3D5RC

Crystal structure of efb-c (n138a) / c3d complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
65
structure length
65
Chain Sequence
b'TDATIKKEQKLIQAQNLVREFEKTHTVSAHRKAQKAVALVSFEYKVKKMVLQERIDNVLKQGLVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
molecule tags Cell adhesion/toxin
source organism Homo sapiens
publication title Electrostatic contributions drive the interaction between Staphylococcus aureus protein Efb-C and its complement target C3d.
pubmed doi rcsb
total genus 29
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF12199 efb-c Extracellular fibrinogen binding protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3d5rC00
2JVHA 2JVGA 2GOXB 2WY7Q 3D5SC 2NOJB 2WY8Q 3D5RC 2GOMA
chains in the Genus database with same CATH superfamily
2K9MA 1Z7LA 2OZUA 4EGYA 4PJNA 3CC4I 3MD2A 5HLHA 3WTSC 1FTZA 3OYBA 3QRFF 1YHQI 4TV7A 5LRSA 1LE8B 2MG4A 1VQ5I 1CF7A 3Q5FA 2Q8KA 1D1BA 3BT9A 4EVIA 3DFGA 1SFOJ 3DEUA 4EJTA 4C3JJ 3I3LA 1R36A 4NQWA 3KYCB 3C2HA 5E8GA 3GWZA 3TO7A 3H1CA 4A3JJ 5FLXZ 1D1CA 2XAGA 2C6YA 5A2QZ 3HRUA 3U21A 2HVSA 4DBQA 3L2CA 2P81A 5FROA 3DCFA 1BW5A 2XUBA 3F0CA 3CZ6A 5K7ZA 2CUEA 1KU9A 4NC6A 1E0EA 4QLCU 1W5TA 3TL4X 2JSPA 3KZZA 1GDTA 3LSJA 2M5WA 3S8PA 3ZCOA 4F52A 3D1NI 1Z05A 2UV1A 3X2QH 3S17J 4GO1A 1R23A 1ONVA 1G3SA 1QQIA 4XRMA 1BI1A 2VT2A 4B09A 4L0YB 1YS7A 4HNTA 2YR2A 5K5OA 2R0QC 4U0WA 3S1NJ 3KP2A 3ZRGA 4A69C 5J40A 4R8HA 4DYQA 2PMHA 3BR5A 3G73A 2M8EA 4UVCA 4DZJA 2EB7A 1KGSA 2GBYA 1FOYA 2R4GA 2VJ4A 3OYEA 1J0RA 2R7OA 3A0HC 1XPXA 5FRMA 1I1SA 5DCFA 2HGCA 5LHGA 5LGTA 2MH9A 3JRBA 4PFOA 2DJIA 2MC3A 4EATA 4X0GA 1U2WA 3BR3A 4Q4ZF 1OLTA 1FNNA 2DDAA 3LQRA 3I5UA 5F0HA 2V6EA 5IT9Z 1A36A 2JT1A 3ONQA 4BBSJ 1HDPA 1SMYF 1UB9A 3ZMZA 1R4NB 2EIMH 4YFXF 2XC7A 3NAUA 4IX7A 3HDDA 3NWSA 3RYRA 3R60A 3S2WA 2TDXA 4I99C 4UUVA 2E60A 4WXCA 4XKWA 4W1UA 2NVXJ 5GAHJ 3M4OJ 2AO9A 2VBYA 4NQWB 2XPWA 2KKOA 4K2EA 1K4TA 3A4CA 2RQPA 3T0YA 5BMZA 3K1MA 2XSDC 2Q0OA 4XORA 5GPAA 2K86A 1PDNC 5ICGA 1HW5A 3DEEA 3ZXSA 1RI7A 4ZDOA 3MFKA 3MMYB 1WGXA 1MMDA 5HDGA 3O8HA 2HOSA 4ETSA 1ORKA 4ZYDA 3CQZJ 2NS7A 2ZSHB 1U0JA 2LY9A 2LOOA 2COBA 3IAM2 5DM6F 1YOVB 4EJWA 3S3OA 4HOBA 3P9IA 3CDHA 3Q9VA 2ZKZA 4XOTA 3K70D 4BDYA 1SAXA 3GCMA 2ELKA 3LSGA 2V7FA 1VQ4I 1ZQ3P 3KZYA 3HRTA 3RYPA 4O6JA 4DNCA 3RKQA 2ME0A 3M7GA 3TW7A 5FFXA 4GGGA 3C2GA 1OYYA 3FM3A 4LITA 4PJ0C 4RLFA 2ELHA 3EQLF 1HF0A 3J80Z 2AXLA 2HQ5A 1W0TA 3H0GJ 2GXBA 1AU7A 3K10A 4EEFG 2QWWA 5DUKA 2Q2EA 5HLIA 5EDNA 2HOEA 1YIOA 4JOMA 2Z2SB 5DUIA 3CUQA 2QBYA 2W1OA 4BACA 2P7VB 4FE7A 5IY5H 2VJ5A 1RRJA 1R22A 2WBMA 4AM3A 3HRSA 2CJJA 2JVGA 3IKVA 3QQAA 3EUHC 2ZXWH 3PFYA 1DPUA 1ZK8A 3QYBA 2JJ7A 1Y1WJ 1F1ZA 3HTSB 1BJZA 4G6TB 1ZG5A 1HW2A 3HGGA 3I4MJ 1ETYA 2ADUA 2LY1A 2NS8A 2BHYA 5L3BA 4BDZA 2HOTA 2STWA 1D0XA 1T0FC 2YPRA 3BPVA 1IRFA 2CQNA 1WFXA 5KAFC 4BJ6C 3FBNB 4KIFA 1MJBA 2XAHA 3GTKJ 1R5HA 1ETQA 1UJ8A 2O61A 2CSOA 4CGZA 2H6CA 3LSMA 3ZR8X 2DBBA 4L5IA 3OYDA 4U88A 1AKHB 3TGNA 3HOWJ 1P4XA 1WWXA 2R7UA 3HOZJ 1YRNA 4DGWB 4KIGA 5F1RA 2XDVA 1FMVA 4PJMA 3MKLA 3H3UA 1OFCX 2IGOA 2DYSH 1D0ZA 2DQRA 3I9V2 2ZCWA 2EBIA 2A5WA 1I27A 2BVLA 3CDLA 2L54A 3L7WA 1X1BA 2IGNA 1G3WA 1YJNI 5D5XB 3JSOA 2IT0A 2VL8A 1LJ9A 4XLCA 3H35A 2OUMA 2XPUA 3I58A 1SD4A 5TJJA 3RPUD 3VOEA 4UB6C 5IYBJ 1WHUA 4CO8A 2FQ3A 3DF8A 4OWRB 3WGHA 1ZGAA 2B0LA 3P9KA 2WWYA 4XLAA 5A2QK 1ZH5A 2AQFA 5ED4A 1GVJA 3WE2A 4KUMA 1K78A 4HRIA 2KZGA 1LNWA 3OR2C 2PEXA 3REOA 1FIAA 3E5XA 2IPQX 4IQJA 4RAYA 4MO7A 1M1EB 2HZDA 4HX4A 5LHIA 2HVQA 1NG7A 1OCCH 1B9NA 3IC7A 1WZ2A 3DQVC 2M30A 3A02A 4WXDA 2LBFB 5JLXA 1F36A 1E3OC 2CW7A 1J5YA 2DN0A 2JZYA 3C18A 2RVCA 1ZRCA 3QAHA 5LFAA 3IRRA 4XL9A 3T1BA 3I4PA 2JN6A 3TOAA 5E1XA 5F08A 1BI3A 1IN8A 5KAIC 1X4OA 2Z9OA 4BXFA 5FKOA 2I8DA 3OV8A 3K4NA 4NBQA 2PN6A 1IF1A 2LKSA 1JI8A 2CYYA 2CW8A 2VI6A 4ENJA 1XMAA 3S32A 4KISA 1GXPA 2OCCH 4BS9A 2PMZA 2VXDA 3DV8A 2FBHA 1BM9A 3PFIA 1DDNA 2WADA 2QQAA 3S2DJ 4QSHA 4RA2A 2VUMJ 5C4JJ 3C7JA 3KEQA 2E1OA 4JBAA 2DQLA 1K7AA 1ZREA 3GEZA 4LG0B 3BCBA 3ZQGA 2K85A 2I10A 3ELKA 2K4BA 1MBHA 3S93A 5ICEA 3L09A 5K7FA 1BBYA 1ETOA 3S3NA 3GMEA 3ABKH 1Q1VA 4BJTA 2X1EA 3TDZC 3VSLA 3WTXC 3QYFA 1BL0A 3JAMZ 1ETKA 3R4KA 2V9PA 2UXXA 3V7CA 1JTXA 4XR6A 5B1AH 1LFBA 1WSUA 2DA7A 4N9HA 2EINH 1VQOI 4XSXF 1OMIA 1OR7C 1SVOA 4HBLA 4A3KJ 2BV6A 2JMWA 5J8CA 4D0PA 4E7IA 2F5CA 3TW6A 4MTEA 3U1KA 3E6BA 1J75A 2RAEA 2M2EA 2CS3A 3SDGA 1O3QA 4M3EA 2R7TA 3C3WA 4AYBN 2A6EF 1FPQA 4BAYA 1WVRA 3AL0C 3BR1A 1S7EA 4CZZA 5EGOA 2M4GA 3Q9SA 5J4VA 2D1HA 3JTHA 3ASNH 3KLOA 3GZ6A 4G7HF 1F4KA 4LK0F 2R7ZJ 5L3GA 3GO5A 1N78A 2EV6A 2RNJA 1VQ6I 3F8CA 1SC7A 2Q2EB 2BW3A 1MBJA 2K9LA 4MEXF 2Y2ZA 4I0AA 3JRFA 2M7BA 1RUOA 2AXTC 3VSKA 4IHSA 2BHZA 4LB6B 2HVRA 2AQEA 2H09A 2QVOA 3W6JB 4LD5A 3LNQA 3OYJA 3F3XA 5J47A 3D5RC 2DOEA 2M1BA 2BY1A 5B66C 2VODA 1S9HA 5CKTA 3E7LA 4IPAA 3TP3A 4JK1X 5B1BH 4A3EJ 3WTZA 5BQTA 2FA5A 2VE8A 4M3DA 2VIXA 2LK2A 4E4HA 1ZRDA 4OIOF 2Y48A 2UWMA 4IVNA 2K02A 1RETA 4A2UA 2V1NA 4G6DA 2L7MP 4I6ZA 4PGHA 1N75A 1PUEE 1X2NA 2QM3A 4FT8A 5L3CA 2DCEA 3H5NA 3ZMSA 2ZXJA 5JVGF 4NHJA 3KX2A 1IJWC 1OCPA 3VYUB 4LG3A 1A31A 1PVEA 2Y31A 1G2HA 3GBGA 1LEBA 1Z67A 4BY1J 1UZCA 5K7HA 3OIOA 3H3VK 4KN7X 1IRXA 1KQ0A 3OIPA 3PJRA 4XRFA 1BI2A 1XB4A 2QLZA 4ENNA 3FK6A 2F2EA 5M5YJ 2GOXB 1GLNA 3V4GA 1MMGA 1LDJA 1FMWA 4BBRJ 1G3YA 4M9SA 4Y7NJ 2O3FA 1MMSA 3T5XA 3K6GA 4HDVA 2DA6A 2L5QA 3DLAA 2HXOA 1P6RA 4A3BJ 4HYEA 1DU6A 4A3LJ 3CC7I 1KA8A 2V1DA 4KT6A 4CH7A 4RM2A 2DTRA 1LKXA 1LFPA 1Q1HA 4PK4A 3RZDJ 3TO6A 5CLSA 3M3YJ 1FSHA 2KMUA 4M73A 3CJTB 1W7PA 1EJ9A 2X6XA 3BR0A 4MFDA 2K9QA 1MW7A 2VBZA 4I2OA 2BY2A 5FLMJ 1OCTC 4BXXJ 1XX5A 2EZHA 4C2MJ 4AVPA 2R7DA 1TW2A 3CO7C 2STTA 1U5TC 4GCVA 4NUBA 3CCMI 3WGGA 2EK5A 2KPMA 3AG1H 4WX9A 3F6OA 5F04A 1ODDA 2YSRA 3SDBA 5M5XJ 1UFMA 1AKHA 3O3KA 1W4MA 4EJUA 1JT0A 1VQLI 2EIKH 5IP7J 2PJRA 4L18B 2R7QA 1SFKA 2K3PA 3KLNA 5KNLA 2Q1ZB 3K4CA 3WTTC 2CO5A 3LSKA 3R0AA 4HV5A 2VOPA 4Z2YA 2FMYA 2QCOA 3RPUA 2CV2A 4AUXA 2CH0A 2Z5UA 3K4MA 1E3PA 2PMUA 4A3DJ 3ZQCA 2LG4A 2WAFA 5F64A 1QZYA 1VQKI 2X51A 4ZZLA 2KISA 2L7KA 2QYOA 3HSFA 5HNFA 1GV2A 2UUZA 3BG6A 4G12A 3E5UA 4B3AA 4C3HJ 5DYMA 3OYCA 2XASA 1OISA 2O7OA 2DTZA 2CQKA 4P5OA 5EJCA 1R1VA 3F8BA 1R4MB 3SEZA 2IRFG 4AD9A 4M9XA 1JUSA 2HQAA 4MEYF 3CCUI 3V8JA 1X1PA 2HXIA 2K9NA 2LFBA 2J5OA 1QU3A 3DBLB 4A0XA 3WTWC 3EUHA 3FDYA 3PQKA 4A12A 3ABMH 4IOCF 1OQYA 3BTLA 2Y9YA 3JRCA 5J6XA 2LY2A 1VZ0A 3JRIA 1XS9A 2EFQA 1P7IA 4A0YA 2W85A 3WU0A 5LGNA 3HUGA 5AIQA 4QWQA 2OA4A 2PX9A 1J7KA 3IL2A 2XGCA 4C2TA 1XGOA 2IA1A 1PUFB 2J5PA 3OMYA 5BS6A 3M8FA 1WCMJ 2L7ZA 2VQLA 4LLLA 2NYXA 4P9FA 3ZQ7A 3HOVJ 1W1WE 2G0EA 1SFUA 1Z9CA 2CW0F 2E1CA 3KFWX 4XBFA 2MD5A 1R9TJ 2KIMA 5FKMA 3ZMUA 3ECOA 2RN7A 1YI2I 4B4CA 4GYGA 2XF5A 3DLLF 2CUZA 2WB1A 5L3EA 3L2RA 3G6EI 2ACJA 5FRNA 2EFOA 3F6VA 2JA7J 2O8XA 2KLOA 5E79C 4LK1F 3RQIA 4A0ZA 5D4SA 4EQQA 4LGWA 3D5SC 1VI0A 1WI3A 2GOMA 1ERDA 3JREA 3V42A 4UV8A 2KHMA 2VC1A 2DXIA 2EV0A 2DW4A 4MQVA 2KJBA 2W25A 3BJOA 5D5UB 3AAFA 2QF7A 2X6WA 5C4XJ 5F27A 1K79A 2UXNA 3BR2A 3MZYA 3K2ZA 1B72A 3CF5F 3CCEI 4CYCB 2O03A 2EH3A 5IP9J 1R71A 1ZLKA 2LREA 2MFZA 3OYFA 1WKMA 1R1UA 2XV4S 5HLTA 2OTLI 3V8KA 3E6MA 4BL0B 2OD5A 1ZELA 4OMZA 3N4MA 2P0WA 1JGGA 4BY7J 1MBEA 2R5ZA 1TWAJ 5HVQC 3QPHA 5D5VB 3G3ZA 5FD6A 4BE0A 3JTGA 1B4AA 4B47A 3EETA 3LL7A 4LLGF 4DYRA 4U0YA 2HPIA 3E97A 3JW4A 1U5TB 3HRMA 3ERED 3M8JA 2FEZA 3OOUA 2KRHA 3EUAA 3ULQB 1AOYA 2L9NA 2ISYA 3SXYA 1U8BA 1FYLA 1D8KA 4YEJA 1ZYRF 3LSRA 1EH6A 4XICA 1VQPI 3E1SA 1V55H 