1PUFA

Crystal structure of hoxa9 and pbx1 homeodomains bound to dna
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
NNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(*AP*CP*TP*CP*TP*AP*TP*GP*AP*TP*TP*TP*AP*CP*GP*AP*CP*GP*
publication title STRUCTURE OF HOXA9 AND PBX1 BOUND TO DNA: HOX HEXAPEPTIDE AND DNA RECOGNITION ANTERIOR TO POSTERIOR
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2003-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1pufA00
1A5JA 2ZB9A 5C4XJ 3FK7A 4B1RA 4QIWN 4A3BJ 1NK3P 4DW6A 5EEAA 3S2HJ 2Y0SN 2HXOA 2KT0A 5FKMA 1NTCA 3ZQHA 1JUSA 3Q0WA 4DZJA 1VF9A 2E1OA 3B6AA 4A3JJ 3FISA 1JKOC 1OCTC 2FJ1A 3GTPJ 1WI3A 4DZPA 2DA3A 5FJ8J 1ZR4A 1U9NA 1MH4A 3GTJJ 3BQZA 3GTLJ 5IYBJ 4BBRJ 4V2FA 3BTJA 1QPIA 3NARA 3BT9A 2H1KA 1ETYA 4BXXJ 1ZGWA 3S15J 1LE8A 2DA2A 4A93J 1U78A 4D5FA 2ID3A 1BL0A 4AC0A 3FKIJ 5K7HA 3GTMJ 1P7IA 3HDDA 2L7ZA 4C3JJ 1JT6A 5FKKA 2LD5A 2L9RA 1JKQC 1F36A 3WHCA 4XK4A 2XB0X 4QTRA 3OOUA 2R5YB 2GM4A 3E7LA 1TWHJ 1RR7A 3W6VA 2OPTA 5F04A 2M9HA 2JA5J 3GTOJ 1Z0XA 4UUSA 1QVTA 1U9OA 3C2BA 2X48A 3G1MA 2NVYJ 9ANTA 3JRIA 3A03A 1ETKA 3LSJA 1Y1WJ 3CMYA 1IDZA 1FIPA 4BKXA 2VKVA 1IC8A 2VPRA 1U8BA 2TCTA 1W0TA 1I50J 1TWFJ 3ZQGA 1ZTRA 3QPLA 1BA5A 2EZLA 2XB5A 5F08A 2OF7A 2VI6A 4RBOA 1IJWC 1Q1VA 2YS9A 5FKNA 4B4CA 4DYRA 3S2DJ 1LFUP 5M3MJ 4W1UA 5E3LA 5E3NA 3D1NI 3TP0A 2I10A 1WH7A 2MW8A 4I6ZA 1WGXA 2DA4A 5FLVA 2Y9YA 3A01A 1YRNB 3Q0VA 2TRTA 1MH3A 3JRFA 1MSEC 3Q3SA 2LR8A 3G1OA 3QQAA 2E2JJ 2EZIA 1JUMA 3S17J 1X2NA 3PO2J 4A3CJ 3PM1A 3TP3A 2ELKA 2B63J 3FIWA 1RESA 4S0HB 4A69C 4C3HJ 3JRAA 1ITYA 1MNMC 1RPWA 3LOCA 5FKLA 1B72A 3B6CA 4CYCA 3ZOBA 4M3GA 5F0HA 1H8AC 1JJ6C 1FEXA 1PUFB 3JRDA 2DMQA 3S1QJ 1ETOA 1S7EA 3BR3A 4B3AA 1OFCX 2DMTA 3HB9A 2JA7J 2EQRA 3GBGA 1IGNA 3S14J 3TEDA 2DJNA 5EYRA 2NS7A 2Y31A 5FKOA 2R5YA 3H3VK 3F0CA 1ETQA 2CUEA 2L7FP 1JKRC 1X58A 4BY7J 2CU7A 3GTGJ 1RKWA 5IP9J 1Z77A 4A3IJ 2NVTJ 2R93J 2WV1A 1APLC 4A3MJ 1B8IB 3HM5A 3Q0UA 1MBFA 2HI3A 1AKHB 2K9SA 3BQYA 3JRGA 2EZKA 1A6IA 3LSRA 4IHXA 5M5WJ 2H8RA 3UKGA 4MIMA 2RAEA 5IYDJ 2R0QC 1UMQA 2DMUA 4M3BA 1H88C 3NAUA 5M3FJ 3HOZJ 1ENHA 1JTYA 2O9LA 4QSHA 2P81A 4NDLA 2JN6A 4XIDA 4D7MA 5DTDA 5F27A 3WHBA 3RZDJ 3A02A 2M34A 1YRNA 1TC3C 3HOUJ 2CQXA 3K2AA 4IHVA 4V2GA 2JMWA 3QPSA 2D5VA 3IH3A 3BG9A 5E3OA 1XS9A 4MO7A 2COBA 1FIAA 3HKZN 1JTXA 3DCFA 3I4MJ 3ZQFA 3JR9A 1FJLA 2WAQN 3GTKJ 3G1LA 2R5ZA 4Y7NJ 4A3GJ 1AU7A 1GVDA 2LVSA 4D5CA 4D7NA 5EG0B 4MFDA 3HOXJ 3IV5A 2DMPA 4X1EA 3ZQLA 3JRHA 5DS9A 4X6AJ 1HOMA 1PUFA 1MBKA 2DA7A 1JKPC 2CQQA 2HYJA 1ORKA 1Y1VJ 3HEFA 3HGGA 4JYKA 4A3KJ 4A3LJ 1IUFA 4IEJA 3BR6A 5EZGA 3OIOA 5J3LA 1IRZA 2K40A 2O7OA 2IAIA 2LP0A 1FTZA 2AHQA 2DTZA 4Y52J 2M2EA 1HF0A 2CJJA 1ZKGA 4ABZA 3LNQA 1I6HJ 1HDDC 1GUUA 3GTQJ 2XRLA 4C2MJ 2LKXA 2HDDA 2XPUA 1RETA 2NS8A 3OSGA 1BW5A 2AO9A 4J19A 1P7JA 5F0CA 1MBGA 4L5EA 2GBYA 3LSGA 4M6VA 2NOGA 1LFBA 3LSPA 1VFCA 4GFBA 1B8IA 1AKHA 1MBJA 3BTIA 5M5YJ 1X2MA 4M3EA 4RDUA 2FD5A 1GV5A 2YU9J 4FE4A 4JP0A 2N8GA 2ECBA 4LOCA 5EF6A 2MGQA 2DA5A 1BJZA 2LY9A 2DA6A 3HBLA 1GDTA 5IYCJ 3SJMA 4W97A 4XRMA 4G12A 5EDNA 1IV6A 1SFOJ 1JGGA 1GV2A 1T33A 1UG2A 4XICA 1ETVA 5EGOB 2MG4A 2JJ7A 4FISA 5FLMJ 3S1RJ 1POGA 4A3EJ 3BR5A 1G2HA 1I3QJ 2K9QA 1D5YA 1K83J 3PO3J 1VNDA 2HXIA 5K7FA 3JREA 5HODA 2HQ5A 3M3YJ 1OJLA 4MLOA 3TW6A 1XG1A 2QCOA 2JA6J 5F0FA 3RZOJ 2XGEA 2QF7A 3CCYA 1EF4A 4FCYA 1SANA 2LLKA 2ME6A 3BR1A 4C3IJ 1TWCJ 3JRCA 4AUXA 2Y9ZA 2E19A 1FTTA 1QRYA 3HGYA 5IP7J 3HOYJ 2MSYA 1MBEA 2ECCA 1GT0C 2IEKA 5K7ZA 3K7AJ 5C4JJ 1WH5A 5GPAA 3MKLA 5J1YA 4XRSA 2L7MP 2PMZN 3IH2A 1T56A 4BBSJ 3ZQCA 5GP9A 2M0CA 3IH4A 3O8GA 5JLXA 4XRSG 3I4NJ 1QVUA 2VUMJ 3HOVJ 3CQZJ 2CUFA 1ZR2A 2KDZA 2ME0A 3BTCA 3OSFA 1B72B 2HOSA 4CYCB 1CQTA 3JRBA 2EBIA 1ZK8A 1DU6A 2WB1N 3MN2A 2X6OA 2XPVA 5C44J 3H0GJ 4AYBN 2Y2ZA 4EEFG 2DN0A 1MBHA 2E2HJ 2LFBA 1IDYA 2Y30A 2G0EA 1K61A 2ID6A 3O8HA 5EZHA 4UUTA 4HNVA 4FE7A 2XPWA 4M3FA 3VPRA 4DYCA 2LTPA 1WCMJ 2R7ZJ 2GLOA 1UHSA 5J1UA 2HOAA 1TWAJ 1ETWA 2JA8J 4FTHA 2JWTA 5E3MA 5EGOA 4JX5A 1HDPA 2EH3A 2XSDC 4IHYA 3BR2A 1BW6A 3BG3A 1VI0A 3ZQIA 3L1PA 1NK2P 1WPKA 3S16J 3BTLA 5F1JA 2X9DA 1F43A 2EZHA 2M8GX 1LE8B 4BY1J 1RKTA 2R92J 1R9TJ 1XC5A 2JK3A 4M3DA 5IOYA 1AHDP 1E3OC 4A3FJ 2K9NA 5IOZA 2CRGA 1HLVA 2HOTA 4IHWA 4I76A 5IPAA 4UUSB 1ZQ3P 5BNGA 3BG5A 2R5ZB 2VKEA 2O8KA 1MSFC 3FK6A 2NVXJ 2YUSA 5GPCA 3MVPA 3RQIA 2IBDA 1JT0A 3M4OJ 1OCPA 2DMNA 2DA1A 2L0KA 3DEWA 5JLWA 5J1RA 3BR0A 2NVQJ 4JX6A 3S1NJ 2W48A 3SDGA 1ETXA 5C3EJ 4A3DJ 3CDLA 3S1MJ 2LK2A 4DYQA 2XGDA 2FQ4A 3HOWJ 1JJ8C 5EG0A 1O4XA 2XGCA 1DU0A 1H89C 4MFEA 4JX4A 1W0UA 2E2IJ 2FX0A 1IG7A 1HCRA 3TW7A 5IP6A 5M5XJ 3RKQA 1TWGJ 3SFIA 3A01B 1JUPA
chains in the Genus database with same CATH superfamily
1Z6RA 3MZYA 4ZDPA 2TDXA 2P5LC 1NK3P 5EEAA 3S2HJ 2CV0A 2HTJA 3SEQA 2KT0A 2RN7A 2P6SA 3DF8A 2R7VA 4HOBA 1JUSA 2RDPA 3EUHC 3HZJA 5CQGA 1J5YA 2IA0A 3ML6A 4A3JJ 1B1BA 3FISA 1JKOC 4RGUA 1PYVA 3KP2A 4S04A 3GTPJ 1ZR4A 4EJVA 5FJ8J 4IVNA 3BP8A 3BZ6A 3KIOA 2DYRH 3MZ8A 1P2FA 4J01A 4NHJA 3GTJJ 3S2WA 3IAS2 2F5FA 4EM0B 3GTLJ 4V2FA 4UNOA 1MMAA 1OQYA 1FYLA 1D5VA 2H6CA 4ZYAA 3E5QA 1ZRCA 2FA5A 1ETYA 2VBXA 4NUBA 1LE8A 1U78A 4D5FA 1MMNA 1BL0A 1BI2A 4CICA 5K7HA 4BE0A 4G7HF 3HDDA 2L7ZA 3GTMJ 4C3JJ 2IS1A 2HYGD 3KZYA 2EFNA 4AIDA 4CCMA 2L4MA 2G9WA 4GYGA 4HAMA 4XK4A 2RGVA 2GM4A 5LLQA 3E7LA 2OA4A 4RS8A 3LA7A 5ICFA 3TDUC 2OPTA 1D3YA 3D0SA 2BVMA 5DM7F 2WAFA 5EEGA 3CD6I 2HDCA 3ABMH 1Z91A 1TP4A 1YYVA 2E35A 5B3SH 2XDVA 3A03A 4XOTA 3CF5F 1FOWA 2P5KA 2VKVA 2A05A 2D1HA 2BHZA 2TCTA 1W0TA 4HZFA 1XGSA 2IGNA 2XC7A 2XGXA 2EZLA 3I9V2 2XB5A 4BQOA 1IF1A 2VI6A 4BXFA 1DGRM 1PUEE 1Q1VA 2VKDA 3GLXA 1E2XA 4KIBA 3S2DJ 5FRMA 5E3LA 3D1NI 4OMZA 4CH7A 4L0ZB 1H9GA 2W82A 1WH7A 1D0YA 1T0FC 2FF4A 3WU2C 4AVPA 4IHTA 2R7FA 4I6ZA 3MFKA 1Y8RB 3CO6C 2DA4A 3Q0VA 1E0EA 1S72I 2GQQA 4EGZA 1TQIA 3FXRA 3VYTB 2IA1A 1J75A 2XASA 2EZIA 4I02A 3LAPA 3QOPA 1R1VA 3LFUA 3NEUA 2B63J 1XSVA 1QGPA 4C2UA 1Z1DA 1NHAA 1HXDA 2H6BA 1FP2A 4S0HB 3E97A 4C3HJ 1DUXC 5FKLA 4RAZA 2VOOA 1B72A 2JRMA 3B6CA 2OV7A 3GYHX 4IXAA 3S1QJ 5KCMA 5LGTA 1IZ1A 1IRGA 5TRDA 2DK8A 1RNLA 1V54H 1WHUA 2QVOA 4Q4ZF 3WODF 1OFCX 2V9KA 4KISA 2IS2A 3B02A 4IHSA 2JA7J 3GBGA 1ZRDA 4PFPA 4CCKA 1X1CA 3DKWA 4QPQA 5FKOA 2R5YA 1FOYA 5FO5A 3RYRA 2M30A 4XN0A 4RB1A 2L7FP 4BL0B 2LC2A 4C9YA 3WTSC 2V9VA 4HDUA 1XGNA 5JVGF 4A6DA 2CU7A 2DPUA 3E3VA 2IS6A 5IP9J 4IQ4A 3FHNA 1Z77A 5E8GA 2XRNA 3PFYA 4ZZLA 4F92B 2NVTJ 3CC2I 1Z21A 4A3MJ 1VZ0A 1X1PA 1B8IB 2QZ8A 1AKHB 4DBQA 3OS0A 1SVOA 2HZDA 3JRGA 1T08B 4ZYHA 3CC7I 4OINF 2H8RA 2LKSA 3UKGA 4MIMA 4IHXA 1SD4A 4AIJA 4LLNA 4YFKF 1H88C 3HPHA 1Z05A 3HOZJ 2O0YA 2BGCA 1ODDA 3G71I 5D6FA 4G7OF 1R4MB 3ZMVA 4NDLA 3V8KA 2PG4A 3ZMTA 2F48A 5F27A 4U88A 3ECOA 3RZDJ 4G6DA 2M34A 1TC3C 2CQXA 3PJRA 2QKLB 2VJIA 3OWTA 5HS7A 1DPRA 1G3TA 1IRXA 3QPSA 1S3JA 1FBSA 1KYZA 3O2PE 4XMYA 3ZN1A 1XS9A 2KJCA 5HLIA 1IV8A 4C2TA 3JW4A 4Q47A 5FFXA 1QNTA 2GAUA 4IL6C 2WY8Q 2R7QA 1ZN2A 2FNPA 2LSOA 2L4AA 1ZGAA 5HNFA 3IAM2 4N9HA 3F72A 2EK5A 3HL2A 2KLOA 4OMYA 2DMPA 4NC7A 1YITI 1PUFA 1MBKA 5DEQA 2DA7A 4U0YA 1ORKA 1Y1VJ 2DFFA 4XQFA 2WAEA 1SD5A 4M74A 4MTEA 3T8TA 3WG9A 5K5OA 3H36A 4I0AA 4PJLA 1FC3A 2F5DA 2O7OA 3OYDA 2HQAA 1R4NB 2AHQA 2HFHA 1JXSA 2DU9A 2M2EA 3H9GA 3JTHA 2X1DA 5CLSA 2K3PA 3LNQA 4BH9A 1ZG1A 2STWA 4RAGA 5BMZA 1GUUA 4KMFA 3I54A 3DU6A 1T98A 3VYSB 1RETA 4D9JA 2P8TA 5A2QK 2AO9A 2QQ8A 4HQMA 3BC8A 3L2UA 3CUQC 1JE8A 2BV6A 3PQKA 2NOGA 3OV8A 3AG1H 3I64A 4U87A 4ZZDA 5FB2A 4Q48A 4BEHA 5E17F 5KK1A 2FD5A 2VT3A 2A6EF 4JP0A 2ECBA 3KEOA 4RLQA 1S6LA 2DA5A 3BOQA 2CH0A 2FRHA 4UB8C 2NRAC 2E36A 1VQOI 4YFNF 4YIIA 3AG3H 5IY5H 5J4YA 4BAYA 5L3DA 5FRNA 1A31A 3ZRGA 1FYMA 3K0LA 3J7AO 1R1UA 1XDSA 1GV2A 1G6NA 3ZPLA 2MG4A 2JJ7A 1DQUA 3I5UA 3TL4X 4JQFA 3BCBA 3P9CA 2A5WA 1I6XA 3QYEA 1YIJI 3ZMUA 4YIRX 4R79A 4H4KC 1LQ1A 1FT9A 4WCGA 3PO3J 3LL7A 3K4MA 2HXIA 1HA8A 2BW3A 3HTSB 4A2UA 5HODA 4ON0A 1O57A 3ERMA 1B59A 2HQ5A 1EA3A 3GFJA 3M3YJ 3LSTA 3M8EA 2XF7A 1OJLA 4MLOA 3EUHA 3TW6A 5D8LB 2QCOA 2R7UA 4CA0A 2QF7A 1RIOH 1EF4A 4B44A 2IP2A 5E18F 3CCQI 4FCYA 4G6QA 4E7JA 3EETA 2VQGA 1T39A 1X4PA 2ISYA 2VBYA 2BY0A 2Y9ZA 2FOKA 3NWTA 4HV6A 2HQRA 1IN6A 1QRYA 1TW2A 1WQ2A 3DLLF 1MBEA 1EH8A 2ECCA 2HZTA 5C4JJ 2VKHA 2ZFUA 1YW8A 3MKLA 4XRSA 2VPLA 1FSHA 2VXZA 1K7AA 4KN7X 3O8GA 4HA8A 2R7OA 5JLXA 4A5MA 4HW0A 3HOVJ 3CQZJ 2VBWA 4IQJA 3PSFA 3KZZA 3NWSA 2ME0A 1AWCA 2XAGA 3OSFA 3RCOA 4F93B 2HOSA 1Z9CA 2D45A 2EBIA 2VONA 3F3XA 2BHYA 4UXNA 1DU6A 2W85A 4QPOA 2XPVA 5CVUA 1SC7A 1P4AA 4BUPA 1T2KA 2MH2A 4PJ0C 4EEFG 5DD8A 2EB7A 5LGNA 4E70A 1LDDA 4I01A 2XUBA 2HOEA 5D4SA 2QGUA 2VL8A 5EZHA 1FMWA 2PJRB 2K7LA 1LJ9A 5H6RA 2E34A 2EFPA 4BYYA 1JHHA 3I58A 4CCOA 2XPWA 2L54A 4RB3C 5KAFC 2R7ZJ 1P4XA 