;  3FHZ A;  1XC5 A;  2GQQ A;  3JRE A;  3PO2 J;  1ZYR F;  2D5V A;  4BL0 B;  1BJA A;  2XGX A;  4OIQ F;  4BE1 A;  1PUF B;  2XF6 A;  4E4H A;  3IHU A;  1OCZ H;  1LPQ A;  2OZU A;  2UUZ A;  3S8P A;  1T0F A;  3TOA A;  1DPU A;  1YX3 A;  4HPQ A;  3C18 A;  4Q4Z F;  1R23 A;  4QLC U;  3AKZ A;  2VT3 A;  2R5Y A;  3PSF A;  4E7J A;  4G9Y A;  3M1C A;  1BR4 A;  1ZN2 A;  3Q3S A;  2BW3 B;  1FLI A;  1JE8 A;  2I5U A;  4EQQ A;  4ZYE A;  1T98 A;  2WAE A;  2KZG A;  2GAU A;  3F8N A;  3NQO A;  4FET A;  3ZR8 X;  4E7S A;  2CO5 A;  5TRD A;  3DKY A;  1ZR2 A;  3SZP A;  3LAP A;  4E7L A;  2OF7 A;  4XOT A;  4W97 A;  3OY9 A;  1ETQ A;  2Q0O A;  2VPR A;  4KT5 C;  4N9H A;  4HOB A;  3N97 A;  3K4C A;  1H9T A;  3ZOB A;  5EYR A;  3AG1 H;  2H27 A;  1EH6 A;  1VQK I;  2LBF A;  1E3P A;  1MZB A;  2JA8 J;  5FFZ A;  2UV1 A;  1F9N A;  1ZRD A;  4BYY A;  2PG4 A;  3GME A;  5J1U A;  3A1Y A;  1UAA A;  2Y69 H;  2A6E F;  2QWW A;  2JA7 J;  2HKO A;  3I0T A;  1KU7 A;  4LJZ F;  2F2E A;  3TMO A;  1D8J A;  4OIN F;  3I55 I;  2E1M C;  2W1O A;  1LUJ B;  2DDB A;  2GBY A;  4A12 A;  3QU3 A;  1S5L C;  3CCE I;  1X3Z B;  1IG7 A;  2G7H A;  1IXS B;  1K83 J;  1AKH B;  2CW7 A;  3DEE A;  4BE0 A;  1Z77 A;  1TNT A;  1ZTR A;  4YIF A;  1ZRE A;  4HG2 A;  1OFC X;  4UNO A;  2A5Y B;  5LRS A;  4S04 A;  2VIX A;  1FOW A;  2MW8 A;  2EK5 A;  3GF2 A;  2ESN A;  2NS7 A;  3QPL A;  1WH7 A;  1QPI A;  3BR0 A;  3WGH A;  1S72 I;  2OTL I;  3J7A Y;  4KIB A;  1P4W A;  3W2A A;  4GCV A;  3BC8 A;  4KIF A;  4D5F A;  2CV2 A;  2D2W A;  2BBY A;  2EFP A;  4HX8 A;  3RYR A;  1KU3 A;  4FAS D;  2XAS A;  4A3K J;  4B43 A;  3A02 A;  2AQF A;  3H5A A;  3TL4 X;  4BGD A;  4KN4 X;  2OZ6 A;  4FCY A;  2MC3 A;  1ETW A;  2VI6 A;  3KP4 A;  1JUP A;  1JKP C;  1G8X A;  4X1E A;  3FXJ A;  3DKX A;  4XRS A;  2DDA A;  2EV0 A;  5E3M A;  3H3V K;  1XTA A;  3PUB A;  2FUG 2;  5HLG A;  2OAZ A;  1KZH A;  3BOQ A;  3TP0 A;  1N77 A;  1BBY A;  1XGO A;  1HDD C;  5AIQ A;  3J80 K;  4C3J J;  4GXO A;  2ZJQ F;  2QEX I;  1QPM A;  2P7V B;  1MBF A;  1VFC A;  2PFB A;  1SFX A;  3ZQG A;  1Z9C A;  2W85 A;  1IAW A;  3C3W A;  4B47 A;  3HGG A;  2ZJP F;  3Q0W A;  1KGS A;  3GZN B;  1U9O A;  3G1M A;  3F72 A;  4R1H A;  3U21 A;  3FXO A;  2DMQ A;  3JSP A;  1O57 A;  1FOK A;  4X0G A;  4G7Z F;  2OU2 A;  3FWE A;  2QSF X;  3TP3 A;  2R0Q C;  4EAT A;  3AG4 H;  2P5V A;  1OYY A;  3FF5 A;  2M1B A;  2IP2 A;  5L3C A;  1LFP A;  2W25 A;  1W36 C;  3R6S A;  5JVT A;  1S6L A;  1XMK A;  1FTT A;  4BJ6 C;  1LFU P;  1OPC A;  1F36 A;  2JPC A;  3PFI A;  2HOS A;  3L09 A;  5HS7 A;  3SFI A;  1DPR A;  4XRM A;  2GWR A;  2Y0S A;  1FSH A;  3FM5 A;  3WU2 C;  4LLG F;  2O0Y A;  2KJC A;  1KYZ A;  2NXN B;  4Q47 A;  5AON A;  1ZRC A;  2BE5 F;  3OS1 A;  4Y52 J;  1ZG1 A;  2M8E A;  3QOE A;  3ZN0 A;  3FBN B;  3OOP A;  4CH7 A;  4CDG A;  2DJI A;  2KIF A;  5J4Y A;  3OIO A;  1FBU A;  4UB8 C;  2DJN A;  2W00 A;  1HC8 A;  2ZJ2 A;  1QHG A;  4C3H J;  2R7V A;  3BG5 A;  4XKW A;  1VQ5 I;  1J75 A;  5LEK A;  4HNV A;  4ENJ A;  3P7N A;  5GAD J;  1BN5 A;  1UG0 A;  3LSK A;  4GYI A;  4HAM A;  4IX7 A;  1I1S A;  3REO A;  3M07 A;  2W84 A;  3G1L A;  2V9V A;  4MFE A;  2EV6 A;  1W5T A;  1T33 A;  2EIN H;  1UB9 A;  2HQ5 A;  3RQI A;  2ZB9 A;  1E3O C;  1J7K A;  1X3W B;  5KCM A;  5CPR B;  2VJJ A;  2MLG A;  4XMY A;  3H9J A;  4EGZ A;  2E5Z A;  2IS4 A;  3FK6 A;  4L0Z B;  2WY7 Q;  4IQ4 A;  4P9U A;  2BEO A;  1W4M A;  3WTS C;  3QYF A;  5J6X A;  3GTQ J;  3C2G A;  3BQY A;  3P9C A;  1V5F A;  5E20 A;  2HQR A;  2NNY A;  3K4K A;  5DTD A;  3V4G A;  4ZTF A;  3WTV C;  1T8I A;  3QYE A;  3DCF A;  3CJQ B;  1BJZ A;  1X58 A;  2R4G A;  3HJE A;  2ELK A;  2M8G X;  4CCJ A;  3EDP A;  2BY0 A;  3DXJ F;  2AS5 F;  1IUY A;  1BW5 A;  4B44 A;  2GIZ A;  4KA4 A;  1USS A;  2ESH A;  3FK7 A;  4BEH A;  4A3G J;  2ELH A;  3WHC A;  3OR1 C;  1BR2 A;  2HVS A;  3KP3 A;  1MH4 A;  4B48 A;  4V2F A;  5LHH A;  1G3Y A;  3EUA A;  5JI6 A;  3VYT B;  3I3L A;  2XC7 A;  2KIQ A;  2PLY A;  2A61 A;  4KNY A;  3CCJ I;  1FP2 A;  4AYB A;  2IS1 A;  3BT9 A;  2L7Z A;  4RDU A;  2NVY J;  2A3S A;  3CP8 A;  1B59 A;  3TBI A;  4KIG A;  3BP8 A;  3LSR A;  4BAC A;  2STT A;  4QTR A;  3TQN A;  5KK1 A;  4H0E A;  2VJ4 A;  4XLF A;  1K7A A;  4CYC A;  3ZMV A;  3OYK A;  4M9Z A;  1VQ8 I;  5KAF C;  3GTK J;  3BG6 A;  5LHG A;  4HDU A;  1HXD A;  5FRN A;  5D4R A;  2DPU A;  2V9K A;  4A3L J;  2M2E A;  1JHF A;  2NVX J;  3A01 A;  1LNW