1OCOH 1V4RA 3DPLC 4U87A 5EG0B 3WHCA 4G6QA 1RC9A 1QVUA 4XN3A 1IN5A 4YIIA 1R7JA 3K70C 3KYDB 2E36A 4XM3A 4L0ZB 1MNEA 3CCRI 2WY7Q 1U9OA 3I64A 3DWLE 2DLLA 1L0OC 1WJCA 2RNGA 2MLKA 4PJLA 2QSGX 2O6GE 2NS0A 5H2FC 4RMNA 3M9AA 3ZN0A 2EIJH 3HM5A 2LF7A 1UHWA 1KQ9A 1VQ7I 2V9KA 5IOZA 1PP8F 1E17A 4FQGA 4RAGA 1TWHJ 2A61A 4D5FA 1P2FA 1A6IA 4FTHA 2OCEA 3RJPA 4II2A 5E1ZB 4XRSG 2KIUA 1T8IA 4EMSA 3ABTA 5J4YA 1RR7A 1KQ8A 3CUQC 4WF2A 2E1NA 4RB3C 3T8TA 2M87A 1BA5A 4I76A 5F6FA 3DBRB 1V5GA 2EZIA 3ERMA 5EF6A 2TCTA 4HNUA 4XLNF 2P4WA 4RGRA 2H6BA 2JA2A 4O5VA 2A07F 2XAUA 1XDUA 5FKLA 1XSDA 3P7NA 3FKIJ 2DPUA 1QNTA 1H0MA 2LKPA 4LG0A 4XLFA 2BZTA 2CUFA 5DD4A 2R7SA 4KJZA 3VEPA 3CC2I 4KDPA 4ABZA 4D5CA 4ENMA 3E5QA 1H88C 1D5YA 2R7RA 3TDUC 6PAXA 3Q0UA 1S72I 2BY0A 1B72B 3QU6A 3NRVA 4CYDA 1IUFA 5GTHC 1XN7A 1QA6A 3ZMDA 3H9GA 3PO2J 3AG2H 3I54A 1ZLJA 4OIQF 5E3OA 4OOIA 1FOKA 2DMQA 2FNPA 3I56I 1B8IB 1XTAA 2DOFA 3AG4H 2L3DA 2GXAA 1O3RA 2QENA 2VE9A 2JRMA 1UG2A 2R7XA 2OU2A 3CCSI 4BU2A 5ICFA 2XKPA 3CD6I 3EPZA 4OAZA 3Q3SA 4B1RA 3GFIA 2XSJC 3WE3A 2VXZA 3FXLA 2FE3A 4UNOA 2QGUA 2LC2A 2XRLA 4A6DA 2OF7A 3PUFA 3M8EA 4BE1A 1GT0C 3DEWA 1FP1D 3GTOJ 3HUGB 2H8WA 4RLQA 3L9FA 1YLFA 1JJ8C 1Y56A 3FHZA 2ZMEC 4KYWA 2M45A 4M6YA 2DFIA 3QPSA 1Z7UA 1XC5A 3F8NA 2Z33A 2OTJI 2KJCA 3FMSA 4NNJA 2ZMEA 4OAYA 1Y6IA 1TBXA 2AS5F 4L9JA 4L9NA 4ZYEA 5DCMA 5DTDA 3K4JA 1HKQA 1QHGA 2EQRA 3RKXA 1HC8A 3MN2A 3OYGA 2BEOA 2EJRA 3EYYA 1B6AA 4LMYA 1NH3A 5K1YA 2IP2A 3CLQA 3LA2A 1TQIA 4A3GJ 3HZJA 2W00A 4BQOA 1RPWA 3SJMA 3S3MA 1MDMA 4HF0A 5GP9A 1GHCA 4P96A 3S15J 3K4BA 3JCUC 3HJEA 1D0YA 4UVBA 1VFCA 4C3IJ 2VPRA 5M3MJ 1ITYA 1XCVA 4GXOA 3VYSB 3GVAA 1ZGWA 1WJFA 3QOEA 5D5WB 1LB2A 4EM0B 5KHDA 1SANA 2F5DA 5J1UA 4ZH4F 4A3FJ 2WTEA 3PIPF 4MLOA 1K83J 4PFPA 1D1AA 1W36D 3ZQHA 2RDPA 4O3MA 2M9HA 5E3NA 3HBLA 1QZZA 1IXCA 2VJIA 4ZTJA 2YX4A 2A68F 3RIRA 4MHGA 1IGNA 3KE2A 5CVVA 4M3FA 1HXDA 4II3A 5FFZA 2Y30A 1MMNA 3GTQJ 3HHHA 2F48A 1G3TA 2DT6A 2Y75A 2Y0SN 5E17F 3J81K 3DPTA 1IW7F 2GIZA 2HFHA 5CVIA 1O7LA 2CQ7A 4RAFA 5FKKA 3GFMA 4XOPA 3ZP5A 2W84A 3BG9A 3R0JA 4HPQA 4CCLA 3HG9A 3BDDA 2VKDA 1XDSA 3N05A 1PUFA 1BR4A 2BW3B 1YS6A 1R49A 2XAJA 1R1TA 1I6HJ 4X1EA 4CXFA 1K61A 1K6YA 2OV7A 4EJVA 2CRGA 2ZJPF 2BVMA 3CP2A 5EZGA 5EG0A 3QPLA 1D3YA 2JA8J 2R3SA 3BTIA 3TKYA 2X4HA 2DA5A 4Y15A 1MNMC 1B1BA 2YUSA 4XNFA 4FASD 5ICCA 5EGOB 1YITI 3ESWB 1ZG3A 2M3AA 3U1DA 1U5TA 2LBFA 5K5QA 3TBIA 3S16J 3K9TA 2DA2A 2QQ8A 4M71A 3SHFA 2MD0A 3V8LA 5IT3A 3BC8A 3TOBA 4XONA 4UHTA 4RBOA 3E0JB 4ZYAA 4M9ZA 1VQ9I 3K0LA 4QPQA 5E3MA 4A3CJ 3GFJA 4AVZA 3G1OA 4YELA 3FX3A 3GUDA 3HSRA 1T0FA 4CDGA 2F4IA 2A69F 1AHDP 1FOXA 1BR2A 3DTEA 2NOGA 3PIOF 2P8TA 1FX7A 2M0MA 2EZKA 2XRNA 4KICA 1G8XA 2HS5A 3W6KB 4E7ZA 1MZBA 4A5MA 4I0BA 4A5NA 3F8FA 2V9VA 1X19A 3MKWB 2RKHA 4CCMA 1KONA 2E2IJ 2VN2A 2OPTA 3FF5A 3GLXA 5LBQA 3J7AO 3IH4A 4AWXB 2BXYA 1RKWA 1TNSA 3CCJI 1Z1DA 2JUCA 1N25A 3HXLA 3U9GA 1XMKA 1QRYA 2L02A 4OINF 3RPQA 4BQQA 5KK1A 5F1JA 4M6VA 1XD7A 2ZB9A 4CSWA 1H89C 4RGUA 1TQPA 3PO3J 4EM2A 2E7WA 3F21A 3QOPA 3RDIA 3I4NJ 2V4JC 3G4SI 2IA0A 3GTPJ 5LEJA 1RESA 2HZTA 5CVUA 1MMAA 1IN7A 1ENHA 3GLLA 3OSFA 4CCOA 3HEFA 2ZNYA 5D8LB 2IS1A 4N4NB 4JX6A 2GA1A 3DBHB 2LD5A 4G7OF 1SFEA 2YX7A 2CV1A 3I71A 4MQ9F 3V7RA 1NTCA 5F0CA 2LNBA 3HIFA 2DA4A 3B6AA 1FSEA 4NB5A 2V79A 3BZCA 2FU4A 3HOSA 4HQMA 3CF2A 3FK7A 1IN6A 1JUMA 4BHCA 4D1QA 1ZN2A 2XGEA 5B3SH 5H6QA 1W5CC 2FOKA 2HTJA 2L01A 4Y4RA 3LWFA 4XQFA 2VBXA 2ZFUA 4AC0A 4ITVA 5TRDA 4G9YA 3CCVI 3TO9A 1MBFA 2CWEA 2Z3YA 5FKNA 1HBXG 4HZFA 4CHUA 3PL8A 2VC0A 1YW9A 1R5ID 2IS6A 3K7AJ 1YJWI 3FBIB 1NHAA 2DU9A 2L4AA 2VQGA 4ZYHA 3SZPA 1B9MA 5EZHA 4OU0A 1NK2P 4HV6A 4NC8A 1O4XA 4E7SA 2R7WA 3VB2A 1USTA 1YJ9I 5JHUA 3D0SA 2CU7A 2ZBKA 5ILUA 3A1YA 3JAMK 2ECCA 2L9RA 3CESA 3FXJA 1S29A 1KU2A 3QP5A 1EH7A 1S3JA 2IJLA 3ZGKA 4D9JA 3RSNA 4S0HB 1TW3A 4ZDPA 2M34A 4EJOA 3IKTA 3ZQQA 1TWCJ 1WQ2A 1WJBA 1V5EA 3OYMA 4HG2A 5HODA 3LAJA 2H1KA 1JUPA 2GA2A 5J3LA 3J7AY 5M5WJ 2R7FA 3ABUA 3O6BB 3ZMTA 3BP8A 3LQQA 2CMPA 2M4KA 3SZGA 4F93B 4HQEA 2RREA 1HQCA 2V6CA 1P4AA 3Q0WA 2ESHA 2D5VA 2DMUA 1VTNC 4UUTA 4YFNF 1BR1A 1L3LA 2K40A 1ZGJA 5J1RA 1LQ1A 1UCRA 1WH5A 3BOQA 4F7ZA 5DDGA 3B02A 3BG7A 1MH4A 2H94A 2K27A 4ZDLA 4NC7A 3OYNA 2HDDA 3H3ZA 3CP8A 3GX4X 3AL0B 3LA3A 4YIFA 3HOUJ 3PQJA 1CGPA 1TNTA 3S14J 3BLYA 4U7DA 2Y0MA 5GAGJ 3GTLJ 2NOJB 1SD6A 2CQQA 2VOOA 2XAQA 5IP6A 3FWEA 2R92J 3JR9A 1IRGA 4U7BA 1YYVA 3ZQFA 2DMPA 2ECBA 3G2BA 2E35A 3WG9A 2R93J 3F9KA 3U2RA 1MBKA 4JYKA 1X3ZB 2QEXI 2FSWA 2JVHA 3L2QA 1W0UA 5HS8A 1ZAOA 4Y52J 4HA8A 4L9TA 2JRTA 3FM5A 1STZA 2XVCA 4CCKA 2GLOA 2NVTJ 1H9TA 4DIQA 4Y33A 1RNLA 2W82A 9ANTA 5HOOA 1KYZA 5BOXA 2PG4A 4QIWN 3EYIA 2RC4A 3GF2A 2COMA 4Y13A 3VFZA 4MNUA 3O2PE 4P9UA 2H8RA 2ZNZA 4JX4A 4BHPA 1YW7A 2VT3A 1ZTRA 4IF4A 4ZJZA 3F8MA 2E5NA 2RGVA 5H20A 3BG3A 4IHTA 4YG2F 3J81Z 1TT5B 4LLNA 2XHKA 3OL4A 4PSWA 2D2WA 4IJAA 3CMYA 3S1MJ 3WODF 1T2KA 2OBPA 4UY8I 2M7AA 4XKVA 5CQEA 4S04A 1YX3A 1SD5A 3BTCA 1FBQA 1VQMI 1ZRFA 5E20A 1ON1A 2MLGA 1MDMB 2PMZN 1RZ4A 1TT0A 5K5RA 4XKBA 3IAS2 4U0VA 4E7JA 2F5FA 3SZTA 5JVTA 2DFFA 5D6EA 1YIJI 2CG4A 1XGSA 3VYTB 2F4OB 2EPFA 3IV5A 1ETVA 4BNCA 2XAFA 2HDCA 3K2AA 1CF7B 1FOWA 3FXOA 5DM7F 4ANJA 1A04A 3LMMA 1G6NA 3LSIA 2LP0A 1WJEA 1TLHB 1WI9A 2WV1A 2FBIA 3ISPA 4RM3A 1FP2A 1QPIA 1YW8A 1ON2A 2HDWA 3I59A 2HPMA 1DUXC 1ZARA 1JKQC 1NG6A 3CO6C 1KU3A 2GZWA 3MVPA 1T56A 1XG1A 2MW8A 3DU6A 2OJED 2W24A 1I39A 5ILSA 3W2VA 5GPCA 1W5SA 2EA2A 3K1NA 1ULYA 2FXAA 2EA4A 4CZCA 4RGSA 1S7AA 3RZOJ 2F4MB 4FCYA 1MJ9A 2QQ9A 3W2AA 2L9VA 5EEAA 1K6OA 2HOAA 3I0TA 2W48A 1UHMA 3E6DA 4HX8A 1TP4A 1EH8A 4E6KG 1T98A 1X1DA 2VB6A 2H1LA 1WH7A 4DJAA 3OYAA 4J01A 4OIRF 3LSPA 1KZHA 2LKXA 5CJ9A 2OQGA 1MH3A 3QWLA 4MGRA 4PUSA 5EYRA 1U6GA 2EFNA 1YG2A 2G7HA 2XF6A 2KDZA 1OJLA 5HDKA 1MGTA 2FRHA 3F72A 3HKZN 1ZR2A 2P5KA 2QKLB 2A5YB 3WGIA 4Q47A 4V19K 1TQMA 4B8XA 1FT9A 1IC8A 3NWTA 4G94A 2IS2A 1PYVA 4F55A 3E6CC 1GVDA 3LAPA 3GZNB 4PGGA 1IXSB 2ZC2A 3PUBA 3G1MA 1VQNI 2PJPA 1I1GA 2CFOA 2FMLA 2X9DA 2XF7A 2ZXIA 4IL6C 3K1PA 4J19A 3GZ5A 2H27A 4F3QA 1FYKA 3WG7H 2JPCA 2R5YB 1S5LC 2NNNA 3CCYA 3S2HJ 1WJAA 2QBYB 2E2JJ 2GQQA 2KRFA 3QP6A 4M3BA 1R00A 1R58A 1JTYA 2F5EA 4HNVA 1X1AA 3IP4B 1JHFA 2ICWG 2B63J 1G59A 2GWRA 2MSYA 4AIHA 1X58A 4IHYA 2KP6A 2KT0A 4IRHA 1AWCA 5FLVA 3ECHA 5JFRA 3M07A 2NNYA 3NARA 4M74A 3D5LA 3MQ0A 4CUGA 4LOCA 2WAQA 2X6OA 4WK8F 2K3FA 1O57A 1W7PD 2GAUA 4PZJA 4XN0A 3W2WA 4NDLA 2VQHA 1U3EM 4N4OB 3I59B 1S8NA 2HYGD 1MJAA 1TTYA 2X6YA 2HTSA 3P9CA 3SQNA 1B8IA 2XB5A 2YS9A 2HEOA 3O8GA 3TQNA 1F5TA 3OOPA 1I3QJ 4ESFA 3OR1C 2MGQA 3T8RA 5GADJ 5LEKA 2FUG2 1FTTA 3PM1A 1J59A 4G8XA 4PJJA 2GM4A 3BR6A 1DU0A 2MA3A 5KVRA 3ZOBA 4E7HA 4BH9A 3IH2A 1V5FA 1U8RA 2W57A 2PJRB 2P6SA 1VQ8I 1Z3YA 5M3FJ 1ZG1A 3HTUA 1IN4A 2HR3A 3W3CA 5FLXK 3RQ4A 2VPLA 2LVSA 1BOAA 4LIVA 2F6CA 5GTIC 1IDZA 3DU5A 4P55A 3UR3C 4C2UA 1HKSA 1D5VA 2UZKA 1U9NA 4I01A 4YFKF 1Y8RB 2FJ1A 4D7NA 4FX4A 1IDYA 3KP6A 1GUUA 3F22A 2WC2A 2JUGA 4AYBA 3G1LA 4MFEA 3S1QJ 3BROA 1GV5A 3GTMJ 2Y9ZA 1BIAA 4B3XA 2EFPA 2E5ZA 5BPIA 1RR8C 3EDPA 2GXGA 3IRQA 2L2OA 1R6RA 1YQAA 3TP0A 1JE8A 1LUJB 2FBKA 3DKXA 3K4KA 4BXUA 3AFHA 3CUQB 1XMXA 3VDXA 3A2KA 1BJAA 3FXKA 4Q48A 2N8GA 5DV5A 3HOTA 4M3GA 2IS4A 2DO7A 3M1CA 3MEXA 3CDIA 1O3TA 3RI4A 4Q5SF 4IXAA 4G7ZF 4WCGA 1SVLA 1FBSA 4BQNA 3GYHX 4C9YA 1USSA 2HYFA 2IGKA 2ZMEB 4DYCA 1JXSA 2YU9J 3RKYA 1YX5A 1RUNA 5CQGA 1HSJA 3B73A 2KIFA 4J00A 3KCCA 1IO2A 1H8AC 4QPOA 4CCNA 5HLGA 5FJ8J 1MKMA 1SFXA 2IXSA 4AIKA 2ME6A 4IHVA 1D8JA 1OCZH 1FLIA 