3KP3A

Staphylococcus epidermidis in complex with ampicillin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
148
structure length
136
Chain Sequence
b'RIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator TcaR
publication title Structural study of TcaR and its complexes with multiple antibiotics from Staphylococcus epidermidis.
pubmed doi rcsb
source organism Staphylococcus epidermidis rp62a
molecule tags Transcription regulator/antibiotic
total genus 44
structure length 136
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kp3A00
3LQQA 5D4SA 1R36A 3REOA 3FWEA 4KIBA 3DEUA 4IF4A 5BQTA 1IXCA 2Y75A 1Z7UA 4L0YB 4Q47A 4G7HF 2IA0A 2MLKA 4DQ2A 1O3SA 3LFKA 2HR3A 5FFZA 5KVRA 3R6SA 1LVAA 1T38A 1MDMB 5DCMB 3E5QA 1Q1HA 2FOKA 1XGSA 2G9WA 4Y15A 1EH6A 3D5LA 5HDKA 2P5KA 4EGZA 4G6QA 4JQFA 2V9VA 3GUDA 3WE3A 4EV0A 3GZ5A 2RN7A 3GFJA 1I1SA 4CO8A 2QENA 4QLCU 4NHJA 1P4XA 2M1BA 1FP1D 5DYMA 2R7FA 1U5TC 1E17A 2CSOA 5HLGA 1L0OC 1HSTA 3N97A 1YLFA 2HQNA 5AIPA 5LHHA 4Z2YA 4A0ZA 1KQ0A 1SAXA 2P7CB 1RZ4A 1FYKA 3ECHA 1BI0A 3B73A 3IWZA 2ACJA 2XAGA 3J7AO 1KYWA 4XRFA 2O3FA 1YS7A 1K7AA 3QOPA 4MQVA 2ZMEA 2QLZA 1IW7F 4XLNF 2ISZA 3MAJA 3S2WA 4HYEA 3ZPLA 2DBBA 4LFUA 3F3XA 4Q5SF 3V7RA 2ELHA 2LF7A 2XKOA 4YIFA 3K1PA 5D5VB 2KJCA 5K1YA 1ON2A 4IRIA 2VE8A 2VBZA 5FLXK 4QWQA 1PUEE 3R0JA 2OZUA 2JPCA 4UVAA 5FGMA 1ZLJA 1B9MA 3RIRA 4S05A 4CYDA 2W84A 2A07F 1MD0A 2L4MA 2O0YA 1XMAA 3QU6A 4P55A 4A2UA 1J9IA 2FQ3A 2M8EA 2Z9OA 1MJBA 3FZVA 3LA3A 2DK8A 5FLXZ 1L3LA 1SMYF 4NQWA 5H6QA 1W5SA 4R79A 4BH9A 1KU9A 3E6DA 4RS8A 1KU2A 2D1VA 2CO5A 2IJLA 5E8GA 3L2CA 1X3UA 2E7WA 2Q2EA 1OKRA 4I02A 5CVRA 1YIOA 2ZFWA 3B02A 2FSWA 2L4AA 3HTSB 4KT5C 3CO7C 3V8LA 4OOIA 3MZHA 4PGGA 3WU1B 4HA8A 3BZ6A 3E6MA 5L3FA 1S3JA 3TO6A 1J0RA 5IT9Z 1R23A 4ENMA 5CVVA 2O6GE 5EEGA 1U8RA 4HLXA 4UV8A 4GO1A 4LG0B 2WWYA 3JW4A 4IRGA 5D5UB 2XHKA 1FYLA 2QBYA 3DXJF 3QPHA 2GZWA 5E1ZB 4ZYHA 4WXHA 1TBXA 4I09A 1BBYA 4MEYF 4LD5A 3T8TA 2M30A 1AOYA 4M9SA 3HSRA 3FMQA 1Z9CA 4G94A 4UVBA 3U9GA 2A5YB 4EJUA 1ZH5A 1LDKB 1ULYA 4UUVA 4HV5A 3FF5A 4R8HA 2JRTA 4B09A 1Z6RA 4KDPA 5FD5A 3I71A 2M45A 2DO7A 2ZBKA 2KIUA 4IVNA 2PFBA 2C6YA 5F6FA 4E70A 4PZJA 1R1UA 1TQPA 2JT1A 2LDUA 1XB4A 1GVJA 2RVCA 3WTYC 5HS9A 4RAZA 3LA7A 4EM0B 4I7HA 1UFMA 1FX7A 2IP2A 3IKTA 1ZG1A 2O61A 3QRFF 2FF4A 2W85A 4G9YA 4AIJA 3I58A 5ED4A 2EA4A 1HW1A 5K5QA 3C18A 3ISPA 4XSZF 2DT5A 1LEBA 2GA1A 1H9GA 3GXOA 4ESBA 3I0TA 2EJRA 2ETHA 1R00A 4KFCA 5TJJA 3G73A 3RYPA 2EFNA 1TQIA 1JHFA 3WTVC 2F5DA 2NNNA 1LEAA 2UWMA 1W7PA 2CFXA 1IRFA 1UCRA 3HOSA 1U78A 1XDSA 3CUQC 3WG9A 4F7ZA 2RC4A 3CLOA 5LEKA 1S7OA 2KJBA 4M73A 1S8NA 2DFIA 4WXCA 4PCQA 3CJNA 2H09A 3MCZA 1T98A 1KYZA 4GGGA 3K0LA 3GWZA 3KP5A 1IRGA 4GYGA 2EFPA 3RKYA 2LKPA 2IVMA 3M9AA 4UXNA 4HLYA 2QYOA 3OOPA 4G6DA 3RI4A 1ZGJA 4MNUA 5DUKA 3ZQ7A 5H6RA 1O7FA 1EH7A 2FNPA 4LB6B 3J81Z 4EJVA 2GQQA 4OU0A 3SXYA 1RUOA 2ZMEB 4XLPF 4EJOA 4GCVA 1U5TA 2F5CA 2W25A 4HW0A 5BPIA 1FSHA 3VFZA 3V7CA 4ZYGA 2VE9A 4HQEA 2EA2A 4G8XA 4H0EA 3ZMVA 4ASNA 2A6HF 5HS7A 4K2EA 3SHFA 4Y17A 1BJAA 2A6EF 4OMZA 1P2FA 2F2EA 5BMZA 2DPDA 2G7UA 2PLYA 4UV9A 2AXLA 3M7GA 1NHAA 2A3SA 3W6JB 2E1NA 1CGPA 2A61A 4CDGA 4YG2F 1LDDA 1UB9A 5D5WB 2XV4S 5JHUA 2A69F 4LMYA 4XSXF 2WV0A 4WCGA 1DP7P 4CZZA 2P6SA 4N9IA 1KU3A 2QQAA 1LQ1A 2VBWA 2RKHA 4MHGA 1J7KA 4I0BA 3D0SA 2H27A 1ZRFA 1DPUA 2D2WA 1OR7A 3JTHA 4L5JA 2ZKZA 2PJPA 4M9XA 3BJAA 4BQAA 2FU4A 5DUIA 3KFWX 1TTYA 2Y0MA 5D8LB 5HOOA 1CF7A 5FD6A 1D8JA 3RPQA 1RIOH 3LWFA 2LF8A 2XAFA 2LSOA 3FXRA 5LRSA 1G3SA 3L00A 1PP8F 1C0WA 2STTA 3ZP5A 4AVPA 5CLSA 1I27A 2K4JA 1T6SA 5ERIA 4ESJA 4IHTA 1WRJA 3GFLA 2VXZA 1ZYRF 2QBYB 2V1XA 4XBFA 4U0VA 1IUYA 4OINF 1HBXG 3ECOA 2PEXA 2P6TA 2VT3A 2DTRA 5DD4A 2HGCA 1XSXA 3QP6A 1ZN2A 1K78A 4MQ9F 1SFEA 3G3ZA 2XKPA 2H6BA 1R5HA 2FEZA 2DAOA 2IA1A 3DFGA 3RKWA 4RB2C 4RGXA 1JE8A 2COMA 2DLLA 2RDPA 3L09A 3DKWA 2OQRA 3C7JA 3W6KB 1YW9A 4AWXB 2EFQA 2K7LA 1ZGAA 4P5OA 5LGTA 4JK1X 3BDDA 2ZJ2A 4ZYDA 4ZYEA 4AIHA 2NRAC 3I59A 3MWMA 4A6EA 3HIFA 3BY6A 1MJAA 2DPUA 1BIAA 3CTAA 2XAJA 2VBYA 1B9NA 1V3FA 1OYIA 5E8IA 2OBPA 2H6CA 1B1BA 1E2XA 2ADUA 3IRQA 1YW7A 3T8RA 1BM9A 1W7PB 1HKSA 4LK1F 4HZFA 1QPMA 1IXSB 4B8XA 1TNSA 2NYXA 3WTXC 4CHUA 4I98B 2A68F 2QQ9A 1LNWA 4KA4A 5DCFA 1BC7C 3MEXA 2K02A 1REPC 3F8FA 3Q5FA 1KA8A 2EFOA 3VB2A 1YYVA 5JR3A 3T0YA 3DV8A 5LHIA 5CYVA 4S04A 5DV5A 3KETA 3R60A 5J8FA 4O6JA 3WTWC 3DPTA 4KMFA 3ABUA 3R61A 4I2OA 2O8XA 1O3RA 1HQCA 3CUQA 2OA4A 1ONVA 4UVCA 3ERED 1U6GA 3EYYA 4KNYA 3H3ZA 4BAYA 3TO7A 2XRNA 5L3EA 3MFKA 2JPBA 3KCCA 2E1CA 3I53A 3F23A 1FLIA 1T0FA 3GF2A 4U7DA 1IN4A 5IT9K 5L3GA 3QP5A 2MLGA 1O7LA 1EV7A 4KIFA 1HKTA 4EJWA 3K69A 4WF2A 2UZKA 4FX4A 1UHWA 1FWZA 2ZCWA 3HRTA 4RB0A 3F72A 3WGGA 1KQ8A 3LAJA 5EEHA 2RNJA 4ON0A 1XSVA 3GYHX 1SFXA 3ULQB 2E7XA 4BHPA 3FMRA 2MC3A 4OMYA 4OIPF 3E6CC 2NAZA 1USSA 1I6XA 1WI9A 1IN6A 2KRFA 2MD5A 2V1UA 5JI6A 1UHMA 3IC7A 4HX7A 2ZXJA 1O57A 4HF0A 2W57A 3HYIA 4IJAA 3PFIA 4CGZA 2EFWA 4EM1A 4A0YA 3WU0A 1F1ZA 3BP8A 1GXPA 5F1RA 3E5UA 4LLLA 2XROA 1YFHA 2LNBA 2EV6A 2AS5F 2GAUA 3QU3A 2Z3YA 3KP3A 3AAFA 1MDMA 5DCMA 4MGRA 3SFZA 3F22A 3HHGA 5HVQC 3O2PE 2OAZA 2HTJA 1YW8A 3ZN1A 4U0YA 3WTSC 5D4RA 1SD4A 2MBFA 4HX8A 5DD8A 1IAWA 4L9NA 4RGSA 4A6DA 3IHUA 4I0AA 4FHTA 1BOAA 1H0MA 4KYWA 1F5TA 1ODDA 2BE5F 4EVIA 5LHGA 3ABTA 2VONA 2YPRA 5AONA 2BBYA 3DP7A 3M8EA 2HQRA 4P96A 3CO6C 4L5IA 2QUFA 3V4GA 1TNTA 1OPCA 3GO5A 2Y48A 4EM2A 1JXSA 3TKYA 2JSCA 2CWEA 1O3TA 1XSDA 2V1DA 6PAXA 3VODA 2M5WA 2YX7A 2IA2A 1BI3A 1USTA 3BJOA 3J81K 2FE3A 3TQNA 4HF1A 1ON1A 2FNAA 2ESHA 4PGHA 4A5NA 4BNCA 3HSFA 3Q9SA 3LA2A 3F8BA 2ISYA 4UNOA 1MZBA 5E20A 2FBKA 1F4KA 3JSOA 4ZZDA 1T2KA 5BS6A 1SMTA 4HQMA 4TV7A 3KP7A 5DDGA 5D5XB 2DU9A 2Z33A 2BYVE 1R7JA 3F6OA 2KIMA 1S6LA 3WTZA 2EK5A 1FP2A 2NS0A 3HRSA 3WGIA 4ENJA 3E97A 3RYRA 1D3YA 3EDPA 1OMIA 4M9ZA 3BJ6A 1J5YA 2F5FA 3COAC 1QO0D 2L54A 2WC2A 3BPXA 2V6CA 2YSRA 5F64A 1IF1A 3GFIA 2VOOA 1OYYA 2VN2A 2RV8A 4ZZLA 4EMSA 3WTUC 1F9NA 4BHBA 4M74A 2NNYA 5L3BA 2IRFG 3BOQA 1HXDA 1H9TA 2QWWA 1GXQA 4KUMA 5K5RA 3WE2A 1EH8A 3FHZA 5LRRA 1VTNC 2X0LA 3IWFA 4A12A 1R58A 5K5OA 1YO5C 5FO5A 3QAHA 2WTEA 2GIVA 3DF8A 1HSJA 4KIGA 3P7NA 4IHSA 3F6VA 1G3WA 3TO9A 4Y13A 1D5VA 4CXFA 1PDNC 5D6EA 2M87A 1HW5A 2FXAA 4M6XA 5ICCA 1TW3A 3H3UA 1D8KA 1KGSA 3P9KA 4HDUA 1HW2A 5IT3A 5A2QK 3I5UA 2MH2A 1TW2A 1SFUA 4UHTA 2HYGD 1KU7A 3EETA 1LDJA 3PQJA 4A0XA 1YG2A 1Z1DA 1T39A 4KMUX 2MH9A 3QPTA 1XGMA 4HX4A 1FT9A 2RGVA 1XN7A 1BC8C 2CQKA 4G7OF 5FFXA 5A2QZ 1DPRA 2PBIA 3HSEA 1SD7A 3TOBA 5CVIA 3IKVA 3IRRA 2PG4A 2XASA 3ELKA 3KP2A 2D1HA 3VEPA 3WTTC 3C3WA 2FMYA 1ZAOA 3KZZA 1HKQA 4KN4X 2XIGA 2P5VA 3HRUA 1FOKA 2XVCA 4NB5A 2CYYA 4U0WA 4PDKA 3V7SA 4JBAA 1BI1A 5H20A 2XAQA 1SD6A 2BV6A 3ML6A 2BEOA 3FM5A 1IZ1A 1ZG5A 3F8MA 4OIRF 2UXXA 2FBIA 1B4AA 4MTDA 4N9HA 2YU3A 2O03A 2DQLA 5FB2A 3EQLF 2QZ8A 3TOAA 4N0BA 3ZMDA 3BPVA 1QBJA 1WSUA 4RB1A 1DUXC 2R7DA 3ZMSA 2CG4A 4EGYA 1G6NA 3NQOA 3DPLC 2HTSA 4D0PA 4ETSA 3FX3A 4L18B 4WXDA 5BOXA 3KLNA 2PMHA 2VBXA 3K9TA 5JVTA 2IT0A 1ZARA 2KIFA 3CDHA 3P9CA 1XGOA 4MEXF 3SQNA 1IXRC 4A5MA 2EWNA 2IPQX 3MQ0A 2L02A 3I64A 2HKOA 1S7AA 2VT2A 2BGCA 1FNNA 3N4MA 2FBHA 4KICA 2K86A 1FBQA 1GHCA 3K2ZA 1RUNA 4LGWA 4LJZF 2HZTA 2PI0A 3RJPA 3H92A 3F8NA 1G3TA 4L9VA 4L0ZB 1MKMA 2QVOA 1XCVA 5DEQA 2XGXA 4ENNA 1FYMA 2Q8KA 5E1WA 4IRHA 5L3DA 5AIQA 4LB5A 2X4HA 3FMSA 3SZTA 4HV6A 4WX9A 1AWCA 2ZNYA 1U5TB 4BXUA 2JTVA 4EQQA 3HUGA 3LAPA 5HDGA 3E5XA 1ZLKA 4MTEA 4LLNA 2P8TA 3GEZA 5ICGA 3KP4A 4HBLA 2HOEA 3K1NA 5TRDA 3M8FA 1QNTA 3KLOA 4M6YA 1U2WA 5LGUA 4GYIA 5D8KB 4L9TA 3ZMTA 3M1EA 3V8KA 5HLHA 1RI7A 1ZREA 2HEOA 2JZYA 3T1BA 1P6RA 2P4WA 3SZPA 1BI2A 1TQMA 5BPDA 2XUBA 2GA2A 2L3DA 5ILSA 3T5XA 2H94A 1RNLA 5LBQA 3P9IA 5HS8A 1Y0UA 4YFKF 3Q9VA 1W5TA 1CF7B 2OZ6A 2QM3A 3GW2A 4DNCA 2GXGA 2HWVA 4ENKA 3F8CA 1V4RA 1FBUA 1DDNA 5ICFA 2GXBA 2HS5A 2ZO4A 3L9FA 4M72A 4I01A 3VOEA 1QZZA 5HLIA 2Z5UA 2EV0A 5KK1A 1U3EM 1FY7A 3PQKA 1ZRCA 1J2XA 1P4WA 3E3VA 4RGRA 3GLXA 4L9JA 2VODA 3K1MA 4KN7X 1IN8A 1XCBA 2P5LC 3HRMA 1R5GA 4U7BA 1K78B 2VC1A 2TDXA 1QQIA 4HOBA 2GWRA 3R0AA 5E17F 4P9FA 2B0LA 2G7HA 2CGPA 3KZYA 2MA3A 5E18F 2DQRA 3GZ6A 2XAHA 2HKXA 3GX4X 1Z05A 3J80K 1FSEA 2Z99A 2PN6A 3EYIA 1WWXA 1I5ZA 1XGNA 1FC3A 5E1XA 1TLHB 2UXNA 3F21A 1JHHA 4WWCA 3FXUA 4HF2A 3TDZC 3BWGA 1R22A 2J5OA 2YX4A 3ZMZA 4OIQF 1BIBA 4YFNF 3I59B 2OQGA 3NEUA 1ZG3A 1XDUA 1Z91A 3J80Z 2HFHA 3I54A 2ESNA 3E6BA 2V79A 2STWA 2FA5A 4U88A 1G3YA 4O5VA 3JAMK 3TDUC 2DK5A 4IXAA 3CUOA 3ZN0A 1WKMA 3RPUA 1QGPA 2IW5A 2PQ8A 1A04A 4RAYA 2FRHA 1P4AA 3L7WA 4FX0A 4BHCA 2EB7A 2KKOA 1FPQA 2W24A 3O6BB 3JSPA 1BN5A 3JAMZ 1B59A 1LB2A 4CICA 1J59A 1K79A 1W7PD 3LSTA 3C1DA 3V8JA 3WODF 3ZMUA 4GXOA 5ICEA 4WK8F 1SD5A 2VOPA 2HYFA 3HOTA 1JGSA 5J6XA 3GFMA 4ZH4F 3WGHA 3O3KA 3FXQA 4Q4ZF 3JTGA 3LQRA 5J8CA 3KEQA 5LEJA 4RGUA 4OIOF 1MGTA 2ZNZA 4LK0F 2CW0F 4HAMA 1Z6TA 3CUQB 2HDCA 3HHHA 3RDIA 1O3QA 3TGNA 2YR2A 2K4BA 2OD5A 1B6AA 1YQAA 4AD9A 4O3MA 4FT8A 2F5EA 3EUHA 3MZYA 5CJ9A 4EJTA 3OV8A 5HDNA 1STZA 3RTRA 5ILUA 1IN5A 3IL2A 3BROA 3U2RA 1K6OA 1IN7A 1PP7U 4Q48A 1YS6A 3ROUA 3I4PA 1ZRDA 4YFXF 1ZHFA 2DW4A 4LG0A 3FM3A 5CVUA 3KE2A 2K27A 1OYWA 4P9UA 2OU2A 3NRVA 2D45A 1QZYA 2R3SA 3DQVC 2QQBA 4M71A 3R4KA 4IPAA 4BYYA 1MJ9A 4LLGF 5L3CA 4YIIA 2L01A 3KP6A 3HTUA 5LGNA 1R1VA 1W4MA 3U1DA 1S29A 5LLQA 1LJ9A 1FBSA 1J75A 4R1HA 2FMLA 4HDVA 2DI3A 4G7ZF 3KEOA 3GVAA 1WQ2A 1G4DA 2EV5A 1FZPB 1YTYA 5JFRA 4ESFA 1KQ9A 2RQPA 1I1GA 2Q0OA 2VC0A 5ILVA 3RKXA 1XD7A 1R1TA 5CVJA 2PMUA 1P92A 2J5PA 1XMKA 4AIKA 2P7VB 5D6FA 4RB3C
chains in the Genus database with same CATH superfamily
3C2HA 2VUMJ 3LQQA 3DBHB 3WG7H 5D4SA 1R36A 3REOA 2XB0X 3FWEA 1FJLA 2LP0A 4KIBA 3DEUA 4Y52J 2FUG2 4IF4A 1VQMI 5BQTA 2K9SA 1IXCA 3CC7I 3OWTA 2Y75A 4GRIA 3S1QJ 1Z7UA 3CCLI 4L0YB 4Q47A 4M6VA 4ABZA 4G7HF 2IA0A 2MLKA 2X6XA 4DQ2A 1O3SA 1A31A 2L7ZA 3S1MJ 4KT6A 3LFKA 2HR3A 3A4CA 5FFZA 5KVRA 3R6SA 1LVAA 1T38A 1MDMB 5DCMB 4XKCA 3E5QA 1Q1HA 2FOKA 4CCNA 1XGSA 2G9WA 4Y15A 1EH6A 3D5LA 3ONQA 5HDKA 3RCOA 2P5KA 4EGZA 4A3GJ 5DM7F 5F0FA 3CZ6A 4CYCA 1EJ9A 3C2GA 4II3A 3H9GA 4G6QA 2WAEA 4JQFA 2V9VA 3GUDA 2ECBA 4M3FA 3WE3A 3ZQHA 3DBLB 4EV0A 3GZ5A 2RN7A 3GFJA 1I1SA 4CO8A 2QENA 4QLCU 4PJLA 1AU7A 1P4XA 4NHJA 2JWTA 2M1BA 4A3KJ 1FP1D 3CCYA 5DYMA 2R7FA 4CSWA 4E7HA 2XC7A 5K7ZA 1U5TC 1E17A 2PJRB 2CSOA 2ID6A 5HLGA 1L0OC 1HSTA 4A69C 5JVGF 1MH4A 3K70D 1YLFA 3N97A 1R4NB 3GTKJ 2XGCA 1JT6A 3PO2J 2HQNA 5AIPA 1BR2A 2P81A 4HNTA 3HOVJ 2XF5A 4F92B 5LHHA 2LG4A 4Z2YA 4X1EA 4A0ZA 1KQ0A 1SAXA 2HDDA 2P7CB 1ETXA 4LG3A 1RZ4A 2LYCA 3ECHA 1FYKA 3HKZN 1BI0A 3B73A 3IWZA 2ACJA 2XAGA 3CCSI 1KYWA 3J7AO 1P7JA 1B8IA 3OR1C 4XRFA 5F0CA 2JUCA 3NARA 5C4JJ 3MN2A 2BOLA 1WJFA 2O3FA 5J1YA 2LY1A 1YS7A 4V2FA 1HLVA 1VQKI 2K5CA 1K7AA 2HVSA 2KDZA 3K10A 3QOPA 2DJNA 1ZK8A 2IGKA 4MQVA 5J1UA 2ZMEA 2QLZA 1IW7F 4XLNF 2ISZA 5J40A 1U8BA 3CD6I 3MAJA 3S2WA 3RQ4A 3VPRA 4HYEA 3ZPLA 2DBBA 4DJAA 4LFUA 3F3XA 4Q5SF 3V7RA 2K3FA 1IUFA 2DA2A 3HOXJ 2ELHA 2LF7A 1YITI 2XKOA 4YIFA 3K1PA 5D5VB 3L2WA 4I6ZA 2KJCA 2F4IA 2QA4I 3I9V2 1YI2I 2LK2A 2QQ8A 5K1YA 1ON2A 3LSHA 4IRIA 2VE8A 3MMYB 2VBZA 5FLXK 4FE4A 1MNEA 1ZTRA 1MBJA 1E0EA 2E35A 1OR7C 4QWQA 1WI3A 3BG9A 1PUEE 1AKHB 1WJDA 3R0JA 2QEXI 3U21A 3B6CA 4C3IJ 2OZUA 2JPCA 4UVAA 5FGMA 3J7AY 1ZLJA 1W1WE 5GPAA 1NTCA 1B9MA 3RIRA 4BEHA 4AIDA 2DA5A 4S05A 2XSJC 3TW7A 4B1RA 2MW8A 1IRXA 4PJMA 2VXDA 4CYDA 1WJEA 1ORKA 1UELB 2W84A 3JREA 1LFUP 2A07F 1MD0A 2L4MA 2O0YA 1AHDP 2R5YA 2JA2A 3E7LA 1XMAA 2DFFA 3QU6A 4P55A 4A2UA 4BY1J 1J9IA 2UV1A 5GAHJ 3GTLJ 4BXXJ 2FQ3A 2M8EA 2Z9OA 1MJBA 3BR2A 3FZVA 3LA3A 3OSFA 3GZNB 5JLXA 2DK8A 5FLXZ 1L3LA 2OUMA 1SMYF 2BHZA 5EDNA 4NQWA 2LKXA 1YRNB 2CQQA 1JT0A 1TC3C 1BW5A 2RNGA 5H6QA 1W5SA 1RRJA 4R79A 4BH9A 