2VONA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auaauuu
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
187
structure length
187
Chain Sequence
DNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords LUPUS LA PROTEIN
total genus 56
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vonA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vonA02
1BBYA 1U5TA 2VC1A 1G3WA 2DIVA 1ZHFA 1MJBA 5FLXZ 2DK2A 2L08A 5J8CA 3SHFA 2VBWA 5MLCV 2EV5A 2IW5A 2A61A 4KMFA 3MZYA 3M1EA 2E7XA 2KM8C 1N8RT 4ESFA 2Z33A 3WODF 2P7CB 1IN8A 2O3FA 4LB6B 4GCVA 2CQ3A 2MZJA 4LK1F 1FSHA 1JHFA 1V3FA 3MURP 2DI3A 1QM9A 2XAJA 3CMES 1M5KC 3IKVA 5ICEA 2N82B 1EH8A 3B4MA 3M8FA 2IPQX 2M52A 1XD7A 4HV5A 5LJ5Y 1R58A 4YB1P 3DQVC 4P6QA 2EFNA 2NNNA 1OO0B 3WTXC 5D8KB 4YOEA 2DNRA 5BMZA 2CPYA 3LA7A 3V8LA 3QOPA 1ZH5A 2I38A 5L3FA 4TV7A 2JRTA 1R00A 4EM0B 5F1RA 3WTUC 3M7GA 2EJRA 4IRGA 4BYYA 2DNLA 2DNMA 4JBAA 4U67Q 3IL2A 2RNJA 3NRVA 4LFUA 3GZ6A 1FHTA 2KG0A 5D77A 2AYBA 3MD1A 2BV6A 3KP2A 5DD8A 2HKOA 2M2BA 1GXPA 3RDIA 4Y00A 3E5XA 2HGMA 3WTYC 1KQSR 1I6XA 3V7SA 2C6YA 1G3YA 3R0JA 2DISA 1FJ7A 3VB2A 1O3TA 4TU9A 1VQLS 3PQJA 4OMYA 4Q47A 1FYMA 2H09A 3V4MA 1EH7A 5HLHA 2YKAA 3CCQS 2JVOA 2M9KA 5FD5A 2XGXA 4YIIA 2ADBA 1VQ8S 1T0FA 4NHJA 2KHCA 2RGVA 2BGCA 2V6CA 1K6OA 3L7WA 3PIPQ 2M8EA 4AIKA 2TDXA 2RU3A 1FT9A 2D9PA 1ULYA 1SFXA 4BH9A 4P9UA 4MGRA 3ZMSA 1CF7A 2YX4A 5E8GA 5LJ3Y 2ZCWA 4RB2C 2X1BA 3FMQA 2MGZB 2CQ4A 4ZYDA 3I54A 3PIOQ 4QU7A 1S79A 3KLNA 5FJ4A 1IRGA 2EVZA 5D6FA 1A04A 4ESJA 1HXDA 3L09A 2A3SA 2HGNA 3T8RA 1J2XA 3OOPA 1IRFA 5BPDA 4G8XA 4LB5A 2A6EF 1XGOA 3ELKA 2WC2A 1VQ4S 1QVFR 4OMZA 3SDEB 3BJOA 3ULQB 3VF0B 4I98B 3KLOA 4F7ZA 3R6SA 1SJ4P 2P4WA 3GZ5A 4IVNA 1GHCA 1WI9A 2LF8A 4U0YA 5ICFA 4I0BA 1MJAA 1XMAA 1SJRA 1OKRA 4RGSA 5F64A 1C0WA 2CG4A 3CCMS 2EWNA 2FC9A 5DV5A 2ZJPQ 3SQNA 2MKKA 1FPQA 3QU6A 5DCMB 4L0YB 1JXSA 1UAWA 1S3JA 1NJIT 3TOAA 1OWXA 1WHXA 4F02A 1WG1A 1MKMA 1O57A 3DPLC 3VAGA 1BI1A 2OTLS 4WCGA 5LSOA 1L3KA 3BY6A 1X4EA 2DTRA 4OU0A 1TQMA 4ZZLA 3G73A 1NU4A 3DP7A 2FNAA 2HTJA 1P2FA 1WEZA 1RZ4A 1ZZNA 4C4WA 3WTVC 3MZHA 4BQAA 1R22A 2VXZA 2ZFWA 3O3KA 2K4BA 3LFKA 3GFIA 5F6FA 4R8HA 1WQ2A 2ZNYA 3RTRA 3Q5FA 5GAGU 5LGTA 1IUYA 1ZRDA 1U1MA 3N4MA 2V79A 1O0PA 3F8NA 2PQ8A 3ZMZA 5DM6Q 3T5XA 1N54B 3Q9SA 3KZZA 2G7HA 3RPUA 2X1GA 2X1AA 4RB1A 2DT5A 1YI2S 3WGGA 1M1KT 3N97A 2JRSA 3FMSA 5FGMA 1VQ7S 5A2QZ 4CXFA 3TKYA 1P6RA 2CPDA 3TO6A 2HWVA 3H3UA 4B09A 1U5TC 1BI0A 4EJUA 2DU9A 2CQ1A 2EFOA 2GHPA 4Q5SF 2OAZA 2HQNA 3Q2TC 2CQIA 3KZYA 4EGYA 2J0QD 1HL6A 2CPJA 4DQ2A 2XS5A 1HSTA 5DDGA 2BYVE 2LNBA 3JSOA 4Z2YA 3UCZP 3EQLF 3CCSS 1WTBA 1ZLKA 1IXCA 2ZBKA 3I5UA 1QZZA 2ETHA 1SD4A 2YPRA 2CQKA 2EA2A 3EUHA 3THTA 4XBFA 4A12A 2DGWA 3F3XA 3I64A 2D45A 4PRFA 1T98A 3CCES 4YFKF 2ADCA 3KFWX 2OTJS 3LQQA 1OYYA 2CO5A 3ISPA 3K9TA 2F5DA 1WKMA 2Q8KA 5H1SV 4EGZA 4FXWA 1XCVA 2FA5A 4FT8A 3NS6A 2FBIA 4ETSA 2A3JA 2VBXA 4G7ZF 3CJNA 2VE9A 3BPVA 4WFBQ 2V9VA 5EN1A 4S05A 2FSWA 3CCLS 5FO5A 1Q7YT 5BPIA 1TNSA 3WTWC 2AS5F 3R60A 5AONA 1VQKS 1K7AA 1X3UA 3C1DA 1UW4A 2UWMA 1F9NA 1VQNS 3CC7S 5HLIA 2IJLA 3F23A 1H2TZ 2QBYA 1DRZA 1DDNA 2XAFA 3BPXA 4HBLA 1SFEA 2RS2A 2ZJQQ 4OIRF 2E5IA 2DNQA 1KYWA 1UFWA 1B7FA 3THPA 1N52B 1S7AA 3ZMVA 1RNLA 4IF4A 2XNRA 1HKTA 3GFMA 4M6YA 2D1VA 5BS6A 1MZBA 1HW2A 3MWMA 2RNEA 3DF8A 2JPCA 5E1XA 3HOSA 3QP6A 4MQVA 4RB0A 2VT2A 4WX9A 2K3KA 2MQQA 2MKJA 1YW8A 2DHSA 1CVJA 3F8MA 2FEZA 3FWEA 4IJAA 4RU2A 3LA2A 3E6DA 2Y75A 4KN7X 3RIRA 3M8EA 2GQQA 2RQCA 4RB3C 1X5SA 1D9AA 2OQGA 1Z05A 4LIRA 4FHTA 4Y15A 4KUMA 4GGGA 2E1NA 3JSPA 3HRMA 3E6MA 4D0PA 3CPWR 2YX7A 2J76E 1YW9A 5K5OA 2DW4A 2CQHA 3CULA 1U6BA 4GYGA 2HR3A 3MXHP 3WTZA 3FZVA 3ERED 4TU8A 1IQTA 2DGOA 2HZCA 4WF9Q 2DNHA 4W92B 2K8GA 3MEXA 2MB0B 1HSJA 2NYXA 1B4AA 5HS8A 3TGNA 4LLGF 1XSXA 4HF1A 3JW4A 3IRRA 3DV8A 4IXAA 5BOXA 3FF5A 2Y48A 1QZYA 3FM5A 1T38A 1KD1T 4EGLA 1QNTA 2DQRA 4ERDA 2RVCA 1BC7C 2MLGA 1XSVA 2MH2A 3TO7A 4GXOA 3ECHA 2LYVA 2G0CA 2HQRA 2MBFA 1KGSA 4LLLA 2VOPA 3WU0A 4G6QA 2DO4A 4WXDA 4ZH4F 1ZRCA 1WEYA 2CPHA 3OW2R 2RVJA 1YQAA 1H0MA 2XAQA 2MZTA 5DDQC 1H6KX 4ZZDA 1UCRA 1PP8F 1F9FA 2QQBA 1VBYA 1I1SA 3T0YA 2J5PA 2ISZA 4KYWA 4RAYA 2MKCA 1FXLA 3EETA 3H2VE 5H6QA 1DPRA 4HLYA 5DCMA 2CQ2A 4EJVA 3FEYB 2K86A 1O3SA 1LDJA 1K78B 2FHOB 2JTVA 4MTEA 4LMZA 5EEGA 3ULHA 2MQLA 3GW2A 2GO9A 1KQ8A 1YTYA 3E6CC 4IPAA 2NRAC 1BI2A 2GWRA 1BIAA 3LWFA 4QPTA 2PJPA 2YTCA 2V1UA 4YG2F 3OV8A 3AAFA 1WI8A 2FRHA 2FU4A 2K02A 5D8LB 5D4RA 2EK5A 1O3RA 1T2KA 2RRAA 2LCWA 1VQ5S 1XB4A 5LEJA 1DBDA 2VT3A 3RKWA 2YR2A 4CDGA 3QPHA 2ZNZA 4JQFA 2AD9A 3S6EA 2OBPA 2KRFA 2OA4A 2CPIA 3PQKA 3G96A 3F72A 4WCEQ 4IUFA 1Z1DA 2QEXS 5DDPC 3VFZA 3HSRA 5CVIA 1KU2A 5E1WA 2DK8A 2A07F 2XNQA 2QENA 4G9YA 3TO8A 1JJ2R 1W5TA 1YJ9S 3LAJA 1O3QA 1RK8A 2Q2EA 3EGZA 3DPTA 1XN7A 3E3VA 3F22A 5KVRA 3TO9A 3L2CA 4LJZF 2L41A 4G7HF 4ZYGA 4WK8F 2FBHA 3HIFA 2KIUA 3F6VA 3U1MA 4ASNA 2GXGA 1UHWA 3V7CA 2E44A 2ACJA 4XRFA 1RKJA 1IN7A 1B59A 1IN6A 1FX7A 1X5TA 2DNZA 2FOKA 2A5YB 2DHGA 1ZN2A 1ODDA 2M87A 3G3ZA 3KE2A 2B0LA 3IRQA 2EFQA 3CCVS 3B73A 1R5GA 1Z91A 5LXYA 4G7OF 3I4PA 1B1BA 4Y0FA 3UCGA 5HDKA 2XUBA 1ZGJA 3C3WA 4HZFA 3W6JB 3TP2A 2EK6A 2W24A 4B8XA 3S7RA 2MZRA 3NS5A 5LLQA 2MQPA 1UFMA 2E7WA 1FO1A 1CF7B 4CZZA 5K1YA 2QQAA 3WTTC 2YH1A 2RKHA 1FZPB 1BC8C 1JE8A 3CXCR 4IO9Q 2ESNA 2K4JA 2HTSA 4WFAQ 4L9NA 4M73A 1LVAA 2J5OA 4M9XA 3TDZC 3RJPA 1R8PA 2XAHA 1VBZA 2NNYA 2QQ9A 2E5GA 2OD5A 1IAWA 4L0ZB 1ZZFA 2X0LA 5JHUA 2MPUA 4H0EA 3H92A 3UD4P 2H94A 2HFHA 1WHVA 3I55S 3MCZA 1DZ5A 3UE2A 2DGUA 5CYVA 5FB2A 4KT5C 1P4AA 1L0OC 1R1TA 3QU3A 2COMA 2ZXJA 1QQIA 3GO5A 1X4BA 4MQ9F 4N9HA 2PMHA 2PLYA 2CPFA 2CQPA 5GAEU 4BHCA 2DPUA 1S72S 1Z7UA 5LGUA 3GYHX 4ENMA 3CF5Q 1USTA 2ESHA 2LF7A 2CYYA 3J7ZT 2AXLA 2HKXA 2F3JA 3R1HA 2NLWA 1HW1A 5CXTA 2DITA 2Z5UA 5GAHU 1D8JA 1KYZA 4P5OA 2M8HA 1FC3A 3CCJS 2QFJA 3HTUA 5FFXA 1LJ9A 1OYWA 2FBKA 3FXQA 5FLXK 5TRDA 1J7KA 3BWGA 5EEHA 2MKHA 4IOAQ 4IRIA 1YS6A 2I2YA 4CO8A 3SMZA 2UXNA 3F8FA 3NEUA 4HQEA 4L9TA 2IT0A 1RIOH 1WEXA 2XVCA 1DP7P 5GMKa 2DFIA 1MDMB 3K69A 4A2UA 1U2FA 3F6OA 3QPTA 4O5VA 5HOOA 1P1TA 4BHPA 4N0BA 3ZPLA 2BBYA 2UZKA 3UWTA 4S04A 5FFZA 3WE3A 4EM1A 2Z99A 1OYIA 2DNYA 1AOYA 2RS8A 1U1NA 3NQOA 4XSZF 3R0AA 1J59A 5DCFA 2WBRA 4LD5A 4LJMA 5DDOC 2STWA 2YSRA 2BZ2A 4OZ1A 2HGLA 1O7FA 4U7BA 2Z9OA 5D78A 1R7JA 2MQNA 4U88A 2XAGA 1MDMA 2MZ1A 2E5JA 2NS0A 4M9ZA 5LRSA 3QAHA 5E17F 2L9WA 4CH0S 4EVIA 2N3OA 2J0SD 1U8RA 4DNCA 1VQMS 2XIGA 2F9DA 2MY8A 5ILSA 1TTYA 3HHNB 1U1PA 2MH9A 1K9MT 2MQOA 4YIFA 3WTSC 4U0VA 2RUGA 4GO1A 1ONVA 4OIQF 4ENKA 4UVAA 2F2EA 1KU9A 1F4KA 3U1LA 2BOPA 2UXXA 2DBBA 3SXLA 1UB9A 5A2QK 2FY1A 1U1LA 2MA3A 5JI6A 3BOQA 4N9IA 3GFLA 2M88A 1W7PB 2U2FA 3CUOA 4CH1A 3ZMUA 4A6EA 1IN4A 5ILVA 3LQVA 2P5VA 3HHGA 4PKDB 2BE5F 3ZZYA 1U1RA 3D0SA 5DUIA 4LGWA 1Q81T 1P92A 3CTAA 1Q82T 2CGPA 2CFXA 1X4FA 1U6GA 3BO2A 3IHUA 3BJAA 2EK1A 5HVQC 4RGRA 2DQLA 1R36A 5J8FA 1YO5C 4M72A 1B9NA 1IN5A 3G6ES 2M70A 3P3DA 3WGHA 4Q4ZF 2AYMA 2DNGA 2F9JA 2XB2D 3BO4A 5LRRA 3L3CA 1N88A 2M8DB 1DUXC 4WF2A 4OOIA 5JVHQ 5HS9A 1WG5A 2DHAA 1FYLA 3TDUC 5K5RA 3K2ZA 3I58A 4C0OC 3K0LA 4BHBA 1R1VA 1QBJA 2LECA 1LEAA 2Y0MA 2AYEA 3MI7X 2DPDA 2MHNA 3NNHA 4ZYEA 2EV6A 1K73T 3BO3A 1KA8A 5E20A 2YU3A 4L9JA 1SJQA 3HSEA 2L54A 1WWHA 3G71S 2ISYA 2RQPA 4EM2A 3WE2A 1KOHA 4HDVA 1E17A 2DGSA 4OINF 5L3EA 2F5FA 2H27A 2L3DA 4L5JA 4TLQA 4ON0A 1HD1A 2KJBA 4HLXA 3V4GA 1YJNS 3HOTA 1R1UA 3W6KB 1FYKA 2DGXA 2DAOA 2XHKA 3DFGA 5ICCA 3HI9A 3MAJA 1R23A 2GA2A 2WTEA 2XKOA 4AWXB 1X4CA 4KDPA 5LHHA 5LEKA 3V8KA 3TQNA 2G4BA 4A5MA 3NMRA 5E1ZB 4UVCA 4A0XA 4UVBA 4YFXF 3VOEA 1U1QA 1G2EA 3Q2SC 4BAYA 1P4XA 1XSDA 2M7SA 2DGQA 2KRBA 2ZMEA 1U1KA 1HBXG 3J80Z 4U7DA 1ZYRF 3E6BA 1YYVA 1LDKB 3V7RA 1QVGR 4AIJA 1VBXA 3FM3A 4U0WA 5CVUA 2CPEA 1ZAOA 3MDFA 1WF0A 1X4HA 4MEYF 4LLNA 4WXCA 3JAMK 4AIHA 3P49B 5E8IA 1FBQA 5HLGA 1O7LA 3KP5A 4HDUA 4L5IA 2AYGA 2QLZA 2DIUA 4CYDA 3K1PA 1VTNC 4KN4X 4M74A 3LAPA 1YW7A 1YFHA 2CW0F 1T39A 3JTHA 2Z3YA 3LQRA 3GFJA 3REOA 1BJAA 2L02A 4V19X 5DYMA 4OZ0A 3K0JA 5DM7Q 2HS5A 3TYTA 1SAXA 3L00A 2H6BA 1YITS 1HKQA 3VAMA 2XASA 2HEOA 1REPC 2HOEA 5ILUA 4MTDA 5JVGQ 1STZA 5D5WB 1OPIA 1LNWA 1AWCA 5AIPA 3ZN0A 3KEOA 1Q1HA 2V94A 2HZTA 2XROA 3HRUA 5HO4A 3J81K 1M5PC 1TW2A 2LXUA 3KCCA 3D2WA 2GZWA 3FEXB 3QRFF 3RW7A 1K78A 1HQCA 2E1CA 1S8NA 3GUDA 2FPHX 1F1ZA 1VQOS 3NNAA 1XDUA 2RT3A 2XS7A 5ICGA 1X4DA 5D5VB 1IF1A 5ERIA 2RRBA 4WIIA 3K1NA 2L4MA 3TOBA 5HL7Q 3WU1B 2CPZA 3CO6C 3L9FA 2LDUA 2M30A 2QBYB 1X5PA 1BN5A 1A7GE 3VEPA 4HF0A 2RV8A 4RGXA 5ITHA 2KH9A 1VQ6S 1YJWS 2DO0A 2O8XA 2LA4A 1F5TA 1PDNC 3MD3A 3ROUA 1DHMA 4M71A 1I5ZA 1E2XA 4UHTA 2LEBA 4W90B 1USSA 4MHGA 1B9MA 1M5OC 1J5YA 2JX2A 1MJ9A 1W2BR 2O0YA 3RKYA 1XCBA 3T1BA 4NQWA 5CLSA 1WHWA 2PBIA 2MJNA 2YH0A 3HYIA 4PGHA 2CQCA 1XMKA 2PFBA 4RAZA 1YG2A 4KNYA 5LHGA 2MMYA 2DHXA 1SD7A 2VONA 2KYXA 1RUNA 1SXLA 1BI3A 5IM0B 2EFWA 2KI2A 3PFIA 1BOAA 5D5XB 3CC2S 2KT5A 1D8KA 2O03A 4BNCA 4A6DA 1HW5A 3P9IA 1FOKA 4F26A 1ON2A 3FXRA 4IHTA 3FXUA 3ZP5A 1QPMA 3K1MA 4HX7A 1BY9A 3BP8A 1TBXA 3CUQB 4TU7A 4K2EA 1J9IA 2VC0A 4ENNA 4F25A 2E5HA 2FXAA 3KEQA 2VODA 1U3EM 2LXIA 3P5TL 1JMTA 2GAUA 4KIBA 2CJKA 1Z6TA 5D4SA 1FSEA 4HW0A 1U6FA 3KP4A 4EJWA 1WELA 1H9GA 3SXYA 5JVTA 3IC7A 2QM3A 5L3CA 1KC8T 4PZJA 3JAMZ 3QP5A 1GXQA 2GXBA 5TJJA 1Z9CA 5D5UB 1TQPA 4PCQA 1FWZA 5D6EA 3ZZZA 1XGNA 2JZYA 5BQTA 2VE8A 5FD6A 4LG0B 4OIPF 5LBQA 4NB5A 1H2UX 2NAZA 2MQMA 2M5WA 1XGMA 1W4MA 4LMYA 4HF2A 1URNA 3CDHA 1T6SA 2P7VB 4A5NA 2ELHA 4ED5A 4E70A 4LK0F 2DLLA 3ABTA 2U1AA 3H3ZA 1NO8A 1WRJA 2RQ4A 1EH6A 1VQ9S 4WKRA 2VN2A 5E18F 1XGSA 1R5HA 2PMUA 2FNPA 1PGZA 3G8TA 3EYYA 5DEQA 2MZSA 1ZG1A 5L3BA 5DETA 4UV9A 4KICA 1AUDA 2PI0A 1G4DA 2MY7A 4ZKAA 1TQIA 2DGVA 3KETA 4I09A 1S6LA 2FC8A 4QU6A 3BEGB 5CA5A 2QYOA 2MC3A 1NHAA 4WWCA 4Z2XA 4FX4A 3FX3A 1IW7F 3R1LA 2MLKA 3CLOA 4HAMA 1QO0D 4M9SA 1KU3A 2FMYA 2HYGD 1SD5A 2J8AA 1XDSA 4CIOA 3HRSA 4XLPF 2NZ4A 2PE8A 3SZPA 3P7NA 4ZYHA 3D5LA 1WI6A 3DXJF 4CQ1A 3V8JA 3LPYA 3IKTA 2L4AA 1H2VZ 2P5KA 1R8HA 2M4MA 2O3DA 2GIVA 3EX7B 3MUVP 3CCRS 1SJ3P 3COAC 2P6SA 3ZQ7A 2IVMA 1K8AT 1KU7A 5LXRA 3CO7C 1G3SA 3SDEA 3S01A 4IOCQ 5K5QA 3P9KA 3CD6S 4J5OA 1IXRC 2CWEA 4HV6A 1IZ1A 3B4DA 2VOOA 4C7QA 3DXBA 2KIMA 2IP2A 1KQ0A 