3R0AA

Possible transcriptional regulator from methanosarcina mazei go1 (gi 21227196)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
120
Chain Sequence
SNAMIDFACKEFKVEDVIKCALNLTKADLNVMKSFLNEPDRWIDTDALSKSLKLDVSTVQRSVKKLHEKEILQRSQQNLDGGGYVYIYKIYSKNQIRNIIQKIVQSWADRLGQELKEWEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator
publication title Possible transcriptional regulator from Methanosarcina mazei Go1 (gi 21227196)
rcsb
source organism Methanosarcina mazei
total genus 33
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3r0aA00
3F8CA 3WTUC 4OU0A 1ZLKA 3GO5A 2E7XA 3CO7C 1EV7A 1E2XA 4N9HA 3KP4A 4MEXF 5LGNA 4BHBA 1IXRC 3TOAA 5LEKA 4BQAA 4L9NA 5JVTA 3E97A 1DP7P 2WV0A 3MZYA 2V1XA 3CUQC 1S3JA 2NAZA 2DBBA 4I02A 1BC8C 5E8GA 1QNTA 4BXUA 1JGSA 2VE8A 3K69A 2FBKA 3PQJA 1L3LA 3RIRA 2NS0A 2HR3A 4XSZF 3QU3A 4A6DA 1MKMA 3U9GA 1OYIA 5D6EA 1SFUA 3L7WA 1F9NA 1KYZA 3QP5A 3JTHA 5BPDA 4P5OA 2Z99A 1FPQA 4XBFA 3FMSA 3F8FA 3ULQB 3KEQA 4I01A 3GFLA 3TDUC 1Z7UA 2VE9A 3F8BA 4WXCA 1G3YA 3F22A 1KA8A 4GYGA 3I64A 1TBXA 2MC3A 3IRRA 2XAGA 3HIFA 1FNNA 4M6YA 1TQPA 3TKYA 5HLIA 2QBYA 1P4XA 1FC3A 2DO7A 1U5TB 2RQPA 2OQGA 1J5YA 1JE8A 3I0TA 1IN6A 3NQOA 5D5VB 5IT9Z 3ELKA 4M9SA 1XB4A 5A2QZ 3WTYC 2HTJA 4XSXF 4WF2A 3D0SA 3HRSA 3OOPA 2STTA 2ISYA 2YX4A 2YU3A 1UHMA 2FQ3A 4LLNA 4L0YB 5BS6A 1Q1HA 1MD0A 3ECOA 4JQFA 3HRTA 1DUXC 1UCRA 2GXBA 1S8NA 2W85A 3GUDA 3F21A 1TW2A 4CXFA 1SMTA 1QQIA 4A0XA 3HSFA 4A12A 4KFCA 4HZFA 5ILUA 3E6BA 1WWXA 5AIQA 4AD9A 1B4AA 1F5TA 1ZG5A 5KK1A 4IRHA 4R1HA 5L3EA 2Z3YA 2JT1A 1YW9A 4EJOA 4O3MA 2MLGA 2UZKA 4ENJA 2ETHA 1ZGAA 1O3SA 1BJAA 1QGPA 4FX4A 5FB2A 2QZ8A 3ZPLA 5EEHA 2XKPA 3FXQA 3FM3A 3BJOA 1D8KA 3KP2A 5F64A 4HYEA 1IAWA 3GFIA 4HLYA 1O7LA 3V8LA 3DQVC 1KU3A 2XAFA 4LG0A 2BGCA 1R1TA 3K2ZA 1OKRA 1BOAA 3R6SA 3SXYA 3BJAA 2IRFG 1GHCA 3M8EA 4OMZA 4L5JA 1XCVA 1R7JA 3EQLF 1U8RA 2L4AA 2HZTA 2ZBKA 2QVOA 4YG2F 3I58A 3LAPA 1EH8A 2PMHA 3S2WA 2HQNA 5DCFA 1V4RA 5HDKA 5L3CA 2CGPA 3HRUA 2IP2A 5E18F 3MAJA 3H3ZA 3MCZA 1KQ9A 5E17F 4CYDA 4RGUA 5BQTA 3M1EA 3CTAA 1PUEE 2D1VA 2F5EA 2EFNA 5JFRA 3P9CA 4UNOA 1ZH5A 2UXXA 4Z2YA 4A5MA 1EH7A 1XSDA 3REOA 4OIRF 5E1XA 1T2KA 5L3DA 2FMLA 1SD6A 4M9XA 2L3DA 2GQQA 1HSJA 4YFKF 1ZARA 5CVJA 4OIPF 2GXGA 3ZMSA 2RVCA 1LNWA 4YFNF 1HW2A 2HS5A 4Y15A 1I6XA 2PN6A 1RUOA 6PAXA 2ZNYA 1F4KA 1RUNA 1JHHA 5CYVA 3SQNA 3M8FA 1IN8A 5FD5A 5BOXA 3QPTA 4EV0A 2JTVA 4HX4A 1IXSB 2A6HF 1R36A 1B59A 1LVAA 5ICFA 2VOOA 2FNAA 1P4WA 3R4KA 4M73A 1D3YA 3KLNA 2P7CB 3JW4A 4MTDA 3GYHX 1J9IA 3E5XA 1Z9CA 3Q9SA 1YS6A 2EFWA 1KGSA 4G7OF 3ABUA 1U5TC 3O3KA 2W84A 2B0LA 3FZVA 5L3FA 3L9FA 3VB2A 4HA8A 2W24A 3J81K 1IRFA 3VODA 5LHIA 1P2FA 3ZMTA 3COAC 2HGCA 3P9IA 1IZ1A 1W7PA 1FYMA 1BIBA 2Z5UA 5DEQA 1X3UA 2XKOA 1DDNA 5HS9A 2JPCA 2KKOA 2VBXA 4Q5SF 4HQMA 4M74A 2VBZA 5HDNA 2QUFA 3KP3A 1KU2A 3GFMA 1IF1A 5FFZA 4WXHA 1CF7A 2ZXJA 4KMFA 2DPDA 5E20A 1MJBA 3E3VA 3GZ6A 1XMAA 4L9VA 5DUKA 3F23A 3V8JA 5ICGA 2FE3A 1MGTA 2FA5A 3K0LA 4LJZF 1G6NA 1GXPA 3SFZA 1P92A 4U7BA 4CGZA 1XDUA 1XCBA 3FXUA 4L9JA 4ZYDA 5D4RA 3HHHA 2HFHA 2G7HA 4DNCA 2EFPA 4BYYA 2YSRA 1J0RA 2XAJA 2V79A 3RDIA 4L5IA 3GLXA 2ACJA 2KIUA 4R8HA 4IF4A 1H9TA 4HF1A 2F5FA 1K79A 1WSUA 4Y17A 3IC7A 3D5LA 2J5PA 4A0ZA 3E6DA 3HHGA 2BYVE 2ESNA 1XSXA 1KQ0A 1ODDA 3WU0A 1FSHA 4ZH4F 2NNYA 2UWMA 2Q2EA 5D4SA 4HV6A 1BI2A 2X4HA 2PI0A 4M71A 4WK8F 3BY6A 5H6QA 1MJAA 5HLGA 3OV8A 2DI3A 2EV0A 1AOYA 3WGIA 3I71A 5D5XB 4GXOA 1LEBA 1GVJA 2L02A 2XAHA 4F7ZA 3Q5FA 4IXAA 2A6EF 2G7UA 1K78B 3TOBA 1J7KA 2MA3A 1ZHFA 3T8RA 3FX3A 3TO7A 4O5VA 3DPTA 3NEUA 4HLXA 2R3SA 3BDDA 2L01A 2PEXA 2CFXA 1FYKA 1J2XA 4HV5A 1OMIA 4KDPA 5DYMA 2F2EA 2VC1A 3QPHA 4RGSA 1U6GA 3ZMDA 5DD4A 3ROUA 3M9AA 4M9ZA 2JZYA 4I0AA 1G3SA 1O7FA 2PFBA 3F6VA 2VBWA 2ZMEA 3W6JB 2DLLA 3T8TA 3B02A 1D8JA 3C7JA 1XMKA 3QOPA 1MZBA 1IN5A 2DW4A 4PGGA 4ZZDA 3RJPA 1ON2A 1IN4A 1R22A 4KIFA 3HTSB 2WTEA 4AVPA 2H94A 2YX7A 1O57A 2CYYA 1EH6A 3RKWA 4WCGA 4HF2A 5AIPA 2LNBA 3E5QA 3ISPA 2MH9A 4OIQF 2V9VA 2L4MA 3EYYA 5E1ZB 3HOSA 2TDXA 4KA4A 3KEOA 3FWEA 2O8XA 1R5HA 2H27A 2FSWA 4ESBA 2HTSA 5FLXZ 4HDVA 3M7GA 4LK0F 4EMSA 2PJPA 4CICA 2RGVA 3IKVA 3CLOA 3R0AA 1WKMA 3DFGA 4RGRA 4MHGA 5J8FA 2K27A 3CUQA 5CVUA 4P55A 1ZYRF 3J7AO 1AWCA 3I59B 2V6CA 4UHTA 5FO5A 1GXQA 1MDMA 2ESHA 3GEZA 2M8EA 3V4GA 1RI7A 2XROA 3PFIA 1T98A 4P9UA 3K9TA 1V3FA 2IVMA 1YW8A 2KRFA 1LEAA 3TQNA 1SD5A 1OR7A 1S6LA 3VFZA 4UV8A 4KT5C 3K1NA 2DU9A 3JSPA 3H92A 2A68F 1LQ1A 3LA3A 4U0YA 1U78A 2EFQA 3T0YA 3LFKA 2NRAC 1PP7U 2M30A 2VC0A 2ZFWA 4N9IA 1XN7A 3HTUA 4HQEA 4OMYA 3C18A 2O03A 2IPQX 2LDUA 1SAXA 1KU7A 1HW1A 1T38A 3LAJA 1Z1DA 2XHKA 3H3UA 5CVVA 2HKXA 3J80Z 4UXNA 3IKTA 5H6RA 1LB2A 3VOEA 1C0WA 1ZGJA 1U2WA 5HS7A 2DFIA 5ED4A 2A3SA 3V7SA 3JAMK 1SFEA 4RB2C 1LDKB 1B9NA 3FM5A 2KJBA 3ZMZA 3LSTA 1RNLA 4EVIA 5HLHA 2FEZA 1YW7A 2LF7A 5TJJA 3TDZC 1IN7A 4RB3C 2FBHA 2IT0A 2OZUA 3F72A 4XLPF 3R60A 3GFJA 4EJVA 4KN7X 4LB5A 1XSVA 1YFHA 2D2WA 2QQAA 1HXDA 5DV5A 5AONA 3ML6A 3C1DA 3FHZA 4RAZA 3SZPA 1I1GA 3IWZA 4CZZA 4HOBA 2Y75A 4U0WA 2OU2A 3MWMA 2XASA 2O3FA 1Z6TA 2JRTA 4A0YA 1VTNC 3FF5A 4CO8A 3ZP5A 2ZMEB 3LWFA 1XGOA 5L3BA 2Y0MA 1P6RA 2P7VB 3I54A 1HKTA 3CDHA 1DPUA 3KFWX 2F5CA 3ZN1A 2ZNZA 5BPIA 1ONVA 1QZYA 1WI9A 1ZRFA 3GW2A 5F6FA 2HOEA 1O3RA 2RV8A 1UB9A 3BZ6A 4A6EA 3BPXA 2O6GE 4PDKA 2VONA 3L00A 1TQMA 3W6KB 4WX9A 2MH2A 1FT9A 3IRQA 5BMZA 5HVQC 3LA2A 2Z33A 5H20A 1G3TA 3KP6A 2E7WA 4B8XA 4EM0B 4I09A 1ULYA 3NRVA 2QLZA 4EQQA 4XRFA 3ECHA 4OINF 1R23A 4KUMA 3QRFF 1FBSA 5D6FA 4BH9A 2QBYB 2ZCWA 3E6MA 2M5WA 1XGNA 2KIMA 4WXDA 1HKSA 2EJRA 1Z91A 4LD5A 2FNPA 4G6DA 4CDGA 2CG4A 1IXCA 1SD4A 2RNJA 2YPRA 2V1DA 4DQ2A 5DUIA 4ESFA 2DTRA 3HOTA 2FF4A 2P5VA 1A04A 2HEOA 2GZWA 3L09A 4CHUA 5DCMA 4XLNF 2BV6A 4LFUA 3CJNA 2STWA 3DF8A 1B9MA 1ON1A 4LK1F 1BC7C 1LJ9A 2EV5A 2GA1A 3DP7A 2IA2A 1W7PD 5IT9K 4IHSA 5A2QK 2GWRA 3EETA 4RB0A 2NNNA 4JBAA 3KP7A 1W5TA 1USSA 3K1PA 2W25A 2F5DA 2CSOA 4MGRA 3TO9A 1NHAA 1XDSA 3F8NA 5DD8A 2ZJ2A 1U5TA 2FMYA 2P6SA 2QM3A 2VN2A 2Q8KA 2FXAA 2UXNA 2HYFA 4RAYA 5CJ9A 3IL2A 1ZLJA 4RS8A 5D8KB 3DEUA 1I1SA 2BE5F 1JXSA 4NQWA 1SFXA 2XVCA 4KN4X 2VBYA 4L0ZB 4KMUX 3GZ5A 1XD7A 3HRMA 4LG0B 3ZMVA 3WTVC 1I27A 4FT8A 5CVIA 4D0PA 1MJ9A 4G9YA 1BBYA 4ETSA 4H0EA 2AXLA 2OBPA 2VODA 3IWFA 2VOPA 4ESJA 2Q0OA 3KZZA 4A2UA 2EA4A 2IA1A 2ISZA 4LLLA 2IA0A 1YQAA 4QLCU 3KCCA 5K5RA 2LF8A 2CWEA 2RC4A 4PGHA 2K86A 5K5QA 3BWGA 4HX7A 5E1WA 1ZN2A 3MEXA 3VEPA 1SMYF 4LMYA 4UV9A 3RYPA 3QU6A 4O6JA 1BM9A 3WG9A 4U88A 3P7NA 1R5GA 1J75A 5JI6A 4RB1A 3B73A 1IUYA 1TQIA 4KIBA 4AIKA 5ERIA 2M87A 1BN5A 1IW7F 4MNUA 3RKYA 1R1UA 3MFKA 2P4WA 4M72A 5J6XA 4WWCA 3EYIA 1QPMA 1TW3A 5CVRA 4GCVA 3HUGA 2G9WA 3LQRA 4HW0A 2A69F 3R61A 2KJCA 3GXOA 2EWNA 2GAUA 4KICA 4YIIA 4HBLA 2Y48A 3V8KA 4GGGA 2LSOA 1YG2A 2NYXA 4I0BA 3WE3A 5D5WB 3BJ6A 3R0JA 2HQRA 3GWZA 2FRHA 4UVCA 1K7AA 1FP2A 2PMUA 2E1NA 3ZQ7A 1FLIA 3KP5A 1WQ2A 3SHFA 2BEOA 2EV6A 5FD6A 4ZYGA 2XGXA 4U7DA 1S29A 3PQKA 1T39A 4BHPA 5TRDA 2OA4A 1WRJA 2K7LA 1W7PB 1QO0D 1BI1A 1FP1D 2K02A 5DCMB 2P8TA 2GIVA 3G73A 2E1CA 2DQLA 2HKOA 4Y13A 3FMQA 4MQ9F 1J59A 4ZYHA 1I5ZA 4A5NA 1O3TA 2GA2A 2HYGD 5LGTA 4YFXF 5DDGA 1YLFA 4HF0A 4GYIA 3E6CC 2D45A 1TNSA 4UVBA 1OYWA 1REPC 1HW5A 3RPUA 1L0OC 1CF7B 5ICCA 3J81Z 3T5XA 4LLGF 2MLKA 2XAQA 5LBQA 3WTZA 4MTEA 2M1BA 4KYWA 5LEJA 1XGMA 2ADUA 2JPBA 1D5VA 3G3ZA 1BI0A 2WC2A 3ABTA 1HSTA 1K6OA 2ELHA 4U0VA 3T1BA 4L9TA 2DPUA 4S05A 4AWXB 2AS5F 1LDJA 2KIFA 4P96A 3WU1B 2EFOA 5LLQA 4G6QA 3ERED 4EJUA 2QQ9A 4EJWA 2QWWA 2JSCA 5LHHA 2RKHA 3GVAA 1Z6RA 4BAYA 2EA2A 3I5UA 1FBQA 1W4MA 5D8LB 1R1VA 4LB6B 3WTWC 2QYOA 4I98B 1KYWA 1FSEA 1ZAOA 2Z9OA 2YR2A 1G4DA 1BI3A 1FOKA 5ILSA 2HWVA 5LHGA 3KE2A 4JK1X 1YO5C 3DKWA 3U2RA 4PCQA 3F8MA 4IVNA 2A61A 4G7HF 3F6OA 5ICEA 1FBUA 5E8IA 1W5SA 4GO1A 3V7CA 3BROA 3N97A 5LRSA 3P9KA 4FHTA 1H0MA 2EB7A 2OZ6A 3MZHA 1KU9A 3TGNA 4R79A 1HQCA 1T6SA 1OYYA 2L54A 2P5KA 1YIOA 2A07F 4S04A 4AIJA 3HYIA 2IJLA 1O3QA 5JR3A 3BOQA 2MD5A 3BP8A 3WTTC 2H6CA 4B09A 3WE2A 1XGSA 5HOOA 1QBJA 2PG4A 2W57A 2MBFA 1Y0UA 1DPRA 2VT2A 4BNCA 4RGXA 4N0BA 3LQQA 3AAFA 2COMA 3WODF 1YS7A 4ON0A 2FBIA 2CQKA 2J5OA 1YTYA 2K4BA 4NHJA 5ILVA 2DK8A 5LRRA 2M45A 3WTXC 2PBIA 2PQ8A 3JTGA 4M6XA 1KQ8A 1BIAA 3CUOA 1FY7A 1K78A 1E17A 3F3XA 4HDUA 4G7ZF 4EJTA 1CGPA 2FU4A 2ZO4A 4IPAA 1STZA 2RDPA 1SD7A 1LDDA 4IRGA 4IJAA 3MQ0A 3WGGA 4NB5A 5F1RA 4IHTA 2XV4S 5L3GA 4ZZLA 4K2EA 3EUHA 2QQBA 3O2PE 1T0FA 3ZN0A 3CUQB 5D5UB 2DT5A 1TTYA 1ZG1A 2O61A 4MQVA 3KZYA 2H09A 1MDMB 1PDNC 5IT3A 2H6BA 5FLXK 2A5YB 3I4PA 2XUBA 4LGWA 3SZTA 2CO5A 4PZJA 3QP6A 3WGHA 1RZ4A 4TV7A 5J8CA 5FGMA 4EGYA 3E5UA 4EM1A 1B1BA 1G3WA 4L18B 3U1DA 2O0YA 4OIOF 4E70A 2R7DA 4HAMA 1PP8F 1TLHB 3WTSC 3JSOA 3RPQA 3Q9VA 1UFMA 5K1YA 1USTA 1S7AA 2ZKZA 1TNTA 2V1UA 3O6BB 3I53A 1S7OA 3BPVA 3C3WA 2K4JA 5JHUA 3RI4A 1F1ZA 1QZZA 1H9GA 3RYRA 1IRGA 1P4AA 3TO6A 5FFXA 1Z05A 2LKPA 3I59A 3RTRA 2OQRA 3DPLC 2FOKA 2OD5A 1FZPB 4ENNA 4MEYF 3KLOA 3L2CA 2P5LC 4ASNA 2X0LA 5CLSA 3RKXA 2P6TA 4UUVA 2IW5A 2XRNA 4EM2A 4G8XA 3EDPA 1FX7A 4KNYA 1RIOH 2PLYA 1UHWA 4I2OA 1R00A 3GX4X 4KIGA 3J80K 1HBXG 2EK5A 1OPCA 2OAZA 3K1MA 3KETA 1JHFA 3FMRA 4AIHA 1B6AA 1ZRDA 1ZREA 3DV8A 4ENMA 4YIFA 3V7RA 3JAMZ 2D1HA 4G94A 2BBYA 3QAHA 2RN7A 3GF2A 2R7FA 2DQRA 4I7HA 4FX0A 4P9FA 3FXRA 4HX8A 3N4MA 4IRIA 2C6YA 4Q4ZF 1U3EM 4ENKA 2CW0F 1R58A 1FYLA 4Q48A 3HSRA 4ZYEA 4BHCA 1YYVA 2XIGA 3ZMUA 1ZRCA 3DXJF 1HKQA 1ZG3A 2DAOA 2VT3A 3IHUA 2DK5A 4UVAA 4EGZA 5EEGA 2WWYA 2QENA 4OOIA 5K5OA 3CO6C 2VXZA 2HDCA 5HDGA 4Q47A 3HSEA 4QWQA 5HS8A 1FWZA 5LGUA 5KVRA 3LA7A
chains in the Genus database with same CATH superfamily
3F8CA 3WTUC 4E7ZA 4OU0A 1ZLKA 2NOGA 3GO5A 3OIOA 2E7XA 2KDOA 3DLAA 3CO7C 1EV7A 1E2XA 4N9HA 2XAUA 3KP4A 4MEXF 5LGNA 4BHBA 1IXRC 3TOAA 3PFYA 4PJ0C 5LEKA 4BQAA 3Q3SA 4L9NA 5JVTA 3ZQHA 3GZNB 3E97A 4FASD 1DP7P 2E35A 2WV0A 1I3QJ 1X1DA 3C2HA 1WH7A 2V1XA 3CUQC 3LSGA 1UHSA 3MZYA 1S3JA 3OYAA 2K9SA 3JRCA 1VQOI 3RZOJ 2NAZA 2DBBA 4I02A 5EG0B 5CKTA 2M3AA 4PK4A 1BC8C 5E8GA 1QNTA 3VSKA 4BXUA 1UZCA 3ABMH 1JGSA 2VE8A 4II3A 4ANJA 3CCEI 1ENHA 3K69A 3MKLA 2FBKA 3H9GA 1X1AA 3PQJA 3RIRA 1L3LA 1AA7A 1IRXA 2NS0A 4M3GA 2HR3A 4XSZF 3QU3A 4A6DA 1YJNI 4PJJA 1O4XA 1MKMA 3U9GA 1OYIA 3BR1A 5JLXA 3ZGKA 5D6EA 2X48A 1VF9A 1P9QC 1SFUA 2CW7A 3L7WA 4BXFA 1F9NA 2OCEA 3IH3A 9ANTA 1OR7C 1KYZA 2Y69H 3QP5A 3JTHA 5BPDA 3DCFA 2ICWG 4G6TB 1R9TJ 4RDUA 3BG5A 4P5OA 4J19A 2Z99A 1P7JA 1FPQA 4XBFA 3NAUA 1H88C 3FMSA 3F8FA 3HPGA 3ULQB 3CMMA 3KEQA 4I01A 1A31A 4JOMA 3GFLA 3TDUC 4BE0A 3Q0UA 1Z7UA 2VE9A 3MVPA 3F8BA 4WXCA 1G3YA 3M8JA 3F22A 1KA8A 4GYGA 3I64A 5KHDA 1TBXA 3CLQA 2MC3A 3CF5F 1POGA 3IRRA 2XAGA 3S16J 4M6VA 2DA2A 3HIFA 2EIJH 3PIOF 3ZXSA 1FNNA 1YX5A 4CCNA 3A01B 3QOEA 2ID3A 3E1SA 3CCLI 3ZOBA 2M2EA 2DMUA 4BS9A 4M6YA 2EQRA 1TQPA 5EGOB 3TKYA 5HLIA 3G6EI 2QBYA 5IOZA 2M8GX 1P4XA 1FC3A 1AKHA 2XDVA 1Z77A 2DO7A 1U5TB 2RQPA 2KISA 2DFHA 2OQGA 2R5ZB 1J5YA 1JE8A 3I0TA 1IN6A 1X19A 1JKPC 3NQOA 5D5VB 3PL8A 5IT9Z 3ELKA 4M9SA 1XB4A 5A2QZ 1MMAA 4XIDA 3WTYC 2HTJA 2HNHA 4XSXF 3GTKJ 1EKEA 4WF2A 3D0SA 2L9NA 3HRSA 3OOPA 5E3OA 2STTA 2ISYA 1Y0NA 2YX4A 3A03A 3ZQFA 3CDLA 1TWFJ 2YU3A 3MZ8A 3HKZN 2KHMA 1JKQC 1UHMA 2FQ3A 3E0JB 4LLNA 3RZDJ 4L0YB 5BS6A 1Q1HA 4NQWB 1MD0A 3ECOA 2X6WA 4JQFA 4E7JA 3HRTA 1DUXC 1WJBA 3OYEA 2LLKA 2WY8Q 1UCRA 2GXBA 1S8NA 2NXNB 1JTXA 2L9VA 3BR3A 2W85A 3GUDA 2VPLA 3F21A 3ASOH 1TW2A 4CXFA 2IBDA 1LKXA 1SMTA 4XL9A 3I55I 1QQIA 2ZXIA 4A0XA 3HSFA 4A12A 3CMYA 4BEHA 1JKOC 1BJZA 4KFCA 2L7ZA 2Y0SN 5C4XJ 4HZFA 4CZCA 1X1CA 3BTJA 4XKCA 5ILUA 1V5GA 2VJ5A 2W82A 5F08A 2ZSHB 1V5EA 3E6BA 4C3HJ 1ACIA 1WWXA 1JT6A 2L7MP 5EYRA 2R7SA 4CYCB 5AIQA 2NVXJ 2DOAA 4AD9A 1B4AA 1MH3A 1F5TA 1ZG5A 2X85A 5KK1A 1YRNB 1WJ5A 4IRHA 2I10A 4R1HA 3IAM2 5L3EA 2Z3YA 