1Y1VJ

Refined rna polymerase ii-tfiis complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1y1vJ00
1FTZA 2LY9A 3ZQFA 4V2FA 2LVSA 2ID3A 1ZK8A 1X58A 5E3LA 1Q1VA 2XGEA 1FEXA 4JX5A 5FKOA 1QVUA 1BA5A 4RDUA 5FKMA 1ETQA 1FJLA 2LFBA 3G1OA 3FKIJ 3GTGJ 1APLC 2VPRA 4FISA 1HDDC 3HGYA 4DYCA 3GTLJ 4MFDA 4XICA 1NK2P 5K7ZA 3S15J 4Y52J 4M3FA 3NARA 4MFEA 4BY7J 3OSFA 2ME0A 2FJ1A 2O8KA 1U9NA 2XPWA 5E3OA 3IH2A 5C44J 5FLMJ 3LNQA 3WHCA 2DA2A 3HGGA 3ZQGA 3BT9A 3FK7A 2DMUA 3IH4A 1JKQC 1ZGWA 1TWCJ 3HDDA 1U78A 1UHSA 3BQZA 4M3BA 2IAIA 1ETXA 2FD5A 2CQXA 1RESA 3BG9A 2DA7A 1DU0A 3WHBA 4A3CJ 2CU7A 2OF7A 1JTXA 3A02A 1W0UA 2JWTA 3BR5A 4UUTA 5F08A 2LLKA 1T33A 2K40A 4L5EA 4FCYA 5FJ8J 4JX6A 1ZTRA 3CMYA 2MW8A 2Y30A 2ID6A 3L1PA 1ENHA 4A3EJ 2B63J 5F0CA 1RKWA 3PM1A 1GV5A 5K7HA 3GTPJ 1Z0XA 1OCTC 3GTKJ 5FKKA 4GFBA 3HM5A 2GM4A 2CJJA 3BQYA 3BR6A 3TEDA 2CRGA 1ORKA 2DMPA 3Q0UA 4BBRJ 4FE4A 3HEFA 1Z77A 2Y2ZA 4XRSA 1X2MA 4HNVA 2DA4A 1MSEC 4M3GA 1BL0A 1ITYA 1JKRC 4XIDA 3S16J 3LSPA 2DA5A 3D1NI 2EZLA 5F0FA 1TC3C 4CYCB 1LFUP 3A01B 3LSRA 1HDPA 3C2BA 3FISA 3I4NJ 4IHWA 3CQZJ 3HOYJ 4M3DA 5M3MJ 3S1NJ 1F43A 1JGGA 2NS7A 4DYRA 3BG3A 2ELKA 1GUUA 3S2HJ 5IYBJ 3S2DJ 2LD5A 1IC8A 2R92J 3IV5A 2L0KA 3OOUA 4Y7NJ 3RKQA 5FKLA 2JK3A 3BTJA 2XRLA 4BKXA 5M5WJ 2W48A 1E3OC 5M5XJ 1QPIA 3SFIA 4A3BJ 2IEKA 3VPRA 3GTMJ 2DJNA 3B6AA 1FIPA 3O8GA 1NK3P 3TP3A 1K61A 3TW7A 2JA8J 1GV2A 1AU7A 5EF6A 2ZB9A 1WPKA 3BTIA 4C3HJ 1AHDP 1BJZA 2E2IJ 4IHXA 2EQRA 3H0GJ 2TCTA 1ETOA 4X1EA 3GTOJ 3NAUA 2DTZA 2HOAA 2VI6A 2XSDC 1MNMC 2N8GA 1WI3A 1QRYA 1WCMJ 2X9DA 1H89C 1S7EA 1BW6A 3ZOBA 3IH3A 1IRZA 4B1RA 4XRMA 5IOZA 1HCRA 3BTCA 5IYCJ 2R5YB 4MO7A 3W6VA 1TWAJ 1MBKA 3LOCA 4DZPA 3CCYA 4QSHA 4DZJA 3S1RJ 4DYQA 3TW6A 3RZDJ 1HLVA 3JRGA 1H8AC 2R93J 2FX0A 3M3YJ 1JTYA 2NVTJ 1LE8B 2HYJA 4C3IJ 3FK6A 2VKVA 5DTDA 3QQAA 1GDTA 1YRNB 2L9RA 4IHYA 3ZQCA 4A3LJ 3A03A 1PUFB 2KDZA 4I76A 1MBEA 4D7NA 2AO9A 1UMQA 2X48A 1MBJA 2WAQN 5IP9J 3S14J 4AC0A 2VUMJ 1RR7A 2CQQA 4CYCA 4JYKA 2JMWA 4B3AA 5DS9A 1ZR2A 3PO2J 3A01A 2P81A 2JA5J 3HB9A 1JKPC 4A3KJ 2Y31A 3E7LA 3S1QJ 5GPCA 2R5ZB 5IOYA 1P7IA 2R0QC 2DA1A 4FE7A 1WH5A 5J1YA 1IUFA 1P7JA 2E19A 3K7AJ 4G12A 5EG0A 2EH3A 3JRBA 1X2NA 4M6VA 3PO3J 1JJ8C 4D7MA 2CUEA 1GVDA 2XB0X 1JJ6C 2XGDA 4X6AJ 1LFBA 1POGA 1FIAA 5J1UA 1IJWC 1SFOJ 2JA7J 1WGXA 1ZR4A 3DEWA 3QPLA 3RZOJ 2XPVA 3RQIA 1NTCA 5HODA 4BY1J 4D5CA 2NS8A 1XG1A 4W1UA 4D5FA 3Q0WA 1RETA 1B8IA 2FQ4A 1TWFJ 4A3DJ 2WB1N 4DW6A 1MH3A 4JP0A 1VFCA 4BBSJ 1H88C 1IDYA 2M0CA 2H8RA 1ETKA 2DA6A 2R5YA 4XRSG 4QIWN 3MVPA 3BTLA 3SJMA 1ETYA 1ZQ3P 2Y9YA 3JRIA 3HBLA 3JRDA 4A69C 1RKTA 1JUMA 2LTPA 3G1LA 4C3JJ 3F0CA 2NVXJ 2G0EA 1VI0A 1ETWA 1AKHB 4XK4A 3BR3A 5M3FJ 4JX4A 5IP7J 2Y0SN 1LE8A 4AYBN 1XS9A 1G2HA 5F04A 3OSGA 5IP6A 1B72B 4RBOA 1YRNA 4A3FJ 4UUSB 1JUPA 5EGOB 2XGCA 1PUFA 2VKEA 3LSGA 4A3MJ 3DCFA 2M9HA 1JUSA 1I50J 2YS9A 2NOGA 2NVQJ 3GBGA 1Y1VJ 2COBA 3JRFA 5E3NA 2QCOA 4M3EA 1EF4A 5J3LA 3M4OJ 3HOVJ 9ANTA 2E1OA 1O4XA 5IPAA 4B4CA 3JR9A 3S17J 2K9QA 1MBHA 1R9TJ 3OIOA 2NVYJ 2E2HJ 4IEJA 4I6ZA 3ZQLA 2WV1A 3HOZJ 2L7ZA 2LR8A 2MG4A 3SDGA 3HOWJ 5GPAA 1A6IA 5C3EJ 1OCPA 4FTHA 1IG7A 2Y9ZA 1TWHJ 2HDDA 1BW5A 1W0TA 1I3QJ 2HOTA 2TRTA 3K2AA 2O9LA 4BXXJ 4A3JJ 5EDNA 2K9SA 3MN2A 2HXIA 4J19A 2ECCA 2EZHA 2GLOA 3GTJJ 2LP0A 2LK2A 2X6OA 5C4XJ 3G1MA 1ETVA 1U8BA 2M34A 3GTQJ 3HKZN 1HOMA 2LKXA 3B6CA 4A3IJ 2HXOA 2K9NA 2JN6A 2XPUA 1QVTA 2PMZN 5GP9A 1IV6A 2E2JJ 3I4MJ 1XC5A 4S0HB 4C2MJ 2O7OA 5EYRA 1K83J 2GBYA 2JJ7A 5K7FA 2MGQA 4AUXA 2EZKA 3Q0VA 2QF7A 3HOUJ 4W97A 1IDZA 1WH7A 2HOSA 5EZGA 3O8HA 1JT0A 1AKHA 1UG2A 1TWGJ 2HQ5A 2DN0A 4IHVA 2CUFA 3BG5A 3BR2A 5BNGA 1MH4A 2OPTA 4NDLA 1OFCX 2D5VA 1B72A 1SANA 4UUSA 5EZHA 3JREA 3H3VK 5EGOA 1U9OA 1I6HJ 5EEAA 5JLXA 3LSJA 1RPWA 2ECBA 2L7MP 4QTRA 4A3GJ 2DMTA 5M5YJ 1JT6A 2RAEA 4ABZA 1MSFC 2EBIA 3Q3SA 1VNDA 2ME6A 1CQTA 2HI3A 3BR0A 4MLOA 1Y1WJ 1ZKGA 2XB5A 2YUSA 4EEFG 2DMNA 3BR1A 2L7FP 2IBDA 2DMQA 5IYDJ 3ZQIA 2JA6J 4V2GA 1D5YA 2H1KA 3JRHA 1FTTA 1F36A 3MKLA 1A5JA 3CDLA 5FLVA 5F27A 5EG0B 1IGNA 3ZQHA 2M8GX 3FIWA 3UKGA 1OJLA 2EZIA 3QPSA 4MIMA 1VF9A 1GT0C 3HOXJ 3TP0A 3S1MJ 5JLWA 1JKOC 5E3MA 4LOCA 1MBGA 5J1RA 5F1JA 3JRCA 2DA3A 2KT0A 1DU6A 2MSYA 4A93J 1HF0A 5FKNA 1MBFA 5C4JJ 1B8IB 5F0HA 1T56A 3JRAA 2R5ZA 2I10A 2YU9J 2M2EA 2AHQA 2R7ZJ
chains in the Genus database with same CATH superfamily
3K4NA 1TL8A 2CW8A 2ZCWA 3BJOA 4D9JA 1RRJA 1Q1VA 5IY5H 4C30A 1X1DA 1FEXA 2IJLA 1VTNC 4IHSA 2XV4S 2AQEA 4C2UA 2K3FA 2HDWA 3G1OA 4OIRF 3FKIJ 5HNFA 2KZVA 2VPRA 3HGYA 1NK2P 5K7ZA 4M3FA 4MFEA 2FJ1A 1U5TA 4E7ZA 1YIOA 5GTIC 3GO5A 1U9NA 2XPWA 5C44J 3LNQA 1V5EA 2W00A 4RB2C 4EM1A 4CSWA 1YS7A 2ZXJA 3BT9A 4CICA 3HOSA 2O0YA 4IHTA 1TWCJ 3U2RA 4WXCA 4BGDA 1D0YA 2R7UA 2FBKA 1U78A 1LEBA 3F8CA 5LEKA 2L02A 1ETXA 2F4IA 1GXQA 2CQXA 3OV8A 1KYZA 4UUVA 2DA7A 3W2WA 3WU2C 2CU7A 1JTXA 3A02A 5BOXA 1YJNI 1W0UA 2JWTA 3L2WA 3UNGC 1ZG5A 3CC2I 2K40A 2OAZA 3HIFA 4L5EA 3CLOA 4CCNA 3CF2A 2XUBA 3QAHA 3DLLF 3CMYA 2Y30A 2ID6A 4BL0B 3L1PA 4A3EJ 2B63J 1BR1A 5F0CA 3T8RA 2FXAA 5TRDA 3PM1A 1GV5A 5K7HA 1J0RA 2ISZA 3CC4I 1FSEA 3GLXA 2VC1A 3TOBA 1MDMB 2XF7A 1W7PB 3DV8A 3Q0UA 4BBRJ 3BCBA 3HXLA 5LGNA 3L2UA 4XRSA 3CUQA 2PI0A 3ULQB 4CCLA 4EM0B 2VOOA 3S16J 2F2EA 4MTEA 4FX4A 4V19K 2A68F 3LL7A 1HBXG 2GOMA 2WADA 3K4MA 2DO7A 4CYCB 3HUGB 4PJNA 3BJAA 5DDGA 1XDSA 5H2FC 1W36C 4AIKA 5LD2C 1HDPA 3I4NJ 3FXRA 4LIUA 1X1BA 2X4HA 1W5CC 2HEOA 2FQ3A 2NS7A 1PUEE 3RDIA 2ZSIB 2X6YA 1GUUA 3S2HJ 1WVRA 3CLQA 4IOAF 2KISA 2LD5A 1K6YA 2R92J 3CCEI 3IV5A 4P96A 1S3JA 3NEUA 4OMYA 2MYSA 3QYEA 4IXAA 5FKLA 3RKQA 4N4OB 5JVGF 3BTJA 1QPIA 3F21A 5M5WJ 5M5XJ 2MLKA 3OYDA 2XC7A 5DD4A 1NK3P 1UHWA 2QKMB 2P7CB 1XD7A 4I02A 3H35A 1SEUA 1OCOH 2XAJA 1BI1A 1Y56A 1AU7A 1MMSA 4H4KC 2ZB9A 1IF1A 3E6MA 1AHDP 3M07A 4KJZA 2IA2A 3ELKA 2BW3A 1XMKA 5A2QK 5EEHA 3GTOJ 1VQ5I 1WQ2A 2DTZA 2HOAA 3NAUA 5HS8A 3OR1C 2XSDC 2A05A 3FXLA 2HGCA 3QWLA 1QRYA 2GOXB 1I27A 3ZN0A 4RGRA 3CCVI 2H6CA 4GCVA 4EJUA 3VOEA 1H89C 2CUJA 3QPHA 1BW6A 2NNNA 3BPVA 2OZ6A 3IH3A 5ICEA 5JR3A 4B1RA 1BBYA 4LB6B 2DDAA 1YTYA 3BTCA 2KIUA 2R5YB 4EGYA 1FYLA 3FXQA 3WGGA 2EV0A 3DPLC 1XX5A 3LOCA 3RQ4A 4DZJA 1Z05A 2LRDA 3E5QA 1HLVA 3ROUA 2KHMA 2MC4A 4XSZF 3WU1B 1FLIA 1HQCA 3LA3A 4F55A 1UFMA 2F5FA 2A6HF 3ZQ7A 2R93J 4CCOA 2Y0SA 2E1NA 1TNSA 3CZ6A 2NRAC 1XMXA 5BPDA 1B1BA 1JTYA 3F72A 1OCZH 3RPUD 4C3IJ 4XBFA 2HKOA 2VKVA 1JGSA 4RAZA 4JBAA 2BYVE 4A3LJ 2GQQA 4I76A 2ISYA 3E6DA 4RB1A 4FT8A 4BS9A 3BDDA 4CCMA 1HSTA 1OPCA 2AO9A 3L2VA 5IP9J 3OYLA 2RNJA 1O57A 3V8LA 1R71A 3N05A 3V8JA 2FE3A 2VT3A 3OS1A 2W85A 3SEZA 2R7RA 5HS9A 1AWCA 4L5JA 3PO2J 2P81A 4UVCA 2A3SA 1JKPC 4PJJA 5HLTA 5LRSA 2QUFA 4ITVA 3E7LA 2V9PA 5GPCA 4G7OF 3BJ6A 3ECHA 4IVNA 1SD7A 3T1BA 4BHCA 5EG0A 2COMA 3TBIA 4HX7A 4PZJA 4OOIA 2F5EA 3T5XA 3VWBA 1IV8A 1HSJA 3DWLE 4D7MA 2CUEA 1O3TA 3TO9A 2XB0X 1JJ6C 1POGA 2WTEA 3FHZA 3RSNA 2EFWA 4NHJA 1H9GA 2L2OA 4IRGA 2Y0MA 1A6QA 2EB7A 3GFLA 1PP8F 3QPLA 3RZOJ 1LQ1A 2HVRA 5HODA 3HHGA 4XORA 2RNGA 4W1UA 3JAMZ 4D5FA 3DBLB 3Q0WA 4BJ6C 4FHTA 2HPMA 3CDIA 4JOMA 3BLYA 2WB1N 5ICCA 1R1VA 3Q9VA 4DW6A 1MH3A 3RCOA 1VFCA 4XKWA 5DM7F 1H88C 2EV5A 4M9XA 4BAYA 2M0CA 5D6EA 5J4VA 1ETKA 1UB9A 4EVIA 3J7AO 1GVJA 2EV6A 2XDVA 4A5MA 2Y9YA 4HV6A 3JRIA 2VBYA 3K69A 3A1YA 2CFOA 3HBLA 2QQBA 2FMLA 3L2CA 4C3JJ 4GXOA 2OU2A 2IT0A 1IO2A 4A6EA 2MFZA 1EKEA 1ETWA 2D1VA 2V1NA 2XAQA 4XK4A 4XM3A 5CVRA 2KIQA 5GAGJ 1E17A 4AYBN 1XS9A 2K3PA 5F04A 3PIOF 1K78B 1B72B 4RBOA 1YRNA 2JRMA 1ZRCA 2XGCA 4Z2YA 1HA8A 3DU5A 3KFWX 3DCFA 3GZ6A 2M9HA 1IUYA 4EJTA 1NG7A 3U9GA 2R4GA 3CUQB 4JK1X 5HVQC 3GBGA 3WTTC 1U2WA 3ZMUA 5KAFC 2ZC2A 1IRGA 1EF4A 3M4OJ 4O5VA 1SD4A 3OIPA 3MKZA 4NUBA 3JR9A 3KIOA 5B1AH 3PNTA 1R9TJ 2HS5A 5D5XB 2OV7A 1Z1DA 3ONQA 4ENJA 1Z6TA 3DBRB 2P6SA 2JPBA 2K86A 2KL4A 5GPAA 2M7BA 4HLYA 4UVBA 3J81Z 2P6TA 1MJBA 4FTHA 2D45A 1KU2A 3E0JB 1GLNA 4GGGA 2Y9ZA 1SVOA 1KQ9A 4NC7A 3WE2A 1EH6A 2HDDA 4ESFA 1OCRH 2GA2A 1YE9A 1W0TA 3ZMZA 2RC4A 2HOTA 3K2AA 1SVMA 2W25A 4BXXJ 2XF6A 4O6JA 5KAIC 5EDNA 4BQOA 4PK4A 2HXIA 1P4WA 2OC6A 3TDZC 1MMDA 3RKYA 2ADUA 3G73A 1IN8A 3GZ5A 1XTAA 1VQ7I 5C4XJ 4HZFA 4Y17A 2A5WA 1FPQA 2WC2A 1YIJI 3HKZN 2QQ9A 2PG4A 4CZZA 4A3IJ 5E20A 2JN6A 4BHBA 2XPUA 5FLXZ 4N9HA 5DUKA 1QVTA 2GIVA 2IP2A 1YLFA 3FMRA 3QPTA 1AA7A 2Z33A 2DBBA 3LQQA 5ED4A 1VQ9I 2Z16A 1MMAA 5LRRA 2GXAA 3HSRA 1D3YA 1ZARA 3HYIA 2MGQA 1S7OA 5IT3A 3MD2A 3R0JA 4AUXA 3Q0VA 3C18A 3GWZA 2NYXA 4ENKA 2HOSA 1Y0UA 3LA7A 4RAGA 5EZGA 2M4KA 1ZG3A 2KKOA 2RV8A 2L01A 3EUAA 3PUFA 2HQ5A 2DN0A 4BACA 2PMUA 1ZHFA 3L2RA 4G7ZF 5BNGA 4CH7A 2OPTA 2JRTA 4L9VA 1QGPA 3JREA 1T2KA 1YX3A 5EGOA 4EGZA 3M8FA 2QWWA 5JLXA 4HG2A 1DDNA 5ILSA 2LF8A 2DOEA 1RPWA 2ECBA 5K5QA 3LSMA 2RREA 2CQKA 4A3GJ 