4GYIA 3VAFA 3UCUP 2FMLA 3RI4A 3S8SA 3ZMDA 2HYIB 1ZRFA 2MGZA 2IA2A 2PEXA 3F21A 2HVZA 4KIGA 2M1BA 1W7PA 2QVOA 1UHMA 1YIJS 2B0GA 3MFKA 2MJUA 2DNNA 1G6NA 4RS8A 4IRHA 5DDRC 1MD0A 5H20A 3RPQA 3VODA 2N7CA 2OU2A 3U9GA 2CQDA 2XS2A 1PUEE 4HOBA 1PP7U 2PEHA 3CCUS 3BS9A 1WSUA 3CMAS 1JJHA 3G8SA 2KN4A 2FE3A 2OSQA 3I59B 2P8TA 5L3GA 1XN9A 3MOJB 3I56S 3J7YU 5HDGA 2KG1A 3E5QA 3R27A 1YS7A 4A8XA 3EDPA 2MSTA 3I71A 5IFMA 1D3YA 3M9AA 2LKPA 2STTA 2JSCA 3CUQA 2G9WA 3O6BB 1VC0A 5CVVA 2DO7A 3EGNA 2RC4A 1M90T 1X0FA 2WV0A 4CICA 3CTRA 1SMTA 2G1DA 2DB1A 1ZLJA 2X1FA 4I0AA 3NNCA 2JPBA 2V1XA 2R7DA 4QWQA 2Q79A 1LEBA 2QA4S 2JWNA 1SJFA 3ZMTA 5JR3A 1X4AA 2R7FA 4EJTA 2MKIA 3KP7A 3HSFA 4BXUA 4R79A 2A6HF 1OMIA 3MQ0A 3IRWP 1A9NB 3F8BA 4EMSA 1FLIA 4UXNA 1LB2A 2ADUA 4Q48A 3P6YC 2IA0A 2OIHA 4FX0A 3U1DA 3KP3A 1U1OA 2OQRA 4L9VA 3MUTP 2X4HA 5JFRA 3HUGA 3R4KA 2O61A 3IWZA 2KXFA 3WGIA 3CUQC 3MUMP 5IM0A 2BEOA 5BJRA 2ZMEB 2Q0OA 3J81Z 5IT3A 2W57A 2W25A 3UD3P 4UNOA 1FP2A 1FJEB 1JJ4A 5LSLA 1ON1A 4I2OA 2LMIA 2DK5A 2HYFA 1ZG3A 3F8CA 1BM9A 3VALA 2EB7A 1P27B 2KM8B 4P9FA 3BJ6A 2DNKA 2SXLA 3VAIA 4XLNF 1EV7A 4PGGA 1VQPS 2W84A 4HX8A 3T8TA 4UY8T 3FMRA 3RW6A 4EV0A 3BZ6A 1BIBA 1WG4A 1X4GA 3VAKA 2N3LA 1VC6A 2FF4A 2KFYA 1KQ9A 1RUOA 1KOOA 1G3TA 1S7OA 1FY7A 2F5EA 4JK1X 4ENJA 6PAXA 2K7LA 3J80K 2CQBA 3US5A 4QQBA 3BROA 5LGNA 2HDCA 2ZO4A 2DH9A 2JVRA 2R3SA 1SFUA 1OR7A 3I0TA 2D9OA 3SZTA 2D2WA 2MKSA 1S29A 5IT9Z 3VAHA 4WXHA 4Y13A 1W5SA 3C18A 5ED4A 5L3DA 2YWKA 1YIOA 1J0RA 3VAJA 1Y0UA 3IWNC 5CVRA 3EYIA 1HD0A 1LDDA 3HTSB 5J6XA 1HA1A 2QZ8A 2KVIA 3JB9k 2L01A 2FQ3A 1I1GA 1WHYA 3DKWA 3U2RA 1V4RA 4AVPA 2M0GB 1ZG5A 1ZREA 1VC5A 1IXSB 3O2PE 3GVAA 2A69F 2XKPA 1JHHA 3P9CA 4PDKA 2QUFA 2M45A 4L18B 4P55A 2GA1A 2DNOA 2IA1A 2KXHA 2IRFG 2OJ3A 4WFNQ 1J75A 2HGCA 3BDDA 3Q9VA 1M5VC 3I53A 4HX4A 1K79A 1DPUA 1MGTA 4I02A 1D8ZA 1FT8A 4HYEA 3CUNA 1QGPA 1OPCA 3KP6A 2K27A 3ZN1A 2LEAA 2RN7A 4I7HA 4KMUX 2KJCA 1I27A 4A0ZA 1YLFA 1WF2A 5H6RA 1TLHB 2LQ5A 1CGPA 3DEUA 2OSRA 4UV8A 5HDNA 3FHZA 2DNPA 2MD5A 2CQ0A 2V1DA 5CJ9A 1B6AA 2CSOA 5CYJA 2ZKZA 1SD6A 4A0YA 4M5DB 3RYPA 4LG0A 2F5CA 3JTGA 4G6DA 3WG9A 2XSFA 4UQTA 1Q86T 4YUDA 3B02A 5HS7A 4QLCU 2P5LC 4G94A 3ABUA 1GVJA 1FNNA 1ZGAA 4PR6A 2LSOA 2MZQA 3HHHA 2WWYA 1TNTA 3LA3A 1W7PD 2JT1A 3GEZA 4AD9A 4XSXF 5IT9K 4FXVA 3E5UA 2DH8A 3CC4S 4MEXF 1SMYF 4Y17A 3J7AO 2DH7A 3HRTA 4ESBA 4RGUA 4R1HA 4BS2A 3SFZA 1RI7A 1TW3A 1U5TB 3ECOA 4UUVA 2QWWA 3IWFA 1JGSA 2XRNA 2EA4A 3GWZA 4CHUA 1D5VA 2VBZA 2ZJRQ 2LA6A 1U2WA 1FJCA 2EV0A 4KA4A 3C7JA 5DUKA 2KXNB 5LHIA 3E97A 3GF2A 4M6XA 5GVQA 4HQMA 2MSSA 1HKSA 1WF1A 2W85A 3G4SS 3G9CA 1FNXH 2DGTA 2D1HA 5IQQA 2VBYA 3DLLQ 2CQGA 1FP1D 2P6TA 1U78A 1P4WA 2KRRA 2LKZA 3H2UB 2A68F 4KIFA 2PN6A 1H9TA 4EQQA 1Z6RA 2RDPA 1YHQS 3GX4X 4YFNF 4O3MA 3LSTA 1X5OA 3I59A 2ERRA 2MXYA 1WWXA 1OIAA 3RKXA 5AIQA 2H6CA 2KIFA 1LQ1A 3RYRA 4KFCA 1YWXA 1ZARA 3GLXA 3ML6A 1L3LA 1PO6A 2D3OR 5KK1A 2ZJ2A 2G7UA 1FBUA 2MYFA 4OIOF 4EJOA 3N9UC 4CGZA 1UP1A 2OZUA 5CVJA 2KU7A 3S2WA 2KKOA 4P96A 2XV4S 2EFPA 4MNUA 4O6JA 2O6GE 3GXOA 4I01A 5GADU 2OZ6A 4HA8A 5DD4A 2PG4A 4IHSA 2CPXA 1FBSA 2UP1A 3R61A
chains in the Genus database with same CATH superfamily
1BBYA 4KH1B 1H38A 2L08A 3SHFA 5MLCV 2EV5A 1P7JA 2W4DA 3M1EA 2E7XA 3K2AA 1XMQF 3WODF 3OSGA 5HQLA 1Y5LB 4OHVA 4KPYA 3QATA 3ZTRA 2CQ3A 1TAUA 3KHLA 1V3FA 3MURP 4RW8B 1OSCA 2MDAA 1MMDA 3CMES 3IKVA 3M8FA 2H3EB 5I42B 2IPQX 4Y3CA 3NCQA 1S5LC 5LJ5Y 1R58A 4YB1P 4P6QA 2EFNA 2CXEA 2NNNA 3WTXC 2CPYA 3QOPA 3Q8YA 4IEJA 1TKXB 5HROB 2R7SA 2HWIA 3SZGA 1R00A 4EM0B 2BY2A 3GJQB 2DNMA 4BJ6C 2ZH7A 2NVTJ 3OUYB 3IL2A 2RNJA 3G6EI 2IS2A 4OWRB 4MAKA 5DD8A 2M2BA 4RBTA 2XHCA 3S1QJ 1GXPA 2BJ3A 3H5RA 3RDIA 4NOHA 4U7UK 2HGMA 4JI0J 4E7ZA 1ROFA 2C6YA 1FRXA 3MVPA 2XEXA 3HZEA 1CG2A 3RCOA 2GMLA 3OXFA 4F0HA 4U8YA 4OMYA 3TA0A 3D5RC 3LH2S 3V4MA 3MZIA 4OJHA 2YKAA 1P8GA 2RUSA 5D4PA 2XGXA 5CAAA 4P7VA 4PG6A 2YNHB 1VQ8S 2V2ZA 4NHJA 1NNDA 3PIPQ 5KFEA 4HNUA 3A1YG 2IYGA 2EXUA 2C28A 4C3IJ 1JLCB 5HNHA 2MTLA 2IS1A 4ECZA 2YX4A 4DBQA 1F3VA 5LJ3Y 4RB2C 4Z37A 2MGZB 5AJ3J 4EYHB 3I54A 2ZBIA 3QSYB 2C1EB 3JXOA 2DVIA 5IYCJ 4A3JJ 1IRGA 2GIQA 4JI8J 4XNFA 1M5HA 4ESJA 3L09A 1PVEA 2GAGC 3T8RA 2V67A 3HFZB 5CCMA 3Q8SB 1IRXA 1HWLA 4IZZA 2LQBA 2A6EF 4LFAJ 2VL1A 4E7LA 2R2TA 3H4BA 3AL0B 1X9SA 3ZGKA 1REVB 4RNFA 1LFWA 3P8BB 1RAHB 4F7ZA 3W9JA 3ETOA 3GTKJ 1J2VA 1HNWF 1GHCA 1WI9A 2HEKA 2BRLA 3QPLA 5DG7A 3OVAA 5ICFA 4I0BA 2F40A 3TW0A 5D6GA 1MJAA 4QWCA 2DMUA 2MHEA 5L9XA 2E1OA 1KHWA 1DTTA 1C0WA 1KVJA 2CG4A 2FC9A 1HOMA 2HQGA 3SQNA 2ZJPQ 1VR6A 1FPQA 3K4KA 3DXSX 5FIIA 4LF8J 3IP4B 1YRTA 1WHXA 5EZGA 4CLWA 4DV4J 1O57A 3VAGA 5C42B 1X4EA 2DTRA 1NU4A 4OI0A 1QUPA 5JJBA 2HTJA 1WEZA 4AQYF 2YWEA 2FY8A 3LP2A 1RZ4A 1VQNI 4WYWA 3TZWA 4C4WA 4UTGA 5B0DA 4FNIA 4B3MJ 1Q8IA 1PG5B 2K4BA 1JQGA 2YVSA 3CCQI 4R8HA 1WQ2A 3RTRA 3Q5FA 2C2EA 2ZWOA 4FISA 1FE4A 2W7AA 4JYAJ 1U1MA 3N4MA 3K8WA 3JSYA 1O0PA 3BCBA 3ZMZA 3V6DA 3RAXA 3CMMA 2X1AA 4RB1A 4Z6YA 4UUSA 2B7CB 5C2CA 3N97A 1IKVB 4OYWA 5FGMA 5BR8F 3OV7A 3QFHA 2AQFA 3T1HJ 4CXFA 4X1EA 1HBUB 2HWVA 3H3UA 4WK1A 3KJVA 4ZDOA 