4M6XA

Mutant structure of methyltransferase from streptomyces hygroscopicus complexed with s-adenosyl-l-homocysteine and methylphenylpyruvic acid
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
339
structure length
339
Chain Sequence
SHMSTEVSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHEFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
total genus 123
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4m6xA01
1AOYA 3R0JA 4PZJA 3FWEA 1XCBA 1IZ1A 3KP3A 3GZ6A 5EEHA 2F5EA 3F8BA 2M30A 2L4AA 1SD5A 3O2PE 4L9TA 2HTSA 2MLKA 3WTVC 4ESBA 5F6FA 1E2XA 3CO7C 4XBFA 2UZKA 1W5TA 4MHGA 1QO0D 4XSXF 4L9VA 3H3UA 5LEJA 2CO5A 3LFKA 2NYXA 4OMZA 4HX8A 5ERIA 5E8GA 3FMQA 5DD4A 3LA7A 5H20A 2JPBA 3BZ6A 2F5DA 3HUGA 2PFBA 3IRQA 4WXHA 3E3VA 2Z3YA 4BHBA 4A0ZA 2STWA 5ICEA 1DP7P 5IT3A 1OKRA 3TQNA 2GA1A 2HR3A 2HOEA 3BP8A 2FNAA 2LKPA 1J75A 1KQ8A 4WXDA 3TOBA 1HSJA 4K2EA 3C18A 1OPCA 3FXUA 3WTUC 4EJWA 1ZN2A 1TQPA 3W6KB 5FLXZ 4IF4A 2A68F 3V8JA 4RB3C 4BXUA 3GO5A 3SZPA 3HRUA 4A6DA 1GVJA 2Y75A 1RUNA 3HIFA 2VBWA 1YW7A 2HFHA 2MA3A 2X4HA 4I2OA 3ZMSA 2FBHA 5DCMA 1KU2A 1IN5A 5ILSA 1E17A 2QQ9A 3FF5A 5ILVA 2GIVA 2CYYA 5TJJA 2YSRA 4UV9A 4I7HA 1T38A 2G9WA 4MQ9F 3I59B 4M6XA 4S04A 2VC0A 1HW1A 4M74A 4E70A 1ULYA 2C6YA 2W57A 2HKOA 3P9CA 3ZMVA 1SD7A 1TQMA 2CQKA 1O3RA 5LHIA 3DP7A 1RI7A 2L54A 1R00A 5AIQA 4Q4ZF 2KRFA 3FXQA 1ONVA 4XSZF 2L4MA 5D5UB 1ZGJA 1S6LA 3R6SA 4MTEA 4RB2C 1S7AA 4MTDA 1B4AA 1R22A 2ETHA 1U78A 2P6TA 3K69A 3DFGA 5A2QZ 3BWGA 2D1VA 1RNLA 2QQBA 2ZFWA 4CGZA 5FB2A 2EV5A 3R60A 2H09A 4IPAA 3V8LA 4EV0A 4CICA 3F8NA 1KYZA 2O0YA 3KLOA 3VB2A 2M87A 3TGNA 3ZQ7A 1Y0UA 3WU0A 1B59A 1O3SA 1IN4A 3FMRA 5HLGA 5BMZA 3QOPA 3E6DA 2ISZA 3T1BA 2PI0A 3FM3A 1V3FA 4O3MA 3EUHA 1WSUA 4A0YA 4MGRA 5K5QA 2W85A 1EH8A 2XAQA 4EGZA 3EETA 3JAMK 4U88A 1ZLJA 3F21A 2IT0A 4A5NA 5K5OA 4UXNA 5FFXA 3KE2A 3ABTA 3DPTA 4O6JA 3HRMA 1ZLKA 4I0AA 3DQVC 3V8KA 1W7PB 3JTGA 1Z1DA 3GFMA 4KMFA 2MBFA 4L0ZB 3LAJA 3ZN0A 1G3SA 3J80Z 4HV5A 4KNYA 1O7LA 4R1HA 4L5JA 3I59A 1B1BA 1C0WA 3CUOA 2YR2A 1Z91A 4LG0B 2UWMA 5ICGA 1J2XA 4KYWA 3QPHA 2MD5A 4IVNA 4I0BA 5K5RA 3I64A 2J5PA 3DF8A 1QGPA 3TDUC 2VXZA 3F72A 3QP5A 4IXAA 4JK1X 4HA8A 1HSTA 2A5YB 4QWQA 3H3ZA 2RVCA 4CDGA 1O3TA 1QPMA 3BPXA 1FBUA 1FC3A 4A5MA 5KVRA 2P5VA 2VODA 3WTZA 1H0MA 1IRFA 3F6OA 2XHKA 4AIHA 3TOAA 2AXLA 1P4AA 5HDKA 2PBIA 1KU9A 2GXGA 3KETA 1DPRA 2FQ3A 3RPUA 4MQVA 5HLIA 5D5VB 5D5WB 2FF4A 1IN6A 2PQ8A 3JW4A 4HOBA 3WE2A 1ZRCA 1XN7A 2H6CA 3WG9A 3WGIA 4NQWA 4GYGA 1REPC 5E1ZB 1F4KA 1FP1D 5H6QA 1S3JA 4FT8A 1D8JA 3BJAA 3C3WA 4ZYGA 3I58A 5BOXA 3T8TA 2V9VA 4PGHA 3JTHA 4R79A 3V4GA 4N9IA 1W5SA 2DFIA 1T6SA 2EFPA 2FMYA 1OYWA 1W7PD 4G6QA 4ZH4F 1IAWA 3MQ0A 2L02A 3J7AO 3SHFA 2R3SA 4LD5A 3WTTC 5AONA 1G6NA 1P2FA 5L3GA 1TW3A 1XGNA 1BI0A 2Q0OA 4FHTA 1OMIA 1USTA 2KJBA 4L9NA 1UHMA 2CG4A 3F8MA 2ESNA 5D5XB 1YYVA 3CDHA 3PQKA 2K27A 2BEOA 2XKOA 4KICA 2VC1A 3RPQA 2ZMEA 4KMUX 1ZH5A 3H92A 2DK5A 3G3ZA 5E20A 1R7JA 4UV8A 3SXYA 3T0YA 4XRFA 1UFMA 1FWZA 2M45A 5H6RA 5KK1A 4EJVA 1JHHA 2ZCWA 5DCMB 2M5WA 3GYHX 1A04A 2EA4A 3MCZA 1DDNA 3K9TA 2Q2EA 1G3YA 2KIMA 3F3XA 2HS5A 3FXRA 4Z2YA 3E5UA 1BIAA 5FLXK 6PAXA 1ZYRF 1IW7F 3M9AA 1R58A 3J81Z 1SMTA 4UVAA 5J8FA 1BJAA 4GCVA 1TNTA 5JHUA 2LDUA 4MNUA 4I09A 1Z05A 5LHGA 2CFXA 3KP7A 3WGGA 1FSHA 2CWEA 3QAHA 2OQGA 1IN8A 4IHSA 4M9ZA 3RKXA 2WWYA 3HSFA 3T8RA 2DQLA 1MZBA 2ISYA 1FLIA 4KUMA 1J7KA 5LRSA 5D8KB 2V6CA 4B8XA 3ISPA 3HHHA 2XKPA 2XVCA 5L3CA 4GGGA 3B02A 1LDDA 5HDNA 3ZMDA 5F64A 1DUXC 1I6XA 4WK8F 1LEAA 2IRFG 4M72A 4L0YB 3I0TA 2IW5A 1YLFA 5E8IA 1U5TC 3KEOA 2DLLA 5A2QK 1MJBA 2HZTA 4Y17A 1WQ2A 1F9NA 4P5OA 3I5UA 2QLZA 3KZZA 2M8EA 1LJ9A 3KCCA 4CYDA 5TRDA 2F5FA 2EFQA 1IF1A 3WGHA 4WX9A 2RQPA 3DEUA 1XGSA 3HHGA 4ZYHA 2A61A 3ZPLA 4KT5C 5JR3A 3ML6A 3MEXA 4IHTA 2XV4S 2JZYA 3BROA 1D5VA 3M1EA 3REOA 1FYMA 1FSEA 1TBXA 1XDUA 4MEXF 1ZREA 3G73A 1O7FA 1HW5A 4D0PA 3ZMZA 4WXCA 2OQRA 2L01A 5HS9A 3GLXA 4OU0A 1PUEE 4ZYDA 5DD8A 4EJUA 2K4JA 1SFUA 4IRIA 4CXFA 2QVOA 4KIGA 4R8HA 2WC2A 1OYIA 3GEZA 2A07F 1BIBA 1ZAOA 3CUQC 2Y0MA 2NNYA 3J80K 1F5TA 1FYLA 5JFRA 1RIOH 1B9MA 1B9NA 1USSA 1S29A 3CUQB 1HQCA 2Z5UA 5ED4A 5DCFA 2HTJA 2O8XA 1WRJA 2RV8A 3KEQA 1YS7A 3TO6A 1RUOA 4EM0B 5CJ9A 5D8LB 3QP6A 3KP5A 1I27A 3JSOA 5ICFA 1G3TA 3GW2A 4CZZA 4H0EA 4RGXA 4A2UA 2WTEA 4JBAA 1P6RA 2OA4A 4LMYA 2LF8A 4G7OF 5JVTA 5E18F 3HOTA 2QBYA 1YS6A 2DTRA 1GXQA 4P55A 4OIRF 4P96A 2XAJA 1KQ0A 4BHPA 4G9YA 2ZO4A 3KP4A 3GFIA 2FNPA 1XD7A 3ZMUA 1U5TA 4PDKA 5LHHA 2FMLA 3WTSC 4LLGF 4OIQF 4BH9A 2A69F 1WWXA 1SD6A 1SD4A 2F5CA 2MH9A 4BYYA 5LLQA 5L3DA 4UHTA 1DPUA 1TQIA 1XGOA 5CVVA 2FRHA 2DBBA 2M1BA 1Z9CA 4NB5A 1FZPB 1XGMA 2P6SA 3SQNA 3GX4X 4HZFA 1Q1HA 1LEBA 4HF2A 4G8XA 4CHUA 2GWRA 3RYPA 1ZARA 4L9JA 2XUBA 5BQTA 4GO1A 3TO7A 3NEUA 1LB2A 1V4RA 2FBIA 3V7CA 2TDXA 4LFUA 4LB6B 2PJPA 4KIBA 2XIGA 2ZNZA 5IT9K 2BGCA 2ZMEB 2A6EF 5FO5A 1KU7A 2ADUA 4XLNF 2GXBA 2DU9A 4YFNF 4HX7A 3OV8A 2XAHA 4I98B 2FA5A 3TO9A 3ZMTA 2P5LC 4EM1A 2JSCA 4KDPA 3CTAA 2CSOA 2NRAC 2QENA 2PG4A 2IP2A 4ASNA 4HDUA 3Q5FA 3CUQA 1XSXA 2J5OA 2DPDA 1J0RA 1BOAA 3AAFA 1T2KA 1CF7A 2JRTA 1EH6A 4AWXB 2ZXJA 2HYGD 4JQFA 3HOSA 2A3SA 4LK0F 3P9IA 1KYWA 1T39A 1QBJA 2PEXA 3BJ6A 5D6EA 1I5ZA 3KP6A 4OOIA 2HQNA 3LA2A 5LGNA 1SFEA 4BAYA 3JAMZ 5HDGA 5CVUA 2K02A 4RB0A 2P7VB 4QLCU 3LWFA 4KN4X 2OZUA 1IXCA 1XMKA 4RGUA 1LDJA 5FD5A 3LAPA 2PMHA 4U0WA 1GXPA 4N0BA 2P4WA 2DPUA 1JE8A 2XAFA 2X0LA 2RN7A 1D3YA 1IXRC 5J8CA 1FNNA 1R5HA 2HWVA 3L00A 4M9XA 3FM5A 2OZ6A 4A12A 3SZTA 3F8FA 3HYIA 2KJCA 1LVAA 5FGMA 1MJAA 5CVJA 1YIOA 3E6MA 5LBQA 3R61A 1R5GA 2Y48A 1HW2A 3M8EA 1YW8A 2HYFA 3I4PA 3PFIA 4BNCA 4Q47A 3KLNA 1HKSA 4Q48A 3IKVA 1B6AA 1H9TA 2G7UA 2Z9OA 4O5VA 2W24A 1PDNC 1MJ9A 1P4WA 4KN7X 5E1XA 2O61A 1ZGAA 1TW2A 2RNJA 4OIOF 4S05A 2E1NA 1FYKA 1I1SA 2ESHA 5DV5A 1YTYA 2H94A 2VN2A 1K7AA 2ACJA 1WKMA 5LEKA 2FE3A 2B0LA 2A6HF 4G7ZF 1BI1A 4U7BA 3LQQA 1HKTA 4LLLA 2BV6A 1ON2A 3K1PA 3S2WA 2DK8A 1IUYA 4A0XA 5FD6A 2CW0F 4OMYA 2P8TA 4UVCA 3BDDA 1FBQA 3HSEA 1O3QA 4EVIA 1S7OA 1WI9A 3L9FA 2ZBKA 3KZYA 4KIFA 1KA8A 4M71A 3CJNA 4EM2A 2VBXA 1UCRA 1OYYA 4HAMA 3FHZA 2O6GE 3U1DA 1TLHB 5DYMA 1UHWA 1YG2A 3IRRA 4EJOA 1XB4A 1U3EM 2EK5A 4Q5SF 1Z7UA 3HTUA 1LNWA 2P5KA 1FT9A 2R7FA 3GXOA 2QBYB 3E97A 4ESFA 3DXJF 3C7JA 1D8KA 3VODA 3CO6C 3C1DA 1STZA 4KFCA 1U5TB 3N4MA 1IRGA 5FFZA 3BJOA 1J5YA 1BC7C 1I1GA 2BE5F 3IWFA 5CLSA 1X3UA 3K1NA 3F22A 2MLGA 2VT3A 4YFXF 3T5XA 2KIUA 5J6XA 1MDMA 3WTXC 1K78A 2VOOA 5L3BA 1XCVA 3I54A 2PLYA 1HBXG 3IKTA 3B73A 2EV6A 1IN7A 4TV7A 2ELHA 4YG2F 1L3LA 3NQOA 3RJPA 3VOEA 3ULQB 4ETSA 3WODF 2IA1A 5CYVA 2VOPA 1ODDA 4EQQA 3E6BA 1U2WA 3ECHA 3L7WA 3MZYA 4OIPF 2VBZA 2XGXA 2E1CA 1TTYA 4P9UA 2DT5A 2COMA 4M73A 2DAOA 3I71A 3RIRA 2BYVE 1H9GA 3MAJA 2XAGA 3N97A 5HOOA 3BPVA 2EFWA 2FOKA 2W84A 4IRGA 5CVIA 5CVRA 1BI2A 1YW9A 2EWNA 2R7DA 4N9HA 1BI3A 4HDVA 2JTVA 3DV8A 2JPCA 3DPLC 1YQAA 1QNTA 3TDZC 4EGYA 5DUKA 2Z99A 3K2ZA 3Q9VA 5AIPA 3DKWA 1IXSB 1EH7A 3HSRA 3JSPA 3ABUA 1ZG1A 2UXXA 4GYIA 1CF7B 1YO5C 1ZRFA 3IWZA 4ZYEA 3GF2A 2RGVA 2FSWA 4L18B 1F1ZA 1G4DA 3M7GA 3E6CC 2EFOA 1P4XA 4LJZF 3WTWC 4G6DA 5HVQC 4RB1A 3O3KA 2YU3A 4ENJA 1K6OA 3GFJA 2FEZA 4AIJA 5HS7A 1J59A 1ZRDA 1JHFA 1RZ4A 1KU3A 3FMSA 2NNNA 3MFKA 1K79A 4U7DA 1FY7A 2QYOA 4WCGA 4F7ZA 4ZZDA 2IA2A 2QWWA 3LQRA 2HDCA 2VONA 1JXSA 4ON0A 2ZJ2A 1G3WA 2KIFA 1MD0A 1JGSA 4P9FA 1VTNC 3I53A 4AVPA 3VFZA 2CGPA 3EYIA 2FXAA 4AD9A 2QZ8A 3ROUA 4ZZLA 5L3FA 2V1UA 4RS8A 2E7WA 1FX7A 1QZYA 2MH2A 3IHUA 4CO8A 4WF2A 3RTRA 2NS0A 3QRFF 2YX4A 3GUDA 1CGPA 2GA2A 1UB9A 3EQLF 1KQ9A 1QQIA 1XSVA 4HW0A 5ICCA 1HXDA 3FX3A 3ZP5A 1XSDA 2HEOA 2MC3A 3QU3A 5LGUA 1AWCA 3QU6A 2DQRA 5K1YA 3VEPA 2OD5A 5L3EA 2E7XA 4HQEA 3HTSB 2OAZA 3WTYC 2D45A 1XDSA 2RDPA 1SAXA 2DW4A 4ENNA 2K7LA 3RYRA 2EJRA 4RAZA 4EMSA 1MGTA 2DO7A 2RC4A 2H6BA 4IJAA 2GAUA 3GVAA 2RKHA 3L09A 1W4MA 2KKOA 2Q8KA 3ZN1A 3ECOA 3MZHA 4WWCA 2EA2A 1Z6TA 3M8FA 2GQQA 1O57A 1XMAA 2DI3A 3IC7A 4M6YA 5DEQA 1Z6RA 1BN5A 2IA0A 3CLOA 1R23A 3K1MA 1ZG5A 2IPQX 4LK1F 2YX7A 3V7SA 5D4RA 4YIIA 2QUFA 3E5XA 2EV0A 4Y13A 2D2WA 4HQMA 2AS5F 3GZ5A 5D4SA 3IL2A 4HBLA 1TNSA 4RGSA 4HX4A 3L2CA 2HQRA 1PP7U 3F6VA 2LF7A 3E5QA 4BQAA 2K4BA 2F2EA 2PMUA 5F1RA 4EJTA 4UUVA 3LA3A 4G94A 1QZZA 1R1TA 2Z33A 2ZNYA 3J81K 2V1DA 3D0SA 2LSOA 1R1UA 4FX4A 4GXOA 4PGGA 3ELKA 2XRNA 4LGWA 3FZVA 1YFHA 4HLXA 2HGCA 3COAC 1OR7A 4L5IA 1FOKA 1KGSA 3R4KA 1GHCA 2OU2A 1FPQA 1R36A 3PQJA 2FBKA 5D6FA 2VE9A 3BY6A 3P7NA 4RGRA 1T0FA 4A6EA 2OBPA 3K0LA 1FP2A 1BM9A 2EB7A 4BHCA 2PN6A 3RI4A 3U9GA 1PP8F 2L3DA 2VBYA 1LQ1A 4YIFA 4IRHA 4Y15A 1HKQA 1ZG3A 3Q9SA 2HKXA 5IT9Z 2GZWA 3MWMA 2IVMA 1P92A 2NAZA 4YFKF 4UVBA 3RKYA 3KFWX 3F8CA 2W25A 3WE3A 2K86A 1LDKB 1SMYF 4ESJA 5BPIA 1W7PA 2D1HA 3EDPA 4I01A 2V79A 1MDMB 2G7HA 3LSTA 4U0VA 1K78B 1NHAA 5DDGA 3EYYA 3NRVA 5LGTA 4HV6A 1ON1A 5JI6A 5ILUA 1ZHFA 2FU4A 4UNOA 1EV7A 2BBYA 2XROA 2EFNA 3TKYA 2O03A 3GWZA 2QM3A 1FBSA 3O6BB 4LB5A 3OOPA 3QPTA 5BS6A 4DQ2A 3KP2A 4OINF 4G7HF 4RAYA 3ERED 2VE8A 3W6JB 2YPRA 2QQAA 5DUIA 4LG0A 2LNBA 5EEGA 2P7CB 3F23A 2ZKZA 2IJLA 4U0YA 1MKMA 3P9KA 3D5LA 1L0OC 3V7RA 3HRSA 3U2RA 4B09A 1J9IA 2WV0A 3WU1B 4ENKA 4HYEA 4XLPF 2H27A 2O3FA 4NHJA 5E1WA 5E17F 4M9SA 2V1XA 1U6GA 4LLNA 1BC8C 1SFXA 4PCQA 3BOQA 3SFZA 4HF1A 2VT2A 1U8RA 5HS8A 4I02A 4HLYA 1BBYA 3HRTA 4ENMA 3RKWA 5LRRA 5HLHA 5BPDA 3RDIA 1T98A 4AIKA 2UXNA 4FX0A 1S8NA 2JT1A 4DNCA 4KA4A 3R0AA 1R1VA 2XASA 4HF0A 2STTA 3GFLA 4MEYF
chains in the Genus database with same CATH superfamily
2MYSA 1AOYA 2HQ5A 2WBMA 1VQMI 4HEA2 3R0JA 4PZJA 2BHZA 1XCBA 3FWEA 1IZ1A 3KP3A 4CA0A 1N25A 2E35A 4IEJA 4XLAA 3GZ6A 1ORKA 2M3AA 3HJEA 2HXOA 4A3JJ 3PFYA 5EEHA 2F5EA 3F8BA 2M30A 4XLFA 4FCYA 2L4AA 4CCLA 1SD5A 3O2PE 3Q0UA 4L9TA 2IEKA 1LPQA 2CW8A 2HTSA 2MLKA 3WTVC 3Q3SA 4ESBA 5F6FA 1S5LC 4AYBN 3W6VA 4HNVA 1E2XA 3CO7C 4XBFA 2UZKA 1W5TA 1QVTA 4MHGA 3WHCA 1QO0D 2KIQA 3EUHC 4XSXF 2CUZA 2V9KA 4L9VA 3H3UA 5LEJA 4CYCB 2CO5A 4NC7A 3LFKA 4PFPA 3AG2H 4AYBA 4FE4A 2HOSA 4ZYAA 2NYXA 4XQFA 4OMZA 1APLC 5IP6A 3OIQA 4HX8A 5ERIA 4HPQA 5E8GA 1XPXA 3BR5A 2NS7A 1I3QJ 3FMQA 2IGNA 1HA8A 5DD4A 3LA7A 5H20A 5FRNA 2OJED 3GMEA 1W5CC 2JPBA 3BZ6A 2F5DA 3ABKH 3HUGA 2PFBA 3SDGA 2F48A 3IRQA 2X1EA 3E3VA 4WXHA 4ANJA 2L2OA 2Z3YA 4BHBA 4A0ZA 2IS2A 2STWA 2JWTA 4DGWB 5ICEA 1DP7P 5IT3A 3FK6A 4C2TA 5GP9A 2O5RA 1OKRA 3TQNA 2GA1A 2HR3A 3LNQA 3SZGA 2HOEA 4J19A 3PSIA 4M3FA 1R71A 3BP8A 3PJRA 4M6VA 4YELA 2FNAA 2LKPA 4MO7A 1J75A 1KQ8A 3M3YJ 1D1BA 3OIOA 4WXDA 3TOBA 4B4CA 1HSJA 1YJWI 1Z7LA 2BY3A 4K2EA 3C18A 2E19A 1OPCA 3BG9A 1R4MB 3FXUA 3WTUC 2VB6A 4EJWA 2F5VA 1ZN2A 3CJQB 1TQPA 3K4KA 3W6KB 3O8GA 1JI8A 1HOMA 5FLXZ 4MFEA 3H9GA 4IF4A 2R7XA 2A68F 3V8JA 4RB3C 4RLFA 3GO5A 2BXZA 4BXUA 4IQ4A 3SZPA 2JSPA 3HRUA 4A6DA 1GVJA 2Y75A 3HM5A 1RUNA 3HIFA 2VBWA 1YW7A 3VWBA 2HFHA 1Z3YA 2MA3A 2E1MB 2X4HA 3CMAI 2R7TA 4I2OA 3ZMSA 4MLOA 2B9SA 2M34A 2PMZN 2FBHA 5DCMA 1KU2A 2L7MP 3QODA 1IN5A 3TMOA 5ILSA 1E17A 2QQ9A 3FF5A 5ILVA 1T8IA 1OLTA 1WH7A 4IX7A 3K7AJ 2GIVA 2DDBA 2CW7A 2CYYA 1X1BA 5TJJA 2YSRA 1RKWA 4UV9A 4I7HA 3ONQA 1T38A 2G9WA 4XKWA 3N05A 2R7OA 3DTIA 4MQ9F 2PMZA 3I59B 4M6XA 3DTKA 4S04A 2QCOA 2VC0A 3LOCA 1HW1A 4M74A 1S9HA 4E70A 1ULYA 3MKWB 2C6YA 2W57A 2XGCA 2HKOA 1YITI 3P9CA 3ZMVA 1E3PA 1SD7A 1TQMA 2CQKA 2I10A 5LHIA 1O3RA 1BJZA 4EATA 2X6WA 3DP7A 2V9PA 3M1CA 4CCNA 5KNLA 3OYNA 2VKVA 1RI7A 2L54A 3FKJA 1EA3A 1R00A 5AIQA 4Q4ZF 1Z0XA 2KRFA 3JRBA 3H0GJ 3TL4X 2VJ4A 4KITB 3FXQA 3O8HA 1ONVA 4XSZF 2AHQA 4XK4A 2ZJRF 2L4MA 5GTIC 5D5UB 3IP4B 1ZGJA 4BEHA 1S6LA 2KLOA 1VNDA 3OR1C 3R6SA 4MTEA 4GRIA 2CFOA 3CZ6A 2ZJPF 4RB2C 1S7AA 2K3FA 4MTDA 5M5YJ 1B4AA 1R22A 5M3MJ 2JVGA 2ETHA 1U78A 1MMGA 2P6TA 3D5RC 1ZQ3P 1LFBA 3K69A 3OSFA 3TEDA 1FIAA 2MW8A 3DFGA 5A2QZ 