3D5RC

Crystal structure of efb-c (n138a) / c3d complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
65
structure length
65
Chain Sequence
TDATIKKEQKLIQAQNLVREFEKTHTVSAHRKAQKAVALVSFEYKVKKMVLQERIDNVLKQGLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/toxin
molecule keywords Complement C3
publication title Electrostatic contributions drive the interaction between Staphylococcus aureus protein Efb-C and its complement target C3d.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF12199 efb-c Extracellular fibrinogen binding protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3d5rC00
3D5RC 2GOXB 2WY7Q 3D5SC 2NOJB 2WY8Q 2JVGA 2JVHA 2GOMA
chains in the Genus database with same CATH superfamily
3ROUA 3LAJA 2H1KA 2KPMA 3ZMVA 4J19A 2Z1DA 2Y9YA 3ZCOA 2HXIA 5HVQC 3UKGA 5M5YJ 2RDPA 2QQBA 3CTAA 4L9NA 2AQEA 4UXNA 2O03A 2NRAC 4D7MA 3LQQA 4UNOA 1O3SA 2NNNA 3RZDJ 4OMZA 4B3AA 2VPLA 1OFCX 2EK5A 3I3LA 3RYPA 2BY1A 3BG9A 1BR1A 5DCMA 4A5MA 3ABKH 1YRNB 2Z16A 5FJ8J 3QRFF 4XQFA 4HLYA 2LG4A 1AKHB 3HOUJ 4HEA2 1WCMJ 1VZ0A 1W36C 4F93B 1YW7A 3DU6A 4BQAA 2V1UA 4DNCA 1IRGA 1G2HA 3MFKA 3K4NA 4GCVA 1LDDA 2E7XA 3DP7A 3F8MA 2M8GX 3L2WA 2X1EA 3I4PA 4BDZA 2D1HA 1QHHD 2ZB9A 1WFXA 3GCMA 1SMYF 3FK6A 5E79C 3GBGA 3M07A 5D5UB 1HA8A 1ZN2A 1MMDA 2OCEA 3ZR8X 1GVJA 4L5IA 3F72A 2DI3A 1CGPA 4B43A 2F4IA 2BXYA 2VONA 1VQPI 4LG3A 5DDGA 2L7FP 3BPXA 4O5VA 3PIOF 2VKEA 3F22A 3TEDA 1RUNA 2V9KA 1I1GA 4BGDA 5EF6A 1T8IA 2M2EA 3EYYA 1X3ZB 4HV6A 2IS4A 4ANJA 3K4CA 5JR3A 2E7WA 4FHTA 1Z1DA 3Q0WA 4C2MJ 2A05A 2HVQA 1WWXA 4OIRF 3JR9A 4V19K 2F4OB 1XB4A 4MFEA 5IT3A 1JE8A 2DBBA 3E7LA 1ETXA 3ZMDA 3JAMK 1BJAA 2IP2A 1HKSA 3F8FA 4G94A 3Q9VA 1RKWA 2DOFA 3H9GA 3WU0A 2OAZA 4RGSA 2O5RA 4AYBN 5EEGA 2MD5A 2ZSIB 3MWMA 1TQMA 3FZVA 2CQXA 2XGCA 5D4SA 4G12A 2HXOA 5CVIA 2DYSH 3JSPA 1HW2A 4XL9A 2BOLA 2LP0A 2VQLA 4A5NA 4B3XA 1V3FA 2HNHA 2WTEA 1WSUA 4EMSA 3WG7H 2KJBA 1J0RA 3M7GA 2LR8A 2A69F 5JVTA 4IHWA 2M7AA 2W25A 2E2JJ 4E70A 4A3CJ 1SD6A 2E5ZA 3K4KA 4YEJA 1WJDA 5E1XA 5DV5A 2ZSHB 3GVAA 2IGOA 4KMUX 4A6EA 5ERIA 3I58A 2XAJA 1MNDA 2Y2ZA 3QPSA 1MMSA 1XC5A 1OMIA 5BPDA 2FEZA 3VFZA 4F91B 3DPUA 4ON0A 2KQRA 4BKXA 4YIIA 4CCMA 2NXNB 2IJLA 2M3AA 5F6FA 5F64A 2BV6A 2FA5A 4AVZA 3I5UA 2XB0X 1YQAA 2E36A 2FBIA 5B1AH 4G6TB 5EGOB 1VFCA 2XHKA 1R23A 1H0MA 4A3BJ 1E0EA 4A3KJ 3S2WA 4C30A 5JFRA 2CGPA 4IRHA 1UELB 1APLC 3WTTC 1O57A 2WA0A 4R8HA 3CQZJ 2ZNYA 2XAGA 4ABZA 4GGGA 1ZTRA 3BR6A 2QUFA 1LFPA 4XKVA 4HNVA 1I1SA 2F4MB 1IV6A 2ZJRF 2G0EA 1MBGA 3P7NA 2WV0A 4YIRX 3L09A 1XGOA 1UG2A 3DKWA 2V1DA 2ZO4A 5E1ZB 2X85A 3OYDA 1R00A 2CS3A 3MQ0A 4RA2A 3ZPLA 2KKOA 5CVUA 1IGNA 5LGUA 5D8KB 5JHUA 3OSFA 4NBQA 4RDUA 1W7PB 1HBXG 3K70C 1WJEA 4M72A 5J3LA 5KAIC 3R61A 1TT0A 4BACA 4LB5A 3KIOA 3S2DJ 3L2CA 1HOMA 1FYLA 3TBIA 4XRSA 4X0GA 2PQ8A 5LHIA 4MIMA 4ZYAA 4CZZA 1LEAA 1PJRA 3H5AA 3PM1A 4P55A 4AM3A 5M3FJ 2P5KA 1DP3A 1T0FA 4M3GA 3CLOA 2MC3A 1OCOH 3SDGA 1X2MA 3ECHA 4U7BA 4DBRA 3FM5A 1JI8A 3M1EA 4QTRA 4DGWB 3M9AA 3IKTA 4RB2C 1BC7C 4HOBA 4EATA 2AXTC 3IH2A 3BOQA 2EH3A 2W84A 2DAOA 4N4NB 1XMAA 3DKYA 3OR1C 3L9FA 1JXSA 1U2WA 3PFIA 4BS9A 1A5JA 5BQTA 1R1VA 2YSRA 5IPAA 3CZ6A 1LFBA 5HDNA 1T6SA 4PUSA 4I09A 4GXOA 3TDZC 2PFBA 2LBFB 3CCQI 2QEXI 2UWMA 3VPRA 2XV4S 4I0BA 3FHZA 2BE5F 4H0EA 2CFOA 3WODF 5F27A 4BJTA 4YRVA 3H3ZA 2AQFA 4KN4X 1X1DA 3F6VA 3MKYB 4RB0A 1TWHJ 4BJ5C 3QYBA 1U6GA 2COBA 4U0VA 2DT7B 4C3JJ 4IRIA 3GTQJ 4IVNA 3KCCA 3I56I 4W1UA 2HTSA 2GAUA 4Y33A 1U3EM 4BXXJ 1FT9A 2VOOA 1GXPA 4EM0B 3OS0A 5M3MJ 4AIHA 2XGEA 3H1CA 3H36A 2ZJQF 2E1OA 1WKMA 4ZYGA 4OINF 1IDZA 4D0PA 5FKKA 3CMMA 5GTIC 2V1NA 2JA6J 5HLGA 3HSEA 1JJ6C 4F3QA 3GLLA 4A3LJ 1O3QA 4FE4A 3OSGA 2NVXJ 1VQ6I 2JA7J 4YIFA 1T39A 1XCBA 2NS0A 1TW2A 4JP0A 4L5JA 2FE3A 2TRTA 5FKMA 2L9NA 1T08B 3LNQA 3H0DA 2WBMA 2MW8A 5KK1A 2K5CA 3GZNB 2PX9A 1NH3A 3CCRI 5HODA 1WJFA 3TQNA 1FLIA 2NS8A 4QPOA 2G9WA 1HW1A 4DIQA 3KPHA 2L9SA 3MAJA 4XN0A 1OYYA 1VF9A 1RKTA 3ZMTA 4GFBA 1TQIA 2HFHA 2IS2A 2EILH 5DYMA 1BIBA 3V7RA 3Q0VA 4XLAA 3MCZA 5H6QA 5TJJA 3HPGA 1KGSA 2IBDA 1FIAA 1IN6A 2EFPA 3FXMA 3DXJF 2EZLA 4OMYA 3K4MA 2EV6A 1XS9A 2CQNA 2X6WA 5EGOA 3S1QJ 1N77A 4FCYA 4M3BA 2H09A 2NVUB 2O8KA 4A6DA 3DEUA 3COAC 3HEFA 3IH4A 1FYKA 4I02A 2QLZA 1Y39A 1MBJA 3QODA 4XOPA 2Q0OA 2L01A 2PMZA 1BW5A 4HRIA 2VXDA 2DODA 2JQ7A 3ZQ7A 4DYCA 4D1QA 1S72I 1KQ8A 2CJJA 3D0SA 1FX7A 3CDHA 3K4LA 5FROA 3H35A 2IPQX 1JHFA 2FBHA 1IN5A 3AL0C 3FMQA 5HDKA 4EQQA 4GDFA 2MSYA 4FISA 4LFUA 5ICGA 3HB9A 3ZN1A 1C0WA 1FTTA 4DOZA 2RC4A 1DDNA 4A0ZA 4DW6A 4BXUA 3MKWB 5J1UA 2DT5A 2MBFA 1Y0UA 2R7DA 2V1XA 4CCJA 4I6ZA 2CO5A 5HLIA 3G1OA 2ZXJA 1JKRC 2DQLA 2O3FA 1IXCA 4A0YA 4RBOA 4KUMA 4N4OB 1SVLA 5JLXA 3LOCA 4BHPA 1JKPC 3J7AO 1LDJA 1MW7A 1MIJA 3T8RA 1T98A 2XF5A 2JA8J 3HOSA 4D7NA 4EM2A 3BLYA 2FD5A 2WAEA 4MHGA 2W48A 2GOMA 5BNGA 2A07F 2HDCA 1XCVA 3I4MJ 5HDGA 4JBAA 3S16J 4WXDA 2MFZA 3GUDA 3S8PA 1RR8C 2AS5F 4ZTFA 3GWZA 3ZOBA 5J4YA 2LBFA 2ELHA 3GLXA 5FD5A 3J7YJ 2VBZA 2IA1A 3HC7A 3ZN0A 2QKMB 1W0UA 4UB8C 1GV5A 2VC1A 2W7NA 1R9TJ 1SD4A 1MNEA 2DA7A 2ZXIA 2PMHA 1P4XA 1POGA 3HUGA 4RGXA 1S5LC 2F5EA 1UCRA 3GFLA 3BT9A 4H4KC 3CCMI 5E18F 1D1BA 1FMVA 3DWLE 4BAYA 4P5OA 3OYMA 4B47A 2E19A 2LY9A 3ERMA 3KEQA 3ZXSA 1ZG5A 1K6OA 1JUMA 2BW3B 5B5EC 1VQ8I 5E17F 3W2WA 4N0BA 1KYWA 2NVYJ 2ECBA 1E3PA 1BC8C 4XLEA 3AL0B 4MEXF 2VQGA 4M6YA 2BYVE 2BVLA 2CU7A 4CYCB 3EUHA 1I5ZA 2X6YA 4D5FA 3IWFA 1Z7LA 2OCCH 3R4KA 1D3YA 2LK2A 4UV8A 3R0JA 1IRFA 1X4OA 1QU3A 1GUUA 3OYIA 1NHAA 1IN8A 2F5CA 2E34A 2DA5A 2XPWA 4IHSA 1UJ8A 3VSLA 1KZHA 2EIJH 2LFBA 4I98B 1X3WB 1OCRH 2B0LA 1O4XA 3ZQLA 4NQWA 1RR7A 3GXOA 3GYHX 1PUFB 2L3DA 2IEKA 2OU2A 1N75A 3GFIA 3FXQA 1ZARA 2PJRA 2QCOA 5GTHC 2IS6A 4XSXF 1XGSA 2OZUA 3TOBA 4CGZA 5HNHA 1P7JA 3HTSB 2OV7A 3ZMZA 5E3NA 2KJCA 2QBYB 2CMPA 2LY1A 4RGRA 1FY7A 1U78A 5J1YA 5IP9J 2DMTA 2HVRA 2EZIA 3P9CA 2XPVA 1X1AA 1KU9A 1Z21A 2HGCA 3IUOA 1ETKA 2LOOA 1YO5C 2DTRA 3L2QA 2OJED 1DP7P 2HZTA 2M45A 4XNFA 2Z3YA 2VIXA 4LD5A 1KU7A 3HKZN 5FKOA 4A0XA 3GTMJ 1EF4A 1VQ5I 5IT9Z 1OR7C 1SAUA 5E1WA 1U5TC 2IA0A 4BHBA 2DYRH 3DCFA 2EPFA 3BC8A 2XIGA 2F2EA 2XSJC 1YW8A 2VQHA 3G2BA 2HEOA 4KT6A 1Z91A 4IHVA 2CWEA 3G73A 4F52A 4JK1X 2BY0A 2Y48A 1ZG1A 4KJZA 1I39A 3GFJA 1UMQA 2RNJA 2FXAA 4HSRA 1IXSB 3OS1A 2IGNA 2K27A 1B72B 1BI2A 3GTGJ 1TBXA 2ISYA 1MMNA 3I55I 1REPC 3E6MA 2Y0SA 1WHUA 1G3WA 4RS8A 1R22A 1R4NB 2C6YA 2ZMEA 4UVCA 3PNYA 5K7ZA 2FF4A 5CVJA 1ZRDA 2DT6A 3RCOA 2VPRA 2R7OA 3DEEA 4XN3A 5EZHA 4CHUA 1PP7U 2B9SA 3HRSA 3WHBA 4IJAA 3J7AY 1FSHA 4Q5SF 1MSEC 2CRGA 2DA2A 4HBLA 4ESJA 3TO7A 5J1RA 3FXKA 4RAGA 3IP4B 4ZTJA 3RI4A 1D1AA 1TWAJ 3GMEA 4WXHA 1F4KA 3CC2I 3C1DA 2JRMA 2H8RA 2H94A 1GHCA 2LKXA 1X19A 2DJIA 2KLOA 3BR1A 3GZ6A 1W4MA 2Z9OA 1XMKA 2FJ1A 2VT2A 3KYCB 4HF0A 4LLLA 3F3XA 1K79A 2ME6A 4M3EA 4HDVA 4X6AJ 1DU6A 3EETA 2CW0F 5B66C 2Z99A 1QZEA 4BE0A 5DD8A 4NNJA 4LMYA 4A3DJ 1BN5A 1SC7A 1WJAA 1B59A 2LY2A 2Z2SB 3O8HA 1QVTA 3BR3A 3BQZA 3K2AA 4WK8F 1TNTA 3E0JB 2QYOA 3E6BA 5F1JA 2JMWA 5F0HA 1U5TB 1J7KA 5H6RA 4BQNA 2E5NA 1ZR4A 3KZZA 1ETOA 1ACIA 1USTA 2ELJA 1YX3A 4B8XA 2M5WA 5F1RA 2GXGA 3JSOA 2MG4A 2PG4A 2LNBA 2X1DA 2KIQA 1J75A 1IJWC 4HYEA 2P4WA 2VBWA 2HYJA 2RAEA 4RB1A 3HOZJ 2BW3A 3FXRA 4YFXF 4CCNA 2STTA 3TL4X 5GAGJ 2QVOA 4HPQA 4MNUA 3W2VA 4HX7A 1S6LA 2FUG2 3P9KA 2DXIA 3HRTA 5L3CA 3U2RA 4HZFA 2JVGA 3HG9A 2M4GA 3KP3A 2MA3A 1HXDA 4ETSA 4P9UA 2N8GA 4XICA 2IRFG 2DFFA 2EB7A 2HPIA 3ZQCA 2GIVA 1XGNA 2R7FA 2VT3A 4MEYF 3UR3C 1OKRA 3D5RC 2ZBKA 4XM3A 1EH7A 3DLLF 2P6SA 4ZDLA 4JX6A 3Q0UA 4UVAA 