1U5TC 1FKOB 5E3LA 3BC8A 4OJ3A 4A69C 2FHMA 4EJUA 2K7KA 2HNYB 1FTZA 2VKZG 2GHPA 2IA6A 2HQNA 2HBRB 3IRXA 3EVMA 1HL6A 1IR1A 2OUGA 3UQSA 3IGVA 1HSTA 3DRPA 4MKAA 3JSOA 2M2EA 3UCZP 3EQLF 3CCSS 4CDIA 5HQMA 5EDWA 4A93J 4LR7A 3FMBA 3QGGA 4OJ1A 1IG7A 2NPFA 5J1UA 4XBFA 1YJRA 1O51A 1YE9A 1J09A 2YKOA 3KLGB 5KFKA 3I64A 3LW5C 3LQQA 2V4JC 3HHLA 2CO5A 2FLNA 4C8YA 4AYBD 2KIQA 4S0HB 4ED1A 1A5JA 3WBZA 2OP5A 2CW7A 2RF2A 2WSEC 3HB9A 5KFUA 1LKZA 5HJXA 3SCKE 2BVZA 2A3JA 4Y7NJ 2VE9A 2H8WA 3BPVA 4RDUA 1CULA 2V9VA 3M3YJ 1IM4A 3VVUA 2OUMA 4ZC3A 1AYEA 3M1CA 3R60A 3DDKA 4DHVA 2EILH 3T3FA 3RZAA 2UWMA 4B9NA 2RIJA 2LQ9A 4XKWA 3F23A 1H2TZ 3CF2A 1ZM2A 3BPXA 4HBLA 4EBCA 1V55H 3MAAB 2DNQA 3D6TB 4LBHA 2XNRA 3PO5A 4M6YA 4NXMJ 2KVQE 4J9LA 2OGUA 3HX9A 2Y0SA 5E0OA 3C15B 3MEGA 3IAS2 3MPDA 2PFFB 4PZVA 2BE2A 3HOSA 1SIWB 3QP6A 4RB0A 2V8HA 4DU7A 2K3KA 2MKJA 1XMXA 3DKXA 5K8OA 2E60A 2CV2A 4DJBA 4DPUA 4OX6A 4RU2A 4BEHB 2DODA 3E6DA 3CCVI 4WE1A 3H0GJ 3V2UC 4KN7X 4JI0F 1LK7A 3M8QA 1QAYA 2YWHA 3UDEA 4FDFA 1X5SA 1HBNA 2EW9A 4DW6A 3I4NJ 4XK8C 4Y15A 2XI3A 2GOMA 4GGGA 2E1NA 4D0PA 3E6MA 2YWFA 3CPWR 2KFZA 1YW9A 1RT5A 4ZVUB 3QYFA 2OPSA 1UWAA 2BE2B 3MXHP 3ERED 4QPQA 4TU8A 1L3VA 1IQTA 2DGOA 2VQHA 1RETA 5IOYA 1SEUA 2DNHA 4U8VA 3MEXA 2QEXI 2NCKL 3T6BA 5F9NA 3FK7A 5HS8A 2VF3A 3TGNA 4LLGF 4HF1A 1LWEA 1Z0XA 2WCXA 1S97A 3IP0A 4C30A 4IXAA 3T6JA 2BV3A 5H2FC 3QODA 3NXZA 2M3DA 3IR7B 3FM5A 3L7UA 2X6WA 1QNTA 5HSPA 2DJNA 2DQRA 2G0EA 3VYRB 3AD7C 5ADZA 4YEAA 4ERDA 2RVCA 2HMIA 2HFVA 2MH2A 2WTFA 2DT6A 4LQ9A 3F0NA 1FVQA 1ITYA 1OYDA 3ECHA 2LYVA 5FLXU 2HQRA 1X31C 4XKBA 4LLLA 3WU0A 1SUQB 6AT1B 1PILA 2JEJA 4WXDA 4ZH4F 3OJSA 5ETVA 1YQAA 1H0MA 1DQ9A 1QHHD 2XAQA 5K8NA 1TWCJ 2AX1A 1I1SA 3T0YA 1UFLA 3GJTB 4B9LA 1EZZB 4ITSA 3CDLA 4EJVA 5GTIC 1O3SA 4A3MJ 3D9BA 4AUXA 3S16J 3MPVA 4LMZA 2C2KB 4J9KA 5EEGA 3MR6A 2IXSA 4A3DJ 4C98A 4LRFA 1S0OA 4AXJA 4Z7CA 3JQKA 2HFSA 3VGVA 1BI2A 3TEGA 4FASD 5DJBA 2YTCA 1FFGB 2FRHA 1POGA 3SFGA 1WI3A 2GJ2A 5D8LB 2LCWA 1FTRA 3RBEA 3H59A 3H5YA 1YZ6A 1KEKA 4X62F 3AY0A 3PFYA 3DLAA 1SVMA 2EC2A 4IHYA 4F36A 1NKEA 3HVTB 4Y2AA 4CDGA 2XPUA 3HSJA 2KJWA 2ZNZA 4IR9A 3H5UA 2VDHA 3FC9A 4FKXA 5CQGA 4RPFA 3POTB 3BQ1A 4EO6A 2NXNA 3G96A 3F72A 3R3TA 5KT2A 4WCEQ 4LREA 4IUFA 1PYVA 1RCOB 1Z1DA 1CJVA 5AE2A 1H7WA 4G1QB 3M8PA 4BU2A 2Z2MA 2DK8A 3MN2A 2A07F 1K44A 1DARA 3CSKA 4WFYA 1TWAJ 2Q2EA 2HHUA 5EGOA 3DPTA 3OJUA 2LBFB 4PUOA 4RUCA 3TO9A 3L2CA 4LJZF 1FX4A 3GFHA 4G7HF 4WK8F 2FBHA 4PFOA 1MSFC 2FJVA 3U1MA 1OMSA 2N8GA 3V7CA 4HSTA 3ZZRA 1K47A 3A0BC 2ZBQA 3HSGA 2H1YA 2CZ4A 3PW2A 3D5SC 4NYOA 3DLGA 1DJ0A 4ZOSA 1QSLA 4RZRA 4PYAA 5DZ6A 1LPQA 2UXBF 3B73A 4NCBA 3NEKA 4Q5VA 2RHQB 3I4PA 5DQGA 3BT9A 2R7QA 4LF4F 1NZAA 3UCGA 1SL2A 2JLFA 2QMWA 2QN6B 1ZS6A 4NXNJ 4HZFA 3TP2A 3JQMA 3GTLJ 2ID3A 2YH1A 2RKHA 2ZJRF 1FZPB 1BC8C 1JE8A 4IO9Q 1TL7B 2HTSA 3FIWA 2J5OA 5E2QA 4K59A 3RJPA 1R8PA 1U2RA 5FLXY 4ZCLA 1IAWA 2X0LA 3T9ZA 5JHUA 2OEJA 1Q5YA 2KDOA 4GC7A 3C2HA 4H0EA 2OD4A 1APSA 3MCZA 2HOTA 4ZVQB 4B3AA 4ZPVR 3UE2A 4ZCIA 4A4JA 2HHSA 1P4AA 1BW5A 1L0OC 4FYDA 2COMA 1KSPA 2ZXJA 3I0RA 2XTJP 1X4BA 1S6QA 3JSBA 4N9HA 2C3PA 2WAQA 2CPFA 4E98A 3Q8PB 4BHCA 3R5JB 3HC7A 4ANEA 1ZELA 3CF5Q 1USTA 1HW8A 1RISA 2D3ZA 4EK2A 2LF7A 2F3JA 3R1HA 3VTIA 2D69A 2VG7A 2RH3A 1Z7LA 3V6JA 4NCGA 4TYAA 1IR2A 4ZLPA 2LOOA 1RR8C 4P9SA 3FXQA 2IRUA 2MKHA 5EEHA 4X64F 2IM3A 3FQLA 2LG4A 1OY9A 2QMUB 2QIFA 1S12A 3TUPA 3SMZA 2GVDB 4L9TA 3EXYA 2NYIA 4ZPAA 1RIOH 2FVCA 5GMKa 2DFIA 3AJDA 1MDMB 4A2UA 1U2FA 3GE9A 3F6OA 1ETQA 4N0BA 3MMJA 2UZKA 2G2OA 4RX6A 1VRUA 1YX2A 2HLUA 4EM1A 1RE1B 1BOBA 3N05A 4NCGB 4P10A 1U1NA 5L39A 3J80Y 4CO2A 4BE2A 2WBRA 1R9TJ 2CNKB 4LITA 4TLRA 4QWBA 3LSIA 3AFHA 3RQIA 5D78A 1RPWA 3I32A 2DPJA 1R7JA 2R2UA 4U88A 2XAGA 1MDMA 3T5JA 4LFAF 2QLWA 2MZ1A 3M4OJ 2E5JA 2NS0A 3V6KA 2QJ3A 5E17F 2L9WA 5I3UA 1VK8A 3UD5A 5M2PA 4EI2A 2N3OA 3M32B 1UHSA 3UPFA 1EKSA 2Z0GA 3VGTA 1FOWA 3OYGA 1C1BA 2EKNA 2K85A 4YRVA 1SQGA 1S59A 5F0WA 3VQSA 1U1PA 3BTCA 4I67A 1ZR4A 2YNGB 3WTSC 4Y2KA 3EGWB 1C1BB 4OIQF 1NZ8A 2ZDPA 3LFUA 4RA2A 4JV1A 1FX2A 2F2EA 3VYTB 2HXIA 5EGOB 4OX7A 3L2VA 2UXXA 3K4JA 3FZBA 2NYHA 1UB9A 3Q86A 5A2QK 2X48A 3D6HB 4KYZA 1TMJA 1U1LA 2MA3A 2K9NA 2LY9A 1QDUB 1WH5A 3TNVA 4QZVB 2LMDA 4N9IA 2P8IA 5ETMA 4B17A 2LP0A 1D8YA 2GLOA 1JB0C 2UUAJ 3DRSA 2F4VJ 3A03A 3RBDA 3LQVA 2BE7D 3LGMA 4WP8A 4DFMA 2IMOA 3I96A 4PKDB 2JLEA 3I4HX 3QT8A 1U4BA 1R5ID 5FROA 3IR6B 1Q81T 4M3BA 1KTVA 1KN6A 5F04A 1TWHJ 5HP1B 4DX5A 2AXTC 3FBBA 5HVQC 1AT1B 3K2YA 4ZLJA 2DQLA 1R36A 4DV0J 4ENOA 1QZEA 1LK5A 1YO5C 3G6ES 1IN5A 2BKNA 2KFNA 1A6QA 1S1TA 2FLLA 3WGHA 4Y3OA 1K6YA 2F9JA 1WJBA 3BO4A 4JI7F 2PMZN 2R5YB 1N88A 3LL7A 3L7OA 1TKTA 2EBEA 4OOIA 3C66A 5HS9A 1WACA 3KJNB 4XN3A 3I0SB 5K5RA 1VQPI 3I58A 4DFJA 3CE8A 2FHJA 3QT7A 5KAIC 3VWBA 1GXUA 2H1LA 4CLUA 3MI7X 3PHTA 4O23A 2DPDA 3NNHA 2Z2ZA 1KA8A 4QCLA 4L9JA 1SFKA 1UEUA 1YRUA 2C42A 5L1LA 3SBMA 3G71S 4EM2A 2L7MP 2JH3A 3HO1A 2XI2A 2F5FA 1VRTA 2BZTA 4L5JA 3ASNH 4XQFA 1S7HA 4TLQA 3BDPA 1EJ9A 2X3DA 1NG7A 4LQ3A 4ON0A 3H3VK 3FSIA 3HKWA 2CUFA 4B9UA 1U45A 2F63A 3C2PA 2DGXA 4BJTA 