2MLGA

Stf76 from the sulfolobus islandicus plasmid-virus pssvx
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
KAKLSLTQLILIRLSNRGCQTLEELEEFTQAKREVLLVTLTRLHQRGVIYRKWRHFSGRKYREYCLKHRDELADLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfolobus transcription factor 76 aminoacid protein, Stf76
publication title Structural and functional studies of Stf76 from the Sulfolobus islandicus plasmid-virus pSSVx: a novel peculiar member of the winged helix-turn-helix transcription factor family.
pubmed doi rcsb
source organism Fuselloviridae
molecule tags Dna binding protein
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2014-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2mlgA00
5BQTA 3N4MA 3BJ6A 4RB1A 3KP5A 3KP3A 2MA3A 3N97A 3ML6A 2F5DA 2IPQX 3WTXC 5F64A 4HF0A 2BGCA 2HYFA 2UXNA 4N9HA 1IXRC 1J7KA 1H9GA 1FBUA 5DD8A 4AWXB 2QWWA 2CSOA 2JPBA 3WTWC 3DKWA 2FU4A 2ZCWA 3FXRA 2G7HA 3DQVC 5D6FA 2Q0OA 2EA4A 2XKOA 4MQVA 1IZ1A 2EFQA 3J80K 3JTGA 4TV7A 1K6OA 3TQNA 1Z91A 5CYVA 3U1DA 5CVVA 4G9YA 2OD5A 1J75A 1DDNA 1TNTA 3HYIA 5L3FA 2XROA 1SD7A 1KU7A 1HKQA 3QPTA 4ESFA 1KU2A 2VONA 3WE3A 1O3SA 3K9TA 4FHTA 1F4KA 4KMFA 2RDPA 4XSZF 1K7AA 4Y13A 3RIRA 5E17F 2ZNYA 3GFJA 3K0LA 2RVCA 2H09A 3IHUA 3BDDA 1KQ8A 2HR3A 3V7SA 4E70A 4BAYA 1ZN2A 4YFKF 2IT0A 1QQIA 1Q1HA 3BJOA 4AIKA 2NYXA 2CW0F 1P4WA 1R5GA 4MEXF 1KYWA 2VN2A 2DAOA 4LB5A 2QLZA 3F6OA 1KU3A 3LQRA 1RI7A 3HOSA 2P8TA 4MNUA 3E5XA 5ILVA 2V1XA 2MLGA 5D5XB 2XKPA 3I64A 2QQAA 4RB0A 3QAHA 1HW2A 3P9KA 1W7PB 4D0PA 3WODF 4HF2A 4WXHA 2HFHA 1SMTA 4QLCU 2FBHA 1HKSA 2L54A 1MKMA 3GXOA 3I5UA 3F8CA 2HOEA 3GW2A 4CICA 3SZPA 4YFXF 4G6DA 1W4MA 2DPUA 2A07F 2IA2A 5HS8A 3SFZA 3T8RA 2OA4A 1UB9A 3BROA 3LWFA 4ZZLA 5IT9Z 2K7LA 1SD4A 4S04A 1EH6A 2M8EA 4O6JA 2DQLA 3GFLA 1LDJA 1R58A 3DV8A 5D6EA 1YS6A 3E5QA 4HX7A 1FOKA 5LHIA 4Q48A 1QZZA 4EVIA 3J81Z 4BHCA 2RN7A 2VBZA 3KP4A 1SMYF 1ZG3A 2QBYA 1QPMA 2A6EF 1ZGAA 4OIPF 5BPDA 4HDVA 4G7HF 4L0ZB 2W84A 3GWZA 1XDUA 2EA2A 2CWEA 3GUDA 2XGXA 4WXCA 3P7NA 2UXXA 2HKXA 1GXQA 2PQ8A 3JSOA 2EFOA 1I6XA 4M9SA 3HIFA 2ETHA 2W57A 3QU6A 2A69F 3ECOA 4ENMA 1P2FA 1MJ9A 3CUQB 4LJZF 1BI3A 1UHMA 2XUBA 1TLHB 5CLSA 3F22A 4PDKA 2BYVE 3GO5A 3G73A 3SXYA 1B9MA 4XLPF 4EJVA 2XASA 3ROUA 3ABTA 2Z9OA 5H6QA 2FQ3A 3F23A 4EGZA 2ZFWA 4P9FA 3ZMSA 4A6DA 3TGNA 3FHZA 2PN6A 3QOPA 2O03A 4MTEA 3WTZA 5DEQA 2EV6A 1AWCA 1YLFA 1E2XA 4WCGA 4HV6A 5A2QK 2IA1A 3Q9VA 3GZ5A 5K5OA 3F21A 4A0ZA 4LB6B 4G94A 3ULQB 3L2CA 3K69A 3V8KA 4U88A 5A2QZ 2ZNZA 2E1CA 1TTYA 5HS7A 1IN7A 1ZGJA 5AONA 2RV8A 4HV5A 5L3BA 1V3FA 2EWNA 2MBFA 3K1NA 4A12A 1OMIA 1X3UA 3WTSC 2Z33A 3GLXA 1REPC 5HDGA 1R7JA 4P55A 2FMLA 1ZYRF 2COMA 2X4HA 1IN5A 1ODDA 3HUGA 4B09A 4P5OA 3I4PA 2P5VA 1O3QA 4HZFA 3RTRA 3HTSB 1G4DA 3TDZC 2UZKA 4BQAA 1YW7A 3BP8A 2ZKZA 1NHAA 1QNTA 2E7XA 2IA0A 1RUNA 1SFXA 2HWVA 5AIPA 3M1EA 2VOOA 5HLHA 1T98A 3KZYA 2CO5A 1B9NA 5LHGA 5EEGA 2P5LC 1WSUA 4LK0F 4UVCA 1FYKA 3GFMA 3E3VA 5K5RA 2V1DA 3KP7A 1P4XA 4KMUX 4RGRA 3CO6C 2P4WA 2KRFA 3FM5A 4RGSA 5E8GA 1CGPA 1W7PA 1TQIA 3FF5A 2DPDA 4IHTA 2VBYA 2R7DA 1FYLA 3R0AA 2GXGA 4IXAA 3ERED 3RDIA 3R4KA 3AAFA 2PG4A 3E5UA 1ZG1A 1FWZA 2KJCA 2J5PA 5CVRA 4DNCA 2ZBKA 1HSJA 4JBAA 3JAMK 2UWMA 3VEPA 3LFKA 1J2XA 3CUOA 1H0MA 1MZBA 4GYGA 2OZUA 1G3SA 1ZRCA 2XAHA 1TQMA 2Z3YA 4BHBA 2L3DA 4A0YA 2F5FA 4GGGA 3NQOA 4MGRA 1K79A 3H3ZA 5KVRA 2ZO4A 5L3GA 1FSEA 1ZLKA 3V7CA 5ILUA 4ZYGA 4LLLA 2PMHA 3HRMA 4ZYEA 2VXZA 4G7ZF 3VFZA 1AOYA 5FD5A 4ESJA 3KLOA 3KZZA 4Q5SF 3LA2A 2FE3A 2AXLA 4OIQF 5BOXA 2STWA 5ICEA 2XAGA 3WU0A 3ZN0A 2EJRA 3P9CA 4M9XA 2A5YB 2VOPA 3ECHA 4FX0A 2D1HA 1G6NA 3BJAA 2RKHA 3CJNA 1J59A 4XBFA 5BPIA 2C6YA 3HTUA 2GA1A 5JVTA 1MDMA 1XMKA 1A04A 1W5TA 2JTVA 1FBSA 2P7VB 1BI0A 4Q47A 1UFMA 4F7ZA 3R0JA 1BI1A 4RGUA 2QENA 2MH9A 3CO7C 1HXDA 2KIMA 1SFUA 3GFIA 5J8FA 2OBPA 4Y15A 1Z05A 2VT2A 5ICGA 5J8CA 5E8IA 3CLOA 4I01A 1FZPB 2W24A 1S29A 4PCQA 1KGSA 1MGTA 5CJ9A 4NB5A 3GZ6A 1K78B 4QWQA 3TO9A 3EETA 5FFXA 1OYIA 5LEJA 2A3SA 4K2EA 2M30A 3FM3A 5LRRA 2HKOA 2XVCA 1T39A 1XGMA 3SQNA 2PI0A 1F9NA 4I7HA 3J80Z 4OU0A 5DV5A 3KEOA 1FPQA 1LVAA 1TBXA 2ISZA 1G3TA 1R1TA 5KK1A 4EGYA 1XCBA 2CFXA 5ILSA 4YIFA 2G7UA 1G3WA 4CXFA 3WTVC 2LNBA 1GXPA 1FT9A 1C0WA 1GHCA 1T2KA 3I59B 2Y75A 4I02A 3F6VA 1SFEA 1HSTA 3IKVA 3VOEA 4CDGA 1JXSA 2VE9A 4AIJA 4LG0B 4A5NA 4HLXA 3HRTA 2WC2A 3DPTA 2QYOA 5K1YA 2GXBA 4I98B 4CZZA 5HLGA 4KDPA 2ESNA 1Z1DA 4KFCA 4UV8A 2KIUA 2PEXA 2HQRA 3REOA 4ZYHA 1LEAA 5E18F 3ABUA 5DCFA 2H94A 4I0AA 1ZRDA 1R36A 2HTJA 2ZJ2A 3ZP5A 3O3KA 5DCMB 1USSA 1T0FA 2IJLA 3MEXA 3QU3A 4KYWA 4ESBA 3HSFA 3LQQA 3I58A 3FX3A 5LGNA 2D45A 3RYRA 3OOPA 2L4AA 1ZG5A 3F8NA 3ELKA 4ZZDA 1LQ1A 4ETSA 4EV0A 1MJBA 3FXQA 1YIOA 3R60A 2JT1A 2DBBA 2V9VA 3KCCA 4KIBA 3LAPA 3IRRA 1J9IA 1B59A 5CVUA 4RS8A 2GAUA 2Q8KA 3T8TA 3U2RA 3COAC 5E1ZB 5HLIA 2X0LA 5LEKA 3E6BA 3Q9SA 2ACJA 4IRIA 4XRFA 1KU9A 5TJJA 4ENKA 4N0BA 2M1BA 3O2PE 1YS7A 4BYYA 2QQBA 4MQ9F 4FX4A 1TQPA 4LLGF 4HLYA 5D5UB 4U7DA 2ISYA 4A0XA 2XAFA 1LDDA 1BIBA 2JZYA 2GWRA 3EQLF 4UV9A 5AIQA 4EMSA 1XDSA 1HKTA 1U5TA 4O3MA 1FLIA 1YW8A 2QVOA 2XRNA 3WG9A 4GXOA 3KETA 2QUFA 4LLNA 1CF7A 3HSRA 1FX7A 4M72A 1P92A 2PBIA 3HRUA 1U8RA 2VC1A 3GX4X 3ZN1A 5JI6A 3WTYC 2JRTA 2EB7A 4OINF 2ESHA 2M45A 2CQKA 3L9FA 5HS9A 4ASNA 3QRFF 4HAMA 4KN4X 4P96A 5EEHA 1JHHA 2A61A 2NAZA 5FLXK 4BNCA 2YX7A 2YPRA 3WTTC 1XMAA 2DLLA 4GCVA 2XHKA 2DT5A 4WX9A 4UNOA 3KE2A 4ENJA 3PQJA 5BMZA 3W6KB 4EQQA 5FLXZ 2HYGD 5IT3A 4ON0A 2MC3A 1IW7F 5ICFA 4KA4A 3E6CC 1MD0A 1LB2A 3KFWX 2CGPA 3JTHA 2P7CB 5E1XA 1FP2A 4IF4A 2KKOA 3I0TA 1I27A 1HW1A 2L02A 1FC3A 1XN7A 2NNNA 2GQQA 4HBLA 2HQNA 2Y48A 3CDHA 4LFUA 5D5VB 2FEZA 4IPAA 5HVQC 1R5HA 3H92A 1S6LA 3ISPA 3DF8A 1U2WA 2Q2EA 3TKYA 1PP8F 1U3EM 1FBQA 4L9NA 3OV8A 2BBYA 4KIGA 2VODA 3I59A 5DUIA 3LA7A 4MTDA 3QPHA 2FA5A 4HX4A 2H6BA 4BH9A 3ZMVA 2LSOA 1BJAA 1ZREA 2LF7A 5CVIA 3ZMUA 4L9TA 1QGPA 4PZJA 1YG2A 4UHTA 4IVNA 2RGVA 2ZXJA 1TNSA 1SD5A 3C3WA 4HA8A 3V8JA 1YW9A 3WGIA 4YIIA 5FGMA 3V7RA 1IRGA 1F5TA 3M8FA 1FSHA 5D5WB 1UHWA 4XLNF 2PFBA 4EM1A 3RKWA 3KP6A 3TO6A 3RJPA 2FBIA 2G9WA 2OQRA 4MEYF 1FYMA 4L0YB 5DCMA 2DTRA 1BC7C 3DFGA 3M7GA 1Z9CA 1QBJA 4KNYA 2LF8A 2Z99A 2PMUA 3G3ZA 4RB2C 1MJAA 5JFRA 2LKPA 2FOKA 3KEQA 5JR3A 1J0RA 5FO5A 5DD4A 3H3UA 1FNNA 5ED4A 2O0YA 2R3SA 2EV5A 2WWYA 3RPUA 5K5QA 4GYIA 2DU9A 4WF2A 4L18B 1I5ZA 4KT5C 1RNLA 4CGZA 2BE5F 4EJOA 5H6RA 4IHSA 2P5KA 2YX4A 1RIOH 2CYYA 1V4RA 2A68F 3JAMZ 2Y0MA 1IRFA 1P4AA 4O5VA 3MCZA 2ZMEB 4M6XA 4LMYA 1BC8C 2F5EA 1IN6A 1Z6TA 2PLYA 5FFZA 1R00A 3HHHA 4MHGA 3W6JB 3HRSA 1BIAA 2JPCA 4NHJA 4U7BA 1XD7A 2FMYA 5H20A 2EK5A 3T1BA 4OIOF 3GEZA 1BM9A 3DP7A 3VODA 1UCRA 1H9TA 3BOQA 2DW4A 1L0OC 1FP1D 3F8FA 3KP2A 4L5IA 4JK1X 4UXNA 4WK8F 4EM2A 4P9UA 3J7AO 1G3YA 2V6CA 2NRAC 2K4JA 2JSCA 1O57A 4HW0A 1IXSB 1TW3A 3DXJF 3CUQA 2VC0A 1KQ0A 2K4BA 3FMSA 3E6DA 5HOOA 4KICA 1PUEE 2FSWA 3K1MA 1W5SA 1LJ9A 4Q4ZF 3V8LA 2H6CA 1DPRA 2GIVA 1O7LA 1USTA 1R1UA 1Y0UA 1OPCA 3TDUC 2HZTA 3B02A 1ZAOA 1XGNA 2P6TA 1LDKB 2L4MA 2IP2A 4OMYA 5L3EA 1I1GA 1D5VA 3F8MA 2IVMA 3L7WA 2LDUA 4BXUA 2HEOA 2O6GE 1RZ4A 3F8BA 2OAZA 2BEOA 1T6SA 1ZLJA 1WQ2A 4HX8A 4IJAA 4HF1A 2P6SA 3BY6A 3MZYA 4RGXA 1R22A 4ZYDA 5JHUA 2QZ8A 4L5JA 1EH8A 2E1NA 1QZYA 3LSTA 1U5TC 2V79A 5DYMA 2NS0A 3FMRA 3Q5FA 4PGGA 2RC4A 2FNAA 1FY7A 1U78A 3R61A 3R6SA 4HQMA 4A6EA 1JHFA 4H0EA 1WWXA 4JQFA 1S7AA 5LRSA 4OIRF 1O3RA 3I54A 3U9GA 2E7WA 3EUHA 3FWEA 4EJWA 1J5YA 1BBYA 4I0BA 1S7OA 5TRDA 4KN7X 2M87A 4HDUA 2STTA 3JSPA 4HYEA 4M74A 1IN4A 1KA8A 3DPLC 5L3DA 3EDPA 4I09A 3L00A 1SAXA 2RNJA 2CG4A 2XIGA 5HDNA 5E20A 5ICCA 1WI9A 3TO7A 3MAJA 3ZQ7A 1XSDA 3BWGA 2MD5A 4Z2YA 1ZHFA 2VBWA 4U0VA 2J5OA 1I1SA 2ELHA 1LEBA 1IN8A 5D8LB 3PFIA 2DK8A 5ERIA 3MZHA 3IKTA 2VT3A 2FRHA 1ZRFA 2FXAA 4I2OA 5D8KB 1F1ZA 2HTSA 2K27A 1KYZA 5F1RA 5IT9K 3P9IA 2R7FA 4R79A 2IW5A 4ENNA 1VTNC 4IRGA 5F6FA 3TOAA 4BHPA 3GVAA 5DDGA 4RB3C 2ZMEA 4OOIA 3V4GA 2OU2A 3C7JA 2MLKA 3J81K 1HBXG 3BPXA 4FT8A 3D5LA 1P6RA 1TW2A 5D4SA 1OYYA 1S3JA 5LBQA 1W7PD 1D8JA 3RKYA 3ZPLA 5CVJA 6PAXA 3MFKA 1XB4A 2WV0A 4EM0B 1IF1A 1B6AA 4AD9A 1YFHA 3M9AA 4KUMA 4M9ZA 1XSVA 2EFNA 1S8NA 2D2WA 2EFWA 3L09A 1B4AA 2DO7A 4IRHA 3SZTA 3WGHA 3O6BB 2W85A 3HOTA 2B0LA 2PJPA 1YO5C 1EH7A 4UUVA 1OR7A 2Z5UA 1YYVA 3BPVA 1Z7UA 4WWCA 3DEUA 1IAWA 5L3CA 5LGTA 4HOBA 3S2WA 2YU3A 1ON1A 2F2EA 1MDMB 4KIFA 2OQGA 3FZVA 4G8XA 1WKMA 3WE2A 3RI4A 2V1UA 3K1PA 4A2UA 2HDCA 2W25A 4L9JA 3HSEA 5J6XA 4YFNF 1K78A 1XCVA 1XSXA 3IWFA 3WTUC 3LA3A 1D8KA 2O61A 3FXUA 2QM3A 1DP7P 3ZMDA 5LGUA 4L9VA 4N9IA 4NQWA 1HQCA 2FF4A 3E6MA 2DK5A 4UVBA 3IC7A 3RYPA 1PDNC 1JGSA 1STZA 1Z6RA 3GF2A 4LK1F 4M73A 1U6GA 1BOAA 1EV7A 4M6YA 3EYYA 1L3LA 2DI3A 1XGSA 3ZMTA 4EJUA 2EV0A 2OZ6A 1WRJA 5DUKA 3HHGA 5E1WA 5LHHA 2WTEA 4LG0A 2YR2A 2O3FA 3CUQC 5FD6A 3IWZA 2K02A 3JW4A 2IRFG 3IL2A 3M8EA 2KIFA 4S05A 3C1DA 3QP6A 2VBXA 3E97A 1DPUA 1DUXC 5BS6A 3MWMA 3NEUA 2M5WA 3F72A 3T5XA 2F5CA 1SD6A 1IUYA 2ADUA 2FNPA 4DQ2A 2AS5F 4CYDA 2DQRA 2NNYA 2D1VA 2K86A 5FB2A 3EYIA 5LLQA 1R23A 3RKXA 4WXDA 1O3TA 2EFPA 4YG2F 1XGOA 3MQ0A 2O8XA 5HDKA 4R8HA 3ZMZA 4CHUA 4XSXF 2DFIA 3WGGA 2HGCA 3VB2A 1LNWA 4RAYA 3I53A 3T0YA 4LGWA 1KQ9A 4UVAA 3KLNA 1YTYA 1B1BA 2YSRA 2XAQA 2A6HF 3TOBA 4CO8A 2BV6A 2VE8A 4PGHA 1JE8A 2QQ9A 1IXCA 4AVPA 4ZH4F 4AIHA 1O7FA 3GYHX 1QO0D 4EJTA 1T38A 5D4RA 1RUOA 1OKRA 2GA2A 2HS5A 3FMQA 3D0SA 2H27A 1D3YA 3BZ6A 4B8XA 1YQAA 2KJBA 3B73A 3F3XA 4RAZA 4A5MA 4GO1A 1R1VA 3PQKA 3I71A 4LD5A 1BN5A 1OYWA 2MH2A 2GZWA 2QBYB 4Y17A 3RPQA 4U0YA 1ZH5A 1U5TB 2RQPA 3NRVA 3SHFA 1BI2A 1HW5A 4G7OF 1CF7B 2XV4S 3CTAA 4R1HA 3LAJA 1GVJA 1ON2A 1ZARA 4M71A 4HQEA 3IRQA 3WU1B 1PP7U 1E17A 2XAJA 1ONVA 3K2ZA 4U0WA 1ULYA 4OMZA 4G6QA 2L01A 3C18A 3QP5A 2TDXA 2FBKA
chains in the Genus database with same CATH superfamily
5BQTA 4XM3A 4FE4A 3N4MA 3BJ6A 4RB1A 2OPTA 3KP5A 3KP3A 1WGXA 2MA3A 2ZXIA 4DJAA 3N97A 2BY1A 3ML6A 2F5DA 2IPQX 2VQLA 3U1KA 3WTXC 1ETOA 3HG9A 4HF0A 5F64A 4F93B 2BGCA 4M3EA 2FUG2 2HYFA 2UXNA 2M34A 4N9HA 1IXRC 1J7KA 1H9GA 1FBUA 5DD8A 4AWXB 3S93A 1TZLA 2QWWA 1QVUA 2DMQA 3MD2A 2CSOA 2JPBA 2LOOA 3BG6A 4PJ0C 4CUGA 3S3OA 3WTWC 2ZMEC 3QYFA 3DKWA 2KRCA 3TW7A 2FU4A 2ZCWA 3ZQLA 3TMOA 2CRGA 3FXRA 2G7HA 3Q0UA 3ZQHA 2PMZN 1V54H 3DQVC 1Z3YA 2ZSHB 5D6FA 2Q0OA 1VQ8I 2EA4A 2MC4A 1ETQA 1IV8A 1POGA 2XKOA 1TWAJ 4MQVA 1OJLA 1IZ1A 3GTJJ 2EFQA 3ASOH 5FRNA 3J80K 2DJIA 3JTGA 4TV7A 1K6OA 3TQNA 1XG1A 1Z91A 2LY1A 4BE0A 2KMUA 4F92B 1GUUA 5CYVA 1LFBA 3ABLH 3U1DA 5CVVA 4G9YA 2OD5A 2EH3A 1J75A 1U0JA 3LFUA 1DDNA 2LD5A 1TNTA 2CW8A 3HYIA 3HDDA 4JX4A 5L3FA 4B3AA 2XROA 4I6ZA 2EBIA 1P9QC 1SD7A 2IGOA 5IYCJ 1KU7A 3GTOJ 1HKQA 1UJ8A 1VQNI 3QPTA 4ESFA 2LK2A 1KU2A 2VONA 4OAYA 3WE3A 2Q2EB 5TGTA 5JLWA 1O3SA 1WJCA 2R5ZB 2YS9A 3K9TA 4FHTA 5C3EJ 1F4KA 2RDPA 1M1EB 3DEEA 1UMQA 3LSKA 4XSZF 2UUZA 1J09A 1OR7C 3Q3SA 1K7AA 3AL0C 4Y13A 2IS2A 3RIRA 5E17F 3CD6I 2ZNYA 3FXLA 2BZTA 3GFJA 4PUSA 5E79C 3K0LA 2RVCA 2H09A 3IHUA 3BDDA 3WHBA 1KQ8A 2HR3A 1D1CA 3HM5A 4ZYAA 3V7SA 4E70A 2VPLA 2L9SA 4BAYA 1ZN2A 4YFKF 3I9V2 4IQ4A 1YX5A 2IT0A 1E3HA 1QQIA 1Q1HA 3BJOA 2CU7A 4AIKA 2LBFB 2NYXA 4HPQA 2CW0F 1P4WA 3TBIA 1R5GA 4XQFA 1X1AA 4MEXF 1ORKA 1KYWA 2DJNA 4V2FA 2VN2A 5DS9A 2R7TA 2DAOA 4LB5A 2QLZA 3K6GA 2K9MA 2XGCA 3F6OA 1DP3A 2IGNA 3BLYA 4MIMA 3G6EI 1KU3A 2W4SA 3LQRA 5GAGJ 1RI7A 3HOSA 1BR2A 2H8WA 2X6XA 2P8TA 2DXIA 4MNUA 3MKYB 4BQQA 3E5XA 5C44J 1VQ4I 5ILVA 2V1XA 1YIJI 2MLGA 5D5XB 2XKPA 3I64A 2QQAA 4RB0A 3QAHA 1HW2A 3DPUA 4E7ZA 2EIMH 4XRSA 5IPAA 3OYFA 3P9KA 1W7PB 4D0PA 3OYMA 5FLMJ 3WODF 5IY5H 3CCLI 3DLLF 3G1LA 4HF2A 3CJQB 4WXHA 3ZQIA 2HFHA 4XR6A 1SMTA 4QLCU 2FBHA 1EF4A 2V6EA 1JKQC 1RETA 1DU6A 1HKSA 2HXOA 3G4SI 2L54A 1MKMA 3GXOA 4PJMA 3I5UA 3F8CA 2HOEA 3GW2A 2NXNB 4CICA 4BY1J 3SZPA 1UAAA 4HNTA 4YFXF 4G6DA 2BXZA 1W4MA 