2VONA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auaauuu
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
187
structure length
187
Chain Sequence
DNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords LUPUS LA PROTEIN
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vonA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vonA02
1KOOA 2R7DA 1YLFA 3GYHX 4FHTA 3QU6A 4BHPA 2OTLS 1I6XA 1ZLJA 1WG5A 1D8JA 1URNA 2D3OR 2EK5A 5DCMB 1O0PA 3ABUA 1S8NA 2N3LA 2RNJA 1GXPA 2IRFG 1O3TA 4PDKA 3CXCR 4YB1P 5EEGA 2JVRA 1IN7A 2HS5A 3KETA 1DDNA 3FF5A 1Z9CA 2LF8A 2MB0B 1UB9A 4XSZF 2DGTA 4TLQA 5HDNA 1Z7UA 4HW0A 2ISZA 5GMKa 4O6JA 3MURP 1RI7A 4OIOF 3JTHA 5LXYA 1ZLKA 4HDUA 4YG2F 3QRFF 2DNMA 5BPDA 2XAFA 2BYVE 2DQLA 2Q79A 3G96A 1DP7P 2J8AA 2MZJA 2DO4A 4WFAQ 3MQ0A 3MXHP 4L0ZB 1DUXC 3NS5A 4J5OA 2PBIA 4H0EA 2FXAA 1JXSA 2VE9A 4NHJA 2UZKA 4WFNQ 3GF2A 2CPIA 3DFGA 4TU7A 1YTYA 1EH6A 1YJ9S 3Q9SA 2QUFA 2NLWA 2M30A 2DI3A 5LBQA 1U1OA 3HTSB 3FM5A 2J5OA 5CYVA 2XKOA 1YW9A 4P6QA 4HF1A 2FBIA 2A3JA 3TO7A 1D3YA 4OMYA 1HKTA 1B1BA 1XCBA 4AWXB 1YJNS 1R5GA 5KK1A 2HDCA 2KT5A 4L9JA 2DITA 3IKTA 1GXQA 3I0TA 2QENA 1ON1A 5GAGU 3R27A 4IRGA 2FPHX 5CYJA 2EB7A 3RPQA 1QGPA 4FX0A 2MQMA 1JJ4A 2IW5A 3DPLC 1K6OA 1JMTA 1DRZA 3RKWA 1TNTA 2L9WA 2F5EA 2H09A 4RB0A 1U6FA 3HHGA 3R60A 1ON2A 5EEHA 3O2PE 2LECA 4IHSA 2J0SD 5F1RA 3ZN0A 3TP2A 2DGOA 4IF4A 3K69A 3S01A 1VQLS 3BJAA 4P96A 5DD4A 2KJCA 2Q2EA 5DDGA 4XLPF 3ABTA 3ZMUA 1JGSA 3WU1B 4LGWA 5GAHU 4I01A 2QBYA 3CC2S 1FYMA 2HGNA 2VC1A 4HLXA 4HV6A 5HS8A 5D77A 1XCVA 4P55A 3GW2A 4EJWA 4HX7A 2DH7A 2UP1A 4EM2A 1ZRDA 2CWEA 4YFNF 3Q5FA 1UFMA 2FC9A 2DGVA 2HGLA 1SFXA 4CO8A 2LA4A 5F6FA 4S04A 2MD5A 1FZPB 3HI9A 3G6ES 1PP8F 4KIFA 2OQRA 1AUDA 2X1FA 1XD7A 5DYMA 5E1ZB 2GA1A 2LCWA 1FJCA 1HA1A 2PN6A 1W7PA 2H6BA 2MLGA 4A8XA 3ML6A 2GWRA 1YHQS 1ZARA 1EH8A 2MHNA 1T2KA 1J2XA 1VTNC 3HHHA 2P4WA 3FM3A 3LPYA 2I38A 1MDMA 1I5ZA 2JPCA 1KQ8A 1BI2A 4HOBA 3R6SA 2RNEA 5TJJA 4A6DA 2F2EA 3I56S 3C18A 1MJAA 5DETA 1NU4A 3NNAA 3V7SA 1NJIT 2M8DB 2M87A 4WIIA 1Z91A 1FLIA 3FMQA 2MZSA 5CVRA 4OMZA 3B4MA 5CA5A 2M1BA 3FXRA 1FNXH 3O6BB 4CDGA 4EM0B 3P6YC 2CQ1A 3HSEA 3WG9A 2CGPA 3CTAA 3NNHA 1P4XA 1OYIA 2J5PA 2HQNA 4IJAA 2P5KA 1YIJS 3DPTA 2H27A 1QPMA 2DU9A 5LLQA 4I02A 1WF1A 2F5CA 4IUFA 2FNAA 1T98A 3IWZA 1OYYA 4HX8A 3IRWP 1BM9A 2GXBA 3H2UB 2WBRA 4O3MA 2J76E 4ETSA 1SD5A 3CUQB 2QQBA 2KVIA 5E1WA 3BPXA 5DD8A 1WWHA 4AD9A 3IHUA 3W6KB 4M6YA 2CW0F 2KIMA 3GFLA 2KFYA 1RNLA 1U6GA 2EV5A 2L41A 2G4BA 1D8ZA 4LIRA 2DO7A 2K86A 1DZ5A 1FOKA 1VBYA 3J80K 5HDKA 3MDFA 4ZZLA 2DNHA 2QFJA 1KYWA 2NS0A 2ZJPQ 3F21A 1U1RA 3ELKA 1YQAA 2K8GA 2HQRA 1KU3A 1FO1A 4RS8A 1MD0A 5IM0B 2HYGD 2FSWA 1ZH5A 2DNZA 1DPUA 3UD4P 5IT9Z 3BZ6A 2E5JA 3GVAA 3E5QA 5L3CA 2RV8A 4MTEA 2OAZA 1A7GE 5IFMA 3M8EA 2RN7A 2FMLA 1L3KA 3F6VA 3MOJB 2AYBA 2CQ2A 2MKIA 1M5KC 1F1ZA 3ECOA 5BMZA 2W25A 3GLXA 3TO9A 2HTSA 4MTDA 2X1GA 3Q2SC 3CJNA 4XLNF 1GHCA 1NHAA 2VODA 5FLXK 2DQRA 5LHIA 3WTVC 1WHWA 1JHFA 1R8PA 2MJUA 2PEXA 1J59A 5ICFA 4FXVA 3DLLQ 3BDDA 5L3DA 1XSXA 1U3EM 4WX9A 4M9SA 3OOPA 3E97A 1SD6A 2ZNYA 1UP1A 4BHBA 4M5DB 3L09A 2V6CA 3WTUC 3V8KA 3COAC 5ILUA 1O57A 4ESJA 1OWXA 2JSCA 3K1PA 1XMKA 2KYXA 1R8HA 2DGQA 1W7PD 3J7AO 4Y0FA 1FT9A 3P7NA 5DUIA 2VXZA 1HSTA 2YPRA 2RVCA 2MYFA 2XROA 2P5LC 3G8TA 2M2BA 3J7ZT 5IT3A 3CCSS 3BY6A 2EWNA 1VBXA 2FY1A 2XAJA 1Y0UA 1O7FA 3EX7B 1OO0B 1U1KA 4GXOA 2D9OA 2KXHA 2P7CB 4EGLA 2YR2A 5FJ4A 3BEGB 3CF5Q 2DNKA 2YTCA 2A61A 3I4PA 1BI1A 2JWNA 2FA5A 2NNNA 4ENKA 5K5QA 2IJLA 2FHOB 1ZAOA 1VQOS 3CTRA 5DDRC 3GX4X 1R1VA 4UVAA 4IHTA 5L3EA 1O3SA 2KU7A 2XS2A 2DO0A 3SMZA 1IXRC 3EQLF 1RUOA 1ZYRF 5E8GA 5LEJA 5LJ3Y 1XN9A 2XNRA 6PAXA 4Y13A 5D78A 2DHSA 2OTJS 2HKXA 3MUMP 1WI9A 4TU8A 5ED4A 2BE5F 3S2WA 2W57A 2OIHA 2QYOA 2CPJA 1X5SA 2A69F 4WF9Q 2D2WA 3CCRS 3W6JB 5ITHA 4W90B 4A12A 1BC7C 4U7DA 3MFKA 5ILSA 2DTRA 3VAJA 1WHVA 3KLOA 2PEHA 2DGWA 3ERED 3MUVP 4L9VA 3M1EA 3H3UA 4IRHA 2AXLA 5DUKA 2HEOA 2HR3A 4AIJA 2RQCA 2XHKA 3R4KA 5CVIA 4EGZA 1J5YA 4P5OA 1WQ2A 1O3QA 4PZJA 2XAHA 2OZUA 2DPUA 3F6OA 2E1CA 3HHNB 3MI7X 1W7PB 2ZMEB 2CQKA 1LEBA 2NZ4A 4CICA 2F3JA 1G3WA 3CUQA 3LA7A 1NO8A 2DNOA 3C1DA 2A3SA 3PQKA 1UHWA 2VBWA 2RKHA 3CUOA 1OKRA 1PP7U 1VQPS 3H2VE 4M72A 1W5SA 4KYWA 1TQPA 4QU7A 3I64A 1J7KA 1WHYA 5LHGA 5FFXA 3SHFA 2E7XA 2QZ8A 4AIKA 3CUNA 1U1PA 3UCZP 2OA4A 3CLOA 2YKAA 1KQ0A 2ZXJA 3HSRA 4I7HA 3RI4A 1N88A 4F26A 4N9IA 2M4MA 2D45A 3NNCA 4RB3C 4KA4A 4Q47A 4U0YA 3J81Z 4PGHA 4U67Q 4CH1A 2VOOA 5IM0A 3TOBA 1RK8A 1SJFA 4KUMA 4BH9A 3DF8A 2L3DA 4L9TA 3VAGA 2ZO4A 3V4MA 3S8SA 2RQ4A 2L4AA 4A5NA 4Z2XA 4HF0A 2V79A 4YFKF 2DW4A 2CQGA 3CC4S 3J7YU 4I0BA 4WFBQ 2YX4A 2E7WA 5DDQC 1G3TA 1P4WA 2KG1A 1VQ6S 1MKMA 3V7CA 2RRAA 2YWKA 2DNPA 1IN5A 2HZCA 2CPHA 1G6NA 2CJKA 5GVQA 5H1SV 1PGZA 4M73A 3LWFA 2FQ3A 2KIFA 4CHUA 2E5HA 2HGMA 2YX7A 2TDXA 3L3CA 1IUYA 2DAOA 3F8NA 5D4SA 3KP2A 2FBHA 2Z3YA 1G3SA 3CCMS 5D5WB 3FEYB 4GO1A 1RIOH 2XS7A 3T8TA 1GVJA 2EVZA 4GYGA 2MJNA 1JJHA 4EJUA 3ULQB 1LB2A 2KRFA 3MUTP 3ZN1A 4WCGA 2IPQX 4FX4A 2ESNA 1TNSA 5GAEU 2N3OA 4ON0A 2Y75A 4EJTA 4ZYDA 4LK1F 3UE2A 