4M6XA

Mutant structure of methyltransferase from streptomyces hygroscopicus complexed with s-adenosyl-l-homocysteine and methylphenylpyruvic acid
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
339
structure length
339
Chain Sequence
SHMSTEVSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHEFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
total genus 123
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4m6xA01
4PGHA 4XBFA 5IT9Z 2FRHA 2XRNA 1OKRA 5K5RA 2GXBA 4KYWA 2L4AA 3LQRA 2QUFA 4FX4A 3D5LA 3DQVC 1YO5C 2Q8KA 4L0YB 1P4AA 4EMSA 5CLSA 3ZQ7A 2Y0MA 4EJUA 5EEHA 3GFJA 2QBYA 1WQ2A 1ZHFA 4JQFA 4HAMA 2ZNYA 1H0MA 3DFGA 4P9FA 1TW3A 1SD6A 4L9NA 4IVNA 3I59A 1JE8A 4ESBA 3FF5A 1MKMA 1IRGA 2QENA 1DPUA 4LK1F 2Q2EA 4IPAA 1GXQA 1R36A 3E6BA 4LB5A 2QQ9A 3QAHA 5HOOA 1FBUA 4A5MA 3J80Z 4AIHA 4B8XA 3MCZA 1SAXA 2FNAA 2MC3A 3CUQC 5CVVA 4LLNA 3R61A 2HTSA 1JXSA 2HDCA 2KJBA 1QO0D 2EV6A 4A12A 2X4HA 1H9GA 1YLFA 4UNOA 3HRUA 4ZYEA 1MZBA 2PI0A 2RDPA 3M7GA 2V79A 4PGGA 4ASNA 4S05A 4KNYA 3GO5A 3E5XA 5H20A 4O5VA 1FSEA 3KEQA 1KU9A 3G73A 1BI3A 5FB2A 2GAUA 3WG9A 4RAZA 4CO8A 1IF1A 2W24A 4I2OA 1XB4A 2VOOA 4KUMA 1PDNC 3TO6A 3MQ0A 5KK1A 3IL2A 1FZPB 1V4RA 1SMYF 2RN7A 3HSEA 3SHFA 5LHHA 1UHMA 2OBPA 2P8TA 5H6RA 1HKTA 1NHAA 2HGCA 5HLHA 4XSXF 3O3KA 4G6QA 3F8FA 4KDPA 1USTA 2O03A 1PP8F 1OR7A 3R60A 4YFXF 3R0AA 2CFXA 3WODF 3QRFF 1O3TA 5ILSA 3F6OA 2LKPA 4M72A 1MJ9A 3IWZA 2M30A 1D8JA 4U0VA 4KIFA 3GW2A 2DT5A 5K5OA 4R1HA 1LDJA 3ZMZA 1YW8A 1HQCA 2A5YB 1OYWA 3MEXA 4F7ZA 1RUOA 4KN4X 4M6YA 1O3RA 4IRIA 5ICGA 4E70A 2F5FA 4A5NA 1FX7A 2PBIA 1CF7A 5F6FA 3GUDA 2L02A 3V7CA 3EYIA 3ZMUA 1WKMA 5DD8A 1D3YA 3VFZA 4HDVA 2MD5A 1D8KA 2EV5A 2WWYA 2M87A 3LSTA 2VBZA 5DDGA 3S2WA 2XKOA 1LNWA 1SD7A 5FLXK 2PN6A 2OD5A 1QZZA 3FXRA 4RGSA 1FYKA 2Z9OA 4N9IA 4UVBA 5HLIA 5FFZA 3G3ZA 5EEGA 4D0PA 3ROUA 4I02A 2O3FA 2QBYB 1OYIA 2P5VA 1ZGAA 2IA0A 5LEJA 5D8KB 2V9VA 3TOAA 3I0TA 3HTUA 2ADUA 5J8CA 2CQKA 3I59B 3K9TA 3QP6A 4OOIA 5BMZA 1A04A 1ZG1A 4U88A 5D5VB 4EV0A 3HRSA 2O8XA 3GFLA 3QPTA 5FGMA 2QWWA 2F5EA 5E8GA 2XKPA 1BI2A 4IHSA 2DPUA 5J8FA 2ACJA 5DCFA 4MTDA 2ZO4A 3C7JA 1GVJA 2HEOA 5CJ9A 1IN8A 2IP2A 5A2QK 1KU7A 4Y13A 2NRAC 3WTZA 4EVIA 2VBXA 4XLNF 5KVRA 4K2EA 4HX4A 3WE2A 1W7PD 5D4SA 4PCQA 3LAJA 3FXQA 2BBYA 2R3SA 4A6DA 1KGSA 1MDMA 5HS9A 3ERED 5FLXZ 5FO5A 1ZLKA 5ILVA 4O6JA 4RAYA 3F8NA 4HF0A 2XV4S 5AIPA 4NB5A 3FMSA 2O0YA 2YU3A 2RGVA 1SFEA 4FX0A 3RIRA 1BN5A 3GX4X 2H6CA 5FFXA 4P9UA 1QZYA 1XD7A 1HSTA 5DYMA 5TJJA 4G9YA 1R1UA 2QLZA 1S3JA 1LVAA 1AWCA 2BYVE 4G7HF 3KETA 2W84A 5D4RA 2WV0A 1BJAA 1WI9A 1ULYA 3HSFA 3C3WA 4HZFA 2P4WA 3I54A 2DTRA 2JSCA 3I5UA 3R6SA 3V4GA 2RQPA 4RB1A 1XMAA 4BHBA 1BI0A 5A2QZ 3WTTC 5BS6A 1KQ8A 2GIVA 1BC8C 4LMYA 1P2FA 2W25A 4DNCA 5LRSA 1T6SA 2W57A 4UUVA 4BXUA 3T1BA 3E3VA 1MD0A 3N97A 4Y15A 1CF7B 1YW7A 2ESHA 5E1XA 4L0ZB 1ODDA 2DPDA 1TNSA 4HX7A 3U1DA 2VONA 3SZTA 4HDUA 1R22A 2P6TA 3ZP5A 1J59A 5FD5A 4M6XA 1LEBA 4G94A 3TDUC 3P7NA 4S04A 4L18B 4YIFA 3E5UA 3WTVC 3L00A 2UXNA 2E1CA 3F22A 2D2WA 4OIQF 3T0YA 1ZGJA 4RGRA 3WTYC 2P5KA 1WWXA 4ETSA 1T2KA 4DQ2A 5CVIA 3EQLF 2J5PA 4L5IA 5BOXA 4BHPA 3KP6A 1LQ1A 2IRFG 5TRDA 2DBBA 4NQWA 3H92A 1QGPA 3FWEA 2VOPA 2L54A 1G4DA 4EJTA 1YYVA 5HVQC 2DU9A 5L3CA 3GZ6A 2FF4A 2PJPA 2ZFWA 1JHHA 3PQKA 2HFHA 2ISZA 2HWVA 3U9GA 2D45A 1K78A 4LD5A 2VC1A 2ISYA 4AIKA 1W5SA 1QBJA 4MNUA 4YG2F 3M1EA 4BAYA 2PMUA 2VT2A 5CYVA 1ZAOA 2QVOA 4BHCA 1XGOA 5ILUA 1SD4A 4IJAA 5ICFA 1BIBA 3WGHA 2A07F 1ZLJA 2QQAA 2DFIA 5LHGA 5LGNA 1FPQA 3HOSA 3BP8A 1G3SA 2NAZA 1XCBA 4WK8F 3LQQA 3JSOA 5LHIA 2HQRA 2Y75A 1MDMB 3KZYA 3Q5FA 4FHTA 2PQ8A 4EJVA 4WCGA 1O3SA 1ZN2A 1EH6A 3WGIA 3R0JA 1S7OA 3GWZA 5D5WB 3GYHX 4ZH4F 2ZKZA 1LB2A 2G9WA 2IW5A 2VT3A 2OAZA 4ZZDA 1U3EM 2CYYA 3RYRA 2JT1A 1S8NA 1PP7U 2MA3A 4NHJA 3AAFA 2LSOA 4BNCA 3V8KA 4WF2A 4KFCA 3I71A 2XAJA 3SFZA 4LG0B 2BE5F 4EQQA 3L9FA 2ZNZA 1T38A 4G6DA 5BPDA 4Z2YA 4GYGA 5LGUA 3E6DA 3GF2A 4LK0F 4OIPF 1G6NA 3KFWX 3CTAA 2DK8A 1DPRA 4A6EA 3MAJA 2PG4A 5CVJA 5BPIA 3FZVA 5K5QA 4MEXF 2NS0A 3N4MA 1GXPA 1J5YA 4UVAA 4UV8A 4LGWA 4WXDA 3D0SA 3M8FA 1TQMA 1G3TA 3CJNA 2KRFA 3VODA 3I4PA 3T8TA 2FE3A 3EDPA 2PLYA 3TKYA 3TOBA 2V1UA 3P9KA 3OV8A 1S29A 3U2RA 3T8RA 1REPC 1G3YA 3BZ6A 4JBAA 1O3QA 4U0WA 2STTA 3BWGA 2DW4A 3KP3A 4YFNF 1ON2A 5LEKA 5L3GA 4XLPF 4HV5A 3TO7A 3RI4A 1E2XA 4QLCU 2IJLA 2LNBA 4EGZA 2Z33A 4U7BA 2RV8A 1HW5A 2GWRA 3HTSB 2D1VA 2DLLA 3BOQA 5E1ZB 4MQVA 2F5CA 3RDIA 1OPCA 4A0XA 5D6FA 5AIQA 3QP5A 4U7DA 5LLQA 2EA2A 1SFXA 4ON0A 5K1YA 3TDZC 4WX9A 2YSRA 3W6JB 1TLHB 1I1SA 3RKYA 3IKTA 1TNTA 5HLGA 2JRTA 3FM3A 3MWMA 3GFIA 1Z1DA 2FBKA 1Z6TA 5JVTA 3IKVA 1BIAA 4HW0A 3H3ZA 2DI3A 4L5JA 1FP1D 1IW7F 4I7HA 1ZARA 1UFMA 3I58A 2M45A 1G3WA 1P92A 4WXHA 4HBLA 3REOA 1K78B 2K4BA 1F9NA 3DV8A 1R00A 1W7PA 3GVAA 4B09A 4OU0A 4OMYA 2IT0A 4UXNA 2H09A 1FWZA 2DO7A 5CVRA 2K27A 4N9HA 1ON1A 2ZMEA 3F8BA 1T39A 5ED4A 2D1HA 1P4XA 3CUOA 3LAPA 4HQEA 2K7LA 3WTXC 4A0ZA 1R1VA 1Z6RA 3O6BB 3T5XA 5JI6A 1KU3A 4L9TA 2RKHA 5E1WA 1DUXC 1XSXA 1BC7C 2K4JA 3DPTA 4IRGA 2XAQA 3H3UA 4YIIA 2O61A 2AS5F 3ZMSA 4KIBA 1ZYRF 1Z05A 4HQMA 1XDSA 2K86A 4HF1A 2KIFA 2EK5A 2HS5A 1HW1A 4L9JA 1R58A 4BQAA 2X0LA 3KZZA 4BYYA 4G7OF 1USSA 2A6HF 4CGZA 5LRRA 5L3FA 4M71A 3GEZA 3VB2A 1KYZA 3PQJA 4MHGA 1D5VA 2F5DA 2H94A 2RVCA 3WU1B 2L4MA 4XSZF 3K0LA 3ZMDA 1UCRA 3E6MA 3MZYA 3C1DA 3L7WA 5J6XA 5H6QA 1XSVA 2IVMA 2HTJA 1YG2A 1IN7A 2JPCA 2CGPA 3MZHA 1S7AA 3DP7A 4EM1A 2GA2A 4EGYA 1FP2A 1STZA 1GHCA 5HS8A 4HLYA 3SQNA 2YX7A 4LG0A 4RB3C 4U0YA 3ISPA 2MH2A 3QU6A 3BDDA 4YFKF 3J81K 4WXCA 3HHGA 3HHHA 2XVCA 2DK5A 1BOAA 1BBYA 4I09A 2OZ6A 3RPQA 1XSDA 1TQIA 1FYLA 1HXDA 5FD6A 2GZWA 3F21A 2DQLA 2HZTA 4UV9A 2VBWA 2ELHA 3V8JA 1F5TA 4IRHA 3ABTA 3HRMA 3VEPA 3CO7C 3V7RA 1R7JA 2M5WA 3PFIA 1U8RA 3GXOA 5E17F 2XIGA 3F23A 2VODA 1YIOA 4AIJA 3Q9SA 4IF4A 2HKXA 4GXOA 2HQNA 3BJOA 4FT8A 3ECOA 4Q48A 5DV5A 2EB7A 2ESNA 2GQQA 3FMRA 2MH9A 5AONA 1V3FA 3K69A 2EV0A 3DEUA 4MGRA 4M9ZA 1ZRCA 3KEOA 2CG4A 5LBQA 4XRFA 3C18A 1IXRC 4M74A 1JHFA 2O6GE 3WU0A 3M9AA 3NEUA 2MLKA 3JW4A 3KP7A 3GZ5A 1BM9A 3GLXA 3KP5A 1IXSB 3KP4A 4UHTA 3BPXA 1IAWA 5DEQA 3K1NA 1B1BA 1Z7UA 1B9NA 2VXZA 1W5TA 2UXXA 3E97A 1W7PB 2EFNA 4G7ZF 3QU3A 5BQTA 3J81Z 2Z99A 5ICCA 4ENJA 3DPLC 3F72A 1K79A 1R5HA 1EV7A 1J0RA 2OZUA 4M73A 1XGNA 2ZMEB 4I98B 1SMTA 2YPRA 2OQRA 1LEAA 2FSWA 4RB0A 1J7KA 1L3LA 1Z9CA 5LGTA 5CVUA 4BH9A 1HW2A 1R5GA 3I53A 3BPVA 4KMUX 2MLGA 4ZYGA 2LF7A 2DAOA 4N0BA 3DF8A 1WRJA 1QQIA 1KA8A 2CW0F 1BI1A 4LLGF 2H27A 3WTWC 1XGSA 1J2XA 2BEOA 1LDDA 3FHZA 2CSOA 1U5TC 5D8LB 1TW2A 2ZBKA 3F6VA 3J7AO 4IHTA 2K02A 4LB6B 1O57A 4TV7A 2UWMA 3DXJF 3RJPA 5HDKA 2RC4A 4HYEA 4ESJA 1KQ0A 4QWQA 4JK1X 3FX3A 3ECHA 1CGPA 3IC7A 1SFUA 3KCCA 1S6LA 4OMZA 4EM0B 4Q4ZF 1H9TA 2FEZA 3BROA 1R1TA 1KU2A 3V8LA 3ZMTA 2EFWA 3TQNA 3LA3A 3P9CA 3B02A 3R4KA 3WTSC 3L09A 4OINF 5JR3A 1XCVA 1FSHA 1KYWA 2PEXA 2V6CA 4G8XA 3WE3A 2JPBA 1WSUA 4ZZLA 3IRQA 4HLXA 2XGXA 1HKSA 2H6BA 4EJWA 1FBSA 5L3DA 2HOEA 1IN5A 1U5TA 3TGNA 2P7VB 2EJRA 1JGSA 1UHWA 3GFMA 4R8HA 3M8EA 3HSRA 4ENKA 5DD4A 2A6EF 4RGXA 1YW9A 2STWA 2R7DA 5D6EA 1FBQA 4LLLA 2FOKA 2NYXA 1DP7P 2MBFA 2XROA 4P96A 3KLOA 4KICA 1FT9A 1B59A 1J9IA 1ZRDA 4Q47A 1QPMA 4OIOF 1RNLA 4IXAA 2GA1A 1YS6A 3OOPA 2XUBA 4KN7X 5DCMA 3RKWA 1L0OC 2E1NA 2VN2A 2VE9A 4LJZF 1ONVA 3K1PA 4CYDA 4GO1A 3B73A 2QYOA 2C6YA 3I64A 2OA4A 4KIGA 1IZ1A 1ZH5A 2PFBA 2KJCA 3IRRA 4KMFA 4I0BA 1HSJA 3CUQA 1VTNC 2FXAA 4GYIA 5F64A 4UVCA 4EM2A 4CXFA 4CHUA 1YFHA 3SZPA 2ETHA 3NQOA 5F1RA 1ZRFA 4EJOA 3ML6A 2B0LA 3RKXA 2A61A 2WTEA 2FA5A 2IPQX 1XDUA 3ZN1A 1T0FA 5IT3A 5JFRA 2RNJA 3QOPA 4HX8A 1B6AA 5E20A 5D5UB 4KA4A 3CLOA 3VOEA 2KIUA 3IWFA 1U78A 2A3SA 1Q1HA 2J5OA 2P7CB 2KKOA 2F2EA 2G7UA 3ULQB 1TBXA 3HOTA 4R79A 4WWCA 1FOKA 2VE8A 2IA1A 3COAC 2QQBA 3BJAA 5L3EA 2NNNA 2A68F 3NRVA 4PDKA 1Y0UA 1KQ9A 3F8CA 1I5ZA 3HRTA 3TO9A 3BJ6A 2CO5A 2V1DA 3MFKA 3O2PE 1MJBA 4M9XA 5E18F 2EFOA 3LA7A 1OYYA 5HDNA 3SXYA 2W85A 3RYPA 1P6RA 3JSPA 4AWXB 2VC0A 5DUKA 5ERIA 1W4MA 4CZZA 4GGGA 4I0AA 4CDGA 3HYIA 1XMKA 2QM3A 2AXLA 2HR3A 1O7LA 3CO6C 1UB9A 4L9VA 3KE2A 5HDGA 4ENNA 1YQAA 1FYMA 1J75A 2Z5UA 1E17A 4LFUA 2HKOA 4HV6A 1RUNA 4ENMA 2Y48A 1HKQA 4HOBA 3Q9VA 4RS8A 5D5XB 1FNNA 2L3DA 1U5TB 1ZREA 2COMA 2EFPA 3V7SA 4AD9A 1F1ZA 3LWFA 6PAXA 4GCVA 2YR2A 4OIRF 3DKWA 3HIFA 2XAFA 4A0YA 1MJAA 2JTVA 2YX4A 1B4AA 2ZCWA 3BY6A 5L3BA 1TTYA 4ESFA 2VBYA 3LFKA 3FXUA 2P5LC 2TDXA 5ICEA 1B9MA 2DQRA 2R7FA 2GXGA 2OQGA 3E5QA 1QNTA 2CWEA 3ZPLA 3KP2A 4I01A 1IRFA 4KT5C 1IN4A 2EFQA 2P6SA 5DCMB 3L2CA 2IA2A 4O3MA 1FC3A 2XASA 1LJ9A 1I1GA 1IN6A 5HS7A 1SD5A 3LA2A 1IUYA 1O7FA 3KLNA 1EH7A 2G7HA 2ZJ2A 4ZYDA 2QZ8A 1XGMA 3EYYA 4P55A 1I27A 2FNPA 3QPHA 3HUGA 3W6KB 1YS7A 2WC2A 2FMLA 1RZ4A 3IHUA 3EETA 2HYGD 2BGCA 3CUQB 2M1BA 3JAMK 4MTEA 4RB2C 2UZKA 2XHKA 3F3XA 2E7XA 2ZXJA 4Q5SF 3ELKA 3EUHA 1EH8A 3WGGA 1Z91A 1C0WA 5IT9K 2FBHA 4Y17A 1IXCA 1ZG5A 1TQPA 1ZG3A 2FBIA 1X3UA 1AOYA 4HF2A 2M8EA 3CDHA 4CICA 5DUIA 3K2ZA 1HBXG 1YTYA 2FMYA 2EWNA 4M9SA 2XAHA 1P4WA 1RIOH 1T98A 3RTRA 4ZYHA 1U2WA 3ABUA 2KIMA 3FMQA 2FU4A 1U6GA 3JTHA 1XN7A 2L01A 4HA8A 1RI7A 2JZYA 3RPUA 2LF8A 3FM5A 2EA4A 2FQ3A 2A69F 2XAGA 4H0EA 4A2UA 2HYFA 1FLIA 1LDKB 2E7WA 1K6OA 3ZMVA 3ZN0A 4AVPA 3K1MA 3E6CC 1I6XA 2LDUA 3J80K 3JTGA 2NNYA 1R23A 3F8MA 1OMIA 4PZJA 4RGUA 1DDNA 4MQ9F 3P9IA 2BV6A 1K7AA 3JAMZ 5E8IA 2Q0OA 2V1XA 1MGTA 1FY7A 1F4KA 2PMHA 2Z3YA 4MEYF 1PUEE 4P5OA 2OU2A 5JHUA 3WTUC
chains in the Genus database with same CATH superfamily
4PGHA 4XBFA 2K9QA 2R0QC 5IT9Z 2FRHA 2XRNA 3MN2A 2R92J 1OKRA 1X1PA 5K5RA 4IHVA 4W97A 2GXBA 1JUSA 4KYWA 1T33A 1YJNI 9ANTA 2V4JC 3H9GA 2L4AA 3LQRA 2F4IA 2QUFA 3DBLB 4FX4A 3D5LA 3PNTA 4HG2A 2B9SA 1NG6A 2BVMA 3SFIA 3JCUC 3DQVC 2DMQA 1YO5C 4BU2A 2OUMA 2Q8KA 2K5CA 2CUJA 3CMYA 4L0YB 1JKPC 1P4AA 4EMSA 5CLSA 1OCCH 3HB9A 1A5JA 3ZQ7A 2Y0MA 4EJUA 5EEHA 3GFJA 2QBYA 3ZRGA 1MMNA 3PFYA 1WQ2A 1ZHFA 4JQFA 3OR1C 4HAMA 2ZNYA 1H0MA 3DFGA 4P9FA 2DOFA 1NK3P 3O8GA 1TW3A 5EJCA 2KISA 4B3XA 1SD6A 4L9NA 4C3JJ 4IVNA 4AU7A 3OS0A 3I59A 1QU3A 2XF7A 1JE8A 4ESBA 4PJLA 1RC9A 3H0DA 3FF5A 1MKMA 3HEFA 1IRGA 2QENA 1DPUA 4LK1F 2Q2EA 3HBLA 4IPAA 1GXQA 2EPFA 1R36A 3E6BA 4LB5A 2QQ9A 1JTYA 1V5EA 3QAHA 5HOOA 1FBUA 4F55A 4CA0A 4A5MA 3B6CA 4HSRA 5M3FJ 2BHZA 3J80Z 3DEEA 5EDNA 4AIHA 3NWTA 4B8XA 4CCJA 1UZCA 3MCZA 4C30A 1SAXA 2FNAA 4CUGA 2MC3A 1JJ6C 3ZGKA 5J1RA 3CUQC 5CVVA 4E7LA 3HKZA 4LLNA 3R61A 2XPUA 4A3JJ 2HTSA 4E7JA 1JXSA 3GTQJ 2HDCA 3FK7A 3MKYB 3AG3H 2VJIA 2KJBA 1QO0D 5JVGF 2EV6A 4A12A 1S72I 2X4HA 1U8BA 1Y0NA 1H9GA 1YLFA 3H36A 1YIJI 4UNOA 2H8RA 3FIWA 3HUGB 2ECBA 3HRUA 4ZYEA 3SZGA 1MZBA 1S9HA 2PI0A 1WJAA 2RDPA 3M7GA 2V79A 4PGGA 4ASNA 2JA6J 4S05A 4KNYA 3QYBA 1WJ5A 3GO5A 4XM3A 1ZR2A 4JX5A 3E5XA 5FJ8J 5H20A 4O5VA 1FSEA 2NVXJ 3KEQA 3SEZA 4A3GJ 3PM1A 2HVRA 1KU9A 3G73A 1BI3A 3C2BA 5FB2A 3L1PA 4XN3A 4DOZA 2GAUA 3E1SA 4BDYA 2X48A 4XLAA 3WG9A 4RAZA 1Y56A 4CO8A 1IF1A 2PX9A 2W24A 1SANA 4BE2A 4I2OA 1XB4A 2VOOA 1OFCX 4KUMA 1QPIA 2HDWA 4XKVA 3TO6A 4AIDA 1PDNC 3MQ0A 1Z3YA 5KK1A 3IL2A 5EZHA 1WI3A 1X4OA 1FZPB 1V4RA 1P7JA 1SMYF 2I8DA 2RN7A 3CP8A 3HSEA 3SHFA 1UHMA 5LHHA 2OBPA 2M0CA 3DCFA 2P8TA 2DFEA 5JHFA 5H6RA 1R6RA 1HKTA 1V54H 1NHAA 2HGCA 4NC6A 5HLHA 2VKEA 1H8AC 2Y9YA 3RZOJ 4XSXF 1AKHA 2GM4A 3O3KA 4G6QA 3F8FA 1D1CA 4KDPA 4W1UA 1USTA 2VQGA 2FX0A 2O03A 1PP8F 3LSJA 1OR7A 2FQ4A 2RAEA 4KISA 4BL0B 3DLLF 2R5YB 1RESA 3R60A 4YFXF 5EG0A 3R0AA 2CFXA 2CQQA 3PUFA 3WODF 3QRFF 1O3TA 5ILSA 3F6OA 2LKPA 2EZIA 4BXFA 2MW8A 4M72A 4D5CA 1WPKA 1MJ9A 2WAFA 3QWLA 3IWZA 2M30A 1D8JA 2GOMA 4GDFA 4CCLA 2LP0A 1LFBA 3D5RC 2V1NA 4U0VA 3MMYB 3JRCA 4KIFA 2F48A 3GW2A 2DT5A 1A6QA 3CMMA 5K5OA 2Y0SN 4R1HA 1LDJA 3ZMZA 2IS6A 1YJ9I 1YW8A 2JSPA 1W0TA 3FISA 2XGEA 