2DJNA

The solution structure of the homeobox domain of human homeobox protein dlx-5
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
GSSGSSGRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Homeobox protein DLX-5
publication title The solution structure of the homeobox domain of human Homeobox protein DLX-5
rcsb
source organism Homo sapiens
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2djnA01
2XSDC 4A3FJ 1U9NA 3H3VK 1ZQ3P 4UUSB 1X58A 2XPUA 4Y52J 3JRFA 1IDYA 3TW7A 4FE4A 3BR1A 1ETVA 1EF4A 2ME6A 4BY7J 3TEDA 2ECBA 3I4MJ 1MNMC 1B8IB 2W48A 1MSEC 3ZQFA 5F1JA 1H8AC 4M3GA 4RDUA 2DA4A 1LFBA 1MBHA 3FIWA 1ZTRA 3M4OJ 4XK4A 3G1MA 2R5ZB 5C4JJ 1B8IA 3WHBA 3BQZA 2XGDA 2L9RA 4I6ZA 1JJ8C 2GM4A 1ETYA 3HOUJ 3W6VA 5FKNA 1FTZA 4A3DJ 2HI3A 4IHYA 1OCPA 3QPLA 3RZDJ 2R5ZA 3K7AJ 1X2NA 2H1KA 3SDGA 2O7OA 5J1UA 4A3JJ 3CDLA 4G12A 1MH3A 4D5FA 4DZJA 2K9NA 4S0HB 3S16J 5E3LA 1UG2A 3VPRA 1ZGWA 3JRGA 3Q0UA 2NVQJ 1UHSA 4V2FA 1K83J 3BT9A 5J3LA 1ITYA 1I3QJ 5IP9J 3JRIA 1NK3P 2EQRA 3LOCA 1ETXA 2L7ZA 5IYCJ 5M3FJ 2XGEA 2X6OA 2Y9YA 1H89C 2DA2A 3ZOBA 2VI6A 4B3AA 3JRBA 1IGNA 1WH7A 2VUMJ 5DTDA 1GDTA 4FISA 3S1QJ 4FTHA 4MFEA 1HLVA 1WPKA 2VPRA 1FJLA 1JKPC 1E3OC 2B63J 4EEFG 4B1RA 5HODA 3CCYA 2HOTA 2NVXJ 3IV5A 1BW5A 2CUEA 2YUSA 4IHXA 5C44J 1JT6A 1XC5A 4LOCA 1ETQA 1QVUA 2KDZA 2XRLA 1JKQC 3GBGA 1I50J 4IEJA 3JRCA 3HGGA 4A3BJ 5E3OA 4MLOA 3BQYA 1S7EA 2LP0A 2DA6A 2EBIA 3IH3A 1TC3C 4XICA 3TP3A 3CMYA 2WV1A 1WI3A 3A01B 1IDZA 3LSRA 1OCTC 4JX4A 3JREA 5BNGA 3JRHA 1WGXA 3BR5A 1ETKA 5F0HA 1VNDA 5E3NA 3O8HA 3A01A 1YRNB 3OSFA 4Y7NJ 2FQ4A 2M0CA 5GPCA 2ID6A 2EZHA 3BTLA 1HCRA 2Y2ZA 1VI0A 2QF7A 4ABZA 4X1EA 2HOAA 2FD5A 4M3FA 1T33A 1A6IA 1JT0A 2N8GA 3MN2A 1YRNA 2H8RA 1WH5A 2FJ1A 4GFBA 9ANTA 1BL0A 3S1MJ 2AHQA 2WB1N 5FKLA 1HDDC 3GTLJ 2P81A 1NTCA 1FIAA 2EH3A 1P7IA 1JTXA 1U78A 4D7MA 2L7MP 5EZHA 1BJZA 4UUSA 3BR3A 5EYRA 3WHCA 5EDNA 3RZOJ 2NVTJ 4A3GJ 2CUFA 4MO7A 2QCOA 1NK2P 3F0CA 1JUPA 4QTRA 4BBSJ 1F36A 1GV5A 5C3EJ 5M5XJ 3ZQLA 5J1YA 1FTTA 1RKTA 5IYBJ 4AUXA 2LD5A 3OIOA 4RBOA 1Z0XA 2M9HA 2Y31A 1HDPA 1OJLA 2CQQA 5FKOA 2JK3A 2D5VA 3H0GJ 1AU7A 2E2JJ 1UMQA 2HXOA 3GTKJ 3IH4A 1ZR2A 2DN0A 4NDLA 2JWTA 4DYQA 2Y30A 3TP0A 2R93J 4XIDA 5K7ZA 2I10A 2NS7A 2K9SA 2Y0SN 1TWFJ 1QRYA 5EEAA 3SFIA 3MKLA 4JX6A 4FCYA 1IUFA 2M8GX 4M3DA 1D5YA 1IJWC 2ZB9A 4JYKA 5IP6A 1I6HJ 4XRMA 5EF6A 4IHVA 2OF7A 3M3YJ 2O8KA 2JN6A 2JA6J 4A3IJ 1H88C 5DS9A 1HF0A 2ELKA 2Y9ZA 4C3JJ 3LSPA 3HOZJ 2DA5A 2XB5A 5M5YJ 2MG4A 2X9DA 1A5JA 1F43A 2XGCA 4I76A 1U8BA 1DU0A 1T56A 3A03A 1AHDP 4DYRA 4A3LJ 2CU7A 2E1OA 3G1OA 2AO9A 5FLMJ 5K7FA 1MBEA 3PM1A 1U9OA 1TWHJ 1MBGA 1IC8A 3GTQJ 1IG7A 3S17J 1TWCJ 3Q0VA 2M2EA 3HOXJ 4BXXJ 2XPVA 1VF9A 4DYCA 4W97A 2DMQA 5IOYA 2CQXA 3BG3A 2DMPA 3UKGA 1VFCA 2COBA 4JX5A 1X2MA 3Q0WA 5F0FA 5FJ8J 2ECCA 1DU6A 1QPIA 4A69C 1W0UA 5E3MA 2JA7J 2HDDA 2KT0A 5FLVA 2LR8A 2ID3A 4D7NA 1RR7A 2LVSA 4CYCB 2DA1A 1MSFC 3TW6A 4UUTA 1POGA 5IPAA 1RPWA 5FKKA 3FISA 4AYBN 4A3KJ 2E19A 4BY1J 3NAUA 1FIPA 3I4NJ 1IV6A 4C3IJ 4CYCA 1GVDA 2R5YB 2LK2A 4DW6A 1Q1VA 2DMTA 3FKIJ 4BKXA 3GTGJ 2GBYA 1R9TJ 2K9QA 1TWAJ 4MFDA 1RESA 3ZQCA 3HOYJ 1MH4A 2XB0X 2YS9A 3HEFA 1RETA 2LY9A 3HM5A 3GTJJ 4M3BA 1MBJA 1MBKA 4XRSA 2R5YA 2FX0A 3JR9A 2ME0A 3GTPJ 2NVYJ 1GT0C 3O8GA 4C2MJ 3S1RJ 4X6AJ 5J1RA 2IAIA 1JKRC 1JGGA 1WCMJ 2JJ7A 1JTYA 3S2DJ 3BTIA 3S1NJ 3LSJA 3G1LA 3BTJA 2LKXA 2VKEA 1ZKGA 3QQAA 3S14J 4FE7A 1JJ6C 3PO3J 3HOVJ 3OSGA 4A3MJ 3RKQA 4M3EA 5JLXA 1JUMA 3RQIA 1ZR4A 3BR0A 2EZKA 2CRGA 1W0TA 1K61A 4BBRJ 1Y1WJ 1P7JA 2LFBA 2DMNA 4MIMA 3JRDA 2WAQN 3CQZJ 1Y1VJ 1FEXA 2MW8A 4IHWA 2G0EA 5F04A 1JKOC 2R0QC 5FKMA 3PO2J 3HDDA 2EZLA 2X48A 5GP9A 2OPTA 2IEKA 1ORKA 2M34A 4L5EA 4XRSG 3GTMJ 1O4XA 2GLOA 1MBFA 4C3HJ 2E2IJ 2LLKA 2JA5J 4JP0A 3HGYA 1B72B 2TCTA 2DA7A 3HOWJ 5JLWA 3FK6A 2NS8A 2EZIA 1HOMA 5F27A 2R7ZJ 5M5WJ 3MVPA 2DJNA 1BA5A 2O9LA 5IP7J 3LNQA 1GUUA 1B72A 3HBLA 1G2HA 1ETWA 4A93J 2E2HJ 3S2HJ 1IRZA 1SFOJ 4QIWN 4HNVA 3C2BA 1LE8B 1RKWA 3QPSA 3BG9A 1PUFB 4B4CA 2MGQA 3E7LA 3BG5A 5EG0B 3JRAA 1GV2A 3ZQHA 3ZQGA 1CQTA 2YU9J 5IOZA 3DEWA 5F08A 4DZPA 3HKZN 3NARA 1LE8A 1TWGJ 1XS9A 5K7HA 1PUFA 1APLC 5EG0A 3BTCA 1LFUP 3BR6A 1AKHB 1BW6A 1QVTA 3B6AA 3S15J 4A3EJ 2HXIA 1XG1A 2L7FP 3HB9A 3IH2A 1SANA 2DTZA 1ENHA 2MSYA 2HOSA 5EZGA 4D5CA 1Z77A 5EGOB 1ZK8A 2DMUA 5F0CA 1AKHA 3D1NI 2R92J 2CJJA 1OFCX 5C4XJ 2NOGA 3SJMA 2HQ5A 2LTPA 5IYDJ 4V2GA 2JMWA 3A02A 3DCFA 5M3MJ 5EGOA 3Q3SA 2TRTA 1JUSA 3OOUA 3BR2A 2JA8J 4J19A 3B6CA 4A3CJ 2RAEA 4W1UA 4M6VA 2PMZN 2VKVA 2XPWA 3ZQIA 2IBDA 4QSHA 3LSGA 3K2AA 2L0KA 1ETOA 5GPAA 4AC0A 3L1PA 3GTOJ 2DA3A 3FK7A 2HYJA 2K40A
chains in the Genus database with same CATH superfamily
2P0WA 4IPAA 1ZQ3P 2XPUA 5KAIC 5H6QA 1BOBA 4DGWB 2NVUB 2ZXIA 2NNYA 1AA7A 4I99C 5CQGA 4L5IA 4KIFA 1ETVA 3L7WA 1EF4A 3TEDA 5FD6A 3I4MJ 3CC2I 2FXAA 1MNMC 1X3ZB 3LFKA 2MD5A 2W48A 4NUBA 3OS2A 2R7WA 3ZQFA 5F1JA 3CDIA 3CCUI 5TJJA 3NEUA 1LFBA 1B9NA 5IT9K 1WFXA 2A6EF 2MFZA 1I5ZA 1SD5A 1QPMA 2PLYA 1S6LA 5C4JJ 3WHBA 4BGDA 2Y0SA 3HL2A 1JJ8C 2FE3A 1ETYA 5ED4A 2W00A 3HOUJ 5EJCA 4RAYA 3DU5A 3H5AA 4BH9A 5CVJA 1W36C 1OCPA 5E18F 1TL8A 1YHQI 4E7JA 5D5UB 3BC8A 1X2NA 2HDCA 1X3WB 1KU7A 2K85A 4A3JJ 1KYZA 4DZJA 2KRCA 3S16J 4FHTA 5E3LA 4HW0A 2KKOA 1ZGWA 1NH3A 4UV8A 3CCSI 2NVQJ 1OMIA 1ON2A 1UHSA 3CDHA 4GCVA 3SQNA 1J2XA 2J5PA 1XDSA 5IYCJ 1WWXA 4P1WA 2A05A 2XASA 1H9TA 2VOOA 3ZOBA 3JRBA 4N9HA 1IGNA 1WSUA 1W5CC 1TNSA 5F64A 3OYNA 3TDUC 2FMLA 3L09A 4MFEA 2RVCA 1B4AA 2UUZA 3D5RC 4HEA2 1OR7A 4B1RA 1YS7A 2HOTA 4EGZA 2NVXJ 3ERMA 3IV5A 1BW5A 5B1AH 2BE5F 4IHXA 4OIPF 2XSJC 3K4NA 3L2WA 1WJFA 3DBLB 3F23A 2XRLA 2GIVA 3GBGA 5K1YA 1STZA 4H4KC 1BR1A 3CMAI 2V6EA 2CV0A 2IPQX 1P6RA 1XSVA 4UVAA 3IAM2 2QQ8A 1S7EA 2LP0A 2DYSH 3ML6A 2DA6A 1Z6RA 2L02A 2GA1A 3QP6A 4HQEA 4PGGA 1TC3C 3WTXC 3B73A 4II2A 3OV8A 2E7XA 3TP3A 3CMYA 3OS0A 1R00A 1GXPA 3LSRA 4JX4A 1WGXA 3BR5A 5L3CA 2VBXA 1OYWA 3T5XA 3QU3A 1BR4A 1ETKA 5HOOA 2HS5A 1U2WA 1BN5A 1MNEA 1BBYA 4YIIA 3QRFF 3O8HA 3QWLA 2EA2A 1V5GA 2QA4I 1WJAA 1VQ9I 4YIFA 1HCRA 2FBKA 3KP4A 3SEQA 2Y2ZA 3IAS2 3MZHA 2HDWA 4X1EA 2LY1A 4ZDOA 2FD5A 4M3FA 2N8GA 1D1AA 4PJLA 1RZ4A 3CCMI 3C3WA 1J09A 5JFRA 1TLHB 9ANTA 4L9NA 4ZYHA 2RNGA 5L3EA 2WB1N 1RRJA 3NWTA 2A69F 1XSXA 2P81A 2XF7A 1NTCA 1FIAA 2EH3A 4G8XA 1JTXA 2R7RA 3P7NA 3DU6A 4EJOA 2L7MP 5JHFA 2YU3A 1QO0D 3TMOA 1BJZA 2X6XA 4XOPA 3WHCA 4A3GJ 2NVTJ 2D1VA 1O57A 4LG3A 2CUFA 2CYYA 4E4HA 1S7OA 4QTRA 5C3EJ 1R4MB 3MD2A 1EH8A 2W84A 3GO5A 1T0FC 2M9HA 5F1RA 3E5QA 3KE2A 5LRRA 3K4LA 2MC4A 4L9TA 4ESFA 4HAMA 4GYGA 1UMQA 2ZMEC 3GTKJ 4N9IA 3RQ4A 3BG6A 3HOSA 4JQFA 1JI8A 3QYFA 2XRNA 3VODA 2Y30A 1MMSA 2R93J 2K9SA 1X1BA 4CDGA 2CFOA 1QRYA 5B1BH 3SFIA 1YJNI 1IUFA 4M3DA 1Y39A 3LQRA 2ZNYA 1ZH5A 4UB8C 1REPC 1G8XA 1KU3A 2L5QA 2MYSA 2BV6A 1XCBA 2TDXA 4IHVA 3M3YJ 2Y75A 3HC7A 3L2UA 1H88C 2NRAC 5B5EC 1HKQA 1HF0A 3CF2A 1RIOH 2ELKA 2Y9ZA 1OQYA 2HU9A 3BJAA 5L3DA 2ZNZA 2ZJ2A 3W2AA 2VT2A 4LK1F 4A3LJ 2E1OA 2QEXI 4J00A 2EB7A 1Y6IA 2MA3A 2EFQA 1VZ0A 3KP6A 1FOXA 2F5DA 5HVQC 3PM1A 1IC8A 1W5TA 2WV0A 1TWCJ 3DV8A 2WY8Q 3R6SA 1MD0A 2RC4A 4P55A 2DMQA 1LEAA 1G3TA 5IOYA 1FBSA 3BG3A 3T0YA 1Z9CA 5E8GA 3PNYA 2V7FA 4JX5A 1ZG3A 1A36A 1ZREA 5F0FA 3HTSB 2ECCA 3QOEA 1DU6A 3F8MA 1T8IA 5E3MA 2FUG2 2QVOA 1WJBA 1LVAA 3RDIA 2E36A 4M73A 5H20A 4XSZF 3IRQA 2ID3A 5DM6F 1VQMI 3OOPA 1MMDA 4LLGF 2G7UA 2KIQA 2KDOA 2HR3A 1R23A 3QODA 3FXUA 3SYTA 3TW6A 4UUTA 3KP2A 1DGRM 2GXAA 3GW2A 1RPWA 2M1BA 2DYRH 4DIQA 3FISA 1IF1A 1Z7UA 1VQ6I 2JTVA 2GQQA 3CO6C 3DBRB 4A3KJ 5J40A 2Z99A 3ZQQA 4E7SA 4KN7X 4BY1J 3NAUA 1FIPA 4NBQA 3N97A 3KYLA 1GVDA 2ESHA 4RLQA 2R5YB 2B9SA 4UV9A 1MMAA 1ERDA 3HRTA 4RMNA 3FKIJ 3K70D 2VBWA 2XAGA 4WXCA 4MFDA 1R22A 2WB1A 4CGZA 1K6OA 1TW3A 1WJCA 1MKMA 2X1DA 3PQJA 3HYIA 2R4GA 4PSXA 1UAAA 3HM5A 3V4GA 4M3BA 2VE8A 4X0GA 2R5YA 2FX0A 3TO6A 3L2RA 3T1BA 2KZGA 2HFHA 5EEHA 1GT0C 4E7LA 3S1RJ 4UXNA 4CXFA 5DD4A 5J1RA 2IAIA 2P5KA 2XUBA 1O3SA 1OYIA 3G1LA 2O5RA 1T95A 1WJDA 4RM3A 4HG2A 6PAXA 1IUYA 1RR8C 2B0LA 1UFMA 4DOZA 2CO5A 2K9MA 4I02A 3PO3J 2R7XA 3D5SC 1C0WA 4UHTA 3CMEI 1FOKA 1XGOA 2DFHA 2XAFA 2FBIA 4YELA 1VQOI 1ZR4A 4AM3A 2F5VA 2FF4A 2O0YA 1PJRA 2HGCA 1Y8RB 3F6OA 2IW5A 3ISPA 2OCEA 3RCOA 3S8PA 4PFPA 3SZPA 1DP7P 2MW8A 2UZKA 1USTA 5F04A 4IO9F 1KGSA 5IT3A 1SFUA 1LUJB 4HNTA 2X48A 1BIAA 1Z21A 1TQPA 4U0YA 2IEKA 4L5EA 5DM7F 1HXDA 1YTYA 2LLKA 3F8NA 3H1CA 4EV0A 3PFIA 4ZTJA 1VQ5I 4RAGA 5DDGA 2TCTA 3F8CA 3HOWJ 4EMSA 5JLWA 3KCCA 2NS8A 2EZIA 4QPQA 1Z3XA 2ZFWA 5M5WJ 5CVVA 2FNPA 2MH2A 1HKTA 4HDVA 4ESBA 2OJED 3MZYA 4RAZA 3HBLA 1G2HA 1ETWA 1G3WA 3CESA 3FXOA 1YJWI 4O3MA 3FMSA 3AG1H 2FNAA 3WTUC 2LC2A 3S2HJ 3L2QA 2HQRA 1FSHA 1R7JA 2QQAA 4G6QA 2L54A 3K70C 2ISZA 5EG0B 3JRAA 2L4AA 2DK5A 4YFKF 4U0VA 2UXXA 