2DJNA

The solution structure of the homeobox domain of human homeobox protein dlx-5
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
GSSGSSGRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein DLX-5
publication title The solution structure of the homeobox domain of human Homeobox protein DLX-5
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2djnA01
2L7FP 2DA1A 2HQ5A 1JGGA 2GLOA 3OSFA 2LKXA 2O8KA 2LD5A 3ZQCA 4M6VA 1JT6A 3MKLA 3CDLA 2Y9ZA 3GTOJ 5EZHA 2HOAA 5JLWA 2CJJA 5FLVA 3BT9A 2DA2A 2TCTA 3BR3A 3HGGA 5FKMA 5DTDA 1SFOJ 2DTZA 1VNDA 3G1OA 1IJWC 1ZGWA 2NOGA 1WH5A 5IYDJ 3L1PA 2R5YA 5GPAA 2XB5A 3JR9A 3S15J 3JRCA 3CQZJ 1GDTA 1ZK8A 1K61A 4QIWN 2X6OA 3H3VK 5EEAA 3HBLA 2WV1A 2EZHA 1ZR4A 3Q0WA 1APLC 2NVTJ 3HOVJ 4CYCA 3WHCA 2NS7A 1G2HA 3HDDA 4A3EJ 2JA7J 4DZPA 5K7FA 4DW6A 1A6IA 3HKZN 3JRAA 4XICA 1RKTA 2R5ZB 5IP9J 1CQTA 4JYKA 4UUTA 3S1NJ 4FISA 4A3MJ 3MVPA 1IDZA 2LP0A 1A5JA 1U78A 1HCRA 2YUSA 1MSEC 1GV2A 2VI6A 2ECCA 5J1UA 1YRNA 2K40A 2DJNA 1D5YA 4XK4A 1AHDP 4BXXJ 2P81A 3RZDJ 2PMZN 1TWHJ 3BR6A 1IC8A 1WGXA 2JMWA 5F1JA 2R7ZJ 2M34A 2HOTA 1MH3A 3HEFA 1JT0A 3DEWA 3HGYA 1Y1VJ 3BR5A 3BG5A 1B8IB 1P7IA 3LSGA 4V2GA 3SDGA 3O8GA 1H8AC 1UMQA 4I6ZA 2HXOA 3GTPJ 3S2DJ 3GTKJ 3TP3A 2HXIA 2L9RA 3S1RJ 1P7JA 3SJMA 1IDYA 4L5EA 2R92J 3BG9A 3ZQLA 3BR1A 1HOMA 1F36A 1NTCA 2E19A 2NVXJ 4A3FJ 1XG1A 5IOYA 4IHYA 4C2MJ 1MBFA 2EH3A 3S2HJ 1H89C 1B72B 4A93J 3OIOA 2JN6A 2LVSA 2XGDA 4B3AA 3E7LA 3RKQA 2Y30A 5J1YA 5C44J 1ETWA 3G1MA 1ETXA 4JX5A 3M3YJ 1ETKA 2WAQN 4MLOA 5F04A 2D5VA 4DYCA 5EGOB 2JA5J 3Q3SA 4A3DJ 2X9DA 3TW7A 1AKHB 3QPLA 2MG4A 2LK2A 3O8HA 5F08A 3LSPA 1Q1VA 9ANTA 3HOZJ 2G0EA 2M9HA 3A02A 3WHBA 1OCTC 2HOSA 1ETYA 3TEDA 4V2FA 5F27A 2QF7A 1WCMJ 4BBRJ 5K7ZA 3PM1A 1UHSA 1ETOA 2O9LA 1LFBA 3A03A 1MBKA 1LFUP 4M3GA 1IG7A 4JP0A 4A3LJ 2ID3A 3ZOBA 1PUFA 2CRGA 2XPUA 3LSRA 4A3GJ 2Y9YA 4Y52J 3VPRA 2KDZA 2X48A 2CUEA 1WH7A 4JX4A 1IV6A 1I50J 1MH4A 1BW5A 2R0QC 2DA3A 4W1UA 3S17J 3JRIA 1DU0A 2B63J 1FIPA 5FKOA 3GTGJ 1OFCX 1DU6A 3B6CA 2L7MP 1Z77A 1BL0A 5FKKA 3S14J 1RPWA 2OPTA 2XGEA 5F0FA 2HYJA 3TW6A 1FTTA 2E2HJ 1Z0XA 1ZR2A 5J3LA 1RKWA 2LFBA 4M3EA 1TWAJ 5EG0B 2VKVA 4A3CJ 2DN0A 2TRTA 5E3OA 4MO7A 1MSFC 1JKOC 2JA6J 1ZQ3P 2LR8A 2CQXA 3H0GJ 2XPWA 4XRSG 2YU9J 3BQYA 1BJZA 3FIWA 2R5ZA 2XGCA 1POGA 2KT0A 3MN2A 3HOWJ 3K7AJ 1JKPC 1MBGA 4Y7NJ 5IP6A 2DMUA 4C3HJ 1IGNA 4AYBN 2ME0A 2E2IJ 3Q0VA 1VI0A 1ENHA 2OF7A 3C2BA 3LOCA 3GBGA 1S7EA 1T56A 3HB9A 2VUMJ 2DMQA 4FE7A 1VFCA 5IYBJ 4BY7J 3F0CA 2VKEA 3BTLA 5M3MJ 4UUSB 3JRDA 1FEXA 1SANA 3PO3J 5EYRA 4M3FA 3HOYJ 1B8IA 3BG3A 3W6VA 3M4OJ 4C3IJ 2I10A 5C4XJ 5K7HA 3D1NI 2CU7A 1LE8A 5GPCA 4B1RA 2GM4A 2ID6A 2L0KA 2K9SA 3BQZA 4C3JJ 2GBYA 3S1MJ 2ME6A 1W0UA 1O4XA 4M3DA 4G12A 4IHWA 3FKIJ 5F0HA 5EDNA 2XRLA 3GTQJ 4BY1J 1JKQC 1GVDA 5DS9A 2R93J 1ZTRA 1B72A 1T33A 2JA8J 3JRFA 3SFIA 1JJ8C 2LTPA 2O7OA 5HODA 2IAIA 1K83J 1OJLA 2XPVA 2LLKA 2JWTA 4LOCA 3A01B 2FQ4A 3NARA 2DA4A 4JX6A 1JUSA 1U8BA 1W0TA 3NAUA 3GTLJ 5EGOA 3HOXJ 4S0HB 3Q0UA 1I6HJ 1BA5A 1AKHA 1MBHA 3JRGA 5E3NA 1QRYA 2Y2ZA 1ORKA 2FD5A 2JK3A 3FK7A 1RETA 3CCYA 5EZGA 5IP7J 3HM5A 3BTIA 1MNMC 1U9NA 2H8RA 4QTRA 1QPIA 2EZIA 4IHVA 3JREA 4MFDA 4IEJA 1MBJA 3BR0A 1TC3C 2DMPA 1PUFB 2AO9A 5C3EJ 4FCYA 4IHXA 1GV5A 2NVQJ 2E1OA 3IH2A 2R5YB 4FE4A 4A3KJ 2E2JJ 1TWGJ 1FIAA 4BKXA 4I76A 2EZLA 1E3OC 1UG2A 5M5XJ 5C4JJ 3IH3A 2LY9A 4BBSJ 2AHQA 1HDDC 2EBIA 1TWCJ 2IBDA 2DMTA 1QVTA 1Y1WJ 1I3QJ 3GTMJ 3OSGA 3B6AA 2W48A 5M3FJ 4B4CA 2Y31A 4CYCB 5FKLA 5E3LA 4DZJA 3K2AA 5FJ8J 4J19A 1JJ6C 5GP9A 4M3BA 1FTZA 4X6AJ 4AC0A 3OOUA 4EEFG 1NK3P 1XS9A 3HOUJ 2FJ1A 4A69C 2M2EA 2MGQA 2N8GA 5EG0A 4QSHA 1JTYA 1RESA 5EF6A 3FISA 4XRMA 4A3IJ 3FK6A 4MFEA 5IOZA 1HLVA 1RR7A 3ZQFA 1HF0A 1YRNB 4AUXA 1FJLA 2HI3A 4XRSA 2YS9A 4X1EA 4RBOA 2ECBA 3GTJJ 1JKRC 4GFBA 1MBEA 4HNVA 5FKNA 1ETQA 1IUFA 2NS8A 4W97A 3S1QJ 4D5FA 1QVUA 1OCPA 5JLXA 2Y0SN 1X2NA 2DA5A 4NDLA 2COBA 2CUFA 2IEKA 2ZB9A 4RDUA 3JRHA 3LNQA 2H1KA 3BTJA 3ZQIA 5IPAA 1HDPA 2M8GX 1WI3A 1WPKA 1AU7A 5BNGA 2QCOA 3S16J 2MW8A 4D7NA 3ZQHA 3CMYA 4UUSA 3DCFA 2CQQA 3QQAA 2DMNA 2EZKA 5FLMJ 1ITYA 1LE8B 2M0CA 2FX0A 1ETVA 1U9OA 2WB1N 3PO2J 2MSYA 2XSDC 3RZOJ 3BR2A 3I4MJ 2RAEA 1BW6A 3ZQGA 4A3BJ 1ZKGA 1X58A 2HDDA 3LSJA 5J1RA 4XIDA 1JUPA 3TP0A 3UKGA 2VPRA 3IV5A 4D7MA 4DYQA 1VF9A 3I4NJ 1X2MA 2K9QA 4DYRA 5IYCJ 2K9NA 1NK2P 3BTCA 1GT0C 2NVYJ 1TWFJ 4D5CA 4ABZA 3JRBA 5M5WJ 1H88C 1R9TJ 1JUMA 2DA7A 3RQIA 1IRZA 4MIMA 2EQRA 1XC5A 3A01A 4A3JJ 1GUUA 2DA6A 5M5YJ 4FTHA 5F0CA 1EF4A 2L7ZA 3QPSA 1F43A 2ELKA 3G1LA 3IH4A 2XB0X 2JJ7A 5E3MA 1JTXA
chains in the Genus database with same CATH superfamily
2L7FP 2HQ5A 3K4NA 3OSFA 3G6EI 2LD5A 1FP2A 1KYZA 3DFGA 4M6VA 1DGRM 4AIJA 3OS2A 4CCNA 4BHCA 3OYHA 2VT2A 3WU0A 4XN3A 4AU7A 2L2OA 1N75A 2WAQA 3HSFA 2TCTA 1OYIA 3BR3A 5FKMA 4EJWA 4U7DA 1GXPA 3F8NA 5GAEJ 1RUNA 1IRXA 1XGOA 2LREA 1I1GA 1ZELA 5LRSA 3VYUB 5GPAA 2H8WA 2JA2A 1MMAA 1TT0A 1BI3A 2M8EA 1T38A 1GDTA 2W00A 4QIWN 2HYFA 1R7JA 3HBLA 1O7FA 2IGOA 4I7HA 4EV0A 2CW8A 4EM0B 3GO5A 4BQNA 4KT6A 4G6QA 1LEBA 3WHCA 2NS7A 4IJAA 3AG1H 1IF1A 1FSEA 3IP4B 3BLYA 2IP2A 4DBRA 1BR2A 4DW6A 3F9KA 5FLXK 3HKZN 3JRAA 3GZ6A 3C2HA 5IP9J 4IZZA 3BP8A 1GLNA 3H9GA 4UUTA 4OMZA 2NNYA 4P9UA 1UHMA 3QYBA 4E7JA 4M74A 2R7WA 1A5JA 1V54H 1TBXA 5E1XA 3ASOH 2H6BA 1QHHD 1SD4A 2E7XA 5HDKA 5D5UB 3OL4A 2IT0A 1O3SA 1H9TA 2DJNA 4UUVA 3FHNA 1D5YA 4BQQA 2FF4A 2V7FA 1TWHJ 3HRTA 2NXNB 3J80Z 1IC8A 4GCVA 5DCMA 4BE1A 2R7ZJ 4PSWA 1EH6A 3KETA 2DW4A 3CMAI 3ROUA 2H6CA 3U1DA 3DEWA 1R5HA 3LA3A 2O6GE 2OA4A 1Y1VJ 1ODDA 2BY0A 1Z91A 2VQLA 4XOTA 2W25A 2M87A 1TW2A 1O3RA 3LFKA 5H20A 1P7IA 3SDGA 1T98A 4YRVA 1UMQA 2Z1DA 1D1AA 1RNLA 4N9IA 2EFOA 4EQQA 3OR1C 2R7DA 4XRFA 3TP3A 3VWBA 1W5SA 3LSHA 4PJJA 5B1BH 3KLNA 2E36A 4E7HA 5LRRA 3SJMA 3F6VA 3OS1A 4N4OB 3DLAA 1NTCA 2E19A 1MGTA 3CCMI 4J01A 2NVXJ 2EIJH 2EJRA 1XG1A 5JVTA 4C2MJ 5HNHA 4LD5A 3KZYA 4P9FA 2E34A 3W2VA 2GOMA 4A93J 1G3SA 2P4WA 4YFKF 4GGGA 1W4MA 1V3FA 4PSXA 1KA8A 3ABUA 2XAHA 1ETKA 2WAQN 5F04A 4ENMA 3GFMA 4DYCA 3RYRA 2V1UA 1Q1HA 2PEXA 3DTKA 3H92A 1AKHB 1OCZH 3LAPA 3HOZJ 1Z05A 1R58A 1VQ9I 3EUHC 3HTSB 4B47A 3VOEA 5F27A 3H3UA 2QF7A 4HV5A 4PZJA 1SVLA 4EJVA 4IOAF 2ELHA 1UHSA 1ETOA 2XHKA 3JSOA 5FRMA 2KKOA 2P5KA 3OIPA 1RI7A 3K1NA 1IG7A 4JP0A 1L0OC 4PCQA 2WAFA 2XF6A 1P92A 4BE2A 4A3LJ 3GFJA 2CRGA 4A3GJ 1WI9A 2HFHA 5HS8A 4Y52J 1BBYA 3VPRA 2W82A 4M73A 1VQ5I 2VKHA 2CUEA 1WH7A 2FEZA 2W24A 1CGPA 5LGUA 1BW5A 4MHGA 4ANJA 1VQ4I 4AVZA 2DA3A 3TGNA 1D8KA 2B63J 1FIPA 3K2ZA 3CLOA 2HKOA 4Y13A 3OYDA 3B6CA 4MEXF 4LB6B 1BL0A 3S14J 4ZZLA 2PI0A 1ZLKA 2CUZA 4KJZA 3T8TA 5ILVA 1UZCA 1Z0XA 3BJAA 5J3LA 2HQAA 5L3FA 3GUDA 2LSOA 5ERIA 1Z3XA 2O0YA 3QPTA 1KQ0A 5IT9Z 2DN0A 2O03A 1NH3A 4GDFA 2DJIA 5CQEA 3IL2A 1G3TA 2Z3YA 2JA6J 3CCSI 3FMQA 3KZZA 3V42A 4XRSG 4MQVA 1SFXA 2Q2EB 1R36A 3FIWA 3T0YA 2KHMA 2JT1A 3I56I 1YO5C 2KT0A 1RC9A 4CCJA 2A3SA 1IO2A 3GWZA 5A2QK 1WSUA 4V19K 2E71A 4WXCA 2RC4A 3MZYA 1DP3A 1Z6RA 3Q0VA 5CQGA 4UV8A 4BQOA 4E4HA 2WWYA 2P5VA 5LEKA 4C30A 3TL4X 2GA1A 2PBIA 5B3SH 1MW7A 4Q5SF 1F4KA 1U6GA 4FE7A 3PIPF 2JSPA 3WTWC 1C0WA 3KP7A 4S05A 1G59A 3CF2A 4UUSB 1FEXA 5JVGF 4BH9A 2L4MA 5IT3A 3L00A 4RB2C 4A0XA 1FNNA 2HTJA 3EQLF 4XSXF 1VQ7I 2OU2A 2I5UA 3SYTA 3D1NI 2CU7A 3OYMA 5L3EA 4OAYA 2ZKZA 3V7SA 2JPCA 3V8KA 3ZMTA 4DJAA 3GYHX 4ZDOA 2FOKA 4C3JJ 4FASD 2GBYA 2ZXHA 4HOBA 2XVCA 1O4XA 4R1HA 5CLSA 4G12A 2HTSA 3FKIJ 2DYRH 2LC2A 4BY1J 1JKQC 4A12A 3PUBA 1ZTRA 2BZTA 4IRHA 4R79A 3JRFA 1LVAA 3ONQA 2UV1A 1KONA 2O7OA 5HODA 1KQ8A 3TO9A 4CGZA 2IAIA 4M71A 2DI3A 4C2TA 1OJLA 3H5AA 1FLIA 1J2XA 2ZJQF 3W2WA 1Y8RB 2DOEA 4KITB 3GTLJ 2F4IA 1VQ8I 5GADJ 1I6HJ 1A35A 1KU9A 4NC6A 2LBFB 1AKHA 3JRGA 5E3NA 1QRYA 2Y2ZA 1ORKA 4IF4A 4QPOA 4NC8A 1XCBA 2IA2A 1R23A 3CDIA 4CXFA 3CCYA 5K5QA 1OQYA 4U7BA 2W84A 4IHVA 1PP7U 3L2UA 4IEJA 3QU6A 1CF7B 1T6SA 4DOZA 1PUFB 4EM2A 2K86A 4IHXA 1VQ6I 1ZGJA 3BPVA 4CYDA 1X1AA 4RM3A 2W7NA 2E2JJ 1R49A 1KU2A 3I55I 3PQJA 2M4KA 3QOPA 1T39A 5CYVA 3IH3A 2R3SA 2VJIA 3F72A 5FFZA 2GWRA 3CJQB 2EBIA 5AIQA 2DQRA 1JE8A 1I3QJ 3GTMJ 3OSGA 5ED4A 1BC7C 1LFPA 4A6DA 1LDDA 1P6RA 2M45A 4XLAA 4IKFA 1I6XA 2CFXA 5FB2A 2CW7A 4J19A 3D5RC 5GP9A 1FTZA 1MMNA 4DQ2A 4Y3OA 2MYSA 1MKMA 2YPRA 2YSRA 4RLQA 4CSWA 4X6AJ 4AC0A 3PFYA 3PFIA 1USTA 5HLTA 1XS9A 2K3FA 2FJ1A 1LDJA 2MA3A 2MGQA 1O3QA 1XCVA 3S32A 3GX4X 2CYYA 1XDSA 1JTYA 1RESA 1OKRA 4A3IJ 3D0SA 5IOZA 3F23A 3IWZA 1RR7A 5BOXA 1HF0A 3EYIA 1IXRC 4JK1X 1FOYA 4BXFA 2F5FA 4HF0A 2YS9A 4XRSA 4RBOA 2ECBA 2Q2EA 3F8CA 4HNVA 1FBUA 1ETQA 3H9QA 2L9VA 3M8FA 2NS8A 3S1QJ 2IA0A 2K9LA 1FSHA 1OCPA 1FP1D 1X2NA 1S7OA 2H1LA 1R1UA 1UJ8A 4NDLA 2CUFA 2IEKA 4CA0A 1SFUA 1WWXA 2R4GA 3BG6A 2Z16A 3MWMA 3LNQA 2VBYA 1IRGA 2VOOA 4Q48A 4XLFA 1KU3A 3J80K 