A;  4P1W A;  3X2Q H;  3EPZ A;  2CUJ A;  2HS5 A;  2HYF A;  3CCV I;  3OYM A;  2DTZ A;  1EV7 A;  1MJB A;  1PP7 U;  2NNN A;  4RAY A;  4D9J A;  2G7U A;  2DW4 A;  1FP1 D;  3Q9V A;  1FTZ A;  3MD2 A;  5EEG A;  5E79 C;  3L7W A;  2COB A;  2RV8 A;  4CSW A;  1XMX A;  1ZKG A;  2MGQ A;  1TNS A;  1R5H A;  4DW6 A;  4HQE A;  1FIP A;  2EWN A;  3ELK A;  4G6D A;  4JBA A;  4MEX F;  4FT8 A;  1XDS A;  1OQY A;  4CA0 A;  4ENK A;  1QQI A;  2ZNY A;  1FY7 A;  2GXG A;  2YX7 A;  4HRI A;  1D8K A;  1SVO A;  1VQN I;  4A6E A;  4XLC A;  1W0T A;  2VBZ A;  3TW7 A;  5D5X B;  3ZQ7 A;  2CFX A;  1J0R A;  3P9I A;  1JTX A;  2VOO A;  3HM5 A;  3GLL A;  1YLF A;  2FXA A;  2R7F A;  3K7A J;  3QPS A;  2ZXH A;  1I3Q J;  2NVT J;  4M71 A;  1L0O C;  5KHD A;  2QLZ A;  1NK3 P;  1HKS A;  3N4M A;  3BDD A;  3CP2 A;  2QSG X;  2HQN A;  3VWB A;  2FEZ A;  2F5C A;  3IH3 A;  4M3E A;  4G94 A;  4EMS A;  3DF8 A;  2V6E A;  1IRG A;  2M87 A;  2ZCW A;  5LEJ A;  2CJJ A;  2XAH A;  3MQ0 A;  1S7E A;  4ON0 A;  5HDG A;  5CVV A;  1XSX A;  2F4I A;  4D1Q A;  4IEJ A;  3QQA A;  4BHC A;  3HOY J;  4E7K A;  5GAE J;  3CUO A;  2M0C A;  4UY8 I;  2RRE A;  3IP4 B;  1RUO A;  4U7D A;  2JA2 A;  1V54 H;  3ASN H;  2K4B A;  4ZYH A;  2RN7 A;  4A3M J;  1A5J A;  1B72 B;  5GTI C;  3GTM J;  2QVO A;  1X2M A;  3I64 A;  3K4L A;  3MFK A;  1ODD A;  3S2D J;  1FNN A;  1R4M B;  3CUQ C;  1KON A;  3K4M A;  1NG7 A;  1XG1 A;  3V7R A;  3HL2 A;  4XL9 A;  2IGK A;  1RIO H;  5GP9 A;  5CJ9 A;  2F4O B;  3C2H A;  2A07 F;  1W7P D;  1V4R A;  2O7O A;  2KIU A;  1CF7 B;  3CMM A;  5CVR A;  1VQP I;  3K4J A;  4AC0 A;  3MVP A;  3PUF A;  1HCR A;  3I59 B;  4IHS A;  1R5G A;  2A6T A;  4NC7 A;  3OL4 A;  1BIB A;  4OOI A;  1DQU A;  4E7H A;  1VF9 A;  4NDL A;  1B4A A;  4J00 A;  1MBK A;  3FZV A;  1FOY A;  1W5C C;  2CQ7 A;  2PN6 A;  4AIH A;  3FM3 A;  5M3F J;  3HOW J;  2EFW A;  2VBX A;  3RKQ A;  1I6H J;  2LKS A;  4XR6 A;  5E17 F;  2ZNZ A;  4M74 A;  1OCP A;  1OYI A;  4D5C A;  1U5T C;  2XKO A;  3ZQF A;  3TO6 A;  3OYJ A;  1G59 A;  5E8G A;  3PFY A;  1V3F A;  5FB2 A;  1HDP A;  3CMA I;  3ZQC A;  3G3Z A;  3BCB A;  3NRV A;  3DLL F;  4A5M A;  5DM6 F;  2GLO A;  4RLF A;  3ZMD A;  2D45 A;  5BMZ A;  5EDN A;  2WB1 N;  5HOO A;  2P6S A;  1I3A A;  3S15 J;  1FEX A;  2FOW A;  3CME I;  5H6R A;  1AU7 A;  4PJJ A;  2FBK A;  2R7Z J;  1Z3X A;  1PVE A;  3F8B A;  2WY8 Q;  2AXL A;  2BGC A;  2F5D A;  2FJ1 A;  2JRT A;  3SDG A;  5E18 F;  1IRX A;  3EUH C;  3KYL A;  4PJM A;  3T1B A;  3WG7 H;  4UUV A;  5HVQ C;  2HYJ A;  1H89 C;  3H35 A;  3HHG A;  2PI0 A;  1XMA A;  2M9H A;  4QWQ A;  3AFH A;  1TWC J;  2NYX A;  2QF7 A;  1IV6 A;  2UXN A;  5B1B H;  5ICF A;  3OYI A;  3RZD J;  2VB6 A;  4BY7 J;  2XPV A;  1TQP A;  3LWF A;  1R6R A;  1FPQ A;  3ONQ A;  5F6F A;  1MJA A;  1IXR C;  3F22 A;  4M73 A;  2HR3 A;  4HX4 A;  1TW2 A;  5D8L B;  3KP7 A;  3CCS I;  3GFL A;  5ICE A;  5M3M J;  3IAS 2;  2R7S A;  5D5U B;  4S05 A;  2BXZ A;  2QGU A;  4R79 A;  2YPR A;  5CVI A;  4G8X A;  4LLL A;  1FYL A;  4P5O A;  3H9G A;  3WG9 A;  1A04 A;  3GFJ A;  4I98 B;  4PFO A;  4BJ5 C;  1W1W E;  2AQE A;  3RQ4 A;  2DCE A;  5DS9 A;  1B9M A;  1FOX A;  1U5T A;  4RGU A;  4U87 A;  5LLQ A;  3DBR B;  4JP0 A;  2X6Y A;  2V1D A;  3LA3 A;  3OL3 A;  3OYF A;  3FKI J;  2J5O A;  3PO3 J;  3KLO A;  2E2I J;  2FML A;  3ABL H;  4L18 B;  3CLO A;  1K78 B;  1VQ7 I;  2VUM J;  1MNE A;  2HXI A;  1U6G A;  3HUG A;  3CC4 I;  2K86 A;  2MA3 A;  2EIJ H;  3PSI A;  5FKN A;  4YEL A;  4LIV A;  1S7A A;  2RNG A;  3EUH A;  5BQT A;  1FWZ A;  4IOA F;  2OQR A;  2GXB A;  3S16 J;  4HDV A;  1ETV A;  1TWA J;  3T8R A;  1GLN A;  1RNL A;  2PMH A;  2DU9 A;  2QYO A;  3HEF A;  4LB6 B;  3PJR A;  2LR8 A;  2DPD A;  4CCL A;  2DLL A;  3S1M J;  1SD7 A;  3DU5 A;  1IN4 A;  5IYB J;  3CDH A;  3HXL A;  3MN2 A;  2HGC A;  1OR7 C;  4PK4 A;  3KET A;  2HOE A;  4NC8 A;  4XK4 A;  5J4V A;  1Z6T A;  2E71 A;  3CCL I;  4AID A;  1BOA A;  3F0C A;  4XBF A;  3WE2 A;  3HYI A;  3RCO A;  3K2Z A;  1XDU A;  2ICW G;  2XB5 A;  3CJN A;  3ERM A;  2X51 A;  1LB2 A;  1JT6 A;  3ZGK A;  2L54 A;  4YG2 F;  2Y0M A;  2YR2 A;  4LGW A;  1RZ4 A;  4DYQ A;  1DU0 A;  2HI3 A;  4FHT A;  3M4O J;  2LLK A;  3DTI A;  2LFB A;  3NAU A;  5IOY A;  1BI0 A;  1NHA A;  5TGT A;  3GTG J;  3WTW C;  5DYM A;  1YJW I;  2OD5 A;  3BJA A;  1GV2 A;  1MH3 A;  3IRQ A;  3F8F A;  4QPO A;  2K7L A;  2VOP A;  4ENM A;  2QQB A;  3G6E I;  4BXX J;  3FXQ A;  3VYS