3KP3A

Staphylococcus epidermidis in complex with ampicillin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
148
structure length
136
Chain Sequence
RIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator TcaR
publication title Structural study of TcaR and its complexes with multiple antibiotics from Staphylococcus epidermidis.
pubmed doi rcsb
source organism Staphylococcus epidermidis rp62a
molecule tags Transcription regulator/antibiotic
total genus 44
structure length 136
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kp3A00
1KQ9A 1HSTA 1YO5C 2IJLA 3ERED 2CO5A 2UWMA 1Z05A 1NHAA 3H3ZA 2VE8A 4HOBA 3RYPA 4JBAA 2Q0OA 3PQKA 3GX4X 1XGOA 2P6TA 1BI0A 4PCQA 1B1BA 2IVMA 3QPTA 2GXGA 3E5QA 4ZYEA 2VBWA 4P9UA 2X0LA 1IZ1A 4JQFA 2O3FA 3DXJF 4HQMA 5D5WB 4KICA 1J7KA 1WRJA 2BEOA 5FLXK 2XIGA 3BZ6A 3M8EA 4M72A 3J80Z 3B73A 1J9IA 2IW5A 3WTSC 2M5WA 1IXCA 1QGPA 1IF1A 3E5UA 2NNYA 3DKWA 1OMIA 3S2WA 3JSPA 3BPXA 3BPVA 3ZMVA 1SD6A 4U7DA 2HFHA 1T0FA 2TDXA 3V8KA 1YW7A 5F6FA 3TGNA 3K0LA 3GFJA 3R61A 2HTJA 1WKMA 3RKYA 2FE3A 4AIKA 4D0PA 5CVJA 1ZGJA 1H9GA 1KYZA 1ZHFA 4EQQA 3HRUA 2HDCA 1U8RA 1XCBA 5CLSA 5ICFA 5JVTA 3T8TA 2LNBA 3K1NA 3NQOA 1K78A 1T6SA 2CSOA 1FWZA 3LQQA 4BYYA 1LVAA 1O7FA 5KK1A 1HW1A 3MFKA 2G7UA 5HVQC 1H9TA 2IA1A 5DD8A 1MDMA 5A2QZ 3WTYC 2HR3A 4A0XA 3F8CA 1HW2A 2RKHA 3RI4A 1OYWA 3KP2A 3IRQA 5JI6A 4L5IA 2K4BA 2MBFA 2O6GE 1IXSB 2XAFA 3ECOA 3GWZA 2LKPA 5DEQA 1CF7B 3KE2A 1ZG5A 1MJAA 2FRHA 2HQNA 3RTRA 1ULYA 1V4RA 1OPCA 2VT3A 3T8RA 1IN5A 3I5UA 3LQRA 2LF8A 4FX0A 1T2KA 3QRFF 2DBBA 3QOPA 2FMLA 3FMSA 2XKOA 3E6BA 4G9YA 2PJPA 3F3XA 1J0RA 3PFIA 1UHMA 1Z6RA 3K69A 3M9AA 3KCCA 1RUNA 3E5XA 4NHJA 2G7HA 3C1DA 4KUMA 4KMFA 5K1YA 4CXFA 3HSEA 3VB2A 5CVIA 3CUQB 4U0YA 3COAC 4UV8A 5FFZA 4P96A 3IKTA 2EK5A 2UZKA 5LBQA 2R7DA 2QLZA 3HRTA 4HYEA 4LK1F 4O3MA 5E20A 3J81Z 2DK5A 3RYRA 1UB9A 5BMZA 4S04A 1QNTA 4GYIA 2XV4S 4ASNA 4OOIA 2XVCA 1RIOH 3P7NA 1IN7A 4MGRA 1BIBA 4A5MA 2O03A 3FWEA 1YG2A 2PFBA 2UXNA 4TV7A 2IA0A 3GO5A 2YPRA 3SZTA 3L9FA 3T0YA 4U0VA 3MWMA 2OZ6A 2MD5A 1YS6A 2Z9OA 4R8HA 4HX4A 1XSDA 1ON1A 3GF2A 4G6DA 3C18A 3I0TA 1FSHA 2OQRA 4O6JA 6PAXA 1FBQA 5FD6A 3I58A 2WV0A 3BJ6A 5ILVA 1XD7A 1MKMA 3JW4A 1Z9CA 4ESBA 2VC0A 2DAOA 4EM2A 2NNNA 3WGIA 2A5YB 2MH9A 3KP3A 3QAHA 1ONVA 2JPBA 5E8GA 2ZNYA 4S05A 1X3UA 4BHCA 1QPMA 5BS6A 5DYMA 1TBXA 1HKQA 3E97A 3G3ZA 4M9XA 3KP4A 2V1XA 2H6CA 2EV5A 1JHHA 4ZYHA 2A68F 3V8JA 3F8NA 2NRAC 5E18F 2JPCA 2PMHA 2XGXA 1PUEE 2PBIA 3FF5A 3WE2A 4P55A 1RUOA 2XHKA 1IW7F 2WC2A 4I01A 2RNJA 4HV6A 3E6DA 3ZMZA 5HLHA 2HOEA 2PMUA 4EGZA 1O3SA 1S3JA 3U1DA 2FBIA 3H3UA 3WTUC 3JTGA 1XDSA 2XKPA 1AOYA 1XB4A 5LGTA 4U88A 2HTSA 3C7JA 5FFXA 4P5OA 1XCVA 3IKVA 1QQIA 5H20A 3IC7A 4N9IA 3KZZA 1QO0D 4YFXF 2EJRA 4HDVA 3WTTC 2P8TA 3WTZA 4HW0A 2ZMEB 4HX8A 1A04A 3GFMA 2CG4A 1D8KA 4EM1A 2M45A 4OMYA 3BJAA 2ZNZA 2MH2A 5DD4A 5IT9K 3D5LA 3F8FA 3JSOA 1LDKB 5HS8A 2V1UA 1LQ1A 3JAMZ 4AWXB 4CGZA 4UVBA 4HF1A 5ED4A 4EJVA 4ZYDA 4EJOA 5D4SA 4ON0A 2CYYA 4A2UA 4RB0A 4MNUA 4AD9A 4RGRA 1BI3A 1PP7U 1R00A 4UUVA 2RN7A 4ENKA 5J8FA 3BDDA 4LGWA 2DFIA 1YFHA 4G6QA 5HDKA 5ICGA 2QYOA 1B59A 3U2RA 3B02A 4A0YA 3MZHA 5F1RA 1BI2A 1XDUA 2GZWA 4G7HF 3WTVC 3MCZA 4XSZF 3RPUA 1IN6A 5L3EA 4OIRF 2DPUA 1W7PD 2FF4A 2XAQA 1KQ0A 2VN2A 1BC8C 4B8XA 2RQPA 2V9VA 3G73A 2JRTA 3V4GA 4ENJA 2KIUA 3VFZA 1W7PA 3FHZA 3HSRA 1U5TB 2EV0A 4M9SA 2RDPA 5EEHA 2AXLA 1WQ2A 3KZYA 3O6BB 3O3KA 5DV5A 2QM3A 1EH8A 4P9FA 1JHFA 2OA4A 1U2WA 4IXAA 4IRHA 1XGMA 3TOBA 4HDUA 1R22A 2ZKZA 1IRGA 4F7ZA 5DCFA 2DI3A 4XBFA 2DQRA 4L9VA 1USSA 2HZTA 3RJPA 1ZN2A 1FNNA 1TQPA 2ESNA 4I02A 2NS0A 2HGCA 1KGSA 3HYIA 5FB2A 2CFXA 4OIPF 1IN8A 3K1PA 1SD5A 1FPQA 2P5LC 1OR7A 4YFKF 4CZZA 3GLXA 2ZFWA 4I0BA 2L4MA 5K5OA 3BP8A 5E1XA 4OIQF 1TNSA 1U78A 2FEZA 2ETHA 1YLFA 4CYDA 3RDIA 3RKWA 3DPTA 2FNPA 1L3LA 3TO6A 5BPIA 3DV8A 1XSXA 4M9ZA 3NRVA 1XMAA 3ELKA 4YG2F 5TRDA 2DLLA 2ZJ2A 1IN4A 5LGNA 4DNCA 2H94A 3ABTA 5LHGA 3FM3A 4LG0B 2JTVA 4PGGA 1YQAA 1QBJA 3CO6C 3HTUA 1F1ZA 5E17F 2M30A 1I1SA 3I59A 4IHTA 4QLCU 2PN6A 1S7OA 5TJJA 5HOOA 4HA8A 2FBKA 1YW9A 1XN7A 4IF4A 1XGNA 5HS9A 4BQAA 4BH9A 3WG9A 3WGHA 3TQNA 3L00A 2P7VB 4M74A 5E1ZB 3LA3A 4KT5C 4LMYA 2DQLA 1KU9A 3MAJA 4LLGF 3F22A 1G4DA 3BJOA 2K4JA 1L0OC 1WWXA 2EA2A 2J5PA 4WF2A 1ZYRF 3EYIA 3SZPA 1R1VA 5L3BA 1BI1A 1G6NA 1J75A 2QZ8A 1CF7A 1P4XA 1DPUA 1MDMB 2GA2A 2EFQA 1EH6A 2VBXA 2KJBA 3C3WA 4RB3C 4MTEA 1D5VA 4PDKA 2LSOA 4HAMA 4EJWA 2V1DA 2IA2A 1FZPB 2VOOA 2BE5F 1P92A 1ZH5A 4HF0A 3HUGA 4LJZF 1RI7A 4LB5A 3CDHA 4E70A 2GXBA 1SFEA 2BGCA 1ZRFA 3REOA 1W5TA 2HYGD 2DO7A 3ULQB 3F8BA 5LEKA 2FOKA 1Y0UA 4O5VA 2IT0A 2ESHA 2OBPA 5D5UB 4EM0B 2GWRA 1O3RA 3J7AO 2XAJA 1SMTA 4MTDA 2FA5A 3CUQA 4GO1A 2QBYB 3FXQA 1QZZA 2W84A 2M87A 3P9IA 1HSJA 3F8MA 3R4KA 2DW4A 3SXYA 1S8NA 5HS7A 1ZRCA 2Y48A 2VONA 2K02A 2QWWA 4OIOF 1DDNA 3HOTA 2D2WA 3EETA 1HKTA 1P6RA 4KN4X 4CICA 4A5NA 2Q8KA 1ZLJA 4EV0A 1GXQA 4GXOA 4OMZA 5HLIA 2ZBKA 3ZN0A 5DCMB 4I7HA 3GZ6A 4EJUA 1TQMA 1P4WA 3U9GA 4BXUA 1KYWA 2EB7A 1QZYA 4HBLA 3LA7A 3ML6A 1JXSA 5LRSA 3O2PE 3M1EA 2Z33A 1ZGAA 4A0ZA 4AIJA 3VEPA 4IRGA 1J5YA 2XRNA 1EH7A 2L01A 1TNTA 3MZYA 5ICEA 2VE9A 1I6XA 4G8XA 3T1BA 1S7AA 3HOSA 3LSTA 3WU0A 3RIRA 2QQAA 1GVJA 1LB2A 1ON2A 1T98A 4L0YB 4CO8A 4Q4ZF 4M6XA 5H6RA 1V3FA 2QQBA 1SFUA 2VODA 1F4KA 3IL2A 2NYXA 3MQ0A 1LEAA 5CVVA 4KFCA 5LGUA 4Q48A 4NQWA 3GZ5A 5FLXZ 1BM9A 1O7LA 3J80K 1R7JA 4UNOA 3KEOA 4LD5A 4M6YA 1G3YA 2KIMA 1F9NA 2VT2A 5FGMA 3V8LA 1BOAA 4I09A 2FU4A 2K7LA 4BHBA 2W85A 1VTNC 3TO7A 3KETA 1K7AA 4IPAA 5L3DA 4NB5A 2K27A 2STWA 2HS5A 1KQ8A 2ZXJA 4ZZDA 2EWNA 4L18B 1FBUA 3L2CA 3QU6A 3SHFA 2YU3A 3ROUA 1I1GA 2HKOA 4EMSA 1R5GA 1E17A 2MLKA 2YR2A 4QWQA 1SD4A 4RGUA 2C6YA 3LA2A 3DP7A 2XAGA 4FT8A 2D45A 1R23A 2O8XA 1HBXG 1UFMA 1MJ9A 1Q1HA 2X4HA 5A2QK 3HTSB 2QVOA 3IRRA 4UHTA 4L9NA 5E1WA 4L5JA 2ZMEA 4AVPA 5BQTA 5L3GA 4WXHA 5FO5A 4MQVA 3BY6A 3R0JA 3Q5FA 5L3CA 1Z91A 3QU3A 2D1HA 5D8LB 1SFXA 5KVRA 4IHSA 2OD5A 4RAYA 2PQ8A 3GFIA 4FX4A 2Z5UA 5D5XB 3WTXC 4I98B 1PDNC 5H6QA 5AIQA 3H92A 3CLOA 3GVAA 1KU2A 5BOXA 4GCVA 3BROA 2DU9A 3F6VA 3N97A 3CUQC 3CUOA 3SQNA 2EA4A 1E2XA 3SFZA 2MC3A 2RV8A 4UXNA 2KRFA 1UCRA 1FLIA 2L54A 3R60A 3HHHA 3LAJA 3AAFA 3GYHX 1ZG1A 1YTYA 4KN7X 4KYWA 2F5EA 5J6XA 3NEUA 1H0MA 3LAPA 1ZG3A 1AWCA 1SMYF 1P4AA 3F6OA 1R1TA 1O3TA 1U5TA 1KA8A 4YIIA 4HLYA 3CJNA 3W6JB 4CHUA 1ZLKA 2MLGA 2A6HF 1XSVA 2MA3A 3F21A 4G7OF 1UHWA 1LEBA 1TQIA 4Y17A 3EYYA 4RS8A 3ZMDA 3K2ZA 2HYFA 4IVNA 3Q9VA 2W57A 2Q2EA 4FHTA 1WSUA 2P5VA 4BAYA 3DQVC 3EDPA 2OQGA 2DT5A 2Y0MA 2ZO4A 3J81K 5HDGA 5LHHA 4Z2YA 2AS5F 5CJ9A 2ACJA 1I5ZA 2BV6A 4N9HA 3W6KB 2H27A 2EFWA 3BOQA 1FP2A 1DPRA 3QPHA 2Z99A 3WU1B 1XMKA 1FYKA 2G9WA 4KMUX 1BJAA 4EJTA 1FSEA 4XSXF 3ZMSA 1FP1D 4OINF 5FD5A 3BWGA 4HX7A 1FYLA 3HRMA 1DUXC 4CDGA 2WTEA 5JFRA 3FX3A 2L4AA 1REPC 5D6FA 2E1CA 3PQJA 3FXRA 3KLNA 1KU7A 4ESJA 5ICCA 1G3TA 1U6GA 2XASA 3FMQA 5LRRA 4ESFA 4M73A 3L7WA 2FSWA 4B09A 2DK8A 5LLQA 3EQLF 2PG4A 2YSRA 2F5FA 5JR3A 1BIAA 1TTYA 1R1UA 3RPQA 1O3QA 3TO9A 4LG0A 4RB2C 2XAHA 1FT9A 1TLHB 3R0AA 2YX7A 4ETSA 1R5HA 2Z3YA 2FXAA 2GQQA 3M8FA 2J5OA 2EFNA 3M7GA 1K6OA 4RB1A 5LEJA 3N4MA 3OV8A 2Y75A 2PI0A 3ZMUA 4RGSA 3P9CA 2HKXA 2DTRA 3IWFA 2R3SA 3I64A 2OU2A 2CQKA 4WXDA 2NAZA 4PZJA 2COMA 3WE3A 1Z7UA 2P4WA 3ZQ7A 4MHGA 2QUFA 4XRFA 1WI9A 2VXZA 1OKRA 1G3WA 4OU0A 5J8CA 4RAZA 5AIPA 2EV6A 4EVIA 3FM5A 5IT3A 1K78B 1CGPA 1R58A 3I59B 4GGGA 5F64A 1FBSA 4BNCA 2F5DA 1SD7A 3EUHA 3K1MA 4L9TA 2JSCA 4XLPF 2ISYA 2FBHA 4L0ZB 2PEXA 3DEUA 1LNWA 5ILSA 4UVAA 4K2EA 5DUKA 1HW5A 1IRFA 5HDNA 2V79A 5EEGA 1RZ4A 1TW3A 2KIFA 3KFWX 4KDPA 5IT9Z 2ELHA 5ERIA 1HXDA 1Z6TA 3OOPA 5AONA 2M1BA 2A61A 4RGXA 3TDZC 3JAMK 2STTA 3CTAA 2YX4A 2QBYA 2IRFG 2CGPA 3E6MA 3E3VA 2GIVA 3GW2A 5JHUA 3V7CA 3HRSA 3CO7C 4N0BA 2FNAA 3TDUC 1JE8A 4A12A 1U5TC 2RVCA 2E1NA 1FX7A 1B9NA 4KIGA 2QENA 4LLLA 2RC4A 1TW2A 1G3SA 5DCMA 4AIHA 3KLOA 1YS7A 3ECHA 2R7FA 4Y15A 3D0SA 1R36A 2H6BA 2W25A 3Q9SA 3ZPLA 3KP5A 3WODF 4LLNA 2XUBA 3K9TA 1BBYA 3HSFA 4H0EA 1IAWA 4HLXA 1FOKA 1C0WA 3GUDA 4MQ9F 1EV7A 1J59A 2A07F 3WTWC 4JK1X 4KNYA 5BPDA 3HHGA 2FQ3A 2A3SA 5L3FA 2VOPA 4XLNF 3VOEA 1STZA 2P5KA 3GFLA 2GAUA 1JGSA 4ZZLA 4HZFA 3QP6A 1OYYA 5ILUA 4ENNA 2L02A 5D8KB 1FC3A 3JTHA 2LF7A 3HIFA 1MJBA 2PLYA 1LJ9A 4I0AA 2ISZA 2W24A 1LDJA 2VBYA 2O61A 4MEYF 1ODDA 1T39A 3LWFA 4YFNF 1IUYA 3LFKA 5CVRA 4DQ2A 3P9KA 4WK8F 2FMYA 1W5SA 4KIBA 4G94A 2BBYA 4IRIA 1U3EM 3FZVA 2E7XA 1ZREA 2WWYA 4HF2A 1FYMA 2KJCA 4GYGA 4PGHA 3L09A 2GA1A 4G7ZF 5E8IA 2F5CA 3MEXA 2P7CB 1USTA 2CW0F 1S29A 2P6SA 3V7RA 3ISPA 3GEZA 1O57A 4BHPA 1GHCA 4KIFA 1XGSA 3WGGA 1B4AA 4HQEA 4Y13A 2F2EA 1D3YA 2VC1A 3DPLC 3ABUA 2L3DA 1HQCA 5D4RA 3V7SA 1ZARA 2EFOA 2HEOA 1J2XA 4IJAA 2ZCWA 2KKOA 1T38A 3I54A 2LDUA 2M8EA 2CWEA 3T5XA 1Z1DA 4A6DA 1RNLA 5K5QA 4U7BA 3I71A 4KA4A 5K5RA 2B0LA 5D6EA 4LK0F 2JT1A 1FY7A 4ENMA 4WX9A 2UXXA 2VBZA 2E7WA 5DUIA 2RGVA 2QQ9A 5LHIA 3I53A 1YW8A 3I4PA 1W4MA 2HQRA 1OYIA 4LFUA 4R79A 4UV9A 3FXUA 1SAXA 1PP8F 1P2FA 4UVCA 2OAZA 3RKXA 4L9JA 4WXCA 1MD0A 2A6EF 2H09A 2IPQX 2ADUA 2V6CA 3F72A 3TKYA 3QP5A 5HLGA 4YIFA 4Q5SF 2DPDA 3ZN1A 4ZH4F 1B6AA 1KU3A 4M71A 2JZYA 3VODA 2XROA 5CYVA 4I2OA 1BN5A 3IHUA 4Q47A 4U0WA 4ZYGA 1YYVA 4LB6B 2OZUA 1MZBA 1MGTA 2BYVE 1ZRDA 3ZMTA 1DP7P 1ZAOA 1S6LA 5DDGA 1IXRC 1YIOA 4HV5A 1HKSA 2EFPA 3E6CC 1BC7C 1D8JA 2HWVA 4EGYA 4MEXF 2A69F 1GXPA 3TOAA 4WCGA 3DF8A 2K86A 5CVUA 1LDDA 3DFGA 3KEQA 4A6EA 1K79A 2O0YA 3GXOA 3KP6A 1F5TA 3F23A 5D5VB 3IWZA 3KP7A 1I27A 3ZP5A 3FMRA 4R1HA 1W7PB 2D1VA 3R6SA 1B9MA 2IP2A 4WWCA
chains in the Genus database with same CATH superfamily
1KQ9A 2MYSA 4M3EA 4MLOA 4DBQA 1HSTA 2X1EA 3LMMA 1YO5C 2IJLA 2YS9A 3ERED 2CO5A 2UWMA 5EGOA 1Z05A 1NHAA 3H3ZA 2VE8A 4HOBA 3RYPA 4JBAA 2Q0OA 3PQKA 2R7ZJ 4CCMA 3GX4X 3TEDA 1XGOA 2P6TA 4C2UA 2L2OA 1BI0A 3TW6A 1BR4A 4PCQA 1UJ8A 1B1BA 2IVMA 3I4NJ 3QPTA 1P7IA 3LSHA 2GXGA 2DYSH 4A3MJ 3E5QA 4ZYEA 2VBWA 4P9UA 2X0LA 1IZ1A 4JQFA 4GFBA 1Z77A 2HVRA 2O3FA 3DXJF 3SYTA 2WAQA 4HQMA 2BY1A 4CCLA 4KICA 5D5WB 2GLOA 1J7KA 2O9LA 1WRJA 3VSLA 2BEOA 4PJJA 2M7AA 5FLXK 2IGKA 1OCZH 2XIGA 3BZ6A 3M8EA 4M72A 3J80Z 4NBQA 3B73A 1J9IA 2IW5A 1AKHB 3WTSC 1D5YA 2M5WA 1A6IA 1IXCA 1HCRA 4NUBA 2EQRA 1QGPA 1IF1A 4BE1A 3E5UA 1RESA 2NNYA 3K4MA 3DKWA 2Y2ZA 5M5XJ 1OMIA 2W00A 3S2WA 3JSPA 3BPXA 3A2KA 2R7OA 3BPVA 2VXDA 3AG2H 3ZMVA 1SD6A 4U7DA 2HFHA 1T0FA 2TDXA 3V8KA 4BU2A 5E3NA 4IQJA 3PSIA 3M4OJ 3QOEA 1YW7A 5F6FA 2MC4A 3TGNA 1B72B 2R7SA 3K0LA 3GFJA 2JRMA 2HTJA 3R61A 3OWTA 2FJ1A 4F93B 1WKMA 3RKYA 4AIDA 2VKVA 2FE3A 2E71A 3CDIA 5E3MA 4AIKA 2HOTA 4D0PA 5CVJA 1ZGJA 3K70C 5FLVA 4E7SA 1H9GA 1KYZA 3W3CA 5FRNA 1ZHFA 2JA8J 2W4SA 4EQQA 1ZR4A 3HRUA 3L2VA 2HDCA 3SZGA 5EF6A 1U8RA 3GTOJ 1X2MA 1XCBA 2IGMA 1MBEA 5CLSA 4F3QA 2BVMA 5ICFA 1TWGJ 5GPCA 3T8TA 2LNBA 5JVTA 1WZ2A 3K1NA 5GAHJ 3NQOA 3HKZN 1K78A 3ASOH 4PFOA 1T6SA 2O7OA 2CSOA 5J1UA 1FWZA 1Y1VJ 3LQQA 2ECCA 4BYYA 1LVAA 4CCOA 3WU2C 1O7FA 2KDOA 2MFZA 1X4PA 5KK1A 1HW1A 3OY9A 3MFKA 2G7UA 4LOCA 1JT6A 5HVQC 4ZTFA 1H9TA 2IA1A 3K6GA 4E7LA 3OIOA 5DD8A 1MDMA 5A2QZ 3K4BA 5KCMA 3HG9A 2HR3A 3KX2A 3WTYC 5EZGA 3BG6A 3B6AA 3KPHA 1E3HA 4A0XA 3F8CA 1HW2A 1TWAJ 2RKHA 3RI4A 3DTEA 1OYWA 3KP2A 1YIJI 3N05A 4RM2A 3PIPF 4ZC3A 1AHDP 3IRQA 4BEHB 2L7KA 4LIVA 4A3KJ 5JI6A 3HEFA 4AUXA 4C3IJ 4QIWN 3Q0WA 4L5IA 2K4BA 2VJIA 1G2HA 2W7NA 4DOZA 2MBFA 2O6GE 2LR8A 1FEXA 1IXSB 2XAFA 3ECOA 3GWZA 4CYCA 2LKPA 3TP3A 1YX3A 3DU5A 5DEQA 2NVTJ 2K5CA 5C4JJ 1CF7B 4B44A 3J7AY 1S9HA 1FIAA 3ZXSA 3KE2A 1ZG5A 4M6VA 1MJAA 3Q0VA 2K3FA 2FRHA 2HQNA 1T95A 2CU7A 3RTRA 1ULYA 1V4RA 1X1CA 1Y6IA 3JRCA 1OPCA 2VKHA 2VT3A 3T8RA 1IN5A 3I5UA 4XR6A 4CH7A 3ESWB 3LQRA 2LF8A 2XGCA 4FX0A 1T2KA 1W5CC 2VJ5A 2KLOA 1N78A 3QRFF 2QA4I 2DBBA 3QOPA 3FDYA 4UUTA 