4EV0A 1JHHA 2DPDA 4HX7A 2OZ6A 3HPGA 2DMTA 1EV7A 1V54H 2QUFA 4HEA2 3OS0A 4E70A 4BEHB 1TZLA 1WJDA 4ZTFA 3B6CA 3A0BC 2HQNA 2E34A 4HLXA 4JP0A 1W36C 2XPVA 5E1WA 4B44A 2VJJA 2Z99A 4BKXA 1Z21A 4BUPA 1I3AA 2M8GX 3LFUA 3HSEA 4KT5C 2DK5A 3DPUA 3L2UA 1Z6RA 3F23A 1ETXA 1BC7C 2IGMA 2R5YA 3HPHA 1FJLA 1LFUP 3C1DA 4LB5A 2ZO4A 3RTRA 1U78A 2V1XA 3BPXA 5FB2A 1IXRC 1YE9A 2DYRH 2ESNA 2WAEA 4UV9A 1Y0NA 2XIGA 1A6QA 1QZEA 5CVRA 1FIPA 3JRDA 2HWVA 1Y0UA 4HDUA 4KN4X 3P5JA 1HLVA 2VKVA 2PBIA 1A5JA 3OSGA 2O0YA 3DTIA 3HB9A 3H0DA 1MNDA 2FOWA 4ESJA 2BGCA 1KU7A 2XROA 1SVMA 2EWNA 1T39A 3I53A 2JTVA 3COAC 3HHGA 3A03A 4PDKA 3GFLA 4KMUX 2VBWA 2TRTA 1ACIA 4AIDA 4XIDA 1HKTA 4F92B 1IV6A 4MTDA 1J2XA 1TL8A 1X2MA 4IEJA 5IOYA 2IA2A 2V26A 4PSXA 2JA6J 1OCRH 4FHTA 1X3UA 5IYDJ 3E3VA 3FXRA 2YU3A 1E2XA 3L2WA 2KRCA 1QGPA 1CQTA 1LPQA 3OYLA 2HNHA 2MYSA 4A3MJ 1EKEA 4YIRX 3NEUA 2P6TA 3I55I 4ENKA 4ZZDA 5FO5A 4IQ4A 4BQAA 2WA0A 1XCBA 1LEAA 1HDDC 1PJRA 3KP3A 2K4JA 4BEHA 5GAEJ 3DP7A 4V2GA 4S05A 3AG3H 4RB0A 2BXZA 2KL4A 2OAZA 3GXOA 3FKJA 4UUSA 2JQ7A 2VONA 4I98B 3RKWA 2JWTA 4B43A 2E2HJ 1W7PB 2X1CA 1FY7A 1OYWA 2EZLA 2MC4A 5LRRA 1XSXA 4W97A 3FXUA 4IRGA 2HKOA 5AONA 2L0KA 3FMRA 1IG7A 3CTAA 1EA3A 3ASOH 3H5AA 1TWGJ 2NVQJ 2PQ8A 1XGMA 3KIOA 3HOXJ 4H0EA 3JSPA 3IUOA 2FD5A 3K69A 1HOMA 1MBGA 5D6FA 1UHSA 2CUJA 4D7MA 1E3HA 2A3SA 4CICA 1MD0A 1IRZA 1IAWA 3IWFA 2PLYA 3H5RA 3FISA 3MKZA 5B5EC 1MSEC 2QZ8A 2VASA 3KZIC 4HW0A 2LRDA 1PP7U 2DJNA 3CMAI 5CVJA 1ETWA 5DD8A 4R1HA 2FX0A 3LA7A 3DTKA 4IRIA 3LFKA 1S6LA 4X6AJ 1JKRC 3VODA 3FXMA 3WTUC 4UB8C 4FX0A 3BJ6A 4IO9F 1QHHD 1K78B 1MIJA 1AA7A 3Q0VA 1J09A 3FZVA 2NVYJ 1DGWY 3ROUA 1WPKA 5HNHA 2D1VA 2BOLA 1BW6A 2DAOA 2M0CA 2X85A 5JI6A 3CMEI 2EV5A 4N9IA 2FQ4A 4HAMA 1K4SA 2K5CA 2HU9A 2ZFWA 5LGUA 2RQQA 5E3LA 3IHUA 1I50J 2BYVE 2IW5A 3OS1A 1JKOC 2GIVA 1HW1A 4RB2C 1DP7P 1DQUA 5TISC 1Y39A 2VLAA 2K7LA 1X4PA 1Z91A 2A6HF 3HL2A 3TEDA 3BTJA 4XLEA 1FBUA 4BHBA 2JSCA 2QSFX 3WU2C 3OS2A 3DKYA 2XGDA 3EUKL 4XMYA 1BOBA 4FISA 4DZPA 4XK4A 5HDNA 1T6SA 2VKEA 1T08B 1JT6A 3CUOA 3UNGC 2E1MB 1BIBA 4BGDA 1POGA 2MABA 4M6XA 2ZJRF 1FC3A 1ZR4A 2PFBA 2WY8Q 5TGTA 2DFEA 1P7JA 4C30A 4UXNA 2LLKA 2EFWA 1N77A 1LDKB 3BY6A 4WXHA 2XB0X 4FE4A 1F43A 4Y17A 4KIBA 3WTYC 5J8FA 3ML6A 4WWCA 2FNAA 1LVKA 1T95A 2VKHA 5JHFA 2Z1DA 1OR7A 3ABLH 4CYCA 1OYIA 4Z6YA 2O8KA 2IBDA 5ERIA 3HYIA 3VYRB 2W7NA 4DW6A 3H9JA 2PI0A 3LSHA 2ETHA 5KCMA 2B9SA 1NK3P 4Y3OA 5HS9A 5F0FA 4IHXA 2BY3A 4HLYA 4V2FA 4JQFA 2JPBA 5E18F 3QODA 5DCMB 3UKGA 2JK3A 5C3EJ 2WB1N 2DA3A 5FD5A 3AKZA 1G4DA 3R61A 1RKTA 5DS9A 3GW2A 2R7VA 4UUSB 1Y8QB 1GXQA 4B48A 2KQRA 4XSZF 3KP7A 1XSVA 2X0LA 2V1UA 4OMYA 4GYIA 4A6EA 4ON0A 1YRNB 4HSTA 4E7LA 5BPDA 1DPRA 3GTGJ 3LOCA 3W6VA 3H36A 3G71I 5AIPA 3OWTA 2P5LC 3CCQI 3MZHA 3NQOA 2QSHX 2QQBA 5E8IA 1ZKGA 3OIQA 5JLWA 5HS7A 4OIPF 2XGXA 5CYVA 4ESBA 3KP5A 4PCQA 3ZN1A 3BZ6A 4I7HA 1TWFJ 3FIWA 1Y1VJ 2LF8A 1S7OA 3BJAA 2KZVA 4HSRA 3C2BA 1VF9A 4P1WA 2HQRA 5LLQA 3FMQA 1B59A 1WRJA 4FETA 2ZJ2A 4BYYA 4R79A 3MKYB 1FEXA 2E19A 1IUYA 5IPAA 2ZJQF 2EILH 2X1DA 5IT9K 2OC6A 3RCOA 3A01A 4GFBA 4IKFA 3CJRB 3J7YJ 3SFZA 3VWBA 1OKRA 2DODA 2L4MA 3QU3A 3WHBA 2HI3A 4L9VA 1UAAA 5LD2C 2Z16A 2BBYA 2X48A 1QO0D 3BWGA 1LE8A 2B7EA 1SMTA 4I02A 5BNGA 1ZHFA 4E7KA 2P7CB 1JGSA 3OY9A 2QKMB 1Z3XA 4KMFA 3FHNA 2DI3A 3MWMA 3J80K 3OYKA 3HOYJ 1OPCA 1KYWA 2HKXA 1DP3A 2CFXA 1I6XA 3JRGA 3KP4A 4EM1A 1SEUA 3SFIA 3CJNA 1IV8A 5EEGA 2LSOA 2HYJA 3PNYA 4ZYGA 3WU1B 1X1CA 2O9LA 1T33A 2BE5F 5EEHA 3IH3A 3OYHA 3PNTA 4F91B 4QTRA 2AHQA 2A6TA 2E1MC 2LYCA 2RV8A 1J9IA 1QBJA 4KNYA 3FXQA 3TMOA 4I09A 4IHWA 2F5VA 4L5EA 3ZQIA 1FYMA 3WTVC 2P5VA 2D45A 3L2VA 2VQCA 1RIOH 1YFHA 2WV0A 3KEOA 3MAJA 2CQXA 5L3FA 1C0WA 2E7XA 5ILVA 2JA5J 5J1YA 3BZKA 1JKPC 2MBFA 4LFUA 1I5ZA 3KEYA 4RGXA 3L1PA 1P92A 3QYEA 1BC8C 2DOAA 4JX5A 3CCLI 2IVMA 1UMQA 2NXNB 4GDFA 1P4WA 1MSFC 5C44J 1SD7A 3SEQA 5L3DA 2MH2A 1FWZA 1O3SA 1UELB 2NAZA 3OYIA 1APLC 2DDBA 3BQYA 3QPTA 2LMDA 5D8KB 4A3IJ 1HSTA 2ZXHA 4DQ2A 3BQZA 4N0BA 1A35A 3HGYA 4EGZA 5H6RA 3MCZA 3KETA 1V3FA 1REPC 5CPRB 3ZMVA 2Y0SA 3K4LA 4CA0A 2R5ZB 3ZQLA 3IWZA 4L5JA 4BE2A 4IOAF 1XGNA 4CCJA 1WJ5A 3J7ZI 1P9QC 5LHHA 2LDUA 3CLOA 3S1RJ 2QA4I 1HA8A 3ZPLA 4RAZA 4RDUA 1YO5C 2L7FP 4YRVA 1BN5A 2DMNA 3JRAA 2OQRA 4DBRA 2G9WA 1F9NA 2K9SA 2ID3A 4KA4A 3CMMA 2CV0A 2DFHA 3BG5A 3R6SA 4IZZA 4KFCA 4KITB 1LDDA 2NVUB 5D4RA 3JRHA 4DOZA 4LIUA 5DEQA 2XKOA 2ID6A 3LSTA 1BI0A 1Z6TA 2O5RA 2E71A 2W4SA 3OL3A 2LR8A 3PSFA 4H4KC 4RB1A 2A05A 1QPMA 1TC3C 4LJZF 5FGMA 3H9QA 3KPHA 4HF2A 4AIJA 2IAIA 3H92A 4UVAA 4BJ5C 4XRSA 2KDOA 1VNDA 3VPRA 4XLPF 3PNVA 2LH9A 1SAUA 2ISZA 1H9GA 2LTPA 1IZ1A 1Z0XA 4M72A 2ZSIB 1QVTA 1DGRM 4HF1A 1YTYA 3KYLA 2FF4A 2DT7B 2DK8A 1Z77A 3M1EA 2CGPA 1T38A 4GRIA 4RS8A 5JR3A 3SYTA 3HC7A 4XKCA 2DA1A 1X3WB 3DXJF 3MZ8A 1EF4A 3L00A 1HCRA 3CJQB 1FZPB 1LVAA 1O7FA 3GTJJ 4AU7A 3PSIA 4XLHA 3DKWA 2IEKA 2L9SA 2WAQN 2NRAC 4ASNA 3V7SA 2KFDA 3HKZA 1JJ6C 5IYCJ 4A93J 4MIMA 2DT5A 1R5GA 3N97A 2ELJA 2G7UA 2Y69H 4ZC3A 3BCAA 3A01B 2I5UA 2KIQA 1UG0A
chains in the Genus database with same CATH topology
2K9MA 1Z7LA 4PJNA 1W36C 3HXLA 3MD2A 4B44A 3OYBA 2VJJA 4BUPA 1Z21A 4BQQA 4NUBA 2KPMA 3LFUA 4CSWA 3DPUA 3L2UA 1D1BA 2IGMA 3HPHA 3SDBA 3RTRA 2V4JC 3I3LA 1YE9A 3C2HA 2PJRA 2WAEA 2R7QA 1SFKA 2K3PA 5KNLA 2Q1ZB 1MMAA 3K4CA 1D1CA 4CCOA 3LSKA 3U21A 2HVSA 2IS1A 4DBQA 4N4NB 3DTIA 5FROA 3H0DA 1MNDA 2CV1A 3CZ6A 2CV2A 1E0EA 2CH0A 3K4MA 3TL4X 2JSPA 4F52A 3S8PA 3HOSA 3ZCOA 2LG4A 2WAFA 3CF2A 2UV1A 2X51A 2L7KA 5HNFA 2UUZA 3BG6A 4F92B 4D1QA 3OYCA 4HNTA 2V26A 4PSXA 4P5OA 3ZRGA 3SEZA 3L2WA 2KRCA 4Y4RA 4XQFA 3OYLA 2ZFUA 2R4GA 2HNHA 2VJ4A 4ITVA 3OYEA 2HQAA 2R7OA 5FRMA 2MYSA 4PFOA 3PL8A 2DJIA 1QU3A 4EATA 4X0GA 3FDYA 2IS6A 1OLTA 4IQ4A 2V6EA 3FBIB 2WA0A 2LY2A 2VQGA 1VZ0A 3ONQA 1PJRA 2XC7A 4IX7A 4NC8A 4BEHA 4E7SA 3NWSA 2R7WA 2KL4A 3FKJA 3A1YA 4C2TA 2E60A 3CESA 4XKWA 3OMYA 4B43A 4NQWB 2X1CA 3ZGKA 4D9JA 2VQLA 3RSNA 2MC4A 3A4CA 4ZDPA 3ZQQA 1WJBA 1V5EA 4XORA 3OYMA 4HG2A 1EA3A 3H5AA 3DEEA 3ZXSA 4ZDOA 3MMYB 2XF5A 3IUOA 1MMDA 3J7AY 2CUZA 2WB1A 3L2RA 5FRNA 2KLOA 2CMPA 2ZSHB 1U0JA 2M4KA 2CUJA 2LOOA 3SZGA 4F93B 3D5SC 3IAM2 2RREA 2GOMA 3S3OA 1ERDA 3V42A 2KHMA 4XOTA 3K70D 4BDYA 2DXIA 3H5RA 3LSGA 2V7FA 1BR1A 3MKZA 2VASA 2X6WA 2LRDA 3BG7A 3C2GA 4LITA 4RLFA 4ZDLA 2LREA 3DTKA 2MFZA 4NC7A 3OYNA 3OYFA 3CP8A 5HLTA 3AL0B 4BL0B 1ZELA 3K10A 1QHHD 2P0WA 1AA7A 5HVQC 1J09A 4BE0A 3BLYA 1DGWY 3LL7A 4B47A 2NOJB 2HPIA 4JOMA 2Z2SB 5HNHA 2BOLA 2W1OA 2X85A 4BACA 3M8JA 2K5CA 3OOUA 4U7BA 2KRHA 3EUAA 2HU9A 2L9NA 2VJ5A 4YEJA 2RQQA 3G2BA 2WBMA 3OS1A 2JVGA 3E1SA 3F9KA 3DPLC 3EUHC 4U87A 1DQUA 3PFYA 2VLAA 1X4PA 4XN3A 3K70C 4XM3A 3HL2A 3QYBA 2JVHA 3L2QA 1MNEA 4XLEA 2WY7Q 3OS2A 3DWLE 4G6TB 3DKYA 4CCKA 3EUKL 4XMYA 1WJCA 2RNGA 1BOBA 4PJLA 4RMNA 4DIQA 4Y33A 3UNGC 2E1MB 2W82A 2LY1A 5HOOA 4BGDA 2MABA 4BDZA 2WY8Q 2V9KA 1D0XA 1T0FC 5TGTA 1WFXA 4C30A 4BJ6C 1N77A 1LDKB 4ZJZA 3FBNB 2E5NA 4II2A 3LSMA 3ZR8X 1LVKA 1T95A 3OL4A 4PSWA 2VKHA 5JHFA 2Z1DA 3OYDA 1V5GA 3VYRB 2W7NA 2M7AA 4HNUA 4XKVA 5CQEA 3H9JA 2JA2A 1YX3A 2R7UA 3LSHA 5KCMA 2XAUA 4Y3OA 4DGWB 2XDVA 1FMVA 4PJMA 1TT0A 4XKBA 2IGOA 4JQFA 3IAS2 4E7JA 1D0ZA 3I9V2 3QODA 4XLFA 2A5WA 2BVLA 2R7SA 3AKZA 4KJZA 3VYTB 2IGNA 1X1BA 2R7VA 2VL8A 4B48A 4XLCA 3H35A 2KQRA 2OUMA 4ANJA 2R7RA 3RPUD 3LMMA 4HSTA 4E7LA 4OWRB 3LSIA 1WJEA 4RM3A 2HDWA 4XLAA 2HPMA 2AQFA 1NG6A 3OWTA 4HRIA 3OR2C 3H9GA 3DU6A 3OIQA 4IQJA 2HZDA 2HVQA 1NG7A 3W2VA 4CZCA 3DQVC 3W2AA 2LBFB 2KZVA 4HSRA 4P1WA 4E6KG 2CW7A 1X1DA 