1PUFA

Crystal structure of hoxa9 and pbx1 homeodomains bound to dna
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
NNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title STRUCTURE OF HOXA9 AND PBX1 BOUND TO DNA: HOX HEXAPEPTIDE AND DNA RECOGNITION ANTERIOR TO POSTERIOR
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*CP*TP*CP*TP*AP*TP*GP*AP*TP*TP*TP*AP*CP*GP*AP*CP*GP*
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2003-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1pufA00
2E2IJ 4A3GJ 3DCFA 4ABZA 1HF0A 2K40A 5IPAA 2Y30A 3SDGA 4B4CA 4FE7A 2VKEA 2HOTA 4M6VA 3TW6A 1JT0A 5GPAA 2B63J 1ZKGA 1IDYA 3HGGA 4B3AA 9ANTA 3CQZJ 3G1LA 2WAQN 5GPCA 3BR2A 1YRNA 1WH7A 3IH2A 2EBIA 1RESA 1XG1A 1Q1VA 3CCYA 1ZR4A 5EGOB 5JLXA 2O7OA 3ZQHA 3JRHA 2LK2A 4FE4A 1BL0A 3GTPJ 5EYRA 1VNDA 5FKLA 1LE8A 2ID6A 5HODA 3GTGJ 1MBGA 2ME0A 5EDNA 2VI6A 2XGEA 4XRSA 1MH4A 1JUMA 1OFCX 3HOWJ 4FTHA 1ZQ3P 4I76A 1MBEA 1OCPA 1YRNB 3HOVJ 1ETWA 3JRIA 3BR3A 2LKXA 2K9QA 4BXXJ 1WGXA 1IRZA 2IAIA 2HI3A 4J19A 3BT9A 4MFDA 4XK4A 3IV5A 1Y1VJ 3HB9A 1JKOC 2L7FP 3O8GA 2DMNA 1U9OA 2YS9A 2CRGA 1ETYA 4MO7A 3BG5A 4UUSA 4S0HB 3M4OJ 4BY7J 1JGGA 4A3BJ 4JX6A 4V2GA 3BTIA 3FK6A 3CMYA 1TWAJ 3FIWA 1TC3C 1JJ8C 1S7EA 3G1OA 1AU7A 1POGA 1UHSA 4D5CA 3S1MJ 4D7NA 2E1OA 1FTTA 3BR1A 3GTKJ 4MIMA 1E3OC 4IHWA 2LFBA 3A03A 4AC0A 4DZJA 2FQ4A 3PM1A 2WV1A 4XICA 3QPLA 5IOYA 1XS9A 1Z0XA 2H8RA 2X6OA 1X2MA 4A93J 1IDZA 1MSFC 5C3EJ 2I10A 2L9RA 3B6AA 4JP0A 4C3IJ 3Q0VA 3PO3J 3HKZN 1QPIA 4AUXA 1QVUA 1U8BA 3RZOJ 2QF7A 1LE8B 1PUFB 5J1UA 1EF4A 3LSRA 2R93J 1RKTA 1O4XA 3SFIA 1ETQA 4GFBA 2VPRA 4DYCA 3PO2J 5F27A 5M5XJ 5J1YA 4XRMA 2KDZA 1FIAA 5F0CA 1K83J 3WHBA 1NK3P 2XB0X 3O8HA 1B8IA 1TWCJ 2DA5A 1MBJA 2LVSA 2KT0A 3L1PA 1QRYA 1SFOJ 5M5YJ 2JWTA 3QPSA 2E2JJ 2CUFA 3QQAA 3WHCA 2R0QC 1GDTA 4NDLA 1A5JA 3BQZA 2ID3A 4RBOA 4QSHA 5M3MJ 1UMQA 1HOMA 4MFEA 2MGQA 3RKQA 4XIDA 3A01A 1IUFA 2CQXA 2R5ZA 3UKGA 1MBFA 5JLWA 3JRBA 5IYCJ 3HM5A 2K9SA 5E3MA 4M3EA 3GBGA 3HEFA 4M3DA 2HXIA 4CYCB 1GV2A 2ECCA 5EG0A 2M8GX 3K2AA 5EF6A 3K7AJ 2ECBA 1ENHA 4W1UA 1I6HJ 5IP7J 3BR5A 4JYKA 1F43A 1I3QJ 1X58A 4LOCA 2Y9YA 2VUMJ 1AHDP 2LTPA 4DZPA 2EZLA 4B1RA 2MW8A 2ELKA 4DYRA 4UUSB 5FKKA 3RQIA 1JKQC 1H88C 2GBYA 2R5ZB 4M3GA 1JT6A 2JK3A 2XB5A 3CDLA 2Y31A 3ZQCA 5IOZA 3JREA 2EQRA 2O8KA 2FX0A 4C3JJ 1VFCA 2NS8A 2X48A 2CU7A 3HOUJ 2JA7J 2Y9ZA 4L5EA 1W0TA 3BTJA 5EEAA 4BBSJ 2DJNA 1BW5A 3JRAA 1JTXA 3IH4A 5M5WJ 1SANA 3S1QJ 3DEWA 3S16J 3ZQGA 2GM4A 2NS7A 3B6CA 5FLMJ 2NVQJ 2FD5A 1H89C 1JUPA 3BQYA 2OPTA 3BTLA 5IYBJ 2HQ5A 2COBA 2LY9A 1Z77A 2LR8A 2M2EA 2N8GA 4BY1J 1HLVA 4FISA 5EZGA 1GVDA 1HDPA 2R5YB 1OJLA 1HDDC 3MVPA 5GP9A 1DU0A 2GLOA 3JRGA 2JMWA 3I4NJ 1MNMC 3TP0A 2D5VA 2IBDA 5IYDJ 2IEKA 5F1JA 3S15J 3GTQJ 1BW6A 3A02A 4X1EA 1TWGJ 2E19A 1WH5A 2CJJA 3S2DJ 3ZQIA 1LFBA 1ZTRA 2FJ1A 2HOAA 2WB1N 1BJZA 3ZQLA 1JUSA 2HXOA 1MBKA 1CQTA 2M0CA 3ZOBA 3JRFA 2DMQA 2VKVA 3GTMJ 2PMZN 2AHQA 1NTCA 1VF9A 1MSEC 1WI3A 2DMTA 3H0GJ 5K7HA 2HYJA 4V2FA 4A3DJ 2XSDC 3Q0WA 3E7LA 4A3MJ 2LD5A 2H1KA 3HOXJ 2DA1A 1JKPC 5E3LA 1B72A 2G0EA 1P7IA 2QCOA 2TCTA 2HOSA 3OOUA 1H8AC 1RPWA 1VI0A 1X2NA 5K7FA 3W6VA 3LSGA 2DMUA 1T56A 2EZHA 3LSJA 4M3BA 2X9DA 1LFUP 3HDDA 2CUEA 5IP9J 3BR0A 1IV6A 2LP0A 3OIOA 4AYBN 1MH3A 3S2HJ 4C3HJ 1WPKA 1GV5A 4DW6A 5F04A 2EZIA 1ITYA 2DA6A 1BA5A 1MBHA 3FK7A 3G1MA 3HOZJ 1ZK8A 4A3FJ 4BKXA 1R9TJ 2E2HJ 4XRSG 3Q0UA 2XRLA 4QIWN 2XPUA 5FKOA 2R92J 2YU9J 1ETVA 2TRTA 2NVYJ 1GUUA 3MN2A 5F08A 5IP6A 4W97A 5EGOA 3SJMA 2DA4A 3NAUA 1ETXA 2DA3A 2K9NA 4X6AJ 5F0FA 3TP3A 2XPWA 3LSPA 2ME6A 1ORKA 2NVXJ 1FTZA 2Y2ZA 3F0CA 3GTLJ 2EZKA 1NK2P 2DMPA 4DYQA 4A3EJ 1B72B 4Y7NJ 3S17J 2MG4A 2L7ZA 3D1NI 2OF7A 1PUFA 1K61A 1OCTC 5DTDA 3HOYJ 5EZHA 5C4JJ 5C44J 4I6ZA 3VPRA 1TWHJ 1F36A 2O9LA 1G2HA 4EEFG 2ZB9A 3FKIJ 1T33A 2L0KA 4A3CJ 4BBRJ 1IG7A 5FKMA 5DS9A 3IH3A 5EG0B 4A69C 1ZGWA 5BNGA 1WCMJ 2XPVA 4IEJA 1AKHB 1FJLA 1AKHA 4IHVA 2Y0SN 3JRDA 1GT0C 2AO9A 3LOCA 2M34A 2DTZA 1RKWA 4A3KJ 1FEXA 3LNQA 5F0HA 1DU6A 5J3LA 1A6IA 3TW7A 3BG9A 2JA5J 3H3VK 5C4XJ 1XC5A 3RZDJ 4JX4A 2HDDA 4Y52J 1RETA 3GTJJ 2CQQA 2DA2A 3Q3SA 4IHYA 2M9HA 4HNVA 3M3YJ 3BTCA 4IHXA 3S14J 2JJ7A 2DA7A 3BG3A 4RDUA 4A3IJ 4UUTA 3A01B 5M3FJ 1P7JA 1JKRC 1JTYA 3C2BA 1JJ6C 4QTRA 3OSFA 2JA8J 1ETKA 2LLKA 5K7ZA 3I4MJ 3S1NJ 4CYCA 1TWFJ 5E3OA 2JA6J 3ZQFA 1QVTA 1RR7A 1ETOA 4D7MA 3NARA 1ZR2A 3JRCA 3JR9A 2DN0A 2YUSA 2MSYA 2R5YA 1IC8A 2EH3A 1HCRA 3GTOJ 3S1RJ 4D5FA 1FIPA 2P81A 4A3LJ 2RAEA 1U9NA 2JN6A 2XGDA 1Y1WJ 3FISA 5FLVA 2R7ZJ 2NOGA 5FJ8J 4FCYA 5FKNA 1UG2A 1B8IB 2L7MP 3HBLA 3TEDA 3BR6A 4A3JJ 1IGNA 1I50J 4G12A 2XGCA 1IJWC 2NVTJ 1W0UA 4MLOA 4C2MJ 5E3NA 3MKLA 4JX5A 4M3FA 5J1RA 2W48A 3HGYA 1D5YA 1APLC 3OSGA 1U78A
chains in the Genus database with same CATH superfamily
2HS5A 1D0XA 3DTIA 3WGGA 2DPUA 3DCFA 2VXDA 3OYKA 5IPAA 1DPRA 1FY7A 2Y30A 4HX7A 2UUZA 1ODDA 4M74A 5HOOA 1W5SA 2K7LA 2ETHA 2EB7A 1ZKGA 2K86A 3HGGA 9ANTA 4BNCA 4D1QA 2LBFA 1ZG1A 1FBUA 2BXYA 1ZYRF 4AVZA 1IN5A 2GOXB 3HXLA 2RREA 2HWVA 5JLXA 2WA0A 1W5CC 1LDDA 1YLFA 3GTPJ 2E36A 3GW2A 1JHFA 3KP2A 5J47A 5LGUA 2VOOA 1T8IA 1FSHA 3FMSA 3E97A 4KICA 1U0JA 2R7DA 5EDNA 2ME0A 2DODA 4ZYDA 2XGEA 3SQNA 1XCVA 1ZQ3P 1WZ2A 4WXHA 1LDKB 4BEHA 2M7BA 4UB6C 1ETWA 4MTEA 3JRIA 4CCJA 1IO2A 1O3SA 2HDCA 1WGXA 1A04A 2IAIA 2L3DA 4J19A 4UNOA 3F6OA 1R7JA 3VYTB 2IGKA 2V7FA 1F5TA 3PNTA 4IXAA 3L2VA 1T0FC 2HYGD 3TOBA 4Y4RA 1M1EB 4KJZA 1Y1VJ 2MLKA 3HB9A 2BVMA 5LGTA 2J5PA 3D5RC 3E1SA 1CF7A 3KYCB 4IZZA 5LEJA 1ETYA 4RB0A 4GYIA 1S9HA 2CUJA 3MZHA 4MGRA 2KMUA 3D0SA 2ZC2A 4UVBA 3M4OJ 3K1NA 2ELHA 2VQGA 2FMLA 2P5LC 4ZTFA 3BTIA 2FSWA 3CMYA 1BI0A 2R7UA 1JJ8C 3G1OA 1AU7A 3V42A 1UHSA 2EK5A 2A3SA 3X2QH 1GVJA 2X1EA 1FTTA 4D7NA 2E1OA 3BR1A 3GTKJ 4MIMA 1E3OC 2X4HA 4RGRA 4DZJA 3ECHA 2F6CA 1P92A 1G59A 3PM1A 2QSGX 4YIRX 1WRJA 4XICA 5IOYA 1XS9A 4IQJA 1U2WA 1Z0XA 2DT5A 2DAOA 5KK1A 1O3QA 1X2MA 2MC4A 3OYFA 1IDZA 1D8KA 1XMKA 3WG9A 4AM3A 2P6SA 3TL4X 5C3EJ 3B6AA 3OV8A 4C3IJ 3FF5A 3PO3J 2K85A 2HKXA 4PJNA 2BZTA 4E7ZA 3RZOJ 4EVIA 2O0YA 1OMIA 3HL2A 4E7JA 1J09A 1EF4A 2R93J 2XAJA 1ETQA 4RGXA 4I09A 1MMAA 3ONQA 4XRMA 2KDZA 1FIAA 3F3XA 1U6GA 2P5VA 3BCBA 3O8HA 1TWCJ 1B8IA 3RJPA 2XSJC 1MBJA 3CUOA 3F23A 4ENJA 1QRYA 4NQWA 1SFOJ 4G8XA 5EJCA 4I7HA 5BQTA 2JWTA 3QPSA 5GAGJ 5M5YJ 3Q9SA 2E2JJ 2CUFA 1IZ1A 3LSHA 3BQZA 4RBOA 4QSHA 4GDFA 1HOMA 1R6RA 2PLYA 4EM1A 1P6RA 2UXNA 3CZ6A 3DF8A 2VLAA 1UFMA 1FNNA 2RNJA 3WE2A 3A01A 2CQXA 2YU3A 1WI9A 3JRBA 2E1MC 2K9SA 1QPMA 1XDSA 2KQRA 3HEFA 4LB6B 1QA6A 5EG0A 3K2AA 2M3AA 1ZAOA 2KZVA 4CDGA 1ON1A 2HNHA 2L4AA 1I6HJ 5IP7J 1G3SA 2ELJA 1XGSA 2EA4A 3VOEA 1ZRFA 3CMAI 4I99C 3CJQB 3CUQB 1E0EA 3CMMA 1IN7A 1X58A 3DBRB 4UXNA 1YJNI 2DOAA 3FM5A 2A61A 4ENNA 1VQ5I 2LSOA 2Y9YA 1SFKA 4L5IA 1RIOH 2NYXA 2BGCA 3ASNH 2CV2A 4B1RA 2DTRA 3MKYB 2ELKA 5TRDA 4ZYAA 3C1DA 1HBXG 2CQ7A 2JK3A 4M3GA 5ILSA 5IY5H 2Y31A 1V54H 5IOZA 4PZJA 2FX0A 2Y75A 3BZKA 4HQEA 4IVNA 4BXFA 1Z67A 2ZSIB 4L5EA 5EEAA 3I5UA 3VWBA 2LF7A 3IHUA 3E6MA 2QKLB 3R61A 1Z3YA 4DNCA 3S1QJ 2QENA 3S16J 1X4OA 3AFHA 1ZH5A 1OYYA 4HF1A 5EEHA 1MDMB 3L2WA 2FD5A 2ESHA 2LC2A 1H89C 5FO5A 2HQ5A 4F3QA 1MIJA 3H9GA 2M2EA 1OKRA 4EJWA 3SFZA 1F1ZA 3BLYA 2V1XA 4ZTJA 2QQ9A 1X3WB 3MWMA 1GVDA 2H1LA 2R5YB 1HDDC 3MVPA 1A6QA 2GLOA 2FBHA 2TDXA 3PSIA 3P9IA 3WU2C 5ILVA 4LG3A 2KDOA 3GTQJ 2KJCA 3T1BA 1Z6RA 3A02A 1TWGJ 2E19A 1WH5A 4UV9A 2R7FA 2DFFA 1YW9A 4BHCA 3KZIC 3CCLI 1LPQA 5HDKA 4C9YA 2XKPA 3GWZA 2HXOA 2VL8A 4XQFA 3WTSC 4XSZF 3S3MA 2I8DA 2FRHA 4PDKA 2KP6A 2OC6A 4MTDA 3ZOBA 1OLTA 3A4CA 3ISPA 3GTMJ 1MNEA 3CJTB 3MZ8A 1FYLA 3CDIA 1TT0A 2PMZN 3H9QA 3H1CA 3K4LA 3WU1B 1BI2A 2K02A 1K4TA 5L3BA 2DMTA 1QBJA 2CSOA 3QPTA 3F8FA 4XN3A 1N77A 3H3ZA 3QU6A 1U5TA 3HOXJ 2LD5A 5BOXA 5E3LA 2G0EA 3I64A 1P7IA 1NG7A 3OOUA 2GXAA 1X1AA 5JI6A 4EQQA 4KMUX 4ZH4F 3A2KA 4AWXB 3DKXA 3L00A 3LSJA 2GQQA 2LRDA 1FP2A 1V3FA 2RQPA 2E5NA 5IP9J 3IAS2 1IV6A 2LP0A 4F92B 4E6KG 3BZ6A 5B5EC 5FROA 1WPKA 1GV5A 4XLCA 3G4SI 3L7WA 2FE3A 3OR1C 1X3UA 4BKXA 1YX3A 2OUMA 5DCMB 1R9TJ 2EFNA 2E2HJ 4XLFA 3ZQ7A 4A2UA 2P4WA 2M1BA 2XRLA 3W6JB 5J8CA 4X0GA 5LD2C 1GXQA 3L2UA 3M8FA 1IUYA 1ETVA 2L01A 2NVYJ 3ABLH 5F08A 4XOTA 1TBXA 3FXQA 4W97A 3F8BA 4CA0A 3MAJA 2DFHA 3C18A 3LSPA 2ME6A 1EJ9A 3TMOA 1IXRC 4PUSA 3OYEA 2Z16A 4C30A 1SVMA 3HPHA 4OAYA 4RGUA 4NNJA 2Z5UA 2OF7A 2M7AA 2F4IA 1D1CA 3R0JA 3I9V2 4QPQA 4F91B 2Z1DA 1NHAA 1RUOA 1J9IA 3GLXA 4ON0A 4L9TA 3RKXA 2GZWA 4I6ZA 2FOWA 1X1DA 3DPUA 3T8TA 2B0LA 1T33A 4U0VA 3WGHA 2XC7A 3RSNA 5CKTA 4F55A 2A6EF 5LHHA 4A69C 1ZGWA 1FC3A 3FMQA 5BNGA 1WCMJ 2XPVA 2YPRA 1TW3A 4TV7A 1AKHB 3S32A 2HFHA 3FXKA 1AA7A 2Y0SN 3JRDA 1SMTA 1Y56A 2M34A 3KYDB 1PUEE 4FX0A 2VKHA 4UUVA 2P7CB 4ZJZA 4U0WA 3MFKA 3LNQA 5E1XA 2UZKA 1P4AA 4E4HA 3E3VA 1J7KA 3H3VK 