3CCRI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccrI00
4V19K 3G6EI 3G4SI 2OTLI 2E34A 3PIOF 5GAEJ 1VQKI 3CF5F 1QA6A 5DM6F 1YI2I 3PIPF 1VQ4I 1ACIA 2QEXI 4UY8I 3CCMI 1VQMI 3CCLI 1Y39A 3CCEI 1YHQI 5DM7F 3CCUI 1VQ6I 1FOYA 2E36A 5GADJ 4IOCF 3CCRI 1VQ9I 3G71I 1HC8A 2ZJPF 5GAGJ 1YITI 1S72I 2FOWA 5GAHJ 1MMSA 2E35A 1VQ5I 3CCSI 2JQ7A 1VQOI 2OTJI 2H8WA 1YJWI 2QA4I 2ZJQF 2ZJRF 1VQPI 1VQLI 1FOWA 3CMAI 3CJTB 3CC7I 3CD6I 4IOAF 3CC4I 1VQ8I 1YIJI 4IO9F 2NXNB 3CCVI 1VQNI 3J7ZI 3CC2I 2K3FA 3I55I 3I56I 3CCJI 1YJ9I 1YJNI 3CCQI 5JVGF 1FOXA 3CMEI 1VQ7I 3DLLF 3J7YJ
chains in the Genus database with same CATH superfamily
2RQQA 5L3EA 3C3WA 1FMVA 4NBQA 4A3IJ 4CHUA 2K9SA 2Z9OA 1FLIA 4CH7A 3BZ6A 1F43A 2Q1ZB 5LLQA 4RBOA 4NC6A 4IJAA 4XK4A 4YELA 4RB2C 3L1PA 4HLXA 3JRDA 1REPC 1UG2A 2K4JA 4B4CA 4KISA 4MFDA 2V9KA 4ZYDA 2E1MC 1LFUP 3GBGA 1P7JA 3L2UA 3GTLJ 2DDBA 1MBEA 2A6EF 3FXLA 3FHNA 1FEXA 4IXAA 4PJMA 3CC4I 2ETHA 2UZKA 3BR5A 2EZLA 2WV1A 1ZG5A 1TWFJ 2VI6A 1LDDA 2DK8A 4XSZF 5DYMA 3ZQ7A 4CICA 1Y8RB 5CQGA 1IO2A 1U9NA 5D5UB 3CTAA 3HPHA 5BQTA 2YS9A 2M5WA 1XGMA 4N0BA 3TDZC 5M3MJ 3K4LA 3K7AJ 3HL2A 2W57A 4GGGA 1TT0A 2CJJA 1WH7A 2E2IJ 4IQJA 2P0WA 3KIOA 1MGTA 2MC4A 3D1NI 1QNTA 1X1DA 2M7AA 2XKOA 2RV8A 2DA1A 4B43A 2DLLA 2IVMA 2BGCA 1MD0A 4A5NA 1QBJA 1X4OA 3OS0A 2EWNA 2XRLA 2BXZA 2DJNA 1SFXA 2PMUA 2J5OA 3FXMA 2OJED 2DQLA 3WTYC 4UB8C 3DU6A 2EV0A 2NS8A 5B3SH 3RYRA 1QQIA 2CWEA 4BEHA 2MFZA 4P9FA 4WWCA 1GUUA 2YPRA 4E7SA 3I55I 2P5LC 2A05A 3T1BA 2P7CB 1T33A 3J80K 2HKOA 1ETVA 5EG0B 2Q2EB 5F1RA 1X1CA 1ZYRF 4TV7A 2M2EA 3X2QH 5D8LB 2XC7A 2HVQA 4QTRA 2R7QA 3W3CA 3BG7A 2Y48A 4L5JA 3EUHC 4XKWA 5J1RA 1IZ1A 3OYIA 4XR6A 2V26A 4QIWN 1Z1DA 3M9AA 4I09A 5JI6A 2TCTA 5E17F 4HDVA 3QPHA 3H3VK 2ZXWH 2CS3A 4E70A 4OOIA 2CV0A 1G3SA 3EYYA 2VBWA 3RPQA 4KJZA 5IT9K 1BA5A 1WVRA 2LBFB 3ZQCA 3DCFA 3QU3A 3PSFA 1JKPC 4XM3A 1Z21A 3Q0WA 3S1MJ 1TT5B 2R0QC 2ZXHA 1HA8A 1SFEA 3TO6A 4IOCF 4II2A 2ZMEB 1LFBA 4CCLA 4R79A 4Y13A 2NNYA 2NVQJ 2NVYJ 5LHHA 4L9NA 2XROA 1WCMJ 4FTHA 4A3DJ 1H88C 2R7VA 1UZCA 2HWVA 4MQ9F 1T0FC 3G1MA 2HQNA 2XF7A 3P9KA 4LB5A 2Q2EA 3OYHA 4BU2A 2HQ5A 4HDUA 1FOXA 2DXIA 4U88A 3HGYA 3ZMZA 1AU7A 2DOEA 2CW0F 3RKXA 2PN6A 4IRHA 3K2AA 4BXFA 1F9NA 1LJ9A 1OR7A 1UHSA 5FFXA 5GADJ 1OJLA 5HLHA 1T38A 2DO7A 3KP3A 4NC8A 1IXSB 2QGUA 4MEYF 3P5JA 5F1JA 2MH2A 1MMNA 2YUSA 3PUBA 1CGPA 1YRNB 1WI9A 3HGGA 4RAFA 2GAUA 2STWA 5DEQA 2F48A 2OCEA 3FK6A 2P7VB 3ZRGA 3GFLA 4CYCB 1YIJI 3DF8A 4QWQA 2CUEA 2EV6A 2LYCA 4Y7NJ 2R7FA 3HOUJ 3K10A 4BYYA 4A3CJ 1XTAA 5H2FC 2ZMEC 1WPKA 4G6TB 1TW3A 4XKCA 2ZMEA 2BY3A 3OR2C 2WA0A 2IA1A 3I71A 3ZQLA 2A07F 4UNOA 1D8JA 3F0CA 2M87A 4EQQA 2VXDA 2JQ7A 2MA3A 1STZA 5J4VA 1X1BA 2QSGX 4W1UA 2KLOA 3BG6A 5J1UA 4A0XA 2H8RA 4BUPA 3WTZA 3RPUD 1FBQA 1ZELA 2R92J 5J3LA 3HRSA 1ZK8A 4EJOA 3FWEA 2L7KA 3G1OA 3KZYA 3FX3A 1IRXA 4A3BJ 3FDYA 1K78A 2QZ8A 2GXBA 4IX7A 4BE2A 2PMHA 3I4MJ 2L9RA 1BIBA 4GYIA 3J81K 2Y30A 2KRCA 4KMUX 1G3YA 5D5WB 1Y39A 4XL9A 3SZTA 3JRFA 2MD5A 1TWHJ 3KP7A 4B48A 1I1GA 4E7LA 4OINF 3OSFA 1HW5A 4PJ0C 5LEJA 1PP8F 2KQRA 4CYCA 1KQ9A 2PJRA 1WH5A 4LK1F 3DEUA 3D5LA 3E5UA 2HI3A 4NHJA 4BE0A 3A03A 1BI0A 3QYFA 3WTUC 2MC3A 2YX4A 1U5TA 1UHMA 4E7IA 1J5YA 2OC6A 4MTEA 4LMYA 3BPVA 1FBSA 1YI2I 2FBIA 2QSFX 1XGOA 4BY7J 1JGGA 1SFKA 3KP4A 4FCYA 5DD4A 2LH9A 3TW7A 1PUEE 1QRYA 4XLAA 5BS6A 1ZGJA 4NNJA 3IRRA 1RNLA 4LLNA 1TLHB 2DBBA 2ID6A 4BY1J 3GTMJ 2QVOA 4LITA 4OAYA 1IN7A 1I39A 3V4GA 2E19A 3S17J 1NG7A 1UHWA 1LVKA 1Z7UA 4P96A 2RKHA 2BW3B 5LFAA 3PIPF 2F2EA 1MDMA 5K1YA 1EH8A 3RDIA 4GDFA 3BQZA 3LNQA 4FX4A 2F5CA 3PFYA 5LGNA 3FISA 4QPQA 1ZRFA 5KHDA 3GUDA 1HLVA 2OTJI 3QOEA 5IP6A 1HDPA 2E1MB 3GVAA 2J5PA 5FLXZ 3ZOBA 3LA3A 5KK1A 3OYAA 1IN4A 2VJIA 3I53A 1IRZA 3IAM2 1SC7A 2H27A 2F4IA 1TTYA 4DQ2A 5TGTA 1S7AA 4EGZA 1NK3P 1QA6A 1FC3A 3ROUA 4NB5A 3CDHA 3CJNA 2M7BA 3G2BA 3LFKA 5L3BA 5HS7A 3JRGA 2QBYA 3O2PE 2RNJA 1HC8A 1WJFA 4M74A 5B5EC 2M8GX 3KYLA 1Z7LA 2Z33A 5ICGA 3BR1A 2YU3A 1KA8A 2DA5A 5FJ8J 3ZMDA 2ELJA 3FKJA 1ZAOA 3KE2A 1HQCA 5EEAA 5F0HA 2JVHA 1G3WA 4Q4ZF 1MDMB 2JA8J 4L9VA 2PX9A 1LPQA 4UV8A 2Y31A 2STTA 3MKWB 2DMNA 2HU9A 3HOXJ 3M8FA 3OYNA 2YU9J 2DODA 2OBPA 2ZSIB 1MH4A 3IUOA 2JMWA 3H92A 4D1QA 2VKEA 2LTPA 4G7OF 4B47A 3T0YA 3DPTA 4XKBA 3HOSA 2FMLA 5L3DA 1FSEA 5JLXA 5E8GA 2PI0A 1JUSA 3MWMA 5K7ZA 2HR3A 2A6TA 1GXPA 3H1CA 3HRMA 3DP7A 1OPCA 2EV5A 3O3KA 5FLMJ 4EMSA 2WV0A 3MEXA 4J00A 4L9TA 2K02A 2K40A 3F22A 2M4GA 2W85A 2LNBA 2LK2A 2XGCA 4KN4X 4MGRA 3DTIA 4A69C 1WI3A 4HRIA 4I0BA 3U2RA 2QA4I 3AG4H 2XHKA 1FOWA 4HQEA 1XS9A 3H9GA 4MFEA 3H35A 1SD7A 1FYLA 4Q5SF 1V54H 4C2UA 4M6XA 2HPIA 1ZLKA 3S14J 2W00A 5HDGA 2ZXIA 2A61A 2BY0A 4M72A 1HKTA 3K4CA 3ERED 1ZH5A 2XGEA 5K5QA 3LSPA 1W5CC 3R61A 4X1EA 2DA4A 5F0FA 3FXOA 1DPRA 3OYEA 1FNNA 2HYJA 1I6XA 3ECOA 2TRTA 2M0MA 2Y2ZA 2RQPA 5HLGA 2V6EA 2XKPA 3OYGA 4XQFA 2GXGA 3GTGJ 2XF5A 2LD5A 2PFBA 3D5SC 1T0FA 2QUFA 3M3YJ 5DCMA 5D4RA 2XF6A 5BPDA 3OS1A 1YS6A 4HOBA 5HLIA 3CO7C 1TWCJ 4PGHA 1SD6A 2VBXA 2B0LA 3H5RA 2LLKA 1B9NA 1RETA 2O5RA 1FTZA 4B8XA 4OWRB 1R22A 3U1DA 4M71A 4EJWA 2R7TA 3U1KA 1Z67A 2MSYA 3QU6A 3DTKA 3K4BA 2WBMA 4L5EA 2OV7A 3FXUA 1RRJA 3HRTA 1WGXA 3MN2A 2VODA 1MSEC 2R7ZJ 2X4HA 4HV6A 1FPQA 3N97A 2ZBKA 3REOA 4FETA 3BLYA 4DBQA 1GV5A 4BHPA 2NOGA 4A5MA 4BXXJ 1S9HA 2GOXB 3A1YA 1S8NA 1T2KA 2LR8A 1S7EA 2VPRA 3FKIJ 2ECCA 2BHYA 2MYSA 1R23A 3DKXA 3O8GA 4E7HA 1IF1A 2CG4A 5EYRA 5TJJA 3J80Z 3SJMA 3HDDA 5B66C 2JRMA 1OYYA 1XSXA 2E1NA 5DCFA 1T39A 3PL8A 4IHSA 3CO6C 3W6KB 2CSOA 3DV8A 4FASD 3ZQFA 4HX7A 2BEOA 4AWXB 1ETXA 2OQGA 2LFBA 2XPUA 3KCCA 1UG0A 4HA8A 2ELHA 3RQ4A 3CCQI 2P8TA 2JSPA 2HVRA 1H8AC 1XGSA 3KEYA 2NYXA 4L0ZB 4IL6C 1EA3A 1X58A 2DFHA 2KMUA 3QYEA 1ETYA 4Y4RA 4UVBA 1JKRC 2HDDA 3ABKH 1R9TJ 3F3XA 4RS8A 4OIQF 2HTJA 4I0AA 3ZN1A 3SHFA 2HQRA 2D1HA 3GFIA 4PFOA 1MMGA 1ZGAA 2P81A 3PQJA 2LY1A 1U2WA 4RLFA 4B1RA 1YIOA 3WGIA 3S1RJ 1YYVA 4ITVA 2Y0SA 1K6YA 1WZ2A 2L4MA 4AM3A 1I6HJ 2BHZA 2R93J 3I3LA 3AG3H 2BXYA 5FRMA 2XPWA 3Q5FA 1YHQI 2VPLA 2L9VA 1N78A 1XGNA 1S29A 3FXKA 1U78A 4MTDA 2JUGA 1S72I 2K7LA 3QYBA 5ICEA 1XDUA 3CC7I 3IH2A 3WG9A 2V79A 2ZFUA 1CF7B 2FQ3A 4I98B 1VQ5I 1UAAA 1MMAA 1R00A 1XSVA 4ESFA 4KFCA 2K9QA 2LSOA 5ICFA 2D45A 2GWRA 2Q0OA 4CSWA 2E2HJ 1IXRC 2DQRA 3JTHA 4HG2A 1Z9CA 1IN6A 3K70D 3W6VA 2DMQA 2F5EA 3EUKL 4LOCA 4YG2F 1WSUA 1O4XA 2K9NA 1XPXA 2LKPA 3L7WA 1SMYF 1DGWY 3H36A 4RGUA 3R0AA 3LFUA 3CP2A 