2VB6A 4FETA 4R79A 3MKYB 5LFAA 4XL9A 4DJAA 3OYAA 4J01A 2X1DA 2R7XA 1X4OA 4PUSA 2OC6A 4BU2A 3RCOA 4IKFA 3EPZA 3CJRB 4OAZA 4BXFA 2I8DA 3VWBA 3K4NA 2XSJC 2VXZA 2XF6A 2LC2A 1JI8A 2CW8A 4BE1A 1UAAA 5LD2C 2Z16A 3HUGB 4RLQA 3S32A 1Y56A 4KISA 2QKLB 4BS9A 4E7KA 2PMZA 3OY9A 2QKMB 1Z3XA 2VXDA 3FHNA 3NWTA 3OYKA 2WADA 4NNJA 2IS2A 1PYVA 1DP3A 4OAYA 1Y6IA 4F55A 3PUBA 3BCBA 3K4JA 3S93A 3S3NA 1QHGA 3PNYA 3OYGA 2CFOA 4BJTA 1X1CA 2XF7A 2ZXIA 2X1EA 3VSLA 3QYFA 4F3QA 3OYHA 3PNTA 4F91B 2A6TA 2E1MC 2LYCA 4XR6A 2W00A 3TMOA 4BQOA 2F5VA 1WJAA 3S3MA 3K4BA 3L2VA 2VQCA 1OR7C 1D0YA 1X1AA 3IP4B 4E7IA 1G59A 3KEYA 3VYSB 2KP6A 3QYEA 2DOAA 1WJFA 3QOEA 2CS3A 5KHDA 2R7TA 3D5LA 4CUGA 2WAQA 4XN0A 4MLOA 4PFPA 3SEQA 1D1AA 3W2WA 1W36D 3AL0C 2VQHA 1UELB 2M4GA 4N4OB 3OYIA 2X6YA 2VJIA 2ZXHA 4ZTJA 3OR1C 1N78A 2FUG2 4II3A 4PJJA 5CPRB 1MMNA 2Q2EB 2Y0SA 3K4LA 4CA0A 2BW3A 2K9LA 4E7HA 4BE2A 1V5FA 4CCJA 1WJ5A 2PJRB 2M7BA 1P9QC 1Z3YA 2DT6A 3W3CA 3VSKA 3RQ4A 3DPTA 2HVRA 2VPLA 2AQEA 1HA8A 4LIVA 2F6CA 3DU5A 3UR3C 4YRVA 3OYJA 4C2UA 3D5RC 4XOPA 4DBRA 4HPQA 4CCLA 3HG9A 1S9HA 5CKTA 2VKDA 3N05A 1BR4A 2BW3B 3CMMA 2CV0A 4IZZA 4KITB 2VIXA 4DOZA 4LIUA 1K6YA 2OV7A 4AYBA 4E4HA 2UWMA 2BVMA 3CP2A 2V1NA 4B3XA 2O5RA 3OL3A 2E5ZA 2W4SA 3PSFA 1N75A 4H4KC 2DCEA 3H5NA 3H9QA 3KX2A 2L2OA 4XNFA 4FASD 1R6RA 3VYUB 4LG3A 2M3AA 4BJ5C 3DKXA 3K4KA 3A2KA 3AFHA 3GBGA 2KDOA 3VDXA 2LBFA 3TBIA 3PNVA 2LH9A 2MD0A 1SAUA 1IRXA 3BC8A 3OIPA 3HOTA 3PJRA 2IS4A 3M1CA 4XONA 3E0JB 4ZYAA 2ZSIB 1DGRM 4QPQA 2GOXB 1GLNA 1MMGA 1FMWA 3KYLA 2DT7B 4AVZA 4BQNA 4C9YA 4YELA 2IGKA 3K6GA 4GRIA 2F4IA 2L5QA 3DLAA 3HC7A 4XKCA 3SYTA 1BR2A 3DTEA 1YX5A 5CQGA 2M0MA 4J00A 3CJQB 4QPOA 4AU7A 4CCNA 3PSIA 4XLHA 1G8XA 2L9SA 4KT6A 4E7ZA 4CH7A 2IXSA 4RM2A 1LKXA 1LFPA 4PK4A 3HKZA 1X19A 3MKWB 3HPGA 4CCMA 1KONA 2KMUA 2ELJA 4HEA2 3OS0A 2X6XA 1TZLA 1WJDA 4ZC3A 4BEHB 3BCAA 4ZTFA 1MW7A 2JUGA 1UG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JVH A;  2JVG A;  2GOX B;  2WY7 Q;  3D5S C;  2NOJ B;  2WY8 Q;  3D5R C;  2GOM A; 
#chains in the Genus database with same CATH topology
 2K9M A;  1Z7L A;  2OZU A;  4EGY A;  4PJN A;  3CC4 I;  3MD2 A;  5HLH A;  3WTS C;  1FTZ A;  3OYB A;  3QRF F;  1YHQ I;  4TV7 A;  5LRS A;  1LE8 B;  2MG4 A;  1VQ5 I;  1CF7 A;  3Q5F A;  2Q8K A;  1D1B A;  3BT9 A;  4EVI A;  3DFG A;  1SFO J;  3DEU A;  4EJT A;  4C3J J;  3I3L A;  1R36 A;  4NQW A;  3KYC B;  3C2H A;  5E8G A;  3GWZ A;  3TO7 A;  3H1C A;  4A3J J;  5FLX Z;  1D1C A;  2XAG A;  2C6Y A;  5A2Q Z;  3HRU A;  3U21 A;  2HVS A;  4DBQ A;  3L2C A;  2P81 A;  5FRO A;  3DCF A;  1BW5 A;  2XUB A;  3F0C A;  3CZ6 A;  5K7Z A;  2CUE A;  1KU9 A;  4NC6 A;  1E0E A;  4QLC U;  1W5T A;  3TL4 X;  2JSP A;  3KZZ A;  1GDT A;  3LSJ A;  2M5W A;  3S8P A;  3ZCO A;  4F52 A;  3D1N I;  1Z05 A;  2UV1 A;  3X2Q H;  3S17 J;  4GO1 A;  1R23 A;  1ONV A;  1G3S A;  1QQI A;  4XRM A;  1BI1 A;  2VT2 A;  4B09 A;  4L0Y B;  1YS7 A;  4HNT A;  2YR2 A;  5K5O A;  2R0Q C;  4U0W A;  3S1N J;  3KP2 A;  3ZRG A;  4A69 C;  5J40 A;  4R8H A;  4DYQ A;  2PMH A;  3BR5 A;  3G73 A;  2M8E A;  4UVC A;  4DZJ A;  2EB7 A;  1KGS A;  2GBY A;  1FOY A;  2R4G A;  2VJ4 A;  3OYE A;  1J0R A;  2R7O A;  3A0H C;  1XPX A;  5FRM A;  1I1S A;  5DCF A;  2HGC A;  5LHG A;  5LGT A;  2MH9 A;  3JRB A;  4PFO A;  2DJI A;  2MC3 A;  4EAT A;  4X0G A;  1U2W A;  3BR3 A;  4Q4Z F;  1OLT A;  1FNN A;  2DDA A;  3LQR A;  3I5U A;  5F0H A;  2V6E A;  5IT9 Z;  1A36 A;  2JT1 A;  3ONQ A;  4BBS J;  1HDP A;  1SMY F;  1UB9 A;  3ZMZ A;  1R4N B;  2EIM H;  4YFX F;  2XC7 A;  3NAU A;  4IX7 A;  3HDD A;  3NWS A;  3RYR A;  3R60 A;  3S2W A;  2TDX A;  4I99 C;  4UUV A;  2E60 A;  4WXC A;  4XKW A;  4W1U A;  2NVX J;  5GAH J;  3M4O J;  2AO9 A;  2VBY A;  4NQW B;  2XPW A;  2KKO A;  4K2E A;  1K4T A;  3A4C A;  2RQP A;  3T0Y A;  5BMZ A;  3K1M A;  2XSD C;  2Q0O A;  4XOR A;  5GPA A;  2K86 A;  1PDN C;  5ICG A;  1HW5 A;  3DEE A;  3ZXS A;  1RI7 A;  4ZDO A;  3MFK A;  3MMY B;  1WGX A;  1MMD A;  5HDG A;  3O8H A;  2HOS A;  4ETS A;  1ORK A;  4ZYD A;  3CQZ J;  2NS7 A;  2ZSH B;  1U0J A;  2LY9 A;  2LOO A;  2COB A;  3IAM 2;  5DM6 F;  1YOV B;  4EJW A;  3S3O A;  4HOB A;  3P9I A;  3CDH A;  3Q9V A;  2ZKZ A;  4XOT A;  3K70 D;  4BDY A;  1SAX A;  3GCM A;  2ELK A;  3LSG A;  2V7F A;  1VQ4 I;  1ZQ3 P;  3KZY A;  3HRT A;  3RYP A;  4O6J A;  4DNC A;  3RKQ A;  2ME0 A;  3M7G A;  3TW7 A;  5FFX A;  4GGG A;  3C2G A;  1OYY A;  3FM3 A;  4LIT A;  4PJ0 C;  4RLF A;  2ELH A;  3EQL F;  1HF0 A;  3J80 Z;  2AXL A;  2HQ5 A;  1W0T A;  3H0G J;  2GXB A;  1AU7 A;  3K10 A;  4EEF G;  2QWW A;  5DUK A;  2Q2E A;  5HLI A;  5EDN A;  2HOE A;  1YIO A;  4JOM A;  2Z2S B;  5DUI A;  3CUQ A;  2QBY A;  2W1O A;  4BAC A;  2P7V B;  4FE7 A;  5IY5 H;  2VJ5 A;  1RRJ A;  1R22 A;  2WBM A;  4AM3 A;  3HRS A;  2CJJ A;  2JVG A;  3IKV A;  3QQA A;  3EUH C;  2ZXW H;  3PFY A;  1DPU A;  1ZK8 A;  3QYB A;  2JJ7 A;  1Y1W J;  1F1Z A;  3HTS B;  1BJZ A;  4G6T B;  1ZG5 A;  1HW2 A;  3HGG A;  3I4M J;  1ETY A;  2ADU A;  2LY1 A;  2NS8 A;  2BHY A;  5L3B A;  4BDZ A;  2HOT A;  2STW A;  1D0X A;  1T0F C;  2YPR A;  3BPV A;  1IRF A;  2CQN A;  1WFX A;  5KAF C;  4BJ6 C;  3FBN B;  4KIF A;  1MJB A;  2XAH A;  3GTK J;  1R5H A;  1ETQ A;  1UJ8 A;  2O61 A;  2CSO A;  4CGZ A;  2H6C A;  3LSM A;  3ZR8 X;  2DBB A;  4L5I A;  3OYD A;  4U88 A;  1AKH B;  3TGN A;  3HOW J;  1P4X A;  1WWX A;  2R7U A;  3HOZ J;  1YRN A;  4DGW B;  4KIG A;  5F1R A;  2XDV A;  1FMV A;  4PJM A;  3MKL A;  3H3U A;  1OFC X;  2IGO A;  2DYS H;  1D0Z A;  2DQR A;  3I9V 2;  2ZCW A;  2EBI A;  2A5W A;  1I27 A;  2BVL A;  3CDL A;  2L54 A;  3L7W A;  1X1B A;  2IGN A;  1G3W A;  1YJN I;  5D5X B;  3JSO A;  2IT0 A;  2VL8 A;  1LJ9 A;  4XLC A;  3H35 A;  2OUM A;  2XPU A;  3I58 A;  1SD4 A;  5TJJ A;  3RPU D;  3VOE A;  4UB6 C;  5IYB J;  1WHU A;  4CO8 A;  2FQ3 A;  3DF8 A;  4OWR B;  3WGH A;  1ZGA A;  2B0L A;  3P9K A;  2WWY A;  4XLA A;  5A2Q K;  1ZH5 A;  2AQF A;  5ED4 A;  1GVJ A;  3WE2 A;  4KUM A;  1K78 A;  4HRI A;  2KZG A;  1LNW A;  3OR2 C;  2PEX A;  3REO A;  1FIA A;  3E5X A;  2IPQ X;  4IQJ A;  4RAY A;  4MO7 A;  1M1E B;  2HZD A;  4HX4 A;  5LHI A;  2HVQ A;  1NG7 A;  1OCC H;  1B9N A;  3IC7 A;  1WZ2 A;  3DQV C;  2M30 A;  3A02 A;  4WXD A;  2LBF B;  5JLX A;  1F36 A;  1E3O C;  2CW7 A;  1J5Y A;  2DN0 A;  2JZY A;  3C18 A;  2RVC A;  1ZRC A;  3QAH A;  5LFA A;  3IRR A;  4XL9 A;  3T1B A;  3I4P A;  2JN6 A;  3TOA A;  5E1X A;  5F08 A;  1BI3 A;  1IN8 A;  5KAI C;  1X4O A;  2Z9O A;  4BXF A;  5FKO A;  2I8D A;  3OV8 A;  3K4N A;  4NBQ A;  2PN6 A;  1IF1 A;  2LKS A;  1JI8 A;  2CYY A;  2CW8 A;  2VI6 A;  4ENJ A;  1XMA A;  3S32 A;  4KIS A;  1GXP A;  2OCC H;  4BS9 A;  2PMZ A;  2VXD A;  3DV8 A;  2FBH A;  1BM9 A;  3PFI A;  1DDN A;  2WAD A;  2QQA A;  3S2D J;  4QSH A;  4RA2 A;  2VUM J;  5C4J J;  3C7J A;  3KEQ A;  2E1O A;  4JBA A;  2DQL A;  1K7A A;  1ZRE A;  3GEZ A;  4LG0 B;  3BCB A;  3ZQG A;  2K85 A;  2I10 A;  3ELK A;  2K4B A;  1MBH A;  3S93 A;  5ICE A;  3L09 A;  5K7F A;  1BBY A;  1ETO A;  3S3N A;  3GME A;  3ABK H;  1Q1V A;  4BJT A;  2X1E A;  3TDZ C;  3VSL A;  3WTX C;  3QYF A;  1BL0 A;  3JAM Z;  1ETK A;  3R4K A;  2V9P A;  2UXX A;  3V7C A;  1JTX A;  4XR6 A;  5B1A H;  1LFB A;  1WSU A;  2DA7 A;  4N9H A;  2EIN H;  1VQO I;  4XSX F;  1OMI A;  1OR7 C;  1SVO A;  4HBL A;  4A3K J;  2BV6 A;  2JMW A;  5J8C A;  4D0P A;  4E7I A;  2F5C A;  3TW6 A;  4MTE A;  3U1K A;  3E6B A;  1J75 A;  2RAE A;  2M2E A;  2CS3 A;  3SDG A;  1O3Q A;  4M3E