1Y1VJ

Refined rna polymerase ii-tfiis complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1y1vJ00
1LFUP 5IP6A 5K7FA 2IAIA 2MG4A 4XRSA 4A3KJ 1GDTA 1VNDA 3ZQLA 4A3BJ 1NK2P 3QPSA 5HODA 1XG1A 2TCTA 2M8GX 4NDLA 2WV1A 1B72B 4JX6A 1MH4A 4I6ZA 2X9DA 3UKGA 1POGA 2GM4A 3RKQA 2WB1N 3S1NJ 3OSFA 2XGCA 1X58A 3E7LA 2DA1A 2ECCA 1BW5A 3HOXJ 2X6OA 5F0CA 2HXOA 2LK2A 3BG5A 5IYDJ 3IH4A 1ZTRA 2P81A 3TW7A 1UHSA 4M3EA 1RETA 4A3FJ 4D7MA 5J1UA 3S1RJ 1TWCJ 2NS7A 4EEFG 1JJ8C 3SJMA 1DU0A 1JKRC 2DA3A 5FKNA 5FKKA 1GVDA 4IHXA 1JGGA 5DTDA 1ZR4A 5E3LA 3MN2A 1FTZA 3JRFA 1UG2A 1PUFA 2JA6J 1MNMC 3HOYJ 2M9HA 3TEDA 3ZOBA 1IDZA 1O4XA 2HOSA 4FTHA 4UUSB 1B72A 1MH3A 2E2HJ 4AYBN 2HXIA 3BTLA 2R7ZJ 4A3EJ 1ETWA 4A3DJ 2ID3A 1ETKA 1ETYA 1QPIA 1RR7A 5EG0A 1GV5A 3H0GJ 1WH5A 3WHBA 3BR0A 1T33A 5EZGA 3D1NI 3W6VA 1NK3P 3WHCA 2FJ1A 3NAUA 4C3JJ 3TP0A 2OPTA 3K7AJ 5F04A 2MGQA 3GTMJ 1OCTC 3GTLJ 3BR3A 2LD5A 3VPRA 4D7NA 2VKEA 2LY9A 1X2NA 4FISA 2E19A 5F0HA 1JKPC 1AU7A 5C4XJ 1MBFA 2O7OA 2ME0A 2HYJA 1ETVA 4DYCA 4S0HB 4L5EA 4JX4A 1AHDP 2DA7A 5JLWA 1ETQA 3PO2J 4UUSA 2XRLA 2L7FP 5F08A 1RKWA 3HM5A 1TWAJ 1FEXA 2M2EA 2NVTJ 4I76A 1JJ6C 1BL0A 1ZR2A 1OCPA 3GTPJ 4MLOA 3HOZJ 5F0FA 2JA5J 3BQZA 1RKTA 2FD5A 5E3OA 5M5YJ 1LE8B 3JRDA 5M5WJ 4J19A 3C2BA 3G1OA 1MBHA 1ORKA 1IRZA 1BW6A 3QPLA 2VKVA 5EEAA 3FK7A 4MFDA 4X6AJ 1G2HA 3BG3A 4A3CJ 1S7EA 2GBYA 5E3NA 2WAQN 3LSPA 1U78A 4IHWA 2DA5A 3B6CA 1PUFB 4M3BA 4A69C 2LP0A 1AKHA 2DA6A 4IHVA 4A3GJ 3LSJA 2EZHA 1Y1WJ 1NTCA 5IOYA 1MSEC 3BR6A 4HNVA 1TC3C 5K7ZA 2D5VA 2FX0A 1HLVA 2EZIA 5M5XJ 5EG0B 1BJZA 1JT6A 3OIOA 2QF7A 1BA5A 2HOTA 1IJWC 2VI6A 3FISA 2ME6A 5IOZA 5EZHA 1LE8A 3SFIA 5FKMA 3HGYA 4D5CA 1HCRA 1IDYA 4JX5A 4W1UA 5DS9A 1ITYA 2XPWA 2YS9A 2Y31A 1T56A 3SDGA 4UUTA 4IHYA 2R5YB 2K9SA 2NOGA 3A01A 3HOWJ 4JYKA 3GTGJ 3S2HJ 1JUPA 4C3HJ 4DZPA 5C3EJ 2X48A 1X2MA 3FKIJ 3Q0VA 1EF4A 3S15J 2Y30A 3ZQIA 1TWGJ 1YRNA 1W0UA 2JA7J 2N8GA 2VUMJ 3PM1A 2DMNA 2YUSA 2IBDA 3BT9A 2XGDA 2DA4A 2K9QA 4QIWN 3NARA 3PO3J 5IYBJ 1JUSA 4B3AA 5C4JJ 1TWFJ 5EF6A 4RDUA 2DMUA 2O8KA 5BNGA 5IPAA 4V2FA 1R9TJ 3HKZN 4BBRJ 2HDDA 3TW6A 1SANA 4B1RA 3LOCA 4QTRA 5J3LA 2M0CA 5M3MJ 3IV5A 2H1KA 4FE4A 3ZQGA 4IEJA 1IV6A 3G1MA 2LLKA 3JRAA 1ETOA 1OJLA 2AO9A 5J1RA 3Q0UA 3JREA 2JWTA 2B63J 3M3YJ 4AUXA 1JKOC 2G0EA 2QCOA 1UMQA 5F27A 2R5YA 1VFCA 1VI0A 2LKXA 1XS9A 2L0KA 4Y7NJ 4Y52J 3FIWA 4M6VA 4XRSG 1AKHB 2HI3A 1DU6A 2NS8A 1SFOJ 3CDLA 1H89C 2RAEA 2JA8J 1Q1VA 3JR9A 2LTPA 1JTYA 4C2MJ 3A03A 3JRBA 2ID6A 1F43A 1K61A 2EBIA 2CJJA 3DCFA 2DTZA 1HOMA 4LOCA 1B8IB 2MSYA 1QVUA 2M34A 4MIMA 3S2DJ 2JMWA 2L7ZA 1IGNA 1QVTA 3DEWA 4W97A 3TP3A 1I3QJ 1Z77A 2AHQA 5EYRA 1IC8A 1CQTA 2JJ7A 1ZQ3P 1P7JA 4DYQA 3A01B 3HOVJ 1W0TA 3MKLA 1ETXA 2DMQA 1WGXA 2W48A 1FIAA 3ZQCA 1JT0A 1APLC 5GPAA 5FJ8J 1YRNB 1ENHA 5IP7J 2CRGA 3BQYA 1GUUA 5EDNA 3JRGA 5FLMJ 3S16J 4XIDA 5C44J 1TWHJ 4B4CA 1E3OC 1XC5A 1IUFA 2Y9ZA 2CUFA 2TRTA 3BR1A 2DMTA 1MBJA 1MSFC 5IYCJ 4M3FA 2KDZA 2VPRA 3FK6A 2ZB9A 2CU7A 1MBGA 2R5ZA 1JUMA 1B8IA 4A3MJ 2DMPA 2R93J 4XRMA 3H3VK 1I6HJ 1VF9A 2KT0A 3K2AA 4RBOA 3IH2A 3BR2A 1FTTA 1QRYA 3CMYA 2DN0A 3OOUA 4BY1J 3RQIA 2NVYJ 2XPVA 1U9NA 4X1EA 2HQ5A 4A3JJ 2CQQA 2XGEA 5JLXA 3L1PA 4C3IJ 2NVQJ 4D5FA 3JRCA 2E1OA 1HF0A 3I4MJ 1F36A 2XB0X 3O8GA 5FLVA 1HDDC 4XICA 1MBEA 3OSGA 1HDPA 3IH3A 5FKLA 1OFCX 3S14J 2I10A 4A93J 3LSRA 2JN6A 4MO7A 3QQAA 3GTQJ 3GTJJ 4BXXJ 4AC0A 2L9RA 4DW6A 3GTOJ 3S1QJ 3ZQFA 3RZOJ 1P7IA 1MBKA 4CYCB 4DZJA 3BTJA 1WI3A 3A02A 3LNQA 3BG9A 2CQXA 3MVPA 1IG7A 1A5JA 2Y0SN 4BY7J 2IEKA 1FJLA 2R0QC 4FE7A 4JP0A 2EZKA 5GPCA 3O8HA 2EH3A 3Q0WA 3HOUJ 5K7HA 1U9OA 2DA2A 2XPUA 2COBA 3HDDA 4BKXA 3S17J 1GV2A 2LFBA 1JKQC 2LR8A 2O9LA 1K83J 3HB9A 2EQRA 4M3GA 2YU9J 1A6IA 3BTIA 3M4OJ 2OF7A 3RZDJ 4DYRA 3JRHA 3F0CA 4MFEA 1JTXA 5EGOB 2JK3A 1D5YA 3GTKJ 1LFBA 1I50J 2FQ4A 2K40A 1WCMJ 2Y9YA 3CQZJ 2E2IJ 2R5ZB 3B6AA 2HOAA 2K9NA 3HGGA 5F1JA 4CYCA 5FKOA 2CUEA 3JRIA 2L7MP 3I4NJ 2MW8A 2EZLA 2Y2ZA 4G12A 3HEFA 1H88C 2LVSA 4V2GA 9ANTA 3G1LA 3LSGA 1FIPA 4GFBA 5J1YA 2R92J 3BR5A 1RPWA 4M3DA 3ZQHA 4A3IJ 2DJNA 2GLOA 3Q3SA 1ZGWA 5M3FJ 1U8BA 2NVXJ 4BBSJ 1WPKA 2H8RA 2E2JJ 3GBGA 4ABZA 1ZK8A 5IP9J 3CCYA 1H8AC 1WH7A 5E3MA 2ELKA 2XB5A 4XK4A 3HBLA 1GT0C 1Y1VJ 1ZKGA 1RESA 4QSHA 5EGOA 3S1MJ 2PMZN 3BTCA 4A3LJ 2XSDC 5GP9A 2ECBA 1Z0XA 4FCYA
chains in the Genus database with same CATH superfamily
4XR6A 3OMYA 5K7FA 1HA8A 1FOWA 4MEXF 1RNLA 2IAIA 2HYFA 5DV5A 1HSJA 5KVRA 2IW5A 4KN4X 4OIOF 2P4WA 3ULQB 1RZ4A 1N78A 3OIPA 4XRFA 4LITA 2F4OB 4JX6A 4XLHA 4AU7A 4BQQA 4KUMA 1G8XA 4I6ZA 4PCQA 3RSNA 2OCCH 3GMEA 4RAZA 3UKGA 5ICCA 5L3BA 2D2WA 2XAJA 5LHGA 4HX4A 4H0EA 2XGCA 1YTYA 3A0BC 1X58A 2Q2EB 5FROA 2ESHA 4CHUA 3E7LA 2DA1A 1QPMA 2ECCA 1U6GA 2M45A 5F0CA 4ZH4F 4OAZA 2HXOA 3RTRA 1BC8C 2CO5A 5IYDJ 1ZTRA 2VOPA 1S29A 1P4WA 1XSVA 2DYSH 2VXZA 5LBQA 3PIPF 3BZ6A 4NC6A 1ZG5A 1ZG1A 3LA3A 4NNJA 3SJMA 1XD7A 2IS6A 5FLXK 5BQTA 5FKNA 1ERDA 4AIJA 4V19K 1XMAA 5DTDA 4PDKA 3HRTA 5E3LA 3MN2A 2W57A 3JRFA 3GFMA 1UG2A 1SD5A 2JA6J 2V6CA 2XGXA 3P7NA 2Y0MA 2RGVA 3RPUD 3W3CA 3HOYJ 2M9HA 3ZN1A 4RM2A 1KGSA 5D6FA 5F6FA 1B72A 3V7SA 2D1VA 3FKJA 4A3EJ 3EUKL 4A3DJ 2LRDA 1ETYA 1YQAA 2RNJA 4IXAA 1D1AA 2M0MA 2HZTA 2WADA 3MWMA 3WHBA 3KZIC 1IN7A 1SD4A 2MC4A 5EZGA 1J7KA 2GA1A 3RYRA 3CUQA 4LIVA 3LSHA 3WHCA 5CVRA 4M6XA 3TP0A 4UB6C 5J47A 1IRGA 1S3JA 3GTMJ 5KNLA 3OR2C 1U8RA 3KIOA 3GTLJ 3BR3A 4Q5SF 5EJCA 4N9HA 5KCMA 1WVRA 3V8JA 3PNYA 2V9VA 2XASA 1R22A 4HOBA 1JHHA 4FISA 2R7DA 2E19A 1JKPC 1AU7A 3IHUA 4LIUA 1T39A 3G2BA 2K4BA 1ETVA 1N75A 1Z05A 2KISA 3KCCA 4JX4A 3S3MA 4PJLA 2LREA 2DOAA 2XRLA 3T5XA 5CVVA 3CCUI 4HF2A 1WJAA 1W7PA 1YS7A 5ILVA 1FEXA 3R4KA 1LFPA 2M30A 4A6DA 1ZR2A 2DW4A 3TKYA 2DI3A 4MLOA 3T0YA 3COAC 2IA0A 1RKTA 2FD5A 5M5YJ 3JRDA 4PGGA 4J19A 1TT5B 1XSDA 5EEHA 5B66C 1IRZA 2XAQA 2DFFA 3BG6A 4BEHA 5AIPA 2IRFG 3IAM2 1G2HA 2VQCA 1ZELA 5GAHJ 3ML6A 1S7EA 1FPQA 2GBYA 1IZ1A 2LG4A 3E1SA 1YLFA 3LSPA 4LG0B 3ZCOA 2DA5A 3GEZA 2OCEA 3PL8A 4ZYGA 4L9TA 3OYEA 3ABLH 2FOKA 4A3GJ 4BXFA 1QQIA 2EZHA 3LSJA 4B44A 3F3XA 3O6BB 4LB6B 3ZMDA 2F5CA 2CQNA 1Y8RB 3BR6A 3HYIA 2A07F 3L9FA 3DXJF 5CYVA 1RR8C 2EZIA 2EFOA 4U88A 4UY8I 5HLTA 5CQEA 2HR3A 4D9JA 1D3YA 3OIOA 3WE2A 3FISA 1Z6RA 2LDUA 4HQMA 2Z2SB 3G3ZA 4E7HA 4CO8A 4LB5A 4IQJA 5EZHA 1LE8A 3FBNB 3TO6A 2BE5F 3HGYA 4HA8A 5FKMA 2XDVA 4JX5A 5HS7A 3SZGA 4WK8F 2B9SA 2XPWA 1VQKI 1P4XA 5DCMA 1PYVA 1T56A 3MCZA 4UUTA 2Z99A 2R5YB 1BR2A 1J09A 2NOGA 3A01A 3HOWJ 2IVMA 3GTGJ 2PFBA 1JXSA 4B47A 2BHZA 3BPVA 4DBQA 4RB1A 3GFLA 4M74A 1X2MA 3MZ8A 1T98A 3NWSA 3S15J 1TWGJ 1SAUA 2VUMJ 3PM1A 4FHTA 3ZR8X 1VQ5I 2BZTA 1WSUA 2GOMA 2K9QA 3TOAA 3PO3J 2K3FA 2VJJA 1IN4A 1MDMA 2XC7A 1TWFJ 2FMYA 2LY2A 2RN7A 1D0ZA 2O8KA 2RVCA 5BNGA 4CCLA 4BXUA 4MQ9F 4V2FA 1R9TJ 2FBHA 2HDDA 2RV8A 4R79A 3WODF 3TW6A 2A3SA 2L02A 4S04A 4XOTA 4CZZA 3EUHA 4YFKF 4IEJA 1FSHA 2A68F 2HU9A 3G1MA 4HPQA 2JWTA 2B63J 2DTRA 3IUOA 3KYDB 5L3FA 2BXYA 2FE3A 5LGNA 2QEXI 1VFCA 3CC7I 5FD5A 3GZNB 1YW9A 1SFKA 1LDJA 2CQKA 5HLHA 5TJJA 1SFOJ 2V1UA 4EV0A 2ZMEA 3AG3H 1R5GA 2ZJQF 2AS5F 3QU3A 1FOYA 2KJBA 3HRSA 1FZPB 1JTYA 5ILSA 2MLKA 3CJRB 4C2MJ 1QHHD 2QQAA 1TT0A 5L3EA 1F43A 3QP5A 1K61A 3RIRA 3FHNA 4A0YA 2CJJA 3DCFA 3WTUC 2HKOA 3F6OA 3WTYC 3E5UA 1VQ4I 3HJEA 1PP8F 1FSEA 1QVUA 1MD0A 5FLXZ 4BH9A 4L0YB 1MNEA 3I56I 3NQOA 2JMWA 4XLEA 3IRRA 1A04A 3G71I 1CGPA 2XSJC 2DXIA 1IC8A 2BW3A 3TMOA 5FB2A 2OQGA 3GUDA 3KX2A 2ZBKA 3V4GA 4F7ZA 4DYQA 1T0FC 1B6AA 1EV7A 3F8MA 3MKLA 3RQ4A 4M9SA 1GHCA 2W48A 3ZQCA 4E7ZA 4GYGA 5B1BH 2VL8A 1APLC 5FJ8J 4XOPA 1ENHA 3SZTA 5IP7J 4IRHA 1YJ9I 3A0HC 3IP4B 4Q47A 4UNOA 3RPUA 5FLMJ 2H94A 2K9MA 4XIDA 3AFHA 5C44J 1HC8A 4O3MA 1YE9A 5FFZA 4XLNF 1IUFA 2Y9ZA 4CCJA 1P6RA 1FWZA 1MZBA 1MKMA 3KP3A 4NUBA 4BNCA 2KRFA 1MSFC 3DEUA 4EM2A 1UELB 4E7JA 3ERED 1TLHB 2K3PA 1G6NA 2XUBA 2R7SA 3K4KA 2DMPA 2R93J 4XRMA 2KIQA 1DPUA 1I27A 2ESNA 1R71A 3FZVA 1IN5A 1X1CA 4XBFA 3K2AA 4LK0F 3M7GA 1UAAA 3I64A 1S6LA 1QNTA 1OMIA 4P9UA 3JCUC 4BDYA 5KAFC 4WXCA 1OYIA 2LKSA 3DKYA 1P2FA 4AYBA 2OC6A 3TBIA 2HVQA 2NVYJ 4HV5A 1U9NA 3OIQA 2XRNA 2HQ5A 2KJCA 5F64A 3WG9A 4A3JJ 3W2AA 2NVQJ 2V1XA 5E1XA 2IGMA 1HF0A 4M73A 2XB0X 3O8GA 3W6KB 1HDDC 1DP3A 3QYEA 4XICA 2VODA 1MBEA 2IPQX 2ZJPF 4F91B 1OKRA 5ICEA 4L18B 3FF5A 1OCCH 4EJWA 3IH3A 1OFCX 3S14J 2GIZA 1ZN2A 4FT8A 1HXDA 4BXXJ 2MH2A 2FEZA 1K4TA 2B7EA 3GTOJ 3ZQFA 3WTSC 1MBKA 4RB2C 3AL0C 4IRIA 2L2OA 4OU0A 3BROA 1GXQA 3IKVA 5H6QA 4A5NA 3I55I 3HOTA 3HUGA 1B4AA 1XB4A 2CQXA 3MVPA 1CF7A 2QQBA 2UUZA 1HQCA 2VBXA 3KPHA 1A5JA 2Y0SN 3F8FA 2DFEA 2F6CA 1FJLA 1F9NA 2M8EA 1R4MB 3LWFA 2A05A 4AWXB 3OS2A 2ICWG 2E1MC 3ZQ7A 3OYDA 4IQ4A 2COBA 3E3VA 1ZRFA 1HKSA 2ISYA 2NVUB 4ESFA 1NG6A 1JKQC 1E17A 4EATA 3GVAA 3OS1A 3HB9A 