1HQCA 2A5YB 1OYWA 1BR2A 3MEXA 1VF9A 2V7FA 2LH9A 4F7ZA 1TC3C 1RUOA 4KN4X 4M6YA 1O3RA 4IRIA 2DT7B 4PJNA 5ICGA 3UNGC 5B1BH 4E70A 2F5FA 4A5NA 1FX7A 3F0CA 2PBIA 5CQEA 1CF7A 3BG7A 4NQWB 1IC8A 3ERMA 5F6FA 3GUDA 2L02A 3V7CA 3EYIA 5B5EC 3ZMUA 1ITYA 1P7IA 1VI0A 2IXSA 1WKMA 3RQ4A 4BE1A 5DD8A 1D3YA 3VFZA 2CUEA 4HDVA 2MD5A 2LTPA 1D8KA 2EV5A 4DW6A 2R4GA 2WWYA 2M87A 2B7EA 3LSTA 3W2WA 5DS9A 1VQMI 2VBZA 5DDGA 3S2WA 2XKOA 1WZ2A 1FIAA 1LNWA 5GP9A 1SD7A 5GADJ 3ABKH 5FLXK 2IBDA 3DBHB 1X19A 3BTLA 2IEKA 2PN6A 3HL2A 2OD5A 3QQAA 1QZZA 3FXRA 5F0FA 4IHWA 4RGSA 1FYKA 2Z9OA 4N9IA 1FOYA 4UVBA 5HLIA 3M07A 4XLHA 5FFZA 3KZIC 3G3ZA 2WY8Q 5EEGA 3BTCA 4D0PA 3ROUA 3OSGA 4A3CJ 3L2QA 4I02A 3LSRA 2O3FA 2QBYB 1OYIA 2P5VA 3H1CA 3TP0A 1ZGAA 3OSFA 2IA0A 2XB5A 1MW7A 3OS2A 5LEJA 1AHDP 5D8KB 2NXNB 4NUBA 4F92B 2V9VA 3TOAA 1JKOC 2K9NA 2KP6A 4BXXJ 3I0TA 3VYRB 3HTUA 2ADUA 3S1RJ 5J8CA 3QODA 2CQKA 2V9PA 3AG2H 3I59B 3K9TA 3QP6A 3K4JA 5FRMA 4OOIA 5BMZA 1A04A 2Z2SB 4RLFA 1ZG1A 5LD2C 2Q2EB 4U88A 5D5VB 4Y52J 4EV0A 4BDZA 4XKBA 3OYMA 3HRSA 4B48A 4B44A 5GAEJ 2O8XA 3GFLA 5DM7F 3QPTA 2ZJRF 3TP3A 5FGMA 2QWWA 3BTIA 1Z0XA 1ETYA 2F5EA 5E8GA 1YITI 1MMGA 3S1QJ 2XKPA 2CQ7A 2KZVA 1VQPI 4E7HA 4ZTJA 1BI2A 4IHSA 3CCQI 2ZXIA 2DPUA 3Q0VA 3RCOA 5J8FA 1K6YA 3IV5A 2ACJA 5DCFA 4MTDA 2XF6A 3GTMJ 2ZO4A 2XRLA 3C7JA 1GVJA 1HA8A 4HNTA 2HEOA 5CJ9A 1IN8A 2IP2A 3K4BA 5A2QK 1KU7A 3LFUA 4Y13A 2NRAC 3WTZA 4BE0A 5J40A 4EVIA 2VBXA 4RAGA 4XLNF 5KVRA 4AYBN 4B43A 4K2EA 4HX4A 3Q0WA 1W7PD 3WE2A 5D4SA 3FBIB 4PCQA 3LAJA 2AQEA 3FXQA 2BBYA 2R3SA 4C3IJ 4A6DA 2R7WA 1KGSA 2AXTC 1ZGWA 1MDMA 5HS9A 3ERED 2A05A 1TT5B 4BKXA 2WAQA 2P0WA 5FLXZ 3OYLA 5FO5A 1ZLKA 5ILVA 4O6JA 3G6EI 4RAYA 3F8NA 4HF0A 2XV4S 5AIPA 3HOZJ 4NB5A 1OCZH 3FMSA 4RA2A 2O0YA 1T8IA 2H1KA 2YU3A 1W36D 2RGVA 3OIOA 1SFEA 2X9DA 4FX0A 5IYDJ 2B63J 3RIRA 3LSGA 1WVRA 1IG7A 3EUKL 2OPTA 1BN5A 3GX4X 5M5WJ 2NS7A 4DIQA 1Y1WJ 3OR2C 3V42A 3ESWB 4RM2A 3PUBA 2H6CA 5FFXA 4P9UA 1XS9A 1QZYA 1XD7A 3FXLA 3KPHA 4A3EJ 1HSTA 1EF4A 5DYMA 1AKHB 3W2AA 1VQ9I 5TJJA 1LFPA 2W7NA 4G9YA 2BW3B 1R1UA 2DOAA 2QLZA 1QA6A 3CMEI 1JI8A 5J4VA 1S3JA 5KHDA 1LVAA 2JN6A 1D0YA 4XLEA 1AWCA 2JA8J 4U87A 1FIPA 4FQGA 2BYVE 2JRMA 4XNFA 5EG0B 1TP4A 1MBHA 4CH7A 2ECCA 3GCMA 4G7HF 3KETA 2W84A 3G1MA 5IP7J 4RDUA 1ZKGA 3OIQA 5D4RA 2WV0A 1BJAA 1GUUA 5FKOA 1WI9A 1ULYA 3HSFA 2WB1A 3LNQA 3C3WA 1A36A 3SJMA 2VJJA 4HZFA 2P4WA 4M3GA 3I54A 2DTRA 2JSCA 3D5SC 4IHXA 1X1CA 3B6AA 4B1RA 3I5UA 3R6SA 3SDGA 3V4GA 2VB6A 2RQPA 3WU2C 4Y33A 1R5ID 4RB1A 1XMAA 4BHBA 3CJQB 1UHSA 3IUOA 1BI0A 5A2QZ 3WTTC 1VQ6I 3C2HA 5H2FC 2LC2A 1T08B 5BS6A 1KQ8A 3K2AA 2GIVA 4Y3OA 1BW5A 3CLQA 1BC8C 4QPQA 3PO3J 2XSJC 2EINH 1P2FA 4LMYA 4RLQA 2W25A 4DNCA 2L7FP 5LRSA 1T6SA 2W57A 4UUVA 4BXUA 2E2JJ 3T1BA 3E3VA 1MD0A 2Y30A 3N97A 5FLVA 1SFKA 4Y15A 3HOXJ 1VQ4I 1WFXA 3QYEA 4KJZA 2PJRA 3S1MJ 2HOAA 1YW7A 1CF7B 2ESHA 2E19A 1U0JA 5E1XA 4L0ZB 3K10A 4J00A 1H88C 3CP2A 5KAFC 1ODDA 2DPDA 1TNSA 4HX7A 3U1DA 2VONA 3K7AJ 2LK2A 2X6XA 3SZTA 4HDUA 1R22A 4YRVA 1ACIA 2P6TA 4ZJZA 3PSFA 2EIJH 3ZP5A 1GV2A 1J59A 5FD5A 1UG0A 4CCKA 4M6XA 1LEBA 2CQXA 4G94A 3TDUC 3P7NA 1VNDA 4S04A 4L18B 1DU0A 4YIFA 3E5UA 3WTVC 3L00A 1Z7LA 1WHUA 2UXNA 1QVUA 2E1CA 1X2MA 3OYCA 3F22A 2DOEA 2H8WA 2D2WA 4OIQF 3T0YA 2LKXA 1ZGJA 3BCAA 2MFZA 4RGRA 3WTYC 2P5KA 2WY7Q 1WWXA 2UUZA 4ETSA 4UB8C 2DA2A 2NVQJ 1T2KA 4DQ2A 2QEXI 5CVIA 3OYKA 3S3MA 3EQLF 4E7IA 2J5PA 4L5IA 5BOXA 4BHPA 1JUPA 3KP6A 1LQ1A 2IRFG 5TRDA 2DBBA 4NQWA 2N8GA 3K6GA 2ZSIB 5LFAA 3H92A 1QGPA 3FWEA 2VOPA 2L54A 4BY7J 1JUMA 1NG7A 5TGTA 1X1DA 1G4DA 3JRDA 4EJTA 1YYVA 5HVQC 2DU9A 4GFBA 5L3CA 2XC7A 3GZ6A 2F6CA 2FF4A 3KIOA 2EZHA 2CFOA 2ZFWA 5E79C 1JHHA 3PQKA 3PL8A 2HFHA 4Y4RA 2XSDC 4I6ZA 1D0XA 3HOWJ 2ISZA 3CCUI 3MVPA 2JA7J 2V9KA 4AVZA 3BZKA 2L9RA 2HWVA 4YELA 4D7MA 3U9GA 2D45A 3VPRA 3A01A 3CQZJ 3AG4H 3HM5A 1SVMA 1K78A 4LD5A 5FKNA 2VC1A 3ONQA 1B8IA 2ISYA 2EIKH 1WCMJ 4XORA 4AIKA 1W5SA 4IOCF 1UG2A 1QBJA 2X6OA 4L5EA 4MNUA 4YG2F 2K9MA 4C3HJ 3M1EA 5EYRA 4BAYA 2PMUA 2X1DA 2VT2A 5CYVA 1UELB 3TL4X 1ZAOA 2EZLA 1I3AA 2QVOA 2EILH 3LSHA 4BHCA 2Q1ZB 4UUTA 4QPOA 1XGOA 2NOJB 2VLAA 5ILUA 1SD4A 4IJAA 5ICFA 1BIBA 3WGHA 2PMZN 2A07F 1ZLJA 2EH3A 2QQAA 3PNYA 2DFIA 1WJDA 4RBOA 1MIJA 1ZTRA 4YEJA 5LHGA 5LGNA 1FPQA 3HOSA 4XN0A 3BP8A 3OYBA 1G3SA 2NAZA 4LIUA 1XCBA 3H35A 4WK8F 3LQQA 5EGOA 5LHIA 3JSOA 4BJTA 2HQRA 2Y75A 1MDMB 3KZYA 3Q5FA 3J7AY 4FHTA 4XK4A 2PQ8A 1D1AA 4EJVA 1VZ0A 1SAUA 4WCGA 1O3SA 1ZN2A 1EH6A 3WGIA 3R0JA 1S7OA 3GWZA 5D5WB 3I55I 5B3SH 3GYHX 3GTGJ 4ZH4F 2ZKZA 1MNMC 1WJBA 1LB2A 2HVSA 2G9WA 2IW5A 1RKTA 2DMNA 2VT3A 3OL3A 1EJ9A 3OYGA 2OAZA 4NDLA 3X2QH 4Y7NJ 4ZZDA 2JQ7A 2BHYA 1U3EM 2CYYA 4CCMA 3K4NA 2L7KA 1T56A 2BZTA 3RYRA 1QVTA 2JT1A 3EPZA 1OR7C 1S8NA 1PP7U 2LRDA 2MA3A 4B3AA 3AAFA 4NHJA 2LSOA 1QHGA 4BNCA 4JX4A 3V8KA 4WF2A 4KFCA 3I71A 4XOTA 4XIDA 2XAJA 3U21A 1IO2A 3CCSI 3SFZA 3PIPF 5IYBJ 4LG0B 3K4LA 2IS4A 2F4MB 1SFOJ 2BE5F 4EQQA 5FKLA 3L9FA 2ZNZA 1T38A 4G6DA 1K4TA 5BPDA 4Z2YA 4HNUA 1OCRH 4GYGA 5LGUA 1NK2P 3E6DA 2PJPA 2FOWA 3GF2A 4LK0F 2KMUA 3CJRB 2QSGX 4OIPF 1G6NA 3KFWX 2VXDA 3CTAA 2I10A 3Q3SA 1WGXA 3K4MA 2HPMA 2DK8A 1OLTA 1DPRA 4F93B 4A6EA 4LOCA 5FROA 3MAJA 1JGGA 2PG4A 5CVJA 3ZQHA 3CCMI 1I39A 3A02A 5BPIA 3FZVA 2JA2A 5K5QA 4MEXF 2NS0A 3N4MA 4ZDPA 1GXPA 1J5YA 1WH7A 4UVAA 4UV8A 1R71A 4LGWA 2ZJPF 4WXDA 1OJLA 3ZQLA 4ANJA 2XGDA 3D0SA 3M8FA 2WV1A 1TQMA 1F36A 1G3TA 2R93J 4XICA 1IV8A 3CJNA 3S17J 2KRFA 3VODA 3IP4B 3I4PA 3T8TA 2FE3A 3S16J 3EDPA 2M3AA 4II3A 2PLYA 2VJ4A 1D1BA 4BACA 4QSHA 3TKYA 3TOBA 4CYCA 2V1UA 2CW8A 3P9KA 1U9NA 3OV8A 1S29A 3U2RA 3HPGA 2WA0A 5IY5H 3T8RA 5FRNA 1REPC 3CF5F 1G3YA 2WB1N 3BZ6A 4JBAA 3MD2A 1O3QA 4U0WA 2STTA 2VPRA 2E60A 3BWGA 3JRBA 2DW4A 2JUCA 2BW3A 4M6VA 3KP3A 4BY1J 4YFNF 3GTPJ 1YX5A 3LMMA 3UR3C 1ON2A 2DJNA 3JR9A 5LEKA 2BY0A 2PJRB 1V5GA 5L3GA 4XLPF 4HV5A 3TO7A 4BBRJ 2D5VA 3WHBA 1E3HA 3RI4A 1E2XA 4QLCU 2X51A 2IJLA 5JLXA 2LNBA 4EGZA 3G4SI 2IGOA 1BW6A 4XRMA 2Z33A 2LKSA 1JKQC 5HNHA 4U7BA 4D5FA 2TRTA 2OC6A 2RV8A 3D1NI 1HW5A 2R7TA 4FASD 2GWRA 4IKFA 3HTSB 2D1VA 2DLLA 3BOQA 2Y31A 3K70D 5IP6A 1K4SA 3QOEA 5E1ZB 4MQVA 4AC0A 2F5CA 3RDIA 5J4YA 1RRJA 1OPCA 4NC8A 4ABZA 4A0XA 5D6FA 5AIQA 2KIQA 3QP5A 4FE4A 3ASOH 3MKWB 4U7DA 1WJCA 5LLQA 3OY9A 4IO9F 4ZDOA 2EA2A 1W36C 2VKVA 2DODA 4PSWA 5HNFA 1SFXA 5JLWA 3QYFA 2WBMA 5CQGA 4ON0A 2LYCA 5K1YA 2DMUA 2Y69H 3TDZC 4WX9A 3NARA 2YSRA 3W6JB 1TLHB 3I4NJ 1I1SA 4II2A 3RKYA 3PO2J 3IKTA 1TNTA 5HLGA 2JRTA 3FM3A 3MWMA 4BQQA 3GFIA 1ORKA 1Z1DA 4M3FA 2FBKA 1RKWA 1J09A 1Z6TA 1O4XA 5JVTA 5E3MA 3IKVA 3DPUA 1BIAA 1VQ7I 1YE9A 1YRNA 4HW0A 2L2OA 2ICWG 3DBRB 3H3ZA 3FHNA 2DI3A 2XAUA 4L5JA 1FP1D 1IW7F 4BJ5C 4I7HA 4DZPA 1ZARA 2R7UA 1BR1A 4IOAF 3VSKA 1N75A 1UFMA 2HZDA 3I58A 3DTEA 2M45A 4HNVA 3H3VK 1G3WA 3DLAA 1FEXA 2CMPA 4BBSJ 3A01B 1P92A 2JJ7A 4WXHA 2MSYA 4HBLA 4N4OB 4E4HA 3REOA 4AUXA 1K78B 2ID3A 2K4BA 3BCBA 4C2UA 3G1OA 1B8IB 1F9NA 3H5NA 5GAHJ 3DV8A 2CQNA 1R00A 1W7PA 2KRHA 3GVAA 2L7ZA 4B09A 4OU0A 4OMYA 3ZR8X 2VPLA 2IT0A 4B47A 4UXNA 2LFBA 2H09A 1FWZA 2DO7A 1PVEA 4PUSA 2ZSHB 4XL9A 2EQRA 5CVRA 1IDYA 2K27A 2WADA 4N9HA 1ON1A 3PIOF 2ZMEA 3F8BA 4M3DA 2LG4A 1HDPA 2M7BA 1T39A 5ED4A 2D1HA 3KYLA 1P4XA 2E1OA 3CUOA 2ZJQF 4A3BJ 2HI3A 3LAPA 4HQEA 2K7LA 3WTXC 4A0ZA 4J19A 1R1VA 1Z6RA 5EGOB 3O6BB 3T5XA 2E2IJ 1H89C 4M3BA 5JI6A 1KU3A 1XTAA 4L9TA 1GT0C 3LSKA 5BNGA 3CCVI 1KZHA 2RKHA 5E1WA 5DTDA 1DUXC 1LE8A 4BEHA 4E7KA 1ENHA 1XSXA 1BC7C 2VQCA 4BQNA 2K4JA 2KZGA 4HEA2 3DPTA 5CKTA 4IRGA 2DXIA 1Y39A 2XAQA 3Q0UA 1IDZA 4MO7A 3H3UA 3RZDJ 1UMQA 4YIIA 2O61A 3BG6A 2CU7A 2AS5F 3S2DJ 3ZMSA 3A2KA 1X1AA 3GBGA 2AQFA 3TEDA 4KIBA 1ZYRF 1Z05A 2Y2ZA 3S1NJ 3NWSA 4HQMA 5M3MJ 1XDSA 5KAIC 2W48A 3DKXA 2K86A 5E3OA 4HF1A 2KIFA 5EZGA 2EK5A 2HS5A 3CDLA 4MIMA 3K4CA 1HW1A 4L9JA 1R58A 4BQAA 1MH3A 2X0LA 3BR3A 3KZZA 3O8HA 3ZQIA 4BYYA 4G7OF 4PFOA 2CJJA 2X85A 1USSA 2A6HF 3NAUA 4IHYA 5LRRA 5L3FA 4CGZA 4M71A 2VI6A 3GEZA 4X0GA 1RR8C 4XLFA 3VB2A 1KYZA 3PQJA 2DDAA 1BOBA 4MHGA 1D5VA 1G59A 2F5DA 5B1AH 2H94A 2RVCA 3WU1B 2L4MA 4XSZF 3K0LA 2YS9A 3CC2I 3ZMDA 3HKZN 1UCRA 3E6MA 3EUAA 3MZYA 4QIWN 3AKZA 3C1DA 3L7WA 1ETVA 5J6XA 5H6QA 1XSVA 2XDVA 3IH2A 2IVMA 3W3CA 4YIRX 2O8KA 4UB6C 1VQ8I 1P9QC 2BXYA 2HTJA 5K7HA 1Y8QB 3OYNA 1G2HA 1YG2A 2E34A 1IN7A 2JPCA 2CGPA 2W82A 2VUMJ 3OIPA 3MZHA 1HC8A 1S7AA 3A03A 3DP7A 4EM1A 3ZCOA 1XG1A 3PSIA 1VQKI 2NVUB 5J3LA 2ID6A 2GA2A 1Y1VJ 2BXZA 4EGYA 1FP2A 3J7YJ 1STZA 4CYCB 1GHCA 2Z16A 2L7MP 1BJZA 5HS8A 4HLYA 3SQNA 2YX7A 4LG0A 4RB3C 2QF7A 2MYSA 3C2GA 5IOZA 4U0YA 3ISPA 2M8GX 2MH2A 3QU6A 1FTZA 5GPCA 2V6EA 3BDDA 4YFKF 2KRCA 2QGUA 2HOSA 1R49A 3J81K 1W1WE 1VQNI 4I99C 3A1YA 4JYKA 4WXCA 3HHGA 2AHQA 3HHHA 2HDDA 1MBFA 2XVCA 3ASNH 2DK5A 1BOAA 1BBYA 4I09A 3S93A 2OZ6A 3M8JA 5KCMA 3RPQA 1XSDA 1TQIA 1FYLA 1MBKA 1HXDA 5FD6A 2VKHA 4ZYAA 2GZWA 3F21A 2DQLA 2JUGA 2HZTA 4UV9A 2M9HA 2ELHA 2VBWA 3BR2A 3V8JA 1F5TA 1MSEC 4DZJA 2GIZA 4IRHA 3ABTA 3HRMA 3VEPA 1FTTA 1ETXA 3CO7C 4J01A 4XQFA 4XMYA 3V7RA 1ETQA 1ZELA 2E1MC 1D0ZA 3JRGA 3OS1A 1R7JA 2M5WA 3PFIA 1U8RA 3GXOA 2R7VA 1R4NB 5E17F 2XIGA 4G6TB 3F23A 4BGDA 2VODA 1YIOA 3ZQQA 3QPLA 4AIJA 3Q9SA 3S14J 4F52A 4IF4A 5F0CA 2HKXA 4GXOA 2M0MA 2KHMA 4FISA 2HQNA 3BJOA 4FT8A 4V2GA 3ECOA 4Q48A 5DV5A 3OYIA 5GAGJ 1T95A 2EB7A 2ESNA 2GQQA 3FMRA 4OAZA 2MH9A 2Y9ZA 4IQ4A 5AONA 2VQLA 1V3FA 4IZZA 3K69A 2EV0A 3DEUA 3GLLA 3TW6A 1SC7A 1D5YA 3P5JA 4A3MJ 1F43A 3S8PA 2O9LA 4MGRA 4IX7A 4M9ZA 2YU9J 4C9YA 3ZXSA 1OQYA 3HC7A 2LD5A 1ZRCA 3KEOA 3HZJA 2CG4A 5LBQA 1JJ8C 4XRFA 3C18A 1SEUA 1IXRC 3CD6I 2OF7A 1YRNB 2HXOA 4M74A 1JHFA 2O6GE 3CJTB 3WU0A 3M9AA 3NEUA 2DYRH 2MLKA 3JW4A 1X1BA 2M2EA 3MZ8A 3KP7A 3GZ5A 1BM9A 2W1OA 2Y0SA 3GLXA 2ME6A 1MNDA 3KP5A 4DGWB 1UAAA 2DMTA 4PK4A 1IXSB 3KP4A 4I76A 4UHTA 5F27A 1TT0A 3BPXA 1IAWA 5DEQA 3K1NA 4A3KJ 1B1BA 1Z7UA 1B9NA 2K9SA 2VXZA 4N4NB 1W5TA 2XGCA 2UXXA 3E97A 1W7PB 2EFNA 3AFHA 5J1YA 4G7ZF 3QU3A 1MBJA 5BQTA 3J81Z 2XF5A 1YI2I 2R7XA 2Z99A 4B4CA 4CCNA 5ICCA 4ENJA 1VQOI 2E71A 3DPLC 3F72A 1K79A 4C2TA 1R5HA 3S3OA 1EV7A 5FKMA 1J0RA 1FJLA 2L5QA 2OZUA 5J1UA 4M73A 1XGNA 2V26A 2ZMEB 3CMAI 4I98B 1SMTA 4NBQA 4V2FA 1TWHJ 3HOVJ 4C2MJ 3IAM2 2E36A 2LR8A 2FJ1A 4EEFG 2YPRA 1PUFA 2LY2A 2OQRA 1LEAA 2KDZA 1GDTA 4P1WA 1N78A 2FSWA 4RB0A 3LSPA 1J7KA 2BOLA 1L3LA 2L0KA 4XRSG 1Z9CA 5LGTA 4E7SA 5KNLA 5CVUA 4BH9A 2HPIA 2LVSA 1KONA 1ETWA 1LUJB 2DCEA 1HW2A 3LSIA 4X6AJ 5EF6A 1LE8B 4BEHB 4GRIA 3A4CA 1R5GA 3VYTB 1MBGA 2IS1A 3I53A 3TW7A 3BPVA 4KMUX 2MLGA 5FKKA 2LF7A 4ZYGA 2DAOA 4LITA 2HNHA 1M1EB 4N0BA 1S7EA 3DF8A 1WRJA 1QQIA 3H5RA 1KA8A 2CW0F 1BI1A 4LLGF 2H27A 1JT0A 3PJRA 3WTWC 3L2UA 1E3PA 2BY1A 2ZXWH 3FK6A 3K70C 1XGSA 3H5AA 1J2XA 2BEOA 1LDDA 3FHZA 2CSOA 2RQQA 1AA7A 2VIXA 1U5TC 3OYJA 5D8LB 1TW2A 1BL0A 2ZBKA 3F6VA 1Z21A 4XKCA 3J7AO 4IHTA 2K02A 4LB6B 2X6YA 3RPUD 1O57A 2H1LA 4TV7A 1S5LC 2UWMA 3DXJF 4XLCA 4LIVA 3RJPA 5HDKA 2RC4A 4HYEA 2EZKA 2EIMH 4ESJA 1X58A 1KQ0A 2LY1A 4QWQA 3SEQA 4XOPA 4JK1X 3BZCA 3FX3A 3DWLE 3ECHA 4AM3A 1CGPA 2X1EA 3IC7A 1SFUA 5GPAA 3LSMA 1N77A 3KCCA 1S6LA 5IPAA 4OMZA 4EM0B 3W2VA 4Q4ZF 4H4KC 1H9TA 2FEZA 3BROA 1R1TA 1W0UA 1KU2A 2CRGA 2DA7A 3V8LA 4IQJA 3ZMTA 1IGNA 4DBRA 4RM3A 4XR6A 3CF2A 3TQNA 2EFWA 3LA3A 3P9CA 4BJ6C 2XB0X 2DA6A 3B02A 1TWGJ 3R4KA 3WTSC 1X4PA 1U9OA 3L09A 3GTOJ 4OINF 5JR3A 1XCVA 2WAQN 3CC4I 4XONA 1OCPA 1FSHA 1E0EA 4DYRA 4F3QA 1KYWA 2PEXA 2M7AA 2V6CA 4G8XA 3IH4A 4E6KG 3WE3A 4AYBA 5B66C 2JPBA 1WSUA 3F9KA 4ZZLA 2KT0A 4PJMA 3IRQA 2WAEA 4HSTA 4D1QA 4HLXA 3DTKA 2JA5J 2XGXA 1HKSA 2H6BA 1G8XA 3H0GJ 2QKMB 1FBSA 2VKDA 4BQOA 3A0BC 4EJWA 3U1KA 1Y6IA 1A35A 5L3DA 3ZQCA 1I50J 2HOEA 1IN5A 1U5TA 5E3LA 3IH3A 2G0EA 3TGNA 2P7VB 4DJAA 2EJRA 2R7QA 4F91B 2M4KA 2K3FA 2E35A 1NTCA 1JGSA 1RR7A 2GOXB 1UHWA 