A;  2R7T A;  3C3W A;  4AYB N;  2A6E F;  1FPQ A;  4BAY A;  1WVR A;  3AL0 C;  3BR1 A;  1S7E A;  4CZZ A;  5EGO A;  2M4G A;  3Q9S A;  5J4V A;  2D1H A;  3JTH A;  3ASN H;  3KLO A;  3GZ6 A;  4G7H F;  1F4K A;  4LK0 F;  2R7Z J;  5L3G A;  3GO5 A;  1N78 A;  2EV6 A;  2RNJ A;  1VQ6 I;  3F8C A;  1SC7 A;  2Q2E B;  2BW3 A;  1MBJ A;  2K9L A;  4MEX F;  2Y2Z A;  4I0A A;  3JRF A;  2M7B A;  1RUO A;  2AXT C;  3VSK A;  4IHS A;  2BHZ A;  4LB6 B;  2HVR A;  2AQE A;  2H09 A;  2QVO A;  3W6J B;  4LD5 A;  3LNQ A;  3OYJ A;  3F3X A;  5J47 A;  3D5R C;  2DOE A;  2M1B A;  2BY1 A;  5B66 C;  2VOD A;  1S9H A;  5CKT A;  3E7L A;  4IPA A;  3TP3 A;  4JK1 X;  5B1B H;  4A3E J;  3WTZ A;  5BQT A;  2FA5 A;  2VE8 A;  4M3D A;  2VIX A;  2LK2 A;  4E4H A;  1ZRD A;  4OIO F;  2Y48 A;  2UWM A;  4IVN A;  2K02 A;  1RET A;  4A2U A;  2V1N A;  4G6D A;  2L7M P;  4I6Z A;  4PGH A;  1N75 A;  1PUE E;  1X2N A;  2QM3 A;  4FT8 A;  5L3C A;  2DCE A;  3H5N A;  3ZMS A;  2ZXJ A;  5JVG F;  4NHJ A;  3KX2 A;  1IJW C;  1OCP A;  3VYU B;  4LG3 A;  1A31 A;  1PVE A;  2Y31 A;  1G2H A;  3GBG A;  1LEB A;  1Z67 A;  4BY1 J;  1UZC A;  5K7H A;  3OIO A;  3H3V K;  4KN7 X;  1IRX A;  1KQ0 A;  3OIP A;  3PJR A;  4XRF A;  1BI2 A;  1XB4 A;  2QLZ A;  4ENN A;  3FK6 A;  2F2E A;  5M5Y J;  2GOX B;  1GLN A;  3V4G A;  1MMG A;  1LDJ A;  1FMW A;  4BBR J;  1G3Y A;  4M9S A;  4Y7N J;  2O3F A;  1MMS A;  3T5X A;  3K6G A;  4HDV A;  2DA6 A;  2L5Q A;  3DLA A;  2HXO A;  1P6R A;  4A3B J;  4HYE A;  1DU6 A;  4A3L J;  3CC7 I;  1KA8 A;  2V1D A;  4KT6 A;  4CH7 A;  4RM2 A;  2DTR A;  1LKX A;  1LFP A;  1Q1H A;  4PK4 A;  3RZD J;  3TO6 A;  5CLS A;  3M3Y J;  1FSH A;  2KMU A;  4M73 A;  3CJT B;  1W7P A;  1EJ9 A;  2X6X A;  3BR0 A;  4MFD A;  2K9Q A;  1MW7 A;  2VBZ A;  4I2O A;  2BY2 A;  5FLM J;  1OCT C;  4BXX J;  1XX5 A;  2EZH A;  4C2M J;  4AVP A;  2R7D A;  1TW2 A;  3CO7 C;  2STT A;  1U5T C;  4GCV A;  4NUB A;  3CCM I;  3WGG A;  2EK5 A;  2KPM A;  3AG1 H;  4WX9 A;  3F6O A;  5F04 A;  1ODD A;  2YSR A;  3SDB A;  5M5X J;  1UFM A;  1AKH A;  3O3K A;  1W4M A;  4EJU A;  1JT0 A;  1VQL I;  2EIK H;  5IP7 J;  2PJR A;  4L18 B;  2R7Q A;  1SFK A;  2K3P A;  3KLN A;  5KNL A;  2Q1Z B;  3K4C A;  3WTT C;  2CO5 A;  3LSK A;  3R0A A;  4HV5 A;  2VOP A;  4Z2Y A;  2FMY A;  2QCO A;  3RPU A;  2CV2 A;  4AUX A;  2CH0 A;  2Z5U A;  3K4M A;  1E3P A;  2PMU A;  4A3D J;  3ZQC A;  2LG4 A;  2WAF A;  5F64 A;  1QZY A;  1VQK I;  2X51 A;  4ZZL A;  2KIS A;  2L7K A;  2QYO A;  3HSF A;  5HNF A;  1GV2 A;  2UUZ A;  3BG6 A;  4G12 A;  3E5U A;  4B3A A;  4C3H J;  5DYM A;  3OYC A;  2XAS A;  1OIS A;  2O7O A;  2DTZ A;  2CQK A;  4P5O A;  5EJC A;  1R1V A;  3F8B A;  1R4M B;  3SEZ A;  2IRF G;  4AD9 A;  4M9X A;  1JUS A;  2HQA A;  4MEY F;  3CCU I;  3V8J A;  1X1P A;  2HXI A;  2K9N A;  2LFB A;  2J5O A;  1QU3 A;  3DBL B;  4A0X A;  3WTW C;  3EUH A;  3FDY A;  3PQK A;  4A12 A;  3ABM H;  4IOC F;  1OQY A;  3BTL A;  2Y9Y A;  3JRC A;  5J6X A;  2LY2 A;  1VZ0 A;  3JRI A;  1XS9 A;  2EFQ A;  1P7I A;  4A0Y A;  2W85 A;  3WU0 A;  5LGN A;  3HUG A;  5AIQ A;  4QWQ A;  2OA4 A;  2PX9 A;  1J7K A;  3IL2 A;  2XGC A;  4C2T A;  1XGO A;  2IA1 A;  1PUF B;  2J5P A;  3OMY A;  5BS6 A;  3M8F A;  1WCM J;  2L7Z A;  2VQL A;  4LLL A;  2NYX A;  4P9F A;  3ZQ7 A;  3HOV J;  1W1W E;  2G0E A;  1SFU A;  1Z9C A;  2CW0 F;  2E1C A;  3KFW X;  4XBF A;  2MD5 A;  1R9T J;  2KIM A;  5FKM A;  3ZMU A;  3ECO A;  2RN7 A;  1YI2 I;  4B4C A;  4GYG A;  2XF5 A;  3DLL F;  2CUZ A;  2WB1 A;  5L3E A;  3L2R A;  3G6E I;  2ACJ A;  5FRN A;  2EFO A;  3F6V A;  2JA7 J;  2O8X A;  2KLO A;  5E79 C;  4LK1 F;  3RQI A;  4A0Z A;  5D4S A;  4EQQ A;  4LGW A;  3D5S C;  1VI0 A;  1WI3 A;  2GOM A;  1ERD A;  3JRE A;  3V42 A;  4UV8 A;  2KHM A;  2VC1 A;  2DXI A;  2EV0 A;  2DW4 A;  4MQV A;  2KJB A;  2W25 A;  3BJO A;  5D5U B;  3AAF A;  2QF7 A;  2X6W A;  5C4X J;  5F27 A;  1K79 A;  2UXN A;  3BR2 A;  3MZY A;  3K2Z A;  1B72 A;  3CF5 F;  3CCE I;  4CYC B;  2O03 A;  2EH3 A;  5IP9 J;  1R71 A;  1ZLK A;  2LRE A;  2MFZ A;  3OYF A;  1WKM A;  1R1U A;  2XV4 S;  5HLT A;  2OTL I;  3V8K A;  3E6M A;  4BL0 B;  2OD5 A;  1ZEL A;  4OMZ A;  3N4M A;  2P0W A;  1JGG A;  4BY7 J;  1MBE A;  2R5Z A;  1TWA J;  5HVQ C;  3QPH A;  5D5V B;  3G3Z A;  5FD6 A;  4BE0 A;  3JTG A;  1B4A A;  4B47 A;  3EET A;  3LL7 A;  4LLG F;  4DYR A;  4U0Y A;  2HPI A;  3E97 A;  3JW4 A;  1U5T B;  3HRM A;  3ERE D;  3M8J A;  2FEZ A;  3OOU A;  2KRH A;  3EUA A;  3ULQ B;  1AOY A;  2L9N A;  2ISY A;  3SXY A;  1U8B A;  1FYL A;  1D8K A;  4YEJ A;  1ZYR F;  3LSR A;  1EH6 A;  4XIC A;  1VQP I;  3E1S A;  1V55 H;  1OCO H;  1V4R A;  3DPL C;  4U87 A;  5EG0 B;  3WHC A;  4G6Q A;  1RC9 A;  1QVU A;  4XN3 A;  1IN5 A;  4YII A;  1R7J A;  3K70 C;  3KYD B;  2E36 A;  4XM3 A;  4L0Z B;  1MNE A;  3CCR I;  2WY7 Q;  1U9O A;  3I64 A;  3DWL E;  2DLL A;  1L0O C;  1WJC A;  2RNG A;  2MLK A;  4PJL A;  2QSG X;  2O6G E;  2NS0 A;  5H2F C;  4RMN A;  3M9A A;  3ZN0 A;  2EIJ H;  3HM5 A;  2LF7 A;  1UHW A;  1KQ9 A;  1VQ7 I;  2V9K A;  5IOZ A;  1PP8 F;  1E17 A;  4FQG A;  4RAG A;  1TWH J;  2A61 A;  4D5F A;  1P2F A;  1A6I A;  4FTH A;  2OCE A;  3RJP A;  4II2 A;  5E1Z B;  4XRS G;  2KIU A;  1T8I A;  4EMS A;  3ABT A;  5J4Y A;  1RR7 A;  1KQ8 A;  3CUQ C;  4WF2 A;  2E1N A;  4RB3 C;  3T8T A;  2M87 A;  1BA5 A;  4I76 A;  5F6F A;  3DBR B;  1V5G A;  2EZI A;  3ERM A;  5EF6 A;  2TCT A;  4HNU A;  4XLN F;  2P4W A;  4RGR A;  2H6B A;  2JA2 A;  4O5V A;  2A07 F;  2XAU A;  1XDU A;  5FKL A;  1XSD A;  3P7N A;  3FKI J;  2DPU A;  1QNT A;  1H0M A;  2LKP A;  4LG0 A;  4XLF A;  2BZT A;  2CUF A;  5DD4 A;  2R7S A;  4KJZ A;  3VEP A;  3CC2 I;  4KDP A;  4ABZ A;  4D5C A;  4ENM A;  3E5Q A;  1H88 C;  1D5Y A;  2R7R A;  3TDU C;  6PAX A;  3Q0U A;  1S72 I;  2BY0 A;  1B72 B;  3QU6 A;  3NRV A;  4CYD A;  1IUF A;  5GTH C;  1XN7 A;  1QA6 A;  3ZMD A;  3H9G A;  3PO2 J;  3AG2 H;  3I54 A;  1ZLJ A;  4OIQ F;  5E3O A;  4OOI A;  1FOK A;  2DMQ A;  2FNP A;  3I56 I;  1B8I B;  1XTA A;  2DOF A;  3AG4 H;  2L3D A;  2GXA A;  1O3R A;  2QEN A;  2VE9 A;  2JRM A;  1UG2 A;  2R7X A;  2OU2 A;  3CCS I;  4BU2 A;  5ICF A;  2XKP A;  3CD6 I;  3EPZ A;  4OAZ A;  3Q3S A;  4B1R A;  3GFI A;  2XSJ C;  3WE3 A;  2VXZ A;  3FXL A;  2FE3 A;  4UNO A;  2QGU A;  2LC2 A;  2XRL A;  4A6D A;  2OF7 A;  3PUF A;  3M8E A;  4BE1 A;  1GT0 C;  3DEW A;  1FP1 D;  3GTO J;  3HUG B;  2H8W A;  4RLQ A;  3L9F A;  1YLF A;  1JJ8 C;  1Y56 A;  3FHZ A;  2ZME C;  4KYW A;  2M45 A;  4M6Y A;  2DFI A;  3QPS A;  1Z7U A;  1XC5 A;  3F8N A;  2Z33 A;  2OTJ I;  2KJC A;  3FMS A;  4NNJ A;  2ZME A;  4OAY A;  1Y6I A;  1TBX A;  2AS5 F;  4L9J A;  4L9N A;  4ZYE A;  5DCM A;  5DTD A;  3K4J A;  1HKQ A;  1QHG A;  2EQR A;  3RKX A;  1HC8 A;  3MN2 A;  3OYG A;  2BEO A;  2EJR A;  3EYY A;  1B6A A;  4LMY A;  1NH3 A;  5K1Y A;  2IP2 A;  3CLQ A;  3LA2 A;  1TQI A;  4A3G J;  3HZJ A;  2W00 A;  4BQO A;  1RPW A;  3SJM A;  3S3M A;  1MDM A;  4HF0 A;  5GP9 A;  1GHC A;  4P96 A;  3S15 J;  3K4B A;  3JCU C;  3HJE A;  1D0Y A;  4UVB A;  1VFC A;  4C3I J;  2VPR A;  5M3M J;  1ITY A;  1XCV A;  4GXO A;  3VYS B;  3GVA A;  1ZGW A;  1WJF A;  3QOE A;  5D5W B;  1LB2 A;  4EM0 B;  5KHD A;  1SAN A;  2F5D A;  5J1U A;  4ZH4 F;  4A3F J;  2WTE A;  3PIP F;  4MLO A;  1K83 J;  4PFP A;  1D1A A;  1W36 D;  3ZQH A;  2RDP A;  4O3M A;  2M9H A;  5E3N A;  3HBL A;  1QZZ A;  1IXC A;  2VJI A;  4ZTJ A;  2YX4 A;  2A68 F;  3RIR A;  4MHG A;  1IGN A;  3KE2 A;  5CVV A;  4M3F A;  1HXD A;  4II3 A;  5FFZ A;  2Y30 A;  1MMN A;  3GTQ J;  3HHH A;  2F48 A;  1G3T A;  2DT6 A;  2Y75 A;  2Y0S N;  5E17 F;  3J81 K;  3DPT A;  1IW7 F;  2GIZ A;  2HFH A;  5CVI A;  1O7L A;  2CQ7 A;  4RAF A;  5FKK A;  3GFM A;  4XOP A;  3ZP5 A;  2W84 A;  3BG9 A;  3R0J A;  4HPQ A;  4CCL A;  3HG9 A;  3BDD A;  2VKD A;  1XDS A;  3N05 A;  1PUF A;  1BR4 A;  2BW3 B;  1YS6 A;  1R49 A;  2XAJ A;  1R1T A;  1I6H J;  4X1E A;  4CXF A;  1K61 A;  1K6Y A;  2OV7 A;  4EJV A;  2CRG A;  2ZJP F;  2BVM A;  3CP2 A;  5EZG A;  5EG0 A;  3QPL A;  1D3Y A;  2JA8 J;  2R3S A;  3BTI A;  3TKY A;  2X4H A;  2DA5 A;  4Y15 A;  1MNM C;  1B1B A;  2YUS A;  4XNF A;  4FAS D;  5ICC A;  5EGO B;  1YIT I;  3ESW B;  1ZG3 A;  2M3A A;  3U1D A;  1U5T A;  2LBF A;  5K5Q A;  3TBI A;  3S16 J;  3K9T A;  2DA2 A;  2QQ8 A;  4M71 A;  3SHF A;  2MD0 A;  3V8L A;  5IT3 A;  3BC8 A;  3TOB A;  4XON A;  4UHT A;  4RBO A;  3E0J B;  4ZYA A;  4M9Z A;  1VQ9 I;  3K0L A;  4QPQ A;  5E3M A;  4A3C J;  3GFJ A;  4AVZ A;  3G1O A;  4YEL A;  3FX3 A;  3GUD A;  3HSR A;  1T0F A;  4CDG A;  2F4I A;  2A69 F;  1AHD P;  1FOX A;  1BR2 A;  3DTE A;  2NOG A;  3PIO F;  2P8T A;  1FX7 A;  2M0M A;  2EZK A;  2XRN A;  4KIC A;  1G8X A;  2HS5 A;  3W6K B;  4E7Z A;  1MZB A;  4A5M A;  4I0B A;  4A5N A;  3F8F A;  2V9V A;  1X19 A;  3MKW B;  2RKH A;  4CCM A;  1KON A;  2E2I J;  2VN2 A;  2OPT A;  3FF5 A;  3GLX A;  5LBQ A;  3J7A O;  3IH4 A;  4AWX B;  2BXY A;  1RKW A;  1TNS A;  3CCJ I;  1Z1D A;  2JUC A;  1N25 A;  3HXL A;  3U9G A;  1XMK A;  1QRY A;  2L02 A;  4OIN F;  3RPQ A;  4BQQ A;  5KK1 A;  5F1J A;  4M6V A;  1XD7 A;  2ZB9 A;  4CSW A;  1H89 C;  4RGU A;  1TQP A;  3PO3 J;  4EM2 A;  2E7W A;  3F21 A;  3QOP A;  3RDI A;  3I4N J;  2V4J C;  3G4S I;  2IA0 A;  3GTP J;  5LEJ A;  1RES A;  2HZT A;  5CVU A;  1MMA A;  1IN7 A;  1ENH A;  3GLL A;  3OSF A;  4CCO A;  3HEF A;  2ZNY A;  5D8L B;  2IS1 A;  4N4N B;  4JX6 A;  2GA1 A;  3DBH B;  2LD5 A;  4G7O F;  1SFE A;  2YX7 A;  2CV1 A;  3I71 A;  4MQ9 F;  3V7R A;  1NTC A;  5F0C A;  2LNB A;  3HIF A;  2DA4 A;  3B6A A;  1FSE A;  4NB5 A;  2V79 A;  3BZC A;  2FU4 A;  3HOS A;  4HQM A;  3CF2 A;  3FK7 A;  1IN6 A;  1JUM A;  4BHC A;  4D1Q A;  1ZN2 A;  2XGE A;  5B3S H;  5H6Q A;  1W5C C;  2FOK A;  2HTJ A;  2L01 A;  4Y4R A;  3LWF A;  4XQF A;  2VBX A;  2ZFU A;  4AC0 A;  4ITV A;  5TRD A;  4G9Y A;  3CCV I;  3TO9 A;  1MBF A;  2CWE A;  2Z3Y A;  5FKN A;  1HBX G;  4HZF A;  4CHU A;  3PL8 A;  2VC0 A;  1YW9 A;  1R5I D;  2IS6 A;  3K7A J;  1YJW I;  3FBI B;  1NHA A;  2DU9 A;  2L4A A;  2VQG A;  4ZYH A;  3SZP A;  1B9M A;  5EZH A;  4OU0 A;  1NK2 P;  4HV6 A;  4NC8 A;  1O4X A;  4E7S A;  2R7W A;  3VB2 A;  1UST A;  1YJ9 I;  5JHU A;  3D0S A;  2CU7 A;  2ZBK A;  5ILU A;  3A1Y A;  3JAM K;  2ECC A;  2L9R A;  3CES A;  3FXJ A;  1S29 A;  1KU2 A;  3QP5 A;  1EH7 A;  1S3J A;  2IJL A;  3ZGK A;  4D9J A;  3RSN A;  4S0H B;  1TW3 A;  4ZDP A;  2M34 A;  4EJO A;  3IKT A;  3ZQQ A;  1TWC J;  1WQ2 A;  1WJB A;  1V5E A;  3OYM A;  4HG2 A;  5HOD A;  3LAJ A;  2H1K A;  1JUP A;  2GA2 A;  5J3L A;  3J7A Y;  5M5W J;  2R7F A;  3ABU A;  3O6B B;  3ZMT A;  3BP8 A;  3LQQ A;  2CMP A;  2M4K A;  3SZG A;  4F93 B;  4HQE A;  2RRE A;  1HQC A;  2V6C A;  1P4A A;  3Q0W A;  2ESH A;  2D5V A;  2DMU A;  1VTN C;  4UUT A;  4YFN F;  1BR1 A;  1L3L A;  2K40 A;  1ZGJ A;  5J1R A;  1LQ1 A;  1UCR A;  1WH5 A;  3BOQ A;  4F7Z A;  5DDG A;  3B02 A;  3BG7 A;  1MH4 A;  2H94 A;  2K27 A;  4ZDL A;  4NC7 A;  3OYN A;  2HDD A;  3H3Z A;  3CP8 A;  3GX4 X;  3AL0 B;  3LA3 A;  4YIF A;  3HOU J;  3PQJ A;  1CGP A;  1TNT A;  3S14 J;  3BLY A;  4U7D A;  2Y0M A;  5GAG J;  3GTL J;  2NOJ B;  1SD6 A;  2CQQ A;  2VOO A;  2XAQ A;  5IP6 A;  3FWE A;  2R92 J;  3JR9 A;  1IRG A;  4U7B A;  1YYV A;  3ZQF A;  2DMP A;  2ECB A;  3G2B A;  2E35 A;  3WG9 A;  2R93 J;  3F9K A;  3U2R A;  1MBK A;  4JYK A;  1X3Z B;  2QEX I;  2FSW A;  2JVH A;  3L2Q A;  1W0U A;  5HS8 A;  1ZAO A;  4Y52 J;  4HA8 A;  4L9T A;  2JRT A;  3FM5 A;  1STZ A;  2XVC A;  4CCK A;  2GLO A;  2NVT J;  1H9T A;  4DIQ A;  4Y33 A;  1RNL A;  2W82 A;  9ANT A;  5HOO A;  1KYZ A;  5BOX A;  2PG4 A;  4QIW N;  3EYI A;  2RC4 A;  3GF2 A;  2COM A;  4Y13 A;  3VFZ A;  4MNU A;  3O2P E;  4P9U A;  2H8R A;  2ZNZ A;  4JX4 A;  4BHP A;  1YW7 A;  2VT3 A;  1ZTR A;  4IF4 A;  4ZJZ A;  3F8M A;  2E5N A;  2RGV A;  5H20 A;  3BG3 A;  4IHT A;  4YG2 F;  3J81 Z;  1TT5 B;  4LLN A;  2XHK A;  3OL4 A;  4PSW A;  2D2W A;  4IJA A;  3CMY A;  3S1M J;  3WOD F;  1T2K A;  2OBP A;  4UY8 I;  2M7A A;  4XKV A;  5CQE A;  4S04 A;  1YX3 A;  1SD5 A;  3BTC A;  1FBQ A;  1VQM I;  1ZRF A;  5E20 A;  1ON1 A;  2MLG A;  1MDM B;  2PMZ N;  1RZ4 A;  1TT0 A;  5K5R A;  4XKB A;  3IAS 2;  4U0V A;  4E7J A;  2F5F A;  3SZT A;  5JVT A;  2DFF A;  5D6E A;  1YIJ I;  2CG4 A;  1XGS A;  3VYT B;  2F4O B;  2EPF A;  3IV5 A;  1ETV A;  4BNC A;  2XAF A;  2HDC A;  3K2A A;  1CF7 B;  1FOW A;  3FXO A;  5DM7 F;  4ANJ A;  1A04 A;  3LMM A;  1G6N A;  3LSI A;  2LP0 A;  1WJE A;  1TLH B;  1WI9 A;  2WV1 A;  2FBI A;  3ISP A;  4RM3 A;  1FP2 A;  1QPI A;  1YW8 A;  1ON2 A;  2HDW A;  3I59 A;  2HPM A;  1DUX C;  1ZAR A;  1JKQ C;  1NG6 A;  3CO6 C;  1KU3 A;  2GZW A;  3MVP A;  1T56 A;  1XG1 A;  2MW8 A;  3DU6 A;  2OJE D;  2W24 A;  1I39 A;  5ILS A;  3W2V A;  5GPC A;  1W5S A;  2EA2 A;  3K1N A;  1ULY A;  2FXA A;  2EA4 A;  4CZC A;  4RGS A;  1S7A A;  3RZO J;  2F4M B;  4FCY A;  1MJ9 A;  2QQ9 A;  3W2A A;  2L9V A;  5EEA A;  1K6O A;  2HOA A;  3I0T A;  2W48 A;  1UHM A;  3E6D A;  4HX8 A;  1TP4 A;  1EH8 A;  4E6K G;  1T98 A;  1X1D A;  2VB6 A;  2H1L A;  1WH7 A;  4DJA A;  3OYA A;  4J01 A;  4OIR F;  3LSP A;  1KZH A;  2LKX A;  5CJ9 A;  2OQG A;  1MH3 A;  3QWL A;  4MGR A;  4PUS A;  5EYR A;  1U6G A;  2EFN A;  1YG2 A;  2G7H A;  2XF6 A;  2KDZ A;  1OJL A;  5HDK A;  1MGT A;  2FRH A;  3F72 A;  3HKZ N;  1ZR2 A;  2P5K A;  2QKL B;  2A5Y B;  3WGI A;  4Q47 A;  4V19 K;  1TQM A;  4B8X A;  1FT9 A;  1IC8 A;  3NWT A;  4G94 A;  2IS2 A;  1PYV A;  4F55 A;  3E6C C;  1GVD A;  3LAP A;  3GZN B;  4PGG A;  1IXS B;  2ZC2 A;  3PUB A;  3G1M A;  1VQN I;  2PJP A;  1I1G A;  2CFO A;  2FML A;  2X9D A;  2XF7 A;  2ZXI A;  4IL6 C;  3K1P A;  4J19 A;  3GZ5 A;  2H27 A;  4F3Q A;  1FYK A;  3WG7 H;  2JPC A;  2R5Y B;  1S5L C;  2NNN A;  3CCY A;  3S2H J;  1WJA A;  2QBY B;  2E2J J;  2GQQ A;  2KRF A;  3QP6 A;  4M3B A;  1R00 A;  1R58 A;  1JTY A;  2F5E A;  4HNV A;  1X1A A;  3IP4 B;  1JHF A;  2ICW G;  2B63 J;  1G59 A;  2GWR A;  2MSY A;  4AIH A;  1X58 A;  4IHY A;  2KP6 A;  2KT0 A;  4IRH A;  1AWC A;  5FLV A;  3ECH A;  5JFR A;  3M07 A;  2NNY A;  3NAR A;  4M74 A;  3D5L A;  3MQ0 A;  4CUG A;  4LOC A;  2WAQ A;  2X6O A;  4WK8 F;  2K3F A;  1O57 A;  1W7P D;  2GAU A;  4PZJ A;  4XN0 A;  3W2W A;  4NDL A;  2VQH A;  1U3E M;  4N4O B;  3I59 B;  1S8N A;  2HYG D;  1MJA A;  1TTY A;  2X6Y A;  2HTS A;  3P9C A;  3SQN A;  1B8I A;  2XB5 A;  2YS9 A;  2HEO A;  3O8G A;  3TQN A;  1F5T A;  3OOP A;  1I3Q J;  4ESF A;  3OR1 C;  2MGQ A;  3T8R A;  5GAD J;  5LEK A;  2FUG 2;  1FTT A;  3PM1 A;  1J59 A;  4G8X A;  4PJJ A;  2GM4 A;  3BR6 A;  1DU0 A;  2MA3 A;  5KVR A;  3ZOB A;  4E7H A;  4BH9 A;  3IH2 A;  1V5F A;  1U8R A;  2W57 A;  2PJR B;  2P6S A;  1VQ8 I;  1Z3Y A;  5M3F J;  1ZG1 A;  3HTU A;  1IN4 A;  2HR3 A;  3W3C A;  5FLX K;  3RQ4 A;  2VPL A;  2LVS A;  1BOA A;  4LIV A;  2F6C A;  5GTI C;  1IDZ A;  3DU5 A;  4P55 A;  3UR3 C;  4C2U A;  1HKS A;  1D5V A;  2UZK A;  1U9N A;  4I01 A;  4YFK F;  1Y8R B;  2FJ1 A;  4D7N A;  4FX4 A;  1IDY A;  3KP6 