3CCRI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccrI00
3G6EI 3CCJI 3CC7I 2E36A 5GAEJ 3CCQI 3CCVI 1YJWI 1YJNI 2E34A 1VQ9I 3CCRI 1VQPI 5DM6F 2K3FA 2OTLI 3CD6I 4IOAF 3PIOF 1YJ9I 4IOCF 1YIJI 1YITI 3I55I 3G4SI 1FOXA 2QA4I 3CCSI 2QEXI 1Y39A 2ZJQF 5JVGF 1FOYA 2ZJPF 4V19K 1VQ4I 3PIPF 1YI2I 3CC2I 3CJTB 3I56I 1VQ8I 5GAGJ 4UY8I 3J7ZI 2FOWA 2OTJI 1HC8A 3CCUI 5GAHJ 3CF5F 2JQ7A 5DM7F 3CCMI 2ZJRF 2H8WA 3DLLF 3CMEI 1ACIA 1VQOI 1FOWA 3J7YJ 1VQ6I 3CCEI 1YHQI 3G71I 1VQ5I 1S72I 3CC4I 5GADJ 3CCLI 2E35A 1MMSA 1VQMI 3CMAI 1QA6A 1VQKI 2NXNB 1VQ7I 1VQLI 4IO9F 1VQNI
chains in the Genus database with same CATH superfamily
5HODA 1LEAA 1J9IA 2DOAA 3TDUC 1ODDA 1X4PA 5H6QA 2QGUA 2MLGA 1BJAA 1YQAA 3G1LA 1WHUA 2IEKA 2Y75A 1XCBA 4I7HA 1QQIA 1QHHD 1LNWA 3KEOA 4PJLA 5J1UA 3GTQJ 3OYFA 3VSLA 4YIIA 2DN0A 2Q0OA 2A05A 2Z2SB 1T2KA 4BE0A 2ZSIB 4WWCA 4HW0A 1SD5A 1BI2A 3K4LA 4BDZA 2F5EA 4HX7A 2XROA 3HTSB 4F52A 3GTOJ 2VBZA 2DMQA 4TV7A 3EUAA 3E97A 1F4KA 1G3TA 1A35A 2GIVA 3HZJA 1R4NB 2DFFA 2D1HA 2VB6A 4CCOA 1ZRCA 3L9FA 1IG7A 4EMSA 1TNSA 2WC2A 2XSJC 2HKXA 1TW3A 1GLNA 2XGDA 1SD6A 4KN4X 5B3SH 1PUFB 4DYRA 1Y39A 2GQQA 1ETVA 4EM2A 3ECOA 2AQFA 2HQAA 4FETA 3RZOJ 2XAGA 3OS0A 2IXSA 1LPQA 4XRSA 1E2XA 3BTIA 4DNCA 4X6AJ 4RDUA 3HOTA 2VQHA 3LSGA 4D5FA 4E4HA 3S3NA 4AIHA 1OJLA 2CQXA 2QENA 2M2EA 2WB1N 3K7AJ 4XN0A 1BR1A 3H35A 1ETWA 1OCCH 1HA8A 1IO2A 2A61A 4HEA2 1SEUA 3QPHA 2HU9A 2BOLA 5F04A 3JW4A 1UHMA 5HLHA 2F5FA 1BW6A 3LSHA 2HNHA 2BVMA 1D3YA 2B7EA 4KT5C 5F0HA 1LFUP 2WA0A 2NNNA 1WI3A 2P81A 3M8JA 3MMYB 4LB5A 3CTAA 3C7JA 4I09A 5D4RA 5FLXK 1IN5A 5GTHC 4IHVA 2HPMA 1TZLA 2KDZA 3Q9VA 4BU2A 2CGPA 2KIUA 3SEQA 2QQ8A 2M1BA 2QLZA 3I64A 3K10A 1U9OA 4UUSA 1D8JA 1FLIA 3GEZA 4MIMA 2P5KA 2E7WA 4D5CA 5CPRB 2VQCA 5IYCJ 3SDBA 1HKTA 2VKHA 3O8GA 2RNJA 3GCMA 3S8PA 3GLLA 4UUSB 2HVSA 2QQAA 2F48A 2XAJA 2YS9A 3DU5A 3ZMDA 2XSDC 2X6OA 5EEAA 2M9HA 5TJJA 3F3XA 4XOTA 1P7IA 3BLYA 3R61A 2X6WA 2ECBA 4B3AA 2KIMA 3I0TA 1VQLI 1FMVA 3J81Z 3ZQLA 2JMWA 4LFUA 2VPRA 1GV5A 3GVAA 1WPKA 3FK7A 3Q3SA 2R7TA 5E1WA 4A3IJ 4IZZA 1YJNI 2O5RA 1I5ZA 1OCTC 2L4MA 4LITA 3JRHA 2FD5A 2K4BA 1EV7A 3AL0B 1W5SA 2LRDA 5IP6A 3OWTA 4D9JA 4AM3A 2LP0A 1DP3A 1O3RA 4M6XA 2ZNZA 5J4YA 3P5JA 4PJJA 2VT3A 3VDXA 1YIJI 2A69F 1XX5A 5H2FC 3BY6A 4MGRA 3BC8A 4Y4RA 4P9UA 3HOWJ 3FXRA 1FNNA 2JPBA 3Q0VA 3PM1A 3HL2A 4HLXA 5M3MJ 2ZB9A 3TP0A 1F1ZA 3R6SA 2NVTJ 4HX4A 4A3EJ 4UVAA 3QPSA 1TW2A 2H8RA 2GM4A 4GFBA 2O9LA 1AWCA 1ETKA 4Y52J 4XLAA 2Z99A 4BKXA 1E3OC 4BE1A 1PDNC 2JWTA 3EYIA 3E0JB 3E6DA 4HOBA 4CZZA 3BZCA 5ILVA 4E7JA 2V1DA 4JOMA 1JTYA 1MBEA 5E3NA 2JPCA 4G7OF 2HOTA 3I4MJ 1ZK8A 2B0LA 2P5LC 1J2XA 1W36C 2FEZA 3OL3A 1B1BA 2E60A 3A1YA 1OYWA 2H94A 5FLMJ 1D1BA 3CP2A 4ZJZA 2VUMJ 5DCFA 5D6EA 1LDKB 1L3LA 2ID6A 1AA7A 1ULYA 5LFAA 4EJOA 4L18B 4WXDA 2JA8J 1SD7A 2HYGD 1PP7U 1M1EB 2M4KA 2LYCA 3S2HJ 1D1CA 1V5GA 2R7QA 4C9YA 3VB2A 2HOSA 5L3EA 1UHWA 2EV5A 2HR3A 4A3DJ 3FMSA 4II3A 3V4GA 5CLSA 3E5UA 4JYKA 4P9FA 3WTSC 4D7MA 2IA0A 4DBQA 3BWGA 1SFKA 1R5ID 1JGGA 4B09A 3ZMTA 5DYMA 1Y8RB 3RKQA 1J5YA 1Z21A 1N78A 2GWRA 3ERED 4JX6A 5JLWA 2XB0X 3ZN1A 1TT0A 3DBRB 4OMYA 1AU7A 3DEWA 2MC3A 1W1WE 1DPRA 4BJTA 2KFDA 4FT8A 1J59A 3R0AA 3DWLE 4C3HJ 1KU3A 4BAYA 3HG9A 2MFZA 4XM3A 4OIOF 4E6KG 1SANA 2FUG2 1QVUA 2DXIA 2F5DA 1YJ9I 3RPUA 3GMEA 4CZCA 5IOZA 4G8XA 1TQMA 3VEPA 4OAYA 5CVUA 1Z3YA 5E1XA 3QPLA 2O8KA 1HSJA 2R5YA 3F0CA 4LLGF 4EGZA 3AKZA 2VJ5A 1J75A 3CUOA 5LBQA 2V9KA 4MTDA 3BP8A 1P7JA 1ON1A 3BPXA 4RB0A 5BPIA 2L9RA 1LVAA 1QGPA 4JX5A 2D1VA 3I58A 3FMRA 2XAFA 1Z91A 2Z1DA 2BY2A 3O3KA 3PQJA 4IHTA 1SC7A 2NS8A 3HDDA 2NOGA 3ZQCA 4ENMA 1JKOC 2ZXWH 1T38A 1PVEA 1KU9A 3K4CA 2V6EA 4KNYA 1Q1VA 3U21A 2R7FA 2LG4A 3EUHA 3V8LA 2LY9A 3DLAA 2BYVE 2MA3A 4UB6C 4HBLA 2ZMEA 4PGGA 2X6YA 3KETA 1LDJA 5DM7F 1MD0A 2H8WA 3WTWC 2UXXA 3CUQA 4ON0A 1GV2A 3WHBA 1K7AA 1KQ9A 1TWAJ 1Z9CA 2DMPA 2EZKA 4HDUA 1VQOI 1ETXA 4WCGA 1VQ6I 4NDLA 3QU3A 2IA2A 2ZBKA 3CUQB 1JUPA 1R5HA 3SFIA 3KYLA 3SXYA 1YHQI 2PJRA 2ESHA 1WJEA 3L7WA 1YTYA 2EJRA 5GP9A 5IP9J 4KDPA 3LSIA 5JR3A 4PZJA 4A3CJ 2DA1A 1S7EA 3CQZJ 3BG3A 4B43A 1QBJA 3U1KA 4ESFA 5DS9A 4A3KJ 1QRYA 3CMAI 1H9TA 2E1MB 2ADUA 1E17A 4IQJA 3VYSB 2BW3A 1TBXA 4RBOA 4ZYHA 2LFBA 4F92B 1W5TA 4RAFA 3FXQA 3OS1A 2RGVA 4L9VA 3D0SA 3GFMA 1R9TJ 2BW3B 2PMZN 2QBYA 3OL4A 1RR8C 3QU6A 3AAFA 3DTIA 2W00A 1TL8A 3CLQA 4ENJA 3GLXA 4EJWA 1K83J 1U8RA 1W0UA 1WVRA 2R0QC 2J5OA 4N9IA 4HRIA 3CCRI 2CW7A 5K7FA 3GFJA 5F6FA 3VFZA 1NK2P 1USSA 4I0BA 3I9V2 5EGOA 4DBRA 1OR7A 2Y30A 3CDIA 2E5ZA 2XF5A 3HEFA 3QYBA 2DU9A 5D8LB 4E70A 3K4JA 3F72A 3T8TA 3I55I 5ED4A 3ZQ7A 2XPWA 3JSPA 5EGOB 2E19A 5E18F 4YFKF 1YW9A 3I71A 3S1NJ 3SDGA 2M87A 4F55A 4ZZLA 3V8JA 3CCSI 2QEXI 4IKFA 2HDWA 2CV0A 1T0FC 2HPIA 1ITYA 4XLEA 4XQFA 2FOKA 1TQPA 2D5VA 1ONVA 1MDMA 1ETQA 4EATA 2RNGA 2HFHA 1NHAA 1DU6A 3S14J 4FX4A 2RQQA 2YPRA 1U0JA 1MZBA 1MDMB 3C3WA 2B63J 4BQOA 1TNTA 1RKTA 3NEUA 2OTJI 2P5VA 4IX7A 1XGMA 5DV5A 2I10A 1IC8A 3MZHA 2JA6J 5ICGA 5CYVA 5J8FA 4OIQF 1SFUA 2JUGA 4U88A 5BPDA 3S3MA 2ZJRF 3DXJF 2H27A 3BR1A 3I5UA 4AC0A 2DA6A 1T98A 3IH3A 3F23A 4Y15A 3N4MA 2XHKA 3CMEI 2PLYA 1SMTA 4DIQA 5LHIA 2X9DA 2R7RA 4JBAA 1SFOJ 5E20A 4G9YA 3T8RA 2PN6A 2DQLA 5C44J 2DA7A 1XTAA 1MNDA 1XGOA 2UUZA 4E7HA 2LBFA 1D5YA 3S17J 2K27A 2L9SA 4N0BA 3DEEA 3KYDB 2BGCA 2D45A 2IGKA 3WU0A 1ZELA 2RV8A 4BBRJ 2HDDA 2VOPA 1U5TC 2KJCA 3P9IA 1BC7C 2OZ6A 4ANJA 4LOCA 2RAEA 3F8NA 4ZC3A 1Z6TA 3ZMVA 3HSRA 4M9XA 3FXLA 1HDDC 4M74A 3ZGKA 1STZA 1MMDA 3HSFA 4M9SA 3DU6A 5EEGA 2XVCA 1FTTA 1U6GA 3EDPA 1WFXA 4HV5A 1OYIA 1DP7P 1YW7A 3G1MA 2L7ZA 1R00A 1MW7A 2GBYA 2EV0A 2QKMB 3FXJA 2CS3A 4LK0F 4XN3A 1T8IA 4BEHA 4ZDLA 3HHHA 1JHHA 3SEZA 2LK2A 2H09A 1CGPA 4JK1X 1T39A 1R23A 4BEHB 2VE9A 3JTGA 2F6CA 2P0WA 4LG0A 1XSVA 1IDZA 4N9HA 2P7CB 5AONA 4RGRA 2WAQN 1XMXA 1I6XA 3DFGA 4LK1F 4LG0B 3MAJA 2L3DA 1G3YA 1Y1WJ 2CW0F 2AO9A 4QSHA 3REOA 4N4NB 1S7OA 2DLLA 2VKVA 3BJ6A 3GTPJ 3IP4B 1ZLJA 2CUFA 3E6CC 1YI2I 2NRAC 3BZ6A 2BEOA 4OOIA 3X2QH 1WSUA 4YFXF 3W2AA 3QPTA 2L01A 3CJRB 3MCZA 2DI3A 5KAFC 2MH9A 2O7OA 1A5JA 2LLKA 4M3FA 4HF1A 3M3YJ 4MQ9F 1JUMA 2OPTA 2XV4S 1YX3A 3GTKJ 3DKWA 5FRNA 1HC8A 4IHYA 4RB1A 4LMYA 1YRNA 2DW4A 4II2A 3HXLA 4YEJA 4ZDOA 3S2WA 5IYBJ 3DP7A 3JRAA 2EA4A 1X3UA 4YIFA 2BZTA 3I53A 1FBUA 5IOYA 1YRNB 1RI7A 1Z6RA 2CRGA 4B4CA 5H6RA 4HSTA 3EPZA 3CCEI 2IP2A 4RA2A 5A2QZ 1JT0A 4Y3OA 2EIJH 5EEHA 1AHDP 5GPCA 2R4GA 2HTJA 