2XRLA 3BWGA 3OYCA 5DM6F 2D1VA 2VXDA 2ZSIB 4C3JJ 1RNLA 2QQBA 3BCAA 2ZFWA 4CGZA 5FB2A 2EV5A 3LSMA 3R60A 4C3IJ 2H09A 4IPAA 1FTZA 1W36D 4XLHA 3V8LA 1RC9A 4M3EA 4EV0A 4CICA 1BW5A 4U87A 3F8NA 1KYZA 2FD5A 2O0YA 3KLOA 3VB2A 2M87A 3TGNA 3MZ8A 1Y0UA 3ZQ7A 2DN0A 2K9LA 1O4XA 1X3ZB 3K6GA 5EDNA 3WU0A 1MMSA 1B59A 1FEXA 1O3SA 1IN4A 3FMRA 3LMMA 5HLGA 5BMZA 1IRXA 3CCJI 3QOPA 3E6DA 2ECBA 2ISZA 3T1BA 4IOCF 4XN3A 2PI0A 3FM3A 2PX9A 4IZZA 1V3FA 2Y2ZA 4O3MA 2Y31A 2LBFA 3OYDA 3EUHA 1WSUA 2DOFA 4A0YA 4MGRA 4IOAF 5K5QA 3OYMA 1ETKA 2DT6A 2W85A 3ZR8X 1EH8A 3GBGA 2R5ZA 2XAQA 5DS9A 4EGZA 3EETA 3K4CA 4AM3A 1D1CA 2F6CA 1YIJI 4F52A 3JAMK 2CV0A 4U88A 1ZLJA 3F21A 2IT0A 2BW3B 2W7NA 4A5NA 5K5OA 3DEEA 4UXNA 5FFXA 3KE2A 1MMDA 4IQJA 4XN0A 2WAFA 3ABTA 3BR3A 1RR7A 3DPTA 4O6JA 3BLYA 4B48A 1ZTRA 4F3QA 2VASA 3CD6I 2KDOA 1X4OA 1AHDP 3RSNA 3HRMA 2VJJA 2EINH 2DT7B 1JKQC 1ZLKA 5LD2C 4DIQA 3OMYA 1K4TA 2E5NA 3B6AA 2OTLI 4I0AA 3DQVC 1U0JA 3ZQIA 3J7ZI 3A01B 3FXMA 3V8KA 1W7PB 3GTJJ 5K7FA 1GV2A 1K6YA 3JTGA 4GFBA 3DCFA 4XKBA 1IC8A 1SC7A 3KZIC 1Z1DA 3GFMA 2TCTA 1HF0A 2HQAA 3NAUA 4KMFA 2KZVA 3ERMA 2MBFA 4L0ZB 3LAJA 3ZN0A 2RREA 1G3SA 3J80Z 1H89C 4BQOA 4HV5A 4A93J 2ZMEC 4KNYA 1O7LA 3CP2A 2PJRA 4ZDLA 3L2QA 3CCSI 3AFHA 3HOWJ 2LK2A 4R1HA 4L5JA 4BDZA 1B72B 3I59A 3OS1A 1B1BA 5IPAA 1E3OC 4F55A 5J1UA 1PUFA 2E71A 1C0WA 3CUOA 3AL0C 1GLNA 2YR2A 4CUGA 1Z91A 2VI6A 4LG0B 5JHFA 2LR8A 2UWMA 5ICGA 1J2XA 1ETVA 1TL8A 2CV2A 2AO9A 1SVOA 4B47A 4KYWA 3QPHA 2MD5A 4IVNA 4I0BA 4BY1J 5K5RA 3I64A 1I50J 2J5PA 2VQCA 3DF8A 1QGPA 3TDUC 4IO9F 2VXZA 2Q1ZB 3F72A 3QP5A 4IXAA 5FKMA 4JK1X 3H1CA 3I55I 4HA8A 2DA3A 1HSTA 2A5YB 4QWQA 3H3ZA 2RVCA 4CDGA 4A3EJ 4FTHA 1O3TA 1QPMA 3HOXJ 3BPXA 3KIOA 1FBUA 5GPCA 2WV1A 3QQAA 5IP7J 1FC3A 4A5MA 5KVRA 2MFZA 2P5VA 1MIJA 3IH2A 2VODA 3WTZA 2M0MA 1JT6A 4BQQA 1UHSA 5DTDA 1FJLA 3H9QA 1H0MA 3VSKA 1WZ2A 1IRFA 2I8DA 3CCQI 3F6OA 3H9JA 2XHKA 1JKRC 3V42A 4AIHA 4LOCA 3H35A 3TOAA 3WHBA 2AXLA 2Z16A 1P4AA 3IAS2 5HDKA 2PBIA 3G1OA 1A6IA 1KU9A 3L1PA 2GXGA 1Y1WJ 3KETA 1FOXA 1DPRA 2FQ3A 5EG0A 3GTPJ 3RPUA 4MQVA 5HLIA 5HNHA 5D5VB 5D5WB 5J4YA 2R7UA 3DBRB 2FF4A 1IN6A 2CU7A 2PQ8A 5B3SH 5IOZA 4YIRX 3I56I 3JW4A 3KYLA 4HOBA 3WE2A 4JX6A 2OC6A 4J01A 1ZRCA 4II2A 1XN7A 3KX2A 1TC3C 1X1AA 1F43A 2H6CA 3WG9A 4RM3A 3S1NJ 1R49A 3WGIA 2M7BA 1CQTA 1VQPI 1MBHA 4NQWA 1BR2A 4GYGA 1REPC 5E1ZB 1H8AC 4BBSJ 3C2BA 4V2GA 1F4KA 1FP1D 5H6QA 1S3JA 4RM2A 2KL4A 4FT8A 4II3A 2RNGA 1D8JA 3BJAA 1D5YA 3C3WA 2VJ5A 4ZYGA 3OY9A 3I58A 5BOXA 3QYEA 2VQGA 3T8TA 2V9VA 1IV6A 4PGHA 3JTHA 3I4NJ 2X51A 4R79A 1V5EA 3V4GA 1IUFA 4N9IA 1MW7A 1W5SA 3HUGB 4F92B 2DFIA 1T6SA 2EFPA 2KDZA 2FMYA 1IJWC 2AQFA 3OYJA 1OYWA 4XONA 5GADJ 1W7PD 3A01A 4G6QA 4ZH4F 2QA4I 1IAWA 3MQ0A 2L02A 3J7AO 3SHFA 3CLQA 2CUEA 1UAAA 2R3SA 4LD5A 3WTTC 2VPLA 1AU7A 5AONA 1SEUA 2L7KA 2Y30A 2CH0A 1G6NA 1P2FA 5L3GA 1TW3A 1XGNA 1BI0A 2Q0OA 4FHTA 1OMIA 1USTA 2KJBA 4BXXJ 4L9NA 1UHMA 5CKTA 2CG4A 3CMEI 3F8MA 4NNJA 2ESNA 2XGDA 3ZCOA 5D5XB 1YYVA 2NVXJ 2VKEA 4D5CA 3CDHA 3PQKA 4A3BJ 2K27A 2BEOA 1QHHD 2XKOA 4KICA 2VC1A 3RPQA 5KAFC 3JRHA 2ZMEA 1X1CA 4KMUX 1W1WE 1ZH5A 3H92A 5EGOA 2DK5A 3G3ZA 2JA7J 5E20A 2B63J 2E36A 1R7JA 1YX5A 1RETA 2DFEA 4UV8A 3SXYA 3T0YA 4XRFA 1UFMA 3TP0A 3OIPA 2V4JC 1FWZA 2M45A 3K4MA 2XDVA 5H6RA 5KK1A 3K70C 4EJVA 1JHHA 4BXFA 1WJ5A 2ZCWA 2LP0A 5DCMB 2XSDC 1RRJA 2DXIA 3HOVJ 2M5WA 5K7HA 2UUZA 3GYHX 2YUSA 1A04A 5EEAA 2EA4A 5E3MA 3MCZA 4Y4RA 2VUMJ 4RDUA 2B7EA 1DDNA 3K9TA 4PJJA 2WADA 2Q2EA 4CSWA 1G3YA 2KIMA 5FKLA 1D0XA 3LSHA 1JUPA 3MN2A 3OSGA 3IUOA 2LMDA 1A6QA 2HS5A 3F3XA 2Y9ZA 1BL0A 1JTYA 4CCKA 3FXRA 5FLMJ 2W4SA 4D1QA 4Z2YA 4ITVA 3JRAA 3HL2A 3E5UA 1BIAA 3FK7A 5FLXK 6PAXA 1ZYRF 1IW7F 3M9AA 1R58A 3J81Z 2V1NA 1SMTA 5J1RA 4BL0B 2IS1A 4UVAA 5J8FA 2EIMH 4J00A 1BJAA 4XRSA 4GCVA 2R7RA 1TNTA 4E7LA 5JHUA 2LDUA 4MNUA 5M3FJ 3CCMI 1R6RA 4I09A 1Z05A 2VKDA 4QIWN 5LHGA 2CFXA 3KP7A 1G8XA 3WGGA 1QVUA 1FSHA 2CWEA 4A3CJ 4BEHB 3TP3A 2EZKA 3ESWB 3QAHA 4DYQA 2OQGA 2M9HA 1IN8A 4IHSA 2WY7Q 3LSJA 4M9ZA 3RKXA 2WWYA 1N77A 2DYSH 3CDIA 3HSFA 4JOMA 1LFPA 3T8RA 2DQLA 3BTCA 2EPFA 1MZBA 2KFDA 3ABMH 3CESA 3BC8A 3Q0VA 2KHMA 2ISYA 2HI3A 3BZKA 2NVUB 1FLIA 3TW6A 1Q1VA 4F93B 4KUMA 1J7KA 1TWFJ 5LRSA 5D8KB 2GIZA 2V6CA 2E34A 4B8XA 3ISPA 5C4JJ 3S3OA 1R4NB 3HHHA 4Y7NJ 4PK4A 2XKPA 2XVCA 5L3CA 4A3DJ 3VYUB 2JA5J 1BA5A 3CCRI 4GGGA 3B02A 1LDDA 2XC7A 1MNDA 4PSWA 1B8IA 1QU3A 3KYCB 5HDNA 3ZMDA 3ZQHA 1UG2A 5F64A 1DUXC 5B66C 1I6XA 1ZKGA 4WK8F 1LEAA 2IRFG 3QYBA 3GTGJ 4M72A 1NK3P 4L0YB 3I0TA 2IW5A 1XMXA 3U1KA 1QA6A 1YLFA 3BG3A 2DA2A 1D1AA 4XM3A 5E8IA 2JN6A 1U5TC 2AXTC 4BDYA 1LUJB 1FOWA 4NC6A 1HC8A 2LBFB 1SVMA 2ELKA 3FISA 3KEOA 1HDPA 5EYRA 2DLLA 2JK3A 1MJBA 2HXIA 5A2QK 4NC8A 2HZTA 4Y17A 1K4SA 2ZXHA 5C3EJ 2R5ZB 1WQ2A 1F9NA 3G4SI 4P5OA 2CQXA 2DJNA 2NOJB 3I5UA 2E1OA 2CQQA 2L9RA 2QLZA 2MD0A 1VI0A 3KZZA 3K4BA 2M8EA 3H3VK 3OL3A 1LJ9A 3KCCA 3PSFA 4CYDA 2M4KA 5TRDA 2F5FA 3DBLB 2EFQA 1P7IA 1IF1A 4BUPA 3WGHA 1YRNA 3VYSB 4WX9A 2RQPA 3DEUA 1P7JA 4BE2A 3DWLE 1XGSA 2ZXIA 3HHGA 4ZYHA 1ETYA 3GZNB 2A61A 4XOTA 3ZPLA 4KT5C 1LFUP 5JR3A 3ML6A 3MEXA 4IHTA 2XV4S 3ZOBA 3OWTA 1YX3A 2JZYA 3BROA 1MSFC 2QSGX 1D5VA 5JVGF 4HSTA 3M1EA 5TGTA 3CC7I 3REOA 4DJAA 1FYMA 3S14J 1FSEA 3RQIA 2XPWA 1TBXA 2X6OA 1XDUA 3CCVI 1ETWA 4MEXF 3G2BA 1ZREA 3G73A 1BOBA 1O7FA 4PJMA 3W3CA 1JKPC 1HW5A 1VQOI 3PNTA 4NUBA 2HNHA 3JRGA 4D0PA 5HNFA 2PJRB 2UV1A 3G1LA 3ZMZA 2EIJH 4WXCA 2EH3A 1WH5A 2OQRA 2L01A 5HS9A 3S3NA 3GLXA 4OU0A 1PUEE 2K5CA 4ZYDA 4GDFA 5DD8A 1QRYA 2OCEA 4EJUA 2K4JA 5GAGJ 4XIDA 1SFUA 1PUFB 4QPOA 2R5YA 2DMPA 4LITA 3S8PA 4UB6C 3BR0A 4IRIA 2NVYJ 1MNMC 4CXFA 1TWGJ 2QVOA 2DMUA 4KIGA 1VQ8I 1A31A 4R8HA 2ZB9A 2WC2A 1OYIA 2XAUA 3GEZA 2A5WA 2A07F 1BIBA 3UNGC 3Q0WA 2IS6A 3A4CA 1ZAOA 1S72I 2QF7A 3CUQC 2Y0MA 2NNYA 1M1EB 1PJRA 4E4HA 3J80K 2R4GA 4V2FA 1W0TA 5FRMA 3BR6A 9ANTA 1F5TA 1FYLA 5JFRA 3G71I 1B9MA 2DOAA 2JUCA 1B9NA 3MMYB 1RIOH 1USSA 1S29A 3M07A 3CUQB 1HQCA 2Z5UA 2M2EA 4DOZA 2JA6J 3PUBA 5ED4A 5DCFA 2HTJA 4N4NB 3GTOJ 3IH3A 2O8XA 2R93J 3MVPA 1WRJA 2RV8A 3KEQA 3OYGA 2XSJC 3BTLA 2D5VA 4BJTA 4B3AA 3CP8A 3CJTB 1FOYA 1YS7A 2ME6A 3TO6A 1RUOA 3DU6A 2XPVA 4EM0B 2VKHA 3RCOA 4JX5A 5CJ9A 5FKNA 5D8LB 5B1AH 2KT0A 3OYLA 1NH3A 3QP6A 2NVQJ 1WJCA 3VDXA 3KP5A 3CCEI 2DA4A 1I27A 3JSOA 3KYDB 4KJZA 1T56A 3RZDJ 5ICFA 1G3TA 3GW2A 4CZZA 4LG3A 4RGXA 4H0EA 2L7FP 1D0ZA 2Z2SB 2L5QA 3OYKA 2WTEA 4JBAA 4A2UA 1P6RA 4FQGA 5EG0B 2WAEA 3G6EI 4A3MJ 2OA4A 4LMYA 3PO3J 2ICWG 2LF8A 1JUSA 5JVTA 4G7OF 3CCLI 4DYRA 5E18F 3HOTA 2QBYA 4IKFA 2OCCH 1YS6A 4XORA 2DTRA 1GXQA 2WAQN 4P55A 3LSIA 4L5EA 2KZGA 4OIRF 4QPQA 1Y8RB 5EF6A 4P96A 2XAJA 1KQ0A 4BHPA 2EZHA 3K4NA 4G9YA 3AG3H 2ZO4A 3KP4A 3DTEA 3GFIA 2L9VA 2FNPA 1XD7A 4IHYA 4NQWB 3ZMUA 1U5TA 2BY2A 4PDKA 5LHHA 1Y39A 5C4XJ 2WAQA 2FMLA 2QSHX 1BR1A 4PFOA 3WTSC 4LLGF 4OIQF 4BH9A 2A69F 3DLAA 4CH7A 1WWXA 1SD6A 1SD4A 3D1NI 4RAFA 3HOYJ 2F5CA 2MH9A 3X2QH 2IAIA 2LY2A 3HC7A 5L3DA 4BYYA 5LLQA 3QOEA 4UHTA 3FHNA 1DPUA 1TQIA 1XGOA 5CVVA 4BE1A 2M8GX 3H0DA 1TWCJ 2FRHA 2E2HJ 2DBBA 1N75A 2M1BA 3DEWA 4D5FA 1SAUA 1Z9CA 4NB5A 2KMUA 1FZPB 2V7FA 4BS9A 3BQYA 4QTRA 2R0QC 1XGMA 2P6SA 3SQNA 5J1YA 4HZFA 3GX4X 1Q1HA 1WJDA 1LEBA 4HF2A 4G8XA 3PNVA 4CHUA 2GWRA 2LC2A 2ZXWH 4A3GJ 2M4GA 3S1MJ 3RYPA 2VQHA 1ZARA 4X6AJ 1RESA 4L9JA 2XUBA 5BQTA 3SJMA 4GO1A 5FKKA 4XMYA 3TO7A 3NEUA 1LB2A 1V4RA 3ZGKA 2FBIA 3V7CA 2TDXA 2IGOA 3NWTA 3FDYA 3VPRA 5M5XJ 2LRDA 4LFUA 1YI2I 4PSXA 2XF7A 4LB6B 2PJPA 4KIBA 2XIGA 2KISA 2ZNZA 5IT9K 3CQZJ 2BVMA 2BGCA 2E2JJ 2MC4A 3L2VA 3HOZJ 3SEQA 2XGEA 4W1UA 5K7ZA 2ZMEB 4EEFG 2A6EF 5EGOB 5E3OA 5EZGA 5FO5A 1KU7A 2ADUA 4XLNF 1ERDA 2GXBA 2DU9A 1JGGA 4YFNF 4HX7A 1YE9A 2YS9A 3GTQJ 3CC4I 2LOOA 3OV8A 4XR6A 2XAHA 1NG6A 2JMWA 2NVTJ 1OCOH 4RLQA 2DYRH 4I98B 1R5ID 2FA5A 3AL0B 3NWSA 5BNGA 3TO9A 3ZMTA 2P5LC 4EM1A 2CMPA 4HNTA 2CJJA 2EQRA 2JSCA 2P81A 3CTAA 3IH4A 4KDPA 1A36A 2CSOA 2NRAC 2QENA 2LFBA 1EJ9A 2Q2EB 2PG4A 2IP2A 4ASNA 4HDUA 4P1WA 4F91B 1DU0A 2R7VA 1OISA 3Q5FA 3CUQA 4RAGA 3S16J 5KCMA 1XSXA 2J5OA 2DPDA 3KEYA 4XICA 2K40A 2E5ZA 1J0RA 1BOAA 4E7JA 3AAFA 2X1CA 1T2KA 2DA5A 1CF7A 1FMVA 1WVRA 2HZDA 2L0KA 3HEFA 2DTZA 3VYRB 2JRTA 1EH6A 4AWXB 2ZXJA 2HYGD 4M3BA 4JQFA 3HG9A 3FXLA 4RBOA 3CCUI 2K9QA 3HOSA 2A3SA 4LK0F 3P9IA 1KYWA 1T39A 1QBJA 2PEXA 3BJ6A 5D6EA 1I5ZA 3KP6A 4OOIA 1Y0NA 1IO2A 1ZGWA 2EILH 5GAEJ 1X4PA 2HQNA 3LA2A 5LGNA 1SFEA 2E60A 3RPUD 4BAYA 4PJ0C 3BT9A 3NARA 5DM7F 5F0FA 2VIXA 3JAMZ 3RZOJ 5HDGA 2R7WA 5CVUA 3PM1A 2K02A 4XRSG 4RB0A 5FROA 2P7VB 1V5GA 4QLCU 3LWFA 4KN4X 2Y0SN 2OZUA 1D0YA 1IXCA 1XMKA 4BJ6C 4RGUA 2HU9A 1RR8C 3BG6A 1WJAA 2A6TA 1PVEA 3M8JA 1WJBA 3WG7H 1B8IB 2BOLA 1LDJA 5FD5A 2LD5A 2Y0SA 3LAPA 2PMHA 4U0WA 3OYAA 2VL8A 1ETXA 2FX0A 2MABA 1GXPA 4N0BA 2P4WA 2COBA 1ACIA 1MBKA 2DPUA 1JE8A 1Y1VJ 2JQ7A 2XAFA 2X0LA 1GV5A 2K85A 2RN7A 1D3YA 1IXRC 2K9MA 2HVQA 5J8CA 5FLVA 4Y52J 1FNNA 1R5HA 2HWVA 3L00A 3OYEA 4PJNA 4M9XA 3FM5A 3MKZA 2OZ6A 1I6HJ 2OPTA 1JKOC 4A12A 3SZTA 4DZJA 1EKEA 3F8FA 3I9V2 3HYIA 1XC5A 4FASD 2KJCA 1LVAA 5CPRB 5FGMA 1MJAA 5CVJA 1YIOA 2GXAA 3E6MA 5LBQA 1POGA 4BU2A 3R61A 4X1EA 3K10A 4AVZA 1R5GA 2CQNA 3S1RJ 2Y48A 1MBFA 1JTXA 3DBHB 2XB0X 1YRNB 3SFIA 2GBYA 5LFAA 1HW2A 3M8EA 4PJLA 1OQYA 3B6CA 1YW8A 2KP6A 2HYFA 2DMQA 1MH3A 3I4PA 3PFIA 4BNCA 3J7YJ 4Q47A 1IGNA 3M4OJ 3BR1A 3KLNA 4BY7J 2OTJI 1Z77A 3DLLF 1HKSA 4Q48A 3IKVA 3JR9A 1B6AA 4FISA 1H9TA 2KPMA 2G7UA 3BTJA 2Z9OA 5J3LA 3JRCA 2TRTA 1QZEA 3SDBA 3OOUA 1ETQA 3A03A 2W24A 4O5VA 1PDNC 1MJ9A 1P4WA 4KN7X 1OCRH 5E1XA 2K9SA 2O61A 1ZGAA 4FE7A 4ZC3A 5C44J 1HCRA 1TP4A 2LREA 4M3DA 1TW2A 2RNJA 4OIOF 5GPAA 4I99C 3K4LA 4S05A 2E1NA 5F27A 1FYKA 1I1SA 2ESHA 5DV5A 5HODA 1E0EA 1YTYA 2H94A 2HVRA 2LVSA 2VQLA 1JJ8C 2F4MB 2VN2A 1K7AA 4I6ZA 2ACJA 1WKMA 1X3WB 5LEKA 2FE3A 2B0LA 1XTAA 2A6HF 4G7ZF 1XS9A 2IGMA 2LKSA 1BI1A 3S3MA 2N8GA 4U7BA 3LQQA 4C2MJ 1HKTA 3LSRA 4LLLA 1YJNI 2R5YB 3CDLA 2BV6A 1ON2A 1X2MA 3F0CA 3K1PA 4UB8C 3S2WA 3W2AA 3OYBA 1AKHA 2X6YA 2DK8A 2X85A 2H8WA 1IUYA 4A0XA 1ITYA 4G12A 1HLVA 1OFCX 2LLKA 2ZSHB 5FD6A 2CW0F 4OMYA 2P8TA 2OV7A 3BDDA 4UVCA 1FBQA 3HSEA 2MGQA 3EPZA 1O3QA 4EVIA 3VSLA 2M0CA 1S7OA 3HXLA 1MBEA 1G2HA 3LSPA 3CF5F 1WI9A 3L9FA 1BR4A 2ZBKA 3KZYA 4KIFA 1KA8A 4M71A 3L2UA 3CJNA 4RMNA 4EM2A 1OJLA 2VBXA 2QSFX 2JVHA 1UCRA 1OYYA 4HAMA 3FHZA 2O6GE 3U1DA 1TLHB 5DYMA 4AC0A 1VQ6I 2V6EA 1UHWA 1YG2A 3IRRA 4EJOA 4V19K 2AQEA 1XB4A 1U3EM 2EK5A 4Q5SF 1Z7UA 3HTUA 4BACA 2JA8J 1XG1A 1W36C 3HZJA 2X1DA 3A0HC 2DCEA 1DU6A 3ABLH 1LNWA 1U9NA 2P5KA 2GOMA 1FT9A 1UELB 2R7FA 2CUJA 3GXOA 1EF4A 2RAEA 2QBYB 2E2IJ 3LSKA 3E97A 3FXKA 4YRVA 2ID3A 1VQLI 4NDLA 4Y3OA 4AU7A 4ESFA 2R7SA 3DXJF 4IHWA 1OCPA 4XLCA 3C7JA 2W82A 5GTHC 3PO2J 1D8KA 3VODA 3CO6C 3C1DA 4CCMA 1STZA 4KFCA 4UUTA 3RKQA 1U5TB 1SANA 1VQ5I 1ENHA 2BY1A 4E7ZA 3N4MA 4AUXA 1W0UA 1IRGA 5FFZA 3AKZA 1VF9A 2DODA 3BJOA 2GOXB 5FJ8J 1J5YA 1BC7C 3F9KA 2EIKH 1I1GA 4B43A 2BE5F 3IWFA 4G6TB 4MIMA 3C2HA 1X3UA 3K1NA 5CLSA 3F22A 2CS3A 2MLGA 4OAYA 3OS2A 2LY1A 3HBLA 1K61A 2BZTA 2VT3A 2X48A 1S7EA 4YFXF 3IAM2 1YHQI 3T5XA 1A5JA 4IHVA 2KIUA 5J6XA 1MDMA 3WTXC 1K78A 2VOOA 3PNYA 5L3BA 1XCVA 3HPHA 1OCTC 5GAHJ 3OL4A 4AIDA 3I54A 2PLYA 1DP3A 2DA6A 1PYVA 2DOEA 1HDDC 3BCBA 3U21A 1E3HA 3IKTA 1HBXG 3ZRGA 3B73A 2EV6A 1GT0C 4HRIA 2K9NA 1IN7A 1YOVB 4TV7A 2HPIA 4OWRB 2ELHA 2F4IA 4YG2F 1L3LA 3NQOA 3RJPA 3IV5A 2CRGA 4XKCA 3ULQB 3VOEA 4M3GA 2OF7A 2LG4A 4LIUA 3WODF 4ETSA 2E1MC 3W2VA 2IA1A 2BVLA 4BQNA 5CYVA 2VOPA 1VQ9I 1ODDA 3KPHA 4EQQA 5B1BH 3OYFA 3K70D 3E6BA 1U2WA 3ECHA 3LFUA 3QYFA 3L7WA 3MZYA 4OIPF 2VBZA 4Y33A 4QSHA 3UKGA 1IRZA 2XGXA 2E1CA 1TTYA 2CV1A 4P9UA 2DT5A 2COMA 4M73A 2I5UA 2DAOA 3I71A 3RIRA 2BYVE 4UUSA 1H9GA 4UY8I 2DA7A 2K3PA 1VQ7I 3HGYA 3MAJA 2CUFA 2XAGA 4N4OB 3N97A 