4M6XA

Mutant structure of methyltransferase from streptomyces hygroscopicus complexed with s-adenosyl-l-homocysteine and methylphenylpyruvic acid
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
339
structure length
339
Chain Sequence
SHMSTEVSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHEFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
molecule keywords Methyltransferase MppJ
total genus 123
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4m6xA01
3GZ5A 3F8NA 1OYIA 4L0ZB 3TO7A 2GA1A 3KP4A 1MJBA 1BN5A 4U0VA 5FLXZ 2FSWA 4ENKA 4WCGA 4EQQA 1CGPA 3TKYA 3MCZA 5KK1A 3RPUA 2H27A 4ESJA 5ICFA 5IT9Z 2HYGD 4KMUX 2NNNA 3SZTA 4L18B 5K5QA 4UVAA 2X4HA 3KP6A 3PQJA 3BPXA 4IPAA 4A6DA 5FLXK 2OQGA 4LG0B 1FC3A 3RYRA 1IAWA 1SFEA 4MNUA 1AWCA 4KNYA 1Z91A 3L09A 3V8LA 4KYWA 4M6XA 5E8GA 2XIGA 4YFXF 3ZMSA 4E70A 2F5EA 3BZ6A 1CF7A 4I2OA 1F1ZA 5LGNA 1R7JA 2STWA 3R0JA 4Q4ZF 1JHFA 2L3DA 5DV5A 2V1XA 2B0LA 5E1ZB 2C6YA 1K78A 2ISYA 5ICGA 1K78B 2MC3A 3E6CC 2RC4A 4ON0A 1USTA 2KIUA 4K2EA 2IT0A 1Q1HA 1XGMA 5CLSA 2L4MA 1SAXA 5HDNA 4CGZA 1FBSA 2M5WA 1BIBA 1K79A 3F21A 3F8FA 1GHCA 3I53A 2NS0A 2J5OA 4AIJA 1OKRA 3RKWA 1ZARA 3I5UA 3VOEA 3H92A 1HSJA 2VE9A 3HRMA 4CHUA 3CUQB 1ZN2A 3CUQC 2FBIA 2HS5A 2DPDA 5CVVA 1IW7F 2PMUA 1IN7A 4L5IA 2VE8A 4A5NA 4O3MA 4AWXB 2L54A 5D4RA 5DUKA 3RTRA 3GUDA 1EH8A 1SFXA 1GVJA 3WU1B 2CG4A 1I5ZA 3CO7C 1R5GA 4ESBA 5IT3A 3SFZA 4ENNA 1W5TA 3ZQ7A 4AIKA 4UXNA 5AIPA 2LNBA 5JR3A 2VBZA 3GFLA 1FP1D 4U7BA 4AVPA 5D5VB 4PCQA 2QM3A 3TOBA 3T8TA 3F8BA 3M8FA 1KYZA 3MWMA 2D1HA 5L3GA 3D0SA 3R4KA 1XCVA 2KIMA 3GWZA 2ELHA 2Y75A 2F5DA 3ZP5A 3HRSA 3R60A 4FX4A 1P2FA 1ON1A 1YW9A 4F7ZA 3ISPA 1YTYA 5DCFA 3WTTC 3QP5A 4OIPF 2CGPA 3K1MA 4GYGA 3B02A 3EDPA 2EFNA 4KDPA 1IRGA 1FLIA 2A68F 1Z05A 4NB5A 3KP7A 3V7RA 3KETA 4G6QA 1SD4A 2P6TA 3F6OA 1W7PA 3LA3A 2MA3A 2HTSA 1UHWA 4B8XA 3O6BB 3M9AA 3I64A 1TQMA 5JI6A 1XGNA 3MQ0A 1ZLJA 1XCBA 1MJAA 4YFNF 5H6QA 1U5TC 2RQPA 2X0LA 1LDKB 3WE3A 3FF5A 2LDUA 2UXXA 3JW4A 3MEXA 5FFZA 2P5LC 3EUHA 5F6FA 4CICA 4MTDA 3E5UA 1JXSA 2QQAA 2RDPA 4HDVA 4HF2A 1FPQA 1O3QA 1JHHA 3RYPA 2YR2A 5J6XA 4G7HF 2VODA 1XN7A 2DPUA 1D8JA 4HF1A 3B73A 5CVUA 3HHGA 2HOEA 2RKHA 3DPLC 2FRHA 2DFIA 4EJWA 1T98A 1KQ0A 1CF7B 3KP2A 3JSOA 1HW1A 1R1TA 2W57A 1KQ8A 5HDGA 1SD6A 1J9IA 1S29A 3MZYA 1HSTA 1IF1A 4P55A 3ABUA 4UV9A 1TQIA 1BI0A 2EJRA 3TGNA 4OMYA 1BI1A 5CVJA 4EGYA 4PZJA 2ZCWA 4G9YA 3IRRA 4CZZA 2LF7A 3RKYA 4UNOA 1R1VA 1FBQA 3T5XA 3C18A 4HLYA 1GXQA 2XAFA 1I6XA 2O3FA 3R6SA 1IN5A 5CJ9A 4EM1A 2VOOA 1JGSA 1BJAA 2CQKA 1F9NA 3GO5A 4JK1X 4U7DA 1XB4A 1XGSA 2M45A 1YG2A 1QBJA 1IRFA 2EV0A 3DPTA 1IN8A 3CUQA 4XBFA 3GZ6A 2A07F 4R8HA 2PQ8A 2HQRA 1T38A 3JAMZ 3GW2A 2NRAC 1LVAA 3QOPA 4O6JA 2DQLA 4HF0A 4LG0A 1HKQA 2WV0A 5FO5A 3ZN0A 2L02A 3VB2A 1ZYRF 4ZYDA 4I0AA 3K0LA 3HTUA 1ZAOA 1MGTA 2FEZA 1WSUA 5HS8A 5FB2A 2XKPA 1J59A 1OMIA 1VTNC 1EH6A 3HSFA 4XSXF 2YX4A 1W7PD 3Q9VA 2E7XA 4BHCA 1H9TA 1FSHA 1EV7A 2P4WA 5D6EA 3K9TA 3I58A 4IVNA 4I01A 4AD9A 4B09A 5HLHA 2RGVA 2FU4A 2OAZA 3ECOA 4A5MA 1KGSA 3LWFA 5L3CA 2M8EA 3QAHA 4L9JA 2IJLA 4PDKA 2DTRA 3WE2A 3WTSC 2HFHA 3SZPA 3G73A 3ZMDA 1XSXA 1TLHB 1XDSA 2HZTA 4UVCA 2XVCA 4EGZA 3V8JA 1BI2A 2H6CA 1MD0A 3WGIA 4RB0A 1KU2A 1BIAA 2GAUA 4YFKF 5E1WA 5DYMA 4U88A 2ETHA 1SD7A 3L9FA 3VEPA 2V79A 4M9XA 2STTA 4RB2C 1WRJA 4MEXF 2K4BA 2O0YA 3GXOA 3H3UA 1QPMA 1IZ1A 5A2QK 3R0AA 1ZGAA 5FFXA 5CYVA 4KFCA 3GFIA 4WXDA 2QZ8A 3KEOA 1UFMA 2QUFA 5LGTA 3U9GA 1ZRFA 5LRSA 2O6GE 5J8FA 4LK0F 2DK8A 2OZ6A 1YFHA 2EFWA 3MAJA 2CFXA 2DW4A 1MKMA 2ZO4A 1TNTA 1ULYA 5ICEA 2ZXJA 3WU0A 1O7FA 4I7HA 3IL2A 3RJPA 3CLOA 3IC7A 1ZG1A 2KIFA 3KP5A 1R5HA 1ZLKA 1ZH5A 2HEOA 3C1DA 1YO5C 2K7LA 1WKMA 1NHAA 2O03A 4PGGA 5HS7A 1S8NA 2DT5A 3HHHA 3TQNA 1J7KA 2D2WA 4RAYA 3WGHA 1U78A 5DD4A 1RUNA 1U2WA 4HA8A 1ON2A 2MD5A 3V4GA 3GFMA 2ESNA 2WC2A 4LB6B 4KN4X 3L2CA 1WI9A 2KJCA 4I98B 3V7CA 3LAPA 4QWQA 5JFRA 3JSPA 1S7OA 3HRUA 3KEQA 1QZYA 3K1PA 1HW2A 3W6KB 1G3YA 2XGXA 4XSZF 2P5KA 3N4MA 2V1UA 1O3RA 1U8RA 1DUXC 4RB1A 2EV6A 1UB9A 2CWEA 1TNSA 3DFGA 1BI3A 3RDIA 2YSRA 1BC8C 4OIQF 3ABTA 3ZMVA 3FWEA 1H0MA 1ONVA 1P4AA 2EK5A 1KYWA 4IF4A 1IN6A 3BROA 2XV4S 3JTHA 2P8TA 4JQFA 3DQVC 1T6SA 3KLOA 1D8KA 2BYVE 2E7WA 2A69F 5E20A 2Y48A 2ESHA 3QU6A 3ZMZA 1V4RA 3GEZA 3TDUC 3FMRA 4HYEA 5FGMA 3S2WA 2MLKA 2FF4A 5LRRA 3BOQA 3JTGA 3F8MA 5AIQA 1TBXA 2A5YB 2L01A 2FA5A 3KP3A 3VODA 2PI0A 5F1RA 1IUYA 5EEGA 2V6CA 3LA7A 3WTZA 4HX4A 1P4WA 3DEUA 4XRFA 5ED4A 2VONA 1SMYF 3ECHA 1WWXA 2MBFA 2HKXA 4RS8A 1Y0UA 3SXYA 2Z3YA 4G7ZF 1JE8A 4WK8F 1MJ9A 3P9CA 2KKOA 4I02A 2Z5UA 5FD5A 1DPUA 4WXCA 1C0WA 4HDUA 2JSCA 2RV8A 3FXQA 3ML6A 5H20A 2IP2A 3C7JA 2LSOA 4L5JA 3ULQB 1I1SA 5DD8A 5J8CA 4IXAA 2Z99A 1B6AA 3NRVA 4DQ2A 2MLGA 2GIVA 2OQRA 2Q0OA 1HBXG 2EFOA 3FHZA 1RIOH 3KFWX 1MZBA 3COAC 4LMYA 5D5XB 3I59A 4P9UA 3BY6A 4BXUA 1L3LA 4U0WA 1P92A 1F5TA 3LFKA 3ROUA 2K02A 4HAMA 4OMZA 1UHMA 5D6FA 4UUVA 1UCRA 2YPRA 1HW5A 3OOPA 1TW2A 2BEOA 4HBLA 2AS5F 3Q9SA 1T39A 3WTUC 4EJVA 5LHHA 2O8XA 5TJJA 4LB5A 4A0YA 1WQ2A 1H9GA 1QGPA 1ZG5A 1X3UA 2HGCA 2OA4A 3E6DA 1HQCA 1ZG3A 2W25A 1G3SA 2EV5A 2ZNYA 2XASA 3HOTA 1V3FA 3K2ZA 2CYYA 2XHKA 4WWCA 3PQKA 2K86A 5K5RA 4ASNA 1G3TA 1J2XA 1RI7A 3LAJA 5JVTA 2MH2A 4GGGA 4ZZDA 1W7PB 2BV6A 2OD5A 2V1DA 4H0EA 2G7UA 2JPBA 3ELKA 3WODF 3NQOA 2A61A 1YS7A 4NQWA 3TOAA 2QBYB 3BDDA 2IA0A 1P6RA 3MZHA 1XDUA 5HVQC 5ICCA 5JHUA 5K1YA 1LDDA 3HTSB 2XAJA 4M6YA 1RNLA 2JT1A 3ZMUA 4WF2A 1IXCA 4KIGA 3JAMK 2QLZA 2YX7A 3GYHX 2QWWA 3RPQA 1FY7A 4GXOA 1HKSA 4RGUA 1FBUA 1SMTA 4L9VA 1O3SA 3CTAA 4ESFA 3KZZA 4HV5A 2WWYA 5L3DA 4P9FA 4ZZLA 4UVBA 4XLPF 1K6OA 3E5XA 2FQ3A 2GWRA 2NYXA 1D3YA 4UV8A 5L3BA 3P9IA 5KVRA 2HWVA 4IRHA 2H6BA 2XRNA 3O2PE 4A0ZA 4ENMA 1ZHFA 3K1NA 1FT9A 2IA1A 5IT9K 1U5TA 1T2KA 3EYIA 4LLGF 2Z9OA 4I09A 4RGRA 3V8KA 2AXLA 2OZUA 1ZREA 4G94A 2OU2A 2A3SA 3O3KA 4KICA 2GXBA 4EJTA 1LQ1A 1XSVA 5DEQA 4BH9A 4UHTA 1QNTA 1FZPB 4EM0B 4YG2F 4LLLA 3RIRA 1YYVA 2ZFWA 1PUEE 1PDNC 2DBBA 2VBYA 2M87A 4KIFA 2PJPA 3MFKA 4P96A 4LGWA 2ISZA 4AIHA 3V7SA 5BPDA 4N9IA 2R3SA 3OV8A 3I71A 4CYDA 3D5LA 1F4KA 1ZRDA 3IKVA 2ZNZA 2MH9A 4IRGA 2O61A 5DDGA 1IXSB 3ERED 4I0BA 2EA4A 2UXNA 3I4PA 4N9HA 4HX8A 3RI4A 3H3ZA 4A2UA 3CJNA 2P5VA 5HLIA 1I27A 3RKXA 4LJZF 1R23A 3E97A 3IWZA 3I59B 1HKTA 3QP6A 1G3WA 3R61A 3EQLF 3FM3A 2M1BA 4LLNA 5F64A 4KIBA 2L4AA 3CUOA 4D0PA 3J80Z 1YS6A 1E2XA 3QPHA 1R22A 4Q48A 3DF8A 2BBYA 4EM2A 3IHUA 4YIFA 1ODDA 2D1VA 4GCVA 2CW0F 4HQMA 4HQEA 2ZKZA 5LBQA 1G4DA 4OIRF 3F22A 3GX4X 2JPCA 2ADUA 3J80K 2E1NA 1S7AA 2K4JA 2HYFA 3F23A 5HLGA 2FMYA 3SQNA 5D5UB 1FSEA 1Z7UA 5ILVA 2VN2A 2CSOA 5LHIA 1B59A 1S3JA 2K27A 1STZA 2DI3A 2FNPA 2HR3A 1HXDA 3T0YA 2NAZA 2DU9A 5H6RA 4WX9A 2DO7A 5L3EA 5HDKA 1LDJA 1PP7U 5E17F 4ETSA 2F5FA 1S6LA 4OINF 2IRFG 1B4AA 2W24A 1DPRA 1FNNA 3KZYA 2XAHA 2FOKA 1YIOA 3DV8A 5LEKA 1J0RA 3C3WA 4M73A 1R36A 3WG9A 3E6MA 5BOXA 2ZJ2A 5BS6A 2NNYA 4MQVA 1B9MA 4ZYGA 2RVCA 1AOYA 2RNJA 1ZGJA 5LGUA 5EEHA 2G9WA 3KCCA 3LQQA 4KUMA 2ZMEA 5D8LB 2Y0MA 5FD6A 2HTJA 3GF2A 1XMKA 1L0OC 3BJ6A 2GZWA 4ZYHA 4EVIA 2PLYA 4GO1A 1U6GA 3F8CA 5ERIA 4Y13A 5E18F 1FYLA 1KU9A 2R7FA 2QENA 2DQRA 3HYIA 1YQAA 4MHGA 1BC7C 3J81Z 4IHSA 2IA2A 1Z6RA 2PG4A 5ILSA 2P7VB 4GYIA 4Z2YA 3FXUA 1FX7A 3HSRA 3I0TA 3GFJA 2PMHA 2UZKA 4PGHA 1QQIA 4L0YB 3FM5A 4G7OF 1SFUA 1OYYA 2GA2A 1O3TA 4O5VA 3Q5FA 2YU3A 5LLQA 1Z9CA 2EFQA 2W85A 1KU3A 4Q5SF 2J5PA 3FMQA 1XMAA 2A6EF 3BP8A 3TO9A 2IW5A 4DNCA 4KMFA 2XAQA 1FOKA 2QBYA 4BHPA 1TQPA 1B9NA 4U0YA 4IHTA 1OPCA 3GLXA 2HDCA 1W4MA 4MTEA 4JBAA 4Y17A 2VT2A 3P7NA 5ILUA 2VBXA 3WTWC 4RGXA 3HUGA 2FBHA 2BE5F 4WXHA 2VC0A 4HW0A 3PFIA 4OOIA 3LQRA 4KN7X 1D5VA 2BGCA 4LK1F 3I54A 4Y15A 2F5CA 3ZMTA 4HV6A 3E5QA 3VFZA 2TDXA 1R58A 5E8IA 3CDHA 4BNCA 1R1UA 2VT3A 2P6SA 5D8KB 2FE3A 1J5YA 4M72A 2QVOA 2CO5A 3LA2A 2DK5A 2PBIA 4CDGA 3M1EA 3F72A 4OIOF 2VBWA 3M7GA 2KJBA 2ZBKA 3BJAA 2H09A 4ZH4F 1RZ4A 4EJOA 4RB3C 5HOOA 2D45A 2RN7A 1A04A 4IJAA 4BAYA 4M74A 4CO8A 3QU3A 5DCMA 4RGSA 1MDMB 4M71A 5CVIA 4BQAA 4LD5A 1LB2A 5DCMB 2XUBA 5CVRA 1MDMA 1LJ9A 4A12A 4EV0A 4CXFA 1YLFA 3N97A 2PN6A 4BYYA 5LHGA 3WTYC 5K5OA 2H94A 4EJUA 1TW3A 1YW7A 2DLLA 3BWGA 2LKPA 1QZZA 4XLNF 1RUOA 2FXAA 1IN4A 2G7HA 2VOPA 3REOA 5D5WB 2LF8A 2JTVA 4A0XA 2Z33A 4EMSA 1XSDA 6PAXA 1KA8A 1XGOA 2WTEA 2F2EA 5A2QZ 1TTYA 2E1CA 4FHTA 1BM9A 1LNWA 3FMSA 4YIIA 4Q47A 1E17A 3EETA 1PP8F 4OU0A 1SD5A 4S05A 1U3EM 3J81K 1BOAA 3NEUA 2EA2A 2IPQX 2EFPA 3HRTA 1YW8A 3E6BA 2GXGA 2JZYA 2QQ9A 4R1HA 2W84A 4P5OA 3WGGA 3U1DA 1FP2A 5L3FA 5HS9A 4S04A 2VC1A 2HQNA 1J75A 3FZVA 2OBPA 3FXRA 4FT8A 3HOSA 4MQ9F 3G3ZA 2A6HF 2XAGA 4ENJA 1P4XA 5BQTA 2Q8KA 4G6DA 2XROA 3SHFA 2DAOA 4LFUA 1GXPA 3E3VA 2M30A 2ACJA 3CO6C 3QPTA 2FBKA 2PFBA 3LSTA 3T1BA 3T8RA 4M9ZA 1BBYA 2ZMEB 4KA4A 4RAZA 2VXZA 1FYMA 3IWFA 3U2RA 3IKTA 3IRQA 2EB7A 4ZYEA 1R00A 1T0FA 2IVMA 4M9SA 2COMA 3TDZC 1USSA 2QQBA 1EH7A 2EWNA 4HZFA 1LEBA 3QRFF 4MEYF 2FNAA 4L9TA 3BPVA 1FWZA 4L9NA 3M8EA 3DKWA 4HX7A 2JRTA 5E1XA 5AONA 1O7LA 3ZN1A 1XD7A 1DDNA 3HSEA 1Z1DA 3L00A 4R79A 2P7CB 1W5SA 1REPC 4BHBA 3DP7A 3TO6A 1U5TB 3WTVC 2QYOA 1O57A 1IXRC 3P9KA 3J7AO 3EYYA 4IRIA 3WTXC 4A6EA 3W6JB 5LEJA 3ZPLA 2PEXA 3KE2A 2FMLA 3L7WA 1DP7P 5D4SA 4QLCU 1Z6TA 4HOBA 5BMZA 1KU7A 4TV7A 5DUIA 1ZRCA 3FX3A 4MGRA 1QO0D 1B1BA 4N0BA 3F3XA 1KQ9A 2UWMA 1I1GA 2V9VA 2GQQA 3AAFA 4NHJA 1K7AA 1FYKA 4KT5C 5BPIA 2XKOA 3F6VA 3K69A 1LEAA 2HKOA 4FX0A 1G6NA 3KLNA 4G8XA 3GVAA 5TRDA 1OYWA 4HLXA 3DXJF 1OR7A 2Q2EA 3HIFA 3BJOA 2R7DA 2KRFA
chains in the Genus database with same CATH superfamily
3SZGA 3GZ5A 3CCJI 3F8NA 1OYIA 4L0ZB 2JWTA 3TO7A 2DTZA 2GA1A 5IP9J 4S0HB 3KP4A 4OAYA 4QIWN 3ZQLA 3FBNB 3TEDA 1MJBA 1BN5A 3HM5A 4C9YA 5EF6A 4U0VA 2LRDA 5FLXZ 2FSWA 4ENKA 4WCGA 2CRGA 4EQQA 2W7NA 3TKYA 2WV1A 4J00A 1CGPA 3MCZA 5KK1A 3TL4X 3OS1A 5M5YJ 1AHDP 1Y1WJ 3RPUA 2H27A 4ESJA 5ICFA 5KAIC 3L2VA 5IT9Z 2KMUA 4NUBA 2HYGD 4KMUX 2NNNA 3SZTA 4L18B 5K5QA 4UVAA 1GT0C 2WAQA 2X4HA 4NC8A 2AQFA 3KP6A 3PQJA 3BPXA 4IPAA 2EH3A 3EUAA 4A6DA 2OCCH 5FLXK 2LG4A 5FKNA 2OQGA 1DQUA 4LG0B 1FC3A 3RYRA 4DYCA 1IAWA 1SFEA 2DOFA 4GFBA 4MNUA 3I4NJ 1AWCA 4DZJA 4E7IA 4KNYA 2BY1A 2R7SA 3ESWB 1Z91A 3KYCB 5IYBJ 3IV5A 4XLCA 1HF0A 4X6AJ 3L09A 3V8LA 4KYWA 2MFZA 2IGOA 4M6XA 2BVLA 2TRTA 5E8GA 2XIGA 4YFXF 3ZMSA 2CU7A 4E70A 5FRMA 1KZHA 4A3CJ 2F5EA 4FE4A 3BZ6A 1CF7A 3ZQFA 4FCYA 4I2OA 1F1ZA 5LGNA 3MMYB 1R7JA 1SANA 3IH2A 3E1SA 2STWA 3R0JA 4UY8I 4Q4ZF 1JHFA 3UKGA 2L3DA 5DV5A 2V1XA 3ZQQA 3VYUB 2B0LA 2K85A 1X3WB 5E1ZB 2DA6A 1K78A 2C6YA 3GBGA 1HCRA 2ISYA 1ETQA 5ICGA 1K78B 3JRFA 2BW3B 2MC3A 3OMYA 1PVEA 2RC4A 2L5QA 3E6CC 4ON0A 1USTA 2KIUA 4PFOA 1FOWA 4ZTFA 3L2UA 4K2EA 5IOYA 3IH4A 2X6WA 2IT0A 1X2NA 4B3XA 2B7EA 1Q1HA 1XGMA 4XOTA 5CLSA 2L4MA 1SAXA 5F1JA 5HDNA 4CGZA 1FBSA 2M5WA 1BIBA 2EPFA 1K79A 3JRCA 3L1PA 3F21A 3F8FA 1GHCA 3JR9A 3KX2A 3LL7A 1T0FC 3LNQA 4Y52J 2F48A 3I53A 4L5EA 2ZXHA 2NS0A 2J5OA 5BNGA 4AIJA 1OKRA 4F3QA 3RKWA 3AG4H 1U9NA 3C2HA 5KNLA 3PJRA 3QPLA 1ZARA 3I5UA 2RAEA 4ZDLA 2HOAA 3VOEA 3ONQA 3H92A 4CYCB 1ZK8A 2PJRB 1IV6A 1HSJA 2VE9A 1TZLA 2QEXI 3HRMA 5IYDJ 3RKQA 4CHUA 2V6EA 3CUQB 1WJDA 1ZN2A 3CUQC 2IS4A 5EG0A 1ZGWA 2FBIA 2HS5A 1J09A 3RQIA 1VQLI 2DPDA 5CVVA 1IW7F 3LSRA 1YJNI 5EG0B 2PMUA 4KT6A 1YIJI 1I39A 1IN7A 2IEKA 4L5IA 1NK3P 2XPVA 2VE8A 3LSJA 2EZHA 4RAGA 5CKTA 4A5NA 3OY9A 4O3MA 4AWXB 2L54A 5D4RA 1UHSA 5DUKA 3RTRA 5B5EC 3GUDA 5JVGF 1EH8A 1SFXA 4BJ6C 1GVJA 3WU1B 2MW8A 2CG4A 1I5ZA 3CO7C 2P0WA 3GCMA 1R5GA 4ESBA 5IT3A 3SFZA 3CCEI 4ENNA 1W5TA 3GTLJ 3ZQ7A 4AIKA 1P7JA 4UXNA 5AIPA 2LNBA 4FASD 5JR3A 2VBZA 3GFLA 1SFOJ 1FP1D 1T8IA 1APLC 4E7ZA 3C2GA 2EQRA 4U7BA 4AVPA 2M4KA 2KISA 3FIWA 4AM3A 2LBFA 3OYAA 5EJCA 1VQNI 2VLAA 1JUPA 1B72A 5D5VB 4PCQA 2QM3A 3TOBA 2EIMH 3A4CA 3T8TA 2ZB9A 