2VONA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auaauuu
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
187
structure length
187
Chain Sequence
DNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords LUPUS LA PROTEIN
total genus 56
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vonA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vonA02
1FYKA 1B9NA 2BE5F 2QQBA 4BHPA 1O0PA 2D9PA 5CVUA 1S29A 1WHWA 4KIBA 1OPIA 2LEAA 3O2PE 4HX7A 2J5PA 2EV5A 2K4JA 3S6EA 1X5SA 5GADU 4MGRA 2DNRA 3IRRA 2ISZA 1JXSA 5LGUA 1AUDA 5HDGA 3HYIA 4HV6A 3I5UA 2X1AA 2QA4S 4CZZA 2KRBA 3K69A 2UXXA 2M9KA 2MJNA 1SXLA 2M8HA 4WIIA 5EN1A 1TBXA 4WFBQ 2CO5A 1LDKB 2FE3A 1ZYRF 2KI2A 1M5VC 4IPAA 2A3SA 1KYWA 2E44A 3G8TA 1YWXA 3IWZA 4KNYA 1P4XA 5DM7Q 2CQ0A 2TDXA 3GF2A 4WXHA 1Y0UA 2EK6A 2V1UA 2WV0A 2LA6A 5DCFA 5DDRC 4H0EA 1WQ2A 2Q0OA 2KXNB 1G3TA 1DP7P 2DO0A 2ELHA 1A04A 4UVAA 3DV8A 1B59A 2FMYA 4U0YA 4FX4A 1J9IA 3CCLS 2XB2D 3V8LA 3IL2A 1FNNA 4S05A 1N52B 1S7AA 2MQOA 3ROUA 3MZYA 3DLLQ 4A5MA 5LSOA 3GFIA 3HI9A 4ETSA 2H6CA 1ZARA 2GIVA 2A61A 1IUYA 3DF8A 3EETA 4V19X 3I0TA 4MEXF 1YW8A 4HOBA 1BOAA 2O8XA 4FT8A 2CPEA 1XGNA 1DZ5A 2QWWA 3GZ5A 1YFHA 1G6NA 4BAYA 1J59A 2A07F 2X0LA 3J80K 2FNPA 3ZMUA 5LEKA 2OTLS 1K7AA 3GX4X 3CUQB 1ON1A 3LAJA 3O3KA 2PFBA 4U7BA 1UHWA 2QQAA 1YJNS 2A69F 1HW2A 1QZYA 2M87A 3IKTA 1X4HA 4MTEA 2A68F 1FJEB 4I2OA 3CCVS 4MHGA 1QBJA 3LA7A 5CVJA 2E5GA 1NJIT 1P6RA 2DGSA 1MZBA 4Q48A 1R1TA 2HGLA 2HGMA 3P7NA 2CWEA 4ENNA 1OR7A 3DEUA 2AS5F 3HOSA 2MQLA 2STTA 1DPUA 2A3JA 5DDQC 1N54B 2LKZA 4JQFA 4ED5A 3M9AA 2MQMA 1X4AA 1T98A 4M72A 2KU7A 2L08A 4IXAA 3ABTA 3TO6A 2N7CA 3US5A 3MQ0A 2DHAA 3OV8A 3FF5A 2O6GE 5DUIA 2J0QD 2FY1A 3KEOA 2CSOA 1O3QA 1T39A 1DHMA 4WFAQ 2NAZA 5DCMB 3SHFA 2J8AA 4OIQF 4CQ1A 2AD9A 1WI9A 2EB7A 2XNQA 1WHVA 1GXQA 3L9FA 4A2UA 4ENJA 2G4BA 2AYBA 3SDEB 4Q5SF 1BN5A 1I1GA 1SJFA 3I55S 2DGUA 2GXGA 1FJ7A 2QEXS 3F72A 3L00A 1PP7U 3KP6A 5LHGA 2HVZA 2NNYA 1HBXG 5CYJA 2CQBA 3W6KB 4G7HF 4L9VA 4KA4A 1U6BA 4OMYA 1WEYA 3GZ6A 5D6FA 1SJ4P 3B4DA 3E6MA 3HRSA 4C0OC 4U0VA 2KIMA 4E70A 1ZG5A 2DNNA 1BBYA 2MC3A 5FD6A 5CVVA 2DGQA 3F3XA 2DNQA 3SQNA 4D0PA 3E3VA 2LMIA 1X3UA 3I59B 3CCRS 5E20A 4O6JA 1H0MA 2U1AA 2FBHA 4Y0FA 1PO6A 4CGZA 2D3OR 3W6JB 5F1RA 3MXHP 2QVOA 2MH2A 4BHBA 1YYVA 3CXCR 2HYIB 3MZHA 1H6KX 2MLKA 4OZ1A 4WK8F 3WTUC 2EA4A 5IT3A 1FY7A 2RNEA 5H6RA 3RI4A 1CVJA 3MFKA 2HWVA 2FU4A 5D8LB 2DQRA 2RVJA 4W92B 2F9JA 4RB2C 2EFWA 1FBUA 3LAPA 4CO8A 2K4BA 4RB3C 5TJJA 5AIQA 4W90B 2K8GA 4ERDA 4HDUA 1WEXA 1GXPA 3TP2A 5HOOA 5D5VB 5E17F 1FZPB 2WBRA 3CPWR 1VQ8S 1E2XA 1MJ9A 2ADBA 1KOOA 1YLFA 1LDDA 4AIKA 5ERIA 3D2WA 5JR3A 1K8AT 1TQIA 3QU3A 1A9NB 1X4BA 3S2WA 3LQVA 1IZ1A 2DLLA 3TYTA 2EV0A 2JT1A 3F6OA 3RYPA 3ZN0A 1R58A 3EYIA 3IC7A 1XSVA 3V8JA 2AYGA 1X4EA 1T0FA 5L3EA 2MZSA 2VN2A 4MQ9F 3LFKA 2RV8A 3NQOA 2B0GA 1FT9A 4LMYA 2BEOA 3BWGA 4M9ZA 3FX3A 5LLQA 2NS0A 3BS9A 3KLNA 4XLPF 2KIUA 3RW6A 2QZ8A 4EQQA 1D9AA 5E1ZB 1A7GE 2V94A 2RT3A 4L9JA 4RAYA 3FEXB 1R5GA 3CD6S 2KVIA 4G9YA 1LEAA 5ICEA 3ERED 1KOHA 4WFNQ 3CMAS 3BJAA 2IP2A 1URNA 2K02A 3D0SA 5JHUA 4ESJA 1WG1A 1I27A 2X1GA 3UWTA 1YIJS 1SJ3P 1B9MA 3O6BB 1KD1T 1VC6A 2MH9A 5JFRA 3SMZA 2VT3A 4DQ2A 1ZG1A 2RC4A 3R27A 2EFOA 2V9VA 2JX2A 1M5PC 1ZRCA 3SDEA 2FHOB 4ESBA 4RGUA 2L9WA 2KG1A 5FJ4A 2IA1A 2QYOA 2VBZA 2J0SD 4HDVA 2QBYB 1JJHA 2VE9A 4I0AA 1WF2A 2VC1A 1KU9A 2LXUA 1DRZA 1SMYF 4AVPA 1Z05A 3WU1B 1U6GA 4LFUA 4HQEA 3VAGA 2HQNA 3NEUA 2HQRA 2ESHA 4RGXA 3TOAA 2DNGA 2DNHA 3G73A 2WC2A 2FNAA 4PGGA 2PE8A 3WGIA 4LG0A 1CF7B 2ERRA 1HD0A 3THTA 3N4MA 3MOJB 4L0YB 3CO6C 2VODA 1W7PA 3H2VE 4TU9A 2F5DA 2K7LA 3WTTC 4L9TA 1FOKA 1GVJA 4YIFA 1FWZA 3I54A 3RDIA 1ZAOA 3CTRA 3P49B 5GAGU 1SFUA 4ENMA 1Z91A 2LXIA 1SAXA 1K9MT 3FM5A 1ZN2A 2RN7A 2XAGA 1H2VZ 2DIVA 1IW7F 3P5TL 4FXWA 4OU0A 1V4RA 2VOOA 2RVCA 3UD4P 1TQMA 1SJQA 1PUEE 1SD7A 5FFZA 1UAWA 4WWCA 2YSRA 2YWKA 3MDFA 4EV0A 2IPQX 1G3YA 5HL7Q 2GQQA 2CYYA 2YPRA 1YO5C 1DPRA 2DT5A 1P2FA 3FMSA 3LSTA 5CYVA 2NZ4A 3K2ZA 3NNHA 4A6DA 1U8RA 1T38A 4XLNF 3RW7A 4PKDB 3UD3P 3P9CA 4M74A 4HV5A 2EK1A 4QWQA 4I09A 2GXBA 1BIBA 2ZJRQ 3R61A 3MD3A 1BI2A 3GFLA 3RJPA 2F2EA 3B73A 2MZJA 4YFKF 2NRAC 4G7ZF 2RS8A 2EFPA 1BI0A 1LB2A 1LJ9A 3CTAA 1GHCA 3VALA 4IRGA 3WE2A 2EV6A 4KFCA 2QLZA 2GA1A 1U1KA 5DCMA 4EMSA 2MKCA 3CCES 2M88A 5HO4A 3QOPA 4CICA 2E5HA 4BXUA 4IO9Q 4UV8A 3KEQA 4KN4X 3MUMP 3VOEA 3G6ES 2K27A 4P96A 2CQ2A 4ON0A 4PZJA 5H1SV 2I38A 3G4SS 2MJUA 1U6FA 3H2UB 1Q7YT 4QU7A 3REOA 4EM0B 2ZMEA 1UCRA 4ASNA 5DM6Q 3RKWA 3D5LA 4HX4A 1QNTA 4ZYDA 4YFXF 3KP2A 1U2FA 1R23A 3MD1A 2DTRA 2DNKA 3LQQA 1X5PA 3F23A 1R8HA 3RPUA 1LQ1A 2BBYA 1YI2S 4MQVA 2FPHX 5F6FA 3KP7A 4ENKA 2DNOA 3MEXA 2EWNA 2KHCA 2MZRA 2DHGA 1IXSB 2HDCA 3U1MA 4ESFA 3ZZZA 2DW4A 2DNMA 3I4PA 2MLGA 1U1RA 2H27A 4UXNA 4WCGA 1ZLJA 2DPDA 2V79A 2XAFA 2M52A 4RU2A 2JTVA 2W85A 2LCWA 4P6QA 1EH8A 1BI3A 3Q9VA 1V3FA 2L3DA 2OSQA 1Z6RA 2NLWA 3MUVP 2GWRA 1JJ2R 3L2CA 1C0WA 3CC7S 2XS5A 5ED4A 5IQQA 2Y75A 3WODF 2HKXA 4Z2YA 1F5TA 3R0JA 1S6LA 2KM8B 2O03A 3BPVA 2BGCA 3R1HA 1J2XA 1ZG3A 2MXYA 2FRHA 1MDMB 4Y13A 1FPQA 2HGCA 5DUKA 