3I55I

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3i55I00
1VQKI 3CCQI 3CMAI 1HC8A 4V19K 1YJWI 1MMSA 1FOWA 3PIOF 1VQ4I 5GAGJ 1S72I 2QEXI 1VQ9I 3CC7I 4IO9F 3DLLF 2E36A 1VQOI 2K3FA 3CCVI 2QA4I 3CCJI 4IOAF 3G6EI 1YITI 3CF5F 3I56I 1FOXA 3CC2I 1YJ9I 5GAHJ 3J7ZI 2ZJPF 3G4SI 1QA6A 3CCMI 3CCLI 1VQLI 5DM6F 3CCEI 2OTJI 1VQNI 5DM7F 2NXNB 2E34A 3CMEI 1YJNI 1YI2I 3CD6I 3G71I 2E35A 3PIPF 2FOWA 3CC4I 5JVGF 2ZJRF 1ACIA 4IOCF 2OTLI 4UY8I 2H8WA 3CJTB 1YHQI 1VQ6I 1VQ7I 2ZJQF 1FOYA 3CCUI 3I55I 3J7YJ 3CCRI 1VQ5I 1VQMI 3CCSI 1YIJI 1Y39A 1VQ8I 5GADJ 2JQ7A 1VQPI 5GAEJ
chains in the Genus database with same CATH superfamily
1SFOJ 1R5HA 1R36A 2R93J 4HW0A 1WH5A 4NC8A 4BACA 1HC8A 3DCFA 5L3BA 3H3ZA 3GWZA 3OOUA 4UB8C 4IHSA 3SFIA 3I53A 4FHTA 5BNGA 4XN0A 4A93J 3VSKA 1LFPA 3J80Z 1XN7A 2HOAA 2Y0SA 4QSHA 3F21A 3LA7A 5HLTA 1IRGA 3H1CA 4HV5A 1MMNA 4UUSB 1R23A 2M3AA 2LY2A 4G6DA 4NNJA 4CDGA 3P9KA 3ABKH 3R4KA 3OV8A 1LNWA 4WX9A 2XAJA 3CUQC 1GUUA 2QZ8A 3RYPA 1FMVA 4BE2A 2OA4A 1RPWA 1DPRA 2D5VA 5LRRA 4PCQA 2L4MA 1TZLA 3KZZA 4RLFA 1MMDA 5E3LA 3L2RA 4YELA 1SD4A 3SDBA 4CCNA 5FRNA 4G9YA 5A2QK 3H35A 4B44A 2CUZA 1KU3A 2VPRA 3HRUA 1P9QC 1GXQA 1XC5A 2COMA 4HZFA 1LB2A 2XF7A 1DGRM 2DT7B 4DOZA 1FIPA 2VC1A 1EF4A 1LDDA 2CQQA 3HEFA 5H20A 4LB6B 3RCOA 1MNEA 2R7RA 1APLC 4ETSA 2FE3A 3S15J 2R7UA 1RRJA 3X2QH 4KT6A 2ELKA 1VQNI 5DM7F 4C3IJ 3BPXA 1P4XA 4XKWA 3GFJA 3BC8A 3ZQGA 3HC7A 4B48A 2WBMA 3K2AA 4M3GA 3H3VK 2EV0A 4ENKA 3QOPA 4LK1F 3HIFA 2H27A 4Q47A 5CVVA 4DIQA 1FOKA 4FE7A 3HTUA 2DPDA 5HLIA 1DP3A 3V8LA 4HNVA 1FZPB 2ZJRF 2CUEA 1FC3A 2VL8A 4C30A 2DPUA 1STZA 2ZFWA 2NS7A 4BDYA 4RS8A 1HCRA 2VXZA 1MBEA 4Y7NJ 1CF7B 3CUQB 2E7XA 1JHHA 3HOWJ 4CCJA 2N8GA 2FNAA 2OZUA 3I58A 2KKOA 2E2JJ 4HG2A 4G6TB 2VOPA 4CICA 4FASD 2KFDA 3QYFA 1Z3YA 3HOSA 3W6VA 5DCFA 5EEGA 3SDGA 3AG4H 1Y39A 1IJWC 2DT6A 4HDVA 5DEQA 3VYRB 1ETXA 1EH8A 3RKWA 1R71A 2P4WA 2W7NA 2F6CA 1S29A 4PSWA 4L5IA 4WXHA 2YS9A 2DFHA 5CJ9A 2HVSA 3ML6A 4BBSJ 1N75A 3PQJA 3H5RA 3DKWA 4YEJA 1JJ6C 2K4BA 3BZCA 4BQNA 5J6XA 4XKBA 4LB5A 2OZ6A 2ZC2A 1ZG5A 1T38A 3IKVA 4M3EA 3M7GA 5F64A 3A01B 1FSHA 2VT3A 4BHPA 3F6OA 2KZVA 4EJVA 3WTVC 3MZ8A 1W7PB 1PDNC 5J4VA 3JRGA 1YX5A 3U1KA 1ZH5A 2JZYA 2QUFA 2R7FA 4L9TA 4BHBA 3T8RA 5J47A 3RKQA 5CLSA 2VJJA 3I3LA 4MHGA 2PLYA 2K9SA 2L7KA 2DAOA 2HQNA 5KK1A 2R7QA 4M3BA 4U0WA 1BI2A 3EDPA 3K4CA 5BMZA 3B02A 1Z67A 1AOYA 3CC2I 2UV1A 2QQ8A 2WWYA 2W4SA 3M1EA 4KUMA 5FJ8J 4ZC3A 1HW2A 4IVNA 3K70D 4ENNA 5DD4A 1HDPA 3DWLE 1H0MA 2OAZA 2J5PA 4O3MA 1QA6A 3OMYA 2MYSA 4F92B 5E1WA 4RGSA 3AG2H 2EFOA 1ZQ3P 2GOMA 4XL9A 2YUSA 2A68F 2ZJ2A 3MEXA 2P5VA 4BY1J 4NDLA 2B63J 1IW7F 5BPDA 2D1VA 3DU6A 2BEOA 1LE8A 4H0EA 1D0ZA 3AFHA 3FXUA 2G7UA 5E1XA 2HOEA 1I1GA 2CJJA 3DPTA 4IHTA 3EUHC 2LMDA 5FLXZ 2ECBA 2JA8J 3BPVA 2Y9YA 2JJ7A 5F04A 4D7MA 3MWMA 2M2EA 5D6FA 1RR7A 1SD7A 1H9TA 2NNYA 4WXDA 4XSZF 2DK8A 4G12A 1XMKA 1Z9CA 3JCUC 2HZDA 1Z91A 3E3VA 1KGSA 4A6DA 5D4SA 3FKIJ 5M5WJ 1YO5C 4XOTA 5JHFA 3O8HA 3J7YJ 4G7OF 3CCSI 1AWCA 4A3JJ 1QZYA 1V5FA 4Q48A 5LD2C 1T0FA 2CV0A 3HGGA 4ZDPA 3S3OA 2E5ZA 2FRHA 1TW2A 1ODDA 2PEXA 2PMHA 3DEUA 3K4LA 3N05A 5GAEJ 3BJAA 2CQ7A 1RESA 1JT6A 5D5VB 3M9AA 1XGNA 2HDWA 4A5NA 1UHWA 1O7LA 4G94A 5GPCA 2X51A 1RI7A 3HRTA 3U21A 2WTEA 5EYRA 3IWZA 2OCEA 4Y3OA 1JTYA 2ICWG 2GA2A 3PIOF 4BDZA 4II2A 1F43A 4IZZA 1PP8F 2MBFA 3S2WA 1XX5A 4C3HJ 3ULQB 2W48A 1S9HA 4A5MA 2V6EA 2DA7A 1ON2A 2QEXI 5L3GA 3HOXJ 2ZMEC 2Q0OA 1HSJA 4LIVA 2XRNA 2XUBA 5FLXK 3MD2A 2LREA 4DW6A 1ZKGA 3VFZA 2F48A 1JI8A 5CVJA 1AKHA 2HS5A 4S04A 4CYDA 2JA5J 1BR4A 5CQGA 2NRAC 3TO7A 2Z9OA 2GXBA 1JGSA 4AC0A 1LEBA 2I5UA 4B09A 3T5XA 2BGCA 4CYCB 1QNTA 3DPLC 5JVTA 1VNDA 2VJIA 4V2GA 5LGUA 4LK0F 3LAJA 1TT0A 2FOKA 2AXLA 3ZQHA 1QU3A 3V7SA 4B43A 2WV0A 1LEAA 2CQNA 4LG3A 2CSOA 3TW6A 2TRTA 5EF6A 3GYHX 1BBYA 3IKTA 2VONA 2A07F 1D3YA 1MSFC 2H8RA 3L2UA 1RR8C 2DCEA 2LY9A 3BG6A 1JKPC 3QP6A 3CMEI 1U9OA 3Q5FA 5KAIC 2O6GE 1YW9A 4E7JA 1MJAA 1M1EB 3KP3A 1RKTA 2VOOA 3F8BA 4A3GJ 2IPQX 2AHQA 3GEZA 3LSGA 3VYSB 4PUSA 4GYGA 1KQ9A 2FOWA 2ZMEB 3CMMA 3CC4I 3IV5A 4EJTA 2KHMA 3F8CA 4HQMA 2NYXA 1MH4A 2VLAA 5EZGA 1UELB 4PGGA 2OV7A 4Q5SF 2Y75A 3LSPA 4HNUA 1K4SA 4RLQA 5L3EA 3KETA 2EPFA 3H92A 1YIJI 4L5EA 2W85A 2V6CA 3RSNA 3KP6A 4BUPA 2PQ8A 4U87A 2JQ7A 2R5YA 4L9JA 4QTRA 5IOZA 1MGTA 3LA3A 1GXPA 2MC3A 2Z5UA 2CW7A 2IEKA 3M1CA 3HOZJ 4ESFA 3HSEA 3VYTB 3TBIA 5FD6A 1ZRFA 4V19K 3LOCA 2JK3A 2LFBA 4CA0A 2HQRA 5AIQA 1ZARA 4G8XA 2FEZA 1PUFA 5CVUA 4L0ZB 2QSHX 1NG6A 1FOWA 2LK2A 3BZ6A 3NRVA 3PUFA 5TGTA 3RIRA 2K7LA 3RQIA 4HPQA 4AYBA 5D8LB 3WTXC 2YSRA 3ZXSA 2M1BA 1B6AA 1U8RA 3CP8A 1PJRA 4WK8F 5EJCA 3HOYJ 1POGA 5K7FA 2ZB9A 2VPLA 5K7HA 4E6KG 3S93A 5DS9A 2OQGA 5HLHA 2CG4A 4RGXA 4BNCA 2ELHA 4ZDLA 2M5WA 1X2NA 2DODA 2HR3A 1C0WA 1LDKB 1WCMJ 4GDFA 3JREA 3S14J 4IX7A 3D0SA 2DBBA 2VODA 3JRAA 2HI3A 1Y8RB 2XAHA 2DYSH 5FD5A 1U9NA 1WJFA 2CMPA 3G4SI 3TMOA 2WV1A 1W5SA 4DYCA 2K4JA 1Z0XA 1ZRDA 4AIDA 3K70C 5GTIC 3KE2A 4KN7X 3W6KB 4O5VA 1GHCA 2VASA 5IYBJ 4NB5A 2DXIA 2UXNA 2XB0X 2IRFG 5EGOB 2IA1A 2BY1A 4CCMA 4A3BJ 3ROUA 5IYDJ 1IN5A 1D1CA 1U78A 4BJ6C 3PL8A 3HBLA 4P55A 1O57A 5IPAA 5EGOA 2Y0MA 1N77A 2NXNB 4HRIA 3I59A 5DDGA 2QENA 3OYCA 1K78A 3ZOBA 3DV8A 3U1DA 2IT0A 3ZGKA 3DTIA 2L0KA 3IH4A 2HDDA 5JLWA 2DOAA 2VKHA 2JT1A 4ZYEA 1R49A 1Z1DA 2V26A 1L0OC 3PM1A 2KIUA 2EK5A 2JVHA 2D45A 2PI0A 3BR2A 3ABUA 4ZYDA 2AQEA 5E8IA 3FM5A 3GFMA 3OYNA 2R7ZJ 3K4JA 3RPUA 2L7FP 4BQQA 5M3MJ 2DDAA 3CJRB 1BC8C 3OR1C 1TQIA 2ZBKA 3CJTB 1H8AC 1OR7A 4ENJA 4DBQA 3PSFA 2MA3A 2LKSA 1W7PD 2VKDA 3ZCOA 2A6EF 2G7HA 1QZZA 1PP7U 4PJLA 3ECOA 3F0CA 1VQ8I 3L2QA 1DP7P 1D8JA 3LFUA 3GXOA 1X4PA 3J81Z 1G3SA 2P0WA 3C3WA 4RB1A 2K5CA 3WG7H 2XROA 1JXSA 3A0HC 2IXSA 2RNGA 3CCQI 5F6FA 3ZMTA 2KISA 3DF8A 5CQEA 4BS9A 3L00A 5D8KB 3S16J 1MDMA 5FKNA 3JTGA 3CDIA 2LF8A 1GLNA 5IP7J 4FX4A 2KIQA 4MFDA 2HYFA 1KZHA 2V1NA 4KISA 1CQTA 1VQ9I 4KDPA 5DCMA 4HSRA 3DLLF 2X9DA 3W2AA 1WSUA 1W5TA 4FT8A 4HEA2 3BTCA 4ZZDA 1S5LC 2DA2A 3FF5A 1U5TA 2QA4I 3K6GA 1RZ4A 3JRBA 1Y56A 2E2HJ 3ISPA 2DYRH 2BZTA 3BT9A 1WJCA 1X1DA 2QKMB 5LHIA 1FOXA 1G3WA 1TNSA 2DMTA 5JI6A 1IN7A 4J01A 3J7ZI 1IDYA 4BAYA 2RQQA 1YRNB 2DJNA 2H6CA 4B3AA 1K6YA 4E7HA 2EBIA 5E1ZB 1GV5A 3KEYA 1BIBA 3W2WA 2P5LC 3PO3J 1I6HJ 3EUKL 3W6JB 3ABLH 3J81K 1GV2A 3V8JA 1X1BA 3JRCA 1QRYA 2EINH 3L7WA 4YFKF 2DJIA 1ZG1A 2VIXA 2RDPA 5F08A 1W4MA 1S6LA 1WHUA 3A1YA 3DLAA 2XPWA 3BG7A 3C2HA 