1HXDA 1MSFC 6PAXA 1B59A 4DJAA 3DEUA 2VIXA 2WBMA 4MLOA 1IW7F 4EEFG 5CQGA 4GYIA 4QLCU 1LJ9A 1FZPB 1ZELA 3FHNA 4IQ4A 5GADJ 5FD6A 1FBSA 5ILVA 3CCSI 2VBWA 1QNTA 2W82A 4DQ2A 1LDDA 3ZQIA 2JA6J 2PEXA 2H1KA 3DTIA 3JRHA 4XNFA 1FTTA 1XSVA 2NXNB 4YFNF 1A5JA 1X1CA 3MEXA 2R7FA 2BGCA 2V4JC 2VJIA 2ZNYA 5EG0B 1RIOH 1IGNA 2VE8A 2M8GX 2DDBA 3FIWA 2EZIA 3QPSA 2HYFA 4AIDA 1VF9A 4M71A 1KU7A 3OS2A 3KLOA 3KP7A 3F9KA 3IWZA 1YS6A 2J5OA 3W2AA 4HLXA 2JPCA 3CCLI 1JE8A 4P5OA 3OYHA 1HKSA 1BI3A 2MSYA 4PGHA 3J80K 2XKOA 1T56A 4BU2A 2XHKA 2YX4A 2E1MB 3JCUC 2HYGD 2E71A 4YFKF 4G9YA 2E5ZA 5H6RA 1X58A 4EQQA 2WA0A 1X3WB 3FXMA 1WSUA 1W5SA 1QVUA 1XGSA 4RDUA 1ETQA 4BJ5C 2G9WA 1VQNI 1ZGJA 1Z21A 3IRQA 3ZR8X 2KMUA 2D2WA 1K4SA 4U0WA 2VONA 4WXHA 1HDDC 2QBYA 2O5RA 1G4DA 3GTLJ 4MFDA 5IT9K 2CQ7A 1HW5A 3FXOA 3OSFA 4R1HA 4BY7J 4L9NA 4J01A 5ILUA 2O8KA 2XIGA 2QEXI 1Y8QB 2XAFA 3QOEA 3S32A 3GMEA 3HGGA 5TGTA 2V9VA 5E79C 2DFEA 2QZ8A 3I54A 2Q2EA 1FNNA 3IH4A 4HEA2 4UB6C 4MNUA 3VYTB 1ZGWA 2ZFWA 1QZZA 1UHSA 1Z67A 3PQJA 5D5WB 2GWRA 2FUG2 2IAIA 2P7VB 1XSDA 3BG9A 4CHUA 1IXCA 1KQ8A 2OCCH 4CCJA 2V1XA 1PDNC 3JW4A 4UV8A 4A3CJ 2OF7A 2ZMEC 1UG0A 2V9KA 5FB2A 1X1AA 4HQEA 4F92B 4HYEA 1T33A 4AWXB 4BE2A 3K70D 4ENNA 2WWYA 5FJ8J 3IP4B 3OYEA 4DOZA 2HVQA 4JX6A 1ZTRA 3OYFA 1IN5A 2MW8A 1O3RA 3I9V2 5F1RA 2KFDA 1LPQA 4EJOA 2YU3A 4E7SA 2KJCA 1XGOA 1WI9A 3FKJA 3HOTA 3L9FA 4U0VA 4GFBA 1XGNA 2G7UA 3QOPA 4HX4A 3A4CA 4BDZA 5DEQA 3BQYA 3BR6A 3EUHC 3LWFA 2DT5A 1LVKA 2CV1A 5HDNA 2DMPA 2QGUA 2IS2A 3FMQA 4RMNA 1X3UA 4FE4A 1EV7A 3GFMA 2Y2ZA 2KZGA 1JHFA 3SZPA 5FFZA 4HRIA 2J5PA 2WAQA 4OAZA 4M3GA 2IGMA 3KYLA 3F22A 1Y39A 3E6CC 1ITYA 1JKRC 4II3A 1M1EB 2EFPA 3QU6A 1WJFA 3HJEA 4RB0A 2XASA 4XLCA 4I09A 5F0FA 1MNDA 3QP5A 3TGNA 2EFNA 3A01B 2RQPA 4N4NB 3LSRA 1D5VA 3R60A 4HDVA 3RPUA 5M3MJ 3K2ZA 1F43A 3M7GA 2FOWA 1R4MB 4DYRA 3BG3A 2ELKA 2K5CA 1ERDA 2VBZA 1MIJA 1YOVB 1IC8A 3CF5F 3K9TA 4LIVA 3PUBA 1A04A 3JSPA 2JK3A 4BKXA 2XRLA 2W48A 4A3BJ 3SFIA 3FDYA 1I6XA 2DJNA 3B6AA 1FIPA 2DODA 3DEEA 2X0LA 3TW7A 2JA8J 3DKXA 3K1MA 4RGXA 4RS8A 1BR4A 2A07F 1WPKA 3BTIA 4NBQA 1QA6A 2HTSA 1BC7C 2EQRA 4IHXA 2I5UA 3SHFA 2FBHA 3DTKA 4B3XA 1LUJB 3H9JA 2RGVA 4A5NA 5JVTA 4PFOA 1WCMJ 3HPGA 1Y8RB 2CV0A 1J7KA 4E4HA 4IPAA 4A12A 3QODA 4XSXF 5L3BA 4IO9F 3I59A 3K1PA 2CMPA 4ZYDA 4G7HF 2ZJ2A 2IS6A 4DZPA 4QSHA 2VJ4A 4DYQA 3RZDJ 2VE9A 5F64A 1X4PA 2OD5A 3CCQI 1H8AC 2VB6A 4FETA 5TISC 3I58A 4WXDA 1BIBA 2EJRA 2H6BA 2P5LC 1T39A 1LE8B 3ASOH 4KMFA 4L18B 3FK6A 3K4JA 2A61A 1R5HA 3ABMH 4CO8A 1QHGA 4UY8I 1FT9A 1XDUA 3FM3A 5ICGA 2IGNA 5CLSA 2Y48A 2JVGA 3OL3A 2DYRH 2P5VA 4A2UA 2KDZA 1PUFB 4HBLA 1SFXA 4IKFA 2OJED 4ZYHA 2CV2A 4ZYGA 2CWEA 1I1GA 3RYPA 5K5OA 4LGWA 1OR7C 2DTRA 3E6BA 3GZNB 4H0EA 4AIJA 4S05A 2VUMJ 1RR7A 3S8PA 2DOFA 3J7YJ 4B3AA 5DS9A 4X0GA 1ZR2A 1AOYA 3FX3A 1TTYA 4C9YA 1DPRA 1PJRA 5BPIA 2DU9A 1R58A 2IA1A 1HKTA 2F6CA 3KZYA 2M7AA 2K9LA 2R0QC 2CYYA 3VODA 5J1YA 1IUFA 5HOOA 1HC8A 2KRHA 1VQ8I 1X4OA 1S6LA 4U88A 1R1TA 2MD0A 2JZYA 3R0AA 1X2NA 2VT2A 1DUXC 1LFPA 2O6GE 2HQRA 2PMHA 1GVDA 3O3KA 3HRTA 3ZGKA 2XGDA 3G71I 1LFBA 3K6GA 4Q5SF 3J7AY 4I0BA 1IJWC 1SFOJ 1IN7A 3M8JA 5ERIA 3CO7C 1ZR4A 2MH2A 5J47A 2BY1A 2XPVA 1DP7P 3BWGA 2E7WA 4D5CA 3IAS2 1XG1A 3O6BB 1MD0A 1RETA 4I99C 2FQ4A 1JHHA 3LSIA 1TWFJ 3K4BA 3QP6A 4BNCA 3ZN1A 2PMZA 3F3XA 4JP0A 4CA0A 2IW5A 4P1WA 4BBSJ 2K9MA 2QLZA 3BZCA 3KX2A 2LY2A 3IL2A 4G6DA 4KIFA 3RI4A 2ZSHB 3BTLA 4WCGA 3AG3H 1YITI 1ZQ3P 2KDOA 2Z2SB 1OISA 1ODDA 1LDJA 2MH9A 3KZZA 1DGRM 3VYSB 3ERED 2LBFA 4R8HA 4EMSA 4OIOF 5B1BH 2G0EA 3DBHB 3W3CA 3VFZA 3FBIB 5B3SH 3BR3A 1GHCA 1IRXA 5M3FJ 4JX4A 1KONA 2Y0SN 3CESA 4QWQA 3H9QA 1BOAA 2Q0OA 4M6XA 1PVEA 3AFHA 4XRFA 4UUSB 2GA1A 2LC2A 3LSKA 3TMOA 1A35A 2L3DA 4ESJA 1Z6RA 1JXSA 4ZDLA 4ZDOA 1G8XA 2W4SA 3HRMA 3SQNA 1I50J 2YS9A 2NOGA 1ZLKA 4KT5C 1Z3YA 2PFBA 3D5RC 4KFCA 3I64A 2DFHA 4A0YA 3ZMTA 4CZCA 5LFAA 3HTUA 1WJBA 2ZJPF 2YX7A 2V6EA 9ANTA 2QKLB 5IPAA 5BMZA 3V8KA 4B4CA 1R5ID 3S17J 1R49A 2IGKA 2NVYJ 4NC8A 1T6SA 4KA4A 3H1CA 3ZQLA 2WV1A 3WTYC 2L7ZA 3HOZJ 2LR8A 3VSKA 2MG4A 2HZDA 2FRHA 4ZC3A 5HLIA 1RUOA 5HDKA 5D8LB 3ESWB 3I71A 1UAAA 1YJWI 4XLAA 1S72I 3H3UA 3H5RA 4LG0B 2BXYA 3I4PA 3R4KA 1D8JA 4NQWA 2X6WA 4YRVA 1W36D 3CD6I 4Y15A 2OUMA 1I3QJ 4YIIA 3OS0A 4EJWA 3LAJA 1EH8A 4A3JJ 1ULYA 3BY6A 3TQNA 1LB2A 4MEXF 2LP0A 4B43A 2X6OA 4Q48A 2BVLA 2GXBA 2ESNA 3KZIC 1ETVA 3F23A 5TJJA 2KLOA 1HOMA 5DD8A 2V1DA 2WAFA 4B09A 1EJ9A 2F48A 2K9NA 4UV9A 1ZGAA 1ACIA 3ZMVA 5GP9A 3B02A 4UXNA 3RYRA 3CMAI 3GFIA 1XC5A 4E7KA 2TDXA 4U7DA 3RIRA 2B9SA 4S0HB 1J2XA 3I59B 2GBYA 2JJ7A 3MAJA 4HW0A 5K7FA 5K5RA 2EIJH 2EZKA 4IRIA 3RKWA 1WH7A 2ZBKA 2DOAA 3UR3C 3O8HA 2PX9A 1AKHA 4KIGA 2M45A 2X1EA 3WTXC 4IHVA 1BN5A 4HF0A 2A69F 2L9VA 3HHHA 1FOXA 1U5TB 2IPQX 3CUQC 4KN4X 1P2FA 2XGXA 1BOBA 1SANA 5ICFA 3BZKA 5EEAA 1D8KA 1QHHD 2M30A 1ZG1A 3CP2A 4BYYA 1RI7A 4G6TB 4LITA 2QA4I 2DMTA 4I2OA 1ZLJA 2RAEA 3HSFA 2EBIA 1O7FA 1FSHA 1KU3A 4AIHA 1VNDA 2ME6A 2HI3A 4CGZA 2DMNA 5BQTA 4F3QA 4KITB 2OCEA 2L7FP 2QM3A 4J00A 2QQ8A 3N97A 1MNEA 1J9IA 4BE0A 3B73A 3H36A 1HW2A 1K79A 3H5AA 4HOBA 2VPLA 4L0ZB 1T0FA 3CDLA 3QYBA 1QZYA 3QRFF 3NRVA 3J80Z 2G7HA 1F4KA 1TBXA 2FF4A 2KIMA 3A2KA 2LDUA 2BBYA 1SD5A 4ZZLA 2MLGA 2HTJA 3WE3A 1YX5A 4MIMA 5FFXA 2F5DA 3HOXJ 3TP0A 2LYCA 3S1MJ 5CQEA 5E3MA 4LOCA 2E7XA 4XKCA 1N25A 2DA3A 3ABKH 4RAYA 3AG1H 5KNLA 3MWMA 4ZZDA 2XRNA 4R79A 4JQFA 1V55H 1W1WE 3JRAA 3O2PE 1R6RA 2R5ZA 2KIFA 2I10A 1VZ0A 2R7ZJ 2UV1A 1FMWA 5E1WA 3ZQFA 2M4GA 2LVSA 4V2FA 1TT5B 3P7NA 1K6OA 5E3LA 4YELA 4TV7A 1K4TA 2BZTA 2QSHX 2FA5A 3AL0B 2O3FA 3PNYA 5FKMA 1G3YA 2LFBA 3P9IA 3KP6A 1BR2A 1U3EM 2MA3A 2Z1DA 2XSJC 3HRSA 2LBFB 4F7ZA 3M1CA 2LSOA 2VQHA 2YPRA 4DYCA 3CCMI 3S2WA 3S15J 4Y52J 2ME0A 1T95A 2JVHA 2DYSH 3VYRB 4ASNA 1TQIA 3WTZA 5CJ9A 2QENA 3IH2A 3I3LA 5DCFA 4E7JA 3WHCA 2BVMA 2EINH 1WHUA 3ZPLA 2X85A 2D1HA 3OYJA 2V1UA 3FK7A 1FYMA 2DMUA 3HSEA 5EEGA 2LH9A 2BW3B 1L3LA 2ZXWH 3HDDA 3CMEI 2ZXHA 2HWVA 4BJTA 3RKXA 1YI2I 3G3ZA 3V4GA 1DU0A 4E7HA 2CW0F 3WHBA 1I39A 2JSCA 2LKPA 3TL4X 2P4WA 3KP3A 1O3SA 3BR5A 4BEHA 5BS6A 2LLKA 4HNTA 1IZ1A 3K4CA 2JQ7A 3BROA 3GVAA 3F6OA 4FCYA 3CDHA 4ON0A 1B9NA 1TP4A 2GXGA 3IHUA 4D0PA 1ENHA 3D5SC 3F8FA 4BQAA 2ZMEA 1N75A 3GTPJ 1FBQA 1Z0XA 3F6VA 1WJEA 1OCTC 3GTKJ 1FBUA 4ZTJA 4Y3OA 3HM5A 3LAPA 5E8IA 5L3FA 1DP3A 3BPXA 3HRUA 2V26A 1ORKA 4FQGA 4MHGA 2ZJQF 5H20A 2H27A 2VLAA 1IXRC 3HEFA 1L0OC 4MTDA 3WGHA 3DKWA 2E1MC 4B47A 1VQ6I 4XKBA 3TDUC 4BDYA 3EUHA 2DA5A 3LSPA 1YW9A 2LREA 5AIPA 4PUSA 1TC3C 4AU7A 1LFUP 1P4XA 2DCEA 2UZKA 3C2BA 3FZVA 5DCMA 5D4RA 3FISA 4IHWA 1ZH5A 3CQZJ 4M3DA 2LMDA 2DW4A 4ZJZA 3GXOA 5EJCA 1Y6IA 1P9QC 3OWTA 1XSXA 2WAEA 4ZDPA 3MMYB 4I98B 2PN6A 1QO0D 4RM3A 2LOOA 3S2DJ 3PSIA 3GLLA 2JSPA 3X2QH 4UHTA 2F4OB 4Y7NJ 2K85A 1P4AA 4HQMA 1XGMA 2CFXA 2K27A 3FBNB 3JAMK 2MBFA 3L2QA 3E1SA 5FROA 2IRFG 3DTEA 3O8GA 1ON2A 4DBRA 1FP2A 3TP3A 1G3TA 1GV2A 1OCCH 4NB5A 2R3SA 4IF4A 2DI3A 1MKMA 3HL2A 4C3HJ 4RLQA 2E2IJ 3GYHX 3H0GJ 1ETOA 1PP7U 1TT0A 2PQ8A 2STTA 3HTSB 3QU3A 1F5TA 1MNMC 2N8GA 4YFXF 2DJIA 4DIQA 1BIAA 1FX7A 2W1OA 2NVUB 2X9DA 4PCQA 5FGMA 5JHFA 1TW3A 3ZOBA 1O3QA 3MZHA 3K4KA 4XRMA 3WTUC 1BI2A 5IYCJ 4NNJA 2W24A 3K10A 1YW8A 3W6VA 3CCRI 3E5XA 4IX7A 2FEZA 1MBKA 2M87A 3CCYA 3S1RJ 4BXUA 3QYFA 2R7VA 1E3PA 5JFRA 3JRGA 2M1BA 1V5GA 1T98A 3HZJA 3G6EI 2Z99A 3IAM2 1FOKA 2X1DA 2F5CA 4XOTA 1OQYA 2BEOA 2HZTA 2XKPA 4A6DA 2NVTJ 2HYJA 1MDMA 3CP8A 1U6GA 3WG7H 1W7PA 1XMAA 2DQRA 2UXXA 3QQAA 4M9ZA 1YRNB 1DQUA 3KYDB 5HNHA 1VQLI 3ZQCA 4AVPA 3FWEA 2X1CA 3A03A 2VQGA 2OQGA 2C6YA 4CUGA 2W84A 3KEYA 3S14J 1MBJA 2WAQN 3LSHA 2VASA 1R00A 2CQQA 4CYCA 1KQ0A 3P9CA 2Z3YA 4JYKA 3C3WA 3GCMA 3FF5A 5CVVA 5FD5A 2H94A 5J4YA 3J81K 1SFUA 2FNAA 2H1LA 3CCJI 2FBIA 1RNLA 1W4MA 5J40A 1JI8A 4E6KG 2Y31A 3S1QJ 1OR7A 5FO5A 4Y33A 2R5ZB 4U0YA 5IOYA 3H92A 4HDUA 2L4AA 2XVCA 4XKVA 1ON1A 3DPTA 4FE7A 1P7JA 1WKMA 5LHIA 2CGPA 2EH3A 1XN7A 3MKWB 4M6VA 3PO3J 2CQNA 2QQAA 3MQ0A 1Q1HA 2JA2A 1V3FA 3CCUI 4X6AJ 4L5IA 1R23A 5D8KB 4LK1F 1W5TA 3KP4A 4MEYF 4PJMA 4RLFA 2GIZA 1N78A 2BHYA 2BXZA 2VOPA 5FLXK 4BY1J 2ESHA 3L7WA 4KYWA 2DK8A 1V4RA 5CVJA 3D5LA 2GAUA 4PJ0C 1B8IA 1IAWA 2EFQA 5JI6A 1UCRA 4A3DJ 3A0BC 1D1CA 3RJPA 3OYKA 3KEQA 1R36A 2ZXIA 2ZKZA 2VJJA 1IDYA 2H8RA 4OIQF 3OIQA 2R5YA 3PL8A 2VODA 2IGOA 4XRSG 3MVPA 4QIWN 5A2QZ 4L0YB 1XCVA 3OYNA 3OMYA 4A69C 3SEQA 4XR6A 4DNCA 3F0CA 2NVXJ 2PJPA 1OLTA 3N4MA 1VI0A 5LEJA 2WV0A 2DQLA 1SVLA 3L00A 4B44A 4RA2A 2ZFUA 3CJTB 3VDXA 1B9MA 3KETA 3OSGA 3VYUB 2V7FA 4KDPA 2GZWA 2O61A 4A0XA 5EGOB 2RQQA 3OYCA 3K4LA 5B5EC 2PJRA 3H9GA 4CXFA 4A3MJ 4LD5A 1JUSA 2NVQJ 2P0WA 3DKYA 4OU0A 2ZJRF 5E3NA 4M3EA 3BG7A 2CG4A 2FU4A 2QYOA 2HOEA 2Y69H 3EUKL 3FM5A 5J3LA 3FXUA 