1JHFA 1R1VA 3HRTA 1IRFA 2VXZA 1U3EM 5ILSA 5GAHU 1N8RT 1FP1D 3MWMA 2DGTA 2VONA 3KFWX 3JAMZ 1SJRA 2RQ4A 3WTSC 1FX7A 3OW2R 3MAJA 2Q8KA 1FBQA 4ZYGA 4LK0F 2X1BA 5FFXA 4GO1A 3TKYA 2IA0A 1J5YA 4G94A 2AXLA 1KC8T 1IN5A 1IXCA 3P9KA 1SMTA 1IRGA 2BYVE 6PAXA 2O3DA 4QLCU 3FZVA 4OIOF 2CQGA 2P6TA 2XAJA 1UP1A 3CUOA 3FHZA 4UNOA 3BY6A 3FXRA 4LJMA 1B1BA 1BI1A 2MBFA 3WGGA 3VAIA 1X4CA 4B8XA 2W57A 1VC0A 2VE8A 3KCCA 1XCBA 3L7WA 1U1NA 4YG2F 5CVRA 1OMIA 4R8HA 2YH0A 1IF1A 5HLHA 1B7FA 2QUFA 2QENA 2RDPA 4WKRA 2DB1A 4AWXB 2I2YA 2EFNA 1WG4A 2MD5A 2V1DA 1OYWA 3NS6A 3F8NA 1PDNC 2A5YB 5ICCA 1HQCA 1HKQA 2MMYA 2FA5A 1IN6A 2HR3A 1KQ0A 3J80Z 1S7OA 4CH1A 4LB6B 3M8EA 3COAC 5L3CA 2QM3A 5ILVA 2ETHA 3TDUC 3E5QA 4A8XA 4IRHA 3DXJF 1VBZA 3ZQ7A 3WTXC 3SXLA 2CQIA 3BEGB 2OTJS 4F02A 5HS9A 1EH7A 1QO0D 4LK1F 4PCQA 3DKWA 4HLYA 3J7ZT 2BOPA 1VQ6S 1IN8A 5D5UB 1XSDA 2M70A 2DH7A 1H9GA 3ULHA 3BO2A 2MZ1A 5LBQA 4G8XA 2KN4A 2ISYA 4JK1X 1L3LA 2FC8A 3E5XA 1R36A 4Y15A 3GO5A 1VQ5S 5L3BA 2V6CA 3H3UA 2GAUA 2W25A 3CUNA 1AWCA 5BOXA 4Q4ZF 2CPZA 1D5VA 2RQPA 1STZA 3I56S 3CF5Q 1U1OA 1ODDA 2OZUA 1VTNC 1Q81T 1FC3A 2ZNYA 2MY8A 1RUOA 1HD1A 4N0BA 1MJBA 2KRFA 4LGWA 3QU6A 1W4MA 3VAHA 2PEHA 1XGSA 2L01A 1VQOS 1JHHA 4NQWA 2KH9A 3Q2TC 3BPXA 1RI7A 1H2UX 2LSOA 3QP5A 4KN7X 4PDKA 2OSRA 2XSFA 2KFYA 1S72S 4NB5A 2CQCA 4HW0A 2CFXA 3C7JA 3WGHA 3EGZA 5K5OA 4IVNA 2KIFA 4F25A 2JRSA 2O0YA 1KGSA 3R60A 2LKPA 4DNCA 3GW2A 3NRVA 3KLOA 3GFJA 1KA8A 1FO1A 2K86A 5E1WA 4P55A 1RKJA 3ML6A 3F8FA 3KP3A 4MNUA 1P4AA 2CGPA 4Y17A 4WXDA 4OIRF 1J7KA 1OO0B 5CA5A 2CG4A 2C6YA 3KE2A 4XSZF 1MJAA 4M6YA 4LLLA 1VQ7S 1BJAA 4KIGA 3N97A 3BZ6A 1XN7A 1KU2A 2Q2EA 3LA3A 4MEYF 3JSOA 3MURP 2DK2A 3G8SA 2J76E 2KXFA 4FX0A 1TNSA 4ZZDA 1WI6A 4KIFA 5AIPA 3ZMSA 1P92A 1ZZFA 1RIOH 3P3DA 4PRFA 4ZH4F 4YB1P 2D1HA 1MKMA 2DNYA 1FP2A 3ZMVA 5LGTA 4OOIA 1WHXA 4KYWA 2N3OA 1VQPS 1WTBA 2GA2A 4JBAA 2M8DB 4A0YA 1HKSA 4FXVA 1D8JA 2KT5A 3QAHA 1ZRFA 2H94A 3M7GA 1WF1A 2ZXJA 2MY7A 4A12A 2CJKA 2P5VA 4G7OF 5D4RA 1BC8C 5DDOC 3CCJS 2KM8C 3BO3A 1U1MA 4UVCA 4AIHA 3EYYA 1FSHA 2VOPA 1MGTA 1XMKA 1K78A 4U0WA 2E5IA 1TQPA 1XN9A 4F7ZA 4G6QA 1O3TA 2UXNA 4WXCA 2HZCA 2DK5A 2ESNA 1ZHFA 2LNBA 3JB9k 4ZYEA 1LDJA 1SD6A 4I0BA 4HF1A 2DGWA 1ONVA 1XDUA 2HTJA 1KU3A 2PBIA 3I59A 1ZGAA 3F6VA 3S7RA 3IWNC 2DFIA 1RZ4A 3QPTA 2XVCA 5K5RA 1YITS 4LJZF 4RAZA 2Y0MA 3IRQA 1N88A 2W24A 2IVMA 5L3DA 3VAJA 1X5TA 1HXDA 1TW2A 4LB5A 4BYYA 1M5OC 2JZYA 1D8ZA 1NO8A 2N82B 4RGRA 1OWXA 2DAOA 4IHTA 2ZJQQ 3ZN1A 1SFEA 5JVGQ 4EGYA 4IUFA 4NHJA 1UB9A 2OU2A 3L3CA 3PQKA 2JPBA 3DXBA 4BHCA 1HSJA 3M1EA 4WCEQ 4S04A 4QPTA 2MZTA 2EK5A 2P5KA 1FYLA 1I1SA 2DGOA 3K0JA 2HFHA 4I98B 3AAFA 1RNLA 5DEQA 5IM0A 5A2QZ 1LVAA 3TO8A 1FNXH 1ON2A 3B02A 2XS2A 5ILUA 2ZO4A 3VAKA 3C18A 4LG0B 1JMTA 3HHGA 3PFIA 2ADCA 4KUMA 1W7PB 3Q2SC 1WELA 2AYEA 3HIFA 3KZZA 1UW4A 1F9FA 2XHKA 1YJ9S 3OOPA 4GXOA 2ZCWA 3VEPA 4R79A 5FGMA 4LLNA 5HVQC 1HW1A 2R7FA 4IF4A 3RYRA 2CPFA 5D5WB 4OMZA 5L3FA 2IA2A 1YQAA 3C3WA 2DHSA 3V7SA 2IRFG 2M30A 3WE3A 4C7QA 4UV9A 4GGGA 1WKMA 5BMZA 2E5JA 3R0AA 2E1NA 1USSA 3TO7A 2RS2A 5TRDA 3VAMA 2MA3A 5LXRA 1R7JA 1IN4A 4F26A 2MKSA 1OKRA 2PI0A 3JSPA 2DNLA 2L54A 1O57A 4RGSA 2OIHA 3CUQC 2YX4A 1Q1HA 1NU4A 4L5IA 5IFMA 5KK1A 1U2WA 1HA1A 2FOKA 5LHIA 2A6EF 2HYFA 2ZBKA 3FM3A 4U7DA 2D45A 2UZKA 3J81Z 1Z9CA 2Y48A 4N9IA 1WHYA 3HUGA 2COMA 4KICA 1YW9A 3GFMA 2CPXA 2DHXA 2XS7A 2MB0B 5ICFA 1YS6A 5D8KB 5BS6A 1F4KA 2KRRA 1PP8F 2GHPA 1FYMA 1ULYA 4L18B 4QU6A 1ZREA 3LWFA 5E18F 3G9CA 5IT9Z 1WSUA 4EJWA 1P4WA 4RB0A 4BNCA 3I53A 2CW0F 1BM9A 5BJRA 2JRTA 4N9HA 3PQJA 1EH6A 4A6EA 5K5QA 2DH9A 4L0ZB 3I58A 1D3YA 3SZTA 1L3KA 2X1FA 4CDGA 2MKHA 4J5OA 3SZPA 4KDPA 2O3FA 5DDPC 3GWZA 4HAMA 5IT9K 1TTYA 2CQHA 3U1LA 2PN6A 3IRWP 4GCVA 5FLXK 3CCMS 3CLOA 4XSXF 4KT5C 1W2BR 1R00A 2L02A 2G1DA 1XCVA 1Z1DA 2FBKA 3T8RA 2RGVA 3EQLF 2IT0A 2UWMA 2QBYA 2DITA 4LIRA 2DGXA 4IJAA 2XRNA 3CJNA 5E1XA 4B09A 2DIUA 3GYHX 3U2RA 1CF7A 1Q82T 1S79A 1XGMA 1UHMA 5J8FA 2N3LA 2DGVA 2KKOA 5EEHA 1E17A 2OQGA 1FJCA 1OYIA 1X5OA 3ZMDA 2XV4S 1DBDA 1TW3A 1U5TB 3F8BA 4ZZLA 2MKKA 3RIRA 3VB2A 2XNRA 1UFWA 1G3SA 2MHNA 3R6SA 3J7AO 3ELKA 3DP7A 5FB2A 4XRFA 3MI7X 3ZZYA 4HF0A 1DUXC 2OQRA 2P4WA 2MKJA 1FBSA 3CC4S 1Z7UA 3V7RA 3HTSB 1FT8A 3BO4A 1WG5A 1L0OC 5EEGA 1G2EA 2FSWA 5LJ3Y 4WF9Q 3I71A 3WG9A 1I6XA 3DQVC 1U78A 2DH8A 1QVFR 2KYXA 1HL6A 2FF4A 1BIAA 2CPHA 2HZTA 1X0FA 4QQBA 3EX7B 2LF7A 2XAQA 3T1BA 1O7FA 4LLGF 4I02A 5JI6A 1SD5A 1QPMA 5L3GA 1CGPA 2MGZA 2A6HF 1RK8A 3BROA 3CC2S 1TLHB 3TDZC 1XDSA 3V8KA 4FHTA 3ZMZA 5J6XA 4YOEA 2HEOA 2P7CB 3WTWC 4M73A 2MYFA 4IRIA 2F5EA 2Z99A 5FD5A 2CPYA 4Z2XA 3IKVA 4UVBA 3CUQA 3RKXA 3SXYA 1X4FA 1ZH5A 2CPDA 3PIPQ 4UUVA 2OJ3A 1SD4A 4L5JA 4HLXA 2FXAA 2PMHA 3GXOA 3KETA 2G0CA 1Z6TA 1IXRC 1USTA 4A0ZA 1VBYA 3WTZA 4TU7A 2RQCA 4CXFA 5LEJA 3PIOQ 1WWXA 3R4KA 4A0XA 2XGXA 2OZ6A 2CPJA 2Z3YA 2PLYA 3HRUA 1R8PA 3JW4A 5J8CA 3JAMK 2XKPA 1M90T 3NMRA 4C4WA 4EJVA 1U1QA 2M7SA 4AIJA 3FXUA 4HA8A 2M2BA 2XAHA 3KP4A 5JVHQ 5CLSA 2M8EA 4U88A 3MCZA 2OA4A 4O3MA 2M45A 1K78B 4OIPF 3CO7C 1S8NA 2DO7A 2HTSA 1OYYA 2QQ9A 1M5KC 2PJPA 3BJOA 1ZGJA 2ZJ2A 2QFJA 