2MLGA

Stf76 from the sulfolobus islandicus plasmid-virus pssvx
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
KAKLSLTQLILIRLSNRGCQTLEELEEFTQAKREVLLVTLTRLHQRGVIYRKWRHFSGRKYREYCLKHRDELADLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfolobus transcription factor 76 aminoacid protein, Stf76
publication title Structural and functional studies of Stf76 from the Sulfolobus islandicus plasmid-virus pSSVx: a novel peculiar member of the winged helix-turn-helix transcription factor family.
pubmed doi rcsb
source organism Fuselloviridae
molecule tags Dna binding protein
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2014-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2mlgA00
3GVAA 3E6MA 1QO0D 5DUKA 4ZYDA 2FXAA 2A3SA 4UV9A 2QQ9A 2Z5UA 1K78A 1W5SA 3ULQB 1TW3A 1ZG1A 2JTVA 2COMA 1MD0A 3R4KA 1FZPB 2XV4S 2Q8KA 3F21A 4YFKF 1MDMA 2Y0MA 1Z9CA 3EUHA 1V3FA 5DCMB 5D5UB 1YW7A 3QPHA 3FX3A 4A0ZA 1ZRCA 3Q5FA 3B02A 5H6QA 4R79A 4WXDA 4AIHA 2PFBA 2FNPA 2A61A 2P5VA 4GCVA 4EJOA 4Q5SF 1ZAOA 3HTSB 3IWZA 2VT2A 2V1UA 4F7ZA 3N4MA 3IRQA 2BEOA 1ZGAA 2IVMA 3BPVA 4WXHA 2QLZA 5A2QZ 2KIUA 2RVCA 1H0MA 4Q4ZF 4L9VA 1BJAA 3DPLC 3HRTA 5JR3A 2O6GE 3ZP5A 1SMTA 4LMYA 3E6BA 1J2XA 1I5ZA 1RZ4A 3WG9A 3RDIA 5AIPA 5CVIA 4WK8F 3GFLA 4HW0A 3CJNA 3GF2A 1O57A 4EQQA 2NNNA 4KT5C 5FD6A 3WE3A 2LF7A 3FF5A 3SZTA 3HSEA 2M5WA 2HEOA 2ZBKA 3T8TA 1P6RA 2FMYA 1FSHA 3E97A 3LSTA 2QBYA 1BIBA 2STWA 3L9FA 2OU2A 3V8LA 1FBUA 5CVVA 4HOBA 4MQ9F 1HW2A 1GXPA 1XCVA 1USTA 4AWXB 1QQIA 5D8KB 2JRTA 1DPRA 5D5VB 1YLFA 1ZREA 2QM3A 3DEUA 1HW5A 3CUQA 1RIOH 4L9NA 1Z91A 3O2PE 1YS7A 1OYWA 3JTGA 2CW0F 2FSWA 3I64A 3P9KA 1BC8C 5FGMA 5A2QK 4NHJA 3K1NA 2ESHA 5ICGA 1XMKA 4G6DA 1K7AA 4EJTA 3KZZA 3GWZA 5LGNA 1IN4A 1IXCA 2ZXJA 1JXSA 2P6SA 1ZLKA 3V4GA 4U88A 3JW4A 2PN6A 3I5UA 3TOAA 4K2EA 4O5VA 3V8JA 1YFHA 5CYVA 3IL2A 3KLNA 2ZJ2A 4GXOA 4M6XA 4A0YA 2WC2A 3C18A 3Q9VA 1R22A 3GEZA 1OYYA 3LA2A 2XKOA 5D5WB 2D1HA 2MBFA 5F1RA 5E1ZB 1O7FA 3H3ZA 3J81K 3ERED 4A0XA 2DK8A 3RJPA 3SZPA 5HDGA 2GWRA 1XSXA 3RPUA 3T8RA 3LA7A 2IW5A 3BJ6A 1FLIA 3EYIA 1KQ8A 3P9CA 3HOSA 3JSPA 4EGYA 3HRUA 4DNCA 2UXNA 2QVOA 2VE8A 5CVUA 1K78B 5DCFA 2XKPA 1VTNC 2HTSA 3W6JB 2DPDA 2FEZA 2MLKA 4LB5A 3ML6A 1RI7A 2CQKA 1MDMB 2GIVA 2B0LA 1MJBA 5K1YA 2P6TA 2LDUA 2HZTA 2AS5F 2PMHA 2X0LA 4M9SA 1KU2A 4LLGF 2EA4A 3DXJF 2PJPA 2PMUA 1HKQA 4BQAA 1UHWA 1BC7C 3CO7C 3ZMSA 5KVRA 1ZARA 4HX8A 2YX4A 1O3QA 3REOA 1HSJA 5DCMA 5AIQA 1R1VA 4WWCA 4EMSA 1TNTA 3VOEA 2ZO4A 2CWEA 2E1NA 1XN7A 3EETA 3EYYA 1TQPA 1LB2A 3L2CA 2IJLA 4MNUA 4IRGA 2VOOA 4KN4X 2J5OA 4BH9A 3NRVA 4LLLA 3DQVC 2A6HF 3WTZA 2HKOA 1YO5C 1JE8A 1ULYA 1A04A 4AVPA 2CGPA 1OPCA 5DEQA 1KU3A 3TGNA 1QZYA 3M8FA 1K6OA 1PP7U 1G6NA 4RB0A 4U7BA 4UHTA 3JAMZ 3WTTC 1WSUA 2K02A 1WRJA 4O6JA 1T2KA 2BGCA 2YR2A 4WF2A 3KLOA 2KJCA 3HUGA 5LHGA 3E5XA 3U9GA 4DQ2A 2OQRA 3ZMUA 3F72A 1FC3A 2EWNA 3HSFA 2VBYA 2PI0A 4HZFA 3CUQB 4LGWA 2VODA 5D6FA 3VODA 3O3KA 3N97A 4M73A 1P4WA 1IN6A 5K5RA 5D4SA 3LAPA 3LA3A 2PG4A 1JGSA 2XAGA 5D8LB 4YIFA 3EQLF 3SXYA 5DUIA 2ZKZA 3K69A 1QNTA 2IP2A 3K1MA 3GLXA 4I0AA 4L9JA 4ZZDA 2A6EF 2FU4A 2XASA 5D6EA 3RYPA 5CJ9A 4I0BA 5LRRA 2RV8A 2NYXA 3DF8A 3VEPA 2FF4A 1G3YA 4L9TA 4P96A 2EFNA 3F3XA 2XAFA 2ZCWA 4WX9A 3FWEA 4KYWA 1SD4A 3C1DA 4RS8A 3JAMK 4G6QA 2ADUA 2XHKA 4HLYA 1G3SA 2KIFA 1MJAA 2H09A 4KNYA 2FE3A 5LGUA 2W85A 3BY6A 4ZZLA 1R00A 1UFMA 1FBSA 5ERIA 2RDPA 4QWQA 2D2WA 3TKYA 3VFZA 4L5JA 1D3YA 3MQ0A 3ROUA 4RB3C 5EEHA 3WE2A 2K4BA 1F4KA 1BIAA 1FT9A 1S6LA 4OMYA 2DPUA 4M9ZA 1IRGA 1OMIA 2RNJA 5E20A 2EFQA 1Z1DA 4CGZA 3GW2A 4IHTA 3KP4A 1WI9A 2HYFA 3CO6C 2K86A 2XVCA 4RGRA 5HOOA 5L3EA 2QUFA 4HV6A 1YIOA 2MC3A 3QP5A 1IXSB 3E3VA 4ASNA 5HVQC 1R1UA 2RQPA 4GO1A 2BE5F 3GX4X 4E70A 5BS6A 3WTYC 2V9VA 1V4RA 4CHUA 3HHHA 1USSA 1LEAA 5E18F 2STTA 2D45A 4HDUA 1XDSA 4MHGA 1ZG3A 4NQWA 5KK1A 3QU6A 2NRAC 3MFKA 1BI1A 4ZYEA 3BOQA 5DD4A 4EGZA 4ESFA 3LAJA 2OAZA 1B9MA 1KYZA 2VE9A 2EV5A 1DDNA 1P4AA 2E7XA 2XAQA 4ENJA 1GVJA 4ZYGA 1B4AA 3WODF 2V1DA 3KE2A 3ZN0A 2YX7A 1U6GA 3ABUA 5L3FA 2DTRA 4A6DA 2EA2A 1E2XA 1LDJA 4N0BA 2FBKA 4S04A 2DU9A 4M74A 4P9FA 3ZPLA 4XBFA 3ZMTA 4EV0A 3FHZA 4G7ZF 2CO5A 4LJZF 2MA3A 5LRSA 1TQMA 2DT5A 1IN5A 3V7SA 2UZKA 4KIGA 3RI4A 1ONVA 5HLHA 3GXOA 3J81Z 4KMUX 3C7JA 3ABTA 1U3EM 3I4PA 3BP8A 3CTAA 2PLYA 5L3BA 3BPXA 3SHFA 1S3JA 1S8NA 4LB6B 5ILUA 2QZ8A 1U2WA 5J8FA 1ZG5A 4I98B 3FXQA 4UVAA 2NAZA 3IHUA 2X4HA 2CG4A 1IF1A 4KIBA 2TDXA 4IRIA 4EM1A 4OIPF 4LFUA 4H0EA 4PGHA 2VONA 4YFXF 4JBAA 1G3WA 3U2RA 4UVCA 2A68F 2LKPA 1FOKA 4UUVA 2W25A 5H20A 3C3WA 1XSDA 1IW7F 2GAUA 5HS7A 2EFPA 4I02A 1P92A 1REPC 1ZN2A 1K79A 2G7HA 4MQVA 1B1BA 3RIRA 1WQ2A 1J59A 4GYGA 1XGOA 3E6CC 4N9IA 3K1PA 1SFUA 4GYIA 4I7HA 2EV0A 5IT3A 1HBXG 2IA2A 2M45A 3BDDA 2LF8A 1S7AA 3KZYA 3OOPA 3TO7A 1W4MA 2DW4A 2ISZA 3M8EA 2GA1A 2VBZA 5K5QA 3DFGA 3KETA 4YG2F 3JTHA 1HKSA 1B9NA 5TJJA 2E1CA 3JSOA 1BI2A 3V7RA 1MJ9A 3U1DA 2M1BA 3R61A 3WGHA 3R0AA 2H6BA 2YPRA 3QP6A 2V79A 2Q0OA 2DFIA 2GQQA 3HIFA 3PQJA 3WGGA 1U5TB 3GZ5A 1U5TC 4RB1A 1STZA 1TNSA 1FNNA 1R5HA 3T5XA 4ESJA 1C0WA 1SFXA 2HYGD 1FWZA 2P4WA 3RPQA 2RC4A 3IC7A 3D0SA 2G9WA 3CUOA 4PDKA 5HLIA 2VOPA 4MGRA 1LDKB 4LG0A 1HSTA 4ENKA 1LJ9A 3D5LA 4IPAA 3EDPA 4P55A 3F6OA 2HR3A 3FMQA 3I53A 3G3ZA 3F8MA 1X3UA 1I27A 5BPIA 2OQGA 4ZH4F 4EM0B 2UWMA 1U78A 3LQRA 5HDKA 2H94A 4UVBA 2F5DA 3WTVC 5FB2A 2YU3A 1ODDA 3MAJA 2XAHA 5AONA 4I09A 4EJWA 4WCGA 3KP7A 3T1BA 5LHHA 4PGGA 2P8TA 1QGPA 4HX7A 4IXAA 3V8KA 3QOPA 3WTSC 2WTEA 3OV8A 2FBIA 2F5CA 1LVAA 3GO5A 1XMAA 5LHIA 2GXGA 1XB4A 2DLLA 2HDCA 2O61A 2F5FA 2MH2A 5J6XA 3BWGA 1XGMA 2QQAA 2H27A 2EFOA 2R7DA 3K9TA 2Z99A 3PFIA 2HKXA 1UHMA 2WV0A 1O7LA 2IA1A 4OIOF 3I59B 3M1EA 4IVNA 2EB7A 1W7PD 3RYRA 3RKYA 1Y0UA 1P2FA 2W84A 1TBXA 4HV5A 5BQTA 3I58A 3COAC 5LBQA 2CYYA 1LNWA 2IPQX 4HQMA 5HS8A 1FYLA 4BHPA 2HTJA 1FBQA 1Z05A 4LK1F 5ILSA 1LEBA 4XSZF 1H9TA 1ZRFA 1PDNC 4Z2YA 4Y13A 3IKTA 2K7LA 2KKOA 1Z6RA 4M71A 4CICA 1KU9A 3J7AO 2QENA 3DPTA 1T98A 3HRSA 5D4RA 1KA8A 3KFWX 3RKXA 1DPUA 2ETHA 4OU0A 4KICA 2IA0A 3ECHA 3CLOA 1TQIA 5DYMA 1YTYA 1J7KA 2QQBA 2XUBA 1RUOA 5FLXK 1B6AA 3FZVA 2VBWA 1R5GA 1XD7A 1XSVA 4R1HA 4L18B 4R8HA 4I2OA 2Y75A 4BHCA 1LQ1A 4LK0F 3MCZA 2XROA 3AAFA 4M72A 3L09A 1EH8A 1SD6A 4AIJA 5ICCA 2LSOA 4CZZA 1ON1A 1IAWA 3T0YA 1FP1D 3LFKA 4YIIA 4KUMA 1YW8A 1ZGJA 3L7WA 2JZYA 4XLNF 3KP2A 3KP5A 3IKVA 3WU0A 4IHSA 2Z33A 1TW2A 4NB5A 1S7OA 4N9HA 5BOXA 2DBBA 1BN5A 2HQRA 2RN7A 2XIGA 4L0YB 3HOTA 1PP8F 2KIMA 1MKMA 4L5IA 5E8GA 3ZQ7A 2Y48A 3MZHA 4TV7A 2GXBA 3GFIA 3RTRA 1P4XA 2Q2EA 4RAZA 3TO9A 1RUNA 1YS6A 4CXFA 2EV6A 4FX4A 2HWVA 2W57A 4MTDA 3H92A 3F23A 1XGNA 2L02A 2V6CA 4RGXA 4LG0B 2VC1A 1F5TA 3RKWA 4EVIA 2FNAA 4ENNA 5LEJA 5JHUA 3GFMA 1U5TA 3ZMVA 3TDZC 4G8XA 3SFZA 2PBIA 2XGXA 1W7PB 3E6DA 1R36A 3F22A 4FT8A 1BI3A 1NHAA 3E5QA 3F8BA 1FYKA 4LLNA 1XGSA 3KCCA 2L4AA 5H6RA 5JFRA 4RAYA 3MWMA 3ISPA 1FSEA 3J80Z 2HS5A 4HAMA 5ILVA 5E1XA 3GYHX 2HFHA 4L0ZB 4Q47A 3K0LA 3F6VA 4B8XA 2L54A 4BHBA 2A07F 2F5EA 2FA5A 1QBJA 2D1VA 4UNOA 1TLHB 5TRDA 2IRFG 4B09A 2HOEA 3GFJA 1HW1A 4MTEA 3TDUC 4CYDA 4BXUA 2Z3YA 2AXLA 3QAHA 1J9IA 4U0YA 3S2WA 4M9XA 1E17A 1HQCA 5ICEA 2M87A 1MGTA 2RGVA 4S05A 1FX7A 3KP6A 3F8CA 4IF4A 2KRFA 5FFXA 2V1XA 4G7OF 3LWFA 4HX4A 3I59A 5CVRA 1WKMA 3R0JA 4HF0A 1LDDA 1U8RA 1G4DA 2EJRA 2QYOA 2O3FA 5HDNA 3LQQA 1T39A 1KU7A 2A5YB 3P9IA 1MZBA 1SFEA 2JPBA 5DDGA 2L4MA 1SD7A 4HLXA 1R7JA 3HTUA 2VBXA 1S29A 2ZNZA 3J80K 3ZMDA 3R60A 4ON0A 5BPDA 1HKTA 2ISYA 2NNYA 1XDUA 3F8NA 3GUDA 3MEXA 3WU1B 2M8EA 1ZYRF 1KGSA 4P5OA 3FM5A 4BYYA 3K2ZA 5ED4A 1OKRA 5F64A 4QLCU 4U0WA 4Y17A 4BAYA 2C6YA 2KJBA 1IN7A 1T0FA 4OIRF 3KP3A 2O8XA 4XSXF 2DO7A 4FX0A 2VT3A 3PQKA 3NQOA 3HHGA 1FP2A 5F6FA 5L3GA 5JVTA 1ZHFA 3H3UA 2XAJA 1CF7B 5L3DA 3ECOA 1OR7A 5IT9Z 2ZMEB 4GGGA 3O6BB 5J8CA 4G94A 4Y15A 1D8JA 2ACJA 4OOIA 3HYIA 4WXCA 1O3SA 1D8KA 1DP7P 1D5VA 2OZUA 3FMSA 4YFNF 1Z7UA 4BNCA 1O3RA 2F2EA 3WTUC 1R23A 1ZLJA 4UXNA 5CVJA 2L3DA 4D0PA 2PEXA 1L0OC 2RKHA 2FOKA 5DD8A 3ZN1A 2JPCA 1FY7A 4ESBA 1UB9A 2J5PA 3R6SA 5D5XB 5FD5A 2E7WA 1L3LA 1TTYA 1ZH5A 1QZZA 1BOAA 3QRFF 2UXXA 4G9YA 2GZWA 1PUEE 1R1TA 3ZMZA 2WWYA 3WTWC 1HXDA 2DK5A 1T6SA 1JHHA 5FFZA 3KEOA 3I0TA 2DQLA 2DAOA 4KN7X 1FYMA 4MEYF 3V7CA 2M30A 2JT1A 1F9NA 3QPTA 4HA8A 1EH6A 1ON2A 1QPMA 1W7PA 4A6EA 5IT9K 4FHTA 2W24A 1IN8A 1J5YA 1GHCA 3E5UA 1YQAA 3P7NA 1BBYA 1ZRDA 4EM2A 4JK1X 2YSRA 5E1WA 1IZ1A 4ETSA 4PCQA 2A69F 2MD5A 3L00A 1SD5A 2NS0A 4A5MA 2O0YA 2EFWA 4U7DA 3SQNA 3FXRA 1AOYA 5FLXZ 1CGPA 3F8FA 3ELKA 2P5LC 3BROA 2P7VB 2OA4A 1EH7A 5LLQA 2EK5A 5CLSA 6PAXA 4XLPF 2GA2A 3W6KB 3WTXC 3HSRA 5E8IA 2MLGA 2L01A 2K27A 4XRFA 2FBHA 1KYWA 2ZFWA 4Q48A 4ENMA 4HF2A 2P5KA 1G3TA 4I01A 4KA4A 1AWCA 1O3TA 4PZJA 1I1GA 4LD5A 5ICFA 3FM3A 4ZYHA 4CO8A 4A5NA 4EJVA 1FPQA 4OMZA 1UCRA 3G73A 2FMLA 1RNLA 3QU3A 4A2UA 2P7CB 2BYVE 3M7GA 4EJUA 1EV7A 5LEKA 5E17F 3IRRA 2QBYB 5EEGA 2OD5A 2FRHA 1JHFA 2O03A 2PQ8A 2HGCA 3I71A 4KFCA 5HS9A 1YYVA 2HQNA 1W5TA 3TOBA 4G7HF 1SAXA 2H6CA 5BMZA 1IRFA 1YG2A 4CDGA 3CUQC 5HLGA 4OINF 1YW9A 4HF1A 3DP7A 2JSCA 4HBLA 4IRHA 2QWWA 2DI3A 1BI0A 1J0RA 5LGTA 2CFXA 2IT0A 4A12A 2VC0A 4HQEA 4KMFA 3Q9SA 2ELHA 1DUXC 3M9AA 5DV5A 3DKWA 3B73A 2DQRA 5K5OA 1R58A 3BJAA 2R7FA 3MZYA 1WWXA 2FQ3A 4KIFA 2OBPA 1H9GA 2K4JA 3DV8A 1KQ9A 2ESNA 4RGUA 4KDPA 1Q1HA 2CSOA 4AIKA 1IXRC 3IWFA 4U0VA 1CF7A 4HYEA 2XRNA 3FMRA 3TO6A 2ZMEA 1OYIA 2BBYA 4IJAA 3TQNA 3FXUA 2ZNYA 1J75A 1BM9A 3HRMA 2Z9OA 4JQFA 3NEUA 2BV6A 4P9UA 2MH9A 3BZ6A 4RGSA 4UV8A 1I6XA 4AD9A 4M6YA 1F1ZA 3CDHA 2OZ6A 2VN2A 2G7UA 5L3CA 1T38A 1SMYF 5FO5A 2R3SA 1IUYA 2LNBA 3I54A 1KQ0A 5JI6A 3KEQA 3VB2A 4OIQF 2VXZA 4RB2C 4MEXF 3GZ6A 3WGIA 1GXQA 1I1SA 4HDVA 1B59A 1XCBA 1Z6TA 4O3MA 3BJOA
chains in the Genus database with same CATH superfamily
3GTLJ 1D5YA 3OR2C 3VYUB 3GVAA 1UAAA 3E6MA 1QO0D 5DUKA 4ZYDA 2FXAA 5F27A 4MO7A 1OFCX 3TW7A 1XMXA 1NTCA 1AKHA 2A3SA 4A3LJ 4UV9A 1PVEA 2QQ9A 2Z5UA 1APLC 1K78A 1W5SA 3ULQB 3DCFA 1TW3A 1ZG1A 2JTVA 2COMA 1MD0A 1TP4A 4JOMA 2HZDA 4E7LA 3R4KA 4CCJA 1BL0A 3BT9A 1FZPB 2XV4S 5IOZA 3OSGA 2HVSA 2Q8KA 3F21A 4YFKF 4QSHA 2Y0MA 1MDMA 1Z9CA 3GTPJ 2R7RA 3EUHA 1T95A 1V3FA 3RZDJ 5DCMB 5D5UB 4PFPA 2KFDA 1YW7A 2XB5A 3JRAA 2HNHA 4P1WA 2OJED 4XNFA 5FJ8J 2V1NA 1SFOJ 3QPHA 3FX3A 2JWTA 4A0ZA 4CH7A 1ZRCA 3MD2A 2A6TA 2WAQN 3Q5FA 3B02A 2VJ5A 1BR1A 5EG0B 3K10A 3CMEI 1B72A 5H6QA 4R79A 4WXDA 1LPQA 3B6AA 4AIHA 4HNVA 2PFBA 3S16J 2FNPA 2A61A 3WHCA 2P5VA 4GCVA 4EJOA 4Q5SF 3JREA 1YJWI 1ZAOA 3HTSB 3Q0VA 3IWZA 1G8XA 3KYDB 2VT2A 2V1UA 4F7ZA 1JKQC 1VQNI 1K4TA 2DMUA 2F4IA 3LOCA 3N4MA 1DU6A 3IRQA 4MIMA 2BEOA 1ZGAA 2KMUA 4LIVA 2IVMA 4MFDA 4M3EA 3CCVI 3OR1C 3BPVA 2AHQA 4WXHA 2QLZA 1MH4A 4BQQA 5A2QZ 1U9OA 2KIUA 2RVCA 1H0MA 4Q4ZF 4L9VA 1BJAA 3DPLC 3HRTA 5JR3A 2E2HJ 4G12A 2O6GE 3ZP5A 1I39A 4J19A 3CP8A 1SMTA 4LMYA 4UUTA 3E6BA 1J2XA 1I5ZA 1RZ4A 1PYVA 4A3MJ 2F4MB 3WG9A 3RDIA 5AIPA 3LSMA 5CVIA 2R7XA 1TT5B 4WK8F 2CW8A 5K7HA 4DYQA 3GFLA 4HW0A 2IS1A 1OCPA 2NVYJ 3CJNA 3GF2A 1G2HA 4ITVA 1O57A 2DA4A 4EQQA 2NNNA 2Y31A 2RREA 4KT5C 5FD6A 1X1CA 1SVLA 2E34A 3AKZA 3WE3A 2G0EA 2VJIA 1WJ5A 2LF7A 2ZSHB 3FF5A 3SZTA 3HSEA 1PUFA 2CUJA 2M5WA 3ZQGA 2CV1A 2HEOA 2ZBKA 3I56I 3T8TA 4KITB 1P6RA 2FMYA 1FSHA 3E97A 1UG2A 2W7NA 3LSTA 3ERMA 2LBFB 4XKBA 1ZR2A 2QBYA 1BIBA 1JTXA 2STWA 1XC5A 3L9FA 4JX6A 2OU2A 3V8LA 1FBUA 5CVVA 1MNDA 4HOBA 4MQ9F 4CSWA 1RRJA 1HW2A 2K9QA 2TRTA 1GXPA 1XCVA 1USTA 1P9QC 4AWXB 1QQIA 4EEFG 5D8KB 2JRTA 4PFOA 1DPRA 1TWHJ 2WBMA 3EPZA 3FXMA 5D5VB 1YLFA 4B44A 1ZREA 4D9JA 2QM3A 2A05A 3OS1A 3IV5A 3DEUA 1HW5A 3CUQA 1RIOH 4L9NA 1Z91A 3O2PE 3TMOA 1SC7A 3S2HJ 1YS7A 4PSXA 1OYWA 3JTGA 1I50J 4NC8A 2XPWA 3BLYA 3OYFA 2CW0F 3FK7A 2FSWA 3I64A 3P9KA 1Y1WJ 2ICWG 3I4NJ 1ZR4A 3CCJI 4LG3A 1BC8C 2QA4I 4N4OB 5FGMA 3JRCA 