3J81Y 1RTDB 4ED2A 4BBSJ 5KOXA 3HI9A 4DCJB 4XN0A 2WTEA 2AZ1A 4AWXB 1X4CA 4QWAA 1FIPA 5A6WA 3V8KA 4A5MA 4XKVA 2KPMA 4A0XA 4UVBA 4YFXF 2AQEA 4BAYA 1TL5A 1KFSA 1MNEA 4LIVA 4M5NA 1U1KA 4J9UE 4IH5A 3M8JA 4AIJA 1VBXA 3UNGC 5CVUA 3CCWA 4IFYB 2KZGA 3Q3SA 2CS3A 4ECRA 4X4SA 5DGAA 2ZFHA 1H8AC 5E8IA 1RT1A 1O7LA 2NVYJ 1B99A 1HNIA 3UW1A 4L5IA 2QLZA 2DIUA 1OY6A 4FZVA 5D3GA 1YW7A 4XOTA 2AJ4A 4ZP9A 4Y33A 1S49A 4OZ0A 4H4MB 2B6AA 2DMQA 3QQAA 3I9V2 5T7LB 3L00A 4AYBA 3GIJA 1YITS 4JI6F 2FOWA 5HVGA 1T0FC 5MAOA 1REPC 2HOEA 5ILUA 3KK2B 3T5HA 3P96A 4ZVHA 1LNWA 5AIPA 2EEYA 2VB6A 1Q1HA 2BMBA 2XROA 3CCUI 4RW4A 4DR2J 4P2MA 3HRUA 5HO4A 1M5PC 4PQUA 3QWUA 1TW2A 2HHHJ 2M7BA 4XKCA 2LXUA 1Z2LA 3D2WA 4AT1B 1SJ1A 3BQYA 1K78A 4ILLA 3GUDA 1A35A 4UUSB 1F1ZA 3NNAA 1XDUA 2D41A 3RZDJ 3HDSA 2MQ8A 1X4DA 4NMLA 4R0JA 2XMAA 3TOBA 3TARA 4U7UD 3KNAA 5LL6d 3FKJA 3W2WA 1X5PA 2BANB 2D3UA 2RV8A 5IY5H 4FYWB 5ITHA 1VQ6S 3OYEA 1HNZJ 2DO0A 4MO7A 4X4UA 2LA4A 1F5TA 1PDNC 2RDIA 3MD3A 1RC9A 1DHMA 3D6FB 1I5ZA 5KOWA 5J1RA 1W0UA 2KZZA 2C3OA 1HI8A 4CLKA 5K7HA 1RHUB 2QA2A 1B9MA 2VKEA 2LBFA 1F2GA 1C4CA 2DCUB 4QJVA 4J7CA 2M0CA 2IM2A 3HPHA 2HLTA 4PGHA 2J0XA 4G6VB 1D9FA 2R42A 2DHXA 3W8PA 2QL7B 1R71A 1RUNA 5IM0B 2B9SA 2C2MB 4RWWA 3MPWA 5D5XB 3KLFB 2WVEA 4WTOB 2O03A 2EZHA 1T94A 4Y28C 4GO5X 4DZ6A 3RR7A 3E8OA 1ON2A 2W2NP 4AVZA 3RB6A 3DLKA 5IQ6A 3FXUA 3MMYB 1WJDA 2NXCA 2CVIA 1ZA1B 1QPMA 4HX7A 2EPIA 1NLKL 3NWGA 3BM7A 5GADJ 1Q8LA 1NK8A 4DBRA 1VQ4I 3CUQB 1YZ7A 4K2EA 3D1OA 3OHAA 5IWAJ 4ENNA 3PRVA 2FXAA 2FVRA 3PR4A 2DFFA 2VODA 4JV0A 2A18A 3P5TL 4V2GA 1Z6TA 4W98A 1RRJA 2ZH9A 2XMVA 1H9GA 3G6XA 4U95A 1TP4A 4NLSA 4NLVA 5DLFA 5L3CA 1KC8T 3BH7B 1UL3A 3GTQJ 2IRYA 1IJWC 3NRBA 2WONB 3GJRB 3VZIA 3PX0A 4RR5A 4ZP7A 2HQ5A 2K1RA 4UUTA 1Z9CA 1TQPA 4B44A 1FWZA 1VZ0A 1DU0A 2QSHX 4LG0B 2ZC4A 4NB5A 1H2UX 2UU9F 2NAZA 3OSFA 4K4VA 4LMYA 3R7SB 5HMZA 4HF2A 4M6VA 1T6SA 4A5NA 1A0OB 4X4VA 4ED5A 2EZKA 3PM9A 4E70A 1N0UA 1RT4B 3PIOF 2U1AA 1NO8A 4IOCF 1EH6A 3VQTA 2R7TA 1XGSA 4O4GB 3B54A 2PMUA 3OYHA 1HWIA 2W4PA 5BXIA 3EYYA 2VU5A 4R8UB 1S1XA 5DEQA 1XNQJ 4KITB 1ZG1A 5L3BA 4ZN3A 3CDBA 2PI0A 2MY7A 3CJRA 5LSRA 2DGVA 4QR1A 1NG6A 4ES3A 1WKKA 4KR0B 5CA5A 1U02A 3PO4A 4WWCA 2GIFA 2V9WA 4FX4A 2DXEA 4HAMA 1QO0D 5J2PB 1OCZH 1KU3A 2HYGD 1G4CA 1YLXA 1SD5A 2J8AA 3HRSA 2Y30A 4WXOA 3D5LA 5B3SH 3PSFA 1NXIA 4QR2A 2L4AA 3RJMB 2O8KA 3H9QA 2XY7A 1PUFA 1R8HA 3H9GA 2V8GA 3IH2A 1MNMC 2GIVA 3D4JA 2CWXA 3CCRS 3KK3B 3ZQ7A 1DURA 1W25A 3RQ4A 1KU7A 5LXRA 4J01A 4RNMA 1FNMA 5K5QA 2UUTA 2XULA 2VI6A 5DS7A 4XPCA 3OOUA 5JVGF 3CVKA 2CWEA 4HV6A 3CCJI 1QVUA 1I50J 1KQ0A 1WGXA 2WVFA 3S3MA 2DA5A 2UVWA 2B51A 3QGHA 5EJCA 2NREA 4HNTA 4M8LA 2IA2A 3WQPA 4LF8F 2PI4A 2ECBA 3F21A 4KO0A 1HBUA 5EWEA 3CDIA 3PUFA 1LXJA 2QVOA 2XWYA 4NLRA 3F0CA 5K14B 2DNNA 4J9OA 4Q44A 4C8KA 1G6NA 3EPGA 4IRHA 2OC6A 3Q0WA 1DFDA 5I3PA 2DOEA 1RB0A 1R0AA 4C48A 2OU2A 3U9GA 2XMUA 2CQDA 3KKFA 1MU2A 4HI2A 3BYPA 3DNCA 5KFLA 2HDDA 4DV3F 2W01A 2C2RA 1B3TA 4ZTFA 3MCNA 4DPWA 3E5QA 3IWXA 3ZTOA 3FBCA 3ONQA 1D3YA 2LKPA 2STTA 3HFVA 3OYDA 1WKLA 4YHHJ 3DCFA 5CVVA 1RAOA 2XMTA 1K61A 2HRUA 3EGNA 2OAUA 2RC4A 3BG7A 4TY9A 1WORA 1WC3A 5C7PA 4RW7B 1T03A 2LY1A 2ZE2B 4I0AA 4Q8FA 2E5LJ 3CJ5A 1KTQA 4O3PA 1YOVB 3RKQA 2QA4S 2JWNA 1SJFA 1RTHA 2R8KA 4X4TA 2R7FA 4EJTA 2GQ2A 2MKIA 4RW8A 4ANDA 1MROA 2IBOA 1EB0A 4BXUA 5AE3A 3W2AA 3HDDA 1IKWB 1A9NB 3HPGA 2D3O1 4DV6J 4UXNA 1LB2A 2OKQA 5KFBA 1LWFB 3BR6A 2V1NA 3G1MA 4N8OA 1FD2A 4RW9A 3U1DA 3KP3A 2FJBB 3MUTP 2E9TA 3MPUB 3M8ZA 4YMEA 3GYGA 2O61A 2H54B 3SSSA 3OL8A 2C2DA 3CUQC 3T41A 5IM0A 1C2PA 3UNYA 2COBA 2BEOA 3VSLA 2Q0OA 4E7JA 2VUMJ 5BYQA 5IT3A 1WOPA 3K10A 3OWTA 3KLHB 2QL5B 1JIHA 4UNOA 1FP2A 2R8HA 4HI1A 2WK4A 2HYJA 1JGGA 2HYFA 4AUKA 8RUCA 1BM9A 3PEHA 2OPRB 4YY3F 1B4SA 5GMEA 1KP6A 3TI0A 4XLNF 3JTOA 2QX0A 2OMOA 1VQPS 3UDLA 2QGFB 3FMRA 1WC0A 2JSXA 5IS2A 1X4GA 3KNGA 1R0BG 3H98A 2DR7A 1LVKA 2VIXA 4GC6A 3BR9A 1S10A 3K58A 4AYBN 5KNLA 2APOA 2F5EA 4ENJA 1QVTA 2DOAA 2AJQA 2CQBA 3US5A 2CV0A 3BROA 1JUPA 2JVRA 4E0DA 2BVLA 1SFUA 3VSKA 3I0TA 2D2WA 1ZAVA 2RHSB 3A01A 3BR8A 4WXHA 2J0WA 4Y13A 5H9EJ 1XTZA 1W5SA 5ED4A 2YWKA 4C8NA 3SDBA 1Y0UA 1T08B 4J9PA 3EYIA 2KVIA 3M8WA 3JB9k 1I1GA 4CI0B 1F60B 2OMLA 2M0GB 1ZG5A 4DR1J 5GPCA 2Y9YA 4JV5F 3CCMI 2XKPA 3RPUD 4DEZA 1JHHA 3P9CA 4L18B 4HDHA 4QW8A 2GA1A 2XSJC 3AD9C 4FBTA 2IA1A 3S2DJ 1CJKA 3FGVA 4WFNQ 2ALZA 2W2PP 5B0GA 4K2JA 1JXEA 4I02A 4P2SA 1N5SA 5HATA 4RMNA 3CUNA 1EX8A 3ZZ0A 2YPYA 1XNRJ 1ZM9A 4ZP6A 2LC2A 3J7YI 4IFYA 3ITHA 3MKLA 2ZXIA 3KG1A 2VQEJ 4DZJA 2LQ5A 2OSRA 1HIYA 2VKVA 2DYRH 1UWBA 4UV8A 1RWXB 2YPZA 1JLFA 4QWDA 1PIEA 4PJ0C 5CJ9A 2HURA 1IQZA 2CSOA 3W66A 4A0YA 4ELTA 4C3MA 1CJVB 2ABYA 1T9VA 2BW3B 5DG8A 1JLAB 4IRKA 2MLZA 4UQTA 4YUDA 3B02A 1IKXB 4QLCU 3S15J 4MMOA 3M4XA 3BQZA 2ILZA 3TEDA 4AM3A 3HVTA 4FYYB 4A8MP 4E8UA 4NXNF 4MIAA 1LFBA 2MZQA 2HNZA 2M0MA 2HNHA 1TNTA 1V5IB 3JSMB 4GKKJ 4QR0A 4NRTA 4Y34A 1W7PD 4RU9A 2JT1A 2EZLA 3TVZA 1A31A 3MM6B 1SKWA 5IT9K 1JLQA 4CO5A 4LFCF 4MIMA 3E5UA 2DH8A 4ZLNA 2IJNA 3J7AO 4KE5A 1U09A 3CGIA 4ESBA 3ILJA 4RGUA 4R1HA 5HP1A 4QYZJ 3NWSA 