3BCAA 2DPUA 2A07F 2TCTA 3PIPF 2IA2A 4BU2A 5HS8A 3CCSI 4GRIA 3SFZA 3T8RA 2KDZA 2OA4A 5DTDA 1UB9A 3BROA 2ID3A 3A0HC 3LWFA 4ZZLA 1K4SA 5IT9Z 2QCOA 4C2TA 2JA2A 2K7LA 3HGYA 1SD4A 5EDNA 3M4OJ 4S04A 1EH6A 2IEKA 2M8EA 4O6JA 2DQLA 3GFLA 4XMYA 1LDJA 1ETWA 1R58A 4YEJA 3DV8A 5EZGA 2XGDA 3L2WA 5D6EA 1YS6A 3E5QA 4XN0A 4NDLA 4HX7A 4BDZA 1VFCA 1FOKA 5LHIA 4Q48A 1QZZA 3CDIA 4EVIA 3J81Z 4BHCA 4BDYA 1MBJA 3L2RA 2RN7A 1OLTA 3SFIA 4S0HB 2YUSA 2VBZA 3ZR8X 3KP4A 1SMYF 3CDLA 1ZG3A 2P0WA 3V42A 3BT9A 1P7IA 4CSWA 1QPMA 2QBYA 2L7MP 2A6EF 1X4OA 1ZGAA 5LD2C 3HOUJ 4OIPF 2WAQA 2ELJA 1ZK8A 4HDVA 4G7HF 5BPDA 4L0ZB 2W84A 3GWZA 1XDUA 5J47A 1Y6IA 2M8GX 2EA2A 1WJDA 2CWEA 1SC7A 3GUDA 3SEQA 3RPUD 1W1WE 2XGXA 2HVQA 4WXCA 3P7NA 4XL9A 2DN0A 2JK3A 3GMEA 3HEFA 5FLVA 2EZIA 4JP0A 1TWGJ 2L5QA 2HKXA 2UXXA 4BQNA 1TC3C 1MMAA 2LMDA 4F52A 3X2QH 2F5VA 3AG3H 1GXQA 2PQ8A 3DCFA 5EYRA 3JSOA 2IS6A 2EFOA 1I6XA 4M9SA 2M9HA 3HIFA 2ETHA 1I50J 2VPRA 4M6VA 2W57A 1VQLI 3QU6A 2A69F 3ECOA 4ENMA 1P2FA 1MJ9A 1MBFA 3CUQB 4LJZF 1BI3A 1UHMA 2XUBA 1HC8A 1TLHB 5CLSA 3F22A 4PDKA 2BYVE 2H1KA 5IOYA 2E1MC 3GO5A 5BNGA 1K6YA 5B3SH 3G73A 2ZFUA 3A03A 4MFDA 3SXYA 1B9MA 4XLPF 2E19A 4XNFA 4EJVA 2XASA 3ROUA 2L2OA 3ABTA 2Z9OA 5H6QA 2BVLA 3CMMA 2FQ3A 4JOMA 3F23A 5M3MJ 2Y69H 4EGZA 2ZFWA 4P9FA 3ZMSA 4A6DA 5IOZA 2KT0A 3WHCA 2IS1A 3NWSA 5CQEA 3TGNA 1T8IA 4AYBA 3FHZA 2PN6A 1X58A 3QOPA 3OY9A 2O03A 4W97A 3VPRA 4MTEA 3WTZA 1H8AC 1MSEC 1OCZH 5DEQA 1G59A 2EV6A 1XTAA 5IYBJ 1V5EA 2WY8Q 1AWCA 1YLFA 1E2XA 2VJIA 2VQGA 3RQ4A 4WCGA 2RAEA 4DBQA 2XRLA 3I4NJ 3AG1H 2X48A 3FXKA 4HV6A 5A2QK 2IA1A 2HVRA 3Q9VA 3GZ5A 5K5OA 3IH3A 3LSHA 3F21A 1VQOI 4A0ZA 3VYSB 4LB6B 3G2BA 1LE8B 4G94A 3ULQB 3ONQA 3SZGA 2JN6A 4B48A 3OYBA 3SDGA 4D9JA 3L2CA 4CYCB 3K69A 3V8KA 1R71A 5GAHJ 3PJRA 3FK7A 3H0GJ 4U88A 2BXYA 3DTKA 5A2QZ 2ZNZA 2E1CA 1TTYA 4XORA 5HS7A 1IN7A 2EINH 1ZGJA 3K4KA 5AONA 2RV8A 4HV5A 1R5ID 5L3BA 3S1QJ 1V3FA 2XC7A 2EWNA 1SAUA 2WADA 4F55A 2MBFA 2OF7A 3K1NA 4A12A 1OMIA 1X3UA 3WTSC 3NAUA 4AC0A 2Z33A 1ERDA 3GLXA 4FCYA 2L9RA 1HOMA 1REPC 5HDGA 1R7JA 4P55A 2FMLA 1ZYRF 2COMA 4Y4RA 2X4HA 2KP6A 1IN5A 1ODDA 2V7FA 1MW7A 3HUGA 4OAZA 4B09A 3QQAA 1MNDA 4P5OA 3VSKA 2CQQA 3HKZN 3I4PA 2DFHA 2P5VA 4HG2A 4IQJA 5F04A 1BJZA 1O3QA 4HZFA 1TWHJ 3RTRA 3HTSB 4L5EA 1G4DA 3S17J 3TDZC 2UZKA 3OIPA 4BQAA 1YW7A 4NUBA 1S72I 5TISC 3BP8A 3PFYA 3GTLJ 3LSRA 3QODA 5GAEJ 2QA4I 2K9NA 3IAM2 2LBFA 3DBRB 2ZKZA 1NHAA 1QNTA 2E7XA 2IA0A 1RUNA 1SFXA 2HWVA 5AIPA 3M1EA 2VOOA 5HLHA 1T98A 2L0KA 3KZYA 4EATA 1FIAA 2OUMA 2CO5A 1B9NA 3G71I 4UUSB 1YJ9I 5LHGA 3AG4H 4B43A 3Q0VA 5EEGA 5EGOA 2P5LC 1WSUA 4LK0F 4UVCA 1FYKA 5EZHA 2L7FP 3S1NJ 1SEUA 3GFMA 3E3VA 5K5RA 2V1DA 3KP7A 1P4XA 4KMUX 4RGRA 3BR3A 3CO6C 2P4WA 1A5JA 2KRFA 4PSXA 3FM5A 4PFOA 5F0HA 4D7NA 4RGSA 5E8GA 4ZDOA 3FDYA 1NH3A 5H2FC 1CGPA 3W2AA 4IEJA 2NVTJ 1JUMA 4AVZA 4C3HJ 1W7PA 3JRAA 1TQIA 3FF5A 1CQTA 1YRNB 1EA3A 1YJWI 2DPDA 2DOFA 3KYCB 1LFPA 2VBYA 1BW6A 3NWTA 4IHTA 1ETYA 2KFDA 2QKLB 5J3LA 2R7DA 1FYLA 2JUCA 3R0AA 2GXGA 1MBGA 4IXAA 3RDIA 3ERED 3R4KA 3AAFA 2PG4A 3E5UA 3E0JB 2GOXB 1E0EA 5CPRB 2O9LA 2DMPA 1ZG1A 2HDDA 4W1UA 3EPZA 3ZQQA 2F4OB 1FWZA 4XK4A 1G2HA 2KJCA 2J5PA 1W0UA 5CVRA 3F9KA 2L7ZA 4DNCA 2ZBKA 1HSJA 4JBAA 2FOWA 3JAMK 2UWMA 3VEPA 2DCEA 3BQZA 3LFKA 3O8HA 1HF0A 1J2XA 3CUOA 3OYLA 1H0MA 1MZBA 3HB9A 4GYGA 2VKEA 3OMYA 1RR7A 2KPMA 2OZUA 2H8RA 1G3SA 2HNHA 2DOEA 2X1DA 1ZRCA 2XAHA 1FIPA 3OL4A 3JRBA 2TRTA 4AUXA 4A69C 1TQMA 2Z3YA 2R7WA 1JT0A 3MKLA 4BHBA 2L3DA 4A0YA 2F5FA 4GGGA 3NQOA 4MGRA 4XLAA 1K79A 3H3ZA 5KVRA 2ZO4A 2ME0A 5L3GA 1FSEA 3PL8A 1WJBA 3W2VA 1ZLKA 3V7CA 1XX5A 3CF5F 2DDBA 5ILUA 1JUSA 2CV2A 2MSYA 2XSDC 4ZYGA 4LLLA 1S7EA 4OWRB 2R5YA 2XF7A 2PMHA 3OSFA 2CJJA 2E1OA 3HRMA 2R7RA 1QA6A 3D5SC 4M3BA 4ZYEA 2VXZA 4G7ZF 2NVXJ 2R7ZJ 3VFZA 2GLOA 2CV0A 3BR5A 5KAIC 1AOYA 5FD5A 4ESJA 2NOGA 3KLOA 2MFZA 3OYDA 3KZZA 2WBMA 4BS9A 4Q5SF 3LA2A 4HNVA 2HU9A 2FE3A 2AXLA 4OIQF 1ZKGA 5BOXA 2STWA 5ICEA 2XAGA 3WU0A 3ZN0A 1T33A 2EJRA 4RA2A 2E36A 3P9CA 3PSFA 2EZHA 4M9XA 2A5YB 5E3NA 2VOPA 3ECHA 2Y9ZA 4IOAF 2I5UA 4FX0A 1VQKI 2D1HA 1G6NA 3BJAA 4I76A 1JKPC 1IV6A 1B72B 2RKHA 1N77A 1FEXA 3CJNA 3ZGKA 1J59A 4XBFA 5BPIA 1U8BA 2C6YA 3HTUA 1N25A 3OOUA 4JYKA 2VJJA 4G6TB 2GA1A 5JVTA 3L2VA 2ZC2A 1TWCJ 1MDMA 1XMKA 1A04A 1W5TA 2JTVA 1FBSA 3AFHA 3GTQJ 2P7VB 1D5YA 1BI0A 1MMDA 2QSFX 4Q47A 1UFMA 4F7ZA 3R0JA 1BI1A 3SYTA 5GADJ 1R4MB 3BTJA 4RGUA 2QENA 2MH9A 3WU2C 2WAEA 4C9YA 3CO7C 2KRHA 3OYAA 1HXDA 1UELB 2KIMA 2QEXI 5FKLA 4D5FA 4II2A 2VIXA 5HNFA 3GFIA 1SFUA 3BR1A 5M5WJ 5J8FA 2OBPA 4Y15A 2XB0X 4I99C 2HQAA 1Z05A 3BG9A 2GM4A 2ECBA 3TP0A 2VT2A 3S16J 3QPSA 2BHYA 3MZ8A 5ICGA 3FHNA 4XLEA 2B9SA 5J8CA 3PO2J 5E8IA 3CLOA 4UY8I 3H5RA 4I01A 1FZPB 3IAS2 1N78A 2W24A 1S29A 2DA5A 1LE8A 3DU6A 4PCQA 1KGSA 2Z16A 1NTCA 4IZZA 1MGTA 5CJ9A 4A93J 4Y3OA 4CCKA 4NB5A 3K7AJ 3GZ6A 1K78B 4QWQA 3TO9A 4B4CA 4BXXJ 3GTGJ 1HDPA 2E34A 3EETA 5FFXA 1Y56A 4IOCF 2K40A 1OYIA 4CH7A 5LEJA 2A3SA 4K2EA 4V19K 2DT6A 2M30A 3LL7A 4FETA 3KIOA 3FM3A 5LRRA 1RR8C 4PJNA 2IBDA 2HKOA 2XVCA 1RRJA 1T39A 1XGMA 2JJ7A 4LITA 5K7ZA 3SQNA 2PI0A 2EIJH 2RNGA 1F9NA 4I7HA 3KZIC 2HDWA 4OU0A 3K4BA 2HI3A 4ABZA 3J80Z 5DV5A 4CA0A 3HOXJ 3KEOA 2ZXWH 1FPQA 2CUEA 1LVAA 1Z21A 1TBXA 2ISZA 1G3TA 1R1TA 1XC5A 2MABA 5KK1A 4F91B 1NK3P 4FE7A 2EPFA 4EGYA 1XCBA 4BBSJ 4A3KJ 2CFXA 3C2HA 5ILSA 5K7FA 2XAUA 1B8IB 4YIFA 2G7UA 1G3WA 2Y0SN 4CXFA 3WTVC 2A5WA 3KEYA 2LNBA 1GXPA 1FT9A 1C0WA 1GHCA 1Z67A 3CLQA 1T2KA 2VLAA 2VQCA 3I59B 2JA5J 1XMXA 5HODA 2Y75A 4I02A 3ESWB 2HZDA 3F6VA 1SFEA 2OCEA 1V5FA 1HSTA 3IKVA 3VOEA 1LKXA 4CDGA 1JXSA 2CUJA 4BL0B 2VE9A 4AIJA 4LG0B 4A5NA 1JT6A 4HLXA 3HRTA 2NS8A 1Z0XA 2WC2A 3DPTA 2QYOA 4N4NB 5CKTA 2HQ5A 5IP9J 5K1YA 2GXBA 4FISA 4I98B 4CZZA 5HLGA 2M2EA 2HOTA 4QPOA 1NK2P 4KDPA 2ESNA 1Z1DA 4KFCA 2NS7A 3JRGA 2R7UA 4UV8A 2KIUA 1X19A 2PEXA 3ABKH 1AU7A 1XPXA 1IRXA 2OTJI 2HQRA 3REOA 3OIOA 4ZYHA 4NC8A 1LEAA 2ID6A 5E18F 4X0GA 2QF7A 3ABUA 2L7KA 3PNTA 2H94A 2Z2SB 4YELA 5DCFA 4ZDLA 1W0TA 4FASD 2LVSA 4I0AA 4M3DA 1ZRDA 1R36A 2HTJA 2ZJ2A 4XIDA 3ZP5A 3O3KA 5DCMB 1USSA 1T0FA 4BBRJ 2IJLA 3MEXA 5JLXA 2DODA 3QU3A 2WB1N 3RQIA 4KYWA 4ESBA 3HSFA 1MNEA 1S9HA 1WH5A 2V1NA 3LQQA 3ZXSA 5C4XJ 3I58A 3FX3A 4DYQA 3FBNB 4A3DJ 4PK4A 2LYCA 5LGNA 1Y0NA 2BW3A 1YJNI 1K61A 2D45A 3RYRA 4FTHA 3ZQGA 3OOPA 2PX9A 2L4AA 1ZG5A 2DMUA 3F8NA 3ELKA 1WHUA 1Y1VJ 2DMTA 4QSHA 4ZZDA 1LQ1A 4P1WA 4ETSA 4LIUA 4ZTFA 4EV0A 1MJBA 5GPCA 3FXQA 4J19A 1YIOA 4PJLA 3R60A 2JT1A 2DBBA 1O4XA 2E1MB 2LY9A 2V9VA 2GOMA 3KCCA 1E3PA 5EG0A 4KIBA 3LAPA 4IHVA 3IRRA 1J9IA 1B59A 3HJEA 5CVUA 4RS8A 3CMYA 2GAUA 2Q8KA 1BL0A 3T8TA 3U2RA 3COAC 3HKZA 3LSPA 4A3LJ 3CCRI 4Z6YA 5GTIC 1I39A 4RMNA 5E1ZB 5HLIA 3GTKJ 2X0LA 5LEKA 3E6BA 3AG2H 3Q9SA 3CCJI 2ACJA 4IRIA 2WA0A 4XRFA 1KU9A 1R9TJ 4AM3A 2AO9A 2M0CA 3ASNH 1W5CC 3S8PA 5TJJA 4ENKA 1W36D 3FIWA 4N0BA 2M1BA 3O2PE 3GTMJ 3TEDA 1YS7A 4BYYA 1OFCX 4B44A 1JUPA 2KQRA 2QQBA 4A3EJ 4NC7A 4MQ9F 4FX4A 1GT0C 1TQPA 4LLGF 4HLYA 3PIOF 2JVHA 1AKHA 2W00A 5D5UB 4U7DA 2ISYA 4A0XA 3JRHA 4UB6C 2XAFA 2R7VA 4N4OB 1LDDA 1BIBA 2OV7A 1D0XA 2JZYA 3ZQCA 2GWRA 3QOEA 3EQLF 3HZJA 4UV9A 1T56A 5AIQA 3SDBA 4EMSA 1XDSA 3CC7I 5FKKA 1HKTA 1U5TA 3RCOA 1PUFA 1NG7A 3DKXA 2G0EA 3KX2A 4O3MA 1FLIA 1YW8A 2QVOA 2XRNA 3WG9A 4GXOA 5K7HA 3KETA 1IC8A 2QUFA 1W36C 1LPQA 4LLNA 1IJWC 3BR0A 1CF7A 2BVMA 3HSRA 1FX7A 2IAIA 4M72A 1Z3XA 1KONA 2X6WA 1BR1A 1P92A 2PBIA 3HRUA 1U8RA 3VSLA 2QSGX 2VC1A 2JSPA 3IH2A 1SVOA 3GX4X 3ZN1A 5JI6A 3WTYC 2JRTA 2EB7A 2Y31A 4OINF 3S1MJ 5DM6F 2ESHA 1U9OA 2M45A 1Y39A 2CQKA 1IG7A 1A35A 4QPQA 1F43A 4RAFA 2ICWG 1OCOH 3L9FA 3VYRB 5HS9A 4ASNA 3LSGA 3QRFF 1RESA 1ETXA 5B1AH 3P5JA 2Z1DA 4HAMA 4KN4X 2DYSH 3PUBA 3H9JA 4P96A 3WG7H 1YOVB 1JHHA 5EEHA 4Y7NJ 2A61A 3DBLB 1PVEA 1MH4A 2NAZA 5FLXK 2X1CA 2MW8A 4DYRA 4BNCA 2YX7A 3D5RC 5F0CA 2K3FA 3IV5A 2YPRA 3WTTC 1XMAA 3CCYA 2DLLA 3CZ6A 4GCVA 4GDFA 3OYKA 3S32A 2LH9A 2XHKA 4IX7A 2QQ8A 2VB6A 2DT5A 1HDDC 4XLFA 4WX9A 2M7AA 2ZB9A 3L2UA 4UNOA 3KE2A 4XKCA 4YRVA 4ENJA 2NVUB 3PQJA 5BMZA 2O5RA 2H1LA 2EQRA 3W6KB 2A6TA 4EQQA 5FLXZ 2DOAA 2HYGD 5IT3A 1VQMI 4BQOA 4ON0A 2MC3A 1IW7F 5ICFA 1WCMJ 4KA4A 3E6CC 1MD0A 1LB2A 3DWLE 3KFWX 4IL6C 2CGPA 2R0QC 4A3GJ 3HPHA 2JUGA 4KITB 4XLCA 5J1RA 3JTHA 2P7CB 2MYSA 5E1XA 1FP2A 4IF4A 2MG4A 4KT6A 5FJ8J 2KKOA 3I0TA 1I27A 1HW1A 2DDAA 2KZGA 5FRMA 4NBQA 1R6RA 3FXMA 2GIZA 2B63J 1BW5A 4BKXA 2L02A 1FC3A 1VI0A 1XN7A 5HNHA 2NNNA 3DTEA 2GQQA 4HBLA 2HQNA 2Y48A 4KMFA 2R7SA 3CDHA 1A31A 4LFUA 4NC6A 5D5VB 3JRCA 2FEZA 1K4TA 4IPAA 2VUMJ 5HVQC 3ZCOA 1R5HA 3H92A 1S6LA 3CESA 4BE2A 3ISPA 3DF8A 1U2WA 2M4GA 1D1BA 2Q2EA 5J1YA 2R5ZA 2K3PA 3TKYA 2VXDA 3W3CA 1U3EM 1FBQA 1PP8F 4L9NA 2DA3A 4A3CJ 1WJ5A 5J4YA 3OV8A 1B8IA 1QU3A 4E7HA 2BBYA 1Q1VA 4KIGA 3SJMA 2VODA 3OS2A 3I59A 3C2BA 5DUIA 2CV1A 3LA7A 3EUAA 1ZELA 2VKVA 4MTDA 3QPHA 2HXIA 4JX5A 2FA5A 4HX4A 4D5CA 2H6BA 4BH9A 3M07A 3ZMVA 2LSOA 3CCQI 1BJAA 1ZREA 2LF7A 2CQNA 2V26A 3K4LA 5CVIA 3ZMUA 4BUPA 4L9TA 4CCLA 1QGPA 4PZJA 1X2MA 1YG2A 2DA1A 4UHTA 3F0CA 2LC2A 1GV5A 4IVNA 3VDXA 1I6HJ 2RGVA 2ZXJA 4IHYA 5FKNA 1V55H 2K9SA 2JRMA 3Q0WA 3OYHA 3OIQA 3S2HJ 1TNSA 1SD5A 2ZSIB 3C3WA 4HA8A 5FKMA 5E3LA 3V8JA 5DM7F 1YW9A 4LG3A 3WGIA 4CCNA 4YIIA 1LVKA 5FGMA 3V7RA 1IRGA 3ZOBA 3MN2A 1VQPI 1ZQ3P 1F5TA 5M3FJ 3M8FA 3GBGA 2XPWA 1FSHA 5D5WB 1UHWA 4XLNF 4NNJA 1VF9A 3OYNA 4C2UA 2EILH 1JKRC 2PFBA 3B6AA 3ZQFA 2KIQA 2K9LA 4EM1A 3RKWA 3KP6A 3TO6A 3RJPA 2FBIA 2G9WA 2OQRA 4MEYF 4B47A 3LSJA 1FYMA 4XOTA 4L0YB 2JVGA 5DCMA 2DTRA 2LG4A 1BC7C 3DFGA 3FXJA 3M7GA 3OS1A 2DA4A 1Z9CA 5J1UA 4XLHA 2F4IA 1QBJA 4DIQA 1QHHD 4KNYA 1QPIA 5C4JJ 2LF8A 2HOSA 3W6VA 3IP4B 2Z99A 3OR1C 2PMUA 3G3ZA 2NOJB 1OCCH 2KISA 4RB2C 3TW6A 2DA2A 2DMNA 1MJAA 2AXTC 5JFRA 2LKPA 2XSJC 2FOKA 1U9NA 3KEQA 5JR3A 2R7QA 3I55I 1J0RA 5FO5A 5DD4A 3UNGC 2JA6J 3H3UA 4DGWB 1FNNA 3CCEI 1SFKA 3L2QA 3CC2I 5ED4A 2O0YA 2R3SA 1HLVA 2EV5A 4DBRA 2WWYA 1OCRH 3C2GA 3RPUA 4D1QA 4MLOA 1IRZA 1GV2A 4RM3A 3BTLA 5K5QA 4GYIA 2E2HJ 2DU9A 4WF2A 1IDZA 2Y0SA 2GBYA 2E60A 4L18B 1I5ZA 4KT5C 3E7LA 1RNLA 3HXLA 4CGZA 2BE5F 1AHDP 2F4MB 3DLAA 2OTLI 4EJOA 5H6RA 4IHSA 2YX4A 2P5KA 1RIOH 2CYYA 1OCPA 1V4RA 2A68F 1ZR2A 3JAMZ 1ACIA 2Y0MA 1IRFA 1P4AA 2OJED 4O5VA 3MCZA 4C3JJ 2LRDA 3UR3C 2ZMEB 1LFUP 2LR8A 4M6XA 4LMYA 4DZJA 3ZRGA 4UUTA 1JGGA 1UZCA 1BC8C 2F5EA 2ZXHA 1IN6A 2FD5A 1Z6TA 2PLYA 2X9DA 1K83J 4LIVA 5FFZA 1R00A 1SANA 2KLOA 3HHHA 4MHGA 3W6JB 3HRSA 1BIAA 9ANTA 4E4HA 2JPCA 3QYBA 4NHJA 4U7BA 3J7AY 2JMWA 2HPMA 1XD7A 2FMYA 5H20A 1H89C 1R4NB 2EK5A 3T1BA 4OIOF 1G8XA 2W7NA 3GEZA 1BM9A 3DP7A 3VODA 4M3FA 1UCRA 1H9TA 3BOQA 2DW4A 1L0OC 1AA7A 3VYUB 1FP1D 3F8FA 3KP2A 4L5IA 4JK1X 4UXNA 4WK8F 4EM2A 2HYJA 1FOYA 3VYTB 4P9UA 1VZ0A 3J7AO 1G3YA 2QGUA 2AHQA 2V6CA 2NRAC 2WB1A 4PSWA 2K4JA 2JSCA 3H36A 3LMMA 2BY3A 2OC6A 2R4GA 5KAFC 1DQUA 1O57A 4HW0A 1IXSB 1T0FC 1TW3A 3GZNB 1WH7A 4ZTJA 3DXJF 3CUQA 3AL0B 2VC0A 1KQ0A 3NARA 2Y2ZA 2K4BA 3KPHA 3CMEI 3FMSA 5IP7J 3E6DA 5HOOA 4KICA 3J7YJ 2LFBA 2UV1A 3OYGA 3FBIB 1PUEE 3K10A 2FSWA 3K1MA 1W5SA 1LJ9A 2DYRH 4Q4ZF 4A3FJ 1QRYA 2K5CA 3V8LA 4Y52J 2CW7A 2H6CA 1FOXA 2M4KA 4C3IJ 3LSMA 1DPRA 2GIVA 3A01B 1O7LA 1OQYA 1A6IA 5B66C 1USTA 1R1UA 1Y0UA 3I3LA 1OPCA 3TDUC 4QIWN 2HZTA 3U21A 3B02A 1ZAOA 1XGNA 1DGRM 3PM1A 2P6TA 2XDVA 4E6KG 1LDKB 2L4MA 2IP2A 1ZGWA 4GFBA 2EZKA 1X4PA 1ENHA 2JQ7A 4OMYA 5L3EA 1I1GA 1RKWA 1UG2A 1D5VA 1MBKA 2XF6A 1BA5A 3F8MA 2IGKA 1MBEA 1X3ZB 2E2JJ 2IVMA 3L7WA 2W48A 1OISA 2LDUA 1I3AA 4IO9F 2GXAA 3LNQA 4X6AJ 4BXUA 2HEOA 4CYCA 2O6GE 1RZ4A 4RDUA 4A3BJ 3LSIA 3F8BA 2OAZA 2BEOA 1T6SA 4A3IJ 1ZLJA 3MKWB 1MMNA 1WQ2A 4HX8A 1VNDA 4IJAA 4HF1A 2R92J 2P6SA 3BY6A 1NG6A 3KYDB 2V9PA 3MZYA 1R22A 4NQWB 4RGXA 1JTXA 5E3MA 4ZYDA 3S3NA 2W1OA 2AQEA 4M3GA 5M5YJ 1TL8A 5JHUA 2QZ8A 3HC7A 4L5JA 