2VONA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auaauuu
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
187
structure length
187
Chain Sequence
b'DNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LUPUS LA PROTEIN
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 56
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vonA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vonA02
1H9GA 3M7GA 4I02A 4BHBA 2LF8A 5HLGA 3VF0B 1SD6A 1X4GA 1U1RA 1W7PA 4UV8A 2HGLA 3FF5A 5HDGA 4EGYA 1OO0B 2WC2A 5LSOA 3KZZA 1K73T 2MKIA 1H6KX 3BY6A 4G9YA 1VQOS 3VALA 1H2UX 2MY8A 2OQRA 3GZ5A 1D3YA 3U9GA 1RUNA 2DK5A 4HW0A 2FRHA 5L3GA 2OSQA 4M6YA 2DO7A 4A12A 2XAFA 2QWWA 1Q1HA 1OYWA 3F3XA 1U5TB 1KD1T 3OOPA 3P49B 1VBXA 2LA6A 3REOA 1MKMA 1FHTA 3RW6A 4I7HA 2MQNA 2RQPA 2V79A 2F9JA 3TGNA 3WE2A 1F9NA 1FPQA 5ICFA 1ZG5A 1VTNC 3BP8A 5ITHA 2IP2A 1B4AA 2TDXA 3WTZA 3WTXC 2XRNA 4HQEA 2DHSA 2O8XA 3LQRA 2A07F 2RNEA 3J7YU 2BOPA 3M8FA 3WTYC 2B0GA 1DZ5A 2FF4A 3G8TA 1FJEB 3KP6A 2I2YA 1BOAA 2O3FA 1PP7U 1J75A 5K5QA 1BIAA 3H92A 2R3SA 2DGSA 5ERIA 5FLXZ 2PQ8A 4ENNA 2PBIA 1FBUA 1U78A 1VBYA 2R7DA 3CUOA 2WWYA 1W7PD 1JXSA 3WG9A 2KU7A 3SDEB 2VC1A 2DK8A 1F1ZA 1IXSB 3I54A 1D5VA 1O3QA 2M8DB 4S05A 1SFEA 1F5TA 3BO4A 2KKOA 1ZLJA 3QU6A 2CPDA 3E6BA 4IHTA 2P5VA 2HDCA 2XAGA 3MUVP 4PKDB 4WFNQ 4YIFA 1K6OA 4A8XA 3V7CA 2E5JA 4KICA 4ZH4F 2J8AA 2YU3A 1MJAA 4HDVA 1RKJA 3PQJA 1XDSA 4P5OA 2CPZA 3BO3A 5JHUA 1U1NA 3DKWA 4OMZA 2MH2A 2CQ4A 2RQCA 2O0YA 3PQKA 1ZRDA 2ESNA 2WTEA 2GIVA 3BZ6A 3F21A 1LEBA 1U1OA 2KM8B 1BI0A 4I01A 1Y0UA 3RYRA 3TO9A 2IA1A 2MKJA 3PIPQ 3KEOA 3TKYA 3M8EA 2PJPA 4M9SA 3G71S 2AYBA 3WTTC 5L3CA 2J5PA 2QENA 1D9AA 3ZZYA 3K9TA 1M5OC 1LDDA 3WU1B 1MGTA 4I09A 1L0OC 5BMZA 4QU6A 2ESHA 3E5QA 2BYVE 5KVRA 3IKVA 2CPXA 1VQ7S 4UQTA 4RB2C 5HS8A 2HYFA 2FXAA 2V1DA 3R0JA 1NO8A 2YH1A 5E20A 1PDNC 1USSA 4EM2A 3I71A 1FLIA 4B8XA 4HDUA 4U7BA 2DHGA 1XGOA 3I0TA 4U7DA 3F8CA 5HLHA 4P96A 1HW5A 2G7UA 2EVZA 1GHCA 2FMYA 1FC3A 3THTA 3B73A 4ESFA 1IQTA 3CUNA 2CQHA 2LEAA 2MZSA 3MXHP 3I4PA 4C4WA 4MGRA 4BXUA 2J0SD 4LLLA 3K1PA 1LNWA 3CCLS 2K3KA 3HRSA 1B59A 4M71A 2HKOA 3LSTA 1U1PA 3JW4A 4PZJA 4RAZA 4WFBQ 3CCJS 4PGHA 2H09A 3L00A 4H0EA 5HDKA 2OJ3A 2ZCWA 1KYZA 3CXCR 1Z9CA 5IQQA 1BC8C 4N9HA 1U3EM 5IM0B 5A2QK 3J80K 5FB2A 5H6RA 3FHZA 4XSZF 2A5YB 1ZLKA 2CWEA 2E44A 2V6CA 2EK1A 1YIJS 1FXLA 3FWEA 3GYHX 2MKSA 4MQ9F 2OIHA 2P7CB 4F02A 1MJ9A 3G4SS 2GA1A 2N3LA 2XNQA 4S04A 2N3OA 1OPIA 1B1BA 4N9IA 5LXRA 1ONVA 2LXIA 3ZMTA 4RGRA 3H2VE 3IWFA 5D6EA 4Z2YA 4L0ZB 1P4AA 1LQ1A 3CDHA 2DNMA 4LD5A 1W5TA 3RTRA 1Q7YT 2RKHA 3TO7A 3G9CA 2BZ2A 2ISYA 4NHJA 2YPRA 2Z5UA 4IHSA 1FBQA 1G4DA 1S3JA 4OU0A 4TU8A 2E5IA 3FM5A 2DISA 2CQ2A 2LKPA 3BWGA 2F3JA 5DV5A 1J2XA 3R27A 2MGZA 4WFAQ 2I38A 5CA5A 3I59B 2KYXA 1BI2A 2DU9A 2A6EF 4XLNF 2X1FA 2IA0A 1XN7A 2RNJA 3CJNA 4J5OA 3N97A 2VBZA 1KU3A 1K78B 5A2QZ 5L3DA 4KIBA 2KJBA 3G6ES 1VC5A 2VBXA 2KIUA 1N52B 2JT1A 2LYVA 2CYYA 1KU9A 3G73A 2XSFA 1VQKS 3UD4P 2D1VA 1U6BA 4YOEA 4QLCU 4UVBA 2NNNA 3EYYA 2L08A 3CLOA 2STWA 2DGUA 3CMAS 1OKRA 2EWNA 4MTEA 2AYMA 3CCRS 3M9AA 1S7OA 3Q5FA 3RDIA 1BY9A 2L54A 3F8FA 1WQ2A 2DGVA 2PMHA 1G6NA 4JK1X 4IOAQ 1QVGR 2O3DA 2P5KA 4PGGA 4A5NA 1YO5C 1UFMA 2VBWA 4Q47A 2DNNA 2ADCA 1FY7A 1WI8A 4ERDA 1VQ9S 1G3WA 2MBFA 1YLFA 3EQLF 2FPHX 2MKHA 2QBYA 4BQAA 1U6FA 5JVGQ 2XAJA 2FHOB 5D6FA 5LEJA 1K9MT 2LMIA 4FXWA 2FOKA 4GGGA 5DUIA 1ZAOA 1QVFR 4Y00A 2MZTA 2Q8KA 4KN7X 4U88A 1JJHA 4YFKF 2RN7A 4G6QA 4CGZA 1T2KA 2MQMA 1YTYA 2ETHA 4KA4A 1OR7A 2MY7A 2K8GA 2XAHA 2ZXJA 1VQ6S 4LK0F 2EFWA 2DNOA 1QZZA 2FBIA 2JWNA 2GQQA 2DH9A 5ED4A 3KEQA 1EV7A 2VE8A 4LK1F 1J59A 1C0WA 2AD9A 3GX4X 4Q4ZF 3COAC 3RKYA 4GCVA 4ESBA 1DUXC 1IRFA 5FO5A 1CF7B 3GF2A 3MQ0A 3R1HA 5DEQA 1WG4A 2MJUA 5FGMA 2CQ3A 3JSOA 3JB9k 1HKQA 2J0QD 1R00A 1R58A 3L2CA 1XN9A 3M1EA 3TYTA 3BOQA 1XGNA 1Z05A 3FEXB 4IO9Q 3HTSB 3EYIA 4YUDA 1U5TC 2Z9OA 2CQ1A 1JE8A 3IWZA 1O7FA 2AYGA 1FP1D 2VE9A 3I56S 1M1KT 4HF1A 3KZYA 1WHXA 2QFJA 4L5JA 1D8KA 4RS8A 1IZ1A 3RI4A 1R1UA 3SZPA 2H6CA 1CGPA 2DTRA 1TW2A 3MWMA 2EV0A 2KRRA 3RIRA 2Q0OA 2DQLA 2DGQA 3CC4S 2JRSA 4YFXF 1I27A 4PRFA 2NAZA 1A7GE 2MLKA 3GLXA 5EEHA 2HR3A 2A3JA 1A04A 2CQKA 1XDUA 4KDPA 2X0LA 1X5SA 1SFUA 4Y13A 1ZZNA 4G7ZF 1W2BR 5D5VB 3S2WA 4C0OC 2K4BA 2UXXA 5HO4A 2DNHA 1EH7A 2DGWA 3WTWC 2KRBA 4CZZA 2ZJ2A 4TU9A 4GO1A 3BO2A 2MZQA 4WX9A 3F8BA 1XSXA 2VODA 1LJ9A 1S6LA 2LCWA 4LLNA 2QM3A 3O6BB 2SXLA 1TNTA 4QPTA 3GFIA 4P9UA 1OMIA 2IPQX 2FMLA 3C18A 3K1MA 1ZGJA 2DGTA 3L7WA 2CQBA 1P92A 3KE2A 3RJPA 1R8PA 4UUVA 4UHTA 2HGNA 2CQCA 5DCMA 5GAEU 1IN8A 5IT9Z 4HV6A 4IVNA 2MJNA 2VT2A 2ZMEB 1JJ4A 2DNZA 4WF2A 5JI6A 2GXBA 2FNAA 1IAWA 2KXFA 1UFWA 2E1CA 2L4AA 5ICEA 4KNYA 3GEZA 3ABUA 1YS6A 1WWXA 5F6FA 3IRRA 2MD5A 4QQBA 2C6YA 4CO8A 2DNYA 3JAMK 2RQ4A 1O3TA 4LMYA 2QYOA 4IRGA 2CQ0A 2GO9A 1IUYA 3ECHA 2A6HF 1L3LA 1HQCA 4ZYEA 2J5OA 5CYJA 1DHMA 4TU7A 4O6JA 2RRBA 1O3SA 1UHMA 3SZTA 3CTRA 5GADU 3LA7A 2M5WA 1S79A 1G3SA 4XBFA 2ZKZA 2HGMA 2K86A 4CH0S 2VXZA 2XV4S 1DDNA 1P4WA 3DF8A 4L9TA 2LDUA 4AIKA 1FT9A 1AUDA 1BBYA 2AYEA 3FXRA 3SHFA 2YTCA 3LQVA 1N88A 2KFYA 