2JT1A 1YW9A 2OUMA 1SANA 3BTCA 4EJOA 2V26A 4O3MA 2TCTA 1ZR2A 2MLGA 2UZKA 4ENJA 2ETHA 1ZGAA 1O3SA 1BJAA 1QGPA 3FBNB 4FX4A 1QPIA 3VYRB 5FB2A 2QZ8A 3ZPLA 3CQZJ 5EEHA 3ABLH 2XKPA 3A2KA 2HPIA 1UELB 1VZ0A 2L0KA 1YITI 2V6EA 2TRTA 3FXQA 1GDTA 4C30A 1B72B 1ZELA 3FM3A 3BJOA 1N78A 2GM4A 1D8KA 3KP2A 5F64A 4HYEA 3S15J 1IAWA 3N05A 3U1KA 3GFIA 4HLYA 1Y39A 1O7LA 3V8LA 3DQVC 3RSNA 2R7UA 4ZTJA 1KU3A 2XAFA 4LG0A 2BGCA 1R1TA 3K2ZA 4F93B 5FJ8J 1OKRA 1BOAA 2DMQA 3R6SA 4XRSG 3SXYA 2K9MA 2F4IA 3S3MA 3BJAA 2IRFG 3K2AA 3FHNA 3QWLA 1MMSA 5J40A 5J3LA 1J09A 3M8EA 1VQLI 4A3DJ 4OMZA 1GHCA 4NBQA 4L5JA 1XCVA 1SVLA 1R7JA 1Z67A 3DTEA 2JA7J 3HOYJ 3EQLF 1U8RA 2L4AA 2HZTA 1Z21A 3OL4A 2M4GA 2VASA 1A36A 2ZBKA 2QVOA 2QSGX 4YG2F 3I58A 3LAPA 4E7IA 2F5VA 2BHYA 1EH8A 2PMHA 3S2WA 2HQNA 5DCFA 5M5XJ 1V4RA 5HDKA 2LH9A 5L3CA 2CGPA 3ZQLA 3HRUA 2IP2A 5E18F 3MAJA 5IP7J 2VXDA 3H3ZA 1FTZA 3MCZA 1KQ9A 5E17F 4CYDA 4RGUA 5BQTA 3M1EA 3CMEI 1VQ4I 3CTAA 3EUHC 1PUEE 1ZGWA 2D1VA 2F5EA 2EFNA 5JFRA 3P9CA 1PYVA 4UNOA 1ZH5A 2UXXA 1VQ8I 2BOLA 3OYLA 4Z2YA 3CC7I 1Y6IA 4A5MA 1EH7A 4XN3A 1XSDA 4JYKA 2ECBA 1U0JA 3LFUA 4OIRF 3REOA 1SEUA 5E1XA 3M07A 2WB1N 4NUBA 5B3SH 5JHFA 1T2KA 2E1MB 5L3DA 2FMLA 3DPUA 1SD6A 4M9XA 2L3DA 2GQQA 1HSJA 2H8RA 4YFKF 1ZARA 2V7FA 5CVJA 4OIPF 3I4MJ 1T8IA 2GXGA 3ZMSA 2IEKA 1W0UA 2O5RA 2RVCA 1LNWA 1T33A 4YFNF 1HW2A 5EJCA 4ABZA 3SDBA 4DJAA 3BG3A 2QEXI 2HS5A 3FXJA 3JRIA 2H8WA 2W00A 2VJIA 4Y15A 1I6XA 2PN6A 1RUOA 4M3DA 3LSPA 4C3IJ 6PAXA 2ZNYA 2GXAA 1F4KA 2YU9J 1RUNA 1JHHA 5CYVA 2O9LA 2DDBA 5IYCJ 3SQNA 3BT9A 3CJRB 4AM3A 3M8FA 5HNHA 1YJ9I 1IN8A 5FD5A 2HVQA 1OJLA 4Y52J 4GFBA 3QODA 5BOXA 3QPTA 4EV0A 2JTVA 4HX4A 1IXSB 4Y33A 2A6HF 1R36A 1B59A 2DMPA 1LVAA 5ICFA 4EATA 1QVUA 2LBFB 3J7YJ 1VQMI 2FNAA 1P4WA 2VOOA 2QGUA 3GLLA 3R4KA 4M73A 2CU7A 2VUMJ 1D3YA 3KLNA 2P7CB 3JW4A 4MTDA 3QYFA 3GYHX 1J9IA 2Y9YA 3E5XA 3Q9SA 1Z9CA 1YS6A 2EFWA 1KGSA 5EZHA 4G7OF 2PJRA 3ABUA 1U5TC 2E60A 3O3KA 2W84A 2LOOA 3HB9A 2VI6A 2VJ4A 2B0LA 3FZVA 1TT0A 3ZQIA 4A3BJ 5IYBJ 4LIVA 5L3FA 3FBIB 4E6KG 3B6AA 3L9FA 4IQJA 3VB2A 2JVHA 4HA8A 4QPQA 1AHDP 2W24A 3J81K 1IRFA 3VODA 3OYHA 5LHIA 1P2FA 3ZMTA 2DOFA 3OMYA 2HGCA 3P9IA 1IZ1A 3COAC 1W7PA 5B1AH 1FYMA 2DA7A 3HJEA 1BIBA 4BACA 2CQNA 1FOYA 2Z5UA 1ZTRA 4CCOA 1IC8A 2ME6A 5DEQA 1FOWA 5F0FA 4FTHA 1X3UA 2XKOA 5GPCA 4GRIA 3DU5A 3TL4X 1DDNA 3S1NJ 5HS9A 3M1CA 2JPCA 2K85A 3CCJI 2WAEA 2KKOA 2VBXA 3CCQI 4Q5SF 4HQMA 4M74A 2VBZA 4XLHA 5HDNA 4Y3OA 2EZHA 4DYQA 2QUFA 1EA3A 2R5YB 5FROA 3KP3A 1KU2A 1N77A 3GFMA 2FX0A 1DP3A 1IF1A 2H1LA 5FFZA 1Z3XA 4WXHA 1A6IA 2LKXA 1SVOA 1CF7A 2ZXJA 4KMFA 5K7HA 2VKDA 1W5CC 3NWTA 1YX3A 4W97A 2DPDA 5KAIC 2JRMA 3HXLA 4BL0B 5C3EJ 5E20A 1MJBA 3TBIA 4QIWN 2IS4A 3E3VA 3GZ6A 3O8HA 1XMAA 4L9VA 5E3NA 5DUKA 4L5EA 3BTLA 5KCMA 5TISC 2CV1A 2K3FA 3BG9A 3V8JA 5ICGA 3F23A 2LREA 1A5JA 2FE3A 1MMDA 4OAZA 1MGTA 4CSWA 1MBFA 4LG3A 2FA5A 3K0LA 4LJZF 5GP9A 1G6NA 3DEEA 1GXPA 1CQTA 1YOVB 1P92A 3SFZA 4C3JJ 5M3FJ 4U7BA 4CGZA 1XDUA 5M3MJ 4F55A 3OYNA 1XCBA 3FXUA 4L9JA 4ZYDA 5D4RA 1A6QA 3HHHA 5IPAA 5CQEA 2HFHA 5BNGA 1MBJA 2G7HA 2LG4A 4DNCA 2CQXA 2EFPA 1QHGA 4BYYA 1NG6A 2YSRA 2CFOA 3D5SC 1J0RA 2XAJA 2V79A 5FLMJ 2BHZA 4RA2A 4M3BA 3RDIA 4L5IA 3GLXA 1SAUA 4FE7A 5F27A 2ACJA 2KIUA 4R8HA 1JGGA 3NARA 1P7IA 1FJLA 2LMDA 2OTJI 2K5CA 4IF4A 3BCAA 1H9TA 2MSYA 4HF1A 1MNEA 2OTLI 4HRIA 2F5FA 1K79A 2KT0A 1WSUA 2JJ7A 5FKMA 3GTQJ 4Y17A 3IC7A 3D5LA 1MBHA 2J5PA 3H1CA 4A0ZA 1Z3YA 3E6DA 4A3CJ 3HHGA 2BYVE 2R7RA 2ESNA 1XSXA 3OSFA 1QA6A 1X1BA 1KQ0A 1ODDA 5F1JA 3WU0A 1FSHA 1X3ZB 4ZH4F 1NG7A 2NNYA 2UWMA 2Q2EA 5D4SA 2KPMA 2DXIA 2V9PA 4HV6A 3IAS2 1BI2A 1FIAA 2X4HA 3EUKL 2PI0A 4M71A 1OCRH 4WK8F 3BY6A 5H6QA 4FISA 1MJAA 5HLGA 3OOUA 3OV8A 2HOSA 4ZC3A 2VPRA 2DI3A 4J01A 2EV0A 4IKFA 1AOYA 2GIZA 3A0HC 3WGIA 2DJIA 2VKEA 3I71A 5JVGF 3HDDA 5D5XB 4GXOA 3CJQB 4ZYAA 1LEBA 1GVJA 2L02A 2M9HA 5IP9J 5GAEJ 2XAHA 4F7ZA 3Q5FA 2M7BA 2B7EA 1FEXA 4IXAA 3LOCA 2A6EF 2G7UA 4XKBA 2E1MC 1K78B 2FOWA 3TOBA 4LOCA 1J7KA 1AU7A 2CMPA 4XMYA 2MA3A 2O8KA 1JUPA 4RM3A 1ZHFA 3T8RA 2CUFA 1U8BA 3I9V2 5FKNA 5K7ZA 3FX3A 3VWBA 5CQGA 3TO7A 4O5VA 3ASNH 3DPTA 3NEUA 1WH5A 4HLXA 2R3SA 3BDDA 4EEFG 2AO9A 2L01A 2N8GA 3K70C 2LY2A 2PEXA 2CFXA 1FYKA 1J2XA 1WI3A 1YE9A 1OMIA 4HV5A 4AUXA 4KDPA 2KZGA 5DYMA 2F2EA 2VC1A 3QPHA 3BTIA 4KT6A 4RGSA 1U6GA 3E7LA 4XKWA 5DD4A 3ZMDA 3ROUA 4NNJA 5HODA 3M9AA 4M9ZA 2JZYA 2IS1A 4I0AA 1G3SA 2OPTA 1NK3P 3PSFA 1O7FA 2XGDA 1MH4A 3ONQA 2E5NA 2PFBA 3F6VA 2VBWA 3LSRA 2ZMEA 3W6JB 4JP0A 5KAFC 1Q1VA 1G8XA 2DLLA 2JWTA 1GUUA 2BVMA 3T8TA 4B3XA 3B02A 3Q0WA 1NH3A 1D8JA 3C7JA 1XMKA 3QOPA 3OYKA 1MZBA 1VNDA 4BDZA 1FMWA 1IN5A 2ECCA 2DW4A 2EZKA 4PGGA 4UY8I 4ZZDA 3RJPA 2PJRB 1ON2A 1IN4A 1R22A 4KIFA 2ME0A 3HTSB 2R7WA 2WTEA 1S7EA 2H94A 2YX7A 1O57A 2CYYA 4AVPA 1EH6A 3RKWA 4WCGA 3LNQA 2UV1A 4HF2A 1BR1A 3IH4A 1WJFA 5AIPA 1BOBA 2LNBA 3E5QA 3ISPA 5B66C 2LY1A 2MH9A 4OIQF 2V9VA 4IQ4A 4CA0A 5LD2C 4DW6A 2L4MA 1WZ2A 3EYYA 3BG7A 5E1ZB 3KYDB 3IV5A 3HOSA 2Q1ZB 2TDXA 3HC7A 4KA4A 3KEOA 2K40A 3OY9A 4DIQA 2X6OA 4B4CA 3FWEA 2O8XA 1R5HA 1MMNA 2H27A 2DA4A 2JK3A 3IUOA 2FSWA 4XRMA 2A5WA 4ESBA 3VYUB 2ZXHA 2HTSA 3H36A 3RCOA 3CD6I 5FLXZ 1ETWA 4HDVA 3TP3A 2I8DA 2GOXB 3M7GA 2DFEA 3K4NA 4LK0F 2W7NA 3K70D 1JT0A 4EMSA 3FXKA 2JN6A 4XNFA 5CPRB 4ZDLA 4CICA 2PJPA 3PO3J 3K4JA 4H4KC 2RGVA 3IKVA 3CLOA 3HG9A 3OYGA 3R0AA 1R6RA 1WKMA 3DFGA 4RGRA 2ZJRF 3GTLJ 2JSPA 4MHGA 5J8FA 2K27A 3CUQA 5CVUA 4P55A 1ZYRF 1I6HJ 1D0ZA 3J7AO 3RPUD 1AWCA 1D0XA 4HPQA 3S93A 3KYLA 3H5NA 3I59B 2V6CA 4UHTA 5GADJ 4XLCA 5FO5A 3UR3C 1GV2A 2DA3A 1GXQA 3U21A 1MDMA 2ESHA 3GEZA 2M8EA 1ZQ3P 2ELKA 3V4GA 1RI7A 3S32A 2XROA 3PFIA 1T98A 4P9UA 1RR8C 2DN0A 3K9TA 4BU2A 2NVQJ 1V3FA 2IVMA 1YW8A 2KRFA 1LEAA 3CCUI 3TQNA 3WG7H 5IY5H 4E4HA 4JX5A 3CCVI 1SD5A 1OR7A 1S6LA 2MFZA 3VFZA 1LE8B 2VQHA 4UV8A 4KT5C 3K1NA 2E19A 2DU9A 4UUSA 2LD5A 2L7KA 1PJRA 2EZLA 1EF4A 3H3VK 2K9QA 3JSPA 2RAEA 4IHWA 3AFHA 3W2VA 3H92A 2X1EA 2KL4A 3KZIC 1G59A 4MO7A 1RR7A 2A68F 1JUMA 1LQ1A 1UG0A 2CV0A 1VQ7I 3LA3A 5C44J 5GTIC 1WVRA 4U0YA 1U78A 2EFQA 3T0YA 3LFKA 4MLOA 3DKXA 2WAQA 2NRAC 2VQCA 2JUCA 2EINH 2NOJB 2PMZN 4B48A 1PP7U 2M30A 2E2HJ 2QF7A 2VC0A 2ZFWA 3V42A 4BKXA 4N9IA 1XN7A 1IDZA 3HTUA 2HVSA 2EBIA 4HQEA 4OMYA 3C18A 2O03A 2IPQX 1U9NA 2LDUA 1SAXA 4W1UA 3IP4B 1KU7A 1HW1A 4DZPA 1GVDA 1T38A 1HDDC 3OS1A 2E2JJ 3ZCOA 4C9YA 3LAJA 4FETA 1E3OC 2XRLA 1Z1DA 3TP0A 5B5EC 2B63J 2XHKA 3H3UA 5CVVA 3I56I 2HKXA 3J80Z 4UXNA 3IKTA 5J47A 1ETQA 4D1QA 5H6RA 1LB2A 4XORA 3VOEA 4DGWB 1ZGJA 4BDYA 1C0WA 3TEDA 1U2WA 5HS7A 3W2AA 2DFIA 5ED4A 2A3SA 3V7SA 3JAMK 1SFEA 4GDFA 2BY2A 4RB2C 1LDKB 1B9NA 3DKYA 3FM5A 2XB0X 2KJBA 2Y2ZA 3G1LA 3ZMZA 1OFCX 1Z7LA 1A35A 3G2BA 3LSTA 1RNLA 4EVIA 3ABKH 2JA8J 4YRVA 2NVYJ 1TC3C 3ZQQA 5HLHA 2FEZA 4AIDA 1YW7A 2LF7A 2QKMB 5TJJA 4IO9F 3AL0B 4HEA2 3TDZC 2FJ1A 2V9KA 4HNVA 3CP8A 1IN7A 2CV2A 4RB3C 3OIQA 2VKVA 5EEAA 2FBHA 2IT0A 2QKLB 3PM1A 4E7KA 2OZUA 1RKWA 1OCOH 3F72A 2B9SA 1RC9A 4J00A 3MMYB 2OJED 4XLPF 1I3AA 3GBGA 1ETVA 3GFJA 3KX2A 3R60A 4KN7X 4D5FA 4EJVA 5JLWA 1B8IB 2HOAA 4U87A 4X1EA 4LB5A 1XSVA 3BR6A 1Z0XA 4PSWA 3WHBA 2BY3A 1YFHA 5FLVA 5GAHJ 2D2WA 2NS8A 2QQAA 5K7FA 3S3OA 2Y9ZA 4JX4A 1HXDA 2X51A 5HNFA 1PUFA 4BQQA 4RMNA 4M3FA 5DV5A 5AONA 3ML6A 1E0EA 3C1DA 3FHZA 2RNGA 4DZJA 4RAZA 3OYJA 2X1DA 3SZPA 1I1GA 2DYRH 3IWZA 4CZZA 4HOBA 2Y75A 3K7AJ 1T0FC 4U0WA 3JREA 4BJ6C 2OU2A 3MWMA 5IOYA 2R7OA 2P0WA 3S3NA 2KDZA 2XASA 2O3FA 4E7SA 1Z6TA 2JRTA 3CC4I 4A0YA 2LRDA 3L2QA 1M1EB 1VTNC 3FF5A 4A3GJ 1OCTC 4CO8A 3ZP5A 2JA2A 2ZMEB 3LWFA 3FDYA 5B1BH 1XGOA 5L3BA 2DODA 2DT6A 3HGGA 2Y0MA 1QVTA 1Y8RB 1P6RA 2P7VB 3I54A 2VQLA 2JUGA 3W2WA 2LK2A 3C2GA 1HKTA 5J1YA 3CDHA 2WY7Q 3HOUJ 3HOXJ 2EH3A 3GTMJ 3O8GA 1DPUA 3KFWX 2F5CA 3ZN1A 2ZNZA 5BPIA 1ONVA 2FUG2 1QZYA 1WI9A 1ZRFA 1MBGA 1HA8A 3GW2A 2NS7A 5F04A 2LY9A 5F6FA 4A3LJ 4D9JA 4XN0A 2VB6A 2KQRA 2HOEA 3LSMA 3M3YJ 1O3RA 1LUJB 2QSHX 2RV8A 4MFEA 1UG2A 1UB9A 5FRMA 3BZ6A 2X1CA 1R5ID 4A6EA 3BPXA 2O6GE 4PDKA 3K6GA 4Y4RA 2VONA 3L00A 3A4CA 1TQMA 3UKGA 2EILH 5FKKA 3W6KB 4WX9A 5DS9A 2MH2A 1FT9A 3IRQA 5BMZA 3HKZA 5HVQC 3HGYA 3LA2A 4MIMA 2Z33A 5H20A 1G3TA 2R7QA 3KP6A 4FQGA 1RPWA 4A3MJ 2E7WA 3A02A 2CUEA 4DBRA 2XF5A 4B8XA 4EM0B 5F0HA 4I09A 1ULYA 3NRVA 1IV8A 2LYCA 2QLZA 1T08B 4EQQA 3Q0VA 4XRFA 2L5QA 5TGTA 3ECHA 3JRFA 4OINF 1R23A 4KUMA 3QRFF 1FBSA 5D6FA 4BH9A 3CCMI 2QBYB 1QRYA 1TT5B 5EG0A 1AKHB 2ZCWA 3E6MA 2M5WA 3FXLA 1XGNA 2KIMA 3A0BC 2HQAA 4WXDA 2LR8A 1TZLA 1HKSA 2EJRA 1Z91A 4LD5A 2FNPA 3KYCB 4G6DA 4YIRX 4CDGA 2CG4A 1IXCA 1SD4A 1UMQA 3MKYB 2RNJA 2KRCA 1VI0A 2YPRA 2L2OA 2V1DA 4B43A 3JR9A 4DQ2A 5DUIA 5M5YJ 4ESFA 2LFBA 2DTRA 3D1NI 3H35A 4A3IJ 3HOTA 2FF4A 2KMUA 3W3CA 2P5VA 1A04A 4I6ZA 2MG4A 2HEOA 2GZWA 3L09A 4CHUA 5DCMA 1XC5A 4XLNF 2BV6A 3DEWA 4LFUA 5IP6A 2ZB9A 1K83J 4IHVA 3CJNA 2STWA 3DF8A 1B9MA 1ON1A 1FMVA 4LK1F 1BC7C 2W1OA 3MKWB 3BLYA 3G4SI 2E71A 1LJ9A 2EV5A 2GA1A 3DP7A 1BR2A 2IA2A 3BG6A 1W7PD 5IT9K 4IHSA 2DA1A 2R93J 5A2QK 2KRHA 2YS9A 2GWRA 3EETA 4BEHB 4RB0A 3DTKA 2NNNA 3HOWJ 3JRDA 4JBAA 3KP7A 1W5TA 1USSA 3K1PA 4D7MA 2W25A 3K4BA 2F5DA 2CSOA 1SFKA 3A01A 4ZTFA 4MGRA 3TO9A 3IH2A 5DTDA 1LFUP 1HF0A 3BC8A 1NHAA 3JRGA 1XDSA 2F6CA 5EGOA 3F8NA 5DD8A 2ZJ2A 2MYSA 2QM3A 1U5TA 2FMYA 2P6SA 2VN2A 2Q8KA 5FKLA 2ZFUA 1QZEA 2FXAA 4XK4A 3PO2J 2DMTA 2UXNA 5E3MA 2Z1DA 2HYFA 4RAYA 2HPMA 5CJ9A 2DOEA 3IL2A 4A3JJ 1HLVA 5FRNA 4XLEA 2M4KA 1ZLJA 4RS8A 1T56A 5D8KB 3DEUA 3S1RJ 1I1SA 3VYTB 2LVSA 4KISA 2BE5F 1JXSA 2DT7B 1ZK8A 4NQWA 3MN2A 1SFXA 5C4JJ 3OS2A 1MMGA 3C2BA 1TL8A 3SFIA 2XVCA 3FK6A 4KN4X 2VBYA 2W4SA 4HNTA 4L0ZB 4KMUX 3GZ5A 1XD7A 3HRMA 1TWHJ 4C2MJ 4LG0B 3ZMVA 2M0MA 2EZIA 3AL0C 3WTVC 1I27A 1IRZA 4FT8A 5CVIA 1IUFA 3OL3A 4P1WA 4D0PA 1ETYA 3S17J 1MJ9A 2I5UA 4G9YA 1BBYA 2VKHA 4ETSA 2HVRA 4H0EA 2AXLA 2OBPA 4G12A 2VODA 2CQQA 3LMMA 3IWFA 3PJRA 2CS3A 4ESJA 2Q0OA 2VOPA 3KZZA 4A2UA 2WB1A 5J4YA 1YIJI 4PJMA 2EA4A 3ESWB 4BBSJ 2IA1A 2WBMA 2ISZA 4LLLA 1ETKA 4Z6YA 4AU7A 2IA0A 1VQ9I 1YQAA 4CYCA 4UB8C 5LFAA 4QLCU 4PUSA 3KCCA 3BZKA 5K5RA 2XGCA 2LF8A 2CWEA 2RC4A 1YRNA 4PGHA 2K86A 4CCJA 5K5QA 2ZJPF 3FIWA 5M5WJ 3BWGA 1BL0A 4HX7A 5E1WA 1ZN2A 2X6YA 1X3WB 3MEXA 3QPLA 3VEPA 2CQ7A 1SMYF 4LMYA 4UV9A 2CJJA 2BXZA 4X0GA 2HYJA 3TW7A 3I3LA 3RYPA 1S72I 3QU6A 3SEQA 3FISA 4O6JA 1BM9A 1UJ8A 3WG9A 4U88A 1W1WE 1W0TA 2JQ7A 4F91B 4HNUA 3P7NA 4UB6C 1R5GA 4ITVA 1J75A 5JI6A 2K9LA 2E2IJ 4RB1A 3B73A 2WAQN 1IUYA 3CDIA 2P81A 2ZMEC 1TQIA 4KIBA 4AIKA 1B72A 1ETOA 3PUBA 3KIOA 5ERIA 2M87A 3ZR8X 1BN5A 1IW7F 4MNUA 3RKYA 1R1UA 1XG1A 3MFKA 4PJLA 3L2RA 2P4WA 3B6CA 4M72A 5J6XA 4WWCA 3EYIA 1QPMA 2DJNA 4N4OB 2F4OB 1WJAA 2HOTA 1TW3A 5CVRA 4GCVA 3VDXA 3HUGA 2ZJQF 2G9WA 1MSEC 2KFDA 3LQRA 4HW0A 2A69F 3HBLA 1SC7A 3R61A 1DU6A 4D5CA 2KJCA 2AXTC 3GXOA 3K4KA 3LSHA 2UUZA 4MFDA 2EWNA 2GAUA 5EF6A 4KICA 4YIIA 3PNYA 4HBLA 2OCCH 2Y48A 3DBRB 3V8KA 4GGGA 2LSOA 1YG2A 3MD2A 4IL6C 2NYXA 3L2VA 4A93J 4QTRA 3GTPJ 2O7OA 1MNMC 4JX6A 4I0BA 3WE3A 5D5WB 3BJ6A 3R0JA 4B47A 2PX9A 2HQRA 2HXIA 2EPFA 2FQ4A 2IAIA 3GWZA 2FRHA 4F3QA 2E36A 2IS6A 4E7HA 4UVCA 1K7AA 1FP2A 3P5JA 2PMUA 1IDYA 2E1NA 3ZQ7A 1FLIA 3KP5A 4C2UA 4RBOA 1WQ2A 4XR6A 3SHFA 1YI2I 2BEOA 2EV6A 5FD6A 3GTGJ 2WV1A 2G0EA 1RETA 3CF2A 3FK7A 4A69C 4AC0A 5KNLA 5H2FC 2HXOA 4ZYGA 2XGXA 4U7DA 1S29A 3PQKA 2OF7A 1T39A 4BHPA 3CCYA 2EIMH 2OA4A 5TRDA 1WRJA 3H9JA 2K7LA 1W7PB 1QO0D 1BI1A 1FP1D 2K02A 5DCMB 3RKQA 2P8TA 2GIVA 4HG2A 1ERDA 3G73A 3HM5A 2E1CA 2DQLA 2HKOA 4A3EJ 2A6TA 4QSHA 4BE2A 2ZC2A 1D0YA 4Y13A 3FMQA 4MQ9F 2IS2A 2BW3A 4BGDA 1J59A 4ZYHA 1S9HA 4D7NA 4RM2A 1I5ZA 4A5NA 1WFXA 4HSTA 4NDLA 1O3TA 2GA2A 5J1RA 2HYGD 2JA5J 5LGTA 4YFXF 4F52A 4FE4A 5DDGA 1R4NB 4B3AA 1YLFA 4HF0A 4GYIA 3E6CC 3S1MJ 2D45A 1MIJA 1TNSA 1XTAA 4OAYA 4UVBA 2WA0A 1OYWA 