4HLXA 3HSFA 2VI6A 4YFXF 1DU6A 2V1DA 4CSWA 1TLHB 1ETYA 4OIOF 3PIPF 3BR0A 1T98A 2P81A 3DBRB 2MSYA 3I4NJ 3QRFF 1WFXA 2UZKA 3H0DA 2WY7Q 1ETVA 2FU4A 2DTRA 4EATA 2HDCA 3BJOA 4IKFA 5M3FJ 2EB7A 3WE3A 1TW3A 2L54A 1I6XA 4RAGA 3V42A 1AA7A 4JX4A 2R7VA 2HZTA 4BXXJ 1K7AA 1U2WA 3UNGC 1QPMA 2EILH 4MTDA 1IN6A 3ZPLA 2JMWA 2M87A 5CYVA 5HS7A 2ME0A 3HOTA 3ERMA 1KU2A 2KIFA 2RREA 3U2RA 4DYQA 1SEUA 2Q2EB 3QPHA 1ON1A 2MFZA 4EJUA 2RVCA 5ILVA 2JSPA 2A61A 3PQKA 2DOEA 5B1AH 4ESJA 4RAYA 3DEEA 1IC8A 4A3LJ 1TWGJ 1BI1A 3E5XA 2CRGA 4OU0A 2GQQA 3MZHA 4X0GA 5GAGJ 1KQ8A 2I8DA 1E3OC 2XPVA 3ZMZA 4KIFA 2Q8KA 3GZNB 3RDIA 3K9TA 3GZ5A 3F23A 3LWFA 3K4BA 4HA8A 1O3TA 1K6OA 3VSLA 2FUG2 1LFBA 3M4OJ 4M73A 3ZQLA 2B9SA 3GVAA 4IHVA 2PN6A 3EPZA 2LLKA 2VBYA 3QPLA 5DD8A 3J7AY 2JRTA 4BEHB 5LHGA 2DMPA 1MW7A 3CF5F 1B4AA 4UB6C 1IUYA 2DN0A 5L3CA 1FYKA 3E1SA 5GAHJ 4D7NA 3S3MA 3E6BA 2AO9A 3DXJF 5D4RA 1QBJA 5LGNA 2E60A 3OR2C 1U0JA 1UJ8A 4R1HA 4A3IJ 2JPCA 3R0JA 3FXKA 2KRCA 4K2EA 1KYWA 2W57A 3DTEA 2FMLA 4N9IA 2VQLA 4UUSA 2FA5A 3ZR8X 2TCTA 4MO7A 1FNNA 3FMQA 3A2KA 1XMXA 5DYMA 3LMMA 3HKZA 3F8NA 4A0XA 4KFCA 3IUOA 1D5YA 1FY7A 3C1DA 1RUOA 1MBHA 2HTJA 3HG9A 2E1NA 4LIUA 2ZXWH 3NAUA 3KP2A 2A3SA 3QPTA 4DYRA 5KNLA 4Q4ZF 1OQYA 2MH2A 2M8EA 4IHYA 4ZDOA 2P5KA 4Y15A 3T0YA 5C4XJ 3WODF 4HDUA 5GP9A 3SJMA 3GMEA 1ETKA 2XB5A 4GRIA 2XHKA 3V7CA 1XSXA 1T56A 1BIAA 2H1KA 1IV8A 2IVMA 4F52A 1QQIA 4MTEA 2STTA 1B9NA 2KIMA 1V4RA 2OCCH 3TDZC 1DQUA 2BXYA 2K9QA 3JRIA 3CO6C 2Y31A 2O61A 1FYLA 4C2MJ 4XIDA 4XKCA 3J80K 3E6DA 3D5LA 1RUNA 3WTZA 3IWFA 3LSHA 2QGUA 4BGDA 5FFXA 3K69A 4UV9A 4I09A 1VF9A 4BL0B 4B4CA 4UNOA 2O8KA 3CMYA 1OKRA 3UKGA 2NVYJ 3PFIA 5AIPA 2Y2ZA 1CF7A 1WVRA 2A6TA 3CUQA 4NC7A 1JE8A 2JRMA 1QHHD 4RM3A 2FD5A 1BA5A 2NNNA 2OJED 4LGWA 3BLYA 4XORA 5EG0B 3JTHA 3CQZJ 2WAQN 4QIWN 2RAEA 5M5YJ 2K3FA 1JT0A 2FMYA 1FJLA 4BHCA 1O7FA 2K85A 2WB1A 1R7JA 2MGQA 1OCPA 5J3LA 1WZ2A 5K5OA 2QCOA 4XR6A 2K9MA 3G6EI 2BW3B 3GLLA 2IJLA 2YPRA 4EJWA 1SAUA 3RYRA 2HOSA 4ZZLA 1SC7A 2CW8A 1A31A 4F91B 2BY3A 1K79A 3QYBA 3FXJA 1LFUP 5H6RA 2C6YA 3A01A 3JSOA 4LMYA 3CCYA 1G8XA 2EZIA 2G9WA 2M34A 2EA4A 1W7PA 3QQAA 4AU7A 1MJ9A 1NK3P 2CQKA 1R1TA 2X6WA 3JRHA 3BCBA 3ECHA 4I76A 2EJRA 2Y0SN 6PAXA 1A36A 3KYLA 1REPC 4MQVA 3FXQA 5ERIA 1T95A 2RNJA 4E70A 3E97A 3HZJA 1TTYA 3BTLA 2VC0A 4LFUA 3OY9A 2WAEA 4KNYA 2JVGA 1G4DA 5ICCA 3Q0WA 3WGGA 1WI3A 1I1SA 1IGNA 3LSMA 1B8IB 1X3WB 3DFGA 2RV8A 3SZPA 4EV0A 4CH7A 3GTKJ 1YLFA 2UXXA 2EFPA 3FK7A 3JAMZ 1GDTA 2X6OA 1IN8A 3G71I 4EM0B 2HKOA 4NC6A 3LA2A 3IRRA 3C2GA 2XASA 3SEQA 1OYWA 1W5CC 3OIQA 2F5FA 2DT5A 3FISA 2V9VA 1TQMA 4HNTA 1R1UA 4EQQA 2FJ1A 2M7BA 1YHQI 1K61A 3V4GA 2YU9J 2Y30A 1EH6A 3LFKA 3S2DJ 4DBRA 3NARA 1X4OA 3FBIB 5F27A 1FWZA 4BXUA 1ITYA 3CCUI 4Y52J 3COAC 4G7ZF 3FMRA 4U88A 3M07A 2GLOA 2F2EA 3TW7A 1IN4A 2O0YA 3P7NA 1Z77A 4AWXB 2L9NA 2CV2A 2FBIA 4MQ9F 3QU6A 2H09A 2XAFA 1XSVA 3P9CA 1JUSA 2AS5F 1NK2P 1S7OA 3KFWX 2W84A 3NWTA 3GFIA 3BG9A 2MC4A 2CS3A 3G1MA 4F3QA 1UAAA 1RC9A 3AAFA 4EJOA 3FHNA 4FETA 1XDUA 4XRSG 2L7ZA 5F1JA 3ZP5A 5D5XB 1PVEA 2B0LA 3ZQFA 1FIAA 3N4MA 2MW8A 2MG4A 4NQWB 2BBYA 3M8EA 2DMUA 3OYMA 3W3CA 3SZGA 4O6JA 1TL8A 1A5JA 3ERED 4CCLA 2DA5A 1YE9A 3CESA 4NBQA 4QWQA 4RB0A 4MNUA 3GTOJ 1NHAA 2EIKH 3JAMK 3ZN1A 3O6BB 3KLNA 2OUMA 3E7LA 2HYJA 3GTPJ 3O3KA 4XSXF 4E7IA 3HRMA 4OINF 1G59A 4PK4A 3GO5A 1Z7UA 4CZZA 2CUJA 3D5RC 1HKSA 1ZAOA 3FDYA 1F4KA 3KP5A 3S8PA 4PJNA 4AVPA 4U7DA 1U8BA 3CCMI 3RJPA 3JRFA 2AXTC 2CW0F 1JKOC 4I02A 3EUHA 2KL4A 3I4PA 4F55A 4FISA 2L2OA 3QWLA 3C2BA 2NOGA 3HXLA 1SAXA 4JYKA 3GTJJ 3MZYA 3H36A 3LQRA 1IUFA 1XMAA 3DKXA 4M9ZA 1IF1A 1N25A 4IEJA 4D9JA 3V7RA 4EVIA 3PSIA 1JKQC 1MIJA 4BY7J 3SYTA 1YIOA 2VE8A 2LVSA 2DW4A 2O5RA 2MH9A 2DO7A 2L9VA 2QVOA 3N97A 2JA7J 2V9KA 5F0CA 4CYCA 2D2WA 5HNHA 4N4OB 2NOJB 2P6SA 3F8FA 2KZGA 4MIMA 1R58A 1YOVB 1Y8QB 1UG0A 1ZR4A 3BP8A 3H9QA 2IGMA 2DDBA 2RC4A 1MSEC 4JK1X 5HODA 1VQ5I 3FXOA 4QPQA 1B1BA 2IA0A 2W25A 3WTYC 3GLXA 3ZRGA 4A0ZA 1YS6A 2Q1ZB 3G3ZA 4UVAA 3IP4B 3K2ZA 3TGNA 1IRZA 5B66C 5J1YA 4UVBA 3SXYA 3ZMVA 2ZMEA 1O3SA 5J8CA 5LLQA 1YJWI 1NTCA 1G3YA 4OIRF 1E2XA 1BJZA 1UG2A 2Z1DA 1VQ4I 4HX7A 1B72B 1IAWA 1HSTA 5TRDA 2XGEA 4M72A 2LYCA 2LKXA 2HEOA 2VKVA 5BOXA 5B5EC 4A12A 4HF1A 1JUMA 2KRHA 3BDDA 5IP6A 3OYKA 5E3NA 1JTXA 2R7DA 3RQ4A 3LSKA 3FMSA 1ZLJA 2OD5A 4OAYA 5H6QA 3HHHA 3Q9VA 4OMZA 3QYEA 4OMYA 2OC6A 5LEJA 5L3FA 4UUTA 2FBKA 3B6CA 2GA1A 3Q0VA 2LNBA 2HOTA 2ZKZA 4ZH4F 2ZJPF 1Z7LA 2MLGA 1H89C 2KDOA 5K5RA 2B7EA 5HDNA 1ZTRA 1MBKA 4I0BA 3OS2A 4X6AJ 3CUOA 4A6EA 3ZQ7A 2NVXJ 1FBQA 3I0TA 3NWSA 1T08B 1X1CA 3RI4A 4LLNA 2VBWA 2L02A 5GPAA 5KVRA 1W36D 5HNFA 3WG9A 1J75A 5FKMA 4ZTJA 2BYVE 2E34A 4E7SA 5C3EJ 4YFNF 3HTSB 4D5FA 1J9IA 4Y4RA 2DA4A 4AIJA 4C2TA 5LHHA 1GVDA 3G1LA 1TC3C 2E7WA 4PDKA 2E35A 1VTNC 2HTSA 1DU0A 4HQEA 2GXGA 1ACIA 3RPQA 4XLHA 1X2MA 2F5EA 3L2WA 5HDGA 2NVTJ 4IXAA 4Y17A 5E20A 4E4HA 3WTUC 2MD5A 4Y13A 4JBAA 1SVMA 2ISYA 1R5ID 1WKMA 3GTQJ 2JTVA 3I9V2 2V79A 2JUCA 2ZFUA 1IRXA 3I54A 4G7HF 1YFHA 4RAZA 1J2XA 3BG5A 3WU1B 1ZGWA 4LLLA 2ISZA 2V7FA 2VJ5A 4L5JA 3H3UA 3LSIA 5HDKA 1FYMA 2VXDA 2OBPA 3ZQIA 1VI0A 4U7BA 1VQKI 2ECCA 4ZJZA 4YIFA 3SZTA 1DPUA 4H4KC 1LKXA 3TQNA 2E5NA 3BQZA 4XMYA 2ESNA 2HGCA 3OYHA 4YIIA 5FKKA 2FQ3A 1S72I 3L9FA 1W1WE 2M8GX 5JR3A 1SMYF 4FE4A 3F9KA 2QBYB 3B6AA 4ZYAA 4CZCA 1EJ9A 4YG2F 2BVLA 3IAS2 2X1EA 4BJTA 2EWNA 2R7SA 2KMUA 1SVOA 3K0LA 4IOAF 3TDUC 1T6SA 2FF4A 3CZ6A 1YW8A 5JFRA 4XRMA 2ME6A 4AD9A 4D1QA 1FT9A 1FBUA 3FK6A 2EFNA 2M9HA 2O03A 3A02A 4XLFA 4G6QA 3KCCA 3GTGJ 1FTTA 2HKXA 1PUEE 5FO5A 4BKXA 2ID6A 4P9UA 4ABZA 4UV8A 4AYBN 5ILUA 4I6ZA 2FBHA 4MGRA 4GFBA 4PJMA 4PFOA 4FQGA 2QSGX 2IGOA 1USTA 3T8TA 3CCEI 3BJ6A 2J5OA 5J8FA 2LTPA 5EDNA 3DKYA 3F72A 1FP2A 4LG0B 5FB2A 3GX4X 4EGYA 1I50J 4KMFA 1IG7A 1HKTA 3CJNA 2LOOA 1ZGAA 1MKMA 2XVCA 2ZSIB 1R22A 2IA2A 4P9FA 2H6BA 1D1BA 5IP9J 3GUDA 1XPXA 4C2UA 2QWWA 2E2IJ 2JSCA 4HF0A 2W82A 2Y48A 3KX2A 3UR3C 3OS1A 2PJRB 5HOOA 1YRNA 2GZWA 1T39A 3SHFA 3I5UA 2XDVA 2OTLI 4B47A 1ZGJA 5FROA 5FLVA 2H8WA 1XG1A 1WJBA 1JKRC 1Z6RA 1WJAA 1VQ7I 1V54H 2ZJQF 1IV6A 2KT0A 3MVPA 3DBHB 1MJBA 3GBGA 3FWEA 4RA2A 1WGXA 1A6QA 4E7KA 1BOBA 3FZVA 1U3EM 1X1PA 1OYYA 4DZJA 2L01A 4B8XA 1HF0A 3GCMA 4M3FA 2LH9A 4OAZA 4XBFA 3HUGB 3F22A 1SANA 4BQAA 4I01A 4EM1A 3GTMJ 4MLOA 3GTLJ 1OCRH 3LAPA 1LJ9A 4XKVA 4ASNA 2WADA 3K1PA 1SFKA 5K7ZA 2V1UA 2IS1A 2E71A 3ASOH 2ID3A 1A6IA 3E6MA 1ZHFA 