1YITS 3E6DA 4HZFA 1XGNA 1FBQA 1WHXA 4C0OC 4B8XA 2ISYA 3I58A 1U6BA 4IOAQ 2COMA 2KXFA 1F9FA 3HUGA 2IVMA 5LSLA 2ACJA 3THTA 3CD6S 3BP8A 1KYZA 3GUDA 5HLGA 4BXUA 2KG0A 3JSPA 2E5GA 2BGCA 1WEZA 4I2OA 2L08A 1X4AA 3L2CA 1G4DA 3MAJA 2MZRA 2LXIA 4HX4A 3K2ZA 1Q82T 1VQ8S 1P4AA 2DNRA 3GFIA 4KMUX 1FP1D 3UD3P 2X1AA 2A6EF 2XAGA 2Z9OA 4RU2A 4F7ZA 3NRVA 3RIRA 1DBDA 3US5A 5LJ5Y 1WF2A 2CQBA 3G4SS 5D5UB 3LQVA 1G3YA 2WV0A 4GYIA 4UQTA 2IA2A 2HFHA 3IC7A 4UXNA 2M88A 3R61A 3CUQC 2EK1A 3VAFA 1PDNC 1E17A 1EH7A 3KEQA 2O3FA 2RGVA 1M5PC 3FXUA 2KRBA 4UUVA 5HLIA 2F9JA 1SMYF 3V8JA 1WELA 5ICGA 1ZG1A 1FYLA 2STWA 3K1NA 3CCJS 2RQPA 2G7HA 5HLHA 1TW3A 3VAHA 2R7FA 3L00A 2CFXA 2VT2A 3HRUA 1ZREA 2P5VA 2CQHA 2CG4A 3THPA 3LFKA 1IN4A 2PFBA 3TQNA 1FSHA 1S79A 4QPTA 3E5XA 2JZYA 2O8XA 2K27A 5LEKA 2FMYA 1IXCA 2JVOA 3RYRA 4JBAA 1X4CA 4HYEA 3T8RA 5CVUA 1XB4A 4RGSA 2ZMEA 5KVRA 4DNCA 5ICCA 3TO6A 1PO6A 3HIFA 4C4WA 2CQ0A 2XUBA 2CSOA 1B7FA 2FC8A 3PQJA 3FEXB 2KM8B 1YIOA 3CPWR 3EUHA 3EDPA 5LRSA 2D1VA 2OSQA 4ERDA 3WGHA 2EFNA 3PIPQ 4E70A 2K7LA 5F64A 1UCRA 3SXYA 3QPTA 1MZBA 1VQ9S 1F9NA 2EFQA 2GAUA 2MPUA 2MGZB 2MQLA 3MZHA 1D9AA 1P2FA 4CQ1A 1VQKS 1L3LA 4UY8T 1FP2A 2LEBA 2IP2A 3CDHA 2F5DA 4WXDA 1SXLA 3HOSA 2HOEA 2LXUA 3JB9k 1QO0D 5CVJA 2UXXA 2VT3A 3MEXA 1M1KT 1IN6A 1T0FA 1HW1A 3RJPA 5BOXA 3JAMZ 2AD9A 2P6SA 2CQCA 1R22A 2U2FA 2R3SA 3EETA 1X3UA 2K4BA 1KU2A 5LGTA 2LMIA 4OU0A 5D4RA 3G9CA 3F22A 1YJWS 3KP4A 4G7OF 1P1TA 1N8RT 4HV5A 2F9DA 1H0MA 2Z33A 1K8AT 1BY9A 3LA2A 1ONVA 1KQSR 4XRFA 1O3RA 1VQMS 4Z2YA 1BJAA 1RZ4A 5D8KB 1N52B 1ULYA 4LMYA 2ZNZA 2ERRA 1S7AA 4D0PA 2C6YA 1S3JA 2ZKZA 2ELHA 2KH9A 3WGIA 2CQIA 1R5HA 1K79A 3H3ZA 3I5UA 1WG4A 3FMSA 2VOPA 4G7ZF 3BWGA 2M52A 1IQTA 4CIOA 1U5TB 2WTEA 2O6GE 2W85A 1SFEA 2CPEA 3ZZZA 2RUGA 1LQ1A 5HVQC 3T5XA 2MKKA 1UFWA 1VQNS 2BV6A 3EGZA 1OPCA 3R1LA 2QEXS 4ZYHA 3HTUA 1TLHB 1ZN2A 1ZZFA 2ZJQQ 2GA2A 2VBYA 4LFUA 2MSSA 4F25A 4NB5A 3TDZC 4K2EA 5D6EA 4BNCA 4RB2C 3KP5A 1H2TZ 3N97A 3WTZA 4KN7X 3GZ5A 2HZTA 1Z6RA 3TO8A 2DNYA 2V1DA 2DGXA 4RAYA 1X4DA 4MQ9F 2KN4A 1LDJA 2LKPA 1R58A 1Q1HA 2OU2A 5AIPA 1SJRA 3CCLS 2I2YA 4PKDB 2O3DA 3E3VA 3NQOA 3KEOA 1B4AA 1FY7A 3OV8A 1JHHA 4GCVA 2LF7A 3KFWX 3H92A 4ASNA 3GFJA 3F3XA 4O5VA 3LQQA 2L02A 3RKYA 1HQCA 1DPRA 1Z1DA 4AIHA 2DFIA 5JVHQ 1ZZNA 1V3FA 1WKMA 1FWZA 5DV5A 1SJQA 1VQ7S 5D8LB 1R00A 3B73A 3I53A 2DNQA 3CCUS 3BO4A 1YW8A 4DQ2A 4P9UA 4WK8F 2QWWA 2CPDA 1A9NB 4MEYF 2HYIB 4NQWA 4LB6B 3E6CC 1M90T 3FX3A 4Q5SF 1R7JA 1R1UA 3V7RA 4WXCA 4CH0S 2DGUA 3OW2R 2PLYA 3L7WA 3QP5A 2NAZA 1BIAA 2F5FA 2X0LA 5K5OA 4HAMA 3SQNA 4KMFA 4KDPA 3F8MA 2FOKA 3ZMSA 1WG1A 2Z99A 3IRQA 1Z05A 1X5TA 1U1MA 4OOIA 1X5PA 1QQIA 3GEZA 1G2EA 1WI8A 1WF0A 2V1XA 3GFMA 2E5IA 4YUDA 3ZP5A 1ZRCA 3BPVA 3DQVC 3TYTA 5E1XA 5MLCV 2ADCA 1Z6TA 2CQ4A 3NS6A 4S05A 4M71A 3RTRA 3C7JA 5HOOA 3R0AA 2KHCA 3HRSA 5BQTA 3RPUA 1Q7YT 2SXLA 3U1DA 4Y15A 3PFIA 2HKOA 3VODA 4QQBA 1REPC 1YW7A 1VC6A 1VQ4S 2KI2A 2MGZA 4EGYA 1VBZA 1CF7B 1IRFA 5AONA 3EGNA 4KT5C 1LDKB 2MBFA 4UVCA 2LKZA 3MWMA 1QVGR 1ZG3A 4QU6A 1O7LA 4G7HF 4PGGA 2YH1A 3NMRA 4HF2A 1CGPA 5TRDA 2W84A 1KA8A 3T1BA 2OJ3A 2P8TA 1R36A 2A5YB 3WE2A 1R1TA 1HD0A 1QNTA 4U0VA 4W92B 4IO9Q 3M7GA 1OYWA 2LSOA 2M5WA 1UHMA 1S72S 2NRAC 2XV4S 4KIBA 3ZPLA 1W2BR 4Q48A 3LAPA 2E44A 5E18F 2HTJA 4MEXF 5D6FA 3VEPA 1J0RA 1YI2S 3WTTC 5AIQA 1BBYA 2JTVA 5FGMA 2RC4A 2MZQA 1SFUA 2KRRA 5LXRA 1P6RA 3C3WA 1YWXA 1FC3A 2RS8A 3ZQ7A 3LSTA 3TKYA 2HVZA 5HDGA 4ENNA 2M8EA 2K4JA 1XDSA 2CYYA 1A04A 2V1UA 1U5TA 4YFXF 2O0YA 4LD5A 5E8IA 2AYGA 1K9MT 3P9CA 1USSA 2K02A 3IRRA 2CQ3A 4TU9A 4LG0B 4PR6A 2P7VB 1QM9A 4UNOA 1I1SA 3KP6A 4N9HA 2AYMA 3G8SA 3HRMA 1S29A 3K1MA 2MZ1A 4WKRA 3E5UA 1X5OA 1QZZA 1VC5A 1LNWA 3V8LA 2CQPA 5DDOC 1FBSA 5IQQA 3BJ6A 2LYVA 1BC8C 4U88A 2MA3A 3UCGA 3D5LA 3D2WA 1FT8A 4ESFA 1F4KA 4G94A 1M5VC 1FYKA 1ZRFA 2DNGA 3VF0B 1OR7A 4UVBA 1YG2A 1MJBA 1S6LA 1WI6A 1LDDA 4U0WA 1JJ2R 4L18B 3J80Z 1I27A 3SZPA 2V9VA 2CPXA 4Q4ZF 1B9NA 3U2RA 3SFZA 1ZGAA 3BOQA 3F23A 4MQVA 3WODF 2UXNA 3QPHA 1IN8A 1KGSA 1WRJA 2ZJRQ 2DK8A 3LA3A 5D5XB 2MKSA 4IPAA 2KM8C 2A07F 3P9IA 4OINF 5IT9K 4L0YB 4RGUA 2HGCA 2JT1A 4HQEA 3CMAS 2QVOA 2Q8KA 2QM3A 1P92A 4V19X 4EMSA 2IA1A 2OZ6A 1IZ1A 4TV7A 1B6AA 4BHCA 3IKVA 1X4GA 4RGRA 1YFHA 3KP3A 3QU3A 4EM1A 1TBXA 2WWYA 2LQ5A 2MQPA 1QBJA 1UW4A 2FNPA 2YSRA 2MC3A 3R0JA 3CC7S 5FLXZ 1FPQA 2DISA 3JW4A 2W24A 4B09A 2JPBA 4IRIA 1HKQA 4M6XA 2DBBA 3I59B 1M5OC 2GO9A 4Y17A 5JFRA 4FT8A 3RW7A 1XDUA 4OIPF 4AVPA 1HW5A 2IA0A 1FSEA 2CPYA 5CVVA 2L01A 2ESHA 4HDVA 4N0BA 2L4MA 1E2XA 3DV8A 1STZA 3QAHA 5HL7Q 1QVFR 3WGGA 5JI6A 3BO2A 2U1AA 1FHTA 4KNYA 2XAQA 4YIFA 2EJRA 2B0LA 2GHPA 2E1NA 2PJPA 4HQMA 4R79A 3DKWA 4RAZA 2LEAA 3SZTA 3UCUP 1FNNA 2H6CA 3K0LA 1CF7A 5D5VB 2DIUA 2MMYA 1KOHA 4M9XA 1K7AA 3DXBA 4LLNA 5FD5A 5ICEA 3SXLA 4U7BA 3RDIA 4G6QA 3ECHA 2J0QD 5CXTA 1K78B 2O61A 2O03A 1LVAA 4OZ1A 1MGTA 4FXWA 1U5TC 2AS5F 1RUNA 4BQAA 3F8BA 1MJ9A 3U9GA 1JE8A 1BI3A 4A6EA 2UWMA 3VAIA 1PUEE 2EA2A 3KLNA 4KICA 2KJBA 5DDPC 4IOCQ 2DH8A 1YS6A 2N7CA 1USTA 5L3GA 3MD1A 4A5MA 3G71S 4UV9A 4CZZA 3KZZA 1FXLA 3QOPA 1HD1A 1XGMA 2PMHA 3ZZYA 2QA4S 