2XPWA 4A3FJ 2BZTA 4NC6A 3WHCA 3X2QH 1REPC 4BY1J 5DM7F 1HW5A 1OCPA 2ZXWH 2LC2A 3RPUA 1L0OC 1CF7B 2HQ5A 5ICCA 3J81Z 3T5XA 2GOMA 3S2DJ 1WPKA 1Y8QB 1YJWI 3BQYA 4DYRA 2F48A 2LBFA 2COBA 4LLGF 4AYBA 5DM6F 3LSIA 2MLKA 1D5YA 4XM3A 3OR1C 4BQNA 1W36C 2XAQA 4V2FA 5LBQA 2KZVA 3WTZA 2M0CA 4XOTA 4MTEA 4E7LA 2K9NA 3OYBA 3K4MA 2CW8A 1V54H 1X4PA 2M1BA 3CZ6A 1G2HA 2F4MB 4KYWA 3FKJA 5LEJA 1WGXA 1XGMA 2ADUA 2JPBA 3AG1H 1D5VA 2KLOA 4DBQA 3G3ZA 3VSLA 1BI0A 3AG4H 2WC2A 3ABTA 1HSTA 3WU2C 3I4NJ 1K6OA 1VQPI 1N75A 2ELHA 4U0VA 3S1QJ 4CCLA 2CRGA 2OC6A 3T1BA 4L9TA 1WJCA 2QA4I 1FIPA 2DPUA 3KEYA 4S05A 1IV6A 3HEFA 1D1CA 4AWXB 4Y7NJ 1TWCJ 2D5VA 4OWRB 2AS5F 1LDJA 1TP4A 2KIFA 4P96A 3H9QA 2OV7A 3WU1B 2DYSH 3SZGA 1LVKA 1VQNI 2EFOA 1X2NA 5LLQA 2H1KA 4G6QA 2DDAA 2V4JC 3QPSA 3ERED 4XONA 3J7ZI 4EJUA 1MBKA 2QQ9A 2R5YA 4EJWA 2QWWA 2JSCA 5LHHA 2RKHA 3H0GJ 3PNVA 3GVAA 1Z6RA 4XOPA 4BAYA 2EA2A 4XLFA 4XLAA 4LITA 1Y56A 1FBQA 3I5UA 1W4MA 1WJDA 2Y30A 4V19K 5D8LB 1R1VA 2QCOA 1RKTA 4LB6B 3WTWC 3QYBA 2QYOA 1ITYA 3PNTA 4I98B 2LKSA 1JJ6C 2Q2EB 1W36D 4PJNA 3BQZA 1KYWA 2BY1A 3BR0A 2L9SA 1FSEA 1ZAOA 2Z9OA 2CUZA 3LL7A 2YR2A 2IXSA 2MGQA 3S8PA 2WAFA 1G4DA 1IG7A 1BI3A 1E3HA 2XSJC 2V1NA 1FOKA 2LP0A 2HWVA 5ILSA 3NWSA 5LHGA 4A3KJ 2XB5A 3KE2A 2IGKA 3GTJJ 3D5RC 4JK1X 4V2GA 1YO5C 3DKWA 4QPOA 1ORKA 1PVEA 3U2RA 2R0QC 4PCQA 3F8MA 3GTOJ 4IVNA 2A61A 1DGWY 4PFPA 4G7HF 4ZDOA 2E5ZA 4BUPA 3OWTA 1MSFC 3F6OA 5ICEA 2IGNA 1FBUA 3JRBA 5E8IA 3MKZA 2Z2SB 2RREA 1I39A 1W5SA 4GO1A 3V7CA 1OCZH 3F9KA 3BROA 3N97A 3EUAA 2R7TA 5LRSA 3P9KA 4FHTA 3RQ4A 2NVTJ 1K4SA 1H0MA 2EB7A 3FXOA 2OZ6A 3MZHA 1KU9A 3TGNA 4N4NB 4R79A 1HQCA 4UUTA 1F43A 1T6SA 1OYYA 2L54A 2P5KA 1YIOA 1HC8A 2A07F 3HUGB 1VQ5I 2W48A 2HDDA 4S04A 3LSJA 4AIJA 5E79C 3HYIA 1U9OA 4XRSA 1XPXA 2DTZA 2IJLA 1O3QA 5JR3A 2HU9A 3BOQA 2MD5A 3BP8A 1F36A 3K4LA 3OYCA 4IX7A 3DBHB 1OLTA 3WTTC 2H6CA 4B09A 3WE2A 1KZHA 2DMNA 1XGSA 2MABA 4I99C 2R92J 5HOOA 4RAFA 1QBJA 2CH0A 1IO2A 2R4GA 2M7AA 2PG4A 3CC2I 3SYTA 2W57A 2MBFA 1Y0UA 1BW5A 1XMXA 1DPRA 2VT2A 4BNCA 1R4MB 4RGXA 1DQUA 1ETXA 1X58A 1WCMJ 3LQQA 4N0BA 5FKOA 4XQFA 3AAFA 2COMA 1NK2P 3WODF 1YS7A 4ON0A 2FBIA 2CQKA 1Y1WJ 2J5OA 4DOZA 1YTYA 2K4BA 4NHJA 1RRJA 2RQQA 3DBLB 5ILVA 2DK8A 5LRRA 2M45A 3WTXC 3VPRA 2PBIA 2PQ8A 3OS0A 3JTGA 4BBRJ 4M6XA 1KQ8A 2GBYA 4I76A 5F0CA 2AQFA 1BIAA 3CUOA 1OISA 1FY7A 1K78A 1E17A 3F3XA 1EJ9A 1APLC 4HDUA 4G7ZF 4EJTA 4IHXA 1GT0C 1CGPA 2FU4A 2ZO4A 2M34A 4IPAA 1TWAJ 3TMOA 2JVGA 1STZA 2RDPA 1JKRC 1SD7A 3GMEA 4AVZA 1LDDA 4S0HB 4M3EA 4BJTA 2ID6A 4IRGA 4IJAA 3MQ0A 3WGGA 2DCEA 3HOVJ 3ZQCA 3S14J 4BQOA 4NB5A 4RLFA 4PFOA 4IOCF 1SVMA 5F1RA 1R71A 4IHTA 3M4OJ 1X2MA 2XV4S 2BW3B 2LTPA 5L3GA 1IJWC 1XX5A 2R7ZJ 4ZZLA 4K2EA 2E34A 1BW6A 3CJTB 3EUHA 2QQBA 3O2PE 1T0FA 4DYCA 3ZN0A 1K4TA 1LFPA 1QHHD 3CUQB 4X6AJ 4ZJZA 2HDWA 1K61A 1V5FA 5D5UB 3HZJA 3KPHA 2DT5A 1XS9A 1TTYA 1ZG1A 2L7FP 1KONA 2O61A 3K10A 4MQVA 1WHUA 4CUGA 2AQEA 3DWLE 3KZYA 2Y0SA 2XSDC 2DA6A 2H09A 3H5RA 1T95A 1DGRM 4CCMA 5IT3A 1MDMB 2H6BA 3G1OA 1PDNC 3BR5A 1BA5A 5FLXK 2FD5A 3JCUC 2PMZA 2A5YB 2VJJA 3AG3H 3A1YA 3I4PA 2DA5A 2XUBA 4LGWA 2XPUA 2CO5A 3SZTA 3TW6A 4PZJA 3QP6A 1K6YA 2VLAA 2VQGA 4NC7A 3BCBA 3WGHA 3JRHA 1RZ4A 4HSRA 4TV7A 4UUSB 3ZRGA 5J8CA 5FGMA 3CMAI 1D1AA 4EGYA 3E5UA 4EM1A 1B1BA 1UAAA 1G3WA 2K3PA 4L18B 3U1DA 4YELA 3OYMA 1H89C 1GLNA 2O0YA 4E70A 2R7DA 4HAMA 1PP8F 4OIOF 1ZKGA 1TLHB 3WTSC 3H5AA 3RPQA 2BXYA 3JSOA 3Q9VA 1UFMA 5EDNA 1DU0A 1I50J 5K1YA 2XC7A 1USTA 1S7AA 3SEZA 2R7VA 1JI8A 3L2WA 2Z16A 2ZKZA 2IGOA 3F0CA 1TNTA 1TWGJ 4KITB 5GAGJ 2V1UA 3O6BB 4C2TA 2KIQA 2AHQA 3I53A 1S7OA 3BPVA 1ZR4A 3C3WA 2K4JA 1FOXA 4KJZA 2VL8A 1SFOJ 5JHUA 3DTIA 3RI4A 1F1ZA 1LPQA 1QZZA 3FXMA 5E3LA 2BY0A 1H9GA 5GPAA 3L1PA 3RYRA 1V55H 1IRGA 3SJMA 1P4AA 3AKZA 1IGNA 3TO6A 4YEJA 2R5ZA 5FFXA 1Z05A 2LKPA 3I59A 4IEJA 3RTRA 1OCCH 2OQRA 3OR2C 4PSXA 3DPLC 2NVUB 4NC8A 4BY7J 2FOKA 2OD5A 1FZPB 4ENNA 4MEYF 3W6VA 3BZCA 4XICA 3KLOA 3OIPA 2L9RA 3L2CA 1X4OA 2YUSA 4BE1A 3K4CA 2DFFA 2QQ8A 2ZSIB 2P5LC 4ASNA 2X0LA 2KP6A 5CLSA 1JUSA 1LE8A 4CH7A 3RKXA 2P6TA 5EZGA 4UUVA 2JMWA 4FCYA 2MD0A 2IW5A 2XRNA 4EM2A 4G8XA 3EDPA 1FX7A 1VFCA 4KNYA 4RLQA 1FTTA 3QQAA 1RIOH 2PLYA 4CCKA 1JTYA 1UHWA 3ERMA 2GLOA 4I2OA 1R00A 3GX4X 1Y1VJ 4KIGA 1RESA 1MNDA 1WJEA 2X6XA 3J80K 3CCRI 1HBXG 4IHYA 2EK5A 1OPCA 2OAZA 3K1MA 2HI3A 4AYBN 2Y31A 3KETA 1JHFA 1S5LC 3FMRA 4AIHA 1B6AA 1ZRDA 1ZREA 1HDPA 3DV8A 4ENMA 4YIFA 3ZQGA 5HLTA 5IYDJ 3CESA 4RAGA 2EIKH 3DU6A 2D1HA 3V7RA 3JAMZ 3LSKA 4G94A 1BR4A 2BBYA 1MBEA 2HZDA 3FKIJ 3GCMA 1X1PA 1VQKI 3SDGA 3QAHA 3PSIA 3S2HJ 2RN7A 3GF2A 4BJ5C 2R7FA 1PUFB 4BXXJ 2A05A 1MW7A 1OQYA 1GV5A 2DQRA 2CUJA 4IZZA 3J7AY 4I7HA 3UNGC 4FX0A 4P9FA 3FXRA 3HL2A 3JRAA 4HX8A 3N4MA 4IRIA 3HOZJ 2C6YA 3PUFA 3G1MA 1HOMA 2XF6A 4Q4ZF 1U3EM 2JA6J 4ZDPA 3OYFA 4ENKA 2XPVA 2CW0F 1R58A 3QYEA 3OSGA 3CP2A 1FYLA 1H8AC 4IOAF 1QU3A 2BVLA 4LIUA 1N25A 4Q48A 1NTCA 3HSRA 2XGEA 2QSFX 2X9DA 4BHCA 4ZYEA 1YYVA 2XIGA 3ZMUA 1ZRCA 1JJ8C 3EPZA 3RQIA 4II2A 2WADA 3OYIA 2ELJA 3AG2H 3DXJF 1HKQA 1LFBA 1ZG3A 2DAOA 2VT3A 3IHUA 2DK5A 2E1OA 4UVAA 3G71I 3DLLF 4EGZA 5EEGA 2WWYA 3BR2A 1HCRA 5J1UA 2MC4A 2QENA 1YHQI 1D1BA 4OOIA 5K5OA 3CO6C 3VYSB 4XKVA 4B1RA 2XF7A 2VXZA 5J4VA 2R7XA 1R49A 5GTHC 2IGMA 2HDCA 5HDGA 3CCSI 3PIPF 3L2UA 1VQ6I 4Q47A 2MW8A 3HSEA 4QWQA 2VIXA 1FWZA 5HS8A 3OYDA 1B8IA 4B44A 1E3PA 3H0DA 3HPHA 5LGUA 4F92B 5KVRA 3LA7A
chains in the Genus database with same CATH topology
3F8CA 3WTUC 4OU0A 1ZLKA 3GO5A 2E7XA 3CO7C 1EV7A 1E2XA 4N9HA 3KP4A 4MEXF 5LGNA 4BHBA 1IXRC 3TOAA 5LEKA 4BQAA 4L9NA 5JVTA 3E97A 1DP7P 2WV0A 3MZYA 2V1XA 3CUQC 1S3JA 2NAZA 2DBBA 4I02A 1BC8C 5E8GA 1QNTA 4BXUA 1JGSA 2VE8A 3K69A 2FBKA 3PQJA 1L3LA 3RIRA 2NS0A 2HR3A 4XSZF 3QU3A 4A6DA 1MKMA 3U9GA 1OYIA 5D6EA 1SFUA 3L7WA 1F9NA 1KYZA 3QP5A 3JTHA 5BPDA 4P5OA 2Z99A 1FPQA 4XBFA 3FMSA 3F8FA 3ULQB 3KEQA 4I01A 3GFLA 3TDUC 1Z7UA 2VE9A 3F8BA 4WXCA 1G3YA 3F22A 1KA8A 4GYGA 3I64A 1TBXA 2MC3A 3IRRA 2XAGA 3HIFA 1FNNA 4M6YA 1TQPA 3TKYA 5HLIA 2QBYA 1P4XA 1FC3A 2DO7A 1U5TB 2RQPA 2OQGA 1J5YA 1JE8A 3I0TA 1IN6A 3NQOA 5D5VB 5IT9Z 3ELKA 4M9SA 1XB4A 5A2QZ 3WTYC 2HTJA 4XSXF 4WF2A 3D0SA 3HRSA 3OOPA 2STTA 2ISYA 2YX4A 2YU3A 1UHMA 2FQ3A 4LLNA 4L0YB 5BS6A 1Q1HA 1MD0A 3ECOA 4JQFA 3HRTA 1DUXC 1UCRA 2GXBA 1S8NA 2W85A 3GUDA 3F21A 1TW2A 4CXFA 1SMTA 1QQIA 4A0XA 3HSFA 4A12A 4KFCA 4HZFA 5ILUA 3E6BA 1WWXA 5AIQA 4AD9A 1B4AA 1F5TA 1ZG5A 5KK1A 4IRHA 4R1HA 5L3EA 2Z3YA 2JT1A 1YW9A 4EJOA 4O3MA 2MLGA 2UZKA 4ENJA 2ETHA 1ZGAA 1O3SA 1BJAA 1QGPA 4FX4A 5FB2A 2QZ8A 3ZPLA 5EEHA 2XKPA 3FXQA 3FM3A 3BJOA 1D8KA 3KP2A 5F64A 4HYEA 1IAWA 3GFIA 4HLYA 1O7LA 3V8LA 3DQVC 1KU3A 2XAFA 4LG0A 2BGCA 1R1TA 3K2ZA 1OKRA 1BOAA 3R6SA 3SXYA 3BJAA 2IRFG 1GHCA 3M8EA 4OMZA 4L5JA 1XCVA 1R7JA 3EQLF 1U8RA 2L4AA 2HZTA 2ZBKA 2QVOA 4YG2F 3I58A 3LAPA 1EH8A 2PMHA 3S2WA 2HQNA 5DCFA 1V4RA 5HDKA 5L3CA 2CGPA 3HRUA 2IP2A 5E18F 3MAJA 3H3ZA 3MCZA 1KQ9A 5E17F 4CYDA 4RGUA 5BQTA 3M1EA 3CTAA 1PUEE 2D1VA 2F5EA 2EFNA 5JFRA 3P9CA 4UNOA 1ZH5A 2UXXA 4Z2YA 4A5MA 1EH7A 1XSDA 3REOA 4OIRF 5E1XA 1T2KA 5L3DA 2FMLA 1SD6A 4M9XA 2L3DA 2GQQA 1HSJA 4YFKF 1ZARA 5CVJA 4OIPF 2GXGA 3ZMSA 2RVCA 1LNWA 4YFNF 1HW2A 2HS5A 4Y15A 1I6XA 2PN6A 1RUOA 6PAXA 2ZNYA 1F4KA 1RUNA 1JHHA 5CYVA 3SQNA 3M8FA 1IN8A 5FD5A 5BOXA 3QPTA 4EV0A 2JTVA 4HX4A 1IXSB 2A6HF 1R36A 1B59A 1LVAA 5ICFA 2VOOA 2FNAA 1P4WA 3R4KA 4M73A 1D3YA 3KLNA 2P7CB 3JW4A 4MTDA 3GYHX 1J9IA 3E5XA 1Z9CA 3Q9SA 1YS6A 2EFWA 1KGSA 4G7OF 3ABUA 1U5TC 3O3KA 2W84A 2B0LA 3FZVA 5L3FA 3L9FA 3VB2A 4HA8A 2W24A 3J81K 1IRFA 3VODA 5LHIA 1P2FA 3ZMTA 3COAC 2HGCA 3P9IA 1IZ1A 1W7PA 1FYMA 1BIBA 2Z5UA 5DEQA 1X3UA 2XKOA 1DDNA 5HS9A 2JPCA 2KKOA 2VBXA 4Q5SF 4HQMA 4M74A 2VBZA 5HDNA 2QUFA 3KP3A 1KU2A 3GFMA 1IF1A 5FFZA 4WXHA 1CF7A 2ZXJA 4KMFA 2DPDA 5E20A 1MJBA 3E3VA 3GZ6A 1XMAA 4L9VA 5DUKA 3F23A 3V8JA 5ICGA 2FE3A 1MGTA 2FA5A 3K0LA 4LJZF 1G6NA 1GXPA 3SFZA 1P92A 4U7BA 4CGZA 1XDUA 1XCBA 3FXUA 4L9JA 4ZYDA 5D4RA 3HHHA 2HFHA 2G7HA 4DNCA 2EFPA 4BYYA 2YSRA 1J0RA 2XAJA 2V79A 3RDIA 4L5IA 3GLXA 2ACJA 2KIUA 4R8HA 4IF4A 1H9TA 4HF1A 2F5FA 1K79A 1WSUA 4Y17A 3IC7A 3D5LA 2J5PA 4A0ZA 3E6DA 3HHGA 2BYVE 2ESNA 1XSXA 1KQ0A 1ODDA 3WU0A 1FSHA 4ZH4F 2NNYA 2UWMA 2Q2EA 5D4SA 4HV6A 1BI2A 2X4HA 2PI0A 4M71A 4WK8F 3BY6A 5H6QA 1MJAA 5HLGA 3OV8A 2DI3A 2EV0A 1AOYA 3WGIA 3I71A 5D5XB 4GXOA 1LEBA 1GVJA 2L02A 2XAHA 4F7ZA 3Q5FA 4IXAA 2A6EF 2G7UA 1K78B 3TOBA 1J7KA 2MA3A 1ZHFA 3T8RA 3FX3A 3TO7A 4O5VA 3DPTA 3NEUA 4HLXA 2R3SA 3BDDA 2L01A 2PEXA 2CFXA 1FYKA 1J2XA 4HV5A 1OMIA 4KDPA 5DYMA 2F2EA 2VC1A 3QPHA 4RGSA 1U6GA 3ZMDA 5DD4A 3ROUA 3M9AA 4M9ZA 2JZYA 4I0AA 1G3SA 1O7FA 2PFBA 3F6VA 2VBWA 2ZMEA 3W6JB 2DLLA 3T8TA 3B02A 1D8JA 3C7JA 1XMKA 3QOPA 1MZBA 1IN5A 2DW4A 4PGGA 4ZZDA 3RJPA 1ON2A 1IN4A 1R22A 4KIFA 3HTSB 2WTEA 4AVPA 2H94A 2YX7A 1O57A 2CYYA 1EH6A 3RKWA 4WCGA 4HF2A 5AIPA 2LNBA 3E5QA 3ISPA 2MH9A 4OIQF 2V9VA 2L4MA 3EYYA 5E1ZB 3HOSA 2TDXA 4KA4A 3KEOA 3FWEA 2O8XA 1R5HA 2H27A 2FSWA 4ESBA 2HTSA 5FLXZ 4HDVA 3M7GA 4LK0F 4EMSA 2PJPA 4CICA 2RGVA 3IKVA 3CLOA 3R0AA 1WKMA 3DFGA 4RGRA 4MHGA 5J8FA 2K27A 3CUQA 5CVUA 4P55A 1ZYRF 3J7AO 1AWCA 3I59B 2V6CA 4UHTA 5FO5A 1GXQA 1MDMA 2ESHA 3GEZA 2M8EA 3V4GA 1RI7A 2XROA 3PFIA 1T98A 4P9UA 3K9TA 1V3FA 2IVMA 1YW8A 2KRFA 1LEAA 3TQNA 1SD5A 1OR7A 1S6LA 3VFZA 4UV8A 4KT5C 3K1NA 2DU9A 3JSPA 3H92A 2A68F 1LQ1A 3LA3A 4U0YA 1U78A 2EFQA 3T0YA 3LFKA 2NRAC 1PP7U 2M30A 2VC0A 2ZFWA 4N9IA 1XN7A 3HTUA 4HQEA 4OMYA 3C18A 2O03A 2IPQX 2LDUA 1SAXA 1KU7A 1HW1A 1T38A 3LAJA 1Z1DA 2XHKA 3H3UA 5CVVA 2HKXA 3J80Z 4UXNA 3IKTA 5H6RA 1LB2A 3VOEA 1C0WA 1ZGJA 1U2WA 5HS7A 2DFIA 5ED4A 2A3SA 3V7SA 3JAMK 1SFEA 4RB2C 1LDKB 1B9NA 3FM5A 2KJBA 3ZMZA 3LSTA 1RNLA 4EVIA 5HLHA 2FEZA 1YW7A 2LF7A 5TJJA 3TDZC 1IN7A 4RB3C 2FBHA 2IT0A 2OZUA 3F72A 4XLPF 3R60A 3GFJA 4EJVA 4KN7X 4LB5A 1XSVA 1YFHA 2D2WA 2QQAA 1HXDA 5DV5A 5AONA 3ML6A 3C1DA 3FHZA 4RAZA 3SZPA 1I1GA 3IWZA 4CZZA 4HOBA 2Y75A 4U0WA 2OU2A 3MWMA 2XASA 2O3FA 1Z6TA 2JRTA 4A0YA 1VTNC 3FF5A 4CO8A 3ZP5A 2ZMEB 3LWFA 1XGOA 5L3BA 2Y0MA 1P6RA 2P7VB 3I54A 1HKTA 3CDHA 1DPUA 3KFWX 2F5CA 3ZN1A 2ZNZA 5BPIA 1ONVA 1QZYA 1WI9A 1ZRFA 3GW2A 5F6FA 2HOEA 1O3RA 2RV8A 1UB9A 3BZ6A 4A6EA 3BPXA 2O6GE 4PDKA 2VONA 3L00A 1TQMA 3W6KB 4WX9A 2MH2A 1FT9A 3IRQA 5BMZA 5HVQC 3LA2A 2Z33A 5H20A 1G3TA 3KP6A 2E7WA 4B8XA 4EM0B 4I09A 1ULYA 3NRVA 2QLZA 4EQQA 4XRFA 3ECHA 4OINF 1R23A 4KUMA 3QRFF 1FBSA 5D6FA 4BH9A 2QBYB 2ZCWA 3E6MA 2M5WA 1XGNA 2KIMA 4WXDA 1HKSA 2EJRA 1Z91A 4LD5A 2FNPA 4G6DA 4CDGA 2CG4A 1IXCA 1SD4A 2RNJA 2YPRA 2V1DA 4DQ2A 5DUIA 4ESFA 2DTRA 3HOTA 2FF4A 2P5VA 1A04A 2HEOA 2GZWA 3L09A 4CHUA 5DCMA 4XLNF 2BV6A 4LFUA 3CJNA 2STWA 3DF8A 1B9MA 1ON1A 4LK1F 1BC7C 1LJ9A 2EV5A 2GA1A 3DP7A 2IA2A 1W7PD 5IT9K 4IHSA 5A2QK 2GWRA 3EETA 4RB0A 2NNNA 4JBAA 3KP7A 1W5TA 1USSA 3K1PA 2W25A 2F5DA 2CSOA 4MGRA 3TO9A 1NHAA 1XDSA 3F8NA 5DD8A 2ZJ2A 1U5TA 2FMYA 2P6SA 2QM3A 2VN2A 2Q8KA 2FXAA 2UXNA 2HYFA 4RAYA 5CJ9A 3IL2A 1ZLJA 4RS8A 5D8KB 3DEUA 1I1SA 2BE5F 1JXSA 4NQWA 1SFXA 2XVCA 4KN4X 2VBYA 4L0ZB 4KMUX 3GZ5A 1XD7A 3HRMA 4LG0B 3ZMVA 3WTVC 1I27A 4FT8A 5CVIA 4D0PA 1MJ9A 4G9YA 1BBYA 4ETSA 4H0EA 2AXLA 2OBPA 2VODA 3IWFA 2VOPA 4ESJA 2Q0OA 3KZZA 4A2UA 2EA4A 2IA1A 2ISZA 4LLLA 2IA0A 1YQAA 4QLCU 3KCCA 5K5RA 2LF8A 2CWEA 2RC4A 4PGHA 2K86A 5K5QA 3BWGA 4HX7A 5E1WA 1ZN2A 3MEXA 3VEPA 1SMYF 4LMYA 4UV9A 3RYPA 3QU6A 4O6JA 1BM9A 3WG9A 4U88A 3P7NA 1R5GA 1J75A 5JI6A 4RB1A 3B73A 1IUYA 1TQIA 4KIBA 4AIKA 5ERIA 2M87A 1BN5A 1IW7F 4MNUA 3RKYA 1R1UA 3MFKA 2P4WA 4M72A 5J6XA 4WWCA 3EYIA 1QPMA 1TW3A 5CVRA 4GCVA 3HUGA 2G9WA 3LQRA 4HW0A 2A69F 3R61A 2KJCA 3GXOA 2EWNA 2GAUA 4KICA 4YIIA 4HBLA 2Y48A 3V8KA 4GGGA 2LSOA 1YG2A 2NYXA 4I0BA 3WE3A 5D5WB 3BJ6A 3R0JA 2HQRA 3GWZA 2FRHA 4UVCA 1K7AA 1FP2A 2PMUA 