1OYIA 2R4GA 2XPUA 2Z99A 1Y0NA 2DOFA 3A03A 2RQPA 4IO9F 1EKEA 1RETA 4HX8A 4PGHA 4KMUX 4A3EJ 4JX5A 3HB9A 2IP2A 3DQVC 4KJZA 4XK4A 2R5ZB 1SFUA 3CCVI 3H9JA 3O8GA 1R1VA 4QLCU 2ELJA 4DNCA 4P5OA 5J4YA 3S3NA 1WWXA 1Q1HA 2R3SA 1XDSA 5EEHA 4AIHA 2LG4A 4M71A 3I56I 1QZEA 2Q2EA 4A2UA 3BR5A 1YJ9I 2KLOA 4AUXA 2LBFB 1S8NA 2DA6A 2KJBA 4F7ZA 3AL0C 4XM3A 5FRMA 4BQOA 2GIZA 1USSA 2YR2A 1TT5B 4M9XA 1RNLA 4Z6YA 5BS6A 1VQLI 2WY8Q 4BU2A 2M30A 3ZMUA 2EZLA 3HM5A 4ZTFA 1MD0A 5B3SH 2K02A 1LQ1A 1B59A 2GAUA 1WQ2A 4AIKA 2CO5A 4FX0A 1FPQA 1LUJB 2KDZA 3K1NA 5EEAA 2BOLA 3EYIA 2XAGA 2HXIA 1ZG3A 3U9GA 4HOBA 1W36C 4BEHA 2BVMA 2DMNA 2WA0A 3BQYA 1QVTA 1YTYA 1XGOA 5KAFC 2Z33A 2L4AA 3FX3A 1F1ZA 3VDXA 3FHZA 3CD6I 1D0XA 3FM3A 1KQ0A 4IPAA 3OYDA 1OLTA 3PFYA 5E18F 3FXMA 1MMGA 2O8XA 3ELKA 3A0BC 1T2KA 4CXFA 1ZRCA 2JPBA 1XS9A 4OIPF 3IAM2 4UY8I 4I7HA 3M8JA 2O3FA 4RB3C 4S0HB 4HF2A 1ZELA 1Y6IA 2XSJC 4BE0A 4OWRB 4RM2A 1B9MA 2QF7A 3TP0A 4IRHA 3I55I 1JHFA 5ILSA 2K40A 2VBZA 3BCAA 3KZIC 2K86A 3LL7A 4N0BA 5TJJA 3IHUA 4IF4A 3VB2A 3CO7C 3AL0B 5K1YA 4LITA 2PX9A 3RKYA 2K27A 2A69F 3DBLB 5C44J 1R6RA 2MLKA 5KCMA 1HKQA 2I10A 2M7AA 3OOPA 3CMAI 4PFPA 5JHUA 3KP4A 9ANTA 2HPMA 1G6NA 3ESWB 1X3ZB 3SQNA 4RGRA 3FKJA 3J7AO 1T8IA 3P5JA 2TDXA 3KZYA 2ESHA 2XC7A 3EETA 3K7AJ 1I39A 3HPHA 1BJAA 1KONA 1F5TA 1YYVA 1EV7A 2JUGA 2GXAA 1A04A 3FXRA 5HLGA 1IXRC 1OCZH 2H94A 5LGTA 4ENMA 2X4HA 2HVQA 4KIBA 4KITB 1QGPA 2OF7A 3KEOA 3KEQA 3CCJI 3CDLA 1MBJA 1LVKA 1XGMA 1ORKA 4HSTA 2WAFA 2ETHA 2F4IA 4HBLA 5F0HA 3WTSC 3KIOA 4A3DJ 2QQ9A 2HU9A 4WWCA 4LD5A 5LBQA 2DLLA 4X1EA 2IBDA 1SFEA 1QO0D 4DGWB 3CCLI 4XN3A 3SFZA 1R5GA 4I0AA 3CDHA 2GWRA 4B1RA 2FQ4A 1OJLA 5EG0A 2PMZN 2O7OA 3LNQA 3S17J 4HLYA 1QVUA 2ZXIA 2QSFX 4ITVA 1HBXG 1BM9A 2EIJH 2QLZA 1MNMC 2XRLA 1ZK8A 1MMAA 5CVRA 1YS7A 3TOAA 2XKOA 2DI3A 1F9NA 1OFCX 3R6SA 2JWTA 3VYUB 3BZKA 1UFMA 3MN2A 4XLCA 2BW3A 4D5CA 1IO2A 3PJRA 1Y1VJ 1LDJA 2CGPA 4JOMA 2HNHA 3Q3SA 4PSXA 5ICGA 4ANJA 3CLOA 5D5UB 2CFOA 3PNVA 3TP3A 4TV7A 3S32A 1X1AA 1VQ6I 4BXFA 3HHGA 3KPHA 3K10A 1RIOH 3BWGA 2VE9A 1JJ8C 1FOYA 3RPUD 4BJ5C 3DU5A 1O4XA 4I99C 4WCGA 3L2CA 1X19A 1XB4A 5FFZA 3S1NJ 4JQFA 1TBXA 1A35A 1P7JA 4HV6A 3OYLA 3HKZN 3EQLF 3JW4A 4DQ2A 4YIRX 3ZQCA 1B8IA 1ZLKA 5FGMA 4LLGF 1GT0C 2YX4A 1IZ1A 3OL3A 3WE2A 4S05A 4L0YB 1JUPA 2LC2A 2KJCA 3WU2C 4A0YA 3OSFA 4UUVA 3Q0UA 1Y1WJ 1T0FC 2A05A 2CYYA 2D1HA 2JA6J 1SMTA 3WTWC 4BE1A 2XAQA 2EFQA 4RAFA 3OIOA 4IRGA 4L9NA 4P96A 1I5ZA 2EA2A 3MQ0A 2A5YB 2V1XA 3L1PA 3RKXA 3OL4A 2GBYA 2L9RA 1BR1A 5BQTA 1WJDA 5ICEA 2HVRA 4GO1A 3WTTC 1VQOI 2X85A 2Z2SB 3OWTA 3TO6A 1VFCA 2X48A 3QPSA 5AONA 2X0LA 1WPKA 3WU0A 1LE8B 4QPOA 1NH3A 1V5GA 2W00A 2EH3A 4CUGA 4JX6A 2BHZA 1DUXC 4R8HA 2DU9A 2VT2A 5DV5A 1NG7A 3SEZA 1Z3XA 2Z16A 2GIVA 1ETQA 4CCOA 2IW5A 1BC7C 3HGYA 3JSPA 2P7VB 2BHYA 2E1MC 4IQJA 3K1MA 1HXDA 1FTZA 1P2FA 3B73A 3GF2A 3LQQA 3WHCA 2LP0A 2R0QC 4NQWA 3GFLA 3LSTA 4D0PA 3E5UA 4KA4A 3W2VA 2ADUA 4PJJA 1AHDP 3GW2A 2CH0A 3HDDA 2HWVA 3FBNB 3BTJA 4EGZA 4WF2A 3AKZA 1R4MB 2ZO4A 3F6VA 1YJNI 5JLXA 1IRFA 2QYOA 2XIGA 2WB1N 3JR9A 5E17F 2VJ4A 1WJEA 3MCZA 1UHMA 2P6TA 4LJZF 3V8KA 2PFBA 1P4WA 1FEXA 2VQHA 2FSWA 2MABA 4M6YA 2UWMA 2CQXA 5LEKA 1L3LA 1FP1D 2LSOA 2AQFA 4XONA 2JN6A 2R7WA 4IOCF 2LKPA 1VZ0A 3AG1H 3JRDA 1UCRA 2XV4S 1DGWY 1P4AA 3Q9SA 3VPRA 3OYAA 2HQ5A 2IS6A 2PMUA 3RTRA 1OCCH 3HYIA 1QHGA 1BOAA 1HW1A 2E1MB 1AKHB 2GM4A 3BY6A 2M0MA 2XGXA 4UHTA 4XLAA 3LSJA 4LOCA 5LRSA 3MKLA 4ESBA 1FMWA 2OPTA 2XF5A 2DA3A 5LFAA 2K9LA 4MEYF 3EUAA 3H5AA 3TL4X 1OCTC 3DEWA 2DTZA 2CFXA 4EEFG 2HXOA 5E79C 1IXCA 2NVUB 1D1AA 1ENHA 5FLMJ 2DFFA 3H9GA 4L9VA 1SD6A 3H0GJ 5J40A 4A3CJ 3KP7A 3MMYB 3NQOA 1ETOA 4XRSA 4HX4A 1GVJA 3ZMDA 3QODA 2E36A 4GXOA 3OYIA 2NS0A 4M3DA 5IY5H 1IXSB 3BG3A 1J7KA 4MEXF 2O9LA 3F3XA 3PO2J 2M4GA 3HJEA 4V2FA 3VEPA 4AM3A 1H88C 1BI0A 5ICFA 2BY2A 2HYGD 2ZXJA 3H5NA 4XLNF 1YITI 2VB6A 3MKZA 3HOUJ 1KYZA 3E5QA 1OPCA 1DDNA 1HW5A 2XAUA 1SD5A 2CWEA 3MKYB 3RZOJ 4UVCA 1N78A 4M6VA 3DP7A 1B72A 3I71A 4MFEA 1P6RA 1K4TA 1HA8A 3QOEA 4FCYA 1MZBA 2H1LA 2RGVA 3BTIA 5DM6F 1T33A 3L2VA 2IS4A 5F0FA 2HPIA 2BY0A 3EYYA 2IGKA 1P7IA 2DQLA 2EV6A 2E1CA 2IGNA 2NAZA 1J5YA 3BR1A 1RKWA 1SVLA 4HYEA 2R5YB 3IH2A 2OU2A 3IRQA 1D5VA 3K4KA 3OYFA 2LY1A 1MNDA 3L09A 2STWA 1Z05A 1YQAA 3BR3A 2BV6A 3MAJA 1U6GA 3OIPA 1ULYA 4W97A 1K83J 4F93B 2ZXHA 5IOYA 4BH9A 3CP2A 5HVQC 4GYIA 2YX7A 4XQFA 2LR8A 4BYYA 1PUFB 5IT9Z 3QU3A 3GZ6A 4IHXA 2CU7A 4M74A 5FKLA 2VQCA 2X1DA 1BR2A 3M8FA 1HOMA 1XCBA 1D0YA 2HFHA 2F5DA 2XGDA 5GTHC 3PNTA 3ABMH 4JP0A 1TWAJ 3OS0A 3S1MJ 3R60A 4J19A 1VQMI 4KT5C 4PZJA 4P1WA 4C3JJ 3I4MJ 2V4JC 1JGGA 4FTHA 1G3TA 3OYBA 3TKYA 3R61A 2DFEA 4AVZA 4M9SA 5E3MA 1EH7A 1OR7C 5KHDA 4J00A 2DFIA 2E19A 4NUBA 2EZHA 2IS2A 2RN7A 4KN4X 3MKWB 1TNTA 3REOA 3CJQB 1BW5A 4NHJA 4CGZA 2PBIA 2F4OB 2ACJA 1ETWA 3ZQQA 3PUBA 1D8KA 1OMIA 1BI3A 1AU7A 2CV1A 3ZMSA 2MD0A 3OSGA 2KRFA 1I3QJ 2DQRA 2XKPA 1S3JA 2DK5A 2X6YA 2RKHA 1FBSA 1J0RA 2FXAA 4ZYHA 3M3YJ 4I2OA 1I27A 3DTKA 5DTDA 2Y9ZA 5D5WB 2A6HF 2Y69H 4CO8A 1V5EA 5J1UA 3FIWA 1P92A 5IYCJ 4WXCA 4XRFA 4RBOA 2KQRA 3I59B 1Z21A 2ZNZA 4L18B 1K78B 5IT9K 1SFXA 1S7EA 1TP4A 1UMQA 1WJ5A 4UXNA 1O3RA 3E6CC 1ZREA 5CVIA 2DA1A 2UUZA 3HL2A 3BR6A 4CCKA 2ZCWA 1EA3A 5K5QA 4ON0A 4CHUA 1U5TC 3KYDB 1WH7A 1O3QA 3K4NA 5E3OA 2EZKA 4A3MJ 3D5SC 2HQAA 2W24A 4OIQF 2EV5A 2R7XA 2QBYA 2OTJI 2ZNYA 1KA8A 3P9IA 3I64A 3D1NI 1HLVA 4IHWA 1TQPA 4R79A 1ERDA 3IC7A 4KICA 4DZPA 1FX7A 1UZCA 1ZYRF 3PNYA 1MBFA 2M0CA 1BL0A 1R00A 1V55H 3CF2A 3NEUA 4EM2A 3ABTA 2PG4A 5J1RA 2CUFA 2GOXB 1HQCA 2G0EA 2OQRA 4ZYGA 2R7TA 3E0JB 2V9PA 1CGPA 1KU9A 2K3PA 2VUMJ 1J09A 1WI9A 1MDMB 5JVGF 4RGUA 4N9HA 4IRIA 2NVQJ 5CPRB 2R92J 2L5QA 1YX3A 3DPUA 5TISC 3KLOA 2R7OA 5M5XJ 3ASNH 2IAIA 3IH3A 2VQGA 1V3FA 1X3UA 3R0AA 4A3KJ 5DCMB 5E8GA 1HDDC 3CTAA 1E0EA 1TWCJ 3CCRI 2KP6A 2K9NA 1MBGA 2QQAA 2VKEA 2FX0A 4E7LA 1S7AA 4LG0A 2QM3A 5FKOA 1U5TB 1Y0UA 1ZR2A 5GADJ 3HRSA 1I3AA 1KU7A 5CKTA 1FLIA 2L7MP 1LPQA 1VQPI 1BW6A 2JA2A 2Z3YA 4E7ZA 1G2HA 4RDUA 1J59A 4GCVA 3OYGA 3S2HJ 3CLQA 3QP5A 1E3PA 4II3A 4W1UA 3S1QJ 1QPIA 3MFKA 3LSRA 2PJRA 1MMSA 3C7JA 1XTAA 2LDUA 3A4CA 4HAMA 4Y33A 3BOQA 4EMSA 2XF6A 1XD7A 1YW7A 3G1OA 4I98B 2BXZA 3O2PE 1R4NB 1UB9A 5L3DA 4XNFA 3CC7I 4BBRJ 2COBA 1TWHJ 5HS9A 5H2FC 5HS8A 3TO9A 1UHSA 2LRDA 3K4MA 4U0VA 1XCVA 2NS8A 3IL2A 2VN2A 4Z2YA 3VODA 2QQBA 2A5WA 2EQRA 2E1OA 2F5VA 2BE5F 1TWFJ 3HUGA 2W1OA 1BN5A 2P8TA 2YU3A 3HSRA 3TOBA 1ZN2A 3ZN0A 1LVAA 4DJAA 2F5CA 2KPMA 5BPIA 1XSDA 4XLPF 3HOVJ 2XSDC 4XOPA 5B1BH 5F1RA 4M6XA 4XICA 2FNPA 2P7CB 4PJ0C 3WGHA 1R9TJ 2DMQA 3KYCB 1Q1VA 4KYWA 1XGSA 2ZSHB 4YRVA 1H9GA 2X6XA 2R5ZA 2VBXA 5IT3A 1FSEA 2L9SA 4N4NB 3OYJA 3VWBA 3C18A 2X1CA 4XLEA 3T1BA 1E17A 1MH3A 3F8MA 3RZDJ 2LF7A 4GGGA 2F4MB 5D6EA 1F36A 3ONQA 4A3FJ 3HPGA 1YI2I 4C9YA 4RMNA 4IL6C 4KIGA 5DUKA 3AG3H 3WHBA 1PYVA 2QKLB 1ONVA 2WC2A 1OISA 2LBFA 5C4JJ 4A69C 3TEDA 1IDZA 3S1RJ 2PJPA 3G2BA 2L3DA 4OOIA 4B3XA 3OYEA 3BROA 4U0YA 5A2QZ 2XGCA 3QAHA 3VOEA 5EZHA 1E3HA 1YG2A 2EFWA 2WAQA 1W0UA 1WRJA 2M45A 2LD5A 4RB2C 2PMZA 5DUIA 1Z6TA 5ED4A 3WGIA 4IJAA 1W0TA 1OCOH 3FXLA 1X58A 2M4KA 4IQ4A 2EIMH 3G73A
