2VONA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auaauuu
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
187
structure length
187
Chain Sequence
DNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LUPUS LA PROTEIN
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 56
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vonA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vonA02
2JVRA 5H20A 2CPDA 3UWTA 5FB2A 3VF0B 2H09A 4KFCA 1K8AT 1ZRDA 2MKSA 5ICCA 5K5OA 2HYFA 1M5PC 2IA2A 5DM7Q 4NHJA 2VOOA 2RRAA 3BPXA 4EJTA 4Y0FA 4A0XA 1AOYA 4RGUA 5HL7Q 1N52B 3F6VA 1X4GA 3E6MA 1YJNS 3CLOA 5F1RA 5FGMA 5LJ3Y 1KU9A 4BAYA 2B0GA 3AAFA 4BHBA 3FHZA 4LMYA 5ILSA 4OIOF 2CPEA 5JR3A 1S29A 3GFJA 1M5OC 4UV8A 5IQQA 3CMAS 2HTSA 3V7RA 5GAHU 4HF2A 2XAHA 3F6OA 4PCQA 1OYWA 3IL2A 2RDPA 3Q2SC 2LSOA 2Q8KA 1LB2A 3CMES 1OPCA 2I38A 2EFNA 3VALA 1FBSA 2PQ8A 6PAXA 5ILUA 1D8ZA 2XAFA 2XB2D 3L3CA 2FF4A 2VE8A 3PIPQ 3JTGA 1IRGA 3TGNA 2A3SA 3E5UA 2MXYA 3RKWA 1Q7YT 5D5WB 3IHUA 3K9TA 4YFNF 2ELHA 2XVCA 3IKVA 2UP1A 4B8XA 4OU0A 4OZ1A 1XN9A 3RKYA 1FZPB 3ZMZA 4WXCA 1E2XA 1BC8C 2D1VA 1XCBA 3HRTA 4ON0A 2QA4S 4R79A 1LDDA 4XRFA 2CG4A 3I59B 1SMYF 2PMHA 1SMTA 3G73A 3K69A 1YW8A 3CCLS 5DD4A 1IRFA 2MZSA 3WTYC 1IXCA 3CDHA 2QUFA 1CVJA 5LHGA 4RAZA 1CF7B 4RB3C 2MQNA 4F7ZA 2OQGA 3D0SA 1X4EA 4EMSA 2OSRA 4R8HA 4HW0A 2HOEA 3GLXA 2KI2A 2DNOA 4R1HA 3H2UB 3D2WA 2DNPA 3TO9A 1WSUA 3CO6C 3J7YU 4PR6A 2HKOA 3CCQS 2V6CA 4OMYA 1I1GA 2YKAA 2A5YB 2MZTA 4BQAA 2DB1A 5LXRA 2CQHA 1VC5A 1IF1A 2ESNA 2KJBA 4UUVA 1QZZA 1FO1A 1R58A 5IM0A 1IAWA 2Y0MA 3WGIA 5CVUA 4I2OA 5LHHA 2LF8A 3E6BA 1QNTA 3BEGB 3JSPA 1IN7A 1W5SA 2JX2A 4CO8A 2Z9OA 2PEHA 2VE9A 2M1BA 2N82B 3SMZA 3Q9SA 2D45A 2DPDA 3MEXA 1MD0A 1WELA 1X5TA 1M5VC 2OD5A 5BJRA 2M7SA 2P5KA 2HGLA 3CUQB 3DPTA 3W6KB 1T39A 1WHXA 3G8TA 2NNYA 4TLQA 1K73T 2OTLS 2OTJS 3LQRA 1IUYA 1M1KT 4P96A 1WHVA 1FP1D 1WWXA 4AIJA 4BS2A 1VC0A 3V4MA 4AD9A 3WTVC 2FSWA 3RDIA 2FC9A 1YQAA 2ETHA 2A68F 1FNNA 3I71A 2P5VA 1GXQA 3S2WA 3BO3A 4YUDA 5E1XA 1KOHA 4EJWA 1I5ZA 5HLGA 2KG1A 1BOAA 1G4DA 4W90B 2LMIA 1HQCA 1U2FA 4BXUA 3I55S 5FD6A 3I0TA 4BNCA 1FNXH 4RGXA 4YB1P 5GVQA 4U88A 4WXHA 4IVNA 2H6BA 2VONA 4K2EA 1P1TA 1NO8A 2MGZA 3CCJS 4QU6A 2HYIB 1LDJA 3U2RA 5HDKA 2BYVE 2MY8A 2L01A 2FOKA 1XGMA 3UD3P 2MH2A 3BDDA 2YX7A 2DK5A 2J76E 4L9TA 3FXQA 2EFPA 1TNSA 4LB5A 1O3TA 3T8TA 2AS5F 3MD3A 1TQPA 4I0BA 2C6YA 1B59A 4EJOA 2VXZA 3GFIA 3LPYA 3TO6A 4YOEA 4QQBA 4P6QA 2LKPA 2DNYA 3N4MA 3WU1B 1WEZA 4CXFA 2JSCA 1RKJA 4HQMA 3FMQA 4OIQF 4CQ1A 1ZG5A 2RQ4A 2GWRA 4XLNF 1HA1A 3J81K 2DU9A 2J0QD 1STZA 3MCZA 4OOIA 1WWHA 3ZMSA 3M8EA 5L3BA 1YFHA 2W85A 2DO4A 3L2CA 3J80Z 3I56S 2XS5A 1KD1T 2CWEA 2OQRA 3ZMVA 2QLZA 1PP7U 3F8NA 4CDGA 1OIAA 1JJ2R 5IT3A 3ZMTA 2FMLA 4MGRA 4KUMA 4FX0A 3O6BB 3ZN1A 4G7HF 4IUFA 2X4HA 1WRJA 1QGPA 3GWZA 1SJRA 2MSSA 3GX4X 5HDGA 2XASA 2D2WA 1ZN2A 2XAJA 2LKZA 4L5JA 3U1LA 4WKRA 3U9GA 1EH7A 4M6YA 1K78B 1U6BA 2CPZA 3BP8A 3NS5A 2HQNA 2QM3A 1SD4A 1VQ6S 2PE8A 3PFIA 4YIIA 2CQIA 1RNLA 5D4RA 2DFIA 2XNQA 3EGNA 4WWCA 3IC7A 2XRNA 2SXLA 3CD6S 3R61A 3SXLA 2D1HA 4KNYA 1LQ1A 4HDUA 5LRSA 2L4AA 4UY8T 3R1LA 5KVRA 2DW4A 5E20A 1RI7A 2GHPA 1DZ5A 3VAJA 1G3YA 4WFBQ 2Z99A 4ZYDA 5BOXA 2G4BA 2OAZA 1VBZA 1A7GE 2CPIA 4ERDA 2H94A 1FSEA 4EQQA 3DEUA 3B73A 2DNHA 3M1EA 1KGSA 2IVMA 1VQ9S 3I53A 3S7RA 4WIIA 3QP5A 1XB4A 4OIRF 3REOA 1K6OA 2P7CB 5CYJA 2MZQA 2UXXA 1JGSA 1S3JA 4GYIA 4BYYA 2AYMA 4NB5A 5GADU 2XKPA 2YWKA 2EFOA 5L3EA 2QBYA 2CPYA 4YIFA 2KH9A 1D8KA 4A0YA 2YSRA 3B02A 4M5DB 1ON1A 3TO8A 1XSVA 3G6ES 2MQMA 1YJ9S 2PMUA 1URNA 4M71A 3SZTA 2CQ0A 1H2VZ 2HFHA 3NNCA 2HWVA 3QPTA 5J8FA 2XROA 2MKJA 1SFUA 2EB7A 3TP2A 1Z7UA 4M74A 1FWZA 2CJKA 3KFWX 3GFMA 2MH9A 3DP7A 2IA0A 1REPC 3LQVA 2W57A 3ZQ7A 3I58A 3IWFA 1KOOA 3CUNA 3F8CA 2XNRA 3MZHA 2RQCA 2A3JA 1ZG3A 2M8DB 1MJAA 3LWFA 3NRVA 5H6QA 3E6DA 2AD9A 2MQLA 3V8LA 2ZBKA 5EN1A 1EV7A 3HRUA 1TLHB 3P5TL 3CC4S 5DDRC 4LLGF 4Y13A 5IFMA 3P6YC 2DGWA 2YH0A 2QQAA 2DITA 1I1SA 4I01A 2P4WA 4N9HA 4EM1A 2P8TA 1JJHA 1USTA 3BO4A 1QVFR 3ECOA 3FF5A 4LD5A 2AYBA 1AUDA 3S01A 1H0MA 2N3LA 1AWCA 2M9KA 1SD7A 2ZFWA 2LNBA 1U1PA 2KXHA 5JHUA 2RNJA 2DH9A 2ZO4A 3MURP 2K8GA 2P5LC 4BH9A 2IPQX 3WTTC 4PGHA 1ZG1A 2CQ2A 2MJUA 3KZZA 1U1NA 1WQ2A 3T8RA 3EX7B 1XDUA 1H6KX 2EVZA 4U67Q 4KMFA 1IN8A 4HF0A 2GXBA 2ZJQQ 2CSOA 2DH8A 3JW4A 3P3DA 1VQMS 4RAYA 2RUGA 1FHTA 3OV8A 1RIOH 5DUKA 4I7HA 4FXVA 5FJ4A 1NU4A 4ZYGA 3NS6A 2DAOA 1G2EA 1HW1A 1JHFA 1YS6A 2FY1A 1ZGJA 5IM0B 2QWWA 1J75A 5J6XA 2PJPA 4F26A 3Q2TC 4WX9A 4HLYA 1LEAA 4HLXA 1YTYA 2PFBA 5BQTA 1EH8A 1LVAA 4IO9Q 5KK1A 2QZ8A 4A12A 4C4WA 2YPRA 2NRAC 1ZZNA 3ZPLA 4C7QA 3KP3A 1FX7A 2UWMA 4CYDA 5D8KB 3ZN0A 4V19X 1GXPA 2XSFA 4G6QA 3IKTA 2OZUA 1X0FA 5HLIA 2VBYA 5CJ9A 5JVHQ 1KQ0A 1PUEE 1X5PA 4RS8A 4HA8A 3FXRA 3L7WA 3BWGA 1CGPA 2LECA 5FFXA 3F22A 3I64A 4RB1A 2Z3YA 4MEXF 1VQPS 1OPIA 1FT9A 4YFKF 2MSTA 3ROUA 1V4RA 1O0PA 3HOSA 5LEKA 1W4MA 4MNUA 4WF2A 1WG5A 1YI2S 2G7UA 1YHQS 2E7WA 4PRFA 3O3KA 3CCES 5CYVA 1ZYRF 4LIRA 3U1MA 2OZ6A 2RVJA 1R00A 2EA4A 2G1DA 2G7HA 5JI6A 3FWEA 1Q82T 3FZVA 1F5TA 2RQPA 2YR2A 1D8JA 2MGZB 