3CCRI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccrI00
3CCUI 1FOXA 3CF5F 3CCLI 3G4SI 3CCJI 1MMSA 1YJNI 3CC4I 3I56I 1VQ8I 4UY8I 1YIJI 5GAGJ 2ZJQF 3CCRI 2QA4I 1VQPI 2ZJRF 3G6EI 2FOWA 3CC2I 3CCQI 3CCMI 4V19K 2E34A 1S72I 1VQ7I 1VQ9I 2JQ7A 1Y39A 5GAHJ 3CMAI 2E35A 2H8WA 2OTLI 3I55I 2ZJPF 1FOYA 3CMEI 3G71I 2QEXI 3J7YJ 1VQ4I 1YI2I 3CC7I 1HC8A 5DM7F 3CJTB 5GADJ 1QA6A 2E36A 3CCSI 4IOAF 5JVGF 3PIOF 1ACIA 1VQNI 3PIPF 1VQLI 1VQ5I 3CCVI 1YHQI 3CCEI 4IO9F 1VQOI 3J7ZI 2OTJI 1VQKI 1YITI 4IOCF 3CD6I 2NXNB 1YJ9I 1FOWA 3DLLF 1YJWI 1VQ6I 5DM6F 2K3FA 5GAEJ 1VQMI
chains in the Genus database with same CATH superfamily
1YG2A 4KICA 5BS6A 2YX4A 2WC2A 1MMDA 3KP5A 1LDJA 4EGZA 2DJNA 3S1QJ 4PSWA 3DEUA 1HW2A 3F8CA 1D1CA 2MW8A 2Z5UA 3RTRA 2OD5A 2COBA 3I56I 1D0ZA 2O8KA 2H6CA 2BW3B 1Z05A 3PUBA 1TP4A 4IJAA 5B1AH 3BR6A 3JRHA 3L1PA 2FF4A 2V7FA 3BJOA 2BEOA 3LSHA 3OYAA 2IGNA 1HA8A 1JUSA 3GFLA 2BXZA 3UR3C 1OCPA 3ZGKA 5EGOB 1TW3A 3ZP5A 3ML6A 4IRGA 1UAAA 4HNUA 1XCBA 1LNWA 5GAHJ 4XKBA 1ENHA 1EH8A 2VODA 2LYCA 1HSJA 1REPC 3R0AA 2ELHA 1Z6TA 5ILVA 3TOAA 3DTEA 1FOYA 2VXZA 3CMEI 3BR3A 3RSNA 2KIUA 3K69A 4BJTA 2JRMA 3BOQA 2K9LA 4F92B 5FKMA 4NC6A 5KAFC 1LUJB 1R23A 1R36A 1X2MA 3F22A 3CC7I 1X1BA 1Z6RA 3CZ6A 4CCOA 1RZ4A 3AAFA 1U8RA 2HYGD 3PIOF 3DEWA 2EV0A 2LSOA 1BC7C 2GXAA 1IRXA 5TISC 5D5XB 1SFKA 4IQJA 5LHGA 4Q4ZF 3M07A 1K79A 4B47A 2A6HF 2KL4A 3QU3A 3H3UA 5FRMA 3RKQA 1UELB 2GA2A 4EMSA 1KA8A 3FM5A 2O8XA 1IN5A 2L3DA 4IOCF 1IGNA 3SXYA 1OCTC 2EB7A 3CD6I 2HTJA 1IG7A 5L3DA 5EJCA 2JA6J 3TOBA 1XD7A 2HKXA 1W36D 1U9OA 3TL4X 4CCMA 3ABMH 1RRJA 2EV5A 2DMTA 4ESJA 4AWXB 4PCQA 3MEXA 2OJED 3CDIA 1BR2A 2ME6A 4CCKA 3QPTA 2GIZA 5DM6F 4MTEA 4E6KG 1EKEA 2CO5A 2XASA 2DW4A 1YW8A 4A0ZA 3F72A 1PVEA 2EFOA 3RZDJ 5GAEJ 2PQ8A 4S05A 4M6VA 3WTUC 1UHMA 3OYDA 3KLNA 3W2AA 1S6LA 2NS0A 5LEKA 2OQGA 3BTLA 2X1CA 2ZBKA 3L7WA 2ACJA 5ICEA 2HOSA 3FX3A 2ECCA 5CVRA 3CP8A 5LBQA 2DFEA 3ERED 3JAMZ 5EEHA 4CYCA 1X2NA 1LKXA 2GOMA 3OIOA 1K6YA 5CJ9A 2R7QA 3QYEA 4M9SA 2WV0A 1K78B 1R1TA 1P9QC 5JI6A 1TQPA 1POGA 2EINH 3ECHA 3MKZA 4BACA 3TGNA 4CCLA 3VSKA 2ZNYA 1YS7A 2FMYA 3FWEA 3ERMA 3OWTA 2D45A 1J75A 2JQ7A 4BL0B 1JXSA 2M3AA 3Q0UA 3QWLA 2QZ8A 4BH9A 5L3GA 2YSRA 3QP6A 4L5IA 3PNTA 1Y1WJ 4IRHA 1ZREA 2VXDA 1BN5A 1TW2A 2OTLI 3W6KB 1HDPA 2VJJA 2RQPA 5DCMA 3OY9A 4M6YA 4XK4A 5FLVA 4C3HJ 2CUJA 2BVMA 4WXHA 5DV5A 3FHZA 1AA7A 2JVHA 3KPHA 5ICFA 3BZKA 1FNNA 4C2TA 2MG4A 4Z6YA 3FXLA 2DXIA 2CV2A 4PFOA 1G3SA 1W0UA 1OJLA 2QF7A 3JTHA 2EK5A 1DPRA 1G4DA 1B8IB 3GTOJ 2P6TA 3ABUA 1XTAA 4HA8A 3RKWA 3D5SC 1MNMC 5HLGA 1W1WE 4RGXA 5K5OA 3K70C 4KMFA 1USTA 3NAUA 1P6RA 4ESFA 2LY2A 1WSUA 2JRTA 1VTNC 1XDSA 4HDVA 3FMRA 1ETOA 5FJ8J 1T33A 1GLNA 2G9WA 5HS7A 5KVRA 3PSFA 2ZSIB 5K7ZA 1A35A 3PFYA 4HG2A 5E3NA 5B1BH 1X1CA 4JYKA 1MBGA 3MQ0A 3TW7A 3BR1A 4BEHB 2QKMB 3H0DA 3LSJA 1R4MB 1ZG3A 4D0PA 1MH4A 2JK3A 2VUMJ 3K1PA 1IC8A 2MBFA 2JPCA 5E1ZB 2HS5A 2VJ5A 3MZYA 3HG9A 5EG0A 3NRVA 2QQ9A 3DBRB 2P8TA 3FDYA 1B9NA 1G3YA 2HQ5A 4ZDLA 4HF2A 2Z99A 2WADA 3TW6A 2BE5F 3KZZA 4CO8A 5M5WJ 5E8GA 2CS3A 2BXYA 4KA4A 1O7LA 1KU7A 1J2XA 1RESA 1WI9A 2EWNA 2K4JA 4A5NA 3ZPLA 5B5EC 3CCYA 4QLCU 4XRSA 5HS9A 2VC1A 3CCLI 1MSFC 3S16J 1KQ9A 1MW7A 2HQAA 3BZCA 3OYLA 2DN0A 4M9ZA 3HEFA 4LK1F 4IL6C 3OYGA 1X3WB 1GXQA 2KP6A 2ZNZA 3IL2A 3HHGA 3F6VA 3TO6A 5L3FA 1T08B 4U7DA 2VKHA 2RQQA 3S14J 2VE9A 3CJNA 4XN0A 3ZMDA 3VYTB 1DP3A 2ZXIA 2DJIA 2A05A 5GPAA 2CJJA 3MCZA 3QPSA 4FX0A 1TWAJ 3VPRA 3RYPA 3DU5A 4U0VA 3WGIA 3CC2I 1ZLJA 5HNFA 3K4KA 1BI2A 5F1RA 2I8DA 3IWZA 3AL0B 1VFCA 2JA2A 3D5RC 3E1SA 2N8GA 2CH0A 2V9PA 1A04A 1JTXA 3V8KA 1FTZA 1JI8A 1JT6A 3CMAI 4A6DA 5F0HA 1XSDA 2HQRA 5H6RA 3SEQA 2DMPA 2MC4A 5HNHA 5AONA 3BG9A 3TO7A 2ZJPF 3AL0C 2VQCA 1R9TJ 2WB1A 4DYCA 1LE8A 4Y52J 3GTQJ 3BZ6A 1BC8C 1YS6A 4M72A 2YS9A 1YI2I 1NH3A 2P6SA 2W4SA 1U5TB 3FXMA 1VZ0A 2HKOA 4LJZF 3WU2C 5DM7F 1XMKA 1LVAA 3E0JB 4AM3A 3CCSI 1OQYA 1JT0A 1SEUA 2PMZA 5DS9A 1MMNA 3CJQB 3JW4A 1U5TC 4IHTA 1MBJA 2V1UA 1FMVA 3LA2A 4S0HB 1IZ1A 2KRCA 2LP0A 4LB5A 2X4HA 4NQWA 1MJAA 2BVLA 3VYSB 1XMAA 3DPUA 2EZKA 5B66C 1YX3A 2DYRH 4FX4A 1LFUP 3TP0A 4YIRX 5CPRB 2BZTA 1ZRFA 2KT0A 4XOTA 2XRLA 1S9HA 4K2EA 2CQ7A 3G1OA 4UHTA 1I5ZA 4XRSG 4FQGA 4CSWA 3IV5A 3DBLB 1RR8C 2F4MB 5DD8A 2IGOA 1CGPA 1VQMI 5EZGA 5BOXA 4XORA 2VKVA 1QZZA 1Z3XA 1QHHD 2CQNA 5TGTA 1TWFJ 4RB3C 4OWRB 4RAYA 2D5VA 1G3WA 3BCBA 3T8TA 5LGUA 2PJPA 3AG1H 4A3GJ 1BJZA 1T39A 4OU0A 1GDTA 4U0WA 2QENA 1QO0D 2CUEA 4GGGA 2HEOA 2HDDA 4BY7J 1MGTA 3I4NJ 4IEJA 1WRJA 4L9TA 4KDPA 2PBIA 3J81K 3DBHB 2Z9OA 2LF7A 4MO7A 2HU9A 1VQPI 3RQIA 1BBYA 2L9VA 5H20A 1UB9A 4I02A 3G6EI 3DKXA 3RDIA 2PJRB 3HOZJ 3BROA 3GBGA 2EIKH 3G2BA 1FSHA 2KZVA 3I0TA 3C7JA 2F2EA 2EA4A 1OR7C 3OYJA 3LFKA 3K4NA 2H8WA 1BJAA 2WA0A 4TV7A 2KJCA 5BNGA 4XRMA 2K5CA 2HXIA 1WJDA 1AKHB 2K27A 2XB5A 1ZGJA 3AFHA 2MFZA 3DKYA 1Y0UA 3BG5A 3HUGB 4ENNA 3IKVA 5GTIC 3J7YJ 2XAGA 2KMUA 3OSGA 4L9NA 2ZMEB 4M3FA 4MEXF 2XF5A 1LE8B 3BTJA 4XLAA 3HL2A 3N97A 2DCEA 2DQRA 2HPMA 3ABTA 3FK7A 1FY7A 1FLIA 2I10A 1G6NA 2Z2SB 1VQ5I 3PO2J 2ZMEC 1RKWA 4KT6A 3CO6C 1JHHA 2P81A 4RAZA 5L3BA 1EA3A 3H5RA 3NWSA 2W1OA 3DQVC 1LEBA 3D5LA 2VLAA 4I2OA 2QYOA 3HSFA 5EDNA 1TTYA 1ONVA 5CVIA 5K5RA 2O61A 4LG3A 2VONA 3K2AA 2JA5J 2FXAA 2MLGA 3RPUA 5HDKA 4PFPA 2O3FA 2VQLA 3I3LA 3MD2A 2VI6A 4P5OA 3WTTC 2KQRA 2R7RA 4UVAA 2VT3A 3M8EA 3DFGA 3KP4A 4UXNA 3K7AJ 5LEJA 5AIPA 1CF7A 1NG7A 2K7LA 4WWCA 1NHAA 4RB1A 2ZFWA 3ASOH 3IAS2 4XKCA 3S3NA 4A3CJ 1JKRC 2ESNA 2KZGA 1GVJA 4UNOA 3JRAA 3A02A 2KJBA 2CMPA 2STWA 3FXUA 3H5AA 5FROA 5LRRA 2UXNA 5CKTA 4P96A 5BQTA 3CC4I 5F6FA 1XS9A 1WJBA 3Q0VA 3PNVA 1SFXA 3I4MJ 2PN6A 2E2IJ 2PMUA 3WODF 1F9NA 4EQQA 4IXAA 4XONA 2Z16A 3LFUA 4BHPA 3H9GA 5E3LA 4G6TB 5E20A 2FA5A 2DFFA 3BPVA 3L2CA 2XKPA 3VWBA 3LSMA 3U9GA 5BPIA 3FXQA 2WAFA 3KP7A 1TWCJ 1S72I 2XROA 2AO9A 3HOUJ 4UVCA 1MIJA 4C30A 3X2QH 1B1BA 3JSPA 2MGQA 3K4LA 1R00A 4MQVA 2EILH 2VN2A 3MKLA 5FKKA 2HOEA 4GXOA 5EGOA 2MH9A 2R7VA 3BCAA 3DLAA 2JUCA 2BV6A 4ENJA 5JLWA 4KYWA 1O57A 2AXLA 4PUSA 3ZMVA 4E7HA 3GZ6A 3CUQB 4BQQA 1ZHFA 4XQFA 1XMXA 4A3MJ 2IS4A 1LPQA 2LH9A 2XAQA 5B3SH 2H09A 2R5ZB 4DIQA 3F6OA 2R7TA 2ZFUA 4QIWN 1XDUA 2NVQJ 1IUYA 1BOAA 4MFDA 1IN4A 3CMYA 3K4BA 3CUQC 4NUBA 1G2HA 2L01A 2LKSA 1YYVA 3KE2A 2IEKA 1I3QJ 1B72B 2DA4A 3BG7A 2QVOA 1YO5C 2L7MP 4A3EJ 4HZFA 3Q0WA 4FT8A 5JR3A 3WTYC 3J81Z 1ZRDA 3SZTA 1FX7A 4Q47A 5K1YA 1ON2A 2BHYA 2QSHX 