chains in the Genus database with same CATH topology
1VQKI 3CCQI 3CMAI 1HC8A 4V19K 1YJWI 1MMSA 1FOWA 3PIOF 1VQ4I 5GAGJ 1S72I 2QEXI 1VQ9I 3CC7I 4IO9F 3DLLF 2E36A 1VQOI 2K3FA 3CCVI 2QA4I 3CCJI 4IOAF 3G6EI 1YITI 3CF5F 3I56I 1FOXA 3CC2I 1YJ9I 5GAHJ 3J7ZI 2ZJPF 3G4SI 1QA6A 3CCMI 3CCLI 1VQLI 5DM6F 3CCEI 2OTJI 1VQNI 5DM7F 2NXNB 2E34A 3CMEI 1YJNI 1YI2I 3CD6I 3G71I 2E35A 3PIPF 2FOWA 3CC4I 5JVGF 2ZJRF 1ACIA 4IOCF 2OTLI 4UY8I 2H8WA 3CJTB 1YHQI 1VQ6I 1VQ7I 2ZJQF 1FOYA 3CCUI 3I55I 3J7YJ 3CCRI 1VQ5I 1VQMI 3CCSI 1YIJI 1Y39A 1VQ8I 5GADJ 2JQ7A 1VQPI 5GAEJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK I;  3CCQ I;  3CMA I;  1HC8 A;  4V19 K;  1YJW I;  1MMS A;  1FOW A;  3PIO F;  1VQ4 I;  5GAG J;  1S72 I;  2QEX I;  1VQ9 I;  3CC7 I;  4IO9 F;  3DLL F;  2E36 A;  1VQO I;  2K3F A;  3CCV I;  2QA4 I;  3CCJ I;  4IOA F;  3G6E I;  1YIT I;  3CF5 F;  3I56 I;  1FOX A;  3CC2 I;  1YJ9 I;  5GAH J;  3J7Z I;  2ZJP F;  3G4S I;  1QA6 A;  3CCM I;  3CCL I;  1VQL I;  5DM6 F;  3CCE I;  2OTJ I;  1VQN I;  5DM7 F;  2NXN B;  2E34 A;  3CME I;  1YJN I;  1YI2 I;  3CD6 I;  3G71 I;  2E35 A;  3PIP F;  2FOW A;  3CC4 I;  5JVG F;  2ZJR F;  1ACI A;  4IOC F;  2OTL I;  4UY8 I;  2H8W A;  3CJT B;  1YHQ I;  1VQ6 I;  1VQ7 I;  2ZJQ F;  1FOY A;  3CCU I;  3I55 I;  3J7Y J;  3CCR I;  1VQ5 I;  1VQM I;  3CCS I;  1YIJ I;  1Y39 A;  1VQ8 I;  5GAD J;  2JQ7 A;  1VQP I;  5GAE J; 
#chains in the Genus database with same CATH topology
 1SFO J;  1R5H A;  1R36 A;  2R93 J;  4HW0 A;  1WH5 A;  4NC8 A;  4BAC A;  1HC8 A;  3DCF A;  5L3B A;  3H3Z A;  3GWZ A;  3OOU A;  4UB8 C;  4IHS A;  3SFI A;  3I53 A;  4FHT A;  5BNG A;  4XN0 A;  4A93 J;  3VSK A;  1LFP A;  3J80 Z;  1XN7 A;  2HOA A;  2Y0S A;  4QSH A;  3F21 A;  3LA7 A;  5HLT A;  1IRG A;  3H1C A;  4HV5 A;  1MMN A;  4UUS B;  1R23 A;  2M3A A;  2LY2 A;  4G6D A;  4NNJ A;  4CDG A;  3P9K A;  3ABK H;  3R4K A;  3OV8 A;  1LNW A;  4WX9 A;  2XAJ A;  3CUQ C;  1GUU A;  2QZ8 A;  3RYP A;  1FMV A;  4BE2 A;  2OA4 A;  1RPW A;  1DPR A;  2D5V A;  5LRR A;  4PCQ A;  2L4M A;  1TZL A;  3KZZ A;  4RLF A;  1MMD A;  5E3L A;  3L2R A;  4YEL A;  1SD4 A;  3SDB A;  4CCN A;  5FRN A;  4G9Y A;  5A2Q K;  3H35 A;  4B44 A;  2CUZ A;  1KU3 A;  2VPR A;  3HRU A;  1P9Q C;  1GXQ A;  1XC5 A;  2COM A;  4HZF A;  1LB2 A;  2XF7 A;  1DGR M;  2DT7 B;  4DOZ A;  1FIP A;  2VC1 A;  1EF4 A;  1LDD A;  2CQQ A;  3HEF A;  5H20 A;  4LB6 B;  3RCO A;  1MNE A;  2R7R A;  1APL C;  4ETS A;  2FE3 A;  3S15 J;  2R7U A;  1RRJ A;  3X2Q H;  4KT6 A;  2ELK A;  1VQN I;  5DM7 F;  4C3I J;  3BPX A;  1P4X A;  4XKW A;  3GFJ A;  3BC8 A;  3ZQG A;  3HC7 A;  4B48 A;  2WBM A;  3K2A A;  4M3G A;  3H3V K;  2EV0 A;  4ENK A;  3QOP A;  4LK1 F;  3HIF A;  2H27 A;  4Q47 A;  5CVV A;  4DIQ A;  1FOK A;  4FE7 A;  3HTU A;  2DPD A;  5HLI A;  1DP3 A;  3V8L A;  4HNV A;  1FZP B;  2ZJR F;  2CUE A;  1FC3 A;  2VL8 A;  4C30 A;  2DPU A;  1STZ A;  2ZFW A;  2NS7 A;  4BDY A;  4RS8 A;  1HCR A;  2VXZ A;  1MBE A;  4Y7N J;  1CF7 B;  3CUQ B;  2E7X A;  1JHH A;  3HOW J;  4CCJ A;  2N8G A;  2FNA A;  2OZU A;  3I58 A;  2KKO A;  2E2J J;  4HG2 A;  4G6T B;  2VOP A;  4CIC A;  4FAS D;  2KFD A;  3QYF A;  1Z3Y A;  3HOS A;  3W6V A;  5DCF A;  5EEG A;  3SDG A;  3AG4 H;  1Y39 A;  1IJW C;  2DT6 A;  4HDV A;  5DEQ A;  3VYR B;  1ETX A;  1EH8 A;  3RKW A;  1R71 A;  2P4W A;  2W7N A;  2F6C A;  1S29 A;  4PSW A;  4L5I A;  4WXH A;  2YS9 A;  2DFH A;  5CJ9 A;  2HVS A;  3ML6 A;  4BBS J;  1N75 A;  3PQJ A;  3H5R A;  3DKW A;  4YEJ A;  1JJ6 C;  2K4B A;  3BZC A;  4BQN A;  5J6X A;  4XKB A;  4LB5 A;  2OZ6 A;  2ZC2 A;  1ZG5 A;  1T38 A;  3IKV A;  4M3E A;  3M7G A;  5F64 A;  3A01 B;  1FSH A;  2VT3 A;  4BHP A;  3F6O A;  2KZV A;  4EJV A;  3WTV C;  3MZ8 A;  1W7P B;  1PDN C;  5J4V A;  3JRG A;  1YX5 A;  3U1K A;  1ZH5 A;  2JZY A;  2QUF A;  2R7F A;  4L9T A;  4BHB A;  3T8R A;  5J47 A;  3RKQ A;  5CLS A;  2VJJ A;  3I3L A;  4MHG A;  2PLY A;  2K9S A;  2L7K A;  2DAO A;  2HQN A;  5KK1 A;  2R7Q A;  4M3B A;  4U0W A;  1BI2 A;  3EDP A;  3K4C A;  5BMZ A;  3B02 A;  1Z67 A;  1AOY A;  3CC2 I;  2UV1 A;  2QQ8 A;  2WWY A;  2W4S A;  3M1E A;  4KUM A;  5FJ8 J;  4ZC3 A;  1HW2 A;  4IVN A;  3K70 D;  4ENN A;  5DD4 A;  1HDP A;  3DWL E;  1H0M A;  2OAZ A;  2J5P A;  4O3M A;  1QA6 A;  3OMY A;  2MYS A;  4F92 B;  5E1W A;  4RGS A;  3AG2 H;  2EFO A;  1ZQ3 P;  2GOM A;  4XL9 A;  2YUS A;  2A68 F;  2ZJ2 A;  3MEX A;  2P5V A;  4BY1 J;  4NDL A;  2B63 J;  1IW7 F;  5BPD A;  2D1V A;  3DU6 A;  2BEO A;  1LE8 A;  4H0E A;  1D0Z A;  3AFH A;  3FXU A;  2G7U A;  5E1X A;  2HOE A;  1I1G A;  2CJJ A;  3DPT A;  4IHT A;  3EUH C;  2LMD A;  5FLX Z;  2ECB A;  2JA8 J;  3BPV A;  2Y9Y A;  2JJ7 A;  5F04 A;  4D7M A;  3MWM A;  2M2E A;  5D6F A;  1RR7 A;  1SD7 A;  1H9T A;  2NNY A;  4WXD A;  4XSZ F;  2DK8 A;  4G12 A;  1XMK A;  1Z9C A;  3JCU C;  2HZD A;  1Z91 A;  3E3V A;  1KGS A;  4A6D A;  5D4S A;  3FKI J;  5M5W J;  1YO5 C;  4XOT A;  5JHF A;  3O8H A;  3J7Y J;  4G7O F;  3CCS I;  1AWC A;  4A3J J;  1QZY A;  1V5F A;  4Q48 A;  5LD2 C;  1T0F A;  2CV0 A;  3HGG A;  4ZDP A;  3S3O A;  2E5Z A;  2FRH A;  1TW2 A;  1ODD A;  2PEX A;  2PMH A;  3DEU A;  3K4L A;  3N05 A;  5GAE J;  3BJA A;  2CQ7 A;  1RES A;  1JT6 A;  5D5V B;  3M9A A;  1XGN A;  2HDW A;  4A5N A;  1UHW A;  1O7L A;  4G94 A;  5GPC A;  2X51 A;  1RI7 A;  3HRT A;  3U21 A;  2WTE A;  5EYR A;  3IWZ A;  2OCE A;  4Y3O A;  1JTY A;  2ICW G;  2GA2 A;  3PIO F;  4BDZ A;  4II2 A;  1F43 A;  4IZZ A;  1PP8 F;  2MBF A;  3S2W A;  1XX5 A;  4C3H J;  3ULQ B;  2W48 A;  1S9H A;  4A5M A;  2V6E A;  2DA7 A;  1ON2 A;  2QEX I;  5L3G A;  3HOX J;  2ZME C;  2Q0O A;  1HSJ A;  