1VQLS 2BEOA 4PKDB 4EVIA 4ZYEA 1P4XA 1QO0D 3W6JB 3G71S 1J59A 3I5UA 2XIGA 3L9FA 3MUVP 4IHSA 1YIJS 4D0PA 5K5RA 1PP8F 1UCRA 4L5IA 1PDNC 3G96A 4O6JA 2ACJA 4HX7A 3KETA 1WI8A 2M5WA 1WHWA 2E44A 1TQMA 3NQOA 5L3GA 2DPUA 5LSLA 2V1UA 3MXHP 1Z6RA 2VBXA 4Z2XA 1KQ9A 1KA8A 2JT1A 1O3RA 2CPJA 3KLNA 3P9CA 4LMZA 1F1ZA 4FT8A 4B09A 2PLYA 4EGLA 3C3WA 2MZJA 4G7OF 3CO7C 1FBQA 5H1SV 1YG2A 2EA2A 3K2ZA 4I98B 5D78A 4KT5C 3MOJB 4L0ZB 3E5QA 4CHUA 4C0OC 1Q1HA 3C7JA 5FD5A 5EEHA 3M7GA 2CO5A 2D9PA 3I54A 4LFUA 3G8SA 1PO6A 3KEOA 2GO9A 4ESFA 4Q4ZF 5ILVA 2MMYA 2MC3A 4O5VA 3MZYA 2D3OR 4KMUX 5LEJA 1R7JA 2CQ1A 2ZMEA 4A6DA 5ED4A 3R6SA 4OMZA 2KIUA 1T6SA 5D6FA 1HSJA 3HSRA 2K7LA 5HOOA 1KC8T 2JTVA 2X0LA 2MJNA 1JMTA 1D5VA 2NAZA 4Q48A 2FU4A 4S05A 3LAJA 1C0WA 3P9KA 2KU7A 1B7FA 1L0OC 3CJNA 2IJLA 1QM9A 1TW2A 2CPHA 2CQ4A 2HDCA 2HTJA 2M4MA 2O8XA 2HS5A 3THTA 1S7AA 1FJ7A 2KG0A 1YW7A 2Q2EA 1P27B 4LGWA 1O3QA 3DFGA 4ZYHA 4KA4A 4CZZA 4YFXF 3CC2S 2MQOA 5D77A 1FJEB 4IOAQ 1LEBA 1GHCA 1SAXA 2QBYB 3RW7A 4GCVA 3WTXC 1OMIA 2NS0A 1H9TA 5FFZA 2DGTA 5J8CA 2D9OA 1VQKS 2RN7A 2XUBA 3R1HA 3R27A 1P2FA 5CLSA 1R5HA 1FC3A 2FA5A 1FBUA 2E7XA 1UHMA 3RYRA 5CVVA 2DIUA 3ZZZA 2V1DA 4U0WA 2OIHA 4ASNA 3H2VE 3B4MA 3CCVS 3KE2A 2EFWA 3MUTP 4AIKA 4WXDA 3CCRS 4HDVA 5IT9K 5LXYA 2E5IA 4UV9A 1OO0B 2E5JA 2M8HA 1KQ8A 2FRHA 3P7NA 3V8JA 1TTYA 3IWZA 1XGSA 2MZ1A 3VAFA 1W2BR 1P92A 3IWNC 4HV5A 3WTWC 1FLIA 1BIBA 2FMYA 4I0AA 3BPVA 3C18A 3EGZA 3TYTA 4P9FA 3CULA 1R1TA 1P4WA 3SDEB 1BY9A 3TKYA 1I27A 3MWMA 1RK8A 3THPA 2GA1A 3HIFA 1HBXG 2J5OA 3QRFF 1FY7A 2U1AA 3QAHA 2JPBA 4RGSA 3BJAA 1MZBA 2LXIA 3ISPA 3QP6A 2H6CA 2XS7A 2HYGD 2ESHA 2HVZA 2A61A 2CW0F 2CQKA 4QWQA 2DGQA 1N54B 4A5MA 3SXYA 2F2EA 2K27A 3KP4A 3TQNA 5HS8A 2CPFA 4ZZDA 5GMKa 1VQ4S 3U1DA 3GF2A 1R8PA 2BE5F 1P4AA 3QU6A 3K1NA 2XKOA 3TOBA 2V79A 3KP6A 4A5NA 3JB9k 1F9FA 1WI6A 3BJ6A 2IW5A 1KQSR 3UE2A 1U1QA 5GAEU 1W5TA 1WEXA 1XN7A 2W84A 1T98A 4AIHA 1WF0A 4U7DA 1Z6TA 2A69F 3DKWA 1ZZFA 1DHMA 4DNCA 3RTRA 3FM3A 5D4SA 2DHXA 1Z1DA 4F25A 3MD1A 2VN2A 2LA4A 3BO2A 3J81Z 5HVQC 3WTSC 5DCFA 4CICA 4QLCU 2RRBA 2BGCA 1BI3A 4IJAA 3VAKA 1O3SA 1K7AA 1U1MA 2EK6A 3EYYA 4F02A 4UXNA 4H0EA 2QQBA 2PI0A 3PQKA 2RKHA 2VBZA 3LA2A 4IRIA 4Y00A 1U8RA 2DO7A 2DIVA 1W7PA 2CQPA 4M6XA 4M9XA 2L02A 2DHGA 5D5UB 4LB6B 1G3TA 2JWNA 2MYFA 2KIFA 1BC7C 1FJCA 1U3EM 4UNOA 2MKHA 2OA4A 4TU8A 4XSXF 4LJMA 5BPDA 4OINF 5BPIA 3JTHA 5ICEA 2EV6A 1R1VA 3DXBA 4ENMA 3MUMP 4KYWA 4KIBA 3HOTA 1LNWA 3V7SA 4RGRA 4EM0B 1WKMA 1UFWA 4KIFA 1S79A 2GAUA 5DDOC 1KYWA 2GQQA 2EV0A 1X4CA 2KXFA 4XLPF 2MKCA 2COMA 1IN6A 1YITS 2JZYA 2R7FA 2KKOA 1ZGAA 5AONA 2DNMA 3WE2A 2O61A 4IPAA 5DETA 3J7AO 1ZAOA 1L3LA 1R5GA 4UVAA 2AYEA 2OBPA 2V9VA 4EJVA 3HHNB 2M52A 1Z91A 1R36A 4EGYA 1NHAA 3GUDA 3J7ZT 2M87A 4QU7A 5ICGA 1EH6A 2VT3A 2WBRA 3NEUA 3R4KA 1YYVA 3RJPA 3BROA 5CVRA 3LQQA 1BBYA 1DUXC 2IRFG 3G4SS 4HV6A 3SDEA 3S8SA 2YX4A 3VAIA 1Q86T 1J2XA 3ELKA 2KHCA 3DLLQ 5E17F 1OR7A 1B4AA 2RU3A 3HTSB 4G9YA 2LDUA 2MKIA 3CPWR 2V1XA 1IZ1A 3NNHA 2J5PA 5DDGA 3V4GA 2Q0OA 4LJZF 4N0BA 2DH7A 3ECHA 3K1MA 2EJRA 1RZ4A 4P9UA 1UHWA 3ERED 1F4KA 2N3OA 1DDNA 1U6GA 1ZLJA 1LJ9A 3P49B 3EQLF 3F8FA 3UD4P 2DNGA 1XD7A 3KZYA 5JVGQ 1TW3A 3WODF 1X4AA 2IP2A 2EK5A 2NZ4A 1YIOA 3GO5A 2V94A 4KN7X 5BS6A 1N88A 2DNNA 1XSDA 3MI7X 2KM8C 1VBXA 2PG4A 4LG0A 2ZMEB 3V7CA 1SFXA 2Y75A 4XBFA 4W92B 1SD6A 2BBYA 4ZKAA 1Z9CA 3QOPA 4IOCQ 3E5XA 1TQIA 5LJ5Y 2E1CA 2KYXA 1BN5A 5H6RA 4GXOA 2KVIA 1U6FA 1T2KA 2G9WA 3GYHX 2L08A 1IN5A 2A07F 1UP1A 1IXRC 3BS9A 1IW7F 1X4HA 1ZRFA 2DGUA 2E5HA 3Q9VA 3F8BA 2OSQA 2MBFA 1FYKA 3VODA 5HLHA 3F8MA 3VAMA 1O7LA 1QBJA 3WGHA 2QENA 3O2PE 4TU7A 2FEZA 5L3DA 2TDXA 1U1OA 2MQQA 3WGGA 3EETA 4G8XA 1M90T 3E97A 1UFMA 1HKSA 2FXAA 2P6TA 1HD1A 1BI1A 4I09A 1OKRA 2F5FA 5HS7A 2J0SD 3ULHA 4ESBA 1J7KA 1D3YA 1Z05A 4IXAA 1X4DA 1QQIA 3K0LA 1R23A 1TBXA 2M8EA 4I02A 2ZNYA 1MKMA 3CUQC 1MGTA 3DF8A 2UZKA 2J8AA 4GYGA 3ULQB 2MKKA 1U5TC 4FX4A 4PZJA 2DLLA 2JRTA 4KDPA 1G6NA 3HSEA 4TU9A 4EV0A 4NQWA 1YW9A 2R7DA 5D5XB 3OW2R 5DCMB 2KRBA 4M73A 3ZP5A 4KN4X 1QPMA 1XGNA 3HI9A 1WTBA 2HEOA 1Y0UA 3SFZA 3C1DA 2MLGA 2KN4A 5DDQC 4RU2A 2DQLA 1PGZA 2VT2A 4U7BA 1OWXA 3NMRA 5K1YA 1YLFA 3GFLA 2B0LA 4M9SA 1WHYA 4GO1A 5DM6Q 2DK2A 4FXWA 1BJAA 2PBIA 2VOPA 2O3DA 2LA6A 2X1BA 4CGZA 1T38A 1B9MA 1MDMB 4KICA 2ZJRQ 1XCVA 3QU3A 1BIAA 1DPUA 1U78A 1R1UA 2MA3A 3CCMS 4OIPF 2STTA 1HL6A 1W7PD 2FHOB 3T1BA 4WCGA 1SJ3P 2HGCA 4ENKA 3F72A 4UVCA 2EWNA 3QPHA 3F21A 4J5OA 3WE3A 3FXUA 3H92A 1BI2A 3MDFA 2NYXA 3R0AA 2ADUA 4A6EA 2LEBA 5TRDA 2O6GE 2M45A 2RS8A 2LEAA 2KJCA 2KT5A 3PQJA 2Q79A 1FYMA 3HSFA 3ZZYA 2CQCA 4E70A 5MLCV 3TOAA 1I6XA 3FEYB 2LF7A 1G3WA 3HTUA 3BZ6A 3SHFA 4CH0S 1SXLA 1HSTA 2ZJ2A 1FSHA 2HKXA 3L09A 5E1WA 4A0ZA 4ENJA 1KU2A 2AXLA 3SQNA 3HYIA 3UCGA 2CQBA 4MTDA 2EFQA 4EGZA 1KU7A 3WG9A 1SFEA 1HD0A 2DTRA 4UHTA 3H3UA 1WF2A 2X1FA 1QVGR 4WK8F 1FT8A 4M9ZA 5DD8A 4M72A 1O7FA 3ABUA 5HS9A 2ADBA 2DGVA 5AIQA 3BOQA 1SJQA 3RKXA 2ZJPQ 4AVPA 3FEXB 3EUHA 2DK8A 2LXUA 1VQOS 2L3DA 3BJOA 3ML6A 5CXTA 2KM8B 1X5OA 1YWXA 2FQ3A 3GZ5A 2W25A 2F5CA 3LAPA 1FP2A 4HQEA 3CTAA 1NJIT 2HGMA 1HXDA 2N7CA 