1FIPA 3ZN0A 3B02A 2GIZA 5AIPA 5DTDA 4B09A 4M3FA 5FLVA 2OPTA 3IKVA 2H1LA 1X4PA 2XV4S 2NAZA 4WK8F 4MLOA 1HW1A 1KQ0A 2D2WA 3F8FA 1W7PA 3DPUA 2PJRB 4CZCA 1ODDA 4NQWB 3I9V2 1QZYA 3UKGA 2LY9A 1ZRCA 3LSJA 2ACJA 5FLXK 4AVZA 5FD5A 4ZTJA 1G3TA 1U5TB 3L2VA 2H1KA 5ILUA 4CXFA 4UUSA 3PJRA 4GO1A 1TQMA 1R5GA 1TL8A 2X85A 2R3SA 1XMXA 4AYBN 3CLQA 3F21A 1OISA 2VT2A 2VQCA 1D5YA 2L9SA 3OR1C 1M1EB 4FT8A 1U5TC 3CCUI 1IGNA 5J8FA 2X1EA 1NHAA 2LBFA 4PCQA 3OOUA 4XRMA 4CCJA 4Y15A 4ZYGA 2HVSA 2HNHA 2DA7A 3C2GA 2FMYA 3LMMA 1LDKB 3JAMK 3QPTA 3LQRA 1RUOA 2XAUA 4Z2YA 2I10A 1YFHA 4D0PA 5M5YJ 2R5YA 1R7JA 3CESA 1E3PA 1OQYA 3G4SI 2O6GE 1S6LA 5FKLA 4AIDA 1SFUA 2UV1A 2LF7A 3WTWC 3FZVA 4NQWA 1JT0A 1FOYA 3L9FA 3PNTA 2JZYA 3VDXA 4PSWA 1MNEA 5DV5A 1X2MA 2IXSA 1BR4A 1IJWC 3HKZN 2OQRA 3IRQA 4U0YA 5JR3A 4DGWB 3TKYA 3CUOA 4CZZA 2KHMA 1IXCA 1FYMA 1ZR2A 3OYMA 2JT1A 2MBFA 4F52A 3LAPA 3LL7A 3ISPA 4RGRA 2AQFA 3I54A 3RPUA 1ZARA 2X6WA 3E5QA 1SVLA 2HZDA 4OMZA 4ZC3A 3K1NA 1IRGA 4PJNA 4AIKA 1HKQA 1R5ID 2LVSA 4M3DA 4Y3OA 3M7GA 3PSIA 3GTQJ 4KIGA 3M1EA 2L7ZA 3BTCA 1QHGA 3GLXA 3FMRA 4UVAA 1BM9A 1X19A 2BY1A 3AG1H 1A6IA 3T5XA 4B3XA 2QQAA 3AL0B 1W1WE 2PEXA 4M6YA 3ONQA 4KDPA 2KIUA 4RA2A 5F6FA 4A3FJ 4A3JJ 4FHTA 2VT3A 5CVIA 4A3EJ 3OIPA 3HC7A 3KP5A 2EBIA 1QPIA 3CCRI 3BCBA 4P55A 4KIBA 5FROA 1YW7A 5IPAA 2KP6A 1GHCA 3QQAA 1GVJA 2KDZA 1W7PD 2EZIA 4DYRA 1D5VA 5EGOB 1K4SA 2H6CA 1BI1A 3LA2A 4XLNF 2RNGA 2W7NA 4EGYA 2ZC2A 1NK2P 4IHYA 3GZ5A 1VQKI 4L0YB 4DBRA 1VQ6I 1K83J 1G4DA 3HUGA 3K4NA 1YITI 2X9DA 5DUIA 1AHDP 4Q48A 1Y0UA 2M30A 1AKHA 2EH3A 3IC7A 1HSJA 2JTVA 3HRUA 2X6YA 1XMKA 1WJBA 3RZDJ 1I5ZA 1Z0XA 3FM3A 3GTJJ 5D8KB 1D3YA 3F8CA 3LSTA 1VF9A 2EFOA 2BBYA 4ESJA 4EM0B 2AO9A 3LWFA 1Z77A 5FKOA 4CYDA 3OYKA 4BE1A 5E1XA 2GIVA 3HHHA 2G0EA 1V3FA 3FK7A 5DM7F 1YG2A 5AONA 2VOOA 2BW3A 2ISYA 3KYDB 3S1NJ 1P7IA 2VE9A 1R71A 3JRIA 3J7AY 1LB2A 1Z3XA 1U8BA 2EILH 1QHHD 4I01A 4BDZA 4F91B 1F5TA 1ETQA 3DWLE 2XAHA 2RAEA 2R7WA 2CUFA 2R5ZA 5J40A 3I56I 3A0BC 2EIMH 3BR6A 3VOEA 3OYFA 2DTRA 4IEJA 1BIAA 4BJ5C 1VQ4I 1YE9A 2FNPA 2CUZA 1FYKA 2EFQA 3CCEI 3GTPJ 1QVTA 3HYIA 4CCNA 2JN6A 2KZVA 5CVRA 3RTRA 1AKHB 4A0YA 1K4TA 5LHIA 3TMOA 4ZYHA 1D1CA 5HODA 1SAXA 3F8NA 1FTTA 5J1YA 2JVGA 3OL3A 1PUFA 4KNYA 3COAC 2OAZA 3ZGKA 2E7XA 3UNGC 1R1UA 3MCZA 4BS9A 2L02A 2LP0A 4DOZA 1HSTA 1KYWA 2ECBA 3A02A 3ERMA 2ME6A 3E1SA 2NVXJ 1UFMA 5E3LA 1MBFA 2K4BA 4HNVA 1X2NA 4PK4A 1QZZA 2IGMA 2LF8A 4BACA 2E36A 3ML6A 1A31A 2Y69H 5IP9J 1IDYA 2UXXA 4HPQA 2VONA 2LKSA 2OZ6A 4L5IA 4E7KA 2DTZA 1GDTA 3OY9A 3KP2A 1YX3A 1ZLJA 3TQNA 2VJ5A 3QWLA 3EDPA 1Y1WJ 2EA4A 1ENHA 2AXLA 2W24A 1QZEA 4A2UA 4KA4A 4U87A 1DUXC 3E6DA 4P9UA 4BJTA 3TDUC 4RAYA 1P4WA 5EJCA 2FU4A 2WAQA 2V1UA 2XRNA 3M8JA 1H9TA 5B1BH 3S16J 2V1NA 5IYCJ 2XDVA 3BC8A 5KAFC 2EJRA 4XMYA 1Y6IA 3H5AA 3LOCA 3I4PA 1SD4A 4ENNA 1KU3A 3S2WA 2XAQA 4FISA 2KISA 3F23A 1DDNA 2VIXA 3HOZJ 4JOMA 2O0YA 3ZR8X 3G3ZA 2DMUA 2XUBA 5FKKA 2QYOA 4C9YA 3PIOF 3ABMH 3DBHB 5GAEJ 5EG0A 2E7WA 5E1ZB 1TQPA 4JX5A 5D5XB 1UCRA 3FBIB 3ABUA 1VQ9I 1RR7A 2HXOA 3OYLA 2O61A 3TEDA 3WGGA 1Y1VJ 1X3UA 2XAFA 3BOQA 4HBLA 3CQZJ 3GO5A 3KX2A 3NWTA 2Y0MA 5DD8A 2M8EA 5TRDA 3BR0A 2XIGA 4XLFA 1LNWA 2K3PA 3BJAA 3OS2A 3AL0C 4EVIA 1FOKA 3Q9VA 1Z3YA 2DMTA 2CW8A 2Y9ZA 1E17A 2NOJB 2DMPA 5FKNA 3BZKA 1K7AA 3BQYA 1K78B 1T95A 2DT6A 5D6EA 2VC0A 3BJOA 3JW4A 3L2RA 4AD9A 3CUQA 5HS9A 1DGRM 1L0OC 1YJ9I 5LD2C 2O7OA 2CQKA 2BV6A 4XOPA 3WHBA 2Z3YA 4MO7A 2V1XA 3HBLA 3CDIA 4G94A 4XN3A 1FIAA 5J8CA 5CLSA 4F93B 5E3OA 1JJ8C 4EEFG 4AUXA 1I27A 2EINH 4RM2A 5F08A 4A0ZA 3VWBA 4P1WA 3I59A 3BG9A 2UUZA 2MH9A 5K7FA 4A6EA 4RMNA 2ZO4A 4BAYA 2WY7Q 2PBIA 4XKVA 3BT9A 4HW0A 5B1AH 3N05A 3MZ8A 2KPMA 4XIDA 4H4KC 2JUCA 1B1BA 4IKFA 2LG4A 1IUFA 2NVUB 3BCAA 1OCTC 3OIOA 3JCUC 4PGGA 1JI8A 2CQ7A 5K5RA 2COMA 5IOYA 3LAJA 1IN5A 2ADUA 1KYZA 2L0KA 3S3MA 2VJJA 3GEZA 1PP7U 4IHTA 4F3QA 4D7NA 2OF7A 5EZGA 3VYSB 2VC1A 3I64A 4C3JJ 3JTGA 1YJWI 5FRNA 2CW7A 5IOZA 2DPUA 1A5JA 2JSCA 1H0MA 5DDGA 2XSJC 3O8HA 1QPMA 4M9XA 4XLPF 2XVCA 2KL4A 4ESBA 1APLC 5E18F 4UXNA 1L3LA 2VQLA 2AHQA 3RKYA 4OIRF 3WTTC 4JYKA 2AXTC 4KITB 3CCLI 3BWGA 3GMEA 3JRHA 4PZJA 4XRSA 1H9GA 3TGNA 1IN8A 4C30A 5DS9A 2C6YA 3V7CA 2IBDA 5ICCA 5IT9Z 1Q1HA 2HGCA 1ZKGA 2Z2SB 3ASNH 2ZJRF 1YQAA 2CQQA 4UUSB 4G7ZF 3CJTB 1ZR4A 1RPWA 4BQOA 1O3QA 3LSGA 2RREA 2QSHX 4G6DA 2BY2A 3WHCA 3CC2I 3BZCA 1BC8C 4V2FA 1Z05A 4E6KG 4B3AA 2CV2A 3CF5F 2K86A 2GM4A 1O3TA 2VBYA 4XLCA 4K2EA 4LK0F 1S7OA 3OV8A 1CF7A 1VNDA 2W82A 3RJPA 1B6AA 5ERIA 2G7UA 2QLZA 4E7ZA 3E97A 5H6RA 3C18A 4PUSA 2GBYA 2VN2A 1F1ZA 2IEKA 2ESHA 2LMDA 4Y17A 2YR2A 4AVPA 1JJ6C 1VZ0A 1I1SA 1ZQ3P 1NH3A 5E3NA 1OMIA 4IVNA 3R60A 4UVCA 4YFXF 1ETOA 2OCCH 5HDKA 4ENKA 2JA6J 4FX0A 2QKLB 3HB9A 2KJBA 2EQRA 3EETA 2MABA 5F27A 2GA2A 3RYPA 3M07A 1ON2A 1USTA 4N9HA 2ZB9A 3QPLA 1UMQA 2I5UA 3GFMA 3CCSI 2PMZN 3FF5A 1E3HA 4WCGA 2CQXA 2PLYA 1SD5A 2EFPA 1EKEA 4M3GA 4BGDA 1W5TA 1NTCA 4F92B 1T98A 3CDLA 1E2XA 2GA1A 4QSHA 2DU9A 3PNVA 1XB4A 1JUMA 3TP0A 2PQ8A 1HF0A 1ETWA 1WJCA 3DEEA 4ZZLA 4LB6B 2VKDA 2E1CA 3DLAA 3OWTA 1I3QJ 1R58A 2ZNYA 4D9JA 1LE8A 3HTUA 5DM6F 4XORA 2XSDC 2FD5A 1RUNA 2QEXI 4EV0A 1WJAA 3HOWJ 2L7MP 3K69A 2TDXA 3CUQC 2QQBA 2KZGA 1POGA 4C2TA 1A35A 2IGKA 3ZCOA 3WU1B 5BMZA 3FMQA 1ZG3A 2NNNA 4QPOA 2CMPA 2NS0A 1V4RA 3MAJA 1Y0NA 1IV6A 2EB7A 3VYTB 1HCRA 3GZNB 1XG1A 3ZP5A 2AQEA 3ZMSA 3LSMA 5H20A 3QOPA 2E2JJ 2HZTA 3P9CA 3IWFA 3RQIA 1W0TA 1TBXA 2DK5A 1O3RA 3AG2H 1PDNC 3TW6A 1KQ8A 3K9TA 1BC7C 1V5FA 3FXJA 5DCMB 3CJRB 3O6BB 3SEQA 2X1DA 1ORKA 2I8DA 2DCEA 2M1BA 1C0WA 2IS4A 3JSOA 3A01A 2LC2A 1HXDA 2WB1A 3VPRA 4ASNA 1EJ9A 2FXAA 2N8GA 2X48A 1BN5A 3H9JA 1ZGWA 1Z6TA 4HNTA 1HDDC 4RGSA 3HTSB 1YJNI 4XNFA 2GQQA 4G7HF 4ZYEA 4S05A 1J2XA 3IHUA 2EK5A 5ILVA 5GPCA 3CMMA 2DT5A 3BTJA 2W1OA 1OFCX 3Q0UA 4UV9A 4ZDPA 2WC2A 3OYCA 1YS7A 4YIIA 3K6GA 4KIFA 2HTSA 2A6HF 2E35A 3QP6A 1IRFA 4LIUA 2V1DA 2H8WA 1R4MB 1ITYA 3DU5A 1HOMA 1VQPI 1JE8A 5FO5A 3CMAI 2ZXJA 3C1DA 2DJIA 1BJAA 3R4KA 3HXLA 3V8KA 1GLNA 4KMFA 5HDNA 2GZWA 2LOOA 4DZPA 2A68F 2IT0A 1V55H 2R7XA 2R7OA 1MBGA 3CCYA 3VODA 3JRBA 2L3DA 3OMYA 5HLTA 1K6OA 2CUJA 2RDPA 3GW2A 5LGUA 4WX9A 2IGNA 2VXZA 3E3VA 2HS5A 4II3A 4IZZA 2EPFA 3IV5A 3NWSA 3OYDA 2XPVA 3HSEA 3S2HJ 1P4XA 3ESWB 5HNFA 4ON0A 2EA2A 3KYCB 3WE3A 3ZQGA 5KNLA 1FJLA 3ECHA 3EQLF 4L9JA 3D5RC 4XONA 1MKMA 5L3FA 3MZYA 1SEUA 2IA0A 1QU3A 4ETSA 5EGOA 1JKOC 3E5XA 1BJZA 4DIQA 2IGOA 