3KP3A

Staphylococcus epidermidis in complex with ampicillin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
148
structure length
136
Chain Sequence
RIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/antibiotic
molecule keywords Transcriptional regulator TcaR
publication title Structural study of TcaR and its complexes with multiple antibiotics from Staphylococcus epidermidis.
pubmed doi rcsb
source organism Staphylococcus epidermidis rp62a
total genus 44
structure length 136
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kp3A00
2EFPA 1P4WA 2DK5A 1O7LA 3P9KA 4PGGA 2Q8KA 4Q48A 3L7WA 5CVIA 1W4MA 3L09A 3CUQC 1FZPB 2XHKA 3H92A 4LMYA 4HBLA 3CUQA 3KP6A 5JHUA 2ISYA 3WU1B 2VE9A 2VBZA 3E6CC 4Y15A 1HKSA 4G94A 4FHTA 5LEJA 3G3ZA 3HTUA 1HSTA 2L4MA 4R8HA 1L3LA 3MEXA 4LLLA 1IW7F 3I64A 2G7UA 3F8BA 1YFHA 1QGPA 4KMFA 1DPRA 2DLLA 1ZN2A 4NQWA 3U1DA 2V6CA 1O3RA 4M9XA 2QUFA 4Y17A 5L3FA 3I53A 5HVQC 2IW5A 1HXDA 1DP7P 3QP6A 4HF0A 4EM1A 1KU2A 4UNOA 3ZN1A 2ESNA 4EJVA 2MC3A 3ZMUA 2Z33A 3HRTA 1IN8A 2FOKA 3LFKA 2FA5A 3I0TA 4R1HA 1J59A 1QPMA 4XLNF 2PQ8A 2QLZA 3GXOA 5FB2A 2NS0A 4AVPA 3ZMTA 4XLPF 1OKRA 4AIKA 1KQ8A 3M1EA 5L3GA 4LLGF 1E17A 2P4WA 3RI4A 1XSDA 1JHFA 3RKWA 5HDGA 3TQNA 1ULYA 1F9NA 1FYMA 4LB6B 1C0WA 1REPC 2MH2A 3DP7A 3K1MA 2O61A 2V1XA 1CGPA 4ZYGA 1IXCA 3KP2A 3ML6A 3CO7C 2E1CA 1EH6A 3FM3A 1WSUA 2QYOA 3DPTA 2IA1A 5BOXA 3DPLC 5CLSA 1W7PB 4MHGA 1F1ZA 3FZVA 1R36A 3TGNA 1FSHA 2F5DA 3R4KA 3WTWC 2A69F 3E5QA 4KMUX 2JPCA 2HEOA 1U5TB 2JRTA 3QRFF 2A5YB 1FC3A 2O03A 2H09A 1P4XA 5JVTA 1ZRCA 1J75A 2ZO4A 5DUIA 1OYYA 4H0EA 2PEXA 2K4BA 3LAJA 4P55A 2PI0A 2XAHA 3W6KB 1FBUA 1MKMA 1TQPA 4M9SA 3HIFA 2YR2A 1HBXG 4F7ZA 1FPQA 1KGSA 4BAYA 1F5TA 4S05A 6PAXA 3IKVA 4UXNA 4KNYA 5AIPA 2W25A 2PN6A 4IRHA 2PFBA 3ERED 5JR3A 3RYRA 3FHZA 4Y13A 5CJ9A 4K2EA 4A2UA 1KU7A 3R0AA 3HOSA 2BEOA 4G7ZF 3TKYA 1KYZA 3LQRA 4WXHA 1SD5A 4MEYF 3T8TA 3KP5A 1ZGAA 5EEGA 1ZAOA 2EA4A 1J9IA 5FO5A 2DPDA 1O7FA 1Z05A 1BIAA 5F64A 2GZWA 3K9TA 4HV6A 3K69A 4OINF 2DO7A 1LB2A 5K5RA 3E6DA 1R5HA 2VT3A 2OQGA 2MLKA 3V4GA 3EYYA 2H27A 5BPDA 4EV0A 3J80Z 3MZHA 3KETA 2PLYA 2CG4A 1OYWA 1XGOA 2LDUA 1DDNA 1YS6A 1TQIA 4S04A 2M30A 3JSPA 4HYEA 3F8MA 1W7PA 4WCGA 3QP5A 5JFRA 5EEHA 3F21A 3DKWA 4HQMA 1ZG1A 5FD6A 1RZ4A 5D8LB 1U5TC 1A04A 1O3QA 4NB5A 2EK5A 2HWVA 4HDVA 3OV8A 4A5NA 3EETA 1R00A 1U5TA 4BHPA 4YFXF 2DQRA 4YIIA 4KIFA 1STZA 1V4RA 3C1DA 4WWCA 3S2WA 4RS8A 3VODA 2FNAA 3T0YA 4CXFA 3BPVA 2FXAA 1TQMA 4L5IA 4KDPA 2L02A 2M87A 2K27A 1G6NA 4EJWA 3KEOA 2JT1A 1BC7C 1MJBA 2H6CA 3EUHA 2EV6A 2VODA 2VC1A 2IA2A 2Z5UA 1G3SA 3KE2A 2K02A 4I0BA 3EQLF 3TDZC 4ZZLA 1ZG5A 2XVCA 3B73A 5LRRA 4CYDA 4OIQF 1Z1DA 2GXBA 1XGSA 1YLFA 2WTEA 3TOBA 2VOPA 4ETSA 1ON2A 2A6EF 4ESBA 2F5CA 3B02A 2WC2A 4ZZDA 1T39A 1WKMA 4TV7A 3WODF 3WTUC 2OD5A 5CVJA 5D8KB 1U2WA 3F6VA 1XSVA 2HTSA 2FBIA 2D45A 4L0YB 4HX7A 4MTEA 2FNPA 2M45A 2DFIA 2CYYA 3RPQA 3ZPLA 1I5ZA 5H6RA 5LHGA 3N4MA 2A3SA 5D5WB 2YPRA 2EFWA 4Q4ZF 2DPUA 3CUOA 3CO6C 4KICA 5E1WA 4EQQA 5ICCA 1FBQA 5J6XA 1YW7A 3KP4A 2DT5A 3ZMSA 4BHCA 2XAFA 5HDNA 2XRNA 1JGSA 2ZJ2A 4U7DA 4WK8F 2A6HF 5A2QZ 2K86A 2E1NA 3R0JA 1ONVA 3WE2A 2VXZA 3I4PA 3I59B 1F4KA 4O3MA 1Z91A 5BS6A 1J0RA 4MQ9F 1HKTA 2QM3A 2P8TA 4B8XA 3T1BA 4OIRF 3GFMA 4HX8A 2GQQA 3E5UA 2P7VB 3J80K 3GWZA 5HDKA 1GHCA 2KKOA 3EYIA 1ODDA 3V7RA 5FD5A 2GWRA 2GIVA 2J5PA 1LQ1A 2KJBA 3J81K 1R1VA 2VONA 1DPUA 3R60A 1KYWA 5FGMA 5ILVA 3K0LA 3QPHA 3I71A 4O5VA 4OMYA 4OOIA 2UZKA 1U6GA 3KLOA 3R61A 4MTDA 3NRVA 2ZMEB 1TBXA 4RB2C 4AIHA 1GXQA 1OMIA 2MD5A 1LDKB 2ACJA 4UV8A 4QLCU 1J5YA 2HTJA 1ZARA 3LWFA 3FM5A 3FF5A 1QQIA 4IRGA 3F8FA 1B59A 3KCCA 1V3FA 3RIRA 5IT9Z 2FQ3A 3V8JA 5H6QA 3T5XA 3LA3A 2FE3A 3GZ6A 1XSXA 5D6EA 1OPCA 3MFKA 1FWZA 3I59A 4I2OA 3GFJA 5E1ZB 4R79A 2COMA 1IN7A 1D8KA 4LG0B 1UFMA 4P9FA 3IL2A 4IPAA 4G8XA 1I27A 3EDPA 1IN4A 4GO1A 1BI0A 4N9IA 2HGCA 2NNYA 2ZKZA 3ZP5A 5HS7A 3REOA 1XD7A 2LF7A 2P6SA 5FFXA 4UVBA 2ETHA 1S8NA 5LRSA 4G6QA 3K2ZA 2L3DA 3QPTA 2FSWA 4YFKF 2F5FA 4N9HA 4UHTA 2G9WA 3GFIA 2JPBA 3HTSB 2ZBKA 3HYIA 1WQ2A 3WGGA 3LAPA 3HOTA 3VOEA 1XGNA 5E8IA 1BI1A 1BOAA 3BJAA 1XGMA 5L3CA 1KQ9A 5HOOA 2R7DA 4G7HF 1XN7A 1YS7A 1KU9A 4QWQA 4BH9A 3JTGA 5DUKA 2ZMEA 5A2QK 4KYWA 3HRSA 1CF7A 4YG2F 3BWGA 3CTAA 2DQLA 2H6BA 2W85A 1IAWA 3T8RA 4A6DA 4ZYHA 2O8XA 4OMZA 2EJRA 4M72A 1IXSB 2QWWA 3PFIA 2A07F 4FX0A 1Y0UA 4WXDA 2YX4A 2VBXA 4HX4A 1BC8C 1P6RA 3M8FA 3BPXA 2IJLA 4A0XA 2IA0A 3SQNA 2DTRA 2WV0A 2ZCWA 3BJOA 2XAQA 5DEQA 5J8CA 2FRHA 2KIUA 3FXUA 3ZMVA 1UHWA 2UXNA 3G73A 4CO8A 4L9TA 3BDDA 4G6DA 4RAZA 3LSTA 4WX9A 4L0ZB 2XAJA 1LNWA 2RN7A 1FOKA 2BV6A 3CLOA 5TRDA 1TNTA 2BGCA 2ESHA 2B0LA 4LG0A 2HZTA 4CZZA 3F72A 1P2FA 1B9MA 2YSRA 5BMZA 5DV5A 3SZPA 3JSOA 1RIOH 2NRAC 5KVRA 4I02A 1MDMB 1H9TA 2MBFA 3F8CA 3JAMZ 5LLQA 2HDCA 4EJTA 3E5XA 3TO6A 2P5LC 3J7AO 3F6OA 3O3KA 3M9AA 4JK1X 3U9GA 5IT9K 1YG2A 2GA1A 1RUOA 4LLNA 2V9VA 2CGPA 1WI9A 2FBHA 5DD4A 3K1PA 3PQJA 2NAZA 5FFZA 4ASNA 4M6XA 2K7LA 3I58A 3JTHA 5CVUA 2G7HA 3HRUA 3F23A 4IHSA 2MH9A 1OR7A 2P5KA 3GW2A 5DD8A 1U78A 3MQ0A 3TO9A 4L18B 3CJNA 1LJ9A 3DV8A 1BBYA 5ICFA 1QZZA 3J81Z 3RTRA 2IT0A 1Q1HA 4M71A 3Q9SA 3F3XA 4ESFA 5LHIA 1EH8A 1W5SA 2HKXA 2PJPA 3P9IA 1BJAA 2RGVA 2XV4S 3KP7A 4RB0A 1S6LA 4KUMA 3GVAA 2M1BA 4KIGA 2Z3YA 4A12A 3ECHA 3PQKA 5IT3A 2H94A 5F6FA 1O57A 4Q47A 5L3BA 1HW2A 3IRRA 3Q9VA 3L2CA 5E8GA 2HKOA 5ILUA 2AXLA 4Q5SF 3ZMZA 2YX7A 1XB4A 1AWCA 2O3FA 1MDMA 2RVCA 2Y75A 4EGZA 5BPIA 3FMSA 1K6OA 4LJZF 5E17F 2NNNA 3HSRA 3HHGA 2V79A 2W57A 2MLGA 2DI3A 2VBYA 3IRQA 2GXGA 1FSEA 2EV0A 1KU3A 4RB3C 3WU0A 3HHHA 3KEQA 4ENNA 2F5EA 3ULQB 3C3WA 1W5TA 3WG9A 2YU3A 2HS5A 3TDUC 2FEZA 4PDKA 2HFHA 1SFUA 3SFZA 3DFGA 4KFCA 1R7JA 2Q2EA 2IVMA 2QBYB 2LKPA 2DU9A 1IN6A 2F2EA 1R5GA 2A61A 1O3SA 4ZH4F 1LEAA 3BY6A 4MEXF 1FP2A 2CSOA 3GX4X 4EGYA 3BOQA 5LGNA 5D5XB 4U7BA 3D0SA 2Z99A 3KP3A 1LVAA 2OU2A 4PGHA 1YYVA 1SFXA 2BYVE 1R22A 4A0YA 5D5VB 3JAMK 1I1GA 2BBYA 1UCRA 3FXRA 3COAC 3LA2A 3FX3A 1ZREA 3ABTA 2QVOA 2VBWA 5DYMA 1S3JA 1NHAA 2VOOA 4ZYDA 1D3YA 3MWMA 1RUNA 2X4HA 3ZMDA 1MD0A 5D4SA 3DF8A 1SD6A 4I7HA 2STTA 5LBQA 2UXXA 3IWFA 4N0BA 2M5WA 2W84A 1T2KA 3MAJA 3GYHX 5D6FA 2ADUA 1FY7A 1PDNC 2ISZA 4D0PA 5DCMB 2OZ6A 1B9NA 2NYXA 2R3SA 3NQOA 2EFOA 3I5UA 3FXQA 2VN2A 4M73A 5LHHA 1LDDA 2RV8A 4KT5C 1HSJA 1SAXA 1R1TA 3QOPA 5DDGA 4HF1A 4G7OF 3HSFA 2D2WA 2WWYA 2QENA 1LEBA 2QBYA 5E1XA 2DW4A 2VC0A 1X3UA 3LQQA 4UV9A 1CF7B 2JSCA 4IHTA 3V7CA 4ON0A 4BXUA 1ZRDA 2R7FA 4E70A 4AD9A 5BQTA 4GCVA 3ZN0A 1D8JA 2QZ8A 4CDGA 1G3WA 5ERIA 4L9JA 4NHJA 4G9YA 2GA2A 4KIBA 3O2PE 3RJPA 1K78B 2HYFA 2JZYA 3OOPA 2O6GE 5ICEA 2CQKA 4PCQA 3VEPA 2IRFG 1BI3A 2J5OA 4M6YA 1XCVA 1FNNA 2HOEA 4CICA 4ESJA 4A0ZA 4RGRA 2KRFA 3QU3A 4DNCA 5ED4A 1O3TA 5K5QA 1IUYA 3SHFA 2FBKA 4JBAA 2HQNA 1JE8A 3F8NA 1HW1A 1B4AA 2QQAA 2TDXA 1L0OC 3P9CA 2XKOA 1U8RA 1IZ1A 2XUBA 5LEKA 1FLIA 4ENMA 3IC7A 5KK1A 4FT8A 1ZLKA 5ILSA 4A6EA 5DCMA 4B09A 4AWXB 3SZTA 4AIJA 3GUDA 2EA2A 1FP1D 1WWXA 5K5OA 1HKQA 4OIPF 1XCBA 4HA8A 3RKYA 1LDJA 4LD5A 2V1UA 2EV5A 1U3EM 1SMYF 3WTTC 4KN4X 4DQ2A 1FT9A 3ELKA 4ENKA 4I0AA 3N97A 1E2XA 3RPUA 2OBPA 1UB9A 3KZZA 2XKPA 4GGGA 5L3EA 4WF2A 1XDUA 4IF4A 2UWMA 1AOYA 5D4RA 4EVIA 3IHUA 5HLGA 5H20A 3V7SA 5LGTA 4IVNA 1FYLA 1FYKA 3E6BA 4UVCA 2EFQA 1XDSA 4RAYA 2CWEA 3RYPA 4HF2A 1JXSA 1TTYA 5FLXZ 3KZYA 2P6TA 3H3ZA 4IJAA 2M8EA 4MQVA 5JI6A 3M8EA 1BN5A 1R58A 2HQRA 1K78A 1IRFA 5HS9A 1T98A 4LK0F 2RNJA 1OYIA 3L9FA 2OQRA 2LF8A 4UUVA 3ECOA 2X0LA 2CW0F 2C6YA 3FMRA 1SD7A 4HOBA 1EH7A 1SMTA 2K4JA 2W24A 1IXRC 3GZ5A 2RQPA 3NEUA 1T6SA 4EJUA 4YFNF 4BHBA 1YQAA 2HR3A 1DUXC 1KA8A 1PP8F 4HV5A 3AAFA 4BYYA 1BI2A 1MJ9A 2PMHA 3C7JA 1SD4A 3HRMA 3VFZA 4U0VA 1QO0D 4L9VA 2STWA 5HS8A 4KA4A 4A5MA 2L54A 2FU4A 3ROUA 1G4DA 1G3TA 3E6MA 2XASA 4M74A 2ELHA 2DBBA 3I54A 1S7AA 2Y48A 1VTNC 5D5UB 5LGUA 3WGIA 3TO7A 1PUEE 3TOAA 1ZLJA 3H3UA 2P5VA 4RGXA 1HW5A 4ZYEA 4HLYA 2ZFWA 5E20A 2GAUA 2D1VA 1XMAA 4CGZA 4EM2A 4EM0B 1H9GA 2Q0OA 1BM9A 4U0YA 3E97A 2QQBA 4U88A 2JTVA 1WRJA 5TJJA 2RDPA 1UHMA 3F22A 4UVAA 2O0YA 1USSA 1PP7U 3P7NA 2XGXA 4XSZF 2Z9OA 3WTZA 3DXJF 2HYGD 4WXCA 1RI7A 4JQFA 3W6JB 4P96A 3WGHA 1QNTA 2KJCA 5J8FA 2V1DA 1QZYA 2D1HA 4MGRA 4MNUA 5AIQA 3BJ6A 1KQ0A 1MJAA 2E7XA 1J2XA 1TW2A 2P7CB 3MCZA 2EB7A 1Z6TA 3VB2A 1FX7A 5E18F 3IKTA 4IRIA 1IRGA 2EWNA 4RGSA 1ZHFA 2CFXA 2E7WA 4GYIA 5HLIA 2ZNYA 4I01A 5K1YA 3WTYC 5FLXK 5DCFA 4I09A 1T38A 4BQAA 1TW3A 1ZYRF 2OZUA 2L01A 1BIBA 3WE3A 4IXAA 4LGWA 1G3YA 3FMQA 3IWZA 4LB5A 1YTYA 2RC4A 1USTA 1K79A 3RDIA 4GYGA 4U0WA 3Q5FA 1XMKA 4YIFA 2L4AA 3LA7A 3DEUA 3L00A 5F1RA 2LNBA 1MGTA 2FMLA 4PZJA 3MZYA 5ICGA 3O6BB 1R1UA 3HUGA 1J7KA 2ZNZA 3GO5A 3GF2A 3WTVC 4RGUA 3D5LA 5CYVA 3FWEA 3GLXA 4P5OA 1YW9A 1P92A 1I1SA 3U2RA 1B6AA 5L3DA 3BZ6A 3BP8A 1Z9CA 1R23A 2AS5F 1MZBA 1S29A 1S7OA 2OA4A 2PBIA 1SFEA 1P4AA 2XROA 2MA3A 3C18A 3CDHA 5HLHA 1ON1A 2ZXJA 1B1BA 3BROA 1I6XA 4CHUA 3V8LA 3KFWX 1K7AA 1ZH5A 2Y0MA 3R6SA 2IP2A 1FBSA 3ZQ7A 3CUQB 3KLNA 2IPQX 2FF4A 1QBJA 3SXYA 4XBFA 2VT2A 4FX4A 4HDUA 4GXOA 2CO5A 4I98B 4HZFA 2A68F 3K1NA 2QQ9A 3V8KA 4LK1F 1Z6RA 3ABUA 2VE8A 4XSXF 2LSOA 1HQCA 3WTXC 3DQVC 2DK8A 1D5VA 1IF1A 2FMYA 4OU0A 4KN7X 4LFUA 4BNCA 3ISPA 1T0FA 4RB1A 2RKHA 3QAHA 4ENJA 2DAOA 2OAZA 4EJOA 3JW4A 4HAMA 1YW8A 4HLXA 1YIOA 1H0MA 1RNLA 1W7PD 3RKXA 3M7GA 1JHHA 1Z7UA 3GFLA 4HW0A 1GXPA 1YO5C 2KIMA 2PMUA 4O6JA 4M9ZA 5CVVA 4P9UA 4Z2YA 2KIFA 2PG4A 5CVRA 2XAGA 1TLHB 1ZGJA 1ZG3A 3HSEA 1ZRFA 2BE5F 1TNSA 2EFNA 4L5JA 1GVJA 2XIGA 1EV7A 3E3VA 3GEZA 3WTSC 1IN5A 4OIOF 3QU6A 4L9NA 4XRFA 4HQEA 4EMSA 5AONA
chains in the Genus database with same CATH superfamily
4XORA 1QRYA 4BACA 4Z6YA 1ZQ3P 2EFPA 3PO2J 4DZPA 1P4WA 2DK5A 4XN3A 2VJJA 1O7LA 2QGUA 3P9KA 4PGGA 2Q8KA 4Q48A 3L7WA 5CVIA 5HLTA 5J4VA 1W4MA 3L09A 3CUQC 2E5NA 3S1RJ 3I3LA 1FZPB 2XHKA 3H92A 4LMYA 4HBLA 1A6QA 1XTAA 3SDGA 2GM4A 1QU3A 3CCYA 3CUQA 4E6KG 3KP6A 1Z77A 1FIPA 2ISYA 5JHUA 3WU1B 2VE9A 2VBZA 5E3OA 3E6CC 4Y15A 1HKSA 2DDBA 4UUTA 4G94A 1R4NB 2V1NA 4FHTA 5LEJA 3G3ZA 3HTUA 1HSTA 2L4MA 4AM3A 3RQ4A 4R8HA 3GLLA 1L3LA 3SDBA 3MEXA 4LLLA 1IW7F 3I64A 3JRCA 3DBRB 2G7UA 3F8BA 1YFHA 1QGPA 4KMFA 1DPRA 2DLLA 1ZN2A 4NQWA 3TP3A 3BCAA 3PM1A 2V6CA 3U1DA 1O3RA 2XSDC 4M9XA 2QUFA 1XC5A 4Y17A 2V6EA 5L3FA 3I53A 5HVQC 2IW5A 1HXDA 1DP7P 3QP6A 4HF0A 4EM1A 4GRIA 2HI3A 1NTCA 1KU2A 4E7HA 3ZN1A 4B3XA 2ESNA 4HPQA 4EJVA 2MC3A 3ZMUA 4UNOA 2M34A 2HXIA 2Z33A 3HB9A 5F08A 3GTLJ 3GTQJ 5IP7J 3HRTA 4DW6A 1LE8B 2N8GA 1IN8A 2X48A 2FOKA 4HNTA 4F3QA 3LFKA 4RBOA 3DLAA 3H3VK 2FA5A 3I0TA 4R1HA 4OWRB 2R5YA 1J59A 1QPMA 2DMNA 3K70C 1BW6A 4XLNF 2PQ8A 2QLZA 2AHQA 1IUFA 3GXOA 1BW5A 5FB2A 2NS0A 4AVPA 1IRZA 3ZMTA 1YE9A 2WAEA 4XLHA 4XLPF 2QA4I 2NS7A 1OKRA 4AIKA 4E7KA 1KQ8A 3M1EA 2E5ZA 3VYSB 5L3GA 4LLGF 2E1OA 4XNFA 3CCEI 3OSGA 1WI3A 1E17A 2P4WA 3OIOA 1MBFA 4YRVA 3RI4A 1XSDA 1X4PA 1JHFA 3RKWA 5HDGA 2XC7A 3TQNA 1ULYA 1F9NA 1FYMA 4LB6B 4PFOA 4CCJA 1C0WA 1MMAA 1REPC 2ZJPF 2MH2A 3DP7A 3K1MA 3KZIC 3LSGA 2OPTA 2VIXA 1ETKA 2H8WA 3GTJJ 2O61A 2V1XA 3RCOA 3A02A 3A2KA 1CGPA 4ZYGA 3UNGC 2LG4A 1IXCA 3KP2A 3ML6A 3CC4I 2RREA 4AIDA 2R5ZB 1A6IA 2JVHA 3I4NJ 3CO7C 4BE1A 2E1CA 1EH6A 2JA7J 3S15J 1SVOA 3FM3A 4DBRA 1NG7A 1U9NA 1WSUA 1HOMA 1UG2A 1JTYA 2QYOA 3DPTA 3CMEI 3CESA 2VB6A 4FASD 2IA1A 5BOXA 3DPLC 5CLSA 2QSHX 4CCOA 1YJWI 1W7PB 4MHGA 3BZCA 3HOYJ 4XL9A 3HEFA 1F1ZA 3FZVA 1R36A 2FD5A 2M3AA 3OYJA 4BY1J 3TGNA 4F91B 1T8IA 3M07A 2F5DA 3R4KA 3WTWC 2M8GX 1FSHA 3HGYA 3L1PA 2A69F 3E5QA 5IP9J 4KMUX 3S3NA 2JPCA 2KZVA 2I5UA 2Z2SB 3A0BC 2HEOA 5IPAA 1U5TB 1XS9A 1ITYA 3LOCA 1NH3A 1Y39A 2JRTA 3QRFF 1GV2A 2IS2A 2A5YB 1FC3A 2JWTA 2O03A 3EUAA 2H09A 1P4XA 5EF6A 4J00A 3CCRI 1ACIA 5JVTA 2V4JC 1J75A 1ZRCA 3U21A 1VQLI 2ZO4A 5DUIA 2M0MA 5FKNA 4DYCA 1OYYA 4CSWA 4H0EA 