1D8KA 4BAYA 2ADUA 3ISPA 3KZYA 3WTXC 1SD7A 2XRNA 3HYIA 1BOAA 5FD6A 3KP7A 3MD3A 2D1HA 1U78A 2VN2A 2DNLA 2HYFA 3LQRA 3IL2A 5H6QA 2MXYA 2VBXA 2JX2A 4P9FA 3CO7C 2RS2A 1L0OC 4OIQF 2IT0A 2M7SA 3P9KA 5HO4A 1C0WA 2HWVA 2MKJA 3B4DA 4C7QA 3L9FA 3VAMA 2G9WA 1H9GA 1FX7A 2M70A 2M9KA 1BI0A 1OPIA 3P5TL 4LG0A 2GXGA 3FHZA 4YIIA 2L54A 2MY7A 2XS5A 3GO5A 4ZH4F 2A68F 4G8XA 1UAWA 2KXNB 5FO5A 3Q2TC 3RYPA 4MHGA 1WEYA 3TGNA 1VC0A 2VONA 2VBZA 4G6DA 4QLCU 3HRTA 2BBYA 2DIVA 5ERIA 4A0YA 5A2QK 1VQ5S 5DCMA 2DHAA 3FWEA 2ETHA 1D5VA 4LLLA 4G9YA 2DPDA 2DHGA 4LB5A 4JQFA 1OIAA 1ZGJA 4A0XA 1X4HA 2X1BA 1XSVA 5LGNA 2ZFWA 5K1YA 3O3KA 2DLLA 1H2UX 4UV8A 5BJRA 3AAFA 2QLZA 1IF1A 3EYYA 4LLGF 3J81K 5LRRA 4XSXF 1U2WA 5DM7Q 2JRSA 3ULHA 1RKJA 2PQ8A 2XB2D 1W4MA 5LGUA 1J75A 4BS2A 1S7OA 2RVJA 1P27B 4EJOA 2QQAA 3F8FA 1TQIA 4JK1X 3P49B 3ZMTA 3N9UC 3SDEB 3BS9A 2XSFA 4EQQA 3FZVA 2DGSA 2NYXA 2DNNA 2K3KA 3WE3A 4ZYEA 2PE8A 3RW6A 4HLYA 1R23A 2XASA 2PI0A 2G1DA 2GZWA 4LK0F 3BROA 4EJVA 1N54B 2VC0A 1AWCA 2H94A 2RU3A 4KN4X 1HW2A 4YOEA 3JSOA 1WSUA 3JTGA 4ENMA 2MY8A 2RDPA 4ENJA 3E6MA 3M8FA 4L5JA 4I0AA 3GZ6A 3QP6A 1J9IA 2QQ9A 5LSOA 2YU3A 1WEXA 3GWZA 3S7RA 2FF4A 4A0ZA 4PRFA 3VOEA 2NNYA 3D0SA 3I59A 3N4MA 3ZMVA 5EN1A 4PCQA 1KD1T 4Y00A 1SJ3P 2Z5UA 1X4FA 2P6TA 3VALA 4M9ZA 2MH9A 4GGGA 4EVIA 3K9TA 4L9NA 1W5TA 1U8RA 2STTA 5H20A 3CO6C 4ZZDA 1WTBA 1X4EA 5DM6Q 5FB2A 1LJ9A 5BS6A 3DXJF 1HSJA 5J6XA 1AOYA 2LA6A 1B59A 2AYEA 3MCZA 3CMES 1ZHFA 3WTWC 5J8CA 1F5TA 5L3FA 2BZ2A 4A2UA 4CYDA 1ZG5A 1XN7A 2DH9A 3U1MA 3FXQA 1EV7A 3G73A 3DEUA 3G3ZA 5CLSA 5JVTA 2DK2A 3CCES 2Y0MA 1IAWA 1BN5A 1YYVA 1K78A 3ZMDA 1SD4A 3ZMZA 5BPIA 1K73T 2Y48A 3VFZA 3WTYC 1Q81T 2MQOA 4CXFA 2EK6A 1XGOA 4ED5A 4ESBA 2FU4A 2KKOA 3RKXA 3I55S 1U1QA 1U1LA 3MZYA 3IWFA 2XGXA 3K0JA 4UHTA 2PMUA 3EYIA 4LMZA 5L3BA 3KCCA 1XGSA 4R8HA 4WWCA 2EFOA 1FBUA 2CPZA 1H9TA 2JRTA 3R1HA 3WTSC 1TQMA 5E17F 1YS7A 4KIGA 2KIUA 4M74A 3V4GA 4IXAA 1H2VZ 4RB1A 3M9AA 3KE2A 2ZJ2A 1B9MA 2LNBA 3T0YA 1XSDA 2CPFA 2DB1A 1LEAA 3IWNC 1IXSB 4MNUA 1WWXA 4ZKAA 5K5RA 1SJ4P 2WC2A 3P3DA 2FRHA 1DHMA 2EFWA 2ZCWA 1HL6A 3BJOA 4RGXA 4OIRF 3NEUA 2MKHA 4HBLA 5HS7A 2V94A 5FFZA 1U1NA 4CGZA 1QZYA 3CCQS 2OBPA 4WXHA 2D9PA 2MQQA 2Q0OA 3U1LA 1YO5C 1KC8T 2ADBA 4BYYA 1HBXG 2CO5A 2EV6A 4WF2A 4I09A 5CJ9A 3I71A 1ODDA 2MQNA 1BIBA 1Q86T 3F8CA 5JR3A 1SAXA 1KQ9A 2RRBA 2OSRA 5HS9A 1TTYA 1KU7A 1IW7F 2B0GA 1XMAA 1X0FA 2XVCA 2QBYB 1H6KX 1FJEB 2G0CA 5DCFA 2ZBKA 2FEZA 3I54A 2EA4A 3F72A 3TDUC 3HOTA 4XBFA 2LDUA 1U2FA 2MH2A 3B02A 1T6SA 2DHXA 2YH0A 2VE8A 1TW2A 2MZTA 2DK5A 3VB2A 3VAKA 4R1HA 3ROUA 4EV0A 3UWTA 1IRGA 2G7UA 2BOPA 2M0GB 3E6BA 1FJ7A 4L5IA 5E20A 4HA8A 4LJMA 2DT5A 3S6EA 2GQQA 5JHUA 4MGRA 4ZYGA 1V4RA 2EFPA 5H6RA 4I98B 3WU0A 5GADU 3CULA 2X4HA 2N82B 3CCVS 2OD5A 1CVJA 2FBKA 3Q9VA 2PG4A 5LHHA 1OMIA 3JAMK 4QWQA 1T38A 2XKPA 2XIGA 1KU9A 3TOAA 2M8HA 1X4BA 2MKCA 2A6HF 5DEQA 3FMRA 1I1GA 3SDEA 2GIVA 4IVNA 3GXOA 3PIOQ 1T39A 2FE3A 5J8FA 4OZ0A 2XNQA 2CQDA 2EV0A 3HSFA 1MDMB 5A2QZ 4WCEQ 2BEOA 1HXDA 1HKSA 2OQGA 1SMTA 4F02A 5ILVA 2RT3A 4KFCA 3BO3A 2M45A 3REOA 2MLKA 3LAJA 5JVGQ 2MSTA 3DP7A 4LJZF
chains in the Genus database with same CATH superfamily
2GJFA 4DSFA 5KFGA 2ZDPA 3BBCA 3MTJA 4ZJZA 1I6XA 3DRXA 1WG5A 2J7UA 3A3OB 1E6VB 4DV7J 2D3OR 4MFBA 3NMAA 5F41A 4ZLJA 2W9BB 1R31A 2XZWA 2HQ3A 2HMIB 1O0PA 3ABUA 1X31C 2YKMA 3LTOA 1S8NA 3DMJA 4B4CA 4KSEB 1RYRA 4EBDA 3OXGA 3CXCR 4YB1P 2F4VJ 2JVRA 1IN7A 3EUAA 3K5LA 2VG6B 1JLCA 4B9SA 1Z7UA 4ECTA 5KG2A 2ISZA 4D1QA 3LGMA 3MURP 5K14A 3JTHA 1LXJA 2ZBRA 4HDUA 4PUSA 4YG2F 1MLAA 2WSFC 2XAFA 2E2JJ 1DQ8A 2DQLA 3ZTOA 1DP7P 1UAAA 1BUXA 2C1EB 3M6XA 1SC4B 2QMUB 2HZAA 3MQ0A 1BW6A 4OYIA 1DUXC 3WHIA 4DJBA 1OYEA 2GXAA 3NS5A 2PBIA 4P2SA 4H0EA 2JEFA 2VE9A 1R43A 4B47A 2CPIA 2OAUA 3DFGA 1VQNI 3G6XA 4TU7A 4ZITA 2YWHA 1Y3KA 1RWOB 1T03A 2NLWA 3W8PA 2VI6A 2WBMA 2HRUA 4RWXA 4X4TA 2DI3A 2XC9A 3DI6A 2VFVA 5TISC 1YW9A 3DOLB 4JB8B 1TWFJ 2R5ZB 2FBIA 5HANA 4Z7CA 1XCBA 4A3GJ 2JOQA 5A6WA 3ZZUA 3GV8B 1YJNS 4QIFA 1RR7A 2JVHA 4L9JA 2DTJA 2WZ1A 2WVEA 3ENWA 1KLNA 5EF6A 2VG5B 4YIRX 5IWAF 4KO0A 5I42A 3SZ2A 4O3SA 2CMPA 3PNYA 4B9NA 4U9RA 4DCOB 4FX0A 2APOA 5F9NA 3RKWA 3C3LA 3UR3C 1U6FA 3VQSA 4DZDA 1JUMA 3M1VB 2LECA 4IHSA 1UPMB 2J0SD 1NPKA 2NPFA 1PYVA 4LSLA 2KZMA 2MFZA 2R7TA 2G2OA 4FISA 1OYDA 3BGRB 2DRAA 1P8GA 3D0HE 2Q3PA 2OV7A 2HDDA 5DDGA 1VLYA 3ABTA 3VSLA 1MN9A 2XY7A 1WJ9A 4LF4J 4DSEA 1A31A 3C2BA 2HNZA 4DR2F 2HGNA 2FIUA 3BDPA 4HLXA 4HV6A 2ZBQA 2KRCA 1X7VA 5D77A 1NEEA 4P55A 3EZOA 4EJWA 2IM3A 4EZ9A 2LC2A 5CZXA 2EH3A 4RBUA 3JAMU 2KO1A 1IKWA 2FC9A 2DGVA 4F0MA 4QIWN 3BR8A 2Y0SA 4ZS6A 1FRXA 4S04A 3K70C 2EW9A 2BW3A 3MEDB 1MMLA 4NC8A 4F4AA 4KIFA 1AUDA 4X6AJ 1MWQA 1U8BA 3H9JA 4J9RA 2DYAA 2Z0GA 4DMZA 2Y9ZA 3DOKA 5FKLA 2IRXA 2GWRA 1POGA 2WB1A 3LO3A 3DRPB 2XLKA 5U47A 4KT0C 1T2KA 3HHHA 1VJQA 1TK5A 2I38A 1I5ZA 5KFRA 3NWSA 5F9LA 2JPCA 1LW0B 4P2MA 1FI4A 3GILA 3GYXB 2LKSA 3I56S 1MJAA 4JI8F 3KJVB 1S9GB 2YY3A 4Y2KA 1QU3A 2D74B 1DJ0A 2WTFA 1Y5IB 2DR8A 2GAGC 2PA8D 1F1BB 4CLTA 1Y1WJ 1JGGA 1NMEB 3CDLA 2KKHA 1K4SA 2CZ9A 4ECQA 3C2GA 4C11A 