3D5RC

Crystal structure of efb-c (n138a) / c3d complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
65
structure length
65
Chain Sequence
TDATIKKEQKLIQAQNLVREFEKTHTVSAHRKAQKAVALVSFEYKVKKMVLQERIDNVLKQGLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Electrostatic contributions drive the interaction between Staphylococcus aureus protein Efb-C and its complement target C3d.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/toxin
total genus 29
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF12199 efb-c Extracellular fibrinogen binding protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3d5rC00
2GOMA 2GOXB 2JVGA 3D5SC 2JVHA 2NOJB 2WY7Q 2WY8Q 3D5RC
chains in the Genus database with same CATH superfamily
1RNLA 1U8BA 2CV1A 1SD5A 4G6TB 1X3UA 1S7EA 1DU0A 4XRSG 1R9TJ 2R92J 4M6YA 4GXOA 4M74A 3GLXA 1D0YA 2OPTA 2JA7J 2Z2SB 1LNWA 2OZUA 3LL7A 3O2PE 2XAGA 4YFKF 3GTGJ 2AXLA 2DU9A 1FYKA 3U21A 3R4KA 3AG4H 3U1KA 4IHSA 2A61A 1QVUA 2LNBA 3TEDA 3G1MA 4KN7X 3ROUA 5E3LA 2JUGA 4HSRA 2IT0A 1IF1A 2JT1A 3QYBA 1TWCJ 4AVZA 2E35A 1JT6A 2V79A 2X6OA 4Y4RA 1FP2A 1WJCA 4RS8A 5FFXA 4HNVA 5E3NA 2RQPA 1T2KA 2XAQA 3W2AA 1D1CA 2DPDA 2LYCA 1LDDA 1AWCA 2E60A 1U3EM 3GFJA 2HOAA 2ZSHB 2GAUA 4RMNA 4DNCA 1DPRA 1ONVA 3AG2H 2A05A 3CDIA 1USSA 2QA4I 5JLWA 1HBXG 2XHKA 1K79A 4I09A 2NAZA 4OIPF 3A0HC 2A68F 2YUSA 3K1MA 4G7ZF 1HOMA 2EV5A 2OU2A 2W00A 1WSUA 1FIPA 2BY2A 2CUFA 3DV8A 2VQHA 4BY7J 1V5FA 2V7FA 2E71A 4ZZDA 2IBDA 3IV5A 5F04A 5F64A 4LK1F 1WKMA 3OL4A 3R6SA 1RRJA 1ZQ3P 1U5TA 4LJZF 3H9JA 5HS8A 2H8WA 1ACIA 1X2MA 2IVMA 1K4TA 3JRIA 2L5QA 3GEZA 1MBJA 1ZKGA 4I02A 3PSIA 4EJWA 1T38A 2ZB9A 3BOQA 1B1BA 3DKXA 3CDHA 5C44J 4A6DA 4Y7NJ 3OIOA 1VQ6I 4U7BA 2ZCWA 3FXKA 3FIWA 4L18B 2JZYA 2M9HA 2B7EA 2DFFA 2W57A 2LP0A 2VN2A 5JFRA 2YX7A 1U8RA 2IGKA 1R1VA 2H6CA 4KT6A 3NRVA 2Q0OA 1OCZH 1QZYA 3G4SI 1V4RA 3KLNA 3HOZJ 1MMAA 2EIKH 3OWTA 4B3XA 1JUMA 4L5JA 5HVQC 2MABA 2NNYA 1BI0A 4FQGA 2HOSA 4BU2A 3ONQA 3JSPA 2EZKA 2JPCA 1LFUP 2QVOA 1YRNA 3I58A 4A0ZA 3HM5A 2LREA 2HPMA 4RLFA 3IRQA 3HRSA 2R7QA 1TT5B 4G94A 4RGUA 5DCFA 4KITB 3DXJF 1X19A 4ETSA 1U9OA 2QCOA 2NRAC 3K4BA 1I6HJ 1Q1HA 2HYJA 4BEHB 2R7VA 1B6AA 2BYVE 3LSPA 2EBIA 2XC7A 3TW6A 4HLXA 1HW2A 4BUPA 3CCLI 1IXRC 1MKMA 4XKBA 4BDYA 2QQ8A 2EINH 3DTKA 3VEPA 2RVCA 2Y2ZA 4D5FA 4LFUA 2O8KA 2X48A 2QBYB 5M3FJ 3ZN0A 2WB1A 3SDBA 1STZA 1Z67A 2DK5A 5JHUA 1ZRFA 3Q0VA 5J1RA 3I56I 2L54A 1OFCX 5EZGA 2ZO4A 1Q1VA 3IUOA 1S7AA 1XSVA 1AOYA 3EPZA 1Z3YA 4AIDA 2D1VA 2XASA 2Y0MA 3IRRA 4G7HF 2KP6A 1YJNI 3V42A 3JTHA 2F5EA 5LEKA 3SXYA 2Z9OA 2HQRA 3GYHX 2HTJA 2NYXA 2J5PA 1IN6A 3QAHA 1BOAA 2ZXIA 3HXLA 3D5RC 4D7NA 2UZKA 1P4AA 4FTHA 1BW6A 3OYKA 1MMSA 2LG4A 5D5UB 2VBXA 2D5VA 2BHYA 2F5VA 2KJCA 4F3QA 3K70D 1OCCH 2UXNA 1PJRA 3RQ4A 2DCEA 3LSJA 2XF6A 4AC0A 1ZH5A 4HW0A 3EUAA 1WJ5A 4NB5A 1C0WA 2V1NA 4BQAA 4FISA 4YIIA 2ZMEA 3TP3A 3RQIA 5BNGA 3WU1B 3FXQA 3RDIA 3BR6A 4JYKA 3M07A 5CQEA 2IGOA 2XVCA 4U0WA 3CCMI 2A69F 2XB5A 4LG3A 1GHCA 5H20A 1XMAA 4M9XA 2KMUA 2DA7A 4ON0A 2DMTA 1JKQC 1G3WA 3QPHA 1WQ2A 3RKYA 1X1BA 2VXZA 2RQQA 3S32A 4V19K 4HV5A 4XLFA 5EJCA 4A2UA 3J7AO 1KU7A 2A6TA 5ILSA 1U5TC 5HDKA 2JWTA 1NH3A 4II3A 2WV1A 3OYGA 3F3XA 1PUFA 2CQXA 5IPAA 4II2A 3I71A 5J1YA 2EV0A 1D8JA 2NXNB 2ID3A 4BGDA 3PIOF 1XCBA 1BR2A 1J0RA 3JCUC 3MKYB 3EUKL 1S72I 3Q0UA 5ICFA 2PMUA 2BVLA 3KFWX 3I54A 4RBOA 2N8GA 1X4PA 4N0BA 1Z0XA 3CP8A 5GPAA 2BZTA 4HQMA 4RB0A 2XIGA 2R7FA 1BBYA 1KQ0A 4GDFA 4C3JJ 1W1WE 1MMDA 2TRTA 2ECBA 2P81A 4HF1A 2EZHA 3AL0C 4JP0A 2NVUB 3MZHA 5DD4A 1SFUA 2DI3A 3OR1C 4KICA 1A36A 1JKOC 1QPMA 4KIFA 1EH8A 1R5HA 3DP7A 2MH9A 4HLYA 4GRIA 1TQPA 1GXPA 5FKNA 2A6HF 2VIXA 5H2FC 1VQ5I 1IZ1A 2Q8KA 4CH7A 4WXCA 1XPXA 3OYHA 4L0YB 3IH4A 2YSRA 1S29A 3H0GJ 2MYSA 1ZG1A 4G12A 3A02A 4XICA 1MSEC 3CTAA 4HG2A 2KLOA 4ZTFA 2MC4A 2JMWA 1JHFA 1Y0NA 2IW5A 3ABTA 4UUSB 1DP7P 1YQAA 4MGRA 3W2WA 2HVSA 1KONA 2KZVA 3K9TA 4XK4A 2COMA 2LSOA 2JK3A 4I01A 3K0LA 3TDUC 5FLXK 2F48A 4A0YA 1RESA 3FWEA 3BTJA 2ACJA 4XLEA 4KA4A 4LGWA 3RZOJ 3FK7A 3HEFA 3GFLA 2DXIA 3HGYA 4N9HA 5GTIC 5H6QA 2DW4A 2ZJRF 1UHMA 3E5UA 1WJDA 3F8NA 5KVRA 1HLVA 3RZDJ 4P96A 3MFKA 2P7CB 1R23A 3PQKA 1Z7LA 2HQNA 5HS9A 1WFXA 5FROA 4KFCA 5A2QZ 4ZYEA 5IYDJ 5KHDA 1V54H 2BY3A 1ZRCA 3KYDB 3NAUA 1BIBA 4OOIA 1H89C 1X4OA 4CCLA 5EGOB 2HVRA 2RNJA 4A93J 2L9SA 1NK3P 4L9TA 4PJ0C 4F92B 1I6XA 1DQUA 1T56A 1FY7A 5DM7F 5DM6F 5IT9Z 4OWRB 4DZJA 2V1UA 3R0JA 1SVLA 4AWXB 3WTVC 1YI2I 3HOYJ 3L09A 4W97A 3GTJJ 3KZZA 4BNCA 4IQJA 1B8IA 3DEWA 5F0FA 1BI3A 2ZKZA 4XORA 2DN0A 3AFHA 3DBLB 3R60A 1HKQA 3A03A 4E7HA 2FNPA 4RAFA 3RPQA 2PQ8A 1O3QA 4BH9A 2EFQA 2KRCA 4PJLA 1O57A 2QLZA 4ITVA 4MHGA 1PDNC 1Y56A 1MBGA 2KIUA 5TGTA 1WJEA 1MBEA 3SJMA 2YR2A 4CDGA 3J81Z 5LGTA 3BR1A 3SFZA 5J8CA 2XGXA 3TDZC 3C2HA 1WH7A 1E3OC 3TKYA 2FX0A 2DA2A 1Z91A 3EUHC 3BJAA 1LQ1A 1TL8A 4YFNF 1U2WA 5CVJA 5FFZA 2RNGA 3H9QA 3VSKA 2MBFA 2IAIA 3KIOA 3GTMJ 3VODA 1YS6A 1K78B 5IY5H 2QQBA 2L7FP 3DWLE 4B3AA 1ENHA 1RPWA 1ZGJA 4XRSA 4XNFA 1ERDA 2Q2EA 3LSIA 3S1MJ 1LFBA 1OCOH 1IV6A 1REPC 3HIFA 1TWHJ 4J01A 2O3FA 2VE8A 2CG4A 4PJJA 1D0XA 2CMPA 3G6EI 4C3IJ 2VI6A 4G6QA 1YJWI 5EYRA 5B1AH 1APLC 2JTVA 4PK4A 1FSEA 4D1QA 1I1GA 4HX7A 3L2UA 4Y15A 4Y52J 3TOBA 1T8IA 2IS6A 1YTYA 3HRTA 3GZ5A 4LOCA 3GTPJ 2FOKA 3ABUA 2R5YB 4IQ4A 3IWFA 3A4CA 3Q3SA 2FBKA 2M2EA 2JQ7A 4A3IJ 2EJRA 1W7PA 2KT0A 1GXQA 1MSFC 3ZPLA 1MDMB 4IHTA 3E6DA 1MJ9A 5E3MA 2BXYA 1RKWA 3K4CA 4HDUA 4Y17A 4CO8A 2LOOA 2M45A 4CZZA 4OU0A 2OCCH 2UWMA 2LF8A 5CJ9A 3CMAI 2HXIA 1L3LA 1AKHB 3A01A 1J75A 5HNFA 2PMZN 2KQRA 2L2OA 3G1LA 4OINF 1ZLJA 2TCTA 3L2QA 3BY6A 1XB4A 3KEOA 1HSJA 4RLQA 4E4HA 1YG2A 3OYAA 1A31A 2DYSH 1CGPA 3TO6A 1SFOJ 3VYRB 1MH3A 2HQ5A 1RC9A 1HDPA 2W24A 1QHGA 1TWFJ 4AYBN 5K7FA 1FTZA 1LE8B 2CUEA 1ZTRA 3ZOBA 2BV6A 3CESA 2X6XA 1IRXA 3BJ6A 4RAYA 2PN6A 2LTPA 5K7ZA 1IN7A 4U0VA 4YG2F 4UVCA 2EZIA 4EJUA 4ZDOA 3HUGB 1UHSA 1W5CC 2R7ZJ 3L7WA 4YIRX 3I3LA 1X1DA 3B02A 3LOCA 5DS9A 3HHHA 1RUNA 4PSWA 3FXLA 3OY9A 2QWWA 1QNTA 1FIAA 3BQZA 1R4NB 2PMHA 3MQ0A 4YFXF 2C6YA 2TDXA 4BL0B 3ZN1A 1LVKA 2P5KA 3DEUA 4UVAA 3AG3H 4C30A 3WG7H 4E7IA 1JUPA 5CQGA 4HEA2 4AUXA 2B63J 3JRFA 2K9NA 4CSWA 2QSFX 4G7OF 2ZNZA 1LJ9A 2Y75A 2PBIA 3CCSI 1F5TA 4J00A 1SC7A 4JBAA 3WG9A 1ZRDA 3RCOA 1VQOI 2HGCA 1Y6IA 3G3ZA 4B8XA 1ZHFA 2OTJI 3VSLA 2KRHA 1OJLA 4GCVA 1YW7A 3CCUI 2CSOA 3FM3A 2E34A 4XKCA 2E2JJ 4C2MJ 3CCYA 2DA6A 2XPWA 2V26A 1TNSA 1TP4A 3JRAA 5E17F 2H1KA 4BE1A 4XR6A 4HBLA 2CWEA 1UG0A 3I4MJ 1R5GA 4L5EA 1TW3A 1N75A 5L3DA 3F8BA 1IXSB 1XN7A 2JJ7A 2OAZA 4M71A 5CYVA 3ERED 1H9GA 4CXFA 4WWCA 2M1BA 2VXDA 3KLOA 1FMVA 4BXUA 4PCQA 2EFNA 2K86A 4LIUA 3P5JA 3FBIB 4A3FJ 2QYOA 2CV2A 1GV5A 2RGVA 1VQPI 2VL8A 1TW2A 1RR8C 3U1DA 2BE5F 5DEQA 2MA3A 1W0UA 1KQ8A 2HKXA 2BXZA 3AKZA 1A35A 4B47A 4EATA 2VC1A 5B3SH 3MD2A 3KYLA 3ZMDA 2F5CA 1UELB 4EGZA 1FJLA 5F1JA 3OIQA 2PX9A 2FMLA 5FB2A 1QZZA 2XUBA 3VFZA 4D5CA 4D0PA 5FLVA 3E6BA 5CVIA 2P6TA 1ZELA 2DK8A 3OSGA 2L01A 4Y13A 1IAWA 3ZR8X 3F72A 1SD4A 1RIOH 1SD6A 2GXBA 1HXDA 3VB2A 4GYGA 2JSPA 2VODA 2L9VA 2JA8J 2KJBA 4MTEA 2NS7A 3M7GA 2ZSIB 2K9QA 3BG7A 1F43A 1FOXA 1HSTA 2ESHA 5LRSA 2AHQA 2HYFA 4DBRA 5HNHA 5DCMA 3CJTB 2BOLA 2QUFA 3CUQA 3L1PA 1MMNA 2O0YA 4PGHA 3IKTA 3R0AA 2F2EA 1VQLI 4ESBA 1ZG3A 1HW1A 3F0CA 3I5UA 1O4XA 3PUFA 1ZG5A 2OBPA 1SVOA 2NNNA 3J80K 5F08A 1S3JA 5IT3A 3HL2A 2LVSA 2NOJB 1HCRA 2MSYA 4XN3A 2R4GA 3CCEI 1VQ9I 3A1YA 1VQKI 1IG7A 1MD0A 2HZTA 5L3EA 1AU7A 2V6EA 1FTTA 1J5YA 2EFPA 1GT0C 2DFHA 3MN2A 2VJ4A 4TV7A 3DTEA 4HDVA 3WTSC 3BZ6A 