A;  1GUU A;  3F22 A;  2WC2 A;  2JUG A;  4AYB A;  3G1L A;  4MFE A;  3S1Q J;  3BRO A;  1GV5 A;  3GTM J;  2Y9Z A;  1BIA A;  4B3X A;  2EFP A;  2E5Z A;  5BPI A;  1RR8 C;  3EDP A;  2GXG A;  3IRQ A;  2L2O A;  1R6R A;  1YQA A;  3TP0 A;  1JE8 A;  1LUJ B;  2FBK A;  3DKX A;  3K4K A;  4BXU A;  3AFH A;  3CUQ B;  1XMX A;  3VDX A;  3A2K A;  1BJA A;  3FXK A;  4Q48 A;  2N8G A;  5DV5 A;  3HOT A;  4M3G A;  2IS4 A;  2DO7 A;  3M1C A;  3MEX A;  3CDI A;  1O3T A;  3RI4 A;  4Q5S F;  4IXA A;  4G7Z F;  4WCG A;  1SVL A;  1FBS A;  4BQN A;  3GYH X;  4C9Y A;  1USS A;  2HYF A;  2IGK A;  2ZME B;  4DYC A;  1JXS A;  2YU9 J;  3RKY A;  1YX5 A;  1RUN A;  5CQG A;  1HSJ A;  3B73 A;  2KIF A;  4J00 A;  3KCC A;  1IO2 A;  1H8A C;  4QPO A;  4CCN A;  5HLG A;  5FJ8 J;  1MKM A;  1SFX A;  2IXS A;  4AIK A;  2ME6 A;  4IHV A;  1D8J A;  1OCZ H;  1FLI A;  4EV0 A;  1JHH A;  2DPD A;  4HX7 A;  2OZ6 A;  3HPG A;  2DMT A;  1EV7 A;  1V54 H;  2QUF A;  4HEA 2;  3OS0 A;  4E70 A;  4BEH B;  1TZL A;  1WJD A;  4ZTF A;  3B6C A;  3A0B C;  2HQN A;  2E34 A;  4HLX A;  4JP0 A;  1W36 C;  2XPV A;  5E1W A;  4B44 A;  2VJJ A;  2Z99 A;  4BKX A;  1Z21 A;  4BUP A;  1I3A A;  2M8G X;  3LFU A;  3HSE A;  4KT5 C;  2DK5 A;  3DPU A;  3L2U A;  1Z6R A;  3F23 A;  1ETX A;  1BC7 C;  2IGM A;  2R5Y A;  3HPH A;  1FJL A;  1LFU P;  3C1D A;  4LB5 A;  2ZO4 A;  3RTR A;  1U78 A;  2V1X A;  3BPX A;  5FB2 A;  1IXR C;  1YE9 A;  2DYR H;  2ESN A;  2WAE A;  4UV9 A;  1Y0N A;  2XIG A;  1A6Q A;  1QZE A;  5CVR A;  1FIP A;  3JRD A;  2HWV A;  1Y0U A;  4HDU A;  4KN4 X;  3P5J A;  1HLV A;  2VKV A;  2PBI A;  1A5J A;  3OSG A;  2O0Y A;  3DTI A;  3HB9 A;  3H0D A;  1MND A;  2FOW A;  4ESJ A;  2BGC A;  1KU7 A;  2XRO A;  1SVM A;  2EWN A;  1T39 A;  3I53 A;  2JTV A;  3COA C;  3HHG A;  3A03 A;  4PDK A;  3GFL A;  4KMU X;  2VBW A;  2TRT A;  1ACI A;  4AID A;  4XID A;  1HKT A;  4F92 B;  1IV6 A;  4MTD A;  1J2X A;  1TL8 A;  1X2M A;  4IEJ A;  5IOY A;  2IA2 A;  2V26 A;  4PSX A;  2JA6 J;  1OCR H;  4FHT A;  1X3U A;  5IYD J;  3E3V A;  3FXR A;  2YU3 A;  1E2X A;  3L2W A;  2KRC A;  1QGP A;  1CQT A;  1LPQ A;  3OYL A;  2HNH A;  2MYS A;  4A3M J;  1EKE A;  4YIR X;  3NEU A;  2P6T A;  3I55 I;  4ENK A;  4ZZD A;  5FO5 A;  4IQ4 A;  4BQA A;  2WA0 A;  1XCB A;  1LEA A;  1HDD C;  1PJR A;  3KP3 A;  2K4J A;  4BEH A;  5GAE J;  3DP7 A;  4V2G A;  4S05 A;  3AG3 H;  4RB0 A;  2BXZ A;  2KL4 A;  2OAZ A;  3GXO A;  3FKJ A;  4UUS A;  2JQ7 A;  2VON A;  4I98 B;  3RKW A;  2JWT A;  4B43 A;  2E2H J;  1W7P B;  2X1C A;  1FY7 A;  1OYW A;  2EZL A;  2MC4 A;  5LRR A;  1XSX A;  4W97 A;  3FXU A;  4IRG A;  2HKO A;  5AON A;  2L0K A;  3FMR A;  1IG7 A;  3CTA A;  1EA3 A;  3ASO H;  3H5A A;  1TWG J;  2NVQ J;  2PQ8 A;  1XGM A;  3KIO A;  3HOX J;  4H0E A;  3JSP A;  3IUO A;  2FD5 A;  3K69 A;  1HOM A;  1MBG A;  5D6F A;  1UHS A;  2CUJ A;  4D7M A;  1E3H A;  2A3S A;  4CIC A;  1MD0 A;  1IRZ A;  1IAW A;  3IWF A;  2PLY A;  3H5R A;  3FIS A;  3MKZ A;  5B5E C;  1MSE C;  2QZ8 A;  2VAS A;  3KZI C;  4HW0 A;  2LRD A;  1PP7 U;  2DJN A;  3CMA I;  5CVJ A;  1ETW A;  5DD8 A;  4R1H A;  2FX0 A;  3LA7 A;  3DTK A;  4IRI A;  3LFK A;  1S6L A;  4X6A J;  1JKR C;  3VOD A;  3FXM A;  3WTU C;  4UB8 C;  4FX0 A;  3BJ6 A;  4IO9 F;  1QHH D;  1K78 B;  1MIJ A;  1AA7 A;  3Q0V A;  1J09 A;  3FZV A;  2NVY J;  1DGW Y;  3ROU A;  1WPK A;  5HNH A;  2D1V A;  2BOL A;  1BW6 A;  2DAO A;  2M0C A;  2X85 A;  5JI6 A;  3CME I;  2EV5 A;  4N9I A;  2FQ4 A;  4HAM A;  1K4S A;  2K5C A;  2HU9 A;  2ZFW A;  5LGU A;  2RQQ A;  5E3L A;  3IHU A;  1I50 J;  2BYV E;  2IW5 A;  3OS1 A;  1JKO C;  2GIV A;  1HW1 A;  4RB2 C;  1DP7 P;  1DQU A;  5TIS C;  1Y39 A;  2VLA A;  2K7L A;  1X4P A;  1Z91 A;  2A6H F;  3HL2 A;  3TED A;  3BTJ A;  4XLE A;  1FBU A;  4BHB A;  2JSC A;  2QSF X;  3WU2 C;  3OS2 A;  3DKY A;  2XGD A;  3EUK L;  4XMY A;  1BOB A;  4FIS A;  4DZP A;  4XK4 A;  5HDN A;  1T6S A;  2VKE A;  1T08 B;  1JT6 A;  3CUO A;  3UNG C;  2E1M B;  1BIB A;  4BGD A;  1POG A;  2MAB A;  4M6X A;  2ZJR F;  1FC3 A;  1ZR4 A;  2PFB A;  2WY8 Q;  5TGT A;  2DFE A;  1P7J A;  4C30 A;  4UXN A;  2LLK A;  2EFW A;  1N77 A;  1LDK B;  3BY6 A;  4WXH A;  2XB0 X;  4FE4 A;  1F43 A;  4Y17 A;  4KIB A;  3WTY C;  5J8F A;  3ML6 A;  4WWC A;  2FNA A;  1LVK A;  1T95 A;  2VKH A;  5JHF A;  2Z1D A;  1OR7 A;  3ABL H;  4CYC A;  1OYI A;  4Z6Y A;  2O8K A;  2IBD A;  5ERI A;  3HYI A;  3VYR B;  2W7N A;  4DW6 A;  3H9J A;  2PI0 A;  3LSH A;  2ETH A;  5KCM A;  2B9S A;  1NK3 P;  4Y3O A;  5HS9 A;  5F0F A;  4IHX A;  2BY3 A;  4HLY A;  4V2F A;  4JQF A;  2JPB A;  5E18 F;  3QOD A;  5DCM B;  3UKG A;  2JK3 A;  5C3E J;  2WB1 N;  2DA3 A;  5FD5 A;  3AKZ A;  1G4D A;  3R61 A;  1RKT A;  5DS9 A;  3GW2 A;  2R7V A;  4UUS B;  1Y8Q B;  1GXQ A;  4B48 A;  2KQR A;  4XSZ F;  3KP7 A;  1XSV A;  2X0L A;  2V1U A;  4OMY A;  4GYI A;  4A6E A;  4ON0 A;  1YRN B;  4HST A;  4E7L A;  5BPD A;  1DPR A;  3GTG J;  3LOC A;  3W6V A;  3H36 A;  3G71 I;  5AIP A;  3OWT A;  2P5L C;  3CCQ I;  3MZH A;  3NQO A;  2QSH X;  2QQB A;  5E8I A;  1ZKG A;  3OIQ A;  5JLW A;  5HS7 A;  4OIP F;  2XGX A;  5CYV A;  4ESB A;  3KP5 A;  4PCQ A;  3ZN1 A;  3BZ6 A;  4I7H A;  1TWF J;  3FIW A;  1Y1V J;  2LF8 A;  1S7O A;  3BJA A;  2KZV A;  4HSR A;  3C2B A;  1VF9 A;  4P1W A;  2HQR A;  5LLQ A;  3FMQ A;  1B59 A;  1WRJ A;  4FET A;  2ZJ2 A;  4BYY A;  4R79 A;  3MKY B;  1FEX A;  2E19 A;  1IUY A;  5IPA A;  2ZJQ F;  2EIL H;  2X1D A;  5IT9 K;  2OC6 A;  3RCO A;  3A01 A;  4GFB A;  4IKF A;  3CJR B;  3J7Y J;  3SFZ A;  3VWB A;  1OKR A;  2DOD A;  2L4M A;  3QU3 A;  3WHB A;  2HI3 A;  4L9V A;  1UAA A;  5LD2 C;  2Z16 A;  2BBY A;  2X48 A;  1QO0 D;  3BWG A;  1LE8 A;  2B7E A;  1SMT A;  4I02 A;  5BNG A;  1ZHF A;  4E7K A;  2P7C B;  1JGS A;  3OY9 A;  2QKM B;  1Z3X A;  4KMF A;  3FHN A;  2DI3 A;  3MWM A;  3J80 K;  3OYK A;  3HOY J;  1OPC A;  1KYW A;  2HKX A;  1DP3 A;  2CFX A;  1I6X A;  3JRG A;  3KP4 A;  4EM1 A;  1SEU A;  3SFI A;  3CJN A;  1IV8 A;  5EEG A;  2LSO A;  2HYJ A;  3PNY A;  4ZYG A;  3WU1 B;  1X1C A;  2O9L A;  1T33 A;  2BE5 F;  5EEH A;  3IH3 A;  3OYH A;  3PNT A;  4F91 B;  4QTR A;  2AHQ A;  2A6T A;  2E1M C;  2LYC A;  2RV8 A;  1J9I A;  1QBJ A;  4KNY A;  3FXQ A;  3TMO A;  4I09 A;  4IHW A;  2F5V A;  4L5E A;  3ZQI A;  1FYM A;  3WTV C;  2P5V A;  2D45 A;  3L2V A;  2VQC A;  1RIO H;  1YFH A;  2WV0 A;  3KEO A;  3MAJ A;  2CQX A;  5L3F A;  1C0W A;  2E7X A;  5ILV A;  2JA5 J;  5J1Y A;  3BZK A;  1JKP C;  2MBF A;  4LFU A;  1I5Z A;  3KEY A;  4RGX A;  3L1P A;  1P92 A;  3QYE A;  1BC8 C;  2DOA A;  4JX5 A;  3CCL I;  2IVM A;  1UMQ A;  2NXN B;  4GDF A;  1P4W A;  1MSF C;  5C44 J;  1SD7 A;  3SEQ A;  5L3D A;  2MH2 A;  1FWZ A;  1O3S A;  1UEL B;  2NAZ A;  3OYI A;  1APL C;  2DDB A;  3BQY A;  3QPT A;  2LMD A;  5D8K B;  4A3I J;  1HST A;  2ZXH A;  4DQ2 A;  3BQZ A;  4N0B A;  1A35 A;  3HGY A;  4EGZ A;  5H6R A;  3MCZ A;  3KET A;  1V3F A;  1REP C;  5CPR B;  3ZMV A;  2Y0S A;  3K4L A;  4CA0 A;  2R5Z B;  3ZQL A;  3IWZ A;  4L5J A;  4BE2 A;  4IOA F;  1XGN A;  4CCJ A;  1WJ5 A;  3J7Z I;  1P9Q C;  5LHH A;  2LDU A;  3CLO A;  3S1R J;  2QA4 I;  1HA8 A;  3ZPL A;  4RAZ A;  4RDU A;  1YO5 C;  2L7F P;  4YRV A;  1BN5 A;  2DMN A;  3JRA A;  2OQR A;  4DBR A;  2G9W A;  1F9N A;  2K9S A;  2ID3 A;  4KA4 A;  3CMM A;  2CV0 A;  2DFH A;  3BG5 A;  3R6S A;  4IZZ A;  4KFC A;  4KIT B;  1LDD A;  2NVU B;  5D4R A;  3JRH A;  4DOZ A;  4LIU A;  5DEQ A;  2XKO A;  2ID6 A;  3LST A;  1BI0 A;  1Z6T A;  2O5R A;  2E71 A;  2W4S A;  3OL3 A;  2LR8 A;  3PSF A;  4H4K C;  4RB1 A;  2A05 A;  1QPM A;  1TC3 C;  4LJZ F;  5FGM A;  3H9Q A;  3KPH A;  4HF2 A;  4AIJ A;  2IAI A;  3H92 A;  4UVA A;  4BJ5 C;  4XRS A;  2KDO A;  1VND A;  3VPR A;  4XLP F;  3PNV A;  2LH9 A;  1SAU A;  2ISZ A;  1H9G A;  2LTP A;  1IZ1 A;  1Z0X A;  4M72 A;  2ZSI B;  1QVT A;  1DGR M;  4HF1 A;  1YTY A;  3KYL A;  2FF4 A;  2DT7 B;  2DK8 A;  1Z77 A;  3M1E A;  2CGP A;  1T38 A;  4GRI A;  4RS8 A;  5JR3 A;  3SYT A;  3HC7 A;  4XKC A;  2DA1 A;  1X3W B;  3DXJ F;  3MZ8 A;  1EF4 A;  3L00 A;  1HCR A;  3CJQ B;  1FZP B;  1LVA A;  1O7F A;  3GTJ J;  4AU7 A;  3PSI A;  4XLH A;  3DKW A;  2IEK A;  2L9S A;  2WAQ N;  2NRA C;  4ASN A;  3V7S A;  2KFD A;  3HKZ A;  1JJ6 C;  5IYC J;  4A93 J;  4MIM A;  2DT5 A;  1R5G A;  3N97 A;  2ELJ A;  2G7U A;  2Y69 H;  4ZC3 A;  3BCA A;  3A01 B;  2I5U A;  2KIQ A;  1UG0 A; 