2V26A 1F5TA 2XVCA 4FQGA 5J1UA 1TWAJ 3E6DA 2WWYA 2L9SA 5K1YA 3HXLA 2LF8A 1W7PA 3EQLF 3I59B 1X19A 3EUAA 4II3A 3TBIA 4IHYA 4U0WA 1XMAA 1YOVB 2VLAA 1HKQA 1SMYF 3ASNH 1BW6A 3BG3A 1VI0A 1NK2P 4Y15A 3RTRA 2VT2A 2Y75A 5F1JA 4GRIA 4RGXA 2EZHA 2DW4A 4ZTJA 5JR3A 1RKTA 2K27A 3DV8A 4CXFA 2Q2EB 3VFZA 3DKXA 3J7YJ 3CJQB 3K1NA 5LHGA 1XMKA 2EILH 2JVGA 3BJOA 1Z6TA 3MZHA 3MMYB 4A3FJ 4L9NA 4HX4A 3OS1A 2HOTA 4RGSA 4IRIA 3SZPA 3MCZA 3R60A 1QHGA 2UUZA 3ZMSA 5LHHA 5IPAA 2Q1ZB 5D5WB 4UUSB 2C6YA 1ZQ3P 4ZDLA 3S8PA 2FE3A 2FOWA 1ZLJA 3EYYA 4XSZF 1O3TA 4LG0A 3C7JA 1UHWA 2NVXJ 3J7AY 2OU2A 2YUSA 3F6OA 3MVPA 4CSWA 2Q8KA 1B6AA 1K4SA 1RUNA 2R7SA 3HRMA 3HRSA 4LITA 3H5RA 2W48A 4G8XA 2K5CA 3KE2A 1ETXA 1P92A 3SDGA 1VQ9I 3RYPA 3CJNA 1Y0NA 4I09A 4A3DJ 3S1MJ 3DFGA 1WVRA 1A6QA 1X1BA 5EG0A 4XLFA 3IUOA 2ZNZA 1H89C 4HDVA 2LF7A 4MFEA 1L3LA 1ONVA 4UB6C 3TW7A 5IP6A 3QPTA 2JPBA 4RB0A 1OCCH 1U5TA 2LY2A 2ZB9A 4UVCA 3RPUD 3CCMI 2HVRA 4A3BJ 4DW6A 2Y0SN 1K4TA 2ZMEB 5FKMA 1R5GA 1IXRC 4J00A 4DZJA 2VQHA 2E1OA 3B6AA 5E79C 5DUIA 1A35A 4FX0A 3TDZC 3HSEA 2PQ8A 3L00A 4DZPA 2DA3A 1W5TA 3G6EI 3CCVI 1ZG5A 1TQMA 2HPIA 1U9NA 2CFOA 2IGOA 1BJAA 3BG6A 3M7GA 1N77A 3TOBA 3WGGA 2E1CA 1BC7C 4OIOF 4RAYA 5CQEA 1YLFA 2VQLA 5IYBJ 1QPIA 3NARA 3ABKH 3GXOA 2KHMA 4GCVA 4BXXJ 3S15J 4AYBA 4P9FA 4F7ZA 3CCSI 3K4KA 3X2QH 3R6SA 4NB5A 4B47A 1XMXA 3FKIJ 2UWMA 2L9RA 4B8XA 1JKQC 1J09A 2KIFA 3WHCA 2XKPA 3K69A 1RR7A 3CCRI 2M9HA 2JA5J 1SEUA 2LMDA 2Z9OA 3GTOJ 2JRTA 1VTNC 1QVTA 1U9OA 2X48A 2K02A 3FXJA 2HS5A 9ANTA 4RGRA 1PP7U 2CW7A 4BNCA 2DAOA 1ETKA 2M4KA 2R7TA 2F4OB 3U2RA 3CMYA 4ENKA 2F6CA 4D1QA 2GA1A 3PNYA 4AIKA 4BHCA 4KT6A 4UV8A 3ZQGA 1ZTRA 3QPLA 1LFPA 2XKOA 2H09A 3D5LA 2OF7A 3PNTA 1XGOA 5HLGA 1IJWC 6PAXA 3BZKA 3CUQA 3GO5A 2H1LA 4B4CA 4WXCA 4W1UA 3K4JA 1WJ5A 4PZJA 4XOPA 3GFIA 4DIQA 4B48A 1YX3A 3LSKA 4U0VA 1YG2A 3DTIA 4YG2F 2M3AA 3FMSA 2CQ7A 1WI9A 5FLVA 4XKBA 2Y9YA 1XB4A 1YRNB 1K78A 1MH3A 3CMMA 3M07A 5ICCA 2BY3A 3M1EA 3I71A 1O3QA 5LD2C 2ZXWH 2LR8A 3QQAA 2A6TA 2R3SA 1EKEA 1JUMA 3CDIA 2HEOA 4XLEA 4FASD 3PO2J 4GXOA 1E3HA 1ZYRF 3SQNA 3CMAI 4IKFA 2HU9A 4OWRB 4LB6B 4QLCU 2DFIA 2ELKA 1Q1HA 5ED4A 1MW7A 1R5ID 4I98B 3JRAA 1ITYA 2B7EA 1MNMC 1RPWA 1YX5A 2JTVA 4CYCA 1XCBA 2QYOA 3KP5A 1T95A 1FEXA 3JRDA 2L2OA 3IWZA 2K85A 3K4BA 3KPHA 1JI8A 3P7NA 1S7EA 2IA2A 1K6YA 1TBXA 3BR3A 3CLQA 4B43A 1NG7A 3A2KA 3ELKA 3ZN0A 3DP7A 4ZYEA 4ESBA 2BE5F 2LKPA 2ZNYA 3CJTB 1IGNA 3S14J 1BM9A 2ZSIB 1FP1D 2DJNA 3AL0C 4IF4A 4LJZF 4YIFA 2CYYA 3L2WA 2Y31A 4XKVA 4B09A 2L01A 2V1XA 3KLOA 1T6SA 2XSJC 4PFOA 5ILUA 2B9SA 3IHUA 3WTVC 3CMEI 1I5ZA 2YSRA 5CKTA 2O03A 1X4OA 1X58A 3VYRB 3BG7A 1V3FA 2BXYA 4ESFA 2CV2A 3KCCA 1OR7A 3KYDB 1APLC 3IKVA 3HTUA 3LWFA 2R7RA 3FDYA 2HI3A 1FSEA 3SDBA 3KEYA 4PJMA 3O6BB 3FBNB 4L9VA 3BQYA 4OIPF 4HSTA 1SAUA 1A6IA 2STTA 3F8FA 2FXAA 1UFMA 5TGTA 3T0YA 2RAEA 5IYDJ 1BOAA 1UMQA 4AWXB 1FNNA 3NAUA 3OYKA 1OKRA 5M3FJ 1ENHA 2O9LA 3LSIA 1P6RA 4A6EA 2K9MA 5DCFA 3T5XA 1XSXA 2JZYA 2V6CA 4XIDA 5DTDA 4E4HA 5B1AH 3LA2A 4KYWA 2GZWA 1SD6A 4LGWA 2DFEA 2JVHA 3B73A 1YW7A 2D5VA 2DTRA 3ZMDA 3BG9A 2LREA 1LEBA 3OYIA 2ZFWA 4MO7A 5DYMA 1FIAA 3HKZN 1KQ9A 1JTXA 2RQQA 2Z2SB 3DCFA 3E5UA 3QP6A 3ZQFA 3JR9A 1EH7A 2ELHA 3ECHA 2WADA 1USSA 2ICWG 3G1LA 3GEZA 2FBKA 1NG6A 1ZG3A 5FLXZ 3DBLB 2JUCA 1GVDA 2Y69H 3CC4I 4WF2A 4XRFA 3GVAA 4WXHA 4MFDA 4A0ZA 2GIZA 3W2AA 4X1EA 1RC9A 3JRHA 5DS9A 3ZQLA 3F8BA 4CO8A 1A36A 2XAHA 2EA2A 3J80K 3HGGA 3R4KA 4IX7A 1WSUA 5JHUA 2M4GA 4A3LJ 2XF5A 1IUFA 2DO7A 3BJ6A 2QKMB 3RPQA 2QQBA 1TNTA 2MD0A 1K6OA 1Y8QB 1ZKGA 1PJRA 4ABZA 4HF2A 2ELJA 3JAMZ 4IRGA 4JBAA 1DP7P 4CHUA 3GTQJ 4C2MJ 2DOEA 4XNFA 4EMSA 4M72A 2FUG2 3MQ0A 3DBHB 2M7BA 2NS8A 4EV0A 5B66C 1HSTA 2X4HA 1P7JA 5KVRA 4L5EA 2GBYA 1NH3A 2DDAA 4M6VA 4BJ5C 3GF2A 2DPDA 1LFBA 3K70D 4GDFA 1B8IA 1KZHA 3GUDA 1QBJA 2QLZA 1AKHA 1MBJA 3BTIA 4XORA 4RDUA 3E0JB 2KRCA 2EPFA 3KFWX 1HKTA 2VXDA 3FXLA 2YU9J 1OYYA 1U0JA 4XLPF 4LOCA 4NQWA 5EF6A 2MGQA 1SFKA 2LRDA 5BPIA 1B4AA 1Y39A 5E8IA 2LY9A 2XAUA 3KLNA 4L0YB 5LFAA 4OU0A 3IRQA 1EH6A 1F1ZA 2ZMEC 1RRJA 2QBYB 3WU0A 2JA2A 2Z5UA 5EDNA 4EJUA 1SFUA 2QQ9A 2YX7A 3PQJA 2VC0A 4XR6A 1KQ0A 4EVIA 1FMVA 2EJRA 3UNGC 2M87A 4F91B 4FISA 5FLMJ 2W1OA 2E1MC 3BR5A 3DTEA 1I3QJ 2K9QA 2P4WA 3QODA 2Z33A 3QOEA 5KHDA 3G73A 1D5YA 1VNDA 5EEHA 1PVEA 4KFCA 1VQNI 3MEXA 1IXSB 2FSWA 3DXJF 1HKSA 1XG1A 5F0FA 3RZOJ 3R0AA 4JK1X 2OCEA 3CCYA 4WX9A 3H9QA 2NXNB 1YS6A 1SANA 3WGHA 4A0XA 1U5TC 4C3IJ 4AUXA 2L9VA 1FTTA 3N97A 3CESA 3DEUA 4HSRA 1GT0C 4O6JA 2IEKA 1WH5A 5BPDA 5J1YA 1CF7A 4S05A 4UUVA 1T56A 4BBSJ 3DQVC 2M0CA 3OIPA 4LK1F 3MD2A 2VUMJ 4R1HA 4HEA2 4F55A 2IS4A 3FXKA 3GZ6A 3EYIA 5L3BA 1B72B 1BOBA 1ZK8A 1KU7A 4BXUA 3E6BA 4HNTA 1LDKB 3H0GJ 4FX4A 1MMSA 2H8WA 1MMGA 3L09A 1IDYA 4BHPA 2DOAA 4LIUA 1YO5C 3O8HA 1K61A 4ZC3A 5D5XB 1DDNA 5J8CA 3M1CA 4M3FA 3TMOA 2G7UA 3HUGB 4A5NA 5GADJ 5HLHA 2LTPA 4P55A 3C2HA 4KITB 3WTYC 1BC8C 1J7KA 1ETWA 1FZPB 2DT5A 1G3YA 4AD9A 5L3EA 1QU3A 1XPXA 2ACJA 5E3MA 2X51A 4KUMA 5FROA 2EH3A 3KP7A 2XSDC 2JSPA 1G4DA 1MD0A 1MMDA 4OIQF 5JFRA 1D1BA 1MIJA 3A1YA 1WPKA 2CO5A 3BTLA 2ZXHA 1LB2A 1IW7F 1HW5A 4LK0F 1EV7A 2E7WA 2M8GX 4BY1J 1KYWA 3V7RA 2KMUA 2HNHA 5FD5A 2DODA 3KX2A 1GXPA 2ZC2A 3CP2A 5ERIA 2ADUA 1QQIA 1WJFA 3OYEA 5IOZA 3L9FA 2CRGA 3TO7A 1HLVA 2VB6A 5HS9A 1WJCA 2BOLA 4IHWA 4I76A 4GO1A 1TLHB 4D0PA 2VKEA 4EM1A 4XBFA 1MSFC 4KN4X 5D5VB 3K6GA 3FK6A 4RLFA 5DUKA 2P7CB 4PDKA 3RQIA 3OOPA 3WGIA 2EV5A 4ENMA 1OCPA 2DMNA 2L0KA 3DEWA 2LDUA 1YHQI 2AXLA 2GWRA 4JX6A 3S1NJ 1FX7A 2PEXA 5C3EJ 4Y33A 4HPQA 2VASA 2JT1A 1Z3YA 5J4VA 4ENJA 2FQ4A 5GAGJ 5K5QA 2QSHX 3HSRA 2X6YA 1O4XA 2X6WA 4RB2C 4PJNA 5J47A 2PJRA 5LEKA 2ZXIA 2FX0A 1IG7A 2W57A 3VWBA 5M5XJ 1EJ9A 2XAFA 2BY1A 3RKQA 2VC1A 4KICA 3A01B 4XN3A 1JUPA 2K4JA 4Z6YA 3C18A 1A5JA 2DT6A 5C4XJ 3FK7A 2DCEA 4B1RA 2K86A 1FOKA 3LSMA 4HX7A 3IC7A 4LFUA 1B9NA 2GXAA 5DCMB 2HXOA 1U6GA 1NTCA 2PMZA 3ZQHA 3Q0WA 2HDWA 2ZJRF 2VQCA 1XD7A 1OR7C 1VF9A 2A5YB 2JSCA 3FM5A 1W5SA 5CVRA 2CUZA 5HVQC 4XONA 3L2RA 2EIJH 1WI3A 1R22A 4BEHB 4H0EA 4EATA 3QPHA 4G9YA 4RAFA 3HRTA 3RIRA 2X1EA 2OZUA 3E1SA 4P1WA 3G4SI 1C0WA 1ZLKA 2A07F 1MH4A 3H9JA 3BZCA 2F4IA 5CVJA 3ZR8X 2CMPA 3BQZA 1LPQA 4BBRJ 3RI4A 1I39A 3C3WA 1I1GA 5GAHJ 3BTJA 2WB1A 4MHGA 2LH9A 1R36A 2WAQA 3WU1B 1VQ4I 1R23A 4DGWB 1ZGWA 4DQ2A 1R58A 2DA2A 3U9GA 4DBRA 4A93J 2Q2EA 2ID3A 1BI0A 4AC0A 1LVAA 1YJNI 2XIGA 1JT6A 5FKKA 4LLLA 4L9JA 1JHFA 1I1SA 1F36A 4I7HA 2HWVA 2DQRA 3R61A 3TKYA 2Z3YA 4E7KA 2XB0X 2F5EA 3L2VA 3W6VA 1LUJB 3C1DA 4OAZA 1QZZA 4UUSA 3C2BA 2Z99A 5J40A 2LBFB 4BE2A 5FFZA 5JHFA 2KFDA 3JSPA 4IOCF 4YFXF 3K4NA 3VOEA 1MNDA 2DDBA 1MZBA 1TT5B 3JRIA 1YI2I 5H6QA 1Y6IA 1H0MA 1IDZA 4BKXA 3E5XA 1IC8A 2VPRA 2QWWA 1SFXA 2CW0F 4N9IA 4ENNA 2M1BA 1TWFJ 3MAJA 2GOXB 3SZTA 3CCLI 2BY2A 4L9TA 1BA5A 1R00A 2HKOA 4AIHA 3CJRB 4RBOA 4PK4A 2YS9A 5FKNA 3HOTA 2RREA 3RKYA 4DYRA 1GXQA 3TGNA 3PNVA 5L3GA 5M3MJ 4MTDA 1LFUP 5E3NA 2OD5A 2GA2A 2I10A 3R0JA 2IXSA 2MW8A 2COMA 3IL2A 3L7WA 1PDNC 5F6FA 3JRFA 1MSEC 2LNBA 3Q3SA 3G2BA 2M0MA 3G1OA 4RM2A 3DEEA 2RNJA 5B1BH 3I56I 2WY7Q 1W1WE 2ZMEA 4BJTA 2CQKA 3S17J 4UVBA 4A3CJ 2CG4A 1XSDA 1HW2A 3SYTA 3HYIA 1FWZA 2Y48A 3BLYA 4GYIA 4II2A 3TP3A 2LOOA 2DYSH 4P9UA 3DPLC 3P9KA 2QSFX 1ZGJA 2EV6A 4CDGA 1WJDA 3H3UA 3F8MA 1V4RA 3DLAA 4TV7A 3CCEI 2NAZA 4LMYA 3D5SC 3LOCA 1OCOH 3KZIC 5F0HA 3WTWC 4CCNA 2DMQA 3KYLA 2A3SA 1SFEA 2FMLA 1FYKA 3GZNB 3Q5FA 1HW1A 3ESWB 1LVKA 2EQRA 2UXXA 1W7PB 3S3MA 4CCJA 3TEDA 3ASOH 3IRRA 3TOAA 2DK5A 3H3VK 3F0CA 4QWQA 1ETQA 1D8JA 2CUEA 3OR1C 2QEXI 2OTJI 1Z3XA 1S8NA 2HGCA 3TO6A 1RKWA 2HR3A 2RNGA 2A61A 1Z7UA 2V1DA 4PUSA 2OUMA 3MKZA 2WV1A 5DM6F 2R93J 4PSWA 3HM5A 3Q0UA 1MBFA 2K9SA 3WTZA 1ON2A 1SMTA 3TQNA 2ZXJA 1R5HA 2D2WA 4MQVA 5M5WJ 1K79A 2XROA 2R0QC 1MDMA 2DMUA 4M3BA 4ZDOA 1GLNA 1W5CC 3OYHA 4E6KG 1ZAOA 2WBMA 4XKWA 5LBQA 3LA3A 1QZEA 2P81A 1GHCA 1SVLA 2JN6A 2DJIA 4CZZA 2CWEA 3VEPA 4NC6A 3WHBA 1YRNA 1UJ8A 1REPC 3K2AA 2L3DA 4IHVA 4V2GA 3L2CA 2R7XA 4BGDA 4YEJA 4ZTFA 3IH3A 3SZGA 4M6YA 3AG4H 1WWXA 2P6TA 5E3OA 1RI7A 2IGMA 4YELA 2COBA 4Y17A 1J2XA 4BJ6C 3I4MJ 2ZSHB 2WAQN 2F2EA 3CCUI 3HC7A 4KA4A 2D1VA 4ASNA 2R5ZA 2QENA 3FHZA 3W6KB 4D7NA 4I99C 3GZ5A 5EG0B 3T1BA 4L18B 1KU9A 4A12A 3E6CC 3HOXJ 1J0RA 4ZJZA 2E5NA 3PIOF 1IRFA 4UV9A 2AXTC 3HEFA 4JYKA 2GIVA 4LD5A 4KIGA 2PJPA 1YIOA 3BR6A 5EZGA 1BR2A 3OIOA 4PGGA 5J3LA 3C2GA 2WA0A 2K40A 2IAIA 1WKMA 2V7FA 3Q9VA 1FTZA 2XAQA 4Y52J 1XDUA 1HF0A 2CJJA 3F8NA 4BDZA 3LQQA 2KPMA 1I6HJ 3RKWA 2KIQA 2XRLA 3PL8A 2OBPA 4E7LA 2HDDA 4DJAA 2LYCA 1QO0D 3VYUB 2XPUA 1XCVA 3DBRB 2L02A 5LEJA 1T38A 1UELB 3NRVA 2MLKA 2VE8A 3K1PA 3FF5A 5HDKA 1XX5A 2M45A 2HQNA 4AU7A 2XHKA 1YJ9I 4GFBA 4IOAF 2W00A 3I53A 1O7LA 1VQKI 2L5QA 3PFIA 3OYLA 1J9IA 4XM3A 2DQLA 4C30A 1X2MA 5M5YJ 