4GXOA 6PAXA 5IPAA 1GHCA 2M8GX 3GXOA 2A6TA 2MH2A 1PYVA 4RA2A 3VDXA 1AU7A 3EUHA 3S16J 3F3XA 1EA3A 2OZ6A 3QP5A 4UUSA 2BHYA 2HKXA 5HLIA 3QQAA 1UB9A 2ZC2A 4CZCA 4Y33A 2DMNA 1YW7A 1H9GA 2EZKA 4RAZA 2FX0A 4HSRA 1T8IA 3PO2J 3OYGA 5LEJA 4ZC3A 2GXBA 1DUXC 3ZQGA 3WTVC 1X58A 3HL2A 3MFKA 2V79A 3HSRA 5B66C 1UCRA 2IXSA 5DV5A 1MMGA 2XASA 3IV5A 3J81K 1I3AA 2QQAA 2KZVA 3LSIA 4DYQA 4C9YA 2YR2A 3HIFA 4JOMA 2Q8KA 1E17A 3RKWA 1FPQA 2QBYB 3R0AA 4I01A 1GT0C 2NVYJ 5GAGJ 2D1VA 3FMSA 4HRIA 5M5WJ 3WTUC 2OAZA 2OTJI 1BR1A 4GRIA 1G6NA 3I58A 1XC5A 2K02A 2JVGA 5GAHJ 4M6YA 1HC8A 4O3MA 2CWEA 5HNFA 4EATA 3IH4A 3CTAA 2LBFA 2A6EF 1JTXA 1FY7A 5BPIA 2DA1A 3FM3A 3ZRGA 4I0BA 2Y9ZA 1Z1DA 2GAUA 3SEZA 5JLWA 1WKMA 3IHUA 4BXUA 4Y15A 3BT9A 3CD6I 2F2EA 3SHFA 3M1CA 5DTDA 3M8EA 1SFOJ 5ICGA 3HOTA 2R7SA 1YYVA 1ZGWA 2NOGA 2VOPA 5CVRA 1R71A 1J59A 2HPMA 5IYDJ 3ZCOA 4BJTA 2XB5A 3S15J 1I5ZA 3DQVC 3QWLA 4YIIA 4RGXA 2XAFA 3CQZJ 3OYKA 1ZK8A 1LJ9A 1D0ZA 1SMTA 2FE3A 1X3WB 1MDMB 2DFHA 5FO5A 2C6YA 3Q0WA 2FBIA 2IS6A 3DXJF 2GQQA 2V1DA 3HOVJ 4I99C 2LKPA 4M9ZA 5CPRB 4P55A 1IUYA 1EKEA 5A2QZ 5H2FC 5K7FA 1HSJA 1A6IA 4XICA 2ZXWH 2M4GA 2R5ZB 2KJCA 3L7WA 1IN5A 4XMYA 3MKYB 2EV0A 3EUAA 4FX4A 1CQTA 3S1NJ 4FISA 4BACA 3DBHB 4R8HA 1XMAA 2LP0A 3FF5A 3CUQC 5IT9K 1R00A 1W7PD 1GV2A 4F93B 5LD2C 4HA8A 1D8JA 2X1CA 4L18B 5TRDA 3S3MA 2XAUA 2DODA 2BOLA 1WHUA 4WWCA 4XK4A 3NWSA 1WVRA 2KIQA 3GFIA 1OR7C 2G7UA 3BR6A 2JMWA 4WX9A 3OYCA 1WJDA 3FX3A 3MCZA 2B9SA 3HEFA 1QBJA 2BVMA 2VT3A 2V26A 5F64A 2EILH 2XV4S 3OYFA 1B8IB 2NNNA 3CJNA 1H8AC 1VTNC 1P4AA 1Y6IA 3T8RA 2HXOA 4Y4RA 2LKSA 3H5RA 3P7NA 2LY2A 2DYSH 5AONA 3S2DJ 5CVVA 2QQ9A 3TDZC 2L9RA 2Z2SB 3HZJA 3ZN0A 3KYLA 2HQNA 3IKVA 3BG9A 1TZLA 5D8KB 2DFFA 4ZYHA 1ZLJA 2CH0A 5ILUA 5FD5A 3K6GA 3K4BA 1MBFA 4YFNF 3RIRA 2PJPA 1R22A 2GOXB 1YS7A 3S2HJ 4Y17A 1B72B 2STTA 2WA0A 2PLYA 1TQIA 2VN2A 4XN0A 1VQKI 3OIOA 3L2CA 1K4TA 3RI4A 2QQ8A 5C44J 5TJJA 1YTYA 3G1MA 4BJ5C 1KYWA 2LF8A 1ZG5A 3HHGA 2VBZA 2JA5J 2EV6A 3H35A 2R7QA 3FM5A 3Q3SA 4A3DJ 3BZCA 2X9DA 3AAFA 2QBYA 3M7GA 2LK2A 9ANTA 3C7JA 3GZNB 3A02A 4DIQA 1ETYA 5J4YA 2HVRA 2MLGA 4PFOA 4V2FA 5HDGA 3IRQA 1WCMJ 4BBRJ 1Z6TA 3PM1A 3PNVA 4RGUA 1V4RA 4NNJA 3I64A 3OYBA 2PMUA 2O9LA 1U8RA 3A03A 2VKDA 1FX7A 3K1MA 4E7SA 3ZQ7A 3TOBA 3WTSC 3ZOBA 2BGCA 3PSIA 4ESBA 3OOPA 4EM1A 3KIOA 4ASNA 2KDZA 4WCGA 2E1MB 3ZPLA 1U3EM 2KIUA 4L5IA 4W1UA 3S17J 4II2A 1DU0A 3BG7A 2MC4A 3WG9A 1U5TC 2CMPA 3GTGJ 4N4NB 2L7MP 1IRFA 1Z77A 3MD2A 1RPWA 2ZFUA 2XGEA 3UNGC 2LYCA 4LK1F 1X4PA 3TW6A 3W3CA 1QZZA 1WJBA 1FTTA 2FBHA 4BDZA 4CCMA 2ESNA 1MDMA 1YI2I 2IGNA 5ICFA 3VFZA 4A3CJ 4P1WA 4B3XA 4LK0F 3GF2A 4HG2A 2DAOA 4PGHA 1JKOC 4B09A 3Q5FA 3J7AY 1K6OA 3I3LA 1Z9CA 4AVPA 3E6DA 2COMA 3RJPA 3FDYA 1BC8C 1G3YA 2XDVA 2R5ZA 3KPHA 1WRJA 4XLCA 5LGNA 3GMEA 3K7AJ 3KYDB 1MBGA 2BEOA 5IP6A 2X6YA 2R7XA 4C3HJ 1IGNA 2XROA 2E2IJ 2XF7A 4RLFA 3O6BB 4S04A 3GVAA 3ABMH 3HB9A 4XM3A 2XAJA 2VUMJ 2DMQA 4WK8F 1WFXA 3ELKA 2BYVE 3ZMVA 1SAXA 2A05A 1K78B 3NRVA 1VFCA 2B7EA 3U21A 1HKQA 2FMYA 2K9MA 5D8LB 4G94A 3F0CA 3K4CA 3BTLA 3JRDA 3AG2H 2ZXJA 1SANA 5EEHA 4YG2F 2VE8A 2CW0F 1B8IA 3J7AO 2ICWG 4HQEA 3M4OJ 5LHGA 5ICEA 2L01A 1OYYA 1YOVB 2DCEA 5K7HA 3U1KA 1PVEA 3J81Z 4U87A 2EFWA 3NWTA 5K1YA 1MJAA 3ECOA 4E6KG 2L0KA 2ZMEC 3BQZA 5GTIC 1S7AA 2M3AA 3S1MJ 3C18A 4ENJA 4L0ZB 3BY6A 3KP2A 4Z6YA 4M3DA 3CO7C 4IHWA 1DPRA 1GVDA 2R93J 1B72A 1T33A 2K3PA 3PQKA 2JA8J 1IAWA 3SFIA 2NRAC 1JJ8C 4BL0B 2LTPA 1Z21A 4KIBA 2LRDA 5B5EC 2Y69H 2XPVA 2EIKH 2V9KA 3A01B 3HXLA 1BIBA 2F5EA 1SFEA 4P96A 4JX6A 3I0TA 4G6TB 4ENNA 2XKPA 1A36A 4S0HB 5D6FA 2GXAA 3Q0UA 2EINH 1IN8A 3A2KA 2OBPA 2WY7Q 2X51A 1UAAA 4HEA2 3LQRA 1W36D 4QPQA 3MEXA 3SEQA 2QQBA 4D9JA 1Z3YA 4UB8C 4IRIA 2K5CA 2K4JA 4XLHA 2LG4A 3PNYA 3OYEA 2EZIA 4U88A 3KEYA 3BR0A 1MBJA 4EMSA 1TW3A 4L0YB 1O3TA 3CF5F 2FNAA 3IH2A 3PSFA 4FE4A 3RPUA 2R5YB 4IOCF 4LIUA 1TWGJ 1YIOA 2ZNZA 4GYIA 1E3OC 1OCRH 2LY9A 1YG2A 4BBSJ 2CQKA 1HQCA 4UVBA 2L7KA 5EEGA 2STWA 1XMKA 3COAC 2FOWA 3H9JA 1E2XA 4I02A 4IO9F 4L9JA 2Y31A 4CYCB 1ZRCA 1D0XA 3DBRB 4DZJA 1X1CA 3WTZA 5KHDA 4I2OA 4PJMA 4M3BA 2F48A 4P5OA 4UV9A 5DD4A 3HTUA 2RKHA 3VODA 1ZN2A 3FXQA 4EJUA 2ZMEB 5LGTA 3ESWB 4LMYA 4OIRF 2JPBA 2M2EA 3QP6A 2B0LA 4ZH4F 3OV8A 4YIFA 2VQCA 3ML6A 3KP5A 4F92B 3FISA 4XRMA 4HDUA 4PJ0C 2YX7A 3E0JB 2DK5A 4AIKA 3I4PA 3GTJJ 2JQ7A 1FYKA 1SD5A 3EUKL 4BUPA 1BOBA 1IUFA 1HXDA 1O7LA 2BE5F 3DKYA 2IW5A 3L2RA 3KP4A 4HLYA 2DK8A 5DUKA 2HZTA 4RDUA 2ZB9A 1YFHA 3JRHA 2EA4A 2DQLA 3FXMA 1ZYRF 3BTJA 2GIZA 2ZCWA 1W1WE 1K78A 2DDAA 1T0FC 1WJEA 3G71I 3CLQA 2QCOA 3FXRA 4YEJA 5DEQA 4I98B 1SC7A 1W5CC 2UZKA 4ZJZA 5FD6A 1ONVA 3KCCA 3MQ0A 4CHUA 1NG7A 1ITYA 1LE8B 2M0CA 2DT5A 3V7RA 1FOKA 5TGTA 3KP3A 4ZDLA 4UY8I 1OCOH 1SEUA 2XSDC 4A0YA 2Q1ZB 3I4MJ 1B59A 4LLLA 1ZRFA 4HW0A 2L9NA 5J1RA 5HLHA 3TP0A 2V1NA 4MTDA 2OCCH 2VPLA 4LITA 1SVMA 4FQGA 3ECHA 4OINF 3I4NJ 2PX9A 2A5WA 3K4JA 2CV2A 2HU9A 3K1PA 4MGRA 4XKWA 4DYRA 4RS8A 3U2RA 4ETSA 1YJWI 2ZFWA 3K70D 3E5UA 4D5CA 2PJRB 3GEZA 4ABZA 4RGRA 3OWTA 3ZP5A 1H88C 2DA7A 3VEPA 1TL8A 4BDYA 2DOAA 2EQRA 4U0WA 4H4KC 2IS1A 3A01A 1LB2A 2HVQA 4BE0A 4FTHA 2HDWA 1EH8A 2Z99A 3SDBA 1AOYA 1EF4A 2DOFA 2L7ZA 3QPSA 2A5YB 4BQAA 2VJJA 4PJNA 4I09A 3QRFF 5L3GA 3R0JA 3FBIB 3LSKA 4XORA 3Q9SA 2XB0X 2RGVA 1XSXA 2P7CB 1XGSA 2GZWA 4BHBA 1F5TA 2XF5A 2GLOA 4ESFA 4PGGA 2O8KA 2R7RA 4L9VA 1JT6A 3HHHA 3MKLA 2QZ8A 1I1SA 4CICA 1Y0UA 1LQ1A 2HOAA 4G8XA 5FLVA 2MC3A 2DA2A 2DTZA 5LHIA 1VNDA 3G1OA 2E5NA 2UXXA 3CCRI 3OMYA 4E7KA 3L1PA 1RIOH 2R5YA 3IC7A 3JR9A 2AXTC 1QNTA 3OIQA 4IHTA 1HKTA 2DBBA 1JXSA 2ADUA 3HRSA 1K61A 2X6OA 3CCUI 2ZJPF 5EEAA 3JW4A 4FT8A 3AL0C 2EZHA 2WAEA 2DO7A 3CUOA 2DDBA 1APLC 3LA2A 4M6XA 2NAZA 4CYCA 1G2HA 3BOQA 4J00A 2HNHA 2RNJA 4XLNF 3HDDA 2JA7J 4NUBA 5JHFA 4F52A 2VBWA 1DQUA 3RKXA 1RKTA 4XKBA 4JYKA 3OYNA 1QHGA 3VSLA 3MVPA 2ZMEA 1QO0D 1IDZA 4HAMA 2KDOA 3K0LA 4FETA 3S2WA 2WC2A 1D3YA 1U78A 3H5NA 4OOIA 4KYWA 2BW3B 5B1AH 2ECCA 4E7LA 5J1UA 2O8XA 2K40A 5E18F 3GFLA 1Y39A 3L2QA 2ELJA 3J7ZI 4E70A 1AHDP 4BXXJ 4LLGF 4KDPA 2P81A 1FMVA 4GO1A 1HW1A 1WGXA 4ON0A 1BJAA 3DTIA 1MH3A 1XSVA 2A6HF 1RRJA 2QSGX 2ISZA 2G7HA 2CUJA 2ZSHB 2BY3A 4Q47A 4MQ9F 2A68F 2ESHA 3BG5A 3CC2I 5LHHA 2YX4A 3WTXC 4V2GA 3DPUA 4JBAA 2DT7B 2Y48A 1TT5B 1MJBA 1S3JA 3M9AA 3LL7A 5JR3A 4D0PA 5CVUA 2QA4I 2FA5A 3MAJA 2P6TA 1P7JA 5BQTA 2HQRA 3DLLF 1J0RA 1IDYA 1HOMA 2FMLA 3EETA 2KZGA 4A3FJ 2L5QA 4KA4A 1MJ9A 5IOYA 4IHYA 4HZFA 5GTHC 1XD7A 2OC6A 2KIFA 2KJBA 2M7AA 1H89C 5CJ9A 4MTEA 2VODA 3E5QA 2XRNA 2LOOA 2XGDA 3AFHA 3E7LA 2P7VB 3K10A 4B3AA 3RKQA 2DTRA 2KMUA 3K4LA 2Y30A 4XBFA 5LBQA 5J1YA 4KT5C 1BI0A 2RN7A 1HW2A 4JX5A 3FXKA 2KRHA 1QPMA 3DU6A 5FROA 5EGOB 3FBNB 3ZXSA 4KNYA 2VJ4A 1IW7F 1Q1VA 2PJRA 1PUEE 2DXIA 1OCTC 4RB3C 2FSWA 2HOSA 4A0ZA 3C2GA 3RYPA 1SAUA 4QLCU 1R4MB 1BIAA 2W85A 2RREA 4CCOA 5JI6A 3R60A 2V6EA 1NG6A 1D5VA 4OU0A 3CCEI 3V8JA 1LFBA 1BM9A 1ZH5A 3M8JA 1LFUP 1EJ9A 1XMXA 1CF7A 2ISYA 4CUGA 1LUJB 1PUFA 3LSRA 3AG4H 2F4MB 2P5LC 4H0EA 2DT6A 2O5RA 1LDKB 3LMMA 1Y56A 2ZBKA 3WU2C 4Q4ZF 2HEOA 4LLNA 5DDGA 3S3NA 3HRMA 3F8BA 2P6SA 4JX4A 2K4BA 3NEUA 4PFPA 4NQWB 3D5LA 3SZPA 3H1CA 2R0QC 1V5EA 4XQFA 3DEEA 1ZRDA 1YIJI 3L09A 1RUOA 2MH9A 2IJLA 3JRIA 1G4DA 2R7TA 2UUZA 1UHWA 3GZ5A 3NQOA 1OFCX 1KQ9A 1DU6A 2YU3A 4RAGA 1MNEA 4FX0A 5FKKA 2AXLA 2OPTA 2A69F 1T0FA 1ACIA 3BJ6A 2HYJA 2HS5A 4NC7A 3TO6A 2BHZA 5CVJA 1OLTA 3TBIA 1TWAJ 4AD9A 2JUCA 5EG0B 2RDPA 3VYTB 2TRTA 5BPDA 4HSTA 5CKTA 5E3OA 2MLKA 3P9IA 5HLGA 2XKOA 1D1BA 2KP6A 3HC7A 2CQXA 2WADA 3TQNA 3H0GJ 2PN6A 2XPWA 2TDXA 4LG3A 1QZEA 2L54A 1BJZA 2X1EA 1YW8A 3GLXA 2XGCA 1POGA 4B44A 1T2KA 4HQMA 2BY1A 2FXAA 3HG9A 2CO5A 1DGWY 2FBKA 4ZZDA 1JKPC 1XB4A 3S8PA 2DMUA 1X19A 2PQ8A 1PDNC 2R7UA 1YS6A 2ME0A 1UFMA 1VI0A 1ENHA 2BW3A 2OF7A 3C2BA 5DM7F 4YIRX 3LSMA 5J4VA 1P9QC 3GBGA 3GW2A 2A07F 1S7EA 1TTYA 4NB5A 5BMZA 4I0AA 5EJCA 2JRTA 1BI2A 2BBYA 3I53A 1O57A 1HBXG 4BY7J 5FGMA 2KISA 4RAYA 4BJ6C 2FRHA 4XOPA 2VKEA 4IL6C 3WGHA 5J40A 3RPQA 2NYXA 3ABTA 5EYRA 3HOYJ 1OPCA 4BNCA 3BG3A 2QGUA 4RB0A 4C3IJ 3QYFA 2I10A 2K27A 4U0VA 4CCKA 3QYEA 2E1NA 3H36A 4KN7X 3OYJA 2M0MA 4HDVA 2AS5F 2PFBA 4B1RA 1B1BA 3ERMA 4Z2YA 3WGGA 1MNDA 2ID6A 2IRFG 4KIFA 1DP7P 3PJRA 3T1BA 3HUGB 2Y0SA 1W0UA 2VBXA 5F0HA 3EDPA 2RQPA 4XONA 4ZTJA 3ZN1A 4DGWB 2QEXI 5DS9A 1Y8QB 2KLOA 2X85A 2A61A 3G2BA 2BXZA 1ZAOA 2CQ7A 4O5VA 1YITI 2EPFA 2DLLA 1D0YA 4X0GA 2XC7A 3DTEA 3L2WA 2JWTA 2O3FA 4LOCA 2FQ4A 2HR3A 2G9WA 2JZYA 3FXUA 2DA4A 5HS7A 1J75A 4NHJA 1U8BA 1W0TA 3NAUA 5EGOA 2WB1A 3F8FA 1WJAA 3CUQB 1DPUA 4IXAA 3BC8A 1R1TA 2HZDA 3B73A 2FD5A 1TNTA 1HSTA 4XKVA 1K7AA 2V6CA 1TP4A 3FK7A 1RETA 3KZIC 5IP7J 5DD8A 1MNMC 3BTIA 3T5XA 1FMWA 1U9NA 4IRGA 2HOEA 3CJTB 1ZHFA 3F6OA 3WG7H 2QUFA 2H8RA 1J9IA 3W6KB 4LB5A 