5C4XJ 2PFBA 3RZDJ 4ITVA 3E5XA 2IVMA 3CLQA 5E1WA 2VKDA 4L9JA 4HNTA 1X1PA 3Q3SA 4IHYA 1ZRCA 3M3YJ 1BI3A 5H20A 2DA7A 3OS0A 3H3UA 5HDNA 1V4RA 4A3IJ 4UUTA 3G71I 4PFOA 3DLLF 3A01B 1DP7P 1P7JA 1SD4A 3KE2A 2HVRA 1XGNA 2MH2A 3PNVA 4YEJA 3EUAA 3ZGKA 3F6VA 4U88A 4QTRA 2C6YA 2W82A 2D2WA 1RC9A 2BE5F 2R7TA 3BG6A 5J4VA 1XPXA 1QVTA 1OYIA 1R4NB 3NARA 3OYHA 1ZR2A 2F5EA 1CGPA 4Q47A 3OYMA 1REPC 3M07A 5GADJ 5CPRB 2EH3A 3K0LA 3K4KA 1K79A 3GTOJ 2EWNA 4A3LJ 2RAEA 1PYVA 5KAFC 4CH7A 2ZXHA 1W1WE 5LRRA 2BHYA 3ZR8X 4NQWB 1KA8A 1N75A 2XAQA 1FT9A 2DI3A 2R7ZJ 2YX4A 5FJ8J 2CS3A 4FCYA 1G3YA 5FKNA 3H5RA 3RPUA 5D5XB 2G7HA 3HBLA 2V26A 2X6WA 2K3PA 3TEDA 1G8XA 4AU7A 4A3JJ 1Z91A 4HEA2 1A35A 4Q48A 3PNYA 1IJWC 4BDZA 4IJAA 4CUGA 4FX4A 4Y33A 2W48A 4ASNA 3KEOA 3MD2A 3OSGA 1WSUA 2X0LA 2IXSA 2OA4A 2E2IJ 4A3GJ 4I02A 3BC8A 4BQAA 4E7IA 3LFUA 4O6JA 2K9LA 4EATA 2O5RA 4B4CA 4BGDA 5D5UB 2DK8A 3GXOA 1IRXA 5D5VB 2Y0SA 4YG2F 4M6VA 3NWSA 1IDYA 3LSMA 3J7ZI 2M4GA 3S3OA 2LY2A 1XSXA 1Z7UA 1D1BA 2R4GA 2EFPA 3IH2A 1G6NA 1Q1VA 3CCYA 1ZR4A 5EGOB 4RMNA 4AIKA 2M87A 2O7OA 4FE4A 4RAZA 2QUFA 1IN8A 1R5HA 5FKLA 2EPFA 2ID6A 4EV0A 2OZUA 4HPQA 2VI6A 3KPHA 2VBYA 1OFCX 4HAMA 1MBEA 3PSFA 4UB8C 5CJ9A 1TNTA 2H09A 3GLLA 5L3EA 3HOVJ 1SFXA 3L2QA 3HSFA 3FHNA 3BR3A 3CCRI 4KNYA 1DP3A 2CW7A 2OCEA 1T98A 2LKXA 2BEOA 4P9FA 4BXXJ 1IRZA 2ADUA 2WAFA 2NOJB 3CF2A 2QSFX 4IF4A 4HW0A 4KN4X 4IX7A 3BT9A 4HLXA 2DFIA 3CCEI 4BYYA 2VC1A 3F8CA 4MFDA 2IJLA 5GAHJ 4OOIA 3VEPA 3GZ6A 3GZNB 1JKOC 3ABMH 3O8GA 1V5FA 3SZPA 1IW7F 2EV0A 1S29A 3DEUA 1TP4A 1YS7A 1DDNA 3K10A 5GAEJ 2QLZA 4IRGA 4R8HA 3MKZA 1PDNC 3RPQA 4Y17A 4WF2A 2Q2EB 4A6DA 1JGGA 4A3BJ 1VTNC 2ZO4A 1D0YA 3PIPF 1YQAA 4MNUA 2M8EA 3IKVA 3DKWA 2HYFA 1USSA 1IRFA 2XASA 4N9IA 4UVAA 5DUIA 2LKPA 1XX5A 2H8WA 4MHGA 3S1MJ 1QGPA 4NBQA 1TNSA 2EFOA 3G2BA 2JT1A 2D45A 4IHWA 3RYPA 4AC0A 1STZA 2FQ4A 2G9WA 2Q2EA 3IC7A 2LYCA 3HTSB 2WV1A 4M73A 3CCUI 5J40A 2X6OA 4A93J 3LA3A 3ZMVA 3AL0C 4D9JA 1HW5A 3PIOF 2I10A 3PFIA 4DIQA 3D5LA 2HZTA 2VBZA 3OYNA 1QPIA 4AUXA 4C2UA 1QVUA 2KZGA 2QF7A 1USTA 4NHJA 3LSRA 1MKMA 2R7QA 3DU5A 2MC3A 2RKHA 2VE8A 1WFXA 4QPOA 2VPRA 5CVUA 4BH9A 5M5XJ 2J5OA 5J1YA 1X1BA 3M1EA 3KEQA 2CV1A 2M5WA 1FSEA 1V5EA 5F0CA 1K83J 5HLGA 4XR6A 1NK3P 4J00A 1EH8A 1WHUA 2BY2A 1OR7C 2CUZA 2KT0A 1KONA 1J59A 1OCCH 3TO6A 3VFZA 5TISC 4LFUA 3GZ5A 3WHCA 3PJRA 4WK8F 3AG4H 3I3LA 5M3MJ 1UMQA 4EJVA 4KISA 1B9NA 2BVLA 1ZRDA 1YITI 1HC8A 4JK1X 1XSDA 1IUFA 2OQRA 3DTKA 2R5ZA 3UKGA 1VQPI 3H0DA 3QPHA 3V4GA 4YFKF 1ZLJA 2M45A 5E3MA 5BPIA 2HXIA 3RI4A 1LJ9A 2ECCA 1I1SA 3E6DA 2M8GX 2E1MB 3A1YA 5JHFA 2XHKA 2VIXA 2WAQA 3O3KA 3CUQC 1QHHD 3K7AJ 2OJED 2ECBA 4RB2C 1FP1D 1EKEA 3HC7A 4HDVA 1N78A 3BR5A 4JYKA 3TKYA 4BE2A 1L3LA 1F43A 2LBFB 1IN4A 2BOLA 2LNBA 4LOCA 5FB2A 1B59A 2VB6A 4LGWA 3QU3A 2EZLA 1XN7A 4KA4A 3IRRA 5F6FA 1H88C 4LB5A 1IV8A 4MQ9F 2EQRA 2DK5A 4C3JJ 3TO9A 1MDMA 1OCRH 3HOUJ 4OMZA 2JA7J 1HQCA 2Y9ZA 4BS9A 1E2XA 1W0TA 2JQ7A 3IUOA 4BBSJ 2DJNA 3L2RA 4OU0A 1JTXA 1YIJI 4N4OB 1RRJA 2QM3A 2V79A 3DEWA 2JZYA 2BXZA 1RNLA 4HQMA 3ZQGA 3SXYA 4V19K 3BY6A 3WTTC 1X3ZB 2NVQJ 1XD7A 2FF4A 3OYDA 2OPTA 3BTLA 5KHDA 2W24A 2COBA 3QOPA 2IGMA 1J75A 3K4CA 2IS2A 1Z77A 1U5TB 2N8GA 3LSTA 2BY0A 3K69A 1L0OC 4HV6A 5EZGA 4P5OA 1K7AA 1Y8RB 1AWCA 3PFYA 1YE9A 4EMSA 1DU0A 3JRGA 1B1BA 2JMWA 2H27A 3I4NJ 1PJRA 3OMYA 3CC2I 1S8NA 2IEKA 3PQKA 1BW6A 2XAHA 4ETSA 3FZVA 4X1EA 4PSXA 2CJJA 2V9KA 4FHTA 4QLCU 3ZQIA 3GYHX 3J81K 2FJ1A 5DYMA 1TL8A 1BJZA 2E7WA 5JVGF 2ISYA 3KP6A 1JUSA 2PG4A 4LMYA 3DFGA 5E8GA 5HLTA 1CQTA 4CCLA 1DGRM 4OWRB 3HRTA 1BN5A 1VQ7I 1KYZA 1K4SA 1NTCA 2G7UA 1WI3A 2K5CA 1DQUA 3GFJA 4ZYHA 4V2FA 4OINF 2XSDC 5AIPA 1V55H 4BQQA 5LGNA 2H1KA 2LKSA 4XLPF 1B72A 5B3SH 1W4MA 4XORA 1RPWA 1X2NA 4XOPA 1Z6TA 2DMUA 4HG2A 3O2PE 1P9QC 2PJRA 2PI0A 2RNGA 4DJAA 4YRVA 1S7AA 2JRMA 5J8FA 3BDDA 3Q9VA 3BP8A 1R1VA 3EPZA 3OIOA 4AYBN 5DV5A 4ESBA 2MYSA 1GLNA 1O3RA 3S2HJ 3GVAA 2Z33A 4DW6A 5F04A 1BR4A 5JVTA 1X1CA 1ITYA 1BA5A 1BR2A 1QZZA 1MBHA 3MZYA 1ZK8A 4A3FJ 2V6EA 3TGNA 2FNPA 2H6BA 2OD5A 2KHMA 3ZPLA 3ZRGA 3E0JB 3WU0A 1D1AA 1FOYA 3NWTA 2DOFA 4O3MA 1HKQA 1OQYA 4XNFA 2BY1A 2XPUA 3FKJA 5K5QA 4L9VA 1KGSA 4LLGF 5FRNA 3GEZA 5IP6A 3MN2A 3GX4X 2HEOA 5HLHA 3RTRA 4XSXF 3W3CA 4G7HF 3NAUA 2RC4A 1GHCA 1FMWA 2PMZA 1BJAA 1MJ9A 1LVAA 1OR7A 1X19A 3CC4I 4F7ZA 1R36A 2EZKA 4A3EJ 2PBIA 2DBBA 1MD0A 4Y7NJ 4KDPA 5LRSA 3S17J 2L7ZA 4ENMA 1MMDA 2R7VA 3I54A 2IT0A 5DTDA 3WTVC 4KT5C 2LH9A 3BJ6A 2B9SA 4HV5A 5DEQA 1G2HA 3FKIJ 3ERMA 2L0KA 3OL3A 4PGGA 3DV8A 1LVKA 4CO8A 4PJMA 4ZC3A 3U9GA 4BBRJ 1IG7A 2CO5A 1YX5A 5EG0B 3I56I 3IWFA 3AG1H 1VQ8I 4IEJA 2FQ3A 4HF0A 4IHVA 1T08B 2XF5A 2LMDA 4XL9A 4C2TA 3I59B 6PAXA 3IP4B 4LD5A 1UG0A 3WTYC 4ZZLA 5ICCA 4A3KJ 5JHUA 1FEXA 3CO6C 5F0HA 1VQMI 1KU2A 1FOWA 1A6IA 3BWGA 5J3LA 2LF8A 3TW7A 3ZMUA 1XC5A 2QYOA 2HDDA 4Y52J 3DU6A 3ABKH 4A12A 1Z1DA 3DQVC 4IOCF 2DA2A 1XCBA 4LJZF 2VT2A 5D8KB 1YTYA 4HNVA 1R5GA 5IT3A 4KFCA 4RDUA 1ZGJA 5M3FJ 3M8JA 3P5JA 3QWLA 3WTUC 1JJ6C 1YYVA 1BC8C 5J6XA 4BAYA 3OSFA 2JA8J 1K6OA 2WTEA 2ZNYA 4G7OF 3V8JA 1TWFJ 4G7ZF 2FBIA 1YS6A 3ZQFA 1RR7A 1ETOA 2KJBA 3V8KA 1FOXA 3LL7A 2AQEA 1AOYA 2JSPA 1FBSA 3JR9A 1YW8A 2BV6A 5F64A 2P8TA 2DU9A 2L7KA 1IC8A 1HCRA 5A2QK 2E35A 3IKTA 4D5FA 2E5ZA 2IPQX 1FIPA 3LQRA 1SFUA 4CCMA 3OS1A 4B44A 3CJNA 3J80K 2W4SA 4M6YA 1LEBA 5AONA 3LWFA 4RAFA 5E1ZB 5D8LB 1UG2A 5D4RA 1VQOI 2E71A 2L7MP 2DXIA 2JTVA 2LOOA 1S72I 4DQ2A 5F1RA 2GIVA 3E6BA 2BYVE 2ZCWA 1OCOH 1MJBA 2L54A 2XGCA 4Y15A 2NVTJ 1W0UA 2VOPA 2CFXA 3WG7H 2KKOA 2GXBA 1YJWI 4LLLA 2AQFA 4PSWA 3OR2C 1XDUA 3CTAA 3HUGB 4M3FA 5J1RA 1B6AA 3VYRB 3HGYA 2MLGA 3W2VA 2UXXA 4WXDA 3OYLA 2W85A 3SHFA 4M9XA 1HF0A 3HTUA 2KIUA 2RQQA 2NNNA 3SDGA 3DBHB 2I5UA 3NQOA 1K78A 3C7JA 2D1VA 3LA7A 3H36A 4FE7A 1OCZH 3KYLA 3CCQI 2VKEA 1UZCA 1DUXC 1J2XA 5H2FC 3TW6A 2ZJPF 5GPAA 5K1YA 1JE8A 3KFWX 5HS8A 3G1LA 4E7HA 5BMZA 3V8LA 3CJRB 2QGUA 3BR2A 1YRNA 2A6HF 3VDXA 1QQIA 4LG0B 1RESA 3H35A 1QZYA 1FWZA 3J81Z 3ECOA 4XLEA 3ZQHA 1BL0A 2LK2A 1VQ6I 2OTLI 1VNDA 2STTA 1LE8A 3K2ZA 1YI2I 1MBGA 4LITA 4CYDA 2VJIA 1JUMA 1KYWA 5EEGA 3HOWJ 1MMNA 4RLFA 3WE3A 3C3WA 1YRNB 2OBPA 3EQLF 3OYJA 3EETA 2IS4A 1Z9CA 4RM3A 1YG2A 1KU9A 2L2OA 3FXOA 2KISA 3U2RA 2FMYA 1RR8C 5CVJA 4N4NB 3LSKA 3RCOA 2IGNA 2MH9A 4KT6A 3ABUA 3CCJI 2VT3A 1SD6A 4PJJA 5E8IA 2DMNA 1U9OA 2VQCA 2YS9A 2ZJRF 2X85A 3M8EA 1N25A 3GFIA 4MO7A 2OZ6A 3BG5A 3ZMDA 3S3NA 1WKMA 4UUSA 3M1CA 4S0HB 2NVUB 1A36A 2CYYA 3IWZA 1ERDA 5BPDA 3K9TA 2V9VA 4EM2A 3MKWB 3A0HC 4B48A 1TC3C 1TWAJ 3FIWA 3FXMA 1S7EA 1POGA 2HU9A 3GF2A 2DQLA 4D5CA 5LFAA 4XKBA 4BACA 4UV8A 4HZFA 3I55I 1ZARA 3DXJF 3LMMA 3BCAA 2LFBA 2WC2A 2V4JC 3CMEI 2CGPA 3QODA 2O61A 3FBIB 1EH6A 3QPLA 2H8RA 2EIJH 4UVCA 2FU4A 2IW5A 1T2KA 2OV7A 1VQKI 1WJ5A 1FYMA 1S5LC 4JBAA 2L9RA 2W7NA 3OYGA 2HGCA 4JP0A 1ZLKA 3Q0VA 4LIVA 3K4JA 1I39A 2L5QA 1I1GA 1RI7A 3F8MA 3HKZN 5J4YA 5HNFA 1U8BA 3CLOA 2VASA 4CICA 3WTWC 1LE8B 5J1UA 4GRIA 1ZGAA 1O4XA 3F72A 3SFIA 2CQNA 4P55A 5DCMA 3T8RA 4J01A 4BL0B 1FZPB 4DYCA 3PO2J 5F27A 1YJ9I 1H9GA 1TQMA 2KLOA 2A05A 1TW2A 2QEXI 2XB0X 2EIKH 2R7RA 4BEHB 2LVSA 4DGWB 1R58A 3K70D 2RGVA 2Y69H 5ERIA 2BW3B 3AG2H 3QQAA 4WX9A 2E1NA 3VYSB 1GDTA 3ZXSA 4F93B 2WY7Q 4NDLA 1A5JA 4G6QA 2ID3A 1BIBA 1U5TC 3U1DA 2MGQA 3RKQA 4XIDA 1F9NA 3QYFA 5H6RA 3CF5F 1HW2A 1QHGA 4E70A 5IYCJ 3O6BB 4N0BA 4GCVA 1SC7A 2OQGA 3ROUA 2QQ8A 4M3EA 3GBGA 1T38A 4M3DA 5ICGA 3DPLC 4XKWA 4CYCB 1GV2A 2RDPA 2ZJQF 4UY8I 1SAXA 1MJAA 1LFPA 4I2OA 3RIRA 3ZCOA 5EF6A 1ENHA 2F2EA 3PQJA 5HS9A 1J0RA 1A31A 4P1WA 3U21A 4OIPF 4G6DA 2FUG2 1FYKA 5HLIA 1I3QJ 4NC7A 3P9CA 2PX9A 3WODF 4IL6C 2STWA 2VUMJ 1AHDP 3OYCA 3AL0B 4IQ4A 2QQAA 1O3TA 4DYRA 2HPIA 4UUSB 1JKQC 2GBYA 2XB5A 3CDLA 1RUNA 3KLOA 2PN6A 2XAGA 3JREA 1SD7A 3ZP5A 1R71A 1I6XA 3OL4A 2X48A 1YO5C 2A5WA 3VYUB 3SDBA 2KL4A 3FXRA 1BW5A 4NUBA 2NRAC 3JRAA 3IH4A 4RS8A 5HDGA 3G6EI 4AIHA 3DWLE 1B4AA 1SANA 2VJ4A 1HW1A 1SAUA 5JR3A 2GM4A 1MMSA 2NS7A 3B6CA 3LAJA 2QBYB 1JUPA 1WJCA 1ZHFA 2ZXJA 3HKZA 4FQGA 5FD5A 4FETA 5IYBJ 1FPQA 1IRGA 1QNTA 1IF1A 4DBQA 5A2QZ 2DOEA 3QRFF 4BY1J 3LA2A 1BR1A 2WB1A 4FISA 2ZSHB 3R6SA 4HRIA 2DDBA 3OOPA 4FASD 5GTIC 1HDPA 1OJLA 3CESA 1TQIA 5ED4A 1MNMC 2WBMA 2XAUA 4B09A 2ISZA 4KIBA 2IS1A 2MFZA 4G9YA 5F1JA 1QZEA 3S15J 2DPDA 1JGSA 4YFNF 1E3HA 4HA8A 1LFBA 3PUBA 1QO0D 4L5JA 1P2FA 1XMAA 2JSCA 2Y0MA 1W36D 3ZQLA 4MQVA 4F52A 3CUQA 1W36C 3FXUA 2M0CA 3BJOA 2HPMA 3JRFA 2DMQA 2VKVA 3B73A 3KCCA 3NRVA 2AHQA 2MD0A 2O03A 3HSRA 1MSEC 4XLAA 3E6CC 3RKWA 2VPLA 1R5ID 2WWYA 4ZYEA 1D0ZA 2EILH 1GXPA 3FBNB 1UHWA 1W5TA 4A0XA 2MABA 3WTXC 4A3DJ 3Q0WA 1SEUA 3E7LA 4A3MJ 3FM3A 2DA1A 1JKPC 4KN7X 1E3PA 4AD9A 3JTGA 4YIFA 2TCTA 3G3ZA 2HOSA 5L3DA 4BQOA 2VXZA 2NXNB 2CW0F 1VI0A 3ASOH 1PP8F 3LSGA 2LG4A 3T0YA 4PFPA 1T56A 