2HQAA 5F0HA 3JRHA 1DQUA 1MBEA 1VFCA 3G71I 2RREA 3M3YJ 1A6IA 4QTRA 3GFMA 3GTJJ 2RNGA 4R8HA 3M8EA 1HCRA 3HSRA 2DDBA 2LOOA 1ETOA 2FUG2 4JOMA 4BUPA 1TZLA 1NH3A 4ENKA 3K4KA 5DD4A 2A6EF 4RGXA 5IOYA 1T0FC 1YW9A 2STWA 2R7DA 3VYSB 1X2NA 3BTJA 5D6EA 1FBQA 3ZOBA 4LLLA 2FOKA 2NYXA 2R7ZJ 1DP7P 2MBFA 1BR4A 1GV5A 2XROA 3MKZA 2CS3A 4P96A 3KLOA 4KICA 2A6TA 1FT9A 1RETA 2NVTJ 1B59A 3G2BA 1J9IA 3GTLJ 1ZRDA 2K9LA 2AO9A 4Q47A 5E3NA 3TMOA 1MNEA 1QPMA 3BQYA 5GTIC 4OIOF 1RNLA 2KFDA 1ETKA 4IXAA 1MMDA 3VSLA 2GA1A 1YS6A 3OOPA 2XUBA 4ZC3A 4KN7X 5DCMA 3RKWA 3S2HJ 3SDBA 1L0OC 2E1NA 2VN2A 2VE9A 4LJZF 3OYAA 2CW7A 1ONVA 2K3PA 1DGRM 3K1PA 4CYDA 4GO1A 3B73A 5IYCJ 2IGMA 2QQ8A 4CZCA 2QYOA 2C6YA 1BA5A 1E3OC 3ABLH 3I64A 4LG3A 2BVLA 2OA4A 4KIGA 1IZ1A 1ZH5A 2MABA 2PFBA 2KJCA 1PJRA 2O7OA 3IRRA 4ITVA 4KMFA 4I0BA 1HSJA 3CUQA 2A5WA 3HJEA 1VTNC 2FXAA 2ZMEC 4GYIA 3FBNB 1UJ8A 5F64A 4UVCA 4EM2A 4CXFA 2HQ5A 4CHUA 1YFHA 2DJIA 1EKEA 3SZPA 2E5NA 2ETHA 4XRSA 3OYHA 2DN0A 2IGKA 3NQOA 4PSXA 4MFDA 2R7OA 2R5ZB 3H9QA 3CCRI 5F1RA 1K83J 3KYCB 1ZRFA 4FE7A 5J47A 4DYQA 2E1MB 2TCTA 4EJOA 2CV2A 1Z67A 2BY3A 3ML6A 2B0LA 3RKXA 2A61A 2WTEA 3JRAA 2GXAA 2FA5A 2IPQX 4PFPA 1YX3A 1XDUA 2DMPA 1T0FA 3ZN1A 4D7NA 2DT6A 3BR1A 2COBA 5IT3A 5JFRA 5HODA 3AL0C 1GVDA 2RNJA 3S32A 3CCYA 3QOPA 4HX8A 1B6AA 3PNVA 2M4GA 5E20A 1QRYA 5D5UB 2L9VA 4KA4A 4E7ZA 3E0JB 2M34A 3CLOA 1PUFB 4X1EA 5C4JJ 3VOEA 2DFHA 4A93J 3HGGA 2K85A 2KIUA 2NOGA 3M4OJ 3IWFA 1U78A 2A3SA 3HOYJ 1Q1HA 1Z3XA 3SYTA 2W00A 2J5OA 4A69C 2P7CB 2KKOA 4D9JA 2F2EA 2G7UA 4HRIA 3ULQB 3I9V2 1XX5A 1I3QJ 1TBXA 3HOTA 3BR6A 5JHUA 4R79A 4WWCA 1FOKA 2VE8A 3DU6A 2IA1A 5F04A 3COAC 1HLVA 2EBIA 2QQBA 2JK3A 2OCCH 3BJAA 5L3EA 1V55H 2NNNA 2A68F 3RSNA 2IGNA 3NRVA 4PDKA 1Y0UA 1KQ9A 2OTLI 2DA1A 4RMNA 2E5ZA 2JVHA 4A3DJ 3F8CA 3I56I 1I5ZA 3HRTA 1TWCJ 3TO9A 3BJ6A 4EATA 2CO5A 2V1DA 3BQZA 3MFKA 3O2PE 2LLKA 1MJBA 1SVOA 2CV1A 1LPQA 1OISA 4M9XA 4ZTFA 5C3EJ 3S3NA 1YOVB 5E18F 2EFOA 3LA7A 1TL8A 2LY9A 1ZQ3P 3S15J 1JKRC 2XPVA 1OYYA 3FKIJ 2OTJI 5HDNA 1X3WB 3AG1H 2DFFA 3SXYA 3CCJI 2W85A 1OCTC 3N05A 3HGYA 2DA4A 1B72A 3RYPA 1P6RA 1LVKA 1FOWA 3JSPA 3OMYA 4UUSA 1EA3A 2VC0A 4AWXB 2OCEA 2CUZA 5DUKA 5ERIA 3KEYA 1W4MA 4CZZA 2ELJA 2F5VA 2LBFA 4DYCA 3OWTA 4GGGA 1ZK8A 4I0AA 4CDGA 3HYIA 3I4MJ 1XMKA 2QM3A 1N25A 2AXLA 2HR3A 3RQIA 1O7LA 4PJ0C 2DA5A 1WJEA 3JREA 2HVQA 4CSWA 3OYDA 3CO6C 1UB9A 4L9VA 3HPHA 3CCLI 3KE2A 2CUFA 4MLOA 4HPQA 4XKWA 5HDGA 2MGQA 4ENNA 1YHQI 2PMZA 1YJWI 1YQAA 3OYFA 1FYMA 2KL4A 1J75A 4OWRB 5CPRB 2DTZA 1AU7A 1ERDA 4M3EA 2Z5UA 1E17A 3LOCA 4LFUA 2HKOA 3DU5A 4HV6A 3MKLA 1RUNA 2HYJA 1IRXA 3VWBA 1FMVA 4ENMA 1XPXA 3OOUA 2NS8A 2Y48A 1A31A 4IEJA 1HKQA 3CC7I 4HOBA 1X3ZB 3Q9VA 2LREA 4RS8A 5D5XB 1FNNA 2E2HJ 5GTHC 3WG7H 2L3DA 1CQTA 2L9NA 1U5TB 1ZREA 2VJ5A 2COMA 2EFPA 3V7SA 2MD0A 1F1ZA 4AD9A 1HDDC 3M1CA 3LWFA 1PYVA 2X6WA 4IL6C 6PAXA 4GCVA 2YR2A 3EUHC 1HOMA 3GZNB 2QKLB 4OIRF 3DKWA 3HIFA 4DBQA 3RKQA 4MFEA 2L9SA 2XAFA 4A0YA 1MJAA 3VDXA 1Y8RB 2JTVA 1B4AA 2YX4A 2ZCWA 3BY6A 5L3BA 1TTYA 3GMEA 4ESFA 3HOUJ 2VBYA 3LFKA 3KYDB 2JWTA 2VL8A 3FXUA 3ZQFA 1DU6A 4OAYA 2P5LC 3BLYA 2TDXA 5ICEA 5DM6F 3L2VA 1DGWY 1POGA 1B9MA 2ZFUA 2DQRA 2KDOA 2R7FA 3L2RA 2GXGA 5EEAA 2OQGA 5M5XJ 3E5QA 1QNTA 2JVGA 4UY8I 2CWEA 3ZPLA 3KP2A 4V19K 4I01A 1IRFA 3FXJA 3OYEA 2KLOA 4KT5C 1IN4A 2EFQA 2P6SA 3BT9A 3FDYA 5C4XJ 3BR0A 2JMWA 5DCMB 1FMWA 4KITB 5M5YJ 3L2CA 1Z77A 2IA2A 4O3MA 1FC3A 2XASA 1LJ9A 1I1GA 1IN6A 5HS7A 1SD5A 3LA2A 2W4SA 1R4MB 1IUYA 3WHCA 1O7FA 3KLNA 1EH7A 2G7HA 2ZJ2A 4ZYDA 2QZ8A 1R9TJ 1XGMA 3EYYA 4P55A 1I27A 2FNPA 2UV1A 2VQHA 4FCYA 1HF0A 3QPHA 3HUGA 3W6KB 3BG3A 3G1LA 1YS7A 2WC2A 3DKYA 1I6HJ 2QSFX 2FMLA 1FOXA 3CDIA 1WH5A 4S0HB 1RZ4A 1IJWC 3IHUA 4A3LJ 3A0HC 2MG4A 2HYGD 2BGCA 3CESA 3EETA 5F08A 2F4OB 3CUQB 5F1JA 1SVLA 2M1BA 3JAMK 4MTEA 2IS2A 3J7ZI 4G12A 3DEWA 1TWAJ 4RB2C 2UZKA 2XHKA 3LL7A 2GBYA 3F3XA 2E7XA 1JTXA 4ZDLA 3BR5A 5HLTA 2ZXJA 4Q5SF 3ELKA 2O5RA 4JP0A 3FXMA 3EUHA 2QA4I 1EH8A 3IAS2 2OJED 5K7ZA 4A3IJ 3HG9A 3FXOA 3WGGA 5TISC 1Z91A 3ABMH 4NNJA 3BG5A 1C0WA 5IT9K 2FBHA 2MC4A 4Y17A 1IXCA 1ZG5A 3GTKJ 1MSFC 1TQPA 1ZG3A 2FBIA 1X3UA 3DTIA 1APLC 1AOYA 3JRFA 1TWFJ 3L2WA 4HF2A 2X1CA 1RPWA 2M8EA 3ZQGA 1IV6A 3CDHA 4CICA 2ELKA 5DUIA 3HDDA 4RAFA 2QSHX 3K2ZA 1Q1VA 1HBXG 2CV0A 2R7SA 3QPSA 1YTYA 2FMYA 2EWNA 4M9SA 2XAHA 1P4WA 1RIOH 1T98A 1GLNA 4NC7A 3RTRA 2ME0A 1MMAA 2Z1DA 4PJJA 4ZYHA 1U2WA 1JT6A 3FKJA 2R5YA 2NVYJ 3ABUA 2KIMA 3FMQA 2FU4A 1U6GA 3JTHA 1XN7A 1MH4A 1QZEA 2L01A 4HA8A 1RI7A 2JZYA 3RPUA 2LF8A 3FM5A 2EA4A 2FQ3A 3FXKA 2XPWA 2A69F 2R5ZA 2VASA 3UKGA 2FD5A 2XAGA 5K7FA 4H0EA 3JRIA 1W5CC 3CCEI 4A2UA 2YUSA 1OCOH 3TBIA 2HYFA 2QCOA 3OL4A 2HU9A 1FLIA 1LDKB 1DP3A 3BG9A 2E7WA 2DYSH 1ZR4A 1IRZA 1K6OA 3VYUB 2KPMA 3BC8A 4JX6A 2R7RA 1LFUP 2KQRA 3ZMVA 3ZN0A 4AVPA 4CCOA 3K1MA 3E6CC 1I6XA 3KX2A 2OV7A 4Z6YA 2LDUA 3J80K 3JTGA 3W6VA 2ZC2A 3CZ6A 2NNYA 1R23A 1XC5A 3HXLA 1B72B 2LMDA 3F8MA 1OMIA 1LKXA 2ZB9A 1VQLI 4PZJA 1QHHD 4RGUA 5C44J 1DDNA 2GLOA 4BS9A 4UUSB 2ZXHA 4MQ9F 3P9IA 2BV6A 1K7AA 1V5FA 3JAMZ 3I3LA 5E8IA 4KT6A 2CH0A 2IAIA 2LBFB 2Q0OA 5FLMJ 2V1XA 3AL0B 1XMXA 4FTHA 4FETA 2HOTA 1MGTA 1FY7A 2I5UA 3H9JA 1MMSA 2HXIA 4A3FJ 1IUFA 1K61A 1F4KA 1WJFA 1VQ5I 2PMHA 2Z3YA 2K40A 4MEYF 1PUEE 4P5OA 2DA3A 2OU2A 2P81A 3WTUC 2BY2A 3E7LA 5IP9J
chains in the Genus database with same CATH topology
4PGHA 4XBFA 5IT9Z 2FRHA 2XRNA 1OKRA 5K5RA 2GXBA 4KYWA 2L4AA 3LQRA 2QUFA 4FX4A 3D5LA 3DQVC 1YO5C 2Q8KA 4L0YB 1P4AA 4EMSA 5CLSA 3ZQ7A 2Y0MA 4EJUA 5EEHA 3GFJA 2QBYA 1WQ2A 1ZHFA 4JQFA 4HAMA 2ZNYA 1H0MA 3DFGA 4P9FA 1TW3A 1SD6A 4L9NA 4IVNA 3I59A 1JE8A 4ESBA 3FF5A 1MKMA 1IRGA 2QENA 1DPUA 4LK1F 2Q2EA 4IPAA 1GXQA 1R36A 3E6BA 4LB5A 2QQ9A 3QAHA 5HOOA 1FBUA 4A5MA 3J80Z 4AIHA 4B8XA 3MCZA 1SAXA 2FNAA 2MC3A 3CUQC 5CVVA 4LLNA 3R61A 2HTSA 1JXSA 2HDCA 2KJBA 1QO0D 2EV6A 4A12A 2X4HA 1H9GA 1YLFA 4UNOA 3HRUA 4ZYEA 1MZBA 2PI0A 2RDPA 3M7GA 2V79A 4PGGA 4ASNA 4S05A 4KNYA 3GO5A 3E5XA 5H20A 4O5VA 1FSEA 3KEQA 1KU9A 3G73A 1BI3A 5FB2A 2GAUA 3WG9A 4RAZA 4CO8A 1IF1A 2W24A 4I2OA 1XB4A 2VOOA 4KUMA 1PDNC 3TO6A 3MQ0A 5KK1A 3IL2A 1FZPB 1V4RA 1SMYF 2RN7A 3HSEA 3SHFA 5LHHA 1UHMA 2OBPA 2P8TA 5H6RA 1HKTA 1NHAA 2HGCA 5HLHA 4XSXF 3O3KA 4G6QA 3F8FA 4KDPA 1USTA 2O03A 1PP8F 1OR7A 3R60A 4YFXF 3R0AA 2CFXA 3WODF 3QRFF 1O3TA 5ILSA 3F6OA 2LKPA 4M72A 1MJ9A 3IWZA 2M30A 1D8JA 4U0VA 4KIFA 3GW2A 2DT5A 5K5OA 4R1HA 1LDJA 3ZMZA 1YW8A 1HQCA 2A5YB 1OYWA 3MEXA 4F7ZA 1RUOA 4KN4X 4M6YA 1O3RA 4IRIA 5ICGA 4E70A 2F5FA 4A5NA 1FX7A 2PBIA 1CF7A 5F6FA 3GUDA 2L02A 3V7CA 3EYIA 3ZMUA 1WKMA 5DD8A 1D3YA 3VFZA 4HDVA 2MD5A 1D8KA 2EV5A 2WWYA 2M87A 3LSTA 2VBZA 5DDGA 3S2WA 2XKOA 1LNWA 1SD7A 5FLXK 2PN6A 2OD5A 1QZZA 3FXRA 4RGSA 1FYKA 2Z9OA 4N9IA 4UVBA 5HLIA 5FFZA 3G3ZA 5EEGA 4D0PA 3ROUA 4I02A 2O3FA 2QBYB 1OYIA 2P5VA 1ZGAA 2IA0A 5LEJA 5D8KB 2V9VA 3TOAA 3I0TA 3HTUA 2ADUA 5J8CA 2CQKA 3I59B 3K9TA 3QP6A 4OOIA 5BMZA 1A04A 1ZG1A 4U88A 5D5VB 4EV0A 3HRSA 2O8XA 3GFLA 3QPTA 5FGMA 2QWWA 2F5EA 5E8GA 2XKPA 1BI2A 4IHSA 2DPUA 5J8FA 2ACJA 5DCFA 4MTDA 2ZO4A 3C7JA 1GVJA 2HEOA 5CJ9A 1IN8A 2IP2A 5A2QK 1KU7A 4Y13A 2NRAC 3WTZA 4EVIA 2VBXA 4XLNF 5KVRA 4K2EA 4HX4A 3WE2A 1W7PD 5D4SA 4PCQA 3LAJA 3FXQA 2BBYA 2R3SA 4A6DA 1KGSA 1MDMA 5HS9A 3ERED 5FLXZ 5FO5A 1ZLKA 5ILVA 4O6JA 4RAYA 3F8NA 4HF0A 2XV4S 5AIPA 4NB5A 3FMSA 2O0YA 2YU3A 2RGVA 1SFEA 4FX0A 3RIRA 1BN5A 3GX4X 2H6CA 5FFXA 4P9UA 1QZYA 1XD7A 1HSTA 5DYMA 5TJJA 4G9YA 1R1UA 2QLZA 1S3JA 1LVAA 1AWCA 2BYVE 4G7HF 3KETA 2W84A 5D4RA 2WV0A 1BJAA 1WI9A 1ULYA 3HSFA 3C3WA 4HZFA 2P4WA 3I54A 2DTRA 2JSCA 3I5UA 3R6SA 3V4GA 2RQPA 4RB1A 1XMAA 4BHBA 1BI0A 5A2QZ 3WTTC 5BS6A 1KQ8A 2GIVA 1BC8C 4LMYA 1P2FA 2W25A 4DNCA 5LRSA 1T6SA 2W57A 4UUVA 4BXUA 3T1BA 3E3VA 1MD0A 3N97A 4Y15A 1CF7B 1YW7A 2ESHA 5E1XA 4L0ZB 1ODDA 2DPDA 1TNSA 4HX7A 3U1DA 2VONA 3SZTA 4HDUA 1R22A 2P6TA 3ZP5A 1J59A 5FD5A 4M6XA 1LEBA 4G94A 3TDUC 3P7NA 4S04A 4L18B 4YIFA 3E5UA 3WTVC 3L00A 2UXNA 2E1CA 3F22A 2D2WA 4OIQF 3T0YA 1ZGJA 4RGRA 3WTYC 2P5KA 1WWXA 4ETSA 1T2KA 4DQ2A 5CVIA 3EQLF 2J5PA 4L5IA 5BOXA 4BHPA 3KP6A 1LQ1A 2IRFG 5TRDA 2DBBA 4NQWA 3H92A 1QGPA 3FWEA 2VOPA 2L54A 1G4DA 4EJTA 1YYVA 5HVQC 2DU9A 5L3CA 3GZ6A 2FF4A 2PJPA 2ZFWA 1JHHA 3PQKA 2HFHA 2ISZA 2HWVA 3U9GA 2D45A 1K78A 4LD5A 2VC1A 2ISYA 4AIKA 1W5SA 1QBJA 4MNUA 4YG2F 3M1EA 4BAYA 2PMUA 2VT2A 5CYVA 1ZAOA 2QVOA 4BHCA 1XGOA 5ILUA 1SD4A 4IJAA 5ICFA 1BIBA 3WGHA 2A07F 1ZLJA 2QQAA 2DFIA 5LHGA 5LGNA 1FPQA 3HOSA 3BP8A 1G3SA 2NAZA 1XCBA 4WK8F 3LQQA 3JSOA 5LHIA 2HQRA 2Y75A 1MDMB 3KZYA 3Q5FA 4FHTA 2PQ8A 4EJVA 4WCGA 1O3SA 1ZN2A 1EH6A 3WGIA 3R0JA 1S7OA 3GWZA 5D5WB 3GYHX 4ZH4F 2ZKZA 1LB2A 2G9WA 2IW5A 2VT3A 2OAZA 4ZZDA 1U3EM 2CYYA 3RYRA 2JT1A 1S8NA 1PP7U 2MA3A 4NHJA 3AAFA 2LSOA 4BNCA 3V8KA 4WF2A 4KFCA 3I71A 2XAJA 3SFZA 4LG0B 2BE5F 4EQQA 3L9FA 2ZNZA 1T38A 4G6DA 5BPDA 4Z2YA 4GYGA 5LGUA 3E6DA 3GF2A 4LK0F 4OIPF 1G6NA 3KFWX 3CTAA 2DK8A 1DPRA 4A6EA 3MAJA 2PG4A 5CVJA 5BPIA 3FZVA 5K5QA 4MEXF 2NS0A 3N4MA 1GXPA 1J5YA 4UVAA 4UV8A 4LGWA 4WXDA 3D0SA 3M8FA 1TQMA 1G3TA 3CJNA 2KRFA 3VODA 3I4PA 3T8TA 2FE3A 3EDPA 2PLYA 3TKYA 3TOBA 2V1UA 3P9KA 3OV8A 1S29A 3U2RA 3T8RA 1REPC 1G3YA 3BZ6A 4JBAA 1O3QA 4U0WA 2STTA 3BWGA 2DW4A 3KP3A 4YFNF 1ON2A 5LEKA 5L3GA 4XLPF 4HV5A 3TO7A 3RI4A 1E2XA 4QLCU 2IJLA 2LNBA 4EGZA 2Z33A 4U7BA 2RV8A 1HW5A 2GWRA 3HTSB 2D1VA 2DLLA 3BOQA 5E1ZB 4MQVA 2F5CA 3RDIA 1OPCA 4A0XA 5D6FA 5AIQA 3QP5A 4U7DA 5LLQA 2EA2A 1SFXA 4ON0A 5K1YA 3TDZC 4WX9A 2YSRA 3W6JB 1TLHB 1I1SA 3RKYA 3IKTA 1TNTA 5HLGA 2JRTA 3FM3A 3MWMA 3GFIA 1Z1DA 2FBKA 1Z6TA 5JVTA 3IKVA 1BIAA 4HW0A 3H3ZA 2DI3A 4L5JA 1FP1D 1IW7F 4I7HA 1ZARA 1UFMA 3I58A 2M45A 1G3WA 1P92A 4WXHA 4HBLA 3REOA 1K78B 2K4BA 1F9NA 3DV8A 1R00A 1W7PA 3GVAA 4B09A 4OU0A 4OMYA 2IT0A 4UXNA 2H09A 1FWZA 2DO7A 5CVRA 2K27A 4N9HA 1ON1A 2ZMEA 3F8BA 1T39A 5ED4A 2D1HA 1P4XA 3CUOA 3LAPA 4HQEA 2K7LA 3WTXC 4A0ZA 1R1VA 1Z6RA 3O6BB 3T5XA 5JI6A 1KU3A 4L9TA 2RKHA 5E1WA 1DUXC 1XSXA 1BC7C 2K4JA 3DPTA 4IRGA 2XAQA 3H3UA 4YIIA 2O61A 2AS5F 3ZMSA 4KIBA 1ZYRF 1Z05A 4HQMA 1XDSA 2K86A 4HF1A 2KIFA 2EK5A 2HS5A 1HW1A 4L9JA 1R58A 4BQAA 2X0LA 3KZZA 4BYYA 4G7OF 1USSA 2A6HF 4CGZA 5LRRA 5L3FA 4M71A 3GEZA 3VB2A 1KYZA 3PQJA 4MHGA 1D5VA 2F5DA 2H94A 2RVCA 3WU1B 2L4MA 4XSZF 3K0LA 3ZMDA 1UCRA 3E6MA 3MZYA 3C1DA 3L7WA 5J6XA 5H6QA 1XSVA 2IVMA 2HTJA 1YG2A 1IN7A 2JPCA 2CGPA 3MZHA 1S7AA 3DP7A 4EM1A 2GA2A 4EGYA 1FP2A 1STZA 1GHCA 5HS8A 4HLYA 3SQNA 2YX7A 4LG0A 4RB3C 4U0YA 3ISPA 2MH2A 3QU6A 3BDDA 4YFKF 3J81K 4WXCA 3HHGA 3HHHA 2XVCA 2DK5A 1BOAA 1BBYA 4I09A 2OZ6A 3RPQA 1XSDA 1TQIA 1FYLA 1HXDA 5FD6A 2GZWA 3F21A 2DQLA 2HZTA 4UV9A 2VBWA 2ELHA 3V8JA 1F5TA 4IRHA 3ABTA 3HRMA 3VEPA 3CO7C 3V7RA 1R7JA 2M5WA 3PFIA 1U8RA 3GXOA 5E17F 2XIGA 3F23A 2VODA 1YIOA 4AIJA 3Q9SA 4IF4A 2HKXA 4GXOA 2HQNA 3BJOA 4FT8A 3ECOA 4Q48A 5DV5A 2EB7A 2ESNA 2GQQA 3FMRA 2MH9A 5AONA 1V3FA 3K69A 2EV0A 3DEUA 4MGRA 4M9ZA 1ZRCA 3KEOA 2CG4A 5LBQA 4XRFA 3C18A 1IXRC 4M74A 1JHFA 2O6GE 3WU0A 3M9AA 3NEUA 2MLKA 3JW4A 3KP7A 3GZ5A 1BM9A 3GLXA 3KP5A 1IXSB 3KP4A 4UHTA 3BPXA 1IAWA 5DEQA 3K1NA 1B1BA 1Z7UA 1B9NA 2VXZA 1W5TA 2UXXA 3E97A 1W7PB 2EFNA 4G7ZF 3QU3A 5BQTA 3J81Z 2Z99A 5ICCA 4ENJA 3DPLC 3F72A 1K79A 1R5HA 1EV7A 1J0RA 2OZUA 4M73A 1XGNA 2ZMEB 4I98B 1SMTA 2YPRA 2OQRA 1LEAA 2FSWA 4RB0A 1J7KA 1L3LA 1Z9CA 5LGTA 5CVUA 4BH9A 1HW2A 1R5GA 3I53A 3BPVA 4KMUX 2MLGA 4ZYGA 2LF7A 2DAOA 4N0BA 3DF8A 1WRJA 1QQIA 1KA8A 2CW0F 1BI1A 4LLGF 2H27A 3WTWC 1XGSA 1J2XA 2BEOA 1LDDA 3FHZA 2CSOA 1U5TC 5D8LB 1TW2A 2ZBKA 3F6VA 3J7AO 4IHTA 2K02A 4LB6B 1O57A 4TV7A 2UWMA 3DXJF 3RJPA 5HDKA 2RC4A 4HYEA 4ESJA 1KQ0A 4QWQA 4JK1X 3FX3A 3ECHA 1CGPA 3IC7A 1SFUA 3KCCA 1S6LA 4OMZA 4EM0B 4Q4ZF 1H9TA 2FEZA 3BROA 1R1TA 1KU2A 3V8LA 3ZMTA 2EFWA 3TQNA 3LA3A 