3DPUA 2B9SA 4MTEA 3CLOA 2ZXJA 4O3MA 2LY1A 3IH4A 4RGSA 2K85A 4DYQA 5D5VB 4KFCA 3F6OA 4DZPA 4C3IJ 4FX0A 5LLQA 3ZXSA 2EH3A 2W57A 3ESWB 2LD5A 2DQRA 1G4DA 4Q48A 3C2BA 3G3ZA 3JR9A 4H4KC 2V7FA 2VL8A 4M3DA 4UB8C 5D5WB 2GA2A 1IV6A 1PUEE 4L9TA 3OIQA 3CC7I 5L3CA 5HDNA 5HOOA 1BIBA 1I39A 3ZMSA 1XSXA 2K9SA 2MLKA 5DDGA 4P55A 1F9NA 4HLYA 1SFEA 2E34A 1OCOH 3FF5A 5FD6A 1VQ9I 3PFIA 1X1BA 2FSWA 5FGMA 3F6VA 5E79C 4A69C 3KEQA 1X1AA 2JN6A 2W48A 2VQLA 3IRRA 2E2HJ 2OTLI 1OMIA 4U7DA 3BG7A 2Y9ZA 2DOFA 2LOOA 3OYNA 5M5XJ 1LDDA 2FF4A 3SZGA 2V1UA 1MMNA 2JVHA 1LEBA 2LKPA 3LFUA 5J1RA 3CO6C 1TWGJ 2QSHX 3R4KA 2JUCA 3HOSA 4PJ0C 1FSEA 1SAXA 1JKPC 4RB3C 4OINF 4CICA 1TTYA 3D5LA 1ERDA 3PL8A 3E5XA 1OYYA 2IT0A 2KP6A 3R0JA 1SFXA 1W4MA 4PJMA 5CVRA 4V19K 2DT7B 3F8MA 5F27A 4F7ZA 1EH6A 3LAJA 4A0YA 2M7BA 3FHNA 4RAGA 5C3EJ 1ZGWA 1X58A 4CCKA 2IW5A 3HRUA 4YFNF 2E1NA 4M3BA 4F3QA 4FASD 3ZR8X 3M4OJ 2ECCA 1F43A 4Q5SF 1FP2A 1PUFA 1JUSA 3G1OA 2EBIA 1T33A 4IQ4A 2ZFUA 1FBSA 2CSOA 1O3TA 1HW2A 3U1DA 3W6JB 2X6XA 2NS7A 4I2OA 4XONA 1JGSA 2ETHA 3KP3A 4AVPA 1XSDA 2HI3A 4KICA 4AU7A 1Y8QB 1DGWY 2EINH 1B9NA 3RYRA 5CQEA 4LB6B 3IWZA 2K86A 3JRDA 1SVOA 2R93J 2E5NA 4IHSA 2DTZA 2G7UA 4RAZA 1ACIA 2MH2A 2V1XA 4U0YA 2CO5A 2XGEA 2M0CA 2VXZA 3LA2A 3LQQA 3JRIA 4FQGA 4W97A 4IJAA 3CP8A 3DBHB 1WCMJ 3VSKA 1N75A 3KE2A 3ZP5A 4BY1J 2G0EA 2NVXJ 2L7MP 1B59A 2W7NA 3BR0A 1IUFA 2K9QA 3GBGA 2DJNA 2EV6A 4A12A 4AIKA 3DTEA 2MD5A 4RGUA 3NARA 2ZXIA 1ORKA 4WK8F 1OKRA 2RC4A 3K1MA 2MSYA 1OLTA 3ABTA 5M5YJ 2H1LA 2Q2EA 3Q5FA 4A3GJ 1D0YA 4HG2A 2BHYA 3OYJA 4A93J 3E5QA 1I3AA 3OYCA 3HPGA 2FRHA 1SVMA 1WH5A 2VLAA 2PMHA 2ZFWA 3HUGA 2Q2EB 3ERMA 4RLQA 3KLNA 3MZ8A 2I8DA 2PG4A 2JVGA 4UUTA 2DPUA 4F91B 3NAUA 1YJWI 4GDFA 1QO0D 3K4BA 1P9QC 3HUGB 2VJIA 1POGA 2ICWG 3FISA 3GFLA 4F93B 2MD0A 3P7NA 4NNJA 1H8AC 4CSWA 4UVCA 4A3MJ 2ZNYA 2NOJB 1I1SA 2KT0A 5DM6F 5LRSA 1U3EM 4ESJA 4U0VA 2K02A 5E8GA 4S0HB 5HS8A 1GXQA 1YOVB 2DMNA 1ZN2A 2DO7A 3K9TA 2V6CA 4M6YA 5J47A 3GTJJ 4EEFG 1FC3A 5ERIA 1JJ8C 2DBBA 5BS6A 5FROA 3S93A 1O3SA 3HYIA 4GYIA 5KNLA 3HOYJ 4G6TB 3VPRA 1K79A 1IAWA 4GGGA 1FOYA 2CUZA 1KZHA 1QZEA 4HNVA 3FKJA 1R71A 3RI4A 5LGTA 1Z0XA 3V8KA 3C18A 1VQ8I 1I50J 1G3SA 4UY8I 5KCMA 5AIQA 3OYGA 1MMGA 3K6GA 1ZAOA 2E7XA 3DKXA 3T0YA 3IL2A 4BQQA 1ZRFA 2EFOA 1R5GA 1R1VA 1B6AA 3CF2A 4UUVA 3QP5A 3BG5A 4MLOA 3TDZC 2VBXA 4WXHA 3BROA 3M1EA 4KYWA 2VQGA 4XKBA 3GZ6A 4PGHA 4BXFA 1UHSA 2GIZA 2WBMA 3QOEA 1MSFC 1BI1A 3SHFA 5D8KB 1IUYA 1KQ8A 3DV8A 4J19A 2WTEA 1DPUA 3FHZA 1NK3P 1MNMC 2EA2A 2FBIA 2LNBA 3ABKH 3TOAA 3L2QA 2IGMA 2KRHA 3RKXA 5IT3A 3I4PA 2VE8A 4L5JA 1HOMA 2OBPA 4B44A 1Y1VJ 3ULQB 1J09A 3WTYC 4X0GA 1MBFA 2XB5A 1NH3A 3CCJI 4V2FA 2FX0A 2F4MB 4EJTA 3JREA 3W3CA 2CJJA 1WKMA 1FOKA 3OOUA 4Q4ZF 2COMA 2IJLA 3WODF 3M8EA 3KP6A 3G73A 2IS6A 5FO5A 3LSRA 3ZPLA 1JT6A 1MH4A 5IT9K 4I76A 1N25A 1QNTA 1R1TA 1XDSA 1ZQ3P 2WADA 1PP8F 1EF4A 1LQ1A 3WE2A 1I1GA 2Z16A 2LVSA 2OQGA 3ROUA 5KHDA 2GAUA 2OCEA 1Z7LA 3BTCA 3LWFA 4QPQA 4S05A 1NTCA 2PQ8A 2DDAA 2JA5J 1T08B 2AQEA 4Y7NJ 1IJWC 2V9VA 1WJ5A 2HOEA 3ZOBA 2NAZA 3OYMA 4RB2C 3U9GA 3DPTA 3DF8A 2HYFA 2KZVA 1AKHA 4QPOA 1JTXA 3WTVC 3TMOA 3K2AA 3HRMA 1IRGA 2FA5A 4BUPA 3EUHC 2JT1A 3PFYA 2CUEA 1AKHB 3ABUA 5TGTA 1RC9A 2OF7A 1EH7A 2DFIA 1DDNA 2EFWA 3CC2I 1R1UA 4A3FJ 3H1CA 3SFZA 4PCQA 2GZWA 4KIBA 5GAGJ 2JA2A 2ZMEC 3LSKA 4HX8A 4P5OA 4XOPA 1ZR4A 2EK5A 1RRJA 2ZJ2A 1KONA 1R58A 4CCLA 2A68F 3ABMH 3CF5F 4IHWA 2OA4A 5L3FA 2JQ7A 2XIGA 5L3GA 4XSZF 2P7VB 3L2RA 2FNPA 2K4JA 2QVOA 3N97A 5F1JA 2P8TA 1MBGA 3WGIA 3OYIA 2A6EF 2ID3A 3LSTA 1BN5A 1BA5A 4RAYA 2LY2A 4PDKA 2XAUA 4AVZA 1QPMA 4LLLA 4DW6A 2ZXHA 2MABA 5KAIC 1W0TA 4E7ZA 2QYOA 2VOOA 4KMFA 1UCRA 2JK3A 4NB5A 3CC4I 4BDYA 5GADJ 3CCLI 4UV8A 4A6EA 4UVBA 2PJPA 3M1CA 3TEDA 3E3VA 2O03A 2QM3A 1VQMI 4DZJA 4KIGA 5FJ8J 1RZ4A 4KUMA 3ZQGA 4CGZA 3JRGA 2HVRA 3IKVA 2Q8KA 2M5WA 2K5CA 3J7AY 2FBKA 2ZCWA 5J3LA 3PSIA 1QPIA 3JAMK 3OYAA 3FBIB 3LAPA 3AFHA 2LH9A 3PUFA 2X0LA 5GAEJ 2M4GA 2K7LA 4BE2A 2R7VA 1T6SA 1E3HA 2A5WA 2KZGA 1OR7C 2VKDA 4ABZA 2F2EA 3KPHA 3GZNB 4AIDA 3S1RJ 3LSPA 4D0PA 4NC6A 4GO1A 4ZZDA 1E3PA 2V9PA 2OCCH 2K3FA 5K5QA 1D8KA 4OIRF 4IOAF 2OU2A 3TO7A 3IC7A 1VF9A 4ASNA 2H1KA 5D4SA 2FMLA 4FCYA 3RCOA 4XRFA 2M34A 3WU1B 1R22A 3C1DA 3A01A 1DGRM 3H9GA 3H5RA 5K1YA 3MZYA 2QUFA 1U2WA 3HHGA 2F4IA 1P2FA 3A01B 2MC4A 4Y33A 1B72A 4R79A 2R7DA 3FX3A 1VQ4I 4IL6C 2HZTA 1C0WA 2BE5F 4HF0A 2Y0SA 4NQWA 3ZCOA 3HTUA 2LF7A 1B72B 5AIPA 2KPMA 2L02A 3FIWA 3F8BA 3FWEA 1R6RA 4QLCU 3OR1C 2EFPA 4BACA 4GCVA 3ABLH 4NQWB 5F0CA 2M45A 2X48A 2K9MA 3MKLA 3RPUD 1GHCA 1HKSA 1KYZA 1USTA 3TW6A 1IN6A 3F9KA 5DUKA 3H9JA 5ILSA 2BXYA 2FMYA 3CCMI 4XRMA 2XGCA 3N05A 4FISA 1YO5C 4BNCA 3V7SA 2UZKA 4CA0A 4Z6YA 3E7LA 3RQ4A 3CMYA 3HOVJ 1A6IA 3PQKA 4XBFA 3HOZJ 4U0WA 4RLFA 1KU2A 1K78A 3F8CA 4HQMA 1S8NA 3PSFA 2LKXA 3A0HC 2TDXA 3K70D 3G71I 1MMAA 2VI6A 3EETA 4N4OB 1IRXA 3IAS2 1K78B 2ZC2A 3DKYA 1XDUA 2X4HA 4WX9A 1ZR2A 3PO3J 4LJZF 3ASOH 4BHCA 2L9VA 4XMYA 4BQAA 1XMAA 3IAM2 3EUKL 2LMDA 1WJCA 3TO9A 4PUSA 5J1YA 3FM5A 1YX5A 3ONQA 1HF0A 4XK4A 2NVUB 1FIPA 1QZZA 4CCJA 2COBA 1Z1DA 4C30A 4IRHA 2ZSHB 2W25A 2KHMA 2QKLB 2DYRH 3IWFA 4UXNA 3G6EI 1MSEC 2R7OA 2ACJA 2DT6A 2LDUA 3CCQI 3S16J 1OCPA 1XD7A 4MQVA 5DUIA 4NUBA 4BHPA 2X1DA 4HQEA 2ZKZA 2STWA 2HQNA 4HZFA 3VYUB 3JSOA 2XAHA 4BXXJ 2DA4A 3GW2A 2OJED 5FLXZ 2FXAA 2DK5A 3KX2A 1V3FA 1XGNA 2RN7A 4A0ZA 2IS2A 3RQIA 5D5XB 1WJBA 2OAZA 1T0FA 2V1NA 4LG3A 2ISYA 1FSHA 1CF7A 4IOCF 2VXDA 1DU0A 3OS2A 1F36A 1CF7B 2QSGX 4CYDA 1K6YA 2WY8Q 2QSFX 5EG0B 1W7PA 1V5EA 4HDVA 5EZHA 5FRMA 2IRFG 4IVNA 2E2IJ 4FE7A 3R60A 2CV1A 1VZ0A 2YU9J 2GLOA 3WTXC 2IPQX 1W7PB 5HLIA 4A0XA 5FB2A 1K4SA 5JFRA 2CUJA 4O6JA 4E7SA 1Y0UA 3WG7H 5FKNA 3M8FA 5M5WJ 2XAQA 3AG4H 1FYMA 2R92J 1FEXA 3CJTB 5JI6A 4WF2A 2FOWA 1NG7A 4YRVA 3L00A 4W1UA 1XN7A 2FBHA 2L4AA 4FE4A 1Z3XA 1RR7A 4M9ZA 2R7XA 2BY0A 1ZG5A 3SJMA 3RSNA 2Y31A 1IDYA 2Z3YA 4BXUA 2CWEA 5HS9A 1YLFA 1MJBA 2WY7Q 4O5VA 5ICCA 5EDNA 4CYCA 1IN8A 1UJ8A 2DCEA 3GF2A 4D1QA 4PFOA 2AHQA 4ENNA 4FHTA 4C2UA 1U5TA 4EQQA 4M3GA 5DEQA 1AOYA 2DK8A 2MG4A 1I3QJ 4CYCB 1V54H 1Z67A 2Y0SN 2CQQA 2A07F 4CO8A 3DPLC 5HS7A 1U5TB 3C2HA 1APLC 3RTRA 1LE8A 3PNTA 4G6DA 3RDIA 3MWMA 3OMYA 4KISA 1EH8A 3OSFA 4EVIA 1WJDA 1LJ9A 3FM3A 3W6VA 3COAC 4BS9A 5CKTA 1LE8B 1XC5A 2DODA 3U2RA 2O6GE 3QYFA 2CU7A 1ZGAA 3K4KA 1MJAA 3G2BA 3UR3C 2KISA 5DCMA 2OD5A 1G6NA 5FD5A 1HDPA 1U8BA 2XF7A 