1W7PB 2WWYA 2DNRA 2E5GA 1JHHA 2XAQA 4L18B 2F9JA 1FPQA 1VTNC 3LA3A 3CCSS 2EK1A 4PDKA 3GVAA 4L0YB 4TV7A 5ERIA 3M8FA 5LGTA 3P9IA 3CUOA 1IQTA 2E1NA 5D6EA 1USSA 1UB9A 3HUGA 2DGOA 2MQPA 1E17A 2WC2A 2FPHX 1YS7A 5HO4A 4A8XA 3KP2A 2MD5A 3BY6A 2A6EF 1R8HA 4MQVA 4IRGA 2QFJA 5LGNA 2HGNA 1O57A 1T0FA 2H27A 1WG1A 2BV6A 1ZHFA 4S04A 2FNAA 2PEXA 1DP7P 2F9DA 2I2YA 5F64A 3JAMK 3G3ZA 4G94A 2GXGA 4LLNA 2MPUA 2PN6A 4LLLA 3WU0A 2M70A 2XV4S 4HF1A 2KIMA 3I4PA 5BMZA 4HYEA 1U5TB 2RV8A 5FLXK 5DCMA 3HRMA 5K5QA 4BHPA 2DHAA 4CH1A 4L9JA 3VAGA 5DEQA 4HBLA 2HQRA 1G3SA 2QVOA 1XDSA 1IXSB 3VB2A 1FXLA 2CFXA 5E8GA 5A2QK 4O3MA 1XGOA 4XSZF 2CGPA 4N9IA 3ZMDA 2WV0A 2F5EA 2W24A 2XAGA 2LYVA 3HRSA 2RC4A 2ZCWA 4AWXB 3JAMZ 3VAHA 2DQRA 1MDMA 3GW2A 1B9NA 4JBAA 3T5XA 3K0JA 1ON2A 2XS2A 5E18F 5FLXZ 1B6AA 5IT9Z 4G7ZF 3RYPA 1VQ8S 3FX3A 3LFKA 3N97A 3E3VA 4QPTA 2ISYA 4L9VA 3J80K 3JSOA 4IHTA 1WG4A 2GA2A 3K1PA 2DGSA 2LQ5A 5A2QZ 1X4FA 2GIVA 4WFAQ 2CQ3A 5E8IA 2NNNA 2M0GB 2FBKA 4FHTA 1VQ7S 2G0CA 1S7OA 3GEZA 1P6RA 2FBIA 2MB0B 4EJUA 1HKTA 2L41A 1X3UA 2JPCA 2K3KA 4OZ0A 4LG0B 1B1BA 1WF1A 4U0VA 1H2TZ 2YU3A 4JK1X 4U0YA 2K4BA 3DXJF 2RVCA 2M88A 1YO5C 2Y48A 4HX8A 3KEQA 2DNKA 3VEPA 2CPXA 1S8NA 4LK0F 4IF4A 3RPQA 3R0JA 1A04A 1HW5A 3I59A 4DQ2A 5JFRA 1UW4A 4HOBA 2BZ2A 1RUOA 2FBHA 3TO7A 4HX4A 3HHHA 2YH1A 2CYYA 3R60A 4JQFA 1ZLKA 2CQGA 3HHGA 2EV5A 2IT0A 3US5A 4KIGA 1ONVA 4RB2C 1GVJA 3CC7S 5D5VB 2QQ9A 1CF7A 5D8LB 2L9WA 1VQ5S 3LSTA 3LA7A 2R3SA 1ULYA 3VFZA 2O0YA 2VODA 1S6LA 1KYZA 1D9AA 1JE8A 4HZFA 4CIOA 1R22A 4G6DA 2MZRA 2FC8A 3UCUP 4L9NA 4Y15A 2DO0A 2DNZA 3V8KA 3RPUA 4MHGA 3NNAA 2DISA 4UVBA 5DYMA 1U1KA 3MFKA 2KRRA 2FE3A 4BHCA 3EDPA 5HDNA 1M5KC 2ZKZA 2X1AA 2OU2A 2CQDA 2KXNB 3B4DA 1OYYA 3FMSA 1RUNA 2STWA 4MEYF 4ZH4F 1SJ4P 1X4BA 4PGGA 2Z5UA 4ETSA 2ZXJA 2HR3A 1MJ9A 2M30A 3CUQA 2RS2A 3VOEA 4WF9Q 5EEGA 2AYGA 2K4JA 2MLKA 1U5TA 2O03A 3MQ0A 1VBYA 1IN4A 1TNTA 2A6HF 3IRWP 3GXOA 3CF5Q 1WEYA 2DHSA 1SJFA 3ABTA 3H3ZA 4RB0A 5JVTA 2DI3A 4EM2A 2MHNA 1SD5A 3KCCA 3L00A 4ESJA 5FO5A 2ERRA 1OYIA 3Q5FA 3KP5A 5CVIA 1U1RA 3WTZA 3RI4A 2KFYA 2GZWA 5AIPA 1H2UX 2WTEA 5CA5A 3CXCR 4Y17A 1MJBA 2FNPA 2P7VB 5ITHA 5DDPC 3KLOA 2JRSA 4LK1F 3N9UC 3F3XA 1VC6A 3ZMUA 5LSOA 4P55A 2HZTA 1WI9A 2DNLA 2RGVA 2DBBA 4UQTA 2X1GA 1U1LA 3EYIA 4Z2YA 2KRFA 4A2UA 2HZCA 2U2FA 1JJ4A 4HAMA 3FMRA 3KP7A 2K86A 5LLQA 3S6EA 1ZARA 3PIOQ 1HW2A 2RT3A 3TDZC 3CTRA 2IA1A 4ENNA 2VC0A 5LBQA 1ZREA 2YTCA 4P5OA 5ICFA 2L4MA 1K9MT 1FOKA 1LDKB 4IRHA 3F23A 5DUIA 1BM9A 2RNEA 1H9GA 4MTEA 1K79A 1L3KA 2NLWA 1S72S 1U2WA 1QZYA 2DNQA 5E1ZB 1BI0A 1ODDA 3MAJA 3WTUC 1ZRCA 3RIRA 2VBWA 3M9AA 2LCWA 3D5LA 3UCZP 3FM5A 5GAGU 4WCEQ 2DT5A 3DQVC 2UXNA 1J0RA 1ZH5A 1KU3A 2OJ3A 5CVJA 2ZNZA 5LRRA 1XSXA 2QEXS 2BOPA 2ADCA 5LGUA 5L3FA 1DBDA 2L54A 3COAC 2DGXA 5DV5A 4GGGA 1HKQA 1K78A 3E6CC 1X5SA 1N8RT 1DPRA 3CCUS 2P6SA 5TJJA 3IRQA 2ISZA 1YJWS 5LHIA 1VQNS 3RW6A 3IRRA 2VC1A 1XMAA 2QYOA 1DRZA 3DV8A 4MQ9F 3GZ6A 3TDUC 3T0YA 3OOPA 2JVOA 1FYLA 1J5YA 4Q47A 1J9IA 1Q81T 2XGXA 2M2BA 4Q5SF 5F6FA 5L3CA 2O3FA 2Z33A 1A9NB 1JXSA 1V3FA 4WFNQ 2K02A 1F9NA 2F5DA 1XMKA 3G9CA 2F3JA 4ED5A 2MY7A 3DPLC 4ZZLA 2XHKA 4YG2F 1UAWA 3SZPA
chains in the Genus database with same CATH superfamily
3EZOA 3FCVA 2H8WA 4RUAA 2CPDA 2WAQD 3UWTA 4I2QA 3VF0B 2B43A 2H09A 1TUVA 3HKZD 2Z58B 4M3GA 5ICCA 1RTJB 3L7PA 1S59A 5DM7Q 1WJDA 4NHJA 4CCHA 2JOQA 2IPOB 1JI8A 4EJTA 1AOYA 1RC9A 3SSSA 1NJXA 2GMHA 2R8HA 4LF7J 5EGOB 3BR2A 2RDIA 2OPSB 2I8EA 3A8KA 5FGMA 1KU9A 1PBUA 4DBQA 3WDOA 4BAYA 3TA1A 3LSJA 1F9HA 4BHBA 4DR7J 1KSPA 4FETA 4LMYA 4ZK7M 5B3SH 1IRXA 3RJMB 1JLAA 5F0WA 5F8MA 2W7OA 4P52A 5K20B 2D7SA 5IQQA 4H54A 5GAHU 4LR9A 2BA9A 4DCPB 1U48A 2LDYA 1TC3C 1NMEB 4AUXA 4FKXA 2L7FP 5DM7F 3F6OA 3RPUD 3KNAA 1C4AA 1RT5A 2HRTA 2QRRA 3Q2SC 3RAMA 3TWZA 1OSCA 1FBSA 4I6ZA 3DMJB 2X1DA 4ES2A 2VQLA 1D8ZA 2CRGA 2XAFA 2XB2D 3QPLA 4W97A 2XZTB 1ACMB 1JKOC 3PIPQ 2Q1LA 2UVUA 3ZQGA 5HQ8A 1YZ7A 3CGIA 2QA4I 1HWIA 2ELHA 4BDPA 3IKVA 2UP1A 3F73A 1VHFA 5D4NA 3ZTOA 3CCLI 3CJTA 2XSDC 3HRTA 4EO8A 2W01A 2QA4S 1QTNB 4YELA 4XKCA 4XRFA 3ENQA 3I59B 1LE8B 3LPEA 3LP0A 1T0TV 1SMYF 4PYDA 5M2UA 1SMTA 4MH8A 2Q43A 3IMQJ 3CCLS 3PIPF 1IRFA 2EBGA 2DR9A 4R25A 3WTYC 3CDHA 1CVJA 4R0EA 1R0AB 3CCQI 2EKNA 5LHGA 3JCUC 3MM9B 1NHUA 1S49A 2E1AA 4RB3C 3JRCA 2VQEJ 2OQGA 3ASOH 4P74A 2R5ZA 4TQRA 3GLXA 4P1WA 5HMYA 2LMDA 2DNPA 3TO9A 4LF7F 1R49A 3M8ZA 2HKOA 3CCQS 3C66A 3M6UA 3QJPA 2DB1A 1RUSA 2CQHA 4DR3J 3SDBA 4DR7F 1IF1A 3H40A 3KTQA 5C4JJ 4KKOB 1B0PA 4Y2IA 3UR0A 3JR9A 3HFKA 1WKKA 4K8RA 3BEGB 2YPZA 3JAMY 2OTJI 1IN7A 3CDEA 5A8WB 1ZBTA 2JX2A 2Z9OA 2KRCA 1XR5A 4DG1A 3TAQA 2B7EA 4I4BA 3PKYA 2DRDA 1VRUB 2LVSA 1X5TA 5FLXY 1M5VC 3MAHA 3MTKA 2P5KA 2HGLA 1ZQ3P 3AJ1A 5CPRB 1CC8A 2CKWA 2OELA 2OTJS 3LQRA 1FP1D 1OQ3A 3HOWJ 2K2PA 4NRUA 1IDZA 2FC9A 1CLFA 3S2WA 4YUDA 1KOHA 1YRNB 5HLGA 2Z2MA 3W64A 2GZOA 4IL6C 2ZZNA 4BNCA 4YB1P 5GVQA 4IVNA 4NYZA 1S7HA 4MFBB 4U7CA 3OYJA 3EMTA 3U2RA 2BYVE 4P71A 1EP4A 3FCWA 3LL7A 1JLQB 2X48A 3K17A 4J90A 2IAJA 3C2BA 1GAOA 5HJXA 4L9TA 3DDNA 1GMWD 1UAAA 4LB5A 3T8TA 2AS5F 1IRZA 2R3VA 1DY3A 3FK4A 3I5CA 