3ABMH 3H1CA 2PEXA 2K4BA 3LAJA 4P55A 2PI0A 2YS9A 1BA5A 2XAHA 3W6KB 1FBUA 1MKMA 1WHUA 1TQPA 2R7TA 3H36A 4A3KJ 4M9SA 3HIFA 1E3OC 1IG7A 2YR2A 1LE8A 1HBXG 1Z67A 4F7ZA 1FPQA 1KGSA 4BAYA 1F5TA 4S05A 3A0HC 3VSKA 6PAXA 3IKVA 4UXNA 2IEKA 4KNYA 4UY8I 5AIPA 3BZKA 1MSFC 2W25A 4XONA 3VWBA 2PN6A 1N25A 4IRHA 2PFBA 2L0KA 3ERED 5EJCA 5JR3A 4NC6A 3RYRA 2BVLA 4Y13A 3FHZA 3MVPA 5CJ9A 4K2EA 4A2UA 2RNGA 2EZHA 1G59A 2EIKH 3TBIA 2ICWG 1WVRA 1KU7A 3R0AA 2CJJA 2DOEA 2BEOA 3HOSA 4G7ZF 3TKYA 1KYZA 3LQRA 4WXHA 1SD5A 4MEYF 2CRGA 3T8TA 1YJNI 3KP5A 1ZGAA 1WH7A 5EEGA 4NNJA 1ZAOA 2EA4A 1J9IA 3C2HA 5FO5A 2GIZA 4BJ5C 2DPDA 3HUGB 1O7FA 1MMNA 1Z05A 1BIAA 3ONQA 5E3NA 2DODA 5F64A 2GZWA 1W36C 3K9TA 4HV6A 2ELKA 2R5ZA 2MSYA 3K69A 2R7WA 1ZR4A 4OINF 2DO7A 2G0EA 2LRDA 1ZGWA 5K5RA 1LB2A 3E6DA 5J1RA 1R5HA 4PFPA 2VT3A 1LFPA 3LSHA 2OQGA 3H0GJ 2MLKA 3K10A 3V4GA 3EYYA 1WFXA 2H27A 5BPDA 4EV0A 1B8IA 3J80Z 3MZHA 3KETA 2PLYA 2CG4A 1OYWA 1XGOA 2LDUA 2MG4A 3KX2A 1DDNA 3KIOA 1YS6A 1TQIA 3ZGKA 1ZKGA 4S04A 4IHWA 2M30A 3LMMA 2DFHA 1TC3C 1I39A 4Y7NJ 2X1DA 3JSPA 1VQ8I 4HYEA 3F8MA 1W7PA 1ZK8A 3FHNA 4WCGA 2DDAA 1XX5A 3QP5A 3P5JA 5JFRA 5EEHA 2MYSA 2BY0A 3F21A 3DKWA 4HQMA 1ZG1A 2LK2A 5FD6A 1R49A 1FIAA 1RZ4A 5D8LB 1U5TC 4XLCA 2EPFA 1A04A 1O3QA 4NB5A 2EK5A 2HWVA 4HDVA 3OV8A 4RA2A 2GLOA 4A5NA 2HDWA 3EETA 4GFBA 4M3EA 2COBA 1R00A 2F5VA 1BR1A 1U5TA 4BHPA 4YFXF 1AA7A 4JX4A 2DQRA 3DTEA 4YIIA 4KIFA 3HOWJ 1WJAA 1U9OA 1STZA 2QSFX 3A4CA 3FXMA 1V4RA 2M9HA 3C1DA 4WWCA 3S2WA 4RS8A 3QQAA 3VODA 2FNAA 4C3IJ 3T0YA 4IHXA 1YI2I 4X1EA 2BOLA 4CXFA 5IY5H 3ZQIA 4RAGA 2VI6A 2KMUA 4JP0A 2L2OA 5GTHC 2DT6A 3CQZJ 3S1NJ 4X6AJ 1MBGA 5J1UA 3ZQHA 3BPVA 1VQNI 2FXAA 1TQMA 4L5IA 2ELJA 4KDPA 2L02A 2M87A 3BG9A 2JA6J 2K27A 1G6NA 2XF7A 2CUJA 3EUHC 4EJWA 3KEOA 4KITB 3NAUA 2JT1A 1R71A 2ID3A 1MJBA 1BC7C 2H6CA 3EUHA 2EZIA 2EV6A 2VODA 4A3EJ 1WZ2A 2VC1A 2IA2A 2Z5UA 1G3SA 1Y1VJ 3KE2A 1RETA 2K02A 3MN2A 4HSRA 4I0BA 3EQLF 1YHQI 3TDZC 1V5FA 4ZZLA 2LC2A 1ZG5A 1FMWA 2XVCA 2AQFA 3B73A 3HOUJ 3OYDA 5LRRA 4X0GA 4CYDA 4OIQF 1Z1DA 3TMOA 2GXBA 3A01B 3CCJI 2DA6A 1XGSA 2R7RA 2ZJRF 5EEAA 1E0EA 4ITVA 1YLFA 4E4HA 2NS8A 2WTEA 3TOBA 4D5FA 2VOPA 4BE2A 4ETSA 1RC9A 1ON2A 2A6EF 4ESBA 2F5CA 3PIPF 3B02A 2XGDA 2L7ZA 3K4MA 4XRSA 2WC2A 4ZZDA 5F0CA 2O5RA 1T39A 1WKMA 2WAQA 1T33A 5EGOB 4TV7A 3WODF 4A3MJ 3WTUC 2OD5A 5CVJA 1EJ9A 5FRNA 5D8KB 3HL2A 1U2WA 3F6VA 1XSVA 2HTSA 2FBIA 2JMWA 2M0CA 1HC8A 2D45A 5M3FJ 4L0YB 4HX7A 3KYCB 4MTEA 2FNPA 2LMDA 4B47A 2K9NA 2M45A 1XMXA 1IDZA 4V2FA 2DFIA 1D0ZA 4DOZA 2CYYA 4OAYA 3RPQA 3S8PA 5C3EJ 1UELB 1JI8A 3ZPLA 2X9DA 2R7SA 4IZZA 1VQ4I 1QHGA 1I5ZA 2X6OA 2CQ7A 2Z1DA 4UB8C 5H6RA 5JHFA 5LHGA 2A3SA 3N4MA 3H9GA 5KAIC 2CQQA 1WJEA 5D5WB 2YPRA 4RLQA 2R7QA 2HU9A 1ETXA 2EFWA 5IOYA 4Q4ZF 2DPUA 3A03A 3CUOA 3CP2A 5J4YA 4BBRJ 3CO6C 4KICA 5E1WA 4EEFG 4EQQA 2XPUA 5ICCA 1FBQA 3CCVI 5J6XA 1YW7A 2CW7A 2XF6A 2HPMA 2ZXIA 3OWTA 3KP4A 2DT5A 3FXJA 3ZMSA 2A5WA 4BHCA 2DMTA 2XAFA 5HDNA 1GV5A 3KPHA 3JRHA 3FKJA 2XRNA 2ME0A 4M3GA 3LNQA 4M6VA 3HJEA 1JGSA 2CQXA 2ZJ2A 4YIRX 4U7DA 4WK8F 2GXAA 1T08B 5H2FC 2A6HF 1OCZH 3E7LA 5A2QZ 4KJZA 2K86A 2CH0A 2E1NA 4BL0B 3IH2A 3R0JA 2IGKA 1ONVA 3WE2A 2VXZA 3I4PA 3I59B 2FOWA 2XSJC 4HNUA 2R7XA 4MFDA 1F4KA 4O3MA 2HXOA 3GTOJ 2DYSH 4NQWB 1Z91A 1W1WE 1J0RA 5BS6A 5TGTA 3CZ6A 5E3LA 2JVGA 3GTKJ 4MQ9F 1X1AA 1HKTA 1X19A 2QM3A 3ABLH 2P8TA 4B8XA 1P9QC 3T1BA 2PMZA 2L7FP 4DJAA 4OIRF 3GFMA 4HX8A 1TWGJ 2GQQA 1Z0XA 3V42A 1MNDA 1SC7A 3E5UA 3IUOA 2P7VB 3J80K 4NC7A 3OYLA 3GWZA 5HDKA 2XF5A 1GHCA 2WBMA 2KKOA 2R5YB 3EYIA 3A01A 1ODDA 1QA6A 3V7RA 1CQTA 2WADA 3FDYA 3FXOA 5FD5A 2GWRA 2GIVA 2V9PA 1X4OA 2F48A 2J5PA 1LQ1A 1JKPC 2KJBA 4XOTA 3J81K 2VPLA 4LG3A 2NVUB 3ZQQA 4NUBA 4BY7J 4B48A 3OIPA 4FQGA 1R1VA 4PJMA 1IDYA 2VONA 1DPUA 3PIOF 3R60A 4Y52J 1KYWA 3N05A 2O9LA 1Y1WJ 4C30A 4XMYA 2QEXI 2DOAA 5FGMA 4BKXA 3K0LA 5ILVA 2JSPA 4G6TB 1K61A 3A1YA 3QPHA 1K6YA 2B7EA 1B72B 2K85A 3CCSI 3I71A 5DM7F 4O5VA 5K7ZA 4OMYA 4OOIA 2FQ4A 2UZKA 1U6GA 3KLOA 3R61A 4MTDA 3NRVA 4MLOA 2ZMEB 1TBXA 3U1KA 1A5JA 1YIJI 2CV2A 3J7ZI 3PUFA 4RB2C 4AIHA 3C2BA 1D1CA 1WGXA 1GXQA 1OMIA 2MD5A 3PJRA 1LDKB 2ACJA 2XAUA 4UV8A 5C44J 5M3MJ 1LPQA 2DFEA 4QLCU 3BG3A 1F36A 1J5YA 2HTJA 2OC6A 1ZARA 3LWFA 4YEJA 4XN0A 1R9TJ 2LY9A 3FM5A 3FF5A 1JKQC 1QQIA 2BY2A 3K4BA 4BJ6C 1S9HA 3OR2C 4IRGA 2X85A 3F8FA 1B59A 4A3CJ 3BR5A 5E3MA 1YX5A 3KCCA 4RDUA 3ERMA 1V3FA 1MH3A 3RIRA 3S2HJ 2E2HJ 5IT9Z 3HBLA 2R7OA 2CV0A 2FQ3A 4XKBA 4ZDOA 2RQQA 3V8JA 4E7JA 2OCEA 4PSXA 4A93J 2EILH 3OSFA 1NG6A 5H6QA 3T5XA 3LA3A 2FE3A 4J01A 3GZ6A 1XSXA 3JRGA 5D6EA 5J47A 1OPCA 2KDZA 3MFKA 1FWZA 3I59A 3VSLA 4I2OA 3RZDJ 3GFJA 1P7JA 5E1ZB 4R79A 2QSGX 1JJ8C 2COMA 1IN7A 1YRNB 1D8KA 2EBIA 3D5SC 1ETYA 4LG0B 4CA0A 1UFMA 1QZEA 2Y0SA 2WY8Q 4P9FA 3IL2A 4IPAA 4BE0A 4G8XA 1I27A 5GP9A 5EZGA 1UMQA 3EDPA 1IN4A 2JJ7A 4GO1A 1RESA 2UUZA 1BI0A 4N9IA 2HGCA 2NNYA 1JGGA 2ZKZA 3ZP5A 5GTIC 5HS7A 3LFUA 2W7NA 3REOA 1XD7A 2LF7A 5DS9A 2P6SA 3GMEA 4D7MA 5FFXA 4UVBA 4RMNA 2BXZA 2ETHA 1S8NA 5LRSA 2LY1A 4G6QA 4JOMA 1I3QJ 1WJBA 3K2ZA 2L3DA 3QPTA 1Y8QB 4A69C 1APLC 2FSWA 4PUSA 3S93A 4YFKF 3CCQI 4BDZA 2WY7Q 3S16J 3AFHA 3C2GA 2F5FA 4N9HA 3VYRB 4UHTA 2G9WA 4JX5A 3GFIA 1WJDA 2JPBA 2MC4A 2P0WA 4D7NA 3HTSB 2VQCA 2ZBKA 3HYIA 1WQ2A 2KPMA 3WGGA 3LAPA 3HOTA 3VOEA 3BTIA 1XGNA 5E8IA 1BI1A 2JA5J 1BOAA 3BJAA 4AVZA 1XGMA 1TWAJ 1KQ9A 5L3CA 2R7DA 5HOOA 4G7HF 1B72A 3S1QJ 2ZMEC 3CJTB 1XN7A 1YS7A 1KU9A 4QWQA 4BH9A 3JTGA 5DUKA 2ZMEA 5A2QK 4KYWA 3HRSA 3OOUA 4KT6A 3PSFA 4XK4A 1CF7A 4YG2F 2CFOA 2KLOA 3BWGA 3CTAA 5GADJ 2DQLA 1VQKI 2H6BA 1D0XA 1W5CC 2W85A 1IAWA 3T8RA 4A6DA 2VJIA 4ZYHA 5B1BH 2O8XA 4OMZA 1I3AA 1B8IB 2EJRA 4M72A 1DGRM 5E79C 3CC2I 1IXSB 2QWWA 2CQNA 4B4CA 3NWSA 3PFIA 1PUFB 2A07F 3WHCA 4FX0A 1Y0UA 4WXDA 3BR0A 1X1BA 3DTIA 5FKLA 2V26A 2YX4A 2VBXA 4HX4A 2DA2A 1BC8C 1P6RA 3M8FA 3BPXA 2IJLA 4A0XA 3DPUA 3LSPA 2IA0A 3SQNA 1O4XA 2EZLA 2DTRA 4A3LJ 1XG1A 5B5EC 2WV0A 3QYEA 4IO9F 3PL8A 2HZDA 4XLFA 1ETVA 3G2BA 3AL0B 2ZCWA 3BJOA 2XAQA 5DEQA 5J8CA 2FRHA 3DKYA 2KIUA 3H9JA 2VASA 3FXUA 3ZMVA 1UHWA 3ZOBA 3K4CA 2UXNA 3LSMA 3SEQA 3G73A 4CO8A 1YITI 1X1DA 1QVUA 3BDDA 4G6DA 2IBDA 4L9TA 4RAZA 3LSTA 4WX9A 2HOAA 2XAJA 4L0ZB 1Q1VA 1U8BA 1LNWA 2RN7A 1FOKA 2BV6A 3CLOA 5TRDA 2VQHA 1YRNA 3S2DJ 4H4KC 5F0FA 4QTRA 1TNTA 2BGCA 2ESHA 2B0LA 4LG0A 4DBQA 3ZQLA 2HZTA 1D5YA 4XLEA 1V5GA 4CZZA 4B43A 3F72A 1P2FA 3ZQGA 1B9MA 2ZJQF 1TWCJ 1X58A 2JK3A 2YSRA 5BMZA 1Z7LA 5FJ8J 2B63J 5DV5A 4ZTJA 3SZPA 2MD0A 1DU0A 3JSOA 2BY3A 3S17J 5IYCJ 1RIOH 3HZJA 3GTPJ 4AYBA 2NRAC 5KVRA 3QOEA 3BR6A 1WJFA 2K5CA 4I02A 5LFAA 1MDMB 2KP6A 2RAEA 1H9TA 2LLKA 2MBFA 3F8CA 3JAMZ 5LLQA 4I76A 2HDCA 4EJTA 3K4LA 5M5WJ 1OCCH 2R4GA 4IOCF 3LSKA 4DZJA 3E5XA 1GDTA 2XPWA 3H0DA 4Y33A 3TO6A 2IS1A 2P5LC 1TWHJ 3J7AO 3F6OA 1N75A 3SZGA 1X3WB 2W82A 3O3KA 1D1AA 4E7IA 3M9AA 4JK1X 5F04A 3U9GA 3LSRA 2W00A 5IT9K 1YG2A 2GA1A 2XGEA 1RUOA 2E36A 4FCYA 4LLNA 2V9VA 2CGPA 1WI9A 2IS4A 2FBHA 5DD4A 3K1PA 3PQJA 4CYCB 1Z21A 1OQYA 4NDLA 5FKKA 2NAZA 1RPWA 5CPRB 5FFZA 4ASNA 4M6XA 2K7LA 4A3JJ 1K4SA 3I58A 2Q2EB 1X2NA 3JTHA 4P1WA 5F0HA 3CMMA 1OR7C 2HDDA 3HKZA 5CVUA 2G7HA 2KL4A 3HRUA 2A05A 2W4SA 1OCOH 2X1EA 3CCMI 2DJNA 3F23A 1JKOC 4IHSA 2MH9A 1OR7A 1OLTA 2EIJH 2P5KA 3VYTB 3GW2A 5DD8A 1U78A 3MQ0A 1PUFA 4QIWN 2XDVA 3TO9A 3NARA 4L18B 3RQIA 3CJNA 1LJ9A 1ZTRA 3PSIA 3DV8A 3BG6A 1BBYA 3BTLA 5ICFA 1FOXA 2M4GA 1QZZA 3J81Z 3RTRA 3WG7H 2IT0A 3HG9A 1UG0A 1Q1HA 4M71A 3AL0C 5HODA 3Q9SA 3F3XA 3ZR8X 4ESFA 4AU7A 5LHIA 1EH8A 1W5SA 2HKXA 2PJPA 3W6VA 2QKLB 1N77A 4FE7A 3P9IA 1BJAA 2RGVA 2XV4S 5DM6F 1ERDA 1VQ6I 2BW3B 1LKXA 3KP7A 4MFEA 1W0TA 4RB0A 1S6LA 4KUMA 2Q1ZB 3GVAA 2M1BA 4KIGA 2Z3YA 5GAHJ 4A12A 4Y3OA 3ECHA 1PVEA 4PJLA 3PQKA 1JTXA 3VPRA 4FETA 5IT3A 2H94A 4F55A 5F6FA 4QPOA 1O57A 5M5XJ 4Q47A 3QYBA 5L3BA 5JLXA 1OJLA 1HW2A 4F92B 4IQJA 3IRRA 2DA7A 4CCKA 3Q9VA 3L2CA 5E8GA 2GOMA 2HKOA 2WB1A 3AG2H 2AXLA 4XRSG 5ILUA 4Q5SF 1P7IA 3SYTA 4M3BA 3ZMZA 2YX7A 2VKVA 1XB4A 1AWCA 2O3FA 1MDMA 2RVCA 2Y75A 4EGZA 3OYMA 5BPIA 3FMSA 1K6OA 4LJZF 2CV1A 2HPIA 1A35A 5E17F 2NNNA 3HSRA 3HHGA 2V79A 3NWTA 2W57A 2WAQN 4JYKA 2XRLA 2MLGA 1G8XA 2DI3A 3OR1C 2VBYA 3CP8A 1SVMA 3BT9A 3IRQA 2GXGA 1FSEA 2EV0A 1KU3A 4RB3C 2BVMA 2X1CA 1DP3A 3WU0A 3FXKA 2VL8A 3HHHA 2NOJB 3KEQA 2DN0A 5GAGJ 2HQ5A 5TISC 4ENNA 2H1LA 2F5EA 3ULQB 1MMSA 3C3WA 2MFZA 1W5TA 3G1MA 3H5RA 3LL7A 3WG9A 3DU6A 3ZQFA 3OYAA 5M5YJ 2YU3A 2HS5A 1I50J 3TDUC 4BXFA 2FEZA 1JUSA 4PDKA 3OYBA 4D1QA 1IO2A 2HFHA 1VQ7I 3I56I 1SFUA 3SFZA 5J1YA 3DFGA 4CYCA 2E71A 4KFCA 3M4OJ 2QF7A 1MBKA 1R7JA 2Q2EA 2LBFB 2IVMA 2QBYB 5C4XJ 2LKPA 2FJ1A 2DU9A 2VJ5A 4XR6A 1IN6A 2VPRA 2F2EA 2NOGA 4IHYA 1N78A 1R5GA 3IAM2 1MBHA 2A61A 1D1BA 1O3SA 4ZH4F 1LEAA 3BY6A 1TT5B 3MKLA 4MEXF 1FP2A 3JCUC 2CSOA 3GX4X 4EGYA 3BOQA 4XLAA 5LGNA 5D5XB 4XIDA 2PX9A 4U7BA 3D0SA 4RM2A 4CH7A 1JUMA 2Z99A 3H9QA 3KP3A 1LVAA 2WV1A 4A3DJ 2OU2A 5F1JA 4GDFA 2QKMB 3H35A 4PGHA 1YJ9I 3G4SI 3QWLA 1YYVA 1SFXA 2F6CA 2BYVE 3OYIA 1SFOJ 1GT0C 4DYRA 1R22A 4A0YA 5D5VB 3JAMK 3MMYB 1I1GA 2BBYA 4PSWA 1UCRA 3FXRA 3COAC 2E1MB 3OIQA 2ZXWH 3LA2A 3FX3A 4W1UA 2BW3A 3D1NI 3OYCA 1ZREA 3ABTA 2QVOA 2E35A 2VBWA 3K2AA 4DYQA 5DYMA 3AG4H 3HXLA 2JUCA 1IGNA 3S3OA 1JJ6C 2I8DA 4IX7A 1MBJA 1S3JA 3F9KA 4RM3A 1NHAA 5DTDA 2VOOA 4ZYDA 2PMZN 4ZDLA 1D3YA 2W1OA 2LREA 3MWMA 1U0JA 1RUNA 2O7OA 2X4HA 3KYLA 1VFCA 2Y9ZA 2CUFA 3ZMDA 1Y6IA 3OYNA 1MD0A 1PYVA 5D4SA 3DF8A 1SD6A 4I7HA 2STTA 5LBQA 2UXXA 2IS6A 2BHZA 4XQFA 2QQ8A 3SJMA 3IWFA 4FE4A 4N0BA 2CS3A 1R6RA 2ME6A 3AG1H 2M5WA 2W84A 1T2KA 3MAJA 4HG2A 5CQEA 3M1CA 3GYHX 2XGCA 3CF2A 2F4MB 5D6FA 2ADUA 1BR4A 3JRIA 1FY7A 4G12A 4ZJZA 5B66C 1PDNC 2M4KA 3GBGA 2ISZA 4D0PA 2KDOA 5DCMB 1NK2P 2OZ6A 1B9NA 2NYXA 1VQ5I 2MGQA 2R3SA 1HLVA 4IEJA 3NQOA 4XICA 1QHHD 2EFOA 3I5UA 3FXQA 1WCMJ 1AHDP 5HNHA 2VN2A 3F0CA 1UHSA 3W3CA 4M73A 5LHHA 2VUMJ 2DTZA 4IQ4A 1LFUP 1LDDA 2K3PA 2RV8A 4KT5C 2DA1A 1HSJA 1OCRH 3OYKA 1R1TA 1SAXA 3QOPA 5DDGA 4I99C 5KHDA 3ASOH 5B1AH 4HF1A 4G7OF 1XPXA 4QSHA 3HSFA 2D2WA 1TZLA 2XB0X 2WWYA 2K3FA 3ASNH 2LKXA 2K9LA 1OISA 2QENA 1UZCA 2PJRB 1G2HA 2LBFA 4ZDPA 1AU7A 4A3GJ 1X1CA 1LEBA 2QBYA 3G1LA 2VKHA 1WPKA 2X6WA 5IP6A 4MO7A 2JN6A 5E1XA 3GTMJ 1QVTA 4CCMA 3FXLA 2DW4A 2VC0A 2Y31A 1R4MB 1X3UA 3LQQA 2OCCH 4UV9A 2MW8A 1CF7B 1KZHA 2JSCA 4IHTA 1KONA 3V7CA 2OJED 3OS1A 4ON0A 2LOOA 4BXUA 2ID6A 1ZRDA 4C9YA 2R7FA 1X3ZB 1ETWA 2IGOA 3CD6I 2JA8J 1I6HJ 4E70A 4PJNA 4AD9A 3JRBA 4BQNA 5BQTA 2ZSHB 4GCVA 3ZN0A 1D8JA 2L9NA 2QZ8A 4CDGA 3J7AY 1G3WA 5ERIA 5IYBJ 4L9JA 4NHJA 2E1MC 3PUBA 2DA5A 4G9YA 2GA2A 2KISA 4KIBA 3O2PE 3RJPA 1PJRA 1MW7A 2LD5A 1K78B 2HYFA 2JZYA 3OOPA 3E1SA 2YU9J 3BR1A 1AKHA 3MKWB 2O6GE 4HRIA 1Z3XA 5ICEA 2CQKA 4BUPA 5K7FA 1GVDA 4PCQA 1BJZA 3VEPA 3DBHB 2IRFG 1BI3A 2J5OA 2Y0SN 4M6YA 1XCVA 4II3A 2LVSA 4JX6A 1FNNA 1LVKA 2LFBA 2HOEA 4CICA 1JT0A 4ESJA 2LH9A 4A0ZA 4BU2A 4RGRA 2KRFA 3QU3A 4DNCA 5ED4A 1O3TA 4ZC3A 2UV1A 5K5QA 1IUYA 4C3HJ 3SHFA 3TW6A 4B1RA 5FLVA 3ABKH 2X6YA 3W2WA 2FBKA 4JBAA 4AC0A 2HQNA 3JRDA 1JE8A 3F8NA 1HW1A 3QODA 1B4AA 2QQAA 2TDXA 1SANA 2VXDA 1L0OC 5IYDJ 3P9CA 2V9KA 2XKOA 4RAFA 1H8AC 1POGA 3HC7A 3D5RC 3DBLB 1U8RA 1IZ1A 4UUSA 1T56A 2XUBA 5LEKA 1FLIA 4MIMA 4ENMA 1DGWY 3FK7A 3IC7A 5KK1A 4FT8A 1ZLKA 3K4NA 5ILSA 4A6EA 5DCMA 3CJQB 1YX3A 4B09A 2WAFA 4AWXB 3E0JB 2KIQA 3SZTA 4AIJA 3GUDA 2EA2A 4BEHB 4ANJA 5FKOA 1MH4A 2IXSA 2K9SA 4E7ZA 1FP1D 1WWXA 5K5OA 1HKQA 3OYFA 4OIPF 3I55I 1XCBA 4HA8A 4BGDA 3RKYA 1LDJA 4LD5A 2V1UA 2EV5A 4KISA 2HVQA 4HNVA 3KYDB 1U3EM 1SMYF 3WTTC 4KN4X 4DQ2A 3QPSA 3QYFA 5J40A 2GOXB 2Y9YA 3PO3J 1FT9A 3ELKA 4ENKA 4I0AA 4C2MJ 3N97A 1E2XA 2Z16A 2PJRA 1MMGA 1VQPI 3RPUA 2OBPA 3Q0WA 1UB9A 3KZZA 2XKPA 4GGGA 5L3EA 2BHYA 4WF2A 3L2WA 1V5EA 1XDUA 2VQGA 4IF4A 3PNYA 2CMPA 