3AFHA 3KEQA 1XMKA 5F08A 5LBQA 2HKOA 1WI9A 2E1MC 1YX3A 2M7BA 5BQTA 2IS6A 1BJAA 4A2UA 5EG0A 3BTCA 1LFUP 1FYLA 2LREA 3BR6A 4XLFA 3S15J 2W57A 3ECOA 2CW8A 2DBBA 3HB9A 3P9IA 1SANA 2M3AA 4ESJA 2PI0A 3P9CA 4LMYA 1ENHA 1T98A 5EZGA 3JSPA 1HSJA 2DMUA 3F8FA 4Z2YA 2VJJA 2R92J 3DKXA 4LGWA 3H36A 2JSCA 3S3OA 4QLCU 1OFCX 2BOLA 3M9AA 2LTPA 3VWBA 2R7QA 2Y48A 5FLXK 3OWTA 4LLLA 1UB9A 4NQWB 4HF2A 1T6SA 2RAEA 2WADA 3ASNH 1D0XA 2KIUA 2PMZN 2XPWA 3HSRA 3AL0C 1QHHD 4CCMA 1TT0A 1LFPA 1EKEA 4YG2F 2K02A 3W2VA 3IKVA 3R0JA 3L1PA 4NQWA 3MKYB 2DA3A 3OL3A 3ESWB 3FK7A 1YYVA 2F4MB 3KP7A 5A2QK 3KX2A 5D6EA 4KT6A 4A3FJ 1U9NA 2QLZA 3I3LA 2DOAA 1X58A 5GTHC 4Y52J 4LK0F 5JI6A 4ZTFA 4XLCA 4D0PA 3DPTA 4MTDA 4CCOA 1F4KA 2R7SA 1Y8QB 3TO7A 4FE4A 2QQBA 1PDNC 4B8XA 1J75A 3EPZA 2ME6A 3H9GA 4BY7J 1N77A 5HS8A 3A4CA 5FGMA 4UY8I 2A3SA 2DT5A 2KISA 1MSEC 4OMZA 3TL4X 4M3GA 4RDUA 1YW9A 2DA4A 3F3XA 5DEQA 3S3NA 4U88A 4IL6C 5LGNA 4R8HA 3FXRA 3G1MA 2ELJA 4RS8A 3BQZA 2KPMA 2XGDA 4F55A 3OYJA 4I6ZA 3Q5FA 2R7VA 4MHGA 3IP4B 4TV7A 3OYHA 2DXIA 2O3FA 1XMXA 5FKNA 1S72I 1P9QC 2DTRA 2HI3A 4IHYA 1D1CA 3QPLA 4IF4A 2DDBA 2PQ8A 1TW2A 5LHGA 3SDGA 5LGTA 4OMYA 3C1DA 4PJMA 1XGSA 1RC9A 4D5FA 4YIRX 2W4SA 2K9NA 3EUHC 2RN7A 3HRUA 4ZH4F 2EFWA 5J3LA 4RGXA 1AOYA 1YW7A 2WY7Q 4B44A 1ITYA 5IP9J 4EATA 1ETXA 2L7ZA 5M3FJ 2X6OA 2Y9YA 1H89C 2XHKA 2VUMJ 2VI6A 1BI2A 2HVQA 4HX7A 1V3FA 1WH7A 4IVNA 4B3AA 1BI3A 1GDTA 2JUGA 2XKOA 4CUGA 4OOIA 3AG2H 3FBIB 4FTHA 1MMGA 3ZRGA 2VPRA 2B63J 1E3OC 1V55H 2GZWA 1G6NA 4C30A 5LLQA 4XLPF 1SMTA 1VQ4I 4M9ZA 3DTKA 4R79A 2F5EA 2HQAA 5LHIA 5C44J 1QZZA 4LOCA 3FF5A 1QVUA 3DFGA 4NC8A 3H9QA 1NHAA 4FQGA 2ZFUA 3K9TA 2XVCA 1L0OC 2BZTA 3PFYA 2KIFA 5GAEJ 3HGGA 3WGIA 2FU4A 2QGUA 4MLOA 4WX9A 3BQYA 2VASA 3OYKA 1IW7F 4MQ9F 3JAMZ 2BY1A 1I6XA 1HA8A 3FM3A 1ULYA 1WI3A 1IDZA 2V1XA 2UWMA 3HOTA 1D0ZA 2AXTC 3IL2A 3G2BA 3JREA 1ZHFA 4XN3A 5BNGA 3JRHA 4PSWA 3LSMA 5DUKA 1YLFA 2R7UA 2BVMA 1UHMA 5HLIA 3OYAA 2GAUA 1VNDA 2H94A 3DEUA 3V42A 5D5WB 3AL0B 3OYEA 3H92A 1DQUA 3WU1B 2M0CA 4UUVA 2M7AA 4I0AA 2CW7A 1R49A 1DPRA 1VI0A 2QF7A 3VOEA 2M0MA 1BR2A 2VPLA 1T38A 1JT0A 3MN2A 4F91B 1WH5A 2WBMA 2DT6A 3S93A 2HQNA 4ENJA 3BG7A 1T08B 1IZ1A 1XSDA 4OIOF 4Y15A 1XPXA 1BL0A 1PP7U 2GXBA 1G59A 4BHCA 4BHBA 2CV1A 3PIPF 5FKLA 4MNUA 1HDDC 3FWEA 5GAGJ 1Y0NA 5IY5H 3ZXSA 1E17A 2W85A 3U9GA 1P7IA 2WAFA 2AQEA 4Z6YA 1LDJA 2IT0A 3M7GA 2M8EA 3BR3A 5BMZA 5EYRA 4D1QA 3N4MA 1VQ7I 3OYFA 2V1UA 1ACIA 2O03A 2V9KA 2X1EA 4MO7A 2QCOA 3TBIA 2IXSA 5LGUA 2OTJI 3LA3A 3CJQB 3WG9A 1RKTA 5IYBJ 1XMAA 1UZCA 2LD5A 3E5XA 3OIOA 2IS1A 4RBOA 2Y31A 4G6DA 1OJLA 1WRJA 4M9SA 4N0BA 5FKOA 3HIFA 2CUJA 2DJIA 1AU7A 4M9XA 2HXOA 2DN0A 4HQMA 1ON1A 2X51A 3E97A 5TGTA 3DBHB 3IHUA 2O6GE 3TP0A 2A68F 4B47A 4XIDA 1K78B 3G4SI 2K7LA 3E1SA 5K7ZA 5FB2A 1UJ8A 3ZN0A 2CFXA 2L2OA 3DLLF 2M8GX 2VT3A 3VB2A 1IJWC 3ZMDA 3K1MA 1ODDA 4G94A 5IP6A 1MDMB 4XR6A 1K78A 1R6RA 2H27A 2GXGA 3M1CA 2OF7A 3MZ8A 2H6CA 2LNBA 3EUHA 3IC7A 4HPQA 4E7IA 4CH7A 2ISYA 2LF8A 4IQ4A 4N4NB 1FBUA 1MIJA 2MH9A 3J80K 4P96A 4AWXB 3HOZJ 1MDMA 5ICCA 1IXSB 1I39A 4KICA 4EM0B 1F43A 2L01A 4I76A 5E20A 2MBFA 3CCVI 1QBJA 2Z5UA 4GXOA 3WE3A 1EJ9A 1O7LA 2RNJA 3PQKA 3A03A 3CUQB 1AHDP 2QSHX 3MWMA 2BHZA 4ENMA 2BXYA 3G1OA 1S29A 2M5WA 1EA3A 2BY0A 4U7BA 4LB6B 4F7ZA 2PBIA 1GXQA 1TWHJ 1MBGA 3U1DA 4DJAA 4HV5A 1PP8F 1O3TA 3CUQA 1IG7A 3GTQJ 3S17J 3HOXJ 4BXXJ 2Z2SB 2H09A 2H8WA 4E7KA 3EETA 3IWZA 4DYCA 1IN7A 3L9FA 4RGUA 1IAWA 4W97A 5D8KB 1X1CA 1EH6A 3ABUA 1E3HA 4EM1A 4AIKA 4CCNA 4LJZF 4CCKA 1X2MA 2PEXA 1J59A 1MJBA 1YG2A 4M72A 4WXDA 1QPIA 4A69C 2ZKZA 1SFKA 1I3AA 2KT0A 1FNNA 3GZNB 3LA7A 2EIMH 5DYMA 5JVTA 2LR8A 2QZ8A 4L9VA 4IKFA 1P4WA 1RR7A 3DKYA 2AQFA 2CUZA 3F72A 2LVSA 2DT7B 2GOMA 1KYWA 2DA1A 3U2RA 4HRIA 5FKKA 2JQ7A 3QP5A 4L18B 1A6QA 2E19A 3M8JA 1BI1A 5HNHA 2LOOA 2EINH 4ZZDA 2DK8A 2Y0MA 2WA0A 4I01A 3K1NA 3WGGA 4C3IJ 2XC7A 2LH9A 4CZCA 3OIPA 4WF2A 1Q1VA 2DMTA 2W1OA 4HX8A 4BKXA 1R9TJ 2YX4A 5HLTA 5J4YA 3HOYJ 1YI2I 1FYKA 1P92A 2Z3YA 2LY9A 2FEZA 1K7AA 1G3YA 4XSXF 5E1XA 3GTJJ 5JHUA 3F21A 1MBKA 3ZMSA 3C18A 3JR9A 2LYCA 3W6KB 2NVYJ 3J81Z 5HDKA 2BGCA 3NWSA 3H3UA 3O8GA 2YPRA 4C2MJ 2P6SA 1KONA 4U87A 1WCMJ 1S7AA 1RUNA 2QUFA 4P9UA 3BTIA 3S1NJ 3RSNA 1ZKGA 4NC7A 4BACA 4KFCA 2OC6A 3V7RA 3S14J 3GFJA 2JT1A 5GTIC 4BQNA 3HOVJ 2EIJH 4A3MJ 3DEEA 2L9NA 3CUOA 5LRSA 5JLXA 4C9YA 1WJEA 2XROA 3BR0A 2EZKA 3TKYA 3G3ZA 2NOJB 1W0TA 1R5GA 3PUBA 1X4OA 1X1DA 4CCJA 1Y1WJ 2VKHA 2DMNA 3JRDA 2WAQN 5CLSA 3GYHX 1Z6TA 1SVLA 4CO8A 4ZYGA 1FEXA 4IHWA 4QWQA 2G0EA 1KZHA 4H0EA 3M8FA 1VTNC 4MEXF 5FKMA 2FMYA 2A6HF 3HDDA 5GADJ 3S2WA 3RPUD 3RI4A 2M34A 3DWLE 3ZGKA 4IX7A 1O4XA 2CGPA 2E2IJ 3BZKA 1JXSA 1HQCA 2V79A 4ZYAA 3SEZA 1TP4A 1YOVB 3O3KA 3KEOA 1E0EA 1HOMA 3B02A 5HS9A 2P6TA 2IGOA 3HHGA 2M4GA 3FHZA 4HDUA 3HPGA 4A93J 3H5RA 1BOAA 2ZC2A 1HW5A 4MEYF 2V4JC 2IGMA 3KZYA 4QIWN 3VYTB 3GCMA 4HNVA 1W1WE 3Q9VA 3LWFA 2V9PA 4B4CA 2MGQA 1IXCA 2FA5A 1EV7A 1GV2A 3ZQGA 3BJOA 3REOA 5IOZA 3DEWA 5ILSA 5D5XB 4A0ZA 2NNNA 2R7TA 4UVCA 1TWGJ 1IXRC 5K7HA 2EWNA 3GLLA 2E60A 4YFNF 1APLC 2CWEA 1AKHB 3OYIA 2HXIA 1XG1A 4LB5A 5LEJA 2DU9A 1R58A 2QM3A 3BDDA 3I58A 3IH2A 2E1CA 5LHHA 2DTZA 3AG4H 1VQPI 4OIRF 3LFUA 2HOSA 5LFAA 5EGOB 4BU2A 4AIHA 1AKHA 1HSTA 3D1NI 1N75A 3VYUB 4BHPA 2KMUA 1W5SA 5BOXA 2NOGA 3WGHA 1SMYF 4I09A 3GZ5A 2HQ5A 3BZCA 3FMRA 3IWFA 4V2GA 3H35A 3A02A 1FZPB 2DI3A 1FX7A 5EGOA 4U7DA 3CF5F 1BC7C 5FD5A 1SD7A 4A12A 2JA8J 1J7KA 1QGPA 4M6VA 1X3UA 1V54H 2DOFA 1R1UA 3E6CC 4BYYA 1OCCH 1SVMA 1WJ5A 3ZCOA 5CPRB 4QSHA 2P5VA 3LSGA 5KK1A 4BXUA 1DP3A 3L00A 3I9V2 4NNJA 4Y17A 5E1ZB 3QYBA 1ETOA 2EFPA 4II3A 4AC0A 4IOCF 3GTOJ 3TDZC 3LAPA 2XAQA 3CC4I 3QPTA 1SFXA 5E8IA 2WTEA 2K40A 5BPDA 2XSDC 3CCQI 5LEKA 1QZYA 5IT9Z 3C7JA 2O8XA 4UUSB 4Y3OA 5CYVA 3E5UA 2D45A 2IS2A 2EV5A 3AG3H 2XGXA 2X0LA 4IZZA 4PK4A 5AONA 3OYDA 2VBZA 3JRFA 1ZGAA 4RLFA 3R60A 2DDAA 3BR1A 4G7ZF 2JPCA 2F5CA 2KP6A 4XKWA 5J8FA 4A5NA 2XF5A 2ECBA 2KZVA 2VIXA 2ZMEB 3R4KA 1B8IB 3H0DA 1ONVA 5F6FA 1T0FA 2ESNA 3RYPA 1YIJI 1FT9A 1ZTRA 1K4SA 4HF1A 2WAQA 3SHFA 1IV8A 2MLKA 2K4BA 2R5ZB 2G9WA 2ZMEA 3K2ZA 1B8IA 4IXAA 2B7EA 3EUKL 2GM4A 4RGSA 2PJRB 5H6RA 2LMDA 1FTZA 2CG4A 3ERED 4A3DJ 2PMUA 2BBYA 2DFFA 4LG0B 1I27A 3BP8A 3QPHA 2R5ZA 3RZDJ 1XN7A 2FBHA 2H1LA 4OINF 3QAHA 4ZJZA 3ZP5A 3ONQA 3K7AJ 1X4PA 1TT5B 2O7OA 3J7ZI 1KU2A 5J1UA 1TTYA 3I59B 4G12A 1MH3A 1G3SA 4QPOA 2PJRA 4S0HB 5FRMA 3CCRI 4OIQF 1LEBA 1X1AA 3DPUA 4LG0A 2W7NA 1R4NB 4V2FA 3IKTA 3MKZA 3JRIA 1YJ9I 2ZCWA 3VYRB 2EQRA 3LOCA 3IRRA 1OYYA 2XGEA 3ECHA 4M71A 2DA2A 2EFOA 1A31A 3I59A 5CVRA 3A2KA 1OPCA 2EFNA 2V6CA 2ADUA 3PJRA 4FISA 3WTZA 2EA4A 1HLVA 2K3FA 3ZQ7A 1U5TC 1JKPC 2VOPA 3CP8A 2DFEA 5HODA 4Y13A 3CP2A 4KT5C 2CUEA 2X85A 1XC5A 2EV0A 1D1BA 2XKPA 3CZ6A 2K3PA 5CKTA 3J7AY 3K69A 2RGVA 3MFKA 1JKQC 1I50J 1E3PA 5L3FA 4YFXF 2QSGX 4C2UA 3JTGA 1BC8C 1AWCA 3IH3A 3WTSC 4JBAA 3DF8A 2LBFB 1H0MA 1L3LA 3S3MA 3M1EA 1D0YA 1M1EB 4UNOA 2QKLB 3EUAA 1QNTA 2X1CA 4WXHA 1FBQA 1QZEA 3LQQA 4BL0B 2LBFA 5F0HA 5HLHA 2BYVE 2CQ7A 5KNLA 2GWRA 1PUEE 2AS5F 4IRGA 1TBXA 2W24A 4F52A 2VBYA 4ABZA 1P4AA 4GO1A 2HOAA 1XD7A 2MC3A 1Y56A 1BM9A 3WTVC 3SZGA 2BVLA 3FXLA 4GFBA 4ZYDA 2IS4A 3OYBA 1FMVA 5FO5A 1D8JA 4G7OF 4UB6C 3E6MA 4AIDA 4L0YB 5EEGA 1U78A 4ASNA 4D7MA 4RB1A 3K1PA 3FZVA 3E3VA 4MQVA 3OYLA 1F5TA 3LAJA 4XMYA 5EDNA 3RZOJ 4IOAF 1ZRFA 3NQOA 3BLYA 1JHFA 2EJRA 3RYRA 4WWCA 2LRDA 4EVIA 4R1HA 1NK2P 3F0CA 5TRDA 4BBSJ 2HPMA 1F36A 1GV5A 4Q47A 1K79A 5M5XJ 1FTTA 3GFIA 4LD5A 5DCFA 2Q0OA 4DNCA 3ZMZA 2VC1A 2CQQA 2Z16A 2JK3A 5KVRA 2ZJRF 1IRGA 2OUMA 3H0GJ 4NB5A 2E2JJ 2PN6A 2R7OA 1X1PA 3IH4A 4PFOA 4A5MA 2G7HA 4NDLA 3J81K 2IVMA 4DYQA 2CQKA 3RIRA 3UR3C 1R71A 2HZDA 5FRNA 4GDFA 3FXMA 4BUPA 2FOWA 2VONA 2GA2A 2WC2A 2NS7A 2Y0SN 3KIOA 4O5VA 2OCCH 2KJCA 5EEAA 2IA0A 4XNFA 3OYMA 2ACJA 4OAYA 1D5YA 4LITA 4V19K 4JYKA 1I6HJ 5ILUA 3COAC 4XRMA 5EF6A 3I55I 1S8NA 2PMHA 2DPDA 5CVUA 5E1WA 2ETHA 2JN6A 2I8DA 4A3IJ 1U8RA 2E7WA 5DS9A 4MTEA 3MQ0A 4C3JJ 3VDXA 1O3RA 4O6JA 4HSTA 3P5JA 2E1MB 2ZXJA 3M07A 3KZIC 2MG4A 1XGMA 2LKSA 4BQQA 2DOEA 3GEZA 1Z3YA 2X6YA 3QOPA 4Y33A 1SD6A 1IN6A 3OYCA 1K6YA 5KCMA 1OR7C 4HNUA 2HVSA 4PJ0C 3H9JA 4RM2A 1I1SA 4L0ZB 1S5LC 3KP5A 4AVPA 1OLTA 5FLMJ 5J4VA 5K7FA 3CTAA 1VQLI 1FWZA 5HLGA 4XBFA 4RA2A 3OY9A 2OQRA 3AAFA 1VF9A 3W6JB 1ZARA 1ZYRF 1F1ZA 3FXKA 4A0XA 1BIBA 1A04A 2BW3B 3IUOA 4F93B 1GVJA 4IQJA 3DP7A 3UKGA 1VFCA 3FDYA 2COBA 2JRMA 3DTIA 3F9KA 3M8EA 1EH7A 3I56I 5FJ8J 2JRTA 3H3ZA 3MAJA 1MJ9A 3WU2C 1W0UA 4A6DA 2HDDA 1ZLKA 2VJ4A 2VLAA 3K4BA 1D8KA 1MGTA 1P2FA 4ZC3A 3C2GA 2BW3A 1USSA 2PMZA 2A5WA 4BXFA 3BPVA 3BPXA 2FSWA 1POGA 1VQNI 2VB6A 4KN4X 4XKBA 4B48A 1QHGA 4AYBN 3OYGA 2K9LA 2OU2A 3HUGB 1IV6A 3FBNB 1YITI 1DDNA 4BJ5C 2LK2A 2RDPA 4DW6A 4KISA 1KQ0A 