1DPUA 3AFHA 3F8BA 5E20A 3SFIA 2ELKA 1QVUA 3VYUB 4R8HA 1GV2A 4BKXA 3ELKA 3JAMZ 1T08B 4Y33A 4CCOA 3HSFA 2CV1A 2P5KA 1MZBA 4KUMA 4HF1A 4UUVA 4IQ4A 3HPGA 3LA7A 2K3FA 3S3NA 2G7HA 1D0ZA 5IYDJ 5FKMA 1MJBA 4EJVA 2L4AA 1D1AA 2A5WA 4J19A 1IDZA 5IT3A 2KKOA 1X3WB 4CA0A 4Z6YA 4BDYA 2VE8A 1MSFC 1SANA 1KU9A 2RGVA 3I0TA 4RLQA 1YRNA 1V5EA 4E7JA 1N25A 3ASOH 5M3FJ 1F36A 1YW9A 3OIQA 3HJEA 2QQ9A 5FB2A 2X6XA 3LQQA 1O57A 3ZQIA 5LEKA 3GCMA 2XB5A 4G9YA 1O7LA 2LDUA 4QLCU 2HOTA 2M4KA 1E3OC 3MZHA 3F6VA 1FT9A 4XRFA 3HM5A 1OCCH 3G6EI 2A69F 2E34A 1NG6A 1FBUA 2DA6A 4FE4A 1G2HA 2HDWA 3HZJA 1IV8A 4I7HA 1TZLA 1YLFA 3BDDA 4PDKA 4LGWA 2H09A 3WU2C 2H94A 1FWZA 3TBIA 5GAGJ 3BY6A 4S0HB 1W4MA 2JJ7A 4RB0A 1WQ2A 5CVVA 1KGSA 3HIFA 5EDNA 1B72B 3KLOA 4ANJA 1TWAJ 4WXHA 1XD7A 3RI4A 4LLLA 3TP3A 2K27A 5L3GA 1FZPB 2HEOA 3BP8A 4V2GA 2NXNB 3KEQA 4GXOA 3BROA 1SVOA 4MIMA 4UB6C 5CJ9A 3T8TA 3VSKA 4CDGA 2VJ4A 1E0EA 3DPLC 4NUBA 3SXYA 4DNCA 3CMEI 3CF2A 4BEHB 5JLWA 2E5ZA 2MG4A 4GYGA 3GTOJ 4BL0B 3WE2A 3MVPA 2FEZA 1KZHA 4HEA2 3W2VA 3OYJA 2VBZA 3TL4X 3L2WA 1AOYA 2D1VA 2WAQN 1SMTA 3DTEA 2FOWA 1MMSA 2W25A 3G1LA 1GT0C 1ZREA 2K5CA 1R5HA 3M4OJ 4KN7X 1W5SA 4CGZA 2Z16A 1JGSA 1O7FA 3I58A 3HEFA 3LSRA 5F0CA 1TP4A 1CQTA 1TNSA 1BW6A 3TOBA 3P9IA 2O8KA 4XOTA 4IRGA 4ABZA 1MJAA 5ILSA 2HYGD 4DYCA 3MKYB 1MMDA 2LKXA 3K70C 2HYFA 4BNCA 3B73A 3WTSC 4AIHA 3K2ZA 4DZJA 1BI3A 4F7ZA 4C2MJ 5EZHA 3DEWA 5E3MA 4A12A 2P4WA 3S15J 1WFXA 2FA5A 3QRFF 1OYWA 2KIMA 2ZJ2A 5JHFA 3WGHA 4L18B 1FY7A 5BOXA 2HOAA 3K4KA 4JK1X 1MBKA 5D5VB 2CO5A 4A3LJ 4JP0A 2LREA 4HYEA 1G59A 3K4MA 2JA2A 3M1CA 1RR8C 2HKXA 4G6QA 3CD6I 1FP1D 4YEJA 3VYRB 3T8RA 2FSWA 3WG7H 4D5CA 3M8EA 3WU0A 2E1OA 2YX7A 4YFNF 2DW4A 2V9VA 2CH0A 4XICA 4ENMA 1A04A 4LG0A 1QGPA 1I3AA 2A3SA 2Q8KA 3L00A 1X1AA 4MEXF 1MH3A 3PUFA 3SZGA 2CYYA 2KIFA 4M73A 2V7FA 1XSDA 1BBYA 3GF2A 3FHZA 3F8MA 9ANTA 3ABLH 1D0XA 3G71I 1ULYA 2WY8Q 4RDUA 2JK3A 1VFCA 2FX0A 4G8XA 2FJ1A 1YTYA 5KVRA 3U9GA 3EYIA 1G8XA 3QPSA 1VQ8I 4M3EA 4IO9F 3K1MA 3OOPA 1TC3C 1DQUA 1V5GA 3IH4A 5D6FA 5J6XA 5EF6A 2WADA 5HOOA 4KT6A 4C3IJ 5KAIC 2BZTA 1VI0A 3S2DJ 4O6JA 5J47A 3S32A 3FXQA 2VB6A 3GLLA 3EPZA 2HOEA 1FMWA 2ZJPF 5CPRB 2OD5A 2ISZA 3C7JA 3MKZA 1ONVA 1RIOH 1WJ5A 4IHVA 3BR3A 2XASA 4A6DA 5KCMA 2FBHA 3DLLF 5CKTA 2B9SA 4S04A 3DBRB 5GTHC 3WODF 4LG3A 2Z99A 5EEHA 1JUPA 4UY8I 4U7DA 2MLKA 1B9MA 1ZG1A 4XSXF 4J01A 2L9NA 2QM3A 1VQOI 1X3ZB 1RESA 4M3BA 2FRHA 1H89C 2W4SA 1S5LC 4RAZA 2M34A 1S3JA 3DFGA 5JFRA 1D1BA 2KRFA 1LEBA 2UXNA 3RSNA 3J81Z 2HOSA 5BPIA 4X0GA 4ZTFA 3FBNB 3E6MA 3VEPA 4AU7A 2JPCA 2QF7A 2H6BA 4MHGA 4LLGF 1MNDA 2KFDA 2DN0A 3LSHA 2VUMJ 4A3KJ 2ESNA 1USSA 2P5VA 3IP4B 2CGPA 2PJPA 4BBRJ 2B63J 1XCVA 1UB9A 5CQEA 2O3FA 3GYHX 5GTIC 3A2KA 1LKXA 5BNGA 1EH7A 4BXUA 1JXSA 2L7FP 5C44J 2E60A 3HOVJ 3HHGA 1MJ9A 1BR2A 1U9OA 3QP5A 1LE8B 2ICWG 2DFFA 1DP7P 1ERDA 2DT7B 4V19K 2K85A 3S1QJ 2OA4A 2Y9YA 3I5UA 1G6NA 1RKWA 4B44A 1IG7A 4LJZF 1JHHA 1W36C 1EF4A 2QENA 2A5YB 4O5VA 2HXIA 2FE3A 4W97A 3PM1A 1ETKA 1XC5A 1TQIA 3VSLA 5M5WJ 3R0JA 1VQLI 3E7LA 1MIJA 3JREA 1WJEA 2W84A 1SAUA 4RAGA 2HPMA 4WXCA 5LHGA 4D5FA 1YO5C 1T56A 1N75A 2XGDA 5C4JJ 4BHBA 4ENJA 2AS5F 4GFBA 3BG3A 5A2QK 2BOLA 3V8LA 1XX5A 4GCVA 5C4XJ 1FX7A 1PJRA 3BJ6A 3ULQB 4WF2A 4F55A 1D8KA 4WXDA 3CZ6A 4JQFA 4FQGA 2R7DA 3CLOA 4HV5A 1K79A 3J7AO 2BYVE 3C2BA 3GX4X 3V8JA 2F4MB 1P2FA 3IKTA 4NDLA 5JVTA 2L54A 5K7HA 2CQNA 2O03A 4BH9A 2XGXA 2EFNA 1MBHA 4MNUA 2Z1DA 3HOTA 1B8IB 4G12A 2R7RA 1IW7F 1I50J 5LGTA 1VQNI 4CCMA 1OCPA 3BG5A 4X6AJ 2HQAA 2IAIA 2B7EA 2NVTJ 4BQQA 3NRVA 4XBFA 2DPDA 4EM1A 2R4GA 3KZIC 3K4JA 4HF2A 1JKQC 3V7SA 1Y56A 3W6JB 2BE5F 3ZMUA 1YX5A 3L2QA 4DYQA 5FFZA 2DYSH 2VL8A 2F6CA 1U0JA 4HF0A 1OCZH 3NARA 1SVMA 4M9ZA 4U0WA 3V42A 2EFWA 1SFOJ 3FIWA 4OMYA 1VQ7I 3MQ0A 2FQ4A 3ZXSA 2F5DA 1GVDA 1MBJA 1Z91A 3BR2A 2VOPA 3RKWA 1W0UA 3RIRA 2G9WA 3NQOA 1LVAA 2ZSHB 4A93J 4Q47A 4XN0A 5EEGA 5F64A 2P6SA 1TW2A 3DKYA 2L2OA 3Q9SA 1OCRH 3JRAA 2DOFA 3RZOJ 2CFXA 2Y0SN 1JHFA 3U21A 2UWMA 4U7BA 4YIRX 3NEUA 3OSGA 3I4NJ 3PNYA 2X1CA 4FE7A 1EH6A 1WKMA 4DJAA 5JVGF 3EUHA 3L09A 4D7MA 2PG4A 1J59A 3LSKA 1AA7A 2GLOA 3JR9A 1GXQA 1R1VA 1B72A 1OYIA 1YOVB 3CCMI 1VQMI 1P4AA 3FM5A 5H6QA 3MMYB 4CCKA 1LUJB 4RB1A 3JSPA 2F5FA 3ZPLA 5GAHJ 3WTVC 3V7RA 3BTLA 5D4SA 1P9QC 2WB1N 1OCOH 1XDSA 3SDBA 2M9HA 4ZJZA 4HZFA 4PSXA 5E79C 1EV7A 1OLTA 2DYRH 2EZKA 3H5NA 3CCVI 1P92A 3D0SA 3PQKA 3J7ZI 3CCJI 3IL2A 1A6QA 3FMSA 4M6VA 1R49A 4I6ZA 5CVUA 2R7SA 1DU0A 1W7PB 2W48A 2DDAA 4ZDLA 2JA5J 3E0JB 1PUFB 1U6GA 1WJDA 3TO9A 4YRVA 1ACIA 1WHUA 2DAOA 3BPXA 1IUYA 1BR1A 3HOYJ 4Y52J 2GOMA 2KIQA 3F72A 3GTKJ 3SEZA 4AYBA 4A3MJ 2M0CA 1X1PA 3IAS2 3B6AA 3LSIA 2CFOA 4KICA 4IOAF 2MD0A 2DI3A 4XLHA 2VLAA 1BOBA 2ZCWA 3PO2J 3L2CA 1MW7A 1A36A 2F5VA 4HX4A 4AC0A 4I76A 4PFPA 2DA3A 2EIJH 3QAHA 5CVJA 2RVCA 4IF4A 5IP7J 2FF4A 3KEOA 4U0VA 3H3UA 4R1HA 3HG9A 3S8PA 4LD5A 4UUTA 5LRSA 1IAWA 2WAFA 1HW2A 4OIPF 2DOAA 3CUQB 2R5YB 1T6SA 1JTXA 2WTEA 4M9SA 3GZ6A 1WWXA 4N4OB 3SFZA 3KP6A 3E6BA 2YSRA 2Y75A 2IS1A 3IH3A 5JHUA 2FBKA 5GP9A 2OTLI 3F6OA 3DXJF 4RM3A 3WTXC 3KPHA 3AKZA 1LQ1A 2ME0A 3DKWA 4JBAA 3I59B 2O8XA 2Z5UA 2QCOA 5FD6A 3AAFA 2IJLA 2QWWA 4NC7A 2HDCA 2VKHA 5CYVA 1TWGJ 1PVEA 1O3SA 3KZZA 2WAEA 1KU7A 4HX8A 1R4NB 3VB2A 2L01A 5C3EJ 3KLNA 3SDGA 3A4CA 5AIQA 3S93A 4OAZA 3ZQHA 3E6CC 2QQ8A 4HSRA 4CUGA 1XCBA 4O3MA 2FNAA 2VQGA 1AWCA 2QBYB 1OR7C 4UHTA 3G73A 2K9LA 1RZ4A 2DFEA 3KFWX 1BW5A 3BTIA 3KETA 2MGQA 4IHWA 1J0RA 4IPAA 2K9MA 1B59A 5LRRA 4HQMA 1RKTA 3UR3C 3S3OA 4BBSJ 2P6TA 2VQHA 1KU2A 2DA2A 3FXRA 3F9KA 2OZUA 1D0YA 2EIKH 3MKLA 1QO0D 1RI7A 1R6RA 1ZTRA 3RKQA 2IRFG 1R1TA 1XMAA 3IWZA 4XLEA 5F04A 5J4YA 3J7YJ 4HSTA 3JRCA 2M45A 2NRAC 1J7KA 2MW8A 5IYBJ 5IY5H 1ZRDA 3H9QA 4LIVA 4P5OA 4YFKF 1JTYA 1HKSA 2KJCA 3ZQQA 2COBA 1FSHA 2F4OB 2JRTA 3RCOA 3MFKA 1UELB 3N4MA 2ID3A 4H0EA 4JX6A 5M5XJ 1BI2A 2FOKA 2ZKZA 4KT5C 4LG0B 5GPAA 4CO8A 3C2HA 3MD2A 4N4NB 3GFJA 3H0GJ 4ZYAA 3W2WA 4BQNA 5HS8A 2KRHA 3TO7A 2JPBA 3CP8A 3R6SA 3SQNA 5HNHA 2E5NA 4PJJA 3A0HC 5TISC 5E1WA 4IHXA 2LRDA 4ZH4F 4EJUA 4A3GJ 1IC8A 4HNUA 1F4KA 3DQVC 4C3HJ 2X0LA 2OUMA 2BVMA 1BL0A 2IA2A 1R36A 1T8IA 2VASA 1DU6A 4LFUA 3NAUA 4ZDOA 2RN7A 4EM2A 1MNMC 3ZMTA 4KYWA 1B4AA 1PYVA 2DFIA 3P7NA 3OL4A 1J75A 5K5OA 2FUG2 2CU7A 2X51A 4EATA 4RB3C 1LEAA 1BOAA 1XN7A 4GRIA 2E71A 3ABTA 1ON1A 3Q0VA 4I2OA 3EUAA 4DW6A 4N9IA 2D5VA 2XAJA 2BVLA 2R5ZB 4ZZDA 5L3CA 1HBXG 2V4JC 3H0DA 2XB0X 5E8IA 2GXAA 5FGMA 3OYBA 1FP2A 3H3ZA 3ZMVA 4YIFA 2WWYA 1U8RA 1Y8QB 1LDJA 5ED4A 4HLYA 2IW5A 1U3EM 2NS7A 4E4HA 4RGXA 3VFZA 5HVQC 1WRJA 2ZNZA 4I02A 2IS2A 4BQAA 2JA7J 1Z6RA 1K61A 3HUGB 1Q1VA 2MLGA 2KDOA 3W2AA 6PAXA 2L5QA 2IPQX 1P6RA 2IP2A 2KT0A 3GXOA 5DUKA 4AIJA 1DP3A 2OU2A 3QODA 2XAGA 4OU0A 1J9IA 2HFHA 3HKZA 2LY2A 2ZJQF 4EJTA 2V9PA 3DBLB 3K1PA 4JX4A 2M3AA 4BJ6C 1ZN2A 1TNTA 1JT6A 3GWZA 1J09A 2PMZA 1RC9A 3PFIA 4MQVA 3SZPA 3B6CA 2ZFWA 5LBQA 2RC4A 1ZHFA 3SYTA 4HAMA 4OIOF 3PO3J 3CJQB 4BHCA 1B8IA 3K0LA 1VTNC 2JWTA 1N77A 5A2QZ 1OKRA 4XRSG 3TOAA 2R7UA 4PJLA 3Q3SA 4I99C 1LFPA 2VKVA 2V6CA 1YW8A 3A01B 2EZHA 4IRIA 2QKMB 3HSRA 2O9LA 2IS6A 1KONA 2CRGA 3CMYA 1UJ8A 2X6OA 1W36D