3E5UA 2HOEA 3GLXA 4O5VA 3V4MA 5HLGA 3V4GA 4HYEA 4HZFA 4ZKAA 2MSTA 2L4AA 2M1BA 2GZWA 3UCUP 2CQKA 1VQNS 2DNZA 1WF0A 2G7UA 3H3ZA 3U9GA 3DPLC 2AYMA 3S01A 3THPA 3U1DA 2OD5A 3RTRA 5DETA 2RU3A 1WI8A 1W5TA 2XROA 1P27B 1I5ZA 4HQMA 4YIIA 3FEYB 2W84A 1U5TA 3J7YU 2GO9A 2YX7A 1YW7A 1H9TA 3G96A 2DQLA 3HSFA 4KMUX 1BC7C 5DV5A 2MQQA 2BV6A 1HKTA 4LD5A 4BS2A 1WRJA 2ZMEB 4PR6A 4EGLA 5BPDA 2DU9A 3J81K 1G4DA 3SFZA 5A2QK 4CHUA 3K0LA 3BJ6A 2F3JA 2YKAA 1HSTA 5HS7A 3UE2A 3NNAA 2VBWA 2D1VA 1K6OA 2MGZB 3P9IA 1X4GA 2F9DA 3K1NA 2YU3A 3BDDA 2ZKZA 3VODA 4RS8A 3LPYA 5LJ5Y 3HHHA 4IHSA 3CCUS 2XUBA 5D5XB 2Z5UA 4P9UA 2JVOA 2FBIA 5LRRA 2LF8A 1HW5A 2P8TA 2M5WA 1OPCA 2ZFWA 2LYVA 3ZP5A 1YIOA 2DPUA 1K79A 3TGNA 1J0RA 5ICGA 5HDNA 5DYMA 4YUDA 5MLCV 4UY8T 2EA2A 3G71S 4K2EA 2FC9A 4M9SA 3WTVC 2NNNA 3ECHA 3M8FA 1D8KA 1JGSA 1S3JA 3FMRA 1XB4A 4IOAQ 3HSEA 3EGNA 3Q5FA 3CULA 3FMQA 2IW5A 2P7VB 3ECOA 2WTEA 2KJCA 2Q79A 3MUTP 3BP8A 2E7WA 4M9XA 1R5HA 3HTUA 1MD0A 2B0LA 5IM0B 3K9TA 1MDMA 2DO4A 1YTYA 3HHNB 3HSRA 3HOTA 5H6QA 3KZYA 4M71A 2LDUA 1O3RA 1Q86T 1KYZA 1WEZA 4G6DA 5AONA 1QGPA 2VC0A 1OIAA 4LMZA 1IAWA 1EV7A 2D2WA 3HRMA 1LNWA 2XIGA 1R1UA 5KVRA 2PEXA 3TQNA 1FSEA 3CCQS 3F21A 5JVTA 4UQTA 5ITHA 4EM2A 2JWNA 2CQ3A 1U1LA 2OAZA 2DNPA 1BY9A 4M5DB 2HKOA 2FQ3A 3IHUA 3E6CC 2MQNA 1KQSR 3LA2A 3T0YA 3VAFA 4XBFA 4IOCQ 3F8CA 1UFMA 3GEZA 2R3SA 4EGZA 2RNJA 4KMFA 2KXHA 1REPC 5CVIA 3QPHA 3NNCA 1TNTA 2STWA 5GMKa 2F5CA 3CMES 5D4SA 3BOQA 3P6YC 3ISPA 1QM9A 2KJBA 2H6BA 2PG4A 1YS7A 3H92A 4EJTA 3JTGA 2RRAA 4RB1A 2F5FA 2M0GB 1U5TC 2DBBA 2XKOA 5LHHA 2HS5A 4Q47A 1O3SA 4ZYHA 5DDGA 4P5OA 2MZQA 2L4MA 2MKIA 1W5SA 5HLIA 1AOYA 2X4HA 4YFNF 1VQ4S 2EFQA 5HDKA 5LGNA 2Z33A 1NHAA 3V7CA 1SFXA 1VC5A 4I01A 3L09A 2VT2A 3I64A 2UP1A 3S8SA 2J5OA 2V1XA 4BQAA 2JPCA 2H09A 3CCSS 2JVRA 4HBLA 3TO9A 1LEBA 1YJWS 2PMUA 3NS5A 2ZJPQ 3E6DA 2XASA 4TLQA 1F1ZA 1VQMS 2EJRA 2YR2A 2RRBA 2R7DA 5FLXZ 5D78A 4I7HA 1YG2A 2IJLA 4Y00A 3R1LA 2U2FA 5LRSA 1FHTA 2HYGD 5BQTA 1R22A 3VF0B 4UHTA 4U67Q 2RKHA 3ZPLA 2E7XA 2LECA 3JTHA 1T6SA 1G3WA 5E8GA 2CPIA 5CXTA 1ZZNA 1ZLKA 4MTDA 4P9FA 3T8TA 3FWEA 4L9NA 5H20A 4AD9A 3LQRA 1IN7A 4R1HA 4WF2A 2YTCA 3EDPA 3RKYA 1J75A 2ADUA 3K1MA 1RUNA 1VQKS 3N9UC 2LEBA 2LQ5A 2RUGA 1VQLS 3K1PA 3WTYC 3UCGA 4GYIA 2DK8A 5CJ9A 5LXYA 3UCZP 2D9OA 1IQTA 3DFGA 3FXQA 2O61A 5D6EA 1H2TZ 1JE8A 5GVQA 4OZ0A 2L41A 2M4MA 1XGOA 3KP5A 2NYXA 1T2KA 3B4MA 1JJ4A 5GAEU 5DD4A 1M1KT 1VBXA 3CDHA 2LA4A 2SXLA 3QP6A 2MSSA 1P1TA 2P6SA 2CQ4A 1X4DA 3RPQA 1QQIA 3VFZA 4CIOA 5DD8A 2BZ2A 2Z9OA 2ACJA 1B4AA 2HGNA 1W7PD 3ABUA 4EM1A 4PGHA 3E6BA 2DISA 4TV7A 5E8IA 1QZZA 4TU8A 5K1YA 1VQ9S 2CQPA 3TOBA 3C1DA 2KG0A 4CH0S 2CQDA 2PQ8A 2K3KA 5BPIA 2P5LC 1WWHA 1XD7A 3ZMTA 2OBPA 1XSXA 1KQ8A 1B6AA 1XMAA 5D77A 2FMLA 3DPTA 5FO5A 2EVZA 3G3ZA 4CYDA 3GVAA 3WU0A 2CQ1A 1FXLA 4BH9A 1DDNA 1QVGR 3GUDA 3ULQB 3E97A 4EVIA 4A5NA 1U1PA 5F64A 2WWYA 2JSCA 4M6XA 2VBXA 5HS8A 3QRFF 2VBYA 1KU7A 1FLIA 2DI3A 2G7HA 2YH1A 2FEZA 2G9WA 2ZNZA 4HX8A 3Q9SA 4EJOA 1K73T 4HF2A 2MPUA 1O7LA 1ZRDA 1PGZA 3T5XA 3F8MA 3IWFA 2MQPA 4WX9A 1YHQS 1KQ9A 2E1CA 1F9NA 3EUHA 4EJUA 3F22A 4OINF 5LSLA 4GYGA
chains in the Genus database with same CATH superfamily
2WVDA 2BE5F 2HDDA 4BHPA 1S29A 2YPYA 2ZVIA 1WHWA 2HHVA 3QT5A 2K7JA 3JAMY 2HVIA 4QW8A 2K4JA 4LVNP 3OTDA 4W98A 4HPQA 2I1RA 3RB3A 3R5DA 1PC5A 1Z77A 4ANCA 1V55H 2LP4A 1X5SA 4X4QA 4MGRA 3MZIA 1JXSA 4OAYA 5LGUA 5HDGA 3HYIA 3CJQB 3W3SA 3NP5A 2QA4S 2Z16A 1RKWA 3K69A 1SXLA 1EQMA 2M8HA 4O44A 4PQAA 4WIIA 1FD2A 4Q0BB 4WFBQ 1DP3A 2KI2A 2WTFA 1KTVA 2A3SA 3OYKA 2E44A 1YWXA 3IWZA 3HHKA 4K7QA 5DM7Q 4ZP9A 3GF2A 4J90A 2EK6A 3IP0A 2DR9A 1T9VA 2ABYA 3D0IE 4H0EA 1WQ2A 2KFNA 4MK9A 2KXNB 2Y0SD 1YLXA 3Q83A 3CIMA 1A04A 2YWGA 1NK2P 4U0YA 1Y0NA 2CWKA 2XB2D 2NYHA 4M5DA 1FNNA 1N52B 4L75A 2CQQA 3RG6A 2MQOA 3LSRA 3ROUA 3ZQQA 3CCJI 4OI4A 2A2CA 3FRYA 3GFIA 5LSOA 1U48A 3CCZA 4JI3F 1ZARA 3MTJA 5FKMA 4RW4A 4KV8B 1IUYA 2AHQA 3KG0A 4LFAJ 3DF8A 3O3LA 4V19X 4J9KA 4MEXF 3MMAA 1BJZA 1VQ9I 1EJ7L 2ZFUA 4FT8A 2LEPA 4URGA 4A3DJ 4X62J 2E60A 1G6NA 4BAYA 5KG4A 3R6LB 1OCPA 2JHEA 2OTLS 3H5UA 4XORA 2XGPA 1KNZA 4KH1B 3Q86A 3ENAA 3DYAA 5KFTA 1QZYA 4X66J 1X4HA 4C9YA 1MSEC 2HOTA 1PYOB 2F4VJ 4DPWA 1QBJA 4OJGA 3O8GA 5CVJA 2XMUA 4HYKA 3J7A1 1S7IA 1MZBA 2IJFA 1IJWC 4NE9C 2PO4A 2PMZA 3P7NA 1VI0A 1B99A 1H98A 3I5BA 2IAIA 4ENNA 1LW0A 3BBFA 4F7VA 2DXIA 3MMAB 2AS5F 3BR5A 3HOSA 4KE5A 2ZHAA 2QTWA 1ZK8A 3NGRA 2LKZA 2I5JA 2JA7J 4DWIA 4FKXA 1TL3A 3AD7C 3M9AA 1X4AA 2LBFB 2VASA 2IAJB 4M72A 2KU7A 2HNYA 2L08A 3CDIA 4IR9A 4XLFA 5HP1B 2VG5B 2OPQA 4USKA 3ABTA 4E7KA 3NAHA 4ITVA 3I32A 3OV8A 3FXMA 2XGEA 1VQOI 3POTA 3SHFA 1FK9B 1D1CA 3M8SA 4DR6J 4CQ1A 1WHVA 4RWXA 5D0HA 2G4BA 2YWEA 3UKGA 1PYTA 4Q5SF 5KOXA 3FC9A 3C6TB 2KKHA 3TBIA 3EZ5A 1YVFA 2AQEA 1LV5A 2NQPA 1HBXG 3AT1B 5CYJA 4HRIA 3A3OB 2AX1A 1GDTA 2VJVA 4OMYA 1WEYA 4FTHA 2GAHC 5EWGA 1SJ4P 3KK2B 3B6AA 4NX9A 3VTIA 3HRSA 2XO7A 3FIWA 2MTLA 2KIMA 4E70A 1ZG5A 2R8HA 2LU1A 1W1WE 2RHSB 2BE2B 1PJ7A 3EXCX 1V3SA 3PEJA 3KDOA 2LMIA 3I59B 3OTOF 5E20A 2JN6A 2HBRB 2HXIA 2H48B 4Y0FA 1VS3A 3AD9C 5T7LB 3W6JB 