2KRFA

Nmr solution structure of the dna binding domain of competence protein a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
69
structure length
69
Chain Sequence
SSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcriptional regulatory protein comA
publication title NMR solution structure and DNA-binding model of the DNA-binding domain of competence protein A.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 17
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2krfA00
4HZFA 1IN4A 1IN6A 3HHHA 1G3WA 4EMSA 3LAJA 4FX0A 1QZZA 2EFOA 1KU7A 4WF2A 4L0ZB 2COMA 3RKYA 4HF1A 3BDDA 4I09A 1FP2A 2W84A 3LAPA 2FF4A 2PEXA 2FU4A 1RIOH 4FX4A 3BJAA 2DQLA 1REPC 3RPUA 5ICGA 3WTSC 1P4XA 5L3DA 1G6NA 3BPXA 1H0MA 2JPCA 5JR3A 3K1NA 3M7GA 4G7ZF 1WWXA 5A2QK 4LLNA 2WC2A 1DDNA 3TOBA 3GF2A 4KNYA 2FOKA 2GA1A 2G9WA 3JSOA 2QZ8A 4RGSA 4EJUA 4AIJA 4KN7X 2LF7A 3GXOA 1H9GA 5ILVA 3HRUA 2VT3A 3CUQB 3ROUA 2CGPA 3HRMA 5FGMA 2KIUA 5BQTA 2NRAC 2HOEA 2EA2A 1ZGJA 5LLQA 3ZPLA 4M72A 2PG4A 5BOXA 2CFXA 3QAHA 4A6DA 4D0PA 3DF8A 2AXLA 6PAXA 4U88A 3BROA 4OIRF 1IF1A 5JHUA 2VOPA 2KIFA 5HLGA 3PQJA 3T1BA 2DW4A 1WKMA 3WGGA 1G3TA 1BJAA 5FD5A 4L5JA 5D8KB 1XSXA 4E70A 4KT5C 3HHGA 1JXSA 4NQWA 1PP8F 3ZMDA 2YSRA 1JHHA 4N9IA 1PDNC 2VN2A 2QQBA 4N0BA 2Y0MA 4HX4A 4A0XA 2HEOA 1SFXA 2F5CA 1LEBA 4B8XA 5ICFA 1U5TA 3NQOA 3L2CA 2HS5A 4MEXF 4OIOF 2ADUA 1G3YA 2A61A 3SHFA 2R3SA 4HX7A 3IKTA 1ZRCA 5CJ9A 3RDIA 2M1BA 1KU3A 2FA5A 4UUVA 1UFMA 3LFKA 1SD4A 2Z99A 3HSRA 2VBWA 3WTZA 5E8GA 1OR7A 1QBJA 4EJTA 5FB2A 5DD8A 2MLGA 3REOA 1ZRFA 2IT0A 3CO7C 5DDGA 1FX7A 3LSTA 1Y0UA 2HDCA 2HR3A 4R8HA 3MZHA 3TQNA 3DV8A 3TGNA 1CF7B 2KKOA 1BI2A 3KEOA 3F21A 1TQMA 3LA7A 1KYWA 1XD7A 3P7NA 4CO8A 2BE5F 1HSTA 2FBHA 1HBXG 1XMAA 1B9NA 2LNBA 1FSEA 4EM0B 2C6YA 2EK5A 5LGNA 5FFXA 2IRFG 1DPUA 3HRSA 2ESHA 2A6EF 3QPTA 2QBYB 3JSPA 1DP7P 2QM3A 1ODDA 2XKPA 