1QPIA 2DFIA 4F7ZA 3JREA 3WTYC 2ETHA 3PUFA 1TC3C 2VQGA 4A6EA 4KFCA 2AO9A 1V5FA 3I59B 1UELB 1PP8F 4HV6A 4KMFA 2E1OA 3ZMUA 2NVQJ 3VB2A 2K85A 1A31A 5DUIA 3CO6C 1UG2A 4UB6C 5C4JJ 2MABA 3E97A 2AHQA 2IBDA 1QVTA 1U0JA 3KX2A 4PUSA 1J09A 4HX7A 4M9XA 4NQWA 1Y1WJ 3F21A 3ZMDA 3B6AA 2HGCA 2W48A 3ABLH 1IV8A 2E60A 1IXCA 2VC1A 3PNTA 1HKSA 1AWCA 5E17F 3CDHA 3K2AA 2R7FA 5J47A 2VXDA 1JJ6C 2LDUA 1JI8A 2JVHA 3OOUA 5KAIC 2KRCA 3DV8A 4EEFG 5AIPA 1NK3P 5F1RA 1IN4A 2CV0A 4YELA 4A69C 4HF1A 4E7ZA 3MMYB 1WZ2A 4BS9A 1YLFA 4CDGA 1YE9A 5EG0A 2XGXA 4XKCA 3H3ZA 1REPC 3DF8A 3FK6A 3WGIA 2CGPA 2Z5UA 1YRNB 1E0EA 4AUXA 1QU3A 2KFDA 2HI3A 3TOAA 4X1EA 3HSEA 2P8TA 1MBEA 3K9TA 5E1ZB 4W97A 1G8XA 2L9SA 3J7YJ 2F5VA 4RMNA 3P9KA 2O61A 4MNUA 2Y0SN 1S29A 2DA5A 2COBA 2V9PA 1ULYA 2VIXA 2HYGD 1ZREA 2H1KA 3E6BA 2QENA 3KFWX 2GXGA 5D4SA 1S6LA 1WI3A 2QLZA 3P5JA 1R4NB 5H6QA 4XSZF 5E1WA 1B6AA 2MW8A 2HWVA 1ERDA 3KYCB 4HNTA 2LF7A 2QSFX 4N9HA 5D5XB 1VQNI 1FBQA 1R1VA 3CZ6A 3BPXA 4O6JA 5FLMJ 3N97A 1DDNA 1U9OA 2WB1N 2EFNA 5KK1A 1XSDA 1LKXA 4A5NA 2L3DA 3MZHA 1S8NA 3LA7A 3ASNH 3RQ4A 3FHZA 2PMZA 3BR2A 4HF2A 1EH7A 1F9NA 3DKXA 1BW6A 4A3BJ 1U5TB 2HDDA 2IS2A 3IUOA 4XIDA 3FXOA 3S3OA 3HUGA 3UKGA 3HJEA 2DPDA 2VPRA 5L3CA 1PJRA 1Z7LA 1K6YA 1VF9A 3CC7I 1MZBA 2K9QA 4PK4A 2K9NA 2FU4A 3BTCA 1VQMI 4WXDA 2XSJC 1X1BA 3JTHA 3K69A 3JRBA 1R9TJ 2OUMA 3BJOA 4HNUA 1IRZA 1KZHA 1XGMA 3EYYA 3M1EA 2EFQA 1K79A 1E3HA 1N25A 1B9NA 5M5YJ 5F0CA 1F43A 3CMEI 5DYMA 2LNBA 4HX4A 4ESJA 4OIQF 2IS4A 3CUQA 3HPHA 2JJ7A 1TQPA 3CC4I 5IY5H 4WF2A 1JGGA 2VL8A 1KGSA 2LKXA 4E7IA 3ZQCA 2UXNA 3CDLA 4NBQA 3DU5A 2KQRA 3GTOJ 4M9SA 5EZHA 1J5YA 4LG0B 2CJJA 2CFOA 2Y0MA 4PJLA 4IQJA 1OR7A 3HGGA 2ZXIA 2CG4A 3HYIA 1V55H 3V7CA 1IJWC 1WH5A 3I59A 4IHSA 1HW5A 3JRCA 3E1SA 3G4SI 3ZQQA 4EGZA 1A6QA 3H3VK 3VYSB 5H6RA 4ZDPA 2WV1A 3DPTA 1ZR4A 2DPUA 3X2QH 4YFXF 3FXLA 4ZYDA 4BU2A 2NVTJ 1B9MA 2AQFA 3QAHA 2VXZA 4A3EJ 1TQMA 3DPLC 2ZSIB 4QWQA 3IWFA 4DZPA 1FYMA 1MMSA 3U9GA 2ZJRF 2CS3A 4CO8A 5E3MA 2F4OB 1YW9A 4A3MJ 3RTRA 4ZTFA 4DBQA 1N77A 3ZGKA 2W1OA 2DFEA 2KRFA 1HCRA 3CCQI 2YUSA 3ABKH 1MSEC 2VI6A 2HVSA 3V4GA 2D45A 1YRNA 1YX5A 2ZNYA 3E6CC 1S5LC 3BZKA 3RZDJ 2PMZN 4EJOA 1SFKA 5F1JA 3DWLE 3JAMK 1W5TA 2M34A 3TMOA 2HOTA 2IPQX 3L9FA 3IAS2 3WU1B 1JT0A 3HGYA 4OIOF 1QA6A 3BR5A 4HPQA 1GXQA 2D2WA 1VQLI 4L9TA 4ZYGA 3SXYA 3CCJI 4BHPA 3LSGA 1SMYF 3O8GA 2KPMA 3OY9A 4ZYEA 3JCUC 2M7BA 4I6ZA 3RPUD 2PMHA 2QM3A 5KNLA 3GTPJ 3GTKJ 3W6JB 3LWFA 2HXIA 1XDUA 4RAFA 1FC3A 3HOSA 1ZARA 3OR2C 3S1RJ 1WJFA 4BGDA 2EK5A 5ILSA 4L5EA 2R92J 3ZQLA 2OV7A 3BR1A 1F36A 5HDNA 3BDDA 4AYBA 1X4OA 3A1YA 1JHFA 3V8LA 2EH3A 4C2UA 1WJCA 2RQQA 5JHUA 4KIGA 2JRMA 2R7OA 3E3VA 3UR3C 4LGWA 3IKTA 1IZ1A 2WBMA 1IN6A 1S72I 2JN6A 2KL4A 2LVSA 2PG4A 4LJZF 4B48A 1U5TA 4AM3A 1YHQI 1ETWA 2QVOA 2GIVA 1XX5A 4DNCA 3RDIA 3KEOA 1ETXA 3M3YJ 3LSTA 1YJ9I 3ZR8X 2BY2A 4MLOA 1YJNI 4KISA 3M07A 4G9YA 3PIOF 1W7PB 2D5VA 3N4MA 4EVIA 2NVUB 5HVQC 4HLXA 2Z33A 3TW7A 2E35A 3CCVI 3EPZA 3QPLA 2MG4A 3O8HA 5F08A 3LSPA 5D4RA 2QYOA 2G0EA 2M9HA 3WHBA 4AWXB 4OAZA 1Z7UA 3TEDA 2E1CA 4M72A 1QQIA 2OQRA 3F22A 1ON2A 5K7ZA 3DKWA 2EFPA 2L4AA 1MBKA 3AKZA 4M3GA 1LNWA 3BCAA 5J8CA 3DBLB 2ID3A 3CESA 2VONA 1BR4A 1MIJA 2XPUA 3G73A 2Y9YA 2X6WA 5BS6A 5HOOA 4L5JA 4UVAA 4BEHB 3IAM2 4KN4X 2H27A 1T95A 4LG0A 4D1QA 2X48A 1FZPB 3E5XA 3I71A 3ISPA 4G6DA 4IPAA 3SFZA 1IV6A 1I50J 1MH4A 2WY8Q 3OL3A 4II3A 3RCOA 5J6XA 1HA8A 5LLQA 1RR8C 1I27A 2DU9A 2EWNA 2AQEA 1QZYA 3WE2A 5FKOA 2ZO4A 5DCFA 2Q0OA 3REOA 3KE2A 5FLXZ 1N78A 2IVMA 4RGSA 3AG3H 3S93A 4CH7A 5F0FA 3VYRB 2E2HJ 1ZR2A 3OYIA 2LH9A 1RKWA 2LFBA 4M3EA 2XUBA 2XIGA 2VKVA 1Z67A 2QKLB 1MD0A 3I9V2 4G7HF 1JGSA 4MO7A 1MSFC 4IQ4A 2BVLA 4LIVA 1ZQ3P 1BOAA 2LR8A 1SD7A 3A0BC 4KUMA 2L02A 1S9HA 3SZTA 4KICA 2YU9J 3BQYA 4XLPF 2J5PA 3HPGA 4OWRB 1R5ID 1E3PA 4EGYA 1T08B 3MN2A 2E5ZA 3HOWJ 2FNPA 3A0HC 4BYYA 4Y7NJ 2EB7A 2VQHA 1XGNA 3OS0A 2X6XA 3R4KA 3OYAA 4AYBN 5D5VB 4HBLA 5D5WB 1WQ2A 3LOCA 3MKWB 3C1DA 2V9VA 1KU7A 1T56A 3BROA 2EV5A 1B4AA 3W2AA 4JQFA 2M1BA 2M30A 3E6MA 2H09A 1QGPA 3R61A 3TKYA 5IYBJ 1TLHB 4FHTA 1BI1A 2V4JC 3WODF 5M3MJ 2W57A 1YX3A 3PO3J 3LAJA 3K4KA 4M3FA 2JSCA 1X3ZB 3W6VA 1M1EB 1J7KA 4PDKA 3FMRA 2R7VA 2IGKA 4N0BA 5C4XJ 3R6SA 1ZG1A 1LE8A 5GPCA 4GYGA 3VSKA 2GM4A 3I54A 5L3DA 1GVJA 2K9SA 2X1DA 5E20A 2ME6A 3GCMA 2VC0A 3CP8A 3WTTC 1P4XA 1X1DA 3QODA 5FRNA 2MBFA 1FOWA 4AIHA 1P2FA 5EDNA 1ZGAA 2XRLA 3AL0B 3GTQJ 1LVKA 3MZ8A 3ERED 1A04A 3DEUA 3O2PE 4RM2A 1W36C 2MD0A 2CQNA 3N05A 2BV6A 1H0MA 5D6EA 4U0YA 1SVOA 1K83J 2LLKA 3NARA 1K4SA 3H0DA 1JHHA 3FWEA 1JUSA 4A5MA 2RVCA 1W7PA 3HOXJ 1OYWA 4XR6A 3LQQA 1U2WA 1NHAA 1BA5A 1MBHA 2GA2A 2E7WA 4KMUX 4WXHA 3F8MA 5FFXA 3DP7A 2JUGA 4IVNA 2JK3A 1TNSA 1FT9A 4XL9A 4ENKA 2OD5A 5EZGA 3HM5A 3CP2A 4OMYA 4G7ZF 3D5SC 2VASA 1XN7A 1FBSA 1ZG3A 2EIMH 3GLLA 4QTRA 2F5CA 2W4SA 2MFZA 4MFDA 2OQGA 1FWZA 1RZ4A 2DMPA 2IGMA 2RNGA 4AIDA 5C3EJ 4FCYA 1OCCH 1GV5A 2KIMA 5K5OA 3A4CA 5TISC 1FYLA 4B8XA 4A3KJ 4HX8A 3TDUC 3ZMZA 3CCLI 2CV1A 1FIAA 1UG0A 4BKXA 4I76A 2EZLA 5M5XJ 3O3KA 4BEHA 1MMDA 1HDDC 4CCLA 1TWCJ 3G3ZA 4BAYA 2DMTA 2Z9OA 1F1ZA 2MD5A 2I8DA 4ITVA 2LY1A 2UWMA 5M3FJ 3BCBA 3B02A 4B4CA 5FKLA 2NS0A 5E3LA 1STZA 3PL8A 1R6RA 4MEYF 2IA1A 2XAGA 3QPHA 1OMIA 1L3LA 5FJ8J 2OZUA 1BN5A 4TV7A 2VLAA 2RV8A 3LFUA 5J8FA 3FKJA 2QSHX 2X0LA 2F5DA 1X1PA 3K4MA 2VJ5A 3HOUJ 3FZVA 2N8GA 4QSHA 3L2VA 4XLEA 5EF6A 3JAMZ 2LMDA 1AA7A 4MFEA 1HLVA 1YQAA 3ZQFA 3QU3A 3CMMA 3QOEA 3ZMSA 4IX7A 1FJLA 2BXYA 1LPQA 2H94A 3RKYA 3P9CA 3JTGA 1G3WA 1JKRC 4LFUA 2K7LA 3KEQA 4GFBA 1Y0NA 5FKNA 5DCMB 2QWWA 2WV0A 4D5FA 1QVUA 4XNFA 2ZJ2A 3SQNA 1USSA 5JLXA 2NOJB 1R5GA 2JTVA 5KCMA 4EJTA 3MKZA 2XAQA 3BZ6A 5E8GA 2M5WA 4F55A 3HKZA 3ZQIA 4ZYAA 3HRUA 2Y75A 2E1MC 4G7OF 2QKMB 1WJ5A 1HDPA 1P4WA 1WPKA 2F6CA 4UHTA 4HYEA 3JSPA 4K2EA 5BNGA 3BWGA 1OISA 4D7NA 3ZQHA 3CMYA 3C3WA 2VE9A 3DCFA 2V1XA 2CQQA 1FOXA 4A2UA 2OTLI 3FXJA 5F6FA 3CJRB 5K5RA 1D1CA 5KVRA 1VQOI 3IRRA 1ETVA 4F91B 1EV7A 2MSYA 3K70C 1VQPI 3KLOA 3SZGA 2WTEA 3RZOJ 3RSNA 5ICCA 2RAEA 2P0WA 4UNOA 1ON1A 5HS9A 1LEAA 1ZKGA 4B43A 3LSJA 5KAFC 5E79C 1JUPA 5JFRA 1VZ0A 2EA2A 1XTAA 1V5GA 3WE3A 2D1HA 2HDCA 4D7MA 5L3BA 4UVCA 3KP6A 1X2MA 4L9NA 5LFAA 4CZZA 1XPXA 2X4HA 5IYCJ 4UXNA 1NK2P 2VB6A 2CSOA 2HPIA 1TWFJ 4F3QA 5DM6F 1IXSB 2FUG2 5CVIA 1SD6A 4OIPF 3OYLA 1JUMA 3RQIA 4MIMA 1I39A 2J5OA 1X3UA 4A3JJ 1GUUA 2DA6A 4RB1A 5E8IA 2FQ3A 2OCEA 3Q9VA 1IN7A 2OJED 2ELKA 3G1LA 3TO7A 3I5UA 2ACJA 3ULQB
chains in the Genus database with same CATH topology
2L7FP 2DA1A 2HQ5A 1JGGA 2GLOA 3OSFA 2LKXA 2O8KA 2LD5A 3ZQCA 4M6VA 1JT6A 3MKLA 3CDLA 2Y9ZA 3GTOJ 5EZHA 2HOAA 5JLWA 2CJJA 5FLVA 3BT9A 2DA2A 2TCTA 3BR3A 3HGGA 5FKMA 5DTDA 1SFOJ 2DTZA 1VNDA 3G1OA 1IJWC 1ZGWA 2NOGA 1WH5A 5IYDJ 3L1PA 2R5YA 5GPAA 2XB5A 3JR9A 3S15J 3JRCA 3CQZJ 1GDTA 1ZK8A 1K61A 4QIWN 2X6OA 3H3VK 5EEAA 3HBLA 2WV1A 2EZHA 1ZR4A 3Q0WA 1APLC 2NVTJ 3HOVJ 4CYCA 3WHCA 2NS7A 1G2HA 3HDDA 4A3EJ 2JA7J 4DZPA 5K7FA 4DW6A 1A6IA 3HKZN 3JRAA 4XICA 1RKTA 2R5ZB 5IP9J 1CQTA 4JYKA 4UUTA 3S1NJ 4FISA 4A3MJ 3MVPA 1IDZA 2LP0A 1A5JA 1U78A 1HCRA 2YUSA 1MSEC 1GV2A 2VI6A 2ECCA 5J1UA 1YRNA 2K40A 2DJNA 1D5YA 4XK4A 1AHDP 4BXXJ 2P81A 3RZDJ 2PMZN 1TWHJ 3BR6A 1IC8A 1WGXA 2JMWA 5F1JA 2R7ZJ 2M34A 2HOTA 1MH3A 3HEFA 1JT0A 3DEWA 3HGYA 1Y1VJ 3BR5A 3BG5A 1B8IB 1P7IA 3LSGA 4V2GA 3SDGA 3O8GA 1H8AC 1UMQA 4I6ZA 2HXOA 3GTPJ 3S2DJ 3GTKJ 3TP3A 2HXIA 2L9RA 3S1RJ 1P7JA 3SJMA 1IDYA 4L5EA 2R92J 3BG9A 3ZQLA 3BR1A 1HOMA 1F36A 1NTCA 2E19A 2NVXJ 4A3FJ 1XG1A 5IOYA 4IHYA 4C2MJ 1MBFA 2EH3A 3S2HJ 1H89C 1B72B 4A93J 3OIOA 2JN6A 2LVSA 2XGDA 4B3AA 3E7LA 3RKQA 2Y30A 5J1YA 5C44J 1ETWA 3G1MA 1ETXA 4JX5A 3M3YJ 1ETKA 2WAQN 4MLOA 5F04A 2D5VA 4DYCA 5EGOB 2JA5J 3Q3SA 4A3DJ 2X9DA 3TW7A 1AKHB 3QPLA 2MG4A 2LK2A 3O8HA 5F08A 3LSPA 1Q1VA 9ANTA 3HOZJ 2G0EA 2M9HA 3A02A 3WHBA 1OCTC 2HOSA 1ETYA 3TEDA 4V2FA 5F27A 2QF7A 1WCMJ 4BBRJ 5K7ZA 3PM1A 1UHSA 1ETOA 2O9LA 1LFBA 3A03A 1MBKA 1LFUP 4M3GA 1IG7A 4JP0A 4A3LJ 2ID3A 3ZOBA 1PUFA 2CRGA 2XPUA 3LSRA 4A3GJ 2Y9YA 4Y52J 3VPRA 2KDZA 2X48A 2CUEA 1WH7A 4JX4A 1IV6A 1I50J 1MH4A 1BW5A 2R0QC 2DA3A 4W1UA 3S17J 3JRIA 1DU0A 2B63J 1FIPA 5FKOA 3GTGJ 1OFCX 1DU6A 3B6CA 2L7MP 1Z77A 1BL0A 5FKKA 3S14J 1RPWA 2OPTA 2XGEA 5F0FA 2HYJA 3TW6A 1FTTA 2E2HJ 1Z0XA 1ZR2A 5J3LA 1RKWA 2LFBA 4M3EA 1TWAJ 5EG0B 2VKVA 4A3CJ 2DN0A 2TRTA 5E3OA 4MO7A 1MSFC 1JKOC 2JA6J 1ZQ3P 2LR8A 2CQXA 3H0GJ 2XPWA 4XRSG 2YU9J 3BQYA 1BJZA 3FIWA 2R5ZA 2XGCA 1POGA 2KT0A 3MN2A 3HOWJ 3K7AJ 1JKPC 1MBGA 4Y7NJ 5IP6A 2DMUA 4C3HJ 1IGNA 4AYBN 2ME0A 2E2IJ 3Q0VA 1VI0A 1ENHA 2OF7A 3C2BA 3LOCA 3GBGA 1S7EA 1T56A 3HB9A 2VUMJ 2DMQA 4FE7A 1VFCA 5IYBJ 4BY7J 3F0CA 2VKEA 3BTLA 5M3MJ 4UUSB 3JRDA 1FEXA 1SANA 3PO3J 5EYRA 4M3FA 3HOYJ 1B8IA 3BG3A 3W6VA 3M4OJ 