1EV7A 3BQZA 4ZZDA 3JAMK 2P7CB 3A2KA 3H36A 2HNHA 4BQNA 3GEZA 3H3ZA 4UB6C 3TMOA 1R71A 3BTCA 3KYDB 3L00A 1WJ5A 1VQ6I 4PJMA 3M9AA 1RIOH 4YFKF 3PQJA 2L7KA 1FZPB 3IH4A 3K4CA 1J09A 1UCRA 3ZR8X 1TLHB 4A3LJ 1T0FC 5FLMJ 2O0YA 2VPLA 2XIGA 3QRFF 2VBYA 2WBMA 3PFIA 1QPIA 2O9LA 2DTZA 2KHMA 3OMYA 2RNJA 5CVVA 1FC3A 2RGVA 4BE0A 4I6ZA 1ETXA 3A03A 4L5JA 2YR2A 2E2JJ 2VBWA 1RNLA 2EJRA 1W7PD 4RM3A 3OYFA 2FRHA 5F64A 1MNDA 1UHSA 5C3EJ 5D6FA 2FOKA 5GPCA 4XSXF 1TQIA 3COAC 3SJMA 1BM9A 3GTPJ 3LA3A 5EZHA 2M2EA 5FGMA 2OCEA 1S7EA 2X1DA 5IOYA 1IW7F 1EH7A 2BBYA 3R61A 4MTDA 1YX5A 4LLGF 3QAHA 4AIJA 1AWCA 1VQ7I 4WCGA 4FETA 4ZC3A 4HNTA 4KMUX 5ED4A 4CA0A 2JMWA 2VB6A 2IS1A 1K78A 4OIOF 3LSIA 3ZMUA 3QPLA 2P0WA 4PJLA 4R8HA 1QBJA 4CHUA 4CCJA 4EJOA 3KEQA 3G71I 4MFEA 3BDDA 1RKTA 2KRFA 1JUPA 2EQRA 4LLLA 3BG6A 1ZN2A 2QQAA 1PJRA 2LBFA 3U1DA 1X1DA 3HSEA 1KYWA 2L5QA 2TCTA 1ETVA 1T56A 4M73A 2PEXA 2EZHA 1XGSA 1IUFA 1PDNC 1HOMA 1N75A 1ZG1A 2A6EF 2LLKA 1MJBA 2DAOA 4JQFA 4BHCA 3WHCA 3M3YJ 4Y4RA 2EBIA 2O03A 2DT5A 1C0WA 1WH5A 2QM3A 1OYYA 1NTCA 4JP0A 2XPWA 1YITI 5FLXZ 4FTHA 1B8IA 3BR2A 4RBOA 4I0AA 2H94A 2CUFA 3IP4B 2XB0X 3M7GA 4PGHA 3W6JB 4F55A 3GCMA 3HDDA 3QP5A 3F8BA 4P1WA 4KFCA 1FOWA 4OAZA 4BJ5C 2F5FA 1Q1VA 3S93A 2COMA 3H3VK 3CMMA 1MD0A 1WJAA 4CZCA 5IOZA 3BPXA 3IHUA 5EEGA 4BUPA 1WJEA 3I64A 4J00A 2HOTA 1G59A 1ITYA 3LMMA 4BEHA 3EDPA 3V8JA 3QOEA 2P7VB 4IF4A 3G3ZA 1BR1A 4M3BA 1PP7U 2DBBA 5CQEA 2CW8A 2I5UA 2LC2A 2XF7A 2VE8A 4ENKA 1ZELA 3GFIA 1XSXA 2VT2A 4B3AA 2Q1ZB 2YPRA 4F52A 2QUFA 1VQ8I 4R1HA 3JRGA 4UY8I 2G7UA 2XGEA 4G7HF 1D5VA 4HOBA 4N9HA 4LK0F 1PUFA 3D0SA 4BAYA 1OCZH 3L09A 2ZJQF 4IZZA 1W36C 2ZSHB 2KIMA 1V5FA 5KCMA 2QA4I 3R4KA 2ZJRF 3U2RA 2ECBA 1Q1HA 2J5PA 3I5UA 2A5YB 1N25A 3BR0A 5KAIC 2L9RA 1A6QA 1IXCA 1AU7A 1S3JA 2RC4A 3CLQA 2CQQA 1JUMA 1H8AC 4OMYA 1LFBA 4RLQA 4LITA 2OV7A 4ZJZA 2OCCH 3JTGA 2OU2A 1IN7A 2ISYA 2H6BA 5FB2A 4RAFA 2AXTC 3I55I 3HBLA 4HW0A 2LKXA 1K4TA 1IN8A 3J7AO 5EF6A 1FT9A 4F91B 3ZCOA 1UHWA 3W2VA 1UG2A 1H0MA 3RQ4A 2V9VA 3E5UA 2OC6A 4M9XA 1BOBA 2ID6A 2ESHA 4RS8A 2RV8A 3WE3A 4BNCA 1W5TA 4BBSJ 1P4WA 3GMEA 3SFIA 5HODA 1OCOH 2E36A 3HSRA 4MNUA 2Y30A 2NOGA 3L2UA 2TDXA 3CDLA 3ZOBA 1IRFA 4AU7A 4CCNA 3GX4X 5IYCJ 1GT0C 1Z7LA 1YW9A 4BJ6C 1VQLI 2LBFB 3CJRB 1LJ9A 5K5QA 3DTKA 2NS7A 3MN2A 3WHBA 2ISZA 3W3CA 1UG0A 1U5TA 4YIIA 4BXXJ 1Z1DA 1IXRC 3CTAA 2NOJB 3GF2A 2ID3A 1O4XA 3HGYA 2F6CA 1SFEA 3IH2A 2LNBA 1KONA 2Z3YA 1ZRCA 5CVUA 3OYCA 1XX5A 3ULQB 5IPAA 4HDUA 2ELKA 5FFZA 4M3DA 1S8NA 3W6VA 2E19A 4UVBA 3GZ5A 4DNCA 2VJ4A 2M9HA 3O8HA 2F5DA 1GVDA 1YJWI 1SD4A 4L5EA 2FE3A 2M30A 3DP7A 3R60A 5CVJA 3FIWA 3K1NA 4IHYA 2NVYJ 5J47A 2YU9J 1BIBA 5E18F 3DXJF 2KISA 5D5UB 1MNEA 3K70D 2HZTA 3GVAA 4XN3A 2J5OA 5E79C 2Q0OA 3GTLJ 1V4RA 4Y7NJ 1P7IA 2FBKA 3BJAA 2L4MA 1R1UA 3M1CA 4Z2YA 2JT1A 2B9SA 1IDYA 2HI3A 2FNAA 2HVSA 3HGGA 3VFZA 1SFUA 3OOUA 2IS2A 1ETWA 5K7FA 3A01B 2HXOA 2F4IA 4P9FA 2OA4A 5FKNA 1OMIA 3P5JA 4UV8A 3S17J 3FHNA 4PGGA 3H35A 3TDUC 2R7WA 3LSKA 4Q48A 1MBKA 2DODA 2VOPA 2F5EA 4LFUA 1W4MA 2F5CA 5D6EA 5GAGJ 4YEJA 1R5HA 2ZXWH 3MWMA 3EUAA 1J0RA 3LAJA 2QSFX 3FZVA 3H9QA 2WAQA 1PUFB 1B59A 4E7SA 2LOOA 5LLQA 1OYIA 1WKMA 1FBQA 4L9JA 4G7OF 2UV1A 4U88A 3F21A 3BC8A 2XSJC 1VQ9I 2D2WA 2K9NA 2GIVA 4G8XA 5F1JA 1X1AA 1Y39A 4HF1A 3WTXC 1J59A 3MKWB 1OR7A 1S7AA 3PM1A 3HM5A 1F43A 2KFDA 4RB2C 2LF8A 4EV0A 3HOTA 4E7KA 1E2XA 2V1DA 2B63J 1KYZA 2QEXI 2PJRA 2OZ6A 4C2MJ 3N4MA 1VQ4I 4AVPA 1R58A 2OZUA 3PUFA 5D5WB 3HZJA 6PAXA 3H0GJ 4ZTJA 5GADJ 1QA6A 2M7BA 4G94A 3PNYA 4BE2A 1P2FA 5JVGF 1GUUA 2NRAC 4Y3OA 1AKHA 1HLVA 3LQRA 1SVMA 2Y48A 1NK2P 1ETYA 2H1LA 3EPZA 2P4WA 3HOSA 1Y8RB 4MGRA 1GXPA 3KP3A 3HUGA 4B48A 2WB1N 2L9NA 1V3FA 3CCEI 2A3SA 5TRDA 2ZMEA 3ZQQA 1KU9A 2VKDA 3ELKA 2KKOA 5DD4A 2OTJI 5DUKA 3ZQLA 5F0CA 2XKOA 2UZKA 2BHZA 3A1YA 4A0XA 2JUGA 4AC0A 4BS9A 2GLOA 2PMZN 1D8JA 3SZPA 3ESWB 1TT5B 5H6QA 4PJJA 3F0CA 2M0MA 3H9JA 2HVRA 2P5KA 2Y0SN 2EIJH 3KIOA 3IAM2 4G6DA 2FNPA 2DT6A 2JSCA 4XNFA 5J1YA 3A0BC 1V5EA 3HTSB 4B8XA 4RDUA 1BI0A 4DGWB 2ZKZA 1D0XA 4XRFA 2DDAA 1VNDA 1DGRM 2GZWA 3M8JA 3CCJI 3F9KA 4WK8F 3S1RJ 2HYFA 1K83J 1JKPC 4WX9A 1A6IA 4DBQA 4ZDOA 1OLTA 2QKLB 5C4XJ 2B7EA 3TO9A 3F8NA 1STZA 2JSPA 5A2QK 5IT9K 2DMQA 4OIPF 4A3FJ 2X6XA 3C18A 3K4JA 5IYBJ 2WWYA 1I6HJ 2DU9A 2E1OA 4IHVA 3GXOA 3AG2H 4X1EA 5HLHA 4KN4X 3N05A 3S15J 3OYNA 1LDKB 3KLOA 2L7FP 2FQ3A 3EUHC 4MQ9F 4A6EA 4ESBA 3AG3H 4A12A 5IYDJ 2GXBA 1S7OA 2VQHA 2HR3A 4B09A 3ZMSA 1T2KA 3L2WA 1G8XA 4NC7A 3F8MA 3HRSA 3K9TA 4ZYGA 1XGNA 1YE9A 1OISA 1T6SA 1R4NB 1MDMB 2FUG2 1BW6A 3RIRA 2CUZA 3F8FA 2XUBA 4OINF 2H27A 2K4BA 3PSIA 5FFXA 2GBYA 2NVUB 3B73A 1J9IA 2E1CA 4A5MA 3I53A 4EEFG 2RREA 3WU1B 4FHTA 1MMGA 3D1NI 1IRZA 2F5VA 1RR7A 3V7SA 3L2RA 1Y1VJ 3CDHA 1MBHA 3E6CC 5HS8A 4UUVA 4J01A 2DTRA 1FP2A 2IA1A 3DPLC 5J1UA 2QBYB 3CUQA 1VI0A 3RI4A 4FISA 4XOPA 2M4KA 1ORKA 5F0FA 2FX0A 2XGCA 3CLOA 3KFWX 4O6JA 4EM1A 3UNGC 3KETA 3MVPA 2R5ZA 2DPDA 4NBQA 2QGUA 1I50J 1K4SA 4U7BA 4Y17A 3T0YA 4BU2A 1S5LC 4I09A 5J1RA 1BI3A 4G9YA 1YQAA 4B3XA 5ILSA 4D9JA 1ZH5A 3HB9A 3LSGA 3VB2A 2HZDA 2QSGX 3HIFA 2ZJ2A 4EM2A 4ZYAA 3LNQA 1B72A 5D5VB 1TWHJ 2IT0A 1USSA 1ZYRF 5HLTA 4OOIA 4RA2A 2CYYA 3ROUA 4P55A 1SVLA 4I0BA 3FXRA 4ETSA 3CCUI 4DBRA 2M8EA 5LGNA 1FIPA 1YJNI 3NWTA 3TDZC 2W7NA 1T0FA 4YELA 1X1PA 2H1KA 3ZQCA 4XICA 2ELJA 1Z3YA 3B6CA 5FKOA 1QRYA 5D8LB 2BY3A 3SQNA 2EV6A 5D8KB 2R7FA 5CYVA 1N77A 3FKJA 4OIRF 4UUSB 1JE8A 2X9DA 5J40A 2VJIA 4LG0A 4BQAA 4M71A 1HW1A 1X58A 3S2DJ 2LKPA 1DDNA 3LWFA 3HRTA 5HVQC 2DA3A 2NNYA 3DKWA 4CYDA 2HVQA 1FJLA 2GOXB 4S04A 1ZAOA 4PZJA 2ADUA 2MSYA 3OYHA 4IVNA 2E35A 3GO5A 2JA8J 2BOLA 2FJ1A 3SHFA 5FLXK 3BTIA 1E17A 5KK1A 3I59A 3JRIA 2D1VA 2YUSA 2FBHA 1AOYA 2E1MB 2MA3A 3L2QA 2XF6A 5JVTA 1JGSA 4FE4A 1SD5A 2ZXHA 2RKHA 4C3JJ 2Y31A 1RETA 1LVKA 2L4AA 2E5NA 3LA7A 1BL0A 1JKQC 4HBLA 1YFHA 2EZIA 2E1MC 3IWFA 3EUKL 1XC5A 1FBUA 2MLKA 4W1UA 3QOPA 4L9VA 4R79A 3OS0A 3I4PA 3E6BA 3HXLA 1GV5A 4XLHA 1EF4A 4V2GA 4C3IJ 1WZ2A 5D4RA 3OYEA 1ETKA 1LDDA 1ZLKA 2PG4A 4XLNF 4IHXA 5F27A 1LB2A 3J7ZI 1TBXA 5A2QZ 5IT9Z 3K6GA 2A69F 4LIUA 3TEDA 4ANJA 4BE1A 4E70A 2NXNB 2RNGA 2ZXJA 3ONQA 4N4OB 1B6AA 2EFPA 2LY1A 3C2HA 4V2FA 4CZZA 2CFXA 2M5WA 3I9V2 2FD5A 3ZQFA 4Y33A 3IRRA 4I7HA 3OS1A 1O3SA 2IGKA 4B1RA 3RCOA 2VBXA 1ULYA 2CV1A 3DU6A 2X6YA 2NVTJ 1U9NA 3QU6A 4I98B 1OCCH 3FBIB 4N4NB 4RGUA 4XR6A 3REOA 3C2BA 4AVZA 3DPTA 3BR5A 1A31A 1I27A 1D0YA 