1KU9A 3E6DA 4RS8A 1JJ8C 1KU2A 2D1VA 4PJJA 4BUPA 2CO5A 2MD0A 2IJLA 3KZIC 1R4MB 5E8GA 3L2CA 2R92J 1X3UA 2X85A 2LC2A 4LITA 2E7WA 2Q2EA 4KISA 1T08B 1K83J 3BG6A 1OKRA 2K9NA 4I02A 5CVRA 3PNTA 2CU7A 1YIOA 2ZFWA 3B02A 4RA2A 4M3EA 2FSWA 2L4AA 4ZYAA 2NXNB 2A5WA 3HTSB 4CA0A 4BE0A 4KT5C 3CO7C 2IGOA 2V7FA 3V8LA 3TP3A 4OOIA 3MZHA 1SFOJ 3BZCA 1DGRM 3D1NI 4PGGA 3WU1B 2EH3A 4HA8A 3BZ6A 3E6MA 2CW8A 5L3FA 1S3JA 4X0GA 3OYKA 4B3AA 3TO6A 1J0RA 5IT9Z 1R23A 4ENMA 2MYSA 5CVVA 4F93B 2O6GE 5EEGA 1U8RA 4HLXA 2JSPA 4UV8A 4FISA 4XN0A 4GO1A 4LG0B 2WWYA 2R7QA 3JW4A 4IRGA 5D5UB 2RQQA 2N8GA 2XHKA 1FYLA 3DXJF 3QPHA 2GZWA 5E1ZB 2QBYA 4ZYHA 4WXHA 1Y56A 1TBXA 4I09A 1BBYA 4MEYF 2XGDA 4LD5A 2HXOA 2IGNA 2M0CA 3T8TA 2M30A 1AOYA 4M9SA 3HSRA 3FMQA 4NBQA 3ZXSA 1Z9CA 4G94A 4UVBA 2DA7A 2DA4A 2DMTA 3U9GA 2A5YB 4EJUA 2ZFUA 1ZH5A 3A0HC 1LDKB 1ULYA 1JTYA 3QODA 4UUVA 5E3OA 1WPKA 4HV5A 3FF5A 4R8HA 2JRTA 4B09A 1Z6RA 2M8GX 5FD5A 4KDPA 3I71A 5IY5H 2M45A 2DO7A 2ZBKA 2KIUA 3FKJA 4IVNA 3W2WA 2HPIA 5EGOA 3OIPA 2XPUA 2PFBA 3K4MA 2C6YA 3H5AA 4XLAA 5F6FA 4E70A 2E1MB 4PZJA 4NUBA 1R1UA 1TQPA 2JT1A 2LDUA 1XB4A 4D9JA 1GVJA 2RVCA 3WTYC 5HS9A 4RAZA 1ETOA 4B43A 4C9YA 3LA7A 4EM0B 4I7HA 1UFMA 1TT5B 1FX7A 2IP2A 4BQNA 3IKTA 1ZG1A 2O61A 1NG6A 2M2EA 3QRFF 2FF4A 2W85A 4G9YA 4IHWA 3HOWJ 4II2A 4AIJA 3I58A 4JX5A 3L2UA 2IS6A 3PSFA 5ED4A 5EZHA 2EA4A 2GOXB 1HW1A 4UB6C 4RM3A 3BC8A 5K5QA 3VYTB 2XPVA 3C18A 3ISPA 4XSZF 5F27A 4QPQA 1M1EB 2DT5A 1LEBA 5FKKA 2GA1A 1H9GA 3GXOA 4ESBA 3I0TA 2EJRA 4G12A 5F08A 2ETHA 3DCFA 1R00A 4JYKA 4YIRX 4E7IA 4RM2A 4KFCA 1RC9A 4PK4A 5TJJA 3DLAA 3G73A 3RYPA 2EFNA 1TQIA 1B72A 1JHFA 1GUUA 3WTVC 3OYAA 3PIPF 2RAEA 2F5DA 2R7TA 2NNNA 2DFEA 1LEAA 1Z3YA 2UWMA 1W7PA 1X1AA 3CQZJ 1I39A 3SEQA 3TL4X 2CFXA 1IRFA 1UCRA 3QYFA 3HOSA 1U78A 1U0JA 2BY1A 3OL3A 1XDSA 3OSGA 3CUQC 3WG9A 3W2VA 4F7ZA 1MBFA 2RC4A 3CLOA 4P1WA 3HEFA 4D5FA 5LEKA 4V2GA 1NH3A 2ECCA 4FASD 4M3GA 3W6VA 2L5QA 1S7OA 2KJBA 4M73A 1IDZA 1QVTA 1G2HA 1S8NA 2DFIA 4WXCA 2XB5A 3LSIA 3KYDB 4BGDA 5EZGA 5JHFA 1YJ9I 4HG2A 4PCQA 3L2VA 3CJNA 1IC8A 2H09A 1T33A 1VQ4I 3MCZA 1T98A 1KYZA 4GGGA 2L9NA 5E3MA 3K0LA 3GWZA 3KP5A 1HOMA 1S5LC 1FIPA 1IRGA 1ERDA 2DT7B 3HZJA 4Z6YA 4RLQA 4GYGA 2EFPA 3TMOA 3RKYA 2LKPA 2LTPA 2IVMA 4EATA 1YJNI 3M9AA 4UXNA 4HLYA 3S3OA 2QYOA 5IYBJ 3OOPA 4MFDA 2I10A 1MMAA 1RKWA 4G6DA 3RI4A 1ZGJA 4MNUA 4RAFA 5DUKA 3ZQ7A 4XMYA 5H6RA 2QSGX 1O7FA 2DDAA 1RPWA 1EH7A 2H1KA 2FNPA 2FQ4A 4LB6B 3J81Z 3JRFA 1VQ9I 4BJ6C 4EJVA 3PFYA 2GQQA 4OU0A 1BW6A 3SXYA 4BE2A 1RUOA 2ZMEB 2O8KA 3QYEA 4XLPF 3OYNA 1WH5A 4EJOA 2KFDA 2QGUA 2WV1A 4GCVA 2WAQA 2JA7J 1W0UA 1U5TA 2DOAA 2F5CA 1WJ5A 2W25A 1X1DA 3OYDA 2XDVA 1LFBA 3NWTA 4DZPA 5KNLA 2WB1A 4HW0A 2WAQN 5BPIA 2VQHA 3ZQLA 1FSHA 3FHNA 2W48A 3VFZA 3S8PA 2HDWA 3FXMA 3V7CA 4ZYGA 2VE9A 4HQEA 3KYLA 2EA2A 4G8XA 4H0EA 3ZMVA 4ASNA 2A6HF 2ZXWH 5HS7A 4K2EA 3SHFA 4Y17A 4F91B 2ZSHB 1BJAA 4CUGA 3EPZA 1MSEC 3HC7A 2A6EF 4OMZA 1P2FA 2K9LA 3N05A 3ZQQA 1UG2A 2F2EA 4D5CA 5BMZA 2DPDA 2G7UA 2JMWA 3HUGB 2PLYA 4UV9A 2AXLA 3M7GA 1XX5A 2XAUA 1NHAA 2A3SA 3W6JB 2E1NA 1CGPA 2A61A 1JKRC 2YU9J 1MSFC 4CDGA 4YG2F 1X3ZB 2D5VA 1LDDA 4DIQA 1UB9A 5D5WB 2XV4S 5JHUA 2A69F 4LMYA 2NVTJ 2X9DA 3DTKA 4XSXF 4A3EJ 1ZELA 4XK4A 1S72I 1A6IA 2WV0A 5IOZA 4WCGA 4D1QA 4NQWB 2X1CA 4B48A 3M07A 1DP7P 3HDDA 4UY8I 4CZZA 2P6SA 1EF4A 4N9IA 1KU3A 2QQAA 4QIWN 1LQ1A 2EIJH 2VBWA 2RKHA 4B4CA 2ICWG 4MHGA 1J7KA 4XICA 3JRDA 4IO9F 3HOUJ 4PFPA 4ZTJA 2VL8A 4I0BA 3D0SA 2GM4A 2H27A 2K9MA 1Y39A 1ZRFA 2X48A 3FXKA 3Q3SA 1DPUA 2D2WA 3BCAA 1OR7A 3JTHA 4L5JA 1Z7LA 2ZKZA 1A36A 2PJPA 4M9XA 3BJAA 4BQAA 2GLOA 2FU4A 5DUIA 3KFWX 1TTYA 2Y0MA 5D8LB 5HOOA 1CF7A 2BVLA 1H89C 1DGWY 4AVZA 5FD6A 2F48A 1D8JA 3J7ZI 1PUFB 3RPQA 1RIOH 3LWFA 2LF8A 3M4OJ 2XAFA 2LSOA 3FXRA 2NOGA 1MW7A 5LRSA 5IOYA 2HVQA 1G3SA 3L00A 3KYCB 1PP8F 1C0WA 2STTA 3H1CA 2OV7A 3ZP5A 4AM3A 4AVPA 5CLSA 1I27A 1JI8A 2K4JA 1T6SA 4XLHA 5ERIA 2VJ5A 4ESJA 4IHTA 1WRJA 2X1EA 3GFLA 5EG0B 2VXZA 1ZYRF 4CH7A 2QBYB 3K6GA 1NG7A 2V1XA 3K4LA 3IAM2 1AA7A 2Z2SB 4E7JA 4XBFA 3AG2H 4U0VA 4ZTFA 1IUYA 2QKMB 1E3HA 4XIDA 4OINF 4XL9A 1HBXG 3ECOA 2PEXA 4IQ4A 2P6TA 2VT3A 2DTRA 5DD4A 1ETVA 2HGCA 1APLC 1XSXA 2QSHX 3QP6A 1ZN2A 2VKHA 1K78A 4MQ9F 1IGNA 1SFEA 3G3ZA 3S1NJ 1LE8B 2XKPA 2H6BA 3DU6A 1FOWA 3ZOBA 1R5HA 1VQNI 2FEZA 2DAOA 1P9QC 2IA1A 3DFGA 3RKWA 4RB2C 3SDBA 4A3LJ 1UJ8A 1SFKA 4RGXA 2Y31A 1JE8A 2COMA 2DLLA 2M3AA 5KCMA 2CW7A 2EINH 2RDPA 2KDOA 2NOJB 3L09A 5TISC 2X6YA 2GIZA 3IAS2 4F55A 3DKWA 2OQRA 3C7JA 3AFHA 1Q1VA 4U87A 2KHMA 3W6KB 4J01A 1YW9A 2HQAA 4AWXB 2EFQA 2DJIA 2K7LA 2IS2A 2DOEA 2LREA 1WH7A 3CMYA 1ZGAA 4P5OA 3LSPA 5LGTA 4JK1X 3BDDA 2VQLA 2ZJ2A 4ZYDA 3IH4A 4ZYEA 4AIHA 3OS0A 2ID3A 3CCVI 2NRAC 4NC8A 3I59A 2F6CA 1UZCA 3JRIA 2W7NA 2HU9A 3MWMA 2ZJRF 1FMWA 4A6EA 3HIFA 3BY6A 3HBLA 3E0JB 1X1BA 2CV2A 2E1OA 2R7VA 1CQTA 5H2FC 1MJAA 5JLWA 2KZGA 3ZR8X 3CF5F 1BIAA 3ZQCA 2DPUA 3CTAA 2E2HJ 2CRGA 2XAJA 2VBYA 1B9NA 2LY2A 4AYBA 1V3FA 4XQFA 1OYIA 3LFUA 5E8IA 1B72B 2OBPA 4E4HA 2H6CA 1B1BA 3K4KA 4AYBN 1E2XA 3VWBA 2ADUA 1JTXA 2GOMA 3IRQA 3I3LA 2JA8J 1YW7A 3HL2A 3S3MA 3IV5A 3T8RA 1BM9A 2LFBA 4KITB 1W7PB 1HKSA 3BZKA 4LK1F 4N4NB 1PVEA 2HOTA 3CDIA 2COBA 4HZFA 4YELA 4BQQA 3BR3A 1QPMA 4F52A 1OCZH 1IXSB 1G59A 4B8XA 2NS8A 1TNSA 2NYXA 2VPLA 3WTXC 4CHUA 2M34A 4I98B 2R7RA 2LVSA 2A68F 2QQ9A 1LNWA 1Y1VJ 1OFCX 3A03A 4KA4A 1FEXA 1R6RA 1OJLA 2EZKA 2F5VA 3FBNB 5DCFA 2V9KA 2R7XA 2E60A 2VLAA 1BC7C 3I55I 3MEXA 2K02A 5IYCJ 4BJ5C 3F8FA 1REPC 2O5RA 3Q5FA 4PUSA 1KA8A 1RR7A 5DTDA 2EFOA 2FX0A 3VB2A 1YYVA 5JR3A 2BXYA 3T0YA 4CZCA 2Y9ZA 4IX7A 1K4TA 3HGYA 3JCUC 3DV8A 5DS9A 2CUJA 5LHIA 3J7YJ 5CYVA 4S04A 5DV5A 1KONA 3KETA 3R60A 3UR3C 5J8FA 3CJTB 4O6JA 3WTWC 4DYQA 1VQ5I 3DPTA 4KMFA 3ABUA 3R61A 4I2OA 2O8XA 1O3RA 1D0ZA 1HQCA 2NVYJ 1POGA 2KP6A 5GP9A 4BL0B 3CUQA 1X1CA 3VYSB 2OA4A 3HPGA 3FDYA 1ONVA 4UVCA 5E3NA 3FKIJ 3ERED 2XF7A 1U6GA 3JR9A 3EYYA 3HJEA 1X19A 2K9QA 4DW6A 4KNYA 1I3AA 3H3ZA 3CMEI 4BAYA 3M3YJ 3TO7A 4IQJA 1X4PA 2DA6A 2XRNA 2HPMA 5L3EA 2ZB9A 3MFKA 2JPBA 3ZCOA 3KCCA 2E1CA 3I53A 2R7UA 3F23A 1FLIA 5FRNA 1T0FA 1X1PA 2M7BA 4IHVA 3GF2A 4U7DA 1IN4A 2CQXA 5IT9K 5L3GA 3QP5A 3DPUA 1LVKA 4NC6A 5FRMA 1F36A 2MLGA 2CFOA 2LKSA 2NVUB 1SVMA 3DWLE 1O7LA 3S32A 1EV7A 4KIFA 1ENHA 3ZQIA 1HKTA 3H5NA 4EJWA 3K69A 4WF2A 1QRYA 2DFHA 1J09A 4OAZA 4PSXA 2UZKA 4FX4A 2OTJI 3AL0B 4A3JJ 1UHWA 3ZGKA 3S17J 1FWZA 4XLEA 2ZCWA 1JKQC 1BOBA 3HRTA 2AHQA 3LL7A 4S0HB 3BQZA 1N77A 4RB0A 4BS9A 4HPQA 1QHGA 2KQRA 4DOZA 3F72A 2VI6A 3WGGA 4IHXA 1KQ8A 3EUAA 3LAJA 2KLOA 1LUJB 3DKYA 1ETQA 4B3XA 5EEHA 1JUMA 2RNJA 4ON0A 1XSVA 2BY3A 2DN0A 4XRSA 1YJWI 3GYHX 1SFXA 3ULQB 2E7XA 3ERMA 4BHPA 3FMRA 2B7EA 2MC3A 4XLFA 1TP4A 2VKEA 2HYJA 4OMYA 1VQLI 4OIPF 3E6CC 3CLQA 1OISA 2NAZA 3GTQJ 3GTMJ 1USSA 1I6XA 1WI9A 2LBFA 1TL8A 3PNYA 1IN6A 5GADJ 1TWAJ 2KRFA 4RDUA 1QPIA 2MD5A 3O8GA 4HRIA 2V1UA 2CV0A 4MIMA 1UAAA 1V5FA 1MBGA 5JI6A 1HDDC 1LFPA 1UHMA 1YOVB 2PMZA 3IC7A 4HX7A 2ZXJA 1RKTA 2JK3A 1O57A 4BQOA 4HEA2 2QF7A 3G2BA 3PNVA 3GBGA 2PMZN 4HF0A 2R5ZB 1WVRA 2W57A 3FXJA 3HYIA 1Z67A 1ZKGA 4IJAA 1X2NA 3PFIA 5BNGA 2VB6A 4CGZA 2EFWA 3H35A 1X2MA 2DYRH 4EM1A 3FXLA 3A01A 4A0YA 3CCQI 3WU0A 1XC5A 1Z21A 2EZLA 2M4KA 1F1ZA 3BP8A 3ESWB 5FKOA 2H8RA 2E5ZA 5K7HA 3I4MJ 1GXPA 2F4OB 4RLFA 1W0TA 5F1RA 3E5UA 2K3PA 4LLLA 2XROA 2BY2A 1UMQA 1YFHA 2LMDA 1VQPI 2LNBA 2EV6A 3KPHA 1WCMJ 2AS5F 2GAUA 4CCOA 3QU3A 2Z3YA 3BLYA 3BTIA 1X4OA 3KP3A 1WJCA 3AAFA 3RZOJ 1MDMA 2IXSA 5DCMA 3AG1H 4FQGA 1MH3A 1MMDA 3E1SA 4MGRA 3SFZA 1IRZA 3F22A 3HHGA 5HVQC 1WJAA 2R0QC 3O2PE 2OAZA 2HTJA 3IP4B 2ELKA 1OCCH 1YW8A 1S7EA 3ZN1A 4U0YA 3WTSC 2DXIA 4JX4A 5D4RA 3G6EI 1SD4A 2X1DA 2MBFA 3LMMA 4HX8A 1KZHA 5DD8A 5KHDA 1IAWA 4L9NA 1GLNA 1XPXA 4N4OB 2CV1A 2JN6A 4RGSA 2TCTA 3K4CA 2V26A 4A6DA 3IHUA 1VF9A 4I0AA 2PX9A 3DTIA 4FHTA 5B3SH 3H3VK 1BOAA 4UUSA 2E5NA 2KRCA 1OQYA 1H0MA 4KYWA 1F5TA 1ODDA 2BE5F 4EVIA 5LHGA 4NC7A 2H1LA 3ABTA 5IP9J 2JVHA 2VONA 2YPRA 5AONA 4BXFA 4BBRJ 1TWCJ 2BBYA 5FLMJ 3DP7A 3M8EA 3BTLA 2HQRA 3PSIA 4P96A 3CO6C 4L5IA 4F3QA 2QUFA 4RAGA 2PJRA 2VQGA 4J19A 3MKLA 4CYCB 3V4GA 4AC0A 1TNTA 1D0YA 1OPCA 3GO5A 2Y48A 4EM2A 1JXSA 3TKYA 2JSCA 2CWEA 1D1CA 3P5JA 5C4XJ 5B1AH 3SDGA 2M4GA 3TP0A 1UHSA 1O3TA 1Y8QB 2ME0A 2QSFX 3JRGA 3D5SC 4DBRA 5FJ8J 3OOUA 1VNDA 1XSDA 1BR4A 4XKVA 3AKZA 4MLOA 1OCOH 2V1DA 1U9OA 1WHUA 3CDLA 4AU7A 3VODA 2M5WA 2YX7A 4AUXA 2IA2A 6PAXA 1BI3A 3JRBA 3A2KA 1IJWC 1USTA 2EILH 3BJOA 3J81K 2WY8Q 3O8HA 2FE3A 2Z16A 2ZSIB 1BR1A 1HCRA 1MMGA 4XORA 3TQNA 2ZJQF 3ASNH 4HF1A 1ON1A 2HOAA 2FNAA 2ESHA 4PGHA 2EPFA 4A5NA 4BNCA 3MZ8A 3M1CA 1O4XA 1HC8A 2A6TA 3MKWB 1MBEA 1E3PA 3HSFA 3Q9SA 3LA2A 4BU2A 1XTAA 2OF7A 5IPAA 3F8BA 4BDYA 2ISYA 4UNOA 2KZVA 1MZBA 3K4JA 2FD5A 2XSDC 5E20A 1GDTA 2FBKA 3BR0A 5LFAA 5GPCA 2K40A 2LY9A 1B8IB 1OCTC 1F4KA 4BKXA 3JSOA 1FIAA 4ZZDA 2V6EA 1T2KA 3CCEI 5BS6A 2ZXIA 1WFXA 2L7MP 2VKVA 1SMTA 4HQMA 4TV7A 3KP7A 3PO3J 5DDGA 3OS2A 5D5XB 1AKHA 2DU9A 1SANA 2Z33A 2BYVE 1R7JA 3F6OA 1VI0A 2KIMA 1S6LA 3WTZA 5HODA 3LSKA 2EK5A 4IOCF 1FP2A 1T56A 2NS0A 3HRSA 3WGIA 2ME6A 4ENJA 3E97A 3RYRA 1D3YA 3EDPA 4XKBA 1OMIA 4M9ZA 3BJ6A 1J5YA 3CCJI 2F5FA 3COAC 1QO0D 2L54A 2V9PA 2WC2A 3BPXA 2WB1N 4DZJA 1MMSA 2V6CA 2YSRA 3OYIA 5F64A 5EJCA 3ZRGA 1V54H 1IF1A 2IEKA 3GFIA 3BT9A 2VOOA 1OYYA 2Q1ZB 2VN2A 2RV8A 4ZZLA 2E2JJ 4E7SA 2E36A 4EMSA 3DU5A 1F9NA 3WTUC 2OCCH 2NVQJ 4BHBA 4M74A 2NNYA 1E3OC 5L3BA 2IRFG 5J47A 4BEHB 3BOQA 1HXDA 1H9TA 3DEEA 2QWWA 4CCLA 1GXQA 4KUMA 2OPTA 5EYRA 5K5RA 3WE2A 1S9HA 5HLTA 2BW3A 1EH8A 2Y2ZA 2R7SA 4A93J 4OWRB 2R5YB 3FHZA 1W36C 1ITYA 3IUOA 4C30A 5LRRA 2AQEA 4EEFG 1VTNC 1LKXA 1EA3A 2X0LA 3IWFA 3W3CA 3DBRB 5J3LA 4A12A 2L2OA 1FOXA 1R58A 3NAUA 4JX6A 1HF0A 2A05A 5K5OA 4CCMA 2Y30A 4PFOA 1YO5C 5FO5A 3QAHA 2WTEA 2I8DA 3OYBA 1ETWA 2GIVA 3DF8A 3NWSA 2X6OA 5EF6A 3S2HJ 3WU2C 3DKXA 4D7NA 1HSJA 1WJBA 3WHBA 3H5RA 4KIGA 3P7NA 4CCKA 4IHSA 3F6VA 1G3WA 3TO9A 4XRMA 4Y13A 1D5VA 4CXFA 1ETYA 5D6EA 1PDNC 1U9NA 1I50J 2M87A 1HW5A 2BXZA 2O9LA 1Y1WJ 2FXAA 2TRTA 2X51A 4NNJA 4M6XA 3SEZA 2Q2EB 5ICCA 1TW3A 3H3UA 1D8KA 3W2AA 1KGSA 3P9KA 4HDUA 4QTRA 1HW2A 1SVOA 1RESA 1G8XA 5IT3A 5A2QK 4M3BA 4RMNA 3CMAI 3I5UA 2MH2A 1TW2A 3OYLA 1SFUA 2YS9A 4UHTA 2HYGD 3A02A 1KU7A 3EETA 2Y0SA 1I3QJ 4A3MJ 1LDJA 3DTEA 3PQJA 4A0XA 3S93A 1P7IA 1YG2A 3QWLA 2CQNA 2XPWA 1Z1DA 1T39A 4KMUX 1JKPC 1YX3A 2MH9A 2VIXA 3QPTA 1XGMA 1FTTA 4HX4A 3H0GJ 1MNDA 1UG0A 1FT9A 5F0HA 2RGVA 1XN7A 1BC8C 1IDYA 3GTPJ 2CQKA 2KIQA 4G7OF 4I76A 5FFXA 5KAIC 3HM5A 1HA8A 3Q0UA 3D5RC 2LBFB 5A2QZ 1DPRA 2PBIA 2LRDA 3OMYA 1A6QA 2CS3A 3HSEA 1SD7A 3TOBA 2LH9A 5CVIA 3G1LA 4HNUA 2HZDA 4A3BJ 3IKVA 4A3IJ 3IRRA 2PG4A 2XASA 3ELKA 3KP2A 3TW6A 2D1HA 3VEPA 2WAFA 3AG4H 4BJTA 4M3DA 3WTTC 2DODA 3C3WA 2FMYA 1ZAOA 3KZZA 1ACIA 1SAUA 1HKQA 2AXTC 4KN4X 3A01B 5EGOB 1K6YA 1N78A 1BJZA 5DM6F 2M9HA 2XIGA 5B66C 2P5VA 3HRUA 1BL0A 5IP7J 2XVCA 1FOKA 4FETA 1TT0A 4NB5A 2CYYA 4U0WA 4PDKA 3L2QA 3V7SA 4JBAA 3CCRI 3BG7A 1BI1A 1A35A 3KEYA 5H20A 1N75A 2XAQA 1V5GA 1SD6A 2BV6A 3FK7A 4DYRA 1V5EA 2FOWA 3ML6A 4W97A 2BEOA 3FM5A 2DDBA 1IV8A 1IZ1A 1ZG5A 5J1RA 1VFCA 3F8MA 4OIRF 3HB9A 2UXXA 2FBIA 2V1NA 1B4AA 2BZTA 4MTDA 4N9HA 3OS1A 2YU3A 2O03A 2DQLA 1MIJA 5CKTA 3PUBA 5B5EC 4Y7NJ 5FB2A 5CPRB 2L7FP 4E6KG 2HI3A 2VQCA 3CESA 1FTZA 3EQLF 5CQGA 2QZ8A 3TOAA 4N0BA 4GFBA 3KX2A 3ZMDA 5F04A 3BPVA 1TZLA 3S3NA 1QBJA 1WSUA 4A3DJ 3AG3H 4RB1A 4UUSB 3BR6A 1DUXC 2CQ7A 2R7DA 3CP8A 3ZMSA 2CG4A 4EGYA 1G6NA 3NQOA 3DPLC 2CJJA 2HTSA 4D0PA 1YX5A 2W1OA 4ETSA 1D5YA 3K4BA 4ANJA 2ZXHA 5KAFC 3FX3A 4L18B 1VQ6I 1D0XA 4WXDA 5BOXA 3KLNA 2PMHA 1JKOC 2JA6J 3VDXA 3QYBA 2VBXA 3ABLH 3K9TA 2DA1A 3DEWA 4ZJZA 5JVTA 1ZARA 2IT0A 2KIFA 2W4SA 2KPMA 3CDHA 3BG5A 3P9CA 1XGOA 3VYUB 1Y0NA 4MEXF 3SQNA 3GTJJ 