3IRWP 1IW7F 1WRJA 2OAZA 1TQPA 2OQGA 1BC7C 5ICCA 4ZKAA 2M7SA 3O3KA 3QPTA 2GA2A 2DNQA 1V4RA 4IF4A 2Z33A 1QPMA 3D2WA 1FSEA 4YG2F 2ZJRQ 4NQWA 2KVIA 4IRIA 3DXJF 5ILSA 1VQ5S 1JJ2R 2UP1A 5L3EA 3BROA 4I2OA 1WHYA 2HVZA 2X4HA 4TV7A 1UAWA 2DIVA 5GAHU 3G8SA 1NU4A 2HQRA 3HRUA 2VT3A 2EK5A 3RYPA 3Q2TC 2BE5F 2F5DA 2QVOA 1X4CA 4PCQA 5GMKa 3ZMVA 3H3UA 4P55A 1N8RT 3LA2A 1H2TZ 2JRTA 1KQSR 2HGCA 3W6KB 3UWTA 1NJIT 3V7SA 3K0JA 3JTHA 4A0YA 2XB2D 3QRFF 5LHGA 3E5XA 2V1XA 3R0AA 3DV8A 3E5UA 3HHGA 1WF0A 1KOOA 3I58A 2MGZB 2OSRA 2NYXA 3ML6A 2RT3A 3P9KA 4PR6A 4RB0A 4MEYF 2G0CA 5IFMA 3ABTA 1YYVA 5DD4A 2CPIA 3CCQS 1JHFA 2MQQA 3ERED 5CVVA 1YG2A 1T38A 5K5RA 2FBHA 1P1TA 1ZREA 4IUFA 3MD1A 3E97A 2M4MA 2VOPA 2GZWA 2OZUA 4HV5A 3TOAA 1J5YA 4IXAA 5K1YA 3CUQC 3UD3P 4LGWA 4YB1P 2LEBA 2G4BA 2M8HA 2CPYA 1KA8A 2RRAA 4EVIA 2CPHA 3MZYA 3KP5A 3VB2A 2DI3A 1WF1A 5D78A 2XKOA 5BJRA 2ZNYA 2GHPA 1LVAA 2ZJQQ 3F23A 1LDJA 2E5HA 2DNPA 4FX4A 3U1LA 1HKSA 4DNCA 2F5EA 1RIOH 2IW5A 1X5OA 1S72S 2COMA 4F7ZA 1F9FA 1XD7A 3FM3A 2ACJA 4MEXF 4OIQF 2DK2A 2FEZA 2CGPA 3ZN1A 1ON2A 3BPXA 1P27B 1VQ4S 2EFQA 3I5UA 1ZYRF 1SJ3P 3SFZA 2MH9A 1E2XA 1YJ9S 1P2FA 4OOIA 3US5A 1H2VZ 5E18F 1L3KA 2RC4A 1YW7A 3L09A 3H2UB 2QUFA 5FD5A 1WG1A 2W85A 2DH8A 5D4SA 2L9WA 2UWMA 3U2RA 3NNAA 4CYDA 3F6OA 4ENJA 3B4MA 3L9FA 4WWCA 1YJNS 3WODF 4HF2A 4G7OF 3HSRA 2XKPA 4GYIA 5DDOC 4Y15A 1FZPB 4I0AA 2HFHA 3NS6A 2OZ6A 4N0BA 2XVCA 3THPA 2PLYA 5H6QA 1Q82T 1KOHA 2ZJPQ 3E6MA 3ISPA 2K7LA 2P6SA 4WCEQ 1R1VA 5CXTA 1OYIA 4AD9A 3K1NA 5DETA 1O0PA 4HX8A 2KI2A 4A6EA 3V7RA 4RB3C 4EGZA 1ZZFA 2KXHA 1MDMA 5BPDA 4EJTA 1JGSA 1REPC 2EB7A 2DNLA 4EGLA 1B9NA 1VQMS 1FJ7A 1YITS 1H9TA 1XMKA 1Z6RA 2X1BA 2DO4A 3PIOQ 1ZGAA 2IT0A 3WE3A 2MSTA 2L3DA 3QU3A 2DBBA 2MZRA 1BIBA 4HYEA 4EJOA 2E7WA 2OD5A 1YQAA 5CVRA 3I64A 1J7KA 3EETA 4KMFA 5JFRA 4O5VA 2R7FA 3EGZA 2MB0B 1RNLA 2B0LA 3NS5A 1JMTA 3CC2S 2M2BA 2L02A 1V3FA 1YJWS 5LJ5Y 4LMZA 1N54B 4DQ2A 1X5TA 5LJ3Y 1XGMA 2PN6A 3DPTA 1HSTA 4L5IA 4U0WA 1GVJA 3EGNA 4L9JA 3N4MA 5D8LB 2MSSA 1X4BA 3SDEA 1R5GA 3HIFA 2OU2A 3J80Z 3VAHA 2DLLA 5HS9A 3LQQA 1BN5A 5GAGU 3HTUA 1FT8A 3LA3A 3G3ZA 2A3SA 5J8FA 1SXLA 5DDQC 4L0YB 3LFKA 2IVMA 2CW0F 3T8TA 5D8KB 4CQ1A 5E17F 3CUQB 2MQLA 1DPRA 2XHKA 1X4EA 1OPCA 4IJAA 3MDFA 5DM6Q 3CMES 1AOYA 4WF9Q 4FT8A 1HW1A 3ZMDA 2E7XA 5K5OA 3Q2SC 1WKMA 2M8EA 2PFBA 3T8RA 4LG0A 2KG0A 3B4DA 2W57A 2DIUA 4D0PA 2G9WA 3IHUA 4ED5A 1FBSA 1M5KC 2DHAA 2J76E 3BDDA 1I1GA 1HBXG 3UCZP 2LA4A 2CG4A 2RDPA 4P9FA 2P7VB 4U67Q 4EM0B 5HDNA 4RGXA 3D5LA 2KXNB 3T0YA 5D5XB 2DH7A 3DP7A 2M0GB 4EM1A 2O61A 3W6JB 4OIRF 4BNCA 1SMYF 2JPBA 3IRQA 1U1QA 3GFLA 2V1UA 2D9OA 3TOBA 4ETSA 1DBDA 5AONA 3HOTA 3HRMA 2OBPA 2M9KA 3CCMS 2ELHA 3P9CA 3U1DA 2RS2A 1STZA 3VAIA 5E1XA 1X4HA 3BJ6A 4YFNF 4KYWA 1B7FA 2UXNA 2CFXA 4UVCA 3TDUC 1H0MA 1ZG1A 3BJAA 3V8KA 2QA4S 1TQIA 5CJ9A 3ROUA 1W7PB 1X4AA 3VAJA 4I98B 1TBXA 4R79A 5EN1A 3ULQB 1YW8A 3P7NA 1FX7A 2EK6A 2OTJS 2MPUA 2X1GA 2KRFA 3I53A 2Q79A 2XROA 4HLXA 5FJ4A 2A69F 3CTAA 3R60A 4KMUX 4O3MA 2NS0A 1LB2A 4M74A 1IRGA 4A2UA 1T98A 2VOOA 4M73A 1U1MA 1X3UA 3VAFA 4QU7A 5FFXA 3QAHA 3DQVC 4HAMA 2VC0A 1YIOA 1K79A 2DNKA 1KU2A 5LHIA 2W24A 5J6XA 1Z1DA 5JVHQ 2D2WA 1WG5A 2P8TA 3MCZA 4LB6B 3F8MA 2STTA 4KT5C 2YH0A 2E5GA 3ELKA 4EJVA 1U6GA 2CJKA 4BYYA 2MXYA 4WCGA 1D8ZA 4WK8F 2D45A 1S7AA 1OYYA 3E3VA 2N7CA 4A0XA 3F22A 2KG1A 1NHAA 1O7LA 4KFCA 1RK8A 3T5XA 2XS2A 2KJCA 4EMSA 2D9PA 2WBRA 1VC0A 5MLCV 3EUHA 1T0FA 3I59A 2D3OR 4YIIA 5E1ZB 2DB1A 4F25A 3TDZC 3H3ZA 2VBYA 2HYGD 2ERRA 2DPUA 4NB5A 3OW2R 1BJAA 4CICA 2DNGA 1HL6A 1R5HA 1QNTA 4PDKA 4MHGA 5D4RA 4BAYA 3HHHA 4JBAA 2PG4A 3MZHA 2RS8A 4LIRA 4XSXF 5LRRA 3J81K 1PP8F 2FC9A 1KGSA 1U2WA 1EH6A 1I6XA 1PGZA 1MZBA 2CPEA 3CULA 2RVJA 4UV9A 4RU2A 4RGUA 2P5LC 3FXQA 2K02A 5HL7Q 2HTJA 2JVRA 2MZJA 1WSUA 5GVQA 1VQNS 4U0VA 5L3BA 1BI1A 1KC8T 4LFUA 5CVJA 1T39A 2DW4A 1PO6A 3QOPA 3S8SA 1LDKB 1O3RA 4UY8T 3P6YC 3KP3A 3UE2A 1IXRC 2NLWA 4R8HA 3QP6A 2BV6A 1MJBA 2MC3A 4W90B 3V8LA 4RB1A 3BEGB 3S7RA 4M6XA 3E6DA 4EQQA 3MFKA 4W92B 1WWHA 4LJZF 4AWXB 5LHHA 1KYWA 3D0SA 2ZBKA 2H94A 3MUTP 4G6DA 5F1RA 1FSHA 1ZHFA 3EDPA 3BS9A 2VONA 1TTYA 4IRHA 3VODA 1RUOA 3E6CC 2H27A 2FC8A 3J81Z 1QZYA 1G3YA 1T6SA 1EH8A 2BBYA 3ZMUA 5LXYA 3OV8A 2CQIA 4BHPA 2MZ1A 1ZARA 2JTVA 3J7ZT 4OZ0A 1CF7A 5FLXK 3TO6A 1U2FA 3F8NA 4FX0A 3R6SA 4HLYA 4L18B 2XS7A 2IJLA 3HRTA 2HQNA 4ENMA 2EJRA 4WXHA 2ZNZA 2LKZA 1B6AA 3GVAA 2HWVA 4BHCA 3ZN0A 3JAMZ 2V94A 3MOJB 1WELA 1SAXA 3GFJA 1QBJA 4L9VA 1MDMB 1FYMA 4EV0A 5AIQA 5D77A 4KUMA 2ADUA 1O57A 4RAYA 2LQ5A 1OWXA 3ECOA 2U1AA 2QZ8A 2HOEA 2A61A 2CSOA 5ILVA 2DPDA 2AS5F 1YS7A 2KIFA 2RV8A 4UXNA 4ZYGA 1XSDA 4QWQA 2QQ9A 1DRZA 2JX2A 2W84A 1SD4A 3MAJA 5DM7Q 2Y0MA 1OIAA 2D1HA 4ASNA 3HI9A 2ZFWA 1R23A 4CH1A 3CCVS 4A6DA 1UP1A 4EJUA 4AIJA 1TLHB 3FMRA 2LECA 3EX7B 3KP7A 2XNRA 2MMYA 3K69A 4CIOA 2EV6A 4V19X 3LAPA 2DQRA 4OIPF 1SMTA 2L01A 4M9XA 4HQMA 5BPIA 4G8XA 4WXDA 3C1DA 3WTVC 2K27A 2AXLA 2L41A 1GXQA 5CVUA 3MURP 2UZKA 4GYGA 3GZ6A 1UW4A 2RUGA 2CPFA 4BH9A 3NRVA 1Q86T 1K8AT 5DYMA 2NNYA 2V9VA 5CYVA 3FMSA 3VFZA 1IN6A 1S8NA 5DUKA 5LGNA 4B09A 3QPHA 1SJQA 1WEZA 