#chains in the Genus database with same CATH homology
 2K9M A;  1Z7L A;  4PJN A;  1W36 C;  3HXL A;  3MD2 A;  4B44 A;  3OYB A;  2VJJ A;  4BUP A;  1Z21 A;  4BQQ A;  4NUB A;  2KPM A;  3LFU A;  4CSW A;  3DPU A;  3L2U A;  1D1B A;  2IGM A;  3HPH A;  3SDB A;  3RTR A;  2V4J C;  3I3L A;  1YE9 A;  3C2H A;  2PJR A;  2WAE A;  2R7Q A;  1SFK A;  2K3P A;  5KNL A;  2Q1Z B;  1MMA A;  3K4C A;  1D1C A;  4CCO A;  3LSK A;  3U21 A;  2HVS A;  2IS1 A;  4DBQ A;  4N4N B;  3DTI A;  5FRO A;  3H0D A;  1MND A;  2CV1 A;  3CZ6 A;  2CV2 A;  1E0E A;  2CH0 A;  3K4M A;  3TL4 X;  2JSP A;  4F52 A;  3S8P A;  3HOS A;  3ZCO A;  2LG4 A;  2WAF A;  3CF2 A;  2UV1 A;  2X51 A;  2L7K A;  5HNF A;  2UUZ A;  3BG6 A;  4F92 B;  4D1Q A;  3OYC A;  4HNT A;  2V26 A;  4PSX A;  4P5O A;  3ZRG A;  3SEZ A;  3L2W A;  2KRC A;  4Y4R A;  4XQF A;  3OYL A;  2ZFU A;  2R4G A;  2HNH A;  2VJ4 A;  4ITV A;  3OYE A;  2HQA A;  2R7O A;  5FRM A;  2MYS A;  4PFO A;  3PL8 A;  2DJI A;  1QU3 A;  4EAT A;  4X0G A;  3FDY A;  2IS6 A;  1OLT A;  4IQ4 A;  2V6E A;  3FBI B;  2WA0 A;  2LY2 A;  2VQG A;  1VZ0 A;  3ONQ A;  1PJR A;  2XC7 A;  4IX7 A;  4NC8 A;  4BEH A;  4E7S A;  3NWS A;  2R7W A;  2KL4 A;  3FKJ A;  3A1Y A;  4C2T A;  2E60 A;  3CES A;  4XKW A;  3OMY A;  4B43 A;  4NQW B;  2X1C A;  3ZGK A;  4D9J A;  2VQL A;  3RSN A;  2MC4 A;  3A4C A;  4ZDP A;  3ZQQ A;  1WJB A;  1V5E A;  4XOR A;  3OYM A;  4HG2 A;  1EA3 A;  3H5A A;  3DEE A;  3ZXS A;  4ZDO A;  3MMY B;  2XF5 A;  3IUO A;  1MMD A;  3J7A Y;  2CUZ A;  2WB1 A;  3L2R A;  5FRN A;  2KLO A;  2CMP A;  2ZSH B;  1U0J A;  2M4K A;  2CUJ A;  2LOO A;  3SZG A;  4F93 B;  3D5S C;  3IAM 2;  2RRE A;  2GOM A;  3S3O A;  1ERD A;  3V42 A;  2KHM A;  4XOT A;  3K70 D;  4BDY A;  2DXI A;  3H5R A;  3LSG A;  2V7F A;  1BR1 A;  3MKZ A;  2VAS A;  2X6W A;  2LRD A;  3BG7 A;  3C2G A;  4LIT A;  4RLF A;  4ZDL A;  2LRE A;  3DTK A;  2MFZ A;  4NC7 A;  3OYN A;  3OYF A;  3CP8 A;  5HLT A;  3AL0 B;  4BL0 B;  1ZEL A;  3K10 A;  1QHH D;  2P0W A;  1AA7 A;  5HVQ C;  1J09 A;  4BE0 A;  3BLY A;  1DGW Y;  3LL7 A;  4B47 A;  2NOJ B;  2HPI A;  4JOM A;  2Z2S B;  5HNH A;  2BOL A;  2W1O A;  2X85 A;  4BAC A;  3M8J A;  2K5C A;  3OOU A;  4U7B A;  2KRH A;  3EUA A;  2HU9 A;  2L9N A;  2VJ5 A;  4YEJ A;  2RQQ A;  3G2B A;  2WBM A;  3OS1 A;  2JVG A;  3E1S A;  3F9K A;  3DPL C;  3EUH C;  4U87 A;  1DQU A;  3PFY A;  2VLA A;  1X4P A;  4XN3 A;  3K70 C;  4XM3 A;  3HL2 A;  3QYB A;  2JVH A;  3L2Q A;  1MNE A;  4XLE A;  2WY7 Q;  3OS2 A;  3DWL E;  4G6T B;  3DKY A;  4CCK A;  3EUK L;  4XMY A;  1WJC A;  2RNG A;  1BOB A;  4PJL A;  4RMN A;  4DIQ A;  4Y33 A;  3UNG C;  2E1M B;  2W82 A;  2LY1 A;  5HOO A;  4BGD A;  2MAB A;  4BDZ A;  2WY8 Q;  2V9K A;  1D0X A;  1T0F C;  5TGT A;  1WFX A;  4C30 A;  4BJ6 C;  1N77 A;  1LDK B;  4ZJZ A;  3FBN B;  2E5N A;  4II2 A;  3LSM A;  3ZR8 X;  1LVK A;  1T95 A;  3OL4 A;  4PSW A;  2VKH A;  5JHF A;  2Z1D A;  3OYD A;  1V5G A;  3VYR B;  2W7N A;  2M7A A;  4HNU A;  4XKV A;  5CQE A;  3H9J A;  2JA2 A;  1YX3 A;  2R7U A;  3LSH A;  5KCM A;  2XAU A;  4Y3O A;  4DGW B;  2XDV A;  1FMV A;  4PJM A;  1TT0 A;  4XKB A;  2IGO A;  4JQF A;  3IAS 2;  4E7J A;  1D0Z A;  3I9V 2;  3QOD A;  4XLF A;  2A5W A;  2BVL A;  2R7S A;  3AKZ A;  4KJZ A;  3VYT B;  2IGN A;  1X1B A;  2R7V A;  2VL8 A;  4B48 A;  4XLC A;  3H35 A;  2KQR A;  2OUM A;  4ANJ A;  2R7R A;  3RPU D;  3LMM A;  4HST A;  4E7L A;  4OWR B;  3LSI A;  1WJE A;  4RM3 A;  2HDW A;  4XLA A;  2HPM A;  2AQF A;  1NG6 A;  3OWT A;  4HRI A;  3OR2 C;  3H9G A;  3DU6 A;  3OIQ A;  4IQJ A;  2HZD A;  2HVQ A;  1NG7 A;  3W2V A;  4CZC A;  3DQV C;  3W2A A;  2LBF B;  2KZV A;  4HSR A;  4P1W A;  4E6K G;  2CW7 A;  1X1D A;  2VB6 A;  4FET A;  4R79 A;  3MKY B;  5LFA A;  4XL9 A;  4DJA A;  3OYA A;  4J01 A;  2X1D A;  2R7X A;  1X4O A;  4PUS A;  2OC6 A;  4BU2 A;  3RCO A;  4IKF A;  3EPZ A;  3CJR B;  4OAZ A;  4BXF A;  2I8D A;  3VWB A;  3K4N A;  2XSJ C;  2VXZ A;  2XF6 A;  2LC2 A;  1JI8 A;  2CW8 A;  4BE1 A;  1UAA A;  5LD2 C;  2Z16 A;  3HUG B;  4RLQ A;  3S32 A;  1Y56 A;  4KIS A;  2QKL B;  4BS9 A;  4E7K A;  2PMZ A;  3OY9 A;  2QKM B;  1Z3X A;  2VXD A;  3FHN A;  3NWT A;  3OYK A;  2WAD A;  4NNJ A;  2IS2 A;  1PYV A;  1DP3 A;  4OAY A;  1Y6I A;  4F55 A;  3PUB A;  3BCB A;  3K4J A;  3S93 A;  3S3N A;  1QHG A;  3PNY A;  3OYG A;  2CFO A;  4BJT A;  1X1C A;  2XF7 A;  2ZXI A;  2X1E A;  3VSL A;  3QYF A;  4F3Q A;  3OYH A;  3PNT A;  4F91 B;  2A6T A;  2E1M C;  2LYC A;  4XR6 A;  2W00 A;  3TMO A;  4BQO A;  2F5V A;  1WJA A;  3S3M A;  3K4B A;  3L2V A;  2VQC A;  1OR7 C;  1D0Y A;  1X1A A;  3IP4 B;  4E7I A;  1G59 A;  3KEY A;  3VYS B;  2KP6 A;  3QYE A;  2DOA A;  1WJF A;  3QOE A;  2CS3 A;  5KHD A;  2R7T A;  3D5L A;  4CUG A;  2WAQ A;  4XN0 A;  4MLO A;  4PFP A;  3SEQ A;  1D1A A;  3W2W A;  1W36 D;  3AL0 C;  2VQH A;  1UEL B;  2M4G A;  4N4O B;  3OYI A;  2X6Y A;  2VJI A;  2ZXH A;  4ZTJ A;  3OR1 C;  1N78 A;  2FUG 2;  4II3 A;  4PJJ A;  5CPR B;  1MMN A;  2Q2E B;  2Y0S A;  3K4L A;  4CA0 A;  2BW3 A;  2K9L A;  4E7H A;  4BE2 A;  1V5F A;  4CCJ A;  1WJ5 A;  2PJR B;  2M7B A;  1P9Q C;  1Z3Y A;  2DT6 A;  3W3C A;  3VSK A;  3RQ4 A;  3DPT A;  2HVR A;  2VPL A;  2AQE A;  1HA8 A;  4LIV A;  2F6C A;  3DU5 A;  3UR3 C;  4YRV A;  3OYJ A;  4C2U A;  3D5R C;  4XOP A;  4DBR A;  4HPQ A;  4CCL A;  3HG9 A;  1S9H A;  5CKT A;  2VKD A;  3N05 A;  1BR4 A;  2BW3 B;  3CMM A;  2CV0 A;  4IZZ A;  4KIT B;  2VIX A;  4DOZ A;  4LIU A;  1K6Y A;  2OV7 A;  4AYB A;  4E4H A;  2UWM A;  2BVM A;  3CP2 A;  2V1N A;  4B3X A;  2O5R A;  3OL3 A;  2E5Z A;  2W4S A;  3PSF A;  1N75 A;  4H4K C;  2DCE A;  3H5N A;  3H9Q A;  3KX2 A;  2L2O A;  4XNF A;  4FAS D;  1R6R A;  3VYU B;  4LG3 A;  2M3A A;  4BJ5 C;  3DKX A;  3K4K A;  3A2K A;  3AFH A;  3GBG A;  2KDO A;  3VDX A;  2LBF A;  3TBI A;  3PNV A;  2LH9 A;  2MD0 A;  1SAU A;  1IRX A;  3BC8 A;  3OIP A;  3HOT A;  3PJR A;  2IS4 A;  3M1C A;  4XON A;  3E0J B;  4ZYA A;  2ZSI B;  1DGR M;  4QPQ A;  2GOX B;  1GLN A;  1MMG A;  1FMW A;  3KYL A;  2DT7 B;  4AVZ A;  4BQN A;  4C9Y A;  4YEL A;  2IGK A;  3K6G A;  4GRI A;  2F4I A;  2L5Q A;  3DLA A;  3HC7 A;  4XKC A;  3SYT A;  1BR2 A;  3DTE A;  1YX5 A;  5CQG A;  2M0M A;  4J00 A;  3CJQ B;  4QPO A;  4AU7 A;  4CCN A;  3PSI A;  4XLH A;  1G8X A;  2L9S A;  4KT6 A;  4E7Z A;  4CH7 A;  2IXS A;  4RM2 A;  1LKX A;  1LFP A;  4PK4 A;  3HKZ A;  1X19 A;  3MKW B;  3HPG A;  4CCM A;  1KON A;  2KMU A;  2ELJ A;  4HEA 2;  3OS0 A;  2X6X A;  1TZL A;  1WJD A;  4ZC3 A;  4BEH B;  3BCA A;  4ZTF A;  1MW7 A;  2JUG A;  1UG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...