1Z05A 2CW8A 2BHZA 5HDGA 4MQVA 1XSXA 1Z7UA 5D6FA 3VYSB 5J6XA 1LKXA 3GZNB 3CQZJ 3WU0A 4HV6A 5GAHJ 2P5LC 3FXOA 2PJRA 4CGZA 2O7OA 5JVGF 3WHBA 2M7AA 2DT6A 2DJNA 2M0CA 3I9V2 3CCQI 3OMYA 2VKEA 3IL2A 4PSXA 4UB8C 1WGXA 3S14J 2GZWA 1BIAA 1WJAA 2V6CA 4Q47A 2M34A 3ZMZA 3WE2A 2XKPA 3V8JA 3HOVJ 2K9MA 1FMWA 5KCMA 2PMZA 2EZLA 1DUXC 3Q9SA 1OMIA 2E7XA 3LSKA 4A3BJ 1FWZA 3VDXA 2B0LA 1NG6A 2XDVA 5LGNA 3PL8A 1MH4A 3RKXA 1H8AC 4OAYA 2KDOA 2W85A 4BEHA 4EMSA 2B9SA 4UUTA 4R1HA 2JA6J 2NS8A 5J4YA 2LKXA 4PJMA 3C2GA 3CJQB 2HFHA 3WTZA 5L3FA 1HA8A 5L3BA 1BOBA 3ASOH 1ZGWA 3KP4A 2MG4A 3E3VA 1O7FA 2GOXB 2Z1DA 3SYTA 1P4WA 4LG0A 3RPUD 4BY1J 2W25A 2CYYA 2R7DA 1D1BA 2XGEA 3JAMK 4FE4A 5FLXZ 1QPIA 3BT9A 1BI2A 3GTOJ 3WGIA 1XDUA 2P0WA 2YPRA 2XPVA 1BJZA 2HZDA 1BI1A 4PFPA 1YS7A 3SZTA 1Y1WJ 3EETA 2VQCA 2R7UA 4B09A 4FT8A 4IOCF 4OAZA 2X6YA 5EZHA 5J1UA 2L9RA 1SMYF 3HOSA 1KYWA 1IN4A 2VJIA 3LMMA 1I39A 3BC8A 4A5MA 2RDPA 5M5WJ 5F0CA 2VOOA 1U5TB 2PG4A 4OMZA 1RR7A 2QSGX 2DOAA 4EJVA 5D8KB 2V4JC 3FM5A 1VFCA 4HZFA 1R1TA 2HPIA 3LFKA 4Q48A 3ZMSA 1FC3A 3V7CA 3CMYA 4M72A 2RREA 4JOMA 4E70A 2VB6A 1OR7A 2OTLI 3UNGC 2XKOA 1P7JA 4YIFA 4DOZA 5ICEA 2YX4A 3RYRA 3HRMA 2DTRA 3L2CA 5AIPA 3CUQC 1B72A 2RV8A 1MNDA 4QWQA 1LEAA 5EDNA 4NQWA 3I59A 1E17A 4C3HJ 3QYFA 3BQYA 3O3KA 1VQ4I 1QQIA 3AL0B 4DYCA 3DEEA 1X3WB 1UMQA 1CF7A 1R6RA 4LB5A 4CYDA 1I1SA 1W36D 3LNQA 3ELKA 1J7KA 1W5SA 4BE2A 4G8XA 2COBA 4XN0A 1G2HA 2R7RA 2V9VA 2Y31A 2Y0SA 3C3WA 3F6VA 5CVRA 1ZREA 3HSFA 4WK8F 1VQNI 3S1NJ 4CYCB 4L9VA 1N77A 4KNYA 1UHWA 3PSFA 2X1DA 2QQAA 1XGSA 1G3TA 2G7UA 4OMYA 2CO5A 5LHHA 1X1CA 1IO2A 2WTEA 1BR4A 5HS7A 2E1CA 3CCRI 1KQ9A 2K9LA 4M6XA 2VONA 4IOAF 2QENA 3ZQCA 4HA8A 1LB2A 1ETYA 2JN6A 3S2DJ 4N4NB 3BPXA 3F8CA 4EEFG 2O03A 4NNJA 1EA3A 2E1OA 5IOYA 3S93A 3HJEA 2LD5A 3RTRA 1IN8A 2V1XA 2Y30A 4Z2YA 1YIJI 1FEXA 3M1EA 4D7MA 2LBFB 1MJBA 4IHVA 1OLTA 5EEAA 1O3TA 2M4KA 1VTNC 1PUEE 4DYRA 3IKVA 2XRLA 3BTLA 3H36A 2VC0A 4CCJA 3DBRB 3CC2I 4UNOA 2Z3YA 1G4DA 2UUZA 1JXSA 5GP9A 2VQLA 2K4BA 3KEQA 3A2KA 3T0YA 2OA4A 3PNYA 3PNVA 2VBYA 3CF5F 1BC7C 1EH7A 2FEZA 4ZTJA 2RN7A 2HKOA 2GM4A 4ZDLA 2DBBA 2AXTC 1D8KA 3BWGA 2GXAA 1Y8QB 3HTUA 4O5VA 3ULQB 2QSHX 2VOPA 3S8PA 2M5WA 1B9MA 1FOYA 2D1HA 4NBQA 2P4WA 2MLKA 3LA2A 3HHGA 4XOPA 4XMYA 1NTCA 4K2EA 1JI8A 2KL4A 1I50J 5HLHA 2IGNA 3V4GA 2L9NA 2IS2A 2GBYA 5K1YA 3L2VA 2OQGA 1Y39A 3ZQGA 2VASA 2LF7A 2O5RA 2ZMEB 3HZJA 1E3HA 4XM3A 2E19A 4DIQA 1N25A 3ZQQA 3ZRGA 1TLHB 4A3LJ 2AQEA 1S9HA 4JX6A 4RB1A 1IJWC 2FSWA 1WCMJ 4MLOA 3I0TA 4UXNA 2BBYA 1H88C 3WE3A 1D5YA 4GGGA 4I0BA 3HB9A 1P92A 5DTDA 4XL9A 2A07F 1FOWA 3CUOA 3E1SA 4RAZA 4EJOA 1HKSA 3DPLC 2IA2A 2W82A 3ZQHA 1JKPC 3H3ZA 3ZMUA 4RM3A 5D5VB 1YX5A 2G9WA 2ELJA 5EGOA 3QOEA 4HF2A 1PUFB 1H9TA 3BR2A 5FKOA 5M5YJ 2EV6A 3WTUC 2QF7A 3K4JA 2ZJPF 2M87A 3GTKJ 3KEYA 2GOMA 4MEYF 3PUBA 4L9JA 2E1MC 3S3OA 1IV8A 3KPHA 2DLLA 3W6VA 2MD5A 4B48A 1JTXA 3T5XA 4QTRA 4W1UA 2HEOA 2JA5J 1W36C 4IF4A 3RJPA 2M4GA 4S04A 5C4XJ 3BG9A 1OCTC 2ZXJA 5ED4A 4I7HA 3FXJA 4DGWB 3J7ZI 4P55A 3H5NA 4QIWN 1V5GA 1ZLKA 3K2AA 3CDLA 2X0LA 3N97A 3WHCA 4P1WA 1ETVA 4ESFA 1FX7A 4XBFA 3CD6I 4QPOA 3S3NA 2A6EF 3SDGA 2FBIA 2PEXA 3P9KA 3M9AA 3GZ6A 5CKTA 3QPSA 4KUMA 4I2OA 4M3EA 1WZ2A 1XS9A 4M6VA 2EFOA 2LKSA 1W5TA 3SFIA 5K5QA 3OYIA 1SFXA 2VLAA 1IXCA 2ZMEC 3MAJA 2FOWA 2KIQA 2Y48A 3JW4A 4AU7A 2YS9A 1IUFA 2CQKA 1R7JA 4NDLA 1XTAA 4LIVA 4BKXA 2ZJ2A 1F9NA 4V2FA 3CLQA 2WAEA 2H8RA 1HQCA 3K4KA 5GAGJ 2EA2A 2CH0A 2KHMA 3VOEA 4CA0A 4RM2A 3CMMA 5HODA 1Z1DA 2RKHA 3N4MA 2HR3A 3HPHA 1XDSA 3JRCA 4BJTA 1BN5A 4XRFA 2OJED 3GUDA 3OYDA 2VE9A 5EG0A 3ZCOA 5F0HA 3V7SA 1E2XA 2IA0A 3PFYA 3OIPA 4D9JA 3QODA 1IRGA 4CCMA 3IC7A 3RYPA 1MW7A 2Q1ZB 3EDPA 1XGNA 2M3AA 1LFPA 5DYMA 4PUSA 4M9SA 1T33A 4MFDA 3TMOA 2XGDA 2GIVA 5D5XB 4RDUA 2UXXA 1X1AA 4ENMA 4IHXA 2HWVA 2ME0A 3GMEA 4XSXF 1UG2A 5B5EC 1VQ8I 3KP3A 3DU6A 4P5OA 5F27A 1AKHA 1YJ9I 4HAMA 2ETHA 3L9FA 1IGNA 2K40A 2X51A 2W4SA 1FBUA 4CCKA 4ANJA 2NVQJ 1R71A 1TC3C 4KJZA 3S1RJ 2IEKA 3Q9VA 2ISYA 3EYIA 3WTWC 3G73A 3JR9A 4M3GA 1LE8A 1B8IB 3H0DA 3MKWB 4I6ZA 1ZK8A 1QU3A 5J8FA 2WWYA 5HOOA 3D5LA 2E36A 4EV0A 1JGGA 4FE7A 2CW0F 2K85A 3M8EA 3ECOA 4XIDA 4HSTA 3OV8A 1D1AA 1JUSA 3FDYA 3B73A 1VQMI 1TQMA 5LEJA 2JSCA 2XF7A 4Y3OA 3H35A 2FQ4A 3TOAA 5M5XJ 3D1NI 4F7ZA 2FBHA 3OYBA 3CMEI 4IKFA 2YU9J 1QO0D 3HC7A 3DF8A 1Z6TA 2R7SA 5CLSA 3WTXC 1WJBA 3BR3A 2EA4A 3FBNB 1AA7A 3LSTA 1P2FA 3DTIA 3BZKA 2M30A 3L00A 4EGYA 2L02A 2P6SA 3NEUA 4NUBA 5EF6A 2DPUA 4FASD 1N78A 2X1EA 2Q2EB 2X6WA 3BG6A 3TP0A 1A5JA 1G3YA 4EM1A 1SAXA 4A3JJ 2EILH 3OYCA 3SQNA 2FE3A 3OOUA 3DFGA 4KIGA 3L2WA 4XLNF 2DMQA 2KDZA 1MBKA 2FA5A 2WY8Q 3G71I 4MNUA 1BJAA 4CICA 2RAEA 3DPUA 2VKHA 1J09A 2JPBA 4U88A 3OYNA 3FK6A 2LY1A 2LMDA 3PNTA 3DLLF 1W7PB 2WA0A 5ICCA 2HXOA 1MBHA 1IDZA 3S2HJ 1LUJB 1A04A 1B9NA 2H09A 3WTYC 1K6YA 4ZYGA 2LLKA 3F9KA 4KYWA 5L3CA 1Z6RA 4BJ6C 1EH6A 3CF2A 3HOWJ 2R5ZA 4OIQF 2BY1A 1GDTA 3KZIC 1ETWA 1X2NA 1I3QJ 4AIKA 3A01B 1DGRM 4A0XA 2EFWA 2DO7A 2QZ8A 3OL3A 2AQFA 3BR0A 1GV2A 3GVAA 3FKJA 3LSHA 2NVTJ 4PJNA 4IZZA 1VNDA 1SFKA 2E2HJ 3LFUA 2Y9ZA 1L0OC 3K1PA 4A5NA 1XMKA 3S16J 3PM1A 3COAC 3CCJI 3BJOA 4LLLA 3P9IA 5LFAA 2BW3A 1TTYA 4RB3C 3MMYB 2XAUA 5K7HA 4HF0A 2JVGA 4UV8A 4PZJA 2JRTA 1FSHA 2FD5A 2UV1A 3HSEA 3U9GA 5IYCJ 3LAPA 3GX4X 3UKGA 2I8DA 1YO5C 3WGHA 1D5VA 2XAFA 3GWZA 1KYZA 3TQNA 3MKZA 1XGMA 1GLNA 3KE2A 4IJAA 5DD8A 4IVNA 2O6GE 3CO6C 1K83J 4GFBA 5TRDA 4E7SA 2YU3A 4RGSA 2R7XA 5K5RA 4IX7A 2WADA 1WVRA 3M1CA 3TBIA 3E6CC 4L5IA 1IW7F 2A3SA 5JLXA 1B4AA 3OS2A 1FOKA 2DT5A 4QSHA 5D6EA 2PFBA 4UHTA 4ZH4F 5IT9K 1KU9A 2HDDA 3LA3A 2ME6A 2OUMA 1ZARA 2F4MB 3IH2A 4QPQA 1XGOA 3IAM2 2CRGA 5BPIA 2AS5F 3QWLA 3J7AY 1S7OA 1X3ZB 5BPDA 3ZQFA 3FMQA 2O8XA 2V1DA 5GPCA 3EYYA 4AIJA 5ILVA 1D0ZA 1NG7A 2KFDA 3H1CA 2KRFA 4A3MJ 4I0AA 4CHUA 2W1OA 3H9GA 4E7LA 2HQAA 1JJ6C 1Z9CA 1WRJA 1YW8A 3BTIA 5HLGA 1Y8RB 2VPRA 4GYIA 3FMSA 3O6BB 2OCEA 3BZCA 3BG3A 5EEHA 5BQTA 2Z16A 2H1LA 5FKMA 1SVMA 1F1ZA 3K4LA 1VI0A 3K2ZA 2JUCA 3LAJA 4DZPA 1ON2A 3TGNA 1QRYA 3QP6A 3J7YJ 1GUUA 5J4VA 2MGQA 3ABLH 3MVPA 1IC8A 1FYLA 4LITA 1ZN2A 2R7OA 4YELA 5LRRA 1FP1D 2FF4A 4XKWA 5D4SA 4M3BA 5J47A 4ESJA 4HYEA 4B4CA 5D4RA 2IXSA 5FLMJ 1MIJA 1FBSA 2HNHA 2FQ3A 2V9KA 3T8RA 4BBSJ 1FBQA 1OYWA 2IJLA 4BAYA 2LFBA 2DA4A 2K3PA 3H92A 2LKPA 4KN4X 4KT5C 3S17J 2DODA 4DW6A 4GO1A 3LSRA 9ANTA 1YYVA 2XSJC 1MBFA 1XCVA 3R61A 3CO7C 2WV0A 4DJAA 4L9NA 2R7WA 4KISA 5E8IA 1WI9A 2L4MA 3CZ6A 1DP3A 2CGPA 2L0KA 4ZYHA 3HRUA 1BM9A 4BHBA 5E20A 2G0EA 3JTGA 3DQVC 3BCAA 4X0GA 5IP6A 5IP7J 4UUVA 4ZYAA 3KP6A 3GFIA 2IS4A 2OC6A 3HPGA 5K5OA 2Z33A 2HU9A 3ZMVA 1QBJA 2D2WA 5DCMB 3CUQB 1RETA 2VJJA 1HF0A 2DMPA 2QQ9A 4IRHA 2CS3A 3E5QA 4M3FA 3IAS2 3HOTA 1MNMC 1MNEA 2IP2A 3VWBA 3F22A 4BHCA 4BJ5C 3KP7A 2PJPA 5ICGA 2KISA 3O8HA 3EQLF 5E1ZB 2HYGD 2MW8A 3TL4X 4AYBA 1R22A 2VPLA 3GXOA 4A3CJ 4S05A 3M4OJ 3GLLA 2W84A 3QQAA 4L0ZB 2EQRA 2QGUA 1FPQA 4BHPA 4C9YA 4EQQA 2PI0A 2R93J 1WWXA 4IRGA 1J59A 2QBYA 5LHIA 3OYMA 2GQQA 4F55A 3H3VK 1KU3A 5DUIA 2HTSA 5C4JJ 3HOXJ 1DPUA 1V3FA 4F93B 3B6CA 3QRFF 1LPQA 2XAJA 4E6KG 1U0JA 3KETA 1T0FA 2PJRB 5DDGA 2XGCA 4MTDA 3SHFA 3RPUA 4LMYA 4EM0B 3M3YJ 3DCFA 2DT7B 1UAAA 3BROA 3ZP5A 1G3SA 4ENKA 4A3KJ 3E6MA 1EKEA 1RUOA 2ISZA 3WGGA 2DMNA 1P7IA 1RI7A 5E1WA 1T6SA 4C2TA 3PJRA 3K4MA 4JQFA 3TW7A 2FRHA 5JI6A 1F36A 1E3PA 2Z5UA 3NQOA 5ILUA 3ML6A 1TWGJ 3PO3J 1S5LC 1BA5A 1IDYA 3HTSB 3V7RA 2CQQA 1R1UA 1R00A 4CYCA 3H5AA 1IRFA 2LDUA 2VJ5A 5LD2C 1R36A 4MFEA 3OS0A 1F4KA 4A3DJ 2RC4A 4ZZLA 4I99C 2XPUA 2QEXI 2KIFA 3DLAA 