5J8CA 1YIOA 1X19A 1OFCX 4PJNA 3O3KA 4EATA 1IV6A 4AYBN 4LGWA 2V26A 1YRNB 4LLNA 1FYMA 4UB8C 4HEA2 2MD0A 5BPDA 4HLYA 2VPRA 3L9FA 3E3VA 2BY2A 3HKZA 2P5VA 3ZMTA 3ZN0A 1YIJI 4BXFA 3S1MJ 2K40A 4IQ4A 2WTEA 4A3JJ 2KPMA 3WTSC 1XB4A 3CF2A 3G1LA 2FOWA 5J4VA 3SEZA 3E97A 4IPAA 4EJWA 3IKTA 1XG1A 3GUDA 2JWTA 3C1DA 2E34A 4CDGA 4LG0B 3EYYA 3MAJA 3I71A 4LIVA 2LTPA 3RPUD 1W7PB 4HLXA 1E3PA 3EETA 1K7AA 1JJ6C 3HOVJ 4M74A 4HSRA 3KEOA 1E3OC 3OL3A 4OMZA 2RN7A 4BY1J 2XDVA 5E17F 2M34A 3HOXJ 3BT9A 3QPHA 2JTVA 2QQ8A 3E5QA 1H9TA 1RUOA 3ISPA 3I59B 2W24A 1QQIA 1SC7A 2PX9A 1RUNA 2STTA 1IF1A 2DMUA 1G3TA 4G6QA 2V6EA 2L54A 2GAUA 2K9MA 2A61A 2CU7A 4RGRA 3RYRA 1WFXA 2UUZA 4YFXF 4EGYA 1DU6A 3DCFA 4D1QA 3S1NJ 2LR8A 5FD6A 2QLZA 3OIQA 1SFOJ 4ZDPA 4E7ZA 1Z67A 3S2WA 3VYUB 3LAPA 3OYMA 2O5RA 3VYRB 3O8GA 4ITVA 5J3LA 4ABZA 3K1MA 2OPTA 3K10A 4E4HA 1A5JA 2F48A 5ERIA 5L3CA 3OYBA 4B43A 5JFRA 1WJFA 4OIQF 4BBRJ 3JRBA 3KP2A 5DTDA 5KNLA 4XLEA 1UJ8A 1P4AA 5J8FA 5GTHC 1SANA 4RB0A 3P9IA 5CLSA 3VDXA 4ZZLA 2FU4A 2WY8Q 2EFWA 2JA7J 1FTTA 3KZYA 1MZBA 2KDOA 1L3LA 3MKYB 3GZNB 3KYCB 1XPXA 1SMTA 5LHIA 3CQZJ 2P5LC 4LD5A 3TKYA 1FMWA 1QZYA 4LB6B 1WVRA 3HOWJ 2AHQA 4DYRA 2MABA 2FEZA 3KX2A 2MYSA 2HQNA 4X0GA 1IN6A 2G7HA 4HX7A 3RJPA 3ZXSA 1WJCA 2Y69H 3DF8A 2DA1A 2RAEA 3GYHX 5EEAA 4BDYA 3GTJJ 3RKYA 1MH3A 3Q9SA 4FCYA 2R0QC 3PO3J 3T8RA 5D4SA 1O7FA 2R5YB 2BYVE 4RGSA 3DEEA 1MBEA 1X4PA 2LREA 3I58A 5GP9A 1WWXA 2Y2ZA 4KIFA 4AIDA 4KUMA 1BR4A 1P4XA 2FSWA 3JRCA 4E7IA 1ON1A 4IHSA 2IAIA 1D1AA 2DFHA 2L02A 2GXGA 2HFHA 3FISA 5IP6A 1HKTA 3A01A 2XPVA 3OYIA 2W57A 1F5TA 5M3MJ 4G12A 5ICCA 2D1HA 4XL9A 4XLFA 3W2WA 1PUEE 4MEYF 2IRFG 1UZCA 2IP2A 4DQ2A 2IBDA 3HHHA 3M8FA 1X4OA 1SAXA 1XCVA 4EJVA 2K02A 5LGTA 4H0EA 3V42A 3VODA 3HJEA 4D7NA 4PK4A 1HKQA 1A36A 1SAUA 4XKVA 4GO1A 2UWMA 5C4JJ 4QTRA 2KDZA 3GTKJ 1YOVB 4C2UA 3HPGA 1MMAA 4NC8A 3SZGA 5M3FJ 2VKEA 1Z77A 2M87A 1HC8A 2CW7A 4M3GA 3SYTA 1H89C 1TWGJ 3OOPA 2Q2EB 2VASA 1GHCA 5CQGA 2E5ZA 3S3OA 4AIKA 1JKOC 2E1NA 1RI7A 3OL4A 2NNNA 2X1EA 2KIQA 3U21A 3CCVI 4II2A 2CRGA 4WF2A 3S2HJ 1FWZA 5IT3A 4D7MA 2EFQA 1W5CC 3H5NA 1TT0A 4QWQA 1VQKI 1O3QA 1B9MA 4C9YA 5ILUA 4I99C 2R7SA 4EM0B 2Z33A 2X0LA 2CWEA 1TNTA 2XAJA 3RKXA 3M4OJ 1QVTA 4HPQA 3ASNH 1HF0A 3OR2C 3WGGA 4EVIA 3S32A 2VIXA 2M0CA 3BJ6A 3J80Z 1KZHA 3ZQIA 2OUMA 3ZMZA 1WCMJ 2W48A 1W5SA 2RVCA 1Z0XA 1Y0NA 1ZARA 2WAEA 2LMDA 4N9IA 1Y6IA 1RPWA 1T98A 4N0BA 3TP3A 3FKIJ 4EJUA 1TZLA 4KN7X 3EQLF 1BI1A 2DOFA 1TL8A 3KYLA 1ZGWA 4G7ZF 2JN6A 2MD5A 2R7ZJ 5HDGA 4HV5A 2R4GA 2Y75A 3H92A 4ZYEA 5FRNA 3RPQA 3LOCA 3TBIA 4A2UA 1HBXG 2E71A 1ZKGA 4PJ0C 2XV4S 4NHJA 4CH7A 2W82A 2A6TA 3SDBA 3KEYA 2W25A 3AKZA 3O2PE 4GYGA 5H2FC 3G73A 3JCUC 1FYLA 2Y0MA 3ZQHA 2XGDA 1O3RA 1EH6A 5EYRA 3EUHA 1KQ8A 1Z91A 4YRVA 4W97A 4HX8A 4YFNF 3BWGA 3LSPA 2GWRA 2K85A 1EJ9A 9ANTA 1H88C 4HQEA 3FXKA 3CESA 3HTUA 4PSXA 1KGSA 2GA1A 2CFOA 2FMLA 2W85A 2LFBA 5LHHA 1HKSA 3JRDA 2O7OA 2WAQN 2OAZA 2VQGA 4FASD 3BLYA 1TQMA 2XAHA 2R92J 1DPUA 5C44J 2AQEA 1AHDP 2K9QA 2RDPA 2NAZA 2Y9ZA 4KIBA 2OQRA 1ZQ3P 2XRNA 1WH7A 4A0YA 1SVOA 3CUOA 3HRUA 1QPMA 3ABKH 1MDMA 2W84A 2R93J 3P7NA 2M1BA 2VC0A 4O3MA 4II3A 4FE7A 3WTVC 4I76A 4A3BJ 2EFNA 1YHQI 5K7HA 4HV6A 1DQUA 5LFAA 1P7JA 3C3WA 5F08A 3U1KA 3DTIA 3NEUA 5E1WA 2NS8A 2X85A 3KCCA 4DOZA 4GDFA 2DYSH 2M8GX 3TQNA 1FPQA 1J5YA 4CGZA 2M7AA 3OV8A 4J19A 2IA2A 4F7ZA 2EH3A 1T95A 2QBYA 2JVGA 4A69C 3JR9A 4AIHA 3GLLA 4F93B 1XGOA 4CXFA 5J6XA 3PJRA 1HDDC 2Y9YA 1I1GA 2CQKA 3I54A 2LK2A 3GTMJ 3VSLA 3OYKA 2M45A 2IGMA 4CYCB 1GV2A 1WHUA 3V7CA 4XMYA 4JBAA 2A68F 1U2WA 3G4SI 1R1VA 1I6XA 3P9KA 4AUXA 2CV0A 1BW5A 2VOOA 4BXUA 3MZ8A 1UFMA 1R5GA 2DFIA 4NB5A 4MIMA 3J7AY 2DO7A 1Z21A 2LY9A 3GW2A 4LMYA 4HX4A 5E8IA 2LVSA 2EZLA 2TRTA 1LEAA 3QQAA 1PP8F 1JGGA 1FYKA 1H9GA 2V6CA 2KLOA 3H1CA 3HC7A 4WXCA 2DQLA 3O6BB 4UV9A 2V1NA 1L0OC 2Z1DA 1IV8A 2X6OA 3Q5FA 5DCMB 3KP6A 3B6AA 2G0EA 2LRDA 2W00A 4KJZA 1SMYF 3BG3A 2K3PA 2VL8A 2ICWG 2ZB9A 3BP8A 3V4GA 3ECOA 1XN7A 2PI0A 4F3QA 2QCOA 4QSHA 4HSTA 1LFPA 5F04A 4UUSA 3GLXA 1FEXA 2DI3A 2ETHA 1IDZA 4KITB 5DUIA 2Y0SA 2KRHA 3SFZA 2DT7B 1DP7P 1KQ0A 5HLIA 3ZQGA 3QYBA 5BMZA 2PFBA 3IH3A 3MFKA 3ABLH 3IC7A 2QWWA 3LL7A 3M1EA 4PDKA 1HSTA 3EYIA 2UXXA 2YU3A 4ZH4F 3HRMA 5M5XJ 2GM4A 4BDZA 3CP2A 4XSZF 2DA5A 1NG6A 2BY0A 2JJ7A 3F3XA 2KIFA 3A0HC 2K86A 5EG0B 5FD5A 2LDUA 2XVCA 3T5XA 1J7KA 5ICGA 4MLOA 4IHWA 1TNSA 2CSOA 3DV8A 5E3OA 1KU2A 1U8BA 2ZC2A 5JHUA 1SD6A 1BIAA 4DZJA 1R22A 2IS6A 4RMNA 1E0EA 1R49A 4XM3A 2ZCWA 1Y8QB 1QZEA 1LQ1A 4JX4A 5L3EA 1FOKA 4U0YA 1FSEA 4DYQA 1N78A 1APLC 1ZTRA 4XIDA 3E6DA 1F36A 2O6GE 4M6XA 2NYXA 4ENMA 2HDCA 4L0ZB 3SDGA 3DLLF 2PMHA 2BY1A 3G1MA 1F1ZA 4BYYA 4L0YB 1OKRA 1DUXC 3JSOA 3K2ZA 5AIQA 1Y56A 4HYEA 4HRIA 1U3EM 1ZGAA 2FQ4A 5FO5A 1FOXA 2DDBA 1YW7A 4YG2F 4IKFA 4RAGA 5JLXA 2DOEA 1U0JA 3Q3SA 3FXJA 4GFBA 4AD9A 1B4AA 1R7JA 3S8PA 1XGMA 5M5YJ 4Y13A 1Z9CA 3F23A 1ZG5A 4QPOA 1WI3A 4HQMA 2LD5A 1R5ID 2AS5F 2FBIA 3KZIC 2A07F 4JX5A 3LSRA 1HXDA 2HPIA 3QYFA 2M4GA 3S3MA 4DW6A 1YRNA 2CQXA 4E7JA 1V55H 2C6YA 3CCQI 4A3DJ 2LG4A 2R3SA 3CCMI 4XLPF 5KHDA 2MH2A 3GFJA 4IRIA 1OPCA 2EA2A 1O3TA 2WV1A 3T1BA 2IJLA 1R6RA 1K6OA 4JOMA 4XKWA 2DOAA 4GYIA 4OAYA 3NARA 1ZR2A 2X6WA 2HDWA 1IJWC 2GQQA 3MZHA 3RZOJ 4GCVA 2OBPA 2DMNA 4BHBA 4WXDA 2AQFA 4E7LA 4L18B 3IRQA 1DGWY 1T38A 3R0JA 4KIGA 5DDGA 3OS2A 2V79A 1MKMA 5E1XA 1D8KA 1MBFA 1W7PA 1S29A 2R7DA 3PL8A 3CJTB 1FIAA 4B44A 4HAMA 4NQWB 3R6SA 2CW0F 3E5XA 4U87A 4IOAF 3E7LA 5FKLA 3B02A 3ZN1A 3WG7H 1VQNI 1CQTA 2EIMH 4QPQA 2E7XA 4ON0A 2R7UA 3JREA 1VF9A 3MMYB 2DA6A 2IA0A 1QU3A 2HGCA 3GTGJ 3AG4H 2E2HJ 2HWVA 5TJJA 1RC9A 4GRIA 2BGCA 4MHGA 3OSFA 1BA5A 4NDLA 2IVMA 3FMSA 3WTZA 4KISA 1WQ2A 2K9SA 2OF7A 3HYIA 3LQQA 3LSTA 2E60A 4RLFA 2XSDC 3FMQA 2DK8A 4BQOA 4A3IJ 3HOYJ 2HYJA 2CG4A 1HQCA 1I1SA 1D5YA 4XLCA 4CUGA 1IXSB 4YIFA 3WTWC 3FM3A 2R7XA 4BKXA 2VBZA 1MSEC 4KNYA 3JRFA 2V1XA 4UUTA 4ASNA 2EPFA 3CF5F 5LD2C 2L9SA 3WGHA 1YTYA 1MMSA 1ZK8A 1M1EB 2BW3A 3K0LA 1ODDA 3VEPA 4CICA 1F4KA 4X6AJ 1E3HA 3WG9A 4D5FA 2WY7Q 4P9UA 2IPQX 1YLFA 4IX7A 1NK3P 4B4CA 3V8LA 2E7WA 1P92A 1PYVA 3ZRGA 4NNJA 2HTSA 2JZYA 2DA2A 4JX6A 1FBSA 3K4MA 5J4YA 3UKGA 3OR1C 1QHGA 3PQKA 2V9KA 5DYMA 4HNVA 3CCRI 2DLLA 1JJ8C 1IRGA 5E3MA 3ZQ7A 1SD7A 2XAFA 1JHFA 3WE2A 2HOAA 1TC3C 1OCRH 4JK1X 3FXOA 1T8IA 4V19K 3Q9VA 5JHFA 2ME0A 2X51A 2DPUA 2R5YA 2R7OA 4LOCA 2V4JC 4ZTFA 3HKZN 2A5WA 3FF5A 3VOEA 2DA7A 2XPUA 3WU0A 5DCFA 1WPKA 3OIPA 2MC3A 1ZR4A 1FP1D 2IW5A 2XHKA 1I3AA 1JTYA 2L7ZA 2X48A 4Q5SF 2NVXJ 2XGXA 4A3KJ 1DU0A 5DEQA 2ZO4A 5HOOA 3L2VA 1X3ZB 3DWLE 3FBNB 3E6MA 3NQOA 1HCRA 3J80K 1ACIA 3BY6A 3PIPF 4AYBA 1QGPA 3V7RA 4H4KC 1UMQA 1U6GA 2IXSA 5HDNA 2Q8KA 1Z7UA 1IAWA 4O5VA 4RM2A 2L2OA 4HF0A 1HW5A 1ERDA 2DK5A 4EJTA 4I01A 1CF7B 1QVUA 4IO9F 1VQOI 4XBFA 1V54H 4DZPA 2Q2EA 2L0KA 3GWZA 1I39A 4BGDA 1KU3A 1X3UA 1IO2A 1ETQA 5IP9J 3CO7C 3HPHA 2H8RA 1K61A 1YJ9I 1U78A 1OYWA 1XSVA 3C2GA 1D1BA 3FK6A 3P9CA 2YX7A 1D3YA 1MJ9A 5IY5H 4D5CA 3QODA 3IUOA 3BQYA 2PLYA 1W0TA 4M3EA 2XAUA 4ZYHA 5IP7J 4KT5C 2F4OB 4ZYDA 4Y15A 1QNTA 1WGXA 2QQBA 5LRSA 2JPBA 2K3FA 4A93J 2XC7A 3A4CA 1V5GA 4DJAA 3GFMA 2CGPA 2B0LA