4KT6A 1V4RA 2XDVA 3TP3A 4A5NA 1BI3A 2QZ8A 5JHUA 5DCMB 3V42A 2JSPA 4L5EA 3P9CA 3RJPA 1IN7A 5B1AH 3QWLA 2W85A 3QRFF 3H5AA 2JRMA 3K0LA 1K6OA 1J0RA 4G94A 1MBKA 5L3DA 2WAFA 2FU4A 4YIRX 4EJVA 3T1BA 1B8IB 3L2CA 1S29A 1O7LA 2K9LA 3HOUJ 1HSTA 5JHFA 2JSCA 4A3JJ 1JKRC 2JTVA 4M6VA 3IKTA 3WGHA 2M30A 4M71A 3K1NA 5JVTA 3PJRA 2DOEA 3CJQB 3MVPA 2EWNA 2VASA 4HNUA 2EIMH 5E3LA 1WWXA 1FIAA 2G7HA 2DYSH 4A3LJ 3HRTA 2CQ7A 1XG1A 3E6BA 3JCUC 2DT5A 3MQ0A 2IGNA 4YELA 3I56I 1UMQA 3H36A 4OIPF 1BM9A 3BTLA 3RIRA 3L2WA 5DTDA 5LD2C 2ZO4A 1R49A 3OIPA 3LA7A 1BOBA 2M0MA 1HBXG 2XPUA 1YFHA 4D7NA 1OISA 1ENHA 4BHBA 3M7GA 1OPCA 3O2PE 5FKLA 3CCUI 1JJ6C 1IF1A 1YS7A 3HPHA 1H9GA 4AYBA 1IZ1A 2MYSA 1QU3A 5L3BA 2HWVA 2EILH 2PX9A 2M8EA 2IS4A 1P6RA 3TO6A 1WZ2A 1XCVA 3S1MJ 3GO5A 2EIKH 3GTLJ 3V7RA 1RESA 2R7ZJ 4XLNF 3WTZA 2AS5F 2KRCA 5EZGA 2JZYA 3OV8A 3LSJA 4CCNA 3K2ZA 5FKOA 4G6QA 2I5UA 1IXCA 3PUBA 3S32A 1ZARA 1G3WA 3B02A 4FTHA 5J8CA 4KN7X 3QODA 5F64A 4CDGA 3H9QA 3CMMA 5B5EC 4B1RA 2W84A 4UHTA 5HDGA 1TQIA 4HV6A 1BW5A 2F5CA 1L0OC 1FZPB 4LGWA 1N77A 2W24A 1B9MA 4XLFA 1OFCX 5FKMA 2DJIA 2KJBA 4JP0A 5DD4A 5LEKA 1VQ7I 3FK6A 3HSEA 2FQ3A 2Y48A 3W6KB 2JJ7A 2P6SA 5EF6A 1FTZA 4LIUA 1YW8A 4A2UA 3HGYA 4M73A 4RS8A 5J40A 2DAOA 3LOCA 1TWFJ 4OWRB 3FBNB 2GA1A 4EGYA 3H3ZA 2HS5A 1GDTA 3H0DA 4ZYGA 5CVJA 1SVLA 3A03A 5ICEA 2OQRA 1OQYA 1UELB 3D1NI 3BR5A 1VTNC 1IRFA 1ZKGA 2KL4A 3IHUA 3JAMZ 5F1RA 2MW8A 2R7SA 2TRTA 4BYYA 3KP2A 1XPXA 1K4TA 2X51A 1UG0A 1K61A 3HM5A 2CV2A 3S1QJ 2IVMA 3AL0C 3FMQA 1S9HA 2O8XA 5HLGA 3BQYA 2V4JC 1VNDA 5J4VA 5C4XJ 4MEYF 5ICFA 3FKIJ 3RKWA 3VOEA 1X4OA 2PBIA 4YG2F 4E7LA 1ZREA 2GXAA 4DYCA 4I6ZA 3TL4X 1UB9A 3I59A 2VJ4A 1RETA 2EPFA 4OAZA 3BQZA 4MO7A 4IRIA 3I3LA 2LF8A 1X19A 1O4XA 3ZRGA 1A36A 1OCZH 3I59B 4C2TA 3WGGA 3LFKA 2YUSA 5F0FA 2Z33A 3QQAA 2HDCA 1MH3A 3SZTA 2L7FP 3QP6A 2DTRA 2X85A 1LFBA 3EQLF 1YIOA 3S3OA 1QVTA 4K2EA 2CFXA 4A5MA 3ZMZA 1XMKA 2LTPA 3BZKA 3OYEA 2X1EA 1MBJA 5GPAA 4HPQA 2IGOA 2VIXA 4R8HA 1X2NA 3OYDA 1U78A 2NVYJ 3TBIA 3FDYA 2FJ1A 5CVIA 4MEXF 2BHZA 2DFEA 1G2HA 2KRFA 3H3UA 3BJOA 3WE3A 2CMPA 2X1CA 3L09A 1S3JA 2GOXB 4LLNA 2A3SA 1ZYRF 2KMUA 3CDLA 1BJZA 3ZQIA 3H0GJ 4DJAA 3J80K 2OUMA 3H5NA 2W1OA 2XASA 1WH7A 2XKPA 3W2WA 5HLTA 3F21A 2E71A 3GTMJ 2RQPA 3KZYA 4AYBN 4QWQA 1BC8C 2NXNB 2R3SA 2YX4A 1VQNI 3RKYA 3GXOA 3UNGC 4AWXB 1HCRA 3S15J 1WGXA 4ESBA 1CQTA 5LGNA 1RUNA 1YE9A 1MIJA 2STTA 2ME0A 2DMUA 5FFZA 1RNLA 3CCVI 2VODA 3CDHA 4RMNA 4BJ6C 3HOXJ 2A5YB 3MFKA 5HNFA 1X3WB 3WHCA 1HW5A 1A6QA 2GXGA 3SZPA 3CO7C 3BG9A 4KJZA 3VYRB 1NG6A 4UV9A 2HZDA 3LL7A 3PIOF 3ZMUA 2DDBA 3FXMA 3BT9A 3BCAA 3O8HA 1H89C 1DQUA 1FYLA 1TT5B 2YX7A 1RIOH 3WU2C 1S5LC 1GT0C 1KU7A 3L2VA 2M3AA 3NWTA 4XLCA 1ZH5A 5A2QK 4XNFA 2F5VA 1RKWA 2CH0A 2RREA 3GTGJ 3TW7A 2XRNA 2QF7A 2XGXA 2KIQA 1SMYF 3BG6A 1SAUA 4PFPA 4BGDA 4HF2A 4ZTFA 3ASNH 3KLOA 5JVGF 2ZJPF 5EYRA 1E0EA 1MBHA 3BR6A 4BBSJ 5B1BH 4RM2A 5EJCA 4WXCA 2PMZA 4Y13A 3T5XA 1A31A 3GWZA 3S2DJ 4C3JJ 4A3BJ 5M3FJ 3BTJA 3QYEA 3LQRA 3K70C 2DA2A 4ZYEA 3KYCB 3UKGA 5HDKA 1JKQC 3B6CA 2FQ4A 1JI8A 2KDOA 4A6DA 2RVCA 2NVQJ 1PJRA 5FKKA 4DOZA 1G59A 2L7KA 1SD4A 4BH9A 1Y6IA 3A4CA 2AXTC 3OY9A 1P4XA 3DLLF 3ZQHA 3TQNA 1FOWA 1IV8A 3K4MA 3TKYA 4XIDA 5CVVA 5K7ZA 2QQ9A 3IUOA 1VQ5I 1HW1A 3OOPA 2E1OA 4B3XA 2UWMA 1J7KA 2XKOA 2D2WA 1R36A 3CUQC 1MMSA 3F8FA 4IXAA 5K5RA 1UFMA 4NC7A 6PAXA 4I01A 2VC0A 1KQ0A 2YR2A 2PMUA 5E1ZB 1D1AA 2J5PA 1TC3C 2Z5UA 2RKHA 5E3MA 5C4JJ 3TGNA 4I98B 3QOPA 1XB4A 2DMTA 1ZGJA 1IN4A 1ETOA 1VFCA 2E1MC 3VODA 3HB9A 4KMUX 3KP5A 4J00A 4L0YB 4OMZA 4HSRA 2E36A 2LREA 2VPLA 2E1CA 3K69A 3VWBA 1Z77A 5FLVA 3D5SC 1Q1HA 2VN2A 1D0XA 4IEJA 2ELKA 2R5YB 4MNUA 4HYEA 3KIOA 4XLPF 4EV0A 1O57A 2LC2A 2QCOA 4CXFA 3GYHX 1ETYA 2EB7A 2P4WA 3H3VK 4ZTJA 1WJFA 1LFPA 5J6XA 1P4WA 2JA7J 2L0KA 3KZIC 1TP4A 3IH2A 4ENKA 2VONA 4LD5A 3Q0WA 4EJUA 5HNHA 3HC7A 2PEXA 2BY1A 2UV1A 2BV6A 4E7KA 4XKVA 3HKZA 2O0YA 4AUXA 3AG3H 3G4SI 2WWYA 4OU0A 1ZG3A 1R4MB 4DQ2A 5BMZA 2IA1A 3ISPA 1BOAA 1Z7UA 2Y0MA 5CQGA 3BDDA 2C6YA 1MGTA 1LVKA 1IXSB 9ANTA 1PYVA 1XS9A 2ZMEB 4ZDPA 3V7CA 3K1PA 3C2GA 1W5CC 2GOMA 1D0ZA 4NHJA 2R5ZA 2MBFA 3JRFA 3ML6A 5FFXA 1REPC 1LB2A 1YS6A 2EZIA 2R5ZB 2PJRB 4CCMA 5D5UB 4G12A 5DD8A 2BY3A 1HKQA 1JXSA 4GXOA 3HRSA 4IRGA 1FJLA 1V55H 3MKWB 2EZHA 4LIVA 3FZVA 4I02A 5JLXA 3NQOA 1KYWA 3BCBA 5LHGA 2KLOA 3KEYA 4XKCA 3OYKA 3J7YJ 1UAAA 4C2MJ 1KA8A 2HOAA 2XC7A 4E7IA 1QZYA 4I0AA 2M7AA 1H0MA 3A2KA 3J7AO 2WAQA 3FXKA 3KP7A 1S72I 3J81K 1W36D 1EKEA 5IP7J 3E6MA 3OYLA 5IYDJ 2M8GX 4EM1A 2QBYB 4M3EA 1FWZA 2ISZA 1T56A 3WTUC 1YG2A 1GVDA 4PJNA 4PSXA 2WV1A 4Z2YA 2CQNA 2KQRA 1BL0A 1LKXA 4Y17A 1Y56A 4GRIA 2LR8A 1GXPA 3VYTB 3BPVA 1O7FA 2HQRA 1GVJA 2EFNA 1IXRC 3IRQA 4IO9F 4IF4A 4M72A 3FXUA 4QIWN 2OV7A 3LSMA 3EYYA 4EM0B 2BVLA 2L2OA 1FY7A 2N8GA 2JRTA 4NBQA 2TCTA 4KITB 1X1DA 2ELJA 2VKEA 5KK1A 4V2GA 5F08A 2H6CA 1ZLKA 1TWHJ 4B48A 1I27A 1Z05A 3D5RC 4BQNA 3PNVA 3CD6I 5E8IA 1O3QA 3CCYA 3I54A 1V5FA 1BIAA 5ILUA 2CW8A 3L2UA 3MN2A 1FX7A 1UZCA 1YITI 4I99C 2Y2ZA 2Y69H 3OYBA 3LA3A 2ME6A 1FOXA 3DTKA 3B73A 4BL0B 3JTHA 1X1CA 5LGUA 3JRCA 4ZYDA 3CJNA 2QA4I 2O3FA 1EJ9A 2DPDA 1FT9A 4XR6A 1A04A 2HXIA 3H92A 3M07A 1WI9A 2HVQA 2OZUA 4Q47A 2ZJQF 2DA3A 3RZDJ 1R7JA 2XPVA 3Q9SA 3BR3A 2G9WA 5E3OA 4U7BA 5K5OA 2OC6A 3K4NA 4XICA 3GX4X 1H88C 3PIPF 4UNOA 3I4NJ 2HQ5A 3KP4A 2IS1A 2BBYA 4KIFA 1IRZA 3WG9A 5EG0A 4G7ZF 3PNYA 1FMWA 1MNEA 3QAHA 1HLVA 1S7AA 4S04A 4R1HA 3WTTC 1VI0A 2HTSA 3MEXA 5GAHJ 3BR2A 3HKZN 4ZYAA 2Z9OA 1X2MA 2FE3A 2EFQA 2LBFB 4ZH4F 2HEOA 3OIOA 3OYHA 1BI0A 2VC1A 2VJJA 1RUOA 3NRVA 2EQRA 4P96A 2UXNA 1P4AA 1TLHB 2XUBA 5LHHA 3AG1H 2V26A 3IV5A 5B66C 3LNQA 4PSWA 1FBQA 2W82A 2PI0A 2VBWA 3HIFA 3RYPA 2IBDA 4RM3A 1ZHFA 4AIJA 4CUGA 2Y9YA 4HA8A 4XL9A 2E35A 3PO2J 2L5QA 3DBLB 2F4OB 1X3ZB 3ELKA 4CH7A 1WQ2A 3JRBA 3E1SA 1UG2A 1QA6A 3SQNA 3OR2C 1TWCJ 2A6TA 2RDPA 4L9JA 1MJ9A 4H0EA 5H20A 2WV0A 2NS0A 2IAIA 1IW7F 1Y0NA 2CQKA 2QQBA 3TOBA 2XRLA 1FPQA 3HJEA 1BBYA 4ETSA 5HVQC 4CHUA 2LKSA 4AD9A 2YSRA 2XF6A 3ECHA 3DEUA 5K7HA 4XLHA 2DFHA 2P6TA 3J80Z 1DUXC 2NYXA 2E2JJ 4NC8A 2FNAA 2HKOA 5D6FA 1WRJA 4JQFA 2GXBA 2Q1ZB 1FP1D 3P9KA 5BOXA 2L9NA 3CZ6A 4G7HF 2L54A 1VQPI 4QTRA 1JE8A 4IPAA 3DQVC 3MKZA 2WB1A 3W2VA 4BJ5C 2CG4A 3L1PA 3KFWX 1ZRDA 2K3PA 2QWWA 3ZN0A 4MFDA 2VT2A 3SYTA 1IGNA 3ZQFA 5IY5H 2BXZA 1YYVA 3Q0UA 5CJ9A 3AG2H 4B8XA 4GYGA 1EA3A 5BQTA 1I6HJ 2AXLA 2LSOA 3MD2A 1T95A 4XSXF 3OSGA 2V79A 3O6BB 3KZZA 4XRSG 1LUJB 1U9NA 1ZG1A 4P1WA 2MGQA 1S6LA 4B47A 1B8IA 1ON2A 3BOQA 5TISC 1HXDA 1ZTRA 5KVRA 2KIFA 1X1PA 1GUUA 3GFIA 3M9AA 1B4AA 5GTIC 2R7WA 3F22A 3FXOA 3J7ZI 2K9NA 3KCCA 5LEJA 3GUDA 5E17F 3CESA 1KGSA 1QHGA 2ELHA 1JHFA 2R7UA 3A02A 4KA4A 5IT9Z 4BY7J 2K40A 2H6BA 1XGSA 1RPWA 3ZQQA 2ESNA 2CFOA 4X1EA 3GZ5A 2HYJA 4PK4A 2KKOA 2HXOA 4HAMA 1W7PD 1G8XA 3HGGA 1P92A 1F5TA 4JX4A 4L9NA 2VBYA 4MFEA 4XKWA 4MHGA 2CYYA 4U87A 2WAEA 1HQCA 2PFBA 2NNYA 4L0ZB 5TRDA 2A6HF 2HGCA 3RPQA 1BR4A 3NWSA 1MKMA 4J01A 1OCRH 2O61A 3MKYB 2EZLA 2YU3A 2DA5A 4L5IA 2W4SA 5BNGA 3A0BC 5LRRA 3LMMA 3DCFA 1D5VA 1WJAA 5IPAA 4DGWB 3BJAA 1VQKI 4IHXA 1BR2A 3B6AA 4ITVA 4XORA 1FYKA 4RGXA 3HBLA 4HNTA