3I55I 1MJAA 1GV5A 1IAWA 4AM3A 4FE4A 2N8GA 2EV0A 1HQCA 4HLYA 5LGUA 2O6GE 1TL8A 5CVVA 2DA6A 2FEZA 3HBLA 3CLOA 4M9XA 4ESJA 1BR1A 2H94A 1ON1A 5IT9K 1D0ZA 1AA7A 4W97A 1DPUA 1IUYA 1ZH5A 2MC4A 2JPCA 1YJWI 1JGGA 4G7ZF 5L3FA 2NNNA 3W6JB 2AS5F 3CDHA 2DOFA 3T8RA 2PN6A 3E6MA 1ETVA 5EGOB 2AQFA 4E7SA 1TZLA 2ZO4A 1ZARA 3O3KA 1POGA 2KISA 2L9NA 3K4CA 2DXIA 3COAC 4WXDA 3A4CA 1K83J 3H5AA 3SXYA 1HSJA 5K7FA 3MWMA 2E7XA 3I3LA 3JREA 2DT7B 2QQAA 1IXCA 2GXBA 3RSNA 4R8HA 3OYMA 4HRIA 3ZGKA 3H0DA 3HG9A 5TJJA 5IT3A 5HOOA 5KNLA 2LLKA 3FX3A 1R71A 1F4KA 1K78B 3LMMA 3BR1A 4M71A 3V7CA 3JRCA 1S7OA 3LQRA 2Y0MA 4MEXF 1X3UA 5IP7J 4N4NB 2MSYA 4V19K 3H92A 2ETHA 1W36D 2AQEA 5A2QZ 1ZHFA 1Y0UA 4FETA 3QP5A 2L7MP 5JVTA 5GP9A 3FMRA 4ZH4F 3P5JA 1N75A 2VJ5A 4XRSG 4NC8A 4F3QA 2UZKA 3I4NJ 1V55H 3F22A 4CZCA 4CCLA 2HYFA 4BE1A 2IVMA 1KU2A 3BTCA 4XSXF 3V42A 4AVZA 3HSFA 4CYDA 2ZJQF 3FXQA 1OPCA 4CYCB 1OYWA 1QA6A 5BOXA 3H5NA 3GCMA 4ANJA 2X6OA 1OCZH 2DLLA 2V4JC 2W24A 4IZZA 2BXZA 3FKJA 4AYBN 2ZKZA 1M1EB 2EWNA 3M8JA 3ABTA 2DN0A 1G59A 1MBHA 1BN5A 2CW8A 1S5LC 2KIMA 1Y56A 2MYSA 3DU5A 4UUTA 4HQEA 4HNVA 4FE7A 4L5IA 3ZXSA 5ICGA 3VPRA 1E17A 4DYCA 3F9KA 2FBIA 2PI0A 1I27A 2QBYA 3M9AA 2GLOA 3PSIA 2M8EA 3RQ4A 2HOAA 1ULYA 3JTGA 2OTLI 2OAZA 3QAHA 2ZJPF 2EIMH 4FTHA 2JWTA 2IT0A 2P5VA 4PJJA 1YW9A 4JX5A 1HDPA 1MGTA 2CQNA 2KZGA 2LY1A 5HLTA 3CO7C 2MABA 2Z16A 3WTUC 1Z67A 4N0BA 3L1PA 1X1DA 2PLYA 3S16J 5FD6A 3QU6A 2GOMA 2EFQA 5HDNA 1V5FA 1LE8B 1OLTA 3F6VA 4ZYDA 1ZREA 1IN8A 2K4BA 3OS2A 3GFMA 4M3DA 3OL3A 2PFBA 4BACA 4EGYA 4IJAA 1G3WA 1W36C 1AHDP 3PUBA 4GGGA 4HG2A 1SVMA 1YTYA 1UHMA 5CVIA 5L3CA 3VODA 1SAXA 4KIFA 2F4MB 5H2FC 1ERDA 5BNGA 3BG5A 4E7ZA 2O8KA 4NNJA 1D1CA 3OYJA 3GMEA 3GWZA 3BPXA 3V7SA 2ESNA 4IPAA 2IGKA 1JT0A 3J81K 4HF1A 3M4OJ 5LRRA 2DA1A 2WTEA 5JLWA 3BR0A 2ZBKA 2NVQJ 4HF0A 4BQAA 3OYAA 3CDLA 4M6XA 1R49A 3MKWB 1QZYA 1MJBA 4YRVA 3F23A 2QSGX 1Z7LA 2XGCA 3ZQ7A 1DU0A 4M9SA 4JX4A 1W0UA 3WTXC 1QPMA 1TWGJ 2EA4A 2JQ7A 3HUGA 2J5PA 2LG4A 1GVJA 3CCJI 3D5RC 1LDJA 4N4OB 4PSXA 1PP8F 1FPQA 4QIWN 3RDIA 2K3FA 5BS6A 1KU3A 4NBQA 1LKXA 2KZVA 3S3OA 1DP3A 4ZYGA 1LNWA 2P0WA 2CUJA 1OCTC 2FJ1A 5GAEJ 2BEOA 2RC4A 1V5EA 3WTTC 4UY8I 4NQWB 3S93A 1A04A 3IKTA 1R6RA 3ZQQA 2R7WA 3BT9A 4PCQA 2KL4A 5E1ZB 1U2WA 2H1KA 3K70C 2KKOA 4L5JA 3VSKA 4K2EA 4M73A 4DNCA 3V8JA 1WJAA 4Z2YA 2VN2A 2W25A 3VSLA 3KP4A 4G94A 1T8IA 1P7IA 2HPMA 5AIPA 2LD5A 5K5RA 2WC2A 2Q0OA 4QTRA 2K9LA 2A68F 3OOUA 2PX9A 5H20A 2IW5A 2X0LA 2R5YB 1TWHJ 1VQ6I 2MLGA 1X3ZB 3HOSA 2KIUA 3BWGA 5F04A 3BDDA 1WJBA 2UV1A 1Z0XA 5HNHA 1OMIA 2MBFA 1TW3A 5GTHC 1KQ8A 4MQ9F 3G1MA 1L0OC 2NVYJ 4UVAA 1VQLI 1FOXA 2MD5A 3L2QA 1E3PA 3HIFA 3LSJA 3ONQA 5CYVA 5LHIA 1Y1WJ 1FIPA 2YPRA 3RPUA 2MA3A 1U8BA 2FNAA 2EFWA 2NOJB 3V8LA 1I50J 5ILSA 3OYBA 2BVLA 3I0TA 4UHTA 2EFOA 2FU4A 5F08A 1KONA 1P4WA 5BQTA 2O8XA 3WE3A 2QA4I 2VOPA 1WJEA 2VJJA 1CF7B 2CGPA 3TP0A 1TTYA 1TQPA 5JI6A 3WE2A 4X0GA 3H1CA 2XF6A 3KETA 1WGXA 3A01A 2RVCA 2VJ4A 1N25A 2TRTA 3G3ZA 3M8FA 2OQGA 4KT5C 5AIQA 5DV5A 2EINH 5DCMA 2PMHA 3HJEA 4I2OA 3FXMA 2E2JJ 2H27A 3GFLA 2OZ6A 1X2NA 1D8KA 5F64A 1O3SA 1FLIA 3PM1A 3EDPA 2ZJ2A 1IN7A 3BCAA 3FIWA 1RESA 3EUKL 4A69C 3FBIB 3CP8A 1YS7A 1N78A 2JUGA 1LEAA 3AG2H 4M3GA 3ZOBA 3WG7H 1JJ6C 1H8AC 1PUFB 4G6TB 1ETOA 4HYEA 4WK8F 2XAJA 3I4PA 4Y3OA 4B3AA 1VQ7I 3GX4X 1CGPA 1STZA 5FLXK 2DMTA 3HB9A 4E7IA 2NNYA 5KAIC 4KNYA 5EYRA 2KRHA 5E1WA 1R1TA 2NS7A 5GTIC 3OL4A 1VQ5I 2YX4A 5AONA 1O7FA 2M5WA 3BJAA 1JKRC 2CFXA 4RA2A 2Y0SA 2E5ZA 4BY7J 2HVQA 2IJLA 3GTGJ 2LBFA 3SFZA 3I59A 4A3IJ 2EIKH 1VQMI 2VE9A 3IWFA 4XLHA 3JAMK 3DWLE 4HV5A 1V5GA 2OJED 4LG3A 4KJZA 1IN5A 1IN4A 4CUGA 2EZKA 1H9TA 3LSRA 4BDYA 2R7DA 3AFHA 1JTYA 4EJOA 3HHHA 3FWEA 1ZRFA 4QSHA 2KRFA 3FZVA 1VQPI 4D7MA 4XLNF 1UAAA 5DD4A 4LB5A 1YE9A 3A02A 4I0BA 3HOUJ 4A0YA 4EJWA 1F9NA 4RM3A 1BIBA 3AL0B 3CTAA 2JMWA 1SD7A 2IRFG 1OYIA 5TISC 3FM3A 4XKCA 3N4MA 4U7DA 4U7BA 3OR2C 5ILVA 5EJCA 5D5UB 5IT9Z 1TT0A 1FJLA 3GTKJ 2BW3B 1OCRH 1O3RA 4Y7NJ 4A3GJ 1AU7A 1KA8A 2LVSA 4D5CA 2RV8A 2HTSA 5J8FA 3QWLA 4XLAA 3IV5A 4X6AJ 1HOMA 4MGRA 2HKXA 2ISZA 3OYCA 4HLXA 3QYBA 3FXOA 4E7HA 3DPTA 1JKPC 2CQQA 2HYJA 2RKHA 3FXUA 4A3KJ 2CV1A 2YR2A 1UZCA 4IEJA 2O3FA 4FT8A 1IRZA 2LP0A 2DTZA 2E71A 2A6HF 2W7NA 1T0FA 1HDDC 1XTAA 1WFXA 3ZMZA 1ACIA 1MJ9A 2LKXA 1AOYA 4BS9A 3OYNA 3REOA 3U1DA 3OSGA 1BW5A 3OMYA 4J19A 5F1RA 3K10A 1FY7A 5D6EA 5F0CA 1MBGA 4M9ZA 1UB9A 3KYCB 3LSHA 1J59A 1RUOA 3P9IA 3LSGA 3BPVA 1X3WB 5B5EC 2P7VB 2PMUA 3LSPA 1VFCA 3OY9A 3ERED 1RZ4A 4M3EA 1YFHA 2FMYA 2BYVE 3IP4B 3RKXA 4OAYA 4EJTA 1XGMA 4LLGF 1BJZA 4EM2A 1OISA 1MKMA 3LAJA 3ABUA 1GDTA 2B0LA 2HVSA 3JSOA 1I3AA 4B3XA 1YQAA 5LRSA 3HHGA 2YU3A 5IYCJ 2KP6A 3SJMA 3S3NA 4XRMA 4G12A 4LIVA 4HNUA 4KMUX 1IV6A 3BROA 1SFOJ 5ICEA 5D8KB 1T33A 1UG2A 4XICA 1X1AA 4F52A 4XLCA 1JGSA 3S1RJ 2BZTA 3H35A 4A3EJ 3PIPF 1G2HA 5E1XA 2L7KA 1WRJA 3DPUA 3DKYA 4OOIA 1ZELA 2MFZA 2NYXA 2Z1DA 1D1AA 3EPZA 3J80Z 1G8XA 1U8RA 3ISPA 3CUOA 3H3ZA 3K1MA 3QU3A 3SEZA 4EQQA 2KJBA 3AKZA 1P9QC 2JA6J 2XGEA 1TNSA 3ABLH 1W4MA 4MNUA 4BU2A 2GXGA 2ME6A 3K4LA 1TWCJ 3F8CA 3VB2A 2E19A 2G7HA 4Q5SF 3HGYA 1G3SA 3HOYJ 2UXNA 4P96A 1S29A 2F5VA 3JCUC 1S9HA 2PBIA 3K7AJ 5K7ZA 4XL9A 1S7AA 4O5VA 5E20A 5GPAA 2PMZN 3IH2A 4FHTA 1B9MA 3ZQCA 3IH4A 4OIRF 1UCRA 1QVUA 2WV0A 3LFKA 4PGHA 4KDPA 2E1NA 2CUFA 4LG0B 2RQPA 3W2WA 3QRFF 1ZR2A 2KDZA 2V6EA 1KGSA 3W3CA 4IO9F 2KQRA 3U1KA 3S32A 2DBBA 5HDGA 1CQTA 3HKZA 4HBLA 2E1MB 3JRBA 3ULQB 5FGMA 2WB1N 3MN2A 3W2VA 3ZCOA 1D0XA 4ETSA 2FBHA 4DOZA 3OYGA 1VQ8I 1FBQA 5C44J 2W4SA 3UR3C 2Y2ZA 4BQNA 3HPGA 2BBYA 3CZ6A 2E2HJ 3PUFA 2I8DA 2LFBA 2Y30A 2G0EA 2X85A 2ID6A 5J6XA 1BBYA 2W84A 3MKYB 3ROUA 2QUFA 3KEQA 4HX8A 3CF2A 1HBXG 3J81Z 2O61A 1BI1A 3J7ZI 1WCMJ 1U5TB 1UHSA 3FMQA 1IO2A 2QM3A 3U21A 2JA8J 1XN7A 3OYFA 2I5UA 1MNEA 5EGOA 3GW2A 1BI3A 3V4GA 3DTKA 3RJPA 1R7JA 3BR2A 4WWCA 3ZQIA 3SHFA 3N05A 4Y13A 5CPRB 4O3MA 1HC8A 3Q9SA 2V9PA 2NVUB 2V1NA 1MDMB 5DDGA 3AAFA 2X1CA 2ZCWA 2VBZA 3A0HC 2X9DA 2XV4S 4Y4RA 2DI3A 1F43A 2E60A 2OC6A 2X6XA 2CS3A 2R92J 3ZP5A 1R9TJ 1XC5A 2FQ3A 1WZ2A 2JK3A 1FBUA 1BR4A 2OCCH 3VDXA 5IOYA 4CGZA 1E3OC 2MC3A 2VODA 1U3EM 2K9NA 1BIAA 3OIQA 2O5RA 3TO9A 2A69F 2ESHA 4JOMA 3GLLA 3A0BC 4IRHA 2R5ZB 3F21A 4MEYF 5HS8A 5GPCA 5D4RA 2IPQX 4RMNA 2IBDA 2KDOA 3BY6A 2VIXA 1USTA 5J1RA 3KP3A 4P5OA 3HRUA 3QYFA 5CJ9A 4BHBA 1UG0A 1RR8C 2LK2A 3CUQB 2CSOA 2V79A 4DYQA 2XGDA 3NQOA 3HOWJ 2J5OA 1JJ8C 2F5CA 2V1UA 2OQRA 3KP6A 2MH9A 1W7PD 2M7AA 2E2IJ 4BQQA 3K9TA 2DFHA 1HCRA 1DGWY 2NS0A 1QHHD 3K2ZA 3SFIA 4ITVA 2R4GA
chains in the Genus database with same CATH topology
1A5JA 2ZB9A 5C4XJ 3FK7A 4B1RA 4QIWN 4A3BJ 1NK3P 4DW6A 5EEAA 3S2HJ 2Y0SN 2HXOA 2KT0A 5FKMA 1NTCA 3ZQHA 1JUSA 3Q0WA 4DZJA 1VF9A 2E1OA 3B6AA 4A3JJ 3FISA 1JKOC 1OCTC 2FJ1A 3GTPJ 1WI3A 4DZPA 2DA3A 5FJ8J 1ZR4A 1U9NA 1MH4A 3GTJJ 3BQZA 3GTLJ 5IYBJ 4BBRJ 4V2FA 3BTJA 1QPIA 3NARA 3BT9A 2H1KA 1ETYA 4BXXJ 1ZGWA 3S15J 1LE8A 2DA2A 4A93J 1U78A 4D5FA 2ID3A 1BL0A 4AC0A 3FKIJ 5K7HA 3GTMJ 1P7IA 3HDDA 2L7ZA 4C3JJ 1JT6A 5FKKA 2LD5A 2L9RA 1JKQC 1F36A 3WHCA 4XK4A 2XB0X 4QTRA 3OOUA 2R5YB 2GM4A 3E7LA 1TWHJ 1RR7A 3W6VA 2OPTA 5F04A 2M9HA 2JA5J 3GTOJ 1Z0XA 4UUSA 1QVTA 1U9OA 3C2BA 2X48A 3G1MA 2NVYJ 9ANTA 3JRIA 3A03A 1ETKA 3LSJA 1Y1WJ 3CMYA 1IDZA 1FIPA 4BKXA 2VKVA 1IC8A 2VPRA 1U8BA 2TCTA 1W0TA 1I50J 1TWFJ 3ZQGA 1ZTRA 3QPLA 1BA5A 2EZLA 2XB5A 5F08A 2OF7A 2VI6A 4RBOA 1IJWC 1Q1VA 2YS9A 5FKNA 4B4CA 4DYRA 3S2DJ 1LFUP 5M3MJ 4W1UA 5E3LA 5E3NA 3D1NI 3TP0A 2I10A 1WH7A 2MW8A 4I6ZA 1WGXA 2DA4A 5FLVA 2Y9YA 3A01A 1YRNB 3Q0VA 2TRTA 1MH3A 3JRFA 1MSEC 3Q3SA 2LR8A 3G1OA 3QQAA 2E2JJ 2EZIA 1JUMA 3S17J 1X2NA 3PO2J 4A3CJ 3PM1A 3TP3A 2ELKA 2B63J 3FIWA 1RESA 4S0HB 4A69C 4C3HJ 3JRAA 1ITYA 1MNMC 1RPWA 3LOCA 5FKLA 1B72A 3B6CA 4CYCA 3ZOBA 4M3GA 5F0HA 1H8AC 1JJ6C 1FEXA 1PUFB 3JRDA 2DMQA 3S1QJ 1ETOA 1S7EA 3BR3A 4B3AA 1OFCX 2DMTA 3HB9A 2JA7J 2EQRA 3GBGA 1IGNA 3S14J 3TEDA 2DJNA 5EYRA 2NS7A 2Y31A 5FKOA 2R5YA 3H3VK 3F0CA 1ETQA 2CUEA 2L7FP 1JKRC 1X58A 4BY7J 2CU7A 3GTGJ 1RKWA 5IP9J 1Z77A 4A3IJ 2NVTJ 2R93J 2WV1A 1APLC 4A3MJ 1B8IB 3HM5A 3Q0UA 1MBFA 2HI3A 1AKHB 2K9SA 3BQYA 3JRGA 2EZKA 1A6IA 3LSRA 4IHXA 5M5WJ 2H8RA 3UKGA 4MIMA 2RAEA 5IYDJ 2R0QC 1UMQA 2DMUA 4M3BA 1H88C 3NAUA 5M3FJ 3HOZJ 1ENHA 1JTYA 2O9LA 4QSHA 2P81A 4NDLA 2JN6A 4XIDA 4D7MA 5DTDA 5F27A 3WHBA 3RZDJ 3A02A 2M34A 1YRNA 1TC3C 3HOUJ 2CQXA 3K2AA 4IHVA 4V2GA 2JMWA 3QPSA 2D5VA 3IH3A 3BG9A 5E3OA 1XS9A 4MO7A 2COBA 1FIAA 3HKZN 1JTXA 3DCFA 3I4MJ 3ZQFA 3JR9A 1FJLA 2WAQN 3GTKJ 3G1LA 2R5ZA 4Y7NJ 4A3GJ 1AU7A 1GVDA 2LVSA 4D5CA 4D7NA 5EG0B 4MFDA 3HOXJ 3IV5A 2DMPA 4X1EA 3ZQLA 3JRHA 5DS9A 4X6AJ 1HOMA 1PUFA 1MBKA 2DA7A 1JKPC 2CQQA 2HYJA 1ORKA 1Y1VJ 3HEFA 3HGGA 4JYKA 4A3KJ 4A3LJ 1IUFA 4IEJA 3BR6A 5EZGA 3OIOA 