3CCRI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccrI00
3CCUI 3CF5F 1VQ5I 1VQ9I 2OTLI 3CD6I 3J7ZI 3CCSI 4UY8I 3CC4I 1YITI 1S72I 2H8WA 2JQ7A 1FOXA 5DM7F 5GADJ 1VQLI 3CCVI 2FOWA 3DLLF 1VQMI 1YHQI 4V19K 1YI2I 1QA6A 2E35A 3PIOF 2QEXI 1VQ4I 2E36A 3CJTB 3CMEI 1VQ6I 3G71I 4IOAF 2ZJQF 1HC8A 4IO9F 1Y39A 1YJWI 1YJ9I 3G6EI 3CC2I 1MMSA 3CC7I 5GAGJ 1VQKI 1YJNI 3PIPF 3I56I 3CCEI 3CCMI 5GAHJ 3CCQI 2ZJRF 1VQOI 1ACIA 5JVGF 4IOCF 1VQ8I 3CCRI 5GAEJ 5DM6F 2QA4I 1VQPI 1FOYA 2K3FA 3J7YJ 1FOWA 3CCJI 3I55I 3G4SI 2ZJPF 1VQNI 2E34A 3CCLI 2OTJI 2NXNB 3CMAI 1VQ7I 1YIJI
chains in the Genus database with same CATH superfamily
4PFPA 4D1QA 3C2HA 4A12A 1Y1VJ 2GXGA 2YU9J 4FHTA 2YR2A 2R0QC 4G6DA 4IL6C 2OTLI 2EK5A 2AQFA 1VF9A 4PJLA 4OINF 3GXOA 3JRAA 2P6SA 4L9TA 4KICA 4BJ6C 2QSHX 4CXFA 5C44J 3LSPA 3F8MA 5B1AH 4M3DA 2X0LA 3E6MA 5DD4A 2C6YA 1NH3A 2CMPA 1T95A 1YW9A 2F5EA 5DM7F 2P7VB 3FF5A 2I10A 2W00A 3K4CA 4Y33A 3PNYA 2BW3B 4LOCA 1VQLI 1O57A 5L3CA 1QHGA 2BY3A 1DPRA 2PFBA 2FBKA 1FX7A 2OCEA 2HVRA 2O6GE 1TWHJ 1FZPB 4GGGA 3AG1H 1QA6A 4HF2A 1OISA 3ML6A 3L2UA 1BC7C 5EYRA 4E7ZA 3W6VA 4XOTA 2LRDA 2EFWA 5FKOA 1K61A 2CQXA 2PEXA 3BR5A 1EKEA 3GFMA 3FWEA 3KE2A 4GO1A 2X48A 2LKSA 3TO6A 3ZMDA 1YFHA 5KNLA 5LGNA 2ZSHB 2VPLA 2DPUA 1FBQA 1EH7A 2IXSA 2VPRA 2DDAA 3BROA 3P5JA 5J8CA 2A61A 5F0FA 3HRTA 3BG9A 1MW7A 2Y30A 4J00A 3GFIA 3L09A 3FXJA 1Q1HA 3PJRA 1Z9CA 3EUHC 2O8XA 2X6YA 1IUFA 1NK2P 3KCCA 1FMWA 3TP3A 2AXLA 5C3EJ 4IOCF 2LY9A 1Z77A 3FMSA 2FD5A 5E79C 1PYVA 3FXOA 1MNEA 4XLCA 4CZCA 4CCLA 3RZOJ 1V55H 1DPUA 2G7HA 3G3ZA 3WTVC 2BY0A 4LLGF 4XRFA 2XGCA 2IS4A 4M71A 1DP3A 2H6CA 2V1XA 1QBJA 3BJ6A 2R3SA 2JPCA 1ZR2A 1LUJB 3HPGA 3J7YJ 3ZRGA 1T39A 1FOWA 2KHMA 4BKXA 3TKYA 2DTZA 2VT2A 3L2WA 1ZG3A 2CU7A 4MTEA 3FIWA 1PP7U 4OIQF 1UHMA 3GZNB 2L7FP 4D5FA 1GVDA 3F22A 2BW3A 4NC8A 2A6EF 2GOXB 1BOBA 1ON1A 1YLFA 1OCTC 2XKPA 5BPIA 2LF7A 3WE3A 2FBHA 5L3EA 1V5EA 3CD6I 2VE9A 2KDOA 2CS3A 4RA2A 3MFKA 4XR6A 2XAQA 1LJ9A 1H9TA 3KEYA 4XKCA 2NOGA 1PJRA 5D6EA 2R4GA 3AFHA 1SD4A 3EUAA 1X1PA 4L9JA 1CGPA 1RUOA 4YG2F 2VJIA 3ELKA 5D5WB 2GA1A 2OA4A 5CLSA 3S2DJ 1TWFJ 3B6CA 2X6OA 3UNGC 4XONA 4PFOA 4YEJA 5E1ZB 3ASNH 3GF2A 3HZJA 1WCMJ 3QP5A 3KLOA 4A3BJ 3I53A 5B3SH 1YW7A 1YI2I 3LAPA 4JYKA 3IKTA 3K2AA 4B43A 3B02A 1UJ8A 2HTSA 5KCMA 5E20A 5LLQA 1POGA 3IH2A 1TBXA 3W2WA 2X1EA 3DKXA 1KA8A 3RPQA 2F48A 4X1EA 3ASOH 1BL0A 2W84A 2K3PA 5M5XJ 1IN8A 2H09A 1YTYA 3IAM2 1L0OC 1TNSA 4BH9A 3ZQIA 4EJOA 1DQUA 2Z99A 1S7EA 1FMVA 4CSWA 1P9QC 1YJ9I 2NNYA 4Z6YA 4OAZA 3OS1A 1BOAA 2FBIA 4XOPA 1FPQA 2XAUA 2K02A 2PMZN 4ZZDA 4BE0A 1JKOC 4BXXJ 4RGXA 3IWZA 3D5SC 3U2RA 4I98B 2FJ1A 2ZJRF 3GZ5A 1JGSA 1A04A 1MDMB 3R60A 2R7FA 3G2BA 4UVBA 2X9DA 2NRAC 1I3QJ 3JRIA 1AWCA 3HEFA 3IH3A 2VJ4A 3G1LA 3T8RA 2KISA 2KQRA 2MYSA 1KQ9A 5BS6A 4ZDPA 2DA3A 3F8FA 2NS0A 4XRSA 1I6XA 4P9FA 3J81Z 4RAGA 1GHCA 3MZHA 1LEAA 2PLYA 2O9LA 4NUBA 3DTKA 1R5HA 3O6BB 2FOKA 2WB1N 4S05A 5LBQA 1OMIA 5HVQC 1R5GA 3E5QA 5LHHA 5IY5H 5HS9A 1XSXA 1B9MA 1MD0A 2K9NA 1FNNA 3VODA 2WV0A 5EEHA 1T33A 2ECBA 4PGGA 4MFEA 1EH8A 1ZLKA 4BEHB 3OR1C 4EGZA 3MVPA 4DQ2A 4V2GA 2DJNA 2K7LA 4LLLA 1IRXA 3C2BA 1SVMA 3QWLA 4KMFA 3LSRA 1DU0A 2FNPA 1YHQI 4CCNA 2FNAA 2E2IJ 4C3JJ 4CCKA 4DYRA 4E4HA 1R00A 1R5ID 3JR9A 1ZTRA 3H92A 2BXYA 3DQVC 2XRNA 2HQAA 4V2FA 3CUQC 1MZBA 5F6FA 2LTPA 1FLIA 2VKVA 2W25A 3HXLA 2CG4A 5HS7A 3RKQA 5D4RA 1OYYA 3CJQB 1HC8A 1MBHA 1I5ZA 1KZHA 2JJ7A 4IKFA 1RIOH 5H2FC 5LEJA 1A31A 3QU3A 5TRDA 1MMSA 2DT7B 3E97A 4ZYDA 5D6FA 2BY1A 2EZLA 3S16J 3L7WA 4BBRJ 5CQEA 3VYSB 2L5QA 3M3YJ 3CCMI 3GTLJ 2DFHA 3MAJA 3BZKA 4FX4A 3KLNA 2KRCA 4BACA 5JVGF 2RN7A 4LFUA 3CUOA 1G3TA 3I0TA 3OV8A 1TQIA 5C4JJ 3AL0B 3X2QH 4B8XA 3N4MA 4C3HJ 2HPIA 4IHSA 4A0XA 1R1TA 4Y7NJ 2WBMA 2R92J 2VUMJ 3V8JA 3S15J 1NHAA 1BM9A 1MBKA 3R4KA 4BEHA 2J5OA 2DJIA 2ZJPF 2E34A 4KMUX 4NB5A 4A5MA 2OTJI 2NXNB 1D0XA 4F92B 1Z0XA 2HI3A 2HKXA 1SAUA 5DCMB 2WY8Q 1J0RA 3H9JA 5FFZA 5J4YA 1I6HJ 3F8CA 2H94A 5F0HA 5K7ZA 2HVQA 3IC7A 1H8AC 2R7ZJ 1W5CC 3GLXA 2KKOA 2QKMB 4HX7A 2XPWA 2A3SA 3FBIB 3K7AJ 1ITYA 5JI6A 2CGPA 1I27A 3I58A 2CW0F 3GEZA 3CESA 4RGSA 3CCSI 4IQ4A 1FIPA 1V5GA 1EH6A 4U88A 2HTJA 3CUQA 3VOEA 1Z67A 3P7NA 4Y17A 3PQJA 2H8WA 1D0ZA 1MNDA 3BTCA 4EM0B 5LD2C 5E3OA 2Y31A 4S0HB 1X19A 3OYHA 2KMUA 2Y9YA 1KQ8A 1WJEA 2XRLA 3RKYA 3M07A 3JRGA 5IYDJ 3NWSA 2OUMA 4X6AJ 1XGOA 1HSTA 1EF4A 2M4GA 4G7OF 2D45A 2HPMA 1OCOH 1G59A 3FX3A 3HIFA 1I1GA 4OMYA 2O3FA 3F3XA 2CYYA 4E7HA 3WODF 2AHQA 1MMNA 2L7KA 3K1NA 1TLHB 4G8XA 2UXXA 3CJTB 3RKWA 2BHZA 3W2VA 2L0KA 5FLXZ 4XRSG 2JA5J 3Q0VA 2QBYA 1YQAA 1O3QA 3OOUA 3W6KB 3E3VA 4UVCA 5D4SA 3OYDA 2HZTA 3CP8A 4LG0B 4OMZA 4DW6A 4FE7A 5FJ8J 1OCZH 1W7PA 2IGOA 2VKEA 3CCEI 1IXCA 2XIGA 5D5VB 4AYBN 2YUSA 4PSWA 5DCMA 5ICEA 2XV4S 1AA7A 5K7HA 1O3RA 2CUEA 3V42A 2VIXA 2D1HA 1E2XA 1B72A 1JKQC 1MBGA 1JTXA 4LJZF 4XIDA 3IHUA 2V1UA 1UAAA 1SD5A 2EIKH 2VKHA 2QVOA 1WGXA 2RQQA 2WADA 4ZYGA 4MLOA 5E3NA 4KJZA 1GXPA 1D1CA 2DMUA 3QOPA 3FXRA 1IZ1A 4BS9A 1WSUA 1PVEA 3RDIA 5KHDA 5J4VA 4YFNF 3HPHA 4R1HA 2QM3A 3FXUA 1HDPA 2JK3A 1TZLA 4FETA 2MH2A 2R7WA 4DZJA 3S8PA 3HSEA 1WI3A 3VYRB 2YSRA 3VSLA 1FJLA 1JHFA 4L9NA 3DBLB 1RR8C 1ODDA 4MFDA 1QPMA 2E19A 5JFRA 4F52A 5F04A 3ROUA 1MMGA 1XC5A 1IRFA 1GUUA 4M3GA 3LNQA 2IT0A 2CV2A 1HW5A 3HGGA 4BHCA 4XLHA 3J81K 1J75A 3A0BC 5GPAA 4Q4ZF 2QSGX 2ELJA 2NVXJ 4HNUA 4OIPF 2LBFA 4JX6A 3SXYA 4O3MA 5J8FA 1ZAOA 1BI1A 4KA4A 4XSXF 1JE8A 3S1QJ 4MHGA 4GXOA 4NQWA 4ENNA 4XM3A 4LG0A 4M3BA 5CVVA 3BR6A 2K4JA 4C30A 1BJZA 2PJRA 3HHHA 2GA2A 1ZARA 2M4KA 1CQTA 1G2HA 2O03A 3RI4A 1HDDC 3W3CA 4XLEA 4EV0A 2PX9A 2Y2ZA 3ZQLA 4NBQA 2Y69H 2EV0A 2MH9A 2NAZA 3MMYB 2DOEA 3CDIA 1SEUA 1XN7A 4EQQA 1FC3A 3HKZA 1U3EM 2K4BA 5FD6A 2IS1A 2W4SA 2HNHA 4PUSA 2DA1A 5LHIA 1IF1A 2E1CA 1TQPA 1ZLJA 1BW6A 3CF2A 1SVOA 2IEKA 3Q3SA 2V6CA 3LOCA 3HTUA 3G1MA 1Z1DA 2IGMA 3T8TA 2R7TA 2BV6A 4XK4A 1U2WA 4CHUA 1WJDA 2FSWA 4YELA 3CCQI 1J9IA 1ZRDA 1F36A 1J7KA 4R79A 5BPDA 3SZGA 4E7SA 1HKQA 3D5LA 1MBJA 1I50J 2L3DA 2J5PA 4M73A 2V7FA 2JWTA 1W5TA 1FBSA 4YIRX 1JKPC 1EV7A 1ZREA 3H0DA 1ORKA 2R7QA 2X4HA 5DUKA 5DDGA 1W0UA 3ZP5A 1S29A 2FF4A 5HDKA 2QKLB 3O2PE 1X4OA 2PI0A 3CDLA 1JT6A 3CCJI 1MMDA 3LSJA 4M74A 2R7OA 4PJMA 1UMQA 3C18A 2DOFA 3HSRA 2OQRA 4II3A 2NVUB 5FLVA 3R0JA 1OLTA 2EFPA 2M2EA 3FMRA 4QTRA 1YYVA 2VJJA 1P7JA 2HR3A 3JW4A 2P8TA 1T0FC 3KPHA 1VQ5I 2ISZA 5LRSA 1UG2A 3NRVA 4AIJA 3LQRA 4D7NA 1ZGAA 