1CQTA 4AYBN 3OSGA 2DOEA 3F8BA 4CCMA 3M8FA 1JKQC 1KYZA 2WBMA 2EILH 1WCMJ 3DTEA 2HPMA 3MWMA 2QSHX 2D1HA 2WAQN 3PO3J 4HSRA 1OCPA 3D0SA 5L3GA 2KRHA 3R4KA 1XCVA 2KIMA 3OYFA 3GWZA 1YRNB 1Y56A 2IS1A 1YRNA 2ELHA 4BL0B 2Y75A 1GV2A 2M3AA 2F5DA 2MD0A 3L2QA 2NXNB 3ZP5A 1OCRH 1TWCJ 1NG6A 3ZR8X 3HRSA 3R60A 4FX4A 2ID6A 2V9KA 4HNTA 1P2FA 2H8WA 1ON1A 3H0DA 1YW9A 2WY7Q 4F7ZA 4A3GJ 3LSGA 4UUTA 3ISPA 1B8IB 1YTYA 5DCFA 5EYRA 3WTTC 3QP5A 1B8IA 4OIPF 2CGPA 3K1MA 5F27A 2LY9A 2BXZA 1Z0XA 4GYGA 3B02A 1N75A 3EDPA 1S7EA 2EFNA 5CQEA 1R71A 4KDPA 1IRGA 1FLIA 2A68F 4H4KC 1Z05A 4B43A 4NB5A 3KP7A 2LY2A 1LPQA 4CCOA 2CJJA 3K4KA 1T33A 1WJFA 3V7RA 3KETA 4M6VA 2DDBA 4Y3OA 4G6QA 1SD4A 3OYLA 2P6TA 3F6OA 4ZYAA 4UUSB 4RMNA 1W7PA 2FOWA 3LA3A 2X51A 4DOZA 2HDDA 4UUSA 1FEXA 2MA3A 3ZQCA 3SFIA 2KRCA 2HTSA 1UHWA 4B8XA 3O6BB 3M9AA 1FMVA 1MMNA 1T95A 1W5CC 3I64A 1TQMA 4HEA2 2R5ZA 5JI6A 1SFKA 1XGNA 3MQ0A 3VSLA 1ZLJA 5C4JJ 1XCBA 5EDNA 1A5JA 1MJAA 4YFNF 5H6QA 1U5TC 3FXJA 3PSFA 1W36D 2RQPA 2X0LA 2K3FA 4UB6C 2QSGX 1LDKB 3WE3A 3FF5A 2COBA 3A03A 3GMEA 2LDUA 4C2UA 2UXXA 3BG7A 3S2DJ 3AG2H 1BOBA 2XB5A 3JW4A 3MEXA 5FFZA 1Q1VA 2P5LC 1XPXA 3I55I 3EUHA 3H36A 5F6FA 2ECCA 4XOPA 4CICA 3A02A 4MTDA 2E5ZA 3E5UA 2QQAA 1FJLA 1JXSA 2RDPA 4HDVA 4HF2A 1FPQA 4XKVA 3VPRA 1O3QA 1Y8QB 1JGGA 1JHHA 4ZDPA 4IQ4A 3RYPA 2YR2A 5J6XA 2EBIA 4G7HF 2VODA 1GV5A 1XN7A 2DPUA 1D8JA 4HF1A 2R5YA 2LTPA 5GTHC 3BCAA 3B73A 3EUKL 1ORKA 4XLHA 5CVUA 2M34A 3HHGA 1X4PA 2HOEA 2RKHA 3BR5A 3DPLC 1V5FA 2DFIA 2CUJA 1W1WE 1T98A 2FRHA 2HQAA 4EJWA 4J01A 9ANTA 1KQ0A 1CF7B 3KP2A 3JSOA 5E3MA 3IUOA 1HW1A 1R1TA 2W57A 4HRIA 1KQ8A 5HDGA 1UMQA 4AVZA 1VQ8I 3S17J 1SVOA 1SD6A 1IV8A 3BG9A 1K83J 1J9IA 1S29A 2AQEA 1BJZA 4B44A 4HPQA 3MZYA 5M5XJ 2E35A 1HSTA 1IF1A 4P55A 1QVUA 3ABUA 4UV9A 1TQIA 2BHYA 1AKHA 5EGOB 1BI0A 3BQYA 1TWGJ 2EJRA 4F93B 3TGNA 4PJLA 3ABKH 3QYEA 3HPHA 2OCEA 5FKKA 4OMYA 1BI1A 5CVJA 4EGYA 2IGKA 1ETWA 2R0QC 2CV1A 4PZJA 1XG1A 2BW3A 2ZCWA 1JTXA 2EINH 1IGNA 4G9YA 4DGWB 2A05A 1VQ7I 3IRRA 4CZZA 2LF7A 3RKYA 4UNOA 1R1VA 1FBQA 2H8RA 1X58A 1FTTA 1MBJA 3T5XA 4A3MJ 1XX5A 2ZMEC 3C18A 4HLYA 2WB1A 3JRIA 3LMMA 4BE2A 1UG2A 1GXQA 1YX3A 2ZJQF 3S15J 2GM4A 1LFPA 2XAFA 1I6XA 3BT9A 2O3FA 2JA5J 3R6SA 1IN5A 5CJ9A 4EM1A 4IL6C 5EZHA 2VOOA 1JGSA 1BJAA 1JTYA 2CQKA 1F9NA 5FJ8J 3GO5A 3H9JA 3OL3A 4JK1X 4U7DA 2LD5A 1ENHA 1XB4A 1XGSA 4F91B 2M45A 1YG2A 3K6GA 1QBJA 4EATA 1SVMA 1HLVA 1IRFA 2EV0A 5DTDA 3DPTA 2W00A 4MO7A 2OUMA 1WVRA 4XONA 1IN8A 3CUQA 4XBFA 3GZ6A 1UZCA 2A07F 4R8HA 2QKLB 2VKEA 3HOVJ 3K4NA 3FK7A 3CMEI 2PQ8A 1QU3A 2JK3A 5FKLA 2QSFX 2HQRA 3CP8A 1T38A 5KCMA 2JQ7A 3BR6A 5J3LA 3JAMZ 4CSWA 2LR8A 4RLFA 3GW2A 3ZRGA 1LVKA 2NRAC 2VUMJ 1LVAA 1QPIA 3QOPA 4O6JA 2DQLA 4HF0A 3CMAI 4LG0A 2DA7A 1HKQA 2WV0A 1N78A 1BR2A 5FO5A 2LKXA 3ZN0A 2L02A 3VB2A 2B63J 1ZYRF 5GP9A 1X19A 3ZGKA 4ZYDA 4I0AA 2DMQA 3K0LA 4IX7A 1D0XA 3G1LA 2BY2A 2UUZA 3HTUA 1Y39A 1ZAOA 1MGTA 2FEZA 3DLAA 1WSUA 5HS8A 5FB2A 2XKPA 4QTRA 2K9QA 1J59A 1OMIA 1VTNC 1A35A 1EH6A 2FUG2 3HSFA 4XSXF 1H89C 2YX4A 1W7PD 4DBQA 3Q9VA 4Z6YA 2XSDC 2E7XA 1YHQI 4BHCA 1H9TA 1FSHA 4I99C 2CQ7A 2DFHA 1EV7A 3LSIA 2P4WA 2L7MP 5D6EA 3K9TA 2PMZA 4V19K 3I58A 4IVNA 3BG3A 4I01A 4AD9A 4B09A 3EPZA 3CCQI 5HLHA 2WY8Q 3PNYA 2RGVA 1WJ5A 2FU4A 3BZCA 2OAZA 3ECOA 4A5MA 1N77A 3AL0B 1KGSA 3LWFA 3IH3A 5L3CA 5EZGA 2M8EA 3UNGC 2G0EA 3L2RA 1FMWA 3QAHA 4L9JA 4XLFA 1IUFA 2R7UA 2IJLA 3NWSA 3U21A 3X2QH 3K2AA 1X4OA 3OYCA 3BR2A 4CA0A 4PDKA 4QPOA 1ZTRA 2E2JJ 3W2AA 2N8GA 3OIPA 4YELA 2DTRA 3WE2A 3WTSC 2HFHA 2AO9A 1VI0A 1MMGA 3SZPA 3G73A 1YJ9I 4NDLA 3ZMDA 1XSXA 3QQAA 4XICA 3H5AA 3CCRI 1TLHB 1HDPA 1D0YA 2KFDA 1XDSA 1IG7A 4C30A 2M0CA 2HZTA 4UVCA 3S8PA 5K7FA 3HGGA 1I3AA 2XVCA 4EGZA 2H1KA 3M8JA 3V8JA 4BGDA 1BI2A 3I56I 2H6CA 1MD0A 2CH0A 5HODA 3WGIA 4RB0A 4QPQA 5DS9A 1KU2A 2NOJB 1BIAA 2GAUA 3S93A 4YFKF 5E1WA 5C3EJ 5DYMA 5J4YA 4U88A 2R7XA 2W82A 2ETHA 2KT0A 2FQ4A 1SD7A 2JN6A 5EEAA 3L9FA 3VEPA 1YE9A 2V79A 4M9XA 5B3SH 3GTMJ 4IOCF 2STTA 4RB2C 1WRJA 4MEXF 2K4BA 3OYIA 2F6CA 2O0YA 3GXOA 3H3UA 3HJEA 1QPMA 3ZQHA 4LOCA 3M4OJ 1IZ1A 5A2QK 2JSPA 4A3FJ 1POGA 3R0AA 1ZGAA 2E71A 5FFXA 2MG4A 5CYVA 3SJMA 4KFCA 3GFIA 4N4OB 4WXDA 2QZ8A 3KEOA 1UFMA 2JRMA 4I6ZA 2QUFA 5LGTA 3U9GA 1ZRFA 5LRSA 2O6GE 5J8FA 1V55H 2R5YB 4LK0F 2DK8A 1W36C 2OZ6A 1YFHA 3O8GA 2EFWA 2LOOA 1OCZH 4XLAA 3CQZJ 3BLYA 3MAJA 4A69C 2CFXA 2DW4A 1MKMA 2ZO4A 3MN2A 3Q0WA 1TNTA 3VYTB 1XC5A 1ULYA 5ICEA 2ZXJA 3WU0A 1Z3YA 5J47A 4DW6A 2H1LA 1O7FA 3BR1A 4D7MA 2F4MB 3WU2C 1LFUP 1EKEA 3HGYA 4I7HA 5KHDA 4A3DJ 3IL2A 5EGOA 2KLOA 1MBEA 3G2BA 1G59A 3PNVA 3RJPA 2VJ5A 3CLOA 3IC7A 1ZG1A 3PL8A 2KIFA 3KP5A 1R5HA 5K7HA 1ZLKA 5E3LA 1ZH5A 3AL0C 2OTLI 2HEOA 3TW7A 2K9MA 3C1DA 1YO5C 2K9NA 2K7LA 4A3EJ 4V2GA 1WKMA 1NHAA 3K4JA 3CESA 3KYDB 1ZKGA 2LK2A 2O03A 2XRLA 4PGGA 5HS7A 1S8NA 2DT5A 3HHHA 1S9HA 4BY1J 4HNVA 3VSKA 3OIOA 3TQNA 1J7KA 2D2WA 2PMZN 4RAYA 4GDFA 3WGHA 2M7AA 1U78A 2CW7A 1UAAA 5DD4A 1RUNA 1XTAA 1U2WA 4HA8A 4XMYA 1ON2A 4I76A 2MD5A 2QQ8A 3V4GA 3GFMA 4BQNA 3FISA 2ESNA 2WC2A 5GAGJ 2Y9ZA 4LB6B 3WG7H 1XMXA 2YS9A 2JUGA 4KN4X 4NNJA 4FE7A 3UR3C 2RREA 3L2CA 4X1EA 4IQJA 1WI9A 2KJCA 2DN0A 4I98B 3V7CA 3LSHA 3LAPA 4QWQA 5JFRA 3JSPA 1S7OA 3HRUA 3KEQA 4D7NA 2Z16A 1QZYA 5GPCA 3K1PA 3TP0A 1VQ4I 1HW2A 2Z2SB 3W6KB 3W2VA 3S1RJ 1G3YA 2XGXA 4XSZF 2ZJRF 2P5KA 3N4MA 2V1UA 1O3RA 1U8RA 1DUXC 1GVDA 1WGXA 4RB1A 2X1EA 2EV6A 3DLLF 1UB9A 3S14J 5M3FJ 2Y69H 2VL8A 2LLKA 2CWEA 1TNSA 2I5UA 4ANJA 3G4SI 5E79C 3DFGA 4DYRA 1BI3A 3RDIA 2L7FP 3O8HA 2DA4A 5JHFA 2YSRA 1BC8C 2LP0A 4OIQF 3ABTA 3ZMVA 1Z21A 3FWEA 2VXDA 2XPUA 1ONVA 1H0MA 2V1NA 4A3KJ 1P4AA 2EK5A 4B48A 1KYWA 4IF4A 2CQXA 1X1PA 1IN6A 3K70C 3BROA 5IP7J 2XV4S 3JTHA 2P8TA 5J1RA 2Y9YA 3NWTA 2E34A 3DQVC 1T6SA 2GOMA 4JQFA 1NG7A 3KLOA 3TBIA 1D8KA 2DA3A 1JKPC 2ID3A 5F04A 3CCVI 2BYVE 2E7WA 2HNHA 2A69F 1MBKA 5E20A 1E3PA 2Y48A 4YIRX 2ESHA 3QU6A 3ZMZA 3IAM2 3HOUJ 1V4RA 2XSJC 3GEZA 3TDUC 1ZR4A 3HXLA 4XL9A 4CH7A 4E6KG 2OJED 3FMRA 4HYEA 5FGMA 3S2WA 2MLKA 2FF4A 5GADJ 5LRRA 3BOQA 3S32A 2CUFA 3F8MA 5AIQA 3JTGA 1O4XA 4HSTA 3FXOA 1TBXA 1QRYA 3OOUA 2KP6A 2A5YB 2LY1A 4A3LJ 1VNDA 3V42A 2ICWG 5GTIC 2E19A 2L01A 2FA5A 2IBDA 3KP3A 1SEUA 3VODA 2PI0A 4JX4A 5F1RA 5IOZA 3JREA 1IUYA 5EEGA 1R4MB 2V6CA 3LA7A 3WTZA 4M3FA 4F55A 4HX4A 1P4WA 4Y7NJ 4MFDA 3DEUA 1ETXA 2CUEA 4XRFA 5ED4A 3HOWJ 2VONA 4IHYA 1SMYF 3ECHA 4BU2A 2O7OA 1WWXA 2P81A 2MBFA 2VIXA 5TGTA 2HKXA 4RS8A 1Y0UA 3K7AJ 3CC4I 3SXYA 2O9LA 2Z3YA 4G7ZF 1JE8A 1D1CA 4WK8F 1MJ9A 3P9CA 2KKOA 3DTKA 2KZVA 1Z7LA 4I02A 2Z5UA 3ASOH 1IRXA 3I4MJ 2MYSA 1ETKA 5FD5A 1DPUA 4WXCA 2IXSA 3RZDJ 1C0WA 4JX6A 4HDUA 1WZ2A 2JSCA 3DBRB 2RV8A 3FXQA 1T56A 1FOYA 2VJ4A 3JRBA 2BXYA 2GIZA 2K5CA 4PJNA 3ML6A 5H20A 2HDWA 2IP2A 2D5VA 3C7JA 2LSOA 2X85A 1D1AA 4L5JA 3CD6I 3ULQB 1I1SA 3B6CA 5DD8A 5J8CA 4IXAA 2Z99A 1B6AA 3NRVA 4DQ2A 2MLGA 2A5WA 2GIVA 1JKOC 3OR2C 4ZJZA 2OQRA 2Q0OA 2IAIA 3CZ6A 2EIJH 1HBXG 2EFOA 3H1CA 3FHZA 1PUFA 2Y2ZA 3G6EI 1RIOH 2K9SA 4NC7A 3KFWX 3BTJA 3PO2J 1MZBA 4ITVA 3COAC 4LMYA 5F0CA 5D5XB 3I59A 2CMPA 2CUZA 5B1BH 3BG6A 3QPSA 4XORA 3BY6A 4P9UA 4BXUA 4DJAA 1L3LA 3OSFA 1ETYA 4U0WA 1P92A 1F5TA 3LFKA 2W1OA 2M8GX 2K02A 3ROUA 2HXIA 2O5RA 2KL4A 3GTOJ 2R7ZJ 3OIQA 2ZJPF 2LBFB 1MNMC 3IAS2 4M3EA 2NVXJ 2CFOA 4HAMA 4OMZA 1A31A 3DEEA 2RQQA 2VI6A 1UHMA 1SVLA 5D6FA 2XDVA 4E4HA 2VQLA 2ECBA 4UUVA 1UCRA 3CCSI 4MFEA 2YPRA 1HW5A 4E7LA 1E3OC 5FLMJ 1RETA 1MNDA 3RSNA 2HVSA 3OOPA 4C2MJ 2BY3A 2F4OB 3OL4A 3Q3SA 4DYQA 2ZC2A 1TW2A 2L2OA 2BEOA 4HBLA 2AS5F 3U1KA 2DT7B 3Q9SA 4Y33A 3F0CA 1T39A 3WTUC 4JYKA 4EJVA 1PYVA 1PJRA 5LHHA 2O8XA 2R92J 5TJJA 4LB5A 3CC2I 4A0YA 1F43A 1WQ2A 1H9GA 1QGPA 1ZG5A 1X3UA 2HGCA 2VKDA 2OA4A 3E6DA 5LD2C 1HQCA 1K6YA 1ZG3A 5IY5H 5C44J 4F92B 2W25A 1G3SA 2EV5A 1E3HA 2ZNYA 2XASA 5B66C 2VKVA 4AYBA 3GTGJ 1I3QJ 1MIJA 3HOTA 1V3FA 3K2ZA 2CYYA 2KDOA 2XHKA 3EUHC 4WWCA 1WJAA 3PQKA 2OTJI 2EZLA 2K86A 5K5RA 4ASNA 1G3TA 1J2XA 1A6QA 1RI7A 5LFAA 3SEQA 3LAJA 3ZCOA 1D1BA 1M1EB 5JVTA 2MH2A 4GGGA 2YU9J 4C3JJ 4LITA 4ZZDA 1W7PB 2BV6A 2OD5A 2V1DA 4H0EA 1MH4A 2G7UA 2JPBA 3ELKA 3WODF 5FRNA 3AKZA 1D5YA 3NQOA 2A61A 3PUBA 1YS7A 4NQWA 3TOAA 2JA7J 4D9JA 3BZKA 4RBOA 4DBRA 2QBYB 2JVHA 4NQWB 1TC3C 1GUUA 2IA0A 1P6RA 3BDDA 3MZHA 1XDUA 3CCYA 5HVQC 1A6IA 2E5NA 5ICCA 5JHUA 5K1YA 5DM7F 1LDDA 4RLQA 4LIUA 3HTSB 4A3IJ 4C2TA 2XAJA 2K3PA 4M6YA 1RNLA 4PUSA 1X1BA 2JT1A 3ZMUA 4WF2A 3QWLA 1IXCA 4KIGA 3JAMK 3S2HJ 2QLZA 2YX7A 2VJIA 1LKXA 3GYHX 1WFXA 2QWWA 3ERMA 2E2HJ 3KPHA 1R5ID 2F4IA 3DWLE 1DP3A 3RPQA 3K4LA 3A0HC 1FY7A 3TW6A 5J4VA 2X6XA 4XRSG 4GXOA 1HKSA 4RGUA 3ZQGA 1FBUA 2LVSA 3FXKA 3ABMH 1SMTA 5JLXA 4L9VA 4JOMA 4BXFA 2PX9A 2K9LA 4CCJA 1O3SA 1AA7A 4YRVA 2L7ZA 3CTAA 3AFHA 4BE0A 4LIVA 2E1MC 3OYEA 4A93J 4ESFA 2Y31A 3KZZA 1P9QC 4II3A 4HV5A 3M3YJ 2WWYA 5L3DA 4P9FA 2VQCA 4ZZLA 5K7ZA 3M07A 1OR7C 4UVBA 1G8XA 4XLPF 1K6OA 4XRSA 1GLNA 3E5XA 2FQ3A 3K4BA 2V9PA 2GWRA 2NYXA 4IEJA 1D3YA 4UV8A 5L3BA 3P9IA 2GXAA 5KVRA 5IYCJ 1MW7A 2R7QA 4BBRJ 2HWVA 3BTLA 4IRHA 2H6BA 3HC7A 2XRNA 3O2PE 4A0ZA 4ENMA 1E0EA 1ZHFA 3K1NA 3GZNB 1LUJB 4BDZA 1FT9A 2LH9A 2IA1A 4QSHA 2R7WA 3GTPJ 3VWBA 5IT9K 1U5TA 1AKHB 1T2KA 1ZR2A 3EYIA 4W1UA 1UELB 4LLGF 2E1MB 1YI2I 2Z9OA 2CW8A 4I09A 4RGRA 1I50J 2AXLA 2OZUA 4XN0A 3V8KA 4KITB 1ZREA 1IDZA 4BE1A 4G94A 2OU2A 2A3SA 3O3KA 4KICA 4N4NB 2GXBA 4EJTA 1LQ1A 1OCCH 3FBIB 3G1OA 1XSVA 5DEQA 4BH9A 2CV0A 3BTIA 4UHTA 1T08B 1QNTA 1FZPB 4EM0B 5GAHJ 4YG2F 4LLLA 5GPAA 1RR7A 1YYVA 2GBYA 2ZFWA 3KEYA 4PJMA 3RIRA 3RQ4A 3OS0A 4ZTJA 1PDNC 1PUEE 2DBBA 1A36A 2VBYA 4AC0A 2DJNA 2E36A 3ZQIA 4KJZA 2QCOA 1VQOI 2M87A 3CF5F 4GRIA 4KIFA 1F36A 2PJPA 3MFKA 2DOAA 4CCNA 4P96A 4LGWA 4BEHB 1Y6IA 2ISZA 4AIHA 2JMWA 3V7SA 5BPDA 4N9IA 2R3SA 3OV8A 3I71A 1ETOA 3D5LA 4CYDA 1F4KA 1ZRDA 2XB0X 2XC7A 3IKVA 2L9VA 3BG5A 2JA8J 4E7SA 2ZNZA 2MH9A 4IRGA 1TP4A 2O61A 4DZPA 5DDGA 1IXSB 3FDYA 3ERED 4I0BA 2EA4A 2UXNA 2WB1N 2HOTA 3DBLB 3I4PA 4N9HA 4HX8A 3RI4A 3A0BC 3H3ZA 4A2UA 3CJNA 2P5VA 5HLIA 1S5LC 1I27A 2NS7A 3RKXA 3S1QJ 1EJ9A 2KZGA 4LJZF 1R23A 3E97A 3IWZA 4MIMA 3I59B 1HKTA 1H8AC 3QP6A 1G3WA 3OYNA 4OAZA 1U9OA 3R61A 3EQLF 3FM3A 1BW6A 1W0TA 1WJBA 4C3IJ 5CPRB 2M1BA 4LLNA 3K4MA 2R7OA 5F64A 4KIBA 3LSKA 2HPIA 4FQGA 3MVPA 2L4AA 3CUOA 4D0PA 3J80Z 1YS6A 1E2XA 1OFCX 1UJ8A 2XGDA 3QPHA 1R22A 3PFYA 3K70D 4Q48A 3DF8A 4HG2A 4IHWA 2A6TA 2BBYA 4XK4A 4EM2A 4RDUA 3IHUA 4YIFA 2ZFUA 4CCLA 1ODDA 2BOLA 2D1VA 5FROA 4GCVA 2CW0F 1JKRC 3DEWA 4HQMA 4HQEA 2XPWA 2ZKZA 2DA2A 5LBQA 2JA2A 1G4DA 3QYBA 3PM1A 4OIRF 3F22A 2MC4A 3PNTA 3LOCA 2JPCA 2ADUA 2F5VA 3GTJJ 3GX4X 1BR1A 3J80K 2E1NA 1S7AA 2K4JA 2HYFA 4E7HA 3F23A 3FK6A 5HLGA 4BXXJ 1BL0A 1WH7A 2LFBA 2HI3A 2FMYA 3SQNA 5D5UB 2KPMA 1FSEA 1Z7UA 3K4CA 1LE8B 5ILVA 2VN2A 1WJEA 2O8KA 4V2FA 2CSOA 5LHIA 1B59A 1S3JA 2K27A 1RESA 1STZA 1D0ZA 3K10A 2DI3A 1V5GA 1VQPI 4IZZA 4PFPA 2FNPA 2DDAA 1IJWC 1Y0NA 2I8DA 2HR3A 1HXDA 3T0YA 1X3ZB 2NAZA 2DU9A 5H6RA 3OYDA 2E60A 3JRGA 4BQOA 1KONA 4WX9A 2DO7A 5L3EA 3PIPF 5HDKA 4B1RA 1LDJA 3Q0UA 2W4SA 3JRHA 1PP7U 2DYRH 2V7FA 5E17F 3MD2A 5J40A 4ETSA 2FJ1A 3CDIA 2F5FA 2VQHA 1S6LA 3DCFA 3E0JB 2BVMA 4OINF 2IRFG 1IDYA 3KYLA 1B4AA 2ME0A 4ABZA 2KHMA 2W24A 3QYFA 1DPRA 2DCEA 1FNNA 3KZYA 2XAHA 2MSYA 1OCOH 2FOKA 2E2IJ 3ZOBA 2OC6A 2LREA 3OYJA 1YIOA 4G6TB 3DV8A 3C3WA 1J0RA 2M4GA 3SDBA 4JP0A 4M73A 5LEKA 1FTZA 1BR4A 1R36A 4XIDA 4D1QA 3WG9A 1Z67A 3HL2A 3E6MA 5BOXA 3A01A 3RZOJ 2ZJ2A 5BS6A 2KIQA 3HG9A 2NNYA 1OCTC 2L9NA 4MQVA 1B9MA 4ZYGA 1W0UA 2RVCA 1AOYA 2RNJA 1ZGJA 1MSFC 5LGUA 3GLLA 1IO2A 5EEHA 2G9WA 3GTKJ 3KCCA 3LQQA 4XQFA 3I3LA 4KUMA 2ME6A 2ZMEA 5D8LB 3W3CA 2Y0MA 5HNFA 5FD6A 3OYMA 2HTJA 1JUSA 3GF2A 1XMKA 2M2EA 1L0OC 2FX0A 3BJ6A 3MKYB 2GZWA 4C3HJ 2CV2A 2WAFA 3VDXA 1MBGA 4ZYHA 3HB9A 3OWTA 1BA5A 3FKIJ 2MABA 4EVIA 