1XGSA 3V4MA 4HOBA 1DPUA 5BQTA 4LG0B 3R1LA 3RPUA 2MKCA 1MD0A 4OINF 2M30A 2ZMEA 2CQPA 1P6RA 2Z3YA 1QQIA 2A68F 4OZ1A 2PE8A 3KLOA 2MKKA 3G96A 3NNCA 4WIIA 4G94A 1AWCA 2U2FA 4MQVA 3Q9SA 2M1BA 1USTA 2FA5A 3ZQ7A 3RKXA 2F2EA 2QBYB 3CC7S 3GUDA 2FBKA 1X4FA 1YWXA 1R1TA 3SMZA 4BS2A 1FJCA 2CQGA 3O2PE 2LNBA 3NNHA 3ZP5A 1WI6A 2NZ4A 3CD6S 3AAFA 3T1BA 1R8HA 4TLQA 5LRSA 1YHQS 3F6VA 4G7HF 2LSOA 1E17A 1ZG3A 5IT3A 2FNPA 2P6TA 2XS5A 2Y75A 2FSWA 1FP2A 3HUGA 3I55S 1FWZA 4ON0A 3RPQA 5JR3A 3HHNB 4HX7A 2M52A 5HOOA 3CO6C 2IRFG 1RZ4A 4MNUA 1HXDA 3MI7X 2N82B 1ZN2A 1U1KA 3FX3A 4AVPA 4ENKA 3WTUC 3K2ZA 2KIMA 1ZRCA 3VAMA 4C7QA 2O03A 2F9DA 1U5TA 3TO8A 5H1SV 1WI9A 5D5UB 3WU0A 1WHWA 1FYLA 1IN7A 5FD6A 5KK1A 1UB9A 2XGXA 2PEXA 5DDPC 1U8RA 4LLGF 1FNNA 2M45A 3ZMSA 5ILUA 3HSEA 3P9IA 3CCSS 1M90T 2RGVA 5HLIA 5EEGA 3HYIA 4EJWA 1FO1A 3LPYA 1XB4A 1YW9A 3VAKA 5H20A 3IWNC 3VAGA 3WGHA 3MEXA 5CVIA 4ZZDA 2L4MA 1XSVA 2XAQA 3DPLC 1IN4A 3WTSC 1I1SA 1W4MA 4Z2XA 2KH9A 1IF1A 1J0RA 2YWKA 2MYFA 1KQ9A 3RKWA 3KP2A 2X1AA 4M5DB 2F5FA 2OTLS 1DP7P 2BGCA 4XLPF 1D8JA 1QM9A 3KP4A 4Y0FA 1VQPS 1J9IA 2YKAA 4JQFA 3BPVA 2CPJA 3FEYB 2YX4A 3S01A 6PAXA 2DHXA 2DFIA 2FU4A 3ZMZA 2GAUA 1WHVA 1WEYA 1FNXH 2K4JA 1ZRFA 1XCVA 4ZZLA 1SFXA 2G7HA 1G2EA 4XRFA 3KFWX 2KN4A 1WEXA 3SXLA 1SD7A 4L9NA 3ZPLA 3ZZZA 2YSRA 1VBZA 3F72A 2W25A 2E1NA 1ON1A 5DCMB 1FOKA 1TW3A 2QQBA 4HA8A 1Z6TA 4RGSA 1BI3A 3FMQA 3N9UC 5E1WA 5LEKA 2MQPA 3GWZA 3DXBA 1LEAA 4HBLA 5DD8A 4UNOA 3P5TL 4AIHA 4P6QA 4ESJA 1URNA 3NEUA 2LF7A 3DFGA 1IN5A 5ICGA 1PUEE 2HS5A 2NRAC 2BEOA 3Q9VA 2P4WA 2QLZA 2HTSA 2HKXA 2QQAA 4HZFA 4ZYDA 1QGPA 2DGOA 3GXOA 3LWFA 2XUBA 5DDGA 3RW7A 4HF0A 1VQLS 2HEOA 1QO0D 3BJOA 3IL2A 3KLNA 2OA4A 2PEHA 1W5SA 4LJMA 4FHTA 3HOSA 3IKTA 4Y17A 2EFOA 5J8CA 5DDRC 3VOEA 1UCRA 4KN4X 3V8JA 1XMAA 3V4GA 1TNSA 1A9NB 1HD0A 3GFMA 3VEPA 3GW2A 2CQDA 4I0BA 2XASA 3UCUP 2ISZA 5DCFA 3TQNA 2VN2A 2MA3A 1VQ8S 3ULHA 1VC6A 3LAJA 5HVQC 1IXCA 4WXCA 1R36A 1KU7A 4M9ZA 2DITA 5LBQA 1SJRA 3UCGA 1I5ZA 1WTBA 1ULYA 1R7JA 2EV5A 5TRDA 3HSFA 2YR2A 4Q5SF 2Q2EA 5IM0A 5CLSA 1Z91A 4K2EA 3NMRA 2MHNA 2F5CA 5E8IA 1G3TA 5F64A 2ZO4A 3K0LA 1HSJA 1R22A 1ODDA 5HS7A 4A5MA 4Q48A 2IA2A 1WF2A 2WV0A 3TP2A 2KT5A 1YFHA 1ZH5A 4KIFA 5JVTA 2EA2A 2FE3A 2H6BA 1K7AA 2XIGA 1JHHA 4IPAA 3NQOA 3SQNA 2RU3A 2DNRA 1M5PC 2JPCA 1HW2A 1CVJA 1SD5A 5E8GA 1TQMA 2Y48A 2PMUA 5FFZA 4HX4A 2MQOA 4R1HA 2PI0A 5IT9K 3KCCA 4CXFA 3GO5A 1YI2S 2KHCA 1X5PA 3CCES 3J7AO 4U0YA 3IC7A 2CO5A 3QP5A 1U1LA 3CO7C 4KIGA 1SJFA 1M5VC 3SXYA 4LB5A 2G1DA 5LLQA 3FXUA 4F26A 2ADBA 4E70A 2GXGA 2EFNA 2FQ3A 4A0ZA 2O6GE 1K78A 1KQ8A 4OMYA 2JVOA 2M87A 3C3WA 2FY1A 2HYIB 2M70A 3MD3A 1F4KA 3CUQA 4IOCQ 3PFIA 3WGIA 3CPWR 2JSCA 1S29A 3WGGA 2M88A 1GXPA 3DEUA 1XCBA 4CHUA 4CDGA 2JZYA 5AIPA 3L3CA 3R61A 3P3DA 5LGUA 2HZTA 2DAOA 4ZYHA 1UHWA 5TJJA 1FYKA 4MTDA 1HD1A 3JTGA 4WKRA 4OIOF 4GXOA 3CF5Q 3KETA 2EFPA 1RI7A 1HKTA 1Q81T 2EA4A 1X0FA 5L3FA 5D5WB 1HA1A 3JSPA 5BS6A 1Z7UA 2MLGA 3B02A 2QEXS 3U1MA 5LGTA 2DT5A 2KM8C 3DLLQ 3R4KA 3CCUS 4UVAA 1SJ4P 1KQ0A 2HZCA 1X4DA 2Z99A 5BOXA 3FZVA 5LSLA 2DO0A 1BM9A 3C7JA 3S6EA 1P4XA 3MUMP 2GWRA 2RVCA 4FXVA 2LXUA 4M72A 2YX7A 1B9MA 2DGXA
chains in the Genus database with same CATH superfamily
3BR9A 4I02A 1SUQA 3KK3B 5HLGA 1WACA 5DGBA 2K3IA 2K9NA 1X4GA 2E34A 2AQFA 3FDYA 1PIEA 1ZM2A 3FF5A 5HDGA 1OO0B 4CYCB 1Z0XA 4RDUA 3HUGB 4ECTA 1VQOS 4M5NA 2MY8A 2OQRA 2VIHA 3ZQFA 3PSFA 3CD6I 4U96A 2HFUA 2OSQA 3MPWA 3ZFVA 4FBUA 4BU2A 1GDTA 1CJUA 2XAFA 1XBWA 1YHQI 1S4FA 1YJNI 2BACA 2Y3YA 2NXEA 3N79A 4PWDA 3TX0A 4K8RA 1U5TB 5EG0A 2LA6A 4U8YA 3GE9A 3REOA 1RKWA 3I55I 3KUGA 1C0UB 2ROPA 4DX7A 3KKFA 3SJMA 4M5MA 1F9NA 1FPQA 3MEGA 2K9QA 5GAHI 2OO4A 4PWUA 3BP8A 3WTXC 4A3EJ 2DHSA 3DWLE 4DUYF 2FHMA 1TAUA 2B0GA 2MQ8A 1FJEB 3SCKE 4MIMA 1CQNA 4C0HA 1GX6A 2KFNA 3EVMA 4RAFA 2V9KA 1T9VA 2DY1A 3CCSI 1KDNA 2RRNA 3H92A 3RCOA 4NXNF 1S99A 4QOTA 3O44A 3FRZA 5KFVA 4IG0B 3DM2B 4J9LA 5FLXZ 5KFGA 2PQ8A 4O3QA 4JI0F 1D1UA 2AV5A 2R7DA 2WWYA 3GV7B 4DL5A 2E9RX 3SDEB 4FQGA 2VC1A 2DK8A 1IXSB 2R5ZA 2LK2A 3K89A 3R6GB 4F0MA 3L7PA 3HLUA 2HZVA 4X65F 4U7UK 3JSMA 3K57A 2IJFA 4IHTA 2P5VA 2AXTC 3U27A 2ZJRF 2OTLI 3H35A 1T0FC 4YIFA 5G0RA 3V7CA 4W1UA 2E5JA 4KICA 2QL9B 2J8AA 2IMWP 3PQJA 2Z16A 4P5OA 3BO3A 3BSNA 1Q53A 3ASNH 3HZJA 2VA2A 2GIVA 1Y7PA 4AL5A 3BZ6A 2CS3A 3JAMY 3F21A 3O5TB 4XORA 5EWFA 3R2CJ 1VS3A 3HHLD 3QIPA 5EUHA 1U4BA 2GOMA 3HOUJ 4NI2A 5AJ3F 3VZHA 2IA1A 2MKJA 3PIPQ 2LY2A 2ZE2A 1YRTA 1T56A 1TZLA 4G12A 4TQRA 2KP6A 2QKMB 4V2GA 3WTTC 3S3MA 5L3CA 5RUBA 3DKYA 3K9TA 1ZTRA 1JQGA 4JV1A 1K83J 4F50A 2GQCA 1ZAWA 3RSNA 2K9LA 3K17A 1L0OC 4QU6A 1F5CA 2BYVE 1Y11A 1I3AA 2CPXA 5HS8A 3OL7A 2HYFA 2FXAA 3GTOJ 4D7MA 2YH1A 4EM2A 3I71A 4JX6A 4U7BA 2GHWA 3S2HJ 2I5JB 4H4OA 2ZVIA 1R4MB 3F8CA 2YVSA 5E3MA 5FDLB 1GHCA 3CCMI 2FMYA 4BE2A 1IQTA 1N48A 3R2DJ 1IG7A 3I4PA 3FC9A 5HP1A 3K1PA 2V9WA 1LNWA 4FE4A 3CCLS 3HRSA 1WC6A 4DR7J 1MN7A 3S8PA 1U1PA 3W60A 2HK2A 4RAZA 3UN2A 2H09A 1V55H 3L00A 1U0HA 3M6XA 1V3SA 5EGYA 4ZPTR 3M07A 2YKNA 2ZZMA 3SV4A 2HRTA 4F92B 3ZC4A 4N9HA 1U3EM 5IM0B 5DQGA 3G6YA 1Z4UA 1UW9A 2LOOA 4DV5F 