2UWMA 1AOYA 5KAFC 2ZXHA 3VYUB 4M3DA 4BJTA 5D4RA 4A3BJ 1FTZA 3DLLF 4EVIA 2KRHA 3IHUA 5HLGA 4LOCA 3HOZJ 5H20A 3V7SA 5LGTA 1FTTA 3RKQA 4IVNA 4IKFA 1FYLA 1FYKA 3GZNB 3E6BA 4CUGA 4UVCA 2ZC2A 2EFQA 1XDSA 2YUSA 4RAYA 2CWEA 3RYPA 4YELA 1ORKA 4HF2A 4B3AA 3ESWB 1JXSA 1TTYA 3CCLI 3TEDA 5FLXZ 3KZYA 4RLFA 2DMUA 5JLWA 1JT6A 2DA3A 2QCOA 2X51A 3ZRGA 2P6TA 3FKIJ 3CCUI 2LKSA 4BXXJ 5GPCA 3S1MJ 3H3ZA 2KRCA 2A6TA 5FROA 1ETQA 3BR3A 2JA2A 2VKDA 3CLQA 2M8EA 4IJAA 4MQVA 5JI6A 3M8EA 1BN5A 3ZXSA 1R58A 2HQRA 2B9SA 1IRFA 1K78A 5HS9A 2L7KA 3M3YJ 2L5QA 1T98A 4LK0F 2RNJA 1OYIA 3L2VA 3L9FA 4U87A 2OQRA 2LF8A 2IGNA 3Q0VA 4UUVA 3ECOA 2KHMA 2X0LA 2CW0F 1X1PA 2C6YA 2GBYA 1VQ9I 2D5VA 2VQLA 1A31A 2R92J 1RR8C 2DT7B 3L2QA 3ZCOA 3FMRA 1V54H 5F27A 1ENHA 4AUXA 2JUGA 5C4JJ 1SD7A 5EDNA 4HOBA 3CMYA 1EH7A 3CDIA 5FKMA 3RZOJ 1SMTA 2K4JA 2W24A 4AYBN 1IXRC 4LITA 1E3PA 3GZ5A 2RQPA 3NEUA 1T6SA 4EJUA 4YFNF 5IOZA 4IL6C 4BHBA 3ZQCA 1YQAA 2CUEA 1YOVB 1DU6A 2HR3A 1DUXC 5HNFA 1KA8A 1WH5A 1PP8F 1ZR2A 3OL3A 4HV5A 3AAFA 5FRMA 4BYYA 1BI2A 4OAZA 2R7VA 1MJ9A 1J09A 1FOYA 2DA4A 2PMHA 4UB6C 3DU5A 3C7JA 1HCRA 3OS0A 1SD4A 3O8GA 3HRMA 3VFZA 4U0VA 3W2AA 1QO0D 1UJ8A 1BL0A 4L9VA 9ANTA 3TW7A 4BEHA 3OY9A 2STWA 2JRMA 1TT0A 2LTPA 3FIWA 5HS8A 4FTHA 2L9VA 4BQOA 4KA4A 1HF0A 2L9RA 4A5MA 3I4MJ 4I6ZA 1LUJB 2KQRA 2L54A 1Y56A 2FU4A 3ROUA 1G4DA 3J7YJ 1S72I 3BTJA 1G3TA 3DKXA 1VF9A 5JVGF 2NVTJ 4EATA 1Z3YA 2E34A 2TRTA 3E6MA 2XASA 2NVXJ 3FBIB 4M74A 4E7SA 2ELHA 2K40A 2OV7A 3K7AJ 2DBBA 3HKZN 3HDDA 3I54A 1S7AA 3PNTA 2Y48A 1SFKA 4XOPA 1VTNC 4ZTFA 1TP4A 1RRJA 1JKRC 3IH4A 5D5UB 5LGUA 3EUKL 3TO7A 3WGIA 2EQRA 1PUEE 3TOAA 1ZLJA 4HSTA 3H3UA 2P5VA 4RGXA 1HW5A 1EKEA 2R0QC 3CC7I 4ZYEA 4HLYA 2ZFWA 5B3SH 3KEYA 5E20A 2NXNB 5GPAA 2HVSA 2GAUA 2D1VA 1XMAA 4CGZA 2HOTA 4B44A 4EM2A 4EM0B 1MNEA 1H9GA 4C2TA 3OYEA 2Q0OA 1BM9A 4U0YA 3E97A 4L5EA 4XM3A 2E2JJ 2QQBA 1DQUA 1S7EA 4U88A 2JTVA 1WRJA 4W97A 5TJJA 1VQOI 4BDYA 2TCTA 2RDPA 1IV6A 2L7MP 1UHMA 3DEEA 3F22A 3BQZA 4UVAA 3HPHA 2O0YA 3JRFA 1USSA 1PP7U 3K6GA 3P7NA 2HOSA 2XGXA 1HDDC 4XSZF 3Q0UA 2Z9OA 3O8HA 3WTZA 3DXJF 2HYGD 3BCBA 3H5NA 1S5LC 4WXCA 1RI7A 4BBSJ 3X2QH 4JQFA 2WB1N 3FK6A 3W6JB 2M7BA 4P96A 3WGHA 1TL8A 1LFBA 1NK3P 1TWFJ 1RKWA 1H89C 1QNTA 2KJCA 5J8FA 2OF7A 2V1DA 3JRAA 1QZYA 3GCMA 4ABZA 2D1HA 4MGRA 4MNUA 5AIQA 3DWLE 4N4OB 2DMPA 1OCTC 1IJWC 2K9MA 2DCEA 3BJ6A 1KQ0A 3BG5A 3BTCA 1SEUA 2IAIA 1MJAA 2E7XA 1J2XA 3FISA 1TW2A 2P7CB 4S0HB 5EG0B 3QPLA 2E2IJ 3MCZA 4HEA2 2EB7A 2XPVA 1Z6TA 3HOXJ 3VB2A 2R93J 4V19K 1FX7A 5J3LA 5E18F 3RPUD 3K70D 3IKTA 4IRIA 1IRGA 2I10A 1BR2A 2EWNA 2HQAA 4RGSA 1ZHFA 3PNVA 2CFXA 2E7WA 3LSIA 4GYIA 5HLIA 2ZNYA 4I01A 3OYHA 5K1YA 3HGGA 3WTYC 2LYCA 3K4KA 5FLXK 5DCFA 4I09A 1T38A 2NVQJ 2ZSIB 3MZ8A 4C2UA 5EZHA 2X6XA 4NC8A 2XB5A 4BQAA 4PK4A 1TW3A 1ZYRF 3Q3SA 2V7FA 5LD2C 2OZUA 3B6CA 3GTGJ 3VDXA 2L01A 3L2RA 1BIBA 3UKGA 3WE3A 3BQYA 3CF5F 4F52A 4IXAA 4F93B 4LGWA 3DEWA 1G3YA 3FMQA 2LR8A 3IWZA 4CZCA 2BY1A 3S32A 4BQQA 4LB5A 3SFIA 5KNLA 3EPZA 1OFCX 2AQEA 1YTYA 2HVRA 2RC4A 3JREA 1USTA 1K79A 3RDIA 2Y69H 4GYGA 1IC8A 4U0WA 3MKYB 3Q5FA 3WHBA 1XMKA 2VJ4A 4YIFA 1ZELA 2L4AA 4LIUA 3LA7A 2AXTC 1WJ5A 3IH3A 3DEUA 5BNGA 1T95A 2Y2ZA 3L00A 4XRMA 5F1RA 1IRXA 2LNBA 3DCFA 3OMYA 4XKWA 1MGTA 2FMLA 4LIVA 2MABA 2BXYA 4PZJA 3OS2A 3MZYA 1F43A 1X2MA 5ICGA 1H88C 1MSEC 4PJ0C 1FMVA 3O6BB 1R1UA 3HUGA 2KZGA 1EA3A 3JR9A 1J7KA 2ECCA 2EINH 2ZNZA 2O8KA 3GO5A 3GF2A 3WTVC 1BOBA 3S3MA 1Y0NA 3G1OA 4RGUA 1QPIA 1SAUA 4IHVA 1ETOA 3D5LA 3BG7A 1A36A 5CYVA 3FWEA 3GLXA 4P5OA 1YW9A 4A3IJ 3K4JA 2E60A 1P92A 2WA0A 3B6AA 1I1SA 3U2RA 4DIQA 3CJRB 1B6AA 1VI0A 5L3DA 2ZFUA 1Y8RB 3BZ6A 1AKHB 3BP8A 3OYGA 1Z9CA 3G71I 1R23A 2EIMH 2AS5F 1HA8A 3UR3C 1SVLA 1MZBA 3TP0A 1S29A 1S7OA 2OA4A 2PBIA 1SFEA 1P4AA 2LP0A 4ZYAA 2XROA 2MA3A 1GLNA 3RSNA 3MKZA 5EYRA 3CDHA 2NVYJ 3C18A 3TL4X 5HLHA 5FLMJ 2H8RA 1ON1A 2ZXJA 3S14J 3DTKA 2DJIA 1B1BA 3BROA 1I6XA 4CHUA 3V8LA 3KFWX 1K7AA 1ZH5A 1MBEA 2L9SA 2Y0MA 3R6SA 2VKEA 2IP2A 5EG0A 1FBSA 2ZB9A 3CDLA 3MD2A 3ZQ7A 3CUQB 3BR2A 2IPQX 3HPGA 3KLNA 5K7HA 1VNDA 2FF4A 2FX0A 4XKVA 3HM5A 4QPQA 1QBJA 1VZ0A 3SXYA 2EH3A 2M2EA 4XBFA 1FEXA 2VT2A 4FX4A 2W48A 1E3HA 4HDUA 2EZKA 4GXOA 4UUSB 2CO5A 2HYJA 2DXIA 4I98B 4HZFA 1UAAA 2OTLI 1K83J 2P81A 2A68F 3BLYA 3K1NA 3OL4A 2QQ9A 4FISA 2DFFA 3AKZA 3V8KA 4CCNA 4LK1F 1Z6RA 3I9V2 3ABUA 2VE8A 4PJJA 4XSXF 2OTJI 3IAS2 2LSOA 2E19A 4DGWB 3IP4B 1HQCA 4C3JJ 3WTXC 3DQVC 5KCMA 4BS9A 2DK8A 5CKTA 1D5VA 1FOWA 3IV5A 1IF1A 2FMYA 2F4IA 4OU0A 2BZTA 3LSJA 1FJLA 4J19A 4KN7X 2R7UA 1OCPA 2VLAA 1T0FC 4LFUA 4II2A 4BNCA 1W36D 1RR7A 3ISPA 3FBNB 1T0FA 3M8JA 4RB1A 4N4NB 4E7LA 2RKHA 3QAHA 4ENJA 2DAOA 1WJCA 4A3FJ 2LY2A 2OAZA 4EJOA 1MNMC 2DOFA 4V2GA 2IGMA 3PFYA 3JW4A 2KFDA 4HAMA 2CU7A 1YW8A 3SEZA 3L2UA 1VQMI 1IV8A 2ECBA 4HLXA 1YIOA 1MMDA 2HNHA 1RNLA 1W7PD 3RKXA 1H0MA 3M7GA 1EF4A 1JHHA 5EGOA 2F4OB 3CMAI 2JQ7A 2AO9A 1Z7UA 3GFLA 4HW0A 1GUUA 1GXPA 1YO5C 2KIMA 4Y4RA 1W0UA 2PMUA 4O6JA 4M9ZA 2K9QA 5CVVA 5GAEJ 4XKCA 4NBQA 4P9UA 3BC8A 4Z2YA 4D5CA 2H1KA 1JUPA 1RKTA 2CW8A 4D9JA 2Y30A 2KIFA 2PG4A 1V55H 1HDPA 5CVRA 1R5ID 2XAGA 2KT0A 4CCLA 1TLHB 1ZGJA 3G6EI 1ZG3A 3HSEA 1ZRFA 2R7ZJ 3W2VA 1M1EB 1TNSA 2BE5F 2EFNA 5CQGA 4L5JA 1GVJA 2XIGA 4M3FA 1EV7A 3HOVJ 3WU2C 3H5AA 1MIJA 3E3VA 3GEZA 3WTSC 1IN5A 4OIOF 2DYRH 4IOAF 3QU6A 4L9NA 2FUG2 2DMQA 1D0YA 2CUZA 3AG3H 4XRFA 4HQEA 2OUMA 2M7AA 4EMSA 1K4TA 5AONA
chains in the Genus database with same CATH topology
2EFPA 1P4WA 2DK5A 1O7LA 3P9KA 4PGGA 2Q8KA 4Q48A 3L7WA 5CVIA 1W4MA 3L09A 3CUQC 1FZPB 2XHKA 3H92A 4LMYA 4HBLA 3CUQA 3KP6A 5JHUA 2ISYA 3WU1B 2VE9A 2VBZA 3E6CC 4Y15A 1HKSA 4G94A 4FHTA 5LEJA 3G3ZA 3HTUA 1HSTA 2L4MA 4R8HA 1L3LA 3MEXA 4LLLA 1IW7F 3I64A 2G7UA 3F8BA 1YFHA 1QGPA 4KMFA 1DPRA 2DLLA 1ZN2A 4NQWA 3U1DA 2V6CA 1O3RA 4M9XA 2QUFA 4Y17A 5L3FA 3I53A 5HVQC 2IW5A 1HXDA 1DP7P 3QP6A 4HF0A 4EM1A 1KU2A 4UNOA 3ZN1A 2ESNA 4EJVA 2MC3A 3ZMUA 2Z33A 3HRTA 1IN8A 2FOKA 3LFKA 2FA5A 3I0TA 4R1HA 1J59A 1QPMA 4XLNF 2PQ8A 2QLZA 3GXOA 5FB2A 2NS0A 4AVPA 3ZMTA 4XLPF 1OKRA 4AIKA 1KQ8A 3M1EA 5L3GA 4LLGF 1E17A 2P4WA 3RI4A 1XSDA 1JHFA 3RKWA 5HDGA 3TQNA 1ULYA 1F9NA 1FYMA 4LB6B 1C0WA 1REPC 2MH2A 3DP7A 3K1MA 2O61A 2V1XA 1CGPA 4ZYGA 1IXCA 3KP2A 3ML6A 3CO7C 2E1CA 1EH6A 3FM3A 1WSUA 2QYOA 3DPTA 2IA1A 5BOXA 3DPLC 5CLSA 1W7PB 4MHGA 1F1ZA 3FZVA 1R36A 3TGNA 1FSHA 2F5DA 3R4KA 3WTWC 2A69F 3E5QA 4KMUX 2JPCA 2HEOA 1U5TB 2JRTA 3QRFF 2A5YB 1FC3A 2O03A 2H09A 1P4XA 5JVTA 1ZRCA 1J75A 2ZO4A 5DUIA 1OYYA 4H0EA 2PEXA 2K4BA 3LAJA 4P55A 2PI0A 2XAHA 3W6KB 1FBUA 1MKMA 1TQPA 4M9SA 3HIFA 2YR2A 1HBXG 4F7ZA 1FPQA 1KGSA 4BAYA 1F5TA 4S05A 6PAXA 3IKVA 4UXNA 4KNYA 5AIPA 2W25A 2PN6A 4IRHA 2PFBA 3ERED 5JR3A 3RYRA 3FHZA 4Y13A 5CJ9A 4K2EA 4A2UA 1KU7A 3R0AA 3HOSA 2BEOA 4G7ZF 3TKYA 1KYZA 3LQRA 4WXHA 1SD5A 4MEYF 3T8TA 3KP5A 1ZGAA 5EEGA 1ZAOA 2EA4A 1J9IA 5FO5A 2DPDA 1O7FA 1Z05A 1BIAA 5F64A 2GZWA 3K9TA 4HV6A 3K69A 4OINF 2DO7A 1LB2A 5K5RA 3E6DA 1R5HA 2VT3A 2OQGA 2MLKA 3V4GA 3EYYA 2H27A 5BPDA 4EV0A 3J80Z 3MZHA 3KETA 2PLYA 2CG4A 1OYWA 1XGOA 2LDUA 1DDNA 1YS6A 1TQIA 4S04A 2M30A 3JSPA 4HYEA 3F8MA 1W7PA 4WCGA 3QP5A 5JFRA 5EEHA 3F21A 3DKWA 4HQMA 1ZG1A 5FD6A 1RZ4A 5D8LB 1U5TC 1A04A 1O3QA 4NB5A 2EK5A 2HWVA 4HDVA 3OV8A 4A5NA 3EETA 1R00A 1U5TA 4BHPA 4YFXF 2DQRA 4YIIA 4KIFA 1STZA 1V4RA 3C1DA 4WWCA 3S2WA 4RS8A 3VODA 2FNAA 3T0YA 4CXFA 3BPVA 2FXAA 1TQMA 4L5IA 4KDPA 2L02A 2M87A 2K27A 1G6NA 4EJWA 3KEOA 2JT1A 1BC7C 1MJBA 2H6CA 3EUHA 2EV6A 2VODA 2VC1A 2IA2A 2Z5UA 1G3SA 3KE2A 2K02A 4I0BA 3EQLF 3TDZC 4ZZLA 1ZG5A 2XVCA 3B73A 5LRRA 4CYDA 4OIQF 1Z1DA 2GXBA 1XGSA 1YLFA 2WTEA 3TOBA 2VOPA 4ETSA 1ON2A 2A6EF 4ESBA 2F5CA 3B02A 2WC2A 4ZZDA 1T39A 1WKMA 4TV7A 3WODF 3WTUC 2OD5A 5CVJA 5D8KB 1U2WA 3F6VA 1XSVA 2HTSA 2FBIA 2D45A 4L0YB 4HX7A 4MTEA 2FNPA 2M45A 2DFIA 2CYYA 3RPQA 3ZPLA 1I5ZA 5H6RA 5LHGA 3N4MA 2A3SA 5D5WB 2YPRA 2EFWA 4Q4ZF 2DPUA 3CUOA 3CO6C 4KICA 5E1WA 4EQQA 5ICCA 1FBQA 5J6XA 1YW7A 3KP4A 2DT5A 3ZMSA 4BHCA 2XAFA 5HDNA 2XRNA 1JGSA 2ZJ2A 4U7DA 4WK8F 2A6HF 5A2QZ 2K86A 2E1NA 3R0JA 1ONVA 3WE2A 2VXZA 3I4PA 3I59B 1F4KA 4O3MA 1Z91A 5BS6A 1J0RA 4MQ9F 1HKTA 2QM3A 2P8TA 4B8XA 3T1BA 4OIRF 3GFMA 4HX8A 2GQQA 3E5UA 2P7VB 3J80K 3GWZA 5HDKA 1GHCA 2KKOA 3EYIA 1ODDA 3V7RA 5FD5A 2GWRA 2GIVA 2J5PA 1LQ1A 2KJBA 3J81K 1R1VA 2VONA 1DPUA 3R60A 1KYWA 5FGMA 5ILVA 3K0LA 3QPHA 3I71A 4O5VA 4OMYA 4OOIA 2UZKA 1U6GA 3KLOA 3R61A 4MTDA 3NRVA 2ZMEB 1TBXA 4RB2C 4AIHA 1GXQA 1OMIA 2MD5A 1LDKB 2ACJA 4UV8A 4QLCU 1J5YA 2HTJA 1ZARA 3LWFA 3FM5A 3FF5A 1QQIA 4IRGA 3F8FA 1B59A 3KCCA 1V3FA 3RIRA 5IT9Z 2FQ3A 3V8JA 5H6QA 3T5XA 3LA3A 2FE3A 3GZ6A 1XSXA 5D6EA 1OPCA 3MFKA 1FWZA 3I59A 4I2OA 3GFJA 5E1ZB 4R79A 2COMA 1IN7A 1D8KA 4LG0B 1UFMA 4P9FA 3IL2A 4IPAA 4G8XA 1I27A 3EDPA 1IN4A 4GO1A 1BI0A 4N9IA 2HGCA 2NNYA 2ZKZA 3ZP5A 5HS7A 3REOA 1XD7A 2LF7A 2P6SA 5FFXA 4UVBA 2ETHA 1S8NA 5LRSA 4G6QA 3K2ZA 2L3DA 3QPTA 2FSWA 4YFKF 2F5FA 4N9HA 4UHTA 2G9WA 3GFIA 2JPBA 3HTSB 2ZBKA 3HYIA 1WQ2A 3WGGA 3LAPA 3HOTA 3VOEA 1XGNA 5E8IA 1BI1A 1BOAA 3BJAA 1XGMA 5L3CA 1KQ9A 5HOOA 2R7DA 4G7HF 1XN7A 1YS7A 1KU9A 4QWQA 4BH9A 3JTGA 5DUKA 2ZMEA 5A2QK 4KYWA 3HRSA 1CF7A 4YG2F 3BWGA 3CTAA 2DQLA 2H6BA 2W85A 1IAWA 3T8RA 4A6DA 4ZYHA 2O8XA 4OMZA 2EJRA 4M72A 1IXSB 2QWWA 3PFIA 2A07F 4FX0A 1Y0UA 4WXDA 2YX4A 2VBXA 4HX4A 1BC8C 1P6RA 3M8FA 3BPXA 2IJLA 4A0XA 2IA0A 3SQNA 2DTRA 2WV0A 2ZCWA 3BJOA 2XAQA 5DEQA 5J8CA 2FRHA 2KIUA 3FXUA 3ZMVA 1UHWA 2UXNA 3G73A 4CO8A 4L9TA 3BDDA 4G6DA 4RAZA 3LSTA 4WX9A 4L0ZB 2XAJA 1LNWA 2RN7A 1FOKA 2BV6A 3CLOA 5TRDA 1TNTA 2BGCA 2ESHA 2B0LA 4LG0A 2HZTA 4CZZA 3F72A 1P2FA 1B9MA 2YSRA 5BMZA 5DV5A 3SZPA 3JSOA 1RIOH 2NRAC 5KVRA 4I02A 1MDMB 1H9TA 2MBFA 3F8CA 3JAMZ 5LLQA 2HDCA 4EJTA 3E5XA 3TO6A 2P5LC 3J7AO 3F6OA 3O3KA 3M9AA 4JK1X 3U9GA 5IT9K 1YG2A 2GA1A 1RUOA 4LLNA 2V9VA 2CGPA 1WI9A 2FBHA 5DD4A 3K1PA 3PQJA 2NAZA 5FFZA 4ASNA 4M6XA 2K7LA 3I58A 3JTHA 5CVUA 2G7HA 3HRUA 3F23A 4IHSA 2MH9A 1OR7A 2P5KA 3GW2A 5DD8A 1U78A 3MQ0A 3TO9A 4L18B 3CJNA 1LJ9A 3DV8A 1BBYA 5ICFA 1QZZA 3J81Z 3RTRA 2IT0A 1Q1HA 4M71A 3Q9SA 3F3XA 4ESFA 5LHIA 1EH8A 1W5SA 2HKXA 2PJPA 3P9IA 1BJAA 2RGVA 2XV4S 3KP7A 4RB0A 1S6LA 4KUMA 3GVAA 2M1BA 4KIGA 2Z3YA 4A12A 3ECHA 3PQKA 5IT3A 2H94A 5F6FA 1O57A 4Q47A 5L3BA 1HW2A 3IRRA 3Q9VA 3L2CA 5E8GA 2HKOA 5ILUA 2AXLA 4Q5SF 3ZMZA 2YX7A 1XB4A 1AWCA 2O3FA 1MDMA 2RVCA 2Y75A 4EGZA 5BPIA 3FMSA 1K6OA 4LJZF 5E17F 2NNNA 3HSRA 3HHGA 2V79A 2W57A 2MLGA 2DI3A 2VBYA 3IRQA 2GXGA 1FSEA 2EV0A 1KU3A 4RB3C 3WU0A 3HHHA 3KEQA 4ENNA 2F5EA 3ULQB 3C3WA 1W5TA 3WG9A 2YU3A 2HS5A 3TDUC 2FEZA 4PDKA 2HFHA 1SFUA 3SFZA 3DFGA 4KFCA 1R7JA 2Q2EA 2IVMA 2QBYB 2LKPA 2DU9A 1IN6A 2F2EA 1R5GA 2A61A 1O3SA 4ZH4F 1LEAA 3BY6A 4MEXF 1FP2A 2CSOA 3GX4X 4EGYA 3BOQA 5LGNA 5D5XB 4U7BA 3D0SA 2Z99A 3KP3A 1LVAA 2OU2A 4PGHA 1YYVA 1SFXA 2BYVE 1R22A 4A0YA 5D5VB 3JAMK 1I1GA 2BBYA 1UCRA 3FXRA 3COAC 3LA2A 3FX3A 1ZREA 3ABTA 2QVOA 2VBWA 5DYMA 1S3JA 1NHAA 2VOOA 4ZYDA 1D3YA 3MWMA 1RUNA 2X4HA 3ZMDA 1MD0A 5D4SA 3DF8A 1SD6A 4I7HA 2STTA 5LBQA 2UXXA 3IWFA 4N0BA 2M5WA 2W84A 1T2KA 3MAJA 3GYHX 5D6FA 2ADUA 1FY7A 1PDNC 2ISZA 4D0PA 5DCMB 2OZ6A 1B9NA 2NYXA 2R3SA 3NQOA 2EFOA 3I5UA 3FXQA 2VN2A 4M73A 5LHHA 1LDDA 2RV8A 4KT5C 1HSJA 1SAXA 1R1TA 3QOPA 5DDGA 4HF1A 4G7OF 3HSFA 2D2WA 2WWYA 2QENA 1LEBA 2QBYA 5E1XA 2DW4A 2VC0A 1X3UA 3LQQA 4UV9A 1CF7B 2JSCA 4IHTA 3V7CA 4ON0A 4BXUA 1ZRDA 2R7FA 4E70A 4AD9A 5BQTA 4GCVA 3ZN0A 1D8JA 2QZ8A 4CDGA 1G3WA 5ERIA 4L9JA 4NHJA 4G9YA 2GA2A 4KIBA 3O2PE 3RJPA 1K78B 2HYFA 2JZYA 3OOPA 2O6GE 5ICEA 2CQKA 4PCQA 3VEPA 2IRFG 1BI3A 2J5OA 4M6YA 1XCVA 1FNNA 2HOEA 4CICA 4ESJA 4A0ZA 4RGRA 2KRFA 3QU3A 4DNCA 5ED4A 1O3TA 5K5QA 1IUYA 3SHFA 2FBKA 4JBAA 2HQNA 1JE8A 3F8NA 1HW1A 1B4AA 2QQAA 2TDXA 1L0OC 3P9CA 2XKOA 1U8RA 1IZ1A 2XUBA 5LEKA 