2VQCA 2FMLA 1W36D 3FMSA 2XKOA 3E6BA 4G9YA 2PJPA 1VNDA 2DA3A 2RQQA 3F3XA 3QYBA 1J0RA 3HUGB 1YJWI 3DU6A 3H35A 3QWLA 3PFIA 1UHMA 1X19A 1Z6RA 3M8JA 3K69A 3M9AA 3KCCA 2BW3A 5F0HA 1RUNA 1RETA 3DKXA 3E5XA 4NHJA 2NVQJ 3RQ4A 4C9YA 1ERDA 1IUFA 2G7HA 3BTJA 3IP4B 3K7AJ 4Y52J 1ITYA 5B66C 4Y7NJ 5F0CA 3C1DA 4KUMA 1P9QC 4KMFA 4YIRX 3CP8A 5K1YA 4CXFA 5KHDA 1G8XA 4XKCA 3S3OA 2E19A 3HSEA 4X0GA 3VB2A 3JRIA 5CVIA 2JN6A 3CUQB 4U0YA 5GAEJ 1K83J 2Y0SA 3H9GA 2KFDA 3COAC 4UV8A 5FFZA 3NWTA 4P96A 3IKTA 2BHZA 3LSJA 2EK5A 3CCQI 2UZKA 3QYEA 1FOYA 5LBQA 2NOGA 2WAFA 1U0JA 2R7DA 2QLZA 3HRTA 4NC8A 4HYEA 2IGOA 2R7XA 4LK1F 1X1BA 1YRNA 4O3MA 3DBRB 3BZKA 3BQYA 3F0CA 4A3BJ 5E20A 3J81Z 4B48A 1LUJB 2DK5A 3RYRA 4IQ4A 3A0BC 1UB9A 3HGYA 3K10A 5BMZA 4S04A 2E34A 1QNTA 1NG7A 5DTDA 2HU9A 4GYIA 3FBIB 3QPSA 2KZGA 1HDPA 2XV4S 4ASNA 2GOXB 3OS0A 3MKZA 4OOIA 2XVCA 1RIOH 2KZVA 3P7NA 3BG9A 1IN7A 4MGRA 1BIBA 1GUUA 2CRGA 1Z3YA 2L7MP 1AU7A 4A5MA 1A5JA 2O03A 3FWEA 1R71A 1YG2A 2Z16A 2PFBA 2UXNA 4TV7A 2IA0A 3ZQLA 3GO5A 3SEZA 2YPRA 5GAGJ 4UUSB 3SZTA 3L9FA 3T0YA 4U0VA 3H9JA 4JOMA 3MWMA 2IEKA 2OZ6A 2MD5A 1YS6A 1X4OA 4E4HA 2Z9OA 4R8HA 1MNDA 4U87A 4HX4A 4M3GA 1XSDA 3DTKA 1ON1A 1BOBA 3RKQA 3GF2A 4G6DA 1BA5A 2R7QA 3C18A 3I0TA 2DA7A 4JYKA 3PFYA 1FSHA 2LG4A 2OQRA 2VI6A 4O6JA 6PAXA 4F91B 1FBQA 5FD6A 3I58A 2WV0A 5CPRB 3BJ6A 4NC7A 5ILVA 3CP2A 1T0FC 1MKMA 1XD7A 1B8IA 1F36A 1JUMA 1YX5A 3JW4A 4YEJA 1Z9CA 4ESBA 2VC0A 2DAOA 4EM2A 2NNNA 4ZDOA 3WGIA 2A5YB 1OQYA 2I8DA 3OYNA 4D1QA 2MH9A 2DJIA 1QVUA 3K4KA 3KP3A 3QAHA 4NQWB 1ONVA 2DDBA 2JPBA 5E8GA 3CF2A 2Z1DA 2ZNYA 4X1EA 3GTPJ 4LIUA 4FISA 5FKLA 4S05A 1X3UA 3TBIA 1QPMA 4BHCA 4C2TA 5BS6A 1LKXA 5DYMA 1DU6A 2NS7A 2DMTA 2MSYA 1TBXA 1WJ5A 1HKQA 3E97A 3G3ZA 4M9XA 3KP4A 2EIJH 5IP6A 2V1XA 2H6CA 4BGDA 2EV5A 2OF7A 4E7IA 2VUMJ 1JHHA 4V2FA 2DFFA 4ZYHA 2CQNA 3GTJJ 2A68F 3V8JA 2KHMA 3PUFA 1EJ9A 1FTTA 3F8NA 2NRAC 2M7BA 3VYUB 2IS6A 3K70D 2L9RA 3SEQA 5E18F 3CCJI 2JPCA 2PMHA 2W82A 1GDTA 2XGXA 3ZR8X 3W2VA 3A03A 4L5EA 1PUEE 3BR5A 2ZXIA 2PBIA 1OCPA 3FF5A 3WE2A 4P55A 2RNGA 1RUOA 2BOLA 2XHKA 1IW7F 2WC2A 4I01A 2RNJA 4HV6A 2LK2A 2XDVA 3K2AA 1J09A 3E6DA 3H0DA 2BHYA 3OR1C 5IY5H 3ZMZA 4G12A 2CV0A 4Z6YA 5HLHA 3OYHA 2HOEA 2PMUA 4EGZA 1O3SA 1S3JA 3U1DA 5IYCJ 2FBIA 3PNTA 3H3UA 3HBLA 3WTUC 3H36A 3JTGA 3BR6A 5IOYA 1XDSA 2XF6A 2XKPA 5FKNA 3AL0B 2E2IJ 1AOYA 1XB4A 2OTJI 4V19K 2V6EA 1RR7A 3E7LA 5LGTA 3GTKJ 4U88A 3OYMA 2HTSA 3OYJA 5M3MJ 3C7JA 5FFXA 2GOMA 4P5OA 2HZDA 1XCVA 3BLYA 4A3FJ 3BG5A 3IKVA 3S17J 2JUCA 1QQIA 2K9QA 5H20A 3IC7A 4HNUA 2JWTA 4N9IA 1GV2A 3FBNB 3KZZA 1QO0D 4YFXF 1TC3C 2EJRA 4XM3A 1E0EA 4HDVA 3WTTC 5B1AH 2P8TA 3WTZA 4E7JA 4HW0A 3O8GA 1JUPA 2NS8A 3K4NA 2ZMEB 4HX8A 4BQQA 1A04A 3OS2A 3GFMA 5IYDJ 2CG4A 1D8KA 3OIPA 2EILH 4EM1A 2M45A 1X3WB 4OMYA 3BJAA 2ZNZA 2MH2A 5DD4A 5IT9K 1PUFB 3D5LA 3F8FA 3OYBA 1LDKB 3JSOA 1R49A 5F1JA 1ACIA 5HS8A 1VQPI 2V1UA 1LQ1A 1QRYA 2IS1A 1H88C 3JAMZ 2D5VA 4AWXB 4CGZA 3FXOA 1VQ8I 1JT0A 4BBSJ 3OYIA 4UVBA 4HF1A 5ED4A 3BCBA 3GCMA 1WH5A 3BTLA 4EJVA 3SJMA 4ZYDA 4EJOA 5D4SA 4ON0A 2CYYA 3H5RA 4A2UA 3CD6I 4RB0A 2F4IA 2UUZA 3HDDA 4MNUA 2ZSHB 4AD9A 4RGRA 1BI3A 1PP7U 1R00A 2PJRB 5E79C 2X85A 4I76A 4UB6C 4UUVA 2CJJA 4AYBA 4DYQA 2RN7A 2NOJB 4ENKA 5J8FA 3BDDA 4LGWA 2DFIA 3DCFA 1YFHA 4G6QA 5HDKA 2E1OA 2CQXA 5ICGA 3MN2A 1SANA 2JSPA 3RPUD 2QYOA 1B59A 3U2RA 3B02A 2CMPA 1GLNA 2LTPA 3Q3SA 3DWLE 2CUZA 2E1MB 4A0YA 2WY8Q 5F1RA 3MZHA 1BI2A 4XOPA 4JX4A 1XDUA 3KEYA 2GZWA 4G7HF 5C4XJ 5KAFC 3WTVC 1HC8A 3MCZA 3FXLA 4XSZF 1LVKA 3RPUA 1IN6A 5L3EA 2H8RA 4OIRF 3S93A 1YJ9I 2DPUA 1W7PD 1WH7A 2FF4A 1IGNA 2XAQA 2NVXJ 1KQ0A 2VN2A 5FROA 4OAZA 3TW7A 4B8XA 1BC8C 2RQPA 2V9VA 1IO2A 3G73A 2JRTA 4JP0A 2M4GA 2DT7B 3V4GA 1UAAA 1BL0A 2HYJA 2XF5A 3J7YJ 2KIUA 3L2QA 4ENJA 4W1UA 1XPXA 1X2NA 4C2MJ 2WB1N 3VFZA 1W7PA 3FHZA 1T33A 3HSRA 1U5TB 5J47A 1K4TA 2EV0A 2YU9J 4M9SA 2RDPA 5EEHA 4A3LJ 2AXLA 1MMSA 1WQ2A 3KZYA 3O6BB 3BT9A 3O3KA 5DV5A 4XORA 2QM3A 2R5ZA 1X58A 1DP3A 4MO7A 1EH8A 4P9FA 4XMYA 2Q1ZB 1JHFA 2M0MA 2OA4A 4PFPA 2VKDA 3LNQA 2VL8A 3MD2A 1U2WA 4IXAA 3BG3A 2FX0A 4IRHA 1XGMA 2Q2EB 3TOBA 3LSKA 4XOTA 3H0GJ 2L7FP 4HDUA 1D0XA 1R22A 2ZKZA 4DGWB 1IRGA 4F7ZA 3BG7A 5EZHA 1N75A 1V54H 1RC9A 1MMNA 2ELKA 5DCFA 2CW7A 1MIJA 2DI3A 1NH3A 2M34A 4XBFA 2DQRA 4J00A 4L9VA 1AA7A 2R93J 3IV5A 2OJED 3CZ6A 1USSA 2RREA 2HVQA 2DODA 2HZTA 3RJPA 1OFCX 1ZN2A 2LKSA 3JRBA 1FNNA 2R5YB 1TQPA 2ESNA 1I50J 4I02A 1ETYA 2NS0A 4HSRA 1NK2P 2HGCA 1KGSA 3HYIA 5FB2A 2CFXA 1SEUA 4OIPF 2VQLA 3S1NJ 1Z7LA 2P0WA 1IN8A 2LBFA 3K1PA 1D1BA 1SD5A 1FPQA 2P5LC 3K4JA 1OR7A 3VSKA 2L0KA 4YFKF 1PJRA 4CZZA 1QVTA 3GLXA 5HNFA 1TWCJ 2ZFWA 4I0BA 2MABA 2L4MA 5FKKA 1SC7A 5F04A 5K5OA 3BP8A 1X1DA 5E1XA 4OIQF 1TNSA 3LSIA 1U78A 2FEZA 2ETHA 1YLFA 1ETWA 4CYDA 3RDIA 5B5EC 3RKWA 4DIQA 3DPTA 2FNPA 1NG6A 3HOWJ 1L3LA 1ETOA 5FLMJ 1B72A 3TO6A 3LSPA 3OYKA 2LMDA 4UB8C 2DMUA 1KZHA 2NVYJ 5BPIA 3DV8A 4GRIA 4KJZA 3CLQA 5DM7F 1XSXA 2X6OA 4M9ZA 3CDLA 1XMAA 3ELKA 3NRVA 1MH4A 4QSHA 3S2DJ 4YG2F 5JHFA 5TRDA 3VYRB 5HLTA 5C44J 2DLLA 3NARA 4A69C 3DKYA 2ZJ2A 1IN4A 3RCOA 2ZJQF 4B4CA 1UMQA 1LFPA 5LGNA 4DNCA 1WCMJ 2E5NA 2H94A 3ABTA 4CZCA 5LHGA 3GBGA 1MSFC 3FM3A 2WAQN 4HPQA 4ITVA 1A31A 4LG0B 2JTVA 4PGGA 3DLAA 1OCTC 1YQAA 5EEAA 1QBJA 3CO6C 2XGDA 1MW7A 3HTUA 1F1ZA 1HA8A 5E3LA 5E17F 5CQEA 2M30A 1I1SA 2HQAA 5IYBJ 2W1OA 3I59A 4IHTA 4QLCU 2PN6A 3BCAA 2K9NA 1S7OA 5TJJA 2JA7J 5HOOA 1W0UA 2Y30A 2FBKA 4HA8A 1YW9A 1XN7A 4IF4A 1SVLA 1JJ6C 2Y31A 3FK7A 1XGNA 5HS9A 3HPGA 4BQAA 4BH9A 2BXZA 3WG9A 3WGHA 3TQNA 3L00A 2P7VB 4M74A 5E1ZB 5B3SH 3LA3A 1ORKA 4KT5C 4LMYA 4BJTA 2DQLA 1LE8B 4BEHA 1KU9A 5EDNA 3MAJA 1ETQA 4LLGF 3F22A 2BXYA 5IOZA 1G4DA 1QZEA 3LL7A 3BJOA 1EF4A 2K4JA 1GV5A 1NK3P 1L0OC 1WWXA 2EA2A 2J5PA 4WF2A 1ZYRF 3EYIA 3SZPA 1R1VA 3IH4A 3ZQCA 5L3BA 1VFCA 1BI1A 4CCKA 1G6NA 2JQ7A 1J75A 2QZ8A 2KPMA 3BTIA 1CF7A 3IUOA 4XNFA 4IHVA 2QKMB 1P4XA 4BBRJ 1DPUA 3I4MJ 4B43A 1A6QA 1T56A 1MDMB 2GA2A 3HOUJ 2M0CA 2N8GA 4IX7A 3LSGA 2EFQA 1EH6A 4E7ZA 2VBXA 2KJBA 2ZXHA 2EZKA 2MD0A 3CCEI 3C3WA 3ERMA 1Y39A 4RB3C 1VF9A 2V4JC 3OR2C 3HJEA 2ZB9A 4MTEA 4F52A 1D5VA 4PDKA 2LSOA 4HAMA 4EJWA 1IRZA 2V1DA 2V9KA 2IA2A 1FZPB 4MFDA 2VOOA 2R4GA 1JTXA 2DOEA 1UELB 2BE5F 1P92A 1ZH5A 1TT5B 4HF0A 3HUGA 4LJZF 1RI7A 1JTYA 4HRIA 4LB5A 3CDHA 4E70A 3L2UA 2GXBA 1SFEA 2BGCA 1ZRFA 3REOA 1W5TA 5F08A 1A36A 2HYGD 1MSEC 1U8BA 3GLLA 2DO7A 3ULQB 3F8BA 5LEKA 4IEJA 3P5JA 2FOKA 2CFOA 1Y0UA 4O5VA 2IT0A 2ESHA 2OBPA 2V7FA 1YJNI 3GZNB 5D5UB 5LFAA 3JCUC 4EM0B 2GWRA 1O3RA 1IV8A 2GXAA 3J7AO 2XAJA 1N77A 1SMTA 1JI8A 4MTDA 2FA5A 2JA6J 3CUQA 4RMNA 4GO1A 2QBYB 3OSFA 3UKGA 2XC7A 3S3MA 3FXQA 1QZZA 2KL4A 2M87A 2W84A 3P9IA 4CSWA 2LREA 1HSJA 3F8MA 3R4KA 2DFHA 3EUAA 2DW4A 3MKLA 3SXYA 1S8NA 5JLWA 5HS7A 2Y9ZA 1I3AA 3JRFA 4A3GJ 1ZRCA 2Y48A 2VONA 2K02A 2QWWA 5K7ZA 5GTHC 4A3EJ 2VPLA 2ICWG 4OIOF 1DDNA 1W1WE 2D2WA 3EETA 3HOTA 1HKTA 1P6RA 4KN4X 4NC6A 4CICA 4IHYA 1IDYA 4A5NA 2Q8KA 1ZLJA 4II3A 2XRLA 4BUPA 4EV0A 1GXQA 4GXOA 4OMZA 3OYLA 3G1OA 5HLIA 2WADA 2ZBKA 3ZN0A 2I5UA 4IZZA 5DCMB 1UG2A 4I7HA 3PO3J 3GZ6A 3BR3A 4EJUA 1TQMA 3FKIJ 1P4WA 3U9GA 4BXUA 1KYWA 2EB7A 1QZYA 1X1PA 4HBLA 1DGWY 2HQ5A 3S3NA 3LA7A 3ML6A 2XB0X 3AG4H 1JXSA 2OPTA 4PSWA 1R5ID 3G1LA 3L2RA 5LRSA 3O2PE 4C30A 1R6RA 3M1EA 2Z33A 1ZGAA 2L5QA 4A0ZA 2VQGA 4AIJA 4UUSA 3AKZA 2E2HJ 3VEPA 4IRGA 5J3LA 1J5YA 2XRNA 3CESA 1EH7A 2L01A 1TNTA 1NTCA 1BW6A 4IL6C 3MZYA 2AO9A 5F27A 5ICEA 2AXTC 3DEWA 4BDYA 2VE9A 4NDLA 1I6XA 4G8XA 3RQIA 5M3FJ 3T1BA 5KAIC 2E5ZA 2Y0SN 1S7AA 3I55I 1OR7C 3ZGKA 1JKOC 3HOSA 2ZFUA 1YRNB 1SAUA 4PJNA 4BL0B 3LSTA 3WU0A 2ZC2A 5IPAA 3RIRA 2QQAA 1GVJA 1LB2A 1ON2A 4QTRA 1T98A 1GVDA 3EPZA 3ZQHA 4L0YB 4CO8A 5J4YA 4B47A 4Q4ZF 1Z3XA 4BXXJ 4M6XA 1X1AA 5H6RA 1V3FA 1HLVA 2QQBA 1SFUA 2VODA 1MMGA 1F4KA 2MG4A 4N4OB 3IL2A 2NYXA 3MQ0A 2EPFA 3WHCA 1LEAA 5CVVA 3HOVJ 5H2FC 5TISC 4KFCA 1I6HJ 5LGUA 1RPWA 4Q48A 1WJFA 4NQWA 2K9LA 1S5LC 3GZ5A 5FLXZ 4M3FA 1MH3A 1BM9A 3SFIA 2BZTA 1O7LA 3J80K 1R7JA 3GTGJ 4E6KG 4UNOA 3KEOA 4LD5A 3PL8A 4M6YA 4B3XA 2CQ7A 1G3YA 2KIMA 4ABZA 1F9NA 2VT2A 5FGMA 3V8LA 4X6AJ 3I9V2 1BOAA 2R7VA 4DJAA 1ZQ3P 3VYTB 4I09A 2FU4A 3MVPA 2K7LA 2LY9A 3L2WA 4BHBA 2W85A 1VTNC 3TO7A 3KETA 2YUSA 1K7AA 2DXIA 4IPAA 5L3DA 4NB5A 4G6TB 1Y56A 2K27A 4LITA 2STWA 1MBKA 5J40A 1WJEA 3CCVI 3HPHA 2HS5A 3LSMA 4II2A 3U1KA 1KQ8A 2XPUA 2ZXJA 4ZZDA 3KZIC 2EWNA 3DEEA 4L18B 4DZPA 1FBUA 3L2CA 3QU6A 3SHFA 3W2WA 3ABLH 2JVGA 2YU3A 3ROUA 4BQOA 1I1GA 4F92B 4QPQA 2DN0A 3PO2J 3HB9A 2HKOA 4EMSA 2B63J 2CUFA 1R5GA 2EH3A 1ZGWA 1JKPC 1E17A 2MLKA 3BTCA 3A1YA 2YR2A 4AC0A 1DU0A 2DA6A 1H8AC 2OC6A 3CMAI 4QWQA 4Y3OA 1SD4A 1VQ6I 4RGUA 2C6YA 3CCRI 1SFOJ 3LA2A 2X6YA 3DP7A 4DW6A 2M8GX 2XAGA 4J01A 4FT8A 2D45A 1R23A 3GTMJ 2O8XA 2FUG2 4BY1J 1TT0A 2ID3A 1HBXG 3I56I 3CQZJ 3JRAA 4IOAF 4PSXA 1UFMA 4NNJA 4DYRA 4BKXA 1MJ9A 1Q1HA 1UG0A 2X4HA 1XC5A 3CCSI 1KONA 5GPAA 5A2QK 3HTSB 4IHXA 3TMOA 3F9KA 2QVOA 3IRRA 4UHTA 1RKWA 3OSGA 4L9NA 1N25A 5E1WA 1MBJA 4L5JA 2ZMEA 2ZXWH 2DA2A 4AVPA 5BQTA 5L3GA 2HI3A 2L9VA 1Q1VA 2WA0A 1EA3A 2JK3A 4EEFG 2CW8A 2DMNA 1PUFA 1ZTRA 2F5VA 4WXHA 5FO5A 3G4SI 4MQVA 3BY6A 1RKTA 3R0JA 3Q5FA 3BZCA 5L3CA 1Z91A 1V55H 3QU3A 2D1HA 5D8LB 4WWCA 2KIQA 1SFXA 5KVRA 2ZJPF 2IS4A 5JVGF 1XMXA 3DBHB 4IHSA 2OD5A 1IG7A 4RAYA 2PQ8A 1G59A 4XKWA 1R4NB 3L1PA 3JREA 4BS9A 3GFIA 2GBYA 3G6EI 4FX4A 2Z5UA 5D5XB 3WTXC 4BE0A 2QEXI 4I98B 2VQHA 2KISA 2HOSA 1PDNC 5H6QA 5AIQA 2KMUA 3H92A 1ZELA 3CLOA 3GVAA 1TWHJ 1KU2A 2PJRA 1OISA 2ZJRF 2R92J 2IAIA 4GCVA 4FCYA 5BOXA 2DMPA 3BROA 4AVZA 2DU9A 3F6VA 1BR1A 3N97A 1XX5A 3CUQC 3IH2A 3CUOA 4BJ6C 4HNVA 4C3HJ 3SQNA 2EA4A 2NVUB 1E2XA 3SFZA 2MC3A 2RV8A 4UXNA 4E7HA 3CC2I 2KRFA 4XLCA 1UCRA 1YOVB 1FLIA 1HOMA 2L54A 2L7ZA 3HHHA 3R60A 3LAJA 3AAFA 3GYHX 1ZG1A 3HGGA 1YTYA 3A01B 2XSJC 2EZLA 2V26A 4KN7X 4KYWA 1OLTA 2F5EA 3ZQQA 1MBHA 5BNGA 5J6XA 1M1EB 3NEUA 1H0MA 3QYFA 3CCUI 2EBIA 1D1CA 5EG0B 4A3IJ 1MMDA 3ZCOA 3LAPA 2A05A 3BR2A 1K61A 1ZG3A 5DS9A 1AWCA 1UHSA 2BY3A 1FMVA 1SMYF 4RA2A 1IJWC 1P4AA 2LRDA 3F6OA 1WJBA 3JRHA 2PMZA 5E3OA 3E0JB 3ZQFA 4UY8I 1R1TA 1TWFJ 1O3TA 4PK4A 4BQNA 1MMAA 1U5TA 1KA8A 4YIIA 1QA6A 4HG2A 4HLYA 2EZIA 3CJNA 3W6JB 4CHUA 1ZLKA 2MLGA 2A6HF 3B6CA 3DPUA 1XSVA 2MA3A 3F21A 4G7OF 1UHWA 1LEBA 1TQIA 4Y17A 1E3PA 1MNMC 1SFKA 1FTZA 3EYYA 4RS8A 3FKJA 3ZMDA 3GTLJ 3K2ZA 2HYFA 4IVNA 3Q9VA 2LOOA 4MIMA 4ZDPA 3FISA 2W57A 2Q2EA 2WY7Q 4FHTA 1WSUA 3AFHA 2CV1A 2P5VA 4BAYA 1Y0NA 3DQVC 4D5CA 4AYBN 2E36A 3EDPA 2OQGA 2DT5A 2G0EA 2Y0MA 3UNGC 3S15J 2VIXA 2LFBA 2V9PA 1OCRH 1QPIA 2ZO4A 2HXIA 3J81K 2QKLB 5HDGA 3A0HC 5LHHA 4Z2YA 2DJNA 2AS5F 4BE2A 5CJ9A 2ACJA 2E60A 1I5ZA 5CKTA 2BV6A 4N9HA 3W6KB 2H27A 3PIOF 3H1CA 2EFWA 3SDBA 3BOQA 2DYRH 1FP2A 3A02A 4XRMA 1BJZA 1DPRA 3QPHA 2Z99A 3TP0A 2MGQA 2X6XA 3WU1B 3CC4I 4RAGA 1XMKA 2XPVA 1MNEA 1FYKA 2JA5J 2GM4A 1XTAA 4W97A 2G9WA 1JKRC 4KMUX 1V5EA 3HC7A 1BJAA 4EJTA 1FSEA 4XSXF 2E2JJ 3ZMSA 1EKEA 2LY2A 1AKHA 1FP1D 4OINF 1ZK8A 3ZQGA 5FD5A 3RZOJ 3CJRB 1Z0XA 4QPOA 3BWGA 4HX7A 1FYLA 1MBFA 2KRCA 3KYLA 3HRMA 1DUXC 4CDGA 2WTEA 5EGOB 1K6YA 5JFRA 3FX3A 2L4AA 1REPC 5D6FA 2E1CA 3PQJA 3G2BA 3FXRA 3KLNA 4F55A 1GT0C 1F43A 1ENHA 1DQUA 1KU7A 4ESJA 5ICCA 1G3TA 1U6GA 2XASA 3FMQA 5LRRA 4ESFA 3OYCA 4M73A 2JA2A 3L7WA 1DGRM 2FSWA 3M07A 4B09A 2DK8A 5LLQA 2HDDA 3EQLF 3HKZA 2LBFB 2PG4A 3ASNH 3PUBA 2YSRA 2F4OB 2F5FA 5JR3A 1BIAA 1TTYA 1TP4A 1R1UA 3RPQA 1O3QA 2KP6A 3TO9A 2R7RA 5M5YJ 3IAM2 4LG0A 4RB2C 3CMEI 2CUJA 1QHHD 2XAHA 3NAUA 3HM5A 3CJQB 3LOCA 4PJLA 1JJ8C 3AL0C 3FXMA 3WG7H 2DCEA 2K85A 1FT9A 1TLHB 2OUMA 1R4MB 2HPIA 3R0AA 2COBA 2CH0A 5FJ8J 3FK6A 2R0QC 2YX7A 3ZQIA 2DOFA 4XLFA 3ABKH 4XLEA 4ETSA 3BC8A 1R5HA 5M5WJ 3PSFA 4XONA 4J19A 2Z3YA 2FXAA 2GQQA 3M8FA 1VQLI 3TL4X 2J5OA 2EFNA 1VQKI 4BACA 