5J3LA 1IRZA 2K40A 2O7OA 2IAIA 2LP0A 1FTZA 2AHQA 2DTZA 4Y52J 2M2EA 1HF0A 2CJJA 1ZKGA 4ABZA 3LNQA 1I6HJ 1HDDC 1GUUA 3GTQJ 2XRLA 4C2MJ 2LKXA 2HDDA 2XPUA 1RETA 2NS8A 3OSGA 1BW5A 2AO9A 4J19A 1P7JA 5F0CA 1MBGA 4L5EA 2GBYA 3LSGA 4M6VA 2NOGA 1LFBA 3LSPA 1VFCA 4GFBA 1B8IA 1AKHA 1MBJA 3BTIA 5M5YJ 1X2MA 4M3EA 4RDUA 2FD5A 1GV5A 2YU9J 4FE4A 4JP0A 2N8GA 2ECBA 4LOCA 5EF6A 2MGQA 2DA5A 1BJZA 2LY9A 2DA6A 3HBLA 1GDTA 5IYCJ 3SJMA 4W97A 4XRMA 4G12A 5EDNA 1IV6A 1SFOJ 1JGGA 1GV2A 1T33A 1UG2A 4XICA 1ETVA 5EGOB 2MG4A 2JJ7A 4FISA 5FLMJ 3S1RJ 1POGA 4A3EJ 3BR5A 1G2HA 1I3QJ 2K9QA 1D5YA 1K83J 3PO3J 1VNDA 2HXIA 5K7FA 3JREA 5HODA 2HQ5A 3M3YJ 1OJLA 4MLOA 3TW6A 1XG1A 2QCOA 2JA6J 5F0FA 3RZOJ 2XGEA 2QF7A 3CCYA 1EF4A 4FCYA 1SANA 2LLKA 2ME6A 3BR1A 4C3IJ 1TWCJ 3JRCA 4AUXA 2Y9ZA 2E19A 1FTTA 1QRYA 3HGYA 5IP7J 3HOYJ 2MSYA 1MBEA 2ECCA 1GT0C 2IEKA 5K7ZA 3K7AJ 5C4JJ 1WH5A 5GPAA 3MKLA 5J1YA 4XRSA 2L7MP 2PMZN 3IH2A 1T56A 4BBSJ 3ZQCA 5GP9A 2M0CA 3IH4A 3O8GA 5JLXA 4XRSG 3I4NJ 1QVUA 2VUMJ 3HOVJ 3CQZJ 2CUFA 1ZR2A 2KDZA 2ME0A 3BTCA 3OSFA 1B72B 2HOSA 4CYCB 1CQTA 3JRBA 2EBIA 1ZK8A 1DU6A 2WB1N 3MN2A 2X6OA 2XPVA 5C44J 3H0GJ 4AYBN 2Y2ZA 4EEFG 2DN0A 1MBHA 2E2HJ 2LFBA 1IDYA 2Y30A 2G0EA 1K61A 2ID6A 3O8HA 5EZHA 4UUTA 4HNVA 4FE7A 2XPWA 4M3FA 3VPRA 4DYCA 2LTPA 1WCMJ 2R7ZJ 2GLOA 1UHSA 5J1UA 2HOAA 1TWAJ 1ETWA 2JA8J 4FTHA 2JWTA 5E3MA 5EGOA 4JX5A 1HDPA 2EH3A 2XSDC 4IHYA 3BR2A 1BW6A 3BG3A 1VI0A 3ZQIA 3L1PA 1NK2P 1WPKA 3S16J 3BTLA 5F1JA 2X9DA 1F43A 2EZHA 2M8GX 1LE8B 4BY1J 1RKTA 2R92J 1R9TJ 1XC5A 2JK3A 4M3DA 5IOYA 1AHDP 1E3OC 4A3FJ 2K9NA 5IOZA 2CRGA 1HLVA 2HOTA 4IHWA 4I76A 5IPAA 4UUSB 1ZQ3P 5BNGA 3BG5A 2R5ZB 2VKEA 2O8KA 1MSFC 3FK6A 2NVXJ 2YUSA 5GPCA 3MVPA 3RQIA 2IBDA 1JT0A 3M4OJ 1OCPA 2DMNA 2DA1A 2L0KA 3DEWA 5JLWA 5J1RA 3BR0A 2NVQJ 4JX6A 3S1NJ 2W48A 3SDGA 1ETXA 5C3EJ 4A3DJ 3CDLA 3S1MJ 2LK2A 4DYQA 2XGDA 2FQ4A 3HOWJ 1JJ8C 5EG0A 1O4XA 2XGCA 1DU0A 1H89C 4MFEA 4JX4A 1W0UA 2E2IJ 2FX0A 1IG7A 1HCRA 3TW7A 5IP6A 5M5XJ 3RKQA 1TWGJ 3SFIA 3A01B 1JUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5J A;  2ZB9 A;  5C4X J;  3FK7 A;  4B1R A;  4QIW N;  4A3B J;  1NK3 P;  4DW6 A;  5EEA A;  3S2H J;  2Y0S N;  2HXO A;  2KT0 A;  5FKM A;  1NTC A;  3ZQH A;  1JUS A;  3Q0W A;  4DZJ A;  1VF9 A;  2E1O A;  3B6A A;  4A3J J;  3FIS A;  1JKO C;  1OCT C;  2FJ1 A;  3GTP J;  1WI3 A;  4DZP A;  2DA3 A;  5FJ8 J;  1ZR4 A;  1U9N A;  1MH4 A;  3GTJ J;  3BQZ A;  3GTL J;  5IYB J;  4BBR J;  4V2F A;  3BTJ A;  1QPI A;  3NAR A;  3BT9 A;  2H1K A;  1ETY A;  4BXX J;  1ZGW A;  3S15 J;  1LE8 A;  2DA2 A;  4A93 J;  1U78 A;  4D5F A;  2ID3 A;  1BL0 A;  4AC0 A;  3FKI J;  5K7H A;  3GTM J;  1P7I A;  3HDD A;  2L7Z A;  4C3J J;  1JT6 A;  5FKK A;  2LD5 A;  2L9R A;  1JKQ C;  1F36 A;  3WHC A;  4XK4 A;  2XB0 X;  4QTR A;  3OOU A;  2R5Y B;  2GM4 A;  3E7L A;  1TWH J;  1RR7 A;  3W6V A;  2OPT A;  5F04 A;  2M9H A;  2JA5 J;  3GTO J;  1Z0X A;  4UUS A;  1QVT A;  1U9O A;  3C2B A;  2X48 A;  3G1M A;  2NVY J;  9ANT A;  3JRI A;  3A03 A;  1ETK A;  3LSJ A;  1Y1W J;  3CMY A;  1IDZ A;  1FIP A;  4BKX A;  2VKV A;  1IC8 A;  2VPR A;  1U8B A;  2TCT A;  1W0T A;  1I50 J;  1TWF J;  3ZQG A;  1ZTR A;  3QPL A;  1BA5 A;  2EZL A;  2XB5 A;  5F08 A;  2OF7 A;  2VI6 A;  4RBO A;  1IJW C;  1Q1V A;  2YS9 A;  5FKN A;  4B4C A;  4DYR A;  3S2D J;  1LFU P;  5M3M J;  4W1U A;  5E3L A;  5E3N A;  3D1N I;  3TP0 A;  2I10 A;  1WH7 A;  2MW8 A;  4I6Z A;  1WGX A;  2DA4 A;  5FLV A;  2Y9Y A;  3A01 A;  1YRN B;  3Q0V A;  2TRT A;  1MH3 A;  3JRF A;  1MSE C;  3Q3S A;  2LR8 A;  3G1O A;  3QQA A;  2E2J J;  2EZI A;  1JUM A;  3S17 J;  1X2N A;  3PO2 J;  4A3C J;  3PM1 A;  3TP3 A;  2ELK A;  2B63 J;  3FIW A;  1RES A;  4S0H B;  4A69 C;  4C3H J;  3JRA A;  1ITY A;  1MNM C;  1RPW A;  3LOC A;  5FKL A;  1B72 A;  3B6C A;  4CYC A;  3ZOB A;  4M3G A;  5F0H A;  1H8A C;  1JJ6 C;  1FEX A;  1PUF B;  3JRD A;  2DMQ A;  3S1Q J;  1ETO A;  1S7E A;  3BR3 A;  4B3A A;  1OFC X;  2DMT A;  3HB9 A;  2JA7 J;  2EQR A;  3GBG A;  1IGN A;  3S14 J;  3TED A;  2DJN A;  5EYR A;  2NS7 A;  2Y31 A;  5FKO A;  2R5Y A;  3H3V K;  3F0C A;  1ETQ A;  2CUE A;  2L7F P;  1JKR C;  1X58 A;  4BY7 J;  2CU7 A;  3GTG J;  1RKW A;  5IP9 J;  1Z77 A;  4A3I J;  2NVT J;  2R93 J;  2WV1 A;  1APL C;  4A3M J;  1B8I B;  3HM5 A;  3Q0U A;  1MBF A;  2HI3 A;  1AKH B;  2K9S A;  3BQY A;  3JRG A;  2EZK A;  1A6I A;  3LSR A;  4IHX A;  5M5W J;  2H8R A;  3UKG A;  4MIM A;  2RAE A;  5IYD J;  2R0Q C;  1UMQ A;  2DMU A;  4M3B A;  1H88 C;  3NAU A;  5M3F J;  3HOZ J;  1ENH A;  1JTY A;  2O9L A;  4QSH A;  2P81 A;  4NDL A;  2JN6 A;  4XID A;  4D7M A;  5DTD A;  5F27 A;  3WHB A;  3RZD J;  3A02 A;  2M34 A;  1YRN A;  1TC3 C;  3HOU J;  2CQX A;  3K2A A;  4IHV A;  4V2G A;  2JMW A;  3QPS A;  2D5V A;  3IH3 A;  3BG9 A;  5E3O A;  1XS9 A;  4MO7 A;  2COB A;  1FIA A;  3HKZ N;  1JTX A;  3DCF A;  3I4M J;  3ZQF A;  3JR9 A;  1FJL A;  2WAQ N;  3GTK J;  3G1L A;  2R5Z A;  4Y7N J;  4A3G J;  1AU7 A;  1GVD A;  2LVS A;  4D5C A;  4D7N A;  5EG0 B;  4MFD A;  3HOX J;  3IV5 A;  2DMP A;  4X1E A;  3ZQL A;  3JRH A;  5DS9 A;  4X6A J;  1HOM A;  1PUF A;  1MBK A;  2DA7 A;  1JKP C;  2CQQ A;  2HYJ A;  1ORK A;  1Y1V J;  3HEF A;  3HGG A;  4JYK A;  4A3K J;  4A3L J;  1IUF A;  4IEJ A;  3BR6 A;  5EZG A;  3OIO A;  5J3L A;  1IRZ A;  2K40 A;  2O7O A;  2IAI A;  2LP0 A;  1FTZ A;  2AHQ A;  2DTZ A;  4Y52 J;  2M2E A;  1HF0 A;  2CJJ A;  1ZKG A;  4ABZ A;  3LNQ A;  1I6H J;  1HDD C;  1GUU A;  3GTQ J;  2XRL A;  4C2M J;  2LKX A;  2HDD A;  2XPU A;  1RET A;  2NS8 A;  3OSG A;  1BW5 A;  2AO9 A;  4J19 A;  1P7J A;  5F0C A;  1MBG A;  4L5E A;  2GBY A;  3LSG A;  4M6V A;  2NOG A;  1LFB A;  3LSP A;  1VFC A;  4GFB A;  1B8I A;  1AKH A;  1MBJ A;  3BTI A;  5M5Y J;  1X2M A;  4M3E A;  4RDU A;  2FD5 A;  1GV5 A;  2YU9 J;  4FE4 A;  4JP0 A;  2N8G A;  2ECB A;  4LOC A;  5EF6 A;  2MGQ A;  2DA5 A;  1BJZ A;  2LY9 A;  2DA6 A;  3HBL A;  1GDT A;  5IYC J;  3SJM A;  4W97 A;  4XRM A;  4G12 A;  5EDN A;  1IV6 A;  1SFO J;  1JGG A;  1GV2 A;  1T33 A;  1UG2 A;  4XIC A;  1ETV A;  5EGO B;  2MG4 A;  2JJ7 A;  4FIS A;  5FLM J;  3S1R J;  1POG A;  4A3E J;  3BR5 A;  1G2H A;  1I3Q J;  2K9Q A;  1D5Y A;  1K83 J;  3PO3 J;  1VND A;  2HXI A;  5K7F A;  3JRE A;  5HOD A;  2HQ5 A;  3M3Y J;  1OJL A;  4MLO A;  3TW6 A;  1XG1 A;  2QCO A;  2JA6 J;  5F0F A;  3RZO J;  2XGE A;  2QF7 A;  3CCY A;  1EF4 A;  4FCY A;  1SAN A;  2LLK A;  2ME6 A;  3BR1 A;  4C3I J;  1TWC J;  3JRC A;  4AUX A;  2Y9Z A;  2E19 A;  1FTT A;  1QRY A;  3HGY A;  5IP7 J;  3HOY J;  2MSY A;  1MBE A;  2ECC A;  1GT0 C;  2IEK A;  5K7Z A;  3K7A J;  5C4J J;  1WH5 A;  5GPA A;  3MKL A;  5J1Y A;  4XRS A;  2L7M P;  2PMZ N;  3IH2 A;  1T56 A;  4BBS J;  3ZQC A;  5GP9 A;  2M0C A;  3IH4 A;  3O8G A;  5JLX A;  4XRS G;  3I4N J;  1QVU A;  2VUM J;  3HOV J;  3CQZ J;  2CUF A;  1ZR2 A;  2KDZ A;  2ME0 A;  3BTC A;  3OSF A;  1B72 B;  2HOS A;  4CYC B;  1CQT A;  3JRB A;  2EBI A;  1ZK8 A;  1DU6 A;  2WB1 N;  3MN2 A;  2X6O A;  2XPV A;  5C44 J;  3H0G J;  4AYB N;  2Y2Z A;  4EEF G;  2DN0 A;  1MBH A;  2E2H J;  2LFB A;  1IDY A;  2Y30 A;  2G0E A;  1K61 A;  2ID6 A;  3O8H A;  5EZH A;  4UUT A;  4HNV A;  4FE7 A;  2XPW A;  4M3F A;  3VPR A;  4DYC A;  2LTP A;  1WCM J;  2R7Z J;  2GLO A;  1UHS A;  5J1U A;  2HOA A;  1TWA J;  1ETW A;  2JA8 J;  4FTH A;  2JWT A;  5E3M A;  5EGO A;  4JX5 A;  1HDP A;  2EH3 A;  2XSD C;  4IHY A;  3BR2 A;  1BW6 A;  3BG3 A;  1VI0 A;  3ZQI A;  3L1P A;  1NK2 P;  1WPK A;  3S16 J;  3BTL A;  5F1J A;  2X9D A;  1F43 A;  2EZH A;  2M8G X;  1LE8 B;  4BY1 J;  1RKT A;  2R92 J;  1R9T J;  1XC5 A;  2JK3 A;  4M3D A;  5IOY A;  1AHD P;  1E3O C;  4A3F J;  2K9N A;  5IOZ A;  2CRG A;  1HLV A;  2HOT A;  4IHW A;  4I76 A;  5IPA A;  4UUS B;  1ZQ3 P;  5BNG A;  3BG5 A;  2R5Z B;  2VKE A;  2O8K A;  1MSF C;  3FK6 A;  2NVX J;  2YUS A;  5GPC A;  3MVP A;  3RQI A;  2IBD A;  1JT0 A;  3M4O J;  1OCP A;  2DMN A;  2DA1 A;  2L0K A;  3DEW A;  5JLW A;  5J1R A;  3BR0 A;  2NVQ J;  4JX6 A;  3S1N J;  2W48 A;  3SDG A;  1ETX A;  5C3E J;  4A3D J;  3CDL A;  3S1M J;  2LK2 A;  4DYQ A;  2XGD A;  2FQ4 A;  3HOW J;  1JJ8 C;  5EG0 A;  1O4X A;  2XGC A;  1DU0 A;  1H89 C;  4MFE A;  4JX4 A;  1W0U A;  2E2I J;  2FX0 A;  1IG7 A;  1HCR A;  3TW7 A;  5IP6 A;  5M5X J;  3RKQ A;  1TWG J;  3SFI A;  3A01 B;  1JUP A; 
#chains in the Genus database with same CATH topology