chains in the Genus database with same CATH topology
3CCUI 1FOXA 3CF5F 3CCLI 3G4SI 3CCJI 1MMSA 1YJNI 3CC4I 3I56I 1VQ8I 4UY8I 1YIJI 5GAGJ 2ZJQF 3CCRI 2QA4I 1VQPI 2ZJRF 3G6EI 2FOWA 3CC2I 3CCQI 3CCMI 4V19K 2E34A 1S72I 1VQ7I 1VQ9I 2JQ7A 1Y39A 5GAHJ 3CMAI 2E35A 2H8WA 2OTLI 3I55I 2ZJPF 1FOYA 3CMEI 3G71I 2QEXI 3J7YJ 1VQ4I 1YI2I 3CC7I 1HC8A 5DM7F 3CJTB 5GADJ 1QA6A 2E36A 3CCSI 4IOAF 5JVGF 3PIOF 1ACIA 1VQNI 3PIPF 1VQLI 1VQ5I 3CCVI 1YHQI 3CCEI 4IO9F 1VQOI 3J7ZI 2OTJI 1VQKI 1YITI 4IOCF 3CD6I 2NXNB 1YJ9I 1FOWA 3DLLF 1YJWI 1VQ6I 5DM6F 2K3FA 5GAEJ 1VQMI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU I;  1FOX A;  3CF5 F;  3CCL I;  3G4S I;  3CCJ I;  1MMS A;  1YJN I;  3CC4 I;  3I56 I;  1VQ8 I;  4UY8 I;  1YIJ I;  5GAG J;  2ZJQ F;  3CCR I;  2QA4 I;  1VQP I;  2ZJR F;  3G6E I;  2FOW A;  3CC2 I;  3CCQ I;  3CCM I;  4V19 K;  2E34 A;  1S72 I;  1VQ7 I;  1VQ9 I;  2JQ7 A;  1Y39 A;  5GAH J;  3CMA I;  2E35 A;  2H8W A;  2OTL I;  3I55 I;  2ZJP F;  1FOY A;  3CME I;  3G71 I;  2QEX I;  3J7Y J;  1VQ4 I;  1YI2 I;  3CC7 I;  1HC8 A;  5DM7 F;  3CJT B;  5GAD J;  1QA6 A;  2E36 A;  3CCS I;  4IOA F;  5JVG F;  3PIO F;  1ACI A;  1VQN I;  3PIP F;  1VQL I;  1VQ5 I;  3CCV I;  1YHQ I;  3CCE I;  4IO9 F;  1VQO I;  3J7Z I;  2OTJ I;  1VQK I;  1YIT I;  4IOC F;  3CD6 I;  2NXN B;  1YJ9 I;  1FOW A;  3DLL F;  1YJW I;  1VQ6 I;  5DM6 F;  2K3F A;  5GAE J;  1VQM I; 
#chains in the Genus database with same CATH topology
 1YG2 A;  4KIC A;  5BS6 A;  2YX4 A;  2WC2 A;  1MMD A;  3KP5 A;  1LDJ A;  4EGZ A;  2DJN A;  3S1Q J;  4PSW A;  3DEU A;  1HW2 A;  3F8C A;  1D1C A;  2MW8 A;  2Z5U A;  3RTR A;  2OD5 A;  2COB A;  3I56 I;  1D0Z A;  2O8K A;  2H6C A;  2BW3 B;  1Z05 A;  3PUB A;  1TP4 A;  4IJA A;  5B1A H;  3BR6 A;  3JRH A;  3L1P A;  2FF4 A;  2V7F A;  3BJO A;  2BEO A;  3LSH A;  3OYA A;  2IGN A;  1HA8 A;  1JUS A;  3GFL A;  2BXZ A;  3UR3 C;  1OCP A;  3ZGK A;  5EGO B;  1TW3 A;  3ZP5 A;  3ML6 A;  4IRG A;  1UAA A;  4HNU A;  1XCB A;  1LNW A;  5GAH J;  4XKB A;  1ENH A;  1EH8 A;  2VOD A;  2LYC A;  1HSJ A;  1REP C;  3R0A A;  2ELH A;  1Z6T A;  5ILV A;  3TOA A;  3DTE A;  1FOY A;  2VXZ A;  3CME I;  3BR3 A;  3RSN A;  2KIU A;  3K69 A;  4BJT A;  2JRM A;  3BOQ A;  2K9L A;  4F92 B;  5FKM A;  4NC6 A;  5KAF C;  1LUJ B;  1R23 A;  1R36 A;  1X2M A;  3F22 A;  3CC7 I;  1X1B A;  1Z6R A;  3CZ6 A;  4CCO A;  1RZ4 A;  3AAF A;  1U8R A;  2HYG D;  3PIO F;  3DEW A;  2EV0 A;  2LSO A;  1BC7 C;  2GXA A;  1IRX A;  5TIS C;  5D5X B;  1SFK A;  4IQJ A;  5LHG A;  4Q4Z F;  3M07 A;  1K79 A;  4B47 A;  2A6H F;  2KL4 A;  3QU3 A;  3H3U A;  5FRM A;  3RKQ A;  1UEL B;  2GA2 A;  4EMS A;  1KA8 A;  3FM5 A;  2O8X A;  1IN5 A;  2L3D A;  4IOC F;  1IGN A;  3SXY A;  1OCT C;  2EB7 A;  3CD6 I;  2HTJ A;  1IG7 A;  5L3D A;  5EJC A;  2JA6 J;  3TOB A;  1XD7 A;  2HKX A;  1W36 D;  1U9O A;  3TL4 X;  4CCM A;  3ABM H;  1RRJ A;  2EV5 A;  2DMT A;  4ESJ A;  4AWX B;  4PCQ A;  3MEX A;  2OJE D;  3CDI A;  1BR2 A;  2ME6 A;  4CCK A;  3QPT A;  2GIZ A;  5DM6 F;  4MTE A;  4E6K G;  1EKE A;  2CO5 A;  2XAS A;  2DW4 A;  1YW8 A;  4A0Z A;  3F72 A;  1PVE A;  2EFO A;  3RZD J;  5GAE J;  2PQ8 A;  4S05 A;  4M6V A;  3WTU C;  1UHM A;  3OYD A;  3KLN A;  3W2A A;  1S6L A;  2NS0 A;  5LEK A;  2OQG A;  3BTL A;  2X1C A;  2ZBK A;  3L7W A;  2ACJ A;  5ICE A;  2HOS A;  3FX3 A;  2ECC A;  5CVR A;  3CP8 A;  5LBQ A;  2DFE A;  3ERE D;  3JAM Z;  5EEH A;  4CYC A;  1X2N A;  1LKX A;  2GOM A;  3OIO A;  1K6Y A;  5CJ9 A;  2R7Q A;  3QYE A;  4M9S A;  2WV0 A;  1K78 B;  1R1T A;  1P9Q C;  5JI6 A;  1TQP A;  1POG A;  2EIN H;  3ECH A;  3MKZ A;  4BAC A;  3TGN A;  4CCL A;  3VSK A;  2ZNY A;  1YS7 A;  2FMY A;  3FWE A;  3ERM A;  3OWT A;  2D45 A;  1J75 A;  2JQ7 A;  4BL0 B;  1JXS A;  2M3A A;  3Q0U A;  3QWL A;  2QZ8 A;  4BH9 A;  5L3G A;  2YSR A;  3QP6 A;  4L5I A;  3PNT A;  1Y1W J;  4IRH A;  1ZRE A;  2VXD A;  1BN5 A;  1TW2 A;  2OTL I;  3W6K B;  1HDP A;  2VJJ A;  2RQP A;  5DCM A;  3OY9 A;  4M6Y A;  4XK4 A;  5FLV A;  4C3H J;  2CUJ A;  2BVM A;  4WXH A;  5DV5 A;  3FHZ A;  1AA7 A;  2JVH A;  3KPH A;  5ICF A;  3BZK A;  1FNN A;  4C2T A;  2MG4 A;  4Z6Y A;  3FXL A;  2DXI A;  2CV2 A;  4PFO A;  1G3S A;  1W0U A;  1OJL A;  2QF7 A;  3JTH A;  2EK5 A;  1DPR A;  1G4D A;  1B8I B;  3GTO J;  2P6T A;  3ABU A;  1XTA A;  4HA8 A;  3RKW A;  3D5S C;  1MNM C;  5HLG A;  1W1W E;  4RGX A;  5K5O A;  3K70 C;  4KMF A;  1UST A;  3NAU A;  1P6R A;  4ESF A;  2LY2 A;  1WSU A;  2JRT A;  1VTN C;  1XDS A;  4HDV A;  3FMR A;  1ETO A;  5FJ8 J;  1T33 A;  1GLN A;  2G9W A;  5HS7 A;  5KVR A;  3PSF A;  2ZSI B;  5K7Z A;  1A35 A;  3PFY A;  4HG2 A;  5E3N A;  5B1B H;  1X1C A;  4JYK A;  1MBG A;  3MQ0 A;  3TW7 A;  3BR1 A;  4BEH B;  2QKM B;  3H0D A;  3LSJ A;  1R4M B;  1ZG3 A;  4D0P A;  1MH4 A;  2JK3 A;  2VUM J;  3K1P A;  1IC8 A;  2MBF A;  2JPC A;  5E1Z B;  2HS5 A;  2VJ5 A;  3MZY A;  3HG9 A;  5EG0 A;  3NRV A;  2QQ9 A;  3DBR B;  2P8T A;  3FDY A;  1B9N A;  1G3Y A;  2HQ5 A;  4ZDL A;  4HF2 A;  2Z99 A;  2WAD A;  3TW6 A;  2BE5 F;  3KZZ A;  4CO8 A;  5M5W J;  5E8G A;  2CS3 A;  2BXY A;  4KA4 A;  1O7L A;  1KU7 A;  1J2X A;  1RES A;  1WI9 A;  2EWN A;  2K4J A;  4A5N A;  3ZPL A;  5B5E C;  3CCY A;  4QLC U;  4XRS A;  5HS9 A;  2VC1 A;  3CCL I;  1MSF C;  3S16 J;  1KQ9 A;  1MW7 A;  2HQA A;  3BZC A;  3OYL A;  2DN0 A;  4M9Z A;  3HEF A;  4LK1 F;  4IL6 C;  3OYG A;  1X3W B;  1GXQ A;  2KP6 A;  2ZNZ A;  3IL2 A;  3HHG A;  3F6V A;  3TO6 A;  5L3F A;  1T08 B;  4U7D A;  2VKH A;  2RQQ A;  3S14 J;  2VE9 A;  3CJN A;  4XN0 A;  3ZMD A;  3VYT B;  1DP3 A;  2ZXI A;  2DJI A;  2A05 A;  5GPA A;  2CJJ A;  3MCZ A;  3QPS A;  4FX0 