3HKZD 2FHJD 2LMDA 2P7CB 4F02A 4EK2A 1MJ9A 4DQRA 1LUJB 1JJ8C 2N3OA 5KFFA 2LP4A 4N9IA 4Y2MA 1ONVA 3H2VE 3IWFA 3N5BA 4J91A 3BB5A 3CDHA 3K2YA 2DNMA 3RQIA 3KG1A 3CDIA 1XJWB 1RQ0A 5K8OA 1M1HA 2OD4A 3O8GA 2CWXA 5K20B 2QLXA 1IV6A 1HW9A 2Z5UA 4WU2A 2ZJPF 4NLOA 3VYRB 3FM5A 1WPKA 1JT6A 5DV5A 3A4TA 2WONB 4HG2A 4WFAQ 3FXOA 3DNCA 4JI8F 5CA5A 3I59B 2KYXA 1BI2A 3AJ2A 3PW4A 4GC6A 4DFJA 3H5RA 1U9NA 4XLNF 1HBOA 2X1FA 4OZLA 1NSPA 3CJNA 5FRNA 3MMAB 1QHHD 1YI2I 1SKWA 2V8PA 3NWGA 2JT1A 4PJLA 2XSFA 2QSHX 4USHA 4YOEA 1U26A 2EXUA 2NNNA 3ETOA 4LF4F 1RTIB 2NXUA 3D28A 1Q16B 3HDDA 2STWA 3D3CJ 3CMAS 5J1UA 4K59A 4C8MA 5HROB 3MVPA 3ZGKA 2NOJB 3M9AA 5JJBA 1I6JA 3Q5FA 4DUYJ 2Y0SD 1WQ2A 4OYIA 1G8XA 2DGVA 5E41A 2W7OA 5C4XJ 1QVGR 2CRGA 3H36A 2O3DA 5HLTA 4PGGA 2OHDA 1MWZA 2DNNA 2L5QA 2CDRB 2X48A 4ERDA 3V5RA 4NXNJ 1N32F 2ZMEC 1S0VA 1S1VA 2AJFE 1KP6A 1NDKA 3WIUA 2FPHX 3CJRB 2P9GA 1U6FA 4G65A 1SBRA 3PYGA 1RWKB 4JI0J 2KISA 3OYKA 1NDCA 3L9ZA 4RWWA 4KN7X 1JJHA 7FD1A 2NCKL 2BM1A 1RAAB 1KRPA 1T2KA 2ETHA 4NLWA 3OSFA 2A18A 2HZAA 3FUYA 2ZXJA 1HNVA 1VQ6S 2C2RA 2V1NA 4LK0F 1WI3A 4EWTA 4WXOA 2W2OP 1EP4A 1BXNA 4KT6A 3O3LA 3ZTSA 1KLNA 3KDOA 4LK1F 2E5ZA 3EE3A 2M8GX 3RB3A 1DUXC 2ELKA 1CF7B 2LBFB 4KC5A 4C2UA 1KZHA 1K1SA 2CQ3A 2J0QD 3TJAA 2F8EX 1R00A 4ZA1A 1TKXA 3A3OB 5B0GA 1CJUB 4D9JA 3TYTA 3GIJA 1Z3YA 1TL1A 1DJ0A 4HKQA 4IO9Q 3HTSB 3NBPA 3EYIA 2Z9OA 1H74A 3IWZA 5AJ3J 2AYGA 1FP1D 3KHGA 3KZYA 2QFJA 4L5JA 1S59A 4RS8A 4ECRA 4RM2A 2H6CA 4PG6A 1T8EA 4FYDA 4Y3OA 3MWMA 1NSQA 2DRAA 2EPIA 4K0KF 2C3YA 4X4OA 3SFGA 1FX4A 4YFXF 1I27A 3CMQA 2VF3A 2NAZA 4RNNA 3GLXA 2WAFA 3MM9A 1XDUA 4KDPA 2DR8A 1TWAJ 2KDOA 3OYFA 1PBAA 2CFOA 4G7ZF 2H8RA 3I9V2 1NZAA 4C9YA 4Y7NJ 2DNHA 4ILLA 1O8BA 3HSGA 2B43A 2ASJA 4ELTA 4CZZA 3LAMA 4C2TA 2JA2A 1FK9B 4GO1A 1HI0P 1NK9A 2YQ3A 2LCWA 2X3GA 3T1HF 2FVRA 2SXLA 4ZN3A 3GFIA 4DV1F 2XMMA 1S0MA 4CCMA 4P9UA 1OMIA 2IPQX 2FMLA 2VG6A 2R4GA 4EBDA 1ZGJA 1WC1A 1R5ID 4ZIWA 1J2VA 2V8VA 4DV5J 1R8PA 1UEVA 4CUGA 1VRUB 2HGNA 1HPZB 3O6QA 4A3KJ 1IN8A 4LIUA 3GLJA 3G86A 3M05A 2MJNA 2VT2A 3X2QH 1D0YA 1FFWB 2DNZA 4WF2A 3PO2J 4EU0A 2VICA 2JFDA 4UB8C 1IAWA 1UFWA 2XGPA 4MK7A 2L4AA 4NI2B 4FYYB 4IRKA 1PYTA 5J2PA 1QTNB 2V8GA 5F6FA 3GB0A 2MD5A 2WVBA 4EATA 4WZQA 2BJDA 5ETTA 5B0AA 3JAMK 2RQ4A 2VKRA 1F0XA 3BGFA 4LMYA 2QYOA 1IUJA 2CQ0A 3TAPA 4I7FA 6FD1A 4KPYA 3IWLA 3ECHA 3RYLA 4L3KA 3GILA 5CYJA 1CJKA 4DCOB 1O3SA 3JTNA 1UHMA 3QWUA 3CTRA 4JI8J 3LA7A 3TA0A 2M5WA 3UDCA 3QT8A 5IOZA 3LSJA 5K8NA 2ZB9A 2OPRA 1MSEC 2V8DA 1FJLA 2ZKZA 2HGMA 3HOVJ 3D6TB 2I1RA 2VXZA 4IR9A 4LITA 3CEDA 3CJKB 1VF9A 1DLOB 1NRKA 1NUEA 3ICLA 3IRXA 4Y28C 1P4WA 3DCFA 4L9TA 1VQ7I 2FYXA 2Q43A 4LF4J 2LDUA 4AIKA 4CLFA 3FXRA 3SHFA 1N88A 1IW7F 2OAZA 4M63A 1TQPA 4II3A 3NRBA 3D67A 2HRYA 4ZKAA 4C8ZA 2ZBPA 5HATA 3QPTA 2BV3A 5E3OA 2WBMA 1YJ7A 4HEA2 2Z33A 3D2WA 1FSEA 2ID3A 2Q6BA 4EZ9A 2ZHBA 1AFIA 3OV7A 4HVZA 5KG4A 1WDDA 1YBUA 1JJ2R 3OIOA 4KGXB 2ZWOA 1N32J 3MMBA 4TV7A 2DIVA 3G8SA 4GKJF 2HQRA 2DMNA 4ITSA 3HRUA 1N5SA 2GM4A 3Q2TC 1R89A 1S7HA 1JKHA 1NK0A 2F5DA 4DR1F 5GAEJ 2QA4G 2W4PA 2EBGA 3RRKA 1H2TZ 3HHEA 2JRTA 3BZQA 4BBRJ 2QSFX 3MPYA 4J9SA 4S0HB 1NJIT 3V7SA 1RHKB 2VPYB 4A0YA 3T1AA 4IQMA 5LHGA 1RT2B 4XKVA 4ECZA 4I67A 3E5UA 2DMQA 3SDGA 1WF0A 2AP6A 2DTJA 4DX5A 1WUUA 3D1OA 1JKQC 4ZITA 2I6WA 1RWMB 4PR6A 3TVZA 2DA3A 4RW6B 3C8YA 3L7OA 3FQKA 3KMSA 1YYVA 2CPIA 3CCQS 4BDZA 3W5YA 4NX9A 5K5RA 3GJSB 4XO0A 2E1MC 4DPXA 3FXKA 1ZREA 1E6VB 3IO1A 4FYXB 1JLQA 3TOAA 2A05A 3MM6A 4LUBA 4LBHA 5KFCA 2XZWA 2PI4A 4YB1P 4NLVA 3NOCA 4B9LA 2RRAA 2ZH4A 1KQFB 3MZYA 3VB2A 3H9GA 2DI3A 3G6EI 1RJJA 2XKOA 5BJRA 4PUSA 3K4NA 4CCNA 4K0KJ 1ZELA 2AJQA 5TGTA 2IBOA 1OQ3A 1Y4ZB 4DNCA 1RIOH 4U9RA 1VDHA 2VQCA 1NHKL 3PW5A 3PYFA 5F8JA 4MEXF 3QFHA 4C0BA 2DK2A 3BGLA 4WTYA 2CGPA 3K4BA 3BPXA 1P27B 1VQ4S 2CJYB 3I5UA 1IDYA 1ZYRF 3CCRI 3S14J 1SJ3P 1P2FA 1LFBA 3KUHA 4ETXA 4NA2A 3PUBA 2FJVA 1RT7B 3FSIA 1GMVA 2HVIA 2L2OA 4PXEA 3L9FA 5B0DA 1YJNS 2NPIA 4HF2A 1TV6A 3SQGB 5SZTA 1X4OA 3T1HJ 1E6YA 5DDOC 3V81B 2AZ1A 4CCJA 1YX2A 1TELA 3MM8B 4H4KA 2XVCA 5C2GA 4DV1J 3V6DA 1H73A 1Q8KA 2QLBB 1ZTWA 3WQPA 1Y3JA 2E1PA 3PJ9A 3CZ6A 2K7LA 2YQ1A 4F4YA 4P7TA 3IN5A 1FCAA 1OYIA 1O0PA 4OYOA 1FNMA 3J7AN 2BJ9A 4ICLA 4HX8A 5D8HB 4U87A 1PYOB 3ABMH 2EI5A 1TKXB 4EGZA 5K14A 3GFXA 1LPQA 4RBVA 3THVA 5D0HA 4EJTA 2RREA 4FVCA 1SVDA 3SEOA 3LSGA 2EB7A 2QLWA 5IOLA 1P9QC 3NBPB 3I0SA 1QSYA 1FJ7A 1YITS 5EHHA 1Z6RA 2X1BA 1GTEA 3IFEA 3PIOQ 2LU1A 3WE3A 3BSAA 1YSJA 4DU7A 2QX0A 2L3DA 3OHBA 2R2TA 2MZRA 4HYEA 4FYWB 1JWWA 4N7TA 4J9RA 1J7KA 1HI1A 2V4JB 1WNEA 4KMFA 4O5VA 3HHLC 3NS5A 3N05A 2HNDA 5E3PA 2L02A 1MMGA 3VSLA 2XI2A 4HI1A 1F43A 3VGSA 4WXWA 1QE1A 3MM9B 2HVHA 3ZXSA 3NEKA 1N54B 4UB6C 1FNOA 2E71A 2PN6A 3HVTA 1V3RA 4OX9F 2HKEA 4RZRA 1QTMA 2FLOA 4U0WA 1YJVA 2CAJA 1X4BA 1RR8C 1SQEA 4WPAA 4F0KA 3HJEA 1RHUB 3WZ0A 1CQMA 2CZVC 3BKUA 3W2VB 2OU2A 3J80Z 3HOZJ 2DLLA 5HS9A 3W3CA 3LQQA 1BN5A 5GAGU 3LSRA 1S6PB 2HAFA 3LA3A 3G3ZA 1K0TA 3CCEI 4HL9A 5DDQC 2CW0F 4QIGA 2M2EA 3VYTB 2HOTA 2JH3A 1HDPA 2ACYA 2JOQA 2VG6B 1HNXF 1AOYA 1IJFB 1UA1A 4XIDA 2YNFA 3PX0A 5F8GA 