1FLIA 4ENMA 3IC7A 5KK1A 4FT8A 1ZLKA 5ILSA 4A6EA 5DCMA 4B09A 4AWXB 3SZTA 4AIJA 3GUDA 2EA2A 1FP1D 1WWXA 5K5OA 1HKQA 4OIPF 1XCBA 4HA8A 3RKYA 1LDJA 4LD5A 2V1UA 2EV5A 1U3EM 1SMYF 3WTTC 4KN4X 4DQ2A 1FT9A 3ELKA 4ENKA 4I0AA 3N97A 1E2XA 3RPUA 2OBPA 1UB9A 3KZZA 2XKPA 4GGGA 5L3EA 4WF2A 1XDUA 4IF4A 2UWMA 1AOYA 5D4RA 4EVIA 3IHUA 5HLGA 5H20A 3V7SA 5LGTA 4IVNA 1FYLA 1FYKA 3E6BA 4UVCA 2EFQA 1XDSA 4RAYA 2CWEA 3RYPA 4HF2A 1JXSA 1TTYA 5FLXZ 3KZYA 2P6TA 3H3ZA 4IJAA 2M8EA 4MQVA 5JI6A 3M8EA 1BN5A 1R58A 2HQRA 1K78A 1IRFA 5HS9A 1T98A 4LK0F 2RNJA 1OYIA 3L9FA 2OQRA 2LF8A 4UUVA 3ECOA 2X0LA 2CW0F 2C6YA 3FMRA 1SD7A 4HOBA 1EH7A 1SMTA 2K4JA 2W24A 1IXRC 3GZ5A 2RQPA 3NEUA 1T6SA 4EJUA 4YFNF 4BHBA 1YQAA 2HR3A 1DUXC 1KA8A 1PP8F 4HV5A 3AAFA 4BYYA 1BI2A 1MJ9A 2PMHA 3C7JA 1SD4A 3HRMA 3VFZA 4U0VA 1QO0D 4L9VA 2STWA 5HS8A 4KA4A 4A5MA 2L54A 2FU4A 3ROUA 1G4DA 1G3TA 3E6MA 2XASA 4M74A 2ELHA 2DBBA 3I54A 1S7AA 2Y48A 1VTNC 5D5UB 5LGUA 3WGIA 3TO7A 1PUEE 3TOAA 1ZLJA 3H3UA 2P5VA 4RGXA 1HW5A 4ZYEA 4HLYA 2ZFWA 5E20A 2GAUA 2D1VA 1XMAA 4CGZA 4EM2A 4EM0B 1H9GA 2Q0OA 1BM9A 4U0YA 3E97A 2QQBA 4U88A 2JTVA 1WRJA 5TJJA 2RDPA 1UHMA 3F22A 4UVAA 2O0YA 1USSA 1PP7U 3P7NA 2XGXA 4XSZF 2Z9OA 3WTZA 3DXJF 2HYGD 4WXCA 1RI7A 4JQFA 3W6JB 4P96A 3WGHA 1QNTA 2KJCA 5J8FA 2V1DA 1QZYA 2D1HA 4MGRA 4MNUA 5AIQA 3BJ6A 1KQ0A 1MJAA 2E7XA 1J2XA 1TW2A 2P7CB 3MCZA 2EB7A 1Z6TA 3VB2A 1FX7A 5E18F 3IKTA 4IRIA 1IRGA 2EWNA 4RGSA 1ZHFA 2CFXA 2E7WA 4GYIA 5HLIA 2ZNYA 4I01A 5K1YA 3WTYC 5FLXK 5DCFA 4I09A 1T38A 4BQAA 1TW3A 1ZYRF 2OZUA 2L01A 1BIBA 3WE3A 4IXAA 4LGWA 1G3YA 3FMQA 3IWZA 4LB5A 1YTYA 2RC4A 1USTA 1K79A 3RDIA 4GYGA 4U0WA 3Q5FA 1XMKA 4YIFA 2L4AA 3LA7A 3DEUA 3L00A 5F1RA 2LNBA 1MGTA 2FMLA 4PZJA 3MZYA 5ICGA 3O6BB 1R1UA 3HUGA 1J7KA 2ZNZA 3GO5A 3GF2A 3WTVC 4RGUA 3D5LA 5CYVA 3FWEA 3GLXA 4P5OA 1YW9A 1P92A 1I1SA 3U2RA 1B6AA 5L3DA 3BZ6A 3BP8A 1Z9CA 1R23A 2AS5F 1MZBA 1S29A 1S7OA 2OA4A 2PBIA 1SFEA 1P4AA 2XROA 2MA3A 3C18A 3CDHA 5HLHA 1ON1A 2ZXJA 1B1BA 3BROA 1I6XA 4CHUA 3V8LA 3KFWX 1K7AA 1ZH5A 2Y0MA 3R6SA 2IP2A 1FBSA 3ZQ7A 3CUQB 3KLNA 2IPQX 2FF4A 1QBJA 3SXYA 4XBFA 2VT2A 4FX4A 4HDUA 4GXOA 2CO5A 4I98B 4HZFA 2A68F 3K1NA 2QQ9A 3V8KA 4LK1F 1Z6RA 3ABUA 2VE8A 4XSXF 2LSOA 1HQCA 3WTXC 3DQVC 2DK8A 1D5VA 1IF1A 2FMYA 4OU0A 4KN7X 4LFUA 4BNCA 3ISPA 1T0FA 4RB1A 2RKHA 3QAHA 4ENJA 2DAOA 2OAZA 4EJOA 3JW4A 4HAMA 1YW8A 4HLXA 1YIOA 1H0MA 1RNLA 1W7PD 3RKXA 3M7GA 1JHHA 1Z7UA 3GFLA 4HW0A 1GXPA 1YO5C 2KIMA 2PMUA 4O6JA 4M9ZA 5CVVA 4P9UA 4Z2YA 2KIFA 2PG4A 5CVRA 2XAGA 1TLHB 1ZGJA 1ZG3A 3HSEA 1ZRFA 2BE5F 1TNSA 2EFNA 4L5JA 1GVJA 2XIGA 1EV7A 3E3VA 3GEZA 3WTSC 1IN5A 4OIOF 3QU6A 4L9NA 4XRFA 4HQEA 4EMSA 5AONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFP A;  1P4W A;  2DK5 A;  1O7L A;  3P9K A;  4PGG A;  2Q8K A;  4Q48 A;  3L7W A;  5CVI A;  1W4M A;  3L09 A;  3CUQ C;  1FZP B;  2XHK A;  3H92 A;  4LMY A;  4HBL A;  3CUQ A;  3KP6 A;  5JHU A;  2ISY A;  3WU1 B;  2VE9 A;  2VBZ A;  3E6C C;  4Y15 A;  1HKS A;  4G94 A;  4FHT A;  5LEJ A;  3G3Z A;  3HTU A;  1HST A;  2L4M A;  4R8H A;  1L3L A;  3MEX A;  4LLL A;  1IW7 F;  3I64 A;  2G7U A;  3F8B A;  1YFH A;  1QGP A;  4KMF A;  1DPR A;  2DLL A;  1ZN2 A;  4NQW A;  3U1D A;  2V6C A;  1O3R A;  4M9X A;  2QUF A;  4Y17 A;  5L3F A;  3I53 A;  5HVQ C;  2IW5 A;  1HXD A;  1DP7 P;  3QP6 A;  4HF0 A;  4EM1 A;  1KU2 A;  4UNO A;  3ZN1 A;  2ESN A;  4EJV A;  2MC3 A;  3ZMU A;  2Z33 A;  3HRT A;  1IN8 A;  2FOK A;  3LFK A;  2FA5 A;  3I0T A;  4R1H A;  1J59 A;  1QPM A;  4XLN F;  2PQ8 A;  2QLZ A;  3GXO A;  5FB2 A;  2NS0 A;  4AVP A;  3ZMT A;  4XLP F;  1OKR A;  4AIK A;  1KQ8 A;  3M1E A;  5L3G A;  4LLG F;  1E17 A;  2P4W A;  3RI4 A;  1XSD A;  1JHF A;  3RKW A;  5HDG A;  3TQN A;  1ULY A;  1F9N A;  1FYM A;  4LB6 B;  1C0W A;  1REP C;  2MH2 A;  3DP7 A;  3K1M A;  2O61 A;  2V1X A;  1CGP A;  4ZYG A;  1IXC A;  3KP2 A;  3ML6 A;  3CO7 C;  2E1C A;  1EH6 A;  3FM3 A;  1WSU A;  2QYO A;  3DPT A;  2IA1 A;  5BOX A;  3DPL C;  5CLS A;  1W7P B;  4MHG A;  1F1Z A;  3FZV A;  1R36 A;  3TGN A;  1FSH A;  2F5D A;  3R4K A;  3WTW C;  2A69 F;  3E5Q A;  4KMU X;  2JPC A;  2HEO A;  1U5T B;  2JRT A;  3QRF F;  2A5Y B;  1FC3 A;  2O03 A;  2H09 A;  1P4X A;  5JVT A;  1ZRC A;  1J75 A;  2ZO4 A;  5DUI A;  1OYY A;  4H0E A;  2PEX A;  2K4B A;  3LAJ A;  4P55 A;  2PI0 A;  2XAH A;  3W6K B;  1FBU A;  1MKM A;  1TQP A;  4M9S A;  3HIF A;  2YR2 A;  1HBX G;  4F7Z A;  1FPQ A;  1KGS A;  4BAY A;  1F5T A;  4S05 A;  6PAX A;  3IKV A;  4UXN A;  4KNY A;  5AIP A;  2W25 A;  2PN6 A;  4IRH A;  2PFB A;  3ERE D;  5JR3 A;  3RYR A;  3FHZ A;  4Y13 A;  5CJ9 A;  4K2E A;  4A2U A;  1KU7 A;  3R0A A;  3HOS A;  2BEO A;  4G7Z F;  3TKY A;  1KYZ A;  3LQR A;  4WXH A;  1SD5 A;  4MEY F;  3T8T A;  3KP5 A;  1ZGA A;  5EEG A;  1ZAO A;  2EA4 A;  1J9I A;  5FO5 A;  2DPD A;  1O7F A;  1Z05 A;  1BIA A;  5F64 A;  2GZW A;  3K9T A;  4HV6 A;  3K69 A;  4OIN F;  2DO7 A;  1LB2 A;  5K5R A;  3E6D A;  1R5H A;  2VT3 A;  2OQG A;  2MLK A;  3V4G A;  3EYY A;  2H27 A;  5BPD A;  4EV0 A;  3J80 Z;  3MZH A;  3KET A;  2PLY A;  2CG4 A;  1OYW A;  1XGO A;  2LDU A;  1DDN A;  1YS6 A;  1TQI A;  4S04 A;  2M30 A;  3JSP A;  4HYE A;  3F8M A;  1W7P A;  4WCG A;  3QP5 A;  5JFR A;  5EEH A;  3F21 A;  3DKW A;  4HQM A;  1ZG1 A;  5FD6 A;  1RZ4 A;  5D8L B;  1U5T C;  1A04 A;  1O3Q A;  4NB5 A;  2EK5 A;  2HWV A;  4HDV A;  3OV8 A;  4A5N A;  3EET A;  1R00 A;  1U5T A;  4BHP A;  4YFX F;  2DQR A;  4YII A;  4KIF A;  1STZ A;  1V4R A;  3C1D A;  4WWC A;  3S2W A;  4RS8 A;  3VOD A;  2FNA A;  3T0Y A;  4CXF A;  3BPV A;  2FXA A;  1TQM A;  4L5I A;  4KDP A;  2L02 A;  2M87 A;  2K27 A;  1G6N A;  4EJW A;  3KEO A;  2JT1 A;  1BC7 C;  1MJB A;  2H6C A;  3EUH A;  2EV6 A;  2VOD A;  2VC1 A;  2IA2 A;  2Z5U A;  1G3S A;  3KE2 A;  2K02 A;  4I0B A;  3EQL F;  3TDZ C;  4ZZL A;  1ZG5 A;  2XVC A;  3B73 A;  5LRR A;  4CYD A;  4OIQ F;  1Z1D A;  2GXB A;  1XGS A;  1YLF A;  2WTE A;  3TOB A;  2VOP A;  4ETS A;  1ON2 A;  2A6E F;  4ESB A;  2F5C A;  3B02 A;  2WC2 A;  4ZZD A;  1T39 A;  1WKM A;  4TV7 A;  3WOD F;  3WTU C;  2OD5 A;  5CVJ A;  5D8K B;  1U2W A;  3F6V A;  1XSV A;  2HTS A;  2FBI A;  2D45 A;  4L0Y B;  4HX7 A;  4MTE A;  2FNP A;  2M45 A;  2DFI A;  2CYY A;  3RPQ A;  3ZPL A;  1I5Z A;  5H6R A;  5LHG A;  3N4M A;  2A3S A;  5D5W B;  2YPR A;  2EFW A;  4Q4Z F;  2DPU A;  3CUO A;  3CO6 C;  4KIC A;  5E1W A;  4EQQ A;  5ICC A;  1FBQ A;  5J6X A;  1YW7 A;  3KP4 A;  2DT5 A;  3ZMS A;  4BHC A;  2XAF A;  5HDN A;  2XRN A;  1JGS A;  2ZJ2 A;  4U7D A;  4WK8 F;  2A6H F;  5A2Q Z;  2K86 A;  2E1N A;  3R0J A;  1ONV A;  3WE2 A;  2VXZ A;  3I4P A;  3I59 B;  1F4K A;  4O3M A;  1Z91 A;  5BS6 A;  1J0R A;  4MQ9 F;  1HKT A;  2QM3 A;  2P8T A;  4B8X A;  3T1B A;  4OIR F;  3GFM A;  4HX8 A;  2GQQ A;  3E5U A;  2P7V B;  3J80 K;  3GWZ A;  5HDK A;  1GHC A;  2KKO A;  3EYI A;  1ODD A;  3V7R A;  5FD5 A;  2GWR A;  2GIV A;  2J5P A;  1LQ1 A;  2KJB A;  3J81 K;  1R1V A;  2VON A;  1DPU A;  3R60 A;  1KYW A;  5FGM A;  5ILV A;  3K0L A;  3QPH A;  3I71 A;  4O5V A;  4OMY A;  4OOI A;  2UZK A;  1U6G A;  3KLO A;  3R61 A;  4MTD A;  3NRV A;  2ZME B;  1TBX A;  4RB2 C;  4AIH A;  1GXQ A;  1OMI A;  2MD5 A;  1LDK B;  2ACJ A;  4UV8 A;  4QLC U;  1J5Y A;  2HTJ A;  1ZAR A;  3LWF A;  3FM5 A;  3FF5 A;  1QQI A;  4IRG A;  3F8F A;  1B59 A;  3KCC A;  1V3F A;  3RIR A;  5IT9 Z;  2FQ3 A;  3V8J A;  5H6Q A;  3T5X A;  3LA3 A;  2FE3 A;  3GZ6 A;  1XSX A;  5D6E A;  1OPC A;  3MFK A;  1FWZ A;  3I59 A;  4I2O A;  3GFJ A;  5E1Z B;  4R79 A;  2COM A;  1IN7 A;  1D8K A;  4LG0 B;  1UFM A;  4P9F A;  3IL2 A;  4IPA A;  4G8X A;  1I27 A;  3EDP A;  1IN4 A;  4GO1 A;  1BI0 A;  4N9I A;  2HGC A;  2NNY A;  2ZKZ A;  3ZP5 A;  5HS7 A;  3REO A;  1XD7 A;  2LF7 A;  2P6S A;  5FFX A;  4UVB A;  2ETH A;  1S8N A;  5LRS A;  4G6Q A;  3K2Z A;  2L3D A;  3QPT A;  2FSW A;  4YFK F;  2F5F A;  4N9H A;  4UHT A;  2G9W A;  3GFI A;  2JPB A;  3HTS B;  2ZBK A;  3HYI A;  1WQ2 A;  3WGG A;  3LAP A;  3HOT A;  3VOE A;  1XGN A;  5E8I A;  1BI1 A;  1BOA A;  3BJA A;  1XGM A;  5L3C A;  1KQ9 A;  5HOO A;  2R7D A;  4G7H F;  1XN7 A;  1YS7 A;  1KU9 A;  4QWQ A;  4BH9 A;  3JTG A;  5DUK A;  2ZME A;  5A2Q K;  4KYW A;  3HRS A;  1CF7 A;  4YG2 F;  3BWG A;  3CTA A;  2DQL A;  2H6B A;  2W85 A;  1IAW A;  3T8R A;  4A6D A;  4ZYH A;  2O8X A;  4OMZ A;  2EJR A;  4M72 A;  1IXS B;  2QWW A;  3PFI A;  2A07 F;  4FX0 A;  1Y0U A;  4WXD A;  2YX4 A;  2VBX A;  4HX4 A;  1BC8 C;  1P6R A;  3M8F A;  3BPX A;  2IJL A;  4A0X A;  2IA0 A;  3SQN A;  2DTR A;  2WV0 A;  2ZCW A;  3BJO A;  2XAQ A;  5DEQ A;  5J8C A;  2FRH A;  2KIU A;  3FXU A;  3ZMV A;  1UHW A;  2UXN A;  3G73 A;  4CO8 A;  4L9T A;  3BDD A;  4G6D A;  4RAZ A;  3LST A;  4WX9 A;  4L0Z B;  2XAJ A;  1LNW A;  2RN7 A;  1FOK A;  2BV6 A;  3CLO A;  5TRD A;  1TNT A;  2BGC A;  2ESH A;  2B0L A;  4LG0 A;  2HZT A;  4CZZ A;  3F72 A;  1P2F A;  1B9M A;  2YSR A;  5BMZ A;  5DV5 A;  3SZP A;  3JSO A;  1RIO H;  2NRA C;  5KVR A;  4I02 A;  1MDM B;  1H9T A;  2MBF A;  3F8C A;  3JAM Z;  5LLQ A;  2HDC A;  4EJT A;  3E5X A;  3TO6 A;  2P5L C;  3J7A O;  3F6O A;  3O3K A;  3M9A A;  4JK1 X;  3U9G A;  5IT9 K;  1YG2 A;  2GA1 A;  1RUO A;  4LLN A;  2V9V A;  2CGP A;  1WI9 A;  2FBH A;  5DD4 A;  3K1P A;  3PQJ A;  2NAZ A;  5FFZ A;  4ASN A;  4M6X A;  2K7L A;  3I58 A;  3JTH A;  5CVU A;  2G7H A;  3HRU A;  3F23 A;  4IHS A;  2MH9 A;  1OR7 A;  2P5K A;  3GW2 A;  5DD8 A;  1U78 A;  3MQ0 A;  3TO9 A;  4L18 B;  3CJN A;  1LJ9 A;  3DV8 A;  1BBY A;  5ICF A;  1QZZ A;  3J81 Z;  3RTR A;  2IT0 A;  1Q1H A;  4M71 A;  3Q9S A;  3F3X A;  4ESF A;  5LHI A;  1EH8 A;  1W5S A;  2HKX A;  2PJP A;  3P9I A;  1BJA A;  2RGV A;  2XV4 S;  3KP7 A;  4RB0 A;  1S6L A;  4KUM A;  3GVA A;  2M1B A;  4KIG A;  2Z3Y A;  4A12 A;  3ECH A;  3PQK A;  5IT3 A;  2H94 A;  5F6F A;  1O57 A;  4Q47 A;  5L3B A;  1HW2 A;  3IRR A;  3Q9V A;  3L2C A;  5E8G A;  2HKO A;  5ILU A;  2AXL A;  4Q5S F;  3ZMZ A;  2YX7 A;  1XB4 A;  1AWC A;  2O3F A;  1MDM A;  2RVC A;  2Y75 A;  4EGZ A;  5BPI A;  3FMS A;  1K6O A;  4LJZ F;  5E17 F;  2NNN A;  3HSR A;  3HHG A;  2V79 A;  2W57 A;  2MLG A;  2DI3 A;  2VBY A;  3IRQ A;  2GXG A;  1FSE A;  2EV0 A;  1KU3 A;  4RB3 C;  3WU0 A;  3HHH A;  3KEQ A;  4ENN A;  2F5E A;  3ULQ B;  3C3W A;  1W5T A;  3WG9 A;  2YU3 A;  2HS5 A;  3TDU C;  2FEZ A;  4PDK A;  2HFH A;  1SFU A;  3SFZ A;  3DFG A;  4KFC A;  1R7J A;  2Q2E A;  2IVM A;  2QBY B;  2LKP A;  2DU9 A;  1IN6 A;  2F2E A;  1R5G A;  2A61 A;  1O3S A;  4ZH4 F;  1LEA A;  3BY6 A;  4MEX F;  1FP2 A;  2CSO A;  3GX4 X;  4EGY A;  3BOQ A;  5LGN A;  5D5X B;  4U7B A;  3D0S A;  2Z99 A;  3KP3 A;  1LVA A;  2OU2 A;  4PGH A;  1YYV A;  1SFX A;  2BYV E;  1R22 A;  4A0Y A;  5D5V B;  3JAM K;  1I1G A;  2BBY A;  1UCR A;  3FXR A;  3COA C;  3LA2 A;  3FX3 A;  1ZRE A;  3ABT A;  2QVO A;  2VBW A;  5DYM A;  1S3J A;  1NHA A;  2VOO A;  4ZYD A;  1D3Y A;  3MWM A;  1RUN A;  2X4H A;  3ZMD A;  1MD0 A;  5D4S A;  3DF8 A;  1SD6 A;  4I7H A;  2STT A;  5LBQ A;  2UXX A;  3IWF A;  4N0B A;  2M5W A;  2W84 A;  1T2K A;  3MAJ A;  3GYH X;  5D6F A;  2ADU A;  1FY7 A;  1PDN C;  2ISZ A;  4D0P A;  5DCM B;  2OZ6 A;  1B9N A;  2NYX A;  2R3S A;  3NQO A;  2EFO A;  3I5U A;  3FXQ A;  2VN2 A;  4M73 A;  5LHH A;  1LDD A;  2RV8 A;  4KT5 C;  1HSJ A;  1SAX A;  1R1T A;  3QOP A;  5DDG A;  4HF1 A;  4G7O F;  3HSF A;  2D2W A;  2WWY A;  2QEN A;  1LEB A;  2QBY A;  5E1X A;  2DW4 A;  2VC0 A;  1X3U A;  3LQQ A;  4UV9 A;  1CF7 B;  2JSC A;  4IHT A;  3V7C A;  4ON0 A;  4BXU A;  1ZRD A;  2R7F A;  4E70 A;  4AD9 A;  5BQT A;  4GCV A;  3ZN0 A;  1D8J A;  2QZ8 A;  4CDG A;  1G3W A;  5ERI A;  4L9J A;  4NHJ A;  4G9Y A;  2GA2 A;  4KIB A;  3O2P E;  3RJP A;  1K78 B;  2HYF