3P9CA 3B02A 3R4KA 3WTSC 3L09A 4OINF 5JR3A 1XCVA 1FSHA 1KYWA 2PEXA 2V6CA 4G8XA 3WE3A 2JPBA 1WSUA 4ZZLA 3IRQA 4HLXA 2XGXA 1HKSA 2H6BA 4EJWA 1FBSA 5L3DA 2HOEA 1IN5A 1U5TA 3TGNA 2P7VB 2EJRA 1JGSA 1UHWA 3GFMA 4R8HA 3M8EA 3HSRA 4ENKA 5DD4A 2A6EF 4RGXA 1YW9A 2STWA 2R7DA 5D6EA 1FBQA 4LLLA 2FOKA 2NYXA 1DP7P 2MBFA 2XROA 4P96A 3KLOA 4KICA 1FT9A 1B59A 1J9IA 1ZRDA 4Q47A 1QPMA 4OIOF 1RNLA 4IXAA 2GA1A 1YS6A 3OOPA 2XUBA 4KN7X 5DCMA 3RKWA 1L0OC 2E1NA 2VN2A 2VE9A 4LJZF 1ONVA 3K1PA 4CYDA 4GO1A 3B73A 2QYOA 2C6YA 3I64A 2OA4A 4KIGA 1IZ1A 1ZH5A 2PFBA 2KJCA 3IRRA 4KMFA 4I0BA 1HSJA 3CUQA 1VTNC 2FXAA 4GYIA 5F64A 4UVCA 4EM2A 4CXFA 4CHUA 1YFHA 3SZPA 2ETHA 3NQOA 5F1RA 1ZRFA 4EJOA 3ML6A 2B0LA 3RKXA 2A61A 2WTEA 2FA5A 2IPQX 1XDUA 3ZN1A 1T0FA 5IT3A 5JFRA 2RNJA 3QOPA 4HX8A 1B6AA 5E20A 5D5UB 4KA4A 3CLOA 3VOEA 2KIUA 3IWFA 1U78A 2A3SA 1Q1HA 2J5OA 2P7CB 2KKOA 2F2EA 2G7UA 3ULQB 1TBXA 3HOTA 4R79A 4WWCA 1FOKA 2VE8A 2IA1A 3COAC 2QQBA 3BJAA 5L3EA 2NNNA 2A68F 3NRVA 4PDKA 1Y0UA 1KQ9A 3F8CA 1I5ZA 3HRTA 3TO9A 3BJ6A 2CO5A 2V1DA 3MFKA 3O2PE 1MJBA 4M9XA 5E18F 2EFOA 3LA7A 1OYYA 5HDNA 3SXYA 2W85A 3RYPA 1P6RA 3JSPA 4AWXB 2VC0A 5DUKA 5ERIA 1W4MA 4CZZA 4GGGA 4I0AA 4CDGA 3HYIA 1XMKA 2QM3A 2AXLA 2HR3A 1O7LA 3CO6C 1UB9A 4L9VA 3KE2A 5HDGA 4ENNA 1YQAA 1FYMA 1J75A 2Z5UA 1E17A 4LFUA 2HKOA 4HV6A 1RUNA 4ENMA 2Y48A 1HKQA 4HOBA 3Q9VA 4RS8A 5D5XB 1FNNA 2L3DA 1U5TB 1ZREA 2COMA 2EFPA 3V7SA 4AD9A 1F1ZA 3LWFA 6PAXA 4GCVA 2YR2A 4OIRF 3DKWA 3HIFA 2XAFA 4A0YA 1MJAA 2JTVA 2YX4A 1B4AA 2ZCWA 3BY6A 5L3BA 1TTYA 4ESFA 2VBYA 3LFKA 3FXUA 2P5LC 2TDXA 5ICEA 1B9MA 2DQRA 2R7FA 2GXGA 2OQGA 3E5QA 1QNTA 2CWEA 3ZPLA 3KP2A 4I01A 1IRFA 4KT5C 1IN4A 2EFQA 2P6SA 5DCMB 3L2CA 2IA2A 4O3MA 1FC3A 2XASA 1LJ9A 1I1GA 1IN6A 5HS7A 1SD5A 3LA2A 1IUYA 1O7FA 3KLNA 1EH7A 2G7HA 2ZJ2A 4ZYDA 2QZ8A 1XGMA 3EYYA 4P55A 1I27A 2FNPA 3QPHA 3HUGA 3W6KB 1YS7A 2WC2A 2FMLA 1RZ4A 3IHUA 3EETA 2HYGD 2BGCA 3CUQB 2M1BA 3JAMK 4MTEA 4RB2C 2UZKA 2XHKA 3F3XA 2E7XA 2ZXJA 4Q5SF 3ELKA 3EUHA 1EH8A 3WGGA 1Z91A 1C0WA 5IT9K 2FBHA 4Y17A 1IXCA 1ZG5A 1TQPA 1ZG3A 2FBIA 1X3UA 1AOYA 4HF2A 2M8EA 3CDHA 4CICA 5DUIA 3K2ZA 1HBXG 1YTYA 2FMYA 2EWNA 4M9SA 2XAHA 1P4WA 1RIOH 1T98A 3RTRA 4ZYHA 1U2WA 3ABUA 2KIMA 3FMQA 2FU4A 1U6GA 3JTHA 1XN7A 2L01A 4HA8A 1RI7A 2JZYA 3RPUA 2LF8A 3FM5A 2EA4A 2FQ3A 2A69F 2XAGA 4H0EA 4A2UA 2HYFA 1FLIA 1LDKB 2E7WA 1K6OA 3ZMVA 3ZN0A 4AVPA 3K1MA 3E6CC 1I6XA 2LDUA 3J80K 3JTGA 2NNYA 1R23A 3F8MA 1OMIA 4PZJA 4RGUA 1DDNA 4MQ9F 3P9IA 2BV6A 1K7AA 3JAMZ 5E8IA 2Q0OA 2V1XA 1MGTA 1FY7A 1F4KA 2PMHA 2Z3YA 4MEYF 1PUEE 4P5OA 2OU2A 5JHUA 3WTUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PGH A;  4XBF A;  5IT9 Z;  2FRH A;  2XRN A;  1OKR A;  5K5R A;  2GXB A;  4KYW A;  2L4A A;  3LQR A;  2QUF A;  4FX4 A;  3D5L A;  3DQV C;  1YO5 C;  2Q8K A;  4L0Y B;  1P4A A;  4EMS A;  5CLS A;  3ZQ7 A;  2Y0M A;  4EJU A;  5EEH A;  3GFJ A;  2QBY A;  1WQ2 A;  1ZHF A;  4JQF A;  4HAM A;  2ZNY A;  1H0M A;  3DFG A;  4P9F A;  1TW3 A;  1SD6 A;  4L9N A;  4IVN A;  3I59 A;  1JE8 A;  4ESB A;  3FF5 A;  1MKM A;  1IRG A;  2QEN A;  1DPU A;  4LK1 F;  2Q2E A;  4IPA A;  1GXQ A;  1R36 A;  3E6B A;  4LB5 A;  2QQ9 A;  3QAH A;  5HOO A;  1FBU A;  4A5M A;  3J80 Z;  4AIH A;  4B8X A;  3MCZ A;  1SAX A;  2FNA A;  2MC3 A;  3CUQ C;  5CVV A;  4LLN A;  3R61 A;  2HTS A;  1JXS A;  2HDC A;  2KJB A;  1QO0 D;  2EV6 A;  4A12 A;  2X4H A;  1H9G A;  1YLF A;  4UNO A;  3HRU A;  4ZYE A;  1MZB A;  2PI0 A;  2RDP A;  3M7G A;  2V79 A;  4PGG A;  4ASN A;  4S05 A;  4KNY A;  3GO5 A;  3E5X A;  5H20 A;  4O5V A;  1FSE A;  3KEQ A;  1KU9 A;  3G73 A;  1BI3 A;  5FB2 A;  2GAU A;  3WG9 A;  4RAZ A;  4CO8 A;  1IF1 A;  2W24 A;  4I2O A;  1XB4 A;  2VOO A;  4KUM A;  1PDN C;  3TO6 A;  3MQ0 A;  5KK1 A;  3IL2 A;  1FZP B;  1V4R A;  1SMY F;  2RN7 A;  3HSE A;  3SHF A;  5LHH A;  1UHM A;  2OBP A;  2P8T A;  5H6R A;  1HKT A;  1NHA A;  2HGC A;  5HLH A;  4XSX F;  3O3K A;  4G6Q A;  3F8F A;  4KDP A;  1UST A;  2O03 A;  1PP8 F;  1OR7 A;  3R60 A;  4YFX F;  3R0A A;  2CFX A;  3WOD F;  3QRF F;  1O3T A;  5ILS A;  3F6O A;  2LKP A;  4M72 A;  1MJ9 A;  3IWZ A;  2M30 A;  1D8J A;  4U0V A;  4KIF A;  3GW2 A;  2DT5 A;  5K5O A;  4R1H A;  1LDJ A;  3ZMZ A;  1YW8 A;  1HQC A;  2A5Y B;  1OYW A;  3MEX A;  4F7Z A;  1RUO A;  4KN4 X;  4M6Y A;  1O3R A;  4IRI A;  5ICG A;  4E70 A;  2F5F A;  4A5N A;  1FX7 A;  2PBI A;  1CF7 A;  5F6F A;  3GUD A;  2L02 A;  3V7C A;  3EYI A;  3ZMU A;  1WKM A;  5DD8 A;  1D3Y A;  3VFZ A;  4HDV A;  2MD5 A;  1D8K A;  2EV5 A;  2WWY A;  2M87 A;  3LST A;  2VBZ A;  5DDG A;  3S2W A;  2XKO A;  1LNW A;  1SD7 A;  5FLX K;  2PN6 A;  2OD5 A;  1QZZ A;  3FXR A;  4RGS A;  1FYK A;  2Z9O A;  4N9I A;  4UVB A;  5HLI A;  5FFZ A;  3G3Z A;  5EEG A;  4D0P A;  3ROU A;  4I02 A;  2O3F A;  2QBY B;  1OYI A;  2P5V A;  1ZGA A;  2IA0 A;  5LEJ A;  5D8K B;  2V9V A;  3TOA A;  3I0T A;  3HTU A;  2ADU A;  5J8C A;  2CQK A;  3I59 B;  3K9T A;  3QP6 A;  4OOI A;  5BMZ A;  1A04 A;  1ZG1 A;  4U88 A;  5D5V B;  4EV0 A;  3HRS A;  2O8X A;  3GFL A;  3QPT A;  5FGM A;  2QWW A;  2F5E A;  5E8G A;  2XKP A;  1BI2 A;  4IHS A;  2DPU A;  5J8F A;  2ACJ A;  5DCF A;  4MTD A;  2ZO4 A;  3C7J A;  1GVJ A;  2HEO A;  5CJ9 A;  1IN8 A;  2IP2 A;  5A2Q K;  1KU7 A;  4Y13 A;  2NRA C;  3WTZ A;  4EVI A;  2VBX A;  4XLN F;  5KVR A;  4K2E A;  4HX4 A;  3WE2 A;  1W7P D;  5D4S A;  4PCQ A;  3LAJ A;  3FXQ A;  2BBY A;  2R3S A;  4A6D A;  1KGS A;  1MDM A;  5HS9 A;  3ERE D;  5FLX Z;  5FO5 A;  1ZLK A;  5ILV A;  4O6J A;  4RAY A;  3F8N A;  4HF0 A;  2XV4 S;  5AIP A;  4NB5 A;  3FMS A;  2O0Y A;  2YU3 A;  2RGV A;  1SFE A;  4FX0 A;  3RIR A;  1BN5 A;  3GX4 X;  2H6C A;  5FFX A;  4P9U A;  1QZY A;  1XD7 A;  1HST A;  5DYM A;  5TJJ A;  4G9Y A;  1R1U A;  2QLZ A;  1S3J A;  1LVA A;  1AWC A;  2BYV E;  4G7H F;  3KET A;  2W84 A;  5D4R A;  2WV0 A;  1BJA A;  1WI9 A;  1ULY A;  3HSF A;  3C3W A;  4HZF A;  2P4W A;  3I54 A;  2DTR A;  2JSC A;  3I5U A;  3R6S A;  3V4G A;  2RQP A;  4RB1 A;  1XMA A;  4BHB A;  1BI0 A;  5A2Q Z;  3WTT C;  5BS6 A;  1KQ8 A;  2GIV A;  1BC8 C;  4LMY A;  1P2F A;  2W25 A;  4DNC A;  5LRS A;  1T6S A;  2W57 A;  4UUV A;  4BXU A;  3T1B A;  3E3V A;  1MD0 A;  3N97 A;  4Y15 A;  1CF7 B;  1YW7 A;  2ESH A;  5E1X A;  4L0Z B;  1ODD A;  2DPD A;  1TNS A;  4HX7 A;  3U1D A;  2VON A;  3SZT A;  4HDU A;  1R22 A;  2P6T A;  3ZP5 A;  1J59 A;  5FD5 A;  4M6X A;  1LEB A;  4G94 A;  3TDU C;  3P7N A;  4S04 A;  4L18 B;  4YIF A;  3E5U A;  3WTV C;  3L00 A;  2UXN A;  2E1C A;  3F22 A;  2D2W A;  4OIQ F;  3T0Y A;  1ZGJ A;  4RGR A;  3WTY C;  2P5K A;  1WWX A;  4ETS A;  1T2K A;  4DQ2 A;  5CVI A;  3EQL F;  2J5P A;  4L5I A;  5BOX A;  4BHP A;  3KP6 A;  1LQ1 A;  2IRF G;  5TRD A;  2DBB A;  4NQW A;  3H92 A;  1QGP A;  3FWE A;  2VOP A;  2L54 A;  1G4D A;  4EJT A;  1YYV A;  5HVQ C;  2DU9 A;  5L3C A;  3GZ6 A;  2FF4 A;  2PJP A;  2ZFW A;  1JHH A;  3PQK A;  2HFH A;  2ISZ A;  2HWV A;  3U9G A;  2D45 A;  1K78 A;  4LD5 A;  2VC1 A;  2ISY A;  4AIK A;  1W5S A;  1QBJ A;  4MNU A;  4YG2 F;  3M1E A;  4BAY A;  2PMU A;  2VT2 A;  5CYV A;  1ZAO A;  2QVO A;  4BHC A;  1XGO A;  5ILU A;  1SD4 A;  4IJA A;  5ICF A;  1BIB A;  3WGH A;  2A07 F;  1ZLJ A;  2QQA A;  2DFI A;  5LHG A;  5LGN A;  1FPQ A;  3HOS A;  3BP8 A;  1G3S A;  2NAZ A;  1XCB A;  4WK8 F;  3LQQ A;  3JSO A;  5LHI A;  2HQR A;  2Y75 A;  1MDM B;  3KZY A;  3Q5F A;  4FHT A;  2PQ8 A;  4EJV A;  4WCG A;  1O3S A;  1ZN2 A;  1EH6 A;  3WGI A;  3R0J A;  1S7O A;  3GWZ A;  5D5W B;  3GYH X;  4ZH4 F;  2ZKZ A;  1LB2 A;  2G9W A;  2IW5 A;  2VT3 A;  2OAZ A;  4ZZD A;  1U3E M;  2CYY A;  3RYR A;  2JT1 A;  1S8N A;  1PP7 U;  2MA3 A;  4NHJ A;  3AAF A;  2LSO A;  4BNC A;  3V8K A;  4WF2 A;  4KFC A;  3I71 A;  2XAJ A;  3SFZ A;  4LG0 B;  2BE5 F;  4EQQ A;  3L9F A;  2ZNZ A;  1T38 A;  4G6D A;  5BPD A;  4Z2Y A;  4GYG A;  5LGU A;  3E6D A;  3GF2 A;  4LK0 F;  4OIP F;  1G6N A;  3KFW X;  3CTA A;  2DK8 A;  1DPR A;  4A6E A;  3MAJ A;  2PG4 A;  5CVJ A;  5BPI A;  3FZV A;  5K5Q A;  4MEX F;  2NS0 A;  3N4M A;  1GXP A;  1J5Y A;  4UVA A;  4UV8 A;  4LGW A;  4WXD A;  3D0S A;  3M8F A;  1TQM A;  1G3T A;  3CJN A;  2KRF A;  3VOD A;  3I4P A;  3T8T A;  2FE3 A;  3EDP A;  2PLY A;  3TKY A;  3TOB A;  2V1U A;  3P9K A;  3OV8 A;  1S29 A;  3U2R A;  3T8R A;  1REP C;  1G3Y A;  3BZ6 A;  4JBA A;  1O3Q A;  4U0W A;  2STT A;  3BWG A;  2DW4 A;  3KP3 A;  4YFN F;  1ON2 A;  5LEK A;  5L3G A;  4XLP F;  4HV5 A;  3TO7 A;  3RI4 A;  1E2X A;  4QLC U;  2IJL A;  2LNB A;  4EGZ A;  2Z33 A;  4U7B A;  2RV8 A;  1HW5 A;  2GWR A;  3HTS B;  2D1V A;  2DLL A;  3BOQ A;  5E1Z B;  4MQV A;  2F5C A;  3RDI A;  1OPC A;  4A0X A;  5D6F A;  5AIQ A;  3QP5 A;  4U7D A;  5LLQ A;  2EA2 A;  1SFX A;  4ON0 A;  5K1Y A;  3TDZ C;  4WX9 A;  2YSR A;  3W6J B;  1TLH B;  1I1S A;  3RKY A;  3IKT A;  1TNT A;  5HLG A;  2JRT A;  3FM3 A;  3MWM A;  3GFI A;  1Z1D A;  2FBK A;  1Z6T A;  5JVT A;  3IKV A;  1BIA A;  4HW0 A;  3H3Z A;  2DI3 A;  4L5J A;  1FP1 D;  1IW7 F;  4I7H A;  1ZAR A;  1UFM A;  3I58 A;  2M45 A;  1G3W A;  1P92 A;  4WXH A;  4HBL A;  3REO A;  1K78 B;  2K4B A;  1F9N A;  3DV8 A;  1R00 A;  1W7P A;  3GVA A;  4B09 A;  4OU0 A;  4OMY A;  2IT0 A;  4UXN A;  2H09 A;  1FWZ A;  2DO7 A;  5CVR A;  2K27 A;  4N9H A;  1ON1 A;  2ZME A;  3F8B A;  1T39 A;  5ED4 A;  2D1H A;  1P4X A;  3CUO A;  3LAP A;  4HQE A;  2K7L A;  3WTX C;  4A0Z A;  1R1V A;  1Z6R A;  3O6B B;  3T5X A;  5JI6 A;  1KU3 A;  4L9T A;  2RKH A;  5E1W A;  1DUX C;  1XSX A;  1BC7 C;  2K4J A;  3DPT A;  4IRG A;  2XAQ A;  3H3U A;  4YII A;  2O61 A;  2AS5 F;  3ZMS A;  4KIB A;  1ZYR F;  1Z05 A;  4HQM A;  1XDS A;  2K86 A;  4HF1 A;  2KIF A;  2EK5 A;  2HS5 A;  1HW1 A;  4L9J A;  1R58 A;  4BQA A;  2X0L A;  3KZZ A;  4BYY A;  4G7O F;  1USS A;  2A6H F;  4CGZ A;  5LRR A;  5L3F A;  4M71 A;  3GEZ A;  3VB2 A;  1KYZ A;  3PQJ A;  4MHG A;  1D5V A;  2F5D A;  2H94 A;  2RVC A;  3WU1 B;  2L4M A;  4XSZ F;  3K0L A;  3ZMD A;  1UCR A;  3E6M A;  3MZY A;  3C1D A;  3L7W A;  5J6X A;  5H6Q A;  1XSV A;  2IVM A;  2HTJ A;  1YG2 A;  1IN7 A;  2JPC A;  2CGP A;  3MZH A;  1S7A A;  3DP7 A;  4EM1 A;  2GA2 A;  4EGY A;  1FP2 A;  1STZ A;  1GHC A;  5HS8 A;  4HLY A;  3SQN A;  2YX7 A;  4LG0 A;  4RB3 C;  4U0Y A;  3ISP A;  2MH2 A;  3QU6 A;  3BDD A;  4YFK F;  3J81 K;  4WXC A;  3HHG A;  3HHH A;  2XVC A;  2DK5 A;  1BOA A;  1BBY A;  4I09 A;  2OZ6 A;  3RPQ A;  1XSD A;  1TQI A;  1FYL A;  1HXD A;  5FD6 A;  2GZW A;  3F21 A;  2DQL A;  2HZT A;  4UV9 A;  2VBW A;  2ELH A;  3V8J A;  1F5T A;  4IRH A;  3ABT A;  3HRM A;  3VEP A;  3CO7 C;  3V7R A;  1R7J A;  2M5W A;  3PFI A;  1U8R A;  3GXO A;  5E17 F;  2XIG A;  3F23 A;  2VOD A;  1YIO A;  4AIJ A;  3Q9S A;  4IF4 A;  2HKX A;  4GXO A;  2HQN A;  3BJO A;  4FT8 A;  3ECO A;  4Q48 A;  5DV5 A;  2EB7 A;  2ESN A;  2GQQ A;  3FMR A;  2MH9 A;  5AON A;  1V3F A;  3K69 A;  2EV0 A;  3DEU A;  4MGR A;  4M9Z A;  1ZRC A;  3KEO A;  2CG4 A;  5LBQ A;  4XRF A;  3C18 A;  1IXR C;  4M74 A;  1JHF A;  2O6G E;  3WU0 A;  3M9A A;  3NEU A;  2MLK A;  3JW4 A;  3KP7 A;  3GZ5 A;  1BM9 A;  3GLX A;  3KP5 A;  1IXS B;  3KP4 A;  4UHT A;  3BPX A;  1IAW A;  5DEQ A;  3K1N A;  1B1B A;  1Z7U A;  1B9N A;  2VXZ A;  1W5T A;  2UXX A;  3E97 A;  1W7P B;  2EFN A;  4G7Z F;  3QU3 A;  5BQT A;  3J81 Z;  2Z99 A;  5ICC A;  4ENJ A;  3DPL C;  3F72 A;  1K79 A;  1R5H A;  1EV7 A;  1J0R A;  2OZU A;  4M73 A;  1XGN A;  2ZME B;  4I98 B;  1SMT A;  2YPR A;  2OQR A;  1LEA A;  2FSW A;  4RB0 A;  1J7K A;  1L3L A;  1Z9C A;  5LGT A;  5CVU A;  4BH9 A;  1HW2 A;  1R5G A;  3I53 A;  3BPV A;  4KMU X;  2MLG A;  4ZYG A;  2LF7 A;  2DAO A;  4N0B A;  3DF8 A;  1WRJ A;  1QQI A;  1KA8 A;  2CW0 F;  1BI1 A;  4LLG F;  2H27 