3ZMDA 3T8RA 1ENHA 4MYTA 2W57A 2L7KA 2F63A 4D0PA 1J5OB 3IHUA 2A6TA 1FBSA 3W6VA 1KEKA 2CV2A 4GKJJ 2DHAA 3G2XA 3UCZP 1FD2A 3S3OA 2LA4A 2CG4A 3L2RA 4P2MA 4U67Q 4RGXA 3BGOP 2KXNB 2DH7A 4J9NA 5IYBJ 4DR1J 1TWCJ 2O61A 1D9FA 3I6PA 1YDLA 2HVQA 2JPBA 3IRQA 3GFLA 2V1UA 2D9OA 4ETSA 3HOWJ 1UWBB 3SEZA 1GXUA 2M9KA 4KHRA 3CCMS 5A8WA 2ELHA 2RS2A 4KFBA 2BJEA 3WBZA 3ERMA 3CJSA 5E1XA 1GV5A 4IG3A 2RIJA 1CJKB 2G2YA 2CVEA 3HKZN 4EO8A 4XR6A 2CUJA 5ETSA 4DPWA 3CCUI 3BJAA 2QA4S 4NOHA 2NYHA 4XKWA 1W7PB 2L7MP 1TBXA 2AHQA 3TNVA 3GYGA 3TVKA 2KFZA 1EIYB 2MPUA 2KRFA 1HNZF 2IBDA 5FJ4A 3I96A 2GJ2A 2IGOA 4O3MA 4G3IA 5D4PA 4M6VA 3MR6A 4DPYA 1VNDA 4C9DA 2VFVA 1FXDA 1Y39A 5L9NA 2BY2A 3D0GE 3MGJA 2AGQA 3VAFA 1NBEB 1V9OA 1G6BA 2CMPA 4RW7A 3EXYA 4DHVA 2PJRA 1JJCB 3DQVC 3G82A 3BYRA 3E8OA 2VC0A 1KNZA 3NWRA 1K79A 1SQFA 2WVDA 2DNKA 4K4VA 5LHIA 5HN0A 1RT1A 3HFZB 2MW8A 3C15A 1IKWA 2OPQB 3SSQA 3W7BA 4DX6A 4NBQA 4DV3F 3PW0A 3F8MA 3E2EA 3LSHA 2NREA 3SZGA 4KT5C 2YH0A 1SIWB 4EJVA 3H5NA 2MXYA 3MPDA 1JKHB 1D8ZA 2GLOA 3PRDA 2YXLA 2NOGA 2N7CA 3BSOA 5HNHA 4DR3F 1O7LA 3TUZC 3T5XA 3LGHA 4J9UE 4DWIA 4OJHA 4A48A 4A3GJ 3BR0A 2WBRA 3POTB 4EBEA 4DDFA 5MLCV 4ZVHA 5B1AH 2WHOA 3NGTA 3AB2B 3DCAA 2HYGD 2DPUA 4NB5A 2QL7B 3OW2R 3K4LA 4WE1A 2DNGA 1R5HA 1QNTA 3WC2A 3W2WA 2LYCA 4BAYA 3HHHA 2RS8A 3T19A 4X84A 3NGDA 1PP8F 2XLIA 2B4OA 1I6XA 3PDNA 2CPEA 4FISA 3KNAA 4GFBA 3MWBA 3KK1A 2FHKA 4OYAA 2P5LC 4R0JA 1VISA 1KHVA 4PG7A 4YR0A 4J00A 2JVRA 3OIPA 3PNIA 1VQNS 1KC8T 4PPDA 1AFJA 1T39A 2DW4A 3ENQA 3QOPA 1NK2P 3Q86A 2ZH1A 1LDKB 4UY8T 2BE7D 3KP3A 3QQCD 4LF8F 4R8HA 3QP6A 2UUWA 1MJBA 1TKTA 3CP8A 4M6XA 4OX9J 2GVDA 3ZOBA 4W92B 4BDYA 4ZK7M 2WOMA 3TAQA 2ZBKA 2H94A 3MUTP 4AC0A 1Y00A 3EDPA 2COBA 1HQUB 4IRHA 1S72I 1RUOA 4GDFA 4W4MA 2IC3A 4XIUA 4QWCA 3ZMUA 1QHGA 5D15A 3OV8A 1OR7C 1JI8A 4G1QA 3NGUA 4II2A 3J7ZT 1D0EA 1QAJA 4OZ0A 3OLBA 4IKFA 1S1UA 2LQJA 1HNXJ 3R6SA 5KFAA 2XS7A 4JV2A 2AF6A 4ENMA 3AG4H 3LO3A 2VJ4A 4XNFA 3M32B 4WWSA 2E1RA 2ZNZA 4J01A 1A36A 1JGGA 3C19A 1B6AA 4DYRA 2HS3A 3Q8QB 3PEHA 2V94A 2Z2MA 1JTXA 3BZCA 3GFJA 1MMSA 4FPRA 5K14B 4L9VA 1TVRA 4EV0A 3DLGB 4KUMA 2VZ9A 1TZ0A 1O57A 1JLEB 3SCLE 4OHZA 2CUFA 2QZ8A 5B0CA 2HOEA 2PMZD 4I2PA 2CSOA 5ILVA 2DPDA 3F9KA 2KLOA 3OR2C 1GFWB 5F3ZA 3UKGA 3U1KA 4UXNA 5KFJA 4PQAA 2QQ9A 1DRZA 3QGPA 4NZ0A 2MLZA 3TL4X 2XF6A 1SFKA 5DM7Q 3PNTA 1YIJI 2HPIA 1R23A 4A6DA 3C14A 2HNDB 4ANEA 1VQMI 4AIJA 2JA7J 3ZTOA 1NKEA 3ZZTA 3QLHB 1JLFB 3KP7A 5HQLA 3K69A 1KTQA 4CIOA 5KFZA 4QPOA 2UXCF 2D69A 4ZPAA 4OIPF 1ZGWA 3T6BA 1RWWB 1OISA 5BPIA 2UXBJ 2IS2A 1W36D 4NMLA 3C1DA 5LL6d 2M0CA 1TL3B 1HNZJ 3CC2I 2K27A 5C5JA 2UZKA 4P9SA 1V6HA 2WSFC 1AA7A 2BJ8A 3BV8A 3QNWB 4BH9A 4KO0B 3NRVA 2H9ZA 2PT0A 3DLJA 2DR7A 1FF2A 4NYZA 1K8AT 4WIQA 2NNYA 3KJNB 1QAXA 1JLAA 1Y1WJ 1A5JA 2W2QP 2PI5A 4OAYA 3KDNA 5ETNA 2VB6A 3CCWA 2CQNA 4WBFA 2ILYA 5DUKA 2E5LF 5CD4H 2EZLA 4B09A 2AGOA 1SJQA 2F4OB 1H3DA 5JLWA 4EUVA 1WDTA 2W9BB 3RPUA 2MKCA 3R1LA 1S1XB 4OINF 2LKXA 4K2XA 3OT9A 3FK6A 1QQIA 4OZ1A 2MKKA 3G96A 4UOGA 4DV3J 2OEJA 1ZR4A 3M9OB 4DLEA 5J3LA 1IBCB 5F8IA 2QF7A 5KOXA 4BACA 3DPUA 4U7CA 3ZQ7A 3OJUA 4KAIA 3PUFA 2ZH8A 2ZXIA 4DJAA 2HHSA 4RWXA 1R1TA 3AXMA 3SMZA 2XPWA 3RBEA 2ELJA 3K5LA 5KG2A 4DR3J 3ILOA 2UUCJ 1WI6A 5KFUA 4USUA 5A8WB 4KFBB 3AAFA 4LSLB 3T1BA 1NMEB 1IGNA 4O4GB 4KH1B 5HK4A 3F6VA 2LSOA 2G0EA 1ZG3A 5DS9A 1RWPB 3I3LA 4YMEA 4CRJA 2P6TA 5L46A 2Y75A 1RLDA 2AKWB 3CJQB 1TWFJ 5JR3A 4CCHA 5EGOA 4WP8A 4KH0B 3CO6C 4B3XA 2JNJA 4MNUA 3S16J 4L3NA 1HQEB 1X9WA 5IC4B 4HI2A 4C30A 3DMJA 5D6GA 1ZRCA 3K2ZA 2O03A 3DI6B 3TO8A 5H1SV 3AL0B 1ETVA 2H4YB 5M2RA 5KK1A 3L2VA 1R8CA 4OHYA 2IGMA 2XO7A 4LFBF 4YQWA 3KG0A 3T3FA 4LLGF 1PJRA 5ILUA 4MT1A 2ZDPA 3A8KA 5KAKA 1HYSA 1XWLA 3HYIA 3LP0B 3VAKA 4RNOA 2EKNA 2W8KA 4KV8B 3D7SB 3WGHA 4WP3A 3MEXA 4ZZDA 4LF8J 1LXJA 3Q8PB 3DPLC 3IM9A 2XCPA 3ZZOA 4EBCA 1TU0B 1MNMC 1HF0A 1I1SA 2GC8A 4O44A 1RT1B 4P2XA 2KH9A 3FK4A 1FMWA 2MSYA 1IKWB 3GJQB 4N77A 3JTPA 1KQ9A 4Y2CA 3OFGA 4BLGA 2DYSH 1EETB 3WDOA 4IYQA 4M5DB 4C2MJ 1YBTA 4I68A 5KG6A 1E3PA 3OYMA 1DP7P 2NYIA 3NAUA 3KP4A 2L48A 1QD1A 4P7VA 4OHWA 4JQFA 5D4OA 4LR8A 1JLCA 1HARA 1CULB 4IDKB 2DFIA 2FU4A 2VV5A 3ZMZA 2GAUA 3C6UB 2EIJH 1ZRFA 2IYGA 1QSLA 1RZMA 2QE5A 4FS1A 1TFYA 1XCVA 2F7VA 5M5YJ 4XRFA 1VJWA 4MTPA 4D1QA 2HS0A 3W2WB 3QATA 1KONA 1RISA 1APSA 3A8IA 4X1EA 1MNDA 5HJYA 3HD1A 3F72A 2W25A 1NAQA 1ON1A 1TL4A 4RJVA 5DCMB 3TAMB 3KK1B 2QQBA 3LW5C 1X1BA 5E1WA 3GWZA 1LEAA 4ESJA 2J9DA 4GRIA 1MBGA 2LF7A 2HS4A 2KL4A 3DKXA 2KRCA 2HS5A 4BXFA 2NRAC 5L1LA 4C6AA 3DRSA 3S3NA 4ZYDA 3GXOA 5LT5A 3AQPA 3RW7A 1TKTB 2PA3A 1F2GA 2UXCJ 3KOAA 2GVDB 3QJPA 2JZ5A 1UZHA 1EAYC 2ZH6A 4B1RA 1U45A 2WOMB 5K8PA 3IKTA 5IP6A 3VOEA 1K44A 2V69A 1UCRA 2VD3A 2XHWA 3GZNB 2GMHA 2YNGB 4NA1A 4QCLA 1TNSA 1HD0A 1Y5IB 5ETKA 3M2RB 3IAS2 2X1CA 3TP3A 1U25A 2XGCA 3F44A 2XASA 2ISZA 4IHVA 3C16A 2DR6A 2MA3A 4FCYA 4G1QB 2NSBA 1IXCA 1SCJB 1R36A 3C2GA 1KU7A 2DITA 1S1UB 1I5ZA 2E5LJ 3OHAA 5IP7J 2Q2EA 4J9VA 3D6MB 5GAGJ 1EX8A 5G4DA 1XERA 4L75A 1G3TA 2GZOA 4PSXA 2DDBA 1WH7A 4DBQA 2LY1A 4K4TA 1ODDA 3F0CA 4GVLA 4A5MA 4KISA 4RUHA 4D5CA 