2E1NA 3ZQ7A 1FLIA 3KP5A 1WQ2A 3SHFA 2BEOA 2EV6A 5FD6A 4ZYGA 2XGXA 4U7DA 1S29A 3PQKA 1T39A 4BHPA 5TRDA 2OA4A 1WRJA 2K7LA 1W7PB 1QO0D 1BI1A 1FP1D 2K02A 5DCMB 2P8TA 2GIVA 3G73A 2E1CA 2DQLA 2HKOA 4Y13A 3FMQA 4MQ9F 1J59A 4ZYHA 1I5ZA 4A5NA 1O3TA 2GA2A 2HYGD 5LGTA 4YFXF 5DDGA 1YLFA 4HF0A 4GYIA 3E6CC 2D45A 1TNSA 4UVBA 1OYWA 1REPC 1HW5A 3RPUA 1L0OC 1CF7B 5ICCA 3J81Z 3T5XA 4LLGF 2MLKA 2XAQA 5LBQA 3WTZA 4MTEA 2M1BA 4KYWA 5LEJA 1XGMA 2ADUA 2JPBA 1D5VA 3G3ZA 1BI0A 2WC2A 3ABTA 1HSTA 1K6OA 2ELHA 4U0VA 3T1BA 4L9TA 2DPUA 4S05A 4AWXB 2AS5F 1LDJA 2KIFA 4P96A 3WU1B 2EFOA 5LLQA 4G6QA 3ERED 4EJUA 2QQ9A 4EJWA 2QWWA 2JSCA 5LHHA 2RKHA 3GVAA 1Z6RA 4BAYA 2EA2A 3I5UA 1FBQA 1W4MA 5D8LB 1R1VA 4LB6B 3WTWC 2QYOA 4I98B 1KYWA 1FSEA 1ZAOA 2Z9OA 2YR2A 1G4DA 1BI3A 1FOKA 5ILSA 2HWVA 5LHGA 3KE2A 4JK1X 1YO5C 3DKWA 3U2RA 4PCQA 3F8MA 4IVNA 2A61A 4G7HF 3F6OA 5ICEA 1FBUA 5E8IA 1W5SA 4GO1A 3V7CA 3BROA 3N97A 5LRSA 3P9KA 4FHTA 1H0MA 2EB7A 2OZ6A 3MZHA 1KU9A 3TGNA 4R79A 1HQCA 1T6SA 1OYYA 2L54A 2P5KA 1YIOA 2A07F 4S04A 4AIJA 3HYIA 2IJLA 1O3QA 5JR3A 3BOQA 2MD5A 3BP8A 3WTTC 2H6CA 4B09A 3WE2A 1XGSA 5HOOA 1QBJA 2PG4A 2W57A 2MBFA 1Y0UA 1DPRA 2VT2A 4BNCA 4RGXA 4N0BA 3LQQA 3AAFA 2COMA 3WODF 1YS7A 4ON0A 2FBIA 2CQKA 2J5OA 1YTYA 2K4BA 4NHJA 5ILVA 2DK8A 5LRRA 2M45A 3WTXC 2PBIA 2PQ8A 3JTGA 4M6XA 1KQ8A 1BIAA 3CUOA 1FY7A 1K78A 1E17A 3F3XA 4HDUA 4G7ZF 4EJTA 1CGPA 2FU4A 2ZO4A 4IPAA 1STZA 2RDPA 1SD7A 1LDDA 4IRGA 4IJAA 3MQ0A 3WGGA 4NB5A 5F1RA 4IHTA 2XV4S 5L3GA 4ZZLA 4K2EA 3EUHA 2QQBA 3O2PE 1T0FA 3ZN0A 3CUQB 5D5UB 2DT5A 1TTYA 1ZG1A 2O61A 4MQVA 3KZYA 2H09A 1MDMB 1PDNC 5IT3A 2H6BA 5FLXK 2A5YB 3I4PA 2XUBA 4LGWA 3SZTA 2CO5A 4PZJA 3QP6A 3WGHA 1RZ4A 4TV7A 5J8CA 5FGMA 4EGYA 3E5UA 4EM1A 1B1BA 1G3WA 4L18B 3U1DA 2O0YA 4OIOF 4E70A 2R7DA 4HAMA 1PP8F 1TLHB 3WTSC 3JSOA 3RPQA 3Q9VA 1UFMA 5K1YA 1USTA 1S7AA 2ZKZA 1TNTA 2V1UA 3O6BB 3I53A 1S7OA 3BPVA 3C3WA 2K4JA 5JHUA 3RI4A 1F1ZA 1QZZA 1H9GA 3RYRA 1IRGA 1P4AA 3TO6A 5FFXA 1Z05A 2LKPA 3I59A 3RTRA 2OQRA 3DPLC 2FOKA 2OD5A 1FZPB 4ENNA 4MEYF 3KLOA 3L2CA 2P5LC 4ASNA 2X0LA 5CLSA 3RKXA 2P6TA 4UUVA 2IW5A 2XRNA 4EM2A 4G8XA 3EDPA 1FX7A 4KNYA 1RIOH 2PLYA 1UHWA 4I2OA 1R00A 3GX4X 4KIGA 3J80K 1HBXG 2EK5A 1OPCA 2OAZA 3K1MA 3KETA 1JHFA 3FMRA 4AIHA 1B6AA 1ZRDA 1ZREA 3DV8A 4ENMA 4YIFA 3V7RA 3JAMZ 2D1HA 4G94A 2BBYA 3QAHA 2RN7A 3GF2A 2R7FA 2DQRA 4I7HA 4FX0A 4P9FA 3FXRA 4HX8A 3N4MA 4IRIA 2C6YA 4Q4ZF 1U3EM 4ENKA 2CW0F 1R58A 1FYLA 4Q48A 3HSRA 4ZYEA 4BHCA 1YYVA 2XIGA 3ZMUA 1ZRCA 3DXJF 1HKQA 1ZG3A 2DAOA 2VT3A 3IHUA 2DK5A 4UVAA 4EGZA 5EEGA 2WWYA 2QENA 4OOIA 5K5OA 3CO6C 2VXZA 2HDCA 5HDGA 4Q47A 3HSEA 4QWQA 5HS8A 1FWZA 5LGUA 5KVRA 3LA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8C A;  3WTU C;  4OU0 A;  1ZLK A;  3GO5 A;  2E7X A;  3CO7 C;  1EV7 A;  1E2X A;  4N9H A;  3KP4 A;  4MEX F;  5LGN A;  4BHB A;  1IXR C;  3TOA A;  5LEK A;  4BQA A;  4L9N A;  5JVT A;  3E97 A;  1DP7 P;  2WV0 A;  3MZY A;  2V1X A;  3CUQ C;  1S3J A;  2NAZ A;  2DBB A;  4I02 A;  1BC8 C;  5E8G A;  1QNT A;  4BXU A;  1JGS A;  2VE8 A;  3K69 A;  2FBK A;  3PQJ A;  1L3L A;  3RIR A;  2NS0 A;  2HR3 A;  4XSZ F;  3QU3 A;  4A6D A;  1MKM A;  3U9G A;  1OYI A;  5D6E A;  1SFU A;  3L7W A;  1F9N A;  1KYZ A;  3QP5 A;  3JTH A;  5BPD A;  4P5O A;  2Z99 A;  1FPQ A;  4XBF A;  3FMS A;  3F8F A;  3ULQ B;  3KEQ A;  4I01 A;  3GFL A;  3TDU C;  1Z7U A;  2VE9 A;  3F8B A;  4WXC A;  1G3Y A;  3F22 A;  1KA8 A;  4GYG A;  3I64 A;  1TBX A;  2MC3 A;  3IRR A;  2XAG A;  3HIF A;  1FNN A;  4M6Y A;  1TQP A;  3TKY A;  5HLI A;  2QBY A;  1P4X A;  1FC3 A;  2DO7 A;  1U5T B;  2RQP A;  2OQG A;  1J5Y A;  1JE8 A;  3I0T A;  1IN6 A;  3NQO A;  5D5V B;  5IT9 Z;  3ELK A;  4M9S A;  1XB4 A;  5A2Q Z;  3WTY C;  2HTJ A;  4XSX F;  4WF2 A;  3D0S A;  3HRS A;  3OOP A;  2STT A;  2ISY A;  2YX4 A;  2YU3 A;  1UHM A;  2FQ3 A;  4LLN A;  4L0Y B;  5BS6 A;  1Q1H A;  1MD0 A;  3ECO A;  4JQF A;  3HRT A;  1DUX C;  1UCR A;  2GXB A;  1S8N A;  2W85 A;  3GUD A;  3F21 A;  1TW2 A;  4CXF A;  1SMT A;  1QQI A;  4A0X A;  3HSF A;  4A12 A;  4KFC A;  4HZF A;  5ILU A;  3E6B A;  1WWX A;  5AIQ A;  4AD9 A;  1B4A A;  1F5T A;  1ZG5 A;  5KK1 A;  4IRH A;  4R1H A;  5L3E A;  2Z3Y A;  2JT1 A;  1YW9 A;  4EJO A;  4O3M A;  2MLG A;  2UZK A;  4ENJ A;  2ETH A;  1ZGA A;  1O3S A;  1BJA A;  1QGP A;  4FX4 A;  5FB2 A;  2QZ8 A;  3ZPL A;  5EEH A;  2XKP A;  3FXQ A;  3FM3 A;  3BJO A;  1D8K A;  3KP2 A;  5F64 A;  4HYE A;  1IAW A;  3GFI A;  4HLY A;  1O7L A;  3V8L A;  3DQV C;  1KU3 A;  2XAF A;  4LG0 A;  2BGC A;  1R1T A;  3K2Z A;  1OKR A;  1BOA A;  3R6S A;  3SXY A;  3BJA A;  2IRF G;  1GHC A;  3M8E A;  4OMZ A;  4L5J A;  1XCV A;  1R7J A;  3EQL F;  1U8R A;  2L4A A;  2HZT A;  2ZBK A;  2QVO A;  4YG2 F;  3I58 A;  3LAP A;  1EH8 A;  2PMH A;  3S2W A;  2HQN A;  5DCF A;  1V4R A;  5HDK A;  5L3C A;  2CGP A;  3HRU A;  2IP2 A;  5E18 F;  3MAJ A;  3H3Z A;  3MCZ A;  1KQ9 A;  5E17 F;  4CYD A;  4RGU A;  5BQT A;  3M1E A;  3CTA A;  1PUE E;  2D1V A;  2F5E A;  2EFN A;  5JFR A;  3P9C A;  4UNO A;  1ZH5 A;  2UXX A;  4Z2Y A;  4A5M A;  1EH7 A;  1XSD A;  3REO A;  4OIR F;  5E1X A;  1T2K A;  5L3D A;  2FML A;  1SD6 A;  4M9X A;  2L3D A;  2GQQ A;  1HSJ A;  4YFK F;  1ZAR A;  5CVJ A;  4OIP F;  2GXG A;  3ZMS A;  2RVC A;  1LNW A;  4YFN F;  1HW2 A;  2HS5 A;  4Y15 A;  1I6X A;  2PN6 A;  1RUO A;  6PAX A;  2ZNY A;  1F4K A;  1RUN A;  1JHH A;  5CYV A;  3SQN A;  3M8F A;  1IN8 A;  5FD5 A;  5BOX A;  3QPT A;  4EV0 A;  2JTV A;  4HX4 A;  1IXS B;  2A6H F;  1R36 A;  1B59 A;  1LVA A;  5ICF A;  2VOO A;  2FNA A;  1P4W A;  3R4K A;  4M73 A;  1D3Y A;  3KLN A;  2P7C B;  3JW4 A;  4MTD A;  3GYH X;  1J9I A;  3E5X A;  1Z9C A;  3Q9S A;  1YS6 A;  2EFW A;  1KGS A;  4G7O F;  3ABU A;  1U5T C;  3O3K A;  2W84 A;  2B0L A;  3FZV A;  5L3F A;  3L9F A;  3VB2 A;  4HA8 A;  2W24 A;  3J81 K;  1IRF A;  3VOD A;  5LHI A;  1P2F A;  3ZMT A;  3COA C;  2HGC A;  3P9I A;  1IZ1 A;  1W7P A;  1FYM A;  1BIB A;  2Z5U A;  5DEQ A;  1X3U A;  2XKO A;  1DDN A;  5HS9 A;  2JPC A;  2KKO A;  2VBX A;  4Q5S F;  4HQM A;  4M74 A;  2VBZ A;  5HDN A;  2QUF A;  3KP3 A;  1KU2 A;  3GFM A;  1IF1 A;  5FFZ A;  4WXH A;  1CF7 A;  2ZXJ A;  4KMF A;  2DPD A;  5E20 A;  1MJB A;  3E3V A;  3GZ6 A;  1XMA A;  4L9V A;  5DUK A;  3F23 A;  3V8J A;  5ICG A;  2FE3 A;  1MGT A;  2FA5 A;  3K0L A;  4LJZ F;  1G6N A;  1GXP A;  3SFZ A;  1P92 A;  4U7B A;  4CGZ A;  1XDU A;  1XCB A;  3FXU A;  4L9J A;  4ZYD A;  5D4R A;  3HHH A;  2HFH A;  2G7H A;  4DNC A;  2EFP A;  4BYY A;  2YSR A;  1J0R A;  2XAJ A;  2V79 A;  3RDI A;  4L5I A;  3GLX A;  2ACJ A;  2KIU A;  4R8H A;  4IF4 A;  1H9T A;  4HF1 A;  2F5F A;  1K79 A;  1WSU A;  4Y17 A;  3IC7 A;  3D5L A;  2J5P A;  4A0Z A;  3E6D A;  3HHG A;  2BYV E;  2ESN A;  1XSX A;  1KQ0 A;  1ODD A;  3WU0 A;  1FSH A;  4ZH4 F;  2NNY A;  2UWM A;  2Q2E A;  5D4S A;  4HV6 A;  1BI2 A;  2X4H A;  2PI0 A;  4M71 A;  4WK8 F;  3BY6 A;  5H6Q A;  1MJA A;  5HLG A;  3OV8 A;  2DI3 A;  2EV0 A;  1AOY A;  3WGI A;  3I71 A;  5D5X B;  4GXO A;  1LEB A;  1GVJ A;  2L02 A;  2XAH A;  4F7Z A;  3Q5F A;  4IXA A;  2A6E F;  2G7U A;  1K78 B;  3TOB A;  1J7K A;  2MA3 A;  1ZHF A;  3T8R A;  3FX3 A;  3TO7 A;  4O5V A;  3DPT A;  3NEU A;  4HLX A;  2R3S A;  3BDD A;  2L01 A;  2PEX A;  2CFX A;  1FYK A;  1J2X A;  4HV5 A;  1OMI A;  4KDP A;  5DYM A;  2F2E A;  2VC1 A;  3QPH A;  4RGS A;  1U6G A;  3ZMD A;  5DD4 A;  3ROU A;  3M9A A;  4M9Z A;  2JZY A;  4I0A A;  1G3S A;  1O7F A;  2PFB A;  3F6V A;  2VBW A;  2ZME A;  3W6J B;  2DLL A;  3T8T A;  3B02 A;  1D8J A;  3C7J A;  1XMK A;  3QOP A;  1MZB A;  1IN5 A;  2DW4 A;  4PGG A;  4ZZD A;  3RJP A;  1ON2 A;  1IN4 A;  1R22 A;  4KIF A;  3HTS B;  2WTE A;  4AVP A;  2H94 A;  2YX7 A;  1O57 A;  2CYY A;  1EH6 A;  3RKW A;  4WCG A;  4HF2 A;  5AIP A;  2LNB A;  3E5Q A;  3ISP A;  2MH9 A;  4OIQ F;  2V9V A;  2L4M A;  3EYY A;  5E1Z B;  3HOS A;  2TDX A;  4KA4 A;  3KEO A;  3FWE A;  2O8X A;  1R5H A;  2H27 A;  2FSW A;  4ESB A;  2HTS A;  5FLX Z;  4HDV A;  3M7G A;  4LK0 F;  4EMS A;  2PJP A;  4CIC A;  2RGV A;  3IKV A;  3CLO A;  3R0A A;  1WKM A;  3DFG A;  4RGR A;  4MHG A;  5J8F A;  2K27 A;  3CUQ A;  5CVU A;  4P55 A;  1ZYR F;  3J7A O;  1AWC A;  3I59 B;  2V6C A;  4UHT A;  5FO5 A;  1GXQ A;  1MDM A;  2ESH A;  3GEZ A;  2M8E A;  3V4G A;  1RI7 A;  2XRO A;  3PFI A;  1T98 A;  4P9U A;  3K9T A;  1V3F A;  2IVM A;  1YW8 A;  2KRF A;  1LEA A;  3TQN A;  1SD5 A;  1OR7 A;  1S6L A;  3VFZ A;  4UV8 A;  4KT5 C;  3K1N A;  2DU9 A;  3JSP A;  3H92 A;  2A68 F;  1LQ1 A;  3LA3 A;  4U0Y A;  1U78 A;  2EFQ A;  3T0Y A;  3LFK A;  2NRA C;  1PP7 U;  2M30 A;  2VC0 A;  2ZFW A;  4N9I A;  1XN7 A;  3HTU A;  4HQE A;  4OMY A;  3C18 A;  2O03 A;  2IPQ X;  2LDU A;  1SAX A;  1KU7 A;  1HW1 A;  1T38 A;  3LAJ A;  1Z1D A;  2XHK A;  3H3U A;  5CVV A;  2HKX A;  3J80 Z;  4UXN A;  3IKT A;  5H6R A;  1LB2 A;  3VOE A;  1C0W A;  1ZGJ A;  1U2W A;  5HS7 A;  2DFI A;  5ED4 A;  2A3S A;  3V7S A;  3JAM K;  1SFE A;  4RB2 C;  1LDK B;  1B9N A;  3FM5 A;  2KJB A;  3ZMZ A;  3LST A;  1RNL A;  4EVI A;  5HLH A;  2FEZ A;  1YW7 A;  2LF7 A;  5TJJ A;  3TDZ C;  1IN7 A;  4RB3 C;  2FBH A;  2IT0 A;  2OZU A;  3F72 A;  4XLP F;  3R60 A;  3GFJ A;  4EJV A;  4KN7 X;  4LB5 A;  1XSV A;  1YFH A;  2D2W A;  2QQA A;  1HXD A;  5DV5 A;  5AON A;  3ML6 A;  3C1D A;  3FHZ A;  4RAZ A;  3SZP A;  1I1G A;  3IWZ A;  4CZZ A;  4HOB A;  2Y75 A;  4U0W A;  2OU2 A;  3MWM A;  2XAS A;  2O3F A;  1Z6T A;  2JRT A;  4A0Y A;  1VTN C;  3FF5 A;  4CO8 A;  3ZP5 A;  2ZME B;  3LWF A;  1XGO A;  5L3B A;  2Y0M A;  1P6R A;  2P7V B;  3I54 A;  1HKT A;  3CDH A;  1DPU A;  3KFW X;  2F5C A;  3ZN1 A;  2ZNZ A;  5BPI A;  1ONV A;  1QZY A;  1WI9 A;  1ZRF A;  3GW2 A;  5F6F A;  2HOE A;  1O3R A;  2RV8 A;  1UB9 A;  3BZ6 A;  4A6E A;  3BPX A;  2O6G E;  4PDK A;  2VON A;  3L00 A;  1TQM A;  3W6K B;  4WX9 A;  2MH2 A;  1FT9 A;  3IRQ A;  5BMZ A;  5HVQ C;  3LA2 A;  2Z33 A;  5H20 A;  1G3T A;  3KP6 A;  2E7W A;  4B8X A;  4EM0 B;  4I09 A;  1ULY A;  3NRV A;  2QLZ A;  4EQQ A;  4XRF A;  3ECH A;  4OIN F;  1R23 A;  4KUM A;  3QRF F;  1FBS A;  5D6F A;  4BH9 A;  2QBY B;  2ZCW A;  3E6M A;  2M5W A;  1XGN A;  2KIM A;  4WXD A;  1HKS A;  2EJR A;  1Z91 A;  4LD5 A;  2FNP A;  4G6D A;  4CDG A;  2CG4 A;  1IXC A;  1SD4 A;  2RNJ A;  2YPR A;  2V1D A;  4DQ2 A;  5DUI A;  4ESF A;  2DTR A;  3HOT A;  2FF4 A;  2P5V A;  1A04 A;  2HEO A;  2GZW A;  3L09 A;  4CHU A;  5DCM A;  4XLN F;  2BV6 A;  4LFU A;  3CJN A;  2STW A;  3DF8 A;  1B9M A;  1ON1 A;  4LK1 F;  1BC7 C;  1LJ9 A;  2EV5 A;  2GA1 A;  3DP7 A;  2IA2 A;  1W7P D;  5IT9 K;  4IHS A;  5A2Q K;  2GWR A;  3EET A;  4RB0 A;  2NNN A;  4JBA A;  3KP7 A;  1W5T A;  1USS A;  3K1P A;  2W25 A;  2F5D A;  2CSO A;  4MGR A;  3TO9 A;  1NHA A;  1XDS A;  3F8N A;  5DD8 A;  2ZJ2 A;  1U5T A;  2FMY A;  2P6S A;  2QM3 A;  2VN2 A;  2Q8K A;  2FXA A;  2UXN A;  2HYF A;  4RAY A;  5CJ9 A;  3IL2 A;  1ZLJ A;  4RS8 A;  5D8K B;  3DEU A;  1I1S A;  2BE5 F;  1JXS A;  4NQW A;  1SFX A;  2XVC A;  4KN4 X;  2VBY A;  4L0Z B;  4KMU X;  3GZ5 A;  1XD7 A;  3HRM A;  4LG0 B;  3ZMV A;  3WTV C;  1I27 A;  4FT8 A;  5CVI A;  4D0P A;  1MJ9 A;  4G9Y A;  1BBY A;  4ETS A;  4H0E A;  2AXL A;  2OBP A;  2VOD A;  3IWF A;  2VOP A;  4ESJ A;  2Q0O A;  3KZZ A;  4A2U A;  2EA4 A;  2IA1 A;  2ISZ A;  4LLL A;  2IA0 A;  1YQA A;  4QLC U;  3KCC A;  5K5R A;  2LF8 A;  2CWE A;  2RC4 A;  4PGH A;  2K86 A;  5K5Q A;  3BWG A;  4HX7 A;  5E1W A;  1ZN2 A;  3MEX A;  3VEP A;  1SMY F;  4LMY A;  4UV9 A;  3RYP A;  3QU6 A;  4O6J A;  1BM9 A;  3WG9 A;  4U88 A;  3P7N A;  1R5G A;  1J75 A;  5JI6 A;  4RB1 A;  3B73 A;  1IUY A;  1TQI A;  4KIB A;  4AIK A;  5ERI A;  2M87 A;  1BN5 A;  1IW7 F;  4MNU A;  3RKY