A;  1TWA J;  3VPR A;  3RYP A;  3DU5 A;  4U0V A;  3WGI A;  3CC2 I;  1ZLJ A;  5HNF A;  3K4K A;  1BI2 A;  5F1R A;  2I8D A;  3IWZ A;  3AL0 B;  1VFC A;  2JA2 A;  3D5R C;  3E1S A;  2N8G A;  2CH0 A;  2V9P A;  1A04 A;  1JTX A;  3V8K A;  1FTZ A;  1JI8 A;  1JT6 A;  3CMA I;  4A6D A;  5F0H A;  1XSD A;  2HQR A;  5H6R A;  3SEQ A;  2DMP A;  2MC4 A;  5HNH A;  5AON A;  3BG9 A;  3TO7 A;  2ZJP F;  3AL0 C;  2VQC A;  1R9T J;  2WB1 A;  4DYC A;  1LE8 A;  4Y52 J;  3GTQ J;  3BZ6 A;  1BC8 C;  1YS6 A;  4M72 A;  2YS9 A;  1YI2 I;  1NH3 A;  2P6S A;  2W4S A;  1U5T B;  3FXM A;  1VZ0 A;  2HKO A;  4LJZ F;  3WU2 C;  5DM7 F;  1XMK A;  1LVA A;  3E0J B;  4AM3 A;  3CCS I;  1OQY A;  1JT0 A;  1SEU A;  2PMZ A;  5DS9 A;  1MMN A;  3CJQ B;  3JW4 A;  1U5T C;  4IHT A;  1MBJ A;  2V1U A;  1FMV A;  3LA2 A;  4S0H B;  1IZ1 A;  2KRC A;  2LP0 A;  4LB5 A;  2X4H A;  4NQW A;  1MJA A;  2BVL A;  3VYS B;  1XMA A;  3DPU A;  2EZK A;  5B66 C;  1YX3 A;  2DYR H;  4FX4 A;  1LFU P;  3TP0 A;  4YIR X;  5CPR B;  2BZT A;  1ZRF A;  2KT0 A;  4XOT A;  2XRL A;  1S9H A;  4K2E A;  2CQ7 A;  3G1O A;  4UHT A;  1I5Z A;  4XRS G;  4FQG A;  4CSW A;  3IV5 A;  3DBL B;  1RR8 C;  2F4M B;  5DD8 A;  2IGO A;  1CGP A;  1VQM I;  5EZG A;  5BOX A;  4XOR A;  2VKV A;  1QZZ A;  1Z3X A;  1QHH D;  2CQN A;  5TGT A;  1TWF J;  4RB3 C;  4OWR B;  4RAY A;  2D5V A;  1G3W A;  3BCB A;  3T8T A;  5LGU A;  2PJP A;  3AG1 H;  4A3G J;  1BJZ A;  1T39 A;  4OU0 A;  1GDT A;  4U0W A;  2QEN A;  1QO0 D;  2CUE A;  4GGG A;  2HEO A;  2HDD A;  4BY7 J;  1MGT A;  3I4N J;  4IEJ A;  1WRJ A;  4L9T A;  4KDP A;  2PBI A;  3J81 K;  3DBH B;  2Z9O A;  2LF7 A;  4MO7 A;  2HU9 A;  1VQP I;  3RQI A;  1BBY A;  2L9V A;  5H20 A;  1UB9 A;  4I02 A;  3G6E I;  3DKX A;  3RDI A;  2PJR B;  3HOZ J;  3BRO A;  3GBG A;  2EIK H;  3G2B A;  1FSH A;  2KZV A;  3I0T A;  3C7J A;  2F2E A;  2EA4 A;  1OR7 C;  3OYJ A;  3LFK A;  3K4N A;  2H8W A;  1BJA A;  2WA0 A;  4TV7 A;  2KJC A;  5BNG A;  4XRM A;  2K5C A;  2HXI A;  1WJD A;  1AKH B;  2K27 A;  2XB5 A;  1ZGJ A;  3AFH A;  2MFZ A;  3DKY A;  1Y0U A;  3BG5 A;  3HUG B;  4ENN A;  3IKV A;  5GTI C;  3J7Y J;  2XAG A;  2KMU A;  3OSG A;  4L9N A;  2ZME B;  4M3F A;  4MEX F;  2XF5 A;  1LE8 B;  3BTJ A;  4XLA A;  3HL2 A;  3N97 A;  2DCE A;  2DQR A;  2HPM A;  3ABT A;  3FK7 A;  1FY7 A;  1FLI A;  2I10 A;  1G6N A;  2Z2S B;  1VQ5 I;  3PO2 J;  2ZME C;  1RKW A;  4KT6 A;  3CO6 C;  1JHH A;  2P81 A;  4RAZ A;  5L3B A;  1EA3 A;  3H5R A;  3NWS A;  2W1O A;  3DQV C;  1LEB A;  3D5L A;  2VLA A;  4I2O A;  2QYO A;  3HSF A;  5EDN A;  1TTY A;  1ONV A;  5CVI A;  5K5R A;  2O61 A;  4LG3 A;  2VON A;  3K2A A;  2JA5 J;  2FXA A;  2MLG A;  3RPU A;  5HDK A;  4PFP A;  2O3F A;  2VQL A;  3I3L A;  3MD2 A;  2VI6 A;  4P5O A;  3WTT C;  2KQR A;  2R7R A;  4UVA A;  2VT3 A;  3M8E A;  3DFG A;  3KP4 A;  4UXN A;  3K7A J;  5LEJ A;  5AIP A;  1CF7 A;  1NG7 A;  2K7L A;  4WWC A;  1NHA A;  4RB1 A;  2ZFW A;  3ASO H;  3IAS 2;  4XKC A;  3S3N A;  4A3C J;  1JKR C;  2ESN A;  2KZG A;  1GVJ A;  4UNO A;  3JRA A;  3A02 A;  2KJB A;  2CMP A;  2STW A;  3FXU A;  3H5A A;  5FRO A;  5LRR A;  2UXN A;  5CKT A;  4P96 A;  5BQT A;  3CC4 I;  5F6F A;  1XS9 A;  1WJB A;  3Q0V A;  3PNV A;  1SFX A;  3I4M J;  2PN6 A;  2E2I J;  2PMU A;  3WOD F;  1F9N A;  4EQQ A;  4IXA A;  4XON A;  2Z16 A;  3LFU A;  4BHP A;  3H9G A;  5E3L A;  4G6T B;  5E20 A;  2FA5 A;  2DFF A;  3BPV A;  3L2C A;  2XKP A;  3VWB A;  3LSM A;  3U9G A;  5BPI A;  3FXQ A;  2WAF A;  3KP7 A;  1TWC J;  1S72 I;  2XRO A;  2AO9 A;  3HOU J;  4UVC A;  1MIJ A;  4C30 A;  3X2Q H;  1B1B A;  3JSP A;  2MGQ A;  3K4L A;  1R00 A;  4MQV A;  2EIL H;  2VN2 A;  3MKL A;  5FKK A;  2HOE A;  4GXO A;  5EGO A;  2MH9 A;  2R7V A;  3BCA A;  3DLA A;  2JUC A;  2BV6 A;  4ENJ A;  5JLW A;  4KYW A;  1O57 A;  2AXL A;  4PUS A;  3ZMV A;  4E7H A;  3GZ6 A;  3CUQ B;  4BQQ A;  1ZHF A;  4XQF A;  1XMX A;  4A3M J;  2IS4 A;  1LPQ A;  2LH9 A;  2XAQ A;  5B3S H;  2H09 A;  2R5Z B;  4DIQ A;  3F6O A;  2R7T A;  2ZFU A;  4QIW N;  1XDU A;  2NVQ J;  1IUY A;  1BOA A;  4MFD A;  1IN4 A;  3CMY A;  3K4B A;  3CUQ C;  4NUB A;  1G2H A;  2L01 A;  2LKS A;  1YYV A;  3KE2 A;  2IEK A;  1I3Q J;  1B72 B;  2DA4 A;  3BG7 A;  2QVO A;  1YO5 C;  2L7M P;  4A3E J;  4HZF A;  3Q0W A;  4FT8 A;  5JR3 A;  3WTY C;  3J81 Z;  1ZRD A;  3SZT A;  1FX7 A;  4Q47 A;  5K1Y A;  1ON2 A;  2BHY A;  2QSH X;  1EV7 A;  3BQZ A;  4ZZD A;  3JAM K;  2P7C B;  3A2K A;  3H36 A;  2HNH A;  4BQN A;  3GEZ A;  3H3Z A;  4UB6 C;  3TMO A;  1R71 A;  3BTC A;  3KYD B;  3L00 A;  1WJ5 A;  1VQ6 I;  4PJM A;  3M9A A;  1RIO H;  4YFK F;  3PQJ A;  2L7K A;  1FZP B;  3IH4 A;  3K4C A;  1J09 A;  1UCR A;  3ZR8 X;  1TLH B;  4A3L J;  1T0F C;  5FLM J;  2O0Y A;  2VPL A;  2XIG A;  3QRF F;  2VBY A;  2WBM A;  3PFI A;  1QPI A;  2O9L A;  2DTZ A;  2KHM A;  3OMY A;  2RNJ A;  5CVV A;  1FC3 A;  2RGV A;  4BE0 A;  4I6Z A;  1ETX A;  3A03 A;  4L5J A;  2YR2 A;  2E2J J;  2VBW A;  1RNL A;  2EJR A;  1W7P D;  4RM3 A;  3OYF A;  2FRH A;  5F64 A;  1MND A;  1UHS A;  5C3E J;  5D6F A;  2FOK A;  5GPC A;  4XSX F;  1TQI A;  3COA C;  3SJM A;  1BM9 A;  3GTP J;  3LA3 A;  5EZH A;  2M2E A;  5FGM A;  2OCE A;  1S7E A;  2X1D A;  5IOY A;  1IW7 F;  1EH7 A;  2BBY A;  3R61 A;  4MTD A;  1YX5 A;  4LLG F;  3QAH A;  4AIJ A;  1AWC A;  1VQ7 I;  4WCG A;  4FET A;  4ZC3 A;  4HNT A;  4KMU X;  5ED4 A;  4CA0 A;  2JMW A;  2VB6 A;  2IS1 A;  1K78 A;  4OIO F;  3LSI A;  3ZMU A;  3QPL A;  2P0W A;  4PJL A;  4R8H A;  1QBJ A;  4CHU A;  4CCJ A;  4EJO A;  3KEQ A;  3G71 I;  4MFE A;  3BDD A;  1RKT A;  2KRF A;  1JUP A;  2EQR A;  4LLL A;  3BG6 A;  1ZN2 A;  2QQA A;  1PJR A;  2LBF A;  3U1D A;  1X1D A;  3HSE A;  1KYW A;  2L5Q A;  2TCT A;  1ETV A;  1T56 A;  4M73 A;  2PEX A;  2EZH A;  1XGS A;  1IUF A;  1PDN C;  1HOM A;  1N75 A;  1ZG1 A;  2A6E F;  2LLK A;  1MJB A;  2DAO A;  4JQF A;  4BHC A;  3WHC A;  3M3Y J;  4Y4R A;  2EBI A;  2O03 A;  2DT5 A;  1C0W A;  1WH5 A;  2QM3 A;  1OYY A;  1NTC A;  4JP0 A;  2XPW A;  1YIT I;  5FLX Z;  4FTH A;  1B8I A;  3BR2 A;  4RBO A;  4I0A A;  2H94 A;  2CUF A;  3IP4 B;  2XB0 X;  3M7G A;  4PGH A;  3W6J B;  4F55 A;  3GCM A;  3HDD A;  3QP5 A;  3F8B A;  4P1W A;  4KFC A;  1FOW A;  4OAZ A;  4BJ5 C;  2F5F A;  1Q1V A;  3S93 A;  2COM A;  3H3V K;  3CMM A;  1MD0 A;  1WJA A;  4CZC A;  5IOZ A;  3BPX A;  3IHU A;  5EEG A;  4BUP A;  