5H2FC 2G7HA 1EKEA 1FLIA 1NHAA 1I1SA 3R6SA 4ENKA 2GOXB 5HVQC 1LJ9A 2HVSA 4FASD 3JRHA 4MFEA 3HHHA 2BY1A 1V55H 2Z9OA 5EGOB 3DBLB 3CJTB 1WJFA 2PMZA 4E7LA 3OYCA 5HLIA 3HRUA 3DKXA 1T6SA 4CZCA 2FQ4A 4HW0A 2K40A 1V5EA 3EPZA 2KZGA 4G6TB 4LMYA 3DF8A 5ED4A 4CCNA 1J59A 2FQ3A 1K6OA 4HLXA 1DQUA 5LEKA 1VQNI 2CUEA 4IVNA 3JRIA 2L4AA 2HVRA 3DQVC 4LJZF 1YO5C 3U1KA 1ONVA 1ACIA 2BVMA 1A6QA 2G9WA 2FF4A 4HDUA 2IGNA 3KYLA 3CMEI 3MEXA 3AG1H 3V7CA 1FIPA 3IC7A 4ZDLA 3ABKH 2R92J 1KU2A 2OJED 5DM7F 4HDVA 5J8FA 3U2RA 4M3DA 3ZQHA 4A3IJ 1TBXA 3L00A 2DOEA 2EWNA 3Q3SA 4XLAA 1ZGWA 2HEOA 1U8BA 2ZO4A 1WPKA 4RA2A 5E8IA 1BC7C 3GBGA 3HC7A 2RKHA 4EJVA 1SVOA 2KIFA 2ELKA 1LEAA 2OQRA 3ISPA 1XGOA 5ILUA 2W24A 3CLQA 2YX7A 2PMUA 1YYVA 3BTCA 3CF5F 4HAMA 2ECBA 4MNUA 1LFUP 5IP6A 3QPHA 1XMXA 3ZN0A 2UWMA 2EFPA 3RJPA 2MG4A 4XRSA 4A3KJ 4ENMA 4EJOA 1VNDA 1H0MA 1WJBA 4B3XA 1D8KA 3IKTA 4A3BJ 4IPAA 3QPSA 1X1PA 3I59A 4M72A 4OAYA 2TCTA 3C2GA 1K78B 2M8GX 3K1PA 1B72B 1MH4A 2M3AA 2QM3A 2M5WA 3WU0A 1POGA 3R0JA 1W7PD 4ZZLA 2WB1N 3F9KA 1J75A 3OSFA 3S1NJ 1FBSA 1Z67A 1LNWA 3DFGA 2V7FA 4KYWA 2WTEA 3IRQA 2R7QA 1T0FA 4U7DA 2DODA 3GYHX 1FYLA 3CUQB 5D4SA 3IH4A 3TW7A 1QZZA 2P81A 2X51A 4YIRX 1OCOH 4M3EA 5J1UA 2KHMA 2CV0A 2IGKA 3DBRB 4MEYF 2Z5UA 2UXNA 1JJ8C 3ASOH 2DA3A 1JKRC 2HPMA 2QBYA 1QO0D 1GLNA 4KIGA 1GVDA 2ZJRF 2JRTA 5HS8A 3QWLA 5BPDA 4NB5A 2UV1A 2QSHX 3ELKA 2YPRA 2R7XA 1FTZA 1HBXG 5H20A 3A2KA 1BI1A 1WRJA 2F5FA 2R7WA 3WGGA 4ZYDA 4E70A 2JQ7A 3R61A 4LGWA 1YS6A 4HSTA 2VXDA 3SEZA 4ZJZA 1MH3A 3JAMK 1WFXA 2E2HJ 4AYBN 2QUFA 5E1WA 2HXIA 3RPQA 3MD2A 1ETWA 2K27A 2UXXA 2OD5A 4KJZA 3H0GJ 4WCGA 2BVLA 3HTUA 2L4MA 5JI6A 1TW3A 1Y39A 3H1CA 5BMZA 3BPXA 4CDGA 4A0ZA 1VQLI 3M9AA 3E6DA 3HIFA 3HOSA 5F04A 4BEHB 1JI8A 2MGQA 2VONA 4Y33A 3F22A 2LD5A 2ZXWH 3LMMA 2A5YB 4XKBA 4P55A 4RGRA 4R1HA 5AONA 1X2NA 3H5AA 3CCLI 2XF7A 5F0HA 2ZXHA 1MBFA 1W5CC 3H3UA 1IV8A 1Z91A 2QA4I 2HYJA 2ADUA 2FNAA 3CLOA 4S0HB 5HDNA 2BOLA 4IJAA 5JLWA 4MTEA 3SYTA 4UUSA 3CCSI 3DTEA 4RLQA 2L7FP 5F08A 1FOXA 1TWAJ 2JUGA 1IUYA 2RQPA 5KAIC 5LHIA 2Q0OA 1MW7A 3GTPJ 1VTNC 1YIOA 2E34A 2X1DA 3HTSB 5E3OA 3HRMA 3DPLC 1LE8B 2R7VA 1WJCA 3G1OA 1ORKA 3DTIA 2E7WA 1O3SA 1G3YA 1FP2A 4N0BA 3JTGA 2VKVA 3FK7A 2V26A 2Z3YA 3OYJA 3LL7A 3K4CA 3BG3A 2DU9A 4RLFA 2BGCA 3V7RA 4A3CJ 1WI9A 4G7HF 4IHWA 4MGRA 3H92A 4M9ZA 5LLQA 3B6CA 1PUFB 2LP0A 4IX7A 4HNTA 2IS2A 1XN7A 4J01A 3VODA 3OV8A 4KNYA 3DV8A 4L0ZB 4WXHA 1MSEC 4HNVA 2D5VA 3ZMSA 5K7ZA 5DDGA 4PSWA 3ECHA 1VQ7I 5M5XJ 1TZLA 2M7BA 3C18A 2IA2A 5EG0B 1BJZA 3PNTA 1JT6A 3EUHC 2QF7A 5LD2C 2HOTA 3VYTB 1IJWC 2VI6A 2ME6A 5IOZA 3PFYA 1BI2A 1VZ0A 3FXUA 3OOPA 1OCRH 3EQLF 2CV2A 1IDYA 2A69F 2L9VA 2M1BA 3F72A 3CZ6A 4I99C 5D5WB 1I6XA 3SDGA 4ZTFA 3ZGKA 1VQPI 3X2QH 1SFUA 4JYKA 4GGGA 3WGHA 1BIBA 4KN7X 4AIDA 3WTVC 1X3ZB 1HSTA 2ZMEC 2PJRB 2X48A 1IW7F 4RB0A 3VEPA 3FDYA 1EF4A 4NQWA 3B02A 3M07A 4N4NB 3ZQIA 1XPXA 2JA7J 4LFUA 2P6SA 2QKLB 3BT9A 3WTTC 2IT0A 2E7XA 4AVPA 3RDIA 1IF1A 5IYBJ 3A4CA 3KP2A 1JUSA 1TNTA 3TQNA 3K70D 2E5NA 3G4SI 1KA8A 3L09A 2E1CA 4IL6C 3S2WA 1WHUA 2VC1A 1X4PA 4CCKA 5GAGJ 2ZSIB 5J3LA 4QTRA 4ZC3A 3CD6I 2WAFA 5M3MJ 2JZYA 1ZG3A 2F4IA 3S3NA 1MNDA 1TQIA 3CC2I 3RKYA 5A2QK 2XHKA 2FA5A 2LLKA 1ETOA 1OJLA 3J7AO 5J1RA 3K6GA 3C1DA 2EFQA 2FU4A 3ABUA 4I0AA 1BOBA 3OYAA 1ODDA 3IAS2 3LSIA 4N4OB 5F27A 1VI0A 4Y13A 1YOVB 2LKXA 4Y7NJ 4IOAF 3LSKA 1S5LC 1WZ2A 3FIWA 1XDSA 2YU3A 1LUJB 2LF7A 4CCMA 3WU2C 1AKHB 2HI3A 1DU6A 3TGNA 1OYWA 3CMMA 2CUZA 5ICFA 2MH9A 3K70C 2DJIA 1FMWA 2WY8Q 2FBIA 2R7UA 1NH3A 4KT5C 2KLOA 1MMNA 3MFKA 1K7AA 3CO6C 1KQ9A 1YITI 3MKYB 1DUXC 2V6EA 2EILH 4MIMA 3L2CA 3WTXC 2NOJB 3HPHA 3S2DJ 5J4VA 1Z9CA 2ZFWA 4W97A 2VN2A 3VB2A 3TP3A 1Z77A 2VBYA 3GO5A 2XVCA 3ONQA 2VPLA 3L2QA 1CQTA 3P9CA 1DPRA 1J5YA 5LGTA 3EUAA 3ECOA 1ETXA 5IT3A 2DMQA 1WGXA 2JSPA 2KKOA 4NBQA 3JAMZ 3ASNH 1KZHA 1D1CA 1JT0A 3GX4X 4KIFA 5GPAA 5K5QA 1HKQA 3DEEA 1YRNB 1GUUA 1KU9A 2EFWA 5EDNA 2GWRA 4ANJA 1T95A 1E3OC 1XC5A 3VFZA 3K9TA 4Q48A 2OZUA 2TRTA 2VIXA 2E5ZA 4BQAA 1MBJA 4ASNA 2WY7Q 2HKXA 2GQQA 4M3FA 4UB8C 3U9GA 3ZMVA 2PN6A 5JR3A 4EVIA 2KDZA 3FK6A 1MBGA 2R5ZA 3N97A 1JUMA 1B8IA 4HBLA 3CDIA 3ZMZA 1VF9A 3L2VA 3FM3A 3K4NA 4G7OF 1CF7B 1E2XA 2Y0SA 1FTTA 1QRYA 3CMYA 2QSGX 2O5RA 3I58A 4IRGA 3RQIA 1BOAA 2OU2A 4X1EA 3F6VA 2CQQA 3L1PA 4C3IJ 1MMDA 1TL8A 1O7LA 2K7LA 5E20A 3NRVA 2W1OA 1F36A 2R3SA 3CP2A 1O3QA 2VASA 2Z1DA 2O3FA 3K10A 3I9V2 2X4HA 1HDPA 3TOBA 1YHQI 4C30A 3FXLA 3K1NA 4A93J 3LSRA 3OYFA 1ZRCA 3GTJJ 4DW6A 2L9RA 3S1QJ 1Y56A 1P7IA 3R0AA 3FHZA 3MMYB 3PQKA 1WI3A 1XX5A 4I09A 5DD8A 3K4BA 4IZZA 2MFZA 3ZMTA 3KYCB 2FUG2 1IG7A 4OIRF 2CQ7A 4FE7A 2EZKA 3K2ZA 4UHTA 3HZJA 4LK1F 2CW7A 2WBMA 3HDDA 2XPUA 2Q2EA 1VQ8I 3F8CA 2BBYA 1K83J 1Z7UA 2HOEA 4OIQF 1Z7LA 3H35A 2YU9J 3M4OJ 2Q8KA 1V5GA 3OYNA 3RZDJ 2K85A 2M7AA 4DYRA 4BU2A 3Q9SA 1RI7A 3LSTA 3RI4A 2PLYA 2OAZA 2PG4A 1JTXA 4WXDA 4Y15A 3C2HA 3TDZC 1D5YA 2ISZA 3GTKJ 3SFZA 5H6RA 3KP4A 3WG7H 2E2IJ 1WCMJ 2K9NA 4CYCA 4U0WA 5FKOA 2RREA 2L7MP 1YI2I 1E3PA 3BOQA 2BEOA 3DPTA 4PK4A 3I59B 3LSMA 3F21A 2OTLI 3CCVI 4G12A 3HEFA 4KISA 2VQGA 5CLSA 5J8CA 2ZXIA 3LQQA 4AIHA 2WB1A 4GCVA 5GTIC 3PIOF 3DLLF 2V9PA 5J1YA 2J5PA 3BR5A 4DQ2A 1RPWA 5CKTA 2KRHA 4F3QA 1YW8A 2GLOA 3MZHA 2JUCA 5M3FJ 3W6JB 2NVXJ 1QGPA 4BBSJ 2QQ9A 5HNFA 3V8LA 4ABZA 4EGYA 2DFHA 5GADJ 5TGTA 3CCYA 1WH7A 2R7TA 1AOYA 3HBLA 3MZYA 4WWCA 1ZKGA 5A2QZ 4QSHA 5CQGA 2JRMA 2IP2A 4A3LJ 2Y69H 5LRSA 2XSDC 3LAPA 4FCYA 4N9IA 2Y75A 2OZ6A 4M6YA 2W00A 4B09A 5ERIA 1K4SA 2YSRA 1OQYA 2EA4A 4XONA 3ZQLA 3KFWX 3ABMH 1NK2P 4DIQA 5HODA 1MJ9A 1BIAA 1SVLA 2WV1A 1STZA 4PSXA 1TQMA 3FXKA 2X9DA 2RQQA 2ZNYA 2GM4A 2RDPA 5JFRA 3RKQA 4LG3A 5D5VB 2VBWA 3KZYA 2K4JA 1BI3A 2FRHA 1BW5A 4CSWA 3HOXJ 3MQ0A 1OR7A 2P8TA 4OOIA 4RAFA 3SHFA 3WE3A 4U7BA 3F23A 2LK2A 4G94A 4ZDOA 2D1HA 4CCOA 3RKXA 1RETA 1LPQA 4A3FJ 4D7MA 4C9YA 1UFMA 1TWCJ 3JW4A 1XDUA 2LBFB 4LLNA 3OYKA 4DGWB 4EEFG 5E17F 2DFIA 4I98B 4RGUA 3GZ5A 2DQLA 4M9XA 4FETA 2LH9A 4IHXA 1SFEA 3K4MA 4QWQA 3SXYA 1UB9A 3FM5A 4XLPF 4CH7A 3CMAI 3ZXSA 3AL0B 2H6BA 1MNMC 3SQNA 2V1DA 4F92B 1IDZA 1O4XA 2O6GE 1KYZA 4FTHA 4UUSB 2G7UA 1XSXA 1RRJA 2KIMA 1DGRM 1B1BA 2AQEA 4P9FA 3BTLA 2R7ZJ 5CPRB 4CYDA 4YFXF 1QPIA 4CGZA 1M1EB 2FMLA 2E1MB 1WH5A 1WQ2A 2ELHA 2IXSA 4NC7A 3D1NI 2I5UA 1BR4A 3W6VA 1BI0A 3NAUA 4BJ6C 4C3JJ 3HHGA 3CJQB 3VWBA 4HX8A 2VKHA 3VYUB 1OCTC 4ZYEA 2LC2A 4FQGA 3MKWB 3H3ZA 3VPRA 2OTJI 1XCVA 4KICA 2DK5A 2E36A 2HQRA 3N05A 2LY9A 3SZPA 3L2UA 3KLOA 5J6XA 5D8KB 5C4XJ 3E97A 3HSFA 3PSIA 4BS9A 5CVUA 1WJDA 1R23A 2VC0A 4E7KA 2PMHA 3CF2A 4BUPA 1AHDP 2DA7A 3QRFF 1ETQA 4KFCA 1W1WE 2LF8A 5BOXA 1BN5A 1RKWA 3KP5A 4Q4ZF 2E60A 3C7JA 3OS0A 2FXAA 2NVTJ 1ZGJA 4I76A 1JJ6C 2QENA 4GDFA 1BL0A 2GAUA 1OCPA 2MLGA 1ZAOA 5F0FA 2JA5J 3BQZA 2EB7A 2MYSA 3GW2A 3U1DA 1FBUA 3CTAA 1Q1HA 2JTVA 3C2BA 3QAHA 1MBHA 2ZFUA 3W2VA 5B1AH 1ON1A 4Y17A 5EEAA 4NC8A 4PUSA 4X6AJ 2P0WA 1Z1DA 3E5XA 1QBJA 3EYYA 3A1YA 3REOA 2JVGA 1U78A 2GXGA 5K5RA 2EIMH 2QSFX 2MBFA 4BYYA 5J4YA 1D0XA 4PJNA 3ZPLA 3BG7A 4M3BA 4A69C 3ZRGA 1P9QC 3GZ6A 4IHVA 2EINH 1IXCA 2WWYA 2GIVA 2WV0A 1J9IA 4RAYA 5LFAA 1KQ0A 1BBYA 1ZYRF 4BQNA 1TC3C 2FX0A 2TDXA 3OYLA 2CSOA 1Y0UA 4E4HA 3HSEA 1G3TA 2E71A 5E1ZB 3TO9A 1N25A 1D1BA 1JHFA 4A12A 1QZEA 4IOCF 2M87A 3TL4X 4HQEA 1MIJA 2K5CA 4D5CA 2OV7A 4XLFA 6PAXA 4EM0B 3FMRA 5DS9A 1ITYA 3E6MA 2I8DA 4I7HA 2Y31A 4II3A 2WA0A 3QOEA 4IHYA 5DYMA 2K9SA 3CCRI 2PI0A 4EJUA 2HPIA 1U2WA 3BDDA 3I0TA 3RYPA 1RIOH 1S8NA 3BP8A 1JUPA 4BACA 2HZDA 1KONA 5CVJA 5C3EJ 2DPDA 2HFHA 3Q0VA 2Y30A 3CDHA 2N8GA 1VQOI 4XNFA 1G3SA 4TV7A 4BAYA 2DMNA 2YUSA 2IBDA 2P5VA 3S32A 5D5XB 4F52A 2L7KA 4QIWN 3NARA 2DQRA 3VOEA 5FRNA 1W7PB 3BCBA 3GFIA 1W5SA 5C4JJ 2HDCA 1ON2A 3FMSA 5EF6A 4RDUA 2DMUA 5IPAA 4B1RA 5FRMA 3E0JB 2NYXA 3J80Z 2M0CA 4XKCA 3FXRA 3ZQGA 4ZZDA 3GF2A 1ZH5A 2KPMA 3JRAA 2H27A 5AIQA 3Q0UA 3JREA 3L2RA 3M3YJ 1K6YA 4AUXA 1XTAA 1R49A 2OA4A 3VYSB 1JKOC 2X6XA 2QCOA 2XAGA 1WJ5A 2LY1A 3CP8A 2HDWA 4BE0A 1XS9A 2L0KA 5GAEJ 1N77A 2H09A 3QPTA 4LD5A 1U5TC 1TQPA 2QVOA 3SEQA 2QGUA 5LHHA 2RNGA 3ZP5A 3BY6A 3FMQA 2NS8A 1HW5A 4RMNA 2BY2A 2K9LA 4BJ5C 3H36A 4BE2A 3CDLA 2RAEA 3CCEI 1Q1VA 3JR9A 4IHTA 1KQ8A 2CG4A 1MJBA 2HQAA 2ID6A 1R1VA 1F5TA 4EJTA 5LRRA 2EBIA 1TW2A 2ZSHB 5E8GA 4EQQA 2YX4A 2W4SA 4B48A 3M1EA 4YRVA 2DTZA 2HWVA 3LAJA 2WAEA 1B8IB 1ZRDA 1FNNA 1IO2A 1WJEA 1OCZH 1IGNA 1USSA 3DEWA 2VB6A 1R00A 1I3QJ 2AHQA 5EYRA 5DCMB 2CGPA 2GXBA 1SMTA 3AKZA 3JSPA 2JJ7A 1ZQ3P 2MABA 2V79A 1P7JA 2GXAA 3A01B 4GO1A 5DD4A 5J40A 3HOVJ 4HEA2 1RUOA 5KK1A 1EA3A 3GLLA 1HW2A 3LQRA 1UCRA 3KETA 3P5JA 4MHGA 3NWTA 2CRGA 1YJWI 2O8XA 1FOKA 2VOOA 2XIGA 3S16J 4Y3OA 2PEXA 3OYBA 1B9NA 1SD6A 2DLLA 3KEQA 1LDDA 4C2UA 2VKDA 2NNNA 1MDMB 3M8EA 1SAXA 