1WJEA 1EH8A 2E1NA 1QZYA 2M7BA 3LSTA 1VQ9I 1F36A 4E7SA 1U5TC 2V79A 5FKOA 3JRIA 1WJFA 5DYMA 3FKIJ 4MFEA 2NS0A 1X1PA 2VJ5A 3PNYA 3FMRA 4BACA 3Q5FA 2X6OA 4PGGA 2RC4A 1QVTA 1JKOC 3A4CA 2FNAA 1FY7A 2MD0A 1U78A 3R61A 2QKMB 2COBA 3R6SA 4HQMA 4A6EA 3GCMA 1JHFA 4H0EA 3DU5A 1WWXA 4JQFA 2DT7B 1APLC 3BQYA 1S7AA 5LRSA 2CUFA 4OIRF 1O3RA 3K70D 3PO3J 1JTYA 3A2KA 3I54A 1UG0A 3U9GA 2E7WA 2IXSA 4DW6A 3S2DJ 1Z7LA 3EUHA 2VASA 3FWEA 4EJWA 1T95A 1J5YA 2RREA 3HUGB 1BBYA 4I0BA 1S7OA 4H4KC 5TRDA 2Y30A 4KN7X 2JWTA 2M87A 4G12A 4HDUA 2STTA 1X2NA 3JSPA 4HYEA 4M74A 4HSRA 4UUSA 5J40A 1FOWA 1IN4A 1KA8A 2FX0A 3DPLC 5L3DA 2ZJRF 2NVQJ 3CCUI 3CF2A 3KYLA 3EDPA 4I09A 4BEHB 3L00A 1SAXA 2RNJA 2CG4A 2XIGA 2D5VA 4E7LA 3K70C 2Q1ZB 5HDNA 5E20A 3CP8A 3DTIA 5ICCA 1WI9A 3TO7A 3JCUC 1TT5B 2AQFA 3K2AA 4QTRA 3MAJA 2PJRB 1BR4A 3ZQ7A 1XSDA 3BWGA 2MD5A 4UB8C 4Z2YA 4ITVA 1ZHFA 2VBWA 5EGOB 4U0VA 4E7KA 3HBLA 3TL4X 1YRNA 2J5OA 1GVDA 2CQ7A 3BR2A 3IH4A 1HA8A 1I1SA 3H1CA 2MGQA 3S3MA 3OWTA 2ELHA 5FROA 1LEBA 1IN8A 5D8LB 3PFIA 2VL8A 2DK8A 4LOCA 4BJ5C 2V4JC 5ERIA 3MZHA 3IKTA 2VT3A 2BOLA 4FQGA 3H5AA 2HOAA 2FRHA 1SVLA 1ZRFA 1WVRA 2FJ1A 2FXAA 4I2OA 5D8KB 2HPIA 1F1ZA 3DKYA 3ABMH 2HTSA 2K27A 2I8DA 2EIKH 4II3A 2O7OA 3HOZJ 2V9KA 4BJ6C 2KZVA 3ERMA 1KYZA 3QYEA 2XPUA 5F1RA 2DFEA 3CJTB 5IT9K 1JJ8C 1FMWA 2KL4A 2R7FA 3P9IA 4R79A 2IW5A 1GLNA 4ENNA 2LREA 3K4NA 1VTNC 1SVMA 2X1EA 4IRGA 5LFAA 5F6FA 2K85A 4KJZA 1PYVA 2JA8J 1OCTC 3BTIA 3SEZA 3TOAA 4BHPA 2N8GA 1IO2A 3GVAA 1EKEA 5DDGA 4RB3C 2ZMEA 4OOIA 3V4GA 2OU2A 3C7JA 2R93J 2MLKA 4RBOA 3J81K 3MMYB 1HBXG 2VJ4A 4CCOA 4DYCA 3BPXA 4FT8A 2ECCA 4B3XA 3D5LA 2I10A 2IGMA 1D1AA 1P6RA 1WI3A 1TW2A 5D4SA 1OYYA 1S3JA 5LBQA 4HEA2 1W7PD 4RLQA 4EEFG 1D8JA 3RKYA 3ZPLA 3DBHB 4J01A 3GLLA 5CVJA 6PAXA 3MFKA 1XB4A 3BR6A 3HOYJ 3S1RJ 2WV0A 4EM0B 1IF1A 1B6AA 1WJAA 2VQHA 4XKVA 4AD9A 2R5YB 1YFHA 1X1CA 3M9AA 4RAGA 4KUMA 1FTTA 2E71A 4M9ZA 1XSVA 2ELKA 2EFNA 1S8NA 2D2WA 2EFWA 3L09A 1B4AA 2DO7A 3A1YA 4IRHA 4XICA 3A0BC 3SZTA 1MMGA 3WGHA 3H5NA 5E3OA 3O6BB 2W85A 3HOTA 4HSTA 1B72A 2B0LA 3H0DA 2PJPA 3K4CA 2XPVA 1P7JA 1YO5C 1EH7A 1V5GA 2CQXA 4UUVA 1OR7A 4XKBA 2Z5UA 4U87A 1VQ6I 1D0YA 3PNVA 2EZLA 3O8GA 4PJJA 4XN3A 2M0MA 3CCVI 1SFOJ 1YYVA 4D7MA 3BPVA 1Z7UA 4A3MJ 3HGGA 3OSGA 5J4VA 2WV1A 4WWCA 1X3WB 3OYCA 2K9QA 3DEUA 2M3AA 4XRSG 1IAWA 5L3CA 5LGTA 4HOBA 3S2WA 5B1BH 3CC4I 4XRMA 4AIDA 3A01A 4JX6A 2LLKA 2W82A 1TT0A 2YU3A 3K4MA 1ON1A 2F2EA 5KCMA 1MDMB 4KIFA 3UKGA 1MSFC 3S15J 2OQGA 3FZVA 3QPLA 2LKSA 3EUKL 1Z77A 5EEAA 4G8XA 1IDYA 2CUZA 1WKMA 1WPKA 3FK6A 3WE2A 3HL2A 3RI4A 3BZCA 1X1DA 2V1UA 3K1PA 3AKZA 3BC8A 1YI2I 5GTHC 4A2UA 2HDCA 2W25A 3J7ZI 3D1NI 1ETVA 1FJLA 4L9JA 4ANJA 2FQ4A 3HSEA 5JVGF 5J6XA 4YFNF 4CZCA 4XKWA 4BY7J 1K78A 4BXFA 1XCVA 1XSXA 3N05A 3IWFA 5F1JA 3M3YJ 3WTUC 1MNMC 2LKXA 3LA3A 3PSIA 1XS9A 1D8KA 2O61A 4V2GA 1ITYA 1TWFJ 3FXUA 1QZEA 2QM3A 4RLFA 1DP7P 3ZMDA 5LGUA 1QHGA 4L9VA 3TP3A 1UHSA 4N9IA 4NQWA 1HQCA 5F08A 2FF4A 2XB5A 3E6MA 2DK5A 4UVBA 1FMVA 1X1BA 3IC7A 2XF5A 3RYPA 1PDNC 1ZR4A 4IKFA 1JGSA 2YU9J 3RZOJ 3GTPJ 1MMSA 1STZA 5CQGA 1Z6RA 3GF2A 4LK1F 3OYJA 4M73A 1U6GA 1BOAA 2CS3A 2L9VA 1YX3A 1EV7A 4M6YA 5IP6A 3EYYA 3G1MA 1LUJB 1L3LA 2DI3A 4CCJA 1XGSA 3ZMTA 4EJUA 3JREA 1VQ7I 2EV0A 1DGWY 2OZ6A 1KZHA 1IGNA 1WRJA 5DUKA 2X51A 1A36A 3HHGA 2BY0A 5E1WA 4DOZA 5LHHA 2WTEA 1MH3A 4LG0A 2YR2A 2DFFA 2LTPA 2O3FA 3CUQC 5FD6A 2VKDA 3IWZA 2K02A 3JW4A 2IRFG 5B5EC 3M8EA 3BZKA 3IL2A 3FISA 1R49A 3M8JA 2O8KA 1ETKA 2KIFA 3BTCA 2OCCH 4S05A 3C1DA 2QSHX 3QP6A 3OL3A 2VBXA 3E97A 3I4MJ 1DUXC 1DPUA 2JA7J 5BS6A 1PJRA 3MWMA 4RM2A 4MO7A 3NEUA 2M5WA 3F72A 1D0ZA 3T5XA 1T08B 1RPWA 2F5CA 1SD6A 4BEHA 4DZPA 1IUYA 2ADUA 1GDTA 2FNPA 3DEWA 4BJTA 4F3QA 4DQ2A 2AS5F 1RC9A 3RKQA 3G1OA 2PJRA 3OYIA 4CYDA 2DQRA 1DU0A 2ME6A 2NNYA 2D1VA 2WAQN 1RKTA 2K86A 5FB2A 3HOVJ 1WFXA 5KNLA 3EYIA 4KISA 3MKZA 1FTZA 1JI8A 5JHFA 5LLQA 1R23A 3CQZJ 3RKXA 4WXDA 2WAFA 1O3TA 1IUFA 2EFPA 2PMZA 1XGOA 3H9GA 4YG2F 3BG5A 3MQ0A 4J00A 2O8XA 5HDKA 4R8HA 2E5NA 3ZMZA 4CHUA 4XSXF 2LY2A 2CMPA 2E35A 2X6YA 2DFIA 3OYEA 4PFPA 3WGGA 2ZJQF 3QWLA 4XOPA 2HGCA 4HRIA 4BGDA 3FKJA 3VB2A 1LNWA 3PUFA 5KHDA 4RAYA 1ZTRA 3I53A 2BHZA 5EJCA 3VWBA 2ZJPF 1YE9A 4IHWA 3T0YA 4LGWA 4ZC3A 1KQ9A 2BW3B 1Y1WJ 4UVAA 3RZDJ 3KLNA 3W2WA 1VQ5I 3L1PA 4HNUA 3CMAI 1YTYA 2B7EA 3B6CA 2IS4A 2Y9YA 1B1BA 2YSRA 2XAQA 2A6HF 4E7IA 3TOBA 3IUOA 3JRDA 2LP0A 5F27A 2CFOA 4AU7A 4CO8A 2BV6A 5F0FA 5IYDJ 2VE8A 4PGHA 1JE8A 5HLTA 4E7JA 4ZJZA 1YHQI 4X1EA 2R7OA 5EG0B 2QQ9A 3BCBA 1IXCA 4ZDPA 2NVYJ 1Y8QB 2F6CA 2VI6A 4AVPA 3A02A 4AYBN 3E1SA 2KHMA 4ZH4F 4AIHA 1TP4A 1O7FA 3GYHX 3K4JA 1QO0D 1EJ9A 4EJTA 2L9NA 1T38A 2RQQA 2XGEA 5D4RA 1RUOA 2WY7Q 1MBHA 3LOCA 3OR2C 1A6QA 1OKRA 2GA2A 2E2IJ 3RSNA 2HVSA 3EUHC 3HPGA 2HS5A 1Y8RB 3M1CA 3FMQA 1WZ2A 3D0SA 2VKHA 2H27A 1D3YA 4B1RA 3BZ6A 4B8XA 1S5LC 3BG3A 1YQAA 1H88C 3S14J 3H35A 2KJBA 3B73A 3HOWJ 3F3XA 4RAZA 4A5MA 5GP9A 4GO1A 1R1VA 3PQKA 4BE1A 3I71A 2DA6A 3JRFA 1AKHB 2KDOA 1E3OC 4LD5A 1BN5A 2DTZA 2BY2A 1OYWA 5EF6A 2MH2A 2GZWA 2QBYB 3BG7A 3CCMI 3JR9A 1HCRA 1N75A 4Y17A 2A05A 4YIRX 4IHXA 2DA7A 3H3VK 1BOBA 2P81A 4Y33A 3RPQA 4U0YA 1ZH5A 1U5TB 2RQPA 3NRVA 1PUFB 3SHFA 1BI2A 2F48A 1HW5A 4G7OF 3MVPA 5GPAA 1CF7B 4C30A 3I56I 2CH0A 2XV4S 3H9QA 3CTAA 4R1HA 3LAJA 1GVJA 1ON2A 1ZARA 4M71A 4HQEA 1JJ6C 3IRQA 3WU1B 1I3QJ 1PP7U 1E17A 2XAJA 1ONVA 4A3JJ 3K2ZA 1MIJA 4U0WA 4CCMA 4XONA 1ULYA 3CJRB 4OMZA 2E5ZA 4G6QA 2R7XA 2L01A 3CP2A 3C18A 3QP5A 2TDXA 2X85A 1YITI 3FXOA 3OS0A 4C2MJ 5M5XJ 2FBKA
chains in the Genus database with same CATH topology
5BQTA 3N4MA 3BJ6A 4RB1A 3KP5A 3KP3A 2MA3A 3N97A 3ML6A 2F5DA 2IPQX 3WTXC 5F64A 4HF0A 2BGCA 2HYFA 2UXNA 4N9HA 1IXRC 1J7KA 1H9GA 1FBUA 5DD8A 4AWXB 2QWWA 2CSOA 2JPBA 3WTWC 3DKWA 2FU4A 2ZCWA 3FXRA 2G7HA 3DQVC 5D6FA 2Q0OA 2EA4A 2XKOA 4MQVA 1IZ1A 2EFQA 3J80K 3JTGA 4TV7A 1K6OA 3TQNA 1Z91A 5CYVA 3U1DA 5CVVA 4G9YA 2OD5A 1J75A 1DDNA 1TNTA 3HYIA 5L3FA 2XROA 1SD7A 1KU7A 1HKQA 3QPTA 4ESFA 1KU2A 2VONA 3WE3A 1O3SA 3K9TA 4FHTA 1F4KA 4KMFA 2RDPA 4XSZF 1K7AA 4Y13A 3RIRA 5E17F 2ZNYA 3GFJA 3K0LA 2RVCA 2H09A 3IHUA 3BDDA 1KQ8A 2HR3A 3V7SA 4E70A 4BAYA 1ZN2A 4YFKF 2IT0A 1QQIA 1Q1HA 3BJOA 4AIKA 2NYXA 2CW0F 1P4WA 1R5GA 4MEXF 1KYWA 2VN2A 2DAOA 4LB5A 2QLZA 3F6OA 1KU3A 3LQRA 1RI7A 3HOSA 2P8TA 4MNUA 3E5XA 5ILVA 2V1XA 2MLGA 5D5XB 2XKPA 3I64A 2QQAA 4RB0A 3QAHA 1HW2A 3P9KA 1W7PB 4D0PA 3WODF 4HF2A 4WXHA 2HFHA 1SMTA 4QLCU 2FBHA 1HKSA 2L54A 1MKMA 3GXOA 3I5UA 3F8CA 2HOEA 3GW2A 4CICA 3SZPA 4YFXF 4G6DA 1W4MA 2DPUA 2A07F 2IA2A 5HS8A 3SFZA 3T8RA 2OA4A 1UB9A 3BROA 3LWFA 4ZZLA 5IT9Z 2K7LA 1SD4A 4S04A 1EH6A 2M8EA 4O6JA 2DQLA 3GFLA 1LDJA 1R58A 3DV8A 5D6EA 1YS6A 3E5QA 4HX7A 1FOKA 5LHIA 4Q48A 1QZZA 4EVIA 3J81Z 4BHCA 2RN7A 2VBZA 3KP4A 1SMYF 1ZG3A 2QBYA 1QPMA 2A6EF 1ZGAA 4OIPF 5BPDA 4HDVA 4G7HF 4L0ZB 2W84A 3GWZA 1XDUA 2EA2A 2CWEA 3GUDA 2XGXA 4WXCA 3P7NA 2UXXA 2HKXA 1GXQA 2PQ8A 3JSOA 2EFOA 1I6XA 4M9SA 3HIFA 2ETHA 2W57A 3QU6A 2A69F 3ECOA 4ENMA 1P2FA 1MJ9A 3CUQB 4LJZF 1BI3A 1UHMA 2XUBA 1TLHB 5CLSA 3F22A 4PDKA 2BYVE 3GO5A 3G73A 3SXYA 1B9MA 4XLPF 4EJVA 2XASA 3ROUA 3ABTA 2Z9OA 5H6QA 2FQ3A 3F23A 4EGZA 2ZFWA 4P9FA 3ZMSA 4A6DA 3TGNA 3FHZA 2PN6A 3QOPA 2O03A 4MTEA 3WTZA 5DEQA 2EV6A 1AWCA 1YLFA 1E2XA 4WCGA 4HV6A 5A2QK 2IA1A 3Q9VA 3GZ5A 5K5OA 3F21A 4A0ZA 4LB6B 4G94A 3ULQB 3L2CA 3K69A 3V8KA 4U88A 5A2QZ 2ZNZA 2E1CA 1TTYA 5HS7A 1IN7A 1ZGJA 5AONA 2RV8A 4HV5A 5L3BA 1V3FA 2EWNA 2MBFA 3K1NA 4A12A 1OMIA 1X3UA 3WTSC 2Z33A 3GLXA 1REPC 5HDGA 1R7JA 4P55A 2FMLA 1ZYRF 2COMA 2X4HA 1IN5A 1ODDA 3HUGA 4B09A 4P5OA 3I4PA 2P5VA 1O3QA 4HZFA 3RTRA 3HTSB 1G4DA 3TDZC 2UZKA 4BQAA 1YW7A 3BP8A 2ZKZA 1NHAA 1QNTA 2E7XA 2IA0A 1RUNA 1SFXA 2HWVA 5AIPA 3M1EA 2VOOA 5HLHA 1T98A 3KZYA 2CO5A 1B9NA 5LHGA 5EEGA 2P5LC 1WSUA 4LK0F 4UVCA 1FYKA 3GFMA 3E3VA 5K5RA 2V1DA 3KP7A 1P4XA 4KMUX 4RGRA 3CO6C 2P4WA 2KRFA 3FM5A 4RGSA 5E8GA 1CGPA 1W7PA 1TQIA 3FF5A 2DPDA 4IHTA 2VBYA 2R7DA 1FYLA 3R0AA 2GXGA 4IXAA 3ERED 3RDIA 3R4KA 3AAFA 2PG4A 3E5UA 1ZG1A 1FWZA 2KJCA 2J5PA 5CVRA 4DNCA 2ZBKA 1HSJA 4JBAA 3JAMK 2UWMA 3VEPA 3LFKA 1J2XA 3CUOA 1H0MA 1MZBA 4GYGA 2OZUA 1G3SA 1ZRCA 2XAHA 1TQMA 2Z3YA 4BHBA 2L3DA 4A0YA 2F5FA 4GGGA 3NQOA 4MGRA 1K79A 3H3ZA 5KVRA 2ZO4A 5L3GA 1FSEA 1ZLKA 3V7CA 5ILUA 4ZYGA 4LLLA 2PMHA 3HRMA 4ZYEA 2VXZA 4G7ZF 3VFZA 1AOYA 5FD5A 4ESJA 3KLOA 3KZZA 4Q5SF 3LA2A 2FE3A 2AXLA 4OIQF 5BOXA 2STWA 5ICEA 2XAGA 3WU0A 3ZN0A 2EJRA 3P9CA 4M9XA 2A5YB 2VOPA 3ECHA 4FX0A 2D1HA 1G6NA 3BJAA 2RKHA 3CJNA 1J59A 4XBFA 5BPIA 2C6YA 3HTUA 2GA1A 5JVTA 1MDMA 1XMKA 1A04A 1W5TA 2JTVA 1FBSA 2P7VB 1BI0A 4Q47A 1UFMA 4F7ZA 3R0JA 1BI1A 4RGUA 2QENA 2MH9A 3CO7C 1HXDA 2KIMA 1SFUA 3GFIA 5J8FA 2OBPA 4Y15A 1Z05A 2VT2A 5ICGA 5J8CA 5E8IA 3CLOA 4I01A 1FZPB 2W24A 1S29A 4PCQA 1KGSA 1MGTA 5CJ9A 4NB5A 3GZ6A 1K78B 4QWQA 3TO9A 3EETA 5FFXA 1OYIA 5LEJA 2A3SA 4K2EA 2M30A 3FM3A 5LRRA 2HKOA 2XVCA 1T39A 1XGMA 3SQNA 2PI0A 1F9NA 4I7HA 3J80Z 4OU0A 5DV5A 3KEOA 1FPQA 1LVAA 1TBXA 2ISZA 1G3TA 1R1TA 5KK1A 4EGYA 1XCBA 2CFXA 5ILSA 4YIFA 2G7UA 1G3WA 4CXFA 3WTVC 2LNBA 1GXPA 1FT9A 1C0WA 1GHCA 1T2KA 3I59B 2Y75A 4I02A 3F6VA 1SFEA 1HSTA 3IKVA 3VOEA 4CDGA 1JXSA 2VE9A 4AIJA 4LG0B 4A5NA 4HLXA 3HRTA 2WC2A 3DPTA 2QYOA 5K1YA 2GXBA 4I98B 4CZZA 5HLGA 4KDPA 2ESNA 1Z1DA 4KFCA 4UV8A 2KIUA 2PEXA 2HQRA 3REOA 4ZYHA 1LEAA 5E18F 3ABUA 5DCFA 2H94A 4I0AA 1ZRDA 1R36A 2HTJA 2ZJ2A 3ZP5A 3O3KA 5DCMB 1USSA 1T0FA 2IJLA 3MEXA 3QU3A 4KYWA 4ESBA 3HSFA 3LQQA 3I58A 3FX3A 5LGNA 2D45A 3RYRA 3OOPA 2L4AA 1ZG5A 3F8NA 3ELKA 4ZZDA 1LQ1A 4ETSA 4EV0A 1MJBA 3FXQA 1YIOA 3R60A 2JT1A 2DBBA 2V9VA 3KCCA 4KIBA 3LAPA 3IRRA 1J9IA 1B59A 5CVUA 4RS8A 2GAUA 2Q8KA 3T8TA 3U2RA 3COAC 5E1ZB 5HLIA 2X0LA 5LEKA 3E6BA 3Q9SA 2ACJA 4IRIA 4XRFA 1KU9A 5TJJA 4ENKA 4N0BA 2M1BA 3O2PE 1YS7A 4BYYA 2QQBA 4MQ9F 4FX4A 1TQPA 4LLGF 4HLYA 5D5UB 4U7DA 2ISYA 4A0XA 2XAFA 1LDDA 1BIBA 2JZYA 2GWRA 3EQLF 4UV9A 5AIQA 4EMSA 1XDSA 1HKTA 1U5TA 4O3MA 1FLIA 1YW8A 2QVOA 2XRNA 3WG9A 4GXOA 3KETA 2QUFA 4LLNA 1CF7A 3HSRA 1FX7A 4M72A 1P92A 2PBIA 3HRUA 1U8RA 2VC1A 3GX4X 3ZN1A 5JI6A 3WTYC 2JRTA 2EB7A 4OINF 2ESHA 2M45A 2CQKA 3L9FA 5HS9A 4ASNA 3QRFF 4HAMA 4KN4X 4P96A 5EEHA 1JHHA 2A61A 2NAZA 5FLXK 4BNCA 2YX7A 2YPRA 3WTTC 1XMAA 2DLLA 4GCVA 2XHKA 2DT5A 4WX9A 4UNOA 3KE2A 4ENJA 3PQJA 5BMZA 3W6KB 4EQQA 5FLXZ 2HYGD 5IT3A 4ON0A 2MC3A 1IW7F 5ICFA 4KA4A 3E6CC 1MD0A 1LB2A 3KFWX 2CGPA 3JTHA 2P7CB 5E1XA 1FP2A 4IF4A 2KKOA 3I0TA 1I27A 1HW1A 2L02A 1FC3A 1XN7A 2NNNA 2GQQA 4HBLA 2HQNA 2Y48A 3CDHA 4LFUA 5D5VB 2FEZA 4IPAA 5HVQC 1R5HA 3H92A 1S6LA 3ISPA 3DF8A 1U2WA 2Q2EA 3TKYA 1PP8F 1U3EM 1FBQA 4L9NA 3OV8A 2BBYA 4KIGA 2VODA 3I59A 5DUIA 3LA7A 4MTDA 3QPHA 2FA5A 4HX4A 2H6BA 4BH9A 3ZMVA 2LSOA 1BJAA 1ZREA 2LF7A 5CVIA 3ZMUA 4L9TA 1QGPA 4PZJA 1YG2A 4UHTA 4IVNA 2RGVA 2ZXJA 1TNSA 1SD5A 3C3WA 4HA8A 3V8JA 1YW9A 3WGIA 4YIIA 5FGMA 3V7RA 1IRGA 1F5TA 3M8FA 1FSHA 5D5WB 1UHWA 4XLNF 2PFBA 4EM1A 3RKWA 3KP6A 3TO6A 3RJPA 2FBIA 2G9WA 2OQRA 4MEYF 1FYMA 4L0YB 5DCMA 2DTRA 1BC7C 3DFGA 3M7GA 1Z9CA 1QBJA 4KNYA 2LF8A 2Z99A 2PMUA 3G3ZA 4RB2C 1MJAA 5JFRA 2LKPA 2FOKA 3KEQA 5JR3A 1J0RA 5FO5A 5DD4A 3H3UA 1FNNA 5ED4A 2O0YA 2R3SA 2EV5A 2WWYA 3RPUA 5K5QA 4GYIA 2DU9A 4WF2A 4L18B 1I5ZA 4KT5C 1RNLA 4CGZA 2BE5F 4EJOA 5H6RA 4IHSA 2P5KA 2YX4A 1RIOH 2CYYA 1V4RA 2A68F 3JAMZ 2Y0MA 1IRFA 1P4AA 4O5VA 3MCZA 2ZMEB 4M6XA 4LMYA 1BC8C 2F5EA 1IN6A 1Z6TA 2PLYA 5FFZA 1R00A 3HHHA 4MHGA 3W6JB 3HRSA 1BIAA 2JPCA 4NHJA 4U7BA 1XD7A 2FMYA 5H20A 2EK5A 3T1BA 4OIOF 3GEZA 1BM9A 3DP7A 3VODA 1UCRA 1H9TA 3BOQA 2DW4A 1L0OC 1FP1D 3F8FA 3KP2A 4L5IA 4JK1X 4UXNA 4WK8F 4EM2A 4P9UA 3J7AO 1G3YA 2V6CA 2NRAC 2K4JA 2JSCA 1O57A 4HW0A 1IXSB 1TW3A 3DXJF 3CUQA 2VC0A 1KQ0A 2K4BA 3FMSA 3E6DA 5HOOA 4KICA 1PUEE 2FSWA 3K1MA 1W5SA 1LJ9A 4Q4ZF 3V8LA 2H6CA 1DPRA 2GIVA 