2M3AA 4NXMF 3QJLA 4ZOSA 2MH2A 2GJFA 4YB5A 3WX4A 4WK8F 4OHZA 5H6RA 3RI4A 3AQOA 3TMOA 1FRMA 4QZVB 4W92B 4RB2C 2POKA 4DR1F 3SFGA 1NRKA 3HSZA 2IM0A 4RB3C 2E1AA 1VHFA 4W90B 4NI2B 4DPOA 1GTEA 4ZPWR 1RSCA 1Y8QB 2VJ5A 5G4DA 3TUPA 4DYRA 4C3IJ 1UA0A 4RUBA 5E17F 4USMA 3BG9A 2WBRA 4NXNF 5CPRB 8RUCA 2H1YA 1CLFA 4CLSA 4ZJZA 3MM6B 4XRSG 4B3MF 2OUGA 5ERIA 3VGTA 5B7WA 3DPUA 2K3IA 2CU7A 2K7KA 3T9ZA 2Z2LA 4GRSA 5EWFA 2D74B 3F6OA 1N78A 2RV8A 2OHDA 2Q3PA 1FT9A 4Y4RA 2BX6A 3EUNA 4AL5A 2GIQA 4XLPF 4RUHA 3IXQA 5E1ZB 5C5JA 1OCOH 4ECQA 4A3FJ 1A7GE 3CGIA 5KAKA 1T0TV 2EI5A 2RT3A 4RAYA 2HVHA 2CDRB 3CD6S 4M5IA 1N5TA 2I0XA 2UV8A 1Q79A 1TUGB 3ERED 1VQ8I 1RR8C 4XK8C 2K9LA 1HMVA 3CMAS 2IP2A 1URNA 2BHYA 2K02A 1VF9A 1T7PA 3TRGA 4LSZB 1GMWA 4ESJA 1WG1A 2EBGA 4C2MA 2LQJA 1X1CA 1RP5A 3HM5A 1KLMB 3UWTA 1B9MA 1VC6A 2OFHX 4DQ2A 1JI8A 2RC4A 2K9MA 1S1TB 2OGUA 4HTIA 5KT7A 1DARA 3MPUB 2FHOB 4UY8I 2IA1A 3FBFA 4OYPA 2J0SD 2QBYB 1TR0A 2G13A 4TNOA 5BNGA 7AT1B 1U24A 5D0GA 3ZQLA 2LXUA 1SMYF 1Z05A 4AVPA 1YRUA 4KGKA 1X9SA 1HPZA 4ZDLA 3ILOA 4I6WA 3B6CA 4LBHA 3NEUA 2HQRA 3HC7A 4ZJOA 1DGRM 4AXIA 4CLZA 2DNGA 3HLUA 4MKAA 2PE8A 4CTAA 1HD0A 4JYAJ 2R7VA 1Y00A 4I69A 2P9GA 3K70C 3H2VE 1VRUB 1JKHB 3KJVB 2HI3A 4L9TA 1GVJA 4ZHRA 4OZJA 1FWZA 3W65A 3RDIA 3CTRA 4QJVA 4WP9A 1Z91A 1JLEA 2XCAA 4G6TB 4C11B 2JA2A 2JEGA 3BSOA 3FZ2A 3EPIA 3UDEA 3EUAA 2LK2A 3H3VK 5IV3A 5KT5A 1IW7F 3JRGA 5DJBA 4FXWA 4I2QB 3DBLB 9ATCB 1B3TA 5HROA 2E71A 3UD4P 2HBZB 4F2RA 4WBFA 1TQMA 3J81Y 3H7HB 1Y10A 2L9SA 3SSRA 2BKNA 5HI7A 4EV0A 2GQQA 3S1RJ 4XTTA 2ECBA 1YO5C 2NZ4A 4YHHF 3LSTA 3AY0A 4OX9J 3K2ZA 3QPLA 3NAUA 3RRGA 3UD3P 3P9CA 4M74A 1T05B 2R93J 3AOAA 2AJQA 3OTEA 2EK1A 1HBUB 5GADI 2ZBQA 1HBMA 3MD3A 4OL8A 1GMUA 2QX0A 2IGMA 2D3O1 1NNDA 3B73A 2LY9A 2IDEA 5GTHC 2NRAC 2XC7A 3OJUA 4OYAA 1BI0A 3CTAA 4DJAA 3ENVA 3D3CJ 3QATA 5A8WA 3VALA 1X4PA 4A3IJ 3VYRB 2H54B 4J9OA 2FOWA 1U1KA 1SVMA 1FRLA 4EMSA 3BGFA 4QIEA 2M88A 5HO4A 2WVEA 3IC1A 5CD4H 3MUMP 1ZETA 3S17J 5LM7E 2ILZA 2M4GA 1XERA 1QAYA 1LK7A 5H1SV 2MJUA 3H2UB 2I5JB 2ZWPA 1Q7YT 3OIQA 1K47A 2GVZB 1IBKJ 4ASNA 4C3LA 3D5LA 4QWDA 1SV5A 3RZDJ 3GCMA 5KFCA 3CW2C 4ZMMA 3KP2A 5E41A 2DTRA 2DNKA 2AJFE 1UFLA 1R8HA 5M2RA 3MMCB 1LQ1A 2BBYA 3KYDB 3U21A 4MQVA 2FHJA 3FK4A 3PFEA 1QUPA 5F6FA 4DDFA 4ENKA 1Y5NB 2C22A 1SEUA 2RF2A 3TOQA 4ESFA 1K44A 3I4PA 2NXNA 3FBBA 2JC1A 4NYOA 5AE3A 4WCGA 1ZLJA 2DEIA 2V79A 2JTVA 2W85A 2LCWA 1VGYA 1NB7A 4B9VA 1EH8A 1Y7PA 4AC0A 4JV0A 3TAMB 3PYGA 3I9V2 1FIPA 1SH0A 4B3SF 2R2UA 3BSCA 2NLWA 1IC8A 4OHYA 1JKRC 5DS9A 3BGRB 2V1NA 3Q0AA 2Z4PA 2HKXA 3K59A 1S6LA 2BGCA 1J09A 1K6YA 5C4XJ 5ETMA 3BH6B 1UG0A 5DUKA 1J5OB 3RYLA 2VXZA 3LA0A 3BTCA 3AD8C 4ES1A 5ILSA 1EKSA 4JOMA 2DN0A 4X4PA 4NNJA 2JVHA 3MWMA 2CW7A 1U0JA 1G6BA 4ZN1A 1ZBTA 3MEGA 1SH3A 2G2YA 2VONA 3FGVA 1SJRA 3LTOA 1RYSA 4BDYA 1DLOA 4KHPJ 1YBUA 1O6XA 2HQFA 4II3A 2B5JA 3MEEB 2GBYA 1FBQA 5B1BH 1KDNA 2H65B 2X1BA 5FFXA 5F0WA 4GO1A 3LNQA 3LSHA 3WC2A 2A5WA 3RR7A 2B8PA 1P7JA 5B09A 2CJAA 1E6YA 1KC8T 3T1YF 1IXCA 3P9KA 1IRGA 4JX6A 4K4SA 1K0VA 2QO3A 4CCHA 2MLXA 2X85A 4E4HA 3ZO7A 2CQGA 2FQ4A 2OPRA 4OYZA 3UDVA 3IH3A 5G0RA 4LJMA 1B1BA 1BI1A 4P2XA 1YX2A 1KVJA 3VAIA 2J6UA 4B8XA 4LF8F 2W57A 1VC0A 2VE8A 3KCCA 1XCBA 4YG2F 1T03B 3MMBA 1OMIA 1HNVB 5TISC 2H4WB 4YIRX 5HLHA 3F0CA 4MFBB 3QJPA 2JUGA 4XPCA 1B7FA 2QENA 5HAOA 4A8KA 4V19J 3M07A 3HG9A 1SV5B 5KFBA 2I2YA 1WG4A 3HBLA 1RU2A 2UU9F 1PDNC 1SJ1A 2HSEB 1X7VA 2HR3A 2CJXB 4USJC 3PCOB 2C2DA 2KHMA 2UZAA 5ILVA 1FJLA 1UVKA 3TDUC 4DR6F 2WSCC 4A8XA 4IRHA 1VBZA 3ZQ7A 4DZDA 2BBEA 1JKHA 3T1HF 2PFDA 1JQGA 1EH7A 1QO0D 1GQEA 4AIDA 1K1SA 4HNVA 4I6AA 2V9WA 3ZRGA 2BOPA 3MCSA 2DH7A 2BW2A 1H9GA 4XLEA 5LBQA 2PA8D 1MH3A 3M9NB 2KN4A 4J37A 4K8RA 2ISYA 4JK1X 1R31A 4B3SJ 1HPZB 2B7BB 3KMSA 2AV5A 3CF2A 4Y15A 5BR8F 4C0HA 1BQNB 5L3BA 2OTJI 5BXIA 5GMDA 2V6CA 3H3UA 4RAFA 2GAUA 2W25A 6FDRA 1CC7A 5BOXA 4DSIA 2CVIA 1HCRA 2CPZA 2AZ3A 3M32B 1Q81T 5F9NA 3HZEA 2HHHJ 4FBTA 4NLDA 2W1BA 3QU6A 3A01A 3GCXP 3F41A 4CT8A 1WD6A 3JSBA 4PDKA 3CCTA 4PG8A 1FTZA 1LUJB 4RMNA 2KFYA 1S72S 4K0KJ 3C7JA 3TL4X 3BN7A 4PPZA 1D1BA 3WGHA 2V8GA 2KJWA 2Q66A 2JRSA 2O0YA 2LKPA 4HEA2 1U6ZA 3GW2A 3IBCB 4USIA 3A4CA 2QSWA 2F7VA 4G65A 2DCUB 3CJKA 4OI2A 3F8FA 1ZTWA 1O4XA 1P4AA 2CGPA 1UL3A 1JTYA 4FF2A 3QO9B 4Y17A 4WXDA 2BJEA 4A8MP 1J7KA 4P72A 4ETZA 2IS1A 1OO0B 2C6YA 1N77A 4DQQA 1Q78A 5C44J 1ZELA 3KE2A 4M6YA 4LLLA 5K7HA 2QSGX 1Z2LA 4ZCMA 3CDAA 4G12A 2Q2EA 2NOGA 4MEYF 2Z58B 3ZR8X 1IKYB 3FKBA 5B5EC 1GXLA 4FX0A 2OPPA 2A0FB 3GG0A 4LRFA 4ZZDA 2PIIA 3G87A 2NXJA 3RB4A 3IAM2 3ZMSA 1P92A 1ZZFA 3AG3H 1RIOH 2QSFA 2QA4G 4YB1P 5HBMA 2TCTA 2D1HA 1M5HA 3ZMVA 5LGTA 4I64A 4EUVA 4ZIVA 2BY3A 3DBHB 3UO0A 3DBRB 4GVBA 4DPUA 3BQ2A 2Y0SN 4JBAA 1SH2A 3HPOA 2LTPA 1D8JA 4FXVA 2H5IB 4XR6A 4FYYB 3W66A 4ECWA 1CJTA 3DU6A 1XTZA 1VQLI 4NLQA 1BC8C 5DDOC 4LF9J 1WKKA 4BXFA 2KM8C 3OSPA 2VDIA 5IXUA 5KFFA 2N4DA 1FDBA 1E3HA 1ACIA 3PHTA 1JKQC 1RKIA 4DV5F 4JI1J 4B3TJ 1FSHA 1SANA 2VOPA 4XK4A 1OMSA 2W4DA 3G6VA 1FI4A 1RJJA 3UN5A 1YRNA 2HFNA 4F7ZA 1F6TA 4IH7A 2UXNA 1UVNA 2OV7A 4IL6C 1CS4A 3A12A 1LKZA 