1VQ8I 1IXRC 4A5MA 4C3HJ 2QCOA 2EWNA 2IPQX 3HKZA 1VQOI 1QA6A 3MQ0A 2L02A 3I64A 4UB8C 2HKOA 5FKNA 4B47A 3RSNA 1S7AA 2VT2A 3GTGJ 5EEAA 3K2AA 4V19K 2BGCA 1FNNA 3BR1A 5B1BH 3N4MA 3AL0C 3EUHC 2FBHA 4KICA 2K86A 1Z3XA 2LOOA 1DP3A 4YEJA 1FBQA 5CQEA 2NVXJ 3CC4I 1GHCA 4W1UA 4RBOA 3K2ZA 1RUNA 3BTJA 2MG4A 2OTLI 4LGWA 2VPRA 4LJZF 3VSKA 2HZTA 2BVMA 3QQAA 3C2BA 2EIMH 4L5EA 4Y4RA 2PI0A 2DMNA 1H88C 1YHQI 3RJPA 1MBHA 1IG7A 3RZDJ 3H92A 3F8NA 1G3TA 2CH0A 3ABKH 1GT0C 4L9VA 4L0ZB 1MKMA 2QVOA 5C3EJ 1XCVA 3OL4A 5DEQA 4XRSG 3IH2A 2XGXA 5GTHC 2DCEA 3K7AJ 4ENNA 4IHYA 1FYMA 2WY7Q 5E1WA 1MBKA 3BCBA 2Q8KA 4C3JJ 2K85A 4IRHA 5L3DA 3LSJA 3HOZJ 4E7LA 3F9KA 5AIQA 4LB5A 2DOFA 2X4HA 2V4JC 2XF6A 3FMSA 4LIVA 1GV2A 2WA0A 3SZTA 4HV6A 2L9SA 2DTZA 4WX9A 3MVPA 2KL4A 1AWCA 2ZNYA 2O7OA 1U5TB 4BXUA 2JTVA 4EQQA 3HUGA 4XM3A 3LAPA 1GVDA 2Z1DA 2BY0A 2VASA 5HDGA 1QHHD 2GBYA 4XOPA 3E5XA 5GAEJ 1ZLKA 4MTEA 4LLNA 2P8TA 3GEZA 5ICGA 2E1MC 3KP4A 3DLLF 4GDFA 4HBLA 2HOEA 3K1NA 3Q0VA 5TRDA 3M8FA 1QNTA 1R49A 3CP2A 3FBIB 3KLOA 2R4GA 4M6YA 1U2WA 2JUGA 1TWHJ 3ABMH 5LGUA 2M0MA 4GYIA 2P0WA 2M7AA 4L9TA 5D8KB 5HNFA 5FKMA 3ZMTA 1QVUA 3M1EA 2HXIA 3V42A 3V8KA 5HLHA 1RI7A 4J00A 1ZREA 3HPHA 2HEOA 3PJRA 1XG1A 1IO2A 2JZYA 4LIUA 4KJZA 2BW3B 4PJNA 4LOCA 1A5JA 3T1BA 4B44A 3CCUI 1P6RA 2B63J 2P4WA 2L0KA 3SZPA 1BI2A 1TQMA 1X58A 3K70C 2VJ4A 4IKFA 1PUFA 5M5XJ 2JQ7A 3BQYA 2B9SA 2DMQA 3IH3A 5BPDA 2XUBA 2GA2A 2L3DA 5ILSA 3T5XA 2H94A 1RNLA 4IL6C 2CUEA 5LBQA 3I56I 2ZJPF 4Y3OA 4E7KA 2WADA 3P9IA 1DQUA 3CF2A 5HS8A 3GTOJ 2E71A 3Q0WA 1QZEA 2E19A 1Y0UA 2L9VA 3Q9VA 4YFKF 4HNVA 1W5TA 2MFZA 5EG0A 4C2UA 1JUPA 2KMUA 1Y8RB 1CF7B 2OZ6A 2QM3A 3GW2A 3OIQA 4DNCA 2GXGA 2HWVA 2LR8A 2IAIA 4ENKA 3F8CA 1V4RA 1FBUA 1R5ID 1DDNA 3BTCA 5ICFA 2GXBA 2HS5A 4BY7J 2ZO4A 4OAYA 3L9FA 3SFIA 4ITVA 3HG9A 3UNGC 4M72A 4I01A 3VOEA 2EZHA 2W00A 3A0BC 1QZZA 3H9QA 4ZDPA 1YE9A 5HLIA 4X6AJ 3CJQB 3LOCA 1TWFJ 2VKDA 1LE8A 2EBIA 2Z5UA 4QPOA 3VSLA 5K7FA 2G0EA 2NS7A 5FROA 1FOYA 2EV0A 5KK1A 1U3EM 1I6HJ 1DU0A 4PJ0C 1FY7A 3PQKA 2YUSA 3CMMA 1ZRCA 1J2XA 2UUZA 1P4WA 3E3VA 4C2MJ 3OYJA 2XRLA 4RGRA 3GLXA 4L9JA 3OYCA 2VODA 3LSMA 3JRHA 3K1MA 3HOYJ 3MD2A 4KN7X 5M5YJ 3CC2I 2QKLB 1IN8A 1XCBA 2P5LC 3HRMA 1R5GA 1FMVA 4U7BA 3F0CA 5E3LA 4BE1A 2IS1A 1K78B 3PM1A 2VC1A 2ZC2A 3ZQFA 3TEDA 2TDXA 1Y6IA 1ETKA 2JVGA 1QQIA 4HOBA 3L2RA 2GWRA 3R0AA 5E17F 1IV6A 1OLTA 4P9FA 2B0LA 5IP6A 2G7HA 2CGPA 3KZYA 2MA3A 5E18F 3JRAA 2DQRA 1T8IA 3OR2C 4MFEA 2ZMEC 3GZ6A 2CUZA 4BDZA 2MGQA 3PUFA 2XAHA 4G6TB 2HKXA 3GMEA 1T95A 4UUTA 3GX4X 3I4NJ 1Z05A 3OYGA 3J80K 5E79C 1FSEA 1W36D 4JP0A 5F1JA 1GV5A 2Z99A 2PN6A 3EYIA 2AO9A 3K4NA 3S15J 1MNMC 1WWXA 1I5ZA 1XGNA 1FC3A 2H8WA 5E1XA 2OJED 3EUKL 1TLHB 3PIOF 2UXNA 3OY9A 3FISA 3F21A 1JHHA 4WWCA 1BA5A 3FXUA 2F4MB 4HF2A 4HSRA 2HOSA 4NDLA 3TDZC 4MO7A 3L1PA 3BWGA 1R22A 2J5OA 2YX4A 3ZMZA 4OIQF 1BIBA 5J4VA 1RR8C 4YFNF 3I59B 1K61A 1JGGA 2OQGA 2VJIA 2JRMA 5FLVA 3NEUA 4XKWA 1ZG3A 4ZC3A 4DBQA 4CCJA 1XDUA 1Z91A 3J80Z 2HFHA 3FIWA 3I54A 1YIJI 2DA3A 3OYEA 1JJ6C 3M8JA 5HNHA 4BACA 2ESNA 4I99C 3E6BA 2V79A 4YRVA 2STWA 2FA5A 2MSYA 4U88A 1G3YA 2EQRA 1F43A 3S14J 3U1KA 2OCEA 1SC7A 4O5VA 3JAMK 4XONA 3TDUC 2DK5A 4IXAA 3CUOA 1OCRH 3ZN0A 4FE7A 2CUFA 2DYSH 3LSGA 4H4KC 3G71I 1WKMA 3RPUA 1QGPA 2IW5A 3QOEA 5J4YA 2R93J 1SEUA 1T0FC 2PQ8A 3JRCA 1A04A 2FJ1A 1Z0XA 4XR6A 4RAYA 2FRHA 2IGMA 2L9RA 1P4AA 2CMPA 5M3MJ 3L7WA 4FX0A 4BHCA 1TWGJ 2RREA 2EB7A 3UKGA 1PJRA 3LSRA 1ZGWA 2JA5J 2KKOA 4Y33A 3H36A 3HGGA 1R71A 1FPQA 2W24A 1WZ2A 1VQ7I 3ZQGA 3O6BB 4XLCA 3JSPA 1BN5A 3JAMZ 1B59A 1LB2A 4CICA 1X3WB 1J59A 4IOAF 1K79A 1W7PD 3LSTA 3C1DA 2HQ5A 3V8JA 3WODF 3ZMUA 3QPSA 4GXOA 5ICEA 4WK8F 1SD5A 2VOPA 5GTIC 2HYFA 3HOTA 1JGSA 3CJRB 2R7WA 3S16J 5J6XA 3GFMA 4ZH4F 3WGHA 3O3KA 3FXQA 2Y9YA 2DMPA 3A1YA 3QPLA 4Q4ZF 4IZZA 2KT0A 1JUSA 2HNHA 3JTGA 3SZGA 1N25A 1YRNA 3LQRA 3OIOA 5J8CA 3PL8A 5GAGJ 3KEQA 1NK2P 5LEJA 4RGUA 4OIOF 1MGTA 2LLKA 3RPUD 2X6WA 2ZNZA 4LK0F 2CW0F 3MKYB 3OYHA 4HAMA 1Z6TA 3CUQB 2HDCA 3FK6A 3G4SI 2EZIA 4A3CJ 4HSTA 3HHHA 3WHCA 2E2IJ 3RDIA 1D1BA 3H0DA 1V55H 1O3QA 2R7OA 3TGNA 1ZR2A 2YR2A 2ELJA 2K4BA 2OD5A 1B6AA 1WGXA 1YQAA 4AD9A 4O3MA 4FT8A 2F5EA 3EUHA 4ZDOA 2JJ7A 3MZYA 2MABA 1R9TJ 5CJ9A 3SJMA 4EJTA 3OV8A 1Z77A 5HDNA 4IEJA 5TGTA 2VJJA 3TBIA 1STZA 4QSHA 3RTRA 3B6AA 5ILUA 1IN5A 3IL2A 3BROA 2E34A 3U2RA 1VZ0A 1K6OA 1SVLA 1IN7A 1PP7U 4Q48A 5FKLA 1YS6A 3ROUA 3S1RJ 3I4PA 2HVRA 3KIOA 4BBSJ 2Y69H 1ZRDA 3OYMA 1QU3A 4YFXF 1ZHFA 2DW4A 5IYDJ 4LG0A 2XGEA 3G1MA 3FM3A 5CVUA 3KE2A 2K27A 3CCMI 2DT6A 1OYWA 3OYFA 4FCYA 4PSWA 4P9UA 1DU6A 2OU2A 3NRVA 2LD5A 4XNFA 2D45A 3BR5A 3FXOA 1ZR4A 1ZQ3P 3G1OA 1QZYA 2IS4A 1NK3P 4DGWB 2R3SA 4A3FJ 3DQVC 2QQBA 2WBMA 4XN3A 4M71A 3R4KA 4IPAA 3SYTA 4BYYA 5LD2C 1MJ9A 1RETA 2Y0SN 4LLGF 4ZDLA 1W5CC 5L3CA 4YIIA 1OCPA 3S2DJ 3RQIA 2L01A 2KRHA 2EIKH 3KP6A 2GXAA 3GCMA 3HTUA 5LGNA 3GLLA 1D1AA 1R1VA 2KISA 2R5ZA 1W4MA 5M5WJ 3U1DA 3LNQA 1EKEA 1HDPA 1S29A 5LLQA 4C2TA 4E7ZA 1LJ9A 2OC6A 3ASOH 2R7ZJ 1FBSA 1J75A 4R1HA 2FMLA 4HDVA 2DI3A 4FTHA 4G7ZF 1XMXA 3KEOA 3GVAA 1WQ2A 2MC4A 2BHYA 5C44J 3BG3A 1G4DA 3MKZA 4D7MA 2EV5A 3X2QH 1YTYA 1K4SA 1FZPB 1PYVA 3VYRB 5JFRA 4JOMA 2I5UA 4ESFA 3RKQA 1KQ9A 1LPQA 2RQPA 1I1GA 2Q0OA 2VC0A 5ILVA 3RKXA 1XD7A 1R1TA 2IBDA 3HXLA 2DMUA 1XS9A 4XOTA 3H9JA 5CVJA 2W82A 2AQFA 2PMUA 1P92A 4DYCA 9ANTA 2J5PA 1XMKA 4AIKA 2L7KA 2P7VB 5M3FJ 1MMNA 1H8AC 5D6FA 4RB3C
chains in the Genus database with same CATH topology
3LQQA 5D4SA 1R36A 3REOA 3FWEA 4KIBA 3DEUA 4IF4A 5BQTA 1IXCA 2Y75A 1Z7UA 4L0YB 4Q47A 4G7HF 2IA0A 2MLKA 4DQ2A 1O3SA 3LFKA 2HR3A 5FFZA 5KVRA 3R6SA 1LVAA 1T38A 1MDMB 5DCMB 3E5QA 1Q1HA 2FOKA 1XGSA 2G9WA 4Y15A 1EH6A 3D5LA 5HDKA 2P5KA 4EGZA 4G6QA 4JQFA 2V9VA 3GUDA 3WE3A 4EV0A 3GZ5A 2RN7A 3GFJA 1I1SA 4CO8A 2QENA 4QLCU 4NHJA 1P4XA 2M1BA 1FP1D 5DYMA 2R7FA 1U5TC 1E17A 2CSOA 5HLGA 1L0OC 1HSTA 3N97A 1YLFA 2HQNA 5AIPA 5LHHA 4Z2YA 4A0ZA 1KQ0A 1SAXA 2P7CB 1RZ4A 1FYKA 3ECHA 1BI0A 3B73A 3IWZA 2ACJA 2XAGA 3J7AO 1KYWA 4XRFA 2O3FA 1YS7A 1K7AA 3QOPA 4MQVA 2ZMEA 2QLZA 1IW7F 4XLNF 2ISZA 3MAJA 3S2WA 4HYEA 3ZPLA 2DBBA 4LFUA 3F3XA 4Q5SF 3V7RA 2ELHA 2LF7A 2XKOA 4YIFA 3K1PA 5D5VB 2KJCA 5K1YA 1ON2A 4IRIA 2VE8A 2VBZA 5FLXK 4QWQA 1PUEE 3R0JA 2OZUA 2JPCA 4UVAA 5FGMA 1ZLJA 1B9MA 3RIRA 4S05A 4CYDA 2W84A 2A07F 1MD0A 2L4MA 2O0YA 1XMAA 3QU6A 4P55A 4A2UA 1J9IA 2FQ3A 2M8EA 2Z9OA 1MJBA 3FZVA 3LA3A 2DK8A 5FLXZ 1L3LA 1SMYF 4NQWA 5H6QA 1W5SA 4R79A 4BH9A 1KU9A 3E6DA 4RS8A 1KU2A 2D1VA 2CO5A 2IJLA 5E8GA 3L2CA 1X3UA 2E7WA 2Q2EA 1OKRA 4I02A 5CVRA 1YIOA 2ZFWA 3B02A 2FSWA 2L4AA 3HTSB 4KT5C 3CO7C 3V8LA 4OOIA 3MZHA 4PGGA 3WU1B 4HA8A 3BZ6A 3E6MA 5L3FA 1S3JA 3TO6A 1J0RA 5IT9Z 1R23A 4ENMA 5CVVA 2O6GE 5EEGA 1U8RA 4HLXA 4UV8A 4GO1A 4LG0B 2WWYA 3JW4A 4IRGA 5D5UB 2XHKA 1FYLA 2QBYA 3DXJF 3QPHA 2GZWA 5E1ZB 4ZYHA 4WXHA 1TBXA 4I09A 1BBYA 4MEYF 4LD5A 3T8TA 2M30A 1AOYA 4M9SA 3HSRA 3FMQA 1Z9CA 4G94A 4UVBA 3U9GA 2A5YB 4EJUA 1ZH5A 1LDKB 1ULYA 4UUVA 4HV5A 3FF5A 4R8HA 2JRTA 4B09A 1Z6RA 4KDPA 5FD5A 3I71A 2M45A 2DO7A 2ZBKA 2KIUA 4IVNA 2PFBA 2C6YA 5F6FA 4E70A 4PZJA 1R1UA 1TQPA 2JT1A 2LDUA 1XB4A 1GVJA 2RVCA 3WTYC 5HS9A 4RAZA 3LA7A 4EM0B 4I7HA 1UFMA 1FX7A 2IP2A 3IKTA 1ZG1A 2O61A 3QRFF 2FF4A 2W85A 4G9YA 4AIJA 3I58A 5ED4A 2EA4A 1HW1A 5K5QA 3C18A 3ISPA 4XSZF 2DT5A 1LEBA 2GA1A 1H9GA 3GXOA 4ESBA 3I0TA 2EJRA 2ETHA 1R00A 4KFCA 5TJJA 3G73A 3RYPA 2EFNA 1TQIA 1JHFA 3WTVC 2F5DA 2NNNA 1LEAA 2UWMA 1W7PA 2CFXA 1IRFA 1UCRA 3HOSA 1U78A 1XDSA 3CUQC 3WG9A 4F7ZA 2RC4A 3CLOA 5LEKA 1S7OA 2KJBA 4M73A 1S8NA 2DFIA 4WXCA 4PCQA 3CJNA 2H09A 3MCZA 1T98A 1KYZA 4GGGA 3K0LA 3GWZA 3KP5A 1IRGA 4GYGA 2EFPA 3RKYA 2LKPA 2IVMA 3M9AA 4UXNA 4HLYA 2QYOA 3OOPA 4G6DA 3RI4A 1ZGJA 4MNUA 5DUKA 3ZQ7A 5H6RA 1O7FA 1EH7A 2FNPA 4LB6B 3J81Z 4EJVA 2GQQA 4OU0A 3SXYA 1RUOA 2ZMEB 4XLPF 4EJOA 4GCVA 1U5TA 2F5CA 2W25A 4HW0A 5BPIA 1FSHA 3VFZA 3V7CA 4ZYGA 2VE9A 4HQEA 2EA2A 4G8XA 4H0EA 3ZMVA 4ASNA 2A6HF 5HS7A 4K2EA 3SHFA 4Y17A 1BJAA 2A6EF 4OMZA 1P2FA 2F2EA 5BMZA 2DPDA 2G7UA 2PLYA 4UV9A 2AXLA 3M7GA 1NHAA 2A3SA 3W6JB 2E1NA 1CGPA 2A61A 4CDGA 4YG2F 1LDDA 1UB9A 5D5WB 2XV4S 5JHUA 2A69F 4LMYA 4XSXF 2WV0A 4WCGA 1DP7P 4CZZA 2P6SA 4N9IA 1KU3A 2QQAA 1LQ1A 2VBWA 2RKHA 4MHGA 1J7KA 4I0BA 3D0SA 2H27A 1ZRFA 1DPUA 2D2WA 1OR7A 3JTHA 4L5JA 2ZKZA 2PJPA 4M9XA 3BJAA 4BQAA 2FU4A 5DUIA 3KFWX 1TTYA 2Y0MA 5D8LB 5HOOA 1CF7A 5FD6A 1D8JA 3RPQA 1RIOH 3LWFA 2LF8A 2XAFA 2LSOA 3FXRA 5LRSA 1G3SA 3L00A 1PP8F 1C0WA 2STTA 3ZP5A 4AVPA 5CLSA 1I27A 2K4JA 1T6SA 5ERIA 4ESJA 4IHTA 1WRJA 3GFLA 2VXZA 1ZYRF 2QBYB 2V1XA 4XBFA 4U0VA 1IUYA 4OINF 1HBXG 3ECOA 2PEXA 2P6TA 2VT3A 2DTRA 5DD4A 2HGCA 1XSXA 3QP6A 1ZN2A 1K78A 4MQ9F 1SFEA 3G3ZA 2XKPA 2H6BA 1R5HA 2FEZA 2DAOA 2IA1A 3DFGA 3RKWA 4RB2C 4RGXA 1JE8A 2COMA 2DLLA 2RDPA 3L09A 3DKWA 2OQRA 3C7JA 3W6KB 1YW9A 4AWXB 2EFQA 2K7LA 1ZGAA 4P5OA 5LGTA 4JK1X 3BDDA 2ZJ2A 4ZYDA 4ZYEA 4AIHA 2NRAC 3I59A 3MWMA 4A6EA 3HIFA 3BY6A 1MJAA 2DPUA 1BIAA 3CTAA 2XAJA 2VBYA 1B9NA 1V3FA 1OYIA 5E8IA 2OBPA 2H6CA 1B1BA 1E2XA 2ADUA 3IRQA 1YW7A 3T8RA 1BM9A 1W7PB 1HKSA 4LK1F 4HZFA 1QPMA 1IXSB 4B8XA 1TNSA 2NYXA 3WTXC 4CHUA 4I98B 2A68F 2QQ9A 1LNWA 4KA4A 5DCFA 1BC7C 3MEXA 2K02A 1REPC 3F8FA 3Q5FA 1KA8A 2EFOA 3VB2A 1YYVA 5JR3A 3T0YA 3DV8A 5LHIA 5CYVA 4S04A 5DV5A 3KETA 3R60A 5J8FA 4O6JA 3WTWC 3DPTA 4KMFA 3ABUA 3R61A 4I2OA 2O8XA 1O3RA 1HQCA 3CUQA 2OA4A 1ONVA 4UVCA 3ERED 1U6GA 3EYYA 4KNYA 3H3ZA 4BAYA 3TO7A 2XRNA 5L3EA 3MFKA 2JPBA 3KCCA 2E1CA 3I53A 3F23A 1FLIA 1T0FA 3GF2A 4U7DA 1IN4A 5IT9K 5L3GA 3QP5A 2MLGA 1O7LA 1EV7A 4KIFA 1HKTA 4EJWA 3K69A 4WF2A 2UZKA 4FX4A 1UHWA 1FWZA 2ZCWA 3HRTA 4RB0A 3F72A 3WGGA 1KQ8A 3LAJA 5EEHA 2RNJA 4ON0A 1XSVA 3GYHX 1SFXA 3ULQB 2E7XA 4BHPA 3FMRA 2MC3A 4OMYA 4OIPF 3E6CC 2NAZA 1USSA 1I6XA 1WI9A 1IN6A 2KRFA 2MD5A 2V1UA 5JI6A 1UHMA 3IC7A 4HX7A 2ZXJA 1O57A 4HF0A 2W57A 3HYIA 4IJAA 3PFIA 4CGZA 2EFWA 4EM1A 4A0YA 3WU0A 1F1ZA 3BP8A 1GXPA 5F1RA 3E5UA 4LLLA 2XROA 1YFHA 2LNBA 2EV6A 2AS5F 2GAUA 3QU3A 2Z3YA 3KP3A 3AAFA 1MDMA 5DCMA 4MGRA 3SFZA 3F22A 3HHGA 5HVQC 3O2PE 2OAZA 2HTJA 1YW8A 3ZN1A 4U0YA 3WTSC 5D4RA 1SD4A 2MBFA 4HX8A 5DD8A 1IAWA 4L9NA 4RGSA 4A6DA 3IHUA 4I0AA 4FHTA 1BOAA 1H0MA 4KYWA 1F5TA 1ODDA 2BE5F 4EVIA 5LHGA 3ABTA 2VONA 2YPRA 5AONA 2BBYA 3DP7A 3M8EA 2HQRA 4P96A 3CO6C 4L5IA 2QUFA 3V4GA 1TNTA 1OPCA 3GO5A 2Y48A 4EM2A 1JXSA 3TKYA 2JSCA 2CWEA 1O3TA 1XSDA 2V1DA 6PAXA 3VODA 2M5WA 2YX7A 2IA2A 1BI3A 1USTA 3BJOA 3J81K 2FE3A 3TQNA 4HF1A 1ON1A 2FNAA 2ESHA 4PGHA 4A5NA 4BNCA 3HSFA 3Q9SA 3LA2A 3F8BA 2ISYA 4UNOA 1MZBA 5E20A 2FBKA 1F4KA 3JSOA 4ZZDA 1T2KA 5BS6A 1SMTA 4HQMA 4TV7A 3KP7A 5DDGA 5D5XB 2DU9A 2Z33A 2BYVE 1R7JA 3F6OA 2KIMA 1S6LA 3WTZA 2EK5A 1FP2A 2NS0A 3HRSA 3WGIA 4ENJA 3E97A 3RYRA 1D3YA 3EDPA 1OMIA 4M9ZA 3BJ6A 1J5YA 2F5FA 3COAC 1QO0D 2L54A 2WC2A 3BPXA 2V6CA 2YSRA 5F64A 1IF1A 3GFIA 2VOOA 1OYYA 2VN2A 2RV8A 4ZZLA 4EMSA 3WTUC 1F9NA 4BHBA 4M74A 2NNYA 5L3BA 2IRFG 3BOQA 1HXDA 1H9TA 2QWWA 1GXQA 4KUMA 5K5RA 3WE2A 1EH8A 3FHZA 5LRRA 1VTNC 2X0LA 3IWFA 4A12A 1R58A 5K5OA 1YO5C 5FO5A 3QAHA 2WTEA 2GIVA 3DF8A 1HSJA 4KIGA 3P7NA 4IHSA 3F6VA 1G3WA 3TO9A 4Y13A 1D5VA 4CXFA 1PDNC 5D6EA 2M87A 1HW5A 2FXAA 4M6XA 5ICCA 1TW3A 3H3UA 1D8KA 1KGSA 3P9KA 4HDUA 1HW2A 5IT3A 5A2QK 3I5UA 2MH2A 1TW2A 1SFUA 4UHTA 2HYGD 1KU7A 3EETA 1LDJA 3PQJA 4A0XA 1YG2A 1Z1DA 1T39A 4KMUX 2MH9A 3QPTA 1XGMA 4HX4A 1FT9A 2RGVA 1XN7A 1BC8C 2CQKA 4G7OF 5FFXA 5A2QZ 1DPRA 2PBIA 3HSEA 1SD7A 3TOBA 5CVIA 3IKVA 3IRRA 2PG4A 2XASA 3ELKA 3KP2A 2D1HA 3VEPA 3WTTC 3C3WA 2FMYA 1ZAOA 3KZZA 1HKQA 4KN4X 2XIGA 2P5VA 3HRUA 1FOKA 2XVCA 4NB5A 2CYYA 4U0WA 4PDKA 3V7SA 4JBAA 1BI1A 5H20A 2XAQA 1SD6A 2BV6A 3ML6A 2BEOA 3FM5A 1IZ1A 1ZG5A 3F8MA 4OIRF 2UXXA 2FBIA 1B4AA 4MTDA 4N9HA 2YU3A 2O03A 2DQLA 5FB2A 3EQLF 2QZ8A 3TOAA 