2PLYA 4GO1A 1RC9A 2ELKA 1SC7A 2FD5A 1U6GA 2IGMA 3F8CA 5ERIA 4Y13A 5E18F 1FYLA 1KU9A 1IRZA 2R7FA 3JRDA 3CMMA 3HOXJ 2QENA 2DQRA 3HYIA 2OPTA 3CJTB 1R4NB 1YQAA 1U0JA 4U87A 2EZKA 4MHGA 1BC7C 1MMAA 3J81Z 1R9TJ 2GOXB 4IHSA 1UG0A 2IA2A 2L9RA 1Z6RA 2PG4A 5DM6F 4RAFA 2P7VB 4GYIA 5ILSA 4Z2YA 5FKOA 3FXUA 4AU7A 1WH5A 1WI3A 1FX7A 2VJJA 2Y0SN 1MSEC 3HSRA 4A3JJ 3I0TA 4PJ0C 3GFJA 2V26A 2PMHA 2KDZA 2ELJA 4RA2A 2UZKA 2VB6A 3H9QA 3OYHA 2JUCA 3J7YJ 1XS9A 2WADA 2IGNA 4PGHA 4P1WA 1NTCA 1QQIA 4L0YB 2WA0A 2X1CA 4X0GA 1FIAA 3FM5A 4G7OF 1QHHD 2ZXIA 1SFUA 1OYYA 2GA2A 2HU9A 4O5VA 3Q5FA 1NH3A 2KQRA 1O3TA 2YU3A 4B4CA 5LLQA 3S3NA 1Z9CA 4BKXA 5F0HA 4B47A 2EFQA 2R93J 2W85A 3G1MA 1KU3A 2DFEA 1Y1VJ 4Q5SF 2J5PA 3HOZJ 2X6YA 3CJRB 3FMQA 1R49A 4II2A 4KISA 2OF7A 4IKFA 5E3NA 1XMAA 1VQ9I 4XM3A 2A6EF 3D5RC 1RRJA 1MH3A 3BP8A 3TO9A 2R7RA 5JLWA 3C2BA 3A1YA 4E7KA 2NVYJ 2IW5A 3NAUA 4DNCA 4KMFA 2XAQA 2JJ7A 3N05A 1FOKA 2QBYA 2NOGA 2R7VA 4BHPA 1TQPA 3DKYA 2I10A 2L7KA 1B9NA 4U0YA 4IHTA 1OPCA 1YX5A 3GLXA 4RM2A 3G71I 4RM3A 2IS2A 2HDCA 3IP4B 3WHBA 1W4MA 4MTEA 4BY7J 4JBAA 4Y17A 3S16J 1QZEA 2VT2A 3P7NA 1I6HJ 2TCTA 5ILUA 3CCUI 2VBXA 5IP6A 1ZQ3P 3JCUC 3WTWC 3GTQJ 4RGXA 2Q2EB 3HUGA 4IOAF 1VFCA 3FKJA 2FBHA 1EF4A 3HKZN 1DGRM 2BE5F 4DIQA 5F0FA 4WXHA 2CQNA 3SEZA 2DYSH 5M3MJ 2VC0A 4HW0A 3PFIA 4OOIA 1JT0A 2UV1A 1HC8A 3J7AY 2OV7A 3S3MA 3LQRA 4KN7X 2XGCA 1D5VA 2BGCA 2DODA 1JJ6C 1V5EA 3E7LA 3OR1C 4LK1F 3AG1H 4J19A 3QODA 1MMSA 3I54A 2DFFA 4BJ5C 5IPAA 4Y15A 2F5CA 5C4XJ 1WHUA 3ZMTA 4HV6A 3BR0A 3E5QA 2AXTC 3VFZA 2TDXA 1R58A 2XF5A 5E8IA 3CDHA 4BNCA 5CQGA 1R1UA 2VT3A 2JVGA 4IHVA 3H3VK 2XAUA 4W97A 2P6SA 5D8KB 2MGQA 3CC7I 1FOXA 2FE3A 1J5YA 5B1AH 4M72A 2QVOA 4BDYA 2CO5A 3LA2A 1VQ5I 3ZXSA 2DK5A 3MZ8A 1Y8RB 3AG3H 3CMYA 1X1AA 2YUSA 1MNEA 3HPGA 5E3OA 2PBIA 2WAEA 4CDGA 3M1EA 3F72A 4OIOF 2VBWA 4BACA 2NVQJ 3M7GA 4MLOA 1N25A 2KJBA 2R4GA 2ZBKA 3BJAA 2H09A 4HNUA 4ZH4F 1RZ4A 2XF6A 2BHZA 3P5JA 4XKWA 4EJOA 2CQQA 3I9V2 4RB3C 5HOOA 2D45A 2RN7A 3JRAA 1A04A 1BW5A 4FETA 3SYTA 4IJAA 4ZDOA 3MKLA 2EIKH 4BAYA 2DMPA 2VKHA 4M74A 2Y0SA 3D5SC 4CO8A 3QU3A 3DTIA 1GDTA 5DCMA 1FIPA 4RGSA 1MDMB 4M71A 4FISA 3BQZA 3DBHB 5CVIA 4LD5A 4BQAA 1LB2A 1P7IA 2XUBA 3ABLH 5CVRA 4NBQA 5DCMB 1MDMA 3NARA 4D5FA 3LSPA 1LJ9A 3HDDA 3TP3A 4A12A 2XF7A 4EV0A 4XN3A 4CXFA 5M5WJ 1YLFA 3CDLA 4BBSJ 3N97A 2VQGA 2PN6A 3HEFA 2BZTA 2HOSA 4BYYA 4M3DA 4AIDA 5LHGA 3WTYC 5K5OA 2H94A 1ERDA 4EJUA 4M3GA 1TW3A 4B3AA 1YW7A 2DLLA 1HOMA 3BR3A 1AU7A 1LFBA 3H35A 3BWGA 1PUFB 2LKPA 1WPKA 3CF2A 2RNGA 5FKMA 1QZZA 4Y4RA 4XLNF 1RUOA 2FXAA 4D5CA 1IN4A 1TWFJ 2G7HA 3B6AA 3OS2A 1SAUA 4CUGA 3CJQB 4E7JA 2VOPA 3REOA 5D5WB 2LF8A 2JTVA 4XKCA 1DU0A 4A0XA 4A3BJ 2PJRA 1S72I 1TWAJ 2Z33A 4EMSA 1OQYA 1XSDA 6PAXA 3CCMI 2W48A 2V4JC 1KA8A 2ZSIB 1XGOA 1Z3XA 4CZCA 2WTEA 2F2EA 3J7ZI 5A2QZ 2EZIA 2HVQA 1YJWI 5FLVA 1TTYA 2E1CA 4FHTA 5HLTA 1R6RA 1BM9A 1DU6A 1LNWA 3TMOA 3FMSA 1VF9A 4YIIA 4Q47A 3A2KA 1JJ8C 1E17A 3EETA 1PP8F 1X1DA 3HKZA 4OU0A 1SD5A 4S05A 3KZIC 1U3EM 3J81K 3PSIA 1K4SA 1BOAA 3NEUA 2CS3A 3QOEA 2EA2A 1OISA 2IPQX 1LE8A 4CCKA 2EFPA 3HRTA 1YW8A 3OYBA 1JT6A 2LMDA 2GXGA 3E6BA 2JZYA 1ETVA 2QQ9A 3DPUA 1B72B 2VASA 4R1HA 3ASNH 1ACIA 2W84A 4P5OA 3LSMA 2XGEA 3WGGA 3U1DA 1FP2A 5L3FA 5HS9A 4FTHA 1TWHJ 2LYCA 3D1NI 4S04A 2VC1A 1MBHA 1QVTA 2HQNA 1NK2P 3MKZA 4JX5A 2HQ5A 1J75A 3FZVA 4NC6A 2OBPA 2K40A 3FXRA 4FT8A 1HA8A 3HOSA 2X9DA 4MQ9F 3S1NJ 3G3ZA 2A6HF 4ZC3A 2XAGA 4ENJA 1P4XA 5BQTA 2Q8KA 4PK4A 2LC2A 3CLQA 2HXOA 4G6DA 3W6VA 1V54H 3W2WA 2XROA 1VZ0A 3SHFA 2DAOA 3PUFA 2QKMB 5KAFC 4LFUA 2DMNA 3F9KA 2DMUA 1VQ6I 3PIOF 3DKXA 2L9SA 1GXPA 3SDGA 4G12A 3E3VA 2DJIA 5TISC 3VYSB 2HVRA 3A01B 1IC8A 2M30A 3OYKA 2GLOA 1TT0A 1QA6A 3Q0VA 5GAEJ 2ACJA 1WJCA 5F08A 3CO6C 1TL8A 3QPTA 1JUMA 2FBKA 1U8BA 2DA1A 2PFBA 3LSTA 3T1BA 3T8RA 1ZELA 3M1CA 1RPWA 4XLEA 2NVTJ 4M9ZA 1YOVB 3HUGB 1BBYA 2ZMEB 4KA4A 4BS9A 4RAZA 2VXZA 4XKBA 5J1UA 1FYMA 4AUXA 1X2MA 3IWFA 2HZDA 3H9GA 3U2RA 3IKTA 3IRQA 2EB7A 1K61A 4CYCA 4ZYEA 1R00A 1T0FA 2M7BA 2IVMA 3RPUD 3H0GJ 4M9SA 2IS6A 2DA5A 4PSXA 2COMA 3TDZC 1USSA 2QQBA 1EH7A 2EWNA 4HZFA 1LEBA 3QRFF 4MEYF 1RKWA 2QF7A 2FNAA 2R5ZB 4L9TA 3BPVA 1FWZA 3HZJA 1RKTA 4L9NA 3LFUA 2JA6J 3M8EA 3DKWA 3VYRB 4HX7A 2JRTA 5E1XA 1QHGA 5J1YA 2ZXWH 5AONA 3KIOA 4IO9F 2X48A 4YEJA 1O7LA 3ZN1A 4PJJA 1TT5B 1XD7A 1DDNA 3H5RA 3HSEA 3FXMA 1Z1DA 3FHNA 3L00A 4R79A 2P7CB 1Z77A 1W5SA 4EEFG 2X6OA 2ZSHB 1REPC 2B9SA 5HNHA 4BHBA 3DP7A 3TO6A 2E1OA 1HDDC 1G2HA 3H5NA 1U5TB 3WTVC 2QYOA 2NVUB 4XRMA 3BCBA 1O57A 1IXRC 3P9KA 3RCOA 5H2FC 3J7AO 2QGUA 3EYYA 3WTXC 4IRIA 4BUPA 4A6EA 2DT6A 4XR6A 4XNFA 3W6JB 5LEJA 1OJLA 1OLTA 2M0MA 4PSWA 3ZPLA 2R7TA 3S3OA 2PEXA 3KE2A 2FMLA 3L7WA 4F52A 3DU5A 1DP7P 3HOYJ 5D4SA 1Z6TA 2HYJA 4HOBA 4TV7A 4QLCU 5BMZA 1KU7A 5DUIA 1ZRCA 2Z1DA 2Q1ZB 3FX3A 1VQKI 3S1MJ 4MGRA 1K4TA 3BC8A 1QO0D 1B1BA 3DU6A 4N0BA 3F3XA 3CP2A 1H88C 1KQ9A 1DGWY 4BQQA 2UWMA 3MKWB 1EA3A 2AHQA 2L0KA 1RR8C 2BY0A 1I1GA 3L2WA 2NS8A 2DMTA 2V9VA 2DXIA 2GQQA 3AAFA 1MBFA 4BEHA 1YITI 4NHJA 3CCLI 1X1CA 1K7AA 1FYKA 4KT5C 1MMDA 5BPIA 2VPRA 4UB8C 2XKOA 2Y30A 3F6VA 3K69A 3WHCA 1LEAA 2HKOA 2M9HA 4LG3A 4FX0A 1ITYA 1G6NA 3KLNA 3OYGA 3BTCA 1JI8A 4G8XA 4M3BA 3GVAA 1VQMI 2LKSA 3FXLA 5TRDA 1OYWA 4HLXA 4IHXA 3DXJF 2VPLA 4BJTA 1OR7A 2X1DA 2Q2EA 3HBLA 3HIFA 4OWRB 3BJOA 2QA4I 2R7DA 2KRFA
chains in the Genus database with same CATH topology
3GZ5A 3F8NA 1OYIA 4L0ZB 3TO7A 2GA1A 3KP4A 1MJBA 1BN5A 4U0VA 5FLXZ 2FSWA 4ENKA 4WCGA 4EQQA 1CGPA 3TKYA 3MCZA 5KK1A 3RPUA 2H27A 4ESJA 5ICFA 5IT9Z 2HYGD 4KMUX 2NNNA 3SZTA 4L18B 5K5QA 4UVAA 2X4HA 3KP6A 3PQJA 3BPXA 4IPAA 4A6DA 5FLXK 2OQGA 4LG0B 1FC3A 3RYRA 1IAWA 1SFEA 4MNUA 1AWCA 4KNYA 1Z91A 3L09A 3V8LA 4KYWA 4M6XA 5E8GA 2XIGA 4YFXF 3ZMSA 4E70A 2F5EA 3BZ6A 1CF7A 4I2OA 1F1ZA 5LGNA 1R7JA 2STWA 3R0JA 4Q4ZF 1JHFA 2L3DA 5DV5A 2V1XA 2B0LA 5E1ZB 2C6YA 1K78A 2ISYA 5ICGA 1K78B 2MC3A 3E6CC 2RC4A 4ON0A 1USTA 2KIUA 4K2EA 2IT0A 1Q1HA 1XGMA 5CLSA 2L4MA 1SAXA 5HDNA 4CGZA 1FBSA 2M5WA 1BIBA 1K79A 3F21A 3F8FA 1GHCA 3I53A 2NS0A 2J5OA 4AIJA 1OKRA 3RKWA 1ZARA 3I5UA 3VOEA 3H92A 1HSJA 2VE9A 3HRMA 4CHUA 3CUQB 1ZN2A 3CUQC 2FBIA 2HS5A 2DPDA 5CVVA 1IW7F 2PMUA 1IN7A 4L5IA 2VE8A 4A5NA 4O3MA 4AWXB 2L54A 5D4RA 5DUKA 3RTRA 3GUDA 1EH8A 1SFXA 1GVJA 3WU1B 2CG4A 1I5ZA 3CO7C 1R5GA 4ESBA 5IT3A 3SFZA 4ENNA 1W5TA 3ZQ7A 4AIKA 4UXNA 5AIPA 2LNBA 5JR3A 2VBZA 3GFLA 1FP1D 4U7BA 4AVPA 5D5VB 4PCQA 2QM3A 3TOBA 3T8TA 3F8BA 3M8FA 1KYZA 3MWMA 2D1HA 5L3GA 3D0SA 3R4KA 1XCVA 2KIMA 3GWZA 2ELHA 2Y75A 2F5DA 3ZP5A 3HRSA 3R60A 4FX4A 1P2FA 1ON1A 1YW9A 4F7ZA 3ISPA 1YTYA 5DCFA 3WTTC 3QP5A 4OIPF 2CGPA 3K1MA 4GYGA 3B02A 3EDPA 2EFNA 4KDPA 1IRGA 1FLIA 2A68F 1Z05A 4NB5A 3KP7A 3V7RA 3KETA 4G6QA 1SD4A 2P6TA 3F6OA 1W7PA 3LA3A 2MA3A 2HTSA 1UHWA 4B8XA 3O6BB 3M9AA 3I64A 1TQMA 5JI6A 1XGNA 3MQ0A 1ZLJA 1XCBA 1MJAA 4YFNF 5H6QA 1U5TC 2RQPA 2X0LA 1LDKB 3WE3A 3FF5A 2LDUA 2UXXA 3JW4A 3MEXA 5FFZA 2P5LC 3EUHA 5F6FA 4CICA 4MTDA 3E5UA 1JXSA 2QQAA 2RDPA 4HDVA 4HF2A 1FPQA 1O3QA 1JHHA 3RYPA 2YR2A 5J6XA 4G7HF 2VODA 1XN7A 2DPUA 1D8JA 4HF1A 3B73A 5CVUA 3HHGA 2HOEA 2RKHA 3DPLC 2FRHA 2DFIA 4EJWA 1T98A 1KQ0A 1CF7B 3KP2A 3JSOA 1HW1A 1R1TA 2W57A 1KQ8A 5HDGA 1SD6A 1J9IA 1S29A 3MZYA 1HSTA 1IF1A 4P55A 3ABUA 4UV9A 1TQIA 1BI0A 2EJRA 3TGNA 4OMYA 1BI1A 5CVJA 4EGYA 4PZJA 2ZCWA 4G9YA 3IRRA 4CZZA 2LF7A 3RKYA 4UNOA 1R1VA 1FBQA 3T5XA 3C18A 4HLYA 1GXQA 2XAFA 1I6XA 2O3FA 3R6SA 1IN5A 5CJ9A 4EM1A 2VOOA 1JGSA 1BJAA 2CQKA 1F9NA 3GO5A 4JK1X 4U7DA 1XB4A 1XGSA 2M45A 1YG2A 1QBJA 1IRFA 2EV0A 3DPTA 1IN8A 3CUQA 4XBFA 3GZ6A 2A07F 4R8HA 2PQ8A 2HQRA 1T38A 3JAMZ 3GW2A 2NRAC 1LVAA 3QOPA 4O6JA 2DQLA 4HF0A 4LG0A 1HKQA 2WV0A 5FO5A 3ZN0A 2L02A 3VB2A 1ZYRF 4ZYDA 4I0AA 3K0LA 3HTUA 1ZAOA 1MGTA 2FEZA 1WSUA 5HS8A 5FB2A 2XKPA 1J59A 1OMIA 1VTNC 1EH6A 3HSFA 4XSXF 2YX4A 1W7PD 3Q9VA 2E7XA 4BHCA 1H9TA 1FSHA 1EV7A 2P4WA 5D6EA 3K9TA 3I58A 4IVNA 4I01A 4AD9A 4B09A 5HLHA 2RGVA 2FU4A 2OAZA 3ECOA 4A5MA 1KGSA 3LWFA 5L3CA 2M8EA 3QAHA 4L9JA 2IJLA 4PDKA 2DTRA 3WE2A 3WTSC 2HFHA 3SZPA 3G73A 3ZMDA 1XSXA 1TLHB 1XDSA 2HZTA 4UVCA 2XVCA 4EGZA 3V8JA 1BI2A 2H6CA 1MD0A 3WGIA 4RB0A 1KU2A 1BIAA 2GAUA 4YFKF 5E1WA 5DYMA 4U88A 2ETHA 1SD7A 3L9FA 3VEPA 2V79A 4M9XA 2STTA 4RB2C 1WRJA 4MEXF 2K4BA 2O0YA 3GXOA 3H3UA 1QPMA 1IZ1A 5A2QK 3R0AA 1ZGAA 5FFXA 5CYVA 4KFCA 3GFIA 4WXDA 2QZ8A 3KEOA 1UFMA 2QUFA 5LGTA 3U9GA 1ZRFA 5LRSA 2O6GE 5J8FA 4LK0F 2DK8A 2OZ6A 1YFHA 2EFWA 3MAJA 2CFXA 2DW4A 1MKMA 2ZO4A 1TNTA 1ULYA 5ICEA 2ZXJA 3WU0A 1O7FA 4I7HA 3IL2A 3RJPA 3CLOA 3IC7A 1ZG1A 2KIFA 3KP5A 1R5HA 1ZLKA 1ZH5A 2HEOA 3C1DA 1YO5C 2K7LA 1WKMA 1NHAA 2O03A 4PGGA 5HS7A 1S8NA 2DT5A 3HHHA 3TQNA 1J7KA 2D2WA 4RAYA 3WGHA 1U78A 5DD4A 1RUNA 1U2WA 4HA8A 1ON2A 2MD5A 3V4GA 3GFMA 2ESNA 2WC2A 4LB6B 4KN4X 3L2CA 1WI9A 2KJCA 4I98B 3V7CA 3LAPA 4QWQA 5JFRA 3JSPA 1S7OA 3HRUA 3KEQA 1QZYA 3K1PA 1HW2A 3W6KB 1G3YA 2XGXA 4XSZF 2P5KA 3N4MA 2V1UA 1O3RA 1U8RA 1DUXC 4RB1A 2EV6A 1UB9A 2CWEA 1TNSA 3DFGA 1BI3A 3RDIA 2YSRA 1BC8C 4OIQF 3ABTA 3ZMVA 3FWEA 1H0MA 1ONVA 1P4AA 2EK5A 1KYWA 4IF4A 1IN6A 3BROA 2XV4S 3JTHA 2P8TA 4JQFA 3DQVC 1T6SA 3KLOA 1D8KA 2BYVE 2E7WA 2A69F 5E20A 2Y48A 2ESHA 3QU6A 3ZMZA 1V4RA 3GEZA 3TDUC 3FMRA 4HYEA 5FGMA 3S2WA 2MLKA 2FF4A 5LRRA 3BOQA 3JTGA 3F8MA 5AIQA 1TBXA 2A5YB 2L01A 2FA5A 3KP3A 3VODA 2PI0A 5F1RA 1IUYA 5EEGA 2V6CA 3LA7A 3WTZA 4HX4A 1P4WA 3DEUA 4XRFA 5ED4A 2VONA 1SMYF 3ECHA 1WWXA 2MBFA 2HKXA 4RS8A 1Y0UA 3SXYA 2Z3YA 4G7ZF 1JE8A 4WK8F 1MJ9A 3P9CA 2KKOA 4I02A 2Z5UA 5FD5A 1DPUA 4WXCA 1C0WA 4HDUA 2JSCA 2RV8A 3FXQA 3ML6A 5H20A 2IP2A 3C7JA 2LSOA 4L5JA 3ULQB 1I1SA 5DD8A 5J8CA 4IXAA 2Z99A 1B6AA 3NRVA 4DQ2A 2MLGA 2GIVA 2OQRA 2Q0OA 1HBXG 2EFOA 3FHZA 1RIOH 3KFWX 1MZBA 3COAC 4LMYA 5D5XB 3I59A 4P9UA 3BY6A 4BXUA 1L3LA 4U0WA 1P92A 1F5TA 3LFKA 3ROUA 2K02A 4HAMA 4OMZA 1UHMA 5D6FA 4UUVA 1UCRA 2YPRA 1HW5A 3OOPA 1TW2A 2BEOA 4HBLA 2AS5F 3Q9SA 1T39A 3WTUC 4EJVA 5LHHA 2O8XA 5TJJA 4LB5A 4A0YA 1WQ2A 1H9GA 1QGPA 1ZG5A 1X3UA 2HGCA 2OA4A 3E6DA 1HQCA 1ZG3A 2W25A 1G3SA 2EV5A 2ZNYA 2XASA 3HOTA 1V3FA 3K2ZA 2CYYA 2XHKA 4WWCA 3PQKA 2K86A 5K5RA 4ASNA 1G3TA 1J2XA 1RI7A 3LAJA 5JVTA 2MH2A 4GGGA 4ZZDA 1W7PB 2BV6A 2OD5A 2V1DA 4H0EA 2G7UA 2JPBA 3ELKA 3WODF 3NQOA 2A61A 1YS7A 4NQWA 3TOAA 2QBYB 3BDDA 2IA0A 1P6RA 3MZHA 1XDUA 5HVQC 5ICCA 5JHUA 5K1YA 1LDDA 3HTSB 2XAJA 4M6YA 1RNLA 2JT1A 3ZMUA 4WF2A 1IXCA 4KIGA 3JAMK 2QLZA 2YX7A 3GYHX 2QWWA 3RPQA 1FY7A 4GXOA 1HKSA 4RGUA 1FBUA 1SMTA 4L9VA 1O3SA 3CTAA 4ESFA 3KZZA 4HV5A 2WWYA 5L3DA 4P9FA 4ZZLA 4UVBA 4XLPF 1K6OA 3E5XA 2FQ3A 2GWRA 2NYXA 1D3YA 4UV8A 5L3BA 3P9IA 5KVRA 2HWVA 4IRHA 2H6BA 2XRNA 3O2PE 4A0ZA 4ENMA 1ZHFA 3K1NA 1FT9A 2IA1A 5IT9K 1U5TA 1T2KA 3EYIA 4LLGF 2Z9OA 4I09A 4RGRA 3V8KA 2AXLA 2OZUA 1ZREA 4G94A 2OU2A 2A3SA 3O3KA 4KICA 2GXBA 4EJTA 1LQ1A 1XSVA 5DEQA 4BH9A 4UHTA 1QNTA 1FZPB 4EM0B 4YG2F 4LLLA 3RIRA 1YYVA 2ZFWA 1PUEE 1PDNC 2DBBA 2VBYA 2M87A 4KIFA 2PJPA 3MFKA 4P96A 4LGWA 2ISZA 4AIHA 3V7SA 5BPDA 4N9IA 2R3SA 3OV8A 3I71A 4CYDA 3D5LA 1F4KA 1ZRDA 3IKVA 2ZNZA 2MH9A 4IRGA 2O61A 5DDGA 1IXSB 3ERED 4I0BA 2EA4A 2UXNA 3I4PA 4N9HA 4HX8A 3RI4A 3H3ZA 4A2UA 3CJNA 2P5VA 5HLIA 1I27A 3RKXA 4LJZF 1R23A 3E97A 3IWZA 3I59B 1HKTA 3QP6A 1G3WA 3R61A 3EQLF 3FM3A 2M1BA 4LLNA 5F64A 4KIBA 2L4AA 3CUOA 4D0PA 3J80Z 1YS6A 1E2XA 3QPHA 1R22A 4Q48A 3DF8A 2BBYA 4EM2A 3IHUA 4YIFA 1ODDA 2D1VA 4GCVA 2CW0F 4HQMA 4HQEA 2ZKZA 5LBQA 1G4DA 4OIRF 3F22A 3GX4X 2JPCA 2ADUA 3J80K 2E1NA 1S7AA 2K4JA 2HYFA 3F23A 5HLGA 2FMYA 3SQNA 5D5UB 1FSEA 1Z7UA 5ILVA 2VN2A 2CSOA 5LHIA 1B59A 1S3JA 2K27A 1STZA 2DI3A 2FNPA 2HR3A 1HXDA 3T0YA 2NAZA 2DU9A 5H6RA 4WX9A 2DO7A 5L3EA 5HDKA 1LDJA 1PP7U 5E17F 4ETSA 2F5FA 1S6LA 4OINF 2IRFG 1B4AA 2W24A 1DPRA 1FNNA 3KZYA 2XAHA 2FOKA 1YIOA 3DV8A 5LEKA 