1YZ6A 4IDKA 2ESNA 5H9FJ 1X9WA 5K7FA 1ZHFA 1V9OA 3UDLA 4ZYEA 3PO3J 3DOLA 3HHDA 4D7MA 4JI2J 1TFWA 3I3LA 4A3CJ 2DGWA 4HF1A 1XDUA 3HKWA 1KU3A 2ZD1A 1TWCJ 1LXJA 1GH8A 2DFIA 1RZ4A 5K5RA 3GTKJ 3OL3A 4GMKA 4Q45A 2W24A 2IVMA 1X5TA 4RZRA 1RTJB 1D8ZA 3ZN1A 2HNZB 3DLEB 2FVRA 3S1QJ 1SFEA 4EGYA 2JPBA 1IUJA 3NAIA 4YS2A 4ZITA 1MMDA 1HSJA 4BHCA 1WC4A 1TVRB 3KK3A 4M3EA 2EK5A 1FYLA 2DGOA 3K0JA 4I98B 4BE1A 1KP6A 5IM0A 1TAUA 5A2QZ 3JS9A 3KYCB 5EZGA 2NUHA 3TO8A 1ON2A 1VIXA 4OYBA 1CSJA 2JNJA 1JMTA 4LG0B 2VA2A 3PFIA 4X4RA 3MAQA 1RACB 1Z7LA 1RAAB 4K2JA 2QLWA 2AYEA 4AQYF 3KZZA 5A2QU 4R79A 4KAIA 4LLNA 1R71A 1ERDA 2R7FA 3TW6A 4FS1A 2CPFA 2ZOFA 5D5WB 4DX7A 3C3WA 3ZZTA 1JLGA 2ASYA 1FTRA 4FQGA 3QYYA 2W8LA 4CCMA 2KRHA 4E7ZA 3TO7A 4M5NA 5IY5H 2UUCJ 2DA2A 2KDZA 4C98A 1R7JA 2KT0A 3LSMA 4LF2A 1AT1B 2PI0A 3JSPA 1KWMA 4KHPF 2DNLA 1O57A 4RGSA 4XICA 3ELHA 4JI2F 2BXYA 2P81A 4IH6A 1HA1A 4NXNJ 3FM3A 1FK9A 2R42A 1DU0A 3AXKA 4U7CA 2CQ7A 1VMBA 1RT7A 4N9IA 5HSPA 5KG7A 2COMA 4B9MA 2CPXA 2FD2A 5CZXA 4CRJA 2IGKA 5BS6A 5J4YA 2IM3A 2YQ0A 4JI1F 4ECSA 3E2EA 1FYMA 1UCNA 4BKXA 4L18B 4K4YA 3OYNA 3GG1A 1JB0C 2B9WA 2NXCA 3NBPB 3M2VB 5IT9Z 3FDSA 4ZCIA 4AL7A 4DFPA 4BNCA 2JA8J 3I53A 2R7XA 3C3LA 1SIZA 4M5KA 1DQ8A 3N6MA 2ZZNA 1B72B 2ID3A 1TP7A 3UN3A 3A3PB 4A6EA 1NSPA 2AHOB 3W9IA 4LF7J 1R3NA 1L3KA 2C2KB 4HAMA 5IT9K 1XMOJ 2CQHA 4PXBA 3DYAB 1Z2ZA 3IS9A 2JWTA 4DL7A 3CCMS 5FLXK 4Y65A 4CI0B 2G1DA 2VQEF 5J3LA 4NEZA 3BDPA 2XBPA 4D1QA 2UWMA 4LIRA 3CMYA 4CNZA 1UA1A 3CJNA 1TV6A 5E1XA 1CJUA 2CV2A 3GYHX 1CF7A 1RLCL 1OQ3A 4DUZF 5J8FA 2RF2B 5F41A 2D5VA 4PWUA 2WB4A 5EEHA 5CYMA 3A1YG 1U5TB 2QMXA 4ZZLA 4L76A 2CQXA 1RKTA 3DLHA 3VB2A 3E01B 5LT5A 3RR8A 4K4UA 5M2UA 4NDLA 1CJKA 3M8RA 2YY3A 3AKZA 3ELKA 3DP7A 5FB2A 2E7VA 2HQIA 2BKOA 1R4NB 5KG0A 3ZZYA 1FBSA 3P5JA 5E3QA 4UT4A 2ZBRA 2DVIA 3F44A 1WG5A 3A02A 4OHWA 2FSWA 2B6AB 1D5YA 3I71A 2WSEC 5IT9U 2LKSA 1I6XA 2V4JC 1QVFR 1RU1A 3PM1A 4N41A 2CPHA 2KB2A 1X0FA 4QQBA 3G8QA 2XAQA 3BM7A 1O7FA 5FKOA 1S57A 1TL1B 4K4WA 2RIJA 3G1MA 4I02A 2LQ9A 4JI5F 4L74A 3CCEI 1TL7B 2O1PA 3C46A 3BROA 3DTKA 3MM9B 1CJUB 5J6XA 4OYOA 4ECUA 2P7CB 1F2HA 3SYZA 2E34A 4X66F 2Y8WA 1WOPA 1X8DA 4YN3B 4CM2A 4HH1A 4UVBA 1B8IA 3K5LA 3GFXA 1X4FA 1U09A 4YELA 2XY6A 1MMGA 5GAHJ 4IQMA 2FXAA 2YNGA 1OISA 3C19A 3GXOA 1NMEB 2MHEA 1Z6TA 4NCBA 4BS9A 3W63A 2Z2MA 4YEAA 2VQGA 3J7AY 1UMJA 2Z3YA 3HRUA 3JW4A 5J8CA 4C4WA 4NUBA 4EJVA 2M7SA 4AIJA 4JX4A 2O7OA 4LF6F 2JEJA 1U4BA 3KEYA 1OPZA 3S16J 3ESWB 3OUYA 3JRIA 2QL5B 1S8NA 2HTSA 4KO0A 3E0JB 1QAIA 2VPWB 3BJOA 3RGIA 3PYDA 4OJ1A 2KZGA 2QFJA 3E5UA 3C14B 2HOEA 1NJXA 2V2VA 1RTJA 4KIAA 3GLXA 5HLGA 5AJ3J 1GT0C 2YWFA 2BVMA 5K7ZA 4ZLNA 3Q24A 3AJ1A 3W5YA 2EPFA 1VQNS 2G7UA 3L1PA 3AODA 3DLGB 3U9GA 4UUSB 3ZZRA 3ISZA 3QQCD 3EPZA 2OD5A 5DETA 2XGQA 4BWJA 2RU3A 1WI8A 6FD1A 4YIIA 1MWZA 3HOZJ 3IWXA 2GO9A 4YY3F 1TWHJ 1LWEA 1HNIA 3HSFA 1R7IA 3PW5A 2MQQA 3UW1A 3KUGA 5D4NA 3NWTA 5C4JJ 3KOAA 3Q8RB 2ZMEB 3BR8A 3I0RB 4YDDB 3G4SI 1N5YB 1Y56A 3A1YA 3CD5A 2YKAA 5HS7A 5FJ8J 3UE2A 2VBWA 2D1VA 1K6OA 2MGZB 3OTBA 3MCNA 3P9IA 3I6PA 1X4GA 4HHJA 2R8KA 2YU3A 4HTJA 1FVSA 4M5JA 5LJ5Y 2ZEJA 1DTQB 1XPXA 4J9NA 4F55A 3R8YA 3G2BA 1C2PA 1WC6A 2JVOA 2LF8A 4ILLA 4ZTJA 2M5WA 2TRTA 2LYVA 3ZP5A 2V26A 2OMLA 4P74A 1K79A 3TGNA 3QIPB 2J8SA 5DYMA 2JSXA 1XMQJ 4UY8T 2QGUA 2HAFA 3TX8A 1XR5A 3RB0A 3H20A 2JK3A 4F4WA 3WTVC 3ECHA 3M8FA 2CNNB 2HK2A 3P5BP 1JGSA 1S3JA 3U1KA 3HSEA 3CCUI 4PYDA 1HOMA 2R7SA 2KJCA 3HULA 3MUTP 3BP8A 2E7WA 4M9XA 1R5HA 2H8RA 2ZDPA 1MD0A 5D6GA 1MW7A 1NXIA 4JV2A 3DKXA 4X64J 2B0LA 1JTXA 1BQXA 1HWLA 2XZTB 3D68A 3T6JA 3K9TA 1YTYA 3N5FA 3OR2B 3HSRA 3M6XA 4AFFA 3G6EI 3K4NA 4RL1A 2LDUA 4DR3J 3GB0A 1Q86T 4G6DA 2G2ZA 2V50A 1BQMB 3RUBL 1IVZA 4ZPVR 2VDHA 1QGPA 5H9EK 2Y1IA 3VGVA 1S6PB 4F92B 1R1UA 2L9NA 3TQNA 4JI5J 4BC9A 1FSEA 2HHQA 2PMWA 2DMQA 1I6HJ 1SFOJ 4NMXA 2BJ8A 4N77A 3V42A 4C8LA 1N5YA 1RT2A 5ITHA 4IFYA 2FJXA 4DR7F 3V4IA 3ERMA 4TKTA 5KG2A 2FQ3A 2Y1LB 4MIAA 1Y0HA 3RBEA 2O9LA 2I10A 2MQNA 2DOAA 4UW2A 1KQSR 4G1QA 2MG4A 2UUBF 5GMEA 4ELUA 4XNFA 4ATNA 3MF5A 3DEWA 1P8GA 2RNJA 2LLZA 4R8UB 4DL2A 1XMXA 4H4OA 2FJ1A 4LSNB 4DN9A 1ENHA 1IWAA 2GNKA 5CH7B 1TNTA 1UJ6A 5GMKa 2X1EA 3HEFA 5F3ZA 2H6BA 4EJTA 3ZFVA 3C6TA 4QYZJ 2F5FA 2ZB9A 2JL9A 2M0CA 3D1NI 4JI4J 1TL4A 3A13A 1RAHB 1W25A 3GFYA 2VZ9A 3QAUA 1O3SA 4ZYHA 3F56A 3KLHB 4F2SA 5DDGA 4KGVB 3BPSP 2K85A 1ZPWX 4IG0A 1AOYA 2Y0BB 3MEDB 1VQ4S 4LITA 5HDKA 4WP8A 5F8JA 2CV0A 1SFXA 4I01A 2VT2A 4BQAA 2JPCA 2X1DA 4IFVB 2LBFA 2IAJA 3DMJA 4HACA 4ZPCA 3CCSS 4LT6A 2GZOA 5FKLA 3NCRA 2ZJPQ 4RBTA 4TLQA 4JI0F 2JEFA 4MFBA 4PPDA 2C2MB 5D78A 3HJFA 4W4MA 1R27B 3OVAA 3GZ7A 5FKKA 3CJ2A 1HNIB 5BQTA 1R22A 2CH0A 3GIMA 3VF0B 2W9CA 4U67Q 4CH7A 2E7XA 3MWBA 5J1RA 1T6SA 1G3WA 1IGNA 5A8RA 2E29A 4FPRA 5AXKA 5LSRA 5B0EA 1IKYA 4Y52J 5H20A 4AD9A 2QIFA 4PYAA 3LQRA 3KZIC 4WF2A 4Z37A 3K1MA 4MK8A 3QLHA 4K0KF 3H98A 2LEBA 2FVSA 5EF6A 3K1PA 3WTYC 4C3HJ 1E0EA 3UCZP 4DSEA 2D9OA 1IQTA 2PA3A 4KO0B 1RWVB 4BJ6C 4DV4J 1N34F 4RNHA 1JXVA 5JJBA 2O61A 2OP5A 1H74A 2KO1A 3TZYA 2FB0A 2M4MA 2NYXA 2R8GA 4XDCA 3B4MA 5GAEU 5DD4A 2L9DA 