1O7LA 2IXSA 1Z3YA 2JT1A 4PJ0C 4XLFA 4FX0A 3ZQHA 5B3SH 3CMAI 1LJ9A 1YLFA 2JRTA 3ECOA 3SXYA 5C4XJ 1MMGA 2OF7A 1L3LA 1ZQ3P 2HOSA 4EJVA 1MKMA 5ILSA 2STWA 4IQJA 1LE8B 2A5YB 2X51A 1W5TA 5J4VA 4B44A 2FMLA 2L7ZA 3VYRB 2CFXA 4M9ZA 3GTLJ 2VJ5A 4MTDA 4HQEA 4RMNA 1ETYA 2QBYA 1VI0A 1MGTA 2CV1A 4ZDOA 2L0KA 1J09A 3DFGA 1D0XA 5HS9A 3JRAA 3BTIA 3E97A 3T0YA 5HOOA 2KHMA 2DDAA 1YE9A 2LD5A 2VXZA 1E3HA 2VQCA 2XGDA 5FLXK 2CH0A 2FRHA 4LIUA 1VQOI 1ZRFA 3BG5A 1JT0A 4E7ZA 1UHSA 4DZPA 3HHHA 1JKOC 2Y75A 3S17J 4BJ6C 3CCJI 5LBQA 1ULYA 1XSVA 1I50J 3K1PA 2RQPA 3FXUA 3WE2A 2P0WA 3PQJA 1BR2A 4FE7A 2NS7A 2DJNA 4U7DA 4HX4A 3MZ8A 1FBSA 3HL2A 4OIPF 1QVUA 1FOXA 1X2NA 1KU2A 3OWTA 4BL0B 4A3EJ 3SZGA 1Y8QB 3WGHA 3LWFA 4NUBA 1S3JA 2CW8A 4RGUA 4MFDA 1ZRCA 2UV1A 1Y0NA 5IP6A 2BEOA 2M9HA 2R5YB 2WB1N 3WTXC 3JTGA 3DLAA 3OY9A 3N05A 2KMUA 2O61A 1AWCA 3QYFA 2E2HJ 4UVBA 1Y1VJ 1MMAA 3BG6A 1K83J 2GXBA 4EJTA 2B7EA 4PZJA 5JLWA 3IH3A 1KQ9A 2K86A 2M1BA 4QWQA 2MH9A 2KDOA 3DQVC 3V7SA 3M8FA 1R6RA 3QP6A 3WTYC 2MD0A 4UUVA 2OA4A 1LVKA 2DPUA 4IHXA 4GO1A 3F0CA 1HQCA 3BR0A 3HJEA 1LFUP 5B1BH 4CO8A 1J5YA 1T56A 3NEUA 1VQKI 1RNLA 4IEJA 2HYGD 2ESHA 4LK1F 5FRMA 1I3AA 4PJJA 3PFYA 1B9MA 2Q2EB 1Y56A 2PI0A 5IYCJ 3E5UA 2L54A 2GM4A 3F8CA 4HX8A 3PNTA 3WTVC 5E20A 2KIFA 2R93J 1OR7A 1U5TA 4CYDA 4II2A 3DPTA 4G8XA 5KCMA 1S9HA 1Z7UA 2L2OA 4XBFA 1WPKA 3PSIA 2DMQA 3W6VA 1S8NA 3WHCA 3BCBA 1JUPA 1AU7A 4OAZA 1Y1WJ 2NAZA 4U0WA 4KMFA 3A01B 3F9KA 1RPWA 2K3FA 2CW7A 3CMEI 4RAZA 1BBYA 4UUSB 4BH9A 2VI6A 4MTEA 4BY7J 5LGNA 1T38A 1HC8A 5LEKA 2ZJ2A 3KEOA 2Z33A 4WCGA 2XB5A 1JKQC 1W1WE 4LLGF 1UHWA 1G3YA 3H92A 4E7SA 1ZK8A 3OIPA 4UY8I 4P96A 1A6IA 2DA3A 2FU4A 3PL8A 5DCFA 3WTSC 3KP4A 3LSIA 1YRNA 1IV8A 1G8XA 2KP6A 3L2UA 3J80K 5L3FA 4JQFA 2ZCWA 4AU7A 1AKHA 1E3OC 3DEWA 4EJWA 2JPCA 2EINH 2A6EF 1VQMI 3LSJA 2XAFA 2Q8KA 2YS9A 3CCEI 1RI7A 3HOVJ 4AUXA 5EYRA 4A93J 1QGPA 3F8NA 4NB5A 3IL2A 3TDUC 2ELKA 1TWGJ 3PO2J 2L02A 3DPLC 5IP7J 3LMMA 2IS1A 3QPHA 3IRQA 2NVQJ 4A69C 4DBQA 1ZHFA 4N9HA 3R6SA 4A12A 2X48A 4DQ2A 1P6RA 3S32A 1D8JA 1IRXA 3KYDB 4TV7A 3ELKA 2XF7A 3FDYA 5CQEA 3KEYA 3SZTA 3GX4X 3TW7A 1TWCJ 4II3A 2O9LA 3JRBA 3OS2A 3K6GA 1OCCH 1W5CC 4PJMA 3E6CC 3BROA 2EFNA 3S3OA 3PSFA 5HS8A 3VYTB 1UHMA 1LQ1A 4RB3C 4QSHA 2HYFA 2H6CA 2K9MA 2HOTA 4M6XA 1YTYA 1MH3A 2JPBA 2BBYA 2DK5A 3AG3H 1Z9CA 3V42A 2D5VA 2EA2A 3I59B 3KYLA 2WADA 2F6CA 2OTJI 1T33A 4HSTA 4EV0A 1X58A 2MYSA 1F1ZA 1GLNA 1X1CA 3LSTA 4DJAA 1BR4A 1W5SA 2XF6A 2QWWA 4AIKA 3QWLA 2D1VA 1OCTC 4NDLA 4ZJZA 3TO9A 1GDTA 4OWRB 4ZYDA 3TKYA 1ENHA 3J81Z 4NC6A 3HBLA 4BNCA 2MC4A 4PSWA 1PUEE 1YIJI 2HZDA 3KP2A 1RZ4A 1HCRA 1B8IB 5LGTA 2CYYA 1OQYA 5F04A 2K9SA 1Z6RA 2GQQA 2E1MC 2VKVA 2ZXWH 4M74A 3AKZA 3LSKA 2Y0MA 2JK3A 3LSMA 5K5QA 3R60A 2A68F 2W82A 5FFXA 2R7UA 3DKXA 4XIDA 1VTNC 4O6JA 1LKXA 5E8IA 3Q3SA 4IQ4A 1R4MB 1FJLA 3OMYA 4KN7X 2L7KA 3DBHB 3I9V2 3SEZA 4ENKA 3H9JA 3OYNA 1D1CA 3MVPA 5TRDA 3CCYA 4Y4RA 4ZDPA 4NHJA 3BJAA 3I71A 1KONA 5JVGF 4IOCF 2O6GE 4KIGA 3BTCA 2COMA 4CCOA 1JTYA 3GZ5A 3F23A 1KA8A 1G3SA 2M4KA 4DYQA 4IO9F 1H8AC 4XKCA 1G6NA 1WRJA 1MJAA 2W00A 2W24A 1MDMB 3TP3A 2W1OA 4LG0B 5AIPA 3K9TA 1YS7A 2ADUA 4ESFA 5L3EA 1W7PA 5LHGA 2I5UA 1R1TA 1XG1A 3BCAA 1NTCA 4KDPA 1NK2P 1QA6A 4EGZA 5CYVA 1G4DA 9ANTA 3G4SI 1JJ8C 5BS6A 2E2IJ 3KETA 3V7CA 3VWBA 4C2UA 5ICCA 1Y6IA 1MBKA 3BG7A 3I0TA 3PIPF 1K78B 4IKFA 1P7IA 1UB9A 4BEHB 5TISC 1TTYA 4A3FJ 3HSRA 1XSDA 1UG0A 1ZGJA 1HLVA 3QYEA 4JYKA 1B1BA 2QM3A 2WWYA 1RIOH 4ZZLA 3QOEA 3CO6C 1TW3A 4P1WA 2HDWA 3NRVA 2OQGA 4M6VA 3X2QH 1ETQA 4KICA 2JTVA 2OQRA 4QIWN 1R71A 3CC7I 5IYDJ 2E1MB 4G6DA 3I53A 5D6FA 1W36D 2EBIA 3CO7C 5GP9A 5EG0B 5D5WB 1FIPA 5D4RA 1NG6A 3SHFA 2RREA 2A6TA 2OBPA 4LJZF 4Y17A 3HRUA 2VL8A 2EZHA 1JT6A 4ZH4F 4CXFA 1DU0A 2EIMH 3F21A 1QQIA 4LLNA 3IAS2 1OYIA 3L7WA 3T1BA 2DFEA 3H5NA 2K85A 2J5PA 4YG2F 4PGGA 1GV2A 4HW0A 2R7TA 2AO9A 2XKPA 2K7LA 2PLYA 2M0CA 4MQVA 4IL6C 1FPQA 1HF0A 1YITI 3LSGA 2VASA 1OPCA 2IGKA 1ZYRF 1BM9A 2QQAA 2LTPA 4FETA 2YUSA 1S7AA 5EEAA 1DUXC 3RKYA 1VQ4I 3RZOJ 3WE3A 1J59A 5HNFA 3HGYA 1QHGA 1LVAA 3K4JA 1EH6A 2X6OA 1EH8A 1WI3A 3RYRA 4XRMA 2BXZA 1B9NA 2UXNA 1O7FA 3RIRA 1D5VA 3ULQB 2F5DA 4IF4A 3EPZA 3DBLB 1T2KA 1SFXA 1F43A 2KIUA 2L9RA 3PQKA 4ENNA 3QPTA 3B6AA 1FEXA 3ZMUA 4E7HA 1R5GA 3VEPA 5FLVA 1YJ9I 3CJTB 2Z5UA 3ZP5A 3KE2A 2RVCA 1R5ID 4PK4A 1MBFA 1LUJB 2Y30A 3OL4A 2VJ4A 5DCMB 1BA5A 1T95A 1ORKA 1SANA 2QQ9A 3JAMZ 3U1KA 2DA6A 2BHYA 1Z05A 1AOYA 3WTUC 1CF7B 4U88A 1PYVA 1M1EB 2WY8Q 4L0YB 3O6BB 3IV5A 2WAQN 5L3GA 5FLMJ 5LD2C 4PGHA 2MABA 1SVMA 2LKPA 2DQRA 4BYYA 5CLSA 4FT8A 4UUTA 3DF8A 1WVRA 1SVOA 4C2TA 3NWTA 4XRFA 3S15J 1O3RA 1PVEA 3C18A 1TZLA 3C2BA 3GFMA 1D5YA 2JA5J 5LRRA 5LHHA 4L18B 4B09A 1WZ2A 1BJZA 4V2GA 2V6CA 3CJQB 2DA4A 3K1MA 4Y3OA 1WH5A 1R58A 4LITA 1K6YA 3A0BC 2R5ZB 1TP4A 2E35A 4A3GJ 4AC0A 1AA7A 1X1PA 2CUEA 4HLXA 2NOJB 2CQKA 4W97A 4C3IJ 1OCZH 4D5CA 2X9DA 5LRSA 4F7ZA 2JSCA 1PDNC 2E1CA 2P81A 3E3VA 4XKWA 4XLCA 2ZXHA 1Q1HA 3A02A 4AD9A 3K70D 3JTHA 2L5QA 2VJIA 4L9TA 4PJNA 5FO5A 2R92J 2CQQA 4BQQA 3ABUA 5DS9A 2JWTA 3M8JA 2EFOA 1RESA 3J81K 4C3HJ 3HDDA 1H9GA 2YX7A 1VQNI 2I8DA 3WG9A 3BR2A 2VUMJ 2V6EA 1BIAA 4AYBA 3GTOJ 2M7BA 1WQ2A 3W6JB 3KZIC 1IRZA 2V26A 1ITYA 2BY2A 1FTZA 2ID6A 4L5EA 4BEHA 2FBKA 2ID3A 1YHQI 4Y7NJ 5D8LB 3HOTA 1S7EA 5DM6F 4XMYA 1IUFA 2ECCA 2WB1A 5FKLA 1QO0D 3VOEA 3ASNH 4ZYEA 4IPAA 4XRSG 4WWCA 2P6TA 4S04A 4IX7A 5HLTA 3M8EA 4HA8A 4S05A 2PMUA 2V9VA 3MZYA 3VSKA 2WY7Q 3K2ZA 3BWGA 1F5TA 1BI1A 3RSNA 3HTUA 1FYMA 2DPDA 3E6DA 1DQUA 2VN2A 1FP2A 1JGGA 3U21A 2CUJA 2WAFA 1SAXA 5ICFA 3FISA 2JZYA 3BZ6A 3MZHA 2XPUA 1HSJA 2A6HF 2VKDA 2X4HA 2R7WA 1K7AA 1IN4A 4DZJA 3FMRA 4IZZA 2DFIA 3LSPA 2KZGA 2ZFUA 3VODA 3OYCA 3JRHA 3HPHA 3KP6A 2R7QA 2L9VA 4CICA 2OUMA 4HDUA 3FM3A 2YU3A 2ZNZA 1KQ0A 1U9OA 1S7OA 4BUPA 3OYBA 3AAFA 3VYUB 1D0ZA 3H3VK 5F08A 2YX4A 3RKWA 2IT0A 2Y69H 1EJ9A 4LIVA 3BR5A 3BTLA 3N97A 2H1LA 3EDPA 1Z6TA 4G7OF 3ABLH 1KYZA 1YYVA 3UNGC 2R7VA 3OOUA 1BOBA 3MKZA 3CCSI 3M1CA 3S1RJ 2UXXA 3HYIA 2M0MA 4CYCA 1B6AA 2KRHA 2LYCA 3U9GA 4U87A 2VE8A 2DN0A 5CPRB 2D45A 4Q48A 1L0OC 1QPMA 2RNGA 2F48A 2TCTA 5DEQA 3ISPA 2LVSA 2NOGA 1ON1A 3IWZA 1U8RA 3FXLA 3HGGA 2P5LC 2GA1A 2M30A 2LSOA 3OIQA 1PUFA 2FX0A 4BBSJ 4NC8A 3HSFA 2RV8A 4I7HA 2A5WA 2FSWA 4WXCA 3ZQQA 1IW7F 6PAXA 2PJPA 3E5QA 1Q1VA 3F6OA 4KIFA 4V2FA 5DM7F 1CF7A 3FWEA 4KISA 5CVVA 2DOAA 2EWNA 2JVHA 4HQMA 4YELA 2HKXA 1W0TA 2IW5A 1QZZA 2VBXA 5K5OA 4YFKF 4ITVA 2Y31A 4J00A 3V4GA 4KIBA 4E7IA 3CP2A 2OPTA 1TLHB 2VLAA 4R1HA 2I10A 2P5VA 1GVDA 2A61A 1TL8A 3JRFA 2VODA 3WTZA 4EJUA 1D8KA 1MNMC 4JOMA 4B1RA 4OIQF 3MN2A 4Q47A 5FRNA 1BI0A 3V8JA 2LF7A 4KNYA 4M73A 3FKIJ 1QRYA 1IF1A 1D0YA 4A3IJ 1R1UA 2R5ZA 5BMZA 3EYIA 1TNSA 2W85A 3OYHA 3ASOH 1HW5A 1V55H 3C7JA 1VQ7I 3ZRGA 2K9QA 1YJNI 3LSHA 5EDNA 4LB6B 3OV8A 3OYKA 5TGTA 1S29A 3RJPA 2Y0SN 4JX5A 4KA4A 1I6XA 1MJ9A 3QP5A 1B72A 2ZC2A 2PEXA 1KU3A 2JUCA 5GAHJ 4K2EA 2XRLA 3S2HJ 5AIQA 2RQQA 4BU2A 2RGVA 3VDXA 2LKSA 4NC7A 4BDYA 2LRDA 2EA4A 3SJMA 2KRCA 4B4CA 3OOPA 2P8TA 3ONQA 2R3SA 3IHUA 3BY6A 3CCVI 3U1DA 3RPUA 1U9NA 3S93A 3V8LA 1LPQA 2V7FA 3A03A 3NARA 1F9NA 2K40A 3NQOA 4PCQA 2XROA 3TMOA 1JUSA 3G6EI 4PJLA 1WH7A 3N4MA 3I64A 5M5WJ 3HOWJ 2EQRA 4M9SA 2V4JC 2PBIA 3CF2A 1G3TA 1ZGAA 3SFIA 2E71A 4RAFA 1WJ5A 3JW4A 4O3MA 3W2AA 2OD5A 1VQ9I 5F0CA 3CD6I 5IYBJ 2DA1A 2DTZA 2RN7A 5IT9K 3K4BA 4HAMA 2HOAA 1K61A 5HLHA 2GBYA 4X1EA 2QKLB 4G7HF 3C2GA 4RAYA 1WGXA 2L7MP 3C2HA 4GYGA 3JCUC 4A3JJ 1R36A 4BE2A 3RKQA 1SEUA 1QZYA 2UZKA 3MD2A 2VE9A 1ZKGA 3OYJA 3Q9SA 