3I55I

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3i55I00
1VQ9I 1QA6A 4UY8I 3G71I 4IO9F 2OTLI 3CCRI 4IOCF 1YJNI 5DM7F 3DLLF 1YITI 2K3FA 5GAEJ 3CCEI 3PIOF 3CC4I 1VQPI 3G4SI 2E36A 5GADJ 1VQ6I 3CC7I 3CF5F 1ACIA 3PIPF 2H8WA 3CCJI 2FOWA 3CJTB 1YIJI 1VQLI 1VQOI 1VQKI 3CCSI 2ZJRF 5DM6F 1Y39A 3CCLI 2NXNB 2ZJPF 1VQ8I 1MMSA 3CCQI 1FOXA 1YJ9I 3CD6I 3J7ZI 4IOAF 1HC8A 2JQ7A 3I56I 3CCMI 3J7YJ 1VQ7I 1S72I 1VQ4I 5GAHJ 1FOWA 2E35A 3CC2I 1FOYA 4V19K 3G6EI 5JVGF 1YHQI 3CMEI 1YI2I 5GAGJ 1VQMI 3I55I 2QA4I 1YJWI 1VQ5I 2E34A 3CCVI 3CMAI 2OTJI 2ZJQF 3CCUI 2QEXI 1VQNI
chains in the Genus database with same CATH superfamily
1YIOA 2GLOA 2FBIA 1Z1DA 5LLQA 2JK3A 1GXQA 1VQ9I 3W6VA 4P9FA 4WXHA 4MTDA 3E3VA 3S1RJ 3S15J 2EZIA 1S7OA 2X6XA 4N9HA 3F8FA 3WTTC 2VXZA 5KK1A 1K6OA 4MFDA 2CFOA 5CPRB 1SEUA 3R6SA 2DO7A 2OTLI 1A31A 3TOAA 2DPUA 1TT0A 4F93B 3OYDA 2D1VA 3F8BA 3S8PA 2PN6A 2R7SA 3CUQB 4I99C 2K3FA 4Y15A 2MBFA 1YS6A 1HW2A 2R7TA 1VFCA 1ON1A 4XNFA 4LMYA 2XAUA 5H6QA 1LKXA 2ID3A 4S05A 1L0OC 3S2WA 1OYIA 3OYIA 3WTXC 3QAHA 4DZJA 4NNJA 3KX2A 3IRRA 4UB8C 4C9YA 1HBXG 1BI2A 2K27A 2MC4A 3D1NI 2GM4A 4ENKA 1VQOI 2PG4A 3I5UA 4KN7X 4LGWA 4FTHA 2TDXA 2R5YB 2ZJRF 4HAMA 4CYDA 4ZYGA 2EQRA 3ZN0A 1QU3A 1FPQA 2K9LA 2L4MA 5FD5A 3KCCA 2AQEA 5J1RA 3N4MA 1LPQA 5M5XJ 2ZSIB 1SMTA 2NS0A 4KIFA 1H9GA 4L0ZB 1E17A 3AG4H 2XROA 3QP6A 2G7HA 3I56I 1QGPA 4ITVA 4RAYA 3BTIA 2DA1A 2QVOA 3CQZJ 3I71A 1E3OC 1REPC 3L00A 1R5ID 3GTOJ 2CQKA 2XGXA 1TTYA 3HUGA 4A3LJ 1F43A 3IH4A 4XSXF 3VWBA 2WWYA 3ISPA 3F23A 1XG1A 2DK5A 4E7IA 1ZELA 2OPTA 2VC1A 3PJRA 4AUXA 3T0YA 3R60A 2EIMH 5B3SH 5AONA 1CF7A 2LF8A 4JX5A 1XSXA 1WHUA 2F2EA 2K9NA 4A3JJ 4H0EA 3E6DA 3ZMTA 1JT0A 3K2AA 5ICGA 4QLCU 3HPHA 3PNYA 3TO6A 4MHGA 5BS6A 1BIBA 2NAZA 3DU6A 4FX0A 1X3UA 1IF1A 2QSFX 5F64A 3CCUI 3GZ5A 3HPGA 1OPCA 4CCOA 3ULQB 2HVRA 2LBFB 5TISC 5J3LA 3HKZN 1NG7A 3KFWX 2P81A 1LFPA 2DJIA 4EJVA 4U7BA 1F5TA 2ZMEC 2QZ8A 1GHCA 1B6AA 3GLLA 4UUSB 1V4RA 5L3BA 5JI6A 3MZ8A 3S14J 1YRNA 4LB6B 1WFXA 4KMUX 2NVQJ 3OOPA 1ZK8A 3K6GA 4OIOF 1TQPA 2E1CA 4YIFA 4EEFG 1P6RA 2W48A 3RKQA 3G4SI 4HQEA 3WHBA 4KIBA 3DQVC 1ZRFA 3BC8A 3OYMA 1D5YA 3VSLA 1FIAA 4D5FA 1JUMA 4PFPA 3QYFA 2LREA 3S93A 4A0XA 3PIPF 4R8HA 4I76A 1XN7A 3H9QA 3P9CA 4RB3C 3ZR8X 1T95A 4I01A 3Q9SA 1QZYA 4D9JA 4B4CA 2DMPA 2LFBA 2X51A 2Y48A 1D3YA 2ZCWA 3D5LA 2GXBA 3E7LA 3Q0WA 4D5CA 3SEZA 2VN2A 9ANTA 4HBLA 2R3SA 1FX7A 1U0JA 2W00A 2HVQA 2F48A 4DYCA 3CO7C 1WQ2A 1BN5A 2F4IA 1R23A 2CQ7A 2OJED 3N05A 2KKOA 3IKTA 3IP4B 4OMZA 1LB2A 3LSKA 4O6JA 1HDPA 1YO5C 1FOKA 2R7FA 4BY1J 1FOWA 2QWWA 2CQQA 1J2XA 4ZYAA 2QCOA 1MDMA 3N97A 2XAQA 2LC2A 2GBYA 1HLVA 5J4VA 2AXTC 3DPUA 4MFEA 2LDUA 3JSPA 1TC3C 1YI2I 4EM1A 2LMDA 3O2PE 2L9SA 3DLAA 4D1QA 3MN2A 2STTA 2MABA 1XGSA 4C2UA 4M73A 2LD5A 1RUNA 3ZMSA 1OCZH 2DA7A 2CWEA 3S17J 4DBRA 4CCLA 2R93J 4XN0A 5K5QA 2HPMA 2LKXA 2OUMA 2XASA 4HNUA 1SAXA 4HV6A 3GBGA 2HQNA 2DN0A 4AIKA 1MBJA 1TWHJ 2NOGA 1WKMA 4DNCA 2JSCA 2DK8A 2VASA 3FK7A 2DW4A 2H6BA 5DUIA 4EATA 1YW8A 2H27A 2IS1A 3C2GA 3WG9A 4RGRA 3PQJA 1GXPA 5LHGA 2Z33A 5DUKA 1Z7UA 5FKNA 1MNMC 1AWCA 3I4PA 4CSWA 1U8RA 2K3PA 1IG7A 1B59A 3CUOA 3K1PA 1YJNI 3HL2A 4ESBA 1QQIA 1ZLKA 2FEZA 4OU0A 3PIOF 3HOVJ 3GTQJ 1SVMA 1V5FA 1T33A 2NYXA 1S6LA 1JT6A 4NHJA 4PGGA 3KP5A 1D5VA 2XAJA 1X1CA 2VQHA 1IDYA 5HLTA 4UNOA 1WCMJ 4NBQA 1I6HJ 3S2DJ 5L3CA 3U1DA 2H8WA 1TWCJ 3E6BA 3MFKA 4NC6A 2DAOA 3MD2A 2FE3A 3CF2A 3IL2A 2HR3A 1U6GA 1WJDA 2VBZA 4IHTA 2PMUA 3KETA 1YLFA 1BJAA 4EGYA 2COBA 3FMSA 3HHHA 1AKHB 2BVLA 2DOEA 4LD5A 3ABUA 1BC8C 2Y9YA 5ILVA 3J80Z 3W2WA 2GA1A 4UUVA 4EVIA 3KEQA 5DTDA 5HLGA 2H6CA 3BP8A 2PMZA 3K70C 1J5YA 5EG0B 4G6QA 4Y4RA 1A6IA 2JA5J 3HOZJ 2A6EF 1U9OA 1H8AC 4EV0A 1WZ2A 1W5TA 1OQYA 1TBXA 4L9NA 1LNWA 1VQ4I 1VTNC 2N8GA 3F8CA 4IRGA 3BTJA 3J7AO 2E71A 3WTZA 2GXAA 3DBHB 2FF4A 2RAEA 3CMEI 2XB0X 3RIRA 3K4KA 1P4XA 1IXRC 2FBHA 3I55I 3H3ZA 2DLLA 2ETHA 1V54H 5BOXA 1LDKB 3CMYA 1YJWI 4E7LA 3FZVA 3JAMZ 2DTRA 5DCFA 4BHBA 3JSOA 3ZMVA 5HNHA 1ETXA 5ICEA 2OBPA 2V26A 5F0CA 5J4YA 1WH7A 3ZRGA 4XOTA 3OSFA 2E2IJ 1A6QA 5FJ8J 1SD7A 2WTEA 3ZXSA 4EGZA 4IHSA 1R6RA 2WB1A 3S3NA 1OYWA 5B1AH 4O5VA 4N4NB 3GWZA 5CVVA 5EGOB 2B63J 4B09A 3U9GA 1T08B 6PAXA 4KFCA 4RAFA 1Y56A 4FHTA 5KCMA 3SZPA 5D5UB 4BAYA 1G8XA 3DV8A 3CC4I 2FSWA 2RKHA 3H92A 2Z16A 1YW7A 2CV1A 4BJTA 3FISA 4XLPF 1I1SA 2B7EA 1K4SA 1D8JA 4XLHA 3HOSA 1ETVA 2E1MC 1IAWA 2L7ZA 3LQQA 2MGQA 2Y0SN 3EUHA 1RKTA 3RJPA 2CO5A 3SFIA 1N77A 2QKMB 4YFXF 1DGWY 4RM3A 3OMYA 1YW9A 1XX5A 1YIJI 1RPWA 3CP8A 2CV0A 3SJMA 4ZZLA 1W7PA 3FMQA 5FLMJ 2K9QA 1K4TA 2IVMA 1IN7A 1ENHA 2EZKA 5E3NA 3CLOA 3BG6A 2FUG2 3LA7A 3QPSA 4RGXA 1Y8RB 1PUFA 1QHGA 1OISA 3FM5A 4CZZA 3W6JB 4B44A 5LGUA 3NAUA 2HNHA 1H89C 3TW6A 1HSJA 5E8GA 4IOAF 4HYEA 1MJBA 1G6NA 2Y69H 5HODA 4QSHA 1SVLA 3MCZA 1WRJA 1BOBA 2EA2A 5HLIA 3SQNA 2P7CB 4GDFA 1S72I 2M0MA 5DYMA 3I54A 3H5AA 4RLFA 3G1MA 1E3PA 1P4AA 2WY8Q 3M8JA 5B1BH 4CGZA 2IS6A 4B3XA 1YOVB 1LVAA 2WV1A 2IJLA 2CW7A 2KLOA 2KRFA 2HQRA 2LYCA 2X9DA 5IT3A 2CUJA 2P4WA 4LIVA 3ZPLA 2EK5A 5F0HA 4FT8A 2YPRA 2EH3A 1UHMA 4A3MJ 4QPOA 2D45A 2UZKA 3MEXA 2BHYA 2NS8A 2ZXHA 1RKWA 3AL0C 3OR2C 5L3FA 1W0TA 4HLYA 1I6XA 4LG3A 2YX4A 1TWAJ 5CVRA 1ZR2A 4MQVA 1FSEA 4BQOA 3VYSB 1IN8A 4PJLA 3K69A 3OL4A 3IRQA 2EV0A 2GOMA 1Z21A 2FRHA 2UUZA 2QGUA 2M34A 4CCNA 3GZ6A 2M7AA 1GVJA 1XPXA 1ETOA 4BQQA 3FBIB 5D4RA 4WCGA 3KYLA 1BOAA 1GV5A 1X3WB 2VJJA 5JFRA 3A01B 3H5NA 1N78A 4A2UA 4BEHB 2F5VA 2VIXA 5BQTA 1TL8A 1GUUA 2COMA 4KN4X 4E7KA 2EB7A 3H0GJ 3ZQGA 4E70A 1FJLA 2QF7A 3QYBA 2B0LA 2WAFA 1XD7A 3ZP5A 3QPTA 1B1BA 2M5WA 2O8XA 1VQ6I 4M72A 3W2AA 3KP3A 2RQPA 4JQFA 3TDUC 2HI3A 3GUDA 4A3IJ 5E1WA 5FLXZ 4FE4A 5EZGA 1G3TA 3BR6A 1LFUP 3WTUC 3NARA 4AWXB 4DYQA 1YS7A 3V8KA 2F4OB 1DP3A 3VYUB 1Y39A 3CCLI 2ZFWA 3BJOA 3FWEA 1SANA 3IKVA 4HX4A 5FKOA 2IGMA 1U2WA 2BVMA 2JUCA 3T8RA 1XGNA 4HX7A 2HU9A 2LRDA 2CQNA 2VKDA 3LL7A 3RTRA 3H1CA 2Z99A 3E6MA 3IAM2 5HOOA 1K61A 3BZKA 3QU6A 4BACA 2EFPA 1RETA 4UHTA 2GA2A 3DF8A 1RZ4A 3IV5A 3S3OA 1J7KA 2NVTJ 4EJOA 1USTA 3HHGA 1UZCA 5B5EC 1OJLA 3L2VA 1XB4A 4BBSJ 4BQAA 3RDIA 2DT5A 4OIQF 1WJCA 4PK4A 5CVJA 4B43A 2DMTA 3CMMA 3LSHA 1MBHA 1OLTA 1V5EA 3VSKA 2R0QC 3ABMH 4GCVA 3G6EI 2HKOA 4BE2A 5GPAA 4XBFA 1X4PA 2E60A 3OYEA 2RN7A 3CLQA 3RYPA 3M1EA 2KIUA 5J6XA 1R4NB 3A2KA 1Z3YA 4PSWA 4W97A 3A0HC 5ERIA 2VODA 1U3EM 4E7HA 3JCUC 4HNTA 2DA4A 3R0JA 5HDNA 2MG4A 2EA4A 1TW3A 3CP2A 