4CDGA 4AQYF 4HSTA 3FVYA 2H3EB 1G4CA 4RW7A 1WH7A 2CGPA 4I99C 1P4XA 2OEMA 1YRNB 1FJGF 2L9DA 2P5KA 1JWWA 2K85A 2DU9A 5LLQA 2LVSA 4PWDB 4NCAA 2GOMA 2CRLA 1SQGA 4HVZA 1NTCA 1TAQA 2LU1A 2KDOA 1GT0C 3AOBA 3CUQB 2QQBA 3H9GA 1S4EA 5K8OA 4HR2A 4A8OA 3W6KB 3MZ8A 2J7KA 2CW0F 3L7UA 2KIMA 3IR6B 3MM6A 2KFYA 4OI2A 2G4BA 1D8ZA 3Q0UA 4BU2A 2QMXA 2K86A 2X3GA 3BBFA 4LRFA 2B51A 1FOKA 2BANA 4X62J 1KYWA 2NS0A 3HPHA 4CDIA 3BGFA 2WB4A 4NL5A 4PG8A 4ZVRB 1KU3A 2VJ4A 2FSWA 1CS4A 2CG8A 2BE2A 3Q3SA 2WAQA 3GVAA 3E5QA 2G1HA 3V42A 1U0HB 2G0IA 2PMWA 3WU2C 1A7GE 4RL1A 2YQ3A 1BQNA 3PW2A 3T1YJ 3D3BJ 3HHEA 4OX8A 4ZVTB 4NZ0A 3CE8A 2AJ4A 2CQ2A 1EAYC 3PYFA 5DS9A 2V4JC 3GLXA 2MDAA 1OY6A 3CJNA 4Z37A 3U7JA 3R2DJ 5FLXK 3NWRA 1NPRA 1DGRM 3W63A 3JCUC 4J9NA 1MBHA 2M4GA 5ICFA 3L9ZA 5L3DA 1XSXA 4YR3A 3OTEA 4PEOA 3CMAI 5E3RA 3M6VA 4XRSA 2JUCA 2Z30B 4M9SA 2I5JA 3M9MB 4ID5A 2V4QA 1V5VA 1UP1A 3GCWP 3JSRA 3W7BA 4TY9A 2HDWA 2V6CA 2BVMA 3FQLA 3MHYA 4HDGA 4NWBA 3W3SA 5ILUA 1O57A 1YX2A 1LNQA 2DY9A 2JJ4D 3K1PA 4RUCA 3H20A 3JQMA 1W7PD 4Y0FA 1B70B 2K3IA 2WSEC 2VXZA 3D0IE 4BWJA 4C8ZA 4FF1A 1TELA 2EPFA 2LLZA 2M2BA 3ERMA 3BY6A 4ZPWR 1JNZB 2HQCA 1F9EB 2FY1A 3W64A 1O7FA 4XLHA 1UPPA 2D9OA 1VQ8I 2P7CB 4C2UA 2VJJA 2KXHA 4EGLA 1JUPA 2YTCA 3ZR8X 1C0UB 3I4PA 2JWNA 2UVVA 4ZP6A 1T08B 2UXDF 4ENKA 4YEAA 3LA0A 4UVAA 1N0UA 3SMZA 1IXRC 3EQLF 2Y0SN 1DTQA 3JSMB 2OPSB 5LJ3Y 5GAHI 1HLWA 5D4NA 2J5AA 2JEIA 2D7SA 2ECCA 4ZVHA 4J9LA 3OYAA 2HG4A 2HKXA 1Q8LA 1WI9A 2IS2A 1NM2A 4TU8A 5ED4A 2BE5F 3BM7A 3O5TB 3E1SA 4A3FJ 5DG8A 1U25A 2CPJA 1X5SA 2A69F 3F41A 3FFIB 2D2WA 2E1RA 6FDRA 5ITHA 2WB1N 4M5KA 2GIQA 3CJQA 3VAJA 2PI4A 1S12A 2PEHA 4L9VA 1F3VA 3H3UA 4IRHA 4JYAJ 2HR3A 1X1BA 1CEZA 2UVRA 2QSWA 4ZYAA 2XAHA 3DRRA 2E1CA 1S9FA 2BYCA 3MI7X 4K0KJ 1WJBA 4LG3A 1P9QC 4MIMA 3J80U 3GFZA 2KJVA 1VQ9I 1JLAA 1PIEA 3VGVA 3NAHA 4DL2A 3IUOA 2KMUA 2IS6A 2DNOA 2PT0A 3PQKA 4B3RF 1OKRA 2R42A 1PP7U 4YB6A 4FNIA 3HHKA 2VLAA 1ZA1B 1W5SA 2QKLB 3BTLA 1T9UA 7AT1B 3IO1A 5LHGA 3SHFA 2E7XA 3IV5A 5C5JA 2B7EA 2OA4A 2YKAA 1Q1VA 3M2RB 1RHKB 3DKDA 2ZFHA 1VI0A 4L72B 4F26A 2ATLA 4BXFA 3I4HX 4CYUB 3GG0A 4CYCA 1RRJA 4OYOA 2UU9J 2IA6A 3V6KA 3DF8A 4L9TA 1X4OA 3LAMA 2L4AA 3GQCA 4HF0A 1ITYA 2YPZA 4KGKA 4EWTA 2CQGA 2CS3A 1YQHA 1EKRA 1N36F 2IBKA 4ANDA 5DDQC 4DR6F 3O8WA 3CESA 4OI0A 2CZ4A 2W2OP 3D68A 2NVYJ 1ZAXA 4N5SA 2LH9A 3LSMA 1IN5A 2OP5A 2DR7A 3K8VA 2CPHA 4X84A 2CJKA 2FGOA 5GVQA 1YE9A 1BL0A 5F0HA 2AP6A 2KIFA 2I8EA 2XBPA 4Q45A 1HNZJ 2YX7A 2ZHAA 4B3OA 2XGEA 2XB0X 2VQHA 4C2TA 3T8TA 3P96A 2L48A 4GYGA 4HT7A 1MW7A 1I5OB 2MJNA 1L5UA 1SC6A 2C2MB 3QT7A 3OFHA 2WAQN 1RTIA 3KLFA 3ZQGA 2IPQX 4FX4A 3TQEA 3TI0A 2N3OA 3JYTB 2BUNA 1HNIB 5K7HA 3JREA 4AM3A 4C98A 3DLBA 1IQZA 2DTZA 4HZFA 3RBEA 4RWWA 5IZHA 3HULA 4DR1F 2JMWA 4C0OC 2DD8S 4IOAQ 2COMA 2KXFA 4RAGA 3J7A1 1F9FA 4JI1F 3HUGA 2AX0A 1DURA 5KFDA 2J9DE 5LSLA 1SKUB 2VF3A 4J9PA 3BP8A 4RLFA 2RUSA 3WBZA 3A8JA 4X65F 4LIVA 4BXUA 3VZIA 1KONA 2CUFA 3GZ7A 4DV0F 2W9CB 2CADA 4NASA 2PFDA 1VFJA 2XMVA 1X4AA 1LUJB 1G4DA 4C0BA 2Z56B 1QA6A 3HXMA 1U0JA 1Q82T 2DNRA 1SQEA 2VQEF 1RTZA 2E2IJ 2X1AA 4UUSA 2BR0A 1ZM2A 4DSJA 4IH7A 4F7ZA 4UUTA 3NRVA 3US5A 2DVIA 2ID3A 2CQBA 2XF6A 5D5UB 3IG1A 4PG7A 1G3YA 4CLKA 4UQTA 4UXNA 2M88A 3E2EA 3VAFA 1PDNC 1E17A 2HXIA 4FBUA 5EJCA 3OL8A 4BCAA 1VI7A 3KIOA 1P9YA 2V6EA 5T7LB 4XN3A 1GMVA 2V34A 3KJNB 2STWA 3K1NA 2G7HA 5K8NA 2DN0A 1S9EB 4ZLLA 4CH7A 5KNLA 3M30B 3H90A 3HRUA 2KZVA 1JLQB 2B8QA 1WJCA 2C42A 1LV5A 2LBFB 3THPA 4CRJA 3A13A 1IN4A 4HTJA 3TQNA 3RTVA 1FSHA 1S79A 1JKOC 3E5XA 2JZYA 1ACMB 4YR0A 2FMYA 3EZ5A 1X4CA 2O1PA 3T8RA 3TZYA 2KPMA 2LP0A 3G87A 3H7HB 2ZMEA 3OR2A 3U21A 2XUBA 2CSOA 2E34A 2LMDA 4O4GB 2K7KA 2DFHA 4AUKA 5F8GA 3PQJA 3ITHB 4Y6IA 1B64A 4ERDA 2FLOA 4WU3A 4IO9F 4IG3B 4FDFA 3NGUA 1CPZA 4G3IA 5HQMA 3MEKA 4IEJA 2MGZB 5J2PA 1BD6A 3OIOA 1NUEA 2UUBF 4UY8T 2MW8A 3H0GJ 4G6VB 4DQQA 2FJVA 3GLLA 3L2UA 5A8KA 3JRIA 3N5BA 2J7WA 5HMXA 3S3OA 3MMJA 3FMWA 1T0FA 3JAMZ 2P9GA 1ZR4A 2ZSIB 4KPCA 4IQ4A 4IKFA 2HEKA 1Q8KA 2H8WA 2LMIA 2ZOMA 3F22A 1YJWS 3KP4A 2HW3A 3D3CJ 4KIAA 1PJRA 1P1TA 4RNMA 1IJWC 1ZM4A 1YKWA 2Z33A 1BY9A 3HDSA 3LANA 4XRFA 3D5MA 3W5ZA 4ZP7A 1N52B 1X19A 4LF7F 4W4MA 1VR6A 1QAXA 3PNIA 4DFPA 4P9SA 1K79A 1E6YB 3S17J 1WG4A 1FKOB 1X3ZB 1FRMA 4K4VA 5TGTA 1AZSA 4FF2A 1HBUB 1S6PB 3DM2A 4LUBA 2W85A 4LIWA 2E1MB 2W1BA 5C42B 2RUGA 4G1QA 5EGOB 2G0JA 5KFTA 2MKKA 1OCCH 2A05A 1RWNB 4ITVA 3KMSA 2ZZMA 1GTEA 1M5SA 8RUCA 3SDGA 2QEXS 2JEGA 2GOXB 1TLHB 2ZH6A 3QYFA 1ZZFA 2GA2A 2HFZA 2VBYA 4NA1A 2ZJQQ 5CYMB 2JFKA 4ZCIA 4GO7X 4BNCA 3W65A 4E4HA 5HVGA 1K1SA 1JKHA 2ZZTA 3WTZA 3MMCA 4N77A 4D9JA 2FDNA 3GZ5A 2HZTA 1TT5B 1Z6RA 3MAAA 4C9YA 2ICWG 2BDPA 4Q5VA 4DYRA 5AIPA 3CCLS 2DXFA 2R5YB 3ZNUA 1KFSA 3E3VA 3TA0A 2MTLA 3O2IA 3LALA 4KISA 5IXUA 1BQMB 1JLGA 3IA0A 1QVTA 3GFJA 3F3XA 4O5VA 3LQQA 2L02A 1HQCA 1Z1DA 4J9MA 5JVHQ 3CDAA 3ZQHA 4JUZA 5KFHA 3B73A 3C15B 5J1EB 2LK2A 3CJ5A 1N0VC 3EUHC 2CPDA 3HSDA 4ETXA 1A9NB 1OCRH 2LR8A 2BKPA 3E6CC 2K9MA 5BYQA 4Q5SF 4K2XA 1FWKA 3A01B 2BA9A 1AHDP 2K2PA 4WXCA 3K7AJ 1EHWA 4CH0S 3OV7A 5M2PA 1LK7A 2DGUA 2V9WA 3L7WA 