3JTHA 1IO2A 4EJTA 4XSZF 4B09A 1UCRA 4QLCU 3BJAA 4XL9A 3HOXJ 2DBBA 1YITI 2R7DA 4ESJA 2QQ9A 4A2UA 1H0MA 2EZHA 4HX4A 2XSDC 3MCZA 1PUFA 1FIAA 2V1DA 4QIWN 4BY7J 1C0WA 2OQGA 4BQQA 4WX9A 3JSOA 1T56A 3AG3H 2LG4A 3SEQA 3ABMH 2HU9A 3OYMA 5E17F 3LA2A 2JN6A 3HBLA 2QQBA 5ICGA 1ZELA 2FOWA 1BC8C 4H0EA 1WJBA 2K40A 2QYOA 3OYGA 4KDPA 3F9KA 1XCBA 2DAOA 4B47A 1S7OA 3AKZA 3WGIA 2XDVA 2WY7Q 1IUYA 3HTSB 2L9SA 4P1WA 1FP2A 2BVLA 2K9MA 3M7GA 1TC3C 2M8EA 3S2HJ 4JOMA 3CLOA 1D5YA 1EJ9A 3LL7A 1MKMA 2GXBA 2JRMA 2DA7A 3M4OJ 2LSOA 2BBYA 1JUPA 4M72A 3REOA 2VC1A 2P5LC 2STTA 2VOPA 2V4JC 3JCUC 4RB1A 2MA3A 3EETA 4BAYA 3OIQA 1HA8A 3JRHA 3FXKA 4DYQA 5IT9K 4UXNA 2JA6J 1Z7UA 3HUGB 2R7XA 2KP6A 4BUPA 3BTIA 4CYDA 2GIVA 1D1AA 1VQKI 1ZRFA 3OSFA 2O5RA 1YJNI 4A3LJ 1UHSA 1WWXA 4A69C 5CKTA 4ZJZA 4HYEA 3MZYA 3K4LA 5H20A 5GAHJ 4IHWA 1I39A 1VI0A 1S3JA 2FEZA 5FLXK 2P5VA 3VFZA 2N8GA 2IJLA 2D1VA 3M1CA 4ENJA 1ZQ3P 2ZXWH 2E5NA 4ZC3A 3TOBA 3WTUC 4OIRF 2GZWA 1VQ8I 2DODA 3DXJF 2RC4A 1FWZA 2F6CA 2I8DA 1N75A 3COAC 2F5CA 1T8IA 2E60A 2E71A 5FKKA 1YOVB 4DJAA 2L9RA 3DTEA 3F21A 4LD5A 4IHYA 1JI8A 1X1DA 2BOLA 3EDPA 4HAMA 2YX7A 2ZKZA 4EATA 2GAUA 5BQTA 2Q2EB 4HSTA 4AD9A 1MGTA 1Z05A 3L00A 3LFKA 1JUMA 2R5ZB 1DGRM 2WAQA 2ZO4A 2MFZA 2H6BA 3DLAA 1GV5A 2A68F 3CQZJ 3MWMA 4WCGA 3JRBA 4A5NA 2V26A 3EYYA 3U21A 4XN0A 2MGQA 4OAYA 2HQRA 4UUSB 4MEYF 3I3LA 3QU6A 1S72I 3NWTA 5KAIC 2HOEA 2MG4A 1R1VA 4XMYA 5M5YJ 3DWLE 4YFKF 3RJPA 3PFYA 1WJAA 1RUNA 3K70C 3RPUD 2JUGA 1T2KA 3FZVA 1XSDA 3ECHA 1JT0A 2LY2A 1A5JA 2WV1A 1WH5A 4ZTFA 3HUGA 2A6HF 3DLLF 1TT0A 4BY1J 1IDZA 2ZNZA 4O6JA 3UR3C 4V19K 2KLOA 3QPLA 3GO5A 1XGNA 4A3DJ 1BR2A 3GUDA 3K0LA 4IJAA 3OIOA 1H9GA 4UB8C 4F3QA 4ENMA 4A3JJ 4YRVA 3HOZJ 4J19A 1ZHFA 1SMTA 1X58A 2CW8A 4ENKA 5TISC 5IP7J 1S7AA 3G73A 3V7RA 2CUFA 2LR8A 1K4SA 3S3MA 1LFUP 4IOAF 2GQQA 2BVMA 1ZGJA 2QF7A 4PJNA 2A69F 2L7MP 1ZR4A 2IAIA 5HLGA 5ED4A 3C2GA 1IV8A 2XF6A 5DS9A 3OYFA 3ZQCA 3KP4A 2EILH 2Z9OA 2Q1ZB 1JXSA 3SZTA 3S93A 3BZCA 2M34A 4ITVA 2CO5A 4FT8A 2H1LA 1J09A 1Q1VA 2JPBA 1SFEA 4W97A 1QVUA 2ZCWA 3AAFA 3B6AA 3EUHA 2WAEA 2HOTA 5IYCJ 5KAFC 3W2AA 5KK1A 2XASA 4MQ9F 1J2XA 2Q2EA 4A6DA 4E7KA 2COBA 2L2OA 1SFXA 1BN5A 3H5AA 3HL2A 3BR2A 2ECCA 2R5ZA 1UG0A 3T1BA 5ERIA 2EQRA 3SJMA 2HYJA 3DBHB 4IXAA 1REPC 3RCOA 2VASA 4HV5A 3ZMUA 2I5UA 2DA6A 4UUSA 5HODA 1GT0C 3U1KA 4PZJA 3ZQ7A 2VODA 4PJJA 5DUIA 3PL8A 4I76A 4XN3A 3CCLI 4UHTA 5F0CA 3HOVJ 1TT5B 3WTWC 1XTAA 2PG4A 4UB6C 5CQGA 2KIFA 2W57A 3HC7A 1WHUA 4CYCA 2ZBKA 3E0JB 4OWRB 2CUJA 1Y1WJ 1WJ5A 4CH7A 1YO5C 2CUZA 5B66C 2EA2A 1SMYF 2V9PA 1KU3A 2PBIA 5J40A 4HEA2 3A03A 3T5XA 4MTDA 1X4PA 2ZXJA 5D8LB 3WTSC 1FP1D 1TP4A 3MN2A 3K2ZA 2E1MB 1S5LC 2AS5F 2O8KA 2V6EA 5KVRA 5FB2A 4RS8A 3E6BA 1O7LA 2WTEA 3OS2A 5LFAA 1O3TA 3LSTA 1XB4A 5E1XA 3ABTA 4P55A 2DXIA 3JRDA 1D0YA 2G0EA 1QGPA 1LE8B 3CJNA 1CF7A 2DA5A 1Y8RB 2ZXIA 3S17J 4C2TA 1USTA 4Y4RA 1TWCJ 2HVSA 3PFIA 2TDXA 3F6VA 2E2HJ 5F1RA 2R5YA 5ILUA 1G4DA 3GW2A 3QPHA 2LNBA 1FSEA 1ETVA 5K5OA 2K85A 3DU6A 2E5ZA 1OR7C 4RAFA 1QO0D 4ZZLA 3TO7A 4G7ZF 1F5TA 1XDSA 2Y0MA 4MIMA 2NVTJ 5GTIC 4BJ5C 1QRYA 2MLGA 4AU7A 5HLHA 2CV0A 2TRTA 2XSJC 3GLLA 3GTOJ 1ZG5A 4CA0A 2IGKA 4L9VA 2L02A 4AVZA 4AIKA 6PAXA 2LYCA 2WAFA 3IP4B 1W0TA 2ETHA 3QP6A 4KYWA 1RETA 3ZN1A 2RNGA 3NQOA 1IRGA 2IPQX 2L4MA 3GX4X 3H9QA 2MD0A 2LC2A 2GBYA 2VBYA 5D5XB 2ZMEC 3CUQB 2CWEA 4CCOA 4WXCA 1KGSA 1A6IA 5H6RA 4E7LA 2COMA 2ME0A 1Z6RA 4EMSA 2ID6A 4PSXA 3HRUA 5ICCA 1NK3P 3FDYA 2QWWA 1U8RA 5FFXA 4HV6A 3K70D 2IP2A 1QNTA 2R7RA 3BTJA 4RLFA 3L2RA 3BPVA 1HOMA 4EM1A 5AONA 2XPUA 3D5RC 1AU7A 1WZ2A 4G9YA 3WG9A 2FX0A 2P7CB 1MMAA 3QYBA 2LKXA 1FOKA 1VQNI 3BDDA 1AHDP 1OJLA 3CMAI 5LRRA 1YIOA 3ABUA 1JJ6C 1LE8A 1APLC 4B48A 3A01A 4N9IA 4Q47A 1K78A 2LKPA 5EZGA 1IAWA 1W1WE 3CF5F 5A2QZ 2GWRA 3KP5A 1LDKB 4B3AA 2QBYB 3CJRB 2A6TA 4HLXA 1HSJA 4CCMA 2VT3A 2L7ZA 2P4WA 1R58A 3GBGA 1OR7A 1HKTA 4M9SA 3KETA 4KNYA 2DFEA 1ETKA 1FYKA 2BE5F 3ZMSA 3S1RJ 4Y3OA 1TQMA 5BMZA 2F5FA 3SHFA 1W7PB 3H0GJ 2DI3A 4BE2A 1O4XA 3SFZA 2BGCA 1Z3YA 1OCCH 1X1CA 4M9XA 3HGYA 2DA4A 3GWZA 1YRNA 5IOYA 2XB0X 3HOWJ 1R71A 3H1CA 1FSHA 4BYYA 4WXDA 2PJPA 1B72B 2KRHA 3ZQFA 2AQEA 1V54H 1P4XA 1B9NA 2DK5A 1D8KA 2M9HA 4LIUA 3VSKA 2DN0A 3N97A 5ILSA 2ADUA 1K7AA 2EINH 2ZMEA 3BLYA 4M3EA 3HOSA 3KP3A 2DT6A 2E35A 3PIOF 4Q48A 1M1EB 1G8XA 2X1CA 1P4WA 3LMMA 3OY9A 4N9HA 1XGMA 1XSVA 4U7BA 1UHWA 2QLZA 4EJVA 2IA1A 4KT6A 4XKBA 2ZJQF 3JRCA 1RPWA 3LA7A 1X3UA 1IGNA 3ABLH 5E8GA 1LPQA 3A0HC 3S14J 4IRIA 5DV5A 2CFXA 3LSMA 4MGRA 4EVIA 3G6EI 1ZRCA 3F8BA 3MZ8A 1OKRA 4XICA 3RSNA 4IQJA 1BR4A 2MABA 1MSEC 2AO9A 1JUSA 4XLFA 2X1DA 2KIQA 4HPQA 1U8BA 2EZIA 2CFOA 3M8JA 3HSFA 1BA5A 1UB9A 3LQQA 3HKZN 3OL4A 1XG1A 2HYGD 3BCBA 1DP7P 4P9UA 3HOYJ 3K4BA 2ID3A 2LBFB 1SD6A 1WRJA 5JVTA 1DUXC 5CVUA 2DPDA 2FMYA 3CCRI 4FQGA 2ZNYA 3BJOA 4A3KJ 3PNTA 5H6QA 1F9NA 5DM6F 2LMDA 1OQYA 1Z7LA 3ZQGA 2XGEA 1TWAJ 4NQWB 5J1YA 4XLNF 1FY7A 2FA5A 2IW5A 3WHBA 2IRFG 3R6SA 1XMAA 1N77A 4YIIA 1UFMA 4HX8A 3BR1A 2PJRB 5HLTA 2L01A 4DBQA 2OF7A 3TBIA 1S6LA 3G4SI 4L18B 3PUBA 4N4NB 2NS7A 2VQCA 2DO7A 4ETSA 1XPXA 4B1RA 4UUVA 1YIJI 3BPXA 2RAEA 1DGWY 3RIRA 3IRRA 3J80Z 1RI7A 1ZK8A 3K69A 4GFBA 4AWXB 1U5TC 3VYUB 1BJAA 1WI9A 3ABKH 3FHNA 4PDKA 4EEFG 3CTAA 1EA3A 2X51A 4A3FJ 2M1BA 4BU2A 1P2FA 1LB2A 2QZ8A 1R23A 1U9OA 3WTZA 3K4KA 2WC2A 1ZYRF 4BDYA 2F4IA 1PP8F 5FROA 1FEXA 2UUZA 2Y0SN 3KYDB 3UKGA 2DQLA 4HNTA 1RR7A 4LG3A 4L0YB 3E6DA 2R7UA 3I9V2 5L3FA 4EGYA 2B9SA 4AIHA 1ETWA 2EA4A 4BHBA 3I64A 1DU6A 1N25A 3DKYA 3VYTB 1A35A 2DMPA 3LSKA 2CQKA 3ZQHA 3TEDA 1U9NA 3R0AA 2DMQA 4IPAA 2KPMA 1VZ0A 2ESNA 2NOJB 2NNNA 3PUFA 1WJFA 2W82A 3FK6A 2HS5A 1OYWA 2CJJA 4AUXA 1XGSA 3EUKL 2P81A 2VLAA 4HF1A 3TQNA 3TDUC 5K5QA 3ZOBA 3L9FA 4HRIA 3TOAA 4HOBA 2LVSA 5EEGA 2HQNA 2QQAA 3MEXA 3EYIA 3OYEA 3RKXA 2CSOA 4HA8A 3RTRA 2FE3A 1TNTA 4PJ0C 3IV5A 2M87A 5J6XA 1IC8A 3L2QA 1RC9A 4OIOF 3VPRA 4UUTA 2X85A 3SQNA 3H3UA 2CQ7A 5AIPA 3ESWB 4FTHA 2LK2A 1BIAA 1JTYA 1R4NB 1WPKA 2HWVA 2XROA 1ZH5A 2UV1A 1L3LA 4CZZA 2TCTA 3GZ6A 3GTJJ 1ACIA 3SFIA 4UV9A 2YS9A 1PUFB 1YS6A 2NVQJ 2F4MB 1IJWC 2VKDA 4G94A 4KIGA 4N4OB 3PO3J 2JT1A 4Y52J 2JVHA 4I99C 1FOYA 1AOYA 4ESBA 1LKXA 2B63J 2K3FA 1A36A 4G6TB 4BHPA 1QHHD 3BTLA 1OPCA 1MNMC 9ANTA 3KX2A 4AC0A 3F23A 2Z2SB 2DU9A 2Y48A 5EGOA 4I01A 2Q8KA 2FUG2 4E70A 3KEOA 5K1YA 5EZHA 3I59B 5L3DA 4FASD 1W5SA 3E5UA 4WWCA 2B0LA 1GDTA 5B5EC 3QRFF 2PMUA 1SAXA 1K6YA 3I54A 