2CRGA 2IAIA 2TRTA 3EUAA 5K7FA 1R00A 2HOSA 4IHWA 5IT9Z 2CSOA 3RPUD 2VT3A 3S1NJ 2JPBA 4KIGA 3BR3A 2DMNA 3O8HA 4JP0A 3OV8A 5FFXA 2P6TA 1APLC 2E1OA 2M87A 2QM3A 2W1OA 4MNUA 3PFIA 3BTLA 4RM2A 2OAZA 1UCRA 1UAAA 4XRSA 1BW5A 3HB9A 3S2HJ 3A02A 4ENNA 4ZC3A 3WE3A 4JBAA 2HTSA 2ADUA 1S5LC 3K1MA 3BWGA 3QOEA 3KEOA 5KVRA 3DLLF 3I4NJ 4G7ZF 2UV1A 2XKOA 3ECOA 2QUFA 3MKLA 4BXFA 4LG0B 3AKZA 1MJ9A 3FDYA 1DU0A 1P7JA 2VXDA 1YE9A 3IAS2 4IKFA 1MIJA 1ACIA 4HZFA 1EH8A 3AFHA 4PCQA 2OA4A 2E7WA 4IVNA 4C2TA 1QVUA 1U5TB 4CHUA 2L9NA 4XLNF 2A5WA 3MWMA 3GFIA 3D5SC 4UV8A 3GYHX 1ZGJA 5CKTA 3E5XA 1OCCH 3MAJA 3CCSI 2OQRA 1VZ0A 3BPVA 1R1UA 2HZTA 2NXNB 3TDZC 5LRRA 3P7NA 4NB5A 4HNVA 1MMSA 4YELA 3GTMJ 3ZCOA 1LDDA 4FX4A 1O3SA 1P4WA 2KP6A 4PFOA 3HBLA 3KYCB 2R7RA 2R7WA 3BOQA 5CYVA 2KJBA 5E3MA 1MJAA 4M6XA 4EJTA 1BIAA 2ESHA 3CJQB 1UG0A 4NUBA 3DKYA 2Q2EA 2W84A 4KISA 2P7VB 4I0BA 1EF4A 3EUHC 2M4GA 3SDGA 2KDOA 1ZQ3P 3KZIC 4S04A 1X1PA 1V55H 5JVGF 5E18F 2WA0A 5L3DA 3KZYA 4E7JA 5IP9J 1R9TJ 2V9KA 2EV5A 4BU2A 2KIQA 2QA4I 2IT0A 3M4OJ 5GPCA 1JI8A 1B72A 3UNGC 4ZTFA 1H0MA 2CYYA 2KRHA 3G1OA 1B9MA 4AIHA 4XRMA 1W36C 1MMGA 3HIFA 3M9AA 4EJWA 1P7IA 3HSEA 2QEXI 5ILUA 2EFQA 2MD0A 4BH9A 4C3JJ 2RQQA 1ONVA 1AU7A 3JRIA 2FOKA 1T38A 3HJEA 2O5RA 1X1DA 1XGMA 3DTEA 4JOMA 1P9QC 2V4JC 3GTLJ 2W57A 2P5VA 3PO3J 3R61A 5DS9A 5FFZA 1BI3A 3FXJA 4HV5A 3TOBA 5KAFC 5BPIA 1TZLA 1DUXC 2L9RA 1ORKA 4Y7NJ 2W24A 5DD4A 2JUGA 1Z77A 3F9KA 2PMZN 3QQAA 1K78B 3W2VA 2UXNA 2BW3A 2XSJC 4L5IA 1G59A 3GTKJ 5J47A 4A69C 2KL4A 4AC0A 3BT9A 5HS7A 3ERED 1DU6A 3MKYB 3LQRA 1R71A 1JUPA 1QZEA 2XUBA 5CJ9A 2VUMJ 2VL8A 4M3GA 2K86A 1TNSA 1C0WA 2L01A 1ZAOA 4I09A 2O7OA 3CESA 5EEGA 1MBGA 3DWLE 1VQKI 3GW2A 3V42A 3L2UA 5LHIA 2LF7A 5DM6F 1Q1HA 1W5CC 1WJFA 1X2MA 2IGNA 2DA2A 3CUQA 5FROA 2OC6A 5IOZA 3VYTB 1U8BA 2XGDA 2ME6A 4XIDA 4A3EJ 2KQRA 3CCQI 4AM3A 2DYRH 3L2CA 1JKQC 3BPXA 3NQOA 4YEJA 2AS5F 5TGTA 1DPUA 2A6HF 3TW7A 3MZHA 1YX3A 4FQGA 4XR6A 3K4MA 5M5WJ 3OSGA 3Q9VA 2WB1N 3LSJA 2ISZA 1BC7C 5GAHJ 2H1LA 1EH7A 1R5GA 5CVIA 2R5YA 3F0CA 2A6TA 3TEDA 1HXDA 1STZA 3ZQCA 2KPMA 3WTWC 2VBWA 3L2RA 1J0RA 1HOMA 1KYZA 4I6ZA 2CH0A 1UG2A 3U21A 4JX6A 3FKJA 3HOWJ 1OCRH 2ELJA 1QPIA 1JKPC 4ENMA 5J1YA 2RDPA 3LNQA 2ZO4A 1NK3P 1OR7A 2EFWA 2WAEA 1T2KA 2L54A 2OZUA 2E19A 3I59B 4HEA2 4ZTJA 1IO2A 2MYSA 3BY6A 4ZDPA 4O3MA 2G7UA 4CH7A 1WGXA 4AD9A 3IUOA 1UHSA 2F6CA 4BQNA 2A5YB 4EMSA 2HDDA 2LSOA 1FLIA 5HS8A 2VBXA 1BJZA 2X6OA 2H09A 2PX9A 5F08A 3BG5A 3E5QA 4BHCA 3M8FA 3FXQA 4J01A 1ZN2A 4IF4A 1LE8B 1ZHFA 1T56A 3HRSA 4A0YA 2VLAA 4Y17A 3SYTA 4BDZA 3KEYA 4RA2A 2FBKA 2LNBA 2R7ZJ 1TNTA 3JTHA 2I10A 2LBFA 5HLHA 1FBUA 4Q5SF 5GADJ 2R5ZB 3CF5F 2VKHA 2V6EA 5C44J 4ESFA 2L02A 3OIQA 5ILSA 1JTXA 2JVGA 2JTVA 5LEKA 3FXLA 4UUSA 1H88C 3V7RA 3D5RC 3H9JA 2VOOA 1ZG3A 2NVXJ 3HOXJ 3T1BA 4ZYEA 2FNPA 4LITA 2LKSA 2HEOA 5DCMB 4F91B 4YRVA 1X1BA 2BBYA 1HKTA 3RQ4A 5FKMA 3ECHA 3Q5FA 1IUFA 3DTIA 1FYMA 2DOFA 2FX0A 2CW0F 1OCTC 4BJ6C 1IC8A 5JR3A 4K2EA 1U78A 2R7DA 2LY1A 2ICWG 4G8XA 5IPAA 3JW4A 3OYKA 2KFDA 2F5FA 1SFOJ 2BHZA 1IV8A 2HOAA 2OF7A 1J59A 2W85A 4HDVA 3CDHA 2PEXA 1USSA 1VQ7I 2M8GX 4WWCA 2LTPA 2V7FA 5A2QZ 2YSRA 4XKVA 3FIWA 1LEAA 5FLVA 5EYRA 3WTYC 2E35A 4KMFA 3WHCA 5D6EA 1OCPA 2VJ4A 4RB1A 2EWNA 3F8NA 4CICA 3J81K 2E2JJ 2XRLA 4CA0A 2HDWA 2P0WA 4BUPA 1Z0XA 1K6YA 5L3GA 4PGHA 4Y52J 1SD6A 3ZQQA 1KZHA 3CJRB 4U0YA 2AO9A 1B8IB 5CLSA 2K5CA 3IWFA 1O7FA 2E34A 1FP1D 5K7HA 1SD5A 1IV6A 1ITYA 2QENA 1YQAA 5HDKA 1ZKGA 3ZQFA 3FK6A 1XS9A 2F4MB 3BR2A 5K5RA 4P9UA 1DPRA 1E3HA 4B8XA 1IN5A 5FD6A 3V8LA 2LH9A 2P8TA 1G3WA 4IXAA 3K7AJ 5HNFA 3JRCA 2X1CA 2HKXA 3AG2H 1ZREA 1QA6A 3KIOA 4M6YA 2W25A 4CYCB 4LOCA 4KNYA 4S0HB 2VOPA 3WGGA 4N4OB 2JWTA 3H36A 3HOUJ 4IRIA 1MKMA 4G94A 3F6OA 3OS1A 2DFFA 4E7ZA 4PDKA 4ZH4F 2QKLB 4KITB 1NH3A 4BJ5C 1WJEA 3BCAA 4NQWB 1D1AA 2QBYB 1QVTA 1TWGJ 5KNLA 3CZ6A 2I8DA 5HS9A 3JTGA 1UHWA 2IGKA 5DV5A 2H8RA 5FKLA 3RPQA 4WK8F 3FKIJ 2I5UA 2Y0MA 4OMYA 2XAHA 2ZMEB 3OYBA 2XVCA 3PNVA 2NNYA 1VQLI 2XF6A 3F6VA 3GZNB 1IRGA 3U2RA 4RB2C 2PJRB 2KDZA 2VBYA 3DFGA 4HF1A 2L5QA 2ZKZA 5D4SA 1HSTA 4HF0A 1PDNC 1KU2A 4XL9A 1UELB 2H94A 1D1CA 2M30A 2JA8J 2C6YA 2P6SA 1J9IA 3DBLB 2IA2A 1I27A 4I02A 2ELHA 1J75A 5LEJA 3DCFA 4D7MA 2E2HJ 3DP7A 2NVYJ 2YR2A 5JLWA 1MNDA 2K02A 1JHFA 2VQLA 2KHMA 3HDDA 3OR1C 4L18B 3JREA 4HX8A 3H9GA 2KRCA 3IWZA 3GTJJ 1Y0NA 2GAUA 1FZPB 1FEXA 2XIGA 3GFMA 3H5RA 5IP6A 1W5SA 3RYRA 4A3KJ 1JGGA 3WGHA 1ERDA 5DD8A 4V19K 2FXAA 2GZWA 4M3BA 2NNNA 2OCCH 3KP6A 1AKHA 1MBEA 2BZTA 4Y3OA 3J80K 4EJUA 1FT9A 2IP2A 1KONA 1Y1VJ 1VQ5I 1ZH5A 2FJ1A 3CUQC 4LIUA 1DDNA 1EV7A 4LJZF 3RCOA 4LK1F 3VYRB 1ZRDA 2F5CA 1WJBA 1ZGAA 2EINH 3LAJA 2DI3A 3V4GA 2MD5A 2GXGA 5M3MJ 3S3MA 2E7XA 2MW8A 1O4XA 1XGOA 1QPMA 3HGYA 4GGGA 3K0LA 3KPHA 2ZC2A 1I3AA 3K4JA 4XKWA 2JA6J 2KZVA 1G3SA 1F4KA 2V1UA 3K1NA 1FSHA 1FMVA 4JK1X 3ROUA 4UVAA 4H4KC 3C2HA 5EF6A 2GQQA 2L7KA 4XICA 2CUFA 2ELKA 2E5NA 4U87A 4G12A 1AA7A 4E7SA 2EBIA 2VC0A 1V3FA 3S16J 2DT7B 2DFHA 2YS9A 3JAMK 3CCYA 4ABZA 3OYNA 3RQIA 3T5XA 5F1RA 4CDGA 4MEXF 1A04A 4RAZA 4BDYA 3VOEA 1HW5A 2XAFA 3FBNB 5JHUA 5C3EJ 2V1DA 1K83J 2ESNA 3ABLH 3WGIA 1T0FA 4OIPF 3JRDA 2LG4A 5EDNA 3KP7A 4M74A 3HOTA 5LD2C 2ACJA 1RIOH 3RZOJ 1OR7C 2CJJA 2YUSA 1IUYA 2GOXB 1PVEA 2KT0A 1B9NA 4FASD 5H20A 1S7AA 3WU0A 1MSFC 2IS4A 5D6FA 4PJ0C 1R5HA 4RBOA 4XLAA 4A93J 3DXJF 1F1ZA 2L4AA 4I7HA 4G7OF 5EGOA 4GYGA 3MKZA 3COAC 5FO5A 2OU2A 3C7JA 3PSFA 2VE8A 3JR9A 4BKXA 2DFIA 4G7HF 1R7JA 4BS9A 3BR5A 2ZJPF 2ZFUA 4CCJA 3DKWA 5LGTA 1EJ9A 1QO0D 3FXOA 2ZXJA 3B6AA 5C4XJ 4L9JA 3LA3A 2R7XA 1KGSA 2EV6A 4AIJA 5IY5H 1A5JA 4P96A 1MGTA 2V9VA 1SMYF 2JMWA 3D0SA 1MMAA 1Y6IA 3BG7A 1PP8F 5D8KB 4DOZA 2DPDA 4CCMA 1MBKA 2GIZA 2KIFA 2M9HA 2R7OA 3ZMDA 2HS5A 1A35A 1LEBA 3TQNA 5E8IA 2XDVA 1IRFA 4YIRX 5LFAA 1FWZA 1G2HA 2K4BA 4XKBA 3F3XA 5E1ZB 2QSHX 1FTTA 3SEQA 1QBJA 4IQJA 4B1RA 5K1YA 1Z7LA 4X1EA 4OWRB 4RMNA 2XF7A 3EUKL 2LY9A 4ETSA 3BQYA 1JHHA 3HSFA 3SFZA 1FYLA 3QPHA 1TW2A 3ASOH 3SHFA 1BR1A 4BNCA 2DA3A 1NG6A 2MC3A 3GFLA 5D8LB 2IA1A 2TCTA 3NWTA 2X1EA 3FMRA 2DYSH 4ANJA 3F22A 3PNTA 4HW0A 5J40A 2PJPA 5M3FJ 1MZBA 1JKOC 1MBFA 1TT5B 4HQMA 3WU2C 3HZJA 2CU7A 3OS2A 1RUOA 4TV7A 5CQEA 1R1TA 4DJAA 2LR8A 2PMHA 1KU9A 2Z2SB 5HVQC 4IJAA 1OFCX 3U1KA 3BR1A 1YFHA 4WX9A 4U0VA 1R36A 3AG3H 2WV0A 2K9SA 3H35A 4M9XA 4A5NA 3FM3A 4IO9F 4BXUA 4U0WA 1Z9CA 4HF2A 2LK2A 5EZHA 2D2WA 1LVKA 1X19A 3C1DA 2OZ6A 3PM1A 