A;  1R1U A;  3MFK A;  2P4W A;  4M72 A;  5J6X A;  4WWC A;  3EYI A;  1QPM A;  1TW3 A;  5CVR A;  4GCV A;  3HUG A;  2G9W A;  3LQR A;  4HW0 A;  2A69 F;  3R61 A;  2KJC A;  3GXO A;  2EWN A;  2GAU A;  4KIC A;  4YII A;  4HBL A;  2Y48 A;  3V8K A;  4GGG A;  2LSO A;  1YG2 A;  2NYX A;  4I0B A;  3WE3 A;  5D5W B;  3BJ6 A;  3R0J A;  2HQR A;  3GWZ A;  2FRH A;  4UVC A;  1K7A A;  1FP2 A;  2PMU A;  2E1N A;  3ZQ7 A;  1FLI A;  3KP5 A;  1WQ2 A;  3SHF A;  2BEO A;  2EV6 A;  5FD6 A;  4ZYG A;  2XGX A;  4U7D A;  1S29 A;  3PQK A;  1T39 A;  4BHP A;  5TRD A;  2OA4 A;  1WRJ A;  2K7L A;  1W7P B;  1QO0 D;  1BI1 A;  1FP1 D;  2K02 A;  5DCM B;  2P8T A;  2GIV A;  3G73 A;  2E1C A;  2DQL A;  2HKO A;  4Y13 A;  3FMQ A;  4MQ9 F;  1J59 A;  4ZYH A;  1I5Z A;  4A5N A;  1O3T A;  2GA2 A;  2HYG D;  5LGT A;  4YFX F;  5DDG A;  1YLF A;  4HF0 A;  4GYI A;  3E6C C;  2D45 A;  1TNS A;  4UVB A;  1OYW A;  1REP C;  1HW5 A;  3RPU A;  1L0O C;  1CF7 B;  5ICC A;  3J81 Z;  3T5X A;  4LLG F;  2MLK A;  2XAQ A;  5LBQ A;  3WTZ A;  4MTE A;  2M1B A;  4KYW A;  5LEJ A;  1XGM A;  2ADU A;  2JPB A;  1D5V A;  3G3Z A;  1BI0 A;  2WC2 A;  3ABT A;  1HST A;  1K6O A;  2ELH A;  4U0V A;  3T1B A;  4L9T A;  2DPU A;  4S05 A;  4AWX B;  2AS5 F;  1LDJ A;  2KIF A;  4P96 A;  3WU1 B;  2EFO A;  5LLQ A;  4G6Q A;  3ERE D;  4EJU A;  2QQ9 A;  4EJW A;  2QWW A;  2JSC A;  5LHH A;  2RKH A;  3GVA A;  1Z6R A;  4BAY A;  2EA2 A;  3I5U A;  1FBQ A;  1W4M A;  5D8L B;  1R1V A;  4LB6 B;  3WTW C;  2QYO A;  4I98 B;  1KYW A;  1FSE A;  1ZAO A;  2Z9O A;  2YR2 A;  1G4D A;  1BI3 A;  1FOK A;  5ILS A;  2HWV A;  5LHG A;  3KE2 A;  4JK1 X;  1YO5 C;  3DKW A;  3U2R A;  4PCQ A;  3F8M A;  4IVN A;  2A61 A;  4G7H F;  3F6O A;  5ICE A;  1FBU A;  5E8I A;  1W5S A;  4GO1 A;  3V7C A;  3BRO A;  3N97 A;  5LRS A;  3P9K A;  4FHT A;  1H0M A;  2EB7 A;  2OZ6 A;  3MZH A;  1KU9 A;  3TGN A;  4R79 A;  1HQC A;  1T6S A;  1OYY A;  2L54 A;  2P5K A;  1YIO A;  2A07 F;  4S04 A;  4AIJ A;  3HYI A;  2IJL A;  1O3Q A;  5JR3 A;  3BOQ A;  2MD5 A;  3BP8 A;  3WTT C;  2H6C A;  4B09 A;  3WE2 A;  1XGS A;  5HOO A;  1QBJ A;  2PG4 A;  2W57 A;  2MBF A;  1Y0U A;  1DPR A;  2VT2 A;  4BNC A;  4RGX A;  4N0B A;  3LQQ A;  3AAF A;  2COM A;  3WOD F;  1YS7 A;  4ON0 A;  2FBI A;  2CQK A;  2J5O A;  1YTY A;  2K4B A;  4NHJ A;  5ILV A;  2DK8 A;  5LRR A;  2M45 A;  3WTX C;  2PBI A;  2PQ8 A;  3JTG A;  4M6X A;  1KQ8 A;  1BIA A;  3CUO A;  1FY7 A;  1K78 A;  1E17 A;  3F3X A;  4HDU A;  4G7Z F;  4EJT A;  1CGP A;  2FU4 A;  2ZO4 A;  4IPA A;  1STZ A;  2RDP A;  1SD7 A;  1LDD A;  4IRG A;  4IJA A;  3MQ0 A;  3WGG A;  4NB5 A;  5F1R A;  4IHT A;  2XV4 S;  5L3G A;  4ZZL A;  4K2E A;  3EUH A;  2QQB A;  3O2P E;  1T0F A;  3ZN0 A;  3CUQ B;  5D5U B;  2DT5 A;  1TTY A;  1ZG1 A;  2O61 A;  4MQV A;  3KZY A;  2H09 A;  1MDM B;  1PDN C;  5IT3 A;  2H6B A;  5FLX K;  2A5Y B;  3I4P A;  2XUB A;  4LGW A;  3SZT A;  2CO5 A;  4PZJ A;  3QP6 A;  3WGH A;  1RZ4 A;  4TV7 A;  5J8C A;  5FGM A;  4EGY A;  3E5U A;  4EM1 A;  1B1B A;  1G3W A;  4L18 B;  3U1D A;  2O0Y A;  4OIO F;  4E70 A;  2R7D A;  4HAM A;  1PP8 F;  1TLH B;  3WTS C;  3JSO A;  3RPQ A;  3Q9V A;  1UFM A;  5K1Y A;  1UST A;  1S7A A;  2ZKZ A;  1TNT A;  2V1U A;  3O6B B;  3I53 A;  1S7O A;  3BPV A;  3C3W A;  2K4J A;  5JHU A;  3RI4 A;  1F1Z A;  1QZZ A;  1H9G A;  3RYR A;  1IRG A;  1P4A A;  3TO6 A;  5FFX A;  1Z05 A;  2LKP A;  3I59 A;  3RTR A;  2OQR A;  3DPL C;  2FOK A;  2OD5 A;  1FZP B;  4ENN A;  4MEY F;  3KLO A;  3L2C A;  2P5L C;  4ASN A;  2X0L A;  5CLS A;  3RKX A;  2P6T A;  4UUV A;  2IW5 A;  2XRN A;  4EM2 A;  4G8X A;  3EDP A;  1FX7 A;  4KNY A;  1RIO H;  2PLY A;  1UHW A;  4I2O A;  1R00 A;  3GX4 X;  4KIG A;  3J80 K;  1HBX G;  2EK5 A;  1OPC A;  2OAZ A;  3K1M A;  3KET A;  1JHF A;  3FMR A;  4AIH A;  1B6A A;  1ZRD A;  1ZRE A;  3DV8 A;  4ENM A;  4YIF A;  3V7R A;  3JAM Z;  2D1H A;  4G94 A;  2BBY A;  3QAH A;  2RN7 A;  3GF2 A;  2R7F A;  2DQR A;  4I7H A;  4FX0 A;  4P9F A;  3FXR A;  4HX8 A;  3N4M A;  4IRI A;  2C6Y A;  4Q4Z F;  1U3E M;  4ENK A;  2CW0 F;  1R58 A;  1FYL A;  4Q48 A;  3HSR A;  4ZYE A;  4BHC A;  1YYV A;  2XIG A;  3ZMU A;  1ZRC A;  3DXJ F;  1HKQ A;  1ZG3 A;  2DAO A;  2VT3 A;  3IHU A;  2DK5 A;  4UVA A;  4EGZ A;  5EEG A;  2WWY A;  2QEN A;  4OOI A;  5K5O A;  3CO6 C;  2VXZ A;  2HDC A;  5HDG A;  4Q47 A;  3HSE A;  4QWQ A;  5HS8 A;  1FWZ A;  5LGU A;  5KVR A;  3LA7 A; 
#chains in the Genus database with same CATH topology
 3F8C A;  3WTU C;  4E7Z A;  4OU0 A;  1ZLK A;  2NOG A;  3GO5 A;  3OIO A;  2E7X A;  2KDO A;  3DLA A;  3CO7 C;  1EV7 A;  1E2X A;  4N9H A;  2XAU A;  3KP4 A;  4MEX F;  5LGN A;  4BHB A;  1IXR C;  3TOA A;  3PFY A;  4PJ0 C;  5LEK A;  4BQA A;  3Q3S A;  4L9N A;  5JVT A;  3ZQH A;  3GZN B;  3E97 A;  4FAS D;  1DP7 P;  2E35 A;  2WV0 A;  1I3Q J;  1X1D A;  3C2H A;  1WH7 A;  2V1X A;  3CUQ C;  3LSG A;  1UHS A;  3MZY A;  1S3J A;  3OYA A;  2K9S A;  3JRC A;  1VQO I;  3RZO J;  2NAZ A;  2DBB A;  4I02 A;  5EG0 B;  5CKT A;  2M3A A;  4PK4 A;  1BC8 C;  5E8G A;  1QNT A;  3VSK A;  4BXU A;  1UZC A;  3ABM H;  1JGS A;  2VE8 A;  4II3 A;  4ANJ A;  3CCE I;  1ENH A;  3K69 A;  3MKL A;  2FBK A;  3H9G A;  1X1A A;  3PQJ A;  3RIR A;  1L3L A;  1AA7 A;  1IRX A;  2NS0 A;  4M3G A;  2HR3 A;  4XSZ F;  3QU3 A;  4A6D A;  1YJN I;  4PJJ A;  1O4X A;  1MKM A;  3U9G A;  1OYI A;  3BR1 A;  5JLX A;  3ZGK A;  5D6E A;  2X48 A;  1VF9 A;  1P9Q C;  1SFU A;  2CW7 A;  3L7W A;  4BXF A;  1F9N A;  2OCE A;  3IH3 A;  9ANT A;  1OR7 C;  1KYZ A;  2Y69 H;  3QP5 A;  3JTH A;  5BPD A;  3DCF A;  2ICW G;  4G6T B;  1R9T J;  4RDU A;  3BG5 A;  4P5O A;  4J19 A;  2Z99 A;  1P7J A;  1FPQ A;  4XBF A;  3NAU A;  1H88 C;  3FMS A;  3F8F A;  3HPG A;  3ULQ B;  3CMM A;  3KEQ A;  4I01 A;  1A31 A;  4JOM A;  3GFL A;  3TDU C;  4BE0 A;  3Q0U A;  1Z7U A;  2VE9 A;  3MVP A;  3F8B A;  4WXC A;  1G3Y A;  3M8J A;  3F22 A;  1KA8 A;  4GYG A;  3I64 A;  5KHD A;  1TBX A;  3CLQ A;  2MC3 A;  3CF5 F;  1POG A;  3IRR A;  2XAG A;  3S16 J;  4M6V A;  2DA2 A;  3HIF A;  2EIJ H;  3PIO F;  3ZXS A;  1FNN A;  1YX5 A;  4CCN A;  3A01 B;  3QOE A;  2ID3 A;  3E1S A;  3CCL I;  3ZOB A;  2M2E A;  2DMU A;  4BS9 A;  4M6Y A;  2EQR A;  1TQP A;  5EGO B;  3TKY A;  5HLI A;  3G6E I;  2QBY A;  5IOZ A;  2M8G X;  1P4X A;  1FC3 A;  1AKH A;  2XDV A;  1Z77 A;  2DO7 A;  1U5T B;  2RQP A;  2KIS A;  2DFH A;  2OQG A;  2R5Z B;  1J5Y A;  1JE8 A;  3I0T A;  1IN6 A;  1X19 A;  1JKP C;  3NQO A;  5D5V B;  3PL8 A;  5IT9 Z;  3ELK A;  4M9S A;  1XB4 A;  5A2Q Z;  1MMA A;  4XID A;  3WTY C;  2HTJ A;  2HNH A;  4XSX F;  3GTK J;  1EKE A;  4WF2 A;  3D0S A;  2L9N A;  3HRS A;  3OOP A;  5E3O A;  2STT A;  2ISY A;  1Y0N A;  2YX4 A;  3A03 A;  3ZQF A;  3CDL A;  1TWF J;  2YU3 A;  3MZ8 A;  3HKZ N;  2KHM A;  1JKQ C;  1UHM A;  2FQ3 A;  3E0J B;  4LLN A;  3RZD J;  4L0Y B;  5BS6 A;  1Q1H A;  4NQW B;  1MD0 A;  3ECO A;  2X6W A;  4JQF A;  4E7J A;  3HRT A;  1DUX C;  1WJB A;  3OYE A;  2LLK A;  2WY8 Q;  1UCR A;  2GXB A;  1S8N A;  2NXN B;  1JTX A;  2L9V A;  3BR3 A;  2W85 A;  3GUD A;  2VPL A;  3F21 A;  3ASO H;  1TW2 A;  4CXF A;  2IBD A;  1LKX A;  1SMT A;  4XL9 A;  3I55 I;  1QQI A;  2ZXI A;  4A0X A;  3HSF A;  4A12 A;  3CMY A;  4BEH A;  1JKO C;  1BJZ A;  4KFC A;  2L7Z A;  2Y0S N;  5C4X J;  4HZF A;  4CZC A;  1X1C A;  3BTJ A;  4XKC A;  5ILU A;  1V5G A;  2VJ5 A;  2W82 A;  5F08 A;  2ZSH B;  1V5E A;  3E6B A;  4C3H J;  1ACI A;  1WWX A;  1JT6 A;  2L7M P;  5EYR A;  2R7S A;  4CYC B;  5AIQ A;  2NVX J;  2DOA A;  4AD9 A;  1B4A A;  1MH3 A;  1F5T A;  1ZG5 A;  2X85 A;  5KK1 A;  1YRN B;  1WJ5 A;  4IRH A;  2I10 A;  4R1H A;  3IAM 2;  5L3E A;  2Z3Y A;  2JT1 A;  1YW9 A;  2OUM A;  1SAN A;  3BTC A;  4EJO A;  2V26 A;  4O3M A;  2TCT A;  1ZR2 A;  2MLG A;  2UZK A;  4ENJ A;  2ETH A;  1ZGA A;  1O3S A;  1BJA A;  1QGP A;  3FBN B;  4FX4 A;  1QPI A;  3VYR B;  5FB2 A;  2QZ8 A;  3ZPL A;  3CQZ J;  5EEH A;  3ABL H;  2XKP A;  3A2K A;  2HPI A;  1UEL B;  1VZ0 A;  2L0K A;  1YIT I;  2V6E A;  2TRT A;  3FXQ A;  1GDT A;  4C30 A;  1B72 B;  1ZEL A;  3FM3 A;  3BJO A;  1N78 A;  2GM4 A;  1D8K A;  3KP2 A;  5F64 A;  4HYE A;  3S15 J;  1IAW A;  3N05 A;  3U1K A;  3GFI A;  4HLY A;  1Y39 A;  1O7L A;  3V8L A;  3DQV C;  3RSN A;  2R7U A;  4ZTJ A;  1KU3 A;  2XAF A;  4LG0 A;  2BGC A;  1R1T A;  3K2Z A;  4F93 B;  5FJ8 J;  1OKR A;  1BOA A;  2DMQ A;  3R6S A;  4XRS G;  3SXY A;  2K9M A;  2F4I A;  3S3M A;  3BJA A;  2IRF G;  3K2A A;  3FHN A;  3QWL A;  1MMS A;  5J40 A;  5J3L A;  1J09 A;  3M8E A;  1VQL I;  4A3D J;  4OMZ A;  1GHC A;  4NBQ A;  4L5J A;  1XCV A;  1SVL A;  1R7J A;  1Z67 A;  3DTE A;  2JA7 J;  3HOY J;  3EQL F;  1U8R A;  2L4A A;  2HZT A;  1Z21 A;  3OL4 A;  2M4G A;  2VAS A;  1A36 A;  2ZBK A;  2QVO A;  2QSG X;  4YG2 F;  3I58 A;  3LAP A;  4E7I A;  2F5V A;  2BHY A;  1EH8 A;  2PMH A;  3S2W A;  2HQN A;  5DCF A;  5M5X J;  1V4R A;  5HDK A;  2LH9 A;  5L3C A;  2CGP A;  3ZQL A;  3HRU A;  2IP2 A;  5E18 F;  3MAJ A;  5IP7 J;  2VXD A;  3H3Z A;  1FTZ A;  3MCZ A;  1KQ9 A;  5E17 F;  4CYD A;  4RGU A;  5BQT A;  3M1E A;  3CME I;  1VQ4 I;  3CTA A;  3EUH C;  1PUE E;  1ZGW A;  2D1V A;  2F5E A;  2EFN A;  5JFR A;  3P9C A;  1PYV A;  4UNO A;  1ZH5 A;  2UXX A;  1VQ8 I;  2BOL A;  3OYL A;  4Z2Y A;  3CC7 I;  1Y6I A;  4A5M A;  1EH7 A;  4XN3 A;  1XSD A;  4JYK A;  2ECB A;  1U0J A;  3LFU A;  4OIR F;  3REO A;  1SEU A;  5E1X A;  3M07 A;  2WB1 N;  4NUB A;  5B3S H;  5JHF A;  1T2K A;  2E1M B;  5L3D A;  2FML A;  3DPU A;  1SD6 A;  4M9X A;  2L3D A;  2GQQ A;  1HSJ A;  2H8R A;  4YFK F;  1ZAR A;  2V7F A;  5CVJ A;  4OIP F;  3I4M J;  1T8I A;  2GXG A;  3ZMS A;  2IEK A;  1W0U A;  2O5R A;  2RVC A;  1LNW A;  1T33 A;  4YFN F;  1HW2 A;  5EJC A;  4ABZ A;  3SDB A;  4DJA A;  3BG3 A;  2QEX I;  2HS5 A;  3FXJ A;  3JRI A;  2H8W A;  2W00 A;  2VJI A;  4Y15 A;  1I6X A;  2PN6 A;  1RUO A;  4M3D A;  3LSP A;  4C3I J;  6PAX A;  2ZNY A;  2GXA A;  1F4K A;  2YU9 J;  1RUN A;  1JHH A;  5CYV A;  2O9L A;  2DDB A;  5IYC J;  3SQN A;  3BT9 A;  3CJR B;  4AM3 A;  3M8F A;  5HNH A;  1YJ9 I;  1IN8 A;  5FD5 A;  2HVQ A;  1OJL A;  4Y52 J;  4GFB A;  3QOD A;  5BOX A;  3QPT A;  4EV0 A;  2JTV A;  4HX4 A;  1IXS B;  4Y33 A;  2A6H F;  1R36 A;  1B59 A;  2DMP A;  1LVA A;  5ICF A;  4EAT A;  1QVU A;  2LBF B;  3J7Y J;  1VQM I;  2FNA A;  1P4W A;  2VOO A;  2QGU A;  3GLL A;  3R4K A;  4M73 A;  2CU7 A;  2VUM J;  1D3Y A;  3KLN A;  2P7C B;  3JW4 A;  4MTD A;  3QYF A;  3GYH X;  1J9I A;  2Y9Y A;  3E5X A;  3Q9S A;  1Z9C A;  1YS6 A;  2EFW A;  1KGS A;  5EZH A;  4G7O F;  2PJR A;  3ABU A;  1U5T C;  2E60 A;  3O3K A;  2W84 A;  2LOO A;  3HB9 A;  2VI6 A;  2VJ4 A;  2B0L A;  3FZV A;  1TT0 A;  3ZQI A;  4A3B J;  5IYB J;  4LIV A;  5L3F A;  3FBI B;  4E6K G;  3B6A A;  3L9F A;  4IQJ A;  3VB2 A;  2JVH A;  4HA8 A;  4QPQ A;  1AHD P;  2W24 A;  3J81 K;  1IRF A;  3VOD A;  3OYH A;  5LHI A;  1P2F A;  3ZMT A;  2DOF A;  3OMY A;  2HGC A;  3P9I A;  1IZ1 A;  3COA C;  1W7P A;  5B1A H;  1FYM A;  2DA7 A;  3HJE A;  1BIB A;  4BAC A;  2CQN A;  1FOY A;  2Z5U A;  1ZTR A;  4CCO A;  1IC8 A;  2ME6 A;  5DEQ A;  1FOW A;  5F0F A;  4FTH A;  1X3U A;  2XKO A;  5GPC A;  4GRI A;  3DU5 A;  3TL4 X;  1DDN A;  3S1N J;  5HS9 A;  3M1C A;  2JPC A;  2K85 A;  3CCJ I;  2WAE A;  2KKO A;  2VBX A;  3CCQ I;  4Q5S F;  4HQM A;  4M74 A;  2VBZ A;  4XLH A;  5HDN A;  4Y3O A;  2EZH A;  4DYQ A;  2QUF A;  1EA3 A;  2R5Y B;  5FRO A;  3KP3 A;  1KU2 A;  1N77 A;  3GFM A;  2FX0 A;  1DP3 A;  1IF1 A;  2H1L A;  5FFZ A;  1Z3X A;  4WXH A;  1A6I A;  2LKX A;  1SVO A;  1CF7 A;  2ZXJ A;  4KMF A;  5K7H A;  2VKD A;  1W5C C;  3NWT A;  1YX3 A;  4W97 A;  2DPD A;  5KAI C;  2JRM A;  3HXL A;  4BL0 B;  5C3E J;  