3CDIA 1YBUA 2C6YA 4ZPCA 1JK9B 4DFJA 4ED6A 3Q83A 3TO6A 2DR7A 4YOEA 3W9HA 2IMOA 2QT7A 3ZFVA 5L9NA 4BBSJ 3MCMA 3WU1B 1YGYA 3FMQA 1B72A 1ZOTA 2J0QD 4OOIA 2NVUB 2DJWA 2O7OA 5A2QU 4ZLNA 3M8EA 3FBCA 2DO4A 4C8LA 2DMUA 2CWEA 2RAEA 4DV7J 2QLZA 3F8NA 4CDGA 1JJ2R 2VA3A 2QO3A 2E1MB 3O6BB 3ZN1A 3PYFA 4G7HF 2X4HA 1WRJA 3GWZA 2MSSA 3MECB 5HDGA 1EHWA 2Y0BB 4L5JA 3D0IE 4KV8B 2C22A 1U6BA 3W8GA 2CPZA 2AT1B 4BS9A 2Q3PA 4DR6J 2ECCA 5KFKA 1HIYA 5IPAA 2D5VA 1ZYQA 1MG7A 4CH7A 5D4RA 4P75A 2DFIA 2A2DA 3EGNA 3IC7A 4OX9J 2SXLA 1MU2A 3M3YJ 2VJ5A 3SXLA 3C2GA 1WJEA 4QWDA 5ADZA 4XKVA 2MHEA 3PW2A 4B4CA 2BJ9A 3PYDA 4KGVB 3L2QA 2BR0A 3JREA 3OR1B 5BOXA 2DFEA 2G4BA 2HQFA 1Y4ZB 4PG6A 1WCMJ 1Z3XA 2DNHA 1NDPA 3I53A 1XTZA 3QP5A 3HHEA 4OIRF 1YJ9I 4IQJA 4YMEA 3REOA 1TL4A 5JUMA 2BBEA 2UXXA 1WC3A 5GADU 4NB5A 3ICLA 2XKPA 5L3EA 4ZP6A 2BANA 1SQFA 4XOPA 1BW5A 4A8MP 1D8KA 5KG7A 5IV3A 3B02A 3HCXA 1ON1A 1D3WA 2GMLA 4IQXA 4HKQA 1YJ9S 3S2HJ 3SZTA 1GXTA 3NNCA 2RH3A 3D6MB 2V8PA 3TP2A 4HNTA 1FVSA 3QAEA 3CW2C 1RHQB 2BXYA 2HHHJ 2X1EA 1YKWA 5L1JA 3CJ0A 4DV7F 1QRYA 4KO0A 5GAEI 4ZITA 3OUYB 3IWFA 2K3IA 4CCMA 4C3KA 4IG3A 2M8DB 4PFPA 4MKYA 1T9TA 2KZZA 5EN1A 1EV7A 2R0QC 4HDGA 5EZGA 1DLOA 4Y2CA 1HQUB 2CQQA 4Y13A 1GUUA 3DYAB 4AQYJ 2QQAA 5LMUJ 1R8CA 4I01A 5BNGA 3H90A 2P4WA 1MSEC 4OX9F 2GQCA 2R92J 2LREA 5KG2A 4BXFA 2E1PA 3D9BA 2OLWA 3ECOA 3FF5A 4LD5A 1AUDA 1R4NB 2XC9A 3OS1A 1XMOF 1AWCA 2M9KA 2IM3A 4LSLB 2QSHX 2ZH6A 4J9KA 4NA2A 2GIQA 1U0HA 3T5KA 2I1RA 4NLGA 4R8UB 2HMIB 5F9NA 4PGHA 1POGA 1PCAA 2QLFB 2E5LJ 3KZZA 2WB1D 4J9OA 1WQ2A 1CS4A 1XDUA 4J9MA 1N5QA 3EGWB 1RT6B 4U7UD 3FBIB 2RSQA 3BZKA 2LK2A 3H5NA 2GXBA 2ZJQQ 1NSKL 2LY9A 2CUFA 1S6PB 3C19A 4I7HA 3TEDA 2CH0A 1S9FA 2JDJA 1HQEB 4ZYGA 3NS6A 4RL1A 1G2EA 3W9IA 2IAIA 4EBCA 5LFAA 3BH7B 1APSA 3AQOA 3H4DA 1BR4A 2FQQB 3G8QA 2QWWA 1YG0A 3D5SC 3Q2TC 3I0RB 4JUZA 4QIEA 4BY7J 1YTYA 2G1HA 2VJVA 2V9WA 1I51B 1EH8A 4PK4A 2NZCA 5KK1A 3HZEA 3MKWB 2ZJQF 4CT8A 1WGXA 2NRAC 4II3A 1HNIB 1GMWA 4AXIA 3KP3A 4F04B 2K9MA 1FX7A 3FXOA 3OFHA 4NLSA 2ZSIB 3ZN0A 1IM4A 4Y6IA 4M95A 1GXPA 3I0SA 4G6QA 3IKTA 3PEJA 4ICLA 4M5KA 2OZUA 2L9RA 4LF5F 3RUBL 3KHHA 4ES1A 1PUEE 2HFNA 4HA8A 3H5AA 3KOAA 4BEHA 1JUMA 5FFXA 3I64A 2K06A 2Z3YA 3TUPA 1FT9A 3KNGA 4YFKF 4F67A 3A02A 5IQ6A 4KHPJ 1VLOA 4M5DA 3HOSA 2VKHA 4CTAB 3MCOA 3MMCA 5LEKA 2XGEA 4MNUA 8AT1B 3UVJB 1WG5A 3ETOA 4LBPA 2CV0A 3GTLJ 4PRFA 3EE3A 5CYVA 1ZYRF 3Q24A 4USHA 2RVJA 3OV7A 2G7HA 3J7AY 1Q82T 2E5LF 1F5TA 2LDIA 3OXGA 4GMKA 2YR2A 4DDFA 2VUGA 2O5DA 2MGZB 1OR7C 2F8HA 1CQTA 1QO0D 3OYBA 5K5RA 4XORA 1HNZJ 4CLZA 2UUWA 1F5CA 4PXEA 1VS3A 3QT5A 3GIRA 4UB8C 2CNNB 3T1HJ 4KHRA 2ACJA 4BHQA 4GVLA 2E44A 5L3GA 4QIGA 1IBKJ 1JLCB 1UA1A 1DTQA 3TJAA 4F91B 1Z6RA 3MR5A 1AA1B 4CLSA 1U6ZA 4WP8A 3SJMA 4Z2XA 1YOVB 1RWWB 5C7PA 1P9YA 4E0DA 1WH5A 1GDTA 2PI5A 1S1VB 2IS2A 5AT1B 3GTJJ 3A12A 1UPPA 4DR1J 5GADJ 4C2MA 1CQMA 1PBAA 2X85A 3CDUA 3MAQA 5H1SV 3AL0B 2FJVA 1YG2A 2EA2A 2DMTA 3K2ZA 1SKUB 1WC6A 1VHIA 4KT5C 3MOJB 2ZKTA 1FOWA 1RT4B 1SANA 4C11B 1UFLA 5EEHA 2IRXA 2I5JB 3I54A 1J2VA 4LFUA 3KEOA 4BJ6C 2HLUA 2RUSA 5ILVA 2ATLA 1YBAA 3HGYA 4ECYA 4PAAA 3MMBB 5KFCA 4KHPF 1NXIA 3G6XA 3N79A 2BKPA 4E7KA 1HSJA 4DV5J 3JTOA 4OV1A 1RT1B 4FS1A 2JTVA 3QZ8A 1JXVA 2X0LA 3AD8C 2E35A 1BD6A 4CO5A 4S05A 2BQUA 3VCDA 2OD6A 3CJNA 4F2RA 2IJLA 4NLQA 1QM9A 4K4VA 2HDCA 2YNIA 2M4MA 4RDUA 2O8XA 2HS5A 3THTA 3FGVA 4DSLA 2AWZA 3S16J 2HBYB 2EILH 2Q2EA 1HNZF 2ZB9A 4Z7YA 4ZYHA 2ZVIA 1A6QA 4KA4A 4CZZA 3IH2A 2NPFA 3AODA 2KVQE 3HOUJ 4IOAQ 1SAXA 4DV2J 1PYSB 3RW7A 3NS7B 3FMWA 1CJVB 3TP3A 1OMIA 3E7LA 1PSDA 1IBKF 2P8IA 3K4MA 3CCVI 2XY5A 2ZSHB 5FFZA 3K5MA 1D1BA 1RBAA 4YB5A 1Q7LB 5J2PA 3BKFA 2XUBA 5K8MA 3R27A 2BY1A 4OI6A 1R5HA 2VFTA 5HBMB 2WCXA 4LITA 2Y30A 4XN3A 4RW8B 3ZZZA 3KLEB 5CVVA 1WOPA 2V1DA 3H2VE 1FMWA 3B4MA 3CCVS 2EFWA 3MUTP 1UFKA 5IYCJ 2CNLB 1VF9A 2DT9A 3G82A 3KXDA 5IT9K 3BGLA 2DRAA 4IOAF 5G0RA 2UXDJ 4E6KG 4XAKA 1KQ8A 2FRHA 3P7NA 2C42A 2LY2A 3V8JA 5IP9J 3NGDA 4OQJA 2R8GA 2HNHA 2LQJA 1SIZA 2OEKA 1HR0J 3C18A 4P9FA 2OKQA 3SQGB 2GM4A 1E3PA 5ETKA 1RWMB 4TYBA 2BRKA 4DV5F 3PKMA 4X4NA 3HIFA 2GIRA 2R7WA 2JHEA 3Q8YA 1FY7A 3HLUA 2ZD1A 3BJAA 3RBDA 3L95X 3VVUA 3SFGA 3QP6A 3DHWC 2BW3B 3WC0A 2HVZA 4U87A 2CW0F 4M3BA 2WVFA 5FKLA 3V6DB 4QWQA 4NCAA 4A3GJ 2KP6A 5GPAA 2Y31A 2DGQA 1N54B 3KUHA 2W8LA 4OI0A 4RX6A 4Q0BB 4E2FB 3QT8A 1U45A 1F43A 1AYEA 4AL7A 1HC8A 1P4AA 1QE1B 2CNOB 1R3NA 3KP6A 3W5YA 3M4XA 3DLEA 4DYCA 1AT1B 1U1QA 2DCLA 5A6WA 1LUJB 4AIHA 1WF0A 4FYDA 1Z6TA 4II2A 1EKSA 3DKWA 4FF4A 5B09A 1ZZFA 2MLZA 2PC6A 2MD0A 3THVA 1HBOA 3GYXB 4FNHA 4I68A 2DHXA 1Z1DA 4F25A 4KTQA 4OFZA 5B0DA 4K0KJ 5HVQC 2E2JJ 4H4KC 3WTSC 4PG7A 4JX5A 4BQQA 4CLUA 1BI3A 5HVFA 1KEKA 4EATA 2R9LA 2UXDF 2YNGA 4ZA1A 1N78A 1MH3A 4XNFA 2D3UA 2QQBA 4K7QA 4QWBA 3PQKA 2W4SA 4L73A 2L0KA 2B9WA 1Y6IA 2ZH3A 2ILZA 1WDTA 3RQ4A 1D0EA 2BV3A 2DIVA 4O44B 3KK1A 4M9XA 2JRMA 2DHGA 2MLYA 2V68A 2AHQA 3P5BP 3QBCA 1Z3YA 2IS1A 5DQIA 4BWMA 1UG0A 3MR2A 2C2OB 4OYPA 2BE9B 2OA4A 4XSXF 1WNEA 1I5OB 3DXBA 5H9FK 3MUMP 2VQCA 2QYGA 2VG5B 3LAMA 1AZSB 5D0HA 3VZHA 1ZA1B 2Z8QA 1TL7B 1UFWA 