1S3JA 2ELHA 3GFMA 3GTGJ 3PNTA 3K0LA 1RESA 3ZQCA 2IP2A 1MH4A 1BI0A 2L9VA 5J6XA 2YS9A 3HEFA 4CICA 1O3QA 3WTWC 3HUGA 2CH0A 3JSOA 1MBJA 4XRSA 2ZJQF 4CSWA 1V5EA 4B3XA 4IRHA 4X6AJ 3OR2C 2JZYA 3ABMH 4FASD 3BWGA 1JKRC 1YFHA 1T39A 1FYMA 2VODA 2JJ7A 1XGNA 3LSJA 3OR1C 2QKMB 4HLXA 2VKEA 2OZ6A 2CSOA 2J5OA 4K2EA 4FE7A 3E0JB 3KETA 4BE0A 2OTLI 2BHYA 3OS1A 4RAFA 3RKQA 1OISA 3HRSA 3K4JA 3RQIA 4IHTA 3HRMA 2RQQA 2OV7A 4ETSA 4BBRJ 3ABTA 2Z33A 3J7YJ 4OAZA 2VQCA 3QU6A 2V26A 3V8JA 3LMMA 2XAJA 3I71A 1Y1VJ 3FXQA 3ZN1A 2KLOA 3FKJA 2E5ZA 2R0QC 3K4MA 3PO2J 2AXLA 4EM2A 2QQ9A 4EJWA 1V4RA 1RNLA 3OIQA 1FMWA 2FOKA 2ZSHB 3KFWX 3GTMJ 2GLOA 4C3HJ 4G6TB 2JA5J 4JP0A 1IN4A 4AVZA 3S32A 3VSKA 2DA7A 3EDPA 3PIOF 4EJUA 1D5VA 2MD0A 3D0SA 3FK6A 2KHMA 5B3SH 4KIBA 1VQ8I 1Y0UA 5F27A 2R7ZJ 2DW4A 4L5JA 1ZELA 3MVPA 4FX0A 2HZTA 1BA5A 2VJIA 3DXJF 5IP7J 4I0BA 5JVGF 2KIMA 1LNWA 1WHUA 1VQKI 4J01A 3E6BA 3EYIA 3R0AA 4ENNA 4HF0A 3C2BA 1GHCA 1LE8B 2HEOA 3QPSA 3O6BB 3BG9A 1Z7LA 3TGNA 3LL7A 1W4MA 3BG5A 1FP2A 4B09A 4EGYA 5LD2C 3ZQHA 2FQ3A 1CQTA 4KMUX 2YU9J 3V8KA 4ITVA 3TOAA 1GLNA 4ZYEA 3HKZN 1LJ9A 3NARA 1LE8A 1J9IA 1XS9A 3K10A 2F48A 3WU0A 3SFZA 4KUMA 2KRHA 2OBPA 2VXZA 1UELB 3ZMVA 4BS9A 2QBYB 5CQEA 1BW6A 3J7AO 3B6AA 5FLXZ 1XX5A 2UV1A 4RB3C 2L7FP 4KYWA 3ELKA 2VQGA 1LDKB 4HX4A 4E6KG 1WZ2A 3DQVC 3HXLA 1R36A 2QBYA 4BDZA 1HBXG 1Z77A 5D4RA 2Z1DA 3PSIA 5F0CA 4EJTA 4KIGA 3CO7C 3P9KA 4M6YA 2CQNA 2GOXB 5ICEA 5C4XJ 1B1BA 5DCMB 3LSHA 2C6YA 3TQNA 5IYDJ 2JMWA 3I64A 5A2QZ 1FC3A 3AKZA 5HDGA 5M3MJ 3WG7H 1K4TA 1LVKA 2Q8KA 4AYBA 4BDYA 1IRFA 1JUSA 3OOUA 4CHUA 3BR2A 4AU7A 1FP1D 5TISC 2OQGA 4W1UA 3LSIA 1XCVA 4N4OB 5DCMA 3SDBA 2RV8A 2ZSIB 4Q4ZF 3F6VA 4M74A 3ZPLA 3BROA 1S9HA 4XLHA 2LDUA 1DUXC 3I5UA 1HKSA 2E5NA 2HPIA 3V7CA 1HW1A 3HJEA 2PG4A 2HYJA 3HZJA 1FY7A 4XL9A 4KNYA 1NG6A 3I0TA 2DODA 5ICGA 3H3VK 2H6BA 1RUOA 3CJTB 4XORA 4PUSA 5H2FC 1IRXA 2QSFX 4XRFA 1SC7A 2E71A 3A0BC 1WKMA 1H9GA 2Z9OA 1UCRA 2HVRA 1IDYA 3TW7A 1F9NA 1WVRA 1ZLJA 4XQFA 4BJTA 3G73A 1TQIA 3K4KA 1OCOH 1PVEA 5L3GA 4PZJA 4PJNA 2P4WA 4JK1X 4ANJA 1N78A 3GMEA 4WK8F 2VJ5A 1H8AC 3W3CA 2STTA 2OD5A 2OAZA 3HPHA 1MBHA 3FIWA 5DD8A 1TNTA 1YIOA 3A0HC 2P5LC 4IHSA 2BXZA 3M4OJ 4XK4A 5L3BA 1B9MA 5D6FA 1O7FA 3BCBA 2L9RA 3OMYA 1MNDA 3W6VA 4EJVA 3KYCB 1LKXA 4DBQA 1D3YA 3PSFA 4HV6A 3CJRB 2HTJA 3VSLA 4I2OA 3CJNA 4BJ6C 3ULQB 1JE8A 3HSFA 2H1KA 1Z1DA 3CDLA 3RJPA 3GZ6A 4ZZLA 1UG2A 3VPRA 4E7ZA 3JRGA 3Q0UA 2K4JA 4Y4RA 1K83J 3BT9A 2COMA 2OA4A 4WCGA 1I3QJ 4XLAA 1NK3P 1YW8A 2F6CA 4XLEA 1W7PD 2X6WA 2ZXWH 3ROUA 5DTDA 1YS6A 3HSEA 1MZBA 3ZMUA 2R3SA 5K5QA 3S1QJ 1Z91A 5KAFC 2QENA 1WPKA 1FJLA 4EEFG 3HKZA 3CCYA 3NRVA 3QYEA 2A6TA 1Z05A 2YUSA 1HW2A 4GRIA 1QU3A 1JT6A 2ZBKA 1ETQA 2KDZA 3RKWA 4D9JA 3HHHA 2EILH 3K6GA 4XONA 3FHNA 4IEJA 3N05A 4E7HA 1FPQA 3JRCA 2L3DA 1CGPA 2KFDA 4A3BJ 4KJZA 1R5HA 5E3OA 3DTEA 2XAHA 2EBIA 2RREA 1FSEA 2JSPA 3JW4A 3VFZA 5BS6A 1SEUA 1IN8A 4XICA 3GX4X 1U3EM 1LPQA 2WV1A 3A01B 3L2VA 4HOBA 1MMNA 1OCTC 4HA8A 4OU0A 2IGKA 4BAYA 1XTAA 4ENKA 1X19A 4M6XA 4BEHB 1HC8A 3GLXA 3LA2A 3E6DA 1MW7A 5E79C 2R7DA 5E3NA 2NS0A 3WE2A 4OWRB 3A01A 1YRNB 3OSFA 4Y7NJ 2FQ4A 1UHWA 1ZG1A 3CLOA 1ZRDA 5GPCA 2ID6A 1RI7A 1IO2A 2EZHA 3BTLA 3JAMK 3RKYA 2BEOA 2DCEA 3BOQA 3V7SA 4BEHA 1G4DA 1T33A 2CV2A 1A6IA 2JA2A 1QQIA 3BJ6A 1YRNA 2H8RA 1DPUA 2FJ1A 1IN5A 2E1NA 2EK5A 3S1MJ 4LFUA 2AHQA 2F5FA 4Q48A 3LSTA 2M45A 5J47A 3GTLJ 1LQ1A 3BZ6A 2JPBA 1PYVA 2L9SA 3FXJA 5EZHA 2P7CB 4UUSA 5DUIA 3BCAA 3GF2A 1FOYA 3BY6A 4DQ2A 2YR2A 4AD9A 4CYDA 4XKCA 3SZTA 2HNHA 1JUPA 1R5ID 2EPFA 2QYOA 5ILVA 1QA6A 2HTSA 4B43A 3CC7I 3ZQLA 5J1YA 4AUXA 1Z0XA 4I7HA 2UXNA 1HDPA 1TZLA 4A6EA 2D5VA 5D4SA 4I98B 1SFEA 3KLNA 2XIGA 3ZR8X 4ON0A 4CA0A 1ZR2A 4C2TA 3DKWA 2D1HA 4EQQA 3HG9A 1U6GA 2JWTA 3CD6I 2NYXA 1A35A 3J80Z 2KRFA 2LSOA 3U21A 4HLYA 4U0WA 2I10A 5AIPA 3C2HA 1TWFJ 2X4HA 3F8BA 3MKLA 4JX6A 4FCYA 4FETA 1KQ8A 2ZB9A 4GGGA 1SD4A 4IJAA 2MLGA 3LSKA 3RTRA 2V9VA 2M87A 3K4CA 4CZZA 4LLNA 4S05A 2O8KA 2JA6J 2GIZA 3HTUA 3U1KA 2IA1A 1DGWY 1R1VA 2LY2A 5ICFA 3KPHA 3LSPA 2ZXHA 2DA5A 3CCJI 2XB5A 3KP3A 2NXNB 5M5YJ 2X9DA 4FX4A 1A5JA 2RQPA 2XGCA 3GWZA 4HZFA 2IA2A 1LB2A 2F4IA 2KJBA 1U8BA 3OL4A 1T56A 1DU0A 2K5CA 2RKHA 3GFLA 4DYRA 2PJPA 2Q1ZB 1ZAOA 4PCQA 4PGHA 1ZRCA 3O2PE 2CU7A 5FFXA 1XDUA 5J8CA 4IRIA 1E2XA 2VQHA 2AO9A 2PFBA 3I53A 2O61A 5D5VB 1MBEA 1U9OA 1SVOA 2Y69H 2P8TA 3TO9A 3Q0VA 2M2EA 1MJAA 1I1GA 2XPVA 2IJLA 2VE9A 2STWA 1SAUA 1SAXA 3CLQA 3ABKH 2CQXA 2IRFG 3D5LA 2DMPA 2DQRA 2DFIA 2VQLA 3Q0WA 4BNCA 1KQ9A 2LF7A 2BY2A 5ERIA 2JA7J 2V1NA 1FOWA 5CVIA 5B66C 1OCZH 2WAEA 3FM5A 3T8TA 3PL8A 5FLVA 5HS7A 2E35A 2MABA 1UG0A 4BQOA 4RB2C 2CS3A 4D7NA 2A5YB 2Q2EB 3DPLC 2DO7A 2IGNA 4CYCB 1MSFC 5E17F 1YE9A 4KA4A 2DAOA 5IPAA 5BPIA 3CCLI 1ZG5A 3PNVA 2I5UA 2VXDA 4KDPA 1R1TA 3RPUA 2W25A 3V8LA 2HOEA 2WWYA 2Q2EA 3I4NJ 4ZDPA 4CYCA 2K86A 2GBYA 4PDKA 2K9QA 1TWAJ 5K5RA 4P5OA 3GXOA 4DBRA 1B59A 2PX9A 3WTYC 2XB0X 1W7PB 1RETA 3EYYA 1JGSA 1CF7B 3T8RA 1V5FA 2F2EA 5GAHJ 2K27A 4UVBA 3F22A 1KA8A 2ME0A 3GTPJ 2A61A 2VC0A 2P7VB 2VKDA 1JGGA 4GYIA 2JVGA 1JTYA 4XM3A 3S2DJ 1W7PA 5AIQA 2LKXA 3BTJA 2M30A 3ASOH 1CF7A 3KYDB 3QQAA 3R61A 1JJ6C 3X2QH 2KQRA 2YX7A 3OSGA 1U0JA 3Q9SA 4M3EA 1JUMA 1J0RA 3MEXA 5CJ9A 2CRGA 1K61A 5FROA 4HYEA 3SXYA 1P7JA 2LFBA 4XLNF 4MIMA 4F92B 4BQAA 2XDVA 3CQZJ 4F3QA 2FRHA 2CMPA 4JOMA 4YRVA 1JKOC 2HYGD 1P4XA 2V1DA 2ZO4A 2EZLA 1WQ2A 5D8LB 2HWVA 3A1YA 5GP9A 2JVHA 2OPTA 4XRSG 1ORKA 4G7HF 3MKWB 1XB4A 1MBFA 2BY3A 3PUFA 2DQLA 2M4KA 1KU9A 3HGYA 1B72B 2VN2A 3UNGC 1ZGJA 2VL8A 3KZZA 5HNFA 4NHJA 2NAZA 3L2CA 2KL4A 4YEJA 3RKXA 1NG7A 2DJNA 3W2WA 2O9LA 3LNQA 1U5TB 4RGRA 1TQMA 1GUUA 1Q1HA 4AIJA 1B72A 4MGRA 3RPQA 2XF6A 2E2HJ 1IRZA 1SFOJ 4NC6A 1Z67A 1RKWA 2QWWA 4HBLA 4XN0A 5HDNA 1N25A 1PUFB 3FMQA 3E7LA 3G71I 1U5TA 3WTTC 2EV6A 4LIVA 4L9JA 4G9YA 3ABLH 3EQLF 1T2KA 2DLLA 1J5YA 4DZPA 4BE2A 3MMYB 4XOTA 2E34A 1PUFA 2XAUA 3VEPA 3GVAA 4BE1A 2LKPA 3CUQC 4RB0A 3G6EI 5K5OA 1QVTA 4ZDLA 3JTHA 4A3EJ 4PJJA 1OKRA 2DPUA 2L4MA 4CCLA 1YO5C 2HKXA 4HSRA 3KLOA 1W36D 2F4OB 2MSYA 4S04A 2W82A 4FT8A 2ZJPF 5JR3A 4D5CA 4A0YA 1ZK8A 4KITB 3I54A 3VYSB 3I4PA 2A07F 2L7KA 3TOBA 1B6AA 2CJJA 3DLAA 4XKVA 1YX5A 3SJMA 1ZN2A 3JCUC 2YSRA 4Q5SF 4E70A 1JHHA 3DCFA 2JUCA 2D2WA 5KHDA 3FX3A 3Q3SA 2TRTA 2XV4S 3H5NA 1YQAA 2EIKH 3B6CA 2ICWG 4J19A 4A3CJ 3KEYA 3CCEI 3ZMTA 2VKVA 3ZQIA 1FLIA 3CMMA 2IBDA 2HYFA 4P9FA 4KMFA 2CW0F 5FFZA 1OCRH 3K2AA 2L0KA 3GUDA 5DV5A 4LIUA 5GPAA 1LDDA 2OZUA 3WODF 2R7FA 3MCZA 2LG4A
chains in the Genus database with same CATH topology
2XSDC 4A3FJ 1U9NA 3H3VK 1ZQ3P 4UUSB 1X58A 2XPUA 4Y52J 3JRFA 1IDYA 3TW7A 4FE4A 3BR1A 1ETVA 1EF4A 2ME6A 4BY7J 3TEDA 2ECBA 3I4MJ 1MNMC 1B8IB 2W48A 1MSEC 3ZQFA 5F1JA 1H8AC 4M3GA 4RDUA 2DA4A 1LFBA 1MBHA 3FIWA 1ZTRA 3M4OJ 4XK4A 3G1MA 2R5ZB 5C4JJ 1B8IA 3WHBA 3BQZA 2XGDA 2L9RA 4I6ZA 1JJ8C 2GM4A 1ETYA 3HOUJ 3W6VA 5FKNA 1FTZA 4A3DJ 2HI3A 4IHYA 1OCPA 3QPLA 3RZDJ 2R5ZA 3K7AJ 1X2NA 2H1KA 3SDGA 2O7OA 5J1UA 4A3JJ 3CDLA 4G12A 1MH3A 4D5FA 4DZJA 2K9NA 4S0HB 3S16J 5E3LA 1UG2A 3VPRA 1ZGWA 3JRGA 3Q0UA 2NVQJ 1UHSA 4V2FA 1K83J 3BT9A 5J3LA 1ITYA 1I3QJ 5IP9J 3JRIA 1NK3P 2EQRA 3LOCA 1ETXA 2L7ZA 5IYCJ 5M3FJ 2XGEA 2X6OA 2Y9YA 1H89C 2DA2A 3ZOBA 2VI6A 4B3AA 3JRBA 1IGNA 1WH7A 2VUMJ 5DTDA 1GDTA 4FISA 3S1QJ 4FTHA 4MFEA 1HLVA 1WPKA 2VPRA 1FJLA 1JKPC 1E3OC 2B63J 4EEFG 4B1RA 5HODA 3CCYA 2HOTA 2NVXJ 3IV5A 1BW5A 2CUEA 2YUSA 4IHXA 5C44J 1JT6A 1XC5A 4LOCA 1ETQA 1QVUA 2KDZA 2XRLA 1JKQC 3GBGA 1I50J 4IEJA 3JRCA 3HGGA 4A3BJ 5E3OA 4MLOA 3BQYA 1S7EA 2LP0A 2DA6A 2EBIA 3IH3A 1TC3C 4XICA 3TP3A 3CMYA 2WV1A 1WI3A 3A01B 1IDZA 3LSRA 1OCTC 4JX4A 3JREA 5BNGA 3JRHA 1WGXA 3BR5A 1ETKA 5F0HA 1VNDA 5E3NA 3O8HA 3A01A 1YRNB 3OSFA 4Y7NJ 2FQ4A 2M0CA 5GPCA 2ID6A 2EZHA 3BTLA 1HCRA 2Y2ZA 1VI0A 2QF7A 4ABZA 4X1EA 2HOAA 2FD5A 4M3FA 1T33A 1A6IA 1JT0A 2N8GA 3MN2A 1YRNA 2H8RA 1WH5A 2FJ1A 4GFBA 9ANTA 1BL0A 3S1MJ 2AHQA 2WB1N 5FKLA 1HDDC 3GTLJ 2P81A 1NTCA 1FIAA 2EH3A 1P7IA 1JTXA 1U78A 4D7MA 2L7MP 5EZHA 1BJZA 4UUSA 3BR3A 5EYRA 3WHCA 5EDNA 3RZOJ 2NVTJ 4A3GJ 2CUFA 4MO7A 2QCOA 1NK2P 3F0CA 1JUPA 4QTRA 4BBSJ 1F36A 1GV5A 5C3EJ 5M5XJ 3ZQLA 5J1YA 1FTTA 1RKTA 5IYBJ 4AUXA 2LD5A 3OIOA 4RBOA 1Z0XA 2M9HA 2Y31A 1HDPA 1OJLA 2CQQA 5FKOA 2JK3A 2D5VA 3H0GJ 1AU7A 2E2JJ 1UMQA 2HXOA 3GTKJ 3IH4A 1ZR2A 2DN0A 4NDLA 2JWTA 4DYQA 2Y30A 3TP0A 2R93J 4XIDA 5K7ZA 2I10A 2NS7A 2K9SA 2Y0SN 1TWFJ 1QRYA 5EEAA 3SFIA 3MKLA 4JX6A 4FCYA 1IUFA 2M8GX 4M3DA 1D5YA 1IJWC 2ZB9A 4JYKA 5IP6A 1I6HJ 4XRMA 5EF6A 4IHVA 2OF7A 3M3YJ 2O8KA 2JN6A 2JA6J 4A3IJ 1H88C 5DS9A 1HF0A 2ELKA 2Y9ZA 4C3JJ 3LSPA 3HOZJ 2DA5A 2XB5A 5M5YJ 2MG4A 2X9DA 1A5JA 1F43A 2XGCA 4I76A 1U8BA 1DU0A 1T56A 3A03A 1AHDP 4DYRA 4A3LJ 2CU7A 2E1OA 3G1OA 2AO9A 5FLMJ 5K7FA 1MBEA 3PM1A 