3WODF 3E6CC 2H6BA 2K02A 3ABTA 2A3SA 5AONA 4L9JA 3KP7A 2EFQA 5HS8A 2LF8A 4WK8F 1XMKA 2HKOA 1G3SA 4BYYA 3EDPA 3KE2A 1MDMB 5BPDA 5D5UB 3F8CA 5CVRA 5TJJA 4XLNF 1LB2A 3J7AO 3CUOA 2DT5A 3PFIA 1J7KA 2ZNZA 1BM9A 2ZMEA 1GHCA 1H9TA 4UVAA 5LEKA 2XAHA 2L3DA 2FE3A 2A6HF 5ILSA 5E8IA 1ON1A 4KIFA 1XSVA 1Q1HA 2YPRA 1Z91A 4EGYA 2D1VA 1P4AA 4OU0A 1WQ2A 4JQFA 1T39A 2RNJA 1U78A 1ZAOA 4MNUA 1QNTA 1ZRDA 4KA4A 3IL2A 1HW2A 3WU0A 2XUBA 3RI4A 4F7ZA 4OMYA 4WWCA 1ZYRF 1ZG3A 2PJPA 5HLHA 4EJVA 5LBQA 2EFWA 4I01A 3DEUA 1D8JA 3R60A 1YQAA 4BHCA 4EGZA 3KP2A 2DK8A 3RYRA 1V4RA 3ISPA 1YW7A 2E7WA 3G73A 2ZNYA 4HOBA 2ISYA 2VBXA 1MZBA 4RB0A 3IKVA 2UZKA 4KN4X 4M9ZA 3ZMTA 4ESJA 3I5UA 2O8XA 1YW9A 2XAFA 1FBUA 3MWMA 4HDUA 3VEPA 1IN8A 2ZKZA 2EFNA 2B0LA 2BBYA 4ZH4F 4L5IA 1K78B 2NYXA 2OD5A 5CVIA 5DYMA 1HKSA 4LB6B 4XSXF 3P9KA 2QQAA 2W25A 3BWGA 2VODA 4JK1X 1FT9A 3K2ZA 4N9HA 3ERED 2CWEA 3ZMVA 1YFHA 2BV6A 2STTA 3COAC 1YLFA 1TQPA 5D5XB 4CDGA 2HTSA 4U0VA 2DI3A 4MGRA 3FHZA 4MTDA 2XASA 2A68F 4YFNF 3DKWA 5D4RA 5JI6A 2RN7A 3T8TA 3D0SA 3CDHA 2IJLA 5HVQC 2JTVA 2DTRA 4Y17A 5DUIA 2K86A 1L3LA 5ILUA 3QU6A 2XVCA 1ONVA 5HDKA 4M6YA 1PUEE 4UVBA 4OOIA 3V7CA 4WX9A 3GYHX 1HW5A 3MZYA 4L9NA 2WV0A 3I64A 3P9IA 5FO5A 2L4MA 2RKHA 4M71A 3ZMZA 3QP5A 4RB2C 2KIMA 1AWCA 1E2XA 5KVRA 3C7JA 4L18B 3KP3A 4IHSA 3DP7A 2DK5A 3DFGA 4G8XA 2M87A 2KJCA 4OIQF 1U2WA 1BN5A 5HS7A 2A69F 2OZUA 5DEQA 4G7OF 4HLYA 3WE3A 2MLKA 2OQRA 1ZGAA 4M9XA 5J6XA 5E17F 1W5SA 5L3EA 2HWVA 2H94A 4KMFA 5AIQA 1F9NA 2NAZA 4LLGF 1Z9CA 4H0EA 4BHPA 3L7WA 4UNOA 4R1HA 5ED4A 3CUQA 2IPQX 3FXRA 3HTSB 4KFCA 2Z33A 5TRDA 4RAZA 3I0TA 1FOKA 1BI0A 2MA3A 4MQ9F 1XB4A 2FXAA 4I02A 4S04A 4P96A 4CZZA 5IT3A 3GX4X 1FNNA 2O0YA 4RAYA 4PGHA 3EYYA 1KQ8A 3HTUA 1ULYA 2VE9A 4BH9A 2HKXA 2VT2A 3T0YA 3VOEA 3GO5A 4I98B 1GXPA 3ECOA 4ZZDA 4EQQA 1QGPA 1W7PB 1LDDA 4IPAA 3BP8A 4PCQA 3O3KA 4BNCA 1U6GA 3ABUA 