2EBIA 1EKEA 5A2QK 4E6KG 4NHJA 1HOMA 4RLQA 2COBA 2ESHA 3K1NA 5ICGA 1XMKA 4G6DA 4RA2A 2L9VA 1K7AA 4EJTA 3HOUJ 3KZZA 1X1DA 2B7EA 3FXKA 1ETYA 3LMMA 2UUZA 3LNQA 3GWZA 3OL3A 1MH3A 5LGNA 1IN4A 1IXCA 1F43A 2ZXJA 1JXSA 2P6SA 5GTIC 1ZLKA 3FK6A 1KONA 5EZGA 3OYIA 3V4GA 2X51A 4U88A 4MLOA 3JW4A 3H3VK 3NAUA 2PN6A 1TWAJ 3I5UA 3TOAA 4K2EA 4E7JA 1Z3XA 4O5VA 3V8JA 1YFHA 5CYVA 3IL2A 3KLNA 2HI3A 1A31A 5FRNA 3FDYA 3G1LA 2ZJ2A 5B5EC 4GXOA 2XRLA 4M6XA 4A0YA 2WC2A 3DBLB 3C18A 3Q9VA 1R22A 3OIOA 3GEZA 1OYYA 3LA2A 3CC7I 2XKOA 5D5WB 2D1HA 2MBFA 5F1RA 3UR3C 2L7ZA 1E3HA 4B1RA 3K4MA 5E1ZB 1O7FA 3H3ZA 3J81K 4UUSB 3ERED 4A0XA 1JJ6C 4BDZA 2DK8A 2HYJA 3RJPA 3SZPA 5HDGA 2GWRA 2BW3B 4C2MJ 1V55H 2VXDA 1TWCJ 1OCCH 1XSXA 1YX5A 2MC4A 4BQNA 1YI2I 2GLOA 2JVGA 3RPUA 3T8RA 3LA7A 2IW5A 4CCNA 3BJ6A 1HDPA 1FLIA 3EYIA 2EH3A 1UZCA 2K40A 3DTEA 1KQ8A 3BG6A 3PIPF 4HNTA 3PNYA 4CUGA 2XF5A 3P9CA 5FKMA 3HOSA 3CCYA 3JSPA 4EGYA 3HRUA 4DNCA 2UXNA 2QVOA 2VE8A 5CVUA 2QKLB 1ETXA 4ZDLA 1K78B 2DXIA 4XKCA 1QVUA 5DCFA 2X1EA 2XKPA 3OIQA 1VTNC 2HTSA 3W6JB 3OWTA 2DPDA 2FEZA 3I4MJ 2MLKA 4H4KC 2DOEA 2NVQJ 5J40A 2R5ZB 2ZJRF 3M3YJ 1FOYA 2VKEA 3HGGA 1S72I 3ML6A 4LB5A 3L2UA 2EZHA 4C2UA 1RI7A 2CQKA 1YX3A 1MDMB 2R93J 2GIVA 3KYLA 2B0LA 4FE4A 1MJBA 3C2BA 5K1YA 3IP4B 2P6TA 2HXOA 2LDUA 2K5CA 2HZTA 2AS5F 3W6VA 1R5ID 2PMHA 3SZGA 5EDNA 2DTZA 4NDLA 2X0LA 2F4OB 3HOYJ 2WAEA 1KU2A 4M9SA 1YJNI 2EINH 1ETVA 4LLGF 4M3FA 3L2VA 4HPQA 1FMVA 2EA4A 3DXJF 4E7KA 2PJPA 1WGXA 3A1YA 2IGOA 2PMUA 4NUBA 4JP0A 1HKQA 4NQWB 3ZQCA 4BQAA 1UHWA 1DGRM 2VUMJ 1BC7C 3DTIA 3DPUA 1X4PA 3CO7C 3NWSA 2JQ7A 4YRVA 2CW7A 3ZMSA 4BE2A 2AO9A 3FKJA 5KVRA 1POGA 5KAIC 1ZARA 4HX8A 2YX4A 1VQLI 1O3QA 2JK3A 3REOA 3J7AY 1HSJA 2BOLA 5DCMA 2EIJH 1HLVA 5AIQA 1R1VA 4BACA 2H8WA 4WWCA 4EMSA 1WJFA 1VQKI 1TNTA 3LFUA 3VOEA 2ZO4A 2W48A 2CWEA 1IV6A 2E1NA 4C30A 1W0TA 1XN7A 4PUSA 3EETA 5HLTA 3EYYA 4FETA 1TQPA 1LB2A 5CPRB 4DOZA 2FJ1A 5FLVA 3L2CA 2IJLA 4L5EA 4DIQA 3H5NA 4MNUA 4IRGA 4D7MA 2VOOA 4KN4X 1LKXA 3ZQLA 1RR8C 2J5OA 4BH9A 1OCOH 1ETOA 3NRVA 4LLLA 3DQVC 2A6HF 4CYCB 3IAM2 4IQ4A 2HKOA 3WTZA 3DLLF 2CV2A 4ZYAA 4C2TA 3DBHB 1YO5C 3ZXSA 3S1NJ 2VQCA 2M34A 1JE8A 1ULYA 5E3LA 5IYBJ 4OAZA 1A04A 4BGDA 4AVPA 2K9LA 3OYMA 2CGPA 4DZJA 2WADA 1OPCA 5DEQA 4XRMA 2E1MC 2CJJA 2QSHX 1KU3A 4QTRA 3TGNA 1QZYA 3M8FA 1K6OA 4II2A 1PP7U 1FEXA 1G6NA 4RB0A 4U7BA 1PUFB 4UHTA 2F6CA 3U1KA 3JAMZ 4Y3OA 1H88C 2CQXA 2W00A 3WTTC 2JVHA 1WSUA 3K7AJ 2K02A 4C3HJ 1WRJA 3UNGC 4O6JA 4ABZA 1SVMA 1T2KA 2BGCA 3HKZN 2LY9A 2V6EA 4BY1J 2YR2A 4WF2A 2MG4A 2HQ5A 3KLOA 4G6TB 2KJCA 4F52A 3HUGA 2M0CA 1NH3A 1TWFJ 2OTLI 2LOOA 5LHGA 3E5XA 3U9GA 1MMAA 3K70D 4AM3A 1D0XA 4DQ2A 2OQRA 2VJ4A 3F72A 3ZMUA 1FC3A 1PJRA 2EWNA 3I55I 3NARA 3HSFA 4PK4A 2ZXWH 2VBYA 2PI0A 3ZCOA 4JYKA 2BVLA 4HZFA 1NG6A 4E7SA 2R5YB 2LP0A 1FTTA 4JX4A 3CUQB 3J7YJ 4LGWA 2VODA 2LBFA 5D6FA 1WHUA 2R7OA 3VODA 1LFBA 3O3KA 3N97A 4M73A 1P4WA 4IZZA 1IN6A 2LREA 5K5RA 5D4SA 3L2WA 3LAPA 1B8IB 1UELB 3LA3A 2PG4A 1N75A 4A3BJ 3W2AA 1JGSA 3CDLA 2XAGA 5D8LB 4YIFA 4XN3A 3S17J 3EQLF 3SXYA 5DUIA 1A6IA 4Y52J 1TL8A 2ZKZA 2HOTA 3K69A 1QNTA 1Z67A 2IP2A 4BQOA 1D0ZA 3K1MA 3GLXA 1X1BA 4I0AA 4L9JA 4ZZDA 2A6EF 2FU4A 2XASA 1WJEA 1QRYA 3I3LA 5D6EA 2MGQA 5CJ9A 3RYPA 4I0BA 3ZOBA 3UKGA 1QA6A 5LRRA 2RV8A 2NYXA 3DF8A 2PMZA 3VEPA 2FF4A 1G3YA 4L9TA 1Y1VJ 5IOYA 4P96A 2ECBA 2DMNA 3VSLA 2EFNA 3F3XA 2XAFA 4NC7A 2ZCWA 4WX9A 3A01B 1WJBA 2H1LA 1JT0A 3FWEA 4KYWA 1SD4A 5FRMA 3C1DA 3DEEA 4RS8A 4AUXA 2QQ8A 2JUCA 2CU7A 4F92B 3S1QJ 2IS2A 2IXSA 3JAMK 4G6QA 4BJ5C 5E3OA 2DDBA 2JA7J 4ZC3A 2X6WA 2ADUA 2X1CA 2XHKA 3OY9A 4HLYA 2NXNB 1G3SA 2WB1A 2KIFA 2LTPA 1MJAA 2H09A 2IBDA 4UB6C 1W5CC 2IS4A 2EIMH 4KNYA 9ANTA 1MBJA 2IGNA 2M4GA 3LL7A 2FE3A 5LGUA 2W85A 2Y30A 1OLTA 3BY6A 4ZZLA 2ZXIA 4XMYA 3QPLA 3L2RA 1R00A 3CF2A 4QPOA 1UFMA 1TZLA 1FBSA 3IAS2 5ERIA 2RDPA 4QWQA 2D2WA 3TKYA 3WHBA 3VFZA 3OMYA 4II3A 4L5JA 1D3YA 2EZIA 3MQ0A 5GPAA 3ROUA 4RB3C 4FQGA 5EEHA 3WE2A 2K4BA 5EEAA 1F4KA 1BIAA 1GV5A 1FT9A 3AL0B 1S6LA 3BG7A 4UUSA 4OMYA 2JUGA 1MMNA 2DPUA 4M9ZA 5C4XJ 2LH9A 2R7ZJ 1IRGA 4HSTA 1OMIA 2RNJA 2HOSA 1DQUA 3VYSB 1HC8A 5E20A 1WPKA 2EFQA 1Z1DA 1ENHA 4YEJA 3TEDA 3HPHA 4CGZA 4B48A 1VQ8I 3JRBA 1S9HA 4KJZA 3GW2A 4V2FA 4IHTA 3JCUC 3KP4A 1WI9A 2D5VA 5M5YJ 2HYFA 3CO6C 3ZGKA 2K86A 2XVCA 4B3AA 4RGRA 3A02A 3BQZA 3PNVA 5HOOA 5L3EA 1N78A 1N77A 2QUFA 1MBHA 1YIOA 4HV6A 2MC3A 5C4JJ 2M0MA 2VKDA 1SVOA 2O9LA 3QP5A 1IXSB 2R5ZA 2DOAA 3E3VA 4IHWA 1WJCA 4ASNA 5HVQC 1JGGA 1WH7A 5E79C 2GIZA 2JRMA 1R1UA 2RQPA 4GO1A 1QHHD 2E19A 3IUOA 5K7FA 2BE5F 3GX4X 4XLHA 4E70A 1Y8QB 1R49A 5BS6A 3WTYC 2JMWA 2M9HA 2CQNA 5EYRA 4NC6A 3MMYB 3DU5A 2V9VA 1V4RA 3HOWJ 3HB9A 4CHUA 3HHHA 1XPXA 1USSA 1VQMI 3CD6I 5KNLA 1LEAA 4UB8C 5E18F 2H1KA 2STTA 2R7SA 2D45A 1XS9A 4HDUA 1XDSA 1HCRA 3K70C 4MHGA 1ZG3A 4NQWA 3KEYA 5KK1A 1ETQA 3QU6A 3ZQFA 2NRAC 1R4MB 4BKXA 3MFKA 1U0JA 5TISC 3K4CA 2ELKA 1BI1A 1WVRA 4ZYEA 3BOQA 3DBRB 4I76A 2XPVA 3ZR8X 2GOXB 3CMMA 2RNGA 2KRHA 2VL8A 5DD4A 4EGZA 4AVZA 3ABKH 3RQIA 2OAZA 3BCAA 3PNTA 1B9MA 4ESFA 1ETKA 3LAJA 3K4NA 1KYZA 2VE9A 2EV5A 1UHSA 1DDNA 3TP0A 1P4AA 2E7XA 5J3LA 4IHVA 2XAQA 4ENJA 4PJMA 1GVJA 2XF7A 4ZYGA 2VASA 1B4AA 2P0WA 3WODF 4GDFA 1ERDA 2V1DA 3KE2A 2LKSA 4Z6YA 3LSIA 3ZN0A 3MKWB 2YX7A 1U6GA 1ZELA 3ABUA 3DWLE 3L1PA 3Q0WA 5K7ZA 3OYBA 2DA5A 3W2WA 5L3FA 2DTRA 1VQ6I 5B1AH 2L9RA 4PJJA 4A6DA 2CQ7A 2EA2A 4IO9F 1E2XA 1LDJA 4CYCA 1FIPA 1FIAA 3VYRB 1K83J 4N0BA 4OWRB 2FBKA 5GPCA 4S04A 2DU9A 4M74A 4P9FA 1MBKA 3HUGB 3ZPLA 4XBFA 3ZMTA 4EV0A 3FHZA 4G7ZF 2CO5A 4I99C 4LJZF 1D1CA 2MA3A 5LRSA 1TQMA 2DT5A 3D1NI 1IN5A 3V7SA 2UZKA 3GZNB 5J1YA 3G1OA 1BR4A 4KIGA 1VQ5I 3OYGA 1ONVA 3RI4A 1IDYA 2PX9A 5F04A 3S3OA 2X9DA 5HLHA 4DW6A 4DYCA 3GXOA 4PSWA 4BBSJ 3J81Z 2X85A 5LD2C 4KMUX 5F0CA 3C7JA 2HVQA 3ABTA 1U3EM 3I4PA 4F91B 3BP8A 3CTAA 1T56A 2PLYA 1GLNA 1T33A 5L3BA 3BPXA 3GTQJ 2KL4A 4XLAA 2DFEA 4D5CA 3M8JA 1WCMJ 3SHFA 1S3JA 1S8NA 4LB6B 3CESA 5ILUA 2QZ8A 1U2WA 5J8FA 3GTJJ 1ZG5A 4I98B 3GTKJ 3SYTA 3FXQA 4UVAA 2NAZA 2Y0SN 2O7OA 3IHUA 2X4HA 3V42A 2CG4A 3BTIA 2R5YA 3LSGA 1IF1A 3K4LA 4KIBA 2TDXA 2WY8Q 4IRIA 4C3IJ 4EM1A 1JKOC 4A93J 4A3FJ 4OIPF 4RM3A 2XC7A 5IP6A 2DYRH 2DA6A 4LFUA 2DFFA 4H0EA 4PGHA 2YUSA 2ZJPF 3M4OJ 1RETA 2YS9A 1GDTA 3FXLA 4XN0A 4AYBA 2VONA 4YFXF 4JBAA 1G3WA 3RZOJ 2K9SA 4UVCA 2A68F 3U2RA 1B8IA 2LKPA 1FOKA 4UUVA 2W25A 5H20A 4F3QA 3C3WA 4BUPA 1XSDA 1EJ9A 3CJTB 1IW7F 2GAUA 5HS7A 1X4OA 2EFPA 3EUAA 4PJLA 4I02A 1P92A 3CCSI 1REPC 1ZN2A 1K79A 3TP3A 4A3CJ 2G7HA 1GT0C 4MQVA 1B1BA 3PJRA 1WFXA 3S32A 3RIRA 4CZCA 1WQ2A 1J59A 4GYGA 1XGOA 4FE7A 2XSDC 3A01A 3E6CC 4UY8I 4N9IA 3K1PA 4ZDPA 1SFUA 4FTHA 1JJ8C 3CCMI 4GYIA 4I7HA 2EV0A 5IYCJ 5IT3A 5E3MA 1HBXG 2PJRB 2IA2A 1LE8B 2M45A 1VQ9I 3BDDA 1F36A 3KZIC 2LF8A 1S7AA 3KZYA 3OOPA 2FX0A 1W4MA 2DW4A 3W3CA 3TO7A 5BNGA 2ISZA 1ZTRA 3M07A 3M8EA 2GA1A 2VBZA 2XGDA 2QKMB 5K5QA 2Q2EB 1AA7A 3DFGA 3KETA 4YG2F 3JTHA 1HKSA 4YELA 4X0GA 3VWBA 4Y7NJ 4X6AJ 5J4YA 3CCQI 5JHFA 2FD5A 1B9NA 5TJJA 2E1CA 1MSEC 3JSOA 1BI2A 2JA2A 3BR5A 3V7RA 1MJ9A 3U1DA 1Y56A 3WG7H 2M1BA 3R61A 4FASD 5F0FA 2EILH 2R7QA 3QWLA 3WGHA 3R0AA 2H6BA 2YPRA 3QP6A 2V79A 1Z21A 2Y2ZA 2Q0OA 4W1UA 1Z7LA 1YE9A 2E5ZA 4DBQA 3IH4A 4Y33A 2LRDA 2DFIA 2GQQA 3ZQQA 5DM7F 3HIFA 3PQJA 3WGGA 1U5TB 3GZ5A 3A0HC 1FMWA 1U5TC 4RB1A 2DA7A 1STZA 1TNSA 1FNNA 1R5HA 3T5XA 5F0HA 4ESJA 1C0WA 1SFXA 3FXJA 3NWTA 2HYGD 3HOZJ 3ZRGA 1FWZA 5JLWA 2P4WA 2KISA 4LITA 2RC4A 3RPQA 3IC7A 3D0SA 2G9WA 2CUZA 3CCLI 3CUOA 4PDKA 3BZCA 3TBIA 1DU0A 2W4SA 5HLIA 2VOPA 4MGRA 1LDKB 4LG0A 1HSTA 4ENKA 1LJ9A 5FKLA 3D5LA 4ZJZA 4IPAA 2L2OA 3EDPA 4YIRX 4P55A 2CH0A 3E1SA 3F6OA 4IHYA 1U9NA 2HR3A 3FMQA 3CCUI 3I53A 3G3ZA 3F8MA 1X3UA 1I27A 2VPRA 4XONA 2HPIA 1T08B 3OYLA 4GRIA 5BPIA 3HXLA 4CCLA 3JRGA 1LFPA 4E4HA 2OQGA 4ZH4F 1IG7A 4EM0B 3PSIA 5J1RA 2UWMA 2M8GX 1U78A 3LQRA 1VI0A 5HDKA 2H94A 3KYCB 4UVBA 4DJAA 1V54H 2F5DA 2FUG2 2ELJA 1JUPA 3S2DJ 3WTVC 1EA3A 2YU3A 1ODDA 2W1OA 3MAJA 5FB2A 3SDGA 2XAHA 2M7AA 2XGCA 3EUKL 2LD5A 1K4SA 5AONA 2AQEA 4I09A 2NVTJ 1MBEA 5B66C 4EJWA 4WCGA 3CDIA 3KP7A 3T1BA 4S0HB 5LHHA 4PGGA 4IX7A 3JRDA 2CUFA 4J00A 3OL4A 2WAQA 4RLFA 2P8TA 1QGPA 4HX7A 4IXAA 3V8KA 5EJCA 3QOPA 3WTSC 2WTEA 3OV8A 2FBIA 1N25A 2F5CA 1LVAA 3GO5A 2R92J 1HA8A 2R7VA 4CA0A 1XMAA 5LHIA 2BY3A 4XOPA 2GXGA 1XB4A 2DLLA 2HDCA 1V5EA 2O61A 2DMQA 2F5FA 2IEKA 2MH2A 3CC4I 1IV8A 4XM3A 5J6XA 1S5LC 3BWGA 1XGMA 2QQAA 5J47A 4XR6A 2H27A 2EFOA 1ZGWA 2R7DA 2JSPA 4BJTA 3OYDA 3K9TA 3G4SI 4D7NA 2Z99A 3PFIA 2HKXA 3I9V2 4XLCA 1UHMA 3QODA 2WV0A 1JI8A 1O7LA 3MKLA 4BBRJ 2E1MB 2IA1A 2KHMA 2VQGA 4OAYA 3SEZA 1VQOI 2LKXA 4OIOF 3I59B 3M1EA 1D1AA 4IVNA 1BW5A 2KIQA 2KDOA 2EB7A 1W7PD 3RYRA 3RKYA 1Y0UA 4E7HA 1P2FA 3OYKA 2W84A 1E0EA 2DT6A 4QIWN 5IPAA 1TBXA 4FCYA 4HV5A 5BQTA 3FKIJ 3I58A 4CCKA 3COAC 5LBQA 1R71A 2CYYA 1LNWA 2IPQX 3HEFA 4HQMA 5HS8A 2KQRA 4EATA 1MBGA 1FYLA 1MSFC 4BL0B 4BHPA 2JN6A 1P7IA 1Z77A 1JKPC 2HTJA 1XTAA 3VSKA 4XLEA 2K85A 1FBQA 1Z05A 5J4VA 2E60A 3FBNB 4LK1F 5ILSA 5F1JA 2Q1ZB 1LEBA 1VZ0A 4XSZF 3K6GA 1H9TA 1ZRFA 4B4CA 2JA8J 1PDNC 5M5XJ 3RSNA 4Z2YA 4Y13A 2EQRA 3IKTA 3SEQA 2K7LA 5H2FC 5C3EJ 2KKOA 1Z6RA 2Y9ZA 4M71A 4HEA2 4CICA 1KU9A 3J7AO 2QENA 3DPTA 1D0YA 2VKVA 1Y0NA 5M5WJ 2E1OA 4XIDA 1T98A 3HRSA 5D4RA 3N05A 1KA8A 3SDBA 3KFWX 3RKXA 1DPUA 2ETHA 4OU0A 2ID3A 4KICA 2IA0A 3CZ6A 3SFIA 3ECHA 3CLOA 4MFEA 4N4NB 2L9NA 4W97A 1TQIA 1VFCA 1G59A 4XKWA 5DYMA 1YTYA 1J7KA 2QQBA 2XUBA 2LG4A 1T0FC 3BG3A 1RUOA 1B6AA 5FLXK 2R7UA 3FZVA 2VBWA 1TC3C 1R5GA 1NK3P 1XD7A 3AFHA 1XSVA 2KZVA 2AQFA 4R1HA 4L18B 3P5JA 1RR7A 2NS7A 4R8HA 4I2OA 2TCTA 3CMAI 3SJMA 4A3IJ 4KT6A 5C44J 2Y75A 4BHCA 3ZQHA 1LQ1A 1BJZA 4J01A 4LK0F 1WJDA 5FROA 3J7ZI 2VI6A 3OS0A 1X2NA 3ABLH 5IY5H 3MCZA 2XROA 3AAFA 3BR1A 4M72A 2DFHA 2EZLA 3S1MJ 3L09A 1LFUP 3E7LA 4BJ6C 3CP2A 1OR7C 4IOCF 1VQPI 1EH8A 2R7TA 1H89C 2V4JC 1SD6A 1QHGA 4DYRA 5GAGJ 4AIJA 5ICCA 3D5SC 2LSOA 4CZZA 1ON1A 5HNHA 1IAWA 3T0YA 3AG1H 1FP1D 3LFKA 5M3FJ 2QSGX 1LUJB 4YIIA 3HGYA 4KUMA 1YW8A 3ASNH 1ZGJA 3L7WA 1A5JA 2JZYA 4XLNF 5HNFA 5JVGF 3KP2A 3KP5A 3RQ4A 3OYHA 3IKVA 3GMEA 4C9YA 3MZ8A 2EPFA 2DODA 3WU0A 4IHSA 2Z33A 2WY7Q 1TW2A 4NB5A 1S7OA 4N9HA 5BOXA 2DBBA 5CQEA 1BN5A 3G71I 3AG2H 1V5FA 4HSRA 4XRSG 1VQ4I 2HQRA 5B3SH 2F48A 2RN7A 2XIGA 4L0YB 4XICA 3HOTA 1YHQI 2WA0A 1PP8F 2PJRA 1LE8A 4IOAF 2KIMA 2BHZA 2DOFA 3HC7A 1MKMA 4L5IA 2DA1A 5E8GA 3ZQ7A 3BTJA 3X2QH 1J09A 2Y48A 4BEHB 3HG9A 4XL9A 3MZHA 1NK2P 4TV7A 2M7BA 2GXBA 3GFIA 2ME0A 2QSFX 4RMNA 3RTRA 1P4XA 2BXZA 4ANJA 2Q2EA 4RAZA 4X1EA 2CRGA 2HOAA 3TO9A 1RUNA 2JA5J 1YS6A 4CXFA 4IHXA 3K4JA 2EV6A 3DKYA 4BE0A 4FX4A 2BY0A 2HWVA 2W57A 2HU9A 3CJQB 1D1BA 3O8GA 4MTDA 3H92A 4RM2A 2MYSA 4BS9A 5LFAA 1FTZA 3F23A 1GV2A 4F93B 1XGNA 3A03A 1T8IA 2L02A 2V6CA 4RGXA 4LG0B 2BVMA 2E35A 4M3GA 2VC1A 2L7KA 2O5RA 1F5TA 3RKWA 4EVIA 2M4KA 2FNAA 4ENNA 1S7EA 5GAHJ 5LEJA 2ZB9A 2KZGA 5JHUA 1YIJI 3GFMA 1U5TA 1MMSA 1LVKA 1OISA 3ZMVA 3TDZC 4G8XA 3SFZA 1YRNB 2PBIA 2XGXA 3H5AA 1W7PB 1JT6A 1R36A 3E6DA 2A5WA 3F22A 4FT8A 3BZKA 3IH2A 1BI3A 1NHAA 2UV1A 1A35A 2XSJC 3E5QA 3F8BA 1IO2A 1KZHA 1FYKA 4LLNA 1XGSA 3KCCA 2L4AA 5H6RA 3BR2A 5JFRA 4RAYA 1OQYA 3MWMA 4A3EJ 5KCMA 3ISPA 1X3ZB 2KLOA 1FSEA 3J80Z 1ZKGA 1MMGA 3HM5A 4CCOA 1X58A 1W1WE 2EIKH 2LLKA 2HS5A 4HAMA 2LY1A 2W82A 5ILVA 5E1XA 3GYHX 3HZJA 2HFHA 2N8GA 4L0ZB 2HVRA 2XAUA 1ORKA 3BTLA 4Q47A 3K0LA 3E0JB 2E71A 3F6VA 2E2IJ 4HG2A 3RKQA 4B8XA 2L54A 4BHBA 2A07F 2F5EA 1UMQA 2FA5A 1QBJA 2D1VA 4UNOA 2FQ4A 1TLHB 5TRDA 2IRFG 3JRHA 4B09A 2HOEA 3GFJA 1HW1A 4MTEA 2ZFUA 2LFBA 3WU2C 2HXIA 5EZHA 3TDUC 4CYDA 4DBRA 4BXUA 1IDZA 2Z3YA 4ZTJA 4XORA 1Y8RB 2AXLA 3QAHA 1E3OC 1J9IA 3QYEA 4PJNA 2OV7A 3S2WA 4U0YA 5IYDJ 2OUMA 4M9XA 5FKNA 5KHDA 1E17A 1HQCA 3AG3H 3DEWA 3O8HA 2NS8A 3BR0A 5ICEA 3HDDA 