4CA0A 3M7GA 1K6OA 2EINH 4EATA 5LEJA 4RB1A 5C3EJ 3OV8A 3N4MA 2Y75A 3JR9A 2PI0A 4RGSA 3ZMUA 3P9CA 2HKXA 2DTRA 4PUSA 3IWFA 5J4VA 4FTHA 1LE8A 2R3SA 3PJRA 2WBMA 4IO9F 3I64A 2OU2A 2CQKA 4WXDA 9ANTA 2NAZA 3CMMA 4PZJA 5J1YA 1P7JA 1FIPA 2COMA 3WE3A 1Z7UA 2P4WA 2FQ4A 2ZMEC 2WV1A 3ZQ7A 2A6TA 4MHGA 2QUFA 3OL4A 4XRFA 1WI9A 2VXZA 1S72I 1OKRA 4ZDLA 1G3WA 4OU0A 5J8CA 4RAZA 5AIPA 2EV6A 4EVIA 1V5GA 3FM5A 1VQ7I 5IT3A 1K78B 1CGPA 1R58A 3I59B 4Y33A 4GGGA 1YHQI 4BY7J 5F64A 1FBSA 2JVHA 3VWBA 4BNCA 2F5DA 3ABMH 3BR0A 1SD7A 2LYCA 3EUHA 3K1MA 1T8IA 4AU7A 4RLFA 2DA5A 3J7ZI 2JMWA 2JSCA 4L9TA 4XLPF 3OYEA 2ISYA 1JKQC 2FBHA 1D1AA 2JUGA 4FQGA 4BJ5C 4L0ZB 2PEXA 3C2GA 3DEUA 1Y8RB 1LNWA 5ILSA 3M3YJ 4UVAA 2A5WA 1WFXA 1FOWA 2ECBA 2KQRA 2VJJA 4RDUA 3FXJA 1H89C 3WHBA 4K2EA 5DUKA 1HW5A 1T08B 1IRFA 1YI2I 5HDNA 5IP7J 2V79A 5EEGA 1RZ4A 1TW3A 2KIFA 3KFWX 3KYCB 4H4KC 3HOZJ 4KDPA 5IT9Z 2ELHA 5ERIA 5K7HA 1HXDA 1Z6TA 3DLLF 3HXLA 2V1NA 2E1MC 1IRXA 2DFEA 5K7FA 3OOPA 4PJMA 5AONA 2M1BA 3HOYJ 1ETVA 2A61A 2XF7A 3S14J 4RGXA 3TDZC 3JAMK 4N4NB 2STTA 2ELJA 2H8WA 3CTAA 3E1SA 2YX4A 4CYCB 3RSNA 2QBYA 2IRFG 3W6VA 3LFUA 4XKBA 2CGPA 3E6MA 3E3VA 2GIVA 3GW2A 3S8PA 5JHUA 1OJLA 3KYDB 1LFUP 3V7CA 3HRSA 2X51A 3CO7C 4N0BA 2FNAA 3TDUC 1JE8A 2LC2A 1WPKA 2BVLA 1HDDC 4FETA 2HOAA 4A12A 1I3QJ 1U5TC 2CQQA 1U9OA 3OS1A 2UV1A 4LG3A 3JRDA 2RVCA 3OYDA 2E1NA 1SVMA 1FX7A 1B9NA 4KIGA 4HNTA 2QENA 4LLLA 3FXKA 2RC4A 4Y4RA 1TW2A 4XRSG 1G3SA 5DCMA 4AIHA 3Q0UA 3KLOA 2FD5A 1YS7A 3NWSA 3VDXA 4D7NA 1WJDA 2QGUA 3ECHA 1VQ5I 2R7FA 4Y15A 3D0SA 1PYVA 1R36A 2AQFA 2QCOA 3DBLB 2H6BA 2W25A 3Q9SA 3FIWA 3ZPLA 3KP5A 3WODF 5FRMA 3G1MA 4LLNA 2BW3B 2XUBA 3K9TA 1BBYA 2HXOA 3HSFA 2CS3A 4H0EA 1WHUA 3CCLI 2B7EA 1IAWA 3EUKL 4HLXA 1FOKA 3GTQJ 2XGEA 4JX6A 1U9NA 1C0WA 2OV7A 3IAS2 3GUDA 1WJCA 2AQEA 4MQ9F 4JX5A 1EV7A 3BQZA 1TL8A 1IC8A 1J59A 4M3DA 2A07F 3S1QJ 3WTWC 1OCOH 3OL3A 1TZLA 1VQMI 2TCTA 4JK1X 2E35A 3IH3A 1Y8QB 1QU3A 4KNYA 3RZDJ 5BPDA 3HHGA 2FQ3A 2A3SA 5IP9J 3VPRA 1FMWA 2I10A 5L3FA 2X1DA 2VOPA 4GDFA 3H5NA 3BR1A 4XLNF 5FKOA 2OCEA 2O5RA 3VOEA 1STZA 2P5KA 3GFLA 2GAUA 3OYGA 1A35A 2QSHX 4I99C 3H5AA 1JGSA 4ZZLA 3S32A 3X2QH 4HZFA 1ETXA 2X1CA 3QP6A 4ZYAA 1Y1WJ 2VJ4A 1OYYA 2RAEA 2M9HA 3O8HA 3ZRGA 5ILUA 4ENNA 2L02A 5D8KB 4D5FA 1FC3A 3JTHA 2LF7A 3HIFA 4A3DJ 3HOXJ 4IKFA 3AG1H 2XAUA 3QPLA 1MJBA 3ZOBA 2M3AA 4CUGA 1SVOA 2PLYA 5GTIC 1LJ9A 3OIQA 1QHGA 4BXFA 1VI0A 4I0AA 3U21A 2ISZA 2W24A 1LDJA 2VBYA 2O61A 4MEYF 1XS9A 1ODDA 4IHWA 1T39A 1Z21A 3LWFA 4YFNF 1IUYA 3OOUA 3S1RJ 3LFKA 2IXSA 5CVRA 4DQ2A 2R7UA 3P9KA 3MZ8A 4WK8F 3MKYB 2CV2A 3OMYA 2FMYA 1E3OC 3JRGA 1W5SA 2FOWA 4MFEA 4KIBA 3CCYA 2K9SA 4G94A 3I3LA 4XK4A 2BBYA 2WAEA 4A3CJ 4IRIA 4HEA2 1U3EM 3FZVA 2E7XA 5JLXA 1S7EA 5TGTA 1ZREA 2R7WA 4RM3A 2WWYA 4HF2A 1FYMA 2KJCA 2JJ7A 2Z2SB 3VYSB 1IV6A 2F48A 5F0FA 2MW8A 2X48A 3S2HJ 2XB5A 4GYGA 4PGHA 3L09A 2GA1A 4D9JA 1I39A 4DZJA 5E8IA 4G7ZF 2F5CA 1B8IB 1JGGA 3MEXA 4C3JJ 4I6ZA 1D0ZA 2P7CB 1USTA 3ONQA 2CW0F 3V42A 2XSDC 1YE9A 1S29A 2DOAA 2P6SA 1ETKA 3V7RA 3ISPA 2O8KA 3GEZA 2EZHA 1O57A 4BHPA 1GHCA 3OYAA 1RRJA 4FE4A 2B9SA 3C2HA 4KIFA 1WI3A 2LP0A 1XGSA 1PVEA 3QODA 3WGGA 4DYCA 1B4AA 2HNHA 2K9MA 5FKMA 1UZCA 4HQEA 4Y13A 2F2EA 1D3YA 2HDWA 3OYFA 2VC1A 3DPLC 3ABUA 2VPRA 1W0TA 3PNVA 2DMQA 2L3DA 1HQCA 5D4RA 3CCMI 3V7SA 1ZARA 3W2AA 2EFOA 2LLKA 1J2XA 2HEOA 2W48A 2VASA 2AHQA 3CJTB 4IJAA 1POGA 3EUHC 2ZCWA 2KKOA 1T38A 1OCCH 3I54A 1HF0A 1D0YA 2DA1A 2LDUA 1RR8C 2M8EA 2CWEA 3T5XA 1VQNI 1BW5A 3K4CA 1Z1DA 3PM1A 4FE7A 5EYRA 2EIKH 2L9SA 2VKEA 2BY2A 4CCJA 4IOCF 4HSTA 2TRTA 3M1CA 2H1KA 4A6DA 3C2BA 1O4XA 1RNLA 4OWRB 5K5QA 4S0HB 4U7BA 3FHNA 3I71A 2LD5A 4KA4A 4A3JJ 2ME0A 2XPWA 4ZTJA 4PJ0C 3AG3H 1VQOI 5K5RA 1Z67A 2B0LA 5D6EA 2EIMH 4LK0F 2JT1A 5LD2C 1FY7A 4E7KA 4ENMA 4CCNA 2ID6A 2Y69H 4M3BA 2K3PA 2GIZA 3D5RC 4WX9A 1R9TJ 2UXXA 2VBZA 3PNYA 2E7WA 1BR2A 4B1RA 4XIDA 1XG1A 3CMYA 2IGNA 5DUIA 4KISA 2RGVA 2DT6A 2KRHA 5GADJ 2X9DA 4DBRA 2QQ9A 5CQGA 5LHIA 3I53A 2K40A 2NXNB 2M4KA 3H9QA 1YW8A 4XQFA 4P1WA 5EJCA 3I4PA 1W4MA 2H1LA 4YRVA 2HQRA 1OYIA 4LFUA 4R79A 1JUSA 1LPQA 2CUEA 3MKWB 4UV9A 3FXUA 3GMEA 1SAXA 1VQ9I 1PP8F 1P2FA 3D1NI 4UVCA 2OAZA 1LFBA 2HVSA 3RKXA 3A01A 1FJLA 4L9JA 4XICA 4XL9A 4WXCA 1MD0A 2A6EF 4KITB 2DTZA 2H09A 2IPQX 2ADUA 5HNHA 3DTIA 2V6CA 3F72A 3KIOA 3TKYA 3QP5A 4XLHA 5EG0A 5HLGA 1MBGA 2BY0A 3QQAA 4YIFA 4Q5SF 2DPDA 3ZN1A 3LSRA 4ZH4F 5HODA 1B6AA 1KU3A 4M71A 3S1MJ 2QSFX 2JZYA 3VODA 4XN3A 2XROA 1W36C 1ZR2A 3A4CA 2WB1A 2M2EA 3D5SC 5CYVA 4OAYA 1V5FA 1IDZA 5KNLA 4I2OA 1BN5A 2R7TA 3IHUA 2DDAA 4Q47A 4U0WA 4ZYGA 4XRSA 1YYVA 2IS2A 4RAFA 4RLQA 5J1RA 3CC7I 4V2GA 2LVSA 4LB6B 2OZUA 1MZBA 4ZJZA 1APLC 1MGTA 2BYVE 2DA4A 1ZRDA 1X3ZB 5B1BH 3ZMTA 3SDGA 1VZ0A 2KDZA 4FASD 1DP7P 1ZAOA 1CQTA 2P81A 3MMYB 4ANJA 2Y9YA 1S6LA 2F4MB 3G71I 5DDGA 1WGXA 1IXRC 4XN0A 2IBDA 1YIOA 2QF7A 4HV5A 1HKSA 1K4SA 3H3VK 2EFPA 3E6CC 2LH9A 1FOXA 2X6WA 1BC7C 1D8JA 5DM6F 2F6CA 2VLAA 2HWVA 4XLAA 3CF5F 5GP9A 4EGYA 1WJAA 4RBOA 2A69F 4MEXF 3HL2A 1GXPA 1YITI 1ZKGA 3TOAA 4B3AA 4WCGA 3S16J 3DF8A 2QSGX 2K86A 2KT0A 2L9NA 5CVUA 1LDDA 1WVRA 2OTLI 3DFGA 3KEQA 4AM3A 4A6EA 1K79A 2O0YA 2LY1A 3GXOA 3KP6A 4KT6A 4BDZA 2VB6A 3HZJA 2R5YA 1F5TA 3F23A 5D5VB 3IWZA 3KP7A 4XKVA 2LKXA 2ME6A 1I27A 4A93J 2HPMA 3ZP5A 3FMRA 4R1HA 4YELA 2PX9A 1W7PB 2OCCH 2PMZN 1VQ4I 2D1VA 3R6SA 1B9MA 3UR3C 3K4LA 2IP2A 2ZSIB 4D7MA 2R5ZB 2QQ8A
chains in the Genus database with same CATH topology
1KQ9A 1HSTA 1YO5C 2IJLA 3ERED 2CO5A 2UWMA 1Z05A 1NHAA 3H3ZA 2VE8A 4HOBA 3RYPA 4JBAA 2Q0OA 3PQKA 3GX4X 1XGOA 2P6TA 1BI0A 4PCQA 1B1BA 2IVMA 3QPTA 2GXGA 3E5QA 4ZYEA 2VBWA 4P9UA 2X0LA 1IZ1A 4JQFA 2O3FA 3DXJF 4HQMA 5D5WB 4KICA 1J7KA 1WRJA 2BEOA 5FLXK 2XIGA 3BZ6A 3M8EA 4M72A 3J80Z 3B73A 1J9IA 2IW5A 3WTSC 2M5WA 1IXCA 1QGPA 1IF1A 3E5UA 2NNYA 3DKWA 1OMIA 3S2WA 3JSPA 3BPXA 3BPVA 3ZMVA 1SD6A 4U7DA 2HFHA 1T0FA 2TDXA 3V8KA 1YW7A 5F6FA 3TGNA 3K0LA 3GFJA 3R61A 2HTJA 1WKMA 3RKYA 2FE3A 4AIKA 4D0PA 5CVJA 1ZGJA 1H9GA 1KYZA 1ZHFA 4EQQA 3HRUA 2HDCA 1U8RA 1XCBA 5CLSA 5ICFA 5JVTA 3T8TA 2LNBA 3K1NA 3NQOA 1K78A 1T6SA 2CSOA 1FWZA 3LQQA 4BYYA 1LVAA 1O7FA 5KK1A 1HW1A 3MFKA 2G7UA 5HVQC 1H9TA 2IA1A 5DD8A 1MDMA 5A2QZ 3WTYC 2HR3A 4A0XA 3F8CA 1HW2A 2RKHA 3RI4A 1OYWA 3KP2A 3IRQA 5JI6A 4L5IA 2K4BA 2MBFA 2O6GE 1IXSB 2XAFA 3ECOA 3GWZA 2LKPA 5DEQA 1CF7B 3KE2A 1ZG5A 1MJAA 2FRHA 2HQNA 3RTRA 1ULYA 1V4RA 1OPCA 2VT3A 3T8RA 1IN5A 3I5UA 3LQRA 2LF8A 4FX0A 1T2KA 3QRFF 2DBBA 3QOPA 2FMLA 3FMSA 2XKOA 3E6BA 4G9YA 2PJPA 3F3XA 1J0RA 3PFIA 1UHMA 1Z6RA 3K69A 3M9AA 3KCCA 1RUNA 3E5XA 4NHJA 2G7HA 3C1DA 4KUMA 4KMFA 5K1YA 4CXFA 3HSEA 3VB2A 5CVIA 3CUQB 4U0YA 3COAC 4UV8A 5FFZA 4P96A 3IKTA 2EK5A 2UZKA 5LBQA 2R7DA 2QLZA 3HRTA 4HYEA 4LK1F 4O3MA 5E20A 3J81Z 2DK5A 3RYRA 1UB9A 5BMZA 4S04A 1QNTA 4GYIA 2XV4S 4ASNA 4OOIA 2XVCA 1RIOH 3P7NA 1IN7A 4MGRA 1BIBA 4A5MA 2O03A 3FWEA 1YG2A 2PFBA 2UXNA 4TV7A 2IA0A 3GO5A 2YPRA 3SZTA 3L9FA 3T0YA 4U0VA 3MWMA 2OZ6A 2MD5A 1YS6A 2Z9OA 4R8HA 4HX4A 1XSDA 1ON1A 3GF2A 4G6DA 3C18A 3I0TA 1FSHA 2OQRA 4O6JA 6PAXA 1FBQA 5FD6A 3I58A 2WV0A 3BJ6A 5ILVA 1XD7A 1MKMA 3JW4A 1Z9CA 4ESBA 2VC0A 2DAOA 4EM2A 2NNNA 3WGIA 2A5YB 2MH9A 3KP3A 3QAHA 1ONVA 2JPBA 5E8GA 2ZNYA 4S05A 1X3UA 4BHCA 1QPMA 5BS6A 5DYMA 1TBXA 1HKQA 3E97A 3G3ZA 4M9XA 3KP4A 2V1XA 2H6CA 2EV5A 1JHHA 4ZYHA 2A68F 3V8JA 3F8NA 2NRAC 5E18F 2JPCA 2PMHA 2XGXA 1PUEE 2PBIA 3FF5A 3WE2A 4P55A 1RUOA 2XHKA 1IW7F 2WC2A 4I01A 2RNJA 4HV6A 3E6DA 3ZMZA 5HLHA 2HOEA 2PMUA 4EGZA 1O3SA 1S3JA 3U1DA 2FBIA 3H3UA 3WTUC 3JTGA 1XDSA 2XKPA 1AOYA 1XB4A 5LGTA 4U88A 2HTSA 3C7JA 5FFXA 4P5OA 1XCVA 3IKVA 1QQIA 5H20A 3IC7A 4N9IA 3KZZA 1QO0D 4YFXF 2EJRA 4HDVA 3WTTC 2P8TA 3WTZA 4HW0A 2ZMEB 4HX8A 1A04A 3GFMA 2CG4A 1D8KA 4EM1A 2M45A 4OMYA 3BJAA 2ZNZA 2MH2A 5DD4A 5IT9K 3D5LA 3F8FA 3JSOA 1LDKB 5HS8A 2V1UA 1LQ1A 3JAMZ 4AWXB 4CGZA 4UVBA 4HF1A 5ED4A 4EJVA 4ZYDA 4EJOA 5D4SA 4ON0A 2CYYA 4A2UA 4RB0A 4MNUA 4AD9A 4RGRA 1BI3A 1PP7U 1R00A 4UUVA 2RN7A 4ENKA 5J8FA 3BDDA 4LGWA 2DFIA 1YFHA 4G6QA 5HDKA 5ICGA 2QYOA 1B59A 3U2RA 3B02A 4A0YA 3MZHA 5F1RA 1BI2A 1XDUA 2GZWA 4G7HF 3WTVC 3MCZA 4XSZF 3RPUA 1IN6A 5L3EA 4OIRF 2DPUA 1W7PD 2FF4A 2XAQA 1KQ0A 2VN2A 1BC8C 4B8XA 2RQPA 2V9VA 3G73A 2JRTA 3V4GA 4ENJA 2KIUA 3VFZA 1W7PA 3FHZA 3HSRA 1U5TB 2EV0A 4M9SA 2RDPA 5EEHA 2AXLA 1WQ2A 3KZYA 3O6BB 3O3KA 5DV5A 2QM3A 1EH8A 4P9FA 1JHFA 2OA4A 1U2WA 4IXAA 4IRHA 1XGMA 3TOBA 4HDUA 1R22A 2ZKZA 1IRGA 4F7ZA 5DCFA 2DI3A 4XBFA 2DQRA 4L9VA 1USSA 2HZTA 3RJPA 1ZN2A 1FNNA 1TQPA 2ESNA 4I02A 2NS0A 2HGCA 1KGSA 3HYIA 5FB2A 2CFXA 4OIPF 1IN8A 3K1PA 1SD5A 1FPQA 2P5LC 1OR7A 4YFKF 4CZZA 3GLXA 2ZFWA 4I0BA 2L4MA 5K5OA 3BP8A 5E1XA 4OIQF 1TNSA 1U78A 2FEZA 2ETHA 1YLFA 4CYDA 3RDIA 3RKWA 3DPTA 2FNPA 1L3LA 3TO6A 5BPIA 3DV8A 1XSXA 4M9ZA 3NRVA 1XMAA 3ELKA 4YG2F 5TRDA 2DLLA 2ZJ2A 1IN4A 5LGNA 4DNCA 2H94A 3ABTA 5LHGA 3FM3A 4LG0B 2JTVA 4PGGA 1YQAA 1QBJA 3CO6C 3HTUA 1F1ZA 5E17F 2M30A 1I1SA 3I59A 4IHTA 4QLCU 2PN6A 1S7OA 5TJJA 5HOOA 4HA8A 2FBKA 1YW9A 1XN7A 4IF4A 1XGNA 5HS9A 4BQAA 4BH9A 3WG9A 3WGHA 3TQNA 3L00A 2P7VB 4M74A 5E1ZB 3LA3A 4KT5C 4LMYA 2DQLA 1KU9A 3MAJA 4LLGF 3F22A 1G4DA 3BJOA 2K4JA 1L0OC 1WWXA 2EA2A 2J5PA 4WF2A 1ZYRF 3EYIA 3SZPA 1R1VA 5L3BA 1BI1A 1G6NA 1J75A 2QZ8A 1CF7A 1P4XA 1DPUA 1MDMB 2GA2A 2EFQA 1EH6A 2VBXA 2KJBA 3C3WA 4RB3C 4MTEA 1D5VA 4PDKA 2LSOA 4HAMA 4EJWA 2V1DA 2IA2A 1FZPB 2VOOA 2BE5F 1P92A 1ZH5A 4HF0A 3HUGA 4LJZF 1RI7A 4LB5A 3CDHA 4E70A 2GXBA 1SFEA 2BGCA 1ZRFA 3REOA 1W5TA 2HYGD 2DO7A 3ULQB 3F8BA 5LEKA 2FOKA 1Y0UA 4O5VA 2IT0A 2ESHA 2OBPA 5D5UB 4EM0B 2GWRA 1O3RA 3J7AO 2XAJA 1SMTA 4MTDA 2FA5A 3CUQA 4GO1A 2QBYB 3FXQA 1QZZA 2W84A 2M87A 3P9IA 1HSJA 3F8MA 3R4KA 2DW4A 3SXYA 1S8NA 5HS7A 1ZRCA 2Y48A 2VONA 2K02A 2QWWA 4OIOF 1DDNA 3HOTA 2D2WA 3EETA 1HKTA 1P6RA 4KN4X 4CICA 4A5NA 2Q8KA 1ZLJA 4EV0A 1GXQA 4GXOA 4OMZA 5HLIA 2ZBKA 3ZN0A 5DCMB 4I7HA 3GZ6A 4EJUA 1TQMA 1P4WA 3U9GA 4BXUA 1KYWA 2EB7A 1QZYA 4HBLA 3LA7A 3ML6A 1JXSA 5LRSA 3O2PE 3M1EA 2Z33A 1ZGAA 4A0ZA 4AIJA 3VEPA 4IRGA 1J5YA 2XRNA 1EH7A 2L01A 1TNTA 3MZYA 5ICEA 2VE9A 1I6XA 4G8XA 3T1BA 1S7AA 3HOSA 3LSTA 3WU0A 3RIRA 2QQAA 1GVJA 1LB2A 1ON2A 1T98A 4L0YB 4CO8A 4Q4ZF 4M6XA 5H6RA 1V3FA 2QQBA 1SFUA 2VODA 1F4KA 3IL2A 2NYXA 3MQ0A 1LEAA 5CVVA 4KFCA 5LGUA 4Q48A 4NQWA 3GZ5A 5FLXZ 1BM9A 1O7LA 3J80K 1R7JA 4UNOA 3KEOA 4LD5A 4M6YA 1G3YA 2KIMA 1F9NA 2VT2A 5FGMA 3V8LA 1BOAA 4I09A 2FU4A 2K7LA 4BHBA 2W85A 1VTNC 3TO7A 3KETA 1K7AA 4IPAA 5L3DA 4NB5A 2K27A 2STWA 2HS5A 1KQ8A 2ZXJA 4ZZDA 2EWNA 4L18B 1FBUA 3L2CA 3QU6A 3SHFA 2YU3A 3ROUA 1I1GA 2HKOA 4EMSA 1R5GA 1E17A 2MLKA 2YR2A 4QWQA 1SD4A 4RGUA 2C6YA 3LA2A 3DP7A 2XAGA 4FT8A 2D45A 1R23A 2O8XA 1HBXG 1UFMA 1MJ9A 1Q1HA 2X4HA 5A2QK 3HTSB 2QVOA 3IRRA 4UHTA 4L9NA 5E1WA 4L5JA 2ZMEA 4AVPA 5BQTA 5L3GA 4WXHA 5FO5A 4MQVA 3BY6A 3R0JA 3Q5FA 5L3CA 1Z91A 3QU3A 2D1HA 5D8LB 1SFXA 5KVRA 4IHSA 2OD5A 4RAYA 2PQ8A 3GFIA 4FX4A 2Z5UA 5D5XB 3WTXC 4I98B 1PDNC 5H6QA 5AIQA 3H92A 3CLOA 3GVAA 1KU2A 5BOXA 4GCVA 3BROA 2DU9A 3F6VA 3N97A 3CUQC 3CUOA 3SQNA 2EA4A 1E2XA 3SFZA 2MC3A 2RV8A 4UXNA 2KRFA 1UCRA 1FLIA 2L54A 3R60A 3HHHA 3LAJA 3AAFA 3GYHX 1ZG1A 1YTYA 4KN7X 4KYWA 2F5EA 5J6XA 3NEUA 1H0MA 3LAPA 1ZG3A 1AWCA 1SMYF 1P4AA 3F6OA 1R1TA 1O3TA 1U5TA 1KA8A 4YIIA 4HLYA 3CJNA 3W6JB 4CHUA 1ZLKA 2MLGA 2A6HF 1XSVA 2MA3A 3F21A 4G7OF 1UHWA 1LEBA 1TQIA 4Y17A 3EYYA 4RS8A 3ZMDA 3K2ZA 2HYFA 4IVNA 3Q9VA 2W57A 2Q2EA 4FHTA 1WSUA 2P5VA 4BAYA 3DQVC 3EDPA 2OQGA 2DT5A 2Y0MA 2ZO4A 3J81K 5HDGA 5LHHA 4Z2YA 2AS5F 5CJ9A 2ACJA 1I5ZA 2BV6A 4N9HA 3W6KB 2H27A 2EFWA 3BOQA 1FP2A 1DPRA 3QPHA 2Z99A 3WU1B 1XMKA 1FYKA 2G9WA 4KMUX 1BJAA 4EJTA 1FSEA 4XSXF 3ZMSA 1FP1D 4OINF 5FD5A 3BWGA 4HX7A 1FYLA 3HRMA 1DUXC 4CDGA 2WTEA 5JFRA 3FX3A 2L4AA 1REPC 5D6FA 2E1CA 3PQJA 3FXRA 3KLNA 