3HYIA 3E6BA 2DQRA 2CYYA 1XCBA 5L3CA 4M6XA 2XIGA 4A2UA 3J80Z 3R4KA 1FBSA 2K7LA 4LG0B 3T5XA 5JVTA 2H09A 2XGXA 1R36A 2H6CA 3IWZA 3SQNA 2OQGA 1EV7A 3V8LA 4WCGA 1FP1D 2AS5F 3CTAA 2EA4A 3M1EA 3MAJA 2F2EA 4S05A 2LSOA 4HW0A 2J5OA 4DQ2A 1FZPB 3F23A 4I2OA 3BJOA 1QQIA 4IXAA 2BEOA 2ZXJA 3ZN1A 4HV5A 2EV6A 1U3EM 4YFXF 4UHTA 1SFUA 4LJZF 5ICCA 2CO5A 3KZZA 3F8FA 3FMSA 2EJRA 3RPQA 1CF7A 2TDXA 4B09A 1UHMA 1KQ9A 3QRFF 3HRTA 2QWWA 1FYLA 1TNTA 1RI7A 2WTEA 4MEYF 4U7BA 4U0YA 4BQAA 3GFMA 3GZ5A 2EV5A 1YIOA 2XV4S 2WWYA 2ACJA 2UXNA 5HDNA 2QBYA 4ZYDA 2M45A 2QUFA 1T98A 1R1TA 2EWNA 5D6FA 3WTYC 2UXXA 1P2FA 2FNAA 4MTEA 1R00A 3FXUA 3FF5A 2L4AA 3K1MA 2V1XA 1MJ9A 3I71A 4G6QA 2Y48A 2F5DA 2FEZA 4EM2A 2ZBKA 2RDPA 1MDMA 4LGWA 2PFBA 1B4AA 5LHHA 3H3ZA 3EETA 1HKTA 3E5QA 1I6XA 1EH8A 3KP4A 3E6DA 1S29A 1XGOA 2X0LA 4O3MA 4KYWA 4AIKA 2Q2EA 4ENKA 3JTGA 1FLIA 1T38A 4OIPF 3GFJA 3QU3A 2EV0A 5L3GA 1BBYA 4JBAA 2CQKA 1U5TC 2QENA 2JPBA 1XSDA 1Z7UA 2P6SA 4CGZA 1EH7A 3KLOA 1XDSA 2MH2A 2HYFA 2G7HA 2NNNA 5K1YA 3F6OA 1MJBA 3KLNA 5H6QA 2JSCA 4LMYA 5D5VB 3LA2A 4KIGA 4GYGA 3J80K 3LQRA 5E1ZB 1O3SA 1Z6TA 3K9TA 4NHJA 3EUHA 4EJOA 2L54A 4AWXB 3KZYA 1D3YA 5BS6A 1KU2A 4LK1F 1WRJA 1PP7U 3BY6A 1HQCA 1I1GA 4EVIA 2MD5A 1XGSA 4A0ZA 2NS0A 4ESFA 4UV9A 2L02A 3O6BB 1IZ1A 1TBXA 5AIPA 3VODA 1R23A 3AAFA 2Z5UA 5F1RA 3CJNA 5D4SA 1FBQA 1YTYA 1JGSA 1L0OC 1MKMA 2P6TA 5F64A 1K78A 1BIBA 3TKYA 3GWZA 2JRTA 1TLHB 1FWZA 3RTRA 4LD5A 2IA2A 3Q9SA 3KETA 2ZCWA 3Q9VA 2YU3A 2PMUA 3I54A 1QPMA 3B02A 2MC3A 2DU9A 3C3WA 2A5YB 3F8NA 3K69A 3V7SA 3W6JB 1W4MA 1YG2A 4I7HA 4IHTA 5J8FA 3GVAA 5IT9Z 1S8NA 2ELHA 2CG4A 5H6RA 1B1BA 4IJAA 2CSOA 3CLOA 2MBFA 1YYVA 3VB2A 3NRVA 4BXUA 3IRRA 3GFLA 1UHWA 1XN7A 2M30A 2QVOA 1MJAA 2E1NA 5FFZA 2O6GE 4LB5A 4AD9A 5LRSA 5HS9A 3JTHA 4MHGA 2QLZA 4ETSA 1O3RA 4CYDA 4R79A 3V8JA 5D6EA 1GVJA 3FM3A 3F22A 3WTWC 2VE8A 3N97A 2XKOA 2XAGA 3KFWX 