1R49A 3JRIA 3M4OJ 2BVMA 2LC2A 1IAWA 1Z67A 3PUBA 3WTWC 4RLQA 3F8BA 3TP0A 3ZQGA 1R7JA 4KYWA 2EIKH 3QU6A 4FASD 1XPXA 2FNPA 2QSFX 2HQAA 3SFZA 1A04A 1RETA 5LFAA 4XLPF 3R0AA 4ASNA 1ZH5A 4C9YA 5HS7A 5LEJA 1TQPA 4MGRA 2NVTJ 2E1NA 2DW4A 2D2WA 3T5XA 1YJWI 1B4AA 2X0LA 3QPLA 1YG2A 2HQ5A 2CV2A 3HRMA 4D9JA 2W57A 1RRJA 2DDBA 1YIOA 4E7KA 4CDGA 3GTPJ 2LH9A 5L3BA 3IC7A 2K4JA 2GWRA 5A2QZ 4UV9A 2X1CA 4R79A 1JTXA 3EUHC 1IXRC 3V8KA 3OYAA 1MJBA 4N9IA 5J8FA 1MBEA 5JI6A 3LL7A 2P7VB 1DGRM 2DO7A 3OR2C 3WU1B 2HR3A 2DCEA 1BL0A 1XGMA 3TGNA 1ETWA 2QGUA 2BZTA 2EFWA 1P9QC 3TW6A 3IRRA 1H88C 1ZELA 1J9IA 2A3SA 3VYSB 3K1NA 4WX9A 3CDIA 3H5RA 1EA3A 4XLNF 3CJRB 2VBYA 3RPUD 1SD5A 4EM1A 2DFHA 3L00A 3K10A 3OYGA 1H9TA 1VQLI 1IZ1A 4LK0F 2VB6A 3TO6A 1E17A 1FP1D 2EFQA 5FFZA 3HIFA 4L9VA 2CQ7A 2TDXA 1G59A 4RM3A 5E3MA 4G7ZF 1LE8A 4BBRJ 3H0GJ 2KIMA 4AVPA 4BY1J 3RDIA 1IC8A 3IKVA 2H8WA 2HPMA 3GF2A 3HM5A 1FOWA 4WF2A 3CMYA 1USSA 3OL3A 3M3YJ 1E2XA 3VB2A 3FKJA 4XORA 1V5GA 1LDKB 4BHCA 3LA3A 3KX2A 5K1YA 3HUGB 4OAYA 2XAQA 2CG4A 2XRNA 5C3EJ 5M5XJ 3CLQA 4Y15A 2P7CB 1FOKA 5ILVA 1OYWA 2GA2A 4A2UA 5FKNA 1LB2A 1FWZA 5IY5H 1OISA 1RUOA 2HVSA 1HKTA 3ESWB 1JGSA 2BY3A 4ZC3A 1WI9A 5CVRA 2VOPA 5J47A 2BHZA 3O2PE 2DU9A 4P9FA 1UFMA 3B6CA 4QLCU 4HF2A 2GIZA 2QF7A 3DTIA 1YS6A 5FB2A 2R7SA 2LMDA 3EUAA 4OOIA 3DV8A 4IRGA 1WJCA 1DPUA 1U8BA 4Z6YA 1FMWA 1MH4A 3K69A 2R5YA 2JSPA 5J8CA 1BW6A 1P92A 2DK8A 4Y52J 2XC7A 2ZMEC 2ACJA 1BI3A 2WV1A 4KT5C 4HNTA 4NQWB 1F36A 3K0LA 1ODDA 2UUZA 3CC4I 2B63J 3BDDA 4FQGA 3WGIA 2PJRB 1FBQA 1UZCA 3LFKA 5EEHA 1EKEA 2WC2A 3L2RA 3G1LA 3A4CA 3BZKA 1IO2A 5D6EA 3B73A 4EJOA 3G71I 2DMPA 1O3TA 2ISZA 2LF8A 3FX3A 1NG7A 3W6KB 5F0FA 3KFWX 1R5HA 3DTKA 4UB6C 3L2VA 2XAUA 4MLOA 2F5VA 1ZLKA 3FIWA 4PFPA 4I99C 3H9QA 5J40A 2VKHA 4ZZDA 2FMYA 4IOAF 3FBNB 3QOPA 5K5RA 2QENA 2O0YA 2RKHA 4CA0A 1JHHA 3S3NA 3GTKJ 3W3CA 2WAQA 4HV5A 2Y9ZA 3QQAA 1SFUA 1IN7A 1I27A 2Q2EA 1P2FA 1IDYA 3RQIA 2R7RA 3LFUA 1FOYA 4E7JA 1GT0C 2R7XA 4CUGA 2ME0A 1QPIA 4E6KG 4AIJA 4HNUA 4XKBA 2HWVA 2XKOA 5GAEJ 4CH7A 2JJ7A 4FTHA 1YX5A 2L4MA 5BOXA 4L9JA 3RKXA 3HKZA 2V79A 1V5FA 4XR6A 1ETVA 3CUQC 1XX5A 3FF5A 2CUFA 2E60A 3BTJA 2ZKZA 3PJRA 2XUBA 2R7ZJ 3D5SC 3HXLA 1LEBA 1VNDA 3GTJJ 3NWSA 1HDPA 1J2XA 5IOZA 1XMXA 1X3UA 1ZG3A 2XAHA 2FOKA 3LA2A 5KNLA 3A01A 4F92B 5ED4A 3OYEA 3ERED 1XTAA 4UUSA 2QA4I 2X6XA 2O8XA 2ZMEB 3KP5A 3SQNA 2K4BA 4ZYHA 4RM2A 1P4AA 4ESBA 1TC3C 3PO3J 4I0AA 4KFCA 4YFNF 2JUGA 1SFEA 1P4WA 2BGCA 2JN6A 3DU5A 5DD4A 3K7AJ 3OYLA 3S14J 3S3MA 1OJLA 3JRDA 2KDZA 4JX4A 1YI2I 1MZBA 2ETHA 5E8GA 3PUFA 3SZPA 5GPCA 1IUYA 2QQ8A 2CSOA 4CCLA 4S0HB 3A0HC 4L0ZB 2PN6A 2AHQA 3RPQA 5JHFA 4G9YA 4RLFA 5EZGA 5LLQA 3Q5FA 4MQ9F 2V9PA 4XSZF 3ML6A 2DMUA 2GZWA 2Q1ZB 4LOCA 4AIDA 5KVRA 3LAPA 2OTLI 3H3UA 1H89C 2KRFA 3CDLA 3CJNA 2F5FA 1I3QJ 2FNAA 2IGMA 2FQ3A 5CKTA 5ICEA 2HS5A 1MD0A 3G1MA 3RTRA 2CUZA 2R0QC 2ZFWA 5H20A 5FD6A 3I54A 2KFDA 1N25A 1XD7A 3A1YA 2HU9A 5KAFC 3S1NJ 3ABMH 4G6QA 4OU0A 1SFOJ 5DUKA 4Y13A 2IAIA 4PSXA 2J5OA 5H2FC 3LSRA 4XK4A 1MSFC 3BJOA 3CUQB 4HF1A 1QBJA 3KLNA 2K9NA 3QU3A 5A2QK 1FZPB 1Y8RB 3O3KA 3DTEA 1X1BA 3WU2C 3SDBA 4EGYA 4IXAA 1HKQA 1EV7A 3I4NJ 1DPRA 2VJJA 1XN7A 5CJ9A 3AG4H 5GADJ 5AONA 2NNYA 1W7PD 1OCPA 3HZJA 2O7OA 1GXQA 2DLLA 2HOEA 1SFKA 1FSEA 2KL4A 3I59A 2VC0A 4B48A 3PNVA 3JRGA 2G7UA 4BXFA 5FLXZ 4F55A 5D5XB 1HSTA 2XDVA 4E4HA 3AG1H 3G3ZA 3D1NI 4EEFG 5K7FA 5E3OA 2M87A 4AWXB 2XSDC 3REOA 3B02A 2MLGA 3FHNA 5EJCA 2KZVA 3J7ZI 2MH2A 3SEQA 5GPAA 3MKLA 1FBUA 2M34A 4M3FA 4BQOA 4Q4ZF 2QZ8A 3HOXJ 3ZQFA 4XONA 4I76A 3JRCA 3AFHA 1K4TA 1X4PA 1WJBA 4FX4A 3CUOA 4GRIA 3NAUA 5DUIA 1B8IA 1N78A 3P9IA 1PP8F 1DGWY 2H6BA 1ZAOA 3HHGA 4IHYA 3DBRB 3AG2H 3FBIB 5L3DA 4CZCA 5C4JJ 3CCLI 3MEXA 2CV0A 2ICWG 4DYRA 2YPRA 2OZ6A 3OYFA 1K4SA 2M8EA 2XGXA 1LNWA 4QPQA 3C3WA 3EUKL 4KITB 3A2KA 1A31A 2PMZN 3LQRA 3LA7A 4HG2A 3IAM2 1ZREA 2LDUA 2GOXB 1A6QA 1MBHA 3ZGKA 5D5VB 4LGWA 4IHTA 1OLTA 3EQLF 2K02A 2YU9J 1BOAA 1NK3P 4I2OA 2HQRA 5CQGA 5ILUA 2EJRA 4XLHA 3CESA 1STZA 5J6XA 1MDMA 5DTDA 1SD7A 3FXOA 2HQNA 4LG0A 3L1PA 1ONVA 1A35A 2K3PA 3KLOA 4CCKA 1ERDA 1YW9A 4MO7A 3CP8A 2HI3A 3KP7A 3KZYA 1SMTA 5FGMA 2LLKA 1XDUA 1IG7A 3QAHA 1HDDC 1TT5B 3MMYB 3BZCA 2L4AA 2H27A 2IA2A 2EV5A 2LREA 5C44J 1RC9A 1T0FC 2MGQA 3BG3A 5E3LA 1ZR2A 3O8GA 1K78A 3GO5A 1Z0XA 3FK7A 4XOTA 4M71A 2DOEA 3GW2A 3ZQIA 5BPIA 4PFOA 2ZJPF 3FMSA 3JREA 4OIOF 4I01A 3FXJA 4Z2YA 2FOWA 1A36A 2NYXA 3E1SA 3T8TA 1CQTA 2R4GA 3TOAA 2JA2A 2G7HA 3P5JA 1ZGWA 1I6HJ 2XVCA 1U0JA 3BPVA 5K7HA 5EG0A 3BJ6A 5KHDA 3GEZA 1ON2A 2XASA 4M3DA 2HTJA 2W4SA 2HDDA 4UHTA 1ZLJA 3J80Z 2MLKA 4CSWA 1YFHA 1YOVB 4E7LA 3CCUI 2IVMA 1FC3A 3RQ4A 3SYTA 1XDSA 2FQ4A 2OC6A 2ESNA 4U0YA 1V54H 2GLOA 2DMNA 2QSHX 3E5XA 4ENMA 3ZMSA 2GXAA 4ENJA 1V5EA 3OIOA 1UAAA 2AXLA 4A3MJ 1Z3XA 3HOYJ 4PDKA 4EVIA 3CF5F 4M9XA 2EV0A 2KT0A 2EZKA 1Z77A 2KISA 1XSXA 2K9LA 3BQYA 3CUQA 3BP8A 3D5LA 2QSGX 1TWFJ 2HKOA 1AHDP 4GYIA 5IOYA 1QNTA 3S1MJ 1V4RA 3ABTA 2YR2A 4BE1A 4J01A 1FNNA 3WGGA
chains in the Genus database with same CATH topology
3LSKA 3LSMA 4FASD 2KPMA 2Z1DA 2W82A 2HQAA 2R7UA 3ZCOA 3DKXA 1LKXA 5HVQC 4IQ4A 1N75A 5LFAA 3OMYA 2PJRA 2L7KA 3I9V2 3SEZA 4C9YA 3H9JA 2AQEA 3OYNA 2IS6A 1D1CA 2VPLA 2CV2A 3I3LA 4Y4RA 4D9JA 4ZDPA 5HNHA 2OV7A 1BR1A 1KONA 4E7KA 2LH9A 4CCOA 2Z16A 2CMPA 2LY1A 2X1CA 4XQFA 4R79A 2LG4A 2M4KA 3EUHC 4HEA2 1VZ0A 2HVRA 4XKCA 2W00A 3OYAA 1W36C 4F93B 1X1AA 1Z21A 2W1OA 3DU6A 3IUOA 2LOOA 3L2QA 3LL7A 3K4NA 1DGRM 3OR2C 4XNFA 2DCEA 3BCAA 2VIXA 3L2WA 1P9QC 2X1EA 4BDZA 1ZELA 1QHHD 3VYSB 1WFXA 1OR7C 3GBGA 1SAUA 1HA8A 1MMDA 3ZR8X 3H5RA 1EA3A 3VWBA 4C2UA 3CJRB 3BC8A 3RPUD 4B43A 1Y6IA 2F4IA 2XSJC 3BG7A 3K10A 3OYGA 2VQHA 4LG3A 3G2BA 4IKFA 4KT6A 4BEHB 2VB6A 4F52A 1UG0A 4KJZA 2V9KA 4BGDA 3QYEA 1G59A 4RM3A 4HSRA 3OS1A 3QOEA 2IGNA 2IS4A 4ANJA 4P1WA 1MMNA 3K4CA 2HDWA 2Y0SA 2HPMA 3PNYA 2HVQA 2E1MB 1W36D 2DT6A 3RCOA 2R7OA 3DEEA 4XN3A 3OL3A 3J7AY 1NG6A 3FKJA 4XORA 1V5GA 2RREA 2A6TA 1LDKB 3KX2A 3HUGB 4OAYA 2VL8A 3IP4B 4ZTJA 3H9GA 2O5RA 3IAS2 1D1AA 2ZSIB 3H5NA 2R7TA 2HVSA 1X19A 2DJIA 2KLOA 4XL9A 4ZC3A 2BOLA 2VQLA 4B3XA 3LSGA 2HNHA 2VASA 2IGKA 4FETA 3DTIA 2M7AA 2R7SA 2E5ZA 3EUAA 3K4KA 4YEJA 1WJDA 5HNFA 4BE0A 1WJCA 4NNJA 1QHGA 2ZSHB 1FMWA 2IGOA 3K4JA 1WJAA 2JSPA 2LY2A 2Z2SB 1MNDA 2XC7A 3E0JB 4HNTA 4F91B 3EPZA 3DPUA 4NQWB 2KQRA 4CCMA 2M3AA 2E5NA 4BQNA 2UUZA 3AKZA 4AVZA 2ELJA 1YX3A 2PJRB 4G6TB 1E0EA 3L2RA 3A4CA 4E7HA 2X1DA 4C30A 1UELB 1NG7A 2BW3A 4PK4A 2WA0A 3DTKA 4CCNA 3L2VA 2XAUA 1LFPA 2VJ4A 3OL4A 4MLOA 2F5VA 4XKVA 1T95A 3TL4X 4PFPA 3H9QA 2VKHA 4HPQA 3W2VA 3FBNB 2X85A 3OYDA 2FUG2 2CS3A 4CA0A 3S3NA 2DXIA 1PYVA 2WAQA 3W3CA 2WY8Q 2JVGA 3HG9A 2M4GA 3K70C 2R7RA 1WJEA 5LD2C 3LFUA 4E7JA 1TT0A 4BACA 2R7XA 2MABA 2HPIA 4CUGA 3UR3C 4E6KG 4HNUA 4XKBA 3TBIA 4CH7A 3D5RC 4X0GA 4XM3A 1YX5A 4C2TA 4ZDLA 4ZYAA 3NWTA 1PJRA 3H5AA 3HKZA 2IXSA 1V5FA 1Z3YA 4XR6A 1DP3A 1TZLA 2E60A 4XLFA 3PJRA 1MMGA 3D5SC 3HXLA 4U7BA 3CJQB 3NWSA 4Y3OA 4DBRA 1JI8A 4LITA 1K6YA 4DGWB 5KNLA 4IQJA 4F92B 4EATA 2X51A 1AA7A 4B44A 2NOJB 3VYRB 3OYEA 2VJ5A 4N4NB 4RMNA 2X6XA 3DKYA 3OR1C 3PUBA 2CV1A 4ZDOA 4BS9A 4RM2A 1J09A 3CZ6A 4XKWA 1D0XA 4XLCA 2ZXHA 2JUGA 4PUSA 3DU5A 5HOOA 2KHMA 3K70D 2L5QA 3OYLA 3S3MA 1YE9A 2VJIA 4PJNA 2LBFB 2UWMA 2VXZA 4BQQA 2VQCA 2CFOA 4BJTA 4CCLA 2CH0A 3M8JA 4LIUA 4YRVA 2AQFA 5JHFA 2I8DA 1X1DA 4E7ZA 4RLFA 2V6EA 3MKYB 4BJ5C 4AYBA 4BJ6C 2M7BA 2Q1ZB 3QYBA 2DT7B 2V26A 2P0WA 1BR2A 4BEHA 3HL2A 4Y33A 3OWTA 2IGMA 4BL0B 3HOTA 3OS0A 5CKTA 4XMYA 3SZGA 2WB1A 4NUBA 