4C3IJ 2I10A 5C4XJ 5K7HA 3D1NI 2CU7A 1LE8A 5GPCA 4B1RA 2GM4A 2ID6A 2L0KA 2K9SA 3BQZA 4C3JJ 2GBYA 3S1MJ 2ME6A 1W0UA 1O4XA 4M3DA 4G12A 4IHWA 3FKIJ 5F0HA 5EDNA 2XRLA 3GTQJ 4BY1J 1JKQC 1GVDA 5DS9A 2R93J 1ZTRA 1B72A 1T33A 2JA8J 3JRFA 3SFIA 1JJ8C 2LTPA 2O7OA 5HODA 2IAIA 1K83J 1OJLA 2XPVA 2LLKA 2JWTA 4LOCA 3A01B 2FQ4A 3NARA 2DA4A 4JX6A 1JUSA 1U8BA 1W0TA 3NAUA 3GTLJ 5EGOA 3HOXJ 4S0HB 3Q0UA 1I6HJ 1BA5A 1AKHA 1MBHA 3JRGA 5E3NA 1QRYA 2Y2ZA 1ORKA 2FD5A 2JK3A 3FK7A 1RETA 3CCYA 5EZGA 5IP7J 3HM5A 3BTIA 1MNMC 1U9NA 2H8RA 4QTRA 1QPIA 2EZIA 4IHVA 3JREA 4MFDA 4IEJA 1MBJA 3BR0A 1TC3C 2DMPA 1PUFB 2AO9A 5C3EJ 4FCYA 4IHXA 1GV5A 2NVQJ 2E1OA 3IH2A 2R5YB 4FE4A 4A3KJ 2E2JJ 1TWGJ 1FIAA 4BKXA 4I76A 2EZLA 1E3OC 1UG2A 5M5XJ 5C4JJ 3IH3A 2LY9A 4BBSJ 2AHQA 1HDDC 2EBIA 1TWCJ 2IBDA 2DMTA 1QVTA 1Y1WJ 1I3QJ 3GTMJ 3OSGA 3B6AA 2W48A 5M3FJ 4B4CA 2Y31A 4CYCB 5FKLA 5E3LA 4DZJA 3K2AA 5FJ8J 4J19A 1JJ6C 5GP9A 4M3BA 1FTZA 4X6AJ 4AC0A 3OOUA 4EEFG 1NK3P 1XS9A 3HOUJ 2FJ1A 4A69C 2M2EA 2MGQA 2N8GA 5EG0A 4QSHA 1JTYA 1RESA 5EF6A 3FISA 4XRMA 4A3IJ 3FK6A 4MFEA 5IOZA 1HLVA 1RR7A 3ZQFA 1HF0A 1YRNB 4AUXA 1FJLA 2HI3A 4XRSA 2YS9A 4X1EA 4RBOA 2ECBA 3GTJJ 1JKRC 4GFBA 1MBEA 4HNVA 5FKNA 1ETQA 1IUFA 2NS8A 4W97A 3S1QJ 4D5FA 1QVUA 1OCPA 5JLXA 2Y0SN 1X2NA 2DA5A 4NDLA 2COBA 2CUFA 2IEKA 2ZB9A 4RDUA 3JRHA 3LNQA 2H1KA 3BTJA 3ZQIA 5IPAA 1HDPA 2M8GX 1WI3A 1WPKA 1AU7A 5BNGA 2QCOA 3S16J 2MW8A 4D7NA 3ZQHA 3CMYA 4UUSA 3DCFA 2CQQA 3QQAA 2DMNA 2EZKA 5FLMJ 1ITYA 1LE8B 2M0CA 2FX0A 1ETVA 1U9OA 2WB1N 3PO2J 2MSYA 2XSDC 3RZOJ 3BR2A 3I4MJ 2RAEA 1BW6A 3ZQGA 4A3BJ 1ZKGA 1X58A 2HDDA 3LSJA 5J1RA 4XIDA 1JUPA 3TP0A 3UKGA 2VPRA 3IV5A 4D7MA 4DYQA 1VF9A 3I4NJ 1X2MA 2K9QA 4DYRA 5IYCJ 2K9NA 1NK2P 3BTCA 1GT0C 2NVYJ 1TWFJ 4D5CA 4ABZA 3JRBA 5M5WJ 1H88C 1R9TJ 1JUMA 2DA7A 3RQIA 1IRZA 4MIMA 2EQRA 1XC5A 3A01A 4A3JJ 1GUUA 2DA6A 5M5YJ 4FTHA 5F0CA 1EF4A 2L7ZA 3QPSA 1F43A 2ELKA 3G1LA 3IH4A 2XB0X 2JJ7A 5E3MA 1JTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7F P;  2DA1 A;  2HQ5 A;  1JGG A;  2GLO A;  3OSF A;  2LKX A;  2O8K A;  2LD5 A;  3ZQC A;  4M6V A;  1JT6 A;  3MKL A;  3CDL A;  2Y9Z A;  3GTO J;  5EZH A;  2HOA A;  5JLW A;  2CJJ A;  5FLV A;  3BT9 A;  2DA2 A;  2TCT A;  3BR3 A;  3HGG A;  5FKM A;  5DTD A;  1SFO J;  2DTZ A;  1VND A;  3G1O A;  1IJW C;  1ZGW A;  2NOG A;  1WH5 A;  5IYD J;  3L1P A;  2R5Y A;  5GPA A;  2XB5 A;  3JR9 A;  3S15 J;  3JRC A;  3CQZ J;  1GDT A;  1ZK8 A;  1K61 A;  4QIW N;  2X6O A;  3H3V K;  5EEA A;  3HBL A;  2WV1 A;  2EZH A;  1ZR4 A;  3Q0W A;  1APL C;  2NVT J;  3HOV J;  4CYC A;  3WHC A;  2NS7 A;  1G2H A;  3HDD A;  4A3E J;  2JA7 J;  4DZP A;  5K7F A;  4DW6 A;  1A6I A;  3HKZ N;  3JRA A;  4XIC A;  1RKT A;  2R5Z B;  5IP9 J;  1CQT A;  4JYK A;  4UUT A;  3S1N J;  4FIS A;  4A3M J;  3MVP A;  1IDZ A;  2LP0 A;  1A5J A;  1U78 A;  1HCR A;  2YUS A;  1MSE C;  1GV2 A;  2VI6 A;  2ECC A;  5J1U A;  1YRN A;  2K40 A;  2DJN A;  1D5Y A;  4XK4 A;  1AHD P;  4BXX J;  2P81 A;  3RZD J;  2PMZ N;  1TWH J;  3BR6 A;  1IC8 A;  1WGX A;  2JMW A;  5F1J A;  2R7Z J;  2M34 A;  2HOT A;  1MH3 A;  3HEF A;  1JT0 A;  3DEW A;  3HGY A;  1Y1V J;  3BR5 A;  3BG5 A;  1B8I B;  1P7I A;  3LSG A;  4V2G A;  3SDG A;  3O8G A;  1H8A C;  1UMQ A;  4I6Z A;  2HXO A;  3GTP J;  3S2D J;  3GTK J;  3TP3 A;  2HXI A;  2L9R A;  3S1R J;  1P7J A;  3SJM A;  1IDY A;  4L5E A;  2R92 J;  3BG9 A;  3ZQL A;  3BR1 A;  1HOM A;  1F36 A;  1NTC A;  2E19 A;  2NVX J;  4A3F J;  1XG1 A;  5IOY A;  4IHY A;  4C2M J;  1MBF A;  2EH3 A;  3S2H J;  1H89 C;  1B72 B;  4A93 J;  3OIO A;  2JN6 A;  2LVS A;  2XGD A;  4B3A A;  3E7L A;  3RKQ A;  2Y30 A;  5J1Y A;  5C44 J;  1ETW A;  3G1M A;  1ETX A;  4JX5 A;  3M3Y J;  1ETK A;  2WAQ N;  4MLO A;  5F04 A;  2D5V A;  4DYC A;  5EGO B;  2JA5 J;  3Q3S A;  4A3D J;  2X9D A;  3TW7 A;  1AKH B;  3QPL A;  2MG4 A;  2LK2 A;  3O8H A;  5F08 A;  3LSP A;  1Q1V A;  9ANT A;  3HOZ J;  2G0E A;  2M9H A;  3A02 A;  3WHB A;  1OCT C;  2HOS A;  1ETY A;  3TED A;  4V2F A;  5F27 A;  2QF7 A;  1WCM J;  4BBR J;  5K7Z A;  3PM1 A;  1UHS A;  1ETO A;  2O9L A;  1LFB A;  3A03 A;  1MBK A;  1LFU P;  4M3G A;  1IG7 A;  4JP0 A;  4A3L J;  2ID3 A;  3ZOB A;  1PUF A;  2CRG A;  2XPU A;  3LSR A;  4A3G J;  2Y9Y A;  4Y52 J;  3VPR A;  2KDZ A;  2X48 A;  2CUE A;  1WH7 A;  4JX4 A;  1IV6 A;  1I50 J;  1MH4 A;  1BW5 A;  2R0Q C;  2DA3 A;  4W1U A;  3S17 J;  3JRI A;  1DU0 A;  2B63 J;  1FIP A;  5FKO A;  3GTG J;  1OFC X;  1DU6 A;  3B6C A;  2L7M P;  1Z77 A;  1BL0 A;  5FKK A;  3S14 J;  1RPW A;  2OPT A;  2XGE A;  5F0F A;  2HYJ A;  3TW6 A;  1FTT A;  2E2H J;  1Z0X A;  1ZR2 A;  5J3L A;  1RKW A;  2LFB A;  4M3E A;  1TWA J;  5EG0 B;  2VKV A;  4A3C J;  2DN0 A;  2TRT A;  5E3O A;  4MO7 A;  1MSF C;  1JKO C;  2JA6 J;  1ZQ3 P;  2LR8 A;  2CQX A;  3H0G J;  2XPW A;  4XRS G;  2YU9 J;  3BQY A;  1BJZ A;  3FIW A;  2R5Z A;  2XGC A;  1POG A;  2KT0 A;  3MN2 A;  3HOW J;  3K7A J;  1JKP C;  1MBG A;  4Y7N J;  5IP6 A;  2DMU A;  4C3H J;  1IGN A;  4AYB N;  2ME0 A;  2E2I J;  3Q0V A;  1VI0 A;  1ENH A;  2OF7 A;  3C2B A;  3LOC A;  3GBG A;  1S7E A;  1T56 A;  3HB9 A;  2VUM J;  2DMQ A;  4FE7 A;  1VFC A;  5IYB J;  4BY7 J;  3F0C A;  2VKE A;  3BTL A;  5M3M J;  4UUS B;  3JRD A;  1FEX A;  1SAN A;  3PO3 J;  5EYR A;  4M3F A;  3HOY J;  1B8I A;  3BG3 A;  3W6V A;  3M4O J;  4C3I J;  2I10 A;  5C4X J;  5K7H A;  3D1N I;  2CU7 A;  1LE8 A;  5GPC A;  4B1R A;  2GM4 A;  2ID6 A;  2L0K A;  2K9S A;  3BQZ A;  4C3J J;  2GBY A;  3S1M J;  2ME6 A;  1W0U A;  1O4X A;  4M3D A;  4G12 A;  4IHW A;  3FKI J;  5F0H A;  5EDN A;  2XRL A;  3GTQ J;  4BY1 J;  1JKQ C;  1GVD A;  5DS9 A;  2R93 J;  1ZTR A;  1B72 A;  1T33 A;  2JA8 J;  3JRF A;  3SFI A;  1JJ8 C;  2LTP A;  2O7O A;  5HOD A;  2IAI A;  1K83 J;  1OJL A;  2XPV A;  2LLK A;  2JWT A;  4LOC A;  3A01 B;  2FQ4 A;  3NAR A;  2DA4 A;  4JX6 A;  1JUS A;  1U8B A;  1W0T A;  3NAU A;  3GTL J;  5EGO A;  3HOX J;  4S0H B;  3Q0U A;  1I6H J;  1BA5 A;  1AKH A;  1MBH A;  3JRG A;  5E3N A;  1QRY A;  2Y2Z A;  1ORK A;  2FD5 A;  2JK3 A;  3FK7 A;  1RET A;  3CCY A;  5EZG A;  5IP7 J;  3HM5 A;  3BTI A;  1MNM C;  1U9N A;  2H8R A;  4QTR A;  1QPI A;  2EZI A;  4IHV A;  3JRE A;  4MFD A;  4IEJ A;  1MBJ A;  3BR0 A;  1TC3 C;  2DMP A;  1PUF B;  2AO9 A;  5C3E J;  4FCY A;  4IHX A;  1GV5 A;  2NVQ J;  2E1O A;  3IH2 A;  2R5Y B;  4FE4 A;  4A3K J;  2E2J J;  1TWG J;  1FIA A;  4BKX A;  4I76 A;  2EZL A;  1E3O C;  1UG2 A;  5M5X J;  5C4J J;  3IH3 A;  2LY9 A;  4BBS J;  2AHQ A;  1HDD C;  2EBI A;  1TWC J;  2IBD A;  2DMT A;  1QVT A;  1Y1W J;  1I3Q J;  3GTM J;  3OSG A;  3B6A A;  2W48 A;  5M3F J;  4B4C A;  2Y31 A;  4CYC B;  5FKL A;  5E3L A;  4DZJ A;  3K2A A;  5FJ8 J;  4J19 A;  1JJ6 C;  5GP9 A;  4M3B A;  1FTZ A;  4X6A J;  4AC0 A;  3OOU A;  4EEF G;  1NK3 P;  1XS9 A;  3HOU J;  2FJ1 A;  4A69 C;  2M2E A;  2MGQ A;  2N8G A;  5EG0 A;  4QSH A;  1JTY A;  1RES A;  5EF6 A;  3FIS A;  4XRM A;  4A3I J;  3FK6 A;  4MFE A;  5IOZ A;  1HLV A;  1RR7 A;  3ZQF A;  1HF0 A;  1YRN B;  4AUX A;  1FJL A;  2HI3 A;  4XRS A;  2YS9 A;  4X1E A;  4RBO A;  2ECB A;  3GTJ J;  1JKR C;  4GFB A;  1MBE A;  4HNV A;  5FKN A;  1ETQ A;  1IUF A;  2NS8 A;  4W97 A;  3S1Q J;  4D5F A;  1QVU A;  1OCP A;  5JLX A;  2Y0S N;  1X2N A;  2DA5 A;  4NDL A;  2COB A;  2CUF A;  2IEK A;  2ZB9 A;  4RDU A;  3JRH A;  3LNQ A;  2H1K A;  3BTJ A;  3ZQI A;  5IPA A;  1HDP A;  2M8G X;  1WI3 A;  1WPK A;  1AU7 A;  5BNG A;  2QCO A;  3S16 J;  2MW8 A;  4D7N A;  3ZQH A;  3CMY A;  4UUS A;  3DCF A;  2CQQ A;  3QQA A;  2DMN A;  2EZK A;  5FLM J;  1ITY A;  1LE8 B;  2M0C A;  2FX0 A;  1ETV A;  1U9O A;  2WB1 N;  3PO2 J;  2MSY A;  2XSD C;  3RZO J;  3BR2 A;  3I4M J;  2RAE A;  1BW6 A;  3ZQG A;  4A3B J;  1ZKG A;  1X58 A;  2HDD A;  3LSJ A;  5J1R A;  4XID A;  1JUP A;  3TP0 A;  3UKG A;  2VPR A;  3IV5 A;  4D7M A;  4DYQ A;  1VF9 A;  3I4N J;  1X2M A;  2K9Q A;  4DYR A;  5IYC J;  2K9N A;  1NK2 P;  3BTC A;  1GT0 C;  2NVY J;  1TWF J;  4D5C A;  4ABZ A;  3JRB A;  5M5W J;  1H88 C;  1R9T J;  1JUM A;  2DA7 A;  3RQI A;  1IRZ A;  4MIM A;  2EQR A;  1XC5 A;  3A01 A;  4A3J J;  1GUU A;  2DA6 A;  5M5Y J;  4FTH A;  5F0C A;  1EF4 A;  2L7Z A;  3QPS A;  1F43 A;  2ELK A;  3G1L A;  3IH4 A;  2XB0 X;  2JJ7 A;  5E3M A;  1JTX A; 
#chains in the Genus database with same CATH topology