2ZFHA 1VBXA 3CDHA 3D0GE 1UW9A 4J19A 2ALYB 2CQ4A 3VQSA 4DR5J 1X4DA 1G7CB 3JSMA 5T14A 2Z9OA 1XJWB 1T08B 2XRLA 3M2RB 1RTIA 2V4QA 4ECXA 1QZZA 1KN6A 2OMOA 3L2QA 3TOBA 2UVRA 4QYRA 3JRCA 4XQFA 1D1UA 1W0UA 1RHQB 2K3KA 7FD1A 5BPIA 1SC7A 4C0BA 4FNIA 1SAUA 2DYSH 2BY1A 4R25A 4J9UE 2F40A 1NK6A 3ITHB 2WAQN 2W2NP 1WC0A 5KG6A 5FO5A 2O67A 3G3ZA 4LF5F 1FXLA 4WTYA 2GMLA 4EVIA 4A5NA 3AL0C 1U1PA 5F64A 3DM2B 2UU9J 2W8KA 4N56A 1MMSA 1FOXA 2X3GA 3QRFF 1QUVA 4ED4A 3K5MA 1KU7A 2DI3A 3RZOJ 1MG7A 4X4UA 1FWPA 2FEZA 4HX8A 1N34J 4HF2A 4B3OB 1ZRDA 1PGZA 4U87A 3QSYB 4UOGA 3IWFA 1NUEA 1N5VA 1FXDA 1KQ9A 3F22A 1F9NA 1ZQ3P 2GMHA 2GAGC 4H4KA 5LSLA 4GYGA 1S77D 5KFMA 1FYKA 5DZ7A 1B9NA 4C8NA 1IR2A 2QQBA 1CULA 2D9PA 4A3MJ 3PW4A 2EEYA 4KIBA 1Q5VA 2LEAA 4F04B 1I3QJ 2FLLA 3J80Y 4P7TA 4CCJA 3IN5A 5GADU 3IRRA 3JSMB 2B43A 5IYCJ 4B9NA 2VQFF 3I5UA 2X1AA 4CZZA 3OTOJ 3OYJA 4DR4J 2M9KA 2DDAA 4GC6A 3HMJG 1APLC 2FE3A 2J9CA 4IPAA 1RBLA 1KYWA 4KPCA 2OF7A 4EBDA 1RAFB 3DM2A 4KNYA 1P4XA 1HBMB 2CXEA 2TDXA 4UB8C 4WK3A 4K2XA 4HR2A 4WXHA 5GAHI 5DDRC 3H5NA 5DCFA 4WFZA 3Q8UA 4LREA 1ETWA 1RWXB 2FX0A 2QE5A 1G3TA 2HFZA 2DJIA 3FKJA 1B59A 4FX4A 3M30B 1J9IA 1RTHB 3CCLS 3V8LA 1BWEA 3V4IB 1RXOB 1F36A 1F3FA 1LOUA 5J1UA 2K9QA 4A5MA 5H2FC 2VFRA 1FEXA 4XKCA 1HA8A 3HI9A 2W4SA 2X9DA 1AROP 3ILJA 2A61A 1OJ4A 3SZ2A 4I2PB 5KFYA 5IP9J 2RQQA 3I0TA 3GJTB 1YW8A 1PJ5A 4HOBA 1UFKA 4OX8A 1SBRA 2HHXA 3NBPA 4A8QA 1RR7A 1RBAA 3K4KA 5A2QY 2PC6A 3BTIA 5IC6B 2W2MP 3S93A 5LEKA 1I50J 5GPCA 1U0HB 3GLJA 1T56A 5LMUJ 1H38A 4QIWN 4C3KA 1YITI 2YNFA 1J5OA 3L4BC 1YJNS 1VRUA 3C2BA 1JIHA 4DI6A 1ITYA 1UMQA 2O8KA 2M87A 4MTEA 2JA5J 4R0EA 1FJEB 2YX1A 3VVTA 2FLOA 1MIJA 2VPXB 3M8QB 1QD1A 2GGPA 2E5GA 3N5BA 3KUHA 3BKTA 1X1DA 3PX0A 1W5CC 1KLNA 2M7AA 3JTNA 4EFAC 2HIQA 2A3JA 3NARA 1T05A 1N5QA 3MR3A 5ETNA 1D0EA 3IP4B 2ZJPF 3GU0A 1DY3A 4HI1A 2W9CB 2GQCA 1AU7A 1NZAA 3WIVA 4X62F 1JLFB 1H89C 3E1SA 3K6GA 4P2MA 2GOMA 4ZPBA 2N7CA 3US5A 3RCOA 5KFOA 2JJ7A 2QLJB 1BR4A 5DUIA 2J0QD 1Z3YA 4ECZA 3PSFA 1DHMA 3O5TB 3KK1A 2J8AA 3KWMA 1MNDA 2XNQA 1XMQF 4XKWA 1GXQA 4ENJA 1X4OA 2QA4I 1BWVA 2AYBA 1SJFA 5KFKA 3I55S 4B9SA 1FJ7A 1JLBB 3F72A 1X1BA 1WKJA 3L00A 1V5EA 3KP6A 4CYUB 1LWEB 5IT9Y 1S4FA 4C97A 4PG4A 1LW2A 1YOVB 1LFPA 2FD5A 4KA4A 4DR3F 2V6EA 1U6BA 2UXDJ 3I4NJ 3H5SA 3GLLA 5D6FA 3CD0A 3E6MA 3OYHA 1WJ9A 3IM8A 2KPMA 4C0OC 1IR0A 1U47A 2B9SA 1M1HA 1NHUA 2ZDOA 3O44A 1BBYA 2I8DA 2B4OA 3LPEA 4K4XA 4FYVB 5D4LA 5F8HA 5KG1A 4ECRA 2VG7A 2BABA 3M1VA 3CCRS 2HRTA 1LE8B 1H0MA 3FSXA 4RBUA 3EDQB 1PO6A 5CKTA 4RW6B 2D3OR 2XQCA 5F1RA 4OI0A 3K58A 2LY1A 5DGAA 2HYIB 1H6KX 1YJTA 2MLKA 2F4FA 3MKWB 3WTUC 2RNEA 3BC8A 2H1KA 3QBCA 2L3MA 1X3ZB 2KL8A 2IMOA 5D8LB 1UZHA 2LY2A 4TY8B 1FRKA 3I0RA 1RAJA 3LAPA 4CO8A 3MHYA 5TJJA 1NM2A 3GSIA 4YQWA 1GXPA 3GJQB 2MDAA 1KZHA 3ZNUA 1YLFA 3NWRA 3VQTA 4ED3A 1S9FA 4DL3A 4BL0B 1IZ1A 2DLLA 3TYTA 3RYPA 1N6QB 3OYEA 2D7SA 2KMUA 1ZM3A 4WE1B 5F0FA 1T0FA 2W48A 2VN2A 3G1OA 3GJSB 1KONA 3L7PA 4QCLA 4C2MJ 5AE2A 1NK8A 1OSDA 1D9AA 4HSRA 1REVA 1IRXA 1TAQA 1VFJA 4HH0A 5IC4B 4B9LA 4XN3A 4OYWA 4XKVA 4KJIA 2EILH 3IV5A 3IA0A 2M2EA 3H9QA 1ZAXA 2KJVA 4USWA 1QHHD 2EWHA 3D0SA 1QSLA 3AXMA 3ZTPA 1I27A 2HS4A 3MMJA 1YIJS 3BPDA 1XQIA 1UHSA 4NPOA 4CYUA 3SMZA 1N0VC 4WYLA 2C3MA 1VFCA 3MFIA 1NB2A 4CLKA 3T1AA 1HWUA 1ZRCA 3M8PB 5THWA 3CP2A 4FN5A 5FJ4A 3R5BA 2QYOA 3QODA 2VD3A 4HDVA 3GYNA 1B0TA 4ED1A 2F65A 3HSGA 3C2HA 2DODA 2VE9A 3RZAA 4I0AA 3TVKA 4ELVA 4LF6J 1F43A 4LFBJ 4KISA 1U6GA 4LFUA 4HQEA 2DFHA 3VAGA 5H9EJ 2HQNA 3H40A 1XG1A 1GMVA 1Y4ZB 2JLEA 4JYKA 2NUUG 3KK2A 2ESHA 4NMLA 2JFDA 4A8FA 3TOAA 4ID5B 4DZJA 2DNHA 2BJDA 4PSWA 2KQRA 4PGGA 3FSYA 1CF7B 1HBNB 2C42A 3MOJB 3W6VA 2DMNA 2ZBCA 3GIKA 2VODA 5DM6F 1R6RA 4XDDA 2E5NA 1H8AC 3D67A 4CLYA 1ZAOA 3C14A 4ENMA 2XB5A 1K9MT 3FM5A 4HKQA 3NCPA 3LAKA 3AB2B 1ZN2A 1EKEA 2XEXA 4O0NA 1Q8BA 3OYDA 4M3BA 1R43A 1M1GA 1V4RA 3ETOA 1Q8IA 5GAEI 2FY8A 4IOAF 5E3AA 4ZCLA 3DRPB 4PSXA 1RUSA 4ZDNA 4X4SA 3VCDA 1SD7A 4E8UA 1IKXA 2GQ2A 4K50A 1RBOB 4ZP7A 2YPRA 3MM8B 1A6IA 1P2FA 1T0FC 1HI8A 2HG4A 3I87A 1K4TA 1LW0B 4TY9A 2BMBA 5ETVA 2R3VA 1XMOF 2HZVA 4ZLJA 4M8LA 4XLNF 1IBKF 1Q8LA 2R4GA 2ZC2A 1BIBA 2ZJRQ 4OYMA 1U8SA 2I8EA 3GCWP 4KT6A 3GFLA 1HNVA 1B70B 2F2EA 4DV6J 2JFKA 2MZJA 4FXDA 4ID8A 4G7ZF 2HFSA 2RS8A 5HQMA 4HT7A 4BHQA 3OFFA 2VFVA 3DOKA 4F8RA 4BY7J 4IRGA 5EGOB 3CMAI 2ZITA 2EV6A 2GA1A 3OVSA 1S59A 2XPUA 4XLHA 1T3OA 2WADA 3CCES 4BCAA 2HQ3A 4GRIA 4TLRA 4MIBA 3TW7A 4BXUA 1GXTA 1HBNA 3I4HX 3A03A 2K27A 4P96A 3TAMA 2V63A 3O6QA 3ZGKA 4ZVQB 4ON0A 1O8BA 4PZJA 5F8GA 2B7CB 2I38A 5F04A 4EM0B 3RKWA 1IKWB 5J47A 2QL9B 2Z57B 3IGVA 3OYFA 2R5ZB 1MU2B 3BR2A 3OR1B 2NS1B 4QTRA 1M1EB 1U2FA 3IRXB 1R23A 1JUSA 3MD1A 3LQQA 4FKYA 3MEEA 1R5ID 2FPHX 1G4CA 3MEXA 4MYUA 4DV7J 2MZRA 2DHGA 4V19K 3MEGB 5CYMB 3SDGA 2DW4A 2DNMA 5KFNA 1EF4A 2MLGA 1I51B 5A0YA 2H27A 1IO2A 4UXNA 5CHCB 1S49A 2DPDA 4NA2A 2M52A 4RU2A 1JNZB 3QGHA 5M5YJ 1BI3A 3Q9VA 1V3FA 2ASJA 1JLCB 1BMQB 3NKYA 1Z6RA 3JRDA 3T1HJ 2NSBA 3MUVP 1JJ2R 3QYBA 3L2CA 3CMQA 5IQQA 2HQGA 1WACA 4Z2YA 1F5BA 3IWLA 3FK6A 2KM8B 3R1HA 1KHVA 3GWCA 2ALZA 2FRHA 