1O7LA 1USTA 1R1UA 1Y0UA 1OPCA 3TDUC 2HZTA 3B02A 1ZAOA 1XGNA 2P6TA 1LDKB 2L4MA 2IP2A 4OMYA 5L3EA 1I1GA 1D5VA 3F8MA 2IVMA 3L7WA 2LDUA 4BXUA 2HEOA 2O6GE 1RZ4A 3F8BA 2OAZA 2BEOA 1T6SA 1ZLJA 1WQ2A 4HX8A 4IJAA 4HF1A 2P6SA 3BY6A 3MZYA 4RGXA 1R22A 4ZYDA 5JHUA 2QZ8A 4L5JA 1EH8A 2E1NA 1QZYA 3LSTA 1U5TC 2V79A 5DYMA 2NS0A 3FMRA 3Q5FA 4PGGA 2RC4A 2FNAA 1FY7A 1U78A 3R61A 3R6SA 4HQMA 4A6EA 1JHFA 4H0EA 1WWXA 4JQFA 1S7AA 5LRSA 4OIRF 1O3RA 3I54A 3U9GA 2E7WA 3EUHA 3FWEA 4EJWA 1J5YA 1BBYA 4I0BA 1S7OA 5TRDA 4KN7X 2M87A 4HDUA 2STTA 3JSPA 4HYEA 4M74A 1IN4A 1KA8A 3DPLC 5L3DA 3EDPA 4I09A 3L00A 1SAXA 2RNJA 2CG4A 2XIGA 5HDNA 5E20A 5ICCA 1WI9A 3TO7A 3MAJA 3ZQ7A 1XSDA 3BWGA 2MD5A 4Z2YA 1ZHFA 2VBWA 4U0VA 2J5OA 1I1SA 2ELHA 1LEBA 1IN8A 5D8LB 3PFIA 2DK8A 5ERIA 3MZHA 3IKTA 2VT3A 2FRHA 1ZRFA 2FXAA 4I2OA 5D8KB 1F1ZA 2HTSA 2K27A 1KYZA 5F1RA 5IT9K 3P9IA 2R7FA 4R79A 2IW5A 4ENNA 1VTNC 4IRGA 5F6FA 3TOAA 4BHPA 3GVAA 5DDGA 4RB3C 2ZMEA 4OOIA 3V4GA 2OU2A 3C7JA 2MLKA 3J81K 1HBXG 3BPXA 4FT8A 3D5LA 1P6RA 1TW2A 5D4SA 1OYYA 1S3JA 5LBQA 1W7PD 1D8JA 3RKYA 3ZPLA 5CVJA 6PAXA 3MFKA 1XB4A 2WV0A 4EM0B 1IF1A 1B6AA 4AD9A 1YFHA 3M9AA 4KUMA 4M9ZA 1XSVA 2EFNA 1S8NA 2D2WA 2EFWA 3L09A 1B4AA 2DO7A 4IRHA 3SZTA 3WGHA 3O6BB 2W85A 3HOTA 2B0LA 2PJPA 1YO5C 1EH7A 4UUVA 1OR7A 2Z5UA 1YYVA 3BPVA 1Z7UA 4WWCA 3DEUA 1IAWA 5L3CA 5LGTA 4HOBA 3S2WA 2YU3A 1ON1A 2F2EA 1MDMB 4KIFA 2OQGA 3FZVA 4G8XA 1WKMA 3WE2A 3RI4A 2V1UA 3K1PA 4A2UA 2HDCA 2W25A 4L9JA 3HSEA 5J6XA 4YFNF 1K78A 1XCVA 1XSXA 3IWFA 3WTUC 3LA3A 1D8KA 2O61A 3FXUA 2QM3A 1DP7P 3ZMDA 5LGUA 4L9VA 4N9IA 4NQWA 1HQCA 2FF4A 3E6MA 2DK5A 4UVBA 3IC7A 3RYPA 1PDNC 1JGSA 1STZA 1Z6RA 3GF2A 4LK1F 4M73A 1U6GA 1BOAA 1EV7A 4M6YA 3EYYA 1L3LA 2DI3A 1XGSA 3ZMTA 4EJUA 2EV0A 2OZ6A 1WRJA 5DUKA 3HHGA 5E1WA 5LHHA 2WTEA 4LG0A 2YR2A 2O3FA 3CUQC 5FD6A 3IWZA 2K02A 3JW4A 2IRFG 3IL2A 3M8EA 2KIFA 4S05A 3C1DA 3QP6A 2VBXA 3E97A 1DPUA 1DUXC 5BS6A 3MWMA 3NEUA 2M5WA 3F72A 3T5XA 2F5CA 1SD6A 1IUYA 2ADUA 2FNPA 4DQ2A 2AS5F 4CYDA 2DQRA 2NNYA 2D1VA 2K86A 5FB2A 3EYIA 5LLQA 1R23A 3RKXA 4WXDA 1O3TA 2EFPA 4YG2F 1XGOA 3MQ0A 2O8XA 5HDKA 4R8HA 3ZMZA 4CHUA 4XSXF 2DFIA 3WGGA 2HGCA 3VB2A 1LNWA 4RAYA 3I53A 3T0YA 4LGWA 1KQ9A 4UVAA 3KLNA 1YTYA 1B1BA 2YSRA 2XAQA 2A6HF 3TOBA 4CO8A 2BV6A 2VE8A 4PGHA 1JE8A 2QQ9A 1IXCA 4AVPA 4ZH4F 4AIHA 1O7FA 3GYHX 1QO0D 4EJTA 1T38A 5D4RA 1RUOA 1OKRA 2GA2A 2HS5A 3FMQA 3D0SA 2H27A 1D3YA 3BZ6A 4B8XA 1YQAA 2KJBA 3B73A 3F3XA 4RAZA 4A5MA 4GO1A 1R1VA 3PQKA 3I71A 4LD5A 1BN5A 1OYWA 2MH2A 2GZWA 2QBYB 4Y17A 3RPQA 4U0YA 1ZH5A 1U5TB 2RQPA 3NRVA 3SHFA 1BI2A 1HW5A 4G7OF 1CF7B 2XV4S 3CTAA 4R1HA 3LAJA 1GVJA 1ON2A 1ZARA 4M71A 4HQEA 3IRQA 3WU1B 1PP7U 1E17A 2XAJA 1ONVA 3K2ZA 4U0WA 1ULYA 4OMZA 4G6QA 2L01A 3C18A 3QP5A 2TDXA 2FBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BQT A;  3N4M A;  3BJ6 A;  4RB1 A;  3KP5 A;  3KP3 A;  2MA3 A;  3N97 A;  3ML6 A;  2F5D A;  2IPQ X;  3WTX C;  5F64 A;  4HF0 A;  2BGC A;  2HYF A;  2UXN A;  4N9H A;  1IXR C;  1J7K A;  1H9G A;  1FBU A;  5DD8 A;  4AWX B;  2QWW A;  2CSO A;  2JPB A;  3WTW C;  3DKW A;  2FU4 A;  2ZCW A;  3FXR A;  2G7H A;  3DQV C;  5D6F A;  2Q0O A;  2EA4 A;  2XKO A;  4MQV A;  1IZ1 A;  2EFQ A;  3J80 K;  3JTG A;  4TV7 A;  1K6O A;  3TQN A;  1Z91 A;  5CYV A;  3U1D A;  5CVV A;  4G9Y A;  2OD5 A;  1J75 A;  1DDN A;  1TNT A;  3HYI A;  5L3F A;  2XRO A;  1SD7 A;  1KU7 A;  1HKQ A;  3QPT A;  4ESF A;  1KU2 A;  2VON A;  3WE3 A;  1O3S A;  3K9T A;  4FHT A;  1F4K A;  4KMF A;  2RDP A;  4XSZ F;  1K7A A;  4Y13 A;  3RIR A;  5E17 F;  2ZNY A;  3GFJ A;  3K0L A;  2RVC A;  2H09 A;  3IHU A;  3BDD A;  1KQ8 A;  2HR3 A;  3V7S A;  4E70 A;  4BAY A;  1ZN2 A;  4YFK F;  2IT0 A;  1QQI A;  1Q1H A;  3BJO A;  4AIK A;  2NYX A;  2CW0 F;  1P4W A;  1R5G A;  4MEX F;  1KYW A;  2VN2 A;  2DAO A;  4LB5 A;  2QLZ A;  3F6O A;  1KU3 A;  3LQR A;  1RI7 A;  3HOS A;  2P8T A;  4MNU A;  3E5X A;  5ILV A;  2V1X A;  2MLG A;  5D5X B;  2XKP A;  3I64 A;  2QQA A;  4RB0 A;  3QAH A;  1HW2 A;  3P9K A;  1W7P B;  4D0P A;  3WOD F;  4HF2 A;  4WXH A;  2HFH A;  1SMT A;  4QLC U;  2FBH A;  1HKS A;  2L54 A;  1MKM A;  3GXO A;  3I5U A;  3F8C A;  2HOE A;  3GW2 A;  4CIC A;  3SZP A;  4YFX F;  4G6D A;  1W4M A;  2DPU A;  2A07 F;  2IA2 A;  5HS8 A;  3SFZ A;  3T8R A;  2OA4 A;  1UB9 A;  3BRO A;  3LWF A;  4ZZL A;  5IT9 Z;  2K7L A;  1SD4 A;  4S04 A;  1EH6 A;  2M8E A;  4O6J A;  2DQL A;  3GFL A;  1LDJ A;  1R58 A;  3DV8 A;  5D6E A;  1YS6 A;  3E5Q A;  4HX7 A;  1FOK A;  5LHI A;  4Q48 A;  1QZZ A;  4EVI A;  3J81 Z;  4BHC A;  2RN7 A;  2VBZ A;  3KP4 A;  1SMY F;  1ZG3 A;  2QBY A;  1QPM A;  2A6E F;  1ZGA A;  4OIP F;  5BPD A;  4HDV A;  4G7H F;  4L0Z B;  2W84 A;  3GWZ A;  1XDU A;  2EA2 A;  2CWE A;  3GUD A;  2XGX A;  4WXC A;  3P7N A;  2UXX A;  2HKX A;  1GXQ A;  2PQ8 A;  3JSO A;  2EFO A;  1I6X A;  4M9S A;  3HIF A;  2ETH A;  2W57 A;  3QU6 A;  2A69 F;  3ECO A;  4ENM A;  1P2F A;  1MJ9 A;  3CUQ B;  4LJZ F;  1BI3 A;  1UHM A;  2XUB A;  1TLH B;  5CLS A;  3F22 A;  4PDK A;  2BYV E;  3GO5 A;  3G73 A;  3SXY A;  1B9M A;  4XLP F;  4EJV A;  2XAS A;  3ROU A;  3ABT A;  2Z9O A;  5H6Q A;  2FQ3 A;  3F23 A;  4EGZ A;  2ZFW A;  4P9F A;  3ZMS A;  4A6D A;  3TGN A;  3FHZ A;  2PN6 A;  3QOP A;  2O03 A;  4MTE A;  3WTZ A;  5DEQ A;  2EV6 A;  1AWC A;  1YLF A;  1E2X A;  4WCG A;  4HV6 A;  5A2Q K;  2IA1 A;  3Q9V A;  3GZ5 A;  5K5O A;  3F21 A;  4A0Z A;  4LB6 B;  4G94 A;  3ULQ B;  3L2C A;  3K69 A;  3V8K A;  4U88 A;  5A2Q Z;  2ZNZ A;  2E1C A;  1TTY A;  5HS7 A;  1IN7 A;  1ZGJ A;  5AON A;  2RV8 A;  4HV5 A;  5L3B A;  1V3F A;  2EWN A;  2MBF A;  3K1N A;  4A12 A;  1OMI A;  1X3U A;  3WTS C;  2Z33 A;  3GLX A;  1REP C;  5HDG A;  1R7J A;  4P55 A;  2FML A;  1ZYR F;  2COM A;  2X4H A;  1IN5 A;  1ODD A;  3HUG A;  4B09 A;  4P5O A;  3I4P A;  2P5V A;  1O3Q A;  4HZF A;  3RTR A;  3HTS B;  1G4D A;  3TDZ C;  2UZK A;  4BQA A;  1YW7 A;  3BP8 A;  2ZKZ A;  1NHA A;  1QNT A;  2E7X A;  2IA0 A;  1RUN A;  1SFX A;  2HWV A;  5AIP A;  3M1E A;  2VOO A;  5HLH A;  1T98 A;  3KZY A;  2CO5 A;  1B9N A;  5LHG A;  5EEG A;  2P5L C;  1WSU A;  4LK0 F;  4UVC A;  1FYK A;  3GFM A;  3E3V A;  5K5R A;  2V1D A;  3KP7 A;  1P4X A;  4KMU X;  4RGR A;  3CO6 C;  2P4W A;  2KRF A;  3FM5 A;  4RGS A;  5E8G A;  1CGP A;  1W7P A;  1TQI A;  3FF5 A;  2DPD A;  4IHT A;  2VBY A;  2R7D A;  1FYL A;  3R0A A;  2GXG A;  4IXA A;  3ERE D;  3RDI A;  3R4K A;  3AAF A;  2PG4 A;  3E5U A;  1ZG1 A;  1FWZ A;  2KJC A;  2J5P A;  5CVR A;  4DNC A;  2ZBK A;  1HSJ A;  4JBA A;  3JAM K;  2UWM A;  3VEP A;  3LFK A;  1J2X A;  3CUO A;  1H0M A;  1MZB A;  4GYG A;  2OZU A;  1G3S A;  1ZRC A;  2XAH A;  1TQM A;  2Z3Y A;  4BHB A;  2L3D A;  4A0Y A;  2F5F A;  4GGG A;  3NQO A;  4MGR A;  1K79 A;  3H3Z A;  5KVR A;  2ZO4 A;  5L3G A;  1FSE A;  1ZLK A;  3V7C A;  5ILU A;  4ZYG A;  4LLL A;  2PMH A;  3HRM A;  4ZYE A;  2VXZ A;  4G7Z F;  3VFZ A;  1AOY A;  5FD5 A;  4ESJ A;  3KLO A;  3KZZ A;  4Q5S F;  3LA2 A;  2FE3 A;  2AXL A;  4OIQ F;  5BOX A;  2STW A;  5ICE A;  2XAG A;  3WU0 A;  3ZN0 A;  2EJR A;  3P9C A;  4M9X A;  2A5Y B;  2VOP A;  3ECH A;  4FX0 A;  2D1H A;  1G6N A;  3BJA A;  2RKH A;  3CJN A;  1J59 A;  4XBF A;  5BPI A;  2C6Y A;  3HTU A;  2GA1 A;  5JVT A;  1MDM A;  1XMK A;  1A04 A;  1W5T A;  2JTV A;  1FBS A;  2P7V B;  1BI0 A;  4Q47 A;  1UFM A;  4F7Z A;  3R0J A;  1BI1 A;  4RGU A;  2QEN A;  2MH9 A;  3CO7 C;  1HXD A;  2KIM A;  1SFU A;  3GFI A;  5J8F A;  2OBP A;  4Y15 A;  1Z05 A;  2VT2 A;  5ICG A;  5J8C A;  5E8I A;  3CLO A;  4I01 A;  1FZP B;  2W24 A;  1S29 A;  4PCQ A;  1KGS A;  1MGT A;  5CJ9 A;  4NB5 A;  3GZ6 A;  1K78 B;  4QWQ A;  3TO9 A;  3EET A;  5FFX A;  1OYI A;  5LEJ A;  2A3S A;  4K2E A;  2M30 A;  3FM3 A;  5LRR A;  2HKO A;  2XVC A;  1T39 A;  1XGM A;  3SQN A;  2PI0 A;  1F9N A;  4I7H A;  3J80 Z;  4OU0 A;  5DV5 A;  3KEO A;  1FPQ A;  1LVA A;  1TBX A;  2ISZ A;  1G3T A;  1R1T A;  5KK1 A;  4EGY A;  1XCB A;  2CFX A;  5ILS A;  4YIF A;  2G7U A;  1G3W A;  4CXF A;  3WTV C;  2LNB A;  1GXP A;  1FT9 A;  1C0W A;  1GHC A;  1T2K A;  3I59 B;  2Y75 A;  4I02 A;  3F6V A;  1SFE A;  1HST A;  3IKV A;  3VOE A;  4CDG A;  1JXS A;  2VE9 A;  4AIJ A;  4LG0 B;  4A5N A;  4HLX A;  3HRT A;  2WC2 A;  3DPT A;  2QYO A;  5K1Y A;  2GXB A;  4I98 B;  4CZZ A;  5HLG A;  4KDP A;  2ESN A;  1Z1D A;  4KFC A;  4UV8 A;  2KIU A;  2PEX A;  2HQR A;  3REO A;  4ZYH A;  1LEA A;  5E18 F;  3ABU A;  5DCF A;  2H94 A;  4I0A A;  1ZRD A;  1R36 A;  2HTJ A;  2ZJ2 A;  3ZP5 A;  3O3K A;  5DCM B;  1USS A;  1T0F A;  2IJL A;  3MEX A;  3QU3 A;  4KYW A;  4ESB A;  3HSF A;  3LQQ A;  3I58 A;  3FX3 A;  5LGN A;  2D45 A;  3RYR A;  3OOP A;  2L4A A;  1ZG5 A;  3F8N A;  3ELK A;  4ZZD A;  1LQ1 A;  4ETS A;  4EV0 A;  1MJB A;  3FXQ A;  1YIO A;  3R60 A;  2JT1 A;  2DBB A;  2V9V A;  3KCC A;  4KIB A;  3LAP A;  3IRR A;  1J9I A;  1B59 A;  5CVU A;  4RS8 A;  2GAU A;  2Q8K A;  3T8T A;  3U2R A;  3COA C;  5E1Z B;  5HLI A;  2X0L A;  5LEK A;  3E6B A;  3Q9S A;  2ACJ A;  4IRI A;  4XRF A;  1KU9 A;  5TJJ A;  4ENK A;  4N0B A;  2M1B A;  3O2P E;  1YS7 A;  4BYY A;  2QQB A;  4MQ9 F;  4FX4 A;  1TQP A;  4LLG F;  4HLY A;  5D5U B;  4U7D A;  2ISY A;  4A0X A;  2XAF A;  1LDD A;  1BIB A;  2JZY A;  2GWR A;  3EQL F;  4UV9 A;  5AIQ A;  4EMS A;  1XDS A;  1HKT A;  1U5T A;  4O3M A;  1FLI A;  1YW8 A;  2QVO A;  2XRN A;  3WG9 A;  4GXO A;  3KET A;  2QUF A;  4LLN A;  1CF7 A;  3HSR A;  1FX7 A;  4M72 A;  1P92 A;  2PBI A;  3HRU A;  1U8R A;  2VC1 A;  3GX4 X;  3ZN1 A;  5JI6 A;  3WTY C;  2JRT A;  2EB7 A;  4OIN F;  2ESH A;  2M45 A;  2CQK A;  3L9F A;  5HS9 A;  4ASN A;  3QRF F;  4HAM A;  4KN4 X;  4P96 A;  5EEH A;  1JHH A;  2A61 A;  2NAZ A;  5FLX K;  4BNC A;  2YX7 A;  2YPR A;  3WTT C;  1XMA A;  2DLL A;  4GCV A;  2XHK A;  2DT5 A;  4WX9 A;  4UNO A;  3KE2 A;  4ENJ A;  3PQJ A;  5BMZ A;  3W6K B;  4EQQ A;  5FLX Z;  2HYG D;  5IT3 A;  4ON0 A;  2MC3 A;  1IW7 F;  5ICF A;  4KA4 A;  3E6C C;  1MD0 A;  1LB2 A;  3KFW X;  2CGP A;  3JTH A;  2P7C B;  5E1X A;  1FP2 A;  4IF4 A;  2KKO A;  3I0T A;  1I27 A;  1HW1 A;  2L02 A;  1FC3 A;  1XN7 A;  2NNN A;  2GQQ A;  4HBL A;  2HQN A;  2Y48 A;  3CDH A;  4LFU A;  5D5V B;  2FEZ A;  4IPA A;  5HVQ C;  1R5H A;  3H92 A;  1S6L A;  3ISP A;  3DF8 A;  1U2W A;  2Q2E A;  3TKY A;  1PP8 F;  1U3E M;  1FBQ A;  4L9N A;  3OV8 A;  2BBY A;  4KIG A;  2VOD A;  3I59 A;  5DUI A;  3LA7 A;  4MTD A;  3QPH A;  2FA5 A;  4HX4 A;  2H6B A;  4BH9 A;  3ZMV A;  2LSO A;  1BJA A;  1ZRE A;  2LF7 A;  5CVI A;  3ZMU A;  4L9T A;  1QGP A;  4PZJ A;  1YG2 A;  4UHT A;  4IVN A;  2RGV A;  2ZXJ A;  1TNS A;  1SD5 A;  3C3W A;  4HA8 A;  3V8J A;  1YW9 A;  3WGI A;  4YII A;  5FGM A;  3V7R A;  1IRG A;  1F5T A;  3M8F A;  1FSH A;  5D5W B;  1UHW A;  4XLN F;  2PFB A;  4EM1 A;  3RKW A;  3KP6 A;  3TO6 A;  3RJP A;  2FBI A;  2G9W A;  2OQR A;  4MEY F;  1FYM A;  4L0Y B;  5DCM A;  2DTR A;  1BC7 C;  3DFG A;  3M7G A;  1Z9C A;  1QBJ A;  4KNY A;  2LF8 A;  2Z99 A;  2PMU A;  3G3Z A;  4RB2 C;  1MJA A;  5JFR A;  2LKP A;  2FOK A;  3KEQ A;  5JR3 A;  1J0R A;  5FO5 A;  5DD4 A;  3H3U A;  1FNN A;  5ED4 A;  2O0Y A;  2R3S A;  2EV5 A;  2WWY A;  3RPU A;  5K5Q A;  4GYI A;  2DU9 A;  4WF2 A;  4L18 B;  1I5Z A;  4KT5 C;  1RNL A;  4CGZ A;  2BE5 F;  4EJO A;  5H6R A;  4IHS A;  2P5K A;  2YX4 A;  1RIO H;  2CYY A;  1V4R A;  2A68 F;  3JAM Z;  2Y0M A;  1IRF A;  1P4A A;  4O5V A;  3MCZ A;  2ZME B;  4M6X A;  4LMY A;  1BC8 C;  2F5E A;  1IN6 A;  1Z6T A;  2PLY A;  5FFZ A;  1R00 A;  3HHH A;  4MHG A;  3W6J B;  3HRS A;  1BIA A;  2JPC A;  4NHJ A;  4U7B A;  1XD7 A;  2FMY A;  5H20 A;  2EK5 A;  3T1B A;  4OIO F;  3GEZ A;  1BM9 A;  3DP7 A;  3VOD A;  1UCR A;  1H9T A;  3BOQ A;  2DW4 A;  1L0O C;  1FP1 D;  3F8F A;  