 2L7F P;  2HQ5 A;  3K4N A;  3OSF A;  3G6E I;  2LD5 A;  1FP2 A;  1KYZ A;  3DFG A;  4M6V A;  1DGR M;  4AIJ A;  3OS2 A;  4CCN A;  4BHC A;  3OYH A;  2VT2 A;  3WU0 A;  4XN3 A;  4AU7 A;  2L2O A;  1N75 A;  2WAQ A;  3HSF A;  2TCT A;  1OYI A;  3BR3 A;  5FKM A;  4EJW A;  4U7D A;  1GXP A;  3F8N A;  5GAE J;  1RUN A;  1IRX A;  1XGO A;  2LRE A;  1I1G A;  1ZEL A;  5LRS A;  3VYU B;  5GPA A;  2H8W A;  2JA2 A;  1MMA A;  1TT0 A;  1BI3 A;  2M8E A;  1T38 A;  1GDT A;  2W00 A;  4QIW N;  2HYF A;  1R7J A;  3HBL A;  1O7F A;  2IGO A;  4I7H A;  4EV0 A;  2CW8 A;  4EM0 B;  3GO5 A;  4BQN A;  4KT6 A;  4G6Q A;  1LEB A;  3WHC A;  2NS7 A;  4IJA A;  3AG1 H;  1IF1 A;  1FSE A;  3IP4 B;  3BLY A;  2IP2 A;  4DBR A;  1BR2 A;  4DW6 A;  3F9K A;  5FLX K;  3HKZ N;  3JRA A;  3GZ6 A;  3C2H A;  5IP9 J;  4IZZ A;  3BP8 A;  1GLN A;  3H9G A;  4UUT A;  4OMZ A;  2NNY A;  4P9U A;  1UHM A;  3QYB A;  4E7J A;  4M74 A;  2R7W A;  1A5J A;  1V54 H;  1TBX A;  5E1X A;  3ASO H;  2H6B A;  1QHH D;  1SD4 A;  2E7X A;  5HDK A;  5D5U B;  3OL4 A;  2IT0 A;  1O3S A;  1H9T A;  2DJN A;  4UUV A;  3FHN A;  1D5Y A;  4BQQ A;  2FF4 A;  2V7F A;  1TWH J;  3HRT A;  2NXN B;  3J80 Z;  1IC8 A;  4GCV A;  5DCM A;  4BE1 A;  2R7Z J;  4PSW A;  1EH6 A;  3KET A;  2DW4 A;  3CMA I;  3ROU A;  2H6C A;  3U1D A;  3DEW A;  1R5H A;  3LA3 A;  2O6G E;  2OA4 A;  1Y1V J;  1ODD A;  2BY0 A;  1Z91 A;  2VQL A;  4XOT A;  2W25 A;  2M87 A;  1TW2 A;  1O3R A;  3LFK A;  5H20 A;  1P7I A;  3SDG A;  1T98 A;  4YRV A;  1UMQ A;  2Z1D A;  1D1A A;  1RNL A;  4N9I A;  2EFO A;  4EQQ A;  3OR1 C;  2R7D A;  4XRF A;  3TP3 A;  3VWB A;  1W5S A;  3LSH A;  4PJJ A;  5B1B H;  3KLN A;  2E36 A;  4E7H A;  5LRR A;  3SJM A;  3F6V A;  3OS1 A;  4N4O B;  3DLA A;  1NTC A;  2E19 A;  1MGT A;  3CCM I;  4J01 A;  2NVX J;  2EIJ H;  2EJR A;  1XG1 A;  5JVT A;  4C2M J;  5HNH A;  4LD5 A;  3KZY A;  4P9F A;  2E34 A;  3W2V A;  2GOM A;  4A93 J;  1G3S A;  2P4W A;  4YFK F;  4GGG A;  1W4M A;  1V3F A;  4PSX A;  1KA8 A;  3ABU A;  2XAH A;  1ETK A;  2WAQ N;  5F04 A;  4ENM A;  3GFM A;  4DYC A;  3RYR A;  2V1U A;  1Q1H A;  2PEX A;  3DTK A;  3H92 A;  1AKH B;  1OCZ H;  3LAP A;  3HOZ J;  1Z05 A;  1R58 A;  1VQ9 I;  3EUH C;  3HTS B;  4B47 A;  3VOE A;  5F27 A;  3H3U A;  2QF7 A;  4HV5 A;  4PZJ A;  1SVL A;  4EJV A;  4IOA F;  2ELH A;  1UHS A;  1ETO A;  2XHK A;  3JSO A;  5FRM A;  2KKO A;  2P5K A;  3OIP A;  1RI7 A;  3K1N A;  1IG7 A;  4JP0 A;  1L0O C;  4PCQ A;  2WAF A;  2XF6 A;  1P92 A;  4BE2 A;  4A3L J;  3GFJ A;  2CRG A;  4A3G J;  1WI9 A;  2HFH A;  5HS8 A;  4Y52 J;  1BBY A;  3VPR A;  2W82 A;  4M73 A;  1VQ5 I;  2VKH A;  2CUE A;  1WH7 A;  2FEZ A;  2W24 A;  1CGP A;  5LGU A;  1BW5 A;  4MHG A;  4ANJ A;  1VQ4 I;  4AVZ A;  2DA3 A;  3TGN A;  1D8K A;  2B63 J;  1FIP A;  3K2Z A;  3CLO A;  2HKO A;  4Y13 A;  3OYD A;  3B6C A;  4MEX F;  4LB6 B;  1BL0 A;  3S14 J;  4ZZL A;  2PI0 A;  1ZLK A;  2CUZ A;  4KJZ A;  3T8T A;  5ILV A;  1UZC A;  1Z0X A;  3BJA A;  5J3L A;  2HQA A;  5L3F A;  3GUD A;  2LSO A;  5ERI A;  1Z3X A;  2O0Y A;  3QPT A;  1KQ0 A;  5IT9 Z;  2DN0 A;  2O03 A;  1NH3 A;  4GDF A;  2DJI A;  5CQE A;  3IL2 A;  1G3T A;  2Z3Y A;  2JA6 J;  3CCS I;  3FMQ A;  3KZZ A;  3V42 A;  4XRS G;  4MQV A;  1SFX A;  2Q2E B;  1R36 A;  3FIW A;  3T0Y A;  2KHM A;  2JT1 A;  3I56 I;  1YO5 C;  2KT0 A;  1RC9 A;  4CCJ A;  2A3S A;  1IO2 A;  3GWZ A;  5A2Q K;  1WSU A;  4V19 K;  2E71 A;  4WXC A;  2RC4 A;  3MZY A;  1DP3 A;  1Z6R A;  3Q0V A;  5CQG A;  4UV8 A;  4BQO A;  4E4H A;  2WWY A;  2P5V A;  5LEK A;  4C30 A;  3TL4 X;  2GA1 A;  2PBI A;  5B3S H;  1MW7 A;  4Q5S F;  1F4K A;  1U6G A;  4FE7 A;  3PIP F;  2JSP A;  3WTW C;  1C0W A;  3KP7 A;  4S05 A;  1G59 A;  3CF2 A;  4UUS B;  1FEX A;  5JVG F;  4BH9 A;  2L4M A;  5IT3 A;  3L00 A;  4RB2 C;  4A0X A;  1FNN A;  2HTJ A;  3EQL F;  4XSX F;  1VQ7 I;  2OU2 A;  2I5U A;  3SYT A;  3D1N I;  2CU7 A;  3OYM A;  5L3E A;  4OAY A;  2ZKZ A;  3V7S A;  2JPC A;  3V8K A;  3ZMT A;  4DJA A;  3GYH X;  4ZDO A;  2FOK A;  4C3J J;  4FAS D;  2GBY A;  2ZXH A;  4HOB A;  2XVC A;  1O4X A;  4R1H A;  5CLS A;  4G12 A;  2HTS A;  3FKI J;  2DYR H;  2LC2 A;  4BY1 J;  1JKQ C;  4A12 A;  3PUB A;  1ZTR A;  2BZT A;  4IRH A;  4R79 A;  3JRF A;  1LVA A;  3ONQ A;  2UV1 A;  1KON A;  2O7O A;  5HOD A;  1KQ8 A;  3TO9 A;  4CGZ A;  2IAI A;  4M71 A;  2DI3 A;  4C2T A;  1OJL A;  3H5A A;  1FLI A;  1J2X A;  2ZJQ F;  3W2W A;  1Y8R B;  2DOE A;  4KIT B;  3GTL J;  2F4I A;  1VQ8 I;  5GAD J;  1I6H J;  1A35 A;  1KU9 A;  4NC6 A;  2LBF B;  1AKH A;  3JRG A;  5E3N A;  1QRY A;  2Y2Z A;  1ORK A;  4IF4 A;  4QPO A;  4NC8 A;  1XCB A;  2IA2 A;  1R23 A;  3CDI A;  4CXF A;  3CCY A;  5K5Q A;  1OQY A;  4U7B A;  2W84 A;  4IHV A;  1PP7 U;  3L2U A;  4IEJ A;  3QU6 A;  1CF7 B;  1T6S A;  4DOZ A;  1PUF B;  4EM2 A;  2K86 A;  4IHX A;  1VQ6 I;  1ZGJ A;  3BPV A;  4CYD A;  1X1A A;  4RM3 A;  2W7N A;  2E2J J;  1R49 A;  1KU2 A;  3I55 I;  3PQJ A;  2M4K A;  3QOP A;  1T39 A;  5CYV A;  3IH3 A;  2R3S A;  2VJI A;  3F72 A;  5FFZ A;  2GWR A;  3CJQ B;  2EBI A;  5AIQ A;  2DQR A;  1JE8 A;  1I3Q J;  3GTM J;  3OSG A;  5ED4 A;  1BC7 C;  1LFP A;  4A6D A;  1LDD A;  1P6R A;  2M45 A;  4XLA A;  4IKF A;  1I6X A;  2CFX A;  5FB2 A;  2CW7 A;  4J19 A;  3D5R C;  5GP9 A;  1FTZ A;  1MMN A;  4DQ2 A;  4Y3O A;  2MYS A;  1MKM A;  2YPR A;  2YSR A;  4RLQ A;  4CSW A;  4X6A J;  4AC0 A;  3PFY A;  3PFI A;  1UST A;  5HLT A;  1XS9 A;  2K3F A;  2FJ1 A;  1LDJ A;  2MA3 A;  2MGQ A;  1O3Q A;  1XCV A;  3S32 A;  3GX4 X;  2CYY A;  1XDS A;  1JTY A;  1RES A;  1OKR A;  4A3I J;  3D0S A;  5IOZ A;  3F23 A;  3IWZ A;  1RR7 A;  5BOX A;  1HF0 A;  3EYI A;  1IXR C;  4JK1 X;  1FOY A;  4BXF A;  2F5F A;  4HF0 A;  2YS9 A;  4XRS A;  4RBO A;  2ECB A;  2Q2E A;  3F8C A;  4HNV A;  1FBU A;  1ETQ A;  3H9Q A;  2L9V A;  3M8F A;  2NS8 A;  3S1Q J;  2IA0 A;  2K9L A;  1FSH A;  1OCP A;  1FP1 D;  1X2N A;  1S7O A;  2H1L A;  1R1U A;  1UJ8 A;  4NDL A;  2CUF A;  2IEK A;  4CA0 A;  1SFU A;  1WWX A;  2R4G A;  3BG6 A;  2Z16 A;  3MWM A;  3LNQ A;  2VBY A;  1IRG A;  2VOO A;  4Q48 A;  4XLF A;  1KU3 A;  3J80 K;  4GXO A;  6PAX A;  5IPA A;  1GHC A;  2M8G X;  3GXO A;  2A6T A;  2MH2 A;  1PYV A;  4RA2 A;  3VDX A;  1AU7 A;  3EUH A;  3S16 J;  3F3X A;  1EA3 A;  2OZ6 A;  3QP5 A;  4UUS A;  2BHY A;  2HKX A;  5HLI A;  3QQA A;  1UB9 A;  2ZC2 A;  4CZC A;  4Y33 A;  2DMN A;  1YW7 A;  1H9G A;  2EZK A;  4RAZ A;  2FX0 A;  4HSR A;  1T8I A;  3PO2 J;  3OYG A;  5LEJ A;  4ZC3 A;  2GXB A;  1DUX C;  3ZQG A;  3WTV C;  1X58 A;  3HL2 A;  3MFK A;  2V79 A;  3HSR A;  5B66 C;  1UCR A;  2IXS A;  5DV5 A;  1MMG A;  2XAS A;  3IV5 A;  3J81 K;  1I3A A;  2QQA A;  2KZV A;  3LSI A;  4DYQ A;  4C9Y A;  2YR2 A;  3HIF A;  4JOM A;  2Q8K A;  1E17 A;  3RKW A;  1FPQ A;  2QBY B;  3R0A A;  4I01 A;  1GT0 C;  2NVY J;  5GAG J;  2D1V A;  3FMS A;  4HRI A;  5M5W J;  3WTU C;  2OAZ A;  2OTJ I;  1BR1 A;  4GRI A;  1G6N A;  3I58 A;  1XC5 A;  2K02 A;  2JVG A;  5GAH J;  4M6Y A;  1HC8 A;  4O3M A;  2CWE A;  5HNF A;  4EAT A;  3IH4 A;  3CTA A;  2LBF A;  2A6E F;  1JTX A;  1FY7 A;  5BPI A;  2DA1 A;  3FM3 A;  3ZRG A;  4I0B A;  2Y9Z A;  1Z1D A;  2GAU A;  3SEZ A;  5JLW A;  1WKM A;  3IHU A;  4BXU A;  4Y15 A;  3BT9 A;  3CD6 I;  2F2E A;  3SHF A;  3M1C A;  5DTD A;  3M8E A;  1SFO J;  5ICG A;  3HOT A;  2R7S A;  1YYV A;  1ZGW A;  2NOG A;  2VOP A;  5CVR A;  1R71 A;  1J59 A;  2HPM A;  5IYD J;  3ZCO A;  4BJT A;  2XB5 A;  3S15 J;  1I5Z A;  3DQV C;  3QWL A;  4YII A;  4RGX A;  2XAF A;  3CQZ J;  3OYK A;  1ZK8 A;  1LJ9 A;  1D0Z A;  1SMT A;  2FE3 A;  1X3W B;  1MDM B;  2DFH A;  5FO5 A;  2C6Y A;  3Q0W A;  2FBI A;  2IS6 A;  3DXJ F;  2GQQ A;  2V1D A;  3HOV J;  4I99 C;  2LKP A;  4M9Z A;  5CPR B;  4P55 A;  1IUY A;  1EKE A;  5A2Q Z;  5H2F C;  5K7F A;  1HSJ A;  1A6I A;  4XIC A;  2ZXW H;  2M4G A;  2R5Z B;  2KJC A;  3L7W A;  1IN5 A;  4XMY A;  3MKY B;  2EV0 A;  3EUA A;  4FX4 A;  1CQT A;  3S1N J;  4FIS A;  4BAC A;  3DBH B;  4R8H A;  1XMA A;  2LP0 A;  3FF5 A;  3CUQ C;  5IT9 K;  1R00 A;  1W7P D;  1GV2 A;  4F93 B;  5LD2 C;  4HA8 A;  1D8J A;  2X1C A;  4L18 B;  5TRD A;  3S3M A;  2XAU A;  2DOD A;  2BOL A;  1WHU A;  4WWC A;  4XK4 A;  3NWS A;  1WVR A;  2KIQ A;  3GFI A;  1OR7 C;  2G7U A;  3BR6 A;  2JMW A;  4WX9 A;  3OYC A;  1WJD A;  3FX3 A;  3MCZ A;  2B9S A;  3HEF A;  1QBJ A;  2BVM A;  2VT3 A;  2V26 A;  5F64 A;  2EIL H;  2XV4 S;  3OYF A;  1B8I B;  2NNN A;  3CJN A;  1H8A C;  1VTN C;  1P4A A;  1Y6I A;  3T8R A;  2HXO A;  4Y4R A;  2LKS A;  3H5R A;  3P7N A;  2LY2 A;  2DYS H;  5AON A;  3S2D J;  5CVV A;  2QQ9 A;  3TDZ C;  2L9R A;  2Z2S B;  3HZJ A;  3ZN0 A;  3KYL A;  2HQN A;  3IKV A;  3BG9 A;  1TZL A;  5D8K B;  2DFF A;  4ZYH A;  1ZLJ A;  2CH0 A;  5ILU A;  5FD5 A;  3K6G A;  3K4B A;  1MBF A;  4YFN F;  3RIR A;  2PJP A;  1R22 A;  2GOX B;  1YS7 A;  3S2H J;  4Y17 A;  1B72 B;  2STT A;  2WA0 A;  2PLY A;  1TQI A;  2VN2 A;  4XN0 A;  1VQK I;  3OIO A;  3L2C A;  1K4T A;  3RI4 A;  2QQ8 A;  5C44 J;  5TJJ A;  1YTY A;  3G1M A;  4BJ5 C;  1KYW A;  2LF8 A;  1ZG5 A;  3HHG A;  2VBZ A;  2JA5 J;  2EV6 A;  3H35 A;  2R7Q A;  3FM5 A;  3Q3S A;  4A3D J;  3BZC A;  2X9D A;  3AAF A;  2QBY A;  3M7G A;  2LK2 A;  9ANT A;  3C7J A;  3GZN B;  3A02 A;  4DIQ A;  1ETY A;  5J4Y A;  2HVR A;  2MLG A;  4PFO A;  4V2F A;  5HDG A;  3IRQ A;  1WCM J;  4BBR J;  1Z6T A;  3PM1 A;  3PNV A;  4RGU A;  1V4R A;  4NNJ A;  3I64 A;  3OYB A;  2PMU A;  2O9L A;  1U8R A;  3A03 A;  2VKD A;  1FX7 A;  3K1M A;  4E7S A;  3ZQ7 A;  3TOB A;  3WTS C;  3ZOB A;  2BGC A;  3PSI A;  4ESB A;  3OOP A;  4EM1 A;  3KIO A;  4ASN A;  2KDZ A;  4WCG A;  2E1M B;  3ZPL A;  1U3E M;  2KIU A;  4L5I A;  4W1U A;  3S17 J;  4II2 A;  1DU0 A;  3BG7 A;  2MC4 A;  3WG9 A;  1U5T C;  2CMP A;  3GTG J;  4N4N B;  2L7M P;  1IRF A;  1Z77 A;  3MD2 A;  1RPW A;  2ZFU A;  2XGE A;  3UNG C;  2LYC A;  4LK1 F;  1X4P A;  3TW6 A;  3W3C A;  1QZZ A;  1WJB A;  1FTT A;  2FBH A;  4BDZ A;  4CCM A;  2ESN A;  1MDM A;  1YI2 I;  2IGN A;  5ICF A;  3VFZ A;  4A3C J;  4P1W A;  4B3X A;  4LK0 F;  3GF2 A;  4HG2 A;  2DAO A;  4PGH A;  1JKO C;  4B09 A;  3Q5F A;  3J7A Y;  1K6O A;  3I3L A;  1Z9C A;  4AVP A;  3E6D A;  2COM A;  3RJP A;  3FDY A;  1BC8 C;  1G3Y A;  2XDV A;  2R5Z A;  3KPH A;  1WRJ A;  4XLC A;  5LGN A;  3GME A;  3K7A J;  3KYD B;  1MBG A;  2BEO A;  5IP6 A;  2X6Y A;  2R7X A;  4C3H J;  1IGN A;  2XRO A;  2E2I J;  2XF7 A;  4RLF A;  3O6B B;  4S04 A;  3GVA A;  3ABM H;  3HB9 A;  4XM3 A;  2XAJ A;  2VUM J;  2DMQ A;  4WK8 F;  1WFX A;  3ELK A;  2BYV E;  3ZMV A;  1SAX A;  2A05 A;  1K78 B;  3NRV A;  1VFC A;  2B7E A;  3U21 A;  1HKQ A;  2FMY A;  2K9M A;  5D8L B;  4G94 A;  3F0C A;  3K4C A;  3BTL A;  3JRD A;  3AG2 H;  2ZXJ A;  1SAN A;  5EEH A;  4YG2 F;  2VE8 A;  2CW0 F;  1B8I A;  3J7A O;  2ICW G;  4HQE A;  3M4O J;  5LHG A;  5ICE A;  2L01 A;  1OYY A;  1YOV B;  2DCE A;  5K7H A;  3U1K A;  1PVE A;  3J81 Z;  4U87 A;  2EFW A;  3NWT A;  5K1Y A;  1MJA A;  3ECO A;  4E6K G;  2L0K A;  2ZME C;  3BQZ A;  5GTI C;  1S7A A;  2M3A A;  3S1M J;  3C18 A;  4ENJ A;  4L0Z B;  3BY6 A;  3KP2 A;  4Z6Y A;  4M3D A;  3CO7 C;  4IHW A;  1DPR A;  1GVD A;  2R93 J;  1B72 A;  1T33 A;  2K3P A;  3PQK A;  2JA8 J;  1IAW A;  3SFI A;  2NRA C;  1JJ8 C;  4BL0 B;  2LTP A;  1Z21 A;  4KIB A;  2LRD A;  5B5E C;  2Y69 H;  2XPV A;  2EIK H;  2V9K A;  3A01 B;  3HXL A;  1BIB A;  2F5E A;  1SFE A;  4P96 A;  4JX6 A;  3I0T A;  4G6T B;  4ENN A;  2XKP A;  1A36 A;  4S0H B;  5D6F A;  2GXA A;  3Q0U A;  2EIN H;  1IN8 A;  3A2K A;  2OBP A;  2WY7 Q;  2X51 A;  1UAA A;  4HEA 2;  3LQR A;  1W36 D;  4QPQ A;  3MEX A;  3SEQ A;  2QQB A;  4D9J A;  1Z3Y A;  4UB8 C;  4IRI A;  2K5C A;  2K4J A;  4XLH A;  2LG4 A;  3PNY A;  3OYE A;  2EZI A;  4U88 A;  3KEY A;  3BR0 A;  1MBJ A;  4EMS A;  1TW3 A;  4L0Y B;  1O3T A;  3CF5 F;  2FNA A;  3IH2 A;  3PSF A;  4FE4 A;  3RPU A;  2R5Y B;  4IOC F;  4LIU A;  1TWG J;  1YIO A;  2ZNZ A;  4GYI A;  1E3O C;  1OCR H;  2LY9 A;  1YG2 A;  4BBS J;  2CQK A;  1HQC A;  4UVB A;  2L7K A;  5EEG A;  2STW A;  1XMK A;  3COA C;  2FOW A;  3H9J A;  1E2X A;  4I02 A;  4IO9 F;  4L9J A;  2Y31 A;  4CYC B;  1ZRC A;  1D0X A;  3DBR B;  4DZJ A;  1X1C A;  3WTZ A;  5KHD A;  4I2O A;  4PJM A;  4M3B A;  2F48 A;  4P5O A;  4UV9 A;  5DD4 A;  3HTU A;  2RKH A;  3VOD A;  1ZN2 A;  3FXQ A;  4EJU A;  2ZME B;  5LGT A;  3ESW B;  4LMY A;  4OIR F;  2JPB A;  2M2E A;  3QP6 A;  2B0L A;  4ZH4 F;  3OV8 A;  4YIF A;  2VQC A;  3ML6 A;  3KP5 A;  4F92 B;  3FIS A;  4XRM A;  4HDU A;  4PJ0 C;  2YX7 A;  3E0J B;  2DK5 A;  4AIK A;  3I4P A;  3GTJ J;  2JQ7 A;  1FYK A;  1SD5 A;  3EUK L;  4BUP A;  1BOB A;  1IUF A;  1HXD A;  1O7L A;  2BE5 F;  3DKY A;  2IW5 A;  3L2R A;  3KP4 A;  4HLY A;  2DK8 A;  5DUK A;  2HZT A;  4RDU A;  2ZB9 A;  1YFH A;  3JRH A;  2EA4 A;  2DQL A;  3FXM A;  1ZYR F;  3BTJ A;  2GIZ A;  2ZCW A;  1W1W E;  1K78 A;  2DDA A;  1T0F C;  1WJE A;  3G71 I;  3CLQ A;  2QCO A;  3FXR A;  4YEJ A;  5DEQ A;  4I98 B;  1SC7 A;  1W5C C;  2UZK A;  4ZJZ A;  5FD6 A;  1ONV A;  3KCC A;  3MQ0 A;  4CHU A;  1NG7 A;  1ITY A;  1LE8 B;  2M0C A;  2DT5 A;  3V7R A;  1FOK A;  5TGT A;  3KP3 A;  4ZDL A;  4UY8 I;  1OCO H;  1SEU A;  2XSD C;  4A0Y A;  2Q1Z B;  3I4M J;  1B59 A;  4LLL A;  1ZRF A;  4HW0 A;  2L9N A;  5J1R A;  5HLH A;  3TP0 A;  2V1N A;  4MTD A;  2OCC H;  2VPL A;  4LIT A;  1SVM A;  4FQG A;  3ECH A;  4OIN F;  3I4N J;  2PX9 A;  2A5W A;  3K4J A;  2CV2 A;  2HU9 A;  3K1P A;  4MGR A;  4XKW A;  4DYR A;  4RS8 A;  3U2R A;  4ETS A;  1YJW I;  2ZFW A;  3K70 D;  3E5U A;  4D5C A;  2PJR B;  3GEZ A;  4ABZ A;  4RGR A;  3OWT A;  3ZP5 A;  1H88 C;  2DA7 A;  3VEP A;  1TL8 A;  4BDY A;  2DOA A;  2EQR A;  4U0W A;  4H4K C;  2IS1 A;  3A01 A;  1LB2 A;  2HVQ A;  4BE0 A;  4FTH A;  2HDW A;  1EH8 A;  2Z99 A;  3SDB A;  1AOY A;  1EF4 A;  2DOF A;  2L7Z A;  3QPS A;  2A5Y B;  4BQA A;  2VJJ A;  4PJN A;  4I09 A;  3QRF F;  5L3G A;  3R0J A;  3FBI B;  3LSK A;  4XOR A;  3Q9S A;  2XB0 X;  2RGV A;  1XSX A;  2P7C B;  1XGS A;  2GZW A;  4BHB A;  1F5T A;  2XF5 A;  2GLO A;  4ESF A;  4PGG A;  2O8K A;  2R7R A;  4L9V A;  1JT6 A;  3HHH A;  3MKL A;  2QZ8 A;  1I1S A;  4CIC A;  1Y0U A;  1LQ1 A;  2HOA A;  4G8X A;  5FLV A;  2MC3 A;  2DA2 A;  2DTZ A;  5LHI A;  1VND A;  3G1O A;  2E5N A;  2UXX A;  3CCR I;  3OMY A;  4E7K A;  3L1P A;  1RIO H;  2R5Y A;  3IC7 A;  3JR9 A;  2AXT C;  1QNT A;  3OIQ A;  4IHT A;  1HKT A;  2DBB A;  1JXS A;  2ADU A;  3HRS A;  1K61 A;  2X6O A;  3CCU I;  2ZJP F;  5EEA A;  3JW4 A;  4FT8 A;  3AL0 C;  2EZH A;  2WAE A;  2DO7 A;  3CUO A;  2DDB A;  1APL C;  3LA2 A;  4M6X A;  2NAZ A;  4CYC A;  1G2H A;  3BOQ A;  4J00 A;  2HNH A;  2RNJ A;  4XLN F;  3HDD A;  2JA7 J;  4NUB A;  5JHF A;  4F52 A;  2VBW A;  1DQU A;  3RKX A;  1RKT A;  4XKB A;  4JYK A;  3OYN A;  1QHG A;  3VSL A;  3MVP A;  2ZME A;  1QO0 D;  1IDZ A;  4HAM A;  2KDO A;  3K0L A;  4FET A;  3S2W A;  2WC2 A;  1D3Y A;  1U78 A;  3H5N A;  4OOI A;  4KYW A;  2BW3 B;  5B1A H;  2ECC A;  4E7L A;  5J1U A;  2O8X A;  2K40 A;  5E18 F;  3GFL A;  1Y39 A;  3L2Q A;  2ELJ A;  3J7Z I;  4E70 A;  1AHD P;  4BXX J;  4LLG F;  4KDP A;  2P81 A;  1FMV A;  4GO1 A;  1HW1 A;  1WGX A;  4ON0 A;  1BJA A;  3DTI A;  1MH3 A;  1XSV A;  2A6H F;  1RRJ A;  2QSG X;  2ISZ A;  2G7H A;  2CUJ A;  2ZSH B;  2BY3 A;  4Q47 A;  4MQ9 F;  2A68 F;  2ESH A;  3BG5 A;  3CC2 I;  5LHH A;  2YX4 A;  3WTX C;  4V2G A;  3DPU A;  4JBA A;  2DT7 B;  2Y48 A;  1TT5 B;  1MJB A;  1S3J A;  3M9A A;  3LL7 A;  5JR3 A;  4D0P A;  5CVU A;  2QA4 I;  2FA5 A;  3MAJ A;  2P6T A;  1P7J A;  5BQT A;  2HQR A;  3DLL F;  1J0R A;  1IDY A;  1HOM A;  2FML A;  3EET A;  2KZG A;  4A3F J;  2L5Q A;  4KA4 A;  1MJ9 A;  5IOY A;  4IHY A;  4HZF A;  5GTH C;  1XD7 A;  2OC6 A;  2KIF A;  2KJB A;  2M7A A;  1H89 C;  5CJ9 A;  4MTE A;  2VOD A;  3E5Q A;  2XRN A;  2LOO A;  2XGD A;  3AFH A;  3E7L A;  2P7V B;  3K10 A;  4B3A A;  3RKQ A;  2DTR A;  2KMU A;  3K4L A;  2Y30 A;  4XBF A;  5LBQ A;  5J1Y A;  4KT5 C;  1BI0 A;  2RN7 A;  1HW2 A;  4JX5 A;  3FXK A;  2KRH A;  1QPM A;  3DU6 A;  5FRO A;  5EGO B;  3FBN B;  3ZXS A;  4KNY A;  2VJ4 A;  1IW7 F;  1Q1V A;  2PJR A;  1PUE E;  2DXI A;  1OCT C;  4RB3 C;  2FSW A;  2HOS A;  4A0Z A;  3C2G A;  3RYP A;  1SAU A;  4QLC U;  1R4M B;  1BIA A;  2W85 A;  2RRE A;  4CCO A;  5JI6 A;  3R60 A;  2V6E A;  1NG6 A;  1D5V A;  4OU0 A;  3CCE I;  3V8J A;  1LFB A;  1BM9 A;  1ZH5 A;  3M8J A;  1LFU P;  1EJ9 A;  1XMX A;  1CF7 A;  2ISY A;  4CUG A;  1LUJ B;  1PUF A;  3LSR A;  3AG4 H;  2F4M B;  2P5L C;  4H0E A;  2DT6 A;  2O5R A;  1LDK B;  3LMM A;  1Y56 A;  2ZBK A;  3WU2 C;  4Q4Z F;  2HEO A;  4LLN A;  5DDG A;  3S3N A;  3HRM A;  3F8B A;  2P6S A;  4JX4 A;  2K4B A;  3NEU A;  4PFP A;  4NQW B;  3D5L A;  3SZP A;  3H1C A;  2R0Q C;  1V5E A;  4XQF A;  3DEE A;  1ZRD A;  1YIJ I;  3L09 A;  1RUO A;  2MH9 A;  2IJL A;  3JRI A;  1G4D A;  2R7T A;  2UUZ A;  1UHW A;  3GZ5 A;  3NQO A;  1OFC X;  1KQ9 A;  1DU6 A;  2YU3 A;  4RAG A;  1MNE A;  4FX0 A;  5FKK A;  2AXL A;  2OPT A;  2A69 F;  1T0F A;  1ACI A;  3BJ6 A;  2HYJ A;  2HS5 A;  4NC7 A;  3TO6 A;  2BHZ A;  5CVJ A;  1OLT A;  3TBI A;  1TWA J;  4AD9 A;  2JUC A;  5EG0 B;  2RDP A;  3VYT B;  2TRT A;  5BPD A;  4HST A;  5CKT A;  5E3O A;  2MLK A;  3P9I A;  5HLG A;  2XKO A;  1D1B A;  2KP6 A;  3HC7 A;  2CQX A;  2WAD A;  3TQN A;  3H0G J;  2PN6 A;  2XPW A;  2TDX A;  4LG3 A;  1QZE A;  2L54 A;  1BJZ A;  2X1E A;  1YW8 A;  3GLX A;  2XGC A;  1POG A;  4B44 A;  1T2K A;  4HQM A;  2BY1 A;  2FXA A;  3HG9 A;  2CO5 A;  1DGW Y;  2FBK A;  4ZZD A;  1JKP C;  1XB4 A;  3S8P A;  2DMU A;  1X19 A;  2PQ8 A;  1PDN C;  2R7U A;  1YS6 A;  2ME0 A;  1UFM A;  1VI0 A;  1ENH A;  2BW3 A;  2OF7 A;  3C2B A;  5DM7 F;  4YIR X;  3LSM A;  5J4V A;  1P9Q C;  3GBG A;  3GW2 