3WTTC 2D45A 3SEZA 4FX4A 3RI4A 3RIRA 3MZYA 4BXFA 4IXAA 5KAFC 1EV7A 5E3OA 4M3DA 1X1PA 1U6GA 2E1NA 2GWRA 1MGTA 5GTHC 2X85A 1Z3XA 1B59A 3CJNA 3G2BA 5J3LA 4HNTA 1OPCA 5M3MJ 2XROA 5EEGA 4LG0B 2GA2A 5BS6A 3RKQA 4BACA 3GBGA 3HDDA 4F91B 2K4JA 2M7BA 1OKRA 4BQOA 1TBXA 3LQRA 3I4NJ 4X6AJ 3ERMA 3FF5A 1TQIA 4BBRJ 4KDPA 4RB2C 1ULYA 4XSZF 3QOPA 4Z6YA 1YRNB 2LBFA 2Y69H 3PFIA 1E0EA 1R49A 3DKWA 2LRDA 3QYEA 1JKRC 1K61A 4HRIA 1LEBA 2E5ZA 5LHGA 4H0EA 4A3EJ 3JSOA 2EPFA 5FD6A 2BEOA 3SZPA 4P9FA 2DTZA 1JE8A 3VYUB 1WH5A 2V9PA 3K1NA 4LLGF 5GADJ 2XB0X 4JX5A 3MWMA 4CCNA 4Y33A 2CFOA 2L4AA 3HOUJ 1K7AA 1XG1A 2R7TA 1QGPA 3U2RA 4A69C 2HDWA 2OV7A 5C3EJ 3NWTA 3FXRA 1OCPA 2DA5A 4MQ9F 3BCBA 4CCOA 1A6IA 3ZQLA 2AO9A 2DAOA 4P9UA 5KNLA 3ECHA 1OCRH 5LLQA 2DQLA 3WODF 1ZR2A 2ELHA 1HW5A 1VZ0A 2WAFA 4A3GJ 1OYYA 4AVPA 2VBWA 2E1MB 2LY9A 1B72B 1ITYA 2W7NA 2LH9A 3GFMA 4NQWB 2ADUA 3I59B 3HG9A 1SD7A 4EVIA 3K6GA 2K3FA 4XLPF 4ASNA 4QLCU 4KMFA 1CF7B 3RKWA 4XOTA 5FO5A 3H3UA 3GW2A 3WU2C 2QKLB 3DU5A 3FXUA 2STWA 3FZVA 2P8TA 2VKVA 4UB6C 2M8EA 2P7VB 4RAGA 5TISC 2F4IA 4UUSA 2HDCA 1O3RA 3K7AJ 1YIOA 2PLYA 3D5SC 1YLFA 3EUHA 4XLAA 5CVUA 3JRBA 2XAHA 5FRNA 2L7KA 2DMUA 4B1RA 2XRNA 4BQNA 3OYJA 4MIMA 2EB7A 3BP8A 4NC8A 2FNAA 2DA3A 1BL0A 1IN5A 6PAXA 3K10A 3HSRA 3C7JA 3S15J 2NOGA 3BG5A 3S3MA 1YW9A 1RKTA 1TZLA 2OZ6A 3N05A 1QVTA 5BOXA 1T0FC 2HOTA 3M8FA 1U78A 4ZC3A 1OISA 1ZYRF 2CU7A 3ABMH 4O3MA 2KIMA 2QKMB 2ESNA 1O7LA 2VKDA 4R79A 2LK2A 3AG1H 1T95A 3E5XA 1JJ8C 5KAIC 3FHNA 4A12A 1J9IA 2LY2A 3JREA 1T08B 3TO7A 2K9SA 4IL6C 1IRZA 4ENNA 3Q0WA 4I98B 3HKZN 2HOEA 2GLOA 2BY0A 3LSMA 1FNNA 4JK1X 1QZEA 1G59A 1USTA 1ETKA 1XX5A 2HI3A 3FXMA 3GTLJ 5TJJA 2WAQN 2CQNA 3IWZA 1OR7C 1BR1A 1D3YA 1S6LA 1YHQI 3P7NA 4S0HB 1YOVB 4X1EA 3IH3A 1TWAJ 1FT9A 2L7MP 3ASNH 1ORKA 4B44A 4Q5SF 1SANA 4ZYDA 2DJIA 2MFZA 2EIMH 2Y9YA 2ZC2A 1Y0UA 2DFIA 3W6KB 5D8LB 3CC4I 3PIPF 2NS0A 4PFOA 4N9IA 3X2QH 4CZCA 4NHJA 2H27A 2J5OA 1LDJA 2ICWG 1EF4A 3IP4B 3W2VA 1M1EB 2KPMA 3V8LA 4HX4A 2GXGA 3C1DA 3GTQJ 5H6RA 3B6AA 5KK1A 5E8GA 5AONA 4AD9A 1VQ7I 2ZFUA 4FHTA 2R0QC 4UY8I 4M9ZA 5E79C 3OOPA 5FGMA 3SEQA 4WX9A 2XV4S 2IPQX 1PYVA 1SMTA 3OR2C 3OSFA 1P6RA 2X4HA 3JRHA 3I53A 3OYLA 4LLNA 1EJ9A 4DQ2A 1MZBA 3DPTA 2MLGA 1QA6A 1PVEA 2MD0A 4IEJA 1K78A 4DYQA 5E1XA 1X58A 4IHYA 4F52A 1JHHA 2IS1A 4ENJA 1JGSA 1T98A 1W0TA 1UB9A 4IHWA 1WI3A 2WY7Q 1WHUA 1KA8A 2DFEA 2ECCA 2E2IJ 3K70C 5GAEJ 4XQFA 1UFMA 1ETXA 3BTCA 1MJAA 5B1BH 1I5ZA 2DQRA 5BMZA 4ZJZA 3BLYA 3CC7I 1BC8C 2FMYA 1S8NA 3C18A 2DA1A 2OF7A 4EJTA 3HBLA 2EH3A 2R5YA 4G9YA 3RSNA 3VYTB 2MC3A 3DKYA 3BPVA 3FX3A 2P5VA 1MMGA 1MDMA 2A5YB 5B66C 4IRIA 3ZGKA 2K27A 2E7WA 3BDDA 2DOEA 2BGCA 4MO7A 2ID6A 1ZR4A 2HVQA 1K6OA 3ABKH 3I4PA 1XSDA 1VF9A 4XLCA 4V2GA 2NVYJ 1V55H 4ABZA 2CFXA 2IA1A 1UZCA 2O61A 2OQRA 1WJFA 4E7JA 2WC2A 2DOFA 2VT2A 1XD7A 2WBMA 3FISA 3KP5A 1R5ID 3QPTA 3MEXA 4CUGA 3J80Z 4MEXF 1NK2P 3LQQA 4JX4A 1PP8F 3CP2A 1LVAA 4WXHA 4BS9A 2FXAA 3OYEA 3H5RA 5F6FA 4FETA 1ODDA 3PO2J 1XMXA 3LSGA 1O3SA 5FRMA 2M0MA 4FX0A 4AM3A 4KMUX 3ZQ7A 3GO5A 1OQYA 1GVDA 4G6DA 4LB6B 1YITI 1W7PD 3HUGA 4OIRF 1JT0A 2K5CA 4BDZA 3E97A 3ISPA 5IYBJ 2ZXWH 4HQEA 3Q5FA 4IPAA 1ON1A 4UVBA 4Q4ZF 3LA7A 2CQ7A 2I10A 1U9NA 3VPRA 2ZNYA 4E7ZA 5EG0B 3QU6A 1KU2A 5FD5A 1ETQA 4XLHA 4RA2A 1T39A 1SFEA 2E5NA 1R4MB 2CV0A 2H6BA 1HC8A 5JHFA 3L2RA 3CJRB 5CPRB 4A6EA 1R58A 5IP9J 3A0BC 2IGMA 3CCVI 5HDNA 3JRDA 3E7LA 2R3SA 4N4OB 3ZMTA 5JVTA 2VBZA 3FMRA 2KZGA 3BR5A 4DBQA 1XC5A 3M8JA 3KZYA 2DDBA 3TO9A 1DU6A 3G1OA 4LD5A 3S2WA 4XONA 2EWNA 3FKIJ 4BQQA 2L7ZA 4U0YA 1Z21A 5AIQA 2F4OB 2FUG2 5ERIA 1DGWY 1SAUA 1YFHA 1A6QA 1AHDP 4M73A 3HGGA 2STTA 5D5WB 5FJ8J 2F5DA 4IO9F 2ZJQF 4XKVA 4NC6A 3F23A 3MCZA 2XF5A 1ZAOA 3JAMZ 3HYIA 3P9CA 5IOZA 3FHZA 2ZFWA 2I5UA 1Z77A 4KIBA 1H0MA 3MKLA 1RZ4A 3QPLA 3T8TA 3KP2A 5FKKA 3HKZA 3T1BA 4NC7A 1TNTA 2CUZA 3C2BA 4HOBA 3D0SA 2LR8A 5DV5A 3UR3C 4LK0F 1P4XA 1V5EA 2FJ1A 4B43A 2QM3A 3KCCA 4RGRA 2WAQA 1TT0A 2JVHA 3I55I 1YX3A 3ZXSA 1J2XA 2Z99A 4J19A 4R8HA 4E7KA 2MH2A 3F6OA 2XSDC 2L3DA 2O9LA 1HDDC 4BE0A 4BXXJ 1ZGAA 2CJJA 3PQJA 1UCRA 2NVXJ 1KZHA 2CW7A 3F8MA 3OYFA 2JA2A 1WPKA 3KYCB 1CQTA 3QU3A 3CLOA 2H94A 1FYMA 3F21A 2ZBKA 4OIOF 3KX2A 3IHUA 5J40A 2M8GX 2W48A 4WF2A 3ZQIA 1G6NA 2OD5A 2ZXHA 4RGXA 5DUKA 4FCYA 3K4NA 2IRFG 3MZ8A 2VT3A 3I64A 2K02A 3NARA 5A2QK 2WB1N 1LDKB 2F5FA 4H4KC 5JR3A 2CUJA 1YE9A 2BVMA 1DDNA 3E0JB 4U87A 5HLTA 1FZPB 1UJ8A 2FU4A 4PGGA 4HX8A 4I76A 4PDKA 2DDAA 1PP7U 3REOA 4HNUA 3W6JB 2X1CA 4EM2A 2HS5A 4O6JA 1I27A 1JTYA 3DBHB 2G7HA 2R5ZB 1SEUA 3O8GA 2A5WA 3K69A 4U7DA 1OYIA 3JRGA 1W4MA 2Y0SN 2K7LA 3QP5A 1POGA 2KKOA 3V8KA 4UV9A 1QHHD 2F6CA 4WXDA 3W3CA 1IUYA 4YRVA 2EIJH 3OS1A 5LBQA 2VUMJ 1G8XA 3GF2A 4ZDPA 3NWSA 4YEJA 5F1RA 4XRMA 1K4SA 5E18F 2GA1A 5L3GA 4C2UA 5HLIA 1I3AA 4BYYA 2GIZA 1P9QC 2VQGA 3J81K 5CVVA 5FKLA 3ESWB 1NHAA 1ETOA 2LC2A 4AIHA 2BW3B 1Y1VJ 2EK5A 3SZGA 4HPQA 2JRMA 4WCGA 2ELKA 1HKTA 3S1QJ 1KGSA 1BW5A 2DYRH 5LGUA 3LWFA 1GVJA 3AAFA 1FLIA 2X9DA 3F8FA 3GCMA
chains in the Genus database with same CATH topology
2CV1A 4G6TB 5HNFA 3K4JA 2KQRA 2L2OA 2X85A 1Z3XA 4HNTA 3KEYA 3G2BA 2GOMA 3PUBA 3L2QA 1D0YA 4BACA 2E1MC 2Z2SB 3GBGA 3LL7A 4RLQA 4E4HA 4F91B 2M7BA 3OYAA 3S3OA 4BQOA 3VYRB 3U21A 1QHGA 4B48A 2LBFA 1E0EA 3QYEA 2LRDA 3CESA 2X6XA 1IRXA 1W36C 4HRIA 2M4GA 2E5ZA 2JUGA 4HSRA 4DGWB 3QYBA 3H5NA 4AVZA 4ZDOA 1V5GA 3HUGB 4Y4RA 1WJCA 3I3LA 1X1DA 4P1WA 3W2AA 3VYUB 4PSWA 4QPOA 1D1CA 3OY9A 3S3NA 2LYCA 2E60A 4CCNA 4Y33A 2ZSHB 2CFOA 4RMNA 5CKTA 4BL0B 2R7TA 2HDWA 1LVKA 2OV7A 3NWTA 3BCBA 3OYIA 4C30A 4CCOA 2VLAA 4E7IA 5CQGA 4AU7A 4HEA2 5KNLA 4CSWA 2WAFA 1VZ0A 2W00A 4J00A 2E1MB 4LIVA 2VQHA 1V5FA 2WAEA 3RCOA 3K4KA 2KHMA 2CH0A 2LH9A 2V7FA 4NQWB 1Y6IA 4CA0A 2W7NA 4RM2A 3CMMA 3HG9A 2KRHA 3VSLA 3K6GA 3HPHA 4BJTA 4XKCA 3OL4A 4XOTA 2V26A 3H9JA 3OYDA 2QKLB 3DU5A 3ZCOA 4BE1A 4XR6A 2L5QA 3PFYA 1UG0A 2F4IA 3OIPA 4D9JA 3QODA 4CCMA 3PSIA 1MW7A 1N75A 2Q1ZB 2M3AA 1LFPA 3TMOA 4PUSA 3DKXA 4U7BA 3D5SC 1X1AA 4XLAA 5FRNA 2VXDA 2L7KA 1FMVA 4BQNA 3OYJA 4LIUA 3FBIB 4NC8A 4P5OA 3DU6A 2CV2A 2VL8A 2IGKA 3K10A 4KT6A 2X51A 3S3MA 1TZLA 2W4SA 4CCKA 4ANJA 3N05A 1MMAA 4B3XA 3OWTA 1T0FC 5HVQC 2MABA 4ZC3A 4KJZA 4BU2A 3AKZA 3ONQA 4B47A 4EATA 2QKMB 3MD2A 2VKDA 3KYLA 1UELB 4R79A 1T95A 3OIQA 3H0DA 3MKWB 3FHNA 1QU3A 2LREA 2HPMA 4RLFA 2R7QA 2LY2A 5HOOA 3D5LA 1ZELA 4KITB 1X19A 3ZR8X 4HSTA 3K4BA 1D1AA 4BEHB 2R7VA 3LSMA 3FDYA 1G59A 2JSPA 2XC7A 4BUPA 2XF7A 4Y3OA 3H35A 2ZSIB 4XKBA 4BDYA 3BG7A 1OR7C 1BR1A 3DTKA 3OYBA 4IKFA 3HC7A 2R7SA 1WJBA 4DBRA 3FBNB 5HNHA 2BOLA 1AA7A 1MMNA 2WB1A 4B44A 3SDBA 3DTIA 2DJIA 2MFZA 4NUBA 4PFOA 3IUOA 4CZCA 4FASD 3HL2A 1N78A 2NOJB 2X1EA 2Q2EB 2X6WA 3BG6A 3EPZA 1Z3YA 3IP4B 4XN3A 2R4GA 3W2VA 2KPMA 3A1YA 2KP6A 3OYCA 3V42A 2V6EA 3OOUA 2VJ4A 2ZFUA 3L2WA 3DTEA 3SEQA 2ZXIA 2WY8Q 3HXLA 3D5RC 1PYVA 2CW8A 3OR2C 3DPUA 2VKHA 3OYLA 1J09A 3OYKA 2LG4A 3VYSB 1LKXA 3OYNA 2LY1A 2F5VA 3DPTA 3PNTA 4F3QA 3K70D 2MD0A 2WA0A 1PJRA 3RQ4A 2IS1A 2DCEA 4F52A 2PJRA 2XF6A 1K6YA 2WY7Q 3F9KA 2M7AA 2DT6A 3I9V2 3EUAA 1WJ5A 3K70C 4BJ6C 2V1NA 3OMYA 4XQFA 3CF2A 4PSXA 1WJAA 1DGRM 4ZJZA 5CQEA 3BLYA 2IGOA 3OL3A 2AQFA 2K9MA 1FMWA 5KCMA 4LG3A 2PMZA 3LSHA 3FKJA 2KMUA 4PJNA 4IZZA 3RSNA 1SFKA 3LFUA 3VYTB 3LSKA 3VDXA 3DKYA 1X1BA 2VXZA 2RQQA 3S32A 1NG6A 2XDVA 1MMGA 3PL8A 4XLFA 5LFAA 2BW3A 3ZGKA 4OAYA 2A6TA 3MMYB 2KDOA 2XAUA 4BEHA 2JVGA 4II3A 2UV1A 2HVQA 3OYGA 2I8DA 4II2A 4PJMA 3C2GA 3CJQB 1HA8A 4XLCA 3MKZA 1GLNA 4BGDA 1BOBA 3MKYB 1BR2A 3EUKL 2BVLA 2GOXB 2Z1DA 3SYTA 