5GTHC 3CCEI 2FU4A 5FRMA 5B66C 3OYFA 1O3RA 3C2BA 3G73A 2IS2A 3DKXA 1SFUA 3GF2A 3RKYA 3RKXA 3PUBA 5IOYA 2DXIA 2E36A 2Q0OA 3CC7I 2IEKA 3QWLA 3MMYB 1TQIA 3K70D 4F55A 3TKYA 3TO7A 1J09A 3V7SA 3PO2J 3V7CA 3JRHA 2K85A 3GFJA 2G0EA 3GEZA 1S29A 2X1DA 2BE5F 4AYBA 4F52A 3QRFF 3EETA 2JRTA 3HUGB 4MO7A 1D0YA 1AHDP 3A01A 3MVPA 2A05A 1UFMA 2GWRA 2D1HA 4BEHA 2ZNZA 3JRGA 1JJ8C 1QNTA 2BV6A 2ZXIA 3H3UA 3TGNA 3K9TA 1NK2P 2WY7Q 1U9NA 2LP0A 1CF7B 1LUJB 5E79C 2Z3YA 1BA5A 5TJJA 3O3KA 1Z67A 1XTAA 3P9IA 2K4JA 4EM2A 3F8MA 2B9SA 4M71A 2JQ7A 2E1MB 2VKVA 1O3TA 4BE0A 3CCMI 1V5GA 5FLXK 1GV2A 2HDCA 4BBRJ 2K9MA 2EPFA 4KICA 1HCRA 2BOLA 3PUFA 3WODF 1SFKA 3BZ6A 3OIOA 4LFUA 3OY9A 2P5LC 4JX4A 1HF0A 3HEFA 3E6CC 4HG2A 4F92B 4ASNA 4M6VA 4V2GA 2LOOA 2RNJA 2ZJ2A 2DTZA 3CC2I 4Y13A 2XKPA 1PYVA 3ZMUA 2E5ZA 2RREA 4BL0B 4QWQA 1G3YA 4XN3A 3TMOA 3FF5A 3ZMZA 4Z2YA 4Z6YA 1YRNB 2R7VA 2WADA 3CCVI 2X85A 2MA3A 3S32A 4RGSA 1I3QJ 3RPUA 1AOYA 3KP2A 3ZGKA 3FXRA 1MH3A 2ZJQF 4KA4A 3EYIA 1XC5A 1P92A 1T6SA 2VJIA 4Q4ZF 3JRFA 3TP0A 4GRIA 5JLXA 4QPQA 4PSXA 2MFZA 4RGUA 1M1EB 4RS8A 4HRIA 5F1JA 4PJJA 3GTGJ 2BY3A 2M2EA 3RKWA 2W82A 1HKSA 1RR7A 4HPQA 1FNNA 4HDUA 3DBRB 3QP5A 3CDIA 2L7FP 2LVSA 1WSUA 2CUZA 2WAQA 3FXUA 2EIKH 4GYIA 4KYWA 2F5DA 4UVBA 3L1PA 1FP2A 4HA8A 4IOCF 1BM9A 4KT5C 4E6KG 3GTPJ 3OYCA 4XONA 2DODA 3A0BC 4LLNA 2K40A 3L09A 3PQKA 5IT9K 4P1WA 2HXIA 4HOBA 5HDGA 1K7AA 3AL0B 1YYVA 2ID6A 1VNDA 3C3WA 2XGCA 2AQFA 1S8NA 1YX5A 2HWVA 4IZZA 3QODA 1HQCA 3BR0A 4DGWB 3K4CA 5IP7J 4KJZA 5AIPA 4U88A 3SXYA 1S7EA 3SZGA 5K7ZA 5KAIC 3ZQ7A 1ZG1A 3MZYA 4XLFA 3I53A 4A3CJ 1LJ9A 3GXOA 1MDMB 1POGA 3GVAA 2AXLA 1VQ8I 5D5XB 1FTZA 3L2WA 5JVTA 3LOCA 2OCEA 4LG0A 3AG1H 1Z6RA 3EYYA 1BW6A 4KUMA 4C2MJ 3DEWA 4ENJA 1FOXA 1ZLJA 4A3DJ 1GVDA 4FISA 2LY2A 4ZYDA 2MH9A 2KIMA 1WH5A 3HOYJ 2MH2A 2XSDC 4AVPA 1U5TA 1PUEE 2NOJB 1ON2A 4BHPA 4XRSG 1VF9A 2V1NA 3ML6A 4OIRF 4XLCA 1T0FC 3O6BB 4AIDA 3P9KA 3GO5A 1D1BA 1MW7A 2V6CA 1T8IA 3KZZA 3E0JB 2Y31A 1ETKA 2YU9J 3ZQIA 2HVSA 4OAYA 4CZCA 5LGNA 5K5OA 4U7DA 1DP7P 5F0FA 1LDJA 4KDPA 1N25A 4ESJA 2X48A 2L0KA 2G9WA 2XRNA 3UR3C 4A5MA 3ZOBA 2BEOA 2E1NA 2KJCA 1N75A 1QHHD 1BI1A 2DQRA 4IPAA 4P55A 3BQZA 2IGOA 4IX7A 3Q0UA 2VKEA 1F9NA 2JN6A 1XMKA 2Y2ZA 1MSEC 3M07A 4MEYF 4MTEA 1MMNA 3FX3A 2Y75A 2DDAA 2YU3A 5LBQA 2BY1A 3EDPA 5IYDJ 2IXSA 3BJ6A 4BYYA 1ZG5A 4HSTA 4NC8A 3G71I 4DBQA 1VI0A 3LAPA 1EH6A 4D7NA 5D5WB 2QQBA 3KP4A 2OV7A 1LFBA 3WE2A 5EEHA 3VFZA 5DM7F 1Y8QB 1YITI 3QYEA 3ESWB 4PUSA 2VE9A 4DYRA 1OKRA 4WF2A 1VQPI 1RESA 1ZTRA 3M8EA 3J81Z 2QLZA 3I64A 1I5ZA 3J7AY 3M7GA 1WVRA 1O7LA 4A3GJ 3I9V2 1D8KA 2UXXA 2MLGA 3BG9A 4IRHA 2Z9OA 3OIPA 1XCVA 1KYWA 2R7UA 3HXLA 4FE7A 2MSYA 3K4NA 4M9SA 1WJAA 1IRZA 1Q1VA 3HTUA 3KLNA 4UV9A 1JGSA 2OD5A 1KA8A 1E2XA 3Q3SA 3QOPA 3ELKA 5AIQA 4YFNF 1FIPA 2L9VA 2QQ9A 4IHYA 4EM0B 1R49A 2L3DA 3LMMA 3JRBA 3EQLF 1PJRA 2LKPA 3B73A 3HRMA 3RZDJ 2CGPA 2HZDA 2EFNA 4I2OA 4M9ZA 2FNAA 3LA2A 1K78A 1JKRC 4N0BA 2BXZA 4G6DA 2ME0A 3HGGA 3CD6I 3G3ZA 3J7ZI 3BCBA 1ETWA 1S3JA 1HC8A 2DU9A 3DPTA 3DPLC 1R4MB 1W0UA 4B47A 4ZYHA 3K4BA 1P2FA 3TBIA 4PJMA 1KQ9A 5ED4A 1JJ6C 2JZYA 1Z05A 5F04A 2HQAA 4PZJA 3HC7A 4A6EA 3I4MJ 3FHNA 1I39A 1G4DA 2OQGA 4R1HA 3X2QH 2JSPA 1FOYA 3HM5A 3VPRA 1R22A 4J00A 2KMUA 5E1XA 4UVCA 1O57A 2Q8KA 2QYOA 5FB2A 1I50J 3BZCA 1Z91A 2MLKA 2O0YA 4BY7J 3LSRA 2BGCA 2FQ4A 3H0DA 4JYKA 1PP7U 3B6CA 2XHKA 4B3AA 2KZGA 5BPDA 1JTYA 1BR4A 2IA0A 3ZN1A 3Q0VA 5FRNA 3I58A 1OCOH 1SVOA 3NWSA 4HLXA 1TQMA 2VI6A 2WBMA 1UB9A 4XKCA 3LSPA 2HFHA 1VQNI 2QSGX 2M45A 1Z6TA 3F72A 4D0PA 1XCBA 3K10A 1T98A 2EIJH 5J8FA 2VJ5A 4II3A 3JRAA 1O3QA 2P5KA 2H1KA 1GLNA 2W4SA 5DDGA 3R0AA 5IYCJ 5H2FC 4UY8I 5D5VB 2M1BA 1F36A 2CFXA 3BDDA 3TP3A 4OAZA 4IEJA 2ZBKA 4IL6C 1W7PB 1FMWA 1WI9A 1WWXA 2R7QA 2M3AA 1RNLA 1E0EA 3CJNA 1TLHB 4L5JA 2CV2A 2EILH 4MIMA 1WPKA 3I59A 3WG7H 1IZ1A 1PUFB 3HTSB 2XC7A 2CG4A 2O3FA 4Q47A 2CMPA 4L9TA 4G9YA 2CW8A 1WI3A 2XB5A 3L9FA 2ECCA 4EQQA 4FCYA 2RGVA 4CCKA 3CCJI 5GP9A 3CJTB 4G6TB 3HKZA 4YIIA 3FXKA 2FQ3A 5ICFA 1RR8C 1LE8A 1R58A 2PBIA 3GX4X 3KE2A 1MMDA 1QZZA 3TO9A 4Q48A 3ASNH 1D0ZA 1X58A 2RV8A 2ZSHB 2IW5A 4R79A 3DTKA 4F7ZA 1GT0C 4V2FA 3LWFA 1CGPA 3VB2A 4XLEA 5H6RA 2PLYA 1ETYA 2FMYA 3G2BA 4RB0A 4ZDOA 2HPIA 2R4GA 1W7PD 3ABTA 4MLOA 4XORA 1LQ1A 4DQ2A 2R5ZA 4NDLA 1RRJA 1BI0A 4ZZDA 2IBDA 3GMEA 5CVUA 4KT6A 3GCMA 4UUTA 1W36D 3J7YJ 4QTRA 3QU3A 1X1AA 1QRYA 4LK0F 3P5JA 1SC7A 3ZQHA 1XDSA 1KU7A 2VQCA 1A36A 2RNGA 3K2ZA 1D0XA 2ZB9A 5DCMA 3IC7A 1IGNA 1ZARA 2IRFG 5FKKA 1RC9A 1ZGWA 4WXCA 1YHQI 2A68F 1ZYRF 3LSMA 1W1WE 1EKEA 1HKQA 2A69F 4A12A 4X0GA 2X0LA 1H9TA 2NRAC 2XPWA 4A6DA 2X6WA 3CMAI 2A07F 5BMZA 2LLKA 5A2QK 1SD4A 3F21A 1UJ8A 2HYFA 3OYLA 4AYBN 3CO6C 2QQAA 3PL8A 2HOEA 3HG9A 3FHZA 1U5TC 3EPZA 2DT6A 1SFXA 4P5OA 4MQ9F 2Q1ZB 2BY0A 2D5VA 2HYJA 2VT2A 2M0CA 2ZXWH 3C18A 4XMYA 3WTVC 1MH4A 1B8IA 1W4MA 1ETQA 1TWFJ 2DOAA 3BLYA 1ULYA 3M1CA 2HOTA 2F5EA 4N9IA 5EG0A 1FBSA 2V9PA 1IXSB 3OWTA 1FYKA 3REOA 1YG2A 5GAEJ 2VPLA 5M5YJ 4XM3A 2L7MP 1KU3A 4HSRA 4C3HJ 3B02A 2DA5A 2PFBA 3G1LA 5DEQA 5J1UA 4DIQA 2QQ8A 4II2A 3HSRA 3UKGA 1I1GA 1DQUA 4BE1A 2JJ7A 2DQLA 4LLLA 2Z5UA 4RAGA 5ICCA 2STWA 4OOIA 4CYCA 4MGRA 3OYGA 1BBYA 4ZJZA 2Y9ZA 4BXXJ 1KQ8A 2DDBA 1BL0A 2VQGA 3VDXA 1DGRM 4ON0A 2R92J 3IHUA 3VEPA 4C30A 4XSZF 5E17F 4E4HA 3ZQLA 3ONQA 2FD5A 1FBQA 2K7LA 2CQXA 2ZNYA 2ISYA 3DEUA 4NQWA 1IJWC 2QBYA 4CO8A 1TP4A 5JHFA 3I0TA 3FXMA 1YJ9I 2FMLA 3O8GA 4FETA 2XF5A 1FY7A 4M3DA 3NRVA 1FC3A 4A0ZA 3R4KA 3A03A 1XMAA 2ZMEA 1XMXA 1IDZA 3OS0A 3ABKH 3TL4X 1KQ0A 3BJAA 1JUSA 5L3EA 4GFBA 1MD0A 3E5UA 1SAUA 2DBBA 2RVCA 4UXNA 3HYIA 2WAQN 3MQ0A 4DZPA 4ZDLA 2PJRA 3E1SA 3LFUA 2X4HA 1EA3A 2HGCA 2JPCA 2O8KA 4XQFA 2JA2A 5F27A 3RSNA 2XV4S 3PSIA 4YFKF 3VODA 3L2QA 1VQMI 1K79A 1IRXA 2A61A 3IH2A 1IN4A 1L3LA 1Y0UA 4F3QA 5EJCA 2V1XA 4Y33A 1XDUA 5KHDA 2OTJI 2XPVA 3LSGA 2GIVA 3WU1B 3AAFA 3QPLA 3DU5A 4AU7A 1XSDA 2IPQX 1XSVA 1IW7F 2RC4A 2YX7A 5BNGA 5GTIC 5LHHA 2VONA 3OOUA 3A1YA 3DEEA 4M3EA 2AHQA 3SZTA 1ZR4A 5J8CA 3IH3A 1HDDC 3OYJA 2J5PA 1SFEA 4UB6C 3OYAA 3ERMA 1MNEA 5F6FA 3OL3A 4B48A 5FGMA 4C3IJ 1X4OA 2DMUA 3CCRI 4LLGF 3WTSC 2Z1DA 3NEUA 3HRTA 4GXOA 2HQ5A 1OMIA 2WC2A 2DFEA 3LFKA 4A3BJ 1UMQA 2JVHA 2PI0A 4XK4A 2HXOA 4CUGA 4QIWN 1X3ZB 1X2NA 2J5OA 1NTCA 1S9HA 4IHXA 2L2OA 4PJNA 2O9LA 3LSTA 3H3VK 1R1VA 2M7BA 4DW6A 2FOWA 2M4KA 5C4JJ 4BGDA 2FA5A 4M3FA 2Q2EB 2EJRA 1T39A 3L7WA 4CXFA 4LB5A 5EEAA 5TRDA 3RI4A 4XOPA 3W6KB 4L5EA 2XPUA 3KYDB 1JE8A 2JRMA 2KISA 2W7NA 1Y1WJ 1HW1A 2PQ8A 3LSIA 2DCEA 2DA6A 2JA7J 3CDLA 2DMQA 1GDTA 1IXCA 4L9VA 2Y30A 4IQ4A 2BYVE 2XGEA 1B72B 1Z3XA 2ECBA 2HYGD 3KLOA 2EZHA 1ZRCA 4X6AJ 3S1MJ 4GO1A 2NS7A 2EFOA 4W1UA 1HA8A 1NHAA 3K4LA 3MKWB 1IN6A 4J19A 4NC7A 1CQTA 2VB6A 2Y0SA 4IHVA 3SDBA 2O6GE 1RI7A 3E97A 3I3LA 3GLXA 4L0YB 2XAGA 1WJ5A 1YTYA 3T8TA 2UWMA 2M8EA 3BROA 2EZLA 4I0AA 4AVZA 4OINF 1OYYA 5IYBJ 5GAGJ 5E20A 5LRSA 2BY2A 1JXSA 2BXYA 1BR2A 3PFYA 2V79A 2VPRA 3BG3A 3V8JA 2DJNA 4YG2F 3S1QJ 5E3OA 2NVUB 2CUEA 1B4AA 1ODDA 3CTAA 4RLQA 5E3LA 3HRUA 4RDUA 4I98B 2JT1A 2A3SA 3W3CA 4XRFA 2X6YA 2O03A 3BTCA 2O61A 3OYHA 3M3YJ 2BW3B 4WXDA 4A3FJ 3A4CA 2HTJA 2CS3A 5CQGA