1B9MA 1YFHA 3BR1A 4KMFA 5IYCJ 1SMYF 4ZDPA 2BY0A 2VPRA 2JPBA 2A6TA 3BJAA 3BWGA 4OIPF 1IAWA 4HRIA 1X3UA 3AG2H 1UHMA 4A3MJ 2KFDA 2UZKA 1LEBA 1I6HJ 3LA7A 4BL0B 3VYRB 2EIKH 2KT0A 4RBOA 4X0GA 3IH2A 1U0JA 1SVMA 4YFNF 2E35A 3QP6A 3IWFA 2ZXJA 3U21A 4EM1A 1WWXA 2DN0A 3OOUA 3VDXA 2BHYA 4L5JA 4BY1J 3AAFA 2D45A 3TDUC 2KL4A 3PUFA 1IXSB 2XAFA 1KU3A 3WU1B 1LB2A 1S7OA 4D5FA 3JRCA 2E1OA 2IS1A 4XKWA 1VQ6I 4L5IA 3I4MJ 1R5HA 3HSRA 3NEUA 5FLVA 2CUJA 1D5VA 3EETA 2ZMEB 5L3CA 4RB3C 1V54H 2CFOA 2LMDA 3HXLA 1X1BA 2HQNA 5FKLA 4HNUA 3K4LA 1ZLKA 1O57A 2HNHA 2IGOA 5L3DA 2I10A 4WF2A 3T1BA 2ACJA 2JN6A 3GTQJ 4AC0A 3J7YJ 1BR1A 1QHGA 3KEOA 1HKTA 1C0WA 3RZOJ 4LLGF 2JVHA 3PUBA 4CYCB 1OISA 2CH0A 4AM3A 3A02A 4UUVA 3LNQA 3FXQA 3BG9A 2EA2A 1Z3YA 1K78A 2A6EF 4O5VA 1PP7U 2BW3B 4O6JA 4BY7J 4E7SA 2R0QC 4F55A 5K5OA 5GPCA 3O8HA 2P7CB 2EH3A 4YIIA 2X6WA 1U9OA 2CWEA 3LFKA 3H9GA 3S17J 2CW0F 1S7AA 2O9LA 1SC7A 2MC3A 2EQRA 4P1WA 2FNPA 3BTIA 1XCBA 5JVGF 4IHSA 4ITVA 1ULYA 2WC2A 1QZYA 1R1UA 1R7JA 1X3WB 1I3AA 1XMKA 2JK3A 4FX0A 1LFBA 3UR3C 1I50J 1Z3XA 3CQZJ 2WAQA 3B6AA 3OL3A 5F1JA 2V9KA 2Z16A 4RGXA 2O61A 3LFUA 4E7IA 2BYVE 3I4NJ 1H88C 4BGDA 2LVSA 2M4GA 1MMAA 3I5UA 4V2GA 9ANTA 4K2EA 3G1LA 3IL2A 5LEJA 3ESWB 3DBHB 4IKFA 2HS5A 1PDNC 4PZJA 1QA6A 3DPUA 1OR7C 1PJRA 2EFNA 4BQOA 4CUGA 1L0OC 2DJNA 2QLZA 3FXOA 1QU3A 4U0VA 1R6RA 3JSOA 3KEYA 5HDKA 1U5TA 1KU7A 2COMA 1H8AC 3QOPA 5E3MA 2XB5A 2H8WA 2BY3A 2XV4S 1GT0C 1Y1VJ 4HF0A 4G7ZF 1D0YA 3S1MJ 2OBPA 5E79C 2X1CA 2QYOA 2IS4A 5IY5H 2JSCA 2DPUA 2O0YA 3CUOA 1Z0XA 2HYGD 3D0SA 4JK1X 5FFXA 4MQVA 3F8BA 3DTKA 1P92A 2DDAA 2VQLA 3F8NA 4U87A 3HUGB 3Q9VA 1GDTA 2XKPA 3DP7A 1AA7A 2O03A 1XG1A 2VE8A 4NDLA 4R8HA 1VQMI 2XF6A 3CCMI 3QU6A 1A36A 2VLAA 2DDBA 4QPOA 3BC8A 3HKZA 3J7ZI 4XMYA 5CJ9A 2X6OA 1K79A 3PNVA 2X0LA 2L54A 1USTA 5HOOA 3BG5A 2KZVA 1H9TA 4KA4A 1UHSA 2JA2A 3WTZA 3R60A 1MMGA 1V5FA 2BXZA 4WX9A 1XGNA 3S1RJ 1A31A 2NS7A 2XKOA 2NXNB 2W7NA 5CVIA 3RCOA 1T08B 2GZWA 1DU0A 4II2A 4YELA 5FKKA 1YJNI 1JGGA 4FX4A 1O3TA 1ZR4A 4OMYA 2C6YA 4XQFA 4XSXF 1PUFA 4L9NA 2VJ5A 2R7RA 3TEDA 3ZOBA 4GXOA 4Z2YA 2HOSA 1T8IA 1BM9A 1DGWY 2DBBA 2PJPA 4XKVA 3N4MA 3K4JA 3M8FA 1D8JA 3O2PE 3KP6A 2ID3A 1ETKA 1HW1A 2LYCA 4UV8A 3ROUA 1RR7A 5EG0A 1GV5A 2AQFA 2XF5A 2K86A 1GXPA 5D5UB 3BR0A 1T33A 3OYHA 2W82A 3ABTA 4LLLA 4YIFA 1S72I 3SDBA 1NK3P 2AXTC 2FJ1A 3J81K 2DT5A 2OPTA 3K7AJ 4DNCA 3QODA 4YG2F 3H5NA 1O3RA 1LKXA 3GWZA 1ZGAA 4S05A 2M4KA 1FBQA 2W85A 4RS8A 4D7NA 2CYYA 1ZHFA 4UVAA 2VKEA 4A2UA 4A6EA 5JHUA 1W36D 4D0PA 2PJRA 2F48A 2O7OA 2ME0A 1I39A 5HNHA 2KIUA 1LQ1A 2H6CA 4DYCA 3IWZA 1OYYA 3BJOA 2NS0A 4L5EA 1IRFA 2QQ8A 3PO2J 4HF1A 5ICGA 2BV6A 2A5WA 4CICA 5FD6A 3HM5A 4JOMA 3T8TA 4Y4RA 2M2EA 1DP7P 3UNGC 1SD7A 2F5EA 3OYIA 2ETHA 1FY7A 3HOZJ 2V4JC 4BJTA 4AIKA 2P5LC 4HX7A 1UJ8A 5HS9A 2CW8A 5M5WJ 1Z6TA 3ERMA 1F4KA 4BDZA 1W4MA 2X6YA 4HLYA 3H5RA 1IN6A 1UZCA 1BW6A 3QPLA 3O3KA 1W36C 4MFDA 4ON0A 4BHBA 2QBYB 3K0LA 3BCAA 3W2WA 4BHPA 4M71A 2STWA 3J80K 5E3NA 2WAQN 4P96A 3WGIA 3DLAA 2A6HF 5DUIA 1EH6A 3KE2A 3PSFA 1FYKA 4KDPA 1ZREA 1AKHA 2DA6A 4ETSA 4RGSA 2A61A 1T2KA 4KITB 2DOFA 1NG7A 1Y1WJ 1MJAA 1R4NB 1NTCA 5IOYA 2L9SA 5LGUA 1LDKB 1B59A 2IJLA 2ZCWA 4XL9A 4L9JA 3V42A 2PX9A 1EH8A 4DBRA 3DWLE 1HLVA 4OMZA 1XGSA 3T8RA 1G3WA 3HL2A 1BA5A 2X85A 1FP1D 5BPIA 1I1GA 3KP7A 1IRXA 2P5KA 4QPQA 3SFIA 2VBZA 4HV6A 1HCRA 4W1UA 4PFPA 4UVCA 5JVTA 2RC4A 2YS9A 4XM3A 4EGZA 2H1LA 2J5OA 2W84A 1VQ9I 4ENJA 1YX3A 1MGTA 2STTA 2PQ8A 2FOWA 3S2HJ 2CV1A 5D8LB 1PUEE 4C3HJ 4DZPA 3PJRA 2EV6A 4LG0A 1J2XA 4BE1A 1LVAA 4HSRA 3FKIJ 4XSZF 1YRNA 2QWWA 1W0UA 4I0BA 1TNSA 2VT3A 3I54A 2QKMB 2XGDA 2ZNZA 2DA4A 2CFXA 2R4GA 3H9JA 3VSLA 3S8PA 4B3AA 3L2WA 3DU6A 2CS3A 5D4RA 5KHDA 2HTJA 3ZQQA 1BJAA 4AVZA 4F93B 3OYGA 3HKZN 4BBRJ 4XORA 2PBIA 4Z6YA 5IT9K 1SANA 4DOZA 2DK8A 3LOCA 3CCQI 1R58A 3V8KA 2W25A 5HLGA 3IV5A 3I3LA 3GCMA 4FE4A 2H1KA 1IV6A 5B3SH 4ESBA 2AO9A 2E1NA 2KQRA 1FYMA 5EEGA 3OYMA 2GA2A 2G0EA 3BZKA 4G9YA 2Q1ZB 4YEJA 1UMQA 5GTHC 2R5YA 4G6QA 1RC9A 3E5QA 4OINF 4A0XA 4Y52J 4HYEA 4M6VA 4XRSG 4JBAA 4J00A 3GFJA 3I71A 4EMSA 2X1EA 2KRCA 1DDNA 2V1NA 3G6EI 1H89C 2JA8J 1RUNA 5BS6A 2LTPA 1XGMA 3BZCA 3EDPA 3A03A 3JRBA 5F1RA 1H9GA 3KLNA 2R7OA 4HZFA 1SEUA 3CC4I 1YG2A 4IF4A 4NHJA 4UXNA 3HG9A 1Z21A 1HOMA 5FGMA 4LOCA 1A35A 2MSYA 3DKWA 3FX3A 4AD9A 1REPC 2M34A 2XAUA 2KMUA 4CXFA 2L3DA 1R1TA 5D6EA 3K1MA 2VJIA 1Y6IA 2L01A 2L7ZA 4GRIA 1QVTA 3L7WA 4HG2A 3G73A 3S93A 2F5VA 2EIJH 1W5TA 2DT6A 2FSWA 4A5MA 4MTDA 1IXRC 2DAOA 2XAHA 1W0TA 2B0LA 1E0EA 3OWTA 2ELJA 1OLTA 4XN0A 3K69A 1FIAA 4B8XA 3CCJI 4ESJA 3EYIA 1AWCA 2LNBA 3OR1C 4E6KG 4NQWB 5DCFA 2EK5A 3BQYA 1SFXA 2KDOA 2QZ8A 3BJ6A 3OY9A 1O7FA 3JTHA 3MAJA 3JRGA 2F4MB 2R7FA 1V3FA 3FXMA 1TWHJ 2ZKZA 4B4CA 1EH7A 2JT1A 3J81Z 4RM3A 1OPCA 2HTSA 2CUFA 3QYBA 2DMTA 1G4DA 2IA1A 2ZB9A 2CU7A 2MA3A 2NNYA 2Y48A 3H3VK 1FC3A 3D5LA 1WKMA 5DM6F 2VQHA 2OUMA 1UHWA 5K1YA 1J0RA 3BR2A 3FXJA 1JE8A 3M1CA 2LSOA 4PGHA 5FO5A 4G8XA 1PVEA 4D1QA 2HGCA 2XPVA 4ENNA 2MD5A 1R36A 2XGEA 3P9KA 5JLXA 1V4RA 2P6TA 3CUQC 1F1ZA 4I2OA 3M8JA 2P7VB 4PJJA 1X1AA 4OWRB 3DU5A 5JHFA 2L9NA 4L9VA 4B43A 4ZYHA 4KT6A 5B5EC 3OSGA 2EV0A 4PJ0C 3Q5FA 1X1DA 4MO7A 3QQAA 3CO7C 2F2EA 2DYRH 3AG4H 3MKZA 3TO7A 1YIJI 5E18F 3PQJA 2LKPA 3J7AY 2AXLA 2EV5A 4DZJA 3BTJA 1GVJA 2F5DA 2L5QA 2ZJ2A 1LVKA 4JQFA 2DO7A 4RAGA 1TTYA 4PFOA 1FT9A 2K02A 4BHCA 4XN3A 2IEKA 1I5ZA 1FMVA 3OL4A 5HDGA 1EJ9A 3FWEA 4JP0A 1X4OA 1YW7A 3Q0WA 3HOUJ 2VE9A 5K7HA 3CESA 4ZTJA 5TRDA 2DA2A 4BKXA 1GV2A 2LFBA 4KIBA 2LR8A 4GYIA 1E3HA 1KYWA 4M3GA 3I53A 1A6IA 1U5TB 3HPGA 2EJRA 2OF7A 3FBIB 5L3GA 3KZZA 4G6DA 1ZARA 1ZLJA 5DUKA 3F0CA 2KP6A 2FBKA 4U0YA 1G59A 2Z33A 5TISC 1Y8QB 2LBFA 5DEQA 1TP4A 2DT7B 4CA0A 2Y9YA 2XROA 1P4AA 1UG0A 2R5ZB 2HOAA 3HGGA 3C3WA 4ZYAA 2ZC2A 2NAZA 1Y0NA 3E6CC 4I02A 1YX5A 3B73A 3D5SC 4XLCA 3QYFA 2MW8A 2EZLA 2Y2ZA 2YR2A 2CMPA 1JGSA 2LOOA 4P5OA 4PJMA 2DCEA 3H9QA 3S3OA 3LSGA 3I4PA 4IO9F 2VT2A 1L3LA 2JPCA 3ZMUA 4UV9A 3H0DA 4GFBA 3P9IA 3E6BA 4H4KC 4DJAA 1T38A 4C2TA 2MD0A 4I01A 4KMUX 2EPFA 2H8RA 1IN8A 1FX7A 4QLCU 2VJ4A 3RKWA 2E2JJ 1MMSA 1ZK8A 5IP9J 3LA2A 5IT9Z 3GXOA 3BLYA 4XK4A 3CJNA 3PFIA 1R5ID 2NRAC 3D5RC 3VSKA 1RESA 5EGOA 2PMZN 1S9HA 3GLXA 1X19A 4UVBA 5GP9A 3WTWC 1U3EM
chains in the Genus database with same CATH topology
1LFUP 5IP6A 5K7FA 2IAIA 2MG4A 4XRSA 4A3KJ 1GDTA 1VNDA 3ZQLA 4A3BJ 1NK2P 3QPSA 5HODA 1XG1A 2TCTA 2M8GX 4NDLA 2WV1A 1B72B 4JX6A 1MH4A 4I6ZA 2X9DA 3UKGA 1POGA 2GM4A 3RKQA 2WB1N 3S1NJ 3OSFA 2XGCA 1X58A 3E7LA 2DA1A 2ECCA 1BW5A 3HOXJ 2X6OA 5F0CA 2HXOA 2LK2A 3BG5A 5IYDJ 3IH4A 1ZTRA 2P81A 3TW7A 1UHSA 4M3EA 1RETA 4A3FJ 4D7MA 5J1UA 3S1RJ 1TWCJ 2NS7A 4EEFG 1JJ8C 3SJMA 1DU0A 1JKRC 2DA3A 5FKNA 5FKKA 1GVDA 4IHXA 1JGGA 5DTDA 1ZR4A 5E3LA 3MN2A 1FTZA 3JRFA 1UG2A 1PUFA 2JA6J 1MNMC 3HOYJ 2M9HA 3TEDA 3ZOBA 1IDZA 1O4XA 2HOSA 4FTHA 4UUSB 1B72A 1MH3A 2E2HJ 4AYBN 2HXIA 3BTLA 2R7ZJ 4A3EJ 1ETWA 4A3DJ 2ID3A 1ETKA 1ETYA 1QPIA 1RR7A 5EG0A 1GV5A 3H0GJ 1WH5A 3WHBA 3BR0A 1T33A 5EZGA 3D1NI 3W6VA 1NK3P 3WHCA 2FJ1A 3NAUA 4C3JJ 3TP0A 2OPTA 3K7AJ 5F04A 2MGQA 3GTMJ 1OCTC 3GTLJ 3BR3A 2LD5A 3VPRA 4D7NA 2VKEA 2LY9A 1X2NA 4FISA 2E19A 5F0HA 1JKPC 1AU7A 5C4XJ 1MBFA 2O7OA 2ME0A 2HYJA 1ETVA 4DYCA 4S0HB 4L5EA 4JX4A 1AHDP 2DA7A 5JLWA 1ETQA 3PO2J 4UUSA 2XRLA 2L7FP 5F08A 1RKWA 3HM5A 1TWAJ 1FEXA 2M2EA 2NVTJ 4I76A 1JJ6C 1BL0A 1ZR2A 1OCPA 3GTPJ 4MLOA 3HOZJ 5F0FA 2JA5J 3BQZA 1RKTA 2FD5A 5E3OA 5M5YJ 1LE8B 3JRDA 5M5WJ 4J19A 3C2BA 3G1OA 1MBHA 1ORKA 1IRZA 1BW6A 3QPLA 2VKVA 5EEAA 3FK7A 4MFDA 4X6AJ 1G2HA 3BG3A 4A3CJ 1S7EA 2GBYA 5E3NA 2WAQN 3LSPA 1U78A 4IHWA 2DA5A 3B6CA 1PUFB 4M3BA 4A69C 2LP0A 1AKHA 2DA6A 4IHVA 4A3GJ 3LSJA 2EZHA 1Y1WJ 1NTCA 5IOYA 1MSEC 3BR6A 4HNVA 1TC3C 5K7ZA 2D5VA 2FX0A 1HLVA 2EZIA 5M5XJ 5EG0B 1BJZA 1JT6A 3OIOA 2QF7A 1BA5A 2HOTA 1IJWC 2VI6A 3FISA 2ME6A 5IOZA 5EZHA 1LE8A 3SFIA 5FKMA 3HGYA 4D5CA 1HCRA 1IDYA 4JX5A 4W1UA 5DS9A 1ITYA 2XPWA 2YS9A 2Y31A 1T56A 3SDGA 4UUTA 4IHYA 2R5YB 2K9SA 2NOGA 3A01A 3HOWJ 4JYKA 3GTGJ 3S2HJ 1JUPA 4C3HJ 4DZPA 5C3EJ 2X48A 1X2MA 3FKIJ 3Q0VA 1EF4A 3S15J 2Y30A 3ZQIA 1TWGJ 1YRNA 1W0UA 2JA7J 2N8GA 2VUMJ 3PM1A 2DMNA 2YUSA 2IBDA 3BT9A 2XGDA 2DA4A 2K9QA 4QIWN 3NARA 3PO3J 5IYBJ 1JUSA 4B3AA 5C4JJ 1TWFJ 5EF6A 4RDUA 2DMUA 2O8KA 5BNGA 5IPAA 4V2FA 1R9TJ 3HKZN 4BBRJ 2HDDA 3TW6A 1SANA 4B1RA 3LOCA 4QTRA 5J3LA 2M0CA 5M3MJ 3IV5A 2H1KA 4FE4A 3ZQGA 4IEJA 1IV6A 3G1MA 2LLKA 3JRAA 1ETOA 1OJLA 2AO9A 5J1RA 3Q0UA 3JREA 2JWTA 2B63J 3M3YJ 4AUXA 1JKOC 2G0EA 2QCOA 1UMQA 5F27A 2R5YA 1VFCA 1VI0A 2LKXA 1XS9A 2L0KA 4Y7NJ 4Y52J 3FIWA 4M6VA 4XRSG 1AKHB 2HI3A 1DU6A 2NS8A 1SFOJ 3CDLA 1H89C 2RAEA 2JA8J 1Q1VA 3JR9A 2LTPA 1JTYA 4C2MJ 3A03A 3JRBA 2ID6A 1F43A 1K61A 