chains in the Genus database with same CATH topology
4V19K 3G6EI 3G4SI 2OTLI 2E34A 3PIOF 5GAEJ 1VQKI 3CF5F 1QA6A 5DM6F 1YI2I 3PIPF 1VQ4I 1ACIA 2QEXI 4UY8I 3CCMI 1VQMI 3CCLI 1Y39A 3CCEI 1YHQI 5DM7F 3CCUI 1VQ6I 1FOYA 2E36A 5GADJ 4IOCF 3CCRI 1VQ9I 3G71I 1HC8A 2ZJPF 5GAGJ 1YITI 1S72I 2FOWA 5GAHJ 1MMSA 2E35A 1VQ5I 3CCSI 2JQ7A 1VQOI 2OTJI 2H8WA 1YJWI 2QA4I 2ZJQF 2ZJRF 1VQPI 1VQLI 1FOWA 3CMAI 3CJTB 3CC7I 3CD6I 4IOAF 3CC4I 1VQ8I 1YIJI 4IO9F 2NXNB 3CCVI 1VQNI 3J7ZI 3CC2I 2K3FA 3I55I 3I56I 3CCJI 1YJ9I 1YJNI 3CCQI 5JVGF 1FOXA 3CMEI 1VQ7I 3DLLF 3J7YJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V19 K;  3G6E I;  3G4S I;  2OTL I;  2E34 A;  3PIO F;  5GAE J;  1VQK I;  3CF5 F;  1QA6 A;  5DM6 F;  1YI2 I;  3PIP F;  1VQ4 I;  1ACI A;  2QEX I;  4UY8 I;  3CCM I;  1VQM I;  3CCL I;  1Y39 A;  3CCE I;  1YHQ I;  5DM7 F;  3CCU I;  1VQ6 I;  1FOY A;  2E36 A;  5GAD J;  4IOC F;  3CCR I;  1VQ9 I;  3G71 I;  1HC8 A;  2ZJP F;  5GAG J;  1YIT I;  1S72 I;  2FOW A;  5GAH J;  1MMS A;  2E35 A;  1VQ5 I;  3CCS I;  2JQ7 A;  1VQO I;  2OTJ I;  2H8W A;  1YJW I;  2QA4 I;  2ZJQ F;  2ZJR F;  1VQP I;  1VQL I;  1FOW A;  3CMA I;  3CJT B;  3CC7 I;  3CD6 I;  4IOA F;  3CC4 I;  1VQ8 I;  1YIJ I;  4IO9 F;  2NXN B;  3CCV I;  1VQN I;  3J7Z I;  3CC2 I;  2K3F A;  3I55 I;  3I56 I;  3CCJ I;  1YJ9 I;  1YJN I;  3CCQ I;  5JVG F;  1FOX A;  3CME I;  1VQ7 I;  3DLL F;  3J7Y J; 
#chains in the Genus database with same CATH topology
 2RQQ A;  5L3E A;  3C3W A;  1FMV A;  4NBQ A;  4A3I J;  4CHU A;  2K9S A;  2Z9O A;  1FLI A;  4CH7 A;  3BZ6 A;  1F43 A;  2Q1Z B;  5LLQ A;  4RBO A;  4NC6 A;  4IJA A;  4XK4 A;  4YEL A;  4RB2 C;  3L1P A;  4HLX A;  3JRD A;  1REP C;  1UG2 A;  2K4J A;  4B4C A;  4KIS A;  4MFD A;  2V9K A;  4ZYD A;  2E1M C;  1LFU P;  3GBG A;  1P7J A;  3L2U A;  3GTL J;  2DDB A;  1MBE A;  2A6E F;  3FXL A;  3FHN A;  1FEX A;  4IXA A;  4PJM A;  3CC4 I;  2ETH A;  2UZK A;  3BR5 A;  2EZL A;  2WV1 A;  1ZG5 A;  1TWF J;  2VI6 A;  1LDD A;  2DK8 A;  4XSZ F;  5DYM A;  3ZQ7 A;  4CIC A;  1Y8R B;  5CQG A;  1IO2 A;  1U9N A;  5D5U B;  3CTA A;  3HPH A;  5BQT A;  2YS9 A;  2M5W A;  1XGM A;  4N0B A;  3TDZ C;  5M3M J;  3K4L A;  3K7A J;  3HL2 A;  2W57 A;  4GGG A;  1TT0 A;  2CJJ A;  1WH7 A;  2E2I J;  4IQJ A;  2P0W A;  3KIO A;  1MGT A;  2MC4 A;  3D1N I;  1QNT A;  1X1D A;  2M7A A;  2XKO A;  2RV8 A;  2DA1 A;  4B43 A;  2DLL A;  2IVM A;  2BGC A;  1MD0 A;  4A5N A;  1QBJ A;  1X4O A;  3OS0 A;  2EWN A;  2XRL A;  2BXZ A;  2DJN A;  1SFX A;  2PMU A;  2J5O A;  3FXM A;  2OJE D;  2DQL A;  3WTY C;  4UB8 C;  3DU6 A;  2EV0 A;  2NS8 A;  5B3S H;  3RYR A;  1QQI A;  2CWE A;  4BEH A;  2MFZ A;  4P9F A;  4WWC A;  1GUU A;  2YPR A;  4E7S A;  3I55 I;  2P5L C;  2A05 A;  3T1B A;  2P7C B;  1T33 A;  3J80 K;  2HKO A;  1ETV A;  5EG0 B;  2Q2E B;  5F1R A;  1X1C A;  1ZYR F;  4TV7 A;  2M2E A;  3X2Q H;  5D8L B;  2XC7 A;  2HVQ A;  4QTR A;  2R7Q A;  3W3C A;  3BG7 A;  2Y48 A;  4L5J A;  3EUH C;  4XKW A;  5J1R A;  1IZ1 A;  3OYI A;  4XR6 A;  2V26 A;  4QIW N;  1Z1D A;  3M9A A;  4I09 A;  5JI6 A;  2TCT A;  5E17 F;  4HDV A;  3QPH A;  3H3V K;  2ZXW H;  2CS3 A;  4E70 A;  4OOI A;  2CV0 A;  1G3S A;  3EYY A;  2VBW A;  3RPQ A;  4KJZ A;  5IT9 K;  1BA5 A;  1WVR A;  2LBF B;  3ZQC A;  3DCF A;  3QU3 A;  3PSF A;  1JKP C;  4XM3 A;  1Z21 A;  3Q0W A;  3S1M J;  1TT5 B;  2R0Q C;  2ZXH A;  1HA8 A;  1SFE A;  3TO6 A;  4IOC F;  4II2 A;  2ZME B;  1LFB A;  4CCL A;  4R79 A;  4Y13 A;  2NNY A;  2NVQ J;  2NVY J;  5LHH A;  4L9N A;  2XRO A;  1WCM J;  4FTH A;  4A3D J;  1H88 C;  2R7V A;  1UZC A;  2HWV A;  4MQ9 F;  1T0F C;  3G1M A;  2HQN A;  2XF7 A;  3P9K A;  4LB5 A;  2Q2E A;  3OYH A;  4BU2 A;  2HQ5 A;  4HDU A;  1FOX A;  2DXI A;  4U88 A;  3HGY A;  3ZMZ A;  1AU7 A;  2DOE A;  2CW0 F;  3RKX A;  2PN6 A;  4IRH A;  3K2A A;  4BXF A;  1F9N A;  1LJ9 A;  1OR7 A;  1UHS A;  5FFX A;  5GAD J;  1OJL A;  5HLH A;  1T38 A;  2DO7 A;  3KP3 A;  4NC8 A;  1IXS B;  2QGU A;  4MEY F;  3P5J A;  5F1J A;  2MH2 A;  1MMN A;  2YUS A;  3PUB A;  1CGP A;  1YRN B;  1WI9 A;  3HGG A;  4RAF A;  2GAU A;  2STW A;  5DEQ A;  2F48 A;  2OCE A;  3FK6 A;  2P7V B;  3ZRG A;  3GFL A;  4CYC B;  1YIJ I;  3DF8 A;  4QWQ A;  2CUE A;  2EV6 A;  2LYC A;  4Y7N J;  2R7F A;  3HOU J;  3K10 A;  4BYY A;  4A3C J;  1XTA A;  5H2F C;  2ZME C;  1WPK A;  4G6T B;  1TW3 A;  4XKC A;  2ZME A;  2BY3 A;  3OR2 C;  2WA0 A;  2IA1 A;  3I71 A;  3ZQL A;  2A07 F;  4UNO A;  1D8J A;  3F0C A;  2M87 A;  4EQQ A;  2VXD A;  2JQ7 A;  2MA3 A;  1STZ A;  5J4V A;  1X1B A;  2QSG X;  4W1U A;  2KLO A;  3BG6 A;  5J1U A;  4A0X A;  2H8R A;  4BUP A;  3WTZ A;  3RPU D;  1FBQ A;  1ZEL A;  2R92 J;  5J3L A;  3HRS A;  1ZK8 A;  4EJO A;  3FWE A;  2L7K A;  3G1O A;  3KZY A;  3FX3 A;  1IRX A;  4A3B J;  3FDY A;  1K78 A;  2QZ8 A;  2GXB A;  4IX7 A;  4BE2 A;  2PMH A;  3I4M J;  2L9R A;  1BIB A;  4GYI A;  3J81 K;  2Y30 A;  2KRC A;  4KMU X;  1G3Y A;  5D5W B;  1Y39 A;  4XL9 A;  3SZT A;  3JRF A;  2MD5 A;  1TWH J;  3KP7 A;  4B48 A;  1I1G A;  4E7L A;  4OIN F;  3OSF A;  1HW5 A;  4PJ0 C;  5LEJ A;  1PP8 F;  2KQR A;  4CYC A;  1KQ9 A;  2PJR A;  1WH5 A;  4LK1 F;  3DEU A;  3D5L A;  3E5U A;  2HI3 A;  4NHJ A;  4BE0 A;  3A03 A;  1BI0 A;  3QYF A;  3WTU C;  2MC3 A;  2YX4 A;  1U5T A;  1UHM A;  4E7I A;  1J5Y A;  2OC6 A;  4MTE A;  4LMY A;  3BPV A;  1FBS A;  1YI2 I;  2FBI A;  2QSF X;  1XGO A;  4BY7 J;  1JGG A;  1SFK A;  3KP4 A;  4FCY A;  5DD4 A;  2LH9 A;  3TW7 A;  1PUE E;  1QRY A;  4XLA A;  5BS6 A;  1ZGJ A;  4NNJ A;  3IRR A;  1RNL A;  4LLN A;  1TLH B;  2DBB A;  2ID6 A;  4BY1 J;  3GTM J;  2QVO A;  4LIT A;  4OAY A;  1IN7 A;  1I39 A;  