chains in the Genus database with same CATH topology
1VQ9I 1QA6A 4UY8I 3G71I 4IO9F 2OTLI 3CCRI 4IOCF 1YJNI 5DM7F 3DLLF 1YITI 2K3FA 5GAEJ 3CCEI 3PIOF 3CC4I 1VQPI 3G4SI 2E36A 5GADJ 1VQ6I 3CC7I 3CF5F 1ACIA 3PIPF 2H8WA 3CCJI 2FOWA 3CJTB 1YIJI 1VQLI 1VQOI 1VQKI 3CCSI 2ZJRF 5DM6F 1Y39A 3CCLI 2NXNB 2ZJPF 1VQ8I 1MMSA 3CCQI 1FOXA 1YJ9I 3CD6I 3J7ZI 4IOAF 1HC8A 2JQ7A 3I56I 3CCMI 3J7YJ 1VQ7I 1S72I 1VQ4I 5GAHJ 1FOWA 2E35A 3CC2I 1FOYA 4V19K 3G6EI 5JVGF 1YHQI 3CMEI 1YI2I 5GAGJ 1VQMI 3I55I 2QA4I 1YJWI 1VQ5I 2E34A 3CCVI 3CMAI 2OTJI 2ZJQF 3CCUI 2QEXI 1VQNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 I;  1QA6 A;  4UY8 I;  3G71 I;  4IO9 F;  2OTL I;  3CCR I;  4IOC F;  1YJN I;  5DM7 F;  3DLL F;  1YIT I;  2K3F A;  5GAE J;  3CCE I;  3PIO F;  3CC4 I;  1VQP I;  3G4S I;  2E36 A;  5GAD J;  1VQ6 I;  3CC7 I;  3CF5 F;  1ACI A;  3PIP F;  2H8W A;  3CCJ I;  2FOW A;  3CJT B;  1YIJ I;  1VQL I;  1VQO I;  1VQK I;  3CCS I;  2ZJR F;  5DM6 F;  1Y39 A;  3CCL I;  2NXN B;  2ZJP F;  1VQ8 I;  1MMS A;  3CCQ I;  1FOX A;  1YJ9 I;  3CD6 I;  3J7Z I;  4IOA F;  1HC8 A;  2JQ7 A;  3I56 I;  3CCM I;  3J7Y J;  1VQ7 I;  1S72 I;  1VQ4 I;  5GAH J;  1FOW A;  2E35 A;  3CC2 I;  1FOY A;  4V19 K;  3G6E I;  5JVG F;  1YHQ I;  3CME I;  1YI2 I;  5GAG J;  1VQM I;  3I55 I;  2QA4 I;  1YJW I;  1VQ5 I;  2E34 A;  3CCV I;  3CMA I;  2OTJ I;  2ZJQ F;  3CCU I;  2QEX I;  1VQN I; 
#chains in the Genus database with same CATH topology
 1YIO A;  2GLO A;  2FBI A;  1Z1D A;  5LLQ A;  2JK3 A;  1GXQ A;  1VQ9 I;  3W6V A;  4P9F A;  4WXH A;  4MTD A;  3E3V A;  3S1R J;  3S15 J;  2EZI A;  1S7O A;  2X6X A;  4N9H A;  3F8F A;  3WTT C;  2VXZ A;  5KK1 A;  1K6O A;  4MFD A;  2CFO A;  5CPR B;  1SEU A;  3R6S A;  2DO7 A;  2OTL I;  1A31 A;  3TOA A;  2DPU A;  1TT0 A;  4F93 B;  3OYD A;  2D1V A;  3F8B A;  3S8P A;  2PN6 A;  2R7S A;  3CUQ B;  4I99 C;  2K3F A;  4Y15 A;  2MBF A;  1YS6 A;  1HW2 A;  2R7T A;  1VFC A;  1ON1 A;  4XNF A;  4LMY A;  2XAU A;  5H6Q A;  1LKX A;  2ID3 A;  4S05 A;  1L0O C;  3S2W A;  1OYI A;  3OYI A;  3WTX C;  3QAH A;  4DZJ A;  4NNJ A;  3KX2 A;  3IRR A;  4UB8 C;  4C9Y A;  1HBX G;  1BI2 A;  2K27 A;  2MC4 A;  3D1N I;  2GM4 A;  4ENK A;  1VQO I;  2PG4 A;  3I5U A;  4KN7 X;  4LGW A;  4FTH A;  2TDX A;  2R5Y B;  2ZJR F;  4HAM A;  4CYD A;  4ZYG A;  2EQR A;  3ZN0 A;  1QU3 A;  1FPQ A;  2K9L A;  2L4M A;  5FD5 A;  3KCC A;  2AQE A;  5J1R A;  3N4M A;  1LPQ A;  5M5X J;  2ZSI B;  1SMT A;  2NS0 A;  4KIF A;  1H9G A;  4L0Z B;  1E17 A;  3AG4 H;  2XRO A;  3QP6 A;  2G7H A;  3I56 I;  1QGP A;  4ITV A;  4RAY A;  3BTI A;  2DA1 A;  2QVO A;  3CQZ J;  3I71 A;  1E3O C;  1REP C;  3L00 A;  1R5I D;  3GTO J;  2CQK A;  2XGX A;  1TTY A;  3HUG A;  4A3L J;  1F43 A;  3IH4 A;  4XSX F;  3VWB A;  2WWY A;  3ISP A;  3F23 A;  1XG1 A;  2DK5 A;  4E7I A;  1ZEL A;  2OPT A;  2VC1 A;  3PJR A;  4AUX A;  3T0Y A;  3R60 A;  2EIM H;  5B3S H;  5AON A;  1CF7 A;  2LF8 A;  4JX5 A;  1XSX A;  1WHU A;  2F2E A;  2K9N A;  4A3J J;  4H0E A;  3E6D A;  3ZMT A;  1JT0 A;  3K2A A;  5ICG A;  4QLC U;  3HPH A;  3PNY A;  3TO6 A;  4MHG A;  5BS6 A;  1BIB A;  2NAZ A;  3DU6 A;  4FX0 A;  1X3U A;  1IF1 A;  2QSF X;  5F64 A;  3CCU I;  3GZ5 A;  3HPG A;  1OPC A;  4CCO A;  3ULQ B;  2HVR A;  2LBF B;  5TIS C;  5J3L A;  3HKZ N;  1NG7 A;  3KFW X;  2P81 A;  1LFP A;  2DJI A;  4EJV A;  4U7B A;  1F5T A;  2ZME C;  2QZ8 A;  1GHC A;  1B6A A;  3GLL A;  4UUS B;  1V4R A;  5L3B A;  5JI6 A;  3MZ8 A;  3S14 J;  1YRN A;  4LB6 B;  1WFX A;  4KMU X;  2NVQ J;  3OOP A;  1ZK8 A;  3K6G A;  4OIO F;  1TQP A;  2E1C A;  4YIF A;  4EEF G;  1P6R A;  2W48 A;  3RKQ A;  3G4S I;  4HQE A;  3WHB A;  4KIB A;  3DQV C;  1ZRF A;  3BC8 A;  3OYM A;  1D5Y A;  3VSL A;  1FIA A;  4D5F A;  1JUM A;  4PFP A;  3QYF A;  2LRE A;  3S93 A;  4A0X A;  3PIP F;  4R8H A;  4I76 A;  1XN7 A;  3H9Q A;  3P9C A;  4RB3 C;  3ZR8 X;  1T95 A;  4I01 A;  3Q9S A;  1QZY A;  4D9J A;  4B4C A;  2DMP A;  2LFB A;  2X51 A;  2Y48 A;  1D3Y A;  2ZCW A;  3D5L A;  2GXB A;  3E7L A;  3Q0W A;  4D5C A;  3SEZ A;  2VN2 A;  9ANT A;  4HBL A;  2R3S A;  1FX7 A;  1U0J A;  2W00 A;  2HVQ A;  2F48 A;  4DYC A;  3CO7 C;  1WQ2 A;  1BN5 A;  2F4I A;  1R23 A;  2CQ7 A;  2OJE D;  3N05 A;  2KKO A;  3IKT A;  3IP4 B;  4OMZ A;  1LB2 A;  3LSK A;  4O6J A;  1HDP A;  1YO5 C;  1FOK A;  2R7F A;  4BY1 J;  1FOW A;  2QWW A;  2CQQ A;  1J2X A;  4ZYA A;  2QCO A;  1MDM A;  3N97 A;  2XAQ A;  2LC2 A;  2GBY A;  1HLV A;  5J4V A;  2AXT C;  3DPU A;  4MFE A;  2LDU A;  3JSP A;  1TC3 C;  1YI2 I;  4EM1 A;  2LMD A;  3O2P E;  2L9S A;  3DLA A;  4D1Q A;  3MN2 A;  2STT A;  2MAB A;  1XGS A;  4C2U A;  4M73 A;  2LD5 A;  1RUN A;  3ZMS A;  1OCZ H;  2DA7 A;  2CWE A;  3S17 J;  4DBR A;  4CCL A;  2R93 J;  4XN0 A;  5K5Q A;  2HPM A;  2LKX A;  2OUM A;  2XAS A;  4HNU A;  1SAX A;  4HV6 A;  3GBG A;  2HQN A;  2DN0 A;  4AIK A;  1MBJ A;  1TWH J;  2NOG A;  1WKM A;  4DNC A;  2JSC A;  2DK8 A;  2VAS A;  3FK7 A;  2DW4 A;  2H6B A;  5DUI A;  4EAT A;  1YW8 A;  2H27 A;  2IS1 A;  3C2G A;  3WG9 A;  4RGR A;  3PQJ A;  1GXP A;  5LHG A;  2Z33 A;  5DUK A;  1Z7U A;  5FKN A;  1MNM C;  1AWC A;  3I4P A;  4CSW A;  1U8R A;  2K3P A;  1IG7 A;  1B59 A;  3CUO A;  3K1P A;  1YJN I;  3HL2 A;  4ESB A;  1QQI A;  1ZLK A;  2FEZ A;  4OU0 A;  3PIO F;  3HOV J;  3GTQ J;  1SVM A;  1V5F A;  1T33 A;  2NYX A;  1S6L A;  1JT6 A;  4NHJ A;  4PGG A;  3KP5 A;  1D5V A;  2XAJ A;  1X1C A;  2VQH A;  1IDY A;  5HLT A;  4UNO A;  1WCM J;  4NBQ A;  1I6H J;  3S2D J;  5L3C A;  3U1D A;  2H8W A;  1TWC J;  3E6B A;  3MFK A;  4NC6 A;  2DAO A;  3MD2 A;  2FE3 A;  3CF2 A;  3IL2 A;  2HR3 A;  1U6G A;  1WJD A;  