chains in the Genus database with same CATH topology
3G6EI 3CCJI 3CC7I 2E36A 5GAEJ 3CCQI 3CCVI 1YJWI 1YJNI 2E34A 1VQ9I 3CCRI 1VQPI 5DM6F 2K3FA 2OTLI 3CD6I 4IOAF 3PIOF 1YJ9I 4IOCF 1YIJI 1YITI 3I55I 3G4SI 1FOXA 2QA4I 3CCSI 2QEXI 1Y39A 2ZJQF 5JVGF 1FOYA 2ZJPF 4V19K 1VQ4I 3PIPF 1YI2I 3CC2I 3CJTB 3I56I 1VQ8I 5GAGJ 4UY8I 3J7ZI 2FOWA 2OTJI 1HC8A 3CCUI 5GAHJ 3CF5F 2JQ7A 5DM7F 3CCMI 2ZJRF 2H8WA 3DLLF 3CMEI 1ACIA 1VQOI 1FOWA 3J7YJ 1VQ6I 3CCEI 1YHQI 3G71I 1VQ5I 1S72I 3CC4I 5GADJ 3CCLI 2E35A 1MMSA 1VQMI 3CMAI 1QA6A 1VQKI 2NXNB 1VQ7I 1VQLI 4IO9F 1VQNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E I;  3CCJ I;  3CC7 I;  2E36 A;  5GAE J;  3CCQ I;  3CCV I;  1YJW I;  1YJN I;  2E34 A;  1VQ9 I;  3CCR I;  1VQP I;  5DM6 F;  2K3F A;  2OTL I;  3CD6 I;  4IOA F;  3PIO F;  1YJ9 I;  4IOC F;  1YIJ I;  1YIT I;  3I55 I;  3G4S I;  1FOX A;  2QA4 I;  3CCS I;  2QEX I;  1Y39 A;  2ZJQ F;  5JVG F;  1FOY A;  2ZJP F;  4V19 K;  1VQ4 I;  3PIP F;  1YI2 I;  3CC2 I;  3CJT B;  3I56 I;  1VQ8 I;  5GAG J;  4UY8 I;  3J7Z I;  2FOW A;  2OTJ I;  1HC8 A;  3CCU I;  5GAH J;  3CF5 F;  2JQ7 A;  5DM7 F;  3CCM I;  2ZJR F;  2H8W A;  3DLL F;  3CME I;  1ACI A;  1VQO I;  1FOW A;  3J7Y J;  1VQ6 I;  3CCE I;  1YHQ I;  3G71 I;  1VQ5 I;  1S72 I;  3CC4 I;  5GAD J;  3CCL I;  2E35 A;  1MMS A;  1VQM I;  3CMA I;  1QA6 A;  1VQK I;  2NXN B;  1VQ7 I;  1VQL I;  4IO9 F;  1VQN I; 
#chains in the Genus database with same CATH topology
 5HOD A;  1LEA A;  1J9I A;  2DOA A;  3TDU C;  1ODD A;  1X4P A;  5H6Q A;  2QGU A;  2MLG A;  1BJA A;  1YQA A;  3G1L A;  1WHU A;  2IEK A;  2Y75 A;  1XCB A;  4I7H A;  1QQI A;  1QHH D;  1LNW A;  3KEO A;  4PJL A;  5J1U A;  3GTQ J;  3OYF A;  3VSL A;  4YII A;  2DN0 A;  2Q0O A;  2A05 A;  2Z2S B;  1T2K A;  4BE0 A;  2ZSI B;  4WWC A;  4HW0 A;  1SD5 A;  1BI2 A;  3K4L A;  4BDZ A;  2F5E A;  4HX7 A;  2XRO A;  3HTS B;  4F52 A;  3GTO J;  2VBZ A;  2DMQ A;  4TV7 A;  3EUA A;  3E97 A;  1F4K A;  1G3T A;  1A35 A;  2GIV A;  3HZJ A;  1R4N B;  2DFF A;  2D1H A;  2VB6 A;  4CCO A;  1ZRC A;  3L9F A;  1IG7 A;  4EMS A;  1TNS A;  2WC2 A;  2XSJ C;  2HKX A;  1TW3 A;  1GLN A;  2XGD A;  1SD6 A;  4KN4 X;  5B3S H;  1PUF B;  4DYR A;  1Y39 A;  2GQQ A;  1ETV A;  4EM2 A;  3ECO A;  2AQF A;  2HQA A;  4FET A;  3RZO J;  2XAG A;  3OS0 A;  2IXS A;  1LPQ A;  4XRS A;  1E2X A;  3BTI A;  4DNC A;  4X6A J;  4RDU A;  3HOT A;  2VQH A;  3LSG A;  4D5F A;  4E4H A;  3S3N A;  4AIH A;  1OJL A;  2CQX A;  2QEN A;  2M2E A;  2WB1 N;  3K7A J;  4XN0 A;  1BR1 A;  3H35 A;  1ETW A;  1OCC H;  1HA8 A;  1IO2 A;  2A61 A;  4HEA 2;  1SEU A;  3QPH A;  2HU9 A;  2BOL A;  5F04 A;  3JW4 A;  1UHM A;  5HLH A;  2F5F A;  1BW6 A;  3LSH A;  2HNH A;  2BVM A;  1D3Y A;  2B7E A;  4KT5 C;  5F0H A;  1LFU P;  2WA0 A;  2NNN A;  1WI3 A;  2P81 A;  3M8J A;  3MMY B;  4LB5 A;  3CTA A;  3C7J A;  4I09 A;  5D4R A;  5FLX K;  1IN5 A;  5GTH C;  4IHV A;  2HPM A;  1TZL A;  2KDZ A;  3Q9V A;  4BU2 A;  2CGP A;  2KIU A;  3SEQ A;  2QQ8 A;  2M1B A;  2QLZ A;  3I64 A;  3K10 A;  1U9O A;  4UUS A;  1D8J A;  1FLI A;  3GEZ A;  4MIM A;  2P5K A;  2E7W A;  4D5C A;  5CPR B;  2VQC A;  5IYC J;  3SDB A;  1HKT A;  2VKH A;  3O8G A;  2RNJ A;  3GCM A;  3S8P A;  3GLL A;  4UUS B;  2HVS A;  2QQA A;  2F48 A;  2XAJ A;  2YS9 A;  3DU5 A;  3ZMD A;  2XSD C;  2X6O A;  5EEA A;  2M9H A;  5TJJ A;  3F3X A;  4XOT A;  1P7I A;  3BLY A;  3R61 A;  2X6W A;  2ECB A;  4B3A A;  2KIM A;  3I0T A;  1VQL I;  1FMV A;  3J81 Z;  3ZQL A;  2JMW A;  4LFU A;  2VPR A;  1GV5 A;  3GVA A;  1WPK A;  3FK7 A;  3Q3S A;  2R7T A;  5E1W A;  4A3I J;  4IZZ A;  1YJN I;  2O5R A;  1I5Z A;  1OCT C;  2L4M A;  4LIT A;  3JRH A;  2FD5 A;  2K4B A;  1EV7 A;  3AL0 B;  1W5S A;  2LRD A;  5IP6 A;  3OWT A;  4D9J A;  4AM3 A;  2LP0 A;  1DP3 A;  1O3R A;  4M6X A;  2ZNZ A;  5J4Y A;  3P5J A;  4PJJ A;  2VT3 A;  3VDX A;  1YIJ I;  2A69 F;  1XX5 A;  5H2F C;  3BY6 A;  4MGR A;  3BC8 A;  4Y4R A;  4P9U A;  3HOW J;  3FXR A;  1FNN A;  2JPB A;  3Q0V A;  3PM1 A;  3HL2 A;  4HLX A;  5M3M J;  2ZB9 A;  3TP0 A;  1F1Z A;  3R6S A;  2NVT J;  4HX4 A;  4A3E J;  4UVA A;  3QPS A;  1TW2 A;  2H8R A;  2GM4 A;  4GFB A;  2O9L A;  1AWC A;  1ETK A;  4Y52 J;  4XLA A;  2Z99 A;  4BKX A;  1E3O C;  4BE1 A;  1PDN C;  2JWT A;  3EYI A;  3E0J B;  3E6D A;  4HOB A;  4CZZ A;  3BZC A;  5ILV A;  4E7J A;  2V1D A;  4JOM A;  1JTY A;  1MBE A;  5E3N A;  2JPC A;  4G7O F;  2HOT A;  3I4M J;  1ZK8 A;  2B0L A;  2P5L C;  1J2X A;  1W36 C;  2FEZ A;  3OL3 A;  1B1B A;  2E60 A;  3A1Y A;  1OYW A;  2H94 A;  5FLM J;  1D1B A;  3CP2 A;  4ZJZ A;  2VUM J;  5DCF A;  5D6E A;  1LDK B;  1L3L A;  2ID6 A;  1AA7 A;  1ULY A;  5LFA A;  4EJO A;  4L18 B;  4WXD A;  2JA8 J;  1SD7 A;  2HYG D;  1PP7 U;  1M1E B;  2M4K A;  2LYC A;  3S2H J;  1D1C A;  1V5G A;  2R7Q A;  4C9Y A;  3VB2 A;  2HOS A;  5L3E A;  1UHW A;  2EV5 A;  2HR3 A;  4A3D J;  3FMS A;  4II3 A;  3V4G A;  5CLS A;  3E5U A;  4JYK A;  4P9F A;  3WTS C;  4D7M A;  2IA0 A;  4DBQ A;  3BWG A;  1SFK A;  1R5I D;  1JGG A;  4B09 A;  3ZMT A;  5DYM A;  1Y8R B;  3RKQ A;  1J5Y A;  1Z21 A;  1N78 A;  2GWR A;  3ERE D;  4JX6 A;  5JLW A;  2XB0 X;  3ZN1 A;  1TT0 A;  3DBR B;  4OMY A;  1AU7 A;  3DEW A;  2MC3 A;  1W1W E;  1DPR A;  4BJT A;  2KFD A;  4FT8 A;  1J59 A;  3R0A A;  3DWL E;  4C3H J;  1KU3 A;  4BAY A;  3HG9 A;  2MFZ A;  4XM3 A;  4OIO F;  4E6K G;  1SAN A;  2FUG 2;  1QVU A;  2DXI A;  2F5D A;  1YJ9 I;  3RPU A;  3GME A;  4CZC A;  5IOZ A;  4G8X A;  1TQM A;  3VEP A;  4OAY A;  5CVU A;  1Z3Y A;  5E1X A;  3QPL A;  2O8K A;  1HSJ A;  2R5Y A;  3F0C A;  4LLG F;  4EGZ A;  3AKZ A;  2VJ5 A;  1J75 A;  3CUO A;  5LBQ A;  2V9K