A;  2JZY A;  3OOP A;  2O6G E;  5ICE A;  2CQK A;  4PCQ A;  3VEP A;  2IRF G;  1BI3 A;  2J5O A;  4M6Y A;  1XCV A;  1FNN A;  2HOE A;  4CIC A;  4ESJ A;  4A0Z A;  4RGR A;  2KRF A;  3QU3 A;  4DNC A;  5ED4 A;  1O3T A;  5K5Q A;  1IUY A;  3SHF A;  2FBK A;  4JBA A;  2HQN A;  1JE8 A;  3F8N A;  1HW1 A;  1B4A A;  2QQA A;  2TDX A;  1L0O C;  3P9C A;  2XKO A;  1U8R A;  1IZ1 A;  2XUB A;  5LEK A;  1FLI A;  4ENM A;  3IC7 A;  5KK1 A;  4FT8 A;  1ZLK A;  5ILS A;  4A6E A;  5DCM A;  4B09 A;  4AWX B;  3SZT A;  4AIJ A;  3GUD A;  2EA2 A;  1FP1 D;  1WWX A;  5K5O A;  1HKQ A;  4OIP F;  1XCB A;  4HA8 A;  3RKY A;  1LDJ A;  4LD5 A;  2V1U A;  2EV5 A;  1U3E M;  1SMY F;  3WTT C;  4KN4 X;  4DQ2 A;  1FT9 A;  3ELK A;  4ENK A;  4I0A A;  3N97 A;  1E2X A;  3RPU A;  2OBP A;  1UB9 A;  3KZZ A;  2XKP A;  4GGG A;  5L3E A;  4WF2 A;  1XDU A;  4IF4 A;  2UWM A;  1AOY A;  5D4R A;  4EVI A;  3IHU A;  5HLG A;  5H20 A;  3V7S A;  5LGT A;  4IVN A;  1FYL A;  1FYK A;  3E6B A;  4UVC A;  2EFQ A;  1XDS A;  4RAY A;  2CWE A;  3RYP A;  4HF2 A;  1JXS A;  1TTY A;  5FLX Z;  3KZY A;  2P6T A;  3H3Z A;  4IJA A;  2M8E A;  4MQV A;  5JI6 A;  3M8E A;  1BN5 A;  1R58 A;  2HQR A;  1K78 A;  1IRF A;  5HS9 A;  1T98 A;  4LK0 F;  2RNJ A;  1OYI A;  3L9F A;  2OQR A;  2LF8 A;  4UUV A;  3ECO A;  2X0L A;  2CW0 F;  2C6Y A;  3FMR A;  1SD7 A;  4HOB A;  1EH7 A;  1SMT A;  2K4J A;  2W24 A;  1IXR C;  3GZ5 A;  2RQP A;  3NEU A;  1T6S A;  4EJU A;  4YFN F;  4BHB A;  1YQA A;  2HR3 A;  1DUX C;  1KA8 A;  1PP8 F;  4HV5 A;  3AAF A;  4BYY A;  1BI2 A;  1MJ9 A;  2PMH A;  3C7J A;  1SD4 A;  3HRM A;  3VFZ A;  4U0V A;  1QO0 D;  4L9V A;  2STW A;  5HS8 A;  4KA4 A;  4A5M A;  2L54 A;  2FU4 A;  3ROU A;  1G4D A;  1G3T A;  3E6M A;  2XAS A;  4M74 A;  2ELH A;  2DBB A;  3I54 A;  1S7A A;  2Y48 A;  1VTN C;  5D5U B;  5LGU A;  3WGI A;  3TO7 A;  1PUE E;  3TOA A;  1ZLJ A;  3H3U A;  2P5V A;  4RGX A;  1HW5 A;  4ZYE A;  4HLY A;  2ZFW A;  5E20 A;  2GAU A;  2D1V A;  1XMA A;  4CGZ A;  4EM2 A;  4EM0 B;  1H9G A;  2Q0O A;  1BM9 A;  4U0Y A;  3E97 A;  2QQB A;  4U88 A;  2JTV A;  1WRJ A;  5TJJ A;  2RDP A;  1UHM A;  3F22 A;  4UVA A;  2O0Y A;  1USS A;  1PP7 U;  3P7N A;  2XGX A;  4XSZ F;  2Z9O A;  3WTZ A;  3DXJ F;  2HYG D;  4WXC A;  1RI7 A;  4JQF A;  3W6J B;  4P96 A;  3WGH A;  1QNT A;  2KJC A;  5J8F A;  2V1D A;  1QZY A;  2D1H A;  4MGR A;  4MNU A;  5AIQ A;  3BJ6 A;  1KQ0 A;  1MJA A;  2E7X A;  1J2X A;  1TW2 A;  2P7C B;  3MCZ A;  2EB7 A;  1Z6T A;  3VB2 A;  1FX7 A;  5E18 F;  3IKT A;  4IRI A;  1IRG A;  2EWN A;  4RGS A;  1ZHF A;  2CFX A;  2E7W A;  4GYI A;  5HLI A;  2ZNY A;  4I01 A;  5K1Y A;  3WTY C;  5FLX K;  5DCF A;  4I09 A;  1T38 A;  4BQA A;  1TW3 A;  1ZYR F;  2OZU A;  2L01 A;  1BIB A;  3WE3 A;  4IXA A;  4LGW A;  1G3Y A;  3FMQ A;  3IWZ A;  4LB5 A;  1YTY A;  2RC4 A;  1UST A;  1K79 A;  3RDI A;  4GYG A;  4U0W A;  3Q5F A;  1XMK A;  4YIF A;  2L4A A;  3LA7 A;  3DEU A;  3L00 A;  5F1R A;  2LNB A;  1MGT A;  2FML A;  4PZJ A;  3MZY A;  5ICG A;  3O6B B;  1R1U A;  3HUG A;  1J7K A;  2ZNZ A;  3GO5 A;  3GF2 A;  3WTV C;  4RGU A;  3D5L A;  5CYV A;  3FWE A;  3GLX A;  4P5O A;  1YW9 A;  1P92 A;  1I1S A;  3U2R A;  1B6A A;  5L3D A;  3BZ6 A;  3BP8 A;  1Z9C A;  1R23 A;  2AS5 F;  1MZB A;  1S29 A;  1S7O A;  2OA4 A;  2PBI A;  1SFE A;  1P4A A;  2XRO A;  2MA3 A;  3C18 A;  3CDH A;  5HLH A;  1ON1 A;  2ZXJ A;  1B1B A;  3BRO A;  1I6X A;  4CHU A;  3V8L A;  3KFW X;  1K7A A;  1ZH5 A;  2Y0M A;  3R6S A;  2IP2 A;  1FBS A;  3ZQ7 A;  3CUQ B;  3KLN A;  2IPQ X;  2FF4 A;  1QBJ A;  3SXY A;  4XBF A;  2VT2 A;  4FX4 A;  4HDU A;  4GXO A;  2CO5 A;  4I98 B;  4HZF A;  2A68 F;  3K1N A;  2QQ9 A;  3V8K A;  4LK1 F;  1Z6R A;  3ABU A;  2VE8 A;  4XSX F;  2LSO A;  1HQC A;  3WTX C;  3DQV C;  2DK8 A;  1D5V A;  1IF1 A;  2FMY A;  4OU0 A;  4KN7 X;  4LFU A;  4BNC A;  3ISP A;  1T0F A;  4RB1 A;  2RKH A;  3QAH A;  4ENJ A;  2DAO A;  2OAZ A;  4EJO A;  3JW4 A;  4HAM A;  1YW8 A;  4HLX A;  1YIO A;  1H0M A;  1RNL A;  1W7P D;  3RKX A;  3M7G A;  1JHH A;  1Z7U A;  3GFL A;  4HW0 A;  1GXP A;  1YO5 C;  2KIM A;  2PMU A;  4O6J A;  4M9Z A;  5CVV A;  4P9U A;  4Z2Y A;  2KIF A;  2PG4 A;  5CVR A;  2XAG A;  1TLH B;  1ZGJ A;  1ZG3 A;  3HSE A;  1ZRF A;  2BE5 F;  1TNS A;  2EFN A;  4L5J A;  1GVJ A;  2XIG A;  1EV7 A;  3E3V A;  3GEZ A;  3WTS C;  1IN5 A;  4OIO F;  3QU6 A;  4L9N A;  4XRF A;  4HQE A;  4EMS A;  5AON A; 
#chains in the Genus database with same CATH topology
 4XOR A;  1QRY A;  4BAC A;  4Z6Y A;  1ZQ3 P;  2EFP A;  3PO2 J;  4DZP A;  1P4W A;  2DK5 A;  4XN3 A;  2VJJ A;  1O7L A;  2QGU A;  3P9K A;  4PGG A;  2Q8K A;  4Q48 A;  3L7W A;  5CVI A;  5HLT A;  5J4V A;  1W4M A;  3L09 A;  3CUQ C;  2E5N A;  3S1R J;  3I3L A;  1FZP B;  2XHK A;  3H92 A;  4LMY A;  4HBL A;  1A6Q A;  1XTA A;  3SDG A;  2GM4 A;  1QU3 A;  3CCY A;  3CUQ A;  4E6K G;  3KP6 A;  1Z77 A;  1FIP A;  2ISY A;  5JHU A;  3WU1 B;  2VE9 A;  2VBZ A;  5E3O A;  3E6C C;  4Y15 A;  1HKS A;  2DDB A;  4UUT A;  4G94 A;  1R4N B;  2V1N A;  4FHT A;  5LEJ A;  3G3Z A;  3HTU A;  1HST A;  2L4M A;  4AM3 A;  3RQ4 A;  4R8H A;  3GLL A;  1L3L A;  3SDB A;  3MEX A;  4LLL A;  1IW7 F;  3I64 A;  3JRC A;  3DBR B;  2G7U A;  3F8B A;  1YFH A;  1QGP A;  4KMF A;  1DPR A;  2DLL A;  1ZN2 A;  4NQW A;  3TP3 A;  3BCA A;  3PM1 A;  2V6C A;  3U1D A;  1O3R A;  2XSD C;  4M9X A;  2QUF A;  1XC5 A;  4Y17 A;  2V6E A;  5L3F A;  3I53 A;  5HVQ C;  2IW5 A;  1HXD A;  1DP7 P;  3QP6 A;  4HF0 A;  4EM1 A;  4GRI A;  2HI3 A;  1NTC A;  1KU2 A;  4E7H A;  3ZN1 A;  4B3X A;  2ESN A;  4HPQ A;  4EJV A;  2MC3 A;  3ZMU A;  4UNO A;  2M34 A;  2HXI A;  2Z33 A;  3HB9 A;  5F08 A;  3GTL J;  3GTQ J;  5IP7 J;  3HRT A;  4DW6 A;  1LE8 B;  2N8G A;  1IN8 A;  2X48 A;  2FOK A;  4HNT A;  4F3Q A;  3LFK A;  4RBO A;  3DLA A;  3H3V K;  2FA5 A;  3I0T A;  4R1H A;  4OWR B;  2R5Y A;  1J59 A;  1QPM A;  2DMN A;  3K70 C;  1BW6 A;  4XLN F;  2PQ8 A;  2QLZ A;  2AHQ A;  1IUF A;  3GXO A;  1BW5 A;  5FB2 A;  2NS0 A;  4AVP A;  1IRZ A;  3ZMT A;  1YE9 A;  2WAE A;  4XLH A;  4XLP F;  2QA4 I;  2NS7 A;  1OKR A;  4AIK A;  4E7K A;  1KQ8 A;  3M1E A;  2E5Z A;  3VYS B;  5L3G A;  4LLG F;  2E1O A;  4XNF A;  3CCE I;  3OSG A;  1WI3 A;  1E17 A;  2P4W A;  3OIO A;  1MBF A;  4YRV A;  3RI4 A;  1XSD A;  1X4P A;  1JHF A;  3RKW A;  5HDG A;  2XC7 A;  3TQN A;  1ULY A;  1F9N A;  1FYM A;  4LB6 B;  4PFO A;  4CCJ A;  1C0W A;  1MMA A;  1REP C;  2ZJP F;  2MH2 A;  3DP7 A;  3K1M A;  3KZI C;  3LSG A;  2OPT A;  2VIX A;  1ETK A;  2H8W A;  3GTJ J;  2O61 A;  2V1X A;  3RCO A;  3A02 A;  3A2K A;  1CGP A;  4ZYG A;  3UNG C;  2LG4 A;  1IXC A;  3KP2 A;  3ML6 A;  3CC4 I;  2RRE A;  4AID A;  2R5Z B;  1A6I A;  2JVH A;  3I4N J;  3CO7 C;  4BE1 A;  2E1C A;  1EH6 A;  2JA7 J;  3S15 J;  1SVO A;  3FM3 A;  4DBR A;  1NG7 A;  1U9N A;  1WSU A;  1HOM A;  1UG2 A;  1JTY A;  2QYO A;  3DPT A;  3CME I;  3CES A;  2VB6 A;  4FAS D;  2IA1 A;  5BOX A;  3DPL C;  5CLS A;  2QSH X;  4CCO A;  1YJW I;  1W7P B;  4MHG A;  3BZC A;  3HOY J;  4XL9 A;  3HEF A;  1F1Z A;  3FZV A;  1R36 A;  2FD5 A;  2M3A A;  3OYJ A;  4BY1 J;  3TGN A;  4F91 B;  1T8I A;  3M07 A;  2F5D A;  3R4K A;  3WTW C;  2M8G X;  1FSH A;  3HGY A;  3L1P A;  2A69 F;  3E5Q A;  5IP9 J;  4KMU X;  3S3N A;  2JPC A;  2KZV A;  2I5U A;  2Z2S B;  3A0B C;  2HEO A;  5IPA A;  1U5T B;  1XS9 A;  1ITY A;  3LOC A;  1NH3 A;  1Y39 A;  2JRT A;  3QRF F;  1GV2 A;  2IS2 A;  2A5Y B;  1FC3 A;  2JWT A;  2O03 A;  3EUA A;  2H09 A;  1P4X A;  5EF6 A;  4J00 A;  3CCR I;  1ACI A;  5JVT A;  2V4J C;  1J75 A;  1ZRC A;  3U21 A;  1VQL I;  2ZO4 A;  5DUI A;  2M0M A;  5FKN A;  4DYC A;  1OYY A;  4CSW A;  4H0E A;  3ABM H;  3H1C A;  2PEX A;  2K4B A;  3LAJ A;  4P55 A;  2PI0 A;  2YS9 A;  1BA5 A;  2XAH A;  3W6K B;  1FBU A;  1MKM A;  1WHU A;  1TQP A;  2R7T A;  3H36 A;  4A3K J;  4M9S A;  3HIF A;  1E3O C;  1IG7 A;  2YR2 A;  1LE8 A;  1HBX G;  1Z67 A;  4F7Z A;  1FPQ A;  1KGS A;  4BAY A;  1F5T A;  4S05 A;  3A0H C;  3VSK A;  6PAX A;  3IKV A;  4UXN A;  2IEK A;  4KNY A;  4UY8 I;  5AIP A;  3BZK A;  1MSF C;  2W25 A;  4XON A;  3VWB A;  2PN6 A;  1N25 A;  4IRH A;  2PFB A;  2L0K A;  3ERE D;  5EJC A;  5JR3 A;  4NC6 A;  3RYR A;  2BVL A;  4Y13 A;  3FHZ A;  3MVP A;  5CJ9 A;  4K2E A;  4A2U A;  2RNG A;  2EZH A;  1G59 A;  2EIK H;  3TBI A;  2ICW G;  1WVR A;  1KU7 A;  3R0A A;  2CJJ A;  2DOE A;  2BEO A;  3HOS A;  4G7Z F;  3TKY A;  1KYZ A;  3LQR A;  4WXH A;  1SD5 A;  4MEY F;  2CRG A;  3T8T A;  1YJN I;  3KP5 A;  1ZGA A;  1WH7 A;  5EEG A;  4NNJ A;  1ZAO A;  2EA4 A;  1J9I A;  3C2H A;  5FO5 A;  2GIZ A;  4BJ5 C;  2DPD A;  3HUG B;  1O7F A;  1MMN A;  1Z05 A;  1BIA A;  3ONQ A;  5E3N A;  2DOD A;  5F64 A;  2GZW A;  1W36 C;  3K9T A;  4HV6 A;  2ELK A;  2R5Z A;  2MSY A;  3K69 A;  2R7W A;  1ZR4 A;  4OIN F;  2DO7 A;  2G0E A;  2LRD A;  1ZGW A;  5K5R A;  1LB2 A;  3E6D A;  5J1R A;  1R5H A;  4PFP A;  2VT3 A;  1LFP A;  3LSH A;  2OQG A;  3H0G J;  2MLK A;  3K10 A;  3V4G A;  3EYY A;  1WFX A;  2H27 A;  5BPD A;  4EV0 A;  1B8I A;  3J80 Z;  3MZH A;  3KET A;  2PLY A;  2CG4 A;  1OYW A;  1XGO A;  2LDU A;  2MG4 A;  3KX2 A;  1DDN A;  3KIO A;  1YS6 A;  1TQI A;  3ZGK A;  1ZKG A;  4S04 A;  4IHW A;  2M30 A;  3LMM A;  2DFH A;  1TC3 C;  1I39 A;  4Y7N J;  2X1D A;  3JSP A;  1VQ8 I;  4HYE A;  3F8M A;  1W7P A;  1ZK8 A;  3FHN A;  4WCG A;  2DDA A;  1XX5 A;  3QP5 A;  3P5J A;  5JFR A;  5EEH A;  2MYS A;  2BY0 A;  3F21 A;  3DKW A;  4HQM A;  1ZG1 A;  2LK2 A;  5FD6 A;  1R49 A;  1FIA A;  1RZ4 A;  5D8L B;  1U5T C;  4XLC A;  2EPF A;  1A04 A;  1O3Q A;  4NB5 A;  2EK5 A;  2HWV A;  4HDV A;  3OV8 A;  4RA2 A;  2GLO A;  4A5N A;  2HDW A;  3EET A;  4GFB A;  4M3E A;  2COB A;  1R00 A;  2F5V A;  1BR1 A;  1U5T A;  4BHP A;  4YFX F;  1AA7 A;  4JX4 A;  2DQR A;  3DTE A;  4YII A;  4KIF A;  3HOW J;  1WJA A;  1U9O A;  1STZ A;  2QSF X;  3A4C A;  3FXM A;  1V4R A;  2M9H A;  3C1D A;  4WWC A;  3S2W A;  4RS8 A;  3QQA A;  3VOD A;  2FNA A;  4C3I J;  3T0Y A;  4IHX A;  1YI2 I;  4X1E A;  2BOL A;  4CXF A;  5IY5 H;  3ZQI A;  4RAG A;  2VI6 A;  2KMU A;  4JP0 A;  2L2O A;  5GTH C;  2DT6 A;  3CQZ J;  3S1N J;  4X6A J;  1MBG A;  5J1U A;  3ZQH A;  3BPV A;  1VQN I;  2FXA A;  1TQM A;  4L5I A;  2ELJ A;  4KDP A;  2L02 A;  2M87 A;  3BG9 A;  2JA6 J;  2K27 A;  1G6N A;  2XF7 A;  2CUJ A;  3EUH C;  4EJW A;  3KEO A;  4KIT B;  3NAU A;  2JT1 A;  1R71 A;  2ID3 A;  1MJB A;  1BC7 C;  2H6C A;  3EUH A;  2EZI A;  2EV6 A;  2VOD A;  4A3E J;  1WZ2 A;  2VC1 A;  2IA2 A;  2Z5U A;  1G3S A;  1Y1V J;  3KE2 A;  1RET A;  2K02 A;  3MN2 A;  4HSR A;  4I0B A;  3EQL F;  1YHQ I;  3TDZ C;  1V5F A;  4ZZL A;  2LC2 A;  1ZG5 A;  1FMW A;  2XVC A;  2AQF A;  3B73 A;  3HOU J;  3OYD A;  5LRR A;  4X0G A;  4CYD A;  4OIQ F;  1Z1D A;  3TMO A;  2GXB A;  3A01 B;  3CCJ I;  2DA6 A;  1XGS A;  2R7R A;  2ZJR F;  5EEA A;  1E0E A;  4ITV A;  1YLF A;  4E4H A;  2NS8 A;  2WTE A;  3TOB A;  4D5F A;  2VOP A;  4BE2 A;  4ETS A;  1RC9 A;  1ON2 A;  2A6E F;  4ESB A;  2F5C A;  3PIP F;  3B02 A;  2XGD A;  2L7Z A;  3K4M A;  4XRS A;  2WC2 A;  4ZZD A;  5F0C A;  2O5R A;  1T39 A;  1WKM A;  2WAQ A;  1T33 A;  5EGO B;  4TV7 A;  3WOD F;  4A3M J;  3WTU C;  2OD5 A;  5CVJ A;  1EJ9 A;  5FRN A;  5D8K B;  3HL2 A;  1U2W A;  3F6V A;  1XSV A;  2HTS A;  2FBI A;  2JMW A;  2M0C A;  1HC8 A;  2D45 A;  5M3F J;  4L0Y B;  4HX7 A;  3KYC B;  4MTE A;  2FNP A;  2LMD A;  4B47 A;  2K9N A;  2M45 A;  1XMX A;  1IDZ A;  4V2F A;  2DFI A;  1D0Z A;  4DOZ A;  2CYY A;  4OAY A;  3RPQ A;  3S8P A;  5C3E J;  1UEL B;  1JI8 A;  3ZPL A;  2X9D A;  2R7S A;  4IZZ A;  1VQ4 I;  1QHG A;  1I5Z A;  2X6O A;  2CQ7 A;  2Z1D A;  4UB8 C;  5H6R A;  5JHF A;  5LHG A;  2A3S A;  3N4M A;  