2M87A 1MGTA 2RGVA 2VIXA 4S05A 2K9MA 1FX7A 3HBLA 2OTJI 3KP6A 3A0BC 3F8CA 4IF4A 2HQAA 2M2EA 4NBQA 2KRFA 1X1PA 4M3BA 5JLXA 2E36A 5FFXA 2V1XA 1QVTA 1E3PA 2XB0X 4M3DA 4G7OF 2BY2A 1GVDA 3ABMH 3U21A 3LWFA 2DA2A 3BC8A 1EF4A 4HX4A 2KT0A 1R4NB 3I59A 5CVRA 1WKMA 3R0JA 4HF0A 3LSJA 3K4KA 1LDDA 2NOGA 3S8PA 2GBYA 2CUEA 1O4XA 1U8BA 3FISA 1U8RA 2Z1DA 1G4DA 2DYSH 2EJRA 4NNJA 4IL6C 2QYOA 2O3FA 4XK4A 5KAFC 5HDNA 3LQQA 1ACIA 1BW6A 2QEXI 3S1RJ 4Y4RA 1T39A 1KU7A 2A5YB 3HKZA 3P9IA 1MZBA 1SFEA 2JPBA 5DDGA 2L4MA 1SD7A 1VF9A 1R7JA 4FISA 4HLXA 2B63J 2DCEA 3CJRB 1DGWY 3HTUA 3CCEI 2E5NA 2VBXA 1S29A 2ZNZA 3K2AA 2WAFA 3J80K 3ZMDA 4PJ0C 3R60A 4ON0A 3BTCA 3ASOH 5BPDA 1HKTA 2ISYA 2NNYA 1XDUA 1AU7A 3F8NA 3GUDA 3MEXA 4JX5A 3WU1B 1X1AA 4AC0A 2M8EA 5DTDA 5GTHC 4IQJA 3CC2I 1ZYRF 1KGSA 4A69C 4P5OA 2B9SA 4RBOA 3FM5A 3ONQA 3W2VA 2H8RA 4BYYA 2DMTA 3VYTB 2DA3A 2OCCH 3K2ZA 1ZQ3P 5ED4A 4HNUA 2GM4A 2E2JJ 1OKRA 3PO3J 3PUFA 5F64A 4QLCU 4U0WA 4Y17A 4BAYA 2C6YA 3ESWB 3L2QA 2R7WA 3QYBA 2KJBA 1IN7A 1T0FA 1H8AC 4OIRF 1JUMA 2KDZA 3KP3A 2O8XA 1CQTA 2DDAA 4XSXF 2DO7A 4AU7A 2V26A 4FX0A 1WI3A 1P7JA 2VT3A 3PQKA 3DKXA 3NQOA 3HHGA 1FP2A 1ETWA 2PMZN 5F6FA 2CFOA 5L3GA 3QYFA 1TT0A 5JVTA 2XF6A 3MKZA 2CS3A 1ZHFA 3H3UA 2Z2SB 2XAJA 1CF7B 2MD0A 5B1BH 1QZEA 5L3DA 3OSFA 3ECOA 3VDXA 1OR7A 1R6RA 4HRIA 1X2MA 5IT9Z 2ZMEB 2VKHA 4GGGA 3O6BB 2ZMEC 5J8CA 4G94A 4Y15A 2VQHA 2ACJA 2I8DA 4OOIA 1D8JA 1IGNA 3HYIA 1M1EB 3GTGJ 3H9QA 2CV0A 4WXCA 1O3SA 1D8KA 3BQYA 1DP7P 1D5VA 1RESA 2OZUA 2K3FA 3H9GA 3S3MA 5TGTA 2WB1N 3FMSA 4YFNF 1Z7UA 4BNCA 1O3RA 3OS2A 2F2EA 3WTUC 1R23A 1ZLJA 2X1DA 3OIPA 4UXNA 5CVJA 2L3DA 4D0PA 2PEXA 1L0OC 2RKHA 2FOKA 3HPGA 5CKTA 5DD8A 1JKRC 2LVSA 3Q0UA 2OCEA 3ZN1A 1R9TJ 1OCRH 1QPIA 3H36A 1IRZA 2JPCA 1W36D 5EGOB 1FY7A 1FOWA 4RAGA 1SEUA 1UB9A 2J5PA 3R6SA 4ESBA 1YJ9I 1SFKA 5D5XB 5FD5A 2E7WA 3HL2A 3BCBA 2VLAA 1L3LA 1TTYA 3S3NA 1ZH5A 4BEHA 1QZZA 1BOAA 2EZKA 3LSKA 3QRFF 2GOMA 2AXTC 2QCOA 4BE1A 2UXXA 2NOJB 4F55A 2YU9J 2M3AA 4E7IA 4D1QA 2NVXJ 1WH5A 2GZWA 2V9KA 4G9YA 1PUEE 1R1TA 4XOTA 3ZMZA 1DP3A 5GADJ 2WWYA 3WTWC 4KISA 2LMDA 1AKHB 1HXDA 2DK5A 1T6SA 1JHHA 5FFZA 4A3KJ 3KEOA 3I0TA 2DQLA 1SANA 2DAOA 4E7ZA 4KN7X 1OJLA 1ITYA 1FYMA 1BR2A 4MEYF 3V7CA 1A6QA 2M30A 2JT1A 1F9NA 3HJEA 2L5QA 1XG1A 3QPTA 4HA8A 3G2BA 4V19K 1EH6A 1ON2A 1YRNA 1IRXA 2CQQA 3A4CA 5F08A 1QPMA 1W7PA 4A6EA 5IT9K 4FHTA 2W24A 1IN8A 3QPSA 1J5YA 2VJJA 3EUHC 3H0DA 2HDDA 3E5UA 1GHCA 1W0UA 1YQAA 3P7NA 1BBYA 2ECCA 1VNDA 4B47A 1ZRDA 2ZC2A 4EM2A 4B3XA 3OYEA 4JK1X 2YSRA 3BG5A 5E1WA 1IZ1A 3S15J 4ETSA 4PCQA 4IEJA 3LSPA 2A69F 3KX2A 4GFBA 3PM1A 2MD5A 3AG4H 3L00A 2OC6A 1SD5A 2LY2A 3CCRI 2BHYA 4D5FA 3Q3SA 4DGWB 1B72B 2NS0A 4A5MA 2O0YA 4LOCA 4DZPA 3RPUD 2EFWA 5E3NA 4U7DA 3SQNA 3FXRA 2IS6A 2DJIA 4C3JJ 5FLXZ 1AOYA 4ZDOA 3BR6A 1CGPA 3F8FA 3ELKA 2X6YA 2P5LC 3BROA 3PFYA 4U87A 4RAFA 4A3GJ 1K6YA 1MBFA 2P7VB 4ZTFA 2NVUB 2OA4A 1JTYA 4IKFA 2LYCA 1BOBA 1EH7A 1MMDA 2EK5A 3DTKA 5LLQA 2QGUA 5CLSA 6PAXA 2X6XA 2GA2A 4XLPF 5FLMJ 1MW7A 2OPTA 1AHDP 3W6KB 3QOEA 5EG0A 1ZK8A 1FOXA 3WTXC 1A36A 3HSRA 5E8IA 2MLGA 1MNMC 2KP6A 2L01A 3JRFA 2K27A 4XRFA 2FBHA 3H35A 4V2GA 1KYWA 2ZFWA 4Q48A 4ENMA 1HDDC 4HF2A 2P5KA 3PL8A 1G3TA 3BG9A 2F5VA 4QPQA 4I01A 5DS9A 4KA4A 1OCTC 1AWCA 1O3TA 1Y6IA 1I6HJ 3CLQA 4PZJA 4XLFA 5M3MJ 1I1GA 4LD5A 5ICFA 3H9JA 3FM3A 4ZYHA 4LIUA 4CO8A 4BU2A 1V5GA 3F0CA 1RKWA 4A5NA 4EJVA 1FPQA 1HF0A 3HOVJ 2L9SA 1BA5A 4OMZA 5IP7J 1UCRA 3IH3A 3G73A 1WJAA 3OYNA 3KIOA 2FMLA 1RNLA 2DN0A 3QU3A 2K3PA 5EF6A 5CQGA 4A2UA 2JA6J 1RC9A 3CQZJ 2P7CB 2BYVE 3M7GA 4EJUA 2LC2A 1EV7A 5LEKA 1UG0A 3B6CA 5E17F 3PO2J 1GUUA 3IRRA 2QBYB 4B43A 1TWGJ 5EEGA 1K61A 1RKTA 2OD5A 2K9NA 2FRHA 3GTMJ 4RDUA 1FJLA 2IAIA 4I6ZA 3ZQIA 1JHFA 2O03A 3FHNA 2X48A 2PQ8A 3QQAA 2MFZA 5IP9J 5FKKA 2HGCA 3I71A 2MW8A 4KFCA 2VQLA 3MN2A 2DT7B 2LK2A 5FKOA 3CMYA 2KRCA 5J1UA 2BY1A 5HS9A 4A3DJ 1YYVA 4CCMA 2HQNA 3GCMA 1W5TA 3TOBA 1IUFA 4G7HF 1SAXA 2V7FA 2H6CA 1VQ7I 3FBIB 5BMZA 2GXAA 1IRFA 2LR8A 1YG2A 4CDGA 2R0QC 3CUQC 2Y0SA 5HLGA 4OINF 1W36C 1YW9A 4M6VA 3PIOF 4HF1A 2R4GA 3KPHA 2Y9YA 1I3AA 2JSCA 2WV1A 3DP7A 2ME6A 4HBLA 4IRHA 2DMPA 5DM6F 2QWWA 1YOVB 1Z3YA 2RQQA 2DI3A 2IGKA 3RCOA 1BI0A 1J0RA 5LGTA 2I10A 2CFXA 2IT0A 4A12A 1XX5A 4AYBN 2VC0A 1RPWA 2I5UA 4HQEA 4KMFA 2CMPA 1IC8A 3Q9SA 2ELHA 3TW6A 3GLLA 1DUXC 3M9AA 3D5RC 5DV5A 3DKWA 3B73A 3FXOA 2L7FP 2DQRA 5K5OA 4BXXJ 1R58A 3BJAA 2R7FA 4BY7J 2FOWA 3MZYA 1WWXA 1YITI 2FQ3A 2ID6A 4KIFA 2OBPA 1IJWC 3FIWA 1H9GA 2K4JA 3DV8A 1KQ9A 2ESNA 2ZXHA 4RGUA 4KDPA 1QU3A 1Q1HA 2CSOA 4BXFA 4AIKA 2XGEA 3OYJA 1IXRC 1NG7A 3IWFA 3PUBA 3A2KA 1MNEA 2Z16A 4U0VA 1CF7A 4HYEA 4XRSA 2V9PA 2XRNA 3FMRA 3DU6A 3M1CA 2L0KA 3MKYB 2O8KA 3TO6A 2ZMEA 1OYIA 2BBYA 2KPMA 4IJAA 3JR9A 1WZ2A 3S14J 2QF7A 3TQNA 3FXUA 2ZNYA 3DLAA 1J75A 2VB6A 1BM9A 1Y39A 1Q1VA 2BXYA 1SAUA 2P81A 3LSHA 3LSRA 3GTOJ 3F9KA 3HRMA 2Z9OA 4JQFA 3NEUA 2OF7A 3PSFA 5GP9A 2BV6A 2MABA 4P9UA 3H1CA 2MH9A 3BZ6A 3S93A 4RGSA 2ZSIB 1I6XA 4UV8A 4AD9A 3H0GJ 1OCZH 5GAEJ 4M6YA 3HOXJ 2JJ7A 3GBGA 3C2HA 2HDWA 2L7MP 1F1ZA 3CDHA 4AIDA 2OZ6A 2VN2A 2G7UA 5L3CA 2XDVA 2XPUA 3H5RA 1T38A 1SMYF 1X19A 5FO5A 3CF5F 2R3SA 2ZJQF 3BR3A 3OOUA 2RAEA 1JUSA 5EGOA 1IUYA 4BDYA 2IGMA 2LNBA 3I54A 1KQ0A 5JI6A 3KEQA 3VB2A 3OYCA 2X6OA 4OIQF 3JRIA 2VXZA 3G1MA 3VPRA 3AL0C 4RB2C 3OYAA 4MEXF 3GZ6A 4XQFA 1I3QJ 3WGIA 2DJNA 1GXQA 2HPMA 1I1SA 4XKVA 2BW3A 2BZTA 1UJ8A 4HDVA 1B59A 1Z0XA 1XCBA 1Z6TA 3K4BA 3C2GA 3MVPA 2Y69H 2VPLA 4O3MA 1MIJA 5HODA 4A3JJ 3G6EI 3TL4X 3BJOA 2MSYA 1X3WB
chains in the Genus database with same CATH topology
3GVAA 3E6MA 1QO0D 5DUKA 4ZYDA 2FXAA 2A3SA 4UV9A 2QQ9A 2Z5UA 1K78A 1W5SA 3ULQB 1TW3A 1ZG1A 2JTVA 2COMA 1MD0A 3R4KA 1FZPB 2XV4S 2Q8KA 3F21A 4YFKF 1MDMA 2Y0MA 1Z9CA 3EUHA 1V3FA 5DCMB 5D5UB 1YW7A 3QPHA 3FX3A 4A0ZA 1ZRCA 3Q5FA 3B02A 5H6QA 4R79A 4WXDA 4AIHA 2PFBA 2FNPA 2A61A 2P5VA 4GCVA 4EJOA 4Q5SF 1ZAOA 3HTSB 3IWZA 2VT2A 2V1UA 4F7ZA 3N4MA 3IRQA 2BEOA 1ZGAA 2IVMA 3BPVA 4WXHA 2QLZA 5A2QZ 2KIUA 2RVCA 1H0MA 4Q4ZF 4L9VA 1BJAA 3DPLC 3HRTA 5JR3A 2O6GE 3ZP5A 1SMTA 4LMYA 3E6BA 1J2XA 1I5ZA 1RZ4A 3WG9A 3RDIA 5AIPA 5CVIA 4WK8F 3GFLA 4HW0A 3CJNA 3GF2A 1O57A 4EQQA 2NNNA 4KT5C 5FD6A 3WE3A 2LF7A 3FF5A 3SZTA 3HSEA 2M5WA 2HEOA 2ZBKA 3T8TA 1P6RA 2FMYA 1FSHA 3E97A 3LSTA 2QBYA 1BIBA 2STWA 3L9FA 2OU2A 3V8LA 1FBUA 5CVVA 4HOBA 4MQ9F 1HW2A 1GXPA 1XCVA 1USTA 4AWXB 1QQIA 5D8KB 2JRTA 1DPRA 5D5VB 1YLFA 1ZREA 2QM3A 3DEUA 1HW5A 3CUQA 1RIOH 4L9NA 1Z91A 3O2PE 1YS7A 1OYWA 3JTGA 2CW0F 2FSWA 3I64A 3P9KA 1BC8C 5FGMA 5A2QK 4NHJA 3K1NA 2ESHA 5ICGA 1XMKA 4G6DA 1K7AA 4EJTA 3KZZA 3GWZA 5LGNA 1IN4A 1IXCA 2ZXJA 1JXSA 2P6SA 1ZLKA 3V4GA 4U88A 3JW4A 2PN6A 3I5UA 3TOAA 4K2EA 4O5VA 3V8JA 1YFHA 5CYVA 3IL2A 3KLNA 2ZJ2A 4GXOA 4M6XA 4A0YA 2WC2A 3C18A 3Q9VA 1R22A 3GEZA 1OYYA 3LA2A 2XKOA 5D5WB 2D1HA 2MBFA 5F1RA 5E1ZB 1O7FA 3H3ZA 3J81K 3ERED 4A0XA 2DK8A 3RJPA 3SZPA 5HDGA 2GWRA 1XSXA 3RPUA 3T8RA 3LA7A 2IW5A 3BJ6A 1FLIA 3EYIA 1KQ8A 3P9CA 3HOSA 3JSPA 4EGYA 3HRUA 4DNCA 2UXNA 2QVOA 2VE8A 5CVUA 1K78B 5DCFA 2XKPA 1VTNC 2HTSA 3W6JB 2DPDA 2FEZA 2MLKA 4LB5A 3ML6A 1RI7A 2CQKA 1MDMB 2GIVA 2B0LA 1MJBA 5K1YA 2P6TA 2LDUA 2HZTA 2AS5F 2PMHA 2X0LA 4M9SA 1KU2A 4LLGF 2EA4A 3DXJF 2PJPA 2PMUA 1HKQA 4BQAA 1UHWA 1BC7C 3CO7C 3ZMSA 5KVRA 1ZARA 4HX8A 2YX4A 1O3QA 3REOA 1HSJA 5DCMA 5AIQA 1R1VA 4WWCA 4EMSA 1TNTA 3VOEA 2ZO4A 2CWEA 2E1NA 1XN7A 3EETA 3EYYA 1TQPA 1LB2A 3L2CA 2IJLA 4MNUA 4IRGA 2VOOA 4KN4X 2J5OA 4BH9A 3NRVA 4LLLA 3DQVC 2A6HF 3WTZA 2HKOA 1YO5C 1JE8A 1ULYA 1A04A 4AVPA 2CGPA 1OPCA 5DEQA 1KU3A 3TGNA 1QZYA 3M8FA 1K6OA 1PP7U 1G6NA 4RB0A 4U7BA 4UHTA 3JAMZ 3WTTC 1WSUA 2K02A 1WRJA 4O6JA 1T2KA 2BGCA 2YR2A 4WF2A 3KLOA 2KJCA 3HUGA 5LHGA 3E5XA 3U9GA 4DQ2A 2OQRA 3ZMUA 3F72A 1FC3A 2EWNA 3HSFA 2VBYA 2PI0A 4HZFA 3CUQB 4LGWA 2VODA 5D6FA 3VODA 3O3KA 3N97A 4M73A 1P4WA 1IN6A 5K5RA 5D4SA 3LAPA 3LA3A 2PG4A 1JGSA 2XAGA 5D8LB 4YIFA 3EQLF 3SXYA 5DUIA 2ZKZA 3K69A 1QNTA 2IP2A 3K1MA 3GLXA 4I0AA 4L9JA 4ZZDA 2A6EF 2FU4A 2XASA 5D6EA 3RYPA 5CJ9A 4I0BA 5LRRA 2RV8A 2NYXA 3DF8A 3VEPA 2FF4A 1G3YA 4L9TA 4P96A 2EFNA 3F3XA 2XAFA 2ZCWA 4WX9A 3FWEA 4KYWA 1SD4A 3C1DA 4RS8A 3JAMK 4G6QA 2ADUA 2XHKA 4HLYA 1G3SA 2KIFA 1MJAA 2H09A 4KNYA 2FE3A 5LGUA 2W85A 3BY6A 4ZZLA 1R00A 1UFMA 1FBSA 5ERIA 2RDPA 4QWQA 2D2WA 3TKYA 3VFZA 4L5JA 1D3YA 3MQ0A 3ROUA 4RB3C 5EEHA 3WE2A 2K4BA 1F4KA 1BIAA 1FT9A 1S6LA 4OMYA 2DPUA 4M9ZA 1IRGA 1OMIA 2RNJA 5E20A 2EFQA 1Z1DA 4CGZA 3GW2A 4IHTA 3KP4A 1WI9A 2HYFA 3CO6C 2K86A 2XVCA 4RGRA 5HOOA 5L3EA 2QUFA 4HV6A 1YIOA 2MC3A 3QP5A 1IXSB 3E3VA 4ASNA 5HVQC 1R1UA 2RQPA 4GO1A 2BE5F 3GX4X 4E70A 5BS6A 3WTYC 2V9VA 1V4RA 4CHUA 3HHHA 1USSA 1LEAA 5E18F 2STTA 2D45A 4HDUA 1XDSA 4MHGA 1ZG3A 4NQWA 5KK1A 3QU6A 2NRAC 3MFKA 1BI1A 4ZYEA 3BOQA 5DD4A 4EGZA 4ESFA 3LAJA 2OAZA 1B9MA 1KYZA 2VE9A 2EV5A 1DDNA 1P4AA 2E7XA 2XAQA 4ENJA 1GVJA 4ZYGA 1B4AA 3WODF 2V1DA 3KE2A 3ZN0A 2YX7A 1U6GA 3ABUA 5L3FA 2DTRA 4A6DA 2EA2A 1E2XA 1LDJA 4N0BA 2FBKA 4S04A 2DU9A 4M74A 4P9FA 3ZPLA 4XBFA 3ZMTA 4EV0A 3FHZA 4G7ZF 2CO5A 4LJZF 2MA3A 5LRSA 1TQMA 2DT5A 1IN5A 3V7SA 2UZKA 4KIGA 3RI4A 1ONVA 5HLHA 3GXOA 3J81Z 4KMUX 3C7JA 3ABTA 1U3EM 3I4PA 3BP8A 3CTAA 2PLYA 5L3BA 3BPXA 3SHFA 1S3JA 1S8NA 4LB6B 5ILUA 2QZ8A 1U2WA 5J8FA 1ZG5A 4I98B 3FXQA 4UVAA 2NAZA 3IHUA 2X4HA 2CG4A 1IF1A 4KIBA 2TDXA 4IRIA 4EM1A 4OIPF 4LFUA 4H0EA 4PGHA 2VONA 4YFXF 4JBAA 1G3WA 3U2RA 4UVCA 2A68F 2LKPA 1FOKA 4UUVA 2W25A 5H20A 3C3WA 1XSDA 1IW7F 2GAUA 5HS7A 2EFPA 4I02A 1P92A 1REPC 1ZN2A 1K79A 2G7HA 4MQVA 1B1BA 3RIRA 1WQ2A 1J59A 4GYGA 1XGOA 3E6CC 4N9IA 3K1PA 1SFUA 4GYIA 4I7HA 2EV0A 5IT3A 1HBXG 2IA2A 2M45A 3BDDA 2LF8A 1S7AA 3KZYA 3OOPA 3TO7A 1W4MA 2DW4A 2ISZA 3M8EA 2GA1A 2VBZA 5K5QA 3DFGA 3KETA 4YG2F 3JTHA 1HKSA 1B9NA 5TJJA 2E1CA 3JSOA 1BI2A 3V7RA 1MJ9A 3U1DA 2M1BA 3R61A 3WGHA 3R0AA 2H6BA 2YPRA 3QP6A 2V79A 2Q0OA 2DFIA 2GQQA 3HIFA 3PQJA 3WGGA 1U5TB 3GZ5A 1U5TC 4RB1A 1STZA 1TNSA 1FNNA 1R5HA 3T5XA 4ESJA 1C0WA 1SFXA 2HYGD 1FWZA 2P4WA 3RPQA 2RC4A 3IC7A 3D0SA 2G9WA 3CUOA 4PDKA 5HLIA 2VOPA 4MGRA 1LDKB 4LG0A 1HSTA 4ENKA 1LJ9A 3D5LA 4IPAA 3EDPA 4P55A 3F6OA 2HR3A 3FMQA 3I53A 3G3ZA 3F8MA 1X3UA 1I27A 5BPIA 2OQGA 4ZH4F 4EM0B 2UWMA 1U78A 3LQRA 5HDKA 2H94A 4UVBA 2F5DA 3WTVC 5FB2A 2YU3A 1ODDA 3MAJA 2XAHA 5AONA 4I09A 4EJWA 4WCGA 3KP7A 3T1BA 5LHHA 4PGGA 2P8TA 1QGPA 4HX7A 4IXAA 3V8KA 3QOPA 3WTSC 2WTEA 3OV8A 2FBIA 2F5CA 1LVAA 3GO5A 1XMAA 5LHIA 2GXGA 1XB4A 2DLLA 2HDCA 2O61A 2F5FA 2MH2A 5J6XA 3BWGA 1XGMA 2QQAA 2H27A 2EFOA 2R7DA 3K9TA 2Z99A 3PFIA 2HKXA 1UHMA 2WV0A 1O7LA 2IA1A 4OIOF 3I59B 3M1EA 4IVNA 2EB7A 1W7PD 3RYRA 3RKYA 1Y0UA 1P2FA 2W84A 1TBXA 4HV5A 5BQTA 3I58A 3COAC 5LBQA 2CYYA 1LNWA 2IPQX 4HQMA 5HS8A 1FYLA 4BHPA 2HTJA 1FBQA 1Z05A 4LK1F 5ILSA 1LEBA 4XSZF 1H9TA 1ZRFA 1PDNC 4Z2YA 4Y13A 3IKTA 2K7LA 2KKOA 1Z6RA 4M71A 4CICA 1KU9A 3J7AO 2QENA 3DPTA 1T98A 3HRSA 5D4RA 1KA8A 3KFWX 3RKXA 1DPUA 2ETHA 4OU0A 4KICA 2IA0A 3ECHA 3CLOA 1TQIA 5DYMA 1YTYA 1J7KA 2QQBA 2XUBA 1RUOA 5FLXK 1B6AA 3FZVA 2VBWA 1R5GA 1XD7A 1XSVA 4R1HA 4L18B 4R8HA 4I2OA 2Y75A 4BHCA 1LQ1A 4LK0F 3MCZA 2XROA 3AAFA 4M72A 3L09A 1EH8A 1SD6A 4AIJA 5ICCA 2LSOA 4CZZA 1ON1A 1IAWA 3T0YA 1FP1D 3LFKA 4YIIA 4KUMA 1YW8A 1ZGJA 3L7WA 2JZYA 4XLNF 3KP2A 3KP5A 3IKVA 3WU0A 4IHSA 2Z33A 1TW2A 4NB5A 1S7OA 4N9HA 5BOXA 2DBBA 1BN5A 2HQRA 2RN7A 2XIGA 4L0YB 3HOTA 1PP8F 2KIMA 1MKMA 4L5IA 5E8GA 3ZQ7A 2Y48A 3MZHA 4TV7A 2GXBA 3GFIA 3RTRA 1P4XA 2Q2EA 4RAZA 3TO9A 1RUNA 1YS6A 4CXFA 2EV6A 4FX4A 2HWVA 2W57A 4MTDA 3H92A 3F23A 1XGNA 2L02A 2V6CA 4RGXA 4LG0B 2VC1A 1F5TA 3RKWA 4EVIA 2FNAA 4ENNA 5LEJA 5JHUA 3GFMA 1U5TA 3ZMVA 3TDZC 4G8XA 3SFZA 2PBIA 2XGXA 1W7PB 3E6DA 1R36A 3F22A 4FT8A 1BI3A 1NHAA 3E5QA 3F8BA 1FYKA 4LLNA 1XGSA 3KCCA 2L4AA 5H6RA 5JFRA 4RAYA 3MWMA 3ISPA 1FSEA 3J80Z 2HS5A 4HAMA 5ILVA 