1AOYA 1R5HA 3R61A 1XDUA 1QO0D 3I4PA 2E7XA 1W5TA 3ZP5A 5BPIA 2GXBA 4ZYGA 4GO1A 2NNYA 3ECHA 1YS6A 4FT8A 2RV8A 3SZTA 5K5QA 1EH6A 4RGRA 4IRIA 1B59A 4YG2F 4UXNA 1I5ZA 4KMUX 2OBPA 1ZLJA 4HLXA 2O03A 4ZYHA 4HA8A 3HSEA 2J5PA 1XGMA 4WXHA 4K2EA 2STWA 1I1SA 3RKWA 3I59B 3E5XA 4RB3C 4RGUA 3BPVA 3FM5A 5H20A 1FC3A 4XSZF 5D8LB 1IXSB 2Q8KA 1S3JA 2FMLA 1D5VA 4L9TA 2PQ8A 2ZO4A 4M74A 5CYVA 4BHBA 2X4HA 2LDUA 3DPTA 1HW1A 4YIIA 5E1XA 5DUKA 1OYIA 3WGHA 4A5NA 2GXGA 2KJBA 4O6JA 1QZYA 4OINF 1W7PA 4P9FA 1OMIA 1J75A 3RKXA 4EJWA 5ICEA 4I0AA 4NB5A 2HFHA 2OZ6A 1IRFA 3IWFA 2RVCA 2JZYA 2V1DA 1K7AA 1LEAA 2XRNA 1R22A 2K27A 1RUOA 4UVCA 4LG0A 1Z1DA 1KA8A 2D2WA 4A6EA 1RNLA 5IT9K 3O2PE 3M9AA 3W6KB 3QOPA 3TDUC 4RB1A 2OAZA 1Z05A 4HAMA 3L00A 3KP5A 2L01A 5J8CA 3GZ6A 3KP6A 3J81Z 3RYPA 5CVUA 4I0BA 1NHAA 3F3XA 4ESBA 1S7OA 3C1DA 1K79A 2V9VA 2GAUA 1ZARA 1SMTA 1U8RA 4P55A 2FMYA 4CICA 1J59A 3TOAA 1UCRA 5E1WA 3LQQA 2ZJ2A 3D5LA 4UV8A 3E3VA 2VC1A 2EFPA 5DCFA 4Y15A 2DFIA 3HOTA 1ZREA 3CUQC 1OYYA 1P4WA 1P92A 1SD7A 2RQPA 1SD6A 5FLXZ 1R5GA 3LA3A 1FYMA 2GA2A 1IRGA 4YFKF 2VBYA 3ZMSA 2H27A 1B9MA 4IF4A 4EM1A 1BIAA 4OMZA 1IXCA 1DUXC 1WI9A 1F1ZA 1F5TA 2D45A 4G9YA 2E1CA 3CO6C 1GXQA 5HOOA 5DCMB 1S7AA 1YS7A 2FRHA 3GLXA 3HSFA 1IAWA 2KRFA 3I58A 1TNSA 5KK1A 3ZMUA 2W85A 2YR2A 1ON2A 1O7LA 1J5YA 3Q5FA 3GEZA 2ESNA 1MGTA 1BOAA 2P8TA 1STZA 1SMYF 3MQ0A 4ASNA 2O3FA 1JHFA 4RS8A 5EEHA 2IVMA 4PZJA 3RIRA 1J9IA 1MD0A 5DD4A 3V7RA 3DXJF 1T2KA 1X3UA 4HYEA 5LHGA 1ZN2A 5E18F 3HIFA 3WU1B 3TO6A 1A04A 2IW5A 1RZ4A 3R0AA 1WSUA 2IA0A 4FHTA 2FSWA 2GWRA 5L3BA 1O57A 2HQRA 4Y13A 5CLSA 2LKPA 2PI0A 3U1DA 1IUYA 1B6AA 3M8FA 2HYGD 2XAJA 2PMHA 4CXFA 3WG9A 2IA1A 3L09A 4KUMA 3JAMZ 2DLLA 3J81K 3ZQ7A 3FZVA 5LGUA 4IVNA 2GIVA 1W7PD 2M5WA 4ENMA 4Q48A 3OV8A 3E97A 4A0YA 4PGGA 4CHUA 3U9GA 2EB7A 3F72A 2K4JA 1BI3A 4GXOA 2BGCA 3H3UA 3QP6A 4LK0F 3TO9A 1FY7A 4BAYA 2QQ9A 