3H9G A;  5KAI C;  2CQQ A;  1WJE A;  5D5W B;  2YPR A;  4RLQ A;  2R7Q A;  2HU9 A;  1ETX A;  2EFW A;  5IOY A;  4Q4Z F;  2DPU A;  3A03 A;  3CUO A;  3CP2 A;  5J4Y A;  4BBR J;  3CO6 C;  4KIC A;  5E1W A;  4EEF G;  4EQQ A;  2XPU A;  5ICC A;  1FBQ A;  3CCV I;  5J6X A;  1YW7 A;  2CW7 A;  2XF6 A;  2HPM A;  2ZXI A;  3OWT A;  3KP4 A;  2DT5 A;  3FXJ A;  3ZMS A;  2A5W A;  4BHC A;  2DMT A;  2XAF A;  5HDN A;  1GV5 A;  3KPH A;  3JRH A;  3FKJ A;  2XRN A;  2ME0 A;  4M3G A;  3LNQ A;  4M6V A;  3HJE A;  1JGS A;  2CQX A;  2ZJ2 A;  4YIR X;  4U7D A;  4WK8 F;  2GXA A;  1T08 B;  5H2F C;  2A6H F;  1OCZ H;  3E7L A;  5A2Q Z;  4KJZ A;  2K86 A;  2CH0 A;  2E1N A;  4BL0 B;  3IH2 A;  3R0J A;  2IGK A;  1ONV A;  3WE2 A;  2VXZ A;  3I4P A;  3I59 B;  2FOW A;  2XSJ C;  4HNU A;  2R7X A;  4MFD A;  1F4K A;  4O3M A;  2HXO A;  3GTO J;  2DYS H;  4NQW B;  1Z91 A;  1W1W E;  1J0R A;  5BS6 A;  5TGT A;  3CZ6 A;  5E3L A;  2JVG A;  3GTK J;  4MQ9 F;  1X1A A;  1HKT A;  1X19 A;  2QM3 A;  3ABL H;  2P8T A;  4B8X A;  1P9Q C;  3T1B A;  2PMZ A;  2L7F P;  4DJA A;  4OIR F;  3GFM A;  4HX8 A;  1TWG J;  2GQQ A;  1Z0X A;  3V42 A;  1MND A;  1SC7 A;  3E5U A;  3IUO A;  2P7V B;  3J80 K;  4NC7 A;  3OYL A;  3GWZ A;  5HDK A;  2XF5 A;  1GHC A;  2WBM A;  2KKO A;  2R5Y B;  3EYI A;  3A01 A;  1ODD A;  1QA6 A;  3V7R A;  1CQT A;  2WAD A;  3FDY A;  3FXO A;  5FD5 A;  2GWR A;  2GIV A;  2V9P A;  1X4O A;  2F48 A;  2J5P A;  1LQ1 A;  1JKP C;  2KJB A;  4XOT A;  3J81 K;  2VPL A;  4LG3 A;  2NVU B;  3ZQQ A;  4NUB A;  4BY7 J;  4B48 A;  3OIP A;  4FQG A;  1R1V A;  4PJM A;  1IDY A;  2VON A;  1DPU A;  3PIO F;  3R60 A;  4Y52 J;  1KYW A;  3N05 A;  2O9L A;  1Y1W J;  4C30 A;  4XMY A;  2QEX I;  2DOA A;  5FGM A;  4BKX A;  3K0L A;  5ILV A;  2JSP A;  4G6T B;  1K61 A;  3A1Y A;  3QPH A;  1K6Y A;  2B7E A;  1B72 B;  2K85 A;  3CCS I;  3I71 A;  5DM7 F;  4O5V A;  5K7Z A;  4OMY A;  4OOI A;  2FQ4 A;  2UZK A;  1U6G A;  3KLO A;  3R61 A;  4MTD A;  3NRV A;  4MLO A;  2ZME B;  1TBX A;  3U1K A;  1A5J A;  1YIJ I;  2CV2 A;  3J7Z I;  3PUF A;  4RB2 C;  4AIH A;  3C2B A;  1D1C A;  1WGX A;  1GXQ A;  1OMI A;  2MD5 A;  3PJR A;  1LDK B;  2ACJ A;  2XAU A;  4UV8 A;  5C44 J;  5M3M J;  1LPQ A;  2DFE A;  4QLC U;  3BG3 A;  1F36 A;  1J5Y A;  2HTJ A;  2OC6 A;  1ZAR A;  3LWF A;  4YEJ A;  4XN0 A;  1R9T J;  2LY9 A;  3FM5 A;  3FF5 A;  1JKQ C;  1QQI A;  2BY2 A;  3K4B A;  4BJ6 C;  1S9H A;  3OR2 C;  4IRG A;  2X85 A;  3F8F A;  1B59 A;  4A3C J;  3BR5 A;  5E3M A;  1YX5 A;  3KCC A;  4RDU A;  3ERM A;  1V3F A;  1MH3 A;  3RIR A;  3S2H J;  2E2H J;  5IT9 Z;  3HBL A;  2R7O A;  2CV0 A;  2FQ3 A;  4XKB A;  4ZDO A;  2RQQ A;  3V8J A;  4E7J A;  2OCE A;  4PSX A;  4A93 J;  2EIL H;  3OSF A;  1NG6 A;  5H6Q A;  3T5X A;  3LA3 A;  2FE3 A;  4J01 A;  3GZ6 A;  1XSX A;  3JRG A;  5D6E A;  5J47 A;  1OPC A;  2KDZ A;  3MFK A;  1FWZ A;  3I59 A;  3VSL A;  4I2O A;  3RZD J;  3GFJ A;  1P7J A;  5E1Z B;  4R79 A;  2QSG X;  1JJ8 C;  2COM A;  1IN7 A;  1YRN B;  1D8K A;  2EBI A;  3D5S C;  1ETY A;  4LG0 B;  4CA0 A;  1UFM A;  1QZE A;  2Y0S A;  2WY8 Q;  4P9F A;  3IL2 A;  4IPA A;  4BE0 A;  4G8X A;  1I27 A;  5GP9 A;  5EZG A;  1UMQ A;  3EDP A;  1IN4 A;  2JJ7 A;  4GO1 A;  1RES A;  2UUZ A;  1BI0 A;  4N9I A;  2HGC A;  2NNY A;  1JGG A;  2ZKZ A;  3ZP5 A;  5GTI C;  5HS7 A;  3LFU A;  2W7N A;  3REO A;  1XD7 A;  2LF7 A;  5DS9 A;  2P6S A;  3GME A;  4D7M A;  5FFX A;  4UVB A;  4RMN A;  2BXZ A;  2ETH A;  1S8N A;  5LRS A;  2LY1 A;  4G6Q A;  4JOM A;  1I3Q J;  1WJB A;  3K2Z A;  2L3D A;  3QPT A;  1Y8Q B;  4A69 C;  1APL C;  2FSW A;  4PUS A;  3S93 A;  4YFK F;  3CCQ I;  4BDZ A;  2WY7 Q;  3S16 J;  3AFH A;  3C2G A;  2F5F A;  4N9H A;  3VYR B;  4UHT A;  2G9W A;  4JX5 A;  3GFI A;  1WJD A;  2JPB A;  2MC4 A;  2P0W A;  4D7N A;  3HTS B;  2VQC A;  2ZBK A;  3HYI A;  1WQ2 A;  2KPM A;  3WGG A;  3LAP A;  3HOT A;  3VOE A;  3BTI A;  1XGN A;  5E8I A;  1BI1 A;  2JA5 J;  1BOA A;  3BJA A;  4AVZ A;  1XGM A;  1TWA J;  1KQ9 A;  5L3C A;  2R7D A;  5HOO A;  4G7H F;  1B72 A;  3S1Q J;  2ZME C;  3CJT B;  1XN7 A;  1YS7 A;  1KU9 A;  4QWQ A;  4BH9 A;  3JTG A;  5DUK A;  2ZME A;  5A2Q K;  4KYW A;  3HRS A;  3OOU A;  4KT6 A;  3PSF A;  4XK4 A;  1CF7 A;  4YG2 F;  2CFO A;  2KLO A;  3BWG A;  3CTA A;  5GAD J;  2DQL A;  1VQK I;  2H6B A;  1D0X A;  1W5C C;  2W85 A;  1IAW A;  3T8R A;  4A6D A;  2VJI A;  4ZYH A;  5B1B H;  2O8X A;  4OMZ A;  1I3A A;  1B8I B;  2EJR A;  4M72 A;  1DGR M;  5E79 C;  3CC2 I;  1IXS B;  2QWW A;  2CQN A;  4B4C A;  3NWS A;  3PFI A;  1PUF B;  2A07 F;  3WHC A;  4FX0 A;  1Y0U A;  4WXD A;  3BR0 A;  1X1B A;  3DTI A;  5FKL A;  2V26 A;  2YX4 A;  2VBX A;  4HX4 A;  2DA2 A;  1BC8 C;  1P6R A;  3M8F A;  3BPX A;  2IJL A;  4A0X A;  3DPU A;  3LSP A;  2IA0 A;  3SQN A;  1O4X A;  2EZL A;  2DTR A;  4A3L J;  1XG1 A;  5B5E C;  2WV0 A;  3QYE A;  4IO9 F;  3PL8 A;  2HZD A;  4XLF A;  1ETV A;  3G2B A;  3AL0 B;  2ZCW A;  3BJO A;  2XAQ A;  5DEQ A;  5J8C A;  2FRH A;  3DKY A;  2KIU A;  3H9J A;  2VAS A;  3FXU A;  3ZMV A;  1UHW A;  3ZOB A;  3K4C A;  2UXN A;  3LSM A;  3SEQ A;  3G73 A;  4CO8 A;  1YIT I;  1X1D A;  1QVU A;  3BDD A;  4G6D A;  2IBD A;  4L9T A;  4RAZ A;  3LST A;  4WX9 A;  2HOA A;  2XAJ A;  4L0Z B;  1Q1V A;  1U8B A;  1LNW A;  2RN7 A;  1FOK A;  2BV6 A;  3CLO A;  5TRD A;  2VQH A;  1YRN A;  3S2D J;  4H4K C;  5F0F A;  4QTR A;  1TNT A;  2BGC A;  2ESH A;  2B0L A;  4LG0 A;  4DBQ A;  3ZQL A;  2HZT A;  1D5Y A;  4XLE A;  1V5G A;  4CZZ A;  4B43 A;  3F72 A;  1P2F A;  3ZQG A;  1B9M A;  2ZJQ F;  1TWC J;  1X58 A;  2JK3 A;  2YSR A;  5BMZ A;  1Z7L A;  5FJ8 J;  2B63 J;  5DV5 A;  4ZTJ A;  3SZP A;  2MD0 A;  1DU0 A;  3JSO A;  2BY3 A;  3S17 J;  5IYC J;  1RIO H;  3HZJ A;  3GTP J;  4AYB A;  2NRA C;  5KVR A;  3QOE A;  3BR6 A;  1WJF A;  2K5C A;  4I02 A;  5LFA A;  1MDM B;  2KP6 A;  2RAE A;  1H9T A;  2LLK A;  2MBF A;  3F8C A;  3JAM Z;  5LLQ A;  4I76 A;  2HDC A;  4EJT A;  3K4L A;  5M5W J;  1OCC H;  2R4G A;  4IOC F;  3LSK A;  4DZJ A;  3E5X A;  1GDT A;  2XPW A;  3H0D A;  4Y33 A;  3TO6 A;  2IS1 A;  2P5L C;  1TWH J;  3J7A O;  3F6O A;  1N75 A;  3SZG A;  1X3W B;  2W82 A;  3O3K A;  1D1A A;  4E7I A;  3M9A A;  4JK1 X;  5F04 A;  3U9G A;  3LSR A;  2W00 A;  5IT9 K;  1YG2 A;  2GA1 A;  2XGE A;  1RUO A;  2E36 A;  4FCY A;  4LLN A;  2V9V A;  2CGP A;  1WI9 A;  2IS4 A;  2FBH A;  5DD4 A;  3K1P A;  3PQJ A;  4CYC B;  1Z21 A;  1OQY A;  4NDL A;  5FKK A;  2NAZ A;  1RPW A;  5CPR B;  5FFZ A;  4ASN A;  4M6X A;  2K7L A;  4A3J J;  1K4S A;  3I58 A;  2Q2E B;  1X2N A;  3JTH A;  4P1W A;  5F0H A;  3CMM A;  1OR7 C;  2HDD A;  3HKZ A;  5CVU A;  2G7H A;  2KL4 A;  3HRU A;  2A05 A;  2W4S A;  1OCO H;  2X1E A;  3CCM I;  2DJN A;  3F23 A;  1JKO C;  4IHS A;  2MH9 A;  1OR7 A;  1OLT A;  2EIJ H;  2P5K A;  3VYT B;  3GW2 A;  5DD8 A;  1U78 A;  3MQ0 A;  1PUF A;  4QIW N;  2XDV A;  3TO9 A;  3NAR A;  4L18 B;  3RQI A;  3CJN A;  1LJ9 A;  1ZTR A;  3PSI A;  3DV8 A;  3BG6 A;  1BBY A;  3BTL A;  5ICF A;  1FOX A;  2M4G A;  1QZZ A;  3J81 Z;  3RTR A;  3WG7 H;  2IT0 A;  3HG9 A;  1UG0 A;  1Q1H A;  4M71 A;  3AL0 C;  5HOD A;  3Q9S A;  3F3X A;  3ZR8 X;  4ESF A;  4AU7 A;  5LHI A;  1EH8 A;  1W5S A;  2HKX A;  2PJP A;  3W6V A;  2QKL B;  1N77 A;  4FE7 A;  3P9I A;  1BJA A;  2RGV A;  2XV4 S;  5DM6 F;  1ERD A;  1VQ6 I;  2BW3 B;  1LKX A;  3KP7 A;  4MFE A;  1W0T A;  4RB0 A;  1S6L A;  4KUM A;  2Q1Z B;  3GVA A;  2M1B A;  4KIG A;  2Z3Y A;  5GAH J;  4A12 A;  4Y3O A;  3ECH A;  1PVE A;  4PJL A;  3PQK A;  1JTX A;  3VPR A;  4FET A;  5IT3 A;  2H94 A;  4F55 A;  5F6F A;  4QPO A;  1O57 A;  5M5X J;  4Q47 A;  3QYB A;  5L3B A;  5JLX A;  1OJL A;  1HW2 A;  4F92 B;  4IQJ A;  3IRR A;  2DA7 A;  4CCK A;  3Q9V A;  3L2C A;  5E8G A;  2GOM A;  2HKO A;  2WB1 A;  3AG2 H;  2AXL A;  4XRS G;  5ILU A;  4Q5S F;  1P7I A;  3SYT A;  4M3B A;  3ZMZ A;  2YX7 A;  2VKV A;  1XB4 A;  1AWC A;  2O3F A;  1MDM A;  2RVC A;  2Y75 A;  4EGZ A;  3OYM A;  5BPI A;  3FMS A;  1K6O A;  4LJZ F;  2CV1 A;  2HPI A;  1A35 A;  5E17 F;  2NNN A;  3HSR A;  3HHG A;  2V79 A;  3NWT A;  2W57 A;  2WAQ N;  4JYK A;  2XRL A;  2MLG A;  1G8X A;  2DI3 A;  3OR1 C;  2VBY A;  3CP8 A;  1SVM A;  3BT9 A;  3IRQ A;  2GXG A;  1FSE A;  2EV0 A;  1KU3 A;  4RB3 C;  2BVM A;  2X1C A;  1DP3 A;  3WU0 A;  3FXK A;  2VL8 A;  3HHH A;  2NOJ B;  3KEQ A;  2DN0 A;  5GAG J;  2HQ5 A;  5TIS C;  4ENN A;  2H1L A;  2F5E A;  3ULQ B;  1MMS A;  3C3W A;  2MFZ A;  1W5T A;  3G1M A;  3H5R A;  3LL7 A;  3WG9 A;  3DU6 A;  3ZQF A;  3OYA A;  5M5Y J;  2YU3 A;  2HS5 A;  1I50 J;  3TDU C;  4BXF A;  2FEZ A;  1JUS A;  4PDK A;  3OYB A;  4D1Q A;  1IO2 A;  2HFH A;  1VQ7 I;  3I56 I;  1SFU A;  3SFZ A;  5J1Y A;  3DFG A;  4CYC A;  2E71 A;  4KFC A;  3M4O J;  2QF7 A;  1MBK A;  1R7J A;  2Q2E A;  2LBF B;  2IVM A;  2QBY B;  5C4X J;  2LKP A;  2FJ1 A;  2DU9 A;  2VJ5 A;  4XR6 A;  1IN6 A;  2VPR A;  2F2E A;  2NOG A;  4IHY A;  1N78 A;  1R5G A;  3IAM 2;  1MBH A;  2A61 A;  1D1B A;  1O3S A;  4ZH4 F;  1LEA A;  3BY6 A;  1TT5 B;  3MKL A;  4MEX F;  1FP2 A;  3JCU C;  2CSO A;  3GX4 X;  4EGY A;  3BOQ A;  4XLA A;  5LGN A;  5D5X B;  4XID A;  2PX9 A;  4U7B A;  3D0S A;  4RM2 A;  4CH7 A;  1JUM A;  2Z99 A;  3H9Q A;  3KP3 A;  1LVA A;  2WV1 A;  4A3D J;  2OU2 A;  5F1J A;  4GDF A;  2QKM B;  3H35 A;  4PGH A;  1YJ9 I;  3G4S I;  3QWL A;  1YYV A;  1SFX A;  2F6C A;  2BYV E;  3OYI A;  1SFO J;  1GT0 C;  4DYR A;  1R22 A;  4A0Y A;  5D5V B;  3JAM K;  3MMY B;  1I1G A;  2BBY A;  4PSW A;  1UCR A;  3FXR A;  3COA C;  2E1M B;  3OIQ A;  2ZXW H;  3LA2 A;  3FX3 A;  4W1U A;  2BW3 A;  3D1N I;  3OYC A;  1ZRE A;  3ABT A;  2QVO A;  2E35 A;  2VBW A;  3K2A A;  4DYQ A;  5DYM A;  3AG4 H;  3HXL A;  2JUC A;  1IGN A;  3S3O A;  1JJ6 C;  2I8D A;  4IX7 A;  1MBJ A;  1S3J A;  3F9K A;  4RM3 A;  1NHA A;  5DTD A;  2VOO A;  4ZYD A;  2PMZ N;  4ZDL A;  1D3Y A;  2W1O A;  2LRE A;  3MWM A;  1U0J A;  1RUN A;  2O7O A;  2X4H A;  3KYL A;  1VFC A;  2Y9Z A;  2CUF A;  3ZMD A;  1Y6I A;  3OYN A;  1MD0 A;  1PYV A;  5D4S A;  3DF8 A;  1SD6 A;  4I7H A;  2STT A;  5LBQ A;  2UXX A;  2IS6 A;  2BHZ A;  4XQF A;  2QQ8 A;  3SJM A;  3IWF A;  4FE4 A;  4N0B A;  2CS3 A;  1R6R A;  2ME6 A;  3AG1 H;  2M5W A;  2W84 A;  1T2K A;  3MAJ A;  4HG2 A;  5CQE A;  3M1C A;  3GYH X;  2XGC A;  3CF2 A;  2F4M B;  5D6F A;  2ADU A;  1BR4 A;  3JRI A;  1FY7 A;  4G12 A;  4ZJZ A;  5B66 C;  1PDN C;  2M4K A;  3GBG A;  2ISZ A;  4D0P A;  2KDO A;  5DCM B;  1NK2 P;  2OZ6 A;  1B9N A;  2NYX A;  1VQ5 I;  2MGQ A;  2R3S A;  1HLV A;  4IEJ A;  3NQO A;  4XIC A;  1QHH D;  2EFO A;  3I5U A;  3FXQ A;  1WCM J;  1AHD P;  5HNH A;  2VN2 A;  3F0C A;  1UHS A;  3W3C A;  4M73 A;  5LHH A;  2VUM J;  2DTZ A;  4IQ4 A;  1LFU P;  1LDD A;  2K3P A;  2RV8 A;  4KT5 C;  2DA1 A;  1HSJ A;  1OCR H;  3OYK A;  1R1T A;  1SAX A;  3QOP A;  5DDG A;  4I99 C;  5KHD A;  3ASO H;  5B1A H;  4HF1 A;  4G7O F;  1XPX A;  4QSH A;  3HSF A;  2D2W A;  1TZL A;  2XB0 X;  2WWY A;  2K3F A;  3ASN H;  2LKX A;  2K9L A;  1OIS A;  2QEN A;  1UZC A;  2PJR B;  1G2H A;  2LBF A;  4ZDP A;  1AU7 A;  4A3G J;  1X1C A;  1LEB A;  2QBY A;  3G1L A;  2VKH A;  1WPK A;  2X6W A;  5IP6 A;  4MO7 A;  2JN6 A;  5E1X A;  3GTM J;  1QVT A;  4CCM A;  3FXL A;  2DW4 A;  2VC0 A;  2Y31 A;  1R4M B;  1X3U A;  3LQQ A;  2OCC H;  4UV9 A;  2MW8 A;  1CF7 B;  1KZH A;  2JSC A;  4IHT A;  1KON A;  3V7C A;  2OJE D;  3OS1 A;  4ON0 A;  2LOO A;  4BXU A;  2ID6 A;  1ZRD A;  4C9Y A;  2R7F A;  1X3Z B;  1ETW A;  2IGO A;  3CD6 I;  2JA8 J;  1I6H J;  4E70 A;  4PJN A;  4AD9 A;  3JRB A;  4BQN A;  5BQT A;  2ZSH B;  4GCV A;  3ZN0 A;  1D8J A;  2L9N A;  2QZ8 A;  4CDG A;  3J7A Y;  1G3W A;  5ERI A;  5IYB J;  4L9J A;  4NHJ A;  2E1M C;  