2CW8A 2UV1A 4IX7A 3RTRA 2CUZA 5HLTA 3DLAA 3OY9A 3N05A 2KMUA 3VSKA 3CMMA 3QYFA 2V1NA 2WY7Q 3A1YA 1MMAA 2HU9A 4F3QA 3BG6A 3RSNA 4PSXA 1DQUA 3U21A 2CUJA 2WAFA 3DTEA 1X1BA 3SDBA 2KDOA 3DQVC 2L9NA 1R6RA 2VKDA 2MD0A 3H0DA 2VJJA 2WBMA 2R7WA 1LVKA 2K5CA 4IZZA 2ZFUA 3OYCA 1WJFA 3HPHA 1SFKA 2R7QA 2OUMA 2KL4A 4QPOA 4B48A 3PNVA 4BUPA 4DIQA 3OYBA 2L9SA 3VYUB 1D0ZA 4XN0A 4BXFA 4F55A 4LIVA 2IS2A 5FRMA 2XDVA 4PJJA 3PFYA 4E4HA 4XLAA 2Q2EB 1Y56A 3UNGC 2R7VA 3OOUA 3FHNA 1BOBA 3MKZA 3PNTA 3M1CA 2KZVA 3HPGA 2M0MA 3SEQA 4BQOA 4XONA 2KRHA 2LYCA 3AFHA 4U87A 3K4MA 1X4PA 1WJBA 4II2A 5CPRB 3DPTA 4GRIA 1N78A 5KCMA 2RNGA 1DGWY 2X6WA 1S9HA 2L2OA 3PSIA 3FBIB 4CZCA 1N77A 2CV0A 3BCBA 4OAZA 3OYFA 4XOPA 3QODA 3F9KA 4QPQA 2PMZA 4HRIA 2CW7A 2VXDA 3EUKL 3OIQA 4KITB 3A2KA 4NC8A 4D1QA 4HG2A 2A5WA 5FROA 3K4LA 3ZQQA 3IAM2 3H35A 4E7SA 2GOXB 3OIPA 4KISA 3ZGKA 2DOAA 3PL8A 2JVHA 3AL0C 4YELA 3LSIA 1OLTA 2KP6A 1G8XA 3L2UA 4JQFA 5CQGA 4AU7A 4XLHA 3CESA 4ITVA 4J00A 4E7IA 3CP2A 4DOZA 3MKWB 2VLAA 2K3PA 4CCJA 4CCKA 1ERDA 3CP8A 4N4OB 4JOMA 5FRNA 3MMYB 1MW7A 1D0YA 3DPLC 3LMMA 2IS1A 2XF5A 2LREA 4DBQA 1T0FC 3HOSA 3OYHA 3BLYA 3S32A 3ZRGA 4XOTA 2WAEA 3LSHA 1IRXA 2XF7A 3FDYA 5CQEA 4PFOA 3KEYA 5TGTA 2GOMA 3OYKA 4II3A 2MFZA 3S8PA 3OS2A 3K6GA 4ZTFA 3E1SA 4PJMA 2LBFA 3S3OA 2R4GA 3PSFA 2JA2A 3VYTB 3HC7A 2QKMB 2RQQA 1U0JA 4BU2A 3VDXA 2W7NA 1MNEA 2ZXIA 4NC7A 2LRDA 4BDYA 2K9MA 5KHDA 2KRCA 3ONQA 2W4SA 3S93A 3V42A 4H4KC 2V7FA 1D1BA 1FMVA 3DWLE 2WADA 4P5OA 3TMOA 4CSWA 4B47A 2F6CA 4PJLA 3OYMA 3KYLA 3ZXSA 4E7LA 3RQ4A 4HSTA 2BW3B 3SYTA 3W2WA 2MYSA 2OC6A 1GLNA 1X1CA 2V4JC 3CF2A 4DJAA 1BR4A 4XLEA 3AL0B 1WJ5A 2XF6A 3W2AA 2VQGA 4ZJZA 1V5EA 1UAAA 2BVLA 4OWRB 1Z3XA 3K4BA 2X6YA 1Z7LA 2QKLB 3C2GA 2MC4A 4PSWA 1X4OA 1QU3A 3C2HA 3OYIA 2HZDA 4BE2A 3MD2A 2K9LA 3OYJA 3VSLA 3D5LA 2BVMA 4BE1A 2LC2A 2E1MC 4J01A 4RLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5R C;  2GOX B;  2WY7 Q;  3D5S C;  2NOJ B;  2WY8 Q;  2JVG A;  2JVH A;  2GOM A; 
#chains in the Genus database with same CATH topology
 3ROU A;  3LAJ A;  2H1K A;  2KPM A;  3ZMV A;  4J19 A;  2Z1D A;  2Y9Y A;  3ZCO A;  2HXI A;  5HVQ C;  3UKG A;  5M5Y J;  2RDP A;  2QQB A;  3CTA A;  4L9N A;  2AQE A;  4UXN A;  2O03 A;  2NRA C;  4D7M A;  3LQQ A;  4UNO A;  1O3S A;  2NNN A;  3RZD J;  4OMZ A;  4B3A A;  2VPL A;  1OFC X;  2EK5 A;  3I3L A;  3RYP A;  2BY1 A;  3BG9 A;  1BR1 A;  5DCM A;  4A5M A;  3ABK H;  1YRN B;  2Z16 A;  5FJ8 J;  3QRF F;  4XQF A;  4HLY A;  2LG4 A;  1AKH B;  3HOU J;  4HEA 2;  1WCM J;  1VZ0 A;  1W36 C;  4F93 B;  1YW7 A;  3DU6 A;  4BQA A;  2V1U A;  4DNC A;  1IRG A;  1G2H A;  3MFK A;  3K4N A;  4GCV A;  1LDD A;  2E7X A;  3DP7 A;  3F8M A;  2M8G X;  3L2W A;  2X1E A;  3I4P A;  4BDZ A;  2D1H A;  1QHH D;  2ZB9 A;  1WFX A;  3GCM A;  1SMY F;  3FK6 A;  5E79 C;  3GBG A;  3M07 A;  5D5U B;  1HA8 A;  1ZN2 A;  1MMD A;  2OCE A;  3ZR8 X;  1GVJ A;  4L5I A;  3F72 A;  2DI3 A;  1CGP A;  4B43 A;  2F4I A;  2BXY A;  2VON A;  1VQP I;  4LG3 A;  5DDG A;  2L7F P;  3BPX A;  4O5V A;  3PIO F;  2VKE A;  3F22 A;  3TED A;  1RUN A;  2V9K A;  1I1G A;  4BGD A;  5EF6 A;  1T8I A;  2M2E A;  3EYY A;  1X3Z B;  4HV6 A;  2IS4 A;  4ANJ A;  3K4C A;  5JR3 A;  2E7W A;  4FHT A;  1Z1D A;  3Q0W A;  4C2M J;  2A05 A;  2HVQ A;  1WWX A;  4OIR F;  3JR9 A;  4V19 K;  2F4O B;  1XB4 A;  4MFE A;  5IT3 A;  1JE8 A;  2DBB A;  3E7L A;  1ETX A;  3ZMD A;  3JAM K;  1BJA A;  2IP2 A;  1HKS A;  3F8F A;  4G94 A;  3Q9V A;  1RKW A;  2DOF A;  3H9G A;  3WU0 A;  2OAZ A;  4RGS A;  2O5R A;  4AYB N;  5EEG A;  2MD5 A;  2ZSI B;  3MWM A;  1TQM A;  3FZV A;  2CQX A;  2XGC A;  5D4S A;  4G12 A;  2HXO A;  5CVI A;  2DYS H;  3JSP A;  1HW2 A;  4XL9 A;  2BOL A;  2LP0 A;  2VQL A;  4A5N A;  4B3X A;  1V3F A;  2HNH A;  2WTE A;  1WSU A;  4EMS A;  3WG7 H;  2KJB A;  1J0R A;  3M7G A;  2LR8 A;  2A69 F;  5JVT A;  4IHW A;  2M7A A;  2W25 A;  2E2J J;  4E70 A;  4A3C J;  1SD6 A;  2E5Z A;  3K4K A;  4YEJ A;  1WJD A;  5E1X A;  5DV5 A;  2ZSH B;  3GVA A;  2IGO A;  4KMU X;  4A6E A;  5ERI A;  3I58 A;  2XAJ A;  1MND A;  2Y2Z A;  3QPS A;  1MMS A;  1XC5 A;  1OMI A;  5BPD A;  2FEZ A;  3VFZ A;  4F91 B;  3DPU A;  4ON0 A;  2KQR A;  4BKX A;  4YII A;  4CCM A;  2NXN B;  2IJL A;  2M3A A;  5F6F A;  5F64 A;  2BV6 A;  2FA5 A;  4AVZ A;  3I5U A;  2XB0 X;  1YQA A;  2E36 A;  2FBI A;  5B1A H;  4G6T B;  5EGO B;  1VFC A;  2XHK A;  1R23 A;  1H0M A;  4A3B J;  1E0E A;  4A3K J;  3S2W A;  4C30 A;  5JFR A;  2CGP A;  4IRH A;  1UEL B;  1APL C;  3WTT C;  1O57 A;  2WA0 A;  4R8H A;  3CQZ J;  2ZNY A;  2XAG A;  4ABZ A;  4GGG A;  1ZTR A;  3BR6 A;  2QUF A;  1LFP A;  4XKV A;  4HNV A;  1I1S A;  2F4M B;  1IV6 A;  2ZJR F;  2G0E A;  1MBG A;  3P7N A;  2WV0 A;  4YIR X;  3L09 A;  1XGO A;  1UG2 A;  3DKW A;  2V1D A;  2ZO4 A;  5E1Z B;  2X85 A;  3OYD A;  1R00 A;  2CS3 A;  3MQ0 A;  4RA2 A;  3ZPL A;  2KKO A;  5CVU A;  1IGN A;  5LGU A;  5D8K B;  5JHU A;  3OSF A;  4NBQ A;  4RDU A;  1W7P B;  1HBX G;  3K70 C;  1WJE A;  4M72 A;  5J3L A;  5KAI C;  3R61 A;  1TT0 A;  4BAC A;  4LB5 A;  3KIO A;  3S2D J;  3L2C A;  1HOM A;  1FYL A;  3TBI A;  4XRS A;  4X0G A;  2PQ8 A;  5LHI A;  4MIM A;  4ZYA A;  4CZZ A;  1LEA A;  1PJR A;  3H5A A;  3PM1 A;  4P55 A;  4AM3 A;  5M3F J;  2P5K A;  1DP3 A;  1T0F A;  4M3G A;  3CLO A;  2MC3 A;  1OCO H;  3SDG A;  1X2M A;  3ECH A;  4U7B A;  4DBR A;  3FM5 A;  1JI8 A;  3M1E A;  4QTR A;  4DGW B;  3M9A A;  3IKT A;  4RB2 C;  1BC7 C;  4HOB A;  4EAT A;  2AXT C;  3IH2 A;  3BOQ A;  2EH3 A;  2W84 A;  2DAO A;  4N4N B;  1XMA A;  3DKY A;  3OR1 C;  3L9F A;  1JXS A;  1U2W A;  3PFI A;  4BS9 A;  1A5J A;  5BQT A;  1R1V A;  2YSR A;  5IPA A;  3CZ6 A;  1LFB A;  5HDN A;  1T6S A;  4PUS A;  4I09 A;  4GXO A;  3TDZ C;  2PFB A;  2LBF B;  3CCQ I;  2QEX I;  2UWM A;  3VPR A;  2XV4 S;  4I0B A;  3FHZ A;  2BE5 F;  4H0E A;  2CFO A;  3WOD F;  5F27 A;  4BJT A;  4YRV A;  3H3Z A;  2AQF A;  4KN4 X;  1X1D A;  3F6V A;  3MKY B;  4RB0 A;  1TWH J;  4BJ5 C;  3QYB A;  1U6G A;  2COB A;  4U0V A;  2DT7 B;  4C3J J;  4IRI A;  3GTQ J;  4IVN A;  3KCC A;  3I56 I;  4W1U A;  2HTS A;  2GAU A;  4Y33 A;  1U3E M;  4BXX J;  1FT9 A;  2VOO A;  1GXP A;  4EM0 B;  3OS0 A;  5M3M J;  4AIH A;  2XGE A;  3H1C A;  3H36 A;  2ZJQ F;  2E1O A;  1WKM A;  4ZYG A;  4OIN F;  1IDZ A;  4D0P A;  5FKK A;  3CMM A;  5GTI C;  2V1N A;  2JA6 J;  5HLG A;  3HSE A;  1JJ6 C;  4F3Q A;  3GLL A;  4A3L J;  1O3Q A;  4FE4 A;  3OSG A;  2NVX J;  1VQ6 I;  2JA7 J;  4YIF A;  1T39 A;  1XCB A;  2NS0 A;  1TW2 A;  4JP0 A;  4L5J A;  2FE3 A;  2TRT A;  5FKM A;  2L9N A;  1T08 B;  3LNQ A;  3H0D A;  2WBM A;  2MW8 A;  5KK1 A;  2K5C A;  3GZN B;  2PX9 A;  1NH3 A;  3CCR I;  5HOD A;  1WJF A;  3TQN A;  1FLI A;  2NS8 A;  4QPO A;  2G9W A;  1HW1 A;  4DIQ A;  3KPH A;  2L9S A;  3MAJ A;  4XN0 A;  1OYY A;  1VF9 A;  1RKT A;  3ZMT A;  4GFB A;  1TQI A;  2HFH A;  2IS2 A;  2EIL H;  5DYM A;  1BIB A;  3V7R A;  3Q0V A;  4XLA A;  3MCZ A;  5H6Q A;  5TJJ A;  3HPG A;  1KGS A;  2IBD A;  1FIA A;  1IN6 A;  2EFP A;  3FXM A;  3DXJ F;  2EZL A;  4OMY A;  3K4M A;  2EV6 A;  1XS9 A;  2CQN A;  2X6W A;  5EGO A;  3S1Q J;  1N77 A;  4FCY A;  4M3B A;  2H09 A;  2NVU B;  2O8K A;  4A6D A;  3DEU A;  3COA C;  3HEF A;  3IH4 A;  1FYK A;  4I02 A;  2QLZ A;  1Y39 A;  1MBJ A;  3QOD A;  4XOP A;  2Q0O A;  2L01 A;  2PMZ A;  1BW5 A;  4HRI A;  2VXD A;  2DOD A;  2JQ7 A;  3ZQ7 A;  4DYC A;  4D1Q A;  1S72 I;  1KQ8 A;  2CJJ A;  3D0S A;  1FX7 A;  3CDH A;  3K4L A;  5FRO