1J0RA 3C3WA 4M73A 1R36A 3WG9A 3E6MA 5BOXA 2ZJ2A 5BS6A 2NNYA 4MQVA 1B9MA 4ZYGA 2RVCA 1AOYA 2RNJA 1ZGJA 5LGUA 5EEHA 2G9WA 3KCCA 3LQQA 4KUMA 2ZMEA 5D8LB 2Y0MA 5FD6A 2HTJA 3GF2A 1XMKA 1L0OC 3BJ6A 2GZWA 4ZYHA 4EVIA 2PLYA 4GO1A 1U6GA 3F8CA 5ERIA 4Y13A 5E18F 1FYLA 1KU9A 2R7FA 2QENA 2DQRA 3HYIA 1YQAA 4MHGA 1BC7C 3J81Z 4IHSA 2IA2A 1Z6RA 2PG4A 5ILSA 2P7VB 4GYIA 4Z2YA 3FXUA 1FX7A 3HSRA 3I0TA 3GFJA 2PMHA 2UZKA 4PGHA 1QQIA 4L0YB 3FM5A 4G7OF 1SFUA 1OYYA 2GA2A 1O3TA 4O5VA 3Q5FA 2YU3A 5LLQA 1Z9CA 2EFQA 2W85A 1KU3A 4Q5SF 2J5PA 3FMQA 1XMAA 2A6EF 3BP8A 3TO9A 2IW5A 4DNCA 4KMFA 2XAQA 1FOKA 2QBYA 4BHPA 1TQPA 1B9NA 4U0YA 4IHTA 1OPCA 3GLXA 2HDCA 1W4MA 4MTEA 4JBAA 4Y17A 2VT2A 3P7NA 5ILUA 2VBXA 3WTWC 4RGXA 3HUGA 2FBHA 2BE5F 4WXHA 2VC0A 4HW0A 3PFIA 4OOIA 3LQRA 4KN7X 1D5VA 2BGCA 4LK1F 3I54A 4Y15A 2F5CA 3ZMTA 4HV6A 3E5QA 3VFZA 2TDXA 1R58A 5E8IA 3CDHA 4BNCA 1R1UA 2VT3A 2P6SA 5D8KB 2FE3A 1J5YA 4M72A 2QVOA 2CO5A 3LA2A 2DK5A 2PBIA 4CDGA 3M1EA 3F72A 4OIOF 2VBWA 3M7GA 2KJBA 2ZBKA 3BJAA 2H09A 4ZH4F 1RZ4A 4EJOA 4RB3C 5HOOA 2D45A 2RN7A 1A04A 4IJAA 4BAYA 4M74A 4CO8A 3QU3A 5DCMA 4RGSA 1MDMB 4M71A 5CVIA 4BQAA 4LD5A 1LB2A 5DCMB 2XUBA 5CVRA 1MDMA 1LJ9A 4A12A 4EV0A 4CXFA 1YLFA 3N97A 2PN6A 4BYYA 5LHGA 3WTYC 5K5OA 2H94A 4EJUA 1TW3A 1YW7A 2DLLA 3BWGA 2LKPA 1QZZA 4XLNF 1RUOA 2FXAA 1IN4A 2G7HA 2VOPA 3REOA 5D5WB 2LF8A 2JTVA 4A0XA 2Z33A 4EMSA 1XSDA 6PAXA 1KA8A 1XGOA 2WTEA 2F2EA 5A2QZ 1TTYA 2E1CA 4FHTA 1BM9A 1LNWA 3FMSA 4YIIA 4Q47A 1E17A 3EETA 1PP8F 4OU0A 1SD5A 4S05A 1U3EM 3J81K 1BOAA 3NEUA 2EA2A 2IPQX 2EFPA 3HRTA 1YW8A 3E6BA 2GXGA 2JZYA 2QQ9A 4R1HA 2W84A 4P5OA 3WGGA 3U1DA 1FP2A 5L3FA 5HS9A 4S04A 2VC1A 2HQNA 1J75A 3FZVA 2OBPA 3FXRA 4FT8A 3HOSA 4MQ9F 3G3ZA 2A6HF 2XAGA 4ENJA 1P4XA 5BQTA 2Q8KA 4G6DA 2XROA 3SHFA 2DAOA 4LFUA 1GXPA 3E3VA 2M30A 2ACJA 3CO6C 3QPTA 2FBKA 2PFBA 3LSTA 3T1BA 3T8RA 4M9ZA 1BBYA 2ZMEB 4KA4A 4RAZA 2VXZA 1FYMA 3IWFA 3U2RA 3IKTA 3IRQA 2EB7A 4ZYEA 1R00A 1T0FA 2IVMA 4M9SA 2COMA 3TDZC 1USSA 2QQBA 1EH7A 2EWNA 4HZFA 1LEBA 3QRFF 4MEYF 2FNAA 4L9TA 3BPVA 1FWZA 4L9NA 3M8EA 3DKWA 4HX7A 2JRTA 5E1XA 5AONA 1O7LA 3ZN1A 1XD7A 1DDNA 3HSEA 1Z1DA 3L00A 4R79A 2P7CB 1W5SA 1REPC 4BHBA 3DP7A 3TO6A 1U5TB 3WTVC 2QYOA 1O57A 1IXRC 3P9KA 3J7AO 3EYYA 4IRIA 3WTXC 4A6EA 3W6JB 5LEJA 3ZPLA 2PEXA 3KE2A 2FMLA 3L7WA 1DP7P 5D4SA 4QLCU 1Z6TA 4HOBA 5BMZA 1KU7A 4TV7A 5DUIA 1ZRCA 3FX3A 4MGRA 1QO0D 1B1BA 4N0BA 3F3XA 1KQ9A 2UWMA 1I1GA 2V9VA 2GQQA 3AAFA 4NHJA 1K7AA 1FYKA 4KT5C 5BPIA 2XKOA 3F6VA 3K69A 1LEAA 2HKOA 4FX0A 1G6NA 3KLNA 4G8XA 3GVAA 5TRDA 1OYWA 4HLXA 3DXJF 1OR7A 2Q2EA 3HIFA 3BJOA 2R7DA 2KRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZ5 A;  3F8N A;  1OYI A;  4L0Z B;  3TO7 A;  2GA1 A;  3KP4 A;  1MJB A;  1BN5 A;  4U0V A;  5FLX Z;  2FSW A;  4ENK A;  4WCG A;  4EQQ A;  1CGP A;  3TKY A;  3MCZ A;  5KK1 A;  3RPU A;  2H27 A;  4ESJ A;  5ICF A;  5IT9 Z;  2HYG D;  4KMU X;  2NNN A;  3SZT A;  4L18 B;  5K5Q A;  4UVA A;  2X4H A;  3KP6 A;  3PQJ A;  3BPX A;  4IPA A;  4A6D A;  5FLX K;  2OQG A;  4LG0 B;  1FC3 A;  3RYR A;  1IAW A;  1SFE A;  4MNU A;  1AWC A;  4KNY A;  1Z91 A;  3L09 A;  3V8L A;  4KYW A;  4M6X A;  5E8G A;  2XIG A;  4YFX F;  3ZMS A;  4E70 A;  2F5E A;  3BZ6 A;  1CF7 A;  4I2O A;  1F1Z A;  5LGN A;  1R7J A;  2STW A;  3R0J A;  4Q4Z F;  1JHF A;  2L3D A;  5DV5 A;  2V1X A;  2B0L A;  5E1Z B;  2C6Y A;  1K78 A;  2ISY A;  5ICG A;  1K78 B;  2MC3 A;  3E6C C;  2RC4 A;  4ON0 A;  1UST A;  2KIU A;  4K2E A;  2IT0 A;  1Q1H A;  1XGM A;  5CLS A;  2L4M A;  1SAX A;  5HDN A;  4CGZ A;  1FBS A;  2M5W A;  1BIB A;  1K79 A;  3F21 A;  3F8F A;  1GHC A;  3I53 A;  2NS0 A;  2J5O A;  4AIJ A;  1OKR A;  3RKW A;  1ZAR A;  3I5U A;  3VOE A;  3H92 A;  1HSJ A;  2VE9 A;  3HRM A;  4CHU A;  3CUQ B;  1ZN2 A;  3CUQ C;  2FBI A;  2HS5 A;  2DPD A;  5CVV A;  1IW7 F;  2PMU A;  1IN7 A;  4L5I A;  2VE8 A;  4A5N A;  4O3M A;  4AWX B;  2L54 A;  5D4R A;  5DUK A;  3RTR A;  3GUD A;  1EH8 A;  1SFX A;  1GVJ A;  3WU1 B;  2CG4 A;  1I5Z A;  3CO7 C;  1R5G A;  4ESB A;  5IT3 A;  3SFZ A;  4ENN A;  1W5T A;  3ZQ7 A;  4AIK A;  4UXN A;  5AIP A;  2LNB A;  5JR3 A;  2VBZ A;  3GFL A;  1FP1 D;  4U7B A;  4AVP A;  5D5V B;  4PCQ A;  2QM3 A;  3TOB A;  3T8T A;  3F8B A;  3M8F A;  1KYZ A;  3MWM A;  2D1H A;  5L3G A;  3D0S A;  3R4K A;  1XCV A;  2KIM A;  3GWZ A;  2ELH A;  2Y75 A;  2F5D A;  3ZP5 A;  3HRS A;  3R60 A;  4FX4 A;  1P2F A;  1ON1 A;  1YW9 A;  4F7Z A;  3ISP A;  1YTY A;  5DCF A;  3WTT C;  3QP5 A;  4OIP F;  2CGP A;  3K1M A;  4GYG A;  3B02 A;  3EDP A;  2EFN A;  4KDP A;  1IRG A;  1FLI A;  2A68 F;  1Z05 A;  4NB5 A;  3KP7 A;  3V7R A;  3KET A;  4G6Q A;  1SD4 A;  2P6T A;  3F6O A;  1W7P A;  3LA3 A;  2MA3 A;  2HTS A;  1UHW A;  4B8X A;  3O6B B;  3M9A A;  3I64 A;  1TQM A;  5JI6 A;  1XGN A;  3MQ0 A;  1ZLJ A;  1XCB A;  1MJA A;  4YFN F;  5H6Q A;  1U5T C;  2RQP A;  2X0L A;  1LDK B;  3WE3 A;  3FF5 A;  2LDU A;  2UXX A;  3JW4 A;  3MEX A;  5FFZ A;  2P5L C;  3EUH A;  5F6F A;  4CIC A;  4MTD A;  3E5U A;  1JXS A;  2QQA A;  2RDP A;  4HDV A;  4HF2 A;  1FPQ A;  1O3Q A;  1JHH A;  3RYP A;  2YR2 A;  5J6X A;  4G7H F;  2VOD A;  1XN7 A;  2DPU A;  1D8J A;  4HF1 A;  3B73 A;  5CVU A;  3HHG A;  2HOE A;  2RKH A;  3DPL C;  2FRH A;  2DFI A;  4EJW A;  1T98 A;  1KQ0 A;  1CF7 B;  3KP2 A;  3JSO A;  1HW1 A;  1R1T A;  2W57 A;  1KQ8 A;  5HDG A;  1SD6 A;  1J9I A;  1S29 A;  3MZY A;  1HST A;  1IF1 A;  4P55 A;  3ABU A;  4UV9 A;  1TQI A;  1BI0 A;  2EJR A;  3TGN A;  4OMY A;  1BI1 A;  5CVJ A;  4EGY A;  4PZJ A;  2ZCW A;  4G9Y A;  3IRR A;  4CZZ A;  2LF7 A;  3RKY A;  4UNO A;  1R1V A;  1FBQ A;  3T5X A;  3C18 A;  4HLY A;  1GXQ A;  2XAF A;  1I6X A;  2O3F A;  3R6S A;  1IN5 A;  5CJ9 A;  4EM1 A;  2VOO A;  1JGS A;  1BJA A;  2CQK A;  1F9N A;  3GO5 A;  4JK1 X;  4U7D A;  1XB4 A;  1XGS A;  2M45 A;  1YG2 A;  1QBJ A;  1IRF A;  2EV0 A;  3DPT A;  1IN8 A;  3CUQ A;  4XBF A;  3GZ6 A;  2A07 F;  4R8H A;  2PQ8 A;  2HQR A;  1T38 A;  3JAM Z;  3GW2 A;  2NRA C;  1LVA A;  3QOP A;  4O6J A;  2DQL A;  4HF0 A;  4LG0 A;  1HKQ A;  2WV0 A;  5FO5 A;  3ZN0 A;  2L02 A;  3VB2 A;  1ZYR F;  4ZYD A;  4I0A A;  3K0L A;  3HTU A;  1ZAO A;  1MGT A;  2FEZ A;  1WSU A;  5HS8 A;  5FB2 A;  2XKP A;  1J59 A;  1OMI A;  1VTN C;  1EH6 A;  3HSF A;  4XSX F;  2YX4 A;  1W7P D;  3Q9V A;  2E7X A;  4BHC A;  1H9T A;  1FSH A;  1EV7 A;  2P4W A;  5D6E A;  3K9T A;  3I58 A;  4IVN A;  4I01 A;  4AD9 A;  4B09 A;  5HLH A;  2RGV A;  2FU4 A;  2OAZ A;  3ECO A;  4A5M A;  1KGS A;  3LWF A;  5L3C A;  2M8E A;  3QAH A;  4L9J A;  2IJL A;  4PDK A;  2DTR A;  3WE2 A;  3WTS C;  2HFH A;  3SZP A;  3G73 A;  3ZMD A;  1XSX A;  1TLH B;  1XDS A;  2HZT A;  4UVC A;  2XVC A;  4EGZ A;  3V8J A;  1BI2 A;  2H6C A;  1MD0 A;  3WGI A;  4RB0 A;  1KU2 A;  1BIA A;  2GAU A;  4YFK F;  5E1W A;  5DYM A;  4U88 A;  2ETH A;  1SD7 A;  3L9F A;  3VEP A;  2V79 A;  4M9X A;  2STT A;  4RB2 C;  1WRJ A;  4MEX F;  2K4B A;  2O0Y A;  3GXO A;  3H3U A;  1QPM A;  1IZ1 A;  5A2Q K;  3R0A A;  1ZGA A;  5FFX A;  5CYV A;  4KFC A;  3GFI A;  4WXD A;  2QZ8 A;  3KEO A;  1UFM A;  2QUF A;  5LGT A;  3U9G A;  1ZRF A;  5LRS A;  2O6G E;  5J8F A;  4LK0 F;  2DK8 A;  2OZ6 A;  1YFH A;  2EFW A;  3MAJ A;  2CFX A;  2DW4 A;  1MKM A;  2ZO4 A;  1TNT A;  1ULY A;  5ICE A;  2ZXJ A;  3WU0 A;  1O7F A;  4I7H A;  3IL2 A;  3RJP A;  3CLO A;  3IC7 A;  1ZG1 A;  2KIF A;  3KP5 A;  1R5H A;  1ZLK A;  1ZH5 A;  2HEO A;  3C1D A;  1YO5 C;  2K7L A;  1WKM A;  1NHA A;  2O03 A;  4PGG A;  5HS7 A;  1S8N A;  2DT5 A;  3HHH A;  3TQN A;  1J7K A;  2D2W A;  4RAY A;  3WGH A;  1U78 A;  5DD4 A;  1RUN A;  1U2W A;  4HA8 A;  1ON2 A;  2MD5 A;  3V4G A;  3GFM A;  2ESN A;  2WC2 A;  4LB6 B;  4KN4 X;  3L2C A;  1WI9 A;  2KJC A;  4I98 B;  3V7C A;  3LAP A;  4QWQ A;  5JFR A;  3JSP A;  1S7O A;  3HRU A;  3KEQ A;  1QZY A;  3K1P A;  1HW2 A;  3W6K B;  1G3Y A;  2XGX A;  4XSZ F;  2P5K A;  3N4M A;  2V1U A;  1O3R A;  1U8R A;  1DUX C;  4RB1 A;  2EV6 A;  1UB9 A;  2CWE A;  1TNS A;  3DFG A;  1BI3 A;  3RDI A;  2YSR A;  1BC8 C;  4OIQ F;  3ABT A;  3ZMV A;  3FWE A;  1H0M A;  1ONV A;  1P4A A;  2EK5 A;  1KYW A;  4IF4 A;  1IN6 A;  3BRO A;  2XV4 S;  3JTH A;  2P8T A;  4JQF A;  3DQV C;  1T6S A;  3KLO A;  1D8K A;  2BYV E;  2E7W A;  2A69 F;  5E20 A;  2Y48 A;  2ESH A;  3QU6 A;  3ZMZ A;  1V4R A;  3GEZ A;  3TDU C;  3FMR A;  4HYE A;  5FGM A;  3S2W A;  2MLK A;  2FF4 A;  5LRR A;  3BOQ A;  3JTG A;  3F8M A;  5AIQ A;  1TBX A;  2A5Y B;  2L01 A;  2FA5 A;  3KP3 A;  3VOD A;  2PI0 A;  5F1R A;  1IUY A;  5EEG A;  2V6C A;  3LA7 A;  3WTZ A;  4HX4 A;  1P4W A;  3DEU A;  4XRF A;  5ED4 A;  2VON A;  1SMY F;  3ECH A;  1WWX A;  2MBF A;  2HKX A;  4RS8 A;  1Y0U A;  3SXY A;  2Z3Y A;  4G7Z F;  1JE8 A;  4WK8 F;  1MJ9 A;  3P9C A;  2KKO A;  4I02 A;  2Z5U A;  5FD5 A;  1DPU A;  4WXC A;  1C0W A;  4HDU A;  2JSC A;  2RV8 A;  3FXQ A;  3ML6 A;  5H20 A;  2IP2 A;  3C7J A;  2LSO A;  4L5J A;  3ULQ B;  1I1S A;  5DD8 A;  5J8C A;  4IXA A;  2Z99 A;  1B6A A;  3NRV A;  4DQ2 A;  2MLG A;  2GIV A;  2OQR A;  2Q0O A;  1HBX G;  2EFO A;  3FHZ A;  1RIO H;  3KFW X;  1MZB A;  3COA C;  4LMY A;  5D5X B;  3I59 A;  4P9U A;  3BY6 A;  4BXU A;  1L3L A;  4U0W A;  1P92 A;  1F5T A;  3LFK A;  3ROU A;  2K02 A;  4HAM A;  4OMZ A;  1UHM A;  5D6F A;  4UUV A;  1UCR A;  2YPR A;  1HW5 A;  3OOP A;  1TW2 A;  2BEO A;  4HBL A;  2AS5 F;  3Q9S A;  1T39 A;  3WTU C;  4EJV A;  5LHH A;  2O8X A;  5TJJ A;  4LB5 A;  4A0Y A;  1WQ2 A;  1H9G A;  1QGP A;  1ZG5 A;  1X3U A;  2HGC A;  2OA4 A;  3E6D A;  1HQC A;  1ZG3 A;  2W25 A;  1G3S A;  2EV5 A;  2ZNY A;  2XAS A;  3HOT A;  1V3F A;  3K2Z A;  2CYY A;  2XHK A;  4WWC A;  3PQK A;  2K86 A;  5K5R A;  4ASN A;  1G3T A;  1J2X A;  1RI7 A;  3LAJ A;  5JVT A;  2MH2 A;  4GGG A;  4ZZD A;  1W7P B;  2BV6 A;  2OD5 A;  2V1D A;  4H0E A;  2G7U A;  2JPB A;  3ELK A;  3WOD F;  3NQO A;  2A61 A;  1YS7 A;  4NQW A;  3TOA A;  2QBY B;  3BDD A;  2IA0 A;  1P6R A;  3MZH A;  1XDU A;  5HVQ C;  5ICC A;  5JHU A;  5K1Y A;  1LDD A;  3HTS B;  2XAJ A;  4M6Y A;  1RNL A;  2JT1 A;  3ZMU A;  4WF2 A;  1IXC A;  4KIG A;  3JAM K;  2QLZ A;  2YX7 A;  3GYH X;  2QWW A;  3RPQ A;  1FY7 A;  4GXO A;  1HKS A;  4RGU A;  1FBU A;  1SMT A;  4L9V A;  1O3S A;  3CTA A;  4ESF A;  3KZZ A;  4HV5 A;  2WWY A;  5L3D A;  4P9F A;  4ZZL A;  4UVB A;  4XLP F;  1K6O A;  3E5X A;  2FQ3 A;  2GWR A;  2NYX A;  1D3Y A;  4UV8 A;  5L3B A;  3P9I A;  5KVR A;  2HWV A;  4IRH A;  2H6B A;  2XRN A;  3O2P E;  4A0Z A;  4ENM A;  1ZHF A;  3K1N A;  1FT9 A;  2IA1 A;  5IT9 K;  1U5T A;  1T2K A;  3EYI A;  4LLG F;  2Z9O A;  4I09 A;  4RGR A;  3V8K A;  2AXL A;  2OZU A;  1ZRE A;  4G94 A;  2OU2 A;  2A3S A;  3O3K A;  4KIC A;  2GXB A;  4EJT A;  1LQ1 A;  1XSV A;  5DEQ A;  4BH9 A;  4UHT A;  1QNT A;  1FZP B;  4EM0 B;  4YG2 F;  4LLL A;  3RIR A;  1YYV A;  2ZFW A;  1PUE E;  1PDN C;  2DBB A;  2VBY A;  2M87 A;  4KIF A;  2PJP A;  3MFK A;  4P96 A;  4LGW A;  2ISZ A;  4AIH A;  3V7S A;  5BPD A;  4N9I A;  2R3S A;  3OV8 A;  3I71 A;  4CYD A;  3D5L A;  1F4K A;  1ZRD A;  3IKV A;  2ZNZ A;  2MH9 A;  4IRG A;  2O61 A;  5DDG A;  1IXS B;  3ERE D;  4I0B A;  2EA4 A;  2UXN A;  3I4P A;  4N9H A;  4HX8 A;  3RI4 A;  3H3Z A;  4A2U A;  3CJN A;  2P5V A;  5HLI A;  1I27 A;  3RKX A;  4LJZ F;  1R23 A;  3E97 A;  3IWZ A;  3I59 B;  1HKT A;  3QP6 A;  1G3W A;  3R61 A;  3EQL F;  3FM3 A;  2M1B A;  4LLN A;  5F64 A;  4KIB A;  2L4A A;  3CUO A;  4D0P A;  3J80 Z;  1YS6 A;  1E2X A;  3QPH A;  1R22 A;  4Q48 A;  3DF8 A;  2BBY A;  4EM2 A;  3IHU A;  4YIF A;  1ODD A;  2D1V A;  4GCV A;  2CW0 F;  4HQM A;  4HQE A;  2ZKZ A;  5LBQ A;  1G4D A;  4OIR F;  3F22 A;  3GX4 X;  2JPC A;  2ADU A;  3J80 K;  2E1N A;  1S7A A;  2K4J