3WTTC 3TO9A 1ETYA 1IG7A 5LEKA 1SFOJ 2HFHA 2MC4A 2ELHA 4I7HA 3DEWA 3G1OA 2NYXA 2PN6A 4M6VA 4F55A 3SDGA 5M3FJ 2CQQA 4MEXF 3GFJA 3WU0A 1ZG1A 1AKHA 1QU3A 4RM2A 2DFIA 2WAQN 2DW4A 2LD5A 4IVNA 2EV6A 4XORA 2EZKA 5CJ9A 5A2QK 1H89C 4BXFA 2Y75A 3NEUA 3BP8A 1E3OC 1P92A 2Y0SA 1HXDA 3I71A 4HBLA 5ILVA 5EF6A 4XLPF 4JK1X 4G12A 1UELB 3V7CA 1BIBA 5IYBJ 4B44A 3LSGA 1TW3A 4P96A 1R36A 1R49A 1E17A 3C3WA 2OZUA 5HNFA 3I4MJ 3DP7A 1YX5A 2CRGA 5IOZA 2BXZA 3A02A 2EFQA 3PQKA 2YX4A 3FKJA 4HW0A 3V4GA 4AM3A 1FYLA 2FU4A 1JJ8C 1WH7A 2HXIA 3FXLA 1S9HA 3JAMZ 4BBSJ 3DKWA 1VQ6I 2O7OA 4BQAA 4Y15A 2QENA 2DMNA 4A3EJ 3V7SA 1A6QA 1MH3A 3EPZA 4KN7X 2EJRA 5DCFA 3C1DA 4ESFA 3S1NJ 1NTCA 3FM5A 3HRMA 2XAFA 3QOEA 4EM2A 3RPUA 2FQ4A 5CYVA 3F0CA 1LEBA 2QUFA 1QQIA 3PIPF 4I0BA 2XF5A 1WVRA 4PCQA 1GXQA 3K1MA 4M9ZA 3BG6A 4CUGA 3AG2H 3I59A 4XLAA 2XPVA 4BE1A 4HZFA 2LP0A 3ERED 3GTQJ 1MJ9A 2EIMH 1QVTA 1IDYA 5BOXA 1Z6TA 4HF0A 2A05A 5HDNA 1RKTA 1Y0NA 3CO7C 4XRMA 5E18F 2UZKA 2ZFWA 3KP6A 1TL8A 2ESHA 2STWA 3DEEA 3CDHA 4JBAA 1GLNA 2XC7A 3ZXSA 1G3YA 4BL0B 3BR3A 2VQLA 2Z33A 2NS8A 1F1ZA 1HW1A 1ZN2A 1HLVA 3FHZA 1VQ7I 2K27A 1T0FA 3E7LA 3RZDJ 1R22A 2M7AA 4XNFA 2K5CA 3KYLA 4RLQA 3ZR8X 3GTKJ 3FK7A 4HNVA 1Y8QB 3RQ4A 5GP9A 2K9QA 1SANA 2GLOA 1Z3XA 2DDBA 2DOAA 3DCFA 2DQRA 1RRJA 5F64A 2DLLA 3CZ6A 1PDNC 1LFPA 2FXAA 1YW8A 4BQNA 3LAJA 3U1DA 2HEOA 1BW5A 4RM3A 5DEQA 4MNUA 2FMLA 1BI3A 3J80K 3CCYA 5TGTA 4EJUA 3JTGA 2E2JJ 3WTXC 4G6QA 4RMNA 1P4AA 2ELKA 3Q5FA 2R7SA 1X3ZB 2VN2A 1K83J 3OYJA 2PQ8A 2MBFA 3MKYB 2VB6A 2VONA 1XDUA 2RV8A 3ZGKA 5L3GA 3OS0A 3O8GA 4A3MJ 2R7VA 2QGUA 4AVPA 2RNJA 2OPTA 4XBFA 2QCOA 4L5IA 4XKWA 3WHCA 4RBOA 3BG7A 3CP2A 3CMEI 1ZGWA 3OR2C 3I5UA 4XQFA 3ZQQA 3Q0UA 3B73A 5JHFA 3S2WA 4JQFA 3JREA 1D5VA 1T38A 3LSHA 4ZDOA 2MW8A 1Y39A 2V9KA 4CYCB 5IPAA 4LB5A 1V5FA 3N05A 4QSHA 3BY6A 1TWGJ 4ZYEA 1QZZA 3A2KA 5LGUA 3BG5A 3OWTA 4IX7A 3IWFA 4JX5A 3GVAA 2KRFA 3SDBA 2MSYA 2W24A 1D8JA 4JP0A 2XVCA 4ZDLA 4RB2C 2EIJH 4ZYHA 1B59A 2AXTC 2G9WA 4WXHA 4ABZA 3HG9A 2EPFA 4F91B 1U78A 1ULYA 2VBZA 1VNDA 1WKMA 4W1UA 1XCVA 3LSIA 1X1AA 3QPTA 3LWFA 1R1UA 2LREA 4U0WA 1USSA 1CF7B 2IA2A 3TW6A 4Z2YA 2RKHA 3O8HA 3WG7H 1ERDA 2ME6A 4HLYA 5EEAA 4LMYA 2R5YB 2DYSH 2OD5A 2HGCA 3BC8A 4ON0A 3R61A 5EDNA 4RB0A 3CMYA 3HM5A 5FO5A 1J59A 4L0ZB 1WFXA 4CDGA 1IN7A 4LB6B 1BI0A 3MKLA 5CVIA 2V79A 4CICA 1YX3A 4KN4X 3CCUI 2KJBA 4I2OA 3M8EA 1STZA 1U0JA 2CH0A 3DEUA 3KP2A 4WK8F 1XMXA 3OYLA 1PUEE 1HF0A 3L2CA 1LDDA 4NC7A 4B3XA 2XF7A 1J5YA 2CV1A 3HHGA 2HDCA 3HOUJ 3P9KA 4UY8I 3ISPA 4TV7A 3M1EA 3H5NA 4MQVA 1QPIA 2O61A 1HKSA 3RYRA 3S32A 4DYCA 3ERMA 1QZYA 5HS8A 3OMYA 2MD5A 4IHVA 1WJCA 3Q9SA 3FMQA 4D9JA 5E3LA 3MD2A 4C2UA 3M9AA 3M8FA 3H36A 3WGGA 5BNGA 2L9NA 5J1UA 3QYFA 1LDJA 1VQMI 1E0EA 1T6SA 3PNVA 1G3WA 1T08B 1W4MA 4HDVA 4HQEA 2V1NA 4LLNA 1MIJA 3H3VK 2EB7A 1P6RA 3Q9VA 2E7WA 1NG7A 2JSPA 3OOPA 3FISA 1TW2A 2K9SA 2XHKA 3U9GA 3WE2A 4QPQA 5DD8A 2D2WA 2EFNA 3GMEA 1V4RA 3ZCOA 4S04A 2R93J 1KQ0A 1X2MA 1Z91A 4D0PA 2VQHA 2OCCH 2VC0A 3KZYA 3A01B 4IO9F 1YJWI 2EV5A 1V3FA 1K78B 1HW2A 3OYNA 3BQZA 1XS9A 2B7EA 3HB9A 1RZ4A 2IVMA 2K86A 4HG2A 3PSFA 5HLIA 1YE9A 2RDPA 1YG2A 5EG0B 3IRQA 5C4XJ 2ZC2A 1HCRA 2E1MC 3JAMK 3I56I 5FKLA 4G7HF 1F43A 3KZIC 3TL4X 3H9GA 3BOQA 2M5WA 2VXDA 4BQOA 3JSPA 2KDZA 2IS2A 1XX5A 1W36C 3KYCB 1IXSB 4U0YA 4A3GJ 2JUCA 2JTVA 1MJBA 3LFUA 1IXRC 1G3SA 2L54A 5GPCA 1YRNB 3DU5A 4O5VA 3VEPA 1O3SA 2KFDA 4JX4A 2GIZA 3K4NA 1TTYA 3BQYA 4DIQA 2E1NA 2VL8A 3OL3A 5EJCA 1VFCA 3PSIA 2IA0A 2XGDA 4LIVA 2JVGA 3D0SA 2ZMEB 4LITA 5AIQA 3IKVA 3H3ZA 2KIUA 3IH4A 3BR0A 2LH9A 4H4KC 1LVKA 1IN4A 4C3IJ 4I6ZA 2M45A 1HBXG 1OFCX 1HQCA 1ETQA 2E1OA 3K1PA 3E6CC 5D5UB 1MBEA 2LF8A 1FT9A 2HOAA 3GCMA 2HXOA 2KT0A 1VQ9I 3OIPA 4BNCA 2DYRH 1S8NA 1KYWA 3AG4H 4A93J 4IF4A 1JHHA 4UVAA 2OU2A 4U0VA 4F7ZA 2LFBA 4YFXF 1R9TJ 1OCPA 1ETOA 2M30A 3K6GA 4NDLA 1K4TA 1JGGA 1I1SA 1Y56A 2EFOA 1K6OA 1MDMA 2A5WA 2ICWG 3HOTA 4GYGA 3CLQA 3FM3A 2O0YA 2P0WA 3DV8A 2GM4A 1MH4A 3BZ6A 5CVRA 4UV8A 4BDZA 2L4AA 2M7BA 3PO2J 1IW7F 2P6TA 4UNOA 4A3CJ 1GV2A 4OU0A 1FBUA 2G7UA 4HSRA 4A6EA 4DZPA 5EG0A 1B8IB 5HNHA 4DBRA 1BI2A 3ZMZA 2LDUA 4I09A 1BBYA 3DF8A 3VDXA 2DT5A 2OZ6A 4I02A 1VQ4I 5HDGA 3HDDA 2PMZA 3KEQA 2IBDA 3G71I 4DNCA 4KITB 4FE4A 3D1NI 4NHJA 5JLXA 2FQ3A 3A4CA 4R8HA 5L3BA 2QQ8A 3QODA 4RAYA 3O3KA 2E7XA 1FYMA 5TJJA 3AL0C 1E3HA 4HDUA 5ICFA 3CC7I 4KIBA 4LK0F 1IN5A 4KT5C 3L2VA 3MKZA 2ZXHA 3KIOA 2EWNA 3S1MJ 2XAGA 1UZCA 2JSCA 1N78A 4N0BA 2VI6A 2W1OA 4GRIA 2KIMA 3DPUA 4GYIA 1IV6A 3H5RA 1RKWA 2CW7A 5LHGA 4IHXA 5DYMA 1VQOI 1H88C 2OC6A 2JRTA 3TGNA 2KJCA 1X1BA 5GAEJ 2RGVA 5FRMA 2RREA 3OYKA 2HYFA 2JA7J 2M3AA 2X6XA 3E5XA 2D5VA 2EBIA 4D5CA 2JA2A 2LY1A 4M3FA 1SVLA 2WB1A 3QPSA 2VE8A 4BJTA 1XD7A 4QWQA 2XGXA 3I55I 3I4NJ 2F2EA 3SEZA 2VBWA 4LK1F 5E3MA 1BR1A 2H27A 4C2MJ 1ON2A 2LLKA 3K4JA 4KFCA 3DPTA 3HYIA 2DK8A 2V9VA 3WU1B 2UWMA 2MLKA 2DMTA 1SFKA 2UXNA 1LFBA 3K4MA 3E1SA 3SYTA 2ZJ2A 1B8IA 1ONVA 3GFLA 3HJEA 5IT9Z 3LA3A 3ZPLA 5J47A 2XAJA 3KFWX 2FRHA 1Y6IA 2HZDA 3HRSA 2WWYA 1FTTA 2X6WA 3CC4I 3ZMVA 1DDNA 3GTPJ 3MQ0A 4BGDA 2JQ7A 3L1PA 3GYHX 1FOXA 4CCJA 5F08A 3ULQB 4K2EA 5K5RA 3JRFA 5F27A 1SFUA 1R4MB 1MBFA 1U5TB 4RAZA 3T0YA 5F1JA 2HDWA 5LGTA 2XKOA 2ZSIB 3V8LA 1W36D 2PMHA 2RQPA 2K9LA 2Z3YA 1KONA 3CMMA 4YIFA 4ANJA 3WGHA 2M0MA 2VBXA 4MO7A 3ECOA 4FCYA 1R6RA 3KZZA 4DOZA 1RNLA 2EH3A 5E8IA 2QEXI 5FD5A 4L5JA 2E36A 4XKVA 3FXMA 5GTHC 2A07F 2Q0OA 2VQGA 3QYEA 1NG6A 5EGOB 4CO8A 3A1YA 2LOOA 3FKIJ 4A0ZA 1KU7A 5IP9J 3NARA 4DGWB 3WU2C 3RQIA 5J1RA 5B1BH 4ASNA 2XUBA 4RB3C 2GXAA 1RESA 2DFFA 3DPLC 4X0GA 2DTRA 1LNWA 3MKWB 1G6NA 1LVAA 2M8GX 4HQMA 1JKRC 4FX0A 2HQ5A 2DCEA 2ZB9A 2XB5A 3FBNB 5FLMJ 4OOIA 3OYBA 1AKHB 4WF2A 4AIDA 1KU2A 2YU3A 2ACJA 3W6JB 2Z1DA 4ZYAA 4A0YA 4EJWA 3OYIA 3CO6C 3IAS2 1SC7A 1SD7A 2ISYA 5IP6A 1VQPI 4IEJA 4P5OA 3PM1A 2HDDA 1U6GA 4D7MA 5HOOA 4KUMA 4RGUA 1VTNC 3BG3A 5D8KB 1MJAA 5FKMA 5JHUA 5CPRB 2RVCA 2JMWA 4RGRA 2H1KA 2Y9ZA 2KZVA 2P5KA 5FRNA 4U7DA 2JA8J 1F4KA 3OYCA 3ZMTA 2W85A 3F6OA 1U5TA 4PK4A 3J7AO 5E1WA 4BXUA 3IUOA 5K7FA 2ZFUA 1X2NA 3J7ZI 2GOMA 3K9TA 3F72A 2YPRA 4NC6A 1O7FA 2OBPA 4IRGA 4RDUA 2F4OB 3IL2A 4QPOA 3TP0A 1ENHA 2NVYJ 5CVJA 3DTIA 5M3MJ 1B6AA 2MC3A 2HOSA 1Y0UA 2M0CA 3FXQA 1R7JA 1T98A 3Q0WA 2H8RA 4GCVA 4LGWA 1IRZA 2BYVE 3BCAA 4A3IJ 4ZTJA 1W7PD 3TW7A 5GADJ 4ZH4F 4E7JA 3VB2A 3WTYC 1XMKA 3S3NA 3OSGA 3CCVI 2CQNA 4F93B 1X3WB 2WA0A 4Y13A 3ZN0A 2W7NA 3BT9A 1OCRH 2L9VA 3C7JA 4KIFA 1QZEA 2BHYA 4PGHA 3J7AY 2KL4A 4Q5SF 3ONQA 3KP7A 4M6YA 4IZZA 3S3OA 4IHTA 4IRHA 1KYZA 4FISA 5IT3A 2HKOA 4KISA 2BZTA 1YS7A 2IGNA 5DTDA 1P7IA 5JR3A 4AYBA 1K79A 1E3PA 3SZPA 1ZKGA 4E7IA 2W48A 5J3LA 2JZYA 4NNJA 1OYIA 5JLWA 4CGZA 2VOOA 4U87A 3F8NA 3CC2I 3TMOA 5GAGJ 3RYPA 4C9YA 4II2A 2Z5UA 5M5WJ 2KZGA 4M6XA 3QQAA 2BY2A 4E6KG 3EQLF 3H35A 4J01A 3QAHA 1WQ2A 2QSFX 1FTZA 1KU9A 1GVJA 3VWBA 3P9IA 5FKNA 3BWGA 3OYAA 3I4PA 4I0AA 1D1BA 3V8KA 1I3AA 3DBRB 3NAUA 1LQ1A 2XAHA 2QA4I 4GDFA 2F5DA 2Z16A 1B1BA 2DA2A 1ETXA 2A5YB 1B4AA 2VJ5A 1D3YA 2OV7A 5FGMA 3K10A 3P9CA 2OJED 1Z21A 3DFGA 2F5VA 4L5EA 1MSFC 3GTMJ 2IS6A 2OAZA 3GTGJ 4B4CA 1IN6A 2BEOA 3TDZC 2VXZA