5HOOA 3BPVA 2EFWA 2FOKA 2W84A 3ASNH 4IRGA 2LY9A 5CVIA 2LKXA 5E3NA 5CVRA 4W97A 1YJ9I 1DGRM 2WY8Q 1BI2A 1YW9A 2EWNA 2L9SA 2R7DA 4N9HA 1BI3A 4XKVA 4HDVA 2GLOA 3G1MA 2JTVA 3DV8A 4KISA 2ZC2A 2JPCA 2R92J 3DPLC 4IHXA 3GTMJ 4RA2A 1YQAA 1QNTA 3TDZC 5J47A 4E7HA 1QPIA 4EGYA 5DUKA 3BG7A 2Z99A 2IBDA 3K2ZA 3Q9VA 5AIPA 1RKTA 3DKWA 1IXSB 3I3LA 5JLXA 3SYTA 1EH7A 3HSRA 3JSPA 2Y69H 3LSGA 2XF5A 3ZQGA 4ZTFA 3ABUA 1ZG1A 1T33A 1IDYA 2UXXA 4GYIA 3ZQFA 1CF7B 3FXOA 1YO5C 1ZRFA 3IWZA 4ZYEA 1WJFA 1LE8A 3GF2A 2RGVA 3S2DJ 1V54H 2FSWA 1AA7A 1JJ6C 4L18B 1F1ZA 4A3FJ 1G4DA 3M7GA 5E3LA 5E79C 1UJ8A 1VZ0A 4CCJA 3E6CC 1WPKA 3PL8A 4HG2A 2EFOA 1P4XA 4LJZF 1RPWA 1X1DA 3WTWC 3L2WA 4G6DA 1TWHJ 5HVQC 4RB1A 3ZXSA 3DKXA 2BY0A 3O3KA 2YU3A 4ENJA 1K6OA 3GFJA 2DMTA 2FEZA 4AIJA 5HS7A 1ZR2A 1J59A 1ZRDA 1JHFA 1RZ4A 3FBNB 1U9OA 1KU3A 3FXJA 2VLAA 3FMSA 4C3HJ 2NNNA 3MFKA 3JRIA 1K79A 4U7DA 1FY7A 2QYOA 2VPRA 1OR7C 3HOUJ 1TWAJ 4WCGA 2QKLB 3UR3C 2JA2A 2ME0A 4F7ZA 4DBRA 4ZZDA 1I39A 1JUMA 2IA2A 2QWWA 2V26A 1Y8QB 3LQRA 2HDCA 3BQZA 2VONA 1JXSA 4ON0A 3ASOH 2ZJ2A 1G3WA 2KIFA 2YU9J 3QWLA 1T0FC 4CYCA 1MD0A 1JGSA 2W1OA 3JCUC 4P9FA 4JX4A 3I53A 1VTNC 1GUUA 5F0HA 5H2FC 4AVPA 3E1SA 3VFZA 2CGPA 3EYIA 2FXAA 5EJCA 1OCZH 1XX5A 2QGUA 3DU5A 3CJRB 4AD9A 2QZ8A 3CC2I 4X0GA 3ROUA 4ZZLA 5L3FA 4OAZA 2V1UA 4RS8A 2E7WA 1FX7A 2L9NA 1QZYA 2MH2A 1Z3XA 4NBQA 2KRCA 3IHUA 4ZDPA 3P5JA 4CO8A 4WF2A 3RTRA 5HLTA 2NS0A 3QRFF 5IYBJ 3JREA 3MKYB 3HGGA 3A1YA 5IYCJ 2YX4A 3GUDA 1CGPA 2GA2A 1UB9A 2Y9YA 3DPUA 3EQLF 3GLLA 1GDTA 1KQ9A 1QQIA 2H1LA 1JT0A 1XSVA 4HW0A 5ICCA 3BTIA 1HXDA 1TZLA 2M7AA 4BGDA 3FX3A 3ZP5A 1XSDA 1WI3A 3CF2A 1BW6A 1I3AA 1X2NA 2ELJA 2MC3A 3QU3A 5TISC 4HSRA 5LGUA 2HEOA 4ZDOA 1AWCA 3QPSA 1MH4A 3QU6A 2DQRA 5K1YA 3HB9A 4XLEA 3VEPA 2OD5A 4CCOA 5L3EA 2E7XA 4HQEA 3HTSB 1SFKA 2OAZA 1X58A 3WTYC 2D45A 1XDSA 2RDPA 1SAXA 2DW4A 1LVKA 4ENNA 2W00A 1WFXA 3H5NA 3S32A 3S1QJ 2K7LA 3RYRA 2ID6A 4DYCA 1TT5B 1FMWA 1K83J 2EJRA 3H5RA 4RAZA 4Z6YA 4EMSA 1MGTA 2DO7A 2RC4A 4KT6A 2DFHA 2O9LA 5IYDJ 2H6BA 4IJAA 4HNUA 2GAUA 3GVAA 2RKHA 3L09A 1W4MA 2KKOA 5CQGA 5J40A 2Q8KA 3ZN1A 3JRDA 3QPLA 3ECOA 3MZHA 3CMMA 1NTCA 4WWCA 2DA1A 1ZK8A 2EA2A 1Z6TA 1DGWY 3M8FA 2GQQA 1O57A 4PUSA 1G59A 1XMAA 2DI3A 3IC7A 2KQRA 3E0JB 3D5SC 4M6YA 1WCMJ 1R9TJ 3HKZN 5DEQA 4E7SA 3GTKJ 3H36A 1Z6RA 3HPGA 1OCCH 2DMNA 3CMYA 1BN5A 2IA0A 2HVSA 4B1RA 2BXYA 1IV8A 4IL6C 2RQQA 3CLOA 1LKXA 4DW6A 1R23A 3HKZA 4A69C 1H88C 2WA0A 3K1MA 1ZG5A 3OYHA 1MBGA 1AKHB 1N78A 5M5WJ 2FOWA 2IPQX 1T95A 4LK1F 5FKOA 2YX7A 3V7SA 5KAIC 3K4JA 5IP9J 5D4RA 4YIIA 1ZELA 1FIPA 2FJ1A 2X6XA 2QUFA 3OYIA 3E5XA 2LYCA 2DJIA 2EV0A 3K2AA 4Y13A 4A3LJ 2D2WA 4DBQA 4HQMA 2AS5F 3GZ5A 4ABZA 5D4SA 3IL2A 4HBLA 1TNSA 2MG4A 4RGSA 4HX4A 3TW7A 2HQRA 2LTPA 2P0WA 3F6VA 4D7NA 3L2CA 3ZQCA 1PP7U 2LF7A 2EZLA 3E5QA 2W48A 3JRFA 1FTTA 4XRMA 4BQAA 1IDZA 2K4BA 3AG1H 1V55H 2F2EA 2OUMA 2PMUA 2ZJQF 5F1RA 4EJTA 4UUVA 3LA3A 4G94A 3GCMA 1QZZA 2XB5A 3SEZA 1WJEA 4H4KC 3ZQQA 1R1TA 1VFCA 2Z33A 3W2WA 4XL9A 2ZNYA 5B5EC 3J81K 5F04A 2V1DA 3D0SA 4FETA 2LSOA 2MSYA 3OS0A 1V5FA 1R1UA 4FX4A 4GXOA 4PGGA 3ELKA 2XRNA 4LGWA 3FZVA 1YFHA 4HLXA 4XNFA 2HGCA 3COAC 1OR7A 2DFFA 4L5IA 5EZHA 1FOKA 1KGSA 3R4KA 1GHCA 1UMQA 2OU2A 1FPQA 2EZIA 1R36A 2R7QA 2FUG2 3ZQLA 3PQJA 2FBKA 2O7OA 5D6FA 2VE9A 3BY6A 3P7NA 4RGRA 1T0FA 2F4OB 3C2GA 2VJIA 2KRHA 4A6EA 3PIOF 3GTLJ 1T08B 2XPUA 3WU2C 2OBPA 3K0LA 1FP2A 3E7LA 1BM9A 2EB7A 4BHCA 2PN6A 3RI4A 3U9GA 1PP8F 4JP0A 4BBRJ 2LH9A 4JYKA 2L3DA 2H1KA 5KHDA 2VBYA 1LQ1A 2ECCA 2JUGA 1SVLA 4S0HB 3S17J 4YIFA 4IRHA 3EUKL 2BW3A 4Y15A 3A02A 1HKQA 1ZG3A 2IXSA 3Q9SA 4BKXA 2HKXA 5IT9Z 2GZWA 3MWMA 3PIPF 1VQ4I 2IVMA 1NK2P 1P92A 2HDDA 1ETOA 2NAZA 2Z1DA 4YFKF 4UVBA 4DZPA 3RKYA 3KFWX 3F8CA 2W25A 4YEJA 3L2RA 1KZHA 2HDWA 2L7ZA 3WE3A 3BG5A 5JLWA 5F1JA 2K86A 3AG4H 4E6KG 4BJ5C 2GM4A 1LDKB 1SMYF 4ESJA 4XOPA 5BPIA 1W7PA 4I76A 2D1HA 1Y56A 3EDPA 4I01A 2V79A 1MDMB 2G7HA 3LSTA 2NXNB 2H8RA 4U0VA 3MD2A 1NHAA 4BE0A 1K78B 3A0BC 2XF6A 3HDDA 4LIVA 1Z67A 3FBIB 5DDGA 2QEXI 1QHGA 3EYYA 3I4MJ 3NRVA 2HYJA 5IY5H 5LGTA 4HV6A 1ON1A 5JI6A 3BR2A 5ILUA 3CCYA 1MMAA 1F36A 1ZHFA 1Z21A 1EV7A 2FU4A 4UNOA 2FQ4A 2BBYA 2HOTA 5F08A 2EFNA 3TKYA 2XROA 3S2HJ 2O03A 3GWZA 2QM3A 1FBSA 1MSEC 3O6BB 4LB5A 2HOAA 3OOPA 1UZCA 3QPTA 1B72A 5J4VA 5BS6A 4C30A 3KP2A 4DQ2A 4OINF 4G7HF 2HPMA 3OR2C 4RAYA 4D9JA 3ERED 2VE8A 2EBIA 3W6JB 2YPRA 3J7AY 2QQAA 5DUIA 3S93A 1WGXA 4LG0A 2LNBA 5EEGA 2P7CB 3F23A 1VQNI 2O8KA 2ZKZA 4E7IA 5IOYA 4D7MA 2IJLA 3LL7A 4U0YA 1MKMA 3P9KA 1IG7A 1MBJA 3D5LA 1L0OC 1NG7A 4UUSB 1MMNA 3FKIJ 3V7RA 1ZR4A 3HRSA 3U2RA 4B09A 1J09A 2CQ7A 3BZCA 1J9IA 2A05A 2WV0A 3A2KA 2QKMB 3WU1B 2QQ8A 4B44A 3S15J 1MNEA 2JJ7A 4ENKA 4MFDA 4A3IJ 4HYEA 4B3XA 4XLPF 1P9QC 2H27A 2O3FA 1UG0A 2G0EA 1WHUA 1TT0A 4NHJA 3VYTB 5E1WA 5E17F 4M9SA 4A3KJ 1VQKI 2V1XA 2ZFUA 1U6GA 4CZCA 4ZJZA 2DDAA 4LLNA 2R7ZJ 3FIWA 1SFXA 1BC8C 4C9YA 1X1PA 3TBIA 4PCQA 4ZTJA 3BOQA 3SFZA 4HF1A 2VT2A 2WB1N 1U8RA 2BHYA 2IS4A 5HS8A 4I02A 2IGKA 4HLYA 1BBYA 1Y6IA 3HRTA 4ENMA 3PUFA 1A35A 3DKYA 3RKWA 2NS8A 5LRRA 5HLHA 1X19A 4C2UA 4E7KA 5F0CA 5BPDA 1GVDA 3RDIA 1T98A 4AIKA 2UXNA 2JRMA 4FX0A 1SFOJ 2WB1A 5CQEA 1S8NA 1LE8B 2JT1A 4DNCA 3MKLA 4KA4A 3RQ4A 3H5AA 3R0AA 2NOGA 1R1VA 2XASA 4HF0A 2STTA 1DQUA 1KONA 1U8BA 3GFLA 4MEYF 2X9DA 3EUAA
chains in the Genus database with same CATH topology
1AOYA 3R0JA 4PZJA 3FWEA 1XCBA 1IZ1A 3KP3A 3GZ6A 5EEHA 2F5EA 3F8BA 2M30A 2L4AA 1SD5A 3O2PE 4L9TA 2HTSA 2MLKA 3WTVC 4ESBA 5F6FA 1E2XA 3CO7C 4XBFA 2UZKA 1W5TA 4MHGA 1QO0D 4XSXF 4L9VA 3H3UA 5LEJA 2CO5A 3LFKA 2NYXA 4OMZA 4HX8A 5ERIA 5E8GA 3FMQA 5DD4A 3LA7A 5H20A 2JPBA 3BZ6A 2F5DA 3HUGA 2PFBA 3IRQA 4WXHA 3E3VA 2Z3YA 4BHBA 4A0ZA 2STWA 5ICEA 1DP7P 5IT3A 1OKRA 3TQNA 2GA1A 2HR3A 2HOEA 3BP8A 2FNAA 2LKPA 1J75A 1KQ8A 4WXDA 3TOBA 1HSJA 4K2EA 3C18A 1OPCA 3FXUA 3WTUC 4EJWA 1ZN2A 1TQPA 3W6KB 5FLXZ 4IF4A 2A68F 3V8JA 4RB3C 4BXUA 3GO5A 3SZPA 3HRUA 4A6DA 1GVJA 2Y75A 1RUNA 3HIFA 2VBWA 1YW7A 2HFHA 2MA3A 2X4HA 4I2OA 3ZMSA 2FBHA 5DCMA 1KU2A 1IN5A 5ILSA 1E17A 2QQ9A 3FF5A 5ILVA 2GIVA 2CYYA 5TJJA 2YSRA 4UV9A 4I7HA 1T38A 2G9WA 4MQ9F 3I59B 4M6XA 4S04A 2VC0A 1HW1A 4M74A 4E70A 1ULYA 2C6YA 2W57A 2HKOA 3P9CA 3ZMVA 1SD7A 1TQMA 2CQKA 1O3RA 5LHIA 3DP7A 1RI7A 2L54A 1R00A 5AIQA 4Q4ZF 2KRFA 3FXQA 1ONVA 4XSZF 2L4MA 5D5UB 1ZGJA 1S6LA 3R6SA 4MTEA 4RB2C 1S7AA 4MTDA 1B4AA 1R22A 2ETHA 1U78A 2P6TA 3K69A 3DFGA 5A2QZ 3BWGA 2D1VA 1RNLA 2QQBA 2ZFWA 4CGZA 5FB2A 2EV5A 3R60A 2H09A 4IPAA 3V8LA 4EV0A 4CICA 3F8NA 1KYZA 2O0YA 3KLOA 3VB2A 2M87A 3TGNA 3ZQ7A 1Y0UA 3WU0A 1B59A 1O3SA 1IN4A 3FMRA 5HLGA 5BMZA 3QOPA 3E6DA 2ISZA 3T1BA 2PI0A 3FM3A 1V3FA 4O3MA 3EUHA 1WSUA 4A0YA 4MGRA 5K5QA 2W85A 1EH8A 2XAQA 4EGZA 3EETA 3JAMK 4U88A 1ZLJA 3F21A 2IT0A 4A5NA 5K5OA 4UXNA 5FFXA 3KE2A 3ABTA 3DPTA 4O6JA 3HRMA 1ZLKA 4I0AA 3DQVC 3V8KA 1W7PB 3JTGA 1Z1DA 3GFMA 4KMFA 2MBFA 4L0ZB 3LAJA 3ZN0A 1G3SA 3J80Z 4HV5A 4KNYA 1O7LA 4R1HA 4L5JA 3I59A 1B1BA 1C0WA 3CUOA 2YR2A 1Z91A 4LG0B 2UWMA 5ICGA 1J2XA 4KYWA 3QPHA 2MD5A 4IVNA 4I0BA 5K5RA 3I64A 2J5PA 3DF8A 1QGPA 3TDUC 2VXZA 3F72A 3QP5A 4IXAA 4JK1X 4HA8A 1HSTA 2A5YB 4QWQA 3H3ZA 2RVCA 4CDGA 1O3TA 1QPMA 3BPXA 1FBUA 1FC3A 4A5MA 5KVRA 2P5VA 2VODA 3WTZA 1H0MA 1IRFA 3F6OA 2XHKA 4AIHA 3TOAA 2AXLA 1P4AA 5HDKA 2PBIA 1KU9A 2GXGA 3KETA 1DPRA 2FQ3A 3RPUA 4MQVA 5HLIA 5D5VB 5D5WB 2FF4A 1IN6A 2PQ8A 3JW4A 4HOBA 3WE2A 1ZRCA 1XN7A 2H6CA 3WG9A 3WGIA 4NQWA 4GYGA 1REPC 5E1ZB 1F4KA 1FP1D 5H6QA 1S3JA 4FT8A 1D8JA 3BJAA 3C3WA 4ZYGA 3I58A 5BOXA 3T8TA 2V9VA 4PGHA 3JTHA 4R79A 3V4GA 4N9IA 1W5SA 2DFIA 1T6SA 2EFPA 2FMYA 1OYWA 1W7PD 4G6QA 4ZH4F 1IAWA 3MQ0A 2L02A 3J7AO 3SHFA 2R3SA 4LD5A 3WTTC 5AONA 1G6NA 1P2FA 5L3GA 1TW3A 1XGNA 1BI0A 2Q0OA 4FHTA 1OMIA 1USTA 2KJBA 4L9NA 1UHMA 2CG4A 3F8MA 2ESNA 5D5XB 1YYVA 3CDHA 3PQKA 2K27A 2BEOA 2XKOA 4KICA 2VC1A 3RPQA 2ZMEA 4KMUX 1ZH5A 3H92A 2DK5A 3G3ZA 5E20A 1R7JA 4UV8A 3SXYA 3T0YA 4XRFA 1UFMA 1FWZA 2M45A 5H6RA 5KK1A 4EJVA 1JHHA 2ZCWA 5DCMB 2M5WA 3GYHX 1A04A 2EA4A 3MCZA 1DDNA 3K9TA 2Q2EA 1G3YA 2KIMA 3F3XA 2HS5A 3FXRA 4Z2YA 3E5UA 1BIAA 5FLXK 6PAXA 1ZYRF 1IW7F 3M9AA 1R58A 3J81Z 1SMTA 4UVAA 5J8FA 1BJAA 4GCVA 1TNTA 5JHUA 2LDUA 4MNUA 4I09A 1Z05A 5LHGA 2CFXA 3KP7A 3WGGA 1FSHA 2CWEA 3QAHA 2OQGA 1IN8A 4IHSA 4M9ZA 3RKXA 2WWYA 3HSFA 3T8RA 2DQLA 1MZBA 2ISYA 1FLIA 4KUMA 1J7KA 5LRSA 5D8KB 2V6CA 4B8XA 3ISPA 3HHHA 2XKPA 2XVCA 5L3CA 4GGGA 3B02A 1LDDA 5HDNA 3ZMDA 5F64A 1DUXC 1I6XA 4WK8F 1LEAA 2IRFG 4M72A 4L0YB 3I0TA 2IW5A 1YLFA 5E8IA 1U5TC 3KEOA 2DLLA 5A2QK 1MJBA 2HZTA 4Y17A 1WQ2A 1F9NA 4P5OA 3I5UA 2QLZA 3KZZA 2M8EA 1LJ9A 3KCCA 4CYDA 5TRDA 2F5FA 2EFQA 1IF1A 3WGHA 4WX9A 2RQPA 3DEUA 1XGSA 3HHGA 4ZYHA 2A61A 3ZPLA 4KT5C 5JR3A 3ML6A 3MEXA 4IHTA 2XV4S 2JZYA 3BROA 1D5VA 3M1EA 3REOA 1FYMA 1FSEA 1TBXA 1XDUA 4MEXF 1ZREA 3G73A 1O7FA 1HW5A 4D0PA 3ZMZA 4WXCA 2OQRA 2L01A 5HS9A 3GLXA 4OU0A 1PUEE 4ZYDA 5DD8A 4EJUA 2K4JA 1SFUA 4IRIA 4CXFA 2QVOA 4KIGA 4R8HA 2WC2A 1OYIA 3GEZA 2A07F 1BIBA 1ZAOA 3CUQC 2Y0MA 2NNYA 3J80K 1F5TA 1FYLA 5JFRA 1RIOH 1B9MA 1B9NA 1USSA 1S29A 3CUQB 1HQCA 2Z5UA 5ED4A 5DCFA 2HTJA 2O8XA 1WRJA 2RV8A 3KEQA 1YS7A 3TO6A 1RUOA 4EM0B 5CJ9A 5D8LB 3QP6A 3KP5A 1I27A 3JSOA 5ICFA 1G3TA 3GW2A 4CZZA 4H0EA 4RGXA 4A2UA 2WTEA 4JBAA 1P6RA 2OA4A 4LMYA 2LF8A 4G7OF 5JVTA 5E18F 3HOTA 2QBYA 1YS6A 2DTRA 1GXQA 4P55A 4OIRF 4P96A 2XAJA 1KQ0A 4BHPA 4G9YA 2ZO4A 3KP4A 3GFIA 2FNPA 1XD7A 3ZMUA 1U5TA 4PDKA 5LHHA 2FMLA 3WTSC 4LLGF 4OIQF 4BH9A 2A69F 1WWXA 1SD6A 1SD4A 2F5CA 2MH9A 4BYYA 5LLQA 5L3DA 4UHTA 1DPUA 1TQIA 1XGOA 5CVVA 2FRHA 2DBBA 2M1BA 1Z9CA 4NB5A 1FZPB 1XGMA 2P6SA 3SQNA 3GX4X 4HZFA 1Q1HA 1LEBA 4HF2A 4G8XA 4CHUA 2GWRA 3RYPA 1ZARA 4L9JA 2XUBA 5BQTA 4GO1A 3TO7A 3NEUA 1LB2A 1V4RA 2FBIA 3V7CA 2TDXA 4LFUA 4LB6B 2PJPA 4KIBA 2XIGA 2ZNZA 5IT9K 2BGCA 2ZMEB 2A6EF 5FO5A 1KU7A 2ADUA 4XLNF 2GXBA 2DU9A 4YFNF 4HX7A 3OV8A 2XAHA 4I98B 2FA5A 3TO9A 3ZMTA 2P5LC 4EM1A 2JSCA 4KDPA 3CTAA 2CSOA 2NRAC 2QENA 2PG4A 2IP2A 4ASNA 4HDUA 3Q5FA 3CUQA 1XSXA 2J5OA 2DPDA 1J0RA 1BOAA 3AAFA 1T2KA 1CF7A 2JRTA 1EH6A 4AWXB 2ZXJA 2HYGD 4JQFA 3HOSA 2A3SA 4LK0F 3P9IA 1KYWA 1T39A 1QBJA 2PEXA 3BJ6A 5D6EA 1I5ZA 3KP6A 4OOIA 2HQNA 3LA2A 5LGNA 1SFEA 4BAYA 3JAMZ 5HDGA 5CVUA 2K02A 4RB0A 2P7VB 4QLCU 3LWFA 4KN4X 2OZUA 1IXCA 1XMKA 4RGUA 1LDJA 5FD5A 3LAPA 2PMHA 4U0WA 1GXPA 4N0BA 2P4WA 2DPUA 1JE8A 2XAFA 2X0LA 2RN7A 1D3YA 1IXRC 5J8CA 1FNNA 1R5HA 2HWVA 3L00A 4M9XA 3FM5A 2OZ6A 4A12A 3SZTA 3F8FA 3HYIA 2KJCA 1LVAA 5FGMA 1MJAA 5CVJA 1YIOA 3E6MA 5LBQA 3R61A 1R5GA 2Y48A 1HW2A 3M8EA 1YW8A 2HYFA 3I4PA 3PFIA 4BNCA 4Q47A 3KLNA 1HKSA 4Q48A 3IKVA 1B6AA 1H9TA 2G7UA 2Z9OA 4O5VA 2W24A 1PDNC 1MJ9A 1P4WA 4KN7X 5E1XA 2O61A 1ZGAA 1TW2A 2RNJA 4OIOF 4S05A 2E1NA 1FYKA 1I1SA 2ESHA 5DV5A 1YTYA 2H94A 2VN2A 1K7AA 2ACJA 1WKMA 5LEKA 2FE3A 2B0LA 2A6HF 4G7ZF 1BI1A 4U7BA 3LQQA 1HKTA 4LLLA 2BV6A 1ON2A 3K1PA 3S2WA 2DK8A 1IUYA 4A0XA 5FD6A 2CW0F 4OMYA 2P8TA 4UVCA 3BDDA 1FBQA 3HSEA 1O3QA 4EVIA 1S7OA 1WI9A 3L9FA 2ZBKA 3KZYA 4KIFA 1KA8A 4M71A 3CJNA 4EM2A 2VBXA 1UCRA 1OYYA 4HAMA 3FHZA 2O6GE 3U1DA 1TLHB 5DYMA 1UHWA 1YG2A 3IRRA 4EJOA 1XB4A 1U3EM 2EK5A 4Q5SF 1Z7UA 3HTUA 1LNWA 2P5KA 1FT9A 2R7FA 3GXOA 2QBYB 3E97A 4ESFA 3DXJF 3C7JA 1D8KA 3VODA 3CO6C 3C1DA 1STZA 4KFCA 1U5TB 3N4MA 1IRGA 5FFZA 3BJOA 1J5YA 1BC7C 1I1GA 2BE5F 3IWFA 5CLSA 1X3UA 3K1NA 3F22A 2MLGA 2VT3A 4YFXF 3T5XA 2KIUA 5J6XA 1MDMA 3WTXC 1K78A 2VOOA 5L3BA 1XCVA 3I54A 2PLYA 1HBXG 3IKTA 3B73A 2EV6A 1IN7A 4TV7A 2ELHA 4YG2F 1L3LA 3NQOA 3RJPA 3VOEA 3ULQB 4ETSA 3WODF 2IA1A 5CYVA 2VOPA 1ODDA 4EQQA 3E6BA 1U2WA 3ECHA 3L7WA 3MZYA 4OIPF 2VBZA 2XGXA 2E1CA 1TTYA 4P9UA 2DT5A 2COMA 4M73A 2DAOA 3I71A 3RIRA 2BYVE 1H9GA 3MAJA 2XAGA 3N97A 5HOOA 3BPVA 2EFWA 2FOKA 2W84A 4IRGA 5CVIA 5CVRA 1BI2A 