A;  4MTD A;  3BP8 A;  1P7J A;  1ON1 A;  3BPX A;  4RB0 A;  5BPI A;  2L9R A;  1LVA A;  1QGP A;  4JX5 A;  2D1V A;  3I58 A;  3FMR A;  2XAF A;  1Z91 A;  2Z1D A;  2BY2 A;  3O3K A;  3PQJ A;  4IHT A;  1SC7 A;  2NS8 A;  3HDD A;  2NOG A;  3ZQC A;  4ENM A;  1JKO C;  2ZXW H;  1T38 A;  1PVE A;  1KU9 A;  3K4C A;  2V6E A;  4KNY A;  1Q1V A;  3U21 A;  2R7F A;  2LG4 A;  3EUH A;  3V8L A;  2LY9 A;  3DLA A;  2BYV E;  2MA3 A;  4UB6 C;  4HBL A;  2ZME A;  4PGG A;  2X6Y A;  3KET A;  1LDJ A;  5DM7 F;  1MD0 A;  2H8W A;  3WTW C;  2UXX A;  3CUQ A;  4ON0 A;  1GV2 A;  3WHB A;  1K7A A;  1KQ9 A;  1TWA J;  1Z9C A;  2DMP A;  2EZK A;  4HDU A;  1VQO I;  1ETX A;  4WCG A;  1VQ6 I;  4NDL A;  3QU3 A;  2IA2 A;  2ZBK A;  3CUQ B;  1JUP A;  1R5H A;  3SFI A;  3KYL A;  3SXY A;  1YHQ I;  2PJR A;  2ESH A;  1WJE A;  3L7W A;  1YTY A;  2EJR A;  5GP9 A;  5IP9 J;  4KDP A;  3LSI A;  5JR3 A;  4PZJ A;  4A3C J;  2DA1 A;  1S7E A;  3CQZ J;  3BG3 A;  4B43 A;  1QBJ A;  3U1K A;  4ESF A;  5DS9 A;  4A3K J;  1QRY A;  3CMA I;  1H9T A;  2E1M B;  2ADU A;  1E17 A;  4IQJ A;  3VYS B;  2BW3 A;  1TBX A;  4RBO A;  4ZYH A;  2LFB A;  4F92 B;  1W5T A;  4RAF A;  3FXQ A;  3OS1 A;  2RGV A;  4L9V A;  3D0S A;  3GFM A;  1R9T J;  2BW3 B;  2PMZ N;  2QBY A;  3OL4 A;  1RR8 C;  3QU6 A;  3AAF A;  3DTI A;  2W00 A;  1TL8 A;  3CLQ A;  4ENJ A;  3GLX A;  4EJW A;  1K83 J;  1U8R A;  1W0U A;  1WVR A;  2R0Q C;  2J5O A;  4N9I A;  4HRI A;  3CCR I;  2CW7 A;  5K7F A;  3GFJ A;  5F6F A;  3VFZ A;  1NK2 P;  1USS A;  4I0B A;  3I9V 2;  5EGO A;  4DBR A;  1OR7 A;  2Y30 A;  3CDI A;  2E5Z A;  2XF5 A;  3HEF A;  3QYB A;  2DU9 A;  5D8L B;  4E70 A;  3K4J A;  3F72 A;  3T8T A;  3I55 I;  5ED4 A;  3ZQ7 A;  2XPW A;  3JSP A;  5EGO B;  2E19 A;  5E18 F;  4YFK F;  1YW9 A;  3I71 A;  3S1N J;  3SDG A;  2M87 A;  4F55 A;  4ZZL A;  3V8J A;  3CCS I;  2QEX I;  4IKF A;  2HDW A;  2CV0 A;  1T0F C;  2HPI A;  1ITY A;  4XLE A;  4XQF A;  2FOK A;  1TQP A;  2D5V A;  1ONV A;  1MDM A;  1ETQ A;  4EAT A;  2RNG A;  2HFH A;  1NHA A;  1DU6 A;  3S14 J;  4FX4 A;  2RQQ A;  2YPR A;  1U0J A;  1MZB A;  1MDM B;  3C3W A;  2B63 J;  4BQO A;  1TNT A;  1RKT A;  3NEU A;  2OTJ I;  2P5V A;  4IX7 A;  1XGM A;  5DV5 A;  2I10 A;  1IC8 A;  3MZH A;  2JA6 J;  5ICG A;  5CYV A;  5J8F A;  4OIQ F;  1SFU A;  2JUG A;  4U88 A;  5BPD A;  3S3M A;  2ZJR F;  3DXJ F;  2H27 A;  3BR1 A;  3I5U A;  4AC0 A;  2DA6 A;  1T98 A;  3IH3 A;  3F23 A;  4Y15 A;  3N4M A;  2XHK A;  3CME I;  2PLY A;  1SMT A;  4DIQ A;  5LHI A;  2X9D A;  2R7R A;  4JBA A;  1SFO J;  5E20 A;  4G9Y A;  3T8R A;  2PN6 A;  2DQL A;  5C44 J;  2DA7 A;  1XTA A;  1MND A;  1XGO A;  2UUZ A;  4E7H A;  2LBF A;  1D5Y A;  3S17 J;  2K27 A;  2L9S A;  4N0B A;  3DEE A;  3KYD B;  2BGC A;  2D45 A;  2IGK A;  3WU0 A;  1ZEL A;  2RV8 A;  4BBR J;  2HDD A;  2VOP A;  1U5T C;  2KJC A;  3P9I A;  1BC7 C;  2OZ6 A;  4ANJ A;  4LOC A;  2RAE A;  3F8N A;  4ZC3 A;  1Z6T A;  3ZMV A;  3HSR A;  4M9X A;  3FXL A;  1HDD C;  4M74 A;  3ZGK A;  1STZ A;  1MMD A;  3HSF A;  4M9S A;  3DU6 A;  5EEG A;  2XVC A;  1FTT A;  1U6G A;  3EDP A;  1WFX A;  4HV5 A;  1OYI A;  1DP7 P;  1YW7 A;  3G1M A;  2L7Z A;  1R00 A;  1MW7 A;  2GBY A;  2EV0 A;  2QKM B;  3FXJ A;  2CS3 A;  4LK0 F;  4XN3 A;  1T8I A;  4BEH A;  4ZDL A;  3HHH A;  1JHH A;  3SEZ A;  2LK2 A;  2H09 A;  1CGP A;  4JK1 X;  1T39 A;  1R23 A;  4BEH B;  2VE9 A;  3JTG A;  2F6C A;  2P0W A;  4LG0 A;  1XSV A;  1IDZ A;  4N9H A;  2P7C B;  5AON A;  4RGR A;  2WAQ N;  1XMX A;  1I6X A;  3DFG A;  4LK1 F;  4LG0 B;  3MAJ A;  2L3D A;  1G3Y A;  1Y1W J;  2CW0 F;  2AO9 A;  4QSH A;  3REO A;  4N4N B;  1S7O A;  2DLL A;  2VKV A;  3BJ6 A;  3GTP J;  3IP4 B;  1ZLJ A;  2CUF A;  3E6C C;  1YI2 I;  2NRA C;  3BZ6 A;  2BEO A;  4OOI A;  3X2Q H;  1WSU A;  4YFX F;  3W2A A;  3QPT A;  2L01 A;  3CJR B;  3MCZ A;  2DI3 A;  5KAF C;  2MH9 A;  2O7O A;  1A5J A;  2LLK A;  4M3F A;  4HF1 A;  3M3Y J;  4MQ9 F;  1JUM A;  2OPT A;  2XV4 S;  1YX3 A;  3GTK J;  3DKW A;  5FRN A;  1HC8 A;  4IHY A;  4RB1 A;  4LMY A;  1YRN A;  2DW4 A;  4II2 A;  3HXL A;  4YEJ A;  4ZDO A;  3S2W A;  5IYB J;  3DP7 A;  3JRA A;  2EA4 A;  1X3U A;  4YIF A;  2BZT A;  3I53 A;  1FBU A;  5IOY A;  1YRN B;  1RI7 A;  1Z6R A;  2CRG A;  4B4C A;  5H6R A;  4HST A;  3EPZ A;  3CCE I;  2IP2 A;  4RA2 A;  5A2Q Z;  1JT0 A;  4Y3O A;  2EIJ H;  5EEH A;  1AHD P;  5GPC A;  2R4G A;  2HTJ A;  3DPU A;  2B9S A;  4MTE A;  3CLO A;  2ZXJ A;  4O3M A;  2LY1 A;  3IH4 A;  4RGS A;  2K85 A;  4DYQ A;  5D5V B;  4KFC A;  3F6O A;  4DZP A;  4C3I J;  4FX0 A;  5LLQ A;  3ZXS A;  2EH3 A;  2W57 A;  3ESW B;  2LD5 A;  2DQR A;  1G4D A;  4Q48 A;  3C2B A;  3G3Z A;  3JR9 A;  4H4K C;  2V7F A;  2VL8 A;  4M3D A;  4UB8 C;  5D5W B;  2GA2 A;  1IV6 A;  1PUE E;  4L9T A;  3OIQ A;  3CC7 I;  5L3C A;  5HDN A;  5HOO A;  1BIB A;  1I39 A;  3ZMS A;  1XSX A;  2K9S A;  2MLK A;  5DDG A;  4P55 A;  1F9N A;  4HLY A;  1SFE A;  2E34 A;  1OCO H;  3FF5 A;  5FD6 A;  1VQ9 I;  3PFI A;  1X1B A;  2FSW A;  5FGM A;  3F6V A;  5E79 C;  4A69 C;  3KEQ A;  1X1A A;  2JN6 A;  2W48 A;  2VQL A;  3IRR A;  2E2H J;  2OTL I;  1OMI A;  4U7D A;  3BG7 A;  2Y9Z A;  2DOF A;  2LOO A;  3OYN A;  5M5X J;  1LDD A;  2FF4 A;  3SZG A;  2V1U A;  1MMN A;  2JVH A;  1LEB A;  2LKP A;  3LFU A;  5J1R A;  3CO6 C;  1TWG J;  2QSH X;  3R4K A;  2JUC A;  3HOS A;  4PJ0 C;  1FSE A;  1SAX A;  1JKP C;  4RB3 C;  4OIN F;  4CIC A;  1TTY A;  3D5L A;  1ERD A;  3PL8 A;  3E5X A;  1OYY A;  2IT0 A;  2KP6 A;  3R0J A;  1SFX A;  1W4M A;  4PJM A;  5CVR A;  4V19 K;  2DT7 B;  3F8M A;  5F27 A;  4F7Z A;  1EH6 A;  3LAJ A;  4A0Y A;  2M7B A;  3FHN A;  4RAG A;  5C3E J;  1ZGW A;  1X58 A;  4CCK A;  2IW5 A;  3HRU A;  4YFN F;  2E1N A;  4M3B A;  4F3Q A;  4FAS D;  3ZR8 X;  3M4O J;  2ECC A;  1F43 A;  4Q5S F;  1FP2 A;  1PUF A;  1JUS A;  3G1O A;  2EBI A;  1T33 A;  4IQ4 A;  2ZFU A;  1FBS A;  2CSO A;  1O3T A;  1HW2 A;  3U1D A;  3W6J B;  2X6X A;  2NS7 A;  4I2O A;  4XON A;  1JGS A;  2ETH A;  3KP3 A;  4AVP A;  1XSD A;  2HI3 A;  4KIC A;  4AU7 A;  1Y8Q B;  1DGW Y;  2EIN H;  1B9N A;  3RYR A;  5CQE A;  4LB6 B;  3IWZ A;  2K86 A;  3JRD A;  1SVO A;  2R93 J;  2E5N A;  4IHS A;  2DTZ A;  2G7U A;  4RAZ A;  1ACI A;  2MH2 A;  2V1X A;  4U0Y A;  2CO5 A;  2XGE A;  2M0C A;  2VXZ A;  3LA2 A;  3LQQ A;  3JRI A;  4FQG A;  4W97 A;  4IJA A;  3CP8 A;  3DBH B;  1WCM J;  3VSK