3BJAA 5B1AH 2OTJI 2MA3A 3VODA 1LFUP 4A6EA 2CUEA 3HDDA 1MMGA 3BR0A 1I3AA 5CVVA 1FBQA 4M9ZA 2AXTC 4C3HJ 5ICEA 3HRSA 3N4MA 2F4OB 2EZIA 3ELKA 2A68F 3FXLA 2DFEA 2IA2A 1RZ4A 2DA6A 1EH7A 4HOBA 3HOZJ 4L9NA 1R49A 4IRHA 1FLIA 1E17A 2Y48A 4S05A 4G6TB 3OYIA 2EA2A 1T39A 4N9HA 4NB5A 4HLYA 2QSHX 2V1UA 4LK1F 5FKOA 3SEZA 4E7LA 2R92J 2YU9J 3M7GA 1MW7A 1BIAA 1ZELA 5L3GA 5DCFA 1Y39A 2CMPA 3SJMA 2F5VA 2NS0A 1WJBA 4FT8A 4BU2A 4CSWA 2DA4A 1IN6A 1ZREA 2BBYA 2FXAA 5F0FA 4O5VA 3TP3A 1ACIA 4XMYA 1ORKA 2NVXJ 1FTZA 1ZN2A 3GTLJ 1NK2P 3I71A 4WWCA 2WV0A 2DMPA 4DYQA 3F8NA 3MMYB 1B72B 2E1CA 2OAZA 3JTHA 2R7XA 3F22A 3D1NI 1R00A 3FX3A 3HOYJ 1IXCA 3VPRA 1TWHJ 1F36A 2X1CA 2CV0A 1TT5B 4BHBA 4EEFG 4B47A 4GXOA 4A3CJ 4ZDOA 2IRFG 3ULQB 4ZDPA 1FJLA 3HRUA 4U87A 5JFRA 3LOCA 1J5YA 1Q1HA 1BOAA 1T0FA 1VQNI 2EV5A 5TJJA 4A5MA 3E5QA 2QWWA 2H94A 1IXSB 3LFKA 4M71A 2ZXIA 2QBYA 2QZ8A 3MQ0A 4M9SA 5L3FA 2PJPA 4XLNF 3KZYA 3S93A 3BG9A 3LAPA 2JA5J 2XKOA 1RETA 2CQQA 2WADA 4CGZA 3EYIA 3SEQA 3LQQA 2UV1A 2M9HA 1F4KA 4DOZA 4M72A 3ZQQA 2RN7A 4IHXA 3S14J 1MNDA 2BHZA 3HPGA 3BG3A 4A0ZA 1IAWA 2XF6A 4L0ZB 3CDHA 4RB1A 1K6YA 5ICFA 4CZCA 2W84A 1JTYA 1XB4A 2W25A 3L09A 2WY8Q 1H0MA 5K7ZA 3I4MJ 4CYCA 2BW3A 4XN0A 5E3OA 3OYBA 1DPUA 1D5VA 1LNWA 2ZJ2A 4D7MA 1Y8QB 4R79A 2GIZA 3JRCA 4HX8A 3U1KA 5CLSA 4BE1A 2MSYA 4LK0F 2R5YA 4ANJA 2K27A 3ZMZA 3S1RJ 2EINH 2IP2A 3CCSI 2JUCA 4MEXF 3OY9A 2YX7A 1W7PD 2XGDA 3FISA 2DLLA 3K4BA 4HSTA 1Y1WJ 3ZMTA 1D8JA 5FGMA 4YELA 2A6TA 4U7DA 1B8IB 3LSIA 1SFEA 5B66C 3IRQA 1UAAA 3F21A 3EUKL 3ML6A 1IGNA 1I50J 3IL2A 3Q5FA 1UB9A 2FEZA 2JPCA 3I0TA 5TGTA 4MLOA 2F4MB 1KU7A 1FMVA 3K1PA 3MKLA 2A07F 4JX5A 1TQPA 5KVRA 1D5YA 2HDWA 3H5NA 1UCRA 2L9NA 3GFLA 2CWEA 2VBXA 5CVIA 2R7SA 2ACJA 2VN2A 1PVEA 4ABZA 2A69F 4H0EA 1TZLA 2K40A 3N05A 4RM2A 1U3EM 1UJ8A 3ABTA 2PMHA 2P6TA 2D1HA 1DGWY 1JT0A 2HOTA 2B63J 2DYRH 3HHGA 4AVPA 2H6CA 3HOSA 4B3AA 3CQZJ 4R1HA 3OYAA 3AAFA 4AIJA 2PEXA 2WAQN 5CQGA 4MEYF 1R1TA 1KQ0A 5GPCA 1V5GA 1WH7A 4IHTA 2EBIA 4ZZDA 1XG1A 3HSEA 4IRIA 3TDUC 3JRHA 3HYIA 4KUMA 5EYRA 5FD6A 1TTYA 1XTAA 4PJLA 1H9TA 1X4PA 1KQ8A 4LIUA 5HODA 3JW4A 3GTGJ 2DYSH 2E60A 3QYEA 2Q8KA 4XRSA 1MH4A 1I27A 4AIDA 3J7AY 4JQFA 4CCOA 4FTHA 3JAMK 2F5FA 4I76A 1OCPA 3ZN0A 3EUHA 1Y0UA 2F5CA 1OISA 4OIOF 1Z05A 3QAHA 1W7PB 3RKYA 2VONA 3B02A 1R1UA 2K9QA 5BS6A 1YFHA 2HI3A 3HG9A 5KCMA 1SVOA 3RYRA 2DT6A 5IT9Z 2KPMA 2EIMH 2Z2SB 1WJFA 2ZMEA 4BE0A 1HSTA 4HYEA 4XK4A 2FA5A 4EJUA 3IV5A 1BBYA 5B1BH 4ESJA 3KP3A 3ZMSA 2HQRA 2DT7B 1R23A 3PL8A 2L7FP 3I59A 1YIOA 1VQLI 2DJIA 3FDYA 2CRGA 2YR2A 1BOBA 3MCZA 3FHZA 3KX2A 4Z6YA 2R3SA 2KIFA 2KFDA 4BY7J 3HJEA 1TLHB 4JX6A 3L9FA 1XGMA 4V2GA 5D6FA 4P9UA 5DUKA 2JA2A 3W6KB 5H6QA 3ZN1A 2LDUA 3FK6A 2UWMA 2L9SA 3DLAA 4PJ0C 4KIFA 4BHPA 2DQRA 2L02A 4M6XA 2HTJA 1WWXA 2M30A 1HXDA 2Z9OA 2XUBA 1BI1A 3JSOA 1WJDA 2PMUA 2E34A 2JVGA 3A03A 2QKMB 2R7OA 4ESFA 2HOEA 3RDIA 3BROA 3COAC 4OIRF 2KRHA 1W7PA 5CYVA 2P7VB 3CCVI 2W57A 4KYWA 2JRTA 4QWQA 1MSFC 1S3JA 4KMFA 1ON2A 1MZBA 4II2A 2AS5F 5E20A 1SD5A 1HKSA 4L18B 2HQNA 2XGXA 3CD6I 4ZDLA 1R22A 4EGYA 1PUFB 1Z3XA 4CXFA 1RKTA 1ZG3A 4CHUA 4KIGA 5FLXK 2B7EA 4ENKA 4BQNA 2W00A 4GFBA 5KNLA 3M9AA 1FOKA 2V1NA 2L4MA 2ZMEC 2O3FA 4L0YB 2MD5A 3UR3C 1LB2A 3WHBA 2IS6A 4CCNA 1YOVB 2DA5A 3FXJA 3R0AA 5LBQA 1LKXA 3L1PA 3K70C 2Q0OA 3WTZA 3EDPA 2R0QC 3TBIA 4OIQF 2F5DA 3CO7C 4CCKA 2XDVA 3J7YJ 4MFEA 4WXCA 4YFXF 2LY1A 1CF7B 1MBFA 2GOMA 5JLWA 2VJJA 3K4NA 2NNYA 4E7KA 3HM5A 5D4SA 2COMA 1QU3A 1P4XA 2KRCA 2V9PA 2P0WA 4W1UA 2YSRA 2GA1A 3NEUA 4RAYA 2JVHA 2XVCA 1KU3A 4GYGA 2HR3A 4YIIA 3W2AA 1FX7A 1NG6A 4XRFA 2XF7A 4Z2YA 1T6SA 4GGGA 2LTPA 3MEXA 4DZPA 3V7SA 3K6GA 2ESNA 2MW8A 2M0MA 2R7WA 4NC8A 2O8XA 3EYYA 3QOEA 5DM7F 1OYWA 3GO5A 5FKKA 3RQIA 3ERED 1JI8A 3G73A 2R5ZB 1D3YA 1JT6A 2LREA 3ZQCA 3KP7A 4B3XA 1G4DA 2F48A 4E7SA 2O8KA 2HZDA 1VFCA 2NS8A 4XLHA 2CU7A 3DKYA 5CVRA 2HQAA 3HUGA 1G3WA 5L3CA 3KEYA 3BTJA 1VQ9I 1HSJA 3QYBA 2EFWA 3UNGC 4DBRA 2ZMEB 2HVQA 3S8PA 4HNUA 5M5WJ 4BDYA 1K78B 4NC6A 2DDAA 3OWTA 4Y13A 2OCCH 2ZXWH 4U7BA 5K5RA 5FLMJ 3GMEA 2RV8A 2DW4A 4HBLA 3BQYA 5DD8A 4IOAF 1BC7C 3HZJA 2OU2A 3H92A 2LY9A 1BM9A 5FFZA 2CW8A 2DO7A 2LR8A 4B8XA 1P4WA 2V1DA 3P9KA 2JPBA 5E79C 5HVQC 1HLVA 5DD4A 4XKVA 1T95A 2IGOA 2ZNZA 3RQ4A 3JAMZ 2CH0A 3DTEA 4I0BA 5GP9A 1XMXA 3DBLB 3KETA 4EJOA 4G94A 3TP0A 2D5VA 2IBDA 5IYDJ 1G3TA 3T5XA 2O6GE 3CP8A 3S2DJ 2KRFA 2X51A 3L2CA 5K5OA 3IAM2 1ZTRA 4XM3A 2HOAA 2WB1N 4K2EA 3KP5A 4OAZA 3F9KA 1LQ1A 1VQ4I 1MBKA 3SZTA 3DP7A 4IHSA 2AXLA 2X6XA 2VQHA 3BOQA 3AG3H 3DPTA 1VF9A 3I4PA 2Z99A 3H0GJ 2CG4A 4XKCA 4BXUA 5K7HA 4HDUA 3K1MA 2HYJA 2IA1A 5FFXA 1YW7A 3SYTA 3VB2A 3SZGA 5HS7A 2ICWG 2CQKA 2X1DA 3D5SC 1KZHA 3C2HA 5GTHC 4IO9F 4Q5SF 1EV7A 2E7XA 2PJRB 2QCOA 4JOMA 1H8AC 2EV6A 3R60A 5K7FA 3W6VA 1R4MB 1ULYA 3N97A 2VODA 2EZHA 1HA8A 3QP6A 4M3BA 3TO7A 3S2WA 4S04A 2X9DA 4A0YA 3E5UA 5ILUA 2XROA 2HTSA 3RPUD 2W1OA 1I5ZA 1MH3A 2JUGA 3HIFA 5LEKA 3GFMA 4EJTA 1Z21A 4OMYA 1PP7U 1U8RA 2V6CA 2RVCA 3FWEA 3I58A 3KP4A 3OIQA 3H5AA 3FK7A 3G1MA 1XGOA 2KIQA 3GCMA 5AIQA 4XRSG 3Q0UA 2XV4S 1Y6IA 2K3FA 3A0BC 3REOA 4QIWN 4EGZA 1ONVA 4KITB 5FRMA 4XONA 4AYBA 3V7CA 3BPXA 3GUDA 4GO1A 2TRTA 3C2GA 1GUUA 4RAGA 3QP5A 5EGOA 3H9JA 3P7NA 3TOAA 1ETXA 1KQ9A 2DA3A 2K9NA 4X6AJ 2HVSA 2XPWA 2EJRA 5D6EA 1UELB 2Y2ZA 2K4JA 3F0CA 3WGIA 3TDZC 1WQ2A 2VQLA 3BPVA 2MG4A 1MGTA 3VSLA 1O57A 4BJ6C 1PUFA 1K61A 3CCMI 1OCTC 2CFOA 2XAFA 4Y3OA 5EZHA 5C4JJ 3OIPA 1ZG5A 5C44J 5DDGA 2O9LA 3FMRA 2FNAA 4I98B 2ZB9A 3KZZA 2VJ5A 3HRMA 4RGSA 2K9MA 2ZBKA 2BY3A 5FKMA 5DS9A 1HKTA 4RA2A 3IH3A 4A5NA 5CQEA 2XRNA 1AKHA 1GT0C 2AO9A 2L9VA 2PQ8A 4IPAA 2QQBA 1UHMA 2DTZA 4LG0A 3CP2A 3J80Z 4XBFA 1RKWA 1Z7LA 3I53A 2Q1ZB 2X6YA 2XIGA 1YHQI 5HNHA 1DU6A 2FBKA 2K4BA 1SVLA 1S7OA 4JX4A 4HSRA 3HHHA 5E18F 1B9MA 3GTJJ 1LUJB 1S6LA 2P5KA 1VZ0A 4Q4ZF 1WJEA 2FOKA 3BTCA 4LLNA 2JJ7A 1C0WA 4PCQA 3KLNA 1OPCA 1JKRC 4CZZA 4HF2A 3C2BA 4BUPA 4U0YA 4RB3C 3BG7A 5D5WB 4HX4A 2MBFA 1XSVA 1ETKA 2ZFUA 3R4KA 2LLKA 3S1NJ 3CC7I 2EFQA 1NH3A 2JA6J 1EA3A 1WJAA 4EM0B 3J7AO 1SMYF 3PUFA 3W2WA 2A5YB 2KIMA 2M4KA 3KIOA 4PGHA 3K4MA 4I0AA 5E17F 4P96A 2DN0A 2YUSA 3VSKA 1LDJA 1O7FA 4D0PA 3JSPA 2IA0A 5IT9K 2P81A 5DM6F 3OS2A 3JCUC 4WCGA 1U9NA 2VBWA 2ZKZA 3EUHC 4H4KC 2JN6A 5FLVA 4II3A 1O7LA 4B43A 4I01A 3TQNA 2NOGA 4UHTA 2HKOA 2GAUA 3DEEA 4BJTA 4RLQA 2GXGA 2VE9A 5LHIA 1WVRA 1Y0NA 2Z3YA 4IKFA 2QA4I 3BR6A 2NAZA 5FLXZ 3AKZA 4BJ5C 4ZYGA 3V7RA 4G12A 3HOTA 2VC0A 1LEAA 2ZFWA 3ESWB 4C2MJ 4PK4A 5LHGA 5E3NA 1JHHA 2GWRA 2WAEA 3BZCA 5KAIC 2QVOA 5LLQA 1APLC 1JXSA 1U78A 2DCEA 2GA2A
chains in the Genus database with same CATH topology
2E2IJ 4A3GJ 3DCFA 4ABZA 1HF0A 2K40A 5IPAA 2Y30A 3SDGA 4B4CA 4FE7A 2VKEA 2HOTA 4M6VA 3TW6A 1JT0A 5GPAA 2B63J 1ZKGA 1IDYA 3HGGA 4B3AA 9ANTA 3CQZJ 3G1LA 2WAQN 5GPCA 3BR2A 1YRNA 1WH7A 3IH2A 2EBIA 1RESA 1XG1A 1Q1VA 3CCYA 1ZR4A 5EGOB 5JLXA 2O7OA 3ZQHA 3JRHA 2LK2A 4FE4A 1BL0A 3GTPJ 5EYRA 1VNDA 5FKLA 1LE8A 2ID6A 5HODA 3GTGJ 1MBGA 2ME0A 5EDNA 2VI6A 2XGEA 4XRSA 1MH4A 1JUMA 1OFCX 3HOWJ 4FTHA 1ZQ3P 4I76A 1MBEA 1OCPA 1YRNB 3HOVJ 1ETWA 3JRIA 3BR3A 2LKXA 2K9QA 4BXXJ 1WGXA 1IRZA 2IAIA 2HI3A 4J19A 3BT9A 4MFDA 4XK4A 3IV5A 1Y1VJ 3HB9A 1JKOC 2L7FP 3O8GA 2DMNA 1U9OA 2YS9A 2CRGA 1ETYA 4MO7A 3BG5A 4UUSA 4S0HB 3M4OJ 4BY7J 1JGGA 4A3BJ 4JX6A 4V2GA 3BTIA 3FK6A 3CMYA 1TWAJ 3FIWA 1TC3C 1JJ8C 1S7EA 3G1OA 1AU7A 1POGA 1UHSA 4D5CA 3S1MJ 4D7NA 2E1OA 1FTTA 3BR1A 3GTKJ 4MIMA 1E3OC 4IHWA 2LFBA 3A03A 4AC0A 4DZJA 2FQ4A 3PM1A 2WV1A 4XICA 3QPLA 5IOYA 1XS9A 1Z0XA 2H8RA 2X6OA 1X2MA 4A93J 1IDZA 1MSFC 5C3EJ 2I10A 2L9RA 3B6AA 4JP0A 4C3IJ 3Q0VA 3PO3J 3HKZN 1QPIA 4AUXA 1QVUA 1U8BA 3RZOJ 2QF7A 1LE8B 1PUFB 5J1UA 1EF4A 3LSRA 2R93J 1RKTA 1O4XA 3SFIA 1ETQA 4GFBA 2VPRA 4DYCA 3PO2J 5F27A 5M5XJ 5J1YA 4XRMA 2KDZA 1FIAA 5F0CA 1K83J 3WHBA 1NK3P 2XB0X 3O8HA 1B8IA 1TWCJ 2DA5A 1MBJA 2LVSA 2KT0A 3L1PA 1QRYA 1SFOJ 5M5YJ 2JWTA 3QPSA 2E2JJ 2CUFA 3QQAA 3WHCA 2R0QC 1GDTA 4NDLA 1A5JA 3BQZA 2ID3A 4RBOA 4QSHA 5M3MJ 1UMQA 1HOMA 4MFEA 2MGQA 3RKQA 4XIDA 3A01A 1IUFA 2CQXA 2R5ZA 3UKGA 1MBFA 5JLWA 3JRBA 5IYCJ 3HM5A 2K9SA 5E3MA 4M3EA 3GBGA 3HEFA 4M3DA 2HXIA 4CYCB 1GV2A 2ECCA 5EG0A 2M8GX 3K2AA 5EF6A 3K7AJ 2ECBA 1ENHA 4W1UA 1I6HJ 5IP7J 3BR5A 4JYKA 1F43A 1I3QJ 1X58A 4LOCA 2Y9YA 2VUMJ 1AHDP 2LTPA 4DZPA 2EZLA 4B1RA 2MW8A 2ELKA 4DYRA 4UUSB 5FKKA 3RQIA 1JKQC 1H88C 2GBYA 2R5ZB 4M3GA 1JT6A 2JK3A 2XB5A 3CDLA 2Y31A 3ZQCA 5IOZA 3JREA 2EQRA 2O8KA 2FX0A 4C3JJ 1VFCA 2NS8A 2X48A 2CU7A 3HOUJ 2JA7J 2Y9ZA 4L5EA 1W0TA 3BTJA 5EEAA 4BBSJ 2DJNA 1BW5A 3JRAA 1JTXA 3IH4A 5M5WJ 1SANA 3S1QJ 3DEWA 3S16J 3ZQGA 2GM4A 2NS7A 3B6CA 5FLMJ 2NVQJ 2FD5A 1H89C 1JUPA 3BQYA 2OPTA 3BTLA 5IYBJ 2HQ5A 2COBA 2LY9A 1Z77A 2LR8A 2M2EA 2N8GA 4BY1J 1HLVA 4FISA 5EZGA 1GVDA 1HDPA 2R5YB 