B;  5HS9 A;  3H3Z A;  1UST A;  3DFG A;  2R92 J;  3E5Q A;  2NOJ B;  5FKO A;  1MMG A;  2W57 A;  2VKE A;  1R9T J;  4CIC A;  2E2J J;  1D1C A;  2M7A A;  2CUZ A;  4HLX A;  2Y30 A;  1MGT A;  2A68 F;  2K40 A;  2QUF A;  4ZYG A;  1VQM I;  2VXZ A;  2D1V A;  1IN8 A;  2OUM A;  4P9F A;  4G7O F;  2KKO A;  2KRH A;  5KVR A;  2YU3 A;  4UUT A;  3ZMS A;  5L3F A;  1AWC A;  1YOV B;  5L3B A;  4BY1 J;  2HVQ A;  4YIR X;  3M8E A;  3G71 I;  1FZP B;  1D1B A;  5J1R A;  1UHM A;  3PIO F;  4ITV A;  2FMY A;  4F92 B;  1DGR M;  4WWC A;  3J7A O;  5FLM J;  2RDP A;  3W2W A;  4II3 A;  5IP6 A;  5HLH A;  3F6O A;  1P92 A;  2X9D A;  1A6I A;  2N8G A;  2VQG A;  3OS0 A;  2KJB A;  2VL8 A;  3CCU I;  3ZP5 A;  3VSK A;  2YX4 A;  4WXH A;  2JVG A;  2V1N A;  1MDM B;  2DA7 A;  2RAE A;  4II2 A;  1BA5 A;  3QOD A;  4A69 C;  1LDD A;  4QSH A;  1WWX A;  1C0W A;  5F64 A;  1UFM A;  1QNT A;  4BKX A;  2DA5 A;  2P8T A;  1CGP A;  2HVR A;  2HFH A;  4ABZ A;  5L3G A;  4EVI A;  4OIP F;  1GVD A;  3QRF F;  4UXN A;  1JKR C;  2H8W A;  4ZH4 F;  2LKP A;  3BR5 A;  5DM7 F;  2LYC A;  3JRH A;  1X2N A;  2DK5 A;  3A4C A;  1IUF A;  4MIM A;  3WGG A;  2GM4 A;  4NC6 A;  2MH9 A;  2DA2 A;  4BNC A;  1MBE A;  2R7Q A;  3D1N I;  2QZ8 A;  4JX6 A;  1UJ8 A;  5FKK A;  4HW0 A;  1QRY A;  1Y8Q B;  5H2F C;  4EJV A;  1W0U A;  3OYB A;  5D5W B;  1TTY A;  1B8I B;  2WAD A;  4LFU A;  1TZL A;  5EGO A;  1XB4 A;  1BM9 A;  2EFQ A;  1WVR A;  2YUS A;  2WAQ N;  2R5Z A;  2M0M A;  3JAM K;  2EZH A;  3QPH A;  1WI3 A;  5K5O A;  4CCO A;  1BW6 A;  2LY1 A;  1YW8 A;  2NS0 A;  1VTN C;  3I71 A;  3Q5F A;  2KPM A;  1YFH A;  5EZH A;  4A93 J;  3BG9 A;  1YJN I;  2KZV A;  3PNT A;  1YS7 A;  2O6G E;  2VKH A;  3F23 A;  3CTA A;  4KT6 A;  5FD5 A;  1JJ8 C;  2EV5 A;  2XVC A;  3J7Z I;  5IYD J;  2VKD A;  5JLW A;  1FJL A;  4BDZ A;  4LG0 A;  1S8N A;  2V1X A;  2FD5 A;  1OCT C;  3F3X A;  2CW0 F;  2KL4 A;  1HF0 A;  1X1A A;  5K7H A;  1FBQ A;  2Z9O A;  1UHS A;  3BJ6 A;  2VBY A;  2ZSH B;  1HA8 A;  5GPA A;  2QA4 I;  5GTH C;  3VDX A;  1K4T A;  3F21 A;  1YHQ I;  4F91 B;  2LBF B;  3S3M A;  2VKV A;  2Y48 A;  1N25 A;  1IN7 A;  2DQR A;  1BC8 C;  4HF2 A;  2DOE A;  3BTL A;  2R7U A;  1VQO I;  2HTS A;  1E0E A;  5DUI A;  2L2O A;  1U78 A;  2FNA A;  2WA0 A;  3LQQ A;  3RYP A;  4Q48 A;  4M6V A;  5LD2 C;  2KMU A;  3FMQ A;  1SMY F;  5E3L A;  5E3N A;  1WJB A;  5IP7 J;  2JA5 J;  4I09 A;  1IV8 A;  1AOY A;  3I5U A;  2E2H J;  4I7H A;  2V7F A;  2MYS A;  4WXC A;  2CQQ A;  3WTX C;  2JN6 A;  3MEX A;  1KA8 A;  5GPC A;  2BHY A;  2KDO A;  3O3K A;  5DDG A;  3H3U A;  2E35 A;  1IZ1 A;  5F04 A;  2EQR A;  3WTY C;  1HST A;  3FDY A;  5CVJ A;  5K7F A;  2RKH A;  3FXM A;  3SZG A;  2Y9Z A;  3H0G J;  2DFI A;  2W82 A;  4AUX A;  5DV5 A;  1Z1D A;  2MC4 A;  2ZO4 A;  9ANT A;  1SD4 A;  3ZN1 A;  5KNL A;  3I58 A;  4MQV A;  1Q1H A;  1S29 A;  3C1D A;  4IPA A;  1UZC A;  3I4P A;  4RGR A;  1YG2 A;  1WJ5 A;  5IOZ A;  2JVH A;  5E1X A;  1HW2 A;  5ILV A;  1Y0U A;  3ZQL A;  2MBF A;  4IF4 A;  1ZAR A;  1TLH B;  2FU4 A;  2FQ4 A;  3DU6 A;  1K79 A;  2IXS A;  2OCE A;  2HXO A;  4QPQ A;  3E5X A;  2VJ5 A;  4XLN F;  2WAF A;  2JTV A;  5B5E C;  2EBI A;  2RQQ A;  2LRD A;  4EJW A;  3H5N A;  2ZME C;  3CES A;  4NBQ A;  4LOC A;  5D4S A;  2F48 A;  4JQF A;  4ASN A;  3CO7 C;  1JUM A;  3CCM I;  2JT1 A;  3SZT A;  5F0C A;  2M4G A;  1OKR A;  3SYT A;  1LE8 A;  4M6Y A;  1Q1V A;  4C9Y A;  1P7J A;  2L7M P;  2LC2 A;  2COM A;  2HEO A;  2WC2 A;  3RZO J;  3KFW X;  3PQK A;  1RC9 A;  2PEX A;  1YIJ I;  1ZGJ A;  1VQ6 I;  2BY2 A;  4LLN A;  3F8M A;  1RES A;  1Z7U A;  3GXO A;  4IJA A;  4QIW N;  1IC8 A;  1OMI A;  2F4M B;  3SEZ A;  1S9H A;  3K1N A;  4I0A A;  1P7I A;  3BQZ A;  4OMY A;  1OR7 A;  4PGH A;  5C3E J;  2EB7 A;  2L01 A;  3PQJ A;  4U7B A;  4M9X A;  2PJR B;  1JTY A;  3GTP J;  1VND A;  4MO7 A;  4C3I J;  2CQX A;  2L02 A;  2XSJ C;  3HSE A;  1N75 A;  1FC3 A;  3PM1 A;  1RRJ A;  2IVM A;  1VQ9 I;  1D5V A;  3GWZ A;  2VXD A;  2DFH A;  3OV8 A;  3CCQ I;  2MD0 A;  1JXS A;  3M1E A;  4ZYA A;  3W3C A;  5DD8 A;  1RUN A;  1QVT A;  1XCB A;  3VPR A;  5JR3 A;  2IS6 A;  4I02 A;  4XKV A;  3U2R A;  2K9N A;  1A31 A;  4IHY A;  4ZZD A;  4IO9 F;  1OJL A;  1JJ6 C;  1DGW Y;  1ERD A;  2X1D A;  3DQV C;  3G73 A;  2R93 J;  1N78 A;  2DMT A;  4PSW A;  3S93 A;  5ED4 A;  3IL2 A;  3WE3 A;  4KJZ A;  3RPU A;  3CZ6 A;  1MW7 A;  1PUF A;  1I6X A;  4HBL A;  3L2C A;  2QQ8 A;  3DBL B;  4N0B