1KU7A 4ESJA 5ICCA 1G3TA 1U6GA 2XASA 3FMQA 5LRRA 4ESFA 4M73A 3L7WA 2FSWA 4B09A 2DK8A 5LLQA 3EQLF 2PG4A 2YSRA 2F5FA 5JR3A 1BIAA 1TTYA 1R1UA 3RPQA 1O3QA 3TO9A 4LG0A 4RB2C 2XAHA 1FT9A 1TLHB 3R0AA 2YX7A 4ETSA 1R5HA 2Z3YA 2FXAA 2GQQA 3M8FA 2J5OA 2EFNA 3M7GA 1K6OA 4RB1A 5LEJA 3N4MA 3OV8A 2Y75A 2PI0A 3ZMUA 4RGSA 3P9CA 2HKXA 2DTRA 3IWFA 2R3SA 3I64A 2OU2A 2CQKA 4WXDA 2NAZA 4PZJA 2COMA 3WE3A 1Z7UA 2P4WA 3ZQ7A 4MHGA 2QUFA 4XRFA 1WI9A 2VXZA 1OKRA 1G3WA 4OU0A 5J8CA 4RAZA 5AIPA 2EV6A 4EVIA 3FM5A 5IT3A 1K78B 1CGPA 1R58A 3I59B 4GGGA 5F64A 1FBSA 4BNCA 2F5DA 1SD7A 3EUHA 3K1MA 4L9TA 2JSCA 4XLPF 2ISYA 2FBHA 4L0ZB 2PEXA 3DEUA 1LNWA 5ILSA 4UVAA 4K2EA 5DUKA 1HW5A 1IRFA 5HDNA 2V79A 5EEGA 1RZ4A 1TW3A 2KIFA 3KFWX 4KDPA 5IT9Z 2ELHA 5ERIA 1HXDA 1Z6TA 3OOPA 5AONA 2M1BA 2A61A 4RGXA 3TDZC 3JAMK 2STTA 3CTAA 2YX4A 2QBYA 2IRFG 2CGPA 3E6MA 3E3VA 2GIVA 3GW2A 5JHUA 3V7CA 3HRSA 3CO7C 4N0BA 2FNAA 3TDUC 1JE8A 4A12A 1U5TC 2RVCA 2E1NA 1FX7A 1B9NA 4KIGA 2QENA 4LLLA 2RC4A 1TW2A 1G3SA 5DCMA 4AIHA 3KLOA 1YS7A 3ECHA 2R7FA 4Y15A 3D0SA 1R36A 2H6BA 2W25A 3Q9SA 3ZPLA 3KP5A 3WODF 4LLNA 2XUBA 3K9TA 1BBYA 3HSFA 4H0EA 1IAWA 4HLXA 1FOKA 1C0WA 3GUDA 4MQ9F 1EV7A 1J59A 2A07F 3WTWC 4JK1X 4KNYA 5BPDA 3HHGA 2FQ3A 2A3SA 5L3FA 2VOPA 4XLNF 3VOEA 1STZA 2P5KA 3GFLA 2GAUA 1JGSA 4ZZLA 4HZFA 3QP6A 1OYYA 5ILUA 4ENNA 2L02A 5D8KB 1FC3A 3JTHA 2LF7A 3HIFA 1MJBA 2PLYA 1LJ9A 4I0AA 2ISZA 2W24A 1LDJA 2VBYA 2O61A 4MEYF 1ODDA 1T39A 3LWFA 4YFNF 1IUYA 3LFKA 5CVRA 4DQ2A 3P9KA 4WK8F 2FMYA 1W5SA 4KIBA 4G94A 2BBYA 4IRIA 1U3EM 3FZVA 2E7XA 1ZREA 2WWYA 4HF2A 1FYMA 2KJCA 4GYGA 4PGHA 3L09A 2GA1A 4G7ZF 5E8IA 2F5CA 3MEXA 2P7CB 1USTA 2CW0F 1S29A 2P6SA 3V7RA 3ISPA 3GEZA 1O57A 4BHPA 1GHCA 4KIFA 1XGSA 3WGGA 1B4AA 4HQEA 4Y13A 2F2EA 1D3YA 2VC1A 3DPLC 3ABUA 2L3DA 1HQCA 5D4RA 3V7SA 1ZARA 2EFOA 2HEOA 1J2XA 4IJAA 2ZCWA 2KKOA 1T38A 3I54A 2LDUA 2M8EA 2CWEA 3T5XA 1Z1DA 4A6DA 1RNLA 5K5QA 4U7BA 3I71A 4KA4A 5K5RA 2B0LA 5D6EA 4LK0F 2JT1A 1FY7A 4ENMA 4WX9A 2UXXA 2VBZA 2E7WA 5DUIA 2RGVA 2QQ9A 5LHIA 3I53A 1YW8A 3I4PA 1W4MA 2HQRA 1OYIA 4LFUA 4R79A 4UV9A 3FXUA 1SAXA 1PP8F 1P2FA 4UVCA 2OAZA 3RKXA 4L9JA 4WXCA 1MD0A 2A6EF 2H09A 2IPQX 2ADUA 2V6CA 3F72A 3TKYA 3QP5A 5HLGA 4YIFA 4Q5SF 2DPDA 3ZN1A 4ZH4F 1B6AA 1KU3A 4M71A 2JZYA 3VODA 2XROA 5CYVA 4I2OA 1BN5A 3IHUA 4Q47A 4U0WA 4ZYGA 1YYVA 4LB6B 2OZUA 1MZBA 1MGTA 2BYVE 1ZRDA 3ZMTA 1DP7P 1ZAOA 1S6LA 5DDGA 1IXRC 1YIOA 4HV5A 1HKSA 2EFPA 3E6CC 1BC7C 1D8JA 2HWVA 4EGYA 4MEXF 2A69F 1GXPA 3TOAA 4WCGA 3DF8A 2K86A 5CVUA 1LDDA 3DFGA 3KEQA 4A6EA 1K79A 2O0YA 3GXOA 3KP6A 1F5TA 3F23A 5D5VB 3IWZA 3KP7A 1I27A 3ZP5A 3FMRA 4R1HA 1W7PB 2D1VA 3R6SA 1B9MA 2IP2A 4WWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ9 A;  1HST A;  1YO5 C;  2IJL A;  3ERE D;  2CO5 A;  2UWM A;  1Z05 A;  1NHA A;  3H3Z A;  2VE8 A;  4HOB A;  3RYP A;  4JBA A;  2Q0O A;  3PQK A;  3GX4 X;  1XGO A;  2P6T A;  1BI0 A;  4PCQ A;  1B1B A;  2IVM A;  3QPT A;  2GXG A;  3E5Q A;  4ZYE A;  2VBW A;  4P9U A;  2X0L A;  1IZ1 A;  4JQF A;  2O3F A;  3DXJ F;  4HQM A;  5D5W B;  4KIC A;  1J7K A;  1WRJ A;  2BEO A;  5FLX K;  2XIG A;  3BZ6 A;  3M8E A;  4M72 A;  3J80 Z;  3B73 A;  1J9I A;  2IW5 A;  3WTS C;  2M5W A;  1IXC A;  1QGP A;  1IF1 A;  3E5U A;  2NNY A;  3DKW A;  1OMI A;  3S2W A;  3JSP A;  3BPX A;  3BPV A;  3ZMV A;  1SD6 A;  4U7D A;  2HFH A;  1T0F A;  2TDX A;  3V8K A;  1YW7 A;  5F6F A;  3TGN A;  3K0L A;  3GFJ A;  3R61 A;  2HTJ A;  1WKM A;  3RKY A;  2FE3 A;  4AIK A;  4D0P A;  5CVJ A;  1ZGJ A;  1H9G A;  1KYZ A;  1ZHF A;  4EQQ A;  3HRU A;  2HDC A;  1U8R A;  1XCB A;  5CLS A;  5ICF A;  5JVT A;  3T8T A;  2LNB A;  3K1N A;  3NQO A;  1K78 A;  1T6S A;  2CSO A;  1FWZ A;  3LQQ A;  4BYY A;  1LVA A;  1O7F A;  5KK1 A;  1HW1 A;  3MFK A;  2G7U A;  5HVQ C;  1H9T A;  2IA1 A;  5DD8 A;  1MDM A;  5A2Q Z;  3WTY C;  2HR3 A;  4A0X A;  3F8C A;  1HW2 A;  2RKH A;  3RI4 A;  1OYW A;  3KP2 A;  3IRQ A;  5JI6 A;  4L5I A;  2K4B A;  2MBF A;  2O6G E;  1IXS B;  2XAF A;  3ECO A;  3GWZ A;  2LKP A;  5DEQ A;  1CF7 B;  3KE2 A;  1ZG5 A;  1MJA A;  2FRH A;  2HQN A;  3RTR A;  1ULY A;  1V4R A;  1OPC A;  2VT3 A;  3T8R A;  1IN5 A;  3I5U A;  3LQR A;  2LF8 A;  4FX0 A;  1T2K A;  3QRF F;  2DBB A;  3QOP A;  2FML A;  3FMS A;  2XKO A;  3E6B A;  4G9Y A;  2PJP A;  3F3X A;  1J0R A;  3PFI A;  1UHM A;  1Z6R A;  3K69 A;  3M9A A;  3KCC A;  1RUN A;  3E5X A;  4NHJ A;  2G7H A;  3C1D A;  4KUM A;  4KMF A;  5K1Y A;  4CXF A;  3HSE A;  3VB2 A;  5CVI A;  3CUQ B;  4U0Y A;  3COA C;  4UV8 A;  5FFZ A;  4P96 A;  3IKT A;  2EK5 A;  2UZK A;  5LBQ A;  2R7D A;  2QLZ A;  3HRT A;  4HYE A;  4LK1 F;  4O3M A;  5E20 A;  3J81 Z;  2DK5 A;  3RYR A;  1UB9 A;  5BMZ A;  4S04 A;  1QNT A;  4GYI A;  2XV4 S;  4ASN A;  4OOI A;  2XVC A;  1RIO H;  3P7N A;  1IN7 A;  4MGR A;  1BIB A;  4A5M A;  2O03 A;  3FWE A;  1YG2 A;  2PFB A;  2UXN A;  4TV7 A;  2IA0 A;  3GO5 A;  2YPR A;  3SZT A;  3L9F A;  3T0Y A;  4U0V A;  3MWM A;  2OZ6 A;  2MD5 A;  1YS6 A;  2Z9O A;  4R8H A;  4HX4 A;  1XSD A;  1ON1 A;  3GF2 A;  4G6D A;  3C18 A;  3I0T A;  1FSH A;  2OQR A;  4O6J A;  6PAX A;  1FBQ A;  5FD6 A;  3I58 A;  2WV0 A;  3BJ6 A;  5ILV A;  1XD7 A;  1MKM A;  3JW4 A;  1Z9C A;  4ESB A;  2VC0 A;  2DAO A;  4EM2 A;  2NNN A;  3WGI A;  2A5Y B;  2MH9 A;  3KP3 A;  3QAH A;  1ONV A;  2JPB A;  5E8G A;  2ZNY A;  4S05 A;  1X3U A;  4BHC A;  1QPM A;  5BS6 A;  5DYM A;  1TBX A;  1HKQ A;  3E97 A;  3G3Z A;  4M9X A;  3KP4 A;  2V1X A;  2H6C A;  2EV5 A;  1JHH A;  4ZYH A;  2A68 F;  3V8J A;  3F8N A;  2NRA C;  5E18 F;  2JPC A;  2PMH A;  2XGX A;  1PUE E;  2PBI A;  3FF5 A;  3WE2 A;  4P55 A;  1RUO A;  2XHK A;  1IW7 F;  2WC2 A;  4I01 A;  2RNJ A;  4HV6 A;  3E6D A;  3ZMZ A;  5HLH A;  2HOE A;  2PMU A;  4EGZ A;  1O3S A;  1S3J A;  3U1D A;  2FBI A;  3H3U A;  3WTU C;  3JTG A;  1XDS A;  2XKP A;  1AOY A;  1XB4 A;  5LGT A;  4U88 A;  2HTS A;  3C7J A;  5FFX A;  4P5O A;  1XCV A;  3IKV A;  1QQI A;  5H20 A;  3IC7 A;  4N9I A;  3KZZ A;  1QO0 D;  4YFX F;  2EJR A;  4HDV A;  3WTT C;  2P8T A;  3WTZ A;  4HW0 A;  2ZME B;  4HX8 A;  1A04 A;  3GFM A;  2CG4 A;  1D8K A;  4EM1 A;  2M45 A;  4OMY A;  3BJA A;  2ZNZ A;  2MH2 A;  5DD4 A;  5IT9 K;  3D5L A;  3F8F A;  3JSO A;  1LDK B;  5HS8 A;  2V1U A;  1LQ1 A;  3JAM Z;  4AWX B;  4CGZ A;  4UVB A;  4HF1 A;  5ED4 A;  4EJV A;  4ZYD A;  4EJO A;  5D4S A;  4ON0 A;  2CYY A;  4A2U A;  4RB0 A;  4MNU A;  4AD9 A;  4RGR A;  1BI3 A;  1PP7 U;  1R00 A;  4UUV A;  2RN7 A;  4ENK A;  5J8F A;  3BDD A;  4LGW A;  2DFI A;  1YFH A;  4G6Q A;  5HDK A;  5ICG A;  2QYO A;  1B59 A;  3U2R A;  3B02 A;  4A0Y A;  3MZH A;  5F1R A;  1BI2 A;  1XDU A;  2GZW A;  4G7H F;  3WTV C;  3MCZ A;  4XSZ F;  3RPU A;  1IN6 A;  5L3E A;  4OIR F;  2DPU A;  1W7P D;  2FF4 A;  2XAQ A;  1KQ0 A;  2VN2 A;  1BC8 C;  4B8X A;  2RQP A;  2V9V A;  3G73 A;  2JRT A;  3V4G A;  4ENJ A;  2KIU A;  3VFZ A;  1W7P A;  3FHZ A;  3HSR A;  1U5T B;  2EV0 A;  4M9S A;  2RDP A;  5EEH A;  2AXL A;  1WQ2 A;  3KZY A;  3O6B B;  3O3K A;  5DV5 A;  2QM3 A;  1EH8 A;  4P9F A;  1JHF A;  2OA4 A;  1U2W A;  4IXA A;  4IRH A;  1XGM A;  3TOB A;  4HDU A;  1R22 A;  2ZKZ A;  1IRG A;  4F7Z A;  5DCF A;  2DI3 A;  4XBF A;  2DQR A;  4L9V A;  1USS A;  2HZT A;  3RJP A;  1ZN2 A;  1FNN A;  1TQP A;  2ESN A;  4I02 A;  2NS0 A;  2HGC A;  1KGS A;  3HYI A;  5FB2 A;  2CFX A;  4OIP F;  1IN8 A;  3K1P A;  1SD5 A;  1FPQ A;  2P5L C;  1OR7 A;  4YFK F;  4CZZ A;  3GLX A;  2ZFW A;  4I0B A;  2L4M A;  5K5O A;  3BP8 A;  5E1X A;  4OIQ F;  1TNS A;  1U78 A;  2FEZ A;  2ETH A;  1YLF A;  4CYD A;  3RDI A;  3RKW A;  3DPT A;  2FNP A;  1L3L A;  3TO6 A;  5BPI A;  3DV8 A;  1XSX A;  4M9Z A;  3NRV A;  1XMA A;  3ELK A;  4YG2 F;  5TRD A;  2DLL A;  2ZJ2 A;  1IN4 A;  5LGN A;  4DNC A;  2H94 A;  3ABT A;  5LHG A;  3FM3 A;  4LG0 B;  2JTV A;  4PGG A;  1YQA A;  1QBJ A;  3CO6 C;  3HTU A;  1F1Z A;  5E17 F;  2M30 A;  1I1S A;  3I59 A;  4IHT A;  4QLC U;  2PN6 A;  1S7O A;  5TJJ A;  5HOO A;  4HA8 A;  2FBK A;  1YW9 A;  1XN7 A;  4IF4 A;  1XGN A;  5HS9 A;  4BQA A;  4BH9 A;  3WG9 A;  3WGH A;  3TQN A;  3L00 A;  2P7V B;  4M74 A;  5E1Z B;  3LA3 A;  4KT5 C;  4LMY A;  2DQL A;  1KU9 A;  3MAJ A;  4LLG F;  3F22 A;  1G4D A;  3BJO A;  2K4J A;  1L0O C;  1WWX A;  2EA2 A;  2J5P A;  4WF2 A;  1ZYR F;  3EYI A;  3SZP A;  1R1V A;  5L3B A;  1BI1 A;  1G6N A;  1J75 A;  2QZ8 A;  1CF7 A;  1P4X A;  1DPU A;  1MDM B;  2GA2 A;  2EFQ A;  1EH6 A;  2VBX A;  2KJB A;  3C3W A;  4RB3 C;  4MTE A;  1D5V A;  4PDK A;  2LSO A;  4HAM A;  4EJW A;  2V1D A;  2IA2 A;  1FZP B;  2VOO A;  2BE5 F;  1P92 A;  1ZH5 A;  4HF0 A;  3HUG A;  4LJZ F;  1RI7 A;  4LB5 A;  3CDH A;  4E70 A;  2GXB A;  1SFE A;  2BGC A;  1ZRF A;  3REO A;  1W5T A;  2HYG D;  2DO7 A;  3ULQ B;  3F8B A;  5LEK A;  2FOK A;  1Y0U A;  4O5V A;  2IT0 A;  2ESH A;  2OBP A;  5D5U B;  4EM0 B;  2GWR A;  1O3R A;  3J7A O;  2XAJ A;  1SMT A;  4MTD A;  2FA5 A;  3CUQ A;  4GO1 A;  2QBY B;  3FXQ A;  1QZZ A;  2W84 A;  2M87 A;  3P9I A;  1HSJ A;  3F8M A;  3R4K A;  2DW4 A;  3SXY A;  1S8N A;  5HS7 A;  1ZRC A;  2Y48 A;  2VON A;  2K02 A;  2QWW A;  4OIO F;  1DDN A;  3HOT A;  2D2W A;  3EET A;  1HKT A;  1P6R A;  4KN4 X;  4CIC A;  4A5N A;  2Q8K A;  1ZLJ A;  4EV0 A;  1GXQ A;  4GXO A;  4OMZ A;  5HLI A;  2ZBK A;  3ZN0 A;  5DCM B;  4I7H A;  3GZ6 A;  4EJU A;  1TQM A;  1P4W A;  3U9G A;  4BXU A;  1KYW A;  2EB7 A;  1QZY A;  4HBL A;  3LA7 A;  3ML6 A;  1JXS A;  5LRS A;  3O2P E;  3M1E A;  2Z33 A;  1ZGA A;  4A0Z A;  4AIJ A;  3VEP A;  4IRG A;  1J5Y A;  2XRN A;  1EH7 A;  2L01 A;  1TNT A;  3MZY A;  5ICE A;  2VE9 A;  1I6X A;  4G8X A;  3T1B A;  1S7A A;  3HOS A;  3LST A;  3WU0 A;  3RIR A;  2QQA A;  1GVJ A;  1LB2 A;  1ON2 A;  1T98 A;  4L0Y B;  4CO8 A;  4Q4Z F;  4M6X A;  5H6R A;  1V3F A;  2QQB A;  1SFU A;  2VOD A;  1F4K A;  3IL2 A;  2NYX A;  3MQ0 A;  1LEA A;  5CVV A;  4KFC A;  5LGU A;  4Q48 A;  4NQW A;  3GZ5 A;  5FLX Z;  1BM9 A;  1O7L A;  3J80 K;  1R7J A;  4UNO A;  3KEO A;  4LD5 A;  4M6Y A;  1G3Y A;  2KIM A;  1F9N A;  2VT2 A;  5FGM A;  3V8L A;  1BOA A;  4I09 A;  2FU4 A;  2K7L A;  4BHB A;  2W85 A;  1VTN C;  3TO7 A;  3KET A;  1K7A A;  4IPA A;  5L3D A;  4NB5 A;  2K27 A;  2STW A;  2HS5 A;  1KQ8 A;  2ZXJ A;  4ZZD A;  2EWN A;  4L18 B;  1FBU A;  3L2C A;  3QU6 A;  3SHF A;  2YU3 A;  3ROU A;  1I1G A;  2HKO A;  4EMS A;  1R5G A;  1E17 A;  2MLK A;  2YR2 A;  4QWQ A;  1SD4 A;  4RGU A;  2C6Y A;  3LA2 A;  3DP7 A;  2XAG A;  4FT8 A;  2D45 A;  1R23 A;  2O8X A;  1HBX G;  1UFM A;  1MJ9 A;  1Q1H A;  2X4H A;  5A2Q K;  3HTS B;  2QVO A;  3IRR A;  4UHT A;  4L9N A;  5E1W A;  4L5J A;  2ZME A;  4AVP A;  5BQT A;  5L3G A;  4WXH A;  5FO5 A;  4MQV A;  3BY6 A;  3R0J A;  3Q5F A;  5L3C A;  1Z91 A;  3QU3 A;  2D1H A;  5D8L B;  1SFX A;  5KVR A;  4IHS A;  2OD5 A;  4RAY A;  2PQ8 A;  3GFI A;  4FX4 A;  2Z5U A;  5D5X B;  3WTX C;  4I98 B;  1PDN C;  5H6Q A;  5AIQ A;  3H92 A;  3CLO A;  3GVA A;  1KU2 A;  5BOX A;  4GCV A;  3BRO A;  2DU9 A;  3F6V A;  3N97 A;  3CUQ C;  3CUO A;  3SQN A;  2EA4 A;  1E2X A;  3SFZ A;  2MC3 A;  2RV8 A;  4UXN A;  2KRF A;  1UCR A;  1FLI A;  2L54 A;  3R60 A;  3HHH A;  3LAJ A;  3AAF A;  3GYH X;  1ZG1 A;  1YTY A;  4KN7 X;  4KYW A;  2F5E A;  5J6X A;  3NEU A;  1H0M A;  3LAP A;  1ZG3 A;  1AWC A;  1SMY F;  1P4A A;  3F6O A;  1R1T A;  1O3T A;  1U5T A;  1KA8 A;  4YII A;  4HLY A;  3CJN A;  3W6J B;  4CHU A;  1ZLK A;  2MLG A;  2A6H F;  1XSV A;  2MA3 A;  3F21 A;  4G7O F;  1UHW A;  1LEB A;  1TQI A;  4Y17 A;  3EYY A;  4RS8 A;  3ZMD A;  3K2Z A;  2HYF A;  4IVN A;  3Q9V A;  2W57 A;  2Q2E A;  4FHT A;  1WSU A;  2P5V A;  4BAY A;  3DQV C;  3EDP A;  2OQG A;  2DT5 A;  2Y0M A;  2ZO4 A;  3J81 K;  5HDG A;  5LHH A;  4Z2Y A;  2AS5 