5K1YA 5E18F 2HNHA 4G94A 3D0SA 4F52A 3WGIA 1S5LC 4IZZA 2OZUA 2XAGA 4IEJA 4I6ZA 1FMVA 5DCMB 2Y75A 3DQVC 3KLNA 3M1EA 3ASNH 1A6IA 3NWTA 3W2VA 4ETSA 5C3EJ 3S3NA 1D1AA 1MW7A 3ZQQA 3G4SI 4IRHA 3WTWC 3F8BA 1I1SA 3C2HA 1BJAA 5CKTA 2DPUA 1QZEA 2L9NA 2JUCA 1P92A 1MMGA 1G59A 2EWNA 4ESBA 4BXFA 4M6YA 4LG3A 2EZHA 2VBXA 3NWSA 2KQRA 3GTJJ 3U21A 2LK2A 2ZNZA 2XROA 2AS5F 4HV5A 2M34A 3FMSA 2HDCA 4KNYA 2IVMA 2LKXA 3COAC 3B6CA 4BQQA 4FASD 3E97A 2NAZA 3M8EA 1N77A 2CW7A 2PMZN 1NHAA 4RGSA 3IKTA 3IUOA 2YSRA 1BC8C 5KVRA 2R7SA 2MC3A 4LK0F 4ENMA 1IV6A 2OTLI 3I4MJ 3JTGA 4M74A 2O7OA 1S7AA 1K83J 2E5NA 4XN3A 2X6XA 1YQAA 4MGRA 3GEZA 2QF7A 2R7QA 3HOUJ 1IN6A 1YHQI 3ZMDA 5HLGA 2R7TA 2QBYB 2EFOA 3GFJA 3BG5A 1MH4A 3C1DA 1D1BA 3LQRA 3ERMA 2BY3A 1K78A 1B72A 2NNYA 1WZ2A 3LFKA 2HR3A 3WODF 2QSGX 3I56I 3H3VK 2EILH 4P55A 1HW1A 2Q2EB 5GTHC 3LSJA 4LB5A 1BM9A 4XLEA 1J59A 1W7PD 2EIKH 3V7RA 1A31A 1WWXA 2Z5UA 5M5YJ 4M72A 3BZ6A 1XPXA 3BG6A 1D0ZA 4LMYA 3BR0A 2E35A 3K1NA 2XB5A 3VEPA 2VKDA 5CPRB 3BR1A 3KP2A 4WK8F 2DMQA 2AQFA 1ZRDA 2K4JA 4S04A 4LLNA 2UWMA 1F36A 3MKLA 1FWZA 1YG2A 2MABA 3VB2A 1S29A 2LF7A 1X1PA 1YJ9I 5FLVA 3SZGA 1J09A 4PSWA 5E8GA 3SDBA 3U1DA 3K0LA 1G3SA 1USSA 1WFXA 4U7BA 3DU6A 2EA4A 2HQAA 4HX8A 2L7KA 5LLQA 2V6CA 4ZH4F 2AXTC 4ZTFA 1GT0C 3ABTA 3E3VA 2AXLA 5F6FA 5L3DA 1OKRA 2M3AA 5J1RA 3ZXSA 5J8FA 1RR8C 1DU6A 2L9SA 3I0TA 5LHHA 4A93J 5LGUA 1HF0A 5FKNA 5LHGA 5C4JJ 1ZN2A 1UZCA 1B8IB 1OMIA 5F0HA 3KCCA 1A36A 4KIBA 2QSFX 2K4BA 2AHQA 4I7HA 1I3AA 2LY9A 1FTZA 3F8NA 4B8XA 2A5YB 2ID3A 1ZK8A 3CJNA 2DPDA 2WY7Q 2F5VA 2XGEA 2HPIA 2XAUA 4JX5A 5FKOA 4UB8C 2IS4A 1U5TC 3CJRB 1BA5A 1FJLA 1E2XA 3WTVC 2XAHA 2DLLA 2VKHA 3GTGJ 1APLC 4FISA 3PNVA 5GAHJ 2FNPA 4XICA 1U8RA 3NARA 2ICWG 1V5FA 2X51A 1U0JA 1YO5C 5HS7A 2NS0A 3R61A 4WX9A 5E3OA 3ECOA 5FLMJ 1RZ4A 2R7WA 2JUGA 1H9TA 2DA2A 3PFYA 3ZQGA 4OWRB 1JKQC 3SZTA 1BI0A 2A6EF 3BQZA 1WJDA 4M3BA 2PJRB 1UJ8A 4YEJA 2FD5A 3L09A 4E70A 1RESA 3EYIA 4PDKA 4XL9A 1ZYRF 4XN0A 4C2TA 2OA4A 4UNOA 3TKYA 4P9FA 4QPOA 5B66C 2ACJA 4UUTA 3W6JB 5F08A 2R7XA 1KYWA 1X3ZB 5CYVA 1ZAOA 5J8CA 1OYYA 1XCBA 1USTA 4XLFA 3RTRA 1CF7A 3KP5A 2FSWA 4GDFA 4GYGA 1RKWA 4L9JA 3PJRA 3V7SA 4G6QA 1GXPA 2OBPA 5FKKA 1P6RA 1SFKA 3LSTA 2EPFA 3WG9A 5FRMA 4DBQA 2EA2A 1IXSB 3BCAA 2GM4A 2CJJA 4OMZA 4G8XA 4CCKA 3TEDA 1E0EA 2CRGA 1ONVA 1TZLA 3PQKA 5HLHA 3S3OA 4PJLA 2PBIA 3MZYA 3OYAA 3IC7A 4Z6YA 1Z77A 3P9KA 1X2MA 2OQRA 4HNVA 2DA4A 1MSEC 1BL0A 3HG9A 4CDGA 1DGWY 2F4MB 2M0MA 3HC7A 4ANJA 4XIDA 4WWCA 3D1NI 1K7AA 1FY7A 3KYCB 2EZLA 4PFPA 5CVIA 2DFIA 2E1CA 1Z7LA 3AL0C 1Z7UA 3CTAA 1REPC 5H6QA 4KMUX 2UXNA 3CUOA 4PSXA 3IRRA 3SFZA 2R7DA 1VQKI 3HOYJ 4KISA 3S1NJ 1JGGA 1TQMA 4HAMA 3NQOA 5IYBJ 1LDKB 3ML6A 1RC9A 2L0KA 3OOUA 1R4NB 1HKQA 4EJVA 2HKXA 2NOJB 4AD9A 2E34A 1KGSA 3IWFA 1E3OC 1EA3A 4QPQA 2IEKA 2KP6A 3VPRA 1TNTA 1CGPA 3GTMJ 2WY8Q 2PLYA 1K61A 3PIPF 2H09A 2ZO4A 4IJAA 3WU0A 4P9UA 5EF6A 4XMYA 1R7JA 1BJZA 1R22A 2TCTA 4X1EA 4U87A 3VSLA 2EIMH 2WB1A 5IT9Z 3EPZA 3TO7A 2VI6A 1WI3A 1TW2A 2MD5A 2Z9OA 1H0MA 2KPMA 3G2BA 1WJ5A 3ABUA 3MCZA 1S7EA 4O3MA 1IRZA 3S93A 3DFGA 3GX4X 5IOZA 4HPQA 1J5YA 3OYGA 2LY1A 1HCRA 5DYMA 4EATA 4MO7A 1TWAJ 5HDGA 1FOWA 1J75A 1O7LA 2FMYA 3TW6A 1Z9CA 3EETA 3ZRGA 2M8EA 1SMYF 2BV6A 2BHZA 3DP7A 4Y13A 3OYBA 1FYKA 3CC7I 4EV0A 2BE5F 2RDPA 4AYBA 2FX0A 3GW2A 2O03A 3M3YJ 1S9HA 5D4SA 4I01A 4N9IA 3MFKA 1QBJA 2W57A 3KPHA 5DTDA 1GDTA 2B0LA 2L9RA 3I5UA 5D6FA 4IHYA 1NG6A 2W7NA 2VXDA 5E1ZB 2EK5A 3H5NA 4HSTA 1MBEA 4OIPF 4D7NA 2KJBA 3C2GA 3DXJF 1MZBA 1UMQA 2X48A 3ZCOA 3J7ZI 4RGUA 1E3HA 4AC0A 1FC3A 1IRFA 2JMWA 3TO6A 4XQFA 1LNWA 3A01A 3H0DA 3HB9A 2JA5J 3V7CA 2JT1A 5L3EA 2P5KA 4A3KJ 3MZ8A 1Y0NA 4CYDA 3F8MA 2BY2A 4AM3A 1B6AA 1P7IA 2E36A 2YR2A 2DA1A 4ZYEA 4KUMA 1WH5A 3ABLH 3K7AJ 2E19A 4G12A 1YFHA 3JRBA 1SAXA 4N0BA 2L54A 4BE1A 1D0XA 3OYMA 4XOPA 5D5VB 1JJ8C 2CS3A 1KA8A 3U1KA 4NQWB 5J1UA 1FIAA 1YYVA 4FX0A 2JA7J 1WGXA 2HQNA 4KN7X 3SXYA 1WRJA 3DEWA 2DFFA 2ELJA 2CH0A 3RQIA 1NTCA 2NS8A 2IS1A 2CUZA 3CJQB 4XLPF 3HKZA 4GRIA 4B48A 1VQOI 1SC7A 4LLGF 3V42A 1V54H 2P8TA 4OINF 4OAYA 4E7IA 1FP1D 1VQPI 5CVUA 4PGGA 2DA6A 1SD6A 2LNBA 4HSRA 4K2EA 4LJZF 1KZHA 3SJMA 1ETYA 2K7LA 3H3ZA 4LLLA 5L3GA 3JRDA 1RKTA 3SYTA 1JUMA 1UHMA 3FXKA 1T0FC 2IXSA 2LTPA 3Q9SA 2HFHA 3G1LA 2DT6A 3TOAA 1OYIA 1NH3A 5DUIA 1CF7B 3GUDA 1AKHB 4ZYAA 2IA0A 5LBQA 3AAFA 1LVAA 4HA8A 3R6SA 5IP7J 1LE8A 1QU3A 1G2HA 1R1UA 5J6XA 3HPHA 5IP6A 2OTJI 1F1ZA 3K70C 2BY0A 4A3FJ 1JUPA 1STZA 1PUFA 1F9NA 2VKEA 2XF5A 3LSGA 2KRCA 4IL6C 5LGTA 3S3MA 2B7EA 2ELHA 3OR2C 3T0YA 5L3CA 1C0WA 1Y1VJ 2COBA 3JRFA 2BOLA 1T08B 2QCOA 3OYIA 1B4AA 2RN7A 3HOVJ 2E1OA 1O4XA 2I8DA 2VQLA 2K9QA 4WF2A 1MBHA 2M5WA 3OIOA 4MQ9F 3P5JA 2E2HJ 5KK1A 4HNUA 3JTHA 4HF1A 2DXIA 4MQVA 4A0ZA 4RB3C 3SDGA 3HOWJ 3PFIA 1VQMI 5D5UB 1OCPA 4KT6A 1QQIA 4E7LA 1IG7A 2FOKA 3EDPA 2KRFA 4RAFA 3RPQA 3E5UA 1ZRFA 1TWHJ 3C7JA 1BW5A 1RUNA 3OL4A 4I0AA 2TRTA 3ZP5A 5FRNA 1Z3XA 1Z91A 2O9LA 2K9SA 3MN2A 4J19A 4RM2A 4XONA 3WTSC 1S8NA 3CMMA 2ECCA 2GLOA 3HUGA 5AIQA 2L4MA 4BUPA 4D1QA 3GF2A 3G1MA 3MKYB 1U8BA 4LFUA 5GAEJ 4Q4ZF 3GTQJ 1DPUA 1WJCA 2CSOA 2HXOA 2QVOA 4II2A 2E2JJ 2VXZA 4UVAA 3ZMSA 2HU9A 3IKVA 3LFUA 4C2MJ 5EYRA 2E60A 2VJ5A 2HVSA 4IQJA 3FXJA 4EM2A 3JSOA 4Q47A 2DT7B 3BC8A 1PYVA 4W97A 3AKZA 1IDZA 2ETHA 2L5QA 1IN4A 2UUZA 1JT0A 1FOYA 1UG2A 3BP8A 1TWGJ 1LEAA 2R7OA 2VC0A 2CUFA 2JTVA 3BR2A 4NDLA 1OFCX 3KEOA 2D5VA 5E17F 2Q1ZB 3OOPA 4BHPA 4L9TA 4UUSA 5EZHA 1OYWA 1U9OA 1I6HJ 2CO5A 2Q8KA 3I53A 3M9AA 3W6KB 1TLHB 1SFEA 1YW7A 2L7MP 2O8XA 4NC6A 3OY9A 4QTRA 1UELB 1TQPA 3LMMA 1JT6A 2VL8A 4ABZA 3DF8A 5KHDA 1T8IA 2LKSA 2STWA 3Q3SA 4AVZA 2LG4A 1MMNA 4F93B 1CQTA 1Y1WJ 1ZKGA 2YUSA 5AONA 2RKHA 4BQNA 2A6TA 2VN2A 4BEHB 4GO1A 1KU9A 1MGTA 2IBDA 3CO6C 2DAOA 1T38A 1ZREA 5IYDJ 3ISPA 5E1XA 3A0HC 1G6NA 1SAUA 4V2GA 1D5YA 3BOQA 2ZMEB 1I5ZA 3REOA 5DM6F 5F27A 1QPMA 4YG2F 4LG0A 1MJ9A 1EH7A 2V79A 3ZQHA 1X19A 4YIRX 1VQ4I 1R5GA 1SMTA 3EYYA 4M73A 4F91B 3UKGA 1OJLA 4HF2A 1XB4A 5JHUA 3AG4H 2DK5A 4IOCF 3AG2H 5JLWA 3I55I 1JKOC 3LA2A 1MJAA 3DLAA 4Y4RA 1MBGA 1WJAA 3EQLF 5F1JA 3JRCA 2KT0A 3KE2A 1LKXA 4KICA 2VQCA 4BH9A 4DGWB 1MBFA 4M9SA 3PSFA 3Q5FA 2RVCA 5DV5A 2H8WA 3DPUA 3T8TA 4XLHA 4XLNF 2YU9J 2M2EA 1G3WA 2K02A 5KCMA 4YIFA
chains in the Genus database with same CATH topology
1FTZA 2LY9A 3ZQFA 4V2FA 2LVSA 2ID3A 1ZK8A 1X58A 5E3LA 1Q1VA 2XGEA 1FEXA 4JX5A 5FKOA 1QVUA 1BA5A 4RDUA 5FKMA 1ETQA 1FJLA 2LFBA 3G1OA 3FKIJ 3GTGJ 1APLC 2VPRA 4FISA 1HDDC 3HGYA 4DYCA 3GTLJ 4MFDA 4XICA 1NK2P 5K7ZA 3S15J 4Y52J 4M3FA 3NARA 4MFEA 4BY7J 3OSFA 2ME0A 2FJ1A 2O8KA 1U9NA 2XPWA 5E3OA 3IH2A 5C44J 5FLMJ 3LNQA 3WHCA 2DA2A 3HGGA 3ZQGA 3BT9A 3FK7A 2DMUA 3IH4A 1JKQC 1ZGWA 1TWCJ 3HDDA 1U78A 1UHSA 3BQZA 4M3BA 2IAIA 1ETXA 2FD5A 2CQXA 1RESA 3BG9A 2DA7A 1DU0A 3WHBA 4A3CJ 2CU7A 2OF7A 1JTXA 3A02A 1W0UA 2JWTA 3BR5A 4UUTA 5F08A 2LLKA 1T33A 2K40A 4L5EA 4FCYA 5FJ8J 4JX6A 1ZTRA 3CMYA 2MW8A 2Y30A 2ID6A 3L1PA 1ENHA 4A3EJ 2B63J 5F0CA 1RKWA 3PM1A 1GV5A 5K7HA 3GTPJ 1Z0XA 1OCTC 3GTKJ 5FKKA 4GFBA 3HM5A 2GM4A 2CJJA 3BQYA 3BR6A 3TEDA 2CRGA 1ORKA 2DMPA 3Q0UA 4BBRJ 4FE4A 3HEFA 1Z77A 2Y2ZA 4XRSA 1X2MA 4HNVA 2DA4A 1MSEC 4M3GA 1BL0A 1ITYA 1JKRC 4XIDA 3S16J 3LSPA 2DA5A 3D1NI 2EZLA 5F0FA 1TC3C 4CYCB 1LFUP 3A01B 3LSRA 1HDPA 3C2BA 3FISA 3I4NJ 4IHWA 3CQZJ 3HOYJ 4M3DA 5M3MJ 3S1NJ 1F43A 1JGGA 2NS7A 4DYRA 3BG3A 2ELKA 1GUUA 3S2HJ 5IYBJ 3S2DJ 2LD5A 1IC8A 2R92J 3IV5A 2L0KA 3OOUA 4Y7NJ 3RKQA 5FKLA 2JK3A 3BTJA 2XRLA 4BKXA 5M5WJ 2W48A 1E3OC 5M5XJ 1QPIA 3SFIA 4A3BJ 2IEKA 3VPRA 3GTMJ 2DJNA 3B6AA 1FIPA 3O8GA 1NK3P 3TP3A 1K61A 3TW7A 2JA8J 1GV2A 1AU7A 5EF6A 2ZB9A 1WPKA 3BTIA 4C3HJ 1AHDP 1BJZA 2E2IJ 4IHXA 2EQRA 3H0GJ 2TCTA 1ETOA 4X1EA 3GTOJ 3NAUA 2DTZA 2HOAA 2VI6A 2XSDC 1MNMC 2N8GA 1WI3A 1QRYA 1WCMJ 2X9DA 1H89C 1S7EA 1BW6A 3ZOBA 3IH3A 1IRZA 4B1RA 4XRMA 5IOZA 1HCRA 3BTCA 5IYCJ 2R5YB 4MO7A 3W6VA 1TWAJ 1MBKA 3LOCA 4DZPA 3CCYA 4QSHA 4DZJA 3S1RJ 4DYQA 3TW6A 3RZDJ 1HLVA 3JRGA 1H8AC 2R93J 2FX0A 3M3YJ 1JTYA 2NVTJ 1LE8B 2HYJA 4C3IJ 3FK6A 2VKVA 5DTDA 3QQAA 1GDTA 1YRNB 2L9RA 4IHYA 3ZQCA 4A3LJ 3A03A 1PUFB 2KDZA 4I76A 1MBEA 4D7NA 2AO9A 1UMQA 2X48A 1MBJA 2WAQN 5IP9J 3S14J 4AC0A 2VUMJ 1RR7A 2CQQA 4CYCA 4JYKA 2JMWA 4B3AA 5DS9A 1ZR2A 3PO2J 3A01A 2P81A 2JA5J 3HB9A 1JKPC 4A3KJ 2Y31A 3E7LA 3S1QJ 5GPCA 2R5ZB 5IOYA 1P7IA 2R0QC 2DA1A 4FE7A 1WH5A 5J1YA 1IUFA 1P7JA 2E19A 3K7AJ 4G12A 5EG0A 2EH3A 3JRBA 1X2NA 4M6VA 3PO3J 1JJ8C 4D7MA 2CUEA 1GVDA 2XB0X 1JJ6C 2XGDA 4X6AJ 1LFBA 1POGA 1FIAA 5J1UA 1IJWC 1SFOJ 2JA7J 1WGXA 1ZR4A 3DEWA 3QPLA 3RZOJ 2XPVA 3RQIA 1NTCA 5HODA 4BY1J 4D5CA 2NS8A 1XG1A 4W1UA 4D5FA 3Q0WA 1RETA 1B8IA 2FQ4A 1TWFJ 4A3DJ 2WB1N 4DW6A 1MH3A 4JP0A 1VFCA 4BBSJ 1H88C 1IDYA 