1MDMB 5J4VA 1FPQA 1HDPA 2HVQA 1JUMA 3TP0A 4OZNA 1IRFA 2F63A 2Z1DA 1DURA 1CS4B 4FETA 4R8UA 4NCAA 5EGOA 1B4SA 4NRTA 3CJQA 1G8XA 1R0AB 1MBEA 3L2WA 3VR1A 2EBIA 3MZ8A 1FX7A 3WTSC 3OW2R 4CCNA 1UVJA 4MKBA 4PABA 2KT3A 4ZYGA 2BR0A 3PUBA 3KX2A 3EUKL 5LFAA 3OR2C 2AW0A 2R4FA 4I2QA 3OXFA 3M2VA 5HATA 2YQ3A 2AXLA 1KVKA 3JQJA 2K3PA 2YKMA 2Y3YA 1YJWI 4O0IA 3PW7A 1SMTA 5U47A 2BYVE 3QWUA 6PAXA 3SV4A 4D5CA 4QLCU 2P6TA 2LMDA 2XAJA 2OD4A 1S0MA 3FHZA 3FUYA 3KKFA 3KTQA 1YJRA 3A3NB 2UVUA 3BY6A 4IG0B 2G0JA 4YMEA 3WGGA 4BU2A 5ETPA 2Z2ZA 1FXRA 4DN0A 5L38A 4NC7A 3CMEI 2VF3A 1C0UA 5D3GA 2W7NA 1PVEA 5HQLA 4WJBA 3HDSA 1VRTB 4BLGA 1BA5A 1OLTA 1EQ0A 3PW2A 1FIAA 1KQKA 4ZPDA 3DI6A 2XPVA 4RLFA 2W1OA 1PKUA 1U2RA 4DYQA 4IX7A 1HNWJ 4RM2A 2ROPA 2RDPA 1ZTTA 2PDAA 3OMYA 4WKRA 1TKXB 2MD5A 2V1DA 1OYWA 5IP7J 2A5YB 5EGYA 5ICCA 3SZGA 2MMYA 2ZSHB 2DT7B 1R8AA 1PJ6A 5E3RA 3J80Z 4CH1A 4LB6B 4DX8H 3I56I 1RT5A 2ROGA 3E5QA 3DXJF 1L3VA 4MIWA 5EX0A 1IJFB 5DG8A 3WTXC 2EW9A 4CUGA 3SXLA 2CQIA 2BW3A 4PCQA 3DKWA 3FBNB 2JMWA 2W2OP 3J7ZT 1V6HA 3CJ3A 4NXMJ 3ULHA 3D1OA 4ZPTR 3CJTA 2ZKTA 5L39A 1YQHA 4G8XA 4IOCF 2ELKA 1WHUA 4HVZA 3E5XA 3FXLA 3GO5A 4FBUA 1FE0A 2C2NA 3WHIA 1UVIA 3CUNA 1AWCA 4B02A 2RQPA 3CF5Q 1U1OA 1ODDA 1D9DA 2OZUA 1HHTP 2ZNYA 4FF4A 3K10A 3QMQA 1MJBA 2KRFA 2L01A 1MROA 1VQOS 4DW6A 4NQWA 4BDZA 1S7HA 1RI7A 2JDJA 2XSFA 3EGWB 2G0IA 5GADJ 2ZH3A 5K8OA 3EGZA 4PJ0C 2VG6B 3RAQA 3R60A 2IRUA 3D6HB 4DNCA 4DUYJ 3GFJA 1CJTB 4AU7A 2NVQJ 1UAAA 1G2HA 1LFWA 3W2AA 3KP3A 4R5PA 3JTPA 4BXXJ 3OT9A 1LEOA 3CDBA 5CA5A 1IV8A 4LR9A 1MJAA 3UVJA 1VQ7S 1ZTRA 2LVWA 3L9ZA 1B7YB 1XN7A 1KU2A 3DCFA 1ETYA 1Q1KA 1FX2A 3T19A 2Y69H 1S7EA 1SUQB 2Y0SA 4J00A 3HKZA 5M5XJ 3JSOA 2ZXWH 4IRDA 1DQUA 1V5FA 2RREA 3JYTB 3QRRA 4WTOB 2J76E 4RUAA 2W82A 3GFHA 1RYRA 1TNSA 1TL8A 1WI6A 5AIPA 3MM5A 2EH3A 1E3OC 2D1CA 3P3DA 2YQ1A 4A3EJ 3M1VB 1DU6A 5KFWA 2AQ4A 1Q7LB 1UETA 4OOIA 2N3OA 3ASNH 4QSHA 4DR4F 2B9XA 3JRAA 4A0YA 3IMQJ 2OJED 2CW8A 2J0WA 3F0NA 1VQ7I 3PRVA 4A12A 2P5VA 4BBRJ 3M4XA 4ANJA 1FWLA 1ORKA 4CCOA 1ZR4A 3JAMU 3CCJS 3OL4A 5JVGF 1VQYA 2COLA 3IAS9 4AIHA 3EYYA 1QVUA 2VJ4A 4F0KA 2WOMB 1MGTA 2ZKUA 1RHKB 2MC4A 3OPKA 1XMKA 3OL8A 2X6WA 2L2OA 2NPFA 2C3PA 1TUWA 4Y7NJ 1JT6A 4LFCJ 3BG6A 3QT6A 1O3TA 1NH8A 4RJVA 2DK5A 4IHXA 3M30A 2LNBA 3JB9k 1LDJA 3N9UC 3I59A 2PBIA 3S7RA 3F6VA 3WHBA 3H90A 4KC5A 3QPTA 5IPAA 1WORA 3ENWA 1YITS 2Y0MA 1PC4A 2FJBB 1PBAA 4K5RA 1R49A 1N88A 3V6HA 2Z0GA 1N56A 4Y2KA 2FUG2 2N82B 4C2TA 1NO8A 2GO8A 4RGRA 1OWXA 4NLRA 4CNYA 4IHTA 3LGHA 2IVFB 3KXDA 2M7BA 3CF5F 1AFIA 1A35A 3L3CA 3LWMA 3VSKA 1FRIA 1L5UA 1NJWA 3DXBA 3MVPA 3DOMB 4B3AA 3TEDA 2DR7A 5CYQA 1FFWB 4S04A 4QPTA 3NGKA 2YS9A 1VQKI 2HFHA 2NSCA 2XSJB 2DXDA 4F0HA 1MWQA 1HBOB 2CZ4A 1NK9A 5A0YB 2XS2A 1Z1ZA 3DOKB 1EZZB 1TU0B 4M95A 1S1XB 2ADCA 2F8HA 2NVYJ 4KUMA 4FYXB 1W7PB 4CSWA 2GXAA 4ED7A 1JKOC 1APSA 1UW4A 1F9FA 3TANA 2WV1A 3OOPA 4GXOA 2ZCWA 2VL1A 3Q8YA 2J6SA 2IEKA 2RDDA 1VI7A 2YWHA 4GDFA 2Q1ZB 1J5EJ 2HOSA 2B6AA 5EJCA 4J91A 3T1YJ 4OMZA 2IA2A 4FE7A 2DHSA 3V7SA 3S8PA 5A8KB 9RUBA 4L5EA 1MBGA 3TW0A 2NS7A 2E5JA 3K7RA 4XKBA 1USSA 4URSA 1VNDA 5TRDA 2XGDA 2ZOMA 3NCQA 5LXRA 4BQQA 4I6ZA 2XLJA 3D5SC 5HNHA 1XNRF 1OKRA 3QT8A 1T03A 1OSCA 4N8OA 1HI1A 1IBLF 3GMEA 1ITPA 5IT4A 4DSKA 1S1XA 4NWBA 5CYQB 3OYIA 1NU4A 2VB6A 3S3OA 3W7BA 3P4UB 3UI3A 5LHIA 2A6EF 2ZBKA 2E2IJ 4DCOB 2QLFB 4DV1F 4YEJA 1N5SA 2Y48A 3R2CJ 3HUGA 1U26A 3GFMA 2DHXA 2FZKB 2EZIA 1RHUB 5EG0B 1RB0A 1PP8F 3LSKA 4CLTA 5SZTA 4KJZA 4ES2A 4RW4B 4HNUA 5ADZA 1BL0A 2RHQB 1WSUA 4EJWA 1RWPB 1FJGF 5KFAA 1BM9A 4F36A 2JRTA 1RT1B 5I42B 4M1KA 4NASA 5K5QA 4L0ZB 1NEEA 3HD2A 4HT5A 3HL2A 4AXJA 3TWZA 3SZPA 4DBRA 1TWGJ 3GWZA 2QEXI 1LK5A 1RCOB 2FVCA 1FD8A 1C1BB 4ZP6A 4CA0A 3IRWP 4GCVA 4RKUC 3OS1A 1CPZA 3BV8A 1W2BR 2L02A 3VYUB 3DXSX 2FBKA 4J9QA 3EQLF 3Q0VA 3GTGJ 2UXDF 2DGXA 3KJQB 1RC9A 1TC3C 4IJAA 1TZ0A 2DIUA 3AL0B 4LR8A 5F8MA 1S79A 1XGMA 4Y3CA 2DGVA 1TUVA 3RQIA 2ATLA 4ZYAA 3SYTA 1FERA 3NWSA 2GVDA 2MKKA 3NGDA 3AG4H 3RIRA 2QRRA 2DHHA 3GPAA 3VZIA 2VKEA 1OYDA 1SFKA 4BJTA 1S5ZA 3BCBA 4XRFA 2PD1A 3MI7X 4ICLB 3KG1A 2C2RA 4HF0A 2P4WA 2MKJA 2XM3A 1BXNA 1XWLA 4E7HA 1Z7UA 1TKTB 3PRDA 4KSEB 3V7RA 4CWBA 2OPSA 3HKZD 1FT8A 1L0OC 5JLXA 3AQPA 1G2EA 5LJ3Y 4WF9Q 4WFYA 3NWGA 1H7XA 3WG9A 3DQVC 2DH8A 2XHWA 4Q2LA 4V2FA 2IVYA 1EP4B 2FF4A 1BIAA 4P73A 3EX7B 5KFSA 1FNMA 1F9HA 4WU2A 4GVBB 2D41A 5L3GA 2A6HF 4AL6A 3ZMZA 4YOEA 5HBMB 2HEOA 4NZ0A 1VOMA 5J2QA 4ECYA 2FQQB 4IG3B 4MIMA 4IRIA 4F4AA 3V81A 2OEJA 4Z2XA 2GJ2A 5J2NB 5SUHA 1R8CA 3SXYA 5AT1B 2GV1A 2ACMA 3KHHA 3CO0P 3RAXA 2OJ3A 2YKOA 3PVXA 4Y3OA 4JV5F 3ENQA 3DRXA 3KETA 5F8IA 1IXRC 4KY3A 3NRBA 4A0ZA 1EAYC 3WTZA 3CQZJ 5ETSA 1U7LA 4RUCA 2RQCA 5LEJA 2FIUA 5KFDA 1LPQA 2OZ6A 2CPJA 4O3PA 2YBVA 2PLYA 1R8PA 1RT2B 3K8WA 5DS7A 5IOZA 1WZ2A 1A6QA 2EIMH 1U1QA 4NCGB 1HR0F 3MECB 4HA8A 1VIOA 2CNKB 2DRAA 2XAHA 4JI6J 2YNIB 2M8EA 2EZLA 3MCZA 2OA4A 4M3FA 2CIMA 2DO7A 1XK8A 2E36A 1OYYA 4PZVA 2NVUB 1EP4A 1ZGJA 2E1MC 1NK3P 2PSZA 4EBCA 2HW3A 1VK8A 2CFOA 4MJKA 4O5VA 4DR2F 3V4MA 4A3GJ 4XN0A 4DMZA 4K4TA 3E8OA 3DRSB 5KT6A 3IBFB 4WKYA 5AXLA 