1KQ0A 3VFZA 3V8KA 3ML6A 4XLPF 5CVVA 1R7JA 1Z6RA 1FYKA 3NEUA 2YX7A 3GW2A 4Q4ZF 2ETHA 4IRHA 5FLXK 2P7CB 1R1UA 2GZWA 3WE2A 2DPDA 2A07F 4IRGA 1IN7A 5E20A 1HSJA 5FD6A 2VBZA 4P5OA 4M9SA 1F4KA 4LLLA 2HZTA 1USTA 1LVAA 1ZH5A 4WXDA 3U2RA 4KDPA 2FQ3A 2CW0F 1YW8A 2VC0A 5EEGA 1BC7C 4LFUA 3P9CA 5CVJA 1LDKB 2MH9A 1IXRC 1U5TB 2P5LC 1ZHFA 1DPRA 4M73A 1KYZA 3T8RA 1KGSA 1KU9A 1ZLKA 5K5RA 2YX4A 2P7VB 2W57A 4DNCA 3FMRA 4PDKA 2FNPA 3MFKA 2RC4A 1O3QA 3M8EA 2M8EA 3WTUC 2F5EA 4GCVA 4HV6A 1O3TA 3F8BA 4HBLA 1G4DA 5HDGA 2RGVA 3R6SA 1SFEA 2K4BA 2OU2A 2Z9OA 4L0YB 2IP2A 1USSA 4AVPA 4WXCA 3F8MA 4RGXA 3OOPA 3FWEA 3S2WA 2PBIA 2HQNA 1FSHA 2XHKA 3I59A 4G94A 4GYIA 1XGNA 1TW2A 2OA4A 4P9UA 3HOSA 3MEXA 4U7DA 1LJ9A 2O61A 3EYIA 1LNWA 3WGIA 1D8KA 3FX3A 3JAMK 1BC8C 1VTNC 2V6CA 3I53A 1TW3A 4HQEA 1HKQA 4GGGA 3SZPA 2DAOA 3GFIA 1ZG1A 2V79A 3H92A 2DPUA 3ZN0A 1CGPA 1LDJA 5K5OA 2F5FA 2BYVE 3FMQA 3JW4A 4MQVA 3FXQA 4QWQA 1E17A 4ZYEA 3DQVC 2QYOA 2P5VA 4O5VA 1J2XA 3BJ6A 5HLIA 2ZMEB 4TV7A 2G7UA 5LRRA 3KEQA 3SFZA 4XBFA 1SAXA 3RJPA 3K0LA 5DV5A 4HQMA 2R7DA 5D5WB 4AIHA 3IC7A 3PQKA 3QPHA 1IW7F 2FBKA 2XROA 4ZZLA 3C18A 5A2QZ 3G3ZA 3DPLC 1V3FA 3IHUA 1TTYA 3TO7A 4HX8A 2PLYA 2D1HA 1T0FA 4KICA 4HF0A 2DO7A 5LHIA 1LQ1A 4G6DA 2W24A 1R58A 4KIBA 2JT1A 4ON0A 1FPQA 2UWMA 3WTTC 1JE8A 3BZ6A 1UB9A 3WTXC 2VONA 3ELKA 2VXZA 5ERIA 3EQLF 3BOQA 5F6FA 3K1PA 4YIFA 4A12A 3R0JA 4EV0A 1BI1A 4U0WA 4HDVA 3SXYA 5LEJA 2GQQA 3WTVC 4Q47A 1C0WA 5L3FA 1J0RA 1HXDA 2Q0OA 3ULQB 1XCVA 4ENNA 1K6OA 3E5UA 4XRFA 3B73A 2HGCA 1P6RA 1IN5A 4QLCU 1OYWA 4G7HF 5LGTA 3E6MA 4A5MA 3HUGA 3MCZA 2P5KA 1R1VA 2Y75A 1I27A 1OKRA 3KCCA 3IRQA 3F6VA 4Z2YA 2PN6A 3V4GA 2V1UA 1S6LA 1TQIA 5DCMA 4Q5SF 2FBIA 3TDZC 5JFRA 4ENJA 5BMZA 2XAQA 2R7FA 1YO5C 2HTJA 1ZG5A 1OPCA 1SD5A 4HF2A 4L9VA 2P4WA 1O7FA 3LWFA 3N4MA 3L9FA 2VOOA 2Z3YA 1T6SA 2DBBA 1RUNA 2ISZA 2ZFWA 3GUDA