4N0BA 3ZMDA 3BPVA 1QBJA 1WSUA 4RB1A 1DUXC 2R7DA 3ZMSA 2CG4A 4EGYA 1G6NA 3NQOA 3DPLC 2HTSA 4D0PA 4ETSA 3FX3A 4L18B 4WXDA 5BOXA 3KLNA 2PMHA 2VBXA 3K9TA 5JVTA 2IT0A 1ZARA 2KIFA 3CDHA 3P9CA 1XGOA 4MEXF 3SQNA 1IXRC 4A5MA 2EWNA 2IPQX 3MQ0A 2L02A 3I64A 2HKOA 1S7AA 2VT2A 2BGCA 1FNNA 3N4MA 2FBHA 4KICA 2K86A 1FBQA 1GHCA 3K2ZA 1RUNA 4LGWA 4LJZF 2HZTA 2PI0A 3RJPA 3H92A 3F8NA 1G3TA 4L9VA 4L0ZB 1MKMA 2QVOA 1XCVA 5DEQA 2XGXA 4ENNA 1FYMA 2Q8KA 5E1WA 4IRHA 5L3DA 5AIQA 4LB5A 2X4HA 3FMSA 3SZTA 4HV6A 4WX9A 1AWCA 2ZNYA 1U5TB 4BXUA 2JTVA 4EQQA 3HUGA 3LAPA 5HDGA 3E5XA 1ZLKA 4MTEA 4LLNA 2P8TA 3GEZA 5ICGA 3KP4A 4HBLA 2HOEA 3K1NA 5TRDA 3M8FA 1QNTA 3KLOA 4M6YA 1U2WA 5LGUA 4GYIA 5D8KB 4L9TA 3ZMTA 3M1EA 3V8KA 5HLHA 1RI7A 1ZREA 2HEOA 2JZYA 3T1BA 1P6RA 2P4WA 3SZPA 1BI2A 1TQMA 5BPDA 2XUBA 2GA2A 2L3DA 5ILSA 3T5XA 2H94A 1RNLA 5LBQA 3P9IA 5HS8A 1Y0UA 4YFKF 3Q9VA 1W5TA 1CF7B 2OZ6A 2QM3A 3GW2A 4DNCA 2GXGA 2HWVA 4ENKA 3F8CA 1V4RA 1FBUA 1DDNA 5ICFA 2GXBA 2HS5A 2ZO4A 3L9FA 4M72A 4I01A 3VOEA 1QZZA 5HLIA 2Z5UA 2EV0A 5KK1A 1U3EM 1FY7A 3PQKA 1ZRCA 1J2XA 1P4WA 3E3VA 4RGRA 3GLXA 4L9JA 2VODA 3K1MA 4KN7X 1IN8A 1XCBA 2P5LC 3HRMA 1R5GA 4U7BA 1K78B 2VC1A 2TDXA 1QQIA 4HOBA 2GWRA 3R0AA 5E17F 4P9FA 2B0LA 2G7HA 2CGPA 3KZYA 2MA3A 5E18F 2DQRA 3GZ6A 2XAHA 2HKXA 3GX4X 1Z05A 3J80K 1FSEA 2Z99A 2PN6A 3EYIA 1WWXA 1I5ZA 1XGNA 1FC3A 5E1XA 1TLHB 2UXNA 3F21A 1JHHA 4WWCA 3FXUA 4HF2A 3TDZC 3BWGA 1R22A 2J5OA 2YX4A 3ZMZA 4OIQF 1BIBA 4YFNF 3I59B 2OQGA 3NEUA 1ZG3A 1XDUA 1Z91A 3J80Z 2HFHA 3I54A 2ESNA 3E6BA 2V79A 2STWA 2FA5A 4U88A 1G3YA 4O5VA 3JAMK 3TDUC 2DK5A 4IXAA 3CUOA 3ZN0A 1WKMA 3RPUA 1QGPA 2IW5A 2PQ8A 1A04A 4RAYA 2FRHA 1P4AA 3L7WA 4FX0A 4BHCA 2EB7A 2KKOA 1FPQA 2W24A 3O6BB 3JSPA 1BN5A 3JAMZ 1B59A 1LB2A 4CICA 1J59A 1K79A 1W7PD 3LSTA 3C1DA 3V8JA 3WODF 3ZMUA 4GXOA 5ICEA 4WK8F 1SD5A 2VOPA 2HYFA 3HOTA 1JGSA 5J6XA 3GFMA 4ZH4F 3WGHA 3O3KA 3FXQA 4Q4ZF 3JTGA 3LQRA 5J8CA 3KEQA 5LEJA 4RGUA 4OIOF 1MGTA 2ZNZA 4LK0F 2CW0F 4HAMA 1Z6TA 3CUQB 2HDCA 3HHHA 3RDIA 1O3QA 3TGNA 2YR2A 2K4BA 2OD5A 1B6AA 1YQAA 4AD9A 4O3MA 4FT8A 2F5EA 3EUHA 3MZYA 5CJ9A 4EJTA 3OV8A 5HDNA 1STZA 3RTRA 5ILUA 1IN5A 3IL2A 3BROA 3U2RA 1K6OA 1IN7A 1PP7U 4Q48A 1YS6A 3ROUA 3I4PA 1ZRDA 4YFXF 1ZHFA 2DW4A 4LG0A 3FM3A 5CVUA 3KE2A 2K27A 1OYWA 4P9UA 2OU2A 3NRVA 2D45A 1QZYA 2R3SA 3DQVC 2QQBA 4M71A 3R4KA 4IPAA 4BYYA 1MJ9A 4LLGF 5L3CA 4YIIA 2L01A 3KP6A 3HTUA 5LGNA 1R1VA 1W4MA 3U1DA 1S29A 5LLQA 1LJ9A 1FBSA 1J75A 4R1HA 2FMLA 4HDVA 2DI3A 4G7ZF 3KEOA 3GVAA 1WQ2A 1G4DA 2EV5A 1FZPB 1YTYA 5JFRA 4ESFA 1KQ9A 2RQPA 1I1GA 2Q0OA 2VC0A 5ILVA 3RKXA 1XD7A 1R1TA 5CVJA 2PMUA 1P92A 2J5PA 1XMKA 4AIKA 2P7VB 5D6FA 4RB3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQQ A;  5D4S A;  1R36 A;  3REO A;  3FWE A;  4KIB A;  3DEU A;  4IF4 A;  5BQT A;  1IXC A;  2Y75 A;  1Z7U A;  4L0Y B;  4Q47 A;  4G7H F;  2IA0 A;  2MLK A;  4DQ2 A;  1O3S A;  3LFK A;  2HR3 A;  5FFZ A;  5KVR A;  3R6S A;  1LVA A;  1T38 A;  1MDM B;  5DCM B;  3E5Q A;  1Q1H A;  2FOK A;  1XGS A;  2G9W A;  4Y15 A;  1EH6 A;  3D5L A;  5HDK A;  2P5K A;  4EGZ A;  4G6Q A;  4JQF A;  2V9V A;  3GUD A;  3WE3 A;  4EV0 A;  3GZ5 A;  2RN7 A;  3GFJ A;  1I1S A;  4CO8 A;  2QEN A;  4QLC U;  4NHJ A;  1P4X A;  2M1B A;  1FP1 D;  5DYM A;  2R7F A;  1U5T C;  1E17 A;  2CSO A;  5HLG A;  1L0O C;  1HST A;  3N97 A;  1YLF A;  2HQN A;  5AIP A;  5LHH A;  4Z2Y A;  4A0Z A;  1KQ0 A;  1SAX A;  2P7C B;  1RZ4 A;  1FYK A;  3ECH A;  1BI0 A;  3B73 A;  3IWZ A;  2ACJ A;  2XAG A;  3J7A O;  1KYW A;  4XRF A;  2O3F A;  1YS7 A;  1K7A A;  3QOP A;  4MQV A;  2ZME A;  2QLZ A;  1IW7 F;  4XLN F;  2ISZ A;  3MAJ A;  3S2W A;  4HYE A;  3ZPL A;  2DBB A;  4LFU A;  3F3X A;  4Q5S F;  3V7R A;  2ELH A;  2LF7 A;  2XKO A;  4YIF A;  3K1P A;  5D5V B;  2KJC A;  5K1Y A;  1ON2 A;  4IRI A;  2VE8 A;  2VBZ A;  5FLX K;  4QWQ A;  1PUE E;  3R0J A;  2OZU A;  2JPC A;  4UVA A;  5FGM A;  1ZLJ A;  1B9M A;  3RIR A;  4S05 A;  4CYD A;  2W84 A;  2A07 F;  1MD0 A;  2L4M A;  2O0Y A;  1XMA A;  3QU6 A;  4P55 A;  4A2U A;  1J9I A;  2FQ3 A;  2M8E A;  2Z9O A;  1MJB A;  3FZV A;  3LA3 A;  2DK8 A;  5FLX Z;  1L3L A;  1SMY F;  4NQW A;  5H6Q A;  1W5S A;  4R79 A;  4BH9 A;  1KU9 A;  3E6D A;  4RS8 A;  1KU2 A;  2D1V A;  2CO5 A;  2IJL A;  5E8G A;  3L2C A;  1X3U A;  2E7W A;  2Q2E A;  1OKR A;  4I02 A;  5CVR A;  1YIO A;  2ZFW A;  3B02 A;  2FSW A;  2L4A A;  3HTS B;  4KT5 C;  3CO7 C;  3V8L A;  4OOI A;  3MZH A;  4PGG A;  3WU1 B;  4HA8 A;  3BZ6 A;  3E6M A;  5L3F A;  1S3J A;  3TO6 A;  1J0R A;  5IT9 Z;  1R23 A;  4ENM A;  5CVV A;  2O6G E;  5EEG A;  1U8R A;  4HLX A;  4UV8 A;  4GO1 A;  4LG0 B;  2WWY A;  3JW4 A;  4IRG A;  5D5U B;  2XHK A;  1FYL A;  2QBY A;  3DXJ F;  3QPH A;  2GZW A;  5E1Z B;  4ZYH A;  4WXH A;  1TBX A;  4I09 A;  1BBY A;  4MEY F;  4LD5 A;  3T8T A;  2M30 A;  1AOY A;  4M9S A;  3HSR A;  3FMQ A;  1Z9C A;  4G94 A;  4UVB A;  3U9G A;  2A5Y B;  4EJU A;  1ZH5 A;  1LDK B;  1ULY A;  4UUV A;  4HV5 A;  3FF5 A;  4R8H A;  2JRT A;  4B09 A;  1Z6R A;  4KDP A;  5FD5 A;  3I71 A;  2M45 A;  2DO7 A;  2ZBK A;  2KIU A;  4IVN A;  2PFB A;  2C6Y A;  5F6F A;  4E70 A;  4PZJ A;  1R1U A;  1TQP A;  2JT1 A;  2LDU A;  1XB4 A;  1GVJ A;  2RVC A;  3WTY C;  5HS9 A;  4RAZ A;  3LA7 A;  4EM0 B;  4I7H A;  1UFM A;  1FX7 A;  2IP2 A;  3IKT A;  1ZG1 A;  2O61 A;  3QRF F;  2FF4 A;  2W85 A;  4G9Y A;  4AIJ A;  3I58 A;  5ED4 A;  2EA4 A;  1HW1 A;  5K5Q A;  3C18 A;  3ISP A;  4XSZ F;  2DT5 A;  1LEB A;  2GA1 A;  1H9G A;  3GXO A;  4ESB A;  3I0T A;  2EJR A;  2ETH A;  1R00 A;  4KFC A;  5TJJ A;  3G73 A;  3RYP A;  2EFN A;  1TQI A;  1JHF A;  3WTV C;  2F5D A;  2NNN A;  1LEA A;  2UWM A;  1W7P A;  2CFX A;  1IRF A;  1UCR A;  3HOS A;  1U78 A;  1XDS A;  3CUQ C;  3WG9 A;  4F7Z A;  2RC4 A;  3CLO A;  5LEK A;  1S7O A;  2KJB A;  4M73 A;  1S8N A;  2DFI A;  4WXC A;  4PCQ A;  3CJN A;  2H09 A;  3MCZ A;  1T98 A;  1KYZ A;  4GGG A;  3K0L A;  3GWZ A;  3KP5 A;  1IRG A;  4GYG A;  2EFP A;  3RKY A;  2LKP A;  2IVM A;  3M9A A;  4UXN A;  4HLY A;  2QYO A;  3OOP A;  4G6D A;  3RI4 A;  1ZGJ A;  4MNU A;  5DUK A;  3ZQ7 A;  5H6R A;  1O7F A;  1EH7 A;  2FNP A;  4LB6 B;  3J81 Z;  4EJV A;  2GQQ A;  4OU0 A;  3SXY A;  1RUO A;  2ZME B;  4XLP F;  4EJO A;  4GCV A;  1U5T A;  2F5C A;  2W25 A;  4HW0 A;  5BPI A;  1FSH A;  3VFZ A;  3V7C A;  4ZYG A;  2VE9 A;  4HQE A;  2EA2 A;  4G8X A;  4H0E A;  3ZMV A;  4ASN A;  2A6H F;  5HS7 A;  4K2E A;  3SHF A;  4Y17 A;  1BJA A;  2A6E F;  4OMZ A;  1P2F A;  2F2E A;  5BMZ A;  2DPD A;  2G7U A;  2PLY A;  4UV9 A;  2AXL A;  3M7G A;  1NHA A;  2A3S A;  3W6J B;  2E1N A;  1CGP A;  2A61 A;  4CDG A;  4YG2 F;  1LDD A;  1UB9 A;  5D5W B;  2XV4 S;  5JHU A;  2A69 F;  4LMY A;  4XSX F;  2WV0 A;  4WCG A;  1DP7 P;  4CZZ A;  2P6S A;  4N9I A;  1KU3 A;  2QQA A;  1LQ1 A;  2VBW A;  2RKH A;  4MHG A;  1J7K A;  4I0B A;  3D0S A;  2H27 A;  1ZRF A;  1DPU A;  2D2W A;  1OR7 A;  3JTH A;  4L5J A;  2ZKZ A;  2PJP A;  4M9X A;  3BJA A;  4BQA A;  2FU4 A;  5DUI A;  3KFW X;  1TTY A;  2Y0M A;  5D8L B;  5HOO A;  1CF7 A;  5FD6 A;  1D8J A;  3RPQ A;  1RIO H;  3LWF A;  2LF8 A;  2XAF A;  2LSO A;  3FXR A;  5LRS A;  1G3S A;  3L00 A;  1PP8 F;  1C0W A;  2STT A;  3ZP5 A;  4AVP A;  5CLS A;  1I27 A;  2K4J A;  1T6S A;  5ERI A;  4ESJ A;  4IHT A;  1WRJ A;  3GFL A;  2VXZ A;  1ZYR F;  2QBY B;  2V1X A;  4XBF A;  4U0V A;  1IUY A;  4OIN F;  1HBX G;  3ECO A;  2PEX A;  2P6T A;  2VT3 A;  2DTR A;  5DD4 A;  2HGC A;  1XSX A;  3QP6 A;  1ZN2 A;  1K78 A;  4MQ9 F;  1SFE A;  3G3Z A;  2XKP A;  2H6B A;  1R5H A;  2FEZ A;  2DAO A;  2IA1 A;  3DFG A;  3RKW A;  4RB2 C;  4RGX A;  1JE8 A;  2COM A;  2DLL A;  2RDP A;  3L09 A;  3DKW A;  2OQR A;  3C7J A;  3W6K B;  1YW9 A;  4AWX B;  2EFQ A;  2K7L A;  1ZGA A;  4P5O A;  5LGT A;  4JK1 X;  3BDD A;  2ZJ2 A;  4ZYD A;  4ZYE A;  4AIH A;  2NRA C;  3I59 A;  3MWM A;  4A6E A;  3HIF A;  3BY6 A;  1MJA A;  2DPU A;  1BIA A;  3CTA A;  2XAJ A;  2VBY A;  1B9N A;  1V3F A;  1OYI A;  5E8I A;  2OBP A;  2H6C A;  1B1B A;  1E2X A;  2ADU A;  3IRQ A;  1YW7 A;  3T8R A;  1BM9 A;  1W7P B;  1HKS A;  4LK1 F;  4HZF A;  1QPM A;  1IXS B;  4B8X A;  1TNS A;  2NYX A;  3WTX C;  4CHU A;  4I98 B;  2A68 F;  2QQ9 A;  1LNW A;  4KA4 A;  5DCF A;  1BC7 C;  3MEX A;  2K02 A;  1REP C;  3F8F A;  3Q5F A;  1KA8 A;  2EFO A;  3VB2 A;  1YYV A;  5JR3 A;  3T0Y A;  3DV8 A;  5LHI A;  5CYV A;  4S04 A;  5DV5 A;  3KET A;  3R60 A;  5J8F A;  4O6J A;  3WTW C;  3DPT A;  4KMF A;  3ABU A;  3R61 A;  4I2O A;  2O8X A;  1O3R A;  1HQC A;  3CUQ A;  2OA4 A;  1ONV A;  4UVC A;  3ERE D;  1U6G A;  3EYY A;  4KNY A;  3H3Z A;  4BAY A;  3TO7 A;  2XRN A;  5L3E A;  3MFK A;  2JPB A;  3KCC A;  2E1C A;  3I53 A;  3F23 A;  1FLI A;  1T0F A;  3GF2 A;  4U7D A;  1IN4 A;  5IT9 K;  5L3G A;  3QP5 A;  2MLG A;  1O7L A;  1EV7 A;  4KIF A;  1HKT A;  4EJW A;  3K69 A;  4WF2 A;  2UZK A;  4FX4 A;  1UHW A;  1FWZ A;  2ZCW A;  3HRT A;  4RB0 A;  3F72 A;  3WGG A;  1KQ8 A;  3LAJ A;  5EEH A;  2RNJ A;  4ON0 A;  1XSV A;  3GYH X;  1SFX A;  3ULQ B;  2E7X A;  4BHP A;  3FMR A;  2MC3 A;  4OMY A;  4OIP F;  3E6C C;  2NAZ A;  1USS A;  1I6X A;  1WI9 A;  1IN6 A;  2KRF A;  2MD5 A;  2V1U A;  5JI6 A;  1UHM A;  3IC7 A;  4HX7 A;  2ZXJ A;  1O57 A;  4HF0 A;  2W57 A;  3HYI A;  4IJA A;  3PFI A;  4CGZ A;  2EFW A;  4EM1 A;  4A0Y A;  3WU0 A;  1F1Z A;  3BP8 A;  1GXP A;  5F1R A;  3E5U A;  4LLL A;  2XRO A;  1YFH A;  2LNB A;  2EV6 A;  2AS5 F;  2GAU A;  3QU3 A;  2Z3Y A;  3KP3 A;  3AAF A;  1MDM A;  5DCM A;  4MGR A;  3SFZ A;  3F22 A;  3HHG A;  5HVQ C;  3O2P E;  2OAZ A;  2HTJ A;  1YW8 A;  3ZN1 A;  4U0Y A;  3WTS C;  5D4R A;  1SD4 A;  2MBF A;  4HX8 A;  5DD8 A;  1IAW A;  4L9N A;  4RGS A;  4A6D A;  3IHU A;  4I0A A;  4FHT A;  1BOA A;  1H0M A;  4KYW A;  1F5T A;  1ODD A;  2BE5 F;  4EVI A;  5LHG A;  3ABT A;  2VON A;  2YPR A;  5AON A;  2BBY A;  3DP7 A;  3M8E A;  2HQR A;  4P96 A;  3CO6 C;  4L5I A;  2QUF A;  3V4G A;  1TNT A;  1OPC A;  3GO5 A;  2Y48 A;  4EM2 A;  1JXS A;  3TKY A;  2JSC A;  2CWE A;  1O3T A;  1XSD A;  2V1D A;  6PAX A;  3VOD A;  2M5W A;  2YX7 A;  2IA2 A;  1BI3 A;  1UST A;  3BJO A;  3J81 K;  2FE3 A;  3TQN A;  4HF1 A;  1ON1 A;  2FNA A;  2ESH A;  4PGH A;  4A5N A;  4BNC A;  3HSF A;  3Q9S A;  3LA2 A;  3F8B A;  2ISY A;  4UNO A;  1MZB A;  5E20 A;  2FBK A;  1F4K A;  3JSO A;  4ZZD A;  1T2K A;  5BS6 A;  1SMT A;  4HQM A;  4TV7 A;  3KP7 A;  5DDG A;  5D5X B;  2DU9 A;  2Z33 A;  2BYV E;  1R7J A;  3F6O A;  2KIM A;  1S6L A;  3WTZ A;  2EK5 A;  1FP2 A;  2NS0 A;  3HRS A;  3WGI A;  4ENJ A;  3E97 A;  3RYR A;  1D3Y A;  3EDP A;  1OMI A;  4M9Z A;  3BJ6 A;  1J5Y A;  2F5F A;  3COA C;  1QO0 D;  2L54 A;  2WC2 A;  3BPX A;  2V6C A;  2YSR A;  5F64 A;  1IF1 A;  3GFI A;  2VOO A;  1OYY A;  2VN2 A;  2RV8 A;  4ZZL A;  4EMS A;  3WTU C;  1F9N A;  4BHB A;  4M74 A;  2NNY A;  5L3B A;  2IRF G;  3BOQ A;  1HXD A;  1H9T A;  2QWW A;  1GXQ A;  4KUM A;  5K5R A;  3WE2 A;  1EH8 A;  3FHZ A;  5LRR A;  1VTN C;  2X0L A;  3IWF A;  4A12 A;  1R58 A;  5K5O A;  1YO5 C;  5FO5 A;  3QAH A;  2WTE A;  2GIV A;  3DF8 A;  1HSJ A;  4KIG A;  3P7N A;  4IHS A;  3F6V A;  1G3W A;  3TO9 A;  4Y13 A;  1D5V A;  4CXF A;  1PDN C;  5D6E A;  2M87 A;  1HW5 A;  2FXA A;  4M6X A;  5ICC A;  1TW3 A;  3H3U A;  1D8K A;  1KGS A;  3P9K A;  4HDU A;  1HW2 A;  5IT3 A;  5A2Q K;  3I5U A;  2MH2 A;  1TW2 A;  1SFU A;  4UHT A;  2HYG D;  1KU7 A;  3EET A;  1LDJ A;  3PQJ A;  4A0X A;  1YG2 A;  1Z1D A;  1T39 A;  4KMU X;  2MH9 A;  3QPT A;  1XGM A;  4HX4 A;  1FT9 A;  2RGV A;  1XN7 A;  1BC8 C;  2CQK A;  4G7O F;  5FFX A;  5A2Q Z;  1DPR A;  2PBI A;  3HSE A;  1SD7 A;  3TOB A;  5CVI A;  3IKV A;  3IRR A;  2PG4 A;  2XAS A;  3ELK A;  3KP2 A;  2D1H A;  3VEP