2EBIA 2CJJA 3DCFA 2DTZA 1HOMA 4LOCA 1B8IB 2MSYA 1QVUA 2M34A 4MIMA 3S2DJ 2JMWA 2L7ZA 1IGNA 1QVTA 3DEWA 4W97A 3TP3A 1I3QJ 1Z77A 2AHQA 5EYRA 1IC8A 1CQTA 2JJ7A 1ZQ3P 1P7JA 4DYQA 3A01B 3HOVJ 1W0TA 3MKLA 1ETXA 2DMQA 1WGXA 2W48A 1FIAA 3ZQCA 1JT0A 1APLC 5GPAA 5FJ8J 1YRNB 1ENHA 5IP7J 2CRGA 3BQYA 1GUUA 5EDNA 3JRGA 5FLMJ 3S16J 4XIDA 5C44J 1TWHJ 4B4CA 1E3OC 1XC5A 1IUFA 2Y9ZA 2CUFA 2TRTA 3BR1A 2DMTA 1MBJA 1MSFC 5IYCJ 4M3FA 2KDZA 2VPRA 3FK6A 2ZB9A 2CU7A 1MBGA 2R5ZA 1JUMA 1B8IA 4A3MJ 2DMPA 2R93J 4XRMA 3H3VK 1I6HJ 1VF9A 2KT0A 3K2AA 4RBOA 3IH2A 3BR2A 1FTTA 1QRYA 3CMYA 2DN0A 3OOUA 4BY1J 3RQIA 2NVYJ 2XPVA 1U9NA 4X1EA 2HQ5A 4A3JJ 2CQQA 2XGEA 5JLXA 3L1PA 4C3IJ 2NVQJ 4D5FA 3JRCA 2E1OA 1HF0A 3I4MJ 1F36A 2XB0X 3O8GA 5FLVA 1HDDC 4XICA 1MBEA 3OSGA 1HDPA 3IH3A 5FKLA 1OFCX 3S14J 2I10A 4A93J 3LSRA 2JN6A 4MO7A 3QQAA 3GTQJ 3GTJJ 4BXXJ 4AC0A 2L9RA 4DW6A 3GTOJ 3S1QJ 3ZQFA 3RZOJ 1P7IA 1MBKA 4CYCB 4DZJA 3BTJA 1WI3A 3A02A 3LNQA 3BG9A 2CQXA 3MVPA 1IG7A 1A5JA 2Y0SN 4BY7J 2IEKA 1FJLA 2R0QC 4FE7A 4JP0A 2EZKA 5GPCA 3O8HA 2EH3A 3Q0WA 3HOUJ 5K7HA 1U9OA 2DA2A 2XPUA 2COBA 3HDDA 4BKXA 3S17J 1GV2A 2LFBA 1JKQC 2LR8A 2O9LA 1K83J 3HB9A 2EQRA 4M3GA 2YU9J 1A6IA 3BTIA 3M4OJ 2OF7A 3RZDJ 4DYRA 3JRHA 3F0CA 4MFEA 1JTXA 5EGOB 2JK3A 1D5YA 3GTKJ 1LFBA 1I50J 2FQ4A 2K40A 1WCMJ 2Y9YA 3CQZJ 2E2IJ 2R5ZB 3B6AA 2HOAA 2K9NA 3HGGA 5F1JA 4CYCA 5FKOA 2CUEA 3JRIA 2L7MP 3I4NJ 2MW8A 2EZLA 2Y2ZA 4G12A 3HEFA 1H88C 2LVSA 4V2GA 9ANTA 3G1LA 3LSGA 1FIPA 4GFBA 5J1YA 2R92J 3BR5A 1RPWA 4M3DA 3ZQHA 4A3IJ 2DJNA 2GLOA 3Q3SA 1ZGWA 5M3FJ 1U8BA 2NVXJ 4BBSJ 1WPKA 2H8RA 2E2JJ 3GBGA 4ABZA 1ZK8A 5IP9J 3CCYA 1H8AC 1WH7A 5E3MA 2ELKA 2XB5A 4XK4A 3HBLA 1GT0C 1Y1VJ 1ZKGA 1RESA 4QSHA 5EGOA 3S1MJ 2PMZN 3BTCA 4A3LJ 2XSDC 5GP9A 2ECBA 1Z0XA 4FCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LFU P;  5IP6 A;  5K7F A;  2IAI A;  2MG4 A;  4XRS A;  4A3K J;  1GDT A;  1VND A;  3ZQL A;  4A3B J;  1NK2 P;  3QPS A;  5HOD A;  1XG1 A;  2TCT A;  2M8G X;  4NDL A;  2WV1 A;  1B72 B;  4JX6 A;  1MH4 A;  4I6Z A;  2X9D A;  3UKG A;  1POG A;  2GM4 A;  3RKQ A;  2WB1 N;  3S1N J;  3OSF A;  2XGC A;  1X58 A;  3E7L A;  2DA1 A;  2ECC A;  1BW5 A;  3HOX J;  2X6O A;  5F0C A;  2HXO A;  2LK2 A;  3BG5 A;  5IYD J;  3IH4 A;  1ZTR A;  2P81 A;  3TW7 A;  1UHS A;  4M3E A;  1RET A;  4A3F J;  4D7M A;  5J1U A;  3S1R J;  1TWC J;  2NS7 A;  4EEF G;  1JJ8 C;  3SJM A;  1DU0 A;  1JKR C;  2DA3 A;  5FKN A;  5FKK A;  1GVD A;  4IHX A;  1JGG A;  5DTD A;  1ZR4 A;  5E3L A;  3MN2 A;  1FTZ A;  3JRF A;  1UG2 A;  1PUF A;  2JA6 J;  1MNM C;  3HOY J;  2M9H A;  3TED A;  3ZOB A;  1IDZ A;  1O4X A;  2HOS A;  4FTH A;  4UUS B;  1B72 A;  1MH3 A;  2E2H J;  4AYB N;  2HXI A;  3BTL A;  2R7Z J;  4A3E J;  1ETW A;  4A3D J;  2ID3 A;  1ETK A;  1ETY A;  1QPI A;  1RR7 A;  5EG0 A;  1GV5 A;  3H0G J;  1WH5 A;  3WHB A;  3BR0 A;  1T33 A;  5EZG A;  3D1N I;  3W6V A;  1NK3 P;  3WHC A;  2FJ1 A;  3NAU A;  4C3J J;  3TP0 A;  2OPT A;  3K7A J;  5F04 A;  2MGQ A;  3GTM J;  1OCT C;  3GTL J;  3BR3 A;  2LD5 A;  3VPR A;  4D7N A;  2VKE A;  2LY9 A;  1X2N A;  4FIS A;  2E19 A;  5F0H A;  1JKP C;  1AU7 A;  5C4X J;  1MBF A;  2O7O A;  2ME0 A;  2HYJ A;  1ETV A;  4DYC A;  4S0H B;  4L5E A;  4JX4 A;  1AHD P;  2DA7 A;  5JLW A;  1ETQ A;  3PO2 J;  4UUS A;  2XRL A;  2L7F P;  5F08 A;  1RKW A;  3HM5 A;  1TWA J;  1FEX A;  2M2E A;  2NVT J;  4I76 A;  1JJ6 C;  1BL0 A;  1ZR2 A;  1OCP A;  3GTP J;  4MLO A;  3HOZ J;  5F0F A;  2JA5 J;  3BQZ A;  1RKT A;  2FD5 A;  5E3O A;  5M5Y J;  1LE8 B;  3JRD A;  5M5W J;  4J19 A;  3C2B A;  3G1O A;  1MBH A;  1ORK A;  1IRZ A;  1BW6 A;  3QPL A;  2VKV A;  5EEA A;  3FK7 A;  4MFD A;  4X6A J;  1G2H A;  3BG3 A;  4A3C J;  1S7E A;  2GBY A;  5E3N A;  2WAQ N;  3LSP A;  1U78 A;  4IHW A;  2DA5 A;  3B6C A;  1PUF B;  4M3B A;  4A69 C;  2LP0 A;  1AKH A;  2DA6 A;  4IHV A;  4A3G J;  3LSJ A;  2EZH A;  1Y1W J;  1NTC A;  5IOY A;  1MSE C;  3BR6 A;  4HNV A;  1TC3 C;  5K7Z A;  2D5V A;  2FX0 A;  1HLV A;  2EZI A;  5M5X J;  5EG0 B;  1BJZ A;  1JT6 A;  3OIO A;  2QF7 A;  1BA5 A;  2HOT A;  1IJW C;  2VI6 A;  3FIS A;  2ME6 A;  5IOZ A;  5EZH A;  1LE8 A;  3SFI A;  5FKM A;  3HGY A;  4D5C A;  1HCR A;  1IDY A;  4JX5 A;  4W1U A;  5DS9 A;  1ITY A;  2XPW A;  2YS9 A;  2Y31 A;  1T56 A;  3SDG A;  4UUT A;  4IHY A;  2R5Y B;  2K9S A;  2NOG A;  3A01 A;  3HOW J;  4JYK A;  3GTG J;  3S2H J;  1JUP A;  4C3H J;  4DZP A;  5C3E J;  2X48 A;  1X2M A;  3FKI J;  3Q0V A;  1EF4 A;  3S15 J;  2Y30 A;  3ZQI A;  1TWG J;  1YRN A;  1W0U A;  2JA7 J;  2N8G A;  2VUM J;  3PM1 A;  2DMN A;  2YUS A;  2IBD A;  3BT9 A;  2XGD A;  2DA4 A;  2K9Q A;  4QIW N;  3NAR A;  3PO3 J;  5IYB J;  1JUS A;  4B3A A;  5C4J J;  1TWF J;  5EF6 A;  4RDU A;  2DMU A;  2O8K A;  5BNG A;  5IPA A;  4V2F A;  1R9T J;  3HKZ N;  4BBR J;  2HDD A;  3TW6 A;  1SAN A;  4B1R A;  3LOC A;  4QTR A;  5J3L A;  2M0C A;  5M3M J;  3IV5 A;  2H1K A;  4FE4 A;  3ZQG A;  4IEJ A;  1IV6 A;  3G1M A;  2LLK A;  3JRA A;  1ETO A;  1OJL A;  2AO9 A;  5J1R A;  3Q0U A;  3JRE A;  2JWT A;  2B63 J;  3M3Y J;  4AUX A;  1JKO C;  2G0E A;  2QCO A;  1UMQ A;  5F27 A;  2R5Y A;  1VFC A;  1VI0 A;  2LKX A;  1XS9 A;  2L0K A;  4Y7N J;  4Y52 J;  3FIW A;  4M6V A;  4XRS G;  1AKH B;  2HI3 A;  1DU6 A;  2NS8 A;  1SFO J;  3CDL A;  1H89 C;  2RAE A;  2JA8 J;  1Q1V A;  3JR9 A;  2LTP A;  1JTY A;  4C2M J;  3A03 A;  3JRB A;  2ID6 A;  1F43 A;  1K61 A;  2EBI A;  2CJJ A;  3DCF A;  2DTZ A;  1HOM A;  4LOC A;  1B8I B;  2MSY A;  1QVU A;  2M34 A;  4MIM A;  3S2D J;  2JMW A;  2L7Z A;  1IGN A;  1QVT A;  3DEW A;  4W97 A;  3TP3 A;  1I3Q J;  1Z77 A;  2AHQ A;  5EYR A;  1IC8 A;  1CQT A;  2JJ7 A;  1ZQ3 P;  1P7J A;  4DYQ A;  3A01 B;  3HOV J;  1W0T A;  3MKL A;  1ETX A;  2DMQ A;  1WGX A;  2W48 A;  1FIA A;  3ZQC A;  1JT0 A;  1APL C;  5GPA A;  5FJ8 J;  1YRN B;  1ENH A;  5IP7 J;  2CRG A;  3BQY A;  1GUU A;  5EDN A;  3JRG A;  5FLM J;  3S16 J;  4XID A;  5C44 J;  1TWH J;  4B4C A;  1E3O C;  1XC5 A;  1IUF A;  2Y9Z A;  2CUF A;  2TRT A;  3BR1 A;  2DMT A;  1MBJ A;  1MSF C;  5IYC J;  4M3F A;  2KDZ A;  2VPR A;  3FK6 A;  2ZB9 A;  2CU7 A;  1MBG A;  2R5Z A;  1JUM A;  1B8I A;  4A3M J;  2DMP A;  2R93 J;  4XRM A;  3H3V K;  1I6H J;  1VF9 A;  2KT0 A;  3K2A A;  4RBO A;  3IH2 A;  3BR2 A;  1FTT A;  1QRY A;  3CMY A;  2DN0 A;  3OOU A;  4BY1 J;  3RQI A;  2NVY J;  2XPV A;  1U9N A;  4X1E A;  2HQ5 A;  4A3J J;  2CQQ A;  2XGE A;  5JLX A;  3L1P A;  4C3I J;  2NVQ J;  4D5F A;  3JRC A;  2E1O A;  1HF0 A;  3I4M J;  1F36 A;  2XB0 X;  3O8G A;  5FLV A;  1HDD C;  4XIC A;  1MBE A;  3OSG A;  1HDP A;  3IH3 A;  5FKL A;  1OFC X;  3S14 J;  2I10 A;  4A93 J;  3LSR A;  2JN6 A;  4MO7 A;  3QQA A;  3GTQ J;  3GTJ J;  4BXX J;  4AC0 A;  2L9R A;  4DW6 A;  3GTO J;  3S1Q J;  3ZQF A;  3RZO J;  1P7I A;  1MBK A;  4CYC B;  4DZJ A;  3BTJ A;  1WI3 A;  3A02 A;  3LNQ A;  3BG9 A;  2CQX A;  3MVP A;  1IG7 A;  1A5J A;  2Y0S N;  4BY7 J;  2IEK A;  1FJL A;  2R0Q C;  4FE7 A;  4JP0 A;  2EZK A;  5GPC A;  3O8H A;  2EH3 A;  3Q0W A;  3HOU J;  5K7H A;  1U9O A;  2DA2 A;  2XPU A;  2COB A;  3HDD A;  4BKX A;  3S17 J;  1GV2 A;  2LFB A;  1JKQ C;  2LR8 A;  2O9L A;  1K83 J;  3HB9 A;  2EQR A;  4M3G A;  2YU9 J;  1A6I A;  3BTI A;  3M4O J;  2OF7 A;  3RZD J;  4DYR A;  3JRH A;  3F0C A;  4MFE A;  1JTX A;  5EGO B;  2JK3 A;  1D5Y A;  3GTK J;  1LFB A;  1I50 J;  2FQ4 A;  2K40 A;  1WCM J;  2Y9Y A;  3CQZ J;  2E2I J;  2R5Z B;  3B6A A;  2HOA A;  2K9N A;  3HGG A;  5F1J A;  4CYC A;  5FKO A;  2CUE A;  3JRI A;  2L7M P;  3I4N J;  2MW8 A;  2EZL A;  2Y2Z A;  4G12 A;  3HEF A;  1H88 C;  2LVS A;  4V2G A;  9ANT A;  3G1L A;  3LSG A;  1FIP A;  4GFB A;  5J1Y A;  2R92 J;  3BR5 A;  1RPW A;  4M3D A;  3ZQH A;  4A3I J;  2DJN A;  2GLO A;  3Q3S A;  1ZGW A;  5M3F J;  1U8B A;  2NVX J;  4BBS J;  1WPK A;  2H8R A;  2E2J J;  3GBG A;  4ABZ A;  1ZK8 A;  5IP9 J;  3CCY A;  1H8A C;  1WH7 A;  5E3M A;  2ELK A;  2XB5 A;  4XK4 A;  3HBL A;  1GT0 C;  1Y1V J;  1ZKG A;  1RES A;  4QSH A;  5EGO A;  3S1M J;  2PMZ N;  3BTC A;  4A3L J;  2XSD C;  5GP9 A;  2ECB A;  1Z0X A;  4FCY A; 
#chains in the Genus database with same CATH topology