chains in the Genus database with same CATH topology
3CCUI 3CF5F 1VQ5I 1VQ9I 2OTLI 3CD6I 3J7ZI 3CCSI 4UY8I 3CC4I 1YITI 1S72I 2H8WA 2JQ7A 1FOXA 5DM7F 5GADJ 1VQLI 3CCVI 2FOWA 3DLLF 1VQMI 1YHQI 4V19K 1YI2I 1QA6A 2E35A 3PIOF 2QEXI 1VQ4I 2E36A 3CJTB 3CMEI 1VQ6I 3G71I 4IOAF 2ZJQF 1HC8A 4IO9F 1Y39A 1YJWI 1YJ9I 3G6EI 3CC2I 1MMSA 3CC7I 5GAGJ 1VQKI 1YJNI 3PIPF 3I56I 3CCEI 3CCMI 5GAHJ 3CCQI 2ZJRF 1VQOI 1ACIA 5JVGF 4IOCF 1VQ8I 3CCRI 5GAEJ 5DM6F 2QA4I 1VQPI 1FOYA 2K3FA 3J7YJ 1FOWA 3CCJI 3I55I 3G4SI 2ZJPF 1VQNI 2E34A 3CCLI 2OTJI 2NXNB 3CMAI 1VQ7I 1YIJI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU I;  3CF5 F;  1VQ5 I;  1VQ9 I;  2OTL I;  3CD6 I;  3J7Z I;  3CCS I;  4UY8 I;  3CC4 I;  1YIT I;  1S72 I;  2H8W A;  2JQ7 A;  1FOX A;  5DM7 F;  5GAD J;  1VQL I;  3CCV I;  2FOW A;  3DLL F;  1VQM I;  1YHQ I;  4V19 K;  1YI2 I;  1QA6 A;  2E35 A;  3PIO F;  2QEX I;  1VQ4 I;  2E36 A;  3CJT B;  3CME I;  1VQ6 I;  3G71 I;  4IOA F;  2ZJQ F;  1HC8 A;  4IO9 F;  1Y39 A;  1YJW I;  1YJ9 I;  3G6E I;  3CC2 I;  1MMS A;  3CC7 I;  5GAG J;  1VQK I;  1YJN I;  3PIP F;  3I56 I;  3CCE I;  3CCM I;  5GAH J;  3CCQ I;  2ZJR F;  1VQO I;  1ACI A;  5JVG F;  4IOC F;  1VQ8 I;  3CCR I;  5GAE J;  5DM6 F;  2QA4 I;  1VQP I;  1FOY A;  2K3F A;  3J7Y J;  1FOW A;  3CCJ I;  3I55 I;  3G4S I;  2ZJP F;  1VQN I;  2E34 A;  3CCL I;  2OTJ I;  2NXN B;  3CMA I;  1VQ7 I;  1YIJ I; 
#chains in the Genus database with same CATH topology
 4PFP A;  4D1Q A;  3C2H A;  4A12 A;  1Y1V J;  2GXG A;  2YU9 J;  4FHT A;  2YR2 A;  2R0Q C;  4G6D A;  4IL6 C;  2OTL I;  2EK5 A;  2AQF A;  1VF9 A;  4PJL A;  4OIN F;  3GXO A;  3JRA A;  2P6S A;  4L9T A;  4KIC A;  4BJ6 C;  2QSH X;  4CXF A;  5C44 J;  3LSP A;  3F8M A;  5B1A H;  4M3D A;  2X0L A;  3E6M A;  5DD4 A;  2C6Y A;  1NH3 A;  2CMP A;  1T95 A;  1YW9 A;  2F5E A;  5DM7 F;  2P7V B;  3FF5 A;  2I10 A;  2W00 A;  3K4C A;  4Y33 A;  3PNY A;  2BW3 B;  4LOC A;  1VQL I;  1O57 A;  5L3C A;  1QHG A;  2BY3 A;  1DPR A;  2PFB A;  2FBK A;  1FX7 A;  2OCE A;  2HVR A;  2O6G E;  1TWH J;  1FZP B;  4GGG A;  3AG1 H;  1QA6 A;  4HF2 A;  1OIS A;  3ML6 A;  3L2U A;  1BC7 C;  5EYR A;  4E7Z A;  3W6V A;  4XOT A;  2LRD A;  2EFW A;  5FKO A;  1K61 A;  2CQX A;  2PEX A;  3BR5 A;  1EKE A;  3GFM A;  3FWE A;  3KE2 A;  4GO1 A;  2X48 A;  2LKS A;  3TO6 A;  3ZMD A;  1YFH A;  5KNL A;  5LGN A;  2ZSH B;  2VPL A;  2DPU A;  1FBQ A;  1EH7 A;  2IXS A;  2VPR A;  2DDA A;  3BRO A;  3P5J A;  5J8C A;  2A61 A;  5F0F A;  3HRT A;  3BG9 A;  1MW7 A;  2Y30 A;  4J00 A;  3GFI A;  3L09 A;  3FXJ A;  1Q1H A;  3PJR A;  1Z9C A;  3EUH C;  2O8X A;  2X6Y A;  1IUF A;  1NK2 P;  3KCC A;  1FMW A;  3TP3 A;  2AXL A;  5C3E J;  4IOC F;  2LY9 A;  1Z77 A;  3FMS A;  2FD5 A;  5E79 C;  1PYV A;  3FXO A;  1MNE A;  4XLC A;  4CZC A;  4CCL A;  3RZO J;  1V55 H;  1DPU A;  2G7H A;  3G3Z A;  3WTV C;  2BY0 A;  4LLG F;  4XRF A;  2XGC A;  2IS4 A;  4M71 A;  1DP3 A;  2H6C A;  2V1X A;  1QBJ A;  3BJ6 A;  2R3S A;  2JPC A;  1ZR2 A;  1LUJ B;  3HPG A;  3J7Y J;  3ZRG A;  1T39 A;  1FOW A;  2KHM A;  4BKX A;  3TKY A;  2DTZ A;  2VT2 A;  3L2W A;  1ZG3 A;  2CU7 A;  4MTE A;  3FIW A;  1PP7 U;  4OIQ F;  1UHM A;  3GZN B;  2L7F P;  4D5F A;  1GVD A;  3F22 A;  2BW3 A;  4NC8 A;  2A6E F;  2GOX B;  1BOB A;  1ON1 A;  1YLF A;  1OCT C;  2XKP A;  5BPI A;  2LF7 A;  3WE3 A;  2FBH A;  5L3E A;  1V5E A;  3CD6 I;  2VE9 A;  2KDO A;  2CS3 A;  4RA2 A;  3MFK A;  4XR6 A;  2XAQ A;  1LJ9 A;  1H9T A;  3KEY A;  4XKC A;  2NOG A;  1PJR A;  5D6E A;  2R4G A;  3AFH A;  1SD4 A;  3EUA A;  1X1P A;  4L9J A;  1CGP A;  1RUO A;  4YG2 F;  2VJI A;  3ELK A;  5D5W B;  2GA1 A;  2OA4 A;  5CLS A;  3S2D J;  1TWF J;  3B6C A;  2X6O A;  3UNG C;  4XON A;  4PFO A;  4YEJ A;  5E1Z B;  3ASN H;  3GF2 A;  3HZJ A;  1WCM J;  3QP5 A;  3KLO A;  4A3B J;  3I53 A;  5B3S H;  1YW7 A;  1YI2 I;  3LAP A;  4JYK A;  3IKT A;  3K2A A;  4B43 A;  3B02 A;  1UJ8 A;  2HTS A;  5KCM A;  5E20 A;  5LLQ A;  1POG A;  3IH2 A;  1TBX A;  3W2W A;  2X1E A;  3DKX A;  1KA8 A;  3RPQ A;  2F48 A;  4X1E A;  3ASO H;  1BL0 A;  2W84 A;  2K3P A;  5M5X J;  1IN8 A;  2H09 A;  1YTY A;  3IAM 2;  1L0O C;  1TNS A;  4BH9 A;  3ZQI A;  4EJO A;  1DQU A;  2Z99 A;  1S7E A;  1FMV A;  4CSW A;  1P9Q C;  1YJ9 I;  2NNY A;  4Z6Y A;  4OAZ A;  3OS1 A;  1BOA A;  2FBI A;  4XOP A;  1FPQ A;  2XAU A;  2K02 A;  2PMZ N;  4ZZD A;  4BE0 A;  1JKO C;  4BXX J;  4RGX A;  3IWZ A;  3D5S C;  3U2R A;  4I98 B;  2FJ1 A;  2ZJR F;  3GZ5 A;  1JGS A;  1A04 A;  1MDM B;  3R60 A;  2R7F A;  3G2B A;  4UVB A;  2X9D A;  2NRA C;  1I3Q J;  3JRI A;  1AWC A;  3HEF A;  3IH3 A;  2VJ4 A;  3G1L A;  3T8R A;  2KIS A;  2KQR A;  2MYS A;  1KQ9 A;  5BS6 A;  4ZDP A;  2DA3 A;  3F8F A;  2NS0 A;  4XRS A;  1I6X A;  4P9F A;  3J81 Z;  4RAG A;  1GHC A;  3MZH A;  1LEA A;  2PLY A;  2O9L A;  4NUB A;  3DTK A;  1R5H A;  3O6B B;  2FOK A;  2WB1 N;  4S05 A;  5LBQ A;  1OMI A;  5HVQ C;  1R5G A;  3E5Q A;  5LHH A;  5IY5 H;  5HS9 A;  1XSX A;  1B9M A;  1MD0 A;  2K9N A;  1FNN A;  3VOD A;  2WV0 A;  5EEH A;  1T33 A;  2ECB A;  4PGG A;  4MFE A;  1EH8 A;  1ZLK A;  4BEH B;  3OR1 C;  4EGZ A;  3MVP A;  4DQ2 A;  4V2G A;  2DJN A;  2K7L A;  4LLL A;  1IRX A;  3C2B A;  1SVM A;  3QWL A;  4KMF A;  3LSR A;  1DU0 A;  2FNP A;  1YHQ I;  4CCN A;  2FNA A;  2E2I J;  4C3J J;  4CCK A;  4DYR A;  4E4H A;  1R00 A;  1R5I D;  3JR9 A;  1ZTR A;  3H92 A;  2BXY A;  3DQV C;  2XRN A;  2HQA A;  4V2F A;  3CUQ C;  1MZB A;  5F6F A;  2LTP A;  1FLI A;  2VKV A;  2W25 A;  3HXL A;  2CG4 A;  5HS7 A;  3RKQ A;  5D4R A;  1OYY A;  3CJQ B;  1HC8 A;  1MBH A;  1I5Z A;  1KZH A;  2JJ7 A;  4IKF A;  1RIO H;  5H2F C;  