1WF2A 3BR5A 3HHKA 4LF6F 3TP2A 2YNHA 2PSZA 2E5NA 2XIGA 3KX2A 4FBTA 3NQOA 3LNQA 2LC2A 1M5PC 5E8GA 5C42A 1RSCA 3HG9A 4A46A 1I51B 1T9YA 5FFZA 2FDNA 1BMQB 3J81U 2PI0A 3CF2A 3C14B 3M8QB 3GO5A 1ZQ3P 2R7QA 3CCES 4TYAA 4E7JA 3IC7A 2CO5A 1SJFA 5EX0A 2Z8QA 4LB5A 2O5DA 2G1DA 4Q0BA 1U9OA 3W3SA 1GAOA 2B9EA 5KT4A 2X9DA 1KFDA 1KQ8A 1Q1VA 2K85A 3JRBA 3MKZA 3X3UA 4DPTA 2PEBA 4J19A 4F2SA 2JVOA 5KFNA 4P74A 3C3WA 4ZVUB 1ERDA 2M70A 3GP9A 3CUQA 3WGIA 1TR0A 3RAQA 1SKRA 5T7LB 2C2OB 2K06A 4LFBJ 4L6V3 3BQ0A 5GAEI 5MAOA 2JZYA 5AIPA 2GVZA 3P3DA 3RG6A 1JLGA 4IZZA 2HZTA 4FKYA 3A8JA 1UHWA 1HD1A 2BBEA 3JTGA 1SH0A 1N5QA 1C4AA 2CDQA 3IM8A 2RKIB 3R5JB 1RI7A 2EFPA 4LF1A 1POGA 3EICA 5L3FA 4IQXA 2V6AA 1X1PA 3V6JA 1N25A 3BBCA 1S9EB 3U1MA 4CLWA 3RBXA 2KM8C 3R9LA 5FLXU 1S1TA 1ZPWX 3CCUS 2R7UA 4WU3A 2YS9A 1DTTA 1RTJA 1BM9A 1KVKA 3Q3SA 3S6EA 2W82A 3BPDA 3RB6A 1P4XA 2GWRA 4IEJA 1RXOB 4M72A 1GXLA 4ZTFA 1GUUA 2Y0BB 2LF8A 3VF0B 2GX8A 4PUOA 3IP4B 1U1RA 2APOA 4CWBA 3W5XA 5LSOA 2MKIA 3MM5B 4LBPA 4AD6A 2N7YA 3GZ5A 3UR3C 1RUNA 2B8PA 4HW0A 2XSJC 4AYBN 3BM7A 2FRHA 1RAHB 4A3IJ 4B3RF 4RPFA 3L95X 4AT1B 5B7WA 4DV2F 3DLBA 1VBXA 1SANA 1MKMA 4K5SA 4F3OA 3RW6A 1FHTA 1NHVA 4NPOA 2MQNA 2RQPA 2VFRA 2F9JA 3TGNA 3DRRA 3OL4A 2P9EA 1UVIA 4B3MF 1HMVB 1G1XA 2HZDA 1XPXA 1ZG5A 5ITHA 4UOHA 2XRNA 3BDEA 2KMUA 2BOPA 2A07F 4O3SA 2QMXA 4NRUA 3KK2A 3BBFA 3X1LB 1SC3B 1PC4A 2R3SA 2MG4A 3DOMB 1YOVB 2HBRB 5HSPA 2ZC2A 1HKAA 3PCOB 4BS9A 2PBIA 3GONA 1U78A 4A3DJ 2KU7A 3IBCB 1F1ZA 4PG5A 2E35A 4KE5A 3D5SC 3BO4A 1RAEB 1ZLJA 4M3GA 4I2QB 2CPDA 4RW9B 1TT0A 2HFSA 1IXKA 3MUVP 4PKDB 1UFLA 4CTAB 3EUHC 1LW2A 1AROP 5J2QA 2HI3A 2IRUA 3MEDB 1N5YB 3IXQA 1XDSA 2QN6B 4CT8A 3M1VB 2RQCA 2K40A 1ZRDA 5IPAA 1C0TA 4F93B 4NYPA 3TI0A 3BDPA 1MU2A 4LF6J 2V26A 5FLVA 3N0VA 2HYJA 4DV7F 4CNYA 1LEBA 3OTDA 3QFWA 1VOMA 2HBYB 3TO9A 2FUG9 3MTKA 2FQ4A 3B6CA 1EB0A 4PABA 3W62A 1D0XA 3TKYA 2FJBB 4WP9A 4M9SA 4F52A 4LR9A 2AYBA 1T03A 1HNIB 4B9TA 3ZZYA 3HZGA 1FA0A 2YUSA 2JMWA 2JJ7A 4DG1B 1B0PA 5HI7A 1DY3A 3SEQA 3M2VA 5BMZA 2ESHA 2E1OA 3E5QA 4OMFG 4YDXA 4RB2C 1NO8A 2V1DA 1W1WE 2CJQA 1S4EA 2DA2A 1XGOA 1B8IA 3MOZA 1O6XA 3LALA 2H51B 2PMZN 1URRA 5H9FJ 3V6HA 1HW5A 2EVZA 3Q22A 1NM2A 1X4PA 2IPOB 2IAIA 4X2BA 4XDDA 4HNUA 2OUGA 3KJFB 3CUNA 1XEZA 4DR6F 4LREA 1XG1A 1REVA 4OYMA 3C16B 1MH4A 1W36C 2K3KA 2H1YA 1EHWA 1B59A 3K5MA 3LSTA 3CCJS 4PGHA 3AAWB 4H0EA 5HDKA 3CIZA 2UVVA 4ZDNA 3T5LA 5IQQA 1BC8C 5IOYA 3W66A 5J40A 4NYOA 1L3VA 3E01A 5HVHA 5H6RA 4LG3A 3FHZA 2A5YB 2B51A 2HLTA 2NZCA 1SQGA 3TEGA 2V6CA 1YIJS 1WJAA 3FWEA 1FXLA 1A6LA 3GYHX 2MKSA 4MQ9F 4OYZA 1IWGA 4OYBA 2GA1A 2W1BA 2XM3A 1NPRA 2XNQA 4ZVPB 5F0FA 1B1BA 5LXRA 3ZMTA 3OUYA 1FJGF 3H2LA 1IR2A 5D6EA 4Z2YA 3NLCA 3QT6A 4S0MA 5C42B 2YKMB 3A01A 4BE0A 3BGRB 2NS8A 3R7SB 4OAZA 2RKHA 3G9CA 2BZ2A 1K1QA 4NHJA 5F0WA 1HWJA 2BQRA 5F0UA 4XAKA 3QPLA 2R8KA 1S0OA 2E5IA 2DISA 1G7CB 3BWGA 1J2XA 2VQLA 2AU0A 1FTCA 4F4KA 1FD8A 3FSXA 1WJBA 4Q0BB 2EZKA 4PSWA 4I6AA 3CJ5A 1U7LA 1EF4A 1XN7A 2VBZA 2BXYA 1XS9A 4B3RJ 5DZ6A 3NG8A 4KIBA 1VC5A 2KIUA 3HZEA 3BCBA 4DV2J 2CYYA 3G73A 3PIOF 1VQKS 3OYAA 4Z7YA 2D1VA 1U6BA 3QYFA 2JA6J 2QL5B 4IH6A 4RW4A 5DO2A 4B3MJ 3GCWP 1CC7A 2GVZB 1OKRA 2K2PA 2ICWG 2D3O1 2CQQA 1FEEA 2HNYA 3ZQHA 5M3FJ 4CLZA 3RDIA 2L54A 4F4AA 3DLKB 3KLIB 3QWPA 1I39A 4PJJA 1L3TA 1U6ZA 3BPSP 1Y10A 3RAMA 2VBWA 5HNFA 5FKNA 1G3WA 2MBFA 2LDIA 1YLFA 1FWLA 3ENAA 5JVGQ 2XAJA 3W1YC 2HWHA 2BKOA 1ZAOA 3PR5B 1QVFR 2Q8KA 4U88A 4YFKF 4KQZA 1DTTB 4XOTA 3IBWA 1QAYA 4WFZA 2MQMA 1YTYA 3OR1C 4LSNB 3K4JA 2QEXI 4E98A 2K8GA 5KG0A 2EFWA 3OQ2A 4MKAA 4PUOB 3K4CA 1YX3A 2JWNA 5CAAA 4BQQA 3KEQA 2DFEA 3HB9A 3HC7A 4NCAA 1F5BA 4GCVA 5FO5A 3MQ0A 3IS9B 3LAKA 2OCCH 5FGMA 5KFBA 1HKQA 2HPMA 3L2CA 3M1EA 1PUFA 4UOFA 4J9OA 1XGNA 4ED2A 4DV7J 3FEXB 2HQCA 1U5TC 2O01C 2HQDA 2CQ1A 1JE8A 1VQOI 1L5UA 3D68A 3I56S 1M1KT 3R5GA 4HF1A 2A5WA 3DRRB 4YIRX 3FK7A 2F8MA 3IGVA 3SZPA 4IFVB 4C3HJ 1J27A 1XTAA 3BG3A 1LW0B 5J1NA 8RUCA 3H98A 2EV0A 3CJ8A 2KRRA 3NWSA 1NKBA 1XMOF 1DARA 4PRFA 4PJNA 3BT9A 2CQKA 2HG4A 1NJWA 2ZBIA 1VYAA 7AT1B 4BHQA 2X0LA 1X5SA 2DTZA 4E4HA 2N4CA 2I10A 4QW9A 1HLVA 4Y13A 4A8OA 4B02A 3OFHA 3OYNA 2A0FB 1KWMA 1R0CB 1T7PA 4V2FA 1AXQA 3DGPB 4ZP9A 5SUHA 1WH5A 1EKRA 1EH7A 2O1PA 3N6MA 4NCGB 5B0EA 2ATLA 3KLGA 2KRBA 4DR6J 1IV8A 2HIQA 2ZJ2A 3OL8A 1CS4A 2AWZA 4TU9A 4RLFA 3I0RA 2XG8A 3HT0A 4XICA 3PHTA 1V5IB 1VBKA 1ZM3A 4TNOA 3OVAA 4LLNA 4LSZB 4M94A 1S57A 4LRDA 4QPTA 1SL1A 4ZLNA 5KFXA 1CBKA 3C18A 3K1MA 5J2QB 3L7WA 1VZ0A 2CQBA 2WA0A 3R5BA 5J1EB 3W8PA 5DLFA 3D5RC 3VCDA 3EPZA 2LFVA 5HODA 1N78A 3PFOA 2JVHA 3FRYA 3OSGA 4QIFA 1MU2B 4HV6A 5I3UB 5E7OB 2XBPA 2ZMEB 2FNAA 4ATNA 5LSRA 5B09A 2V8HA 2H48B 2KXFA 1FJGJ 2QG9B 1SC1B 5EF6A 4KNYA 5J2NB 1NZ8A 1FI4A 4ZHRB 4C3IJ 2AHOB 2C6YA 4CO8A 2D1CA 1NH3A 1UTAA 3EZUA 3NS7B 1O3TA 1ZA1B 2GIZA 3GV5B 4DL3A 3P5JA 2MC4A 1IUYA 3KLVA 4B9UA 3MM7A 1L3LA 4ZYEA 5A8KB 1RAOA 1DHMA 5AXMA 3IC1A 1KQKA 1U0JA 3SZTA 1N6QB 5GADU 3HSDA 2ZD1A 4B3AA 1S79A 4XBFA 1B8IB 4NLRA 4IOCF 2XV4S 2QSGX 1HDDC 3GV8B 1HR0F 1A6QA 3JREA 3QYEA 4Z37A 1DDNA 4YB5A 3DF8A 3UNGC 3IA0A 3TANA 3RJMB 