A;  2HYF A;  3F23 A;  5HLG A;  2FMY A;  3SQN A;  5D5U B;  1FSE A;  1Z7U A;  5ILV A;  2VN2 A;  2CSO A;  5LHI A;  1B59 A;  1S3J A;  2K27 A;  1STZ A;  2DI3 A;  2FNP A;  2HR3 A;  1HXD A;  3T0Y A;  2NAZ A;  2DU9 A;  5H6R A;  4WX9 A;  2DO7 A;  5L3E A;  5HDK A;  1LDJ A;  1PP7 U;  5E17 F;  4ETS A;  2F5F A;  1S6L A;  4OIN F;  2IRF G;  1B4A A;  2W24 A;  1DPR A;  1FNN A;  3KZY A;  2XAH A;  2FOK A;  1YIO A;  3DV8 A;  5LEK A;  1J0R A;  3C3W A;  4M73 A;  1R36 A;  3WG9 A;  3E6M A;  5BOX A;  2ZJ2 A;  5BS6 A;  2NNY A;  4MQV A;  1B9M A;  4ZYG A;  2RVC A;  1AOY A;  2RNJ A;  1ZGJ A;  5LGU A;  5EEH A;  2G9W A;  3KCC A;  3LQQ A;  4KUM A;  2ZME A;  5D8L B;  2Y0M A;  5FD6 A;  2HTJ A;  3GF2 A;  1XMK A;  1L0O C;  3BJ6 A;  2GZW A;  4ZYH A;  4EVI A;  2PLY A;  4GO1 A;  1U6G A;  3F8C A;  5ERI A;  4Y13 A;  5E18 F;  1FYL A;  1KU9 A;  2R7F A;  2QEN A;  2DQR A;  3HYI A;  1YQA A;  4MHG A;  1BC7 C;  3J81 Z;  4IHS A;  2IA2 A;  1Z6R A;  2PG4 A;  5ILS A;  2P7V B;  4GYI A;  4Z2Y A;  3FXU A;  1FX7 A;  3HSR A;  3I0T A;  3GFJ A;  2PMH A;  2UZK A;  4PGH A;  1QQI A;  4L0Y B;  3FM5 A;  4G7O F;  1SFU A;  1OYY A;  2GA2 A;  1O3T A;  4O5V A;  3Q5F A;  2YU3 A;  5LLQ A;  1Z9C A;  2EFQ A;  2W85 A;  1KU3 A;  4Q5S F;  2J5P A;  3FMQ A;  1XMA A;  2A6E F;  3BP8 A;  3TO9 A;  2IW5 A;  4DNC A;  4KMF A;  2XAQ A;  1FOK A;  2QBY A;  4BHP A;  1TQP A;  1B9N A;  4U0Y A;  4IHT A;  1OPC A;  3GLX A;  2HDC A;  1W4M A;  4MTE A;  4JBA A;  4Y17 A;  2VT2 A;  3P7N A;  5ILU A;  2VBX A;  3WTW C;  4RGX A;  3HUG A;  2FBH A;  2BE5 F;  4WXH A;  2VC0 A;  4HW0 A;  3PFI A;  4OOI A;  3LQR A;  4KN7 X;  1D5V A;  2BGC A;  4LK1 F;  3I54 A;  4Y15 A;  2F5C A;  3ZMT A;  4HV6 A;  3E5Q A;  3VFZ A;  2TDX A;  1R58 A;  5E8I A;  3CDH A;  4BNC A;  1R1U A;  2VT3 A;  2P6S A;  5D8K B;  2FE3 A;  1J5Y A;  4M72 A;  2QVO A;  2CO5 A;  3LA2 A;  2DK5 A;  2PBI A;  4CDG A;  3M1E A;  3F72 A;  4OIO F;  2VBW A;  3M7G A;  2KJB A;  2ZBK A;  3BJA A;  2H09 A;  4ZH4 F;  1RZ4 A;  4EJO A;  4RB3 C;  5HOO A;  2D45 A;  2RN7 A;  1A04 A;  4IJA A;  4BAY A;  4M74 A;  4CO8 A;  3QU3 A;  5DCM A;  4RGS A;  1MDM B;  4M71 A;  5CVI A;  4BQA A;  4LD5 A;  1LB2 A;  5DCM B;  2XUB A;  5CVR A;  1MDM A;  1LJ9 A;  4A12 A;  4EV0 A;  4CXF A;  1YLF A;  3N97 A;  2PN6 A;  4BYY A;  5LHG A;  3WTY C;  5K5O A;  2H94 A;  4EJU A;  1TW3 A;  1YW7 A;  2DLL A;  3BWG A;  2LKP A;  1QZZ A;  4XLN F;  1RUO A;  2FXA A;  1IN4 A;  2G7H A;  2VOP A;  3REO A;  5D5W B;  2LF8 A;  2JTV A;  4A0X A;  2Z33 A;  4EMS A;  1XSD A;  6PAX A;  1KA8 A;  1XGO A;  2WTE A;  2F2E A;  5A2Q Z;  1TTY A;  2E1C A;  4FHT A;  1BM9 A;  1LNW A;  3FMS A;  4YII A;  4Q47 A;  1E17 A;  3EET A;  1PP8 F;  4OU0 A;  1SD5 A;  4S05 A;  1U3E M;  3J81 K;  1BOA A;  3NEU A;  2EA2 A;  2IPQ X;  2EFP A;  3HRT A;  1YW8 A;  3E6B A;  2GXG A;  2JZY A;  2QQ9 A;  4R1H A;  2W84 A;  4P5O A;  3WGG A;  3U1D A;  1FP2 A;  5L3F A;  5HS9 A;  4S04 A;  2VC1 A;  2HQN A;  1J75 A;  3FZV A;  2OBP A;  3FXR A;  4FT8 A;  3HOS A;  4MQ9 F;  3G3Z A;  2A6H F;  2XAG A;  4ENJ A;  1P4X A;  5BQT A;  2Q8K A;  4G6D A;  2XRO A;  3SHF A;  2DAO A;  4LFU A;  1GXP A;  3E3V A;  2M30 A;  2ACJ A;  3CO6 C;  3QPT A;  2FBK A;  2PFB A;  3LST A;  3T1B A;  3T8R A;  4M9Z A;  1BBY A;  2ZME B;  4KA4 A;  4RAZ A;  2VXZ A;  1FYM A;  3IWF A;  3U2R A;  3IKT A;  3IRQ A;  2EB7 A;  4ZYE A;  1R00 A;  1T0F A;  2IVM A;  4M9S A;  2COM A;  3TDZ C;  1USS A;  2QQB A;  1EH7 A;  2EWN A;  4HZF A;  1LEB A;  3QRF F;  4MEY F;  2FNA A;  4L9T A;  3BPV A;  1FWZ A;  4L9N A;  3M8E A;  3DKW A;  4HX7 A;  2JRT A;  5E1X A;  5AON A;  1O7L A;  3ZN1 A;  1XD7 A;  1DDN A;  3HSE A;  1Z1D A;  3L00 A;  4R79 A;  2P7C B;  1W5S A;  1REP C;  4BHB A;  3DP7 A;  3TO6 A;  1U5T B;  3WTV C;  2QYO A;  1O57 A;  1IXR C;  3P9K A;  3J7A O;  3EYY A;  4IRI A;  3WTX C;  4A6E A;  3W6J B;  5LEJ A;  3ZPL A;  2PEX A;  3KE2 A;  2FML A;  3L7W A;  1DP7 P;  5D4S A;  4QLC U;  1Z6T A;  4HOB A;  5BMZ A;  1KU7 A;  4TV7 A;  5DUI A;  1ZRC A;  3FX3 A;  4MGR A;  1QO0 D;  1B1B A;  4N0B A;  3F3X A;  1KQ9 A;  2UWM A;  1I1G A;  2V9V A;  2GQQ A;  3AAF A;  4NHJ A;  1K7A A;  1FYK A;  4KT5 C;  5BPI A;  2XKO A;  3F6V A;  3K69 A;  1LEA A;  2HKO A;  4FX0 A;  1G6N A;  3KLN A;  4G8X A;  3GVA A;  5TRD A;  1OYW A;  4HLX A;  3DXJ F;  1OR7 A;  2Q2E A;  3HIF A;  3BJO A;  2R7D A;  2KRF A; 
#chains in the Genus database with same CATH topology
 3SZG A;  3GZ5 A;  3CCJ I;  3F8N A;  1OYI A;  4L0Z B;  2JWT A;  3TO7 A;  2DTZ A;  2GA1 A;  5IP9 J;  4S0H B;  3KP4 A;  4OAY A;  4QIW N;  3ZQL A;  3FBN B;  3TED A;  1MJB A;  1BN5 A;  3HM5 A;  4C9Y A;  5EF6 A;  4U0V A;  2LRD A;  5FLX Z;  2FSW A;  4ENK A;  4WCG A;  2CRG A;  4EQQ A;  2W7N A;  3TKY A;  2WV1 A;  4J00 A;  1CGP A;  3MCZ A;  5KK1 A;  3TL4 X;  3OS1 A;  5M5Y J;  1AHD P;  1Y1W J;  3RPU A;  2H27 A;  4ESJ A;  5ICF A;  5KAI C;  3L2V A;  5IT9 Z;  2KMU A;  4NUB A;  2HYG D;  4KMU X;  2NNN A;  3SZT A;  4L18 B;  5K5Q A;  4UVA A;  1GT0 C;  2WAQ A;  2X4H A;  4NC8 A;  2AQF A;  3KP6 A;  3PQJ A;  3BPX A;  4IPA A;  2EH3 A;  3EUA A;  4A6D A;  2OCC H;  5FLX K;  2LG4 A;  5FKN A;  2OQG A;  1DQU A;  4LG0 B;  1FC3 A;  3RYR A;  4DYC A;  1IAW A;  1SFE A;  2DOF A;  4GFB A;  4MNU A;  3I4N J;  1AWC A;  4DZJ A;  4E7I A;  4KNY A;  2BY1 A;  2R7S A;  3ESW B;  1Z91 A;  3KYC B;  5IYB J;  3IV5 A;  4XLC A;  1HF0 A;  4X6A J;  3L09 A;  3V8L A;  4KYW A;  2MFZ A;  2IGO A;  4M6X A;  2BVL A;  2TRT A;  5E8G A;  2XIG A;  4YFX F;  3ZMS A;  2CU7 A;  4E70 A;  5FRM A;  1KZH A;  4A3C J;  2F5E A;  4FE4 A;  3BZ6 A;  1CF7 A;  3ZQF A;  4FCY A;  4I2O A;  1F1Z A;  5LGN A;  3MMY B;  1R7J A;  1SAN A;  3IH2 A;  3E1S A;  2STW A;  3R0J A;  4UY8 I;  4Q4Z F;  1JHF A;  3UKG A;  2L3D A;  5DV5 A;  2V1X A;  3ZQQ A;  3VYU B;  2B0L A;  2K85 A;  1X3W B;  5E1Z B;  2DA6 A;  1K78 A;  2C6Y A;  3GBG A;  1HCR A;  2ISY A;  1ETQ A;  5ICG A;  1K78 B;  3JRF A;  2BW3 B;  2MC3 A;  3OMY A;  1PVE A;  2RC4 A;  2L5Q A;  3E6C C;  4ON0 A;  1UST A;  2KIU A;  4PFO A;  1FOW A;  4ZTF A;  3L2U A;  4K2E A;  5IOY A;  3IH4 A;  2X6W A;  2IT0 A;  1X2N A;  4B3X A;  2B7E A;  1Q1H A;  1XGM A;  4XOT A;  5CLS A;  2L4M A;  1SAX A;  5F1J A;  5HDN A;  4CGZ A;  1FBS A;  2M5W A;  1BIB A;  2EPF A;  1K79 A;  3JRC A;  3L1P A;  3F21 A;  3F8F A;  1GHC A;  3JR9 A;  3KX2 A;  3LL7 A;  1T0F C;  3LNQ A;  4Y52 J;  2F48 A;  3I53 A;  4L5E A;  2ZXH A;  2NS0 A;  2J5O A;  5BNG A;  4AIJ A;  1OKR A;  4F3Q A;  3RKW A;  3AG4 H;  1U9N A;  3C2H A;  5KNL A;  3PJR A;  3QPL A;  1ZAR A;  3I5U A;  2RAE A;  4ZDL A;  2HOA A;  3VOE A;  3ONQ A;  3H92 A;  4CYC B;  1ZK8 A;  2PJR B;  1IV6 A;  1HSJ A;  2VE9 A;  1TZL A;  2QEX I;  3HRM A;  5IYD J;  3RKQ A;  4CHU A;  2V6E A;  3CUQ B;  1WJD A;  1ZN2 A;  3CUQ C;  2IS4 A;  5EG0 A;  1ZGW A;  2FBI A;  2HS5 A;  1J09 A;  3RQI A;  1VQL I;  2DPD A;  5CVV A;  1IW7 F;  3LSR A;  1YJN I;  5EG0 B;  2PMU A;  4KT6 A;  1YIJ I;  1I39 A;  1IN7 A;  2IEK A;  4L5I A;  1NK3 P;  2XPV A;  2VE8 A;  3LSJ A;  2EZH A;  4RAG A;  5CKT A;  4A5N A;  3OY9 A;  4O3M A;  4AWX B;  2L54 A;  5D4R A;  1UHS A;  5DUK A;  3RTR A;  5B5E C;  3GUD A;  5JVG F;  1EH8 A;  1SFX A;  4BJ6 C;  1GVJ A;  3WU1 B;  2MW8 A;  2CG4 A;  1I5Z A;  3CO7 C;  2P0W A;  3GCM A;  1R5G A;  4ESB A;  5IT3 A;  3SFZ A;  3CCE I;  4ENN A;  1W5T A;  3GTL J;  3ZQ7 A;  4AIK A;  1P7J A;  4UXN A;  5AIP A;  2LNB A;  4FAS D;  5JR3 A;  2VBZ A;  3GFL A;  1SFO J;  1FP1 D;  1T8I A;  1APL C;  4E7Z A;  3C2G A;  2EQR A;  4U7B A;  4AVP A;  2M4K A;  2KIS A;  3FIW A;  4AM3 A;  2LBF A;  3OYA A;  5EJC A;  1VQN I;  2VLA A;  1JUP A;  1B72 A;  5D5V B;  4PCQ A;  2QM3 A;  3TOB A;  2EIM H;  3A4C A;  3T8T A;  2ZB9 A;  1CQT A;  4AYB N;  3OSG A;  2DOE A;  3F8B A;  4CCM A;  3M8F A;  1JKQ C;  1KYZ A;  2WBM A;  2EIL H;  1WCM J;  3DTE A;  2HPM A;  3MWM A;  2QSH X;  2D1H A;  2WAQ N;  3PO3 J;  4HSR A;  1OCP A;  3D0S A;  5L3G A;  2KRH A;  3R4K A;  1XCV A;  2KIM A;  3OYF A;  3GWZ A;  1YRN B;  1Y56 A;  2IS1 A;  1YRN A;  2ELH A;  4BL0 B;  2Y75 A;  1GV2 A;  2M3A A;  2F5D A;  2MD0 A;  3L2Q A;  2NXN B;  3ZP5 A;  1OCR H;  1TWC J;  1NG6 A;  3ZR8 X;  3HRS A;  3R60 A;  4FX4 A;  2ID6 A;  2V9K A;  4HNT A;  1P2F A;  2H8W A;  1ON1 A;  3H0D A;  1YW9 A;  2WY7 Q;  4F7Z A;  4A3G J;  3LSG A;  4UUT A;  3ISP A;  1B8I B;  1YTY A;  5DCF A;  5EYR A;  3WTT C;  3QP5 A;  1B8I A;  4OIP F;  2CGP A;  3K1M A;  5F27 A;  2LY9 A;  2BXZ A;  1Z0X A;  4GYG A;  3B02 A;  1N75 A;  3EDP A;  1S7E A;  2EFN A;  5CQE A;  1R71 A;  4KDP A;  1IRG A;  1FLI A;  2A68 F;  4H4K C;  1Z05 A;  4B43 A;  4NB5 A;  3KP7 A;  2LY2 A;  1LPQ A;  4CCO A;  2CJJ A;  3K4K A;  1T33 A;  1WJF A;  3V7R A;  3KET A;  4M6V A;  2DDB A;  4Y3O A;  4G6Q A;  1SD4 A;  3OYL A;  2P6T A;  3F6O A;  4ZYA A;  4UUS B;  4RMN A;  1W7P A;  2FOW A;  3LA3 A;  2X51 A;  4DOZ A;  2HDD A;  4UUS A;  1FEX A;  2MA3 A;  3ZQC A;  3SFI A;  2KRC A;  2HTS A;  1UHW A;  4B8X A;  3O6B B;  3M9A A;  1FMV A;  1MMN A;  1T95 A;  1W5C C;  3I64 A;  1TQM A;  4HEA 2;  2R5Z A;  5JI6 A;  1SFK A;  1XGN A;  3MQ0 A;  3VSL A;  1ZLJ A;  5C4J J;  1XCB A;  5EDN A;  1A5J A;  1MJA A;  4YFN F;  5H6Q A;  1U5T C;  3FXJ A;  3PSF A;  1W36 D;  2RQP A;  2X0L A;  2K3F A;  4UB6 C;  2QSG X;  1LDK B;  3WE3 A;  3FF5 A;  2COB A;  3A03 A;  3GME A;  2LDU A;  4C2U A;  2UXX A;  3BG7 A;  3S2D J;  3AG2 H;  1BOB A;  2XB5 A;  3JW4 A;  3MEX A;  5FFZ A;  1Q1V A;  2P5L C;  1XPX A;  3I55 I;  3EUH A;  3H36 A;  5F6F A;  2ECC A;  4XOP A;  4CIC A;  3A02 A;  4MTD A;  2E5Z A;  3E5U A;  2QQA A;  1FJL A;  1JXS A;  2RDP A;  4HDV A;  4HF2 A;  1FPQ A;  4XKV A;  3VPR A;  1O3Q A;  1Y8Q B;  1JGG A;  1JHH A;  4ZDP A;  4IQ4 A;  3RYP A;  2YR2 A;  5J6X A;  2EBI A;  4G7H F;  2VOD A;  1GV5 A;  1XN7 A;  2DPU A;  1D8J A;  4HF1 A;  2R5Y A;  2LTP A;  5GTH C;  3BCA A;  3B73 A;  3EUK L;  1ORK A;  4XLH A;  5CVU A;  2M34 A;  3HHG A;  1X4P A;  2HOE A;  2RKH A;  3BR5 A;  3DPL C;  1V5F A;  2DFI A;  2CUJ A;  1W1W E;  1T98 A;  2FRH A;  2HQA A;  4EJW A;  4J01 A;  9ANT A;  1KQ0 A;  1CF7 B;  3KP2 A;  3JSO A;  5E3M A;  3IUO A;  1HW1 A;  1R1T A;  2W57 A;  4HRI A;  1KQ8 A;  5HDG A;  1UMQ A;  4AVZ A;  1VQ8 I;  3S17 J;  1SVO A;  1SD6 A;  1IV8 A;  3BG9 A;  1K83 J;  1J9I A;  1S29 A;  2AQE A;  1BJZ A;  4B44 A;  4HPQ A;  3MZY A;  5M5X J;  2E35 A;  1HST A;  1IF1 A;  4P55 A;  1QVU A;  3ABU A;  4UV9 A;  1TQI A;  2BHY A;  1AKH A;  5EGO B;  1BI0 A;  3BQY A;  1TWG J;  2EJR A;  4F93 B;  3TGN A;  4PJL A;  3ABK H;  3QYE A;  3HPH A;  2OCE A;  5FKK A;  4OMY A;  1BI1 A;  5CVJ A;  4EGY A;  2IGK A;  1ETW A;  2R0Q C;  2CV1 A;  4PZJ A;  1XG1 A;  2BW3 A;  2ZCW A;  1JTX A;  2EIN H;  1IGN A;  4G9Y A;  4DGW B;  2A05 A;  1VQ7 I;  3IRR A;  4CZZ A;  2LF7 A;  3RKY A;  4UNO A;  1R1V A;  1FBQ A;  2H8R A;  1X58 A;  1FTT A;  1MBJ A;  3T5X A;  4A3M J;  1XX5 A;  2ZME C;  3C18 A;  4HLY A;  2WB1 A;  3JRI A;  3LMM A;  4BE2 A;  1UG2 A;  1GXQ A;  1YX3 A;  2ZJQ F;  3S15 J;  2GM4 A;  1LFP A;  2XAF A;  1I6X A;  3BT9 A;  2O3F A;  2JA5 J;  3R6S A;  1IN5 A;  5CJ9 A;  4EM1 A;  4IL6 C;  5EZH A;  2VOO A;  1JGS A;  1BJA A;  1JTY A;  2CQK A;  1F9N A;  5FJ8 J;  3GO5 A;  3H9J A;  3OL3 A;  4JK1 X;  4U7D A;  2LD5 A;  1ENH A;  1XB4 A;  1XGS A;  4F91 B;  2M45 A;  1YG2 A;  3K6G A;  1QBJ A;  4EAT A;  1SVM A;  1HLV A;  1IRF A;  2EV0 A;  5DTD A;  3DPT A;  2W00 A;  4MO7 A;  2OUM A;  1WVR A;  4XON A;  1IN8 A;  3CUQ A;  4XBF A;  3GZ6 A;  1UZC A;  2A07 F;  4R8H A;  2QKL B;  2VKE A;  3HOV J;  3K4N A;  3FK7 A;  3CME I;  2PQ8 A;  1QU3 A;  2JK3 A;  5FKL A;  2QSF X;  2HQR A;  3CP8 A;  1T38 A;  5KCM A;  2JQ7 A;  3BR6 A;  5J3L A;  3JAM Z;  