1YW9A 2EWNA 2R7DA 4N9HA 1BI3A 4HDVA 2JTVA 3DV8A 2JPCA 3DPLC 1YQAA 1QNTA 3TDZC 4EGYA 5DUKA 2Z99A 3K2ZA 3Q9VA 5AIPA 3DKWA 1IXSB 1EH7A 3HSRA 3JSPA 3ABUA 1ZG1A 2UXXA 4GYIA 1CF7B 1YO5C 1ZRFA 3IWZA 4ZYEA 3GF2A 2RGVA 2FSWA 4L18B 1F1ZA 1G4DA 3M7GA 3E6CC 2EFOA 1P4XA 4LJZF 3WTWC 4G6DA 5HVQC 4RB1A 3O3KA 2YU3A 4ENJA 1K6OA 3GFJA 2FEZA 4AIJA 5HS7A 1J59A 1ZRDA 1JHFA 1RZ4A 1KU3A 3FMSA 2NNNA 3MFKA 1K79A 4U7DA 1FY7A 2QYOA 4WCGA 4F7ZA 4ZZDA 2IA2A 2QWWA 3LQRA 2HDCA 2VONA 1JXSA 4ON0A 2ZJ2A 1G3WA 2KIFA 1MD0A 1JGSA 4P9FA 1VTNC 3I53A 4AVPA 3VFZA 2CGPA 3EYIA 2FXAA 4AD9A 2QZ8A 3ROUA 4ZZLA 5L3FA 2V1UA 4RS8A 2E7WA 1FX7A 1QZYA 2MH2A 3IHUA 4CO8A 4WF2A 3RTRA 2NS0A 3QRFF 2YX4A 3GUDA 1CGPA 2GA2A 1UB9A 3EQLF 1KQ9A 1QQIA 1XSVA 4HW0A 5ICCA 1HXDA 3FX3A 3ZP5A 1XSDA 2HEOA 2MC3A 3QU3A 5LGUA 1AWCA 3QU6A 2DQRA 5K1YA 3VEPA 2OD5A 5L3EA 2E7XA 4HQEA 3HTSB 2OAZA 3WTYC 2D45A 1XDSA 2RDPA 1SAXA 2DW4A 4ENNA 2K7LA 3RYRA 2EJRA 4RAZA 4EMSA 1MGTA 2DO7A 2RC4A 2H6BA 4IJAA 2GAUA 3GVAA 2RKHA 3L09A 1W4MA 2KKOA 2Q8KA 3ZN1A 3ECOA 3MZHA 4WWCA 2EA2A 1Z6TA 3M8FA 2GQQA 1O57A 1XMAA 2DI3A 3IC7A 4M6YA 5DEQA 1Z6RA 1BN5A 2IA0A 3CLOA 1R23A 3K1MA 1ZG5A 2IPQX 4LK1F 2YX7A 3V7SA 5D4RA 4YIIA 2QUFA 3E5XA 2EV0A 4Y13A 2D2WA 4HQMA 2AS5F 3GZ5A 5D4SA 3IL2A 4HBLA 1TNSA 4RGSA 4HX4A 3L2CA 2HQRA 1PP7U 3F6VA 2LF7A 3E5QA 4BQAA 2K4BA 2F2EA 2PMUA 5F1RA 4EJTA 4UUVA 3LA3A 4G94A 1QZZA 1R1TA 2Z33A 2ZNYA 3J81K 2V1DA 3D0SA 2LSOA 1R1UA 4FX4A 4GXOA 4PGGA 3ELKA 2XRNA 4LGWA 3FZVA 1YFHA 4HLXA 2HGCA 3COAC 1OR7A 4L5IA 1FOKA 1KGSA 3R4KA 1GHCA 2OU2A 1FPQA 1R36A 3PQJA 2FBKA 5D6FA 2VE9A 3BY6A 3P7NA 4RGRA 1T0FA 4A6EA 2OBPA 3K0LA 1FP2A 1BM9A 2EB7A 4BHCA 2PN6A 3RI4A 3U9GA 1PP8F 2L3DA 2VBYA 1LQ1A 4YIFA 4IRHA 4Y15A 1HKQA 1ZG3A 3Q9SA 2HKXA 5IT9Z 2GZWA 3MWMA 2IVMA 1P92A 2NAZA 4YFKF 4UVBA 3RKYA 3KFWX 3F8CA 2W25A 3WE3A 2K86A 1LDKB 1SMYF 4ESJA 5BPIA 1W7PA 2D1HA 3EDPA 4I01A 2V79A 1MDMB 2G7HA 3LSTA 4U0VA 1K78B 1NHAA 5DDGA 3EYYA 3NRVA 5LGTA 4HV6A 1ON1A 5JI6A 5ILUA 1ZHFA 2FU4A 4UNOA 1EV7A 2BBYA 2XROA 2EFNA 3TKYA 2O03A 3GWZA 2QM3A 1FBSA 3O6BB 4LB5A 3OOPA 3QPTA 5BS6A 4DQ2A 3KP2A 4OINF 4G7HF 4RAYA 3ERED 2VE8A 3W6JB 2YPRA 2QQAA 5DUIA 4LG0A 2LNBA 5EEGA 2P7CB 3F23A 2ZKZA 2IJLA 4U0YA 1MKMA 3P9KA 3D5LA 1L0OC 3V7RA 3HRSA 3U2RA 4B09A 1J9IA 2WV0A 3WU1B 4ENKA 4HYEA 4XLPF 2H27A 2O3FA 4NHJA 5E1WA 5E17F 4M9SA 2V1XA 1U6GA 4LLNA 1BC8C 1SFXA 4PCQA 3BOQA 3SFZA 4HF1A 2VT2A 1U8RA 5HS8A 4I02A 4HLYA 1BBYA 3HRTA 4ENMA 3RKWA 5LRRA 5HLHA 5BPDA 3RDIA 1T98A 4AIKA 2UXNA 4FX0A 1S8NA 2JT1A 4DNCA 4KA4A 3R0AA 1R1VA 2XASA 4HF0A 2STTA 3GFLA 4MEYF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOY A;  3R0J A;  4PZJ A;  3FWE A;  1XCB A;  1IZ1 A;  3KP3 A;  3GZ6 A;  5EEH A;  2F5E A;  3F8B A;  2M30 A;  2L4A A;  1SD5 A;  3O2P E;  4L9T A;  2HTS A;  2MLK A;  3WTV C;  4ESB A;  5F6F A;  1E2X A;  3CO7 C;  4XBF A;  2UZK A;  1W5T A;  4MHG A;  1QO0 D;  4XSX F;  4L9V A;  3H3U A;  5LEJ A;  2CO5 A;  3LFK A;  2NYX A;  4OMZ A;  4HX8 A;  5ERI A;  5E8G A;  3FMQ A;  5DD4 A;  3LA7 A;  5H20 A;  2JPB A;  3BZ6 A;  2F5D A;  3HUG A;  2PFB A;  3IRQ A;  4WXH A;  3E3V A;  2Z3Y A;  4BHB A;  4A0Z A;  2STW A;  5ICE A;  1DP7 P;  5IT3 A;  1OKR A;  3TQN A;  2GA1 A;  2HR3 A;  2HOE A;  3BP8 A;  2FNA A;  2LKP A;  1J75 A;  1KQ8 A;  4WXD A;  3TOB A;  1HSJ A;  4K2E A;  3C18 A;  1OPC A;  3FXU A;  3WTU C;  4EJW A;  1ZN2 A;  1TQP A;  3W6K B;  5FLX Z;  4IF4 A;  2A68 F;  3V8J A;  4RB3 C;  4BXU A;  3GO5 A;  3SZP A;  3HRU A;  4A6D A;  1GVJ A;  2Y75 A;  1RUN A;  3HIF A;  2VBW A;  1YW7 A;  2HFH A;  2MA3 A;  2X4H A;  4I2O A;  3ZMS A;  2FBH A;  5DCM A;  1KU2 A;  1IN5 A;  5ILS A;  1E17 A;  2QQ9 A;  3FF5 A;  5ILV A;  2GIV A;  2CYY A;  5TJJ A;  2YSR A;  4UV9 A;  4I7H A;  1T38 A;  2G9W A;  4MQ9 F;  3I59 B;  4M6X A;  4S04 A;  2VC0 A;  1HW1 A;  4M74 A;  4E70 A;  1ULY A;  2C6Y A;  2W57 A;  2HKO A;  3P9C A;  3ZMV A;  1SD7 A;  1TQM A;  2CQK A;  1O3R A;  5LHI A;  3DP7 A;  1RI7 A;  2L54 A;  1R00 A;  5AIQ A;  4Q4Z F;  2KRF A;  3FXQ A;  1ONV A;  4XSZ F;  2L4M A;  5D5U B;  1ZGJ A;  1S6L A;  3R6S A;  4MTE A;  4RB2 C;  1S7A A;  4MTD A;  1B4A A;  1R22 A;  2ETH A;  1U78 A;  2P6T A;  3K69 A;  3DFG A;  5A2Q Z;  3BWG A;  2D1V A;  1RNL A;  2QQB A;  2ZFW A;  4CGZ A;  5FB2 A;  2EV5 A;  3R60 A;  2H09 A;  4IPA A;  3V8L A;  4EV0 A;  4CIC A;  3F8N A;  1KYZ A;  2O0Y A;  3KLO A;  3VB2 A;  2M87 A;  3TGN A;  3ZQ7 A;  1Y0U A;  3WU0 A;  1B59 A;  1O3S A;  1IN4 A;  3FMR A;  5HLG A;  5BMZ A;  3QOP A;  3E6D A;  2ISZ A;  3T1B A;  2PI0 A;  3FM3 A;  1V3F A;  4O3M A;  3EUH A;  1WSU A;  4A0Y A;  4MGR A;  5K5Q A;  2W85 A;  1EH8 A;  2XAQ A;  4EGZ A;  3EET A;  3JAM K;  4U88 A;  1ZLJ A;  3F21 A;  2IT0 A;  4A5N A;  5K5O A;  4UXN A;  5FFX A;  3KE2 A;  3ABT A;  3DPT A;  4O6J A;  3HRM A;  1ZLK A;  4I0A A;  3DQV C;  3V8K A;  1W7P B;  3JTG A;  1Z1D A;  3GFM A;  4KMF A;  2MBF A;  4L0Z B;  3LAJ A;  3ZN0 A;  1G3S A;  3J80 Z;  4HV5 A;  4KNY A;  1O7L A;  4R1H A;  4L5J A;  3I59 A;  1B1B A;  1C0W A;  3CUO A;  2YR2 A;  1Z91 A;  4LG0 B;  2UWM A;  5ICG A;  1J2X A;  4KYW A;  3QPH A;  2MD5 A;  4IVN A;  4I0B A;  5K5R A;  3I64 A;  2J5P A;  3DF8 A;  1QGP A;  3TDU C;  2VXZ A;  3F72 A;  3QP5 A;  4IXA A;  4JK1 X;  4HA8 A;  1HST A;  2A5Y B;  4QWQ A;  3H3Z A;  2RVC A;  4CDG A;  1O3T A;  1QPM A;  3BPX A;  1FBU A;  1FC3 A;  4A5M A;  5KVR A;  2P5V A;  2VOD A;  3WTZ A;  1H0M A;  1IRF A;  3F6O A;  2XHK A;  4AIH A;  3TOA A;  2AXL A;  1P4A A;  5HDK A;  2PBI A;  1KU9 A;  2GXG A;  3KET A;  1DPR A;  2FQ3 A;  3RPU A;  4MQV A;  5HLI A;  5D5V B;  5D5W B;  2FF4 A;  1IN6 A;  2PQ8 A;  3JW4 A;  4HOB A;  3WE2 A;  1ZRC A;  1XN7 A;  2H6C A;  3WG9 A;  3WGI A;  4NQW A;  4GYG A;  1REP C;  5E1Z B;  1F4K A;  1FP1 D;  5H6Q A;  1S3J A;  4FT8 A;  1D8J A;  3BJA A;  3C3W A;  4ZYG A;  3I58 A;  5BOX A;  3T8T A;  2V9V A;  4PGH A;  3JTH A;  4R79 A;  3V4G A;  4N9I A;  1W5S A;  2DFI A;  1T6S A;  2EFP A;  2FMY A;  1OYW A;  1W7P D;  4G6Q A;  4ZH4 F;  1IAW A;  3MQ0 A;  2L02 A;  3J7A O;  3SHF A;  2R3S A;  4LD5 A;  3WTT C;  5AON A;  1G6N A;  1P2F A;  5L3G A;  1TW3 A;  1XGN A;  1BI0 A;  2Q0O A;  4FHT A;  1OMI A;  1UST A;  2KJB A;  4L9N A;  1UHM A;  2CG4 A;  3F8M A;  2ESN A;  5D5X B;  1YYV A;  3CDH A;  3PQK A;  2K27 A;  2BEO A;  2XKO A;  4KIC A;  2VC1 A;  3RPQ A;  2ZME A;  4KMU X;  1ZH5 A;  3H92 A;  2DK5 A;  3G3Z A;  5E20 A;  1R7J A;  4UV8 A;  3SXY A;  3T0Y A;  4XRF A;  1UFM A;  1FWZ A;  2M45 A;  5H6R A;  5KK1 A;  4EJV A;  1JHH A;  2ZCW A;  5DCM B;  2M5W A;  3GYH X;  1A04 A;  2EA4 A;  3MCZ A;  1DDN A;  3K9T A;  2Q2E A;  1G3Y A;  2KIM A;  3F3X A;  2HS5 A;  3FXR A;  4Z2Y A;  3E5U A;  1BIA A;  5FLX K;  6PAX A;  1ZYR F;  1IW7 F;  3M9A A;  1R58 A;  3J81 Z;  1SMT A;  4UVA A;  5J8F A;  1BJA A;  4GCV A;  1TNT A;  5JHU A;  2LDU A;  4MNU A;  4I09 A;  1Z05 A;  5LHG A;  2CFX A;  3KP7 A;  3WGG A;  1FSH A;  2CWE A;  3QAH A;  2OQG A;  1IN8 A;  4IHS A;  4M9Z A;  3RKX A;  2WWY A;  3HSF A;  3T8R A;  2DQL A;  1MZB A;  2ISY A;  1FLI A;  4KUM A;  1J7K A;  5LRS A;  5D8K B;  2V6C A;  4B8X A;  3ISP A;  3HHH A;  2XKP A;  2XVC A;  5L3C A;  4GGG A;  3B02 A;  1LDD A;  5HDN A;  3ZMD A;  5F64 A;  1DUX C;  1I6X A;  4WK8 F;  1LEA A;  2IRF G;  4M72 A;  4L0Y B;  3I0T A;  2IW5 A;  1YLF A;  5E8I A;  1U5T C;  3KEO A;  2DLL A;  5A2Q K;  1MJB A;  2HZT A;  4Y17 A;  1WQ2 A;  1F9N A;  4P5O A;  3I5U A;  2QLZ A;  3KZZ A;  2M8E A;  1LJ9 A;  3KCC A;  4CYD A;  5TRD A;  2F5F A;  2EFQ A;  1IF1 A;  3WGH A;  4WX9 A;  2RQP A;  3DEU A;  1XGS A;  3HHG A;  4ZYH A;  2A61 A;  3ZPL A;  4KT5 C;  5JR3 A;  3ML6 A;  3MEX A;  4IHT A;  2XV4 S;  2JZY A;  3BRO A;  1D5V A;  3M1E A;  3REO A;  1FYM A;  1FSE A;  1TBX A;  1XDU A;  4MEX F;  1ZRE A;  3G73 A;  1O7F A;  1HW5 A;  4D0P A;  3ZMZ A;  4WXC A;  2OQR A;  2L01 A;  5HS9 A;  3GLX A;  4OU0 A;  1PUE E;  4ZYD A;  5DD8 A;  4EJU A;  2K4J A;  1SFU A;  4IRI A;  4CXF A;  2QVO A;  4KIG A;  4R8H A;  2WC2 A;  1OYI A;  3GEZ A;  2A07 F;  1BIB A;  1ZAO A;  3CUQ C;  2Y0M A;  2NNY A;  3J80 K;  1F5T A;  1FYL A;  5JFR A;  1RIO H;  1B9M A;  1B9N A;  1USS A;  1S29 A;  3CUQ B;  1HQC A;  2Z5U A;  5ED4 A;  5DCF A;  2HTJ A;  2O8X A;  1WRJ A;  2RV8 A;  3KEQ A;  1YS7 A;  3TO6 A;  1RUO A;  4EM0 B;  5CJ9 A;  5D8L B;  3QP6 A;  3KP5 A;  1I27 A;  3JSO A;  5ICF A;  1G3T A;  3GW2 A;  4CZZ A;  4H0E A;  4RGX A;  4A2U A;  2WTE A;  4JBA A;  1P6R A;  2OA4 A;  4LMY A;  2LF8 A;  4G7O F;  5JVT A;  5E18 F;  3HOT A;  2QBY A;  1YS6 A;  2DTR A;  1GXQ A;  4P55 A;  4OIR F;  4P96 A;  2XAJ A;  1KQ0 A;  4BHP A;  4G9Y A;  2ZO4 A;  3KP4 A;  3GFI A;  2FNP A;  1XD7 A;  3ZMU A;  1U5T A;  4PDK A;  5LHH A;  2FML A;  3WTS C;  4LLG F;  4OIQ F;  4BH9 A;  2A69 F;  1WWX A;  1SD6 A;  1SD4 A;  2F5C A;  2MH9 A;  4BYY A;  5LLQ A;  5L3D A;  4UHT A;  1DPU A;  1TQI A;  1XGO A;  5CVV A;  2FRH A;  2DBB A;  2M1B A;  1Z9C A;  4NB5 A;  1FZP B;  1XGM A;  2P6S A;  3SQN A;  3GX4 X;  4HZF A;  1Q1H A;  1LEB A;  4HF2 A;  4G8X A;  4CHU A;  2GWR A;  3RYP A;  1ZAR A;  4L9J A;  2XUB A;  5BQT A;  4GO1 A;  3TO7 A;  3NEU A;  1LB2 A;  1V4R A;  2FBI A;  3V7C A;  2TDX A;  4LFU A;  4LB6 B;  2PJP A;  4KIB A;  2XIG A;  2ZNZ A;  5IT9 K;  2BGC A;  2ZME B;  2A6E F;  5FO5 A;  1KU7 A;  2ADU A;  4XLN F;  2GXB A;  2DU9 A;  4YFN F;  4HX7 A;  3OV8 A;  2XAH A;  4I98 B;  2FA5 A;  3TO9 A;  3ZMT A;  2P5L C;  4EM1 A;  2JSC A;  4KDP A;  3CTA A;  2CSO A;  2NRA C;  2QEN A;  2PG4 A;  2IP2 A;  4ASN A;  4HDU A;  3Q5F A;  3CUQ A;  1XSX A;  2J5O A;  2DPD A;  1J0R A;  1BOA A;  3AAF A;  1T2K A;  1CF7 A;  2JRT A;  1EH6 A;  4AWX B;  2ZXJ A;  2HYG D;  4JQF A;  3HOS A;  2A3S A;  4LK0 F;  3P9I A;  1KYW A;  1T39 A;  1QBJ A;  2PEX A;  3BJ6 A;  5D6E A;  1I5Z A;  3KP6 A;  4OOI A;  2HQN A;  3LA2 A;  5LGN A;  1SFE A;  4BAY A;  3JAM Z;  5HDG A;  5CVU A;  2K02 A;  4RB0 A;  2P7V B;  4QLC U;  3LWF A;  4KN4 X;  2OZU A;  1IXC A;  1XMK A;  4RGU A;  1LDJ A;  5FD5 A;  3LAP A;  2PMH A;  4U0W A;  1GXP A;  4N0B A;  2P4W A;  2DPU A;  1JE8 A;  2XAF A;  2X0L A;  2RN7 A;  1D3Y A;  1IXR C;  5J8C A;  1FNN A;  1R5H A;  2HWV A;  3L00 A;  4M9X A;  3FM5 A;  2OZ6 A;  4A12 A;  3SZT A;  3F8F A;  3HYI A;  2KJC A;  1LVA A;  5FGM A;  1MJA A;  5CVJ A;  1YIO A;  3E6M A;  5LBQ A;  3R61 A;  1R5G A;  2Y48 A;  1HW2 A;  3M8E A;  1YW8 A;  2HYF A;  3I4P A;  3PFI A;  4BNC A;  4Q47 A;  3KLN A;  1HKS A;  4Q48 A;  3IKV A;  1B6A A;  1H9T A;  2G7U A;  2Z9O A;  4O5V A;  2W24 A;  1PDN C;  1MJ9 A;  1P4W A;  4KN7 X;  5E1X A;  2O61 A;  1ZGA A;  1TW2 A;  2RNJ A;  4OIO F;  4S05 A;  2E1N A;  1FYK A;  1I1S A;  2ESH A;  5DV5 A;  1YTY A;  2H94 A;  2VN2 A;  1K7A A;  2ACJ A;  1WKM A;  5LEK A;  2FE3 A;  2B0L A;  2A6H F;  4G7Z F;  1BI1 A;  4U7B A;  3LQQ A;  1HKT A;  4LLL A;  2BV6 A;  1ON2 A;  3K1P A;  3S2W A;  2DK8 A;  1IUY A;  4A0X A;  5FD6 A;  2CW0 F;  4OMY A;  2P8T A;  4UVC A;  3BDD A;  1FBQ A;  3HSE A;  1O3Q A;  4EVI A;  1S7O A;  1WI9 A;  3L9F A;  2ZBK A;  3KZY A;  4KIF A;  1KA8 A;  4M71 A;  3CJN A;  4EM2 A;  2VBX A;  1UCR A;  1OYY A;  4HAM A;  3FHZ A;  2O6G E;  3U1D A;  1TLH B;  5DYM A;  1UHW A;  1YG2 A;  3IRR A;  4EJO A;  1XB4 A;  1U3E M;  2EK5 A;  4Q5S F;  1Z7U A;  3HTU A;  1LNW A;  2P5K A;  1FT9 A;  2R7F A;  3GXO A;  2QBY B;  3E97 A;  4ESF A;  3DXJ F;  3C7J A;  1D8K A;  3VOD A;  3CO6 C;  3C1D A;  1STZ A;  4KFC A;  1U5T B;  3N4M A;  1IRG A;  5FFZ A;  3BJO A;  1J5Y A;  1BC7 C;  1I1G A;  2BE5 F;  3IWF A;  5CLS A;  1X3U A;  3K1N A;  3F22 A;  2MLG A;  2VT3 A;  4YFX F;  3T5X A;  2KIU A;  5J6X A;  1MDM A;  3WTX C;  1K78 A;  2VOO A;  5L3B A;  1XCV A;  3I54 A;  2PLY A;  1HBX G;  3IKT A;  