 4XR6 A;  3OMY A;  5K7F A;  1HA8 A;  1FOW A;  4MEX F;  1RNL A;  2IAI A;  2HYF A;  5DV5 A;  1HSJ A;  5KVR A;  2IW5 A;  4KN4 X;  4OIO F;  2P4W A;  3ULQ B;  1RZ4 A;  1N78 A;  3OIP A;  4XRF A;  4LIT A;  2F4O B;  4JX6 A;  4XLH A;  4AU7 A;  4BQQ A;  4KUM A;  1G8X A;  4I6Z A;  4PCQ A;  3RSN A;  2OCC H;  3GME A;  4RAZ A;  3UKG A;  5ICC A;  5L3B A;  2D2W A;  2XAJ A;  5LHG A;  4HX4 A;  4H0E A;  2XGC A;  1YTY A;  3A0B C;  1X58 A;  2Q2E B;  5FRO A;  2ESH A;  4CHU A;  3E7L A;  2DA1 A;  1QPM A;  2ECC A;  1U6G A;  2M45 A;  5F0C A;  4ZH4 F;  4OAZ A;  2HXO A;  3RTR A;  1BC8 C;  2CO5 A;  5IYD J;  1ZTR A;  2VOP A;  1S29 A;  1P4W A;  1XSV A;  2DYS H;  2VXZ A;  5LBQ A;  3PIP F;  3BZ6 A;  4NC6 A;  1ZG5 A;  1ZG1 A;  3LA3 A;  4NNJ A;  3SJM A;  1XD7 A;  2IS6 A;  5FLX K;  5BQT A;  5FKN A;  1ERD A;  4AIJ A;  4V19 K;  1XMA A;  5DTD A;  4PDK A;  3HRT A;  5E3L A;  3MN2 A;  2W57 A;  3JRF A;  3GFM A;  1UG2 A;  1SD5 A;  2JA6 J;  2V6C A;  2XGX A;  3P7N A;  2Y0M A;  2RGV A;  3RPU D;  3W3C A;  3HOY J;  2M9H A;  3ZN1 A;  4RM2 A;  1KGS A;  5D6F A;  5F6F A;  1B72 A;  3V7S A;  2D1V A;  3FKJ A;  4A3E J;  3EUK L;  4A3D J;  2LRD A;  1ETY A;  1YQA A;  2RNJ A;  4IXA A;  1D1A A;  2M0M A;  2HZT A;  2WAD A;  3MWM A;  3WHB A;  3KZI C;  1IN7 A;  1SD4 A;  2MC4 A;  5EZG A;  1J7K A;  2GA1 A;  3RYR A;  3CUQ A;  4LIV A;  3LSH A;  3WHC A;  5CVR A;  4M6X A;  3TP0 A;  4UB6 C;  5J47 A;  1IRG A;  1S3J A;  3GTM J;  5KNL A;  3OR2 C;  1U8R A;  3KIO A;  3GTL J;  3BR3 A;  4Q5S F;  5EJC A;  4N9H A;  5KCM A;  1WVR A;  3V8J A;  3PNY A;  2V9V A;  2XAS A;  1R22 A;  4HOB A;  1JHH A;  4FIS A;  2R7D A;  2E19 A;  1JKP C;  1AU7 A;  3IHU A;  4LIU A;  1T39 A;  3G2B A;  2K4B A;  1ETV A;  1N75 A;  1Z05 A;  2KIS A;  3KCC A;  4JX4 A;  3S3M A;  4PJL A;  2LRE A;  2DOA A;  2XRL A;  3T5X A;  5CVV A;  3CCU I;  4HF2 A;  1WJA A;  1W7P A;  1YS7 A;  5ILV A;  1FEX A;  3R4K A;  1LFP A;  2M30 A;  4A6D A;  1ZR2 A;  2DW4 A;  3TKY A;  2DI3 A;  4MLO A;  3T0Y A;  3COA C;  2IA0 A;  1RKT A;  2FD5 A;  5M5Y J;  3JRD A;  4PGG A;  4J19 A;  1TT5 B;  1XSD A;  5EEH A;  5B66 C;  1IRZ A;  2XAQ A;  2DFF A;  3BG6 A;  4BEH A;  5AIP A;  2IRF G;  3IAM 2;  1G2H A;  2VQC A;  1ZEL A;  5GAH J;  3ML6 A;  1S7E A;  1FPQ A;  2GBY A;  1IZ1 A;  2LG4 A;  3E1S A;  1YLF A;  3LSP A;  4LG0 B;  3ZCO A;  2DA5 A;  3GEZ A;  2OCE A;  3PL8 A;  4ZYG A;  4L9T A;  3OYE A;  3ABL H;  2FOK A;  4A3G J;  4BXF A;  1QQI A;  2EZH A;  3LSJ A;  4B44 A;  3F3X A;  3O6B B;  4LB6 B;  3ZMD A;  2F5C A;  2CQN A;  1Y8R B;  3BR6 A;  3HYI A;  2A07 F;  3L9F A;  3DXJ F;  5CYV A;  1RR8 C;  2EZI A;  2EFO A;  4U88 A;  4UY8 I;  5HLT A;  5CQE A;  2HR3 A;  4D9J A;  1D3Y A;  3OIO A;  3WE2 A;  3FIS A;  1Z6R A;  2LDU A;  4HQM A;  2Z2S B;  3G3Z A;  4E7H A;  4CO8 A;  4LB5 A;  4IQJ A;  5EZH A;  1LE8 A;  3FBN B;  3TO6 A;  2BE5 F;  3HGY A;  4HA8 A;  5FKM A;  2XDV A;  4JX5 A;  5HS7 A;  3SZG A;  4WK8 F;  2B9S A;  2XPW A;  1VQK I;  1P4X A;  5DCM A;  1PYV A;  1T56 A;  3MCZ A;  4UUT A;  2Z99 A;  2R5Y B;  1BR2 A;  1J09 A;  2NOG A;  3A01 A;  3HOW J;  2IVM A;  3GTG J;  2PFB A;  1JXS A;  4B47 A;  2BHZ A;  3BPV A;  4DBQ A;  4RB1 A;  3GFL A;  4M74 A;  1X2M A;  3MZ8 A;  1T98 A;  3NWS A;  3S15 J;  1TWG J;  1SAU A;  2VUM J;  3PM1 A;  4FHT A;  3ZR8 X;  1VQ5 I;  2BZT A;  1WSU A;  2GOM A;  2K9Q A;  3TOA A;  3PO3 J;  2K3F A;  2VJJ A;  1IN4 A;  1MDM A;  2XC7 A;  1TWF J;  2FMY A;  2LY2 A;  2RN7 A;  1D0Z A;  2O8K A;  2RVC A;  5BNG A;  4CCL A;  4BXU A;  4MQ9 F;  4V2F A;  1R9T J;  2FBH A;  2HDD A;  2RV8 A;  4R79 A;  3WOD F;  3TW6 A;  2A3S A;  2L02 A;  4S04 A;  4XOT A;  4CZZ A;  3EUH A;  4YFK F;  4IEJ A;  1FSH A;  2A68 F;  2HU9 A;  3G1M A;  4HPQ A;  2JWT A;  2B63 J;  2DTR A;  3IUO A;  3KYD B;  5L3F A;  2BXY A;  2FE3 A;  5LGN A;  2QEX I;  1VFC A;  3CC7 I;  5FD5 A;  3GZN B;  1YW9 A;  1SFK A;  1LDJ A;  2CQK A;  5HLH A;  5TJJ A;  1SFO J;  2V1U A;  4EV0 A;  2ZME A;  3AG3 H;  1R5G A;  2ZJQ F;  2AS5 F;  3QU3 A;  1FOY A;  2KJB A;  3HRS A;  1FZP B;  1JTY A;  5ILS A;  2MLK A;  3CJR B;  4C2M J;  1QHH D;  2QQA A;  1TT0 A;  5L3E A;  1F43 A;  3QP5 A;  1K61 A;  3RIR A;  3FHN A;  4A0Y A;  2CJJ A;  3DCF A;  3WTU C;  2HKO A;  3F6O A;  3WTY C;  3E5U A;  1VQ4 I;  3HJE A;  1PP8 F;  1FSE A;  1QVU A;  1MD0 A;  5FLX Z;  4BH9 A;  4L0Y B;  1MNE A;  3I56 I;  3NQO A;  2JMW A;  4XLE A;  3IRR A;  1A04 A;  3G71 I;  1CGP A;  2XSJ C;  2DXI A;  1IC8 A;  2BW3 A;  3TMO A;  5FB2 A;  2OQG A;  3GUD A;  3KX2 A;  2ZBK A;  3V4G A;  4F7Z A;  4DYQ A;  1T0F C;  1B6A A;  1EV7 A;  3F8M A;  3MKL A;  3RQ4 A;  4M9S A;  1GHC A;  2W48 A;  3ZQC A;  4E7Z A;  4GYG A;  5B1B H;  2VL8 A;  1APL C;  5FJ8 J;  4XOP A;  1ENH A;  3SZT A;  5IP7 J;  4IRH A;  1YJ9 I;  3A0H C;  3IP4 B;  4Q47 A;  4UNO A;  3RPU A;  5FLM J;  2H94 A;  2K9M A;  4XID A;  3AFH A;  5C44 J;  1HC8 A;  4O3M A;  1YE9 A;  5FFZ A;  4XLN F;  1IUF A;  2Y9Z A;  4CCJ A;  1P6R A;  1FWZ A;  1MZB A;  1MKM A;  3KP3 A;  4NUB A;  4BNC A;  2KRF A;  1MSF C;  3DEU A;  4EM2 A;  1UEL B;  4E7J A;  3ERE D;  1TLH B;  2K3P A;  1G6N A;  2XUB A;  2R7S A;  3K4K A;  2DMP A;  2R93 J;  4XRM A;  2KIQ A;  1DPU A;  1I27 A;  2ESN A;  1R71 A;  3FZV A;  1IN5 A;  1X1C A;  4XBF A;  3K2A A;  4LK0 F;  3M7G A;  1UAA A;  3I64 A;  1S6L A;  1QNT A;  1OMI A;  4P9U A;  3JCU C;  4BDY A;  5KAF C;  4WXC A;  1OYI A;  2LKS A;  3DKY A;  1P2F A;  4AYB A;  2OC6 A;  3TBI A;  2HVQ A;  2NVY J;  4HV5 A;  1U9N A;  3OIQ A;  2XRN A;  2HQ5 A;  2KJC A;  5F64 A;  3WG9 A;  4A3J J;  3W2A A;  2NVQ J;  2V1X A;  5E1X A;  2IGM A;  1HF0 A;  4M73 A;  2XB0 X;  3O8G A;  3W6K B;  1HDD C;  1DP3 A;  3QYE A;  4XIC A;  2VOD A;  1MBE A;  2IPQ X;  2ZJP F;  4F91 B;  1OKR A;  5ICE A;  4L18 B;  3FF5 A;  1OCC H;  4EJW A;  3IH3 A;  1OFC X;  3S14 J;  2GIZ A;  1ZN2 A;  4FT8 A;  1HXD A;  4BXX J;  2MH2 A;  2FEZ A;  1K4T A;  2B7E A;  3GTO J;  3ZQF A;  3WTS C;  1MBK A;  4RB2 C;  3AL0 C;  4IRI A;  2L2O A;  4OU0 A;  3BRO A;  1GXQ A;  3IKV A;  5H6Q A;  4A5N A;  3I55 I;  3HOT A;  3HUG A;  1B4A A;  1XB4 A;  2CQX A;  3MVP A;  1CF7 A;  2QQB A;  2UUZ A;  1HQC A;  2VBX A;  3KPH A;  1A5J A;  2Y0S N;  3F8F A;  2DFE A;  2F6C A;  1FJL A;  1F9N A;  2M8E A;  1R4M B;  3LWF A;  2A05 A;  4AWX B;  3OS2 A;  2ICW G;  2E1M C;  3ZQ7 A;  3OYD A;  4IQ4 A;  2COB A;  3E3V A;  1ZRF A;  1HKS A;  2ISY A;  2NVU B;  4ESF A;  1NG6 A;  1JKQ C;  1E17 A;  4EAT A;  3GVA A;  3OS1 A;  3HB9 A;  5H2F C;  2G7H A;  1EKE A;  1FLI A;  1NHA A;  1I1S A;  3R6S A;  4ENK A;  2GOX B;  5HVQ C;  1LJ9 A;  2HVS A;  4FAS D;  3JRH A;  4MFE A;  3HHH A;  2BY1 A;  1V55 H;  2Z9O A;  5EGO B;  3DBL B;  3CJT B;  1WJF A;  2PMZ A;  4E7L A;  3OYC A;  5HLI A;  3HRU A;  3DKX A;  1T6S A;  4CZC A;  2FQ4 A;  4HW0 A;  2K40 A;  1V5E A;  3EPZ A;  2KZG A;  4G6T B;  4LMY A;  3DF8 A;  5ED4 A;  4CCN A;  1J59 A;  2FQ3 A;  1K6O A;  4HLX A;  1DQU A;  5LEK A;  1VQN I;  2CUE A;  4IVN A;  3JRI A;  2L4A A;  2HVR A;  3DQV C;  4LJZ F;  1YO5 C;  3U1K A;  1ONV A;  1ACI A;  2BVM A;  1A6Q A;  2G9W A;  2FF4 A;  4HDU A;  2IGN A;  3KYL A;  3CME I;  3MEX A;  3AG1 H;  3V7C A;  1FIP A;  3IC7 A;  4ZDL A;  3ABK H;  2R92 J;  1KU2 A;  2OJE D;  5DM7 F;  4HDV A;  5J8F A;  3U2R A;  4M3D A;  3ZQH A;  4A3I J;  1TBX A;  3L00 A;  2DOE A;  2EWN A;  3Q3S A;  4XLA A;  1ZGW A;  2HEO A;  1U8B A;  2ZO4 A;  1WPK A;  4RA2 A;  5E8I A;  1BC7 C;  3GBG A;  3HC7 A;  2RKH A;  4EJV A;  1SVO A;  2KIF A;  2ELK A;  1LEA A;  2OQR A;  3ISP A;  1XGO A;  5ILU A;  2W24 A;  3CLQ A;  2YX7 A;  2PMU A;  1YYV A;  3BTC A;  3CF5 F;  4HAM A;  2ECB A;  4MNU A;  1LFU P;  5IP6 A;  3QPH A;  1XMX A;  3ZN0 A;  2UWM A;  2EFP A;  3RJP A;  2MG4 A;  4XRS A;  4A3K J;  4ENM A;  4EJO A;  1VND A;  1H0M A;  1WJB A;  4B3X A;  1D8K A;  3IKT A;  4A3B J;  4IPA A;  3QPS A;  1X1P A;  3I59 A;  4M72 A;  4OAY A;  2TCT A;  3C2G A;  1K78 B;  2M8G X;  3K1P A;  1B72 B;  1MH4 A;  2M3A A;  2QM3 A;  2M5W A;  3WU0 A;  1POG A;  3R0J A;  1W7P D;  4ZZL A;  2WB1 N;  3F9K A;  1J75 A;  3OSF A;  3S1N J;  1FBS A;  1Z67 A;  1LNW A;  3DFG A;  2V7F A;  4KYW A;  2WTE A;  3IRQ A;  2R7Q A;  1T0F A;  4U7D A;  2DOD A;  3GYH X;  1FYL A;  3CUQ B;  5D4S A;  3IH4 A;  3TW7 A;  1QZZ A;  2P81 A;  2X51 A;  4YIR X;  1OCO H;  4M3E A;  5J1U A;  2KHM A;  2CV0 A;  2IGK A;  3DBR B;  4MEY F;  2Z5U A;  2UXN A;  1JJ8 C;  3ASO H;  2DA3 A;  1JKR C;  2HPM A;  2QBY A;  1QO0 D;  1GLN A;  4KIG A;  1GVD A;  2ZJR F;  2JRT A;  5HS8 A;  3QWL A;  5BPD A;  4NB5 A;  2UV1 A;  2QSH X;  3ELK A;  2YPR A;  2R7X A;  1FTZ A;  1HBX G;  5H20 A;  3A2K A;  1BI1 A;  1WRJ A;  2F5F A;  2R7W A;  3WGG A;  4ZYD A;  4E70 A;  2JQ7 A;  3R61 A;  4LGW A;  1YS6 A;  4HST A;  2VXD A;  3SEZ A;  4ZJZ A;  1MH3 A;  3JAM K;  1WFX A;  2E2H J;  4AYB N;  2QUF A;  5E1W A;  2HXI A;  3RPQ A;  3MD2 A;  1ETW A;  2K27 A;  2UXX A;  2OD5 A;  4KJZ A;  3H0G J;  4WCG A;  2BVL A;  3HTU A;  2L4M A;  5JI6 A;  1TW3 A;  1Y39 A;  3H1C A;  5BMZ A;  3BPX A;  4CDG A;  4A0Z A;  1VQL I;  3M9A A;  3E6D A;  3HIF A;  3HOS A;  5F04 A;  4BEH B;  1JI8 A;  2MGQ A;  2VON A;  4Y33 A;  3F22 A;  2LD5 A;  2ZXW H;  3LMM A;  