1OJLA 1HDDC 3MVPA 5GP9A 1DU0A 2GLOA 3JRGA 2JMWA 3I4NJ 1MNMC 3TP0A 2D5VA 2IBDA 5IYDJ 2IEKA 5F1JA 3S15J 3GTQJ 1BW6A 3A02A 4X1EA 1TWGJ 2E19A 1WH5A 2CJJA 3S2DJ 3ZQIA 1LFBA 1ZTRA 2FJ1A 2HOAA 2WB1N 1BJZA 3ZQLA 1JUSA 2HXOA 1MBKA 1CQTA 2M0CA 3ZOBA 3JRFA 2DMQA 2VKVA 3GTMJ 2PMZN 2AHQA 1NTCA 1VF9A 1MSEC 1WI3A 2DMTA 3H0GJ 5K7HA 2HYJA 4V2FA 4A3DJ 2XSDC 3Q0WA 3E7LA 4A3MJ 2LD5A 2H1KA 3HOXJ 2DA1A 1JKPC 5E3LA 1B72A 2G0EA 1P7IA 2QCOA 2TCTA 2HOSA 3OOUA 1H8AC 1RPWA 1VI0A 1X2NA 5K7FA 3W6VA 3LSGA 2DMUA 1T56A 2EZHA 3LSJA 4M3BA 2X9DA 1LFUP 3HDDA 2CUEA 5IP9J 3BR0A 1IV6A 2LP0A 3OIOA 4AYBN 1MH3A 3S2HJ 4C3HJ 1WPKA 1GV5A 4DW6A 5F04A 2EZIA 1ITYA 2DA6A 1BA5A 1MBHA 3FK7A 3G1MA 3HOZJ 1ZK8A 4A3FJ 4BKXA 1R9TJ 2E2HJ 4XRSG 3Q0UA 2XRLA 4QIWN 2XPUA 5FKOA 2R92J 2YU9J 1ETVA 2TRTA 2NVYJ 1GUUA 3MN2A 5F08A 5IP6A 4W97A 5EGOA 3SJMA 2DA4A 3NAUA 1ETXA 2DA3A 2K9NA 4X6AJ 5F0FA 3TP3A 2XPWA 3LSPA 2ME6A 1ORKA 2NVXJ 1FTZA 2Y2ZA 3F0CA 3GTLJ 2EZKA 1NK2P 2DMPA 4DYQA 4A3EJ 1B72B 4Y7NJ 3S17J 2MG4A 2L7ZA 3D1NI 2OF7A 1PUFA 1K61A 1OCTC 5DTDA 3HOYJ 5EZHA 5C4JJ 5C44J 4I6ZA 3VPRA 1TWHJ 1F36A 2O9LA 1G2HA 4EEFG 2ZB9A 3FKIJ 1T33A 2L0KA 4A3CJ 4BBRJ 1IG7A 5FKMA 5DS9A 3IH3A 5EG0B 4A69C 1ZGWA 5BNGA 1WCMJ 2XPVA 4IEJA 1AKHB 1FJLA 1AKHA 4IHVA 2Y0SN 3JRDA 1GT0C 2AO9A 3LOCA 2M34A 2DTZA 1RKWA 4A3KJ 1FEXA 3LNQA 5F0HA 1DU6A 5J3LA 1A6IA 3TW7A 3BG9A 2JA5J 3H3VK 5C4XJ 1XC5A 3RZDJ 4JX4A 2HDDA 4Y52J 1RETA 3GTJJ 2CQQA 2DA2A 3Q3SA 4IHYA 2M9HA 4HNVA 3M3YJ 3BTCA 4IHXA 3S14J 2JJ7A 2DA7A 3BG3A 4RDUA 4A3IJ 4UUTA 3A01B 5M3FJ 1P7JA 1JKRC 1JTYA 3C2BA 1JJ6C 4QTRA 3OSFA 2JA8J 1ETKA 2LLKA 5K7ZA 3I4MJ 3S1NJ 4CYCA 1TWFJ 5E3OA 2JA6J 3ZQFA 1QVTA 1RR7A 1ETOA 4D7MA 3NARA 1ZR2A 3JRCA 3JR9A 2DN0A 2YUSA 2MSYA 2R5YA 1IC8A 2EH3A 1HCRA 3GTOJ 3S1RJ 4D5FA 1FIPA 2P81A 4A3LJ 2RAEA 1U9NA 2JN6A 2XGDA 1Y1WJ 3FISA 5FLVA 2R7ZJ 2NOGA 5FJ8J 4FCYA 5FKNA 1UG2A 1B8IB 2L7MP 3HBLA 3TEDA 3BR6A 4A3JJ 1IGNA 1I50J 4G12A 2XGCA 1IJWC 2NVTJ 1W0UA 4MLOA 4C2MJ 5E3NA 3MKLA 4JX5A 4M3FA 5J1RA 2W48A 3HGYA 1D5YA 1APLC 3OSGA 1U78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2I J;  4A3G J;  3DCF A;  4ABZ A;  1HF0 A;  2K40 A;  5IPA A;  2Y30 A;  3SDG A;  4B4C A;  4FE7 A;  2VKE A;  2HOT A;  4M6V A;  3TW6 A;  1JT0 A;  5GPA A;  2B63 J;  1ZKG A;  1IDY A;  3HGG A;  4B3A A;  9ANT A;  3CQZ J;  3G1L A;  2WAQ N;  5GPC A;  3BR2 A;  1YRN A;  1WH7 A;  3IH2 A;  2EBI A;  1RES A;  1XG1 A;  1Q1V A;  3CCY A;  1ZR4 A;  5EGO B;  5JLX A;  2O7O A;  3ZQH A;  3JRH A;  2LK2 A;  4FE4 A;  1BL0 A;  3GTP J;  5EYR A;  1VND A;  5FKL A;  1LE8 A;  2ID6 A;  5HOD A;  3GTG J;  1MBG A;  2ME0 A;  5EDN A;  2VI6 A;  2XGE A;  4XRS A;  1MH4 A;  1JUM A;  1OFC X;  3HOW J;  4FTH A;  1ZQ3 P;  4I76 A;  1MBE A;  1OCP A;  1YRN B;  3HOV J;  1ETW A;  3JRI A;  3BR3 A;  2LKX A;  2K9Q A;  4BXX J;  1WGX A;  1IRZ A;  2IAI A;  2HI3 A;  4J19 A;  3BT9 A;  4MFD A;  4XK4 A;  3IV5 A;  1Y1V J;  3HB9 A;  1JKO C;  2L7F P;  3O8G A;  2DMN A;  1U9O A;  2YS9 A;  2CRG A;  1ETY A;  4MO7 A;  3BG5 A;  4UUS A;  4S0H B;  3M4O J;  4BY7 J;  1JGG A;  4A3B J;  4JX6 A;  4V2G A;  3BTI A;  3FK6 A;  3CMY A;  1TWA J;  3FIW A;  1TC3 C;  1JJ8 C;  1S7E A;  3G1O A;  1AU7 A;  1POG A;  1UHS A;  4D5C A;  3S1M J;  4D7N A;  2E1O A;  1FTT A;  3BR1 A;  3GTK J;  4MIM A;  1E3O C;  4IHW A;  2LFB A;  3A03 A;  4AC0 A;  4DZJ A;  2FQ4 A;  3PM1 A;  2WV1 A;  4XIC A;  3QPL A;  5IOY A;  1XS9 A;  1Z0X A;  2H8R A;  2X6O A;  1X2M A;  4A93 J;  1IDZ A;  1MSF C;  5C3E J;  2I10 A;  2L9R A;  3B6A A;  4JP0 A;  4C3I J;  3Q0V A;  3PO3 J;  3HKZ N;  1QPI A;  4AUX A;  1QVU A;  1U8B A;  3RZO J;  2QF7 A;  1LE8 B;  1PUF B;  5J1U A;  1EF4 A;  3LSR A;  2R93 J;  1RKT A;  1O4X A;  3SFI A;  1ETQ A;  4GFB A;  2VPR A;  4DYC A;  3PO2 J;  5F27 A;  5M5X J;  5J1Y A;  4XRM A;  2KDZ A;  1FIA A;  5F0C A;  1K83 J;  3WHB A;  1NK3 P;  2XB0 X;  3O8H A;  1B8I A;  1TWC J;  2DA5 A;  1MBJ A;  2LVS A;  2KT0 A;  3L1P A;  1QRY A;  1SFO J;  5M5Y J;  2JWT A;  3QPS A;  2E2J J;  2CUF A;  3QQA A;  3WHC A;  2R0Q C;  1GDT A;  4NDL A;  1A5J A;  3BQZ A;  2ID3 A;  4RBO A;  4QSH A;  5M3M J;  1UMQ A;  1HOM A;  4MFE A;  2MGQ A;  3RKQ A;  4XID A;  3A01 A;  1IUF A;  2CQX A;  2R5Z A;  3UKG A;  1MBF A;  5JLW A;  3JRB A;  5IYC J;  3HM5 A;  2K9S A;  5E3M A;  4M3E A;  3GBG A;  3HEF A;  4M3D A;  2HXI A;  4CYC B;  1GV2 A;  2ECC A;  5EG0 A;  2M8G X;  3K2A A;  5EF6 A;  3K7A J;  2ECB A;  1ENH A;  4W1U A;  1I6H J;  5IP7 J;  3BR5 A;  4JYK A;  1F43 A;  1I3Q J;  1X58 A;  4LOC A;  2Y9Y A;  2VUM J;  1AHD P;  2LTP A;  4DZP A;  2EZL A;  4B1R A;  2MW8 A;  2ELK A;  4DYR A;  4UUS B;  5FKK A;  3RQI A;  1JKQ C;  1H88 C;  2GBY A;  2R5Z B;  4M3G A;  1JT6 A;  2JK3 A;  2XB5 A;  3CDL A;  2Y31 A;  3ZQC A;  5IOZ A;  3JRE A;  2EQR A;  2O8K A;  2FX0 A;  4C3J J;  1VFC A;  2NS8 A;  2X48 A;  2CU7 A;  3HOU J;  2JA7 J;  2Y9Z A;  4L5E A;  1W0T A;  3BTJ A;  5EEA A;  4BBS J;  2DJN A;  1BW5 A;  3JRA A;  1JTX A;  3IH4 A;  5M5W J;  1SAN A;  3S1Q J;  3DEW A;  3S16 J;  3ZQG A;  2GM4 A;  2NS7 A;  3B6C A;  5FLM J;  2NVQ J;  2FD5 A;  1H89 C;  1JUP A;  3BQY A;  2OPT A;  3BTL A;  5IYB J;  2HQ5 A;  2COB A;  2LY9 A;  1Z77 A;  2LR8 A;  2M2E A;  2N8G A;  4BY1 J;  1HLV A;  4FIS A;  5EZG A;  1GVD A;  1HDP A;  2R5Y B;  1OJL A;  1HDD C;  3MVP A;  5GP9 A;  1DU0 A;  2GLO A;  3JRG A;  2JMW A;  3I4N J;  1MNM C;  3TP0 A;  2D5V A;  2IBD A;  5IYD J;  2IEK A;  5F1J A;  3S15 J;  3GTQ J;  1BW6 A;  3A02 A;  4X1E A;  1TWG J;  2E19 A;  1WH5 A;  2CJJ A;  3S2D J;  3ZQI A;  1LFB A;  1ZTR A;  2FJ1 A;  2HOA A;  2WB1 N;  1BJZ A;  3ZQL A;  1JUS A;  2HXO A;  1MBK A;  1CQT A;  2M0C A;  3ZOB A;  3JRF A;  2DMQ A;  2VKV A;  3GTM J;  2PMZ N;  2AHQ A;  1NTC A;  1VF9 A;  1MSE C;  1WI3 A;  2DMT A;  3H0G J;  5K7H A;  2HYJ A;  4V2F A;  4A3D J;  2XSD C;  3Q0W A;  3E7L A;  4A3M J;  2LD5 A;  2H1K A;  3HOX J;  2DA1 A;  1JKP C;  5E3L A;  1B72 A;  2G0E A;  1P7I A;  2QCO A;  2TCT A;  2HOS A;  3OOU A;  1H8A C;  1RPW A;  1VI0 A;  1X2N A;  5K7F A;  3W6V A;  3LSG A;  2DMU A;  1T56 A;  2EZH A;  3LSJ A;  4M3B A;  2X9D A;  1LFU P;  3HDD A;  2CUE A;  5IP9 J;  3BR0 A;  1IV6 A;  2LP0 A;  3OIO A;  4AYB N;  1MH3 A;  3S2H J;  4C3H J;  1WPK A;  1GV5 A;  4DW6 A;  5F04 A;  2EZI A;  1ITY A;  2DA6 A;  1BA5 A;  1MBH A;  3FK7 A;  3G1M A;  3HOZ J;  1ZK8 A;  4A3F J;  4BKX A;  1R9T J;  2E2H J;  4XRS G;  3Q0U A;  2XRL A;  4QIW N;  2XPU A;  5FKO A;  2R92 J;  2YU9 J;  1ETV A;  2TRT A;  2NVY J;  1GUU A;  3MN2 A;  5F08 A;  5IP6 A;  4W97 A;  5EGO A;  3SJM A;  2DA4 A;  3NAU A;  1ETX A;  2DA3 A;  2K9N A;  4X6A J;  5F0F A;  3TP3 A;  2XPW A;  3LSP A;  2ME6 A;  1ORK A;  2NVX J;  1FTZ A;  2Y2Z A;  3F0C A;  3GTL J;  2EZK A;  1NK2 P;  2DMP A;  4DYQ A;  4A3E J;  1B72 B;  4Y7N J;  3S17 J;  2MG4 A;  2L7Z A;  3D1N I;  2OF7 A;  1PUF A;  1K61 A;  1OCT C;  5DTD A;  3HOY J;  5EZH A;  5C4J J;  5C44 J;  4I6Z A;  3VPR A;  1TWH J;  1F36 A;  2O9L A;  1G2H A;  4EEF G;  2ZB9 A;  3FKI J;  1T33 A;  2L0K A;  4A3C J;  4BBR J;  1IG7 A;  5FKM A;  5DS9 A;  3IH3 A;  5EG0 B;  4A69 C;  1ZGW A;  5BNG A;  1WCM J;  2XPV A;  4IEJ A;  1AKH B;  1FJL A;  1AKH A;  4IHV A;  2Y0S N;  3JRD A;  1GT0 C;  2AO9 A;  3LOC A;  2M34 A;  2DTZ A;  1RKW A;  4A3K J;  1FEX A;  3LNQ A;  5F0H A;  1DU6 A;  5J3L A;  1A6I A;  3TW7 A;  3BG9 A;  2JA5 J;  3H3V K;  5C4X J;  1XC5 A;  3RZD J;  4JX4 A;  2HDD A;  4Y52 J;  1RET A;  3GTJ J;  2CQQ A;  2DA2 A;  3Q3S A;  4IHY A;  2M9H A;  4HNV A;  3M3Y J;  3BTC A;  4IHX A;  3S14 J;  2JJ7 A;  2DA7 A;  3BG3 A;  4RDU A;  4A3I J;  4UUT A;  3A01 B;  5M3F J;  1P7J A;  1JKR C;  1JTY A;  3C2B A;  1JJ6 C;  4QTR A;  3OSF A;  2JA8 J;  1ETK A;  2LLK A;  5K7Z A;  3I4M J;  3S1N J;  4CYC A;  1TWF J;  5E3O A;  2JA6 J;  3ZQF A;  1QVT A;  1RR7 A;  1ETO A;  4D7M A;  3NAR A;  1ZR2 A;  3JRC A;  3JR9 A;  2DN0 A;  2YUS A;  2MSY A;  2R5Y A;  1IC8 A;  2EH3 A;  1HCR A;  3GTO J;  3S1R J;  4D5F A;  1FIP A;  2P81 A;  4A3L J;  2RAE A;  1U9N A;  2JN6 A;  2XGD A;  1Y1W J;  3FIS A;  5FLV A;  2R7Z J;  2NOG A;  5FJ8 J;  4FCY A;  5FKN A;  1UG2 A;  1B8I B;  2L7M P;  3HBL A;  3TED A;  3BR6 A;  4A3J J;  1IGN A;  1I50 J;  4G12 A;  2XGC A;  1IJW C;  2NVT J;  1W0U A;  4MLO A;  4C2M J;  5E3N A;  3MKL A;  4JX5 A;  4M3F A;  5J1R A;  2W48 A;  3HGY A;  1D5Y A;  1APL C;  3OSG A;  1U78 A; 
#chains in the Genus database with same CATH topology