3RPUD 1WJFA 4E7SA 1X4PA 4E7JA 4CUGA 2WBMA 2R7XA 3CP8A 1D1BA 2WADA 4IX7A 3M1CA 3TBIA 3OS2A 3CP2A 1MMDA 4BS9A 2P0WA 3OYEA 3H5RA 4FETA 2HZDA 4PFPA 3LSGA 3AL0C 5FRMA 2OUMA 2M0MA 4QPQA 2VQCA 2R7UA 3OR1C 4OAZA 3IAM2 2X6YA 4GRIA 3J7AY 2K5CA 3HOSA 2VIXA 4BDZA 2VJIA 4CH7A 3LMMA 1D0ZA 1NG7A 3OYHA 3BC8A 2W1OA 2MYSA 3H9GA 4E7LA 2HQAA 4HG2A 2KLOA 4ZTFA 2MC4A 4E7ZA 2DOAA 2V4JC 2HPIA 4XLHA 2E5NA 2RREA 4JOMA 2VB6A 2Z16A 2CV0A 3W2WA 3UNGC 5JHFA 3L2RA 4DOZA 3CJRB 5CPRB 1KONA 2KZVA 2HVSA 2IGMA 3K4LA 4N4OB 1MNDA 4LITA 4YELA 2R7OA 3QYFA 4DBQA 4XLEA 4XKWA 3M8JA 3AL0B 3DEEA 1R6RA 2IXSA 1W36D 2DXIA 2HNHA 4XONA 4BQQA 4BE2A 4XN0A 2V9KA 1WJDA 1Z21A 2FUG2 2R7RA 2K3PA 2Y0SA 1DGWY 1SAUA 1Z7LA 1WFXA 5FROA 2XSJC 5KHDA 1N77A 3PSFA 4DJAA 2X1DA 4XKVA 1X4OA 2R7WA 4KISA 1DP3A 3CZ6A 4CCLA 2XF5A 2HVRA 2L9SA 1X1CA 3DQVC 3BCAA 1BR4A 4F92B 4X0GA 3HKZA 4ZYAA 1DQUA 2K9LA 4NC7A 2CUZA 2IS4A 2OC6A 4OWRB 3UR3C 3HPGA 1V5EA 2HU9A 4B43A 4N4NB 2WAQA 1TT0A 2VJJA 2JVHA 1EA3A 4NNJA 4IQJA 1YX3A 3S93A 3ZXSA 2CS3A 3HOTA 4E7KA 3IAS2 3RTRA 1MNEA 4XORA 4BE0A 3AFHA 3VWBA 2LBFB 2CW7A 4E7HA 1OLTA 2JA2A 4BJ5C 3OYFA 2M4KA 2KRCA 4PJLA 4ITVA 3TL4X 4AYBA 2VPLA 1Y56A 4CCJA 3KX2A 5TGTA 1WJEA 2ZXHA 2UUZA 3K4NA 2VQLA 3C2HA 3A2KA 4C9YA 1LDKB 3PNYA 3PNVA 4H4KC 2CUJA 3EUHC 1YE9A 2BVMA 3E0JB 4U87A 5HLTA 3OYMA 4ZTJA 4ZDLA 4F55A 2RNGA 3H9QA 3S8PA 3VSKA 4F93B 4HNUA 4E6KG 1U0JA 2X1CA 3DWLE 2PJRB 1ERDA 4XOPA 4XMYA 4XNFA 3LSIA 1JI8A 2KL4A 2IGNA 4J01A 2L9NA 2IS2A 3L2VA 4PJJA 1D0XA 2CMPA 2VASA 2DT7B 2O5RA 1UAAA 2A5WA 4XM3A 4DIQA 4D1QA 4PK4A 3ZQQA 3ZRGA 2AQEA 3L2UA 1S9HA 2IS6A 3W3CA 1QHHD 2F6CA 4C2TA 3PJRA 3K4MA 4JQFA 4YRVA 4MLOA 3OS1A 1G8XA 4ZDPA 4IQ4A 3NWSA 4YEJA 3A4CA 4C2UA 4XL9A 3E1SA 1P9QC 3H5AA 2VQGA 2VJ5A 3DPLC 5LD2C 3OS0A 2W82A 2LC2A 2BW3B 4RM3A 3SZGA 4HPQA 1YX5A 2ELJA 3QOEA 3K4CA 2LOOA 3DLAA 3SEZA 2UWMA 4BXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOM A;  2GOX B;  2JVG A;  3D5S C;  2JVH A;  2NOJ B;  2WY7 Q;  2WY8 Q;  3D5R C; 
#chains in the Genus database with same CATH topology
 1RNL A;  1U8B A;  2CV1 A;  1SD5 A;  4G6T B;  1X3U A;  1S7E A;  1DU0 A;  4XRS G;  1R9T J;  2R92 J;  4M6Y A;  4GXO A;  4M74 A;  3GLX A;  1D0Y A;  2OPT A;  2JA7 J;  2Z2S B;  1LNW A;  2OZU A;  3LL7 A;  3O2P E;  2XAG A;  4YFK F;  3GTG J;  2AXL A;  2DU9 A;  1FYK A;  3U21 A;  3R4K A;  3AG4 H;  3U1K A;  4IHS A;  2A61 A;  1QVU A;  2LNB A;  3TED A;  3G1M A;  4KN7 X;  3ROU A;  5E3L A;  2JUG A;  4HSR A;  2IT0 A;  1IF1 A;  2JT1 A;  3QYB A;  1TWC J;  4AVZ A;  2E35 A;  1JT6 A;  2V79 A;  2X6O A;  4Y4R A;  1FP2 A;  1WJC A;  4RS8 A;  5FFX A;  4HNV A;  5E3N A;  2RQP A;  1T2K A;  2XAQ A;  3W2A A;  1D1C A;  2DPD A;  2LYC A;  1LDD A;  1AWC A;  2E60 A;  1U3E M;  3GFJ A;  2HOA A;  2ZSH B;  2GAU A;  4RMN A;  4DNC A;  1DPR A;  1ONV A;  3AG2 H;  2A05 A;  3CDI A;  1USS A;  2QA4 I;  5JLW A;  1HBX G;  2XHK A;  1K79 A;  4I09 A;  2NAZ A;  4OIP F;  3A0H C;  2A68 F;  2YUS A;  3K1M A;  4G7Z F;  1HOM A;  2EV5 A;  2OU2 A;  2W00 A;  1WSU A;  1FIP A;  2BY2 A;  2CUF A;  3DV8 A;  2VQH A;  4BY7 J;  1V5F A;  2V7F A;  2E71 A;  4ZZD A;  2IBD A;  3IV5 A;  5F04 A;  5F64 A;  4LK1 F;  1WKM A;  3OL4 A;  3R6S A;  1RRJ A;  1ZQ3 P;  1U5T A;  4LJZ F;  3H9J A;  5HS8 A;  2H8W A;  1ACI A;  1X2M A;  2IVM A;  1K4T A;  3JRI A;  2L5Q A;  3GEZ A;  1MBJ A;  1ZKG A;  4I02 A;  3PSI A;  4EJW A;  1T38 A;  2ZB9 A;  3BOQ A;  1B1B A;  3DKX A;  3CDH A;  5C44 J;  4A6D A;  4Y7N J;  3OIO A;  1VQ6 I;  4U7B A;  2ZCW A;  3FXK A;  3FIW A;  4L18 B;  2JZY A;  2M9H A;  2B7E A;  2DFF A;  2W57 A;  2LP0 A;  2VN2 A;  5JFR A;  2YX7 A;  1U8R A;  2IGK A;  1R1V A;  2H6C A;  4KT6 A;  3NRV A;  2Q0O A;  1OCZ H;  1QZY A;  3G4S I;  1V4R A;  3KLN A;  3HOZ J;  1MMA A;  2EIK H;  3OWT A;  4B3X A;  1JUM A;  4L5J A;  5HVQ C;  2MAB A;  2NNY A;  1BI0 A;  4FQG A;  2HOS A;  4BU2 A;  3ONQ A;  3JSP A;  2EZK A;  2JPC A;  1LFU P;  2QVO A;  1YRN A;  3I58 A;  4A0Z A;  3HM5 A;  2LRE A;  2HPM A;  4RLF A;  3IRQ A;  3HRS A;  2R7Q A;  1TT5 B;  4G94 A;  4RGU A;  5DCF A;  4KIT B;  3DXJ F;  1X19 A;  4ETS A;  1U9O A;  2QCO A;  2NRA C;  3K4B A;  1I6H J;  1Q1H A;  2HYJ A;  4BEH B;  2R7V A;  1B6A A;  2BYV E;  3LSP A;  2EBI A;  2XC7 A;  3TW6 A;  4HLX A;  1HW2 A;  4BUP A;  3CCL I;  1IXR C;  1MKM A;  4XKB A;  4BDY A;  2QQ8 A;  2EIN H;  3DTK A;  3VEP A;  2RVC A;  2Y2Z A;  4D5F A;  4LFU A;  2O8K A;  2X48 A;  2QBY B;  5M3F J;  3ZN0 A;  2WB1 A;  3SDB A;  1STZ A;  1Z67 A;  2DK5 A;  5JHU A;  1ZRF A;  3Q0V A;  5J1R A;  3I56 I;  2L54 A;  1OFC X;  5EZG A;  2ZO4 A;  1Q1V A;  3IUO A;  1S7A A;  1XSV A;  1AOY A;  3EPZ A;  1Z3Y A;  4AID A;  2D1V A;  2XAS A;  2Y0M A;  3IRR A;  4G7H F;  2KP6 A;  1YJN I;  3V42 A;  3JTH A;  2F5E A;  5LEK A;  3SXY A;  2Z9O A;  2HQR A;  3GYH X;  2HTJ A;  2NYX A;  2J5P A;  1IN6 A;  3QAH A;  1BOA A;  2ZXI A;  3HXL A;  3D5R C;  4D7N A;  2UZK A;  1P4A A;  4FTH A;  1BW6 A;  3OYK A;  1MMS A;  2LG4 A;  5D5U B;  2VBX A;  2D5V A;  2BHY A;  2F5V A;  2KJC A;  4F3Q A;  3K70 D;  1OCC H;  2UXN A;  1PJR A;  3RQ4 A;  2DCE A;  3LSJ A;  2XF6 A;  4AC0 A;  1ZH5 A;  4HW0 A;  3EUA A;  1WJ5 A;  4NB5 A;  1C0W A;  2V1N A;  4BQA A;  4FIS A;  4YII A;  2ZME A;  3TP3 A;  3RQI A;  5BNG A;  3WU1 B;  3FXQ A;  3RDI A;  3BR6 A;  4JYK A;  3M07 A;  5CQE A;  2IGO A;  2XVC A;  4U0W A;  3CCM I;  2A69 F;  2XB5 A;  4LG3 A;  1GHC A;  5H20 A;  1XMA A;  4M9X A;  2KMU A;  2DA7 A;  4ON0 A;  2DMT A;  1JKQ C;  1G3W A;  3QPH A;  1WQ2 A;  3RKY A;  1X1B A;  2VXZ A;  2RQQ A;  3S32 A;  4V19 K;  4HV5 A;  4XLF A;  5EJC A;  4A2U A;  3J7A O;  1KU7 A;  2A6T A;  5ILS A;  1U5T C;  5HDK A;  2JWT A;  1NH3 A;  4II3 A;  2WV1 A;  3OYG A;  3F3X A;  1PUF A;  2CQX A;  5IPA A;  4II2 A;  3I71 A;  5J1Y A;  2EV0 A;  1D8J A;  2NXN B;  2ID3 A;  4BGD A;  3PIO F;  1XCB A;  1BR2 A;  1J0R A;  3JCU C;  3MKY B;  3EUK L;  1S72 I;  3Q0U A;  5ICF A;  2PMU A;  2BVL A;  3KFW X;  3I54 A;  4RBO A;  2N8G A;  1X4P A;  4N0B A;  1Z0X A;  3CP8 A;  5GPA A;  2BZT A;  4HQM A;  4RB0 A;  2XIG A;  2R7F A;  1BBY A;  1KQ0 A;  4GDF A;  4C3J J;  1W1W E;  1MMD A;  2TRT A;  2ECB A;  2P81 A;  4HF1 A;  2EZH A;  3AL0 C;  4JP0 A;  2NVU B;  3MZH A;  5DD4 A;  1SFU A;  2DI3 A;  3OR1 C;  4KIC A;  1A36 A;  1JKO C;  1QPM A;  4KIF A;  1EH8 A;  1R5H A;  3DP7 A;  2MH9 A;  4HLY A;  4GRI A;  1TQP A;  1GXP A;  5FKN A;  2A6H F;  2VIX A;  5H2F C;  1VQ5 I;  1IZ1 A;  2Q8K A;  4CH7 A;  4WXC A;  1XPX A;  3OYH A;  4L0Y B;  3IH4 A;  2YSR A;  1S29 A;  3H0G J;  2MYS A;  1ZG1 A;  4G12 A;  3A02 A;  4XIC A;  1MSE C;  3CTA A;  4HG2 A;  2KLO A;  4ZTF A;  2MC4 A;  2JMW A;  1JHF A;  1Y0N A;  2IW5 A;  3ABT A;  4UUS B;  1DP7 P;  1YQA A;  4MGR A;  3W2W A;  2HVS A;  1KON A;  2KZV A;  3K9T A;  4XK4 A;  2COM A;  2LSO A;  2JK3 A;  4I01 A;  3K0L A;  3TDU C;  5FLX K;  2F48 A;  4A0Y A;  1RES A;  3FWE A;  3BTJ A;  2ACJ A;  4XLE A;  4KA4 A;  4LGW A;  3RZO J;  3FK7 A;  3HEF A;  3GFL A;  2DXI A;  3HGY A;  4N9H A;  5GTI C;  5H6Q A;  2DW4 A;  2ZJR F;  1UHM A;  3E5U A;  1WJD A;  3F8N A;  5KVR A;  1HLV A;  3RZD J;  4P96 A;  3MFK A;  2P7C B;  1R23 A;  3PQK A;  1Z7L A;  2HQN A;  5HS9 A;  1WFX A;  5FRO A;  4KFC A;  5A2Q Z;  4ZYE A;  5IYD J;  5KHD A;  1V54 H;  2BY3 A;  1ZRC A;  3KYD B;  3NAU A;  1BIB A;  4OOI A;  1H89 C;  1X4O A;  4CCL A;  5EGO B;  2HVR A;  2RNJ A;  4A93 J;  2L9S A;  1NK3 P;  4L9T A;  4PJ0 C;  4F92 B;  1I6X A;  1DQU A;  1T56 A;  1FY7 A;  5DM7 F;  5DM6 