F;  5CJ9 A;  2ACJ A;  1I5Z A;  2BV6 A;  4N9H A;  3W6K B;  2H27 A;  2EFW A;  3BOQ A;  1FP2 A;  1DPR A;  3QPH A;  2Z99 A;  3WU1 B;  1XMK A;  1FYK A;  2G9W A;  4KMU X;  1BJA A;  4EJT A;  1FSE A;  4XSX F;  3ZMS A;  1FP1 D;  4OIN F;  5FD5 A;  3BWG A;  4HX7 A;  1FYL A;  3HRM A;  1DUX C;  4CDG A;  2WTE A;  5JFR A;  3FX3 A;  2L4A A;  1REP C;  5D6F A;  2E1C A;  3PQJ A;  3FXR A;  3KLN A;  1KU7 A;  4ESJ A;  5ICC A;  1G3T A;  1U6G A;  2XAS A;  3FMQ A;  5LRR A;  4ESF A;  4M73 A;  3L7W A;  2FSW A;  4B09 A;  2DK8 A;  5LLQ A;  3EQL F;  2PG4 A;  2YSR A;  2F5F A;  5JR3 A;  1BIA A;  1TTY A;  1R1U A;  3RPQ A;  1O3Q A;  3TO9 A;  4LG0 A;  4RB2 C;  2XAH A;  1FT9 A;  1TLH B;  3R0A A;  2YX7 A;  4ETS A;  1R5H A;  2Z3Y A;  2FXA A;  2GQQ A;  3M8F A;  2J5O A;  2EFN A;  3M7G A;  1K6O A;  4RB1 A;  5LEJ A;  3N4M A;  3OV8 A;  2Y75 A;  2PI0 A;  3ZMU A;  4RGS A;  3P9C A;  2HKX A;  2DTR A;  3IWF A;  2R3S A;  3I64 A;  2OU2 A;  2CQK A;  4WXD A;  2NAZ A;  4PZJ A;  2COM A;  3WE3 A;  1Z7U A;  2P4W A;  3ZQ7 A;  4MHG A;  2QUF A;  4XRF A;  1WI9 A;  2VXZ A;  1OKR A;  1G3W A;  4OU0 A;  5J8C A;  4RAZ A;  5AIP A;  2EV6 A;  4EVI A;  3FM5 A;  5IT3 A;  1K78 B;  1CGP A;  1R58 A;  3I59 B;  4GGG A;  5F64 A;  1FBS A;  4BNC A;  2F5D A;  1SD7 A;  3EUH A;  3K1M A;  4L9T A;  2JSC A;  4XLP F;  2ISY A;  2FBH A;  4L0Z B;  2PEX A;  3DEU A;  1LNW A;  5ILS A;  4UVA A;  4K2E A;  5DUK A;  1HW5 A;  1IRF A;  5HDN A;  2V79 A;  5EEG A;  1RZ4 A;  1TW3 A;  2KIF A;  3KFW X;  4KDP A;  5IT9 Z;  2ELH A;  5ERI A;  1HXD A;  1Z6T A;  3OOP A;  5AON A;  2M1B A;  2A61 A;  4RGX A;  3TDZ C;  3JAM K;  2STT A;  3CTA A;  2YX4 A;  2QBY A;  2IRF G;  2CGP A;  3E6M A;  3E3V A;  2GIV A;  3GW2 A;  5JHU A;  3V7C A;  3HRS A;  3CO7 C;  4N0B A;  2FNA A;  3TDU C;  1JE8 A;  4A12 A;  1U5T C;  2RVC A;  2E1N A;  1FX7 A;  1B9N A;  4KIG A;  2QEN A;  4LLL A;  2RC4 A;  1TW2 A;  1G3S A;  5DCM A;  4AIH A;  3KLO A;  1YS7 A;  3ECH A;  2R7F A;  4Y15 A;  3D0S A;  1R36 A;  2H6B A;  2W25 A;  3Q9S A;  3ZPL A;  3KP5 A;  3WOD F;  4LLN A;  2XUB A;  3K9T A;  1BBY A;  3HSF A;  4H0E A;  1IAW A;  4HLX A;  1FOK A;  1C0W A;  3GUD A;  4MQ9 F;  1EV7 A;  1J59 A;  2A07 F;  3WTW C;  4JK1 X;  4KNY A;  5BPD A;  3HHG A;  2FQ3 A;  2A3S A;  5L3F A;  2VOP A;  4XLN F;  3VOE A;  1STZ A;  2P5K A;  3GFL A;  2GAU A;  1JGS A;  4ZZL A;  4HZF A;  3QP6 A;  1OYY A;  5ILU A;  4ENN A;  2L02 A;  5D8K B;  1FC3 A;  3JTH A;  2LF7 A;  3HIF A;  1MJB A;  2PLY A;  1LJ9 A;  4I0A A;  2ISZ A;  2W24 A;  1LDJ A;  2VBY A;  2O61 A;  4MEY F;  1ODD A;  1T39 A;  3LWF A;  4YFN F;  1IUY A;  3LFK A;  5CVR A;  4DQ2 A;  3P9K A;  4WK8 F;  2FMY A;  1W5S A;  4KIB A;  4G94 A;  2BBY A;  4IRI A;  1U3E M;  3FZV A;  2E7X A;  1ZRE A;  2WWY A;  4HF2 A;  1FYM A;  2KJC A;  4GYG A;  4PGH A;  3L09 A;  2GA1 A;  4G7Z F;  5E8I A;  2F5C A;  3MEX A;  2P7C B;  1UST A;  2CW0 F;  1S29 A;  2P6S A;  3V7R A;  3ISP A;  3GEZ A;  1O57 A;  4BHP A;  1GHC A;  4KIF A;  1XGS A;  3WGG A;  1B4A A;  4HQE A;  4Y13 A;  2F2E A;  1D3Y A;  2VC1 A;  3DPL C;  3ABU A;  2L3D A;  1HQC A;  5D4R A;  3V7S A;  1ZAR A;  2EFO A;  2HEO A;  1J2X A;  4IJA A;  2ZCW A;  2KKO A;  1T38 A;  3I54 A;  2LDU A;  2M8E A;  2CWE A;  3T5X A;  1Z1D A;  4A6D A;  1RNL A;  5K5Q A;  4U7B A;  3I71 A;  4KA4 A;  5K5R A;  2B0L A;  5D6E A;  4LK0 F;  2JT1 A;  1FY7 A;  4ENM A;  4WX9 A;  2UXX A;  2VBZ A;  2E7W A;  5DUI A;  2RGV A;  2QQ9 A;  5LHI A;  3I53 A;  1YW8 A;  3I4P A;  1W4M A;  2HQR A;  1OYI A;  4LFU A;  4R79 A;  4UV9 A;  3FXU A;  1SAX A;  1PP8 F;  1P2F A;  4UVC A;  2OAZ A;  3RKX A;  4L9J A;  4WXC A;  1MD0 A;  2A6E F;  2H09 A;  2IPQ X;  2ADU A;  2V6C A;  3F72 A;  3TKY A;  3QP5 A;  5HLG A;  4YIF A;  4Q5S F;  2DPD A;  3ZN1 A;  4ZH4 F;  1B6A A;  1KU3 A;  4M71 A;  2JZY A;  3VOD A;  2XRO A;  5CYV A;  4I2O A;  1BN5 A;  3IHU A;  4Q47 A;  4U0W A;  4ZYG A;  1YYV A;  4LB6 B;  2OZU A;  1MZB A;  1MGT A;  2BYV E;  1ZRD A;  3ZMT A;  1DP7 P;  1ZAO A;  1S6L A;  5DDG A;  1IXR C;  1YIO A;  4HV5 A;  1HKS A;  2EFP A;  3E6C C;  1BC7 C;  1D8J A;  2HWV A;  4EGY A;  4MEX F;  2A69 F;  1GXP A;  3TOA A;  4WCG A;  3DF8 A;  2K86 A;  5CVU A;  1LDD A;  3DFG A;  3KEQ A;  4A6E A;  1K79 A;  2O0Y A;  3GXO A;  3KP6 A;  1F5T A;  3F23 A;  5D5V B;  3IWZ A;  3KP7 A;  1I27 A;  3ZP5 A;  3FMR A;  4R1H A;  1W7P B;  2D1V A;  3R6S A;  1B9M A;  2IP2 A;  4WWC A; 
#chains in the Genus database with same CATH topology
 1KQ9 A;  2MYS A;  4M3E A;  4MLO A;  4DBQ A;  1HST A;  2X1E A;  3LMM A;  1YO5 C;  2IJL A;  2YS9 A;  3ERE D;  2CO5 A;  2UWM A;  5EGO A;  1Z05 A;  1NHA A;  3H3Z A;  2VE8 A;  4HOB A;  3RYP A;  4JBA A;  2Q0O A;  3PQK A;  2R7Z J;  4CCM A;  3GX4 X;  3TED A;  1XGO A;  2P6T A;  4C2U A;  2L2O A;  1BI0 A;  3TW6 A;  1BR4 A;  4PCQ A;  1UJ8 A;  1B1B A;  2IVM A;  3I4N J;  3QPT A;  1P7I A;  3LSH A;  2GXG A;  2DYS H;  4A3M J;  3E5Q A;  4ZYE A;  2VBW A;  4P9U A;  2X0L A;  1IZ1 A;  4JQF A;  4GFB A;  1Z77 A;  2HVR A;  2O3F A;  3DXJ F;  3SYT A;  2WAQ A;  4HQM A;  2BY1 A;  4CCL A;  4KIC A;  5D5W B;  2GLO A;  1J7K A;  2O9L A;  1WRJ A;  3VSL A;  2BEO A;  4PJJ A;  2M7A A;  5FLX K;  2IGK A;  1OCZ H;  2XIG A;  3BZ6 A;  3M8E A;  4M72 A;  3J80 Z;  4NBQ A;  3B73 A;  1J9I A;  2IW5 A;  1AKH B;  3WTS C;  1D5Y A;  2M5W A;  1A6I A;  1IXC A;  1HCR A;  4NUB A;  2EQR A;  1QGP A;  1IF1 A;  4BE1 A;  3E5U A;  1RES A;  2NNY A;  3K4M A;  3DKW A;  2Y2Z A;  5M5X J;  1OMI A;  2W00 A;  3S2W A;  3JSP A;  3BPX A;  3A2K A;  2R7O A;  3BPV A;  2VXD A;  3AG2 H;  3ZMV A;  1SD6 A;  4U7D A;  2HFH A;  1T0F A;  2TDX A;  3V8K A;  4BU2 A;  5E3N A;  4IQJ A;  3PSI A;  3M4O J;  3QOE A;  1YW7 A;  5F6F A;  2MC4 A;  3TGN A;  1B72 B;  2R7S A;  3K0L A;  3GFJ A;  2JRM A;  2HTJ A;  3R61 A;  3OWT A;  2FJ1 A;  4F93 B;  1WKM A;  3RKY A;  4AID A;  2VKV A;  2FE3 A;  2E71 A;  3CDI A;  5E3M A;  4AIK A;  2HOT A;  4D0P A;  5CVJ A;  1ZGJ A;  3K70 C;  5FLV A;  4E7S A;  1H9G A;  1KYZ A;  3W3C A;  5FRN A;  1ZHF A;  2JA8 J;  2W4S A;  4EQQ A;  1ZR4 A;  3HRU A;  3L2V A;  2HDC A;  3SZG A;  5EF6 A;  1U8R A;  3GTO J;  1X2M A;  1XCB A;  2IGM A;  1MBE A;  5CLS A;  4F3Q A;  2BVM A;  5ICF A;  1TWG J;  5GPC A;  3T8T A;  2LNB A;  5JVT A;  1WZ2 A;  3K1N A;  5GAH J;  3NQO A;  3HKZ N;  1K78 A;  3ASO H;  4PFO A;  1T6S A;  2O7O A;  2CSO A;  5J1U A;  1FWZ A;  1Y1V J;  3LQQ A;  2ECC A;  4BYY A;  1LVA A;  4CCO A;  3WU2 C;  1O7F A;  2KDO A;  2MFZ A;  1X4P A;  5KK1 A;  1HW1 A;  3OY9 A;  3MFK A;  2G7U A;  4LOC A;  1JT6 A;  5HVQ C;  4ZTF A;  1H9T A;  2IA1 A;  3K6G A;  4E7L A;  3OIO A;  5DD8 A;  1MDM A;  5A2Q Z;  3K4B A;  5KCM A;  3HG9 A;  2HR3 A;  3KX2 A;  3WTY C;  5EZG A;  3BG6 A;  3B6A A;  3KPH A;  1E3H A;  4A0X A;  3F8C A;  1HW2 A;  1TWA J;  2RKH A;  3RI4 A;  3DTE A;  1OYW A;  3KP2 A;  1YIJ I;  3N05 A;  4RM2 A;  3PIP F;  4ZC3 A;  1AHD P;  3IRQ A;  4BEH B;  2L7K A;  4LIV A;  4A3K J;  5JI6 A;  3HEF A;  4AUX A;  4C3I J;  4QIW N;  3Q0W A;  4L5I A;  2K4B A;  2VJI A;  1G2H A;  2W7N A;  4DOZ A;  2MBF A;  2O6G E;  2LR8 A;  1FEX A;  1IXS B;  2XAF A;  3ECO A;  3GWZ A;  4CYC A;  2LKP A;  3TP3 A;  1YX3 A;  3DU5 A;  5DEQ A;  2NVT J;  2K5C A;  5C4J J;  1CF7 B;  4B44 A;  3J7A Y;  1S9H A;  1FIA A;  3ZXS A;  3KE2 A;  1ZG5 A;  4M6V A;  1MJA A;  3Q0V A;  2K3F A;  2FRH A;  2HQN A;  1T95 A;  2CU7 A;  3RTR A;  1ULY A;  1V4R A;  1X1C A;  1Y6I A;  3JRC A;  1OPC A;  2VKH A;  2VT3 A;  3T8R A;  1IN5 A;  3I5U A;  4XR6 A;  4CH7 A;  3ESW B;  3LQR A;  2LF8 A;  2XGC A;  4FX0 A;  1T2K A;  1W5C C;  2VJ5 A;  2KLO A;  1N78 A;  3QRF F;  2QA4 I;  2DBB A;  3QOP A;  3FDY A;  4UUT A;  2VQC A;  2FML A;  1W36 D;  3FMS A;  2XKO A;  3E6B A;  4G9Y A;  2PJP A;  1VND A;  2DA3 A;  2RQQ A;  3F3X A;  3QYB A;  1J0R A;  3HUG B;  1YJW I;  3DU6 A;  3H35 A;  3QWL A;  3PFI A;  1UHM A;  1X19 A;  1Z6R A;  3M8J A;  3K69 A;  3M9A A;  3KCC A;  2BW3 A;  5F0H A;  1RUN A;  1RET A;  3DKX A;  3E5X A;  4NHJ A;  2NVQ J;  3RQ4 A;  4C9Y A;  1ERD A;  1IUF A;  2G7H A;  3BTJ A;  3IP4 B;  3K7A J;  4Y52 J;  1ITY A;  5B66 C;  4Y7N J;  5F0C A;  3C1D A;  4KUM A;  1P9Q C;  4KMF A;  4YIR X;  3CP8 A;  5K1Y A;  4CXF A;  5KHD A;  1G8X A;  4XKC A;  3S3O A;  2E19 A;  3HSE A;  4X0G A;  3VB2 A;  3JRI A;  5CVI A;  2JN6 A;  3CUQ B;  4U0Y A;  5GAE J;  1K83 J;  2Y0S A;  3H9G A;  2KFD A;  3COA C;  4UV8 A;  5FFZ A;  3NWT A;  4P96 A;  3IKT A;  2BHZ A;  3LSJ A;  2EK5 A;  3CCQ I;  2UZK A;  3QYE A;  1FOY A;  5LBQ A;  2NOG A;  2WAF A;  1U0J A;  2R7D A;  2QLZ A;  3HRT A;  4NC8 A;  4HYE A;  2IGO A;  2R7X A;  4LK1 F;  1X1B A;  1YRN A;  4O3M A;  3DBR B;  3BZK A;  3BQY A;  3F0C A;  4A3B J;  5E20 A;  3J81 Z;  4B48 A;  1LUJ B;  2DK5 A;  3RYR A;  4IQ4 A;  3A0B C;  1UB9 A;  3HGY A;  3K10 A;  5BMZ A;  4S04 A;  2E34 A;  1QNT A;  1NG7 A;  5DTD A;  2HU9 A;  4GYI A;  3FBI B;  3QPS A;  2KZG A;  1HDP A;  2XV4 S;  4ASN A;  2GOX B;  3OS0 A;  3MKZ A;  4OOI A;  2XVC A;  1RIO H;  2KZV A;  3P7N A;  3BG9 A;  1IN7 A;  4MGR A;  1BIB A;  1GUU A;  2CRG A;  1Z3Y A;  2L7M P;  1AU7 A;  4A5M A;  1A5J A;  2O03 A;  3FWE A;  1R71 A;  1YG2 A;  2Z16 A;  2PFB A;  2UXN A;  4TV7 A;  2IA0 A;  3ZQL A;  3GO5 A;  3SEZ A;  2YPR A;  5GAG J;  4UUS B;  3SZT A;  3L9F A;  3T0Y A;  4U0V A;  3H9J A;  4JOM A;  3MWM A;  2IEK A;  2OZ6 A;  2MD5 A;  1YS6 A;  1X4O A;  4E4H A;  2Z9O A;  4R8H A;  1MND A;  4U87 A;  4HX4 A;  4M3G A;  1XSD A;  3DTK A;  1ON1 A;  1BOB A;  3RKQ A;  3GF2 A;  4G6D A;  1BA5 A;  2R7Q A;  3C18 A;  3I0T A;  2DA7 A;  4JYK A;  3PFY A;  1FSH A;  2LG4 A;  2OQR A;  2VI6 A;  4O6J A;  6PAX A;  4F91 B;  1FBQ A;  5FD6 A;  3I58 A;  2WV0 A;  5CPR B;  3BJ6 A;  4NC7 A;  5ILV A;  3CP2 A;  1T0F C;  1MKM A;  1XD7 A;  1B8I A;  1F36 A;  1JUM A;  1YX5 A;  3JW4 A;  4YEJ A;  1Z9C A;  4ESB A;  2VC0 A;  2DAO A;  4EM2 A;  2NNN A;  4ZDO A;  3WGI A;  2A5Y B;  1OQY A;  2I8D A;  3OYN A;  4D1Q A;  2MH9 A;  2DJI A;  1QVU A;  3K4K A;  3KP3 A;  3QAH A;  4NQW B;  1ONV A;  2DDB A;  2JPB A;  5E8G A;  3CF2 A;  2Z1D A;  2ZNY A;  4X1E A;  3GTP J;  4LIU A;  4FIS A;  5FKL A;  4S05 A;  1X3U A;  3TBI A;  1QPM A;  4BHC A;  4C2T A;  5BS6 A;  1LKX A;  5DYM A;  1DU6 A;  2NS7 A;  2DMT A;  2MSY A;  1TBX A;  1WJ5 A;  1HKQ A;  3E97 A;  3G3Z A;  4M9X A;  3KP4 A;  2EIJ H;  5IP6 A;  2V1X A;  2H6C A;  4BGD A;  2EV5 A;  2OF7 A;  4E7I A;  2VUM J;  1JHH A;  4V2F A;  2DFF A;  4ZYH A;  2CQN A;  3GTJ J;  2A68 F;  3V8J A;  2KHM A;  3PUF A;  1EJ9 A;  1FTT A;  3F8N A;  2NRA C;  2M7B A;  3VYU B;  2IS6 A;  3K70 D;  2L9R A;  3SEQ A;  5E18 F;  3CCJ I;  2JPC A;  2PMH A;  2W82 A;  1GDT A;  2XGX A;  3ZR8 X;  3W2V A;  3A03 A;  4L5E A;  1PUE E;  3BR5 A;  2ZXI A;  2PBI A;  1OCP A;  3FF5 A;  3WE2 A;  4P55 A;  2RNG A;  1RUO A;  2BOL A;  2XHK A;  1IW7 F;  2WC2 A;  4I01 A;  2RNJ A;  4HV6 A;  2LK2 A;  2XDV A;  3K2A A;  1J09 A;  3E6D A;  3H0D A;  2BHY A;  3OR1 C;  5IY5 H;  3ZMZ A;  4G12 A;  2CV0 A;  4Z6Y A;  5HLH A;  3OYH A;  2HOE A;  2PMU A;  4EGZ A;  1O3S A;  1S3J A;  3U1D A;  5IYC J;  2FBI A;  3PNT A;  3H3U A;  3HBL A;  3WTU C;  3H36 A;  3JTG A;  3BR6 A;  5IOY A;  1XDS A;  2XF6 A;  2XKP A;  5FKN A;  3AL0 B;  2E2I J;  1AOY A;  1XB4 A;  2OTJ I;  4V19 K;  2V6E A;  1RR7 A;  3E7L A;  5LGT A;  3GTK J;  4U88 A;  3OYM A;  2HTS A;  3OYJ A;  5M3M J;  3C7J A;  5FFX A;  2GOM A;  4P5O A;  2HZD A;  1XCV A;  3BLY A;  4A3F J;  3BG5 A;  3IKV A;  3S17 J;  2JUC A;  1QQI A;  2K9Q A;  5H20 A;  3IC7 A;  4HNU A;  2JWT A;  4N9I A;  1GV2 A;  3FBN B;  3KZZ A;  1QO0 D;  4YFX F;  1TC3 C;  2EJR A;  4XM3 A;  1E0E A;  4HDV A;  3WTT C;  5B1A H;  2P8T A;  3WTZ A;  4E7J A;  4HW0 A;  3O8G A;  1JUP A;  