3B73 A;  2EV6 A;  1IN7 A;  4TV7 A;  2ELH A;  4YG2 F;  1L3L A;  3NQO A;  3RJP A;  3VOE A;  3ULQ B;  4ETS A;  3WOD F;  2IA1 A;  5CYV A;  2VOP A;  1ODD A;  4EQQ A;  3E6B A;  1U2W A;  3ECH A;  3L7W A;  3MZY A;  4OIP F;  2VBZ A;  2XGX A;  2E1C A;  1TTY A;  4P9U A;  2DT5 A;  2COM A;  4M73 A;  2DAO A;  3I71 A;  3RIR A;  2BYV E;  1H9G A;  3MAJ A;  2XAG A;  3N97 A;  5HOO A;  3BPV A;  2EFW A;  2FOK A;  2W84 A;  4IRG A;  5CVI A;  5CVR A;  1BI2 A;  1YW9 A;  2EWN A;  2R7D A;  4N9H A;  1BI3 A;  4HDV A;  2JTV A;  3DV8 A;  2JPC A;  3DPL C;  1YQA A;  1QNT A;  3TDZ C;  4EGY A;  5DUK A;  2Z99 A;  3K2Z A;  3Q9V A;  5AIP A;  3DKW A;  1IXS B;  1EH7 A;  3HSR A;  3JSP A;  3ABU A;  1ZG1 A;  2UXX A;  4GYI A;  1CF7 B;  1YO5 C;  1ZRF A;  3IWZ A;  4ZYE A;  3GF2 A;  2RGV A;  2FSW A;  4L18 B;  1F1Z A;  1G4D A;  3M7G A;  3E6C C;  2EFO A;  1P4X A;  4LJZ F;  3WTW C;  4G6D A;  5HVQ C;  4RB1 A;  3O3K A;  2YU3 A;  4ENJ A;  1K6O A;  3GFJ A;  2FEZ A;  4AIJ A;  5HS7 A;  1J59 A;  1ZRD A;  1JHF A;  1RZ4 A;  1KU3 A;  3FMS A;  2NNN A;  3MFK A;  1K79 A;  4U7D A;  1FY7 A;  2QYO A;  4WCG A;  4F7Z A;  4ZZD A;  2IA2 A;  2QWW A;  3LQR A;  2HDC A;  2VON A;  1JXS A;  4ON0 A;  2ZJ2 A;  1G3W A;  2KIF A;  1MD0 A;  1JGS A;  4P9F A;  1VTN C;  3I53 A;  4AVP A;  3VFZ A;  2CGP A;  3EYI A;  2FXA A;  4AD9 A;  2QZ8 A;  3ROU A;  4ZZL A;  5L3F A;  2V1U A;  4RS8 A;  2E7W A;  1FX7 A;  1QZY A;  2MH2 A;  3IHU A;  4CO8 A;  4WF2 A;  3RTR A;  2NS0 A;  3QRF F;  2YX4 A;  3GUD A;  1CGP A;  2GA2 A;  1UB9 A;  3EQL F;  1KQ9 A;  1QQI A;  1XSV A;  4HW0 A;  5ICC A;  1HXD A;  3FX3 A;  3ZP5 A;  1XSD A;  2HEO A;  2MC3 A;  3QU3 A;  5LGU A;  1AWC A;  3QU6 A;  2DQR A;  5K1Y A;  3VEP A;  2OD5 A;  5L3E A;  2E7X A;  4HQE A;  3HTS B;  2OAZ A;  3WTY C;  2D45 A;  1XDS A;  2RDP A;  1SAX A;  2DW4 A;  4ENN A;  2K7L A;  3RYR A;  2EJR A;  4RAZ A;  4EMS A;  1MGT A;  2DO7 A;  2RC4 A;  2H6B A;  4IJA A;  2GAU A;  3GVA A;  2RKH A;  3L09 A;  1W4M A;  2KKO A;  2Q8K A;  3ZN1 A;  3ECO A;  3MZH A;  4WWC A;  2EA2 A;  1Z6T A;  3M8F A;  2GQQ A;  1O57 A;  1XMA A;  2DI3 A;  3IC7 A;  4M6Y A;  5DEQ A;  1Z6R A;  1BN5 A;  2IA0 A;  3CLO A;  1R23 A;  3K1M A;  1ZG5 A;  2IPQ X;  4LK1 F;  2YX7 A;  3V7S A;  5D4R A;  4YII A;  2QUF A;  3E5X A;  2EV0 A;  4Y13 A;  2D2W A;  4HQM A;  2AS5 F;  3GZ5 A;  5D4S A;  3IL2 A;  4HBL A;  1TNS A;  4RGS A;  4HX4 A;  3L2C A;  2HQR A;  1PP7 U;  3F6V A;  2LF7 A;  3E5Q A;  4BQA A;  2K4B A;  2F2E A;  2PMU A;  5F1R A;  4EJT A;  4UUV A;  3LA3 A;  4G94 A;  1QZZ A;  1R1T A;  2Z33 A;  2ZNY A;  3J81 K;  2V1D A;  3D0S A;  2LSO A;  1R1U A;  4FX4 A;  4GXO A;  4PGG A;  3ELK A;  2XRN A;  4LGW A;  3FZV A;  1YFH A;  4HLX A;  2HGC A;  3COA C;  1OR7 A;  4L5I A;  1FOK A;  1KGS A;  3R4K A;  1GHC A;  2OU2 A;  1FPQ A;  1R36 A;  3PQJ A;  2FBK A;  5D6F A;  2VE9 A;  3BY6 A;  3P7N A;  4RGR A;  1T0F A;  4A6E A;  2OBP A;  3K0L A;  1FP2 A;  1BM9 A;  2EB7 A;  4BHC A;  2PN6 A;  3RI4 A;  3U9G A;  1PP8 F;  2L3D A;  2VBY A;  1LQ1 A;  4YIF A;  4IRH A;  4Y15 A;  1HKQ A;  1ZG3 A;  3Q9S A;  2HKX A;  5IT9 Z;  2GZW A;  3MWM A;  2IVM A;  1P92 A;  2NAZ A;  4YFK F;  4UVB A;  3RKY A;  3KFW X;  3F8C A;  2W25 A;  3WE3 A;  2K86 A;  1LDK B;  1SMY F;  4ESJ A;  5BPI A;  1W7P A;  2D1H A;  3EDP A;  4I01 A;  2V79 A;  1MDM B;  2G7H A;  3LST A;  4U0V A;  1K78 B;  1NHA A;  5DDG A;  3EYY A;  3NRV A;  5LGT A;  4HV6 A;  1ON1 A;  5JI6 A;  5ILU A;  1ZHF A;  2FU4 A;  4UNO A;  1EV7 A;  2BBY A;  2XRO A;  2EFN A;  3TKY A;  2O03 A;  3GWZ A;  2QM3 A;  1FBS A;  3O6B B;  4LB5 A;  3OOP A;  3QPT A;  5BS6 A;  4DQ2 A;  3KP2 A;  4OIN F;  4G7H F;  4RAY A;  3ERE D;  2VE8 A;  3W6J B;  2YPR A;  2QQA A;  5DUI A;  4LG0 A;  2LNB A;  5EEG A;  2P7C B;  3F23 A;  2ZKZ A;  2IJL A;  4U0Y A;  1MKM A;  3P9K A;  3D5L A;  1L0O C;  3V7R A;  3HRS A;  3U2R A;  4B09 A;  1J9I A;  2WV0 A;  3WU1 B;  4ENK A;  4HYE A;  4XLP F;  2H27 A;  2O3F A;  4NHJ A;  5E1W A;  5E17 F;  4M9S A;  2V1X A;  1U6G A;  4LLN A;  1BC8 C;  1SFX A;  4PCQ A;  3BOQ A;  3SFZ A;  4HF1 A;  2VT2 A;  1U8R A;  5HS8 A;  4I02 A;  4HLY A;  1BBY A;  3HRT A;  4ENM A;  3RKW A;  5LRR A;  5HLH A;  5BPD A;  3RDI A;  1T98 A;  4AIK A;  2UXN A;  4FX0 A;  1S8N A;  2JT1 A;  4DNC A;  4KA4 A;  3R0A A;  1R1V A;  2XAS A;  4HF0 A;  2STT A;  3GFL A;  4MEY F; 
#chains in the Genus database with same CATH topology
 2MYS A;  1AOY A;  2HQ5 A;  2WBM A;  1VQM I;  4HEA 2;  3R0J A;  4PZJ A;  2BHZ A;  1XCB A;  3FWE A;  1IZ1 A;  3KP3 A;  4CA0 A;  1N25 A;  2E35 A;  4IEJ A;  4XLA A;  3GZ6 A;  1ORK A;  2M3A A;  3HJE A;  2HXO A;  4A3J J;  3PFY A;  5EEH A;  2F5E A;  3F8B A;  2M30 A;  4XLF A;  4FCY A;  2L4A A;  4CCL A;  1SD5 A;  3O2P E;  3Q0U A;  4L9T A;  2IEK A;  1LPQ A;  2CW8 A;  2HTS A;  2MLK A;  3WTV C;  3Q3S A;  4ESB A;  5F6F A;  1S5L C;  4AYB N;  3W6V A;  4HNV A;  1E2X A;  3CO7 C;  4XBF A;  2UZK A;  1W5T A;  1QVT A;  4MHG A;  3WHC A;  1QO0 D;  2KIQ A;  3EUH C;  4XSX F;  2CUZ A;  2V9K A;  4L9V A;  3H3U A;  5LEJ A;  4CYC B;  2CO5 A;  4NC7 A;  3LFK A;  4PFP A;  3AG2 H;  4AYB A;  4FE4 A;  2HOS A;  4ZYA A;  2NYX A;  4XQF A;  4OMZ A;  1APL C;  5IP6 A;  3OIQ A;  4HX8 A;  5ERI A;  4HPQ A;  5E8G A;  1XPX A;  3BR5 A;  2NS7 A;  1I3Q J;  3FMQ A;  2IGN A;  1HA8 A;  5DD4 A;  3LA7 A;  5H20 A;  5FRN A;  2OJE D;  3GME A;  1W5C C;  2JPB A;  3BZ6 A;  2F5D A;  3ABK H;  3HUG A;  2PFB A;  3SDG A;  2F48 A;  3IRQ A;  2X1E A;  3E3V A;  4WXH A;  4ANJ A;  2L2O A;  2Z3Y A;  4BHB A;  4A0Z A;  2IS2 A;  2STW A;  2JWT A;  4DGW B;  5ICE A;  1DP7 P;  5IT3 A;  3FK6 A;  4C2T A;  5GP9 A;  2O5R A;  1OKR A;  3TQN A;  2GA1 A;  2HR3 A;  3LNQ A;  3SZG A;  2HOE A;  4J19 A;  3PSI A;  4M3F A;  1R71 A;  3BP8 A;  3PJR A;  4M6V A;  4YEL A;  2FNA A;  2LKP A;  4MO7 A;  1J75 A;  1KQ8 A;  3M3Y J;  1D1B A;  3OIO A;  4WXD A;  3TOB A;  4B4C A;  1HSJ A;  1YJW I;  1Z7L A;  2BY3 A;  4K2E A;  3C18 A;  2E19 A;  1OPC A;  3BG9 A;  1R4M B;  3FXU A;  3WTU C;  2VB6 A;  4EJW A;  2F5V A;  1ZN2 A;  3CJQ B;  1TQP A;  3K4K A;  3W6K B;  3O8G A;  1JI8 A;  1HOM A;  5FLX Z;  4MFE A;  3H9G A;  4IF4 A;  2R7X A;  2A68 F;  3V8J A;  4RB3 C;  4RLF A;  3GO5 A;  2BXZ A;  4BXU A;  4IQ4 A;  3SZP A;  2JSP A;  3HRU A;  4A6D A;  1GVJ A;  2Y75 A;  3HM5 A;  1RUN A;  3HIF A;  2VBW A;  1YW7 A;  3VWB A;  2HFH A;  1Z3Y A;  2MA3 A;  2E1M B;  2X4H A;  3CMA I;  2R7T A;  4I2O A;  3ZMS A;  4MLO A;  2B9S A;  2M34 A;  2PMZ N;  2FBH A;  5DCM A;  1KU2 A;  2L7M P;  3QOD A;  1IN5 A;  3TMO A;  5ILS A;  1E17 A;  2QQ9 A;  3FF5 A;  5ILV A;  1T8I A;  1OLT A;  1WH7 A;  4IX7 A;  3K7A J;  2GIV A;  2DDB A;  2CW7 A;  2CYY A;  1X1B A;  5TJJ A;  2YSR A;  1RKW A;  4UV9 A;  4I7H A;  3ONQ A;  1T38 A;  2G9W A;  4XKW A;  3N05 A;  2R7O A;  3DTI A;  4MQ9 F;  2PMZ A;  3I59 B;  4M6X A;  3DTK A;  4S04 A;  2QCO A;  2VC0 A;  3LOC A;  1HW1 A;  4M74 A;  1S9H A;  4E70 A;  1ULY A;  3MKW B;  2C6Y A;  2W57 A;  2XGC A;  2HKO A;  1YIT I;  3P9C A;  3ZMV A;  1E3P A;  1SD7 A;  1TQM A;  2CQK A;  2I10 A;  5LHI A;  1O3R A;  1BJZ A;  4EAT A;  2X6W A;  3DP7 A;  2V9P A;  3M1C A;  4CCN A;  5KNL A;  3OYN A;  2VKV A;  1RI7 A;  2L54 A;  3FKJ A;  1EA3 A;  1R00 A;  5AIQ A;  4Q4Z F;  1Z0X A;  2KRF A;  3JRB A;  3H0G J;  3TL4 X;  2VJ4 A;  4KIT B;  3FXQ A;  3O8H A;  1ONV A;  4XSZ F;  2AHQ A;  4XK4 A;  2ZJR F;  2L4M A;  5GTI C;  5D5U B;  3IP4 B;  1ZGJ A;  4BEH A;  1S6L A;  2KLO A;  1VND A;  3OR1 C;  3R6S A;  4MTE A;  4GRI A;  2CFO A;  3CZ6 A;  2ZJP F;  4RB2 C;  1S7A A;  2K3F A;  4MTD A;  5M5Y J;  1B4A A;  1R22 A;  5M3M J;  2JVG A;  2ETH A;  1U78 A;  1MMG A;  2P6T A;  3D5R C;  1ZQ3 P;  1LFB A;  3K69 A;  3OSF A;  3TED A;  1FIA A;  2MW8 A;  3DFG A;  5A2Q Z;  2XRL A;  3BWG A;  3OYC A;  5DM6 F;  2D1V A;  2VXD A;  2ZSI B;  4C3J J;  1RNL A;  2QQB A;  3BCA A;  2ZFW A;  4CGZ A;  5FB2 A;  2EV5 A;  3LSM A;  3R60 A;  4C3I J;  2H09 A;  4IPA A;  1FTZ A;  1W36 D;  4XLH A;  3V8L A;  1RC9 A;  4M3E A;  4EV0 A;  4CIC A;  1BW5 A;  4U87 A;  3F8N A;  1KYZ A;  2FD5 A;  2O0Y A;  3KLO A;  3VB2 A;  2M87 A;  3TGN A;  3MZ8 A;  1Y0U A;  3ZQ7 A;  2DN0 A;  2K9L A;  1O4X A;  1X3Z B;  3K6G A;  5EDN A;  3WU0 A;  1MMS A;  1B59 A;  1FEX A;  1O3S A;  1IN4 A;  3FMR A;  3LMM A;  5HLG A;  5BMZ A;  1IRX A;  3CCJ I;  3QOP A;  3E6D A;  2ECB A;  2ISZ A;  3T1B A;  4IOC F;  4XN3 A;  2PI0 A;  3FM3 A;  2PX9 A;  4IZZ A;  1V3F A;  2Y2Z A;  4O3M A;  2Y31 A;  2LBF A;  3OYD A;  3EUH A;  1WSU A;  2DOF A;  4A0Y A;  4MGR A;  4IOA F;  5K5Q A;  3OYM A;  1ETK A;  2DT6 A;  2W85 A;  3ZR8 X;  1EH8 A;  3GBG A;  2R5Z A;  2XAQ A;  5DS9 A;  4EGZ A;  3EET A;  3K4C A;  4AM3 A;  1D1C A;  2F6C A;  1YIJ I;  4F52 A;  3JAM K;  2CV0 A;  4U88 A;  1ZLJ A;  3F21 A;  2IT0 A;  2BW3 B;  2W7N A;  4A5N A;  5K5O A;  3DEE A;  4UXN A;  5FFX A;  3KE2 A;  1MMD A;  4IQJ A;  4XN0 A;  2WAF A;  3ABT A;  3BR3 A;  1RR7 A;  3DPT A;  4O6J A;  3BLY A;  4B48 A;  1ZTR A;  4F3Q A;  2VAS A;  3CD6 I;  2KDO A;  1X4O A;  1AHD P;  3RSN A;  3HRM A;  2VJJ A;  2EIN H;  2DT7 B;  1JKQ C;  1ZLK A;  5LD2 C;  4DIQ A;  3OMY A;  1K4T A;  2E5N A;  3B6A A;  2OTL I;  4I0A A;  3DQV C;  1U0J A;  3ZQI A;  3J7Z I;  3A01 B;  3FXM A;  3V8K A;  1W7P B;  3GTJ J;  5K7F A;  1GV2 A;  1K6Y A;  3JTG A;  4GFB A;  3DCF A;  4XKB A;  1IC8 A;  1SC7 A;  3KZI C;  1Z1D A;  3GFM A;  2TCT A;  1HF0 A;  2HQA A;  3NAU A;  4KMF A;  2KZV A;  3ERM A;  2MBF A;  4L0Z B;  3LAJ A;  3ZN0 A;  2RRE A;  1G3S A;  3J80 Z;  1H89 C;  4BQO A;  4HV5 A;  4A93 J;  2ZME C;  4KNY A;  1O7L A;  3CP2 A;  2PJR A;  4ZDL A;  3L2Q A;  3CCS I;  3AFH A;  3HOW J;  2LK2 A;  4R1H A;  4L5J A;  4BDZ A;  1B72 B;  3I59 A;  3OS1 A;  1B1B A;  5IPA A;  1E3O C;  4F55 A;  5J1U A;  1PUF A;  2E71 A;  1C0W A;  3CUO A;  3AL0 C;  1GLN A;  2YR2 A;  4CUG A;  1Z91 A;  2VI6 A;  4LG0 B;  5JHF A;  2LR8 A;  2UWM A;  5ICG A;  1J2X A;  1ETV A;  1TL8 A;  2CV2 A;  2AO9 A;  1SVO A;  4B47 A;  4KYW A;  3QPH A;  2MD5 A;  4IVN A;  4I0B A;  4BY1 J;  5K5R A;  3I64 A;  1I50 J;  2J5P A;  2VQC A;  3DF8 A;  1QGP A;  3TDU C;  4IO9 F;  2VXZ A;  2Q1Z B;  3F72 A;  3QP5 A;  4IXA A;  5FKM A;  4JK1 X;  3H1C A;  3I55 I;  4HA8 A;  2DA3 A;  1HST A;  2A5Y B;  4QWQ A;  3H3Z A;  2RVC A;  4CDG A;  4A3E J;  4FTH A;  1O3T A;  1QPM A;  3HOX J;  3BPX A;  3KIO A;  1FBU A;  5GPC A;  2WV1 A;  3QQA A;  5IP7 J;  1FC3 A;  4A5M A;  5KVR A;  2MFZ A;  2P5V A;  1MIJ A;  3IH2 A;  2VOD A;  3WTZ A;  2M0M A;  1JT6 A;  4BQQ A;  1UHS A;  5DTD A;  1FJL A;  3H9Q A;  1H0M A;  3VSK A;  1WZ2 A;  1IRF A;  2I8D A;  3CCQ I;  3F6O A;  3H9J A;  2XHK A;  1JKR C;  3V42 A;  4AIH A;  4LOC A;  3H35 A;  3TOA A;  3WHB A;  2AXL A;  2Z16 A;  1P4A A;  3IAS 2;  5HDK A;  2PBI A;  3G1O A;  1A6I A;  1KU9 A;  3L1P A;  2GXG A;  1Y1W J;  3KET A;  1FOX A;  1DPR A;  2FQ3 A;  5EG0 A;  3GTP J;  3RPU A;  4MQV A;  5HLI A;  5HNH A;  5D5V B;  5D5W B;  5J4Y A;  2R7U A;  3DBR B;  2FF4 A;  1IN6 A;  2CU7 A;  2PQ8 A;  5B3S H;  5IOZ A;  4YIR X;  3I56 I;  3JW4 A;  3KYL A;  4HOB A;  3WE2 A;  4JX6 A;  2OC6 A;  4J01 A;  1ZRC A;  4II2 A;  1XN7 A;  3KX2 A;  1TC3 C;  1X1A A;  1F43 A;  2H6C A;  3WG9 A;  4RM3 A;  3S1N J;  1R49 A;  3WGI A;  2M7B A;  1CQT A;  1VQP I;  1MBH A;  4NQW A;  1BR2 A;  4GYG A;  1REP C;  5E1Z B;  1H8A C;  4BBS J;  3C2B A;  4V2G A;  1F4K A;  1FP1 D;  5H6Q A;  1S3J A;  4RM2 A;  2KL4 A;  4FT8 A;  4II3 A;  2RNG A;  1D8J A;  3BJA A;  1D5Y A;  3C3W A;  2VJ5 A;  4ZYG A;  3OY9 A;  3I58 A;  5BOX A;  3QYE A;  2VQG A;  3T8T A;  2V9V A;  1IV6 A;  4PGH A;  3JTH A;  3I4N J;  2X51 A;  4R79 A;  1V5E A;  3V4G A;  1IUF A;  4N9I A;  1MW7 A;  1W5S A;  3HUG B;  