2M0CA 2H8RA 1ETKA 2DA6A 2R5YA 4XRSG 4QIWN 3MVPA 3BTLA 3SJMA 1ETYA 1ZQ3P 2Y9YA 3JRIA 3HBLA 3JRDA 4A69C 1RKTA 1JUMA 2LTPA 3G1LA 4C3JJ 3F0CA 2NVXJ 2G0EA 1VI0A 1ETWA 1AKHB 4XK4A 3BR3A 5M3FJ 4JX4A 5IP7J 2Y0SN 1LE8A 4AYBN 1XS9A 1G2HA 5F04A 3OSGA 5IP6A 1B72B 4RBOA 1YRNA 4A3FJ 4UUSB 1JUPA 5EGOB 2XGCA 1PUFA 2VKEA 3LSGA 4A3MJ 3DCFA 2M9HA 1JUSA 1I50J 2YS9A 2NOGA 2NVQJ 3GBGA 1Y1VJ 2COBA 3JRFA 5E3NA 2QCOA 4M3EA 1EF4A 5J3LA 3M4OJ 3HOVJ 9ANTA 2E1OA 1O4XA 5IPAA 4B4CA 3JR9A 3S17J 2K9QA 1MBHA 1R9TJ 3OIOA 2NVYJ 2E2HJ 4IEJA 4I6ZA 3ZQLA 2WV1A 3HOZJ 2L7ZA 2LR8A 2MG4A 3SDGA 3HOWJ 5GPAA 1A6IA 5C3EJ 1OCPA 4FTHA 1IG7A 2Y9ZA 1TWHJ 2HDDA 1BW5A 1W0TA 1I3QJ 2HOTA 2TRTA 3K2AA 2O9LA 4BXXJ 4A3JJ 5EDNA 2K9SA 3MN2A 2HXIA 4J19A 2ECCA 2EZHA 2GLOA 3GTJJ 2LP0A 2LK2A 2X6OA 5C4XJ 3G1MA 1ETVA 1U8BA 2M34A 3GTQJ 3HKZN 1HOMA 2LKXA 3B6CA 4A3IJ 2HXOA 2K9NA 2JN6A 2XPUA 1QVTA 2PMZN 5GP9A 1IV6A 2E2JJ 3I4MJ 1XC5A 4S0HB 4C2MJ 2O7OA 5EYRA 1K83J 2GBYA 2JJ7A 5K7FA 2MGQA 4AUXA 2EZKA 3Q0VA 2QF7A 3HOUJ 4W97A 1IDZA 1WH7A 2HOSA 5EZGA 3O8HA 1JT0A 1AKHA 1UG2A 1TWGJ 2HQ5A 2DN0A 4IHVA 2CUFA 3BG5A 3BR2A 5BNGA 1MH4A 2OPTA 4NDLA 1OFCX 2D5VA 1B72A 1SANA 4UUSA 5EZHA 3JREA 3H3VK 5EGOA 1U9OA 1I6HJ 5EEAA 5JLXA 3LSJA 1RPWA 2ECBA 2L7MP 4QTRA 4A3GJ 2DMTA 5M5YJ 1JT6A 2RAEA 4ABZA 1MSFC 2EBIA 3Q3SA 1VNDA 2ME6A 1CQTA 2HI3A 3BR0A 4MLOA 1Y1WJ 1ZKGA 2XB5A 2YUSA 4EEFG 2DMNA 3BR1A 2L7FP 2IBDA 2DMQA 5IYDJ 3ZQIA 2JA6J 4V2GA 1D5YA 2H1KA 3JRHA 1FTTA 1F36A 3MKLA 1A5JA 3CDLA 5FLVA 5F27A 5EG0B 1IGNA 3ZQHA 2M8GX 3FIWA 3UKGA 1OJLA 2EZIA 3QPSA 4MIMA 1VF9A 1GT0C 3HOXJ 3TP0A 3S1MJ 5JLWA 1JKOC 5E3MA 4LOCA 1MBGA 5J1RA 5F1JA 3JRCA 2DA3A 2KT0A 1DU6A 2MSYA 4A93J 1HF0A 5FKNA 1MBFA 5C4JJ 1B8IB 5F0HA 1T56A 3JRAA 2R5ZA 2I10A 2YU9J 2M2EA 2AHQA 2R7ZJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FTZ A;  2LY9 A;  3ZQF A;  4V2F A;  2LVS A;  2ID3 A;  1ZK8 A;  1X58 A;  5E3L A;  1Q1V A;  2XGE A;  1FEX A;  4JX5 A;  5FKO A;  1QVU A;  1BA5 A;  4RDU A;  5FKM A;  1ETQ A;  1FJL A;  2LFB A;  3G1O A;  3FKI J;  3GTG J;  1APL C;  2VPR A;  4FIS A;  1HDD C;  3HGY A;  4DYC A;  3GTL J;  4MFD A;  4XIC A;  1NK2 P;  5K7Z A;  3S15 J;  4Y52 J;  4M3F A;  3NAR A;  4MFE A;  4BY7 J;  3OSF A;  2ME0 A;  2FJ1 A;  2O8K A;  1U9N A;  2XPW A;  5E3O A;  3IH2 A;  5C44 J;  5FLM J;  3LNQ A;  3WHC A;  2DA2 A;  3HGG A;  3ZQG A;  3BT9 A;  3FK7 A;  2DMU A;  3IH4 A;  1JKQ C;  1ZGW A;  1TWC J;  3HDD A;  1U78 A;  1UHS A;  3BQZ A;  4M3B A;  2IAI A;  1ETX A;  2FD5 A;  2CQX A;  1RES A;  3BG9 A;  2DA7 A;  1DU0 A;  3WHB A;  4A3C J;  2CU7 A;  2OF7 A;  1JTX A;  3A02 A;  1W0U A;  2JWT A;  3BR5 A;  4UUT A;  5F08 A;  2LLK A;  1T33 A;  2K40 A;  4L5E A;  4FCY A;  5FJ8 J;  4JX6 A;  1ZTR A;  3CMY A;  2MW8 A;  2Y30 A;  2ID6 A;  3L1P A;  1ENH A;  4A3E J;  2B63 J;  5F0C A;  1RKW A;  3PM1 A;  1GV5 A;  5K7H A;  3GTP J;  1Z0X A;  1OCT C;  3GTK J;  5FKK A;  4GFB A;  3HM5 A;  2GM4 A;  2CJJ A;  3BQY A;  3BR6 A;  3TED A;  2CRG A;  1ORK A;  2DMP A;  3Q0U A;  4BBR J;  4FE4 A;  3HEF A;  1Z77 A;  2Y2Z A;  4XRS A;  1X2M A;  4HNV A;  2DA4 A;  1MSE C;  4M3G A;  1BL0 A;  1ITY A;  1JKR C;  4XID A;  3S16 J;  3LSP A;  2DA5 A;  3D1N I;  2EZL A;  5F0F A;  1TC3 C;  4CYC B;  1LFU P;  3A01 B;  3LSR A;  1HDP A;  3C2B A;  3FIS A;  3I4N J;  4IHW A;  3CQZ J;  3HOY J;  4M3D A;  5M3M J;  3S1N J;  1F43 A;  1JGG A;  2NS7 A;  4DYR A;  3BG3 A;  2ELK A;  1GUU A;  3S2H J;  5IYB J;  3S2D J;  2LD5 A;  1IC8 A;  2R92 J;  3IV5 A;  2L0K A;  3OOU A;  4Y7N J;  3RKQ A;  5FKL A;  2JK3 A;  3BTJ A;  2XRL A;  4BKX A;  5M5W J;  2W48 A;  1E3O C;  5M5X J;  1QPI A;  3SFI A;  4A3B J;  2IEK A;  3VPR A;  3GTM J;  2DJN A;  3B6A A;  1FIP A;  3O8G A;  1NK3 P;  3TP3 A;  1K61 A;  3TW7 A;  2JA8 J;  1GV2 A;  1AU7 A;  5EF6 A;  2ZB9 A;  1WPK A;  3BTI A;  4C3H J;  1AHD P;  1BJZ A;  2E2I J;  4IHX A;  2EQR A;  3H0G J;  2TCT A;  1ETO A;  4X1E A;  3GTO J;  3NAU A;  2DTZ A;  2HOA A;  2VI6 A;  2XSD C;  1MNM C;  2N8G A;  1WI3 A;  1QRY A;  1WCM J;  2X9D A;  1H89 C;  1S7E A;  1BW6 A;  3ZOB A;  3IH3 A;  1IRZ A;  4B1R A;  4XRM A;  5IOZ A;  1HCR A;  3BTC A;  5IYC J;  2R5Y B;  4MO7 A;  3W6V A;  1TWA J;  1MBK A;  3LOC A;  4DZP A;  3CCY A;  4QSH A;  4DZJ A;  3S1R J;  4DYQ A;  3TW6 A;  3RZD J;  1HLV A;  3JRG A;  1H8A C;  2R93 J;  2FX0 A;  3M3Y J;  1JTY A;  2NVT J;  1LE8 B;  2HYJ A;  4C3I J;  3FK6 A;  2VKV A;  5DTD A;  3QQA A;  1GDT A;  1YRN B;  2L9R A;  4IHY A;  3ZQC A;  4A3L J;  3A03 A;  1PUF B;  2KDZ A;  4I76 A;  1MBE A;  4D7N A;  2AO9 A;  1UMQ A;  2X48 A;  1MBJ A;  2WAQ N;  5IP9 J;  3S14 J;  4AC0 A;  2VUM J;  1RR7 A;  2CQQ A;  4CYC A;  4JYK A;  2JMW A;  4B3A A;  5DS9 A;  1ZR2 A;  3PO2 J;  3A01 A;  2P81 A;  2JA5 J;  3HB9 A;  1JKP C;  4A3K J;  2Y31 A;  3E7L A;  3S1Q J;  5GPC A;  2R5Z B;  5IOY A;  1P7I A;  2R0Q C;  2DA1 A;  4FE7 A;  1WH5 A;  5J1Y A;  1IUF A;  1P7J A;  2E19 A;  3K7A J;  4G12 A;  5EG0 A;  2EH3 A;  3JRB A;  1X2N A;  4M6V A;  3PO3 J;  1JJ8 C;  4D7M A;  2CUE A;  1GVD A;  2XB0 X;  1JJ6 C;  2XGD A;  4X6A J;  1LFB A;  1POG A;  1FIA A;  5J1U A;  1IJW C;  1SFO J;  2JA7 J;  1WGX A;  1ZR4 A;  3DEW A;  3QPL A;  3RZO J;  2XPV A;  3RQI A;  1NTC A;  5HOD A;  4BY1 J;  4D5C A;  2NS8 A;  1XG1 A;  4W1U A;  4D5F A;  3Q0W A;  1RET A;  1B8I A;  2FQ4 A;  1TWF J;  4A3D J;  2WB1 N;  4DW6 A;  1MH3 A;  4JP0 A;  1VFC A;  4BBS J;  1H88 C;  1IDY A;  2M0C A;  2H8R A;  1ETK A;  2DA6 A;  2R5Y A;  4XRS G;  4QIW N;  3MVP A;  3BTL A;  3SJM A;  1ETY A;  1ZQ3 P;  2Y9Y A;  3JRI A;  3HBL A;  3JRD A;  4A69 C;  1RKT A;  1JUM A;  2LTP A;  3G1L A;  4C3J J;  3F0C A;  2NVX J;  2G0E A;  1VI0 A;  1ETW A;  1AKH B;  4XK4 A;  3BR3 A;  5M3F J;  4JX4 A;  5IP7 J;  2Y0S N;  1LE8 A;  4AYB N;  1XS9 A;  1G2H A;  5F04 A;  3OSG A;  5IP6 A;  1B72 B;  4RBO A;  1YRN A;  4A3F J;  4UUS B;  1JUP A;  5EGO B;  2XGC A;  1PUF A;  2VKE A;  3LSG A;  4A3M J;  3DCF A;  2M9H A;  1JUS A;  1I50 J;  2YS9 A;  2NOG A;  2NVQ J;  3GBG A;  1Y1V J;  2COB A;  3JRF A;  5E3N A;  2QCO A;  4M3E A;  1EF4 A;  5J3L A;  3M4O J;  3HOV J;  9ANT A;  2E1O A;  1O4X A;  5IPA A;  4B4C A;  3JR9 A;  3S17 J;  2K9Q A;  1MBH A;  1R9T J;  3OIO A;  2NVY J;  2E2H J;  4IEJ A;  4I6Z A;  3ZQL A;  2WV1 A;  3HOZ J;  2L7Z A;  2LR8 A;  2MG4 A;  3SDG A;  3HOW J;  5GPA A;  1A6I A;  5C3E J;  1OCP A;  4FTH A;  1IG7 A;  2Y9Z A;  1TWH J;  2HDD A;  1BW5 A;  1W0T A;  1I3Q J;  2HOT A;  2TRT A;  3K2A A;  2O9L A;  4BXX J;  4A3J J;  5EDN A;  2K9S A;  3MN2 A;  2HXI A;  4J19 A;  2ECC A;  2EZH A;  2GLO A;  3GTJ J;  2LP0 A;  2LK2 A;  2X6O A;  5C4X J;  3G1M A;  1ETV A;  1U8B A;  2M34 A;  3GTQ J;  3HKZ N;  1HOM A;  2LKX A;  3B6C A;  4A3I J;  2HXO A;  2K9N A;  2JN6 A;  2XPU A;  1QVT A;  2PMZ N;  5GP9 A;  1IV6 A;  2E2J J;  3I4M J;  1XC5 A;  4S0H B;  4C2M J;  2O7O A;  5EYR A;  1K83 J;  2GBY A;  2JJ7 A;  5K7F A;  2MGQ A;  4AUX A;  2EZK A;  3Q0V A;  2QF7 A;  3HOU J;  4W97 A;  1IDZ A;  1WH7 A;  2HOS A;  5EZG A;  3O8H A;  1JT0 A;  1AKH A;  1UG2 A;  1TWG J;  2HQ5 A;  2DN0 A;  4IHV A;  2CUF A;  3BG5 A;  3BR2 A;  5BNG A;  1MH4 A;  2OPT A;  4NDL A;  1OFC X;  2D5V A;  1B72 A;  1SAN A;  4UUS A;  5EZH A;  3JRE A;  3H3V K;  5EGO A;  1U9O A;  1I6H J;  5EEA A;  5JLX A;  3LSJ A;  1RPW A;  2ECB A;  2L7M P;  4QTR A;  4A3G J;  2DMT A;  5M5Y J;  1JT6 A;  2RAE A;  4ABZ A;  1MSF C;  2EBI A;  3Q3S A;  1VND A;  2ME6 A;  1CQT A;  2HI3 A;  3BR0 A;  4MLO A;  1Y1W J;  1ZKG A;  2XB5 A;  2YUS A;  4EEF G;  2DMN A;  3BR1 A;  2L7F P;  2IBD A;  2DMQ A;  5IYD J;  3ZQI A;  2JA6 J;  4V2G A;  1D5Y A;  2H1K A;  3JRH A;  1FTT A;  1F36 A;  3MKL A;  1A5J A;  3CDL A;  5FLV A;  5F27 A;  5EG0 B;  1IGN A;  3ZQH A;  2M8G X;  3FIW A;  3UKG A;  1OJL A;  2EZI A;  3QPS A;  4MIM A;  1VF9 A;  1GT0 C;  3HOX J;  3TP0 A;  3S1M J;  5JLW A;  1JKO C;  5E3M A;  4LOC A;  1MBG A;  5J1R A;  5F1J A;  3JRC A;  2DA3 A;  2KT0 A;  1DU6 A;  2MSY A;  4A93 J;  1HF0 A;  5FKN A;  1MBF A;  5C4J J;  1B8I B;  5F0H A;  1T56 A;  3JRA A;  2R5Z A;  2I10 A;  2YU9 J;  2M2E A;  2AHQ A;  2R7Z J; 
#chains in the Genus database with same CATH topology