4CSW A;  2LR8 A;  4RLF A;  3GW2 A;  3ZRG A;  1LVK A;  2NRA C;  2VUM J;  1LVA A;  1QPI A;  3QOP A;  4O6J A;  2DQL A;  4HF0 A;  3CMA I;  4LG0 A;  2DA7 A;  1HKQ A;  2WV0 A;  1N78 A;  1BR2 A;  5FO5 A;  2LKX A;  3ZN0 A;  2L02 A;  3VB2 A;  2B63 J;  1ZYR F;  5GP9 A;  1X19 A;  3ZGK A;  4ZYD A;  4I0A A;  2DMQ A;  3K0L A;  4IX7 A;  1D0X A;  3G1L A;  2BY2 A;  2UUZ A;  3HTU A;  1Y39 A;  1ZAO A;  1MGT A;  2FEZ A;  3DLA A;  1WSU A;  5HS8 A;  5FB2 A;  2XKP A;  4QTR A;  2K9Q A;  1J59 A;  1OMI A;  1VTN C;  1A35 A;  1EH6 A;  2FUG 2;  3HSF A;  4XSX F;  1H89 C;  2YX4 A;  1W7P D;  4DBQ A;  3Q9V A;  4Z6Y A;  2XSD C;  2E7X A;  1YHQ I;  4BHC A;  1H9T A;  1FSH A;  4I99 C;  2CQ7 A;  2DFH A;  1EV7 A;  3LSI A;  2P4W A;  2L7M P;  5D6E A;  3K9T A;  2PMZ A;  4V19 K;  3I58 A;  4IVN A;  3BG3 A;  4I01 A;  4AD9 A;  4B09 A;  3EPZ A;  3CCQ I;  5HLH A;  2WY8 Q;  3PNY A;  2RGV A;  1WJ5 A;  2FU4 A;  3BZC A;  2OAZ A;  3ECO A;  4A5M A;  1N77 A;  3AL0 B;  1KGS A;  3LWF A;  3IH3 A;  5L3C A;  5EZG A;  2M8E A;  3UNG C;  2G0E A;  3L2R A;  1FMW A;  3QAH A;  4L9J A;  4XLF A;  1IUF A;  2R7U A;  2IJL A;  3NWS A;  3U21 A;  3X2Q H;  3K2A A;  1X4O A;  3OYC A;  3BR2 A;  4CA0 A;  4PDK A;  4QPO A;  1ZTR A;  2E2J J;  3W2A A;  2N8G A;  3OIP A;  4YEL A;  2DTR A;  3WE2 A;  3WTS C;  2HFH A;  2AO9 A;  1VI0 A;  1MMG A;  3SZP A;  3G73 A;  1YJ9 I;  4NDL A;  3ZMD A;  1XSX A;  3QQA A;  4XIC A;  3H5A A;  3CCR I;  1TLH B;  1HDP A;  1D0Y A;  2KFD A;  1XDS A;  1IG7 A;  4C30 A;  2M0C A;  2HZT A;  4UVC A;  3S8P A;  5K7F A;  3HGG A;  1I3A A;  2XVC A;  4EGZ A;  2H1K A;  3M8J A;  3V8J A;  4BGD A;  1BI2 A;  3I56 I;  2H6C A;  1MD0 A;  2CH0 A;  5HOD A;  3WGI A;  4RB0 A;  4QPQ A;  5DS9 A;  1KU2 A;  2NOJ B;  1BIA A;  2GAU A;  3S93 A;  4YFK F;  5E1W A;  5C3E J;  5DYM A;  5J4Y A;  4U88 A;  2R7X A;  2W82 A;  2ETH A;  2KT0 A;  2FQ4 A;  1SD7 A;  2JN6 A;  5EEA A;  3L9F A;  3VEP A;  1YE9 A;  2V79 A;  4M9X A;  5B3S H;  3GTM J;  4IOC F;  2STT A;  4RB2 C;  1WRJ A;  4MEX F;  2K4B A;  3OYI A;  2F6C A;  2O0Y A;  3GXO A;  3H3U A;  3HJE A;  1QPM A;  3ZQH A;  4LOC A;  3M4O J;  1IZ1 A;  5A2Q K;  2JSP A;  4A3F J;  1POG A;  3R0A A;  1ZGA A;  2E71 A;  5FFX A;  2MG4 A;  5CYV A;  3SJM A;  4KFC A;  3GFI A;  4N4O B;  4WXD A;  2QZ8 A;  3KEO A;  1UFM A;  2JRM A;  4I6Z A;  2QUF A;  5LGT A;  3U9G A;  1ZRF A;  5LRS A;  2O6G E;  5J8F A;  1V55 H;  2R5Y B;  4LK0 F;  2DK8 A;  1W36 C;  2OZ6 A;  1YFH A;  3O8G A;  2EFW A;  2LOO A;  1OCZ H;  4XLA A;  3CQZ J;  3BLY A;  3MAJ A;  4A69 C;  2CFX A;  2DW4 A;  1MKM A;  2ZO4 A;  3MN2 A;  3Q0W A;  1TNT A;  3VYT B;  1XC5 A;  1ULY A;  5ICE A;  2ZXJ A;  3WU0 A;  1Z3Y A;  5J47 A;  4DW6 A;  2H1L A;  1O7F A;  3BR1 A;  4D7M A;  2F4M B;  3WU2 C;  1LFU P;  1EKE A;  3HGY A;  4I7H A;  5KHD A;  4A3D J;  3IL2 A;  5EGO A;  2KLO A;  1MBE A;  3G2B A;  1G59 A;  3PNV A;  3RJP A;  2VJ5 A;  3CLO A;  3IC7 A;  1ZG1 A;  3PL8 A;  2KIF A;  3KP5 A;  1R5H A;  5K7H A;  1ZLK A;  5E3L A;  1ZH5 A;  3AL0 C;  2OTL I;  2HEO A;  3TW7 A;  2K9M A;  3C1D A;  1YO5 C;  2K9N A;  2K7L A;  4A3E J;  4V2G A;  1WKM A;  1NHA A;  3K4J A;  3CES A;  3KYD B;  1ZKG A;  2LK2 A;  2O03 A;  2XRL A;  4PGG A;  5HS7 A;  1S8N A;  2DT5 A;  3HHH A;  1S9H A;  4BY1 J;  4HNV A;  3VSK A;  3OIO A;  3TQN A;  1J7K A;  2D2W A;  2PMZ N;  4RAY A;  4GDF A;  3WGH A;  2M7A A;  1U78 A;  2CW7 A;  1UAA A;  5DD4 A;  1RUN A;  1XTA A;  1U2W A;  4HA8 A;  4XMY A;  1ON2 A;  4I76 A;  2MD5 A;  2QQ8 A;  3V4G A;  3GFM A;  4BQN A;  3FIS A;  2ESN A;  2WC2 A;  5GAG J;  2Y9Z A;  4LB6 B;  3WG7 H;  1XMX A;  2YS9 A;  2JUG A;  4KN4 X;  4NNJ A;  4FE7 A;  3UR3 C;  2RRE A;  3L2C A;  4X1E A;  4IQJ A;  1WI9 A;  2KJC A;  2DN0 A;  4I98 B;  3V7C A;  3LSH A;  3LAP A;  4QWQ A;  5JFR A;  3JSP A;  1S7O A;  3HRU A;  3KEQ A;  4D7N A;  2Z16 A;  1QZY A;  5GPC A;  3K1P A;  3TP0 A;  1VQ4 I;  1HW2 A;  2Z2S B;  3W6K B;  3W2V A;  3S1R J;  1G3Y A;  2XGX A;  4XSZ F;  2ZJR F;  2P5K A;  3N4M A;  2V1U A;  1O3R A;  1U8R A;  1DUX C;  1GVD A;  1WGX A;  4RB1 A;  2X1E A;  2EV6 A;  3DLL F;  1UB9 A;  3S14 J;  5M3F J;  2Y69 H;  2VL8 A;  2LLK A;  2CWE A;  1TNS A;  2I5U A;  4ANJ A;  3G4S I;  5E79 C;  3DFG A;  4DYR A;  1BI3 A;  3RDI A;  2L7F P;  3O8H A;  2DA4 A;  5JHF A;  2YSR A;  1BC8 C;  2LP0 A;  4OIQ F;  3ABT A;  3ZMV A;  1Z21 A;  3FWE A;  2VXD A;  2XPU A;  1ONV A;  1H0M A;  2V1N A;  4A3K J;  1P4A A;  2EK5 A;  4B48 A;  1KYW A;  4IF4 A;  2CQX A;  1X1P A;  1IN6 A;  3K70 C;  3BRO A;  5IP7 J;  2XV4 S;  3JTH A;  2P8T A;  5J1R A;  2Y9Y A;  3NWT A;  2E34 A;  3DQV C;  1T6S A;  2GOM A;  4JQF A;  1NG7 A;  3KLO A;  3TBI A;  1D8K A;  2DA3 A;  1JKP C;  2ID3 A;  5F04 A;  3CCV I;  2BYV E;  2E7W A;  2HNH A;  2A69 F;  1MBK A;  5E20 A;  1E3P A;  2Y48 A;  4YIR X;  2ESH A;  3QU6 A;  3ZMZ A;  3IAM 2;  3HOU J;  1V4R A;  2XSJ C;  3GEZ A;  3TDU C;  1ZR4 A;  3HXL A;  4XL9 A;  4CH7 A;  4E6K G;  2OJE D;  3FMR A;  4HYE A;  5FGM A;  3S2W A;  2MLK A;  2FF4 A;  5GAD J;  5LRR A;  3BOQ A;  3S32 A;  2CUF A;  3F8M A;  5AIQ A;  3JTG A;  1O4X A;  4HST A;  3FXO A;  1TBX A;  1QRY A;  3OOU A;  2KP6 A;  2A5Y B;  2LY1 A;  4A3L J;  1VND A;  3V42 A;  2ICW G;  5GTI C;  2E19 A;  2L01 A;  2FA5 A;  2IBD A;  3KP3 A;  1SEU A;  3VOD A;  2PI0 A;  4JX4 A;  5F1R A;  5IOZ A;  3JRE A;  1IUY A;  5EEG A;  1R4M B;  2V6C A;  3LA7 A;  3WTZ A;  4M3F A;  4F55 A;  4HX4 A;  1P4W A;  4Y7N J;  4MFD A;  3DEU A;  1ETX A;  2CUE A;  4XRF A;  5ED4 A;  3HOW J;  2VON A;  4IHY A;  1SMY F;  3ECH A;  4BU2 A;  2O7O A;  1WWX A;  2P81 A;  2MBF A;  2VIX A;  5TGT A;  2HKX A;  4RS8 A;  1Y0U A;  3K7A J;  3CC4 I;  3SXY A;  2O9L A;  2Z3Y A;  4G7Z F;  1JE8 A;  1D1C A;  4WK8 F;  1MJ9 A;  3P9C A;  2KKO A;  3DTK A;  2KZV A;  1Z7L A;  4I02 A;  2Z5U A;  3ASO H;  1IRX A;  3I4M J;  2MYS A;  1ETK A;  5FD5 A;  1DPU A;  4WXC A;  2IXS A;  3RZD J;  1C0W A;  4JX6 A;  4HDU A;  1WZ2 A;  2JSC A;  3DBR B;  2RV8 A;  3FXQ A;  1T56 A;  1FOY A;  2VJ4 A;  3JRB A;  2BXY A;  2GIZ A;  2K5C A;  4PJN A;  3ML6 A;  5H20 A;  2HDW A;  2IP2 A;  2D5V A;  3C7J A;  2LSO A;  2X85 A;  1D1A A;  4L5J A;  3CD6 I;  3ULQ B;  1I1S A;  3B6C A;  5DD8 A;  5J8C A;  4IXA A;  2Z99 A;  1B6A A;  3NRV A;  4DQ2 A;  2MLG A;  2A5W A;  2GIV A;  1JKO C;  3OR2 C;  4ZJZ A;  2OQR A;  2Q0O A;  2IAI A;  3CZ6 A;  2EIJ H;  1HBX G;  2EFO A;  3H1C A;  3FHZ A;  1PUF A;  2Y2Z A;  3G6E I;  1RIO H;  2K9S A;  4NC7 A;  3KFW X;  3BTJ A;  3PO2 J;  1MZB A;  4ITV A;  3COA C;  4LMY A;  5F0C A;  5D5X B;  3I59 A;  2CMP A;  2CUZ A;  5B1B H;  3BG6 A;  3QPS A;  4XOR A;  3BY6 A;  4P9U A;  4BXU A;  4DJA A;  1L3L A;  3OSF A;  1ETY A;  4U0W A;  1P92 A;  1F5T A;  3LFK A;  2W1O A;  2M8G X;  2K02 A;  3ROU A;  2HXI A;  2O5R A;  2KL4 A;  3GTO J;  2R7Z J;  3OIQ A;  2ZJP F;  2LBF B;  1MNM C;  3IAS 2;  4M3E A;  2NVX J;  2CFO A;  4HAM A;  4OMZ A;  1A31 A;  3DEE A;  2RQQ A;  2VI6 A;  1UHM A;  1SVL A;  5D6F A;  2XDV A;  4E4H A;  2VQL A;  2ECB A;  4UUV A;  1UCR A;  3CCS I;  4MFE A;  2YPR A;  1HW5 A;  4E7L A;  1E3O C;  5FLM J;  1RET A;  1MND A;  3RSN A;  2HVS A;  3OOP A;  4C2M J;  2BY3 A;  2F4O B;  3OL4 A;  3Q3S A;  4DYQ A;  2ZC2 A;  1TW2 A;  2L2O A;  2BEO A;  4HBL A;  2AS5 F;  3U1K A;  2DT7 B;  3Q9S A;  4Y33 A;  3F0C A;  1T39 A;  3WTU C;  4JYK A;  4EJV A;  1PYV A;  1PJR A;  5LHH A;  2O8X A;  2R92 J;  5TJJ A;  4LB5 A;  3CC2 I;  4A0Y A;  1F43 A;  1WQ2 A;  1H9G A;  1QGP A;  1ZG5 A;  1X3U A;  2HGC A;  2VKD A;  2OA4 A;  3E6D A;  5LD2 C;  1HQC A;  1K6Y A;  1ZG3 A;  5IY5 H;  5C44 J;  4F92 B;  2W25 A;  1G3S A;  2EV5 A;  1E3H A;  2ZNY A;  2XAS A;  5B66 C;  2VKV A;  4AYB A;  3GTG J;  1I3Q J;  1MIJ A;  3HOT A;  1V3F A;  3K2Z A;  2CYY A;  2KDO A;  2XHK A;  3EUH C;  4WWC A;  1WJA A;  3PQK A;  2OTJ I;  2EZL A;  2K86 A;  5K5R A;  4ASN A;  1G3T A;  1J2X A;  1A6Q A;  1RI7 A;  5LFA A;  3SEQ A;  3LAJ A;  3ZCO A;  1D1B A;  1M1E B;  5JVT A;  2MH2 A;  4GGG A;  2YU9 J;  4C3J J;  4LIT A;  4ZZD A;  1W7P B;  2BV6 A;  2OD5 A;  2V1D A;  4H0E A;  1MH4 A;  2G7U A;  2JPB A;  3ELK A;  3WOD F;  5FRN A;  3AKZ A;  1D5Y A;  3NQO A;  2A61 A;  3PUB A;  1YS7 A;  4NQW A;  3TOA A;  2JA7 J;  4D9J A;  3BZK A;  4RBO A;  4DBR A;  2QBY B;  2JVH A;  4NQW B;  1TC3 C;  1GUU A;  2IA0 A;  1P6R A;  3BDD A;  3MZH A;  1XDU A;  3CCY A;  5HVQ C;  1A6I A;  2E5N A;  5ICC A;  5JHU A;  5K1Y A;  5DM7 F;  1LDD A;  4RLQ A;  4LIU A;  3HTS B;  4A3I J;  4C2T A;  2XAJ A;  2K3P A;  4M6Y A;  1RNL A;  4PUS A;  1X1B A;  2JT1 A;  3ZMU A;  4WF2 A;  3QWL A;  1IXC A;  4KIG A;  3JAM K;  3S2H J;  2QLZ A;  2YX7 A;  2VJI A;  1LKX A;  3GYH X;  1WFX A;  2QWW A;  3ERM A;  2E2H J;  3KPH A;  1R5I D;  2F4I A;  3DWL E;  1DP3 A;  3RPQ A;  3K4L A;  3A0H C;  1FY7 A;  3TW6 A;  5J4V A;  2X6X A;  4XRS G;  4GXO A;  1HKS A;  4RGU A;  3ZQG A;  1FBU A;  2LVS A;  3FXK A;  3ABM H;  1SMT A;  5JLX A;  4L9V A;  4JOM A;  4BXF A;  2PX9 A;  2K9L A;  4CCJ A;  1O3S A;  1AA7 A;  4YRV A;  2L7Z A;  3CTA A;  3AFH A;  4BE0 A;  4LIV A;  2E1M C;  3OYE A;  4A93 J;  4ESF A;  2Y31 A;  3KZZ A;  1P9Q C;  4II3 A;  4HV5 A;  3M3Y J;  2WWY A;  5L3D A;  4P9F A;  2VQC A;  4ZZL A;  5K7Z A;  3M07 A;  1OR7 C;  4UVB A;  1G8X A;  4XLP F;  1K6O A;  4XRS A;  1GLN A;  3E5X A;  2FQ3 A;  3K4B A;  2V9P A;  2GWR A;  2NYX A;  4IEJ A;  1D3Y A;  4UV8 A;  5L3B A;  3P9I A;  2GXA A;  5KVR A;  5IYC J;  1MW7 A;  2R7Q A;  4BBR J;  2HWV A;  3BTL A;  4IRH A;  2H6B A;  3HC7 A;  2XRN A;  3O2P E;  4A0Z A;  4ENM A;  1E0E A;  1ZHF A;  3K1N A;  3GZN B;  1LUJ B;  4BDZ A;  1FT9 A;  2LH9 A;  2IA1 A;  4QSH A;  2R7W A;  3GTP J;  3VWB A;  5IT9 K;  1U5T A;  1AKH B;  1T2K A;  1ZR2 A;  3EYI A;  4W1U A;  1UEL B;  4LLG F;  2E1M B;  1YI2 I;  2Z9O A;  2CW8 A;  4I09 A;  4RGR A;  1I50 J;  2AXL A;  2OZU A;  4XN0 A;  3V8K A;  4KIT B;  1ZRE A;  1IDZ A;  4BE1 A;  4G94 A;  2OU2 A;  2A3S A;  3O3K A;  4KIC A;  4N4N B;  2GXB A;  4EJT A;  1LQ1 A;  1OCC H;  3FBI B;  3G1O A;  1XSV A;  5DEQ A;  4BH9 A;  2CV0 A;  3BTI A;  4UHT A;  1T08 B;  1QNT A;  1FZP B;  4EM0 B;  5GAH J;  4YG2 F;  4LLL A;  5GPA A;  1RR7 A;  1YYV A;  2GBY A;  2ZFW A;  3KEY A;  4PJM A;  3RIR A;  3RQ4 A;  3OS0 A;  4ZTJ A;  1PDN C;  1PUE E;  2DBB A;  1A36 A;  2VBY A;  4AC0 A;  2DJN A;  2E36 A;  3ZQI A;  4KJZ A;  2QCO A;  1VQO I;  2M87 A;  3CF5 F;  4GRI A;  4KIF A;  1F36 A;  2PJP A;  3MFK A;  2DOA A;  4CCN A;  4P96 A;  4LGW A;  4BEH B;  1Y6I A;  2ISZ A;  4AIH A;  2JMW A;  3V7S A;  5BPD A;  4N9I A;  2R3S A;  3OV8 A;  3I71 A;  1ETO A;  3D5L A;  4CYD A;  1F4K A;  1ZRD A;  2XB0 X;  2XC7 A;  3IKV A;  2L9V A;  3BG5 A;  2JA8 J;  4E7S A;  2ZNZ A;  2MH9 A;  4IRG A;  1TP4 A;  2O61 A;  4DZP A;  5DDG A;  1IXS B;  3FDY A;  3ERE D;  4I0B A;  2EA4 A;  2UXN A;  2WB1 N;  2HOT A;  3DBL B;  3I4P A;  4N9H A;  4HX8 A;  3RI4 A;  3A0B C;  3H3Z A;  4A2U A;  3CJN A;  2P5V A;  5HLI A;  1S5L C;  1I27 A;  2NS7 A;  3RKX A;  3S1Q J;  1EJ9 A;  2KZG A;  4LJZ F;  1R23 A;  3E97 A;  3IWZ A;  4MIM A;  3I59 B;  1HKT A;  1H8A C;  3QP6 A;  1G3W A;  3OYN A;  4OAZ A;  1U9O A;  3R61 A;  3EQL F;  3FM3 A;  1BW6 A;  1W0T A;  1WJB A;  4C3I J;  5CPR B;  2M1B A;  4LLN A;  3K4M A;  2R7O A;  5F64 A;  4KIB A;  3LSK A;  2HPI A;  4FQG A;  3MVP A;  2L4A A;  3CUO A;  4D0P A;  3J80 Z;  1YS6 A;  1E2X A;  1OFC X;  1UJ8 A;  2XGD A;  3QPH A;  1R22 A;  3PFY A;  3K70 D;  4Q48 A;  3DF8 A;  4HG2 A;  4IHW A;  2A6T A;  2BBY A;  4XK4 A;  4EM2 A;  4RDU A;  3IHU A;  4YIF A;  2ZFU A;  4CCL A;  1ODD A;  2BOL A;  2D1V A;  5FRO A;  4GCV A;  2CW0 F;  1JKR C;  3DEW A;  4HQM A;  4HQE A;  2XPW A;  2ZKZ A;  2DA2 A;  5LBQ A;  2JA2 A;  1G4D A;  3QYB A;  