1U9OA 1TWHJ 1MBGA 1IC8A 3GTQJ 1IG7A 3S17J 1TWCJ 3Q0VA 2M2EA 3HOXJ 4BXXJ 2XPVA 1VF9A 4DYCA 4W97A 2DMQA 5IOYA 2CQXA 3BG3A 2DMPA 3UKGA 1VFCA 2COBA 4JX5A 1X2MA 3Q0WA 5F0FA 5FJ8J 2ECCA 1DU6A 1QPIA 4A69C 1W0UA 5E3MA 2JA7J 2HDDA 2KT0A 5FLVA 2LR8A 2ID3A 4D7NA 1RR7A 2LVSA 4CYCB 2DA1A 1MSFC 3TW6A 4UUTA 1POGA 5IPAA 1RPWA 5FKKA 3FISA 4AYBN 4A3KJ 2E19A 4BY1J 3NAUA 1FIPA 3I4NJ 1IV6A 4C3IJ 4CYCA 1GVDA 2R5YB 2LK2A 4DW6A 1Q1VA 2DMTA 3FKIJ 4BKXA 3GTGJ 2GBYA 1R9TJ 2K9QA 1TWAJ 4MFDA 1RESA 3ZQCA 3HOYJ 1MH4A 2XB0X 2YS9A 3HEFA 1RETA 2LY9A 3HM5A 3GTJJ 4M3BA 1MBJA 1MBKA 4XRSA 2R5YA 2FX0A 3JR9A 2ME0A 3GTPJ 2NVYJ 1GT0C 3O8GA 4C2MJ 3S1RJ 4X6AJ 5J1RA 2IAIA 1JKRC 1JGGA 1WCMJ 2JJ7A 1JTYA 3S2DJ 3BTIA 3S1NJ 3LSJA 3G1LA 3BTJA 2LKXA 2VKEA 1ZKGA 3QQAA 3S14J 4FE7A 1JJ6C 3PO3J 3HOVJ 3OSGA 4A3MJ 3RKQA 4M3EA 5JLXA 1JUMA 3RQIA 1ZR4A 3BR0A 2EZKA 2CRGA 1W0TA 1K61A 4BBRJ 1Y1WJ 1P7JA 2LFBA 2DMNA 4MIMA 3JRDA 2WAQN 3CQZJ 1Y1VJ 1FEXA 2MW8A 4IHWA 2G0EA 5F04A 1JKOC 2R0QC 5FKMA 3PO2J 3HDDA 2EZLA 2X48A 5GP9A 2OPTA 2IEKA 1ORKA 2M34A 4L5EA 4XRSG 3GTMJ 1O4XA 2GLOA 1MBFA 4C3HJ 2E2IJ 2LLKA 2JA5J 4JP0A 3HGYA 1B72B 2TCTA 2DA7A 3HOWJ 5JLWA 3FK6A 2NS8A 2EZIA 1HOMA 5F27A 2R7ZJ 5M5WJ 3MVPA 2DJNA 1BA5A 2O9LA 5IP7J 3LNQA 1GUUA 1B72A 3HBLA 1G2HA 1ETWA 4A93J 2E2HJ 3S2HJ 1IRZA 1SFOJ 4QIWN 4HNVA 3C2BA 1LE8B 1RKWA 3QPSA 3BG9A 1PUFB 4B4CA 2MGQA 3E7LA 3BG5A 5EG0B 3JRAA 1GV2A 3ZQHA 3ZQGA 1CQTA 2YU9J 5IOZA 3DEWA 5F08A 4DZPA 3HKZN 3NARA 1LE8A 1TWGJ 1XS9A 5K7HA 1PUFA 1APLC 5EG0A 3BTCA 1LFUP 3BR6A 1AKHB 1BW6A 1QVTA 3B6AA 3S15J 4A3EJ 2HXIA 1XG1A 2L7FP 3HB9A 3IH2A 1SANA 2DTZA 1ENHA 2MSYA 2HOSA 5EZGA 4D5CA 1Z77A 5EGOB 1ZK8A 2DMUA 5F0CA 1AKHA 3D1NI 2R92J 2CJJA 1OFCX 5C4XJ 2NOGA 3SJMA 2HQ5A 2LTPA 5IYDJ 4V2GA 2JMWA 3A02A 3DCFA 5M3MJ 5EGOA 3Q3SA 2TRTA 1JUSA 3OOUA 3BR2A 2JA8J 4J19A 3B6CA 4A3CJ 2RAEA 4W1UA 4M6VA 2PMZN 2VKVA 2XPWA 3ZQIA 2IBDA 4QSHA 3LSGA 3K2AA 2L0KA 1ETOA 5GPAA 4AC0A 3L1PA 3GTOJ 2DA3A 3FK7A 2HYJA 2K40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSD C;  4A3F J;  1U9N A;  3H3V K;  1ZQ3 P;  4UUS B;  1X58 A;  2XPU A;  4Y52 J;  3JRF A;  1IDY A;  3TW7 A;  4FE4 A;  3BR1 A;  1ETV A;  1EF4 A;  2ME6 A;  4BY7 J;  3TED A;  2ECB A;  3I4M J;  1MNM C;  1B8I B;  2W48 A;  1MSE C;  3ZQF A;  5F1J A;  1H8A C;  4M3G A;  4RDU A;  2DA4 A;  1LFB A;  1MBH A;  3FIW A;  1ZTR A;  3M4O J;  4XK4 A;  3G1M A;  2R5Z B;  5C4J J;  1B8I A;  3WHB A;  3BQZ A;  2XGD A;  2L9R A;  4I6Z A;  1JJ8 C;  2GM4 A;  1ETY A;  3HOU J;  3W6V A;  5FKN A;  1FTZ A;  4A3D J;  2HI3 A;  4IHY A;  1OCP A;  3QPL A;  3RZD J;  2R5Z A;  3K7A J;  1X2N A;  2H1K A;  3SDG A;  2O7O A;  5J1U A;  4A3J J;  3CDL A;  4G12 A;  1MH3 A;  4D5F A;  4DZJ A;  2K9N A;  4S0H B;  3S16 J;  5E3L A;  1UG2 A;  3VPR A;  1ZGW A;  3JRG A;  3Q0U A;  2NVQ J;  1UHS A;  4V2F A;  1K83 J;  3BT9 A;  5J3L A;  1ITY A;  1I3Q J;  5IP9 J;  3JRI A;  1NK3 P;  2EQR A;  3LOC A;  1ETX A;  2L7Z A;  5IYC J;  5M3F J;  2XGE A;  2X6O A;  2Y9Y A;  1H89 C;  2DA2 A;  3ZOB A;  2VI6 A;  4B3A A;  3JRB A;  1IGN A;  1WH7 A;  2VUM J;  5DTD A;  1GDT A;  4FIS A;  3S1Q J;  4FTH A;  4MFE A;  1HLV A;  1WPK A;  2VPR A;  1FJL A;  1JKP C;  1E3O C;  2B63 J;  4EEF G;  4B1R A;  5HOD A;  3CCY A;  2HOT A;  2NVX J;  3IV5 A;  1BW5 A;  2CUE A;  2YUS A;  4IHX A;  5C44 J;  1JT6 A;  1XC5 A;  4LOC A;  1ETQ A;  1QVU A;  2KDZ A;  2XRL A;  1JKQ C;  3GBG A;  1I50 J;  4IEJ A;  3JRC A;  3HGG A;  4A3B J;  5E3O A;  4MLO A;  3BQY A;  1S7E A;  2LP0 A;  2DA6 A;  2EBI A;  3IH3 A;  1TC3 C;  4XIC A;  3TP3 A;  3CMY A;  2WV1 A;  1WI3 A;  3A01 B;  1IDZ A;  3LSR A;  1OCT C;  4JX4 A;  3JRE A;  5BNG A;  3JRH A;  1WGX A;  3BR5 A;  1ETK A;  5F0H A;  1VND A;  5E3N A;  3O8H A;  3A01 A;  1YRN B;  3OSF A;  4Y7N J;  2FQ4 A;  2M0C A;  5GPC A;  2ID6 A;  2EZH A;  3BTL A;  1HCR A;  2Y2Z A;  1VI0 A;  2QF7 A;  4ABZ A;  4X1E A;  2HOA A;  2FD5 A;  4M3F A;  1T33 A;  1A6I A;  1JT0 A;  2N8G A;  3MN2 A;  1YRN A;  2H8R A;  1WH5 A;  2FJ1 A;  4GFB A;  9ANT A;  1BL0 A;  3S1M J;  2AHQ A;  2WB1 N;  5FKL A;  1HDD C;  3GTL J;  2P81 A;  1NTC A;  1FIA A;  2EH3 A;  1P7I A;  1JTX A;  1U78 A;  4D7M A;  2L7M P;  5EZH A;  1BJZ A;  4UUS A;  3BR3 A;  5EYR A;  3WHC A;  5EDN A;  3RZO J;  2NVT J;  4A3G J;  2CUF A;  4MO7 A;  2QCO A;  1NK2 P;  3F0C A;  1JUP A;  4QTR A;  4BBS J;  1F36 A;  1GV5 A;  5C3E J;  5M5X J;  3ZQL A;  5J1Y A;  1FTT A;  1RKT A;  5IYB J;  4AUX A;  2LD5 A;  3OIO A;  4RBO A;  1Z0X A;  2M9H A;  2Y31 A;  1HDP A;  1OJL A;  2CQQ A;  5FKO A;  2JK3 A;  2D5V A;  3H0G J;  1AU7 A;  2E2J J;  1UMQ A;  2HXO A;  3GTK J;  3IH4 A;  1ZR2 A;  2DN0 A;  4NDL A;  2JWT A;  4DYQ A;  2Y30 A;  3TP0 A;  2R93 J;  4XID A;  5K7Z A;  2I10 A;  2NS7 A;  2K9S A;  2Y0S N;  1TWF J;  1QRY A;  5EEA A;  3SFI A;  3MKL A;  4JX6 A;  4FCY A;  1IUF A;  2M8G X;  4M3D A;  1D5Y A;  1IJW C;  2ZB9 A;  4JYK A;  5IP6 A;  1I6H J;  4XRM A;  5EF6 A;  4IHV A;  2OF7 A;  3M3Y J;  2O8K A;  2JN6 A;  2JA6 J;  4A3I J;  1H88 C;  5DS9 A;  1HF0 A;  2ELK A;  2Y9Z A;  4C3J J;  3LSP A;  3HOZ J;  2DA5 A;  2XB5 A;  5M5Y J;  2MG4 A;  2X9D A;  1A5J A;  1F43 A;  2XGC A;  4I76 A;  1U8B A;  1DU0 A;  1T56 A;  3A03 A;  1AHD P;  4DYR A;  4A3L J;  2CU7 A;  2E1O A;  3G1O A;  2AO9 A;  5FLM J;  5K7F A;  1MBE A;  3PM1 A;  1U9O A;  1TWH J;  1MBG A;  1IC8 A;  3GTQ J;  1IG7 A;  3S17 J;  1TWC J;  3Q0V A;  2M2E A;  3HOX J;  4BXX J;  2XPV A;  1VF9 A;  4DYC A;  4W97 A;  2DMQ A;  5IOY A;  2CQX A;  3BG3 A;  2DMP A;  3UKG A;  1VFC A;  2COB A;  4JX5 A;  1X2M A;  3Q0W A;  5F0F A;  5FJ8 J;  2ECC A;  1DU6 A;  1QPI A;  4A69 C;  1W0U A;  5E3M A;  2JA7 J;  2HDD A;  2KT0 A;  5FLV A;  2LR8 A;  2ID3 A;  4D7N A;  1RR7 A;  2LVS A;  4CYC B;  2DA1 A;  1MSF C;  3TW6 A;  4UUT A;  1POG A;  5IPA A;  1RPW A;  5FKK A;  3FIS A;  4AYB N;  4A3K J;  2E19 A;  4BY1 J;  3NAU A;  1FIP A;  3I4N J;  1IV6 A;  4C3I J;  4CYC A;  1GVD A;  2R5Y B;  2LK2 A;  4DW6 A;  1Q1V A;  2DMT A;  3FKI J;  4BKX A;  3GTG J;  2GBY A;  1R9T J;  2K9Q A;  1TWA J;  4MFD A;  1RES A;  3ZQC A;  3HOY J;  1MH4 A;  2XB0 X;  2YS9 A;  3HEF A;  1RET A;  2LY9 A;  3HM5 A;  3GTJ J;  4M3B A;  1MBJ A;  1MBK A;  4XRS A;  2R5Y A;  2FX0 A;  3JR9 A;  2ME0 A;  3GTP J;  2NVY J;  1GT0 C;  3O8G A;  4C2M J;  3S1R J;  4X6A J;  5J1R A;  2IAI A;  1JKR C;  1JGG A;  1WCM J;  2JJ7 A;  1JTY A;  3S2D J;  3BTI A;  3S1N J;  3LSJ A;  3G1L A;  3BTJ A;  2LKX A;  2VKE A;  1ZKG A;  3QQA A;  3S14 J;  4FE7 A;  1JJ6 C;  3PO3 J;  3HOV J;  3OSG A;  4A3M J;  3RKQ A;  4M3E A;  5JLX A;  1JUM A;  3RQI A;  1ZR4 A;  3BR0 A;  2EZK A;  2CRG A;  1W0T A;  1K61 A;  4BBR J;  1Y1W J;  1P7J A;  2LFB A;  2DMN A;  4MIM A;  3JRD A;  2WAQ N;  3CQZ J;  1Y1V J;  1FEX A;  2MW8 A;  4IHW A;  2G0E A;  5F04 A;  1JKO C;  2R0Q C;  5FKM A;  3PO2 J;  3HDD A;  2EZL A;  2X48 A;  5GP9 A;  2OPT A;  2IEK A;  1ORK A;  2M34 A;  4L5E A;  4XRS G;  3GTM J;  1O4X A;  2GLO A;  1MBF A;  4C3H J;  2E2I J;  2LLK A;  2JA5 J;  4JP0 A;  3HGY A;  1B72 B;  2TCT A;  2DA7 A;  3HOW J;  5JLW A;  3FK6 A;  2NS8 A;  2EZI A;  1HOM A;  5F27 A;  2R7Z J;  5M5W J;  3MVP A;  2DJN A;  1BA5 A;  2O9L A;  5IP7 J;  3LNQ A;  1GUU A;  1B72 A;  3HBL A;  1G2H A;  1ETW A;  4A93 J;  2E2H J;  3S2H J;  1IRZ A;  1SFO J;  4QIW N;  4HNV A;  3C2B A;  1LE8 B;  1RKW A;  3QPS A;  3BG9 A;  1PUF B;  4B4C A;  2MGQ A;  3E7L A;  3BG5 A;  5EG0 B;  3JRA A;  1GV2 A;  3ZQH A;  3ZQG A;  1CQT A;  2YU9 J;  5IOZ A;  3DEW A;  5F08 A;  4DZP A;  3HKZ N;  3NAR A;  1LE8 A;  1TWG J;  1XS9 A;  5K7H A;  1PUF A;  1APL C;  5EG0 A;  3BTC A;  1LFU P;  3BR6 A;  1AKH B;  1BW6 A;  1QVT A;  3B6A A;  3S15 J;  4A3E J;  2HXI A;  1XG1 A;  2L7F P;  3HB9 A;  3IH2 A;  1SAN A;  2DTZ A;  1ENH A;  2MSY A;  2HOS A;  5EZG A;  4D5C A;  1Z77 A;  5EGO B;  1ZK8 A;  2DMU A;  5F0C A;  1AKH A;  3D1N I;  2R92 J;  2CJJ A;  1OFC X;  5C4X J;  2NOG A;  3SJM A;  2HQ5 A;  2LTP A;  5IYD J;  4V2G A;  2JMW A;  3A02 A;  3DCF A;  5M3M J;  5EGO A;  3Q3S A;  2TRT A;  1JUS A;  3OOU A;  3BR2 A;  2JA8 J;  4J19 A;  3B6C A;  4A3C J;  2RAE A;  4W1U A;  4M6V A;  2PMZ N;  2VKV A;  2XPW A;  3ZQI A;  2IBD A;  4QSH A;  3LSG A;  3K2A A;  2L0K A;  1ETO A;  5GPA A;  4AC0 A;  3L1P A;  3GTO J;  2DA3 A;  3FK7 A;  2HYJ A;  2K40 A; 
#chains in the Genus database with same CATH topology