5E20 A;  1MJB A;  3TBI A;  4QIW N;  2IS4 A;  3E3V A;  3GZ6 A;  3O8H A;  1XMA A;  4L9V A;  5E3N A;  5DUK A;  4L5E A;  3BTL A;  5KCM A;  5TIS C;  2CV1 A;  2K3F A;  3BG9 A;  3V8J A;  5ICG A;  3F23 A;  2LRE A;  1A5J A;  2FE3 A;  1MMD A;  4OAZ A;  1MGT A;  4CSW A;  1MBF A;  4LG3 A;  2FA5 A;  3K0L A;  4LJZ F;  5GP9 A;  1G6N A;  3DEE A;  1GXP A;  1CQT A;  1YOV B;  1P92 A;  3SFZ A;  4C3J J;  5M3F J;  4U7B A;  4CGZ A;  1XDU A;  5M3M J;  4F55 A;  3OYN A;  1XCB A;  3FXU A;  4L9J A;  4ZYD A;  5D4R A;  1A6Q A;  3HHH A;  5IPA A;  5CQE A;  2HFH A;  5BNG A;  1MBJ A;  2G7H A;  2LG4 A;  4DNC A;  2CQX A;  2EFP A;  1QHG A;  4BYY A;  1NG6 A;  2YSR A;  2CFO A;  3D5S C;  1J0R A;  2XAJ A;  2V79 A;  5FLM J;  2BHZ A;  4RA2 A;  4M3B A;  3RDI A;  4L5I A;  3GLX A;  1SAU A;  4FE7 A;  5F27 A;  2ACJ A;  2KIU A;  4R8H A;  1JGG A;  3NAR A;  1P7I A;  1FJL A;  2LMD A;  2OTJ I;  2K5C A;  4IF4 A;  3BCA A;  1H9T A;  2MSY A;  4HF1 A;  1MNE A;  2OTL I;  4HRI A;  2F5F A;  1K79 A;  2KT0 A;  1WSU A;  2JJ7 A;  5FKM A;  3GTQ J;  4Y17 A;  3IC7 A;  3D5L A;  1MBH A;  2J5P A;  3H1C A;  4A0Z A;  1Z3Y A;  3E6D A;  4A3C J;  3HHG A;  2BYV E;  2R7R A;  2ESN A;  1XSX A;  3OSF A;  1QA6 A;  1X1B A;  1KQ0 A;  1ODD A;  5F1J A;  3WU0 A;  1FSH A;  1X3Z B;  4ZH4 F;  1NG7 A;  2NNY A;  2UWM A;  2Q2E A;  5D4S A;  2KPM A;  2DXI A;  2V9P A;  4HV6 A;  3IAS 2;  1BI2 A;  1FIA A;  2X4H A;  3EUK L;  2PI0 A;  4M71 A;  1OCR H;  4WK8 F;  3BY6 A;  5H6Q A;  4FIS A;  1MJA A;  5HLG A;  3OOU A;  3OV8 A;  2HOS A;  4ZC3 A;  2VPR A;  2DI3 A;  4J01 A;  2EV0 A;  4IKF A;  1AOY A;  2GIZ A;  3A0H C;  3WGI A;  2DJI A;  2VKE A;  3I71 A;  5JVG F;  3HDD A;  5D5X B;  4GXO A;  3CJQ B;  4ZYA A;  1LEB A;  1GVJ A;  2L02 A;  2M9H A;  5IP9 J;  5GAE J;  2XAH A;  4F7Z A;  3Q5F A;  2M7B A;  2B7E A;  1FEX A;  4IXA A;  3LOC A;  2A6E F;  2G7U A;  4XKB A;  2E1M C;  1K78 B;  2FOW A;  3TOB A;  4LOC A;  1J7K A;  1AU7 A;  2CMP A;  4XMY A;  2MA3 A;  2O8K A;  1JUP A;  4RM3 A;  1ZHF A;  3T8R A;  2CUF A;  1U8B A;  3I9V 2;  5FKN A;  5K7Z A;  3FX3 A;  3VWB A;  5CQG A;  3TO7 A;  4O5V A;  3ASN H;  3DPT A;  3NEU A;  1WH5 A;  4HLX A;  2R3S A;  3BDD A;  4EEF G;  2AO9 A;  2L01 A;  2N8G A;  3K70 C;  2LY2 A;  2PEX A;  2CFX A;  1FYK A;  1J2X A;  1WI3 A;  1YE9 A;  1OMI A;  4HV5 A;  4AUX A;  4KDP A;  2KZG A;  5DYM A;  2F2E A;  2VC1 A;  3QPH A;  3BTI A;  4KT6 A;  4RGS A;  1U6G A;  3E7L A;  4XKW A;  5DD4 A;  3ZMD A;  3ROU A;  4NNJ A;  5HOD A;  3M9A A;  4M9Z A;  2JZY A;  2IS1 A;  4I0A A;  1G3S A;  2OPT A;  1NK3 P;  3PSF A;  1O7F A;  2XGD A;  1MH4 A;  3ONQ A;  2E5N A;  2PFB A;  3F6V A;  2VBW A;  3LSR A;  2ZME A;  3W6J B;  4JP0 A;  5KAF C;  1Q1V A;  1G8X A;  2DLL A;  2JWT A;  1GUU A;  2BVM A;  3T8T A;  4B3X A;  3B02 A;  3Q0W A;  1NH3 A;  1D8J A;  3C7J A;  1XMK A;  3QOP A;  3OYK A;  1MZB A;  1VND A;  4BDZ A;  1FMW A;  1IN5 A;  2ECC A;  2DW4 A;  2EZK A;  4PGG A;  4UY8 I;  4ZZD A;  3RJP A;  2PJR B;  1ON2 A;  1IN4 A;  1R22 A;  4KIF A;  2ME0 A;  3HTS B;  2R7W A;  2WTE A;  1S7E A;  2H94 A;  2YX7 A;  1O57 A;  2CYY A;  4AVP A;  1EH6 A;  3RKW A;  4WCG A;  3LNQ A;  2UV1 A;  4HF2 A;  1BR1 A;  3IH4 A;  1WJF A;  5AIP A;  1BOB A;  2LNB A;  3E5Q A;  3ISP A;  5B66 C;  2LY1 A;  2MH9 A;  4OIQ F;  2V9V A;  4IQ4 A;  4CA0 A;  5LD2 C;  4DW6 A;  2L4M A;  1WZ2 A;  3EYY A;  3BG7 A;  5E1Z B;  3KYD B;  3IV5 A;  3HOS A;  2Q1Z B;  2TDX A;  3HC7 A;  4KA4 A;  3KEO A;  2K40 A;  3OY9 A;  4DIQ A;  2X6O A;  4B4C A;  3FWE A;  2O8X A;  1R5H A;  1MMN A;  2H27 A;  2DA4 A;  2JK3 A;  3IUO A;  2FSW A;  4XRM A;  2A5W A;  4ESB A;  3VYU B;  2ZXH A;  2HTS A;  3H36 A;  3RCO A;  3CD6 I;  5FLX Z;  1ETW A;  4HDV A;  3TP3 A;  2I8D A;  2GOX B;  3M7G A;  2DFE A;  3K4N A;  4LK0 F;  2W7N A;  3K70 D;  1JT0 A;  4EMS A;  3FXK A;  2JN6 A;  4XNF A;  5CPR B;  4ZDL A;  4CIC A;  2PJP A;  3PO3 J;  3K4J A;  4H4K C;  2RGV A;  3IKV A;  3CLO A;  3HG9 A;  3OYG A;  3R0A A;  1R6R A;  1WKM A;  3DFG A;  4RGR A;  2ZJR F;  3GTL J;  2JSP A;  4MHG A;  5J8F A;  2K27 A;  3CUQ A;  5CVU A;  4P55 A;  1ZYR F;  1I6H J;  1D0Z A;  3J7A O;  3RPU D;  1AWC A;  1D0X A;  4HPQ A;  3S93 A;  3KYL A;  3H5N A;  3I59 B;  2V6C A;  4UHT A;  5GAD J;  4XLC A;  5FO5 A;  3UR3 C;  1GV2 A;  2DA3 A;  1GXQ A;  3U21 A;  1MDM A;  2ESH A;  3GEZ A;  2M8E A;  1ZQ3 P;  2ELK A;  3V4G A;  1RI7 A;  3S32 A;  2XRO A;  3PFI A;  1T98 A;  4P9U A;  1RR8 C;  2DN0 A;  3K9T A;  4BU2 A;  2NVQ J;  1V3F A;  2IVM A;  1YW8 A;  2KRF A;  1LEA A;  3CCU I;  3TQN A;  3WG7 H;  5IY5 H;  4E4H A;  4JX5 A;  3CCV I;  1SD5 A;  1OR7 A;  1S6L A;  2MFZ A;  3VFZ A;  1LE8 B;  2VQH A;  4UV8 A;  4KT5 C;  3K1N A;  2E19 A;  2DU9 A;  4UUS A;  2LD5 A;  2L7K A;  1PJR A;  2EZL A;  1EF4 A;  3H3V K;  2K9Q A;  3JSP A;  2RAE A;  4IHW A;  3AFH A;  3W2V A;  3H92 A;  2X1E A;  2KL4 A;  3KZI C;  1G59 A;  4MO7 A;  1RR7 A;  2A68 F;  1JUM A;  1LQ1 A;  1UG0 A;  2CV0 A;  1VQ7 I;  3LA3 A;  5C44 J;  5GTI C;  1WVR A;  4U0Y A;  1U78 A;  2EFQ A;  3T0Y A;  3LFK A;  4MLO A;  3DKX A;  2WAQ A;  2NRA C;  2VQC A;  2JUC A;  2EIN H;  2NOJ B;  2PMZ N;  4B48 A;  1PP7 U;  2M30 A;  2E2H J;  2QF7 A;  2VC0 A;  2ZFW A;  3V42 A;  4BKX A;  4N9I A;  1XN7 A;  1IDZ A;  3HTU A;  2HVS A;  2EBI A;  4HQE A;  4OMY A;  3C18 A;  2O03 A;  2IPQ X;  1U9N A;  2LDU A;  1SAX A;  4W1U A;  3IP4 B;  1KU7 A;  1HW1 A;  4DZP A;  1GVD A;  1T38 A;  1HDD C;  3OS1 A;  2E2J J;  3ZCO A;  4C9Y A;  3LAJ A;  4FET A;  1E3O C;  2XRL A;  1Z1D A;  3TP0 A;  5B5E C;  2B63 J;  2XHK A;  3H3U A;  5CVV A;  3I56 I;  2HKX A;  3J80 Z;  4UXN A;  3IKT A;  5J47 A;  1ETQ A;  4D1Q A;  5H6R A;  1LB2 A;  4XOR A;  3VOE A;  4DGW B;  1ZGJ A;  4BDY A;  1C0W A;  3TED A;  1U2W A;  5HS7 A;  3W2A A;  2DFI A;  5ED4 A;  2A3S A;  3V7S A;  3JAM K;  1SFE A;  4GDF A;  2BY2 A;  4RB2 C;  1LDK B;  1B9N A;  3DKY A;  3FM5 A;  2XB0 X;  2KJB A;  2Y2Z A;  3G1L A;  3ZMZ A;  1OFC X;  1Z7L A;  1A35 A;  3G2B A;  3LST A;  1RNL A;  4EVI A;  3ABK H;  2JA8 J;  4YRV A;  2NVY J;  1TC3 C;  3ZQQ A;  5HLH A;  2FEZ A;  4AID A;  1YW7 A;  2LF7 A;  2QKM B;  5TJJ A;  4IO9 F;  3AL0 B;  4HEA 2;  3TDZ C;  2FJ1 A;  2V9K A;  4HNV A;  3CP8 A;  1IN7 A;  2CV2 A;  4RB3 C;  3OIQ A;  2VKV A;  5EEA A;  2FBH A;  2IT0 A;  2QKL B;  3PM1 A;  4E7K A;  2OZU A;  1RKW A;  1OCO H;  3F72 A;  2B9S A;  1RC9 A;  4J00 A;  3MMY B;  2OJE D;  4XLP F;  1I3A A;  3GBG A;  1ETV A;  3GFJ A;  3KX2 A;  3R60 A;  4KN7 X;  4D5F A;  4EJV A;  5JLW A;  1B8I B;  2HOA A;  4U87 A;  4X1E A;  4LB5 A;  1XSV A;  3BR6 A;  1Z0X A;  4PSW A;  3WHB A;  2BY3 A;  1YFH A;  5FLV A;  5GAH J;  2D2W A;  2NS8 A;  2QQA A;  5K7F A;  3S3O A;  2Y9Z A;  4JX4 A;  1HXD A;  2X51 A;  5HNF A;  1PUF A;  4BQQ A;  4RMN A;  4M3F A;  5DV5 A;  5AON A;  3ML6 A;  1E0E A;  3C1D A;  3FHZ A;  2RNG A;  4DZJ A;  4RAZ A;  3OYJ A;  2X1D A;  3SZP A;  1I1G A;  2DYR H;  3IWZ A;  4CZZ A;  4HOB A;  2Y75 A;  3K7A J;  1T0F C;  4U0W A;  3JRE A;  4BJ6 C;  2OU2 A;  3MWM A;  5IOY A;  2R7O A;  2P0W A;  3S3N A;  2KDZ A;  2XAS A;  2O3F A;  4E7S A;  1Z6T A;  2JRT A;  3CC4 I;  4A0Y A;  2LRD A;  3L2Q A;  1M1E B;  1VTN C;  3FF5 A;  4A3G J;  1OCT C;  4CO8 A;  3ZP5 A;  2JA2 A;  2ZME B;  3LWF A;  3FDY A;  5B1B H;  1XGO A;  5L3B A;  2DOD A;  2DT6 A;  3HGG A;  2Y0M A;  1QVT A;  1Y8R B;  1P6R A;  2P7V B;  3I54 A;  2VQL A;  2JUG A;  3W2W A;  2LK2 A;  3C2G A;  1HKT A;  5J1Y A;  3CDH A;  2WY7 Q;  3HOU J;  3HOX J;  2EH3 A;  3GTM J;  3O8G A;  1DPU A;  3KFW X;  2F5C A;  3ZN1 A;  2ZNZ A;  5BPI A;  1ONV A;  2FUG 2;  1QZY A;  1WI9 A;  1ZRF A;  1MBG A;  1HA8 A;  3GW2 A;  2NS7 A;  5F04 A;  2LY9 A;  5F6F A;  4A3L J;  4D9J A;  4XN0 A;  2VB6 A;  2KQR A;  2HOE A;  3LSM A;  3M3Y J;  1O3R A;  1LUJ B;  2QSH X;  2RV8 A;  4MFE A;  1UG2 A;  1UB9 A;  5FRM A;  3BZ6 A;  2X1C A;  1R5I D;  4A6E A;  3BPX A;  2O6G E;  4PDK A;  3K6G A;  4Y4R A;  2VON A;  3L00 A;  3A4C A;  1TQM A;  3UKG A;  2EIL H;  5FKK A;  3W6K B;  4WX9 A;  5DS9 A;  2MH2 A;  1FT9 A;  3IRQ A;  5BMZ A;  3HKZ A;  5HVQ C;  3HGY A;  3LA2 A;  4MIM A;  2Z33 A;  5H20 A;  1G3T A;  2R7Q A;  3KP6 A;  4FQG A;  1RPW A;  4A3M J;  2E7W A;  3A02 A;  2CUE A;  4DBR A;  2XF5 A;  4B8X A;  4EM0 B;  5F0H A;  4I09 A;  1ULY A;  3NRV A;  1IV8 A;  2LYC A;  2QLZ A;  1T08 B;  4EQQ A;  3Q0V A;  4XRF A;  2L5Q A;  5TGT A;  3ECH A;  3JRF A;  4OIN F;  1R23 A;  4KUM A;  3QRF F;  1FBS A;  5D6F A;  4BH9 A;  3CCM I;  2QBY B;  1QRY A;  1TT5 B;  5EG0 A;  1AKH B;  2ZCW A;  3E6M A;  2M5W A;  3FXL A;  1XGN A;  2KIM A;  3A0B C;  2HQA A;  4WXD A;  2LR8 A;  1TZL A;  1HKS A;  2EJR A;  1Z91 A;  4LD5 A;  2FNP A;  3KYC B;  4G6D A;  4YIR X;  4CDG A;  2CG4 A;  1IXC A;  1SD4 A;  1UMQ A;  3MKY B;  2RNJ A;  2KRC A;  1VI0 A;  2YPR A;  2L2O A;  2V1D A;  4B43 A;  3JR9 A;  4DQ2 A;  5DUI A;  5M5Y J;  4ESF A;  2LFB A;  2DTR A;  3D1N I;  3H35 A;  4A3I J;  3HOT A;  2FF4 A;  2KMU A;  3W3C A;  2P5V A;  1A04 A;  4I6Z A;  2MG4 A;  2HEO A;  2GZW A;  3L09 A;  4CHU A;  5DCM A;  1XC5 A;  4XLN F;  2BV6 A;  3DEW A;  4LFU A;  5IP6 A;  2ZB9 A;  1K83 J;  4IHV A;  3CJN A;  2STW A;  3DF8 A;  1B9M A;  1ON1 A;  1FMV A;  4LK1 F;  1BC7 C;  2W1O A;  3MKW B;  3BLY A;  3G4S I;  2E71 A;  1LJ9 A;  2EV5 A;  2GA1 A;  3DP7 A;  1BR2 A;  2IA2 A;  3BG6 A;  1W7P D;  5IT9 K;  4IHS A;  2DA1 A;  2R93 J;  5A2Q K;  2KRH A;  2YS9 A;  2GWR A;  3EET A;  4BEH B;  4RB0 A;  3DTK A;  2NNN A;  3HOW J;  3JRD A;  4JBA A;  3KP7 A;  1W5T A;  1USS A;  3K1P A;  4D7M A;  2W25 A;  3K4B A;  2F5D A;  2CSO A;  1SFK A;  3A01 A;  4ZTF A;  4MGR A;  3TO9 A;  3IH2 A;  5DTD A;  1LFU P;  1HF0 A;  3BC8 A;  1NHA A;  3JRG A;  1XDS A;  2F6C A;  5EGO A;  3F8N A;  5DD8 A;  2ZJ2 A;  2MYS A;  2QM3 A;  1U5T A;  2FMY A;  2P6S A;  2VN2 A;  2Q8K A;  5FKL A;  2ZFU A;  1QZE A;  2FXA A;  4XK4 A;  3PO2 J;  2DMT A;  2UXN A;  5E3M A;  2Z1D A;  2HYF A;  4RAY A;  2HPM A;  5CJ9 A;  2DOE A;  3IL2 A;  4A3J J;  1HLV A;  5FRN A;  4XLE A;  2M4K A;  1ZLJ A;  4RS8 A;  1T56 A;  5D8K B;  3DEU A;  3S1R J;  1I1S A;  3VYT B;  2LVS A;  4KIS A;  2BE5 F;  1JXS A;  2DT7 B;  1ZK8 A;  4NQW A;  3MN2 A;  1SFX A;  5C4J J;  3OS2 A;  1MMG A;  3C2B A;  1TL8 A;  3SFI A;  2XVC A;  3FK6 A;  4KN4 X;  2VBY A;  2W4S A;  4HNT A;  4L0Z B;  4KMU X;  3GZ5 A;  1XD7 A;  3HRM A;  1TWH J;  4C2M J;  4LG0 B;  3ZMV A;  2M0M A;  2EZI A;  3AL0 C;  3WTV C;  1I27 A;  1IRZ A;  4FT8 A;  5CVI A;  1IUF A;  3OL3 A;  4P1W A;  4D0P A;  1ETY A;  3S17 J;  1MJ9 A;  2I5U A;  4G9Y A;  1BBY A;  2VKH A;  4ETS A;  2HVR A;  4H0E A;  2AXL A;  2OBP A;  4G12 A;  2VOD A;  2CQQ A;  3LMM A;  3IWF A;  3PJR A;  2CS3 A;  4ESJ A;  2Q0O A;  2VOP A;  3KZZ A;  4A2U A;  2WB1 A;  5J4Y A;  1YIJ I;  4PJM A;  2EA4 A;  3ESW B;  4BBS J;  2IA1 A;  2WBM A;  2ISZ A;  4LLL A;  1ETK A;  4Z6Y A;  4AU7 A;  2IA0 A;  1VQ9 I;  1YQA A;  4CYC A;  4UB8 C;  5LFA A;  4QLC U;  4PUS A;  3KCC A;  3BZK A;  5K5R A;  2XGC A;  2LF8 A;  2CWE A;  2RC4 A;  1YRN A;  4PGH A;  2K86 A;  4CCJ A;  5K5Q A;  2ZJP F;  3FIW A;  5M5W J;  3BWG A;  1BL0 A;  4HX7 A;  5E1W A;  1ZN2 A;  2X6Y A;  1X3W B;  3MEX A;  3QPL A;  3VEP A;  2CQ7 A;  1SMY F;  4LMY A;  4UV9 A;  2CJJ A;  2BXZ A;  4X0G A;  2HYJ A;  3TW7 A;  3I3L A;  3RYP A;  1S72 I;  3QU6 A;  3SEQ A;  3FIS A;  4O6J A;  1BM9 A;  1UJ8 A;  3WG9 A;  4U88 A;  1W1W E;  1W0T A;  2JQ7 A;  4F91 B;  4HNU A;  3P7N A;  4UB6 C;  1R5G A;  4ITV A;  1J75 A;  5JI6 A;  2K9L A;  2E2I J;  4RB1 A;  3B73 A;  2WAQ N;  1IUY A;  3CDI A;  2P81 A;  2ZME C;  1TQI A;  4KIB A;  4AIK A;  1B72 A;  1ETO A;  3PUB A;  3KIO A;  5ERI A;  2M87 A;  3ZR8 X;  1BN5 A;  1IW7 F;  4MNU A;  3RKY A;  1R1U A;  1XG1 A;  