3PM1 A;  4OIR F;  3F22 A;  2MC4 A;  3PNT A;  3LOC A;  2JPC A;  2ADU A;  2F5V A;  3GTJ J;  3GX4 X;  1BR1 A;  3J80 K;  2E1N A;  1S7A A;  2K4J A;  2HYF A;  4E7H A;  3F23 A;  3FK6 A;  5HLG A;  4BXX J;  1BL0 A;  1WH7 A;  2LFB A;  2HI3 A;  2FMY A;  3SQN A;  5D5U B;  2KPM A;  1FSE A;  1Z7U A;  3K4C A;  1LE8 B;  5ILV A;  2VN2 A;  1WJE A;  2O8K A;  4V2F A;  2CSO A;  5LHI A;  1B59 A;  1S3J A;  2K27 A;  1RES A;  1STZ A;  1D0Z A;  3K10 A;  2DI3 A;  1V5G A;  1VQP I;  4IZZ A;  4PFP A;  2FNP A;  2DDA A;  1IJW C;  1Y0N A;  2I8D A;  2HR3 A;  1HXD A;  3T0Y A;  1X3Z B;  2NAZ A;  2DU9 A;  5H6R A;  3OYD A;  2E60 A;  3JRG A;  4BQO A;  1KON A;  4WX9 A;  2DO7 A;  5L3E A;  3PIP F;  5HDK A;  4B1R A;  1LDJ A;  3Q0U A;  2W4S A;  3JRH A;  1PP7 U;  2DYR H;  2V7F A;  5E17 F;  3MD2 A;  5J40 A;  4ETS A;  2FJ1 A;  3CDI A;  2F5F A;  2VQH A;  1S6L A;  3DCF A;  3E0J B;  2BVM A;  4OIN F;  2IRF G;  1IDY A;  3KYL A;  1B4A A;  2ME0 A;  4ABZ A;  2KHM A;  2W24 A;  3QYF A;  1DPR A;  2DCE A;  1FNN A;  3KZY A;  2XAH A;  2MSY A;  1OCO H;  2FOK A;  2E2I J;  3ZOB A;  2OC6 A;  2LRE A;  3OYJ A;  1YIO A;  4G6T B;  3DV8 A;  3C3W A;  1J0R A;  2M4G A;  3SDB A;  4JP0 A;  4M73 A;  5LEK A;  1FTZ A;  1BR4 A;  1R36 A;  4XID A;  4D1Q A;  3WG9 A;  1Z67 A;  3HL2 A;  3E6M A;  5BOX A;  3A01 A;  3RZO J;  2ZJ2 A;  5BS6 A;  2KIQ A;  3HG9 A;  2NNY A;  1OCT C;  2L9N A;  4MQV A;  1B9M A;  4ZYG A;  1W0U A;  2RVC A;  1AOY A;  2RNJ A;  1ZGJ A;  1MSF C;  5LGU A;  3GLL A;  1IO2 A;  5EEH A;  2G9W A;  3GTK J;  3KCC A;  3LQQ A;  4XQF A;  3I3L A;  4KUM A;  2ME6 A;  2ZME A;  5D8L B;  3W3C A;  2Y0M A;  5HNF A;  5FD6 A;  3OYM A;  2HTJ A;  1JUS A;  3GF2 A;  1XMK A;  2M2E A;  1L0O C;  2FX0 A;  3BJ6 A;  3MKY B;  2GZW A;  4C3H J;  2CV2 A;  2WAF A;  3VDX A;  1MBG A;  4ZYH A;  3HB9 A;  3OWT A;  1BA5 A;  3FKI J;  2MAB A;  4EVI A;  2PLY A;  4GO1 A;  1RC9 A;  2ELK A;  1SC7 A;  2FD5 A;  1U6G A;  2IGM A;  3F8C A;  5ERI A;  4Y13 A;  5E18 F;  1FYL A;  1KU9 A;  1IRZ A;  2R7F A;  3JRD A;  3CMM A;  3HOX J;  2QEN A;  2DQR A;  3HYI A;  2OPT A;  3CJT B;  1R4N B;  1YQA A;  1U0J A;  4U87 A;  2EZK A;  4MHG A;  1BC7 C;  1MMA A;  3J81 Z;  1R9T J;  2GOX B;  4IHS A;  1UG0 A;  2IA2 A;  2L9R A;  1Z6R A;  2PG4 A;  5DM6 F;  4RAF A;  2P7V B;  4GYI A;  5ILS A;  4Z2Y A;  5FKO A;  3FXU A;  4AU7 A;  1WH5 A;  1WI3 A;  1FX7 A;  2VJJ A;  2Y0S N;  1MSE C;  3HSR A;  4A3J J;  3I0T A;  4PJ0 C;  3GFJ A;  2V26 A;  2PMH A;  2KDZ A;  2ELJ A;  4RA2 A;  2UZK A;  2VB6 A;  3H9Q A;  3OYH A;  2JUC A;  3J7Y J;  1XS9 A;  2WAD A;  2IGN A;  4PGH A;  4P1W A;  1NTC A;  1QQI A;  4L0Y B;  2WA0 A;  2X1C A;  4X0G A;  1FIA A;  3FM5 A;  4G7O F;  1QHH D;  2ZXI A;  1SFU A;  1OYY A;  2GA2 A;  2HU9 A;  4O5V A;  3Q5F A;  1NH3 A;  2KQR A;  1O3T A;  2YU3 A;  4B4C A;  5LLQ A;  3S3N A;  1Z9C A;  4BKX A;  5F0H A;  4B47 A;  2EFQ A;  2R93 J;  2W85 A;  3G1M A;  1KU3 A;  2DFE A;  1Y1V J;  4Q5S F;  2J5P A;  3HOZ J;  2X6Y A;  3CJR B;  3FMQ A;  1R49 A;  4II2 A;  4KIS A;  2OF7 A;  4IKF A;  5E3N A;  1XMA A;  1VQ9 I;  4XM3 A;  2A6E F;  3D5R C;  1RRJ A;  1MH3 A;  3BP8 A;  3TO9 A;  2R7R A;  5JLW A;  3C2B A;  3A1Y A;  4E7K A;  2NVY J;  2IW5 A;  3NAU A;  4DNC A;  4KMF A;  2XAQ A;  2JJ7 A;  3N05 A;  1FOK A;  2QBY A;  2NOG A;  2R7V A;  4BHP A;  1TQP A;  3DKY A;  2I10 A;  2L7K A;  1B9N A;  4U0Y A;  4IHT A;  1OPC A;  1YX5 A;  3GLX A;  4RM2 A;  3G71 I;  4RM3 A;  2IS2 A;  2HDC A;  3IP4 B;  3WHB A;  1W4M A;  4MTE A;  4BY7 J;  4JBA A;  4Y17 A;  3S16 J;  1QZE A;  2VT2 A;  3P7N A;  1I6H J;  2TCT A;  5ILU A;  3CCU I;  2VBX A;  5IP6 A;  1ZQ3 P;  3JCU C;  3WTW C;  3GTQ J;  4RGX A;  2Q2E B;  3HUG A;  4IOA F;  1VFC A;  3FKJ A;  2FBH A;  1EF4 A;  3HKZ N;  1DGR M;  2BE5 F;  4DIQ A;  5F0F A;  4WXH A;  2CQN A;  3SEZ A;  2DYS H;  5M3M J;  2VC0 A;  4HW0 A;  3PFI A;  4OOI A;  1JT0 A;  2UV1 A;  1HC8 A;  3J7A Y;  2OV7 A;  3S3M A;  3LQR A;  4KN7 X;  2XGC A;  1D5V A;  2BGC A;  2DOD A;  1JJ6 C;  1V5E A;  3E7L A;  3OR1 C;  4LK1 F;  3AG1 H;  4J19 A;  3QOD A;  1MMS A;  3I54 A;  2DFF A;  4BJ5 C;  5IPA A;  4Y15 A;  2F5C A;  5C4X J;  1WHU A;  3ZMT A;  4HV6 A;  3BR0 A;  3E5Q A;  2AXT C;  3VFZ A;  2TDX A;  1R58 A;  2XF5 A;  5E8I A;  3CDH A;  4BNC A;  5CQG A;  1R1U A;  2VT3 A;  2JVG A;  4IHV A;  3H3V K;  2XAU A;  4W97 A;  2P6S A;  5D8K B;  2MGQ A;  3CC7 I;  1FOX A;  2FE3 A;  1J5Y A;  5B1A H;  4M72 A;  2QVO A;  4BDY A;  2CO5 A;  3LA2 A;  1VQ5 I;  3ZXS A;  2DK5 A;  3MZ8 A;  1Y8R B;  3AG3 H;  3CMY A;  1X1A A;  2YUS A;  1MNE A;  3HPG A;  5E3O A;  2PBI A;  2WAE A;  4CDG A;  3M1E A;  3F72 A;  4OIO F;  2VBW A;  4BAC A;  2NVQ J;  3M7G A;  4MLO A;  1N25 A;  2KJB A;  2R4G A;  2ZBK A;  3BJA A;  2H09 A;  4HNU A;  4ZH4 F;  1RZ4 A;  2XF6 A;  2BHZ A;  3P5J A;  4XKW A;  4EJO A;  2CQQ A;  3I9V 2;  4RB3 C;  5HOO A;  2D45 A;  2RN7 A;  3JRA A;  1A04 A;  1BW5 A;  4FET A;  3SYT A;  4IJA A;  4ZDO A;  3MKL A;  2EIK H;  4BAY A;  2DMP A;  2VKH A;  4M74 A;  2Y0S A;  3D5S C;  4CO8 A;  3QU3 A;  3DTI A;  1GDT A;  5DCM A;  1FIP A;  4RGS A;  1MDM B;  4M71 A;  4FIS A;  3BQZ A;  3DBH B;  5CVI A;  4LD5 A;  4BQA A;  1LB2 A;  1P7I A;  2XUB A;  3ABL H;  5CVR A;  4NBQ A;  5DCM B;  1MDM A;  3NAR A;  4D5F A;  3LSP A;  1LJ9 A;  3HDD A;  3TP3 A;  4A12 A;  2XF7 A;  4EV0 A;  4XN3 A;  4CXF A;  5M5W J;  1YLF A;  3CDL A;  4BBS J;  3N97 A;  2VQG A;  2PN6 A;  3HEF A;  2BZT A;  2HOS A;  4BYY A;  4M3D A;  4AID A;  5LHG A;  3WTY C;  5K5O A;  2H94 A;  1ERD A;  4EJU A;  4M3G A;  1TW3 A;  4B3A A;  1YW7 A;  2DLL A;  1HOM A;  3BR3 A;  1AU7 A;  1LFB A;  3H35 A;  3BWG A;  1PUF B;  2LKP A;  1WPK A;  3CF2 A;  2RNG A;  5FKM A;  1QZZ A;  4Y4R A;  4XLN F;  1RUO A;  2FXA A;  4D5C A;  1IN4 A;  1TWF J;  2G7H A;  3B6A A;  3OS2 A;  1SAU A;  4CUG A;  3CJQ B;  4E7J A;  2VOP A;  3REO A;  5D5W B;  2LF8 A;  2JTV A;  4XKC A;  1DU0 A;  4A0X A;  4A3B J;  2PJR A;  1S72 I;  1TWA J;  2Z33 A;  4EMS A;  1OQY A;  1XSD A;  6PAX A;  3CCM I;  2W48 A;  2V4J C;  1KA8 A;  2ZSI B;  1XGO A;  1Z3X A;  4CZC A;  2WTE A;  2F2E A;  3J7Z I;  5A2Q Z;  2EZI A;  2HVQ A;  1YJW I;  5FLV A;  1TTY A;  2E1C A;  4FHT A;  5HLT A;  1R6R A;  1BM9 A;  1DU6 A;  1LNW A;  3TMO A;  3FMS A;  1VF9 A;  4YII A;  4Q47 A;  3A2K A;  1JJ8 C;  1E17 A;  3EET A;  1PP8 F;  1X1D A;  3HKZ A;  4OU0 A;  1SD5 A;  4S05 A;  3KZI C;  1U3E M;  3J81 K;  3PSI A;  1K4S A;  1BOA A;  3NEU A;  2CS3 A;  3QOE A;  2EA2 A;  1OIS A;  2IPQ X;  1LE8 A;  4CCK A;  2EFP A;  3HRT A;  1YW8 A;  3OYB A;  1JT6 A;  2LMD A;  2GXG A;  3E6B A;  2JZY A;  1ETV A;  2QQ9 A;  3DPU A;  1B72 B;  2VAS A;  4R1H A;  3ASN H;  1ACI A;  2W84 A;  4P5O A;  3LSM A;  2XGE A;  3WGG A;  3U1D A;  1FP2 A;  5L3F A;  5HS9 A;  4FTH A;  1TWH J;  2LYC A;  3D1N I;  4S04 A;  2VC1 A;  1MBH A;  1QVT A;  2HQN A;  1NK2 P;  3MKZ A;  4JX5 A;  2HQ5 A;  1J75 A;  3FZV A;  4NC6 A;  2OBP A;  2K40 A;  3FXR A;  4FT8 A;  1HA8 A;  3HOS A;  2X9D A;  4MQ9 F;  3S1N J;  3G3Z A;  2A6H F;  4ZC3 A;  2XAG A;  4ENJ A;  1P4X A;  5BQT A;  2Q8K A;  4PK4 A;  2LC2 A;  3CLQ A;  2HXO A;  4G6D A;  3W6V A;  1V54 H;  3W2W A;  2XRO A;  1VZ0 A;  3SHF A;  2DAO A;  3PUF A;  2QKM B;  5KAF C;  4LFU A;  2DMN A;  3F9K A;  2DMU A;  1VQ6 I;  3PIO F;  3DKX A;  2L9S A;  1GXP A;  3SDG A;  4G12 A;  3E3V A;  2DJI A;  5TIS C;  3VYS B;  2HVR A;  3A01 B;  1IC8 A;  2M30 A;  3OYK A;  2GLO A;  1TT0 A;  1QA6 A;  3Q0V A;  5GAE J;  2ACJ A;  1WJC A;  5F08 A;  3CO6 C;  1TL8 A;  3QPT A;  1JUM A;  2FBK A;  1U8B A;  2DA1 A;  2PFB A;  3LST A;  3T1B A;  3T8R A;  1ZEL A;  3M1C A;  1RPW A;  4XLE A;  2NVT J;  4M9Z A;  1YOV B;  3HUG B;  1BBY A;  2ZME B;  4KA4 A;  4BS9 A;  4RAZ A;  2VXZ A;  4XKB A;  5J1U A;  1FYM A;  4AUX A;  1X2M A;  3IWF A;  2HZD A;  3H9G A;  3U2R A;  3IKT A;  3IRQ A;  2EB7 A;  1K61 A;  4CYC A;  4ZYE A;  1R00 A;  1T0F A;  2M7B A;  2IVM A;  3RPU D;  3H0G J;  4M9S A;  2IS6 A;  2DA5 A;  4PSX A;  2COM A;  3TDZ C;  1USS A;  2QQB A;  1EH7 A;  2EWN A;  4HZF A;  1LEB A;  3QRF F;  4MEY F;  1RKW A;  2QF7 A;  2FNA A;  2R5Z B;  4L9T A;  3BPV A;  1FWZ A;  3HZJ A;  1RKT A;  4L9N A;  3LFU A;  2JA6 J;  3M8E A;  3DKW A;  3VYR B;  4HX7 A;  2JRT A;  5E1X A;  1QHG A;  5J1Y A;  2ZXW H;  5AON A;  3KIO A;  4IO9 F;  2X48 A;  4YEJ A;  1O7L A;  3ZN1 A;  4PJJ A;  1TT5 B;  1XD7 A;  1DDN A;  3H5R A;  3HSE A;  3FXM A;  1Z1D A;  3FHN A;  3L00 A;  4R79 A;  2P7C B;  1Z77 A;  1W5S A;  4EEF G;  2X6O A;  2ZSH B;  1REP C;  2B9S A;  5HNH A;  4BHB A;  3DP7 A;  3TO6 A;  2E1O A;  1HDD C;  1G2H A;  3H5N A;  1U5T B;  3WTV C;  2QYO A;  2NVU B;  4XRM A;  3BCB A;  1O57 A;  1IXR C;  3P9K A;  3RCO A;  5H2F C;  3J7A O;  2QGU A;  3EYY A;  3WTX C;  4IRI A;  4BUP A;  4A6E A;  2DT6 A;  4XR6 A;  4XNF A;  3W6J B;  5LEJ A;  1OJL A;  1OLT A;  2M0M A;  4PSW A;  3ZPL A;  2R7T A;  3S3O A;  2PEX A;  3KE2 A;  2FML A;  3L7W A;  4F52 A;  3DU5 A;  1DP7 P;  3HOY J;  5D4S A;  1Z6T A;  2HYJ A;  4HOB A;  4TV7 A;  4QLC U;  5BMZ A;  1KU7 A;  5DUI A;  1ZRC A;  2Z1D A;  2Q1Z B;  3FX3 A;  1VQK I;  3S1M J;  4MGR A;  1K4T A;  3BC8 A;  1QO0 D;  1B1B A;  3DU6 A;  4N0B A;  3F3X A;  3CP2 A;  1H88 C;  1KQ9 A;  1DGW Y;  4BQQ A;  2UWM A;  3MKW B;  1EA3 A;  2AHQ A;  2L0K A;  1RR8 C;  2BY0 A;  1I1G A;  3L2W A;  2NS8 A;  2DMT A;  2V9V A;  2DXI A;  2GQQ A;  3AAF A;  1MBF A;  4BEH A;  1YIT I;  4NHJ A;  3CCL I;  1X1C A;  1K7A A;  1FYK A;  4KT5 C;  1MMD A;  5BPI A;  2VPR A;  4UB8 C;  2XKO A;  2Y30 A;  3F6V A;  3K69 A;  3WHC A;  1LEA A;  2HKO A;  2M9H A;  4LG3 A;  4FX0 A;  1ITY A;  1G6N A;  3KLN A;  3OYG A;  3BTC A;  1JI8 A;  4G8X A;  4M3B A;  3GVA A;  1VQM I;  2LKS A;  3FXL A;  5TRD A;  1OYW A;  4HLX A;  4IHX A;  3DXJ F;  2VPL A;  4BJT A;  1OR7 A;  2X1D A;  2Q2E A;  3HBL A;  3HIF A;  4OWR B;  3BJO A;  2QA4 I;  2R7D A;  2KRF A; 
#chains in the Genus database with same CATH homology
 3GZ5 A;  3F8N A;  1OYI A;  4L0Z B;  3TO7 A;  2GA1 A;  3KP4 A;  1MJB A;  1BN5 A;  4U0V A;  5FLX Z;  2FSW A;  4ENK A;  4WCG A;  4EQQ A;  1CGP A;  3TKY A;  3MCZ A;  5KK1 A;  3RPU A;  2H27 A;  4ESJ A;  5ICF A;  5IT9 Z;  2HYG D;  4KMU X;  2NNN A;  3SZT A;  4L18 B;  5K5Q A;  4UVA A;  2X4H A;  3KP6 A;  3PQJ A;  3BPX A;  4IPA A;  4A6D A;  5FLX K;  2OQG A;  4LG0 B;  1FC3 A;  3RYR A;  1IAW A;  1SFE A;  4MNU A;  1AWC A;  4KNY A;  1Z91 A;  3L09 A;  3V8L A;  4KYW A;  4M6X A;  5E8G A;  2XIG A;  4YFX F;  3ZMS A;  4E70 A;  2F5E A;  3BZ6 A;  1CF7 A;  4I2O A;  1F1Z A;  5LGN A;  1R7J A;  2STW A;  3R0J A;  4Q4Z F;  1JHF A;  2L3D A;  5DV5 A;  2V1X A;  2B0L A;  5E1Z B;  2C6Y A;  1K78 A;  2ISY A;  5ICG A;  1K78 B;  2MC3 A;  3E6C C;  2RC4 A;  4ON0 A;  1UST A;  2KIU A;  4K2E A;  2IT0 A;  1Q1H A;  1XGM A;  5CLS A;  2L4M A;  1SAX A;  5HDN A;  4CGZ A;  1FBS A;  2M5W A;  1BIB A;  1K79 A;  3F21 A;  3F8F A;  1GHC A;  3I53 A;  2NS0 A;  2J5O A;  4AIJ A;  1OKR A;  3RKW A;  1ZAR A;  3I5U A;  3VOE A;  3H92 A;  1HSJ A;  2VE9 A;  3HRM A;  4CHU A;  3CUQ B;  1ZN2 A;  3CUQ C;  2FBI A;  2HS5 A;  2DPD A;  5CVV A;  1IW7 F;  2PMU A;  1IN7 A;  4L5I A;  2VE8 A;  4A5N A;  4O3M A;  4AWX B;  2L54 A;  5D4R A;  5DUK A;  3RTR A;  3GUD A;  1EH8 A;  1SFX A;  1GVJ A;  3WU1 B;  2CG4 A;  1I5Z A;  3CO7 C;  1R5G A;  4ESB A;  5IT3 A;  3SFZ A;  4ENN A;  1W5T A;  3ZQ7 A;  4AIK A;  4UXN A;  5AIP A;  2LNB A;  5JR3 A;  2VBZ A;  3GFL A;  1FP1 D;  4U7B A;  4AVP A;  5D5V B;  4PCQ A;  2QM3 A;  3TOB A;  3T8T A;  3F8B A;  3M8F A;  1KYZ A;  3MWM A;  2D1H A;  5L3G A;  3D0S A;  3R4K A;  1XCV A;  2KIM A;  3GWZ A;  2ELH A;  2Y75 A;  2F5D A;  3ZP5 A;  3HRS A;  3R60 A;  4FX4 A;  1P2F A;  1ON1 A;  1YW9 