1UVJA 3T9NA 2J9CA 4DV6F 2RHSB 2KFYA 3IRWP 2IBKA 2OQGA 6AT1B 3BKTA 1UG2A 4OX6A 5AE1A 2RSQA 4TLRA 2GA2A 3I4NJ 3PR4A 5HVFA 4K5RA 4B9MA 4ED0A 3F41A 3GIIA 4YG2F 1I6HJ 4QR0A 2CU7A 4NQWA 3GG1A 3LP1B 4IRIA 3DXJF 2L9SA 2FLNA 4V19J 1WJEA 1VQ5S 1UWAA 1BQNA 3WHIA 3BN7A 1BE4A 3BROA 2COLA 3CCLI 1FESA 4I2OA 5LMUF 2HVZA 2X4HA 5GAHU 1NU4A 1RE1B 3QRQA 3OFEA 1TP4A 3GMGA 5F9NA 2Y9YA 3N6LA 4XLAA 3C66A 1IC8A 4A8KA 1RKIA 5KHDA 2HHVA 4PCQA 2XZTB 2VJIA 2BDPA 1JXEA 3PG9A 3M2UA 1IWAA 5EJCA 2HGCA 2J0WA 1PJ6A 3UWTA 3JTHA 1KR4A 3J81Y 3NAHA 4D3HA 4ECSA 3HHGA 2QYCA 1AYEA 3GTJJ 3RAXA 2NYXA 2OPSB 2H54B 2ZHOA 2LRDA 1S5ZA 3P9KA 1DGWY 5GP9A 3MR7A 1YRNA 4Y33A 3KYDB 1TUGB 3OPKA 3HFKA 4E2FB 3ABTA 4OX8A 3D1QA 1JHFA 4BGDA 1YG2A 1B4SA 1LWFA 4C3MA 2GZWA 2FD5A 2X51A 2BKPA 2OZUA 2H5IB 4IXAA 3UD3P 4LGWA 2G4BA 2M8HA 3H5AA 5DM7F 2CPHA 3KZIC 4DCJB 1OFCX 2XWXA 2ZNYA 2GHPA 3E1SA 1LVAA 1XMOJ 3TVYA 1LDJA 2E5HA 3FMWA 1T9TA 3U1LA 1AUSL 1HKSA 5EWEA 2JLEA 1R0BG 2COMA 2BJ1A 5T41A 2VJJA 4ITVA 2ACJA 2FEZA 1RETA 3CMAI 3SFIA 1NHUA 1SC6A 4X6AJ 1YJ9S 1HHTP 1FKPA 3US5A 5E18F 1L3KA 1D3WA 3QIDA 5FLXY 5A2QU 1HA8A 3J80U 3QJJA 1IM4A 2L9WA 4DS5A 3KEYA 3KK3A 2FJWA 3NNAA 3FKIJ 3F6OA 1SJ1A 4ENJA 1VQYA 4G7OF 4LF5F 5H9EK 4LBIA 3OYDA 4XDCA 1T9XA 1KOHA 3E6MA 1F3FA 3GCXP 4DUZF 2PDAA 3CESA 5GTHC 3PO5A 1VQ6I 4E7KA 4RB3C 4XMYA 2XZDB 5C24B 4ECYA 1PUFB 5BPDA 2RD5C 2XLJA 1JGSA 4MKBA 1FRXA 2Z57B 1MSFC 2Y0SA 4A3MJ 2FVPA 2CXEA 3HPHA 2DO4A 4C8KA 2B7BB 3KG4A 3QU3A 2QTWA 2DBBA 2R3VA 3OS1A 4OL8A 1O51A 2OD5A 4YB7A 1YQAA 1MMAA 1XMQF 3I64A 3FKJA 3N4WA 1FDBA 1IBKF 5JFRA 2KZZA 1A6IA 2MB0B 2ALZA 3KLFB 1YJWS 1V3FA 4USWA 4LF7F 4B08A 4LMZA 2X3DA 2QMUB 3DM2A 2DR5A 4ZDLA 1S48A 3CGIA 2RQQA 5GAGI 1HCRA 4BUPA 1YG0A 4NEZA 3VPRA 3EGNA 5KNLA 3ZXWA 5BR8F 3BREA 3I31A 3SDEA 4BY7J 1HR0J 4RKUC 1I50J 2Z2ZA 4HH0A 4BCAA 1MIJA 4IH7A 3HTUA 1FT8A 2E1MB 1PYVA 2A3SA 5AT1B 5J8FA 4DV6J 3AOCA 3LFKA 1T05B 3PO4A 2L7FP 4WZMA 2XHKA 3G87A 4RR5A 4IJAA 3MDFA 3CMES 3VVTA 2IJRA 3PACA 1EA3A 2NS7A 1RADB 1HW1A 5K5OA 1ZA2B 3B4DA 1TKDA 5LMUJ 1DTQB 2ZKTA 4I56A 2G9WA 1M5KC 5AXKA 2J76E 1I1GA 4N76A 2VFSA 1P9YA 2L9VA 2CV1A 5KG5A 2HK3A 3D5LA 3IBFB 2YWGA 2KYZA 2IY5B 4PYAA 4ZJOA 4P71A 4BNCA 4HT5A 4KJZA 3HVWA 2JEIA 3TOBA 2UUAF 3S2DJ 2OBPA 1PILA 4L73A 4HHHA 2A2DA 3VAIA 4Q7AA 3LP2A 2DA7A 4YFNF 3MM7B 2UXNA 2CFXA 3BJYA 4LRBA 4JI4F 4ECXA 3I5BA 1HBUB 1IUFA 3M8RA 5LD2C 2I5JA 5CJ9A 3S1TA 4DSIA 1R71A 1X4AA 5FDLA 4I98B 3DTKA 4A4JA 2KDZA 3P7NA 2BW7A 2OTJS 3V42A 2IS6A 2H5EA 2X1GA 3I53A 2HMIB 1LE8B 2A69F 1D1BA 4KMUX 3ZZUA 4F4WA 1BWEA 2IFXA 1S0NA 4UZBA 1LB2A 2FLPA 3CCTA 1EQMA 1BWVA 1I3OB 3L4BC 1SEUA 1UHSA 4A2UA 1XNRF 1T98A 4B47A 4IOAF 4C11B 2DA4A 3ASOH 4QU7A 2BVMA 2OAUA 4NLYA 3EZOA 4P73A 4OI4A 2QSWA 3HHLB 3A1YA 3PFEA 4CLLA 1KU2A 3DLEB 3CP2A 5J6XA 4OYXA 1DAXA 2EG2A 1KHWA 5JVHQ 3WG7H 4ETZA 1WC5A 4LB6B 1HQ2A 2B7CB 4QBUA 3ELKA 1RHRB 5E3QA 2CJKA 3S1QJ 3J7AY 4WCGA 4IRCA 1SC7A 4WK8F 1D0ZA 2LY9A 1S7AA 4AIDA 2PD1A 3F22A 4OX7A 9RUBA 3Q24A 2OMOA 4LF5J 2XO6A 2KJCA 5AE3A 2VLAA 2WB4A 4KIAA 2IS1A 3NCQA 1F2HA 3AG2H 4IH5A 3WHBA 4UUTA 3I59A 5E1ZB 2DB1A 4DUZJ 4F25A 3H3ZA 2UUZA 2VBYA 1GT0C 1HL6A 1OSDA 1YRNB 4JOMA 2FZKB 2VASA 4MHGA 5D4RA 3LTOA 4FZVA 1ITYA 5L39A 4YFUA 4XSXF 5LRRA 3J81K 4PAAA 3FKBA 2WAQN 2D74B 2JC0A 1PGZA 5HQMA 2RVJA 4UV9A 1XIQA 2B5JA 5HL7Q 1NJZA 2FGOA 3ISZA 4CM2A 5HVGA 5HROA 4ZVQB 3FXJA 1XMQJ 3A1YG 2DXDA 2IMOA 3CCQI 1IBKJ 3WC0A 5KFIA 1IR0A 5CVJA 1PO6A 4ZCKA 4HEA9 2MD0A 1M5SA 5KFYA 1SIZA 1SC4B 4LF7J 2NLWA 3HBLA 4V19K 3IMQJ 3CJRA 4RB1A 3S7RA 1UELB 4EQQA 3MFKA 4LJZF 4DI6A 5LHHA 1PC5A 3D0SA 5BR8J 3QSYB 4U8VA 4G6DA 1FSHA 2ZH9A 1TTYA 5K7HA 3VODA 4HACB 4B9SA 4C8LA 2PMWA 4NLUA 3EWGA 4D3GA 3J81Z 5EWGA 1QZYA 2BHYA 1T6SA 2BBYA 1VQ4I 3DBHB 2CQIA 5BNGA 2MZ1A 3UN5A 4USJC 2B6AA 2ZM6F 3OTCA 1CF7A 4MAKA 2AEMA 5FLXK 2LBFA 3F8NA 4KR0B 3D4JA 4HLYA 4YDDB 4L18B 2CW8A 3HRTA 2HQNA 2GJFA 3D6HB 4A8QA 1NB2A 3A12A 1D9DA 1QVTA 1Y8RB 2DVIA 4X4NA 2YBVA 4FKXA 4E7SA 5D77A 4O3RA 2VPXB 2R7SA 4QIWN 5KFTA 1CG2A 3ECOA 1N33F 4ED7A 3K59A 3VTIA 2RF2A 3NWTA 1TQLA 1ZAXA 3L7UA 1JK9B 3DRPB 3OYHA 1YS7A 2KIFA 2Q1ZB 4ZYGA 2UUAJ 5K7ZA 2F1FA 2W84A 1SD4A 2NUHA 2HWTA 1IBMF 1YRXA 2Y0MA 2V5HG 2D1HA 3HI9A 2ZFWA 1JKPC 4CH1A 2UUBJ 1YITI 4ID5B 3RUBL 1BA5A 3G4SI 4V1Ak 3CJ4A 4JI4J 3FMRA 3QPSA 1QRYA 1NSAA 4QWDA 4V19X 3LAPA 3LWMA 2XMAA 3IH4A 1R8BA 1ZTTA 4RBUA 2BE2B 2LXFA 3EUAA 2QGFB 4HQMA 2HHXA 4F4XA 4RMNA 3WTVC 2AXLA 4P52A 2R7TA 1VFCA 2L41A 3ZO7A 1FK9A 4GYGA 2RH3A 2Y1RI 5GPCA 2RU9A 3NOGA 2P9CA 2CPFA 2DMTA 3A3NB 2DY9A 2JK3A 5GADJ 1XNRJ 3PKMA 5DYMA 1ROFA 1YZ6A 1LEOA 1VHFA 2E1AA 4C8NA 5CYVA 4N5SA 4FDFA 2EBIA 4E8UA 1YE9A 5A6WA 5ETPA 1NKCA 3C2PA 1S8NA 4DX8H 1W0TA 1PG5B 5LGNA 1VRUA 3QPHA 1HPZA 3V4MA 4HOBA 2AZ3A 5BQTA 2QV6A 4AL6A 3FCVA 2MTLA 5HAOA 1YZ7A 2A68F 3KJVB 3NNCA 4LFAF 4WIIA 1F6TA 2DCEA 3IG1A 2ZZNA 2U2FA 2DDAA 5FLMJ 3Q9SA 4X4SA 2F2EA 2QBYB 3CC7S 2LDYA 1RTDB 1FMVA 2PFFB 4BS2A 5JLXA 4CO2A 1FJCA 1OSCA 3TUJC 2CQGA 1BW6A 2LNBA 2HBZB 1UPMB 3NNHA 2IRYA 1BJZA 2VFUA 4DW6A 1RBLA 1GH8A 1X1AA 2XYGB 3LP2B 2W2MP 1KTVA 3IH3A 2HQIA 2QQ8A 3BTLA 