A;  5FLV A;  2P7C B;  1GUU A;  3I54 A;  3WTZ A;  1W7P A;  2P0W A;  4Y33 A;  1Y6I A;  4FTH A;  2NVQ J;  5LGT A;  4RS8 A;  3RSN A;  3LSP A;  3F6V A;  4JYK A;  1Z21 A;  4A2U A;  4DOZ A;  5LBQ A;  1M1E B;  4XN3 A;  5LHI A;  4GO1 A;  5E1W A;  1BI1 A;  2CYY A;  2IA0 A;  2M7B A;  4RM2 A;  4IKF A;  3BJO A;  1PJR A;  3OYH A;  1SAU A;  1P4A A;  5J8F A;  1WHU A;  3QYB A;  1SFK A;  3HOT A;  2H94 A;  5BOX A;  2L9V A;  2Z3Y A;  3GTO J;  3P5J A;  3B73 A;  3H9Q A;  5D6F A;  1DDN A;  4ZDO A;  1X1P A;  4BS9 A;  4XKB A;  3FKJ A;  2HOA A;  2ZXI A;  4P96 A;  3OIP A;  2XRO A;  1I5Z A;  3W6K B;  3ML6 A;  1JKQ C;  1Z91 A;  1HBX G;  3MCZ A;  2V26 A;  1QBJ A;  1WFX A;  1WJC A;  5H6Q A;  3WU1 B;  3IWZ A;  4B09 A;  3CCY A;  3HOU J;  2B63 J;  2ME6 A;  1IDZ A;  3RJP A;  5GAH J;  1FYK A;  4RAG A;  3SFZ A;  1RI7 A;  4A6D A;  2XGD A;  3LA7 A;  5DCF A;  2F5V A;  1FX7 A;  2IJL A;  1JHH A;  2VT2 A;  4LK0 F;  2R7T A;  2K3P A;  2DFF A;  2L9N A;  4L0Y B;  5FLX Z;  1ETX A;  4TV7 A;  5K5Q A;  3SJM A;  4M3F A;  2DYS H;  4XRF A;  4M3G A;  4ETS A;  3LST A;  4DZP A;  3DKW A;  2JMW A;  3HOS A;  3M9A A;  3E7L A;  4BAY A;  2HOT A;  3BPX A;  3ABU A;  2L9R A;  3GLX A;  1R00 A;  4E70 A;  3DPU A;  4YFN F;  2DFE A;  4FIS A;  4XLA A;  3F9K A;  2R3S A;  3NEU A;  2I10 A;  3L1P A;  2XGE A;  4DYR A;  3AL0 C;  2XIG A;  3K6G A;  2Y75 A;  4AIK A;  4U0V A;  2FRH A;  4BQN A;  5K7Z A;  2R7W A;  5C4X J;  3K70 C;  1IW7 F;  4IL6 C;  3FXR A;  3LL7 A;  1WKM A;  4KIC A;  4BU2 A;  2DXI A;  1VI0 A;  2YS9 A;  1TWH J;  1U9N A;  4HLY A;  3E3V A;  3K1M A;  3ZMZ A;  3GFI A;  4RB3 C;  1VQL I;  4HZF A;  5BPD A;  3AG2 H;  1BI3 A;  2E1N A;  3L9F A;  5A2Q Z;  1WRJ A;  5E3O A;  5JLX A;  2H1K A;  1F1Z A;  3R0J A;  4Z6Y A;  1B9N A;  2O8X A;  3TO9 A;  3H5R A;  2F5E A;  3MWM A;  1WSU A;  2IAI A;  4N4N B;  4D0P A;  2W24 A;  1LQ1 A;  5IP9 J;  1CQT A;  3HOX J;  3NAR A;  2IT0 A;  2I8D A;  5CQE A;  1APL C;  2IA2 A;  4PZJ A;  4XSX F;  4BXU A;  1W36 D;  1Z6R A;  3LFU A;  4U0Y A;  5ICC A;  4HF1 A;  1OCO H;  3ZRG A;  3QU6 A;  4KUM A;  1SFE A;  2Y2Z A;  4CCK A;  3S1N J;  2X6W A;  1YIO A;  2MLK A;  1YW7 A;  3M7G A;  4W1U A;  3DV8 A;  2H09 A;  4PDK A;  5E1Z B;  4E7I A;  2J5P A;  2XDV A;  1KQ0 A;  1YIT I;  2R7O A;  4HNU A;  2LH9 A;  5FKM A;  1O4X A;  4L9V A;  4L9J A;  2HDD A;  2K9M A;  3HSR A;  3ZPL A;  1J09 A;  3ABM H;  4EM0 B;  2VC0 A;  1OYW A;  3SDB A;  1R1T A;  1MIJ A;  3CJT B;  3LFK A;  4RAZ A;  2UWM A;  3FXK A;  1LVK A;  4AIJ A;  2Q2E B;  1J9I A;  3ULQ B;  1YJ9 I;  2VC1 A;  3JRG A;  3OMY A;  2FA5 A;  4RMN A;  1FIA A;  4KFC A;  4X6A J;  3RDI A;  4XRS G;  4IHW A;  4A0Y A;  1QZY A;  4UV9 A;  3R61 A;  1ULY A;  2ISZ A;  2FQ3 A;  1LE8 B;  3BTC A;  1FMV A;  2VQC A;  2ZME A;  2WAQ A;  1FMW A;  3ZQH A;  4S0H B;  1YE9 A;  4NUB A;  2WV1 A;  2Z1D A;  2HPI A;  4Y3O A;  1P6R A;  1B6A A;  1WI9 A;  1KQ9 A;  2DQL A;  3J81 Z;  2M4K A;  2R5Z B;  2XAQ A;  4Y4R A;  3JTH A;  1XSD A;  2E36 A;  2CQK A;  4L9T A;  5EZG A;  5EGO B;  3M8J A;  1HSJ A;  3PIP F;  4EV0 A;  3RKW A;  3GZ5 A;  5C44 J;  3H36 A;  3GTL J;  3TKY A;  1TWF J;  2MG4 A;  2P5K A;  3I9V 2;  4I6Z A;  3A01 B;  1R71 A;  4AYB N;  4O5V A;  2BV6 A;  3E0J B;  2GA1 A;  5HLT A;  4YEJ A;  3HG9 A;  2CWE A;  5F08 A;  3CMY A;  2O9L A;  4KIT B;  4XQF A;  1RET A;  4M3D A;  5ILU A;  2DOD A;  3S14 J;  1YRN B;  4PJN A;  1EH8 A;  2CV0 A;  2BHZ A;  2FBI A;  1WJF A;  3A03 A;  3EQL F;  1MBJ A;  1YS6 A;  4KIS A;  4FX0 A;  2Q8K A;  2O3F A;  1YI2 I;  3LSG A;  1BIA A;  3IKV A;  2LVS A;  4GRI A;  2HKX A;  1IXC A;  2X0L A;  1U2W A;  4MLO A;  5B66 C;  2KRC A;  1K6Y A;  1LDK B;  3GYH X;  4B4C A;  1DP3 A;  2ISY A;  3MAJ A;  4CZZ A;  2Y9Y A;  2ZFU A;  1V55 H;  1GT0 C;  2H6B A;  1O7F A;  2QSH X;  3FIW A;  2A5W A;  4HV5 A;  3T5X A;  4XOP A;  4IHT A;  2KQR A;  4AU7 A;  2W4S A;  2XF7 A;  3UNG C;  4CZC A;  3KP6 A;  1YX5 A;  2Z16 A;  2G0E A;  1ZK8 A;  3ABK H;  4RB2 C;  4B1R A;  1T08 B;  1SAX A;  4DIQ A;  4XID A;  3GW2 A;  2BVL A;  3TW6 A;  1WJE A;  1QGP A;  1WH5 A;  5EEA A;  3RKY A;  4ESF A;  2QM3 A;  1XPX A;  1Z67 A;  2KRF A;  1T38 A;  1ZR4 A;  3U9G A;  3QP6 A;  4XLE A;  2VBW A;  2ME0 A;  2E5N A;  4LG3 A;  1D0Z A;  3BPV A;  2DK8 A;  2VLA A;  1O3R A;  2MAB A;  3HPG A;  3OR2 C;  3K4B A;  2ECB A;  1ON1 A;  2EZK A;  1WPK A;  1Z0X A;  2LG4 A;  4M72 A;  4AVZ A;  1EJ9 A;  2YU9 J;  1QU3 A;  2XUB A;  1PUE