chains in the Genus database with same CATH superfamily
1R4NB 4HZFA 1IN4A 1IN6A 3HHHA 2LY1A 1G3WA 4EMSA 3LAJA 4FX0A 1QZZA 2EFOA 1KU7A 4WF2A 4MFDA 4AYBN 4L0ZB 2COMA 3RKYA 4KISA 2HVSA 3L2UA 4HF1A 2R7RA 3BDDA 4I09A 1FP2A 2W84A 1IV8A 3LAPA 2FF4A 1YITI 2PEXA 3A1YA 3BR1A 1Z7LA 1GV5A 2FU4A 4XNFA 3FK6A 4FX4A 1RIOH 3FKIJ 4NBQA 3OYCA 4M3DA 5C4XJ 3OIOA 3BJAA 2DQLA 1REPC 3RPUA 3HG9A 5ICGA 3WTSC 1WPKA 2F4OB 2MFZA 4HPQA 1IRZA 1P4XA 5L3DA 1G6NA 3DKYA 3RSNA 3BPXA 1H0MA 2JPCA 4MO7A 5JR3A 1W1WE 5HODA 3K1NA 2KIQA 2BW3B 3M7GA 5M5YJ 1FMVA 2X85A 4G7ZF 2WAEA 1RESA 1WWXA 2NOJB 5A2QK 1EF4A 1XG1A 3N05A 5GAGJ 3NWTA 4LLNA 2WC2A 1DDNA 3TOBA 4A3BJ 2DA1A 3GF2A 2CS3A 4KNYA 1POGA 2FOKA 2WAFA 2GA1A 2EIKH 2G9WA 1WHUA 2LLKA 3JSOA 3UKGA 2QZ8A 4RGSA 4EJUA 3HB9A 4AIJA 4RMNA 4KN7X 4BJ5C 2LF7A 2HQ5A 3GXOA 2CMPA 1H9GA 4E4HA 1UAAA 5ILVA 4HG2A 1MBKA 3JCUC 3BTJA 5TISC 3OYIA 1VQ7I 3HRUA 2IAIA 3DPUA 5B3SH 1XX5A 2X1DA 2HI3A 2VT3A 4HSRA 3CUQB 3ROUA 2CJJA 2CGPA 3HRMA 2DMPA 5FGMA 2KIUA 2I10A 5BQTA 2FOWA 1SANA 2NRAC 3H0DA 4UUSB 2HOEA 2EA2A 1ZGJA 5LLQA 3ZPLA 2JA8J 3HEFA 4M72A 3HL2A 4JX4A 2PG4A 1JUSA 3EPZA 4I6ZA 2YS9A 2CW7A 5BOXA 2CFXA 1X1BA 3QAHA 4A6DA 3S1NJ 4D0PA 3GZNB 3BTCA 2R93J 3DF8A 1X58A 2AXLA 2V4JC 6PAXA 1OCTC 4U88A 3AL0B 5EZHA 2IBDA 3BROA 5CQEA 1YI2I 2OUMA 3S14J 3DTKA 1JUPA 4MIMA 4OIRF 1IF1A 1RPWA 5JHUA 5K7ZA 2E34A 2VOPA 2WAQN 1JI8A 2KIFA 2JRMA 1XS9A 4V19K 5HLGA 3PQJA 1K4TA 3T1BA 2DW4A 1WKMA 2HOAA 4A93J 3CC4I 2M9HA 3CC7I 3WGGA 1G3TA 1BJAA 2Y9YA 4ZTJA 1X1AA 4L5JA 5FD5A 5D8KB 4PFOA 3M8JA 4RAFA 1XSXA 4B47A 4E7SA 3K4CA 4E70A 1Z3YA 3OL3A 3VYRB 4DIQA 4KT5C 3RQ4A 3LMMA 3HHGA 1JXSA 2XPWA 4NQWA 2Y0SN 1PP8F 3ZMDA 2UUZA 2YSRA 1JHHA 4N9IA 4RA2A 1PDNC 4C30A 2E1MB 2VN2A 2QQBA 2LR8A 4N0BA 4BU2A 2Y0MA 4HX4A 4A0XA 1MNDA 3LOCA 2HEOA 4XRMA 2LD5A 2V6EA 1SFXA 2F5CA 1D0ZA 4EEFG 1LEBA 4B8XA 4E7HA 5ICFA 1U5TA 3NQOA 3L2CA 1ZQ3P 2HS5A 