A;  2A07 F;  1S7E A;  1TTY A;  4NB5 A;  5BMZ A;  4I0A A;  5EJC A;  2JRT A;  1BI2 A;  2BBY A;  3I53 A;  1O57 A;  1HBX G;  4BY7 J;  5FGM A;  2KIS A;  4RAY A;  4BJ6 C;  2FRH A;  4XOP A;  2VKE A;  4IL6 C;  3WGH A;  5J40 A;  3RPQ A;  2NYX A;  3ABT A;  5EYR A;  3HOY J;  1OPC A;  4BNC A;  3BG3 A;  2QGU A;  4RB0 A;  4C3I J;  3QYF A;  2I10 A;  2K27 A;  4U0V A;  4CCK A;  3QYE A;  2E1N A;  3H36 A;  4KN7 X;  3OYJ A;  2M0M A;  4HDV A;  2AS5 F;  2PFB A;  4B1R A;  1B1B A;  3ERM A;  4Z2Y A;  3WGG A;  1MND A;  2ID6 A;  2IRF G;  4KIF A;  1DP7 P;  3PJR A;  3T1B A;  3HUG B;  2Y0S A;  1W0U A;  2VBX A;  5F0H A;  3EDP A;  2RQP A;  4XON A;  4ZTJ A;  3ZN1 A;  4DGW B;  2QEX I;  5DS9 A;  1Y8Q B;  2KLO A;  2X85 A;  2A61 A;  3G2B A;  2BXZ A;  1ZAO A;  2CQ7 A;  4O5V A;  1YIT I;  2EPF A;  2DLL A;  1D0Y A;  4X0G A;  2XC7 A;  3DTE A;  3L2W A;  2JWT A;  2O3F A;  4LOC A;  2FQ4 A;  2HR3 A;  2G9W A;  2JZY A;  3FXU A;  2DA4 A;  5HS7 A;  1J75 A;  4NHJ A;  1U8B A;  1W0T A;  3NAU A;  5EGO A;  2WB1 A;  3F8F A;  1WJA A;  3CUQ B;  1DPU A;  4IXA A;  3BC8 A;  1R1T A;  2HZD A;  3B73 A;  2FD5 A;  1TNT A;  1HST A;  4XKV A;  1K7A A;  2V6C A;  1TP4 A;  3FK7 A;  1RET A;  3KZI C;  5IP7 J;  5DD8 A;  1MNM C;  3BTI A;  3T5X A;  1FMW A;  1U9N A;  4IRG A;  2HOE A;  3CJT B;  1ZHF A;  3F6O A;  3WG7 H;  2QUF A;  2H8R A;  1J9I A;  3W6K B;  4LB5 A;  1QPI A;  2DFI A;  4F7Z A;  3JRE A;  3WTY C;  2ETH A;  3PUF A;  1TC3 C;  2VQG A;  4A6E A;  4KFC A;  2AO9 A;  1V5F A;  3I59 B;  1UEL B;  1PP8 F;  4HV6 A;  4KMF A;  2E1O A;  3ZMU A;  2NVQ J;  3VB2 A;  2K85 A;  1A31 A;  5DUI A;  3CO6 C;  1UG2 A;  4UB6 C;  5C4J J;  2MAB A;  3E97 A;  2AHQ A;  2IBD A;  1QVT A;  1U0J A;  3KX2 A;  4PUS A;  1J09 A;  4HX7 A;  4M9X A;  4NQW A;  1Y1W J;  3F21 A;  3ZMD A;  3B6A A;  2HGC A;  2W48 A;  3ABL H;  1IV8 A;  2E60 A;  1IXC A;  2VC1 A;  3PNT A;  1HKS A;  1AWC A;  5E17 F;  3CDH A;  3K2A A;  2R7F A;  5J47 A;  2VXD A;  1JJ6 C;  2LDU A;  1JI8 A;  2JVH A;  3OOU A;  5KAI C;  2KRC A;  3DV8 A;  4EEF G;  5AIP A;  1NK3 P;  5F1R A;  1IN4 A;  2CV0 A;  4YEL A;  4A69 C;  4HF1 A;  4E7Z A;  3MMY B;  1WZ2 A;  4BS9 A;  1YLF A;  4CDG A;  1YE9 A;  5EG0 A;  2XGX A;  4XKC A;  3H3Z A;  1REP C;  3DF8 A;  3FK6 A;  3WGI A;  2CGP A;  2Z5U A;  1YRN B;  1E0E A;  4AUX A;  1QU3 A;  2KFD A;  2HI3 A;  3TOA A;  4X1E A;  3HSE A;  2P8T A;  1MBE A;  3K9T A;  5E1Z B;  4W97 A;  1G8X A;  2L9S A;  3J7Y J;  2F5V A;  4RMN A;  3P9K A;  2O61 A;  4MNU A;  2Y0S N;  1S29 A;  2DA5 A;  2COB A;  2V9P A;  1ULY A;  2VIX A;  2HYG D;  1ZRE A;  2H1K A;  3E6B A;  2QEN A;  3KFW X;  2GXG A;  5D4S A;  1S6L A;  1WI3 A;  2QLZ A;  3P5J A;  1R4N B;  5H6Q A;  4XSZ F;  5E1W A;  1B6A A;  2MW8 A;  2HWV A;  1ERD A;  3KYC B;  4HNT A;  2LF7 A;  2QSF X;  4N9H A;  5D5X B;  1VQN I;  1FBQ A;  1R1V A;  3CZ6 A;  3BPX A;  4O6J A;  5FLM J;  3N97 A;  1DDN A;  1U9O A;  2WB1 N;  2EFN A;  5KK1 A;  1XSD A;  1LKX A;  4A5N A;  2L3D A;  3MZH A;  1S8N A;  3LA7 A;  3ASN H;  3RQ4 A;  3FHZ A;  2PMZ A;  3BR2 A;  4HF2 A;  1EH7 A;  1F9N A;  3DKX A;  1BW6 A;  4A3B J;  1U5T B;  2HDD A;  2IS2 A;  3IUO A;  4XID A;  3FXO A;  3S3O A;  3HUG A;  3UKG A;  3HJE A;  2DPD A;  2VPR A;  5L3C A;  1PJR A;  1Z7L A;  1K6Y A;  1VF9 A;  3CC7 I;  1MZB A;  2K9Q A;  4PK4 A;  2K9N A;  2FU4 A;  3BTC A;  1VQM I;  4WXD A;  2XSJ C;  1X1B A;  3JTH A;  3K69 A;  3JRB A;  1R9T J;  2OUM A;  3BJO A;  4HNU A;  1IRZ A;  1KZH A;  1XGM A;  3EYY A;  3M1E A;  2EFQ A;  1K79 A;  1E3H A;  1N25 A;  1B9N A;  5M5Y J;  5F0C A;  1F43 A;  3CME I;  5DYM A;  2LNB A;  4HX4 A;  4ESJ A;  4OIQ F;  2IS4 A;  3CUQ A;  3HPH A;  2JJ7 A;  1TQP A;  3CC4 I;  5IY5 H;  4WF2 A;  1JGG A;  2VL8 A;  1KGS A;  2LKX A;  4E7I A;  3ZQC A;  2UXN A;  3CDL A;  4NBQ A;  3DU5 A;  2KQR A;  3GTO J;  4M9S A;  5EZH A;  1J5Y A;  4LG0 B;  2CJJ A;  2CFO A;  2Y0M A;  4PJL A;  4IQJ A;  1OR7 A;  3HGG A;  2ZXI A;  2CG4 A;  3HYI A;  1V55 H;  3V7C A;  1IJW C;  1WH5 A;  3I59 A;  4IHS A;  1HW5 A;  3JRC A;  3E1S A;  3G4S I;  3ZQQ A;  4EGZ A;  1A6Q A;  3H3V K;  3VYS B;  5H6R A;  4ZDP A;  2WV1 A;  3DPT A;  1ZR4 A;  2DPU A;  3X2Q H;  4YFX F;  3FXL A;  4ZYD A;  4BU2 A;  2NVT J;  1B9M A;  2AQF A;  3QAH A;  2VXZ A;  4A3E J;  1TQM A;  3DPL C;  2ZSI B;  4QWQ A;  3IWF A;  4DZP A;  1FYM A;  1MMS A;  3U9G A;  2ZJR F;  2CS3 A;  4CO8 A;  5E3M A;  2F4O B;  1YW9 A;  4A3M J;  3RTR A;  4ZTF A;  4DBQ A;  1N77 A;  3ZGK A;  2W1O A;  2DFE A;  2KRF A;  1HCR A;  3CCQ I;  2YUS A;  3ABK H;  1MSE C;  2VI6 A;  2HVS A;  3V4G A;  2D45 A;  1YRN A;  1YX5 A;  2ZNY A;  3E6C C;  1S5L C;  3BZK A;  3RZD J;  2PMZ N;  4EJO A;  1SFK A;  5F1J A;  3DWL E;  3JAM K;  1W5T A;  2M34 A;  3TMO A;  2HOT A;  2IPQ X;  3L9F A;  3IAS 2;  3WU1 B;  1JT0 A;  3HGY A;  4OIO F;  1QA6 A;  3BR5 A;  4HPQ A;  1GXQ A;  2D2W A;  1VQL I;  4L9T A;  4ZYG A;  3SXY A;  3CCJ I;  4BHP A;  3LSG A;  1SMY F;  3O8G A;  2KPM A;  3OY9 A;  4ZYE A;  3JCU C;  2M7B A;  4I6Z A;  3RPU D;  2PMH A;  2QM3 A;  5KNL A;  3GTP J;  3GTK J;  3W6J B;  3LWF A;  2HXI A;  1XDU A;  4RAF A;  1FC3 A;  3HOS A;  1ZAR A;  3OR2 C;  3S1R J;  1WJF A;  4BGD A;  2EK5 A;  5ILS A;  4L5E A;  2R92 J;  3ZQL A;  2OV7 A;  3BR1 A;  1F36 A;  5HDN A;  3BDD A;  4AYB A;  1X4O A;  3A1Y A;  1JHF A;  3V8L A;  2EH3 A;  4C2U A;  1WJC A;  2RQQ A;  5JHU A;  4KIG A;  2JRM A;  2R7O A;  3E3V A;  3UR3 C;  4LGW A;  3IKT A;  1IZ1 A;  2WBM A;  1IN6 A;  1S72 I;  2JN6 A;  2KL4 A;  2LVS A;  2PG4 A;  4LJZ F;  4B48 A;  1U5T A;  4AM3 A;  1YHQ I;  1ETW A;  2QVO A;  2GIV A;  1XX5 A;  4DNC A;  3RDI A;  3KEO A;  1ETX A;  3M3Y J;  3LST A;  1YJ9 I;  3ZR8 X;  2BY2 A;  4MLO A;  1YJN I;  4KIS A;  3M07 A;  4G9Y A;  3PIO F;  1W7P B;  2D5V A;  3N4M A;  4EVI A;  2NVU B;  5HVQ C;  4HLX A;  2Z33 A;  3TW7 A;  2E35 A;  3CCV I;  3EPZ A;  3QPL A;  2MG4 A;  3O8H A;  5F08 A;  3LSP A;  5D4R A;  2QYO A;  2G0E A;  2M9H A;  3WHB A;  4AWX B;  4OAZ A;  1Z7U A;  3TED A;  2E1C A;  4M72 A;  1QQI A;  2OQR A;  3F22 A;  1ON2 A;  5K7Z A;  3DKW A;  2EFP A;  2L4A A;  1MBK A;  3AKZ A;  4M3G A;  1LNW A;  3BCA A;  5J8C A;  3DBL B;  2ID3 A;  3CES A;  2VON A;  1BR4 A;  1MIJ A;  2XPU A;  3G73 A;  2Y9Y A;  2X6W A;  5BS6 A;  5HOO A;  4L5J A;  4UVA A;  4BEH B;  3IAM 2;  4KN4 X;  2H27 A;  1T95 A;  4LG0 A;  4D1Q A;  2X48 A;  1FZP B;  3E5X A;  3I71 A;  3ISP A;  4G6D A;  4IPA A;  3SFZ A;  1IV6 A;  1I50 J;  1MH4 A;  2WY8 Q;  3OL3 A;  4II3 A;  3RCO A;  5J6X A;  1HA8 A;  5LLQ A;  1RR8 C;  1I27 A;  2DU9 A;  2EWN A;  2AQE A;  1QZY A;  3WE2 A;  5FKO A;  2ZO4 A;  5DCF A;  2Q0O A;  3REO A;  3KE2 A;  5FLX Z;  1N78 A;  2IVM A;  4RGS A;  3AG3 H;  3S93 A;  4CH7 A;  5F0F A;  3VYR B;  2E2H J;  1ZR2 A;  3OYI A;  2LH9 A;  1RKW A;  2LFB A;  4M3E A;  2XUB A;  2XIG A;  2VKV A;  1Z67 A;  2QKL B;  1MD0 A;  3I9V 2;  4G7H F;  1JGS A;  4MO7 A;  1MSF C;  4IQ4 A;  2BVL A;  4LIV A;  1ZQ3 P;  1BOA A;  2LR8 A;  1SD7 A;  3A0B C;  4KUM A;  2L02 A;  1S9H A;  3SZT A;  4KIC A;  2YU9 J;  3BQY A;  4XLP F;  2J5P A;  3HPG A;  4OWR B;  1R5I D;  1E3P A;  4EGY A;  1T08 B;  3MN2 A;  2E5Z A;  3HOW J;  2FNP A;  3A0H C;  4BYY A;  4Y7N J;  2EB7 A;  2VQH A;  1XGN A;  3OS0 A;  2X6X A;  3R4K A;  3OYA A;  4AYB N;  5D5V B;  4HBL A;  5D5W B;  1WQ2 A;  3LOC A;  3MKW B;  3C1D A;  2V9V A;  1KU7 A;  1T56 A;  3BRO A;  2EV5 A;  1B4A A;  3W2A A;  4JQF A;  2M1B A;  2M30 A;  3E6M A;  2H09 A;  1QGP A;  3R61 A;  3TKY A;  5IYB J;  1TLH B;  4FHT A;  1BI1 A;  2V4J C;  3WOD F;  5M3M J;  2W57 A;  1YX3 A;  3PO3 J;  3LAJ A;  3K4K A;  4M3F A;  2JSC A;  1X3Z B;  3W6V A;  1M1E B;  1J7K A;  4PDK A;  3FMR A;  2R7V A;  2IGK A;  4N0B A;  5C4X J;  3R6S A;  1ZG1 A;  1LE8 A;  5GPC A;  4GYG A;  3VSK A;  2GM4 A;  3I54 A;  5L3D A;  1GVJ A;  2K9S A;  2X1D A;  5E20 A;  2ME6 A;  3GCM A;  2VC0 A;  3CP8 A;  3WTT C;  1P4X A;  1X1D A;  3QOD A;  5FRN A;  2MBF A;  1FOW A;  4AIH A;  1P2F A;  5EDN A;  1ZGA A;  2XRL A;  3AL0 B;  3GTQ J;  1LVK A;  3MZ8 A;  3ERE D;  1A04 A;  3DEU A;  3O2P E;  4RM2 A;  1W36 C;  2MD0 A;  2CQN A;  3N05 A;  2BV6 A;  1H0M A;  5D6E A;  4U0Y A;  1SVO A;  1K83 J;  2LLK A;  3NAR A;  1K4S A;  3H0D A;  1JHH A;  3FWE A;  1JUS A;  4A5M A;  2RVC A;  1W7P A;  3HOX J;  1OYW A;  4XR6 A;  3LQQ A;  1U2W A;  1NHA A;  1BA5 A;  1MBH A;  2GA2 A;  2E7W A;  4KMU X;  4WXH A;  3F8M A;  5FFX A;  3DP7 A;  2JUG A;  4IVN A;  2JK3 A;  1TNS A;  1FT9 A;  4XL9 A;  4ENK A;  2OD5 A;  5EZG A;  3HM5 A;  3CP2 A;  4OMY A;  4G7Z F;  3D5S C;  2VAS A;  1XN7 A;  1FBS A;  1ZG3 A;  2EIM H;  3GLL A;  4QTR A;  2F5C A;  2W4S A;  2MFZ A;  4MFD A;  2OQG A;  1FWZ A;  1RZ4 A;  2DMP A;  2IGM A;  