A;  3WTW C;  1XGS A;  1J2X A;  2BEO A;  1LDD A;  3FHZ A;  2CSO A;  1U5T C;  5D8L B;  1TW2 A;  2ZBK A;  3F6V A;  3J7A O;  4IHT A;  2K02 A;  4LB6 B;  1O57 A;  4TV7 A;  2UWM A;  3DXJ F;  3RJP A;  5HDK A;  2RC4 A;  4HYE A;  4ESJ A;  1KQ0 A;  4QWQ A;  4JK1 X;  3FX3 A;  3ECH A;  1CGP A;  3IC7 A;  1SFU A;  3KCC A;  1S6L A;  4OMZ A;  4EM0 B;  4Q4Z F;  1H9T A;  2FEZ A;  3BRO A;  1R1T A;  1KU2 A;  3V8L A;  3ZMT A;  2EFW A;  3TQN A;  3LA3 A;  3P9C A;  3B02 A;  3R4K A;  3WTS C;  3L09 A;  4OIN F;  5JR3 A;  1XCV A;  1FSH A;  1KYW A;  2PEX A;  2V6C A;  4G8X A;  3WE3 A;  2JPB A;  1WSU A;  4ZZL A;  3IRQ A;  4HLX A;  2XGX A;  1HKS A;  2H6B A;  4EJW A;  1FBS A;  5L3D A;  2HOE A;  1IN5 A;  1U5T A;  3TGN A;  2P7V B;  2EJR A;  1JGS A;  1UHW A;  3GFM A;  4R8H A;  3M8E A;  3HSR A;  4ENK A;  5DD4 A;  2A6E F;  4RGX A;  1YW9 A;  2STW A;  2R7D A;  5D6E A;  1FBQ A;  4LLL A;  2FOK A;  2NYX A;  1DP7 P;  2MBF A;  2XRO A;  4P96 A;  3KLO A;  4KIC A;  1FT9 A;  1B59 A;  1J9I A;  1ZRD A;  4Q47 A;  1QPM A;  4OIO F;  1RNL A;  4IXA A;  2GA1 A;  1YS6 A;  3OOP A;  2XUB A;  4KN7 X;  5DCM A;  3RKW A;  1L0O C;  2E1N A;  2VN2 A;  2VE9 A;  4LJZ F;  1ONV A;  3K1P A;  4CYD A;  4GO1 A;  3B73 A;  2QYO A;  2C6Y A;  3I64 A;  2OA4 A;  4KIG A;  1IZ1 A;  1ZH5 A;  2PFB A;  2KJC A;  3IRR A;  4KMF A;  4I0B A;  1HSJ A;  3CUQ A;  1VTN C;  2FXA A;  4GYI A;  5F64 A;  4UVC A;  4EM2 A;  4CXF A;  4CHU A;  1YFH A;  3SZP A;  2ETH A;  3NQO A;  5F1R A;  1ZRF A;  4EJO A;  3ML6 A;  2B0L A;  3RKX A;  2A61 A;  2WTE A;  2FA5 A;  2IPQ X;  1XDU A;  3ZN1 A;  1T0F A;  5IT3 A;  5JFR A;  2RNJ A;  3QOP A;  4HX8 A;  1B6A A;  5E20 A;  5D5U B;  4KA4 A;  3CLO A;  3VOE A;  2KIU A;  3IWF A;  1U78 A;  2A3S A;  1Q1H A;  2J5O A;  2P7C B;  2KKO A;  2F2E A;  2G7U A;  3ULQ B;  1TBX A;  3HOT A;  4R79 A;  4WWC A;  1FOK A;  2VE8 A;  2IA1 A;  3COA C;  2QQB A;  3BJA A;  5L3E A;  2NNN A;  2A68 F;  3NRV A;  4PDK A;  1Y0U A;  1KQ9 A;  3F8C A;  1I5Z A;  3HRT A;  3TO9 A;  3BJ6 A;  2CO5 A;  2V1D A;  3MFK A;  3O2P E;  1MJB A;  4M9X A;  5E18 F;  2EFO A;  3LA7 A;  1OYY A;  5HDN A;  3SXY A;  2W85 A;  3RYP A;  1P6R A;  3JSP A;  4AWX B;  2VC0 A;  5DUK A;  5ERI A;  1W4M A;  4CZZ A;  4GGG A;  4I0A A;  4CDG A;  3HYI A;  1XMK A;  2QM3 A;  2AXL A;  2HR3 A;  1O7L A;  3CO6 C;  1UB9 A;  4L9V A;  3KE2 A;  5HDG A;  4ENN A;  1YQA A;  1FYM A;  1J75 A;  2Z5U A;  1E17 A;  4LFU A;  2HKO A;  4HV6 A;  1RUN A;  4ENM A;  2Y48 A;  1HKQ A;  4HOB A;  3Q9V A;  4RS8 A;  5D5X B;  1FNN A;  2L3D A;  1U5T B;  1ZRE A;  2COM A;  2EFP A;  3V7S A;  4AD9 A;  1F1Z A;  3LWF A;  6PAX A;  4GCV A;  2YR2 A;  4OIR F;  3DKW A;  3HIF A;  2XAF A;  4A0Y A;  1MJA A;  2JTV A;  2YX4 A;  1B4A A;  2ZCW A;  3BY6 A;  5L3B A;  1TTY A;  4ESF A;  2VBY A;  3LFK A;  3FXU A;  2P5L C;  2TDX A;  5ICE A;  1B9M A;  2DQR A;  2R7F A;  2GXG A;  2OQG A;  3E5Q A;  1QNT A;  2CWE A;  3ZPL A;  3KP2 A;  4I01 A;  1IRF A;  4KT5 C;  1IN4 A;  2EFQ A;  2P6S A;  5DCM B;  3L2C A;  2IA2 A;  4O3M A;  1FC3 A;  2XAS A;  1LJ9 A;  1I1G A;  1IN6 A;  5HS7 A;  1SD5 A;  3LA2 A;  1IUY A;  1O7F A;  3KLN A;  1EH7 A;  2G7H A;  2ZJ2 A;  4ZYD A;  2QZ8 A;  1XGM A;  3EYY A;  4P55 A;  1I27 A;  2FNP A;  3QPH A;  3HUG A;  3W6K B;  1YS7 A;  2WC2 A;  2FML A;  1RZ4 A;  3IHU A;  3EET A;  2HYG D;  2BGC A;  3CUQ B;  2M1B A;  3JAM K;  4MTE A;  4RB2 C;  2UZK A;  2XHK A;  3F3X A;  2E7X A;  2ZXJ A;  4Q5S F;  3ELK A;  3EUH A;  1EH8 A;  3WGG A;  1Z91 A;  1C0W A;  5IT9 K;  2FBH A;  4Y17 A;  1IXC A;  1ZG5 A;  1TQP A;  1ZG3 A;  2FBI A;  1X3U A;  1AOY A;  4HF2 A;  2M8E A;  3CDH A;  4CIC A;  5DUI A;  3K2Z A;  1HBX G;  1YTY A;  2FMY A;  2EWN A;  4M9S A;  2XAH A;  1P4W A;  1RIO H;  1T98 A;  3RTR A;  4ZYH A;  1U2W A;  3ABU A;  2KIM A;  3FMQ A;  2FU4 A;  1U6G A;  3JTH A;  1XN7 A;  2L01 A;  4HA8 A;  1RI7 A;  2JZY A;  3RPU A;  2LF8 A;  3FM5 A;  2EA4 A;  2FQ3 A;  2A69 F;  2XAG A;  4H0E A;  4A2U A;  2HYF A;  1FLI A;  1LDK B;  2E7W A;  1K6O A;  3ZMV A;  3ZN0 A;  4AVP A;  3K1M A;  3E6C C;  1I6X A;  2LDU A;  3J80 K;  3JTG A;  2NNY A;  1R23 A;  3F8M A;  1OMI A;  4PZJ A;  4RGU A;  1DDN A;  4MQ9 F;  3P9I A;  2BV6 A;  1K7A A;  3JAM Z;  5E8I A;  2Q0O A;  2V1X A;  1MGT A;  1FY7 A;  1F4K A;  2PMH A;  2Z3Y A;  4MEY F;  1PUE E;  4P5O A;  2OU2 A;  5JHU A;  3WTU C; 
#chains in the Genus database with same CATH topology
 4PGH A;  4XBF A;  2K9Q A;  2R0Q C;  5IT9 Z;  2FRH A;  2XRN A;  3MN2 A;  2R92 J;  1OKR A;  1X1P A;  5K5R A;  4IHV A;  4W97 A;  2GXB A;  1JUS A;  4KYW A;  1T33 A;  1YJN I;  9ANT A;  2V4J C;  3H9G A;  2L4A A;  3LQR A;  2F4I A;  2QUF A;  3DBL B;  4FX4 A;  3D5L A;  3PNT A;  4HG2 A;  2B9S A;  1NG6 A;  2BVM A;  3SFI A;  3JCU C;  3DQV C;  2DMQ A;  1YO5 C;  4BU2 A;  2OUM A;  2Q8K A;  2K5C A;  2CUJ A;  3CMY A;  4L0Y B;  1JKP C;  1P4A A;  4EMS A;  5CLS A;  1OCC H;  3HB9 A;  1A5J A;  3ZQ7 A;  2Y0M A;  4EJU A;  5EEH A;  3GFJ A;  2QBY A;  3ZRG A;  1MMN A;  3PFY A;  1WQ2 A;  1ZHF A;  4JQF A;  3OR1 C;  4HAM A;  2ZNY A;  1H0M A;  3DFG A;  4P9F A;  2DOF A;  1NK3 P;  3O8G A;  1TW3 A;  5EJC A;  2KIS A;  4B3X A;  1SD6 A;  4L9N A;  4C3J J;  4IVN A;  4AU7 A;  3OS0 A;  3I59 A;  1QU3 A;  2XF7 A;  1JE8 A;  4ESB A;  4PJL A;  1RC9 A;  3H0D A;  3FF5 A;  1MKM A;  3HEF A;  1IRG A;  2QEN A;  1DPU A;  4LK1 F;  2Q2E A;  3HBL A;  4IPA A;  1GXQ A;  2EPF A;  1R36 A;  3E6B A;  4LB5 A;  2QQ9 A;  1JTY A;  1V5E A;  3QAH A;  5HOO A;  1FBU A;  4F55 A;  4CA0 A;  4A5M A;  3B6C A;  4HSR A;  5M3F J;  2BHZ A;  3J80 Z;  3DEE A;  5EDN A;  4AIH A;  3NWT A;  4B8X A;  4CCJ A;  1UZC A;  3MCZ A;  4C30 A;  1SAX A;  2FNA A;  4CUG A;  2MC3 A;  1JJ6 C;  3ZGK A;  5J1R A;  3CUQ C;  5CVV A;  4E7L A;  3HKZ A;  4LLN A;  3R61 A;  2XPU A;  4A3J J;  2HTS A;  4E7J A;  1JXS A;  3GTQ J;  2HDC A;  3FK7 A;  3MKY B;  3AG3 H;  2VJI A;  2KJB A;  1QO0 D;  5JVG F;  2EV6 A;  4A12 A;  1S72 I;  2X4H A;  1U8B A;  1Y0N A;  1H9G A;  1YLF A;  3H36 A;  1YIJ I;  4UNO A;  2H8R A;  3FIW A;  3HUG B;  2ECB A;  3HRU A;  4ZYE A;  3SZG A;  1MZB A;  1S9H A;  2PI0 A;  1WJA A;  2RDP A;  3M7G A;  2V79 A;  4PGG A;  4ASN A;  2JA6 J;  4S05 A;  4KNY A;  3QYB A;  1WJ5 A;  3GO5 A;  4XM3 A;  1ZR2 A;  4JX5 A;  3E5X A;  5FJ8 J;  5H20 A;  4O5V A;  1FSE A;  2NVX J;  3KEQ A;  3SEZ A;  4A3G J;  3PM1 A;  2HVR A;  1KU9 A;  3G73 A;  1BI3 A;  3C2B A;  5FB2 A;  3L1P A;  4XN3 A;  4DOZ A;  2GAU A;  3E1S A;  4BDY A;  2X48 A;  4XLA A;  3WG9 A;  4RAZ A;  1Y56 A;  4CO8 A;  1IF1 A;  2PX9 A;  2W24 A;  1SAN A;  4BE2 A;  4I2O A;  1XB4 A;  2VOO A;  1OFC X;  4KUM A;  1QPI A;  2HDW A;  4XKV A;  3TO6 A;  4AID A;  1PDN C;  3MQ0 A;  1Z3Y A;  5KK1 A;  3IL2 A;  5EZH A;  1WI3 A;  1X4O A;  1FZP B;  1V4R A;  1P7J A;  1SMY F;  2I8D A;  2RN7 A;  3CP8 A;  3HSE A;  3SHF A;  1UHM A;  5LHH A;  2OBP A;  2M0C A;  3DCF A;  2P8T A;  2DFE A;  5JHF A;  5H6R A;  1R6R A;  1HKT A;  1V54 H;  1NHA A;  2HGC A;  4NC6 A;  5HLH A;  2VKE A;  1H8A C;  2Y9Y A;  3RZO J;  4XSX F;  1AKH A;  2GM4 A;  3O3K A;  4G6Q A;  3F8F A;  1D1C A;  4KDP A;  4W1U A;  1UST A;  2VQG A;  2FX0 A;  2O03 A;  1PP8 F;  3LSJ A;  1OR7 A;  2FQ4 A;  2RAE A;  4KIS A;  4BL0 B;  3DLL F;  2R5Y B;  1RES A;  3R60 A;  4YFX F;  5EG0 A;  3R0A A;  2CFX A;  2CQQ A;  3PUF A;  3WOD F;  3QRF F;  1O3T A;  5ILS A;  3F6O A;  2LKP A;  2EZI A;  4BXF A;  2MW8 A;  4M72 A;  4D5C A;  1WPK A;  1MJ9 A;  2WAF A;  3QWL A;  3IWZ A;  2M30 A;  1D8J A;  2GOM A;  4GDF A;  4CCL A;  2LP0 A;  1LFB A;  3D5R C;  2V1N A;  4U0V A;  3MMY B;  3JRC A;  4KIF A;  2F48 A;  3GW2 A;  2DT5 A;  1A6Q A;  3CMM A;  5K5O A;  2Y0S N;  4R1H A;  1LDJ A;  3ZMZ A;  2IS6 A;  1YJ9 I;  1YW8 A;  2JSP A;  1W0T A;  3FIS A;  2XGE A;  1HQC A;  2A5Y B;  1OYW A;  1BR2 A;  3MEX A;  1VF9 A;  2V7F A;  2LH9 A;  4F7Z A;  1TC3 C;  1RUO A;  4KN4 X;  4M6Y A;  1O3R A;  4IRI A;  2DT7 B;  4PJN A;  5ICG A;  3UNG C;  5B1B H;  4E70 A;  2F5F A;  4A5N A;  1FX7 A;  3F0C A;  2PBI A;  5CQE A;  1CF7 A;  3BG7 A;  4NQW B;  1IC8 A;  3ERM A;  5F6F A;  3GUD A;  2L02 A;  3V7C A;  3EYI A;  5B5E C;  3ZMU A;  1ITY A;  1P7I A;  1VI0 A;  2IXS A;  1WKM A;  3RQ4 A;  4BE1 A;  5DD8 A;  1D3Y A;  3VFZ A;  2CUE A;  4HDV A;  2MD5 A;  2LTP A;  1D8K A;  2EV5 A;  4DW6 A;  2R4G A;  2WWY A;  2M87 A;  2B7E A;  3LST A;  3W2W A;  5DS9 A;  1VQM I;  2VBZ A;  5DDG A;  3S2W A;  2XKO A;  1WZ2 A;  1FIA A;  1LNW A;  5GP9 A;  1SD7 A;  5GAD J;  3ABK H;  5FLX K;  2IBD A;  3DBH B;  1X19 A;  3BTL A;  2IEK A;  2PN6 A;  3HL2 A;  2OD5 A;  3QQA A;  1QZZ A;  3FXR A;  5F0F A;  4IHW A;  4RGS A;  1FYK A;  2Z9O A;  4N9I A;  1FOY A;  4UVB A;  5HLI A;  3M07 A;  4XLH A;  5FFZ A;  3KZI C;  3G3Z A;  2WY8 Q;  5EEG A;  3BTC A;  4D0P A;  3ROU A;  3OSG A;  4A3C J;  3L2Q A;  4I02 A;  3LSR A;  2O3F A;  2QBY B;  1OYI A;  2P5V A;  3H1C A;  3TP0 A;  1ZGA A;  3OSF A;  2IA0 A;  2XB5 A;  1MW7 A;  3OS2 A;  5LEJ A;  1AHD P;  5D8K B;  2NXN B;  4NUB A;  4F92 B;  2V9V A;  3TOA A;  1JKO C;  2K9N A;  2KP6 A;  4BXX J;  3I0T A;  3VYR B;  3HTU A;  2ADU A;  3S1R J;  5J8C A;  3QOD A;  2CQK A;  2V9P A;  3AG2 H;  3I59 B;  3K9T A;  3QP6 A;  3K4J A;  5FRM A;  4OOI A;  5BMZ A;  1A04 A;  2Z2S B;  4RLF A;  1ZG1 A;  5LD2 C;  2Q2E B;  4U88 A;  5D5V B;  4Y52 J;  4EV0 A;  4BDZ A;  4XKB A;  3OYM A;  3HRS A;  4B48 A;  4B44 A;  5GAE J;  2O8X A;  3GFL A;  5DM7 F;  3QPT A;  2ZJR F;  3TP3 A;  5FGM A;  2QWW A;  3BTI A;  1Z0X A;  1ETY A;  2F5E A;  5E8G A;  1YIT I;  1MMG A;  3S1Q J;  2XKP A;  2CQ7 A;  2KZV A;  1VQP I;  4E7H A;  4ZTJ A;  1BI2 A;  4IHS A;  3CCQ I;  2ZXI A;  2DPU A;  3Q0V A;  3RCO A;  5J8F A;  1K6Y A;  3IV5 A;  2ACJ A;  5DCF A;  4MTD A;  2XF6 A;  3GTM J;  2ZO4 A;  2XRL A;  3C7J A;  1GVJ A;  1HA8 A;  4HNT A;  2HEO A;  5CJ9 A;  1IN8 A;  2IP2 A;  3K4B A;  5A2Q K;  1KU7 A;  3LFU A;  4Y13 A;  2NRA C;  3WTZ A;  4BE0 A;  5J40 A;  4EVI A;  2VBX A;  4RAG A;  4XLN F;  5KVR A;  4AYB N;  4B43 A;  4K2E A;  4HX4 A;  3Q0W A;  1W7P D;  3WE2 A;  5D4S A;  3FBI B;  4PCQ A;  3LAJ A;  2AQE A;  3FXQ A;  2BBY A;  2R3S A;  4C3I J;  4A6D A;  2R7W A;  1KGS A;  2AXT C;  1ZGW A;  1MDM A;  5HS9 A;  3ERE D;  2A05 A;  1TT5 B;  4BKX A;  2WAQ A;  2P0W A;  5FLX Z;  3OYL A;  5FO5 A;  1ZLK A;  5ILV A;  4O6J A;  3G6E I;  4RAY A;  3F8N A;  4HF0 A;  2XV4 S;  5AIP A;  3HOZ J;  4NB5 A;  1OCZ H;  3FMS A;  4RA2 A;  2O0Y A;  1T8I A;  2H1K A;  2YU3 A;  1W36 D;  2RGV A;  3OIO A;  1SFE A;  2X9D A;  4FX0 A;  5IYD J;  2B63 J;  3RIR A;  3LSG A;  1WVR A;  1IG7 A;  3EUK L;  2OPT A;  1BN5 A;  3GX4 X;  5M5W J;  2NS7 A;  4DIQ A;  1Y1W J;  3OR2 C;  3V42 A;  3ESW B;  4RM2 A;  3PUB A;  2H6C A;  5FFX A;  4P9U A;  1XS9 A;  1QZY A;  1XD7 A;  3FXL A;  3KPH A;  4A3E J;  1HST A;  1EF4 A;  5DYM A;  1AKH B;  3W2A A;  1VQ9 I;  5TJJ A;  1LFP A;  2W7N A;  4G9Y A;  2BW3 B;  1R1U A;  2DOA A;  2QLZ A;  1QA6 A;  3CME I;  1JI8 A;  5J4V A;  1S3J A;  5KHD A;  1LVA A;  2JN6 A;  1D0Y A;  4XLE A;  1AWC A;  2JA8 J;  4U87 A;  1FIP A;  4FQG A;  2BYV E;  2JRM A;  4XNF A;  5EG0 B;  1TP4 A;  1MBH A;  4CH7 A;  2ECC A;  3GCM A;  4G7H F;  3KET A;  2W84 A;  3G1M A;  5IP7 J;  4RDU A;  1ZKG A;  3OIQ A;  5D4R A;  2WV0 A;  1BJA A;  1GUU A;  5FKO A;  1WI9 A;  1ULY A;  3HSF A;  2WB1 A;  3LNQ A;  3C3W A;  1A36 A;  3SJM A;  2VJJ A;  4HZF A;  2P4W A;  4M3G A;  3I54 A;  2DTR A;  2JSC A;  3D5S C;  4IHX A;  1X1C A;  3B6A A;  4B1R A;  3I5U A;  3R6S A;  3SDG A;  3V4G A;  2VB6 A;  2RQP A;  3WU2 C;  4Y33 A;  1R5I D;  4RB1 A;  1XMA A;  4BHB A;  3CJQ B;  1UHS A;  3IUO A;  1BI0 A;  5A2Q Z;  3WTT C;  1VQ6 I;  3C2H A;  5H2F C;  2LC2 A;  1T08 B;  5BS6 A;  1KQ8 A;  