1WJE A;  3I64 A;  4J00 A;  2HOT A;  1G59 A;  1ITY A;  3LMM A;  4BEH A;  3EDP A;  3V8J A;  3QOE A;  2P7V B;  4IF4 A;  3G3Z A;  1BR1 A;  4M3B A;  1PP7 U;  2DBB A;  5CQE A;  2CW8 A;  2I5U A;  2LC2 A;  2XF7 A;  2VE8 A;  4ENK A;  1ZEL A;  3GFI A;  1XSX A;  2VT2 A;  4B3A A;  2Q1Z B;  2YPR A;  4F52 A;  2QUF A;  1VQ8 I;  4R1H A;  3JRG A;  4UY8 I;  2G7U A;  2XGE A;  4G7H F;  1D5V A;  4HOB A;  4N9H A;  4LK0 F;  1PUF A;  3D0S A;  4BAY A;  1OCZ H;  3L09 A;  2ZJQ F;  4IZZ A;  1W36 C;  2ZSH B;  2KIM A;  1V5F A;  5KCM A;  2QA4 I;  3R4K A;  2ZJR F;  3U2R A;  2ECB A;  1Q1H A;  2J5P A;  3I5U A;  2A5Y B;  1N25 A;  3BR0 A;  5KAI C;  2L9R A;  1A6Q A;  1IXC A;  1AU7 A;  1S3J A;  2RC4 A;  3CLQ A;  2CQQ A;  1JUM A;  1H8A C;  4OMY A;  1LFB A;  4RLQ A;  4LIT A;  2OV7 A;  4ZJZ A;  2OCC H;  3JTG A;  2OU2 A;  1IN7 A;  2ISY A;  2H6B A;  5FB2 A;  4RAF A;  2AXT C;  3I55 I;  3HBL A;  4HW0 A;  2LKX A;  1K4T A;  1IN8 A;  3J7A O;  5EF6 A;  1FT9 A;  4F91 B;  3ZCO A;  1UHW A;  3W2V A;  1UG2 A;  1H0M A;  3RQ4 A;  2V9V A;  3E5U A;  2OC6 A;  4M9X A;  1BOB A;  2ID6 A;  2ESH A;  4RS8 A;  2RV8 A;  3WE3 A;  4BNC A;  1W5T A;  4BBS J;  1P4W A;  3GME A;  3SFI A;  5HOD A;  1OCO H;  2E36 A;  3HSR A;  4MNU A;  2Y30 A;  2NOG A;  3L2U A;  2TDX A;  3CDL A;  3ZOB A;  1IRF A;  4AU7 A;  4CCN A;  3GX4 X;  5IYC J;  1GT0 C;  1Z7L A;  1YW9 A;  4BJ6 C;  1VQL I;  2LBF B;  3CJR B;  1LJ9 A;  5K5Q A;  3DTK A;  2NS7 A;  3MN2 A;  3WHB A;  2ISZ A;  3W3C A;  1UG0 A;  1U5T A;  4YII A;  4BXX J;  1Z1D A;  1IXR C;  3CTA A;  2NOJ B;  3GF2 A;  2ID3 A;  1O4X A;  3HGY A;  2F6C A;  1SFE A;  3IH2 A;  2LNB A;  1KON A;  2Z3Y A;  1ZRC A;  5CVU A;  3OYC A;  1XX5 A;  3ULQ B;  5IPA A;  4HDU A;  2ELK A;  5FFZ A;  4M3D A;  1S8N A;  3W6V A;  2E19 A;  4UVB A;  3GZ5 A;  4DNC A;  2VJ4 A;  2M9H A;  3O8H A;  2F5D A;  1GVD A;  1YJW I;  1SD4 A;  4L5E A;  2FE3 A;  2M30 A;  3DP7 A;  3R60 A;  5CVJ A;  3FIW A;  3K1N A;  4IHY A;  2NVY J;  5J47 A;  2YU9 J;  1BIB A;  5E18 F;  3DXJ F;  2KIS A;  5D5U B;  1MNE A;  3K70 D;  2HZT A;  3GVA A;  4XN3 A;  2J5O A;  5E79 C;  2Q0O A;  3GTL J;  1V4R A;  4Y7N J;  1P7I A;  2FBK A;  3BJA A;  2L4M A;  1R1U A;  3M1C A;  4Z2Y A;  2JT1 A;  2B9S A;  1IDY A;  2HI3 A;  2FNA A;  2HVS A;  3HGG A;  3VFZ A;  1SFU A;  3OOU A;  2IS2 A;  1ETW A;  5K7F A;  3A01 B;  2HXO A;  2F4I A;  4P9F A;  2OA4 A;  5FKN A;  1OMI A;  3P5J A;  4UV8 A;  3S17 J;  3FHN A;  4PGG A;  3H35 A;  3TDU C;  2R7W A;  3LSK A;  4Q48 A;  1MBK A;  2DOD A;  2VOP A;  2F5E A;  4LFU A;  1W4M A;  2F5C A;  5D6E A;  5GAG J;  4YEJ A;  1R5H A;  2ZXW H;  3MWM A;  3EUA A;  1J0R A;  3LAJ A;  2QSF X;  3FZV A;  3H9Q A;  2WAQ A;  1PUF B;  1B59 A;  4E7S A;  2LOO A;  5LLQ A;  1OYI A;  1WKM A;  1FBQ A;  4L9J A;  4G7O F;  2UV1 A;  4U88 A;  3F21 A;  3BC8 A;  2XSJ C;  1VQ9 I;  2D2W A;  2K9N A;  2GIV A;  4G8X A;  5F1J A;  1X1A A;  1Y39 A;  4HF1 A;  3WTX C;  1J59 A;  3MKW B;  1OR7 A;  1S7A A;  3PM1 A;  3HM5 A;  1F43 A;  2KFD A;  4RB2 C;  2LF8 A;  4EV0 A;  3HOT A;  4E7K A;  1E2X A;  2V1D A;  2B63 J;  1KYZ A;  2QEX I;  2PJR A;  2OZ6 A;  4C2M J;  3N4M A;  1VQ4 I;  4AVP A;  1R58 A;  2OZU A;  3PUF A;  5D5W B;  3HZJ A;  6PAX A;  3H0G J;  4ZTJ A;  5GAD J;  1QA6 A;  2M7B A;  4G94 A;  3PNY A;  4BE2 A;  1P2F A;  5JVG F;  1GUU A;  2NRA C;  4Y3O A;  1AKH A;  1HLV A;  3LQR A;  1SVM A;  2Y48 A;  1NK2 P;  1ETY A;  2H1L A;  3EPZ A;  2P4W A;  3HOS A;  1Y8R B;  4MGR A;  1GXP A;  3KP3 A;  3HUG A;  4B48 A;  2WB1 N;  2L9N A;  1V3F A;  3CCE I;  2A3S A;  5TRD A;  2ZME A;  3ZQQ A;  1KU9 A;  2VKD A;  3ELK A;  2KKO A;  5DD4 A;  2OTJ I;  5DUK A;  3ZQL A;  5F0C A;  2XKO A;  2UZK A;  2BHZ A;  3A1Y A;  4A0X A;  2JUG A;  4AC0 A;  4BS9 A;  2GLO A;  2PMZ N;  1D8J A;  3SZP A;  3ESW B;  1TT5 B;  5H6Q A;  4PJJ A;  3F0C A;  2M0M A;  3H9J A;  2HVR A;  2P5K A;  2Y0S N;  2EIJ H;  3KIO A;  3IAM 2;  4G6D A;  2FNP A;  2DT6 A;  2JSC A;  4XNF A;  5J1Y A;  3A0B C;  1V5E A;  3HTS B;  4B8X A;  4RDU A;  1BI0 A;  4DGW B;  2ZKZ A;  1D0X A;  4XRF A;  2DDA A;  1VND A;  1DGR M;  2GZW A;  3M8J A;  3CCJ I;  3F9K A;  4WK8 F;  3S1R J;  2HYF A;  1K83 J;  1JKP C;  4WX9 A;  1A6I A;  4DBQ A;  4ZDO A;  1OLT A;  2QKL B;  5C4X J;  2B7E A;  3TO9 A;  3F8N A;  1STZ A;  2JSP A;  5A2Q K;  5IT9 K;  2DMQ A;  4OIP F;  4A3F J;  2X6X A;  3C18 A;  3K4J A;  5IYB J;  2WWY A;  1I6H J;  2DU9 A;  2E1O A;  4IHV A;  3GXO A;  3AG2 H;  4X1E A;  5HLH A;  4KN4 X;  3N05 A;  3S15 J;  3OYN A;  1LDK B;  3KLO A;  2L7F P;  2FQ3 A;  3EUH C;  4MQ9 F;  4A6E A;  4ESB A;  3AG3 H;  4A12 A;  5IYD J;  2GXB A;  1S7O A;  2VQH A;  2HR3 A;  4B09 A;  3ZMS A;  1T2K A;  3L2W A;  1G8X A;  4NC7 A;  3F8M A;  3HRS A;  3K9T A;  4ZYG A;  1XGN A;  1YE9 A;  1OIS A;  1T6S A;  1R4N B;  1MDM B;  2FUG 2;  1BW6 A;  3RIR A;  2CUZ A;  3F8F A;  2XUB A;  4OIN F;  2H27 A;  2K4B A;  3PSI A;  5FFX A;  2GBY A;  2NVU B;  3B73 A;  1J9I A;  2E1C A;  4A5M A;  3I53 A;  4EEF G;  2RRE A;  3WU1 B;  4FHT A;  1MMG A;  3D1N I;  1IRZ A;  2F5V A;  1RR7 A;  3V7S A;  3L2R A;  1Y1V J;  3CDH A;  1MBH A;  3E6C C;  5HS8 A;  4UUV A;  4J01 A;  2DTR A;  1FP2 A;  2IA1 A;  3DPL C;  5J1U A;  2QBY B;  3CUQ A;  1VI0 A;  3RI4 A;  4FIS A;  4XOP A;  2M4K A;  1ORK A;  5F0F A;  2FX0 A;  2XGC A;  3CLO A;  3KFW X;  4O6J A;  4EM1 A;  3UNG C;  3KET A;  3MVP A;  2R5Z A;  2DPD A;  4NBQ A;  2QGU A;  1I50 J;  1K4S A;  4U7B A;  4Y17 A;  3T0Y A;  4BU2 A;  1S5L C;  4I09 A;  5J1R A;  1BI3 A;  4G9Y A;  1YQA A;  4B3X A;  5ILS A;  4D9J A;  1ZH5 A;  3HB9 A;  3LSG A;  3VB2 A;  2HZD A;  2QSG X;  3HIF A;  2ZJ2 A;  4EM2 A;  4ZYA A;  3LNQ A;  1B72 A;  5D5V B;  1TWH J;  2IT0 A;  1USS A;  1ZYR F;  5HLT A;  4OOI A;  4RA2 A;  2CYY A;  3ROU A;  4P55 A;  1SVL A;  4I0B A;  3FXR A;  4ETS A;  3CCU I;  4DBR A;  2M8E A;  5LGN A;  1FIP A;  1YJN I;  3NWT A;  3TDZ C;  2W7N A;  1T0F A;  4YEL A;  1X1P A;  2H1K A;  3ZQC A;  4XIC A;  2ELJ A;  1Z3Y A;  3B6C A;  5FKO A;  1QRY A;  5D8L B;  2BY3 A;  3SQN A;  2EV6 A;  5D8K B;  2R7F A;  5CYV A;  1N77 A;  3FKJ A;  4OIR F;  4UUS B;  1JE8 A;  2X9D A;  5J40 A;  2VJI A;  4LG0 A;  4BQA A;  4M71 A;  1HW1 A;  1X58 A;  3S2D J;  2LKP A;  1DDN A;  3LWF A;  3HRT A;  5HVQ C;  2DA3 A;  2NNY A;  3DKW A;  4CYD A;  2HVQ A;  1FJL A;  2GOX B;  4S04 A;  1ZAO A;  4PZJ A;  2ADU A;  2MSY A;  