4LIV A;  2XRN A;  2XUB A;  5FLX K;  3MD2 A;  2LRE A;  4DW6 A;  1ZKG A;  3VFZ A;  2F48 A;  1JI8 A;  5CVJ A;  1AKH A;  2HS5 A;  4S04 A;  4CYD A;  2JA5 J;  1BR4 A;  5CQG A;  2NRA C;  3TO7 A;  2Z9O A;  2GXB A;  1JGS A;  4AC0 A;  1LEB A;  2I5U A;  4B09 A;  3T5X A;  2BGC A;  4CYC B;  1QNT A;  3DPL C;  5JVT A;  1VND A;  2VJI A;  4V2G A;  5LGU A;  4LK0 F;  3LAJ A;  1TT0 A;  2FOK A;  2AXL A;  3ZQH A;  1QU3 A;  3V7S A;  4B43 A;  2WV0 A;  1LEA A;  2CQN A;  4LG3 A;  2CSO A;  3TW6 A;  2TRT A;  5EF6 A;  3GYH X;  1BBY A;  3IKT A;  2VON A;  2A07 F;  1D3Y A;  1MSF C;  2H8R A;  3L2U A;  1RR8 C;  2DCE A;  2LY9 A;  3BG6 A;  1JKP C;  3QP6 A;  3CME I;  1U9O A;  3Q5F A;  5KAI C;  2O6G E;  1YW9 A;  4E7J A;  1MJA A;  1M1E B;  3KP3 A;  1RKT A;  2VOO A;  3F8B A;  4A3G J;  2IPQ X;  2AHQ A;  3GEZ A;  3LSG A;  3VYS B;  4PUS A;  4GYG A;  1KQ9 A;  2FOW A;  2ZME B;  3CMM A;  3CC4 I;  3IV5 A;  4EJT A;  2KHM A;  3F8C A;  4HQM A;  2NYX A;  1MH4 A;  2VLA A;  5EZG A;  1UEL B;  4PGG A;  2OV7 A;  4Q5S F;  2Y75 A;  3LSP A;  4HNU A;  1K4S A;  4RLQ A;  5L3E A;  3KET A;  2EPF A;  3H92 A;  1YIJ I;  4L5E A;  2W85 A;  2V6C A;  3RSN A;  3KP6 A;  4BUP A;  2PQ8 A;  4U87 A;  2JQ7 A;  2R5Y A;  4L9J A;  4QTR A;  5IOZ A;  1MGT A;  3LA3 A;  1GXP A;  2MC3 A;  2Z5U A;  2CW7 A;  2IEK A;  3M1C A;  3HOZ J;  4ESF A;  3HSE A;  3VYT B;  3TBI A;  5FD6 A;  1ZRF A;  4V19 K;  3LOC A;  2JK3 A;  2LFB A;  4CA0 A;  2HQR A;  5AIQ A;  1ZAR A;  4G8X A;  2FEZ A;  1PUF A;  5CVU A;  4L0Z B;  2QSH X;  1NG6 A;  1FOW A;  2LK2 A;  3BZ6 A;  3NRV A;  3PUF A;  5TGT A;  3RIR A;  2K7L A;  3RQI A;  4HPQ A;  4AYB A;  5D8L B;  3WTX C;  2YSR A;  3ZXS A;  2M1B A;  1B6A A;  1U8R A;  3CP8 A;  1PJR A;  4WK8 F;  5EJC A;  3HOY J;  1POG A;  5K7F A;  2ZB9 A;  2VPL A;  5K7H A;  4E6K G;  3S93 A;  5DS9 A;  2OQG A;  5HLH A;  2CG4 A;  4RGX A;  4BNC A;  2ELH A;  4ZDL A;  2M5W A;  1X2N A;  2DOD A;  2HR3 A;  1C0W A;  1LDK B;  1WCM J;  4GDF A;  3JRE A;  3S14 J;  4IX7 A;  3D0S A;  2DBB A;  2VOD A;  3JRA A;  2HI3 A;  1Y8R B;  2XAH A;  2DYS H;  5FD5 A;  1U9N A;  1WJF A;  2CMP A;  3G4S I;  3TMO A;  2WV1 A;  1W5S A;  4DYC A;  2K4J A;  1Z0X A;  1ZRD A;  4AID A;  3K70 C;  5GTI C;  3KE2 A;  4KN7 X;  3W6K B;  4O5V A;  1GHC A;  2VAS A;  5IYB J;  4NB5 A;  2DXI A;  2UXN A;  2XB0 X;  2IRF G;  5EGO B;  2IA1 A;  2BY1 A;  4CCM A;  4A3B J;  3ROU A;  5IYD J;  1IN5 A;  1D1C A;  1U78 A;  4BJ6 C;  3PL8 A;  3HBL A;  4P55 A;  1O57 A;  5IPA A;  5EGO A;  2Y0M A;  1N77 A;  2NXN B;  4HRI A;  3I59 A;  5DDG A;  2QEN A;  3OYC A;  1K78 A;  3ZOB A;  3DV8 A;  3U1D A;  2IT0 A;  3ZGK A;  3DTI A;  2L0K A;  3IH4 A;  2HDD A;  5JLW A;  2DOA A;  2VKH A;  2JT1 A;  4ZYE A;  1R49 A;  1Z1D A;  2V26 A;  1L0O C;  3PM1 A;  2KIU A;  2EK5 A;  2JVH A;  2D45 A;  2PI0 A;  3BR2 A;  3ABU A;  4ZYD A;  2AQE A;  5E8I A;  3FM5 A;  3GFM A;  3OYN A;  2R7Z J;  3K4J A;  3RPU A;  2L7F P;  4BQQ A;  5M3M J;  2DDA A;  3CJR B;  1BC8 C;  3OR1 C;  1TQI A;  2ZBK A;  3CJT B;  1H8A C;  1OR7 A;  4ENJ A;  4DBQ A;  3PSF A;  2MA3 A;  2LKS A;  1W7P D;  2VKD A;  3ZCO A;  2A6E F;  2G7H A;  1QZZ A;  1PP7 U;  4PJL A;  3ECO A;  3F0C A;  1VQ8 I;  3L2Q A;  1DP7 P;  1D8J A;  3LFU A;  3GXO A;  1X4P A;  3J81 Z;  1G3S A;  2P0W A;  3C3W A;  4RB1 A;  2K5C A;  3WG7 H;  2XRO A;  1JXS A;  3A0H C;  2IXS A;  2RNG A;  3CCQ I;  5F6F A;  3ZMT A;  2KIS A;  3DF8 A;  5CQE A;  4BS9 A;  3L00 A;  5D8K B;  3S16 J;  1MDM A;  5FKN A;  3JTG A;  3CDI A;  2LF8 A;  1GLN A;  5IP7 J;  4FX4 A;  2KIQ A;  4MFD A;  2HYF A;  1KZH A;  2V1N A;  4KIS A;  1CQT A;  1VQ9 I;  4KDP A;  5DCM A;  4HSR A;  3DLL F;  2X9D A;  3W2A A;  1WSU A;  1W5T A;  4FT8 A;  4HEA 2;  3BTC A;  4ZZD A;  1S5L C;  2DA2 A;  3FF5 A;  1U5T A;  2QA4 I;  3K6G A;  1RZ4 A;  3JRB A;  1Y56 A;  2E2H J;  3ISP A;  2DYR H;  2BZT A;  3BT9 A;  1WJC A;  1X1D A;  2QKM B;  5LHI A;  1FOX A;  1G3W A;  1TNS A;  2DMT A;  5JI6 A;  1IN7 A;  4J01 A;  3J7Z I;  1IDY A;  4BAY A;  2RQQ A;  1YRN B;  2DJN A;  2H6C A;  4B3A A;  1K6Y A;  4E7H A;  2EBI A;  5E1Z B;  1GV5 A;  3KEY A;  1BIB A;  3W2W A;  2P5L C;  3PO3 J;  1I6H J;  3EUK L;  3W6J B;  3ABL H;  3J81 K;  1GV2 A;  3V8J A;  1X1B A;  3JRC A;  1QRY A;  2EIN H;  3L7W A;  4YFK F;  2DJI A;  1ZG1 A;  2VIX A;  2RDP A;  5F08 A;  1W4M A;  1S6L A;  1WHU A;  3A1Y A;  3DLA A;  2XPW A;  3BG7 A;  3C2H A;  4HLX A;  3HSF A;  2VI6 A;  4YFX F;  1DU6 A;  2V1D A;  4CSW A;  1TLH B;  1ETY A;  4OIO F;  3PIP F;  3BR0 A;  1T98 A;  2P81 A;  3DBR B;  2MSY A;  3I4N J;  3QRF F;  1WFX A;  2UZK A;  3H0D A;  2WY7 Q;  1ETV A;  2FU4 A;  2DTR A;  4EAT A;  2HDC A;  3BJO A;  4IKF A;  5M3F J;  2EB7 A;  3WE3 A;  1TW3 A;  2L54 A;  1I6X A;  4RAG A;  3V42 A;  1AA7 A;  4JX4 A;  2R7V A;  2HZT A;  4BXX J;  1K7A A;  1U2W A;  3UNG C;  1QPM A;  2EIL H;  4MTD A;  1IN6 A;  3ZPL A;  2JMW A;  2M87 A;  5CYV A;  5HS7 A;  2ME0 A;  3HOT A;  3ERM A;  1KU2 A;  2KIF A;  2RRE A;  3U2R A;  4DYQ A;  1SEU A;  2Q2E B;  3QPH A;  1ON1 A;  2MFZ A;  4EJU A;  2RVC A;  5ILV A;  2JSP A;  2A61 A;  3PQK A;  2DOE A;  5B1A H;  4ESJ A;  4RAY A;  3DEE A;  1IC8 A;  4A3L J;  1TWG J;  1BI1 A;  3E5X A;  2CRG A;  4OU0 A;  2GQQ A;  3MZH A;  4X0G A;  5GAG J;  1KQ8 A;  2I8D A;  1E3O C;  2XPV A;  3ZMZ A;  4KIF A;  2Q8K A;  3GZN B;  3RDI A;  3K9T A;  3GZ5 A;  3F23 A;  3LWF A;  3K4B A;  4HA8 A;  1O3T A;  1K6O A;  3VSL A;  2FUG 2;  1LFB A;  3M4O J;  4M73 A;  3ZQL A;  2B9S A;  3GVA A;  4IHV A;  2PN6 A;  3EPZ A;  2LLK A;  2VBY A;  3QPL A;  5DD8 A;  3J7A Y;  2JRT A;  4BEH B;  5LHG A;  2DMP A;  1MW7 A;  3CF5 F;  1B4A A;  4UB6 C;  1IUY A;  2DN0 A;  5L3C A;  1FYK A;  3E1S A;  5GAH J;  4D7N A;  3S3M A;  3E6B A;  2AO9 A;  3DXJ F;  5D4R A;  1QBJ A;  5LGN A;  2E60 A;  3OR2 C;  1U0J A;  1UJ8 A;  4R1H A;  4A3I J;  2JPC A;  3R0J A;  3FXK A;  2KRC A;  4K2E A;  1KYW A;  2W57 A;  3DTE A;  2FML A;  4N9I A;  2VQL A;  4UUS A;  2FA5 A;  3ZR8 X;  2TCT A;  4MO7 A;  1FNN A;  3FMQ A;  3A2K A;  1XMX A;  5DYM A;  3LMM A;  3HKZ A;  3F8N A;  4A0X A;  4KFC A;  3IUO A;  1D5Y A;  1FY7 A;  3C1D A;  1RUO A;  1MBH A;  2HTJ A;  3HG9 A;  2E1N A;  4LIU A;  2ZXW H;  3NAU A;  3KP2 A;  2A3S A;  3QPT A;  4DYR A;  5KNL A;  4Q4Z F;  1OQY A;  2MH2 A;  2M8E A;  4IHY A;  4ZDO A;  2P5K A;  4Y15 A;  3T0Y A;  5C4X J;  3WOD F;  4HDU A;  5GP9 A;  3SJM