5E1XA 3GYHX 2HFHA 4L0ZB 4Q47A 3K0LA 3F6VA 4B8XA 2L54A 4BHBA 2A07F 2F5EA 2FA5A 1QBJA 2D1VA 4UNOA 1TLHB 5TRDA 2IRFG 4B09A 2HOEA 3GFJA 1HW1A 4MTEA 3TDUC 4CYDA 4BXUA 2Z3YA 2AXLA 3QAHA 1J9IA 4U0YA 3S2WA 4M9XA 1E17A 1HQCA 5ICEA 2M87A 1MGTA 2RGVA 4S05A 1FX7A 3KP6A 3F8CA 4IF4A 2KRFA 5FFXA 2V1XA 4G7OF 3LWFA 4HX4A 3I59A 5CVRA 1WKMA 3R0JA 4HF0A 1LDDA 1U8RA 1G4DA 2EJRA 2QYOA 2O3FA 5HDNA 3LQQA 1T39A 1KU7A 2A5YB 3P9IA 1MZBA 1SFEA 2JPBA 5DDGA 2L4MA 1SD7A 4HLXA 1R7JA 3HTUA 2VBXA 1S29A 2ZNZA 3J80K 3ZMDA 3R60A 4ON0A 5BPDA 1HKTA 2ISYA 2NNYA 1XDUA 3F8NA 3GUDA 3MEXA 3WU1B 2M8EA 1ZYRF 1KGSA 4P5OA 3FM5A 4BYYA 3K2ZA 5ED4A 1OKRA 5F64A 4QLCU 4U0WA 4Y17A 4BAYA 2C6YA 2KJBA 1IN7A 1T0FA 4OIRF 3KP3A 2O8XA 4XSXF 2DO7A 4FX0A 2VT3A 3PQKA 3NQOA 3HHGA 1FP2A 5F6FA 5L3GA 5JVTA 1ZHFA 3H3UA 2XAJA 1CF7B 5L3DA 3ECOA 1OR7A 5IT9Z 2ZMEB 4GGGA 3O6BB 5J8CA 4G94A 4Y15A 1D8JA 2ACJA 4OOIA 3HYIA 4WXCA 1O3SA 1D8KA 1DP7P 1D5VA 2OZUA 3FMSA 4YFNF 1Z7UA 4BNCA 1O3RA 2F2EA 3WTUC 1R23A 1ZLJA 4UXNA 5CVJA 2L3DA 4D0PA 2PEXA 1L0OC 2RKHA 2FOKA 5DD8A 3ZN1A 2JPCA 1FY7A 4ESBA 1UB9A 2J5PA 3R6SA 5D5XB 5FD5A 2E7WA 1L3LA 1TTYA 1ZH5A 1QZZA 1BOAA 3QRFF 2UXXA 4G9YA 2GZWA 1PUEE 1R1TA 3ZMZA 2WWYA 3WTWC 1HXDA 2DK5A 1T6SA 1JHHA 5FFZA 3KEOA 3I0TA 2DQLA 2DAOA 4KN7X 1FYMA 4MEYF 3V7CA 2M30A 2JT1A 1F9NA 3QPTA 4HA8A 1EH6A 1ON2A 1QPMA 1W7PA 4A6EA 5IT9K 4FHTA 2W24A 1IN8A 1J5YA 1GHCA 3E5UA 1YQAA 3P7NA 1BBYA 1ZRDA 4EM2A 4JK1X 2YSRA 5E1WA 1IZ1A 4ETSA 4PCQA 2A69F 2MD5A 3L00A 1SD5A 2NS0A 4A5MA 2O0YA 2EFWA 4U7DA 3SQNA 3FXRA 1AOYA 5FLXZ 1CGPA 3F8FA 3ELKA 2P5LC 3BROA 2P7VB 2OA4A 1EH7A 5LLQA 2EK5A 5CLSA 6PAXA 4XLPF 2GA2A 3W6KB 3WTXC 3HSRA 5E8IA 2MLGA 2L01A 2K27A 4XRFA 2FBHA 1KYWA 2ZFWA 4Q48A 4ENMA 4HF2A 2P5KA 1G3TA 4I01A 4KA4A 1AWCA 1O3TA 4PZJA 1I1GA 4LD5A 5ICFA 3FM3A 4ZYHA 4CO8A 4A5NA 4EJVA 1FPQA 4OMZA 1UCRA 3G73A 2FMLA 1RNLA 3QU3A 4A2UA 2P7CB 2BYVE 3M7GA 4EJUA 1EV7A 5LEKA 5E17F 3IRRA 2QBYB 5EEGA 2OD5A 2FRHA 1JHFA 2O03A 2PQ8A 2HGCA 3I71A 4KFCA 5HS9A 1YYVA 2HQNA 1W5TA 3TOBA 4G7HF 1SAXA 2H6CA 5BMZA 1IRFA 1YG2A 4CDGA 3CUQC 5HLGA 4OINF 1YW9A 4HF1A 3DP7A 2JSCA 4HBLA 4IRHA 2QWWA 2DI3A 1BI0A 1J0RA 5LGTA 2CFXA 2IT0A 4A12A 2VC0A 4HQEA 4KMFA 3Q9SA 2ELHA 1DUXC 3M9AA 5DV5A 3DKWA 3B73A 2DQRA 5K5OA 1R58A 3BJAA 2R7FA 3MZYA 1WWXA 2FQ3A 4KIFA 2OBPA 1H9GA 2K4JA 3DV8A 1KQ9A 2ESNA 4RGUA 4KDPA 1Q1HA 2CSOA 4AIKA 1IXRC 3IWFA 4U0VA 1CF7A 4HYEA 2XRNA 3FMRA 3TO6A 2ZMEA 1OYIA 2BBYA 4IJAA 3TQNA 3FXUA 2ZNYA 1J75A 1BM9A 3HRMA 2Z9OA 4JQFA 3NEUA 2BV6A 4P9UA 2MH9A 3BZ6A 4RGSA 4UV8A 1I6XA 4AD9A 4M6YA 1F1ZA 3CDHA 2OZ6A 2VN2A 2G7UA 5L3CA 1T38A 1SMYF 5FO5A 2R3SA 1IUYA 2LNBA 3I54A 1KQ0A 5JI6A 3KEQA 3VB2A 4OIQF 2VXZA 4RB2C 4MEXF 3GZ6A 3WGIA 1GXQA 1I1SA 4HDVA 1B59A 1XCBA 1Z6TA 4O3MA 3BJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GVA A;  3E6M A;  1QO0 D;  5DUK A;  4ZYD A;  2FXA A;  2A3S A;  4UV9 A;  2QQ9 A;  2Z5U A;  1K78 A;  1W5S A;  3ULQ B;  1TW3 A;  1ZG1 A;  2JTV A;  2COM A;  1MD0 A;  3R4K A;  1FZP B;  2XV4 S;  2Q8K A;  3F21 A;  4YFK F;  1MDM A;  2Y0M A;  1Z9C A;  3EUH A;  1V3F A;  5DCM B;  5D5U B;  1YW7 A;  3QPH A;  3FX3 A;  4A0Z A;  1ZRC A;  3Q5F A;  3B02 A;  5H6Q A;  4R79 A;  4WXD A;  4AIH A;  2PFB A;  2FNP A;  2A61 A;  2P5V A;  4GCV A;  4EJO A;  4Q5S F;  1ZAO A;  3HTS B;  3IWZ A;  2VT2 A;  2V1U A;  4F7Z A;  3N4M A;  3IRQ A;  2BEO A;  1ZGA A;  2IVM A;  3BPV A;  4WXH A;  2QLZ A;  5A2Q Z;  2KIU A;  2RVC A;  1H0M A;  4Q4Z F;  4L9V A;  1BJA A;  3DPL C;  3HRT A;  5JR3 A;  2O6G E;  3ZP5 A;  1SMT A;  4LMY A;  3E6B A;  1J2X A;  1I5Z A;  1RZ4 A;  3WG9 A;  3RDI A;  5AIP A;  5CVI A;  4WK8 F;  3GFL A;  4HW0 A;  3CJN A;  3GF2 A;  1O57 A;  4EQQ A;  2NNN A;  4KT5 C;  5FD6 A;  3WE3 A;  2LF7 A;  3FF5 A;  3SZT A;  3HSE A;  2M5W A;  2HEO A;  2ZBK A;  3T8T A;  1P6R A;  2FMY A;  1FSH A;  3E97 A;  3LST A;  2QBY A;  1BIB A;  2STW A;  3L9F A;  2OU2 A;  3V8L A;  1FBU A;  5CVV A;  4HOB A;  4MQ9 F;  1HW2 A;  1GXP A;  1XCV A;  1UST A;  4AWX B;  1QQI A;  5D8K B;  2JRT A;  1DPR A;  5D5V B;  1YLF A;  1ZRE A;  2QM3 A;  3DEU A;  1HW5 A;  3CUQ A;  1RIO H;  4L9N A;  1Z91 A;  3O2P E;  1YS7 A;  1OYW A;  3JTG A;  2CW0 F;  2FSW A;  3I64 A;  3P9K A;  1BC8 C;  5FGM A;  5A2Q K;  4NHJ A;  3K1N A;  2ESH A;  5ICG A;  1XMK A;  4G6D A;  1K7A A;  4EJT A;  3KZZ A;  3GWZ A;  5LGN A;  1IN4 A;  1IXC A;  2ZXJ A;  1JXS A;  2P6S A;  1ZLK A;  3V4G A;  4U88 A;  3JW4 A;  2PN6 A;  3I5U A;  3TOA A;  4K2E A;  4O5V A;  3V8J A;  1YFH A;  5CYV A;  3IL2 A;  3KLN A;  2ZJ2 A;  4GXO A;  4M6X A;  4A0Y A;  2WC2 A;  3C18 A;  3Q9V A;  1R22 A;  3GEZ A;  1OYY A;  3LA2 A;  2XKO A;  5D5W B;  2D1H A;  2MBF A;  5F1R A;  5E1Z B;  1O7F A;  3H3Z A;  3J81 K;  3ERE D;  4A0X A;  2DK8 A;  3RJP A;  3SZP A;  5HDG A;  2GWR A;  1XSX A;  3RPU A;  3T8R A;  3LA7 A;  2IW5 A;  3BJ6 A;  1FLI A;  3EYI A;  1KQ8 A;  3P9C A;  3HOS A;  3JSP A;  4EGY A;  3HRU A;  4DNC A;  2UXN A;  2QVO A;  2VE8 A;  5CVU A;  1K78 B;  5DCF A;  2XKP A;  1VTN C;  2HTS A;  3W6J B;  2DPD A;  2FEZ A;  2MLK A;  4LB5 A;  3ML6 A;  1RI7 A;  2CQK A;  1MDM B;  2GIV A;  2B0L A;  1MJB A;  5K1Y A;  2P6T A;  2LDU A;  2HZT A;  2AS5 F;  2PMH A;  2X0L A;  4M9S A;  1KU2 A;  4LLG F;  2EA4 A;  3DXJ F;  2PJP A;  2PMU A;  1HKQ A;  4BQA A;  1UHW A;  1BC7 C;  3CO7 C;  3ZMS A;  5KVR A;  1ZAR A;  4HX8 A;  2YX4 A;  1O3Q A;  3REO A;  1HSJ A;  5DCM A;  5AIQ A;  1R1V A;  4WWC A;  4EMS A;  1TNT A;  3VOE A;  2ZO4 A;  2CWE A;  2E1N A;  1XN7 A;  3EET A;  3EYY A;  1TQP A;  1LB2 A;  3L2C A;  2IJL A;  4MNU A;  4IRG A;  2VOO A;  4KN4 X;  2J5O A;  4BH9 A;  3NRV A;  4LLL A;  3DQV C;  2A6H F;  3WTZ A;  2HKO A;  1YO5 C;  1JE8 A;  1ULY A;  1A04 A;  4AVP A;  2CGP A;  1OPC A;  5DEQ A;  1KU3 A;  3TGN A;  1QZY A;  3M8F A;  1K6O A;  1PP7 U;  1G6N A;  4RB0 A;  4U7B A;  4UHT A;  3JAM Z;  3WTT C;  1WSU A;  2K02 A;  1WRJ A;  4O6J A;  1T2K A;  2BGC A;  2YR2 A;  4WF2 A;  3KLO A;  2KJC A;  3HUG A;  5LHG A;  3E5X A;  3U9G A;  4DQ2 A;  2OQR A;  3ZMU A;  3F72 A;  1FC3 A;  2EWN A;  3HSF A;  2VBY A;  2PI0 A;  4HZF A;  3CUQ B;  4LGW A;  2VOD A;  5D6F A;  3VOD A;  3O3K A;  3N97 A;  4M73 A;  1P4W A;  1IN6 A;  5K5R A;  5D4S A;  3LAP A;  3LA3 A;  2PG4 A;  1JGS A;  2XAG A;  5D8L B;  4YIF A;  3EQL F;  3SXY A;  5DUI A;  2ZKZ A;  3K69 A;  1QNT A;  2IP2 A;  3K1M A;  3GLX A;  4I0A A;  4L9J A;  4ZZD A;  2A6E F;  2FU4 A;  2XAS A;  5D6E A;  3RYP A;  5CJ9 A;  4I0B A;  5LRR A;  2RV8 A;  2NYX A;  3DF8 A;  3VEP A;  2FF4 A;  1G3Y A;  4L9T A;  4P96 A;  2EFN A;  3F3X A;  2XAF A;  2ZCW A;  4WX9 A;  3FWE A;  4KYW A;  1SD4 A;  3C1D A;  4RS8 A;  3JAM K;  4G6Q A;  2ADU A;  2XHK A;  4HLY A;  1G3S A;  2KIF A;  1MJA A;  2H09 A;  4KNY A;  2FE3 A;  5LGU A;  2W85 A;  3BY6 A;  4ZZL A;  1R00 A;  1UFM A;  1FBS A;  5ERI A;  2RDP A;  4QWQ A;  2D2W A;  3TKY A;  3VFZ A;  4L5J A;  1D3Y A;  3MQ0 A;  3ROU A;  4RB3 C;  5EEH A;  3WE2 A;  2K4B A;  1F4K A;  1BIA A;  1FT9 A;  1S6L A;  4OMY A;  2DPU A;  4M9Z A;  1IRG A;  1OMI A;  2RNJ A;  5E20 A;  2EFQ A;  1Z1D A;  4CGZ A;  3GW2 A;  4IHT A;  3KP4 A;  1WI9 A;  2HYF A;  3CO6 C;  2K86 A;  2XVC A;  4RGR A;  5HOO A;  5L3E A;  2QUF A;  4HV6 A;  1YIO A;  2MC3 A;  3QP5 A;  1IXS B;  3E3V A;  4ASN A;  5HVQ C;  1R1U A;  2RQP A;  4GO1 A;  2BE5 F;  3GX4 X;  4E70 A;  5BS6 A;  3WTY C;  2V9V A;  1V4R A;  4CHU A;  3HHH A;  1USS A;  1LEA A;  5E18 F;  2STT A;  2D45 A;  4HDU A;  1XDS A;  4MHG A;  1ZG3 A;  4NQW A;  5KK1 A;  3QU6 A;  2NRA C;  3MFK A;  1BI1 A;  4ZYE A;  3BOQ A;  5DD4 A;  4EGZ A;  4ESF A;  3LAJ A;  2OAZ A;  1B9M A;  1KYZ A;  2VE9 A;  2EV5 A;  1DDN A;  1P4A A;  2E7X A;  2XAQ A;  4ENJ A;  1GVJ A;  4ZYG A;  1B4A A;  3WOD F;  2V1D A;  3KE2 A;  3ZN0 A;  2YX7 A;  1U6G A;  3ABU A;  5L3F A;  2DTR A;  4A6D A;  2EA2 A;  1E2X A;  1LDJ A;  4N0B A;  2FBK A;  4S04 A;  2DU9 A;  4M74 A;  4P9F A;  3ZPL A;  4XBF A;  3ZMT A;  4EV0 A;  3FHZ A;  4G7Z F;  2CO5 A;  4LJZ F;  2MA3 A;  5LRS A;  1TQM A;  2DT5 A;  1IN5 A;  3V7S A;  2UZK A;  4KIG A;  3RI4 A;  1ONV A;  5HLH A;  3GXO A;  3J81 Z;  4KMU X;  3C7J A;  3ABT A;  1U3E M;  3I4P A;  3BP8 A;  3CTA A;  2PLY A;  5L3B A;  3BPX A;  3SHF A;  1S3J A;  1S8N A;  4LB6 B;  5ILU A;  2QZ8 A;  1U2W A;  5J8F A;  1ZG5 A;  4I98 B;  3FXQ A;  4UVA A;  2NAZ A;  3IHU A;  2X4H A;  2CG4 A;  1IF1 A;  4KIB A;  2TDX A;  4IRI A;  4EM1 A;  4OIP F;  4LFU A;  4H0E A;  4PGH A;  2VON A;  4YFX F;  4JBA A;  1G3W A;  3U2R A;  4UVC A;  2A68 F;  2LKP A;  1FOK A;  4UUV A;  2W25 A;  5H20 A;  3C3W A;  1XSD A;  1IW7 F;  2GAU A;  5HS7 A;  2EFP A;  4I02 A;  1P92 A;  1REP C;  1ZN2 A;  1K79 A;  2G7H A;  4MQV A;  1B1B A;  3RIR A;  1WQ2 A;  1J59 A;  4GYG A;  1XGO A;  3E6C C;  4N9I A;  3K1P A;  1SFU A;  4GYI A;  4I7H A;  2EV0 A;  5IT3 A;  1HBX G;  2IA2 A;  2M45 A;  3BDD A;  2LF8 A;  1S7A A;  3KZY A;  3OOP A;  3TO7 A;  1W4M A;  2DW4 A;  2ISZ A;  3M8E A;  2GA1 A;  2VBZ A;  5K5Q A;  3DFG A;  3KET A;  4YG2 F;  3JTH A;  1HKS A;  1B9N A;  5TJJ A;  2E1C A;  3JSO A;  1BI2 A;  3V7R A;  1MJ9 A;  3U1D A;  2M1B A;  3R61 A;  3WGH A;  3R0A A;  2H6B A;  2YPR A;  3QP6 A;  2V79 A;  2Q0O A;  2DFI A;  2GQQ A;  3HIF A;  3PQJ A;  3WGG A;  1U5T B;  3GZ5 A;  1U5T C;  4RB1 A;  1STZ A;  1TNS A;  1FNN A;  1R5H A;  3T5X A;  4ESJ A;  1C0W A;  1SFX A;  2HYG D;  1FWZ A;  2P4W A;  3RPQ A;  2RC4 A;  3IC7 A;  3D0S A;  2G9W A;  3CUO A;  4PDK A;  5HLI A;  2VOP A;  4MGR A;  1LDK B;  4LG0 A;  1HST A;  4ENK A;  1LJ9 A;  3D5L A;  4IPA A;  3EDP A;  4P55 A;  3F6O A;  2HR3 A;  3FMQ A;  3I53 A;  3G3Z A;  3F8M A;  1X3U A;  1I27 A;  5BPI A;  2OQG A;  4ZH4 F;  4EM0 B;  2UWM A;  1U78 A;  3LQR A;  5HDK A;  2H94 A;  4UVB A;  2F5D A;  3WTV C;  5FB2 A;  2YU3 A;  1ODD A;  3MAJ A;  2XAH A;  5AON A;  4I09 A;  4EJW A;  4WCG A;  3KP7 A;  3T1B A;  5LHH A;  4PGG A;  2P8T A;  1QGP A;  4HX7 A;  4IXA A;  3V8K A;  3QOP A;  3WTS C;  2WTE A;  3OV8 A;  2FBI A;  2F5C A;  1LVA A;  3GO5 A;  1XMA A;  5LHI A;  2GXG A;  1XB4 A;  2DLL A;  2HDC A;  2O61 A;  2F5F A;  2MH2 A;  5J6X A;  3BWG A;  1XGM A;  2QQA A;  2H27 A;  2EFO A;  2R7D A;  3K9T A;  2Z99 A;  3PFI A;  2HKX A;  1UHM A;  2WV0 A;  1O7L A;  2IA1 A;  4OIO F;  3I59 B;  3M1E A;  4IVN A;  2EB7 A;  1W7P D;  3RYR A;  3RKY A;  1Y0U A;  1P2F A;  2W84 A;  1TBX A;  4HV5 A;  5BQT A;  3I58 A;  3COA C;  5LBQ A;  2CYY A;  1LNW A;  2IPQ X;  4HQM A;  5HS8 A;  1FYL A;  4BHP A;  2HTJ A;  1FBQ A;  1Z05 A;  4LK1 F;  5ILS A;  1LEB A;  4XSZ F;  1H9T A;  1ZRF A;  1PDN C;  4Z2Y A;  4Y13 A;  3IKT A;  2K7L A;  2KKO A;  1Z6R A;  4M71 A;  4CIC A;  1KU9 A;  3J7A O;  2QEN A;  3DPT A;  1T98 A;  3HRS A;  5D4R A;  1KA8 A;  3KFW X;  3RKX A;  1DPU A;  2ETH A;  4OU0 A;  4KIC A;  2IA0 A;  3ECH A;  3CLO A;  1TQI A;  5DYM A;  1YTY A;  1J7K A;  2QQB A;  2XUB A;  1RUO A;  5FLX K;  1B6A A;  3FZV A;  2VBW A;  1R5G A;  1XD7 A;  1XSV A;  4R1H A;  4L18 B;  4R8H A;  4I2O A;  2Y75 A;  4BHC A;  1LQ1 A;  4LK0 F;  3MCZ A;  2XRO A;  3AAF A;  4M72 A;  3L09 A;  1EH8 A;  1SD6 A;  4AIJ A;  5ICC A;  2LSO A;  4CZZ A;  1ON1 A;  1IAW A;  3T0Y A;  1FP1 D;  3LFK A;  4YII A;  4KUM A;  1YW8 A;  1ZGJ A;  3L7W A;  2JZY A;  4XLN F;  3KP2 A;  3KP5 A;  3IKV A;  3WU0 A;  4IHS A;  2Z33 A;  1TW2 A;  4NB5 A;  1S7O A;  4N9H A;  5BOX A;  2DBB A;  1BN5 A;  2HQR A;  2RN7 A;  2XIG A;  4L0Y B;  3HOT A;  1PP8 F;  2KIM A;  1MKM A;  4L5I A;  5E8G A;  3ZQ7 A;  2Y48 A;  3MZH A;  4TV7 A;  2GXB A;  3GFI A;  3RTR A;  1P4X A;  2Q2E A;  4RAZ A;  3TO9 A;  1RUN A;  1YS6 A;  4CXF A;  2EV6 A;  4FX4 A;  2HWV A;  2W57 A;  4MTD A;  3H92 A;  3F23 A;  1XGN A;  2L02 A;  2V6C A;  4RGX A;  4LG0 B;  2VC1 A;  1F5T A;  3RKW A;  4EVI A;  2FNA A;  4ENN A;  5LEJ A;  5JHU A;  3GFM A;  1U5T A;  3ZMV A;  3TDZ C;  4G8X A;  3SFZ A;  2PBI A;  2XGX A;  1W7P B;  3E6D A;  1R36 A;  3F22 A;  4FT8 A;  1BI3 A;  1NHA A;  3E5Q A;  3F8B A;  1FYK A;  4LLN A;  1XGS A;  3KCC A;  2L4A A;  5H6R A;  5JFR A;  4RAY A;  3MWM A;  3ISP A;  1FSE A;  3J80 Z;  2HS5 A;  4HAM A;  5ILV A;  5E1X A;  3GYH X;  2HFH A;  4L0Z B;  4Q47 A;  3K0L A;  3F6V A;  4B8X A;  2L54 A;  4BHB A;  2A07 F;  2F5E A;  2FA5 A;  1QBJ A;  2D1V A;  4UNO A;  1TLH B;  5TRD A;  2IRF G;  4B09 A;  2HOE A;  3GFJ A;  1HW1 A;  4MTE A;  3TDU C;  4CYD A;  4BXU A;  2Z3Y A;  2AXL A;  3QAH A;  1J9I A;  4U0Y A;  3S2W A;  4M9X A;  1E17 A;  1HQC A;  5ICE A;  2M87 A;  1MGT A;  2RGV A;  4S05 A;  1FX7 A;  3KP6 A;  3F8C A;  4IF4 A;  2KRF A;  5FFX A;  2V1X A;  4G7O F;  3LWF A;  4HX4 A;  3I59 A;  5CVR A;  1WKM A;  3R0J A;  4HF0 A;  1LDD A;  1U8R A;  1G4D A;  2EJR A;  2QYO A;  2O3F A;  5HDN A;  3LQQ A;  1T39 A;  1KU7 A;  2A5Y B;  3P9I A;  1MZB A;  1SFE A;  2JPB A;  5DDG A;  2L4M A;  1SD7 A;  4HLX A;  1R7J A;  3HTU A;  2VBX A;  1S29 A;  2ZNZ A;  3J80 K;  3ZMD A;  3R60 A;  4ON0 A;  5BPD A;  1HKT A;  2ISY A;  2NNY A;  1XDU A;  3F8N A;  3GUD A;  3MEX A;  3WU1 B;  2M8E A;  1ZYR F;  1KGS A;  4P5O A;  3FM5 A;  4BYY A;  3K2Z A;  5ED4 A;  1OKR A;  5F64 A;  4QLC U;  4U0W A;  4Y17 A;  4BAY A;  2C6Y A;  2KJB A;  1IN7 A;  1T0F A;  4OIR F;  3KP3 A;  2O8X A;  4XSX F;  2DO7 A;  4FX0 A;  2VT3 A;  3PQK A;  3NQO A;  3HHG A;  1FP2 A;  5F6F A;  5L3G A;  5JVT A;  1ZHF A;  3H3U A;  2XAJ A;  1CF7 B;  5L3D A;  3ECO A;  1OR7 A;  5IT9 Z;  2ZME B;  4GGG A;  3O6B B;  5J8C A;  4G94 A;  4Y15 A;  1D8J A;  2ACJ A;  4OOI A;  3HYI A;  4WXC A;  1O3S A;  1D8K A;  1DP7 P;  1D5V A;  2OZU A;  3FMS A;  4YFN F;  1Z7U A;  4BNC A;  1O3R A;  2F2E A;  3WTU C;  1R23 A;  1ZLJ A;  4UXN A;  5CVJ A;  2L3D A;  4D0P A;  2PEX A;  1L0O C;  2RKH A;  2FOK A;  5DD8 A;  3ZN1 A;  2JPC A;  1FY7 A;  4ESB A;  1UB9 A;  2J5P A;  3R6S A;  5D5X B;  5FD5 A;  2E7W A;  1L3L A;  1TTY A;  1ZH5 A;  1QZZ A;  1BOA A;  3QRF F;  2UXX A;  4G9Y A;  2GZW A;  1PUE E;  1R1T A;  3ZMZ A;  2WWY A;  3WTW C;  1HXD A;  2DK5 A;  1T6S A;  1JHH A;  5FFZ A;  3KEO A;  3I0T A;  2DQL A;  2DAO A;  4KN7 X;  1FYM A;  4MEY F;  3V7C A;  2M30 A;  2JT1 A;  1F9N A;  3QPT A;  4HA8 A;  1EH6 A;  1ON2 A;  1QPM A;  1W7P A;  4A6E A;  5IT9 K;  4FHT A;  2W24 A;  1IN8 A;  1J5Y A;  1GHC A;  3E5U A;  1YQA A;  3P7N A;  1BBY A;  1ZRD A;  4EM2 A;  4JK1 X;  2YSR A;  5E1W A;  1IZ1 A;  4ETS A;  4PCQ A;  2A69 F;  2MD5 A;  3L00 A;  1SD5 A;  2NS0 A;  4A5M A;  2O0Y A;  2EFW A;  4U7D A;  3SQN A;  3FXR A;  1AOY A;  5FLX Z;  1CGP A;  3F8F A;  3ELK A;  2P5L C;  3BRO A;  2P7V B;  2OA4 A;  1EH7 A;  5LLQ A;  2EK5 A;  5CLS A;  6PAX A;  4XLP F;  2GA2 A;  3W6K B;  3WTX C;  3HSR A;  5E8I A;  2MLG A;  2L01 A;  2K27 A;  4XRF A;  2FBH A;  1KYW A;  2ZFW A;  4Q48 A;  4ENM A;  4HF2 A;  2P5K A;  1G3T A;  4I01 A;  4KA4 A;  1AWC A;  1O3T A;  4PZJ A;  1I1G A;  4LD5 A;  5ICF A;  3FM3 A;  4ZYH A;  4CO8 A;  4A5N A;  4EJV A;  1FPQ A;  4OMZ A;  1UCR A;  3G73 A;  2FML A;  1RNL A;  3QU3 A;  4A2U A;  2P7C B;  2BYV E;  3M7G A;  4EJU A;  1EV7 A;  5LEK A;  5E17 F;  3IRR A;  2QBY B;  5EEG A;  2OD5 A;  2FRH A;  1JHF A;  2O03 A;  2PQ8 A;  2HGC A;  3I71 A;  4KFC A;  5HS9 A;  1YYV A;  2HQN A;  1W5T A;  3TOB A;  4G7H F;  1SAX A;  2H6C A;  5BMZ A;  1IRF A;  1YG2 A;  4CDG A;  3CUQ C;  5HLG A;  4OIN F;  1YW9 A;  4HF1 A;  3DP7 A;  2JSC A;  4HBL A;  4IRH A;  2QWW A;  2DI3 A;  1BI0 A;  1J0R A;  5LGT A;  2CFX A;  2IT0 A;  4A12 A;  2VC0 A;  4HQE A;  4KMF A;  3Q9S A;  2ELH A;  1DUX C;  3M9A A;  5DV5 A;  3DKW A;  3B73 A;  2DQR A;  5K5O A;  1R58 A;  3BJA A;  2R7F A;  3MZY A;  1WWX A;  2FQ3 A;  4KIF A;  2OBP A;  1H9G A;  2K4J A;  3DV8 A;  1KQ9 A;  2ESN A;  4RGU A;  4KDP A;  1Q1H A;  2CSO A;  4AIK A;  1IXR C;  3IWF A;  4U0V A;  1CF7 A;  4HYE A;  2XRN A;  3FMR A;  3TO6 A;  2ZME A;  1OYI A;  2BBY A;  4IJA A;  3TQN A;  3FXU A;  2ZNY A;  1J75 A;  1BM9 A;  3HRM A;  2Z9O A;  4JQF A;  3NEU A;  2BV6 A;  4P9U A;  2MH9 A;  3BZ6 A;  4RGS A;  4UV8 A;  1I6X A;  4AD9 A;  4M6Y A;  1F1Z A;  3CDH A;  2OZ6 A;  2VN2 A;  2G7U A;  5L3C A;  1T38 A;  1SMY F;  5FO5 A;  2R3S A;  1IUY A;  2LNB A;  3I54 A;  1KQ0 A;  5JI6 A;  3KEQ A;  3VB2 A;  4OIQ F;  2VXZ A;  4RB2 C;  4MEX F;  3GZ6 A;  3WGI A;  1GXQ A;  1I1S A;  4HDV A;  1B59 A;  1XCB A;  1Z6T A;  4O3M A;  3BJO A; 
#chains in the Genus database with same CATH topology
 3GTL J;  1D5Y A;  3OR2 C;  3VYU B;  3GVA A;  1UAA A;  3E6M A;  1QO0 D;  5DUK A;  4ZYD A;  2FXA A;  5F27 A;  4MO7 A;  1OFC X;  3TW7 A;  1XMX A;  1NTC A;  1AKH A;  2A3S A;  4A3L J;  4UV9 A;  1PVE A;  2QQ9 A;  2Z5U A;  1APL C;  1K78 A;  1W5S A;  3ULQ B;  3DCF A;  1TW3 A;  1ZG1 A;  2JTV A;  2COM A;  1MD0 A;  1TP4 A;  4JOM A;  2HZD A;  4E7L A;  3R4K A;  4CCJ A;  1BL0 A;  3BT9 A;  1FZP B;  2XV4 S;  5IOZ A;  3OSG A;  2HVS A;  2Q8K A;  3F21 A;  4YFK F;  4QSH A;  2Y0M A;  1MDM A;  1Z9C A;  3GTP J;  2R7R A;  3EUH A;  1T95 A;  1V3F A;  3RZD J;  5DCM B;  5D5U B;  4PFP A;  2KFD A;  1YW7 A;  2XB5 A;  3JRA A;  2HNH A;  4P1W A;  2OJE D;  4XNF A;  5FJ8 J;  2V1N A;  1SFO J;  3QPH A;  3FX3 A;  2JWT A;  4A0Z A;  4CH7 A;  1ZRC A;  3MD2 A;  2A6T A;  2WAQ N;  3Q5F A;  3B02 A;  2VJ5 A;  1BR1 A;  5EG0 B;  3K10 A;  3CME I;  1B72 A;  5H6Q A;  4R79 A;  4WXD A;  1LPQ A;  3B6A A;  4AIH A;  4HNV A;  2PFB A;  3S16 J;  2FNP A;  2A61 A;  3WHC A;  2P5V A;  4GCV A;  4EJO A;  4Q5S F;  3JRE A;  1YJW I;  1ZAO A;  3HTS B;  3Q0V A;  3IWZ A;  1G8X A;  3KYD B;  2VT2 A;  2V1U A;  4F7Z A;  1JKQ C;  1VQN I;  1K4T A;  2DMU A;  2F4I A;  3LOC A;  3N4M A;  1DU6 A;  3IRQ A;  4MIM A;  2BEO A;  1ZGA A;  2KMU A;  4LIV A;  2IVM A;  4MFD A;  4M3E A;  3CCV I;  3OR1 C;  3BPV A;  2AHQ A;  4WXH A;  2QLZ A;  1MH4 A;  4BQQ A;  5A2Q Z;  1U9O A;  2KIU A;  2RVC A;  1H0M A;  4Q4Z F;  4L9V A;  1BJA A;  3DPL C;  3HRT A;  5JR3 A;  2E2H J;  4G12 A;  2O6G E;  3ZP5 A;  1I39 A;  4J19 A;  3CP8 A;  1SMT A;  4LMY A;  4UUT A;  3E6B A;  1J2X A;  1I5Z A;  1RZ4 A;  1PYV A;  4A3M J;  2F4M B;  3WG9 A;  3RDI A;  5AIP A;  3LSM A;  5CVI A;  2R7X A;  1TT5 B;  4WK8 F;  2CW8 A;  5K7H A;  4DYQ A;  3GFL A;  4HW0 A;  2IS1 A;  1OCP A;  2NVY J;  3CJN A;  3GF2 A;  1G2H A;  4ITV A;  1O57 A;  2DA4 A;  4EQQ A;  2NNN A;  2Y31 A;  2RRE A;  4KT5 C;  5FD6 A;  1X1C A;  1SVL A;  2E34 A;  3AKZ A;  3WE3 A;  2G0E A;  2VJI A;  1WJ5 A;  2LF7 A;  2ZSH B;  3FF5 A;  3SZT A;  3HSE A;  1PUF A;  2CUJ A;  2M5W A;  3ZQG A;  2CV1 A;  2HEO A;  2ZBK A;  3I56 I;  3T8T A;  4KIT B;  1P6R A;  2FMY A;  1FSH A;  3E97 A;  1UG2 A;  2W7N A;  3LST A;  3ERM A;  2LBF B;  4XKB A;  1ZR2 A;  2QBY A;  1BIB A;  1JTX A;  2STW A;  1XC5 A;  3L9F A;  4JX6 A;  2OU2 A;  3V8L A;  1FBU A;  5CVV A;  1MND A;  4HOB A;  4MQ9 F;  4CSW A;  1RRJ A;  1HW2 A;  2K9Q A;  2TRT A;  1GXP A;  1XCV A;  1UST A;  1P9Q C;  4AWX B;  1QQI A;  4EEF G;  5D8K B;  2JRT A;  4PFO A;  1DPR A;  1TWH J;  2WBM A;  3EPZ A;  3FXM A;  5D5V B;  1YLF A;  4B44 A;  1ZRE A;  4D9J A;  2QM3 A;  2A05 A;  3OS1 A;  3IV5 A;  3DEU A;  1HW5 A;  3CUQ A;  1RIO H;  4L9N A;  1Z91 A;  3O2P E;  3TMO A;  1SC7 A;  3S2H J;  1YS7 A;  4PSX A;  1OYW A;  3JTG A;  1I50 J;  4NC8 A;  2XPW A;  3BLY A;  3OYF A;  2CW0 F;  3FK7 A;  2FSW A;  3I64 A;  3P9K A;  1Y1W J;  2ICW G;  3I4N J;  1ZR4 A;  3CCJ I;  4LG3 A;  1BC8 C;  2QA4 I;  4N4O B;  5FGM A;  3JRC A;  2EBI A;  1EKE A;  5A2Q K;  4E6K G;  4NHJ A;  1HOM A;  4RLQ A;  2COB A;  2ESH A;  3K1N A;  5ICG A;  1XMK A;  4G6D A;  4RA2 A;  2L9V A;  1K7A A;  4EJT A;  3HOU J;  3KZZ A;  1X1D A;  2B7E A;  3FXK A;  1ETY A;  3LMM A;  2UUZ A;  3LNQ A;  3GWZ A;  3OL3 A;  1MH3 A;  5LGN A;  1IN4 A;  1IXC A;  1F43 A;  2ZXJ A;  1JXS A;  2P6S A;  5GTI C;  1ZLK A;  3FK6 A;  1KON A;  5EZG A;  3OYI A;  3V4G A;  2X51 A;  4U88 A;  4MLO A;  3JW4 A;  3H3V K;  3NAU A;  2PN6 A;  1TWA J;  3I5U A;  3TOA A;  4K2E A;  4E7J A;  1Z3X A;  4O5V A;  3V8J A;  1YFH A;  5CYV A;  3IL2 A;  3KLN A;  2HI3 A;  1A31 A;  5FRN A;  3FDY A;  3G1L A;  2ZJ2 A;  5B5E C;  4GXO A;  2XRL A;  4M6X A;  4A0Y A;  2WC2 A;  3DBL B;  3C18 A;  3Q9V A;  1R22 A;  3OIO A;  3GEZ A;  1OYY A;  3LA2 A;  3CC7 I;  2XKO A;  5D5W B;  2D1H A;  2MBF A;  5F1R A;  3UR3 C;  2L7Z A;  1E3H A;  4B1R A;  3K4M A;  5E1Z B;  1O7F A;  3H3Z A;  3J81 K;  4UUS B;  3ERE D;  4A0X A;  1JJ6 C;  4BDZ A;  2DK8 A;  2HYJ A;  3RJP A;  3SZP A;  5HDG A;  2GWR A;  2BW3 B;  4C2M J;  1V55 H;  2VXD A;  1TWC J;  1OCC H;  1XSX A;  1YX5 A;  2MC4 A;  4BQN A;  1YI2 I;  2GLO A;  2JVG A;  3RPU A;  3T8R A;  3LA7 A;  2IW5 A;  4CCN A;  3BJ6 A;  1HDP A;  1FLI A;  3EYI A;  2EH3 A;  1UZC A;  2K40 A;  3DTE A;  1KQ8 A;  3BG6 A;  3PIP F;  4HNT A;  3PNY A;  4CUG A;  2XF5 A;  3P9C A;  5FKM A;  3HOS A;  3CCY A;  3JSP A;  4EGY A;  3HRU A;  4DNC A;  2UXN A;  2QVO A;  2VE8 A;  5CVU A;  2QKL B;  1ETX A;  4ZDL A;  1K78 B;  2DXI A;  4XKC A;  1QVU A;  5DCF A;  2X1E A;  2XKP A;  3OIQ A;  1VTN C;  2HTS A;  3W6J B;  3OWT A;  2DPD A;  2FEZ A;  3I4M J;  2MLK A;  4H4K C;  2DOE A;  2NVQ J;  5J40 A;  2R5Z B;  2ZJR F;  3M3Y J;  1FOY A;  2VKE A;  3HGG A;  1S72 I;  3ML6 A;  4LB5 A;  3L2U A;  2EZH A;  4C2U A;  1RI7 A;  2CQK A;  1YX3 A;  1MDM B;  2R93 J;  2GIV A;  3KYL A;  2B0L A;  4FE4 A;  1MJB A;  3C2B A;  5K1Y A;  3IP4 B;  2P6T A;  2HXO A;  2LDU A;  2K5C A;  2HZT A;  2AS5 F;  3W6V A;  1R5I D;  2PMH A;  3SZG A;  5EDN A;  2DTZ A;  4NDL A;  2X0L A;  2F4O B;  3HOY J;  2WAE A;  1KU2 A;  4M9S A;  1YJN I;  2EIN H;  1ETV A;  4LLG F;  4M3F A;  3L2V A;  4HPQ A;  1FMV A;  2EA4 A;  3DXJ F;  4E7K A;  2PJP A;  1WGX A;  3A1Y A;  2IGO A;  2PMU A;  4NUB A;  4JP0 A;  1HKQ A;  4NQW B;  3ZQC A;  4BQA A;  1UHW A;  1DGR M;  2VUM J;  1BC7 C;  3DTI A;  3DPU A;  1X4P A;  3CO7 C;  3NWS A;  2JQ7 A;  4YRV A;  2CW7 A;  3ZMS A;  4BE2 A;  2AO9 A;  3FKJ A;  5KVR A;  1POG A;  5KAI C;  1ZAR A;  4HX8 A;  2YX4 A;  1VQL I;  1O3Q A;  2JK3 A;  3REO A;  3J7A Y;  1HSJ A;  2BOL A;  5DCM A;  2EIJ H;  1HLV A;  5AIQ A;  1R1V A;  4BAC A;  2H8W A;  4WWC A;  4EMS A;  1WJF A;  1VQK I;  1TNT A;  3LFU A;  3VOE A;  2ZO4 A;  2W48 A;  2CWE A;  1IV6 A;  2E1N A;  4C30 A;  1W0T A;  1XN7 A;  4PUS A;  3EET A;  5HLT A;  3EYY A;  4FET A;  1TQP A;  1LB2 A;  5CPR B;  4DOZ A;  2FJ1 A;  5FLV A;  3L2C A;  2IJL A;  4L5E A;  4DIQ A;  3H5N A;  4MNU A;  4IRG A;  4D7M A;  2VOO A;  4KN4 X;  1LKX A;  3ZQL A;  1RR8 C;  2J5O A;  4BH9 A;  1OCO H;  1ETO A;  3NRV A;  4LLL A;  3DQV C;  2A6H F;  4CYC B;  3IAM 2;  4IQ4 A;  2HKO A;  3WTZ A;  3DLL F;  2CV2 A;  4ZYA A;  4C2T A;  3DBH B;  1YO5 C;  3ZXS A;  3S1N J;  2VQC A;  2M34 A;  1JE8 A;  1ULY A;  5E3L A;  5IYB J;  4OAZ A;  1A04 A;  4BGD A;  4AVP A;  2K9L A;  3OYM A;  2CGP A;  4DZJ A;  2WAD A;  1OPC A;  5DEQ A;  4XRM A;  2E1M C;  2CJJ A;  2QSH X;  1KU3 A;  4QTR A;  3TGN A;  1QZY A;  3M8F A;  1K6O A;  4II2 A;  1PP7 U;  1FEX A;  1G6N A;  4RB0 A;  4U7B A;  1PUF B;  4UHT A;  2F6C A;  3U1K A;  3JAM Z;  4Y3O A;  1H88 C;  2CQX A;  2W00 A;  3WTT C;  2JVH A;  1WSU A;  3K7A J;  2K02 A;  4C3H J;  1WRJ A;  3UNG C;  4O6J A;  4ABZ A;  1SVM A;  1T2K A;  2BGC A;  3HKZ N;  2LY9 A;  2V6E A;  4BY1 J;  2YR2 A;  4WF2 A;  2MG4 A;  2HQ5 A;  3KLO A;  4G6T B;  2KJC A;  4F52 A;  3HUG A;  2M0C A;  1NH3 A;  1TWF J;  2OTL I;  2LOO A;  5LHG A;  3E5X A;  3U9G A;  1MMA A;  3K70 D;  4AM3 A;  1D0X A;  4DQ2 A;  2OQR A;  2VJ4 A;  3F72 A;  3ZMU A;  1FC3 A;  1PJR A;  2EWN A;  3I55 I;  3NAR A;  3HSF A;  4PK4 A;  2ZXW H;  2VBY A;  2PI0 A;  3ZCO A;  4JYK A;  2BVL A;  4HZF A;  