E;  4OMZ A;  5EJC A;  3IC7 A;  4KMF A;  5HNF A;  1MDM A;  5AIP A;  3I4N J;  3A0B C;  1IF1 A;  2CUF A;  2LRE A;  2X4H A;  1ZGW A;  1QVU A;  2VAS A;  4A3B J;  3J80 Z;  1X1D A;  1ZH5 A;  3BR1 A;  1AKH A;  3GVA A;  1TW3 A;  3LQR A;  4GFB A;  4IXA A;  5FO5 A;  1T95 A;  2P81 A;  3KEO A;  4PCQ A;  1X1C A;  3ECH A;  1K6O A;  1SFU A;  3M3Y J;  3BG3 A;  3RKX A;  3S1R J;  3LSJ A;  4NB5 A;  5A2Q K;  2DN0 A;  2JSP A;  1A6Q A;  3GZ6 A;  2VQH A;  3RPQ A;  1TBX A;  3KZY A;  2RC4 A;  4BQO A;  4WCG A;  1YQA A;  2CV1 A;  1Z7L A;  2E60 A;  1A35 A;  3CQZ J;  2NOG A;  1AA7 A;  2FOK A;  2LSO A;  4K2E A;  4OAZ A;  4UVA A;  5J3L A;  4G7H F;  3S2W A;  2IA1 A;  3KYC B;  4NHJ A;  1G6N A;  1U5T B;  2ZBK A;  3RIR A;  3CLQ A;  2WWY A;  1G4D A;  1D1A A;  2ZSI B;  1TP4 A;  2Q1Z B;  1O3S A;  2PMZ N;  3I53 A;  2B9S A;  2EZL A;  4I2O A;  4PUS A;  2RGV A;  3HRT A;  4WXD A;  5ERI A;  3VYU B;  4AD9 A;  3H1C A;  2YSR A;  1J5Y A;  2TRT A;  5FLX K;  3TOB A;  3HSF A;  3Q9S A;  2KP6 A;  3IH4 A;  2O61 A;  3D5L A;  3BR6 A;  4M6X A;  1XS9 A;  1R36 A;  2DO7 A;  4ZZL A;  5LFA A;  4EJT A;  1WJD A;  1ONV A;  1R5I D;  1K78 A;  3QWL A;  5HDN A;  4KMU X;  2XPU A;  1EKE A;  2OC6 A;  4L5I A;  1GXQ A;  4LK1 F;  4OIR F;  4RBO A;  5J1Y A;  1LVA A;  4A3E J;  1FSE A;  1G3S A;  2VE8 A;  3BG7 A;  1DP7 P;  1XX5 A;  1G3T A;  1FT9 A;  1K4S A;  3KX2 A;  3O8H A;  2VPL A;  4MHG A;  5TJJ A;  3TGN A;  2JRM A;  3R0A A;  3E6B A;  5IPA A;  2Y31 A;  3KE2 A;  1T0F C;  3L2Q A;  2Z33 A;  3DP7 A;  4NNJ A;  5H20 A;  4BBR J;  4OIO F;  2R7X A;  4C30 A;  3HGY A;  4C2M J;  3GO5 A;  2ZXW H;  2QQA A;  4CO8 A;  2XAF A;  1ZLJ A;  2V4J C;  2DOA A;  1D3Y A;  3DBH B;  3GCM A;  3OYN A;  2JWT A;  2QKM B;  3K0L A;  1MMA A;  1HW1 A;  3CC2 I;  4BQQ A;  4HYE A;  4UV8 A;  4XSZ F;  2A05 A;  2VQL A;  3IH2 A;  3H0D A;  2V9P A;  4BBS J;  1V5G A;  2K9L A;  3JSO A;  2ZXJ A;  1NTC A;  1KU2 A;  2ZFW A;  1JUS A;  1TWG J;  3CUQ A;  3PNY A;  4GYG A;  5HOD A;  2XAG A;  1O3Q A;  3S1Q J;  3D5R C;  4V19 K;  5L3D A;  1HOM A;  3HB9 A;  4YFX F;  1R1V A;  2KFD A;  1T6S A;  3KCC A;  3FHN A;  1NH3 A;  2DOF A;  4YFK F;  2XKP A;  4GGG A;  2K85 A;  1MNM C;  1GVJ A;  2LDU A;  2Z2S B;  3DWL E;  2FF4 A;  4C2T A;  2NAZ A;  4DQ2 A;  3LNQ A;  4XM3 A;  1WZ2 A;  3CO6 C;  2M3A A;  2H8R A;  2QEN A;  3WOD F;  2M30 A;  3E97 A;  2ZKZ A;  4BDY A;  1IN6 A;  4KYW A;  3Q0V A;  1SD5 A;  1O3T A;  1HLV A;  2AO9 A;  2D1H A;  4ESB A;  2R7D A;  1RKW A;  3ZCO A;  2EJR A;  2P5L C;  4EJU A;  3OYA A;  3RI4 A;  1HKT A;  3VOD A;  1SAN A;  3OIQ A;  1QA6 A;  5JFR A;  2F5F A;  4CXF A;  1UCR A;  1STZ A;  4F93 B;  4I99 C;  1EA3 A;  1X19 A;  2KLO A;  2W7N A;  1RPW A;  1WCM J;  2A6H F;  3GX4 X;  3I59 A;  1U8B A;  2P4W A;  3B02 A;  2FE3 A;  3B6C A;  2LY9 A;  2FBH A;  5ILS A;  1CF7 A;  4UUS B;  4HQM A;  2PBI A;  1H9G A;  1KU9 A;  1MMN A;  2X48 A;  1KYW A;  1X4P A;  3JCU C;  3VYR B;  2GOM A;  4XIC A;  1YO5 C;  2L5Q A;  4Y15 A;  1W7P B;  3VSL A;  1Y0N A;  3ISP A;  2LTP A;  1WGX A;  3GBG A;  4M9S A;  2E7W A;  2RNJ A;  1R4N B;  2E7X A;  5E8I A;  1ZRF A;  2STW A;  1DU6 A;  2MFZ A;  4ANJ A;  4IRI A;  2LKX A;  2EIK H;  2B7E A;  1ETK A;  4IRH A;  2LY2 A;  2O5R A;  3C7J A;  3KPH A;  5M5W J;  3TO7 A;  1G2H A;  4A3D J;  1MND A;  2JUC A;  3CF2 A;  1T39 A;  2L3D A;  1HKQ A;  2GIV A;  2DAO A;  3V8L A;  3MZH A;  2MH2 A;  3W2V A;  1QHH D;  2IS2 A;  4IQJ A;  1LEB A;  3K1P A;  3D5S C;  3H92 A;  5D6E A;  3J81 K;  3OYD A;  1F43 A;  1XSV A;  4O6J A;  2PJP A;  2XPW A;  2WB1 A;  3LSI A;  1PDN C;  3I4M J;  2IBD A;  4XLH A;  1P9Q C;  1S3J A;  3QP5 A;  3GUD A;  2GZW A;  1GHC A;  3A0H C;  2L7K A;  3UR3 C;  4KN7 X;  2ECC A;  4PJ0 C;  4CCN A;  4D7M A;  1X1B A;  1XGN A;  1ZAO A;  3KLN A;  5FJ8 J;  2XF5 A;  1LFB A;  1YYV A;  3CJR B;  2PX9 A;  5C4J J;  1LKX A;  2FX0 A;  1WJA A;  1MBG A;  2EZI A;  1MMS A;  4DYC A;  4EJO A;  2V1U A;  4RB1 A;  5HNH A;  1S7O A;  2TCT A;  2X1C A;  3HKZ N;  3S32 A;  3HRM A;  1GDT A;  4BUP A;  3IUO A;  3HBL A;  1SC7 A;  3MKW B;  3E6M A;  4LIU A;  1O7L A;  1WQ2 A;  2PMU A;  3DEW A;  3E6C C;  2V6C A;  3IAM 2;  3KP2 A;  4F3Q A;  6PAX A;  3K10 A;  4RGS A;  1TQI A;  1Z3Y A;  4U0W A;  1A36 A;  5FD6 A;  2W48 A;  2CSO A;  2XAU A;  1BOB A; 
#chains in the Genus database with same CATH homology