5AE1A 2YNHB 1BIAA 5K5OA 2W2QP 3SQNA 2NS1B 1XPXA 3CO0P 2FOKA 3ZMSA 1PJ5A 1U2CA 1REGX 3HT3A 1MIJA 4EUVA 1X5TA 4OOIA 1YJNI 2V63A 3RQIA 4CT9A 1QQIA 3GFMA 2UUCJ 3IAM9 2LOOA 4HI1A 3BR6A 2F65A 2RU9A 3PW0A 3VYRB 2CQ4A 2IEKA 1O5JA 3EDRB 1XMQJ 4II2A 4L3NA 4DPTA 4KKOA 2MD0A 2H4WB 1RABB 2Y1JA 3U1DA 2GVDA 2KVQE 3PFIA 2HKOA 3MM9B 2KJWA 3S16J 3SCLE 3HPOA 1WC5A 3KK3A 1CF7B 1EETB 5BR8J 3Q23A 2ZH2A 3HJVA 2ZUAA 3Q24A 3EGNA 2HS0A 1VRQC 4KT5C 3H5NA 2CV1A 5J2MB 1LWEB 2GQ2A 4LF8F 3PEJA 5K9FA 1TV6B 5D0GA 1QVGR 2JDJA 4QU6A 3QT5A 4USKA 1V54H 4HF2A 1YX3A 4ED1A 2E1AA 4XAKA 5F8LA 4BWMA 2P8TA 2OPPA 4F50A 2A5YB 3G71I 5F0WA 2XTJP 4FYXB 1HD0A 4DPWA 4U96A 2RF2B 4W92B 4LRDA 1KR4A 1A0OB 2LSOA 4LFCJ 1NK2P 4NE9C 3J81U 5T14A 1BR1A 1NRKA 1HBNB 3ZPLA 4QIGA 2ZSHB 3LAPA 2HTJA 5D6FA 4DU7A 1YI2S 2IDEA 3LSHA 3WTTC 5AIQA 2JTVA 4DV1J 3M8QB 3FXMA 4JX4A 5E3LA 2KRRA 4DF4A 4ES1A 5LXRA 1P6RA 1YZ6A 1X1AA 3R3TA 2DA1A 4UOHA 1ZTRA 4JI7F 3V2UC 2K4JA 5CKTA 3C16A 2CYYA 4LFAJ 1A04A 1H7XA 3PSIA 2V1UA 2VA2A 4M3DA 2IJNA 5D3GA 5LOQA 3K5PA 4RM2A 5E8IA 2IJFA 1K9MT 4ES2A 2A6OA 1USSA 4C8NA 4ZTJA 3IRRA 1EA3A 2BEFA 3AODA 3BSAA 2DPJA 3ZTSA 2OCCH 1QM9A 2Z2LA 4AFFA 2XGPA 1I1SA 4C3MA 1Y6IA 3TUJC 2AYMA 4TLRA 5THWA 4RW6A 4Y4RA 2M7AA 1BE4A 1REVA 4WKRA 1KN6A 1QZZA 2K1RA 3L7OA 5J4YA 5KT4A 4DPOA 2VPXB 3D2WA 2CQXA 3R5BA 5EDWA 2FVSA 3OFGA 3SSSA 4WP8A 4DLGA 3O44A 1OR7A 2AZ3A 3DGVA 1BLUA 4QBUA 1S6LA 1WI6A 5KFVA 5KG0A 2GIRA 7FDRA 4IH5A 2DR6A 3J80Z 2RAEA 1N33F 4MYUA 5AE3A 4GKKF 2E35A 4HACB 4ANCA 3F23A 4NI2A 1FIPA 3KZIC 2XULA 3H3VK 3VWSA 1KGSA 1CJVA 3P9IA 1QE1A 4OINF 5E3NA 2O67A 3JSBA 4RGUA 2QVOA 1P92A 5DM6F 4EEYA 3BBBA 4V19X 4DFJA 5KFYA 2O5DA 3BKFA 2OZ6A 1IZ1A 4Q44A 1X4GA 1FD2A 3GSDA 4HI2A 4W98A 1TL7A 1HWLA 3J81j 2DCUB 2LQ5A 1QBJA 2MC3A 3PV8A 4IHVA 3CC7S 1FPQA 2DISA 3FZ2A 2JPBA 2PJRA 1VRUA 4A3BJ 3GTPJ 3CLQA 4OIPF 4J9KA 2HHQA 2IA0A 3SYTA 1LQ9A 1UWBB 1QUPA 2ESHA 4F93B 1E2XA 2LKXA 3DV8A 1MNMC 1FHTA 5IOYA 1IKVA 3MMAB 4P71A 2CU7A 5GP9A 2VFRA 3B8HA 3BJYA 5HAOA 2LEAA 1FOWA 3SZTA 4JI3J 1I51B 4JV5F 1FNNA 3K0LA 2K5CA 3H5XA 3JTOA 2R8IA 1GK8A 3TOQA 3KUHA 2NXCA 1S77D 5M5XJ 1FNOA 4U7BA 4G6QA 4NQWB 1E3OC 2J0XA 2NUUG 1WJ5A 3OR1C 1LE8A 2HWIA 1GV2A 2M8GX 5T41A 5A8WA 9ANTA 3F8BA 1JKQC 1JE8A 4M5GA 4MMOA 1L3TA 2M7BA 2OFHX 2IM2A 4I2QB 4NLQA 1WDTA 2ZBPA 4IOCQ 4A93J 3OMYA 1HPZB 1HWIA 2L7FP 2HLTA 2EC2A 2BRKA 5J2NB 4CLSA 4F04B 2XQCA 3F44A 3QOPA 1NJXA 4DHVA 5EWGA 4NRTA 2F48A 1D8KA 4LFBJ 5FIIA 1DTTB 2GC8A 2ADUA 5L1IA 1FD8A 1SD7A 1U8WA 4ZJQA 5GPCA 4J9UE 5KT3A 1L3SA 4DL4A 2RH3A 2D1HA 2VN2A 2XWYA 1X1CA 3LQRA 3PKYA 4JI0J 5FLVA 2JX2A 2C2OB 3WZ0A 5EDNA 2E66A 2FVQA 2BKNA 2M7SA 3P9KA 5HO4A 1C0WA 2IGNA 3I0RA 3L9FA 3VAMA 2G9WA 2BM1A 4OX6A 2M70A 1BI0A 2CQ7A 3P5TL 1X58A 2F4IA 4LG0A 1TZ0A 4RA2A 1SVOA 1SL0A 4ZPVR 1RAIB 2GQCA 2L54A 1IV6A 3ZQIA 2YNIA 4S0MA 2RDJA 3G86A 3H2LA 3GO5A 1V9OA 2CAJA 3W8GA 1NJYA 1UAWA 1LPQA 3SSQA 2R2UA 1HR0F 3Q2TC 1UJ6A 2XMWA 3KYCB 2B9XA 3MEGA 1VMBA 3U02A 4YY3J 4JI2J 2QC3A 3RZOJ 1UG2A 5ERIA 3ETMA 2HIYA 2ETHA 4IR9A 1JQGA 2DOFA 4G9YA 2DPDA 3HHLA 3CCVI 1OJ4A 3DBRB 4LITA 2Y1IA 4JQFA 1OIAA 1ZGJA 2V26A 1HOMA 2OPRB 4ILMA 5B0BA 4DV2F 4OHYA 3RKQA 5J3LA 1JKRC 3AAFA 3IRXB 2UVWA 4DEZA 3AQPA 4E7IA 5E41A 2L9RA 4BQQA 4OYBA 2PQ8A 2MG4A 3A1YA 2EZIA 2XB2D 4HPQA 5KG3A 5F8NA 3ZCOA 4JK1X 3N9UC 3BS9A 2WSCC 3PUBA 1UJ5A 1B8IB 2HQAA 2HQGA 3OVAA 5AXNA 2NYXA 1QSLA 1R23A 2XASA 1R3NA 3C8YA 1K47A 4WZQA 1RAEB 2MY8A 3QYEA 4Q0BB 1RT5B 1X8DA 2GIFA 3JRFA 3TZXA 3MM5A 2HSEB 4R0EA 1WEXA 3S7RA 3MR3A 4K5SA 2NNYA 3D0SA 3DOLA 1R89A 2V2VA 3I59A 4PG5A 3SQGA 4HYKA 3D1NI 2CW8A 1OCPA 1N5YA 3NAUA 4MFBB 2P6TA 3VALA 4DSLA 1UJ8A 2XY6A 4DV7F 2YKMB 3CIMA 1HNWJ 3DMJB 2W4DA 2JRMA 5DLGA 2STTA 3IP4B 1H88C 4ZZDA 2VIHA 2AMCB 3RQ4A 1EQMA 1ZPVA 3A1YG 5KCMA 2AYEA 4BHQA 3MCZA 3OYHA 3L2RA 2F4VF 5J8CA 1JLCB 4DR4J 4F4KA 2GBYA 3QBCA 2CUEA 5C7PA 2Z57B 5M2UA 1XN7A 5AJ3J 2XM3A 1Q7LB 1GDTA 1TVRA 3CCES 1W7WA 2DK2A 3AA8A 1JK9B 2ROEA 3JRGA 3K4LA 4C2MA 1K78A 3Q8PB 3ZMDA 1SD4A 5BPIA 2RB7A 3QGHA 1PUFA 3WTYC 2DT6A 1HI8A 2K9NA 5FJ8J 5DQGA 1XGOA 1WPKA 1TAUA 4ESBA 4ZVQB 1KKHA 3RKXA 1Y4ZB 3MZYA 1T03B 3N6LA 3IWFA 3GTMJ 4UHTA 5B0GA 3EYIA 4LMZA 5L3BA 5KFBA 4NBQA 3AOAA 2K06A 4R8HA 4F4ZA 1RU1A 5IV3A 3R1HA 3WTSC 3FHNA 3CP8A 3HHDA 3R7NB 3H25A 2AQ4A 1U8SA 3OSNA 1I6JA 1KQGB 3LF0A 1HLVA 4DV5J 3KE2A 2ZJ2A 2LNBA 2CPFA 2OF7A 2DB1A 5F3ZA 1Q8IA 4Q8FA 2HHWA 2YQ1A 5LD2C 5K5RA 4KO0B 3P3DA 5I42B 4Z6YA 2RIJA 3RSNA 3MPDA 2GAHC 2MGQA 2ZCWA 5KFAA 5KFZA 1PILA 3BREA 1JXLA 2UV1A 3NEUA 1WI3A 1KQKA 4HBLA 5HS7A 5H9EJ 5FFZA 1U1NA 3SZGA 2OBPA 3MVPA 3D28A 1APLC 2XGCA 4OI3A 1G3OA 4LSLB 2PSZA 1HBXG 2JLGA 1Q86T 2GZOA 1KQ9A 3H5UA 2RRBA 5AXMA 2GCFA 2ZITA 3GYGA 3LWMA 1XMAA 2HNZB 2XVCA 2NVXJ 1T8IA 3IFEA 4LF4F 2G0CA 1S5LC 2HPUA 2EZKA 2GHWA 2D3UA 3CJ2A 3HOTA 1U2FA 2LDUA 4USUA 4D7NA 1TW2A 3DLKA 2UUAJ 3VB2A 4QPXA 4QCLA 4XONA 3CCYA 2R8GA 4EV0A 1IKWB 1IRGA 1FJ7A 4PJLA 4A8QA 2XAUA 3Q0VA 4HA8A 4FVCA 2EIKH 2FJAB 4YP3A 2BW3B 3WU0A 5HVFA 2GJIA 4Q2MA 4OJ1A 2FBKA 3Q9VA 4Y2MA 1ACIA 2CV2A 4JBCA 4CO4A 4ZCKA 3W1YC 3DOKB 1IRXA 5I3PA 1IKXA 