2A5Y B;  4XKB A;  4P55 A;  4RGR A;  4R1H A;  5AON A;  1X2N A;  3H5A A;  3CCL I;  2XF7 A;  5F0H A;  2ZXH A;  1MBF A;  1W5C C;  3H3U A;  1IV8 A;  1Z91 A;  2QA4 I;  2HYJ A;  2ADU A;  2FNA A;  3CLO A;  4S0H B;  5HDN A;  2BOL A;  4IJA A;  5JLW A;  4MTE A;  3SYT A;  4UUS A;  3CCS I;  3DTE A;  4RLQ A;  2L7F P;  5F08 A;  1FOX A;  1TWA J;  2JUG A;  1IUY A;  2RQP A;  5KAI C;  5LHI A;  2Q0O A;  1MW7 A;  3GTP J;  1VTN C;  1YIO A;  2E34 A;  2X1D A;  3HTS B;  5E3O A;  3HRM A;  3DPL C;  1LE8 B;  2R7V A;  1WJC A;  3G1O A;  1ORK A;  3DTI A;  2E7W A;  1O3S A;  1G3Y A;  1FP2 A;  4N0B A;  3JTG A;  2VKV A;  3FK7 A;  2V26 A;  2Z3Y A;  3OYJ A;  3LL7 A;  3K4C A;  3BG3 A;  2DU9 A;  4RLF A;  2BGC A;  3V7R A;  4A3C J;  1WI9 A;  4G7H F;  4IHW A;  4MGR A;  3H92 A;  4M9Z A;  5LLQ A;  3B6C A;  1PUF B;  2LP0 A;  4IX7 A;  4HNT A;  2IS2 A;  1XN7 A;  4J01 A;  3VOD A;  3OV8 A;  4KNY A;  3DV8 A;  4L0Z B;  4WXH A;  1MSE C;  4HNV A;  2D5V A;  3ZMS A;  5K7Z A;  5DDG A;  4PSW A;  3ECH A;  1VQ7 I;  5M5X J;  1TZL A;  2M7B A;  3C18 A;  2IA2 A;  5EG0 B;  1BJZ A;  3PNT A;  1JT6 A;  3EUH C;  2QF7 A;  5LD2 C;  2HOT A;  3VYT B;  1IJW C;  2VI6 A;  2ME6 A;  5IOZ A;  3PFY A;  1BI2 A;  1VZ0 A;  3FXU A;  3OOP A;  1OCR H;  3EQL F;  2CV2 A;  1IDY A;  2A69 F;  2L9V A;  2M1B A;  3F72 A;  3CZ6 A;  4I99 C;  5D5W B;  1I6X A;  3SDG A;  4ZTF A;  3ZGK A;  1VQP I;  3X2Q H;  1SFU A;  4JYK A;  4GGG A;  3WGH A;  1BIB A;  4KN7 X;  4AID A;  3WTV C;  1X3Z B;  1HST A;  2ZME C;  2PJR B;  2X48 A;  1IW7 F;  4RB0 A;  3VEP A;  3FDY A;  1EF4 A;  4NQW A;  3B02 A;  3M07 A;  4N4N B;  3ZQI A;  1XPX A;  2JA7 J;  4LFU A;  2P6S A;  2QKL B;  3BT9 A;  3WTT C;  2IT0 A;  2E7X A;  4AVP A;  3RDI A;  1IF1 A;  5IYB J;  3A4C A;  3KP2 A;  1JUS A;  1TNT A;  3TQN A;  3K70 D;  2E5N A;  3G4S I;  1KA8 A;  3L09 A;  2E1C A;  4IL6 C;  3S2W A;  1WHU A;  2VC1 A;  1X4P A;  4CCK A;  5GAG J;  2ZSI B;  5J3L A;  4QTR A;  4ZC3 A;  3CD6 I;  2WAF A;  5M3M J;  2JZY A;  1ZG3 A;  2F4I A;  3S3N A;  1MND A;  1TQI A;  3CC2 I;  3RKY A;  5A2Q K;  2XHK A;  2FA5 A;  2LLK A;  1ETO A;  1OJL A;  3J7A O;  5J1R A;  3K6G A;  3C1D A;  2EFQ A;  2FU4 A;  3ABU A;  4I0A A;  1BOB A;  3OYA A;  1ODD A;  3IAS 2;  3LSI A;  4N4O B;  5F27 A;  1VI0 A;  4Y13 A;  1YOV B;  2LKX A;  4Y7N J;  4IOA F;  3LSK A;  1S5L C;  1WZ2 A;  3FIW A;  1XDS A;  2YU3 A;  1LUJ B;  2LF7 A;  4CCM A;  3WU2 C;  1AKH B;  2HI3 A;  1DU6 A;  3TGN A;  1OYW A;  3CMM A;  2CUZ A;  5ICF A;  2MH9 A;  3K70 C;  2DJI A;  1FMW A;  2WY8 Q;  2FBI A;  2R7U A;  1NH3 A;  4KT5 C;  2KLO A;  1MMN A;  3MFK A;  1K7A A;  3CO6 C;  1KQ9 A;  1YIT I;  3MKY B;  1DUX C;  2V6E A;  2EIL H;  4MIM A;  3L2C A;  3WTX C;  2NOJ B;  3HPH A;  3S2D J;  5J4V A;  1Z9C A;  2ZFW A;  4W97 A;  2VN2 A;  3VB2 A;  3TP3 A;  1Z77 A;  2VBY A;  3GO5 A;  2XVC A;  3ONQ A;  2VPL A;  3L2Q A;  1CQT A;  3P9C A;  1DPR A;  1J5Y A;  5LGT A;  3EUA A;  3ECO A;  1ETX A;  5IT3 A;  2DMQ A;  1WGX A;  2JSP A;  2KKO A;  4NBQ A;  3JAM Z;  3ASN H;  1KZH A;  1D1C A;  1JT0 A;  3GX4 X;  4KIF A;  5GPA A;  5K5Q A;  1HKQ A;  3DEE A;  1YRN B;  1GUU A;  1KU9 A;  2EFW A;  5EDN A;  2GWR A;  4ANJ A;  1T95 A;  1E3O C;  1XC5 A;  3VFZ A;  3K9T A;  4Q48 A;  2OZU A;  2TRT A;  2VIX A;  2E5Z A;  4BQA A;  1MBJ A;  4ASN A;  2WY7 Q;  2HKX A;  2GQQ A;  4M3F A;  4UB8 C;  3U9G A;  3ZMV A;  2PN6 A;  5JR3 A;  4EVI A;  2KDZ A;  3FK6 A;  1MBG A;  2R5Z A;  3N97 A;  1JUM A;  1B8I A;  4HBL A;  3CDI A;  3ZMZ A;  1VF9 A;  3L2V A;  3FM3 A;  3K4N A;  4G7O F;  1CF7 B;  1E2X A;  2Y0S A;  1FTT A;  1QRY A;  3CMY A;  2QSG X;  2O5R A;  3I58 A;  4IRG A;  3RQI A;  1BOA A;  2OU2 A;  4X1E A;  3F6V A;  2CQQ A;  3L1P A;  4C3I J;  1MMD A;  1TL8 A;  1O7L A;  2K7L A;  5E20 A;  3NRV A;  2W1O A;  1F36 A;  2R3S A;  3CP2 A;  1O3Q A;  2VAS A;  2Z1D A;  2O3F A;  3K10 A;  3I9V 2;  2X4H A;  1HDP A;  3TOB A;  1YHQ I;  4C30 A;  3FXL A;  3K1N A;  4A93 J;  3LSR A;  3OYF A;  1ZRC A;  3GTJ J;  4DW6 A;  2L9R A;  3S1Q J;  1Y56 A;  1P7I A;  3R0A A;  3FHZ A;  3MMY B;  3PQK A;  1WI3 A;  1XX5 A;  4I09 A;  5DD8 A;  3K4B A;  4IZZ A;  2MFZ A;  3ZMT A;  3KYC B;  2FUG 2;  1IG7 A;  4OIR F;  2CQ7 A;  4FE7 A;  2EZK A;  3K2Z A;  4UHT A;  3HZJ A;  4LK1 F;  2CW7 A;  2WBM A;  3HDD A;  2XPU A;  2Q2E A;  1VQ8 I;  3F8C A;  2BBY A;  1K83 J;  1Z7U A;  2HOE A;  4OIQ F;  1Z7L A;  3H35 A;  2YU9 J;  3M4O J;  2Q8K A;  1V5G A;  3OYN A;  3RZD J;  2K85 A;  2M7A A;  4DYR A;  4BU2 A;  3Q9S A;  1RI7 A;  3LST A;  3RI4 A;  2PLY A;  2OAZ A;  2PG4 A;  1JTX A;  4WXD A;  4Y15 A;  3C2H A;  3TDZ C;  1D5Y A;  2ISZ A;  3GTK J;  3SFZ A;  5H6R A;  3KP4 A;  3WG7 H;  2E2I J;  1WCM J;  2K9N A;  4CYC A;  4U0W A;  5FKO A;  2RRE A;  2L7M P;  1YI2 I;  1E3P A;  3BOQ A;  2BEO A;  3DPT A;  4PK4 A;  3I59 B;  3LSM A;  3F21 A;  2OTL I;  3CCV I;  4G12 A;  3HEF A;  4KIS A;  2VQG A;  5CLS A;  5J8C A;  2ZXI A;  3LQQ A;  4AIH A;  2WB1 A;  4GCV A;  5GTI C;  3PIO F;  3DLL F;  2V9P A;  5J1Y A;  2J5P A;  3BR5 A;  4DQ2 A;  1RPW A;  5CKT A;  2KRH A;  4F3Q A;  1YW8 A;  2GLO A;  3MZH A;  2JUC A;  5M3F J;  3W6J B;  2NVX J;  1QGP A;  4BBS J;  2QQ9 A;  5HNF A;  3V8L A;  4ABZ A;  4EGY A;  2DFH A;  5GAD J;  5TGT A;  3CCY A;  1WH7 A;  2R7T A;  1AOY A;  3HBL A;  3MZY A;  4WWC A;  1ZKG A;  5A2Q Z;  4QSH A;  5CQG A;  2JRM A;  2IP2 A;  4A3L J;  2Y69 H;  5LRS A;  2XSD C;  3LAP A;  4FCY A;  4N9I A;  2Y75 A;  2OZ6 A;  4M6Y A;  2W00 A;  4B09 A;  5ERI A;  1K4S A;  2YSR A;  1OQY A;  2EA4 A;  4XON A;  3ZQL A;  3KFW X;  3ABM H;  1NK2 P;  4DIQ A;  5HOD A;  1MJ9 A;  1BIA A;  1SVL A;  2WV1 A;  1STZ A;  4PSX A;  1TQM A;  3FXK A;  2X9D A;  2RQQ A;  2ZNY A;  2GM4 A;  2RDP A;  5JFR A;  3RKQ A;  4LG3 A;  5D5V B;  2VBW A;  3KZY A;  2K4J A;  1BI3 A;  2FRH A;  1BW5 A;  4CSW A;  3HOX J;  3MQ0 A;  1OR7 A;  2P8T A;  4OOI A;  4RAF A;  3SHF A;  3WE3 A;  4U7B A;  3F23 A;  2LK2 A;  4G94 A;  4ZDO A;  2D1H A;  4CCO A;  3RKX A;  1RET A;  1LPQ A;  4A3F J;  4D7M A;  4C9Y A;  1UFM A;  1TWC J;  3JW4 A;  1XDU A;  2LBF B;  4LLN A;  3OYK A;  4DGW B;  4EEF G;  5E17 F;  2DFI A;  4I98 B;  4RGU A;  3GZ5 A;  2DQL A;  4M9X A;  4FET A;  2LH9 A;  4IHX A;  1SFE A;  3K4M A;  4QWQ A;  3SXY A;  1UB9 A;  3FM5 A;  4XLP F;  4CH7 A;  3CMA I;  3ZXS A;  3AL0 B;  2H6B A;  1MNM C;  3SQN A;  2V1D A;  4F92 B;  1IDZ A;  1O4X A;  2O6G E;  1KYZ A;  4FTH A;  4UUS B;  2G7U A;  1XSX A;  1RRJ A;  2KIM A;  1DGR M;  1B1B A;  2AQE A;  4P9F A;  3BTL A;  2R7Z J;  5CPR B;  4CYD A;  4YFX F;  1QPI A;  4CGZ A;  1M1E B;  2FML A;  2E1M B;  1WH5 A;  1WQ2 A;  2ELH A;  2IXS A;  4NC7 A;  3D1N I;  2I5U A;  1BR4 A;  3W6V A;  1BI0 A;  3NAU A;  4BJ6 C;  4C3J J;  3HHG A;  3CJQ B;  3VWB A;  4HX8 A;  2VKH A;  3VYU B;  1OCT C;  4ZYE A;  2LC2 A;  4FQG A;  3MKW B;  3H3Z A;  3VPR A;  2OTJ I;  1XCV A;  4KIC A;  2DK5 A;  2E36 A;  2HQR A;  3N05 A;  2LY9 A;  3SZP A;  3L2U A;  3KLO A;  5J6X A;  5D8K B;  5C4X J;  3E97 A;  3HSF A;  3PSI A;  4BS9 A;  5CVU A;  1WJD A;  1R23 A;  2VC0 A;  4E7K A;  2PMH A;  3CF2 A;  4BUP A;  1AHD P;  2DA7 A;  3QRF F;  1ETQ A;  4KFC A;  1W1W E;  2LF8 A;  5BOX A;  1BN5 A;  1RKW A;  3KP5 A;  4Q4Z F;  2E60 A;  3C7J A;  3OS0 A;  2FXA A;  2NVT J;  1ZGJ A;  4I76 A;  1JJ6 C;  2QEN A;  4GDF A;  1BL0 A;  2GAU A;  1OCP A;  2MLG A;  1ZAO A;  5F0F A;  2JA5 J;  3BQZ A;  2EB7 A;  2MYS A;  3GW2 A;  3U1D A;  1FBU A;  3CTA A;  1Q1H A;  2JTV A;  3C2B A;  3QAH A;  1MBH A;  2ZFU A;  3W2V A;  5B1A H;  1ON1 A;  4Y17 A;  5EEA A;  4NC8 A;  4PUS A;  4X6A J;  2P0W A;  1Z1D A;  3E5X A;  1QBJ A;  3EYY A;  3A1Y A;  3REO A;  2JVG A;  1U78 A;  2GXG A;  5K5R A;  2EIM H;  2QSF X;  2MBF A;  4BYY A;  5J4Y A;  1D0X A;  4PJN A;  3ZPL A;  3BG7 A;  4M3B A;  4A69 C;  3ZRG A;  1P9Q C;  3GZ6 A;  4IHV A;  2EIN H;  1IXC A;  2WWY A;  2GIV A;  2WV0 A;  1J9I A;  4RAY A;  5LFA A;  1KQ0 A;  1BBY A;  1ZYR F;  4BQN A;  1TC3 C;  2FX0 A;  2TDX A;  3OYL A;  2CSO A;  1Y0U A;  4E4H A;  3HSE A;  1G3T A;  2E71 A;  5E1Z B;  3TO9 A;  1N25 A;  1D1B A;  1JHF A;  4A12 A;  1QZE A;  4IOC F;  2M87 A;  3TL4 X;  4HQE A;  1MIJ A;  2K5C A;  4D5C A;  2OV7 A;  4XLF A;  6PAX A;  4EM0 B;  3FMR A;  5DS9 A;  1ITY A;  3E6M A;  2I8D A;  4I7H A;  2Y31 A;  4II3 A;  2WA0 A;  3QOE A;  4IHY A;  5DYM A;  2K9S A;  3CCR I;  2PI0 A;  4EJU A;  2HPI A;  1U2W A;  3BDD A;  3I0T A;  3RYP A;  1RIO H;  1S8N A;  3BP8 A;  1JUP A;  4BAC A;  2HZD A;  1KON A;  5CVJ A;  5C3E J;  2DPD A;  2HFH A;  3Q0V A;  2Y30 A;  3CDH A;  2N8G A;  1VQO I;  4XNF A;  1G3S A;  4TV7 A;  4BAY A;  2DMN A;  2YUS A;  2IBD A;  2P5V A;  3S32 A;  5D5X B;  4F52 A;  