2RNG A;  4AID A;  5C3E J;  4FCY A;  1OCC H;  1GV5 A;  2KIM A;  5K5O A;  3A4C A;  5TIS C;  1FYL A;  4B8X A;  4A3K J;  4HX8 A;  3TDU C;  3ZMZ A;  3CCL I;  2CV1 A;  1FIA A;  1UG0 A;  4BKX A;  4I76 A;  2EZL A;  5M5X J;  3O3K A;  4BEH A;  1MMD A;  1HDD C;  4CCL A;  1TWC J;  3G3Z A;  4BAY A;  2DMT A;  2Z9O A;  1F1Z A;  2MD5 A;  2I8D A;  4ITV A;  2LY1 A;  2UWM A;  5M3F J;  3BCB A;  3B02 A;  4B4C A;  5FKL A;  2NS0 A;  5E3L A;  1STZ A;  3PL8 A;  1R6R A;  4MEY F;  2IA1 A;  2XAG A;  3QPH A;  1OMI A;  1L3L A;  5FJ8 J;  2OZU A;  1BN5 A;  4TV7 A;  2VLA A;  2RV8 A;  3LFU A;  5J8F A;  3FKJ A;  2QSH X;  2X0L A;  2F5D A;  1X1P A;  3K4M A;  2VJ5 A;  3HOU J;  3FZV A;  2N8G A;  4QSH A;  3L2V A;  4XLE A;  5EF6 A;  3JAM Z;  2LMD A;  1AA7 A;  4MFE A;  1HLV A;  1YQA A;  3ZQF A;  3QU3 A;  3CMM A;  3QOE A;  3ZMS A;  4IX7 A;  1FJL A;  2BXY A;  1LPQ A;  2H94 A;  3RKY A;  3P9C A;  3JTG A;  1G3W A;  1JKR C;  4LFU A;  2K7L A;  3KEQ A;  4GFB A;  1Y0N A;  5FKN A;  5DCM B;  2QWW A;  2WV0 A;  4D5F A;  1QVU A;  4XNF A;  2ZJ2 A;  3SQN A;  1USS A;  5JLX A;  2NOJ B;  1R5G A;  2JTV A;  5KCM A;  4EJT A;  3MKZ A;  2XAQ A;  3BZ6 A;  5E8G A;  2M5W A;  4F55 A;  3HKZ A;  3ZQI A;  4ZYA A;  3HRU A;  2Y75 A;  2E1M C;  4G7O F;  2QKM B;  1WJ5 A;  1HDP A;  1P4W A;  1WPK A;  2F6C A;  4UHT A;  4HYE A;  3JSP A;  4K2E A;  5BNG A;  3BWG A;  1OIS A;  4D7N A;  3ZQH A;  3CMY A;  3C3W A;  2VE9 A;  3DCF A;  2V1X A;  2CQQ A;  1FOX A;  4A2U A;  2OTL I;  3FXJ A;  5F6F A;  3CJR B;  5K5R A;  1D1C A;  5KVR A;  1VQO I;  3IRR A;  1ETV A;  4F91 B;  1EV7 A;  2MSY A;  3K70 C;  1VQP I;  3KLO A;  3SZG A;  2WTE A;  3RZO J;  3RSN A;  5ICC A;  2RAE A;  2P0W A;  4UNO A;  1ON1 A;  5HS9 A;  1LEA A;  1ZKG A;  4B43 A;  3LSJ A;  5KAF C;  5E79 C;  1JUP A;  5JFR A;  1VZ0 A;  2EA2 A;  1XTA A;  1V5G A;  3WE3 A;  2D1H A;  2HDC A;  4D7M A;  5L3B A;  4UVC A;  3KP6 A;  1X2M A;  4L9N A;  5LFA A;  4CZZ A;  1XPX A;  2X4H A;  5IYC J;  4UXN A;  1NK2 P;  2VB6 A;  2CSO A;  2HPI A;  1TWF J;  4F3Q A;  5DM6 F;  1IXS B;  2FUG 2;  5CVI A;  1SD6 A;  4OIP F;  3OYL A;  1JUM A;  3RQI A;  4MIM A;  1I39 A;  2J5O A;  1X3U A;  4A3J J;  1GUU A;  2DA6 A;  4RB1 A;  5E8I A;  2FQ3 A;  2OCE A;  3Q9V A;  1IN7 A;  2OJE D;  2ELK A;  3G1L A;  3TO7 A;  3I5U A;  2ACJ A;  3ULQ B; 
#chains in the Genus database with same CATH homology
 2L7F P;  2DA1 A;  2HQ5 A;  1JGG A;  2GLO A;  3OSF A;  2LKX A;  2O8K A;  2LD5 A;  3ZQC A;  4M6V A;  1JT6 A;  3MKL A;  3CDL A;  2Y9Z A;  3GTO J;  5EZH A;  2HOA A;  5JLW A;  2CJJ A;  5FLV A;  3BT9 A;  2DA2 A;  2TCT A;  3BR3 A;  3HGG A;  5FKM A;  5DTD A;  1SFO J;  2DTZ A;  1VND A;  3G1O A;  1IJW C;  1ZGW A;  2NOG A;  1WH5 A;  5IYD J;  3L1P A;  2R5Y A;  5GPA A;  2XB5 A;  3JR9 A;  3S15 J;  3JRC A;  3CQZ J;  1GDT A;  1ZK8 A;  1K61 A;  4QIW N;  2X6O A;  3H3V K;  5EEA A;  3HBL A;  2WV1 A;  2EZH A;  1ZR4 A;  3Q0W A;  1APL C;  2NVT J;  3HOV J;  4CYC A;  3WHC A;  2NS7 A;  1G2H A;  3HDD A;  4A3E J;  2JA7 J;  4DZP A;  5K7F A;  4DW6 A;  1A6I A;  3HKZ N;  3JRA A;  4XIC A;  1RKT A;  2R5Z B;  5IP9 J;  1CQT A;  4JYK A;  4UUT A;  3S1N J;  4FIS A;  4A3M J;  3MVP A;  1IDZ A;  2LP0 A;  1A5J A;  1U78 A;  1HCR A;  2YUS A;  1MSE C;  1GV2 A;  2VI6 A;  2ECC A;  5J1U A;  1YRN A;  2K40 A;  2DJN A;  1D5Y A;  4XK4 A;  1AHD P;  4BXX J;  2P81 A;  3RZD J;  2PMZ N;  1TWH J;  3BR6 A;  1IC8 A;  1WGX A;  2JMW A;  5F1J A;  2R7Z J;  2M34 A;  2HOT A;  1MH3 A;  3HEF A;  1JT0 A;  3DEW A;  3HGY A;  1Y1V J;  3BR5 A;  3BG5 A;  1B8I B;  1P7I A;  3LSG A;  4V2G A;  3SDG A;  3O8G A;  1H8A C;  1UMQ A;  4I6Z A;  2HXO A;  3GTP J;  3S2D J;  3GTK J;  3TP3 A;  2HXI A;  2L9R A;  3S1R J;  1P7J A;  3SJM A;  1IDY A;  4L5E A;  2R92 J;  3BG9 A;  3ZQL A;  3BR1 A;  1HOM A;  1F36 A;  1NTC A;  2E19 A;  2NVX J;  4A3F J;  1XG1 A;  5IOY A;  4IHY A;  4C2M J;  1MBF A;  2EH3 A;  3S2H J;  1H89 C;  1B72 B;  4A93 J;  3OIO A;  2JN6 A;  2LVS A;  2XGD A;  4B3A A;  3E7L A;  3RKQ A;  2Y30 A;  5J1Y A;  5C44 J;  1ETW A;  3G1M A;  1ETX A;  4JX5 A;  3M3Y J;  1ETK A;  2WAQ N;  4MLO A;  5F04 A;  2D5V A;  4DYC A;  5EGO B;  2JA5 J;  3Q3S A;  4A3D J;  2X9D A;  3TW7 A;  1AKH B;  3QPL A;  2MG4 A;  2LK2 A;  3O8H A;  5F08 A;  3LSP A;  1Q1V A;  9ANT A;  3HOZ J;  2G0E A;  2M9H A;  3A02 A;  3WHB A;  1OCT C;  2HOS A;  1ETY A;  3TED A;  4V2F A;  5F27 A;  2QF7 A;  1WCM J;  4BBR J;  5K7Z A;  3PM1 A;  1UHS A;  1ETO A;  2O9L A;  1LFB A;  3A03 A;  1MBK A;  1LFU P;  4M3G A;  1IG7 A;  4JP0 A;  4A3L J;  2ID3 A;  3ZOB A;  1PUF A;  2CRG A;  2XPU A;  3LSR A;  4A3G J;  2Y9Y A;  4Y52 J;  3VPR A;  2KDZ A;  2X48 A;  2CUE A;  1WH7 A;  4JX4 A;  1IV6 A;  1I50 J;  1MH4 A;  1BW5 A;  2R0Q C;  2DA3 A;  4W1U A;  3S17 J;  3JRI A;  1DU0 A;  2B63 J;  1FIP A;  5FKO A;  3GTG J;  1OFC X;  1DU6 A;  3B6C A;  2L7M P;  1Z77 A;  1BL0 A;  5FKK A;  3S14 J;  1RPW A;  2OPT A;  2XGE A;  5F0F A;  2HYJ A;  3TW6 A;  1FTT A;  2E2H J;  1Z0X A;  1ZR2 A;  5J3L A;  1RKW A;  2LFB A;  4M3E A;  1TWA J;  5EG0 B;  2VKV A;  4A3C J;  2DN0 A;  2TRT A;  5E3O A;  4MO7 A;  1MSF C;  1JKO C;  2JA6 J;  1ZQ3 P;  2LR8 A;  2CQX A;  3H0G J;  2XPW A;  4XRS G;  2YU9 J;  3BQY A;  1BJZ A;  3FIW A;  2R5Z A;  2XGC A;  1POG A;  2KT0 A;  3MN2 A;  3HOW J;  3K7A J;  1JKP C;  1MBG A;  4Y7N J;  5IP6 A;  2DMU A;  4C3H J;  1IGN A;  4AYB N;  2ME0 A;  2E2I J;  3Q0V A;  1VI0 A;  1ENH A;  2OF7 A;  3C2B A;  3LOC A;  3GBG A;  1S7E A;  1T56 A;  3HB9 A;  2VUM J;  2DMQ A;  4FE7 A;  1VFC A;  5IYB J;  4BY7 J;  3F0C A;  2VKE A;  3BTL A;  5M3M J;  4UUS B;  3JRD A;  1FEX A;  1SAN A;  3PO3 J;  5EYR A;  4M3F A;  3HOY J;  1B8I A;  3BG3 A;  3W6V A;  3M4O J;  4C3I J;  2I10 A;  5C4X J;  5K7H A;  3D1N I;  2CU7 A;  1LE8 A;  5GPC A;  4B1R A;  2GM4 A;  2ID6 A;  2L0K A;  2K9S A;  3BQZ A;  4C3J J;  2GBY A;  3S1M J;  2ME6 A;  1W0U A;  1O4X A;  4M3D A;  4G12 A;  4IHW A;  3FKI J;  5F0H A;  5EDN A;  2XRL A;  3GTQ J;  4BY1 J;  1JKQ C;  1GVD A;  5DS9 A;  2R93 J;  1ZTR A;  1B72 A;  1T33 A;  2JA8 J;  3JRF A;  3SFI A;  1JJ8 C;  2LTP A;  2O7O A;  5HOD A;  2IAI A;  1K83 J;  1OJL A;  2XPV A;  2LLK A;  2JWT A;  4LOC A;  3A01 B;  2FQ4 A;  3NAR A;  2DA4 A;  4JX6 A;  1JUS A;  1U8B A;  1W0T A;  3NAU A;  3GTL J;  5EGO A;  3HOX J;  4S0H B;  3Q0U A;  1I6H J;  1BA5 A;  1AKH A;  1MBH A;  3JRG A;  5E3N A;  1QRY A;  2Y2Z A;  1ORK A;  2FD5 A;  2JK3 A;  3FK7 A;  1RET A;  3CCY A;  5EZG A;  5IP7 J;  3HM5 A;  3BTI A;  1MNM C;  1U9N A;  2H8R A;  4QTR A;  1QPI A;  2EZI A;  4IHV A;  3JRE A;  4MFD A;  4IEJ A;  1MBJ A;  3BR0 A;  1TC3 C;  2DMP A;  1PUF B;  2AO9 A;  5C3E J;  4FCY A;  4IHX A;  1GV5 A;  2NVQ J;  2E1O A;  3IH2 A;  2R5Y B;  4FE4 A;  4A3K J;  2E2J J;  1TWG J;  1FIA A;  4BKX A;  4I76 A;  2EZL A;  1E3O C;  1UG2 A;  5M5X J;  5C4J J;  3IH3 A;  2LY9 A;  4BBS J;  2AHQ A;  1HDD C;  2EBI A;  1TWC J;  2IBD A;  2DMT A;  1QVT A;  1Y1W J;  1I3Q J;  3GTM J;  3OSG A;  3B6A A;  2W48 A;  5M3F J;  4B4C A;  2Y31 A;  4CYC B;  5FKL A;  5E3L A;  4DZJ A;  3K2A A;  5FJ8 J;  4J19 A;  1JJ6 C;  5GP9 A;  4M3B A;  1FTZ A;  4X6A J;  4AC0 A;  3OOU A;  4EEF G;  1NK3 P;  1XS9 A;  3HOU J;  2FJ1 A;  4A69 C;  2M2E A;  2MGQ A;  2N8G A;  5EG0 A;  4QSH A;  1JTY A;  1RES A;  5EF6 A;  3FIS A;  4XRM A;  4A3I J;  3FK6 A;  4MFE A;  5IOZ A;  1HLV A;  1RR7 A;  3ZQF A;  1HF0 A;  1YRN B;  4AUX A;  1FJL A;  2HI3 A;  4XRS A;  2YS9 A;  4X1E A;  4RBO A;  2ECB A;  3GTJ J;  1JKR C;  4GFB A;  1MBE A;  4HNV A;  5FKN A;  1ETQ A;  1IUF A;  2NS8 A;  4W97 A;  3S1Q J;  4D5F A;  1QVU A;  1OCP A;  5JLX A;  2Y0S N;  1X2N A;  2DA5 A;  4NDL A;  2COB A;  2CUF A;  2IEK A;  2ZB9 A;  4RDU A;  3JRH A;  3LNQ A;  2H1K A;  3BTJ A;  3ZQI A;  5IPA A;  1HDP A;  2M8G X;  1WI3 A;  1WPK A;  1AU7 A;  5BNG A;  2QCO A;  3S16 J;  2MW8 A;  4D7N A;  3ZQH A;  3CMY A;  4UUS A;  3DCF A;  2CQQ A;  3QQA A;  2DMN A;  2EZK A;  5FLM J;  1ITY A;  1LE8 B;  2M0C A;  2FX0 A;  1ETV A;  1U9O A;  2WB1 N;  3PO2 J;  2MSY A;  2XSD C;  3RZO J;  3BR2 A;  3I4M J;  2RAE A;  1BW6 A;  3ZQG A;  4A3B J;  1ZKG A;  1X58 A;  2HDD A;  3LSJ A;  5J1R A;  4XID A;  1JUP A;  3TP0 A;  3UKG A;  2VPR A;  3IV5 A;  4D7M A;  4DYQ A;  1VF9 A;  3I4N J;  1X2M A;  2K9Q A;  4DYR A;  5IYC J;  2K9N A;  1NK2 P;  3BTC A;  1GT0 C;  2NVY J;  1TWF J;  4D5C A;  4ABZ A;  3JRB A;  5M5W J;  1H88 C;  1R9T J;  1JUM A;  2DA7 A;  3RQI A;  1IRZ A;  4MIM A;  2EQR A;  1XC5 A;  3A01 A;  4A3J J;  1GUU A;  2DA6 A;  5M5Y J;  4FTH A;  5F0C A;  1EF4 A;  2L7Z A;  3QPS A;  1F43 A;  2ELK A;  3G1L A;  3IH4 A;  2XB0 X;  2JJ7 A;  5E3M A;  1JTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...