4F92 B;  2DFI A;  1T6S A;  2EFP A;  2KDZ A;  2FMY A;  1IJW C;  2AQF A;  3OYJ A;  1OYW A;  4XON A;  5GAD J;  1W7P D;  3A01 A;  4G6Q A;  4ZH4 F;  2QA4 I;  1IAW A;  3MQ0 A;  2L02 A;  3J7A O;  3SHF A;  3CLQ A;  2CUE A;  1UAA A;  2R3S A;  4LD5 A;  3WTT C;  2VPL A;  1AU7 A;  5AON A;  1SEU A;  2L7K A;  2Y30 A;  2CH0 A;  1G6N A;  1P2F A;  5L3G A;  1TW3 A;  1XGN A;  1BI0 A;  2Q0O A;  4FHT A;  1OMI A;  1UST A;  2KJB A;  4BXX J;  4L9N A;  1UHM A;  5CKT A;  2CG4 A;  3CME I;  3F8M A;  4NNJ A;  2ESN A;  2XGD A;  3ZCO A;  5D5X B;  1YYV A;  2NVX J;  2VKE A;  4D5C A;  3CDH A;  3PQK A;  4A3B J;  2K27 A;  2BEO A;  1QHH D;  2XKO A;  4KIC A;  2VC1 A;  3RPQ A;  5KAF C;  3JRH A;  2ZME A;  1X1C A;  4KMU X;  1W1W E;  1ZH5 A;  3H92 A;  5EGO A;  2DK5 A;  3G3Z A;  2JA7 J;  5E20 A;  2B63 J;  2E36 A;  1R7J A;  1YX5 A;  1RET A;  2DFE A;  4UV8 A;  3SXY A;  3T0Y A;  4XRF A;  1UFM A;  3TP0 A;  3OIP A;  2V4J C;  1FWZ A;  2M45 A;  3K4M A;  2XDV A;  5H6R A;  5KK1 A;  3K70 C;  4EJV A;  1JHH A;  4BXF A;  1WJ5 A;  2ZCW A;  2LP0 A;  5DCM B;  2XSD C;  1RRJ A;  2DXI A;  3HOV J;  2M5W A;  5K7H A;  2UUZ A;  3GYH X;  2YUS A;  1A04 A;  5EEA A;  2EA4 A;  5E3M A;  3MCZ A;  4Y4R A;  2VUM J;  4RDU A;  2B7E A;  1DDN A;  3K9T A;  4PJJ A;  2WAD A;  2Q2E A;  4CSW A;  1G3Y A;  2KIM A;  5FKL A;  1D0X A;  3LSH A;  1JUP A;  3MN2 A;  3OSG A;  3IUO A;  2LMD A;  1A6Q A;  2HS5 A;  3F3X A;  2Y9Z A;  1BL0 A;  1JTY A;  4CCK A;  3FXR A;  5FLM J;  2W4S A;  4D1Q A;  4Z2Y A;  4ITV A;  3JRA A;  3HL2 A;  3E5U A;  1BIA A;  3FK7 A;  5FLX K;  6PAX A;  1ZYR F;  1IW7 F;  3M9A A;  1R58 A;  3J81 Z;  2V1N A;  1SMT A;  5J1R A;  4BL0 B;  2IS1 A;  4UVA A;  5J8F A;  2EIM H;  4J00 A;  1BJA A;  4XRS A;  4GCV A;  2R7R A;  1TNT A;  4E7L A;  5JHU A;  2LDU A;  4MNU A;  5M3F J;  3CCM I;  1R6R A;  4I09 A;  1Z05 A;  2VKD A;  4QIW N;  5LHG A;  2CFX A;  3KP7 A;  1G8X A;  3WGG A;  1QVU A;  1FSH A;  2CWE A;  4A3C J;  4BEH B;  3TP3 A;  2EZK A;  3ESW B;  3QAH A;  4DYQ A;  2OQG A;  2M9H A;  1IN8 A;  4IHS A;  2WY7 Q;  3LSJ A;  4M9Z A;  3RKX A;  2WWY A;  1N77 A;  2DYS H;  3CDI A;  3HSF A;  4JOM A;  1LFP A;  3T8R A;  2DQL A;  3BTC A;  2EPF A;  1MZB A;  2KFD A;  3ABM H;  3CES A;  3BC8 A;  3Q0V A;  2KHM A;  2ISY A;  2HI3 A;  3BZK A;  2NVU B;  1FLI A;  3TW6 A;  1Q1V A;  4F93 B;  4KUM A;  1J7K A;  1TWF J;  5LRS A;  5D8K B;  2GIZ A;  2V6C A;  2E34 A;  4B8X A;  3ISP A;  5C4J J;  3S3O A;  1R4N B;  3HHH A;  4Y7N J;  4PK4 A;  2XKP A;  2XVC A;  5L3C A;  4A3D J;  3VYU B;  2JA5 J;  1BA5 A;  3CCR I;  4GGG A;  3B02 A;  1LDD A;  2XC7 A;  1MND A;  4PSW A;  1B8I A;  1QU3 A;  3KYC B;  5HDN A;  3ZMD A;  3ZQH A;  1UG2 A;  5F64 A;  1DUX C;  5B66 C;  1I6X A;  1ZKG A;  4WK8 F;  1LEA A;  2IRF G;  3QYB A;  3GTG J;  4M72 A;  1NK3 P;  4L0Y B;  3I0T A;  2IW5 A;  1XMX A;  3U1K A;  1QA6 A;  1YLF A;  3BG3 A;  2DA2 A;  1D1A A;  4XM3 A;  5E8I A;  2JN6 A;  1U5T C;  2AXT C;  4BDY A;  1LUJ B;  1FOW A;  4NC6 A;  1HC8 A;  2LBF B;  1SVM A;  2ELK A;  3FIS A;  3KEO A;  1HDP A;  5EYR A;  2DLL A;  2JK3 A;  1MJB A;  2HXI A;  5A2Q K;  4NC8 A;  2HZT A;  4Y17 A;  1K4S A;  2ZXH A;  5C3E J;  2R5Z B;  1WQ2 A;  1F9N A;  3G4S I;  4P5O A;  2CQX A;  2DJN A;  2NOJ B;  3I5U A;  2E1O A;  2CQQ A;  2L9R A;  2QLZ A;  2MD0 A;  1VI0 A;  3KZZ A;  3K4B A;  2M8E A;  3H3V K;  3OL3 A;  1LJ9 A;  3KCC A;  3PSF A;  4CYD A;  2M4K A;  5TRD A;  2F5F A;  3DBL B;  2EFQ A;  1P7I A;  1IF1 A;  4BUP A;  3WGH A;  1YRN A;  3VYS B;  4WX9 A;  2RQP A;  3DEU A;  1P7J A;  4BE2 A;  3DWL E;  1XGS A;  2ZXI A;  3HHG A;  4ZYH A;  1ETY A;  3GZN B;  2A61 A;  4XOT A;  3ZPL A;  4KT5 C;  1LFU P;  5JR3 A;  3ML6 A;  3MEX A;  4IHT A;  2XV4 S;  3ZOB A;  3OWT A;  1YX3 A;  2JZY A;  3BRO A;  1MSF C;  2QSG X;  1D5V A;  5JVG F;  4HST A;  3M1E A;  5TGT A;  3CC7 I;  3REO A;  4DJA A;  1FYM A;  3S14 J;  1FSE A;  3RQI A;  2XPW A;  1TBX A;  2X6O A;  1XDU A;  3CCV I;  1ETW A;  4MEX F;  3G2B A;  1ZRE A;  3G73 A;  1BOB A;  1O7F A;  4PJM A;  3W3C A;  1JKP C;  1HW5 A;  1VQO I;  3PNT A;  4NUB A;  2HNH A;  3JRG A;  4D0P A;  5HNF A;  2PJR B;  2UV1 A;  3G1L A;  3ZMZ A;  2EIJ H;  4WXC A;  2EH3 A;  1WH5 A;  2OQR A;  2L01 A;  5HS9 A;  3S3N A;  3GLX A;  4OU0 A;  1PUE E;  2K5C A;  4ZYD A;  4GDF A;  5DD8 A;  1QRY A;  2OCE A;  4EJU A;  2K4J A;  5GAG J;  4XID A;  1SFU A;  1PUF B;  4QPO A;  2R5Y A;  2DMP A;  4LIT A;  3S8P A;  4UB6 C;  3BR0 A;  4IRI A;  2NVY J;  1MNM C;  4CXF A;  1TWG J;  2QVO A;  2DMU A;  4KIG A;  1VQ8 I;  1A31 A;  4R8H A;  2ZB9 A;  2WC2 A;  1OYI A;  2XAU A;  3GEZ A;  2A5W A;  2A07 F;  1BIB A;  3UNG C;  3Q0W A;  2IS6 A;  3A4C A;  1ZAO A;  1S72 I;  2QF7 A;  3CUQ C;  2Y0M A;  2NNY A;  1M1E B;  1PJR A;  4E4H A;  3J80 K;  2R4G A;  4V2F A;  1W0T A;  5FRM A;  3BR6 A;  9ANT A;  1F5T A;  1FYL A;  5JFR A;  3G71 I;  1B9M A;  2DOA A;  2JUC A;  1B9N A;  3MMY B;  1RIO H;  1USS A;  1S29 A;  3M07 A;  3CUQ B;  1HQC A;  2Z5U A;  2M2E A;  4DOZ A;  2JA6 J;  3PUB A;  5ED4 A;  5DCF A;  2HTJ A;  4N4N B;  3GTO J;  3IH3 A;  2O8X A;  2R93 J;  3MVP A;  1WRJ A;  2RV8 A;  3KEQ A;  3OYG A;  2XSJ C;  3BTL A;  2D5V A;  4BJT A;  4B3A A;  3CP8 A;  3CJT B;  1FOY A;  1YS7 A;  2ME6 A;  3TO6 A;  1RUO A;  3DU6 A;  2XPV A;  4EM0 B;  2VKH A;  3RCO A;  4JX5 A;  5CJ9 A;  5FKN A;  5D8L B;  5B1A H;  2KT0 A;  3OYL A;  1NH3 A;  3QP6 A;  2NVQ J;  1WJC A;  3VDX A;  3KP5 A;  3CCE I;  2DA4 A;  1I27 A;  3JSO A;  3KYD B;  4KJZ A;  1T56 A;  3RZD J;  5ICF A;  1G3T A;  3GW2 A;  4CZZ A;  4LG3 A;  4RGX A;  4H0E A;  2L7F P;  1D0Z A;  2Z2S B;  2L5Q A;  3OYK A;  2WTE A;  4JBA A;  4A2U A;  1P6R A;  4FQG A;  5EG0 B;  2WAE A;  3G6E I;  4A3M J;  2OA4 A;  4LMY A;  3PO3 J;  2ICW G;  2LF8 A;  1JUS A;  5JVT A;  4G7O F;  3CCL I;  4DYR A;  5E18 F;  3HOT A;  2QBY A;  4IKF A;  2OCC H;  1YS6 A;  4XOR A;  2DTR A;  1GXQ A;  2WAQ N;  4P55 A;  3LSI A;  4L5E A;  2KZG A;  4OIR F;  4QPQ A;  1Y8R B;  5EF6 A;  4P96 A;  2XAJ A;  1KQ0 A;  4BHP A;  2EZH A;  3K4N A;  4G9Y A;  3AG3 H;  2ZO4 A;  3KP4 A;  3DTE A;  3GFI A;  2L9V A;  2FNP A;  1XD7 A;  4IHY A;  4NQW B;  3ZMU A;  1U5T A;  2BY2 A;  4PDK A;  5LHH A;  1Y39 A;  5C4X J;  2WAQ A;  2FML A;  2QSH X;  1BR1 A;  4PFO A;  3WTS C;  4LLG F;  4OIQ F;  4BH9 A;  2A69 F;  3DLA A;  4CH7 A;  1WWX A;  1SD6 A;  1SD4 A;  3D1N I;  4RAF A;  3HOY J;  2F5C A;  2MH9 A;  3X2Q H;  2IAI A;  2LY2 A;  3HC7 A;  5L3D A;  4BYY A;  5LLQ A;  3QOE A;  4UHT A;  3FHN A;  1DPU A;  1TQI A;  1XGO A;  5CVV A;  4BE1 A;  2M8G X;  3H0D A;  1TWC J;  2FRH A;  2E2H J;  2DBB A;  1N75 A;  2M1B A;  3DEW A;  4D5F A;  1SAU A;  1Z9C A;  4NB5 A;  2KMU A;  1FZP B;  2V7F A;  4BS9 A;  3BQY A;  4QTR A;  2R0Q C;  1XGM A;  2P6S A;  3SQN A;  5J1Y A;  4HZF A;  3GX4 X;  1Q1H A;  1WJD A;  1LEB A;  4HF2 A;  4G8X A;  3PNV A;  4CHU A;  2GWR A;  2LC2 A;  2ZXW H;  4A3G J;  2M4G A;  3S1M J;  3RYP A;  2VQH A;  1ZAR A;  4X6A J;  1RES A;  4L9J A;  2XUB A;  5BQT A;  3SJM A;  4GO1 A;  5FKK A;  4XMY A;  3TO7 A;  3NEU A;  1LB2 A;  1V4R A;  3ZGK A;  2FBI A;  3V7C A;  2TDX A;  2IGO A;  3NWT A;  3FDY A;  3VPR A;  5M5X J;  2LRD A;  4LFU A;  1YI2 I;  4PSX A;  2XF7 A;  4LB6 B;  2PJP A;  4KIB A;  2XIG A;  2KIS A;  2ZNZ A;  5IT9 K;  3CQZ J;  2BVM A;  2BGC A;  2E2J J;  2MC4 A;  3L2V A;  3HOZ J;  3SEQ A;  2XGE A;  4W1U A;  5K7Z A;  2ZME B;  4EEF G;  2A6E F;  5EGO B;  5E3O A;  5EZG A;  5FO5 A;  1KU7 A;  2ADU A;  4XLN F;  1ERD A;  2GXB A;  2DU9 A;  1JGG A;  4YFN F;  4HX7 A;  1YE9 A;  2YS9 A;  3GTQ J;  3CC4 I;  2LOO A;  3OV8 A;  4XR6 A;  2XAH A;  1NG6 A;  2JMW A;  2NVT J;  1OCO H;  4RLQ A;  2DYR H;  4I98 B;  1R5I D;  2FA5 A;  3AL0 B;  3NWS A;  5BNG A;  3TO9 A;  3ZMT A;  2P5L C;  4EM1 A;  2CMP A;  4HNT A;  2CJJ A;  2EQR A;  2JSC A;  2P81 A;  3CTA A;  3IH4 A;  4KDP A;  1A36 A;  2CSO A;  2NRA C;  2QEN A;  2LFB A;  1EJ9 A;  2Q2E B;  2PG4 A;  2IP2 A;  4ASN A;  4HDU A;  4P1W A;  4F91 B;  1DU0 A;  2R7V A;  1OIS A;  3Q5F A;  3CUQ A;  4RAG A;  3S16 J;  5KCM A;  1XSX A;  2J5O A;  2DPD A;  3KEY A;  4XIC A;  2K40 A;  2E5Z A;  1J0R A;  1BOA A;  4E7J A;  3AAF A;  2X1C A;  1T2K A;  2DA5 A;  1CF7 A;  1FMV A;  1WVR A;  2HZD A;  2L0K A;  3HEF A;  2DTZ A;  3VYR B;  2JRT A;  1EH6 A;  4AWX B;  2ZXJ A;  2HYG D;  4M3B A;  4JQF A;  3HG9 A;  3FXL A;  4RBO A;  3CCU I;  2K9Q A;  3HOS A;  2A3S A;  4LK0 F;  3P9I A;  1KYW A;  1T39 A;  1QBJ A;  2PEX A;  3BJ6 A;  5D6E A;  1I5Z A;  3KP6 A;  4OOI A;  1Y0N A;  1IO2 A;  1ZGW A;  2EIL H;  5GAE J;  1X4P A;  2HQN A;  3LA2 A;  5LGN A;  1SFE A;  2E60 A;  3RPU D;  4BAY A;  4PJ0 C;  3BT9 A;  3NAR A;  5DM7 F;  5F0F A;  2VIX A;  3JAM Z;  3RZO J;  5HDG A;  2R7W A;  5CVU A;  3PM1 A;  2K02 A;  4XRS G;  4RB0 A;  5FRO A;  2P7V B;  1V5G A;  4QLC U;  3LWF A;  4KN4 X;  2Y0S N;  2OZU A;  1D0Y A;  1IXC A;  1XMK A;  4BJ6 C;  4RGU A;  2HU9 A;  1RR8 C;  3BG6 A;  1WJA A;  2A6T A;  1PVE A;  3M8J A;  1WJB A;  3WG7 H;  1B8I B;  2BOL A;  1LDJ A;  5FD5 A;  2LD5 A;  2Y0S A;  3LAP A;  2PMH A;  4U0W A;  3OYA A;  2VL8 A;  1ETX A;  2FX0 A;  2MAB A;  1GXP A;  4N0B A;  2P4W A;  2COB A;  1ACI A;  1MBK A;  2DPU A;  1JE8 A;  1Y1V J;  2JQ7 A;  2XAF A;  2X0L A;  1GV5 A;  2K85 A;  2RN7 A;  1D3Y A;  1IXR C;  2K9M A;  2HVQ A;  5J8C A;  5FLV A;  4Y52 J;  1FNN A;  1R5H A;  2HWV A;  3L00 A;  3OYE A;  4PJN A;  4M9X A;  3FM5 A;  3MKZ A;  2OZ6 A;  1I6H J;  2OPT A;  1JKO C;  4A12 A;  3SZT A;  4DZJ A;  1EKE A;  3F8F A;  3I9V 2;  3HYI A;  1XC5 A;  4FAS D;  2KJC A;  1LVA A;  5CPR B;  5FGM A;  1MJA A;  5CVJ A;  1YIO A;  2GXA A;  3E6M A;  5LBQ A;  1POG A;  4BU2 A;  3R61 A;  4X1E A;  3K10 A;  4AVZ A;  1R5G A;  2CQN A;  3S1R J;  2Y48 A;  1MBF A;  1JTX A;  3DBH B;  2XB0 X;  1YRN B;  3SFI A;  2GBY A;  5LFA A;  1HW2 A;  3M8E A;  4PJL A;  1OQY A;  3B6C A;  1YW8 A;  2KP6 A;  2HYF A;  2DMQ A;  1MH3 A;  3I4P A;  3PFI A;  4BNC A;  3J7Y J;  4Q47 A;  1IGN A;  3M4O J;  3BR1 A;  3KLN A;  4BY7 J;  2OTJ I;  1Z77 A;  3DLL F;  1HKS A;  4Q48 A;  3IKV A;  3JR9 A;  1B6A A;  4FIS A;  1H9T A;  2KPM A;  2G7U A;  3BTJ A;  2Z9O A;  5J3L A;  3JRC A;  2TRT A;  1QZE A;  3SDB A;  3OOU A;  1ETQ A;  3A03 A;  2W24 A;  4O5V A;  1PDN C;  1MJ9 A;  1P4W A;  4KN7 X;  1OCR H;  5E1X A;  2K9S A;  2O61 A;  1ZGA A;  4FE7 A;  4ZC3 A;  5C44 J;  1HCR A;  1TP4 A;  2LRE A;  4M3D A;  1TW2 A;  2RNJ A;  4OIO F;  5GPA A;  4I99 C;  3K4L A;  4S05 A;  2E1N A;  5F27 A;  1FYK A;  1I1S A;  2ESH A;  5DV5 A;  5HOD A;  1E0E A;  1YTY A;  2H94 A;  2HVR A;  2LVS A;  2VQL A;  1JJ8 C;  2F4M B;  2VN2 A;  1K7A A;  4I6Z A;  2ACJ A;  1WKM A;  1X3W B;  5LEK A;  2FE3 A;  2B0L A;  1XTA A;  2A6H F;  4G7Z F;  1XS9 A;  2IGM A;  2LKS A;  1BI1 A;  3S3M A;  2N8G A;  4U7B A;  3LQQ A;  4C2M J;  1HKT A;  3LSR A;  4LLL A;  1YJN I;  2R5Y B;  3CDL A;  2BV6 A;  1ON2 A;  1X2M A;  3F0C A;  3K1P A;  4UB8 C;  3S2W A;  3W2A A;  3OYB A;  1AKH A;  2X6Y A;  2DK8 A;  2X85 A;  2H8W A;  1IUY A;  4A0X A;  1ITY A;  4G12 A;  1HLV A;  1OFC X;  2LLK A;  2ZSH B;  5FD6 A;  2CW0 F;  4OMY A;  2P8T A;  2OV7 A;  3BDD A;  4UVC A;  1FBQ A;  3HSE A;  2MGQ A;  3EPZ A;  1O3Q A;  4EVI A;  3VSL A;  2M0C A;  1S7O A;  3HXL A;  1MBE A;  1G2H A;  3LSP A;  3CF5 F;  1WI9 A;  3L9F A;  1BR4 A;  2ZBK A;  3KZY A;  4KIF A;  1KA8 A;  4M71 A;  3L2U A;  3CJN A;  4RMN A;  4EM2 A;  1OJL A;  2VBX A;  2QSF X;  2JVH A;  1UCR A;  1OYY A;  4HAM A;  3FHZ A;  2O6G E;  3U1D A;  1TLH B;  5DYM A;  4AC0 A;  1VQ6 I;  2V6E A;  1UHW A;  1YG2 A;  3IRR A;  4EJO A;  4V19 K;  2AQE A;  1XB4 A;  1U3E M;  2EK5 A;  4Q5S F;  1Z7U A;  3HTU A;  4BAC A;  2JA8 J;  1XG1 A;  1W36 C;  3HZJ A;  2X1D