 1Z6R A;  3MZY A;  4ZDP A;  2TDX A;  2P5L C;  1NK3 P;  5EEA A;  3S2H J;  2CV0 A;  2HTJ A;  3SEQ A;  2KT0 A;  2RN7 A;  2P6S A;  3DF8 A;  2R7V A;  4HOB A;  1JUS A;  2RDP A;  3EUH C;  3HZJ A;  5CQG A;  1J5Y A;  2IA0 A;  3ML6 A;  4A3J J;  1B1B A;  3FIS A;  1JKO C;  4RGU A;  1PYV A;  3KP2 A;  4S04 A;  3GTP J;  1ZR4 A;  4EJV A;  5FJ8 J;  4IVN A;  3BP8 A;  3BZ6 A;  3KIO A;  2DYR H;  3MZ8 A;  1P2F A;  4J01 A;  4NHJ A;  3GTJ J;  3S2W A;  3IAS 2;  2F5F A;  4EM0 B;  3GTL J;  4V2F A;  4UNO A;  1MMA A;  1OQY A;  1FYL A;  1D5V A;  2H6C A;  4ZYA A;  3E5Q A;  1ZRC A;  2FA5 A;  1ETY A;  2VBX A;  4NUB A;  1LE8 A;  1U78 A;  4D5F A;  1MMN A;  1BL0 A;  1BI2 A;  4CIC A;  5K7H A;  4BE0 A;  4G7H F;  3HDD A;  2L7Z A;  3GTM J;  4C3J J;  2IS1 A;  2HYG D;  3KZY A;  2EFN A;  4AID A;  4CCM A;  2L4M A;  2G9W A;  4GYG A;  4HAM A;  4XK4 A;  2RGV A;  2GM4 A;  5LLQ A;  3E7L A;  2OA4 A;  4RS8 A;  3LA7 A;  5ICF A;  3TDU C;  2OPT A;  1D3Y A;  3D0S A;  2BVM A;  5DM7 F;  2WAF A;  5EEG A;  3CD6 I;  2HDC A;  3ABM H;  1Z91 A;  1TP4 A;  1YYV A;  2E35 A;  5B3S H;  2XDV A;  3A03 A;  4XOT A;  3CF5 F;  1FOW A;  2P5K A;  2VKV A;  2A05 A;  2D1H A;  2BHZ A;  2TCT A;  1W0T A;  4HZF A;  1XGS A;  2IGN A;  2XC7 A;  2XGX A;  2EZL A;  3I9V 2;  2XB5 A;  4BQO A;  1IF1 A;  2VI6 A;  4BXF A;  1DGR M;  1PUE E;  1Q1V A;  2VKD A;  3GLX A;  1E2X A;  4KIB A;  3S2D J;  5FRM A;  5E3L A;  3D1N I;  4OMZ A;  4CH7 A;  4L0Z B;  1H9G A;  2W82 A;  1WH7 A;  1D0Y A;  1T0F C;  2FF4 A;  3WU2 C;  4AVP A;  4IHT A;  2R7F A;  4I6Z A;  3MFK A;  1Y8R B;  3CO6 C;  2DA4 A;  3Q0V A;  1E0E A;  1S72 I;  2GQQ A;  4EGZ A;  1TQI A;  3FXR A;  3VYT B;  2IA1 A;  1J75 A;  2XAS A;  2EZI A;  4I02 A;  3LAP A;  3QOP A;  1R1V A;  3LFU A;  3NEU A;  2B63 J;  1XSV A;  1QGP A;  4C2U A;  1Z1D A;  1NHA A;  1HXD A;  2H6B A;  1FP2 A;  4S0H B;  3E97 A;  4C3H J;  1DUX C;  5FKL A;  4RAZ A;  2VOO A;  1B72 A;  2JRM A;  3B6C A;  2OV7 A;  3GYH X;  4IXA A;  3S1Q J;  5KCM A;  5LGT A;  1IZ1 A;  1IRG A;  5TRD A;  2DK8 A;  1RNL A;  1V54 H;  1WHU A;  2QVO A;  4Q4Z F;  3WOD F;  1OFC X;  2V9K A;  4KIS A;  2IS2 A;  3B02 A;  4IHS A;  2JA7 J;  3GBG A;  1ZRD A;  4PFP A;  4CCK A;  1X1C A;  3DKW A;  4QPQ A;  5FKO A;  2R5Y A;  1FOY A;  5FO5 A;  3RYR A;  2M30 A;  4XN0 A;  4RB1 A;  2L7F P;  4BL0 B;  2LC2 A;  4C9Y A;  3WTS C;  2V9V A;  4HDU A;  1XGN A;  5JVG F;  4A6D A;  2CU7 A;  2DPU A;  3E3V A;  2IS6 A;  5IP9 J;  4IQ4 A;  3FHN A;  1Z77 A;  5E8G A;  2XRN A;  3PFY A;  4ZZL A;  4F92 B;  2NVT J;  3CC2 I;  1Z21 A;  4A3M J;  1VZ0 A;  1X1P A;  1B8I B;  2QZ8 A;  1AKH B;  4DBQ A;  3OS0 A;  1SVO A;  2HZD A;  3JRG A;  1T08 B;  4ZYH A;  3CC7 I;  4OIN F;  2H8R A;  2LKS A;  3UKG A;  4MIM A;  4IHX A;  1SD4 A;  4AIJ A;  4LLN A;  4YFK F;  1H88 C;  3HPH A;  1Z05 A;  3HOZ J;  2O0Y A;  2BGC A;  1ODD A;  3G71 I;  5D6F A;  4G7O F;  1R4M B;  3ZMV A;  4NDL A;  3V8K A;  2PG4 A;  3ZMT A;  2F48 A;  5F27 A;  4U88 A;  3ECO A;  3RZD J;  4G6D A;  2M34 A;  1TC3 C;  2CQX A;  3PJR A;  2QKL B;  2VJI A;  3OWT A;  5HS7 A;  1DPR A;  1G3T A;  1IRX A;  3QPS A;  1S3J A;  1FBS A;  1KYZ A;  3O2P E;  4XMY A;  3ZN1 A;  1XS9 A;  2KJC A;  5HLI A;  1IV8 A;  4C2T A;  3JW4 A;  4Q47 A;  5FFX A;  1QNT A;  2GAU A;  4IL6 C;  2WY8 Q;  2R7Q A;  1ZN2 A;  2FNP A;  2LSO A;  2L4A A;  1ZGA A;  5HNF A;  3IAM 2;  4N9H A;  3F72 A;  2EK5 A;  3HL2 A;  2KLO A;  4OMY A;  2DMP A;  4NC7 A;  1YIT I;  1PUF A;  1MBK A;  5DEQ A;  2DA7 A;  4U0Y A;  1ORK A;  1Y1V J;  2DFF A;  4XQF A;  2WAE A;  1SD5 A;  4M74 A;  4MTE A;  3T8T A;  3WG9 A;  5K5O A;  3H36 A;  4I0A A;  4PJL A;  1FC3 A;  2F5D A;  2O7O A;  3OYD A;  2HQA A;  1R4N B;  2AHQ A;  2HFH A;  1JXS A;  2DU9 A;  2M2E A;  3H9G A;  3JTH A;  2X1D A;  5CLS A;  2K3P A;  3LNQ A;  4BH9 A;  1ZG1 A;  2STW A;  4RAG A;  5BMZ A;  1GUU A;  4KMF A;  3I54 A;  3DU6 A;  1T98 A;  3VYS B;  1RET A;  4D9J A;  2P8T A;  5A2Q K;  2AO9 A;  2QQ8 A;  4HQM A;  3BC8 A;  3L2U A;  3CUQ C;  1JE8 A;  2BV6 A;  3PQK A;  2NOG A;  3OV8 A;  3AG1 H;  3I64 A;  4U87 A;  4ZZD A;  5FB2 A;  4Q48 A;  4BEH A;  5E17 F;  5KK1 A;  2FD5 A;  2VT3 A;  2A6E F;  4JP0 A;  2ECB A;  3KEO A;  4RLQ A;  1S6L A;  2DA5 A;  3BOQ A;  2CH0 A;  2FRH A;  4UB8 C;  2NRA C;  2E36 A;  1VQO I;  4YFN F;  4YII A;  3AG3 H;  5IY5 H;  5J4Y A;  4BAY A;  5L3D A;  5FRN A;  1A31 A;  3ZRG A;  1FYM A;  3K0L A;  3J7A O;  1R1U A;  1XDS A;  1GV2 A;  1G6N A;  3ZPL A;  2MG4 A;  2JJ7 A;  1DQU A;  3I5U A;  3TL4 X;  4JQF A;  3BCB A;  3P9C A;  2A5W A;  1I6X A;  3QYE A;  1YIJ I;  3ZMU A;  4YIR X;  4R79 A;  4H4K C;  1LQ1 A;  1FT9 A;  4WCG A;  3PO3 J;  3LL7 A;  3K4M A;  2HXI A;  1HA8 A;  2BW3 A;  3HTS B;  4A2U A;  5HOD A;  4ON0 A;  1O57 A;  3ERM A;  1B59 A;  2HQ5 A;  1EA3 A;  3GFJ A;  3M3Y J;  3LST A;  3M8E A;  2XF7 A;  1OJL A;  4MLO A;  3EUH A;  3TW6 A;  5D8L B;  2QCO A;  2R7U A;  4CA0 A;  2QF7 A;  1RIO H;  1EF4 A;  4B44 A;  2IP2 A;  5E18 F;  3CCQ I;  4FCY A;  4G6Q A;  4E7J A;  3EET A;  2VQG A;  1T39 A;  1X4P A;  2ISY A;  2VBY A;  2BY0 A;  2Y9Z A;  2FOK A;  3NWT A;  4HV6 A;  2HQR A;  1IN6 A;  1QRY A;  1TW2 A;  1WQ2 A;  3DLL F;  1MBE A;  1EH8 A;  2ECC A;  2HZT A;  5C4J J;  2VKH A;  2ZFU A;  1YW8 A;  3MKL A;  4XRS A;  2VPL A;  1FSH A;  2VXZ A;  1K7A A;  4KN7 X;  3O8G A;  4HA8 A;  2R7O A;  5JLX A;  4A5M A;  4HW0 A;  3HOV J;  3CQZ J;  2VBW A;  4IQJ A;  3PSF A;  3KZZ A;  3NWS A;  2ME0 A;  1AWC A;  2XAG A;  3OSF A;  3RCO A;  4F93 B;  2HOS A;  1Z9C A;  2D45 A;  2EBI A;  2VON A;  3F3X A;  2BHY A;  4UXN A;  1DU6 A;  2W85 A;  4QPO A;  2XPV A;  5CVU A;  1SC7 A;  1P4A A;  4BUP A;  1T2K A;  2MH2 A;  4PJ0 C;  4EEF G;  5DD8 A;  2EB7 A;  5LGN A;  4E70 A;  1LDD A;  4I01 A;  2XUB A;  2HOE A;  5D4S A;  2QGU A;  2VL8 A;  5EZH A;  1FMW A;  2PJR B;  2K7L A;  1LJ9 A;  5H6R A;  2E34 A;  2EFP A;  4BYY A;  1JHH A;  3I58 A;  4CCO A;  2XPW A;  2L54 A;  4RB3 C;  5KAF C;  2R7Z J;  1P4X A;  2V26 A;  1F5T A;  2XVC A;  4FQG A;  5J1U A;  1TWA J;  3E6D A;  2WWY A;  2L9S A;  5K1Y A;  3HXL A;  2LF8 A;  1W7P A;  3EQL F;  3I59 B;  1X19 A;  3EUA A;  4II3 A;  3TBI A;  4IHY A;  4U0W A;  1XMA A;  1YOV B;  2VLA A;  1HKQ A;  1SMY F;  3ASN H;  1BW6 A;  3BG3 A;  1VI0 A;  1NK2 P;  4Y15 A;  3RTR A;  2VT2 A;  2Y75 A;  5F1J A;  4GRI A;  4RGX A;  2EZH A;  2DW4 A;  4ZTJ A;  5JR3 A;  1RKT A;  2K27 A;  3DV8 A;  4CXF A;  2Q2E B;  3VFZ A;  3DKX A;  3J7Y J;  3CJQ B;  3K1N A;  5LHG A;  1XMK A;  2EIL H;  2JVG A;  3BJO A;  1Z6T A;  3MZH A;  3MMY B;  4A3F J;  4L9N A;  4HX4 A;  3OS1 A;  2HOT A;  4RGS A;  4IRI A;  3SZP A;  3MCZ A;  3R60 A;  1QHG A;  2UUZ A;  3ZMS A;  5LHH A;  5IPA A;  2Q1Z B;  5D5W B;  4UUS B;  2C6Y A;  1ZQ3 P;  4ZDL A;  3S8P A;  2FE3 A;  2FOW A;  1ZLJ A;  3EYY A;  4XSZ F;  1O3T A;  4LG0 A;  3C7J A;  1UHW A;  2NVX J;  3J7A Y;  2OU2 A;  2YUS A;  3F6O A;  3MVP A;  4CSW A;  2Q8K A;  1B6A A;  1K4S A;  1RUN A;  2R7S A;  3HRM A;  3HRS A;  4LIT A;  3H5R A;  2W48 A;  4G8X A;  2K5C A;  3KE2 A;  1ETX A;  1P92 A;  3SDG A;  1VQ9 I;  3RYP A;  3CJN A;  1Y0N A;  4I09 A;  4A3D J;  3S1M J;  3DFG A;  1WVR A;  1A6Q A;  1X1B A;  5EG0 A;  4XLF A;  3IUO A;  2ZNZ A;  1H89 C;  4HDV A;  2LF7 A;  4MFE A;  1L3L A;  1ONV A;  4UB6 C;  3TW7 A;  5IP6 A;  3QPT A;  2JPB A;  4RB0 A;  1OCC H;  1U5T A;  2LY2 A;  2ZB9 A;  4UVC A;  3RPU D;  3CCM I;  2HVR A;  4A3B J;  4DW6 A;  2Y0S N;  1K4T A;  2ZME B;  5FKM A;  1R5G A;  1IXR C;  4J00 A;  4DZJ A;  2VQH A;  2E1O A;  3B6A A;  5E79 C;  5DUI A;  1A35 A;  4FX0 A;  3TDZ C;  3HSE A;  2PQ8 A;  3L00 A;  4DZP A;  2DA3 A;  1W5T A;  3G6E I;  3CCV I;  1ZG5 A;  1TQM A;  2HPI A;  1U9N A;  2CFO A;  2IGO A;  1BJA A;  3BG6 A;  3M7G A;  1N77 A;  3TOB A;  3WGG A;  2E1C A;  1BC7 C;  4OIO F;  4RAY A;  5CQE A;  1YLF A;  2VQL A;  5IYB J;  1QPI A;  3NAR A;  3ABK H;  3GXO A;  2KHM A;  4GCV A;  4BXX J;  3S15 J;  4AYB A;  4P9F A;  4F7Z A;  3CCS I;  3K4K A;  3X2Q H;  3R6S A;  4NB5 A;  4B47 A;  1XMX A;  3FKI J;  2UWM A;  2L9R A;  4B8X A;  1JKQ C;  1J09 A;  2KIF A;  3WHC A;  2XKP A;  3K69 A;  1RR7 A;  3CCR I;  2M9H A;  2JA5 J;  1SEU A;  2LMD A;  2Z9O A;  3GTO J;  2JRT A;  1VTN C;  1QVT A;  1U9O A;  2X48 A;  2K02 A;  3FXJ A;  2HS5 A;  9ANT A;  4RGR A;  1PP7 U;  2CW7 A;  4BNC A;  2DAO A;  1ETK A;  2M4K A;  2R7T A;  2F4O B;  3U2R A;  3CMY A;  4ENK A;  2F6C A;  4D1Q A;  2GA1 A;  3PNY A;  4AIK A;  4BHC A;  4KT6 A;  4UV8 A;  3ZQG A;  1ZTR A;  3QPL A;  1LFP A;  2XKO A;  2H09 A;  3D5L A;  2OF7 A;  3PNT A;  1XGO A;  5HLG A;  1IJW C;  6PAX A;  3BZK A;  3CUQ A;  3GO5 A;  2H1L A;  4B4C A;  4WXC A;  4W1U A;  3K4J A;  1WJ5 A;  4PZJ A;  4XOP A;  3GFI A;  4DIQ A;  4B48 A;  1YX3 A;  3LSK A;  4U0V A;  1YG2 A;  3DTI A;  4YG2 F;  2M3A A;  3FMS A;  2CQ7 A;  1WI9 A;  5FLV A;  4XKB A;  2Y9Y A;  1XB4 A;  1YRN B;  1K78 A;  1MH3 A;  3CMM A;  3M07 A;  5ICC A;  2BY3 A;  3M1E A;  3I71 A;  1O3Q A;  5LD2 C;  2ZXW H;  2LR8 A;  3QQA A;  2A6T A;  2R3S A;  1EKE A;  1JUM A;  3CDI A;  