2XS5A 3OWTA 1FP2A 3CDEA 3TOQA 3M9MB 2VIXA 1FWZA 4ON0A 4HX7A 5HOOA 3CJKA 1RZ4A 3MD2A 2IIHA 3H0PA 1GMUA 1DLOA 5DG9A 3OJSA 4BEHB 1ZN2A 1DU0A 4PWWA 2A6OA 3TMOA 2E66A 3W61A 1WI9A 2QA4I 2LD5A 1R0AB 3HXMA 2XGXA 3VQSA 3TA1A 1OCCH 5C3EJ 2HFZA 2MEWA 3ZQGA 3ZMSA 1SKUB 3OR2B 3RPUD 2DT7B 4ED6A 2F6CA 4OLOA 4M1KA 3LPYA 4EYHB 4DSLA 5H20A 3IWNC 4E7IA 3SQOP 1WOPA 4CSWA 2NQPA 2XAQA 3OL6A 2M3AA 2E7VA 2B8QA 3W64A 3VGTA 1BHNA 4TY8B 1G3OA 2R92J 2YWKA 3I5AA 1OYEA 1VJQA 2D41A 2OI2A 3MEKA 2NPFA 3RKWA 1TMMA 3KP2A 2DFHA 1ORKA 3VR1A 2FZCB 2ATCB 4OZ3A 2BGCA 1RTHA 1QM9A 4M5GA 4Y0FA 1VQPS 3F73A 2WAQA 2CPJA 1RT2A 5GMDA 2R8IA 3VWSA 3PJWA 2ZM6J 5KAIC 6PAXA 3MZIA 3K8VA 1Z67A 4UUSB 1WHVA 4HHJA 2IVFB 3GCMA 4CP5A 2IDLA 1WEYA 1FNXH 2VA3A 5EX3A 1XQIA 4RW6A 3HSZA 1SFXA 5IV4A 3DC2A 1WD6A 3SIPB 1ETWA 4ES1A 2JRMA 1SD7A 3FHNA 2B4PA 1X1CA 3GTPJ 1Q95G 1E6VA 3QYBA 3CVKA 3BQ1A 5HANA 3ZZZA 1U48A 2HAIA 3IGNA 4JI2F 4AL7A 1X1DA 5TISC 1N33J 1WKKA 2B5JB 3VQTA 1TW3A 2XDVA 4RGSA 3ZZPA 2DMUA 3VYUB 4HBLA 3P5TL 5E3RA 3K10A 4P6QA 4NZ7A 3NEUA 4DYCA 2LG4A 3CDUA 1IBMJ 1DP3A 1DQAA 1IN5A 2V7FA 5ICGA 1R7IA 4DZPA 3MKYB 2C2MB 3JSBA 3Q9VA 3ZTRA 2QQAA 1E0EA 5M5WJ 2L9RA 2V2KA 4FF3A 5DDGA 1LKZA 1VQNI 3BJOA 3IL2A 1S1WB 2OA4A 4X4QA 5IT4A 3TWZA 3CMMA 4MFDA 2CW7A 1ZS6A 2QJ3A 1ICEB 4FHTA 3UI3A 2JFKA 4Y17A 5J8CA 4QR2A 5CZVA 4OV6A 4B44A 1RT7A 5C7PA 5EYRA 3VYSB 3SQGA 2PC6A 2CQDA 2BW3A 4I0BA 5A2QY 2CH0A 3ET6A 2ZOGA 3V81A 3J80Y 5KT3A 5F0CA 2L0KA 5DM6F 3MM8A 2FJ1A 3TQNA 1C1CB 4ZVGA 1VQ8S 1WKLA 2W7NA 2B6AB 4H4KC 1SJRA 2VKZG 2W48A 4BWJA 5C25B 3K58A 4QPXA 3HSFA 4Q5SF 3R5DA 1VI0A 1QLNA 5CLSA 1Z91A 4K2EA 2MHNA 2B9YA 4ID8A 2BXJA 3SBMA 4ZJZA 1R22A 4LFAJ 5HS7A 3GPAA 4OHXA 1RWXB 3OBIA 2R5YB 4K4SA 2KT5A 5B0FA 4BE1A 1ZH5A 2GFFA 3D6FB 2EA2A 2RF2B 2FE3A 4G1PA 2V4JA 4IPAA 2R7WA 1GVDA 2DNRA 4IFYB 1ETXA 1RT5B 5DG7A 2LFBA 4IR1A 1CVJA 1I3QJ 1TQMA 2Y48A 2BE9B 3Q23A 1OJLA 3K5OA 4DZDA 2NVTJ 5FKKA 2K3FA 1LWCB 4HX4A 4QIEA 1XNQF 3D9BA 1IO2A 4N56A 2G0JA 5F08A 3UD5A 2MABA 3EYZA 3FIWA 1U1LA 4KIGA 4HDHA 4CI0B 4IX7A 5LLQA 5CYMB 2VQFF 4F3QA 2PFDA 4E70A 3B82A 1GX5A 2C2EA 5LOQA 3W2VA 4A0ZA 1MLAA 1K78A 2IGNA 2YNIB 2VJUA 1S6PA 1I94F 2Y2ZA 3C46A 1X9MA 3DBRB 1N56A 2FY1A 3CMYA 4OZNA 3CPWR 4B3OA 2JSCA 4J90A 3HO1A 1MMLA 3HVRA 3WGGA 4UTGA 1XCBA 1CC8A 1TL7A 2XMWA 3L3CA 2C2KB 2CJ9A 4IOBA 2BKNA 1T08B 1F9HA 4ZYHA 1FYKA 2NVYJ 2VG5B 4MTDA 2C1EB 3J7ZI 4OIOF 4GXOA 3CF5Q 1J5OA 2ZFUA 3BQZA 1HKTA 1Q81T 1Z2LA 1HA1A 1S9GB 3JSPA 2MLGA 2DT5A 4JUZA 2VQHA 3IG1B 4FXDA 1ZKGA 1ZR2A 1HFEL 3R4KA 4UVAA 3D0IE 2XY6A 1KQ0A 4F0HA 2X1DA 4DYQA 1X4DA 1UWBA 5BOXA 2Y69H 3Q0VA 2DO0A 3PFYA 3BF4A 4C3JJ 3BG7A 1BR1A 1Y5LB 4JYKA 4DPUA 5IZHA 1VMBA 3MUMP 2O7OA 2RVCA 4FXVA 2LXUA 3G1MA 1B9MA 1H9GA 2H4WB 1SD6A 2KVQE 4DV0F 4K50A 1IN0A 1W7PA 1CJTA 2HGLA 2R8HA 1DQ8A 4EGYA 3BY6A 2C3OA 3VALA 3DEEA 3DRYA 1OY8A 1D3YA 5JMNA 3U9GA 3KMQA 3M3YJ 2DK5A 2Y31A 4YR2A 1YJTA 3PW7A 5L3GA 4OLPA 2MLXA 3QO9B 2DO7A 2NXCA 1BUXA 3HFVA 2ZH7A 3RZAA 3VSKA 1B99A 2QWWA 4JI2J 3HHDA 2QA2A 4HH1A 1Q1HA 1S12A 1K6YA 3F3XA 2PGCA 2FIUA 4ZCMA 2Y9ZA 2A1BA 3P49B 1CJVB 1Q0NA 1RUSA 2L9NA 4I7HA 3WE2A 3D5MA 1D5YA 3ZCOA 1IJWC 1VTNC 1B3TA 2TDXA 2R2UA 1P1LA 2J7KA 4HLBA 1JXLA 4HQEA 3J7YU 3PNYA 1HBNB 2RNEA 1U8BA 3M8FA 1DZ5A 2BYCA 2FF4A 3R7BB 3B78A 3KP6A 4TQSA 3AXKA 2I2YA 3WHCA 2OPQA 1BOAA 1ZM4A 3UN3A 2G0IA 3TEDA 4PEOA 1UVMA 1LNQA 3LSPA 2DGSA 2GNKA 5IXUA 2V50A 4YB6A 3LH2S 1FBUA 2AMCB 1VBYA 5KFOA 3CUOA 2EH3A 3MPVA 5I42B 3WG9A 3CIMA 3K5NA 1RTHB 1D5VA 3VV2B 3UFCX 2TRTA 2M8DB 3M4OJ 1Y1VJ 1SFEA 3POTA 1K0VA 4HNVA 1ACIA 3TBIA 5CCMA 2MYSA 4FYVB 5I3QA 4LRFA 2HNHA 1JTYA 1MSWD 3HULA 2ECBA 4A8XA 2FVCA 1MJAA 1JB0C 1RKJA 2FY8A 5JHUA 1RBAA 2KHDA 3DKWA 5F3TA 1U1NA 2MH2A 4HNTA 2CQ4A 3W9HA 2O0YA 3PQKA 4ZVFA 4LR7A 4C3LA 3GR1A 2F4FA 2GIQA 3W5ZA 3BTJA 3MCMA 3DLHA 4YN3B 1U1OA 2WSCC 2KM8B 1BI0A 3GIMA 4I01A 4Y2KA 3RYRA 3GSIA 3K4KA 2UXDF 2FGCA 3M8EA 2Z30B 2PJPA 3G71S 2IDEA 3LFUA 5HMYA 1XNQJ 1GNKA 4DUTA 5J1PA 1M5OC 2EFVA 1MGTA 4RLEA 4DQSA 2KZMA 1DQUA 2ZZTA 2VQFJ 3DEWA 2JLGA 3OY9A 1FLIA 2GIRA 3AOAA 4HDUA 1HQUA 2ZKUA 3OSNA 1UPPA 1ITPA 4KGVB 3I0TA 4U7DA 3PKYA 5HLHA 3PVXA 3HM9A 4P96A 4UY85 2G7UA 2XSJB 1H38A 1I94J 2ILZA 1R9TJ 2ZWPA 3CO9A 4OFZA 1WGXA 1FC3A 3THTA 2BANA 3JYTB 3B73A 1TTHB 3GTMJ 3OVBA 1IKYA 2BW3B 4K4XA 3ET6B 2DYAA 3MXHP 4MGRA 4BXUA 2GBYA 4LLLA 1P7JA 4M71A 4R0EA 2HKOA 4KGKA 3HJFA 4MH8A 1OCPA 3HEFA 1HI8A 4DPOA 3M32A 2OJ3A 2XTJP 4USIA 1KYZA 1Z9CA 4CDIA 1RHMB 2KJWA 5A2QK 2HFVA 3J80K 3TJ9A 1DQ9A 4XSZF 5E5NA 2CWEA 1PAEX 3DLGA 3PEJA 3J7Z5 4EMDA 1Y6IA 1JLEA 2OIHA 4CLYA 4KYZA 1NSKL 3G4SS 3GFHA 2N3LA 3PZPA 1R3NA 4S04A 5F8LA 2UVRA 2P2CB 1N36F 4C48A 1OPIA 2HQGA 3KHHA 2LXIA 4RGRA 2VKEA 3BTCA 2UV1A 1TWGJ 4L0ZB 1BQMB 3DDKA 1LQ1A 5FD1A 1B70B 1W5CC 4FPIA 2H8WA 4XRMA 1Q7YT 2DYRH 3SFUA 3TO7A 4QZVB 2ISYA 1ELOA 3QLHA 1JLFA 2ME0A 4DV0J 1S3JA 4LRCA 3ZTQA 4OU0A 4TU8A 1HWIA 2F3JA 3R27A 3BH7B 1BC6A 1TL3A 2HDDA 4XK8C 1FRJA 2A6EF 2JSPA 2Y30A 2A10A 3A03A 2RNJA 2B9WA 1KU3A 1K78B 5A2QZ 5L3DA 1U02A 2FZGB 2KJBA 3DGVA 5CH7B 1TC3C 1T9WA 2VBXA 2FQQB 1OJ4A 1N52B 1WSVA 4KO0A 5L1KA