3K2A A;  2GIV A;  4Y3O A;  1BW5 A;  3CLQ A;  1BC8 C;  4QPQ A;  3PO3 J;  2XSJ C;  2EIN H;  1P2F A;  4LMY A;  4RLQ A;  2W25 A;  4DNC A;  2L7F P;  5LRS A;  1T6S A;  2W57 A;  4UUV A;  4BXU A;  2E2J J;  3T1B A;  3E3V A;  1MD0 A;  2Y30 A;  3N97 A;  5FLV A;  1SFK A;  4Y15 A;  3HOX J;  1VQ4 I;  1WFX A;  3QYE A;  4KJZ A;  2PJR A;  3S1M J;  2HOA A;  1YW7 A;  1CF7 B;  2ESH A;  2E19 A;  1U0J A;  5E1X A;  4L0Z B;  3K10 A;  4J00 A;  1H88 C;  3CP2 A;  5KAF C;  1ODD A;  2DPD A;  1TNS A;  4HX7 A;  3U1D A;  2VON A;  3K7A J;  2LK2 A;  2X6X A;  3SZT A;  4HDU A;  1R22 A;  4YRV A;  1ACI A;  2P6T A;  4ZJZ A;  3PSF A;  2EIJ H;  3ZP5 A;  1GV2 A;  1J59 A;  5FD5 A;  1UG0 A;  4CCK A;  4M6X A;  1LEB A;  2CQX A;  4G94 A;  3TDU C;  3P7N A;  1VND A;  4S04 A;  4L18 B;  1DU0 A;  4YIF A;  3E5U A;  3WTV C;  3L00 A;  1Z7L A;  1WHU A;  2UXN A;  1QVU A;  2E1C A;  1X2M A;  3OYC A;  3F22 A;  2DOE A;  2H8W A;  2D2W A;  4OIQ F;  3T0Y A;  2LKX A;  1ZGJ A;  3BCA A;  2MFZ A;  4RGR A;  3WTY C;  2P5K A;  2WY7 Q;  1WWX A;  2UUZ A;  4ETS A;  4UB8 C;  2DA2 A;  2NVQ J;  1T2K A;  4DQ2 A;  2QEX I;  5CVI A;  3OYK A;  3S3M A;  3EQL F;  4E7I A;  2J5P A;  4L5I A;  5BOX A;  4BHP A;  1JUP A;  3KP6 A;  1LQ1 A;  2IRF G;  5TRD A;  2DBB A;  4NQW A;  2N8G A;  3K6G A;  2ZSI B;  5LFA A;  3H92 A;  1QGP A;  3FWE A;  2VOP A;  2L54 A;  4BY7 J;  1JUM A;  1NG7 A;  5TGT A;  1X1D A;  1G4D A;  3JRD A;  4EJT A;  1YYV A;  5HVQ C;  2DU9 A;  4GFB A;  5L3C A;  2XC7 A;  3GZ6 A;  2F6C A;  2FF4 A;  3KIO A;  2EZH A;  2CFO A;  2ZFW A;  5E79 C;  1JHH A;  3PQK A;  3PL8 A;  2HFH A;  4Y4R A;  2XSD C;  4I6Z A;  1D0X A;  3HOW J;  2ISZ A;  3CCU I;  3MVP A;  2JA7 J;  2V9K A;  4AVZ A;  3BZK A;  2L9R A;  2HWV A;  4YEL A;  4D7M A;  3U9G A;  2D45 A;  3VPR A;  3A01 A;  3CQZ J;  3AG4 H;  3HM5 A;  1SVM A;  1K78 A;  4LD5 A;  5FKN A;  2VC1 A;  3ONQ A;  1B8I A;  2ISY A;  2EIK H;  1WCM J;  4XOR A;  4AIK A;  1W5S A;  4IOC F;  1UG2 A;  1QBJ A;  2X6O A;  4L5E A;  4MNU A;  4YG2 F;  2K9M A;  4C3H J;  3M1E A;  5EYR A;  4BAY A;  2PMU A;  2X1D A;  2VT2 A;  5CYV A;  1UEL B;  3TL4 X;  1ZAO A;  2EZL A;  1I3A A;  2QVO A;  2EIL H;  3LSH A;  4BHC A;  2Q1Z B;  4UUT A;  4QPO A;  1XGO A;  2NOJ B;  2VLA A;  5ILU A;  1SD4 A;  4IJA A;  5ICF A;  1BIB A;  3WGH A;  2PMZ N;  2A07 F;  1ZLJ A;  2EH3 A;  2QQA A;  3PNY A;  2DFI A;  1WJD A;  4RBO A;  1MIJ A;  1ZTR A;  4YEJ A;  5LHG A;  5LGN A;  1FPQ A;  3HOS A;  4XN0 A;  3BP8 A;  3OYB A;  1G3S A;  2NAZ A;  4LIU A;  1XCB A;  3H35 A;  4WK8 F;  3LQQ A;  5EGO A;  5LHI A;  3JSO A;  4BJT A;  2HQR A;  2Y75 A;  1MDM B;  3KZY A;  3Q5F A;  3J7A Y;  4FHT A;  4XK4 A;  2PQ8 A;  1D1A A;  4EJV A;  1VZ0 A;  1SAU A;  4WCG A;  1O3S A;  1ZN2 A;  1EH6 A;  3WGI A;  3R0J A;  1S7O A;  3GWZ A;  5D5W B;  3I55 I;  5B3S H;  3GYH X;  3GTG J;  4ZH4 F;  2ZKZ A;  1MNM C;  1WJB A;  1LB2 A;  2HVS A;  2G9W A;  2IW5 A;  1RKT A;  2DMN A;  2VT3 A;  3OL3 A;  1EJ9 A;  3OYG A;  2OAZ A;  4NDL A;  3X2Q H;  4Y7N J;  4ZZD A;  2JQ7 A;  2BHY A;  1U3E M;  2CYY A;  4CCM A;  3K4N A;  2L7K A;  1T56 A;  2BZT A;  3RYR A;  1QVT A;  2JT1 A;  3EPZ A;  1OR7 C;  1S8N A;  1PP7 U;  2LRD A;  2MA3 A;  4B3A A;  3AAF A;  4NHJ A;  2LSO A;  1QHG A;  4BNC A;  4JX4 A;  3V8K A;  4WF2 A;  4KFC A;  3I71 A;  4XOT A;  4XID A;  2XAJ A;  3U21 A;  1IO2 A;  3CCS I;  3SFZ A;  3PIP F;  5IYB J;  4LG0 B;  3K4L A;  2IS4 A;  2F4M B;  1SFO J;  2BE5 F;  4EQQ A;  5FKL A;  3L9F A;  2ZNZ A;  1T38 A;  4G6D A;  1K4T A;  5BPD A;  4Z2Y A;  4HNU A;  1OCR H;  4GYG A;  5LGU A;  1NK2 P;  3E6D A;  2PJP A;  2FOW A;  3GF2 A;  4LK0 F;  2KMU A;  3CJR B;  2QSG X;  4OIP F;  1G6N A;  3KFW X;  2VXD A;  3CTA A;  2I10 A;  3Q3S A;  1WGX A;  3K4M A;  2HPM A;  2DK8 A;  1OLT A;  1DPR A;  4F93 B;  4A6E A;  4LOC A;  5FRO A;  3MAJ A;  1JGG A;  2PG4 A;  5CVJ A;  3ZQH A;  3CCM I;  1I39 A;  3A02 A;  5BPI A;  3FZV A;  2JA2 A;  5K5Q A;  4MEX F;  2NS0 A;  3N4M A;  4ZDP A;  1GXP A;  1J5Y A;  1WH7 A;  4UVA A;  4UV8 A;  1R71 A;  4LGW A;  2ZJP F;  4WXD A;  1OJL A;  3ZQL A;  4ANJ A;  2XGD A;  3D0S A;  3M8F A;  2WV1 A;  1TQM A;  1F36 A;  1G3T A;  2R93 J;  4XIC A;  1IV8 A;  3CJN A;  3S17 J;  2KRF A;  3VOD A;  3IP4 B;  3I4P A;  3T8T A;  2FE3 A;  3S16 J;  3EDP A;  2M3A A;  4II3 A;  2PLY A;  2VJ4 A;  1D1B A;  4BAC A;  4QSH A;  3TKY A;  3TOB A;  4CYC A;  2V1U A;  2CW8 A;  3P9K A;  1U9N A;  3OV8 A;  1S29 A;  3U2R A;  3HPG A;  2WA0 A;  5IY5 H;  3T8R A;  5FRN A;  1REP C;  3CF5 F;  1G3Y A;  2WB1 N;  3BZ6 A;  4JBA A;  3MD2 A;  1O3Q A;  4U0W A;  2STT A;  2VPR A;  2E60 A;  3BWG A;  3JRB A;  2DW4 A;  2JUC A;  2BW3 A;  4M6V A;  3KP3 A;  4BY1 J;  4YFN F;  3GTP J;  1YX5 A;  3LMM A;  3UR3 C;  1ON2 A;  2DJN A;  3JR9 A;  5LEK A;  2BY0 A;  2PJR B;  1V5G A;  5L3G A;  4XLP F;  4HV5 A;  3TO7 A;  4BBR J;  2D5V A;  3WHB A;  1E3H A;  3RI4 A;  1E2X A;  4QLC U;  2X51 A;  2IJL A;  5JLX A;  2LNB A;  4EGZ A;  3G4S I;  2IGO A;  1BW6 A;  4XRM A;  2Z33 A;  2LKS A;  1JKQ C;  5HNH A;  4U7B A;  4D5F A;  2TRT A;  2OC6 A;  2RV8 A;  3D1N I;  1HW5 A;  2R7T A;  4FAS D;  2GWR A;  4IKF A;  3HTS B;  2D1V A;  2DLL A;  3BOQ A;  2Y31 A;  3K70 D;  5IP6 A;  1K4S A;  3QOE A;  5E1Z B;  4MQV A;  4AC0 A;  2F5C A;  3RDI A;  5J4Y A;  1RRJ A;  1OPC A;  4NC8 A;  4ABZ A;  4A0X A;  5D6F A;  5AIQ A;  2KIQ A;  3QP5 A;  4FE4 A;  3ASO H;  3MKW B;  4U7D A;  1WJC A;  5LLQ A;  3OY9 A;  4IO9 F;  4ZDO A;  2EA2 A;  1W36 C;  2VKV A;  2DOD A;  4PSW A;  5HNF A;  1SFX A;  5JLW A;  3QYF A;  2WBM A;  5CQG A;  4ON0 A;  2LYC A;  5K1Y A;  2DMU A;  2Y69 H;  3TDZ C;  4WX9 A;  3NAR A;  2YSR A;  3W6J B;  1TLH B;  3I4N J;  1I1S A;  4II2 A;  3RKY A;  3PO2 J;  3IKT A;  1TNT A;  5HLG A;  2JRT A;  3FM3 A;  3MWM A;  4BQQ A;  3GFI A;  1ORK A;  1Z1D A;  4M3F A;  2FBK A;  1RKW A;  1J09 A;  1Z6T A;  1O4X A;  5JVT A;  5E3M A;  3IKV A;  3DPU A;  1BIA A;  1VQ7 I;  1YE9 A;  1YRN A;  4HW0 A;  2L2O A;  2ICW G;  3DBR B;  3H3Z A;  3FHN A;  2DI3 A;  2XAU A;  4L5J A;  1FP1 D;  1IW7 F;  4BJ5 C;  4I7H A;  4DZP A;  1ZAR A;  2R7U A;  1BR1 A;  4IOA F;  3VSK A;  1N75 A;  1UFM A;  2HZD A;  3I58 A;  3DTE A;  2M45 A;  4HNV A;  3H3V K;  1G3W A;  3DLA A;  1FEX A;  2CMP A;  4BBS J;  3A01 B;  1P92 A;  2JJ7 A;  4WXH A;  2MSY A;  4HBL A;  4N4O B;  4E4H A;  3REO A;  4AUX A;  1K78 B;  2ID3 A;  2K4B A;  3BCB A;  4C2U A;  3G1O A;  1B8I B;  1F9N A;  3H5N A;  5GAH J;  3DV8 A;  2CQN A;  1R00 A;  1W7P A;  2KRH A;  3GVA A;  2L7Z A;  4B09 A;  4OU0 A;  4OMY A;  3ZR8 X;  2VPL A;  2IT0 A;  4B47 A;  4UXN A;  2LFB A;  2H09 A;  1FWZ A;  2DO7 A;  1PVE A;  4PUS A;  2ZSH B;  4XL9 A;  2EQR A;  5CVR A;  1IDY A;  2K27 A;  2WAD A;  4N9H A;  1ON1 A;  3PIO F;  2ZME A;  3F8B A;  4M3D A;  2LG4 A;  1HDP A;  2M7B A;  1T39 A;  5ED4 A;  2D1H A;  3KYL A;  1P4X A;  2E1O A;  3CUO A;  2ZJQ F;  4A3B J;  2HI3 A;  3LAP A;  4HQE A;  2K7L A;  3WTX C;  4A0Z A;  4J19 A;  1R1V A;  1Z6R A;  5EGO B;  3O6B B;  3T5X A;  2E2I J;  1H89 C;  4M3B A;  5JI6 A;  1KU3 A;  1XTA A;  4L9T A;  1GT0 C;  3LSK A;  5BNG A;  3CCV I;  1KZH A;  2RKH A;  5E1W A;  5DTD A;  1DUX C;  1LE8 A;  4BEH A;  4E7K A;  1ENH A;  1XSX A;  1BC7 C;  2VQC A;  4BQN A;  2K4J A;  2KZG A;  4HEA 2;  3DPT A;  5CKT A;  4IRG A;  2DXI A;  1Y39 A;  2XAQ A;  3Q0U A;  1IDZ A;  4MO7 A;  3H3U A;  3RZD J;  1UMQ A;  4YII A;  2O61 A;  3BG6 A;  2CU7 A;  2AS5 F;  3S2D J;  3ZMS A;  3A2K A;  1X1A A;  3GBG A;  2AQF A;  3TED A;  4KIB A;  1ZYR F;  1Z05 A;  2Y2Z A;  3S1N J;  3NWS A;  4HQM A;  5M3M J;  1XDS A;  5KAI C;  2W48 A;  3DKX A;  2K86 A;  5E3O A;  4HF1 A;  2KIF A;  5EZG A;  2EK5 A;  2HS5 A;  3CDL A;  4MIM A;  3K4C A;  1HW1 A;  4L9J A;  1R58 A;  4BQA A;  1MH3 A;  2X0L A;  3BR3 A;  3KZZ A;  3O8H A;  3ZQI A;  4BYY A;  4G7O F;  4PFO A;  2CJJ A;  2X85 A;  1USS A;  2A6H F;  3NAU A;  4IHY A;  5LRR A;  5L3F A;  4CGZ A;  4M71 A;  2VI6 A;  3GEZ A;  4X0G A;  1RR8 C;  4XLF A;  3VB2 A;  1KYZ A;  3PQJ A;  2DDA A;  1BOB A;  4MHG A;  1D5V A;  1G59 A;  2F5D A;  5B1A H;  2H94 A;  2RVC A;  3WU1 B;  2L4M A;  4XSZ F;  3K0L A;  2YS9 A;  3CC2 I;  3ZMD A;  3HKZ N;  1UCR A;  3E6M A;  3EUA A;  3MZY A;  4QIW N;  3AKZ A;  3C1D A;  3L7W A;  1ETV A;  5J6X A;  5H6Q A;  1XSV A;  2XDV A;  3IH2 A;  2IVM A;  3W3C A;  4YIR X;  2O8K A;  4UB6 C;  1VQ8 I;  1P9Q C;  2BXY A;  2HTJ A;  5K7H A;  1Y8Q B;  3OYN A;  1G2H A;  1YG2 A;  2E34 A;  1IN7 A;  2JPC A;  2CGP A;  2W82 A;  2VUM J;  3OIP A;  3MZH A;  1HC8 A;  1S7A A;  3A03 A;  3DP7 A;  4EM1 A;  3ZCO A;  1XG1 A;  3PSI A;  1VQK I;  2NVU B;  5J3L A;  2ID6 A;  2GA2 A;  1Y1V J;  2BXZ A;  4EGY A;  1FP2 A;  3J7Y J;  1STZ A;  4CYC B;  1GHC A;  2Z16 A;  2L7M P;  1BJZ A;  5HS8 A;  4HLY A;  3SQN A;  2YX7 A;  4LG0 A;  4RB3 C;  2QF7 A;  2MYS A;  3C2G A;  5IOZ A;  4U0Y A;  3ISP A;  2M8G X;  2MH2 A;  3QU6 A;  1FTZ A;  5GPC A;  2V6E A;  3BDD A;  4YFK F;  2KRC A;  2QGU A;  2HOS A;  1R49 A;  3J81 K;  1W1W E;  1VQN I;  4I99 C;  3A1Y A;  4JYK A;  4WXC A;  3HHG A;  2AHQ A;  3HHH A;  2HDD A;  1MBF A;  2XVC A;  3ASN H;  2DK5 A;  1BOA A;  1BBY A;  4I09 A;  3S93 A;  2OZ6 A;  3M8J A;  5KCM A;  3RPQ A;  1XSD A;  1TQI A;  1FYL A;  1MBK A;  1HXD A;  5FD6 A;  2VKH A;  4ZYA A;  2GZW A;  3F21 A;  2DQL A;  2JUG A;  2HZT A;  4UV9 A;  2M9H A;  2ELH A;  2VBW A;  3BR2 A;  3V8J A;  1F5T A;  1MSE C;  4DZJ A;  2GIZ A;  4IRH A;  3ABT A;  3HRM A;  3VEP A;  1FTT A;  1ETX A;  3CO7 C;  4J01 A;  4XQF A;  4XMY A;  3V7R A;  1ETQ A;  1ZEL A;  2E1M C;  1D0Z A;  3JRG A;  3OS1 A;  1R7J A;  2M5W A;  3PFI A;  1U8R A;  3GXO A;  2R7V A;  1R4N B;  5E17 F;  2XIG A;  4G6T B;  3F23 A;  4BGD A;  2VOD A;  1YIO A;  3ZQQ A;  3QPL A;  4AIJ A;  3Q9S A;  3S14 J;  4F52 A;  4IF4 A;  5F0C A;  2HKX A;  4GXO A;  2M0M A;  2KHM A;  4FIS A;  2HQN A;  3BJO A;  4FT8 A;  4V2G A;  3ECO A;  4Q48 A;  5DV5 A;  3OYI A;  5GAG J;  1T95 A;  2EB7 A;  2ESN A;  2GQQ A;  3FMR A;  4OAZ A;  2MH9 A;  2Y9Z A;  4IQ4 A;  5AON A;  2VQL A;  1V3F A;  4IZZ A;  3K69 A;  2EV0 A;  3DEU A;  3GLL A;  3TW6 A;  1SC7 A;  1D5Y A;  3P5J A;  4A3M J;  1F43 A;  3S8P A;  2O9L A;  4MGR A;  4IX7 A;  4M9Z A;  2YU9 J;  4C9Y A;  3ZXS A;  1OQY A;  3HC7 A;  2LD5 A;  1ZRC A;  3KEO A;  3HZJ A;  2CG4 A;  5LBQ A;  1JJ8 C;  4XRF A;  3C18 A;  1SEU A;  1IXR C;  3CD6 I;  2OF7 A;  1YRN B;  2HXO A;  4M74 A;  1JHF A;  2O6G E;  3CJT B;  3WU0 A;  3M9A A;  3NEU A;  2DYR H;  2MLK A;  3JW4 A;  1X1B A;  2M2E A;  3MZ8 A;  3KP7 A;  3GZ5 A;  1BM9 A;  2W1O A;  2Y0S A;  3GLX A;  2ME6 A;  1MND A;  3KP5 A;  4DGW B;  1UAA A;  2DMT A;  4PK4 A;  1IXS B;  3KP4 A;  4I76 A;  4UHT A;  5F27 A;  1TT0 A;  3BPX A;  1IAW A;  5DEQ A;  3K1N A;  4A3K J;  1B1B A;  1Z7U A;  1B9N A;  2K9S A;  2VXZ A;  4N4N B;  1W5T A;  2XGC A;  2UXX A;  3E97 A;  1W7P B;  2EFN A;  3AFH A;  5J1Y A;  4G7Z F;  3QU3 A;  1MBJ A;  5BQT A;  3J81 Z;  2XF5 A;  1YI2 I;  2R7X A;  2Z99 A;  4B4C A;  4CCN A;  5ICC A;  4ENJ A;  1VQO I;  2E71 A;  3DPL C;  3F72 A;  1K79 A;  4C2T A;  1R5H A;  3S3O A;  1EV7 A;  5FKM A;  1J0R A;  1FJL A;  2L5Q A;  2OZU A;  5J1U A;  4M73 A;  1XGN A;  2V26 A;  2ZME B;  3CMA I;  4I98 B;  1SMT A;  4NBQ A;  4V2F A;  1TWH J;  3HOV J;  4C2M J;  3IAM 2;  2E36 A;  2LR8 A;  2FJ1 A;  4EEF G;  2YPR A;  1PUF A;  2LY2 A;  2OQR A;  1LEA A;  2KDZ A;  1GDT A;  4P1W A;  1N78 A;  2FSW A;  4RB0 A;  3LSP A;  1J7K A;  2BOL A;  1L3L A;  2L0K A;  4XRS G;  1Z9C A;  5LGT A;  4E7S A;  5KNL A;  5CVU A;  4BH9 A;  2HPI A;  2LVS A;  1KON A;  1ETW A;  1LUJ B;  2DCE A;  1HW2 A;  3LSI A;  4X6A J;  5EF6 A;  1LE8 B;  4BEH B;  4GRI A;  3A4C A;  1R5G A;  3VYT B;  1MBG A;  2IS1 A;  