2VBZ A;  4IHT A;  2PMU A;  3KET A;  1YLF A;  1BJA A;  4EGY A;  2COB A;  3FMS A;  3HHH A;  1AKH B;  2BVL A;  2DOE A;  4LD5 A;  3ABU A;  1BC8 C;  2Y9Y A;  5ILV A;  3J80 Z;  3W2W A;  2GA1 A;  4UUV A;  4EVI A;  3KEQ A;  5DTD A;  5HLG A;  2H6C A;  3BP8 A;  2PMZ A;  3K70 C;  1J5Y A;  5EG0 B;  4G6Q A;  4Y4R A;  1A6I A;  2JA5 J;  3HOZ J;  2A6E F;  1U9O A;  1H8A C;  4EV0 A;  1WZ2 A;  1W5T A;  1OQY A;  1TBX A;  4L9N A;  1LNW A;  1VQ4 I;  1VTN C;  2N8G A;  3F8C A;  4IRG A;  3BTJ A;  3J7A O;  2E71 A;  3WTZ A;  2GXA A;  3DBH B;  2FF4 A;  2RAE A;  3CME I;  2XB0 X;  3RIR A;  3K4K A;  1P4X A;  1IXR C;  2FBH A;  3I55 I;  3H3Z A;  2DLL A;  2ETH A;  1V54 H;  5BOX A;  1LDK B;  3CMY A;  1YJW I;  4E7L A;  3FZV A;  3JAM Z;  2DTR A;  5DCF A;  4BHB A;  3JSO A;  3ZMV A;  5HNH A;  1ETX A;  5ICE A;  2OBP A;  2V26 A;  5F0C A;  5J4Y A;  1WH7 A;  3ZRG A;  4XOT A;  3OSF A;  2E2I J;  1A6Q A;  5FJ8 J;  1SD7 A;  2WTE A;  3ZXS A;  4EGZ A;  4IHS A;  1R6R A;  2WB1 A;  3S3N A;  1OYW A;  5B1A H;  4O5V A;  4N4N B;  3GWZ A;  5CVV A;  5EGO B;  2B63 J;  4B09 A;  3U9G A;  1T08 B;  6PAX A;  4KFC A;  4RAF A;  1Y56 A;  4FHT A;  5KCM A;  3SZP A;  5D5U B;  4BAY A;  1G8X A;  3DV8 A;  3CC4 I;  2FSW A;  2RKH A;  3H92 A;  2Z16 A;  1YW7 A;  2CV1 A;  4BJT A;  3FIS A;  4XLP F;  1I1S A;  2B7E A;  1K4S A;  1D8J A;  4XLH A;  3HOS A;  1ETV A;  2E1M C;  1IAW A;  2L7Z A;  3LQQ A;  2MGQ A;  2Y0S N;  3EUH A;  1RKT A;  3RJP A;  2CO5 A;  3SFI A;  1N77 A;  2QKM B;  4YFX F;  1DGW Y;  4RM3 A;  3OMY A;  1YW9 A;  1XX5 A;  1YIJ I;  1RPW A;  3CP8 A;  2CV0 A;  3SJM A;  4ZZL A;  1W7P A;  3FMQ A;  5FLM J;  2K9Q A;  1K4T A;  2IVM A;  1IN7 A;  1ENH A;  2EZK A;  5E3N A;  3CLO A;  3BG6 A;  2FUG 2;  3LA7 A;  3QPS A;  4RGX A;  1Y8R B;  1PUF A;  1QHG A;  1OIS A;  3FM5 A;  4CZZ A;  3W6J B;  4B44 A;  5LGU A;  3NAU A;  2HNH A;  1H89 C;  3TW6 A;  1HSJ A;  5E8G A;  4IOA F;  4HYE A;  1MJB A;  1G6N A;  2Y69 H;  5HOD A;  4QSH A;  1SVL A;  3MCZ A;  1WRJ A;  1BOB A;  2EA2 A;  5HLI A;  3SQN A;  2P7C B;  4GDF A;  1S72 I;  2M0M A;  5DYM A;  3I54 A;  3H5A A;  4RLF A;  3G1M A;  1E3P A;  1P4A A;  2WY8 Q;  3M8J A;  5B1B H;  4CGZ A;  2IS6 A;  4B3X A;  1YOV B;  1LVA A;  2WV1 A;  2IJL A;  2CW7 A;  2KLO A;  2KRF A;  2HQR A;  2LYC A;  2X9D A;  5IT3 A;  2CUJ A;  2P4W A;  4LIV A;  3ZPL A;  2EK5 A;  5F0H A;  4FT8 A;  2YPR A;  2EH3 A;  1UHM A;  4A3M J;  4QPO A;  2D45 A;  2UZK A;  3MEX A;  2BHY A;  2NS8 A;  2ZXH A;  1RKW A;  3AL0 C;  3OR2 C;  5L3F A;  1W0T A;  4HLY A;  1I6X A;  4LG3 A;  2YX4 A;  1TWA J;  5CVR A;  1ZR2 A;  4MQV A;  1FSE A;  4BQO A;  3VYS B;  1IN8 A;  4PJL A;  3K69 A;  3OL4 A;  3IRQ A;  2EV0 A;  2GOM A;  1Z21 A;  2FRH A;  2UUZ A;  2QGU A;  2M34 A;  4CCN A;  3GZ6 A;  2M7A A;  1GVJ A;  1XPX A;  1ETO A;  4BQQ A;  3FBI B;  5D4R A;  4WCG A;  3KYL A;  1BOA A;  1GV5 A;  1X3W B;  2VJJ A;  5JFR A;  3A01 B;  3H5N A;  1N78 A;  4A2U A;  4BEH B;  2F5V A;  2VIX A;  5BQT A;  1TL8 A;  1GUU A;  2COM A;  4KN4 X;  4E7K A;  2EB7 A;  3H0G J;  3ZQG A;  4E70 A;  1FJL A;  2QF7 A;  3QYB A;  2B0L A;  2WAF A;  1XD7 A;  3ZP5 A;  3QPT A;  1B1B A;  2M5W A;  2O8X A;  1VQ6 I;  4M72 A;  3W2A A;  3KP3 A;  2RQP A;  4JQF A;  3TDU C;  2HI3 A;  3GUD A;  4A3I J;  5E1W A;  5FLX Z;  4FE4 A;  5EZG A;  1G3T A;  3BR6 A;  1LFU P;  3WTU C;  3NAR A;  4AWX B;  4DYQ A;  1YS7 A;  3V8K A;  2F4O B;  1DP3 A;  3VYU B;  1Y39 A;  3CCL I;  2ZFW A;  3BJO A;  3FWE A;  1SAN A;  3IKV A;  4HX4 A;  5FKO A;  2IGM A;  1U2W A;  2BVM A;  2JUC A;  3T8R A;  1XGN A;  4HX7 A;  2HU9 A;  2LRD A;  2CQN A;  2VKD A;  3LL7 A;  3RTR A;  3H1C A;  2Z99 A;  3E6M A;  3IAM 2;  5HOO A;  1K61 A;  3BZK A;  3QU6 A;  4BAC A;  2EFP A;  1RET A;  4UHT A;  2GA2 A;  3DF8 A;  1RZ4 A;  3IV5 A;  3S3O A;  1J7K A;  2NVT J;  4EJO A;  1UST A;  3HHG A;  1UZC A;  5B5E C;  1OJL A;  3L2V A;  1XB4 A;  4BBS J;  4BQA A;  3RDI A;  2DT5 A;  4OIQ F;  1WJC A;  4PK4 A;  5CVJ A;  4B43 A;  2DMT A;  3CMM A;  3LSH A;  1MBH A;  1OLT A;  1V5E A;  3VSK A;  2R0Q C;  3ABM H;  4GCV A;  3G6E I;  2HKO A;  4BE2 A;  5GPA A;  4XBF A;  1X4P A;  2E60 A;  3OYE A;  2RN7 A;  3CLQ A;  3RYP A;  3M1E A;  2KIU A;  5J6X A;  1R4N B;  3A2K A;  1Z3Y A;  4PSW A;  4W97 A;  3A0H C;  5ERI A;  2VOD A;  1U3E M;  4E7H A;  3JCU C;  4HNT A;  2DA4 A;  3R0J A;  5HDN A;  2MG4 A;  2EA4 A;  1TW3 A;  3CP2 A;  2CRG A;  2IAI A;  2TRT A;  3EUA A;  5K7F A;  1R00 A;  2HOS A;  4IHW A;  5IT9 Z;  2CSO A;  3RPU D;  2VT3 A;  3S1N J;  2JPB A;  4KIG A;  3BR3 A;  2DMN A;  3O8H A;  4JP0 A;  3OV8 A;  5FFX A;  2P6T A;  1APL C;  2E1O A;  2M87 A;  2QM3 A;  2W1O A;  4MNU A;  3PFI A;  3BTL A;  4RM2 A;  2OAZ A;  1UCR A;  1UAA A;  4XRS A;  1BW5 A;  3HB9 A;  3S2H J;  3A02 A;  4ENN A;  4ZC3 A;  3WE3 A;  4JBA A;  2HTS A;  2ADU A;  1S5L C;  3K1M A;  3BWG A;  3QOE A;  3KEO A;  5KVR A;  3DLL F;  3I4N J;  4G7Z F;  2UV1 A;  2XKO A;  3ECO A;  2QUF A;  3MKL A;  4BXF A;  4LG0 B;  3AKZ A;  1MJ9 A;  3FDY A;  1DU0 A;  1P7J A;  2VXD A;  1YE9 A;  3IAS 2;  4IKF A;  1MIJ A;  1ACI A;  4HZF A;  1EH8 A;  3AFH A;  4PCQ A;  2OA4 A;  2E7W A;  4IVN A;  4C2T A;  1QVU A;  1U5T B;  4CHU A;  2L9N A;  4XLN F;  2A5W A;  3MWM A;  3GFI A;  3D5S C;  4UV8 A;  3GYH X;  1ZGJ A;  5CKT A;  3E5X A;  1OCC H;  3MAJ A;  3CCS I;  2OQR A;  1VZ0 A;  3BPV A;  1R1U A;  2HZT A;  2NXN B;  3TDZ C;  5LRR A;  3P7N A;  4NB5 A;  4HNV A;  1MMS A;  4YEL A;  3GTM J;  3ZCO A;  1LDD A;  4FX4 A;  1O3S A;  1P4W A;  2KP6 A;  4PFO A;  3HBL A;  3KYC B;  2R7R A;  2R7W A;  3BOQ A;  5CYV A;  2KJB A;  5E3M A;  1MJA A;  4M6X A;  4EJT A;  1BIA A;  2ESH A;  3CJQ B;  1UG0 A;  4NUB A;  3DKY A;  2Q2E A;  2W84 A;  4KIS A;  2P7V B;  4I0B A;  1EF4 A;  3EUH C;  2M4G A;  3SDG A;  2KDO A;  1ZQ3 P;  3KZI C;  4S04 A;  1X1P A;  1V55 H;  5JVG F;  5E18 F;  2WA0 A;  5L3D A;  3KZY A;  4E7J A;  5IP9 J;  1R9T J;  2V9K A;  2EV5 A;  4BU2 A;  2KIQ A;  2QA4 I;  2IT0 A;  3M4O J;  5GPC A;  1JI8 A;  1B72 A;  3UNG C;  4ZTF A;  1H0M A;  2CYY A;  2KRH A;  3G1O A;  1B9M A;  4AIH A;  4XRM A;  1W36 C;  1MMG A;  3HIF A;  3M9A A;  4EJW A;  1P7I A;  3HSE A;  2QEX I;  5ILU A;  2EFQ A;  2MD0 A;  4BH9 A;  4C3J J;  2RQQ A;  1ONV A;  1AU7 A;  3JRI A;  2FOK A;  1T38 A;  3HJE A;  2O5R A;  1X1D A;  1XGM A;  3DTE A;  4JOM A;  1P9Q C;  2V4J C;  3GTL J;  2W57 A;  2P5V