 2HS5 A;  1D0X A;  3DTI A;  3WGG A;  2DPU A;  3DCF A;  2VXD A;  3OYK A;  5IPA A;  1DPR A;  1FY7 A;  2Y30 A;  4HX7 A;  2UUZ A;  1ODD A;  4M74 A;  5HOO A;  1W5S A;  2K7L A;  2ETH A;  2EB7 A;  1ZKG A;  2K86 A;  3HGG A;  9ANT A;  4BNC A;  4D1Q A;  2LBF A;  1ZG1 A;  1FBU A;  2BXY A;  1ZYR F;  4AVZ A;  1IN5 A;  2GOX B;  3HXL A;  2RRE A;  2HWV A;  5JLX A;  2WA0 A;  1W5C C;  1LDD A;  1YLF A;  3GTP J;  2E36 A;  3GW2 A;  1JHF A;  3KP2 A;  5J47 A;  5LGU A;  2VOO A;  1T8I A;  1FSH A;  3FMS A;  3E97 A;  4KIC A;  1U0J A;  2R7D A;  5EDN A;  2ME0 A;  2DOD A;  4ZYD A;  2XGE A;  3SQN A;  1XCV A;  1ZQ3 P;  1WZ2 A;  4WXH A;  1LDK B;  4BEH A;  2M7B A;  4UB6 C;  1ETW A;  4MTE A;  3JRI A;  4CCJ A;  1IO2 A;  1O3S A;  2HDC A;  1WGX A;  1A04 A;  2IAI A;  2L3D A;  4J19 A;  4UNO A;  3F6O A;  1R7J A;  3VYT B;  2IGK A;  2V7F A;  1F5T A;  3PNT A;  4IXA A;  3L2V A;  1T0F C;  2HYG D;  3TOB A;  4Y4R A;  1M1E B;  4KJZ A;  1Y1V J;  2MLK A;  3HB9 A;  2BVM A;  5LGT A;  2J5P A;  3D5R C;  3E1S A;  1CF7 A;  3KYC B;  4IZZ A;  5LEJ A;  1ETY A;  4RB0 A;  4GYI A;  1S9H A;  2CUJ A;  3MZH A;  4MGR A;  2KMU A;  3D0S A;  2ZC2 A;  4UVB A;  3M4O J;  3K1N A;  2ELH A;  2VQG A;  2FML A;  2P5L C;  4ZTF A;  3BTI A;  2FSW A;  3CMY A;  1BI0 A;  2R7U A;  1JJ8 C;  3G1O A;  1AU7 A;  3V42 A;  1UHS A;  2EK5 A;  2A3S A;  3X2Q H;  1GVJ A;  2X1E A;  1FTT A;  4D7N A;  2E1O A;  3BR1 A;  3GTK J;  4MIM A;  1E3O C;  2X4H A;  4RGR A;  4DZJ A;  3ECH A;  2F6C A;  1P92 A;  1G59 A;  3PM1 A;  2QSG X;  4YIR X;  1WRJ A;  4XIC A;  5IOY A;  1XS9 A;  4IQJ A;  1U2W A;  1Z0X A;  2DT5 A;  2DAO A;  5KK1 A;  1O3Q A;  1X2M A;  2MC4 A;  3OYF A;  1IDZ A;  1D8K A;  1XMK A;  3WG9 A;  4AM3 A;  2P6S A;  3TL4 X;  5C3E J;  3B6A A;  3OV8 A;  4C3I J;  3FF5 A;  3PO3 J;  2K85 A;  2HKX A;  4PJN A;  2BZT A;  4E7Z A;  3RZO J;  4EVI A;  2O0Y A;  1OMI A;  3HL2 A;  4E7J A;  1J09 A;  1EF4 A;  2R93 J;  2XAJ A;  1ETQ A;  4RGX A;  4I09 A;  1MMA A;  3ONQ A;  4XRM A;  2KDZ A;  1FIA A;  3F3X A;  1U6G A;  2P5V A;  3BCB A;  3O8H A;  1TWC J;  1B8I A;  3RJP A;  2XSJ C;  1MBJ A;  3CUO A;  3F23 A;  4ENJ A;  1QRY A;  4NQW A;  1SFO J;  4G8X A;  5EJC A;  4I7H A;  5BQT A;  2JWT A;  3QPS A;  5GAG J;  5M5Y J;  3Q9S A;  2E2J J;  2CUF A;  1IZ1 A;  3LSH A;  3BQZ A;  4RBO A;  4QSH A;  4GDF A;  1HOM A;  1R6R A;  2PLY A;  4EM1 A;  1P6R A;  2UXN A;  3CZ6 A;  3DF8 A;  2VLA A;  1UFM A;  1FNN A;  2RNJ A;  3WE2 A;  3A01 A;  2CQX A;  2YU3 A;  1WI9 A;  3JRB A;  2E1M C;  2K9S A;  1QPM A;  1XDS A;  2KQR A;  3HEF A;  4LB6 B;  1QA6 A;  5EG0 A;  3K2A A;  2M3A A;  1ZAO A;  2KZV A;  4CDG A;  1ON1 A;  2HNH A;  2L4A A;  1I6H J;  5IP7 J;  1G3S A;  2ELJ A;  1XGS A;  2EA4 A;  3VOE A;  1ZRF A;  3CMA I;  4I99 C;  3CJQ B;  3CUQ B;  1E0E A;  3CMM A;  1IN7 A;  1X58 A;  3DBR B;  4UXN A;  1YJN I;  2DOA A;  3FM5 A;  2A61 A;  4ENN A;  1VQ5 I;  2LSO A;  2Y9Y A;  1SFK A;  4L5I A;  1RIO H;  2NYX A;  2BGC A;  3ASN H;  2CV2 A;  4B1R A;  2DTR A;  3MKY B;  2ELK A;  5TRD A;  4ZYA A;  3C1D A;  1HBX G;  2CQ7 A;  2JK3 A;  4M3G A;  5ILS A;  5IY5 H;  2Y31 A;  1V54 H;  5IOZ A;  4PZJ A;  2FX0 A;  2Y75 A;  3BZK A;  4HQE A;  4IVN A;  4BXF A;  1Z67 A;  2ZSI B;  4L5E A;  5EEA A;  3I5U A;  3VWB A;  2LF7 A;  3IHU A;  3E6M A;  2QKL B;  3R61 A;  1Z3Y A;  4DNC A;  3S1Q J;  2QEN A;  3S16 J;  1X4O A;  3AFH A;  1ZH5 A;  1OYY A;  4HF1 A;  5EEH A;  1MDM B;  3L2W A;  2FD5 A;  2ESH A;  2LC2 A;  1H89 C;  5FO5 A;  2HQ5 A;  4F3Q A;  1MIJ A;  3H9G A;  2M2E A;  1OKR A;  4EJW A;  3SFZ A;  1F1Z A;  3BLY A;  2V1X A;  4ZTJ A;  2QQ9 A;  1X3W B;  3MWM A;  1GVD A;  2H1L A;  2R5Y B;  1HDD C;  3MVP A;  1A6Q A;  2GLO A;  2FBH A;  2TDX A;  3PSI A;  3P9I A;  3WU2 C;  5ILV A;  4LG3 A;  2KDO A;  3GTQ J;  2KJC A;  3T1B A;  1Z6R A;  3A02 A;  1TWG J;  2E19 A;  1WH5 A;  4UV9 A;  2R7F A;  2DFF A;  1YW9 A;  4BHC A;  3KZI C;  3CCL I;  1LPQ A;  5HDK A;  4C9Y A;  2XKP A;  3GWZ A;  2HXO A;  2VL8 A;  4XQF A;  3WTS C;  4XSZ F;  3S3M A;  2I8D A;  2FRH A;  4PDK A;  2KP6 A;  2OC6 A;  4MTD A;  3ZOB A;  1OLT A;  3A4C A;  3ISP A;  3GTM J;  1MNE A;  3CJT B;  3MZ8 A;  1FYL A;  3CDI A;  1TT0 A;  2PMZ N;  3H9Q A;  3H1C A;  3K4L A;  3WU1 B;  1BI2 A;  2K02 A;  1K4T A;  5L3B A;  2DMT A;  1QBJ A;  2CSO A;  3QPT A;  3F8F A;  4XN3 A;  1N77 A;  3H3Z A;  3QU6 A;  1U5T A;  3HOX J;  2LD5 A;  5BOX A;  5E3L A;  2G0E A;  3I64 A;  1P7I A;  1NG7 A;  3OOU A;  2GXA A;  1X1A A;  5JI6 A;  4EQQ A;  4KMU X;  4ZH4 F;  3A2K A;  4AWX B;  3DKX A;  3L00 A;  3LSJ A;  2GQQ A;  2LRD A;  1FP2 A;  1V3F A;  2RQP A;  2E5N A;  5IP9 J;  3IAS 2;  1IV6 A;  2LP0 A;  4F92 B;  4E6K G;  3BZ6 A;  5B5E C;  5FRO A;  1WPK A;  1GV5 A;  4XLC A;  3G4S I;  3L7W A;  2FE3 A;  3OR1 C;  1X3U A;  4BKX A;  1YX3 A;  2OUM A;  5DCM B;  1R9T J;  2EFN A;  2E2H J;  4XLF A;  3ZQ7 A;  4A2U A;  2P4W A;  2M1B A;  2XRL A;  3W6J B;  5J8C A;  4X0G A;  5LD2 C;  1GXQ A;  3L2U A;  3M8F A;  1IUY A;  1ETV A;  2L01 A;  2NVY J;  3ABL H;  5F08 A;  4XOT A;  1TBX A;  3FXQ A;  4W97 A;  3F8B A;  4CA0 A;  3MAJ A;  2DFH A;  3C18 A;  3LSP A;  2ME6 A;  1EJ9 A;  3TMO A;  1IXR C;  4PUS A;  3OYE A;  2Z16 A;  4C30 A;  1SVM A;  3HPH A;  4OAY A;  4RGU A;  4NNJ A;  2Z5U A;  2OF7 A;  2M7A A;  2F4I A;  1D1C A;  3R0J A;  3I9V 2;  4QPQ A;  4F91 B;  2Z1D A;  1NHA A;  1RUO A;  1J9I A;  3GLX A;  4ON0 A;  4L9T A;  3RKX A;  2GZW A;  4I6Z A;  2FOW A;  1X1D A;  3DPU A;  3T8T A;  2B0L A;  1T33 A;  4U0V A;  3WGH A;  2XC7 A;  3RSN A;  5CKT A;  4F55 A;  2A6E F;  5LHH A;  4A69 C;  1ZGW A;  1FC3 A;  3FMQ A;  5BNG A;  1WCM J;  2XPV A;  2YPR A;  1TW3 A;  4TV7 A;  1AKH B;  3S32 A;  2HFH A;  3FXK A;  1AA7 A;  2Y0S N;  3JRD A;  1SMT A;  1Y56 A;  2M34 A;  3KYD B;  1PUE E;  4FX0 A;  2VKH A;  4UUV A;  2P7C B;  4ZJZ A;  4U0W A;  3MFK A;  3LNQ A;  5E1X A;  2UZK A;  1P4A A;  4E4H A;  3E3V A;  1J7K A;  3H3V K;  5C4X J;  2PFB A;  3RZD J;  4ITV A;  3E5X A;  2IVM A;  3CLQ A;  5E1W A;  2VKD A;  4L9J A;  4HNT A;  1X1P A;  3Q3S A;  4IHY A;  1ZRC A;  3M3Y J;  1BI3 A;  5H20 A;  2DA7 A;  3OS0 A;  3H3U A;  5HDN A;  1V4R A;  4A3I J;  4UUT A;  3G71 I;  4PFO A;  3DLL F;  3A01 B;  1DP7 P;  1P7J A;  1SD4 A;  3KE2 A;  2HVR A;  1XGN A;  2MH2 A;  3PNV A;  4YEJ A;  3EUA A;  3ZGK A;  3F6V A;  4U88 A;  4QTR A;  2C6Y A;  2W82 A;  2D2W A;  1RC9 A;  2BE5 F;  2R7T A;  3BG6 A;  5J4V A;  1XPX A;  1QVT A;  1OYI A;  1R4N B;  3NAR A;  3OYH A;  1ZR2 A;  2F5E A;  1CGP A;  4Q47 A;  3OYM A;  1REP C;  3M07 A;  5GAD J;  5CPR B;  2EH3 A;  3K0L A;  3K4K A;  1K79 A;  3GTO J;  2EWN A;  4A3L J;  2RAE A;  1PYV A;  5KAF C;  4CH7 A;  2ZXH A;  1W1W E;  5LRR A;  2BHY A;  3ZR8 X;  4NQW B;  1KA8 A;  1N75 A;  2XAQ A;  1FT9 A;  2DI3 A;  2R7Z J;  2YX4 A;  5FJ8 J;  2CS3 A;  4FCY A;  1G3Y A;  5FKN A;  3H5R A;  3RPU A;  5D5X B;  2G7H A;  3HBL A;  2V26 A;  2X6W A;  2K3P A;  3TED A;  1G8X A;  4AU7 A;  4A3J J;  1Z91 A;  4HEA 2;  1A35 A;  4Q48 A;  3PNY A;  1IJW C;  4BDZ A;  4IJA A;  4CUG A;  4FX4 A;  4Y33 A;  2W48 A;  4ASN A;  3KEO A;  3MD2 A;  3OSG A;  1WSU A;  2X0L A;  2IXS A;  2OA4 A;  2E2I J;  4A3G J;  4I02 A;  3BC8 A;  4BQA A;  4E7I A;  3LFU A;  4O6J A;  2K9L A;  4EAT A;  2O5R A;  4B4C A;  4BGD A;  5D5U B;  2DK8 A;  3GXO A;  1IRX A;  5D5V B;  2Y0S A;  4YG2 F;  4M6V A;  3NWS A;  1IDY A;  3LSM A;  3J7Z I;  2M4G A;  3S3O A;  2LY2 A;  1XSX A;  1Z7U A;  1D1B A;  2R4G A;  2EFP A;  3IH2 A;  1G6N A;  1Q1V A;  3CCY A;  1ZR4 A;  5EGO B;  4RMN A;  4AIK A;  2M87 A;  2O7O A;  4FE4 A;  4RAZ A;  2QUF A;  1IN8 A;  1R5H A;  5FKL A;  2EPF A;  2ID6 A;  4EV0 A;  2OZU A;  4HPQ A;  2VI6 A;  3KPH A;  2VBY A;  1OFC X;  4HAM A;  1MBE A;  3PSF A;  4UB8 C;  5CJ9 A;  1TNT A;  2H09 A;  3GLL A;  5L3E A;  3HOV J;  1SFX A;  3L2Q A;  3HSF A;  3FHN A;  3BR3 A;  3CCR I;  4KNY A;  1DP3 A;  2CW7 A;  2OCE A;  1T98 A;  2LKX A;  2BEO A;  4P9F A;  4BXX J;  1IRZ A;  2ADU A;  2WAF A;  2NOJ B;  3CF2 A;  2QSF X;  4IF4 A;  4HW0 A;  4KN4 X;  4IX7 A;  3BT9 A;  4HLX A;  2DFI A;  3CCE I;  4BYY A;  2VC1 A;  3F8C A;  4MFD A;  2IJL A;  5GAH J;  4OOI A;  3VEP A;  3GZ6 A;  3GZN B;  1JKO C;  3ABM H;  3O8G A;  1V5F A;  3SZP A;  1IW7 F;  2EV0 A;  1S29 A;  3DEU A;  1TP4 A;  1YS7 A;  1DDN A;  3K10 A;  5GAE J;  2QLZ A;  4IRG A;  4R8H A;  3MKZ A;  1PDN C;  3RPQ A;  4Y17 A;  4WF2 A;  2Q2E B;  4A6D A;  1JGG A;  4A3B J;  1VTN C;  2ZO4 A;  1D0Y A;  3PIP F;  1YQA A;  4MNU A;  2M8E A;  3IKV A;  3DKW A;  2HYF A;  1USS A;  1IRF A;  2XAS A;  4N9I A;  4UVA A;  5DUI A;  2LKP A;  1XX5 A;  2H8W A;  4MHG A;  3S1M J;  1QGP A;  4NBQ A;  1TNS A;  2EFO A;  3G2B A;  2JT1 A;  2D45 A;  4IHW A;  3RYP A;  4AC0 A;  1STZ A;  2FQ4 A;  2G9W A;  2Q2E A;  3IC7 A;  2LYC A;  3HTS B;  2WV1 A;  4M73 A;  3CCU I;  5J40 A;  2X6O A;  4A93 J;  3LA3 A;  3ZMV A;  3AL0 C;  4D9J A;  1HW5 A;  3PIO F;  2I10 A;  3PFI A;  4DIQ A;  3D5L A;  2HZT A;  2VBZ A;  3OYN A;  1QPI A;  4AUX A;  4C2U A;  1QVU A;  2KZG A;  2QF7 A;  1UST