3I53 A;  3TW7 A;  3BPV A;  4KMU X;  2MLG A;  5FKK A;  2LF7 A;  4ZYG A;  2DAO A;  4LIT A;  2HNH A;  1M1E B;  4N0B A;  1S7E A;  3DF8 A;  1WRJ A;  1QQI A;  3H5R A;  1KA8 A;  2CW0 F;  1BI1 A;  4LLG F;  2H27 A;  1JT0 A;  3PJR A;  3WTW C;  3L2U A;  1E3P A;  2BY1 A;  2ZXW H;  3FK6 A;  3K70 C;  1XGS A;  3H5A A;  1J2X A;  2BEO A;  1LDD A;  3FHZ A;  2CSO A;  2RQQ A;  1AA7 A;  2VIX A;  1U5T C;  3OYJ A;  5D8L B;  1TW2 A;  1BL0 A;  2ZBK A;  3F6V A;  1Z21 A;  4XKC A;  3J7A O;  4IHT A;  2K02 A;  4LB6 B;  2X6Y A;  3RPU D;  1O57 A;  2H1L A;  4TV7 A;  1S5L C;  2UWM A;  3DXJ F;  4XLC A;  4LIV A;  3RJP A;  5HDK A;  2RC4 A;  4HYE A;  2EZK A;  2EIM H;  4ESJ A;  1X58 A;  1KQ0 A;  2LY1 A;  4QWQ A;  3SEQ A;  4XOP A;  4JK1 X;  3BZC A;  3FX3 A;  3DWL E;  3ECH A;  4AM3 A;  1CGP A;  2X1E A;  3IC7 A;  1SFU A;  5GPA A;  3LSM A;  1N77 A;  3KCC A;  1S6L A;  5IPA A;  4OMZ A;  4EM0 B;  3W2V A;  4Q4Z F;  4H4K C;  1H9T A;  2FEZ A;  3BRO A;  1R1T A;  1W0U A;  1KU2 A;  2CRG A;  2DA7 A;  3V8L A;  4IQJ A;  3ZMT A;  1IGN A;  4DBR A;  4RM3 A;  4XR6 A;  3CF2 A;  3TQN A;  2EFW A;  3LA3 A;  3P9C A;  4BJ6 C;  2XB0 X;  2DA6 A;  3B02 A;  1TWG J;  3R4K A;  3WTS C;  1X4P A;  1U9O A;  3L09 A;  3GTO J;  4OIN F;  5JR3 A;  1XCV A;  2WAQ N;  3CC4 I;  4XON A;  1OCP A;  1FSH A;  1E0E A;  4DYR A;  4F3Q A;  1KYW A;  2PEX A;  2M7A A;  2V6C A;  4G8X A;  3IH4 A;  4E6K G;  3WE3 A;  4AYB A;  5B66 C;  2JPB A;  1WSU A;  3F9K A;  4ZZL A;  2KT0 A;  4PJM A;  3IRQ A;  2WAE A;  4HST A;  4D1Q A;  4HLX A;  3DTK A;  2JA5 J;  2XGX A;  1HKS A;  2H6B A;  1G8X A;  3H0G J;  2QKM B;  1FBS A;  2VKD A;  4BQO A;  3A0B C;  4EJW A;  3U1K A;  1Y6I A;  1A35 A;  5L3D A;  3ZQC A;  1I50 J;  2HOE A;  1IN5 A;  1U5T A;  5E3L A;  3IH3 A;  2G0E A;  3TGN A;  2P7V B;  4DJA A;  2EJR A;  2R7Q A;  4F91 B;  2M4K A;  2K3F A;  2E35 A;  1NTC A;  1JGS A;  1RR7 A;  2GOX B;  1UHW A;  2HQA A;  5F0H A;  3JRH A;  1DQU A;  1MBE A;  1VFC A;  3G71 I;  2RRE A;  3M3Y J;  1A6I A;  4QTR A;  3GFM A;  3GTJ J;  2RNG A;  4R8H A;  3M8E A;  1HCR A;  3HSR A;  2DDB A;  2LOO A;  1ETO A;  2FUG 2;  4JOM A;  4BUP A;  1TZL A;  1NH3 A;  4ENK A;  3K4K A;  5DD4 A;  2A6E F;  4RGX A;  5IOY A;  1T0F C;  1YW9 A;  2STW A;  2R7D A;  3VYS B;  1X2N A;  3BTJ A;  5D6E A;  1FBQ A;  3ZOB A;  4LLL A;  2FOK A;  2NYX A;  2R7Z J;  1DP7 P;  2MBF A;  1BR4 A;  1GV5 A;  2XRO A;  3MKZ A;  2CS3 A;  4P96 A;  3KLO A;  4KIC A;  2A6T A;  1FT9 A;  1RET A;  2NVT J;  1B59 A;  3G2B A;  1J9I A;  3GTL J;  1ZRD A;  2K9L A;  2AO9 A;  4Q47 A;  5E3N A;  3TMO A;  1MNE A;  1QPM A;  3BQY A;  5GTI C;  4OIO F;  1RNL A;  2KFD A;  1ETK A;  4IXA A;  1MMD A;  3VSL A;  2GA1 A;  1YS6 A;  3OOP A;  2XUB A;  4ZC3 A;  4KN7 X;  5DCM A;  3RKW A;  3S2H J;  3SDB A;  1L0O C;  2E1N A;  2VN2 A;  2VE9 A;  4LJZ F;  3OYA A;  2CW7 A;  1ONV A;  2K3P A;  1DGR M;  3K1P A;  4CYD A;  4GO1 A;  3B73 A;  5IYC J;  2IGM A;  2QQ8 A;  4CZC A;  2QYO A;  2C6Y A;  1BA5 A;  1E3O C;  3ABL H;  3I64 A;  4LG3 A;  2BVL A;  2OA4 A;  4KIG A;  1IZ1 A;  1ZH5 A;  2MAB A;  2PFB A;  2KJC A;  1PJR A;  2O7O A;  3IRR A;  4ITV A;  4KMF A;  4I0B A;  1HSJ A;  3CUQ A;  2A5W A;  3HJE A;  1VTN C;  2FXA A;  2ZME C;  4GYI A;  3FBN B;  1UJ8 A;  5F64 A;  4UVC A;  4EM2 A;  4CXF A;  2HQ5 A;  4CHU A;  1YFH A;  2DJI A;  1EKE A;  3SZP A;  2E5N A;  2ETH A;  4XRS A;  3OYH A;  2DN0 A;  2IGK A;  3NQO A;  4PSX A;  4MFD A;  2R7O A;  2R5Z B;  3H9Q A;  3CCR I;  5F1R A;  1K83 J;  3KYC B;  1ZRF A;  4FE7 A;  5J47 A;  4DYQ A;  2E1M B;  2TCT A;  4EJO A;  2CV2 A;  1Z67 A;  2BY3 A;  3ML6 A;  2B0L A;  3RKX A;  2A61 A;  2WTE A;  3JRA A;  2GXA A;  2FA5 A;  2IPQ X;  4PFP A;  1YX3 A;  1XDU A;  2DMP A;  1T0F A;  3ZN1 A;  4D7N A;  2DT6 A;  3BR1 A;  2COB A;  5IT3 A;  5JFR A;  5HOD A;  3AL0 C;  1GVD A;  2RNJ A;  3S32 A;  3CCY A;  3QOP A;  4HX8 A;  1B6A A;  3PNV A;  2M4G A;  5E20 A;  1QRY A;  5D5U B;  2L9V A;  4KA4 A;  4E7Z A;  3E0J B;  2M34 A;  3CLO A;  1PUF B;  4X1E A;  5C4J J;  3VOE A;  2DFH A;  4A93 J;  3HGG A;  2K85 A;  2KIU A;  2NOG A;  3M4O J;  3IWF A;  1U78 A;  2A3S A;  3HOY J;  1Q1H A;  1Z3X A;  3SYT A;  2W00 A;  2J5O A;  4A69 C;  2P7C B;  2KKO A;  4D9J A;  2F2E A;  2G7U A;  4HRI A;  3ULQ B;  3I9V 2;  1XX5 A;  1I3Q J;  1TBX A;  3HOT A;  3BR6 A;  5JHU A;  4R79 A;  4WWC A;  1FOK A;  2VE8 A;  3DU6 A;  2IA1 A;  5F04 A;  3COA C;  1HLV A;  2EBI A;  2QQB A;  2JK3 A;  2OCC H;  3BJA A;  5L3E A;  1V55 H;  2NNN A;  2A68 F;  3RSN A;  2IGN A;  3NRV A;  4PDK A;  1Y0U A;  1KQ9 A;  2OTL I;  2DA1 A;  4RMN A;  2E5Z A;  2JVH A;  4A3D J;  3F8C A;  3I56 I;  1I5Z A;  3HRT A;  1TWC J;  3TO9 A;  3BJ6 A;  4EAT A;  2CO5 A;  2V1D A;  3BQZ A;  3MFK A;  3O2P E;  2LLK A;  1MJB A;  1SVO A;  2CV1 A;  1LPQ A;  1OIS A;  4M9X A;  4ZTF A;  5C3E J;  3S3N A;  1YOV B;  5E18 F;  2EFO A;  3LA7 A;  1TL8 A;  2LY9 A;  1ZQ3 P;  3S15 J;  1JKR C;  2XPV A;  1OYY A;  3FKI J;  2OTJ I;  5HDN A;  1X3W B;  3AG1 H;  2DFF A;  3SXY A;  3CCJ I;  2W85 A;  1OCT C;  3N05 A;  3HGY A;  2DA4 A;  1B72 A;  3RYP A;  1P6R A;  1LVK A;  1FOW A;  3JSP A;  3OMY A;  4UUS A;  1EA3 A;  2VC0 A;  4AWX B;  2OCE A;  2CUZ A;  5DUK A;  5ERI A;  3KEY A;  1W4M A;  4CZZ A;  2ELJ A;  2F5V A;  2LBF A;  4DYC A;  3OWT A;  4GGG A;  1ZK8 A;  4I0A A;  4CDG A;  3HYI A;  3I4M J;  1XMK A;  2QM3 A;  1N25 A;  2AXL A;  2HR3 A;  3RQI A;  1O7L A;  4PJ0 C;  2DA5 A;  1WJE A;  3JRE A;  2HVQ A;  4CSW A;  3OYD A;  3CO6 C;  1UB9 A;  4L9V A;  3HPH A;  3CCL I;  3KE2 A;  2CUF A;  4MLO A;  4HPQ A;  4XKW A;  5HDG A;  2MGQ A;  4ENN A;  1YHQ I;  2PMZ A;  1YJW I;  1YQA A;  3OYF A;  1FYM A;  2KL4 A;  1J75 A;  4OWR B;  5CPR B;  2DTZ A;  1AU7 A;  1ERD A;  4M3E A;  2Z5U A;  1E17 A;  3LOC A;  4LFU A;  2HKO A;  3DU5 A;  4HV6 A;  3MKL A;  1RUN A;  2HYJ A;  1IRX A;  3VWB A;  1FMV A;  4ENM A;  1XPX A;  3OOU A;  2NS8 A;  2Y48 A;  1A31 A;  4IEJ A;  1HKQ A;  3CC7 I;  4HOB A;  1X3Z B;  3Q9V A;  2LRE A;  4RS8 A;  5D5X B;  1FNN A;  2E2H J;  5GTH C;  3WG7 H;  2L3D A;  1CQT A;  2L9N A;  1U5T B;  1ZRE A;  2VJ5 A;  2COM A;  2EFP A;  3V7S A;  2MD0 A;  1F1Z A;  4AD9 A;  1HDD C;  3M1C A;  3LWF A;  1PYV A;  2X6W A;  4IL6 C;  6PAX A;  4GCV A;  2YR2 A;  3EUH C;  1HOM A;  3GZN B;  2QKL B;  4OIR F;  3DKW A;  3HIF A;  4DBQ A;  3RKQ A;  4MFE A;  2L9S A;  2XAF A;  4A0Y A;  1MJA A;  3VDX A;  1Y8R B;  2JTV A;  1B4A A;  2YX4 A;  2ZCW A;  3BY6 A;  5L3B A;  1TTY A;  3GME A;  4ESF A;  3HOU J;  2VBY A;  3LFK A;  3KYD B;  2JWT A;  2VL8 A;  3FXU A;  3ZQF A;  1DU6 A;  4OAY A;  2P5L C;  3BLY A;  2TDX A;  5ICE A;  5DM6 F;  3L2V A;  1DGW Y;  1POG A;  1B9M A;  2ZFU A;  2DQR A;  2KDO A;  2R7F A;  3L2R A;  2GXG A;  5EEA A;  2OQG A;  5M5X J;  3E5Q A;  1QNT A;  2JVG A;  4UY8 I;  2CWE A;  3ZPL A;  3KP2 A;  4V19 K;  4I01 A;  1IRF A;  3FXJ A;  3OYE A;  2KLO A;  4KT5 C;  1IN4 A;  2EFQ A;  2P6S A;  3BT9 A;  3FDY A;  5C4X J;  3BR0 A;  2JMW A;  5DCM B;  1FMW A;  4KIT B;  5M5Y J;  3L2C A;  1Z77 A;  2IA2 A;  4O3M A;  1FC3 A;  2XAS A;  1LJ9 A;  1I1G A;  1IN6 A;  5HS7 A;  1SD5 A;  3LA2 A;  2W4S A;  1R4M B;  1IUY A;  3WHC A;  1O7F A;  3KLN A;  1EH7 A;  2G7H A;  2ZJ2 A;  4ZYD A;  2QZ8 A;  1R9T J;  1XGM A;  3EYY A;  4P55 A;  1I27 A;  2FNP A;  2UV1 A;  2VQH A;  4FCY A;  1HF0 A;  3QPH A;  3HUG A;  3W6K B;  3BG3 A;  3G1L A;  1YS7 A;  2WC2 A;  3DKY A;  1I6H J;  2QSF X;  2FML A;  1FOX A;  3CDI A;  1WH5 A;  4S0H B;  1RZ4 A;  1IJW C;  3IHU A;  4A3L J;  3A0H C;  2MG4 A;  2HYG D;  2BGC A;  3CES A;  3EET A;  5F08 A;  2F4O B;  3CUQ B;  5F1J A;  1SVL A;  2M1B A;  3JAM K;  4MTE A;  2IS2 A;  3J7Z I;  4G12 A;  3DEW A;  1TWA J;  4RB2 C;  2UZK A;  2XHK A;  3LL7 A;  2GBY A;  3F3X A;  2E7X A;  1JTX A;  4ZDL A;  3BR5 A;  5HLT A;  2ZXJ A;  4Q5S F;  3ELK A;  2O5R A;  4JP0 A;  3FXM A;  3EUH A;  2QA4 I;  1EH8 A;  3IAS 2;  2OJE D;  5K7Z A;  4A3I J;  3HG9 A;  3FXO A;  3WGG A;  5TIS C;  1Z91 A;  3ABM H;  4NNJ A;  3BG5 A;  1C0W A;  5IT9 K;  2FBH A;  2MC4 A;  4Y17 A;  1IXC A;  1ZG5 A;  3GTK J;  1MSF C;  1TQP A;  1ZG3 A;  2FBI A;  1X3U A;  3DTI A;  1APL C;  1AOY A;  3JRF A;  1TWF J;  3L2W A;  4HF2 A;  2X1C A;  1RPW A;  2M8E A;  3ZQG A;  1IV6 A;  3CDH A;  4CIC A;  2ELK A;  5DUI A;  3HDD A;  4RAF A;  2QSH X;  3K2Z A;  1Q1V A;  1HBX G;  2CV0 A;  2R7S A;  3QPS A;  1YTY A;  2FMY A;  2EWN A;  4M9S A;  2XAH A;  1P4W A;  1RIO H;  1T98 A;  1GLN A;  4NC7 A;  3RTR A;  2ME0 A;  1MMA A;  2Z1D A;  4PJJ A;  4ZYH A;  1U2W A;  1JT6 A;  3FKJ A;  2R5Y A;  2NVY J;  3ABU A;  2KIM A;  3FMQ A;  2FU4 A;  1U6G A;  3JTH A;  1XN7 A;  1MH4 A;  1QZE A;  2L01 A;  4HA8 A;  1RI7 A;  2JZY A;  3RPU A;  2LF8 A;  3FM5 A;  2EA4 A;  2FQ3 A;  3FXK A;  2XPW A;  2A69 F;  2R5Z A;  2VAS A;  3UKG A;  2FD5 A;  2XAG A;  5K7F A;  4H0E A;  3JRI A;  1W5C C;  3CCE I;  4A2U A;  2YUS A;  1OCO H;  3TBI A;  2HYF A;  2QCO A;  3OL4 A;  2HU9 A;  1FLI A;  1LDK B;  1DP3 A;  3BG9 A;  2E7W A;  2DYS H;  1ZR4 A;  1IRZ A;  1K6O A;  3VYU B;  2KPM A;  3BC8 A;  4JX6 A;  2R7R A;  1LFU P;  2KQR A;  3ZMV A;  3ZN0 A;  4AVP A;  4CCO A;  3K1M A;  3E6C C;  1I6X A;  3KX2 A;  2OV7 A;  4Z6Y A;  2LDU A;  3J80 K;  3JTG A;  3W6V A;  2ZC2 A;  3CZ6 A;  2NNY A;  1R23 A;  1XC5 A;  3HXL A;  1B72 B;  2LMD A;  3F8M A;  1OMI A;  1LKX A;  2ZB9 A;  1VQL I;  4PZJ A;  1QHH D;  4RGU A;  5C44 J;  1DDN A;  2GLO A;  4BS9 A;  4UUS B;  2ZXH A;  4MQ9 F;  3P9I A;  2BV6 A;  1K7A A;  1V5F A;  3JAM Z;  3I3L A;  5E8I A;  4KT6 A;  2CH0 A;  2IAI A;  2LBF B;  2Q0O A;  5FLM J;  2V1X A;  3AL0 B;  1XMX A;  4FTH A;  4FET A;  2HOT A;  1MGT A;  1FY7 A;  2I5U A;  3H9J A;  1MMS A;  2HXI A;  4A3F J;  1IUF A;  1K61 A;  1F4K A;  1WJF A;  1VQ5 I;  2PMH A;  2Z3Y A;  2K40 A;  4MEY F;  1PUE E;  4P5O A;  2DA3 A;  2OU2 A;  2P81 A;  3WTU C;  2BY2 A;  3E7L A;  5IP9 J; 
#chains in the Genus database with same CATH homology
 4PGH A;  4XBF A;  5IT9 Z;  2FRH A;  2XRN A;  1OKR A;  5K5R A;  2GXB A;  4KYW A;  2L4A A;  3LQR A;  2QUF A;  4FX4 A;  3D5L A;  3DQV C;  1YO5 C;  2Q8K A;  4L0Y B;  1P4A A;  4EMS A;  5CLS A;  3ZQ7 A;  2Y0M A;  4EJU A;  5EEH A;  3GFJ A;  2QBY A;  1WQ2 A;  1ZHF A;  4JQF A;  4HAM A;  2ZNY A;  1H0M A;  3DFG A;  4P9F A;  1TW3 A;  1SD6 A;  4L9N A;  4IVN A;  3I59 A;  1JE8 A;  4ESB A;  3FF5 A;  1MKM A;  1IRG A;  2QEN A;  1DPU A;  4LK1 F;  2Q2E A;  4IPA A;  1GXQ A;  1R36 A;  3E6B A;  4LB5 A;  2QQ9 A;  3QAH A;  5HOO A;  1FBU A;  4A5M A;  3J80 Z;  4AIH A;  4B8X A;  3MCZ A;  1SAX A;  2FNA A;  2MC3 A;  3CUQ C;  5CVV A;  4LLN A;  3R61 A;  2HTS A;  1JXS A;  2HDC A;  2KJB A;  1QO0 D;  2EV6 A;  4A12 A;  2X4H A;  1H9G A;  1YLF A;  4UNO A;  3HRU A;  4ZYE A;  1MZB A;  2PI0 A;  2RDP A;  3M7G A;  2V79 A;  4PGG A;  4ASN A;  4S05 A;  4KNY A;  3GO5 A;  3E5X A;  5H20 A;  4O5V A;  1FSE A;  3KEQ A;  1KU9 A;  3G73 A;  1BI3 A;  5FB2 A;  2GAU A;  3WG9 A;  4RAZ A;  4CO8 A;  1IF1 A;  2W24 A;  4I2O A;  1XB4 A;  2VOO A;  4KUM A;  1PDN C;  3TO6 A;  3MQ0 A;  5KK1 A;  3IL2 A;  1FZP B;  1V4R A;  1SMY F;  2RN7 A;  3HSE A;  3SHF A;  5LHH A;  1UHM A;  2OBP A;  2P8T A;  5H6R A;  1HKT A;  1NHA A;  2HGC A;  5HLH A;  4XSX F;  3O3K A;  4G6Q A;  3F8F A;  4KDP A;  1UST A;  2O03 A;  1PP8 F;  1OR7 A;  3R60 A;  4YFX F;  3R0A A;  2CFX A;  3WOD F;  3QRF F;  1O3T A;  5ILS A;  3F6O A;  2LKP A;  4M72 A;  1MJ9 A;  3IWZ A;  2M30 A;  1D8J A;  4U0V A;  4KIF A;  3GW2 A;  2DT5 A;  5K5O A;  4R1H A;  1LDJ A;  3ZMZ A;  1YW8 A;  1HQC A;  2A5Y B;  1OYW A;  3MEX A;  4F7Z A;  1RUO A;  4KN4 X;  4M6Y A;  1O3R A;  4IRI A;  5ICG A;  4E70 A;  2F5F A;  4A5N A;  1FX7 A;  2PBI A;  1CF7 A;  5F6F A;  3GUD A;  2L02 