3PUB A;  2DA5 A;  4G9Y A;  2GA2 A;  2KIS A;  4KIB A;  3O2P E;  3RJP A;  1PJR A;  1MW7 A;  2LD5 A;  1K78 B;  2HYF A;  2JZY A;  3OOP A;  3E1S A;  2YU9 J;  3BR1 A;  1AKH A;  3MKW B;  2O6G E;  4HRI A;  1Z3X A;  5ICE A;  2CQK A;  4BUP A;  5K7F A;  1GVD A;  4PCQ A;  1BJZ A;  3VEP A;  3DBH B;  2IRF G;  1BI3 A;  2J5O A;  2Y0S N;  4M6Y A;  1XCV A;  4II3 A;  2LVS A;  4JX6 A;  1FNN A;  1LVK A;  2LFB A;  2HOE A;  4CIC A;  1JT0 A;  4ESJ A;  2LH9 A;  4A0Z A;  4BU2 A;  4RGR A;  2KRF A;  3QU3 A;  4DNC A;  5ED4 A;  1O3T A;  4ZC3 A;  2UV1 A;  5K5Q A;  1IUY A;  4C3H J;  3SHF A;  3TW6 A;  4B1R A;  5FLV A;  3ABK H;  2X6Y A;  3W2W A;  2FBK A;  4JBA A;  4AC0 A;  2HQN A;  3JRD A;  1JE8 A;  3F8N A;  1HW1 A;  3QOD A;  1B4A A;  2QQA A;  2TDX A;  1SAN A;  2VXD A;  1L0O C;  5IYD J;  3P9C A;  2V9K A;  2XKO A;  4RAF A;  1H8A C;  1POG A;  3HC7 A;  3D5R C;  3DBL B;  1U8R A;  1IZ1 A;  4UUS A;  1T56 A;  2XUB A;  5LEK A;  1FLI A;  4MIM A;  4ENM A;  1DGW Y;  3FK7 A;  3IC7 A;  5KK1 A;  4FT8 A;  1ZLK A;  3K4N A;  5ILS A;  4A6E A;  5DCM A;  3CJQ B;  1YX3 A;  4B09 A;  2WAF A;  4AWX B;  3E0J B;  2KIQ A;  3SZT A;  4AIJ A;  3GUD A;  2EA2 A;  4BEH B;  4ANJ A;  5FKO A;  1MH4 A;  2IXS A;  2K9S A;  4E7Z A;  1FP1 D;  1WWX A;  5K5O A;  1HKQ A;  3OYF A;  4OIP F;  3I55 I;  1XCB A;  4HA8 A;  4BGD A;  3RKY A;  1LDJ A;  4LD5 A;  2V1U A;  2EV5 A;  4KIS A;  2HVQ A;  4HNV A;  3KYD B;  1U3E M;  1SMY F;  3WTT C;  4KN4 X;  4DQ2 A;  3QPS A;  3QYF A;  5J40 A;  2GOX B;  2Y9Y A;  3PO3 J;  1FT9 A;  3ELK A;  4ENK A;  4I0A A;  4C2M J;  3N97 A;  1E2X A;  2Z16 A;  2PJR A;  1MMG A;  1VQP I;  3RPU A;  2OBP A;  3Q0W A;  1UB9 A;  3KZZ A;  2XKP A;  4GGG A;  5L3E A;  2BHY A;  4WF2 A;  3L2W A;  1V5E A;  1XDU A;  2VQG A;  4IF4 A;  3PNY A;  2CMP A;  2UWM A;  1AOY A;  5KAF C;  2ZXH A;  3VYU B;  4M3D A;  4BJT A;  5D4R A;  4A3B J;  1FTZ A;  3DLL F;  4EVI A;  2KRH A;  3IHU A;  5HLG A;  4LOC A;  3HOZ J;  5H20 A;  3V7S A;  5LGT A;  1FTT A;  3RKQ A;  4IVN A;  4IKF A;  1FYL A;  1FYK A;  3GZN B;  3E6B A;  4CUG A;  4UVC A;  2ZC2 A;  2EFQ A;  1XDS A;  2YUS A;  4RAY A;  2CWE A;  3RYP A;  4YEL A;  1ORK A;  4HF2 A;  4B3A A;  3ESW B;  1JXS A;  1TTY A;  3CCL I;  3TED A;  5FLX Z;  3KZY A;  4RLF A;  2DMU A;  5JLW A;  1JT6 A;  2DA3 A;  2QCO A;  2X51 A;  3ZRG A;  2P6T A;  3FKI J;  3CCU I;  2LKS A;  4BXX J;  5GPC A;  3S1M J;  3H3Z A;  2KRC A;  2A6T A;  5FRO A;  1ETQ A;  3BR3 A;  2JA2 A;  2VKD A;  3CLQ A;  2M8E A;  4IJA A;  4MQV A;  5JI6 A;  3M8E A;  1BN5 A;  3ZXS A;  1R58 A;  2HQR A;  2B9S A;  1IRF A;  1K78 A;  5HS9 A;  2L7K A;  3M3Y J;  2L5Q A;  1T98 A;  4LK0 F;  2RNJ A;  1OYI A;  3L2V A;  3L9F A;  4U87 A;  2OQR A;  2LF8 A;  2IGN A;  3Q0V A;  4UUV A;  3ECO A;  2KHM A;  2X0L A;  2CW0 F;  1X1P A;  2C6Y A;  2GBY A;  1VQ9 I;  2D5V A;  2VQL A;  1A31 A;  2R92 J;  1RR8 C;  2DT7 B;  3L2Q A;  3ZCO A;  3FMR A;  1V54 H;  5F27 A;  1ENH A;  4AUX A;  2JUG A;  5C4J J;  1SD7 A;  5EDN A;  4HOB A;  3CMY A;  1EH7 A;  3CDI A;  5FKM A;  3RZO J;  1SMT A;  2K4J A;  2W24 A;  4AYB N;  1IXR C;  4LIT A;  1E3P A;  3GZ5 A;  2RQP A;  3NEU A;  1T6S A;  4EJU A;  4YFN F;  5IOZ A;  4IL6 C;  4BHB A;  3ZQC A;  1YQA A;  2CUE A;  1YOV B;  1DU6 A;  2HR3 A;  1DUX C;  5HNF A;  1KA8 A;  1WH5 A;  1PP8 F;  1ZR2 A;  3OL3 A;  4HV5 A;  3AAF A;  5FRM A;  4BYY A;  1BI2 A;  4OAZ A;  2R7V A;  1MJ9 A;  1J09 A;  1FOY A;  2DA4 A;  2PMH A;  4UB6 C;  3DU5 A;  3C7J A;  1HCR A;  3OS0 A;  1SD4 A;  3O8G A;  3HRM A;  3VFZ A;  4U0V A;  3W2A A;  1QO0 D;  1UJ8 A;  1BL0 A;  4L9V A;  9ANT A;  3TW7 A;  4BEH A;  3OY9 A;  2STW A;  2JRM A;  1TT0 A;  2LTP A;  3FIW A;  5HS8 A;  4FTH A;  2L9V A;  4BQO A;  4KA4 A;  1HF0 A;  2L9R A;  4A5M A;  3I4M J;  4I6Z A;  1LUJ B;  2KQR A;  2L54 A;  1Y56 A;  2FU4 A;  3ROU A;  1G4D A;  3J7Y J;  1S72 I;  3BTJ A;  1G3T A;  3DKX A;  1VF9 A;  5JVG F;  2NVT J;  4EAT A;  1Z3Y A;  2E34 A;  2TRT A;  3E6M A;  2XAS A;  2NVX J;  3FBI B;  4M74 A;  4E7S A;  2ELH A;  2K40 A;  2OV7 A;  3K7A J;  2DBB A;  3HKZ N;  3HDD A;  3I54 A;  1S7A A;  3PNT A;  2Y48 A;  1SFK A;  4XOP A;  1VTN C;  4ZTF A;  1TP4 A;  1RRJ A;  1JKR C;  3IH4 A;  5D5U B;  5LGU A;  3EUK L;  3TO7 A;  3WGI A;  2EQR A;  1PUE E;  3TOA A;  1ZLJ A;  4HST A;  3H3U A;  2P5V A;  4RGX A;  1HW5 A;  1EKE A;  2R0Q C;  3CC7 I;  4ZYE A;  4HLY A;  2ZFW A;  5B3S H;  3KEY A;  5E20 A;  2NXN B;  5GPA A;  2HVS A;  2GAU A;  2D1V A;  1XMA A;  4CGZ A;  2HOT A;  4B44 A;  4EM2 A;  4EM0 B;  1MNE A;  1H9G A;  4C2T A;  3OYE A;  2Q0O A;  1BM9 A;  4U0Y A;  3E97 A;  4L5E A;  4XM3 A;  2E2J J;  2QQB A;  1DQU A;  1S7E A;  4U88 A;  2JTV A;  1WRJ A;  4W97 A;  5TJJ A;  1VQO I;  4BDY A;  2TCT A;  2RDP A;  1IV6 A;  2L7M P;  1UHM A;  3DEE A;  3F22 A;  3BQZ A;  4UVA A;  3HPH A;  2O0Y A;  3JRF A;  1USS A;  1PP7 U;  3K6G A;  3P7N A;  2HOS A;  2XGX A;  1HDD C;  4XSZ F;  3Q0U A;  2Z9O A;  3O8H A;  3WTZ A;  3DXJ F;  2HYG D;  3BCB A;  3H5N A;  1S5L C;  4WXC A;  1RI7 A;  4BBS J;  3X2Q H;  4JQF A;  2WB1 N;  3FK6 A;  3W6J B;  2M7B A;  4P96 A;  3WGH A;  1TL8 A;  1LFB A;  1NK3 P;  1TWF J;  1RKW A;  1H89 C;  1QNT A;  2KJC A;  5J8F A;  2OF7 A;  2V1D A;  3JRA A;  1QZY A;  3GCM A;  4ABZ A;  2D1H A;  4MGR A;  4MNU A;  5AIQ A;  3DWL E;  4N4O B;  2DMP A;  1OCT C;  1IJW C;  2K9M A;  2DCE A;  3BJ6 A;  1KQ0 A;  3BG5 A;  3BTC A;  1SEU A;  2IAI A;  1MJA A;  2E7X A;  1J2X A;  3FIS A;  1TW2 A;  2P7C B;  4S0H B;  5EG0 B;  3QPL A;  2E2I J;  3MCZ A;  4HEA 2;  2EB7 A;  2XPV A;  1Z6T A;  3HOX J;  3VB2 A;  2R93 J;  4V19 K;  1FX7 A;  5J3L A;  5E18 F;  3RPU D;  3K70 D;  3IKT A;  4IRI A;  1IRG A;  2I10 A;  1BR2 A;  2EWN A;  2HQA A;  4RGS A;  1ZHF A;  3PNV A;  2CFX A;  2E7W A;  3LSI A;  4GYI A;  5HLI A;  2ZNY A;  4I01 A;  3OYH A;  5K1Y A;  3HGG A;  3WTY C;  2LYC A;  3K4K A;  5FLX K;  5DCF A;  4I09 A;  1T38 A;  2NVQ J;  2ZSI B;  3MZ8 A;  4C2U A;  5EZH A;  2X6X A;  4NC8 A;  2XB5 A;  4BQA A;  4PK4 A;  1TW3 A;  1ZYR F;  3Q3S A;  2V7F A;  5LD2 C;  2OZU A;  3B6C A;  3GTG J;  3VDX A;  2L01 A;  3L2R A;  1BIB A;  3UKG A;  3WE3 A;  3BQY A;  3CF5 F;  4F52 A;  4IXA A;  4F93 B;  4LGW A;  3DEW A;  1G3Y A;  3FMQ A;  2LR8 A;  3IWZ A;  4CZC A;  2BY1 A;  3S32 A;  4BQQ A;  4LB5 A;  3SFI A;  5KNL A;  3EPZ A;  1OFC X;  2AQE A;  1YTY A;  2HVR A;  2RC4 A;  3JRE A;  1UST A;  1K79 A;  3RDI A;  2Y69 H;  4GYG A;  1IC8 A;  4U0W A;  3MKY B;  3Q5F A;  3WHB A;  1XMK A;  2VJ4 A;  4YIF A;  1ZEL A;  2L4A A;  4LIU A;  3LA7 A;  2AXT C;  1WJ5 A;  3IH3 A;  3DEU A;  5BNG A;  1T95 A;  2Y2Z A;  3L00 A;  4XRM A;  5F1R A;  1IRX A;  2LNB A;  3DCF A;  3OMY A;  4XKW A;  1MGT A;  2FML A;  4LIV A;  2MAB A;  2BXY A;  4PZJ A;  3OS2 A;  3MZY A;  1F43 A;  1X2M A;  5ICG A;  1H88 C;  1MSE C;  4PJ0 C;  1FMV A;  3O6B B;  1R1U A;  3HUG A;  2KZG A;  1EA3 A;  3JR9 A;  1J7K A;  2ECC A;  2EIN H;  2ZNZ A;  2O8K A;  3GO5 A;  3GF2 A;  3WTV C;  1BOB A;  3S3M A;  1Y0N A;  3G1O A;  4RGU A;  1QPI A;  1SAU A;  4IHV A;  1ETO A;  3D5L A;  3BG7 A;  1A36 A;  5CYV A;  3FWE A;  3GLX A;  4P5O A;  1YW9 A;  4A3I J;  3K4J A;  2E60 A;  1P92 A;  2WA0 A;  3B6A A;  1I1S A;  3U2R A;  4DIQ A;  3CJR B;  1B6A A;  1VI0 A;  5L3D A;  2ZFU A;  1Y8R B;  3BZ6 A;  1AKH B;  3BP8 A;  3OYG A;  1Z9C A;  3G71 I;  1R23 A;  2EIM H;  2AS5 F;  1HA8 A;  3UR3 C;  1SVL A;  1MZB A;  3TP0 A;  1S29 A;  1S7O A;  2OA4 A;  2PBI A;  1SFE A;  1P4A A;  2LP0 A;  4ZYA A;  2XRO A;  2MA3 A;  1GLN A;  3RSN A;  3MKZ A;  5EYR A;  3CDH A;  2NVY J;  3C18 A;  3TL4 X;  5HLH A;  5FLM J;  2H8R A;  1ON1 A;  2ZXJ A;  3S14 J;  3DTK A;  2DJI A;  1B1B A;  3BRO A;  1I6X A;  4CHU A;  3V8L A;  3KFW X;  1K7A A;  1ZH5 A;  1MBE A;  2L9S A;  2Y0M A;  3R6S A;  2VKE A;  2IP2 A;  5EG0 A;  1FBS A;  2ZB9 A;  3CDL A;  3MD2 A;  3ZQ7 A;  3CUQ B;  3BR2 A;  2IPQ X;  3HPG A;  3KLN A;  5K7H A;  1VND A;  2FF4 A;  2FX0 A;  4XKV A;  3HM5 A;  4QPQ A;  1QBJ A;  1VZ0 A;  3SXY A;  2EH3 A;  2M2E A;  4XBF A;  1FEX A;  2VT2 A;  4FX4 A;  2W48 A;  1E3H A;  4HDU A;  2EZK A;  4GXO A;  4UUS B;  2CO5 A;  2HYJ A;  2DXI A;  4I98 B;  4HZF A;  1UAA A;  2OTL I;  1K83 J;  2P81 A;  2A68 F;  3BLY A;  3K1N A;  3OL4 A;  2QQ9 A;  4FIS A;  2DFF A;  3AKZ A;  3V8K A;  4CCN A;  4LK1 F;  1Z6R A;  3I9V 2;  3ABU A;  2VE8 A;  4PJJ A;  4XSX F;  2OTJ I;  3IAS 2;  2LSO A;  2E19 A;  4DGW B;  3IP4 B;  1HQC A;  4C3J J;  3WTX C;  3DQV C;  5KCM A;  4BS9 A;  2DK8 A;  5CKT A;  1D5V A;  1FOW A;  3IV5 A;  1IF1 A;  2FMY A;  2F4I A;  4OU0 A;  2BZT A;  3LSJ A;  1FJL A;  4J19 A;  4KN7 X;  2R7U A;  1OCP A;  2VLA A;  1T0F C;  4LFU A;  4II2 A;  4BNC A;  1W36 D;  1RR7 A;  3ISP A;  3FBN B;  1T0F A;  3M8J A;  4RB1 A;  4N4N B;  4E7L A;  2RKH A;  3QAH A;  4ENJ A;  2DAO A;  1WJC A;  4A3F J;  2LY2 A;  2OAZ A;  4EJO A;  1MNM C;  2DOF A;  4V2G A;  2IGM A;  3PFY A;  3JW4 A;  2KFD A;  4HAM A;  2CU7 A;  1YW8 A;  3SEZ A;  3L2U A;  1VQM I;  1IV8 A;  2ECB A;  4HLX A;  1YIO A;  1MMD A;  2HNH A;  1RNL A;  1W7P D;  3RKX A;  1H0M A;  3M7G A;  1EF4 A;  1JHH A;  5EGO A;  2F4O B;  3CMA I;  2JQ7 A;  2AO9 A;  1Z7U A;  3GFL A;  4HW0 A;  1GUU A;  1GXP A;  1YO5 C;  2KIM A;  4Y4R A;  1W0U A;  2PMU A;  4O6J A;  4M9Z A;  2K9Q A;  5CVV A;  5GAE J;  4XKC A;  4NBQ A;  4P9U A;  3BC8 A;  4Z2Y A;  4D5C A;  2H1K A;  1JUP A;  1RKT A;  2CW8 A;  4D9J A;  2Y30 A;  2KIF A;  2PG4 A;  1V55 H;  1HDP A;  5CVR A;  1R5I D;  2XAG A;  2KT0 A;  4CCL A;  1TLH B;  1ZGJ A;  3G6E I;  1ZG3 A;  3HSE A;  1ZRF A;  2R7Z J;  3W2V A;  1M1E B;  1TNS A;  2BE5 F;  2EFN A;  5CQG A;  4L5J A;  1GVJ A;  2XIG A;  4M3F A;  1EV7 A;  3HOV J;  3WU2 C;  3H5A A;  1MIJ A;  3E3V A;  3GEZ A;  3WTS C;  1IN5 A;  4OIO F;  2DYR H;  4IOA F;  3QU6 A;  4L9N A;  2FUG 2;  2DMQ A;  1D0Y A;  2CUZ A;  3AG3 H;  4XRF A;  4HQE A;  2OUM A;  2M7A A;  4EMS A;  1K4T A;  5AON A; 
#chains in the Genus database with same CATH homology