 2P0W A;  4IPA A;  1ZQ3 P;  2XPU A;  5KAI C;  5H6Q A;  1BOB A;  4DGW B;  2NVU B;  2ZXI A;  2NNY A;  1AA7 A;  4I99 C;  5CQG A;  4L5I A;  4KIF A;  1ETV A;  3L7W A;  1EF4 A;  3TED A;  5FD6 A;  3I4M J;  3CC2 I;  2FXA A;  1MNM C;  1X3Z B;  3LFK A;  2MD5 A;  2W48 A;  4NUB A;  3OS2 A;  2R7W A;  3ZQF A;  5F1J A;  3CDI A;  3CCU I;  5TJJ A;  3NEU A;  1LFB A;  1B9N A;  5IT9 K;  1WFX A;  2A6E F;  2MFZ A;  1I5Z A;  1SD5 A;  1QPM A;  2PLY A;  1S6L A;  5C4J J;  3WHB A;  4BGD A;  2Y0S A;  3HL2 A;  1JJ8 C;  2FE3 A;  1ETY A;  5ED4 A;  2W00 A;  3HOU J;  5EJC A;  4RAY A;  3DU5 A;  3H5A A;  4BH9 A;  5CVJ A;  1W36 C;  1OCP A;  5E18 F;  1TL8 A;  1YHQ I;  4E7J A;  5D5U B;  3BC8 A;  1X2N A;  2HDC A;  1X3W B;  1KU7 A;  2K85 A;  4A3J J;  1KYZ A;  4DZJ A;  2KRC A;  3S16 J;  4FHT A;  5E3L A;  4HW0 A;  2KKO A;  1ZGW A;  1NH3 A;  4UV8 A;  3CCS I;  2NVQ J;  1OMI A;  1ON2 A;  1UHS A;  3CDH A;  4GCV A;  3SQN A;  1J2X A;  2J5P A;  1XDS A;  5IYC J;  1WWX A;  4P1W A;  2A05 A;  2XAS A;  1H9T A;  2VOO A;  3ZOB A;  3JRB A;  4N9H A;  1IGN A;  1WSU A;  1W5C C;  1TNS A;  5F64 A;  3OYN A;  3TDU C;  2FML A;  3L09 A;  4MFE A;  2RVC A;  1B4A A;  2UUZ A;  3D5R C;  4HEA 2;  1OR7 A;  4B1R A;  1YS7 A;  2HOT A;  4EGZ A;  2NVX J;  3ERM A;  3IV5 A;  1BW5 A;  5B1A H;  2BE5 F;  4IHX A;  4OIP F;  2XSJ C;  3K4N A;  3L2W A;  1WJF A;  3DBL B;  3F23 A;  2XRL A;  2GIV A;  3GBG A;  5K1Y A;  1STZ A;  4H4K C;  1BR1 A;  3CMA I;  2V6E A;  2CV0 A;  2IPQ X;  1P6R A;  1XSV A;  4UVA A;  3IAM 2;  2QQ8 A;  1S7E A;  2LP0 A;  2DYS H;  3ML6 A;  2DA6 A;  1Z6R A;  2L02 A;  2GA1 A;  3QP6 A;  4HQE A;  4PGG A;  1TC3 C;  3WTX C;  3B73 A;  4II2 A;  3OV8 A;  2E7X A;  3TP3 A;  3CMY A;  3OS0 A;  1R00 A;  1GXP A;  3LSR A;  4JX4 A;  1WGX A;  3BR5 A;  5L3C A;  2VBX A;  1OYW A;  3T5X A;  3QU3 A;  1BR4 A;  1ETK A;  5HOO A;  2HS5 A;  1U2W A;  1BN5 A;  1MNE A;  1BBY A;  4YII A;  3QRF F;  3O8H A;  3QWL A;  2EA2 A;  1V5G A;  2QA4 I;  1WJA A;  1VQ9 I;  4YIF A;  1HCR A;  2FBK A;  3KP4 A;  3SEQ A;  2Y2Z A;  3IAS 2;  3MZH A;  2HDW A;  4X1E A;  2LY1 A;  4ZDO A;  2FD5 A;  4M3F A;  2N8G A;  1D1A A;  4PJL A;  1RZ4 A;  3CCM I;  3C3W A;  1J09 A;  5JFR A;  1TLH B;  9ANT A;  4L9N A;  4ZYH A;  2RNG A;  5L3E A;  2WB1 N;  1RRJ A;  3NWT A;  2A69 F;  1XSX A;  2P81 A;  2XF7 A;  1NTC A;  1FIA A;  2EH3 A;  4G8X A;  1JTX A;  2R7R A;  3P7N A;  3DU6 A;  4EJO A;  2L7M P;  5JHF A;  2YU3 A;  1QO0 D;  3TMO A;  1BJZ A;  2X6X A;  4XOP A;  3WHC A;  4A3G J;  2NVT J;  2D1V A;  1O57 A;  4LG3 A;  2CUF A;  2CYY A;  4E4H A;  1S7O A;  4QTR A;  5C3E J;  1R4M B;  3MD2 A;  1EH8 A;  2W84 A;  3GO5 A;  1T0F C;  2M9H A;  5F1R A;  3E5Q A;  3KE2 A;  5LRR A;  3K4L A;  2MC4 A;  4L9T A;  4ESF A;  4HAM A;  4GYG A;  1UMQ A;  2ZME C;  3GTK J;  4N9I A;  3RQ4 A;  3BG6 A;  3HOS A;  4JQF A;  1JI8 A;  3QYF A;  2XRN A;  3VOD A;  2Y30 A;  1MMS A;  2R93 J;  2K9S A;  1X1B A;  4CDG A;  2CFO A;  1QRY A;  5B1B H;  3SFI A;  1YJN I;  1IUF A;  4M3D A;  1Y39 A;  3LQR A;  2ZNY A;  1ZH5 A;  4UB8 C;  1REP C;  1G8X A;  1KU3 A;  2L5Q A;  2MYS A;  2BV6 A;  1XCB A;  2TDX A;  4IHV A;  3M3Y J;  2Y75 A;  3HC7 A;  3L2U A;  1H88 C;  2NRA C;  5B5E C;  1HKQ A;  1HF0 A;  3CF2 A;  1RIO H;  2ELK A;  2Y9Z A;  1OQY A;  2HU9 A;  3BJA A;  5L3D A;  2ZNZ A;  2ZJ2 A;  3W2A A;  2VT2 A;  4LK1 F;  4A3L J;  2E1O A;  2QEX I;  4J00 A;  2EB7 A;  1Y6I A;  2MA3 A;  2EFQ A;  1VZ0 A;  3KP6 A;  1FOX A;  2F5D A;  5HVQ C;  3PM1 A;  1IC8 A;  1W5T A;  2WV0 A;  1TWC J;  3DV8 A;  2WY8 Q;  3R6S A;  1MD0 A;  2RC4 A;  4P55 A;  2DMQ A;  1LEA A;  1G3T A;  5IOY A;  1FBS A;  3BG3 A;  3T0Y A;  1Z9C A;  5E8G A;  3PNY A;  2V7F A;  4JX5 A;  1ZG3 A;  1A36 A;  1ZRE A;  5F0F A;  3HTS B;  2ECC A;  3QOE A;  1DU6 A;  3F8M A;  1T8I A;  5E3M A;  2FUG 2;  2QVO A;  1WJB A;  1LVA A;  3RDI A;  2E36 A;  4M73 A;  5H20 A;  4XSZ F;  3IRQ A;  2ID3 A;  5DM6 F;  1VQM I;  3OOP A;  1MMD A;  4LLG F;  2G7U A;  2KIQ A;  2KDO A;  2HR3 A;  1R23 A;  3QOD A;  3FXU A;  3SYT A;  3TW6 A;  4UUT A;  3KP2 A;  1DGR M;  2GXA A;  3GW2 A;  1RPW A;  2M1B A;  2DYR H;  4DIQ A;  3FIS A;  1IF1 A;  1Z7U A;  1VQ6 I;  2JTV A;  2GQQ A;  3CO6 C;  3DBR B;  4A3K J;  5J40 A;  2Z99 A;  3ZQQ A;  4E7S A;  4KN7 X;  4BY1 J;  3NAU A;  1FIP A;  4NBQ A;  3N97 A;  3KYL A;  1GVD A;  2ESH A;  4RLQ A;  2R5Y B;  2B9S A;  4UV9 A;  1MMA A;  1ERD A;  3HRT A;  4RMN A;  3FKI J;  3K70 D;  2VBW A;  2XAG A;  4WXC A;  4MFD A;  1R22 A;  2WB1 A;  4CGZ A;  1K6O A;  1TW3 A;  1WJC A;  1MKM A;  2X1D A;  3PQJ A;  3HYI A;  2R4G A;  4PSX A;  1UAA A;  3HM5 A;  3V4G A;  4M3B A;  2VE8 A;  4X0G A;  2R5Y A;  2FX0 A;  3TO6 A;  3L2R A;  3T1B A;  2KZG A;  2HFH A;  5EEH A;  1GT0 C;  4E7L A;  3S1R J;  4UXN A;  4CXF A;  5DD4 A;  5J1R A;  2IAI A;  2P5K A;  2XUB A;  1O3S A;  1OYI A;  3G1L A;  2O5R A;  1T95 A;  1WJD A;  4RM3 A;  4HG2 A;  6PAX A;  1IUY A;  1RR8 C;  2B0L A;  1UFM A;  4DOZ A;  2CO5 A;  2K9M A;  4I02 A;  3PO3 J;  2R7X A;  3D5S C;  1C0W A;  4UHT A;  3CME I;  1FOK A;  1XGO A;  2DFH A;  2XAF A;  2FBI A;  4YEL A;  1VQO I;  1ZR4 A;  4AM3 A;  2F5V A;  2FF4 A;  2O0Y A;  1PJR A;  2HGC A;  1Y8R B;  3F6O A;  2IW5 A;  3ISP A;  2OCE A;  3RCO A;  3S8P A;  4PFP A;  3SZP A;  1DP7 P;  2MW8 A;  2UZK A;  1UST A;  5F04 A;  4IO9 F;  1KGS A;  5IT3 A;  1SFU A;  1LUJ B;  4HNT A;  2X48 A;  1BIA A;  1Z21 A;  1TQP A;  4U0Y A;  2IEK A;  4L5E A;  5DM7 F;  1HXD A;  1YTY A;  2LLK A;  3F8N A;  3H1C A;  4EV0 A;  3PFI A;  4ZTJ A;  1VQ5 I;  4RAG A;  5DDG A;  2TCT A;  3F8C A;  3HOW J;  4EMS A;  5JLW A;  3KCC A;  2NS8 A;  2EZI A;  4QPQ A;  1Z3X A;  2ZFW A;  5M5W J;  5CVV A;  2FNP A;  2MH2 A;  1HKT A;  4HDV A;  4ESB A;  2OJE D;  3MZY A;  4RAZ A;  3HBL A;  1G2H A;  1ETW A;  1G3W A;  3CES A;  3FXO A;  1YJW I;  4O3M A;  3FMS A;  3AG1 H;  2FNA A;  3WTU C;  2LC2 A;  3S2H J;  3L2Q A;  2HQR A;  1FSH A;  1R7J A;  2QQA A;  4G6Q A;  2L54 A;  3K70 C;  2ISZ A;  5EG0 B;  3JRA A;  2L4A A;  2DK5 A;  4YFK F;  4U0V A;  2UXX A;  3AFH A;  3KEQ A;  1XMK A;  5F08 A;  5LBQ A;  2HKO A;  1WI9 A;  2E1M C;  1YX3 A;  2M7B A;  5BQT A;  2IS6 A;  1BJA A;  4A2U A;  5EG0 A;  3BTC A;  1LFU P;  1FYL A;  2LRE A;  3BR6 A;  4XLF A;  3S15 J;  2W57 A;  3ECO A;  2CW8 A;  2DBB A;  3HB9 A;  3P9I A;  1SAN A;  2M3A A;  4ESJ A;  2PI0 A;  3P9C A;  4LMY A;  1ENH A;  1T98 A;  5EZG A;  3JSP A;  1HSJ A;  2DMU A;  3F8F A;  4Z2Y A;  2VJJ A;  2R92 J;  3DKX A;  4LGW A;  3H36 A;  2JSC A;  3S3O A;  4QLC U;  1OFC X;  2BOL A;  3M9A A;  2LTP A;  3VWB A;  2R7Q A;  2Y48 A;  5FLX K;  3OWT A;  4LLL A;  1UB9 A;  4NQW B;  4HF2 A;  1T6S A;  2RAE A;  2WAD A;  3ASN H;  1D0X A;  2KIU A;  2PMZ N;  2XPW A;  3HSR A;  3AL0 C;  1QHH D;  4CCM A;  1TT0 A;  1LFP A;  1EKE A;  4YG2 F;  2K02 A;  3W2V A;  3IKV A;  3R0J A;  3L1P A;  4NQW A;  3MKY B;  2DA3 A;  3OL3 A;  3ESW B;  3FK7 A;  1YYV A;  2F4M B;  3KP7 A;  5A2Q K;  3KX2 A;  5D6E A;  4KT6 A;  4A3F J;  1U9N A;  2QLZ A;  3I3L A;  2DOA A;  1X58 A;  5GTH C;  4Y52 J;  4LK0 F;  5JI6 A;  4ZTF A;  4XLC A;  4D0P A;  3DPT A;  4MTD A;  4CCO A;  1F4K A;  2R7S A;  1Y8Q B;  3TO7 A;  4FE4 A;  2QQB A;  1PDN C;  4B8X A;  1J75 A;  3EPZ A;  2ME6 A;  3H9G A;  4BY7 J;  1N77 A;  5HS8 A;  3A4C A;  5FGM A;  4UY8 I;  2A3S A;  2DT5 A;  2KIS A;  1MSE C;  4OMZ A;  3TL4 X;  4M3G A;  4RDU A;  1YW9 A;  2DA4 A;  3F3X A;  5DEQ A;  3S3N A;  4U88 A;  4IL6 C;  5LGN A;  4R8H A;  3FXR A;  3G1M A;  2ELJ A;  4RS8 A;  3BQZ A;  2KPM A;  2XGD A;  4F55 A;  3OYJ A;  4I6Z A;  3Q5F A;  2R7V A;  4MHG A;  3IP4 B;  4TV7 A;  3OYH A;  2DXI A;  2O3F A;  1XMX A;  5FKN A;  1S72 I;  1P9Q C;  2DTR A;  2HI3 A;  4IHY A;  1D1C A;  3QPL A;  4IF4 A;  2DDB A;  2PQ8 A;  1TW2 A;  5LHG A;  3SDG A;  5LGT A;  4OMY A;  3C1D A;  4PJM A;  1XGS A;  1RC9 A;  4D5F A;  4YIR X;  2W4S A;  2K9N A;  3EUH C;  2RN7 A;  3HRU A;  4ZH4 F;  2EFW A;  5J3L A;  4RGX A;  1AOY A;  1YW7 A;  2WY7 Q;  4B44 A;  1ITY A;  5IP9 J;  4EAT A;  1ETX A;  2L7Z A;  5M3F J;  2X6O A;  2Y9Y A;  1H89 C;  2XHK A;  2VUM J;  2VI6 A;  1BI2 A;  2HVQ A;  4HX7 A;  1V3F A;  1WH7 A;  4IVN A;  4B3A A;  1BI3 A;  1GDT A;  2JUG A;  2XKO A;  4CUG A;  4OOI A;  3AG2 H;  3FBI B;  4FTH A;  1MMG A;  3ZRG A;  2VPR A;  2B63 J;  1E3O C;  1V55 H;  2GZW A;  1G6N A;  4C30 A;  5LLQ A;  4XLP F;  1SMT A;  1VQ4 I;  4M9Z A;  3DTK A;  4R79 A;  2F5E A;  2HQA A;  5LHI A;  5C44 J;  1QZZ A;  4LOC A;  3FF5 A;  1QVU A;  3DFG A;  4NC8 A;  3H9Q A;  1NHA A;  4FQG A;  2ZFU A;  3K9T A;  2XVC A;  1L0O C;  2BZT A;  3PFY A;  2KIF A;  5GAE J;  3HGG A;  3WGI A;  2FU4 A;  2QGU A;  4MLO A;  4WX9 A;  3BQY A;  2VAS A;  3OYK A;  1IW7 F;  4MQ9 F;  3JAM Z;  2BY1 A;  1I6X A;  1HA8 A;  3FM3 A;  1ULY A;  1WI3 A;  1IDZ A;  2V1X A;  2UWM A;  3HOT A;  1D0Z A;  2AXT C;  3IL2 A;  3G2B A;  3JRE A;  1ZHF A;  4XN3 A;  5BNG A;  3JRH A;  4PSW A;  3LSM A;  5DUK A;  1YLF A;  2R7U A;  2BVM A;  1UHM A;  5HLI A;  3OYA A;  2GAU A;  1VND A;  2H94 A;  3DEU A;  3V42 A;  5D5W B;  3AL0 B;  3OYE