A;  3A0H C;  2DCE A;  1DU6 A;  3ABL H;  1LNW A;  1U9N A;  2P5K A;  2GOM A;  1FT9 A;  1UEL B;  2R7F A;  2CUJ A;  3GXO A;  1EF4 A;  2RAE A;  2QBY B;  2E2I J;  3LSK A;  3E97 A;  3FXK A;  4YRV A;  2ID3 A;  1VQL I;  4NDL A;  4Y3O A;  4AU7 A;  4ESF A;  2R7S A;  3DXJ F;  4IHW A;  1OCP A;  4XLC A;  3C7J A;  2W82 A;  5GTH C;  3PO2 J;  1D8K A;  3VOD A;  3CO6 C;  3C1D A;  4CCM A;  1STZ A;  4KFC A;  4UUT A;  3RKQ A;  1U5T B;  1SAN A;  1VQ5 I;  1ENH A;  2BY1 A;  4E7Z A;  3N4M A;  4AUX A;  1W0U A;  1IRG A;  5FFZ A;  3AKZ A;  1VF9 A;  2DOD A;  3BJO A;  2GOX B;  5FJ8 J;  1J5Y A;  1BC7 C;  3F9K A;  2EIK H;  1I1G A;  4B43 A;  2BE5 F;  3IWF A;  4G6T B;  4MIM A;  3C2H A;  1X3U A;  3K1N A;  5CLS A;  3F22 A;  2CS3 A;  2MLG A;  4OAY A;  3OS2 A;  2LY1 A;  3HBL A;  1K61 A;  2BZT A;  2VT3 A;  2X48 A;  1S7E A;  4YFX F;  3IAM 2;  1YHQ I;  3T5X A;  1A5J A;  4IHV A;  2KIU A;  5J6X A;  1MDM A;  3WTX C;  1K78 A;  2VOO A;  3PNY A;  5L3B A;  1XCV A;  3HPH A;  1OCT C;  5GAH J;  3OL4 A;  4AID A;  3I54 A;  2PLY A;  1DP3 A;  2DA6 A;  1PYV A;  2DOE A;  1HDD C;  3BCB A;  3U21 A;  1E3H A;  3IKT A;  1HBX G;  3ZRG A;  3B73 A;  2EV6 A;  1GT0 C;  4HRI A;  2K9N A;  1IN7 A;  1YOV B;  4TV7 A;  2HPI A;  4OWR B;  2ELH A;  2F4I A;  4YG2 F;  1L3L A;  3NQO A;  3RJP A;  3IV5 A;  2CRG A;  4XKC A;  3ULQ B;  3VOE A;  4M3G A;  2OF7 A;  2LG4 A;  4LIU A;  3WOD F;  4ETS A;  2E1M C;  3W2V A;  2IA1 A;  2BVL A;  4BQN A;  5CYV A;  2VOP A;  1VQ9 I;  1ODD A;  3KPH A;  4EQQ A;  5B1B H;  3OYF A;  3K70 D;  3E6B A;  1U2W A;  3ECH A;  3LFU A;  3QYF A;  3L7W A;  3MZY A;  4OIP F;  2VBZ A;  4Y33 A;  4QSH A;  3UKG A;  1IRZ A;  2XGX A;  2E1C A;  1TTY A;  2CV1 A;  4P9U A;  2DT5 A;  2COM A;  4M73 A;  2I5U A;  2DAO A;  3I71 A;  3RIR A;  2BYV E;  4UUS A;  1H9G A;  4UY8 I;  2DA7 A;  2K3P A;  1VQ7 I;  3HGY A;  3MAJ A;  2CUF A;  2XAG A;  4N4O B;  3N97 A;  5HOO A;  3BPV A;  2EFW A;  2FOK A;  2W84 A;  3ASN H;  4IRG A;  2LY9 A;  5CVI A;  2LKX A;  5E3N A;  5CVR A;  4W97 A;  1YJ9 I;  1DGR M;  2WY8 Q;  1BI2 A;  1YW9 A;  2EWN A;  2L9S A;  2R7D A;  4N9H A;  1BI3 A;  4XKV A;  4HDV A;  2GLO A;  3G1M A;  2JTV A;  3DV8 A;  4KIS A;  2ZC2 A;  2JPC A;  2R92 J;  3DPL C;  4IHX A;  3GTM J;  4RA2 A;  1YQA A;  1QNT A;  3TDZ C;  5J47 A;  4E7H A;  1QPI A;  4EGY A;  5DUK A;  3BG7 A;  2Z99 A;  2IBD A;  3K2Z A;  3Q9V A;  5AIP A;  1RKT A;  3DKW A;  1IXS B;  3I3L A;  5JLX A;  3SYT A;  1EH7 A;  3HSR A;  3JSP A;  2Y69 H;  3LSG A;  2XF5 A;  3ZQG A;  4ZTF A;  3ABU A;  1ZG1 A;  1T33 A;  1IDY A;  2UXX A;  4GYI A;  3ZQF A;  1CF7 B;  3FXO A;  1YO5 C;  1ZRF A;  3IWZ A;  4ZYE A;  1WJF A;  1LE8 A;  3GF2 A;  2RGV A;  3S2D J;  1V54 H;  2FSW A;  1AA7 A;  1JJ6 C;  4L18 B;  1F1Z A;  4A3F J;  1G4D A;  3M7G A;  5E3L A;  5E79 C;  1UJ8 A;  1VZ0 A;  4CCJ A;  3E6C C;  1WPK A;  3PL8 A;  4HG2 A;  2EFO A;  1P4X A;  4LJZ F;  1RPW A;  1X1D A;  3WTW C;  3L2W A;  4G6D A;  1TWH J;  5HVQ C;  4RB1 A;  3ZXS A;  3DKX A;  2BY0 A;  3O3K A;  2YU3 A;  4ENJ A;  1K6O A;  3GFJ A;  2DMT A;  2FEZ A;  4AIJ A;  5HS7 A;  1ZR2 A;  1J59 A;  1ZRD A;  1JHF A;  1RZ4 A;  3FBN B;  1U9O A;  1KU3 A;  3FXJ A;  2VLA A;  3FMS A;  4C3H J;  2NNN A;  3MFK A;  3JRI A;  1K79 A;  4U7D A;  1FY7 A;  2QYO A;  2VPR A;  1OR7 C;  3HOU J;  1TWA J;  4WCG A;  2QKL B;  3UR3 C;  2JA2 A;  2ME0 A;  4F7Z A;  4DBR A;  4ZZD A;  1I39 A;  1JUM A;  2IA2 A;  2QWW A;  2V26 A;  1Y8Q B;  3LQR A;  2HDC A;  3BQZ A;  2VON A;  1JXS A;  4ON0 A;  3ASO H;  2ZJ2 A;  1G3W A;  2KIF A;  2YU9 J;  3QWL A;  1T0F C;  4CYC A;  1MD0 A;  1JGS A;  2W1O A;  3JCU C;  4P9F A;  4JX4 A;  3I53 A;  1VTN C;  1GUU A;  5F0H A;  5H2F C;  4AVP A;  3E1S A;  3VFZ A;  2CGP A;  3EYI A;  2FXA A;  5EJC A;  1OCZ H;  1XX5 A;  2QGU A;  3DU5 A;  3CJR B;  4AD9 A;  2QZ8 A;  3CC2 I;  4X0G A;  3ROU A;  4ZZL A;  5L3F A;  4OAZ A;  2V1U A;  4RS8 A;  2E7W A;  1FX7 A;  2L9N A;  1QZY A;  2MH2 A;  1Z3X A;  4NBQ A;  2KRC A;  3IHU A;  4ZDP A;  3P5J A;  4CO8 A;  4WF2 A;  3RTR A;  5HLT A;  2NS0 A;  3QRF F;  5IYB J;  3JRE A;  3MKY B;  3HGG A;  3A1Y A;  5IYC J;  2YX4 A;  3GUD A;  1CGP A;  2GA2 A;  1UB9 A;  2Y9Y A;  3DPU A;  3EQL F;  3GLL A;  1GDT A;  1KQ9 A;  1QQI A;  2H1L A;  1JT0 A;  1XSV A;  4HW0 A;  5ICC A;  3BTI A;  1HXD A;  1TZL A;  2M7A A;  4BGD A;  3FX3 A;  3ZP5 A;  1XSD A;  1WI3 A;  3CF2 A;  1BW6 A;  1I3A A;  1X2N A;  2ELJ A;  2MC3 A;  3QU3 A;  5TIS C;  4HSR A;  5LGU A;  2HEO A;  4ZDO A;  1AWC A;  3QPS A;  1MH4 A;  3QU6 A;  2DQR A;  5K1Y A;  3HB9 A;  4XLE A;  3VEP A;  2OD5 A;  4CCO A;  5L3E A;  2E7X A;  4HQE A;  3HTS B;  1SFK A;  2OAZ A;  1X58 A;  3WTY C;  2D45 A;  1XDS A;  2RDP A;  1SAX A;  2DW4 A;  1LVK A;  4ENN A;  2W00 A;  1WFX A;  3H5N A;  3S32 A;  3S1Q J;  2K7L A;  3RYR A;  2ID6 A;  4DYC A;  1TT5 B;  1FMW A;  1K83 J;  2EJR A;  3H5R A;  4RAZ A;  4Z6Y A;  4EMS A;  1MGT A;  2DO7 A;  2RC4 A;  4KT6 A;  2DFH A;  2O9L A;  5IYD J;  2H6B A;  4IJA A;  4HNU A;  2GAU A;  3GVA A;  2RKH A;  3L09 A;  1W4M A;  2KKO A;  5CQG A;  5J40 A;  2Q8K A;  3ZN1 A;  3JRD A;  3QPL A;  3ECO A;  3MZH A;  3CMM A;  1NTC A;  4WWC A;  2DA1 A;  1ZK8 A;  2EA2 A;  1Z6T A;  1DGW Y;  3M8F A;  2GQQ A;  1O57 A;  4PUS A;  1G59 A;  1XMA A;  2DI3 A;  3IC7 A;  2KQR A;  3E0J B;  3D5S C;  4M6Y A;  1WCM J;  1R9T J;  3HKZ N;  5DEQ A;  4E7S A;  3GTK J;  3H36 A;  1Z6R A;  3HPG A;  1OCC H;  2DMN A;  3CMY A;  1BN5 A;  2IA0 A;  2HVS A;  4B1R A;  2BXY A;  1IV8 A;  4IL6 C;  2RQQ A;  3CLO A;  1LKX A;  4DW6 A;  1R23 A;  3HKZ A;  4A69 C;  1H88 C;  2WA0 A;  3K1M A;  1ZG5 A;  3OYH A;  1MBG A;  1AKH B;  1N78 A;  5M5W J;  2FOW A;  2IPQ X;  1T95 A;  4LK1 F;  5FKO A;  2YX7 A;  3V7S A;  5KAI C;  3K4J A;  5IP9 J;  5D4R A;  4YII A;  1ZEL A;  1FIP A;  2FJ1 A;  2X6X A;  2QUF A;  3OYI A;  3E5X A;  2LYC A;  2DJI A;  2EV0 A;  3K2A A;  4Y13 A;  4A3L J;  2D2W A;  4DBQ A;  4HQM A;  2AS5 F;  3GZ5 A;  4ABZ A;  5D4S A;  3IL2 A;  4HBL A;  1TNS A;  2MG4 A;  4RGS A;  4HX4 A;  3TW7 A;  2HQR A;  2LTP A;  2P0W A;  3F6V A;  4D7N A;  3L2C A;  3ZQC A;  1PP7 U;  2LF7 A;  2EZL A;  3E5Q A;  2W48 A;  3JRF A;  1FTT A;  4XRM A;  4BQA A;  1IDZ A;  2K4B A;  3AG1 H;  1V55 H;  2F2E A;  2OUM A;  2PMU A;  2ZJQ F;  5F1R A;  4EJT A;  4UUV A;  3LA3 A;  4G94 A;  3GCM A;  1QZZ A;  2XB5 A;  3SEZ A;  1WJE A;  4H4K C;  3ZQQ A;  1R1T A;  1VFC A;  2Z33 A;  3W2W A;  4XL9 A;  2ZNY A;  5B5E C;  3J81 K;  5F04 A;  2V1D A;  3D0S A;  4FET A;  2LSO A;  2MSY A;  3OS0 A;  1V5F A;  1R1U A;  4FX4 A;  4GXO A;  4PGG A;  3ELK A;  2XRN A;  4LGW A;  3FZV A;  1YFH A;  4HLX A;  4XNF A;  2HGC A;  3COA C;  1OR7 A;  2DFF A;  4L5I A;  5EZH A;  1FOK A;  1KGS A;  3R4K A;  1GHC A;  1UMQ A;  2OU2 A;  1FPQ A;  2EZI A;  1R36 A;  2R7Q A;  2FUG 2;  3ZQL A;  3PQJ A;  2FBK A;  2O7O A;  5D6F A;  2VE9 A;  3BY6 A;  3P7N A;  4RGR A;  1T0F A;  2F4O B;  3C2G A;  2VJI A;  2KRH A;  4A6E A;  3PIO F;  3GTL J;  1T08 B;  2XPU A;  3WU2 C;  2OBP A;  3K0L A;  1FP2 A;  3E7L A;  1BM9 A;  2EB7 A;  4BHC A;  2PN6 A;  3RI4 A;  3U9G A;  1PP8 F;  4JP0 A;  4BBR J;  2LH9 A;  4JYK A;  2L3D A;  2H1K A;  5KHD A;  2VBY A;  1LQ1 A;  2ECC A;  2JUG A;  1SVL A;  4S0H B;  3S17 J;  4YIF A;  4IRH A;  3EUK L;  2BW3 A;  4Y15 A;  3A02 A;  1HKQ A;  1ZG3 A;  2IXS A;  3Q9S A;  4BKX A;  2HKX A;  5IT9 Z;  2GZW A;  3MWM A;  3PIP F;  1VQ4 I;  2IVM A;  1NK2 P;  1P92 A;  2HDD A;  1ETO A;  2NAZ A;  2Z1D A;  4YFK F;  4UVB A;  4DZP A;  3RKY A;  3KFW X;  3F8C A;  2W25 A;  4YEJ A;  3L2R A;  1KZH A;  2HDW A;  2L7Z A;  3WE3 A;  3BG5 A;  5JLW A;  5F1J A;  2K86 A;  3AG4 H;  4E6K G;  4BJ5 C;  2GM4 A;  1LDK B;  1SMY F;  4ESJ A;  4XOP A;  5BPI A;  1W7P A;  4I76 A;  2D1H A;  1Y56 A;  3EDP A;  4I01 A;  2V79 A;  1MDM B;  2G7H A;  3LST A;  2NXN B;  2H8R A;  4U0V A;  3MD2 A;  1NHA A;  4BE0 A;  1K78 B;  3A0B C;  2XF6 A;  3HDD A;  4LIV A;  1Z67 A;  3FBI B;  5DDG A;  2QEX I;  1QHG A;  3EYY A;  3I4M J;  3NRV A;  2HYJ A;  5IY5 H;  5LGT A;  4HV6 A;  1ON1 A;  5JI6 A;  3BR2 A;  5ILU A;  3CCY A;  1MMA A;  1F36 A;  1ZHF A;  1Z21 A;  1EV7 A;  2FU4 A;  4UNO A;  2FQ4 A;  2BBY A;  2HOT A;  5F08 A;  2EFN A;  3TKY A;  2XRO A;  3S2H J;  2O03 A;  3GWZ A;  2QM3 A;  1FBS A;  1MSE C;  3O6B B;  4LB5 A;  2HOA A;  3OOP A;  1UZC A;  3QPT A;  1B72 A;  5J4V A;  5BS6 A;  4C30 A;  3KP2 A;  4DQ2 A;  4OIN F;  4G7H F;  2HPM A;  3OR2 C;  4RAY A;  4D9J A;  3ERE D;  2VE8 A;  2EBI A;  3W6J B;  2YPR A;  3J7A Y;  2QQA A;  5DUI A;  3S93 A;  1WGX A;  4LG0 A;  2LNB A;  5EEG A;  2P7C B;  3F23 A;  1VQN I;  2O8K A;  2ZKZ A;  4E7I A;  5IOY A;  4D7M A;  2IJL A;  3LL7 A;  4U0Y A;  1MKM A;  3P9K A;  1IG7 A;  1MBJ A;  3D5L A;  1L0O C;  1NG7 A;  4UUS B;  1MMN A;  3FKI J;  3V7R A;  1ZR4 A;  3HRS A;  3U2R A;  4B09 A;  1J09 A;  2CQ7 A;  3BZC A;  1J9I A;  2A05 A;  2WV0 A;  3A2K A;  2QKM B;  3WU1 B;  2QQ8 A;  4B44 A;  3S15 J;  1MNE A;  2JJ7 A;  4ENK A;  4MFD A;  4A3I J;  4HYE A;  4B3X A;  4XLP F;  1P9Q C;  2H27 A;  2O3F A;  1UG0 A;  2G0E A;  1WHU A;  1TT0 A;  4NHJ A;  3VYT B;  5E1W A;  5E17 F;  4M9S A;  4A3K J;  1VQK I;  2V1X A;  2ZFU A;  1U6G A;  4CZC A;  4ZJZ A;  2DDA A;  4LLN A;  2R7Z J;  3FIW A;  1SFX A;  1BC8 C;  4C9Y A;  1X1P A;  3TBI A;  4PCQ A;  4ZTJ A;  3BOQ A;  3SFZ A;  4HF1 A;  2VT2 A;  2WB1 N;  1U8R A;  2BHY A;  2IS4 A;  5HS8 A;  4I02 A;  2IGK A;  4HLY A;  1BBY A;  1Y6I A;  3HRT A;  4ENM A;  3PUF A;  1A35 A;  3DKY A;  3RKW A;  2NS8 A;  5LRR A;  5HLH A;  1X19 A;  4C2U A;  4E7K A;  5F0C A;  5BPD A;  1GVD A;  3RDI A;  1T98 A;  4AIK A;  2UXN A;  2JRM A;  4FX0 A;  1SFO J;  2WB1 A;  5CQE A;  1S8N A;  1LE8 B;  2JT1 A;  4DNC A;  3MKL A;  4KA4 A;  3RQ4 A;  3H5A A;  3R0A A;  2NOG A;  1R1V A;  2XAS A;  4HF0 A;  2STT A;  1DQU A;  1KON A;  1U8B A;  3GFL A;  4MEY F;  2X9D A;  3EUA A; 
#chains in the Genus database with same CATH homology
 1AOY A;  3R0J A;  4PZJ A;  3FWE A;  1XCB A;  1IZ1 A;  3KP3 A;  3GZ6 A;  5EEH A;  2F5E A;  3F8B A;  2M30 A;  2L4A A;  1SD5 A;  3O2P E;  4L9T A;  2HTS A;  2MLK A;  3WTV C;  4ESB A;  5F6F A;  1E2X A;  3CO7 C;  4XBF A;  2UZK A;  1W5T A;  4MHG A;  1QO0 D;  4XSX F;  4L9V A;  3H3U A;  5LEJ A;  2CO5 A;  3LFK A;  2NYX A;  4OMZ A;  4HX8 A;  5ERI A;  5E8G A;  3FMQ A;  5DD4 A;  3LA7 A;  5H20 A;  2JPB A;  3BZ6 A;  2F5D A;  3HUG A;  2PFB A;  3IRQ A;  4WXH A;  3E3V A;  2Z3Y A;  4BHB A;  4A0Z A;  2STW A;  5ICE A;  1DP7 P;  5IT3 A;  1OKR A;  3TQN A;  2GA1 A;  2HR3 A;  2HOE A;  3BP8 A;  2FNA A;  2LKP A;  1J75 A;  1KQ8 A;  4WXD A;  3TOB A;  1HSJ A;  4K2E A;  3C18 A;  1OPC A;  3FXU A;  3WTU C;  4EJW A;  1ZN2 A;  1TQP A;  3W6K B;  5FLX Z;  4IF4 A;  2A68 F;  3V8J A;  4RB3 C;  4BXU A;  3GO5 A;  3SZP A;  3HRU A;  4A6D A;  1GVJ A;  2Y75 A;  1RUN A;  3HIF A;  2VBW A;  1YW7 A;  2HFH A;  2MA3 A;  2X4H A;  4I2O A;  3ZMS A;  2FBH A;  5DCM A;  1KU2 A;  1IN5 A;  5ILS A;  1E17 A;  2QQ9 A;  3FF5 A;  5ILV A;  2GIV A;  2CYY A;  5TJJ A;  2YSR A;  4UV9 A;  4I7H A;  1T38 A;  2G9W A;  4MQ9 F;  3I59 B;  4M6X A;  4S04 A;  2VC0 A;  1HW1 A;  4M74 A;  4E70 A;  1ULY A;  2C6Y A;  2W57 A;  2HKO A;  3P9C A;  3ZMV A;  1SD7 A;  1TQM A;  2CQK A;  1O3R A;  5LHI A;  3DP7 A;  1RI7 A;  2L54 A;  1R00 A;  5AIQ A;  4Q4Z F;  2KRF A;  3FXQ A;  1ONV A;  4XSZ F;  2L4M A;  5D5U B;  1ZGJ A;  1S6L A;  3R6S A;  4MTE A;  4RB2 C;  1S7A A;  4MTD A;  1B4A A;  1R22 A;  2ETH A;  1U78 A;  2P6T A;  3K69 A;  3DFG A;  5A2Q Z;  3BWG A;  2D1V A;  1RNL A;  2QQB A;  2ZFW A;  4CGZ A;  5FB2 A;  2EV5 A;  3R60 A;  2H09 A;  4IPA A;  3V8L A;  4EV0 A;  4CIC A;  3F8N A;  1KYZ A;  2O0Y A;  3KLO A;  3VB2 A;  2M87 A;  3TGN