1I1GA 4CI0B 1SJ1A 1F60B 2XNQA 2P8IA 4FYWB 1CSJA 2KT3A 1XMXA 5A76A 3RU0A 4XM3A 1TMMA 3BO3A 1RAAB 3REOA 2XPVA 1BXNA 5D4PA 4X4UA 1AA1B 4OYMA 4A8SA 4UOGA 5KOWA 2R7DA 5CCLA 1YLFA 3AHPA 4HDHA 1ZLJA 1Y9OA 1D8JA 4HHUA 3LW5C 2X9DA 4C11B 2AGQA 2EK5A 2B8PA 5DCMB 1RLDA 1RBLA 2VFTA 3FRZA 4RW7B 1S5ZA 2RNJA 2FJWA 1R4MB 4F7VA 3F73A 4FBTA 2R4FA 2IJRA 4PDKA 5EEGA 2HS5A 3KETA 4LRBA 3RGIA 4H4MA 3BKTA 4A8KA 3W9JA 2HK2A 3FF5A 1Z9CA 1UB9A 2DGTA 3DTEA 5HDNA 4B48A 4HW0A 5GMKa 4O6JA 4NA2A 3CJ0A 2GVZB 4OIOF 4BKXA 3IAS2 3BG6A 1TKZA 4AXIA 3IAS9 2DO4A 4WFAQ 1T9XA 3MXHP 3CCWA 3MEEA 2V67A 3I9V9 4UF4A 1RA6A 3MM6B 2W2NP 3A4TA 4GKJJ 2UZKA 5L9XA 2YNFA 2E5ZA 2QEXI 1HI1A 2IM1A 2BANB 5ETNA 3FM5A 2J5OA 2XKOA 4X62F 4WYLA 4PJJA 4HH0A 4L73A 2HVIA 3PKMA 1S1XA 5KG6A 4OMYA 2MQ8A 1B1BA 2EIJH 4AWXB 2QMWA 1CS4B 3M8RA 4KY3A 3TZZA 2BE2B 1RPWA 3I0TA 4JV2A 3CCLI 2QENA 1ON1A 3R27A 4IRGA 2EB7A 1BQNB 1D9DA 5KFJA 4A4JA 2QYCA 3M05A 3DPLC 2IDLA 1R27B 3OSGA 2JN6A 2LQBA 3T1YF 2H09A 2VQGA 1B99A 4J90A 4E8UA 2V4RA 3QJLA 5EEHA 2G2ZA 4DI6A 2DDBA 4CA0A 1TP4A 1BQXA 4EU0A 4UOFA 3OUYA 3ZN0A 4BE1A 4Y28C 1DARA 2IBDA 3JSMA 4P96A 2PDAA 2Q2EA 4KJZA 4XLPF 2K3FA 3SIPB 4LF5J 4J01A 2HS4A 3WU1B 2I5JB 4ID5B 4F4XA 1RSCA 4F2RA 4I01A 2QBYA 2I1RA 3CC2S 4ED0A 1XG1A 2JA8J 4O3NA 3ZTRA 3D7SB 1XCVA 4BL0B 4HX7A 3DHXA 3E01B 2EKYA 4UW2A 3HK2A 3ZXSA 2CWEA 2QLWA 1WH5A 1UFMA 4W97A 2YPYA 2LA4A 4XORA 2V4JA 3UFCX 5F6FA 1FZPB 3HI9A 4NLYA 2OUGA 1LK5A 1F6TA 4MIBA 5E1ZB 4CCOA 3DKXA 2LCWA 1FJCA 4YQWA 2H6BA 3HCXA 3AL0C 3RBDA 3OJUA 2FVRA 1VQOI 3ML6A 4DPYA 1ZARA 2M4KA 2WAFA 2FLPA 2ZVSA 1J2XA 3NEKA 1OFCX 3FM3A 4OHWA 3D9BA 4EO8A 1BI2A 2HHHJ 3R6SA 2RNEA 4A6DA 1DTQB 3AJDA 2BQRA 2K9SA 3DU5A 3NNAA 2F1FA 1FKPA 1PSDA 5F8IA 2M8DB 1RTHA 4WIIA 5HNHA 2AXTC 3FMQA 2MZSA 4I67A 4OMZA 4YN3B 4XOPA 1GEHA 3A0HC 2EFGA 3D5RC 5CA5A 4AUXA 3FXRA 4O23A 3JRHA 4EM0B 4NCGA 3P6YC 1V3SA 3I96A 2NXEA 3CTAA 3CJQB 3HGYA 3WX4A 1Z4UA 1OYIA 1BJZA 2JFDA 4XN0A 2RQMA 3CJKA 2HQNA 3QIDA 3NP5A 5C4XJ 1QPMA 2L7MP 1GV5A 2DOAA 3WDOA 4I02A 3OIQA 1WF1A 3TNVA 2MC4A 4JYAF 2JC1A 2FNAA 3DRRB 1OYYA 4M5NA 5M2RA 1S49A 1OQYA 1D9FA 1TKTA 5GTHC 3NCPA 3KYLA 4DFKA 2GXBA 3H2UB 2GMLA 2WBRA 4NMLA 4K0KF 4O3MA 2J76E 4ETSA 3MPUB 1S10A 1J5OA 1JLAB 3ILJA 3OTDA 4OZ2A 2IIHA 2VU5A 3SDBA 1MBEA 3BPXA 2GHVC 1VQYA 1NKCA 4AD9A 3QAUA 3MPWA 4CO0A 4DBQA 1RNLA 1DU6A 1BHNA 1RHMB 4XK8C 2EV5A 2ILYA 1DGWY 4LIRA 3V6DA 3OYFA 1RT7A 4IZZA 2QE5A 1JT0A 4OI6A 3DCFA 5EZGA 1JI8A 5HDKA 3MDFA 5EG0A 4ZZLA 2DNHA 3JYTA 3KWMA 5BYSA 2C3MA 3F21A 3HOWJ 3AA9A 4F67A 1NKBA 3ELKA 3AXMA 1YLXA 4UT4A 5GADJ 4CYCB 3QYYA 1G1XA 4DL0C 2DXIA 3BZQA 2OEKA 4N8OA 3DLAA 4NMXA 3UQSA 3CC4I 1DPUA 2UU9F 3UD4P 1NK0A 3BZ6A 3OL6A 2BJ7A 3GIMA 3CCZA 3S14J 3PACA 4EZ6A 3JTPA 1L3KA 3JR9A 2X6XA 1EARA 2IAJA 1F1ZA 2KTQA 3ECOA 4XDDA 5BMZA 4YDDB 2CIMA 3TO9A 4MTDA 3Q2SC 4XLNF 3IWLA 1NHAA 4IOAF 2IYIA 4TVAB 2QGFB 2ALYB 4DPUA 4B3OB 3TP0A 2MJUA 2PEXA 2B9YA 2W01A 1J59A 1HNZF 3DLLQ 4FP9A 1U3EM 3OR2C 3ZTQA 5B1AH 3SYZA 5ETKA 4WX9A 4WPAA 2C3OA 1RTIB 2PD1A 3KLFB 3OOPA 1RT3A 2HLUA 1SD6A 3OWTA 2KLOA 3RJMB 2XMAA 1JNRB 1Y8RB 2QN6B 1ZBTA 4ESJA 2QLFB 4DX8H 1CJTB 1B3TA 3K7RA 4QTRA 3UNYA 3BG7A 2I10A 2KYXA 4FYDA 2FX0A 3D0GE 2DGQA 1QSYA 1FT9A 2R7RA 2YPRA 2MYFA 4GFBA 2LBFA 2XROA 2P5LC 5IT3A 3QPIA 4JI6J 3HUGB 5DG7A 3OYJA 5J2QA 2EWNA 3W3CA 1Y0UA 1BR2A 3ABLH 1OO0B 5CD4A 4IR1A 1JXEA 3AB4B 4K4TA 3CF5Q 2W1OA 1TK8A 4NLGA 2ELKA 5LFAA 2BXYA 1JJ8C 2C28A 1YRUA 2IJLA 4UUSB 2B7BB 4IG3A 1ZAOA 3TEDA 3J7AY 3TX0A 1R1VA 1O3SA 2R7VA 3IG1B 1ZYRF 4OJHA 5E8GA 4HG2A 5LEJA 2ZWOA 3IS9A 4D3HA 6PAXA 4OYXA 2AF6A 4E98A 1WNEA 3S2WA 4AU7A 2QYOA 1IG7A 2B43A 3K2YA 5GAGJ 3E0JB 2PFFB 3PNTA 1BC7C 4KRWA 1S1TA 1NJZA 4N7TA 3KLOA 2DGWA 3ERED 3MUVP 5ETTA 4NEZA 2AXLA 5DUKA 1VJWA 2DMUA 1RCXB 3DRSA 1QD1A 2RQCA 2XG8A 2GW8A 1IWAA 1WQ2A 3KMQA 1O3QA 4PZJA 2OZUA 2DPUA 1GAOA 4LRAA 5LMNJ 4AYBA 1IM6A 1W7PB 2HFUA 2ZMEB 1N25A 3ENQA 3OR2B 4CICA 5KFPA 3GTKJ 1UVIA 2EG1A 1WOSA 2E7VA 2ZDOA 1MROA 2F5GA 3I31A 1EKEA 4M1KA 5B0AA 2H1KA 2A3SA 1Q78A 2DXDA 3HOVJ 1Y10A 4E7ZA 4DGWB 1VQKI 4A46A 1BGXT 1AFJA 4QU7A 3I4NJ 1IUJA 4OL8A 3P5BP 2Q1LA 5DGBA 2QZ8A 5J2PB 3GJQB 1DY3A 1RT2A 3T3FA 1UFLA 2VL1A 2VDIA 1WKJA 4I68A 3CLOA 5CQEA 2OO4A 3OS0A 1KQ0A 2ZXJA 3RI4A 3M4OJ 1N88A 1CG2A 4N9IA 2M4MA 2D45A 2C2ZB 3NNCA 5A8KB 1SCJB 2JL9A 4RB3C 2VKHA 4U67Q 4U7UK 3RUBL 2FJEB 3CF2A 3FNNA 5IM0A 3TAMA 1SJFA 2O9LA 2VL8A 1F5CA 4BDZA 1YBUA 5FLXU 2BY0A 1OS5A 1BMQB 4A5NA 4CTAA 4Z2XA 5KAFC 4PG4A 4KPYA 4QPQA 2DW4A 2FJDB 3VV2B 4I0BA 2ZJPF 2QA2A 4WTYA 4ZN3A 2KG1A 3MECA 2R5YA 1VQ6S 1ETKA 2ZJQF 2RRAA 2DNPA 1KDNA 1G6NA 2GM4A 1PGZA 1UMJA 5KFMA 3DRYA 1XMOJ 2HGMA 4JV0A 4XQFA 2ZUGA 3LUYA 3M2VA 3SEZA 2EBGA 1NK9A 1IVZA 5CHCB 3WG7H 3A3PB 3Q89A 2DFFA 4EJUA 1AZSB 3P8BB 3W2VA 1PAUB 3DM2B 3ENVA 4Y2CA 3MUTP 4XLEA 2CW7A 1K4TA 1RWMB 1NDPA 1AA7A 4G1QB 2WK4A 5GAEU 3H0DA 3HF5A 4E7JA 4ON0A 2RQKA 3HP6A 4LK1F 1FA0A 1YITS 3E6DA 3AB2B 2AGPA 4WU2A 4A8YA 4LR7A 1HQ2A 1UZDA 1JKHB 1YJRA 2IVMA 3WC2A 3MMCB 2ACJA 2CQQA 1D3WA 3THTA 2EBIA 1UA1A 3GUDA 5HLGA 2C3PA 3MAAB 4ZJLA 1U0SA 2KG0A 4C97A 3NGRA 