A;  3H35 A;  2IPQ X;  1JHF A;  2FBH A;  1IN5 A;  3AL0 C;  3FMQ A;  5HDK A;  4EQQ A;  4GDF A;  2MSY A;  4FIS A;  4LFU A;  5ICG A;  3HB9 A;  3ZN1 A;  1C0W A;  1FTT A;  4DOZ A;  2RC4 A;  1DDN A;  4A0Z A;  4DW6 A;  4BXU A;  3MKW B;  5J1U A;  2DT5 A;  2MBF A;  1Y0U A;  2R7D A;  2V1X A;  4CCJ A;  4I6Z A;  2CO5 A;  5HLI A;  3G1O A;  2ZXJ A;  1JKR C;  2DQL A;  2O3F A;  1IXC A;  4A0Y A;  4RBO A;  4KUM A;  4N4O B;  1SVL A;  5JLX A;  3LOC A;  4BHP A;  1JKP C;  3J7A O;  1LDJ A;  1MW7 A;  1MIJ A;  3T8R A;  1T98 A;  2XF5 A;  2JA8 J;  3HOS A;  4D7N A;  4EM2 A;  3BLY A;  2FD5 A;  2WAE A;  4MHG A;  2W48 A;  2GOM A;  5BNG A;  2A07 F;  2HDC A;  1XCV A;  3I4M J;  5HDG A;  4JBA A;  3S16 J;  4WXD A;  2MFZ A;  3GUD A;  3S8P A;  1RR8 C;  2AS5 F;  4ZTF A;  3GWZ A;  3ZOB A;  5J4Y A;  2LBF A;  2ELH A;  3GLX A;  5FD5 A;  3J7Y J;  2VBZ A;  2IA1 A;  3HC7 A;  3ZN0 A;  2QKM B;  1W0U A;  4UB8 C;  1GV5 A;  2VC1 A;  2W7N A;  1R9T J;  1SD4 A;  1MNE A;  2DA7 A;  2ZXI A;  2PMH A;  1P4X A;  1POG A;  3HUG A;  4RGX A;  1S5L C;  2F5E A;  1UCR A;  3GFL A;  3BT9 A;  4H4K C;  3CCM I;  5E18 F;  1D1B A;  1FMV A;  3DWL E;  4BAY A;  4P5O A;  3OYM A;  4B47 A;  2E19 A;  2LY9 A;  3ERM A;  3KEQ A;  3ZXS A;  1ZG5 A;  1K6O A;  1JUM A;  2BW3 B;  5B5E C;  1VQ8 I;  5E17 F;  3W2W A;  4N0B A;  1KYW A;  2NVY J;  2ECB A;  1E3P A;  1BC8 C;  4XLE A;  3AL0 B;  4MEX F;  2VQG A;  4M6Y A;  2BYV E;  2BVL A;  2CU7 A;  4CYC B;  3EUH A;  1I5Z A;  2X6Y A;  4D5F A;  3IWF A;  1Z7L A;  2OCC H;  3R4K A;  1D3Y A;  2LK2 A;  4UV8 A;  3R0J A;  1IRF A;  1X4O A;  1QU3 A;  1GUU A;  3OYI A;  1NHA A;  1IN8 A;  2F5C A;  2E34 A;  2DA5 A;  2XPW A;  4IHS A;  1UJ8 A;  3VSL A;  1KZH A;  2EIJ H;  2LFB A;  4I98 B;  1X3W B;  1OCR H;  2B0L A;  1O4X A;  3ZQL A;  4NQW A;  1RR7 A;  3GXO A;  3GYH X;  1PUF B;  2L3D A;  2IEK A;  2OU2 A;  1N75 A;  3GFI A;  3FXQ A;  1ZAR A;  2PJR A;  2QCO A;  5GTH C;  2IS6 A;  4XSX F;  1XGS A;  2OZU A;  3TOB A;  4CGZ A;  5HNH A;  1P7J A;  3HTS B;  2OV7 A;  3ZMZ A;  5E3N A;  2KJC A;  2QBY B;  2CMP A;  2LY1 A;  4RGR A;  1FY7 A;  1U78 A;  5J1Y A;  5IP9 J;  2DMT A;  2HVR A;  2EZI A;  3P9C A;  2XPV A;  1X1A A;  1KU9 A;  1Z21 A;  2HGC A;  3IUO A;  1ETK A;  2LOO A;  1YO5 C;  2DTR A;  3L2Q A;  2OJE D;  1DP7 P;  2HZT A;  2M45 A;  4XNF A;  2Z3Y A;  2VIX A;  4LD5 A;  1KU7 A;  3HKZ N;  5FKO A;  4A0X A;  3GTM J;  1EF4 A;  1VQ5 I;  5IT9 Z;  1OR7 C;  1SAU A;  5E1W A;  1U5T C;  2IA0 A;  4BHB A;  2DYR H;  3DCF A;  2EPF A;  3BC8 A;  2XIG A;  2F2E A;  2XSJ C;  1YW8 A;  2VQH A;  3G2B A;  2HEO A;  4KT6 A;  1Z91 A;  4IHV A;  2CWE A;  3G73 A;  4F52 A;  4JK1 X;  2BY0 A;  2Y48 A;  1ZG1 A;  4KJZ A;  1I39 A;  3GFJ A;  1UMQ A;  2RNJ A;  2FXA A;  4HSR A;  1IXS B;  3OS1 A;  2IGN A;  2K27 A;  1B72 B;  1BI2 A;  3GTG J;  1TBX A;  2ISY A;  1MMN A;  3I55 I;  1REP C;  3E6M A;  2Y0S A;  1WHU A;  1G3W A;  4RS8 A;  1R22 A;  1R4N B;  2C6Y A;  2ZME A;  4UVC A;  3PNY A;  5K7Z A;  2FF4 A;  5CVJ A;  1ZRD A;  2DT6 A;  3RCO A;  2VPR A;  2R7O A;  3DEE A;  4XN3 A;  5EZH A;  4CHU A;  1PP7 U;  2B9S A;  3HRS A;  3WHB A;  4IJA A;  3J7A Y;  1FSH A;  4Q5S F;  1MSE C;  2CRG A;  2DA2 A;  4HBL A;  4ESJ A;  3TO7 A;  5J1R A;  3FXK A;  4RAG A;  3IP4 B;  4ZTJ A;  3RI4 A;  1D1A A;  1TWA J;  3GME A;  4WXH A;  1F4K A;  3CC2 I;  3C1D A;  2JRM A;  2H8R A;  2H94 A;  1GHC A;  2LKX A;  1X19 A;  2DJI A;  2KLO A;  3BR1 A;  3GZ6 A;  1W4M A;  2Z9O A;  1XMK A;  2FJ1 A;  2VT2 A;  3KYC B;  4HF0 A;  4LLL A;  3F3X A;  1K79 A;  2ME6 A;  4M3E A;  4HDV A;  4X6A J;  1DU6 A;  3EET A;  2CW0 F;  5B66 C;  2Z99 A;  1QZE A;  4BE0 A;  5DD8 A;  4NNJ A;  4LMY A;  4A3D J;  1BN5 A;  1SC7 A;  1WJA A;  1B59 A;  2LY2 A;  2Z2S B;  3O8H A;  1QVT A;  3BR3 A;  3BQZ A;  3K2A A;  4WK8 F;  1TNT A;  3E0J B;  2QYO A;  3E6B A;  5F1J A;  2JMW A;  5F0H A;  1U5T B;  1J7K A;  5H6R A;  4BQN A;  2E5N A;  1ZR4 A;  3KZZ A;  1ETO A;  1ACI A;  1UST A;  2ELJ A;  1YX3 A;  4B8X A;  2M5W A;  5F1R A;  2GXG A;  3JSO A;  2MG4 A;  2PG4 A;  2LNB A;  2X1D A;  2KIQ A;  1J75 A;  1IJW C;  4HYE A;  2P4W A;  2VBW A;  2HYJ A;  2RAE A;  4RB1 A;  3HOZ J;  2BW3 A;  3FXR A;  4YFX F;  4CCN A;  2STT A;  3TL4 X;  5GAG J;  2QVO A;  4HPQ A;  4MNU A;  3W2V A;  4HX7 A;  1S6L A;  2FUG 2;  3P9K A;  2DXI A;  3HRT A;  5L3C A;  3U2R A;  4HZF A;  2JVG A;  3HG9 A;  2M4G A;  3KP3 A;  2MA3 A;  1HXD A;  4ETS A;  4P9U A;  2N8G A;  4XIC A;  2IRF G;  2DFF A;  2EB7 A;  2HPI A;  3ZQC A;  2GIV A;  1XGN A;  2R7F A;  2VT3 A;  4MEY F;  3UR3 C;  1OKR A;  3D5R C;  2ZBK A;  4XM3 A;  1EH7 A;  3DLL F;  2P6S A;  4ZDL A;  4JX6 A;  3Q0U A;  4UVA A;  1O7L A;  2IXS A;  1Z3Y A;  2JT1 A;  4PJ0 C;  4XLF A;  4FX0 A;  3ZQH A;  5B3S H;  3CMA I;  1LJ9 A;  1YLF A;  2JRT A;  3ECO A;  3SXY A;  5C4X J;  1MMG A;  2OF7 A;  1L3L A;  1ZQ3 P;  2HOS A;  4EJV A;  1MKM A;  5ILS A;  2STW A;  4IQJ A;  1LE8 B;  2A5Y B;  2X51 A;  1W5T A;  5J4V A;  4B44 A;  2FML A;  2L7Z A;  3VYR B;  2CFX A;  4M9Z A;  3GTL J;  2VJ5 A;  4MTD A;  4HQE A;  4RMN A;  1ETY A;  2QBY A;  1VI0 A;  1MGT A;  2CV1 A;  4ZDO A;  2L0K A;  1J09 A;  3DFG A;  1D0X A;  5HS9 A;  3JRA A;  3BTI A;  3E97 A;  3T0Y A;  5HOO A;  2KHM A;  2DDA A;  1YE9 A;  2LD5 A;  2VXZ A;  1E3H A;  2VQC A;  2XGD A;  5FLX K;  2CH0 A;  2FRH A;  4LIU A;  1VQO I;  1ZRF A;  3BG5 A;  1JT0 A;  4E7Z A;  1UHS A;  4DZP A;  3HHH A;  1JKO C;  2Y75 A;  3S17 J;  4BJ6 C;  3CCJ I;  5LBQ A;  1ULY A;  1XSV A;  1I50 J;  3K1P A;  2RQP A;  3FXU A;  3WE2 A;  2P0W A;  3PQJ A;  1BR2 A;  4FE7 A;  2NS7 A;  2DJN A;  4U7D A;  4HX4 A;  3MZ8 A;  1FBS A;  3HL2 A;  4OIP F;  1QVU A;  1FOX A;  1X2N A;  1KU2 A;  3OWT A;  4BL0 B;  4A3E J;  3SZG A;  1Y8Q B;  3WGH A;  3LWF A;  4NUB A;  1S3J A;  2CW8 A;  4RGU A;  4MFD A;  1ZRC A;  2UV1 A;  1Y0N A;  5IP6 A;  2BEO A;  2M9H A;  2R5Y B;  2WB1 N;  3WTX C;  3JTG A;  3DLA A;  3OY9 A;  3N05 A;  2KMU A;  2O61 A;  1AWC A;  3QYF A;  2E2H J;  4UVB A;  1Y1V J;  1MMA A;  3BG6 A;  1K83 J;  2GXB A;  4EJT A;  2B7E A;  4PZJ A;  5JLW A;  3IH3 A;  1KQ9 A;  2K86 A;  2M1B A;  4QWQ A;  2MH9 A;  2KDO A;  3DQV C;  3V7S A;  3M8F A;  1R6R A;  3QP6 A;  3WTY C;  2MD0 A;  4UUV A;  2OA4 A;  1LVK A;  2DPU A;  4IHX A;  4GO1 A;  3F0C A;  1HQC A;  3BR0 A;  3HJE A;  1LFU P;  5B1B H;  4CO8 A;  1J5Y A;  1T56 A;  3NEU A;  1VQK I;  1RNL A;  4IEJ A;  2HYG D;  2ESH A;  4LK1 F;  5FRM A;  1I3A A;  4PJJ A;  3PFY A;  1B9M A;  2Q2E B;  1Y56 A;  2PI0 A;  5IYC J;  3E5U A;  2L54 A;  2GM4 A;  3F8C A;  4HX8 A;  3PNT A;  3WTV C;  5E20 A;  2KIF A;  2R93 J;  1OR7 A;  1U5T A;  4CYD A;  4II2 A;  3DPT A;  4G8X A;  5KCM A;  1S9H A;  1Z7U A;  2L2O A;  4XBF A;  1WPK A;  3PSI A;  2DMQ A;  3W6V A;  1S8N A;  3WHC A;  3BCB A;  1JUP A;  1AU7 A;  4OAZ A;  1Y1W J;  2NAZ A;  4U0W A;  4KMF A;  3A01 B;  3F9K A;  1RPW A;  2K3F A;  2CW7 A;  3CME I;  4RAZ A;  1BBY A;  4UUS B;  4BH9 A;  2VI6 A;  4MTE A;  4BY7 J;  5LGN A;  1T38 A;  1HC8 A;  5LEK A;  2ZJ2 A;  3KEO A;  2Z33 A;  4WCG A;  2XB5 A;  1JKQ C;  1W1W E;  4LLG F;  1UHW A;  1G3Y A;  3H92 A;  4E7S A;  1ZK8 A;  3OIP A;  4UY8 I;  4P96 A;  1A6I A;  2DA3 A;  2FU4 A;  3PL8 A;  5DCF A;  3WTS C;  3KP4 A;  3LSI A;  1YRN A;  1IV8 A;  1G8X A;  2KP6 A;  3L2U A;  3J80 K;  5L3F A;  4JQF A;  2ZCW A;  4AU7 A;  1AKH A;  1E3O C;  3DEW A;  4EJW A;  2JPC A;  2EIN H;  2A6E F;  1VQM I;  3LSJ A;  2XAF A;  2Q8K A;  2YS9 A;  3CCE I;  1RI7 A;  3HOV J;  4AUX A;  5EYR A;  