F;  5IT9 Z;  4OWR B;  4DZJ A;  2V1U A;  3R0J A;  1SVL A;  4AWX B;  3WTV C;  1YI2 I;  3HOY J;  3L09 A;  4W97 A;  3GTJ J;  3KZZ A;  4BNC A;  4IQJ A;  1B8I A;  3DEW A;  5F0F A;  1BI3 A;  2ZKZ A;  4XOR A;  2DN0 A;  3AFH A;  3DBL B;  3R60 A;  1HKQ A;  3A03 A;  4E7H A;  2FNP A;  4RAF A;  3RPQ A;  2PQ8 A;  1O3Q A;  4BH9 A;  2EFQ A;  2KRC A;  4PJL A;  1O57 A;  2QLZ A;  4ITV A;  4MHG A;  1PDN C;  1Y56 A;  1MBG A;  2KIU A;  5TGT A;  1WJE A;  1MBE A;  3SJM A;  2YR2 A;  4CDG A;  3J81 Z;  5LGT A;  3BR1 A;  3SFZ A;  5J8C A;  2XGX A;  3TDZ C;  3C2H A;  1WH7 A;  1E3O C;  3TKY A;  2FX0 A;  2DA2 A;  1Z91 A;  3EUH C;  3BJA A;  1LQ1 A;  1TL8 A;  4YFN F;  1U2W A;  5CVJ A;  5FFZ A;  2RNG A;  3H9Q A;  3VSK A;  2MBF A;  2IAI A;  3KIO A;  3GTM J;  3VOD A;  1YS6 A;  1K78 B;  5IY5 H;  2QQB A;  2L7F P;  3DWL E;  4B3A A;  1ENH A;  1RPW A;  1ZGJ A;  4XRS A;  4XNF A;  1ERD A;  2Q2E A;  3LSI A;  3S1M J;  1LFB A;  1OCO H;  1IV6 A;  1REP C;  3HIF A;  1TWH J;  4J01 A;  2O3F A;  2VE8 A;  2CG4 A;  4PJJ A;  1D0X A;  2CMP A;  3G6E I;  4C3I J;  2VI6 A;  4G6Q A;  1YJW I;  5EYR A;  5B1A H;  1APL C;  2JTV A;  4PK4 A;  1FSE A;  4D1Q A;  1I1G A;  4HX7 A;  3L2U A;  4Y15 A;  4Y52 J;  3TOB A;  1T8I A;  2IS6 A;  1YTY A;  3HRT A;  3GZ5 A;  4LOC A;  3GTP J;  2FOK A;  3ABU A;  2R5Y B;  4IQ4 A;  3IWF A;  3A4C A;  3Q3S A;  2FBK A;  2M2E A;  2JQ7 A;  4A3I J;  2EJR A;  1W7P A;  2KT0 A;  1GXQ A;  1MSF C;  3ZPL A;  1MDM B;  4IHT A;  3E6D A;  1MJ9 A;  5E3M A;  2BXY A;  1RKW A;  3K4C A;  4HDU A;  4Y17 A;  4CO8 A;  2LOO A;  2M45 A;  4CZZ A;  4OU0 A;  2OCC H;  2UWM A;  2LF8 A;  5CJ9 A;  3CMA I;  2HXI A;  1L3L A;  1AKH B;  3A01 A;  1J75 A;  5HNF A;  2PMZ N;  2KQR A;  2L2O A;  3G1L A;  4OIN F;  1ZLJ A;  2TCT A;  3L2Q A;  3BY6 A;  1XB4 A;  3KEO A;  1HSJ A;  4RLQ A;  4E4H A;  1YG2 A;  3OYA A;  1A31 A;  2DYS H;  1CGP A;  3TO6 A;  1SFO J;  3VYR B;  1MH3 A;  2HQ5 A;  1RC9 A;  1HDP A;  2W24 A;  1QHG A;  1TWF J;  4AYB N;  5K7F A;  1FTZ A;  1LE8 B;  2CUE A;  1ZTR A;  3ZOB A;  2BV6 A;  3CES A;  2X6X A;  1IRX A;  3BJ6 A;  4RAY A;  2PN6 A;  2LTP A;  5K7Z A;  1IN7 A;  4U0V A;  4YG2 F;  4UVC A;  2EZI A;  4EJU A;  4ZDO A;  3HUG B;  1UHS A;  1W5C C;  2R7Z J;  3L7W A;  4YIR X;  3I3L A;  1X1D A;  3B02 A;  3LOC A;  5DS9 A;  3HHH A;  1RUN A;  4PSW A;  3FXL A;  3OY9 A;  2QWW A;  1QNT A;  1FIA A;  3BQZ A;  1R4N B;  2PMH A;  3MQ0 A;  4YFX F;  2C6Y A;  2TDX A;  4BL0 B;  3ZN1 A;  1LVK A;  2P5K A;  3DEU A;  4UVA A;  3AG3 H;  4C30 A;  3WG7 H;  4E7I A;  1JUP A;  5CQG A;  4HEA 2;  4AUX A;  2B63 J;  3JRF A;  2K9N A;  4CSW A;  2QSF X;  4G7O F;  2ZNZ A;  1LJ9 A;  2Y75 A;  2PBI A;  3CCS I;  1F5T A;  4J00 A;  1SC7 A;  4JBA A;  3WG9 A;  1ZRD A;  3RCO A;  1VQO I;  2HGC A;  1Y6I A;  3G3Z A;  4B8X A;  1ZHF A;  2OTJ I;  3VSL A;  2KRH A;  1OJL A;  4GCV A;  1YW7 A;  3CCU I;  2CSO A;  3FM3 A;  2E34 A;  4XKC A;  2E2J J;  4C2M J;  3CCY A;  2DA6 A;  2XPW A;  2V26 A;  1TNS A;  1TP4 A;  3JRA A;  5E17 F;  2H1K A;  4BE1 A;  4XR6 A;  4HBL A;  2CWE A;  1UG0 A;  3I4M J;  1R5G A;  4L5E A;  1TW3 A;  1N75 A;  5L3D A;  3F8B A;  1IXS B;  1XN7 A;  2JJ7 A;  2OAZ A;  4M71 A;  5CYV A;  3ERE D;  1H9G A;  4CXF A;  4WWC A;  2M1B A;  2VXD A;  3KLO A;  1FMV A;  4BXU A;  4PCQ A;  2EFN A;  2K86 A;  4LIU A;  3P5J A;  3FBI B;  4A3F J;  2QYO A;  2CV2 A;  1GV5 A;  2RGV A;  1VQP I;  2VL8 A;  1TW2 A;  1RR8 C;  3U1D A;  2BE5 F;  5DEQ A;  2MA3 A;  1W0U A;  1KQ8 A;  2HKX A;  2BXZ A;  3AKZ A;  1A35 A;  4B47 A;  4EAT A;  2VC1 A;  5B3S H;  3MD2 A;  3KYL A;  3ZMD A;  2F5C A;  1UEL B;  4EGZ A;  1FJL A;  5F1J A;  3OIQ A;  2PX9 A;  2FML A;  5FB2 A;  1QZZ A;  2XUB A;  3VFZ A;  4D5C A;  4D0P A;  5FLV A;  3E6B A;  5CVI A;  2P6T A;  1ZEL A;  2DK8 A;  3OSG A;  2L01 A;  4Y13 A;  1IAW A;  3ZR8 X;  3F72 A;  1SD4 A;  1RIO H;  1SD6 A;  2GXB A;  1HXD A;  3VB2 A;  4GYG A;  2JSP A;  2VOD A;  2L9V A;  2JA8 J;  2KJB A;  4MTE A;  2NS7 A;  3M7G A;  2ZSI B;  2K9Q A;  3BG7 A;  1F43 A;  1FOX A;  1HST A;  2ESH A;  5LRS A;  2AHQ A;  2HYF A;  4DBR A;  5HNH A;  5DCM A;  3CJT B;  2BOL A;  2QUF A;  3CUQ A;  3L1P A;  1MMN A;  2O0Y A;  4PGH A;  3IKT A;  3R0A A;  2F2E A;  1VQL I;  4ESB A;  1ZG3 A;  1HW1 A;  3F0C A;  3I5U A;  1O4X A;  3PUF A;  1ZG5 A;  2OBP A;  1SVO A;  2NNN A;  3J80 K;  5F08 A;  1S3J A;  5IT3 A;  3HL2 A;  2LVS A;  2NOJ B;  1HCR A;  2MSY A;  4XN3 A;  2R4G A;  3CCE I;  1VQ9 I;  3A1Y A;  1VQK I;  1IG7 A;  1MD0 A;  2HZT A;  5L3E A;  1AU7 A;  2V6E A;  1FTT A;  1J5Y A;  2EFP A;  1GT0 C;  2DFH A;  3MN2 A;  2VJ4 A;  4TV7 A;  3DTE A;  4HDV A;  3WTS C;  3BZ6 A;  1Z05 A;  2CW8 A;  2BHZ A;  5HDG A;  4MQV A;  1XSX A;  1Z7U A;  5D6F A;  3VYS B;  5J6X A;  1LKX A;  3GZN B;  3CQZ J;  3WU0 A;  4HV6 A;  5GAH J;  2P5L C;  3FXO A;  2PJR A;  4CGZ A;  2O7O A;  5JVG F;  3WHB A;  2M7A A;  2DT6 A;  2DJN A;  2M0C A;  3I9V 2;  3CCQ I;  3OMY A;  2VKE A;  3IL2 A;  4PSX A;  4UB8 C;  1WGX A;  3S14 J;  2GZW A;  1BIA A;  1WJA A;  2V6C A;  4Q47 A;  2M34 A;  3ZMZ A;  3WE2 A;  2XKP A;  3V8J A;  3HOV J;  2K9M A;  1FMW A;  5KCM A;  2PMZ A;  2EZL A;  1DUX C;  3Q9S A;  1OMI A;  2E7X A;  3LSK A;  4A3B J;  1FWZ A;  3VDX A;  2B0L A;  1NG6 A;  2XDV A;  5LGN A;  3PL8 A;  1MH4 A;  3RKX A;  1H8A C;  4OAY A;  2KDO A;  2W85 A;  4BEH A;  4EMS A;  2B9S A;  4UUT A;  4R1H A;  2JA6 J;  2NS8 A;  5J4Y A;  2LKX A;  4PJM A;  3C2G A;  3CJQ B;  2HFH A;  3WTZ A;  5L3F A;  1HA8 A;  5L3B A;  1BOB A;  3ASO H;  1ZGW A;  3KP4 A;  2MG4 A;  3E3V A;  1O7F A;  2GOX B;  2Z1D A;  3SYT A;  1P4W A;  4LG0 A;  3RPU D;  4BY1 J;  2W25 A;  2CYY A;  2R7D A;  1D1B A;  2XGE A;  3JAM K;  4FE4 A;  5FLX Z;  1QPI A;  3BT9 A;  1BI2 A;  3GTO J;  3WGI A;  1XDU A;  2P0W A;  2YPR A;  2XPV A;  1BJZ A;  2HZD A;  1BI1 A;  4PFP A;  1YS7 A;  3SZT A;  1Y1W J;  3EET A;  2VQC A;  2R7U A;  4B09 A;  4FT8 A;  4IOC F;  4OAZ A;  2X6Y A;  5EZH A;  5J1U A;  2L9R A;  1SMY F;  3HOS A;  1KYW A;  1IN4 A;  2VJI A;  3LMM A;  1I39 A;  3BC8 A;  4A5M A;  2RDP A;  5M5W J;  5F0C A;  2VOO A;  1U5T B;  2PG4 A;  4OMZ A;  1RR7 A;  2QSG X;  2DOA A;  4EJV A;  5D8K B;  2V4J C;  3FM5 A;  1VFC A;  4HZF A;  1R1T A;  2HPI A;  3LFK A;  4Q48 A;  3ZMS A;  1FC3 A;  3V7C A;  3CMY A;  4M72 A;  2RRE A;  4JOM A;  4E70 A;  2VB6 A;  1OR7 A;  2OTL I;  3UNG C;  2XKO A;  1P7J A;  4YIF A;  4DOZ A;  5ICE A;  2YX4 A;  3RYR A;  3HRM A;  2DTR A;  3L2C A;  5AIP A;  3CUQ C;  1B72 A;  2RV8 A;  1MND A;  4QWQ A;  1LEA A;  5EDN A;  4NQW A;  3I59 A;  1E17 A;  4C3H J;  3QYF A;  3BQY A;  3O3K A;  1VQ4 I;  1QQI A;  3AL0 B;  4DYC A;  3DEE A;  1X3W B;  1UMQ A;  1CF7 A;  1R6R A;  4LB5 A;  4CYD A;  1I1S A;  1W36 D;  3LNQ A;  3ELK A;  1J7K A;  1W5S A;  4BE2 A;  4G8X A;  2COB A;  4XN0 A;  1G2H A;  2R7R A;  2V9V A;  2Y31 A;  2Y0S A;  3C3W A;  3F6V A;  5CVR A;  1ZRE A;  3HSF A;  4WK8 F;  1VQN I;  3S1N J;  4CYC B;  4L9V A;  1N77 A;  4KNY A;  1UHW A;  3PSF A;  2X1D A;  2QQA A;  1XGS A;  1G3T A;  2G7U A;  4OMY A;  2CO5 A;  5LHH A;  1X1C A;  1IO2 A;  2WTE A;  1BR4 A;  5HS7 A;  2E1C A;  3CCR I;  1KQ9 A;  2K9L A;  4M6X A;  2VON A;  4IOA F;  2QEN A;  3ZQC A;  4HA8 A;  1LB2 A;  1ETY A;  2JN6 A;  3S2D J;  4N4N B;  3BPX A;  3F8C A;  4EEF G;  2O03 A;  4NNJ A;  1EA3 A;  2E1O A;  5IOY A;  3S93 A;  3HJE A;  2LD5 A;  3RTR A;  1IN8 A;  2V1X A;  2Y30 A;  4Z2Y A;  1YIJ I;  1FEX A;  3M1E A;  4D7M A;  2LBF B;  1MJB A;  4IHV A;  1OLT A;  5EEA A;  1O3T A;  