3KP2 A;  4L5I A;  4JK1 X;  4UXN A;  4WK8 F;  4EM2 A;  4P9U A;  3J7A O;  1G3Y A;  2V6C A;  2NRA C;  2K4J A;  2JSC A;  1O57 A;  4HW0 A;  1IXS B;  1TW3 A;  3DXJ F;  3CUQ A;  2VC0 A;  1KQ0 A;  2K4B A;  3FMS A;  3E6D A;  5HOO A;  4KIC A;  1PUE E;  2FSW A;  3K1M A;  1W5S A;  1LJ9 A;  4Q4Z F;  3V8L A;  2H6C A;  1DPR A;  2GIV A;  1O7L A;  1UST A;  1R1U A;  1Y0U A;  1OPC A;  3TDU C;  2HZT A;  3B02 A;  1ZAO A;  1XGN A;  2P6T A;  1LDK B;  2L4M A;  2IP2 A;  4OMY A;  5L3E A;  1I1G A;  1D5V A;  3F8M A;  2IVM A;  3L7W A;  2LDU A;  4BXU A;  2HEO A;  2O6G E;  1RZ4 A;  3F8B A;  2OAZ A;  2BEO A;  1T6S A;  1ZLJ A;  1WQ2 A;  4HX8 A;  4IJA A;  4HF1 A;  2P6S A;  3BY6 A;  3MZY A;  4RGX A;  1R22 A;  4ZYD A;  5JHU A;  2QZ8 A;  4L5J A;  1EH8 A;  2E1N A;  1QZY A;  3LST A;  1U5T C;  2V79 A;  5DYM A;  2NS0 A;  3FMR A;  3Q5F A;  4PGG A;  2RC4 A;  2FNA A;  1FY7 A;  1U78 A;  3R61 A;  3R6S A;  4HQM A;  4A6E A;  1JHF A;  4H0E A;  1WWX A;  4JQF A;  1S7A A;  5LRS A;  4OIR F;  1O3R A;  3I54 A;  3U9G A;  2E7W A;  3EUH A;  3FWE A;  4EJW A;  1J5Y A;  1BBY A;  4I0B A;  1S7O A;  5TRD A;  4KN7 X;  2M87 A;  4HDU A;  2STT A;  3JSP A;  4HYE A;  4M74 A;  1IN4 A;  1KA8 A;  3DPL C;  5L3D A;  3EDP A;  4I09 A;  3L00 A;  1SAX A;  2RNJ A;  2CG4 A;  2XIG A;  5HDN A;  5E20 A;  5ICC A;  1WI9 A;  3TO7 A;  3MAJ A;  3ZQ7 A;  1XSD A;  3BWG A;  2MD5 A;  4Z2Y A;  1ZHF A;  2VBW A;  4U0V A;  2J5O A;  1I1S A;  2ELH A;  1LEB A;  1IN8 A;  5D8L B;  3PFI A;  2DK8 A;  5ERI A;  3MZH A;  3IKT A;  2VT3 A;  2FRH A;  1ZRF A;  2FXA A;  4I2O A;  5D8K B;  1F1Z A;  2HTS A;  2K27 A;  1KYZ A;  5F1R A;  5IT9 K;  3P9I A;  2R7F A;  4R79 A;  2IW5 A;  4ENN A;  1VTN C;  4IRG A;  5F6F A;  3TOA A;  4BHP A;  3GVA A;  5DDG A;  4RB3 C;  2ZME A;  4OOI A;  3V4G A;  2OU2 A;  3C7J A;  2MLK A;  3J81 K;  1HBX G;  3BPX A;  4FT8 A;  3D5L A;  1P6R A;  1TW2 A;  5D4S A;  1OYY A;  1S3J A;  5LBQ A;  1W7P D;  1D8J A;  3RKY A;  3ZPL A;  5CVJ A;  6PAX A;  3MFK A;  1XB4 A;  2WV0 A;  4EM0 B;  1IF1 A;  1B6A A;  4AD9 A;  1YFH A;  3M9A A;  4KUM A;  4M9Z A;  1XSV A;  2EFN A;  1S8N A;  2D2W A;  2EFW A;  3L09 A;  1B4A A;  2DO7 A;  4IRH A;  3SZT A;  3WGH A;  3O6B B;  2W85 A;  3HOT A;  2B0L A;  2PJP A;  1YO5 C;  1EH7 A;  4UUV A;  1OR7 A;  2Z5U A;  1YYV A;  3BPV A;  1Z7U A;  4WWC A;  3DEU A;  1IAW A;  5L3C A;  5LGT A;  4HOB A;  3S2W A;  2YU3 A;  1ON1 A;  2F2E A;  1MDM B;  4KIF A;  2OQG A;  3FZV A;  4G8X A;  1WKM A;  3WE2 A;  3RI4 A;  2V1U A;  3K1P A;  4A2U A;  2HDC A;  2W25 A;  4L9J A;  3HSE A;  5J6X A;  4YFN F;  1K78 A;  1XCV A;  1XSX A;  3IWF A;  3WTU C;  3LA3 A;  1D8K A;  2O61 A;  3FXU A;  2QM3 A;  1DP7 P;  3ZMD A;  5LGU A;  4L9V A;  4N9I A;  4NQW A;  1HQC A;  2FF4 A;  3E6M A;  2DK5 A;  4UVB A;  3IC7 A;  3RYP A;  1PDN C;  1JGS A;  1STZ A;  1Z6R A;  3GF2 A;  4LK1 F;  4M73 A;  1U6G A;  1BOA A;  1EV7 A;  4M6Y A;  3EYY A;  1L3L A;  2DI3 A;  1XGS A;  3ZMT A;  4EJU A;  2EV0 A;  2OZ6 A;  1WRJ A;  5DUK A;  3HHG A;  5E1W A;  5LHH A;  2WTE A;  4LG0 A;  2YR2 A;  2O3F A;  3CUQ C;  5FD6 A;  3IWZ A;  2K02 A;  3JW4 A;  2IRF G;  3IL2 A;  3M8E A;  2KIF A;  4S05 A;  3C1D A;  3QP6 A;  2VBX A;  3E97 A;  1DPU A;  1DUX C;  5BS6 A;  3MWM A;  3NEU A;  2M5W A;  3F72 A;  3T5X A;  2F5C A;  1SD6 A;  1IUY A;  2ADU A;  2FNP A;  4DQ2 A;  2AS5 F;  4CYD A;  2DQR A;  2NNY A;  2D1V A;  2K86 A;  5FB2 A;  3EYI A;  5LLQ A;  1R23 A;  3RKX A;  4WXD A;  1O3T A;  2EFP A;  4YG2 F;  1XGO A;  3MQ0 A;  2O8X A;  5HDK A;  4R8H A;  3ZMZ A;  4CHU A;  4XSX F;  2DFI A;  3WGG A;  2HGC A;  3VB2 A;  1LNW A;  4RAY A;  3I53 A;  3T0Y A;  4LGW A;  1KQ9 A;  4UVA A;  3KLN A;  1YTY A;  1B1B A;  2YSR A;  2XAQ A;  2A6H F;  3TOB A;  4CO8 A;  2BV6 A;  2VE8 A;  4PGH A;  1JE8 A;  2QQ9 A;  1IXC A;  4AVP A;  4ZH4 F;  4AIH A;  1O7F A;  3GYH X;  1QO0 D;  4EJT A;  1T38 A;  5D4R A;  1RUO A;  1OKR A;  2GA2 A;  2HS5 A;  3FMQ A;  3D0S A;  2H27 A;  1D3Y A;  3BZ6 A;  4B8X A;  1YQA A;  2KJB A;  3B73 A;  3F3X A;  4RAZ A;  4A5M A;  4GO1 A;  1R1V A;  3PQK A;  3I71 A;  4LD5 A;  1BN5 A;  1OYW A;  2MH2 A;  2GZW A;  2QBY B;  4Y17 A;  3RPQ A;  4U0Y A;  1ZH5 A;  1U5T B;  2RQP A;  3NRV A;  3SHF A;  1BI2 A;  1HW5 A;  4G7O F;  1CF7 B;  2XV4 S;  3CTA A;  4R1H A;  3LAJ A;  1GVJ A;  1ON2 A;  1ZAR A;  4M71 A;  4HQE A;  3IRQ A;  3WU1 B;  1PP7 U;  1E17 A;  2XAJ A;  1ONV A;  3K2Z A;  4U0W A;  1ULY A;  4OMZ A;  4G6Q A;  2L01 A;  3C18 A;  3QP5 A;  2TDX A;  2FBK A; 
#chains in the Genus database with same CATH topology
 5BQT A;  4XM3 A;  4FE4 A;  3N4M A;  3BJ6 A;  4RB1 A;  2OPT A;  3KP5 A;  3KP3 A;  1WGX A;  2MA3 A;  2ZXI A;  4DJA A;  3N97 A;  2BY1 A;  3ML6 A;  2F5D A;  2IPQ X;  2VQL A;  3U1K A;  3WTX C;  1ETO A;  3HG9 A;  4HF0 A;  5F64 A;  4F93 B;  2BGC A;  4M3E A;  2FUG 2;  2HYF A;  2UXN A;  2M34 A;  4N9H A;  1IXR C;  1J7K A;  1H9G A;  1FBU A;  5DD8 A;  4AWX B;  3S93 A;  1TZL A;  2QWW A;  1QVU A;  2DMQ A;  3MD2 A;  2CSO A;  2JPB A;  2LOO A;  3BG6 A;  4PJ0 C;  4CUG A;  3S3O A;  3WTW C;  2ZME C;  3QYF A;  3DKW A;  2KRC A;  3TW7 A;  2FU4 A;  2ZCW A;  3ZQL A;  3TMO A;  2CRG A;  3FXR A;  2G7H A;  3Q0U A;  3ZQH A;  2PMZ N;  1V54 H;  3DQV C;  1Z3Y A;  2ZSH B;  5D6F A;  2Q0O A;  1VQ8 I;  2EA4 A;  2MC4 A;  1ETQ A;  1IV8 A;  1POG A;  2XKO A;  1TWA J;  4MQV A;  1OJL A;  1IZ1 A;  3GTJ J;  2EFQ A;  3ASO H;  5FRN A;  3J80 K;  2DJI A;  3JTG A;  4TV7 A;  1K6O A;  3TQN A;  1XG1 A;  1Z91 A;  2LY1 A;  4BE0 A;  2KMU A;  4F92 B;  1GUU A;  5CYV A;  1LFB A;  3ABL H;  3U1D A;  5CVV A;  4G9Y A;  2OD5 A;  2EH3 A;  1J75 A;  1U0J A;  3LFU A;  1DDN A;  2LD5 A;  1TNT A;  2CW8 A;  3HYI A;  3HDD A;  4JX4 A;  5L3F A;  4B3A A;  2XRO A;  4I6Z A;  2EBI A;  1P9Q C;  1SD7 A;  2IGO A;  5IYC J;  1KU7 A;  3GTO J;  1HKQ A;  1UJ8 A;  1VQN I;  3QPT A;  4ESF A;  2LK2 A;  1KU2 A;  2VON A;  4OAY A;  3WE3 A;  2Q2E B;  5TGT A;  5JLW A;  1O3S A;  1WJC A;  2R5Z B;  2YS9 A;  3K9T A;  4FHT A;  5C3E J;  1F4K A;  2RDP A;  1M1E B;  3DEE A;  1UMQ A;  3LSK A;  4XSZ F;  2UUZ A;  1J09 A;  1OR7 C;  3Q3S A;  1K7A A;  3AL0 C;  4Y13 A;  2IS2 A;  3RIR A;  5E17 F;  3CD6 I;  2ZNY A;  3FXL A;  2BZT A;  3GFJ A;  4PUS A;  5E79 C;  3K0L A;  2RVC A;  2H09 A;  3IHU A;  3BDD A;  3WHB A;  1KQ8 A;  2HR3 A;  1D1C A;  3HM5 A;  4ZYA A;  3V7S A;  4E70 A;  2VPL A;  2L9S A;  4BAY A;  1ZN2 A;  4YFK F;  3I9V 2;  4IQ4 A;  1YX5 A;  2IT0 A;  1E3H A;  1QQI A;  1Q1H A;  3BJO A;  2CU7 A;  4AIK A;  2LBF B;  2NYX A;  4HPQ A;  2CW0 F;  1P4W A;  3TBI A;  1R5G A;  4XQF A;  1X1A A;  4MEX F;  1ORK A;  1KYW A;  2DJN A;  4V2F A;  2VN2 A;  5DS9 A;  2R7T A;  2DAO A;  4LB5 A;  2QLZ A;  3K6G A;  2K9M A;  2XGC A;  3F6O A;  1DP3 A;  2IGN A;  3BLY A;  4MIM A;  3G6E I;  1KU3 A;  2W4S A;  3LQR A;  5GAG J;  1RI7 A;  3HOS A;  1BR2 A;  2H8W A;  2X6X A;  2P8T A;  2DXI A;  4MNU A;  3MKY B;  4BQQ A;  3E5X A;  5C44 J;  1VQ4 I;  5ILV A;  2V1X A;  1YIJ I;  2MLG A;  5D5X B;  2XKP A;  3I64 A;  2QQA A;  4RB0 A;  3QAH A;  1HW2 A;  3DPU A;  4E7Z A;  2EIM H;  4XRS A;  5IPA A;  3OYF A;  3P9K A;  1W7P B;  4D0P A;  3OYM A;  5FLM J;  3WOD F;  5IY5 H;  3CCL I;  3DLL F;  3G1L A;  4HF2 A;  3CJQ B;  4WXH A;  3ZQI A;  2HFH A;  4XR6 A;  1SMT A;  4QLC U;  2FBH A;  1EF4 A;  2V6E A;  1JKQ C;  1RET A;  1DU6 A;  1HKS A;  2HXO A;  3G4S I;  2L54 A;  1MKM A;  3GXO A;  4PJM A;  3I5U A;  3F8C A;  2HOE A;  3GW2 A;  2NXN B;  4CIC A;  4BY1 J;  3SZP A;  1UAA A;  4HNT A;  4YFX F;  4G6D A;  2BXZ A;  1W4M A;  3BCA A;  2DPU A;  2A07 F;  2TCT A;  3PIP F;  2IA2 A;  4BU2 A;  5HS8 A;  3CCS I;  4GRI A;  3SFZ A;  3T8R A;  2KDZ A;  2OA4 A;  5DTD A;  1UB9 A;  3BRO A;  2ID3 A;  3A0H C;  3LWF A;  4ZZL A;  1K4S A;  5IT9 Z;  2QCO A;  4C2T A;  2JA2 A;  2K7L A;  3HGY A;  1SD4 A;  5EDN A;  3M4O J;  4S04 A;  1EH6 A;  2IEK A;  2M8E A;  4O6J A;  2DQL A;  3GFL A;  4XMY A;  1LDJ A;  1ETW A;  1R58 A;  4YEJ A;  3DV8 A;  5EZG A;  2XGD A;  3L2W A;  5D6E A;  1YS6 A;  3E5Q A;  4XN0 A;  4NDL A;  4HX7 A;  4BDZ A;  1VFC A;  1FOK A;  5LHI A;  4Q48 A;  1QZZ A;  3CDI A;  4EVI A;  3J81 Z;  4BHC A;  4BDY A;  1MBJ A;  3L2R A;  2RN7 A;  1OLT A;  3SFI A;  4S0H B;  2YUS A;  2VBZ A;  3ZR8 X;  3KP4 A;  1SMY F;  3CDL A;  1ZG3 A;  2P0W A;  3V42 A;  3BT9 A;  1P7I A;  4CSW A;  1QPM A;  2QBY A;  2L7M P;  2A6E F;  1X4O A;  1ZGA A;  5LD2 C;  3HOU J;  4OIP F;  2WAQ A;  2ELJ A;  1ZK8 A;  4HDV A;  4G7H F;  5BPD A;  4L0Z B;  2W84 A;  3GWZ A;  1XDU A;  5J47 A;  1Y6I A;  2M8G X;  2EA2 A;  1WJD A;  2CWE A;  1SC7 A;  3GUD A;  3SEQ A;  3RPU D;  1W1W E;  2XGX A;  2HVQ A;  4WXC A;  3P7N A;  4XL9 A;  2DN0 A;  2JK3 A;  3GME A;  3HEF A;  5FLV A;  2EZI A;  4JP0 A;  1TWG J;  2L5Q A;  2HKX A;  2UXX A;  4BQN A;  1TC3 C;  1MMA A;  2LMD A;  4F52 A;  3X2Q H;  2F5V A;  3AG3 H;  1GXQ A;  2PQ8 A;  3DCF A;  5EYR A;  3JSO A;  2IS6 A;  2EFO A;  1I6X A;  4M9S A;  2M9H A;  3HIF A;  2ETH A;  1I50 J;  2VPR A;  4M6V A;  2W57 A;  1VQL I;  3QU6 A;  2A69 F;  3ECO A;  4ENM A;  1P2F A;  1MJ9 A;  1MBF A;  3CUQ B;  4LJZ F;  1BI3 A;  1UHM A;  2XUB A;  1HC8 A;  1TLH B;  5CLS A;  3F22 A;  4PDK A;  2BYV E;  2H1K A;  5IOY A;  2E1M C;  3GO5 A;  5BNG A;  1K6Y A;  5B3S H;  3G73 A;  2ZFU A;  3A03 A;  4MFD A;  3SXY A;  1B9M A;  4XLP F;  2E19 A;  4XNF A;  4EJV A;  2XAS A;  3ROU A;  2L2O A;  3ABT A;  2Z9O A;  5H6Q A;  2BVL A;  3CMM A;  2FQ3 A;  4JOM A;  3F23 A;  5M3M J;  2Y69 H;  4EGZ A;  2ZFW A;  4P9F A;  3ZMS A;  4A6D A;  5IOZ A;  2KT0 A;  3WHC A;  2IS1 A;  3NWS A;  5CQE A;  3TGN A;  1T8I A;  4AYB A;  3FHZ A;  2PN6 A;  1X58 A;  3QOP A;  3OY9 A;  2O03 A;  4W97 A;  3VPR A;  4MTE A;  3WTZ A;  1H8A C;  1MSE C;  1OCZ H;  5DEQ A;  1G59 A;  2EV6 A;  1XTA A;  5IYB J;  1V5E A;  2WY8 Q;  1AWC A;  1YLF A;  1E2X A;  2VJI A;  2VQG A;  3RQ4 A;  4WCG A;  2RAE A;  4DBQ A;  2XRL A;  3I4N J;  3AG1 H;  2X48 A;  3FXK A;  4HV6 A;  5A2Q K;  2IA1 A;  2HVR A;  3Q9V A;  3GZ5 A;  5K5O A;  3IH3 A;  3LSH A;  3F21 A;  1VQO I;  4A0Z A;  3VYS B;  4LB6 B;  3G2B A;  1LE8 B;  4G94 A;  3ULQ B;  3ONQ A;  3SZG A;  2JN6 A;  4B48 A;  3OYB A;  3SDG A;  4D9J A;  3L2C A;  4CYC B;  3K69 A;  3V8K A;  1R71 A;  5GAH J;  3PJR A;  3FK7 A;  3H0G J;  4U88 A;  2BXY A;  3DTK A;  5A2Q Z;  2ZNZ A;  2E1C A;  1TTY A;  4XOR A;  5HS7 A;  1IN7 A;  2EIN H;  1ZGJ A;  3K4K A;  5AON A;  2RV8 A;  4HV5 A;  1R5I D;  5L3B A;  3S1Q J;  1V3F A;  2XC7 A;  2EWN A;  1SAU A;  2WAD A;  4F55 A;  2MBF A;  2OF7 A;  3K1N A;  4A12 A;  1OMI A;  1X3U A;  3WTS C;  3NAU A;  4AC0 A;  2Z33 A;  1ERD A;  3GLX A;  4FCY A;  2L9R A;  1HOM A;  1REP C;  5HDG A;  1R7J A;  4P55 A;  2FML A;  1ZYR F;  2COM A;  4Y4R A;  2X4H A;  2KP6 A;  1IN5 A;  1ODD A;  2V7F A;  1MW7 A;  3HUG A;  4OAZ A;  4B09 A;  3QQA A;  1MND A;  4P5O A;  3VSK A;  2CQQ A;  3HKZ N;  3I4P A;  2DFH A;  2P5V A;  4HG2 A;  4IQJ A;  5F04 A;  1BJZ A;  1O3Q A;  4HZF A;  1TWH J;  3RTR A;  3HTS B;  4L5E A;  1G4D A;  3S17 J;  3TDZ C;  2UZK A;  3OIP A;  4BQA A;  1YW7 A;  4NUB A;  1S72 I;  5TIS C;  3BP8 A;  3PFY A;  3GTL J;  3LSR A;  3QOD A;  5GAE J;  2QA4 I;  2K9N A;  3IAM 2;  2LBF A;  3DBR B;  2ZKZ A;  1NHA A;  1QNT A;  2E7X A;  2IA0 A;  1RUN A;  1SFX A;  2HWV A;  5AIP A;  3M1E A;  2VOO A;  5HLH A;  1T98 A;  2L0K A;  3KZY A;  4EAT A;  1FIA A;  2OUM A;  2CO5 A;  1B9N A;  3G71 I;  4UUS B;  1YJ9 I;  5LHG A;  3AG4 H;  4B43 A;  3Q0V A;  5EEG A;  5EGO A;  2P5L C;  1WSU A;  4LK0 F;  4UVC A;  1FYK A;  5EZH A;  2L7F P;  3S1N J;  1SEU A;  3GFM A;  3E3V A;  5K5R A;  2V1D A;  3KP7 A;  1P4X A;  4KMU X;  4RGR A;  3BR3 A;  3CO6 C;  2P4W A;  1A5J A;  2KRF A;  4PSX A;  3FM5 A;  4PFO A;  5F0H A;  4D7N A;  4RGS A;  