4A93 J;  1QGP A;  3F8N A;  4NB5 A;  3IL2 A;  3TDU C;  2ELK A;  1TWG J;  3PO2 J;  2L02 A;  3DPL C;  5IP7 J;  3LMM A;  2IS1 A;  3QPH A;  3IRQ A;  2NVQ J;  4A69 C;  4DBQ A;  1ZHF A;  4N9H A;  3R6S A;  4A12 A;  2X48 A;  4DQ2 A;  1P6R A;  3S32 A;  1D8J A;  1IRX A;  3KYD B;  4TV7 A;  3ELK A;  2XF7 A;  3FDY A;  5CQE A;  3KEY A;  3SZT A;  3GX4 X;  3TW7 A;  1TWC J;  4II3 A;  2O9L A;  3JRB A;  3OS2 A;  3K6G A;  1OCC H;  1W5C C;  4PJM A;  3E6C C;  3BRO A;  2EFN A;  3S3O A;  3PSF A;  5HS8 A;  3VYT B;  1UHM A;  1LQ1 A;  4RB3 C;  4QSH A;  2HYF A;  2H6C A;  2K9M A;  2HOT A;  4M6X A;  1YTY A;  1MH3 A;  2JPB A;  2BBY A;  2DK5 A;  3AG3 H;  1Z9C A;  3V42 A;  2D5V A;  2EA2 A;  3I59 B;  3KYL A;  2WAD A;  2F6C A;  2OTJ I;  1T33 A;  4HST A;  4EV0 A;  1X58 A;  2MYS A;  1F1Z A;  1GLN A;  1X1C A;  3LST A;  4DJA A;  1BR4 A;  1W5S A;  2XF6 A;  2QWW A;  4AIK A;  3QWL A;  2D1V A;  1OCT C;  4NDL A;  4ZJZ A;  3TO9 A;  1GDT A;  4OWR B;  4ZYD A;  3TKY A;  1ENH A;  3J81 Z;  4NC6 A;  3HBL A;  4BNC A;  2MC4 A;  4PSW A;  1PUE E;  1YIJ I;  2HZD A;  3KP2 A;  1RZ4 A;  1HCR A;  1B8I B;  5LGT A;  2CYY A;  1OQY A;  5F04 A;  2K9S A;  1Z6R A;  2GQQ A;  2E1M C;  2VKV A;  2ZXW H;  4M74 A;  3AKZ A;  3LSK A;  2Y0M A;  2JK3 A;  3LSM A;  5K5Q A;  3R60 A;  2A68 F;  2W82 A;  5FFX A;  2R7U A;  3DKX A;  4XID A;  1VTN C;  4O6J A;  1LKX A;  5E8I A;  3Q3S A;  4IQ4 A;  1R4M B;  1FJL A;  3OMY A;  4KN7 X;  2L7K A;  3DBH B;  3I9V 2;  3SEZ A;  4ENK A;  3H9J A;  3OYN A;  1D1C A;  3MVP A;  5TRD A;  3CCY A;  4Y4R A;  4ZDP A;  4NHJ A;  3BJA A;  3I71 A;  1KON A;  5JVG F;  4IOC F;  2O6G E;  4KIG A;  3BTC A;  2COM A;  4CCO A;  1JTY A;  3GZ5 A;  3F23 A;  1KA8 A;  1G3S A;  2M4K A;  4DYQ A;  4IO9 F;  1H8A C;  4XKC A;  1G6N A;  1WRJ A;  1MJA A;  2W00 A;  2W24 A;  1MDM B;  3TP3 A;  2W1O A;  4LG0 B;  5AIP A;  3K9T A;  1YS7 A;  2ADU A;  4ESF A;  5L3E A;  1W7P A;  5LHG A;  2I5U A;  1R1T A;  1XG1 A;  3BCA A;  1NTC A;  4KDP A;  1NK2 P;  1QA6 A;  4EGZ A;  5CYV A;  1G4D A;  9ANT A;  3G4S I;  1JJ8 C;  5BS6 A;  2E2I J;  3KET A;  3V7C A;  3VWB A;  4C2U A;  5ICC A;  1Y6I A;  1MBK A;  3BG7 A;  3I0T A;  3PIP F;  1K78 B;  4IKF A;  1P7I A;  1UB9 A;  4BEH B;  5TIS C;  1TTY A;  4A3F J;  3HSR A;  1XSD A;  1UG0 A;  1ZGJ A;  1HLV A;  3QYE A;  4JYK A;  1B1B A;  2QM3 A;  2WWY A;  1RIO H;  4ZZL A;  3QOE A;  3CO6 C;  1TW3 A;  4P1W A;  2HDW A;  3NRV A;  2OQG A;  4M6V A;  3X2Q H;  1ETQ A;  4KIC A;  2JTV A;  2OQR A;  4QIW N;  1R71 A;  3CC7 I;  5IYD J;  2E1M B;  4G6D A;  3I53 A;  5D6F A;  1W36 D;  2EBI A;  3CO7 C;  5GP9 A;  5EG0 B;  5D5W B;  1FIP A;  5D4R A;  1NG6 A;  3SHF A;  2RRE A;  2A6T A;  2OBP A;  4LJZ F;  4Y17 A;  3HRU A;  2VL8 A;  2EZH A;  1JT6 A;  4ZH4 F;  4CXF A;  1DU0 A;  2EIM H;  3F21 A;  1QQI A;  4LLN A;  3IAS 2;  1OYI A;  3L7W A;  3T1B A;  2DFE A;  3H5N A;  2K85 A;  2J5P A;  4YG2 F;  4PGG A;  1GV2 A;  4HW0 A;  2R7T A;  2AO9 A;  2XKP A;  2K7L A;  2PLY A;  2M0C A;  4MQV A;  4IL6 C;  1FPQ A;  1HF0 A;  1YIT I;  3LSG A;  2VAS A;  1OPC A;  2IGK A;  1ZYR F;  1BM9 A;  2QQA A;  2LTP A;  4FET A;  2YUS A;  1S7A A;  5EEA A;  1DUX C;  3RKY A;  1VQ4 I;  3RZO J;  3WE3 A;  1J59 A;  5HNF A;  3HGY A;  1QHG A;  1LVA A;  3K4J A;  1EH6 A;  2X6O A;  1EH8 A;  1WI3 A;  3RYR A;  4XRM A;  2BXZ A;  1B9N A;  2UXN A;  1O7F A;  3RIR A;  1D5V A;  3ULQ B;  2F5D A;  4IF4 A;  3EPZ A;  3DBL B;  1T2K A;  1SFX A;  1F43 A;  2KIU A;  2L9R A;  3PQK A;  4ENN A;  3QPT A;  3B6A A;  1FEX A;  3ZMU A;  4E7H A;  1R5G A;  3VEP A;  5FLV A;  1YJ9 I;  3CJT B;  2Z5U A;  3ZP5 A;  3KE2 A;  2RVC A;  1R5I D;  4PK4 A;  1MBF A;  1LUJ B;  2Y30 A;  3OL4 A;  2VJ4 A;  5DCM B;  1BA5 A;  1T95 A;  1ORK A;  1SAN A;  2QQ9 A;  3JAM Z;  3U1K A;  2DA6 A;  2BHY A;  1Z05 A;  1AOY A;  3WTU C;  1CF7 B;  4U88 A;  1PYV A;  1M1E B;  2WY8 Q;  4L0Y B;  3O6B B;  3IV5 A;  2WAQ N;  5L3G A;  5FLM J;  5LD2 C;  4PGH A;  2MAB A;  1SVM A;  2LKP A;  2DQR A;  4BYY A;  5CLS A;  4FT8 A;  4UUT A;  3DF8 A;  1WVR A;  1SVO A;  4C2T A;  3NWT A;  4XRF A;  3S15 J;  1O3R A;  1PVE A;  3C18 A;  1TZL A;  3C2B A;  3GFM A;  1D5Y A;  2JA5 J;  5LRR A;  5LHH A;  4L18 B;  4B09 A;  1WZ2 A;  1BJZ A;  4V2G A;  2V6C A;  3CJQ B;  2DA4 A;  3K1M A;  4Y3O A;  1WH5 A;  1R58 A;  4LIT A;  1K6Y A;  3A0B C;  2R5Z B;  1TP4 A;  2E35 A;  4A3G J;  4AC0 A;  1AA7 A;  1X1P A;  2CUE A;  4HLX A;  2NOJ B;  2CQK A;  4W97 A;  4C3I J;  1OCZ H;  4D5C A;  2X9D A;  5LRS A;  4F7Z A;  2JSC A;  1PDN C;  2E1C A;  2P81 A;  3E3V A;  4XKW A;  4XLC A;  2ZXH A;  1Q1H A;  3A02 A;  4AD9 A;  3K70 D;  3JTH A;  2L5Q A;  2VJI A;  4L9T A;  4PJN A;  5FO5 A;  2R92 J;  2CQQ A;  4BQQ A;  3ABU A;  5DS9 A;  2JWT A;  3M8J A;  2EFO A;  1RES A;  3J81 K;  4C3H J;  3HDD A;  1H9G A;  2YX7 A;  1VQN I;  2I8D A;  3WG9 A;  3BR2 A;  2VUM J;  2V6E A;  1BIA A;  4AYB A;  3GTO J;  2M7B A;  1WQ2 A;  3W6J B;  3KZI C;  1IRZ A;  2V26 A;  1ITY A;  2BY2 A;  1FTZ A;  2ID6 A;  4L5E A;  4BEH A;  2FBK A;  2ID3 A;  1YHQ I;  4Y7N J;  5D8L B;  3HOT A;  1S7E A;  5DM6 F;  4XMY A;  1IUF A;  2ECC A;  2WB1 A;  5FKL A;  1QO0 D;  3VOE A;  3ASN H;  4ZYE A;  4IPA A;  4XRS G;  4WWC A;  2P6T A;  4S04 A;  4IX7 A;  5HLT A;  3M8E A;  4HA8 A;  4S05 A;  2PMU A;  2V9V A;  3MZY A;  3VSK A;  2WY7 Q;  3K2Z A;  3BWG A;  1F5T A;  1BI1 A;  3RSN A;  3HTU A;  1FYM A;  2DPD A;  3E6D A;  1DQU A;  2VN2 A;  1FP2 A;  1JGG A;  3U21 A;  2CUJ A;  2WAF A;  1SAX A;  5ICF A;  3FIS A;  2JZY A;  3BZ6 A;  3MZH A;  2XPU A;  1HSJ A;  2A6H F;  2VKD A;  2X4H A;  2R7W A;  1K7A A;  1IN4 A;  4DZJ A;  3FMR A;  4IZZ A;  2DFI A;  3LSP A;  2KZG A;  2ZFU A;  3VOD A;  3OYC A;  3JRH A;  3HPH A;  3KP6 A;  2R7Q A;  2L9V A;  4CIC A;  2OUM A;  4HDU A;  3FM3 A;  2YU3 A;  2ZNZ A;  1KQ0 A;  1U9O A;  1S7O A;  4BUP A;  3OYB A;  3AAF A;  3VYU B;  1D0Z A;  3H3V K;  5F08 A;  2YX4 A;  3RKW A;  2IT0 A;  2Y69 H;  1EJ9 A;  4LIV A;  3BR5 A;  3BTL A;  3N97 A;  2H1L A;  3EDP A;  1Z6T A;  4G7O F;  3ABL H;  1KYZ A;  1YYV A;  3UNG C;  2R7V A;  3OOU A;  1BOB A;  3MKZ A;  3CCS I;  3M1C A;  3S1R J;  2UXX A;  3HYI A;  2M0M A;  4CYC A;  1B6A A;  2KRH A;  2LYC A;  3U9G A;  4U87 A;  2VE8 A;  2DN0 A;  5CPR B;  2D45 A;  4Q48 A;  1L0O C;  1QPM A;  2RNG A;  2F48 A;  2TCT A;  5DEQ A;  3ISP A;  2LVS A;  2NOG A;  1ON1 A;  3IWZ A;  1U8R A;  3FXL A;  3HGG A;  2P5L C;  2GA1 A;  2M30 A;  2LSO A;  3OIQ A;  1PUF A;  2FX0 A;  4BBS J;  4NC8 A;  3HSF A;  2RV8 A;  4I7H A;  2A5W A;  2FSW A;  4WXC A;  3ZQQ A;  1IW7 F;  6PAX A;  2PJP A;  3E5Q A;  1Q1V A;  3F6O A;  4KIF A;  4V2F A;  5DM7 F;  1CF7 A;  3FWE A;  4KIS A;  5CVV A;  2DOA A;  2EWN A;  2JVH A;  4HQM A;  4YEL A;  2HKX A;  1W0T A;  2IW5 A;  1QZZ A;  2VBX A;  5K5O A;  4YFK F;  4ITV A;  2Y31 A;  4J00 A;  3V4G A;  4KIB A;  4E7I A;  3CP2 A;  2OPT A;  1TLH B;  2VLA A;  4R1H A;  2I10 A;  2P5V A;  1GVD A;  2A61 A;  1TL8 A;  3JRF A;  2VOD A;  3WTZ A;  4EJU A;  1D8K A;  1MNM C;  4JOM A;  4B1R A;  4OIQ F;  3MN2 A;  4Q47 A;  5FRN A;  1BI0 A;  3V8J A;  2LF7 A;  4KNY A;  4M73 A;  3FKI J;  1QRY A;  1IF1 A;  1D0Y A;  4A3I J;  1R1U A;  2R5Z A;  5BMZ A;  3EYI A;  1TNS A;  2W85 A;  3OYH A;  3ASO H;  1HW5 A;  1V55 H;  3C7J A;  1VQ7 I;  3ZRG A;  2K9Q A;  1YJN I;  3LSH A;  5EDN A;  4LB6 B;  3OV8 A;  3OYK A;  5TGT A;  1S29 A;  3RJP A;  2Y0S N;  4JX5 A;  4KA4 A;  1I6X A;  1MJ9 A;  3QP5 A;  1B72 A;  2ZC2 A;  2PEX A;  1KU3 A;  2JUC A;  5GAH J;  4K2E A;  