3V4G A;  2E19 A;  3S17 J;  1NG7 A;  1UHW A;  1LVK A;  1Z7U A;  4P96 A;  2RKH A;  2BW3 B;  5LFA A;  3PIP F;  2F2E A;  1MDM A;  5K1Y A;  1EH8 A;  3RDI A;  4GDF A;  3BQZ A;  3LNQ A;  4FX4 A;  2F5C A;  3PFY A;  5LGN A;  3FIS A;  4QPQ A;  1ZRF A;  5KHD A;  3GUD A;  1HLV A;  2OTJ I;  3QOE A;  5IP6 A;  1HDP A;  2E1M B;  3GVA A;  2J5P A;  5FLX Z;  3ZOB A;  3LA3 A;  5KK1 A;  3OYA A;  1IN4 A;  2VJI A;  3I53 A;  1IRZ A;  3IAM 2;  1SC7 A;  2H27 A;  2F4I A;  1TTY A;  4DQ2 A;  5TGT A;  1S7A A;  4EGZ A;  1NK3 P;  1QA6 A;  1FC3 A;  3ROU A;  4NB5 A;  3CDH A;  3CJN A;  2M7B A;  3G2B A;  3LFK A;  5L3B A;  5HS7 A;  3JRG A;  2QBY A;  3O2P E;  2RNJ A;  1HC8 A;  1WJF A;  4M74 A;  5B5E C;  2M8G X;  3KYL A;  1Z7L A;  2Z33 A;  5ICG A;  3BR1 A;  2YU3 A;  1KA8 A;  2DA5 A;  5FJ8 J;  3ZMD A;  2ELJ A;  3FKJ A;  1ZAO A;  3KE2 A;  1HQC A;  5EEA A;  5F0H A;  2JVH A;  1G3W A;  4Q4Z F;  1MDM B;  2JA8 J;  4L9V A;  2PX9 A;  1LPQ A;  4UV8 A;  2Y31 A;  2STT A;  3MKW B;  2DMN A;  2HU9 A;  3HOX J;  3M8F A;  3OYN A;  2YU9 J;  2DOD A;  2OBP A;  2ZSI B;  1MH4 A;  3IUO A;  2JMW A;  3H92 A;  4D1Q A;  2VKE A;  2LTP A;  4G7O F;  4B47 A;  3T0Y A;  3DPT A;  4XKB A;  3HOS A;  2FML A;  5L3D A;  1FSE A;  5JLX A;  5E8G A;  2PI0 A;  1JUS A;  3MWM A;  5K7Z A;  2HR3 A;  2A6T A;  1GXP A;  3H1C A;  3HRM A;  3DP7 A;  1OPC A;  2EV5 A;  3O3K A;  5FLM J;  4EMS A;  2WV0 A;  3MEX A;  4J00 A;  4L9T A;  2K02 A;  2K40 A;  3F22 A;  2M4G A;  2W85 A;  2LNB A;  2LK2 A;  2XGC A;  4KN4 X;  4MGR A;  3DTI A;  4A69 C;  1WI3 A;  4HRI A;  4I0B A;  3U2R A;  2QA4 I;  3AG4 H;  2XHK A;  1FOW A;  4HQE A;  1XS9 A;  3H9G A;  4MFE A;  3H35 A;  1SD7 A;  1FYL A;  4Q5S F;  1V54 H;  4C2U A;  4M6X A;  2HPI A;  1ZLK A;  3S14 J;  2W00 A;  5HDG A;  2ZXI A;  2A61 A;  2BY0 A;  4M72 A;  1HKT A;  3K4C A;  3ERE D;  1ZH5 A;  2XGE A;  5K5Q A;  3LSP A;  1W5C C;  3R61 A;  4X1E A;  2DA4 A;  5F0F A;  3FXO A;  1DPR A;  3OYE A;  1FNN A;  2HYJ A;  1I6X A;  3ECO A;  2TRT A;  2M0M A;  2Y2Z A;  2RQP A;  5HLG A;  2V6E A;  2XKP A;  3OYG A;  4XQF A;  2GXG A;  3GTG J;  2XF5 A;  2LD5 A;  2PFB A;  3D5S C;  1T0F A;  2QUF A;  3M3Y J;  5DCM A;  5D4R A;  2XF6 A;  5BPD A;  3OS1 A;  1YS6 A;  4HOB A;  5HLI A;  3CO7 C;  1TWC J;  4PGH A;  1SD6 A;  2VBX A;  2B0L A;  3H5R A;  2LLK A;  1B9N A;  1RET A;  2O5R A;  1FTZ A;  4B8X A;  4OWR B;  1R22 A;  3U1D A;  4M71 A;  4EJW A;  2R7T A;  3U1K A;  1Z67 A;  2MSY A;  3QU6 A;  3DTK A;  3K4B A;  2WBM A;  4L5E A;  2OV7 A;  3FXU A;  1RRJ A;  3HRT A;  1WGX A;  3MN2 A;  2VOD A;  1MSE C;  2R7Z J;  2X4H A;  4HV6 A;  1FPQ A;  3N97 A;  2ZBK A;  3REO A;  4FET A;  3BLY A;  4DBQ A;  1GV5 A;  4BHP A;  2NOG A;  4A5M A;  4BXX J;  1S9H A;  2GOX B;  3A1Y A;  1S8N A;  1T2K A;  2LR8 A;  1S7E A;  2VPR A;  3FKI J;  2ECC A;  2BHY A;  2MYS A;  1R23 A;  3DKX A;  3O8G A;  4E7H A;  1IF1 A;  2CG4 A;  5EYR A;  5TJJ A;  3J80 Z;  3SJM A;  3HDD A;  5B66 C;  2JRM A;  1OYY A;  1XSX A;  2E1N A;  5DCF A;  1T39 A;  3PL8 A;  4IHS A;  3CO6 C;  3W6K B;  2CSO A;  3DV8 A;  4FAS D;  3ZQF A;  4HX7 A;  2BEO A;  4AWX B;  1ETX A;  2OQG A;  2LFB A;  2XPU A;  3KCC A;  1UG0 A;  4HA8 A;  2ELH A;  3RQ4 A;  3CCQ I;  2P8T A;  2JSP A;  2HVR A;  1H8A C;  1XGS A;  3KEY A;  2NYX A;  4L0Z B;  4IL6 C;  1EA3 A;  1X58 A;  2DFH A;  2KMU A;  3QYE A;  1ETY A;  4Y4R A;  4UVB A;  1JKR C;  2HDD A;  3ABK H;  1R9T J;  3F3X A;  4RS8 A;  4OIQ F;  2HTJ A;  4I0A A;  3ZN1 A;  3SHF A;  2HQR A;  2D1H A;  3GFI A;  4PFO A;  1MMG A;  1ZGA A;  2P81 A;  3PQJ A;  2LY1 A;  1U2W A;  4RLF A;  4B1R A;  1YIO A;  3WGI A;  3S1R J;  1YYV A;  4ITV A;  2Y0S A;  1K6Y A;  1WZ2 A;  2L4M A;  4AM3 A;  1I6H J;  2BHZ A;  2R93 J;  3I3L A;  3AG3 H;  2BXY A;  5FRM A;  2XPW A;  3Q5F A;  1YHQ I;  2VPL A;  2L9V A;  1N78 A;  1XGN A;  1S29 A;  3FXK A;  1U78 A;  4MTD A;  2JUG A;  1S72 I;  2K7L A;  3QYB A;  5ICE A;  1XDU A;  3CC7 I;  3IH2 A;  3WG9 A;  2V79 A;  2ZFU A;  1CF7 B;  2FQ3 A;  4I98 B;  1VQ5 I;  1UAA A;  1MMA A;  1R00 A;  1XSV A;  4ESF A;  4KFC A;  2K9Q A;  2LSO A;  5ICF A;  2D45 A;  2GWR A;  2Q0O A;  4CSW A;  2E2H J;  1IXR C;  2DQR A;  3JTH A;  4HG2 A;  1Z9C A;  1IN6 A;  3K70 D;  3W6V A;  2DMQ A;  2F5E A;  3EUK L;  4LOC A;  4YG2 F;  1WSU A;  1O4X A;  2K9N A;  1XPX A;  2LKP A;  3L7W A;  1SMY F;  1DGW Y;  3H36 A;  4RGU A;  3R0A A;  3LFU A;  3CP2 A;  1FIP A;  3ZN0 A;  3B02 A;  2GIZ A;  5AIP A;  5DTD A;  4B09 A;  4M3F A;  5FLV A;  2OPT A;  3IKV A;  2H1L A;  1X4P A;  2XV4 S;  2NAZ A;  4WK8 F;  4MLO A;  1HW1 A;  1KQ0 A;  2D2W A;  3F8F A;  1W7P A;  3DPU A;  2PJR B;  4CZC A;  1ODD A;  4NQW B;  3I9V 2;  1QZY A;  3UKG A;  2LY9 A;  1ZRC A;  3LSJ A;  2ACJ A;  5FLX K;  4AVZ A;  5FD5 A;  4ZTJ A;  1G3T A;  1U5T B;  3L2V A;  2H1K A;  5ILU A;  4CXF A;  4UUS A;  3PJR A;  4GO1 A;  1TQM A;  1R5G A;  1TL8 A;  2X85 A;  2R3S A;  1XMX A;  4AYB N;  3CLQ A;  3F21 A;  1OIS A;  2VT2 A;  2VQC A;  1D5Y A;  2L9S A;  3OR1 C;  1M1E B;  4FT8 A;  1U5T C;  3CCU I;  1IGN A;  5J8F A;  2X1E A;  1NHA A;  2LBF A;  4PCQ A;  3OOU A;  4XRM A;  4CCJ A;  4Y15 A;  4ZYG A;  2HVS A;  2HNH A;  2DA7 A;  3C2G A;  2FMY A;  3LMM A;  1LDK B;  3JAM K;  3QPT A;  3LQR A;  1RUO A;  2XAU A;  4Z2Y A;  2I10 A;  1YFH A;  4D0P A;  5M5Y J;  2R5Y A;  1R7J A;  3CES A;  1E3P A;  1OQY A;  3G4S I;  2O6G E;  1S6L A;  5FKL A;  4AID A;  1SFU A;  2UV1 A;  2LF7 A;  3WTW C;  3FZV A;  4NQW A;  1JT0 A;  1FOY A;  3L9F A;  3PNT A;  2JZY A;  3VDX A;  4PSW A;  1MNE A;  5DV5 A;  1X2M A;  2IXS A;  1BR4 A;  1IJW C;  3HKZ N;  2OQR A;  3IRQ A;  4U0Y A;  5JR3 A;  4DGW B;  3TKY A;  3CUO A;  4CZZ A;  2KHM A;  1IXC A;  1FYM A;  1ZR2 A;  3OYM A;  2JT1 A;  2MBF A;  4F52 A;  3LAP A;  3LL7 A;  3ISP A;  4RGR A;  2AQF A;  3I54 A;  3RPU A;  1ZAR A;  2X6W A;  3E5Q A;  1SVL A;  2HZD A;  4OMZ A;  4ZC3 A;  3K1N A;  1IRG A;  4PJN A;  4AIK A;  1HKQ A;  1R5I D;  2LVS A;  4M3D A;  4Y3O A;  3M7G A;  3PSI A;  3GTQ J;  4KIG A;  3M1E A;  2L7Z A;  3BTC A;  1QHG A;  3GLX A;  3FMR A;  4UVA A;  1BM9 A;  1X19 A;  2BY1 A;  3AG1 H;  1A6I A;  3T5X A;  4B3X A;  2QQA A;  3AL0 B;  1W1W E;  2PEX A;  4M6Y A;  3ONQ A;  4KDP A;  2KIU A;  4RA2 A;  5F6F A;  4A3F J;  4A3J J;  4FHT A;  2VT3 A;  5CVI A;  4A3E J;  3OIP A;  3HC7 A;  3KP5 A;  2EBI A;  1QPI A;  3CCR I;  3BCB A;  4P55 A;  4KIB A;  5FRO