A;  3PO3 J;  3R61 A;  5DS9 A;  5FFZ A;  1BI3 A;  3FXJ A;  4HV5 A;  3TOB A;  5KAF C;  5BPI A;  1TZL A;  1DUX C;  2L9R A;  1ORK A;  4Y7N J;  2W24 A;  5DD4 A;  2JUG A;  1Z77 A;  3F9K A;  2PMZ N;  3QQA A;  1K78 B;  3W2V A;  2UXN A;  2BW3 A;  2XSJ C;  4L5I A;  1G59 A;  3GTK J;  5J47 A;  4A69 C;  2KL4 A;  4AC0 A;  3BT9 A;  5HS7 A;  3ERE D;  1DU6 A;  3MKY B;  3LQR A;  1R71 A;  1JUP A;  1QZE A;  2XUB A;  5CJ9 A;  2VUM J;  2VL8 A;  4M3G A;  2K86 A;  1TNS A;  1C0W A;  2L01 A;  1ZAO A;  4I09 A;  2O7O A;  3CES A;  5EEG A;  1MBG A;  3DWL E;  1VQK I;  3GW2 A;  3V42 A;  3L2U A;  5LHI A;  2LF7 A;  5DM6 F;  1Q1H A;  1W5C C;  1WJF A;  1X2M A;  2IGN A;  2DA2 A;  3CUQ A;  5FRO A;  2OC6 A;  5IOZ A;  3VYT B;  1U8B A;  2XGD A;  2ME6 A;  4XID A;  4A3E J;  2KQR A;  3CCQ I;  4AM3 A;  2DYR H;  3L2C A;  1JKQ C;  3BPX A;  3NQO A;  4YEJ A;  2AS5 F;  5TGT A;  1DPU A;  2A6H F;  3TW7 A;  3MZH A;  1YX3 A;  4FQG A;  4XR6 A;  3K4M A;  5M5W J;  3OSG A;  3Q9V A;  2WB1 N;  3LSJ A;  2ISZ A;  1BC7 C;  5GAH J;  2H1L A;  1EH7 A;  1R5G A;  5CVI A;  2R5Y A;  3F0C A;  2A6T A;  3TED A;  1HXD A;  1STZ A;  3ZQC A;  2KPM A;  3WTW C;  2VBW A;  3L2R A;  1J0R A;  1HOM A;  1KYZ A;  4I6Z A;  2CH0 A;  1UG2 A;  3U21 A;  4JX6 A;  3FKJ A;  3HOW J;  1OCR H;  2ELJ A;  1QPI A;  1JKP C;  4ENM A;  5J1Y A;  2RDP A;  3LNQ A;  2ZO4 A;  1NK3 P;  1OR7 A;  2EFW A;  2WAE A;  1T2K A;  2L54 A;  2OZU A;  2E19 A;  3I59 B;  4HEA 2;  4ZTJ A;  1IO2 A;  2MYS A;  3BY6 A;  4ZDP A;  4O3M A;  2G7U A;  4CH7 A;  1WGX A;  4AD9 A;  3IUO A;  1UHS A;  2F6C A;  4BQN A;  2A5Y B;  4EMS A;  2HDD A;  2LSO A;  1FLI A;  5HS8 A;  2VBX A;  1BJZ A;  2X6O A;  2H09 A;  2PX9 A;  5F08 A;  3BG5 A;  3E5Q A;  4BHC A;  3M8F A;  3FXQ A;  4J01 A;  1ZN2 A;  4IF4 A;  1LE8 B;  1ZHF A;  1T56 A;  3HRS A;  4A0Y A;  2VLA A;  4Y17 A;  3SYT A;  4BDZ A;  3KEY A;  4RA2 A;  2FBK A;  2LNB A;  2R7Z J;  1TNT A;  3JTH A;  2I10 A;  2LBF A;  5HLH A;  1FBU A;  4Q5S F;  5GAD J;  2R5Z B;  3CF5 F;  2VKH A;  2V6E A;  5C44 J;  4ESF A;  2L02 A;  3OIQ A;  5ILS A;  1JTX A;  2JVG A;  2JTV A;  5LEK A;  3FXL A;  4UUS A;  1H88 C;  3V7R A;  3D5R C;  3H9J A;  2VOO A;  1ZG3 A;  2NVX J;  3HOX J;  3T1B A;  4ZYE A;  2FNP A;  4LIT A;  2LKS A;  2HEO A;  5DCM B;  4F91 B;  4YRV A;  1X1B A;  2BBY A;  1HKT A;  3RQ4 A;  5FKM A;  3ECH A;  3Q5F A;  1IUF A;  3DTI A;  1FYM A;  2DOF A;  2FX0 A;  2CW0 F;  1OCT C;  4BJ6 C;  1IC8 A;  5JR3 A;  4K2E A;  1U78 A;  2R7D A;  2LY1 A;  2ICW G;  4G8X A;  5IPA A;  3JW4 A;  3OYK A;  2KFD A;  2F5F A;  1SFO J;  2BHZ A;  1IV8 A;  2HOA A;  2OF7 A;  1J59 A;  2W85 A;  4HDV A;  3CDH A;  2PEX A;  1USS A;  1VQ7 I;  2M8G X;  4WWC A;  2LTP A;  2V7F A;  5A2Q Z;  2YSR A;  4XKV A;  3FIW A;  1LEA A;  5FLV A;  5EYR A;  3WTY C;  2E35 A;  4KMF A;  3WHC A;  5D6E A;  1OCP A;  2VJ4 A;  4RB1 A;  2EWN A;  3F8N A;  4CIC A;  3J81 K;  2E2J J;  2XRL A;  4CA0 A;  2HDW A;  2P0W A;  4BUP A;  1Z0X A;  1K6Y A;  5L3G A;  4PGH A;  4Y52 J;  1SD6 A;  3ZQQ A;  1KZH A;  3CJR B;  4U0Y A;  2AO9 A;  1B8I B;  5CLS A;  2K5C A;  3IWF A;  1O7F A;  2E34 A;  1FP1 D;  5K7H A;  1SD5 A;  1IV6 A;  1ITY A;  2QEN A;  1YQA A;  5HDK A;  1ZKG A;  3ZQF A;  3FK6 A;  1XS9 A;  2F4M B;  3BR2 A;  5K5R A;  4P9U A;  1DPR A;  1E3H A;  4B8X A;  1IN5 A;  5FD6 A;  3V8L A;  2LH9 A;  2P8T A;  1G3W A;  4IXA A;  3K7A J;  5HNF A;  3JRC A;  2X1C A;  2HKX A;  3AG2 H;  1ZRE A;  1QA6 A;  3KIO A;  4M6Y A;  2W25 A;  4CYC B;  4LOC A;  4KNY A;  4S0H B;  2VOP A;  3WGG A;  4N4O B;  2JWT A;  3H36 A;  3HOU J;  4IRI A;  1MKM A;  4G94 A;  3F6O A;  3OS1 A;  2DFF A;  4E7Z A;  4PDK A;  4ZH4 F;  2QKL B;  4KIT B;  1NH3 A;  4BJ5 C;  1WJE A;  3BCA A;  4NQW B;  1D1A A;  2QBY B;  1QVT A;  1TWG J;  5KNL A;  3CZ6 A;  2I8D A;  5HS9 A;  3JTG A;  1UHW A;  2IGK A;  5DV5 A;  2H8R A;  5FKL A;  3RPQ A;  4WK8 F;  3FKI J;  2I5U A;  2Y0M A;  4OMY A;  2XAH A;  2ZME B;  3OYB A;  2XVC A;  3PNV A;  2NNY A;  1VQL I;  2XF6 A;  3F6V A;  3GZN B;  1IRG A;  3U2R A;  4RB2 C;  2PJR B;  2KDZ A;  2VBY A;  3DFG A;  4HF1 A;  2L5Q A;  2ZKZ A;  5D4S A;  1HST A;  4HF0 A;  1PDN C;  1KU2 A;  4XL9 A;  1UEL B;  2H94 A;  1D1C A;  2M30 A;  2JA8 J;  2C6Y A;  2P6S A;  1J9I A;  3DBL B;  2IA2 A;  1I27 A;  4I02 A;  2ELH A;  1J75 A;  5LEJ A;  3DCF A;  4D7M A;  2E2H J;  3DP7 A;  2NVY J;  2YR2 A;  5JLW A;  1MND A;  2K02 A;  1JHF A;  2VQL A;  2KHM A;  3HDD A;  3OR1 C;  4L18 B;  3JRE A;  4HX8 A;  3H9G A;  2KRC A;  3IWZ A;  3GTJ J;  1Y0N A;  2GAU A;  1FZP B;  1FEX A;  2XIG A;  3GFM A;  3H5R A;  5IP6 A;  1W5S A;  3RYR A;  4A3K J;  1JGG A;  3WGH A;  1ERD A;  5DD8 A;  4V19 K;  2FXA A;  2GZW A;  4M3B A;  2NNN A;  2OCC H;  3KP6 A;  1AKH A;  1MBE A;  2BZT A;  4Y3O A;  3J80 K;  4EJU A;  1FT9 A;  2IP2 A;  1KON A;  1Y1V J;  1VQ5 I;  1ZH5 A;  2FJ1 A;  3CUQ C;  4LIU A;  1DDN A;  1EV7 A;  4LJZ F;  3RCO A;  4LK1 F;  3VYR B;  1ZRD A;  2F5C A;  1WJB A;  1ZGA A;  2EIN H;  3LAJ A;  2DI3 A;  3V4G A;  2MD5 A;  2GXG A;  5M3M J;  3S3M A;  2E7X A;  2MW8 A;  1O4X A;  1XGO A;  1QPM A;  3HGY A;  4GGG A;  3K0L A;  3KPH A;  2ZC2 A;  1I3A A;  3K4J A;  4XKW A;  2JA6 J;  2KZV A;  1G3S A;  1F4K A;  2V1U A;  3K1N A;  1FSH A;  1FMV A;  4JK1 X;  3ROU A;  4UVA A;  4H4K C;  3C2H A;  5EF6 A;  2GQQ A;  2L7K A;  4XIC A;  2CUF A;  2ELK A;  2E5N A;  4U87 A;  4G12 A;  1AA7 A;  4E7S A;  2EBI A;  2VC0 A;  1V3F A;  3S16 J;  2DT7 B;  2DFH A;  2YS9 A;  3JAM K;  3CCY A;  4ABZ A;  3OYN A;  3RQI A;  3T5X A;  5F1R A;  4CDG A;  4MEX F;  1A04 A;  4RAZ A;  4BDY A;  3VOE A;  1HW5 A;  2XAF A;  3FBN B;  5JHU A;  5C3E J;  2V1D A;  1K83 J;  2ESN A;  3ABL H;  3WGI A;  1T0F A;  4OIP F;  3JRD A;  2LG4 A;  5EDN A;  3KP7 A;  4M74 A;  3HOT A;  5LD2 C;  2ACJ A;  1RIO H;  3RZO J;  1OR7 C;  2CJJ A;  2YUS A;  1IUY A;  2GOX B;  1PVE A;  2KT0 A;  1B9N A;  4FAS D;  5H20 A;  1S7A A;  3WU0 A;  1MSF C;  2IS4 A;  5D6F A;  4PJ0 C;  1R5H A;  4RBO A;  4XLA A;  4A93 J;  3DXJ F;  1F1Z A;  2L4A A;  4I7H A;  4G7O F;  5EGO A;  4GYG A;  3MKZ A;  3COA C;  5FO5 A;  2OU2 A;  3C7J A;  3PSF A;  2VE8 A;  3JR9 A;  4BKX A;  2DFI A;  4G7H F;  1R7J A;  4BS9 A;  3BR5 A;  2ZJP F;  2ZFU A;  4CCJ A;  3DKW A;  5LGT A;  1EJ9 A;  1QO0 D;  3FXO A;  2ZXJ A;  3B6A A;  5C4X J;  4L9J A;  3LA3 A;  2R7X A;  1KGS A;  2EV6 A;  4AIJ A;  5IY5 H;  1A5J A;  