3BREA 3H3ZA 5GAGI 3OR2A 3T9NA 3DLAA 2Q2EB 2AX0A 2QSHX 1I5ZA 4HQMA 2QF7A 2W84A 1FESA 3TUZC 3KLEA 3J7YU 4DPTA 4ZVTB 3D1HA 3G96A 2ZH6A 1S76D 5J2NA 5BYQA 1BC7C 4NL5A 3CC4I 2BV6A 2BM0A 4JP8A 1TTHB 4NYZA 1Y6IA 3G71I 5FD1A 3LSJA 4TQSA 4BS2A 1D1AA 3N6LA 2O5RA 3WHCA 4PR6A 1S9EB 4CYCA 2FVQA 3CJSA 4L72B 3K0LA 3BJ6A 3TEGA 1KSPA 5I3UB 3G82B 1RTDA 4N76A 2LH9A 3BDDA 4H54A 2ZKZA 4E7SA 1EETA 1NTCA 2AMCB 3HHHA 2HMIA 1MLAA 2V4RA 2VQHA 3CCUS 2LQBA 2QA2A 2V8HA 3DNCA 4J9VA 5CABA 4E98A 5DQHA 1YGYA 2ZFWA 5I3QA 2DPUA 1TMJA 3N01A 1BE4A 3MN2A 1J0RA 5HDNA 4KGZB 4Y6IA 1RT3B 2XZDB 3RRKA 1GV2A 3L2UA 3FMWA 5DLFA 3CCWA 2BOLA 4RWWA 1W36D 4IOAQ 1XB4A 3CDLA 2E1MB 1BQNA 3CULA 4DS5A 2P7VB 4OZ3A 2FGOA 3D28A 2WTEA 3HT0A 3PNYA 3QYEA 1TKXA 5K8MA 3L7UA 3M6VA 2LQ8A 1C0UB 1MDMA 1IDYA 3HOTA 3FMBA 1O51A 1S6UA 4CLUA 1YBAA 1GLNA 4M71A 1YSJA 1S99A 1YZ7A 1NH3A 3SCKE 1TL7A 2H1LA 4PUOB 3HHEA 1WC5A 1T95A 2H5EA 5A76A 3RBZA 3DTIA 2JVGA 1KHWA 1T9WA 2RQKA 3QOEA 4LMZA 1IAWA 3OUYB 2D2WA 3V81B 3HRMA 3QFWA 3PUFA 5KVRA 3D5MA 2ZUGA 3CCQS 5LOQA 2R9LA 3UFCX 3CJKB 3LL7A 4XLAA 4B44A 2YU9J 4UQTA 4EM2A 2CQ3A 2OAZA 2DNPA 1Q53A 5JXSA 1BY9A 2MQ8A 2HKOA 2CZVC 4M5DB 4HDHA 4DG1B 3CJRB 3E6CC 3T0YA 3HZGA 2CKWA 1FE4A 4KMFA 1PG5B 1FNOA 1VQSA 4QR1A 4TXSA 3CCYA 2HHWA 3UDCA 3W2WA 5C24B 3CMES 2KJBA 1NDKA 4RB1A 2IFXA 5KAFC 1MMLA 1QSSA 2XKOA 2E66A 3IFEA 3K4CA 3PNVA 1LNQA 4Q47A 4QWAA 4UUSA 2XMKA 4DL6A 1E6YB 2KTQA 3K8VA 2MKIA 2WY7Q 2MYSA 2Z33A 2IDLA 4L73A 3H59A 3S8SA 2J5OA 2EFVA 4RNFA 3J81j 2MKYA 5ETRA 1N75A 1UEKA 1SC1B 3R7BB 2LRDA 1GV5A 4IKFA 3GTQJ 1LEBA 4KYZA 3HKZN 2ZOGA 3L2RA 2EJRA 2YR2A 2RRBA 4WXWA 2R7DA 5KFVA 4I7HA 4I7FB 2R7UA 2HLUA 3QAEA 1TL3B 3R1LA 1UEVA 2U2FA 1FHTA 3DRPA 4CO4A 1U9OA 2BANB 2BEFA 3ZPLA 3EGVA 3NY0A 2AT1B 1UPMB 4YDXA 1V5GA 4CZCA 4MTDA 4C6AA 1TK0A 2EKYA 3FWEA 1Q5YA 2XSJA 3PFOA 3G6XA 2YTCA 2ADUA 3PV8A 2ASDA 4Q8FA 2BQ3A 5IP6A 2ZBPA 2EIKH 1VQ5I 4GKKF 2DK8A 3RB6A 2EIJH 2H5JB 4AT1B 3DFGA 1RHMB 3P8BB 1H2TZ 1JE8A 1PCAA 3LGMA 4M5LA 5GVQA 4GC7A 4OZ0A 2L41A 4PAAA 1WI3A 1T2KA 4ITSA 1IBLJ 2ZHBA 2M9HA 5F8LA 5IV4A 2SXLA 4ZDPA 1P1TA 2P6SA 5J1NA 4XOPA 2HAIA 4PG6A 4CO3A 1QQIA 4DUTA 3VFZA 3SEOA 4GO7X 4FZVA 1NSKL 3FFIA 2VPLA 2HPUA 4IYQA 1MN9A 2UV8G 2XF5A 4PGHA 3I31A 4AQYJ 3E6BA 5JUMA 4RLQA 1XBWA 4TV7A 3CP8A 4P2FA 5E8IA 3J7ZI 2GVZA 2DCLA 3BT9A 5FKNA 3W2WB 2HQAA 2L7MP 3DMJB 1N32F 2IGNA 2MLZA 4EATA 1WWHA 4PG7A 2A6MA 2K1RA 4BQOA 2OBPA 1N36F 2WB1D 4ZHRB 1QHGA 1XMAA 2FMLA 2RKIA 2EVZA 1EKRA 4CYDA 4Q0BA 1DDNA 1QVGR 4DQIA 1S9GB 3OXGA 5I4MA 1S1UB 2OLWA 1V3ZA 2WWYA 1FA0A 1RISA 1TMMA 2R8IA 3KLFA 1RT4A 4M6XA 3VGSA 1FF2A 2VBXA 4B4CA 3N0VA 5HS8A 3TVYA 2VBYA 4ZP8A 4WWSA 5J1EB 3BGOP 3BR0A 2G7HA 2JSPA 2QKLB 1HNWF 4IR1A 1N36J 4B3MJ 1SI9A 4ZJQA 5D8HB 4YRVA 4LIVA 3T5XA 3S32A 4WX9A 3EUHA 4H4OB 5B3SH 2F4IA 3MKLA 4OV6A 2HPIA 4FYWB 2LFVA 3SQGA 3KUEA 1VHIA 1UJ8A 1CBKA 5J2PA 5HROB 2AWZA 2IBKA 2GW8A 1T33A 4U8YA 4CCLA 2V4JB 2DNRA 1N32J 2ISZA 3QWLA 4DQPA 1F0XA 4HV6A 2IMWP 3OVBA 1YRXA 1KFDA 1CEZA 2KRBA 2VKHA 5D4PA 3MD2A 1X3WB 2CO5A 1LDKB 1ZYRF 1DJ0A 4KPYA 3QWPA 2WHOA 3G8TA 1WJDA 4KGXB 3H5YA 3JRHA 4GKKJ 4S0MA 2V1UA 3JREA 2G2OA 4LUBA 3A8IA 4DFJA 3VGUA 3BKFA 1DP7P 2DO0A 5A8WB 3OSNA 2EKNA 4UVAA 4XOTA 3CD7A 2ZWOA 2W7PA 3BDEA 3L2VA 2VFSA 4S05A 2E5LJ 2F5VA 1S7AA 3M8YA 1VLYA 1MROB 3CIZA 3FXJA 3MZYA 4LBPA 4OI3A 2FZCB 3DLLQ 2OTLI 2A10A 4G1QB 3R3TA 4WE1A 4ETSA 4EO8A 4J9SA 3TA2A 1JLAA 4JI8J 2LFBA 2O8XA 1WOSA 4FS2A 1X58A 3LP0A 3GZ5A 1YFHA 3BB5A 1J59A 2A07F 2WVCA 2X0LA 3Q3SA 3ZMUA 3GTLJ 3P96A 3K7AJ 5HLTA 1WJ5A 1S6QA 5HK4A 3CUQB 1WJBA 2C3UA 3O3KA 1LXNA 4U7BA 1UHWA 5E0OA 5K8PA 1E3PA 2QQAA 1WKLA 1C0TB 2G9OA 3NOGA 4A3KJ 1OJLA 1TFYA 1FOYA 1RT5B 2KDOA 2A68F 1XIQA 3GFZA 3CCVS 4MHGA 3LA7A 3QT7A 5L1JA 1I6JA 5HNFA 2ZMEC 1P6RA 2DGSA 1ZA1B 3QJJA 2HGLA 1OR7A 1AUSL 3DEUA 2HWIA 2STTA 1WH5A 1HC8A 5L9NA 2RB7A 2IS2A 5DDQC 1N54B 5BR8J 4MK7A 4XO0A 3TJ8A 1NDCA 2MQMA 1T98A 2CJBA 2ROEA 3EVMA 1JLAB 2PT0A 3MR6A 3FNNA 2KP6A 1VJWA 2CG8A 2LU2A 2HNDB 2GIRA 2DMUA 2DHAA 1IN0A 2B3TB 2BACA 4A4JA 5J1EA 4M6VA 3KEOA 2CSOA 1O3QA 1KR4A 4JI8F 1T39A 4WFAQ 2NAZA 5DCMB 1A6LA 1N0UA 1AA1B 4FYDA 1WI9A 2EB7A 4QIGA 2LC2A 2BVLA 3JRFA 3AHPA 2HVEA 4EK2A 1BN5A 1XX5A 2DGUA 2PFFB 1WCMJ 2HS3A 3HFKA 5TGTA 1VISA 2ZBIA 4IG3A 2HVZA 4B3RF 2NNYA 4EWTA 1XC9A 3W6KB 4AYBN 4G7HF 2XF7A 4L9VA 1TKTA 5E3OA 4DQSA 3H9JA 4Z7YA 4U0VA 3SQGB 2DNNA 3CCMI 2MC3A 5FD6A 3MPVA 5CVVA 2QV6A 5J2PB 3F3XA 4U95A 2OC6A 3SQNA 4WFXA 2WAQD 3AG2H 1Q1VA 4O6JA 1RADB 3ZTSA 3HGYA 2FBHA 2HVRA 1QTNB 1NG6A 1H72C 2AJ2A 3OYMA 3MXHP 5FDLB 2QVOA 3BYRA 1RA6A 2GVDB 3DDKA 4BHBA 3MZHA 3ZZPA 2EA4A 5IT3A 1FY7A 3JSYA 1WPKA 1CVJA 3MFKA 1T02A 1FEHA 2K5CA 2FU4A 3OS0A 3BKUA 5F3TA 1U25A 2FGCA 3PX4A 4DIQA 4RM3A 1AXQA 5HMXA 4V2GA 2K4BA 2JQ7A 1XEZA 3PO4A 1NDLA 5BYRA 3CDWA 3CD6I 1WEXA 4K4VA 4QYZK 3TP2A 3TUJC 5HOOA 1SKSA 5D5VB 2LVSA 3CPWR 1VQ8S 2DR5A 2ADBA 4A3JJ 1ZYQA 3EUHC 3CCVI 4AIKA 1C1BA 3D2WA 1K8AT 1TQIA 3QU3A 2O01C 2EV0A 2JT1A 2CMPA 2V68A 1TKDA 2LYCA 1A31A 3ZN0A 3HVTB 3RAMA 1R58A 2PJRB 3IC7A 1XSVA 3AFHA 1X4EA 4WZQA 4LF4J 4MQ9F 4LF5J 2B0GA 3FX3A