A;  3H92 A;  1DQU A;  3WU1 B;  2M0C A;  4UUV A;  2M7A A;  4I0A A;  2CW7 A;  1R49 A;  1DPR A;  1VI0 A;  2QF7 A;  3VOE A;  2M0M A;  1BR2 A;  2VPL A;  1T38 A;  1JT0 A;  3MN2 A;  4F91 B;  1WH5 A;  2WBM A;  2DT6 A;  3S93 A;  2HQN A;  4ENJ A;  3BG7 A;  1T08 B;  1IZ1 A;  1XSD A;  4OIO F;  4Y15 A;  1XPX A;  1BL0 A;  1PP7 U;  2GXB A;  1G59 A;  4BHC A;  4BHB A;  2CV1 A;  3PIP F;  5FKL A;  4MNU A;  1HDD C;  3FWE A;  5GAG J;  1Y0N A;  5IY5 H;  3ZXS A;  1E17 A;  2W85 A;  3U9G A;  1P7I A;  2WAF A;  2AQE A;  4Z6Y A;  1LDJ A;  2IT0 A;  3M7G A;  2M8E A;  3BR3 A;  5BMZ A;  5EYR A;  4D1Q A;  3N4M A;  1VQ7 I;  3OYF A;  2V1U A;  1ACI A;  2O03 A;  2V9K A;  2X1E A;  4MO7 A;  2QCO A;  3TBI A;  2IXS A;  5LGU A;  2OTJ I;  3LA3 A;  3CJQ B;  3WG9 A;  1RKT A;  5IYB J;  1XMA A;  1UZC A;  2LD5 A;  3E5X A;  3OIO A;  2IS1 A;  4RBO A;  2Y31 A;  4G6D A;  1OJL A;  1WRJ A;  4M9S A;  4N0B A;  5FKO A;  3HIF A;  2CUJ A;  2DJI A;  1AU7 A;  4M9X A;  2HXO A;  2DN0 A;  4HQM A;  1ON1 A;  2X51 A;  3E97 A;  5TGT A;  3DBH B;  3IHU A;  2O6G E;  3TP0 A;  2A68 F;  4B47 A;  4XID A;  1K78 B;  3G4S I;  2K7L A;  3E1S A;  5K7Z A;  5FB2 A;  1UJ8 A;  3ZN0 A;  2CFX A;  2L2O A;  3DLL F;  2M8G X;  2VT3 A;  3VB2 A;  1IJW C;  3ZMD A;  3K1M A;  1ODD A;  4G94 A;  5IP6 A;  1MDM B;  4XR6 A;  1K78 A;  1R6R A;  2H27 A;  2GXG A;  3M1C A;  2OF7 A;  3MZ8 A;  2H6C A;  2LNB A;  3EUH A;  3IC7 A;  4HPQ A;  4E7I A;  4CH7 A;  2ISY A;  2LF8 A;  4IQ4 A;  4N4N B;  1FBU A;  1MIJ A;  2MH9 A;  3J80 K;  4P96 A;  4AWX B;  3HOZ J;  1MDM A;  5ICC A;  1IXS B;  1I39 A;  4KIC A;  4EM0 B;  1F43 A;  2L01 A;  4I76 A;  5E20 A;  2MBF A;  3CCV I;  1QBJ A;  2Z5U A;  4GXO A;  3WE3 A;  1EJ9 A;  1O7L A;  2RNJ A;  3PQK A;  3A03 A;  3CUQ B;  1AHD P;  2QSH X;  3MWM A;  2BHZ A;  4ENM A;  2BXY A;  3G1O A;  1S29 A;  2M5W A;  1EA3 A;  2BY0 A;  4U7B A;  4LB6 B;  4F7Z A;  2PBI A;  1GXQ A;  1TWH J;  1MBG A;  3U1D A;  4DJA A;  4HV5 A;  1PP8 F;  1O3T A;  3CUQ A;  1IG7 A;  3GTQ J;  3S17 J;  3HOX J;  4BXX J;  2Z2S B;  2H09 A;  2H8W A;  4E7K A;  3EET A;  3IWZ A;  4DYC A;  1IN7 A;  3L9F A;  4RGU A;  1IAW A;  4W97 A;  5D8K B;  1X1C A;  1EH6 A;  3ABU A;  1E3H A;  4EM1 A;  4AIK A;  4CCN A;  4LJZ F;  4CCK A;  1X2M A;  2PEX A;  1J59 A;  1MJB A;  1YG2 A;  4M72 A;  4WXD A;  1QPI A;  4A69 C;  2ZKZ A;  1SFK A;  1I3A A;  2KT0 A;  1FNN A;  3GZN B;  3LA7 A;  2EIM H;  5DYM A;  5JVT A;  2LR8 A;  2QZ8 A;  4L9V A;  4IKF A;  1P4W A;  1RR7 A;  3DKY A;  2AQF A;  2CUZ A;  3F72 A;  2LVS A;  2DT7 B;  2GOM A;  1KYW A;  2DA1 A;  3U2R A;  4HRI A;  5FKK A;  2JQ7 A;  3QP5 A;  4L18 B;  1A6Q A;  2E19 A;  3M8J A;  1BI1 A;  5HNH A;  2LOO A;  2EIN H;  4ZZD A;  2DK8 A;  2Y0M A;  2WA0 A;  4I01 A;  3K1N A;  3WGG A;  4C3I J;  2XC7 A;  2LH9 A;  4CZC A;  3OIP A;  4WF2 A;  1Q1V A;  2DMT A;  2W1O A;  4HX8 A;  4BKX A;  1R9T J;  2YX4 A;  5HLT A;  5J4Y A;  3HOY J;  1YI2 I;  1FYK A;  1P92 A;  2Z3Y A;  2LY9 A;  2FEZ A;  1K7A A;  1G3Y A;  4XSX F;  5E1X A;  3GTJ J;  5JHU A;  3F21 A;  1MBK A;  3ZMS A;  3C18 A;  3JR9 A;  2LYC A;  3W6K B;  2NVY J;  3J81 Z;  5HDK A;  2BGC A;  3NWS A;  3H3U A;  3O8G A;  2YPR A;  4C2M J;  2P6S A;  1KON A;  4U87 A;  1WCM J;  1S7A A;  1RUN A;  2QUF A;  4P9U A;  3BTI A;  3S1N J;  3RSN A;  1ZKG A;  4NC7 A;  4BAC A;  4KFC A;  2OC6 A;  3V7R A;  3S14 J;  3GFJ A;  2JT1 A;  5GTI C;  4BQN A;  3HOV J;  2EIJ H;  4A3M J;  3DEE A;  2L9N A;  3CUO A;  5LRS A;  5JLX A;  4C9Y A;  1WJE A;  2XRO A;  3BR0 A;  2EZK A;  3TKY A;  3G3Z A;  2NOJ B;  1W0T A;  1R5G A;  3PUB A;  1X4O A;  1X1D A;  4CCJ A;  1Y1W J;  2VKH A;  2DMN A;  3JRD A;  2WAQ N;  5CLS A;  3GYH X;  1Z6T A;  1SVL A;  4CO8 A;  4ZYG A;  1FEX A;  4IHW A;  4QWQ A;  2G0E A;  1KZH A;  4H0E A;  3M8F A;  1VTN C;  4MEX F;  5FKM A;  2FMY A;  2A6H F;  3HDD A;  5GAD J;  3S2W A;  3RPU D;  3RI4 A;  2M34 A;  3DWL E;  3ZGK A;  4IX7 A;  1O4X A;  2CGP A;  2E2I J;  3BZK A;  1JXS A;  1HQC A;  2V79 A;  4ZYA A;  3SEZ A;  1TP4 A;  1YOV B;  3O3K A;  3KEO A;  1E0E A;  1HOM A;  3B02 A;  5HS9 A;  2P6T A;  2IGO A;  3HHG A;  2M4G A;  3FHZ A;  4HDU A;  3HPG A;  4A93 J;  3H5R A;  1BOA A;  2ZC2 A;  1HW5 A;  4MEY F;  2V4J C;  2IGM A;  3KZY A;  4QIW N;  3VYT B;  3GCM A;  4HNV A;  1W1W E;  3Q9V A;  3LWF A;  2V9P A;  4B4C A;  2MGQ A;  1IXC A;  2FA5 A;  1EV7 A;  1GV2 A;  3ZQG A;  3BJO A;  3REO A;  5IOZ A;  3DEW A;  5ILS A;  5D5X B;  4A0Z A;  2NNN A;  2R7T A;  4UVC A;  1TWG J;  1IXR C;  5K7H A;  2EWN A;  3GLL A;  2E60 A;  4YFN F;  1APL C;  2CWE A;  1AKH B;  3OYI A;  2HXI A;  1XG1 A;  4LB5 A;  5LEJ A;  2DU9 A;  1R58 A;  2QM3 A;  3BDD A;  3I58 A;  3IH2 A;  2E1C A;  5LHH A;  2DTZ A;  3AG4 H;  1VQP I;  4OIR F;  3LFU A;  2HOS A;  5LFA A;  5EGO B;  4BU2 A;  4AIH A;  1AKH A;  1HST A;  3D1N I;  1N75 A;  3VYU B;  4BHP A;  2KMU A;  1W5S A;  5BOX A;  2NOG A;  3WGH A;  1SMY F;  4I09 A;  3GZ5 A;  2HQ5 A;  3BZC A;  3FMR A;  3IWF A;  4V2G A;  3H35 A;  3A02 A;  1FZP B;  2DI3 A;  1FX7 A;  5EGO A;  4U7D A;  3CF5 F;  1BC7 C;  5FD5 A;  1SD7 A;  4A12 A;  2JA8 J;  1J7K A;  1QGP A;  4M6V A;  1X3U A;  1V54 H;  2DOF A;  1R1U A;  3E6C C;  4BYY A;  1OCC H;  1SVM A;  1WJ5 A;  3ZCO A;  5CPR B;  4QSH A;  2P5V A;  3LSG A;  5KK1 A;  4BXU A;  1DP3 A;  3L00 A;  3I9V 2;  4NNJ A;  4Y17 A;  5E1Z B;  3QYB A;  1ETO A;  2EFP A;  4II3 A;  4AC0 A;  4IOC F;  3GTO J;  3TDZ C;  3LAP A;  2XAQ A;  3CC4 I;  3QPT A;  1SFX A;  5E8I A;  2WTE A;  2K40 A;  5BPD A;  2XSD C;  3CCQ I;  5LEK A;  1QZY A;  5IT9 Z;  3C7J A;  2O8X A;  4UUS B;  4Y3O A;  5CYV A;  3E5U A;  2D45 A;  2IS2 A;  2EV5 A;  3AG3 H;  2XGX A;  2X0L A;  4IZZ A;  4PK4 A;  5AON A;  3OYD A;  2VBZ A;  3JRF A;  1ZGA A;  4RLF A;  3R60 A;  2DDA A;  3BR1 A;  4G7Z F;  2JPC A;  2F5C A;  2KP6 A;  4XKW A;  5J8F A;  4A5N A;  2XF5 A;  2ECB A;  2KZV A;  2VIX A;  2ZME B;  3R4K A;  1B8I B;  3H0D A;  1ONV A;  5F6F A;  1T0F A;  2ESN A;  3RYP A;  1YIJ I;  1FT9 A;  1ZTR A;  1K4S A;  4HF1 A;  2WAQ A;  3SHF A;  1IV8 A;  2MLK A;  2K4B A;  2R5Z B;  2G9W A;  2ZME A;  3K2Z A;  1B8I A;  4IXA A;  2B7E A;  3EUK L;  2GM4 A;  4RGS A;  2PJR B;  5H6R A;  2LMD A;  1FTZ A;  2CG4 A;  3ERE D;  4A3D J;  2PMU A;  2BBY A;  2DFF A;  4LG0 B;  1I27 A;  3BP8 A;  3QPH A;  2R5Z A;  3RZD J;  1XN7 A;  2FBH A;  2H1L A;  4OIN F;  3QAH A;  4ZJZ A;  3ZP5 A;  3ONQ A;  3K7A J;  1X4P A;  1TT5 B;  2O7O A;  3J7Z I;  1KU2 A;  5J1U A;  1TTY A;  3I59 B;  4G12 A;  1MH3 A;  1G3S A;  4QPO A;  2PJR A;  4S0H B;  5FRM A;  3CCR I;  4OIQ F;  1LEB A;  1X1A A;  3DPU A;  4LG0 A;  2W7N A;  1R4N B;  4V2F A;  3IKT A;  3MKZ A;  3JRI A;  1YJ9 I;  2ZCW A;  3VYR B;  2EQR A;  3LOC A;  3IRR A;  1OYY A;  2XGE A;  3ECH A;  4M71 A;  2DA2 A;  2EFO A;  1A31 A;  3I59 A;  5CVR A;  3A2K A;  1OPC A;  2EFN A;  2V6C A;  2ADU A;  3PJR A;  4FIS A;  3WTZ A;  2EA4 A;  1HLV A;  2K3F A;  3ZQ7 A;  1U5T C;  1JKP C;  2VOP A;  3CP8 A;  2DFE A;  5HOD A;  4Y13 A;  3CP2 A;  4KT5 C;  2CUE A;  2X85 A;  1XC5 A;  2EV0 A;  1D1B A;  2XKP A;  3CZ6 A;  2K3P A;  5CKT A;  3J7A Y;  3K69 A;  2RGV A;  3MFK A;  1JKQ C;  1I50 J;  1E3P A;  5L3F A;  4YFX F;  2QSG X;  4C2U A;  3JTG A;  1BC8 C;  1AWC A;  3IH3 A;  3WTS C;  4JBA A;  3DF8 A;  2LBF B;  1H0M A;  1L3L A;  3S3M A;  3M1E A;  1D0Y A;  1M1E B;  4UNO A;  2QKL B;  3EUA A;  1QNT A;  2X1C A;  4WXH A;  1FBQ A;  1QZE A;  3LQQ A;  4BL0 B;  2LBF A;  5F0H A;  5HLH A;  2BYV E;  2CQ7 A;  5KNL A;  2GWR A;  1PUE E;  2AS5 F;  4IRG A;  1TBX A;  2W24 A;  4F52 A;  2VBY A;  4ABZ A;  1P4A A;  4GO1 A;  2HOA A;  1XD7 A;  2MC3 A;  1Y56 A;  1BM9 A;  3WTV C;  3SZG A;  2BVL A;  3FXL A;  4GFB A;  4ZYD A;  2IS4 A;  3OYB A;  1FMV A;  5FO5 A;  1D8J A;  4G7O F;  4UB6 C;  3E6M A;  4AID A;  4L0Y B;  5EEG A;  1U78 A;  4ASN A;  4D7M A;  4RB1 A;  3K1P A;  3FZV A;  3E3V A;  4MQV A;  3OYL A;  1F5T A;  3LAJ A;  4XMY A;  5EDN A;  3RZO J;  4IOA F;  1ZRF A;  3NQO A;  3BLY A;  1JHF A;  2EJR A;  3RYR A;  4WWC A;  2LRD A;  4EVI A;  4R1H A;  1NK2 P;  3F0C A;  5TRD A;  4BBS J;  2HPM A;  1F36 A;  1GV5 A;  4Q47 A;  1K79 A;  5M5X J;  1FTT A;  3GFI A;  4LD5 A;  5DCF A;  2Q0O A;  4DNC A;  3ZMZ A;  2VC1 A;  2CQQ A;  2Z16 A;  2JK3 A;  5KVR A;  2ZJR F;  1IRG A;  2OUM A;  3H0G J;  4NB5 A;  2E2J J;  2PN6 A;  2R7O A;  1X1P A;  3IH4 A;  4PFO A;  4A5M A;  2G7H A;  4NDL A;  3J81 K;  2IVM A;  4DYQ A;  2CQK A;  3RIR A;  3UR3 C;  1R71 A;  2HZD A;  5FRN A;  4GDF A;  3FXM A;  4BUP A;  2FOW A;  2VON A;  2GA2 A;  2WC2 A;  2NS7 A;  2Y0S N;  3KIO A;  4O5V A;  2OCC H;  2KJC A;  5EEA A;  2IA0 A;  4XNF A;  3OYM A;  2ACJ A;  4OAY A;  1D5Y A;  4LIT A;  4V19 K;  4JYK A;  1I6H J;  5ILU