2QWWA 2B9EA 2A6OA 2BACA 1JT0A 2Z2SB 1PBUA 2EV0A 4KHPF 5KTQA 5DUKA 3OR1A 2R0QC 3PJ9A 3JAMU 4UOGA 1TK5A 3GF2A 1RKWA 4PFPA 3KZIC 5I42A 2MSSA 2XWXA 3PYGA 3G9CA 1GEHA 2DGTA 4BY1J 1TZ0A 4XIUA 1FP1D 1T9YA 1T05B 3HL2A 4D9JA 2FTRA 4JX4A 4LIUA 3OYJA 4USIA 1JXLA 4JI5F 3I55I 2KT3A 4U7CA 3CJ4A 5HLFB 4ILMA 2RDPA 4O3MA 4NE9C 4HEA2 2FB0A 4ED7A 3FZ2A 5AIQA 2BW2A 2JUGA 3C19A 1LQ1A 5JHFA 3RYRA 1OCOH 1RWUA 5IP9J 3PIPF 2M5YA 4URQU 1S0VA 1KR4A 3UN5A 1I3OB 3EUKL 2ZJ2A 2G7UA 1FBUA 2K2PA 4DR4F 1N0VC 2VIHA 1RA7A 2VICA 3X3UA 4OIOF 5JXSA 5EHHA 1F5CA 4EJOA 4DDFA 2ZD1B 1UP1A 3IBCB 2FJDB 2LFBA 1NCLA 2HPMA 1IWGA 2KKOA 4II2A 4LSNA 2EFPA 4N8NA 2AMCB 1CJUA 3CCSI 3VZHA 1JLBB 2JWTA 3CIMA 3I0SA 2P0WA 2CPXA 3IS9B 1ZETA 5KFRA 3R61A 3ZO7A 1G3WA 2DIVA 1ZHFA 1MJBA 2YBVA 5FLXZ 3VVTA 2JRMA 2VBWA 1C0TB 2GHWA 3OYBA 2P9GA 2A61A 3MZYA 4MKVA 2AJFE 3RR8A 4M5KA 2P7CB 1IN8A 4OI3A 4H4OB 4JP8A 5E3NA 5THWA 2N4CA 2BQ3A 2XHWA 3LP0B 2W8LA 4MIBA 5CZXA 1FSHA 1C4AA 1QM9A 5L9NA 2ZH5A 2XAJA 5HQ8A 2WVDA 3CESA 2ELJA 1XD7A 3R5CA 1RWKB 2Y9HA 1OO0B 4I69A 5F1JA 1Y10A 3HBLA 4HTIA 1ZH5A 2XB0X 1BQXA 1PC5A 1MSWD 3WTUC 1SC4B 2Y31A 1RQ0A 1S77D 4BDZA 5A2QY 3NRVA 1NHUA 2ZUAA 3GZ6A 3LSGA 1FHTA 4Q2LA 1YBTA 2CRLA 2BV6A 3KP2A 3MD1A 3SCLE 2R8JA 1HQEB 3E5XA 3ITHB 3WTYC 1I6XA 1CQTA 2CJJA 5EZHA 3PNIA 1G3YA 3DWLE 1FJ7A 2R7OA 1O3TA 1WSVA 1RWNB 4Q47A 2JVHA 4LFBF 2JVOA 2PDAA 2BVMA 3PJXA 4F8RA 3MEDB 4YIIA 2ADBA 3OYFA 2A2CA 2E5NA 3OVSA 4XICA 3L7WA 4AIKA 2RU3A 4BDYA 5IV3A 2YNFB 2AHQA 2D9PA 3CJ8A 4OMFG 2JC0A 3BJYA 1FA0A 2I1RA 2X1BA 1A6LA 1NEEA 2CQ4A 3KLNA 2IJFA 3F73A 2FVQA 5D6FA 3MWBA 1HXDA 1KQKA 1TL1B 4I99C 3HG9A 2HGNA 4UF4A 2JA5J 2B4UA 1IRFA 4DV1F 5BYRA 4LB5A 1N5YB 3ELKA 2WC2A 3MM6A 2UUCJ 1TMMA 2H5EA 1X7VA 2GVZA 2Z1DA 3ISND 3KLOA 4ECXA 3R6SA 4X66F 1R8BA 2LDIA 3V81A 1S7IA 3Q23A 1Q1KA 1OCCH 1VQ5I 3T1YJ 2I8EA 2XRLA 2IYIA 5HN0A 1WC1A 1XMAA 4GRIA 1S48A 1S6OA 2YXLA 1OKRA 4FYXB 4RGSA 2V63A 4XL9A 5DV5A 5E7OB 5DRKA 2NUHA 3QU6A 3IWLA 5CYMA 1NJIT 3TOAA 2XF5A 1OWXA 4OYZA 2R2SA 1BI1A 1GMWD 3GTJJ 2JJ7A 2V34A 1RTJA 3C16B 5HBMB 3OHBA 4F3MA 4USUA 4OU0A 1KQGB 3QJLA 2FNAA 1P2FA 3IH4A 1ZZNA 3KWMA 2I6WA 2OPSB 1FWLA 1LEOA 2DMNA 2HK2A 3ETMA 2VXZA 3ZOBA 1NHKL 2X85A 3E7LA 1YRNB 3OT9A 5E41A 2VHGA 3LA0A 3GFIA 4NLDA 3LAKA 2MEWA 4MFDA 1JT6A 1GTEA 5LGTA 1TWGJ 2HQAA 1Y39A 3K4CA 3LMMA 4DUYJ 2JN6A 2BJEA 2MLYA 3WC2A 4AL5A 1IKWA 2V2VA 4D3GA 2KDZA 3Q9SA 2G7HA 1ETWA 5FKOA 4FS2A 1TL7A 5F08A 3WGGA 2KZMA 1QJHA 2K1RB 3PKYA 2YKQA 1MWZA 3TKYA 1P6RA 3TO6A 3ERMA 2CDQA 5A6PA 3TA1A 4DV4F 1IBKF 4J90A 4PEOA 3WZ0A 4BL0B 4OV1A 1WJCA 4II3A 2R7WA 3KZYA 2CQIA 2NZCA 3N79A 2PMZA 2VFVA 3J7AY 2CUEA 2RE1A 4NX9A 1RT6B 1FF2A 5DDGA 5J4YA 3M1VA 4DSJA 3SSQA 1IO2A 1XQIA 1ZKGA 1RKIA 3HLUA 1IXCA 1ZAXA 4IHWA 3ZXSA 1T02A 2EA2A 3EUHA 2KO1A 4CRJA 2QLBB 2PT0A 2DGWA 1FXDA 4F52A 3FSYA 2AJ1A 2NS1B 1T98A 3GP9A 4G6TB 1VGYA 2Q8KA 2R4FA 5J1EA 4TQSA 1CBKA 2Z16A 3W2VA 3ZQHA 5KAKA 3NAHA 4YS2A 3OYLA 1Q79A 3GSDA 3JTNA 4ETSA 3SQGB 4DSIA 5H9EK 3A8EA 4WFBQ 4C97A 3M2UB 2FSWA 3CCLS 5IZHA 5B0CA 3N5FA 3KEYA 3KLIB 3I5BA 3HHKA 2UVVA 2AS5F 4ECVA 1VQKS 1X3UA 4MLOA 1UW4A 4EUVA 1RYSA 1S6PB 4F4KA 4B47A 1TKZA 1IV6A 1UA1A 1DRZA 2DXDA 2E1RA 2BM0A 2Q6BA 1XR7A 1Y3KA 2E9RX 4ICLA 4OAYA 2E5IA 3DPUA 4CLTA 2KL4A 3IM8A 1KYWA 2WB1A 2GMJA 4U87A 3LPEA 4OIXA 1UFWA 1N52B 3LF0A 3J7ZI 1CS4A 4IF4A 3OTOF 2CUZA 5HVFA 2F6CA 1MWYA 2ROGA 3DF8A 2JPCA 3U02A 2O5DA 4Q45A 3B8HA 1V5VA 2B43A 2VT2A 1T03B 4IO9F 4N5SA 2IEKA 2FEZA 4IJAA 3LA2A 4A3CJ 3G82A 1DQAA 3VCDA 2QQ8A 2B63J 2RD5C 3DRPB 4M1KA 2GQQA 3KUEA 4NLGA 2X6YA 4RB3C 4E2FB 1D9AA 2OQGA 4LIRA 3S3NA 2RJZA 1U0SA 5LMNF 1U0HA 1F5BA 2A05A 3DLJA 2DW4A 4NLOA 5KFAA 1HNZF 2HR3A 3WTZA 1UEKA 4CCNA 1FK9A 3ABMH 2QSFX 2GBYA 5HBMA 4DN9A 4JI3F 3W3CA 4PUOB 1HSJA 5FLVA 1B4AA 2AX0A 5HAOA 4DPYA 3DV8A 3V42A 2NR0A 2OPPB 4RJVA 1EARA 1FEHA 4OJGA 3KTQA 1AZSB 1RLDA 4G1QA 2GC8A 1BC7C 4NUBA 1XSVA 3P5JA 3TO7A 4OI4A 3H5AA 2A0FB 2G0CA 2XCPA 3R7NB 1U0HB 4XIDA 1XMOF 4F0KA 3OW2R 2XGDA 2B9WA 3D1NI 1ZBTA 1EF4A 2ZBPA 1YDLA 3QAEA 3PZPA 1UCRA 3CJQA 2B4VA 4ES2A 5L38A 3QWPA 2KMUA 2ISZA 4KYWA 2XPVA 3H2VE 4K4SA 2CA9A 5BR8J 2V8VA 5DCMA 3FEYB 2K86A 3G86A 2FHOB 2LXFA 1RTZA 2JTVA 3MEEB 3HOWJ 1FKPB 3DBHB 3H9JA 1Z1ZA 2WONA 3ULHA 2MQLA 1QA6A 2MABA 1FDNA 1YTYA 1WOSA 1P1LA 2NRAC 4ALZA 2VKDA 3QWLA 2ACYA 3HJVA 1NK3P 2GWRA 5EG0B 1XTAA 3ZZTA 4XTTA 1R4MB 2M8GX 2PJPA 2C3YA 1N6QA 4YG2F 3MM5B 3AAFA 3HVRA 1DGRM 1WI8A 2YNHA 2K02A 5D4RA 1O3RA 2N4DA 2HVDA 3PUBA 3JR9A 3D67A 5LEJA 4WBFA 3IMQJ 3RKWA 1EQMA 2OBPA 1QAXA 2ZWPA 2OA4A 2WY7Q 2CPIA 3TUZC 2OPQA 4BBYA 3DHXA 2CV1A 3QIPA 3AFGA 2QLJB 2E5ZA 3HSRA 1SKUB 1L3SA 1X4PA 3CCYA 4KHRA 2W8KA 4IRCA 1W5TA 1V5EA 1YJ9S 3RB3A 3KUGA 3U7JA 5CHCB 1A6IA 1UWBB 1O3QA 2QYGA 3MKWB 3MECB 3BDEA 3OBIA 3EGZA 3W1YC 4AE5A 2VPRA 1IXKA 1KQFB 2Z30B 9RUBA 3LP1A 1QTMA 4F7VA 3F6VA 2DA4A 5CCLA 4KKOB 1VQ6I 3KDNA 1DQ8A 4WTYA 3FK6A 4DYCA 1AXQA 1RKJA 3GIMA 2H4WB 1B59A 3BN4A 1X5TA 2DNZA 4BE0A 3J7YJ 2QA4G 1ODDA 3ZQCA 3MKZA 5A2QU 1HDDC 2B0LA 2ZH1A 4LOCA 4DX8H 2EFQA 3OXGA 3CCVS 1R5GA 1TL1A 1DY3A 1Z91A 5LXYA 1LWCA 3PSIA 1W36D 