5LEJ A;  1A31 A;  3QU3 A;  5TRD A;  1MMS A;  2DT7 B;  3E97 A;  4ZYD A;  5D6F A;  2BY1 A;  2EZL A;  3S16 J;  3L7W A;  4BBR J;  5CQE A;  3VYS B;  2L5Q A;  3M3Y J;  3CCM I;  3GTL J;  2DFH A;  3MAJ A;  3BZK A;  4FX4 A;  3KLN A;  2KRC A;  4BAC A;  5JVG F;  2RN7 A;  4LFU A;  3CUO A;  1G3T A;  3I0T A;  3OV8 A;  1TQI A;  5C4J J;  3AL0 B;  3X2Q H;  4B8X A;  3N4M A;  4C3H J;  2HPI A;  4IHS A;  4A0X A;  1R1T A;  4Y7N J;  2WBM A;  2R92 J;  2VUM J;  3V8J A;  3S15 J;  1NHA A;  1BM9 A;  1MBK A;  3R4K A;  4BEH A;  2J5O A;  2DJI A;  2ZJP F;  2E34 A;  4KMU X;  4NB5 A;  4A5M A;  2OTJ I;  2NXN B;  1D0X A;  4F92 B;  1Z0X A;  2HI3 A;  2HKX A;  1SAU A;  5DCM B;  2WY8 Q;  1J0R A;  3H9J A;  5FFZ A;  5J4Y A;  1I6H J;  3F8C A;  2H94 A;  5F0H A;  5K7Z A;  2HVQ A;  3IC7 A;  1H8A C;  2R7Z J;  1W5C C;  3GLX A;  2KKO A;  2QKM B;  4HX7 A;  2XPW A;  2A3S A;  3FBI B;  3K7A J;  1ITY A;  5JI6 A;  2CGP A;  1I27 A;  3I58 A;  2CW0 F;  3GEZ A;  3CES A;  4RGS A;  3CCS I;  4IQ4 A;  1FIP A;  1V5G A;  1EH6 A;  4U88 A;  2HTJ A;  3CUQ A;  3VOE A;  1Z67 A;  3P7N A;  4Y17 A;  3PQJ A;  2H8W A;  1D0Z A;  1MND A;  3BTC A;  4EM0 B;  5LD2 C;  5E3O A;  2Y31 A;  4S0H B;  1X19 A;  3OYH A;  2KMU A;  2Y9Y A;  1KQ8 A;  1WJE A;  2XRL A;  3RKY A;  3M07 A;  3JRG A;  5IYD J;  3NWS A;  2OUM A;  4X6A J;  1XGO A;  1HST A;  1EF4 A;  2M4G A;  4G7O F;  2D45 A;  2HPM A;  1OCO H;  1G59 A;  3FX3 A;  3HIF A;  1I1G A;  4OMY A;  2O3F A;  3F3X A;  2CYY A;  4E7H A;  3WOD F;  2AHQ A;  1MMN A;  2L7K A;  3K1N A;  1TLH B;  4G8X A;  2UXX A;  3CJT B;  3RKW A;  2BHZ A;  3W2V A;  2L0K A;  5FLX Z;  4XRS G;  2JA5 J;  3Q0V A;  2QBY A;  1YQA A;  1O3Q A;  3OOU A;  3W6K B;  3E3V A;  4UVC A;  5D4S A;  3OYD A;  2HZT A;  3CP8 A;  4LG0 B;  4OMZ A;  4DW6 A;  4FE7 A;  5FJ8 J;  1OCZ H;  1W7P A;  2IGO A;  2VKE A;  3CCE I;  1IXC A;  2XIG A;  5D5V B;  4AYB N;  2YUS A;  4PSW A;  5DCM A;  5ICE A;  2XV4 S;  1AA7 A;  5K7H A;  1O3R A;  2CUE A;  3V42 A;  2VIX A;  2D1H A;  1E2X A;  1B72 A;  1JKQ C;  1MBG A;  1JTX A;  4LJZ F;  4XID A;  3IHU A;  2V1U A;  1UAA A;  1SD5 A;  2EIK H;  2VKH A;  2QVO A;  1WGX A;  2RQQ A;  2WAD A;  4ZYG A;  4MLO A;  5E3N A;  4KJZ A;  1GXP A;  1D1C A;  2DMU A;  3QOP A;  3FXR A;  1IZ1 A;  4BS9 A;  1WSU A;  1PVE A;  3RDI A;  5KHD A;  5J4V A;  4YFN F;  3HPH A;  4R1H A;  2QM3 A;  3FXU A;  1HDP A;  2JK3 A;  1TZL A;  4FET A;  2MH2 A;  2R7W A;  4DZJ A;  3S8P A;  3HSE A;  1WI3 A;  3VYR B;  2YSR A;  3VSL A;  1FJL A;  1JHF A;  4L9N A;  3DBL B;  1RR8 C;  1ODD A;  4MFD A;  1QPM A;  2E19 A;  5JFR A;  4F52 A;  5F04 A;  3ROU A;  1MMG A;  1XC5 A;  1IRF A;  1GUU A;  4M3G A;  3LNQ A;  2IT0 A;  2CV2 A;  1HW5 A;  3HGG A;  4BHC A;  4XLH A;  3J81 K;  1J75 A;  3A0B C;  5GPA A;  4Q4Z F;  2QSG X;  2ELJ A;  2NVX J;  4HNU A;  4OIP F;  2LBF A;  4JX6 A;  3SXY A;  4O3M A;  5J8F A;  1ZAO A;  1BI1 A;  4KA4 A;  4XSX F;  1JE8 A;  3S1Q J;  4MHG A;  4GXO A;  4NQW A;  4ENN A;  4XM3 A;  4LG0 A;  4M3B A;  5CVV A;  3BR6 A;  2K4J A;  4C30 A;  1BJZ A;  2PJR A;  3HHH A;  2GA2 A;  1ZAR A;  2M4K A;  1CQT A;  1G2H A;  2O03 A;  3RI4 A;  1HDD C;  3W3C A;  4XLE A;  4EV0 A;  2PX9 A;  2Y2Z A;  3ZQL A;  4NBQ A;  2Y69 H;  2EV0 A;  2MH9 A;  2NAZ A;  3MMY B;  2DOE A;  3CDI A;  1SEU A;  1XN7 A;  4EQQ A;  1FC3 A;  3HKZ A;  1U3E M;  2K4B A;  5FD6 A;  2IS1 A;  2W4S A;  2HNH A;  4PUS A;  2DA1 A;  5LHI A;  1IF1 A;  2E1C A;  1TQP A;  1ZLJ A;  1BW6 A;  3CF2 A;  1SVO A;  2IEK A;  3Q3S A;  2V6C A;  3LOC A;  3HTU A;  3G1M A;  1Z1D A;  2IGM A;  3T8T A;  2R7T A;  2BV6 A;  4XK4 A;  1U2W A;  4CHU A;  1WJD A;  2FSW A;  4YEL A;  3CCQ I;  1J9I A;  1ZRD A;  1F36 A;  1J7K A;  4R79 A;  5BPD A;  3SZG A;  4E7S A;  1HKQ A;  3D5L A;  1MBJ A;  1I50 J;  2L3D A;  2J5P A;  4M73 A;  2V7F A;  2JWT A;  1W5T A;  1FBS A;  4YIR X;  1JKP C;  1EV7 A;  1ZRE A;  3H0D A;  1ORK A;  2R7Q A;  2X4H A;  5DUK A;  5DDG A;  1W0U A;  3ZP5 A;  1S29 A;  2FF4 A;  5HDK A;  2QKL B;  3O2P E;  1X4O A;  2PI0 A;  3CDL A;  1JT6 A;  3CCJ I;  1MMD A;  3LSJ A;  4M74 A;  2R7O A;  4PJM A;  1UMQ A;  3C18 A;  2DOF A;  3HSR A;  2OQR A;  4II3 A;  2NVU B;  5FLV A;  3R0J A;  1OLT A;  2EFP A;  2M2E A;  3FMR A;  4QTR A;  1YYV A;  2VJJ A;  1P7J A;  2HR3 A;  3JW4 A;  2P8T A;  1T0F C;  3KPH A;  1VQ5 I;  2ISZ A;  5LRS A;  1UG2 A;  3NRV A;  4AIJ A;  3LQR A;  4D7N A;  1ZGA A;  3JTH A;  1IO2 A;  4EJT A;  4XSZ F;  4B09 A;  1UCR A;  4QLC U;  3BJA A;  4XL9 A;  3HOX J;  2DBB A;  1YIT I;  2R7D A;  4ESJ A;  2QQ9 A;  4A2U A;  1H0M A;  2EZH A;  4HX4 A;  2XSD C;  3MCZ A;  1PUF A;  1FIA A;  2V1D A;  4QIW N;  4BY7 J;  1C0W A;  2OQG A;  4BQQ A;  4WX9 A;  3JSO A;  1T56 A;  3AG3 H;  2LG4 A;  3SEQ A;  3ABM H;  2HU9 A;  3OYM A;  5E17 F;  3LA2 A;  2JN6 A;  3HBL A;  2QQB A;  5ICG A;  1ZEL A;  2FOW A;  1BC8 C;  4H0E A;  1WJB A;  2K40 A;  2QYO A;  3OYG A;  4KDP A;  3F9K A;  1XCB A;  2DAO A;  4B47 A;  1S7O A;  3AKZ A;  3WGI A;  2XDV A;  2WY7 Q;  1IUY A;  3HTS B;  2L9S A;  4P1W A;  1FP2 A;  2BVL A;  2K9M A;  3M7G A;  1TC3 C;  2M8E A;  3S2H J;  4JOM A;  3CLO A;  1D5Y A;  1EJ9 A;  3LL7 A;  1MKM A;  2GXB A;  2JRM A;  2DA7 A;  3M4O J;  2LSO A;  2BBY A;  1JUP A;  4M72 A;  3REO A;  2VC1 A;  2P5L C;  2STT A;  2VOP A;  2V4J C;  3JCU C;  4RB1 A;  2MA3 A;  3EET A;  4BAY A;  3OIQ A;  1HA8 A;  3JRH A;  3FXK A;  4DYQ A;  5IT9 K;  4UXN A;  2JA6 J;  1Z7U A;  3HUG B;  2R7X A;  2KP6 A;  4BUP A;  3BTI A;  4CYD A;  2GIV A;  1D1A A;  1VQK I;  1ZRF A;  3OSF A;  2O5R A;  1YJN I;  4A3L J;  1UHS A;  1WWX A;  4A69 C;  5CKT A;  4ZJZ A;  4HYE A;  3MZY A;  3K4L A;  5H20 A;  5GAH J;  4IHW A;  1I39 A;  1VI0 A;  1S3J A;  2FEZ A;  5FLX K;  2P5V A;  3VFZ A;  2N8G A;  2IJL A;  2D1V A;  3M1C A;  4ENJ A;  1ZQ3 P;  2ZXW H;  2E5N A;  4ZC3 A;  3TOB A;  3WTU C;  4OIR F;  2GZW A;  1VQ8 I;  2DOD A;  3DXJ F;  2RC4 A;  1FWZ A;  2F6C A;  2I8D A;  1N75 A;  3COA C;  2F5C A;  1T8I A;  2E60 A;  2E71 A;  5FKK A;  1YOV B;  4DJA A;  2L9R A;  3DTE A;  3F21 A;  4LD5 A;  4IHY A;  1JI8 A;  1X1D A;  2BOL A;  3EDP A;  4HAM A;  2YX7 A;  2ZKZ A;  4EAT A;  2GAU A;  5BQT A;  2Q2E B;  4HST A;  4AD9 A;  1MGT A;  1Z05 A;  3L00 A;  3LFK A;  1JUM A;  2R5Z B;  1DGR M;  2WAQ A;  2ZO4 A;  2MFZ A;  2H6B A;  3DLA A;  1GV5 A;  2A68 F;  3CQZ J;  3MWM A;  4WCG A;  3JRB A;  4A5N A;  2V26 A;  3EYY