2NS8 A;  3K4N A;  2ZME B;  4HX8 A;  4BQQ A;  1A04 A;  3OS2 A;  3GFM A;  5IYD J;  2CG4 A;  1D8K A;  3OIP A;  2EIL H;  4EM1 A;  2M45 A;  1X3W B;  4OMY A;  3BJA A;  2ZNZ A;  2MH2 A;  5DD4 A;  5IT9 K;  1PUF B;  3D5L A;  3F8F A;  3OYB A;  1LDK B;  3JSO A;  1R49 A;  5F1J A;  1ACI A;  5HS8 A;  1VQP I;  2V1U A;  1LQ1 A;  1QRY A;  2IS1 A;  1H88 C;  3JAM Z;  2D5V A;  4AWX B;  4CGZ A;  3FXO A;  1VQ8 I;  1JT0 A;  4BBS J;  3OYI A;  4UVB A;  4HF1 A;  5ED4 A;  3BCB A;  3GCM A;  1WH5 A;  3BTL A;  4EJV A;  3SJM A;  4ZYD A;  4EJO A;  5D4S A;  4ON0 A;  2CYY A;  3H5R A;  4A2U A;  3CD6 I;  4RB0 A;  2F4I A;  2UUZ A;  3HDD A;  4MNU A;  2ZSH B;  4AD9 A;  4RGR A;  1BI3 A;  1PP7 U;  1R00 A;  2PJR B;  5E79 C;  2X85 A;  4I76 A;  4UB6 C;  4UUV A;  2CJJ A;  4AYB A;  4DYQ A;  2RN7 A;  2NOJ B;  4ENK A;  5J8F A;  3BDD A;  4LGW A;  2DFI A;  3DCF A;  1YFH A;  4G6Q A;  5HDK A;  2E1O A;  2CQX A;  5ICG A;  3MN2 A;  1SAN A;  2JSP A;  3RPU D;  2QYO A;  1B59 A;  3U2R A;  3B02 A;  2CMP A;  1GLN A;  2LTP A;  3Q3S A;  3DWL E;  2CUZ A;  2E1M B;  4A0Y A;  2WY8 Q;  5F1R A;  3MZH A;  1BI2 A;  4XOP A;  4JX4 A;  1XDU A;  3KEY A;  2GZW A;  4G7H F;  5C4X J;  5KAF C;  3WTV C;  1HC8 A;  3MCZ A;  3FXL A;  4XSZ F;  1LVK A;  3RPU A;  1IN6 A;  5L3E A;  2H8R A;  4OIR F;  3S93 A;  1YJ9 I;  2DPU A;  1W7P D;  1WH7 A;  2FF4 A;  1IGN A;  2XAQ A;  2NVX J;  1KQ0 A;  2VN2 A;  5FRO A;  4OAZ A;  3TW7 A;  4B8X A;  1BC8 C;  2RQP A;  2V9V A;  1IO2 A;  3G73 A;  2JRT A;  4JP0 A;  2M4G A;  2DT7 B;  3V4G A;  1UAA A;  1BL0 A;  2HYJ A;  2XF5 A;  3J7Y J;  2KIU A;  3L2Q A;  4ENJ A;  4W1U A;  1XPX A;  1X2N A;  4C2M J;  2WB1 N;  3VFZ A;  1W7P A;  3FHZ A;  1T33 A;  3HSR A;  1U5T B;  5J47 A;  1K4T A;  2EV0 A;  2YU9 J;  4M9S A;  2RDP A;  5EEH A;  4A3L J;  2AXL A;  1MMS A;  1WQ2 A;  3KZY A;  3O6B B;  3BT9 A;  3O3K A;  5DV5 A;  4XOR A;  2QM3 A;  2R5Z A;  1X58 A;  1DP3 A;  4MO7 A;  1EH8 A;  4P9F A;  4XMY A;  2Q1Z B;  1JHF A;  2M0M A;  2OA4 A;  4PFP A;  2VKD A;  3LNQ A;  2VL8 A;  3MD2 A;  1U2W A;  4IXA A;  3BG3 A;  2FX0 A;  4IRH A;  1XGM A;  2Q2E B;  3TOB A;  3LSK A;  4XOT A;  3H0G J;  2L7F P;  4HDU A;  1D0X A;  1R22 A;  2ZKZ A;  4DGW B;  1IRG A;  4F7Z A;  3BG7 A;  5EZH A;  1N75 A;  1V54 H;  1RC9 A;  1MMN A;  2ELK A;  5DCF A;  2CW7 A;  1MIJ A;  2DI3 A;  1NH3 A;  2M34 A;  4XBF A;  2DQR A;  4J00 A;  4L9V A;  1AA7 A;  2R93 J;  3IV5 A;  2OJE D;  3CZ6 A;  1USS A;  2RRE A;  2HVQ A;  2DOD A;  2HZT A;  3RJP A;  1OFC X;  1ZN2 A;  2LKS A;  3JRB A;  1FNN A;  2R5Y B;  1TQP A;  2ESN A;  1I50 J;  4I02 A;  1ETY A;  2NS0 A;  4HSR A;  1NK2 P;  2HGC A;  1KGS A;  3HYI A;  5FB2 A;  2CFX A;  1SEU A;  4OIP F;  2VQL A;  3S1N J;  1Z7L A;  2P0W A;  1IN8 A;  2LBF A;  3K1P A;  1D1B A;  1SD5 A;  1FPQ A;  2P5L C;  3K4J A;  1OR7 A;  3VSK A;  2L0K A;  4YFK F;  1PJR A;  4CZZ A;  1QVT A;  3GLX A;  5HNF A;  1TWC J;  2ZFW A;  4I0B A;  2MAB A;  2L4M A;  5FKK A;  1SC7 A;  5F04 A;  5K5O A;  3BP8 A;  1X1D A;  5E1X A;  4OIQ F;  1TNS A;  3LSI A;  1U78 A;  2FEZ A;  2ETH A;  1YLF A;  1ETW A;  4CYD A;  3RDI A;  5B5E C;  3RKW A;  4DIQ A;  3DPT A;  2FNP A;  1NG6 A;  3HOW J;  1L3L A;  1ETO A;  5FLM J;  1B72 A;  3TO6 A;  3LSP A;  3OYK A;  2LMD A;  4UB8 C;  2DMU A;  1KZH A;  2NVY J;  5BPI A;  3DV8 A;  4GRI A;  4KJZ A;  3CLQ A;  5DM7 F;  1XSX A;  2X6O A;  4M9Z A;  3CDL A;  1XMA A;  3ELK A;  3NRV A;  1MH4 A;  4QSH A;  3S2D J;  4YG2 F;  5JHF A;  5TRD A;  3VYR B;  5HLT A;  5C44 J;  2DLL A;  3NAR A;  4A69 C;  3DKY A;  2ZJ2 A;  1IN4 A;  3RCO A;  2ZJQ F;  4B4C A;  1UMQ A;  1LFP A;  5LGN A;  4DNC A;  1WCM J;  2E5N A;  2H94 A;  3ABT A;  4CZC A;  5LHG A;  3GBG A;  1MSF C;  3FM3 A;  2WAQ N;  4HPQ A;  4ITV A;  1A31 A;  4LG0 B;  2JTV A;  4PGG A;  3DLA A;  1OCT C;  1YQA A;  5EEA A;  1QBJ A;  3CO6 C;  2XGD A;  1MW7 A;  3HTU A;  1F1Z A;  1HA8 A;  5E3L A;  5E17 F;  5CQE A;  2M30 A;  1I1S A;  2HQA A;  5IYB J;  2W1O A;  3I59 A;  4IHT A;  4QLC U;  2PN6 A;  3BCA A;  2K9N A;  1S7O A;  5TJJ A;  2JA7 J;  5HOO A;  1W0U A;  2Y30 A;  2FBK A;  4HA8 A;  1YW9 A;  1XN7 A;  4IF4 A;  1SVL A;  1JJ6 C;  2Y31 A;  3FK7 A;  1XGN A;  5HS9 A;  3HPG A;  4BQA A;  4BH9 A;  2BXZ A;  3WG9 A;  3WGH A;  3TQN A;  3L00 A;  2P7V B;  4M74 A;  5E1Z B;  5B3S H;  3LA3 A;  1ORK A;  4KT5 C;  4LMY A;  4BJT A;  2DQL A;  1LE8 B;  4BEH A;  1KU9 A;  5EDN A;  3MAJ A;  1ETQ A;  4LLG F;  3F22 A;  2BXY A;  5IOZ A;  1G4D A;  1QZE A;  3LL7 A;  3BJO A;  1EF4 A;  2K4J A;  1GV5 A;  1NK3 P;  1L0O C;  1WWX A;  2EA2 A;  2J5P A;  4WF2 A;  1ZYR F;  3EYI A;  3SZP A;  1R1V A;  3IH4 A;  3ZQC A;  5L3B A;  1VFC A;  1BI1 A;  4CCK A;  1G6N A;  2JQ7 A;  1J75 A;  2QZ8 A;  2KPM A;  3BTI A;  1CF7 A;  3IUO A;  4XNF A;  4IHV A;  2QKM B;  1P4X A;  4BBR J;  1DPU A;  3I4M J;  4B43 A;  1A6Q A;  1T56 A;  1MDM B;  2GA2 A;  3HOU J;  2M0C A;  2N8G A;  4IX7 A;  3LSG A;  2EFQ A;  1EH6 A;  4E7Z A;  2VBX A;  2KJB A;  2ZXH A;  2EZK A;  2MD0 A;  3CCE I;  3C3W A;  3ERM A;  1Y39 A;  4RB3 C;  1VF9 A;  2V4J C;  3OR2 C;  3HJE A;  2ZB9 A;  4MTE A;  4F52 A;  1D5V A;  4PDK A;  2LSO A;  4HAM A;  4EJW A;  1IRZ A;  2V1D A;  2V9K A;  2IA2 A;  1FZP B;  4MFD A;  2VOO A;  2R4G A;  1JTX A;  2DOE A;  1UEL B;  2BE5 F;  1P92 A;  1ZH5 A;  1TT5 B;  4HF0 A;  3HUG A;  4LJZ F;  1RI7 A;  1JTY A;  4HRI A;  4LB5 A;  3CDH A;  4E70 A;  3L2U A;  2GXB A;  1SFE A;  2BGC A;  1ZRF A;  3REO A;  1W5T A;  5F08 A;  1A36 A;  2HYG D;  1MSE C;  1U8B A;  3GLL A;  2DO7 A;  3ULQ B;  3F8B A;  5LEK A;  4IEJ A;  3P5J A;  2FOK A;  2CFO A;  1Y0U A;  4O5V A;  2IT0 A;  2ESH A;  2OBP A;  2V7F A;  1YJN I;  3GZN B;  5D5U B;  5LFA A;  3JCU C;  4EM0 B;  2GWR A;  1O3R A;  1IV8 A;  2GXA A;  3J7A O;  2XAJ A;  1N77 A;  1SMT A;  1JI8 A;  4MTD A;  2FA5 A;  2JA6 J;  3CUQ A;  4RMN A;  4GO1 A;  2QBY B;  3OSF A;  3UKG A;  2XC7 A;  3S3M A;  3FXQ A;  1QZZ A;  2KL4 A;  2M87 A;  2W84 A;  3P9I A;  4CSW A;  2LRE A;  1HSJ A;  3F8M A;  3R4K A;  2DFH A;  3EUA A;  2DW4 A;  3MKL A;  3SXY A;  1S8N A;  5JLW A;  5HS7 A;  2Y9Z A;  1I3A A;  3JRF A;  4A3G J;  1ZRC A;  2Y48 A;  2VON A;  2K02 A;  2QWW A;  5K7Z A;  5GTH C;  4A3E J;  2VPL A;  2ICW G;  4OIO F;  1DDN A;  1W1W E;  2D2W A;  3EET A;  3HOT A;  1HKT A;  1P6R A;  4KN4 X;  4NC6 A;  4CIC A;  4IHY A;  1IDY A;  4A5N A;  2Q8K A;  1ZLJ A;  4II3 A;  2XRL A;  4BUP A;  4EV0 A;  1GXQ A;  4GXO A;  4OMZ A;  3OYL A;  3G1O A;  5HLI A;  2WAD A;  2ZBK A;  3ZN0 A;  2I5U A;  4IZZ A;  5DCM B;  1UG2 A;  4I7H A;  3PO3 J;  3GZ6 A;  3BR3 A;  4EJU A;  1TQM A;  3FKI J;  1P4W A;  3U9G A;  4BXU A;  1KYW A;  2EB7 A;  1QZY A;  1X1P A;  4HBL A;  1DGW Y;  2HQ5 A;  3S3N A;  3LA7 A;  3ML6 A;  2XB0 X;  3AG4 H;  1JXS A;  2OPT A;  4PSW A;  1R5I D;  3G1L A;  3L2R A;  5LRS A;  3O2P E;  4C30 A;  1R6R A;  3M1E A;  2Z33 A;  1ZGA A;  2L5Q A;  4A0Z A;  2VQG A;  4AIJ A;  4UUS A;  3AKZ A;  2E2H J;  3VEP A;  4IRG A;  5J3L A;  1J5Y A;  2XRN A;  3CES A;  1EH7 A;  2L01 A;  1TNT A;  1NTC A;  1BW6 A;  4IL6 C;  3MZY A;  2AO9 A;  5F27 A;  5ICE A;  2AXT C;  3DEW A;  4BDY A;  2VE9 A;  4NDL A;  1I6X A;  4G8X A;  3RQI A;  5M3F J;  3T1B A;  5KAI C;  2E5Z A;  2Y0S N;  1S7A A;  3I55 I;  1OR7 C;  3ZGK A;  1JKO C;  3HOS A;  2ZFU A;  1YRN B;  1SAU A;  4PJN A;  4BL0 B;  3LST A;  3WU0 A;  2ZC2 A;  5IPA A;  3RIR A;  2QQA A;  1GVJ A;  1LB2 A;  1ON2 A;  4QTR A;  1T98 A;  1GVD A;  3EPZ A;  3ZQH A;  4L0Y B;  4CO8 A;  5J4Y A;  4B47 A;  4Q4Z F;  1Z3X A;  4BXX J;  4M6X A;  1X1A A;  5H6R A;  1V3F A;  1HLV A;  2QQB A;  1SFU A;  2VOD A;  1MMG A;  1F4K A;  2MG4 A;  4N4O B;  3IL2 A;  2NYX A;  3MQ0 A;  2EPF A;  3WHC A;  1LEA A;  5CVV A;  3HOV J;  5H2F C;  5TIS C;  4KFC A;  1I6H J;  5LGU A;  1RPW A;  4Q48 A;  1WJF A;  4NQW A;  2K9L A;  1S5L C;  3GZ5 A;  5FLX Z;  4M3F A;  1MH3 A;  1BM9 A;  3SFI A;  2BZT A;  1O7L A;  3J80 K;  1R7J A;  3GTG J;  4E6K G;  4UNO A;  3KEO A;  4LD5 A;  3PL8 A;  4M6Y A;  4B3X A;  2CQ7 A;  1G3Y A;  2KIM A;  4ABZ A;  1F9N A;  2VT2 A;  5FGM A;  3V8L A;  4X6A J;  3I9V 2;  1BOA A;  2R7V A;  4DJA A;  1ZQ3 P;  3VYT B;  4I09 A;  2FU4 A;  3MVP A;  2K7L A;  2LY9 A;  3L2W A;  4BHB A;  2W85 A;  1VTN C;  3TO7 A;  3KET A;  2YUS A;  1K7A A;  2DXI A;  4IPA A;  5L3D A;  4NB5 A;  4G6T B;  1Y56 A;  2K27 A;  4LIT A;  2STW A;  1MBK A;  5J40 A;  1WJE A;  3CCV I;  3HPH A;  2HS5 A;  3LSM A;  4II2 A;  3U1K A;  1KQ8 A;  2XPU A;  2ZXJ A;  4ZZD A;  3KZI C;  2EWN A;  3DEE A;  4L18 B;  4DZP A;  1FBU A;  3L2C A;  3QU6 A;  3SHF A;  3W2W A;  3ABL H;  2JVG A;  2YU3 A;  3ROU A;  4BQO A;  1I1G A;  4F92 B;  4QPQ A;  2DN0 A;  3PO2 J;  3HB9 A;  2HKO A;  4EMS A;  2B63 J;  2CUF A;  1R5G A;  2EH3 A;  1ZGW A;  1JKP C;  1E17 A;  2MLK A;  3BTC A;  3A1Y A;  2YR2 A;  4AC0 A;  1DU0 A;  2DA6 A;  1H8A C;  2OC6 A;  3CMA I;  4QWQ A;  4Y3O A;  1SD4 A;  1VQ6 I;  4RGU A;  2C6Y A;  3CCR I;  1SFO J;  3LA2 A;  2X6Y A;  3DP7 A;  4DW6 A;  2M8G X;  2XAG A;  4J01 A;  4FT8 A;  2D45 A;  1R23 A;  3GTM J;  2O8X A;  2FUG 2;  4BY1 J;  1TT0 A;  2ID3 A;  1HBX G;  3I56 I;  3CQZ J;  3JRA A;  4IOA F;  4PSX A;  1UFM A;  4NNJ A;  4DYR A;  4BKX A;  1MJ9 A;  1Q1H A;  1UG0 A;  2X4H A;  1XC5 A;  3CCS I;  1KON A;  5GPA A;  5A2Q K;  3HTS B;  4IHX A;  3TMO A;  3F9K A;  2QVO A;  3IRR A;  4UHT A;  1RKW A;  3OSG A;  4L9N A;  1N25 A;  5E1W A;  1MBJ A;  4L5J A;  2ZME A;  2ZXW H;  2DA2 A;  4AVP A;  5BQT A;  5L3G A;  2HI3 A;  2L9V A;  1Q1V A;  2WA0 A;  1EA3 A;  2JK3 A;  4EEF G;  2CW8 A;  2DMN A;  1PUF A;  1ZTR A;  2F5V A;  4WXH A;  5FO5 A;  3G4S I;  4MQV A;  3BY6 A;  1RKT A;  3R0J A;  3Q5F A;  3BZC A;  5L3C A;  1Z91 A;  1V55 H;  3QU3 A;  2D1H A;  5D8L B;  4WWC A;  2KIQ A;  1SFX A;  5KVR A;  2ZJP F;  2IS4 A;  5JVG F;  1XMX A;  3DBH B;  4IHS A;  2OD5 A;  1IG7 A;  4RAY A;  2PQ8 A;  1G59 A;  4XKW A;  1R4N B;  3L1P A;  3JRE A;  4BS9 A;  3GFI A;  2GBY A;  3G6E I;  4FX4 A;  2Z5U A;  5D5X B;  3WTX C;  4BE0 A;  2QEX I;  4I98 B;  2VQH A;  2KIS A;  2HOS A;  1PDN C;  5H6Q A;  5AIQ A;  2KMU A;  3H92 A;  1ZEL A;  3CLO A;  3GVA A;  1TWH J;  1KU2 A;  2PJR A;  1OIS A;  2ZJR F;  2R92 J;  2IAI A;  4GCV A;  4FCY A;  5BOX A;  2DMP A;  3BRO A;  4AVZ A;  2DU9 A;  3F6V A;  1BR1 A;  3N97 A;  1XX5 A;  3CUQ C;  3IH2 A;  3CUO A;  4BJ6 C;  4HNV A;  4C3H J;  3SQN A;  2EA4 A;  2NVU B;  1E2X A;  3SFZ A;  2MC3 A;  2RV8 A;  4UXN A;  4E7H A;  3CC2 I;  2KRF A;  4XLC A;  1UCR A;  1YOV B;  1FLI A;  1HOM A;  2L54 A;  2L7Z A;  3HHH A;  3R60 A;  3LAJ A;  3AAF A;  3GYH X;  1ZG1 A;  3HGG A;  1YTY A;  3A01 B;  2XSJ C;  2EZL A;  2V26 A;  4KN7 X;  4KYW A;  1OLT A;  2F5E A;  3ZQQ A;  1MBH A;  5BNG A;  5J6X A;  1M1E B;  3NEU A;  1H0M A;  3QYF A;  3CCU I;  2EBI A;  1D1C A;  5EG0 B;  4A3I J;  1MMD A;  3ZCO A;  3LAP A;  2A05 A;  3BR2 A;  1K61 A;  1ZG3 A;  5DS9 A;  1AWC A;  1UHS A;  2BY3 A;  1FMV A;  1SMY F;  4RA2 A;  1IJW C;  1P4A A;  2LRD A;  3F6O A;  1WJB A;  3JRH A;  2PMZ A;  5E3O A;  3E0J B;  3ZQF A;  4UY8 I;  1R1T A;  1TWF J;  1O3T A;  4PK4 A;  4BQN A;  1MMA A;  1U5T A;  1KA8 A;  4YII A;  1QA6 A;  4HG2 A;  4HLY A;  2EZI A;  3CJN A;  3W6J B;  4CHU A;  1ZLK A;  2MLG A;  2A6H F;  3B6C A;  3DPU A;  1XSV A;  2MA3 A;  3F21 A;  4G7O F;  1UHW A;  1LEB A;  1TQI A;  4Y17 A;  1E3P A;  1MNM C;  1SFK A;  1FTZ A;  3EYY A;  4RS8 A;  3FKJ A;  3ZMD A;  3GTL J;  3K2Z A;  2HYF A;  4IVN A;  3Q9V A;  2LOO A;  4MIM A;  4ZDP A;  3FIS A;  2W57 A;  2Q2E A;  2WY7 Q;  4FHT A;  1WSU A;  3AFH A;  2CV1 A;  2P5V A;  4BAY A;  1Y0N A;  3DQV C;  4D5C A;  4AYB N;  2E36 A;  3EDP A;  2OQG A;  2DT5 A;  2G0E A;  2Y0M A;  3UNG C;  3S15 J;  2VIX A;  2LFB A;  2V9P A;  1OCR H;  