1B1BA 1UCNA 4FE7A 5HDKA 2L9SA 1ZGJA 1NK9A 3BGLA 2W24A 4B8XA 4DQRA 3S7RA 1H73A 2MZRA 3O3LA 3GG0A 4PJMA 1RSCA 2E7WA 1SC3B 1FVSA 1CF7B 5J47A 4CZZA 2K9QA 5K1YA 2E35A 3WTTC 3BGRA 2CUJA 2W00A 3HM5A 4DS4A 1ZTWA 4PQAA 4JX5A 1CS4B 2V68A 4L9NA 3TDZC 3VHQA 1VBZA 1QE1B 2NNYA 2XSDC 5DG9A 3TZXA 3K5PA 4L0ZB 1QY7A 1UVJA 2R7UA 2MPUA 1WHVA 4C0BA 2QV6A 3I55S 2V2QA 1AW0A 4IHXA 1NH3A 4A48A 3SIPB 5FB2A 4DPOA 1DQUA 3O44A 3GIKA 4DV3J 1FRKA 4NLTA 2VJUA 1QQIA 3M32A 3GO5A 4MQ9F 2FQQB 2PMHA 2J9DE 2YWWA 4M63A 2PLYA 3GWCA 1URRA 4N56A 4WP9A 2Z8QA 4OI6A 1S72S 3BR5A 1Z7UA 2VASA 1MIJA 2X9DA 2FUG2 2ESHA 4I6WA 2XYHB 3NGRA 2CYYA 2HKXA 4C8ZA 2NLWA 1RT3B 4D5CA 4OHWA 2OTJI 3LO3A 1NK5A 4JI4J 1KYZA 1UKUA 1YIJI 3W9HA 2CJYB 2M8HA 4ATNA 1HR0J 1OYWA 3VYSB 4U96A 1RTIA 5FLXK 5TRDA 2JOQA 3ASOH 2KYZA 2ASJA 1R49A 4IOAQ 4IRIA 3D1HA 4ZYAA 3NEUA 2YKNB 4LRAA 4LFBJ 2JDJA 4EZ6A 5KAFC 4WWSA 3T1AA 2Q43A 1P1TA 5F41A 4DV1J 2YX1A 3JAMY 3ZPLA 4UUXA 3TX0A 2BBYA 1OQ3A 3UWTA 1SPBP 2BBEA 1OQ6A 4HKQA 1DTQA 4K0KF 1XX5A 1V5GA 1AOYA 3S1MJ 3PXGa 2RS8A 5DS9A 2E1AA 2L7KA 2FZCB 4CLYA 1J59A 3GTPJ 2EINH 4ED4A 1H98A 3PYDA 3J7Z5 3J7A1 5DDOC 2STWA 2YSRA 2BZ2A 1SFOJ 3EMTA 4PWUA 2HGLA 3P5BP 2IFXA 4U7BA 2Z9OA 2F5VA 1W7WA 3M6UA 3CW2C 2JA6J 4M9ZA 3QAHA 1B0PA 1WDTA 4IDKA 4EVIA 3N6NA 1G1XA 5IC6B 3GSIA 5A8KB 2VFSA 4NYPA 2EFGA 1FRIA 1QLNA 2XIGA 2F9DA 2MY8A 1Q5VA 2MW8A 5ILSA 4QOTA 4UUWA 2A10A 2HMIB 2MH9A 2MQOA 2C22A 4BUPA 2XLKA 2PFDA 4U0VA 3KDOA 1HNVB 3OTDA 5IYDJ 1ONVA 4H4KC 2H9ZA 4GVBB 3X1LB 3HHEA 4UOFA 4ZIWA 2HHPA 4I6ZA 4AXIA 1IBMJ 1YRXA 4BY7J 2FY1A 1T11A 4HACB 2R7RA 3PW7A 1CC7A 4K2XA 4B08A 2XAUA 5B5EC 4E4HA 1W7PB 1XPXA 1IN4A 4C11A 2P5VA 1XC5A 4FCYA 3D0SA 3CJ3A 1HC8A 2L9DA 4UT4A 5DUIA 5LMNJ 4F67A 1P92A 2RRNA 2CFXA 3KUHA 3KHRA 5DLGA 1VMBA 2CUYA 3A8IA 3IHUA 2EK1A 1NDLA 4XRSA 3H8YA 3RTVA 4ES1A 3W65A 2DJWA 1RP5A 1CJKB 1BXNA 2G9OA 2DCLA 1C0UB 2UXBJ 2V2KA 4CT8A 2M70A 1C0UA 3NG8A 4I6AA 3MHYA 5B66C 4K4YA 2F5GA 2GNKA 3L3CA 1KLNA 2QSWA 2DY9A 2ZBRA 4Y52J 1WG5A 2DHAA 2HVIA 1R6RA 3H40A 3K2ZA 1XK8A 1YBUA 2J7UA 4C0OC 3K0LA 2LD5A 5E3RA 4Q8EA 2RDJA 4I7FA 1YKWA 4DL7A 1JTYA 1R1VA 1SV5B 1WNEA 2JFDA 4DI6A 3SQOP 2Y0MA 2AYEA 1FD8A 2HBZB 1VRQC 2EV6A 1Q95G 1SJQA 5J3LA 4ID5A 4ICLB 1X3WB 3NKYA 1IWAA 3HSEA 1XMOJ 1N36F 1WWHA 1Q78A 4DSEA 2RQPA 2GJFA 3DLBA 4MKYA 4L74A 1KOHA 2L0KA 4HDVA 4CYUA 3CZ6A 1S0NA 3PW5A 3CMEI 4JP0A 4ZDNA 4KJZA 1U8SA 1ACMB 1Q4RA 2IAJA 5HK4A 2Q1LA 1UVIA 2F8MA 3TL4X 5H9FK 2FJ1A 2POKA 1R1UA 1EA3A 3W6KB 1TTHB 4RNHA 3G1LA 4LF5F 3DFGA 1CQMA 3MAJA 2GA2A 2XKOA 2FIUA 4DR3J 1AFJA 2BW3A 2IGKA 2NOJB 4KDPA 3SV3A 5LEKA 4USMA 2A2DA 2G4BA 4M5DA 5GAGJ 3NMRA 5E1ZB 5IT9U 4WK3A 4YELA 2F4FA 7FDRA 1XSDA 1N4LA 1HNXF 1F0XA 1HBXG 4I0WA 1YYVA 3K4BA 3V7RA 3FK4A 3CDAA 1QVGR 2AF6A 1TL4A 2CPEA 1WF0A 3OLBA 1TV6B 3JAMK 2W48A 4CSWA 4HDUA 2AYGA 2ID6A 1T9UA 3WX4A 1NK2P 4CYDA 4GDFA 2PC6A 3RAQA 1MBKA 4DZPA 3K5MA 2Z3YA 3REOA 1X1CA 3GBGA 2V6EA 5DM7Q 3A8KA 3TYTA 3B6BA 3PACA 1SAXA 2H6BA 3H7HB 2HEOA 4MTDA 5D5WB 1OPIA 3ZN0A 2HZTA 2HFOA 4E7IA 5KFTA 3J81K 1IDZA 1PSDA 3FEXB 4JI2F 4NZ7A 2E1CA 1S8NA 1XR6A 3BSNA 1VQOS 1I3AA 1EHWA 2XS7A 5ICGA 4D7MA 4WZQA 1AB8A 3R97A 5D5VB 1IF1A 2F4MB 4BHQA 2B56A 3WU1B 2CPZA 2PSZA 2LDUA 3D6MB 1YJUA 1Z77A 2QBYB 5HMYA 2HVRA 3ZTQA 3QIPB 1MMNA 3AAWB 1KWMA 3SFUA 1A7GE 4GVBA 5G0RB 3OYIA 2CJQA 2KH9A 2HBYB 1YJWS 3MAQA 4YB6A 2O8XA 1IVZA 5CKTA 1NDKA 1SVLA 4DUYF 1NRKA 4KT6A 4M71A 3TQEA 3TVYA 1PJRA 1CULB 1E2XA 2EC0A 4UHTA 5HODA 1SL0A 3HFKA 1S57A 4EMDA 2DR5A 4B3MF 4B4CA 1KRPA 4DGWB 3MMCB 4MHGA 3CCZA 5G4DA 1HHQA 2ALYB 2JX2A 3SJMA 3JQJA 2LEPA 5KFYA 3JCUC 4ZCKA 4K4XA 3MM5A 3TEHB 3PNVA 2PBIA 4F91B 3LSPA 3BG6A 1XMKA 2PFBA 4RAZA 4YP3A 3HHDA 4KNYA 5LHGA 1BI3A 1WKJA 4JI4F 2OTLI 4RW4B 2KI2A 4HRIA 2IDLA 1L5UA 1G59A 1K1SA 3RBXA 3CC2S 2RQQA 3MM9B 2R2RA 3PFOA 1RT2A 2BRKA 4K0KJ 1HW5A 2EIJH 2Z2LA 4F26A 3FXRA 4IHTA 1SVDA 3DKDA 3L9ZA 1RCXB 1TVRA 2YNIA 4TU7A 1LE8B 4CO4A 2KHMA 1W0TA 2XBPA 3R9LA 4XORA 1RT1B 4FPRA 1BGXT 3Q8RB 5L1KA 1JMTA 4KIBA 2CJKA 4IKFA 1U6FA 4A3EJ 3PJRA 1WJFA 5JVTA 1UJ6A 2QM3A 1AA7A 2Y3YA 4PZJA 3JAMZ 3K17A 2GXBA 4C6AA 5TJJA 1FDAA 3X2QH 3ZC4A 1IN0A 3CCTA 7FD1A 1YX3A 3FDSA 4RW6A 1XGNA 2DYAA 3V6DB 2VE8A 4FBUA 2QKMB 5LBQA 2IS6A 4V19J 1Q16B 2MQMA 1MMGA 5ETRA 5B0AA 1RAGB 2AWZA 2P7VB 1D1CA 2ELHA 3O8GA 2TCTA 2DLLA 2JHEA 1GV5A 4DYQA 2RQ4A 2UUCF 2X1EA 1TKZB 3QT5A 1VQ9S 5KFHA 4WKRA 5E18F 2EWHA 2FNPA 1IRZA 3G8TA 2NSCA 1SCJB 4ED8A 2V5HG 2MZSA 1NSKL 3PR5B 2VH7A 4UV9A 3GU0A 1AUDA 1G4DA 1HBOB 1CQNA 2F7VA 3EYZA 1FKAF 2WSFC 2QKLB 5KFSA 5EYRA 5AE1A 2MC3A 1NHAA 1T95A 3J81j 4Z2XA 3FX3A 2MLKA 3PW0A 4TQRA 5J4VA 4M9SA 4NA2A 3TBIA 3EDQB 4BLGA 4LSLA 3N0VA 4CIOA 3HOZJ 4BXFA 4XLPF 4EFAC 2PE8A 3SZPA 3MR2A 3PNYA 2KKHA 3T1YF 1FK9B 5KG3A 4CQ1A 3V8JA 2LU2A 2LVWA 4URSA 1H2VZ 4KGZB 2XGPA 5E3MA 2ZE2A 4DX6A 1G8XA 4V19K 4WFZA 2P6SA 1X1AA 2IVMA 1I6JA 2G2ZA 1R8AA 1GXTA 4NPOA 4A8SA 3ISNC 3MF5A 3CO7C 1G3SA 2H1KA 3S01A 2W4SA 2AJ0A 3BG9A 4JYKA 2HS3A 2BDPA 2CIMA 1IXRC 2UXCF 1IZ1A 1TUGB 2L3MA 2VOOA 2WOMB 1SQFA 3DLKB 4ZJLA 2KIMA 1N34F 1YRNA 1NDPA 3D3CJ 5K8PA 1S1WA 3ZMDA 