A;  3WTT C;  3C3W A;  2FMY A;  1ZAO A;  3KZZ A;  1HKQ A;  4KN4 X;  2XIG A;  2P5V A;  3HRU A;  1FOK A;  2XVC A;  4NB5 A;  2CYY A;  4U0W A;  4PDK A;  3V7S A;  4JBA A;  1BI1 A;  5H20 A;  2XAQ A;  1SD6 A;  2BV6 A;  3ML6 A;  2BEO A;  3FM5 A;  1IZ1 A;  1ZG5 A;  3F8M A;  4OIR F;  2UXX A;  2FBI A;  1B4A A;  4MTD A;  4N9H A;  2YU3 A;  2O03 A;  2DQL A;  5FB2 A;  3EQL F;  2QZ8 A;  3TOA A;  4N0B A;  3ZMD A;  3BPV A;  1QBJ A;  1WSU A;  4RB1 A;  1DUX C;  2R7D A;  3ZMS A;  2CG4 A;  4EGY A;  1G6N A;  3NQO A;  3DPL C;  2HTS A;  4D0P A;  4ETS A;  3FX3 A;  4L18 B;  4WXD A;  5BOX A;  3KLN A;  2PMH A;  2VBX A;  3K9T A;  5JVT A;  2IT0 A;  1ZAR A;  2KIF A;  3CDH A;  3P9C A;  1XGO A;  4MEX F;  3SQN A;  1IXR C;  4A5M A;  2EWN A;  2IPQ X;  3MQ0 A;  2L02 A;  3I64 A;  2HKO A;  1S7A A;  2VT2 A;  2BGC A;  1FNN A;  3N4M A;  2FBH A;  4KIC A;  2K86 A;  1FBQ A;  1GHC A;  3K2Z A;  1RUN A;  4LGW A;  4LJZ F;  2HZT A;  2PI0 A;  3RJP A;  3H92 A;  3F8N A;  1G3T A;  4L9V A;  4L0Z B;  1MKM A;  2QVO A;  1XCV A;  5DEQ A;  2XGX A;  4ENN A;  1FYM A;  2Q8K A;  5E1W A;  4IRH A;  5L3D A;  5AIQ A;  4LB5 A;  2X4H A;  3FMS A;  3SZT A;  4HV6 A;  4WX9 A;  1AWC A;  2ZNY A;  1U5T B;  4BXU A;  2JTV A;  4EQQ A;  3HUG A;  3LAP A;  5HDG A;  3E5X A;  1ZLK A;  4MTE A;  4LLN A;  2P8T A;  3GEZ A;  5ICG A;  3KP4 A;  4HBL A;  2HOE A;  3K1N A;  5TRD A;  3M8F A;  1QNT A;  3KLO A;  4M6Y A;  1U2W A;  5LGU A;  4GYI A;  5D8K B;  4L9T A;  3ZMT A;  3M1E A;  3V8K A;  5HLH A;  1RI7 A;  1ZRE A;  2HEO A;  2JZY A;  3T1B A;  1P6R A;  2P4W A;  3SZP A;  1BI2 A;  1TQM A;  5BPD A;  2XUB A;  2GA2 A;  2L3D A;  5ILS A;  3T5X A;  2H94 A;  1RNL A;  5LBQ A;  3P9I A;  5HS8 A;  1Y0U A;  4YFK F;  3Q9V A;  1W5T A;  1CF7 B;  2OZ6 A;  2QM3 A;  3GW2 A;  4DNC A;  2GXG A;  2HWV A;  4ENK A;  3F8C A;  1V4R A;  1FBU A;  1DDN A;  5ICF A;  2GXB A;  2HS5 A;  2ZO4 A;  3L9F A;  4M72 A;  4I01 A;  3VOE A;  1QZZ A;  5HLI A;  2Z5U A;  2EV0 A;  5KK1 A;  1U3E M;  1FY7 A;  3PQK A;  1ZRC A;  1J2X A;  1P4W A;  3E3V A;  4RGR A;  3GLX A;  4L9J A;  2VOD A;  3K1M A;  4KN7 X;  1IN8 A;  1XCB A;  2P5L C;  3HRM A;  1R5G A;  4U7B A;  1K78 B;  2VC1 A;  2TDX A;  1QQI A;  4HOB A;  2GWR A;  3R0A A;  5E17 F;  4P9F A;  2B0L A;  2G7H A;  2CGP A;  3KZY A;  2MA3 A;  5E18 F;  2DQR A;  3GZ6 A;  2XAH A;  2HKX A;  3GX4 X;  1Z05 A;  3J80 K;  1FSE A;  2Z99 A;  2PN6 A;  3EYI A;  1WWX A;  1I5Z A;  1XGN A;  1FC3 A;  5E1X A;  1TLH B;  2UXN A;  3F21 A;  1JHH A;  4WWC A;  3FXU A;  4HF2 A;  3TDZ C;  3BWG A;  1R22 A;  2J5O A;  2YX4 A;  3ZMZ A;  4OIQ F;  1BIB A;  4YFN F;  3I59 B;  2OQG A;  3NEU A;  1ZG3 A;  1XDU A;  1Z91 A;  3J80 Z;  2HFH A;  3I54 A;  2ESN A;  3E6B A;  2V79 A;  2STW A;  2FA5 A;  4U88 A;  1G3Y A;  4O5V A;  3JAM K;  3TDU C;  2DK5 A;  4IXA A;  3CUO A;  3ZN0 A;  1WKM A;  3RPU A;  1QGP A;  2IW5 A;  2PQ8 A;  1A04 A;  4RAY A;  2FRH A;  1P4A A;  3L7W A;  4FX0 A;  4BHC A;  2EB7 A;  2KKO A;  1FPQ A;  2W24 A;  3O6B B;  3JSP A;  1BN5 A;  3JAM Z;  1B59 A;  1LB2 A;  4CIC A;  1J59 A;  1K79 A;  1W7P D;  3LST A;  3C1D A;  3V8J A;  3WOD F;  3ZMU A;  4GXO A;  5ICE A;  4WK8 F;  1SD5 A;  2VOP A;  2HYF A;  3HOT A;  1JGS A;  5J6X A;  3GFM A;  4ZH4 F;  3WGH A;  3O3K A;  3FXQ A;  4Q4Z F;  3JTG A;  3LQR A;  5J8C A;  3KEQ A;  5LEJ A;  4RGU A;  4OIO F;  1MGT A;  2ZNZ A;  4LK0 F;  2CW0 F;  4HAM A;  1Z6T A;  3CUQ B;  2HDC A;  3HHH A;  3RDI A;  1O3Q A;  3TGN A;  2YR2 A;  2K4B A;  2OD5 A;  1B6A A;  1YQA A;  4AD9 A;  4O3M A;  4FT8 A;  2F5E A;  3EUH A;  3MZY A;  5CJ9 A;  4EJT A;  3OV8 A;  5HDN A;  1STZ A;  3RTR A;  5ILU A;  1IN5 A;  3IL2 A;  3BRO A;  3U2R A;  1K6O A;  1IN7 A;  1PP7 U;  4Q48 A;  1YS6 A;  3ROU A;  3I4P A;  1ZRD A;  4YFX F;  1ZHF A;  2DW4 A;  4LG0 A;  3FM3 A;  5CVU A;  3KE2 A;  2K27 A;  1OYW A;  4P9U A;  2OU2 A;  3NRV A;  2D45 A;  1QZY A;  2R3S A;  3DQV C;  2QQB A;  4M71 A;  3R4K A;  4IPA A;  4BYY A;  1MJ9 A;  4LLG F;  5L3C A;  4YII A;  2L01 A;  3KP6 A;  3HTU A;  5LGN A;  1R1V A;  1W4M A;  3U1D A;  1S29 A;  5LLQ A;  1LJ9 A;  1FBS A;  1J75 A;  4R1H A;  2FML A;  4HDV A;  2DI3 A;  4G7Z F;  3KEO A;  3GVA A;  1WQ2 A;  1G4D A;  2EV5 A;  1FZP B;  1YTY A;  5JFR A;  4ESF A;  1KQ9 A;  2RQP A;  1I1G A;  2Q0O A;  2VC0 A;  5ILV A;  3RKX A;  1XD7 A;  1R1T A;  5CVJ A;  2PMU A;  1P92 A;  2J5P A;  1XMK A;  4AIK A;  2P7V B;  5D6F A;  4RB3 C; 
#chains in the Genus database with same CATH topology
 3C2H A;  2VUM J;  3LQQ A;  3DBH B;  3WG7 H;  5D4S A;  1R36 A;  3REO A;  2XB0 X;  3FWE A;  1FJL A;  2LP0 A;  4KIB A;  3DEU A;  4Y52 J;  2FUG 2;  4IF4 A;  1VQM I;  5BQT A;  2K9S A;  1IXC A;  3CC7 I;  3OWT A;  2Y75 A;  4GRI A;  3S1Q J;  1Z7U A;  3CCL I;  4L0Y B;  4Q47 A;  4M6V A;  4ABZ A;  4G7H F;  2IA0 A;  2MLK A;  2X6X A;  4DQ2 A;  1O3S A;  1A31 A;  2L7Z A;  3S1M J;  4KT6 A;  3LFK A;  2HR3 A;  3A4C A;  5FFZ A;  5KVR A;  3R6S A;  1LVA A;  1T38 A;  1MDM B;  5DCM B;  4XKC A;  3E5Q A;  1Q1H A;  2FOK A;  4CCN A;  1XGS A;  2G9W A;  4Y15 A;  1EH6 A;  3D5L A;  3ONQ A;  5HDK A;  3RCO A;  2P5K A;  4EGZ A;  4A3G J;  5DM7 F;  5F0F A;  3CZ6 A;  4CYC A;  1EJ9 A;  3C2G A;  4II3 A;  3H9G A;  4G6Q A;  2WAE A;  4JQF A;  2V9V A;  3GUD A;  2ECB A;  4M3F A;  3WE3 A;  3ZQH A;  3DBL B;  4EV0 A;  3GZ5 A;  2RN7 A;  3GFJ A;  1I1S A;  4CO8 A;  2QEN A;  4QLC U;  4PJL A;  1AU7 A;  1P4X A;  4NHJ A;  2JWT A;  2M1B A;  4A3K J;  1FP1 D;  3CCY A;  5DYM A;  2R7F A;  4CSW A;  4E7H A;  2XC7 A;  5K7Z A;  1U5T C;  1E17 A;  2PJR B;  2CSO A;  2ID6 A;  5HLG A;  1L0O C;  1HST A;  4A69 C;  5JVG F;  1MH4 A;  3K70 D;  1YLF A;  3N97 A;  1R4N B;  3GTK J;  2XGC A;  1JT6 A;  3PO2 J;  2HQN A;  5AIP A;  1BR2 A;  2P81 A;  4HNT A;  3HOV J;  2XF5 A;  4F92 B;  5LHH A;  2LG4 A;  4Z2Y A;  4X1E A;  4A0Z A;  1KQ0 A;  1SAX A;  2HDD A;  2P7C B;  1ETX A;  4LG3 A;  1RZ4 A;  2LYC A;  3ECH A;  1FYK A;  3HKZ N;  1BI0 A;  3B73 A;  3IWZ A;  2ACJ A;  2XAG A;  3CCS I;  1KYW A;  3J7A O;  1P7J A;  1B8I A;  3OR1 C;  4XRF A;  5F0C A;  2JUC A;  3NAR A;  5C4J J;  3MN2 A;  2BOL A;  1WJF A;  2O3F A;  5J1Y A;  2LY1 A;  1YS7 A;  4V2F A;  1HLV A;  1VQK I;  2K5C A;  1K7A A;  2HVS A;  2KDZ A;  3K10 A;  3QOP A;  2DJN A;  1ZK8 A;  2IGK A;  4MQV A;  5J1U A;  2ZME A;  2QLZ A;  1IW7 F;  4XLN F;  2ISZ A;  5J40 A;  1U8B A;  3CD6 I;  3MAJ A;  3S2W A;  3RQ4 A;  3VPR A;  4HYE A;  3ZPL A;  2DBB A;  4DJA A;  4LFU A;  3F3X A;  4Q5S F;  3V7R A;  2K3F A;  1IUF A;  2DA2 A;  3HOX J;  2ELH A;  2LF7 A;  1YIT I;  2XKO A;  4YIF A;  3K1P A;  5D5V B;  3L2W A;  4I6Z A;  2KJC A;  2F4I A;  2QA4 I;  3I9V 2;  1YI2 I;  2LK2 A;  2QQ8 A;  5K1Y A;  1ON2 A;  3LSH A;  4IRI A;  2VE8 A;  3MMY B;  2VBZ A;  5FLX K;  4FE4 A;  1MNE A;  1ZTR A;  1MBJ A;  1E0E A;  2E35 A;  1OR7 C;  4QWQ A;  1WI3 A;  3BG9 A;  1PUE E;  1AKH B;  1WJD A;  3R0J A;  2QEX I;  3U21 A;  3B6C A;  4C3I J;  2OZU A;  2JPC A;  4UVA A;  5FGM A;  3J7A Y;  1ZLJ A;  1W1W E;  5GPA A;  1NTC A;  1B9M A;  3RIR A;  4BEH A;  4AID A;  2DA5 A;  4S05 A;  2XSJ C;  3TW7 A;  4B1R A;  2MW8 A;  1IRX A;  4PJM A;  2VXD A;  4CYD A;  1WJE A;  1ORK A;  1UEL B;  2W84 A;  3JRE A;  1LFU P;  2A07 F;  1MD0 A;  2L4M A;  2O0Y A;  1AHD P;  2R5Y A;  2JA2 A;  3E7L A;  1XMA A;  2DFF A;  3QU6 A;  4P55 A;  4A2U A;  4BY1 J;  1J9I A;  2UV1 A;  5GAH J;  3GTL J;  4BXX J;  2FQ3 A;  2M8E A;  2Z9O A;  1MJB A;  3BR2 A;  3FZV A;  3LA3 A;  3OSF A;  3GZN B;  5JLX A;  2DK8 A;  5FLX Z;  1L3L A;  2OUM A;  1SMY F;  2BHZ A;  5EDN A;  4NQW A;  2LKX A;  1YRN B;  2CQQ A;  1JT0 A;  1TC3 C;  1BW5 A;  2RNG A;  5H6Q A;  1W5S A;  1RRJ A;  4R79 A;  4BH9 A;  1KU9 A;  3E6D A;  4RS8 A;  1JJ8 C;  1KU2 A;  2D1V A;  4PJJ A;  4BUP A;  2CO5 A;  2MD0 A;  2IJL A;  3KZI C;  1R4M B;  5E8G A;  3L2C A;  2R92 J;  1X3U A;  2X85 A;  2LC2 A;  4LIT A;  2E7W A;  2Q2E A;  4KIS A;  1T08 B;  1K83 J;  3BG6 A;  1OKR A;  2K9N A;  4I02 A;  5CVR A;  3PNT A;  2CU7 A;  1YIO A;  2ZFW A;  3B02 A;  4RA2 A;  4M3E A;  2FSW A;  2L4A A;  4ZYA A;  2NXN B;  2A5W A;  3HTS B;  4CA0 A;  4BE0 A;  4KT5 C;  3CO7 C;  2IGO A;  2V7F A;  3V8L A;  3TP3 A;  4OOI A;  3MZH A;  1SFO J;  3BZC A;  1DGR M;  3D1N I;  4PGG A;  3WU1 B;  2EH3 A;  4HA8 A;  3BZ6 A;  3E6M A;  2CW8 A;  5L3F A;  1S3J A;  4X0G A;  3OYK A;  4B3A A;  3TO6 A;  1J0R A;  5IT9 Z;  1R23 A;  4ENM A;  2MYS A;  5CVV A;  4F93 B;  2O6G E;  5EEG A;  1U8R A;  4HLX A;  2JSP A;  4UV8 A;  4FIS A;  4XN0 A;  4GO1 A;  4LG0 B;  2WWY A;  2R7Q A;  3JW4 A;  4IRG A;  5D5U B;  2RQQ A;  2N8G A;  2XHK A;  1FYL A;  3DXJ F;  3QPH A;  2GZW A;  5E1Z B;  2QBY A;  4ZYH A;  4WXH A;  1Y56 A;  1TBX A;  4I09 A;  1BBY A;  4MEY F;  2XGD A;  4LD5 A;  2HXO A;  2IGN A;  2M0C A;  3T8T A;  2M30 A;  1AOY A;  4M9S A;  3HSR A;  3FMQ A;  4NBQ A;  3ZXS A;  1Z9C A;  4G94 A;  4UVB A;  2DA7 A;  2DA4 A;  2DMT A;  3U9G A;  2A5Y B;  4EJU A;  2ZFU A;  1ZH5 A;  3A0H C;  1LDK B;  1ULY A;  1JTY A;  3QOD A;  4UUV A;  5E3O A;  1WPK A;  4HV5 A;  3FF5 A;  4R8H A;  2JRT A;  4B09 A;  1Z6R A;  2M8G X;  5FD5 A;  4KDP A;  3I71 A;  5IY5 H;  2M45 A;  2DO7 A;  2ZBK A;  2KIU A;  3FKJ A;  4IVN A;  3W2W A;  2HPI A;  5EGO A;  3OIP A;  2XPU A;  2PFB A;  3K4M A;  2C6Y A;  3H5A A;  4XLA A;  5F6F A;  4E70 A;  2E1M B;  4PZJ A;  4NUB A;  1R1U A;  1TQP A;  2JT1 A;  2LDU A;  1XB4 A;  4D9J A;  1GVJ A;  2RVC A;  3WTY C;  5HS9 A;  4RAZ A;  1ETO A;  4B43 A;  4C9Y A;  3LA7 A;  4EM0 B;  4I7H A;  1UFM A;  1TT5 B;  1FX7 A;  2IP2 A;  4BQN A;  3IKT A;  1ZG1 A;  2O61 A;  1NG6 A;  2M2E A;  3QRF F;  2FF4 A;  2W85 A;  4G9Y A;  4IHW A;  3HOW J;  4II2 A;  4AIJ A;  3I58 A;  4JX5 A;  3L2U A;  2IS6 A;  3PSF A;  5ED4 A;  5EZH A;  2EA4 A;  2GOX B;  1HW1 A;  4UB6 C;  4RM3 A;  3BC8 A;  5K5Q A;  3VYT B;  2XPV A;  3C18 A;  3ISP A;  4XSZ F;  5F27 A;  4QPQ A;  1M1E B;  2DT5 A;  1LEB A;  5FKK A;  2GA1 A;  1H9G A;  3GXO A;  4ESB A;  3I0T A;  2EJR A;  4G12 A;  5F08 A;  2ETH A;  3DCF A;  1R00 A;  4JYK A;  4YIR X;  4E7I A;  4RM2 A;  4KFC A;  1RC9 A;  4PK4 A;  5TJJ A;  3DLA A;  3G73 A;  3RYP A;  2EFN A;  1TQI A;  1B72 A;  1JHF A;  1GUU A;  3WTV C;  3OYA A;  3PIP F;  2RAE A;  2F5D A;  2R7T A;  2NNN A;  2DFE A;  1LEA A;  1Z3Y A;  2UWM A;  1W7P A;  1X1A A;  3CQZ J;  1I39 A;  3SEQ A;  3TL4 X;  2CFX A;  1IRF A;  1UCR A;  3QYF A;  3HOS A;  1U78 A;  1U0J A;  2BY1 A;  3OL3 A;  1XDS A;  3OSG A;  3CUQ C;  3WG9 A;  3W2V A;  4F7Z A;  1MBF A;  2RC4 A;  3CLO A;  4P1W A;  3HEF A;  4D5F A;  5LEK A;  4V2G A;  1NH3 A;  2ECC A;  4FAS D;  4M3G A;  3W6V A;  2L5Q A;  1S7O A;  2KJB A;  4M73 A;  1IDZ A;  1QVT A;  1G2H A;  1S8N A;  2DFI A;  4WXC A;  2XB5 A;  3LSI A;  3KYD B;  4BGD A;  5EZG A;  5JHF A;  1YJ9 I;  4HG2 A;  4PCQ A;  3L2V A;  3CJN A;  1IC8 A;  2H09 A;  1T33 A;  1VQ4 I;  3MCZ A;  1T98 A;  1KYZ A;  4GGG A;  2L9N A;  5E3M A;  3K0L A;  3GWZ A;  3KP5 A;  1HOM A;  1S5L C;  1FIP A;  1IRG A;  1ERD A;  2DT7 B;  3HZJ A;  4Z6Y A;  4RLQ A;  4GYG A;  2EFP A;  3TMO A;  3RKY A;  2LKP A;  2LTP A;  2IVM A;  4EAT A;  1YJN I;  3M9A A;  4UXN A;  4HLY A;  3S3O A;  2QYO A;  5IYB J;  3OOP A;  4MFD A;  2I10 A;  1MMA A;  1RKW A;  4G6D A;  3RI4 A;  1ZGJ A;  4MNU A;  4RAF A;  5DUK A;  3ZQ7 A;  4XMY A;  5H6R A;  2QSG X;  1O7F A;  2DDA A;  1RPW A;  1EH7 A;  2H1K A;  2FNP A;  2FQ4 A;  4LB6 B;  3J81 Z;  3JRF A;  1VQ9 I;  4BJ6 C;  4EJV A;  3PFY A;  2GQQ A;  4OU0 A;  1BW6 A;  3SXY A;  4BE2 A;  1RUO A;  2ZME B;  2O8K A;  3QYE A;  4XLP F;  3OYN A;  1WH5 A;  4EJO A;  2KFD A;  2QGU A;  2WV1 A;  4GCV A;  2WAQ A;  2JA7 J;  1W0U A;  1U5T A;  2DOA A;  2F5C A;  1WJ5 A;  2W25 A;  1X1D A;  3OYD A;  2XDV A;  1LFB A;  3NWT A;  