A;  3COA C;  4XRM A;  5EF6 A;  3I55 I;  1S8N A;  2PMH A;  2DPD A;  5CVU A;  5E1W A;  2ETH A;  2JN6 A;  2I8D A;  4A3I J;  1U8R A;  2E7W A;  5DS9 A;  4MTE A;  3MQ0 A;  4C3J J;  3VDX A;  1O3R A;  4O6J A;  4HST A;  3P5J A;  2E1M B;  2ZXJ A;  3M07 A;  3KZI C;  2MG4 A;  1XGM A;  2LKS A;  4BQQ A;  2DOE A;  3GEZ A;  1Z3Y A;  2X6Y A;  3QOP A;  4Y33 A;  1SD6 A;  1IN6 A;  3OYC A;  1K6Y A;  5KCM A;  1OR7 C;  4HNU A;  2HVS A;  4PJ0 C;  3H9J A;  4RM2 A;  1I1S A;  4L0Z B;  1S5L C;  3KP5 A;  4AVP A;  1OLT A;  5FLM J;  5J4V A;  5K7F A;  3CTA A;  1VQL I;  1FWZ A;  5HLG A;  4XBF A;  4RA2 A;  3OY9 A;  2OQR A;  3AAF A;  1VF9 A;  3W6J B;  1ZAR A;  1ZYR F;  1F1Z A;  3FXK A;  4A0X A;  1BIB A;  1A04 A;  2BW3 B;  3IUO A;  4F93 B;  1GVJ A;  4IQJ A;  3DP7 A;  3UKG A;  1VFC A;  3FDY A;  2COB A;  2JRM A;  3DTI A;  3F9K A;  3M8E A;  1EH7 A;  3I56 I;  5FJ8 J;  2JRT A;  3H3Z A;  3MAJ A;  1MJ9 A;  3WU2 C;  1W0U A;  4A6D A;  2HDD A;  1ZLK A;  2VJ4 A;  2VLA A;  3K4B A;  1D8K A;  1MGT A;  1P2F A;  4ZC3 A;  3C2G A;  2BW3 A;  1USS A;  2PMZ A;  2A5W A;  4BXF A;  3BPV A;  3BPX A;  2FSW A;  1POG A;  1VQN I;  2VB6 A;  4KN4 X;  4XKB A;  4B48 A;  1QHG A;  4AYB N;  3OYG A;  2K9L A;  2OU2 A;  3HUG B;  1IV6 A;  3FBN B;  1YIT I;  1DDN A;  4BJ5 C;  2LK2 A;  2RDP A;  4DW6 A;  4KIS A;  1KQ0 A;  1S3J A;  2ELH A;  3GFM A;  3GTG J;  3PNT A;  3K0L A;  1RES A;  3ZQC A;  2IP2 A;  1MH4 A;  1BI0 A;  2L9V A;  5J6X A;  2YS9 A;  3HEF A;  4CIC A;  1O3Q A;  3WTW C;  3HUG A;  2CH0 A;  3JSO A;  1MBJ A;  4XRS A;  2ZJQ F;  4CSW A;  1V5E A;  4B3X A;  4IRH A;  4X6A J;  3OR2 C;  2JZY A;  3ABM H;  4FAS D;  3BWG A;  1JKR C;  1YFH A;  1T39 A;  1FYM A;  2VOD A;  2JJ7 A;  1XGN A;  3LSJ A;  3OR1 C;  2QKM B;  4HLX A;  2VKE A;  2OZ6 A;  2CSO A;  2J5O A;  4K2E A;  4FE7 A;  3E0J B;  3KET A;  4BE0 A;  2OTL I;  2BHY A;  3OS1 A;  4RAF A;  3RKQ A;  1OIS A;  3HRS A;  3K4J A;  3RQI A;  4IHT A;  3HRM A;  2RQQ A;  2OV7 A;  4ETS A;  4BBR J;  3ABT A;  2Z33 A;  3J7Y J;  4OAZ A;  2VQC A;  3QU6 A;  2V26 A;  3V8J A;  3LMM A;  2XAJ A;  3I71 A;  1Y1V J;  3FXQ A;  3ZN1 A;  2KLO A;  3FKJ A;  2E5Z A;  2R0Q C;  3K4M A;  3PO2 J;  2AXL A;  4EM2 A;  2QQ9 A;  4EJW A;  1V4R A;  1RNL A;  3OIQ A;  1FMW A;  2FOK A;  2ZSH B;  3KFW X;  3GTM J;  2GLO A;  4C3H J;  4G6T B;  2JA5 J;  4JP0 A;  1IN4 A;  4AVZ A;  3S32 A;  3VSK A;  2DA7 A;  3EDP A;  3PIO F;  4EJU A;  1D5V A;  2MD0 A;  3D0S A;  3FK6 A;  2KHM A;  5B3S H;  4KIB A;  1VQ8 I;  1Y0U A;  5F27 A;  2R7Z J;  2DW4 A;  4L5J A;  1ZEL A;  3MVP A;  4FX0 A;  2HZT A;  1BA5 A;  2VJI A;  3DXJ F;  5IP7 J;  4I0B A;  5JVG F;  2KIM A;  1LNW A;  1WHU A;  1VQK I;  4J01 A;  3E6B A;  3EYI A;  3R0A A;  4ENN A;  4HF0 A;  3C2B A;  1GHC A;  1LE8 B;  2HEO A;  3QPS A;  3O6B B;  3BG9 A;  1Z7L A;  3TGN A;  3LL7 A;  1W4M A;  3BG5 A;  1FP2 A;  4B09 A;  4EGY A;  5LD2 C;  3ZQH A;  2FQ3 A;  1CQT A;  4KMU X;  2YU9 J;  3V8K A;  4ITV A;  3TOA A;  1GLN A;  4ZYE A;  3HKZ N;  1LJ9 A;  3NAR A;  1LE8 A;  1J9I A;  1XS9 A;  3K10 A;  2F48 A;  3WU0 A;  3SFZ A;  4KUM A;  2KRH A;  2OBP A;  2VXZ A;  1UEL B;  3ZMV A;  4BS9 A;  2QBY B;  5CQE A;  1BW6 A;  3J7A O;  3B6A A;  5FLX Z;  1XX5 A;  2UV1 A;  4RB3 C;  2L7F P;  4KYW A;  3ELK A;  2VQG A;  1LDK B;  4HX4 A;  4E6K G;  1WZ2 A;  3DQV C;  3HXL A;  1R36 A;  2QBY A;  4BDZ A;  1HBX G;  1Z77 A;  5D4R A;  2Z1D A;  3PSI A;  5F0C A;  4EJT A;  4KIG A;  3CO7 C;  3P9K A;  4M6Y A;  2CQN A;  2GOX B;  5ICE A;  5C4X J;  1B1B A;  5DCM B;  3LSH A;  2C6Y A;  3TQN A;  5IYD J;  2JMW A;  3I64 A;  5A2Q Z;  1FC3 A;  3AKZ A;  5HDG A;  5M3M J;  3WG7 H;  1K4T A;  1LVK A;  2Q8K A;  4AYB A;  4BDY A;  1IRF A;  1JUS A;  3OOU A;  4CHU A;  3BR2 A;  4AU7 A;  1FP1 D;  5TIS C;  2OQG A;  4W1U A;  3LSI A;  1XCV A;  4N4O B;  5DCM A;  3SDB A;  2RV8 A;  2ZSI B;  4Q4Z F;  3F6V A;  4M74 A;  3ZPL A;  3BRO A;  1S9H A;  4XLH A;  2LDU A;  1DUX C;  3I5U A;  1HKS A;  2E5N A;  2HPI A;  3V7C A;  1HW1 A;  3HJE A;  2PG4 A;  2HYJ A;  3HZJ A;  1FY7 A;  4XL9 A;  4KNY A;  1NG6 A;  3I0T A;  2DOD A;  5ICG A;  3H3V K;  2H6B A;  1RUO A;  3CJT B;  4XOR A;  4PUS A;  5H2F C;  1IRX A;  2QSF X;  4XRF A;  1SC7 A;  2E71 A;  3A0B C;  1WKM A;  1H9G A;  2Z9O A;  1UCR A;  2HVR A;  1IDY A;  3TW7 A;  1F9N A;  1WVR A;  1ZLJ A;  4XQF A;  4BJT A;  3G73 A;  1TQI A;  3K4K A;  1OCO H;  1PVE A;  5L3G A;  4PZJ A;  4PJN A;  2P4W A;  4JK1 X;  4ANJ A;  1N78 A;  3GME A;  4WK8 F;  2VJ5 A;  1H8A C;  3W3C A;  2STT A;  2OD5 A;  2OAZ A;  3HPH A;  1MBH A;  3FIW A;  5DD8 A;  1TNT A;  1YIO A;  3A0H C;  2P5L C;  4IHS A;  2BXZ A;  3M4O J;  4XK4 A;  5L3B A;  1B9M A;  5D6F A;  1O7F A;  3BCB A;  2L9R A;  3OMY A;  1MND A;  3W6V A;  4EJV A;  3KYC B;  1LKX A;  4DBQ A;  1D3Y A;  3PSF A;  4HV6 A;  3CJR B;  2HTJ A;  3VSL A;  4I2O A;  3CJN A;  4BJ6 C;  3ULQ B;  1JE8 A;  3HSF A;  2H1K A;  1Z1D A;  3CDL A;  3RJP A;  3GZ6 A;  4ZZL A;  1UG2 A;  3VPR A;  4E7Z A;  3JRG A;  3Q0U A;  2K4J A;  4Y4R A;  1K83 J;  3BT9 A;  2COM A;  2OA4 A;  4WCG A;  1I3Q J;  4XLA A;  1NK3 P;  1YW8 A;  2F6C A;  4XLE A;  1W7P D;  2X6W A;  2ZXW H;  3ROU A;  5DTD A;  1YS6 A;  3HSE A;  1MZB A;  3ZMU A;  2R3S A;  5K5Q A;  3S1Q J;  1Z91 A;  5KAF C;  2QEN A;  1WPK A;  1FJL A;  4EEF G;  3HKZ A;  3CCY A;  3NRV A;  3QYE A;  2A6T A;  1Z05 A;  2YUS A;  1HW2 A;  4GRI A;  1QU3 A;  1JT6 A;  2ZBK A;  1ETQ A;  2KDZ A;  3RKW A;  4D9J A;  3HHH A;  2EIL H;  3K6G A;  4XON A;  3FHN A;  4IEJ A;  3N05 A;  4E7H A;  1FPQ A;  3JRC A;  2L3D A;  1CGP A;  2KFD A;  4A3B J;  4KJZ A;  1R5H A;  5E3O A;  3DTE A;  2XAH A;  2EBI A;  2RRE A;  1FSE A;  2JSP A;  3JW4 A;  3VFZ A;  5BS6 A;  1SEU A;  1IN8 A;  4XIC A;  3GX4 X;  1U3E M;  1LPQ A;  2WV1 A;  3A01 B;  3L2V A;  4HOB A;  1MMN A;  1OCT C;  4HA8 A;  4OU0 A;  2IGK A;  4BAY A;  1XTA A;  4ENK A;  1X19 A;  4M6X A;  4BEH B;  1HC8 A;  3GLX A;  3LA2 A;  3E6D A;  1MW7 A;  5E79 C;  2R7D A;  5E3N A;  2NS0 A;  3WE2 A;  4OWR B;  3A01 A;  1YRN B;  3OSF A;  4Y7N J;  2FQ4 A;  1UHW A;  1ZG1 A;  3CLO A;  1ZRD A;  5GPC A;  2ID6 A;  1RI7 A;  1IO2 A;  2EZH A;  3BTL A;  3JAM K;  3RKY A;  2BEO A;  2DCE A;  3BOQ A;  3V7S A;  4BEH A;  1G4D A;  1T33 A;  2CV2 A;  1A6I A;  2JA2 A;  1QQI A;  3BJ6 A;  1YRN A;  2H8R A;  1DPU A;  2FJ1 A;  1IN5 A;  2E1N A;  2EK5 A;  3S1M J;  4LFU A;  2AHQ A;  2F5F A;  4Q48 A;  3LST A;  2M45 A;  5J47 A;  3GTL J;  1LQ1 A;  3BZ6 A;  2JPB A;  1PYV A;  2L9S A;  3FXJ A;  5EZH A;  2P7C B;  4UUS A;  5DUI A;  3BCA A;  3GF2 A;  1FOY A;  3BY6 A;  4DQ2 A;  2YR2 A;  4AD9 A;  4CYD A;  4XKC A;  3SZT A;  2HNH A;  1JUP A;  1R5I D;  2EPF A;  2QYO A;  5ILV A;  1QA6 A;  2HTS A;  4B43 A;  3CC7 I;  3ZQL A;  5J1Y A;  4AUX A;  1Z0X A;  4I7H A;  2UXN A;  1HDP A;  1TZL A;  4A6E A;  2D5V A;  5D4S A;  4I98 B;  1SFE A;  3KLN A;  2XIG A;  3ZR8 X;  4ON0 A;  4CA0 A;  1ZR2 A;  4C2T A;  3DKW A;  2D1H A;  4EQQ A;  3HG9 A;  1U6G A;  2JWT A;  3CD6 I;  2NYX A;  1A35 A;  3J80 Z;  2KRF A;  2LSO A;  3U21 A;  4HLY A;  4U0W A;  2I10 A;  5AIP A;  3C2H A;  1TWF J;  2X4H A;  3F8B A;  3MKL A;  4JX6 A;  4FCY A;  4FET A;  1KQ8 A;  2ZB9 A;  4GGG A;  1SD4 A;  4IJA A;  2MLG A;  3LSK A;  3RTR A;  2V9V A;  2M87 A;  3K4C A;  4CZZ A;  4LLN A;  4S05 A;  2O8K A;  2JA6 J;  2GIZ A;  3HTU A;  3U1K A;  2IA1 A;  1DGW Y;  1R1V A;  2LY2 A;  5ICF A;  3KPH A;  3LSP A;  2ZXH A;  2DA5 A;  3CCJ I;  2XB5 A;  3KP3 A;  2NXN B;  5M5Y J;  2X9D A;  4FX4 A;  1A5J A;  2RQP A;  2XGC A;  3GWZ A;  4HZF A;  2IA2 A;  1LB2 A;  2F4I A;  2KJB A;  1U8B A;  3OL4 A;  1T56 A;  1DU0 A;  2K5C A;  2RKH A;  3GFL A;  4DYR A;  2PJP A;  2Q1Z B;  1ZAO A;  4PCQ A;  4PGH A;  1ZRC A;  3O2P E;  2CU7 A;  5FFX A;  1XDU A;  5J8C A;  4IRI A;  1E2X A;  2VQH A;  2AO9 A;  2PFB A;  3I53 A;  2O61 A;  5D5V B;  1MBE A;  1U9O A;  1SVO A;  2Y69 H;  2P8T A;  3TO9 A;  3Q0V A;  2M2E A;  1MJA A;  1I1G A;  2XPV A;  2IJL A;  2VE9 A;  2STW A;  1SAU A;  1SAX A;  3CLQ A;  3ABK H;  2CQX A;  2IRF G;  3D5L A;  2DMP A;  2DQR A;  2DFI A;  2VQL A;  3Q0W A;  4BNC A;  1KQ9 A;  2LF7 A;  2BY2 A;  5ERI A;  2JA7 J;  2V1N A;  1FOW A;  5CVI A;  5B66 C;  1OCZ H;  2WAE A;  3FM5 A;  3T8T A;  3PL8 A;  5FLV A;  5HS7 A;  2E35 A;  2MAB A;  1UG0 A;  4BQO A;  4RB2 C;  2CS3 A;  4D7N A;  2A5Y B;  2Q2E B;  3DPL C;  2DO7 A;  2IGN A;  4CYC B;  1MSF C;  5E17 F;  1YE9 A;  4KA4 A;  2DAO A;  5IPA A;  5BPI A;  3CCL I;  1ZG5 A;  3PNV A;  2I5U A;  2VXD A;  4KDP A;  1R1T A;  3RPU A;  2W25 A;  3V8L A;  2HOE A;  2WWY A;  2Q2E A;  3I4N J;  4ZDP A;  4CYC A;  2K86 A;  2GBY A;  4PDK A;  2K9Q A;  1TWA J;  5K5R A;  4P5O A;  3GXO A;  4DBR A;  1B59 A;  2PX9 A;  3WTY