4EM0B 2LLZA 1ZM3A 2PFFB 2OMOA 2GAUA 3EVMA 4ZVUB 4XLPF 2MKCA 3WHIA 2B9EA 4TVAB 5C25A 1GTEA 3V42A 2R7FA 3FZBA 4BQNA 5IS2A 4DUYF 2CZ4A 4EJVA 2M52A 1Z91A 1S9GA 1TZ0A 4EGYA 3AH6A 2VT3A 1RT7B 2X3GA 3BQZA 4K4TA 3FKJA 3GTQJ 1U49A 2XHWA 4LQ3A 3BROA 2K7JA 4F4XA 5HLFA 4UY8I 2BJEA 1DUXC 5FKMA 5B0CA 4F3QA 4HV6A 4K0KF 2Q6BA 1OYDA 4ED7A 1T3NA 5T7LA 3H42A 3ELKA 3DLLQ 1OR7A 1Z2ZA 1B4AA 5IT0A 2RU3A 4GKJF 4OJGA 3VSKA 4G9YA 2LDUA 2Y1IA 3WX8A 3MM5A 1FX2A 1IZ1A 1R4MB 4ZYAA 4FQGA 3CF5F 5DDGA 3VYRB 3V4GA 4X4VA 2Q0OA 1EJ9A 3R7NB 1NNDA 2IM0A 4HI1A 5KG0A 2N3OA 1U6GA 3MEEA 4EMDA 5DG9A 2B8QA 3DOMA 2PA8D 3UD4P 2DNGA 3IRXB 1TW3A 3WODF 1AB8A 2DXEA 1X2MA 3LO3A 4OZNA 4W4MA 4RNMA 3DLLF 4DV0J 5HROA 5ETMA 2DNNA 1XSDA 1VBXA 2ZMEB 4W92B 3ZZUA 4M5MA 4ZKAA 1Z9CA 5KOXA 4C2UA 1AKHB 5CABA 4OI1A 5BR8F 2Z2ZA 2LEPA 5LJ5Y 1KFSA 4FASD 1BN5A 2EBEA 1U47A 3J7ZI 1G6BA 5C44J 3LGHA 1IN5A 4PUOB 3DOKA 4YB6A 5K5MA 2AEMA 3D0HE 3ITHA 1NK2P 4DJBA 2ZKUA 2FVQA 3LUYA 2BE7D 3PJXA 1KLNA 1QD1A 2FD5A 3IH3A 3Q9VA 1WI3A 1EB0A 1HYSA 4JI4J 3VODA 4CO2A 3F8MA 1GV5A 3EUKL 1O7LA 1QBJA 3WGHA 1XG1A 3ZR8X 4D9JA 5L3DA 2FUG2 3BSCA 4PG4A 4DF8A 3DLHA 3HOXJ 4F3OA 1DQ9A 3G2BA 4AUKA 1HKSA 2P6TA 1BI1A 3SV4A 2Z2LA 1YZ6A 2O9LA 3HPOA 2F5FA 5D0RA 3SYTA 4LSZB 1RKTA 3ULHA 4IXAA 1X4DA 1QQIA 1TBXA 2ZNYA 4GVBB 2BJDA 4CM0A 1N5YA 4G65A 1SL1A 3PXGa 1EARA 1KLMA 2A6MA 3PYGA 3HDDA 4FX4A 4PZJA 1IWGA 5A8RB 3O8HA 1NH3A 4HL9A 1YW9A 2R7DA 2W82A 3DGPB 2H8RA 5HMZA 2NXUA 3A8EA 4DU7A 5DCMB 4B3OA 4YIRX 4KN4X 1XS9A 4XIUA 1XGNA 2WK4A 2HEOA 2DTZA 4RU2A 1PJ5A 4ZCMA 3RB3A 1TL3B 4XKWA 1S76D 5HODA 1TP7A 4DL3A 4DV0F 3CD0A 2FVRA 3LALA 3TA2A 1UWBB 5DM6Q 3AD9C 3ZTPA 1F60B 1TV6B 1WPKA 2OMLA 4A3EJ 2EZKA 1NKBA 1JXEA 4S0HB 5H2FC 2ZJRQ 4ECWA 1BC6A 2MA3A 2Z2SB 2STTA 2ROGA 2W7PA 2FB0A 4FN5A 4X1EA 4ENKA 2E1RA 4YS2A 2EWNA 1JLGB 3F21A 4NLVA 4MYUA 3FXUA 2FX0A 1RU2A 3CEDA 2ADUA 1LW2B 2YNFB 3DDIA 2H1YA 3SEOA 3GJSB 3QODA 1Q8BA 2KJCA 2KT5A 3PQJA 4NZ6A 3MHYA 3ZZYA 2CQCA 4E70A 5MLCV 3FEYB 5DM6F 5EEAA 5LM7E 1RWUA 1SXLA 1TWGJ 5KHDA 1TKXA 2XF7A 3TQEA 1XNRJ 4PPDA 1NK3P 1RACB 4NI2B 1HNXJ 1TR0A 2K5CA 4EGZA 5EDNA 1HD0A 4CLWA 3HVRA 2DTRA 4UHTA 3H3UA 1FTTA 1QVGR 1FT8A 2RJZA 4OJHA 5DD8A 3W3CA 4M72A 4LF1A 2RQQA 4IG0A 1AXQA 1U8BA 2DGVA 4RW7B 3FK6A 1DQUA 3RKXA 1HPZA 3BCBA 5F8IA 4AVPA 1S1WA 3VGUA 4PWDB 3W60A 1SQGA 4X4RA 4URGA 2HNYA 3DRSB 3OR2B 5F8JA 3GZ5A 2N7YA 3SCIE 3DGVA 3ZC4A 3GG0A 4XLEA 2F5CA 3VGTA 1D1AA 3GV8B 3CTAA 2QIFA 1QDUB 5D4PA 1NJIT 5EG0B 1HLWA 2Z30B 1W7PB 2HHTA 2WWYA 2E5GA 3M9NB 1FPQA 3CD7A 1X1BA 1NDLA 3LA3A 3Q8UA 2EK1A 4L0YB 5ERIA 5C3EJ 3M8FA 1YJTA 1RAOA 4H4KA 4OZJA 1PVEA 3CUOA 1IV6A 4Y65A 1N0VC 2GV1A 2DGOA 2E19A 5KFMA 1E17A 4OJ3A 2ZXWH 4KYZA 5GAHI 3LGNA 3BY6A 4MQVA 2QA1A 1IR0A 2BV6A 3KZIC 4S04A 2E60A 3CJKB 1UVLA 2OHDA 4CA0A 3BTLA 4YRVA 1WJ9A 2CS3A 2HFOA 3A13A 3G3ZA 1UVJA 3BGUA 5IT9Y 3KG4A 4LLLA 1WC0A 4OLOA 5L9XA 4A3FJ 2XV4S 4A3CJ 1XNRF 1OCTC 4HF1A 3ILLA 5H9EJ 1K4TA 3AA8A 4WZMA 3HRMA 5K5QA 3OXLA 3BG9A 3RBEA 1TWHJ 4C2MJ 3OQ2A 2HQRA 4M6VA 1IXSB 1NH8A 3VB2A 1NDCA 1DTTA 5E8GA 1S7IA 2V0NA 1RAHB 1XGOA 2CQNA 1M1EB 1OY6A 3ZMDA 4KAIA 2K9QA 3H9QA 2AZ1A 3HRSA 2UUTA 4PJMA 3PRBA 4K4XA 5CCMA 1IG7A 3DLKA 4AT1B 2DQRA 3CJSA 1W26A 5DGAA 1FWKA 5C42B 3V81A 1RXOB 1RYSA 2DPIA 5KFRA 1LKXA 3E3VA 1BGXT 2B6AB 3TZWA 3HSJA 2V6EA 4B9UA 1NSQA 4DPTA 4ER8A 5FD1A 3LW5C 4L9VA 2HSEB 2BKNA 3Q8PB 4WTOB 4IHTA 1WG4A 4BE2A 2LQ5A 2DGSA 1RAJA 2FJBB 2GIVA 1T03A 1S1XA 2NNNA 3EGVA 2EEYA 4DL0C 5J2MB 3HP6A 4MFEA 4PPZA 4ZIVA 5F8HA 3GEZA 1P6RA 4U6PA 3TAPA 2L41A 4V19J 4U0VA 3DN9A 4DQIA 3DXJF 3DM2B 5FIIA 1N6QA 2WW4A 2VKVA 4NA1A 3S17J 1ETXA 1LWCA 3EJMA 3VEPA 2CPXA 3KYLA 3CJRB 2JSXA 1Q4RA 3RPQA 2G2ZA 5F1JA 4DQ2A 2BZ2A 3Q89A 2X6OA 2FBHA 4Y3OA 1VQ5I 3M6XA 5LOQA 2HWHA 1HA8A 2CQGA 2YWWA 3HHGA 3GIMA 1ONVA 1R71A 3R5AA 2V69A 4LFAJ 3I6PA 5LD2C 2L9WA 2XMJA 3TX8A 4CO3A 3LSTA 1VQ5S 2R3SA 2O0YA 4FISA 5JMNA 2C2NA 1R43A 1JE8A 2HQCA 4KBIA 2EFVA 3JRHA 1RT3A 4G6DA 4JI1J 1OCCH 2GHWA 3NWGA 4Y15A 3SZ2A 4L6V3 1MBEA 3PL8A 3JSMB 1S9HA 2ZH1A 2CMPA 1AU7A 2IA6A 3RBXA 2C3YA 1WDDA 4X4OA 2V4RA 2GXAA 1WFXA 4BHCA 4C8OA 4NQWB 2VKEA 3ZQCA 3SI8A 2VPWB 4B47A 1TT5B 3B4DA 3CJ5A 2DJIA 1RUNA 4B3AA 3KLGA 4DYQA 2Z5UA 4D5FA 2RE1A 3I9V2 1R8AA 4OI4A 2ZXHA 3VOEA 5CCLA 4XLCA 3AXKA 1V5VA 3IS9B 1VBYA 2L5QA 1IN4A 2A6HF 1O4XA 1F9EB 2HHWA 4MIMA 5G4DA 2DHSA 1TAUA 3G6VA 3H3ZA 1LW0A 2DI3A 1RETA 4KPYA 2R2RA 4NMXA 4F4YA 1RESA 1SD5A 2MHNA 2BW2A 3Q5FA 2JMWA 3RI4A 1IJEB 4NASA 5CA5A 3HJFA 4LBIA 3BPSP 1MJBA 1NK9A 1AA7A 4ZMMA 1VC6A 2UUCJ 5LSOA 3GTOJ 4YFUA 3M2VA 4P55A 3NRBA 4M63A 3V5RA 4J00A 1IKVB 1HBNA 1NSPA 3W5ZA 1OY8A 2DBBA 3GWCA 2X1GA 2HBZB 3EYIA 1CJUA 2W2QP 4LFAF 4A2UA 2V4JB 3U02A 2RB7A 3FMRA 2L9VA 2ZH9A 5HATA 3E01A 3S6EA 1HW2A 3MPVA 1U9OA 1TVRA 1S72I 2VC0A 5KFPA 1KN6A 1K9MT 4UUTA 3UW1A 5I3UB 1T8IA 3F23A 2HW3A 4PWWA 4B08A 1H9GA 1L3KA 1K79A 3OBIA 1S72S 1CEZA 1LK7A 3JSRA 5ETRA 5E1ZB 2OPQB 2UVRA 3MAJA 3RIRA 5GADI 1E6YA 1Y39A 3MWBA 1QVUA 1Y00A 2HHSA 4UZCA 1RTIB 2PSZA 1XSXA 1YJWI 2ZM6F 4ECTA 2JH3A 1OCRH 3GYGA 1AUSL 5KG1A 4DFPA 2YPYA 3QYEA 2W9CB 3VQSA 2P6SA 1FE0A 