 3K4N A;  1TL8 A;  2CW8 A;  2ZCW A;  3BJO A;  4D9J A;  1RRJ A;  1Q1V A;  5IY5 H;  4C30 A;  1X1D A;  1FEX A;  2IJL A;  1VTN C;  4IHS A;  2XV4 S;  2AQE A;  4C2U A;  2K3F A;  2HDW A;  3G1O A;  4OIR F;  3FKI J;  5HNF A;  2KZV A;  2VPR A;  3HGY A;  1NK2 P;  5K7Z A;  4M3F A;  4MFE A;  2FJ1 A;  1U5T A;  4E7Z A;  1YIO A;  5GTI C;  3GO5 A;  1U9N A;  2XPW A;  5C44 J;  3LNQ A;  1V5E A;  2W00 A;  4RB2 C;  4EM1 A;  4CSW A;  1YS7 A;  2ZXJ A;  3BT9 A;  4CIC A;  3HOS A;  2O0Y A;  4IHT A;  1TWC J;  3U2R A;  4WXC A;  4BGD A;  1D0Y A;  2R7U A;  2FBK A;  1U78 A;  1LEB A;  3F8C A;  5LEK A;  2L02 A;  1ETX A;  2F4I A;  1GXQ A;  2CQX A;  3OV8 A;  1KYZ A;  4UUV A;  2DA7 A;  3W2W A;  3WU2 C;  2CU7 A;  1JTX A;  3A02 A;  5BOX A;  1YJN I;  1W0U A;  2JWT A;  3L2W A;  3UNG C;  1ZG5 A;  3CC2 I;  2K40 A;  2OAZ A;  3HIF A;  4L5E A;  3CLO A;  4CCN A;  3CF2 A;  2XUB A;  3QAH A;  3DLL F;  3CMY A;  2Y30 A;  2ID6 A;  4BL0 B;  3L1P A;  4A3E J;  2B63 J;  1BR1 A;  5F0C A;  3T8R A;  2FXA A;  5TRD A;  3PM1 A;  1GV5 A;  5K7H A;  1J0R A;  2ISZ A;  3CC4 I;  1FSE A;  3GLX A;  2VC1 A;  3TOB A;  1MDM B;  2XF7 A;  1W7P B;  3DV8 A;  3Q0U A;  4BBR J;  3BCB A;  3HXL A;  5LGN A;  3L2U A;  4XRS A;  3CUQ A;  2PI0 A;  3ULQ B;  4CCL A;  4EM0 B;  2VOO A;  3S16 J;  2F2E A;  4MTE A;  4FX4 A;  4V19 K;  2A68 F;  3LL7 A;  1HBX G;  2GOM A;  2WAD A;  3K4M A;  2DO7 A;  4CYC B;  3HUG B;  4PJN A;  3BJA A;  5DDG A;  1XDS A;  5H2F C;  1W36 C;  4AIK A;  5LD2 C;  1HDP A;  3I4N J;  3FXR A;  4LIU A;  1X1B A;  2X4H A;  1W5C C;  2HEO A;  2FQ3 A;  2NS7 A;  1PUE E;  3RDI A;  2ZSI B;  2X6Y A;  1GUU A;  3S2H J;  1WVR A;  3CLQ A;  4IOA F;  2KIS A;  2LD5 A;  1K6Y A;  2R92 J;  3CCE I;  3IV5 A;  4P96 A;  1S3J A;  3NEU A;  4OMY A;  2MYS A;  3QYE A;  4IXA A;  5FKL A;  3RKQ A;  4N4O B;  5JVG F;  3BTJ A;  1QPI A;  3F21 A;  5M5W J;  5M5X J;  2MLK A;  3OYD A;  2XC7 A;  5DD4 A;  1NK3 P;  1UHW A;  2QKM B;  2P7C B;  1XD7 A;  4I02 A;  3H35 A;  1SEU A;  1OCO H;  2XAJ A;  1BI1 A;  1Y56 A;  1AU7 A;  1MMS A;  4H4K C;  2ZB9 A;  1IF1 A;  3E6M A;  1AHD P;  3M07 A;  4KJZ A;  2IA2 A;  3ELK A;  2BW3 A;  1XMK A;  5A2Q K;  5EEH A;  3GTO J;  1VQ5 I;  1WQ2 A;  2DTZ A;  2HOA A;  3NAU A;  5HS8 A;  3OR1 C;  2XSD C;  2A05 A;  3FXL A;  2HGC A;  3QWL A;  1QRY A;  2GOX B;  1I27 A;  3ZN0 A;  4RGR A;  3CCV I;  2H6C A;  4GCV A;  4EJU A;  3VOE A;  1H89 C;  2CUJ A;  3QPH A;  1BW6 A;  2NNN A;  3BPV A;  2OZ6 A;  3IH3 A;  5ICE A;  5JR3 A;  4B1R A;  1BBY A;  4LB6 B;  2DDA A;  1YTY A;  3BTC A;  2KIU A;  2R5Y B;  4EGY A;  1FYL A;  3FXQ A;  3WGG A;  2EV0 A;  3DPL C;  1XX5 A;  3LOC A;  3RQ4 A;  4DZJ A;  1Z05 A;  2LRD A;  3E5Q A;  1HLV A;  3ROU A;  2KHM A;  2MC4 A;  4XSZ F;  3WU1 B;  1FLI A;  1HQC A;  3LA3 A;  4F55 A;  1UFM A;  2F5F A;  2A6H F;  3ZQ7 A;  2R93 J;  4CCO A;  2Y0S A;  2E1N A;  1TNS A;  3CZ6 A;  2NRA C;  1XMX A;  5BPD A;  1B1B A;  1JTY A;  3F72 A;  1OCZ H;  3RPU D;  4C3I J;  4XBF A;  2HKO A;  2VKV A;  1JGS A;  4RAZ A;  4JBA A;  2BYV E;  4A3L J;  2GQQ A;  4I76 A;  2ISY A;  3E6D A;  4RB1 A;  4FT8 A;  4BS9 A;  3BDD A;  4CCM A;  1HST A;  1OPC A;  2AO9 A;  3L2V A;  5IP9 J;  3OYL A;  2RNJ A;  1O57 A;  3V8L A;  1R71 A;  3N05 A;  3V8J A;  2FE3 A;  2VT3 A;  3OS1 A;  2W85 A;  3SEZ A;  2R7R A;  5HS9 A;  1AWC A;  4L5J A;  3PO2 J;  2P81 A;  4UVC A;  2A3S A;  1JKP C;  4PJJ A;  5HLT A;  5LRS A;  2QUF A;  4ITV A;  3E7L A;  2V9P A;  5GPC A;  4G7O F;  3BJ6 A;  3ECH A;  4IVN A;  1SD7 A;  3T1B A;  4BHC A;  5EG0 A;  2COM A;  3TBI A;  4HX7 A;  4PZJ A;  4OOI A;  2F5E A;  3T5X A;  3VWB A;  1IV8 A;  1HSJ A;  3DWL E;  4D7M A;  2CUE A;  1O3T A;  3TO9 A;  2XB0 X;  1JJ6 C;  1POG A;  2WTE A;  3FHZ A;  3RSN A;  2EFW A;  4NHJ A;  1H9G A;  2L2O A;  4IRG A;  2Y0M A;  1A6Q A;  2EB7 A;  3GFL A;  1PP8 F;  3QPL A;  3RZO J;  1LQ1 A;  2HVR A;  5HOD A;  3HHG A;  4XOR A;  2RNG A;  4W1U A;  3JAM Z;  4D5F A;  3DBL B;  3Q0W A;  4BJ6 C;  4FHT A;  2HPM A;  3CDI A;  4JOM A;  3BLY A;  2WB1 N;  5ICC A;  1R1V A;  3Q9V A;  4DW6 A;  1MH3 A;  3RCO A;  1VFC A;  4XKW A;  5DM7 F;  1H88 C;  2EV5 A;  4M9X A;  4BAY A;  2M0C A;  5D6E A;  5J4V A;  1ETK A;  1UB9 A;  4EVI A;  3J7A O;  1GVJ A;  2EV6 A;  2XDV A;  4A5M A;  2Y9Y A;  4HV6 A;  3JRI A;  2VBY A;  3K69 A;  3A1Y A;  2CFO A;  3HBL A;  2QQB A;  2FML A;  3L2C A;  4C3J J;  4GXO A;  2OU2 A;  2IT0 A;  1IO2 A;  4A6E A;  2MFZ A;  1EKE A;  1ETW A;  2D1V A;  2V1N A;  2XAQ A;  4XK4 A;  4XM3 A;  5CVR A;  2KIQ A;  5GAG J;  1E17 A;  4AYB N;  1XS9 A;  2K3P A;  5F04 A;  3PIO F;  1K78 B;  1B72 B;  4RBO A;  1YRN A;  2JRM A;  1ZRC A;  2XGC A;  4Z2Y A;  1HA8 A;  3DU5 A;  3KFW X;  3DCF A;  3GZ6 A;  2M9H A;  1IUY A;  4EJT A;  1NG7 A;  3U9G A;  2R4G A;  3CUQ B;  4JK1 X;  5HVQ C;  3GBG A;  3WTT C;  1U2W A;  3ZMU A;  5KAF C;  2ZC2 A;  1IRG A;  1EF4 A;  3M4O J;  4O5V A;  1SD4 A;  3OIP A;  3MKZ A;  4NUB A;  3JR9 A;  3KIO A;  5B1A H;  3PNT A;  1R9T J;  2HS5 A;  5D5X B;  2OV7 A;  1Z1D A;  3ONQ A;  4ENJ A;  1Z6T A;  3DBR B;  2P6S A;  2JPB A;  2K86 A;  2KL4 A;  5GPA A;  2M7B A;  4HLY A;  4UVB A;  3J81 Z;  2P6T A;  1MJB A;  4FTH A;  2D45 A;  1KU2 A;  3E0J B;  1GLN A;  4GGG A;  2Y9Z A;  1SVO A;  1KQ9 A;  4NC7 A;  3WE2 A;  1EH6 A;  2HDD A;  4ESF A;  1OCR H;  2GA2 A;  1YE9 A;  1W0T A;  3ZMZ A;  2RC4 A;  2HOT A;  3K2A A;  1SVM A;  2W25 A;  4BXX J;  2XF6 A;  4O6J A;  5KAI C;  5EDN A;  4BQO A;  4PK4 A;  2HXI A;  1P4W A;  2OC6 A;  3TDZ C;  1MMD A;  3RKY A;  2ADU A;  3G73 A;  1IN8 A;  3GZ5 A;  1XTA A;  1VQ7 I;  5C4X J;  4HZF A;  4Y17 A;  2A5W A;  1FPQ A;  2WC2 A;  1YIJ I;  3HKZ N;  2QQ9 A;  2PG4 A;  4CZZ A;  4A3I J;  5E20 A;  2JN6 A;  4BHB A;  2XPU A;  5FLX Z;  4N9H A;  5DUK A;  1QVT A;  2GIV A;  2IP2 A;  1YLF A;  3FMR A;  3QPT A;  1AA7 A;  2Z33 A;  2DBB A;  3LQQ A;  5ED4 A;  1VQ9 I;  2Z16 A;  1MMA A;  5LRR A;  2GXA A;  3HSR A;  1D3Y A;  1ZAR A;  3HYI A;  2MGQ A;  1S7O A;  5IT3 A;  3MD2 A;  3R0J A;  4AUX A;  3Q0V A;  3C18 A;  3GWZ A;  2NYX A;  4ENK A;  2HOS A;  1Y0U A;  3LA7 A;  4RAG A;  5EZG A;  2M4K A;  1ZG3 A;  2KKO A;  2RV8 A;  2L01 A;  3EUA A;  3PUF A;  2HQ5 A;  2DN0 A;  4BAC A;  2PMU A;  1ZHF A;  3L2R A;  4G7Z F;  5BNG A;  4CH7 A;  2OPT A;  2JRT A;  4L9V A;  1QGP A;  3JRE A;  1T2K A;  1YX3 A;  5EGO A;  4EGZ A;  3M8F A;  2QWW A;  5JLX A;  4HG2 A;  1DDN A;  5ILS A;  2LF8 A;  2DOE A;  1RPW A;  2ECB A;  5K5Q A;  3LSM A;  2RRE A;  2CQK A;  4A3G J;  1HXD A;  1MSF C;  6PAX A;  1B59 A;  4DJA A;  3DEU A;  2VIX A;  2WBM A;  4MLO A;  1IW7 F;  4EEF G;  5CQG A;  4GYI A;  4QLC U;  1LJ9 A;  1FZP B;  1ZEL A;  3FHN A;  4IQ4 A;  5GAD J;  5FD6 A;  1FBS A;  5ILV A;  3CCS I;  2VBW A;  1QNT A;  2W82 A;  4DQ2 A;  1LDD A;  3ZQI A;  2JA6 J;  2PEX A;  2H1K A;  3DTI A;  3JRH A;  4XNF A;  1FTT A;  1XSV A;  2NXN B;  4YFN F;  1A5J A;  1X1C A;  3MEX A;  2R7F A;  2BGC A;  2V4J C;  2VJI A;  2ZNY A;  5EG0 B;  1RIO H;  1IGN A;  2VE8 A;  2M8G X;  2DDB A;  3FIW A;  2EZI A;  3QPS A;  2HYF A;  4AID A;  1VF9 A;  4M71 A;  1KU7 A;  3OS2 A;  3KLO A;  3KP7 A;  3F9K A;  3IWZ A;  1YS6 A;  2J5O A;  3W2A A;  4HLX A;  2JPC A;  3CCL I;  1JE8 A;  4P5O A;  3OYH A;  1HKS A;  1BI3 A;  2MSY A;  4PGH A;  3J80 K;  2XKO A;  1T56 A;  4BU2 A;  2XHK A;  2YX4 A;  2E1M B;  3JCU C;  2HYG D;  2E71 A;  4YFK F;  4G9Y A;  2E5Z A;  5H6R A;  1X58 A;  4EQQ A;  2WA0 A;  1X3W B;  3FXM A;  1WSU A;  1W5S A;  1QVU A;  1XGS A;  4RDU A;  1ETQ A;  4BJ5 C;  2G9W A;  1VQN I;  1ZGJ A;  1Z21 A;  3IRQ A;  3ZR8 X;  2KMU A;  2D2W A;  1K4S A;  4U0W A;  2VON A;  4WXH A;  1HDD C;  2QBY A;  2O5R A;  1G4D A;  3GTL J;  4MFD A;  5IT9 K;  2CQ7 A;  1HW5 A;  3FXO A;  3OSF A;  4R1H A;  4BY7 J;  4L9N A;  4J01 A;  5ILU A;  2O8K A;  2XIG A;  2QEX I;  1Y8Q B;  2XAF A;  3QOE A;  3S32 A;  3GME A;  3HGG A;  5TGT A;  2V9V A;  5E79 C;  2DFE A;  2QZ8 A;  3I54 A;  2Q2E A;  1FNN A;  3IH4 A;  4HEA 2;  4UB6 C;  4MNU A;  3VYT B;  1ZGW A;  2ZFW A;  1QZZ A;  1UHS A;  1Z67 A;  3PQJ A;  5D5W B;  2GWR A;  2FUG 2;  2IAI A;  2P7V B;  1XSD A;  3BG9 A;  4CHU A;  1IXC A;  1KQ8 A;  2OCC H;  4CCJ A;  2V1X A;  1PDN C;  3JW4 A;  4UV8 A;  4A3C J;  2OF7 A;  2ZME C;  1UG0 A;  2V9K A;  5FB2 A;  1X1A A;  4HQE A;  4F92 B;  4HYE A;  1T33 A;  4AWX B;  4BE2 A;  3K70 D;  4ENN A;  2WWY A;  5FJ8 J;  3IP4 B;  3OYE A;  4DOZ A;  2HVQ A;  4JX6 A;  1ZTR A;  3OYF A;  1IN5 A;  2MW8 A;  1O3R A;  3I9V 2;  5F1R A;  2KFD A;  1LPQ A;  4EJO A;  2YU3 A;  4E7S A;  2KJC A;  1XGO A;  1WI9 A;  3FKJ A;  3HOT A;  3L9F A;  4U0V A;  4GFB A;  1XGN A;  2G7U A;  3QOP A;  4HX4 A;  3A4C A;  4BDZ A;  5DEQ A;  3BQY A;  3BR6 A;  3EUH C;  3LWF A;  2DT5 A;  1LVK A;  2CV1 A;  5HDN A;  2DMP A;  2QGU A;  2IS2 A;  3FMQ A;  4RMN A;  1X3U A;  4FE4 A;  1EV7 A;  3GFM A;  2Y2Z A;  2KZG A;  1JHF A;  3SZP A;  5FFZ A;  4HRI A;  2J5P A;  2WAQ A;  4OAZ A;  4M3G A;  2IGM A;  3KYL A;  3F22 A;  1Y39 A;  3E6C C;  1ITY A;  1JKR C;  4II3 A;  1M1E B;  2EFP A;  3QU6 A;  1WJF A;  3HJE A;  4RB0 A;  2XAS A;  4XLC A;  4I09 A;  5F0F A;  1MND A;  3QP5 A;  3TGN A;  2EFN A;  3A01 B;  2RQP A;  4N4N B;  3LSR A;  1D5V A;  3R60 