4MEXF 4OIOF 2ADUA 2NS7A 3EUKL 1HCRA 1G3YA 2A61A 3BCBA 3SHFA 2R3SA 4HX7A 1WJCA 2EINH 3IKTA 1ZRCA 3CD6I 5CJ9A 3RDIA 4XLAA 2M1BA 1KU3A 2OV7A 2FA5A 4UUVA 2F6CA 5FROA 1UFMA 3LFKA 1SD4A 2Z99A 3HSRA 3PUBA 2VBWA 2HVQA 2ZJQF 3D5RC 1D1CA 3WTZA 3DCFA 5FRNA 1X3ZB 5E8GA 1VQKI 1OR7A 2CUFA 1T08B 1QBJA 4EJTA 5FB2A 4F55A 5DD8A 1WI3A 2MLGA 3REOA 2XSDC 1ZRFA 2IT0A 2BY0A 5J40A 3CO7C 3BTLA 1WH5A 1APLC 4W1UA 5DDGA 2L5QA 3ZQIA 5B66C 1FX7A 3LSKA 4XOPA 3LSTA 1Y0UA 4DZPA 1AKHB 2HR3A 4R8HA 2HDCA 3CQZJ 4IKFA 3MZHA 3TQNA 4BBSJ 3DV8A 3TGNA 4U87A 1PVEA 1CF7B 1Z21A 2KKOA 1BI2A 4DJAA 3KEOA 3F21A 2XGDA 2ID6A 3DBLB 1TQMA 3LA7A 1KYWA 2UV1A 1WZ2A 5J47A 4Y3OA 1XD7A 3P7NA 1LFBA 4CO8A 1MSFC 1MMGA 2F5VA 1X4OA 2X6OA 2BE5F 4XLHA 2WY8Q 1HSTA 2FBHA 1HBXG 1XMAA 3CJRB 1B9NA 5FKMA 2JWTA 2LNBA 1FSEA 2R7OA 4EM0B 2ZFUA 1NH3A 4ZC3A 2C6YA 2EK5A 5LGNA 5FFXA 2IRFG 1DPUA 5F0FA 3HRSA 1OR7C 5DM7F 3PO2J 3H3VK 2ESHA 2A6EF 3QPTA 3BT9A 2QBYB 1DP3A 3QPSA 1WCMJ 5CQGA 3JSPA 1DP7P 2QM3A 1ODDA 2K9MA 2XKPA 3WODF 3E6CC 2H6BA 2P81A 2K02A 3ABTA 2A3SA 2BY3A 3CZ6A 5AONA 4L9JA 3KP7A 2EFQA 5HS8A 1JJ8C 3G4SI 1T56A 2LF8A 4WK8F 1ITYA 1UG0A 2DFEA 1XMKA 2HKOA 1YJWI 4A3KJ 4CUGA 2ELJA 1U8BA 1G3SA 5TGTA 4BYYA 2VJIA 4HRIA 3JRHA 2EZHA 4A3GJ 3EDPA 3KE2A 4CCNA 1MDMB 5BPDA 4BXFA 2B9SA 2TCTA 5D5UB 5IY5H 3F8CA 5CVRA 1T8IA 1YX3A 5HLTA 5TJJA 4XLNF 5IP9J 3RPUD 2XF6A 3D1NI 1LB2A 1ZR4A 4X6AJ 3H5NA 4XN0A 3CUOA 4ZDPA 2DT5A 2DA5A 4PJMA 3PFIA 3J7AO 1J7KA 2ZNZA 1BM9A 2ZMEA 3C2GA 2DA6A 2WY7Q 1GHCA 4DW6A 1H9TA 4UVAA 2Q2EB 5LEKA 2XAHA 5M3MJ 3S2HJ 2KZGA 2L3DA 2DMQA 2FE3A 2A6HF 5ILSA 5E8IA 3GTJJ 1ON1A 4KIFA 1XSVA 1Q1HA 1WJAA 2YPRA 1OCZH 5GTIC 1Z91A 3LSMA 4DYCA 2WBMA 3PIPF 4HNUA 3OYGA 2MGQA 4EGYA 3ZQGA 3CMEI 4A3DJ 2D1VA 2HQAA 4AUXA 1P4AA 4OU0A 1WQ2A 3TW6A 4JQFA 4B3XA 1T39A 2RNJA 4BXXJ 1U78A 3IP4B 4XLEA 1ZAOA 2H8WA 2GM4A 4MNUA 1Y6IA 1QNTA 1ZRDA 4KA4A 3CDLA 