2HEO A;  4XLE A;  4FAS D;  3PO2 J;  4GXO A;  1E3H A;  1ZYR F;  3SQN A;  3CMA I;  4IKF A;  2HU9 A;  4OWR B;  4LB6 B;  4QLC U;  2DFI A;  2ELK A;  1Q1H A;  5ED4 A;  1MW7 A;  1R5I D;  4I98 B;  3JRA A;  1ITY A;  2B7E A;  1MNM C;  1RPW A;  1YX5 A;  2JTV A;  4CYC A;  1XCB A;  2QYO A;  3KP5 A;  1T95 A;  1FEX A;  3JRD A;  2L2O A;  3IWZ A;  2K85 A;  3K4B A;  3KPH A;  1JI8 A;  3P7N A;  1S7E A;  2IA2 A;  1K6Y A;  1TBX A;  3BR3 A;  3CLQ A;  4B43 A;  1NG7 A;  3A2K A;  3ELK A;  3ZN0 A;  3DP7 A;  4ZYE A;  4ESB A;  2BE5 F;  2LKP A;  2ZNY A;  3CJT B;  1IGN A;  3S14 J;  1BM9 A;  2ZSI B;  1FP1 D;  2DJN A;  3AL0 C;  4IF4 A;  4LJZ F;  4YIF A;  2CYY A;  3L2W A;  2Y31 A;  4XKV A;  4B09 A;  2L01 A;  2V1X A;  3KLO A;  1T6S A;  2XSJ C;  4PFO A;  5ILU A;  2B9S A;  3IHU A;  3WTV C;  3CME I;  1I5Z A;  2YSR A;  5CKT A;  2O03 A;  1X4O A;  1X58 A;  3VYR B;  3BG7 A;  1V3F A;  2BXY A;  4ESF A;  2CV2 A;  3KCC A;  1OR7 A;  3KYD B;  1APL C;  3IKV A;  3HTU A;  3LWF A;  2R7R A;  3FDY A;  2HI3 A;  1FSE A;  3SDB A;  3KEY A;  4PJM A;  3O6B B;  3FBN B;  4L9V A;  3BQY A;  4OIP F;  4HST A;  1SAU A;  1A6I A;  2STT A;  3F8F A;  2FXA A;  1UFM A;  5TGT A;  3T0Y A;  2RAE A;  5IYD J;  1BOA A;  1UMQ A;  4AWX B;  1FNN A;  3NAU A;  3OYK A;  1OKR A;  5M3F J;  1ENH A;  2O9L A;  3LSI A;  1P6R A;  4A6E A;  2K9M A;  5DCF A;  3T5X A;  1XSX A;  2JZY A;  2V6C A;  4XID A;  5DTD A;  4E4H A;  5B1A H;  3LA2 A;  4KYW A;  2GZW A;  1SD6 A;  4LGW A;  2DFE A;  2JVH A;  3B73 A;  1YW7 A;  2D5V A;  2DTR A;  3ZMD A;  3BG9 A;  2LRE A;  1LEB A;  3OYI A;  2ZFW A;  4MO7 A;  5DYM A;  1FIA A;  3HKZ N;  1KQ9 A;  1JTX A;  2RQQ A;  2Z2S B;  3DCF A;  3E5U A;  3QP6 A;  3ZQF A;  3JR9 A;  1EH7 A;  2ELH A;  3ECH A;  2WAD A;  1USS A;  2ICW G;  3G1L A;  3GEZ A;  2FBK A;  1NG6 A;  1ZG3 A;  5FLX Z;  3DBL B;  2JUC A;  1GVD A;  2Y69 H;  3CC4 I;  4WF2 A;  4XRF A;  3GVA A;  4WXH A;  4MFD A;  4A0Z A;  2GIZ A;  3W2A A;  4X1E A;  1RC9 A;  3JRH A;  5DS9 A;  3ZQL A;  3F8B A;  4CO8 A;  1A36 A;  2XAH A;  2EA2 A;  3J80 K;  3HGG A;  3R4K A;  4IX7 A;  1WSU A;  5JHU A;  2M4G A;  4A3L J;  2XF5 A;  1IUF A;  2DO7 A;  3BJ6 A;  2QKM B;  3RPQ A;  2QQB A;  1TNT A;  2MD0 A;  1K6O A;  1Y8Q B;  1ZKG A;  1PJR A;  4ABZ A;  4HF2 A;  2ELJ A;  3JAM Z;  4IRG A;  4JBA A;  1DP7 P;  4CHU A;  3GTQ J;  4C2M J;  2DOE A;  4XNF A;  4EMS A;  4M72 A;  2FUG 2;  3MQ0 A;  3DBH B;  2M7B A;  2NS8 A;  4EV0 A;  5B66 C;  1HST A;  2X4H A;  1P7J A;  5KVR A;  4L5E A;  2GBY A;  1NH3 A;  2DDA A;  4M6V A;  4BJ5 C;  3GF2 A;  2DPD A;  1LFB A;  3K70 D;  4GDF A;  1B8I A;  1KZH A;  3GUD A;  1QBJ A;  2QLZ A;  1AKH A;  1MBJ A;  3BTI A;  4XOR A;  4RDU A;  3E0J B;  2KRC A;  2EPF A;  3KFW X;  1HKT A;  2VXD A;  3FXL A;  2YU9 J;  1OYY A;  1U0J A;  4XLP F;  4LOC A;  4NQW A;  5EF6 A;  2MGQ A;  1SFK A;  2LRD A;  5BPI A;  1B4A A;  1Y39 A;  5E8I A;  2LY9 A;  2XAU A;  3KLN A;  4L0Y B;  5LFA A;  4OU0 A;  3IRQ A;  1EH6 A;  1F1Z A;  2ZME C;  1RRJ A;  2QBY B;  3WU0 A;  2JA2 A;  2Z5U A;  5EDN A;  4EJU A;  1SFU A;  2QQ9 A;  2YX7 A;  3PQJ A;  2VC0 A;  4XR6 A;  1KQ0 A;  4EVI A;  1FMV A;  2EJR A;  3UNG C;  2M87 A;  4F91 B;  4FIS A;  5FLM J;  2W1O A;  2E1M C;  3BR5 A;  3DTE A;  1I3Q J;  2K9Q A;  2P4W A;  3QOD A;  2Z33 A;  3QOE A;  5KHD A;  3G73 A;  1D5Y A;  1VND A;  5EEH A;  1PVE A;  4KFC A;  1VQN I;  3MEX A;  1IXS B;  2FSW A;  3DXJ F;  1HKS A;  1XG1 A;  5F0F A;  3RZO J;  3R0A A;  4JK1 X;  2OCE A;  3CCY A;  4WX9 A;  3H9Q A;  2NXN B;  1YS6 A;  1SAN A;  3WGH A;  4A0X A;  1U5T C;  4C3I J;  4AUX A;  2L9V A;  1FTT A;  3N97 A;  3CES A;  3DEU A;  4HSR A;  1GT0 C;  4O6J A;  2IEK A;  1WH5 A;  5BPD A;  5J1Y A;  1CF7 A;  4S05 A;  4UUV A;  1T56 A;  4BBS J;  3DQV C;  2M0C A;  3OIP A;  4LK1 F;  3MD2 A;  2VUM J;  4R1H A;  4HEA 2;  4F55 A;  2IS4 A;  3FXK A;  3GZ6 A;  3EYI A;  5L3B A;  1B72 B;  1BOB A;  1ZK8 A;  1KU7 A;  4BXU A;  3E6B A;  4HNT A;  1LDK B;  3H0G J;  4FX4 A;  1MMS A;  2H8W A;  1MMG A;  3L09 A;  1IDY A;  4BHP A;  2DOA A;  4LIU A;  1YO5 C;  3O8H A;  1K61 A;  4ZC3 A;  5D5X B;  1DDN A;  5J8C A;  3M1C A;  4M3F A;  3TMO A;  2G7U A;  3HUG B;  4A5N A;  5GAD J;  5HLH A;  2LTP A;  4P55 A;  3C2H A;  4KIT B;  3WTY C;  1BC8 C;  1J7K A;  1ETW A;  1FZP B;  2DT5 A;  1G3Y A;  4AD9 A;  5L3E A;  1QU3 A;  1XPX A;  2ACJ A;  5E3M A;  2X51 A;  4KUM A;  5FRO A;  2EH3 A;  3KP7 A;  2XSD C;  2JSP A;  1G4D A;  1MD0 A;  1MMD A;  4OIQ F;  5JFR A;  1D1B A;  1MIJ A;  3A1Y A;  1WPK A;  2CO5 A;  3BTL A;  2ZXH A;  1LB2 A;  1IW7 F;  1HW5 A;  4LK0 F;  1EV7 A;  2E7W A;  2M8G X;  4BY1 J;  1KYW A;  3V7R A;  2KMU A;  2HNH A;  5FD5 A;  2DOD A;  3KX2 A;  1GXP A;  2ZC2 A;  3CP2 A;  5ERI A;  2ADU A;  1QQI A;  1WJF A;  3OYE A;  5IOZ A;  3L9F A;  2CRG A;  3TO7 A;  1HLV A;  2VB6 A;  5HS9 A;  1WJC A;  2BOL A;  4IHW A;  4I76 A;  4GO1 A;  1TLH B;  4D0P A;  2VKE A;  4EM1 A;  4XBF A;  1MSF C;  4KN4 X;  5D5V B;  3K6G A;  3FK6 A;  4RLF A;  5DUK A;  2P7C B;  4PDK A;  3RQI A;  3OOP A;  3WGI A;  2EV5 A;  4ENM A;  1OCP A;  2DMN A;  2L0K A;  3DEW A;  2LDU A;  1YHQ I;  2AXL A;  2GWR A;  4JX6 A;  3S1N J;  1FX7 A;  2PEX A;  5C3E J;  4Y33 A;  4HPQ A;  2VAS A;  2JT1 A;  1Z3Y A;  5J4V A;  4ENJ A;  2FQ4 A;  5GAG J;  5K5Q A;  2QSH X;  3HSR A;  2X6Y A;  1O4X A;  2X6W A;  4RB2 C;  4PJN A;  5J47 A;  2PJR A;  5LEK A;  2ZXI A;  2FX0 A;  1IG7 A;  2W57 A;  3VWB A;  5M5X J;  1EJ9 A;  2XAF A;  2BY1 A;  3RKQ A;  2VC1 A;  4KIC A;  3A01 B;  4XN3 A;  1JUP A;  2K4J A;  4Z6Y A;  3C18 A;  1A5J A;  2DT6 A;  5C4X J;  3FK7 A;  2DCE A;  4B1R A;  2K86 A;  1FOK A;  3LSM A;  4HX7 A;  3IC7 A;  4LFU A;  1B9N A;  2GXA A;  5DCM B;  2HXO A;  1U6G A;  1NTC A;  2PMZ A;  3ZQH A;  3Q0W A;  2HDW A;  2ZJR F;  2VQC A;  1XD7 A;  1OR7 C;  1VF9 A;  2A5Y B;  2JSC A;  3FM5 A;  1W5S A;  5CVR A;  2CUZ A;  5HVQ C;  4XON A;  3L2R A;  2EIJ H;  1WI3 A;  1R22 A;  4BEH B;  4H0E A;  4EAT A;  3QPH A;  4G9Y A;  4RAF A;  3HRT A;  3RIR A;  2X1E A;  2OZU A;  3E1S A;  4P1W A;  3G4S I;  1C0W A;  1ZLK A;  2A07 F;  1MH4 A;  3H9J A;  3BZC A;  2F4I A;  5CVJ A;  3ZR8 X;  2CMP A;  3BQZ A;  1LPQ A;  4BBR J;  3RI4 A;  1I39 A;  3C3W A;  1I1G A;  5GAH J;  3BTJ A;  2WB1 A;  4MHG A;  2LH9 A;  1R36 A;  2WAQ A;  3WU1 B;  1VQ4 I;  1R23 A;  4DGW B;  1ZGW A;  4DQ2 A;  1R58 A;  2DA2 A;  3U9G A;  4DBR A;  4A93 J;  2Q2E A;  2ID3 A;  1BI0 A;  4AC0 A;  1LVA A;  1YJN I;  2XIG A;  1JT6 A;  5FKK A;  4LLL A;  4L9J A;  1JHF A;  1I1S A;  1F36 A;  4I7H A;  2HWV A;  2DQR A;  3R61 A;  3TKY A;  2Z3Y A;  4E7K A;  2XB0 X;  2F5E A;  3L2V A;  3W6V A;  1LUJ B;  3C1D A;  4OAZ A;  1QZZ A;  4UUS A;  3C2B A;  2Z99 A;  5J40 A;  2LBF B;  4BE2 A;  5FFZ A;  5JHF A;  2KFD A;  3JSP A;  4IOC F;  4YFX F;  3K4N A;  3VOE A;  1MND A;  2DDB A;  1MZB A;  1TT5 B;  3JRI A;  1YI2 I;  5H6Q A;  1Y6I A;  1H0M A;  1IDZ A;  4BKX A;  3E5X A;  1IC8 A;  2VPR A;  2QWW A;  1SFX A;  2CW0 F;  4N9I A;  4ENN A;  2M1B A;  1TWF J;  3MAJ A;  2GOX B;  3SZT A;  3CCL I;  2BY2 A;  4L9T A;  1BA5 A;  1R00 A;  2HKO A;  4AIH A;  3CJR B;  4RBO A;  4PK4 A;  2YS9 A;  5FKN A;  3HOT A;  2RRE A;  3RKY A;  4DYR A;  1GXQ A;  3TGN A;  3PNV A;  5L3G A;  5M3M J;  4MTD A;  1LFU P;  5E3N A;  2OD5 A;  2GA2 A;  2I10 A;  3R0J A;  2IXS A;  2MW8 A;  2COM A;  3IL2 A;  3L7W A;  1PDN C;  5F6F A;  3JRF A;  1MSE C;  2LNB A;  3Q3S A;  3G2B A;  2M0M A;  3G1O A;  4RM2 A;  3DEE A;  2RNJ A;  5B1B H;  3I56 I;  2WY7 Q;  1W1W E;  2ZME A;  4BJT A;  2CQK A;  3S17 J;  4UVB A;  4A3C J;  2CG4 A;  1XSD A;  1HW2 A;  3SYT A;  3HYI A;  1FWZ A;  2Y48 A;  3BLY A;  4GYI A;  4II2 A;  3TP3 A;  2LOO A;  2DYS H;  4P9U A;  3DPL C;  3P9K A;  2QSF X;  1ZGJ A;  2EV6 A;  4CDG A;  1WJD A;  3H3U A;  3F8M A;  1V4R A;  3DLA A;  4TV7 A;  3CCE I;  2NAZ A;  4LMY A;  3D5S C;  3LOC A;  1OCO H;  3KZI C;  5F0H A;  3WTW C;  4CCN A;  2DMQ A;  3KYL A;  2A3S A;  1SFE A;  2FML A;  1FYK A;  3GZN B;  3Q5F A;  1HW1 A;  3ESW B;  1LVK A;  2EQR A;  2UXX A;  1W7P B;  3S3M A;  4CCJ A;  3TED A;  3ASO H;  3IRR A;  3TOA A;  2DK5 A;  3H3V K;  3F0C A;  4QWQ A;  1ETQ A;  1D8J A;  2CUE A;  3OR1 C;  2QEX I;  2OTJ I;  1Z3X A;  1S8N A;  2HGC A;  3TO6 A;  1RKW A;  2HR3 A;  2RNG A;  2A61 A;  1Z7U A;  2V1D A;  4PUS A;  2OUM A;  3MKZ A;  2WV1 A;  5DM6 F;  2R93 J;  4PSW A;  3HM5 A;  3Q0U A;  1MBF A;  2K9S A;  3WTZ A;  1ON2 A;  1SMT A;  3TQN A;  2ZXJ A;  1R5H A;  2D2W A;  4MQV A;  5M5W J;  1K79 A;  2XRO A;  2R0Q C;  1MDM A;  2DMU A;  4M3B A;  4ZDO A;  1GLN A;  1W5C C;  3OYH A;  4E6K G;  1ZAO A;  2WBM A;  4XKW A;  5LBQ A;  3LA3 A;  1QZE A;  2P81 A;  1GHC A;  1SVL A;  2JN6 A;  2DJI A;  4CZZ A;  2CWE A;  