 2EFP A;  1P4W A;  2DK5 A;  1O7L A;  3P9K A;  4PGG A;  2Q8K A;  4Q48 A;  3L7W A;  5CVI A;  1W4M A;  3L09 A;  3CUQ C;  1FZP B;  2XHK A;  3H92 A;  4LMY A;  4HBL A;  3CUQ A;  3KP6 A;  5JHU A;  2ISY A;  3WU1 B;  2VE9 A;  2VBZ A;  3E6C C;  4Y15 A;  1HKS A;  4G94 A;  4FHT A;  5LEJ A;  3G3Z A;  3HTU A;  1HST A;  2L4M A;  4R8H A;  1L3L A;  3MEX A;  4LLL A;  1IW7 F;  3I64 A;  2G7U A;  3F8B A;  1YFH A;  1QGP A;  4KMF A;  1DPR A;  2DLL A;  1ZN2 A;  4NQW A;  3U1D A;  2V6C A;  1O3R A;  4M9X A;  2QUF A;  4Y17 A;  5L3F A;  3I53 A;  5HVQ C;  2IW5 A;  1HXD A;  1DP7 P;  3QP6 A;  4HF0 A;  4EM1 A;  1KU2 A;  4UNO A;  3ZN1 A;  2ESN A;  4EJV A;  2MC3 A;  3ZMU A;  2Z33 A;  3HRT A;  1IN8 A;  2FOK A;  3LFK A;  2FA5 A;  3I0T A;  4R1H A;  1J59 A;  1QPM A;  4XLN F;  2PQ8 A;  2QLZ A;  3GXO A;  5FB2 A;  2NS0 A;  4AVP A;  3ZMT A;  4XLP F;  1OKR A;  4AIK A;  1KQ8 A;  3M1E A;  5L3G A;  4LLG F;  1E17 A;  2P4W A;  3RI4 A;  1XSD A;  1JHF A;  3RKW A;  5HDG A;  3TQN A;  1ULY A;  1F9N A;  1FYM A;  4LB6 B;  1C0W A;  1REP C;  2MH2 A;  3DP7 A;  3K1M A;  2O61 A;  2V1X A;  1CGP A;  4ZYG A;  1IXC A;  3KP2 A;  3ML6 A;  3CO7 C;  2E1C A;  1EH6 A;  3FM3 A;  1WSU A;  2QYO A;  3DPT A;  2IA1 A;  5BOX A;  3DPL C;  5CLS A;  1W7P B;  4MHG A;  1F1Z A;  3FZV A;  1R36 A;  3TGN A;  1FSH A;  2F5D A;  3R4K A;  3WTW C;  2A69 F;  3E5Q A;  4KMU X;  2JPC A;  2HEO A;  1U5T B;  2JRT A;  3QRF F;  2A5Y B;  1FC3 A;  2O03 A;  2H09 A;  1P4X A;  5JVT A;  1ZRC A;  1J75 A;  2ZO4 A;  5DUI A;  1OYY A;  4H0E A;  2PEX A;  2K4B A;  3LAJ A;  4P55 A;  2PI0 A;  2XAH A;  3W6K B;  1FBU A;  1MKM A;  1TQP A;  4M9S A;  3HIF A;  2YR2 A;  1HBX G;  4F7Z A;  1FPQ A;  1KGS A;  4BAY A;  1F5T A;  4S05 A;  6PAX A;  3IKV A;  4UXN A;  4KNY A;  5AIP A;  2W25 A;  2PN6 A;  4IRH A;  2PFB A;  3ERE D;  5JR3 A;  3RYR A;  3FHZ A;  4Y13 A;  5CJ9 A;  4K2E A;  4A2U A;  1KU7 A;  3R0A A;  3HOS A;  2BEO A;  4G7Z F;  3TKY A;  1KYZ A;  3LQR A;  4WXH A;  1SD5 A;  4MEY F;  3T8T A;  3KP5 A;  1ZGA A;  5EEG A;  1ZAO A;  2EA4 A;  1J9I A;  5FO5 A;  2DPD A;  1O7F A;  1Z05 A;  1BIA A;  5F64 A;  2GZW A;  3K9T A;  4HV6 A;  3K69 A;  4OIN F;  2DO7 A;  1LB2 A;  5K5R A;  3E6D A;  1R5H A;  2VT3 A;  2OQG A;  2MLK A;  3V4G A;  3EYY A;  2H27 A;  5BPD A;  4EV0 A;  3J80 Z;  3MZH A;  3KET A;  2PLY A;  2CG4 A;  1OYW A;  1XGO A;  2LDU A;  1DDN A;  1YS6 A;  1TQI A;  4S04 A;  2M30 A;  3JSP A;  4HYE A;  3F8M A;  1W7P A;  4WCG A;  3QP5 A;  5JFR A;  5EEH A;  3F21 A;  3DKW A;  4HQM A;  1ZG1 A;  5FD6 A;  1RZ4 A;  5D8L B;  1U5T C;  1A04 A;  1O3Q A;  4NB5 A;  2EK5 A;  2HWV A;  4HDV A;  3OV8 A;  4A5N A;  3EET A;  1R00 A;  1U5T A;  4BHP A;  4YFX F;  2DQR A;  4YII A;  4KIF A;  1STZ A;  1V4R A;  3C1D A;  4WWC A;  3S2W A;  4RS8 A;  3VOD A;  2FNA A;  3T0Y A;  4CXF A;  3BPV A;  2FXA A;  1TQM A;  4L5I A;  4KDP A;  2L02 A;  2M87 A;  2K27 A;  1G6N A;  4EJW A;  3KEO A;  2JT1 A;  1BC7 C;  1MJB A;  2H6C A;  3EUH A;  2EV6 A;  2VOD A;  2VC1 A;  2IA2 A;  2Z5U A;  1G3S A;  3KE2 A;  2K02 A;  4I0B A;  3EQL F;  3TDZ C;  4ZZL A;  1ZG5 A;  2XVC A;  3B73 A;  5LRR A;  4CYD A;  4OIQ F;  1Z1D A;  2GXB A;  1XGS A;  1YLF A;  2WTE A;  3TOB A;  2VOP A;  4ETS A;  1ON2 A;  2A6E F;  4ESB A;  2F5C A;  3B02 A;  2WC2 A;  4ZZD A;  1T39 A;  1WKM A;  4TV7 A;  3WOD F;  3WTU C;  2OD5 A;  5CVJ A;  5D8K B;  1U2W A;  3F6V A;  1XSV A;  2HTS A;  2FBI A;  2D45 A;  4L0Y B;  4HX7 A;  4MTE A;  2FNP A;  2M45 A;  2DFI A;  2CYY A;  3RPQ A;  3ZPL A;  1I5Z A;  5H6R A;  5LHG A;  3N4M A;  2A3S A;  5D5W B;  2YPR A;  2EFW A;  4Q4Z F;  2DPU A;  3CUO A;  3CO6 C;  4KIC A;  5E1W A;  4EQQ A;  5ICC A;  1FBQ A;  5J6X A;  1YW7 A;  3KP4 A;  2DT5 A;  3ZMS A;  4BHC A;  2XAF A;  5HDN A;  2XRN A;  1JGS A;  2ZJ2 A;  4U7D A;  4WK8 F;  2A6H F;  5A2Q Z;  2K86 A;  2E1N A;  3R0J A;  1ONV A;  3WE2 A;  2VXZ A;  3I4P A;  3I59 B;  1F4K A;  4O3M A;  1Z91 A;  5BS6 A;  1J0R A;  4MQ9 F;  1HKT A;  2QM3 A;  2P8T A;  4B8X A;  3T1B A;  4OIR F;  3GFM A;  4HX8 A;  2GQQ A;  3E5U A;  2P7V B;  3J80 K;  3GWZ A;  5HDK A;  1GHC A;  2KKO A;  3EYI A;  1ODD A;  3V7R A;  5FD5 A;  2GWR A;  2GIV A;  2J5P A;  1LQ1 A;  2KJB A;  3J81 K;  1R1V A;  2VON A;  1DPU A;  3R60 A;  1KYW A;  5FGM A;  5ILV A;  3K0L A;  3QPH A;  3I71 A;  4O5V A;  4OMY A;  4OOI A;  2UZK A;  1U6G A;  3KLO A;  3R61 A;  4MTD A;  3NRV A;  2ZME B;  1TBX A;  4RB2 C;  4AIH A;  1GXQ A;  1OMI A;  2MD5 A;  1LDK B;  2ACJ A;  4UV8 A;  4QLC U;  1J5Y A;  2HTJ A;  1ZAR A;  3LWF A;  3FM5 A;  3FF5 A;  1QQI A;  4IRG A;  3F8F A;  1B59 A;  3KCC A;  1V3F A;  3RIR A;  5IT9 Z;  2FQ3 A;  3V8J A;  5H6Q A;  3T5X A;  3LA3 A;  2FE3 A;  3GZ6 A;  1XSX A;  5D6E A;  1OPC A;  3MFK A;  1FWZ A;  3I59 A;  4I2O A;  3GFJ A;  5E1Z B;  4R79 A;  2COM A;  1IN7 A;  1D8K A;  4LG0 B;  1UFM A;  4P9F A;  3IL2 A;  4IPA A;  4G8X A;  1I27 A;  3EDP A;  1IN4 A;  4GO1 A;  1BI0 A;  4N9I A;  2HGC A;  2NNY A;  2ZKZ A;  3ZP5 A;  5HS7 A;  3REO A;  1XD7 A;  2LF7 A;  2P6S A;  5FFX A;  4UVB A;  2ETH A;  1S8N A;  5LRS A;  4G6Q A;  3K2Z A;  2L3D A;  3QPT A;  2FSW A;  4YFK F;  2F5F A;  4N9H A;  4UHT A;  2G9W A;  3GFI A;  2JPB A;  3HTS B;  2ZBK A;  3HYI A;  1WQ2 A;  3WGG A;  3LAP A;  3HOT A;  3VOE A;  1XGN A;  5E8I A;  1BI1 A;  1BOA A;  3BJA A;  1XGM A;  5L3C A;  1KQ9 A;  5HOO A;  2R7D A;  4G7H F;  1XN7 A;  1YS7 A;  1KU9 A;  4QWQ A;  4BH9 A;  3JTG A;  5DUK A;  2ZME A;  5A2Q K;  4KYW A;  3HRS A;  1CF7 A;  4YG2 F;  3BWG A;  3CTA A;  2DQL A;  2H6B A;  2W85 A;  1IAW A;  3T8R A;  4A6D A;  4ZYH A;  2O8X A;  4OMZ A;  2EJR A;  4M72 A;  1IXS B;  2QWW A;  3PFI A;  2A07 F;  4FX0 A;  1Y0U A;  4WXD A;  2YX4 A;  2VBX A;  4HX4 A;  1BC8 C;  1P6R A;  3M8F A;  3BPX A;  2IJL A;  4A0X A;  2IA0 A;  3SQN A;  2DTR A;  2WV0 A;  2ZCW A;  3BJO A;  2XAQ A;  5DEQ A;  5J8C A;  2FRH A;  2KIU A;  3FXU A;  3ZMV A;  1UHW A;  2UXN A;  3G73 A;  4CO8 A;  4L9T A;  3BDD A;  4G6D A;  4RAZ A;  3LST A;  4WX9 A;  4L0Z B;  2XAJ A;  1LNW A;  2RN7 A;  1FOK A;  2BV6 A;  3CLO A;  5TRD A;  1TNT A;  2BGC A;  2ESH A;  2B0L A;  4LG0 A;  2HZT A;  4CZZ A;  3F72 A;  1P2F A;  1B9M A;  2YSR A;  5BMZ A;  5DV5 A;  3SZP A;  3JSO A;  1RIO H;  2NRA C;  5KVR A;  4I02 A;  1MDM B;  1H9T A;  2MBF A;  3F8C A;  3JAM Z;  5LLQ A;  2HDC A;  4EJT A;  3E5X A;  3TO6 A;  2P5L C;  3J7A O;  3F6O A;  3O3K A;  3M9A A;  4JK1 X;  3U9G A;  5IT9 K;  1YG2 A;  2GA1 A;  1RUO A;  4LLN A;  2V9V A;  2CGP A;  1WI9 A;  2FBH A;  5DD4 A;  3K1P A;  3PQJ A;  2NAZ A;  5FFZ A;  4ASN A;  4M6X A;  2K7L A;  3I58 A;  3JTH A;  5CVU A;  2G7H A;  3HRU A;  3F23 A;  4IHS A;  2MH9 A;  1OR7 A;  2P5K A;  3GW2 A;  5DD8 A;  1U78 A;  3MQ0 A;  3TO9 A;  4L18 B;  3CJN A;  1LJ9 A;  3DV8 A;  1BBY A;  5ICF A;  1QZZ A;  3J81 Z;  3RTR A;  2IT0 A;  1Q1H A;  4M71 A;  3Q9S A;  3F3X A;  4ESF A;  5LHI A;  1EH8 A;  1W5S A;  2HKX A;  2PJP A;  3P9I A;  1BJA A;  2RGV A;  2XV4 S;  3KP7 A;  4RB0 A;  1S6L A;  4KUM A;  3GVA A;  2M1B A;  4KIG A;  2Z3Y A;  4A12 A;  3ECH A;  3PQK A;  5IT3 A;  2H94 A;  5F6F A;  1O57 A;  4Q47 A;  5L3B A;  1HW2 A;  3IRR A;  3Q9V A;  3L2C A;  5E8G A;  2HKO A;  5ILU A;  2AXL A;  4Q5S F;  3ZMZ A;  2YX7 A;  1XB4 A;  1AWC A;  2O3F A;  1MDM A;  2RVC A;  2Y75 A;  4EGZ A;  5BPI A;  3FMS A;  1K6O A;  4LJZ F;  5E17 F;  2NNN A;  3HSR A;  3HHG A;  2V79 A;  2W57 A;  2MLG A;  2DI3 A;  2VBY A;  3IRQ A;  2GXG A;  1FSE A;  2EV0 A;  1KU3 A;  4RB3 C;  3WU0 A;  3HHH A;  3KEQ A;  4ENN A;  2F5E A;  3ULQ B;  3C3W A;  1W5T A;  3WG9 A;  2YU3 A;  2HS5 A;  3TDU C;  2FEZ A;  4PDK A;  2HFH A;  1SFU A;  3SFZ A;  3DFG A;  4KFC A;  1R7J A;  2Q2E A;  2IVM A;  2QBY B;  2LKP A;  2DU9 A;  1IN6 A;  2F2E A;  1R5G A;  2A61 A;  1O3S A;  4ZH4 F;  1LEA A;  3BY6 A;  4MEX F;  1FP2 A;  2CSO A;  3GX4 X;  4EGY A;  3BOQ A;  5LGN A;  5D5X B;  4U7B A;  3D0S A;  2Z99 A;  3KP3 A;  1LVA A;  2OU2 A;  4PGH A;  1YYV A;  1SFX A;  2BYV E;  1R22 A;  4A0Y A;  5D5V B;  3JAM K;  1I1G A;  2BBY A;  1UCR A;  3FXR A;  3COA C;  3LA2 A;  3FX3 A;  1ZRE A;  3ABT A;  2QVO A;  2VBW A;  5DYM A;  1S3J A;  1NHA A;  2VOO A;  4ZYD A;  1D3Y A;  3MWM A;  1RUN A;  2X4H A;  3ZMD A;  1MD0 A;  5D4S A;  3DF8 A;  1SD6 A;  4I7H A;  2STT A;  5LBQ A;  2UXX A;  3IWF A;  4N0B A;  2M5W A;  2W84 A;  1T2K A;  3MAJ A;  3GYH X;  5D6F A;  2ADU A;  1FY7 A;  1PDN C;  2ISZ A;  4D0P A;  5DCM B;  2OZ6 A;  1B9N A;  2NYX A;  2R3S A;  3NQO A;  2EFO A;  3I5U A;  3FXQ A;  2VN2 A;  4M73 A;  5LHH A;  1LDD A;  2RV8 A;  4KT5 C;  1HSJ A;  1SAX A;  1R1T A;  3QOP A;  5DDG A;  4HF1 A;  4G7O F;  3HSF A;  2D2W A;  2WWY A;  2QEN A;  1LEB A;  2QBY A;  5E1X A;  2DW4 A;  2VC0 A;  1X3U A;  3LQQ A;  4UV9 A;  1CF7 B;  2JSC A;  4IHT A;  3V7C A;  4ON0 A;  4BXU A;  1ZRD A;  2R7F A;  4E70 A;  4AD9 A;  5BQT A;  4GCV A;  3ZN0 A;  1D8J A;  2QZ8 A;  4CDG A;  1G3W A;  5ERI A;  4L9J A;  4NHJ A;  4G9Y A;  2GA2 A;  4KIB A;  3O2P E;  3RJP A;  1K78 B;  2HYF A;  2JZY A;  3OOP A;  2O6G E;  5ICE A;  2CQK A;  4PCQ A;  3VEP A;  2IRF G;  1BI3 A;  2J5O A;  4M6Y A;  1XCV A;  1FNN A;  2HOE A;  4CIC A;  4ESJ A;  4A0Z A;  4RGR A;  2KRF A;  3QU3 A;  4DNC A;  5ED4 A;  1O3T A;  5K5Q A;  1IUY A;  3SHF A;  2FBK A;  4JBA A;  2HQN A;  1JE8 A;  3F8N A;  1HW1 A;  1B4A A;  2QQA A;  2TDX A;  1L0O C;  3P9C A;  2XKO A;  1U8R A;  1IZ1 A;  2XUB A;  5LEK A;  1FLI A;  4ENM A;  3IC7 A;  5KK1 A;  4FT8 A;  1ZLK A;  5ILS A;  4A6E A;  5DCM A;  4B09 A;  4AWX B;  3SZT A;  4AIJ A;  3GUD A;  2EA2 A;  1FP1 D;  1WWX A;  5K5O A;  1HKQ A;  4OIP F;  1XCB A;  4HA8 A;  3RKY A;  1LDJ A;  4LD5 A;  2V1U A;  2EV5 A;  1U3E M;  1SMY F;  3WTT C;  4KN4 X;  4DQ2 A;  1FT9 A;  3ELK A;  4ENK A;  4I0A A;  3N97 A;  1E2X A;  3RPU A;  2OBP A;  1UB9 A;  3KZZ A;  2XKP A;  4GGG A;  5L3E A;  4WF2 A;  1XDU A;  4IF4 A;  2UWM A;  1AOY A;  5D4R A;  4EVI A;  3IHU A;  5HLG A;  5H20 A;  3V7S A;  5LGT A;  4IVN A;  1FYL A;  1FYK A;  3E6B A;  4UVC A;  2EFQ A;  1XDS A;  4RAY A;  2CWE A;  3RYP A;  4HF2 A;  1JXS A;  1TTY A;  5FLX Z;  3KZY A;  2P6T A;  3H3Z A;  4IJA A;  2M8E A;  4MQV A;  5JI6 A;  3M8E A;  1BN5 A;  1R58 A;  2HQR A;  1K78 A;  1IRF A;  5HS9 A;  1T98 A;  4LK0 F;  2RNJ A;  1OYI A;  3L9F A;  2OQR A;  2LF8 A;  4UUV A;  3ECO A;  2X0L A;  2CW0 F;  2C6Y A;  3FMR A;  1SD7 A;  4HOB A;  1EH7 A;  1SMT A;  2K4J A;  2W24 A;  1IXR C;  3GZ5 A;  2RQP A;  3NEU A;  1T6S A;  4EJU A;  4YFN F;  4BHB A;  1YQA A;  2HR3 A;  1DUX C;  1KA8 A;  1PP8 F;  4HV5 A;  3AAF A;  4BYY A;  1BI2 A;  1MJ9 A;  2PMH A;  3C7J A;  1SD4 A;  3HRM A;  3VFZ A;  4U0V A;  1QO0 D;  4L9V A;  2STW A;  5HS8 A;  4KA4 A;  4A5M A;  2L54 A;  2FU4 A;  3ROU A;  1G4D A;  1G3T A;  3E6M A;  2XAS A;  4M74 A;  2ELH A;  2DBB A;  3I54 A;  1S7A A;  2Y48 A;  1VTN C;  5D5U B;  5LGU A;  3WGI A;  3TO7 A;  1PUE E;  3TOA A;  1ZLJ A;  3H3U A;  2P5V A;  4RGX A;  1HW5 A;  4ZYE A;  4HLY A;  2ZFW A;  5E20 A;  2GAU A;  2D1V A;  1XMA A;  4CGZ A;  4EM2 A;  4EM0 B;  1H9G A;  2Q0O A;  1BM9 A;  4U0Y A;  3E97 A;  2QQB A;  4U88 A;  2JTV A;  1WRJ A;  5TJJ A;  2RDP A;  1UHM A;  3F22 A;  4UVA A;  2O0Y A;  1USS A;  1PP7 U;  3P7N A;  2XGX A;  4XSZ F;  2Z9O A;  3WTZ A;  3DXJ F;  2HYG D;  4WXC A;  1RI7 A;  4JQF A;  3W6J B;  4P96 A;  3WGH A;  1QNT A;  2KJC A;  5J8F A;  2V1D A;  1QZY A;  2D1H A;  4MGR A;  4MNU A;  5AIQ A;  3BJ6 A;  1KQ0 A;  1MJA A;  2E7X A;  1J2X A;  1TW2 A;  2P7C B;  3MCZ A;  2EB7 A;  1Z6T A;  3VB2 A;  1FX7 A;  5E18 F;  3IKT A;  4IRI A;  1IRG A;  2EWN A;  4RGS A;  1ZHF A;  2CFX A;  2E7W A;  4GYI A;  5HLI A;  2ZNY A;  4I01 A;  5K1Y A;  3WTY C;  5FLX K;  5DCF A;  4I09 A;  1T38 A;  4BQA A;  1TW3 A;  1ZYR F;  2OZU A;  2L01 A;  1BIB A;  3WE3 A;  4IXA A;  4LGW A;  1G3Y A;  3FMQ A;  3IWZ A;  4LB5 A;  1YTY A;  2RC4 A;  1UST A;  1K79 A;  3RDI A;  4GYG A;  4U0W A;  3Q5F A;  1XMK A;  4YIF A;  2L4A A;  3LA7 A;  3DEU A;  3L00 A;  5F1R A;  2LNB A;  1MGT A;  2FML A;  4PZJ A;  3MZY A;  5ICG A;  3O6B B;  1R1U A;  3HUG A;  1J7K A;  2ZNZ A;  3GO5 A;  3GF2 A;  3WTV C;  4RGU A;  3D5L A;  5CYV A;  3FWE A;  3GLX A;  4P5O A;  1YW9 A;  1P92 A;  1I1S A;  3U2R A;  1B6A A;  5L3D A;  3BZ6 A;  3BP8 A;  1Z9C A;  1R23 A;  2AS5 F;  1MZB A;  1S29 A;  1S7O A;  2OA4 A;  2PBI A;  1SFE A;  1P4A A;  2XRO A;  2MA3 A;  3C18 A;  3CDH A;  5HLH A;  1ON1 A;  2ZXJ A;  1B1B A;  3BRO A;  1I6X A;  4CHU A;  3V8L A;  3KFW X;  1K7A A;  1ZH5 A;  2Y0M A;  3R6S A;  2IP2 A;  1FBS A;  3ZQ7 A;  3CUQ B;  3KLN A;  2IPQ X;  2FF4 A;  1QBJ A;  3SXY A;  4XBF A;  2VT2 A;  4FX4 A;  4HDU A;  4GXO A;  2CO5 A;  4I98 B;  4HZF A;  2A68 F;  3K1N A;  2QQ9 A;  3V8K A;  4LK1 F;  1Z6R A;  3ABU A;  2VE8 A;  4XSX F;  2LSO A;  1HQC A;  3WTX C;  3DQV C;  2DK8 A;  1D5V A;  1IF1 A;  2FMY A;  4OU0 A;  4KN7 X;  4LFU A;  4BNC A;  3ISP A;  1T0F A;  4RB1 A;  2RKH A;  3QAH A;  4ENJ A;  2DAO A;  2OAZ A;  4EJO A;  3JW4 A;  4HAM A;  1YW8 A;  4HLX A;  1YIO A;  1H0M A;  1RNL A;  1W7P D;  3RKX A;  3M7G A;  1JHH A;  1Z7U A;  3GFL A;  4HW0 A;  1GXP A;  1YO5 C;  2KIM A;  2PMU A;  4O6J A;  4M9Z A;  5CVV A;  4P9U A;  4Z2Y A;  2KIF A;  2PG4 A;  5CVR A;  2XAG A;  1TLH B;  1ZGJ A;  1ZG3 A;  3HSE A;  1ZRF A;  2BE5 F;  1TNS A;  2EFN A;  4L5J A;  1GVJ A;  2XIG A;  1EV7 A;  3E3V A;  3GEZ A;  3WTS C;  1IN5 A;  4OIO F;  3QU6 A;  4L9N A;  4XRF A;  4HQE A;  4EMS A;  5AON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...