A;  3U21 A;  4XN0 A;  2MGQ A;  4OAY A;  2HQR A;  4UUS B;  4MEY F;  3I3L A;  3QU6 A;  1S72 I;  3NWT A;  5KAI C;  2HOE A;  2MG4 A;  1R1V A;  4XMY A;  5M5Y J;  3DWL E;  4YFK F;  3RJP A;  3PFY A;  1WJA A;  1RUN A;  3K70 C;  3RPU D;  2JUG A;  1T2K A;  3FZV A;  1XSD A;  3ECH A;  1JT0 A;  2LY2 A;  1A5J A;  2WV1 A;  1WH5 A;  4ZTF A;  3HUG A;  2A6H F;  3DLL F;  1TT0 A;  4BY1 J;  1IDZ A;  2ZNZ A;  4O6J A;  3UR3 C;  4V19 K;  2KLO A;  3QPL A;  3GO5 A;  1XGN A;  4A3D J;  1BR2 A;  3GUD A;  3K0L A;  4IJA A;  3OIO A;  1H9G A;  4UB8 C;  4F3Q A;  4ENM A;  4A3J J;  4YRV A;  3HOZ J;  4J19 A;  1ZHF A;  1SMT A;  1X58 A;  2CW8 A;  4ENK A;  5TIS C;  5IP7 J;  1S7A A;  3G73 A;  3V7R A;  2CUF A;  2LR8 A;  1K4S A;  3S3M A;  1LFU P;  4IOA F;  2GQQ A;  2BVM A;  1ZGJ A;  2QF7 A;  4PJN A;  2A69 F;  2L7M P;  1ZR4 A;  2IAI A;  5HLG A;  5ED4 A;  3C2G A;  1IV8 A;  2XF6 A;  5DS9 A;  3OYF A;  3ZQC A;  3KP4 A;  2EIL H;  2Z9O A;  2Q1Z B;  1JXS A;  3SZT A;  3S93 A;  3BZC A;  2M34 A;  4ITV A;  2CO5 A;  4FT8 A;  2H1L A;  1J09 A;  1Q1V A;  2JPB A;  1SFE A;  4W97 A;  1QVU A;  2ZCW A;  3AAF A;  3B6A A;  3EUH A;  2WAE A;  2HOT A;  5IYC J;  5KAF C;  3W2A A;  5KK1 A;  2XAS A;  4MQ9 F;  1J2X A;  2Q2E A;  4A6D A;  4E7K A;  2COB A;  2L2O A;  1SFX A;  1BN5 A;  3H5A A;  3HL2 A;  3BR2 A;  2ECC A;  2R5Z A;  1UG0 A;  3T1B A;  5ERI A;  2EQR A;  3SJM A;  2HYJ A;  3DBH B;  4IXA A;  1REP C;  3RCO A;  2VAS A;  4HV5 A;  3ZMU A;  2I5U A;  2DA6 A;  4UUS A;  5HOD A;  1GT0 C;  3U1K A;  4PZJ A;  3ZQ7 A;  2VOD A;  4PJJ A;  5DUI A;  3PL8 A;  4I76 A;  4XN3 A;  3CCL I;  4UHT A;  5F0C A;  3HOV J;  1TT5 B;  3WTW C;  1XTA A;  2PG4 A;  4UB6 C;  5CQG A;  2KIF A;  2W57 A;  3HC7 A;  1WHU A;  4CYC A;  2ZBK A;  3E0J B;  4OWR B;  2CUJ A;  1Y1W J;  1WJ5 A;  4CH7 A;  1YO5 C;  2CUZ A;  5B66 C;  2EA2 A;  1SMY F;  2V9P A;  1KU3 A;  2PBI A;  5J40 A;  4HEA 2;  3A03 A;  3T5X A;  4MTD A;  1X4P A;  2ZXJ A;  5D8L B;  3WTS C;  1FP1 D;  1TP4 A;  3MN2 A;  3K2Z A;  2E1M B;  1S5L C;  2AS5 F;  2O8K A;  2V6E A;  5KVR A;  5FB2 A;  4RS8 A;  3E6B A;  1O7L A;  2WTE A;  3OS2 A;  5LFA A;  1O3T A;  3LST A;  1XB4 A;  5E1X A;  3ABT A;  4P55 A;  2DXI A;  3JRD A;  1D0Y A;  2G0E A;  1QGP A;  1LE8 B;  3CJN A;  1CF7 A;  2DA5 A;  1Y8R B;  2ZXI A;  3S17 J;  4C2T A;  1UST A;  4Y4R A;  1TWC J;  2HVS A;  3PFI A;  2TDX A;  3F6V A;  2E2H J;  5F1R A;  2R5Y A;  5ILU A;  1G4D A;  3GW2 A;  3QPH A;  2LNB A;  1FSE A;  1ETV A;  5K5O A;  2K85 A;  3DU6 A;  2E5Z A;  1OR7 C;  4RAF A;  1QO0 D;  4ZZL A;  3TO7 A;  4G7Z F;  1F5T A;  1XDS A;  2Y0M A;  4MIM A;  2NVT J;  5GTI C;  4BJ5 C;  1QRY A;  2MLG A;  4AU7 A;  5HLH A;  2CV0 A;  2TRT A;  2XSJ C;  3GLL A;  3GTO J;  1ZG5 A;  4CA0 A;  2IGK A;  4L9V A;  2L02 A;  4AVZ A;  4AIK A;  6PAX A;  2LYC A;  2WAF A;  3IP4 B;  1W0T A;  2ETH A;  3QP6 A;  4KYW A;  1RET A;  3ZN1 A;  2RNG A;  3NQO A;  1IRG A;  2IPQ X;  2L4M A;  3GX4 X;  3H9Q A;  2MD0 A;  2LC2 A;  2GBY A;  2VBY A;  5D5X B;  2ZME C;  3CUQ B;  2CWE A;  4CCO A;  4WXC A;  1KGS A;  1A6I A;  5H6R A;  4E7L A;  2COM A;  2ME0 A;  1Z6R A;  4EMS A;  2ID6 A;  4PSX A;  3HRU A;  5ICC A;  1NK3 P;  3FDY A;  2QWW A;  1U8R A;  5FFX A;  4HV6 A;  3K70 D;  2IP2 A;  1QNT A;  2R7R A;  3BTJ A;  4RLF A;  3L2R A;  3BPV A;  1HOM A;  4EM1 A;  5AON A;  2XPU A;  3D5R C;  1AU7 A;  1WZ2 A;  4G9Y A;  3WG9 A;  2FX0 A;  2P7C B;  1MMA A;  3QYB A;  2LKX A;  1FOK A;  1VQN I;  3BDD A;  1AHD P;  1OJL A;  3CMA I;  5LRR A;  1YIO A;  3ABU A;  1JJ6 C;  1LE8 A;  1APL C;  4B48 A;  3A01 A;  4N9I A;  4Q47 A;  1K78 A;  2LKP A;  5EZG A;  1IAW A;  1W1W E;  3CF5 F;  5A2Q Z;  2GWR A;  3KP5 A;  1LDK B;  4B3A A;  2QBY B;  3CJR B;  2A6T A;  4HLX A;  1HSJ A;  4CCM A;  2VT3 A;  2L7Z A;  2P4W A;  1R58 A;  3GBG A;  1OR7 A;  1HKT A;  4M9S A;  3KET A;  4KNY A;  2DFE A;  1ETK A;  1FYK A;  2BE5 F;  3ZMS A;  3S1R J;  4Y3O A;  1TQM A;  5BMZ A;  2F5F A;  3SHF A;  1W7P B;  3H0G J;  2DI3 A;  4BE2 A;  1O4X A;  3SFZ A;  2BGC A;  1Z3Y A;  1OCC H;  1X1C A;  4M9X A;  3HGY A;  2DA4 A;  3GWZ A;  1YRN A;  5IOY A;  2XB0 X;  3HOW J;  1R71 A;  3H1C A;  1FSH A;  4BYY A;  4WXD A;  2PJP A;  1B72 B;  2KRH A;  3ZQF A;  2AQE A;  1V54 H;  1P4X A;  1B9N A;  2DK5 A;  1D8K A;  2M9H A;  4LIU A;  3VSK A;  2DN0 A;  3N97 A;  5ILS A;  2ADU A;  1K7A A;  2EIN H;  2ZME A;  3BLY A;  4M3E A;  3HOS A;  3KP3 A;  2DT6 A;  2E35 A;  3PIO F;  4Q48 A;  1M1E B;  1G8X A;  2X1C A;  1P4W A;  3LMM A;  3OY9 A;  4N9H A;  1XGM A;  1XSV A;  4U7B A;  1UHW A;  2QLZ A;  4EJV A;  2IA1 A;  4KT6 A;  4XKB A;  2ZJQ F;  3JRC A;  1RPW A;  3LA7 A;  1X3U A;  1IGN A;  3ABL H;  5E8G A;  1LPQ A;  3A0H C;  3S14 J;  4IRI A;  5DV5 A;  2CFX A;  3LSM A;  4MGR A;  4EVI A;  3G6E I;  1ZRC A;  3F8B A;  3MZ8 A;  1OKR A;  4XIC A;  3RSN A;  4IQJ A;  1BR4 A;  2MAB A;  1MSE C;  2AO9 A;  1JUS A;  4XLF A;  2X1D A;  2KIQ A;  4HPQ A;  1U8B A;  2EZI A;  2CFO A;  3M8J A;  3HSF A;  1BA5 A;  1UB9 A;  3LQQ A;  3HKZ N;  3OL4 A;  1XG1 A;  2HYG D;  3BCB A;  1DP7 P;  4P9U A;  3HOY J;  3K4B A;  2ID3 A;  2LBF B;  1SD6 A;  1WRJ A;  5JVT A;  1DUX C;  5CVU A;  2DPD A;  2FMY A;  3CCR I;  4FQG A;  2ZNY A;  3BJO A;  4A3K J;  3PNT A;  5H6Q A;  1F9N A;  5DM6 F;  2LMD A;  1OQY A;  1Z7L A;  3ZQG A;  2XGE A;  1TWA J;  4NQW B;  5J1Y A;  4XLN F;  1FY7 A;  2FA5 A;  2IW5 A;  3WHB A;  2IRF G;  3R6S A;  1XMA A;  1N77 A;  4YII A;  1UFM A;  4HX8 A;  3BR1 A;  2PJR B;  5HLT A;  2L01 A;  4DBQ A;  2OF7 A;  3TBI A;  1S6L A;  3G4S I;  4L18 B;  3PUB A;  4N4N B;  2NS7 A;  2VQC A;  2DO7 A;  4ETS A;  1XPX A;  4B1R A;  4UUV A;  1YIJ I;  3BPX A;  2RAE A;  1DGW Y;  3RIR A;  3IRR A;  3J80 Z;  1RI7 A;  1ZK8 A;  3K69 A;  4GFB A;  4AWX B;  1U5T C;  3VYU B;  1BJA A;  1WI9 A;  3ABK H;  3FHN A;  4PDK A;  4EEF G;  3CTA A;  1EA3 A;  2X51 A;  4A3F J;  2M1B A;  4BU2 A;  1P2F A;  1LB2 A;  2QZ8 A;  1R23 A;  1U9O A;  3WTZ A;  3K4K A;  2WC2 A;  1ZYR F;  4BDY A;  2F4I A;  1PP8 F;  5FRO A;  1FEX A;  2UUZ A;  2Y0S N;  3KYD B;  3UKG A;  2DQL A;  4HNT A;  1RR7 A;  4LG3 A;  4L0Y B;  3E6D A;  2R7U A;  3I9V 2;  5L3F A;  4EGY A;  2B9S A;  4AIH A;  1ETW A;  2EA4 A;  4BHB A;  3I64 A;  1DU6 A;  1N25 A;  3DKY A;  3VYT B;  1A35 A;  2DMP A;  3LSK A;  2CQK A;  3ZQH A;  3TED A;  1U9N A;  3R0A A;  2DMQ A;  4IPA A;  2KPM A;  1VZ0 A;  2ESN A;  