A;  1N75 A;  3KE2 A;  3ZP5 A;  4BY1 J;  2G0E A;  2NVX J;  2L7M P;  1B59 A;  2W7N A;  3BR0 A;  1IUF A;  2K9Q A;  3GBG A;  2DJN A;  2EV6 A;  4A12 A;  4AIK A;  3DTE A;  2MD5 A;  4RGU A;  3NAR A;  2ZXI A;  1ORK A;  4WK8 F;  1OKR A;  2RC4 A;  3K1M A;  2MSY A;  1OLT A;  3ABT A;  5M5Y J;  2H1L A;  2Q2E A;  3Q5F A;  4A3G J;  1D0Y A;  4HG2 A;  2BHY A;  3OYJ A;  4A93 J;  3E5Q A;  1I3A A;  3OYC A;  3HPG A;  2FRH A;  1SVM A;  1WH5 A;  2VLA A;  2PMH A;  2ZFW A;  3HUG A;  2Q2E B;  3ERM A;  4RLQ A;  3KLN A;  3MZ8 A;  2I8D A;  2PG4 A;  2JVG A;  4UUT A;  2DPU A;  4F91 B;  3NAU A;  1YJW I;  4GDF A;  1QO0 D;  3K4B A;  1P9Q C;  3HUG B;  2VJI A;  1POG A;  2ICW G;  3FIS A;  3GFL A;  4F93 B;  2MD0 A;  3P7N A;  4NNJ A;  1H8A C;  4CSW A;  4UVC A;  4A3M J;  2ZNY A;  2NOJ B;  1I1S A;  2KT0 A;  5DM6 F;  5LRS A;  1U3E M;  4ESJ A;  4U0V A;  2K02 A;  5E8G A;  4S0H B;  5HS8 A;  1GXQ A;  1YOV B;  2DMN A;  1ZN2 A;  2DO7 A;  3K9T A;  2V6C A;  4M6Y A;  5J47 A;  3GTJ J;  4EEF G;  1FC3 A;  5ERI A;  1JJ8 C;  2DBB A;  5BS6 A;  5FRO A;  3S93 A;  1O3S A;  3HYI A;  4GYI A;  5KNL A;  3HOY J;  4G6T B;  3VPR A;  1K79 A;  1IAW A;  4GGG A;  1FOY A;  2CUZ A;  1KZH A;  1QZE A;  4HNV A;  3FKJ A;  1R71 A;  3RI4 A;  5LGT A;  1Z0X A;  3V8K A;  3C18 A;  1VQ8 I;  1I50 J;  1G3S A;  4UY8 I;  5KCM A;  5AIQ A;  3OYG A;  1MMG A;  3K6G A;  1ZAO A;  2E7X A;  3DKX A;  3T0Y A;  3IL2 A;  4BQQ A;  1ZRF A;  2EFO A;  1R5G A;  1R1V A;  1B6A A;  3CF2 A;  4UUV A;  3QP5 A;  3BG5 A;  4MLO A;  3TDZ C;  2VBX A;  4WXH A;  3BRO A;  3M1E A;  4KYW A;  2VQG A;  4XKB A;  3GZ6 A;  4PGH A;  4BXF A;  1UHS A;  2GIZ A;  2WBM A;  3QOE A;  1MSF C;  1BI1 A;  3SHF A;  5D8K B;  1IUY A;  1KQ8 A;  3DV8 A;  4J19 A;  2WTE A;  1DPU A;  3FHZ A;  1NK3 P;  1MNM C;  2EA2 A;  2FBI A;  2LNB A;  3ABK H;  3TOA A;  3L2Q A;  2IGM A;  2KRH A;  3RKX A;  5IT3 A;  3I4P A;  2VE8 A;  4L5J A;  1HOM A;  2OBP A;  4B44 A;  1Y1V J;  3ULQ B;  1J09 A;  3WTY C;  4X0G A;  1MBF A;  2XB5 A;  1NH3 A;  3CCJ I;  4V2F A;  2FX0 A;  2F4M B;  4EJT A;  3JRE A;  3W3C A;  2CJJ A;  1WKM A;  1FOK A;  3OOU A;  4Q4Z F;  2COM A;  2IJL A;  3WOD F;  3M8E A;  3KP6 A;  3G73 A;  2IS6 A;  5FO5 A;  3LSR A;  3ZPL A;  1JT6 A;  1MH4 A;  5IT9 K;  4I76 A;  1N25 A;  1QNT A;  1R1T A;  1XDS A;  1ZQ3 P;  2WAD A;  1PP8 F;  1EF4 A;  1LQ1 A;  3WE2 A;  1I1G A;  2Z16 A;  2LVS A;  2OQG A;  3ROU A;  5KHD A;  2GAU A;  2OCE A;  1Z7L A;  3BTC A;  3LWF A;  4QPQ A;  4S05 A;  1NTC A;  2PQ8 A;  2DDA A;  2JA5 J;  1T08 B;  2AQE A;  4Y7N J;  1IJW C;  2V9V A;  1WJ5 A;  2HOE A;  3ZOB A;  2NAZ A;  3OYM A;  4RB2 C;  3U9G A;  3DPT A;  3DF8 A;  2HYF A;  2KZV A;  1AKH A;  4QPO A;  1JTX A;  3WTV C;  3TMO A;  3K2A A;  3HRM A;  1IRG A;  2FA5 A;  4BUP A;  3EUH C;  2JT1 A;  3PFY A;  2CUE A;  1AKH B;  3ABU A;  5TGT A;  1RC9 A;  2OF7 A;  1EH7 A;  2DFI A;  1DDN A;  2EFW A;  3CC2 I;  1R1U A;  4A3F J;  3H1C A;  3SFZ A;  4PCQ A;  2GZW A;  4KIB A;  5GAG J;  2JA2 A;  2ZME C;  3LSK A;  4HX8 A;  4P5O A;  4XOP A;  1ZR4 A;  2EK5 A;  1RRJ A;  2ZJ2 A;  1KON A;  1R58 A;  4CCL A;  2A68 F;  3ABM H;  3CF5 F;  4IHW A;  2OA4 A;  5L3F A;  2JQ7 A;  2XIG A;  5L3G A;  4XSZ F;  2P7V B;  3L2R A;  2FNP A;  2K4J A;  2QVO A;  3N97 A;  5F1J A;  2P8T A;  1MBG A;  3WGI A;  3OYI A;  2A6E F;  2ID3 A;  3LST A;  1BN5 A;  1BA5 A;  4RAY A;  2LY2 A;  4PDK A;  2XAU A;  4AVZ A;  1QPM A;  4LLL A;  4DW6 A;  2ZXH A;  2MAB A;  5KAI C;  1W0T A;  4E7Z A;  2QYO A;  2VOO A;  4KMF A;  1UCR A;  2JK3 A;  4NB5 A;  3CC4 I;  4BDY A;  5GAD J;  3CCL I;  4UV8 A;  4A6E A;  4UVB A;  2PJP A;  3M1C A;  3TED A;  3E3V A;  2O03 A;  2QM3 A;  1VQM I;  4DZJ A;  4KIG A;  5FJ8 J;  1RZ4 A;  4KUM A;  3ZQG A;  4CGZ A;  3JRG A;  2HVR A;  3IKV A;  2Q8K A;  2M5W A;  2K5C A;  3J7A Y;  2FBK A;  2ZCW A;  5J3L A;  3PSI A;  1QPI A;  3JAM K;  3OYA A;  3FBI B;  3LAP A;  3AFH A;  2LH9 A;  3PUF A;  2X0L A;  5GAE J;  2M4G A;  2K7L A;  4BE2 A;  2R7V A;  1T6S A;  1E3H A;  2A5W A;  2KZG A;  1OR7 C;  2VKD A;  4ABZ A;  2F2E A;  3KPH A;  3GZN B;  4AID A;  3S1R J;  3LSP A;  4D0P A;  4NC6 A;  4GO1 A;  4ZZD A;  1E3P A;  2V9P A;  2OCC H;  2K3F A;  5K5Q A;  1D8K A;  4OIR F;  4IOA F;  2OU2 A;  3TO7 A;  3IC7 A;  1VF9 A;  4ASN A;  2H1K A;  5D4S A;  2FML A;  4FCY A;  3RCO A;  4XRF A;  2M34 A;  3WU1 B;  1R22 A;  3C1D A;  3A01 A;  1DGR M;  3H9G A;  3H5R A;  5K1Y A;  3MZY A;  2QUF A;  1U2W A;  3HHG A;  2F4I A;  1P2F A;  3A01 B;  2MC4 A;  4Y33 A;  1B72 A;  4R79 A;  2R7D A;  3FX3 A;  1VQ4 I;  4IL6 C;  2HZT A;  1C0W A;  2BE5 F;  4HF0 A;  2Y0S A;  4NQW A;  3ZCO A;  3HTU A;  2LF7 A;  1B72 B;  5AIP A;  2KPM A;  2L02 A;  3FIW A;  3F8B A;  3FWE A;  1R6R A;  4QLC U;  3OR1 C;  2EFP A;  4BAC A;  4GCV A;  3ABL H;  4NQW B;  5F0C A;  2M45 A;  2X48 A;  2K9M A;  3MKL A;  3RPU D;  1GHC A;  1HKS A;  1KYZ A;  1UST A;  3TW6 A;  1IN6 A;  3F9K A;  5DUK A;  3H9J A;  5ILS A;  2BXY A;  2FMY A;  3CCM I;  4XRM A;  2XGC A;  3N05 A;  4FIS A;  1YO5 C;  4BNC A;  3V7S A;  2UZK A;  4CA0 A;  4Z6Y A;  3E7L A;  3RQ4 A;  3CMY A;  3HOV J;  1A6I A;  3PQK A;  4XBF A;  3HOZ J;  4U0W A;  4RLF A;  1KU2 A;  1K78 A;  3F8C A;  4HQM A;  1S8N A;  3PSF A;  2LKX A;  3A0H C;  2TDX A;  3K70 D;  3G71 I;  1MMA A;  2VI6 A;  3EET A;  4N4O B;  1IRX A;  3IAS 2;  1K78 B;  2ZC2 A;  3DKY A;  1XDU A;  2X4H A;  4WX9 A;  1ZR2 A;  3PO3 J;  4LJZ F;  3ASO H;  4BHC A;  2L9V A;  4XMY A;  4BQA A;  1XMA A;  3IAM 2;  3EUK L;  2LMD A;  1WJC A;  3TO9 A;  4PUS A;  5J1Y A;  3FM5 A;  1YX5 A;  3ONQ A;  1HF0 A;  4XK4 A;  2NVU B;  1FIP A;  1QZZ A;  4CCJ A;  2COB A;  1Z1D A;  4C30 A;  4IRH A;  2ZSH B;  2W25 A;  2KHM A;  2QKL B;  2DYR H;  3IWF A;  4UXN A;  3G6E I;  1MSE C;  2R7O A;  2ACJ A;  2DT6 A;  2LDU A;  3CCQ I;  3S16 J;  1OCP A;  1XD7 A;  4MQV A;  5DUI A;  4NUB A;  4BHP A;  2X1D A;  4HQE A;  2ZKZ A;  2STW A;  2HQN A;  4HZF A;  3VYU B;  3JSO A;  2XAH A;  4BXX J;  2DA4 A;  3GW2 A;  2OJE D;  5FLX Z;  2FXA A;  2DK5 A;  3KX2 A;  1V3F A;  1XGN A;  2RN7 A;  4A0Z A;  2IS2 A;  3RQI A;  5D5X B;  1WJB A;  2OAZ A;  1T0F A;  2V1N A;  4LG3 A;  2ISY A;  1FSH A;  1CF7 A;  4IOC F;  2VXD A;  1DU0 A;  3OS2 A;  1F36 A;  1CF7 B;  2QSG X;  4CYD A;  1K6Y A;  2WY8 Q;  2QSF X;  5EG0 B;  1W7P A;  1V5E A;  4HDV A;  5EZH A;  5FRM A;  2IRF G;  4IVN A;  2E2I J;  4FE7 A;  