A;  4HDV A;  3RPU A;  5M3M J;  3K2Z A;  1F43 A;  3M7G A;  2FOW A;  1R4M B;  4DYR A;  3BG3 A;  2ELK A;  2K5C A;  1ERD A;  2VBZ A;  1MIJ A;  1YOV B;  1IC8 A;  3CF5 F;  3K9T A;  4LIV A;  3PUB A;  1A04 A;  3JSP A;  2JK3 A;  4BKX A;  2XRL A;  2W48 A;  4A3B J;  3SFI A;  3FDY A;  1I6X A;  2DJN A;  3B6A A;  1FIP A;  2DOD A;  3DEE A;  2X0L A;  3TW7 A;  2JA8 J;  3DKX A;  3K1M A;  4RGX A;  4RS8 A;  1BR4 A;  2A07 F;  1WPK A;  3BTI A;  4NBQ A;  1QA6 A;  2HTS A;  1BC7 C;  2EQR A;  4IHX A;  2I5U A;  3SHF A;  2FBH A;  3DTK A;  4B3X A;  1LUJ B;  3H9J A;  2RGV A;  4A5N A;  5JVT A;  4PFO A;  1WCM J;  3HPG A;  1Y8R B;  2CV0 A;  1J7K A;  4E4H A;  4IPA A;  4A12 A;  3QOD A;  4XSX F;  5L3B A;  4IO9 F;  3I59 A;  3K1P A;  2CMP A;  4ZYD A;  4G7H F;  2ZJ2 A;  2IS6 A;  4DZP A;  4QSH A;  2VJ4 A;  4DYQ A;  3RZD J;  2VE9 A;  5F64 A;  1X4P A;  2OD5 A;  3CCQ I;  1H8A C;  2VB6 A;  4FET A;  5TIS C;  3I58 A;  4WXD A;  1BIB A;  2EJR A;  2H6B A;  2P5L C;  1T39 A;  1LE8 B;  3ASO H;  4KMF A;  4L18 B;  3FK6 A;  3K4J A;  2A61 A;  1R5H A;  3ABM H;  4CO8 A;  1QHG A;  4UY8 I;  1FT9 A;  1XDU A;  3FM3 A;  5ICG A;  2IGN A;  5CLS A;  2Y48 A;  2JVG A;  3OL3 A;  2DYR H;  2P5V A;  4A2U A;  2KDZ A;  1PUF B;  4HBL A;  1SFX A;  4IKF A;  2OJE D;  4ZYH A;  2CV2 A;  4ZYG A;  2CWE A;  1I1G A;  3RYP A;  5K5O A;  4LGW A;  1OR7 C;  2DTR A;  3E6B A;  3GZN B;  4H0E A;  4AIJ A;  4S05 A;  2VUM J;  1RR7 A;  3S8P A;  2DOF A;  3J7Y J;  4B3A A;  5DS9 A;  4X0G A;  1ZR2 A;  1AOY A;  3FX3 A;  1TTY A;  4C9Y A;  1DPR A;  1PJR A;  5BPI A;  2DU9 A;  1R58 A;  2IA1 A;  1HKT A;  2F6C A;  3KZY A;  2M7A A;  2K9L A;  2R0Q C;  2CYY A;  3VOD A;  5J1Y A;  1IUF A;  5HOO A;  1HC8 A;  2KRH A;  1VQ8 I;  1X4O A;  1S6L A;  4U88 A;  1R1T A;  2MD0 A;  2JZY A;  3R0A A;  1X2N A;  2VT2 A;  1DUX C;  1LFP A;  2O6G E;  2HQR A;  2PMH A;  1GVD A;  3O3K A;  3HRT A;  3ZGK A;  2XGD A;  3G71 I;  1LFB A;  3K6G A;  4Q5S F;  3J7A Y;  4I0B A;  1IJW C;  1SFO J;  1IN7 A;  3M8J A;  5ERI A;  3CO7 C;  1ZR4 A;  2MH2 A;  5J47 A;  2BY1 A;  2XPV A;  1DP7 P;  3BWG A;  2E7W A;  4D5C A;  3IAS 2;  1XG1 A;  3O6B B;  1MD0 A;  1RET A;  4I99 C;  2FQ4 A;  1JHH A;  3LSI A;  1TWF J;  3K4B A;  3QP6 A;  4BNC A;  3ZN1 A;  2PMZ A;  3F3X A;  4JP0 A;  4CA0 A;  2IW5 A;  4P1W A;  4BBS J;  2K9M A;  2QLZ A;  3BZC A;  3KX2 A;  2LY2 A;  3IL2 A;  4G6D A;  4KIF A;  3RI4 A;  2ZSH B;  3BTL A;  4WCG A;  3AG3 H;  1YIT I;  1ZQ3 P;  2KDO A;  2Z2S B;  1OIS A;  1ODD A;  1LDJ A;  2MH9 A;  3KZZ A;  1DGR M;  3VYS B;  3ERE D;  2LBF A;  4R8H A;  4EMS A;  4OIO F;  5B1B H;  2G0E A;  3DBH B;  3W3C A;  3VFZ A;  3FBI B;  5B3S H;  3BR3 A;  1GHC A;  1IRX A;  5M3F J;  4JX4 A;  1KON A;  2Y0S N;  3CES A;  4QWQ A;  3H9Q A;  1BOA A;  2Q0O A;  4M6X A;  1PVE A;  3AFH A;  4XRF A;  4UUS B;  2GA1 A;  2LC2 A;  3LSK A;  3TMO A;  1A35 A;  2L3D A;  4ESJ A;  1Z6R A;  1JXS A;  4ZDL A;  4ZDO A;  1G8X A;  2W4S A;  3HRM A;  3SQN A;  1I50 J;  2YS9 A;  2NOG A;  1ZLK A;  4KT5 C;  1Z3Y A;  2PFB A;  3D5R C;  4KFC A;  3I64 A;  2DFH A;  4A0Y A;  3ZMT A;  4CZC A;  5LFA A;  3HTU A;  1WJB A;  2ZJP F;  2YX7 A;  2V6E A;  9ANT A;  2QKL B;  5IPA A;  5BMZ A;  3V8K A;  4B4C A;  1R5I D;  3S17 J;  1R49 A;  2IGK A;  2NVY J;  4NC8 A;  1T6S A;  4KA4 A;  3H1C A;  3ZQL A;  2WV1 A;  3WTY C;  2L7Z A;  3HOZ J;  2LR8 A;  3VSK A;  2MG4 A;  2HZD A;  2FRH A;  4ZC3 A;  5HLI A;  1RUO A;  5HDK A;  5D8L B;  3ESW B;  3I71 A;  1UAA A;  1YJW I;  4XLA A;  1S72 I;  3H3U A;  3H5R A;  4LG0 B;  2BXY A;  3I4P A;  3R4K A;  1D8J A;  4NQW A;  2X6W A;  4YRV A;  1W36 D;  3CD6 I;  4Y15 A;  2OUM A;  1I3Q J;  4YII A;  3OS0 A;  4EJW A;  3LAJ A;  1EH8 A;  4A3J J;  1ULY A;  3BY6 A;  3TQN A;  1LB2 A;  4MEX F;  2LP0 A;  4B43 A;  2X6O A;  4Q48 A;  2BVL A;  2GXB A;  2ESN A;  3KZI C;  1ETV A;  3F23 A;  5TJJ A;  2KLO A;  1HOM A;  5DD8 A;  2V1D A;  2WAF A;  4B09 A;  1EJ9 A;  2F48 A;  2K9N A;  4UV9 A;  1ZGA A;  1ACI A;  3ZMV A;  5GP9 A;  3B02 A;  4UXN A;  3RYR A;  3CMA I;  3GFI A;  1XC5 A;  4E7K A;  2TDX A;  4U7D A;  3RIR A;  2B9S A;  4S0H B;  1J2X A;  3I59 B;  2GBY A;  2JJ7 A;  3MAJ A;  4HW0 A;  5K7F A;  5K5R A;  2EIJ H;  2EZK A;  4IRI A;  3RKW A;  1WH7 A;  2ZBK A;  2DOA A;  3UR3 C;  3O8H A;  2PX9 A;  1AKH A;  4KIG A;  2M45 A;  2X1E A;  3WTX C;  4IHV A;  1BN5 A;  4HF0 A;  2A69 F;  2L9V A;  3HHH A;  1FOX A;  1U5T B;  2IPQ X;  3CUQ C;  4KN4 X;  1P2F A;  2XGX A;  1BOB A;  1SAN A;  5ICF A;  3BZK A;  5EEA A;  1D8K A;  1QHH D;  2M30 A;  1ZG1 A;  3CP2 A;  4BYY A;  1RI7 A;  4G6T B;  4LIT A;  2QA4 I;  2DMT A;  4I2O A;  1ZLJ A;  2RAE A;  3HSF A;  2EBI A;  1O7F A;  1FSH A;  1KU3 A;  4AIH A;  1VND A;  2ME6 A;  2HI3 A;  4CGZ A;  2DMN A;  5BQT A;  4F3Q A;  4KIT B;  2OCE A;  2L7F P;  2QM3 A;  4J00 A;  2QQ8 A;  3N97 A;  1MNE A;  1J9I A;  4BE0 A;  3B73 A;  3H36 A;  1HW2 A;  1K79 A;  3H5A A;  4HOB A;  2VPL A;  4L0Z B;  1T0F A;  3CDL A;  3QYB A;  1QZY A;  3QRF F;  3NRV A;  3J80 Z;  2G7H A;  1F4K A;  1TBX A;  2FF4 A;  2KIM A;  3A2K A;  2LDU A;  2BBY A;  1SD5 A;  4ZZL A;  2MLG A;  2HTJ A;  3WE3 A;  1YX5 A;  4MIM A;  5FFX A;  2F5D A;  3HOX J;  3TP0 A;  2LYC A;  3S1M J;  5CQE A;  5E3M A;  4LOC A;  2E7X A;  4XKC A;  1N25 A;  2DA3 A;  3ABK H;  4RAY A;  3AG1 H;  5KNL A;  3MWM A;  4ZZD A;  2XRN A;  4R79 A;  4JQF A;  1V55 H;  1W1W E;  3JRA A;  3O2P E;  1R6R A;  2R5Z A;  2KIF A;  2I10 A;  1VZ0 A;  2R7Z J;  2UV1 A;  1FMW A;  5E1W A;  3ZQF A;  2M4G A;  2LVS A;  4V2F A;  1TT5 B;  3P7N A;  1K6O A;  5E3L A;  4YEL A;  4TV7 A;  1K4T A;  2BZT A;  2QSH X;  2FA5 A;  3AL0 B;  2O3F A;  3PNY A;  5FKM A;  1G3Y A;  2LFB A;  3P9I A;  3KP6 A;  1BR2 A;  1U3E M;  2MA3 A;  2Z1D A;  2XSJ C;  3HRS A;  2LBF B;  4F7Z A;  3M1C A;  2LSO A;  2VQH A;  2YPR A;  4DYC A;  3CCM I;  3S2W A;  3S15 J;  4Y52 J;  2ME0 A;  1T95 A;  2JVH A;  2DYS H;  3VYR B;  4ASN A;  1TQI A;  3WTZ A;  5CJ9 A;  2QEN A;  3IH2 A;  3I3L A;  5DCF A;  4E7J A;  3WHC A;  2BVM A;  2EIN H;  1WHU A;  3ZPL A;  2X85 A;  2D1H A;  3OYJ A;  2V1U A;  3FK7 A;  1FYM A;  2DMU A;  3HSE A;  5EEG A;  2LH9 A;  2BW3 B;  1L3L A;  2ZXW H;  3HDD A;  3CME I;  2ZXH A;  2HWV A;  4BJT A;  3RKX A;  1YI2 I;  3G3Z A;  3V4G A;  1DU0 A;  4E7H A;  2CW0 F;  3WHB A;  1I39 A;  2JSC A;  2LKP A;  3TL4 X;  2P4W A;  3KP3 A;  1O3S A;  3BR5 A;  4BEH A;  5BS6 A;  2LLK A;  4HNT A;  1IZ1 A;  3K4C A;  2JQ7 A;  3BRO A;  3GVA A;  3F6O A;  4FCY A;  3CDH A;  4ON0 A;  1B9N A;  1TP4 A;  2GXG A;  3IHU A;  4D0P A;  1ENH A;  3D5S C;  3F8F A;  4BQA A;  2ZME A;  1N75 A;  3GTP J;  1FBQ A;  1Z0X A;  3F6V A;  1WJE A;  1OCT C;  3GTK J;  1FBU A;  4ZTJ A;  4Y3O A;  3HM5 A;  3LAP A;  5E8I A;  5L3F A;  1DP3 A;  3BPX A;  3HRU A;  2V26 A;  1ORK A;  4FQG A;  4MHG A;  2ZJQ F;  5H20 A;  2H27 A;  2VLA A;  1IXR C;  3HEF A;  1L0O C;  4MTD A;  3WGH A;  3DKW A;  2E1M C;  4B47 A;  1VQ6 I;  4XKB A;  3TDU C;  4BDY A;  3EUH A;  2DA5 A;  3LSP A;  1YW9 A;  2LRE A;  5AIP A;  4PUS A;  1TC3 C;  4AU7 A;  1LFU P;  1P4X A;  2DCE A;  2UZK A;  3C2B A;  3FZV A;  5DCM A;  5D4R A;  3FIS A;  4IHW A;  1ZH5 A;  3CQZ J;  4M3D A;  2LMD A;  2DW4 A;  4ZJZ A;  3GXO A;  5EJC A;  1Y6I A;  1P9Q C;  3OWT A;  1XSX A;  2WAE A;  4ZDP A;  3MMY B;  4I98 B;  2PN6 A;  1QO0 D;  4RM3 A;  2LOO A;  3S2D J;  3PSI A;  3GLL A;  2JSP A;  3X2Q H;  4UHT A;  2F4O B;  4Y7N J;  2K85 A;  1P4A A;  4HQM A;  1XGM A;  2CFX A;  2K27 A;  3FBN B;  3JAM K;  2MBF A;  3L2Q A;  3E1S A;  5FRO A;  2IRF G;  3DTE A;  3O8G A;  1ON2 A;  4DBR A;  1FP2 A;  3TP3 A;  1G3T A;  1GV2 A;  1OCC H;  4NB5 A;  2R3S A;  4IF4 A;  2DI3 A;  1MKM A;  3HL2 A;  4C3H J;  4RLQ A;  2E2I J;  3GYH X;  3H0G J;  1ETO A;  1PP7 U;  1TT0 A;  2PQ8 A;  2STT A;  3HTS B;  3QU3 A;  1F5T A;  1MNM C;  2N8G A;  4YFX F;  2DJI A;  4DIQ A;  1BIA A;  1FX7 A;  2W1O A;  2NVU B;  2X9D A;  4PCQ A;  5FGM A;  5JHF A;  1TW3 A;  3ZOB A;  1O3Q A;  3MZH A;  3K4K A;  4XRM A;  3WTU C;  1BI2 A;  5IYC J;  4NNJ A;  2W24 A;  3K10 A;  1YW8 A;  3W6V A;  3CCR I;  3E5X A;  4IX7 A;  2FEZ A;  1MBK A;  2M87 A;  3CCY A;  3S1R J;  4BXU A;  3QYF A;  2R7V A;  1E3P A;  5JFR A;  3JRG A;  2M1B A;  1V5G A;  1T98 A;  3HZJ A;  3G6E I;  2Z99 A;  3IAM 2;  1FOK A;  2X1D A;  2F5C A;  4XOT A;  1OQY A;  2BEO A;  2HZT A;  2XKP A;  4A6D A;  2NVT J;  2HYJ A;  1MDM A;  3CP8 A;  1U6G A;  3WG7 H;  1W7P A;  1XMA A;  2DQR A;  2UXX A;  3QQA A;  4M9Z A;  1YRN B;  1DQU A;  3KYD B;  5HNH A;  1VQL I;  3ZQC A;  4AVP A;  3FWE A;  2X1C A;  3A03 A;  2VQG A;  2OQG A;  2C6Y A;  4CUG A;  2W84 A;  3KEY A;  3S14 J;  1MBJ A;  2WAQ N;  3LSH A;  2VAS A;  