4P96 A;  1MGT A;  2V9V A;  1SMY F;  2JMW A;  3D0S A;  1MMA A;  1Y6I A;  3BG7 A;  1PP8 F;  5D8K B;  4DOZ A;  2DPD A;  4CCM A;  1MBK A;  2GIZ A;  2KIF A;  2M9H A;  2R7O A;  3ZMD A;  2HS5 A;  1A35 A;  1LEB A;  3TQN A;  5E8I A;  2XDV A;  1IRF A;  4YIR X;  5LFA A;  1FWZ A;  1G2H A;  2K4B A;  4XKB A;  3F3X A;  5E1Z B;  2QSH X;  1FTT A;  3SEQ A;  1QBJ A;  4IQJ A;  4B1R A;  5K1Y A;  1Z7L A;  4X1E A;  4OWR B;  4RMN A;  2XF7 A;  3EUK L;  2LY9 A;  4ETS A;  3BQY A;  1JHH A;  3HSF A;  3SFZ A;  1FYL A;  3QPH A;  1TW2 A;  3ASO H;  3SHF A;  1BR1 A;  4BNC A;  2DA3 A;  1NG6 A;  2MC3 A;  3GFL A;  5D8L B;  2IA1 A;  2TCT A;  3NWT A;  2X1E A;  3FMR A;  2DYS H;  4ANJ A;  3F22 A;  3PNT A;  4HW0 A;  5J40 A;  2PJP A;  5M3F J;  1MZB A;  1JKO C;  1MBF A;  1TT5 B;  4HQM A;  3WU2 C;  3HZJ A;  2CU7 A;  3OS2 A;  1RUO A;  4TV7 A;  5CQE A;  1R1T A;  4DJA A;  2LR8 A;  2PMH A;  1KU9 A;  2Z2S B;  5HVQ C;  4IJA A;  1OFC X;  3U1K A;  3BR1 A;  1YFH A;  4WX9 A;  4U0V A;  1R36 A;  3AG3 H;  2WV0 A;  2K9S A;  3H35 A;  4M9X A;  4A5N A;  3FM3 A;  4IO9 F;  4BXU A;  4U0W A;  1Z9C A;  4HF2 A;  2LK2 A;  5EZH A;  2D2W A;  1LVK A;  1X19 A;  3C1D A;  2OZ6 A;  3PM1 A;  5GTH C;  3CCE I;  2FU4 A;  5FRM A;  5B66 C;  3OYF A;  1O3R A;  3C2B A;  3G73 A;  2IS2 A;  3DKX A;  1SFU A;  3GF2 A;  3RKY A;  3RKX A;  3PUB A;  5IOY A;  2DXI A;  2E36 A;  2Q0O A;  3CC7 I;  2IEK A;  3QWL A;  3MMY B;  1TQI A;  3K70 D;  4F55 A;  3TKY A;  3TO7 A;  1J09 A;  3V7S A;  3PO2 J;  3V7C A;  3JRH A;  2K85 A;  3GFJ A;  2G0E A;  3GEZ A;  1S29 A;  2X1D A;  2BE5 F;  4AYB A;  4F52 A;  3QRF F;  3EET A;  2JRT A;  3HUG B;  4MO7 A;  1D0Y A;  1AHD P;  3A01 A;  3MVP A;  2A05 A;  1UFM A;  2GWR A;  2D1H A;  4BEH A;  2ZNZ A;  3JRG A;  1JJ8 C;  1QNT A;  2BV6 A;  2ZXI A;  3H3U A;  3TGN A;  3K9T A;  1NK2 P;  2WY7 Q;  1U9N A;  2LP0 A;  1CF7 B;  1LUJ B;  5E79 C;  2Z3Y A;  1BA5 A;  5TJJ A;  3O3K A;  1Z67 A;  1XTA A;  3P9I A;  2K4J A;  4EM2 A;  3F8M A;  2B9S A;  4M71 A;  2JQ7 A;  2E1M B;  2VKV A;  1O3T A;  4BE0 A;  3CCM I;  1V5G A;  5FLX K;  1GV2 A;  2HDC A;  4BBR J;  2K9M A;  2EPF A;  4KIC A;  1HCR A;  2BOL A;  3PUF A;  3WOD F;  1SFK A;  3BZ6 A;  3OIO A;  4LFU A;  3OY9 A;  2P5L C;  4JX4 A;  1HF0 A;  3HEF A;  3E6C C;  4HG2 A;  4F92 B;  4ASN A;  4M6V A;  4V2G A;  2LOO A;  2RNJ A;  2ZJ2 A;  2DTZ A;  3CC2 I;  4Y13 A;  2XKP A;  1PYV A;  3ZMU A;  2E5Z A;  2RRE A;  4BL0 B;  4QWQ A;  1G3Y A;  4XN3 A;  3TMO A;  3FF5 A;  3ZMZ A;  4Z2Y A;  4Z6Y A;  1YRN B;  2R7V A;  2WAD A;  3CCV I;  2X85 A;  2MA3 A;  3S32 A;  4RGS A;  1I3Q J;  3RPU A;  1AOY A;  3KP2 A;  3ZGK A;  3FXR A;  1MH3 A;  2ZJQ F;  4KA4 A;  3EYI A;  1XC5 A;  1P92 A;  1T6S A;  2VJI A;  4Q4Z F;  3JRF A;  3TP0 A;  4GRI A;  5JLX A;  4QPQ A;  4PSX A;  2MFZ A;  4RGU A;  1M1E B;  4RS8 A;  4HRI A;  5F1J A;  4PJJ A;  3GTG J;  2BY3 A;  2M2E A;  3RKW A;  2W82 A;  1HKS A;  1RR7 A;  4HPQ A;  1FNN A;  4HDU A;  3DBR B;  3QP5 A;  3CDI A;  2L7F P;  2LVS A;  1WSU A;  2CUZ A;  2WAQ A;  3FXU A;  2EIK H;  4GYI A;  4KYW A;  2F5D A;  4UVB A;  3L1P A;  1FP2 A;  4HA8 A;  4IOC F;  1BM9 A;  4KT5 C;  4E6K G;  3GTP J;  3OYC A;  4XON A;  2DOD A;  3A0B C;  4LLN A;  2K40 A;  3L09 A;  3PQK A;  5IT9 K;  4P1W A;  2HXI A;  4HOB A;  5HDG A;  1K7A A;  3AL0 B;  1YYV A;  2ID6 A;  1VND A;  3C3W A;  2XGC A;  2AQF A;  1S8N A;  1YX5 A;  2HWV A;  4IZZ A;  3QOD A;  1HQC A;  3BR0 A;  4DGW B;  3K4C A;  5IP7 J;  4KJZ A;  5AIP A;  4U88 A;  3SXY A;  1S7E A;  3SZG A;  5K7Z A;  5KAI C;  3ZQ7 A;  1ZG1 A;  3MZY A;  4XLF A;  3I53 A;  4A3C J;  1LJ9 A;  3GXO A;  1MDM B;  1POG A;  3GVA A;  2AXL A;  1VQ8 I;  5D5X B;  1FTZ A;  3L2W A;  5JVT A;  3LOC A;  2OCE A;  4LG0 A;  3AG1 H;  1Z6R A;  3EYY A;  1BW6 A;  4KUM A;  4C2M J;  3DEW A;  4ENJ A;  1FOX A;  1ZLJ A;  4A3D J;  1GVD A;  4FIS A;  2LY2 A;  4ZYD A;  2MH9 A;  2KIM A;  1WH5 A;  3HOY J;  2MH2 A;  2XSD C;  4AVP A;  1U5T A;  1PUE E;  2NOJ B;  1ON2 A;  4BHP A;  4XRS G;  1VF9 A;  2V1N A;  3ML6 A;  4OIR F;  4XLC A;  1T0F C;  3O6B B;  4AID A;  3P9K A;  3GO5 A;  1D1B A;  1MW7 A;  2V6C A;  1T8I A;  3KZZ A;  3E0J B;  2Y31 A;  1ETK A;  2YU9 J;  3ZQI A;  2HVS A;  4OAY A;  4CZC A;  5LGN A;  5K5O A;  4U7D A;  1DP7 P;  5F0F A;  1LDJ A;  4KDP A;  1N25 A;  4ESJ A;  2X48 A;  2L0K A;  2G9W A;  2XRN A;  3UR3 C;  4A5M A;  3ZOB A;  2BEO A;  2E1N A;  2KJC A;  1N75 A;  1QHH D;  1BI1 A;  2DQR A;  4IPA A;  4P55 A;  3BQZ A;  2IGO A;  4IX7 A;  3Q0U A;  2VKE A;  1F9N A;  2JN6 A;  1XMK A;  2Y2Z A;  1MSE C;  3M07 A;  4MEY F;  4MTE A;  1MMN A;  3FX3 A;  2Y75 A;  2DDA A;  2YU3 A;  5LBQ A;  2BY1 A;  3EDP A;  5IYD J;  2IXS A;  3BJ6 A;  4BYY A;  1ZG5 A;  4HST A;  4NC8 A;  3G71 I;  4DBQ A;  1VI0 A;  3LAP A;  1EH6 A;  4D7N A;  5D5W B;  2QQB A;  3KP4 A;  2OV7 A;  1LFB A;  3WE2 A;  5EEH A;  3VFZ A;  5DM7 F;  1Y8Q B;  1YIT I;  3QYE A;  3ESW B;  4PUS A;  2VE9 A;  4DYR A;  1OKR A;  4WF2 A;  1VQP I;  1RES A;  1ZTR A;  3M8E A;  3J81 Z;  2QLZ A;  3I64 A;  1I5Z A;  3J7A Y;  3M7G A;  1WVR A;  1O7L A;  4A3G J;  3I9V 2;  1D8K A;  2UXX A;  2MLG A;  3BG9 A;  4IRH A;  2Z9O A;  3OIP A;  1XCV A;  1KYW A;  2R7U A;  3HXL A;  4FE7 A;  2MSY A;  3K4N A;  4M9S A;  1WJA A;  1IRZ A;  1Q1V A;  3HTU A;  3KLN A;  4UV9 A;  1JGS A;  2OD5 A;  1KA8 A;  1E2X A;  3Q3S A;  3QOP A;  3ELK A;  5AIQ A;  4YFN F;  1FIP A;  2L9V A;  2QQ9 A;  4IHY A;  4EM0 B;  1R49 A;  2L3D A;  3LMM A;  3JRB A;  3EQL F;  1PJR A;  2LKP A;  3B73 A;  3HRM A;  3RZD J;  2CGP A;  2HZD A;  2EFN A;  4I2O A;  4M9Z A;  2FNA A;  3LA2 A;  1K78 A;  1JKR C;  4N0B A;  2BXZ A;  4G6D A;  2ME0 A;  3HGG A;  3CD6 I;  3G3Z A;  3J7Z I;  3BCB A;  1ETW A;  1S3J A;  1HC8 A;  2DU9 A;  3DPT A;  3DPL C;  1R4M B;  1W0U A;  4B47 A;  4ZYH A;  3K4B A;  1P2F A;  3TBI A;  4PJM A;  1KQ9 A;  5ED4 A;  1JJ6 C;  2JZY A;  1Z05 A;  5F04 A;  2HQA A;  4PZJ A;  3HC7 A;  4A6E A;  3I4M J;  3FHN A;  1I39 A;  1G4D A;  2OQG A;  4R1H A;  3X2Q H;  2JSP A;  1FOY A;  3HM5 A;  3VPR A;  1R22 A;  4J00 A;  2KMU A;  5E1X A;  4UVC A;  1O57 A;  2Q8K A;  2QYO A;  5FB2 A;  1I50 J;  3BZC A;  1Z91 A;  2MLK A;  2O0Y A;  4BY7 J;  3LSR A;  2BGC A;  2FQ4 A;  3H0D A;  4JYK A;  1PP7 U;  3B6C A;  2XHK A;  4B3A A;  2KZG A;  5BPD A;  1JTY A;  1BR4 A;  2IA0 A;  3ZN1 A;  3Q0V A;  5FRN A;  3I58 A;  1OCO H;  1SVO A;  3NWS