2XRL A;  3S2H J;  5AIQ A;  2RQQ A;  4BU2 A;  2RGV A;  3VDX A;  2LKS A;  4NC7 A;  4BDY A;  2LRD A;  2EA4 A;  3SJM A;  2KRC A;  4B4C A;  3OOP A;  2P8T A;  3ONQ A;  2R3S A;  3IHU A;  3BY6 A;  3CCV I;  3U1D A;  3RPU A;  1U9N A;  3S93 A;  3V8L A;  1LPQ A;  2V7F A;  3A03 A;  3NAR A;  1F9N A;  2K40 A;  3NQO A;  4PCQ A;  2XRO A;  3TMO A;  1JUS A;  3G6E I;  4PJL A;  1WH7 A;  3N4M A;  3I64 A;  5M5W J;  3HOW J;  2EQR A;  4M9S A;  2V4J C;  2PBI A;  3CF2 A;  1G3T A;  1ZGA A;  3SFI A;  2E71 A;  4RAF A;  1WJ5 A;  3JW4 A;  4O3M A;  3W2A A;  2OD5 A;  1VQ9 I;  5F0C A;  3CD6 I;  5IYB J;  2DA1 A;  2DTZ A;  2RN7 A;  5IT9 K;  3K4B A;  4HAM A;  2HOA A;  1K61 A;  5HLH A;  2GBY A;  4X1E A;  2QKL B;  4G7H F;  3C2G A;  4RAY A;  1WGX A;  2L7M P;  3C2H A;  4GYG A;  3JCU C;  4A3J J;  1R36 A;  4BE2 A;  3RKQ A;  1SEU A;  1QZY A;  2UZK A;  3MD2 A;  2VE9 A;  1ZKG A;  3OYJ A;  3Q9S A;  1R49 A;  3JRI A;  3M4O J;  2BVM A;  2LC2 A;  1IAW A;  1Z67 A;  3PUB A;  3WTW C;  4RLQ A;  3F8B A;  3TP0 A;  3ZQG A;  1R7J A;  4KYW A;  2EIK H;  3QU6 A;  4FAS D;  1XPX A;  2FNP A;  2QSF X;  2HQA A;  3SFZ A;  1A04 A;  1RET A;  5LFA A;  4XLP F;  3R0A A;  4ASN A;  1ZH5 A;  4C9Y A;  5HS7 A;  5LEJ A;  1TQP A;  4MGR A;  2NVT J;  2E1N A;  2DW4 A;  2D2W A;  3T5X A;  1YJW I;  1B4A A;  2X0L A;  3QPL A;  1YG2 A;  2HQ5 A;  2CV2 A;  3HRM A;  4D9J A;  2W57 A;  1RRJ A;  2DDB A;  1YIO A;  4E7K A;  4CDG A;  3GTP J;  2LH9 A;  5L3B A;  3IC7 A;  2K4J A;  2GWR A;  5A2Q Z;  4UV9 A;  2X1C A;  4R79 A;  1JTX A;  3EUH C;  1IXR C;  3V8K A;  3OYA A;  1MJB A;  4N9I A;  5J8F A;  1MBE A;  5JI6 A;  3LL7 A;  2P7V B;  1DGR M;  2DO7 A;  3OR2 C;  3WU1 B;  2HR3 A;  2DCE A;  1BL0 A;  1XGM A;  3TGN A;  1ETW A;  2QGU A;  2BZT A;  2EFW A;  1P9Q C;  3TW6 A;  3IRR A;  1H88 C;  1ZEL A;  1J9I A;  2A3S A;  3VYS B;  3K1N A;  4WX9 A;  3CDI A;  3H5R A;  1EA3 A;  4XLN F;  3CJR B;  2VBY A;  3RPU D;  1SD5 A;  4EM1 A;  2DFH A;  3L00 A;  3K10 A;  3OYG A;  1H9T A;  1VQL I;  1IZ1 A;  4LK0 F;  2VB6 A;  3TO6 A;  1E17 A;  1FP1 D;  2EFQ A;  5FFZ A;  3HIF A;  4L9V A;  2CQ7 A;  2TDX A;  1G59 A;  4RM3 A;  5E3M A;  4G7Z F;  1LE8 A;  4BBR J;  3H0G J;  2KIM A;  4AVP A;  4BY1 J;  3RDI A;  1IC8 A;  3IKV A;  2H8W A;  2HPM A;  3GF2 A;  3HM5 A;  1FOW A;  4WF2 A;  3CMY A;  1USS A;  3OL3 A;  3M3Y J;  1E2X A;  3VB2 A;  3FKJ A;  4XOR A;  1V5G A;  1LDK B;  4BHC A;  3LA3 A;  3KX2 A;  5K1Y A;  3HUG B;  4OAY A;  2XAQ A;  2CG4 A;  2XRN A;  5C3E J;  5M5X J;  3CLQ A;  4Y15 A;  2P7C B;  1FOK A;  5ILV A;  1OYW A;  2GA2 A;  4A2U A;  5FKN A;  1LB2 A;  1FWZ A;  5IY5 H;  1OIS A;  1RUO A;  2HVS A;  1HKT A;  3ESW B;  1JGS A;  2BY3 A;  4ZC3 A;  1WI9 A;  5CVR A;  2VOP A;  5J47 A;  2BHZ A;  3O2P E;  2DU9 A;  4P9F A;  1UFM A;  3B6C A;  4QLC U;  4HF2 A;  2GIZ A;  2QF7 A;  3DTI A;  1YS6 A;  5FB2 A;  2R7S A;  2LMD A;  3EUA A;  4OOI A;  3DV8 A;  4IRG A;  1WJC A;  1DPU A;  1U8B A;  4Z6Y A;  1FMW A;  1MH4 A;  3K69 A;  2R5Y A;  2JSP A;  5J8C A;  1BW6 A;  1P92 A;  2DK8 A;  4Y52 J;  2XC7 A;  2ZME C;  2ACJ A;  1BI3 A;  2WV1 A;  4KT5 C;  4HNT A;  4NQW B;  1F36 A;  3K0L A;  1ODD A;  2UUZ A;  3CC4 I;  2B63 J;  3BDD A;  4FQG A;  3WGI A;  2PJR B;  1FBQ A;  1UZC A;  3LFK A;  5EEH A;  1EKE A;  2WC2 A;  3L2R A;  3G1L A;  3A4C A;  3BZK A;  1IO2 A;  5D6E A;  3B73 A;  4EJO A;  3G71 I;  2DMP A;  1O3T A;  2ISZ A;  2LF8 A;  3FX3 A;  1NG7 A;  3W6K B;  5F0F A;  3KFW X;  1R5H A;  3DTK A;  4UB6 C;  3L2V A;  2XAU A;  4MLO A;  2F5V A;  1ZLK A;  3FIW A;  4PFP A;  4I99 C;  3H9Q A;  5J40 A;  2VKH A;  4ZZD A;  2FMY A;  4IOA F;  3FBN B;  3QOP A;  5K5R A;  2QEN A;  2O0Y A;  2RKH A;  4CA0 A;  1JHH A;  3S3N A;  3GTK J;  3W3C A;  2WAQ A;  4HV5 A;  2Y9Z A;  3QQA A;  1SFU A;  1IN7 A;  1I27 A;  2Q2E A;  1P2F A;  1IDY A;  3RQI A;  2R7R A;  3LFU A;  1FOY A;  4E7J A;  1GT0 C;  2R7X A;  4CUG A;  2ME0 A;  1QPI A;  4E6K G;  4AIJ A;  4HNU A;  4XKB A;  2HWV A;  2XKO A;  5GAE J;  4CH7 A;  2JJ7 A;  4FTH A;  1YX5 A;  2L4M A;  5BOX A;  4L9J A;  3RKX A;  3HKZ A;  2V79 A;  1V5F A;  4XR6 A;  1ETV A;  3CUQ C;  1XX5 A;  3FF5 A;  2CUF A;  2E60 A;  3BTJ A;  2ZKZ A;  3PJR A;  2XUB A;  2R7Z J;  3D5S C;  3HXL A;  1LEB A;  1VND A;  3GTJ J;  3NWS A;  1HDP A;  1J2X A;  5IOZ A;  1XMX A;  1X3U A;  1ZG3 A;  2XAH A;  2FOK A;  3LA2 A;  5KNL A;  3A01 A;  4F92 B;  5ED4 A;  3OYE A;  3ERE D;  1XTA A;  4UUS A;  2QA4 I;  2X6X A;  2O8X A;  2ZME B;  3KP5 A;  3SQN A;  2K4B A;  4ZYH A;  4RM2 A;  1P4A A;  4ESB A;  1TC3 C;  3PO3 J;  4I0A A;  4KFC A;  4YFN F;  2JUG A;  1SFE A;  1P4W A;  2BGC A;  2JN6 A;  3DU5 A;  5DD4 A;  3K7A J;  3OYL A;  3S14 J;  3S3M A;  1OJL A;  3JRD A;  2KDZ A;  4JX4 A;  1YI2 I;  1MZB A;  2ETH A;  5E8G A;  3PUF A;  3SZP A;  5GPC A;  1IUY A;  2QQ8 A;  2CSO A;  4CCL A;  4S0H B;  3A0H C;  4L0Z B;  2PN6 A;  2AHQ A;  3RPQ A;  5JHF A;  4G9Y A;  4RLF A;  5EZG A;  5LLQ A;  3Q5F A;  4MQ9 F;  2V9P A;  4XSZ F;  3ML6 A;  2DMU A;  2GZW A;  2Q1Z B;  4LOC A;  4AID A;  5KVR A;  3LAP A;  2OTL I;  3H3U A;  1H89 C;  2KRF A;  3CDL A;  3CJN A;  2F5F A;  1I3Q J;  2FNA A;  2IGM A;  2FQ3 A;  5CKT A;  5ICE A;  2HS5 A;  1MD0 A;  3G1M A;  3RTR A;  2CUZ A;  2R0Q C;  2ZFW A;  5H20 A;  5FD6 A;  3I54 A;  2KFD A;  1N25 A;  1XD7 A;  3A1Y A;  2HU9 A;  5KAF C;  3S1N J;  3ABM H;  4G6Q A;  4OU0 A;  1SFO J;  5DUK A;  4Y13 A;  2IAI A;  4PSX A;  2J5O A;  5H2F C;  3LSR A;  4XK4 A;  1MSF C;  3BJO A;  3CUQ B;  4HF1 A;  1QBJ A;  3KLN A;  2K9N A;  3QU3 A;  5A2Q K;  1FZP B;  1Y8R B;  3O3K A;  3DTE A;  1X1B A;  3WU2 C;  3SDB A;  4EGY A;  4IXA A;  1HKQ A;  1EV7 A;  3I4N J;  1DPR A;  2VJJ A;  1XN7 A;  5CJ9 A;  3AG4 H;  5GAD J;  5AON A;  2NNY A;  1W7P D;  1OCP A;  3HZJ A;  2O7O A;  1GXQ A;  2DLL A;  2HOE A;  1SFK A;  1FSE A;  2KL4 A;  3I59 A;  2VC0 A;  4B48 A;  3PNV A;  3JRG A;  2G7U A;  4BXF A;  5FLX Z;  4F55 A;  5D5X B;  1HST A;  2XDV A;  4E4H A;  3AG1 H;  3G3Z A;  3D1N I;  4EEF G;  5K7F A;  5E3O A;  2M87 A;  4AWX B;  2XSD C;  3REO A;  3B02 A;  2MLG A;  3FHN A;  5EJC A;  2KZV A;  3J7Z I;  2MH2 A;  3SEQ A;  5GPA A;  3MKL A;  1FBU A;  2M34 A;  4M3F A;  4BQO A;  4Q4Z F;  2QZ8 A;  3HOX J;  3ZQF A;  4XON A;  4I76 A;  3JRC A;  3AFH A;  1K4T A;  1X4P A;  1WJB A;  4FX4 A;  3CUO A;  4GRI A;  3NAU A;  5DUI A;  1B8I A;  1N78 A;  3P9I A;  1PP8 F;  1DGW Y;  2H6B A;  1ZAO A;  3HHG A;  4IHY A;  3DBR B;  3AG2 H;  3FBI B;  5L3D A;  4CZC A;  5C4J J;  3CCL I;  3MEX A;  2CV0 A;  2ICW G;  4DYR A;  2YPR A;  2OZ6 A;  3OYF A;  1K4S A;  2M8E A;  2XGX A;  1LNW A;  4QPQ A;  3C3W A;  3EUK L;  4KIT B;  3A2K A;  1A31 A;  2PMZ N;  3LQR A;  3LA7 A;  4HG2 A;  3IAM 2;  1ZRE A;  2LDU A;  2GOX B;  1A6Q A;  1MBH A;  3ZGK A;  5D5V B;  4LGW A;  4IHT A;  1OLT A;  3EQL F;  2K02 A;  2YU9 J;  1BOA A;  1NK3 P;  4I2O A;  2HQR A;  5CQG A;  5ILU A;  2EJR A;  4XLH A;  3CES A;  1STZ A;  5J6X A;  1MDM A;  5DTD A;  1SD7 A;  3FXO A;  2HQN A;  4LG0 A;  3L1P A;  1ONV A;  1A35 A;  2K3P A;  3KLO A;  4CCK A;  1ERD A;  1YW9 A;  4MO7 A;  3CP8 A;  2HI3 A;  3KP7 A;  3KZY A;  1SMT A;  5FGM A;  2LLK A;  1XDU A;  1IG7 A;  3QAH A;  1HDD C;  1TT5 B;  3MMY B;  3BZC A;  2L4A A;  2H27 A;  2IA2 A;  2EV5 A;  2LRE A;  5C44 J;  1RC9 A;  1T0F C;  2MGQ A;  3BG3 A;  5E3L A;  1ZR2 A;  3O8G A;  1K78 A;  3GO5 A;  1Z0X A;  3FK7 A;  4XOT A;  4M71 A;  2DOE A;  3GW2 A;  3ZQI A;  5BPI A;  4PFO A;  2ZJP F;  3FMS A;  3JRE A;  4OIO F;  4I01 A;  3FXJ A;  4Z2Y A;  2FOW A;  1A36 A;  2NYX A;  3E1S A;  3T8T A;  1CQT A;  2R4G A;  3TOA A;  2JA2 A;  2G7H A;  3P5J A;  1ZGW A;  1I6H J;  2XVC A;  1U0J A;  3BPV A;  5K7H A;  5EG0 A;  3BJ6 A;  5KHD A;  3GEZ A;  1ON2 A;  2XAS A;  4M3D A;  2HTJ A;  2W4S A;  2HDD A;  4UHT A;  1ZLJ A;  3J80 Z;  2MLK A;  4CSW A;  1YFH A;  1YOV B;  4E7L A;  3CCU I;  2IVM A;  1FC3 A;  3RQ4 A;  3SYT A;  1XDS A;  2FQ4 A;  2OC6 A;  2ESN A;  4U0Y A;  1V54 H;  2GLO A;  2DMN A;  2QSH X;  3E5X A;  4ENM A;  3ZMS A;  2GXA A;  4ENJ A;  1V5E A;  3OIO A;  1UAA A;  2AXL A;  4A3M J;  1Z3X A;  3HOY J;  4PDK A;  4EVI A;  3CF5 F;  4M9X A;  2EV0 A;  2KT0 A;  2EZK A;  1Z77 A;  2KIS A;  1XSX A;  2K9L A;  3BQY A;  3CUQ A;  3BP8 A;  3D5L A;  2QSG X;  1TWF J;  2HKO A;  1AHD P;  4GYI A;  5IOY A;  1QNT A;  3S1M J;  1V4R A;  3ABT A;  2YR2 A;  4BE1 A;  4J01 A;  1FNN A;  3WGG A; 