2HYIB 4NDLA 4DZDA 4LIWA 1FRHA 1RESA 4HHUA 3PKMA 4KIGA 1OY8A 1NM2A 4YIRX 1Z2ZA 4CLLA 3ENWA 3MFKA 3QLHA 2MJUA 4HH1A 1WSRA 5FD1A 1PUEE 4C2MJ 3CCUS 2PEHA 3S14J 2Y1LB 3G1OA 2UU9J 4PG7A 2ELKA 3OTBA 4BE1A 3CMAS 3QPSA 3G8SA 2KN4A 2FE3A 2DN0A 3I59B 2E1MB 5L3GA 3PY8A 3BKFA 4M3GA 4RNOA 3J7YU 1RT5B 2KG1A 2NOGA 4R8UA 2WAQD 1U9NA 3C6TB 4RNNA 1W36C 4O4GA 3EDPA 3ILOA 2BR0A 3I71A 3EM1A 2FJWA 2GO8A 3WIVA 5C42A 3S1NJ 4K4TA 1H0HB 2JSCA 5T14A 4HVZA 2FLPA 2G9WA 1KLMB 1VC0A 4YN3B 2PMZD 1RU1A 1V6HA 1ETXA 5IV4A 5FKLA 4CICA 3MCMA 3FNNA 3G6VA 1RXOB 2DDAA 3DGPA 2DB1A 1J5EF 4QIWD 5GAHJ 3KYLA 3KIOA 3V4IA 3JRDA 1SB6A 4CLPA 4B9MA 2V1XA 4QWQA 4A3FJ 4CO3A 3NP5A 3KP7A 1JX4A 1YI2I 4JOMA 3HSFA 4R79A 3FCHA 5T7LA 3MQ0A 3M2RA 3IRWP 2H51B 1VIOA 3F8BA 1FLIA 2GVDA 3TWZA 4DR4J 2DD8S 1FOYA 2NXUA 2DFEA 2CNNB 4WU3A 1TL8A 4FX0A 1FWKA 2VA3A 2OQRA 2CRGA 4L9VA 2X4HA 5EWGA 1VFJA 4IKAA 5IPAA 3F9KA 3M8SA 1YJNI 3GZ7A 4F4WA 3H0DA 3CDEA 3HUGA 2X7IA 3OFEA 4CNZA 4DCOB 1D1AA 3MUMP 4DXLA 1U47A 4IQMA 3J81Z 1VQ7I 2XC9A 1AKHB 4N4NB 4MFEA 1HBMB 2ZH2A 3IFEA 5LSLA 2DK5A 3F8CA 5I3QA 3MEDA 4DSKA 2EB7A 2WB1D 2IC3B 3DOMB 4P9FA 3TAMB 1N78A 3VYUB 3VDXA 2DNKA 2SXLA 3VAIA 2PI5A 2MGQA 4KJIA 2P81A 5AXLA 4KHPJ 3T8TA 1OISA 4UB8C 5J2NB 2DTZA 1HLVA 2HKEA 4EV0A 4X65J 2Y1RI 3BZ6A 1BIBA 3VAKA 2N3LA 3RYLA 1GUUA 4CCJA 1VC6A 2KFYA 1B70B 2BXJA 5E3OA 1I5OB 2KB2A 1FY7A 4JK1X 3W5XA 3K89A 1S1VB 4QIGA 3PDNA 4HLBA 1UETA 4R5PA 2MKSA 2VPWB 3ZQGA 1R27B 4LBIA 3C18A 1ELOA 1YIOA 5KFMA 3RU0A 2AEJA 2ZKUA 3HTSB 1N36J 5J6XA 1HA1A 5D0EA 3LSJA 2H5JB 1VDHA 2H4YB 2QRRA 2FQ3A 5KT6A 2BJ9A 4BC9A 1WHYA 1Z4UA 3DKWA 3U2RA 4AVPA 2Y2ZA 1YVFA 2KTQA 1XIQA 4KPCA 2MSYA 3PO2J 3W60A 2QUFA 3ADAC 2M45A 4YQWA 3T19A 5KFZA 3OIOA 3BLYA 2IRFG 5F8MA 1HQUA 2Q3PA 3Q9VA 5IOLA 2K9LA 1M5VC 1W1WE 3IR5B 5CQEA 2FZKB 4DMZA 2B9YA 4DX7A 4GVLA 4HYEA 2R8IA 3SV4A 1RTIB 3K4NA 1EETA 4X0GA 1Z67A 2K27A 3NGUA 4KMUX 3KLVA 1I27A 3J80U 5EUHA 1M1EB 1TLHB 1CGPA 3THVA 4IR1A 1NK4A 3HZJA 4CYCB 1RTJB 1NJWA 3FHZA 2DNPA 2MD5A 1AHDP 4CCOA 5KCMA 2BUNA 1HCRA 3K5LA 4M5DB 2PGCA 3RYPA 1PAUB 2J8SA 3MR3A 3OR1B 4G6DA 2XSFA 3I0RB 3O1LA 1I94F 2WB4A 3EJMA 3LOUA 2DR6A 5HS7A 1DTQB 5B09A 4OYOA 4XDDA 2P5LC 3IO1A 4J9QA 3HK2A 2ASDA 4KSEB 3UDCA 4G1IA 1GVJA 4ZMMA 4J00A 1ZGAA 5ETOA 4ILRA 4PR6A 2LSOA 2JEIA 1HPZB 1XERA 3HHHA 1GMWA 2WWYA 4AL6A 3QYEA 1N34J 2XMMA 3GEZA 8AT1B 3J7AN 1V3ZA 2KRHA 4MEXF 1SMYF 2EKYA 2HFUA 5FKKA 4XDCA 4BS2A 2XMJA 1OR7C 2HZVA 2R9LA 2X1DA 3IWFA 3MCSA 1WHUA 1N56A 5F8JA 1JGSA 2XRNA 2EA4A 1FJLA 1MBJA 1EP4A 2BJ8A 2GAHC 4HEA9 2BY0A 3NOGA 2ZXWH 4N76A 4KA4A 3C7JA 1U6ZA 1N5VA 1S9EB 3W64A 5M5XJ 4DLGA 4M6XA 5FJ8J 2ZHBA 1RZMA 4HQMA 1WF1A 3G4SS 4DUZJ 1LW0B 2D1HA 3OFFA 3VWSA 1D3WA 3DLLQ 4FN5A 2CQGA 2XZWA 4IOAF 2V69A 2P6TA 1P4WA 2E2JJ 2KRRA 3W6VA 3AOAA 1QTNB 3H2UB 2RILA 1UVKA 3CCLI 2W7NA 1Z6RA 1YHQS 1WCMJ 3QGPA 2ERRA 3O5TB 3NAIA 1E6YB 1TL3B 2H6CA 4Y6IA 1GT0C 1R7IA 2JEFA 3ML6A 1L3LA 4BS9A 1MU2B 2F4OB 2MYFA 4B02A 2AV5A 4HACA 3N9UC 4M3DA 4HPQA 3AD8C 1OS5A 1WH7A 3S2WA 3EE3A 3ELHA 4MNUA 4O6JA 1SV5A 1OQYA 1MBHA 2RSQA 4NMXA 3A13A 5DD4A 1L3TA 4IHSA 4PXEA 1TL3A 3BG5A 3O6QA 2YNGA 3LSKA 2W1BA 3CP2A 5D4NA 1C1CA 1U5TA 2VC1A 5ETSA 2BHYA 1BHNA 3NCPA 2DK2A 2UZAA 3H4DA 1FOXA 3UN2A 2DR9A 4PJLA 1I6HJ 3CC4I 4ZVEA 1N8RT 3RAMA 2Z33A 3AOBA 5AJ3F 4LB6B 4GCVA 1T9TA 2MZJA 3H20A 3A3OB 1XBWA 2BY1A 1FFWB 1JHFA 1ORKA 2LLZA 4M5MA 1N5YA 3MFHA 1WZ2A 5D3GB 1JNZB 3A1YA 2K40A 5ICEA 2N82B 4DQPA 1EH8A 3C2BA 1SAUA 4HV5A 2OJED 2A6MA 3PX6A 2VJJA 5D8KB 3ZCOA 2O7OA 4ECTA 5L3FA 4LF1A 4QBUA 2EJRA 4BYYA 4OLPA 2HK3A 1NK7A 4U67Q 2B4PA 2DT7B 3H25A 2KG0A 5HVHA 5K9FA 3CJRB 4OZ2A 3LGNA 4D1QA 5B0BA 2DY1A 1KQSR 3V7SA 4FF3A 3EPIA 2DISA 3VB2A 3ENAA 4TU9A 1VQLS 1F9EB 2JEGA 1S4FA 3IN5A 1J5OB 4YR3A 3CCQS 4OYXA 4CO0A 2M9KA 5FD5A 3B82A 5DQIA 1L3UA 1RT3A 3T1HF 2RDDA 3KLEB 2KHCA 4PG4A 2RGVA 4HHHA 1K6OA 2TDXA 1KDNA 1FT9A 5B7WA 1ULYA 3KYDB 1NPRA 4MGRA 2DCEA 2XLJA 4BGDA 3Q22A 3ZMSA 4OL8A 4NA1A 1IC8A 3WU2C 5E8GA 2ZCWA 4ITVA 2V26A 1CPZA 3EZUA 4QU7A 1S79A 4DV5F 1ZOTA 3O8WA 3I9V9 1EETB 1VK3A 4YDXA 5FJ4A 4WJBA 5F0CA 2EVZA 1A04A 3ZQFA 2M4GA 3G2XA 3BKTA 1J2XA 3OOPA 4B3TJ 2G2YA 4G8XA 3I3LA 4X4RA 4DLEA 3W63A 5EX3A 4LF7F 1VQ4S 1OCRH 4OMZA 3HHLC 3Q0VA 5F27A 1VQMI 4Q0BA 3VF0B 4I98B 3PFEA 4WFXA 1SJ4P 3VR1A 1HNWJ 2P4WA 4NEYA 2ZH6A 2E2HJ 2KT0A 4U0YA 3ENQA 5LMUJ 2WRMA 4FVMA 4FVCA 1JKOC 4G12A 4DN0A 2DRAA 3CO9A 1SH3A 1CEZA 4N41A 4IRDA 2EWNA 2R4GA 2MKKA 1I94J 5J40A 1GV2A 4L0YB 2XM3A 1S3JA 1ZAWA 2IBKA 2NQPA 4ZVGA 3GMGA 1WG1A 5KT5A 3OL9A 4EEYA 3BZKA 4WCGA 5LSOA 1L3KA 3BY6A 1N33F 1EJ7L 1TQMA 3AKZA 3DP7A 1PYTA 5D4LA 3HZGA 4IO1A 4DR7F 5D15A 1IBLJ 1MNDA 2HS0A 4TN2A 3WTVC 1F1BB 3JYTB 1RGVA 1VQ8I 2ZFWA 4RUBA 3OR1C 3LFKA 4J9RA 4P2FA 3ET6B 1FRMA 1Y1WJ 2ZNYA 4OQJA 2QSGX 1IUYA 3HEFA 1ZRDA 1RAAB 1R89A 1NH7A 3IG1A 4B3OB 3BSOA 5DM6Q 5TGTA 3UDVA 1N54B 4X65F 1NJXA 2X1GA 2CW8A 1M1GA 1SC1B 3FMSA 4FTHA 2IS4A 2JMWA 2EPFA 4JV2A 1F6TA 3BR3A 3ZXWA 3TANA 3L2UA 3JS9A 1D1UA 4B09A 2AQ4A 2FX0A 1BI0A 2LKSA 4L5EA 3KHGA 3OXLA 5KFFA 1VHFA 2DU9A 2CQ1A 4LSLB 2EFOA 1WVRA 4K8RA 3TAPA 3A8JA 4RW9B