4DZP A;  5KNL A;  2WB1 A;  4HW0 A;  2WAQ N;  5BPI A;  2VQH A;  3ZQL A;  1FSH A;  3FHN A;  2W48 A;  3VFZ A;  3S8P A;  2HDW A;  3FXM A;  3V7C A;  4ZYG A;  2VE9 A;  4HQE A;  3KYL A;  2EA2 A;  4G8X A;  4H0E A;  3ZMV A;  4ASN A;  2A6H F;  2ZXW H;  5HS7 A;  4K2E A;  3SHF A;  4Y17 A;  4F91 B;  2ZSH B;  1BJA A;  4CUG A;  3EPZ A;  1MSE C;  3HC7 A;  2A6E F;  4OMZ A;  1P2F A;  2K9L A;  3N05 A;  3ZQQ A;  1UG2 A;  2F2E A;  4D5C A;  5BMZ A;  2DPD A;  2G7U A;  2JMW A;  3HUG B;  2PLY A;  4UV9 A;  2AXL A;  3M7G A;  1XX5 A;  2XAU A;  1NHA A;  2A3S A;  3W6J B;  2E1N A;  1CGP A;  2A61 A;  1JKR C;  2YU9 J;  1MSF C;  4CDG A;  4YG2 F;  1X3Z B;  2D5V A;  1LDD A;  4DIQ A;  1UB9 A;  5D5W B;  2XV4 S;  5JHU A;  2A69 F;  4LMY A;  2NVT J;  2X9D A;  3DTK A;  4XSX F;  4A3E J;  1ZEL A;  4XK4 A;  1S72 I;  1A6I A;  2WV0 A;  5IOZ A;  4WCG A;  4D1Q A;  4NQW B;  2X1C A;  4B48 A;  3M07 A;  1DP7 P;  3HDD A;  4UY8 I;  4CZZ A;  2P6S A;  1EF4 A;  4N9I A;  1KU3 A;  2QQA A;  4QIW N;  1LQ1 A;  2EIJ H;  2VBW A;  2RKH A;  4B4C A;  2ICW G;  4MHG A;  1J7K A;  4XIC A;  3JRD A;  4IO9 F;  3HOU J;  4PFP A;  4ZTJ A;  2VL8 A;  4I0B A;  3D0S A;  2GM4 A;  2H27 A;  2K9M A;  1Y39 A;  1ZRF A;  2X48 A;  3FXK A;  3Q3S A;  1DPU A;  2D2W A;  3BCA A;  1OR7 A;  3JTH A;  4L5J A;  1Z7L A;  2ZKZ A;  1A36 A;  2PJP A;  4M9X A;  3BJA A;  4BQA A;  2GLO A;  2FU4 A;  5DUI A;  3KFW X;  1TTY A;  2Y0M A;  5D8L B;  5HOO A;  1CF7 A;  2BVL A;  1H89 C;  1DGW Y;  4AVZ A;  5FD6 A;  2F48 A;  1D8J A;  3J7Z I;  1PUF B;  3RPQ A;  1RIO H;  3LWF A;  2LF8 A;  3M4O J;  2XAF A;  2LSO A;  3FXR A;  2NOG A;  1MW7 A;  5LRS A;  5IOY A;  2HVQ A;  1G3S A;  3L00 A;  3KYC B;  1PP8 F;  1C0W A;  2STT A;  3H1C A;  2OV7 A;  3ZP5 A;  4AM3 A;  4AVP A;  5CLS A;  1I27 A;  1JI8 A;  2K4J A;  1T6S A;  4XLH A;  5ERI A;  2VJ5 A;  4ESJ A;  4IHT A;  1WRJ A;  2X1E A;  3GFL A;  5EG0 B;  2VXZ A;  1ZYR F;  4CH7 A;  2QBY B;  3K6G A;  1NG7 A;  2V1X A;  3K4L A;  3IAM 2;  1AA7 A;  2Z2S B;  4E7J A;  4XBF A;  3AG2 H;  4U0V A;  4ZTF A;  1IUY A;  2QKM B;  1E3H A;  4XID A;  4OIN F;  4XL9 A;  1HBX G;  3ECO A;  2PEX A;  4IQ4 A;  2P6T A;  2VT3 A;  2DTR A;  5DD4 A;  1ETV A;  2HGC A;  1APL C;  1XSX A;  2QSH X;  3QP6 A;  1ZN2 A;  2VKH A;  1K78 A;  4MQ9 F;  1IGN A;  1SFE A;  3G3Z A;  3S1N J;  1LE8 B;  2XKP A;  2H6B A;  3DU6 A;  1FOW A;  3ZOB A;  1R5H A;  1VQN I;  2FEZ A;  2DAO A;  1P9Q C;  2IA1 A;  3DFG A;  3RKW A;  4RB2 C;  3SDB A;  4A3L J;  1UJ8 A;  1SFK A;  4RGX A;  2Y31 A;  1JE8 A;  2COM A;  2DLL A;  2M3A A;  5KCM A;  2CW7 A;  2EIN H;  2RDP A;  2KDO A;  2NOJ B;  3L09 A;  5TIS C;  2X6Y A;  2GIZ A;  3IAS 2;  4F55 A;  3DKW A;  2OQR A;  3C7J A;  3AFH A;  1Q1V A;  4U87 A;  2KHM A;  3W6K B;  4J01 A;  1YW9 A;  2HQA A;  4AWX B;  2EFQ A;  2DJI A;  2K7L A;  2IS2 A;  2DOE A;  2LRE A;  1WH7 A;  3CMY A;  1ZGA A;  4P5O A;  3LSP A;  5LGT A;  4JK1 X;  3BDD A;  2VQL A;  2ZJ2 A;  4ZYD A;  3IH4 A;  4ZYE A;  4AIH A;  3OS0 A;  2ID3 A;  3CCV I;  2NRA C;  4NC8 A;  3I59 A;  2F6C A;  1UZC A;  3JRI A;  2W7N A;  2HU9 A;  3MWM A;  2ZJR F;  1FMW A;  4A6E A;  3HIF A;  3BY6 A;  3HBL A;  3E0J B;  1X1B A;  2CV2 A;  2E1O A;  2R7V A;  1CQT A;  5H2F C;  1MJA A;  5JLW A;  2KZG A;  3ZR8 X;  3CF5 F;  1BIA A;  3ZQC A;  2DPU A;  3CTA A;  2E2H J;  2CRG A;  2XAJ A;  2VBY A;  1B9N A;  2LY2 A;  4AYB A;  1V3F A;  4XQF A;  1OYI A;  3LFU A;  5E8I A;  1B72 B;  2OBP A;  4E4H A;  2H6C A;  1B1B A;  3K4K A;  4AYB N;  1E2X A;  3VWB A;  2ADU A;  1JTX A;  2GOM A;  3IRQ A;  3I3L A;  2JA8 J;  1YW7 A;  3HL2 A;  3S3M A;  3IV5 A;  3T8R A;  1BM9 A;  2LFB A;  4KIT B;  1W7P B;  1HKS A;  3BZK A;  4LK1 F;  4N4N B;  1PVE A;  2HOT A;  3CDI A;  2COB A;  4HZF A;  4YEL A;  4BQQ A;  3BR3 A;  1QPM A;  4F52 A;  1OCZ H;  1IXS B;  1G59 A;  4B8X A;  2NS8 A;  1TNS A;  2NYX A;  2VPL A;  3WTX C;  4CHU A;  2M34 A;  4I98 B;  2R7R A;  2LVS A;  2A68 F;  2QQ9 A;  1LNW A;  1Y1V J;  1OFC X;  3A03 A;  4KA4 A;  1FEX A;  1R6R A;  1OJL A;  2EZK A;  2F5V A;  3FBN B;  5DCF A;  2V9K A;  2R7X A;  2E60 A;  2VLA A;  1BC7 C;  3I55 I;  3MEX A;  2K02 A;  5IYC J;  4BJ5 C;  3F8F A;  1REP C;  2O5R A;  3Q5F A;  4PUS A;  1KA8 A;  1RR7 A;  5DTD A;  2EFO A;  2FX0 A;  3VB2 A;  1YYV A;  5JR3 A;  2BXY A;  3T0Y A;  4CZC A;  2Y9Z A;  4IX7 A;  1K4T A;  3HGY A;  3JCU C;  3DV8 A;  5DS9 A;  2CUJ A;  5LHI A;  3J7Y J;  5CYV A;  4S04 A;  5DV5 A;  1KON A;  3KET A;  3R60 A;  3UR3 C;  5J8F A;  3CJT B;  4O6J A;  3WTW C;  4DYQ A;  1VQ5 I;  3DPT A;  4KMF A;  3ABU A;  3R61 A;  4I2O A;  2O8X A;  1O3R A;  1D0Z A;  1HQC A;  2NVY J;  1POG A;  2KP6 A;  5GP9 A;  4BL0 B;  3CUQ A;  1X1C A;  3VYS B;  2OA4 A;  3HPG A;  3FDY A;  1ONV A;  4UVC A;  5E3N A;  3FKI J;  3ERE D;  2XF7 A;  1U6G A;  3JR9 A;  3EYY A;  3HJE A;  1X19 A;  2K9Q A;  4DW6 A;  4KNY A;  1I3A A;  3H3Z A;  3CME I;  4BAY A;  3M3Y J;  3TO7 A;  4IQJ A;  1X4P A;  2DA6 A;  2XRN A;  2HPM A;  5L3E A;  2ZB9 A;  3MFK A;  2JPB A;  3ZCO A;  3KCC A;  2E1C A;  3I53 A;  2R7U A;  3F23 A;  1FLI A;  5FRN A;  1T0F A;  1X1P A;  2M7B A;  4IHV A;  3GF2 A;  4U7D A;  1IN4 A;  2CQX A;  5IT9 K;  5L3G A;  3QP5 A;  3DPU A;  1LVK A;  4NC6 A;  5FRM A;  1F36 A;  2MLG A;  2CFO A;  2LKS A;  2NVU B;  1SVM A;  3DWL E;  1O7L A;  3S32 A;  1EV7 A;  4KIF A;  1ENH A;  3ZQI A;  1HKT A;  3H5N A;  4EJW A;  3K69 A;  4WF2 A;  1QRY A;  2DFH A;  1J09 A;  4OAZ A;  4PSX A;  2UZK A;  4FX4 A;  2OTJ I;  3AL0 B;  4A3J J;  1UHW A;  3ZGK A;  3S17 J;  1FWZ A;  4XLE A;  2ZCW A;  1JKQ C;  1BOB A;  3HRT A;  2AHQ A;  3LL7 A;  4S0H B;  3BQZ A;  1N77 A;  4RB0 A;  4BS9 A;  4HPQ A;  1QHG A;  2KQR A;  4DOZ A;  3F72 A;  2VI6 A;  3WGG A;  4IHX A;  1KQ8 A;  3EUA A;  3LAJ A;  2KLO A;  1LUJ B;  3DKY A;  1ETQ A;  4B3X A;  5EEH A;  1JUM A;  2RNJ A;  4ON0 A;  1XSV A;  2BY3 A;  2DN0 A;  4XRS A;  1YJW I;  3GYH X;  1SFX A;  3ULQ B;  2E7X A;  3ERM A;  4BHP A;  3FMR A;  2B7E A;  2MC3 A;  4XLF A;  1TP4 A;  2VKE A;  2HYJ A;  4OMY A;  1VQL I;  4OIP F;  3E6C C;  3CLQ A;  1OIS A;  2NAZ A;  3GTQ J;  3GTM J;  1USS A;  1I6X A;  1WI9 A;  2LBF A;  1TL8 A;  3PNY A;  1IN6 A;  5GAD J;  1TWA J;  2KRF A;  4RDU A;  1QPI A;  2MD5 A;  3O8G A;  4HRI A;  2V1U A;  2CV0 A;  4MIM A;  1UAA A;  1V5F A;  1MBG A;  5JI6 A;  1HDD C;  1LFP A;  1UHM A;  1YOV B;  2PMZ A;  3IC7 A;  4HX7 A;  2ZXJ A;  1RKT A;  2JK3 A;  1O57 A;  4BQO A;  4HEA 2;  2QF7 A;  3G2B A;  3PNV A;  3GBG A;  2PMZ N;  4HF0 A;  2R5Z B;  1WVR A;  2W57 A;  3FXJ A;  3HYI A;  1Z67 A;  1ZKG A;  4IJA A;  1X2N A;  3PFI A;  5BNG A;  2VB6 A;  4CGZ A;  2EFW A;  3H35 A;  1X2M A;  2DYR H;  4EM1 A;  3FXL A;  3A01 A;  4A0Y A;  3CCQ I;  3WU0 A;  1XC5 A;  1Z21 A;  2EZL A;  2M4K A;  1F1Z A;  3BP8 A;  3ESW B;  5FKO A;  2H8R A;  2E5Z A;  5K7H A;  3I4M J;  1GXP A;  2F4O B;  4RLF A;  1W0T A;  5F1R A;  3E5U A;  2K3P A;  4LLL A;  2XRO A;  2BY2 A;  1UMQ A;  1YFH A;  2LMD A;  1VQP I;  2LNB A;  2EV6 A;  3KPH A;  1WCM J;  2AS5 F;  2GAU A;  4CCO A;  3QU3 A;  2Z3Y A;  3BLY A;  3BTI A;  1X4O A;  3KP3 A;  1WJC A;  3AAF A;  3RZO J;  1MDM A;  2IXS A;  5DCM A;  3AG1 H;  4FQG A;  1MH3 A;  1MMD A;  3E1S A;  4MGR A;  3SFZ A;  1IRZ A;  3F22 A;  3HHG A;  5HVQ C;  1WJA A;  2R0Q C;  3O2P E;  2OAZ A;  2HTJ A;  3IP4 B;  2ELK A;  1OCC H;  1YW8 A;  1S7E A;  3ZN1 A;  4U0Y A;  3WTS C;  2DXI A;  4JX4 A;  5D4R A;  3G6E I;  1SD4 A;  2X1D A;  2MBF A;  3LMM A;  4HX8 A;  1KZH A;  5DD8 A;  5KHD A;  1IAW A;  4L9N A;  1GLN A;  1XPX A;  4N4O B;  2CV1 A;  2JN6 A;  4RGS A;  2TCT A;  3K4C A;  2V26 A;  4A6D A;  3IHU A;  1VF9 A;  4I0A A;  2PX9 A;  3DTI A;  4FHT A;  5B3S H;  3H3V K;  1BOA A;  4UUS A;  2E5N A;  2KRC A;  1OQY A;  1H0M A;  4KYW A;  1F5T A;  1ODD A;  2BE5 F;  4EVI A;  5LHG A;  4NC7 A;  2H1L A;  3ABT A;  5IP9 J;  2JVH A;  2VON A;  2YPR A;  5AON A;  4BXF A;  4BBR J;  1TWC J;  2BBY A;  5FLM J;  3DP7 A;  3M8E A;  3BTL A;  2HQR A;  3PSI A;  4P96 A;  3CO6 C;  4L5I A;  4F3Q A;  2QUF A;  4RAG A;  2PJR A;  2VQG A;  4J19 A;  3MKL A;  4CYC B;  3V4G A;  4AC0 A;  1TNT A;  1D0Y A;  1OPC A;  3GO5 A;  2Y48 A;  4EM2 A;  1JXS A;  3TKY A;  2JSC A;  2CWE A;  1D1C A;  3P5J A;  5C4X J;  5B1A H;  3SDG A;  2M4G A;  3TP0 A;  1UHS A;  1O3T A;  1Y8Q B;  2ME0 A;  2QSF X;  3JRG A;  3D5S C;  4DBR A;  5FJ8 J;  3OOU A;  1VND A;  1XSD A;  1BR4 A;  4XKV A;  3AKZ A;  4MLO A;  1OCO H;  2V1D A;  1U9O A;  1WHU A;  3CDL A;  4AU7 A;  3VOD A;  2M5W A;  2YX7 A;  4AUX A;  2IA2 A;  6PAX A;  1BI3 A;  3JRB A;  3A2K A;  1IJW C;  1UST A;  2EIL H;  3BJO A;  3J81 K;  2WY8 Q;  3O8H A;  2FE3 A;  2Z16 A;  2ZSI B;  1BR1 A;  1HCR A;  1MMG A;  4XOR A;  3TQN A;  2ZJQ F;  3ASN H;  4HF1 A;  1ON1 A;  2HOA A;  2FNA A;  2ESH A;  4PGH A;  2EPF A;  4A5N A;  4BNC A;  3MZ8 A;  3M1C A;  1O4X A;  1HC8 A;  2A6T A;  3MKW B;  1MBE A;  1E3P A;  3HSF A;  3Q9S A;  3LA2 A;  4BU2 A;  1XTA A;  2OF7 A;  5IPA A;  3F8B A;  4BDY A;  2ISY A;  4UNO A;  2KZV A;  1MZB A;  3K4J A;  2FD5 A;  2XSD C;  5E20 A;  1GDT A;  2FBK A;  3BR0 A;  5LFA A;  5GPC A;  2K40 A;  2LY9 A;  1B8I B;  1OCT C;  1F4K A;  4BKX A;  3JSO A;  1FIA A;  4ZZD A;  2V6E A;  1T2K A;  3CCE I;  5BS6 A;  2ZXI A;  1WFX A;  2L7M P;  2VKV A;  1SMT A;  4HQM A;  4TV7 A;  3KP7 A;  3PO3 J;  5DDG A;  3OS2 A;  5D5X B;  1AKH A;  2DU9 A;  1SAN A;  2Z33 A;  2BYV E;  1R7J A;  3F6O A;  1VI0 A;  2KIM A;  1S6L A;  3WTZ A;  5HOD A;  3LSK A;  2EK5 A;  4IOC F;  1FP2 A;  1T56 A;  2NS0 A;  3HRS A;  3WGI A;  2ME6 A;  4ENJ A;  3E97 A;  3RYR A;  1D3Y A;  3EDP A;  4XKB A;  1OMI A;  4M9Z A;  3BJ6 A;  1J5Y A;  3CCJ I;  2F5F A;  3COA C;  1QO0 D;  2L54 A;  2V9P A;  2WC2 A;  3BPX A;  2WB1 N;  4DZJ A;  1MMS A;  2V6C A;  2YSR A;  3OYI A;  5F64 A;  5EJC A;  3ZRG A;  1V54 H;  1IF1 A;  2IEK A;  3GFI A;  3BT9 A;  2VOO A;  1OYY A;  2Q1Z B;  2VN2 A;  2RV8 A;  4ZZL A;  2E2J J;  4E7S A;  2E36 A;  4EMS A;  3DU5 A;  1F9N A;  3WTU C;  2OCC H;  2NVQ J;  4BHB A;  4M74 A;  2NNY A;  1E3O C;  5L3B A;  2IRF G;  5J47 A;  4BEH B;  3BOQ A;  1HXD A;  1H9T A;  3DEE A;  2QWW A;  4CCL A;  1GXQ A;  4KUM A;  2OPT A;  5EYR A;  5K5R A;  3WE2 A;  1S9H A;  5HLT A;  2BW3 A;  1EH8 A;  2Y2Z A;  2R7S A;  4A93 J;  4OWR B;  2R5Y B;  3FHZ A;  1W36 C;  1ITY A;  3IUO A;  4C30 A;  5LRR A;  2AQE A;  4EEF G;  1VTN C;  1LKX A;  1EA3 A;  2X0L A;  3IWF A;  3W3C A;  3DBR B;  5J3L A;  4A12 A;  2L2O A;  1FOX A;  1R58 A;  3NAU A;  4JX6 A;  1HF0 A;  2A05 A;  5K5O A;  4CCM A;  2Y30 A;  4PFO A;  1YO5 C;  5FO5 A;  3QAH A;  2WTE A;  2I8D A;  3OYB A;  1ETW A;  2GIV A;  3DF8 A;  3NWS A;  2X6O A;  5EF6 A;  3S2H J;  3WU2 C;  3DKX A;  4D7N A;  1HSJ A;  1WJB A;  3WHB A;  3H5R A;  4KIG A;  3P7N A;  4CCK A;  4IHS A;  3F6V A;  1G3W A;  3TO9 A;  4XRM A;  4Y13 A;  1D5V A;  4CXF A;  1ETY A;  5D6E A;  1PDN C;  1U9N A;  1I50 J;  2M87 A;  1HW5 A;  2BXZ A;  2O9L A;  1Y1W J;  2FXA A;  2TRT A;  2X51 A;  4NNJ A;  4M6X A;  3SEZ A;  2Q2E B;  5ICC A;  1TW3 A;  3H3U A;  1D8K A;  3W2A A;  1KGS A;  3P9K A;  4HDU A;  4QTR A;  1HW2 A;  1SVO A;  1RES A;  1G8X A;  5IT3 A;  5A2Q K;  4M3B A;  4RMN A;  3CMA I;  3I5U A;  2MH2 A;  1TW2 A;  3OYL A;  1SFU A;  2YS9 A;  4UHT A;  2HYG D;  3A02 A;  1KU7 A;  3EET A;  2Y0S A;  1I3Q J;  4A3M J;  1LDJ A;  3DTE A;  3PQJ A;  4A0X A;  3S93 A;  1P7I A;  1YG2 A;  3QWL A;  2CQN A;  2XPW A;  1Z1D A;  1T39 A;  4KMU X;  1JKP C;  1YX3 A;  2MH9 A;  2VIX A;  3QPT A;  1XGM A;  1FTT A;  4HX4 A;  3H0G J;  1MND A;  1UG0 A;  1FT9 A;  5F0H A;  2RGV A;  1XN7 A;  1BC8 C;  1IDY A;  3GTP J;  2CQK A;  2KIQ A;  4G7O F;  4I76 A;  5FFX A;  5KAI C;  3HM5 A;  1HA8 A;  3Q0U A;  3D5R C;  2LBF B;  5A2Q Z;  