A;  4F7Z A;  3ISP A;  1YTY A;  5DCF A;  3WTT C;  3QP5 A;  4OIP F;  2CGP A;  3K1M A;  4GYG A;  3B02 A;  3EDP A;  2EFN A;  4KDP A;  1IRG A;  1FLI A;  2A68 F;  1Z05 A;  4NB5 A;  3KP7 A;  3V7R A;  3KET A;  4G6Q A;  1SD4 A;  2P6T A;  3F6O A;  1W7P A;  3LA3 A;  2MA3 A;  2HTS A;  1UHW A;  4B8X A;  3O6B B;  3M9A A;  3I64 A;  1TQM A;  5JI6 A;  1XGN A;  3MQ0 A;  1ZLJ A;  1XCB A;  1MJA A;  4YFN F;  5H6Q A;  1U5T C;  2RQP A;  2X0L A;  1LDK B;  3WE3 A;  3FF5 A;  2LDU A;  2UXX A;  3JW4 A;  3MEX A;  5FFZ A;  2P5L C;  3EUH A;  5F6F A;  4CIC A;  4MTD A;  3E5U A;  1JXS A;  2QQA A;  2RDP A;  4HDV A;  4HF2 A;  1FPQ A;  1O3Q A;  1JHH A;  3RYP A;  2YR2 A;  5J6X A;  4G7H F;  2VOD A;  1XN7 A;  2DPU A;  1D8J A;  4HF1 A;  3B73 A;  5CVU A;  3HHG A;  2HOE A;  2RKH A;  3DPL C;  2FRH A;  2DFI A;  4EJW A;  1T98 A;  1KQ0 A;  1CF7 B;  3KP2 A;  3JSO A;  1HW1 A;  1R1T A;  2W57 A;  1KQ8 A;  5HDG A;  1SD6 A;  1J9I A;  1S29 A;  3MZY A;  1HST A;  1IF1 A;  4P55 A;  3ABU A;  4UV9 A;  1TQI A;  1BI0 A;  2EJR A;  3TGN A;  4OMY A;  1BI1 A;  5CVJ A;  4EGY A;  4PZJ A;  2ZCW A;  4G9Y A;  3IRR A;  4CZZ A;  2LF7 A;  3RKY A;  4UNO A;  1R1V A;  1FBQ A;  3T5X A;  3C18 A;  4HLY A;  1GXQ A;  2XAF A;  1I6X A;  2O3F A;  3R6S A;  1IN5 A;  5CJ9 A;  4EM1 A;  2VOO A;  1JGS A;  1BJA A;  2CQK A;  1F9N A;  3GO5 A;  4JK1 X;  4U7D A;  1XB4 A;  1XGS A;  2M45 A;  1YG2 A;  1QBJ A;  1IRF A;  2EV0 A;  3DPT A;  1IN8 A;  3CUQ A;  4XBF A;  3GZ6 A;  2A07 F;  4R8H A;  2PQ8 A;  2HQR A;  1T38 A;  3JAM Z;  3GW2 A;  2NRA C;  1LVA A;  3QOP A;  4O6J A;  2DQL A;  4HF0 A;  4LG0 A;  1HKQ A;  2WV0 A;  5FO5 A;  3ZN0 A;  2L02 A;  3VB2 A;  1ZYR F;  4ZYD A;  4I0A A;  3K0L A;  3HTU A;  1ZAO A;  1MGT A;  2FEZ A;  1WSU A;  5HS8 A;  5FB2 A;  2XKP A;  1J59 A;  1OMI A;  1VTN C;  1EH6 A;  3HSF A;  4XSX F;  2YX4 A;  1W7P D;  3Q9V A;  2E7X A;  4BHC A;  1H9T A;  1FSH A;  1EV7 A;  2P4W A;  5D6E A;  3K9T A;  3I58 A;  4IVN A;  4I01 A;  4AD9 A;  4B09 A;  5HLH A;  2RGV A;  2FU4 A;  2OAZ A;  3ECO A;  4A5M A;  1KGS A;  3LWF A;  5L3C A;  2M8E A;  3QAH A;  4L9J A;  2IJL A;  4PDK A;  2DTR A;  3WE2 A;  3WTS C;  2HFH A;  3SZP A;  3G73 A;  3ZMD A;  1XSX A;  1TLH B;  1XDS A;  2HZT A;  4UVC A;  2XVC A;  4EGZ A;  3V8J A;  1BI2 A;  2H6C A;  1MD0 A;  3WGI A;  4RB0 A;  1KU2 A;  1BIA A;  2GAU A;  4YFK F;  5E1W A;  5DYM A;  4U88 A;  2ETH A;  1SD7 A;  3L9F A;  3VEP A;  2V79 A;  4M9X A;  2STT A;  4RB2 C;  1WRJ A;  4MEX F;  2K4B A;  2O0Y A;  3GXO A;  3H3U A;  1QPM A;  1IZ1 A;  5A2Q K;  3R0A A;  1ZGA A;  5FFX A;  5CYV A;  4KFC A;  3GFI A;  4WXD A;  2QZ8 A;  3KEO A;  1UFM A;  2QUF A;  5LGT A;  3U9G A;  1ZRF A;  5LRS A;  2O6G E;  5J8F A;  4LK0 F;  2DK8 A;  2OZ6 A;  1YFH A;  2EFW A;  3MAJ A;  2CFX A;  2DW4 A;  1MKM A;  2ZO4 A;  1TNT A;  1ULY A;  5ICE A;  2ZXJ A;  3WU0 A;  1O7F A;  4I7H A;  3IL2 A;  3RJP A;  3CLO A;  3IC7 A;  1ZG1 A;  2KIF A;  3KP5 A;  1R5H A;  1ZLK A;  1ZH5 A;  2HEO A;  3C1D A;  1YO5 C;  2K7L A;  1WKM A;  1NHA A;  2O03 A;  4PGG A;  5HS7 A;  1S8N A;  2DT5 A;  3HHH A;  3TQN A;  1J7K A;  2D2W A;  4RAY A;  3WGH A;  1U78 A;  5DD4 A;  1RUN A;  1U2W A;  4HA8 A;  1ON2 A;  2MD5 A;  3V4G A;  3GFM A;  2ESN A;  2WC2 A;  4LB6 B;  4KN4 X;  3L2C A;  1WI9 A;  2KJC A;  4I98 B;  3V7C A;  3LAP A;  4QWQ A;  5JFR A;  3JSP A;  1S7O A;  3HRU A;  3KEQ A;  1QZY A;  3K1P A;  1HW2 A;  3W6K B;  1G3Y A;  2XGX A;  4XSZ F;  2P5K A;  3N4M A;  2V1U A;  1O3R A;  1U8R A;  1DUX C;  4RB1 A;  2EV6 A;  1UB9 A;  2CWE A;  1TNS A;  3DFG A;  1BI3 A;  3RDI A;  2YSR A;  1BC8 C;  4OIQ F;  3ABT A;  3ZMV A;  3FWE A;  1H0M A;  1ONV A;  1P4A A;  2EK5 A;  1KYW A;  4IF4 A;  1IN6 A;  3BRO A;  2XV4 S;  3JTH A;  2P8T A;  4JQF A;  3DQV C;  1T6S A;  3KLO A;  1D8K A;  2BYV E;  2E7W A;  2A69 F;  5E20 A;  2Y48 A;  2ESH A;  3QU6 A;  3ZMZ A;  1V4R A;  3GEZ A;  3TDU C;  3FMR A;  4HYE A;  5FGM A;  3S2W A;  2MLK A;  2FF4 A;  5LRR A;  3BOQ A;  3JTG A;  3F8M A;  5AIQ A;  1TBX A;  2A5Y B;  2L01 A;  2FA5 A;  3KP3 A;  3VOD A;  2PI0 A;  5F1R A;  1IUY A;  5EEG A;  2V6C A;  3LA7 A;  3WTZ A;  4HX4 A;  1P4W A;  3DEU A;  4XRF A;  5ED4 A;  2VON A;  1SMY F;  3ECH A;  1WWX A;  2MBF A;  2HKX A;  4RS8 A;  1Y0U A;  3SXY A;  2Z3Y A;  4G7Z F;  1JE8 A;  4WK8 F;  1MJ9 A;  3P9C A;  2KKO A;  4I02 A;  2Z5U A;  5FD5 A;  1DPU A;  4WXC A;  1C0W A;  4HDU A;  2JSC A;  2RV8 A;  3FXQ A;  3ML6 A;  5H20 A;  2IP2 A;  3C7J A;  2LSO A;  4L5J A;  3ULQ B;  1I1S A;  5DD8 A;  5J8C A;  4IXA A;  2Z99 A;  1B6A A;  3NRV A;  4DQ2 A;  2MLG A;  2GIV A;  2OQR A;  2Q0O A;  1HBX G;  2EFO A;  3FHZ A;  1RIO H;  3KFW X;  1MZB A;  3COA C;  4LMY A;  5D5X B;  3I59 A;  4P9U A;  3BY6 A;  4BXU A;  1L3L A;  4U0W A;  1P92 A;  1F5T A;  3LFK A;  3ROU A;  2K02 A;  4HAM A;  4OMZ A;  1UHM A;  5D6F A;  4UUV A;  1UCR A;  2YPR A;  1HW5 A;  3OOP A;  1TW2 A;  2BEO A;  4HBL A;  2AS5 F;  3Q9S A;  1T39 A;  3WTU C;  4EJV A;  5LHH A;  2O8X A;  5TJJ A;  4LB5 A;  4A0Y A;  1WQ2 A;  1H9G A;  1QGP A;  1ZG5 A;  1X3U A;  2HGC A;  2OA4 A;  3E6D A;  1HQC A;  1ZG3 A;  2W25 A;  1G3S A;  2EV5 A;  2ZNY A;  2XAS A;  3HOT A;  1V3F A;  3K2Z A;  2CYY A;  2XHK A;  4WWC A;  3PQK A;  2K86 A;  5K5R A;  4ASN A;  1G3T A;  1J2X A;  1RI7 A;  3LAJ A;  5JVT A;  2MH2 A;  4GGG A;  4ZZD A;  1W7P B;  2BV6 A;  2OD5 A;  2V1D A;  4H0E A;  2G7U A;  2JPB A;  3ELK A;  3WOD F;  3NQO A;  2A61 A;  1YS7 A;  4NQW A;  3TOA A;  2QBY B;  3BDD A;  2IA0 A;  1P6R A;  3MZH A;  1XDU A;  5HVQ C;  5ICC A;  5JHU A;  5K1Y A;  1LDD A;  3HTS B;  2XAJ A;  4M6Y A;  1RNL A;  2JT1 A;  3ZMU A;  4WF2 A;  1IXC A;  4KIG A;  3JAM K;  2QLZ A;  2YX7 A;  3GYH X;  2QWW A;  3RPQ A;  1FY7 A;  4GXO A;  1HKS A;  4RGU A;  1FBU A;  1SMT A;  4L9V A;  1O3S A;  3CTA A;  4ESF A;  3KZZ A;  4HV5 A;  2WWY A;  5L3D A;  4P9F A;  4ZZL A;  4UVB A;  4XLP F;  1K6O A;  3E5X A;  2FQ3 A;  2GWR A;  2NYX A;  1D3Y A;  4UV8 A;  5L3B A;  3P9I A;  5KVR A;  2HWV A;  4IRH A;  2H6B A;  2XRN A;  3O2P E;  4A0Z A;  4ENM A;  1ZHF A;  3K1N A;  1FT9 A;  2IA1 A;  5IT9 K;  1U5T A;  1T2K A;  3EYI A;  4LLG F;  2Z9O A;  4I09 A;  4RGR A;  3V8K A;  2AXL A;  2OZU A;  1ZRE A;  4G94 A;  2OU2 A;  2A3S A;  3O3K A;  4KIC A;  2GXB A;  4EJT A;  1LQ1 A;  1XSV A;  5DEQ A;  4BH9 A;  4UHT A;  1QNT A;  1FZP B;  4EM0 B;  4YG2 F;  4LLL A;  3RIR A;  1YYV A;  2ZFW A;  1PUE E;  1PDN C;  2DBB A;  2VBY A;  2M87 A;  4KIF A;  2PJP A;  3MFK A;  4P96 A;  4LGW A;  2ISZ A;  4AIH A;  3V7S A;  5BPD A;  4N9I A;  2R3S A;  3OV8 A;  3I71 A;  4CYD A;  3D5L A;  1F4K A;  1ZRD A;  3IKV A;  2ZNZ A;  2MH9 A;  4IRG A;  2O61 A;  5DDG A;  1IXS B;  3ERE D;  4I0B A;  2EA4 A;  2UXN A;  3I4P A;  4N9H A;  4HX8 A;  3RI4 A;  3H3Z A;  4A2U A;  3CJN A;  2P5V A;  5HLI A;  1I27 A;  3RKX A;  4LJZ F;  1R23 A;  3E97 A;  3IWZ A;  3I59 B;  1HKT A;  3QP6 A;  1G3W A;  3R61 A;  3EQL F;  3FM3 A;  2M1B A;  4LLN A;  5F64 A;  4KIB A;  2L4A A;  3CUO A;  4D0P A;  3J80 Z;  1YS6 A;  1E2X A;  3QPH A;  1R22 A;  4Q48 A;  3DF8 A;  2BBY A;  4EM2 A;  3IHU A;  4YIF A;  1ODD A;  2D1V A;  4GCV A;  2CW0 F;  4HQM A;  4HQE A;  2ZKZ A;  5LBQ A;  1G4D A;  4OIR F;  3F22 A;  3GX4 X;  2JPC A;  2ADU A;  3J80 K;  2E1N A;  1S7A A;  2K4J A;  2HYF A;  3F23 A;  5HLG A;  2FMY A;  3SQN A;  5D5U B;  1FSE A;  1Z7U A;  5ILV A;  2VN2 A;  2CSO A;  5LHI A;  1B59 A;  1S3J A;  2K27 A;  1STZ A;  2DI3 A;  2FNP A;  2HR3 A;  1HXD A;  3T0Y A;  2NAZ A;  2DU9 A;  5H6R A;  4WX9 A;  2DO7 A;  5L3E A;  5HDK A;  1LDJ A;  1PP7 U;  5E17 F;  4ETS A;  2F5F A;  1S6L A;  4OIN F;  2IRF G;  1B4A A;  2W24 A;  1DPR A;  1FNN A;  3KZY A;  2XAH A;  2FOK A;  1YIO A;  3DV8 A;  5LEK A;  1J0R A;  3C3W A;  4M73 A;  1R36 A;  3WG9 A;  3E6M A;  5BOX A;  2ZJ2 A;  5BS6 A;  2NNY A;  4MQV A;  1B9M A;  4ZYG A;  2RVC A;  1AOY A;  2RNJ A;  1ZGJ A;  5LGU A;  5EEH A;  2G9W A;  3KCC A;  3LQQ A;  4KUM A;  2ZME A;  5D8L B;  2Y0M A;  5FD6 A;  2HTJ A;  3GF2 A;  1XMK A;  1L0O C;  3BJ6 A;  2GZW A;  4ZYH A;  4EVI A;  2PLY A;  4GO1 A;  1U6G A;  3F8C A;  5ERI A;  4Y13 A;  5E18 F;  1FYL A;  1KU9 A;  2R7F A;  2QEN A;  2DQR A;  3HYI A;  1YQA A;  4MHG A;  1BC7 C;  3J81 Z;  4IHS A;  2IA2 A;  1Z6R A;  2PG4 A;  5ILS A;  2P7V B;  4GYI A;  4Z2Y A;  3FXU A;  1FX7 A;  3HSR A;  3I0T A;  3GFJ A;  2PMH A;  2UZK A;  4PGH A;  1QQI A;  4L0Y B;  3FM5 A;  4G7O F;  1SFU A;  1OYY A;  2GA2 A;  1O3T A;  4O5V A;  3Q5F A;  2YU3 A;  5LLQ A;  1Z9C A;  2EFQ A;  2W85 A;  1KU3 A;  4Q5S F;  2J5P A;  3FMQ A;  1XMA A;  2A6E F;  3BP8 A;  3TO9 A;  2IW5 A;  4DNC A;  4KMF A;  2XAQ A;  1FOK A;  2QBY A;  4BHP A;  1TQP A;  1B9N A;  4U0Y A;  4IHT A;  1OPC A;  3GLX A;  2HDC A;  1W4M A;  4MTE A;  4JBA A;  4Y17 A;  2VT2 A;  3P7N A;  5ILU A;  2VBX A;  3WTW C;  4RGX A;  3HUG A;  2FBH A;  2BE5 F;  4WXH A;  2VC0 A;  4HW0 A;  3PFI A;  4OOI A;  3LQR A;  4KN7 X;  1D5V A;  2BGC A;  4LK1 F;  3I54 A;  4Y15 A;  2F5C A;  3ZMT A;  4HV6 A;  3E5Q A;  3VFZ A;  2TDX A;  1R58 A;  5E8I A;  3CDH A;  4BNC A;  1R1U A;  2VT3 A;  2P6S A;  5D8K B;  2FE3 A;  1J5Y A;  4M72 A;  2QVO A;  2CO5 A;  3LA2 A;  2DK5 A;  2PBI A;  4CDG A;  3M1E A;  3F72 A;  4OIO F;  2VBW A;  3M7G A;  2KJB A;  2ZBK A;  3BJA A;  2H09 A;  4ZH4 F;  1RZ4 A;  4EJO A;  4RB3 C;  5HOO A;  2D45 A;  2RN7 A;  1A04 A;  4IJA A;  4BAY A;  4M74 A;  4CO8 A;  3QU3 A;  5DCM A;  4RGS A;  1MDM B;  4M71 A;  5CVI A;  4BQA A;  4LD5 A;  1LB2 A;  5DCM B;  2XUB A;  5CVR A;  1MDM A;  1LJ9 A;  4A12 A;  4EV0 A;  4CXF A;  1YLF A;  3N97 A;  2PN6 A;  4BYY A;  5LHG A;  3WTY C;  5K5O A;  2H94 A;  4EJU A;  1TW3 A;  1YW7 A;  2DLL A;  3BWG A;  2LKP A;  1QZZ A;  4XLN F;  1RUO A;  2FXA A;  1IN4 A;  2G7H A;  2VOP A;  3REO A;  5D5W B;  2LF8 A;  2JTV A;  4A0X A;  2Z33 A;  4EMS A;  1XSD A;  6PAX A;  1KA8 A;  1XGO A;  2WTE A;  2F2E A;  5A2Q Z;  1TTY A;  2E1C A;  4FHT A;  1BM9 A;  1LNW A;  3FMS A;  4YII A;  4Q47 A;  1E17 A;  3EET A;  1PP8 F;  4OU0 A;  1SD5 A;  4S05 A;  1U3E M;  3J81 K;  1BOA A;  3NEU A;  2EA2 A;  2IPQ X;  2EFP A;  3HRT A;  1YW8 A;  3E6B A;  2GXG A;  2JZY A;  2QQ9 A;  4R1H A;  2W84 A;  4P5O A;  3WGG A;  3U1D A;  1FP2 A;  5L3F A;  5HS9 A;  4S04 A;  2VC1 A;  2HQN A;  1J75 A;  3FZV A;  2OBP A;  3FXR A;  4FT8 A;  3HOS A;  4MQ9 F;  3G3Z A;  2A6H F;  2XAG A;  4ENJ A;  1P4X A;  5BQT A;  2Q8K A;  4G6D A;  2XRO A;  3SHF A;  2DAO A;  4LFU A;  1GXP A;  3E3V A;  2M30 A;  2ACJ A;  3CO6 C;  3QPT A;  2FBK A;  2PFB A;  3LST A;  3T1B A;  3T8R A;  4M9Z A;  1BBY A;  2ZME B;  4KA4 A;  4RAZ A;  2VXZ A;  1FYM A;  3IWF A;  3U2R A;  3IKT A;  3IRQ A;  2EB7 A;  4ZYE A;  1R00 A;  1T0F A;  2IVM A;  4M9S A;  2COM A;  3TDZ C;  1USS A;  2QQB A;  1EH7 A;  2EWN A;  4HZF A;  1LEB A;  3QRF F;  4MEY F;  2FNA A;  4L9T A;  3BPV A;  1FWZ A;  4L9N A;  3M8E A;  3DKW A;  4HX7 A;  2JRT A;  5E1X A;  5AON A;  1O7L A;  3ZN1 A;  1XD7 A;  1DDN A;  3HSE A;  1Z1D A;  3L00 A;  4R79 A;  2P7C B;  1W5S A;  1REP C;  4BHB A;  3DP7 A;  3TO6 A;  1U5T B;  3WTV C;  2QYO A;  1O57 A;  1IXR C;  3P9K A;  3J7A O;  3EYY A;  4IRI A;  3WTX C;  4A6E A;  3W6J B;  5LEJ A;  3ZPL A;  2PEX A;  3KE2 A;  2FML A;  3L7W A;  1DP7 P;  5D4S A;  4QLC U;  1Z6T A;  4HOB A;  5BMZ A;  1KU7 A;  4TV7 A;  5DUI A;  1ZRC A;  3FX3 A;  4MGR A;  1QO0 D;  1B1B A;  4N0B A;  3F3X A;  1KQ9 A;  2UWM A;  1I1G A;  2V9V A;  2GQQ A;  3AAF A;  4NHJ A;  1K7A A;  1FYK A;  4KT5 C;  5BPI A;  2XKO A;  3F6V A;  3K69 A;  1LEA A;  2HKO A;  4FX0 A;  1G6N A;  3KLN A;  4G8X A;  3GVA A;  5TRD A;  1OYW A;  4HLX A;  3DXJ F;  1OR7 A;  2Q2E A;  3HIF A;  3BJO A;  2R7D A;  2KRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...