2M4K A;  1VTN C;  1PUE E;  4DYR A;  3IKV A;  2XRL A;  3BTL A;  3H36 A;  2VC0 A;  4CCJ A;  3DBR B;  3CC2 I;  4UNO A;  2Z3Y A;  1G4D A;  2UUZ A;  1JXS A;  5GP9 A;  2VQL A;  2K4B A;  3KEQ A;  3A2K A;  3T0Y A;  2OA4 A;  3PNY A;  3PNV A;  2VBY A;  3CF5 F;  1BC7 C;  1EH7 A;  2FEZ A;  4ZTJ A;  2RN7 A;  2HKO A;  2GM4 A;  4ZDL A;  2DBB A;  2AXT C;  1D8K A;  3BWG A;  2GXA A;  1Y8Q B;  3HTU A;  4O5V A;  3ULQ B;  2QSH X;  2VOP A;  3S8P A;  2M5W A;  1B9M A;  1FOY A;  2D1H A;  4NBQ A;  2P4W A;  2MLK A;  3LA2 A;  3HHG A;  4XOP A;  4XMY A;  1NTC A;  4K2E A;  1JI8 A;  2KL4 A;  1I50 J;  5HLH A;  2IGN A;  3V4G A;  2L9N A;  2IS2 A;  2GBY A;  5K1Y A;  3L2V A;  2OQG A;  1Y39 A;  3ZQG A;  2VAS A;  2LF7 A;  2O5R A;  2ZME B;  3HZJ A;  1E3H A;  4XM3 A;  2E19 A;  4DIQ A;  1N25 A;  3ZQQ A;  3ZRG A;  1TLH B;  4A3L J;  2AQE A;  1S9H A;  4JX6 A;  4RB1 A;  1IJW C;  2FSW A;  1WCM J;  4MLO A;  3I0T A;  4UXN A;  2BBY A;  1H88 C;  3WE3 A;  1D5Y A;  4GGG A;  4I0B A;  3HB9 A;  1P92 A;  5DTD A;  4XL9 A;  2A07 F;  1FOW A;  3CUO A;  3E1S A;  4RAZ A;  4EJO A;  1HKS A;  3DPL C;  2IA2 A;  2W82 A;  3ZQH A;  1JKP C;  3H3Z A;  3ZMU A;  4RM3 A;  5D5V B;  1YX5 A;  2G9W A;  2ELJ A;  5EGO A;  3QOE A;  4HF2 A;  1PUF B;  1H9T A;  3BR2 A;  5FKO A;  5M5Y J;  2EV6 A;  3WTU C;  2QF7 A;  3K4J A;  2ZJP F;  2M87 A;  3GTK J;  3KEY A;  2GOM A;  4MEY F;  3PUB A;  4L9J A;  2E1M C;  3S3O A;  1IV8 A;  3KPH A;  2DLL A;  3W6V A;  2MD5 A;  4B48 A;  1JTX A;  3T5X A;  4QTR A;  4W1U A;  2HEO A;  2JA5 J;  1W36 C;  4IF4 A;  3RJP A;  2M4G A;  4S04 A;  5C4X J;  3BG9 A;  1OCT C;  2ZXJ A;  5ED4 A;  4I7H A;  3FXJ A;  4DGW B;  3J7Z I;  4P55 A;  3H5N A;  4QIW N;  1V5G A;  1ZLK A;  3K2A A;  3CDL A;  2X0L A;  3N97 A;  3WHC A;  4P1W A;  1ETV A;  4ESF A;  1FX7 A;  4XBF A;  3CD6 I;  4QPO A;  3S3N A;  2A6E F;  3SDG A;  2FBI A;  2PEX A;  3P9K A;  3M9A A;  3GZ6 A;  5CKT A;  3QPS A;  4KUM A;  4I2O A;  4M3E A;  1WZ2 A;  1XS9 A;  4M6V A;  2EFO A;  2LKS A;  1W5T A;  3SFI A;  5K5Q A;  3OYI A;  1SFX A;  2VLA A;  1IXC A;  2ZME C;  3MAJ A;  2FOW A;  2KIQ A;  2Y48 A;  3JW4 A;  4AU7 A;  2YS9 A;  1IUF A;  2CQK A;  1R7J A;  4NDL A;  1XTA A;  4LIV A;  4BKX A;  2ZJ2 A;  1F9N A;  4V2F A;  3CLQ A;  2WAE A;  2H8R A;  1HQC A;  3K4K A;  5GAG J;  2EA2 A;  2CH0 A;  2KHM A;  3VOE A;  4CA0 A;  4RM2 A;  3CMM A;  5HOD A;  1Z1D A;  2RKH A;  3N4M A;  2HR3 A;  3HPH A;  1XDS A;  3JRC A;  4BJT A;  1BN5 A;  4XRF A;  2OJE D;  3GUD A;  3OYD A;  2VE9 A;  5EG0 A;  3ZCO A;  5F0H A;  3V7S A;  1E2X A;  2IA0 A;  3PFY A;  3OIP A;  4D9J A;  3QOD A;  1IRG A;  4CCM A;  3IC7 A;  3RYP A;  1MW7 A;  2Q1Z B;  3EDP A;  1XGN A;  2M3A A;  1LFP A;  5DYM A;  4PUS A;  4M9S A;  1T33 A;  4MFD A;  3TMO A;  2XGD A;  2GIV A;  5D5X B;  4RDU A;  2UXX A;  1X1A A;  4ENM A;  4IHX A;  2HWV A;  2ME0 A;  3GME A;  4XSX F;  1UG2 A;  5B5E C;  1VQ8 I;  3KP3 A;  3DU6 A;  4P5O A;  5F27 A;  1AKH A;  1YJ9 I;  4HAM A;  2ETH A;  3L9F A;  1IGN A;  2K40 A;  2X51 A;  2W4S A;  1FBU A;  4CCK A;  4ANJ A;  2NVQ J;  1R71 A;  1TC3 C;  4KJZ A;  3S1R J;  2IEK A;  3Q9V A;  2ISY A;  3EYI A;  3WTW C;  3G73 A;  3JR9 A;  4M3G A;  1LE8 A;  1B8I B;  3H0D A;  3MKW B;  4I6Z A;  1ZK8 A;  1QU3 A;  5J8F A;  2WWY A;  5HOO A;  3D5L A;  2E36 A;  4EV0 A;  1JGG A;  4FE7 A;  2CW0 F;  2K85 A;  3M8E A;  3ECO A;  4XID A;  4HST A;  3OV8 A;  1D1A A;  1JUS A;  3FDY A;  3B73 A;  1VQM I;  1TQM A;  5LEJ A;  2JSC A;  2XF7 A;  4Y3O A;  3H35 A;  2FQ4 A;  3TOA A;  5M5X J;  3D1N I;  4F7Z A;  2FBH A;  3OYB A;  3CME I;  4IKF A;  2YU9 J;  1QO0 D;  3HC7 A;  3DF8 A;  1Z6T A;  2R7S A;  5CLS A;  3WTX C;  1WJB A;  3BR3 A;  2EA4 A;  3FBN B;  1AA7 A;  3LST A;  1P2F A;  3DTI A;  3BZK A;  2M30 A;  3L00 A;  4EGY A;  2L02 A;  2P6S A;  3NEU A;  4NUB A;  5EF6 A;  2DPU A;  4FAS D;  1N78 A;  2X1E A;  2Q2E B;  2X6W A;  3BG6 A;  3TP0 A;  1A5J A;  1G3Y A;  4EM1 A;  1SAX A;  4A3J J;  2EIL H;  3OYC A;  3SQN A;  2FE3 A;  3OOU A;  3DFG A;  4KIG A;  3L2W A;  4XLN F;  2DMQ A;  2KDZ A;  1MBK A;  2FA5 A;  2WY8 Q;  3G71 I;  4MNU A;  1BJA A;  4CIC A;  2RAE A;  3DPU A;  2VKH A;  1J09 A;  2JPB A;  4U88 A;  3OYN A;  3FK6 A;  2LY1 A;  2LMD A;  3PNT A;  3DLL F;  1W7P B;  2WA0 A;  5ICC A;  2HXO A;  1MBH A;  1IDZ A;  3S2H J;  1LUJ B;  1A04 A;  1B9N A;  2H09 A;  3WTY C;  1K6Y A;  4ZYG A;  2LLK A;  3F9K A;  4KYW A;  5L3C A;  1Z6R A;  4BJ6 C;  1EH6 A;  3CF2 A;  3HOW J;  2R5Z A;  4OIQ F;  2BY1 A;  1GDT A;  3KZI C;  1ETW A;  1X2N A;  1I3Q J;  4AIK A;  3A01 B;  1DGR M;  4A0X A;  2EFW A;  2DO7 A;  2QZ8 A;  3OL3 A;  2AQF A;  3BR0 A;  1GV2 A;  3GVA A;  3FKJ A;  3LSH A;  2NVT J;  4PJN A;  4IZZ A;  1VND A;  1SFK A;  2E2H J;  3LFU A;  2Y9Z A;  1L0O C;  3K1P A;  4A5N A;  1XMK A;  3S16 J;  3PM1 A;  3COA C;  3CCJ I;  3BJO A;  4LLL A;  3P9I A;  5LFA A;  2BW3 A;  1TTY A;  4RB3 C;  3MMY B;  2XAU A;  5K7H A;  4HF0 A;  2JVG A;  4UV8 A;  4PZJ A;  2JRT A;  1FSH A;  2FD5 A;  2UV1 A;  3HSE A;  3U9G A;  5IYC J;  3LAP A;  3GX4 X;  3UKG A;  2I8D A;  1YO5 C;  3WGH A;  1D5V A;  2XAF A;  3GWZ A;  1KYZ A;  3TQN A;  3MKZ A;  1XGM A;  1GLN A;  3KE2 A;  4IJA A;  5DD8 A;  4IVN A;  2O6G E;  3CO6 C;  1K83 J;  4GFB A;  5TRD A;  4E7S A;  2YU3 A;  4RGS A;  2R7X A;  5K5R A;  4IX7 A;  2WAD A;  1WVR A;  3M1C A;  3TBI A;  3E6C C;  4L5I A;  1IW7 F;  2A3S A;  5JLX A;  1B4A A;  3OS2 A;  1FOK A;  2DT5 A;  4QSH A;  5D6E A;  2PFB A;  4UHT A;  4ZH4 F;  5IT9 K;  1KU9 A;  2HDD A;  3LA3 A;  2ME6 A;  2OUM A;  1ZAR A;  2F4M B;  3IH2 A;  4QPQ A;  1XGO A;  3IAM 2;  2CRG A;  5BPI A;  2AS5 F;  3QWL A;  3J7A Y;  1S7O A;  1X3Z B;  5BPD A;  3ZQF A;  3FMQ A;  2O8X A;  2V1D A;  5GPC A;  3EYY A;  4AIJ A;  5ILV A;  1D0Z A;  1NG7 A;  2KFD A;  3H1C A;  2KRF A;  4A3M J;  4I0A A;  4CHU A;  2W1O A;  3H9G A;  4E7L A;  2HQA A;  1JJ6 C;  1Z9C A;  1WRJ A;  1YW8 A;  3BTI A;  5HLG A;  1Y8R B;  2VPR A;  4GYI A;  3FMS A;  3O6B B;  2OCE A;  3BZC A;  3BG3 A;  5EEH A;  5BQT A;  2Z16 A;  2H1L A;  5FKM A;  1SVM A;  1F1Z A;  3K4L A;  1VI0 A;  3K2Z A;  2JUC A;  3LAJ A;  4DZP A;  1ON2 A;  3TGN A;  1QRY A;  3QP6 A;  3J7Y J;  1GUU A;  5J4V A;  2MGQ A;  3ABL H;  3MVP A;  1IC8 A;  1FYL A;  4LIT A;  1ZN2 A;  2R7O A;  4YEL A;  5LRR A;  1FP1 D;  2FF4 A;  4XKW A;  5D4S A;  4M3B A;  5J47 A;  4ESJ A;  4HYE A;  4B4C A;  5D4R A;  2IXS A;  5FLM J;  1MIJ A;  1FBS A;  2HNH A;  2FQ3 A;  2V9K A;  3T8R A;  4BBS J;  1FBQ A;  1OYW A;  2IJL A;  4BAY A;  2LFB A;  2DA4 A;  2K3P A;  3H92 A;  2LKP A;  4KN4 X;  4KT5 C;  3S17 J;  2DOD A;  4DW6 A;  4GO1 A;  3LSR A;  9ANT A;  1YYV A;  2XSJ C;  1MBF A;  1XCV A;  3R61 A;  3CO7 C;  2WV0 A;  4DJA A;  4L9N A;  2R7W A;  4KIS A;  5E8I A;  1WI9 A;  2L4M A;  3CZ6 A;  1DP3 A;  2CGP A;  2L0K A;  4ZYH A;  3HRU A;  1BM9 A;  4BHB A;  5E20 A;  2G0E A;  3JTG A;  3DQV C;  3BCA A;  4X0G A;  5IP6 A;  5IP7 J;  4UUV A;  4ZYA A;  3KP6 A;  3GFI A;  2IS4 A;  2OC6 A;  3HPG A;  5K5O A;  2Z33 A;  2HU9 A;  3ZMV A;  1QBJ A;  2D2W A;  5DCM B;  3CUQ B;  1RET A;  2VJJ A;  1HF0 A;  2DMP A;  2QQ9 A;  4IRH A;  2CS3 A;  3E5Q A;  4M3F A;  3IAS 2;  3HOT A;  1MNM C;  1MNE A;  2IP2 A;  3VWB A;  3F22 A;  4BHC A;  4BJ5 C;  3KP7 A;  2PJP A;  5ICG A;  2KIS A;  3O8H A;  3EQL F;  5E1Z B;  2HYG D;  2MW8 A;  3TL4 X;  4AYB A;  1R22 A;  2VPL A;  3GXO A;  4A3C J;  4S05 A;  3M4O J;  3GLL A;  2W84 A;  3QQA A;  4L0Z B;  2EQR A;  2QGU A;  1FPQ A;  4BHP A;  4C9Y A;  4EQQ A;  2PI0 