2HWIA 1YJWS 4KSEB 1K0TA 3ZO7A 3IRRA 2QYOA 3DV8A 3TDUC 2YKNA 2FJDB 1FYLA 2QL5B 1UJ5A 2D3O1 2UUCF 1NBEB 2M2BA 4IHWA 2UXBF 3TEHB 5F6FA 2FQ4A 2HHXA 1FDNA 2Z33A 1H0HB 2DJNA 4WFNQ 2NYHA 2F63A 3QNWB 2CFOA 3DPLC 4ZZLA 3LSRA 1BQXA 1ZTTA 1UMQA 2XHKA 2E9TA 1JJ6C 3UO0A 1UWAA 3UI3A 5FB2A 5KAFC 1U2CA 5AXKA 2B9YA 3QSIA 4LG3A 1Y5IB 3MMAB 4F7VA 3K4JA 2VOOA 3W2VB 2W9BB 3BPXA 2Z4PA 4RW9B 2IBOA 4MO7A 4PG5A 1N52B 1X4GA 2O5RA 5E3LA 1TZLA 3CMAI 5DTDA 3CIZA 5F1RA 4ED1A 3LMMA 4ABZA 2EIMH 4XKBA 3PFYA 1D9FA 2B0GA 3S3OA 1LFBA 3CMEI 2AX1A 5ILSA 1RB0A 1XC5A 1REVA 3BBCA 4PZVA 2HU9A 1J5EJ 1S29A 3GFJA 2O01C 3CMAS 5KT2A 4B17A 2FHJD 2EFGA 3P4UB 2MC4A 2DR5A 1OYWA 4F92B 5A76A 2LSOA 3PX6A 1LB2A 3CMES 3A8IA 3F0NA 1TL1B 1U26A 2PQ8A 9ANTA 4XIDA 2YWGA 3W63A 3L3CA 2FF4A 2PDAA 3PM1A 5IP7J 2A3SA 4DL5A 1QA6A 5EX3A 5JXSA 4O0IA 1Q7YT 2MABA 5D5WB 2GLOA 2P0WA 2CJAA 3MM6A 4DOZA 3TVKA 3HG9A 5HLTA 2Z56B 3MEGA 3ZTSA 4F0HA 4B8XA 4OZ1A 4B02A 3X2QH 3T6JA 2XGQA 4NPOA 1FZPB 3D3BJ 1XMBA 2E1MC 4WXCA 1E2XA 1BC8C 2D1VA 1XCBA 1GK8A 4ZLJA 2DT7B 4ON0A 3OS0A 3M8RA 3BTCA 5AE1A 3TZXA 1CULA 3QGIA 4B3MJ 2BM0A 2K40A 4ZOSA 3PX4A 3K69A 5ETVA 5DQGA 2VKZG 4ZLLA 4ALZA 4C3JJ 3H1CA 1IXCA 2QUFA 1SJ1A 3IAS9 1TELA 3RU0A 2WV1A 3QGPA 2QKLB 4RAZA 4F7ZA 4RBVA 1X4EA 1QAXA 4R8HA 2W1BA 1JKRC 3MTJA 2NQPA 2HOEA 2KI2A 3HVTB 4DV4J 1FE4A 2VG7A 3J7YU 4PR6A 1S6QB 2Z0GA 1NK8A 2V6CA 4OMYA 3NOCA 4OYBA 2FLLA 3M32B 1VC5A 4HVZA 3IAM2 2F65A 5IM0A 1IAWA 3ZQQA 3Q8RB 2DOAA 2LRDA 5CVUA 4H4OB 3ZCOA 1J5EF 2HHQA 1IDYA 2AJ0A 4K4UA 2D1CA 1QNTA 3EVWA 3GJTB 2VFVA 5EYRA 1XNQJ 2RQMA 4CO8A 4ELUA 1UVKA 3SCJE 1XC9A 1HDPA 3SMZA 3D1OA 2PEBA 2DPDA 2QA4G 3KJFB 4HTJA 3MEXA 3M8PB 1MD0A 1NDKA 1WELA 1RPWA 1U25A 3DPTA 1T39A 2RILA 2A10A 2VU5A 2NNYA 3OYAA 1W36C 4TLQA 2COLA 2R5YA 1IKXA 3G86A 5CYQA 4BS2A 2QG9B 1V54H 1FA0A 5I4MA 3K4KA 4AD9A 1CJKA 2VDHA 2ETHA 3PJWA 2Q1ZB 2DA4A 3HHLC 2P5VA 3BN4A 2LP4A 4OX7A 2RKIB 3JSBA 4EJWA 1I5ZA 2EC2A 1G4DA 1O6XA 3GU0A 1HQCA 1U2FA 4BXUA 1VRQC 2CJJA 3I0TA 2OPSA 4JYAJ 2A1BA 1FJGJ 4U88A 2B4VA 2O67A 4QU6A 2HYIB 2FOKA 4OHVA 3BDDA 3HSGA 4WYLA 1U2RA 2DK5A 4CWBA 1NPKA 4JI7J 3FXQA 1T3OA 3AOAA 4DV4F 1TNSA 4AXJA 4YEJA 4O3QA 1QHHD 5K14B 4I0BA 4L3KA 4LIWA 5J2QA 4JX4A 3JXOA 3ELHA 3TUIC 2VXZA 3HPGA 3LPYA 3JRDA 2JA2A 2DN0A 4P6QA 2LKPA 3N4MA 1WEZA 3LOUA 4X0GA 3I56I 1S0NA 4CXFA 1FI4A 4OYIA 3T6BA 3R2DJ 1I3QJ 3CDBA 4QYZJ 5K8PA 2RQ4A 4FE4A 4K4ZA 2DU9A 1Y1WJ 3MCZA 1CJTB 1R0CB 1ZK8A 2ROPA 5DLFA 2ZBCA 2HS3A 5L3BA 1MMSA 1IXKA 3L2CA 3J80Z 3I56S 1KD1T 4Q5VA 1PP7U 1UPMB 5F04A 3GLLA 1F0XA 4TNOA 3K8VA 1LE8A 2KHDA 3QIDA 2FMLA 4D3HA 4QR2A 1FK9B 4IUFA 1W36D 3GX4X 3CD6I 2XAJA 2AIRB 5IOZA 1MMDA 2VJUA 3MM9A 4CLLA 3C2PA 3BP8A 3OSFA 1XEZA 2YQ3A 3PDNA 2OFGX 3C8YA 2XY7A 5CD4H 3DRPB 3J80U 4DQSA 4F2SA 2HHPA 4RAGA 2XRNA 3CD6S 5KOWA 3KHGA 2D1HA 1RAIB 4QCLA 2JZ5A 5LSRA 3DCFA 1EZZB 1RLDA 2ZOFA 2OUGA 4UY8T 2YQ0A 5KVRA 2XPWA 3E8OA 4ZCLA 2PJRA 1VQYA 1NUEA 2DW4A 3F56A 1DZ5A 3VAJA 3PW0A 4ZYDA 1XPXA 4KKOA 2OAZA 1VBZA 1IBLJ 4OHYA 4EQQA 3OL3A 2VPLA 3PUBA 1U0JA 3M1EA 1KGSA 4WU2A 1F2GA 2ZBRA 3VGSA 3K5LA 3S7RA 3TVYA 2IBKA 4I2QB 5A8WA 2QF7A 1K6OA 2P7CB 5B0BA 1N77A 3QYFA 2AQFA 3DI6A 3GFYA 2QMWA 5KFBA 4GYIA 4PUSA 3KDNA 3BQ2A 3O5TB 2EFOA 2N4CA 1KR4A 2CPYA 4YIFA 4AC0A 1V5IB 1U4BA 4A0YA 4F3MA 2WSEC 3TO8A 4B9MA 3I3LA 2MQMA 4X6AJ 5LT5A 3ZZPA 3FSYA 2J7WA 1S6UA 2HFHA 2HWVA 1SFUA 5C2GA 1U24A 3W66A 4M74A 5E3RA 1LVKA 1FWZA 1R89A 3KFWX 4BWJA 1EKRA 3GFMA 2MH9A 1KS2A 3DP7A 4KB7A 4ZCKA 1JLAB 2GJFA 3OJUA 1REPC 1QUPA 3ZQ7A 4QR0A 3FKIJ 3JRBA 4LIUA 2ZE2A 4QW9A 3J7YJ 3S2DJ 3QGHA 1H7WA 4U8YA 1RT5B 3DPUA 3S15J 2BE2A 5AJ3J 3E6DA 4CSWA 1TTHB 2HNDA 3HRUA 5DDRC 3HFZB 2J9DE 2VG6A 5IFMA 1GXUA 3P6YC 4ZDOA 3B6AA 1PC4A 2JA6J 2O8KA 4EM1A 2P8TA 3BO4A 3BB5A 2D69A 4MKBA 3S01A 3BBBA 4QBUA 4NZ0A 3JYTA 4E7SA 3CJTB 4DZJA 2B56A 3A4TA 3FISA 3LGMA 1FXDA 3OYCA 3GMGA 3N28A 1IBLF 2TCTA 2ASDA 3CO9A 2R4FA 1MMGA 3OD2A 2ZO4A 2DODA 4A3JJ 1C4CA 1X3WB 2Y8WA 1TFWA 2K8GA 3BLYA 2HQAA 3RYLA 2G2OA 1NCLA 4DS5A 3GPAA 1U1NA 3T8RA 4FXDA 3FJ2A 2EVZA 4U67Q 2B9XA 5CZVA 4C0HA 1MMNA 2R5ZB 1IN8A 4HF0A 3I5BA 4I7FB 3JW4A 3P3DA 2LY1A 2IC3B 4OZ2A 4RAYA 3BGRA 3MECA 3OV8A 3SSRA 1HDDC 1PC5A 5DUKA 1I3OB 4GFBA 3HXLA 4DPOA 1O51A 2DAOA 1HW1A 2OV7A 4DV1J 2GQ2A 4LF4J 3UNYA 3MPUB 4FF1A 2ZH7A 4JP8A 4C8KA 3ILOA 5J6XA 3PSIA 2PJPA 2VPYB 4WX9A 1LEAA 2G0EA 2V2VA 4KGMA 5BQTA 1Y5LB 2XULA 2DT6A 3FXKA 4HSRA 1K61A 3NBPA 3BGFA 2KISA 5AJ3F 3K58A 4DG1B 5IZHA 4P72A 2NPIA 4FKYA 2V7FA 1ZM4A 4C8ZA 4CYDA 1VQPI 3PNIA 5D8KB 2Q6CA 4J9LA 3JSYA 4V19X 3K8WA 1BUXA 2V4QA 1ETKA 1X0FA 3R5GA 2RNGA 3PNYA 2AP6A 2CQXA 4EO6A 5JVHQ 1KQ0A 1X5PA 2J7KA 3FXRA 3L7WA 3BWGA 3H59A 2EW9A 4RA2A 1RKWA 1VDHA 4FYVB 4MEXF 1VQPS 1OPIA 2R2UA 3CZ6A 3HMJG 2MSTA 1H98A 1VQSA 2JUGA 1VQLI 1YX5A 5IWAJ 4WF2A 4LFBJ 4NCBA 3QT6A 1ELOA 4P7TA 2XF6A 3FUYA 4NYOA 4DS4A 3PO5A 2OZ6A 1R00A 2EA4A 4ZVHA 3C3LA 2UV8G 3PRDA 3IBCB 4FPIA 1R6RA 1VQLS 1O8BA 1EP4B 4CO4A 1P4XA 3W6JB 1J59A 3MUVP 2F5VA 1SKRA 2IGMA 2GHVC 3OUYA 3GYNA 3HHLA 1UCRA 4ECVA 1PDNC 2F1FA 4O6JA 4HX7A 3KETA 1WI8A 4DV1F 3H35A 2JEIA 2M5WA 1WHWA 3BG5A 