2BGCA 1FE4A 2JA6J 1IRZA 2L08A 3GV7B 3KKFA 2LXIA 2E1OA 4HX4A 3VWBA 4BJ5C 2BJ8A 1VQ8S 2VFSA 4KMUX 3UD3P 1JLGB 1ZTTA 3HSZA 4CO2A 4RU2A 2ZM6J 1DBDA 3BPSP 4M3BA 3CCEI 1HKAA 1HWKA 2IHR1 3H5RA 4UY85 3SFIA 4Q43A 4GYIA 2ZEJA 2BKOA 1R8BA 2PC6A 4DUYJ 2VPLA 4N41A 3KEQA 2O3FA 2RGVA 3MMYB 3FXUA 1PBAA 5HI7A 3V8JA 1LWCA 3OYNA 4I6WA 4XMYA 4IHXA 1VRTA 2ELJA 3N6NA 1RT4A 4DX7A 4U8YA 1ZTWA 2OFGX 1TW3A 2MEWA 5E2QA 3QWLA 4LREA 2R7FA 3L00A 3A03A 3VHQA 2VT2A 2GGPA 1ZREA 1YZ7A 3DLEA 4OYAA 2CG4A 1KZHA 2YVSA 4KAIA 3BN4A 2MKYA 1W36D 2PFBA 1YJTA 2MHEA 3NS7B 4FPIA 3H4BA 2LQ8A 1JJCB 3GTJJ 5LEKA 1B7YB 2XMJA 3BYRA 2JVOA 4JBAA 2YKNA 2UUCF 1XB4A 5ICCA 4C4WA 2CQ0A 3IMQJ 1WACA 2VPZB 2KM8B 1XMQF 4KKOB 3EUHA 3EDPA 1AU7A 2GVDB 3PIPQ 3ZQQA 4E70A 3SXYA 3FSXA 1VQ9S 1LKZA 2ASJA 4FQGA 1CC7A 4ZVPB 2CJYB 3KK3B 2MPUA 2MQLA 3MZHA 1VGYA 3OS2A 1D9AA 2DRBA 4ED8A 4CQ1A 3MN2A 1RCOB 1L3LA 3DPUA 2F5DA 4M95A 3QYBA 5BR8F 3VVTA 2VPWB 3DWLE 4NXMJ 3JB9k 2NXJA 2IVFB 5K7FA 4MIWA 2UXXA 4KBIA 4L76A 2F4FA 1M1KT 3MEXA 1IN6A 4P2XA 4AYBN 3RJPA 4OWRB 4AIDA 2P6SA 2JC0A 1HBMA 1E3HA 2OPPB 4RW9A 1X3UA 3ZRGA 1NH7A 4XKVA 5LGTA 1D5YA 3K4MA 2MLYA 4BQNA 2CNKB 3PRDA 4KV8A 4LSZB 3W62A 3ZFVA 4XR6A 4XNFA 3PW4A 2LFBA 2ROGA 4CLLA 1L3UA 3GSIA 4DG1A 5EYRA 4LFCF 3JRCA 1KQSR 2VJVA 2I5UA 2BY1A 1QUVA 4DXLA 3LSRA 1EZZB 4N4NB 2CXEA 2JA5J 1RZ4A 4OHVA 2CFOA 1ERDA 2QTWA 1S7AA 4D0PA 3S1RJ 3CWJA 3LFUA 2ZKZA 4DV1F 4NLDA 4EO6A 2CQIA 1R5HA 4OFZA 3I5UA 1NK5A 4IX7A 2ALZA 3FMSA 2WVCA 2RD5C 3W66A 2Z2YB 3C16B 1IQTA 1K61A 3TQ1A 1W0TA 4CIOA 2AJ2A 4QZVB 2A1BA 2O6GE 5D3GB 4LFAF 1SFEA 3PG9A 3ZZZA 4KH0B 3C2PA 2FB0A 1LQ1A 3E3XA 3T6BA 2XMMA 3E8OA 2JEJA 2XLIA 4PABA 3Q0AA 3EGZA 4PJNA 3R1LA 5J47A 1VBKA 2WOMA 4Y2AA 3MD2A 3HTUA 1WC1A 1MMSA 2OMLA 4I69A 4JI5J 1ZN2A 1YOVB 4RW6B 1ITPA 3TDZC 4C3JJ 4K2EA 1REVB 1H2TZ 3EICA 4I6AA 3J7YI 3GJTB 1L3VA 4KN7X 1ZKGA 4ZDPA 4ZMMA 2DNYA 2V1DA 4RAYA 1X4DA 2KN4A 4I7FA 4RBOA 1U26A 1LWFB 2OU2A 4TXSA 1SEUA 1GMWA 2B4UA 1HDPA 3NQOA 3KEOA 4P72A 1FY7A 3KG0A 2HS3A 3NL0A 3R97A 5DTDA 3BKUA 1C4AA 2LF7A 5ETRA 2POKA 3BTCA 1Z7LA 3EPIA 3H1CA 5HBMA 3KLIA 4NI2B 5K8PA 5DV5A 1RUSA 1SJQA 1VQ7S 2HI3A 1R00A 1VDHA 5H9FK 3TBIA 4N4OB 5H2FC 1RWUA 3W5YA 1CJVB 4S0HB 4P9UA 4A3IJ 4WK8F 5E3OA 2QWWA 2CUJA 4MEYF 4NQWA 4LB6B 1M90T 3TRGA 4F4YA 4EMDA 2BXZA 1R1UA 1VLOA 2H4YB 1NAQA 3OOUA 3OW2R 3QP5A 4HAMA 4KMFA 1TL7B 2WW4A 4KDPA 2FUG2 2CDQA 2X3DA 3CJRB 1S9HA 2Z99A 1SUQA 2PO4A 2FUG9 2F6CA 3GEZA 1G2EA 2PJRB 2XB5A 4UY8I 1VRUB 2QSFA 1WFXA 3K4NA 2A10A 3DEWA 2KL4A 2Y2ZA 2UXCJ 2LY2A 4ZVUB 1HHQA 1PAEX 1LFWA 5MLCV 1ROFA 4Z7YA 1QAJA 1LFBA 1I39A 3QOEA 3R7BB 4ZDLA 3HRSA 2UVUA 3RPUA 4IOCF 1IKVB 3TAPA 3VODA 2IMWP 1REPC 1IR0A 4CLFA 2KI2A 3IR7B 1N56A 2RKIA 2Z2MA 4JI3F 5AONA 3GLJA 1LDKB 3T5KA 2NVTJ 3F9KA 3PJRA 2CUYA 3BR9A 4C3IJ 4ZIWA 3MWMA 4J00A 5E0OA 2Y1RI 3Q8SB 3OYEA 1O7LA 4UB6C 5A2QU 1H98A 4PGGA 3NMRA 1LE8B 5TRDA 1NK6A 3R5AA 1KLMA 4BXXJ 2Y8YA 1KA8A 2OJ3A 3OYMA 3UNGC 3S32A 1HCRA 1WUUA 2XLJA 4XLCA 5JHFA 2M5WA 2XI3A 3G82A 3B82A 3GE9A 2XV4S 2ZE2A 2R8HA 3L1PA 2E44A 1J0RA 1RAHB 4C9DA 4LFBF 2DPIA 5FGMA 5L46A 4D7MA 3PX4A 4URSA 4RW4A 3UR0A 1CJUA 3M9NB 3IWXA 3CB4A 3K4JA 2HVZA 4ENNA 3OR1A 2ILZA 3HGGA 1NH3A 4JI0F 1RHJB 4USWA 5L38A 2H9ZA 2O0YA 4LD5A 2HOAA 3NXZA 2AYGA 3I0RB 1XMBA 1R8CA 1HHTP 2BMBA 1RAGB 2CQ3A 4M94A 2AEJA 4LG0B 4EYIB 4PFOA 2QLBB 2RSQA 2YNIB 3G8SA 1S29A 1H74A 3K1MA 4CM0A 1JX4A 2MZ1A 1X5OA 1WD6A 2CQPA 1FBSA 1CQNA 1NZ8A 5IC4B 3CJSA 3MEGB 1N75A 2OLWA 3CT9A 3K5OA 1FT8A 1F4KA 3OYCA 1FK9A 4DS4A 1M5VC 1ZRFA 2VD3A 3VF0B 4YY3F 5MAOA 3H5YA 4JI2F 1MJBA 1DLOA 3I0SA 1U45A 3HHLB 3ET6A 1JJ2R 2HBZB 3AD8C 2DA2A 3ESWB 3SZPA 1TL5A 3QRPA 4D5CA 3QIPA 2QJ3A 3U2RA 4P10A 3MMBA 2QSGX 1OJLA 3X2QH 1ZGAA 3PRBA 4C8OA 2XEXA 2EINH 2F7VA 1IN8A 2ZJRQ 2DK8A 3LA3A 4PXEA 3AFGA 2MKSA 5IT9K 1NKEA 3RB3A 4HQEA 1QPIA 2YWFA 5KFWA 2QM3A 3D1HA 2DOEA 3DTIA 3OIPA 3C46A 3HPGA 4RGRA 3MOZA 3KP3A 4ECRA 2D3ZA 1RTDB 2WWYA 3R7SB 5E3MA 1UW4A 2FNPA 3QO9A 3MM5B 5FLXZ 4UUWA 3DBLB 4IRIA 4M6XA 1E3PA 3I59B 4X64J 1M5OC 3SQGB 4FT8A 4LF2A 1N5QA 1N5YB 4MO7A 3GB0A 2L01A 2HHXA 4N0BA 2GIZA 2L4MA 1X9WA 3QAHA 2LDYA 5HL7Q 1QVFR 2VKZG 4DR7J 1MN7A 2U1AA 3HKZD 1HNWF 4KNYA 4USHA 2XAQA 1X9SA 2B0LA 3FRYA 2PJPA 2QSHX 3EGVA 4RAZA 4A3MJ 3R8YA 3G6YA 3VGSA 2DIUA 2HNHA 5D5VB 3OYBA 4NLOA 3GWCA 4DR4F 3NGKA 4QWEA 4M9XA 2ME6A 2F8HA 2L9NA 5A0YA 1K7AA 1TVRB 3DXBA 1MMDA 1WCMJ 5AJ3F 2JA7J 5FKKA 1K78B 2O61A 2VKEA 4CM2A 5JMNA 1LVAA 3HSGA 1PUFB 1H72C 3PM9A 1M1GA 1IV8A 4FXWA 1U5TC 3WHBA 2AS5F 4G1IA 3C6UA 3U9GA 2DJNA 2UWMA 1BI3A 3VAIA 2IGKA 3W5XA 2EA2A 4DL5A 3ABMH 2QT7A 4XKBA 3CMYA 5LL6d 4L75A 1YS6A 5KOXA 4A5MA 3GZNB 2YQ0A 4UV9A 3G71S 1H3DA 1NK8A 1FKAF 3D1OA 1FFWB 1FXLA 1A35A 3EPZA 1HD1A 5IOZA 3CDEA 3ZZYA 2QA4S 4ED6A 2E19A 4KB7A 3S93A 3GIIA 2HNYB 4OV1A 4H4OA 8AT1B 1EF4A 5L1KA 4ELVA 3KP7A 5SZTA 3QWUA 4DV5F 1UMQA 3NCRA 2DNLA 2HYFA 3IL2A 2V9PA 4LF6J 2CA9A 2MXYA 4XKWA 1NBEB 2VBXA 4J7CA 4P9FA 4CZCA 1L0OC 5HMYA 1F9HA 4ATNA 3LSPA 3ZZPA 2MKJA 3KLVA 2VB6A 4C7QA 2ZFUA 2NYHA 2AV5A 1FWPA 1RKTA 1T9TA 1OPIA 3V4IA 2GXGA 3NOGA 2DEJA 2WVFA 1FVQA 2YKQA 