A;  4HLX A;  1TQM A;  2VI6 A;  2WBM A;  1UB9 A;  4XKC A;  3LSP A;  2HFH A;  1VQN I;  2QSG X;  2M45 A;  1Z6T A;  3F72 A;  4D0P A;  1XCB A;  3K10 A;  1T98 A;  2EIJ H;  5J8F A;  2VJ5 A;  4II3 A;  3JRA A;  1O3Q A;  2P5K A;  2H1K A;  1GLN A;  2W4S A;  5DDG A;  3R0A A;  5IYC J;  5H2F C;  4UY8 I;  5D5V B;  2M1B A;  1F36 A;  2CFX A;  3BDD A;  3TP3 A;  4OAZ A;  4IEJ A;  2ZBK A;  4IL6 C;  1W7P B;  1FMW A;  1WI9 A;  1WWX A;  2R7Q A;  2M3A A;  1RNL A;  1E0E A;  3CJN A;  1TLH B;  4L5J A;  2CV2 A;  2EIL H;  4MIM A;  1WPK A;  3I59 A;  3WG7 H;  1IZ1 A;  1PUF B;  3HTS B;  2XC7 A;  2CG4 A;  2O3F A;  4Q47 A;  2CMP A;  4L9T A;  4G9Y A;  2CW8 A;  1WI3 A;  2XB5 A;  3L9F A;  2ECC A;  4EQQ A;  4FCY A;  2RGV A;  4CCK A;  3CCJ I;  5GP9 A;  3CJT B;  4G6T B;  3HKZ A;  4YII A;  3FXK A;  2FQ3 A;  5ICF A;  1RR8 C;  1LE8 A;  1R58 A;  2PBI A;  3GX4 X;  3KE2 A;  1MMD A;  1QZZ A;  3TO9 A;  4Q48 A;  3ASN H;  1D0Z A;  1X58 A;  2RV8 A;  2ZSH B;  2IW5 A;  4R79 A;  3DTK A;  4F7Z A;  1GT0 C;  4V2F A;  3LWF A;  1CGP A;  3VB2 A;  4XLE A;  5H6R A;  2PLY A;  1ETY A;  2FMY A;  3G2B A;  4RB0 A;  4ZDO A;  2HPI A;  2R4G A;  1W7P D;  3ABT A;  4MLO A;  4XOR A;  1LQ1 A;  4DQ2 A;  2R5Z A;  4NDL A;  1RRJ A;  1BI0 A;  4ZZD A;  2IBD A;  3GME A;  5CVU A;  4KT6 A;  3GCM A;  4UUT A;  1W36 D;  3J7Y J;  4QTR A;  3QU3 A;  1X1A A;  1QRY A;  4LK0 F;  3P5J A;  1SC7 A;  3ZQH A;  1XDS A;  1KU7 A;  2VQC A;  1A36 A;  2RNG A;  3K2Z A;  1D0X A;  2ZB9 A;  5DCM A;  3IC7 A;  1IGN A;  1ZAR A;  2IRF G;  5FKK A;  1RC9 A;  1ZGW A;  4WXC A;  1YHQ I;  2A68 F;  1ZYR F;  3LSM A;  1W1W E;  1EKE A;  1HKQ A;  2A69 F;  4A12 A;  4X0G A;  2X0L A;  1H9T A;  2NRA C;  2XPW A;  4A6D A;  2X6W A;  3CMA I;  2A07 F;  5BMZ A;  2LLK A;  5A2Q K;  1SD4 A;  3F21 A;  1UJ8 A;  2HYF A;  3OYL A;  4AYB N;  3CO6 C;  2QQA A;  3PL8 A;  2HOE A;  3HG9 A;  3FHZ A;  1U5T C;  3EPZ A;  2DT6 A;  1SFX A;  4P5O A;  4MQ9 F;  2Q1Z B;  2BY0 A;  2D5V A;  2HYJ A;  2VT2 A;  2M0C A;  2ZXW H;  3C18 A;  4XMY A;  3WTV C;  1MH4 A;  1B8I A;  1W4M A;  1ETQ A;  1TWF J;  2DOA A;  3BLY A;  1ULY A;  3M1C A;  2HOT A;  2F5E A;  4N9I A;  5EG0 A;  1FBS A;  2V9P A;  1IXS B;  3OWT A;  1FYK A;  3REO A;  1YG2 A;  5GAE J;  2VPL A;  5M5Y J;  4XM3 A;  2L7M P;  1KU3 A;  4HSR A;  4C3H J;  3B02 A;  2DA5 A;  2PFB A;  3G1L A;  5DEQ A;  5J1U A;  4DIQ A;  2QQ8 A;  4II2 A;  3HSR A;  3UKG A;  1I1G A;  1DQU A;  4BE1 A;  2JJ7 A;  2DQL A;  4LLL A;  2Z5U A;  4RAG A;  5ICC A;  2STW A;  4OOI A;  4CYC A;  4MGR A;  3OYG A;  1BBY A;  4ZJZ A;  2Y9Z A;  4BXX J;  1KQ8 A;  2DDB A;  1BL0 A;  2VQG A;  3VDX A;  1DGR M;  4ON0 A;  2R92 J;  3IHU A;  3VEP A;  4C30 A;  4XSZ F;  5E17 F;  4E4H A;  3ZQL A;  3ONQ A;  2FD5 A;  1FBQ A;  2K7L A;  2CQX A;  2ZNY A;  2ISY A;  3DEU A;  4NQW A;  1IJW C;  2QBY A;  4CO8 A;  1TP4 A;  5JHF A;  3I0T A;  3FXM A;  1YJ9 I;  2FML A;  3O8G A;  4FET A;  2XF5 A;  1FY7 A;  4M3D A;  3NRV A;  1FC3 A;  4A0Z A;  3R4K A;  3A03 A;  1XMA A;  2ZME A;  1XMX A;  1IDZ A;  3OS0 A;  3ABK H;  3TL4 X;  1KQ0 A;  3BJA A;  1JUS A;  5L3E A;  4GFB A;  1MD0 A;  3E5U A;  1SAU A;  2DBB A;  2RVC A;  4UXN A;  3HYI A;  2WAQ N;  3MQ0 A;  4DZP A;  4ZDL A;  2PJR A;  3E1S A;  3LFU A;  2X4H A;  1EA3 A;  2HGC A;  2JPC A;  2O8K A;  4XQF A;  2JA2 A;  5F27 A;  3RSN A;  2XV4 S;  3PSI A;  4YFK F;  3VOD A;  3L2Q A;  1VQM I;  1K79 A;  1IRX A;  2A61 A;  3IH2 A;  1IN4 A;  1L3L A;  1Y0U A;  4F3Q A;  5EJC A;  2V1X A;  4Y33 A;  1XDU A;  5KHD A;  2OTJ I;  2XPV A;  3LSG A;  2GIV A;  3WU1 B;  3AAF A;  3QPL A;  3DU5 A;  4AU7 A;  1XSD A;  2IPQ X;  1XSV A;  1IW7 F;  2RC4 A;  2YX7 A;  5BNG A;  5GTI C;  5LHH A;  2VON A;  3OOU A;  3A1Y A;  3DEE A;  4M3E A;  2AHQ A;  3SZT A;  1ZR4 A;  5J8C A;  3IH3 A;  1HDD C;  3OYJ A;  2J5P A;  1SFE A;  4UB6 C;  3OYA A;  3ERM A;  1MNE A;  5F6F A;  3OL3 A;  4B48 A;  5FGM A;  4C3I J;  1X4O A;  2DMU A;  3CCR I;  4LLG F;  3WTS C;  2Z1D A;  3NEU A;  3HRT A;  4GXO A;  2HQ5 A;  1OMI A;  2WC2 A;  2DFE A;  3LFK A;  4A3B J;  1UMQ A;  2JVH A;  2PI0 A;  4XK4 A;  2HXO A;  4CUG A;  4QIW N;  1X3Z B;  1X2N A;  2J5O A;  1NTC A;  1S9H A;  4IHX A;  2L2O A;  4PJN A;  2O9L A;  3LST A;  3H3V K;  1R1V A;  2M7B A;  4DW6 A;  2FOW A;  2M4K A;  5C4J J;  4BGD A;  2FA5 A;  4M3F A;  2Q2E B;  2EJR A;  1T39 A;  3L7W A;  4CXF A;  4LB5 A;  5EEA A;  5TRD A;  3RI4 A;  4XOP A;  3W6K B;  4L5E A;  2XPU A;  3KYD B;  1JE8 A;  2JRM A;  2KIS A;  2W7N A;  1Y1W J;  1HW1 A;  2PQ8 A;  3LSI A;  2DCE A;  2DA6 A;  2JA7 J;  3CDL A;  2DMQ A;  1GDT A;  1IXC A;  4L9V A;  2Y30 A;  4IQ4 A;  2BYV E;  2XGE A;  1B72 B;  1Z3X A;  2ECB A;  2HYG D;  3KLO A;  2EZH A;  1ZRC A;  4X6A J;  3S1M J;  4GO1 A;  2NS7 A;  2EFO A;  4W1U A;  1HA8 A;  1NHA A;  3K4L A;  3MKW B;  1IN6 A;  4J19 A;  4NC7 A;  1CQT A;  2VB6 A;  2Y0S A;  4IHV A;  3SDB A;  2O6G E;  1RI7 A;  3E97 A;  3I3L A;  3GLX A;  4L0Y B;  2XAG A;  1WJ5 A;  1YTY A;  3T8T A;  2UWM A;  2M8E A;  3BRO A;  2EZL A;  4I0A A;  4AVZ A;  4OIN F;  1OYY A;  5IYB J;  5GAG J;  5E20 A;  5LRS A;  2BY2 A;  1JXS A;  2BXY A;  1BR2 A;  3PFY A;  2V79 A;  2VPR A;  3BG3 A;  3V8J A;  2DJN A;  4YG2 F;  3S1Q J;  5E3O A;  2NVU B;  2CUE A;  1B4A A;  1ODD A;  3CTA A;  4RLQ A;  5E3L A;  3HRU A;  4RDU A;  4I98 B;  2JT1 A;  2A3S A;  3W3C A;  4XRF A;  2X6Y A;  2O03 A;  3BTC A;  2O61 A;  3OYH A;  3M3Y J;  2BW3 B;  4WXD A;  4A3F J;  3A4C A;  2HTJ A;  2CS3 A;  5CQG A; 
#chains in the Genus database with same CATH homology
 1VQ9 I;  1QA6 A;  4UY8 I;  3G71 I;  4IO9 F;  2OTL I;  3CCR I;  4IOC F;  1YJN I;  5DM7 F;  3DLL F;  1YIT I;  2K3F A;  5GAE J;  3CCE I;  3PIO F;  3CC4 I;  1VQP I;  3G4S I;  2E36 A;  5GAD J;  1VQ6 I;  3CC7 I;  3CF5 F;  1ACI A;  3PIP F;  2H8W A;  3CCJ I;  2FOW A;  3CJT B;  1YIJ I;  1VQL I;  1VQO I;  1VQK I;  3CCS I;  2ZJR F;  5DM6 F;  1Y39 A;  3CCL I;  2NXN B;  2ZJP F;  1VQ8 I;  1MMS A;  3CCQ I;  1FOX A;  1YJ9 I;  3CD6 I;  3J7Z I;  4IOA F;  1HC8 A;  2JQ7 A;  3I56 I;  3CCM I;  3J7Y J;  1VQ7 I;  1S72 I;  1VQ4 I;  5GAH J;  1FOW A;  2E35 A;  3CC2 I;  1FOY A;  4V19 K;  3G6E I;  5JVG F;  1YHQ I;  3CME I;  1YI2 I;  5GAG J;  1VQM I;  3I55 I;  2QA4 I;  1YJW I;  1VQ5 I;  2E34 A;  3CCV I;  3CMA I;  2OTJ I;  2ZJQ F;  3CCU I;  2QEX I;  1VQN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...