3VEP A;  4NC6 A;  3WHB A;  1YRN A;  1UJ8 A;  1REP C;  3K2A A;  2L3D A;  4IHV A;  4V2G A;  3L2C A;  2R7X A;  4BGD A;  4YEJ A;  4ZTF A;  3IH3 A;  3SZG A;  4M6Y A;  3AG4 H;  1WWX A;  2P6T A;  5E3O A;  1RI7 A;  2IGM A;  4YEL A;  2COB A;  4Y17 A;  1J2X A;  4BJ6 C;  3I4M J;  2ZSH B;  2WAQ N;  2F2E A;  3CCU I;  3HC7 A;  4KA4 A;  2D1V A;  4ASN A;  2R5Z A;  2QEN A;  3FHZ A;  3W6K B;  4D7N A;  4I99 C;  3GZ5 A;  5EG0 B;  3T1B A;  4L18 B;  1KU9 A;  4A12 A;  3E6C C;  3HOX J;  1J0R A;  4ZJZ A;  2E5N A;  3PIO F;  1IRF A;  4UV9 A;  2AXT C;  3HEF A;  4JYK A;  2GIV A;  4LD5 A;  4KIG A;  2PJP A;  1YIO A;  3BR6 A;  5EZG A;  1BR2 A;  3OIO A;  4PGG A;  5J3L A;  3C2G A;  2WA0 A;  2K40 A;  2IAI A;  1WKM A;  2V7F A;  3Q9V A;  1FTZ A;  2XAQ A;  4Y52 J;  1XDU A;  1HF0 A;  2CJJ A;  3F8N A;  4BDZ A;  3LQQ A;  2KPM A;  1I6H J;  3RKW A;  2KIQ A;  2XRL A;  3PL8 A;  2OBP A;  4E7L A;  2HDD A;  4DJA A;  2LYC A;  1QO0 D;  3VYU B;  2XPU A;  1XCV A;  3DBR B;  2L02 A;  5LEJ A;  1T38 A;  1UEL B;  3NRV A;  2MLK A;  2VE8 A;  3K1P A;  3FF5 A;  5HDK A;  1XX5 A;  2M45 A;  2HQN A;  4AU7 A;  2XHK A;  1YJ9 I;  4GFB A;  4IOA F;  2W00 A;  3I53 A;  1O7L A;  1VQK I;  2L5Q A;  3PFI A;  3OYL A;  1J9I A;  4XM3 A;  2DQL A;  4C30 A;  1X2M A;  5M5Y J;  3I55 I;  1MJA A;  1GV5 A;  1IAW A;  4AM3 A;  4FE4 A;  2N8G A;  2EV0 A;  1HQC A;  4HLY A;  5LGU A;  2O6G E;  1TL8 A;  5CVV A;  2DA6 A;  2FEZ A;  3HBL A;  3CLO A;  4M9X A;  4ESJ A;  1BR1 A;  2H94 A;  1ON1 A;  5IT9 K;  1D0Z A;  1AA7 A;  4W97 A;  1DPU A;  1IUY A;  1ZH5 A;  2MC4 A;  2JPC A;  1YJW I;  1JGG A;  4G7Z F;  5L3F A;  2NNN A;  3W6J B;  2AS5 F;  3CDH A;  2DOF A;  3T8R A;  2PN6 A;  3E6M A;  1ETV A;  5EGO B;  2AQF A;  4E7S A;  1TZL A;  2ZO4 A;  1ZAR A;  3O3K A;  1POG A;  2KIS A;  2L9N A;  3K4C A;  2DXI A;  3COA C;  4WXD A;  3A4C A;  1K83 J;  3H5A A;  3SXY A;  1HSJ A;  5K7F A;  3MWM A;  2E7X A;  3I3L A;  3JRE A;  2DT7 B;  2QQA A;  1IXC A;  2GXB A;  3RSN A;  4R8H A;  3OYM A;  4HRI A;  3ZGK A;  3H0D A;  3HG9 A;  5TJJ A;  5IT3 A;  5HOO A;  5KNL A;  2LLK A;  3FX3 A;  1R71 A;  1F4K A;  1K78 B;  3LMM A;  3BR1 A;  4M71 A;  3V7C A;  3JRC A;  1S7O A;  3LQR A;  2Y0M A;  4MEX F;  1X3U A;  5IP7 J;  4N4N B;  2MSY A;  4V19 K;  3H92 A;  2ETH A;  1W36 D;  2AQE A;  5A2Q Z;  1ZHF A;  1Y0U A;  4FET A;  3QP5 A;  2L7M P;  5JVT A;  5GP9 A;  3FMR A;  4ZH4 F;  3P5J A;  1N75 A;  2VJ5 A;  4XRS G;  4NC8 A;  4F3Q A;  2UZK A;  3I4N J;  1V55 H;  3F22 A;  4CZC A;  4CCL A;  2HYF A;  4BE1 A;  2IVM A;  1KU2 A;  3BTC A;  4XSX F;  3V42 A;  4AVZ A;  3HSF A;  4CYD A;  2ZJQ F;  3FXQ A;  1OPC A;  4CYC B;  1OYW A;  1QA6 A;  5BOX A;  3H5N A;  3GCM A;  4ANJ A;  2X6O A;  1OCZ H;  2DLL A;  2V4J C;  2W24 A;  4IZZ A;  2BXZ A;  3FKJ A;  4AYB N;  2ZKZ A;  1M1E B;  2EWN A;  3M8J A;  3ABT A;  2DN0 A;  1G59 A;  1MBH A;  1BN5 A;  2CW8 A;  1S5L C;  2KIM A;  1Y56 A;  2MYS A;  3DU5 A;  4UUT A;  4HQE A;  4HNV A;  4FE7 A;  4L5I A;  3ZXS A;  5ICG A;  3VPR A;  1E17 A;  4DYC A;  3F9K A;  2FBI A;  2PI0 A;  1I27 A;  2QBY A;  3M9A A;  2GLO A;  3PSI A;  2M8E A;  3RQ4 A;  2HOA A;  1ULY A;  3JTG A;  2OTL I;  2OAZ A;  3QAH A;  2ZJP F;  2EIM H;  4FTH A;  2JWT A;  2IT0 A;  2P5V A;  4PJJ A;  1YW9 A;  4JX5 A;  1HDP A;  1MGT A;  2CQN A;  2KZG A;  2LY1 A;  5HLT A;  3CO7 C;  2MAB A;  2Z16 A;  3WTU C;  1Z67 A;  4N0B A;  3L1P A;  1X1D A;  2PLY A;  3S16 J;  5FD6 A;  3QU6 A;  2GOM A;  2EFQ A;  5HDN A;  1V5F A;  1LE8 B;  1OLT A;  3F6V A;  4ZYD A;  1ZRE A;  1IN8 A;  2K4B A;  3OS2 A;  3GFM A;  4M3D A;  3OL3 A;  2PFB A;  4BAC A;  4EGY A;  4IJA A;  1G3W A;  1W36 C;  1AHD P;  3PUB A;  4GGG A;  4HG2 A;  1SVM A;  1YTY A;  1UHM A;  5CVI A;  5L3C A;  3VOD A;  1SAX A;  4KIF A;  2F4M B;  5H2F C;  1ERD A;  5BNG A;  3BG5 A;  4E7Z A;  2O8K A;  4NNJ A;  1D1C A;  3OYJ A;  3GME A;  3GWZ A;  3BPX A;  3V7S A;  2ESN A;  4IPA A;  2IGK A;  1JT0 A;  3J81 K;  4HF1 A;  3M4O J;  5LRR A;  2DA1 A;  2WTE A;  5JLW A;  3BR0 A;  2ZBK A;  2NVQ J;  4HF0 A;  4BQA A;  3OYA A;  3CDL A;  4M6X A;  1R49 A;  3MKW B;  1QZY A;  1MJB A;  4YRV A;  3F23 A;  2QSG X;  1Z7L A;  2XGC A;  3ZQ7 A;  1DU0 A;  4M9S A;  4JX4 A;  1W0U A;  3WTX C;  1QPM A;  1TWG J;  2EA4 A;  2JQ7 A;  3HUG A;  2J5P A;  2LG4 A;  1GVJ A;  3CCJ I;  3D5R C;  1LDJ A;  4N4O B;  4PSX A;  1PP8 F;  1FPQ A;  4QIW N;  3RDI A;  2K3F A;  5BS6 A;  1KU3 A;  4NBQ A;  1LKX A;  2KZV A;  3S3O A;  1DP3 A;  4ZYG A;  1LNW A;  2P0W A;  2CUJ A;  1OCT C;  2FJ1 A;  5GAE J;  2BEO A;  2RC4 A;  1V5E A;  3WTT C;  4UY8 I;  4NQW B;  3S93 A;  1A04 A;  3IKT A;  1R6R A;  3ZQQ A;  2R7W A;  3BT9 A;  4PCQ A;  2KL4 A;  5E1Z B;  1U2W A;  2H1K A;  3K70 C;  2KKO A;  4L5J A;  3VSK A;  4K2E A;  4M73 A;  4DNC A;  3V8J A;  1WJA A;  4Z2Y A;  2VN2 A;  2W25 A;  3VSL A;  3KP4 A;  4G94 A;  1T8I A;  1P7I A;  2HPM A;  5AIP A;  2LD5 A;  5K5R A;  2WC2 A;  2Q0O A;  4QTR A;  2K9L A;  2A68 F;  3OOU A;  2PX9 A;  5H20 A;  2IW5 A;  2X0L A;  2R5Y B;  1TWH J;  1VQ6 I;  2MLG A;  1X3Z B;  3HOS A;  2KIU A;  3BWG A;  5F04 A;  3BDD A;  1WJB A;  2UV1 A;  1Z0X A;  5HNH A;  1OMI A;  2MBF A;  1TW3 A;  5GTH C;  1KQ8 A;  4MQ9 F;  3G1M A;  1L0O C;  2NVY J;  4UVA A;  1VQL I;  1FOX A;  2MD5 A;  3L2Q A;  1E3P A;  3HIF A;  3LSJ A;  3ONQ A;  5CYV A;  5LHI A;  1Y1W J;  1FIP A;  2YPR A;  3RPU A;  2MA3 A;  1U8B A;  2FNA A;  2EFW A;  2NOJ B;  3V8L A;  1I50 J;  5ILS A;  3OYB A;  2BVL A;  3I0T A;  4UHT A;  2EFO A;  2FU4 A;  5F08 A;  1KON A;  1P4W A;  5BQT A;  2O8X A;  3WE3 A;  2QA4 I;  2VOP A;  1WJE A;  2VJJ A;  1CF7 B;  2CGP A;  3TP0 A;  1TTY A;  1TQP A;  5JI6 A;  3WE2 A;  4X0G A;  3H1C A;  2XF6 A;  3KET A;  1WGX A;  3A01 A;  2RVC A;  2VJ4 A;  1N25 A;  2TRT A;  3G3Z A;  3M8F A;  2OQG A;  4KT5 C;  5AIQ A;  5DV5 A;  2EIN H;  5DCM A;  2PMH A;  3HJE A;  4I2O A;  3FXM A;  2E2J J;  2H27 A;  3GFL A;  2OZ6 A;  1X2N A;  1D8K A;  5F64 A;  1O3S A;  1FLI A;  3PM1 A;  3EDP A;  2ZJ2 A;  1IN7 A;  3BCA A;  3FIW A;  1RES A;  3EUK L;  4A69 C;  3FBI B;  3CP8 A;  1YS7 A;  1N78 A;  2JUG A;  1LEA A;  3AG2 H;  4M3G A;  3ZOB A;  3WG7 H;  1JJ6 C;  1H8A C;  1PUF B;  4G6T B;  1ETO A;  4HYE A;  4WK8 F;  2XAJ A;  3I4P A;  4Y3O A;  4B3A A;  1VQ7 I;  3GX4 X;  1CGP A;  1STZ A;  5FLX K;  2DMT A;  3HB9 A;  4E7I A;  2NNY A;  5KAI C;  4KNY A;  5EYR A;  2KRH A;  5E1W A;  1R1T A;  2NS7 A;  5GTI C;  3OL4 A;  1VQ5 I;  2YX4 A;  5AON A;  1O7F A;  2M5W A;  3BJA A;  1JKR C;  2CFX A;  4RA2 A;  2Y0S A;  2E5Z A;  4BY7 J;  2HVQ A;  2IJL A;  3GTG J;  2LBF A;  3SFZ A;  3I59 A;  4A3I J;  2EIK H;  1VQM I;  2VE9 A;  3IWF A;  4XLH A;  3JAM K;  3DWL E;  4HV5 A;  1V5G A;  2OJE D;  4LG3 A;  4KJZ A;  1IN5 A;  1IN4 A;  4CUG A;  2EZK A;  1H9T A;  3LSR A;  4BDY A;  2R7D A;  3AFH A;  1JTY A;  4EJO A;  3HHH A;  3FWE A;  1ZRF A;  4QSH A;  2KRF A;  3FZV A;  1VQP I;  4D7M A;  4XLN F;  1UAA A;  5DD4 A;  4LB5 A;  1YE9 A;  3A02 A;  4I0B A;  3HOU J;  4A0Y A;  4EJW A;  1F9N A;  4RM3 A;  1BIB A;  3AL0 B;  3CTA A;  2JMW A;  1SD7 A;  2IRF G;  1OYI A;  5TIS C;  3FM3 A;  4XKC A;  3N4M A;  4U7D A;  4U7B A;  3OR2 C;  5ILV A;  5EJC A;  5D5U B;  5IT9 Z;  1TT0 A;  1FJL A;  3GTK J;  2BW3 B;  1OCR H;  1O3R A;  4Y7N J;  4A3G J;  1AU7 A;  1KA8 A;  2LVS A;  4D5C A;  2RV8 A;  2HTS A;  5J8F A;  3QWL A;  4XLA A;  3IV5 A;  4X6A J;  1HOM A;  4MGR A;  2HKX A;  2ISZ A;  3OYC A;  4HLX A;  3QYB A;  3FXO A;  4E7H A;  3DPT A;  1JKP C;  2CQQ A;  2HYJ A;  2RKH A;  3FXU A;  4A3K J;  2CV1 A;  2YR2 A;  1UZC A;  4IEJ A;  2O3F A;  4FT8 A;  1IRZ A;  2LP0 A;  2DTZ A;  2E71 A;  2A6H F;  2W7N A;  1T0F A;  1HDD C;  1XTA A;  1WFX A;  3ZMZ A;  1ACI A;  1MJ9 A;  2LKX A;  1AOY A;  4BS9 A;  3OYN A;  3REO A;  3U1D A;  3OSG A;  1BW5 A;  3OMY A;  4J19 A;  5F1R A;  3K10 A;  1FY7 A;  5D6E A;  5F0C A;  1MBG A;  4M9Z A;  1UB9 A;  3KYC B;  3LSH A;  1J59 A;  1RUO A;  3P9I A;  3LSG A;  3BPV A;  1X3W B;  5B5E C;  2P7V B;  2PMU A;  3LSP A;  1VFC A;  3OY9 A;  3ERE D;  1RZ4 A;  4M3E A;  1YFH A;  2FMY A;  2BYV E;  3IP4 B;  3RKX A;  4OAY A;  4EJT A;  1XGM A;  4LLG F;  1BJZ A;  4EM2 A;  1OIS A;  1MKM A;  3LAJ A;  3ABU A;  1GDT A;  2B0L A;  2HVS A;  3JSO A;  1I3A A;  4B3X A;  1YQA A;  5LRS A;  3HHG A;  2YU3 A;  5IYC J;  2KP6 A;  3SJM A;  3S3N A;  4XRM A;  4G12 A;  4LIV A;  4HNU A;  4KMU X;  1IV6 A;  3BRO A;  1SFO J;  5ICE A;  5D8K B;  1T33 A;  1UG2 A;  4XIC A;  1X1A A;  4F52 A;  4XLC A;  1JGS A;  3S1R J;  2BZT A;  3H35 A;  4A3E J;  3PIP F;  1G2H A;  5E1X A;  2L7K A;  1WRJ A;  3DPU A;  3DKY A;  4OOI A;  1ZEL A;  2MFZ A;  2NYX A;  2Z1D A;  1D1A A;  3EPZ A;  3J80 Z;  1G8X A;  1U8R A;  3ISP A;  3CUO A;  3H3Z