2LKXA 2DPUA 1SL2A 4MK9A 3LSGA 2QJ3A 1RHKB 1GT0C 2AEFA 3OJSA 3RAQA 3CCZA 2DMPA 4PSWA 1B72B 1O3RA 2OEMA 2CPJA 3P9CA 1E6VA 4DLGA 4DR4J 1F1ZA 4M8LA 4B09A 3BF4A 4B3RJ 4C30A 3D0GE 2PLYA 1S9EA 3VYTB 4N8OA 2YU9J 3ZTRA 2XSJB 3W6VA 5J1UA 1YVFA 3AG2H 1Q1HA 3C7JA 3N6MA 2HMIA 2GOMA 2OC6A 3FC9A 1PO6A 1N48A 1QSLA 4O5VA 2D3OR 3ERMA 4KMUX 4KFBA 5LEJA 2XQCA 1IKWB 1R7JA 1T56A 1U8SA 4A6DA 3ILJA 5ED4A 3R6SA 4BE0A 4CZCA 4X2BA 5D6FA 5KFVA 2K7LA 3W7BA 5HOOA 4LFBF 4RNHA 1MU2B 1FFGB 1NB7A 1HQEA 3OSGA 3K70D 2OPRA 2MJNA 2H5EA 1JMTA 2NAZA 4Q48A 1ETWA 1C0WA 5EGYA 3P9KA 4CYCB 2XM3A 4JI6F 4OYAA 4IDKA 3IR7B 3CC2I 2CQ4A 1XR7A 2CUZA 2XGCA 4WBFA 1ROFA 1MBFA 3W3SA 2OGUA 1XTAA 2JA5J 3DFGA 4WXWA 1HNIA 4YFXF 3CC2S 3QO9A 3HF5A 3DLBA 2BANB 4GCVA 5HNFA 4UZBA 2MDAA 3W2WA 2ATCB 2WONB 2XMVA 4USUA 2RN7A 3R1HA 2FTRA 3RGIA 3C6TA 2FVPA 2LU1A 2XO7A 1FFWB 2KTQA 2XCPA 1UHMA 4NMLA 1DQAA 5KFFA 4IOBA 4U0WA 1RCXB 5FRMA 1Q79A 3KE2A 1D09B 4WXDA 3L7UA 4HDVA 2YY3A 4E7LA 2WSCC 3NG8A 4KO0B 1OO0B 1TWCJ 2M8HA 4N8NA 1RU1A 3IWZA 3VAFA 4IG3B 4DR5J 1W2BR 1P92A 3IWNC 4HV5A 3WTWC 2X7IA 4N77A 1RR7A 4ZJZA 3VPRA 4I0AA 3BPVA 4DYRA 3Q23A 3KHLA 1B99A 2YNHB 3QMQA 3TYTA 1DLOB 3EGZA 2VPRA 2EZLA 2VD3A 4DV3J 5KT6A 3GJRB 1R1TA 3JTPA 2CWKA 4RWWA 3IC1A 2GA1A 4M5HA 1HBXG 4OHWA 4A3MJ 4IRCA 1G3OA 1YRXA 2U1AA 4FZVA 1Q1KA 3QAHA 4N7TA 3CMQA 1MZBA 3ISPA 2XS7A 1U0SA 4AYBA 1JLCA 4XK4A 2A61A 2CQKA 2CIMA 2IXSA 5KFUA 1FRHA 4A5MA 3SXYA 3KP4A 3OYDA 4ZZDA 2ZMEC 1EAYC 1TKTA 4IHXA 2EXUA 4E8UA 4USJC 1R8PA 3EUHC 1CS4B 3RG6A 1EA3A 3QU6A 4ZVOB 1GLNA 3H25A 1SC6A 2YWEA 2V2QA 4A5NA 2C2EA 2F40A 2J5AA 4C11A 3JTNA 1WEXA 1XN7A 4JV2A 3TEGA 1T98A 4DV6J 1W2IA 4ETZA 3CJQA 4DNCA 3RTRA 4A8WA 4M3DA 2FLPA 1NPRA 2E66A 4HDHA 5I42A 3GILA 4RO0A 2LA4A 3BO2A 3J81Z 3A03A 2N8GA 5DCFA 4CICA 5HSPA 2CUEA 3NARA 1O3SA 5F0CA 3EYYA 4F02A 1FRMA 5LMNJ 2PI0A 1FD8A 3C2HA 4M3FA 2DA2A 3CT9A 1RGVA 1WOOA 3FHNA 3BBFA 2OJED 3S1RJ 4JOUA 3HKWA 4G1QA 2CWXA 1FOXA 1EETA 2DXFA 3J81U 1S0OA 4D1QA 3I0SB 2R7RA 1C1CB 3ENAA 4ICLB 1IKYB 1G3TA 4LF8J 1X19A 4USIA 1BC7C 3R5CA 4NXNF 4JV5J 5DZ7A 1LPQA 4IHVA 1Y5NB 3K4LA 2EWHA 4AYBN 3HOZJ 1M1HA 4KH0B 4TU8A 1VMBA 4BEHB 5ICEA 1BW6A 2NUHA 1CG2A 1I94J 4U96A 1LNWA 3MMCB 3V7SA 4U9RA 2RD5C 1V55H 4TY9A 4UOFA 2L48A 4NC8A 5HBMA 1FFSB 4GC6A 1YE9A 2KIQA 3BR8A 1X4PA 2WBMA 4RW8A 1ZGAA 2O61A 1X1CA 4GO5X 3FRZA 3RQIA 4Z37A 3PNTA 2AYEA 1DFDA 3GUDA 1K4SA 3GFZA 2KFZA 4DV6F 3R4KA 2M7AA 3E2EA 1LFUP 3RJPA 2E2IJ 2JFKA 3V6HA 2AV5A 1BBYA 4WXOA 2BJ7A 3H5UA 4MIWA 4DL4A 2DYRH 1ZPVA 4HT5A 3S8SA 1DTQB 2HQIA 5E17F 5KFSA 3Q0AA 4XDCA 4AL5A 2AQEA 4MKAA 3HTSB 3EPIA 5FJ8J 3FBFA 3RRGA 1UZCA 5LMNF 2W1OA 3MR3A 2ZUAA 4X66J 1D5YA 3NNHA 2J5PA 2BW3A 1QSSA 4IKFA 1NM2A 2XY6A 4HPQA 3V6DA 4IX7A 3VHQA 2EJRA 5B0EA 4P9UA 3ERED 1ZAXA 1DDNA 1Z7LA 4DX5A 2VICA 2JQ7A 1MROA 4XRSG 4OHXA 3D6FB 5J2NA 3F8FA 4F4WA 2GVZB 4JV5F 2Q66A 2YBVA 5JVGQ 1TWFJ 2IP2A 2NZ4A 3IFEA 5HI7A 1N88A 1S7EA 2PI4A 3BGOP 3OR2C 2KZVA 3V7CA 1SFXA 1W7WA 2QA2A 2HURA 1TFYA 5DS9A 3IGNA 3DDKA 4FVCA 3MCSA 3A0BC 5H6RA 4KGKA 3ONQA 1CSJA 2KVIA 4OLPA 2MTLA 4HHJA 2APOA 3GYHX 4Q44A 2A07F 1SC7A 1WC1A 1IXRC 3BS9A 1ULRA 4UOGA 1X4HA 4ZJOA 5KFLA 1ZRFA 2DGUA 2IRUA 3HHDA 3BG7A 4KT6A 5HK4A 5BYQA 1S10A 4HTIA 3SZGA 4DLEA 1UA0A 3O2PE 3D7SB 3AD7C 2FEZA 3KJNB 2TDXA 2F4FA 4BY1J 2QLBB 1REGX 4KQZA 3EETA 3QATA 4G8XA 3E97A 3PW7A 2KFDA 3B6BA 1WH7A 1ETYA 1PAUB 4O44A 5KFGA 3W61A 1OKRA 2C1EB 5HS7A 2J0SD 3DBHB 3GE9A 3P96A 4W98A 1R23A 1D1UA 1E3OC 3SBMA 2RDJA 4X62F 1MBHA 3CUQC 1MGTA 1LOUA 3DF8A 2J8AA 4GYGA 3ULQB 3D6HB 2I6WA 3TMOA 1G6NA 3HSEA 4X66F 2FHKA 2VG5A 1AZSA 1HNVA 1C1BA 1FOYA 1VNDA 3FFIB 2R7XA 3OYHA 1WTBA 1TL5A 1H73A 3SDGA 5KFYA 4BU2A 2BJ1A 5K1YA 4BL0B 3OPKA 2B0LA 3NGSA 4M9SA 4YQWA 5M3FJ 3M8SA 2DK2A 1BJAA 2HI3A 3QPSA 5T14A 3PSFA 2W7AA 4OZ3A 1MDMB 4KICA 1FRXA 1XCVA 1BIAA 1MNDA 4F4AA 3GSDA 3HM5A 1S1TA 4OIPF 4M1KA 1W7PD 2FHOB 3T1BA 4WCGA 1OCPA 1YX3A 2HGCA 1TKZA 2ZD1B 3QRPA 1A0OB 4J5OA 3ZNUA 4GKKJ 4XLFA 1ZKGA 5IP6A 3H92A 1BI2A 3MDFA 3M30A 4JV0A 2XG8A 5HVGA 2O6GE 2M45A 2B9SA 1W5CC 2LEAA 1RAFB 2Q79A 4FNIA 3BH6B 3TOAA 1I6XA 1DURA 2WOMB 3HTUA 3CLQA 3SHFA 4CH0S 3MKZA 2JEFA 1T7PA 5KAKA 1F6TA 2Y9ZA 1FRJA 2GGPA 3ZNJ1 3BJYA 1FSHA 4MK8A 5E1WA 2BY0A 3FQKA 4ENJA 3HYIA 3DLEB 2EFQA 1KU7A 4M5GA 3E3XA 3JRAA 3KLHA 2WVBA 2X1FA 4BACA 4WK8F 4ED8A 3GIKA 4M9ZA 3IP4B 3ABUA 4CM2A 3SCKE 3OYKA 4YR2A 1FWPA 3VZIA 3BOQA 3LFUA 4WE1B 4C9YA 3FEXB 3EUHA 2VFUA 2HPMA 3NAIA 5K7ZA 3BJOA 3ML6A 4MIAA 2KM8B 3CCSI 5KFZA 1RAAB 2W25A 1RAEB 2J0XA 1FP2A 1RTDA 2R8IA 5C2CA 3AG4H 2J7UA 1HXDA 2N7CA 2VKRA 5DZ6A 4NZ7A 4XM3A 2DNRA 2XAQA 3KK1B 4E7JA 3EXCX 3CCSS 2ZWOA 4YDXA 4PDKA 1R27B 3VWBA 3P9IA 3LP1B 1FXRA 5D6EA 5F0UA 1UB9A 1APLC 2DXIA 2I9SA 4GKKF 1NZAA 4DPUA 1YS7A 2YKMA 5HO4A 4A8XA 2ZVSA 4ZCIA 8RUCA 1WSVA 1V3ZA 4IRGA 2QFJA 3M8JA 4JV1A 3UQSA 1WG1A 3GMEA 1ZHFA 3EWGA 4RJVA 2A05A 4ECQA 5BYSA 2F9DA 2I2YA 5F64A 5ETLA 3VYSB 2GXGA 1JNZB 4KHMA 2FZKB 1GT8A 4A8SA 2BUNA 5IC4B 1U5TB 2J9DA 3R9LA 4FF3A 5DCMA 1KDNA 2GCFA 3MPDA 5DEQA 3ZGKA 1MSFC 4C97A 3H98A 2QVOA 3AB2B 1XDSA 2CQ7A 1YQHA 2AJ2A 1GX6A 2CJYB 