A;  3GME A;  1ETK A;  2XB5 A;  4GRI A;  2XHK A;  3V7C A;  1XSX A;  1T56 A;  1BIA A;  2H1K A;  1IV8 A;  2IVM A;  4F52 A;  1QQI A;  4MTE A;  2STT A;  1B9N A;  2KIM A;  1V4R A;  2OCC H;  3TDZ C;  1DQU A;  2BXY A;  2K9Q A;  3JRI A;  3CO6 C;  2Y31 A;  2O61 A;  1FYL A;  4C2M J;  4XID A;  4XKC A;  3J80 K;  3E6D A;  3D5L A;  1RUN A;  3WTZ A;  3IWF A;  3LSH A;  2QGU A;  4BGD A;  5FFX A;  3K69 A;  4UV9 A;  4I09 A;  1VF9 A;  4BL0 B;  4B4C A;  4UNO A;  2O8K A;  3CMY A;  1OKR A;  3UKG A;  2NVY J;  3PFI A;  5AIP A;  2Y2Z A;  1CF7 A;  1WVR A;  2A6T A;  3CUQ A;  4NC7 A;  1JE8 A;  2JRM A;  1QHH D;  4RM3 A;  2FD5 A;  1BA5 A;  2NNN A;  2OJE D;  4LGW A;  3BLY A;  4XOR A;  5EG0 B;  3JTH A;  3CQZ J;  2WAQ N;  4QIW N;  2RAE A;  5M5Y J;  2K3F A;  1JT0 A;  2FMY A;  1FJL A;  4BHC A;  1O7F A;  2K85 A;  2WB1 A;  1R7J A;  2MGQ A;  1OCP A;  5J3L A;  1WZ2 A;  5K5O A;  2QCO A;  4XR6 A;  2K9M A;  3G6E I;  2BW3 B;  3GLL A;  2IJL A;  2YPR A;  4EJW A;  1SAU A;  3RYR A;  2HOS A;  4ZZL A;  1SC7 A;  2CW8 A;  1A31 A;  4F91 B;  2BY3 A;  1K79 A;  3QYB A;  3FXJ A;  1LFU P;  5H6R A;  2C6Y A;  3A01 A;  3JSO A;  4LMY A;  3CCY A;  1G8X A;  2EZI A;  2G9W A;  2M34 A;  2EA4 A;  1W7P A;  3QQA A;  4AU7 A;  1MJ9 A;  1NK3 P;  2CQK A;  1R1T A;  2X6W A;  3JRH A;  3BCB A;  3ECH A;  4I76 A;  2EJR A;  2Y0S N;  6PAX A;  1A36 A;  3KYL A;  1REP C;  4MQV A;  3FXQ A;  5ERI A;  1T95 A;  2RNJ A;  4E70 A;  3E97 A;  3HZJ A;  1TTY A;  3BTL A;  2VC0 A;  4LFU A;  3OY9 A;  2WAE A;  4KNY A;  2JVG A;  1G4D A;  5ICC A;  3Q0W A;  3WGG A;  1WI3 A;  1I1S A;  1IGN A;  3LSM A;  1B8I B;  1X3W B;  3DFG A;  2RV8 A;  3SZP A;  4EV0 A;  4CH7 A;  3GTK J;  1YLF A;  2UXX A;  2EFP A;  3FK7 A;  3JAM Z;  1GDT A;  2X6O A;  1IN8 A;  3G71 I;  4EM0 B;  2HKO A;  4NC6 A;  3LA2 A;  3IRR A;  3C2G A;  2XAS A;  3SEQ A;  1OYW A;  1W5C C;  3OIQ A;  2F5F A;  2DT5 A;  3FIS A;  2V9V A;  1TQM A;  4HNT A;  1R1U A;  4EQQ A;  2FJ1 A;  2M7B A;  1YHQ I;  1K61 A;  3V4G A;  2YU9 J;  2Y30 A;  1EH6 A;  3LFK A;  3S2D J;  4DBR A;  3NAR A;  1X4O A;  3FBI B;  5F27 A;  1FWZ A;  4BXU A;  1ITY A;  3CCU I;  4Y52 J;  3COA C;  4G7Z F;  3FMR A;  4U88 A;  3M07 A;  2GLO A;  2F2E A;  3TW7 A;  1IN4 A;  2O0Y A;  3P7N A;  1Z77 A;  4AWX B;  2L9N A;  2CV2 A;  2FBI A;  4MQ9 F;  3QU6 A;  2H09 A;  2XAF A;  1XSV A;  3P9C A;  1JUS A;  2AS5 F;  1NK2 P;  1S7O A;  3KFW X;  2W84 A;  3NWT A;  3GFI A;  3BG9 A;  2MC4 A;  2CS3 A;  3G1M A;  4F3Q A;  1UAA A;  1RC9 A;  3AAF A;  4EJO A;  3FHN A;  4FET A;  1XDU A;  4XRS G;  2L7Z A;  5F1J A;  3ZP5 A;  5D5X B;  1PVE A;  2B0L A;  3ZQF A;  1FIA A;  3N4M A;  2MW8 A;  2MG4 A;  4NQW B;  2BBY A;  3M8E A;  2DMU A;  3OYM A;  3W3C A;  3SZG A;  4O6J A;  1TL8 A;  1A5J A;  3ERE D;  4CCL A;  2DA5 A;  1YE9 A;  3CES A;  4NBQ A;  4QWQ A;  4RB0 A;  4MNU A;  3GTO J;  1NHA A;  2EIK H;  3JAM K;  3ZN1 A;  3O6B B;  3KLN A;  2OUM A;  3E7L A;  2HYJ A;  3GTP J;  3O3K A;  4XSX F;  4E7I A;  3HRM A;  4OIN F;  1G59 A;  4PK4 A;  3GO5 A;  1Z7U A;  4CZZ A;  2CUJ A;  3D5R C;  1HKS A;  1ZAO A;  3FDY A;  1F4K A;  3KP5 A;  3S8P A;  4PJN A;  4AVP A;  4U7D A;  1U8B A;  3CCM I;  3RJP A;  3JRF A;  2AXT C;  2CW0 F;  1JKO C;  4I02 A;  3EUH A;  2KL4 A;  3I4P A;  4F55 A;  4FIS A;  2L2O A;  3QWL A;  3C2B A;  2NOG A;  3HXL A;  1SAX A;  4JYK A;  3GTJ J;  3MZY A;  3H36 A;  3LQR A;  1IUF A;  1XMA A;  3DKX A;  4M9Z A;  1IF1 A;  1N25 A;  4IEJ A;  4D9J A;  3V7R A;  4EVI A;  3PSI A;  1JKQ C;  1MIJ A;  4BY7 J;  3SYT A;  1YIO A;  2VE8 A;  2LVS A;  2DW4 A;  2O5R A;  2MH9 A;  2DO7 A;  2L9V A;  2QVO A;  3N97 A;  2JA7 J;  2V9K A;  5F0C A;  4CYC A;  2D2W A;  5HNH A;  4N4O B;  2NOJ B;  2P6S A;  3F8F A;  2KZG A;  4MIM A;  1R58 A;  1YOV B;  1Y8Q B;  1UG0 A;  1ZR4 A;  3BP8 A;  3H9Q A;  2IGM A;  2DDB A;  2RC4 A;  1MSE C;  4JK1 X;  5HOD A;  1VQ5 I;  3FXO A;  4QPQ A;  1B1B A;  2IA0 A;  2W25 A;  3WTY C;  3GLX A;  3ZRG A;  4A0Z A;  1YS6 A;  2Q1Z B;  3G3Z A;  4UVA A;  3IP4 B;  3K2Z A;  3TGN A;  1IRZ A;  5B66 C;  5J1Y A;  4UVB A;  3SXY A;  3ZMV A;  2ZME A;  1O3S A;  5J8C A;  5LLQ A;  1YJW I;  1NTC A;  1G3Y A;  4OIR F;  1E2X A;  1BJZ A;  1UG2 A;  2Z1D A;  1VQ4 I;  4HX7 A;  1B72 B;  1IAW A;  1HST A;  5TRD A;  2XGE A;  4M72 A;  2LYC A;  2LKX A;  2HEO A;  2VKV A;  5BOX A;  5B5E C;  4A12 A;  4HF1 A;  1JUM A;  2KRH A;  3BDD A;  5IP6 A;  3OYK A;  5E3N A;  1JTX A;  2R7D A;  3RQ4 A;  3LSK A;  3FMS A;  1ZLJ A;  2OD5 A;  4OAY A;  5H6Q A;  3HHH A;  3Q9V A;  4OMZ A;  3QYE A;  4OMY A;  2OC6 A;  5LEJ A;  5L3F A;  4UUT A;  2FBK A;  3B6C A;  2GA1 A;  3Q0V A;  2LNB A;  2HOT A;  2ZKZ A;  4ZH4 F;  2ZJP F;  1Z7L A;  2MLG A;  1H89 C;  2KDO A;  5K5R A;  2B7E A;  5HDN A;  1ZTR A;  1MBK A;  4I0B A;  3OS2 A;  4X6A J;  3CUO A;  4A6E A;  3ZQ7 A;  2NVX J;  1FBQ A;  3I0T A;  3NWS A;  1T08 B;  1X1C A;  3RI4 A;  4LLN A;  2VBW A;  2L02 A;  5GPA A;  5KVR A;  1W36 D;  5HNF A;  3WG9 A;  1J75 A;  5FKM A;  4ZTJ A;  2BYV E;  2E34 A;  4E7S A;  5C3E J;  4YFN F;  3HTS B;  4D5F A;  1J9I A;  4Y4R A;  2DA4 A;  4AIJ A;  4C2T A;  5LHH A;  1GVD A;  3G1L A;  1TC3 C;  2E7W A;  4PDK A;  2E35 A;  1VTN C;  2HTS A;  1DU0 A;  4HQE A;  2GXG A;  1ACI A;  3RPQ A;  4XLH A;  1X2M A;  2F5E A;  3L2W A;  5HDG A;  2NVT J;  4IXA A;  4Y17 A;  5E20 A;  4E4H A;  3WTU C;  2MD5 A;  4Y13 A;  4JBA A;  1SVM A;  2ISY A;  1R5I D;  1WKM A;  3GTQ J;  2JTV A;  3I9V 2;  2V79 A;  2JUC A;  2ZFU A;  1IRX A;  3I54 A;  4G7H F;  1YFH A;  4RAZ A;  1J2X A;  3BG5 A;  3WU1 B;  1ZGW A;  4LLL A;  2ISZ A;  2V7F A;  2VJ5 A;  4L5J A;  3H3U A;  3LSI A;  5HDK A;  1FYM A;  2VXD A;  2OBP A;  3ZQI A;  1VI0 A;  4U7B A;  1VQK I;  2ECC A;  4ZJZ A;  4YIF A;  3SZT A;  1DPU A;  4H4K C;  1LKX A;  3TQN A;  2E5N A;  3BQZ A;  4XMY A;  2ESN A;  2HGC A;  3OYH A;  4YII A;  5FKK A;  2FQ3 A;  1S72 I;  3L9F A;  1W1W E;  2M8G X;  5JR3 A;  1SMY F;  4FE4 A;  3F9K A;  2QBY B;  3B6A A;  4ZYA A;  4CZC A;  1EJ9 A;  4YG2 F;  2BVL A;  3IAS 2;  2X1E A;  4BJT A;  2EWN A;  2R7S A;  2KMU A;  1SVO A;  3K0L A;  4IOA F;  3TDU C;  1T6S A;  2FF4 A;  3CZ6 A;  1YW8 A;  5JFR A;  4XRM A;  2ME6 A;  4AD9 A;  4D1Q A;  1FT9 A;  1FBU A;  3FK6 A;  2EFN A;  2M9H A;  2O03 A;  3A02 A;  4XLF A;  4G6Q A;  3KCC A;  3GTG J;  1FTT A;  2HKX A;  1PUE E;  5FO5 A;  4BKX A;  2ID6 A;  4P9U A;  4ABZ A;  4UV8 A;  