1NG6 A;  4E7S A;  2R5Y B;  2LP0 A;  1FTT A;  4JX4 A;  3CUQ B;  3J7Y J;  4LGW A;  2VOD A;  2LBF A;  5D6F A;  1WHU A;  2R7O A;  3VOD A;  1LFB A;  3O3K A;  3N97 A;  4M73 A;  1P4W A;  4IZZ A;  1IN6 A;  2LRE A;  5K5R A;  5D4S A;  3L2W A;  3LAP A;  1B8I B;  1UEL B;  3LA3 A;  2PG4 A;  1N75 A;  4A3B J;  3W2A A;  1JGS A;  3CDL A;  2XAG A;  5D8L B;  4YIF A;  4XN3 A;  3S17 J;  3EQL F;  3SXY A;  5DUI A;  1A6I A;  4Y52 J;  1TL8 A;  2ZKZ A;  2HOT A;  3K69 A;  1QNT A;  1Z67 A;  2IP2 A;  4BQO A;  1D0Z A;  3K1M A;  3GLX A;  1X1B A;  4I0A A;  4L9J A;  4ZZD A;  2A6E F;  2FU4 A;  2XAS A;  1WJE A;  1QRY A;  3I3L A;  5D6E A;  2MGQ A;  5CJ9 A;  3RYP A;  4I0B A;  3ZOB A;  3UKG A;  1QA6 A;  5LRR A;  2RV8 A;  2NYX A;  3DF8 A;  2PMZ A;  3VEP A;  2FF4 A;  1G3Y A;  4L9T A;  1Y1V J;  5IOY A;  4P96 A;  2ECB A;  2DMN A;  3VSL A;  2EFN A;  3F3X A;  2XAF A;  4NC7 A;  2ZCW A;  4WX9 A;  3A01 B;  1WJB A;  2H1L A;  1JT0 A;  3FWE A;  4KYW A;  1SD4 A;  5FRM A;  3C1D A;  3DEE A;  4RS8 A;  4AUX A;  2QQ8 A;  2JUC A;  2CU7 A;  4F92 B;  3S1Q J;  2IS2 A;  2IXS A;  3JAM K;  4G6Q A;  4BJ5 C;  5E3O A;  2DDB A;  2JA7 J;  4ZC3 A;  2X6W A;  2ADU A;  2X1C A;  2XHK A;  3OY9 A;  4HLY A;  2NXN B;  1G3S A;  2WB1 A;  2KIF A;  2LTP A;  1MJA A;  2H09 A;  2IBD A;  4UB6 C;  1W5C C;  2IS4 A;  2EIM H;  4KNY A;  9ANT A;  1MBJ A;  2IGN A;  2M4G A;  3LL7 A;  2FE3 A;  5LGU A;  2W85 A;  2Y30 A;  1OLT A;  3BY6 A;  4ZZL A;  2ZXI A;  4XMY A;  3QPL A;  3L2R A;  1R00 A;  3CF2 A;  4QPO A;  1UFM A;  1TZL A;  1FBS A;  3IAS 2;  5ERI A;  2RDP A;  4QWQ A;  2D2W A;  3TKY A;  3WHB A;  3VFZ A;  3OMY A;  4II3 A;  4L5J A;  1D3Y A;  2EZI A;  3MQ0 A;  5GPA A;  3ROU A;  4RB3 C;  4FQG A;  5EEH A;  3WE2 A;  2K4B A;  5EEA A;  1F4K A;  1BIA A;  1GV5 A;  1FT9 A;  3AL0 B;  1S6L A;  3BG7 A;  4UUS A;  4OMY A;  2JUG A;  1MMN A;  2DPU A;  4M9Z A;  5C4X J;  2LH9 A;  2R7Z J;  1IRG A;  4HST A;  1OMI A;  2RNJ A;  2HOS A;  1DQU A;  3VYS B;  1HC8 A;  5E20 A;  1WPK A;  2EFQ A;  1Z1D A;  1ENH A;  4YEJ A;  3TED A;  3HPH A;  4CGZ A;  4B48 A;  1VQ8 I;  3JRB A;  1S9H A;  4KJZ A;  3GW2 A;  4V2F A;  4IHT A;  3JCU C;  3KP4 A;  1WI9 A;  2D5V A;  5M5Y J;  2HYF A;  3CO6 C;  3ZGK A;  2K86 A;  2XVC A;  4B3A A;  4RGR A;  3A02 A;  3BQZ A;  3PNV A;  5HOO A;  5L3E A;  1N78 A;  1N77 A;  2QUF A;  1MBH A;  1YIO A;  4HV6 A;  2MC3 A;  5C4J J;  2M0M A;  2VKD A;  1SVO A;  2O9L A;  3QP5 A;  1IXS B;  2R5Z A;  2DOA A;  3E3V A;  4IHW A;  1WJC A;  4ASN A;  5HVQ C;  1JGG A;  1WH7 A;  5E79 C;  2GIZ A;  2JRM A;  1R1U A;  2RQP A;  4GO1 A;  1QHH D;  2E19 A;  3IUO A;  5K7F A;  2BE5 F;  3GX4 X;  4XLH A;  4E70 A;  1Y8Q B;  1R49 A;  5BS6 A;  3WTY C;  2JMW A;  2M9H A;  2CQN A;  5EYR A;  4NC6 A;  3MMY B;  3DU5 A;  2V9V A;  1V4R A;  3HOW J;  3HB9 A;  4CHU A;  3HHH A;  1XPX A;  1USS A;  1VQM I;  3CD6 I;  5KNL A;  1LEA A;  4UB8 C;  5E18 F;  2H1K A;  2STT A;  2R7S A;  2D45 A;  1XS9 A;  4HDU A;  1XDS A;  1HCR A;  3K70 C;  4MHG A;  1ZG3 A;  4NQW A;  3KEY A;  5KK1 A;  1ETQ A;  3QU6 A;  3ZQF A;  2NRA C;  1R4M B;  4BKX A;  3MFK A;  1U0J A;  5TIS C;  3K4C A;  2ELK A;  1BI1 A;  1WVR A;  4ZYE A;  3BOQ A;  3DBR B;  4I76 A;  2XPV A;  3ZR8 X;  2GOX B;  3CMM A;  2RNG A;  2KRH A;  2VL8 A;  5DD4 A;  4EGZ A;  4AVZ A;  3ABK H;  3RQI A;  2OAZ A;  3BCA A;  3PNT A;  1B9M A;  4ESF A;  1ETK A;  3LAJ A;  3K4N A;  1KYZ A;  2VE9 A;  2EV5 A;  1UHS A;  1DDN A;  3TP0 A;  1P4A A;  2E7X A;  5J3L A;  4IHV A;  2XAQ A;  4ENJ A;  4PJM A;  1GVJ A;  2XF7 A;  4ZYG A;  2VAS A;  1B4A A;  2P0W A;  3WOD F;  4GDF A;  1ERD A;  2V1D A;  3KE2 A;  2LKS A;  4Z6Y A;  3LSI A;  3ZN0 A;  3MKW B;  2YX7 A;  1U6G A;  1ZEL A;  3ABU A;  3DWL E;  3L1P A;  3Q0W A;  5K7Z A;  3OYB A;  2DA5 A;  3W2W A;  5L3F A;  2DTR A;  1VQ6 I;  5B1A H;  2L9R A;  4PJJ A;  4A6D A;  2CQ7 A;  2EA2 A;  4IO9 F;  1E2X A;  1LDJ A;  4CYC A;  1FIP A;  1FIA A;  3VYR B;  1K83 J;  4N0B A;  4OWR B;  2FBK A;  5GPC A;  4S04 A;  2DU9 A;  4M74 A;  4P9F A;  1MBK A;  3HUG B;  3ZPL A;  4XBF A;  3ZMT A;  4EV0 A;  3FHZ A;  4G7Z F;  2CO5 A;  4I99 C;  4LJZ F;  1D1C A;  2MA3 A;  5LRS A;  1TQM A;  2DT5 A;  3D1N I;  1IN5 A;  3V7S A;  2UZK A;  3GZN B;  5J1Y A;  3G1O A;  1BR4 A;  4KIG A;  1VQ5 I;  3OYG A;  1ONV A;  3RI4 A;  1IDY A;  2PX9 A;  5F04 A;  3S3O A;  2X9D A;  5HLH A;  4DW6 A;  4DYC A;  3GXO A;  4PSW A;  4BBS J;  3J81 Z;  2X85 A;  5LD2 C;  4KMU X;  5F0C A;  3C7J A;  2HVQ A;  3ABT A;  1U3E M;  3I4P A;  4F91 B;  3BP8 A;  3CTA A;  1T56 A;  2PLY A;  1GLN A;  1T33 A;  5L3B A;  3BPX A;  3GTQ J;  2KL4 A;  4XLA A;  2DFE A;  4D5C A;  3M8J A;  1WCM J;  3SHF A;  1S3J A;  1S8N A;  4LB6 B;  3CES A;  5ILU A;  2QZ8 A;  1U2W A;  5J8F A;  3GTJ J;  1ZG5 A;  4I98 B;  3GTK J;  3SYT A;  3FXQ A;  4UVA A;  2NAZ A;  2Y0S N;  2O7O A;  3IHU A;  2X4H A;  3V42 A;  2CG4 A;  3BTI A;  2R5Y A;  3LSG A;  1IF1 A;  3K4L A;  4KIB A;  2TDX A;  2WY8 Q;  4IRI A;  4C3I J;  4EM1 A;  1JKO C;  4A93 J;  4A3F J;  4OIP F;  4RM3 A;  2XC7 A;  5IP6 A;  2DYR H;  2DA6 A;  4LFU A;  2DFF A;  4H0E A;  4PGH A;  2YUS A;  2ZJP F;  3M4O J;  1RET A;  2YS9 A;  1GDT A;  3FXL A;  4XN0 A;  4AYB A;  2VON A;  4YFX F;  4JBA A;  1G3W A;  3RZO J;  2K9S A;  4UVC A;  2A68 F;  3U2R A;  1B8I A;  2LKP A;  1FOK A;  4UUV A;  2W25 A;  5H20 A;  4F3Q A;  3C3W A;  4BUP A;  1XSD A;  1EJ9 A;  3CJT B;  1IW7 F;  2GAU A;  5HS7 A;  1X4O A;  2EFP A;  3EUA A;  4PJL A;  4I02 A;  1P92 A;  3CCS I;  1REP C;  1ZN2 A;  1K79 A;  3TP3 A;  4A3C J;  2G7H A;  1GT0 C;  4MQV A;  1B1B A;  3PJR A;  1WFX A;  3S32 A;  3RIR A;  4CZC A;  1WQ2 A;  1J59 A;  4GYG A;  1XGO A;  4FE7 A;  2XSD C;  3A01 A;  3E6C C;  4UY8 I;  4N9I A;  3K1P A;  4ZDP A;  1SFU A;  4FTH A;  1JJ8 C;  3CCM I;  4GYI A;  4I7H A;  2EV0 A;  5IYC J;  5IT3 A;  5E3M A;  1HBX G;  2PJR B;  2IA2 A;  1LE8 B;  2M45 A;  1VQ9 I;  3BDD A;  1F36 A;  3KZI C;  2LF8 A;  1S7A A;  3KZY A;  3OOP A;  2FX0 A;  1W4M A;  2DW4 A;  3W3C A;  3TO7 A;  5BNG A;  2ISZ A;  1ZTR A;  3M07 A;  3M8E A;  2GA1 A;  2VBZ A;  2XGD A;  2QKM B;  5K5Q A;  2Q2E B;  1AA7 A;  3DFG A;  3KET A;  4YG2 F;  3JTH A;  1HKS A;  4YEL A;  4X0G A;  3VWB A;  4Y7N J;  4X6A J;  5J4Y A;  3CCQ I;  5JHF A;  2FD5 A;  1B9N A;  5TJJ A;  2E1C A;  1MSE C;  3JSO A;  1BI2 A;  2JA2 A;  3BR5 A;  3V7R A;  1MJ9 A;  3U1D A;  1Y56 A;  3WG7 H;  2M1B A;  3R61 A;  4FAS D;  5F0F A;  2EIL H;  2R7Q A;  3QWL A;  3WGH A;  3R0A A;  2H6B A;  2YPR A;  3QP6 A;  2V79 A;  1Z21 A;  2Y2Z A;  2Q0O A;  4W1U A;  1Z7L A;  1YE9 A;  2E5Z A;  4DBQ A;  3IH4 A;  4Y33 A;  2LRD A;  2DFI A;  2GQQ A;  3ZQQ A;  5DM7 F;  3HIF A;  3PQJ A;  3WGG A;  1U5T B;  3GZ5 A;  3A0H C;  1FMW A;  1U5T C;  4RB1 A;  2DA7 A;  1STZ A;  1TNS A;  1FNN A;  1R5H A;  3T5X A;  5F0H A;  4ESJ A;  1C0W A;  1SFX A;  3FXJ A;  3NWT A;  2HYG D;  3HOZ J;  3ZRG A;  1FWZ A;  5JLW A;  2P4W A;  2KIS A;  4LIT A;  2RC4 A;  3RPQ A;  3IC7 A;  3D0S A;  2G9W A;  2CUZ A;  3CCL I;  3CUO A;  4PDK A;  3BZC A;  3TBI A;  1DU0 A;  2W4S A;  5HLI A;  2VOP A;  4MGR A;  1LDK B;  4LG0 A;  1HST A;  4ENK A;  1LJ9 A;  5FKL A;  3D5L A;  4ZJZ A;  4IPA A;  2L2O A;  3EDP A;  4YIR X;  4P55 A;  2CH0 A;  3E1S A;  3F6O A;  4IHY A;  1U9N A;  2HR3 A;  3FMQ A;  3CCU I;  3I53 A;  3G3Z A;  3F8M A;  1X3U A;  1I27 A;  2VPR A;  4XON A;  2HPI A;  1T08 B;  3OYL A;  4GRI A;  5BPI A;  3HXL A;  4CCL A;  3JRG A;  1LFP A;  4E4H A;  2OQG A;  4ZH4 F;  1IG7 A;  4EM0 B;  3PSI A;  5J1R A;  2UWM A;  2M8G X;  1U78 A;  3LQR A;  1VI0 A;  5HDK A;  2H94 A;  3KYC B;  4UVB A;  4DJA A;  1V54 H;  2F5D A;  2FUG 2;  2ELJ A;  1JUP A;  3S2D J;  3WTV C;  1EA3 A;  2YU3 A;  1ODD A;  2W1O A;  3MAJ A;  5FB2 A;  3SDG A;  2XAH A;  2M7A A;  2XGC A;  3EUK L;  2LD5 A;  1K4S A;  5AON A;  2AQE A;  4I09 A;  2NVT J;  1MBE A;  5B66 C;  4EJW A;  4WCG A;  3CDI A;  3KP7 A;  3T1B A;  4S0H B;  5LHH A;  4PGG A;  4IX7 A;  3JRD A;  2CUF A;  4J00 A;  3OL4 A;  2WAQ A;  4RLF A;  2P8T A;  1QGP A;  4HX7 A;  4IXA A;  3V8K A;  5EJC A;  3QOP A;  3WTS C;  2WTE A;  3OV8 A;  2FBI A;  1N25 A;  2F5C A;  1LVA A;  3GO5 A;  2R92 J;  1HA8 A;  2R7V A;  4CA0 A;  1XMA A;  5LHI A;  2BY3 A;  4XOP A;  2GXG A;  1XB4 A;  2DLL A;  2HDC A;  1V5E A;  2O61 A;  2DMQ A;  2F5F A;  2IEK A;  2MH2 A;  3CC4 I;  1IV8 A;  4XM3 A;  5J6X A;  1S5L C;  3BWG A;  1XGM A;  2QQA A;  5J47 A;  4XR6 A;  2H27 A;  2EFO A;  1ZGW A;  2R7D A;  2JSP A;  4BJT A;  3OYD A;  3K9T A;  3G4S I;  4D7N A;  2Z99 A;  3PFI A;  2HKX A;  3I9V 2;  4XLC A;  1UHM A;  3QOD A;  2WV0 A;  1JI8 A;  1O7L A;  3MKL A;  4BBR J;  2E1M B;  2IA1 A;  2KHM A;  2VQG A;  4OAY A;  3SEZ A;  1VQO I;  2LKX A;  4OIO F;  3I59 B;  3M1E A;  1D1A A;  4IVN A;  1BW5 A;  2KIQ A;  2KDO A;  2EB7 A;  1W7P D;  3RYR A;  3RKY A;  1Y0U A;  4E7H A;  1P2F A;  3OYK A;  2W84 A;  1E0E A;  2DT6 A;  4QIW N;  5IPA A;  1TBX A;  4FCY A;  4HV5 A;  5BQT A;  3FKI J;  3I58 A;  4CCK A;  3COA C;  5LBQ A;  1R71 A;  2CYY A;  1LNW A;  2IPQ X;  3HEF A;  4HQM A;  5HS8 A;  2KQR A;  4EAT A;  1MBG A;  1FYL A;  1MSF C;  4BL0 B;  4BHP A;  2JN6 A;  1P7I A;  1Z77 A;  1JKP C;  2HTJ A;  1XTA A;  3VSK A;  4XLE A;  2K85 A;  1FBQ A;  1Z05 A;  5J4V A;  2E60 A;  3FBN B;  4LK1 F;  5ILS A;  5F1J A;  2Q1Z B;  1LEB A;  1VZ0 A;  4XSZ F;  3K6G A;  1H9T A;  1ZRF A;  4B4C A;  2JA8 J;  1PDN C;  5M5X J;  3RSN A;  4Z2Y A;  4Y13 A;  2EQR A;  3IKT A;  3SEQ A;  2K7L A;  5H2F C;  5C3E J;  2KKO A;  1Z6R A;  2Y9Z A;  4M71 A;  4HEA 2;  4CIC A;  1KU9 A;  3J7A O;  2QEN A;  3DPT A;  1D0Y A;  2VKV A;  1Y0N A;  5M5W J;  2E1O A;  4XID A;  1T98 A;  3HRS A;  5D4R A;  3N05 A;  1KA8 A;  3SDB A;  3KFW X;  3RKX A;  1DPU A;  2ETH A;  4OU0 A;  2ID3 A;  4KIC A;  2IA0 A;  3CZ6 A;  3SFI A;  3ECH A;  3CLO A;  4MFE A;  4N4N B;  2L9N A;  4W97 A;  1TQI A;  1VFC A;  1G59 A;  4XKW A;  5DYM A;  1YTY A;  1J7K A;  2QQB A;  2XUB A;  2LG4 A;  1T0F C;  3BG3 A;  1RUO A;  1B6A A;  5FLX K;  2R7U A;  3FZV A;  2VBW A;  1TC3 C;  1R5G A;  1NK3 P;  1XD7 A;  3AFH A;  1XSV A;  2KZV A;  2AQF A;  4R1H A;  4L18 B;  3P5J A;  1RR7 A;  2NS7 A;  4R8H A;  4I2O A;  2TCT A;  3CMA I;  3SJM A;  4A3I J;  4KT6 A;  5C44 J;  2Y75 A;  4BHC A;  3ZQH A;  1LQ1 A;  1BJZ A;  4J01 A;  4LK0 F;  1WJD A;  5FRO A;  3J7Z I;  2VI6 A;  3OS0 A;  1X2N A;  3ABL H;  5IY5 H;  3MCZ A;  2XRO A;  3AAF A;  3BR1 A;  4M72 A;  2DFH A;  2EZL A;  3S1M J;  3L09 A;  1LFU P;  3E7L A;  4BJ6 C;  3CP2 A;  1OR7 C;  4IOC F;  1VQP I;  1EH8 A;  2R7T A;  1H89 C;  2V4J C;  1SD6 A;  1QHG A;  4DYR A;  5GAG J;  4AIJ A;  5ICC A;  3D5S C;  2LSO A;  4CZZ A;  1ON1 A;  5HNH A;  1IAW A;  3T0Y A;  3AG1 H;  1FP1 D;  3LFK A;  5M3F J;  2QSG X;  1LUJ B;  4YII A;  3HGY A;  4KUM A;  1YW8 A;  3ASN H;  1ZGJ A;  3L7W A;  1A5J A;  2JZY A;  4XLN F;  5HNF A;  5JVG F;  3KP2 A;  3KP5 A;  3RQ4 A;  3OYH A;  3IKV A;  3GME A;  4C9Y A;  3MZ8 A;  2EPF A;  2DOD A;  3WU0 A;  4IHS A;  2Z33 A;  2WY7 Q;  1TW2 A;  4NB5 A;  1S7O A;  4N9H A;  5BOX A;  2DBB A;  5CQE A;  1BN5 A;  3G71 I;  3AG2 H;  1V5F A;  4HSR A;  4XRS G;  1VQ4 I;  2HQR A;  5B3S H;  2F48 A;  2RN7 A;  2XIG A;  4L0Y B;  4XIC A;  3HOT A;  1YHQ I;  2WA0 A;  1PP8 F;  2PJR A;  1LE8 A;  4IOA F;  2KIM A;  2BHZ A;  2DOF A;  3HC7 A;  1MKM A;  4L5I A;  2DA1 A;  5E8G A;  3ZQ7 A;  3BTJ A;  3X2Q H;  1J09 A;  2Y48 A;  4BEH B;  3HG9 A;  4XL9 A;  3MZH A;  1NK2 P;  4TV7 A;  2M7B A;  2GXB A;  3GFI A;  2ME0 A;  2QSF X;  4RMN A;  3RTR A;  1P4X A;  2BXZ A;  4ANJ A;  2Q2E A;  4RAZ A;  4X1E A;  2CRG A;  2HOA A;  3TO9 A;  1RUN A;  2JA5 J;  1YS6 A;  4CXF A;  4IHX A;  3K4J A;  2EV6 A;  3DKY A;  4BE0 A;  4FX4 A;  2BY0 A;  2HWV A;  2W57 A;  2HU9 A;  3CJQ B;  