A;  4NHJ A;  3LSR A;  1MKM A;  2R7Q A;  3DU5 A;  2MC3 A;  2RKH A;  2VE8 A;  1WFX A;  4QPO A;  2VPR A;  5CVU A;  4BH9 A;  5M5X J;  2J5O A;  5J1Y A;  1X1B A;  3M1E A;  3KEQ A;  2CV1 A;  2M5W A;  1FSE A;  1V5E A;  5F0C A;  1K83 J;  5HLG A;  4XR6 A;  1NK3 P;  4J00 A;  1EH8 A;  1WHU A;  2BY2 A;  1OR7 C;  2CUZ A;  2KT0 A;  1KON A;  1J59 A;  1OCC H;  3TO6 A;  3VFZ A;  5TIS C;  4LFU A;  3GZ5 A;  3WHC A;  3PJR A;  4WK8 F;  3AG4 H;  3I3L A;  5M3M J;  1UMQ A;  4EJV A;  4KIS A;  1B9N A;  2BVL A;  1ZRD A;  1YIT I;  1HC8 A;  4JK1 X;  1XSD A;  1IUF A;  2OQR A;  3DTK A;  2R5Z A;  3UKG A;  1VQP I;  3H0D A;  3QPH A;  3V4G A;  4YFK F;  1ZLJ A;  2M45 A;  5E3M A;  5BPI A;  2HXI A;  3RI4 A;  1LJ9 A;  2ECC A;  1I1S A;  3E6D A;  2M8G X;  2E1M B;  3A1Y A;  5JHF A;  2XHK A;  2VIX A;  2WAQ A;  3O3K A;  3CUQ C;  1QHH D;  3K7A J;  2OJE D;  2ECB A;  4RB2 C;  1FP1 D;  1EKE A;  3HC7 A;  4HDV A;  1N78 A;  3BR5 A;  4JYK A;  3TKY A;  4BE2 A;  1L3L A;  1F43 A;  2LBF B;  1IN4 A;  2BOL A;  2LNB A;  4LOC A;  5FB2 A;  1B59 A;  2VB6 A;  4LGW A;  3QU3 A;  2EZL A;  1XN7 A;  4KA4 A;  3IRR A;  5F6F A;  1H88 C;  4LB5 A;  1IV8 A;  4MQ9 F;  2EQR A;  2DK5 A;  4C3J J;  3TO9 A;  1MDM A;  1OCR H;  3HOU J;  4OMZ A;  2JA7 J;  1HQC A;  2Y9Z A;  4BS9 A;  1E2X A;  1W0T A;  2JQ7 A;  3IUO A;  4BBS J;  2DJN A;  3L2R A;  4OU0 A;  1JTX A;  1YIJ I;  4N4O B;  1RRJ A;  2QM3 A;  2V79 A;  3DEW A;  2JZY A;  2BXZ A;  1RNL A;  4HQM A;  3ZQG A;  3SXY A;  4V19 K;  3BY6 A;  3WTT C;  1X3Z B;  2NVQ J;  1XD7 A;  2FF4 A;  3OYD A;  2OPT A;  3BTL A;  5KHD A;  2W24 A;  2COB A;  3QOP A;  2IGM A;  1J75 A;  3K4C A;  2IS2 A;  1Z77 A;  1U5T B;  2N8G A;  3LST A;  2BY0 A;  3K69 A;  1L0O C;  4HV6 A;  5EZG A;  4P5O A;  1K7A A;  1Y8R B;  1AWC A;  3PFY A;  1YE9 A;  4EMS A;  1DU0 A;  3JRG A;  1B1B A;  2JMW A;  2H27 A;  3I4N J;  1PJR A;  3OMY A;  3CC2 I;  1S8N A;  2IEK A;  3PQK A;  1BW6 A;  2XAH A;  4ETS A;  3FZV A;  4X1E A;  4PSX A;  2CJJ A;  2V9K A;  4FHT A;  4QLC U;  3ZQI A;  3GYH X;  3J81 K;  2FJ1 A;  5DYM A;  1TL8 A;  1BJZ A;  2E7W A;  5JVG F;  2ISY A;  3KP6 A;  1JUS A;  2PG4 A;  4LMY A;  3DFG A;  5E8G A;  5HLT A;  1CQT A;  4CCL A;  1DGR M;  4OWR B;  3HRT A;  1BN5 A;  1VQ7 I;  1KYZ A;  1K4S A;  1NTC A;  2G7U A;  1WI3 A;  2K5C A;  1DQU A;  3GFJ A;  4ZYH A;  4V2F A;  4OIN F;  2XSD C;  5AIP A;  1V55 H;  4BQQ A;  5LGN A;  2H1K A;  2LKS A;  4XLP F;  1B72 A;  5B3S H;  1W4M A;  4XOR A;  1RPW A;  1X2N A;  4XOP A;  1Z6T A;  2DMU A;  4HG2 A;  3O2P E;  1P9Q C;  2PJR A;  2PI0 A;  2RNG A;  4DJA A;  4YRV A;  1S7A A;  2JRM A;  5J8F A;  3BDD A;  3Q9V A;  3BP8 A;  1R1V A;  3EPZ A;  3OIO A;  4AYB N;  5DV5 A;  4ESB A;  2MYS A;  1GLN A;  1O3R A;  3S2H J;  3GVA A;  2Z33 A;  4DW6 A;  5F04 A;  1BR4 A;  5JVT A;  1X1C A;  1ITY A;  1BA5 A;  1BR2 A;  1QZZ A;  1MBH A;  3MZY A;  1ZK8 A;  4A3F J;  2V6E A;  3TGN A;  2FNP A;  2H6B A;  2OD5 A;  2KHM A;  3ZPL A;  3ZRG A;  3E0J B;  3WU0 A;  1D1A A;  1FOY A;  3NWT A;  2DOF A;  4O3M A;  1HKQ A;  1OQY A;  4XNF A;  2BY1 A;  2XPU A;  3FKJ A;  5K5Q A;  4L9V A;  1KGS A;  4LLG F;  5FRN A;  3GEZ A;  5IP6 A;  3MN2 A;  3GX4 X;  2HEO A;  5HLH A;  3RTR A;  4XSX F;  3W3C A;  4G7H F;  3NAU A;  2RC4 A;  1GHC A;  1FMW A;  2PMZ A;  1BJA A;  1MJ9 A;  1LVA A;  1OR7 A;  1X19 A;  3CC4 I;  4F7Z A;  1R36 A;  2EZK A;  4A3E J;  2PBI A;  2DBB A;  1MD0 A;  4Y7N J;  4KDP A;  5LRS A;  3S17 J;  2L7Z A;  4ENM A;  1MMD A;  2R7V A;  3I54 A;  2IT0 A;  5DTD A;  3WTV C;  4KT5 C;  2LH9 A;  3BJ6 A;  2B9S A;  4HV5 A;  5DEQ A;  1G2H A;  3FKI J;  3ERM A;  2L0K A;  3OL3 A;  4PGG A;  3DV8 A;  1LVK A;  4CO8 A;  4PJM A;  4ZC3 A;  3U9G A;  4BBR J;  1IG7 A;  2CO5 A;  1YX5 A;  5EG0 B;  3I56 I;  3IWF A;  3AG1 H;  1VQ8 I;  4IEJ A;  2FQ3 A;  4HF0 A;  4IHV A;  1T08 B;  2XF5 A;  2LMD A;  4XL9 A;  4C2T A;  3I59 B;  6PAX A;  3IP4 B;  4LD5 A;  1UG0 A;  3WTY C;  4ZZL A;  5ICC A;  4A3K J;  5JHU A;  1FEX A;  3CO6 C;  5F0H A;  1VQM I;  1KU2 A;  1FOW A;  1A6I A;  3BWG A;  5J3L A;  2LF8 A;  3TW7 A;  3ZMU A;  1XC5 A;  2QYO A;  2HDD A;  4Y52 J;  3DU6 A;  3ABK H;  4A12 A;  1Z1D A;  3DQV C;  4IOC F;  2DA2 A;  1XCB A;  4LJZ F;  2VT2 A;  5D8K B;  1YTY A;  4HNV A;  1R5G A;  5IT3 A;  4KFC A;  4RDU A;  1ZGJ A;  5M3F J;  3M8J A;  3P5J A;  3QWL A;  3WTU C;  1JJ6 C;  1YYV A;  1BC8 C;  5J6X A;  4BAY A;  3OSF A;  2JA8 J;  1K6O A;  2WTE A;  2ZNY A;  4G7O F;  3V8J A;  1TWF J;  4G7Z F;  2FBI A;  1YS6 A;  3ZQF A;  1RR7 A;  1ETO A;  2KJB A;  3V8K A;  1FOX A;  3LL7 A;  2AQE A;  1AOY A;  2JSP A;  1FBS A;  3JR9 A;  1YW8 A;  2BV6 A;  5F64 A;  2P8T A;  2DU9 A;  2L7K A;  1IC8 A;  1HCR A;  5A2Q K;  2E35 A;  3IKT A;  4D5F A;  2E5Z A;  2IPQ X;  1FIP A;  3LQR A;  1SFU A;  4CCM A;  3OS1 A;  4B44 A;  3CJN A;  3J80 K;  2W4S A;  4M6Y A;  1LEB A;  5AON A;  3LWF A;  4RAF A;  5E1Z B;  5D8L B;  1UG2 A;  5D4R A;  1VQO I;  2E71 A;  2L7M P;  2DXI A;  2JTV A;  2LOO A;  1S72 I;  4DQ2 A;  5F1R A;  2GIV A;  3E6B A;  2BYV E;  2ZCW A;  1OCO H;  1MJB A;  2L54 A;  2XGC A;  4Y15 A;  2NVT J;  1W0U A;  2VOP A;  2CFX A;  3WG7 H;  2KKO A;  2GXB A;  1YJW I;  4LLL A;  2AQF A;  4PSW A;  3OR2 C;  1XDU A;  3CTA A;  3HUG B;  4M3F A;  5J1R A;  1B6A A;  3VYR B;  3HGY A;  2MLG A;  3W2V A;  2UXX A;  4WXD A;  3OYL A;  2W85 A;  3SHF A;  4M9X A;  1HF0 A;  3HTU A;  2KIU A;  2RQQ A;  2NNN A;  3SDG A;  3DBH B;  2I5U A;  3NQO A;  1K78 A;  3C7J A;  2D1V A;  3LA7 A;  3H36 A;  4FE7 A;  1OCZ H;  3KYL A;  3CCQ I;  2VKE A;  1UZC A;  1DUX C;  1J2X A;  5H2F C;  3TW6 A;  2ZJP F;  5GPA A;  5K1Y A;  1JE8 A;  3KFW X;  5HS8 A;  3G1L A;  4E7H A;  5BMZ A;  3V8L A;  3CJR B;  2QGU A;  3BR2 A;  1YRN A;  2A6H F;  3VDX A;  1QQI A;  4LG0 B;  1RES A;  3H35 A;  1QZY A;  1FWZ A;  3J81 Z;  3ECO A;  4XLE A;  3ZQH A;  1BL0 A;  2LK2 A;  1VQ6 I;  2OTL I;  1VND A;  2STT A;  1LE8 A;  3K2Z A;  1YI2 I;  1MBG A;  4LIT A;  4CYD A;  2VJI A;  1JUM A;  1KYW A;  5EEG A;  3HOW J;  1MMN A;  4RLF A;  3WE3 A;  3C3W A;  1YRN B;  2OBP A;  3EQL F;  3OYJ A;  3EET A;  2IS4 A;  1Z9C A;  4RM3 A;  1YG2 A;  1KU9 A;  2L2O A;  3FXO A;  2KIS A;  3U2R A;  2FMY A;  1RR8 C;  5CVJ A;  4N4N B;  3LSK A;  3RCO A;  2IGN A;  2MH9 A;  4KT6 A;  3ABU A;  3CCJ I;  2VT3 A;  1SD6 A;  4PJJ A;  5E8I A;  2DMN A;  1U9O A;  2VQC A;  2YS9 A;  2ZJR F;  2X85 A;  3M8E A;  1N25 A;  3GFI A;  4MO7 A;  2OZ6 A;  3BG5 A;  3ZMD A;  3S3N A;  1WKM A;  4UUS A;  3M1C A;  4S0H B;  2NVU B;  1A36 A;  2CYY A;  3IWZ A;  1ERD A;  5BPD A;  3K9T A;  2V9V A;  4EM2 A;  3MKW B;  3A0H C;  4B48 A;  1TC3 C;  1TWA J;  3FIW A;  3FXM A;  1S7E A;  1POG A;  2HU9 A;  3GF2 A;  2DQL A;  4D5C A;  5LFA A;  4XKB A;  4BAC A;  4UV8 A;  4HZF A;  3I55 I;  1ZAR A;  3DXJ F;  3LMM A;  3BCA A;  2LFB A;  2WC2 A;  2V4J C;  3CME I;  2CGP A;  3QOD A;  2O61 A;  3FBI B;  1EH6 A;  3QPL A;  2H8R A;  2EIJ H;  4UVC A;  2FU4 A;  2IW5 A;  1T2K A;  2OV7 A;  1VQK I;  1WJ5 A;  1FYM A;  1S5L C;  4JBA A;  2L9R A;  2W7N A;  3OYG A;  2HGC A;  4JP0 A;  1ZLK A;  3Q0V A;  4LIV A;  3K4J A;  1I39 A;  2L5Q A;  1I1G A;  1RI7 A;  3F8M A;  3HKZ N;  5J4Y A;  5HNF A;  1U8B A;  3CLO A;  2VAS A;  4CIC A;  3WTW C;  1LE8 B;  5J1U A;  4GRI A;  1ZGA A;  1O4X A;  3F72 A;  3SFI A;  2CQN A;  4P55 A;  5DCM A;  3T8R A;  4J01 A;  4BL0 B;  1FZP B;  4DYC A;  3PO2 J;  5F27 A;  1YJ9 I;  1H9G A;  1TQM A;  2KLO A;  2A05 A;  1TW2 A;  2QEX I;  2XB0 X;  2EIK H;  2R7R A;  4BEH B;  2LVS A;  4DGW B;  1R58 A;  3K70 D;  2RGV A;  2Y69 H;  5ERI A;  2BW3 B;  3AG2 H;  3QQA A;  4WX9 A;  2E1N A;  3VYS B;  1GDT A;  3ZXS A;  4F93 B;  2WY7 Q;  4NDL A;  1A5J A;  4G6Q A;  2ID3 A;  1BIB A;  1U5T C;  3U1D A;  2MGQ A;  3RKQ A;  4XID A;  1F9N A;  3QYF A;  5H6R A;  3CF5 F;  1HW2 A;  1QHG A;  4E70 A;  5IYC J;  3O6B B;  4N0B A;  4GCV A;  1SC7 A;  2OQG A;  3ROU A;  2QQ8 A;  4M3E A;  3GBG A;  1T38 A;  4M3D A;  5ICG A;  3DPL C;  4XKW A;  4CYC B;  1GV2 A;  2RDP A;  2ZJQ F;  4UY8 I;  1SAX A;  1MJA A;  1LFP A;  4I2O A;  3RIR A;  3ZCO A;  5EF6 A;  1ENH A;  2F2E A;  3PQJ A;  5HS9 A;  1J0R A;  1A31 A;  4P1W A;  3U21 A;  4OIP F;  4G6D A;  2FUG 2;  1FYK A;  5HLI A;  1I3Q J;  4NC7 A;  3P9C A;  2PX9 A;  3WOD F;  4IL6 C;  2STW A;  2VUM J;  1AHD P;  3OYC A;  3AL0 B;  4IQ4 A;  2QQA A;  1O3T A;  4DYR A;  2HPI A;  4UUS B;  1JKQ C;  2GBY A;  2XB5 A;  3CDL A;  1RUN A;  3KLO A;  2PN6 A;  2XAG A;  3JRE A;  1SD7 A;  3ZP5 A;  1R71 A;  1I6X A;  3OL4 A;  2X48 A;  1YO5 C;  2A5W A;  3VYU B;  3SDB A;  2KL4 A;  3FXR A;  1BW5 A;  4NUB A;  2NRA C;  3JRA A;  3IH4 A;  4RS8 A;  5HDG A;  3G6E I;  4AIH A;  3DWL E;  1B4A A;  1SAN A;  2VJ4 A;  1HW1 A;  1SAU A;  5JR3 A;  