5E8G A;  4ZDO A;  3FDY A;  1NH3 A;  5H2F C;  1CGP A;  3W2A A;  4IEJ A;  2NVT J;  1JUM A;  4AVZ A;  4C3H J;  1W7P A;  3JRA A;  1TQI A;  3FF5 A;  1CQT A;  1YRN B;  1EA3 A;  1YJW I;  2DPD A;  2DOF A;  3KYC B;  1LFP A;  2VBY A;  1BW6 A;  3NWT A;  4IHT A;  1ETY A;  2KFD A;  2QKL B;  5J3L A;  2R7D A;  1FYL A;  2JUC A;  3R0A A;  2GXG A;  1MBG A;  4IXA A;  3RDI A;  3ERE D;  3R4K A;  3AAF A;  2PG4 A;  3E5U A;  3E0J B;  2GOX B;  1E0E A;  5CPR B;  2O9L A;  2DMP A;  1ZG1 A;  2HDD A;  4W1U A;  3EPZ A;  3ZQQ A;  2F4O B;  1FWZ A;  4XK4 A;  1G2H A;  2KJC A;  2J5P A;  1W0U A;  5CVR A;  3F9K A;  2L7Z A;  4DNC A;  2ZBK A;  1HSJ A;  4JBA A;  2FOW A;  3JAM K;  2UWM A;  3VEP A;  2DCE A;  3BQZ A;  3LFK A;  3O8H A;  1HF0 A;  1J2X A;  3CUO A;  3OYL A;  1H0M A;  1MZB A;  3HB9 A;  4GYG A;  2VKE A;  3OMY A;  1RR7 A;  2KPM A;  2OZU A;  2H8R A;  1G3S A;  2HNH A;  2DOE A;  2X1D A;  1ZRC A;  2XAH A;  1FIP A;  3OL4 A;  3JRB A;  2TRT A;  4AUX A;  4A69 C;  1TQM A;  2Z3Y A;  2R7W A;  1JT0 A;  3MKL A;  4BHB A;  2L3D A;  4A0Y A;  2F5F A;  4GGG A;  3NQO A;  4MGR A;  4XLA A;  1K79 A;  3H3Z A;  5KVR A;  2ZO4 A;  2ME0 A;  5L3G A;  1FSE A;  3PL8 A;  1WJB A;  3W2V A;  1ZLK A;  3V7C A;  1XX5 A;  3CF5 F;  2DDB A;  5ILU A;  1JUS A;  2CV2 A;  2MSY A;  2XSD C;  4ZYG A;  4LLL A;  1S7E A;  4OWR B;  2R5Y A;  2XF7 A;  2PMH A;  3OSF A;  2CJJ A;  2E1O A;  3HRM A;  2R7R A;  1QA6 A;  3D5S C;  4M3B A;  4ZYE A;  2VXZ A;  4G7Z F;  2NVX J;  2R7Z J;  3VFZ A;  2GLO A;  2CV0 A;  3BR5 A;  5KAI C;  1AOY A;  5FD5 A;  4ESJ A;  2NOG A;  3KLO A;  2MFZ A;  3OYD A;  3KZZ A;  2WBM A;  4BS9 A;  4Q5S F;  3LA2 A;  4HNV A;  2HU9 A;  2FE3 A;  2AXL A;  4OIQ F;  1ZKG A;  5BOX A;  2STW A;  5ICE A;  2XAG A;  3WU0 A;  3ZN0 A;  1T33 A;  2EJR A;  4RA2 A;  2E36 A;  3P9C A;  3PSF A;  2EZH A;  4M9X A;  2A5Y B;  5E3N A;  2VOP A;  3ECH A;  2Y9Z A;  4IOA F;  2I5U A;  4FX0 A;  1VQK I;  2D1H A;  1G6N A;  3BJA A;  4I76 A;  1JKP C;  1IV6 A;  1B72 B;  2RKH A;  1N77 A;  1FEX A;  3CJN A;  3ZGK A;  1J59 A;  4XBF A;  5BPI A;  1U8B A;  2C6Y A;  3HTU A;  1N25 A;  3OOU A;  4JYK A;  2VJJ A;  4G6T B;  2GA1 A;  5JVT A;  3L2V A;  2ZC2 A;  1TWC J;  1MDM A;  1XMK A;  1A04 A;  1W5T A;  2JTV A;  1FBS A;  3AFH A;  3GTQ J;  2P7V B;  1D5Y A;  1BI0 A;  1MMD A;  2QSF X;  4Q47 A;  1UFM A;  4F7Z A;  3R0J A;  1BI1 A;  3SYT A;  5GAD J;  1R4M B;  3BTJ A;  4RGU A;  2QEN A;  2MH9 A;  3WU2 C;  2WAE A;  4C9Y A;  3CO7 C;  2KRH A;  3OYA A;  1HXD A;  1UEL B;  2KIM A;  2QEX I;  5FKL A;  4D5F A;  4II2 A;  2VIX A;  5HNF A;  3GFI A;  1SFU A;  3BR1 A;  5M5W J;  5J8F A;  2OBP A;  4Y15 A;  2XB0 X;  4I99 C;  2HQA A;  1Z05 A;  3BG9 A;  2GM4 A;  2ECB A;  3TP0 A;  2VT2 A;  3S16 J;  3QPS A;  2BHY A;  3MZ8 A;  5ICG A;  3FHN A;  4XLE A;  2B9S A;  5J8C A;  3PO2 J;  5E8I A;  3CLO A;  4UY8 I;  3H5R A;  4I01 A;  1FZP B;  3IAS 2;  1N78 A;  2W24 A;  1S29 A;  2DA5 A;  1LE8 A;  3DU6 A;  4PCQ A;  1KGS A;  2Z16 A;  1NTC A;  4IZZ A;  1MGT A;  5CJ9 A;  4A93 J;  4Y3O A;  4CCK A;  4NB5 A;  3K7A J;  3GZ6 A;  1K78 B;  4QWQ A;  3TO9 A;  4B4C A;  4BXX J;  3GTG J;  1HDP A;  2E34 A;  3EET A;  5FFX A;  1Y56 A;  4IOC F;  2K40 A;  1OYI A;  4CH7 A;  5LEJ A;  2A3S A;  4K2E A;  4V19 K;  2DT6 A;  2M30 A;  3LL7 A;  4FET A;  3KIO A;  3FM3 A;  5LRR A;  1RR8 C;  4PJN A;  2IBD A;  2HKO A;  2XVC A;  1RRJ A;  1T39 A;  1XGM A;  2JJ7 A;  4LIT A;  5K7Z A;  3SQN A;  2PI0 A;  2EIJ H;  2RNG A;  1F9N A;  4I7H A;  3KZI C;  2HDW A;  4OU0 A;  3K4B A;  2HI3 A;  4ABZ A;  3J80 Z;  5DV5 A;  4CA0 A;  3HOX J;  3KEO A;  2ZXW H;  1FPQ A;  2CUE A;  1LVA A;  1Z21 A;  1TBX A;  2ISZ A;  1G3T A;  1R1T A;  1XC5 A;  2MAB A;  5KK1 A;  4F91 B;  1NK3 P;  4FE7 A;  2EPF A;  4EGY A;  1XCB A;  4BBS J;  4A3K J;  2CFX A;  3C2H A;  5ILS A;  5K7F A;  2XAU A;  1B8I B;  4YIF A;  2G7U A;  1G3W A;  2Y0S N;  4CXF A;  3WTV C;  2A5W A;  3KEY A;  2LNB A;  1GXP A;  1FT9 A;  1C0W A;  1GHC A;  1Z67 A;  3CLQ A;  1T2K A;  2VLA A;  2VQC A;  3I59 B;  2JA5 J;  1XMX A;  5HOD A;  2Y75 A;  4I02 A;  3ESW B;  2HZD A;  3F6V A;  1SFE A;  2OCE A;  1V5F A;  1HST A;  3IKV A;  3VOE A;  1LKX A;  4CDG A;  1JXS A;  2CUJ A;  4BL0 B;  2VE9 A;  4AIJ A;  4LG0 B;  4A5N A;  1JT6 A;  4HLX A;  3HRT A;  2NS8 A;  1Z0X A;  2WC2 A;  3DPT A;  2QYO A;  4N4N B;  5CKT A;  2HQ5 A;  5IP9 J;  5K1Y A;  2GXB A;  4FIS A;  4I98 B;  4CZZ A;  5HLG A;  2M2E A;  2HOT A;  4QPO A;  1NK2 P;  4KDP A;  2ESN A;  1Z1D A;  4KFC A;  2NS7 A;  3JRG A;  2R7U A;  4UV8 A;  2KIU A;  1X19 A;  2PEX A;  3ABK H;  1AU7 A;  1XPX A;  1IRX A;  2OTJ I;  2HQR A;  3REO A;  3OIO A;  4ZYH A;  4NC8 A;  1LEA A;  2ID6 A;  5E18 F;  4X0G A;  2QF7 A;  3ABU A;  2L7K A;  3PNT A;  2H94 A;  2Z2S B;  4YEL A;  5DCF A;  4ZDL A;  1W0T A;  4FAS D;  2LVS A;  4I0A A;  4M3D A;  1ZRD A;  1R36 A;  2HTJ A;  2ZJ2 A;  4XID A;  3ZP5 A;  3O3K A;  5DCM B;  1USS A;  1T0F A;  4BBR J;  2IJL A;  3MEX A;  5JLX A;  2DOD A;  3QU3 A;  2WB1 N;  3RQI A;  4KYW A;  4ESB A;  3HSF A;  1MNE A;  1S9H A;  1WH5 A;  2V1N A;  3LQQ A;  3ZXS A;  5C4X J;  3I58 A;  3FX3 A;  4DYQ A;  3FBN B;  4A3D J;  4PK4 A;  2LYC A;  5LGN A;  1Y0N A;  2BW3 A;  1YJN I;  1K61 A;  2D45 A;  3RYR A;  4FTH A;  3ZQG A;  3OOP A;  2PX9 A;  2L4A A;  1ZG5 A;  2DMU A;  3F8N A;  3ELK A;  1WHU A;  1Y1V J;  2DMT A;  4QSH A;  4ZZD A;  1LQ1 A;  4P1W A;  4ETS A;  4LIU A;  4ZTF A;  4EV0 A;  1MJB A;  5GPC A;  3FXQ A;  4J19 A;  1YIO A;  4PJL A;  3R60 A;  2JT1 A;  2DBB A;  1O4X A;  2E1M B;  2LY9 A;  2V9V A;  2GOM A;  3KCC A;  1E3P A;  5EG0 A;  4KIB A;  3LAP A;  4IHV A;  3IRR A;  1J9I A;  1B59 A;  3HJE A;  5CVU A;  4RS8 A;  3CMY A;  2GAU A;  2Q8K A;  1BL0 A;  3T8T A;  3U2R A;  3COA C;  3HKZ A;  3LSP A;  4A3L J;  3CCR I;  4Z6Y A;  5GTI C;  1I39 A;  4RMN A;  5E1Z B;  5HLI A;  3GTK J;  2X0L A;  5LEK A;  3E6B A;  3AG2 H;  3Q9S A;  3CCJ I;  2ACJ A;  4IRI A;  2WA0 A;  4XRF A;  1KU9 A;  1R9T J;  4AM3 A;  2AO9 A;  2M0C A;  3ASN H;  1W5C C;  3S8P A;  5TJJ A;  4ENK A;  1W36 D;  3FIW A;  4N0B A;  2M1B A;  3O2P E;  3GTM J;  3TED A;  1YS7 A;  4BYY A;  1OFC X;  4B44 A;  1JUP A;  2KQR A;  2QQB A;  4A3E J;  4NC7 A;  4MQ9 F;  4FX4 A;  1GT0 C;  1TQP A;  4LLG F;  4HLY A;  3PIO F;  2JVH A;  1AKH A;  2W00 A;  5D5U B;  4U7D A;  2ISY A;  4A0X A;  3JRH A;  4UB6 C;  2XAF A;  2R7V A;  4N4O B;  1LDD A;  1BIB A;  2OV7 A;  1D0X A;  2JZY A;  3ZQC A;  2GWR A;  3QOE A;  3EQL F;  3HZJ A;  4UV9 A;  1T56 A;  5AIQ A;  3SDB A;  4EMS A;  1XDS A;  3CC7 I;  5FKK A;  1HKT A;  1U5T A;  3RCO A;  1PUF A;  1NG7 A;  3DKX A;  2G0E A;  3KX2 A;  4O3M A;  1FLI A;  1YW8 A;  2QVO A;  2XRN A;  3WG9 A;  4GXO A;  5K7H A;  3KET A;  1IC8 A;  2QUF A;  1W36 C;  1LPQ A;  4LLN A;  1IJW C;  3BR0 A;  1CF7 A;  2BVM A;  3HSR A;  1FX7 A;  2IAI A;  4M72 A;  1Z3X A;  1KON A;  2X6W A;  1BR1 A;  1P92 A;  2PBI A;  3HRU A;  1U8R A;  3VSL A;  2QSG X;  2VC1 A;  2JSP A;  3IH2 A;  1SVO A;  3GX4 X;  3ZN1 A;  5JI6 A;  3WTY C;  2JRT A;  2EB7 A;  2Y31 A;  4OIN F;  3S1M J;  5DM6 F;  2ESH A;  1U9O A;  2M45 A;  1Y39 A;  2CQK A;  1IG7 A;  1A35 A;  4QPQ A;  1F43 A;  4RAF A;  2ICW G;  1OCO H;  3L9F A;  3VYR B;  5HS9 A;  4ASN A;  3LSG A;  3QRF F;  1RES A;  1ETX A;  5B1A H;  3P5J A;  2Z1D A;  4HAM A;  4KN4 X;  2DYS H;  3PUB A;  3H9J A;  4P96 A;  3WG7 H;  1YOV B;  1JHH A;  5EEH A;  4Y7N J;  2A61 A;  3DBL B;  1PVE A;  1MH4 A;  2NAZ A;  5FLX K;  2X1C A;  2MW8 A;  4DYR A;  4BNC A;  2YX7 A;  3D5R C;  5F0C A;  2K3F A;  3IV5 A;  2YPR A;  3WTT C;  1XMA A;  3CCY A;  2DLL A;  3CZ6 A;  4GCV A;  4GDF A;  3OYK A;  3S32 A;  2LH9 A;  2XHK A;  4IX7 A;  2QQ8 A;  2VB6 A;  2DT5 A;  1HDD C;  4XLF A;  4WX9 A;  2M7A A;  2ZB9 A;  3L2U A;  4UNO A;  3KE2 A;  4XKC A;  4YRV A;  4ENJ A;  2NVU B;  3PQJ A;  5BMZ A;  2O5R A;  2H1L A;  2EQR A;  3W6K B;  2A6T A;  4EQQ A;  5FLX Z;  2DOA A;  2HYG D;  5IT3 A;  1VQM I;  4BQO A;  4ON0 A;  2MC3 A;  1IW7 F;  5ICF A;  1WCM J;  4KA4 A;  3E6C C;  1MD0 A;  1LB2 A;  3DWL E;  3KFW X;  4IL6 C;  2CGP A;  2R0Q C;  4A3G J;  3HPH A;  2JUG A;  4KIT B;  4XLC A;  5J1R A;  3JTH A;  2P7C B;  2MYS A;  5E1X A;  1FP2 A;  4IF4 A;  2MG4 A;  4KT6 A;  5FJ8 J;  2KKO A;  3I0T A;  1I27 A;  1HW1 A;  2DDA A;  2KZG A;  5FRM A;  4NBQ A;  1R6R A;  3FXM A;  2GIZ A;  2B63 J;  1BW5 A;  4BKX A;  2L02 A;  1FC3 A;  1VI0 A;  1XN7 A;  5HNH A;  2NNN A;  3DTE A;  2GQQ A;  4HBL A;  2HQN A;  2Y48 A;  4KMF A;  2R7S A;  3CDH A;  1A31 A;  4LFU A;  4NC6 A;  5D5V B;  3JRC A;  2FEZ A;  1K4T A;  4IPA A;  2VUM J;  5HVQ C;  3ZCO A;  1R5H A;  3H92 A;  1S6L A;  3CES A;  4BE2 A;  3ISP A;  3DF8 A;  1U2W A;  2M4G A;  1D1B A;  2Q2E A;  5J1Y A;  2R5Z A;  2K3P A;  3TKY A;  2VXD A;  3W3C A;  1U3E M;  1FBQ A;  1PP8 F;  4L9N A;  2DA3 A;  4A3C J;  1WJ5 A;  5J4Y A;  3OV8 A;  1B8I A;  1QU3 A;  4E7H A;  2BBY A;  1Q1V A;  4KIG A;  3SJM A;  2VOD A;  3OS2 A;  3I59 A;  3C2B A;  5DUI A;  2CV1 A;  3LA7 A;  3EUA A;  1ZEL A;  2VKV A;  4MTD A;  3QPH A;  2HXI A;  4JX5 A;  2FA5 A;  4HX4 A;  4D5C A;  2H6B A;  4BH9 A;  3M07 A;  3ZMV A;  2LSO A;  3CCQ I;  1BJA A;  1ZRE A;  2LF7 A;  2CQN A;  2V26 A;  3K4L A;  5CVI A;  3ZMU A;  4BUP A;  4L9T A;  4CCL A;  1QGP A;  4PZJ A;  1X2M A;  1YG2 A;  2DA1 A;  4UHT A;  3F0C A;  2LC2 A;  1GV5 A;  4IVN A;  3VDX A;  1I6H J;  2RGV A;  2ZXJ A;  4IHY A;  5FKN A;  1V55 H;  2K9S A;  2JRM A;  3Q0W A;  3OYH A;  3OIQ A;  3S2H J;  1TNS A;  1SD5 A;  2ZSI B;  3C3W A;  4HA8 A;  5FKM A;  5E3L A;  3V8J A;  5DM7 F;  1YW9 A;  4LG3 A;  3WGI A;  4CCN A;  4YII A;  1LVK A;  5FGM A;  3V7R A;  1IRG A;  3ZOB A;  3MN2 A;  1VQP I;  1ZQ3 P;  1F5T A;  5M3F J;  3M8F A;  3GBG A;  2XPW A;  1FSH A;  5D5W B;  1UHW A;  4XLN F;  4NNJ A;  1VF9 A;  3OYN A;  4C2U A;  2EIL H;  1JKR C;  2PFB A;  3B6A A;  3ZQF A;  2KIQ A;  2K9L A;  4EM1 A;  3RKW A;  3KP6 A;  3TO6 A;  3RJP A;  2FBI A;  2G9W A;  2OQR A;  4MEY F;  4B47 A;  3LSJ A;  1FYM A;  4XOT A;  4L0Y B;  2JVG A;  5DCM A;  2DTR A;  2LG4 A;  1BC7 C;  3DFG A;  3FXJ A;  3M7G A;  3OS1 A;  2DA4 A;  1Z9C A;  5J1U A;  4XLH A;  2F4I A;  1QBJ A;  4DIQ A;  1QHH D;  4KNY A;  1QPI A;  5C4J J;  2LF8 A;  2HOS A;  3W6V A;  3IP4 B;  2Z99 A;  3OR1 C;  2PMU A;  3G3Z A;  2NOJ B;  1OCC H;  2KIS A;  4RB2 C;  3TW6 A;  2DA2 A;  2DMN A;  1MJA A;  2AXT C;  5JFR A;  2LKP A;  2XSJ C;  2FOK A;  1U9N A;  3KEQ A;  5JR3 A;  2R7Q A;  3I55 I;  1J0R A;  5FO5 A;  5DD4 A;  3UNG C;  2JA6 J;  3H3U A;  4DGW B;  1FNN A;  3CCE I;  1SFK A;  3L2Q A;  3CC2 I;  5ED4 A;  2O0Y A;  2R3S A;  1HLV A;  2EV5 A;  4DBR A;  2WWY A;  1OCR H;  3C2G A;  3RPU A;  4D1Q A;  4MLO A;  1IRZ A;  1GV2 A;  4RM3 A;  3BTL A;  5K5Q A;  4GYI A;  2E2H J;  2DU9 A;  4WF2 A;  1IDZ A;  2Y0S A;  2GBY A;  2E60 A;  4L18 B;  1I5Z A;  4KT5 C;  3E7L A;  1RNL A;  3HXL A;  4CGZ A;  2BE5 F;  1AHD P;  2F4M B;  3DLA A;  2OTL I;  4EJO A;  5H6R A;  4IHS A;  2YX4 A;  2P5K A;  1RIO H;  2CYY A;  1OCP A;  1V4R A;  2A68 F;  1ZR2 A;  3JAM Z;  1ACI A;  2Y0M A;  1IRF A;  1P4A A;  2OJE D;  4O5V A;  3MCZ A;  4C3J J;  2LRD A;  3UR3 C;  2ZME B;  1LFU P;  2LR8 A;  4M6X A;  4LMY A;  4DZJ A;  3ZRG A;  4UUT A;  1JGG A;  1UZC A;  1BC8 C;  2F5E A;  2ZXH A;  1IN6 A;  2FD5 A;  1Z6T A;  2PLY A;  2X9D A;  1K83 J;  4LIV A;  5FFZ A;  1R00 A;  1SAN A;  2KLO A;  3HHH A;  4MHG A;  3W6J B;  3HRS A;  1BIA A;  9ANT A;  4E4H A;  2JPC A;  3QYB A;  4NHJ A;  4U7B A;  3J7A Y;  2JMW A;  2HPM A;  1XD7 A;  2FMY A;  5H20 A;  1H89 C;  1R4N B;  2EK5 A;  3T1B A;  4OIO F;  1G8X A;  2W7N A;  3GEZ A;  1BM9 A;  3DP7 A;  3VOD A;  4M3F A;  1UCR A;  1H9T A;  3BOQ A;  2DW4 A;  1L0O C;  1AA7 A;  3VYU B;  1FP1 D;  3F8F A;  3KP2 A;  