A;  3K1M A;  3QU3 A;  3SEZ A;  4EQQ A;  2KJB A;  3AKZ A;  1P9Q C;  2JA6 J;  2XGE A;  1TNS A;  3ABL H;  1W4M A;  4MNU A;  4BU2 A;  2GXG A;  2ME6 A;  3K4L A;  1TWC J;  3F8C A;  3VB2 A;  2E19 A;  2G7H A;  4Q5S F;  3HGY A;  1G3S A;  3HOY J;  2UXN A;  4P96 A;  1S29 A;  2F5V A;  3JCU C;  1S9H A;  2PBI A;  3K7A J;  5K7Z A;  4XL9 A;  1S7A A;  4O5V A;  5E20 A;  5GPA A;  2PMZ N;  3IH2 A;  4FHT A;  1B9M A;  3ZQC A;  3IH4 A;  4OIR F;  1UCR A;  1QVU A;  2WV0 A;  3LFK A;  4PGH A;  4KDP A;  2E1N A;  2CUF A;  4LG0 B;  2RQP A;  3W2W A;  3QRF F;  1ZR2 A;  2KDZ A;  2V6E A;  1KGS A;  3W3C A;  4IO9 F;  2KQR A;  3U1K A;  3S32 A;  2DBB A;  5HDG A;  1CQT A;  3HKZ A;  4HBL A;  2E1M B;  3JRB A;  3ULQ B;  5FGM A;  2WB1 N;  3MN2 A;  3W2V A;  3ZCO A;  1D0X A;  4ETS A;  2FBH A;  4DOZ A;  3OYG A;  1VQ8 I;  1FBQ A;  5C44 J;  2W4S A;  3UR3 C;  2Y2Z A;  4BQN A;  3HPG A;  2BBY A;  3CZ6 A;  2E2H J;  3PUF A;  2I8D A;  2LFB A;  2Y30 A;  2G0E A;  2X85 A;  2ID6 A;  5J6X A;  1BBY A;  2W84 A;  3MKY B;  3ROU A;  2QUF A;  3KEQ A;  4HX8 A;  3CF2 A;  1HBX G;  3J81 Z;  2O61 A;  1BI1 A;  3J7Z I;  1WCM J;  1U5T B;  1UHS A;  3FMQ A;  1IO2 A;  2QM3 A;  3U21 A;  2JA8 J;  1XN7 A;  3OYF A;  2I5U A;  1MNE A;  5EGO A;  3GW2 A;  1BI3 A;  3V4G A;  3DTK A;  3RJP A;  1R7J A;  3BR2 A;  4WWC A;  3ZQI A;  3SHF A;  3N05 A;  4Y13 A;  5CPR B;  4O3M A;  1HC8 A;  3Q9S A;  2V9P A;  2NVU B;  2V1N A;  1MDM B;  5DDG A;  3AAF A;  2X1C A;  2ZCW A;  2VBZ A;  3A0H C;  2X9D A;  2XV4 S;  4Y4R A;  2DI3 A;  1F43 A;  2E60 A;  2OC6 A;  2X6X A;  2CS3 A;  2R92 J;  3ZP5 A;  1R9T J;  1XC5 A;  2FQ3 A;  1WZ2 A;  2JK3 A;  1FBU A;  1BR4 A;  2OCC H;  3VDX A;  5IOY A;  4CGZ A;  1E3O C;  2MC3 A;  2VOD A;  1U3E M;  2K9N A;  1BIA A;  3OIQ A;  2O5R A;  3TO9 A;  2A69 F;  2ESH A;  4JOM A;  3GLL A;  3A0B C;  4IRH A;  2R5Z B;  3F21 A;  4MEY F;  5HS8 A;  5GPC A;  5D4R A;  2IPQ X;  4RMN A;  2IBD A;  2KDO A;  3BY6 A;  2VIX A;  1UST A;  5J1R A;  3KP3 A;  4P5O A;  3HRU A;  3QYF A;  5CJ9 A;  4BHB A;  1UG0 A;  1RR8 C;  2LK2 A;  3CUQ B;  2CSO A;  2V79 A;  4DYQ A;  2XGD A;  3NQO A;  3HOW J;  2J5O A;  1JJ8 C;  2F5C A;  2V1U A;  2OQR A;  3KP6 A;  2MH9 A;  1W7P D;  2M7A A;  2E2I J;  4BQQ A;  3K9T A;  2DFH A;  1HCR A;  1DGW Y;  2NS0 A;  1QHH D;  3K2Z A;  3SFI A;  4ITV A;  2R4G A; 
#chains in the Genus database with same CATH homology
 1A5J A;  2ZB9 A;  5C4X J;  3FK7 A;  4B1R A;  4QIW N;  4A3B J;  1NK3 P;  4DW6 A;  5EEA A;  3S2H J;  2Y0S N;  2HXO A;  2KT0 A;  5FKM A;  1NTC A;  3ZQH A;  1JUS A;  3Q0W A;  4DZJ A;  1VF9 A;  2E1O A;  3B6A A;  4A3J J;  3FIS A;  1JKO C;  1OCT C;  2FJ1 A;  3GTP J;  1WI3 A;  4DZP A;  2DA3 A;  5FJ8 J;  1ZR4 A;  1U9N A;  1MH4 A;  3GTJ J;  3BQZ A;  3GTL J;  5IYB J;  4BBR J;  4V2F A;  3BTJ A;  1QPI A;  3NAR A;  3BT9 A;  2H1K A;  1ETY A;  4BXX J;  1ZGW A;  3S15 J;  1LE8 A;  2DA2 A;  4A93 J;  1U78 A;  4D5F A;  2ID3 A;  1BL0 A;  4AC0 A;  3FKI J;  5K7H A;  3GTM J;  1P7I A;  3HDD A;  2L7Z A;  4C3J J;  1JT6 A;  5FKK A;  2LD5 A;  2L9R A;  1JKQ C;  1F36 A;  3WHC A;  4XK4 A;  2XB0 X;  4QTR A;  3OOU A;  2R5Y B;  2GM4 A;  3E7L A;  1TWH J;  1RR7 A;  3W6V A;  2OPT A;  5F04 A;  2M9H A;  2JA5 J;  3GTO J;  1Z0X A;  4UUS A;  1QVT A;  1U9O A;  3C2B A;  2X48 A;  3G1M A;  2NVY J;  9ANT A;  3JRI A;  3A03 A;  1ETK A;  3LSJ A;  1Y1W J;  3CMY A;  1IDZ A;  1FIP A;  4BKX A;  2VKV A;  1IC8 A;  2VPR A;  1U8B A;  2TCT A;  1W0T A;  1I50 J;  1TWF J;  3ZQG A;  1ZTR A;  3QPL A;  1BA5 A;  2EZL A;  2XB5 A;  5F08 A;  2OF7 A;  2VI6 A;  4RBO A;  1IJW C;  1Q1V A;  2YS9 A;  5FKN A;  4B4C A;  4DYR A;  3S2D J;  1LFU P;  5M3M J;  4W1U A;  5E3L A;  5E3N A;  3D1N I;  3TP0 A;  2I10 A;  1WH7 A;  2MW8 A;  4I6Z A;  1WGX A;  2DA4 A;  5FLV A;  2Y9Y A;  3A01 A;  1YRN B;  3Q0V A;  2TRT A;  1MH3 A;  3JRF A;  1MSE C;  3Q3S A;  2LR8 A;  3G1O A;  3QQA A;  2E2J J;  2EZI A;  1JUM A;  3S17 J;  1X2N A;  3PO2 J;  4A3C J;  3PM1 A;  3TP3 A;  2ELK A;  2B63 J;  3FIW A;  1RES A;  4S0H B;  4A69 C;  4C3H J;  3JRA A;  1ITY A;  1MNM C;  1RPW A;  3LOC A;  5FKL A;  1B72 A;  3B6C A;  4CYC A;  3ZOB A;  4M3G A;  5F0H A;  1H8A C;  1JJ6 C;  1FEX A;  1PUF B;  3JRD A;  2DMQ A;  3S1Q J;  1ETO A;  1S7E A;  3BR3 A;  4B3A A;  1OFC X;  2DMT A;  3HB9 A;  2JA7 J;  2EQR A;  3GBG A;  1IGN A;  3S14 J;  3TED A;  2DJN A;  5EYR A;  2NS7 A;  2Y31 A;  5FKO A;  2R5Y A;  3H3V K;  3F0C A;  1ETQ A;  2CUE A;  2L7F P;  1JKR C;  1X58 A;  4BY7 J;  2CU7 A;  3GTG J;  1RKW A;  5IP9 J;  1Z77 A;  4A3I J;  2NVT J;  2R93 J;  2WV1 A;  1APL C;  4A3M J;  1B8I B;  3HM5 A;  3Q0U A;  1MBF A;  2HI3 A;  1AKH B;  2K9S A;  3BQY A;  3JRG A;  2EZK A;  1A6I A;  3LSR A;  4IHX A;  5M5W J;  2H8R A;  3UKG A;  4MIM A;  2RAE A;  5IYD J;  2R0Q C;  1UMQ A;  2DMU A;  4M3B A;  1H88 C;  3NAU A;  5M3F J;  3HOZ J;  1ENH A;  1JTY A;  2O9L A;  4QSH A;  2P81 A;  4NDL A;  2JN6 A;  4XID A;  4D7M A;  5DTD A;  5F27 A;  3WHB A;  3RZD J;  3A02 A;  2M34 A;  1YRN A;  1TC3 C;  3HOU J;  2CQX A;  3K2A A;  4IHV A;  4V2G A;  2JMW A;  3QPS A;  2D5V A;  3IH3 A;  3BG9 A;  5E3O A;  1XS9 A;  4MO7 A;  2COB A;  1FIA A;  3HKZ N;  1JTX A;  3DCF A;  3I4M J;  3ZQF A;  3JR9 A;  1FJL A;  2WAQ N;  3GTK J;  3G1L A;  2R5Z A;  4Y7N J;  4A3G J;  1AU7 A;  1GVD A;  2LVS A;  4D5C A;  4D7N A;  5EG0 B;  4MFD A;  3HOX J;  3IV5 A;  2DMP A;  4X1E A;  3ZQL A;  3JRH A;  5DS9 A;  4X6A J;  1HOM A;  1PUF A;  1MBK A;  2DA7 A;  1JKP C;  2CQQ A;  2HYJ A;  1ORK A;  1Y1V J;  3HEF A;  3HGG A;  4JYK A;  4A3K J;  4A3L J;  1IUF A;  4IEJ A;  3BR6 A;  5EZG A;  3OIO A;  5J3L A;  1IRZ A;  2K40 A;  2O7O A;  2IAI A;  2LP0 A;  1FTZ A;  2AHQ A;  2DTZ A;  4Y52 J;  2M2E A;  1HF0 A;  2CJJ A;  1ZKG A;  4ABZ A;  3LNQ A;  1I6H J;  1HDD C;  1GUU A;  3GTQ J;  2XRL A;  4C2M J;  2LKX A;  2HDD A;  2XPU A;  1RET A;  2NS8 A;  3OSG A;  1BW5 A;  2AO9 A;  4J19 A;  1P7J A;  5F0C A;  1MBG A;  4L5E A;  2GBY A;  3LSG A;  4M6V A;  2NOG A;  1LFB A;  3LSP A;  1VFC A;  4GFB A;  1B8I A;  1AKH A;  1MBJ A;  3BTI A;  5M5Y J;  1X2M A;  4M3E A;  4RDU A;  2FD5 A;  1GV5 A;  2YU9 J;  4FE4 A;  4JP0 A;  2N8G A;  2ECB A;  4LOC A;  5EF6 A;  2MGQ A;  2DA5 A;  1BJZ A;  2LY9 A;  2DA6 A;  3HBL A;  1GDT A;  5IYC J;  3SJM A;  4W97 A;  4XRM A;  4G12 A;  5EDN A;  1IV6 A;  1SFO J;  1JGG A;  1GV2 A;  1T33 A;  1UG2 A;  4XIC A;  1ETV A;  5EGO B;  2MG4 A;  2JJ7 A;  4FIS A;  5FLM J;  3S1R J;  1POG A;  4A3E J;  3BR5 A;  1G2H A;  1I3Q J;  2K9Q A;  1D5Y A;  1K83 J;  3PO3 J;  1VND A;  2HXI A;  5K7F A;  3JRE A;  5HOD A;  2HQ5 A;  3M3Y J;  1OJL A;  4MLO A;  3TW6 A;  1XG1 A;  2QCO A;  2JA6 J;  5F0F A;  3RZO J;  2XGE A;  2QF7 A;  3CCY A;  1EF4 A;  4FCY A;  1SAN A;  2LLK A;  2ME6 A;  3BR1 A;  4C3I J;  1TWC J;  3JRC A;  4AUX A;  2Y9Z A;  2E19 A;  1FTT A;  1QRY A;  3HGY A;  5IP7 J;  3HOY J;  2MSY A;  1MBE A;  2ECC A;  1GT0 C;  2IEK A;  5K7Z A;  3K7A J;  5C4J J;  1WH5 A;  5GPA A;  3MKL A;  5J1Y A;  4XRS A;  2L7M P;  2PMZ N;  3IH2 A;  1T56 A;  4BBS J;  3ZQC A;  5GP9 A;  2M0C A;  3IH4 A;  3O8G A;  5JLX A;  4XRS G;  3I4N J;  1QVU A;  2VUM J;  3HOV J;  3CQZ J;  2CUF A;  1ZR2 A;  2KDZ A;  2ME0 A;  3BTC A;  3OSF A;  1B72 B;  2HOS A;  4CYC B;  1CQT A;  3JRB A;  2EBI A;  1ZK8 A;  1DU6 A;  2WB1 N;  3MN2 A;  2X6O A;  2XPV A;  5C44 J;  3H0G J;  4AYB N;  2Y2Z A;  4EEF G;  2DN0 A;  1MBH A;  2E2H J;  2LFB A;  1IDY A;  2Y30 A;  2G0E A;  1K61 A;  2ID6 A;  3O8H A;  5EZH A;  4UUT A;  4HNV A;  4FE7 A;  2XPW A;  4M3F A;  3VPR A;  4DYC A;  2LTP A;  1WCM J;  2R7Z J;  2GLO A;  1UHS A;  5J1U A;  2HOA A;  1TWA J;  1ETW A;  2JA8 J;  4FTH A;  2JWT A;  5E3M A;  5EGO A;  4JX5 A;  1HDP A;  2EH3 A;  2XSD C;  4IHY A;  3BR2 A;  1BW6 A;  3BG3 A;  1VI0 A;  3ZQI A;  3L1P A;  1NK2 P;  1WPK A;  3S16 J;  3BTL A;  5F1J A;  2X9D A;  1F43 A;  2EZH A;  2M8G X;  1LE8 B;  4BY1 J;  1RKT A;  2R92 J;  1R9T J;  1XC5 A;  2JK3 A;  4M3D A;  5IOY A;  1AHD P;  1E3O C;  4A3F J;  2K9N A;  5IOZ A;  2CRG A;  1HLV A;  2HOT A;  4IHW A;  4I76 A;  5IPA A;  4UUS B;  1ZQ3 P;  5BNG A;  3BG5 A;  2R5Z B;  2VKE A;  2O8K A;  1MSF C;  3FK6 A;  2NVX J;  2YUS A;  5GPC A;  3MVP A;  3RQI A;  2IBD A;  1JT0 A;  3M4O J;  1OCP A;  2DMN A;  2DA1 A;  2L0K A;  3DEW A;  5JLW A;  5J1R A;  3BR0 A;  2NVQ J;  4JX6 A;  3S1N J;  2W48 A;  3SDG A;  1ETX A;  5C3E J;  4A3D J;  3CDL A;  3S1M J;  2LK2 A;  4DYQ A;  2XGD A;  2FQ4 A;  3HOW J;  1JJ8 C;  5EG0 A;  1O4X A;  2XGC A;  1DU0 A;  1H89 C;  4MFE A;  4JX4 A;  1W0U A;  2E2I J;  2FX0 A;  1IG7 A;  1HCR A;  3TW7 A;  5IP6 A;  5M5X J;  3RKQ A;  1TWG J;  3SFI A;  3A01 B;  1JUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...