3R60 A;  2CV1 A;  1VZ0 A;  2YU9 J;  2GLO A;  3WTX C;  2IPQ X;  1W7P B;  5HLI A;  4A0X A;  5FB2 A;  1K4S A;  5JFR A;  2CUJ A;  4O6J A;  4E7S A;  1Y0U A;  3WG7 H;  5FKN A;  3M8F A;  5M5W J;  2XAQ A;  3AG4 H;  1FYM A;  2R92 J;  1FEX A;  3CJT B;  5JI6 A;  4WF2 A;  2FOW A;  1NG7 A;  4YRV A;  3L00 A;  4W1U A;  1XN7 A;  2FBH A;  2L4A A;  4FE4 A;  1Z3X A;  1RR7 A;  4M9Z A;  2R7X A;  2BY0 A;  1ZG5 A;  3SJM A;  3RSN A;  2Y31 A;  1IDY A;  2Z3Y A;  4BXU A;  2CWE A;  5HS9 A;  1YLF A;  1MJB A;  2WY7 Q;  4O5V A;  5ICC A;  5EDN A;  4CYC A;  1IN8 A;  1UJ8 A;  2DCE A;  3GF2 A;  4D1Q A;  4PFO A;  2AHQ A;  4ENN A;  4FHT A;  4C2U A;  1U5T A;  4EQQ A;  4M3G A;  5DEQ A;  1AOY A;  2DK8 A;  2MG4 A;  1I3Q J;  4CYC B;  1V54 H;  1Z67 A;  2Y0S N;  2CQQ A;  2A07 F;  4CO8 A;  3DPL C;  5HS7 A;  1U5T B;  3C2H A;  1APL C;  3RTR A;  1LE8 A;  3PNT A;  4G6D A;  3RDI A;  3MWM A;  3OMY A;  4KIS A;  1EH8 A;  3OSF A;  4EVI A;  1WJD A;  1LJ9 A;  3FM3 A;  3W6V A;  3COA C;  4BS9 A;  5CKT A;  1LE8 B;  1XC5 A;  2DOD A;  3U2R A;  2O6G E;  3QYF A;  2CU7 A;  1ZGA A;  3K4K A;  1MJA A;  3G2B A;  3UR3 C;  2KIS A;  5DCM A;  2OD5 A;  1G6N A;  5FD5 A;  1HDP A;  1U8B A;  2XF7 A;  4KT6 A;  1V4R A;  2XDV A;  3TP3 A;  4A5N A;  1BI3 A;  2QZ8 A;  5JHU A;  5DCM B;  3V42 A;  2JSP A;  4L5E A;  3P9C A;  3RJP A;  1IN7 A;  5B1A H;  3QWL A;  2W85 A;  3QRF F;  3H5A A;  2JRM A;  3K0L A;  1K6O A;  1J0R A;  4G94 A;  1MBK A;  5L3D A;  2WAF A;  2FU4 A;  4YIR X;  4EJV A;  3T1B A;  1B8I B;  3L2C A;  1S29 A;  1O7L A;  2K9L A;  3HOU J;  1HST A;  5JHF A;  2JSC A;  4A3J J;  1JKR C;  2JTV A;  4M6V A;  3IKT A;  3WGH A;  2M30 A;  4M71 A;  3K1N A;  5JVT A;  3PJR A;  2DOE A;  3CJQ B;  3MVP A;  2EWN A;  2VAS A;  4HNU A;  2EIM H;  5E3L A;  1WWX A;  1FIA A;  2G7H A;  2DYS H;  4A3L J;  3HRT A;  2CQ7 A;  1XG1 A;  3E6B A;  3JCU C;  2DT5 A;  3MQ0 A;  2IGN A;  4YEL A;  3I56 I;  1UMQ A;  3H36 A;  4OIP F;  1BM9 A;  3BTL A;  3RIR A;  3L2W A;  5DTD A;  5LD2 C;  2ZO4 A;  1R49 A;  3OIP A;  3LA7 A;  1BOB A;  2M0M A;  1HBX G;  2XPU A;  1YFH A;  4D7N A;  1OIS A;  1ENH A;  4BHB A;  3M7G A;  1OPC A;  3O2P E;  5FKL A;  3CCU I;  1JJ6 C;  1IF1 A;  1YS7 A;  3HPH A;  1H9G A;  4AYB A;  1IZ1 A;  2MYS A;  1QU3 A;  5L3B A;  2HWV A;  2EIL H;  2PX9 A;  2M8E A;  2IS4 A;  1P6R A;  3TO6 A;  1WZ2 A;  1XCV A;  3S1M J;  3GO5 A;  2EIK H;  3GTL J;  3V7R A;  1RES A;  2R7Z J;  4XLN F;  3WTZ A;  2AS5 F;  2KRC A;  5EZG A;  2JZY A;  3OV8 A;  3LSJ A;  4CCN A;  3K2Z A;  5FKO A;  4G6Q A;  2I5U A;  1IXC A;  3PUB A;  3S32 A;  1ZAR A;  1G3W A;  3B02 A;  4FTH A;  5J8C A;  4KN7 X;  3QOD A;  5F64 A;  4CDG A;  3H9Q A;  3CMM A;  5B5E C;  4B1R A;  2W84 A;  4UHT A;  5HDG A;  1TQI A;  4HV6 A;  1BW5 A;  2F5C A;  1L0O C;  1FZP B;  4LGW A;  1N77 A;  2W24 A;  1B9M A;  4XLF A;  1OFC X;  5FKM A;  2DJI A;  2KJB A;  4JP0 A;  5DD4 A;  5LEK A;  1VQ7 I;  3FK6 A;  3HSE A;  2FQ3 A;  2Y48 A;  3W6K B;  2JJ7 A;  2P6S A;  5EF6 A;  1FTZ A;  4LIU A;  1YW8 A;  4A2U A;  3HGY A;  4M73 A;  4RS8 A;  5J40 A;  2DAO A;  3LOC A;  1TWF J;  4OWR B;  3FBN B;  2GA1 A;  4EGY A;  3H3Z A;  2HS5 A;  1GDT A;  3H0D A;  4ZYG A;  5CVJ A;  1SVL A;  3A03 A;  5ICE A;  2OQR A;  1OQY A;  1UEL B;  3D1N I;  3BR5 A;  1VTN C;  1IRF A;  1ZKG A;  2KL4 A;  3IHU A;  3JAM Z;  5F1R A;  2MW8 A;  2R7S A;  2TRT A;  4BYY A;  3KP2 A;  1XPX A;  1K4T A;  2X51 A;  1UG0 A;  1K61 A;  3HM5 A;  2CV2 A;  3S1Q J;  2IVM A;  3AL0 C;  3FMQ A;  1S9H A;  2O8X A;  5HLG A;  3BQY A;  2V4J C;  1VND A;  5J4V A;  5C4X J;  4MEY F;  5ICF A;  3FKI J;  3RKW A;  3VOE A;  1X4O A;  2PBI A;  4YG2 F;  4E7L A;  1ZRE A;  2GXA A;  4DYC A;  4I6Z A;  3TL4 X;  1UB9 A;  3I59 A;  2VJ4 A;  1RET A;  2EPF A;  4OAZ A;  3BQZ A;  4MO7 A;  4IRI A;  3I3L A;  2LF8 A;  1X19 A;  1O4X A;  3ZRG A;  1A36 A;  1OCZ H;  3I59 B;  4C2T A;  3WGG A;  3LFK A;  2YUS A;  5F0F A;  2Z33 A;  3QQA A;  2HDC A;  1MH3 A;  3SZT A;  2L7F P;  3QP6 A;  2DTR A;  2X85 A;  1LFB A;  3EQL F;  1YIO A;  3S3O A;  1QVT A;  4K2E A;  2CFX A;  4A5M A;  3ZMZ A;  1XMK A;  2LTP A;  3BZK A;  3OYE A;  2X1E A;  1MBJ A;  5GPA A;  4HPQ A;  2IGO A;  2VIX A;  4R8H A;  1X2N A;  3OYD A;  1U78 A;  2NVY J;  3TBI A;  3FDY A;  2FJ1 A;  5CVI A;  4MEX F;  2BHZ A;  2DFE A;  1G2H A;  2KRF A;  3H3U A;  3BJO A;  3WE3 A;  2CMP A;  2X1C A;  3L09 A;  1S3J A;  2GOX B;  4LLN A;  2A3S A;  1ZYR F;  2KMU A;  3CDL A;  1BJZ A;  3ZQI A;  3H0G J;  4DJA A;  3J80 K;  2OUM A;  3H5N A;  2W1O A;  2XAS A;  1WH7 A;  2XKP A;  3W2W A;  5HLT A;  3F21 A;  2E71 A;  3GTM J;  2RQP A;  3KZY A;  4AYB N;  4QWQ A;  1BC8 C;  2NXN B;  2R3S A;  2YX4 A;  1VQN I;  3RKY A;  3GXO A;  3UNG C;  4AWX B;  1HCR A;  3S15 J;  1WGX A;  4ESB A;  1CQT A;  5LGN A;  1RUN A;  1YE9 A;  1MIJ A;  2STT A;  2ME0 A;  2DMU A;  5FFZ A;  1RNL A;  3CCV I;  2VOD A;  3CDH A;  4RMN A;  4BJ6 C;  3HOX J;  2A5Y B;  3MFK A;  5HNF A;  1X3W B;  3WHC A;  1HW5 A;  1A6Q A;  2GXG A;  3SZP A;  3CO7 C;  3BG9 A;  4KJZ A;  3VYR B;  1NG6 A;  4UV9 A;  2HZD A;  3LL7 A;  3PIO F;  3ZMU A;  2DDB A;  3FXM A;  3BT9 A;  3BCA A;  3O8H A;  1H89 C;  1DQU A;  1FYL A;  1TT5 B;  2YX7 A;  1RIO H;  3WU2 C;  1S5L C;  1GT0 C;  1KU7 A;  3L2V A;  2M3A A;  3NWT A;  4XLC A;  1ZH5 A;  5A2Q K;  4XNF A;  2F5V A;  1RKW A;  2CH0 A;  2RRE A;  3GTG J;  3TW7 A;  2XRN A;  2QF7 A;  2XGX A;  2KIQ A;  1SMY F;  3BG6 A;  1SAU A;  4PFP A;  4BGD A;  4HF2 A;  4ZTF A;  3ASN H;  3KLO A;  5JVG F;  2ZJP F;  5EYR A;  1E0E A;  1MBH A;  3BR6 A;  4BBS J;  5B1B H;  4RM2 A;  5EJC A;  4WXC A;  2PMZ A;  4Y13 A;  3T5X A;  1A31 A;  3GWZ A;  3S2D J;  4C3J J;  4A3B J;  5M3F J;  3BTJ A;  3QYE A;  3LQR A;  3K70 C;  2DA2 A;  4ZYE A;  3KYC B;  3UKG A;  5HDK A;  1JKQ C;  3B6C A;  2FQ4 A;  1JI8 A;  2KDO A;  4A6D A;  2RVC A;  2NVQ J;  1PJR A;  5FKK A;  4DOZ A;  1G59 A;  2L7K A;  1SD4 A;  4BH9 A;  1Y6I A;  3A4C A;  2AXT C;  3OY9 A;  1P4X A;  3DLL F;  3ZQH A;  3TQN A;  1FOW A;  1IV8 A;  3K4M A;  3TKY A;  4XID A;  5CVV A;  5K7Z A;  2QQ9 A;  3IUO A;  1VQ5 I;  1HW1 A;  3OOP A;  2E1O A;  4B3X A;  2UWM A;  1J7K A;  2XKO A;  2D2W A;  1R36 A;  3CUQ C;  1MMS A;  3F8F A;  4IXA A;  5K5R A;  1UFM A;  4NC7 A;  6PAX A;  4I01 A;  2VC0 A;  1KQ0 A;  2YR2 A;  2PMU A;  5E1Z B;  1D1A A;  2J5P A;  1TC3 C;  2Z5U A;  2RKH A;  5E3M A;  5C4J J;  3TGN