1R00 A;  2CQQ A;  4CYC A;  1KQ0 A;  3P9C A;  2Z3Y A;  4JYK A;  3C3W A;  3GCM A;  3FF5 A;  5CVV A;  5FD5 A;  2H94 A;  5J4Y A;  3J81 K;  1SFU A;  2FNA A;  2H1L A;  3CCJ I;  2FBI A;  1RNL A;  1W4M A;  5J40 A;  1JI8 A;  4E6K G;  2Y31 A;  3S1Q J;  1OR7 A;  5FO5 A;  4Y33 A;  2R5Z B;  4U0Y A;  5IOY A;  3H92 A;  4HDU A;  2L4A A;  2XVC A;  4XKV A;  1ON1 A;  3DPT A;  4FE7 A;  1P7J A;  1WKM A;  5LHI A;  2CGP A;  2EH3 A;  1XN7 A;  3MKW B;  4M6V A;  3PO3 J;  2CQN A;  2QQA A;  3MQ0 A;  1Q1H A;  2JA2 A;  1V3F A;  3CCU I;  4X6A J;  4L5I A;  1R23 A;  5D8K B;  4LK1 F;  1W5T A;  3KP4 A;  4MEY F;  4PJM A;  4RLF A;  2GIZ A;  1N78 A;  2BHY A;  2BXZ A;  2VOP A;  5FLX K;  4BY1 J;  2ESH A;  3L7W A;  4KYW A;  2DK8 A;  1V4R A;  5CVJ A;  3D5L A;  2GAU A;  4PJ0 C;  1B8I A;  1IAW A;  2EFQ A;  5JI6 A;  1UCR A;  4A3D J;  3A0B C;  1D1C A;  3RJP A;  3OYK A;  3KEQ A;  1R36 A;  2ZXI A;  2ZKZ A;  2VJJ A;  1IDY A;  2H8R A;  4OIQ F;  3OIQ A;  2R5Y A;  3PL8 A;  2VOD A;  2IGO A;  4XRS G;  3MVP A;  4QIW N;  5A2Q Z;  4L0Y B;  1XCV A;  3OYN A;  3OMY A;  4A69 C;  3SEQ A;  4XR6 A;  4DNC A;  3F0C A;  2NVX J;  2PJP A;  1OLT A;  3N4M A;  1VI0 A;  5LEJ A;  2WV0 A;  2DQL A;  1SVL A;  3L00 A;  4B44 A;  4RA2 A;  2ZFU A;  3CJT B;  3VDX A;  1B9M A;  3KET A;  3OSG A;  3VYU B;  2V7F A;  4KDP A;  2GZW A;  2O61 A;  4A0X A;  5EGO B;  2RQQ A;  3OYC A;  3K4L A;  5B5E C;  2PJR A;  3H9G A;  4CXF A;  4A3M J;  4LD5 A;  1JUS A;  2NVQ J;  2P0W A;  3DKY A;  4OU0 A;  2ZJR F;  5E3N A;  4M3E A;  3BG7 A;  2CG4 A;  2FU4 A;  2QYO A;  2HOE A;  2Y69 H;  3EUK L;  3FM5 A;  5J3L A;  3FXU A;  5K1Y A;  5E18 F;  2HNH A;  4G94 A;  3D0S A;  4F52 A;  3WGI A;  1S5L C;  4IZZ A;  2OZU A;  2XAG A;  4IEJ A;  4I6Z A;  1FMV A;  5DCM B;  2Y75 A;  3DQV C;  3KLN A;  3M1E A;  3ASN H;  1A6I A;  3NWT A;  3W2V A;  4ETS A;  5C3E J;  3S3N A;  1D1A A;  1MW7 A;  3ZQQ A;  3G4S I;  4IRH A;  3WTW C;  3F8B A;  1I1S A;  3C2H A;  1BJA A;  5CKT A;  2DPU A;  1QZE A;  2L9N A;  2JUC A;  1P92 A;  1MMG A;  1G59 A;  2EWN A;  4ESB A;  4BXF A;  4M6Y A;  4LG3 A;  2EZH A;  2VBX A;  3NWS A;  2KQR A;  3GTJ J;  3U21 A;  2LK2 A;  2ZNZ A;  2XRO A;  2AS5 F;  4HV5 A;  2M34 A;  3FMS A;  2HDC A;  4KNY A;  2IVM A;  2LKX A;  3COA C;  3B6C A;  4BQQ A;  4FAS D;  3E97 A;  2NAZ A;  3M8E A;  1N77 A;  2CW7 A;  2PMZ N;  1NHA A;  4RGS A;  3IKT A;  3IUO A;  2YSR A;  1BC8 C;  5KVR A;  2R7S A;  2MC3 A;  4LK0 F;  4ENM A;  1IV6 A;  2OTL I;  3I4M J;  3JTG A;  4M74 A;  2O7O A;  1S7A A;  1K83 J;  2E5N A;  4XN3 A;  2X6X A;  1YQA A;  4MGR A;  3GEZ A;  2QF7 A;  2R7Q A;  3HOU J;  1IN6 A;  1YHQ I;  3ZMD A;  5HLG A;  2R7T A;  2QBY B;  2EFO A;  3GFJ A;  3BG5 A;  1MH4 A;  3C1D A;  1D1B A;  3LQR A;  3ERM A;  2BY3 A;  1K78 A;  1B72 A;  2NNY A;  1WZ2 A;  3LFK A;  2HR3 A;  3WOD F;  2QSG X;  3I56 I;  3H3V K;  2EIL H;  4P55 A;  1HW1 A;  2Q2E B;  5GTH C;  3LSJ A;  4LB5 A;  1BM9 A;  4XLE A;  1J59 A;  1W7P D;  2EIK H;  3V7R A;  1A31 A;  1WWX A;  2Z5U A;  5M5Y J;  4M72 A;  3BZ6 A;  1XPX A;  3BG6 A;  1D0Z A;  4LMY A;  3BR0 A;  2E35 A;  3K1N A;  2XB5 A;  3VEP A;  2VKD A;  5CPR B;  3BR1 A;  3KP2 A;  4WK8 F;  2DMQ A;  2AQF A;  1ZRD A;  2K4J A;  4S04 A;  4LLN A;  2UWM A;  1F36 A;  3MKL A;  1FWZ A;  1YG2 A;  2MAB A;  3VB2 A;  1S29 A;  2LF7 A;  1X1P A;  1YJ9 I;  5FLV A;  3SZG A;  1J09 A;  4PSW A;  5E8G A;  3SDB A;  3U1D A;  3K0L A;  1G3S A;  1USS A;  1WFX A;  4U7B A;  3DU6 A;  2EA4 A;  2HQA A;  4HX8 A;  2L7K A;  5LLQ A;  2V6C A;  4ZH4 F;  2AXT C;  4ZTF A;  1GT0 C;  3ABT A;  3E3V A;  2AXL A;  5F6F A;  5L3D A;  1OKR A;  2M3A A;  5J1R A;  3ZXS A;  5J8F A;  1RR8 C;  1DU6 A;  2L9S A;  3I0T A;  5LHH A;  4A93 J;  5LGU A;  1HF0 A;  5FKN A;  5LHG A;  5C4J J;  1ZN2 A;  1UZC A;  1B8I B;  1OMI A;  5F0H A;  3KCC A;  1A36 A;  4KIB A;  2QSF X;  2K4B A;  2AHQ A;  4I7H A;  1I3A A;  2LY9 A;  1FTZ A;  3F8N A;  4B8X A;  2A5Y B;  2ID3 A;  1ZK8 A;  3CJN A;  2DPD A;  2WY7 Q;  2F5V A;  2XGE A;  2HPI A;  2XAU A;  4JX5 A;  5FKO A;  4UB8 C;  2IS4 A;  1U5T C;  3CJR B;  1BA5 A;  1FJL A;  1E2X A;  3WTV C;  2XAH A;  2DLL A;  2VKH A;  3GTG J;  1APL C;  4FIS A;  3PNV A;  5GAH J;  2FNP A;  4XIC A;  1U8R A;  3NAR A;  2ICW G;  1V5F A;  2X51 A;  1U0J A;  1YO5 C;  5HS7 A;  2NS0 A;  3R61 A;  4WX9 A;  5E3O A;  3ECO A;  5FLM J;  1RZ4 A;  2R7W A;  2JUG A;  1H9T A;  2DA2 A;  3PFY A;  3ZQG A;  4OWR B;  1JKQ C;  3SZT A;  1BI0 A;  2A6E F;  3BQZ A;  1WJD A;  4M3B A;  2PJR B;  1UJ8 A;  4YEJ A;  2FD5 A;  3L09 A;  4E70 A;  1RES A;  3EYI A;  4PDK A;  4XL9 A;  1ZYR F;  4XN0 A;  4C2T A;  2OA4 A;  4UNO A;  3TKY A;  4P9F A;  4QPO A;  5B66 C;  2ACJ A;  4UUT A;  3W6J B;  5F08 A;  2R7X A;  1KYW A;  1X3Z B;  5CYV A;  1ZAO A;  5J8C A;  1OYY A;  1XCB A;  1UST A;  4XLF A;  3RTR A;  1CF7 A;  3KP5 A;  2FSW A;  4GDF A;  4GYG A;  1RKW A;  4L9J A;  3PJR A;  3V7S A;  4G6Q A;  1GXP A;  2OBP A;  5FKK A;  1P6R A;  1SFK A;  3LST A;  2EPF A;  3WG9 A;  5FRM A;  4DBQ A;  2EA2 A;  1IXS B;  3BCA A;  2GM4 A;  2CJJ A;  4OMZ A;  4G8X A;  4CCK A;  3TED A;  1E0E A;  2CRG A;  1ONV A;  1TZL A;  3PQK A;  5HLH A;  3S3O A;  4PJL A;  2PBI A;  3MZY A;  3OYA A;  3IC7 A;  4Z6Y A;  1Z77 A;  3P9K A;  1X2M A;  2OQR A;  4HNV A;  2DA4 A;  1MSE C;  1BL0 A;  3HG9 A;  4CDG A;  1DGW Y;  2F4M B;  2M0M A;  3HC7 A;  4ANJ A;  4XID A;  4WWC A;  3D1N I;  1K7A A;  1FY7 A;  3KYC B;  2EZL A;  4PFP A;  5CVI A;  2DFI A;  2E1C A;  1Z7L A;  3AL0 C;  1Z7U A;  3CTA A;  1REP C;  5H6Q A;  4KMU X;  2UXN A;  3CUO A;  4PSX A;  3IRR A;  3SFZ A;  2R7D A;  1VQK I;  3HOY J;  4KIS A;  3S1N J;  1JGG A;  1TQM A;  4HAM A;  3NQO A;  5IYB J;  1LDK B;  3ML6 A;  1RC9 A;  2L0K A;  3OOU A;  1R4N B;  1HKQ A;  4EJV A;  2HKX A;  2NOJ B;  4AD9 A;  2E34 A;  1KGS A;  3IWF A;  1E3O C;  1EA3 A;  4QPQ A;  2IEK A;  2KP6 A;  3VPR A;  1TNT A;  1CGP A;  3GTM J;  2WY8 Q;  2PLY A;  1K61 A;  3PIP F;  2H09 A;  2ZO4 A;  4IJA A;  3WU0 A;  4P9U A;  5EF6 A;  4XMY A;  1R7J A;  1BJZ A;  1R22 A;  2TCT A;  4X1E A;  4U87 A;  3VSL A;  2EIM H;  2WB1 A;  5IT9 Z;  3EPZ A;  3TO7 A;  2VI6 A;  1WI3 A;  1TW2 A;  2MD5 A;  2Z9O A;  1H0M A;  2KPM A;  3G2B A;  1WJ5 A;  3ABU A;  3MCZ A;  1S7E A;  4O3M A;  1IRZ A;  3S93 A;  3DFG A;  3GX4 X;  5IOZ A;  4HPQ A;  1J5Y A;  3OYG A;  2LY1 A;  1HCR A;  5DYM A;  4EAT A;  4MO7 A;  1TWA J;  5HDG A;  1FOW A;  1J75 A;  1O7L A;  2FMY A;  3TW6 A;  1Z9C A;  3EET A;  3ZRG A;  2M8E A;  1SMY F;  2BV6 A;  2BHZ A;  3DP7 A;  4Y13 A;  3OYB A;  1FYK A;  3CC7 I;  4EV0 A;  2BE5 F;  2RDP A;  4AYB A;  2FX0 A;  3GW2 A;  2O03 A;  3M3Y J;  1S9H A;  5D4S A;  4I01 A;  4N9I A;  3MFK A;  1QBJ A;  2W57 A;  3KPH A;  5DTD A;  1GDT A;  2B0L A;  2L9R A;  3I5U A;  5D6F A;  4IHY A;  1NG6 A;  2W7N A;  2VXD A;  5E1Z B;  2EK5 A;  3H5N A;  4HST A;  1MBE A;  4OIP F;  4D7N A;  2KJB A;  3C2G A;  3DXJ F;  1MZB A;  1UMQ A;  2X48 A;  3ZCO A;  3J7Z I;  4RGU A;  1E3H A;  4AC0 A;  1FC3 A;  1IRF A;  2JMW A;  3TO6 A;  4XQF A;  1LNW A;  3A01 A;  3H0D A;  3HB9 A;  2JA5 J;  3V7C A;  2JT1 A;  5L3E A;  2P5K A;  4A3K J;  3MZ8 A;  1Y0N A;  4CYD A;  3F8M A;  2BY2 A;  4AM3 A;  1B6A A;  1P7I A;  2E36 A;  2YR2 A;  2DA1 A;  4ZYE A;  4KUM A;  1WH5 A;  3ABL H;  3K7A J;  2E19 A;  4G12 A;  1YFH A;  3JRB A;  1SAX A;  4N0B A;  2L54 A;  4BE1 A;  1D0X A;  3OYM A;  4XOP A;  5D5V B;  1JJ8 C;  2CS3 A;  1KA8 A;  3U1K A;  4NQW B;  5J1U A;  1FIA A;  1YYV A;  4FX0 A;  2JA7 J;  1WGX A;  2HQN A;  4KN7 X;  3SXY A;  1WRJ A;  3DEW A;  2DFF A;  2ELJ A;  2CH0 A;  3RQI A;  1NTC A;  2NS8 A;  2IS1 A;  2CUZ A;  3CJQ B;  4XLP F;  3HKZ A;  4GRI A;  4B48 A;  1VQO I;  1SC7 A;  4LLG F;  3V42 A;  1V54 H;  2P8T A;  4OIN F;  4OAY A;  4E7I A;  1FP1 D;  1VQP I;  5CVU A;  4PGG A;  2DA6 A;  1SD6 A;  2LNB A;  4HSR A;  4K2E A;  4LJZ F;  1KZH A;  3SJM A;  1ETY A;  2K7L A;  3H3Z A;  4LLL A;  5L3G A;  3JRD A;  1RKT A;  3SYT A;  1JUM A;  1UHM A;  3FXK A;  1T0F C;  2IXS A;  2LTP A;  3Q9S A;  2HFH A;  3G1L A;  2DT6 A;  3TOA A;  1OYI A;  1NH3 A;  5DUI A;  1CF7 B;  3GUD A;  1AKH B;  4ZYA A;  2IA0 A;  5LBQ A;  3AAF A;  1LVA A;  4HA8 A;  3R6S A;  5IP7 J;  1LE8 A;  1QU3 A;  1G2H A;  1R1U A;  5J6X A;  3HPH A;  5IP6 A;  2OTJ I;  1F1Z A;  3K70 C;  2BY0 A;  4A3F J;  1JUP A;  1STZ A;  1PUF A;  1F9N A;  2VKE A;  2XF5 A;  3LSG A;  2KRC A;  4IL6 C;  5LGT A;  3S3M A;  2B7E A;  2ELH A;  3OR2 C;  3T0Y A;  5L3C A;  1C0W A;  1Y1V J;  2COB A;  3JRF A;  2BOL A;  1T08 B;  2QCO A;  3OYI A;  1B4A A;  2RN7 A;  3HOV J;  2E1O A;  1O4X A;  2I8D A;  2VQL A;  2K9Q A;  4WF2 A;  1MBH A;  2M5W A;  3OIO A;  4MQ9 F;  3P5J A;  