1DPR A;  2PBI A;  2LRD A;  3OMY A;  1A6Q A;  2CS3 A;  3HSE A;  1SD7 A;  3TOB A;  2LH9 A;  5CVI A;  3G1L A;  4HNU A;  2HZD A;  4A3B J;  3IKV A;  4A3I J;  3IRR A;  2PG4 A;  2XAS A;  3ELK A;  3KP2 A;  3TW6 A;  2D1H A;  3VEP A;  2WAF A;  3AG4 H;  4BJT A;  4M3D A;  3WTT C;  2DOD A;  3C3W A;  2FMY A;  1ZAO A;  3KZZ A;  1ACI A;  1SAU A;  1HKQ A;  2AXT C;  4KN4 X;  3A01 B;  5EGO B;  1K6Y A;  1N78 A;  1BJZ A;  5DM6 F;  2M9H A;  2XIG A;  5B66 C;  2P5V A;  3HRU A;  1BL0 A;  5IP7 J;  2XVC A;  1FOK A;  4FET A;  1TT0 A;  4NB5 A;  2CYY A;  4U0W A;  4PDK A;  3L2Q A;  3V7S A;  4JBA A;  3CCR I;  3BG7 A;  1BI1 A;  1A35 A;  3KEY A;  5H20 A;  1N75 A;  2XAQ A;  1V5G A;  1SD6 A;  2BV6 A;  3FK7 A;  4DYR A;  1V5E A;  2FOW A;  3ML6 A;  4W97 A;  2BEO A;  3FM5 A;  2DDB A;  1IV8 A;  1IZ1 A;  1ZG5 A;  5J1R A;  1VFC A;  3F8M A;  4OIR F;  3HB9 A;  2UXX A;  2FBI A;  2V1N A;  1B4A A;  2BZT A;  4MTD A;  4N9H A;  3OS1 A;  2YU3 A;  2O03 A;  2DQL A;  1MIJ A;  5CKT A;  3PUB A;  5B5E C;  4Y7N J;  5FB2 A;  5CPR B;  2L7F P;  4E6K G;  2HI3 A;  2VQC A;  3CES A;  1FTZ A;  3EQL F;  5CQG A;  2QZ8 A;  3TOA A;  4N0B A;  4GFB A;  3KX2 A;  3ZMD A;  5F04 A;  3BPV A;  1TZL A;  3S3N A;  1QBJ A;  1WSU A;  4A3D J;  3AG3 H;  4RB1 A;  4UUS B;  3BR6 A;  1DUX C;  2CQ7 A;  2R7D A;  3CP8 A;  3ZMS A;  2CG4 A;  4EGY A;  1G6N A;  3NQO A;  3DPL C;  2CJJ A;  2HTS A;  4D0P A;  1YX5 A;  2W1O A;  4ETS A;  1D5Y A;  3K4B A;  4ANJ A;  2ZXH A;  5KAF C;  3FX3 A;  4L18 B;  1VQ6 I;  1D0X A;  4WXD A;  5BOX A;  3KLN A;  2PMH A;  1JKO C;  2JA6 J;  3VDX A;  3QYB A;  2VBX A;  3ABL H;  3K9T A;  2DA1 A;  3DEW A;  4ZJZ A;  5JVT A;  1ZAR A;  2IT0 A;  2KIF A;  2W4S A;  2KPM A;  3CDH A;  3BG5 A;  3P9C A;  1XGO A;  3VYU B;  1Y0N A;  4MEX F;  3SQN A;  3GTJ J;  1VQ8 I;  1IXR C;  4A5M A;  4C3H J;  2QCO A;  2EWN A;  2IPQ X;  3HKZ A;  1VQO I;  1QA6 A;  3MQ0 A;  2L02 A;  3I64 A;  4UB8 C;  2HKO A;  5FKN A;  4B47 A;  3RSN A;  1S7A A;  2VT2 A;  3GTG J;  5EEA A;  3K2A A;  4V19 K;  2BGC A;  1FNN A;  3BR1 A;  5B1B H;  3N4M A;  3AL0 C;  3EUH C;  2FBH A;  4KIC A;  2K86 A;  1Z3X A;  2LOO A;  1DP3 A;  4YEJ A;  1FBQ A;  5CQE A;  2NVX J;  3CC4 I;  1GHC A;  4W1U A;  4RBO A;  3K2Z A;  1RUN A;  3BTJ A;  2MG4 A;  2OTL I;  4LGW A;  2VPR A;  4LJZ F;  3VSK A;  2HZT A;  2BVM A;  3QQA A;  3C2B A;  2EIM H;  4L5E A;  4Y4R A;  2PI0 A;  2DMN A;  1H88 C;  1YHQ I;  3RJP A;  1MBH A;  1IG7 A;  3RZD J;  3H92 A;  3F8N A;  1G3T A;  2CH0 A;  3ABK H;  1GT0 C;  4L9V A;  4L0Z B;  1MKM A;  2QVO A;  5C3E J;  1XCV A;  3OL4 A;  5DEQ A;  4XRS G;  3IH2 A;  2XGX A;  5GTH C;  2DCE A;  3K7A J;  4ENN A;  4IHY A;  1FYM A;  2WY7 Q;  5E1W A;  1MBK A;  3BCB A;  2Q8K A;  4C3J J;  2K85 A;  4IRH A;  5L3D A;  3LSJ A;  3HOZ J;  4E7L A;  3F9K A;  5AIQ A;  4LB5 A;  2DOF A;  2X4H A;  2V4J C;  2XF6 A;  3FMS A;  4LIV A;  1GV2 A;  2WA0 A;  3SZT A;  4HV6 A;  2L9S A;  2DTZ A;  4WX9 A;  3MVP A;  2KL4 A;  1AWC A;  2ZNY A;  2O7O A;  1U5T B;  4BXU A;  2JTV A;  4EQQ A;  3HUG A;  4XM3 A;  3LAP A;  1GVD A;  2Z1D A;  2BY0 A;  2VAS A;  5HDG A;  1QHH D;  2GBY A;  4XOP A;  3E5X A;  5GAE J;  1ZLK A;  4MTE A;  4LLN A;  2P8T A;  3GEZ A;  5ICG A;  2E1M C;  3KP4 A;  3DLL F;  4GDF A;  4HBL A;  2HOE A;  3K1N A;  3Q0V A;  5TRD A;  3M8F A;  1QNT A;  1R49 A;  3CP2 A;  3FBI B;  3KLO A;  2R4G A;  4M6Y A;  1U2W A;  2JUG A;  1TWH J;  3ABM H;  5LGU A;  2M0M A;  4GYI A;  2P0W A;  2M7A A;  4L9T A;  5D8K B;  5HNF A;  5FKM A;  3ZMT A;  1QVU A;  3M1E A;  2HXI A;  3V42 A;  3V8K A;  5HLH A;  1RI7 A;  4J00 A;  1ZRE A;  3HPH A;  2HEO A;  3PJR A;  1XG1 A;  1IO2 A;  2JZY A;  4LIU A;  4KJZ A;  2BW3 B;  4PJN A;  4LOC A;  1A5J A;  3T1B A;  4B44 A;  3CCU I;  1P6R A;  2B63 J;  2P4W A;  2L0K A;  3SZP A;  1BI2 A;  1TQM A;  1X58 A;  3K70 C;  2VJ4 A;  4IKF A;  1PUF A;  5M5X J;  2JQ7 A;  3BQY A;  2B9S A;  2DMQ A;  3IH3 A;  5BPD A;  2XUB A;  2GA2 A;  2L3D A;  5ILS A;  3T5X A;  2H94 A;  1RNL A;  4IL6 C;  2CUE A;  5LBQ A;  3I56 I;  2ZJP F;  4Y3O A;  4E7K A;  2WAD A;  3P9I A;  1DQU A;  3CF2 A;  5HS8 A;  3GTO J;  2E71 A;  3Q0W A;  1QZE A;  2E19 A;  1Y0U A;  2L9V A;  3Q9V A;  4YFK F;  4HNV A;  1W5T A;  2MFZ A;  5EG0 A;  4C2U A;  1JUP A;  2KMU A;  1Y8R B;  1CF7 B;  2OZ6 A;  2QM3 A;  3GW2 A;  3OIQ A;  4DNC A;  2GXG A;  2HWV A;  2LR8 A;  2IAI A;  4ENK A;  3F8C A;  1V4R A;  1FBU A;  1R5I D;  1DDN A;  3BTC A;  5ICF A;  2GXB A;  2HS5 A;  4BY7 J;  2ZO4 A;  4OAY A;  3L9F A;  3SFI A;  4ITV A;  3HG9 A;  3UNG C;  4M72 A;  4I01 A;  3VOE A;  2EZH A;  2W00 A;  3A0B C;  1QZZ A;  3H9Q A;  4ZDP A;  1YE9 A;  5HLI A;  4X6A J;  3CJQ B;  3LOC A;  1TWF J;  2VKD A;  1LE8 A;  2EBI A;  2Z5U A;  4QPO A;  3VSL A;  5K7F A;  2G0E A;  2NS7 A;  5FRO A;  1FOY A;  2EV0 A;  5KK1 A;  1U3E M;  1I6H J;  1DU0 A;  4PJ0 C;  1FY7 A;  3PQK A;  2YUS A;  3CMM A;  1ZRC A;  1J2X A;  2UUZ A;  1P4W A;  3E3V A;  4C2M J;  3OYJ A;  2XRL A;  4RGR A;  3GLX A;  4L9J A;  3OYC A;  2VOD A;  3LSM A;  3JRH A;  3K1M A;  3HOY J;  3MD2 A;  4KN7 X;  5M5Y J;  3CC2 I;  2QKL B;  1IN8 A;  1XCB A;  2P5L C;  3HRM A;  1R5G A;  1FMV A;  4U7B A;  3F0C A;  5E3L A;  4BE1 A;  2IS1 A;  1K78 B;  3PM1 A;  2VC1 A;  2ZC2 A;  3ZQF A;  3TED A;  2TDX A;  1Y6I A;  1ETK A;  2JVG A;  1QQI A;  4HOB A;  3L2R A;  2GWR A;  3R0A A;  5E17 F;  1IV6 A;  1OLT A;  4P9F A;  2B0L A;  5IP6 A;  2G7H A;  2CGP A;  3KZY A;  2MA3 A;  5E18 F;  3JRA A;  2DQR A;  1T8I A;  3OR2 C;  4MFE A;  2ZME C;  3GZ6 A;  2CUZ A;  4BDZ A;  2MGQ A;  3PUF A;  2XAH A;  4G6T B;  2HKX A;  3GME A;  1T95 A;  4UUT A;  3GX4 X;  3I4N J;  1Z05 A;  3OYG A;  3J80 K;  5E79 C;  1FSE A;  1W36 D;  4JP0 A;  5F1J A;  1GV5 A;  2Z99 A;  2PN6 A;  3EYI A;  2AO9 A;  3K4N A;  3S15 J;  1MNM C;  1WWX A;  1I5Z A;  1XGN A;  1FC3 A;  2H8W A;  5E1X A;  2OJE D;  3EUK L;  1TLH B;  3PIO F;  2UXN A;  3OY9 A;  3FIS A;  3F21 A;  1JHH A;  4WWC A;  1BA5 A;  3FXU A;  2F4M B;  4HF2 A;  4HSR A;  2HOS A;  4NDL A;  3TDZ C;  4MO7 A;  3L1P A;  3BWG A;  1R22 A;  2J5O A;  2YX4 A;  3ZMZ A;  4OIQ F;  1BIB A;  5J4V A;  1RR8 C;  4YFN F;  3I59 B;  1K61 A;  1JGG A;  2OQG A;  2VJI A;  2JRM A;  5FLV A;  3NEU A;  4XKW A;  1ZG3 A;  4ZC3 A;  4DBQ A;  4CCJ A;  1XDU A;  1Z91 A;  3J80 Z;  2HFH A;  3FIW A;  3I54 A;  1YIJ I;  2DA3 A;  3OYE A;  1JJ6 C;  3M8J A;  5HNH A;  4BAC A;  2ESN A;  4I99 C;  3E6B A;  2V79 A;  4YRV A;  2STW A;  2FA5 A;  2MSY A;  4U88 A;  1G3Y A;  2EQR A;  1F43 A;  3S14 J;  3U1K A;  2OCE A;  1SC7 A;  4O5V A;  3JAM K;  4XON A;  3TDU C;  2DK5 A;  4IXA A;  3CUO A;  1OCR H;  3ZN0 A;  4FE7 A;  2CUF A;  2DYS H;  3LSG A;  4H4K C;  3G71 I;  1WKM A;  3RPU A;  1QGP A;  2IW5 A;  3QOE A;  5J4Y A;  2R93 J;  1SEU A;  1T0F C;  2PQ8 A;  3JRC A;  1A04 A;  2FJ1 A;  1Z0X A;  4XR6 A;  4RAY A;  2FRH A;  2IGM A;  2L9R A;  1P4A A;  2CMP A;  5M3M J;  3L7W A;  4FX0 A;  4BHC A;  1TWG J;  2RRE A;  2EB7 A;  3UKG A;  1PJR A;  3LSR A;  1ZGW A;  2JA5 J;  2KKO A;  4Y33 A;  3H36 A;  3HGG A;  1R71 A;  1FPQ A;  2W24 A;  1WZ2 A;  1VQ7 I;  3ZQG A;  3O6B B;  4XLC A;  3JSP A;  1BN5 A;  3JAM Z;  1B59 A;  1LB2 A;  4CIC A;  1X3W B;  1J59 A;  4IOA F;  1K79 A;  1W7P D;  3LST A;  3C1D A;  2HQ5 A;  3V8J A;  3WOD F;  3ZMU A;  3QPS A;  4GXO A;  5ICE A;  4WK8 F;  1SD5 A;  2VOP A;  5GTI C;  2HYF A;  3HOT A;  1JGS A;  3CJR B;  2R7W A;  3S16 J;  5J6X A;  3GFM A;  4ZH4 F;  3WGH A;  3O3K A;  3FXQ A;  2Y9Y A;  2DMP A;  3A1Y A;  3QPL A;  4Q4Z F;  4IZZ A;  2KT0 A;  1JUS A;  2HNH A;  3JTG A;  3SZG A;  1N25 A;  1YRN A;  3LQR A;  3OIO A;  5J8C A;  3PL8 A;  5GAG J;  3KEQ A;  1NK2 P;  5LEJ A;  4RGU A;  4OIO F;  1MGT A;  2LLK A;  3RPU D;  2X6W A;  2ZNZ A;  4LK0 F;  2CW0 F;  3MKY B;  3OYH A;  4HAM A;  1Z6T A;  3CUQ B;  2HDC A;  3FK6 A;  3G4S I;  2EZI A;  4A3C J;  4HST A;  3HHH A;  3WHC A;  2E2I J;  3RDI A;  1D1B A;  3H0D A;  1V55 H;  1O3Q A;  2R7O A;  3TGN A;  1ZR2 A;  2YR2 A;  2ELJ A;  2K4B A;  2OD5 A;  1B6A A;  1WGX A;  1YQA A;  4AD9 A;  4O3M A;  4FT8 A;  2F5E A;  3EUH A;  4ZDO A;  2JJ7 A;  3MZY A;  2MAB A;  1R9T J;  5CJ9 A;  3SJM A;  4EJT A;  3OV8 A;  1Z77 A;  5HDN A;  4IEJ A;  5TGT A;  2VJJ A;  3TBI A;  1STZ A;  4QSH A;  3RTR A;  3B6A A;  5ILU A;  1IN5 A;  3IL2 A;  3BRO A;  2E34 A;  3U2R A;  1VZ0 A;  1K6O A;  1SVL A;  1IN7 A;  1PP7 U;  4Q48 A;  5FKL A;  1YS6 A;  3ROU A;  3S1R J;  3I4P A;  2HVR A;  3KIO A;  4BBS J;  2Y69 H;  1ZRD A;  3OYM A;  1QU3 A;  4YFX F;  1ZHF A;  2DW4 A;  5IYD J;  4LG0 A;  2XGE A;  3G1M A;  3FM3 A;  5CVU A;  3KE2 A;  2K27 A;  3CCM I;  2DT6 A;  1OYW A;  3OYF A;  4FCY A;  4PSW A;  4P9U A;  1DU6 A;  2OU2 A;  3NRV A;  2LD5 A;  4XNF A;  2D45 A;  3BR5 A;  3FXO A;  1ZR4 A;  1ZQ3 P;  3G1O A;  1QZY A;  2IS4 A;  1NK3 P;  4DGW B;  2R3S A;  4A3F J;  3DQV C;  2QQB A;  2WBM A;  4XN3 A;  4M71 A;  3R4K A;  4IPA A;  3SYT A;  4BYY A;  5LD2 C;  1MJ9 A;  1RET A;  2Y0S N;  4LLG F;  4ZDL A;  1W5C C;  5L3C A;  4YII A;  1OCP A;  3S2D J;  3RQI A;  2L01 A;  2KRH A;  2EIK H;  3KP6 A;  2GXA A;  3GCM A;  3HTU A;  5LGN A;  3GLL A;  1D1A A;  1R1V A;  2KIS A;  2R5Z A;  1W4M A;  5M5W J;  3U1D A;  3LNQ A;  1EKE A;  1HDP A;  1S29 A;  5LLQ A;  4C2T A;  4E7Z A;  1LJ9 A;  2OC6 A;  3ASO H;  2R7Z J;  1FBS A;  1J75 A;  4R1H A;  2FML A;  4HDV A;  2DI3 A;  4FTH A;  4G7Z F;  1XMX A;  3KEO A;  3GVA A;  1WQ2 A;  2MC4 A;  2BHY A;  5C44 J;  3BG3 A;  1G4D A;  3MKZ A;  4D7M A;  2EV5 A;  3X2Q H;  1YTY A;  1K4S A;  1FZP B;  1PYV A;  3VYR B;  5JFR A;  4JOM A;  2I5U A;  4ESF A;  3RKQ A;  1KQ9 A;  1LPQ A;  2RQP A;  1I1G A;  2Q0O A;  2VC0 A;  5ILV A;  3RKX A;  1XD7 A;  1R1T A;  2IBD A;  3HXL A;  2DMU A;  1XS9 A;  4XOT A;  3H9J A;  5CVJ A;  2W82 A;  2AQF A;  2PMU A;  1P92 A;  4DYC A;  9ANT A;  2J5P A;  1XMK A;  4AIK A;  2L7K A;  2P7V B;  5M3F J;  1MMN A;  1H8A C;  5D6F A;  4RB3 C; 
#chains in the Genus database with same CATH homology