#chains in the Genus database with same CATH homology
 3LSK A;  3LSM A;  4FAS D;  2KPM A;  2Z1D A;  2W82 A;  2HQA A;  2R7U A;  3ZCO A;  3DKX A;  1LKX A;  5HVQ C;  4IQ4 A;  1N75 A;  5LFA A;  3OMY A;  2PJR A;  2L7K A;  3I9V 2;  3SEZ A;  4C9Y A;  3H9J A;  2AQE A;  3OYN A;  2IS6 A;  1D1C A;  2VPL A;  2CV2 A;  3I3L A;  4Y4R A;  4D9J A;  4ZDP A;  5HNH A;  2OV7 A;  1BR1 A;  1KON A;  4E7K A;  2LH9 A;  4CCO A;  2Z16 A;  2CMP A;  2LY1 A;  2X1C A;  4XQF A;  4R79 A;  2LG4 A;  2M4K A;  3EUH C;  4HEA 2;  1VZ0 A;  2HVR A;  4XKC A;  2W00 A;  3OYA A;  1W36 C;  4F93 B;  1X1A A;  1Z21 A;  2W1O A;  3DU6 A;  3IUO A;  2LOO A;  3L2Q A;  3LL7 A;  3K4N A;  1DGR M;  3OR2 C;  4XNF A;  2DCE A;  3BCA A;  2VIX A;  3L2W A;  1P9Q C;  2X1E A;  4BDZ A;  1ZEL A;  1QHH D;  3VYS B;  1WFX A;  1OR7 C;  3GBG A;  1SAU A;  1HA8 A;  1MMD A;  3ZR8 X;  3H5R A;  1EA3 A;  3VWB A;  4C2U A;  3CJR B;  3BC8 A;  3RPU D;  4B43 A;  1Y6I A;  2F4I A;  2XSJ C;  3BG7 A;  3K10 A;  3OYG A;  2VQH A;  4LG3 A;  3G2B A;  4IKF A;  4KT6 A;  4BEH B;  2VB6 A;  4F52 A;  1UG0 A;  4KJZ A;  2V9K A;  4BGD A;  3QYE A;  1G59 A;  4RM3 A;  4HSR A;  3OS1 A;  3QOE A;  2IGN A;  2IS4 A;  4ANJ A;  4P1W A;  1MMN A;  3K4C A;  2HDW A;  2Y0S A;  2HPM A;  3PNY A;  2HVQ A;  2E1M B;  1W36 D;  2DT6 A;  3RCO A;  2R7O A;  3DEE A;  4XN3 A;  3OL3 A;  3J7A Y;  1NG6 A;  3FKJ A;  4XOR A;  1V5G A;  2RRE A;  2A6T A;  1LDK B;  3KX2 A;  3HUG B;  4OAY A;  2VL8 A;  3IP4 B;  4ZTJ A;  3H9G A;  2O5R A;  3IAS 2;  1D1A A;  2ZSI B;  3H5N A;  2R7T A;  2HVS A;  1X19 A;  2DJI A;  2KLO A;  4XL9 A;  4ZC3 A;  2BOL A;  2VQL A;  4B3X A;  3LSG A;  2HNH A;  2VAS A;  2IGK A;  4FET A;  3DTI A;  2M7A A;  2R7S A;  2E5Z A;  3EUA A;  3K4K A;  4YEJ A;  1WJD A;  5HNF A;  4BE0 A;  1WJC A;  4NNJ A;  1QHG A;  2ZSH B;  1FMW A;  2IGO A;  3K4J A;  1WJA A;  2JSP A;  2LY2 A;  2Z2S B;  1MND A;  2XC7 A;  3E0J B;  4HNT A;  4F91 B;  3EPZ A;  3DPU A;  4NQW B;  2KQR A;  4CCM A;  2M3A A;  2E5N A;  4BQN A;  2UUZ A;  3AKZ A;  4AVZ A;  2ELJ A;  1YX3 A;  2PJR B;  4G6T B;  1E0E A;  3L2R A;  3A4C A;  4E7H A;  2X1D A;  4C30 A;  1UEL B;  1NG7 A;  2BW3 A;  4PK4 A;  2WA0 A;  3DTK A;  4CCN A;  3L2V A;  2XAU A;  1LFP A;  2VJ4 A;  3OL4 A;  4MLO A;  2F5V A;  4XKV A;  1T95 A;  3TL4 X;  4PFP A;  3H9Q A;  2VKH A;  4HPQ A;  3W2V A;  3FBN B;  2X85 A;  3OYD A;  2FUG 2;  2CS3 A;  4CA0 A;  3S3N A;  2DXI A;  1PYV A;  2WAQ A;  3W3C A;  2WY8 Q;  2JVG A;  3HG9 A;  2M4G A;  3K70 C;  2R7R A;  1WJE A;  5LD2 C;  3LFU A;  4E7J A;  1TT0 A;  4BAC A;  2R7X A;  2MAB A;  2HPI A;  4CUG A;  3UR3 C;  4E6K G;  4HNU A;  4XKB A;  3TBI A;  4CH7 A;  3D5R C;  4X0G A;  4XM3 A;  1YX5 A;  4C2T A;  4ZDL A;  4ZYA A;  3NWT A;  1PJR A;  3H5A A;  3HKZ A;  2IXS A;  1V5F A;  1Z3Y A;  4XR6 A;  1DP3 A;  1TZL A;  2E60 A;  4XLF A;  3PJR A;  1MMG A;  3D5S C;  3HXL A;  4U7B A;  3CJQ B;  3NWS A;  4Y3O A;  4DBR A;  1JI8 A;  4LIT A;  1K6Y A;  4DGW B;  5KNL A;  4IQJ A;  4F92 B;  4EAT A;  2X51 A;  1AA7 A;  4B44 A;  2NOJ B;  3VYR B;  3OYE A;  2VJ5 A;  4N4N B;  4RMN A;  2X6X A;  3DKY A;  3OR1 C;  3PUB A;  2CV1 A;  4ZDO A;  4BS9 A;  4RM2 A;  1J09 A;  3CZ6 A;  4XKW A;  1D0X A;  4XLC A;  2ZXH A;  2JUG A;  4PUS A;  3DU5 A;  5HOO A;  2KHM A;  3K70 D;  2L5Q A;  3OYL A;  3S3M A;  1YE9 A;  2VJI A;  4PJN A;  2LBF B;  2UWM A;  2VXZ A;  4BQQ A;  2VQC A;  2CFO A;  4BJT A;  4CCL A;  2CH0 A;  3M8J A;  4LIU A;  4YRV A;  2AQF A;  5JHF A;  2I8D A;  1X1D A;  4E7Z A;  4RLF A;  2V6E A;  3MKY B;  4BJ5 C;  4AYB A;  4BJ6 C;  2M7B A;  2Q1Z B;  3QYB A;  2DT7 B;  2V26 A;  2P0W A;  1BR2 A;  4BEH A;  3HL2 A;  4Y33 A;  3OWT A;  2IGM A;  4BL0 B;  3HOT A;  3OS0 A;  5CKT A;  4XMY A;  3SZG A;  2WB1 A;  4NUB A;  2CW8 A;  2UV1 A;  4IX7 A;  3RTR A;  2CUZ A;  5HLT A;  3DLA A;  3OY9 A;  3N05 A;  2KMU A;  3VSK A;  3CMM A;  3QYF A;  2V1N A;  2WY7 Q;  3A1Y A;  1MMA A;  2HU9 A;  4F3Q A;  3BG6 A;  3RSN A;  4PSX A;  1DQU A;  3U21 A;  2CUJ A;  2WAF A;  3DTE A;  1X1B A;  3SDB A;  2KDO A;  3DQV C;  2L9N A;  1R6R A;  2VKD A;  2MD0 A;  3H0D A;  2VJJ A;  2WBM A;  2R7W A;  1LVK A;  2K5C A;  4IZZ A;  2ZFU A;  3OYC A;  1WJF A;  3HPH A;  1SFK A;  2R7Q A;  2OUM A;  2KL4 A;  4QPO A;  4B48 A;  3PNV A;  4BUP A;  4DIQ A;  3OYB A;  2L9S A;  3VYU B;  1D0Z A;  4XN0 A;  4BXF A;  4F55 A;  4LIV A;  2IS2 A;  5FRM A;  2XDV A;  4PJJ A;  3PFY A;  4E4H A;  4XLA A;  2Q2E B;  1Y56 A;  3UNG C;  2R7V A;  3OOU A;  3FHN A;  1BOB A;  3MKZ A;  3PNT A;  3M1C A;  2KZV A;  3HPG A;  2M0M A;  3SEQ A;  4BQO A;  4XON A;  2KRH A;  2LYC A;  3AFH A;  4U87 A;  3K4M A;  1X4P A;  1WJB A;  4II2 A;  5CPR B;  3DPT A;  4GRI A;  1N78 A;  5KCM A;  2RNG A;  1DGW Y;  2X6W A;  1S9H A;  2L2O A;  3PSI A;  3FBI B;  4CZC A;  1N77 A;  2CV0 A;  3BCB A;  4OAZ A;  3OYF A;  4XOP A;  3QOD A;  3F9K A;  4QPQ A;  2PMZ A;  4HRI A;  2CW7 A;  2VXD A;  3EUK L;  3OIQ A;  4KIT B;  3A2K A;  4NC8 A;  4D1Q A;  4HG2 A;  2A5W A;  5FRO A;  3K4L A;  3ZQQ A;  3IAM 2;  3H35 A;  4E7S A;  2GOX B;  3OIP A;  4KIS A;  3ZGK A;  2DOA A;  3PL8 A;  2JVH A;  3AL0 C;  4YEL A;  3LSI A;  1OLT A;  2KP6 A;  1G8X A;  3L2U A;  4JQF A;  5CQG A;  4AU7 A;  4XLH A;  3CES A;  4ITV A;  4J00 A;  4E7I A;  3CP2 A;  4DOZ A;  3MKW B;  2VLA A;  2K3P A;  4CCJ A;  4CCK A;  1ERD A;  3CP8 A;  4N4O B;  4JOM A;  5FRN A;  3MMY B;  1MW7 A;  1D0Y A;  3DPL C;  3LMM A;  2IS1 A;  2XF5 A;  2LRE A;  4DBQ A;  1T0F C;  3HOS A;  3OYH A;  3BLY A;  3S32 A;  3ZRG A;  4XOT A;  2WAE A;  3LSH A;  1IRX A;  2XF7 A;  3FDY A;  5CQE A;  4PFO A;  3KEY A;  5TGT A;  2GOM A;  3OYK A;  4II3 A;  2MFZ A;  3S8P A;  3OS2 A;  3K6G A;  4ZTF A;  3E1S A;  4PJM A;  2LBF A;  3S3O A;  2R4G A;  3PSF A;  2JA2 A;  3VYT B;  3HC7 A;  2QKM B;  2RQQ A;  1U0J A;  4BU2 A;  3VDX A;  2W7N A;  1MNE A;  2ZXI A;  4NC7 A;  2LRD A;  4BDY A;  2K9M A;  5KHD A;  2KRC A;  3ONQ A;  2W4S A;  3S93 A;  3V42 A;  4H4K C;  2V7F A;  1D1B A;  1FMV A;  3DWL E;  2WAD A;  4P5O A;  3TMO A;  4CSW A;  4B47 A;  2F6C A;  4PJL A;  3OYM A;  3KYL A;  3ZXS A;  4E7L A;  3RQ4 A;  4HST A;  2BW3 B;  3SYT A;  3W2W A;  2MYS A;  2OC6 A;  1GLN A;  1X1C A;  2V4J C;  3CF2 A;  4DJA A;  1BR4 A;  4XLE A;  3AL0 B;  1WJ5 A;  2XF6 A;  3W2A A;  2VQG A;  4ZJZ A;  1V5E A;  1UAA A;  2BVL A;  4OWR B;  1Z3X A;  3K4B A;  2X6Y A;  1Z7L A;  2QKL B;  3C2G A;  2MC4 A;  4PSW A;  1X4O A;  1QU3 A;  3C2H A;  3OYI A;  2HZD A;  4BE2 A;  3MD2 A;  2K9L A;  3OYJ A;  3VSL A;  3D5L A;  2BVM A;  4BE1 A;  2LC2 A;  2E1M C;  4J01 A;  4RLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...