2E2H J;  5KK1 A;  4HNU A;  3JTH A;  4HF1 A;  2DXI A;  4MQV A;  4A0Z A;  4RB3 C;  3SDG A;  3HOW J;  3PFI A;  1VQM I;  5D5U B;  1OCP A;  4KT6 A;  1QQI A;  4E7L A;  1IG7 A;  2FOK A;  3EDP A;  2KRF A;  4RAF A;  3RPQ A;  3E5U A;  1ZRF A;  1TWH J;  3C7J A;  1BW5 A;  1RUN A;  3OL4 A;  4I0A A;  2TRT A;  3ZP5 A;  5FRN A;  1Z3X A;  1Z91 A;  2O9L A;  2K9S A;  3MN2 A;  4J19 A;  4RM2 A;  4XON A;  3WTS C;  1S8N A;  3CMM A;  2ECC A;  2GLO A;  3HUG A;  5AIQ A;  2L4M A;  4BUP A;  4D1Q A;  3GF2 A;  3G1M A;  3MKY B;  1U8B A;  4LFU A;  5GAE J;  4Q4Z F;  3GTQ J;  1DPU A;  1WJC A;  2CSO A;  2HXO A;  2QVO A;  4II2 A;  2E2J J;  2VXZ A;  4UVA A;  3ZMS A;  2HU9 A;  3IKV A;  3LFU A;  4C2M J;  5EYR A;  2E60 A;  2VJ5 A;  2HVS A;  4IQJ A;  3FXJ A;  4EM2 A;  3JSO A;  4Q47 A;  2DT7 B;  3BC8 A;  1PYV A;  4W97 A;  3AKZ A;  1IDZ A;  2ETH A;  2L5Q A;  1IN4 A;  2UUZ A;  1JT0 A;  1FOY A;  1UG2 A;  3BP8 A;  1TWG J;  1LEA A;  2R7O A;  2VC0 A;  2CUF A;  2JTV A;  3BR2 A;  4NDL A;  1OFC X;  3KEO A;  2D5V A;  5E17 F;  2Q1Z B;  3OOP A;  4BHP A;  4L9T A;  4UUS A;  5EZH A;  1OYW A;  1U9O A;  1I6H J;  2CO5 A;  2Q8K A;  3I53 A;  3M9A A;  3W6K B;  1TLH B;  1SFE A;  1YW7 A;  2L7M P;  2O8X A;  4NC6 A;  3OY9 A;  4QTR A;  1UEL B;  1TQP A;  3LMM A;  1JT6 A;  2VL8 A;  4ABZ A;  3DF8 A;  5KHD A;  1T8I A;  2LKS A;  2STW A;  3Q3S A;  4AVZ A;  2LG4 A;  1MMN A;  4F93 B;  1CQT A;  1Y1W J;  1ZKG A;  2YUS A;  5AON A;  2RKH A;  4BQN A;  2A6T A;  2VN2 A;  4BEH B;  4GO1 A;  1KU9 A;  1MGT A;  2IBD A;  3CO6 C;  2DAO A;  1T38 A;  1ZRE A;  5IYD J;  3ISP A;  5E1X A;  3A0H C;  1G6N A;  1SAU A;  4V2G A;  1D5Y A;  3BOQ A;  2ZME B;  1I5Z A;  3REO A;  5DM6 F;  5F27 A;  1QPM A;  4YG2 F;  4LG0 A;  1MJ9 A;  1EH7 A;  2V79 A;  3ZQH A;  1X19 A;  4YIR X;  1VQ4 I;  1R5G A;  1SMT A;  3EYY A;  4M73 A;  4F91 B;  3UKG A;  1OJL A;  4HF2 A;  1XB4 A;  5JHU A;  3AG4 H;  2DK5 A;  4IOC F;  3AG2 H;  5JLW A;  3I55 I;  1JKO C;  3LA2 A;  1MJA A;  3DLA A;  4Y4R A;  1MBG A;  1WJA A;  3EQL F;  5F1J A;  3JRC A;  2KT0 A;  3KE2 A;  1LKX A;  4KIC A;  2VQC A;  4BH9 A;  4DGW B;  1MBF A;  4M9S A;  3PSF A;  3Q5F A;  2RVC A;  5DV5 A;  2H8W A;  3DPU A;  3T8T A;  4XLH A;  4XLN F;  2YU9 J;  2M2E A;  1G3W A;  2K02 A;  5KCM A;  4YIF A; 
#chains in the Genus database with same CATH homology
 1FTZ A;  2LY9 A;  3ZQF A;  4V2F A;  2LVS A;  2ID3 A;  1ZK8 A;  1X58 A;  5E3L A;  1Q1V A;  2XGE A;  1FEX A;  4JX5 A;  5FKO A;  1QVU A;  1BA5 A;  4RDU A;  5FKM A;  1ETQ A;  1FJL A;  2LFB A;  3G1O A;  3FKI J;  3GTG J;  1APL C;  2VPR A;  4FIS A;  1HDD C;  3HGY A;  4DYC A;  3GTL J;  4MFD A;  4XIC A;  1NK2 P;  5K7Z A;  3S15 J;  4Y52 J;  4M3F A;  3NAR A;  4MFE A;  4BY7 J;  3OSF A;  2ME0 A;  2FJ1 A;  2O8K A;  1U9N A;  2XPW A;  5E3O A;  3IH2 A;  5C44 J;  5FLM J;  3LNQ A;  3WHC A;  2DA2 A;  3HGG A;  3ZQG A;  3BT9 A;  3FK7 A;  2DMU A;  3IH4 A;  1JKQ C;  1ZGW A;  1TWC J;  3HDD A;  1U78 A;  1UHS A;  3BQZ A;  4M3B A;  2IAI A;  1ETX A;  2FD5 A;  2CQX A;  1RES A;  3BG9 A;  2DA7 A;  1DU0 A;  3WHB A;  4A3C J;  2CU7 A;  2OF7 A;  1JTX A;  3A02 A;  1W0U A;  2JWT A;  3BR5 A;  4UUT A;  5F08 A;  2LLK A;  1T33 A;  2K40 A;  4L5E A;  4FCY A;  5FJ8 J;  4JX6 A;  1ZTR A;  3CMY A;  2MW8 A;  2Y30 A;  2ID6 A;  3L1P A;  1ENH A;  4A3E J;  2B63 J;  5F0C A;  1RKW A;  3PM1 A;  1GV5 A;  5K7H A;  3GTP J;  1Z0X A;  1OCT C;  3GTK J;  5FKK A;  4GFB A;  3HM5 A;  2GM4 A;  2CJJ A;  3BQY A;  3BR6 A;  3TED A;  2CRG A;  1ORK A;  2DMP A;  3Q0U A;  4BBR J;  4FE4 A;  3HEF A;  1Z77 A;  2Y2Z A;  4XRS A;  1X2M A;  4HNV A;  2DA4 A;  1MSE C;  4M3G A;  1BL0 A;  1ITY A;  1JKR C;  4XID A;  3S16 J;  3LSP A;  2DA5 A;  3D1N I;  2EZL A;  5F0F A;  1TC3 C;  4CYC B;  1LFU P;  3A01 B;  3LSR A;  1HDP A;  3C2B A;  3FIS A;  3I4N J;  4IHW A;  3CQZ J;  3HOY J;  4M3D A;  5M3M J;  3S1N J;  1F43 A;  1JGG A;  2NS7 A;  4DYR A;  3BG3 A;  2ELK A;  1GUU A;  3S2H J;  5IYB J;  3S2D J;  2LD5 A;  1IC8 A;  2R92 J;  3IV5 A;  2L0K A;  3OOU A;  4Y7N J;  3RKQ A;  5FKL A;  2JK3 A;  3BTJ A;  2XRL A;  4BKX A;  5M5W J;  2W48 A;  1E3O C;  5M5X J;  1QPI A;  3SFI A;  4A3B J;  2IEK A;  3VPR A;  3GTM J;  2DJN A;  3B6A A;  1FIP A;  3O8G A;  1NK3 P;  3TP3 A;  1K61 A;  3TW7 A;  2JA8 J;  1GV2 A;  1AU7 A;  5EF6 A;  2ZB9 A;  1WPK A;  3BTI A;  4C3H J;  1AHD P;  1BJZ A;  2E2I J;  4IHX A;  2EQR A;  3H0G J;  2TCT A;  1ETO A;  4X1E A;  3GTO J;  3NAU A;  2DTZ A;  2HOA A;  2VI6 A;  2XSD C;  1MNM C;  2N8G A;  1WI3 A;  1QRY A;  1WCM J;  2X9D A;  1H89 C;  1S7E A;  1BW6 A;  3ZOB A;  3IH3 A;  1IRZ A;  4B1R A;  4XRM A;  5IOZ A;  1HCR A;  3BTC A;  5IYC J;  2R5Y B;  4MO7 A;  3W6V A;  1TWA J;  1MBK A;  3LOC A;  4DZP A;  3CCY A;  4QSH A;  4DZJ A;  3S1R J;  4DYQ A;  3TW6 A;  3RZD J;  1HLV A;  3JRG A;  1H8A C;  2R93 J;  2FX0 A;  3M3Y J;  1JTY A;  2NVT J;  1LE8 B;  2HYJ A;  4C3I J;  3FK6 A;  2VKV A;  5DTD A;  3QQA A;  1GDT A;  1YRN B;  2L9R A;  4IHY A;  3ZQC A;  4A3L J;  3A03 A;  1PUF B;  2KDZ A;  4I76 A;  1MBE A;  4D7N A;  2AO9 A;  1UMQ A;  2X48 A;  1MBJ A;  2WAQ N;  5IP9 J;  3S14 J;  4AC0 A;  2VUM J;  1RR7 A;  2CQQ A;  4CYC A;  4JYK A;  2JMW A;  4B3A A;  5DS9 A;  1ZR2 A;  3PO2 J;  3A01 A;  2P81 A;  2JA5 J;  3HB9 A;  1JKP C;  4A3K J;  2Y31 A;  3E7L A;  3S1Q J;  5GPC A;  2R5Z B;  5IOY A;  1P7I A;  2R0Q C;  2DA1 A;  4FE7 A;  1WH5 A;  5J1Y A;  1IUF A;  1P7J A;  2E19 A;  3K7A J;  4G12 A;  5EG0 A;  2EH3 A;  3JRB A;  1X2N A;  4M6V A;  3PO3 J;  1JJ8 C;  4D7M A;  2CUE A;  1GVD A;  2XB0 X;  1JJ6 C;  2XGD A;  4X6A J;  1LFB A;  1POG A;  1FIA A;  5J1U A;  1IJW C;  1SFO J;  2JA7 J;  1WGX A;  1ZR4 A;  3DEW A;  3QPL A;  3RZO J;  2XPV A;  3RQI A;  1NTC A;  5HOD A;  4BY1 J;  4D5C A;  2NS8 A;  1XG1 A;  4W1U A;  4D5F A;  3Q0W A;  1RET A;  1B8I A;  2FQ4 A;  1TWF J;  4A3D J;  2WB1 N;  4DW6 A;  1MH3 A;  4JP0 A;  1VFC A;  4BBS J;  1H88 C;  1IDY A;  2M0C A;  2H8R A;  1ETK A;  2DA6 A;  2R5Y A;  4XRS G;  4QIW N;  3MVP A;  3BTL A;  3SJM A;  1ETY A;  1ZQ3 P;  2Y9Y A;  3JRI A;  3HBL A;  3JRD A;  4A69 C;  1RKT A;  1JUM A;  2LTP A;  3G1L A;  4C3J J;  3F0C A;  2NVX J;  2G0E A;  1VI0 A;  1ETW A;  1AKH B;  4XK4 A;  3BR3 A;  5M3F J;  4JX4 A;  5IP7 J;  2Y0S N;  1LE8 A;  4AYB N;  1XS9 A;  1G2H A;  5F04 A;  3OSG A;  5IP6 A;  1B72 B;  4RBO A;  1YRN A;  4A3F J;  4UUS B;  1JUP A;  5EGO B;  2XGC A;  1PUF A;  2VKE A;  3LSG A;  4A3M J;  3DCF A;  2M9H A;  1JUS A;  1I50 J;  2YS9 A;  2NOG A;  2NVQ J;  3GBG A;  1Y1V J;  2COB A;  3JRF A;  5E3N A;  2QCO A;  4M3E A;  1EF4 A;  5J3L A;  3M4O J;  3HOV J;  9ANT A;  2E1O A;  1O4X A;  5IPA A;  4B4C A;  3JR9 A;  3S17 J;  2K9Q A;  1MBH A;  1R9T J;  3OIO A;  2NVY J;  2E2H J;  4IEJ A;  4I6Z A;  3ZQL A;  2WV1 A;  3HOZ J;  2L7Z A;  2LR8 A;  2MG4 A;  3SDG A;  3HOW J;  5GPA A;  1A6I A;  5C3E J;  1OCP A;  4FTH A;  1IG7 A;  2Y9Z A;  1TWH J;  2HDD A;  1BW5 A;  1W0T A;  1I3Q J;  2HOT A;  2TRT A;  3K2A A;  2O9L A;  4BXX J;  4A3J J;  5EDN A;  2K9S A;  3MN2 A;  2HXI A;  4J19 A;  2ECC A;  2EZH A;  2GLO A;  3GTJ J;  2LP0 A;  2LK2 A;  2X6O A;  5C4X J;  3G1M A;  1ETV A;  1U8B A;  2M34 A;  3GTQ J;  3HKZ N;  1HOM A;  2LKX A;  3B6C A;  4A3I J;  2HXO A;  2K9N A;  2JN6 A;  2XPU A;  1QVT A;  2PMZ N;  5GP9 A;  1IV6 A;  2E2J J;  3I4M J;  1XC5 A;  4S0H B;  4C2M J;  2O7O A;  5EYR A;  1K83 J;  2GBY A;  2JJ7 A;  5K7F A;  2MGQ A;  4AUX A;  2EZK A;  3Q0V A;  2QF7 A;  3HOU J;  4W97 A;  1IDZ A;  1WH7 A;  2HOS A;  5EZG A;  3O8H A;  1JT0 A;  1AKH A;  1UG2 A;  1TWG J;  2HQ5 A;  2DN0 A;  4IHV A;  2CUF A;  3BG5 A;  3BR2 A;  5BNG A;  1MH4 A;  2OPT A;  4NDL A;  1OFC X;  2D5V A;  1B72 A;  1SAN A;  4UUS A;  5EZH A;  3JRE A;  3H3V K;  5EGO A;  1U9O A;  1I6H J;  5EEA A;  5JLX A;  3LSJ A;  1RPW A;  2ECB A;  2L7M P;  4QTR A;  4A3G J;  2DMT A;  5M5Y J;  1JT6 A;  2RAE A;  4ABZ A;  1MSF C;  2EBI A;  3Q3S A;  1VND A;  2ME6 A;  1CQT A;  2HI3 A;  3BR0 A;  4MLO A;  1Y1W J;  1ZKG A;  2XB5 A;  2YUS A;  4EEF G;  2DMN A;  3BR1 A;  2L7F P;  2IBD A;  2DMQ A;  5IYD J;  3ZQI A;  2JA6 J;  4V2G A;  1D5Y A;  2H1K A;  3JRH A;  1FTT A;  1F36 A;  3MKL A;  1A5J A;  3CDL A;  5FLV A;  5F27 A;  5EG0 B;  1IGN A;  3ZQH A;  2M8G X;  3FIW A;  3UKG A;  1OJL A;  2EZI A;  3QPS A;  4MIM A;  1VF9 A;  1GT0 C;  3HOX J;  3TP0 A;  3S1M J;  5JLW A;  1JKO C;  5E3M A;  4LOC A;  1MBG A;  5J1R A;  5F1J A;  3JRC A;  2DA3 A;  2KT0 A;  1DU6 A;  2MSY A;  4A93 J;  1HF0 A;  5FKN A;  1MBF A;  5C4J J;  1B8I B;  5F0H A;  1T56 A;  3JRA A;  2R5Z A;  2I10 A;  2YU9 J;  2M2E A;  2AHQ A;  2R7Z J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...