2L7K A;  4QIW N;  3NAR A;  2DQR A;  3VOE A;  5FRN A;  1W7P B;  3BCB A;  3GFI A;  1W5S A;  5C4J J;  2HDC A;  1ON2 A;  3FMS A;  5EF6 A;  4RDU A;  2DMU A;  5IPA A;  4B1R A;  5FRM A;  3E0J B;  2NYX A;  3J80 Z;  2M0C A;  4XKC A;  3FXR A;  3ZQG A;  4ZZD A;  3GF2 A;  1ZH5 A;  2KPM A;  3JRA A;  2H27 A;  5AIQ A;  3Q0U A;  3JRE A;  3L2R A;  3M3Y J;  1K6Y A;  4AUX A;  1XTA A;  1R49 A;  2OA4 A;  3VYS B;  1JKO C;  2X6X A;  2QCO A;  2XAG A;  1WJ5 A;  2LY1 A;  3CP8 A;  2HDW A;  4BE0 A;  1XS9 A;  2L0K A;  5GAE J;  1N77 A;  2H09 A;  3QPT A;  4LD5 A;  1U5T C;  1TQP A;  2QVO A;  3SEQ A;  2QGU A;  5LHH A;  2RNG A;  3ZP5 A;  3BY6 A;  3FMQ A;  2NS8 A;  1HW5 A;  4RMN A;  2BY2 A;  2K9L A;  4BJ5 C;  3H36 A;  4BE2 A;  3CDL A;  2RAE A;  3CCE I;  1Q1V A;  3JR9 A;  4IHT A;  1KQ8 A;  2CG4 A;  1MJB A;  2HQA A;  2ID6 A;  1R1V A;  1F5T A;  4EJT A;  5LRR A;  2EBI A;  1TW2 A;  2ZSH B;  5E8G A;  4EQQ A;  2YX4 A;  2W4S A;  4B48 A;  3M1E A;  4YRV A;  2DTZ A;  2HWV A;  3LAJ A;  2WAE A;  1B8I B;  1ZRD A;  1FNN A;  1IO2 A;  1WJE A;  1OCZ H;  1IGN A;  1USS A;  3DEW A;  2VB6 A;  1R00 A;  1I3Q J;  2AHQ A;  5EYR A;  5DCM B;  2CGP A;  2GXB A;  1SMT A;  3AKZ A;  3JSP A;  2JJ7 A;  1ZQ3 P;  2MAB A;  2V79 A;  1P7J A;  2GXA A;  3A01 B;  4GO1 A;  5DD4 A;  5J40 A;  3HOV J;  4HEA 2;  1RUO A;  5KK1 A;  1EA3 A;  3GLL A;  1HW2 A;  3LQR A;  1UCR A;  3KET A;  3P5J A;  4MHG A;  3NWT A;  2CRG A;  1YJW I;  2O8X A;  1FOK A;  2VOO A;  2XIG A;  3S16 J;  4Y3O A;  2PEX A;  3OYB A;  1B9N A;  1SD6 A;  2DLL A;  3KEQ A;  1LDD A;  4C2U A;  2VKD A;  2NNN A;  1MDM B;  3M8E A;  1SAX A;  1B9M A;  1YFH A;  3BR1 A;  4KMF A;  5IYC J;  1SMY F;  4ZDP A;  2BY0 A;  2VPR A;  2JPB A;  2A6T A;  3BJA A;  3BWG A;  4OIP F;  1IAW A;  4HRI A;  1X3U A;  3AG2 H;  1UHM A;  4A3M J;  2KFD A;  2UZK A;  1LEB A;  1I6H J;  3LA7 A;  4BL0 B;  3VYR B;  2EIK H;  2KT0 A;  4RBO A;  4X0G A;  3IH2 A;  1U0J A;  1SVM A;  4YFN F;  2E35 A;  3QP6 A;  3IWF A;  2ZXJ A;  3U21 A;  4EM1 A;  1WWX A;  2DN0 A;  3OOU A;  3VDX A;  2BHY A;  4L5J A;  4BY1 J;  3AAF A;  2D45 A;  3TDU C;  2KL4 A;  3PUF A;  1IXS B;  2XAF A;  1KU3 A;  3WU1 B;  1LB2 A;  1S7O A;  4D5F A;  3JRC A;  2E1O A;  2IS1 A;  4XKW A;  1VQ6 I;  4L5I A;  3I4M J;  1R5H A;  3HSR A;  3NEU A;  5FLV A;  2CUJ A;  1D5V A;  3EET A;  2ZME B;  5L3C A;  4RB3 C;  1V54 H;  2CFO A;  2LMD A;  3HXL A;  1X1B A;  2HQN A;  5FKL A;  4HNU A;  3K4L A;  1ZLK A;  1O57 A;  2HNH A;  2IGO A;  5L3D A;  2I10 A;  4WF2 A;  3T1B A;  2ACJ A;  2JN6 A;  3GTQ J;  4AC0 A;  3J7Y J;  1BR1 A;  1QHG A;  3KEO A;  1HKT A;  1C0W A;  3RZO J;  4LLG F;  2JVH A;  3PUB A;  4CYC B;  1OIS A;  2CH0 A;  4AM3 A;  3A02 A;  4UUV A;  3LNQ A;  3FXQ A;  3BG9 A;  2EA2 A;  1Z3Y A;  1K78 A;  2A6E F;  4O5V A;  1PP7 U;  2BW3 B;  4O6J A;  4BY7 J;  4E7S A;  2R0Q C;  4F55 A;  5K5O A;  5GPC A;  3O8H A;  2P7C B;  2EH3 A;  4YII A;  2X6W A;  1U9O A;  2CWE A;  3LFK A;  3H9G A;  3S17 J;  2CW0 F;  1S7A A;  2O9L A;  1SC7 A;  2MC3 A;  2EQR A;  4P1W A;  2FNP A;  3BTI A;  1XCB A;  5JVG F;  4IHS A;  4ITV A;  1ULY A;  2WC2 A;  1QZY A;  1R1U A;  1R7J A;  1X3W B;  1I3A A;  1XMK A;  2JK3 A;  4FX0 A;  1LFB A;  3UR3 C;  1I50 J;  1Z3X A;  3CQZ J;  2WAQ A;  3B6A A;  3OL3 A;  5F1J A;  2V9K A;  2Z16 A;  4RGX A;  2O61 A;  3LFU A;  4E7I A;  2BYV E;  3I4N J;  1H88 C;  4BGD A;  2LVS A;  2M4G A;  1MMA A;  3I5U A;  4V2G A;  9ANT A;  4K2E A;  3G1L A;  3IL2 A;  5LEJ A;  3ESW B;  3DBH B;  4IKF A;  2HS5 A;  1PDN C;  4PZJ A;  1QA6 A;  3DPU A;  1OR7 C;  1PJR A;  2EFN A;  4BQO A;  4CUG A;  1L0O C;  2DJN A;  2QLZ A;  3FXO A;  1QU3 A;  4U0V A;  1R6R A;  3JSO A;  3KEY A;  5HDK A;  1U5T A;  1KU7 A;  2COM A;  1H8A C;  3QOP A;  5E3M A;  2XB5 A;  2H8W A;  2BY3 A;  2XV4 S;  1GT0 C;  1Y1V J;  4HF0 A;  4G7Z F;  1D0Y A;  3S1M J;  2OBP A;  5E79 C;  2X1C A;  2QYO A;  2IS4 A;  5IY5 H;  2JSC A;  2DPU A;  2O0Y A;  3CUO A;  1Z0X A;  2HYG D;  3D0S A;  4JK1 X;  5FFX A;  4MQV A;  3F8B A;  3DTK A;  1P92 A;  2DDA A;  2VQL A;  3F8N A;  4U87 A;  3HUG B;  3Q9V A;  1GDT A;  2XKP A;  3DP7 A;  1AA7 A;  2O03 A;  1XG1 A;  2VE8 A;  4NDL A;  4R8H A;  1VQM I;  2XF6 A;  3CCM I;  3QU6 A;  1A36 A;  2VLA A;  2DDB A;  4QPO A;  3BC8 A;  3HKZ A;  3J7Z I;  4XMY A;  5CJ9 A;  2X6O A;  1K79 A;  3PNV A;  2X0L A;  2L54 A;  1UST A;  5HOO A;  3BG5 A;  2KZV A;  1H9T A;  4KA4 A;  1UHS A;  2JA2 A;  3WTZ A;  3R60 A;  1MMG A;  1V5F A;  2BXZ A;  4WX9 A;  1XGN A;  3S1R J;  1A31 A;  2NS7 A;  2XKO A;  2NXN B;  2W7N A;  5CVI A;  3RCO A;  1T08 B;  2GZW A;  1DU0 A;  4II2 A;  4YEL A;  5FKK A;  1YJN I;  1JGG A;  4FX4 A;  1O3T A;  1ZR4 A;  4OMY A;  2C6Y A;  4XQF A;  4XSX F;  1PUF A;  4L9N A;  2VJ5 A;  2R7R A;  3TED A;  3ZOB A;  4GXO A;  4Z2Y A;  2HOS A;  1T8I A;  1BM9 A;  1DGW Y;  2DBB A;  2PJP A;  4XKV A;  3N4M A;  3K4J A;  3M8F A;  1D8J A;  3O2P E;  3KP6 A;  2ID3 A;  1ETK A;  1HW1 A;  2LYC A;  4UV8 A;  3ROU A;  1RR7 A;  5EG0 A;  1GV5 A;  2AQF A;  2XF5 A;  2K86 A;  1GXP A;  5D5U B;  3BR0 A;  1T33 A;  3OYH A;  2W82 A;  3ABT A;  4LLL A;  4YIF A;  1S72 I;  3SDB A;  1NK3 P;  2AXT C;  2FJ1 A;  3J81 K;  2DT5 A;  2OPT A;  3K7A J;  4DNC A;  3QOD A;  4YG2 F;  3H5N A;  1O3R A;  1LKX A;  3GWZ A;  1ZGA A;  4S05 A;  2M4K A;  1FBQ A;  2W85 A;  4RS8 A;  4D7N A;  2CYY A;  1ZHF A;  4UVA A;  2VKE A;  4A2U A;  4A6E A;  5JHU A;  1W36 D;  4D0P A;  2PJR A;  2F48 A;  2O7O A;  2ME0 A;  1I39 A;  5HNH A;  2KIU A;  1LQ1 A;  2H6C A;  4DYC A;  3IWZ A;  1OYY A;  3BJO A;  2NS0 A;  4L5E A;  1IRF A;  2QQ8 A;  3PO2 J;  4HF1 A;  5ICG A;  2BV6 A;  2A5W A;  4CIC A;  5FD6 A;  3HM5 A;  4JOM A;  3T8T A;  4Y4R A;  2M2E A;  1DP7 P;  3UNG C;  1SD7 A;  2F5E A;  3OYI A;  2ETH A;  1FY7 A;  3HOZ J;  2V4J C;  4BJT A;  4AIK A;  2P5L C;  4HX7 A;  1UJ8 A;  5HS9 A;  2CW8 A;  5M5W J;  1Z6T A;  3ERM A;  1F4K A;  4BDZ A;  1W4M A;  2X6Y A;  4HLY A;  3H5R A;  1IN6 A;  1UZC A;  1BW6 A;  3QPL A;  3O3K A;  1W36 C;  4MFD A;  4ON0 A;  4BHB A;  2QBY B;  3K0L A;  3BCA A;  3W2W A;  4BHP A;  4M71 A;  2STW A;  3J80 K;  5E3N A;  2WAQ N;  4P96 A;  3WGI A;  3DLA A;  2A6H F;  5DUI A;  1EH6 A;  3KE2 A;  3PSF A;  1FYK A;  4KDP A;  1ZRE A;  1AKH A;  2DA6 A;  4ETS A;  4RGS A;  2A61 A;  1T2K A;  4KIT B;  2DOF A;  1NG7 A;  1Y1W J;  1MJA A;  1R4N B;  1NTC A;  5IOY A;  2L9S A;  5LGU A;  1LDK B;  1B59 A;  2IJL A;  2ZCW A;  4XL9 A;  4L9J A;  3V42 A;  2PX9 A;  1EH8 A;  4DBR A;  3DWL E;  1HLV A;  4OMZ A;  1XGS A;  3T8R A;  1G3W A;  3HL2 A;  1BA5 A;  2X85 A;  1FP1 D;  5BPI A;  1I1G A;  3KP7 A;  1IRX A;  2P5K A;  4QPQ A;  3SFI A;  2VBZ A;  4HV6 A;  1HCR A;  4W1U A;  4PFP A;  4UVC A;  5JVT A;  2RC4 A;  2YS9 A;  4XM3 A;  4EGZ A;  2H1L A;  2J5O A;  2W84 A;  1VQ9 I;  4ENJ A;  1YX3 A;  1MGT A;  2STT A;  2PQ8 A;  2FOW A;  3S2H J;  2CV1 A;  5D8L B;  1PUE E;  4C3H J;  4DZP A;  3PJR A;  2EV6 A;  4LG0 A;  1J2X A;  4BE1 A;  1LVA A;  4HSR A;  3FKI J;  4XSZ F;  1YRN A;  2QWW A;  1W0U A;  4I0B A;  1TNS A;  2VT3 A;  3I54 A;  2QKM B;  2XGD A;  2ZNZ A;  2DA4 A;  2CFX A;  2R4G A;  3H9J A;  3VSL A;  3S8P A;  4B3A A;  3L2W A;  3DU6 A;  2CS3 A;  5D4R A;  5KHD A;  2HTJ A;  3ZQQ A;  1BJA A;  4AVZ A;  4F93 B;  3OYG A;  3HKZ N;  4BBR J;  4XOR A;  2PBI A;  4Z6Y A;  5IT9 K;  1SAN A;  4DOZ A;  2DK8 A;  3LOC A;  3CCQ I;  1R58 A;  3V8K A;  2W25 A;  5HLG A;  3IV5 A;  3I3L A;  3GCM A;  4FE4 A;  2H1K A;  1IV6 A;  5B3S H;  4ESB A;  2AO9 A;  2E1N A;  2KQR A;  1FYM A;  5EEG A;  3OYM A;  2GA2 A;  2G0E A;  3BZK A;  4G9Y A;  2Q1Z B;  4YEJ A;  1UMQ A;  5GTH C;  2R5Y A;  4G6Q A;  1RC9 A;  3E5Q A;  4OIN F;  4A0X A;  4Y52 J;  4HYE A;  4M6V A;  4XRS G;  4JBA A;  4J00 A;  3GFJ A;  3I71 A;  4EMS A;  2X1E A;  2KRC A;  1DDN A;  2V1N A;  3G6E I;  1H89 C;  2JA8 J;  1RUN A;  5BS6 A;  2LTP A;  1XGM A;  3BZC A;  3EDP A;  3A03 A;  3JRB A;  5F1R A;  1H9G A;  3KLN A;  2R7O A;  4HZF A;  1SEU A;  3CC4 I;  1YG2 A;  4IF4 A;  4NHJ A;  4UXN A;  3HG9 A;  1Z21 A;  1HOM A;  5FGM A;  4LOC A;  1A35 A;  2MSY A;  3DKW A;  3FX3 A;  4AD9 A;  1REP C;  2M34 A;  2XAU A;  2KMU A;  4CXF A;  2L3D A;  1R1T A;  5D6E A;  3K1M A;  2VJI A;  1Y6I A;  2L01 A;  2L7Z A;  4GRI A;  1QVT A;  3L7W A;  4HG2 A;  3G73 A;  3S93 A;  2F5V A;  2EIJ H;  1W5T A;  2DT6 A;  2FSW A;  4A5M A;  4MTD A;  1IXR C;  2DAO A;  2XAH A;  1W0T A;  2B0L A;  1E0E A;  3OWT A;  2ELJ A;  1OLT A;  4XN0 A;  3K69 A;  1FIA A;  4B8X A;  3CCJ I;  4ESJ A;  3EYI A;  1AWC A;  2LNB A;  3OR1 C;  4E6K G;  4NQW B;  5DCF A;  2EK5 A;  3BQY A;  1SFX A;  2KDO A;  2QZ8 A;  3BJ6 A;  3OY9 A;  1O7F A;  3JTH A;  3MAJ A;  3JRG A;  