3OYH A;  4IVN A;  2E35 A;  3GO5 A;  2JA8 J;  2BOL A;  2FJ1 A;  3SHF A;  5FLX K;  3BTI A;  1E17 A;  5KK1 A;  3I59 A;  3JRI A;  2D1V A;  2YUS A;  2FBH A;  1AOY A;  2E1M B;  2MA3 A;  3L2Q A;  2XF6 A;  5JVT A;  1JGS A;  4FE4 A;  1SD5 A;  2ZXH A;  2RKH A;  4C3J J;  2Y31 A;  1RET A;  1LVK A;  2L4A A;  2E5N A;  3LA7 A;  1BL0 A;  1JKQ C;  4HBL A;  1YFH A;  2EZI A;  2E1M C;  3IWF A;  3EUK L;  1XC5 A;  1FBU A;  2MLK A;  4W1U A;  3QOP A;  4L9V A;  4R79 A;  3OS0 A;  3I4P A;  3E6B A;  3HXL A;  1GV5 A;  4XLH A;  1EF4 A;  4V2G A;  4C3I J;  1WZ2 A;  5D4R A;  3OYE A;  1ETK A;  1LDD A;  1ZLK A;  2PG4 A;  4XLN F;  4IHX A;  5F27 A;  1LB2 A;  3J7Z I;  1TBX A;  5A2Q Z;  5IT9 Z;  3K6G A;  2A69 F;  4LIU A;  3TED A;  4ANJ A;  4BE1 A;  4E70 A;  2NXN B;  2RNG A;  2ZXJ A;  3ONQ A;  4N4O B;  1B6A A;  2EFP A;  2LY1 A;  3C2H A;  4V2F A;  4CZZ A;  2CFX A;  2M5W A;  3I9V 2;  2FD5 A;  3ZQF A;  4Y33 A;  3IRR A;  4I7H A;  3OS1 A;  1O3S A;  2IGK A;  4B1R A;  3RCO A;  2VBX A;  1ULY A;  2CV1 A;  3DU6 A;  2X6Y A;  2NVT J;  1U9N A;  3QU6 A;  4I98 B;  1OCC H;  3FBI B;  4N4N B;  4RGU A;  4XR6 A;  3REO A;  3C2B A;  4AVZ A;  3DPT A;  3BR5 A;  1A31 A;  1I27 A;  1D0Y A;  5J8C A;  1YIO A;  1X19 A;  1OFC X;  4PJN A;  3O3K A;  4EAT A;  1IV6 A;  4AYB N;  4LGW A;  2V26 A;  1YRN B;  4LLN A;  1FYM A;  4UB8 C;  4HEA 2;  2MD0 A;  5BPD A;  4HLY A;  2VPR A;  3L9F A;  3E3V A;  2BY2 A;  3HKZ A;  2P5V A;  3ZMT A;  3ZN0 A;  1YIJ I;  4BXF A;  3S1M J;  2K40 A;  4IQ4 A;  2WTE A;  4A3J J;  2KPM A;  3WTS C;  1XB4 A;  3CF2 A;  3G1L A;  2FOW A;  5J4V A;  3SEZ A;  3E97 A;  4IPA A;  4EJW A;  3IKT A;  1XG1 A;  3GUD A;  2JWT A;  3C1D A;  2E34 A;  4CDG A;  4LG0 B;  3EYY A;  3MAJ A;  3I71 A;  4LIV A;  2LTP A;  3RPU D;  1W7P B;  4HLX A;  1E3P A;  3EET A;  1K7A A;  1JJ6 C;  3HOV J;  4M74 A;  4HSR A;  3KEO A;  1E3O C;  3OL3 A;  4OMZ A;  2RN7 A;  4BY1 J;  2XDV A;  5E17 F;  2M34 A;  3HOX J;  3BT9 A;  3QPH A;  2JTV A;  2QQ8 A;  3E5Q A;  1H9T A;  1RUO A;  3ISP A;  3I59 B;  2W24 A;  1QQI A;  1SC7 A;  2PX9 A;  1RUN A;  2STT A;  1IF1 A;  2DMU A;  1G3T A;  4G6Q A;  2V6E A;  2L54 A;  2GAU A;  2K9M A;  2A61 A;  2CU7 A;  4RGR A;  3RYR A;  1WFX A;  2UUZ A;  4YFX F;  4EGY A;  1DU6 A;  3DCF A;  4D1Q A;  3S1N J;  2LR8 A;  5FD6 A;  2QLZ A;  3OIQ A;  1SFO J;  4ZDP A;  4E7Z A;  1Z67 A;  3S2W A;  3VYU B;  3LAP A;  3OYM A;  2O5R A;  3VYR B;  3O8G A;  4ITV A;  5J3L A;  4ABZ A;  3K1M A;  2OPT A;  3K10 A;  4E4H A;  1A5J A;  2F48 A;  5ERI A;  5L3C A;  3OYB A;  4B43 A;  5JFR A;  1WJF A;  4OIQ F;  4BBR J;  3JRB A;  3KP2 A;  5DTD A;  5KNL A;  4XLE A;  1UJ8 A;  1P4A A;  5J8F A;  5GTH C;  1SAN A;  4RB0 A;  3P9I A;  5CLS A;  3VDX A;  4ZZL A;  2FU4 A;  2WY8 Q;  2EFW A;  2JA7 J;  1FTT A;  3KZY A;  1MZB A;  2KDO A;  1L3L A;  3MKY B;  3GZN B;  3KYC B;  1XPX A;  1SMT A;  5LHI A;  3CQZ J;  2P5L C;  4LD5 A;  3TKY A;  1FMW A;  1QZY A;  4LB6 B;  1WVR A;  3HOW J;  2AHQ A;  4DYR A;  2MAB A;  2FEZ A;  3KX2 A;  2MYS A;  2HQN A;  4X0G A;  1IN6 A;  2G7H A;  4HX7 A;  3RJP A;  3ZXS A;  1WJC A;  2Y69 H;  3DF8 A;  2DA1 A;  2RAE A;  3GYH X;  5EEA A;  4BDY A;  3GTJ J;  3RKY A;  1MH3 A;  3Q9S A;  4FCY A;  2R0Q C;  3PO3 J;  3T8R A;  5D4S A;  1O7F A;  2R5Y B;  2BYV E;  4RGS A;  3DEE A;  1MBE A;  1X4P A;  2LRE A;  3I58 A;  5GP9 A;  1WWX A;  2Y2Z A;  4KIF A;  4AID A;  4KUM A;  1BR4 A;  1P4X A;  2FSW A;  3JRC A;  4E7I A;  1ON1 A;  4IHS A;  2IAI A;  1D1A A;  2DFH A;  2L02 A;  2GXG A;  2HFH A;  3FIS A;  5IP6 A;  1HKT A;  3A01 A;  2XPV A;  3OYI A;  2W57 A;  1F5T A;  5M3M J;  4G12 A;  5ICC A;  2D1H A;  4XL9 A;  4XLF A;  3W2W A;  1PUE E;  4MEY F;  2IRF G;  1UZC A;  2IP2 A;  4DQ2 A;  2IBD A;  3HHH A;  3M8F A;  1X4O A;  1SAX A;  1XCV A;  4EJV A;  2K02 A;  5LGT A;  4H0E A;  3V42 A;  3VOD A;  3HJE A;  4D7N A;  4PK4 A;  1HKQ A;  1A36 A;  1SAU A;  4XKV A;  4GO1 A;  2UWM A;  5C4J J;  4QTR A;  2KDZ A;  3GTK J;  1YOV B;  4C2U A;  3HPG A;  1MMA A;  4NC8 A;  3SZG A;  5M3F J;  2VKE A;  1Z77 A;  2M87 A;  1HC8 A;  2CW7 A;  4M3G A;  3SYT A;  1H89 C;  1TWG J;  3OOP A;  2Q2E B;  2VAS A;  1GHC A;  5CQG A;  2E5Z A;  3S3O A;  4AIK A;  1JKO C;  2E1N A;  1RI7 A;  3OL4 A;  2NNN A;  2X1E A;  2KIQ A;  3U21 A;  3CCV I;  4II2 A;  2CRG A;  4WF2 A;  3S2H J;  1FWZ A;  5IT3 A;  4D7M A;  2EFQ A;  1W5C C;  3H5N A;  1TT0 A;  4QWQ A;  1VQK I;  1O3Q A;  1B9M A;  4C9Y A;  5ILU A;  4I99 C;  2R7S A;  4EM0 B;  2Z33 A;  2X0L A;  2CWE A;  1TNT A;  2XAJ A;  3RKX A;  3M4O J;  1QVT A;  4HPQ A;  3ASN H;  1HF0 A;  3OR2 C;  3WGG A;  4EVI A;  3S32 A;  2VIX A;  2M0C A;  3BJ6 A;  3J80 Z;  1KZH A;  3ZQI A;  2OUM A;  3ZMZ A;  1WCM J;  2W48 A;  1W5S A;  2RVC A;  1Z0X A;  1Y0N A;  1ZAR A;  2WAE A;  2LMD A;  4N9I A;  1Y6I A;  1RPW A;  1T98 A;  4N0B A;  3TP3 A;  3FKI J;  4EJU A;  1TZL A;  4KN7 X;  3EQL F;  1BI1 A;  2DOF A;  1TL8 A;  3KYL A;  1ZGW A;  4G7Z F;  2JN6 A;  2MD5 A;  2R7Z J;  5HDG A;  4HV5 A;  2R4G A;  2Y75 A;  3H92 A;  4ZYE A;  5FRN A;  3RPQ A;  3LOC A;  3TBI A;  4A2U A;  1HBX G;  2E71 A;  1ZKG A;  4PJ0 C;  2XV4 S;  4NHJ A;  4CH7 A;  2W82 A;  2A6T A;  3SDB A;  3KEY A;  2W25 A;  3AKZ A;  3O2P E;  4GYG A;  5H2F C;  3G73 A;  3JCU C;  1FYL A;  2Y0M A;  3ZQH A;  2XGD A;  1O3R A;  1EH6 A;  5EYR A;  3EUH A;  1KQ8 A;  1Z91 A;  4YRV A;  4W97 A;  4HX8 A;  4YFN F;  3BWG A;  3LSP A;  2GWR A;  2K85 A;  1EJ9 A;  9ANT A;  1H88 C;  4HQE A;  3FXK A;  3CES A;  3HTU A;  4PSX A;  1KGS A;  2GA1 A;  2CFO A;  2FML A;  2W85 A;  2LFB A;  5LHH A;  1HKS A;  3JRD A;  2O7O A;  2WAQ N;  2OAZ A;  2VQG A;  4FAS D;  3BLY A;  1TQM A;  2XAH A;  2R92 J;  1DPU A;  5C44 J;  2AQE A;  1AHD P;  2K9Q A;  2RDP A;  2NAZ A;  2Y9Z A;  4KIB A;  2OQR A;  1ZQ3 P;  2XRN A;  1WH7 A;  4A0Y A;  1SVO A;  3CUO A;  3HRU A;  1QPM A;  3ABK H;  1MDM A;  2W84 A;  2R93 J;  3P7N A;  2M1B A;  2VC0 A;  4O3M A;  4II3 A;  4FE7 A;  3WTV C;  4I76 A;  4A3B J;  2EFN A;  1YHQ I;  5K7H A;  4HV6 A;  1DQU A;  5LFA A;  1P7J A;  3C3W A;  5F08 A;  3U1K A;  3DTI A;  3NEU A;  5E1W A;  2NS8 A;  2X85 A;  3KCC A;  4DOZ A;  4GDF A;  2DYS H;  2M8G X;  3TQN A;  1FPQ A;  1J5Y A;  4CGZ A;  2M7A A;  3OV8 A;  4J19 A;  2IA2 A;  4F7Z A;  2EH3 A;  1T95 A;  2QBY A;  2JVG A;  4A69 C;  3JR9 A;  4AIH A;  3GLL A;  4F93 B;  1XGO A;  4CXF A;  5J6X A;  3PJR A;  1HDD