3MFK A;  4PJL A;  3L2R A;  2P4W A;  3B6C A;  4M72 A;  5J6X A;  4WWC A;  3EYI A;  1QPM A;  2DJN A;  4N4O B;  2F4O B;  1WJA A;  2HOT A;  1TW3 A;  5CVR A;  4GCV A;  3VDX A;  3HUG A;  2ZJQ F;  2G9W A;  1MSE C;  2KFD A;  3LQR A;  4HW0 A;  2A69 F;  3HBL A;  1SC7 A;  3R61 A;  1DU6 A;  4D5C A;  2KJC A;  2AXT C;  3GXO A;  3K4K A;  3LSH A;  2UUZ A;  4MFD A;  2EWN A;  2GAU A;  5EF6 A;  4KIC A;  4YII A;  3PNY A;  4HBL A;  2OCC H;  2Y48 A;  3DBR B;  3V8K A;  4GGG A;  2LSO A;  1YG2 A;  3MD2 A;  4IL6 C;  2NYX A;  3L2V A;  4A93 J;  4QTR A;  3GTP J;  2O7O A;  1MNM C;  4JX6 A;  4I0B A;  3WE3 A;  5D5W B;  3BJ6 A;  3R0J A;  4B47 A;  2PX9 A;  2HQR A;  2HXI A;  2EPF A;  2FQ4 A;  2IAI A;  3GWZ A;  2FRH A;  4F3Q A;  2E36 A;  2IS6 A;  4E7H A;  4UVC A;  1K7A A;  1FP2 A;  3P5J A;  2PMU A;  1IDY A;  2E1N A;  3ZQ7 A;  1FLI A;  3KP5 A;  4C2U A;  4RBO A;  1WQ2 A;  4XR6 A;  3SHF A;  1YI2 I;  2BEO A;  2EV6 A;  5FD6 A;  3GTG J;  2WV1 A;  2G0E A;  1RET A;  3CF2 A;  3FK7 A;  4A69 C;  4AC0 A;  5KNL A;  5H2F C;  2HXO A;  4ZYG A;  2XGX A;  4U7D A;  1S29 A;  3PQK A;  2OF7 A;  1T39 A;  4BHP A;  3CCY A;  2EIM H;  2OA4 A;  5TRD A;  1WRJ A;  3H9J A;  2K7L A;  1W7P B;  1QO0 D;  1BI1 A;  1FP1 D;  2K02 A;  5DCM B;  3RKQ A;  2P8T A;  2GIV A;  4HG2 A;  1ERD A;  3G73 A;  3HM5 A;  2E1C A;  2DQL A;  2HKO A;  4A3E J;  2A6T A;  4QSH A;  4BE2 A;  2ZC2 A;  1D0Y A;  4Y13 A;  3FMQ A;  4MQ9 F;  2IS2 A;  2BW3 A;  4BGD A;  1J59 A;  4ZYH A;  1S9H A;  4D7N A;  4RM2 A;  1I5Z A;  4A5N A;  1WFX A;  4HST A;  4NDL A;  1O3T A;  2GA2 A;  5J1R A;  2HYG D;  2JA5 J;  5LGT A;  4YFX F;  4F52 A;  4FE4 A;  5DDG A;  1R4N B;  4B3A A;  1YLF A;  4HF0 A;  4GYI A;  3E6C C;  3S1M J;  2D45 A;  1MIJ A;  1TNS A;  1XTA A;  4OAY A;  4UVB A;  2WA0 A;  1OYW A;  2XPW A;  4A3F J;  2BZT A;  4NC6 A;  3WHC A;  3X2Q H;  1REP C;  4BY1 J;  5DM7 F;  1HW5 A;  1OCP A;  2ZXW H;  2LC2 A;  3RPU A;  1L0O C;  1CF7 B;  2HQ5 A;  5ICC A;  3J81 Z;  3T5X A;  2GOM A;  3S2D J;  1WPK A;  1Y8Q B;  1YJW I;  3BQY A;  4DYR A;  2F48 A;  2LBF A;  2COB A;  4LLG F;  4AYB A;  5DM6 F;  3LSI A;  2MLK A;  1D5Y A;  4XM3 A;  3OR1 C;  4BQN A;  1W36 C;  2XAQ A;  4V2F A;  5LBQ A;  2KZV A;  3WTZ A;  2M0C A;  4XOT A;  4MTE A;  4E7L A;  2K9N A;  3OYB A;  3K4M A;  2CW8 A;  1V54 H;  1X4P A;  2M1B A;  3CZ6 A;  1G2H A;  2F4M B;  4KYW A;  3FKJ A;  5LEJ A;  1WGX A;  1XGM A;  2ADU A;  2JPB A;  3AG1 H;  1D5V A;  2KLO A;  4DBQ A;  3G3Z A;  3VSL A;  1BI0 A;  3AG4 H;  2WC2 A;  3ABT A;  1HST A;  3WU2 C;  3I4N J;  1K6O A;  1VQP I;  1N75 A;  2ELH A;  4U0V A;  3S1Q J;  4CCL A;  2CRG A;  2OC6 A;  3T1B A;  4L9T A;  1WJC A;  2QA4 I;  1FIP A;  2DPU A;  3KEY A;  4S05 A;  1IV6 A;  3HEF A;  1D1C A;  4AWX B;  4Y7N J;  1TWC J;  2D5V A;  4OWR B;  2AS5 F;  1LDJ A;  1TP4 A;  2KIF A;  4P96 A;  3H9Q A;  2OV7 A;  3WU1 B;  2DYS H;  3SZG A;  1LVK A;  1VQN I;  2EFO A;  1X2N A;  5LLQ A;  2H1K A;  4G6Q A;  2DDA A;  2V4J C;  3QPS A;  3ERE D;  4XON A;  3J7Z I;  4EJU A;  1MBK A;  2QQ9 A;  2R5Y A;  4EJW A;  2QWW A;  2JSC A;  5LHH A;  2RKH A;  3H0G J;  3PNV A;  3GVA A;  1Z6R A;  4XOP A;  4BAY A;  2EA2 A;  4XLF A;  4XLA A;  4LIT A;  1Y56 A;  1FBQ A;  3I5U A;  1W4M A;  1WJD A;  2Y30 A;  4V19 K;  5D8L B;  1R1V A;  2QCO A;  1RKT A;  4LB6 B;  3WTW C;  3QYB A;  2QYO A;  1ITY A;  3PNT A;  4I98 B;  2LKS A;  1JJ6 C;  2Q2E B;  1W36 D;  4PJN A;  3BQZ A;  1KYW A;  2BY1 A;  3BR0 A;  2L9S A;  1FSE A;  1ZAO A;  2Z9O A;  2CUZ A;  3LL7 A;  2YR2 A;  2IXS A;  2MGQ A;  3S8P A;  2WAF A;  1G4D A;  1IG7 A;  1BI3 A;  1E3H A;  2XSJ C;  2V1N A;  1FOK A;  2LP0 A;  2HWV A;  5ILS A;  3NWS A;  5LHG A;  4A3K J;  2XB5 A;  3KE2 A;  2IGK A;  3GTJ J;  3D5R C;  4JK1 X;  4V2G A;  1YO5 C;  3DKW A;  4QPO A;  1ORK A;  1PVE A;  3U2R A;  2R0Q C;  4PCQ A;  3F8M A;  3GTO J;  4IVN A;  2A61 A;  1DGW Y;  4PFP A;  4G7H F;  4ZDO A;  2E5Z A;  4BUP A;  3OWT A;  1MSF C;  3F6O A;  5ICE A;  2IGN A;  1FBU A;  3JRB A;  5E8I A;  3MKZ A;  2Z2S B;  2RRE A;  1I39 A;  1W5S A;  4GO1 A;  3V7C A;  1OCZ H;  3F9K A;  3BRO A;  3N97 A;  3EUA A;  2R7T A;  5LRS A;  3P9K A;  4FHT A;  3RQ4 A;  2NVT J;  1K4S A;  1H0M A;  2EB7 A;  3FXO A;  2OZ6 A;  3MZH A;  1KU9 A;  3TGN A;  4N4N B;  4R79 A;  1HQC A;  4UUT A;  1F43 A;  1T6S A;  1OYY A;  2L54 A;  2P5K A;  1YIO A;  1HC8 A;  2A07 F;  3HUG B;  1VQ5 I;  2W48 A;  2HDD A;  4S04 A;  3LSJ A;  4AIJ A;  5E79 C;  3HYI A;  1U9O A;  4XRS A;  1XPX A;  2DTZ A;  2IJL A;  1O3Q A;  5JR3 A;  2HU9 A;  3BOQ A;  2MD5 A;  3BP8 A;  1F36 A;  3K4L A;  3OYC A;  4IX7 A;  3DBH B;  1OLT A;  3WTT C;  2H6C A;  4B09 A;  3WE2 A;  1KZH A;  2DMN A;  1XGS A;  2MAB A;  4I99 C;  2R92 J;  5HOO A;  4RAF A;  1QBJ A;  2CH0 A;  1IO2 A;  2R4G A;  2M7A A;  2PG4 A;  3CC2 I;  3SYT A;  2W57 A;  2MBF A;  1Y0U A;  1BW5 A;  1XMX A;  1DPR A;  2VT2 A;  4BNC A;  1R4M B;  4RGX A;  1DQU A;  1ETX A;  1X58 A;  1WCM J;  3LQQ A;  4N0B A;  5FKO A;  4XQF A;  3AAF A;  2COM A;  1NK2 P;  3WOD F;  1YS7 A;  4ON0 A;  2FBI A;  2CQK A;  1Y1W J;  2J5O A;  4DOZ A;  1YTY A;  2K4B A;  4NHJ A;  1RRJ A;  2RQQ A;  3DBL B;  5ILV A;  2DK8 A;  5LRR A;  2M45 A;  3WTX C;  3VPR A;  2PBI A;  2PQ8 A;  3OS0 A;  3JTG A;  4BBR J;  4M6X A;  1KQ8 A;  2GBY A;  4I76 A;  5F0C A;  2AQF A;  1BIA A;  3CUO A;  1OIS A;  1FY7 A;  1K78 A;  1E17 A;  3F3X A;  1EJ9 A;  1APL C;  4HDU A;  4G7Z F;  4EJT A;  4IHX A;  1GT0 C;  1CGP A;  2FU4 A;  2ZO4 A;  2M34 A;  4IPA A;  1TWA J;  3TMO A;  2JVG A;  1STZ A;  2RDP A;  1JKR C;  1SD7 A;  3GME A;  4AVZ A;  1LDD A;  4S0H B;  4M3E A;  4BJT A;  2ID6 A;  4IRG A;  4IJA A;  3MQ0 A;  3WGG A;  2DCE A;  3HOV J;  3ZQC A;  3S14 J;  4BQO A;  4NB5 A;  4RLF A;  4PFO A;  4IOC F;  1SVM A;  5F1R A;  1R71 A;  4IHT A;  3M4O J;  1X2M A;  2XV4 S;  2BW3 B;  2LTP A;  5L3G A;  1IJW C;  1XX5 A;  2R7Z J;  4ZZL A;  4K2E A;  2E34 A;  1BW6 A;  3CJT B;  3EUH A;  2QQB A;  3O2P E;  1T0F A;  4DYC A;  3ZN0 A;  1K4T A;  1LFP A;  1QHH D;  3CUQ B;  4X6A J;  4ZJZ A;  2HDW A;  1K61 A;  1V5F A;  5D5U B;  3HZJ A;  3KPH A;  2DT5 A;  1XS9 A;  1TTY A;  1ZG1 A;  2L7F P;  1KON A;  2O61 A;  3K10 A;  4MQV A;  1WHU A;  4CUG A;  2AQE A;  3DWL E;  3KZY A;  2Y0S A;  2XSD C;  2DA6 A;  2H09 A;  3H5R A;  1T95 A;  1DGR M;  4CCM A;  5IT3 A;  1MDM B;  2H6B A;  3G1O A;  1PDN C;  3BR5 A;  1BA5 A;  5FLX K;  2FD5 A;  3JCU C;  2PMZ A;  2A5Y B;  2VJJ A;  3AG3 H;  3A1Y A;  3I4P A;  2DA5 A;  2XUB A;  4LGW A;  2XPU A;  2CO5 A;  3SZT A;  3TW6 A;  4PZJ A;  3QP6 A;  1K6Y A;  2VLA A;  2VQG A;  4NC7 A;  3BCB A;  3WGH A;  3JRH A;  1RZ4 A;  4HSR A;  4TV7 A;  4UUS B;  3ZRG A;  5J8C A;  5FGM A;  3CMA I;  1D1A A;  4EGY A;  3E5U A;  4EM1 A;  1B1B A;  1UAA A;  1G3W A;  2K3P A;  4L18 B;  3U1D A;  4YEL A;  3OYM A;  1H89 C;  1GLN A;  2O0Y A;  4E70 A;  2R7D A;  4HAM A;  1PP8 F;  4OIO F;  1ZKG A;  1TLH B;  3WTS C;  3H5A A;  3RPQ A;  2BXY A;  3JSO A;  3Q9V A;  1UFM A;  5EDN A;  1DU0 A;  1I50 J;  5K1Y A;  2XC7 A;  1UST A;  1S7A A;  3SEZ A;  2R7V A;  1JI8 A;  3L2W A;  2Z16 A;  2ZKZ A;  2IGO A;  3F0C A;  1TNT A;  1TWG J;  4KIT B;  5GAG J;  2V1U A;  3O6B B;  4C2T A;  2KIQ A;  2AHQ A;  3I53 A;  1S7O A;  3BPV A;  1ZR4 A;  3C3W A;  2K4J A;  1FOX A;  4KJZ A;  2VL8 A;  1SFO J;  5JHU A;  3DTI A;  3RI4 A;  1F1Z A;  1LPQ A;  1QZZ A;  3FXM A;  5E3L A;  2BY0 A;  1H9G A;  5GPA A;  3L1P A;  3RYR A;  1V55 H;  1IRG A;  3SJM A;  1P4A A;  3AKZ A;  1IGN A;  3TO6 A;  4YEJ A;  2R5Z A;  5FFX A;  1Z05 A;  2LKP A;  3I59 A;  4IEJ A;  3RTR A;  1OCC H;  2OQR A;  3OR2 C;  4PSX A;  3DPL C;  2NVU B;  4NC8 A;  4BY7 J;  2FOK A;  2OD5 A;  1FZP B;  4ENN A;  4MEY F;  3W6V A;  3BZC A;  4XIC A;  3KLO A;  3OIP A;  2L9R A;  3L2C A;  1X4O A;  2YUS A;  4BE1 A;  3K4C A;  2DFF A;  2QQ8 A;  2ZSI B;  2P5L C;  4ASN A;  2X0L A;  2KP6 A;  5CLS A;  1JUS A;  1LE8 A;  4CH7 A;  3RKX A;  2P6T A;  5EZG A;  4UUV A;  2JMW A;  4FCY A;  2MD0 A;  2IW5 A;  2XRN A;  4EM2 A;  4G8X A;  3EDP A;  1FX7 A;  1VFC A;  4KNY A;  4RLQ A;  1FTT A;  3QQA A;  1RIO H;  2PLY A;  4CCK A;  1JTY A;  1UHW A;  3ERM A;  2GLO A;  4I2O A;  1R00 A;  3GX4 X;  1Y1V J;  4KIG A;  1RES A;  1MND A;  1WJE A;  2X6X A;  3J80 K;  3CCR I;  1HBX G;  4IHY A;  2EK5 A;  1OPC A;  2OAZ A;  3K1M A;  2HI3 A;  4AYB N;  2Y31 A;  3KET A;  1JHF A;  1S5L C;  3FMR A;  4AIH A;  1B6A A;  1ZRD A;  1ZRE A;  1HDP A;  3DV8 A;  4ENM A;  4YIF A;  3ZQG A;  5HLT A;  5IYD J;  3CES A;  4RAG A;  2EIK H;  3DU6 A;  2D1H A;  3V7R A;  3JAM Z;  3LSK A;  4G94 A;  1BR4 A;  2BBY A;  1MBE A;  2HZD A;  3FKI J;  3GCM A;  1X1P A;  1VQK I;  3SDG A;  3QAH A;  3PSI A;  3S2H J;  2RN7 A;  3GF2 A;  4BJ5 C;  2R7F A;  1PUF B;  4BXX J;  2A05 A;  1MW7 A;  1OQY A;  1GV5 A;  2DQR A;  2CUJ A;  4IZZ A;  3J7A Y;  4I7H A;  3UNG C;  4FX0 A;  4P9F A;  3FXR A;  3HL2 A;  3JRA A;  4HX8 A;  3N4M A;  4IRI A;  3HOZ J;  2C6Y A;  3PUF A;  3G1M A;  1HOM A;  2XF6 A;  4Q4Z F;  1U3E M;  2JA6 J;  4ZDP A;  3OYF A;  4ENK A;  2XPV A;  2CW0 F;  1R58 A;  3QYE A;  3OSG A;  3CP2 A;  1FYL A;  1H8A C;  4IOA F;  1QU3 A;  2BVL A;  4LIU A;  1N25 A;  4Q48 A;  1NTC A;  3HSR A;  2XGE A;  2QSF X;  2X9D A;  4BHC A;  4ZYE A;  1YYV A;  2XIG A;  3ZMU A;  1ZRC A;  1JJ8 C;  3EPZ A;  3RQI A;  4II2 A;  2WAD A;  3OYI A;  2ELJ A;  3AG2 H;  3DXJ F;  1HKQ A;  1LFB A;  1ZG3 A;  2DAO A;  2VT3 A;  3IHU A;  2DK5 A;  2E1O A;  4UVA A;  3G71 I;  3DLL F;  4EGZ A;  5EEG A;  2WWY A;  3BR2 A;  1HCR A;  5J1U A;  2MC4 A;  2QEN A;  1YHQ I;  1D1B A;  4OOI A;  5K5O A;  3CO6 C;  3VYS B;  4XKV A;  4B1R A;  2XF7 A;  2VXZ A;  5J4V A;  2R7X A;  1R49 A;  5GTH C;  2IGM A;  2HDC A;  5HDG A;  3CCS I;  3PIP F;  3L2U A;  1VQ6 I;  4Q47 A;  2MW8 A;  3HSE A;  4QWQ A;  2VIX A;  1FWZ A;  5HS8 A;  3OYD A;  1B8I A;  4B44 A;  1E3P A;  3H0D A;  3HPH A;  5LGU A;  4F92 B;  5KVR A;  3LA7 A; 
#chains in the Genus database with same CATH homology