2F4M B;  2R7F A;  1V3F A;  3FXM A;  1TWH J;  2ZKZ A;  4B4C A;  1EH7 A;  2JT1 A;  3J81 Z;  4RM3 A;  1OPC A;  2HTS A;  2CUF A;  3QYB A;  2DMT A;  1G4D A;  2IA1 A;  2ZB9 A;  2CU7 A;  2MA3 A;  2NNY A;  2Y48 A;  3H3V K;  1FC3 A;  3D5L A;  1WKM A;  5DM6 F;  2VQH A;  2OUM A;  1UHW A;  5K1Y A;  1J0R A;  3BR2 A;  3FXJ A;  1JE8 A;  3M1C A;  2LSO A;  4PGH A;  5FO5 A;  4G8X A;  1PVE A;  4D1Q A;  2HGC A;  2XPV A;  4ENN A;  2MD5 A;  1R36 A;  2XGE A;  3P9K A;  5JLX A;  1V4R A;  2P6T A;  3CUQ C;  1F1Z A;  4I2O A;  3M8J A;  2P7V B;  4PJJ A;  1X1A A;  4OWR B;  3DU5 A;  5JHF A;  2L9N A;  4L9V A;  4B43 A;  4ZYH A;  4KT6 A;  5B5E C;  3OSG A;  2EV0 A;  4PJ0 C;  3Q5F A;  1X1D A;  4MO7 A;  3QQA A;  3CO7 C;  2F2E A;  2DYR H;  3AG4 H;  3MKZ A;  3TO7 A;  1YIJ I;  5E18 F;  3PQJ A;  2LKP A;  3J7A Y;  2AXL A;  2EV5 A;  4DZJ A;  3BTJ A;  1GVJ A;  2F5D A;  2L5Q A;  2ZJ2 A;  1LVK A;  4JQF A;  2DO7 A;  4RAG A;  1TTY A;  4PFO A;  1FT9 A;  2K02 A;  4BHC A;  4XN3 A;  2IEK A;  1I5Z A;  1FMV A;  3OL4 A;  5HDG A;  1EJ9 A;  3FWE A;  4JP0 A;  1X4O A;  1YW7 A;  3Q0W A;  3HOU J;  2VE9 A;  5K7H A;  3CES A;  4ZTJ A;  5TRD A;  2DA2 A;  4BKX A;  1GV2 A;  2LFB A;  4KIB A;  2LR8 A;  4GYI A;  1E3H A;  1KYW A;  4M3G A;  3I53 A;  1A6I A;  1U5T B;  3HPG A;  2EJR A;  2OF7 A;  3FBI B;  5L3G A;  3KZZ A;  4G6D A;  1ZAR A;  1ZLJ A;  5DUK A;  3F0C A;  2KP6 A;  2FBK A;  4U0Y A;  1G59 A;  2Z33 A;  5TIS C;  1Y8Q B;  2LBF A;  5DEQ A;  1TP4 A;  2DT7 B;  4CA0 A;  2Y9Y A;  2XRO A;  1P4A A;  1UG0 A;  2R5Z B;  2HOA A;  3HGG A;  3C3W A;  4ZYA A;  2ZC2 A;  2NAZ A;  1Y0N A;  3E6C C;  4I02 A;  1YX5 A;  3B73 A;  3D5S C;  4XLC A;  3QYF A;  2MW8 A;  2EZL A;  2Y2Z A;  2YR2 A;  2CMP A;  1JGS A;  2LOO A;  4P5O A;  4PJM A;  2DCE A;  3H9Q A;  3S3O A;  3LSG A;  3I4P A;  4IO9 F;  2VT2 A;  1L3L A;  2JPC A;  3ZMU A;  4UV9 A;  3H0D A;  4GFB A;  3P9I A;  3E6B A;  4H4K C;  4DJA A;  1T38 A;  4C2T A;  2MD0 A;  4I01 A;  4KMU X;  2EPF A;  2H8R A;  1IN8 A;  1FX7 A;  4QLC U;  2VJ4 A;  3RKW A;  2E2J J;  1MMS A;  1ZK8 A;  5IP9 J;  3LA2 A;  5IT9 Z;  3GXO A;  3BLY A;  4XK4 A;  3CJN A;  3PFI A;  1R5I D;  2NRA C;  3D5R C;  3VSK A;  1RES A;  5EGO A;  2PMZ N;  1S9H A;  3GLX A;  1X19 A;  4UVB A;  5GP9 A;  3WTW C;  1U3E M; 
#chains in the Genus database with same CATH homology
 1LFU P;  5IP6 A;  5K7F A;  2IAI A;  2MG4 A;  4XRS A;  4A3K J;  1GDT A;  1VND A;  3ZQL A;  4A3B J;  1NK2 P;  3QPS A;  5HOD A;  1XG1 A;  2TCT A;  2M8G X;  4NDL A;  2WV1 A;  1B72 B;  4JX6 A;  1MH4 A;  4I6Z A;  2X9D A;  3UKG A;  1POG A;  2GM4 A;  3RKQ A;  2WB1 N;  3S1N J;  3OSF A;  2XGC A;  1X58 A;  3E7L A;  2DA1 A;  2ECC A;  1BW5 A;  3HOX J;  2X6O A;  5F0C A;  2HXO A;  2LK2 A;  3BG5 A;  5IYD J;  3IH4 A;  1ZTR A;  2P81 A;  3TW7 A;  1UHS A;  4M3E A;  1RET A;  4A3F J;  4D7M A;  5J1U A;  3S1R J;  1TWC J;  2NS7 A;  4EEF G;  1JJ8 C;  3SJM A;  1DU0 A;  1JKR C;  2DA3 A;  5FKN A;  5FKK A;  1GVD A;  4IHX A;  1JGG A;  5DTD A;  1ZR4 A;  5E3L A;  3MN2 A;  1FTZ A;  3JRF A;  1UG2 A;  1PUF A;  2JA6 J;  1MNM C;  3HOY J;  2M9H A;  3TED A;  3ZOB A;  1IDZ A;  1O4X A;  2HOS A;  4FTH A;  4UUS B;  1B72 A;  1MH3 A;  2E2H J;  4AYB N;  2HXI A;  3BTL A;  2R7Z J;  4A3E J;  1ETW A;  4A3D J;  2ID3 A;  1ETK A;  1ETY A;  1QPI A;  1RR7 A;  5EG0 A;  1GV5 A;  3H0G J;  1WH5 A;  3WHB A;  3BR0 A;  1T33 A;  5EZG A;  3D1N I;  3W6V A;  1NK3 P;  3WHC A;  2FJ1 A;  3NAU A;  4C3J J;  3TP0 A;  2OPT A;  3K7A J;  5F04 A;  2MGQ A;  3GTM J;  1OCT C;  3GTL J;  3BR3 A;  2LD5 A;  3VPR A;  4D7N A;  2VKE A;  2LY9 A;  1X2N A;  4FIS A;  2E19 A;  5F0H A;  1JKP C;  1AU7 A;  5C4X J;  1MBF A;  2O7O A;  2ME0 A;  2HYJ A;  1ETV A;  4DYC A;  4S0H B;  4L5E A;  4JX4 A;  1AHD P;  2DA7 A;  5JLW A;  1ETQ A;  3PO2 J;  4UUS A;  2XRL A;  2L7F P;  5F08 A;  1RKW A;  3HM5 A;  1TWA J;  1FEX A;  2M2E A;  2NVT J;  4I76 A;  1JJ6 C;  1BL0 A;  1ZR2 A;  1OCP A;  3GTP J;  4MLO A;  3HOZ J;  5F0F A;  2JA5 J;  3BQZ A;  1RKT A;  2FD5 A;  5E3O A;  5M5Y J;  1LE8 B;  3JRD A;  5M5W J;  4J19 A;  3C2B A;  3G1O A;  1MBH A;  1ORK A;  1IRZ A;  1BW6 A;  3QPL A;  2VKV A;  5EEA A;  3FK7 A;  4MFD A;  4X6A J;  1G2H A;  3BG3 A;  4A3C J;  1S7E A;  2GBY A;  5E3N A;  2WAQ N;  3LSP A;  1U78 A;  4IHW A;  2DA5 A;  3B6C A;  1PUF B;  4M3B A;  4A69 C;  2LP0 A;  1AKH A;  2DA6 A;  4IHV A;  4A3G J;  3LSJ A;  2EZH A;  1Y1W J;  1NTC A;  5IOY A;  1MSE C;  3BR6 A;  4HNV A;  1TC3 C;  5K7Z A;  2D5V A;  2FX0 A;  1HLV A;  2EZI A;  5M5X J;  5EG0 B;  1BJZ A;  1JT6 A;  3OIO A;  2QF7 A;  1BA5 A;  2HOT A;  1IJW C;  2VI6 A;  3FIS A;  2ME6 A;  5IOZ A;  5EZH A;  1LE8 A;  3SFI A;  5FKM A;  3HGY A;  4D5C A;  1HCR A;  1IDY A;  4JX5 A;  4W1U A;  5DS9 A;  1ITY A;  2XPW A;  2YS9 A;  2Y31 A;  1T56 A;  3SDG A;  4UUT A;  4IHY A;  2R5Y B;  2K9S A;  2NOG A;  3A01 A;  3HOW J;  4JYK A;  3GTG J;  3S2H J;  1JUP A;  4C3H J;  4DZP A;  5C3E J;  2X48 A;  1X2M A;  3FKI J;  3Q0V A;  1EF4 A;  3S15 J;  2Y30 A;  3ZQI A;  1TWG J;  1YRN A;  1W0U A;  2JA7 J;  2N8G A;  2VUM J;  3PM1 A;  2DMN A;  2YUS A;  2IBD A;  3BT9 A;  2XGD A;  2DA4 A;  2K9Q A;  4QIW N;  3NAR A;  3PO3 J;  5IYB J;  1JUS A;  4B3A A;  5C4J J;  1TWF J;  5EF6 A;  4RDU A;  2DMU A;  2O8K A;  5BNG A;  5IPA A;  4V2F A;  1R9T J;  3HKZ N;  4BBR J;  2HDD A;  3TW6 A;  1SAN A;  4B1R A;  3LOC A;  4QTR A;  5J3L A;  2M0C A;  5M3M J;  3IV5 A;  2H1K A;  4FE4 A;  3ZQG A;  4IEJ A;  1IV6 A;  3G1M A;  2LLK A;  3JRA A;  1ETO A;  1OJL A;  2AO9 A;  5J1R A;  3Q0U A;  3JRE A;  2JWT A;  2B63 J;  3M3Y J;  4AUX A;  1JKO C;  2G0E A;  2QCO A;  1UMQ A;  5F27 A;  2R5Y A;  1VFC A;  1VI0 A;  2LKX A;  1XS9 A;  2L0K A;  4Y7N J;  4Y52 J;  3FIW A;  4M6V A;  4XRS G;  1AKH B;  2HI3 A;  1DU6 A;  2NS8 A;  1SFO J;  3CDL A;  1H89 C;  2RAE A;  2JA8 J;  1Q1V A;  3JR9 A;  2LTP A;  1JTY A;  4C2M J;  3A03 A;  3JRB A;  2ID6 A;  1F43 A;  1K61 A;  2EBI A;  2CJJ A;  3DCF A;  2DTZ A;  1HOM A;  4LOC A;  1B8I B;  2MSY A;  1QVU A;  2M34 A;  4MIM A;  3S2D J;  2JMW A;  2L7Z A;  1IGN A;  1QVT A;  3DEW A;  4W97 A;  3TP3 A;  1I3Q J;  1Z77 A;  2AHQ A;  5EYR A;  1IC8 A;  1CQT A;  2JJ7 A;  1ZQ3 P;  1P7J A;  4DYQ A;  3A01 B;  3HOV J;  1W0T A;  3MKL A;  1ETX A;  2DMQ A;  1WGX A;  2W48 A;  1FIA A;  3ZQC A;  1JT0 A;  1APL C;  5GPA A;  5FJ8 J;  1YRN B;  1ENH A;  5IP7 J;  2CRG A;  3BQY A;  1GUU A;  5EDN A;  3JRG A;  5FLM J;  3S16 J;  4XID A;  5C44 J;  1TWH J;  4B4C A;  1E3O C;  1XC5 A;  1IUF A;  2Y9Z A;  2CUF A;  2TRT A;  3BR1 A;  2DMT A;  1MBJ A;  1MSF C;  5IYC J;  4M3F A;  2KDZ A;  2VPR A;  3FK6 A;  2ZB9 A;  2CU7 A;  1MBG A;  2R5Z A;  1JUM A;  1B8I A;  4A3M J;  2DMP A;  2R93 J;  4XRM A;  3H3V K;  1I6H J;  1VF9 A;  2KT0 A;  3K2A A;  4RBO A;  3IH2 A;  3BR2 A;  1FTT A;  1QRY A;  3CMY A;  2DN0 A;  3OOU A;  4BY1 J;  3RQI A;  2NVY J;  2XPV A;  1U9N A;  4X1E A;  2HQ5 A;  4A3J J;  2CQQ A;  2XGE A;  5JLX A;  3L1P A;  4C3I J;  2NVQ J;  4D5F A;  3JRC A;  2E1O A;  1HF0 A;  3I4M J;  1F36 A;  2XB0 X;  3O8G A;  5FLV A;  1HDD C;  4XIC A;  1MBE A;  3OSG A;  1HDP A;  3IH3 A;  5FKL A;  1OFC X;  3S14 J;  2I10 A;  4A93 J;  3LSR A;  2JN6 A;  4MO7 A;  3QQA A;  3GTQ J;  3GTJ J;  4BXX J;  4AC0 A;  2L9R A;  4DW6 A;  3GTO J;  3S1Q J;  3ZQF A;  3RZO J;  1P7I A;  1MBK A;  4CYC B;  4DZJ A;  3BTJ A;  1WI3 A;  3A02 A;  3LNQ A;  3BG9 A;  2CQX A;  3MVP A;  1IG7 A;  1A5J A;  2Y0S N;  4BY7 J;  2IEK A;  1FJL A;  2R0Q C;  4FE7 A;  4JP0 A;  2EZK A;  5GPC A;  3O8H A;  2EH3 A;  3Q0W A;  3HOU J;  5K7H A;  1U9O A;  2DA2 A;  2XPU A;  2COB A;  3HDD A;  4BKX A;  3S17 J;  1GV2 A;  2LFB A;  1JKQ C;  2LR8 A;  2O9L A;  1K83 J;  3HB9 A;  2EQR A;  4M3G A;  2YU9 J;  1A6I A;  3BTI A;  3M4O J;  2OF7 A;  3RZD J;  4DYR A;  3JRH A;  3F0C A;  4MFE A;  1JTX A;  5EGO B;  2JK3 A;  1D5Y A;  3GTK J;  1LFB A;  1I50 J;  2FQ4 A;  2K40 A;  1WCM J;  2Y9Y A;  3CQZ J;  2E2I J;  2R5Z B;  3B6A A;  2HOA A;  2K9N A;  3HGG A;  5F1J A;  4CYC A;  5FKO A;  2CUE A;  3JRI A;  2L7M P;  3I4N J;  2MW8 A;  2EZL A;  2Y2Z A;  4G12 A;  3HEF A;  1H88 C;  2LVS A;  4V2G A;  9ANT A;  3G1L A;  3LSG A;  1FIP A;  4GFB A;  5J1Y A;  2R92 J;  3BR5 A;  1RPW A;  4M3D A;  3ZQH A;  4A3I J;  2DJN A;  2GLO A;  3Q3S A;  1ZGW A;  5M3F J;  1U8B A;  2NVX J;  4BBS J;  1WPK A;  2H8R A;  2E2J J;  3GBG A;  4ABZ A;  1ZK8 A;  5IP9 J;  3CCY A;  1H8A C;  1WH7 A;  5E3M A;  2ELK A;  2XB5 A;  4XK4 A;  3HBL A;  1GT0 C;  1Y1V J;  1ZKG A;  1RES A;  4QSH A;  5EGO A;  3S1M J;  2PMZ N;  3BTC A;  4A3L J;  2XSD C;  5GP9 A;  2ECB A;  1Z0X A;  4FCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...