C;  2Y9Y A;  1I1G A;  2CQK A;  3I54 A;  2LK2 A;  3GTM J;  3VSL A;  3OYK A;  2M45 A;  2IGM A;  4CYC B;  1GV2 A;  1WHU A;  3V7C A;  4XMY A;  4JBA A;  2A68 F;  1U2W A;  3G4S I;  1R1V A;  1I6X A;  3P9K A;  4AUX A;  2CV0 A;  1BW5 A;  2VOO A;  4BXU A;  3MZ8 A;  1UFM A;  1R5G A;  2DFI A;  4NB5 A;  4MIM A;  3J7A Y;  2DO7 A;  1Z21 A;  2LY9 A;  3GW2 A;  4LMY A;  4HX4 A;  5E8I A;  2LVS A;  2EZL A;  2TRT A;  1LEA A;  3QQA A;  1PP8 F;  1JGG A;  1FYK A;  1H9G A;  2V6C A;  2KLO A;  3H1C A;  3HC7 A;  4WXC A;  2DQL A;  3O6B B;  4UV9 A;  2V1N A;  1L0O C;  2Z1D A;  1IV8 A;  2X6O A;  3Q5F A;  5DCM B;  3KP6 A;  3B6A A;  2G0E A;  2LRD A;  2W00 A;  4KJZ A;  1SMY F;  3BG3 A;  2K3P A;  2VL8 A;  2ICW G;  2ZB9 A;  3BP8 A;  3V4G A;  3ECO A;  1XN7 A;  2PI0 A;  4F3Q A;  2QCO A;  4QSH A;  4HST A;  1LFP A;  5F04 A;  4UUS A;  3GLX A;  1FEX A;  2DI3 A;  2ETH A;  1IDZ A;  4KIT B;  5DUI A;  2Y0S A;  2KRH A;  3SFZ A;  2DT7 B;  1DP7 P;  1KQ0 A;  5HLI A;  3ZQG A;  3QYB A;  5BMZ A;  2PFB A;  3IH3 A;  3MFK A;  3ABL H;  3IC7 A;  2QWW A;  3LL7 A;  3M1E A;  4PDK A;  1HST A;  3EYI A;  2UXX A;  2YU3 A;  4ZH4 F;  3HRM A;  5M5X J;  2GM4 A;  4BDZ A;  3CP2 A;  4XSZ F;  2DA5 A;  1NG6 A;  2BY0 A;  2JJ7 A;  3F3X A;  2KIF A;  3A0H C;  2K86 A;  5EG0 B;  5FD5 A;  2LDU A;  2XVC A;  3T5X A;  1J7K A;  5ICG A;  4MLO A;  4IHW A;  1TNS A;  2CSO A;  3DV8 A;  5E3O A;  1KU2 A;  1U8B A;  2ZC2 A;  5JHU A;  1SD6 A;  1BIA A;  4DZJ A;  1R22 A;  2IS6 A;  4RMN A;  1E0E A;  1R49 A;  4XM3 A;  2ZCW A;  1Y8Q B;  1QZE A;  1LQ1 A;  4JX4 A;  5L3E A;  1FOK A;  4U0Y A;  1FSE A;  4DYQ A;  1N78 A;  1APL C;  1ZTR A;  4XID A;  3E6D A;  1F36 A;  2O6G E;  4M6X A;  2NYX A;  4ENM A;  2HDC A;  4L0Z B;  3SDG A;  3DLL F;  2PMH A;  2BY1 A;  3G1M A;  1F1Z A;  4BYY A;  4L0Y B;  1OKR A;  1DUX C;  3JSO A;  3K2Z A;  5AIQ A;  1Y56 A;  4HYE A;  4HRI A;  1U3E M;  1ZGA A;  2FQ4 A;  5FO5 A;  1FOX A;  2DDB A;  1YW7 A;  4YG2 F;  4IKF A;  4RAG A;  5JLX A;  2DOE A;  1U0J A;  3Q3S A;  3FXJ A;  4GFB A;  4AD9 A;  1B4A A;  1R7J A;  3S8P A;  1XGM A;  5M5Y J;  4Y13 A;  1Z9C A;  3F23 A;  1ZG5 A;  4QPO A;  1WI3 A;  4HQM A;  2LD5 A;  1R5I D;  2AS5 F;  2FBI A;  3KZI C;  2A07 F;  4JX5 A;  3LSR A;  1HXD A;  2HPI A;  3QYF A;  2M4G A;  3S3M A;  4DW6 A;  1YRN A;  2CQX A;  4E7J A;  1V55 H;  2C6Y A;  3CCQ I;  4A3D J;  2LG4 A;  2R3S A;  3CCM I;  4XLP F;  5KHD A;  2MH2 A;  3GFJ A;  4IRI A;  1OPC A;  2EA2 A;  1O3T A;  2WV1 A;  3T1B A;  2IJL A;  1R6R A;  1K6O A;  4JOM A;  4XKW A;  2DOA A;  4GYI A;  4OAY A;  3NAR A;  1ZR2 A;  2X6W A;  2HDW A;  1IJW C;  2GQQ A;  3MZH A;  3RZO J;  4GCV A;  2OBP A;  2DMN A;  4BHB A;  4WXD A;  2AQF A;  4E7L A;  4L18 B;  3IRQ A;  1DGW Y;  1T38 A;  3R0J A;  4KIG A;  5DDG A;  3OS2 A;  2V79 A;  1MKM A;  5E1X A;  1D8K A;  1MBF A;  1W7P A;  1S29 A;  2R7D A;  3PL8 A;  3CJT B;  1FIA A;  4B44 A;  4HAM A;  4NQW B;  3R6S A;  2CW0 F;  3E5X A;  4U87 A;  4IOA F;  3E7L A;  5FKL A;  3B02 A;  3ZN1 A;  3WG7 H;  1VQN I;  1CQT A;  2EIM H;  4QPQ A;  2E7X A;  4ON0 A;  2R7U A;  3JRE A;  1VF9 A;  3MMY B;  2DA6 A;  2IA0 A;  1QU3 A;  2HGC A;  3GTG J;  3AG4 H;  2E2H J;  2HWV A;  5TJJ A;  1RC9 A;  4GRI A;  2BGC A;  4MHG A;  3OSF A;  1BA5 A;  4NDL A;  2IVM A;  3FMS A;  3WTZ A;  4KIS A;  1WQ2 A;  2K9S A;  2OF7 A;  3HYI A;  3LQQ A;  3LST A;  2E60 A;  4RLF A;  2XSD C;  3FMQ A;  2DK8 A;  4BQO A;  4A3I J;  3HOY J;  2HYJ A;  2CG4 A;  1HQC A;  1I1S A;  1D5Y A;  4XLC A;  4CUG A;  1IXS B;  4YIF A;  3WTW C;  3FM3 A;  2R7X A;  4BKX A;  2VBZ A;  1MSE C;  4KNY A;  3JRF A;  2V1X A;  4UUT A;  4ASN A;  2EPF A;  3CF5 F;  5LD2 C;  2L9S A;  3WGH A;  1YTY A;  1MMS A;  1ZK8 A;  1M1E B;  2BW3 A;  3K0L A;  1ODD A;  3VEP A;  4CIC A;  1F4K A;  4X6A J;  1E3H A;  3WG9 A;  4D5F A;  2WY7 Q;  4P9U A;  2IPQ X;  1YLF A;  4IX7 A;  1NK3 P;  4B4C A;  3V8L A;  2E7W A;  1P92 A;  1PYV A;  3ZRG A;  4NNJ A;  2HTS A;  2JZY A;  2DA2 A;  4JX6 A;  1FBS A;  3K4M A;  5J4Y A;  3UKG A;  3OR1 C;  1QHG A;  3PQK A;  2V9K A;  5DYM A;  4HNV A;  3CCR I;  2DLL A;  1JJ8 C;  1IRG A;  5E3M A;  3ZQ7 A;  1SD7 A;  2XAF A;  1JHF A;  3WE2 A;  2HOA A;  1TC3 C;  1OCR H;  4JK1 X;  3FXO A;  1T8I A;  4V19 K;  3Q9V A;  5JHF A;  2ME0 A;  2X51 A;  2DPU A;  2R5Y A;  2R7O A;  4LOC A;  2V4J C;  4ZTF A;  3HKZ N;  2A5W A;  3FF5 A;  3VOE A;  2DA7 A;  2XPU A;  3WU0 A;  5DCF A;  1WPK A;  3OIP A;  2MC3 A;  1ZR4 A;  1FP1 D;  2IW5 A;  2XHK A;  1I3A A;  1JTY A;  2L7Z A;  2X48 A;  4Q5S F;  2NVX J;  2XGX A;  4A3K J;  1DU0 A;  5DEQ A;  2ZO4 A;  5HOO A;  3L2V A;  1X3Z B;  3DWL E;  3FBN B;  3E6M A;  3NQO A;  1HCR A;  3J80 K;  1ACI A;  3BY6 A;  3PIP F;  4AYB A;  1QGP A;  3V7R A;  4H4K C;  1UMQ A;  1U6G A;  2IXS A;  5HDN A;  2Q8K A;  1Z7U A;  1IAW A;  4O5V A;  4RM2 A;  2L2O A;  4HF0 A;  1HW5 A;  1ERD A;  2DK5 A;  4EJT A;  4I01 A;  1CF7 B;  1QVU A;  4IO9 F;  1VQO I;  4XBF A;  1V54 H;  4DZP A;  2Q2E A;  2L0K A;  3GWZ A;  1I39 A;  4BGD A;  1KU3 A;  1X3U A;  1IO2 A;  1ETQ A;  5IP9 J;  3CO7 C;  3HPH A;  2H8R A;  1K61 A;  1YJ9 I;  1U78 A;  1OYW A;  1XSV A;  3C2G A;  1D1B A;  3FK6 A;  3P9C A;  2YX7 A;  1D3Y A;  1MJ9 A;  5IY5 H;  4D5C A;  3QOD A;  3IUO A;  3BQY A;  2PLY A;  1W0T A;  4M3E A;  2XAU A;  4ZYH A;  5IP7 J;  4KT5 C;  2F4O B;  4ZYD A;  4Y15 A;  1QNT A;  1WGX A;  2QQB A;  5LRS A;  2JPB A;  2K3F A;  4A93 J;  2XC7 A;  3A4C A;  1V5G A;  4DJA A;  3GFM A;  2CGP A;  2B0L A; 
#chains in the Genus database with same CATH homology
 3CCU I;  1FOX A;  3CF5 F;  3CCL I;  3G4S I;  3CCJ I;  1MMS A;  1YJN I;  3CC4 I;  3I56 I;  1VQ8 I;  4UY8 I;  1YIJ I;  5GAG J;  2ZJQ F;  3CCR I;  2QA4 I;  1VQP I;  2ZJR F;  3G6E I;  2FOW A;  3CC2 I;  3CCQ I;  3CCM I;  4V19 K;  2E34 A;  1S72 I;  1VQ7 I;  1VQ9 I;  2JQ7 A;  1Y39 A;  5GAH J;  3CMA I;  2E35 A;  2H8W A;  2OTL I;  3I55 I;  2ZJP F;  1FOY A;  3CME I;  3G71 I;  2QEX I;  3J7Y J;  1VQ4 I;  1YI2 I;  3CC7 I;  1HC8 A;  5DM7 F;  3CJT B;  5GAD J;  1QA6 A;  2E36 A;  3CCS I;  4IOA F;  5JVG F;  3PIO F;  1ACI A;  1VQN I;  3PIP F;  1VQL I;  1VQ5 I;  3CCV I;  1YHQ I;  3CCE I;  4IO9 F;  1VQO I;  3J7Z I;  2OTJ I;  1VQK I;  1YIT I;  4IOC F;  3CD6 I;  2NXN B;  1YJ9 I;  1FOW A;  3DLL F;  1YJW I;  1VQ6 I;  5DM6 F;  2K3F A;  5GAE J;  1VQM I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...