A;  1YW7 A;  5IPA A;  2KP6 A;  1GHC A;  3QQA A;  1GVJ A;  2KDZ A;  1W7P D;  2EZI A;  4DYR A;  1D5V A;  5EGO B;  1K4S A;  2H6C A;  1BI1 A;  3LA2 A;  4XLN F;  2RNG A;  2W7N A;  4EGY A;  2ZC2 A;  1NK2 P;  4IHY A;  3GZ5 A;  1VQK I;  4L0Y B;  4DBR A;  1VQ6 I;  1K83 J;  1G4D A;  3HUG A;  3K4N A;  1YIT I;  2X9D A;  5DUI A;  1AHD P;  4Q48 A;  1Y0U A;  2M30 A;  1AKH A;  2EH3 A;  3IC7 A;  1HSJ A;  2JTV A;  3HRU A;  2X6Y A;  1XMK A;  1WJB A;  3RZD J;  1I5Z A;  1Z0X A;  3FM3 A;  3GTJ J;  5D8K B;  1D3Y A;  3F8C A;  3LST A;  1VF9 A;  2EFO A;  2BBY A;  4ESJ A;  4EM0 B;  2AO9 A;  3LWF A;  1Z77 A;  5FKO A;  4CYD A;  3OYK A;  4BE1 A;  5E1X A;  2GIV A;  3HHH A;  2G0E A;  1V3F A;  3FK7 A;  5DM7 F;  1YG2 A;  5AON A;  2VOO A;  2BW3 A;  2ISY A;  3KYD B;  3S1N J;  1P7I A;  2VE9 A;  1R71 A;  3JRI A;  3J7A Y;  1LB2 A;  1Z3X A;  1U8B A;  2EIL H;  1QHH D;  4I01 A;  4BDZ A;  4F91 B;  1F5T A;  1ETQ A;  3DWL E;  2XAH A;  2RAE A;  2R7W A;  2CUF A;  2R5Z A;  5J40 A;  3I56 I;  3A0B C;  2EIM H;  3BR6 A;  3VOE A;  3OYF A;  2DTR A;  4IEJ A;  1BIA A;  4BJ5 C;  1VQ4 I;  1YE9 A;  2FNP A;  2CUZ A;  1FYK A;  2EFQ A;  3CCE I;  3GTP J;  1QVT A;  3HYI A;  4CCN A;  2JN6 A;  2KZV A;  5CVR A;  3RTR A;  1AKH B;  4A0Y A;  1K4T A;  5LHI A;  3TMO A;  4ZYH A;  1D1C A;  5HOD A;  1SAX A;  3F8N A;  1FTT A;  5J1Y A;  2JVG A;  3OL3 A;  1PUF A;  4KNY A;  3COA C;  2OAZ A;  3ZGK A;  2E7X A;  3UNG C;  1R1U A;  3MCZ A;  4BS9 A;  2L02 A;  2LP0 A;  4DOZ A;  1HST A;  1KYW A;  2ECB A;  3A02 A;  3ERM A;  2ME6 A;  3E1S A;  2NVX J;  1UFM A;  5E3L A;  1MBF A;  2K4B A;  4HNV A;  1X2N A;  4PK4 A;  1QZZ A;  2IGM A;  2LF8 A;  4BAC A;  2E36 A;  3ML6 A;  1A31 A;  2Y69 H;  5IP9 J;  1IDY A;  2UXX A;  4HPQ A;  2VON A;  2LKS A;  2OZ6 A;  4L5I A;  4E7K A;  2DTZ A;  1GDT A;  3OY9 A;  3KP2 A;  1YX3 A;  1ZLJ A;  3TQN A;  2VJ5 A;  3QWL A;  3EDP A;  1Y1W J;  2EA4 A;  1ENH A;  2AXL A;  2W24 A;  1QZE A;  4A2U A;  4KA4 A;  4U87 A;  1DUX C;  3E6D A;  4P9U A;  4BJT A;  3TDU C;  4RAY A;  1P4W A;  5EJC A;  2FU4 A;  2WAQ A;  2V1U A;  2XRN A;  3M8J A;  1H9T A;  5B1B H;  3S16 J;  2V1N A;  5IYC J;  2XDV A;  3BC8 A;  5KAF C;  2EJR A;  4XMY A;  1Y6I A;  3H5A A;  3LOC A;  3I4P A;  1SD4 A;  4ENN A;  1KU3 A;  3S2W A;  2XAQ A;  4FIS A;  2KIS A;  3F23 A;  1DDN A;  2VIX A;  3HOZ J;  4JOM A;  2O0Y A;  3ZR8 X;  3G3Z A;  2DMU A;  2XUB A;  5FKK A;  2QYO A;  4C9Y A;  3PIO F;  3ABM H;  3DBH B;  5GAE J;  5EG0 A;  2E7W A;  5E1Z B;  1TQP A;  4JX5 A;  5D5X B;  1UCR A;  3FBI B;  3ABU A;  1VQ9 I;  1RR7 A;  2HXO A;  3OYL A;  2O61 A;  3TED A;  3WGG A;  1Y1V J;  1X3U A;  2XAF A;  3BOQ A;  4HBL A;  3CQZ J;  3GO5 A;  3KX2 A;  3NWT A;  2Y0M A;  5DD8 A;  2M8E A;  5TRD A;  3BR0 A;  2XIG A;  4XLF A;  1LNW A;  2K3P A;  3BJA A;  3OS2 A;  3AL0 C;  4EVI A;  1FOK A;  3Q9V A;  1Z3Y A;  2DMT A;  2CW8 A;  2Y9Z A;  1E17 A;  2NOJ B;  2DMP A;  5FKN A;  3BZK A;  1K7A A;  3BQY A;  1K78 B;  1T95 A;  2DT6 A;  5D6E A;  2VC0 A;  3BJO A;  3JW4 A;  3L2R A;  4AD9 A;  3CUQ A;  5HS9 A;  1DGR M;  1L0O C;  1YJ9 I;  5LD2 C;  2O7O A;  2CQK A;  2BV6 A;  4XOP A;  3WHB A;  2Z3Y A;  4MO7 A;  2V1X A;  3HBL A;  3CDI A;  4G94 A;  4XN3 A;  1FIA A;  5J8C A;  5CLS A;  4F93 B;  5E3O A;  1JJ8 C;  4EEF G;  4AUX A;  1I27 A;  2EIN H;  4RM2 A;  5F08 A;  4A0Z A;  3VWB A;  4P1W A;  3I59 A;  3BG9 A;  2UUZ A;  2MH9 A;  5K7F A;  4A6E A;  4RMN A;  2ZO4 A;  4BAY A;  2WY7 Q;  2PBI A;  4XKV A;  3BT9 A;  4HW0 A;  5B1A H;  3N05 A;  3MZ8 A;  2KPM A;  4XID A;  4H4K C;  2JUC A;  1B1B A;  4IKF A;  2LG4 A;  1IUF A;  2NVU B;  3BCA A;  1OCT C;  3OIO A;  3JCU C;  4PGG A;  1JI8 A;  2CQ7 A;  5K5R A;  2COM A;  5IOY A;  3LAJ A;  1IN5 A;  2ADU A;  1KYZ A;  2L0K A;  3S3M A;  2VJJ A;  3GEZ A;  1PP7 U;  4IHT A;  4F3Q A;  4D7N A;  2OF7 A;  5EZG A;  3VYS B;  2VC1 A;  3I64 A;  4C3J J;  3JTG A;  1YJW I;  5FRN A;  2CW7 A;  5IOZ A;  2DPU A;  1A5J A;  2JSC A;  1H0M A;  5DDG A;  2XSJ C;  3O8H A;  1QPM A;  4M9X A;  4XLP F;  2XVC A;  2KL4 A;  4ESB A;  1APL C;  5E18 F;  4UXN A;  1L3L A;  2VQL A;  2AHQ A;  3RKY A;  4OIR F;  3WTT C;  4JYK A;  2AXT C;  4KIT B;  3CCL I;  3BWG A;  3GME A;  3JRH A;  4PZJ A;  4XRS A;  1H9G A;  3TGN A;  1IN8 A;  4C30 A;  5DS9 A;  2C6Y A;  3V7C A;  2IBD A;  5ICC A;  5IT9 Z;  1Q1H A;  2HGC A;  1ZKG A;  2Z2S B;  3ASN H;  2ZJR F;  1YQA A;  2CQQ A;  4UUS B;  4G7Z F;  3CJT B;  1ZR4 A;  1RPW A;  4BQO A;  1O3Q A;  3LSG A;  2RRE A;  2QSH X;  4G6D A;  2BY2 A;  3WHC A;  3CC2 I;  3BZC A;  1BC8 C;  4V2F A;  1Z05 A;  4E6K G;  4B3A A;  2CV2 A;  3CF5 F;  2K86 A;  2GM4 A;  1O3T A;  2VBY A;  4XLC A;  4K2E A;  4LK0 F;  1S7O A;  3OV8 A;  1CF7 A;  1VND A;  2W82 A;  3RJP A;  1B6A A;  5ERI A;  2G7U A;  2QLZ A;  4E7Z A;  3E97 A;  5H6R A;  3C18 A;  4PUS A;  2GBY A;  2VN2 A;  1F1Z A;  2IEK A;  2ESH A;  2LMD A;  4Y17 A;  2YR2 A;  4AVP A;  1JJ6 C;  1VZ0 A;  1I1S A;  1ZQ3 P;  1NH3 A;  5E3N A;  1OMI A;  4IVN A;  3R60 A;  4UVC A;  4YFX F;  1ETO A;  2OCC H;  5HDK A;  4ENK A;  2JA6 J;  4FX0 A;  2QKL B;  3HB9 A;  2KJB A;  2EQR A;  3EET A;  2MAB A;  5F27 A;  2GA2 A;  3RYP A;  3M07 A;  1ON2 A;  1UST A;  4N9H A;  2ZB9 A;  3QPL A;  1UMQ A;  2I5U A;  3GFM A;  3CCS I;  2PMZ N;  3FF5 A;  1E3H A;  4WCG A;  2CQX A;  2PLY A;  1SD5 A;  2EFP A;  1EKE A;  4M3G A;  4BGD A;  1W5T A;  1NTC A;  4F92 B;  1T98 A;  3CDL A;  1E2X A;  2GA1 A;  4QSH A;  2DU9 A;  3PNV A;  1XB4 A;  1JUM A;  3TP0 A;  2PQ8 A;  1HF0 A;  1ETW A;  1WJC A;  3DEE A;  4ZZL A;  4LB6 B;  2VKD A;  2E1C A;  3DLA A;  3OWT A;  1I3Q J;  1R58 A;  2ZNY A;  4D9J A;  1LE8 A;  3HTU A;  5DM6 F;  4XOR A;  2XSD C;  2FD5 A;  1RUN A;  2QEX I;  4EV0 A;  1WJA A;  3HOW J;  2L7M P;  3K69 A;  2TDX A;  3CUQ C;  2QQB A;  2KZG A;  1POG A;  4C2T A;  1A35 A;  2IGK A;  3ZCO A;  3WU1 B;  5BMZ A;  3FMQ A;  1ZG3 A;  2NNN A;  4QPO A;  2CMP A;  2NS0 A;  1V4R A;  3MAJ A;  1Y0N A;  1IV6 A;  2EB7 A;  3VYT B;  1HCR A;  3GZN B;  1XG1 A;  3ZP5 A;  2AQE A;  3ZMS A;  3LSM A;  5H20 A;  3QOP A;  2E2J J;  2HZT A;  3P9C A;  3IWF A;  3RQI A;  1W0T A;  1TBX A;  2DK5 A;  1O3R A;  3AG2 H;  1PDN C;  3TW6 A;  1KQ8 A;  3K9T A;  1BC7 C;  1V5F A;  3FXJ A;  5DCM B;  3CJR B;  3O6B B;  3SEQ A;  2X1D A;  1ORK A;  2I8D A;  2DCE A;  2M1B A;  1C0W A;  2IS4 A;  3JSO A;  3A01 A;  2LC2 A;  1HXD A;  2WB1 A;  