C;  2XB0 X;  1W7P B;  1RET A;  3EYY A;  1JGS A;  1CF7 B;  3T8R A;  1V5F A;  2F2E A;  5GAH J;  2K27 A;  4UVB A;  3F22 A;  1KA8 A;  2ME0 A;  3GTP J;  2A61 A;  2VC0 A;  2P7V B;  2VKD A;  1JGG A;  4GYI A;  2JVG A;  1JTY A;  4XM3 A;  3S2D J;  1W7P A;  5AIQ A;  2LKX A;  3BTJ A;  2M30 A;  3ASO H;  1CF7 A;  3KYD B;  3QQA A;  3R61 A;  1JJ6 C;  3X2Q H;  2KQR A;  2YX7 A;  3OSG A;  1U0J A;  3Q9S A;  4M3E A;  1JUM A;  1J0R A;  3MEX A;  5CJ9 A;  2CRG A;  1K61 A;  5FRO A;  4HYE A;  3SXY A;  1P7J A;  2LFB A;  4XLN F;  4MIM A;  4F92 B;  4BQA A;  2XDV A;  3CQZ J;  4F3Q A;  2FRH A;  2CMP A;  4JOM A;  4YRV A;  1JKO C;  2HYG D;  1P4X A;  2V1D A;  2ZO4 A;  2EZL A;  1WQ2 A;  5D8L B;  2HWV A;  3A1Y A;  5GP9 A;  2JVH A;  2OPT A;  4XRS G;  1ORK A;  4G7H F;  3MKW B;  1XB4 A;  1MBF A;  2BY3 A;  3PUF A;  2DQL A;  2M4K A;  1KU9 A;  3HGY A;  1B72 B;  2VN2 A;  3UNG C;  1ZGJ A;  2VL8 A;  3KZZ A;  5HNF A;  4NHJ A;  2NAZ A;  3L2C A;  2KL4 A;  4YEJ A;  3RKX A;  1NG7 A;  2DJN A;  3W2W A;  2O9L A;  3LNQ A;  1U5T B;  4RGR A;  1TQM A;  1GUU A;  1Q1H A;  4AIJ A;  1B72 A;  4MGR A;  3RPQ A;  2XF6 A;  2E2H J;  1IRZ A;  1SFO J;  4NC6 A;  1Z67 A;  1RKW A;  2QWW A;  4HBL A;  4XN0 A;  5HDN A;  1N25 A;  1PUF B;  3FMQ A;  3E7L A;  3G71 I;  1U5T A;  3WTT C;  2EV6 A;  4LIV A;  4L9J A;  4G9Y A;  3ABL H;  3EQL F;  1T2K A;  2DLL A;  1J5Y A;  4DZP A;  4BE2 A;  3MMY B;  4XOT A;  2E34 A;  1PUF A;  2XAU A;  3VEP A;  3GVA A;  4BE1 A;  2LKP A;  3CUQ C;  4RB0 A;  3G6E I;  5K5O A;  1QVT A;  4ZDL A;  3JTH A;  4A3E J;  4PJJ A;  1OKR A;  2DPU A;  2L4M A;  4CCL A;  1YO5 C;  2HKX A;  4HSR A;  3KLO A;  1W36 D;  2F4O B;  2MSY A;  4S04 A;  2W82 A;  4FT8 A;  2ZJP F;  5JR3 A;  4D5C A;  4A0Y A;  1ZK8 A;  4KIT B;  3I54 A;  3VYS B;  3I4P A;  2A07 F;  2L7K A;  3TOB A;  1B6A A;  2CJJ A;  3DLA A;  4XKV A;  1YX5 A;  3SJM A;  1ZN2 A;  3JCU C;  2YSR A;  4Q5S F;  4E70 A;  1JHH A;  3DCF A;  2JUC A;  2D2W A;  5KHD A;  3FX3 A;  3Q3S A;  2TRT A;  2XV4 S;  3H5N A;  1YQA A;  2EIK H;  3B6C A;  2ICW G;  4J19 A;  4A3C J;  3KEY A;  3CCE I;  3ZMT A;  2VKV A;  3ZQI A;  1FLI A;  3CMM A;  2IBD A;  2HYF A;  4P9F A;  4KMF A;  2CW0 F;  5FFZ A;  1OCR H;  3K2A A;  2L0K A;  3GUD A;  5DV5 A;  4LIU A;  5GPA A;  1LDD A;  2OZU A;  3WOD F;  2R7F A;  3MCZ A;  2LG4 A; 
#chains in the Genus database with same CATH homology
 2XSD C;  4A3F J;  1U9N A;  3H3V K;  1ZQ3 P;  4UUS B;  1X58 A;  2XPU A;  4Y52 J;  3JRF A;  1IDY A;  3TW7 A;  4FE4 A;  3BR1 A;  1ETV A;  1EF4 A;  2ME6 A;  4BY7 J;  3TED A;  2ECB A;  3I4M J;  1MNM C;  1B8I B;  2W48 A;  1MSE C;  3ZQF A;  5F1J A;  1H8A C;  4M3G A;  4RDU A;  2DA4 A;  1LFB A;  1MBH A;  3FIW A;  1ZTR A;  3M4O J;  4XK4 A;  3G1M A;  2R5Z B;  5C4J J;  1B8I A;  3WHB A;  3BQZ A;  2XGD A;  2L9R A;  4I6Z A;  1JJ8 C;  2GM4 A;  1ETY A;  3HOU J;  3W6V A;  5FKN A;  1FTZ A;  4A3D J;  2HI3 A;  4IHY A;  1OCP A;  3QPL A;  3RZD J;  2R5Z A;  3K7A J;  1X2N A;  2H1K A;  3SDG A;  2O7O A;  5J1U A;  4A3J J;  3CDL A;  4G12 A;  1MH3 A;  4D5F A;  4DZJ A;  2K9N A;  4S0H B;  3S16 J;  5E3L A;  1UG2 A;  3VPR A;  1ZGW A;  3JRG A;  3Q0U A;  2NVQ J;  1UHS A;  4V2F A;  1K83 J;  3BT9 A;  5J3L A;  1ITY A;  1I3Q J;  5IP9 J;  3JRI A;  1NK3 P;  2EQR A;  3LOC A;  1ETX A;  2L7Z A;  5IYC J;  5M3F J;  2XGE A;  2X6O A;  2Y9Y A;  1H89 C;  2DA2 A;  3ZOB A;  2VI6 A;  4B3A A;  3JRB A;  1IGN A;  1WH7 A;  2VUM J;  5DTD A;  1GDT A;  4FIS A;  3S1Q J;  4FTH A;  4MFE A;  1HLV A;  1WPK A;  2VPR A;  1FJL A;  1JKP C;  1E3O C;  2B63 J;  4EEF G;  4B1R A;  5HOD A;  3CCY A;  2HOT A;  2NVX J;  3IV5 A;  1BW5 A;  2CUE A;  2YUS A;  4IHX A;  5C44 J;  1JT6 A;  1XC5 A;  4LOC A;  1ETQ A;  1QVU A;  2KDZ A;  2XRL A;  1JKQ C;  3GBG A;  1I50 J;  4IEJ A;  3JRC A;  3HGG A;  4A3B J;  5E3O A;  4MLO A;  3BQY A;  1S7E A;  2LP0 A;  2DA6 A;  2EBI A;  3IH3 A;  1TC3 C;  4XIC A;  3TP3 A;  3CMY A;  2WV1 A;  1WI3 A;  3A01 B;  1IDZ A;  3LSR A;  1OCT C;  4JX4 A;  3JRE A;  5BNG A;  3JRH A;  1WGX A;  3BR5 A;  1ETK A;  5F0H A;  1VND A;  5E3N A;  3O8H A;  3A01 A;  1YRN B;  3OSF A;  4Y7N J;  2FQ4 A;  2M0C A;  5GPC A;  2ID6 A;  2EZH A;  3BTL A;  1HCR A;  2Y2Z A;  1VI0 A;  2QF7 A;  4ABZ A;  4X1E A;  2HOA A;  2FD5 A;  4M3F A;  1T33 A;  1A6I A;  1JT0 A;  2N8G A;  3MN2 A;  1YRN A;  2H8R A;  1WH5 A;  2FJ1 A;  4GFB A;  9ANT A;  1BL0 A;  3S1M J;  2AHQ A;  2WB1 N;  5FKL A;  1HDD C;  3GTL J;  2P81 A;  1NTC A;  1FIA A;  2EH3 A;  1P7I A;  1JTX A;  1U78 A;  4D7M A;  2L7M P;  5EZH A;  1BJZ A;  4UUS A;  3BR3 A;  5EYR A;  3WHC A;  5EDN A;  3RZO J;  2NVT J;  4A3G J;  2CUF A;  4MO7 A;  2QCO A;  1NK2 P;  3F0C A;  1JUP A;  4QTR A;  4BBS J;  1F36 A;  1GV5 A;  5C3E J;  5M5X J;  3ZQL A;  5J1Y A;  1FTT A;  1RKT A;  5IYB J;  4AUX A;  2LD5 A;  3OIO A;  4RBO A;  1Z0X A;  2M9H A;  2Y31 A;  1HDP A;  1OJL A;  2CQQ A;  5FKO A;  2JK3 A;  2D5V A;  3H0G J;  1AU7 A;  2E2J J;  1UMQ A;  2HXO A;  3GTK J;  3IH4 A;  1ZR2 A;  2DN0 A;  4NDL A;  2JWT A;  4DYQ A;  2Y30 A;  3TP0 A;  2R93 J;  4XID A;  5K7Z A;  2I10 A;  2NS7 A;  2K9S A;  2Y0S N;  1TWF J;  1QRY A;  5EEA A;  3SFI A;  3MKL A;  4JX6 A;  4FCY A;  1IUF A;  2M8G X;  4M3D A;  1D5Y A;  1IJW C;  2ZB9 A;  4JYK A;  5IP6 A;  1I6H J;  4XRM A;  5EF6 A;  4IHV A;  2OF7 A;  3M3Y J;  2O8K A;  2JN6 A;  2JA6 J;  4A3I J;  1H88 C;  5DS9 A;  1HF0 A;  2ELK A;  2Y9Z A;  4C3J J;  3LSP A;  3HOZ J;  2DA5 A;  2XB5 A;  5M5Y J;  2MG4 A;  2X9D A;  1A5J A;  1F43 A;  2XGC A;  4I76 A;  1U8B A;  1DU0 A;  1T56 A;  3A03 A;  1AHD P;  4DYR A;  4A3L J;  2CU7 A;  2E1O A;  3G1O A;  2AO9 A;  5FLM J;  5K7F A;  1MBE A;  3PM1 A;  1U9O A;  1TWH J;  1MBG A;  1IC8 A;  3GTQ J;  1IG7 A;  3S17 J;  1TWC J;  3Q0V A;  2M2E A;  3HOX J;  4BXX J;  2XPV A;  1VF9 A;  4DYC A;  4W97 A;  2DMQ A;  5IOY A;  2CQX A;  3BG3 A;  2DMP A;  3UKG A;  1VFC A;  2COB A;  4JX5 A;  1X2M A;  3Q0W A;  5F0F A;  5FJ8 J;  2ECC A;  1DU6 A;  1QPI A;  4A69 C;  1W0U A;  5E3M A;  2JA7 J;  2HDD A;  2KT0 A;  5FLV A;  2LR8 A;  2ID3 A;  4D7N A;  1RR7 A;  2LVS A;  4CYC B;  2DA1 A;  1MSF C;  3TW6 A;  4UUT A;  1POG A;  5IPA A;  1RPW A;  5FKK A;  3FIS A;  4AYB N;  4A3K J;  2E19 A;  4BY1 J;  3NAU A;  1FIP A;  3I4N J;  1IV6 A;  4C3I J;  4CYC A;  1GVD A;  2R5Y B;  2LK2 A;  4DW6 A;  1Q1V A;  2DMT A;  3FKI J;  4BKX A;  3GTG J;  2GBY A;  1R9T J;  2K9Q A;  1TWA J;  4MFD A;  1RES A;  3ZQC A;  3HOY J;  1MH4 A;  2XB0 X;  2YS9 A;  3HEF A;  1RET A;  2LY9 A;  3HM5 A;  3GTJ J;  4M3B A;  1MBJ A;  1MBK A;  4XRS A;  2R5Y A;  2FX0 A;  3JR9 A;  2ME0 A;  3GTP J;  2NVY J;  1GT0 C;  3O8G A;  4C2M J;  3S1R J;  4X6A J;  5J1R A;  2IAI A;  1JKR C;  1JGG A;  1WCM J;  2JJ7 A;  1JTY A;  3S2D J;  3BTI A;  3S1N J;  3LSJ A;  3G1L A;  3BTJ A;  2LKX A;  2VKE A;  1ZKG A;  3QQA A;  3S14 J;  4FE7 A;  1JJ6 C;  3PO3 J;  3HOV J;  3OSG A;  4A3M J;  3RKQ A;  4M3E A;  5JLX A;  1JUM A;  3RQI A;  1ZR4 A;  3BR0 A;  2EZK A;  2CRG A;  1W0T A;  1K61 A;  4BBR J;  1Y1W J;  1P7J A;  2LFB A;  2DMN A;  4MIM A;  3JRD A;  2WAQ N;  3CQZ J;  1Y1V J;  1FEX A;  2MW8 A;  4IHW A;  2G0E A;  5F04 A;  1JKO C;  2R0Q C;  5FKM A;  3PO2 J;  3HDD A;  2EZL A;  2X48 A;  5GP9 A;  2OPT A;  2IEK A;  1ORK A;  2M34 A;  4L5E A;  4XRS G;  3GTM J;  1O4X A;  2GLO A;  1MBF A;  4C3H J;  2E2I J;  2LLK A;  2JA5 J;  4JP0 A;  3HGY A;  1B72 B;  2TCT A;  2DA7 A;  3HOW J;  5JLW A;  3FK6 A;  2NS8 A;  2EZI A;  1HOM A;  5F27 A;  2R7Z J;  5M5W J;  3MVP A;  2DJN A;  1BA5 A;  2O9L A;  5IP7 J;  3LNQ A;  1GUU A;  1B72 A;  3HBL A;  1G2H A;  1ETW A;  4A93 J;  2E2H J;  3S2H J;  1IRZ A;  1SFO J;  4QIW N;  4HNV A;  3C2B A;  1LE8 B;  1RKW A;  3QPS A;  3BG9 A;  1PUF B;  4B4C A;  2MGQ A;  3E7L A;  3BG5 A;  5EG0 B;  3JRA A;  1GV2 A;  3ZQH A;  3ZQG A;  1CQT A;  2YU9 J;  5IOZ A;  3DEW A;  5F08 A;  4DZP A;  3HKZ N;  3NAR A;  1LE8 A;  1TWG J;  1XS9 A;  5K7H A;  1PUF A;  1APL C;  5EG0 A;  3BTC A;  1LFU P;  3BR6 A;  1AKH B;  1BW6 A;  1QVT A;  3B6A A;  3S15 J;  4A3E J;  2HXI A;  1XG1 A;  2L7F P;  3HB9 A;  3IH2 A;  1SAN A;  2DTZ A;  1ENH A;  2MSY A;  2HOS A;  5EZG A;  4D5C A;  1Z77 A;  5EGO B;  1ZK8 A;  2DMU A;  5F0C A;  1AKH A;  3D1N I;  2R92 J;  2CJJ A;  1OFC X;  5C4X J;  2NOG A;  3SJM A;  2HQ5 A;  2LTP A;  5IYD J;  4V2G A;  2JMW A;  3A02 A;  3DCF A;  5M3M J;  5EGO A;  3Q3S A;  2TRT A;  1JUS A;  3OOU A;  3BR2 A;  2JA8 J;  4J19 A;  3B6C A;  4A3C J;  2RAE A;  4W1U A;  4M6V A;  2PMZ N;  2VKV A;  2XPW A;  3ZQI A;  2IBD A;  4QSH A;  3LSG A;  3K2A A;  2L0K A;  1ETO A;  5GPA A;  4AC0 A;  3L1P A;  3GTO J;  2DA3 A;  3FK7 A;  2HYJ A;  2K40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...