4L5I A;  4JK1 X;  4UXN A;  4WK8 F;  4EM2 A;  2HYJ A;  1FOY A;  3VYT B;  4P9U A;  1VZ0 A;  3J7A O;  1G3Y A;  2QGU A;  2AHQ A;  2V6C A;  2NRA C;  2WB1 A;  4PSW A;  2K4J A;  2JSC A;  3H36 A;  3LMM A;  2BY3 A;  2OC6 A;  2R4G A;  5KAF C;  1DQU A;  1O57 A;  4HW0 A;  1IXS B;  1T0F C;  1TW3 A;  3GZN B;  1WH7 A;  4ZTJ A;  3DXJ F;  3CUQ A;  3AL0 B;  2VC0 A;  1KQ0 A;  3NAR A;  2Y2Z A;  2K4B A;  3KPH A;  3CME I;  3FMS A;  5IP7 J;  3E6D A;  5HOO A;  4KIC A;  3J7Y J;  2LFB A;  2UV1 A;  3OYG A;  3FBI B;  1PUE E;  3K10 A;  2FSW A;  3K1M A;  1W5S A;  1LJ9 A;  2DYR H;  4Q4Z F;  4A3F J;  1QRY A;  2K5C A;  3V8L A;  4Y52 J;  2CW7 A;  2H6C A;  1FOX A;  2M4K A;  4C3I J;  3LSM A;  1DPR A;  2GIV A;  3A01 B;  1O7L A;  1OQY A;  1A6I A;  5B66 C;  1UST A;  1R1U A;  1Y0U A;  3I3L A;  1OPC A;  3TDU C;  4QIW N;  2HZT A;  3U21 A;  3B02 A;  1ZAO A;  1XGN A;  1DGR M;  3PM1 A;  2P6T A;  2XDV A;  4E6K G;  1LDK B;  2L4M A;  2IP2 A;  1ZGW A;  4GFB A;  2EZK A;  1X4P A;  1ENH A;  2JQ7 A;  4OMY A;  5L3E A;  1I1G A;  1RKW A;  1UG2 A;  1D5V A;  1MBK A;  2XF6 A;  1BA5 A;  3F8M A;  2IGK A;  1MBE A;  1X3Z B;  2E2J J;  2IVM A;  3L7W A;  2W48 A;  1OIS A;  2LDU A;  1I3A A;  4IO9 F;  2GXA A;  3LNQ A;  4X6A J;  4BXU A;  2HEO A;  4CYC A;  2O6G E;  1RZ4 A;  4RDU A;  4A3B J;  3LSI A;  3F8B A;  2OAZ A;  2BEO A;  1T6S A;  4A3I J;  1ZLJ A;  3MKW B;  1MMN A;  1WQ2 A;  4HX8 A;  1VND A;  4IJA A;  4HF1 A;  2R92 J;  2P6S A;  3BY6 A;  1NG6 A;  3KYD B;  2V9P A;  3MZY A;  1R22 A;  4NQW B;  4RGX A;  1JTX A;  5E3M A;  4ZYD A;  3S3N A;  2W1O A;  2AQE A;  4M3G A;  5M5Y J;  1TL8 A;  5JHU A;  2QZ8 A;  3HC7 A;  4L5J A;  1WJE A;  1EH8 A;  2E1N A;  1QZY A;  2M7B A;  3LST A;  1VQ9 I;  1F36 A;  4E7S A;  1U5T C;  2V79 A;  5FKO A;  3JRI A;  1WJF A;  5DYM A;  3FKI J;  4MFE A;  2NS0 A;  1X1P A;  2VJ5 A;  3PNY A;  3FMR A;  4BAC A;  3Q5F A;  2X6O A;  4PGG A;  2RC4 A;  1QVT A;  1JKO C;  3A4C A;  2FNA A;  1FY7 A;  2MD0 A;  1U78 A;  3R61 A;  2QKM B;  2COB A;  3R6S A;  4HQM A;  4A6E A;  3GCM A;  1JHF A;  4H0E A;  3DU5 A;  1WWX A;  4JQF A;  2DT7 B;  1APL C;  3BQY A;  1S7A A;  5LRS A;  2CUF A;  4OIR F;  1O3R A;  3K70 D;  3PO3 J;  1JTY A;  3A2K A;  3I54 A;  1UG0 A;  3U9G A;  2E7W A;  2IXS A;  4DW6 A;  3S2D J;  1Z7L A;  3EUH A;  2VAS A;  3FWE A;  4EJW A;  1T95 A;  1J5Y A;  2RRE A;  3HUG B;  1BBY A;  4I0B A;  1S7O A;  4H4K C;  5TRD A;  2Y30 A;  4KN7 X;  2JWT A;  2M87 A;  4G12 A;  4HDU A;  2STT A;  1X2N A;  3JSP A;  4HYE A;  4M74 A;  4HSR A;  4UUS A;  5J40 A;  1FOW A;  1IN4 A;  1KA8 A;  2FX0 A;  3DPL C;  5L3D A;  2ZJR F;  2NVQ J;  3CCU I;  3CF2 A;  3KYL A;  3EDP A;  4I09 A;  4BEH B;  3L00 A;  1SAX A;  2RNJ A;  2CG4 A;  2XIG A;  2D5V A;  4E7L A;  3K70 C;  2Q1Z B;  5HDN A;  5E20 A;  3CP8 A;  3DTI A;  5ICC A;  1WI9 A;  3TO7 A;  3JCU C;  1TT5 B;  2AQF A;  3K2A A;  4QTR A;  3MAJ A;  2PJR B;  1BR4 A;  3ZQ7 A;  1XSD A;  3BWG A;  2MD5 A;  4UB8 C;  4Z2Y A;  4ITV A;  1ZHF A;  2VBW A;  5EGO B;  4U0V A;  4E7K A;  3HBL A;  3TL4 X;  1YRN A;  2J5O A;  1GVD A;  2CQ7 A;  3BR2 A;  3IH4 A;  1HA8 A;  1I1S A;  3H1C A;  2MGQ A;  3S3M A;  3OWT A;  2ELH A;  5FRO A;  1LEB A;  1IN8 A;  5D8L B;  3PFI A;  2VL8 A;  2DK8 A;  4LOC A;  4BJ5 C;  2V4J C;  5ERI A;  3MZH A;  3IKT A;  2VT3 A;  2BOL A;  4FQG A;  3H5A A;  2HOA A;  2FRH A;  1SVL A;  1ZRF A;  1WVR A;  2FJ1 A;  2FXA A;  4I2O A;  5D8K B;  2HPI A;  1F1Z A;  3DKY A;  3ABM H;  2HTS A;  2K27 A;  2I8D A;  2EIK H;  4II3 A;  2O7O A;  3HOZ J;  2V9K A;  4BJ6 C;  2KZV A;  3ERM A;  1KYZ A;  3QYE A;  2XPU A;  5F1R A;  2DFE A;  3CJT B;  5IT9 K;  1JJ8 C;  1FMW A;  2KL4 A;  2R7F A;  3P9I A;  4R79 A;  2IW5 A;  1GLN A;  4ENN A;  2LRE A;  3K4N A;  1VTN C;  1SVM A;  2X1E A;  4IRG A;  5LFA A;  5F6F A;  2K85 A;  4KJZ A;  1PYV A;  2JA8 J;  1OCT C;  3BTI A;  3SEZ A;  3TOA A;  4BHP A;  2N8G A;  1IO2 A;  3GVA A;  1EKE A;  5DDG A;  4RB3 C;  2ZME A;  4OOI A;  3V4G A;  2OU2 A;  3C7J A;  2R93 J;  2MLK A;  4RBO A;  3J81 K;  3MMY B;  1HBX G;  2VJ4 A;  4CCO A;  4DYC A;  3BPX A;  4FT8 A;  2ECC A;  4B3X A;  3D5L A;  2I10 A;  2IGM A;  1D1A A;  1P6R A;  1WI3 A;  1TW2 A;  5D4S A;  1OYY A;  1S3J A;  5LBQ A;  4HEA 2;  1W7P D;  4RLQ A;  4EEF G;  1D8J A;  3RKY A;  3ZPL A;  3DBH B;  4J01 A;  3GLL A;  5CVJ A;  6PAX A;  3MFK A;  1XB4 A;  3BR6 A;  3HOY J;  3S1R J;  2WV0 A;  4EM0 B;  1IF1 A;  1B6A A;  1WJA A;  2VQH A;  4XKV A;  4AD9 A;  2R5Y B;  1YFH A;  1X1C A;  3M9A A;  4RAG A;  4KUM A;  1FTT A;  2E71 A;  4M9Z A;  1XSV A;  2ELK A;  2EFN A;  1S8N A;  2D2W A;  2EFW A;  3L09 A;  1B4A A;  2DO7 A;  3A1Y A;  4IRH A;  4XIC A;  3A0B C;  3SZT A;  1MMG A;  3WGH A;  3H5N A;  5E3O A;  3O6B B;  2W85 A;  3HOT A;  4HST A;  1B72 A;  2B0L A;  3H0D A;  2PJP A;  3K4C A;  2XPV A;  1P7J A;  1YO5 C;  1EH7 A;  1V5G A;  2CQX A;  4UUV A;  1OR7 A;  4XKB A;  2Z5U A;  4U87 A;  1VQ6 I;  1D0Y A;  3PNV A;  2EZL A;  3O8G A;  4PJJ A;  4XN3 A;  2M0M A;  3CCV I;  1SFO J;  1YYV A;  4D7M A;  3BPV A;  1Z7U A;  4A3M J;  3HGG A;  3OSG A;  5J4V A;  2WV1 A;  4WWC A;  1X3W B;  3OYC A;  2K9Q A;  3DEU A;  2M3A A;  4XRS G;  1IAW A;  5L3C A;  5LGT A;  4HOB A;  3S2W A;  5B1B H;  3CC4 I;  4XRM A;  4AID A;  3A01 A;  4JX6 A;  2LLK A;  2W82 A;  1TT0 A;  2YU3 A;  3K4M A;  1ON1 A;  2F2E A;  5KCM A;  1MDM B;  4KIF A;  3UKG A;  1MSF C;  3S15 J;  2OQG A;  3FZV A;  3QPL A;  2LKS A;  3EUK L;  1Z77 A;  5EEA A;  4G8X A;  1IDY A;  2CUZ A;  1WKM A;  1WPK A;  3FK6 A;  3WE2 A;  3HL2 A;  3RI4 A;  3BZC A;  1X1D A;  2V1U A;  3K1P A;  3AKZ A;  3BC8 A;  1YI2 I;  5GTH C;  4A2U A;  2HDC A;  2W25 A;  3J7Z I;  3D1N I;  1ETV A;  1FJL A;  4L9J A;  4ANJ A;  2FQ4 A;  3HSE A;  5JVG F;  5J6X A;  4YFN F;  4CZC A;  4XKW A;  4BY7 J;  1K78 A;  4BXF A;  1XCV A;  1XSX A;  3N05 A;  3IWF A;  5F1J A;  3M3Y J;  3WTU C;  1MNM C;  2LKX A;  3LA3 A;  3PSI A;  1XS9 A;  1D8K A;  2O61 A;  4V2G A;  1ITY A;  1TWF J;  3FXU A;  1QZE A;  2QM3 A;  4RLF A;  1DP7 P;  3ZMD A;  5LGU A;  1QHG A;  4L9V A;  3TP3 A;  1UHS A;  4N9I A;  4NQW A;  1HQC A;  5F08 A;  2FF4 A;  2XB5 A;  3E6M A;  2DK5 A;  4UVB A;  1FMV A;  1X1B A;  3IC7 A;  2XF5 A;  3RYP A;  1PDN C;  1ZR4 A;  4IKF A;  1JGS A;  2YU9 J;  3RZO J;  3GTP J;  1MMS A;  1STZ A;  5CQG A;  1Z6R A;  3GF2 A;  4LK1 F;  3OYJ A;  4M73 A;  1U6G A;  1BOA A;  2CS3 A;  2L9V A;  1YX3 A;  1EV7 A;  4M6Y A;  5IP6 A;  3EYY A;  3G1M A;  1LUJ B;  1L3L A;  2DI3 A;  4CCJ A;  1XGS A;  3ZMT A;  4EJU A;  3JRE A;  1VQ7 I;  2EV0 A;  1DGW Y;  2OZ6 A;  1KZH A;  1IGN A;  1WRJ A;  5DUK A;  2X51 A;  1A36 A;  3HHG A;  2BY0 A;  5E1W A;  4DOZ A;  5LHH A;  2WTE A;  1MH3 A;  4LG0 A;  2YR2 A;  2DFF A;  2LTP A;  2O3F A;  3CUQ C;  5FD6 A;  2VKD A;  3IWZ A;  2K02 A;  3JW4 A;  2IRF G;  5B5E C;  3M8E A;  3BZK A;  3IL2 A;  3FIS A;  1R49 A;  3M8J A;  2O8K A;  1ETK A;  2KIF A;  3BTC A;  2OCC H;  4S05 A;  3C1D A;  2QSH X;  3QP6 A;  3OL3 A;  2VBX A;  3E97 A;  3I4M J;  1DUX C;  1DPU A;  2JA7 J;  5BS6 A;  1PJR A;  3MWM A;  4RM2 A;  4MO7 A;  3NEU A;  2M5W A;  3F72 A;  1D0Z A;  3T5X A;  1T08 B;  1RPW A;  2F5C A;  1SD6 A;  4BEH A;  4DZP A;  1IUY A;  2ADU A;  1GDT A;  2FNP A;  3DEW A;  4BJT A;  4F3Q A;  4DQ2 A;  2AS5 F;  1RC9 A;  3RKQ A;  3G1O A;  2PJR A;  3OYI A;  4CYD A;  2DQR A;  1DU0 A;  2ME6 A;  2NNY A;  2D1V A;  2WAQ N;  1RKT A;  2K86 A;  5FB2 A;  3HOV J;  1WFX A;  5KNL A;  3EYI A;  4KIS A;  3MKZ A;  1FTZ A;  1JI8 A;  5JHF A;  5LLQ A;  1R23 A;  3CQZ J;  3RKX A;  4WXD A;  2WAF A;  1O3T A;  1IUF A;  2EFP A;  2PMZ A;  1XGO A;  3H9G A;  4YG2 F;  3BG5 A;  3MQ0 A;  4J00 A;  2O8X A;  5HDK A;  4R8H A;  2E5N A;  3ZMZ A;  4CHU A;  4XSX F;  2LY2 A;  2CMP A;  2E35 A;  2X6Y A;  2DFI A;  3OYE A;  4PFP A;  3WGG A;  2ZJQ F;  3QWL A;  4XOP A;  2HGC A;  4HRI A;  4BGD A;  3FKJ A;  3VB2 A;  1LNW A;  3PUF A;  5KHD A;  4RAY A;  1ZTR A;  3I53 A;  2BHZ A;  5EJC A;  3VWB A;  2ZJP F;  1YE9 A;  4IHW A;  3T0Y A;  4LGW A;  4ZC3 A;  1KQ9 A;  2BW3 B;  1Y1W J;  4UVA A;  3RZD J;  3KLN A;  3W2W A;  1VQ5 I;  3L1P A;  4HNU A;  3CMA I;  1YTY A;  2B7E A;  3B6C A;  2IS4 A;  2Y9Y A;  1B1B A;  2YSR A;  2XAQ A;  2A6H F;  4E7I A;  3TOB A;  3IUO A;  3JRD A;  2LP0 A;  5F27 A;  2CFO A;  4AU7 A;  4CO8 A;  2BV6 A;  5F0F A;  5IYD J;  2VE8 A;  4PGH A;  1JE8 A;  5HLT A;  4E7J A;  4ZJZ A;  1YHQ I;  4X1E A;  2R7O A;  5EG0 B;  2QQ9 A;  3BCB A;  1IXC A;  4ZDP A;  2NVY J;  1Y8Q B;  2F6C A;  2VI6 A;  4AVP A;  3A02 A;  4AYB N;  3E1S A;  2KHM A;  4ZH4 F;  4AIH A;  1TP4 A;  1O7F A;  3GYH X;  3K4J A;  1QO0 D;  1EJ9 A;  4EJT A;  2L9N A;  1T38 A;  2RQQ A;  2XGE A;  5D4R A;  1RUO A;  2WY7 Q;  1MBH A;  3LOC A;  3OR2 C;  1A6Q A;  1OKR A;  2GA2 A;  2E2I J;  3RSN A;  2HVS A;  3EUH C;  3HPG A;  2HS5 A;  1Y8R B;  3M1C A;  3FMQ A;  1WZ2 A;  3D0S A;  2VKH A;  2H27 A;  1D3Y A;  4B1R A;  3BZ6 A;  4B8X A;  1S5L C;  3BG3 A;  1YQA A;  1H88 C;  3S14 J;  3H35 A;  2KJB A;  3B73 A;  3HOW J;  3F3X A;  4RAZ A;  4A5M A;  5GP9 A;  4GO1 A;  1R1V A;  3PQK A;  4BE1 A;  3I71 A;  2DA6 A;  3JRF A;  1AKH B;  2KDO A;  1E3O C;  4LD5 A;  1BN5 A;  2DTZ A;  2BY2 A;  1OYW A;  5EF6 A;  2MH2 A;  2GZW A;  2QBY B;  3BG7 A;  3CCM I;  3JR9 A;  1HCR A;  1N75 A;  4Y17 A;  2A05 A;  4YIR X;  4IHX A;  2DA7 A;  3H3V K;  1BOB A;  2P81 A;  4Y33 A;  3RPQ A;  4U0Y A;  1ZH5 A;  1U5T B;  2RQP A;  3NRV A;  1PUF B;  3SHF A;  1BI2 A;  2F48 A;  1HW5 A;  4G7O F;  3MVP A;  5GPA A;  1CF7 B;  4C30 A;  3I56 I;  2CH0 A;  2XV4 S;  3H9Q A;  3CTA A;  4R1H A;  3LAJ A;  1GVJ A;  1ON2 A;  1ZAR A;  4M71 A;  4HQE A;  1JJ6 C;  3IRQ A;  3WU1 B;  1I3Q J;  1PP7 U;  1E17 A;  2XAJ A;  1ONV A;  4A3J J;  3K2Z A;  1MIJ A;  4U0W A;  4CCM A;  4XON A;  1ULY A;  3CJR B;  4OMZ A;  2E5Z A;  4G6Q A;  2R7X A;  2L01 A;  3CP2 A;  3C18 A;  3QP5 A;  2TDX A;  2X85 A;  1YIT I;  3FXO A;  3OS0 A;  4C2M J;  5M5X J;  2FBK A; 
#chains in the Genus database with same CATH homology