3VPR A;  4ASN A;  1EJ9 A;  2FXA A;  2N8G A;  2X48 A;  1BN5 A;  3H9J A;  1ZGW A;  1Z6T A;  4HNT A;  1HDD C;  4RGS A;  3HTS B;  1YJN I;  4XNF A;  2GQQ A;  4G7H F;  4ZYE A;  4S05 A;  1J2X A;  3IHU A;  2EK5 A;  5ILV A;  5GPC A;  3CMM A;  2DT5 A;  3BTJ A;  2W1O A;  1OFC X;  3Q0U A;  4UV9 A;  4ZDP A;  2WC2 A;  3OYC A;  1YS7 A;  4YII A;  3K6G A;  4KIF A;  2HTS A;  2A6H F;  2E35 A;  3QP6 A;  1IRF A;  4LIU A;  2V1D A;  2H8W A;  1R4M B;  1ITY A;  3DU5 A;  1HOM A;  1VQP I;  1JE8 A;  5FO5 A;  3CMA I;  2ZXJ A;  3C1D A;  2DJI A;  1BJA A;  3R4K A;  3HXL A;  3V8K A;  1GLN A;  4KMF A;  5HDN A;  2GZW A;  2LOO A;  4DZP A;  2A68 F;  2IT0 A;  1V55 H;  2R7X A;  2R7O A;  1MBG A;  3CCY A;  3VOD A;  3JRB A;  2L3D A;  3OMY A;  5HLT A;  1K6O A;  2CUJ A;  2RDP A;  3GW2 A;  5LGU A;  4WX9 A;  2IGN A;  2VXZ A;  3E3V A;  2HS5 A;  4II3 A;  4IZZ A;  2EPF A;  3IV5 A;  3NWS A;  3OYD A;  2XPV A;  3HSE A;  3S2H J;  1P4X A;  3ESW B;  5HNF A;  4ON0 A;  2EA2 A;  3KYC B;  3WE3 A;  3ZQG A;  5KNL A;  1FJL A;  3ECH A;  3EQL F;  4L9J A;  3D5R C;  4XON A;  1MKM A;  5L3F A;  3MZY A;  1SEU A;  2IA0 A;  1QU3 A;  4ETS A;  5EGO A;  1JKO C;  3E5X A;  1BJZ A;  4DIQ A;  2IGO A;  1DPU A;  3AFH A;  3F8B A;  5E20 A;  3SFI A;  2ELK A;  1QVU A;  3VYU B;  4R8H A;  1GV2 A;  4BKX A;  3ELK A;  3JAM Z;  1T08 B;  4Y33 A;  4CCO A;  3HSF A;  2CV1 A;  2P5K A;  1MZB A;  4KUM A;  4HF1 A;  4UUV A;  4IQ4 A;  3HPG A;  3LA7 A;  2K3F A;  3S3N A;  2G7H A;  1D0Z A;  5IYD J;  5FKM A;  1MJB A;  4EJV A;  2L4A A;  1D1A A;  2A5W A;  4J19 A;  1IDZ A;  5IT3 A;  2KKO A;  1X3W B;  4CA0 A;  4Z6Y A;  4BDY A;  2VE8 A;  1MSF C;  1SAN A;  1KU9 A;  2RGV A;  3I0T A;  4RLQ A;  1YRN A;  1V5E A;  4E7J A;  1N25 A;  3ASO H;  5M3F J;  1F36 A;  1YW9 A;  3OIQ A;  3HJE A;  2QQ9 A;  5FB2 A;  2X6X A;  3LQQ A;  1O57 A;  3ZQI A;  5LEK A;  3GCM A;  2XB5 A;  4G9Y A;  1O7L A;  2LDU A;  4QLC U;  2HOT A;  2M4K A;  1E3O C;  3MZH A;  3F6V A;  1FT9 A;  4XRF A;  3HM5 A;  1OCC H;  3G6E I;  2A69 F;  2E34 A;  1NG6 A;  1FBU A;  2DA6 A;  4FE4 A;  1G2H A;  2HDW A;  3HZJ A;  1IV8 A;  4I7H A;  1TZL A;  1YLF A;  3BDD A;  4PDK A;  4LGW A;  2H09 A;  3WU2 C;  2H94 A;  1FWZ A;  3TBI A;  5GAG J;  3BY6 A;  4S0H B;  1W4M A;  2JJ7 A;  4RB0 A;  1WQ2 A;  5CVV A;  1KGS A;  3HIF A;  5EDN A;  1B72 B;  3KLO A;  4ANJ A;  1TWA J;  4WXH A;  1XD7 A;  3RI4 A;  4LLL A;  3TP3 A;  2K27 A;  5L3G A;  1FZP B;  2HEO A;  3BP8 A;  4V2G A;  2NXN B;  3KEQ A;  4GXO A;  3BRO A;  1SVO A;  4MIM A;  4UB6 C;  5CJ9 A;  3T8T A;  3VSK A;  4CDG A;  2VJ4 A;  1E0E A;  3DPL C;  4NUB A;  3SXY A;  4DNC A;  3CME I;  3CF2 A;  4BEH B;  5JLW A;  2E5Z A;  2MG4 A;  4GYG A;  3GTO J;  4BL0 B;  3WE2 A;  3MVP A;  2FEZ A;  1KZH A;  4HEA 2;  3W2V A;  3OYJ A;  2VBZ A;  3TL4 X;  3L2W A;  1AOY A;  2D1V A;  2WAQ N;  1SMT A;  3DTE A;  2FOW A;  1MMS A;  2W25 A;  3G1L A;  1GT0 C;  1ZRE A;  2K5C A;  1R5H A;  3M4O J;  4KN7 X;  1W5S A;  4CGZ A;  2Z16 A;  1JGS A;  1O7F A;  3I58 A;  3HEF A;  3LSR A;  5F0C A;  1TP4 A;  1CQT A;  1TNS A;  1BW6 A;  3TOB A;  3P9I A;  2O8K A;  4XOT A;  4IRG A;  4ABZ A;  1MJA A;  5ILS A;  2HYG D;  4DYC A;  3MKY B;  1MMD A;  2LKX A;  3K70 C;  2HYF A;  4BNC A;  3B73 A;  3WTS C;  4AIH A;  3K2Z A;  4DZJ A;  1BI3 A;  4F7Z A;  4C2M J;  5EZH A;  3DEW A;  5E3M A;  4A12 A;  2P4W A;  3S15 J;  1WFX A;  2FA5 A;  3QRF F;  1OYW A;  2KIM A;  2ZJ2 A;  5JHF A;  3WGH A;  4L18 B;  1FY7 A;  5BOX A;  2HOA A;  3K4K A;  4JK1 X;  1MBK A;  5D5V B;  2CO5 A;  4A3L J;  4JP0 A;  2LRE A;  4HYE A;  1G59 A;  3K4M A;  2JA2 A;  3M1C A;  1RR8 C;  2HKX A;  4G6Q A;  3CD6 I;  1FP1 D;  4YEJ A;  3VYR B;  3T8R A;  2FSW A;  3WG7 H;  4D5C A;  3M8E A;  3WU0 A;  2E1O A;  2YX7 A;  4YFN F;  2DW4 A;  2V9V A;  2CH0 A;  4XIC A;  4ENM A;  1A04 A;  4LG0 A;  1QGP A;  1I3A A;  2A3S A;  2Q8K A;  3L00 A;  1X1A A;  4MEX F;  1MH3 A;  3PUF A;  3SZG A;  2CYY A;  2KIF A;  4M73 A;  2V7F A;  1XSD A;  1BBY A;  3GF2 A;  3FHZ A;  3F8M A;  9ANT A;  3ABL H;  1D0X A;  3G71 I;  1ULY A;  2WY8 Q;  4RDU A;  2JK3 A;  1VFC A;  2FX0 A;  4G8X A;  2FJ1 A;  1YTY A;  5KVR A;  3U9G A;  3EYI A;  1G8X A;  3QPS A;  1VQ8 I;  4M3E A;  4IO9 F;  3K1M A;  3OOP A;  1TC3 C;  1DQU A;  1V5G A;  3IH4 A;  5D6F A;  5J6X A;  5EF6 A;  2WAD A;  5HOO A;  4KT6 A;  4C3I J;  5KAI C;  2BZT A;  1VI0 A;  3S2D J;  4O6J A;  5J47 A;  3S32 A;  3FXQ A;  2VB6 A;  3GLL A;  3EPZ A;  2HOE A;  1FMW A;  2ZJP F;  5CPR B;  2OD5 A;  2ISZ A;  3C7J A;  3MKZ A;  1ONV A;  1RIO H;  1WJ5 A;  4IHV A;  3BR3 A;  2XAS A;  4A6D A;  5KCM A;  2FBH A;  3DLL F;  5CKT A;  2B9S A;  4S04 A;  3DBR B;  5GTH C;  3WOD F;  4LG3 A;  2Z99 A;  5EEH A;  1JUP A;  4UY8 I;  4U7D A;  2MLK A;  1B9M A;  1ZG1 A;  4XSX F;  4J01 A;  2L9N A;  2QM3 A;  1VQO I;  1X3Z B;  1RES A;  4M3B A;  2FRH A;  1H89 C;  2W4S A;  1S5L C;  4RAZ A;  2M34 A;  1S3J A;  3DFG A;  5JFR A;  1D1B A;  2KRF A;  1LEB A;  2UXN A;  3RSN A;  3J81 Z;  2HOS A;  5BPI A;  4X0G A;  4ZTF A;  3FBN B;  3E6M A;  3VEP A;  4AU7 A;  2JPC A;  2QF7 A;  2H6B A;  4MHG A;  4LLG F;  1MND A;  2KFD A;  2DN0 A;  3LSH A;  2VUM J;  4A3K J;  2ESN A;  1USS A;  2P5V A;  3IP4 B;  2CGP A;  2PJP A;  4BBR J;  2B63 J;  1XCV A;  1UB9 A;  5CQE A;  2O3F A;  3GYH X;  5GTI C;  3A2K A;  1LKX A;  5BNG A;  1EH7 A;  4BXU A;  1JXS A;  2L7F P;  5C44 J;  2E60 A;  3HOV J;  3HHG A;  1MJ9 A;  1BR2 A;  1U9O A;  3QP5 A;  1LE8 B;  2ICW G;  2DFF A;  1DP7 P;  1ERD A;  2DT7 B;  4V19 K;  2K85 A;  3S1Q J;  2OA4 A;  2Y9Y A;  3I5U A;  1G6N A;  1RKW A;  4B44 A;  1IG7 A;  4LJZ F;  1JHH A;  1W36 C;  1EF4 A;  2QEN A;  2A5Y B;  4O5V A;  2HXI A;  2FE3 A;  4W97 A;  3PM1 A;  1ETK A;  1XC5 A;  1TQI A;  3VSL A;  5M5W J;  3R0J A;  1VQL I;  3E7L A;  1MIJ A;  3JRE A;  1WJE A;  2W84 A;  1SAU A;  4RAG A;  2HPM A;  4WXC A;  5LHG A;  4D5F A;  1YO5 C;  1T56 A;  1N75 A;  2XGD A;  5C4J J;  4BHB A;  4ENJ A;  2AS5 F;  4GFB A;  3BG3 A;  5A2Q K;  2BOL A;  3V8L A;  1XX5 A;  4GCV A;  5C4X J;  1FX7 A;  1PJR A;  3BJ6 A;  3ULQ B;  4WF2 A;  4F55 A;  1D8K A;  4WXD A;  3CZ6 A;  4JQF A;  4FQG A;  2R7D A;  3CLO A;  4HV5 A;  1K79 A;  3J7A O;  2BYV E;  3C2B A;  3GX4 X;  3V8J A;  2F4M B;  1P2F A;  3IKT A;  4NDL A;  5JVT A;  2L54 A;  5K7H A;  2CQN A;  2O03 A;  4BH9 A;  2XGX A;  2EFN A;  1MBH A;  4MNU A;  2Z1D A;  3HOT A;  1B8I