2NOJ B;  2NNN A;  3PUF A;  1WJF A;  2W82 A;  3FK6 A;  2HS5 A;  1OYW A;  2CJJ A;  4AUX A;  1XGS A;  3EUK L;  2P81 A;  2VLA A;  4HF1 A;  3TQN A;  3TDU C;  5K5Q A;  3ZOB A;  3L9F A;  4HRI A;  3TOA A;  4HOB A;  2LVS A;  5EEG A;  2HQN A;  2QQA A;  3MEX A;  3EYI A;  3OYE A;  3RKX A;  2CSO A;  4HA8 A;  3RTR A;  2FE3 A;  1TNT A;  4PJ0 C;  3IV5 A;  2M87 A;  5J6X A;  1IC8 A;  3L2Q A;  1RC9 A;  4OIO F;  3VPR A;  4UUT A;  2X85 A;  3SQN A;  3H3U A;  2CQ7 A;  5AIP A;  3ESW B;  4FTH A;  2LK2 A;  1BIA A;  1JTY A;  1R4N B;  1WPK A;  2HWV A;  2XRO A;  1ZH5 A;  2UV1 A;  1L3L A;  4CZZ A;  2TCT A;  3GZ6 A;  3GTJ J;  1ACI A;  3SFI A;  4UV9 A;  2YS9 A;  1PUF B;  1YS6 A;  2NVQ J;  2F4M B;  1IJW C;  2VKD A;  4G94 A;  4KIG A;  4N4O B;  3PO3 J;  2JT1 A;  4Y52 J;  2JVH A;  4I99 C;  1FOY A;  1AOY A;  4ESB A;  1LKX A;  2B63 J;  2K3F A;  1A36 A;  4G6T B;  4BHP A;  1QHH D;  3BTL A;  1OPC A;  1MNM C;  9ANT A;  3KX2 A;  4AC0 A;  3F23 A;  2Z2S B;  2DU9 A;  2Y48 A;  5EGO A;  4I01 A;  2Q8K A;  2FUG 2;  4E70 A;  3KEO A;  5K1Y A;  5EZH A;  3I59 B;  5L3D A;  4FAS D;  1W5S A;  3E5U A;  4WWC A;  2B0L A;  1GDT A;  5B5E C;  3QRF F;  2PMU A;  1SAX A;  1K6Y A;  3I54 A;  3WTT C;  3TO9 A;  1ETY A;  1IG7 A;  5LEK A;  1SFO J;  2HFH A;  2MC4 A;  2ELH A;  4I7H A;  3DEW A;  3G1O A;  2NYX A;  2PN6 A;  4M6V A;  4F55 A;  3SDG A;  5M3F J;  2CQQ A;  4MEX F;  3GFJ A;  3WU0 A;  1ZG1 A;  1AKH A;  1QU3 A;  4RM2 A;  2DFI A;  2WAQ N;  2DW4 A;  2LD5 A;  4IVN A;  2EV6 A;  4XOR A;  2EZK A;  5CJ9 A;  5A2Q K;  1H89 C;  4BXF A;  2Y75 A;  3NEU A;  3BP8 A;  1E3O C;  1P92 A;  2Y0S A;  1HXD A;  3I71 A;  4HBL A;  5ILV A;  5EF6 A;  4XLP F;  4JK1 X;  4G12 A;  1UEL B;  3V7C A;  1BIB A;  5IYB J;  4B44 A;  3LSG A;  1TW3 A;  4P96 A;  1R36 A;  1R49 A;  1E17 A;  3C3W A;  2OZU A;  5HNF A;  3I4M J;  3DP7 A;  1YX5 A;  2CRG A;  5IOZ A;  2BXZ A;  3A02 A;  2EFQ A;  3PQK A;  2YX4 A;  3FKJ A;  4HW0 A;  3V4G A;  4AM3 A;  1FYL A;  2FU4 A;  1JJ8 C;  1WH7 A;  2HXI A;  3FXL A;  1S9H A;  3JAM Z;  4BBS J;  3DKW A;  1VQ6 I;  2O7O A;  4BQA A;  4Y15 A;  2QEN A;  2DMN A;  4A3E J;  3V7S A;  1A6Q A;  1MH3 A;  3EPZ A;  4KN7 X;  2EJR A;  5DCF A;  3C1D A;  4ESF A;  3S1N J;  1NTC A;  3FM5 A;  3HRM A;  2XAF A;  3QOE A;  4EM2 A;  3RPU A;  2FQ4 A;  5CYV A;  3F0C A;  1LEB A;  2QUF A;  1QQI A;  3PIP F;  4I0B A;  2XF5 A;  1WVR A;  4PCQ A;  1GXQ A;  3K1M A;  4M9Z A;  3BG6 A;  4CUG A;  3AG2 H;  3I59 A;  4XLA A;  2XPV A;  4BE1 A;  4HZF A;  2LP0 A;  3ERE D;  3GTQ J;  1MJ9 A;  2EIM H;  1QVT A;  1IDY A;  5BOX A;  1Z6T A;  4HF0 A;  2A05 A;  5HDN A;  1RKT A;  1Y0N A;  3CO7 C;  4XRM A;  5E18 F;  2UZK A;  2ZFW A;  3KP6 A;  1TL8 A;  2ESH A;  2STW A;  3DEE A;  3CDH A;  4JBA A;  1GLN A;  2XC7 A;  3ZXS A;  1G3Y A;  4BL0 B;  3BR3 A;  2VQL A;  2Z33 A;  2NS8 A;  1F1Z A;  1HW1 A;  1ZN2 A;  1HLV A;  3FHZ A;  1VQ7 I;  2K27 A;  1T0F A;  3E7L A;  3RZD J;  1R22 A;  2M7A A;  4XNF A;  2K5C A;  3KYL A;  4RLQ A;  3ZR8 X;  3GTK J;  3FK7 A;  4HNV A;  1Y8Q B;  3RQ4 A;  5GP9 A;  2K9Q A;  1SAN A;  2GLO A;  1Z3X A;  2DDB A;  2DOA A;  3DCF A;  2DQR A;  1RRJ A;  5F64 A;  2DLL A;  3CZ6 A;  1PDN C;  1LFP A;  2FXA A;  1YW8 A;  4BQN A;  3LAJ A;  3U1D A;  2HEO A;  1BW5 A;  4RM3 A;  5DEQ A;  4MNU A;  2FML A;  1BI3 A;  3J80 K;  3CCY A;  5TGT A;  4EJU A;  3JTG A;  2E2J J;  3WTX C;  4G6Q A;  4RMN A;  1P4A A;  2ELK A;  3Q5F A;  2R7S A;  1X3Z B;  2VN2 A;  1K83 J;  3OYJ A;  2PQ8 A;  2MBF A;  3MKY B;  2VB6 A;  2VON A;  1XDU A;  2RV8 A;  3ZGK A;  5L3G A;  3OS0 A;  3O8G A;  4A3M J;  2R7V A;  2QGU A;  4AVP A;  2RNJ A;  2OPT A;  4XBF A;  2QCO A;  4L5I A;  4XKW A;  3WHC A;  4RBO A;  3BG7 A;  3CP2 A;  3CME I;  1ZGW A;  3OR2 C;  3I5U A;  4XQF A;  3ZQQ A;  3Q0U A;  3B73 A;  5JHF A;  3S2W A;  4JQF A;  3JRE A;  1D5V A;  1T38 A;  3LSH A;  4ZDO A;  2MW8 A;  1Y39 A;  2V9K A;  4CYC B;  5IPA A;  4LB5 A;  1V5F A;  3N05 A;  4QSH A;  3BY6 A;  1TWG J;  4ZYE A;  1QZZ A;  3A2K A;  5LGU A;  3BG5 A;  3OWT A;  4IX7 A;  3IWF A;  4JX5 A;  3GVA A;  2KRF A;  3SDB A;  2MSY A;  2W24 A;  1D8J A;  4JP0 A;  2XVC A;  4ZDL A;  4RB2 C;  2EIJ H;  4ZYH A;  1B59 A;  2AXT C;  2G9W A;  4WXH A;  4ABZ A;  3HG9 A;  2EPF A;  4F91 B;  1U78 A;  1ULY A;  2VBZ A;  1VND A;  1WKM A;  4W1U A;  1XCV A;  3LSI A;  1X1A A;  3QPT A;  3LWF A;  1R1U A;  2LRE A;  4U0W A;  1USS A;  1CF7 B;  2IA2 A;  3TW6 A;  4Z2Y A;  2RKH A;  3O8H A;  3WG7 H;  1ERD A;  2ME6 A;  4HLY A;  5EEA A;  4LMY A;  2R5Y B;  2DYS H;  2OD5 A;  2HGC A;  3BC8 A;  4ON0 A;  3R61 A;  5EDN A;  4RB0 A;  3CMY A;  3HM5 A;  5FO5 A;  1J59 A;  4L0Z B;  1WFX A;  4CDG A;  1IN7 A;  4LB6 B;  1BI0 A;  3MKL A;  5CVI A;  2V79 A;  4CIC A;  1YX3 A;  4KN4 X;  3CCU I;  2KJB A;  4I2O A;  3M8E A;  1STZ A;  1U0J A;  2CH0 A;  3DEU A;  3KP2 A;  4WK8 F;  1XMX A;  3OYL A;  1PUE E;  1HF0 A;  3L2C A;  1LDD A;  4NC7 A;  4B3X A;  2XF7 A;  1J5Y A;  2CV1 A;  3HHG A;  2HDC A;  3HOU J;  3P9K A;  4UY8 I;  3ISP A;  4TV7 A;  3M1E A;  3H5N A;  4MQV A;  1QPI A;  2O61 A;  1HKS A;  3RYR A;  3S32 A;  4DYC A;  3ERM A;  1QZY A;  5HS8 A;  3OMY A;  2MD5 A;  4IHV A;  1WJC A;  3Q9S A;  3FMQ A;  4D9J A;  5E3L A;  3MD2 A;  4C2U A;  3M9A A;  3M8F A;  3H36 A;  3WGG A;  5BNG A;  2L9N A;  5J1U A;  3QYF A;  1LDJ A;  1VQM I;  1E0E A;  1T6S A;  3PNV A;  1G3W A;  1T08 B;  1W4M A;  4HDV A;  4HQE A;  2V1N A;  4LLN A;  1MIJ A;  3H3V K;  2EB7 A;  1P6R A;  3Q9V A;  2E7W A;  1NG7 A;  2JSP A;  3OOP A;  3FIS A;  1TW2 A;  2K9S A;  2XHK A;  3U9G A;  3WE2 A;  4QPQ A;  5DD8 A;  2D2W A;  2EFN A;  3GME A;  1V4R A;  3ZCO A;  4S04 A;  2R93 J;  1KQ0 A;  1X2M A;  1Z91 A;  4D0P A;  2VQH A;  2OCC H;  2VC0 A;  3KZY A;  3A01 B;  4IO9 F;  1YJW I;  2EV5 A;  1V3F A;  1K78 B;  1HW2 A;  3OYN A;  3BQZ A;  1XS9 A;  2B7E A;  3HB9 A;  1RZ4 A;  2IVM A;  2K86 A;  4HG2 A;  3PSF A;  5HLI A;  1YE9 A;  2RDP A;  1YG2 A;  5EG0 B;  3IRQ A;  5C4X J;  2ZC2 A;  1HCR A;  2E1M C;  3JAM K;  3I56 I;  5FKL A;  4G7H F;  1F43 A;  3KZI C;  3TL4 X;  3H9G A;  3BOQ A;  2M5W A;  2VXD A;  4BQO A;  3JSP A;  2KDZ A;  2IS2 A;  1XX5 A;  1W36 C;  3KYC B;  1IXS B;  4U0Y A;  4A3G J;  2JUC A;  2JTV A;  1MJB A;  3LFU A;  1IXR C;  1G3S A;  2L54 A;  5GPC A;  1YRN B;  3DU5 A;  4O5V A;  3VEP A;  1O3S A;  2KFD A;  4JX4 A;  2GIZ A;  3K4N A;  1TTY A;  3BQY A;  4DIQ A;  2E1N A;  2VL8 A;  3OL3 A;  5EJC A;  1VFC A;  3PSI A;  2IA0 A;  2XGD A;  4LIV A;  2JVG A;  3D0S A;  2ZME B;  4LIT A;  5AIQ A;  3IKV A;  3H3Z A;  2KIU A;  3IH4 A;  3BR0 A;  2LH9 A;  4H4K C;  1LVK A;  1IN4 A;  4C3I J;  4I6Z A;  2M45 A;  1HBX G;  1OFC X;  1HQC A;  1ETQ A;  2E1O A;  3K1P A;  3E6C C;  5D5U B;  1MBE A;  2LF8 A;  1FT9 A;  2HOA A;  3GCM A;  2HXO A;  2KT0 A;  1VQ9 I;  3OIP A;  4BNC A;  2DYR H;  1S8N A;  1KYW A;  3AG4 H;  4A93 J;  4IF4 A;  1JHH A;  4UVA A;  2OU2 A;  4U0V A;  4F7Z A;  2LFB A;  4YFX F;  1R9T J;  1OCP A;  1ETO A;  2M30 A;  3K6G A;  4NDL A;  1K4T A;  1JGG A;  1I1S A;  1Y56 A;  2EFO A;  1K6O A;  1MDM A;  2A5W A;  2ICW G;  3HOT A;  4GYG A;  3CLQ A;  3FM3 A;  2O0Y A;  2P0W A;  3DV8 A;  2GM4 A;  1MH4 A;  3BZ6 A;  5CVR A;  4UV8 A;  4BDZ A;  2L4A A;  2M7B A;  3PO2 J;  1IW7 F;  2P6T A;  4UNO A;  4A3C J;  1GV2 A;  4OU0 A;  1FBU A;  2G7U A;  4HSR A;  4A6E A;  4DZP A;  5EG0 A;  1B8I B;  5HNH A;  4DBR A;  1BI2 A;  3ZMZ A;  2LDU A;  4I09 A;  1BBY A;  3DF8 A;  3VDX A;  2DT5 A;  2OZ6 A;  4I02 A;  1VQ4 I;  5HDG A;  3HDD A;  2PMZ A;  3KEQ A;  2IBD A;  3G71 I;  4DNC A;  4KIT B;  4FE4 A;  3D1N I;  4NHJ A;  5JLX A;  2FQ3 A;  3A4C A;  4R8H A;  5L3B A;  2QQ8 A;  3QOD A;  4RAY A;  3O3K A;  2E7X A;  1FYM A;  5TJJ A;  3AL0 C;  1E3H A;  4HDU A;  5ICF A;  3CC7 I;  4KIB A;  4LK0 F;  1IN5 A;  4KT5 C;  3L2V A;  3MKZ A;  2ZXH A;  3KIO A;  2EWN A;  3S1M J;  2XAG A;  1UZC A;  2JSC A;  1N78 A;  4N0B A;  2VI6 A;  2W1O A;  4GRI A;  2KIM A;  3DPU A;  4GYI A;  1IV6 A;  3H5R A;  1RKW A;  2CW7 A;  5LHG A;  4IHX A;  5DYM A;  1VQO I;  1H88 C;  2OC6 A;  2JRT A;  3TGN A;  2KJC A;  1X1B A;  5GAE J;  2RGV A;  5FRM A;  2RRE A;  3OYK A;  2HYF A;  2JA7 J;  2M3A A;  2X6X A;  3E5X A;  2D5V A;  2EBI A;  4D5C A;  2JA2 A;  2LY1 A;  4M3F A;  1SVL A;  2WB1 A;  3QPS A;  2VE8 A;  4BJT A;  1XD7 A;  4QWQ A;  2XGX A;  3I55 I;  3I4N J;  2F2E A;  3SEZ A;  2VBW A;  4LK1 F;  5E3M A;  1BR1 A;  2H27 A;  4C2M J;  1ON2 A;  2LLK A;  3K4J A;  4KFC A;  3DPT A;  3HYI A;  2DK8 A;  2V9V A;  3WU1 B;  2UWM A;  2MLK A;  2DMT A;  1SFK A;  2UXN A;  1LFB A;  3K4M A;  3E1S A;  3SYT A;  2ZJ2 A;  1B8I A;  1ONV A;  3GFL A;  3HJE A;  5IT9 Z;  3LA3 A;  3ZPL A;  5J47 A;  2XAJ A;  3KFW X;  2FRH A;  1Y6I A;  2HZD A;  3HRS A;  2WWY A;  1FTT A;  2X6W A;  3CC4 I;  3ZMV A;  1DDN A;  3GTP J;  3MQ0 A;  4BGD A;  2JQ7 A;  3L1P A;  3GYH X;  1FOX A;  4CCJ A;  5F08 A;  3ULQ B;  4K2E A;  5K5R A;  3JRF A;  5F27 A;  1SFU A;  1R4M B;  1MBF A;  1U5T B;  4RAZ A;  3T0Y A;  5F1J A;  2HDW A;  5LGT A;  2XKO A;  2ZSI B;  3V8L A;  1W36 D;  2PMH A;  2RQP A;  2K9L A;  2Z3Y A;  1KON A;  3CMM A;  4YIF A;  4ANJ A;  3WGH A;  2M0M A;  2VBX A;  4MO7 A;  3ECO A;  4FCY A;  1R6R A;  3KZZ A;  4DOZ A;  1RNL A;  2EH3 A;  5E8I A;  2QEX I;  5FD5 A;  4L5J A;  2E36 A;  4XKV A;  3FXM A;  5GTH C;  2A07 F;  2Q0O A;  2VQG A;  3QYE A;  1NG6 A;  5EGO B;  4CO8 A;  3A1Y A;  2LOO A;  3FKI J;  4A0Z A;  1KU7 A;  5IP9 J;  3NAR A;  4DGW B;  3WU2 C;  3RQI A;  5J1R A;  5B1B H;  4ASN A;  2XUB A;  4RB3 C;  2GXA A;  1RES A;  2DFF A;  3DPL C;  4X0G A;  2DTR A;  1LNW A;  3MKW B;  1G6N A;  1LVA A;  2M8G X;  4HQM A;  1JKR C;  4FX0 A;  2HQ5 A;  2DCE A;  2ZB9 A;  2XB5 A;  3FBN B;  5FLM J;  4OOI A;  3OYB A;  1AKH B;  4WF2 A;  4AID A;  1KU2 A;  2YU3 A;  2ACJ A;  3W6J B;  2Z1D A;  4ZYA A;  4A0Y A;  4EJW A;  3OYI A;  3CO6 C;  3IAS 2;  1SC7 A;  1SD7 A;  2ISY A;  5IP6 A;  1VQP I;  4IEJ A;  4P5O A;  3PM1 A;  2HDD A;  1U6G A;  4D7M A;  5HOO A;  4KUM A;  4RGU A;  1VTN C;  3BG3 A;  5D8K B;  1MJA A;  5FKM A;  5JHU A;  5CPR B;  2RVC A;  2JMW A;  4RGR A;  2H1K A;  2Y9Z A;  2KZV A;  2P5K A;  5FRN A;  4U7D A;  2JA8 J;  1F4K A;  3OYC A;  3ZMT A;  2W85 A;  3F6O A;  1U5T A;  4PK4 A;  3J7A O;  5E1W A;  4BXU A;  3IUO A;  5K7F A;  2ZFU A;  1X2N A;  3J7Z I;  2GOM A;  3K9T A;  3F72 A;  2YPR A;  4NC6 A;  1O7F A;  2OBP A;  4IRG A;  4RDU A;  2F4O B;  3IL2 A;  4QPO A;  3TP0 A;  1ENH A;  2NVY J;  5CVJ A;  3DTI A;  5M3M J;  1B6A A;  2MC3 A;  2HOS A;  1Y0U A;  2M0C A;  3FXQ A;  1R7J A;  1T98 A;  3Q0W A;  2H8R A;  4GCV A;  4LGW A;  1IRZ A;  2BYV E;  3BCA A;  4A3I J;  4ZTJ A;  1W7P D;  3TW7 A;  5GAD J;  4ZH4 F;  4E7J A;  3VB2 A;  3WTY C;  1XMK A;  3S3N A;  3OSG A;  3CCV I;  2CQN A;  4F93 B;  1X3W B;  2WA0 A;  4Y13 A;  3ZN0 A;  2W7N A;  3BT9 A;  1OCR H;  2L9V A;  3C7J A;  4KIF A;  1QZE A;  2BHY A;  4PGH A;  3J7A Y;  2KL4 A;  4Q5S F;  3ONQ A;  3KP7 A;  4M6Y A;  4IZZ A;  3S3O A;  4IHT A;  4IRH A;  1KYZ A;  4FIS A;  5IT3 A;  2HKO A;  4KIS A;  2BZT A;  1YS7 A;  2IGN A;  5DTD A;  1P7I A;  5JR3 A;  4AYB A;  1K79 A;  1E3P A;  3SZP A;  1ZKG A;  4E7I A;  2W48 A;  5J3L A;  2JZY A;  4NNJ A;  1OYI A;  5JLW A;  4CGZ A;  2VOO A;  4U87 A;  3F8N A;  3CC2 I;  3TMO A;  5GAG J;  3RYP A;  4C9Y A;  4II2 A;  2Z5U A;  5M5W J;  2KZG A;  4M6X A;  3QQA A;  2BY2 A;  4E6K G;  3EQL F;  3H35 A;  4J01 A;  3QAH A;  1WQ2 A;  2QSF X;  1FTZ A;  1KU9 A;  1GVJ A;  3VWB A;  3P9I A;  5FKN A;  3BWG A;  3OYA A;  3I4P A;  4I0A A;  1D1B A;  3V8K A;  1I3A A;  3DBR B;  3NAU A;  1LQ1 A;  2XAH A;  2QA4 I;  4GDF A;  2F5D A;  2Z16 A;  1B1B A;  2DA2 A;  1ETX A;  2A5Y B;  1B4A A;  2VJ5 A;  1D3Y A;  2OV7 A;  5FGM A;  3K10 A;  3P9C A;  2OJE D;  1Z21 A;  3DFG A;  2F5V A;  4L5E A;  1MSF C;  3GTM J;  2IS6 A;  2OAZ A;  3GTG J;  4B4C A;  1IN6 A;  2BEO A;  3TDZ C;  2VXZ A; 
#chains in the Genus database with same CATH homology
 3CCU I;  3CF5 F;  1VQ5 I;  1VQ9 I;  2OTL I;  3CD6 I;  3J7Z I;  3CCS I;  4UY8 I;  3CC4 I;  1YIT I;  1S72 I;  2H8W A;  2JQ7 A;  1FOX A;  5DM7 F;  5GAD J;  1VQL I;  3CCV I;  2FOW A;  3DLL F;  1VQM I;  1YHQ I;  4V19 K;  1YI2 I;  1QA6 A;  2E35 A;  3PIO F;  2QEX I;  1VQ4 I;  2E36 A;  3CJT B;  3CME I;  1VQ6 I;  3G71 I;  4IOA F;  2ZJQ F;  1HC8 A;  4IO9 F;  1Y39 A;  1YJW I;  1YJ9 I;  3G6E I;  3CC2 I;  1MMS A;  3CC7 I;  5GAG J;  1VQK I;  1YJN I;  3PIP F;  3I56 I;  3CCE I;  3CCM I;  5GAH J;  3CCQ I;  2ZJR F;  1VQO I;  1ACI A;  5JVG F;  4IOC F;  1VQ8 I;  3CCR I;  5GAE J;  5DM6 F;  2QA4 I;  1VQP I;  1FOY A;  2K3F A;  3J7Y J;  1FOW A;  3CCJ I;  3I55 I;  3G4S I;  2ZJP F;  1VQN I;  2E34 A;  3CCL I;  2OTJ I;  2NXN B;  3CMA I;  1VQ7 I;  1YIJ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...