2GM4 A;  1MMS A;  2NS7 A;  3B6C A;  3LAJ A;  2QBY B;  1JUP A;  1WJC A;  1ZHF A;  2ZXJ A;  3HKZ A;  4FQG A;  5FD5 A;  4FET A;  5IYB J;  1FPQ A;  1IRG A;  1QNT A;  1IF1 A;  4DBQ A;  5A2Q Z;  2DOE A;  3QRF F;  4BY1 J;  3LA2 A;  1BR1 A;  2WB1 A;  4FIS A;  2ZSH B;  3R6S A;  4HRI A;  2DDB A;  3OOP A;  4FAS D;  5GTI C;  1HDP A;  1OJL A;  3CES A;  1TQI A;  5ED4 A;  1MNM C;  2WBM A;  2XAU A;  4B09 A;  2ISZ A;  4KIB A;  2IS1 A;  2MFZ A;  4G9Y A;  5F1J A;  1QZE A;  3S15 J;  2DPD A;  1JGS A;  4YFN F;  1E3H A;  4HA8 A;  1LFB A;  3PUB A;  1QO0 D;  4L5J A;  1P2F A;  1XMA A;  2JSC A;  2Y0M A;  1W36 D;  3ZQL A;  4MQV A;  4F52 A;  3CUQ A;  1W36 C;  3FXU A;  2M0C A;  3BJO A;  2HPM A;  3JRF A;  2DMQ A;  2VKV A;  3B73 A;  3KCC A;  3NRV A;  2AHQ A;  2MD0 A;  2O03 A;  3HSR A;  1MSE C;  4XLA A;  3E6C C;  3RKW A;  2VPL A;  1R5I D;  2WWY A;  4ZYE A;  1D0Z A;  2EIL H;  1GXP A;  3FBN B;  1UHW A;  1W5T A;  4A0X A;  2MAB A;  3WTX C;  4A3D J;  3Q0W A;  1SEU A;  3E7L A;  4A3M J;  3FM3 A;  2DA1 A;  1JKP C;  4KN7 X;  1E3P A;  4AD9 A;  3JTG A;  4YIF A;  2TCT A;  3G3Z A;  2HOS A;  5L3D A;  4BQO A;  2VXZ A;  2NXN B;  2CW0 F;  1VI0 A;  3ASO H;  1PP8 F;  3LSG A;  2LG4 A;  3T0Y A;  4PFP A;  1T56 A;  3BJA A;  5B1A H;  2OTJ I;  2MA3 A;  3VOD A;  1LFU P;  4A6E A;  2CUE A;  3HDD A;  1MMG A;  3BR0 A;  1I3A A;  5CVV A;  1FBQ A;  4M9Z A;  2AXT C;  4C3H J;  5ICE A;  3HRS A;  3N4M A;  2F4O B;  2EZI A;  3ELK A;  2A68 F;  3FXL A;  2DFE A;  2IA2 A;  1RZ4 A;  2DA6 A;  1EH7 A;  4HOB A;  3HOZ J;  4L9N A;  1R49 A;  4IRH A;  1FLI A;  1E17 A;  2Y48 A;  4S05 A;  4G6T B;  3OYI A;  2EA2 A;  1T39 A;  4N9H A;  4NB5 A;  4HLY A;  2QSH X;  2V1U A;  4LK1 F;  5FKO A;  3SEZ A;  4E7L A;  2R92 J;  2YU9 J;  3M7G A;  1MW7 A;  1BIA A;  1ZEL A;  5L3G A;  5DCF A;  1Y39 A;  2CMP A;  3SJM A;  2F5V A;  2NS0 A;  1WJB A;  4FT8 A;  4BU2 A;  4CSW A;  2DA4 A;  1IN6 A;  1ZRE A;  2BBY A;  2FXA A;  5F0F A;  4O5V A;  3TP3 A;  1ACI A;  4XMY A;  1ORK A;  2NVX J;  1FTZ A;  1ZN2 A;  3GTL J;  1NK2 P;  3I71 A;  4WWC A;  2WV0 A;  2DMP A;  4DYQ A;  3F8N A;  3MMY B;  1B72 B;  2E1C A;  2OAZ A;  3JTH A;  2R7X A;  3F22 A;  3D1N I;  1R00 A;  3FX3 A;  3HOY J;  1IXC A;  3VPR A;  1TWH J;  1F36 A;  2X1C A;  2CV0 A;  1TT5 B;  4BHB A;  4EEF G;  4B47 A;  4GXO A;  4A3C J;  4ZDO A;  2IRF G;  3ULQ B;  4ZDP A;  1FJL A;  3HRU A;  4U87 A;  5JFR A;  3LOC A;  1J5Y A;  1Q1H A;  1BOA A;  1T0F A;  1VQN I;  2EV5 A;  5TJJ A;  4A5M A;  3E5Q A;  2QWW A;  2H94 A;  1IXS B;  3LFK A;  4M71 A;  2ZXI A;  2QBY A;  2QZ8 A;  3MQ0 A;  4M9S A;  5L3F A;  2PJP A;  4XLN F;  3KZY A;  3S93 A;  3BG9 A;  3LAP A;  2JA5 J;  2XKO A;  1RET A;  2CQQ A;  2WAD A;  4CGZ A;  3EYI A;  3SEQ A;  3LQQ A;  2UV1 A;  2M9H A;  1F4K A;  4DOZ A;  4M72 A;  3ZQQ A;  2RN7 A;  4IHX A;  3S14 J;  1MND A;  2BHZ A;  3HPG A;  3BG3 A;  4A0Z A;  1IAW A;  2XF6 A;  4L0Z B;  3CDH A;  4RB1 A;  1K6Y A;  5ICF A;  4CZC A;  2W84 A;  1JTY A;  1XB4 A;  2W25 A;  3L09 A;  2WY8 Q;  1H0M A;  5K7Z A;  3I4M J;  4CYC A;  2BW3 A;  4XN0 A;  5E3O A;  3OYB A;  1DPU A;  1D5V A;  1LNW A;  2ZJ2 A;  4D7M A;  1Y8Q B;  4R79 A;  2GIZ A;  3JRC A;  4HX8 A;  3U1K A;  5CLS A;  4BE1 A;  2MSY A;  4LK0 F;  2R5Y A;  4ANJ A;  2K27 A;  3ZMZ A;  3S1R J;  2EIN H;  2IP2 A;  3CCS I;  2JUC A;  4MEX F;  3OY9 A;  2YX7 A;  1W7P D;  2XGD A;  3FIS A;  2DLL A;  3K4B A;  4HST A;  1Y1W J;  3ZMT A;  1D8J A;  5FGM A;  4YEL A;  2A6T A;  4U7D A;  1B8I B;  3LSI A;  1SFE A;  5B66 C;  3IRQ A;  1UAA A;  3F21 A;  3EUK L;  3ML6 A;  1IGN A;  1I50 J;  3IL2 A;  3Q5F A;  1UB9 A;  2FEZ A;  2JPC A;  3I0T A;  5TGT A;  4MLO A;  2F4M B;  1KU7 A;  1FMV A;  3K1P A;  3MKL A;  2A07 F;  4JX5 A;  1TQP A;  5KVR A;  1D5Y A;  2HDW A;  3H5N A;  1UCR A;  2L9N A;  3GFL A;  2CWE A;  2VBX A;  5CVI A;  2R7S A;  2ACJ A;  2VN2 A;  1PVE A;  4ABZ A;  2A69 F;  4H0E A;  1TZL A;  2K40 A;  3N05 A;  4RM2 A;  1U3E M;  1UJ8 A;  3ABT A;  2PMH A;  2P6T A;  2D1H A;  1DGW Y;  1JT0 A;  2HOT A;  2B63 J;  2DYR H;  3HHG A;  4AVP A;  2H6C A;  3HOS A;  4B3A A;  3CQZ J;  4R1H A;  3OYA A;  3AAF A;  4AIJ A;  2PEX A;  2WAQ N;  5CQG A;  4MEY F;  1R1T A;  1KQ0 A;  5GPC A;  1V5G A;  1WH7 A;  4IHT A;  2EBI A;  4ZZD A;  1XG1 A;  3HSE A;  4IRI A;  3TDU C;  3JRH A;  3HYI A;  4KUM A;  5EYR A;  5FD6 A;  1TTY A;  1XTA A;  4PJL A;  1H9T A;  1X4P A;  1KQ8 A;  4LIU A;  5HOD A;  3JW4 A;  3GTG J;  2DYS H;  2E60 A;  3QYE A;  2Q8K A;  4XRS A;  1MH4 A;  1I27 A;  4AID A;  3J7A Y;  4JQF A;  4CCO A;  4FTH A;  3JAM K;  2F5F A;  4I76 A;  1OCP A;  3ZN0 A;  3EUH A;  1Y0U A;  2F5C A;  1OIS A;  4OIO F;  1Z05 A;  3QAH A;  1W7P B;  3RKY A;  2VON A;  3B02 A;  1R1U A;  2K9Q A;  5BS6 A;  1YFH A;  2HI3 A;  3HG9 A;  5KCM A;  1SVO A;  3RYR A;  2DT6 A;  5IT9 Z;  2KPM A;  2EIM H;  2Z2S B;  1WJF A;  2ZME A;  4BE0 A;  1HST A;  4HYE A;  4XK4 A;  2FA5 A;  4EJU A;  3IV5 A;  1BBY A;  5B1B H;  4ESJ A;  3KP3 A;  3ZMS A;  2HQR A;  2DT7 B;  1R23 A;  3PL8 A;  2L7F P;  3I59 A;  1YIO A;  1VQL I;  2DJI A;  3FDY A;  2CRG A;  2YR2 A;  1BOB A;  3MCZ A;  3FHZ A;  3KX2 A;  4Z6Y A;  2R3S A;  2KIF A;  2KFD A;  4BY7 J;  3HJE A;  1TLH B;  4JX6 A;  3L9F A;  1XGM A;  4V2G A;  5D6F A;  4P9U A;  5DUK A;  2JA2 A;  3W6K B;  5H6Q A;  3ZN1 A;  2LDU A;  3FK6 A;  2UWM A;  2L9S A;  3DLA A;  4PJ0 C;  4KIF A;  4BHP A;  2DQR A;  2L02 A;  4M6X A;  2HTJ A;  1WWX A;  2M30 A;  1HXD A;  2Z9O A;  2XUB A;  1BI1 A;  3JSO A;  1WJD A;  2PMU A;  2E34 A;  2JVG A;  3A03 A;  2QKM B;  2R7O A;  4ESF A;  2HOE A;  3RDI A;  3BRO A;  3COA C;  4OIR F;  2KRH A;  1W7P A;  5CYV A;  2P7V B;  3CCV I;  2W57 A;  4KYW A;  2JRT A;  4QWQ A;  1MSF C;  1S3J A;  4KMF A;  1ON2 A;  1MZB A;  4II2 A;  2AS5 F;  5E20 A;  1SD5 A;  1HKS A;  4L18 B;  2HQN A;  2XGX A;  3CD6 I;  4ZDL A;  1R22 A;  4EGY A;  1PUF B;  1Z3X A;  4CXF A;  1RKT A;  1ZG3 A;  4CHU A;  4KIG A;  5FLX K;  2B7E A;  4ENK A;  4BQN A;  2W00 A;  4GFB A;  5KNL A;  3M9A A;  1FOK A;  2V1N A;  2L4M A;  2ZME C;  2O3F A;  4L0Y B;  2MD5 A;  3UR3 C;  1LB2 A;  3WHB A;  2IS6 A;  4CCN A;  1YOV B;  2DA5 A;  3FXJ A;  3R0A A;  5LBQ A;  1LKX A;  3L1P A;  3K70 C;  2Q0O A;  3WTZ A;  3EDP A;  2R0Q C;  3TBI A;  4OIQ F;  2F5D A;  3CO7 C;  4CCK A;  2XDV A;  3J7Y J;  4MFE A;  4WXC A;  4YFX F;  2LY1 A;  1CF7 B;  1MBF A;  2GOM A;  5JLW A;  2VJJ A;  3K4N A;  2NNY A;  4E7K A;  3HM5 A;  5D4S A;  2COM A;  1QU3 A;  1P4X A;  2KRC A;  2V9P A;  2P0W A;  4W1U A;  2YSR A;  2GA1 A;  3NEU A;  4RAY A;  2JVH A;  2XVC A;  1KU3 A;  4GYG A;  2HR3 A;  4YII A;  3W2A A;  1FX7 A;  1NG6 A;  4XRF A;  2XF7 A;  4Z2Y A;  1T6S A;  4GGG A;  2LTP A;  3MEX A;  4DZP A;  3V7S A;  3K6G A;  2ESN A;  2MW8 A;  2M0M A;  2R7W A;  4NC8 A;  2O8X A;  3EYY A;  3QOE A;  5DM7 F;  1OYW A;  3GO5 A;  5FKK A;  3RQI A;  3ERE D;  1JI8 A;  3G73 A;  2R5Z B;  1D3Y A;  1JT6 A;  2LRE A;  3ZQC A;  3KP7 A;  4B3X A;  1G4D A;  2F48 A;  4E7S A;  2O8K A;  2HZD A;  1VFC A;  2NS8 A;  4XLH A;  2CU7 A;  3DKY A;  5CVR A;  2HQA A;  3HUG A;  1G3W A;  5L3C A;  3KEY A;  3BTJ A;  1VQ9 I;  1HSJ A;  3QYB A;  2EFW A;  3UNG C;  4DBR A;  2ZME B;  2HVQ A;  3S8P A;  4HNU A;  5M5W J;  4BDY A;  1K78 B;  4NC6 A;  2DDA A;  3OWT A;  4Y13 A;  2OCC H;  2ZXW H;  4U7B A;  5K5R A;  5FLM J;  3GME A;  2RV8 A;  2DW4 A;  4HBL A;  3BQY A;  5DD8 A;  4IOA F;  1BC7 C;  3HZJ A;  2OU2 A;  3H92 A;  2LY9 A;  1BM9 A;  5FFZ A;  2CW8 A;  2DO7 A;  2LR8 A;  4B8X A;  1P4W A;  2V1D A;  3P9K A;  2JPB A;  5E79 C;  5HVQ C;  1HLV A;  5DD4 A;  4XKV A;  1T95 A;  2IGO A;  2ZNZ A;  3RQ4 A;  3JAM Z;  2CH0 A;  3DTE A;  4I0B A;  5GP9 A;  1XMX A;  3DBL B;  3KET A;  4EJO A;  4G94 A;  3TP0 A;  2D5V A;  2IBD A;  5IYD J;  1G3T A;  3T5X A;  2O6G E;  3CP8 A;  3S2D J;  2KRF A;  2X51 A;  3L2C A;  5K5O A;  3IAM 2;  1ZTR A;  4XM3 A;  2HOA A;  2WB1 N;  4K2E A;  3KP5 A;  4OAZ A;  3F9K A;  1LQ1 A;  1VQ4 I;  1MBK A;  3SZT A;  3DP7 A;  4IHS A;  2AXL A;  2X6X A;  2VQH A;  3BOQ A;  3AG3 H;  3DPT A;  1VF9 A;  3I4P A;  2Z99 A;  3H0G J;  2CG4 A;  4XKC A;  4BXU A;  5K7H A;  4HDU A;  3K1M A;  2HYJ A;  2IA1 A;  5FFX A;  1YW7 A;  3SYT A;  3VB2 A;  3SZG A;  5HS7 A;  2ICW G;  2CQK A;  2X1D A;  3D5S C;  1KZH A;  3C2H A;  5GTH C;  4IO9 F;  4Q5S F;  1EV7 A;  2E7X A;  2PJR B;  2QCO A;  4JOM A;  1H8A C;  2EV6 A;  3R60 A;  5K7F A;  3W6V A;  1R4M B;  1ULY A;  3N97 A;  2VOD A;  2EZH A;  1HA8 A;  3QP6 A;  4M3B A;  3TO7 A;  3S2W A;  4S04 A;  2X9D A;  4A0Y A;  3E5U A;  5ILU A;  2XRO A;  2HTS A;  3RPU D;  2W1O A;  1I5Z A;  1MH3 A;  2JUG A;  3HIF A;  5LEK A;  3GFM A;  4EJT A;  1Z21 A;  4OMY A;  1PP7 U;  1U8R A;  2V6C A;  2RVC A;  3FWE A;  3I58 A;  3KP4 A;  3OIQ A;  3H5A A;  3FK7 A;  3G1M A;  1XGO A;  2KIQ A;  3GCM A;  5AIQ A;  4XRS G;  3Q0U A;  2XV4 S;  1Y6I A;  2K3F A;  3A0B C;  3REO A;  4QIW N;  4EGZ A;  1ONV A;  4KIT B;  5FRM A;  4XON A;  4AYB A;  3V7C A;  3BPX A;  3GUD A;  4GO1 A;  2TRT A;  3C2G A;  1GUU A;  4RAG A;  3QP5 A;  5EGO A;  3H9J A;  3P7N A;  3TOA A;  1ETX A;  1KQ9 A;  2DA3 A;  2K9N A;  4X6A J;  2HVS A;  2XPW A;  2EJR A;  5D6E A;  1UEL B;  2Y2Z A;  2K4J A;  3F0C A;  3WGI A;  3TDZ C;  1WQ2 A;  2VQL A;  3BPV A;  2MG4 A;  1MGT A;  3VSL A;  1O57 A;  4BJ6 C;  1PUF A;  1K61 A;  3CCM I;  1OCT C;  2CFO A;  2XAF A;  4Y3O A;  5EZH A;  5C4J J;  3OIP A;  1ZG5 A;  5C44 J;  5DDG A;  2O9L A;  3FMR A;  2FNA A;  4I98 B;  2ZB9 A;  3KZZ A;  2VJ5 A;  3HRM A;  4RGS A;  2K9M A;  2ZBK A;  2BY3 A;  5FKM A;  5DS9 A;  1HKT A;  4RA2 A;  3IH3 A;  4A5N A;  5CQE A;  2XRN A;  1AKH A;  1GT0 C;  2AO9 A;  2L9V A;  2PQ8 A;  4IPA A;  2QQB A;  1UHM A;  2DTZ A;  4LG0 A;  3CP2 A;  3J80 Z;  4XBF A;  1RKW A;  1Z7L A;  3I53 A;  2Q1Z B;  2X6Y A;  2XIG A;  1YHQ I;  5HNH A;  1DU6 A;  2FBK A;  2K4B A;  1SVL A;  1S7O A;  4JX4 A;  4HSR A;  3HHH A;  5E18 F;  1B9M A;  3GTJ J;  1LUJ B;  1S6L A;  2P5K A;  1VZ0 A;  4Q4Z F;  1WJE A;  2FOK A;  3BTC A;  4LLN A;  2JJ7 A;  1C0W A;  4PCQ A;  3KLN A;  1OPC A;  1JKR C;  4CZZ A;  4HF2 A;  3C2B A;  4BUP A;  4U0Y A;  4RB3 C;  3BG7 A;  5D5W B;  4HX4 A;  2MBF A;  1XSV A;  1ETK A;  2ZFU A;  3R4K A;  2LLK A;  3S1N J;  3CC7 I;  2EFQ A;  1NH3 A;  2JA6 J;  1EA3 A;  1WJA A;  4EM0 B;  3J7A O;  1SMY F;  3PUF A;  3W2W A;  2A5Y B;  2KIM A;  2M4K A;  3KIO A;  4PGH A;  3K4M A;  4I0A A;  5E17 F;  4P96 A;  2DN0 A;  2YUS A;  3VSK A;  1LDJ A;  1O7F A;  4D0P A;  3JSP A;  2IA0 A;  5IT9 K;  2P81 A;  5DM6 F;  3OS2 A;  3JCU C;  4WCG A;  1U9N A;  2VBW A;  2ZKZ A;  3EUH C;  4H4K C;  2JN6 A;  5FLV A;  4II3 A;  1O7L A;  4B43 A;  4I01 A;  3TQN A;  2NOG A;  4UHT A;  2HKO A;  2GAU A;  3DEE A;  4BJT A;  4RLQ A;  2GXG A;  2VE9 A;  5LHI A;  1WVR A;  1Y0N A;  2Z3Y A;  4IKF A;  2QA4 I;  3BR6 A;  2NAZ A;  5FLX Z;  3AKZ A;  4BJ5 C;  4ZYG A;  3V7R A;  4G12 A;  3HOT A;  2VC0 A;  1LEA A;  2ZFW A;  3ESW B;  4C2M J;  4PK4 A;  5LHG A;  5E3N A;  1JHH A;  2GWR A;  2WAE A;  3BZC A;  5KAI C;  2QVO A;  5LLQ A;  1APL C;  1JXS A;  1U78 A;  2DCE A;  2GA2 A; 
#chains in the Genus database with same CATH homology
 2E2I J;  4A3G J;  3DCF A;  4ABZ A;  1HF0 A;  2K40 A;  5IPA A;  2Y30 A;  3SDG A;  4B4C A;  4FE7 A;  2VKE A;  2HOT A;  4M6V A;  3TW6 A;  1JT0 A;  5GPA A;  2B63 J;  1ZKG A;  1IDY A;  3HGG A;  4B3A A;  9ANT A;  3CQZ J;  3G1L A;  2WAQ N;  5GPC A;  3BR2 A;  1YRN A;  1WH7 A;  3IH2 A;  2EBI A;  1RES A;  1XG1 A;  1Q1V A;  3CCY A;  1ZR4 A;  5EGO B;  5JLX A;  2O7O A;  3ZQH A;  3JRH A;  2LK2 A;  4FE4 A;  1BL0 A;  3GTP J;  5EYR A;  1VND A;  5FKL A;  1LE8 A;  2ID6 A;  5HOD A;  3GTG J;  1MBG A;  2ME0 A;  5EDN A;  2VI6 A;  2XGE A;  4XRS A;  1MH4 A;  1JUM A;  1OFC X;  3HOW J;  4FTH A;  1ZQ3 P;  4I76 A;  1MBE A;  1OCP A;  1YRN B;  3HOV J;  1ETW A;  3JRI A;  3BR3 A;  2LKX A;  2K9Q A;  4BXX J;  1WGX A;  1IRZ A;  2IAI A;  2HI3 A;  4J19 A;  3BT9 A;  4MFD A;  4XK4 A;  3IV5 A;  1Y1V J;  3HB9 A;  1JKO C;  2L7F P;  3O8G A;  2DMN A;  1U9O A;  2YS9 A;  2CRG A;  1ETY A;  4MO7 A;  3BG5 A;  4UUS A;  4S0H B;  3M4O J;  4BY7 J;  1JGG A;  4A3B J;  4JX6 A;  4V2G A;  3BTI A;  3FK6 A;  3CMY A;  1TWA J;  3FIW A;  1TC3 C;  1JJ8 C;  1S7E A;  3G1O A;  1AU7 A;  1POG A;  1UHS A;  4D5C A;  3S1M J;  4D7N A;  2E1O A;  1FTT A;  3BR1 A;  3GTK J;  4MIM A;  1E3O C;  4IHW A;  2LFB A;  3A03 A;  4AC0 A;  4DZJ A;  2FQ4 A;  3PM1 A;  2WV1 A;  4XIC A;  3QPL A;  5IOY A;  1XS9 A;  1Z0X A;  2H8R A;  2X6O A;  1X2M A;  4A93 J;  1IDZ A;  1MSF C;  5C3E J;  2I10 A;  2L9R A;  3B6A A;  4JP0 A;  4C3I J;  3Q0V A;  3PO3 J;  3HKZ N;  1QPI A;  4AUX A;  1QVU A;  1U8B A;  3RZO J;  2QF7 A;  1LE8 B;  1PUF B;  5J1U A;  1EF4 A;  3LSR A;  2R93 J;  1RKT A;  1O4X A;  3SFI A;  1ETQ A;  4GFB A;  2VPR A;  4DYC A;  3PO2 J;  5F27 A;  5M5X J;  5J1Y A;  4XRM A;  2KDZ A;  1FIA A;  5F0C A;  1K83 J;  3WHB A;  1NK3 P;  2XB0 X;  3O8H A;  1B8I A;  1TWC J;  2DA5 A;  1MBJ A;  2LVS A;  2KT0 A;  3L1P A;  1QRY A;  1SFO J;  5M5Y J;  2JWT A;  3QPS A;  2E2J J;  2CUF A;  3QQA A;  3WHC A;  2R0Q C;  1GDT A;  4NDL A;  1A5J A;  3BQZ A;  2ID3 A;  4RBO A;  4QSH A;  5M3M J;  1UMQ A;  1HOM A;  4MFE A;  2MGQ A;  3RKQ A;  4XID A;  3A01 A;  1IUF A;  2CQX A;  2R5Z A;  3UKG A;  1MBF A;  5JLW A;  3JRB A;  5IYC J;  3HM5 A;  2K9S A;  5E3M A;  4M3E A;  3GBG A;  3HEF A;  4M3D A;  2HXI A;  4CYC B;  1GV2 A;  2ECC A;  5EG0 A;  2M8G X;  3K2A A;  5EF6 A;  3K7A J;  2ECB A;  1ENH A;  4W1U A;  1I6H J;  5IP7 J;  3BR5 A;  4JYK A;  1F43 A;  1I3Q J;  1X58 A;  4LOC A;  2Y9Y A;  2VUM J;  1AHD P;  2LTP A;  4DZP A;  2EZL A;  4B1R A;  2MW8 A;  2ELK A;  4DYR A;  4UUS B;  5FKK A;  3RQI A;  1JKQ C;  1H88 C;  2GBY A;  2R5Z B;  4M3G A;  1JT6 A;  2JK3 A;  2XB5 A;  3CDL A;  2Y31 A;  3ZQC A;  5IOZ A;  3JRE A;  2EQR A;  2O8K A;  2FX0 A;  4C3J J;  1VFC A;  2NS8 A;  2X48 A;  2CU7 A;  3HOU J;  2JA7 J;  2Y9Z A;  4L5E A;  1W0T A;  3BTJ A;  5EEA A;  4BBS J;  2DJN A;  1BW5 A;  3JRA A;  1JTX A;  3IH4 A;  5M5W J;  1SAN A;  3S1Q J;  3DEW A;  3S16 J;  3ZQG A;  2GM4 A;  2NS7 A;  3B6C A;  5FLM J;  2NVQ J;  2FD5 A;  1H89 C;  1JUP A;  3BQY A;  2OPT A;  3BTL A;  5IYB J;  2HQ5 A;  2COB A;  2LY9 A;  1Z77 A;  2LR8 A;  2M2E A;  2N8G A;  4BY1 J;  1HLV A;  4FIS A;  5EZG A;  1GVD A;  1HDP A;  2R5Y B;  1OJL A;  1HDD C;  3MVP A;  5GP9 A;  1DU0 A;  2GLO A;  3JRG A;  2JMW A;  3I4N J;  1MNM C;  3TP0 A;  2D5V A;  2IBD A;  5IYD J;  2IEK A;  5F1J A;  3S15 J;  3GTQ J;  1BW6 A;  3A02 A;  4X1E A;  1TWG J;  2E19 A;  1WH5 A;  2CJJ A;  3S2D J;  3ZQI A;  1LFB A;  1ZTR A;  2FJ1 A;  2HOA A;  2WB1 N;  1BJZ A;  3ZQL A;  1JUS A;  2HXO A;  1MBK A;  1CQT A;  2M0C A;  3ZOB A;  3JRF A;  2DMQ A;  2VKV A;  3GTM J;  2PMZ N;  2AHQ A;  1NTC A;  1VF9 A;  1MSE C;  1WI3 A;  2DMT A;  3H0G J;  5K7H A;  2HYJ A;  4V2F A;  4A3D J;  2XSD C;  3Q0W A;  3E7L A;  4A3M J;  2LD5 A;  2H1K A;  3HOX J;  2DA1 A;  1JKP C;  5E3L A;  1B72 A;  2G0E A;  1P7I A;  2QCO A;  2TCT A;  2HOS A;  3OOU A;  1H8A C;  1RPW A;  1VI0 A;  1X2N A;  5K7F A;  3W6V A;  3LSG A;  2DMU A;  1T56 A;  2EZH A;  3LSJ A;  4M3B A;  2X9D A;  1LFU P;  3HDD A;  2CUE A;  5IP9 J;  3BR0 A;  1IV6 A;  2LP0 A;  3OIO A;  4AYB N;  1MH3 A;  3S2H J;  4C3H J;  1WPK A;  1GV5 A;  4DW6 A;  5F04 A;  2EZI A;  1ITY A;  2DA6 A;  1BA5 A;  1MBH A;  3FK7 A;  3G1M A;  3HOZ J;  1ZK8 A;  4A3F J;  4BKX A;  1R9T J;  2E2H J;  4XRS G;  3Q0U A;  2XRL A;  4QIW N;  2XPU A;  5FKO A;  2R92 J;  2YU9 J;  1ETV A;  2TRT A;  2NVY J;  1GUU A;  3MN2 A;  5F08 A;  5IP6 A;  4W97 A;  5EGO A;  3SJM A;  2DA4 A;  3NAU A;  1ETX A;  2DA3 A;  2K9N A;  4X6A J;  5F0F A;  3TP3 A;  2XPW A;  3LSP A;  2ME6 A;  1ORK A;  2NVX J;  1FTZ A;  2Y2Z A;  3F0C A;  3GTL J;  2EZK A;  1NK2 P;  2DMP A;  4DYQ A;  4A3E J;  1B72 B;  4Y7N J;  3S17 J;  2MG4 A;  2L7Z A;  3D1N I;  2OF7 A;  1PUF A;  1K61 A;  1OCT C;  5DTD A;  3HOY J;  5EZH A;  5C4J J;  5C44 J;  4I6Z A;  3VPR A;  1TWH J;  1F36 A;  2O9L A;  1G2H A;  4EEF G;  2ZB9 A;  3FKI J;  1T33 A;  2L0K A;  4A3C J;  4BBR J;  1IG7 A;  5FKM A;  5DS9 A;  3IH3 A;  5EG0 B;  4A69 C;  1ZGW A;  5BNG A;  1WCM J;  2XPV A;  4IEJ A;  1AKH B;  1FJL A;  1AKH A;  4IHV A;  2Y0S N;  3JRD A;  1GT0 C;  2AO9 A;  3LOC A;  2M34 A;  2DTZ A;  1RKW A;  4A3K J;  1FEX A;  3LNQ A;  5F0H A;  1DU6 A;  5J3L A;  1A6I A;  3TW7 A;  3BG9 A;  2JA5 J;  3H3V K;  5C4X J;  1XC5 A;  3RZD J;  4JX4 A;  2HDD A;  4Y52 J;  1RET A;  3GTJ J;  2CQQ A;  2DA2 A;  3Q3S A;  4IHY A;  2M9H A;  4HNV A;  3M3Y J;  3BTC A;  4IHX A;  3S14 J;  2JJ7 A;  2DA7 A;  3BG3 A;  4RDU A;  4A3I J;  4UUT A;  3A01 B;  5M3F J;  1P7J A;  1JKR C;  1JTY A;  3C2B A;  1JJ6 C;  4QTR A;  3OSF A;  2JA8 J;  1ETK A;  2LLK A;  5K7Z A;  3I4M J;  3S1N J;  4CYC A;  1TWF J;  5E3O A;  2JA6 J;  3ZQF A;  1QVT A;  1RR7 A;  1ETO A;  4D7M A;  3NAR A;  1ZR2 A;  3JRC A;  3JR9 A;  2DN0 A;  2YUS A;  2MSY A;  2R5Y A;  1IC8 A;  2EH3 A;  1HCR A;  3GTO J;  3S1R J;  4D5F A;  1FIP A;  2P81 A;  4A3L J;  2RAE A;  1U9N A;  2JN6 A;  2XGD A;  1Y1W J;  3FIS A;  5FLV A;  2R7Z J;  2NOG A;  5FJ8 J;  4FCY A;  5FKN A;  1UG2 A;  1B8I B;  2L7M P;  3HBL A;  3TED A;  3BR6 A;  4A3J J;  1IGN A;  1I50 J;  4G12 A;  2XGC A;  1IJW C;  2NVT J;  1W0U A;  4MLO A;  4C2M J;  5E3N A;  3MKL A;  4JX5 A;  4M3F A;  5J1R A;  2W48 A;  3HGY A;  1D5Y A;  1APL C;  3OSG A;  1U78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...