 5BQT A;  3N4M A;  3BJ6 A;  4RB1 A;  3KP5 A;  3KP3 A;  2MA3 A;  3N97 A;  3ML6 A;  2F5D A;  2IPQ X;  3WTX C;  5F64 A;  4HF0 A;  2BGC A;  2HYF A;  2UXN A;  4N9H A;  1IXR C;  1J7K A;  1H9G A;  1FBU A;  5DD8 A;  4AWX B;  2QWW A;  2CSO A;  2JPB A;  3WTW C;  3DKW A;  2FU4 A;  2ZCW A;  3FXR A;  2G7H A;  3DQV C;  5D6F A;  2Q0O A;  2EA4 A;  2XKO A;  4MQV A;  1IZ1 A;  2EFQ A;  3J80 K;  3JTG A;  4TV7 A;  1K6O A;  3TQN A;  1Z91 A;  5CYV A;  3U1D A;  5CVV A;  4G9Y A;  2OD5 A;  1J75 A;  1DDN A;  1TNT A;  3HYI A;  5L3F A;  2XRO A;  1SD7 A;  1KU7 A;  1HKQ A;  3QPT A;  4ESF A;  1KU2 A;  2VON A;  3WE3 A;  1O3S A;  3K9T A;  4FHT A;  1F4K A;  4KMF A;  2RDP A;  4XSZ F;  1K7A A;  4Y13 A;  3RIR A;  5E17 F;  2ZNY A;  3GFJ A;  3K0L A;  2RVC A;  2H09 A;  3IHU A;  3BDD A;  1KQ8 A;  2HR3 A;  3V7S A;  4E70 A;  4BAY A;  1ZN2 A;  4YFK F;  2IT0 A;  1QQI A;  1Q1H A;  3BJO A;  4AIK A;  2NYX A;  2CW0 F;  1P4W A;  1R5G A;  4MEX F;  1KYW A;  2VN2 A;  2DAO A;  4LB5 A;  2QLZ A;  3F6O A;  1KU3 A;  3LQR A;  1RI7 A;  3HOS A;  2P8T A;  4MNU A;  3E5X A;  5ILV A;  2V1X A;  2MLG A;  5D5X B;  2XKP A;  3I64 A;  2QQA A;  4RB0 A;  3QAH A;  1HW2 A;  3P9K A;  1W7P B;  4D0P A;  3WOD F;  4HF2 A;  4WXH A;  2HFH A;  1SMT A;  4QLC U;  2FBH A;  1HKS A;  2L54 A;  1MKM A;  3GXO A;  3I5U A;  3F8C A;  2HOE A;  3GW2 A;  4CIC A;  3SZP A;  4YFX F;  4G6D A;  1W4M A;  2DPU A;  2A07 F;  2IA2 A;  5HS8 A;  3SFZ A;  3T8R A;  2OA4 A;  1UB9 A;  3BRO A;  3LWF A;  4ZZL A;  5IT9 Z;  2K7L A;  1SD4 A;  4S04 A;  1EH6 A;  2M8E A;  4O6J A;  2DQL A;  3GFL A;  1LDJ A;  1R58 A;  3DV8 A;  5D6E A;  1YS6 A;  3E5Q A;  4HX7 A;  1FOK A;  5LHI A;  4Q48 A;  1QZZ A;  4EVI A;  3J81 Z;  4BHC A;  2RN7 A;  2VBZ A;  3KP4 A;  1SMY F;  1ZG3 A;  2QBY A;  1QPM A;  2A6E F;  1ZGA A;  4OIP F;  5BPD A;  4HDV A;  4G7H F;  4L0Z B;  2W84 A;  3GWZ A;  1XDU A;  2EA2 A;  2CWE A;  3GUD A;  2XGX A;  4WXC A;  3P7N A;  2UXX A;  2HKX A;  1GXQ A;  2PQ8 A;  3JSO A;  2EFO A;  1I6X A;  4M9S A;  3HIF A;  2ETH A;  2W57 A;  3QU6 A;  2A69 F;  3ECO A;  4ENM A;  1P2F A;  1MJ9 A;  3CUQ B;  4LJZ F;  1BI3 A;  1UHM A;  2XUB A;  1TLH B;  5CLS A;  3F22 A;  4PDK A;  2BYV E;  3GO5 A;  3G73 A;  3SXY A;  1B9M A;  4XLP F;  4EJV A;  2XAS A;  3ROU A;  3ABT A;  2Z9O A;  5H6Q A;  2FQ3 A;  3F23 A;  4EGZ A;  2ZFW A;  4P9F A;  3ZMS A;  4A6D A;  3TGN A;  3FHZ A;  2PN6 A;  3QOP A;  2O03 A;  4MTE A;  3WTZ A;  5DEQ A;  2EV6 A;  1AWC A;  1YLF A;  1E2X A;  4WCG A;  4HV6 A;  5A2Q K;  2IA1 A;  3Q9V A;  3GZ5 A;  5K5O A;  3F21 A;  4A0Z A;  4LB6 B;  4G94 A;  3ULQ B;  3L2C A;  3K69 A;  3V8K A;  4U88 A;  5A2Q Z;  2ZNZ A;  2E1C A;  1TTY A;  5HS7 A;  1IN7 A;  1ZGJ A;  5AON A;  2RV8 A;  4HV5 A;  5L3B A;  1V3F A;  2EWN A;  2MBF A;  3K1N A;  4A12 A;  1OMI A;  1X3U A;  3WTS C;  2Z33 A;  3GLX A;  1REP C;  5HDG A;  1R7J A;  4P55 A;  2FML A;  1ZYR F;  2COM A;  2X4H A;  1IN5 A;  1ODD A;  3HUG A;  4B09 A;  4P5O A;  3I4P A;  2P5V A;  1O3Q A;  4HZF A;  3RTR A;  3HTS B;  1G4D A;  3TDZ C;  2UZK A;  4BQA A;  1YW7 A;  3BP8 A;  2ZKZ A;  1NHA A;  1QNT A;  2E7X A;  2IA0 A;  1RUN A;  1SFX A;  2HWV A;  5AIP A;  3M1E A;  2VOO A;  5HLH A;  1T98 A;  3KZY A;  2CO5 A;  1B9N A;  5LHG A;  5EEG A;  2P5L C;  1WSU A;  4LK0 F;  4UVC A;  1FYK A;  3GFM A;  3E3V A;  5K5R A;  2V1D A;  3KP7 A;  1P4X A;  4KMU X;  4RGR A;  3CO6 C;  2P4W A;  2KRF A;  3FM5 A;  4RGS A;  5E8G A;  1CGP A;  1W7P A;  1TQI A;  3FF5 A;  2DPD A;  4IHT A;  2VBY A;  2R7D A;  1FYL A;  3R0A A;  2GXG A;  4IXA A;  3ERE D;  3RDI A;  3R4K A;  3AAF A;  2PG4 A;  3E5U A;  1ZG1 A;  1FWZ A;  2KJC A;  2J5P A;  5CVR A;  4DNC A;  2ZBK A;  1HSJ A;  4JBA A;  3JAM K;  2UWM A;  3VEP A;  3LFK A;  1J2X A;  3CUO A;  1H0M A;  1MZB A;  4GYG A;  2OZU A;  1G3S A;  1ZRC A;  2XAH A;  1TQM A;  2Z3Y A;  4BHB A;  2L3D A;  4A0Y A;  2F5F A;  4GGG A;  3NQO A;  4MGR A;  1K79 A;  3H3Z A;  5KVR A;  2ZO4 A;  5L3G A;  1FSE A;  1ZLK A;  3V7C A;  5ILU A;  4ZYG A;  4LLL A;  2PMH A;  3HRM A;  4ZYE A;  2VXZ A;  4G7Z F;  3VFZ A;  1AOY A;  5FD5 A;  4ESJ A;  3KLO A;  3KZZ A;  4Q5S F;  3LA2 A;  2FE3 A;  2AXL A;  4OIQ F;  5BOX A;  2STW A;  5ICE A;  2XAG A;  3WU0 A;  3ZN0 A;  2EJR A;  3P9C A;  4M9X A;  2A5Y B;  2VOP A;  3ECH A;  4FX0 A;  2D1H A;  1G6N A;  3BJA A;  2RKH A;  3CJN A;  1J59 A;  4XBF A;  5BPI A;  2C6Y A;  3HTU A;  2GA1 A;  5JVT A;  1MDM A;  1XMK A;  1A04 A;  1W5T A;  2JTV A;  1FBS A;  2P7V B;  1BI0 A;  4Q47 A;  1UFM A;  4F7Z A;  3R0J A;  1BI1 A;  4RGU A;  2QEN A;  2MH9 A;  3CO7 C;  1HXD A;  2KIM A;  1SFU A;  3GFI A;  5J8F A;  2OBP A;  4Y15 A;  1Z05 A;  2VT2 A;  5ICG A;  5J8C A;  5E8I A;  3CLO A;  4I01 A;  1FZP B;  2W24 A;  1S29 A;  4PCQ A;  1KGS A;  1MGT A;  5CJ9 A;  4NB5 A;  3GZ6 A;  1K78 B;  4QWQ A;  3TO9 A;  3EET A;  5FFX A;  1OYI A;  5LEJ A;  2A3S A;  4K2E A;  2M30 A;  3FM3 A;  5LRR A;  2HKO A;  2XVC A;  1T39 A;  1XGM A;  3SQN A;  2PI0 A;  1F9N A;  4I7H A;  3J80 Z;  4OU0 A;  5DV5 A;  3KEO A;  1FPQ A;  1LVA A;  1TBX A;  2ISZ A;  1G3T A;  1R1T A;  5KK1 A;  4EGY A;  1XCB A;  2CFX A;  5ILS A;  4YIF A;  2G7U A;  1G3W A;  4CXF A;  3WTV C;  2LNB A;  1GXP A;  1FT9 A;  1C0W A;  1GHC A;  1T2K A;  3I59 B;  2Y75 A;  4I02 A;  3F6V A;  1SFE A;  1HST A;  3IKV A;  3VOE A;  4CDG A;  1JXS A;  2VE9 A;  4AIJ A;  4LG0 B;  4A5N A;  4HLX A;  3HRT A;  2WC2 A;  3DPT A;  2QYO A;  5K1Y A;  2GXB A;  4I98 B;  4CZZ A;  5HLG A;  4KDP A;  2ESN A;  1Z1D A;  4KFC A;  4UV8 A;  2KIU A;  2PEX A;  2HQR A;  3REO A;  4ZYH A;  1LEA A;  5E18 F;  3ABU A;  5DCF A;  2H94 A;  4I0A A;  1ZRD A;  1R36 A;  2HTJ A;  2ZJ2 A;  3ZP5 A;  3O3K A;  5DCM B;  1USS A;  1T0F A;  2IJL A;  3MEX A;  3QU3 A;  4KYW A;  4ESB A;  3HSF A;  3LQQ A;  3I58 A;  3FX3 A;  5LGN A;  2D45 A;  3RYR A;  3OOP A;  2L4A A;  1ZG5 A;  3F8N A;  3ELK A;  4ZZD A;  1LQ1 A;  4ETS A;  4EV0 A;  1MJB A;  3FXQ A;  1YIO A;  3R60 A;  2JT1 A;  2DBB A;  2V9V A;  3KCC A;  4KIB A;  3LAP A;  3IRR A;  1J9I A;  1B59 A;  5CVU A;  4RS8 A;  2GAU A;  2Q8K A;  3T8T A;  3U2R A;  3COA C;  5E1Z B;  5HLI A;  2X0L A;  5LEK A;  3E6B A;  3Q9S A;  2ACJ A;  4IRI A;  4XRF A;  1KU9 A;  5TJJ A;  4ENK A;  4N0B A;  2M1B A;  3O2P E;  1YS7 A;  4BYY A;  2QQB A;  4MQ9 F;  4FX4 A;  1TQP A;  4LLG F;  4HLY A;  5D5U B;  4U7D A;  2ISY A;  4A0X A;  2XAF A;  1LDD A;  1BIB A;  2JZY A;  2GWR A;  3EQL F;  4UV9 A;  5AIQ A;  4EMS A;  1XDS A;  1HKT A;  1U5T A;  4O3M A;  1FLI A;  1YW8 A;  2QVO A;  2XRN A;  3WG9 A;  4GXO A;  3KET A;  2QUF A;  4LLN A;  1CF7 A;  3HSR A;  1FX7 A;  4M72 A;  1P92 A;  2PBI A;  3HRU A;  1U8R A;  2VC1 A;  3GX4 X;  3ZN1 A;  5JI6 A;  3WTY C;  2JRT A;  2EB7 A;  4OIN F;  2ESH A;  2M45 A;  2CQK A;  3L9F A;  5HS9 A;  4ASN A;  3QRF F;  4HAM A;  4KN4 X;  4P96 A;  5EEH A;  1JHH A;  2A61 A;  2NAZ A;  5FLX K;  4BNC A;  2YX7 A;  2YPR A;  3WTT C;  1XMA A;  2DLL A;  4GCV A;  2XHK A;  2DT5 A;  4WX9 A;  4UNO A;  3KE2 A;  4ENJ A;  3PQJ A;  5BMZ A;  3W6K B;  4EQQ A;  5FLX Z;  2HYG D;  5IT3 A;  4ON0 A;  2MC3 A;  1IW7 F;  5ICF A;  4KA4 A;  3E6C C;  1MD0 A;  1LB2 A;  3KFW X;  2CGP A;  3JTH A;  2P7C B;  5E1X A;  1FP2 A;  4IF4 A;  2KKO A;  3I0T A;  1I27 A;  1HW1 A;  2L02 A;  1FC3 A;  1XN7 A;  2NNN A;  2GQQ A;  4HBL A;  2HQN A;  2Y48 A;  3CDH A;  4LFU A;  5D5V B;  2FEZ A;  4IPA A;  5HVQ C;  1R5H A;  3H92 A;  1S6L A;  3ISP A;  3DF8 A;  1U2W A;  2Q2E A;  3TKY A;  1PP8 F;  1U3E M;  1FBQ A;  4L9N A;  3OV8 A;  2BBY A;  4KIG A;  2VOD A;  3I59 A;  5DUI A;  3LA7 A;  4MTD A;  3QPH A;  2FA5 A;  4HX4 A;  2H6B A;  4BH9 A;  3ZMV A;  2LSO A;  1BJA A;  1ZRE A;  2LF7 A;  5CVI A;  3ZMU A;  4L9T A;  1QGP A;  4PZJ A;  1YG2 A;  4UHT A;  4IVN A;  2RGV A;  2ZXJ A;  1TNS A;  1SD5 A;  3C3W A;  4HA8 A;  3V8J A;  1YW9 A;  3WGI A;  4YII A;  5FGM A;  3V7R A;  1IRG A;  1F5T A;  3M8F A;  1FSH A;  5D5W B;  1UHW A;  4XLN F;  2PFB A;  4EM1 A;  3RKW A;  3KP6 A;  3TO6 A;  3RJP A;  2FBI A;  2G9W A;  2OQR A;  4MEY F;  1FYM A;  4L0Y B;  5DCM A;  2DTR A;  1BC7 C;  3DFG A;  3M7G A;  1Z9C A;  1QBJ A;  4KNY A;  2LF8 A;  2Z99 A;  2PMU A;  3G3Z A;  4RB2 C;  1MJA A;  5JFR A;  2LKP A;  2FOK A;  3KEQ A;  5JR3 A;  1J0R A;  5FO5 A;  5DD4 A;  3H3U A;  1FNN A;  5ED4 A;  2O0Y A;  2R3S A;  2EV5 A;  2WWY A;  3RPU A;  5K5Q A;  4GYI A;  2DU9 A;  4WF2 A;  4L18 B;  1I5Z A;  4KT5 C;  1RNL A;  4CGZ A;  2BE5 F;  4EJO A;  5H6R A;  4IHS A;  2P5K A;  2YX4 A;  1RIO H;  2CYY A;  1V4R A;  2A68 F;  3JAM Z;  2Y0M A;  1IRF A;  1P4A A;  4O5V A;  3MCZ A;  2ZME B;  4M6X A;  4LMY A;  1BC8 C;  2F5E A;  1IN6 A;  1Z6T A;  2PLY A;  5FFZ A;  1R00 A;  3HHH A;  4MHG A;  3W6J B;  3HRS A;  1BIA A;  2JPC A;  4NHJ A;  4U7B A;  1XD7 A;  2FMY A;  5H20 A;  2EK5 A;  3T1B A;  4OIO F;  3GEZ A;  1BM9 A;  3DP7 A;  3VOD A;  1UCR A;  1H9T A;  3BOQ A;  2DW4 A;  1L0O C;  1FP1 D;  3F8F A;  3KP2 A;  4L5I A;  4JK1 X;  4UXN A;  4WK8 F;  4EM2 A;  4P9U A;  3J7A O;  1G3Y A;  2V6C A;  2NRA C;  2K4J A;  2JSC A;  1O57 A;  4HW0 A;  1IXS B;  1TW3 A;  3DXJ F;  3CUQ A;  2VC0 A;  1KQ0 A;  2K4B A;  3FMS A;  3E6D A;  5HOO A;  4KIC A;  1PUE E;  2FSW A;  3K1M A;  1W5S A;  1LJ9 A;  4Q4Z F;  3V8L A;  2H6C A;  1DPR A;  2GIV A;  1O7L A;  1UST A;  1R1U A;  1Y0U A;  1OPC A;  3TDU C;  2HZT A;  3B02 A;  1ZAO A;  1XGN A;  2P6T A;  1LDK B;  2L4M A;  2IP2 A;  4OMY A;  5L3E A;  1I1G A;  1D5V A;  3F8M A;  2IVM A;  3L7W A;  2LDU A;  4BXU A;  2HEO A;  2O6G E;  1RZ4 A;  3F8B A;  2OAZ A;  2BEO A;  1T6S A;  1ZLJ A;  1WQ2 A;  4HX8 A;  4IJA A;  4HF1 A;  2P6S A;  3BY6 A;  3MZY A;  4RGX A;  1R22 A;  4ZYD A;  5JHU A;  2QZ8 A;  4L5J A;  1EH8 A;  2E1N A;  1QZY A;  3LST A;  1U5T C;  2V79 A;  5DYM A;  2NS0 A;  3FMR A;  3Q5F A;  4PGG A;  2RC4 A;  2FNA A;  1FY7 A;  1U78 A;  3R61 A;  3R6S A;  4HQM A;  4A6E A;  1JHF A;  4H0E A;  1WWX A;  4JQF A;  1S7A A;  5LRS A;  4OIR F;  1O3R A;  3I54 A;  3U9G A;  2E7W A;  3EUH A;  3FWE A;  4EJW A;  1J5Y A;  1BBY A;  4I0B A;  1S7O A;  5TRD A;  4KN7 X;  2M87 A;  4HDU A;  2STT A;  3JSP A;  4HYE A;  4M74 A;  1IN4 A;  1KA8 A;  3DPL C;  5L3D A;  3EDP A;  4I09 A;  3L00 A;  1SAX A;  2RNJ A;  2CG4 A;  2XIG A;  5HDN A;  5E20 A;  5ICC A;  1WI9 A;  3TO7 A;  3MAJ A;  3ZQ7 A;  1XSD A;  3BWG A;  2MD5 A;  4Z2Y A;  1ZHF A;  2VBW A;  4U0V A;  2J5O A;  1I1S A;  2ELH A;  1LEB A;  1IN8 A;  5D8L B;  3PFI A;  2DK8 A;  5ERI A;  3MZH A;  3IKT A;  2VT3 A;  2FRH A;  1ZRF A;  2FXA A;  4I2O A;  5D8K B;  1F1Z A;  2HTS A;  2K27 A;  1KYZ A;  5F1R A;  5IT9 K;  3P9I A;  2R7F A;  4R79 A;  2IW5 A;  4ENN A;  1VTN C;  4IRG A;  5F6F A;  3TOA A;  4BHP A;  3GVA A;  5DDG A;  4RB3 C;  2ZME A;  4OOI A;  3V4G A;  2OU2 A;  3C7J A;  2MLK A;  3J81 K;  1HBX G;  3BPX A;  4FT8 A;  3D5L A;  1P6R A;  1TW2 A;  5D4S A;  1OYY A;  1S3J A;  5LBQ A;  1W7P D;  1D8J A;  3RKY A;  3ZPL A;  5CVJ A;  6PAX A;  3MFK A;  1XB4 A;  2WV0 A;  4EM0 B;  1IF1 A;  1B6A A;  4AD9 A;  1YFH A;  3M9A A;  4KUM A;  4M9Z A;  1XSV A;  2EFN A;  1S8N A;  2D2W A;  2EFW A;  3L09 A;  1B4A A;  2DO7 A;  4IRH A;  3SZT A;  3WGH A;  3O6B B;  2W85 A;  3HOT A;  2B0L A;  2PJP A;  1YO5 C;  1EH7 A;  4UUV A;  1OR7 A;  2Z5U A;  1YYV A;  3BPV A;  1Z7U A;  4WWC A;  3DEU A;  1IAW A;  5L3C A;  5LGT A;  4HOB A;  3S2W A;  2YU3 A;  1ON1 A;  2F2E A;  1MDM B;  4KIF A;  2OQG A;  3FZV A;  4G8X A;  1WKM A;  3WE2 A;  3RI4 A;  2V1U A;  3K1P A;  4A2U A;  2HDC A;  2W25 A;  4L9J A;  3HSE A;  5J6X A;  4YFN F;  1K78 A;  1XCV A;  1XSX A;  3IWF A;  3WTU C;  3LA3 A;  1D8K A;  2O61 A;  3FXU A;  2QM3 A;  1DP7 P;  3ZMD A;  5LGU A;  4L9V A;  4N9I A;  4NQW A;  1HQC A;  2FF4 A;  3E6M A;  2DK5 A;  4UVB A;  3IC7 A;  3RYP A;  1PDN C;  1JGS A;  1STZ A;  1Z6R A;  3GF2 A;  4LK1 F;  4M73 A;  1U6G A;  1BOA A;  1EV7 A;  4M6Y A;  3EYY A;  1L3L A;  2DI3 A;  1XGS A;  3ZMT A;  4EJU A;  2EV0 A;  2OZ6 A;  1WRJ A;  5DUK A;  3HHG A;  5E1W A;  5LHH A;  2WTE A;  4LG0 A;  2YR2 A;  2O3F A;  3CUQ C;  5FD6 A;  3IWZ A;  2K02 A;  3JW4 A;  2IRF G;  3IL2 A;  3M8E A;  2KIF A;  4S05 A;  3C1D A;  3QP6 A;  2VBX A;  3E97 A;  1DPU A;  1DUX C;  5BS6 A;  3MWM A;  3NEU A;  2M5W A;  3F72 A;  3T5X A;  2F5C A;  1SD6 A;  1IUY A;  2ADU A;  2FNP A;  4DQ2 A;  2AS5 F;  4CYD A;  2DQR A;  2NNY A;  2D1V A;  2K86 A;  5FB2 A;  3EYI A;  5LLQ A;  1R23 A;  3RKX A;  4WXD A;  1O3T A;  2EFP A;  4YG2 F;  1XGO A;  3MQ0 A;  2O8X A;  5HDK A;  4R8H A;  3ZMZ A;  4CHU A;  4XSX F;  2DFI A;  3WGG A;  2HGC A;  3VB2 A;  1LNW A;  4RAY A;  3I53 A;  3T0Y A;  4LGW A;  1KQ9 A;  4UVA A;  3KLN A;  1YTY A;  1B1B A;  2YSR A;  2XAQ A;  2A6H F;  3TOB A;  4CO8 A;  2BV6 A;  2VE8 A;  4PGH A;  1JE8 A;  2QQ9 A;  1IXC A;  4AVP A;  4ZH4 F;  4AIH A;  1O7F A;  3GYH X;  1QO0 D;  4EJT A;  1T38 A;  5D4R A;  1RUO A;  1OKR A;  2GA2 A;  2HS5 A;  3FMQ A;  3D0S A;  2H27 A;  1D3Y A;  3BZ6 A;  4B8X A;  1YQA A;  2KJB A;  3B73 A;  3F3X A;  4RAZ A;  4A5M A;  4GO1 A;  1R1V A;  3PQK A;  3I71 A;  4LD5 A;  1BN5 A;  1OYW A;  2MH2 A;  2GZW A;  2QBY B;  4Y17 A;  3RPQ A;  4U0Y A;  1ZH5 A;  1U5T B;  2RQP A;  3NRV A;  3SHF A;  1BI2 A;  1HW5 A;  4G7O F;  1CF7 B;  2XV4 S;  3CTA A;  4R1H A;  3LAJ A;  1GVJ A;  1ON2 A;  1ZAR A;  4M71 A;  4HQE A;  3IRQ A;  3WU1 B;  1PP7 U;  1E17 A;  2XAJ A;  1ONV A;  3K2Z A;  4U0W A;  1ULY A;  4OMZ A;  4G6Q A;  2L01 A;  3C18 A;  3QP5 A;  2TDX A;  2FBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...