4AYB N;  5ILU A;  4I6Z A;  2FBH A;  4MGR A;  4GFB A;  4PJM A;  4PFO A;  4FQG A;  2QSG X;  2IGO A;  1UST A;  3T8T A;  3CCE I;  3BJ6 A;  2J5O A;  5J8F A;  2LTP A;  5EDN A;  3DKY A;  3F72 A;  1FP2 A;  4LG0 B;  5FB2 A;  3GX4 X;  4EGY A;  1I50 J;  4KMF A;  1IG7 A;  1HKT A;  3CJN A;  2LOO A;  1ZGA A;  1MKM A;  2XVC A;  2ZSI B;  1R22 A;  2IA2 A;  4P9F A;  2H6B A;  1D1B A;  5IP9 J;  3GUD A;  1XPX A;  4C2U A;  2QWW A;  2E2I J;  2JSC A;  4HF0 A;  2W82 A;  2Y48 A;  3KX2 A;  3UR3 C;  3OS1 A;  2PJR B;  5HOO A;  1YRN A;  2GZW A;  1T39 A;  3SHF A;  3I5U A;  2XDV A;  2OTL I;  4B47 A;  1ZGJ A;  5FRO A;  5FLV A;  2H8W A;  1XG1 A;  1WJB A;  1JKR C;  1Z6R A;  1WJA A;  1VQ7 I;  1V54 H;  2ZJQ F;  1IV6 A;  2KT0 A;  3MVP A;  3DBH B;  1MJB A;  3GBG A;  3FWE A;  4RA2 A;  1WGX A;  1A6Q A;  4E7K A;  1BOB A;  3FZV A;  1U3E M;  1X1P A;  1OYY A;  4DZJ A;  2L01 A;  4B8X A;  1HF0 A;  3GCM A;  4M3F A;  2LH9 A;  4OAZ A;  4XBF A;  3HUG B;  3F22 A;  1SAN A;  4BQA A;  4I01 A;  4EM1 A;  3GTM J;  4MLO A;  3GTL J;  1OCR H;  3LAP A;  1LJ9 A;  4XKV A;  4ASN A;  2WAD A;  3K1P A;  1SFK A;  5K7Z A;  2V1U A;  2IS1 A;  2E71 A;  3ASO H;  2ID3 A;  1A6I A;  3E6M A;  1ZHF A;  1OYI A;  2R4G A;  2XPU A;  2Z99 A;  1Y0N A;  2DOF A;  3A03 A;  2RQP A;  4IO9 F;  1EKE A;  1RET A;  4HX8 A;  4PGH A;  4KMU X;  4A3E J;  4JX5 A;  3HB9 A;  2IP2 A;  3DQV C;  4KJZ A;  4XK4 A;  2R5Z B;  1SFU A;  3CCV I;  3H9J A;  3O8G A;  1R1V A;  4QLC U;  2ELJ A;  4DNC A;  4P5O A;  5J4Y A;  3S3N A;  1WWX A;  1Q1H A;  2R3S A;  1XDS A;  5EEH A;  4AIH A;  2LG4 A;  4M71 A;  3I56 I;  1QZE A;  2Q2E A;  4A2U A;  3BR5 A;  1YJ9 I;  2KLO A;  4AUX A;  2LBF B;  1S8N A;  2DA6 A;  2KJB A;  4F7Z A;  3AL0 C;  4XM3 A;  5FRM A;  4BQO A;  2GIZ A;  1USS A;  2YR2 A;  1TT5 B;  4M9X A;  1RNL A;  4Z6Y A;  5BS6 A;  1VQL I;  2WY8 Q;  4BU2 A;  2M30 A;  3ZMU A;  2EZL A;  3HM5 A;  4ZTF A;  1MD0 A;  5B3S H;  2K02 A;  1LQ1 A;  1B59 A;  2GAU A;  1WQ2 A;  4AIK A;  2CO5 A;  4FX0 A;  1FPQ A;  1LUJ B;  2KDZ A;  3K1N A;  5EEA A;  2BOL A;  3EYI A;  2XAG A;  2HXI A;  1ZG3 A;  3U9G A;  4HOB A;  1W36 C;  4BEH A;  2BVM A;  2DMN A;  2WA0 A;  3BQY A;  1QVT A;  1YTY A;  1XGO A;  5KAF C;  2Z33 A;  2L4A A;  3FX3 A;  1F1Z A;  3VDX A;  3FHZ A;  3CD6 I;  1D0X A;  3FM3 A;  1KQ0 A;  4IPA A;  3OYD A;  1OLT A;  3PFY A;  5E18 F;  3FXM A;  1MMG A;  2O8X A;  3ELK A;  3A0B C;  1T2K A;  4CXF A;  1ZRC A;  2JPB A;  1XS9 A;  4OIP F;  3IAM 2;  4UY8 I;  4I7H A;  3M8J A;  2O3F A;  4RB3 C;  4S0H B;  4HF2 A;  1ZEL A;  1Y6I A;  2XSJ C;  4BE0 A;  4OWR B;  4RM2 A;  1B9M A;  2QF7 A;  3TP0 A;  4IRH A;  3I55 I;  1JHF A;  5ILS A;  2K40 A;  2VBZ A;  3BCA A;  3KZI C;  2K86 A;  3LL7 A;  4N0B A;  5TJJ A;  3IHU A;  4IF4 A;  3VB2 A;  3CO7 C;  3AL0 B;  5K1Y A;  4LIT A;  2PX9 A;  3RKY A;  2K27 A;  2A69 F;  3DBL B;  5C44 J;  1R6R A;  2MLK A;  5KCM A;  1HKQ A;  2I10 A;  2M7A A;  3OOP A;  3CMA I;  4PFP A;  5JHU A;  3KP4 A;  9ANT A;  2HPM A;  1G6N A;  3ESW B;  1X3Z B;  3SQN A;  4RGR A;  3FKJ A;  3J7A O;  1T8I A;  3P5J A;  2TDX A;  3KZY A;  2ESH A;  2XC7 A;  3EET A;  3K7A J;  1I39 A;  3HPH A;  1BJA A;  1KON A;  1F5T A;  1YYV A;  1EV7 A;  2JUG A;  2GXA A;  1A04 A;  3FXR A;  5HLG A;  1IXR C;  1OCZ H;  2H94 A;  5LGT A;  4ENM A;  2X4H A;  2HVQ A;  4KIB A;  4KIT B;  1QGP A;  2OF7 A;  3KEO A;  3KEQ A;  3CCJ I;  3CDL A;  1MBJ A;  1LVK A;  1XGM A;  1ORK A;  4HST A;  2WAF A;  2ETH A;  2F4I A;  4HBL A;  5F0H A;  3WTS C;  3KIO A;  4A3D J;  2QQ9 A;  2HU9 A;  4WWC A;  4LD5 A;  5LBQ A;  2DLL A;  4X1E A;  2IBD A;  1SFE A;  1QO0 D;  4DGW B;  3CCL I;  4XN3 A;  3SFZ A;  1R5G A;  4I0A A;  3CDH A;  2GWR A;  4B1R A;  2FQ4 A;  1OJL A;  5EG0 A;  2PMZ N;  2O7O A;  3LNQ A;  3S17 J;  4HLY A;  1QVU A;  2ZXI A;  2QSF X;  4ITV A;  1HBX G;  1BM9 A;  2EIJ H;  2QLZ A;  1MNM C;  2XRL A;  1ZK8 A;  1MMA A;  5CVR A;  1YS7 A;  3TOA A;  2XKO A;  2DI3 A;  1F9N A;  1OFC X;  3R6S A;  2JWT A;  3VYU B;  3BZK A;  1UFM A;  3MN2 A;  4XLC A;  2BW3 A;  4D5C A;  1IO2 A;  3PJR A;  1Y1V J;  1LDJ A;  2CGP A;  4JOM A;  2HNH A;  3Q3S A;  4PSX A;  5ICG A;  4ANJ A;  3CLO A;  5D5U B;  2CFO A;  3PNV A;  3TP3 A;  4TV7 A;  3S32 A;  1X1A A;  1VQ6 I;  4BXF A;  3HHG A;  3KPH A;  3K10 A;  1RIO H;  3BWG A;  2VE9 A;  1JJ8 C;  1FOY A;  3RPU D;  4BJ5 C;  3DU5 A;  1O4X A;  4I99 C;  4WCG A;  3L2C A;  1X19 A;  1XB4 A;  5FFZ A;  3S1N J;  4JQF A;  1TBX A;  1A35 A;  1P7J A;  4HV6 A;  3OYL A;  3HKZ N;  3EQL F;  3JW4 A;  4DQ2 A;  4YIR X;  3ZQC A;  1B8I A;  1ZLK A;  5FGM A;  4LLG F;  1GT0 C;  2YX4 A;  1IZ1 A;  3OL3 A;  3WE2 A;  4S05 A;  4L0Y B;  1JUP A;  2LC2 A;  2KJC A;  3WU2 C;  4A0Y A;  3OSF A;  4UUV A;  3Q0U A;  1Y1W J;  1T0F C;  2A05 A;  2CYY A;  2D1H A;  2JA6 J;  1SMT A;  3WTW C;  4BE1 A;  2XAQ A;  2EFQ A;  4RAF A;  3OIO A;  4IRG A;  4L9N A;  4P96 A;  1I5Z A;  2EA2 A;  3MQ0 A;  2A5Y B;  2V1X A;  3L1P A;  3RKX A;  3OL4 A;  2GBY A;  2L9R A;  1BR1 A;  5BQT A;  1WJD A;  5ICE A;  2HVR A;  4GO1 A;  3WTT C;  1VQO I;  2X85 A;  2Z2S B;  3OWT A;  3TO6 A;  1VFC A;  2X48 A;  3QPS A;  5AON A;  2X0L A;  1WPK A;  3WU0 A;  1LE8 B;  4QPO A;  1NH3 A;  1V5G A;  2W00 A;  2EH3 A;  4CUG A;  4JX6 A;  2BHZ A;  1DUX C;  4R8H A;  2DU9 A;  2VT2 A;  5DV5 A;  1NG7 A;  3SEZ A;  1Z3X A;  2Z16 A;  2GIV A;  1ETQ A;  4CCO A;  2IW5 A;  1BC7 C;  3HGY A;  3JSP A;  2P7V B;  2BHY A;  2E1M C;  4IQJ A;  3K1M A;  1HXD A;  1FTZ A;  1P2F A;  3B73 A;  3GF2 A;  3LQQ A;  3WHC A;  2LP0 A;  2R0Q C;  4NQW A;  3GFL A;  3LST A;  4D0P A;  3E5U A;  4KA4 A;  3W2V A;  2ADU A;  4PJJ A;  1AHD P;  3GW2 A;  2CH0 A;  3HDD A;  2HWV A;  3FBN B;  3BTJ A;  4EGZ A;  4WF2 A;  3AKZ A;  1R4M B;  2ZO4 A;  3F6V A;  1YJN I;  5JLX A;  1IRF A;  2QYO A;  2XIG A;  2WB1 N;  3JR9 A;  5E17 F;  2VJ4 A;  1WJE A;  3MCZ A;  1UHM A;  2P6T A;  4LJZ F;  3V8K A;  2PFB A;  1P4W A;  1FEX A;  2VQH A;  2FSW A;  2MAB A;  4M6Y A;  2UWM A;  2CQX A;  5LEK A;  1L3L A;  1FP1 D;  2LSO A;  2AQF A;  4XON A;  2JN6 A;  2R7W A;  4IOC F;  2LKP A;  1VZ0 A;  3AG1 H;  3JRD A;  1UCR A;  2XV4 S;  1DGW Y;  1P4A A;  3Q9S A;  3VPR A;  3OYA A;  2HQ5 A;  2IS6 A;  2PMU A;  3RTR A;  1OCC H;  3HYI A;  1QHG A;  1BOA A;  1HW1 A;  2E1M B;  1AKH B;  2GM4 A;  3BY6 A;  2M0M A;  2XGX A;  4UHT A;  4XLA A;  3LSJ A;  4LOC A;  5LRS A;  3MKL A;  4ESB