5HJYA 2CFXA 3ASNH 5HLFB 5A2QK 2CGPA 1VQ8I 2WV0A 2F5EA 2XAGA 2XEXA 4BJ5C 1TV6A 5T7LB 2LP0A 3B8HA 3VAHA 2ZDOA 3DBLB 2XGDA 1OCZH 2MGQA 3VV2B 2XS2A 2QGFB 1JLGA 2H51B 2KKHA 3HSDA 3MM5B 1VQ8S 3FX3A 2V1NA 1GMUA 1VQ7I 1X4OA 4HR2A 1PG5B 4E98A 3J7YI 4F0KA 1C0TB 4DQQA 4QZVB 5A2QZ 3M8YA 3GFXA 2E36A 3DOMB 1A35A 2C28A 1VQ7S 1QAIA 2ZH2A 3ABKH 4DCJB 2G0CA 1ZA2B 5J1NA 2MB0B 4NL5A 3HB9A 2DDAA 2DTJA 4ZP9A 1NZ8A 2BOAA 2JPCA 4NI2A 5B7WA 1KVKA 4DZDA 2E1OA 2K4BA 2XO6A 2D74B 1Y0HA 5KFHA 2R8KA 4RNNA 1YO5C 4HX8A 2LXFA 3KEQA 1HMVA 1SUQB 2WAQA 3FBBA 1S8NA 2V5HG 2C3OA 3HKZA 2M4GA 4IF4A 3DOKB 4DX6A 2J0WA 3M6VA 3UN2A 1B3TA 3ITHB 5JFRA 1HBUA 1QAYA 3TO7A 4IH7A 1FTRA 5C24A 4HX4A 4BGDA 2W00A 1HYSB 2YH1A 4I6AA 3OTOF 1UTAA 1ZLKA 1NH7A 4LVOP 2EV5A 4KISA 4UUXA 1RDRA 2UU9J 4KIGA 4RB2C 4AIDA 1M5HA 1CF7A 1M0SA 4IZZA 5KCMA 4DX7A 2MSYA 4NX9A 1JLBB 5EG0A 1ULYA 3VFZA 1Q16B 2HVEA 4CDIA 3TRGA 1OQYA 4CIOA 1F3VA 3Q8VA 1IM6A 1SIWB 3FSIA 1B0TA 2XZWA 4WWSA 3BT9A 1N5YB 4Y28C 1XMOJ 1LV5A 1X9SA 1ORKA 1KLMB 3KLFB 2HVDA 1NK4A 1HARA 4OYMA 3RPUA 4MHGA 5C4XJ 4ELTA 1MNEA 5DYMA 1U1KA 3MFKA 2NREA 3EDPA 3PNVA 1QSYA 1N34J 3AFGA 5A0YB 4MLOA 1UZDA 5DG8A 2OU2A 2CQDA 2KXNB 3OL7A 5F8NA 2KDOA 2QQ8A 4JI0F 4EYIB 1OYYA 1CC7A 2H1KA 4ZH4F 2C2DA 4BDZA 1X4BA 4PSXA 3N01A 4PGGA 2ZXJA 3CUQA 4W1UA 3CQZJ 2RS2A 2KRHA 1Y0NA 4C9DA 2DYAA 2AYGA 2K4JA 2MLKA 1RABB 5BYRA 1LWEA 3UN3A 4RMNA 7FD1A 2IDLA 2WAQN 3K5NA 4IH6A 1WHUA 3GXOA 5M3MJ 3ABTA 5JVTA 3HKZN 3HJVA 1KWMA 3L00A 1LWFB 3K5OA 2UUBF 4K2XA 1T9XA 2KFYA 2I10A 2GZWA 5AIPA 3CXCR 2WTEA 3BCAA 5E2QA 2FNPA 3O6QA 2P7VB 5ITHA 1OY9A 3N9UC 4KR0B 2PX9A 2CV2A 4XPEA 3FMBA 4CCLA 1WI9A 2ZFUA 1TUWA 5C42A 2UU9F 1A5JA 1P7IA 1MWZA 1Q53A 5ETOA 5D15A 2KRFA 2HZCA 4F50A 2NXNB 2B6AA 2KT0A 4Q8EA 2K86A 1U7LA 5LLQA 3PIOQ 3ADAC 4LF5J 4NLYA 5KTQA 4ENNA 3MF5A 1YSJA 1MH4A 3EZUA 3FCHA 2YTCA 5ICFA 4LRAA 2ELJA 1FMVA 2M34A 3FQLA 3NGKA 4HACA 3TW7A 4IG0B 4UF4A 2LFBA 4IRHA 1BM9A 4MTEA 3IG1B 1N34F 2HYJA 1LQ9A 1QZYA 1BI0A 1ODDA 2F4OB 4ZDPA 3WTUC 1ZRCA 2LCWA 4X64F 3D5LA 3SV3A 3FM5A 1S48A 2B51A 2DT5A 1RQ0A 3DQVC 3PIOF 2UXNA 3CJRA 3BZQA 3HEFA 3RB6A 1WOSA 1ZH5A 4ES3A 1LFWA 1SPBP 2FHMA 3G1MA 4ZLPA 2ZNZA 1TK8A 3CCUI 4DUZJ 5LRRA 2ID3A 1C2PA 2PIIA 1VQNI 2ADCA 1KQFB 1XMQJ 3ABMH 2CU7A 2L54A 2FVCA 3COAC 2XDVA 3JRIA 1HKQA 1K78A 3FXJA 1Z0XA 1PAEX 2LBFB 5IOLA 1X5SA 2X51A 1N8RT 3CCUS 1IVZA 2R7SA 3LSPA 5TJJA 3A2KA 1XBWA 2BJ3A 4ZDNA 3IRQA 2EINH 2ISZA 2JLEA 1VQNS 3RW6A 3BR5A 2VC1A 1DRZA 4MQ9F 3T0YA 3OOPA 4Q47A 2XGXA 1T02A 2G2YA 5GP9A 3K4CA 4HHHA 1BWEA 4LR8A 2O3FA 4ILLA 1JXSA 3ET6A 3QLHA 3JSMA 2BQRA 2F5DA 3DOLA 2F3JA 2MY7A 4Y34A 2W7NA 2PMWA 1UAWA 4EEYA 3SZPA 2JVRA 3J7A1 1SCJB 1JLEB 5H20A 3EUAA 3BDPA 1BHNA 5GAEJ 1YJNI 3QFHA 2K1RA 4ZN1A 1ZRDA 4HI2A 2E2HJ 5K5OA 2HYFA 1M5PC 2ZC4A 2IA2A 3BYPA 2FY8A 1DTTB 1T08B 2HK3A 4Y0FA 2AQ4A 1RWKB 5HL7Q 4DUTA 3ISNC 3F6VA 3UNGC 1AFJA 1YJNS 2NXEA 2DY9A 4OYOA 2F4IA 3DLKB 1XK8A 3WG7H 2UZAA 3KWMA 4OAZA 2OPPB 2VB6A 1FDAA 3AAFA 4LBHA 3T5HA 3D4JA 3KMQA 3V4IB 3V81B 2HRYA 5JR3A 1RTHB 3OXFA 1M5OC 5JLWA 4DUZF 3V7RA 3MKYB 4HF2A 3G6YA 1ENHA 2OI2A 3H0GJ 3LANA 4IH5A 1XMQF 2HRUA 4PCQA 2YWHA 4GC7A 1IKVA 3KUEA 1OPCA 2I38A 2EFNA 3R3TA 4ZC3A 2ROEA 6PAXA 4DI6A 3D66A 1VZ0A 3S1QJ 3JTGA 1IRGA 3TGNA 4WFXA 4N76A 2MXYA 5J47A 3EVOA 3DLGA 3WQPA 3K9TA 4YFNF 2XLIA 1NJZA 1SC3B 2R2SA 3BG3A 3D54A 3K6GA 1N6QB 3RKYA 3UDLA 5D4LA 4P2XA 2UUZA 2OCCH 1LWCB 3OTDA 4NYPA 4R79A 1LDDA 4D3GA 3RR7A 1BMQB 4DR2J 4PFOA 5IYBJ 3N5FA 4LR7A 4RKUC 4BCAA 5DD4A 1VISA 2MZSA 3C15B 3IGVA 2QKMB 2HVSA 1CPZA 1NJYA 3D0SA 3L7OA 4EMSA 1JKQC 2OSRA 4CLTA 3W62A 3D67A 3ISND 4R1HA 4KGZB 2K3PA 3CO6C 1SVOA 3DRRA 4IYQA 1RT3B 2HHUA 2XB5A 5B1AH 1I1GA 1TK0A 3RBZA 2A5YB 5IC6B 2FD2A 3HBLA 4NDLA 2JSPA 1Q5YA 2ESNA 2KJBA 1QZZA 1FO1A 2ZBIA 3N0VA 2H4WB 1NRKA 3R7BB 4B48A 4I2OA 5LHHA 4ED4A 3E6BA 3Q8QB 4HNVA 1LFPA 4O23A 2R7TA 3JSPA 4URQU 2JEGA 2PEHA 3NMAA 1E3HA 4EZ9A 3Q9SA 2D45A 3KLGB 4G3IA 4RAFA 5HP1A 1DGRM 3F9KA 2M7SA 5CYMA 3Q3SA 1UL3A 2W8KA 3TJ9A 1WHXA 1NKEA 3LNQA 4P96A 3I55I 4AIJA 4ZHRA 5FDLA 4WTYA 1G2HA 2YX1A 4DL6A 1VC0A 2H65B 2E5NA 5A2QY 1LW0B 3MMAA 1YQAA 4GO7X 2WHOA 3HT0A 4I1TA 1FNNA 3W2VA 2V8HA 1GXLA 4X4PA 4CI0B 2R2TA 1BOAA 4D5CA 2WB1A 2LMIA 4W90B 3I55S 4F55A 4DR2F 5FD6A 3K4NA 5FLVA 1WTFA 4RGXA 4B43A 1VGYA 2H6BA 2VONA 2KFNA 3M2VB 1KTVA 2RF2A 1SB6A 4OX8A 4KT0C 1P1TA 3AT1B 2KT3A 5HQMA 1CJUB 1XGMA 1A6LA 1BJZA 2MH2A 2CZ9A 2XYHB 2J76E 4DSKA 3L2UA 3E01B 1O3TA 3H7HB 3M1VA 2AX0A 3MD3A 3MM8B 5KFXA 3CDLA 2GVDB 2V67A 3JAMU 1TQPA 1TL1A 3GFIA 2PT0A 2WW8A 5E0OA 4WPAA 4QQBA 3M9OB 5AXLA 2DNYA 2JA7J 1VRTA 2FUG9 1PYVA 1RKJA 4HQMA 4OIQF 4CQ1A 1QZEA 1ZG5A 1HA1A 1JXLA 2J6SA 4URSA 3CCTA 2A2CA 2JWTA 1YFHA 4CLKA 1E6YB 2KMUA 3QJLA 4BXXJ 4DUYJ 3QRRA 2XS5A 2CXEA 2KPMA 1S1UA 2DFHA 1VQ6I 3ZMTA 5FLMJ 4KUMA 4FX0A 3L2VA 1SJRA 2GIZA 2NVQJ 3M2UB 1ZN2A 4B9VA 3U1LA 3BQYA 1BQMA 4WKRA 4YY3F 4M6YA 1TL8A 3NS5A 4C8YA 2HQNA 2QM3A 2ASYA 2WB1N 2M0CA 1VQ6S 2PE8A 3PFIA 4YIIA 4X65J 4QPOA 5IY5H 2MFZA 2DA3A 2H5JB 5F8GA 3HVTA 3CJ4A 4RBUA 2F7VA 4KNYA 1LQ1A 4HDUA 5LRSA 4GKJJ 2YKNB 2DYSH 3M32A 5CD4A 2ZBPA