B;  4G12 A;  2R7R A;  1IW7 F;  1I50 J;  5LGT A;  1VQN I;  4CCM A;  1OCP A;  3BG5 A;  4X6A J;  2HQA A;  2IAI A;  2B7E A;  2NVT J;  4BQQ A;  3NRV A;  4XBF A;  2DPD A;  4EM1 A;  2R4G A;  3KZI C;  3K4J A;  4HF2 A;  1JKQ C;  3V7S A;  1Y56 A;  3W6J B;  2BE5 F;  3ZMU A;  1YX5 A;  3L2Q A;  4DYQ A;  5FFZ A;  2DYS H;  2VL8 A;  2F6C A;  1U0J A;  4HF0 A;  1OCZ H;  3NAR A;  1SVM A;  4M9Z A;  4U0W A;  3V42 A;  2EFW A;  1SFO J;  3FIW A;  4OMY A;  1VQ7 I;  3MQ0 A;  2FQ4 A;  3ZXS A;  2F5D A;  1GVD A;  1MBJ A;  1Z91 A;  3BR2 A;  2VOP A;  3RKW A;  1W0U A;  3RIR A;  2G9W A;  3NQO A;  1LVA A;  2ZSH B;  4A93 J;  4Q47 A;  4XN0 A;  5EEG A;  5F64 A;  2P6S A;  1TW2 A;  3DKY A;  2L2O A;  3Q9S A;  1OCR H;  3JRA A;  2DOF A;  3RZO J;  2CFX A;  2Y0S N;  1JHF A;  3U21 A;  2UWM A;  4U7B A;  4YIR X;  3NEU A;  3OSG A;  3I4N J;  3PNY A;  2X1C A;  4FE7 A;  1EH6 A;  1WKM A;  4DJA A;  5JVG F;  3EUH A;  3L09 A;  4D7M A;  2PG4 A;  1J59 A;  3LSK A;  1AA7 A;  2GLO A;  3JR9 A;  1GXQ A;  1R1V A;  1B72 A;  1OYI A;  1YOV B;  3CCM I;  1VQM I;  1P4A A;  3FM5 A;  5H6Q A;  3MMY B;  4CCK A;  1LUJ B;  4RB1 A;  3JSP A;  2F5F A;  3ZPL A;  5GAH J;  3WTV C;  3V7R A;  3BTL A;  5D4S A;  1P9Q C;  2WB1 N;  1OCO H;  1XDS A;  3SDB A;  2M9H A;  4ZJZ A;  4HZF A;  4PSX A;  5E79 C;  1EV7 A;  1OLT A;  2DYR H;  2EZK A;  3H5N A;  3CCV I;  1P92 A;  3D0S A;  3PQK A;  3J7Z I;  3CCJ I;  3IL2 A;  1A6Q A;  3FMS A;  4M6V A;  1R49 A;  4I6Z A;  5CVU A;  2R7S A;  1DU0 A;  1W7P B;  2W48 A;  2DDA A;  4ZDL A;  2JA5 J;  3E0J B;  1PUF B;  1U6G A;  1WJD A;  3TO9 A;  4YRV A;  1ACI A;  1WHU A;  2DAO A;  3BPX A;  1IUY A;  1BR1 A;  3HOY J;  4Y52 J;  2GOM A;  2KIQ A;  3F72 A;  3GTK J;  3SEZ A;  4AYB A;  4A3M J;  2M0C A;  1X1P A;  3IAS 2;  3B6A A;  3LSI A;  2CFO A;  4KIC A;  4IOA F;  2MD0 A;  2DI3 A;  4XLH A;  2VLA A;  1BOB A;  2ZCW A;  3PO2 J;  3L2C A;  1MW7 A;  1A36 A;  2F5V A;  4HX4 A;  4AC0 A;  4I76 A;  4PFP A;  2DA3 A;  2EIJ H;  3QAH A;  5CVJ A;  2RVC A;  4IF4 A;  5IP7 J;  2FF4 A;  3KEO A;  4U0V A;  3H3U A;  4R1H A;  3HG9 A;  3S8P A;  4LD5 A;  4UUT A;  5LRS A;  1IAW A;  2WAF A;  1HW2 A;  4OIP F;  2DOA A;  3CUQ B;  2R5Y B;  1T6S A;  1JTX A;  2WTE A;  4M9S A;  3GZ6 A;  1WWX A;  4N4O B;  3SFZ A;  3KP6 A;  3E6B A;  2YSR A;  2Y75 A;  2IS1 A;  3IH3 A;  5JHU A;  2FBK A;  5GP9 A;  2OTL I;  3F6O A;  3DXJ F;  4RM3 A;  3WTX C;  3KPH A;  3AKZ A;  1LQ1 A;  2ME0 A;  3DKW A;  4JBA A;  3I59 B;  2O8X A;  2Z5U A;  2QCO A;  5FD6 A;  3AAF A;  2IJL A;  2QWW A;  4NC7 A;  2HDC A;  2VKH A;  5CYV A;  1TWG J;  1PVE A;  1O3S A;  3KZZ A;  2WAE A;  1KU7 A;  4HX8 A;  1R4N B;  3VB2 A;  2L01 A;  5C3E J;  3KLN A;  3SDG A;  3A4C A;  5AIQ A;  3S93 A;  4OAZ A;  3ZQH A;  3E6C C;  2QQ8 A;  4HSR A;  4CUG A;  1XCB A;  4O3M A;  2FNA A;  2VQG A;  1AWC A;  2QBY B;  1OR7 C;  4UHT A;  3G73 A;  2K9L A;  1RZ4 A;  2DFE A;  3KFW X;  1BW5 A;  3BTI A;  3KET A;  2MGQ A;  4IHW A;  1J0R A;  4IPA A;  2K9M A;  1B59 A;  5LRR A;  4HQM A;  1RKT A;  3UR3 C;  3S3O A;  4BBS J;  2P6T A;  2VQH A;  1KU2 A;  2DA2 A;  3FXR A;  3F9K A;  2OZU A;  1D0Y A;  2EIK H;  3MKL A;  1QO0 D;  1RI7 A;  1R6R A;  1ZTR A;  3RKQ A;  2IRF G;  1R1T A;  1XMA A;  3IWZ A;  4XLE A;  5F04 A;  5J4Y A;  3J7Y J;  4HST A;  3JRC A;  2M45 A;  2NRA C;  1J7K A;  2MW8 A;  5IYB J;  5IY5 H;  1ZRD A;  3H9Q A;  4LIV A;  4P5O A;  4YFK F;  1JTY A;  1HKS A;  2KJC A;  3ZQQ A;  2COB A;  1FSH A;  2F4O B;  2JRT A;  3RCO A;  3MFK A;  1UEL B;  3N4M A;  2ID3 A;  4H0E A;  4JX6 A;  5M5X J;  1BI2 A;  2FOK A;  2ZKZ A;  4KT5 C;  4LG0 B;  5GPA A;  4CO8 A;  3C2H A;  3MD2 A;  4N4N B;  3GFJ A;  3H0G J;  4ZYA A;  3W2W A;  4BQN A;  5HS8 A;  2KRH A;  3TO7 A;  2JPB A;  3CP8 A;  3R6S A;  3SQN A;  5HNH A;  2E5N A;  4PJJ A;  3A0H C;  5TIS C;  5E1W A;  4IHX A;  2LRD A;  4ZH4 F;  4EJU A;  4A3G J;  1IC8 A;  4HNU A;  1F4K A;  3DQV C;  4C3H J;  2X0L A;  2OUM A;  2BVM A;  1BL0 A;  2IA2 A;  1R36 A;  1T8I A;  2VAS A;  1DU6 A;  4LFU A;  3NAU A;  4ZDO A;  2RN7 A;  4EM2 A;  1MNM C;  3ZMT A;  4KYW A;  1B4A A;  1PYV A;  2DFI A;  3P7N A;  3OL4 A;  1J75 A;  5K5O A;  2FUG 2;  2CU7 A;  2X51 A;  4EAT A;  4RB3 C;  1LEA A;  1BOA A;  1XN7 A;  4GRI A;  2E71 A;  3ABT A;  1ON1 A;  3Q0V A;  4I2O A;  3EUA A;  4DW6 A;  4N9I A;  2D5V A;  2XAJ A;  2BVL A;  2R5Z B;  4ZZD A;  5L3C A;  1HBX G;  2V4J C;  3H0D A;  2XB0 X;  5E8I A;  2GXA A;  5FGM A;  3OYB A;  1FP2 A;  3H3Z A;  3ZMV A;  4YIF A;  2WWY A;  1U8R A;  1Y8Q B;  1LDJ A;  5ED4 A;  4HLY A;  2IW5 A;  1U3E M;  2NS7 A;  4E4H A;  4RGX A;  3VFZ A;  5HVQ C;  1WRJ A;  2ZNZ A;  4I02 A;  2IS2 A;  4BQA A;  2JA7 J;  1Z6R A;  1K61 A;  3HUG B;  1Q1V A;  2MLG A;  2KDO A;  3W2A A;  6PAX A;  2L5Q A;  2IPQ X;  1P6R A;  2IP2 A;  2KT0 A;  3GXO A;  5DUK A;  4AIJ A;  1DP3 A;  2OU2 A;  3QOD A;  2XAG A;  4OU0 A;  1J9I A;  2HFH A;  3HKZ A;  2LY2 A;  2ZJQ F;  4EJT A;  2V9P A;  3DBL B;  3K1P A;  4JX4 A;  2M3A A;  4BJ6 C;  1ZN2 A;  1TNT A;  1JT6 A;  3GWZ A;  1J09 A;  2PMZ A;  1RC9 A;  3PFI A;  4MQV A;  3SZP A;  3B6C A;  2ZFW A;  5LBQ A;  2RC4 A;  1ZHF A;  3SYT A;  4HAM A;  4OIO F;  3PO3 J;  3CJQ B;  4BHC A;  1B8I A;  3K0L A;  1VTN C;  2JWT A;  1N77 A;  5A2Q Z;  1OKR A;  4XRS G;  3TOA A;  2R7U A;  4PJL A;  3Q3S A;  4I99 C;  1LFP A;  2VKV A;  2V6C A;  1YW8 A;  3A01 B;  2EZH A;  4IRI A;  2QKM B;  3HSR A;  2O9L A;  2IS6 A;  1KON A;  2CRG A;  3CMY A;  1UJ8 A;  2X6O A;  1W36 D; 
#chains in the Genus database with same CATH homology
 4V19 K;  3G6E I;  3G4S I;  2OTL I;  2E34 A;  3PIO F;  5GAE J;  1VQK I;  3CF5 F;  1QA6 A;  5DM6 F;  1YI2 I;  3PIP F;  1VQ4 I;  1ACI A;  2QEX I;  4UY8 I;  3CCM I;  1VQM I;  3CCL I;  1Y39 A;  3CCE I;  1YHQ I;  5DM7 F;  3CCU I;  1VQ6 I;  1FOY A;  2E36 A;  5GAD J;  4IOC F;  3CCR I;  1VQ9 I;  3G71 I;  1HC8 A;  2ZJP F;  5GAG J;  1YIT I;  1S72 I;  2FOW A;  5GAH J;  1MMS A;  2E35 A;  1VQ5 I;  3CCS I;  2JQ7 A;  1VQO I;  2OTJ I;  2H8W A;  1YJW I;  2QA4 I;  2ZJQ F;  2ZJR F;  1VQP I;  1VQL I;  1FOW A;  3CMA I;  3CJT B;  3CC7 I;  3CD6 I;  4IOA F;  3CC4 I;  1VQ8 I;  1YIJ I;  4IO9 F;  2NXN B;  3CCV I;  1VQN I;  3J7Z I;  3CC2 I;  2K3F A;  3I55 I;  3I56 I;  3CCJ I;  1YJ9 I;  1YJN I;  3CCQ I;  5JVG F;  1FOX A;  3CME I;  1VQ7 I;  3DLL F;  3J7Y J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...