A;  2R93 J;  1WWX A;  4IRG A;  1J59 A;  2QBY A;  5LHI A;  3OYM A;  2GQQ A;  4F55 A;  3H3V K;  1KU3 A;  5DUI A;  2HTS A;  5C4J J;  3HOX J;  1DPU A;  1V3F A;  4F93 B;  3B6C A;  3QRF F;  1LPQ A;  2XAJ A;  4E6K G;  1U0J A;  3KET A;  1T0F A;  2PJR B;  5DDG A;  2XGC A;  4MTD A;  3SHF A;  3RPU A;  4LMY A;  4EM0 B;  3M3Y J;  3DCF A;  2DT7 B;  1UAA A;  3BRO A;  3ZP5 A;  1G3S A;  4ENK A;  4A3K J;  3E6M A;  1EKE A;  1RUO A;  2ISZ A;  3WGG A;  2DMN A;  1P7I A;  1RI7 A;  5E1W A;  1T6S A;  4C2T A;  3PJR A;  3K4M A;  4JQF A;  3TW7 A;  2FRH A;  5JI6 A;  1F36 A;  1E3P A;  2Z5U A;  3NQO A;  5ILU A;  3ML6 A;  1TWG J;  3PO3 J;  1S5L C;  1BA5 A;  1IDY A;  3HTS B;  3V7R A;  2CQQ A;  1R1U A;  1R00 A;  4CYC A;  3H5A A;  1IRF A;  2LDU A;  2VJ5 A;  5LD2 C;  1R36 A;  4MFE A;  3OS0 A;  1F4K A;  4A3D J;  2RC4 A;  4ZZL A;  4I99 C;  2XPU A;  2QEX I;  2KIF A;  3DLA A;  3WTT C;  2D45 A;  3SEZ A;  4FX4 A;  3RI4 A;  3RIR A;  3MZY A;  4BXF A;  4IXA A;  5KAF C;  1EV7 A;  5E3O A;  4M3D A;  1X1P A;  1U6G A;  2E1N A;  2GWR A;  1MGT A;  5GTH C;  2X85 A;  1Z3X A;  1B59 A;  3CJN A;  3G2B A;  5J3L A;  4HNT A;  1OPC A;  5M3M J;  2XRO A;  5EEG A;  4LG0 B;  2GA2 A;  5BS6 A;  3RKQ A;  4BAC A;  3GBG A;  3HDD A;  4F91 B;  2K4J A;  2M7B A;  1OKR A;  4BQO A;  1TBX A;  3LQR A;  3I4N J;  4X6A J;  3ERM A;  3FF5 A;  1TQI A;  4BBR J;  4KDP A;  4RB2 C;  1ULY A;  4XSZ F;  3QOP A;  4Z6Y A;  1YRN B;  2LBF A;  2Y69 H;  3PFI A;  1E0E A;  1R49 A;  3DKW A;  2LRD A;  3QYE A;  1JKR C;  1K61 A;  4HRI A;  1LEB A;  2E5Z A;  5LHG A;  4H0E A;  4A3E J;  3JSO A;  2EPF A;  5FD6 A;  2BEO A;  3SZP A;  4P9F A;  2DTZ A;  1JE8 A;  3VYU B;  1WH5 A;  2V9P A;  3K1N A;  4LLG F;  5GAD J;  2XB0 X;  4JX5 A;  3MWM A;  4CCN A;  4Y33 A;  2CFO A;  2L4A A;  3HOU J;  1K7A A;  1XG1 A;  2R7T A;  1QGP A;  3U2R A;  4A69 C;  2HDW A;  2OV7 A;  5C3E J;  3NWT A;  3FXR A;  1OCP A;  2DA5 A;  4MQ9 F;  3BCB A;  4CCO A;  1A6I A;  3ZQL A;  2AO9 A;  2DAO A;  4P9U A;  5KNL A;  3ECH A;  1OCR H;  5LLQ A;  2DQL A;  3WOD F;  1ZR2 A;  2ELH A;  1HW5 A;  1VZ0 A;  2WAF A;  4A3G J;  1OYY A;  4AVP A;  2VBW A;  2E1M B;  2LY9 A;  1B72 B;  1ITY A;  2W7N A;  2LH9 A;  3GFM A;  4NQW B;  2ADU A;  3I59 B;  3HG9 A;  1SD7 A;  4EVI A;  3K6G A;  2K3F A;  4XLP F;  4ASN A;  4QLC U;  4KMF A;  1CF7 B;  3RKW A;  4XOT A;  5FO5 A;  3H3U A;  3GW2 A;  3WU2 C;  2QKL B;  3DU5 A;  3FXU A;  2STW A;  3FZV A;  2P8T A;  2VKV A;  4UB6 C;  2M8E A;  2P7V B;  4RAG A;  5TIS C;  2F4I A;  4UUS A;  2HDC A;  1O3R A;  3K7A J;  1YIO A;  2PLY A;  3D5S C;  1YLF A;  3EUH A;  4XLA A;  5CVU A;  3JRB A;  2XAH A;  5FRN A;  2L7K A;  2DMU A;  4B1R A;  2XRN A;  4BQN A;  3OYJ A;  4MIM A;  2EB7 A;  3BP8 A;  4NC8 A;  2FNA A;  2DA3 A;  1BL0 A;  1IN5 A;  6PAX A;  3K10 A;  3HSR A;  3C7J A;  3S15 J;  2NOG A;  3BG5 A;  3S3M A;  1YW9 A;  1RKT A;  1TZL A;  2OZ6 A;  3N05 A;  1QVT A;  5BOX A;  1T0F C;  2HOT A;  3M8F A;  1U78 A;  4ZC3 A;  1OIS A;  1ZYR F;  2CU7 A;  3ABM H;  4O3M A;  2KIM A;  2QKM B;  2ESN A;  1O7L A;  2VKD A;  4R79 A;  2LK2 A;  3AG1 H;  1T95 A;  3E5X A;  1JJ8 C;  5KAI C;  3FHN A;  4A12 A;  1J9I A;  2LY2 A;  3JRE A;  1T08 B;  3TO7 A;  2K9S A;  4IL6 C;  1IRZ A;  4ENN A;  3Q0W A;  4I98 B;  3HKZ N;  2HOE A;  2GLO A;  2BY0 A;  3LSM A;  1FNN A;  4JK1 X;  1QZE A;  1G59 A;  1UST A;  1ETK A;  1XX5 A;  2HI3 A;  3FXM A;  3GTL J;  5TJJ A;  2WAQ N;  2CQN A;  3IWZ A;  1OR7 C;  1BR1 A;  1D3Y A;  1S6L A;  1YHQ I;  3P7N A;  4S0H B;  1YOV B;  4X1E A;  3IH3 A;  1TWA J;  1FT9 A;  2L7M P;  3ASN H;  1ORK A;  4B44 A;  4Q5S F;  1SAN A;  4ZYD A;  2DJI A;  2MFZ A;  2EIM H;  2Y9Y A;  2ZC2 A;  1Y0U A;  2DFI A;  3W6K B;  5D8L B;  3CC4 I;  3PIP F;  2NS0 A;  4PFO A;  4N9I A;  3X2Q H;  4CZC A;  4NHJ A;  2H27 A;  2J5O A;  1LDJ A;  2ICW G;  1EF4 A;  3IP4 B;  3W2V A;  1M1E B;  2KPM A;  3V8L A;  4HX4 A;  2GXG A;  3C1D A;  3GTQ J;  5H6R A;  3B6A A;  5KK1 A;  5E8G A;  5AON A;  4AD9 A;  1VQ7 I;  2ZFU A;  4FHT A;  2R0Q C;  4UY8 I;  4M9Z A;  5E79 C;  3OOP A;  5FGM A;  3SEQ A;  4WX9 A;  2XV4 S;  2IPQ X;  1PYV A;  1SMT A;  3OR2 C;  3OSF A;  1P6R A;  2X4H A;  3JRH A;  3I53 A;  3OYL A;  4LLN A;  1EJ9 A;  4DQ2 A;  1MZB A;  3DPT A;  2MLG A;  1QA6 A;  1PVE A;  2MD0 A;  4IEJ A;  1K78 A;  4DYQ A;  5E1X A;  1X58 A;  4IHY A;  4F52 A;  1JHH A;  2IS1 A;  4ENJ A;  1JGS A;  1T98 A;  1W0T A;  1UB9 A;  4IHW A;  1WI3 A;  2WY7 Q;  1WHU A;  1KA8 A;  2DFE A;  2ECC A;  2E2I J;  3K70 C;  5GAE J;  4XQF A;  1UFM A;  1ETX A;  3BTC A;  1MJA A;  5B1B H;  1I5Z A;  2DQR A;  5BMZ A;  4ZJZ A;  3BLY A;  3CC7 I;  1BC8 C;  2FMY A;  1S8N A;  3C18 A;  2DA1 A;  2OF7 A;  4EJT A;  3HBL A;  2EH3 A;  2R5Y A;  4G9Y A;  3RSN A;  3VYT B;  2MC3 A;  3DKY A;  3BPV A;  3FX3 A;  2P5V A;  1MMG A;  1MDM A;  2A5Y B;  5B66 C;  4IRI A;  3ZGK A;  2K27 A;  2E7W A;  3BDD A;  2DOE A;  2BGC A;  4MO7 A;  2ID6 A;  1ZR4 A;  2HVQ A;  1K6O A;  3ABK H;  3I4P A;  1XSD A;  1VF9 A;  4XLC A;  4V2G A;  2NVY J;  1V55 H;  4ABZ A;  2CFX A;  2IA1 A;  1UZC A;  2O61 A;  2OQR A;  1WJF A;  4E7J A;  2WC2 A;  2DOF A;  2VT2 A;  1XD7 A;  2WBM A;  3FIS A;  3KP5 A;  1R5I D;  3QPT A;  3MEX A;  4CUG A;  3J80 Z;  4MEX F;  1NK2 P;  3LQQ A;  4JX4 A;  1PP8 F;  3CP2 A;  1LVA A;  4WXH A;  4BS9 A;  2FXA A;  3OYE A;  3H5R A;  5F6F A;  4FET A;  1ODD A;  3PO2 J;  1XMX A;  3LSG A;  1O3S A;  5FRM A;  2M0M A;  4FX0 A;  4AM3 A;  4KMU X;  3ZQ7 A;  3GO5 A;  1OQY A;  1GVD A;  4G6D A;  4LB6 B;  1YIT I;  1W7P D;  3HUG A;  4OIR F;  1JT0 A;  2K5C A;  4BDZ A;  3E97 A;  3ISP A;  5IYB J;  2ZXW H;  4HQE A;  3Q5F A;  4IPA A;  1ON1 A;  4UVB A;  4Q4Z F;  3LA7 A;  2CQ7 A;  2I10 A;  1U9N A;  3VPR A;  2ZNY A;  4E7Z A;  5EG0 B;  3QU6 A;  1KU2 A;  5FD5 A;  1ETQ A;  4XLH A;  4RA2 A;  1T39 A;  1SFE A;  2E5N A;  1R4M B;  2CV0 A;  2H6B A;  1HC8 A;  5JHF A;  3L2R A;  3CJR B;  5CPR B;  4A6E A;  1R58 A;  5IP9 J;  3A0B C;  2IGM A;  3CCV I;  5HDN A;  3JRD A;  3E7L A;  2R3S A;  4N4O B;  3ZMT A;  5JVT A;  2VBZ A;  3FMR A;  2KZG A;  3BR5 A;  4DBQ A;  1XC5 A;  3M8J A;  3KZY A;  2DDB A;  3TO9 A;  1DU6 A;  3G1O A;  4LD5 A;  3S2W A;  4XON A;  2EWN A;  3FKI J;  4BQQ A;  2L7Z A;  4U0Y A;  1Z21 A;  5AIQ A;  2F4O B;  2FUG 2;  5ERI A;  1DGW Y;  1SAU A;  1YFH A;  1A6Q A;  1AHD P;  4M73 A;  3HGG A;  2STT A;  5D5W B;  5FJ8 J;  2F5D A;  4IO9 F;  2ZJQ F;  4XKV A;  4NC6 A;  3F23 A;  3MCZ A;  2XF5 A;  1ZAO A;  3JAM Z;  3HYI A;  3P9C A;  5IOZ A;  3FHZ A;  2ZFW A;  2I5U A;  1Z77 A;  4KIB A;  1H0M A;  3MKL A;  1RZ4 A;  3QPL A;  3T8T A;  3KP2 A;  5FKK A;  3HKZ A;  3T1B A;  4NC7 A;  1TNT A;  2CUZ A;  3C2B A;  4HOB A;  3D0S A;  2LR8 A;  5DV5 A;  3UR3 C;  4LK0 F;  1P4X A;  1V5E A;  2FJ1 A;  4B43 A;  2QM3 A;  3KCC A;  4RGR A;  2WAQ A;  1TT0 A;  2JVH A;  3I55 I;  1YX3 A;  3ZXS A;  1J2X A;  2Z99 A;  4J19 A;  4R8H A;  4E7K A;  2MH2 A;  3F6O A;  2XSD C;  2L3D A;  2O9L A;  1HDD C;  4BE0 A;  4BXX J;  1ZGA A;  2CJJ A;  3PQJ A;  1UCR A;  2NVX J;  1KZH A;  2CW7 A;  3F8M A;  3OYF A;  2JA2 A;  1WPK A;  3KYC B;  1CQT A;  3QU3 A;  3CLO A;  2H94 A;  1FYM A;  3F21 A;  2ZBK A;  4OIO F;  3KX2 A;  3IHU A;  5J40 A;  2M8G X;  2W48 A;  4WF2 A;  3ZQI A;  1G6N A;  2OD5 A;  2ZXH A;  4RGX A;  5DUK A;  4FCY A;  3K4N A;  2IRF G;  3MZ8 A;  2VT3 A;  3I64 A;  2K02 A;  3NAR A;  5A2Q K;  2WB1 N;  1LDK B;  2F5F A;  4H4K C;  5JR3 A;  2CUJ A;  1YE9 A;  2BVM A;  1DDN A;  3E0J B;  4U87 A;  5HLT A;  1FZP B;  1UJ8 A;  2FU4 A;  4PGG A;  4HX8 A;  4I76 A;  4PDK A;  2DDA A;  1PP7 U;  3REO A;  4HNU A;  3W6J B;  2X1C A;  4EM2 A;  2HS5 A;  4O6J A;  1I27 A;  1JTY A;  3DBH B;  2G7H A;  2R5Z B;  1SEU A;  3O8G A;  2A5W A;  3K69 A;  4U7D A;  1OYI A;  3JRG A;  1W4M A;  2Y0S N;  2K7L A;  3QP5 A;  1POG A;  2KKO A;  3V8K A;  4UV9 A;  1QHH D;  2F6C A;  4WXD A;  3W3C A;  1IUY A;  4YRV A;  2EIJ H;  3OS1 A;  5LBQ A;  2VUM J;  1G8X A;  3GF2 A;  4ZDP A;  3NWS A;  4YEJ A;  5F1R A;  4XRM A;  1K4S A;  5E18 F;  2GA1 A;  5L3G A;  4C2U A;  5HLI A;  1I3A A;  4BYY A;  2GIZ A;  1P9Q C;  2VQG A;  3J81 K;  5CVV A;  5FKL A;  3ESW B;  1NHA A;  1ETO A;  2LC2 A;  4AIH A;  2BW3 B;  1Y1V J;  2EK5 A;  3SZG A;  4HPQ A;  2JRM A;  4WCG A;  2ELK A;  1HKT A;  3S1Q J;  1KGS A;  1BW5 A;  2DYR H;  5LGU A;  3LWF A;  1GVJ A;  3AAF A;  1FLI A;  2X9D A;  3F8F A;  3GCM A; 