 3F8C A;  3WTU C;  4OU0 A;  1ZLK A;  3GO5 A;  2E7X A;  3CO7 C;  1EV7 A;  1E2X A;  4N9H A;  3KP4 A;  4MEX F;  5LGN A;  4BHB A;  1IXR C;  3TOA A;  5LEK A;  4BQA A;  4L9N A;  5JVT A;  3E97 A;  1DP7 P;  2WV0 A;  3MZY A;  2V1X A;  3CUQ C;  1S3J A;  2NAZ A;  2DBB A;  4I02 A;  1BC8 C;  5E8G A;  1QNT A;  4BXU A;  1JGS A;  2VE8 A;  3K69 A;  2FBK A;  3PQJ A;  1L3L A;  3RIR A;  2NS0 A;  2HR3 A;  4XSZ F;  3QU3 A;  4A6D A;  1MKM A;  3U9G A;  1OYI A;  5D6E A;  1SFU A;  3L7W A;  1F9N A;  1KYZ A;  3QP5 A;  3JTH A;  5BPD A;  4P5O A;  2Z99 A;  1FPQ A;  4XBF A;  3FMS A;  3F8F A;  3ULQ B;  3KEQ A;  4I01 A;  3GFL A;  3TDU C;  1Z7U A;  2VE9 A;  3F8B A;  4WXC A;  1G3Y A;  3F22 A;  1KA8 A;  4GYG A;  3I64 A;  1TBX A;  2MC3 A;  3IRR A;  2XAG A;  3HIF A;  1FNN A;  4M6Y A;  1TQP A;  3TKY A;  5HLI A;  2QBY A;  1P4X A;  1FC3 A;  2DO7 A;  1U5T B;  2RQP A;  2OQG A;  1J5Y A;  1JE8 A;  3I0T A;  1IN6 A;  3NQO A;  5D5V B;  5IT9 Z;  3ELK A;  4M9S A;  1XB4 A;  5A2Q Z;  3WTY C;  2HTJ A;  4XSX F;  4WF2 A;  3D0S A;  3HRS A;  3OOP A;  2STT A;  2ISY A;  2YX4 A;  2YU3 A;  1UHM A;  2FQ3 A;  4LLN A;  4L0Y B;  5BS6 A;  1Q1H A;  1MD0 A;  3ECO A;  4JQF A;  3HRT A;  1DUX C;  1UCR A;  2GXB A;  1S8N A;  2W85 A;  3GUD A;  3F21 A;  1TW2 A;  4CXF A;  1SMT A;  1QQI A;  4A0X A;  3HSF A;  4A12 A;  4KFC A;  4HZF A;  5ILU A;  3E6B A;  1WWX A;  5AIQ A;  4AD9 A;  1B4A A;  1F5T A;  1ZG5 A;  5KK1 A;  4IRH A;  4R1H A;  5L3E A;  2Z3Y A;  2JT1 A;  1YW9 A;  4EJO A;  4O3M A;  2MLG A;  2UZK A;  4ENJ A;  2ETH A;  1ZGA A;  1O3S A;  1BJA A;  1QGP A;  4FX4 A;  5FB2 A;  2QZ8 A;  3ZPL A;  5EEH A;  2XKP A;  3FXQ A;  3FM3 A;  3BJO A;  1D8K A;  3KP2 A;  5F64 A;  4HYE A;  1IAW A;  3GFI A;  4HLY A;  1O7L A;  3V8L A;  3DQV C;  1KU3 A;  2XAF A;  4LG0 A;  2BGC A;  1R1T A;  3K2Z A;  1OKR A;  1BOA A;  3R6S A;  3SXY A;  3BJA A;  2IRF G;  1GHC A;  3M8E A;  4OMZ A;  4L5J A;  1XCV A;  1R7J A;  3EQL F;  1U8R A;  2L4A A;  2HZT A;  2ZBK A;  2QVO A;  4YG2 F;  3I58 A;  3LAP A;  1EH8 A;  2PMH A;  3S2W A;  2HQN A;  5DCF A;  1V4R A;  5HDK A;  5L3C A;  2CGP A;  3HRU A;  2IP2 A;  5E18 F;  3MAJ A;  3H3Z A;  3MCZ A;  1KQ9 A;  5E17 F;  4CYD A;  4RGU A;  5BQT A;  3M1E A;  3CTA A;  1PUE E;  2D1V A;  2F5E A;  2EFN A;  5JFR A;  3P9C A;  4UNO A;  1ZH5 A;  2UXX A;  4Z2Y A;  4A5M A;  1EH7 A;  1XSD A;  3REO A;  4OIR F;  5E1X A;  1T2K A;  5L3D A;  2FML A;  1SD6 A;  4M9X A;  2L3D A;  2GQQ A;  1HSJ A;  4YFK F;  1ZAR A;  5CVJ A;  4OIP F;  2GXG A;  3ZMS A;  2RVC A;  1LNW A;  4YFN F;  1HW2 A;  2HS5 A;  4Y15 A;  1I6X A;  2PN6 A;  1RUO A;  6PAX A;  2ZNY A;  1F4K A;  1RUN A;  1JHH A;  5CYV A;  3SQN A;  3M8F A;  1IN8 A;  5FD5 A;  5BOX A;  3QPT A;  4EV0 A;  2JTV A;  4HX4 A;  1IXS B;  2A6H F;  1R36 A;  1B59 A;  1LVA A;  5ICF A;  2VOO A;  2FNA A;  1P4W A;  3R4K A;  4M73 A;  1D3Y A;  3KLN A;  2P7C B;  3JW4 A;  4MTD A;  3GYH X;  1J9I A;  3E5X A;  1Z9C A;  3Q9S A;  1YS6 A;  2EFW A;  1KGS A;  4G7O F;  3ABU A;  1U5T C;  3O3K A;  2W84 A;  2B0L A;  3FZV A;  5L3F A;  3L9F A;  3VB2 A;  4HA8 A;  2W24 A;  3J81 K;  1IRF A;  3VOD A;  5LHI A;  1P2F A;  3ZMT A;  3COA C;  2HGC A;  3P9I A;  1IZ1 A;  1W7P A;  1FYM A;  1BIB A;  2Z5U A;  5DEQ A;  1X3U A;  2XKO A;  1DDN A;  5HS9 A;  2JPC A;  2KKO A;  2VBX A;  4Q5S F;  4HQM A;  4M74 A;  2VBZ A;  5HDN A;  2QUF A;  3KP3 A;  1KU2 A;  3GFM A;  1IF1 A;  5FFZ A;  4WXH A;  1CF7 A;  2ZXJ A;  4KMF A;  2DPD A;  5E20 A;  1MJB A;  3E3V A;  3GZ6 A;  1XMA A;  4L9V A;  5DUK A;  3F23 A;  3V8J A;  5ICG A;  2FE3 A;  1MGT A;  2FA5 A;  3K0L A;  4LJZ F;  1G6N A;  1GXP A;  3SFZ A;  1P92 A;  4U7B A;  4CGZ A;  1XDU A;  1XCB A;  3FXU A;  4L9J A;  4ZYD A;  5D4R A;  3HHH A;  2HFH A;  2G7H A;  4DNC A;  2EFP A;  4BYY A;  2YSR A;  1J0R A;  2XAJ A;  2V79 A;  3RDI A;  4L5I A;  3GLX A;  2ACJ A;  2KIU A;  4R8H A;  4IF4 A;  1H9T A;  4HF1 A;  2F5F A;  1K79 A;  1WSU A;  4Y17 A;  3IC7 A;  3D5L A;  2J5P A;  4A0Z A;  3E6D A;  3HHG A;  2BYV E;  2ESN A;  1XSX A;  1KQ0 A;  1ODD A;  3WU0 A;  1FSH A;  4ZH4 F;  2NNY A;  2UWM A;  2Q2E A;  5D4S A;  4HV6 A;  1BI2 A;  2X4H A;  2PI0 A;  4M71 A;  4WK8 F;  3BY6 A;  5H6Q A;  1MJA A;  5HLG A;  3OV8 A;  2DI3 A;  2EV0 A;  1AOY A;  3WGI A;  3I71 A;  5D5X B;  4GXO A;  1LEB A;  1GVJ A;  2L02 A;  2XAH A;  4F7Z A;  3Q5F A;  4IXA A;  2A6E F;  2G7U A;  1K78 B;  3TOB A;  1J7K A;  2MA3 A;  1ZHF A;  3T8R A;  3FX3 A;  3TO7 A;  4O5V A;  3DPT A;  3NEU A;  4HLX A;  2R3S A;  3BDD A;  2L01 A;  2PEX A;  2CFX A;  1FYK A;  1J2X A;  4HV5 A;  1OMI A;  4KDP A;  5DYM A;  2F2E A;  2VC1 A;  3QPH A;  4RGS A;  1U6G A;  3ZMD A;  5DD4 A;  3ROU A;  3M9A A;  4M9Z A;  2JZY A;  4I0A A;  1G3S A;  1O7F A;  2PFB A;  3F6V A;  2VBW A;  2ZME A;  3W6J B;  2DLL A;  3T8T A;  3B02 A;  1D8J A;  3C7J A;  1XMK A;  3QOP A;  1MZB A;  1IN5 A;  2DW4 A;  4PGG A;  4ZZD A;  3RJP A;  1ON2 A;  1IN4 A;  1R22 A;  4KIF A;  3HTS B;  2WTE A;  4AVP A;  2H94 A;  2YX7 A;  1O57 A;  2CYY A;  1EH6 A;  3RKW A;  4WCG A;  4HF2 A;  5AIP A;  2LNB A;  3E5Q A;  3ISP A;  2MH9 A;  4OIQ F;  2V9V A;  2L4M A;  3EYY A;  5E1Z B;  3HOS A;  2TDX A;  4KA4 A;  3KEO A;  3FWE A;  2O8X A;  1R5H A;  2H27 A;  2FSW A;  4ESB A;  2HTS A;  5FLX Z;  4HDV A;  3M7G A;  4LK0 F;  4EMS A;  2PJP A;  4CIC A;  2RGV A;  3IKV A;  3CLO A;  3R0A A;  1WKM A;  3DFG A;  4RGR A;  4MHG A;  5J8F A;  2K27 A;  3CUQ A;  5CVU A;  4P55 A;  1ZYR F;  3J7A O;  1AWC A;  3I59 B;  2V6C A;  4UHT A;  5FO5 A;  1GXQ A;  1MDM A;  2ESH A;  3GEZ A;  2M8E A;  3V4G A;  1RI7 A;  2XRO A;  3PFI A;  1T98 A;  4P9U A;  3K9T A;  1V3F A;  2IVM A;  1YW8 A;  2KRF A;  1LEA A;  3TQN A;  1SD5 A;  1OR7 A;  1S6L A;  3VFZ A;  4UV8 A;  4KT5 C;  3K1N A;  2DU9 A;  3JSP A;  3H92 A;  2A68 F;  1LQ1 A;  3LA3 A;  4U0Y A;  1U78 A;  2EFQ A;  3T0Y A;  3LFK A;  2NRA C;  1PP7 U;  2M30 A;  2VC0 A;  2ZFW A;  4N9I A;  1XN7 A;  3HTU A;  4HQE A;  4OMY A;  3C18 A;  2O03 A;  2IPQ X;  2LDU A;  1SAX A;  1KU7 A;  1HW1 A;  1T38 A;  3LAJ A;  1Z1D A;  2XHK A;  3H3U A;  5CVV A;  2HKX A;  3J80 Z;  4UXN A;  3IKT A;  5H6R A;  1LB2 A;  3VOE A;  1C0W A;  1ZGJ A;  1U2W A;  5HS7 A;  2DFI A;  5ED4 A;  2A3S A;  3V7S A;  3JAM K;  1SFE A;  4RB2 C;  1LDK B;  1B9N A;  3FM5 A;  2KJB A;  3ZMZ A;  3LST A;  1RNL A;  4EVI A;  5HLH A;  2FEZ A;  1YW7 A;  2LF7 A;  5TJJ A;  3TDZ C;  1IN7 A;  4RB3 C;  2FBH A;  2IT0 A;  2OZU A;  3F72 A;  4XLP F;  3R60 A;  3GFJ A;  4EJV A;  4KN7 X;  4LB5 A;  1XSV A;  1YFH A;  2D2W A;  2QQA A;  1HXD A;  5DV5 A;  5AON A;  3ML6 A;  3C1D A;  3FHZ A;  4RAZ A;  3SZP A;  1I1G A;  3IWZ A;  4CZZ A;  4HOB A;  2Y75 A;  4U0W A;  2OU2 A;  3MWM A;  2XAS A;  2O3F A;  1Z6T A;  2JRT A;  4A0Y A;  1VTN C;  3FF5 A;  4CO8 A;  3ZP5 A;  2ZME B;  3LWF A;  1XGO A;  5L3B A;  2Y0M A;  1P6R A;  2P7V B;  3I54 A;  1HKT A;  3CDH A;  1DPU A;  3KFW X;  2F5C A;  3ZN1 A;  2ZNZ A;  5BPI A;  1ONV A;  1QZY A;  1WI9 A;  1ZRF A;  3GW2 A;  5F6F A;  2HOE A;  1O3R A;  2RV8 A;  1UB9 A;  3BZ6 A;  4A6E A;  3BPX A;  2O6G E;  4PDK A;  2VON A;  3L00 A;  1TQM A;  3W6K B;  4WX9 A;  2MH2 A;  1FT9 A;  3IRQ A;  5BMZ A;  5HVQ C;  3LA2 A;  2Z33 A;  5H20 A;  1G3T A;  3KP6 A;  2E7W A;  4B8X A;  4EM0 B;  4I09 A;  1ULY A;  3NRV A;  2QLZ A;  4EQQ A;  4XRF A;  3ECH A;  4OIN F;  1R23 A;  4KUM A;  3QRF F;  1FBS A;  5D6F A;  4BH9 A;  2QBY B;  2ZCW A;  3E6M A;  2M5W A;  1XGN A;  2KIM A;  4WXD A;  1HKS A;  2EJR A;  1Z91 A;  4LD5 A;  2FNP A;  4G6D A;  4CDG A;  2CG4 A;  1IXC A;  1SD4 A;  2RNJ A;  2YPR A;  2V1D A;  4DQ2 A;  5DUI A;  4ESF A;  2DTR A;  3HOT A;  2FF4 A;  2P5V A;  1A04 A;  2HEO A;  2GZW A;  3L09 A;  4CHU A;  5DCM A;  4XLN F;  2BV6 A;  4LFU A;  3CJN A;  2STW A;  3DF8 A;  1B9M A;  1ON1 A;  4LK1 F;  1BC7 C;  1LJ9 A;  2EV5 A;  2GA1 A;  3DP7 A;  2IA2 A;  1W7P D;  5IT9 K;  4IHS A;  5A2Q K;  2GWR A;  3EET A;  4RB0 A;  2NNN A;  4JBA A;  3KP7 A;  1W5T A;  1USS A;  3K1P A;  2W25 A;  2F5D A;  2CSO A;  4MGR A;  3TO9 A;  1NHA A;  1XDS A;  3F8N A;  5DD8 A;  2ZJ2 A;  1U5T A;  2FMY A;  2P6S A;  2QM3 A;  2VN2 A;  2Q8K A;  2FXA A;  2UXN A;  2HYF A;  4RAY A;  5CJ9 A;  3IL2 A;  1ZLJ A;  4RS8 A;  5D8K B;  3DEU A;  1I1S A;  2BE5 F;  1JXS A;  4NQW A;  1SFX A;  2XVC A;  4KN4 X;  2VBY A;  4L0Z B;  4KMU X;  3GZ5 A;  1XD7 A;  3HRM A;  4LG0 B;  3ZMV A;  3WTV C;  1I27 A;  4FT8 A;  5CVI A;  4D0P A;  1MJ9 A;  4G9Y A;  1BBY A;  4ETS A;  4H0E A;  2AXL A;  2OBP A;  2VOD A;  3IWF A;  2VOP A;  4ESJ A;  2Q0O A;  3KZZ A;  4A2U A;  2EA4 A;  2IA1 A;  2ISZ A;  4LLL A;  2IA0 A;  1YQA A;  4QLC U;  3KCC A;  5K5R A;  2LF8 A;  2CWE A;  2RC4 A;  4PGH A;  2K86 A;  5K5Q A;  3BWG A;  4HX7 A;  5E1W A;  1ZN2 A;  3MEX A;  3VEP A;  1SMY F;  4LMY A;  4UV9 A;  3RYP A;  3QU6 A;  4O6J A;  1BM9 A;  3WG9 A;  4U88 A;  3P7N A;  1R5G A;  1J75 A;  5JI6 A;  4RB1 A;  3B73 A;  1IUY A;  1TQI A;  4KIB A;  4AIK A;  5ERI A;  2M87 A;  1BN5 A;  1IW7 F;  4MNU A;  3RKY A;  1R1U A;  3MFK A;  2P4W A;  4M72 A;  5J6X A;  4WWC A;  3EYI A;  1QPM A;  1TW3 A;  5CVR A;  4GCV A;  3HUG A;  2G9W A;  3LQR A;  4HW0 A;  2A69 F;  3R61 A;  2KJC A;  3GXO A;  2EWN A;  2GAU A;  4KIC A;  4YII A;  4HBL A;  2Y48 A;  3V8K A;  4GGG A;  2LSO A;  1YG2 A;  2NYX A;  4I0B A;  3WE3 A;  5D5W B;  3BJ6 A;  3R0J A;  2HQR A;  3GWZ A;  2FRH A;  4UVC A;  1K7A A;  1FP2 A;  2PMU A;  2E1N A;  3ZQ7 A;  1FLI A;  3KP5 A;  1WQ2 A;  3SHF A;  2BEO A;  2EV6 A;  5FD6 A;  4ZYG A;  2XGX A;  4U7D A;  1S29 A;  3PQK A;  1T39 A;  4BHP A;  5TRD A;  2OA4 A;  1WRJ A;  2K7L A;  1W7P B;  1QO0 D;  1BI1 A;  1FP1 D;  2K02 A;  5DCM B;  2P8T A;  2GIV A;  3G73 A;  2E1C A;  2DQL A;  2HKO A;  4Y13 A;  3FMQ A;  4MQ9 F;  1J59 A;  4ZYH A;  1I5Z A;  4A5N A;  1O3T A;  2GA2 A;  2HYG D;  5LGT A;  4YFX F;  5DDG A;  1YLF A;  4HF0 A;  4GYI A;  3E6C C;  2D45 A;  1TNS A;  4UVB A;  1OYW A;  1REP C;  1HW5 A;  3RPU A;  1L0O C;  1CF7 B;  5ICC A;  3J81 Z;  3T5X A;  4LLG F;  2MLK A;  2XAQ A;  5LBQ A;  3WTZ A;  4MTE A;  2M1B A;  4KYW A;  5LEJ A;  1XGM A;  2ADU A;  2JPB A;  1D5V A;  3G3Z A;  1BI0 A;  2WC2 A;  3ABT A;  1HST A;  1K6O A;  2ELH A;  4U0V A;  3T1B A;  4L9T A;  2DPU A;  4S05 A;  4AWX B;  2AS5 F;  1LDJ A;  2KIF A;  4P96 A;  3WU1 B;  2EFO A;  5LLQ A;  4G6Q A;  3ERE D;  4EJU A;  2QQ9 A;  4EJW A;  2QWW A;  2JSC A;  5LHH A;  2RKH A;  3GVA A;  1Z6R A;  4BAY A;  2EA2 A;  3I5U A;  1FBQ A;  1W4M A;  5D8L B;  1R1V A;  4LB6 B;  3WTW C;  2QYO A;  4I98 B;  1KYW A;  1FSE A;  1ZAO A;  2Z9O A;  2YR2 A;  1G4D A;  1BI3 A;  1FOK A;  5ILS A;  2HWV A;  5LHG A;  3KE2 A;  4JK1 X;  1YO5 C;  3DKW A;  3U2R A;  4PCQ A;  3F8M A;  4IVN A;  2A61 A;  4G7H F;  3F6O A;  5ICE A;  1FBU A;  5E8I A;  1W5S A;  4GO1 A;  3V7C A;  3BRO A;  3N97 A;  5LRS A;  3P9K A;  4FHT A;  1H0M A;  2EB7 A;  2OZ6 A;  3MZH A;  1KU9 A;  3TGN A;  4R79 A;  1HQC A;  1T6S A;  1OYY A;  2L54 A;  2P5K A;  1YIO A;  2A07 F;  4S04 A;  4AIJ A;  3HYI A;  2IJL A;  1O3Q A;  5JR3 A;  3BOQ A;  2MD5 A;  3BP8 A;  3WTT C;  2H6C A;  4B09 A;  3WE2 A;  1XGS A;  5HOO A;  1QBJ A;  2PG4 A;  2W57 A;  2MBF A;  1Y0U A;  1DPR A;  2VT2 A;  4BNC A;  4RGX A;  4N0B A;  3LQQ A;  3AAF A;  2COM A;  3WOD F;  1YS7 A;  4ON0 A;  2FBI A;  2CQK A;  2J5O A;  1YTY A;  2K4B A;  4NHJ A;  5ILV A;  2DK8 A;  5LRR A;  2M45 A;  3WTX C;  2PBI A;  2PQ8 A;  3JTG A;  4M6X A;  1KQ8 A;  1BIA A;  3CUO A;  1FY7 A;  1K78 A;  1E17 A;  3F3X A;  4HDU A;  4G7Z F;  4EJT A;  1CGP A;  2FU4 A;  2ZO4 A;  4IPA A;  1STZ A;  2RDP A;  1SD7 A;  1LDD A;  4IRG A;  4IJA A;  3MQ0 A;  3WGG A;  4NB5 A;  5F1R A;  4IHT A;  2XV4 S;  5L3G A;  4ZZL A;  4K2E A;  3EUH A;  2QQB A;  3O2P E;  1T0F A;  3ZN0 A;  3CUQ B;  5D5U B;  2DT5 A;  1TTY A;  1ZG1 A;  2O61 A;  4MQV A;  3KZY A;  2H09 A;  1MDM B;  1PDN C;  5IT3 A;  2H6B A;  5FLX K;  2A5Y B;  3I4P A;  2XUB A;  4LGW A;  3SZT A;  2CO5 A;  4PZJ A;  3QP6 A;  3WGH A;  1RZ4 A;  4TV7 A;  5J8C A;  5FGM A;  4EGY A;  3E5U A;  4EM1 A;  1B1B A;  1G3W A;  4L18 B;  3U1D A;  2O0Y A;  4OIO F;  4E70 A;  2R7D A;  4HAM A;  1PP8 F;  1TLH B;  3WTS C;  3JSO A;  3RPQ A;  3Q9V A;  1UFM A;  5K1Y A;  1UST A;  1S7A A;  2ZKZ A;  1TNT A;  2V1U A;  3O6B B;  3I53 A;  1S7O A;  3BPV A;  3C3W A;  2K4J A;  5JHU A;  3RI4 A;  1F1Z A;  1QZZ A;  1H9G A;  3RYR A;  1IRG A;  1P4A A;  3TO6 A;  5FFX A;  1Z05 A;  2LKP A;  3I59 A;  3RTR A;  2OQR A;  3DPL C;  2FOK A;  2OD5 A;  1FZP B;  4ENN A;  4MEY F;  3KLO A;  3L2C A;  2P5L C;  4ASN A;  2X0L A;  5CLS A;  3RKX A;  2P6T A;  4UUV A;  2IW5 A;  2XRN A;  4EM2 A;  4G8X A;  3EDP A;  1FX7 A;  4KNY A;  1RIO H;  2PLY A;  1UHW A;  4I2O A;  1R00 A;  3GX4 X;  4KIG A;  3J80 K;  1HBX G;  2EK5 A;  1OPC A;  2OAZ A;  3K1M A;  3KET A;  1JHF A;  3FMR A;  4AIH A;  1B6A A;  1ZRD A;  1ZRE A;  3DV8 A;  4ENM A;  4YIF A;  3V7R A;  3JAM Z;  2D1H A;  4G94 A;  2BBY A;  3QAH A;  2RN7 A;  3GF2 A;  2R7F A;  2DQR A;  4I7H A;  4FX0 A;  4P9F A;  3FXR A;  4HX8 A;  3N4M A;  4IRI A;  2C6Y A;  4Q4Z F;  1U3E M;  4ENK A;  2CW0 F;  1R58 A;  1FYL A;  4Q48 A;  3HSR A;  4ZYE A;  4BHC A;  1YYV A;  2XIG A;  3ZMU A;  1ZRC A;  3DXJ F;  1HKQ A;  1ZG3 A;  2DAO A;  2VT3 A;  3IHU A;  2DK5 A;  4UVA A;  4EGZ A;  5EEG A;  2WWY A;  2QEN A;  4OOI A;  5K5O A;  3CO6 C;  2VXZ A;  2HDC A;  5HDG A;  4Q47 A;  3HSE A;  4QWQ A;  5HS8 A;  1FWZ A;  5LGU A;  5KVR A;  3LA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...