 4HF0 A;  3D0S A;  4ESJ A;  1BC7 C;  3ECO A;  1XGS A;  5LRR A;  3AAF A;  5CYV A;  2DBB A;  5HS8 A;  3HRS A;  1MD0 A;  3TDZ C;  3DPT A;  2HWV A;  2XRN A;  4MTE A;  4O3M A;  3VFZ A;  2UXX A;  1JGS A;  2UZK A;  2WTE A;  2IPQ X;  3QAH A;  2JPB A;  4LG0 B;  1IRF A;  4ZYD A;  1Z05 A;  3EYY A;  2HYG D;  4UVC A;  5FGM A;  4EGY A;  3WTT C;  4EM1 A;  1R7J A;  3R60 A;  1REP C;  5IT9 K;  4BHP A;  3HTU A;  3RTR A;  3CUQ B;  4A0X A;  3QPT A;  2K4J A;  5BS6 A;  1ZG3 A;  2HTJ A;  1YTY A;  4MQ9 F;  2TDX A;  3FX3 A;  4LMY A;  1LDJ A;  2GA2 A;  4MTD A;  5K1Y A;  1DUX C;  1XGM A;  5DCM A;  4I01 A;  2NRA C;  4RGX A;  1GXP A;  4AWX B;  1PP8 F;  1FBS A;  2DI3 A;  4L5J A;  2H6C A;  4I0B A;  2EFO A;  2HZT A;  1U3E M;  3ERE D;  3BY6 A;  2LF8 A;  5DEQ A;  5K5R A;  3HIF A;  4JK1 X;  3FMR A;  4XLP F;  5F1R A;  1ZG5 A;  2VN2 A;  1XCV A;  3JAM Z;  2QBY A;  4BHB A;  2QBY B;  1KQ8 A;  2JZY A;  3R4K A;  5HLI A;  3MZY A;  3T0Y A;  2V79 A;  3FMS A;  2RQP A;  5IT3 A;  2Z99 A;  4IRG A;  2XHK A;  1J59 A;  3SHF A;  4Y13 A;  3GFM A;  1R58 A;  4KDP A;  3P9K A;  3VEP A;  2XV4 S;  4HA8 A;  1MJ9 A;  1SD6 A;  2CG4 A;  3SQN A;  1ZLK A;  3HRU A;  2EA4 A;  3FXU A;  3SXY A;  3E5U A;  1F5T A;  1FYM A;  4FX4 A;  2ZME B;  2ADU A;  3GEZ A;  1P2F A;  3LA2 A;  4A0Z A;  2LNB A;  5EEH A;  1HW5 A;  1E17 A;  1BI2 A;  3ZMT A;  4AVP A;  1UHW A;  2ETH A;  3WU0 A;  5JHU A;  1P4X A;  4RB0 A;  1ON2 A;  2C6Y A;  4LD5 A;  5BPI A;  3ABT A;  3KEQ A;  2JSC A;  2HDC A;  1ZGA A;  3BWG A;  5LGN A;  2FSW A;  5DUK A;  4Z2Y A;  2DTR A;  4PGG A;  2ACJ A;  4Q5S F;  3ZMU A;  3V8K A;  4WF2 A;  1E2X A;  4A5N A;  1X3U A;  1MKM A;  3VB2 A;  2O03 A;  1LEA A;  3V7C A;  1B1B A;  3K69 A;  4ENN A;  5ICG A;  1SMT A;  4HV6 A;  1EH7 A;  3HHH A;  2OQG A;  4CHU A;  2DT5 A;  3F8C A;  1L3L A;  1QZZ A;  3JTG A;  5DCM B;  3TDU C;  2K02 A;  3K9T A;  2BYV E;  1W5S A;  3V7S A;  1TQM A;  1H0M A;  1I27 A;  4MNU A;  2P6T A;  5HDK A;  3COA C;  2PQ8 A;  4R8H A;  2RVC A;  2K27 A;  5D5V B;  4BQA A;  2FNP A;  1YW9 A;  2L4A A;  3O6B B;  3DPL C;  2QQ9 A;  2Z5U A;  3BRO A;  3KP5 A;  4WK8 F;  2M45 A;  4BH9 A;  2EFN A;  5CLS A;  4N9I A;  4WX9 A;  4OU0 A;  1LJ9 A;  1XD7 A;  3WGI A;  4DNC A;  5LGU A;  1J2X A;  1IN5 A;  3HTS B;  2E1C A;  3L00 A;  3IKT A;  5L3E A;  2Q2E A;  2LF7 A;  4B8X A;  1T2K A;  2MD5 A;  3QOP A;  4U88 A;  3W6J B;  2B0L A;  1HQC A;  5CVU A;  4P55 A;  3BZ6 A;  4YII A;  1R22 A;  2IRF G;  1ZHF A;  3KZZ A;  4CGZ A;  5D8K B;  3E6D A;  2IW5 A;  5J8C A;  2M5W A;  2G9W A;  3EYI A;  1U8R A;  1XN7 A;  3O2P E;  5DD4 A;  2OA4 A;  3LAJ A;  3WTU C;  2L4M A;  2OBP A;  4IVN A;  4CYD A;  4HX7 A;  2WV0 A;  3EET A;  1I1G A;  4MEY F;  4MGR A;  3IRR A;  3JW4 A;  2A69 F;  1QO0 D;  3IWF A;  4UVB A;  4L9N A;  2VE9 A;  3V8J A;  2XAJ A;  4NQW A;  4F7Z A;  2KIM A;  4G6Q A;  4Y17 A;  3DEU A;  3M8F A;  5FFX A;  4LB5 A;  4UHT A;  4EM2 A;  2VOD A;  5IT9 Z;  1G3W A;  2VON A;  2CGP A;  3U1D A;  2EA2 A;  3VOE A;  1R1U A;  1F4K A;  3ROU A;  3T8T A;  3FHZ A;  2GQQ A;  1ZYR F;  1BJA A;  2XGX A;  4OIQ F;  3IHU A;  2OZU A;  1T0F A;  3TOA A;  1DPU A;  3C18 A;  4Q4Z F;  1R23 A;  4QLC U;  2VT3 A;  4G9Y A;  1ZN2 A;  1FLI A;  1JE8 A;  4ZYE A;  4EQQ A;  3NQO A;  1T98 A;  2GAU A;  3F8N A;  5TRD A;  2CO5 A;  3SZP A;  3LAP A;  2Q0O A;  4KT5 C;  4N9H A;  3N97 A;  4HOB A;  1H9T A;  2H27 A;  1EH6 A;  1MZB A;  5FFZ A;  1F9N A;  1ZRD A;  4BYY A;  2PG4 A;  2A6E F;  2QWW A;  2HKO A;  3I0T A;  1KU7 A;  4LJZ F;  2F2E A;  1D8J A;  4OIN F;  4A12 A;  3QU3 A;  2G7H A;  1IXS B;  1TNT A;  4YIF A;  1ZRE A;  4UNO A;  2A5Y B;  5LRS A;  4S04 A;  2EK5 A;  3GF2 A;  2ESN A;  3WGH A;  4KIB A;  1P4W A;  4GCV A;  4KIF A;  2D2W A;  2BBY A;  2EFP A;  4HX8 A;  3RYR A;  1KU3 A;  2XAS A;  4KN4 X;  2OZ6 A;  2MC3 A;  3KP4 A;  2EV0 A;  5HLG A;  2OAZ A;  3BOQ A;  1BBY A;  1XGO A;  5AIQ A;  3J80 K;  4GXO A;  1QPM A;  2P7V B;  2PFB A;  1SFX A;  1Z9C A;  2W85 A;  1IAW A;  3C3W A;  1KGS A;  3F72 A;  4R1H A;  3JSP A;  1O57 A;  1FOK A;  4G7Z F;  2OU2 A;  3FWE A;  2P5V A;  1OYY A;  3FF5 A;  2M1B A;  2IP2 A;  5L3C A;  2W25 A;  3R6S A;  5JVT A;  1S6L A;  1XMK A;  1OPC A;  2JPC A;  3PFI A;  3L09 A;  5HS7 A;  1DPR A;  2GWR A;  1FSH A;  3FM5 A;  4LLG F;  2O0Y A;  2KJC A;  1KYZ A;  4Q47 A;  5AON A;  1ZRC A;  2BE5 F;  1ZG1 A;  2M8E A;  3ZN0 A;  3OOP A;  4CDG A;  2KIF A;  1FBU A;  2ZJ2 A;  1J75 A;  5LEK A;  4ENJ A;  3P7N A;  1BN5 A;  4GYI A;  4HAM A;  1I1S A;  3REO A;  2W84 A;  2V9V