#chains in the Genus database with same CATH homology
 2CV1 A;  4G6T B;  5HNF A;  3K4J A;  2KQR A;  2L2O A;  2X85 A;  1Z3X A;  4HNT A;  3KEY A;  3G2B A;  2GOM A;  3PUB A;  3L2Q A;  1D0Y A;  4BAC A;  2E1M C;  2Z2S B;  3GBG A;  3LL7 A;  4RLQ A;  4E4H A;  4F91 B;  2M7B A;  3OYA A;  3S3O A;  4BQO A;  3VYR B;  3U21 A;  1QHG A;  4B48 A;  2LBF A;  1E0E A;  3QYE A;  2LRD A;  3CES A;  2X6X A;  1IRX A;  1W36 C;  4HRI A;  2M4G A;  2E5Z A;  2JUG A;  4HSR A;  4DGW B;  3QYB A;  3H5N A;  4AVZ A;  4ZDO A;  1V5G A;  3HUG B;  4Y4R A;  1WJC A;  3I3L A;  1X1D A;  4P1W A;  3W2A A;  3VYU B;  4PSW A;  4QPO A;  1D1C A;  3OY9 A;  3S3N A;  2LYC A;  2E60 A;  4CCN A;  4Y33 A;  2ZSH B;  2CFO A;  4RMN A;  5CKT A;  4BL0 B;  2R7T A;  2HDW A;  1LVK A;  2OV7 A;  3NWT A;  3BCB A;  3OYI A;  4C30 A;  4CCO A;  2VLA A;  4E7I A;  5CQG A;  4AU7 A;  4HEA 2;  5KNL A;  4CSW A;  2WAF A;  1VZ0 A;  2W00 A;  4J00 A;  2E1M B;  4LIV A;  2VQH A;  1V5F A;  2WAE A;  3RCO A;  3K4K A;  2KHM A;  2CH0 A;  2LH9 A;  2V7F A;  4NQW B;  1Y6I A;  4CA0 A;  2W7N A;  4RM2 A;  3CMM A;  3HG9 A;  2KRH A;  3VSL A;  3K6G A;  3HPH A;  4BJT A;  4XKC A;  3OL4 A;  4XOT A;  2V26 A;  3H9J A;  3OYD A;  2QKL B;  3DU5 A;  3ZCO A;  4BE1 A;  4XR6 A;  2L5Q A;  3PFY A;  1UG0 A;  2F4I A;  3OIP A;  4D9J A;  3QOD A;  4CCM A;  3PSI A;  1MW7 A;  1N75 A;  2Q1Z B;  2M3A A;  1LFP A;  3TMO A;  4PUS A;  3DKX A;  4U7B A;  3D5S C;  1X1A A;  4XLA A;  5FRN A;  2VXD A;  2L7K A;  1FMV A;  4BQN A;  3OYJ A;  4LIU A;  3FBI B;  4NC8 A;  4P5O A;  3DU6 A;  2CV2 A;  2VL8 A;  2IGK A;  3K10 A;  4KT6 A;  2X51 A;  3S3M A;  1TZL A;  2W4S A;  4CCK A;  4ANJ A;  3N05 A;  1MMA A;  4B3X A;  3OWT A;  1T0F C;  5HVQ C;  2MAB A;  4ZC3 A;  4KJZ A;  4BU2 A;  3AKZ A;  3ONQ A;  4B47 A;  4EAT A;  2QKM B;  3MD2 A;  2VKD A;  3KYL A;  1UEL B;  4R79 A;  1T95 A;  3OIQ A;  3H0D A;  3MKW B;  3FHN A;  1QU3 A;  2LRE A;  2HPM A;  4RLF A;  2R7Q A;  2LY2 A;  5HOO A;  3D5L A;  1ZEL A;  4KIT B;  1X19 A;  3ZR8 X;  4HST A;  3K4B A;  1D1A A;  4BEH B;  2R7V A;  3LSM A;  3FDY A;  1G59 A;  2JSP A;  2XC7 A;  4BUP A;  2XF7 A;  4Y3O A;  3H35 A;  2ZSI B;  4XKB A;  4BDY A;  3BG7 A;  1OR7 C;  1BR1 A;  3DTK A;  3OYB A;  4IKF A;  3HC7 A;  2R7S A;  1WJB A;  4DBR A;  3FBN B;  5HNH A;  2BOL A;  1AA7 A;  1MMN A;  2WB1 A;  4B44 A;  3SDB A;  3DTI A;  2DJI A;  2MFZ A;  4NUB A;  4PFO A;  3IUO A;  4CZC A;  4FAS D;  3HL2 A;  1N78 A;  2NOJ B;  2X1E A;  2Q2E B;  2X6W A;  3BG6 A;  3EPZ A;  1Z3Y A;  3IP4 B;  4XN3 A;  2R4G A;  3W2V A;  2KPM A;  3A1Y A;  2KP6 A;  3OYC A;  3V42 A;  2V6E A;  3OOU A;  2VJ4 A;  2ZFU A;  3L2W A;  3DTE A;  3SEQ A;  2ZXI A;  2WY8 Q;  3HXL A;  3D5R C;  1PYV A;  2CW8 A;  3OR2 C;  3DPU A;  2VKH A;  3OYL A;  1J09 A;  3OYK A;  2LG4 A;  3VYS B;  1LKX A;  3OYN A;  2LY1 A;  2F5V A;  3DPT A;  3PNT A;  4F3Q A;  3K70 D;  2MD0 A;  2WA0 A;  1PJR A;  3RQ4 A;  2IS1 A;  2DCE A;  4F52 A;  2PJR A;  2XF6 A;  1K6Y A;  2WY7 Q;  3F9K A;  2M7A A;  2DT6 A;  3I9V 2;  3EUA A;  1WJ5 A;  3K70 C;  4BJ6 C;  2V1N A;  3OMY A;  4XQF A;  3CF2 A;  4PSX A;  1WJA A;  1DGR M;  4ZJZ A;  5CQE A;  3BLY A;  2IGO A;  3OL3 A;  2AQF A;  2K9M A;  1FMW A;  5KCM A;  4LG3 A;  2PMZ A;  3LSH A;  3FKJ A;  2KMU A;  4PJN A;  4IZZ A;  3RSN A;  1SFK A;  3LFU A;  3VYT B;  3LSK A;  3VDX A;  3DKY A;  1X1B A;  2VXZ A;  2RQQ A;  3S32 A;  1NG6 A;  2XDV A;  1MMG A;  3PL8 A;  4XLF A;  5LFA A;  2BW3 A;  3ZGK A;  4OAY A;  2A6T A;  3MMY B;  2KDO A;  2XAU A;  4BEH A;  2JVG A;  4II3 A;  2UV1 A;  2HVQ A;  3OYG A;  2I8D A;  4II2 A;  4PJM A;  3C2G A;  3CJQ B;  1HA8 A;  4XLC A;  3MKZ A;  1GLN A;  4BGD A;  1BOB A;  3MKY B;  1BR2 A;  3EUK L;  2BVL A;  2GOX B;  2Z1D A;  3SYT A;  3RPU D;  1WJF A;  4E7S A;  1X4P A;  4E7J A;  4CUG A;  2WBM A;  2R7X A;  3CP8 A;  1D1B A;  2WAD A;  4IX7 A;  3M1C A;  3TBI A;  3OS2 A;  3CP2 A;  1MMD A;  4BS9 A;  2P0W A;  3OYE A;  3H5R A;  4FET A;  2HZD A;  4PFP A;  3LSG A;  3AL0 C;  5FRM A;  2OUM A;  2M0M A;  4QPQ A;  2VQC A;  2R7U A;  3OR1 C;  4OAZ A;  3IAM 2;  2X6Y A;  4GRI A;  3J7A Y;  2K5C A;  3HOS A;  2VIX A;  4BDZ A;  2VJI A;  4CH7 A;  3LMM A;  1D0Z A;  1NG7 A;  3OYH A;  3BC8 A;  2W1O A;  2MYS A;  3H9G A;  4E7L A;  2HQA A;  4HG2 A;  2KLO A;  4ZTF A;  2MC4 A;  4E7Z A;  2DOA A;  2V4J C;  2HPI A;  4XLH A;  2E5N A;  2RRE A;  4JOM A;  2VB6 A;  2Z16 A;  2CV0 A;  3W2W A;  3UNG C;  5JHF A;  3L2R A;  4DOZ A;  3CJR B;  5CPR B;  1KON A;  2KZV A;  2HVS A;  2IGM A;  3K4L A;  4N4O B;  1MND A;  4LIT A;  4YEL A;  2R7O A;  3QYF A;  4DBQ A;  4XLE A;  4XKW A;  3M8J A;  3AL0 B;  3DEE A;  1R6R A;  2IXS A;  1W36 D;  2DXI A;  2HNH A;  4XON A;  4BQQ A;  4BE2 A;  4XN0 A;  2V9K A;  1WJD A;  1Z21 A;  2FUG 2;  2R7R A;  2K3P A;  2Y0S A;  1DGW Y;  1SAU A;  1Z7L A;  1WFX A;  5FRO A;  2XSJ C;  5KHD A;  1N77 A;  3PSF A;  4DJA A;  2X1D A;  4XKV A;  1X4O A;  2R7W A;  4KIS A;  1DP3 A;  3CZ6 A;  4CCL A;  2XF5 A;  2HVR A;  2L9S A;  1X1C A;  3DQV C;  3BCA A;  1BR4 A;  4F92 B;  4X0G A;  3HKZ A;  4ZYA A;  1DQU A;  2K9L A;  4NC7 A;  2CUZ A;  2IS4 A;  2OC6 A;  4OWR B;  3UR3 C;  3HPG A;  1V5E A;  2HU9 A;  4B43 A;  4N4N B;  2WAQ A;  1TT0 A;  2VJJ A;  2JVH A;  1EA3 A;  4NNJ A;  4IQJ A;  1YX3 A;  3S93 A;  3ZXS A;  2CS3 A;  3HOT A;  4E7K A;  3IAS 2;  3RTR A;  1MNE A;  4XOR A;  4BE0 A;  3AFH A;  3VWB A;  2LBF B;  2CW7 A;  4E7H A;  1OLT A;  2JA2 A;  4BJ5 C;  3OYF A;  2M4K A;  2KRC A;  4PJL A;  4ITV A;  3TL4 X;  4AYB A;  2VPL A;  1Y56 A;  4CCJ A;  3KX2 A;  5TGT A;  1WJE A;  2ZXH A;  2UUZ A;  3K4N A;  2VQL A;  3C2H A;  3A2K A;  4C9Y A;  1LDK B;  3PNY A;  3PNV A;  4H4K C;  2CUJ A;  3EUH C;  1YE9 A;  2BVM A;  3E0J B;  4U87 A;  5HLT A;  3OYM A;  4ZTJ A;  4ZDL A;  4F55 A;  2RNG A;  3H9Q A;  3S8P A;  3VSK A;  4F93 B;  4HNU A;  4E6K G;  1U0J A;  2X1C A;  3DWL E;  2PJR B;  1ERD A;  4XOP A;  4XMY A;  4XNF A;  3LSI A;  1JI8 A;  2KL4 A;  2IGN A;  4J01 A;  2L9N A;  2IS2 A;  3L2V A;  4PJJ A;  1D0X A;  2CMP A;  2VAS A;  2DT7 B;  2O5R A;  1UAA A;  2A5W A;  4XM3 A;  4DIQ A;  4D1Q A;  4PK4 A;  3ZQQ A;  3ZRG A;  2AQE A;  3L2U A;  1S9H A;  2IS6 A;  3W3C A;  1QHH D;  2F6C A;  4C2T A;  3PJR A;  3K4M A;  4JQF A;  4YRV A;  4MLO A;  3OS1 A;  1G8X A;  4ZDP A;  4IQ4 A;  3NWS A;  4YEJ A;  3A4C A;  4C2U A;  4XL9 A;  3E1S A;  1P9Q C;  3H5A A;  2VQG A;  2VJ5 A;  3DPL C;  5LD2 C;  3OS0 A;  2W82 A;  2LC2 A;  2BW3 B;  4RM3 A;  3SZG A;  4HPQ A;  1YX5 A;  2ELJ A;  3QOE A;  3K4C A;  2LOO A;  3DLA A;  3SEZ A;  2UWM A;  4BXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...