1D1B A;  3O8G A;  4MTD A;  3H92 A;  4RM2 A;  2MYS A;  4BS9 A;  5LFA A;  1FTZ A;  3F23 A;  1GV2 A;  4F93 B;  1XGN A;  3A03 A;  1T8I A;  2L02 A;  2V6C A;  4RGX A;  4LG0 B;  2BVM A;  2E35 A;  4M3G A;  2VC1 A;  2L7K A;  2O5R A;  1F5T A;  3RKW A;  4EVI A;  2M4K A;  2FNA A;  4ENN A;  1S7E A;  5GAH J;  5LEJ A;  2ZB9 A;  2KZG A;  5JHU A;  1YIJ I;  3GFM A;  1U5T A;  1MMS A;  1LVK A;  1OIS A;  3ZMV A;  3TDZ C;  4G8X A;  3SFZ A;  1YRN B;  2PBI A;  2XGX A;  3H5A A;  1W7P B;  1JT6 A;  1R36 A;  3E6D A;  2A5W A;  3F22 A;  4FT8 A;  3BZK A;  3IH2 A;  1BI3 A;  1NHA A;  2UV1 A;  1A35 A;  2XSJ C;  3E5Q A;  3F8B A;  1IO2 A;  1KZH A;  1FYK A;  4LLN A;  1XGS A;  3KCC A;  2L4A A;  5H6R A;  3BR2 A;  5JFR A;  4RAY A;  1OQY A;  3MWM A;  4A3E J;  5KCM A;  3ISP A;  1X3Z B;  2KLO A;  1FSE A;  3J80 Z;  1ZKG A;  1MMG A;  3HM5 A;  4CCO A;  1X58 A;  1W1W E;  2EIK H;  2LLK A;  2HS5 A;  4HAM A;  2LY1 A;  2W82 A;  5ILV A;  5E1X A;  3GYH X;  3HZJ A;  2HFH A;  2N8G A;  4L0Z B;  2HVR A;  2XAU A;  1ORK A;  3BTL A;  4Q47 A;  3K0L A;  3E0J B;  2E71 A;  3F6V A;  2E2I J;  4HG2 A;  3RKQ A;  4B8X A;  2L54 A;  4BHB A;  2A07 F;  2F5E A;  1UMQ A;  2FA5 A;  1QBJ A;  2D1V A;  4UNO A;  2FQ4 A;  1TLH B;  5TRD A;  2IRF G;  3JRH A;  4B09 A;  2HOE A;  3GFJ A;  1HW1 A;  4MTE A;  2ZFU A;  2LFB A;  3WU2 C;  2HXI A;  5EZH A;  3TDU C;  4CYD A;  4DBR A;  4BXU A;  1IDZ A;  2Z3Y A;  4ZTJ A;  4XOR A;  1Y8R B;  2AXL A;  3QAH A;  1E3O C;  1J9I A;  3QYE A;  4PJN A;  2OV7 A;  3S2W A;  4U0Y A;  5IYD J;  2OUM A;  4M9X A;  5FKN A;  5KHD A;  1E17 A;  1HQC A;  3AG3 H;  3DEW A;  3O8H A;  2NS8 A;  3BR0 A;  5ICE A;  3HDD A;  2M87 A;  1MGT A;  2RGV A;  2VIX A;  4S05 A;  2K9M A;  1FX7 A;  3HBL A;  2OTJ I;  3KP6 A;  3A0B C;  3F8C A;  4IF4 A;  2HQA A;  2M2E A;  4NBQ A;  2KRF A;  1X1P A;  4M3B A;  5JLX A;  2E36 A;  5FFX A;  2V1X A;  1QVT A;  1E3P A;  2XB0 X;  4M3D A;  4G7O F;  2BY2 A;  1GVD A;  3ABM H;  3U21 A;  3LWF A;  2DA2 A;  3BC8 A;  1EF4 A;  4HX4 A;  2KT0 A;  1R4N B;  3I59 A;  5CVR A;  1WKM A;  3R0J A;  4HF0 A;  3LSJ A;  3K4K A;  1LDD A;  2NOG A;  3S8P A;  2GBY A;  2CUE A;  1O4X A;  1U8B A;  3FIS A;  1U8R A;  2Z1D A;  1G4D A;  2DYS H;  2EJR A;  4NNJ A;  4IL6 C;  2QYO A;  2O3F A;  4XK4 A;  5KAF C;  5HDN A;  3LQQ A;  1ACI A;  1BW6 A;  2QEX I;  3S1R J;  4Y4R A;  1T39 A;  1KU7 A;  2A5Y B;  3HKZ A;  3P9I A;  1MZB A;  1SFE A;  2JPB A;  5DDG A;  2L4M A;  1SD7 A;  1VF9 A;  1R7J A;  4FIS A;  4HLX A;  2B63 J;  2DCE A;  3CJR B;  1DGW Y;  3HTU A;  3CCE I;  2E5N A;  2VBX A;  1S29 A;  2ZNZ A;  3K2A A;  2WAF A;  3J80 K;  3ZMD A;  4PJ0 C;  3R60 A;  4ON0 A;  3BTC A;  3ASO H;  5BPD A;  1HKT A;  2ISY A;  2NNY A;  1XDU A;  1AU7 A;  3F8N A;  3GUD A;  3MEX A;  4JX5 A;  3WU1 B;  1X1A A;  4AC0 A;  2M8E A;  5DTD A;  5GTH C;  4IQJ A;  3CC2 I;  1ZYR F;  1KGS A;  4A69 C;  4P5O A;  2B9S A;  4RBO A;  3FM5 A;  3ONQ A;  3W2V A;  2H8R A;  4BYY A;  2DMT A;  3VYT B;  2DA3 A;  2OCC H;  3K2Z A;  1ZQ3 P;  5ED4 A;  4HNU A;  2GM4 A;  2E2J J;  1OKR A;  3PO3 J;  3PUF A;  5F64 A;  4QLC U;  4U0W A;  4Y17 A;  4BAY A;  2C6Y A;  3ESW B;  3L2Q A;  2R7W A;  3QYB A;  2KJB A;  1IN7 A;  1T0F A;  1H8A C;  4OIR F;  1JUM A;  2KDZ A;  3KP3 A;  2O8X A;  1CQT A;  2DDA A;  4XSX F;  2DO7 A;  4AU7 A;  2V26 A;  4FX0 A;  1WI3 A;  1P7J A;  2VT3 A;  3PQK A;  3DKX A;  3NQO A;  3HHG A;  1FP2 A;  1ETW A;  2PMZ N;  5F6F A;  2CFO A;  5L3G A;  3QYF A;  1TT0 A;  5JVT A;  2XF6 A;  3MKZ A;  2CS3 A;  1ZHF A;  3H3U A;  2Z2S B;  2XAJ A;  1CF7 B;  2MD0 A;  5B1B H;  1QZE A;  5L3D A;  3OSF A;  3ECO A;  3VDX A;  1OR7 A;  1R6R A;  4HRI A;  1X2M A;  5IT9 Z;  2ZME B;  2VKH A;  4GGG A;  3O6B B;  2ZME C;  5J8C A;  4G94 A;  4Y15 A;  2VQH A;  2ACJ A;  2I8D A;  4OOI A;  1D8J A;  1IGN A;  3HYI A;  1M1E B;  3GTG J;  3H9Q A;  2CV0 A;  4WXC A;  1O3S A;  1D8K A;  3BQY A;  1DP7 P;  1D5V A;  1RES A;  2OZU A;  2K3F A;  3H9G A;  3S3M A;  5TGT A;  2WB1 N;  3FMS A;  4YFN F;  1Z7U A;  4BNC A;  1O3R A;  3OS2 A;  2F2E A;  3WTU C;  1R23 A;  1ZLJ A;  2X1D A;  3OIP A;  4UXN A;  5CVJ A;  2L3D A;  4D0P A;  2PEX A;  1L0O C;  2RKH A;  2FOK A;  3HPG A;  5CKT A;  5DD8 A;  1JKR C;  2LVS A;  3Q0U A;  2OCE A;  3ZN1 A;  1R9T J;  1OCR H;  1QPI A;  3H36 A;  1IRZ A;  2JPC A;  1W36 D;  5EGO B;  1FY7 A;  1FOW A;  4RAG A;  1SEU A;  1UB9 A;  2J5P A;  3R6S A;  4ESB A;  1YJ9 I;  1SFK A;  5D5X B;  5FD5 A;  2E7W A;  3HL2 A;  3BCB A;  2VLA A;  1L3L A;  1TTY A;  3S3N A;  1ZH5 A;  4BEH A;  1QZZ A;  1BOA A;  2EZK A;  3LSK A;  3QRF F;  2GOM A;  2AXT C;  2QCO A;  4BE1 A;  2UXX A;  2NOJ B;  4F55 A;  2YU9 J;  2M3A A;  4E7I A;  4D1Q A;  2NVX J;  1WH5 A;  2GZW A;  2V9K A;  4G9Y A;  1PUE E;  1R1T A;  4XOT A;  3ZMZ A;  1DP3 A;  5GAD J;  2WWY A;  3WTW C;  4KIS A;  2LMD A;  1AKH B;  1HXD A;  2DK5 A;  1T6S A;  1JHH A;  5FFZ A;  4A3K J;  3KEO A;  3I0T A;  2DQL A;  1SAN A;  2DAO A;  4E7Z A;  4KN7 X;  1OJL A;  1ITY A;  1FYM A;  1BR2 A;  4MEY F;  3V7C A;  1A6Q A;  2M30 A;  2JT1 A;  1F9N A;  3HJE A;  2L5Q A;  1XG1 A;  3QPT A;  4HA8 A;  3G2B A;  4V19 K;  1EH6 A;  1ON2 A;  1YRN A;  1IRX A;  2CQQ A;  3A4C A;  5F08 A;  1QPM A;  1W7P A;  4A6E A;  5IT9 K;  4FHT A;  2W24 A;  1IN8 A;  3QPS A;  1J5Y A;  2VJJ A;  3EUH C;  3H0D A;  2HDD A;  3E5U A;  1GHC A;  1W0U A;  1YQA A;  3P7N A;  1BBY A;  2ECC A;  1VND A;  4B47 A;  1ZRD A;  2ZC2 A;  4EM2 A;  4B3X A;  3OYE A;  4JK1 X;  2YSR A;  3BG5 A;  5E1W A;  1IZ1 A;  3S15 J;  4ETS A;  4PCQ A;  4IEJ A;  3LSP A;  2A69 F;  3KX2 A;  4GFB A;  3PM1 A;  2MD5 A;  3AG4 H;  3L00 A;  2OC6 A;  1SD5 A;  2LY2 A;  3CCR I;  2BHY A;  4D5F A;  3Q3S A;  4DGW B;  1B72 B;  2NS0 A;  4A5M A;  2O0Y A;  4LOC A;  4DZP A;  3RPU D;  2EFW A;  5E3N A;  4U7D A;  3SQN A;  3FXR A;  2IS6 A;  2DJI A;  4C3J J;  5FLX Z;  1AOY A;  4ZDO A;  3BR6 A;  1CGP A;  3F8F A;  3ELK A;  2X6Y A;  2P5L C;  3BRO A;  3PFY A;  4U87 A;  4RAF A;  4A3G J;  1K6Y A;  1MBF A;  2P7V B;  4ZTF A;  2NVU B;  2OA4 A;  1JTY A;  4IKF A;  2LYC A;  1BOB A;  1EH7 A;  1MMD A;  2EK5 A;  3DTK A;  5LLQ A;  2QGU A;  5CLS A;  6PAX A;  2X6X A;  2GA2 A;  4XLP F;  5FLM J;  1MW7 A;  2OPT A;  1AHD P;  3W6K B;  3QOE A;  5EG0 A;  1ZK8 A;  1FOX A;  3WTX C;  1A36 A;  3HSR A;  5E8I A;  2MLG A;  1MNM C;  2KP6 A;  2L01 A;  3JRF A;  2K27 A;  4XRF A;  2FBH A;  3H35 A;  4V2G A;  1KYW A;  2ZFW A;  4Q48 A;  4ENM A;  1HDD C;  4HF2 A;  2P5K A;  3PL8 A;  1G3T A;  3BG9 A;  2F5V A;  4QPQ A;  4I01 A;  5DS9 A;  4KA4 A;  1OCT C;  1AWC A;  1O3T A;  1Y6I A;  1I6H J;  3CLQ A;  4PZJ A;  4XLF A;  5M3M J;  1I1G A;  4LD5 A;  5ICF A;  3H9J A;  3FM3 A;  4ZYH A;  4LIU A;  4CO8 A;  4BU2 A;  1V5G A;  3F0C A;  1RKW A;  4A5N A;  4EJV A;  1FPQ A;  1HF0 A;  3HOV J;  2L9S A;  1BA5 A;  4OMZ A;  5IP7 J;  1UCR A;  3IH3 A;  3G73 A;  1WJA A;  3OYN A;  3KIO A;  2FML A;  1RNL A;  2DN0 A;  3QU3 A;  2K3P A;  5EF6 A;  5CQG A;  4A2U A;  2JA6 J;  1RC9 A;  3CQZ J;  2P7C B;  2BYV E;  3M7G A;  4EJU A;  2LC2 A;  1EV7 A;  5LEK A;  1UG0 A;  3B6C A;  5E17 F;  3PO2 J;  1GUU A;  3IRR A;  2QBY B;  4B43 A;  1TWG J;  5EEG A;  1K61 A;  1RKT A;  2OD5 A;  2K9N A;  2FRH A;  3GTM J;  4RDU A;  1FJL A;  2IAI A;  4I6Z A;  3ZQI A;  1JHF A;  2O03 A;  3FHN A;  2X48 A;  2PQ8 A;  3QQA A;  2MFZ A;  5IP9 J;  5FKK A;  2HGC A;  3I71 A;  2MW8 A;  4KFC A;  2VQL A;  3MN2 A;  2DT7 B;  2LK2 A;  5FKO A;  3CMY A;  2KRC A;  5J1U A;  2BY1 A;  5HS9 A;  4A3D J;  1YYV A;  4CCM A;  2HQN A;  3GCM A;  1W5T A;  3TOB A;  1IUF A;  4G7H F;  1SAX A;  2V7F A;  2H6C A;  1VQ7 I;  3FBI B;  5BMZ A;  2GXA A;  1IRF A;  2LR8 A;  1YG2 A;  4CDG A;  2R0Q C;  3CUQ C;  2Y0S A;  5HLG A;  4OIN F;  1W36 C;  1YW9 A;  4M6V A;  3PIO F;  4HF1 A;  2R4G A;  3KPH A;  2Y9Y A;  1I3A A;  2JSC A;  2WV1 A;  3DP7 A;  2ME6 A;  4HBL A;  4IRH A;  2DMP A;  5DM6 F;  2QWW A;  1YOV B;  1Z3Y A;  2RQQ A;  2DI3 A;  2IGK A;  3RCO A;  1BI0 A;  1J0R A;  5LGT A;  2I10 A;  2CFX A;  2IT0 A;  4A12 A;  1XX5 A;  4AYB N;  2VC0 A;  1RPW A;  2I5U A;  4HQE A;  4KMF A;  2CMP A;  1IC8 A;  3Q9S A;  2ELH A;  3TW6 A;  3GLL A;  1DUX C;  3M9A A;  3D5R C;  5DV5 A;  3DKW A;  3B73 A;  3FXO A;  2L7F P;  2DQR A;  5K5O A;  4BXX J;  1R58 A;  3BJA A;  2R7F A;  4BY7 J;  2FOW A;  3MZY A;  1WWX A;  1YIT I;  2FQ3 A;  2ID6 A;  4KIF A;  2OBP A;  1IJW C;  3FIW A;  1H9G A;  2K4J A;  3DV8 A;  1KQ9 A;  2ESN A;  2ZXH A;  4RGU A;  4KDP A;  1QU3 A;  1Q1H A;  2CSO A;  4BXF A;  4AIK A;  2XGE A;  3OYJ A;  1IXR C;  1NG7 A;  3IWF A;  3PUB A;  3A2K A;  1MNE A;  2Z16 A;  4U0V A;  1CF7 A;  4HYE A;  4XRS A;  2V9P A;  2XRN A;  3FMR A;  3DU6 A;  3M1C A;  2L0K A;  3MKY B;  2O8K A;  3TO6 A;  2ZME A;  1OYI A;  2BBY A;  2KPM A;  4IJA A;  3JR9 A;  1WZ2 A;  3S14 J;  2QF7 A;  3TQN A;  3FXU A;  2ZNY A;  3DLA A;  1J75 A;  2VB6 A;  1BM9 A;  1Y39 A;  1Q1V A;  2BXY A;  1SAU A;  2P81 A;  3LSH A;  3LSR A;  3GTO J;  3F9K A;  3HRM A;  2Z9O A;  4JQF A;  3NEU A;  2OF7 A;  3PSF A;  5GP9 A;  2BV6 A;  2MAB A;  4P9U A;  3H1C A;  2MH9 A;  3BZ6 A;  3S93 A;  4RGS A;  2ZSI B;  1I6X A;  4UV8 A;  4AD9 A;  3H0G J;  1OCZ H;  5GAE J;  4M6Y A;  3HOX J;  2JJ7 A;  3GBG A;  3C2H A;  2HDW A;  2L7M P;  1F1Z A;  3CDH A;  4AID A;  2OZ6 A;  2VN2 A;  2G7U A;  5L3C A;  2XDV A;  2XPU A;  3H5R A;  1T38 A;  1SMY F;  1X19 A;  5FO5 A;  3CF5 F;  2R3S A;  2ZJQ F;  3BR3 A;  3OOU A;  2RAE A;  1JUS A;  5EGO A;  1IUY A;  4BDY A;  2IGM A;  2LNB A;  3I54 A;  1KQ0 A;  5JI6 A;  3KEQ A;  3VB2 A;  3OYC A;  2X6O A;  4OIQ F;  3JRI A;  2VXZ A;  3G1M A;  3VPR A;  3AL0 C;  4RB2 C;  3OYA A;  4MEX F;  3GZ6 A;  4XQF A;  1I3Q J;  3WGI A;  2DJN A;  1GXQ A;  2HPM A;  1I1S A;  4XKV A;  2BW3 A;  2BZT A;  1UJ8 A;  4HDV A;  1B59 A;  1Z0X A;  1XCB A;  1Z6T A;  3K4B A;  3C2G A;  3MVP A;  2Y69 H;  2VPL A;  4O3M A;  1MIJ A;  5HOD A;  4A3J J;  3G6E I;  3TL4 X;  3BJO A;  2MSY A;  1X3W B; 
#chains in the Genus database with same CATH homology