A;  1FMW A;  2OPT A;  2XF5 A;  2DA3 A;  5LFA A;  2K9L A;  4MEY F;  3EUA A;  3H5A A;  3TL4 X;  1OCT C;  3DEW A;  2DTZ A;  2CFX A;  4EEF G;  2HXO A;  5E79 C;  1IXC A;  2NVU B;  1D1A A;  1ENH A;  5FLM J;  2DFF A;  3H9G A;  4L9V A;  1SD6 A;  3H0G J;  5J40 A;  4A3C J;  3KP7 A;  3MMY B;  3NQO A;  1ETO A;  4XRS A;  4HX4 A;  1GVJ A;  3ZMD A;  3QOD A;  2E36 A;  4GXO A;  3OYI A;  2NS0 A;  4M3D A;  5IY5 H;  1IXS B;  3BG3 A;  1J7K A;  4MEX F;  2O9L A;  3F3X A;  3PO2 J;  2M4G A;  3HJE A;  4V2F A;  3VEP A;  4AM3 A;  1H88 C;  1BI0 A;  5ICF A;  2BY2 A;  2HYG D;  2ZXJ A;  3H5N A;  4XLN F;  1YIT I;  2VB6 A;  3MKZ A;  3HOU J;  1KYZ A;  3E5Q A;  1OPC A;  1DDN A;  1HW5 A;  2XAU A;  1SD5 A;  2CWE A;  3MKY B;  3RZO J;  4UVC A;  1N78 A;  4M6V A;  3DP7 A;  1B72 A;  3I71 A;  4MFE A;  1P6R A;  1K4T A;  1HA8 A;  3QOE A;  4FCY A;  1MZB A;  2H1L A;  2RGV A;  3BTI A;  5DM6 F;  1T33 A;  3L2V A;  2IS4 A;  5F0F A;  2HPI A;  2BY0 A;  3EYY A;  2IGK A;  1P7I A;  2DQL A;  2EV6 A;  2E1C A;  2IGN A;  2NAZ A;  1J5Y A;  3BR1 A;  1RKW A;  1SVL A;  4HYE A;  2R5Y B;  3IH2 A;  2OU2 A;  3IRQ A;  1D5V A;  3K4K A;  3OYF A;  2LY1 A;  1MND A;  3L09 A;  2STW A;  1Z05 A;  1YQA A;  3BR3 A;  2BV6 A;  3MAJ A;  1U6G A;  3OIP A;  1ULY A;  4W97 A;  1K83 J;  4F93 B;  2ZXH A;  5IOY A;  4BH9 A;  3CP2 A;  5HVQ C;  4GYI A;  2YX7 A;  4XQF A;  2LR8 A;  4BYY A;  1PUF B;  5IT9 Z;  3QU3 A;  3GZ6 A;  4IHX A;  2CU7 A;  4M74 A;  5FKL A;  2VQC A;  2X1D A;  1BR2 A;  3M8F A;  1HOM A;  1XCB A;  1D0Y A;  2HFH A;  2F5D A;  2XGD A;  5GTH C;  3PNT A;  3ABM H;  4JP0 A;  1TWA J;  3OS0 A;  3S1M J;  3R60 A;  4J19 A;  1VQM I;  4KT5 C;  4PZJ A;  4P1W A;  4C3J J;  3I4M J;  2V4J C;  1JGG A;  4FTH A;  1G3T A;  3OYB A;  3TKY A;  3R61 A;  2DFE A;  4AVZ A;  4M9S A;  5E3M A;  1EH7 A;  1OR7 C;  5KHD A;  4J00 A;  2DFI A;  2E19 A;  4NUB A;  2EZH A;  2IS2 A;  2RN7 A;  4KN4 X;  3MKW B;  1TNT A;  3REO A;  3CJQ B;  1BW5 A;  4NHJ A;  4CGZ A;  2PBI A;  2F4O B;  2ACJ A;  1ETW A;  3ZQQ A;  3PUB A;  1D8K A;  1OMI A;  1BI3 A;  1AU7 A;  2CV1 A;  3ZMS A;  2MD0 A;  3OSG A;  2KRF A;  1I3Q J;  2DQR A;  2XKP A;  1S3J A;  2DK5 A;  2X6Y A;  2RKH A;  1FBS A;  1J0R A;  2FXA A;  4ZYH A;  3M3Y J;  4I2O A;  1I27 A;  3DTK A;  5DTD A;  2Y9Z A;  5D5W B;  2A6H F;  2Y69 H;  4CO8 A;  1V5E A;  5J1U A;  3FIW A;  1P92 A;  5IYC J;  4WXC A;  4XRF A;  4RBO A;  2KQR A;  3I59 B;  1Z21 A;  2ZNZ A;  4L18 B;  1K78 B;  5IT9 K;  1SFX A;  1S7E A;  1TP4 A;  1UMQ A;  1WJ5 A;  4UXN A;  1O3R A;  3E6C C;  1ZRE A;  5CVI A;  2DA1 A;  2UUZ A;  3HL2 A;  3BR6 A;  4CCK A;  2ZCW A;  1EA3 A;  5K5Q A;  4ON0 A;  4CHU A;  1U5T C;  3KYD B;  1WH7 A;  1O3Q A;  3K4N A;  5E3O A;  2EZK A;  4A3M J;  3D5S C;  2HQA A;  2W24 A;  4OIQ F;  2EV5 A;  2R7X A;  2QBY A;  2OTJ I;  2ZNY A;  1KA8 A;  3P9I A;  3I64 A;  3D1N I;  1HLV A;  4IHW A;  1TQP A;  4R79 A;  1ERD A;  3IC7 A;  4KIC A;  4DZP A;  1FX7 A;  1UZC A;  1ZYR F;  3PNY A;  1MBF A;  2M0C A;  1BL0 A;  1R00 A;  1V55 H;  3CF2 A;  3NEU A;  4EM2 A;  3ABT A;  2PG4 A;  5J1R A;  2CUF A;  2GOX B;  1HQC A;  2G0E A;  2OQR A;  4ZYG A;  2R7T A;  3E0J B;  2V9P A;  1CGP A;  1KU9 A;  2K3P A;  2VUM J;  1J09 A;  1WI9 A;  1MDM B;  5JVG F;  4RGU A;  4N9H A;  4IRI A;  2NVQ J;  5CPR B;  2R92 J;  2L5Q A;  1YX3 A;  3DPU A;  5TIS C;  3KLO A;  2R7O A;  5M5X J;  3ASN H;  2IAI A;  3IH3 A;  2VQG A;  1V3F A;  1X3U A;  3R0A A;  4A3K J;  5DCM B;  5E8G A;  1HDD C;  3CTA A;  1E0E A;  1TWC J;  3CCR I;  2KP6 A;  2K9N A;  1MBG A;  2QQA A;  2VKE A;  2FX0 A;  4E7L A;  1S7A A;  4LG0 A;  2QM3 A;  5FKO A;  1U5T B;  1Y0U A;  1ZR2 A;  5GAD J;  3HRS A;  1I3A A;  1KU7 A;  5CKT A;  1FLI A;  2L7M P;  1LPQ A;  1VQP I;  1BW6 A;  2JA2 A;  2Z3Y A;  4E7Z A;  1G2H A;  4RDU A;  1J59 A;  4GCV A;  3OYG A;  3S2H J;  3CLQ A;  3QP5 A;  1E3P A;  4II3 A;  4W1U A;  3S1Q J;  1QPI A;  3MFK A;  3LSR A;  2PJR A;  1MMS A;  3C7J A;  1XTA A;  2LDU A;  3A4C A;  4HAM A;  4Y33 A;  3BOQ A;  4EMS A;  2XF6 A;  1XD7 A;  1YW7 A;  3G1O A;  4I98 B;  2BXZ A;  3O2P E;  1R4N B;  1UB9 A;  5L3D A;  4XNF A;  3CC7 I;  4BBR J;  2COB A;  1TWH J;  5HS9 A;  5H2F C;  5HS8 A;  3TO9 A;  1UHS A;  2LRD A;  3K4M A;  4U0V A;  1XCV A;  2NS8 A;  3IL2 A;  2VN2 A;  4Z2Y A;  3VOD A;  2QQB A;  2A5W A;  2EQR A;  2E1O A;  2F5V A;  2BE5 F;  1TWF J;  3HUG A;  2W1O A;  1BN5 A;  2P8T A;  2YU3 A;  3HSR A;  3TOB A;  1ZN2 A;  3ZN0 A;  1LVA A;  4DJA A;  2F5C A;  2KPM A;  5BPI A;  1XSD A;  4XLP F;  3HOV J;  2XSD C;  4XOP A;  5B1B H;  5F1R A;  4M6X A;  4XIC A;  2FNP A;  2P7C B;  4PJ0 C;  3WGH A;  1R9T J;  2DMQ A;  3KYC B;  1Q1V A;  4KYW A;  1XGS A;  2ZSH B;  4YRV A;  1H9G A;  2X6X A;  2R5Z A;  2VBX A;  5IT3 A;  1FSE A;  2L9S A;  4N4N B;  3OYJ A;  3VWB A;  3C18 A;  2X1C A;  4XLE A;  3T1B A;  1E17 A;  1MH3 A;  3F8M A;  3RZD J;  2LF7 A;  4GGG A;  2F4M B;  5D6E A;  1F36 A;  3ONQ A;  4A3F J;  3HPG A;  1YI2 I;  4C9Y A;  4RMN A;  4IL6 C;  4KIG A;  5DUK A;  3AG3 H;  3WHB A;  1PYV A;  2QKL B;  1ONV A;  2WC2 A;  1OIS A;  2LBF A;  5C4J J;  4A69 C;  3TED A;  1IDZ A;  3S1R J;  2PJP A;  3G2B A;  2L3D A;  4OOI A;  4B3X A;  3OYE A;  3BRO A;  4U0Y A;  5A2Q Z;  2XGC A;  3QAH A;  3VOE A;  5EZH A;  1E3H A;  1YG2 A;  2EFW A;  2WAQ A;  1W0U A;  1WRJ A;  2M45 A;  2LD5 A;  4RB2 C;  2PMZ A;  5DUI A;  1Z6T A;  5ED4 A;  3WGI A;  4IJA A;  1W0T A;  1OCO H;  3FXL A;  1X58 A;  2M4K A;  4IQ4 A;  2EIM H;  3G73 A; 
#chains in the Genus database with same CATH homology
 1VQK I;  3CCQ I;  3CMA I;  1HC8 A;  4V19 K;  1YJW I;  1MMS A;  1FOW A;  3PIO F;  1VQ4 I;  5GAG J;  1S72 I;  2QEX I;  1VQ9 I;  3CC7 I;  4IO9 F;  3DLL F;  2E36 A;  1VQO I;  2K3F A;  3CCV I;  2QA4 I;  3CCJ I;  4IOA F;  3G6E I;  1YIT I;  3CF5 F;  3I56 I;  1FOX A;  3CC2 I;  1YJ9 I;  5GAH J;  3J7Z I;  2ZJP F;  3G4S I;  1QA6 A;  3CCM I;  3CCL I;  1VQL I;  5DM6 F;  3CCE I;  2OTJ I;  1VQN I;  5DM7 F;  2NXN B;  2E34 A;  3CME I;  1YJN I;  1YI2 I;  3CD6 I;  3G71 I;  2E35 A;  3PIP F;  2FOW A;  3CC4 I;  5JVG F;  2ZJR F;  1ACI A;  4IOC F;  2OTL I;  4UY8 I;  2H8W A;  3CJT B;  1YHQ I;  1VQ6 I;  1VQ7 I;  2ZJQ F;  1FOY A;  3CCU I;  3I55 I;  3J7Y J;  3CCR I;  1VQ5 I;  1VQM I;  3CCS I;  1YIJ I;  1Y39 A;  1VQ8 I;  5GAD J;  2JQ7 A;  1VQP I;  5GAE J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...