1QPI A;  2ZO4 A;  2HXI A;  3J81 K;  2QKL B;  5HDG A;  3A0H C;  5LHH A;  4Z2Y A;  2DJN A;  2AS5 F;  4BE2 A;  5CJ9 A;  2ACJ A;  2E60 A;  1I5Z A;  5CKT A;  2BV6 A;  4N9H A;  3W6K B;  2H27 A;  3PIO F;  3H1C A;  2EFW A;  3SDB A;  3BOQ A;  2DYR H;  1FP2 A;  3A02 A;  4XRM A;  1BJZ A;  1DPR A;  3QPH A;  2Z99 A;  3TP0 A;  2MGQ A;  2X6X A;  3WU1 B;  3CC4 I;  4RAG A;  1XMK A;  2XPV A;  1MNE A;  1FYK A;  2JA5 J;  2GM4 A;  1XTA A;  4W97 A;  2G9W A;  1JKR C;  4KMU X;  1V5E A;  3HC7 A;  1BJA A;  4EJT A;  1FSE A;  4XSX F;  2E2J J;  3ZMS A;  1EKE A;  2LY2 A;  1AKH A;  1FP1 D;  4OIN F;  1ZK8 A;  3ZQG A;  5FD5 A;  3RZO J;  3CJR B;  1Z0X A;  4QPO A;  3BWG A;  4HX7 A;  1FYL A;  1MBF A;  2KRC A;  3KYL A;  3HRM A;  1DUX C;  4CDG A;  2WTE A;  5EGO B;  1K6Y A;  5JFR A;  3FX3 A;  2L4A A;  1REP C;  5D6F A;  2E1C A;  3PQJ A;  3G2B A;  3FXR A;  3KLN A;  4F55 A;  1GT0 C;  1F43 A;  1ENH A;  1DQU A;  1KU7 A;  4ESJ A;  5ICC A;  1G3T A;  1U6G A;  2XAS A;  3FMQ A;  5LRR A;  4ESF A;  3OYC A;  4M73 A;  2JA2 A;  3L7W A;  1DGR M;  2FSW A;  3M07 A;  4B09 A;  2DK8 A;  5LLQ A;  2HDD A;  3EQL F;  3HKZ A;  2LBF B;  2PG4 A;  3ASN H;  3PUB A;  2YSR A;  2F4O B;  2F5F A;  5JR3 A;  1BIA A;  1TTY A;  1TP4 A;  1R1U A;  3RPQ A;  1O3Q A;  2KP6 A;  3TO9 A;  2R7R A;  5M5Y J;  3IAM 2;  4LG0 A;  4RB2 C;  3CME I;  2CUJ A;  1QHH D;  2XAH A;  3NAU A;  3HM5 A;  3CJQ B;  3LOC A;  4PJL A;  1JJ8 C;  3AL0 C;  3FXM A;  3WG7 H;  2DCE A;  2K85 A;  1FT9 A;  1TLH B;  2OUM A;  1R4M B;  2HPI A;  3R0A A;  2COB A;  2CH0 A;  5FJ8 J;  3FK6 A;  2R0Q C;  2YX7 A;  3ZQI A;  2DOF A;  4XLF A;  3ABK H;  4XLE A;  4ETS A;  3BC8 A;  1R5H A;  5M5W J;  3PSF A;  4XON A;  4J19 A;  2Z3Y A;  2FXA A;  2GQQ A;  3M8F A;  1VQL I;  3TL4 X;  2J5O A;  2EFN A;  1VQK I;  4BAC A;  4CA0 A;  3M7G A;  1K6O A;  2EIN H;  4EAT A;  5LEJ A;  4RB1 A;  5C3E J;  3OV8 A;  3N4M A;  2Y75 A;  3JR9 A;  2PI0 A;  4RGS A;  3ZMU A;  3P9C A;  2HKX A;  2DTR A;  4PUS A;  3IWF A;  5J4V A;  4FTH A;  1LE8 A;  2R3S A;  3PJR A;  2WBM A;  4IO9 F;  3I64 A;  2OU2 A;  2CQK A;  4WXD A;  9ANT A;  2NAZ A;  3CMM A;  4PZJ A;  5J1Y A;  1P7J A;  1FIP A;  2COM A;  3WE3 A;  1Z7U A;  2P4W A;  2FQ4 A;  2ZME C;  2WV1 A;  3ZQ7 A;  2A6T A;  4MHG A;  2QUF A;  3OL4 A;  4XRF A;  1WI9 A;  2VXZ A;  1S72 I;  1OKR A;  4ZDL A;  1G3W A;  4OU0 A;  5J8C A;  4RAZ A;  5AIP A;  2EV6 A;  4EVI A;  1V5G A;  3FM5 A;  1VQ7 I;  5IT3 A;  1K78 B;  1CGP A;  1R58 A;  3I59 B;  4Y33 A;  4GGG A;  1YHQ I;  4BY7 J;  5F64 A;  1FBS A;  2JVH A;  3VWB A;  4BNC A;  2F5D A;  3ABM H;  3BR0 A;  1SD7 A;  2LYC A;  3EUH A;  3K1M A;  1T8I A;  4AU7 A;  4RLF A;  2DA5 A;  3J7Z I;  2JMW A;  2JSC A;  4L9T A;  4XLP F;  3OYE A;  2ISY A;  1JKQ C;  2FBH A;  1D1A A;  2JUG A;  4FQG A;  4BJ5 C;  4L0Z B;  2PEX A;  3C2G A;  3DEU A;  1Y8R B;  1LNW A;  5ILS A;  3M3Y J;  4UVA A;  2A5W A;  1WFX A;  1FOW A;  2ECB A;  2KQR A;  2VJJ A;  4RDU A;  3FXJ A;  1H89 C;  3WHB A;  4K2E A;  5DUK A;  1HW5 A;  1T08 B;  1IRF A;  1YI2 I;  5HDN A;  5IP7 J;  2V79 A;  5EEG A;  1RZ4 A;  1TW3 A;  2KIF A;  3KFW X;  3KYC B;  4H4K C;  3HOZ J;  4KDP A;  5IT9 Z;  2ELH A;  5ERI A;  5K7H A;  1HXD A;  1Z6T A;  3DLL F;  3HXL A;  2V1N A;  2E1M C;  1IRX A;  2DFE A;  5K7F A;  3OOP A;  4PJM A;  5AON A;  2M1B A;  3HOY J;  1ETV A;  2A61 A;  2XF7 A;  3S14 J;  4RGX A;  3TDZ C;  3JAM K;  4N4N B;  2STT A;  2ELJ A;  2H8W A;  3CTA A;  3E1S A;  2YX4 A;  4CYC B;  3RSN A;  2QBY A;  2IRF G;  3W6V A;  3LFU A;  4XKB A;  2CGP A;  3E6M A;  3E3V A;  2GIV A;  3GW2 A;  3S8P A;  5JHU A;  1OJL A;  3KYD B;  1LFU P;  3V7C A;  3HRS A;  2X51 A;  3CO7 C;  4N0B A;  2FNA A;  3TDU C;  1JE8 A;  2LC2 A;  1WPK A;  2BVL A;  1HDD C;  4FET A;  2HOA A;  4A12 A;  1I3Q J;  1U5T C;  2CQQ A;  1U9O A;  3OS1 A;  2UV1 A;  4LG3 A;  3JRD A;  2RVC A;  3OYD A;  2E1N A;  1SVM A;  1FX7 A;  1B9N A;  4KIG A;  4HNT A;  2QEN A;  4LLL A;  3FXK A;  2RC4 A;  4Y4R A;  1TW2 A;  4XRS G;  1G3S A;  5DCM A;  4AIH A;  3Q0U A;  3KLO A;  2FD5 A;  1YS7 A;  3NWS A;  3VDX A;  4D7N A;  1WJD A;  2QGU A;  3ECH A;  1VQ5 I;  2R7F A;  4Y15 A;  3D0S A;  1PYV A;  1R36 A;  2AQF A;  2QCO A;  3DBL B;  2H6B A;  2W25 A;  3Q9S A;  3FIW A;  3ZPL A;  3KP5 A;  3WOD F;  5FRM A;  3G1M A;  4LLN A;  2BW3 B;  2XUB A;  3K9T A;  1BBY A;  2HXO A;  3HSF A;  2CS3 A;  4H0E A;  1WHU A;  3CCL I;  2B7E A;  1IAW A;  3EUK L;  4HLX A;  1FOK A;  3GTQ J;  2XGE A;  4JX6 A;  1U9N A;  1C0W A;  2OV7 A;  3IAS 2;  3GUD A;  1WJC A;  2AQE A;  4MQ9 F;  4JX5 A;  1EV7 A;  3BQZ A;  1TL8 A;  1IC8 A;  1J59 A;  4M3D A;  2A07 F;  3S1Q J;  3WTW C;  1OCO H;  3OL3 A;  1TZL A;  1VQM I;  2TCT A;  4JK1 X;  2E35 A;  3IH3 A;  1Y8Q B;  1QU3 A;  4KNY A;  3RZD J;  5BPD A;  3HHG A;  2FQ3 A;  2A3S A;  5IP9 J;  3VPR A;  1FMW A;  2I10 A;  5L3F A;  2X1D A;  2VOP A;  4GDF A;  3H5N A;  3BR1 A;  4XLN F;  5FKO A;  2OCE A;  2O5R A;  3VOE A;  1STZ A;  2P5K A;  3GFL A;  2GAU A;  3OYG A;  1A35 A;  2QSH X;  4I99 C;  3H5A A;  1JGS A;  4ZZL A;  3S32 A;  3X2Q H;  4HZF A;  1ETX A;  2X1C A;  3QP6 A;  4ZYA A;  1Y1W J;  2VJ4 A;  1OYY A;  2RAE A;  2M9H A;  3O8H A;  3ZRG A;  5ILU A;  4ENN A;  2L02 A;  5D8K B;  4D5F A;  1FC3 A;  3JTH A;  2LF7 A;  3HIF A;  4A3D J;  3HOX J;  4IKF A;  3AG1 H;  2XAU A;  3QPL A;  1MJB A;  3ZOB A;  2M3A A;  4CUG A;  1SVO A;  2PLY A;  5GTI C;  1LJ9 A;  3OIQ A;  1QHG A;  4BXF A;  1VI0 A;  4I0A A;  3U21 A;  2ISZ A;  2W24 A;  1LDJ A;  2VBY A;  2O61 A;  4MEY F;  1XS9 A;  1ODD A;  4IHW A;  1T39 A;  1Z21 A;  3LWF A;  4YFN F;  1IUY A;  3OOU A;  3S1R J;  3LFK A;  2IXS A;  5CVR A;  4DQ2 A;  2R7U A;  3P9K A;  3MZ8 A;  4WK8 F;  3MKY B;  2CV2 A;  3OMY A;  2FMY A;  1E3O C;  3JRG A;  1W5S A;  2FOW A;  4MFE A;  4KIB A;  3CCY A;  2K9S A;  4G94 A;  3I3L A;  4XK4 A;  2BBY A;  2WAE A;  4A3C J;  4IRI A;  4HEA 2;  1U3E M;  3FZV A;  2E7X A;  5JLX A;  1S7E A;  5TGT A;  1ZRE A;  2R7W A;  4RM3 A;  2WWY A;  4HF2 A;  1FYM A;  2KJC A;  2JJ7 A;  2Z2S B;  3VYS B;  1IV6 A;  2F48 A;  5F0F A;  2MW8 A;  2X48 A;  3S2H J;  2XB5 A;  4GYG A;  4PGH A;  3L09 A;  2GA1 A;  4D9J A;  1I39 A;  4DZJ A;  5E8I A;  4G7Z F;  2F5C A;  1B8I B;  1JGG A;  3MEX A;  4C3J J;  4I6Z A;  1D0Z A;  2P7C B;  1UST A;  3ONQ A;  2CW0 F;  3V42 A;  2XSD C;  1YE9 A;  1S29 A;  2DOA A;  2P6S A;  1ETK A;  3V7R A;  3ISP A;  2O8K A;  3GEZ A;  2EZH A;  1O57 A;  4BHP A;  1GHC A;  3OYA A;  1RRJ A;  4FE4 A;  2B9S A;  3C2H A;  4KIF A;  1WI3 A;  2LP0 A;  1XGS A;  1PVE A;  3QOD A;  3WGG A;  4DYC A;  1B4A A;  2HNH A;  2K9M A;  5FKM A;  1UZC A;  4HQE A;  4Y13 A;  2F2E A;  1D3Y A;  2HDW A;  3OYF A;  2VC1 A;  3DPL C;  3ABU A;  2VPR A;  1W0T A;  3PNV A;  2DMQ A;  2L3D A;  1HQC A;  5D4R A;  3CCM I;  3V7S A;  1ZAR A;  3W2A A;  2EFO A;  2LLK A;  1J2X A;  2HEO A;  2W48 A;  2VAS A;  2AHQ A;  3CJT B;  4IJA A;  1POG A;  3EUH C;  2ZCW A;  2KKO A;  1T38 A;  1OCC H;  3I54 A;  1HF0 A;  1D0Y A;  2DA1 A;  2LDU A;  1RR8 C;  2M8E A;  2CWE A;  3T5X A;  1VQN I;  1BW5 A;  3K4C A;  1Z1D A;  3PM1 A;  4FE7 A;  5EYR A;  2EIK H;  2L9S A;  2VKE A;  2BY2 A;  4CCJ A;  4IOC F;  4HST A;  2TRT A;  3M1C A;  2H1K A;  4A6D A;  3C2B A;  1O4X A;  1RNL A;  4OWR B;  5K5Q A;  4S0H B;  4U7B A;  3FHN A;  3I71 A;  2LD5 A;  4KA4 A;  4A3J J;  2ME0 A;  2XPW A;  4ZTJ A;  4PJ0 C;  3AG3 H;  1VQO I;  5K5R A;  1Z67 A;  2B0L A;  5D6E A;  2EIM H;  4LK0 F;  2JT1 A;  5LD2 C;  1FY7 A;  4E7K A;  4ENM A;  4CCN A;  2ID6 A;  2Y69 H;  4M3B A;  2K3P A;  2GIZ A;  3D5R C;  4WX9 A;  1R9T J;  2UXX A;  2VBZ A;  3PNY A;  2E7W A;  1BR2 A;  4B1R A;  4XID A;  1XG1 A;  3CMY A;  2IGN A;  5DUI A;  4KIS A;  2RGV A;  2DT6 A;  2KRH A;  5GAD J;  2X9D A;  4DBR A;  2QQ9 A;  5CQG A;  5LHI A;  3I53 A;  2K40 A;  2NXN B;  2M4K A;  3H9Q A;  1YW8 A;  4XQF A;  4P1W A;  5EJC A;  3I4P A;  1W4M A;  2H1L A;  4YRV A;  2HQR A;  1OYI A;  4LFU A;  4R79 A;  1JUS A;  1LPQ A;  2CUE A;  3MKW B;  4UV9 A;  3FXU A;  3GME A;  1SAX A;  1VQ9 I;  1PP8 F;  1P2F A;  3D1N I;  4UVC A;  2OAZ A;  1LFB A;  2HVS A;  3RKX A;  3A01 A;  1FJL A;  4L9J A;  4XIC A;  4XL9 A;  4WXC A;  1MD0 A;  2A6E F;  4KIT B;  2DTZ A;  2H09 A;  2IPQ X;  2ADU A;  5HNH A;  3DTI A;  2V6C A;  3F72 A;  3KIO A;  3TKY A;  3QP5 A;  4XLH A;  5EG0 A;  5HLG A;  1MBG A;  2BY0 A;  3QQA A;  4YIF A;  4Q5S F;  2DPD A;  3ZN1 A;  3LSR A;  4ZH4 F;  5HOD A;  1B6A A;  1KU3 A;  4M71 A;  3S1M J;  2QSF X;  2JZY A;  3VOD A;  4XN3 A;  2XRO A;  1W36 C;  1ZR2 A;  3A4C A;  2WB1 A;  2M2E A;  3D5S C;  5CYV A;  4OAY A;  1V5F A;  1IDZ A;  5KNL A;  4I2O A;  1BN5 A;  2R7T A;  3IHU A;  2DDA A;  4Q47 A;  4U0W A;  4ZYG A;  4XRS A;  1YYV A;  2IS2 A;  4RAF A;  4RLQ A;  5J1R A;  3CC7 I;  4V2G A;  2LVS A;  4LB6 B;  2OZU A;  1MZB A;  4ZJZ A;  1APL C;  1MGT A;  2BYV E;  2DA4 A;  1ZRD A;  1X3Z B;  5B1B H;  3ZMT A;  3SDG A;  1VZ0 A;  2KDZ A;  4FAS D;  1DP7 P;  1ZAO A;  1CQT A;  2P81 A;  3MMY B;  4ANJ A;  2Y9Y A;  1S6L A;  2F4M B;  3G71 I;  5DDG A;  1WGX A;  1IXR C;  4XN0 A;  2IBD A;  1YIO A;  2QF7 A;  4HV5 A;  1HKS A;  1K4S A;  3H3V K;  2EFP A;  3E6C C;  2LH9 A;  1FOX A;  2X6W A;  1BC7 C;  1D8J A;  5DM6 F;  2F6C A;  2VLA A;  2HWV A;  4XLA A;  3CF5 F;  5GP9 A;  4EGY A;  1WJA A;  4RBO A;  2A69 F;  4MEX F;  3HL2 A;  1GXP A;  1YIT I;  1ZKG A;  3TOA A;  4B3A A;  4WCG A;  3S16 J;  3DF8 A;  2QSG X;  2K86 A;  2KT0 A;  2L9N A;  5CVU A;  1LDD A;  1WVR A;  2OTL I;  3DFG A;  3KEQ A;  4AM3 A;  4A6E A;  1K79 A;  2O0Y A;  2LY1 A;  3GXO A;  3KP6 A;  4KT6 A;  4BDZ A;  2VB6 A;  3HZJ A;  2R5Y A;  1F5T A;  3F23 A;  5D5V B;  3IWZ A;  3KP7 A;  4XKV A;  2LKX A;  2ME6 A;  1I27 A;  4A93 J;  2HPM A;  3ZP5 A;  3FMR A;  4R1H A;  4YEL A;  2PX9 A;  1W7P B;  2OCC H;  2PMZ N;  1VQ4 I;  2D1V A;  3R6S A;  1B9M A;  3UR3 C;  3K4L A;  2IP2 A;  2ZSI B;  4D7M A;  2R5Z B;  2QQ8 A; 
#chains in the Genus database with same CATH homology