 3GVA A;  3E6M A;  1QO0 D;  5DUK A;  4ZYD A;  2FXA A;  2A3S A;  4UV9 A;  2QQ9 A;  2Z5U A;  1K78 A;  1W5S A;  3ULQ B;  1TW3 A;  1ZG1 A;  2JTV A;  2COM A;  1MD0 A;  3R4K A;  1FZP B;  2XV4 S;  2Q8K A;  3F21 A;  4YFK F;  1MDM A;  2Y0M A;  1Z9C A;  3EUH A;  1V3F A;  5DCM B;  5D5U B;  1YW7 A;  3QPH A;  3FX3 A;  4A0Z A;  1ZRC A;  3Q5F A;  3B02 A;  5H6Q A;  4R79 A;  4WXD A;  4AIH A;  2PFB A;  2FNP A;  2A61 A;  2P5V A;  4GCV A;  4EJO A;  4Q5S F;  1ZAO A;  3HTS B;  3IWZ A;  2VT2 A;  2V1U A;  4F7Z A;  3N4M A;  3IRQ A;  2BEO A;  1ZGA A;  2IVM A;  3BPV A;  4WXH A;  2QLZ A;  5A2Q Z;  2KIU A;  2RVC A;  1H0M A;  4Q4Z F;  4L9V A;  1BJA A;  3DPL C;  3HRT A;  5JR3 A;  2O6G E;  3ZP5 A;  1SMT A;  4LMY A;  3E6B A;  1J2X A;  1I5Z A;  1RZ4 A;  3WG9 A;  3RDI A;  5AIP A;  5CVI A;  4WK8 F;  3GFL A;  4HW0 A;  3CJN A;  3GF2 A;  1O57 A;  4EQQ A;  2NNN A;  4KT5 C;  5FD6 A;  3WE3 A;  2LF7 A;  3FF5 A;  3SZT A;  3HSE A;  2M5W A;  2HEO A;  2ZBK A;  3T8T A;  1P6R A;  2FMY A;  1FSH A;  3E97 A;  3LST A;  2QBY A;  1BIB A;  2STW A;  3L9F A;  2OU2 A;  3V8L A;  1FBU A;  5CVV A;  4HOB A;  4MQ9 F;  1HW2 A;  1GXP A;  1XCV A;  1UST A;  4AWX B;  1QQI A;  5D8K B;  2JRT A;  1DPR A;  5D5V B;  1YLF A;  1ZRE A;  2QM3 A;  3DEU A;  1HW5 A;  3CUQ A;  1RIO H;  4L9N A;  1Z91 A;  3O2P E;  1YS7 A;  1OYW A;  3JTG A;  2CW0 F;  2FSW A;  3I64 A;  3P9K A;  1BC8 C;  5FGM A;  5A2Q K;  4NHJ A;  3K1N A;  2ESH A;  5ICG A;  1XMK A;  4G6D A;  1K7A A;  4EJT A;  3KZZ A;  3GWZ A;  5LGN A;  1IN4 A;  1IXC A;  2ZXJ A;  1JXS A;  2P6S A;  1ZLK A;  3V4G A;  4U88 A;  3JW4 A;  2PN6 A;  3I5U A;  3TOA A;  4K2E A;  4O5V A;  3V8J A;  1YFH A;  5CYV A;  3IL2 A;  3KLN A;  2ZJ2 A;  4GXO A;  4M6X A;  4A0Y A;  2WC2 A;  3C18 A;  3Q9V A;  1R22 A;  3GEZ A;  1OYY A;  3LA2 A;  2XKO A;  5D5W B;  2D1H A;  2MBF A;  5F1R A;  5E1Z B;  1O7F A;  3H3Z A;  3J81 K;  3ERE D;  4A0X A;  2DK8 A;  3RJP A;  3SZP A;  5HDG A;  2GWR A;  1XSX A;  3RPU A;  3T8R A;  3LA7 A;  2IW5 A;  3BJ6 A;  1FLI A;  3EYI A;  1KQ8 A;  3P9C A;  3HOS A;  3JSP A;  4EGY A;  3HRU A;  4DNC A;  2UXN A;  2QVO A;  2VE8 A;  5CVU A;  1K78 B;  5DCF A;  2XKP A;  1VTN C;  2HTS A;  3W6J B;  2DPD A;  2FEZ A;  2MLK A;  4LB5 A;  3ML6 A;  1RI7 A;  2CQK A;  1MDM B;  2GIV A;  2B0L A;  1MJB A;  5K1Y A;  2P6T A;  2LDU A;  2HZT A;  2AS5 F;  2PMH A;  2X0L A;  4M9S A;  1KU2 A;  4LLG F;  2EA4 A;  3DXJ F;  2PJP A;  2PMU A;  1HKQ A;  4BQA A;  1UHW A;  1BC7 C;  3CO7 C;  3ZMS A;  5KVR A;  1ZAR A;  4HX8 A;  2YX4 A;  1O3Q A;  3REO A;  1HSJ A;  5DCM A;  5AIQ A;  1R1V A;  4WWC A;  4EMS A;  1TNT A;  3VOE A;  2ZO4 A;  2CWE A;  2E1N A;  1XN7 A;  3EET A;  3EYY A;  1TQP A;  1LB2 A;  3L2C A;  2IJL A;  4MNU A;  4IRG A;  2VOO A;  4KN4 X;  2J5O A;  4BH9 A;  3NRV A;  4LLL A;  3DQV C;  2A6H F;  3WTZ A;  2HKO A;  1YO5 C;  1JE8 A;  1ULY A;  1A04 A;  4AVP A;  2CGP A;  1OPC A;  5DEQ A;  1KU3 A;  3TGN A;  1QZY A;  3M8F A;  1K6O A;  1PP7 U;  1G6N A;  4RB0 A;  4U7B A;  4UHT A;  3JAM Z;  3WTT C;  1WSU A;  2K02 A;  1WRJ A;  4O6J A;  1T2K A;  2BGC A;  2YR2 A;  4WF2 A;  3KLO A;  2KJC A;  3HUG A;  5LHG A;  3E5X A;  3U9G A;  4DQ2 A;  2OQR A;  3ZMU A;  3F72 A;  1FC3 A;  2EWN A;  3HSF A;  2VBY A;  2PI0 A;  4HZF A;  3CUQ B;  4LGW A;  2VOD A;  5D6F A;  3VOD A;  3O3K A;  3N97 A;  4M73 A;  1P4W A;  1IN6 A;  5K5R A;  5D4S A;  3LAP A;  3LA3 A;  2PG4 A;  1JGS A;  2XAG A;  5D8L B;  4YIF A;  3EQL F;  3SXY A;  5DUI A;  2ZKZ A;  3K69 A;  1QNT A;  2IP2 A;  3K1M A;  3GLX A;  4I0A A;  4L9J A;  4ZZD A;  2A6E F;  2FU4 A;  2XAS A;  5D6E A;  3RYP A;  5CJ9 A;  4I0B A;  5LRR A;  2RV8 A;  2NYX A;  3DF8 A;  3VEP A;  2FF4 A;  1G3Y A;  4L9T A;  4P96 A;  2EFN A;  3F3X A;  2XAF A;  2ZCW A;  4WX9 A;  3FWE A;  4KYW A;  1SD4 A;  3C1D A;  4RS8 A;  3JAM K;  4G6Q A;  2ADU A;  2XHK A;  4HLY A;  1G3S A;  2KIF A;  1MJA A;  2H09 A;  4KNY A;  2FE3 A;  5LGU A;  2W85 A;  3BY6 A;  4ZZL A;  1R00 A;  1UFM A;  1FBS A;  5ERI A;  2RDP A;  4QWQ A;  2D2W A;  3TKY A;  3VFZ A;  4L5J A;  1D3Y A;  3MQ0 A;  3ROU A;  4RB3 C;  5EEH A;  3WE2 A;  2K4B A;  1F4K A;  1BIA A;  1FT9 A;  1S6L A;  4OMY A;  2DPU A;  4M9Z A;  1IRG A;  1OMI A;  2RNJ A;  5E20 A;  2EFQ A;  1Z1D A;  4CGZ A;  3GW2 A;  4IHT A;  3KP4 A;  1WI9 A;  2HYF A;  3CO6 C;  2K86 A;  2XVC A;  4RGR A;  5HOO A;  5L3E A;  2QUF A;  4HV6 A;  1YIO A;  2MC3 A;  3QP5 A;  1IXS B;  3E3V A;  4ASN A;  5HVQ C;  1R1U A;  2RQP A;  4GO1 A;  2BE5 F;  3GX4 X;  4E70 A;  5BS6 A;  3WTY C;  2V9V A;  1V4R A;  4CHU A;  3HHH A;  1USS A;  1LEA A;  5E18 F;  2STT A;  2D45 A;  4HDU A;  1XDS A;  4MHG A;  1ZG3 A;  4NQW A;  5KK1 A;  3QU6 A;  2NRA C;  3MFK A;  1BI1 A;  4ZYE A;  3BOQ A;  5DD4 A;  4EGZ A;  4ESF A;  3LAJ A;  2OAZ A;  1B9M A;  1KYZ A;  2VE9 A;  2EV5 A;  1DDN A;  1P4A A;  2E7X A;  2XAQ A;  4ENJ A;  1GVJ A;  4ZYG A;  1B4A A;  3WOD F;  2V1D A;  3KE2 A;  3ZN0 A;  2YX7 A;  1U6G A;  3ABU A;  5L3F A;  2DTR A;  4A6D A;  2EA2 A;  1E2X A;  1LDJ A;  4N0B A;  2FBK A;  4S04 A;  2DU9 A;  4M74 A;  4P9F A;  3ZPL A;  4XBF A;  3ZMT A;  4EV0 A;  3FHZ A;  4G7Z F;  2CO5 A;  4LJZ F;  2MA3 A;  5LRS A;  1TQM A;  2DT5 A;  1IN5 A;  3V7S A;  2UZK A;  4KIG A;  3RI4 A;  1ONV A;  5HLH A;  3GXO A;  3J81 Z;  4KMU X;  3C7J A;  3ABT A;  1U3E M;  3I4P A;  3BP8 A;  3CTA A;  2PLY A;  5L3B A;  3BPX A;  3SHF A;  1S3J A;  1S8N A;  4LB6 B;  5ILU A;  2QZ8 A;  1U2W A;  5J8F A;  1ZG5 A;  4I98 B;  3FXQ A;  4UVA A;  2NAZ A;  3IHU A;  2X4H A;  2CG4 A;  1IF1 A;  4KIB A;  2TDX A;  4IRI A;  4EM1 A;  4OIP F;  4LFU A;  4H0E A;  4PGH A;  2VON A;  4YFX F;  4JBA A;  1G3W A;  3U2R A;  4UVC A;  2A68 F;  2LKP A;  1FOK A;  4UUV A;  2W25 A;  5H20 A;  3C3W A;  1XSD A;  1IW7 F;  2GAU A;  5HS7 A;  2EFP A;  4I02 A;  1P92 A;  1REP C;  1ZN2 A;  1K79 A;  2G7H A;  4MQV A;  1B1B A;  3RIR A;  1WQ2 A;  1J59 A;  4GYG A;  1XGO A;  3E6C C;  4N9I A;  3K1P A;  1SFU A;  4GYI A;  4I7H A;  2EV0 A;  5IT3 A;  1HBX G;  2IA2 A;  2M45 A;  3BDD A;  2LF8 A;  1S7A A;  3KZY A;  3OOP A;  3TO7 A;  1W4M A;  2DW4 A;  2ISZ A;  3M8E A;  2GA1 A;  2VBZ A;  5K5Q A;  3DFG A;  3KET A;  4YG2 F;  3JTH A;  1HKS A;  1B9N A;  5TJJ A;  2E1C A;  3JSO A;  1BI2 A;  3V7R A;  1MJ9 A;  3U1D A;  2M1B A;  3R61 A;  3WGH A;  3R0A A;  2H6B A;  2YPR A;  3QP6 A;  2V79 A;  2Q0O A;  2DFI A;  2GQQ A;  3HIF A;  3PQJ A;  3WGG A;  1U5T B;  3GZ5 A;  1U5T C;  4RB1 A;  1STZ A;  1TNS A;  1FNN A;  1R5H A;  3T5X A;  4ESJ A;  1C0W A;  1SFX A;  2HYG D;  1FWZ A;  2P4W A;  3RPQ A;  2RC4 A;  3IC7 A;  3D0S A;  2G9W A;  3CUO A;  4PDK A;  5HLI A;  2VOP A;  4MGR A;  1LDK B;  4LG0 A;  1HST A;  4ENK A;  1LJ9 A;  3D5L A;  4IPA A;  3EDP A;  4P55 A;  3F6O A;  2HR3 A;  3FMQ A;  3I53 A;  3G3Z A;  3F8M A;  1X3U A;  1I27 A;  5BPI A;  2OQG A;  4ZH4 F;  4EM0 B;  2UWM A;  1U78 A;  3LQR A;  5HDK A;  2H94 A;  4UVB A;  2F5D A;  3WTV C;  5FB2 A;  2YU3 A;  1ODD A;  3MAJ A;  2XAH A;  5AON A;  4I09 A;  4EJW A;  4WCG A;  3KP7 A;  3T1B A;  5LHH A;  4PGG A;  2P8T A;  1QGP A;  4HX7 A;  4IXA A;  3V8K A;  3QOP A;  3WTS C;  2WTE A;  3OV8 A;  2FBI A;  2F5C A;  1LVA A;  3GO5 A;  1XMA A;  5LHI A;  2GXG A;  1XB4 A;  2DLL A;  2HDC A;  2O61 A;  2F5F A;  2MH2 A;  5J6X A;  3BWG A;  1XGM A;  2QQA A;  2H27 A;  2EFO A;  2R7D A;  3K9T A;  2Z99 A;  3PFI A;  2HKX A;  1UHM A;  2WV0 A;  1O7L A;  2IA1 A;  4OIO F;  3I59 B;  3M1E A;  4IVN A;  2EB7 A;  1W7P D;  3RYR A;  3RKY A;  1Y0U A;  1P2F A;  2W84 A;  1TBX A;  4HV5 A;  5BQT A;  3I58 A;  3COA C;  5LBQ A;  2CYY A;  1LNW A;  2IPQ X;  4HQM A;  5HS8 A;  1FYL A;  4BHP A;  2HTJ A;  1FBQ A;  1Z05 A;  4LK1 F;  5ILS A;  1LEB A;  4XSZ F;  1H9T A;  1ZRF A;  1PDN C;  4Z2Y A;  4Y13 A;  3IKT A;  2K7L A;  2KKO A;  1Z6R A;  4M71 A;  4CIC A;  1KU9 A;  3J7A O;  2QEN A;  3DPT A;  1T98 A;  3HRS A;  5D4R A;  1KA8 A;  3KFW X;  3RKX A;  1DPU A;  2ETH A;  4OU0 A;  4KIC A;  2IA0 A;  3ECH A;  3CLO A;  1TQI A;  5DYM A;  1YTY A;  1J7K A;  2QQB A;  2XUB A;  1RUO A;  5FLX K;  1B6A A;  3FZV A;  2VBW A;  1R5G A;  1XD7 A;  1XSV A;  4R1H A;  4L18 B;  4R8H A;  4I2O A;  2Y75 A;  4BHC A;  1LQ1 A;  4LK0 F;  3MCZ A;  2XRO A;  3AAF A;  4M72 A;  3L09 A;  1EH8 A;  1SD6 A;  4AIJ A;  5ICC A;  2LSO A;  4CZZ A;  1ON1 A;  1IAW A;  3T0Y A;  1FP1 D;  3LFK A;  4YII A;  4KUM A;  1YW8 A;  1ZGJ A;  3L7W A;  2JZY A;  4XLN F;  3KP2 A;  3KP5 A;  3IKV A;  3WU0 A;  4IHS A;  2Z33 A;  1TW2 A;  4NB5 A;  1S7O A;  4N9H A;  5BOX A;  2DBB A;  1BN5 A;  2HQR A;  2RN7 A;  2XIG A;  4L0Y B;  3HOT A;  1PP8 F;  2KIM A;  1MKM A;  4L5I A;  5E8G A;  3ZQ7 A;  2Y48 A;  3MZH A;  4TV7 A;  2GXB A;  3GFI A;  3RTR A;  1P4X A;  2Q2E A;  4RAZ A;  3TO9 A;  1RUN A;  1YS6 A;  4CXF A;  2EV6 A;  4FX4 A;  2HWV A;  2W57 A;  4MTD A;  3H92 A;  3F23 A;  1XGN A;  2L02 A;  2V6C A;  4RGX A;  4LG0 B;  2VC1 A;  1F5T A;  3RKW A;  4EVI A;  2FNA A;  4ENN A;  5LEJ A;  5JHU A;  3GFM A;  1U5T A;  3ZMV A;  3TDZ C;  4G8X A;  3SFZ A;  2PBI A;  2XGX A;  1W7P B;  3E6D A;  1R36 A;  3F22 A;  4FT8 A;  1BI3 A;  1NHA A;  3E5Q A;  3F8B A;  1FYK A;  4LLN A;  1XGS A;  3KCC A;  2L4A A;  5H6R A;  5JFR A;  4RAY A;  3MWM A;  3ISP A;  1FSE A;  3J80 Z;  2HS5 A;  4HAM A;  5ILV A;  5E1X A;  3GYH X;  2HFH A;  4L0Z B;  4Q47 A;  3K0L A;  3F6V A;  4B8X A;  2L54 A;  4BHB A;  2A07 F;  2F5E A;  2FA5 A;  1QBJ A;  2D1V A;  4UNO A;  1TLH B;  5TRD A;  2IRF G;  4B09 A;  2HOE A;  3GFJ A;  1HW1 A;  4MTE A;  3TDU C;  4CYD A;  4BXU A;  2Z3Y A;  2AXL A;  3QAH A;  1J9I A;  4U0Y A;  3S2W A;  4M9X A;  1E17 A;  1HQC A;  5ICE A;  2M87 A;  1MGT A;  2RGV A;  4S05 A;  1FX7 A;  3KP6 A;  3F8C A;  4IF4 A;  2KRF A;  5FFX A;  2V1X A;  4G7O F;  3LWF A;  4HX4 A;  3I59 A;  5CVR A;  1WKM A;  3R0J A;  4HF0 A;  1LDD A;  1U8R A;  1G4D A;  2EJR A;  2QYO A;  2O3F A;  5HDN A;  3LQQ A;  1T39 A;  1KU7 A;  2A5Y B;  3P9I A;  1MZB A;  1SFE A;  2JPB A;  5DDG A;  2L4M A;  1SD7 A;  4HLX A;  1R7J A;  3HTU A;  2VBX A;  1S29 A;  2ZNZ A;  3J80 K;  3ZMD A;  3R60 A;  4ON0 A;  5BPD A;  1HKT A;  2ISY A;  2NNY A;  1XDU A;  3F8N A;  3GUD A;  3MEX A;  3WU1 B;  2M8E A;  1ZYR F;  1KGS A;  4P5O A;  3FM5 A;  4BYY A;  3K2Z A;  5ED4 A;  1OKR A;  5F64 A;  4QLC U;  4U0W A;  4Y17 A;  4BAY A;  2C6Y A;  2KJB A;  1IN7 A;  1T0F A;  4OIR F;  3KP3 A;  2O8X A;  4XSX F;  2DO7 A;  4FX0 A;  2VT3 A;  3PQK A;  3NQO A;  3HHG A;  1FP2 A;  5F6F A;  5L3G A;  5JVT A;  1ZHF A;  3H3U A;  2XAJ A;  1CF7 B;  5L3D A;  3ECO A;  1OR7 A;  5IT9 Z;  2ZME B;  4GGG A;  3O6B B;  5J8C A;  4G94 A;  4Y15 A;  1D8J A;  2ACJ A;  4OOI A;  3HYI A;  4WXC A;  1O3S A;  1D8K A;  1DP7 P;  1D5V A;  2OZU A;  3FMS A;  4YFN F;  1Z7U A;  4BNC A;  1O3R A;  2F2E A;  3WTU C;  1R23 A;  1ZLJ A;  4UXN A;  5CVJ A;  2L3D A;  4D0P A;  2PEX A;  1L0O C;  2RKH A;  2FOK A;  5DD8 A;  3ZN1 A;  2JPC A;  1FY7 A;  4ESB A;  1UB9 A;  2J5P A;  3R6S A;  5D5X B;  5FD5 A;  2E7W A;  1L3L A;  1TTY A;  1ZH5 A;  1QZZ A;  1BOA A;  3QRF F;  2UXX A;  4G9Y A;  2GZW A;  1PUE E;  1R1T A;  3ZMZ A;  2WWY A;  3WTW C;  1HXD A;  2DK5 A;  1T6S A;  1JHH A;  5FFZ A;  3KEO A;  3I0T A;  2DQL A;  2DAO A;  4KN7 X;  1FYM A;  4MEY F;  3V7C A;  2M30 A;  2JT1 A;  1F9N A;  3QPT A;  4HA8 A;  1EH6 A;  1ON2 A;  1QPM A;  1W7P A;  4A6E A;  5IT9 K;  4FHT A;  2W24 A;  1IN8 A;  1J5Y A;  1GHC A;  3E5U A;  1YQA A;  3P7N A;  1BBY A;  1ZRD A;  4EM2 A;  4JK1 X;  2YSR A;  5E1W A;  1IZ1 A;  4ETS A;  4PCQ A;  2A69 F;  2MD5 A;  3L00 A;  1SD5 A;  2NS0 A;  4A5M A;  2O0Y A;  2EFW A;  4U7D A;  3SQN A;  3FXR A;  1AOY A;  5FLX Z;  1CGP A;  3F8F A;  3ELK A;  2P5L C;  3BRO A;  2P7V B;  2OA4 A;  1EH7 A;  5LLQ A;  2EK5 A;  5CLS A;  6PAX A;  4XLP F;  2GA2 A;  3W6K B;  3WTX C;  3HSR A;  5E8I A;  2MLG A;  2L01 A;  2K27 A;  4XRF A;  2FBH A;  1KYW A;  2ZFW A;  4Q48 A;  4ENM A;  4HF2 A;  2P5K A;  1G3T A;  4I01 A;  4KA4 A;  1AWC A;  1O3T A;  4PZJ A;  1I1G A;  4LD5 A;  5ICF A;  3FM3 A;  4ZYH A;  4CO8 A;  4A5N A;  4EJV A;  1FPQ A;  4OMZ A;  1UCR A;  3G73 A;  2FML A;  1RNL A;  3QU3 A;  4A2U A;  2P7C B;  2BYV E;  3M7G A;  4EJU A;  1EV7 A;  5LEK A;  5E17 F;  3IRR A;  2QBY B;  5EEG A;  2OD5 A;  2FRH A;  1JHF A;  2O03 A;  2PQ8 A;  2HGC A;  3I71 A;  4KFC A;  5HS9 A;  1YYV A;  2HQN A;  1W5T A;  3TOB A;  4G7H F;  1SAX A;  2H6C A;  5BMZ A;  1IRF A;  1YG2 A;  4CDG A;  3CUQ C;  5HLG A;  4OIN F;  1YW9 A;  4HF1 A;  3DP7 A;  2JSC A;  4HBL A;  4IRH A;  2QWW A;  2DI3 A;  1BI0 A;  1J0R A;  5LGT A;  2CFX A;  2IT0 A;  4A12 A;  2VC0 A;  4HQE A;  4KMF A;  3Q9S A;  2ELH A;  1DUX C;  3M9A A;  5DV5 A;  3DKW A;  3B73 A;  2DQR A;  5K5O A;  1R58 A;  3BJA A;  2R7F A;  3MZY A;  1WWX A;  2FQ3 A;  4KIF A;  2OBP A;  1H9G A;  2K4J A;  3DV8 A;  1KQ9 A;  2ESN A;  4RGU A;  4KDP A;  1Q1H A;  2CSO A;  4AIK A;  1IXR C;  3IWF A;  4U0V A;  1CF7 A;  4HYE A;  2XRN A;  3FMR A;  3TO6 A;  2ZME A;  1OYI A;  2BBY A;  4IJA A;  3TQN A;  3FXU A;  2ZNY A;  1J75 A;  1BM9 A;  3HRM A;  2Z9O A;  4JQF A;  3NEU A;  2BV6 A;  4P9U A;  2MH9 A;  3BZ6 A;  4RGS A;  4UV8 A;  1I6X A;  4AD9 A;  4M6Y A;  1F1Z A;  3CDH A;  2OZ6 A;  2VN2 A;  2G7U A;  5L3C A;  1T38 A;  1SMY F;  5FO5 A;  2R3S A;  1IUY A;  2LNB A;  3I54 A;  1KQ0 A;  5JI6 A;  3KEQ A;  3VB2 A;  4OIQ F;  2VXZ A;  4RB2 C;  4MEX F;  3GZ6 A;  3WGI A;  1GXQ A;  1I1S A;  4HDV A;  1B59 A;  1XCB A;  1Z6T A;  4O3M A;  3BJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...