4NX9A 4WTOB 5DZ6A 4BC9A 3ZNJ1 2DA4A 3ASOH 2XS5A 4R5PA 4B3SJ 3T5HA 2RNGA 2A68F 5FKOA 5IC6B 3SV3A 1MMGA 2KXNB 3NRBA 2Y69H 5FO5A 4ZVSB 3CJ4A 4MHGA 2M34A 4MFEA 1QTMA 4TN2A 1VC0A 2VONA 3QSYB 4QLCU 4B3XA 2BBYA 2DIVA 1XTZA 1VQ5S 5DCMA 3FWEA 3FDYA 3DLKB 1P6TA 3GJSB 2CVEA 4LLLA 1GNKA 3N05A 2UUAF 4K4ZA 1U02A 3CO9A 4A0XA 2DKOB 2EXUA 2GX8A 4A8WA 5K1YA 1H2UX 3QGGA 1APSA 2XMUA 2QLZA 1UZHA 3CSKA 3J81K 4BEHA 5LRRA 1VK8A 2GVZA 1JIHA 3ULHA 3DKYA 4BS2A 1S7OA 4ZPDA 1IKXB 2GA7A 1TQIA 3TVKA 2C2RA 3QJPA 4XKCA 2DGSA 2K3KA 3MF5A 3TJAA 4LK0F 1N54B 1FVSA 4MKAA 2H94A 4KN4X 1HW2A 1WSUA 4ENMA 3H0PA 4Q2LA 1UVKA 3M6WA 2QL9B 2XGDA 3GZ6A 3R2CJ 5IT9Y 1J9IA 2QQ9A 1IO2A 2YU3A 2FF4A 4ZCMA 3I82A 1WSRA 3T6JA 3Q22A 3TA1A 3MCNA 3ZMVA 5EN1A 4PCQA 2Z5UA 3PXGa 3DLGA 5ETVA 3M8JA 3D6HB 4M9ZA 4QYRA 3K9TA 3C6TA 3VTIA 4L9NA 1U8RA 1C1CA 3LP0A 1AYEA 3GFYA 1VQ6I 3Q0WA 4H4MB 3DXSX 4U7UD 1QZEA 1V6HA 4ELUA 4P2FA 2D5VA 5L3FA 1H73A 1ZG5A 2FY8A 3UD5A 2DH9A 1FX2A 3U1MA 5GAEI 3FXQA 1EV7A 4PXBA 1TKZB 3G3ZA 3EPGA 3KDNA 3E7LA 1K1QA 1R6RA 2JUGA 1NDKA 2Y0MA 1IAWA 2HIQA 5KFFA 4DL7A 1YYVA 3MFHA 3TVZA 2DMNA 4RNNA 3MEEB 1Q81T 2MQOA 4CUGA 4ZDOA 3PTWA 1BA5A 5KFSA 2FU4A 1N48A 4QWCA 2HVEA 2ZH8A 4ZVEA 2YNFB 4GKJF 1YITI 2H48B 2AJ0A 3JRBA 3M32A 3K0JA 4X2BA 3E01A 4QYZK 1FBUA 2AJ1A 1TQMA 1YJUA 1WVRA 1YS7A 1S1XB 3V4GA 3AFHA 2OJED 1D1AA 2OGUA 1XSDA 4RW8A 1LEAA 2DCEA 4ZKAA 2WY8Q 4GDFA 5F0CA 3M8PA 1EKSA 2EFWA 1XEZA 1HL6A 3BJOA 4P52A 3N28A 2HZVA 3IM9A 2OELA 2QFIA 3LH2S 1WKLA 2P81A 2V94A 4G65A 5KTQA 3OTOJ 1S7EA 4KQZA 2H51B 2WRMA 2D9PA 1TL4A 4CCKA 1RDRA 5IP9J 1SBRA 2MQQA 1S1UA 3U1LA 3NGSA 3OUYB 1KC8T 2EZLA 1RADB 2ADBA 1UWAA 3OL7A 1MMNA 2CKWA 2EV6A 4O0IA 3AT1B 1K0VA 3I71A 1SFOJ 2BJDA 2Q2EB 3S1MJ 1SAXA 3W6VA 3LOUA 5HS9A 2R2TA 2QLJB 1R49A 3M07A 2B0GA 2QBYB 4LF5F 3CCTA 4HL9A 2ZBKA 2FEZA 1ETYA 3CJ3A 4DQRA 3CGIA 1P1LA 2FD2A 2IRUA 5CZVA 3B02A 2VE8A 3QRQA 3PX0A 3VAKA 4DUTA 1Z21A 4R1HA 2J9EA 2VV5A 3UWTA 4ES3A 2G7UA 2M0GB 3E6BA 1JUSA 3PO2J 4NLXA 3SQOP 4MFDA 4L5IA 5E20A 1K44A 2V4JB 3S6EA 4NPOA 5JHUA 4ZYGA 1V4RA 3JXOA 2AIRB 3CULA 3CCVS 2OD5A 4G6TB 3CIZA 2DYRH 4M5LA 4BJTA 1YHQI 1T38A 1UZCA 3V81A 2BJ3A 3LAKA 1KU9A 1BWEA 1Q79A 2EKNA 2M8HA 2MKCA 5G0RA 3GTGJ 3S1QJ 1IR2A 3SDEA 2GIVA 3PIOQ 1T39A 3PJ9A 1I3AA 5J8FA 4OZ0A 3TW6A 4B08A 5GAHJ 3BTIA 5A2QZ 3J81Y 4NLTA 5KT6A 4N56A 3OYIA 4WCEQ 1HKSA 4DYQA 3WIVA 2JJ7A 4F02A 2HHHF 2RT3A 3HOYJ 3TL4X 2M45A 1FKPB 3A8IA 1V55H 5IT4A 1RTHB 3NWGA 4X4VA 2ME0A 3DP7A 3PJWA 2W9AA 1DP3A 2YXLA 3GCMA 3CJ8A 3A8EA 4FHTA 3GTOJ 4BHPA 3KXDA 4UB8C 3PHEA 1NK7A 3AY0A 1GVDA 1Q53A 1CC8A 4CSWA 4NCGB 3VGTA 3PO5A 2IRFG 1O3TA 4NNJA 3CJKB 1DDNA 3K10A 3MWBA 4XSZF 4TLQA 2D41A 1W25A 2JHEA 2KHMA 3F0CA 1RI7A 2GO8A 2LYCA 1TKTB 2DHHA 1ZLKA 2LDIA 4NLRA 4HRIA 2DNMA 4ZLNA 1YDLA 2BYVE 4HSRA 1JLFA 5CQGA 2Q79A 1J5OB 2R2SA 2J8AA 2Q66A 2B9WA 1FDNA 4Y52J 1QLNA 1T11A 5HLFB 1JTXA 2CDRB 3PW5A 3M9OB 1Y0HA 2FXAA 4MT1A 4RR5A 3NGTA 4NHJA 2IXSA 3GF2A 5KFLA 3V6DB 4OX9J 6AT1B 1RT7B 4ZK7M 1YJ9S 3Q9SA 2QUFA 4JP0A 5EG0B 1FNMA 2Y3YA 1WJEA 3N01A 1U1OA 4DYCA 3HVTA 4W1UA 3HTSB 4Q7AA 5CYVA 2HKEA 2E5LJ 2R8JA 4M5HA 1RAFB 1CJTA 2KZGA 3V5RA 1D3YA 1XNQJ 2OC6A 3KJQB 3DLLF 4P1WA 2GMHA 3NCQA 5KK1A 2HDCA 4NA3A 4LBIA 5GPAA 2XYPB 3IKTA 4AC0A 4K4WA 4QIWD 4V2FA 1TTHB 3OFFA 5FDLA 2NSBA 2VDHA 5CYJA 3RPQA 4BBYA 2MQMA 1DRZA 4XTTA 4HHHA 2IAJB 4ZCLA 4MK7A 2KT2A 1SPBP 4F91B 2L9WA 3RB6A 3DDIA 3HHGA 3JS9A 3H4DA 3R60A 3R9LA 1HMVA 2R7XA 3O2PE 4IRCA 2ASYA 4LIUA 4IHYA 3VDXA 1VQ7I 3R6LB 3HO1A 4B9TA 2CZVC 1ZA2B 2DR9A 4IF4A 3K69A 3S01A 1VQLS 1N5TA 3BJAA 2BOAA 3DOMA 2HHTA 3ZQFA 5IQ6A 4JI4J 3CF5F 5IP6A 1JGSA 2NOJB 1AXQA 2W00A 5GAHU 5JXSA 1RT3B 3LPEA 2XMTA 2HHSA 3KX2A 5GTIC 2M3DA 3W2WA 1NPPA 1T05A 3PYGA 3HBLA 4KGMA 2MLXA 2DODA 1W2IA 1N32J 1ZRDA 4YFNF 1W0UA 3M8YA 3U27A 3DC2A 5JJBA 3CCSI 3HKZN 1SFXA 2HGLA 4ENOA 3UDEA 1P7JA 4NC6A 2KP6A 3O8HA 1ORKA 5HJYA 4QPOA 2CJBA 2ZXHA 3Q83A 5J2QB 1BC6A 3G6ES 1PP8F 1N34J 3KHLA 2OQRA 4DU8A 4M63A 1Q5YA 4JI6F 2X1FA 3GYNA 5DYMA 3A3NB 2GA1A 1TP7A 5DJBA 1W7PA 3GIRA 4R25A 2MLGA 2FHJD 4A8XA 1OPZA 2VFUA 4D5FA 3OL4A 2R7OA 1EH8A 2MHNA 1VTNC 3NY0A 2P4WA 1D1UA 3G8QA 2B9SA 2VKRA 3LPYA 1KEKA 5E33A 2FD5A 1MDMA 3ZXWA 1VZ0A 4HOBA 5LT5A 1UFKA 3TAQA 5IY5H 2HBQB 2F2EA 3C18A 5DETA 2AEFA 1NU4A 2Q6CA 1NJIT 4E7KA 4IHWA 2C3YA 3CP2A 3HVRA 2B5JA 3IS9B 4WP9A 5CVRA 4DOZA 2I6WA 3B4MA 2CNOB 2M1BA 4USMA 2KZZA 3GONA 3O6BB 3FBEA 4ID8A 2BW2A 2EG2A 4WE1A 2X1DA 3R5JB 1U9NA 3HFVA 2CQ1A 3HSEA 2NUHA 5HROA 1TKDA 3WG9A 1Q0NA 1S1TB 3NNHA 2UUTA 1Y56A 4NYPA 1Z3YA 1YIJS 2HQ5A 3DPTA 3DRSB 3HOXJ 3HKWA 4BY7J 2F5CA 1T98A 1QJHA 4G12A 4HX8A 3KK2A 2W2PP 3PDNA 5E3PA 1BM9A 4E0DA 2XO6A 5LMNF 2HQIA 3FXLA 1SD5A 3EUNA 3FDSA 3T41A 2KVIA 2V50A 1MROB 1I6HJ 1D1CA 5DD8A 2VKVA 3IHUA 2ZKTA 3X1LB 3I6PA 4M6YA 3LMMA 3GFLA 5C2CA 4NLPA 2E5NA 2DO7A 4X1EA 3I32A 3D67A 3H42A 3OVSA 1DZ5A 3D66A 3GTQJ 1RT2B 3TX8A 1VBYA 1SV5A 3QWPA 4G1PA 1FERA 2V8HA 3D5SC 1QAYA 2I9SA 2ZJPQ 1U1RA 2HQRA 2QIFA 3SSRA 4YDXA 1FO1A 4RS8A 2CRGA 1MD0A 2CQNA 5IM0B 2HYGD 3TAMB 3CJTA 4RJVA 2VXDA 2YKOA 3FCHA 2X1EA 5L3CA 4MTEA 2OAZA