 3LQQ A;  5D4S A;  1R36 A;  3REO A;  3FWE A;  4KIB A;  3DEU A;  4IF4 A;  5BQT A;  1IXC A;  2Y75 A;  1Z7U A;  4L0Y B;  4Q47 A;  4G7H F;  2IA0 A;  2MLK A;  4DQ2 A;  1O3S A;  3LFK A;  2HR3 A;  5FFZ A;  5KVR A;  3R6S A;  1LVA A;  1T38 A;  1MDM B;  5DCM B;  3E5Q A;  1Q1H A;  2FOK A;  1XGS A;  2G9W A;  4Y15 A;  1EH6 A;  3D5L A;  5HDK A;  2P5K A;  4EGZ A;  4G6Q A;  4JQF A;  2V9V A;  3GUD A;  3WE3 A;  4EV0 A;  3GZ5 A;  2RN7 A;  3GFJ A;  1I1S A;  4CO8 A;  2QEN A;  4QLC U;  4NHJ A;  1P4X A;  2M1B A;  1FP1 D;  5DYM A;  2R7F A;  1U5T C;  1E17 A;  2CSO A;  5HLG A;  1L0O C;  1HST A;  3N97 A;  1YLF A;  2HQN A;  5AIP A;  5LHH A;  4Z2Y A;  4A0Z A;  1KQ0 A;  1SAX A;  2P7C B;  1RZ4 A;  1FYK A;  3ECH A;  1BI0 A;  3B73 A;  3IWZ A;  2ACJ A;  2XAG A;  3J7A O;  1KYW A;  4XRF A;  2O3F A;  1YS7 A;  1K7A A;  3QOP A;  4MQV A;  2ZME A;  2QLZ A;  1IW7 F;  4XLN F;  2ISZ A;  3MAJ A;  3S2W A;  4HYE A;  3ZPL A;  2DBB A;  4LFU A;  3F3X A;  4Q5S F;  3V7R A;  2ELH A;  2LF7 A;  2XKO A;  4YIF A;  3K1P A;  5D5V B;  2KJC A;  5K1Y A;  1ON2 A;  4IRI A;  2VE8 A;  2VBZ A;  5FLX K;  4QWQ A;  1PUE E;  3R0J A;  2OZU A;  2JPC A;  4UVA A;  5FGM A;  1ZLJ A;  1B9M A;  3RIR A;  4S05 A;  4CYD A;  2W84 A;  2A07 F;  1MD0 A;  2L4M A;  2O0Y A;  1XMA A;  3QU6 A;  4P55 A;  4A2U A;  1J9I A;  2FQ3 A;  2M8E A;  2Z9O A;  1MJB A;  3FZV A;  3LA3 A;  2DK8 A;  5FLX Z;  1L3L A;  1SMY F;  4NQW A;  5H6Q A;  1W5S A;  4R79 A;  4BH9 A;  1KU9 A;  3E6D A;  4RS8 A;  1KU2 A;  2D1V A;  2CO5 A;  2IJL A;  5E8G A;  3L2C A;  1X3U A;  2E7W A;  2Q2E A;  1OKR A;  4I02 A;  5CVR A;  1YIO A;  2ZFW A;  3B02 A;  2FSW A;  2L4A A;  3HTS B;  4KT5 C;  3CO7 C;  3V8L A;  4OOI A;  3MZH A;  4PGG A;  3WU1 B;  4HA8 A;  3BZ6 A;  3E6M A;  5L3F A;  1S3J A;  3TO6 A;  1J0R A;  5IT9 Z;  1R23 A;  4ENM A;  5CVV A;  2O6G E;  5EEG A;  1U8R A;  4HLX A;  4UV8 A;  4GO1 A;  4LG0 B;  2WWY A;  3JW4 A;  4IRG A;  5D5U B;  2XHK A;  1FYL A;  2QBY A;  3DXJ F;  3QPH A;  2GZW A;  5E1Z B;  4ZYH A;  4WXH A;  1TBX A;  4I09 A;  1BBY A;  4MEY F;  4LD5 A;  3T8T A;  2M30 A;  1AOY A;  4M9S A;  3HSR A;  3FMQ A;  1Z9C A;  4G94 A;  4UVB A;  3U9G A;  2A5Y B;  4EJU A;  1ZH5 A;  1LDK B;  1ULY A;  4UUV A;  4HV5 A;  3FF5 A;  4R8H A;  2JRT A;  4B09 A;  1Z6R A;  4KDP A;  5FD5 A;  3I71 A;  2M45 A;  2DO7 A;  2ZBK A;  2KIU A;  4IVN A;  2PFB A;  2C6Y A;  5F6F A;  4E70 A;  4PZJ A;  1R1U A;  1TQP A;  2JT1 A;  2LDU A;  1XB4 A;  1GVJ A;  2RVC A;  3WTY C;  5HS9 A;  4RAZ A;  3LA7 A;  4EM0 B;  4I7H A;  1UFM A;  1FX7 A;  2IP2 A;  3IKT A;  1ZG1 A;  2O61 A;  3QRF F;  2FF4 A;  2W85 A;  4G9Y A;  4AIJ A;  3I58 A;  5ED4 A;  2EA4 A;  1HW1 A;  5K5Q A;  3C18 A;  3ISP A;  4XSZ F;  2DT5 A;  1LEB A;  2GA1 A;  1H9G A;  3GXO A;  4ESB A;  3I0T A;  2EJR A;  2ETH A;  1R00 A;  4KFC A;  5TJJ A;  3G73 A;  3RYP A;  2EFN A;  1TQI A;  1JHF A;  3WTV C;  2F5D A;  2NNN A;  1LEA A;  2UWM A;  1W7P A;  2CFX A;  1IRF A;  1UCR A;  3HOS A;  1U78 A;  1XDS A;  3CUQ C;  3WG9 A;  4F7Z A;  2RC4 A;  3CLO A;  5LEK A;  1S7O A;  2KJB A;  4M73 A;  1S8N A;  2DFI A;  4WXC A;  4PCQ A;  3CJN A;  2H09 A;  3MCZ A;  1T98 A;  1KYZ A;  4GGG A;  3K0L A;  3GWZ A;  3KP5 A;  1IRG A;  4GYG A;  2EFP A;  3RKY A;  2LKP A;  2IVM A;  3M9A A;  4UXN A;  4HLY A;  2QYO A;  3OOP A;  4G6D A;  3RI4 A;  1ZGJ A;  4MNU A;  5DUK A;  3ZQ7 A;  5H6R A;  1O7F A;  1EH7 A;  2FNP A;  4LB6 B;  3J81 Z;  4EJV A;  2GQQ A;  4OU0 A;  3SXY A;  1RUO A;  2ZME B;  4XLP F;  4EJO A;  4GCV A;  1U5T A;  2F5C A;  2W25 A;  4HW0 A;  5BPI A;  1FSH A;  3VFZ A;  3V7C A;  4ZYG A;  2VE9 A;  4HQE A;  2EA2 A;  4G8X A;  4H0E A;  3ZMV A;  4ASN A;  2A6H F;  5HS7 A;  4K2E A;  3SHF A;  4Y17 A;  1BJA A;  2A6E F;  4OMZ A;  1P2F A;  2F2E A;  5BMZ A;  2DPD A;  2G7U A;  2PLY A;  4UV9 A;  2AXL A;  3M7G A;  1NHA A;  2A3S A;  3W6J B;  2E1N A;  1CGP A;  2A61 A;  4CDG A;  4YG2 F;  1LDD A;  1UB9 A;  5D5W B;  2XV4 S;  5JHU A;  2A69 F;  4LMY A;  4XSX F;  2WV0 A;  4WCG A;  1DP7 P;  4CZZ A;  2P6S A;  4N9I A;  1KU3 A;  2QQA A;  1LQ1 A;  2VBW A;  2RKH A;  4MHG A;  1J7K A;  4I0B A;  3D0S A;  2H27 A;  1ZRF A;  1DPU A;  2D2W A;  1OR7 A;  3JTH A;  4L5J A;  2ZKZ A;  2PJP A;  4M9X A;  3BJA A;  4BQA A;  2FU4 A;  5DUI A;  3KFW X;  1TTY A;  2Y0M A;  5D8L B;  5HOO A;  1CF7 A;  5FD6 A;  1D8J A;  3RPQ A;  1RIO H;  3LWF A;  2LF8 A;  2XAF A;  2LSO A;  3FXR A;  5LRS A;  1G3S A;  3L00 A;  1PP8 F;  1C0W A;  2STT A;  3ZP5 A;  4AVP A;  5CLS A;  1I27 A;  2K4J A;  1T6S A;  5ERI A;  4ESJ A;  4IHT A;  1WRJ A;  3GFL A;  2VXZ A;  1ZYR F;  2QBY B;  2V1X A;  4XBF A;  4U0V A;  1IUY A;  4OIN F;  1HBX G;  3ECO A;  2PEX A;  2P6T A;  2VT3 A;  2DTR A;  5DD4 A;  2HGC A;  1XSX A;  3QP6 A;  1ZN2 A;  1K78 A;  4MQ9 F;  1SFE A;  3G3Z A;  2XKP A;  2H6B A;  1R5H A;  2FEZ A;  2DAO A;  2IA1 A;  3DFG A;  3RKW A;  4RB2 C;  4RGX A;  1JE8 A;  2COM A;  2DLL A;  2RDP A;  3L09 A;  3DKW A;  2OQR A;  3C7J A;  3W6K B;  1YW9 A;  4AWX B;  2EFQ A;  2K7L A;  1ZGA A;  4P5O A;  5LGT A;  4JK1 X;  3BDD A;  2ZJ2 A;  4ZYD A;  4ZYE A;  4AIH A;  2NRA C;  3I59 A;  3MWM A;  4A6E A;  3HIF A;  3BY6 A;  1MJA A;  2DPU A;  1BIA A;  3CTA A;  2XAJ A;  2VBY A;  1B9N A;  1V3F A;  1OYI A;  5E8I A;  2OBP A;  2H6C A;  1B1B A;  1E2X A;  2ADU A;  3IRQ A;  1YW7 A;  3T8R A;  1BM9 A;  1W7P B;  1HKS A;  4LK1 F;  4HZF A;  1QPM A;  1IXS B;  4B8X A;  1TNS A;  2NYX A;  3WTX C;  4CHU A;  4I98 B;  2A68 F;  2QQ9 A;  1LNW A;  4KA4 A;  5DCF A;  1BC7 C;  3MEX A;  2K02 A;  1REP C;  3F8F A;  3Q5F A;  1KA8 A;  2EFO A;  3VB2 A;  1YYV A;  5JR3 A;  3T0Y A;  3DV8 A;  5LHI A;  5CYV A;  4S04 A;  5DV5 A;  3KET A;  3R60 A;  5J8F A;  4O6J A;  3WTW C;  3DPT A;  4KMF A;  3ABU A;  3R61 A;  4I2O A;  2O8X A;  1O3R A;  1HQC A;  3CUQ A;  2OA4 A;  1ONV A;  4UVC A;  3ERE D;  1U6G A;  3EYY A;  4KNY A;  3H3Z A;  4BAY A;  3TO7 A;  2XRN A;  5L3E A;  3MFK A;  2JPB A;  3KCC A;  2E1C A;  3I53 A;  3F23 A;  1FLI A;  1T0F A;  3GF2 A;  4U7D A;  1IN4 A;  5IT9 K;  5L3G A;  3QP5 A;  2MLG A;  1O7L A;  1EV7 A;  4KIF A;  1HKT A;  4EJW A;  3K69 A;  4WF2 A;  2UZK A;  4FX4 A;  1UHW A;  1FWZ A;  2ZCW A;  3HRT A;  4RB0 A;  3F72 A;  3WGG A;  1KQ8 A;  3LAJ A;  5EEH A;  2RNJ A;  4ON0 A;  1XSV A;  3GYH X;  1SFX A;  3ULQ B;  2E7X A;  4BHP A;  3FMR A;  2MC3 A;  4OMY A;  4OIP F;  3E6C C;  2NAZ A;  1USS A;  1I6X A;  1WI9 A;  1IN6 A;  2KRF A;  2MD5 A;  2V1U A;  5JI6 A;  1UHM A;  3IC7 A;  4HX7 A;  2ZXJ A;  1O57 A;  4HF0 A;  2W57 A;  3HYI A;  4IJA A;  3PFI A;  4CGZ A;  2EFW A;  4EM1 A;  4A0Y A;  3WU0 A;  1F1Z A;  3BP8 A;  1GXP A;  5F1R A;  3E5U A;  4LLL A;  2XRO A;  1YFH A;  2LNB A;  2EV6 A;  2AS5 F;  2GAU A;  3QU3 A;  2Z3Y A;  3KP3 A;  3AAF A;  1MDM A;  5DCM A;  4MGR A;  3SFZ A;  3F22 A;  3HHG A;  5HVQ C;  3O2P E;  2OAZ A;  2HTJ A;  1YW8 A;  3ZN1 A;  4U0Y A;  3WTS C;  5D4R A;  1SD4 A;  2MBF A;  4HX8 A;  5DD8 A;  1IAW A;  4L9N A;  4RGS A;  4A6D A;  3IHU A;  4I0A A;  4FHT A;  1BOA A;  1H0M A;  4KYW A;  1F5T A;  1ODD A;  2BE5 F;  4EVI A;  5LHG A;  3ABT A;  2VON A;  2YPR A;  5AON A;  2BBY A;  3DP7 A;  3M8E A;  2HQR A;  4P96 A;  3CO6 C;  4L5I A;  2QUF A;  3V4G A;  1TNT A;  1OPC A;  3GO5 A;  2Y48 A;  4EM2 A;  1JXS A;  3TKY A;  2JSC A;  2CWE A;  1O3T A;  1XSD A;  2V1D A;  6PAX A;  3VOD A;  2M5W A;  2YX7 A;  2IA2 A;  1BI3 A;  1UST A;  3BJO A;  3J81 K;  2FE3 A;  3TQN A;  4HF1 A;  1ON1 A;  2FNA A;  2ESH A;  4PGH A;  4A5N A;  4BNC A;  3HSF A;  3Q9S A;  3LA2 A;  3F8B A;  2ISY A;  4UNO A;  1MZB A;  5E20 A;  2FBK A;  1F4K A;  3JSO A;  4ZZD A;  1T2K A;  5BS6 A;  1SMT A;  4HQM A;  4TV7 A;  3KP7 A;  5DDG A;  5D5X B;  2DU9 A;  2Z33 A;  2BYV E;  1R7J A;  3F6O A;  2KIM A;  1S6L A;  3WTZ A;  2EK5 A;  1FP2 A;  2NS0 A;  3HRS A;  3WGI A;  4ENJ A;  3E97 A;  3RYR A;  1D3Y A;  3EDP A;  1OMI A;  4M9Z A;  3BJ6 A;  1J5Y A;  2F5F A;  3COA C;  1QO0 D;  2L54 A;  2WC2 A;  3BPX A;  2V6C A;  2YSR A;  5F64 A;  1IF1 A;  3GFI A;  2VOO A;  1OYY A;  2VN2 A;  2RV8 A;  4ZZL A;  4EMS A;  3WTU C;  1F9N A;  4BHB A;  4M74 A;  2NNY A;  5L3B A;  2IRF G;  3BOQ A;  1HXD A;  1H9T A;  2QWW A;  1GXQ A;  4KUM A;  5K5R A;  3WE2 A;  1EH8 A;  3FHZ A;  5LRR A;  1VTN C;  2X0L A;  3IWF A;  4A12 A;  1R58 A;  5K5O A;  1YO5 C;  5FO5 A;  3QAH A;  2WTE A;  2GIV A;  3DF8 A;  1HSJ A;  4KIG A;  3P7N A;  4IHS A;  3F6V A;  1G3W A;  3TO9 A;  4Y13 A;  1D5V A;  4CXF A;  1PDN C;  5D6E A;  2M87 A;  1HW5 A;  2FXA A;  4M6X A;  5ICC A;  1TW3 A;  3H3U A;  1D8K A;  1KGS A;  3P9K A;  4HDU A;  1HW2 A;  5IT3 A;  5A2Q K;  3I5U A;  2MH2 A;  1TW2 A;  1SFU A;  4UHT A;  2HYG D;  1KU7 A;  3EET A;  1LDJ A;  3PQJ A;  4A0X A;  1YG2 A;  1Z1D A;  1T39 A;  4KMU X;  2MH9 A;  3QPT A;  1XGM A;  4HX4 A;  1FT9 A;  2RGV A;  1XN7 A;  1BC8 C;  2CQK A;  4G7O F;  5FFX A;  5A2Q Z;  1DPR A;  2PBI A;  3HSE A;  1SD7 A;  3TOB A;  5CVI A;  3IKV A;  3IRR A;  2PG4 A;  2XAS A;  3ELK A;  3KP2 A;  2D1H A;  3VEP A;  3WTT C;  3C3W A;  2FMY A;  1ZAO A;  3KZZ A;  1HKQ A;  4KN4 X;  2XIG A;  2P5V A;  3HRU A;  1FOK A;  2XVC A;  4NB5 A;  2CYY A;  4U0W A;  4PDK A;  3V7S A;  4JBA A;  1BI1 A;  5H20 A;  2XAQ A;  1SD6 A;  2BV6 A;  3ML6 A;  2BEO A;  3FM5 A;  1IZ1 A;  1ZG5 A;  3F8M A;  4OIR F;  2UXX A;  2FBI A;  1B4A A;  4MTD A;  4N9H A;  2YU3 A;  2O03 A;  2DQL A;  5FB2 A;  3EQL F;  2QZ8 A;  3TOA A;  4N0B A;  3ZMD A;  3BPV A;  1QBJ A;  1WSU A;  4RB1 A;  1DUX C;  2R7D A;  3ZMS A;  2CG4 A;  4EGY A;  1G6N A;  3NQO A;  3DPL C;  2HTS A;  4D0P A;  4ETS A;  3FX3 A;  4L18 B;  4WXD A;  5BOX A;  3KLN A;  2PMH A;  2VBX A;  3K9T A;  5JVT A;  2IT0 A;  1ZAR A;  2KIF A;  3CDH A;  3P9C A;  1XGO A;  4MEX F;  3SQN A;  1IXR C;  4A5M A;  2EWN A;  2IPQ X;  3MQ0 A;  2L02 A;  3I64 A;  2HKO A;  1S7A A;  2VT2 A;  2BGC A;  1FNN A;  3N4M A;  2FBH A;  4KIC A;  2K86 A;  1FBQ A;  1GHC A;  3K2Z A;  1RUN A;  4LGW A;  4LJZ F;  2HZT A;  2PI0 A;  3RJP A;  3H92 A;  3F8N A;  1G3T A;  4L9V A;  4L0Z B;  1MKM A;  2QVO A;  1XCV A;  5DEQ A;  2XGX A;  4ENN A;  1FYM A;  2Q8K A;  5E1W A;  4IRH A;  5L3D A;  5AIQ A;  4LB5 A;  2X4H A;  3FMS A;  3SZT A;  4HV6 A;  4WX9 A;  1AWC A;  2ZNY A;  1U5T B;  4BXU A;  2JTV A;  4EQQ A;  3HUG A;  3LAP A;  5HDG A;  3E5X A;  1ZLK A;  4MTE A;  4LLN A;  2P8T A;  3GEZ A;  5ICG A;  3KP4 A;  4HBL A;  2HOE A;  3K1N A;  5TRD A;  3M8F A;  1QNT A;  3KLO A;  4M6Y A;  1U2W A;  5LGU A;  4GYI A;  5D8K B;  4L9T A;  3ZMT A;  3M1E A;  3V8K A;  5HLH A;  1RI7 A;  1ZRE A;  2HEO A;  2JZY A;  3T1B A;  1P6R A;  2P4W A;  3SZP A;  1BI2 A;  1TQM A;  5BPD A;  2XUB A;  2GA2 A;  2L3D A;  5ILS A;  3T5X A;  2H94 A;  1RNL A;  5LBQ A;  3P9I A;  5HS8 A;  1Y0U A;  4YFK F;  3Q9V A;  1W5T A;  1CF7 B;  2OZ6 A;  2QM3 A;  3GW2 A;  4DNC A;  2GXG A;  2HWV A;  4ENK A;  3F8C A;  1V4R A;  1FBU A;  1DDN A;  5ICF A;  2GXB A;  2HS5 A;  2ZO4 A;  3L9F A;  4M72 A;  4I01 A;  3VOE A;  1QZZ A;  5HLI A;  2Z5U A;  2EV0 A;  5KK1 A;  1U3E M;  1FY7 A;  3PQK A;  1ZRC A;  1J2X A;  1P4W A;  3E3V A;  4RGR A;  3GLX A;  4L9J A;  2VOD A;  3K1M A;  4KN7 X;  1IN8 A;  1XCB A;  2P5L C;  3HRM A;  1R5G A;  4U7B A;  1K78 B;  2VC1 A;  2TDX A;  1QQI A;  4HOB A;  2GWR A;  3R0A A;  5E17 F;  4P9F A;  2B0L A;  2G7H A;  2CGP A;  3KZY A;  2MA3 A;  5E18 F;  2DQR A;  3GZ6 A;  2XAH A;  2HKX A;  3GX4 X;  1Z05 A;  3J80 K;  1FSE A;  2Z99 A;  2PN6 A;  3EYI A;  1WWX A;  1I5Z A;  1XGN A;  1FC3 A;  5E1X A;  1TLH B;  2UXN A;  3F21 A;  1JHH A;  4WWC A;  3FXU A;  4HF2 A;  3TDZ C;  3BWG A;  1R22 A;  2J5O A;  2YX4 A;  3ZMZ A;  4OIQ F;  1BIB A;  4YFN F;  3I59 B;  2OQG A;  3NEU A;  1ZG3 A;  1XDU A;  1Z91 A;  3J80 Z;  2HFH A;  3I54 A;  2ESN A;  3E6B A;  2V79 A;  2STW A;  2FA5 A;  4U88 A;  1G3Y A;  4O5V A;  3JAM K;  3TDU C;  2DK5 A;  4IXA A;  3CUO A;  3ZN0 A;  1WKM A;  3RPU A;  1QGP A;  2IW5 A;  2PQ8 A;  1A04 A;  4RAY A;  2FRH A;  1P4A A;  3L7W A;  4FX0 A;  4BHC A;  2EB7 A;  2KKO A;  1FPQ A;  2W24 A;  3O6B B;  3JSP A;  1BN5 A;  3JAM Z;  1B59 A;  1LB2 A;  4CIC A;  1J59 A;  1K79 A;  1W7P D;  3LST A;  3C1D A;  3V8J A;  3WOD F;  3ZMU A;  4GXO A;  5ICE A;  4WK8 F;  1SD5 A;  2VOP A;  2HYF A;  3HOT A;  1JGS A;  5J6X A;  3GFM A;  4ZH4 F;  3WGH A;  3O3K A;  3FXQ A;  4Q4Z F;  3JTG A;  3LQR A;  5J8C A;  3KEQ A;  5LEJ A;  4RGU A;  4OIO F;  1MGT A;  2ZNZ A;  4LK0 F;  2CW0 F;  4HAM A;  1Z6T A;  3CUQ B;  2HDC A;  3HHH A;  3RDI A;  1O3Q A;  3TGN A;  2YR2 A;  2K4B A;  2OD5 A;  1B6A A;  1YQA A;  4AD9 A;  4O3M A;  4FT8 A;  2F5E A;  3EUH A;  3MZY A;  5CJ9 A;  4EJT A;  3OV8 A;  5HDN A;  1STZ A;  3RTR A;  5ILU A;  1IN5 A;  3IL2 A;  3BRO A;  3U2R A;  1K6O A;  1IN7 A;  1PP7 U;  4Q48 A;  1YS6 A;  3ROU A;  3I4P A;  1ZRD A;  4YFX F;  1ZHF A;  2DW4 A;  4LG0 A;  3FM3 A;  5CVU A;  3KE2 A;  2K27 A;  1OYW A;  4P9U A;  2OU2 A;  3NRV A;  2D45 A;  1QZY A;  2R3S A;  3DQV C;  2QQB A;  4M71 A;  3R4K A;  4IPA A;  4BYY A;  1MJ9 A;  4LLG F;  5L3C A;  4YII A;  2L01 A;  3KP6 A;  3HTU A;  5LGN A;  1R1V A;  1W4M A;  3U1D A;  1S29 A;  5LLQ A;  1LJ9 A;  1FBS A;  1J75 A;  4R1H A;  2FML A;  4HDV A;  2DI3 A;  4G7Z F;  3KEO A;  3GVA A;  1WQ2 A;  1G4D A;  2EV5 A;  1FZP B;  1YTY A;  5JFR A;  4ESF A;  1KQ9 A;  2RQP A;  1I1G A;  2Q0O A;  2VC0 A;  5ILV A;  3RKX A;  1XD7 A;  1R1T A;  5CVJ A;  2PMU A;  1P92 A;  2J5P A;  1XMK A;  4AIK A;  2P7V B;  5D6F A;  4RB3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...