A;  4I98 B;  3QOP A;  1XB4 A;  2DMT A;  1ZGJ A;  1IN4 A;  1ETO A;  1VFC A;  2E1M C;  3VOD A;  3HB9 A;  4KMU X;  3KP5 A;  4J00 A;  4L0Y B;  4OMZ A;  4HSR A;  2E36 A;  2LRE A;  2VPL A;  2E1C A;  3K69 A;  3VWB A;  1Z77 A;  5FLV A;  3D5S C;  1Q1H A;  2VN2 A;  1D0X A;  4IEJ A;  2ELK A;  2R5Y B;  4MNU A;  4HYE A;  3KIO A;  4XLP F;  4EV0 A;  1O57 A;  2LC2 A;  2QCO A;  4CXF A;  3GYH X;  1ETY A;  2EB7 A;  2P4W A;  3H3V K;  4ZTJ A;  1WJF A;  1LFP A;  5J6X A;  1P4W A;  2JA7 J;  2L0K A;  3KZI C;  1TP4 A;  3IH2 A;  4ENK A;  2VON A;  4LD5 A;  3Q0W A;  4EJU A;  5HNH A;  3HC7 A;  2PEX A;  2BY1 A;  2UV1 A;  2BV6 A;  4E7K A;  4XKV A;  3HKZ A;  2O0Y A;  4AUX A;  3AG3 H;  3G4S I;  2WWY A;  4OU0 A;  1ZG3 A;  1R4M B;  4DQ2 A;  5BMZ A;  2IA1 A;  3ISP A;  1BOA A;  1Z7U A;  2Y0M A;  5CQG A;  3BDD A;  2C6Y A;  1MGT A;  1LVK A;  1IXS B;  9ANT A;  1PYV A;  1XS9 A;  2ZME B;  4ZDP A;  3V7C A;  3K1P A;  3C2G A;  1W5C C;  2GOM A;  1D0Z A;  4NHJ A;  2R5Z A;  2MBF A;  3JRF A;  3ML6 A;  5FFX A;  1REP C;  1LB2 A;  1YS6 A;  2EZI A;  2R5Z B;  2PJR B;  4CCM A;  5D5U B;  4G12 A;  5DD8 A;  2BY3 A;  1HKQ A;  1JXS A;  4GXO A;  3HRS A;  4IRG A;  1FJL A;  1V55 H;  3MKW B;  2EZH A;  4LIV A;  3FZV A;  4I02 A;  5JLX A;  3NQO A;  1KYW A;  3BCB A;  5LHG A;  2KLO A;  3KEY A;  4XKC A;  3OYK A;  3J7Y J;  1UAA A;  4C2M J;  1KA8 A;  2HOA A;  2XC7 A;  4E7I A;  1QZY A;  4I0A A;  2M7A A;  1H0M A;  3A2K A;  3J7A O;  2WAQ A;  3FXK A;  3KP7 A;  1S72 I;  3J81 K;  1W36 D;  1EKE A;  5IP7 J;  3E6M A;  3OYL A;  5IYD J;  2M8G X;  4EM1 A;  2QBY B;  4M3E A;  1FWZ A;  2ISZ A;  1T56 A;  3WTU C;  1YG2 A;  1GVD A;  4PJN A;  4PSX A;  2WV1 A;  4Z2Y A;  2CQN A;  2KQR A;  1BL0 A;  1LKX A;  4Y17 A;  1Y56 A;  4GRI A;  2LR8 A;  1GXP A;  3VYT B;  3BPV A;  1O7F A;  2HQR A;  1GVJ A;  2EFN A;  1IXR C;  3IRQ A;  4IO9 F;  4IF4 A;  4M72 A;  3FXU A;  4QIW N;  2OV7 A;  3LSM A;  3EYY A;  4EM0 B;  2BVL A;  2L2O A;  1FY7 A;  2N8G A;  2JRT A;  4NBQ A;  2TCT A;  4KIT B;  1X1D A;  2ELJ A;  2VKE A;  5KK1 A;  4V2G A;  5F08 A;  2H6C A;  1ZLK A;  1TWH J;  4B48 A;  1I27 A;  1Z05 A;  3D5R C;  4BQN A;  3PNV A;  3CD6 I;  5E8I A;  1O3Q A;  3CCY A;  3I54 A;  1V5F A;  1BIA A;  5ILU A;  2CW8 A;  3L2U A;  3MN2 A;  1FX7 A;  1UZC A;  1YIT I;  4I99 C;  2Y2Z A;  2Y69 H;  3OYB A;  3LA3 A;  2ME6 A;  1FOX A;  3DTK A;  3B73 A;  4BL0 B;  3JTH A;  1X1C A;  5LGU A;  3JRC A;  4ZYD A;  3CJN A;  2QA4 I;  2O3F A;  1EJ9 A;  2DPD A;  1FT9 A;  4XR6 A;  1A04 A;  2HXI A;  3H92 A;  3M07 A;  1WI9 A;  2HVQ A;  2OZU A;  4Q47 A;  2ZJQ F;  2DA3 A;  3RZD J;  1R7J A;  2XPV A;  3Q9S A;  3BR3 A;  2G9W A;  5E3O A;  4U7B A;  5K5O A;  2OC6 A;  3K4N A;  4XIC A;  3GX4 X;  1H88 C;  3PIP F;  4UNO A;  3I4N J;  2HQ5 A;  3KP4 A;  2IS1 A;  2BBY A;  4KIF A;  1IRZ A;  3WG9 A;  5EG0 A;  4G7Z F;  3PNY A;  1FMW A;  1MNE A;  3QAH A;  1HLV A;  1S7A A;  4S04 A;  4R1H A;  3WTT C;  1VI0 A;  2HTS A;  3MEX A;  5GAH J;  3BR2 A;  3HKZ N;  4ZYA A;  2Z9O A;  1X2M A;  2FE3 A;  2EFQ A;  2LBF B;  4ZH4 F;  2HEO A;  3OIO A;  3OYH A;  1BI0 A;  2VC1 A;  2VJJ A;  1RUO A;  3NRV A;  2EQR A;  4P96 A;  2UXN A;  1P4A A;  1TLH B;  2XUB A;  5LHH A;  3AG1 H;  2V26 A;  3IV5 A;  5B66 C;  3LNQ A;  4PSW A;  1FBQ A;  2W82 A;  2PI0 A;  2VBW A;  3HIF A;  3RYP A;  2IBD A;  4RM3 A;  1ZHF A;  4AIJ A;  4CUG A;  2Y9Y A;  4HA8 A;  4XL9 A;  2E35 A;  3PO2 J;  2L5Q A;  3DBL B;  2F4O B;  1X3Z B;  3ELK A;  4CH7 A;  1WQ2 A;  3JRB A;  3E1S A;  1UG2 A;  1QA6 A;  3SQN A;  3OR2 C;  1TWC J;  2A6T A;  2RDP A;  4L9J A;  1MJ9 A;  4H0E A;  5H20 A;  2WV0 A;  2NS0 A;  2IAI A;  1IW7 F;  1Y0N A;  2CQK A;  2QQB A;  3TOB A;  2XRL A;  1FPQ A;  3HJE A;  1BBY A;  4ETS A;  5HVQ C;  4CHU A;  2LKS A;  4AD9 A;  2YSR A;  2XF6 A;  3ECH A;  3DEU A;  5K7H A;  4XLH A;  2DFH A;  2P6T A;  3J80 Z;  1DUX C;  2NYX A;  2E2J J;  4NC8 A;  2FNA A;  2HKO A;  5D6F A;  1WRJ A;  4JQF A;  2GXB A;  2Q1Z B;  1FP1 D;  3P9K A;  5BOX A;  2L9N A;  3CZ6 A;  4G7H F;  2L54 A;  1VQP I;  4QTR A;  1JE8 A;  4IPA A;  3DQV C;  3MKZ A;  2WB1 A;  3W2V A;  4BJ5 C;  2CG4 A;  3L1P A;  3KFW X;  1ZRD A;  2K3P A;  2QWW A;  3ZN0 A;  4MFD A;  2VT2 A;  3SYT A;  1IGN A;  3ZQF A;  5IY5 H;  2BXZ A;  1YYV A;  3Q0U A;  5CJ9 A;  3AG2 H;  4B8X A;  4GYG A;  1EA3 A;  5BQT A;  1I6H J;  2AXL A;  2LSO A;  3MD2 A;  1T95 A;  4XSX F;  3OSG A;  2V79 A;  3O6B B;  3KZZ A;  4XRS G;  1LUJ B;  1U9N A;  1ZG1 A;  4P1W A;  2MGQ A;  1S6L A;  4B47 A;  1B8I A;  1ON2 A;  3BOQ A;  5TIS C;  1HXD A;  1ZTR A;  5KVR A;  2KIF A;  1X1P A;  1GUU A;  3GFI A;  3M9A A;  1B4A A;  5GTI C;  2R7W A;  3F22 A;  3FXO A;  3J7Z I;  2K9N A;  3KCC A;  5LEJ A;  3GUD A;  5E17 F;  3CES A;  1KGS A;  1QHG A;  2ELH A;  1JHF A;  2R7U A;  3A02 A;  4KA4 A;  5IT9 Z;  4BY7 J;  2K40 A;  2H6B A;  1XGS A;  1RPW A;  3ZQQ A;  2ESN A;  2CFO A;  4X1E A;  3GZ5 A;  2HYJ A;  4PK4 A;  2KKO A;  2HXO A;  4HAM A;  1W7P D;  1G8X A;  3HGG A;  1P92 A;  1F5T A;  4JX4 A;  4L9N A;  2VBY A;  4MFE A;  4XKW A;  4MHG A;  2CYY A;  4U87 A;  2WAE A;  1HQC A;  2PFB A;  2NNY A;  4L0Z B;  5TRD A;  2A6H F;  2HGC A;  3RPQ A;  1BR4 A;  3NWS A;  1MKM A;  4J01 A;  1OCR H;  2O61 A;  3MKY B;  2EZL A;  2YU3 A;  2DA5 A;  4L5I A;  2W4S A;  5BNG A;  3A0B C;  5LRR A;  3LMM A;  3DCF A;  1D5V A;  1WJA A;  5IPA A;  4DGW B;  3BJA A;  1VQK I;  4IHX A;  1BR2 A;  3B6A A;  4ITV A;  4XOR A;  1FYK A;  4RGX A;  3HBL A;  4HNT A; 
#chains in the Genus database with same CATH homology
 3G6E I;  3CCJ I;  3CC7 I;  2E36 A;  5GAE J;  3CCQ I;  3CCV I;  1YJW I;  1YJN I;  2E34 A;  1VQ9 I;  3CCR I;  1VQP I;  5DM6 F;  2K3F A;  2OTL I;  3CD6 I;  4IOA F;  3PIO F;  1YJ9 I;  4IOC F;  1YIJ I;  1YIT I;  3I55 I;  3G4S I;  1FOX A;  2QA4 I;  3CCS I;  2QEX I;  1Y39 A;  2ZJQ F;  5JVG F;  1FOY A;  2ZJP F;  4V19 K;  1VQ4 I;  3PIP F;  1YI2 I;  3CC2 I;  3CJT B;  3I56 I;  1VQ8 I;  5GAG J;  4UY8 I;  3J7Z I;  2FOW A;  2OTJ I;  1HC8 A;  3CCU I;  5GAH J;  3CF5 F;  2JQ7 A;  5DM7 F;  3CCM I;  2ZJR F;  2H8W A;  3DLL F;  3CME I;  1ACI A;  1VQO I;  1FOW A;  3J7Y J;  1VQ6 I;  3CCE I;  1YHQ I;  3G71 I;  1VQ5 I;  1S72 I;  3CC4 I;  5GAD J;  3CCL I;  2E35 A;  1MMS A;  1VQM I;  3CMA I;  1QA6 A;  1VQK I;  2NXN B;  1VQ7 I;  1VQL I;  4IO9 F;  1VQN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...