A;  3V7C A;  3EYI A;  3ZMU A;  1WKM A;  5DD8 A;  1D3Y A;  3VFZ A;  4HDV A;  2MD5 A;  1D8K A;  2EV5 A;  2WWY A;  2M87 A;  3LST A;  2VBZ A;  5DDG A;  3S2W A;  2XKO A;  1LNW A;  1SD7 A;  5FLX K;  2PN6 A;  2OD5 A;  1QZZ A;  3FXR A;  4RGS A;  1FYK A;  2Z9O A;  4N9I A;  4UVB A;  5HLI A;  5FFZ A;  3G3Z A;  5EEG A;  4D0P A;  3ROU A;  4I02 A;  2O3F A;  2QBY B;  1OYI A;  2P5V A;  1ZGA A;  2IA0 A;  5LEJ A;  5D8K B;  2V9V A;  3TOA A;  3I0T A;  3HTU A;  2ADU A;  5J8C A;  2CQK A;  3I59 B;  3K9T A;  3QP6 A;  4OOI A;  5BMZ A;  1A04 A;  1ZG1 A;  4U88 A;  5D5V B;  4EV0 A;  3HRS A;  2O8X A;  3GFL A;  3QPT A;  5FGM A;  2QWW A;  2F5E A;  5E8G A;  2XKP A;  1BI2 A;  4IHS A;  2DPU A;  5J8F A;  2ACJ A;  5DCF A;  4MTD A;  2ZO4 A;  3C7J A;  1GVJ A;  2HEO A;  5CJ9 A;  1IN8 A;  2IP2 A;  5A2Q K;  1KU7 A;  4Y13 A;  2NRA C;  3WTZ A;  4EVI A;  2VBX A;  4XLN F;  5KVR A;  4K2E A;  4HX4 A;  3WE2 A;  1W7P D;  5D4S A;  4PCQ A;  3LAJ A;  3FXQ A;  2BBY A;  2R3S A;  4A6D A;  1KGS A;  1MDM A;  5HS9 A;  3ERE D;  5FLX Z;  5FO5 A;  1ZLK A;  5ILV A;  4O6J A;  4RAY A;  3F8N A;  4HF0 A;  2XV4 S;  5AIP A;  4NB5 A;  3FMS A;  2O0Y A;  2YU3 A;  2RGV A;  1SFE A;  4FX0 A;  3RIR A;  1BN5 A;  3GX4 X;  2H6C A;  5FFX A;  4P9U A;  1QZY A;  1XD7 A;  1HST A;  5DYM A;  5TJJ A;  4G9Y A;  1R1U A;  2QLZ A;  1S3J A;  1LVA A;  1AWC A;  2BYV E;  4G7H F;  3KET A;  2W84 A;  5D4R A;  2WV0 A;  1BJA A;  1WI9 A;  1ULY A;  3HSF A;  3C3W A;  4HZF A;  2P4W A;  3I54 A;  2DTR A;  2JSC A;  3I5U A;  3R6S A;  3V4G A;  2RQP A;  4RB1 A;  1XMA A;  4BHB A;  1BI0 A;  5A2Q Z;  3WTT C;  5BS6 A;  1KQ8 A;  2GIV A;  1BC8 C;  4LMY A;  1P2F A;  2W25 A;  4DNC A;  5LRS A;  1T6S A;  2W57 A;  4UUV A;  4BXU A;  3T1B A;  3E3V A;  1MD0 A;  3N97 A;  4Y15 A;  1CF7 B;  1YW7 A;  2ESH A;  5E1X A;  4L0Z B;  1ODD A;  2DPD A;  1TNS A;  4HX7 A;  3U1D A;  2VON A;  3SZT A;  4HDU A;  1R22 A;  2P6T A;  3ZP5 A;  1J59 A;  5FD5 A;  4M6X A;  1LEB A;  4G94 A;  3TDU C;  3P7N A;  4S04 A;  4L18 B;  4YIF A;  3E5U A;  3WTV C;  3L00 A;  2UXN A;  2E1C A;  3F22 A;  2D2W A;  4OIQ F;  3T0Y A;  1ZGJ A;  4RGR A;  3WTY C;  2P5K A;  1WWX A;  4ETS A;  1T2K A;  4DQ2 A;  5CVI A;  3EQL F;  2J5P A;  4L5I A;  5BOX A;  4BHP A;  3KP6 A;  1LQ1 A;  2IRF G;  5TRD A;  2DBB A;  4NQW A;  3H92 A;  1QGP A;  3FWE A;  2VOP A;  2L54 A;  1G4D A;  4EJT A;  1YYV A;  5HVQ C;  2DU9 A;  5L3C A;  3GZ6 A;  2FF4 A;  2PJP A;  2ZFW A;  1JHH A;  3PQK A;  2HFH A;  2ISZ A;  2HWV A;  3U9G A;  2D45 A;  1K78 A;  4LD5 A;  2VC1 A;  2ISY A;  4AIK A;  1W5S A;  1QBJ A;  4MNU A;  4YG2 F;  3M1E A;  4BAY A;  2PMU A;  2VT2 A;  5CYV A;  1ZAO A;  2QVO A;  4BHC A;  1XGO A;  5ILU A;  1SD4 A;  4IJA A;  5ICF A;  1BIB A;  3WGH A;  2A07 F;  1ZLJ A;  2QQA A;  2DFI A;  5LHG A;  5LGN A;  1FPQ A;  3HOS A;  3BP8 A;  1G3S A;  2NAZ A;  1XCB A;  4WK8 F;  3LQQ A;  3JSO A;  5LHI A;  2HQR A;  2Y75 A;  1MDM B;  3KZY A;  3Q5F A;  4FHT A;  2PQ8 A;  4EJV A;  4WCG A;  1O3S A;  1ZN2 A;  1EH6 A;  3WGI A;  3R0J A;  1S7O A;  3GWZ A;  5D5W B;  3GYH X;  4ZH4 F;  2ZKZ A;  1LB2 A;  2G9W A;  2IW5 A;  2VT3 A;  2OAZ A;  4ZZD A;  1U3E M;  2CYY A;  3RYR A;  2JT1 A;  1S8N A;  1PP7 U;  2MA3 A;  4NHJ A;  3AAF A;  2LSO A;  4BNC A;  3V8K A;  4WF2 A;  4KFC A;  3I71 A;  2XAJ A;  3SFZ A;  4LG0 B;  2BE5 F;  4EQQ A;  3L9F A;  2ZNZ A;  1T38 A;  4G6D A;  5BPD A;  4Z2Y A;  4GYG A;  5LGU A;  3E6D A;  3GF2 A;  4LK0 F;  4OIP F;  1G6N A;  3KFW X;  3CTA A;  2DK8 A;  1DPR A;  4A6E A;  3MAJ A;  2PG4 A;  5CVJ A;  5BPI A;  3FZV A;  5K5Q A;  4MEX F;  2NS0 A;  3N4M A;  1GXP A;  1J5Y A;  4UVA A;  4UV8 A;  4LGW A;  4WXD A;  3D0S A;  3M8F A;  1TQM A;  1G3T A;  3CJN A;  2KRF A;  3VOD A;  3I4P A;  3T8T A;  2FE3 A;  3EDP A;  2PLY A;  3TKY A;  3TOB A;  2V1U A;  3P9K A;  3OV8 A;  1S29 A;  3U2R A;  3T8R A;  1REP C;  1G3Y A;  3BZ6 A;  4JBA A;  1O3Q A;  4U0W A;  2STT A;  3BWG A;  2DW4 A;  3KP3 A;  4YFN F;  1ON2 A;  5LEK A;  5L3G A;  4XLP F;  4HV5 A;  3TO7 A;  3RI4 A;  1E2X A;  4QLC U;  2IJL A;  2LNB A;  4EGZ A;  2Z33 A;  4U7B A;  2RV8 A;  1HW5 A;  2GWR A;  3HTS B;  2D1V A;  2DLL A;  3BOQ A;  5E1Z B;  4MQV A;  2F5C A;  3RDI A;  1OPC A;  4A0X A;  5D6F A;  5AIQ A;  3QP5 A;  4U7D A;  5LLQ A;  2EA2 A;  1SFX A;  4ON0 A;  5K1Y A;  3TDZ C;  4WX9 A;  2YSR A;  3W6J B;  1TLH B;  1I1S A;  3RKY A;  3IKT A;  1TNT A;  5HLG A;  2JRT A;  3FM3 A;  3MWM A;  3GFI A;  1Z1D A;  2FBK A;  1Z6T A;  5JVT A;  3IKV A;  1BIA A;  4HW0 A;  3H3Z A;  2DI3 A;  4L5J A;  1FP1 D;  1IW7 F;  4I7H A;  1ZAR A;  1UFM A;  3I58 A;  2M45 A;  1G3W A;  1P92 A;  4WXH A;  4HBL A;  3REO A;  1K78 B;  2K4B A;  1F9N A;  3DV8 A;  1R00 A;  1W7P A;  3GVA A;  4B09 A;  4OU0 A;  4OMY A;  2IT0 A;  4UXN A;  2H09 A;  1FWZ A;  2DO7 A;  5CVR A;  2K27 A;  4N9H A;  1ON1 A;  2ZME A;  3F8B A;  1T39 A;  5ED4 A;  2D1H A;  1P4X A;  3CUO A;  3LAP A;  4HQE A;  2K7L A;  3WTX C;  4A0Z A;  1R1V A;  1Z6R A;  3O6B B;  3T5X A;  5JI6 A;  1KU3 A;  4L9T A;  2RKH A;  5E1W A;  1DUX C;  1XSX A;  1BC7 C;  2K4J A;  3DPT A;  4IRG A;  2XAQ A;  3H3U A;  4YII A;  2O61 A;  2AS5 F;  3ZMS A;  4KIB A;  1ZYR F;  1Z05 A;  4HQM A;  1XDS A;  2K86 A;  4HF1 A;  2KIF A;  2EK5 A;  2HS5 A;  1HW1 A;  4L9J A;  1R58 A;  4BQA A;  2X0L A;  3KZZ A;  4BYY A;  4G7O F;  1USS A;  2A6H F;  4CGZ A;  5LRR A;  5L3F A;  4M71 A;  3GEZ A;  3VB2 A;  1KYZ A;  3PQJ A;  4MHG A;  1D5V A;  2F5D A;  2H94 A;  2RVC A;  3WU1 B;  2L4M A;  4XSZ F;  3K0L A;  3ZMD A;  1UCR A;  3E6M A;  3MZY A;  3C1D A;  3L7W A;  5J6X A;  5H6Q A;  1XSV A;  2IVM A;  2HTJ A;  1YG2 A;  1IN7 A;  2JPC A;  2CGP A;  3MZH A;  1S7A A;  3DP7 A;  4EM1 A;  2GA2 A;  4EGY A;  1FP2 A;  1STZ A;  1GHC A;  5HS8 A;  4HLY A;  3SQN A;  2YX7 A;  4LG0 A;  4RB3 C;  4U0Y A;  3ISP A;  2MH2 A;  3QU6 A;  3BDD A;  4YFK F;  3J81 K;  4WXC A;  3HHG A;  3HHH A;  2XVC A;  2DK5 A;  1BOA A;  1BBY A;  4I09 A;  2OZ6 A;  3RPQ A;  1XSD A;  1TQI A;  1FYL A;  1HXD A;  5FD6 A;  2GZW A;  3F21 A;  2DQL A;  2HZT A;  4UV9 A;  2VBW A;  2ELH A;  3V8J A;  1F5T A;  4IRH A;  3ABT A;  3HRM A;  3VEP A;  3CO7 C;  3V7R A;  1R7J A;  2M5W A;  3PFI A;  1U8R A;  3GXO A;  5E17 F;  2XIG A;  3F23 A;  2VOD A;  1YIO A;  4AIJ A;  3Q9S A;  4IF4 A;  2HKX A;  4GXO A;  2HQN A;  3BJO A;  4FT8 A;  3ECO A;  4Q48 A;  5DV5 A;  2EB7 A;  2ESN A;  2GQQ A;  3FMR A;  2MH9 A;  5AON A;  1V3F A;  3K69 A;  2EV0 A;  3DEU A;  4MGR A;  4M9Z A;  1ZRC A;  3KEO A;  2CG4 A;  5LBQ A;  4XRF A;  3C18 A;  1IXR C;  4M74 A;  1JHF A;  2O6G E;  3WU0 A;  3M9A A;  3NEU A;  2MLK A;  3JW4 A;  3KP7 A;  3GZ5 A;  1BM9 A;  3GLX A;  3KP5 A;  1IXS B;  3KP4 A;  4UHT A;  3BPX A;  1IAW A;  5DEQ A;  3K1N A;  1B1B A;  1Z7U A;  1B9N A;  2VXZ A;  1W5T A;  2UXX A;  3E97 A;  1W7P B;  2EFN A;  4G7Z F;  3QU3 A;  5BQT A;  3J81 Z;  2Z99 A;  5ICC A;  4ENJ A;  3DPL C;  3F72 A;  1K79 A;  1R5H A;  1EV7 A;  1J0R A;  2OZU A;  4M73 A;  1XGN A;  2ZME B;  4I98 B;  1SMT A;  2YPR A;  2OQR A;  1LEA A;  2FSW A;  4RB0 A;  1J7K A;  1L3L A;  1Z9C A;  5LGT A;  5CVU A;  4BH9 A;  1HW2 A;  1R5G A;  3I53 A;  3BPV A;  4KMU X;  2MLG A;  4ZYG A;  2LF7 A;  2DAO A;  4N0B A;  3DF8 A;  1WRJ A;  1QQI A;  1KA8 A;  2CW0 F;  1BI1 A;  4LLG F;  2H27 A;  3WTW C;  1XGS A;  1J2X A;  2BEO A;  1LDD A;  3FHZ A;  2CSO A;  1U5T C;  5D8L B;  1TW2 A;  2ZBK A;  3F6V A;  3J7A O;  4IHT A;  2K02 A;  4LB6 B;  1O57 A;  4TV7 A;  2UWM A;  3DXJ F;  3RJP A;  5HDK A;  2RC4 A;  4HYE A;  4ESJ A;  1KQ0 A;  4QWQ A;  4JK1 X;  3FX3 A;  3ECH A;  1CGP A;  3IC7 A;  1SFU A;  3KCC A;  1S6L A;  4OMZ A;  4EM0 B;  4Q4Z F;  1H9T A;  2FEZ A;  3BRO A;  1R1T A;  1KU2 A;  3V8L A;  3ZMT A;  2EFW A;  3TQN A;  3LA3 A;  3P9C A;  3B02 A;  3R4K A;  3WTS C;  3L09 A;  4OIN F;  5JR3 A;  1XCV A;  1FSH A;  1KYW A;  2PEX A;  2V6C A;  4G8X A;  3WE3 A;  2JPB A;  1WSU A;  4ZZL A;  3IRQ A;  4HLX A;  2XGX A;  1HKS A;  2H6B A;  4EJW A;  1FBS A;  5L3D A;  2HOE A;  1IN5 A;  1U5T A;  3TGN A;  2P7V B;  2EJR A;  1JGS A;  1UHW A;  3GFM A;  4R8H A;  3M8E A;  3HSR A;  4ENK A;  5DD4 A;  2A6E F;  4RGX A;  1YW9 A;  2STW A;  2R7D A;  5D6E A;  1FBQ A;  4LLL A;  2FOK A;  2NYX A;  1DP7 P;  2MBF A;  2XRO A;  4P96 A;  3KLO A;  4KIC A;  1FT9 A;  1B59 A;  1J9I A;  1ZRD A;  4Q47 A;  1QPM A;  4OIO F;  1RNL A;  4IXA A;  2GA1 A;  1YS6 A;  3OOP A;  2XUB A;  4KN7 X;  5DCM A;  3RKW A;  1L0O C;  2E1N A;  2VN2 A;  2VE9 A;  4LJZ F;  1ONV A;  3K1P A;  4CYD A;  4GO1 A;  3B73 A;  2QYO A;  2C6Y A;  3I64 A;  2OA4 A;  4KIG A;  1IZ1 A;  1ZH5 A;  2PFB A;  2KJC A;  3IRR A;  4KMF A;  4I0B A;  1HSJ A;  3CUQ A;  1VTN C;  2FXA A;  4GYI A;  5F64 A;  4UVC A;  4EM2 A;  4CXF A;  4CHU A;  1YFH A;  3SZP A;  2ETH A;  3NQO A;  5F1R A;  1ZRF A;  4EJO A;  3ML6 A;  2B0L A;  3RKX A;  2A61 A;  2WTE A;  2FA5 A;  2IPQ X;  1XDU A;  3ZN1 A;  1T0F A;  5IT3 A;  5JFR A;  2RNJ A;  3QOP A;  4HX8 A;  1B6A A;  5E20 A;  5D5U B;  4KA4 A;  3CLO A;  3VOE A;  2KIU A;  3IWF A;  1U78 A;  2A3S A;  1Q1H A;  2J5O A;  2P7C B;  2KKO A;  2F2E A;  2G7U A;  3ULQ B;  1TBX A;  3HOT A;  4R79 A;  4WWC A;  1FOK A;  2VE8 A;  2IA1 A;  3COA C;  2QQB A;  3BJA A;  5L3E A;  2NNN A;  2A68 F;  3NRV A;  4PDK A;  1Y0U A;  1KQ9 A;  3F8C A;  1I5Z A;  3HRT A;  3TO9 A;  3BJ6 A;  2CO5 A;  2V1D A;  3MFK A;  3O2P E;  1MJB A;  4M9X A;  5E18 F;  2EFO A;  3LA7 A;  1OYY A;  5HDN A;  3SXY A;  2W85 A;  3RYP A;  1P6R A;  3JSP A;  4AWX B;  2VC0 A;  5DUK A;  5ERI A;  1W4M A;  4CZZ A;  4GGG A;  4I0A A;  4CDG A;  3HYI A;  1XMK A;  2QM3 A;  2AXL A;  2HR3 A;  1O7L A;  3CO6 C;  1UB9 A;  4L9V A;  3KE2 A;  5HDG A;  4ENN A;  1YQA A;  1FYM A;  1J75 A;  2Z5U A;  1E17 A;  4LFU A;  2HKO A;  4HV6 A;  1RUN A;  4ENM A;  2Y48 A;  1HKQ A;  4HOB A;  3Q9V A;  4RS8 A;  5D5X B;  1FNN A;  2L3D A;  1U5T B;  1ZRE A;  2COM A;  2EFP A;  3V7S A;  4AD9 A;  1F1Z A;  3LWF A;  6PAX A;  4GCV A;  2YR2 A;  4OIR F;  3DKW A;  3HIF A;  2XAF A;  4A0Y A;  1MJA A;  2JTV A;  2YX4 A;  1B4A A;  2ZCW A;  3BY6 A;  5L3B A;  1TTY A;  4ESF A;  2VBY A;  3LFK A;  3FXU A;  2P5L C;  2TDX A;  5ICE A;  1B9M A;  2DQR A;  2R7F A;  2GXG A;  2OQG A;  3E5Q A;  1QNT A;  2CWE A;  3ZPL A;  3KP2 A;  4I01 A;  1IRF A;  4KT5 C;  1IN4 A;  2EFQ A;  2P6S A;  5DCM B;  3L2C A;  2IA2 A;  4O3M A;  1FC3 A;  2XAS A;  1LJ9 A;  1I1G A;  1IN6 A;  5HS7 A;  1SD5 A;  3LA2 A;  1IUY A;  1O7F A;  3KLN A;  1EH7 A;  2G7H A;  2ZJ2 A;  4ZYD A;  2QZ8 A;  1XGM A;  3EYY A;  4P55 A;  1I27 A;  2FNP A;  3QPH A;  3HUG A;  3W6K B;  1YS7 A;  2WC2 A;  2FML A;  1RZ4 A;  3IHU A;  3EET A;  2HYG D;  2BGC A;  3CUQ B;  2M1B A;  3JAM K;  4MTE A;  4RB2 C;  2UZK A;  2XHK A;  3F3X A;  2E7X A;  2ZXJ A;  4Q5S F;  3ELK A;  3EUH A;  1EH8 A;  3WGG A;  1Z91 A;  1C0W A;  5IT9 K;  2FBH A;  4Y17 A;  1IXC A;  1ZG5 A;  1TQP A;  1ZG3 A;  2FBI A;  1X3U A;  1AOY A;  4HF2 A;  2M8E A;  3CDH A;  4CIC A;  5DUI A;  3K2Z A;  1HBX G;  1YTY A;  2FMY A;  2EWN A;  4M9S A;  2XAH A;  1P4W A;  1RIO H;  1T98 A;  3RTR A;  4ZYH A;  1U2W A;  3ABU A;  2KIM A;  3FMQ A;  2FU4 A;  1U6G A;  3JTH A;  1XN7 A;  2L01 A;  4HA8 A;  1RI7 A;  2JZY A;  3RPU A;  2LF8 A;  3FM5 A;  2EA4 A;  2FQ3 A;  2A69 F;  2XAG A;  4H0E A;  4A2U A;  2HYF A;  1FLI A;  1LDK B;  2E7W A;  1K6O A;  3ZMV A;  3ZN0 A;  4AVP A;  3K1M A;  3E6C C;  1I6X A;  2LDU A;  3J80 K;  3JTG A;  2NNY A;  1R23 A;  3F8M A;  1OMI A;  4PZJ A;  4RGU A;  1DDN A;  4MQ9 F;  3P9I A;  2BV6 A;  1K7A A;  3JAM Z;  5E8I A;  2Q0O A;  2V1X A;  1MGT A;  1FY7 A;  1F4K A;  2PMH A;  2Z3Y A;  4MEY F;  1PUE E;  4P5O A;  2OU2 A;  5JHU A;  3WTU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...