 1KQ9 A;  1HST A;  1YO5 C;  2IJL A;  3ERE D;  2CO5 A;  2UWM A;  1Z05 A;  1NHA A;  3H3Z A;  2VE8 A;  4HOB A;  3RYP A;  4JBA A;  2Q0O A;  3PQK A;  3GX4 X;  1XGO A;  2P6T A;  1BI0 A;  4PCQ A;  1B1B A;  2IVM A;  3QPT A;  2GXG A;  3E5Q A;  4ZYE A;  2VBW A;  4P9U A;  2X0L A;  1IZ1 A;  4JQF A;  2O3F A;  3DXJ F;  4HQM A;  5D5W B;  4KIC A;  1J7K A;  1WRJ A;  2BEO A;  5FLX K;  2XIG A;  3BZ6 A;  3M8E A;  4M72 A;  3J80 Z;  3B73 A;  1J9I A;  2IW5 A;  3WTS C;  2M5W A;  1IXC A;  1QGP A;  1IF1 A;  3E5U A;  2NNY A;  3DKW A;  1OMI A;  3S2W A;  3JSP A;  3BPX A;  3BPV A;  3ZMV A;  1SD6 A;  4U7D A;  2HFH A;  1T0F A;  2TDX A;  3V8K A;  1YW7 A;  5F6F A;  3TGN A;  3K0L A;  3GFJ A;  3R61 A;  2HTJ A;  1WKM A;  3RKY A;  2FE3 A;  4AIK A;  4D0P A;  5CVJ A;  1ZGJ A;  1H9G A;  1KYZ A;  1ZHF A;  4EQQ A;  3HRU A;  2HDC A;  1U8R A;  1XCB A;  5CLS A;  5ICF A;  5JVT A;  3T8T A;  2LNB A;  3K1N A;  3NQO A;  1K78 A;  1T6S A;  2CSO A;  1FWZ A;  3LQQ A;  4BYY A;  1LVA A;  1O7F A;  5KK1 A;  1HW1 A;  3MFK A;  2G7U A;  5HVQ C;  1H9T A;  2IA1 A;  5DD8 A;  1MDM A;  5A2Q Z;  3WTY C;  2HR3 A;  4A0X A;  3F8C A;  1HW2 A;  2RKH A;  3RI4 A;  1OYW A;  3KP2 A;  3IRQ A;  5JI6 A;  4L5I A;  2K4B A;  2MBF A;  2O6G E;  1IXS B;  2XAF A;  3ECO A;  3GWZ A;  2LKP A;  5DEQ A;  1CF7 B;  3KE2 A;  1ZG5 A;  1MJA A;  2FRH A;  2HQN A;  3RTR A;  1ULY A;  1V4R A;  1OPC A;  2VT3 A;  3T8R A;  1IN5 A;  3I5U A;  3LQR A;  2LF8 A;  4FX0 A;  1T2K A;  3QRF F;  2DBB A;  3QOP A;  2FML A;  3FMS A;  2XKO A;  3E6B A;  4G9Y A;  2PJP A;  3F3X A;  1J0R A;  3PFI A;  1UHM A;  1Z6R A;  3K69 A;  3M9A A;  3KCC A;  1RUN A;  3E5X A;  4NHJ A;  2G7H A;  3C1D A;  4KUM A;  4KMF A;  5K1Y A;  4CXF A;  3HSE A;  3VB2 A;  5CVI A;  3CUQ B;  4U0Y A;  3COA C;  4UV8 A;  5FFZ A;  4P96 A;  3IKT A;  2EK5 A;  2UZK A;  5LBQ A;  2R7D A;  2QLZ A;  3HRT A;  4HYE A;  4LK1 F;  4O3M A;  5E20 A;  3J81 Z;  2DK5 A;  3RYR A;  1UB9 A;  5BMZ A;  4S04 A;  1QNT A;  4GYI A;  2XV4 S;  4ASN A;  4OOI A;  2XVC A;  1RIO H;  3P7N A;  1IN7 A;  4MGR A;  1BIB A;  4A5M A;  2O03 A;  3FWE A;  1YG2 A;  2PFB A;  2UXN A;  4TV7 A;  2IA0 A;  3GO5 A;  2YPR A;  3SZT A;  3L9F A;  3T0Y A;  4U0V A;  3MWM A;  2OZ6 A;  2MD5 A;  1YS6 A;  2Z9O A;  4R8H A;  4HX4 A;  1XSD A;  1ON1 A;  3GF2 A;  4G6D A;  3C18 A;  3I0T A;  1FSH A;  2OQR A;  4O6J A;  6PAX A;  1FBQ A;  5FD6 A;  3I58 A;  2WV0 A;  3BJ6 A;  5ILV A;  1XD7 A;  1MKM A;  3JW4 A;  1Z9C A;  4ESB A;  2VC0 A;  2DAO A;  4EM2 A;  2NNN A;  3WGI A;  2A5Y B;  2MH9 A;  3KP3 A;  3QAH A;  1ONV A;  2JPB A;  5E8G A;  2ZNY A;  4S05 A;  1X3U A;  4BHC A;  1QPM A;  5BS6 A;  5DYM A;  1TBX A;  1HKQ A;  3E97 A;  3G3Z A;  4M9X A;  3KP4 A;  2V1X A;  2H6C A;  2EV5 A;  1JHH A;  4ZYH A;  2A68 F;  3V8J A;  3F8N A;  2NRA C;  5E18 F;  2JPC A;  2PMH A;  2XGX A;  1PUE E;  2PBI A;  3FF5 A;  3WE2 A;  4P55 A;  1RUO A;  2XHK A;  1IW7 F;  2WC2 A;  4I01 A;  2RNJ A;  4HV6 A;  3E6D A;  3ZMZ A;  5HLH A;  2HOE A;  2PMU A;  4EGZ A;  1O3S A;  1S3J A;  3U1D A;  2FBI A;  3H3U A;  3WTU C;  3JTG A;  1XDS A;  2XKP A;  1AOY A;  1XB4 A;  5LGT A;  4U88 A;  2HTS A;  3C7J A;  5FFX A;  4P5O A;  1XCV A;  3IKV A;  1QQI A;  5H20 A;  3IC7 A;  4N9I A;  3KZZ A;  1QO0 D;  4YFX F;  2EJR A;  4HDV A;  3WTT C;  2P8T A;  3WTZ A;  4HW0 A;  2ZME B;  4HX8 A;  1A04 A;  3GFM A;  2CG4 A;  1D8K A;  4EM1 A;  2M45 A;  4OMY A;  3BJA A;  2ZNZ A;  2MH2 A;  5DD4 A;  5IT9 K;  3D5L A;  3F8F A;  3JSO A;  1LDK B;  5HS8 A;  2V1U A;  1LQ1 A;  3JAM Z;  4AWX B;  4CGZ A;  4UVB A;  4HF1 A;  5ED4 A;  4EJV A;  4ZYD A;  4EJO A;  5D4S A;  4ON0 A;  2CYY A;  4A2U A;  4RB0 A;  4MNU A;  4AD9 A;  4RGR A;  1BI3 A;  1PP7 U;  1R00 A;  4UUV A;  2RN7 A;  4ENK A;  5J8F A;  3BDD A;  4LGW A;  2DFI A;  1YFH A;  4G6Q A;  5HDK A;  5ICG A;  2QYO A;  1B59 A;  3U2R A;  3B02 A;  4A0Y A;  3MZH A;  5F1R A;  1BI2 A;  1XDU A;  2GZW A;  4G7H F;  3WTV C;  3MCZ A;  4XSZ F;  3RPU A;  1IN6 A;  5L3E A;  4OIR F;  2DPU A;  1W7P D;  2FF4 A;  2XAQ A;  1KQ0 A;  2VN2 A;  1BC8 C;  4B8X A;  2RQP A;  2V9V A;  3G73 A;  2JRT A;  3V4G A;  4ENJ A;  2KIU A;  3VFZ A;  1W7P A;  3FHZ A;  3HSR A;  1U5T B;  2EV0 A;  4M9S A;  2RDP A;  5EEH A;  2AXL A;  1WQ2 A;  3KZY A;  3O6B B;  3O3K A;  5DV5 A;  2QM3 A;  1EH8 A;  4P9F A;  1JHF A;  2OA4 A;  1U2W A;  4IXA A;  4IRH A;  1XGM A;  3TOB A;  4HDU A;  1R22 A;  2ZKZ A;  1IRG A;  4F7Z A;  5DCF A;  2DI3 A;  4XBF A;  2DQR A;  4L9V A;  1USS A;  2HZT A;  3RJP A;  1ZN2 A;  1FNN A;  1TQP A;  2ESN A;  4I02 A;  2NS0 A;  2HGC A;  1KGS A;  3HYI A;  5FB2 A;  2CFX A;  4OIP F;  1IN8 A;  3K1P A;  1SD5 A;  1FPQ A;  2P5L C;  1OR7 A;  4YFK F;  4CZZ A;  3GLX A;  2ZFW A;  4I0B A;  2L4M A;  5K5O A;  3BP8 A;  5E1X A;  4OIQ F;  1TNS A;  1U78 A;  2FEZ A;  2ETH A;  1YLF A;  4CYD A;  3RDI A;  3RKW A;  3DPT A;  2FNP A;  1L3L A;  3TO6 A;  5BPI A;  3DV8 A;  1XSX A;  4M9Z A;  3NRV A;  1XMA A;  3ELK A;  4YG2 F;  5TRD A;  2DLL A;  2ZJ2 A;  1IN4 A;  5LGN A;  4DNC A;  2H94 A;  3ABT A;  5LHG A;  3FM3 A;  4LG0 B;  2JTV A;  4PGG A;  1YQA A;  1QBJ A;  3CO6 C;  3HTU A;  1F1Z A;  5E17 F;  2M30 A;  1I1S A;  3I59 A;  4IHT A;  4QLC U;  2PN6 A;  1S7O A;  5TJJ A;  5HOO A;  4HA8 A;  2FBK A;  1YW9 A;  1XN7 A;  4IF4 A;  1XGN A;  5HS9 A;  4BQA A;  4BH9 A;  3WG9 A;  3WGH A;  3TQN A;  3L00 A;  2P7V B;  4M74 A;  5E1Z B;  3LA3 A;  4KT5 C;  4LMY A;  2DQL A;  1KU9 A;  3MAJ A;  4LLG F;  3F22 A;  1G4D A;  3BJO A;  2K4J A;  1L0O C;  1WWX A;  2EA2 A;  2J5P A;  4WF2 A;  1ZYR F;  3EYI A;  3SZP A;  1R1V A;  5L3B A;  1BI1 A;  1G6N A;  1J75 A;  2QZ8 A;  1CF7 A;  1P4X A;  1DPU A;  1MDM B;  2GA2 A;  2EFQ A;  1EH6 A;  2VBX A;  2KJB A;  3C3W A;  4RB3 C;  4MTE A;  1D5V A;  4PDK A;  2LSO A;  4HAM A;  4EJW A;  2V1D A;  2IA2 A;  1FZP B;  2VOO A;  2BE5 F;  1P92 A;  1ZH5 A;  4HF0 A;  3HUG A;  4LJZ F;  1RI7 A;  4LB5 A;  3CDH A;  4E70 A;  2GXB A;  1SFE A;  2BGC A;  1ZRF A;  3REO A;  1W5T A;  2HYG D;  2DO7 A;  3ULQ B;  3F8B A;  5LEK A;  2FOK A;  1Y0U A;  4O5V A;  2IT0 A;  2ESH A;  2OBP A;  5D5U B;  4EM0 B;  2GWR A;  1O3R A;  3J7A O;  2XAJ A;  1SMT A;  4MTD A;  2FA5 A;  3CUQ A;  4GO1 A;  2QBY B;  3FXQ A;  1QZZ A;  2W84 A;  2M87 A;  3P9I A;  1HSJ A;  3F8M A;  3R4K A;  2DW4 A;  3SXY A;  1S8N A;  5HS7 A;  1ZRC A;  2Y48 A;  2VON A;  2K02 A;  2QWW A;  4OIO F;  1DDN A;  3HOT A;  2D2W A;  3EET A;  1HKT A;  1P6R A;  4KN4 X;  4CIC A;  4A5N A;  2Q8K A;  1ZLJ A;  4EV0 A;  1GXQ A;  4GXO A;  4OMZ A;  5HLI A;  2ZBK A;  3ZN0 A;  5DCM B;  4I7H A;  3GZ6 A;  4EJU A;  1TQM A;  1P4W A;  3U9G A;  4BXU A;  1KYW A;  2EB7 A;  1QZY A;  4HBL A;  3LA7 A;  3ML6 A;  1JXS A;  5LRS A;  3O2P E;  3M1E A;  2Z33 A;  1ZGA A;  4A0Z A;  4AIJ A;  3VEP A;  4IRG A;  1J5Y A;  2XRN A;  1EH7 A;  2L01 A;  1TNT A;  3MZY A;  5ICE A;  2VE9 A;  1I6X A;  4G8X A;  3T1B A;  1S7A A;  3HOS A;  3LST A;  3WU0 A;  3RIR A;  2QQA A;  1GVJ A;  1LB2 A;  1ON2 A;  1T98 A;  4L0Y B;  4CO8 A;  4Q4Z F;  4M6X A;  5H6R A;  1V3F A;  2QQB A;  1SFU A;  2VOD A;  1F4K A;  3IL2 A;  2NYX A;  3MQ0 A;  1LEA A;  5CVV A;  4KFC A;  5LGU A;  4Q48 A;  4NQW A;  3GZ5 A;  5FLX Z;  1BM9 A;  1O7L A;  3J80 K;  1R7J A;  4UNO A;  3KEO A;  4LD5 A;  4M6Y A;  1G3Y A;  2KIM A;  1F9N A;  2VT2 A;  5FGM A;  3V8L A;  1BOA A;  4I09 A;  2FU4 A;  2K7L A;  4BHB A;  2W85 A;  1VTN C;  3TO7 A;  3KET A;  1K7A A;  4IPA A;  5L3D A;  4NB5 A;  2K27 A;  2STW A;  2HS5 A;  1KQ8 A;  2ZXJ A;  4ZZD A;  2EWN A;  4L18 B;  1FBU A;  3L2C A;  3QU6 A;  3SHF A;  2YU3 A;  3ROU A;  1I1G A;  2HKO A;  4EMS A;  1R5G A;  1E17 A;  2MLK A;  2YR2 A;  4QWQ A;  1SD4 A;  4RGU A;  2C6Y A;  3LA2 A;  3DP7 A;  2XAG A;  4FT8 A;  2D45 A;  1R23 A;  2O8X A;  1HBX G;  1UFM A;  1MJ9 A;  1Q1H A;  2X4H A;  5A2Q K;  3HTS B;  2QVO A;  3IRR A;  4UHT A;  4L9N A;  5E1W A;  4L5J A;  2ZME A;  4AVP A;  5BQT A;  5L3G A;  4WXH A;  5FO5 A;  4MQV A;  3BY6 A;  3R0J A;  3Q5F A;  5L3C A;  1Z91 A;  3QU3 A;  2D1H A;  5D8L B;  1SFX A;  5KVR A;  4IHS A;  2OD5 A;  4RAY A;  2PQ8 A;  3GFI A;  4FX4 A;  2Z5U A;  5D5X B;  3WTX C;  4I98 B;  1PDN C;  5H6Q A;  5AIQ A;  3H92 A;  3CLO A;  3GVA A;  1KU2 A;  5BOX A;  4GCV A;  3BRO A;  2DU9 A;  3F6V A;  3N97 A;  3CUQ C;  3CUO A;  3SQN A;  2EA4 A;  1E2X A;  3SFZ A;  2MC3 A;  2RV8 A;  4UXN A;  2KRF A;  1UCR A;  1FLI A;  2L54 A;  3R60 A;  3HHH A;  3LAJ A;  3AAF A;  3GYH X;  1ZG1 A;  1YTY A;  4KN7 X;  4KYW A;  2F5E A;  5J6X A;  3NEU A;  1H0M A;  3LAP A;  1ZG3 A;  1AWC A;  1SMY F;  1P4A A;  3F6O A;  1R1T A;  1O3T A;  1U5T A;  1KA8 A;  4YII A;  4HLY A;  3CJN A;  3W6J B;  4CHU A;  1ZLK A;  2MLG A;  2A6H F;  1XSV A;  2MA3 A;  3F21 A;  4G7O F;  1UHW A;  1LEB A;  1TQI A;  4Y17 A;  3EYY A;  4RS8 A;  3ZMD A;  3K2Z A;  2HYF A;  4IVN A;  3Q9V A;  2W57 A;  2Q2E A;  4FHT A;  1WSU A;  2P5V A;  4BAY A;  3DQV C;  3EDP A;  2OQG A;  2DT5 A;  2Y0M A;  2ZO4 A;  3J81 K;  5HDG A;  5LHH A;  4Z2Y A;  2AS5 F;  5CJ9 A;  2ACJ A;  1I5Z A;  2BV6 A;  4N9H A;  3W6K B;  2H27 A;  2EFW A;  3BOQ A;  1FP2 A;  1DPR A;  3QPH A;  2Z99 A;  3WU1 B;  1XMK A;  1FYK A;  2G9W A;  4KMU X;  1BJA A;  4EJT A;  1FSE A;  4XSX F;  3ZMS A;  1FP1 D;  4OIN F;  5FD5 A;  3BWG A;  4HX7 A;  1FYL A;  3HRM A;  1DUX C;  4CDG A;  2WTE A;  5JFR A;  3FX3 A;  2L4A A;  1REP C;  5D6F A;  2E1C A;  3PQJ A;  3FXR A;  3KLN A;  1KU7 A;  4ESJ A;  5ICC A;  1G3T A;  1U6G A;  2XAS A;  3FMQ A;  5LRR A;  4ESF A;  4M73 A;  3L7W A;  2FSW A;  4B09 A;  2DK8 A;  5LLQ A;  3EQL F;  2PG4 A;  2YSR A;  2F5F A;  5JR3 A;  1BIA A;  1TTY A;  1R1U A;  3RPQ A;  1O3Q A;  3TO9 A;  4LG0 A;  4RB2 C;  2XAH A;  1FT9 A;  1TLH B;  3R0A A;  2YX7 A;  4ETS A;  1R5H A;  2Z3Y A;  2FXA A;  2GQQ A;  3M8F A;  2J5O A;  2EFN A;  3M7G A;  1K6O A;  4RB1 A;  5LEJ A;  3N4M A;  3OV8 A;  2Y75 A;  2PI0 A;  3ZMU A;  4RGS A;  3P9C A;  2HKX A;  2DTR A;  3IWF A;  2R3S A;  3I64 A;  2OU2 A;  2CQK A;  4WXD A;  2NAZ A;  4PZJ A;  2COM A;  3WE3 A;  1Z7U A;  2P4W A;  3ZQ7 A;  4MHG A;  2QUF A;  4XRF A;  1WI9 A;  2VXZ A;  1OKR A;  1G3W A;  4OU0 A;  5J8C A;  4RAZ A;  5AIP A;  2EV6 A;  4EVI A;  3FM5 A;  5IT3 A;  1K78 B;  1CGP A;  1R58 A;  3I59 B;  4GGG A;  5F64 A;  1FBS A;  4BNC A;  2F5D A;  1SD7 A;  3EUH A;  3K1M A;  4L9T A;  2JSC A;  4XLP F;  2ISY A;  2FBH A;  4L0Z B;  2PEX A;  3DEU A;  1LNW A;  5ILS A;  4UVA A;  4K2E A;  5DUK A;  1HW5 A;  1IRF A;  5HDN A;  2V79 A;  5EEG A;  1RZ4 A;  1TW3 A;  2KIF A;  3KFW X;  4KDP A;  5IT9 Z;  2ELH A;  5ERI A;  1HXD A;  1Z6T A;  3OOP A;  5AON A;  2M1B A;  2A61 A;  4RGX A;  3TDZ C;  3JAM K;  2STT A;  3CTA A;  2YX4 A;  2QBY A;  2IRF G;  2CGP A;  3E6M A;  3E3V A;  2GIV A;  3GW2 A;  5JHU A;  3V7C A;  3HRS A;  3CO7 C;  4N0B A;  2FNA A;  3TDU C;  1JE8 A;  4A12 A;  1U5T C;  2RVC A;  2E1N A;  1FX7 A;  1B9N A;  4KIG A;  2QEN A;  4LLL A;  2RC4 A;  1TW2 A;  1G3S A;  5DCM A;  4AIH A;  3KLO A;  1YS7 A;  3ECH A;  2R7F A;  4Y15 A;  3D0S A;  1R36 A;  2H6B A;  2W25 A;  3Q9S A;  3ZPL A;  3KP5 A;  3WOD F;  4LLN A;  2XUB A;  3K9T A;  1BBY A;  3HSF A;  4H0E A;  1IAW A;  4HLX A;  1FOK A;  1C0W A;  3GUD A;  4MQ9 F;  1EV7 A;  1J59 A;  2A07 F;  3WTW C;  4JK1 X;  4KNY A;  5BPD A;  3HHG A;  2FQ3 A;  2A3S A;  5L3F A;  2VOP A;  4XLN F;  3VOE A;  1STZ A;  2P5K A;  3GFL A;  2GAU A;  1JGS A;  4ZZL A;  4HZF A;  3QP6 A;  1OYY A;  5ILU A;  4ENN A;  2L02 A;  5D8K B;  1FC3 A;  3JTH A;  2LF7 A;  3HIF A;  1MJB A;  2PLY A;  1LJ9 A;  4I0A A;  2ISZ A;  2W24 A;  1LDJ A;  2VBY A;  2O61 A;  4MEY F;  1ODD A;  1T39 A;  3LWF A;  4YFN F;  1IUY A;  3LFK A;  5CVR A;  4DQ2 A;  3P9K A;  4WK8 F;  2FMY A;  1W5S A;  4KIB A;  4G94 A;  2BBY A;  4IRI A;  1U3E M;  3FZV A;  2E7X A;  1ZRE A;  2WWY A;  4HF2 A;  1FYM A;  2KJC A;  4GYG A;  4PGH A;  3L09 A;  2GA1 A;  4G7Z F;  5E8I A;  2F5C A;  3MEX A;  2P7C B;  1UST A;  2CW0 F;  1S29 A;  2P6S A;  3V7R A;  3ISP A;  3GEZ A;  1O57 A;  4BHP A;  1GHC A;  4KIF A;  1XGS A;  3WGG A;  1B4A A;  4HQE A;  4Y13 A;  2F2E A;  1D3Y A;  2VC1 A;  3DPL C;  3ABU A;  2L3D A;  1HQC A;  5D4R A;  3V7S A;  1ZAR A;  2EFO A;  2HEO A;  1J2X A;  4IJA A;  2ZCW A;  2KKO A;  1T38 A;  3I54 A;  2LDU A;  2M8E A;  2CWE A;  3T5X A;  1Z1D A;  4A6D A;  1RNL A;  5K5Q A;  4U7B A;  3I71 A;  4KA4 A;  5K5R A;  2B0L A;  5D6E A;  4LK0 F;  2JT1 A;  1FY7 A;  4ENM A;  4WX9 A;  2UXX A;  2VBZ A;  2E7W A;  5DUI A;  2RGV A;  2QQ9 A;  5LHI A;  3I53 A;  1YW8 A;  3I4P A;  1W4M A;  2HQR A;  1OYI A;  4LFU A;  4R79 A;  4UV9 A;  3FXU A;  1SAX A;  1PP8 F;  1P2F A;  4UVC A;  2OAZ A;  3RKX A;  4L9J A;  4WXC A;  1MD0 A;  2A6E F;  2H09 A;  2IPQ X;  2ADU A;  2V6C A;  3F72 A;  3TKY A;  3QP5 A;  5HLG A;  4YIF A;  4Q5S F;  2DPD A;  3ZN1 A;  4ZH4 F;  1B6A A;  1KU3 A;  4M71 A;  2JZY A;  3VOD A;  2XRO A;  5CYV A;  4I2O A;  1BN5 A;  3IHU A;  4Q47 A;  4U0W A;  4ZYG A;  1YYV A;  4LB6 B;  2OZU A;  1MZB A;  1MGT A;  2BYV E;  1ZRD A;  3ZMT A;  1DP7 P;  1ZAO A;  1S6L A;  5DDG A;  1IXR C;  1YIO A;  4HV5 A;  1HKS A;  2EFP A;  3E6C C;  1BC7 C;  1D8J A;  2HWV A;  4EGY A;  4MEX F;  2A69 F;  1GXP A;  3TOA A;  4WCG A;  3DF8 A;  2K86 A;  5CVU A;  1LDD A;  3DFG A;  3KEQ A;  4A6E A;  1K79 A;  2O0Y A;  3GXO A;  3KP6 A;  1F5T A;  3F23 A;  5D5V B;  3IWZ A;  3KP7 A;  1I27 A;  3ZP5 A;  3FMR A;  4R1H A;  1W7P B;  2D1V A;  3R6S A;  1B9M A;  2IP2 A;  4WWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...