A;  3ZQ7 A;  1Y0U A;  3WU0 A;  1B59 A;  1O3S A;  1IN4 A;  3FMR A;  5HLG A;  5BMZ A;  3QOP A;  3E6D A;  2ISZ A;  3T1B A;  2PI0 A;  3FM3 A;  1V3F A;  4O3M A;  3EUH A;  1WSU A;  4A0Y A;  4MGR A;  5K5Q A;  2W85 A;  1EH8 A;  2XAQ A;  4EGZ A;  3EET A;  3JAM K;  4U88 A;  1ZLJ A;  3F21 A;  2IT0 A;  4A5N A;  5K5O A;  4UXN A;  5FFX A;  3KE2 A;  3ABT A;  3DPT A;  4O6J A;  3HRM A;  1ZLK A;  4I0A A;  3DQV C;  3V8K A;  1W7P B;  3JTG A;  1Z1D A;  3GFM A;  4KMF A;  2MBF A;  4L0Z B;  3LAJ A;  3ZN0 A;  1G3S A;  3J80 Z;  4HV5 A;  4KNY A;  1O7L A;  4R1H A;  4L5J A;  3I59 A;  1B1B A;  1C0W A;  3CUO A;  2YR2 A;  1Z91 A;  4LG0 B;  2UWM A;  5ICG A;  1J2X A;  4KYW A;  3QPH A;  2MD5 A;  4IVN A;  4I0B A;  5K5R A;  3I64 A;  2J5P A;  3DF8 A;  1QGP A;  3TDU C;  2VXZ A;  3F72 A;  3QP5 A;  4IXA A;  4JK1 X;  4HA8 A;  1HST A;  2A5Y B;  4QWQ A;  3H3Z A;  2RVC A;  4CDG A;  1O3T A;  1QPM A;  3BPX A;  1FBU A;  1FC3 A;  4A5M A;  5KVR A;  2P5V A;  2VOD A;  3WTZ A;  1H0M A;  1IRF A;  3F6O A;  2XHK A;  4AIH A;  3TOA A;  2AXL A;  1P4A A;  5HDK A;  2PBI A;  1KU9 A;  2GXG A;  3KET A;  1DPR A;  2FQ3 A;  3RPU A;  4MQV A;  5HLI A;  5D5V B;  5D5W B;  2FF4 A;  1IN6 A;  2PQ8 A;  3JW4 A;  4HOB A;  3WE2 A;  1ZRC A;  1XN7 A;  2H6C A;  3WG9 A;  3WGI A;  4NQW A;  4GYG A;  1REP C;  5E1Z B;  1F4K A;  1FP1 D;  5H6Q A;  1S3J A;  4FT8 A;  1D8J A;  3BJA A;  3C3W A;  4ZYG A;  3I58 A;  5BOX A;  3T8T A;  2V9V A;  4PGH A;  3JTH A;  4R79 A;  3V4G A;  4N9I A;  1W5S A;  2DFI A;  1T6S A;  2EFP A;  2FMY A;  1OYW A;  1W7P D;  4G6Q A;  4ZH4 F;  1IAW A;  3MQ0 A;  2L02 A;  3J7A O;  3SHF A;  2R3S A;  4LD5 A;  3WTT C;  5AON A;  1G6N A;  1P2F A;  5L3G A;  1TW3 A;  1XGN A;  1BI0 A;  2Q0O A;  4FHT A;  1OMI A;  1UST A;  2KJB A;  4L9N A;  1UHM A;  2CG4 A;  3F8M A;  2ESN A;  5D5X B;  1YYV A;  3CDH A;  3PQK A;  2K27 A;  2BEO A;  2XKO A;  4KIC A;  2VC1 A;  3RPQ A;  2ZME A;  4KMU X;  1ZH5 A;  3H92 A;  2DK5 A;  3G3Z A;  5E20 A;  1R7J A;  4UV8 A;  3SXY A;  3T0Y A;  4XRF A;  1UFM A;  1FWZ A;  2M45 A;  5H6R A;  5KK1 A;  4EJV A;  1JHH A;  2ZCW A;  5DCM B;  2M5W A;  3GYH X;  1A04 A;  2EA4 A;  3MCZ A;  1DDN A;  3K9T A;  2Q2E A;  1G3Y A;  2KIM A;  3F3X A;  2HS5 A;  3FXR A;  4Z2Y A;  3E5U A;  1BIA A;  5FLX K;  6PAX A;  1ZYR F;  1IW7 F;  3M9A A;  1R58 A;  3J81 Z;  1SMT A;  4UVA A;  5J8F A;  1BJA A;  4GCV A;  1TNT A;  5JHU A;  2LDU A;  4MNU A;  4I09 A;  1Z05 A;  5LHG A;  2CFX A;  3KP7 A;  3WGG A;  1FSH A;  2CWE A;  3QAH A;  2OQG A;  1IN8 A;  4IHS A;  4M9Z A;  3RKX A;  2WWY A;  3HSF A;  3T8R A;  2DQL A;  1MZB A;  2ISY A;  1FLI A;  4KUM A;  1J7K A;  5LRS A;  5D8K B;  2V6C A;  4B8X A;  3ISP A;  3HHH A;  2XKP A;  2XVC A;  5L3C A;  4GGG A;  3B02 A;  1LDD A;  5HDN A;  3ZMD A;  5F64 A;  1DUX C;  1I6X A;  4WK8 F;  1LEA A;  2IRF G;  4M72 A;  4L0Y B;  3I0T A;  2IW5 A;  1YLF A;  5E8I A;  1U5T C;  3KEO A;  2DLL A;  5A2Q K;  1MJB A;  2HZT A;  4Y17 A;  1WQ2 A;  1F9N A;  4P5O A;  3I5U A;  2QLZ A;  3KZZ A;  2M8E A;  1LJ9 A;  3KCC A;  4CYD A;  5TRD A;  2F5F A;  2EFQ A;  1IF1 A;  3WGH A;  4WX9 A;  2RQP A;  3DEU A;  1XGS A;  3HHG A;  4ZYH A;  2A61 A;  3ZPL A;  4KT5 C;  5JR3 A;  3ML6 A;  3MEX A;  4IHT A;  2XV4 S;  2JZY A;  3BRO A;  1D5V A;  3M1E A;  3REO A;  1FYM A;  1FSE A;  1TBX A;  1XDU A;  4MEX F;  1ZRE A;  3G73 A;  1O7F A;  1HW5 A;  4D0P A;  3ZMZ A;  4WXC A;  2OQR A;  2L01 A;  5HS9 A;  3GLX A;  4OU0 A;  1PUE E;  4ZYD A;  5DD8 A;  4EJU A;  2K4J A;  1SFU A;  4IRI A;  4CXF A;  2QVO A;  4KIG A;  4R8H A;  2WC2 A;  1OYI A;  3GEZ A;  2A07 F;  1BIB A;  1ZAO A;  3CUQ C;  2Y0M A;  2NNY A;  3J80 K;  1F5T A;  1FYL A;  5JFR A;  1RIO H;  1B9M A;  1B9N A;  1USS A;  1S29 A;  3CUQ B;  1HQC A;  2Z5U A;  5ED4 A;  5DCF A;  2HTJ A;  2O8X A;  1WRJ A;  2RV8 A;  3KEQ A;  1YS7 A;  3TO6 A;  1RUO A;  4EM0 B;  5CJ9 A;  5D8L B;  3QP6 A;  3KP5 A;  1I27 A;  3JSO A;  5ICF A;  1G3T A;  3GW2 A;  4CZZ A;  4H0E A;  4RGX A;  4A2U A;  2WTE A;  4JBA A;  1P6R A;  2OA4 A;  4LMY A;  2LF8 A;  4G7O F;  5JVT A;  5E18 F;  3HOT A;  2QBY A;  1YS6 A;  2DTR A;  1GXQ A;  4P55 A;  4OIR F;  4P96 A;  2XAJ A;  1KQ0 A;  4BHP A;  4G9Y A;  2ZO4 A;  3KP4 A;  3GFI A;  2FNP A;  1XD7 A;  3ZMU A;  1U5T A;  4PDK A;  5LHH A;  2FML A;  3WTS C;  4LLG F;  4OIQ F;  4BH9 A;  2A69 F;  1WWX A;  1SD6 A;  1SD4 A;  2F5C A;  2MH9 A;  4BYY A;  5LLQ A;  5L3D A;  4UHT A;  1DPU A;  1TQI A;  1XGO A;  5CVV A;  2FRH A;  2DBB A;  2M1B A;  1Z9C A;  4NB5 A;  1FZP B;  1XGM A;  2P6S A;  3SQN A;  3GX4 X;  4HZF A;  1Q1H A;  1LEB A;  4HF2 A;  4G8X A;  4CHU A;  2GWR A;  3RYP A;  1ZAR A;  4L9J A;  2XUB A;  5BQT A;  4GO1 A;  3TO7 A;  3NEU A;  1LB2 A;  1V4R A;  2FBI A;  3V7C A;  2TDX A;  4LFU A;  4LB6 B;  2PJP A;  4KIB A;  2XIG A;  2ZNZ A;  5IT9 K;  2BGC A;  2ZME B;  2A6E F;  5FO5 A;  1KU7 A;  2ADU A;  4XLN F;  2GXB A;  2DU9 A;  4YFN F;  4HX7 A;  3OV8 A;  2XAH A;  4I98 B;  2FA5 A;  3TO9 A;  3ZMT A;  2P5L C;  4EM1 A;  2JSC A;  4KDP A;  3CTA A;  2CSO A;  2NRA C;  2QEN A;  2PG4 A;  2IP2 A;  4ASN A;  4HDU A;  3Q5F A;  3CUQ A;  1XSX A;  2J5O A;  2DPD A;  1J0R A;  1BOA A;  3AAF A;  1T2K A;  1CF7 A;  2JRT A;  1EH6 A;  4AWX B;  2ZXJ A;  2HYG D;  4JQF A;  3HOS A;  2A3S A;  4LK0 F;  3P9I A;  1KYW A;  1T39 A;  1QBJ A;  2PEX A;  3BJ6 A;  5D6E A;  1I5Z A;  3KP6 A;  4OOI A;  2HQN A;  3LA2 A;  5LGN A;  1SFE A;  4BAY A;  3JAM Z;  5HDG A;  5CVU A;  2K02 A;  4RB0 A;  2P7V B;  4QLC U;  3LWF A;  4KN4 X;  2OZU A;  1IXC A;  1XMK A;  4RGU A;  1LDJ A;  5FD5 A;  3LAP A;  2PMH A;  4U0W A;  1GXP A;  4N0B A;  2P4W A;  2DPU A;  1JE8 A;  2XAF A;  2X0L A;  2RN7 A;  1D3Y A;  1IXR C;  5J8C A;  1FNN A;  1R5H A;  2HWV A;  3L00 A;  4M9X A;  3FM5 A;  2OZ6 A;  4A12 A;  3SZT A;  3F8F A;  3HYI A;  2KJC A;  1LVA A;  5FGM A;  1MJA A;  5CVJ A;  1YIO A;  3E6M A;  5LBQ A;  3R61 A;  1R5G A;  2Y48 A;  1HW2 A;  3M8E A;  1YW8 A;  2HYF A;  3I4P A;  3PFI A;  4BNC A;  4Q47 A;  3KLN A;  1HKS A;  4Q48 A;  3IKV A;  1B6A A;  1H9T A;  2G7U A;  2Z9O A;  4O5V A;  2W24 A;  1PDN C;  1MJ9 A;  1P4W A;  4KN7 X;  5E1X A;  2O61 A;  1ZGA A;  1TW2 A;  2RNJ A;  4OIO F;  4S05 A;  2E1N A;  1FYK A;  1I1S A;  2ESH A;  5DV5 A;  1YTY A;  2H94 A;  2VN2 A;  1K7A A;  2ACJ A;  1WKM A;  5LEK A;  2FE3 A;  2B0L A;  2A6H F;  4G7Z F;  1BI1 A;  4U7B A;  3LQQ A;  1HKT A;  4LLL A;  2BV6 A;  1ON2 A;  3K1P A;  3S2W A;  2DK8 A;  1IUY A;  4A0X A;  5FD6 A;  2CW0 F;  4OMY A;  2P8T A;  4UVC A;  3BDD A;  1FBQ A;  3HSE A;  1O3Q A;  4EVI A;  1S7O A;  1WI9 A;  3L9F A;  2ZBK A;  3KZY A;  4KIF A;  1KA8 A;  4M71 A;  3CJN A;  4EM2 A;  2VBX A;  1UCR A;  1OYY A;  4HAM A;  3FHZ A;  2O6G E;  3U1D A;  1TLH B;  5DYM A;  1UHW A;  1YG2 A;  3IRR A;  4EJO A;  1XB4 A;  1U3E M;  2EK5 A;  4Q5S F;  1Z7U A;  3HTU A;  1LNW A;  2P5K A;  1FT9 A;  2R7F A;  3GXO A;  2QBY B;  3E97 A;  4ESF A;  3DXJ F;  3C7J A;  1D8K A;  3VOD A;  3CO6 C;  3C1D A;  1STZ A;  4KFC A;  1U5T B;  3N4M A;  1IRG A;  5FFZ A;  3BJO A;  1J5Y A;  1BC7 C;  1I1G A;  2BE5 F;  3IWF A;  5CLS A;  1X3U A;  3K1N A;  3F22 A;  2MLG A;  2VT3 A;  4YFX F;  3T5X A;  2KIU A;  5J6X A;  1MDM A;  3WTX C;  1K78 A;  2VOO A;  5L3B A;  1XCV A;  3I54 A;  2PLY A;  1HBX G;  3IKT A;  3B73 A;  2EV6 A;  1IN7 A;  4TV7 A;  2ELH A;  4YG2 F;  1L3L A;  3NQO A;  3RJP A;  3VOE A;  3ULQ B;  4ETS A;  3WOD F;  2IA1 A;  5CYV A;  2VOP A;  1ODD A;  4EQQ A;  3E6B A;  1U2W A;  3ECH A;  3L7W A;  3MZY A;  4OIP F;  2VBZ A;  2XGX A;  2E1C A;  1TTY A;  4P9U A;  2DT5 A;  2COM A;  4M73 A;  2DAO A;  3I71 A;  3RIR A;  2BYV E;  1H9G A;  3MAJ A;  2XAG A;  3N97 A;  5HOO A;  3BPV A;  2EFW A;  2FOK A;  2W84 A;  4IRG A;  5CVI A;  5CVR A;  1BI2 A;  1YW9 A;  2EWN A;  2R7D A;  4N9H A;  1BI3 A;  4HDV A;  2JTV A;  3DV8 A;  2JPC A;  3DPL C;  1YQA A;  1QNT A;  3TDZ C;  4EGY A;  5DUK A;  2Z99 A;  3K2Z A;  3Q9V A;  5AIP A;  3DKW A;  1IXS B;  1EH7 A;  3HSR A;  3JSP A;  3ABU A;  1ZG1 A;  2UXX A;  4GYI A;  1CF7 B;  1YO5 C;  1ZRF A;  3IWZ A;  4ZYE A;  3GF2 A;  2RGV A;  2FSW A;  4L18 B;  1F1Z A;  1G4D A;  3M7G A;  3E6C C;  2EFO A;  1P4X A;  4LJZ F;  3WTW C;  4G6D A;  5HVQ C;  4RB1 A;  3O3K A;  2YU3 A;  4ENJ A;  1K6O A;  3GFJ A;  2FEZ A;  4AIJ A;  5HS7 A;  1J59 A;  1ZRD A;  1JHF A;  1RZ4 A;  1KU3 A;  3FMS A;  2NNN A;  3MFK A;  1K79 A;  4U7D A;  1FY7 A;  2QYO A;  4WCG A;  4F7Z A;  4ZZD A;  2IA2 A;  2QWW A;  3LQR A;  2HDC A;  2VON A;  1JXS A;  4ON0 A;  2ZJ2 A;  1G3W A;  2KIF A;  1MD0 A;  1JGS A;  4P9F A;  1VTN C;  3I53 A;  4AVP A;  3VFZ A;  2CGP A;  3EYI A;  2FXA A;  4AD9 A;  2QZ8 A;  3ROU A;  4ZZL A;  5L3F A;  2V1U A;  4RS8 A;  2E7W A;  1FX7 A;  1QZY A;  2MH2 A;  3IHU A;  4CO8 A;  4WF2 A;  3RTR A;  2NS0 A;  3QRF F;  2YX4 A;  3GUD A;  1CGP A;  2GA2 A;  1UB9 A;  3EQL F;  1KQ9 A;  1QQI A;  1XSV A;  4HW0 A;  5ICC A;  1HXD A;  3FX3 A;  3ZP5 A;  1XSD A;  2HEO A;  2MC3 A;  3QU3 A;  5LGU A;  1AWC A;  3QU6 A;  2DQR A;  5K1Y A;  3VEP A;  2OD5 A;  5L3E A;  2E7X A;  4HQE A;  3HTS B;  2OAZ A;  3WTY C;  2D45 A;  1XDS A;  2RDP A;  1SAX A;  2DW4 A;  4ENN A;  2K7L A;  3RYR A;  2EJR A;  4RAZ A;  4EMS A;  1MGT A;  2DO7 A;  2RC4 A;  2H6B A;  4IJA A;  2GAU A;  3GVA A;  2RKH A;  3L09 A;  1W4M A;  2KKO A;  2Q8K A;  3ZN1 A;  3ECO A;  3MZH A;  4WWC A;  2EA2 A;  1Z6T A;  3M8F A;  2GQQ A;  1O57 A;  1XMA A;  2DI3 A;  3IC7 A;  4M6Y A;  5DEQ A;  1Z6R A;  1BN5 A;  2IA0 A;  3CLO A;  1R23 A;  3K1M A;  1ZG5 A;  2IPQ X;  4LK1 F;  2YX7 A;  3V7S A;  5D4R A;  4YII A;  2QUF A;  3E5X A;  2EV0 A;  4Y13 A;  2D2W A;  4HQM A;  2AS5 F;  3GZ5 A;  5D4S A;  3IL2 A;  4HBL A;  1TNS A;  4RGS A;  4HX4 A;  3L2C A;  2HQR A;  1PP7 U;  3F6V A;  2LF7 A;  3E5Q A;  4BQA A;  2K4B A;  2F2E A;  2PMU A;  5F1R A;  4EJT A;  4UUV A;  3LA3 A;  4G94 A;  1QZZ A;  1R1T A;  2Z33 A;  2ZNY A;  3J81 K;  2V1D A;  3D0S A;  2LSO A;  1R1U A;  4FX4 A;  4GXO A;  4PGG A;  3ELK A;  2XRN A;  4LGW A;  3FZV A;  1YFH A;  4HLX A;  2HGC A;  3COA C;  1OR7 A;  4L5I A;  1FOK A;  1KGS A;  3R4K A;  1GHC A;  2OU2 A;  1FPQ A;  1R36 A;  3PQJ A;  2FBK A;  5D6F A;  2VE9 A;  3BY6 A;  3P7N A;  4RGR A;  1T0F A;  4A6E A;  2OBP A;  3K0L A;  1FP2 A;  1BM9 A;  2EB7 A;  4BHC A;  2PN6 A;  3RI4 A;  3U9G A;  1PP8 F;  2L3D A;  2VBY A;  1LQ1 A;  4YIF A;  4IRH A;  4Y15 A;  1HKQ A;  1ZG3 A;  3Q9S A;  2HKX A;  5IT9 Z;  2GZW A;  3MWM A;  2IVM A;  1P92 A;  2NAZ A;  4YFK F;  4UVB A;  3RKY A;  3KFW X;  3F8C A;  2W25 A;  3WE3 A;  2K86 A;  1LDK B;  1SMY F;  4ESJ A;  5BPI A;  1W7P A;  2D1H A;  3EDP A;  4I01 A;  2V79 A;  1MDM B;  2G7H A;  3LST A;  4U0V A;  1K78 B;  1NHA A;  5DDG A;  3EYY A;  3NRV A;  5LGT A;  4HV6 A;  1ON1 A;  5JI6 A;  5ILU A;  1ZHF A;  2FU4 A;  4UNO A;  1EV7 A;  2BBY A;  2XRO A;  2EFN A;  3TKY A;  2O03 A;  3GWZ A;  2QM3 A;  1FBS A;  3O6B B;  4LB5 A;  3OOP A;  3QPT A;  5BS6 A;  4DQ2 A;  3KP2 A;  4OIN F;  4G7H F;  4RAY A;  3ERE D;  2VE8 A;  3W6J B;  2YPR A;  2QQA A;  5DUI A;  4LG0 A;  2LNB A;  5EEG A;  2P7C B;  3F23 A;  2ZKZ A;  2IJL A;  4U0Y A;  1MKM A;  3P9K A;  3D5L A;  1L0O C;  3V7R A;  3HRS A;  3U2R A;  4B09 A;  1J9I A;  2WV0 A;  3WU1 B;  4ENK A;  4HYE A;  4XLP F;  2H27 A;  2O3F A;  4NHJ A;  5E1W A;  5E17 F;  4M9S A;  2V1X A;  1U6G A;  4LLN A;  1BC8 C;  1SFX A;  4PCQ A;  3BOQ A;  3SFZ A;  4HF1 A;  2VT2 A;  1U8R A;  5HS8 A;  4I02 A;  4HLY A;  1BBY A;  3HRT A;  4ENM A;  3RKW A;  5LRR A;  5HLH A;  5BPD A;  3RDI A;  1T98 A;  4AIK A;  2UXN A;  4FX0 A;  1S8N A;  2JT1 A;  4DNC A;  4KA4 A;  3R0A A;  1R1V A;  2XAS A;  4HF0 A;  2STT A;  3GFL A;  4MEY F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...