A;  2EV6 A;  1W5T A;  1UB9 A;  1J7K A;  2MLG A;  4EGZ A;  4L0Z B;  4P9U A;  2BEO A;  1W4M A;  3WTS C;  5J6X A;  3P9C A;  5E20 A;  2HQR A;  2NNY A;  3V4G A;  3WTV C;  3EDP A;  3DXJ F;  2AS5 F;  1IUY A;  4KA4 A;  1USS A;  2ESH A;  2ELH A;  3KP3 A;  5LHH A;  1G3Y A;  5JI6 A;  2PLY A;  2A61 A;  4KNY A;  1FP2 A;  2A3S A;  1B59 A;  4KIG A;  3BP8 A;  2STT A;  3TQN A;  5KK1 A;  4H0E A;  1K7A A;  3ZMV A;  4M9Z A;  5LHG A;  4HDU A;  1HXD A;  5D4R A;  2DPU A;  1JHF A;  1LNW A;  2HS5 A;  2HYF A;  1EV7 A;  1MJB A;  1PP7 U;  2NNN A;  4RAY A;  2G7U A;  2DW4 A;  1FP1 D;  3Q9V A;  5EEG A;  3L7W A;  2RV8 A;  1TNS A;  1R5H A;  4HQE A;  2EWN A;  3ELK A;  4G6D A;  4JBA A;  4MEX F;  4FT8 A;  1XDS A;  4ENK A;  1QQI A;  2ZNY A;  1FY7 A;  2GXG A;  2YX7 A;  1D8K A;  4A6E A;  2VBZ A;  5D5X B;  3ZQ7 A;  2CFX A;  1J0R A;  3P9I A;  2VOO A;  1YLF A;  2FXA A;  2R7F A;  4M71 A;  1L0O C;  2QLZ A;  1HKS A;  3N4M A;  3BDD A;  2HQN A;  2FEZ A;  2F5C A;  4G94 A;  4EMS A;  3DF8 A;  1IRG A;  2M87 A;  2ZCW A;  5LEJ A;  2XAH A;  3MQ0 A;  4ON0 A;  5HDG A;  5CVV A;  1XSX A;  4BHC A;  3CUO A;  1RUO A;  4U7D A;  2K4B A;  4ZYH A;  2RN7 A;  2QVO A;  3I64 A;  3MFK A;  1ODD A;  1FNN A;  3CUQ C;  3V7R A;  1RIO H;  5CJ9 A;  2A07 F;  1W7P D;  1V4R A;  2KIU A;  1CF7 B;  5CVR A;  3I59 B;  4IHS A;  1R5G A;  1BIB A;  4OOI A;  1B4A A;  3FZV A;  2PN6 A;  4AIH A;  3FM3 A;  2VBX A;  5E17 F;  2ZNZ A;  4M74 A;  1OYI A;  1U5T C;  2XKO A;  3TO6 A;  5E8G A;  1V3F A;  5FB2 A;  3G3Z A;  3NRV A;  4A5M A;  3ZMD A;  2D45 A;  5BMZ A;  5HOO A;  2P6S A;  5H6R A;  2FBK A;  3F8B A;  2EFW A;  2AXL A;  2BGC A;  2F5D A;  2JRT A;  5E18 F;  3T1B A;  4UUV A;  5HVQ C;  3HHG A;  2PI0 A;  1XMA A;  4QWQ A;  2NYX A;  2UXN A;  5ICF A;  1TQP A;  3LWF A;  1FPQ A;  5F6F A;  1MJA A;  1IXR C;  3F22 A;  4M73 A;  2HR3 A;  4HX4 A;  1TW2 A;  5D8L B;  3KP7 A;  3GFL A;  5ICE A;  5D5U B;  4S05 A;  4R79 A;  2YPR A;  5CVI A;  4G8X A;  4LLL A;  1FYL A;  4P5O A;  3WG9 A;  1A04 A;  3GFJ A;  4I98 B;  1B9M A;  1U5T A;  4RGU A;  5LLQ A;  2V1D A;  3LA3 A;  2J5O A;  3KLO A;  2FML A;  4L18 B;  3CLO A;  1K78 B;  1U6G A;  3HUG A;  2K86 A;  2MA3 A;  1S7A A;  3EUH A;  5BQT A;  1FWZ A;  2OQR A;  2GXB A;  4HDV A;  3T8R A;  1RNL A;  2PMH A;  2DU9 A;  2QYO A;  4LB6 B;  2DPD A;  2DLL A;  1SD7 A;  1IN4 A;  3CDH A;  2HGC A;  3KET A;  2HOE A;  1Z6T A;  1BOA A;  4XBF A;  3WE2 A;  3HYI A;  3K2Z A;  1XDU A;  3CJN A;  1LB2 A;  2L54 A;  4YG2 F;  2Y0M A;  2YR2 A;  4LGW A;  1RZ4 A;  4FHT A;  1BI0 A;  1NHA A;  3WTW C;  5DYM A;  2OD5 A;  3BJA A;  3IRQ A;  3F8F A;  2K7L A;  2VOP A;  4ENM A;  2QQB A;  3FXQ A;  5HS9 A;  3H3Z A;  1UST A;  3DFG A;  3E5Q A;  2W57 A;  4CIC A;  4HLX A;  1MGT A;  2A68 F;  2QUF A;  4ZYG A;  2VXZ A;  2D1V A;  1IN8 A;  4P9F A;  4G7O F;  2KKO A;  5KVR A;  2YU3 A;  1AWC A;  3ZMS A;  5L3F A;  5L3B A;  3M8E A;  1FZP B;  1UHM A;  2FMY A;  4WWC A;  3J7A O;  2RDP A;  5HLH A;  3F6O A;  1P92 A;  2KJB A;  3ZP5 A;  2YX4 A;  4WXH A;  1MDM B;  1LDD A;  1WWX A;  1C0W A;  5F64 A;  1UFM A;  1QNT A;  2P8T A;  1CGP A;  2HFH A;  5L3G A;  4EVI A;  4OIP F;  3QRF F;  4UXN A;  4ZH4 F;  2LKP A;  2DK5 A;  3WGG A;  2MH9 A;  4BNC A;  2QZ8 A;  4HW0 A;  4EJV A;  5D5W B;  1TTY A;  4LFU A;  1XB4 A;  1BM9 A;  2EFQ A;  3JAM K;  3QPH A;  5K5O A;  1YW8 A;  2NS0 A;  1VTN C;  3I71 A;  3Q5F A;  1YFH A;  1YS7 A;  2O6G E;  3F23 A;  3CTA A;  5FD5 A;  2EV5 A;  2XVC A;  4LG0 A;  1S8N A;  2V1X A;  3F3X A;  2CW0 F;  1FBQ A;  2Z9O A;  3BJ6 A;  2VBY A;  3F21 A;  2Y48 A;  1IN7 A;  2DQR A;  1BC8 C;  4HF2 A;  2HTS A;  5DUI A;  1U78 A;  2FNA A;  3LQQ A;  3RYP A;  4Q48 A;  3FMQ A;  1SMY F;  4I09 A;  1AOY A;  3I5U A;  4I7H A;  4WXC A;  3WTX C;  3MEX A;  1KA8 A;  3O3K A;  5DDG A;  3H3U A;  1IZ1 A;  3WTY C;  1HST A;  5CVJ A;  2RKH A;  2DFI A;  5DV5 A;  1Z1D A;  2ZO4 A;  1SD4 A;  3ZN1 A;  3I58 A;  4MQV A;  1Q1H A;  1S29 A;  3C1D A;  4IPA A;  3I4P A;  4RGR A;  1YG2 A;  5E1X A;  1HW2 A;  5ILV A;  1Y0U A;  2MBF A;  4IF4 A;  1ZAR A;  1TLH B;  2FU4 A;  1K79 A;  3E5X A;  4XLN F;  2JTV A;  4EJW A;  5D4S A;  3CO7 C;  4ASN A;  4JQF A;  2JT1 A;  3SZT A;  1OKR A;  4M6Y A;  2COM A;  2HEO A;  2WC2 A;  3KFW X;  3PQK A;  2PEX A;  1ZGJ A;  4LLN A;  3F8M A;  1Z7U A;  3GXO A;  4IJA A;  1OMI A;  3K1N A;  4I0A A;  4OMY A;  1OR7 A;  4PGH A;  2EB7 A;  2L01 A;  3PQJ A;  4U7B A;  4M9X A;  3HSE A;  2L02 A;  1FC3 A;  2IVM A;  1D5V A;  3GWZ A;  3OV8 A;  1JXS A;  3M1E A;  5DD8 A;  1RUN A;  1XCB A;  5JR3 A;  4I02 A;  3U2R A;  4ZZD A;  3DQV C;  3G73 A;  5ED4 A;  3IL2 A;  3WE3 A;  3RPU A;  1I6X A;  4HBL A;  3L2C A;  4N0B A;  2P7C B;  3WTZ A;  3I54 A;  1W7P A;  5LGT A;  4RS8 A;  3F6V A;  4A2U A;  5LBQ A;  5LHI A;  4GO1 A;  5E1W A;  2CYY A;  1BI1 A;  2IA0 A;  3BJO A;  1P4A A;  5J8F A;  3HOT A;  2H94 A;  5BOX A;  2Z3Y A;  3B73 A;  5D6F A;  1DDN A;  4P96 A;  2XRO A;  1I5Z A;  3W6K B;  3ML6 A;  1Z91 A;  1HBX G;  3MCZ A;  1QBJ A;  5H6Q A;  3WU1 B;  3IWZ A;  4B09 A;  3RJP A;  1FYK A;  3SFZ A;  1RI7 A;  4A6D A;  3LA7 A;  5DCF A;  1FX7 A;  2IJL A;  1JHH A;  2VT2 A;  4LK0 F;  4L0Y B;  5FLX Z;  4TV7 A;  5K5Q A;  4XRF A;  4ETS A;  3LST A;  3DKW A;  3HOS A;  3M9A A;  4BAY A;  3BPX A;  3ABU A;  3GLX A;  1R00 A;  4E70 A;  4YFN F;  2R3S A;  3NEU A;  2XIG A;  4AIK A;  2Y75 A;  4U0V A;  2FRH A;  1IW7 F;  3FXR A;  1WKM A;  4KIC A;  4HLY A;  3E3V A;  3K1M A;  3ZMZ A;  3GFI A;  4RB3 C;  4HZF A;  5BPD A;  1BI3 A;  2E1N A;  3L9F A;  5A2Q Z;  1WRJ A;  1F1Z A;  3R0J A;  1B9N A;  2O8X A;  3TO9 A;  2F5E A;  3MWM A;  1WSU A;  4D0P A;  2W24 A;  1LQ1 A;  2IT0 A;  2IA2 A;  4PZJ A;  4XSX F;  4BXU A;  1Z6R A;  4U0Y A;  5ICC A;  4HF1 A;  3QU6 A;  4KUM A;  1SFE A;  1YIO A;  2MLK A;  1YW7 A;  3M7G A;  3DV8 A;  2H09 A;  4PDK A;  5E1Z B;  2J5P A;  1KQ0 A;  4L9V A;  4L9J A;  3HSR A;  3ZPL A;  4EM0 B;  2VC0 A;  1OYW A;  1R1T A;  3LFK A;  4RAZ A;  2UWM A;  4AIJ A;  1J9I A;  3ULQ B;  2VC1 A;  2FA5 A;  4KFC A;  3RDI A;  4A0Y A;  1QZY A;  4UV9 A;  3R61 A;  1ULY A;  2ISZ A;  2FQ3 A;  2ZME A;  1P6R A;  1B6A A;  1WI9 A;  1KQ9 A;  2DQL A;  3J81 Z;  2XAQ A;  3JTH A;  1XSD A;  2CQK A;  4L9T A;  1HSJ A;  4EV0 A;  3RKW A;  3GZ5 A;  3TKY A;  2P5K A;  4O5V A;  2BV6 A;  2GA1 A;  2CWE A;  5ILU A;  1EH8 A;  2FBI A;  3EQL F;  1YS6 A;  4FX0 A;  2Q8K A;  2O3F A;  1BIA A;  3IKV A;  2HKX A;  1IXC A;  2X0L A;  1U2W A;  1LDK B;  3GYH X;  2ISY A;  3MAJ A;  4CZZ A;  2H6B A;  1O7F A;  4HV5 A;  3T5X A;  4IHT A;  3KP6 A;  4RB2 C;  1SAX A;  3GW2 A;  1QGP A;  3RKY A;  4ESF A;  2QM3 A;  2KRF A;  1T38 A;  3U9G A;  3QP6 A;  2VBW A;  3BPV A;  2DK8 A;  1O3R A;  1ON1 A;  4M72 A;  2XUB A;  1PUE E;  4OMZ A;  3IC7 A;  4KMF A;  1MDM A;  5AIP A;  1IF1 A;  2X4H A;  3J80 Z;  1ZH5 A;  3GVA A;  1TW3 A;  3LQR A;  4IXA A;  5FO5 A;  3KEO A;  4PCQ A;  3ECH A;  1K6O A;  1SFU A;  3RKX A;  4NB5 A;  5A2Q K;  3GZ6 A;  3RPQ A;  1TBX A;  3KZY A;  2RC4 A;  4WCG A;  1YQA A;  4K2E A;  2FOK A;  2LSO A;  4UVA A;  4G7H F;  3S2W A;  2IA1 A;  4NHJ A;  1G6N A;  1U5T B;  2ZBK A;  3RIR A;  2WWY A;  1G4D A;  1O3S A;  3I53 A;  4I2O A;  2RGV A;  3HRT A;  4WXD A;  5ERI A;  4AD9 A;  2YSR A;  1J5Y A;  5FLX K;  3TOB A;  3HSF A;  3Q9S A;  2O61 A;  3D5L A;  4M6X A;  1R36 A;  2DO7 A;  4ZZL A;  4EJT A;  1ONV A;  1K78 A;  5HDN A;  4KMU X;  4L5I A;  1GXQ A;  4LK1 F;  4OIR F;  1LVA A;  1FSE A;  1G3S A;  2VE8 A;  1DP7 P;  1G3T A;  1FT9 A;  4MHG A;  5TJJ A;  3TGN A;  3R0A A;  3E6B A;  3KE2 A;  2Z33 A;  3DP7 A;  5H20 A;  4OIO F;  3GO5 A;  2QQA A;  4CO8 A;  2XAF A;  1ZLJ A;  1D3Y A;  3K0L A;  1HW1 A;  4HYE A;  4UV8 A;  4XSZ F;  3JSO A;  2ZXJ A;  2ZFW A;  1KU2 A;  3CUQ A;  4GYG A;  2XAG A;  1O3Q A;  5L3D A;  4YFX F;  1R1V A;  1T6S A;  3KCC A;  4YFK F;  2XKP A;  4GGG A;  1GVJ A;  2LDU A;  2FF4 A;  2NAZ A;  4DQ2 A;  3CO6 C;  2QEN A;  3WOD F;  2M30 A;  3E97 A;  2ZKZ A;  1IN6 A;  4KYW A;  1SD5 A;  1O3T A;  2D1H A;  4ESB A;  2R7D A;  2EJR A;  2P5L C;  4EJU A;  3RI4 A;  1HKT A;  3VOD A;  5JFR A;  2F5F A;  4CXF A;  1UCR A;  1STZ A;  3GX4 X;  2A6H F;  3I59 A;  2P4W A;  3B02 A;  2FE3 A;  2FBH A;  5ILS A;  1CF7 A;  4HQM A;  1H9G A;  1KU9 A;  2PBI A;  1KYW A;  1YO5 C;  4Y15 A;  1W7P B;  3ISP A;  4M9S A;  2E7W A;  2RNJ A;  2STW A;  2E7X A;  5E8I A;  1ZRF A;  4IRI A;  4IRH A;  3C7J A;  3TO7 A;  1T39 A;  2L3D A;  1HKQ A;  2GIV A;  2DAO A;  3V8L A;  3MZH A;  2MH2 A;  1LEB A;  3K1P A;  3H92 A;  5D6E A;  3J81 K;  1XSV A;  4O6J A;  2PJP A;  1PDN C;  1S3J A;  3QP5 A;  2GZW A;  3GUD A;  1GHC A;  4KN7 X;  1XGN A;  1ZAO A;  3KLN A;  1YYV A;  4EJO A;  2V1U A;  4RB1 A;  1S7O A;  3HRM A;  3E6M A;  1O7L A;  1WQ2 A;  2PMU A;  3E6C C;  2V6C A;  3KP2 A;  6PAX A;  4RGS A;  1TQI A;  4U0W A;  5FD6 A;  2CSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...