3IL2A 1HW2A 4JOMA 4IL6C 3WU0A 4D9JA 2XUBA 2HPMA 5EG0A 3RI4A 1YRNA 3HGYA 3VWBA 4F7ZA 1SAUA 4OMYA 4WWCA 1DQUA 1K4SA 2BHZA 1ZYRF 1ZG3A 2PJPA 3S17J 3GLLA 2DT6A 4N4NB 5HLHA 3W6VA 1MH3A 3OYAA 4EJVA 5LBQA 4PK4A 2EFWA 1BW5A 2VPLA 4I01A 2ZXIA 3DEUA 1PUFA 1D8JA 4LG3A 3R60A 1YQAA 4BHCA 1ETQA 4EGZA 3ABMH 3KP2A 1ZELA 2DK8A 4E7LA 1V4RA 3ISPA 3RYRA 5EGOA 1YW7A 5IP7J 1PYVA 2E7WA 2ZNYA 3G73A 2V26A 1NG6A 4HOBA 2ISYA 5GPCA 2FUG2 2VBXA 3CCYA 1UG2A 3OR2C 1WFXA 4FE7A 1MZBA 2VKDA 2IS2A 4RB0A 2M0CA 2E71A 4DZJA 3IKVA 5JHFA 2UZKA 2JSPA 1N77A 3K6GA 3ONQA 5B1BH 4KN4X 4M9ZA 3ZMTA 4ESJA 2IGOA 3I5UA 2X6WA 2VLAA 3IH4A 2O8XA 1YW9A 2XAFA 2LK2A 1FBUA 3SEZA 3MWMA 4HDUA 3VEPA 1XMXA 1TC3C 1IN8A 1I50J 2M4GA 2ZKZA 2EFNA 2B0LA 2BBYA 3NAUA 4ZH4F 4L5IA 3D5SC 4CCOA 1K78B 4NC7A 2LG4A 2NYXA 2OD5A 5CVIA 2ZSIB 2DT7B 2WADA 5DYMA 1HKSA 4E6KG 4LB6B 1Y39A 1IRXA 3GMEA 2MC4A 3I56I 4XSXF 3P9KA 3OSFA 1YIJI 3VDXA 3OIPA 2QQAA 2W25A 2QSHX 3BWGA 2F48A 3C2BA 2DMTA 4Y4RA 4JK1X 1FT9A 2VODA 3K2ZA 4N9HA 3ERED 1FOXA 2CWEA 2FJ1A 4RLQA 3C2HA 3ZMVA 1YFHA 2BV6A 2STTA 3COAC 3M4OJ 3OYLA 2R5ZA 4FETA 1YLFA 3KZIC 1TQPA 4BQNA 5D5XB 1MNEA 4CDGA 3H35A 2HTSA 1W36D 4U0VA 2DI3A 3H9JA 4MGRA 3FHZA 2GIZA 4MTDA 5FJ8J 2XASA 4DOZA 2A68F 1SVMA 4YFNF 2CV0A 3DKWA 5D4RA 5JI6A 2RN7A 2VUMJ 3T8TA 3D0SA 4ZYAA 3CDHA 2IJLA 2RNGA 5HVQC 3PUFA 2KISA 3CCJI 2Y9ZA 2JTVA 2DTRA 4Y17A 1X1DA 5DUIA 2K86A 2LKXA 2BZTA 4ANJA 3A4CA 1L3LA 4CCLA 5ILUA 2DA2A 1IDYA 2P0WA 3HGGA 2XVCA 3QU6A 4PSWA 4QSHA 2HDWA 5IYCJ 1ONVA 2XF5A 4M6YA 5HDKA 1FJLA 1PUEE 4UVBA 3MN2A 1QHHD 5CPRB 3OYDA 3K10A 2XRLA 4ITVA 4F3QA 2F4IA 1GDTA 4OOIA 3SEQA 3V7CA 4WX9A 3GYHX 1HW5A 4XKBA 3BG9A 1Q1VA 2EBIA 3MZYA 4L9NA 2WV0A 3I64A 3P9IA 2CU7A 5FO5A 2RKHA 2L4MA 3BZCA 4M71A 1RR8C 1ETKA 3ZMZA 3QP5A 4RB2C 2YU9J 1HA8A 2KIMA 1AWCA 3E1SA 1E2XA 3OYHA 5KVRA 3C7JA 5FLMJ 2KHMA 4L18B 2JQ7A 3KP3A 4IHSA 3DP7A 2DK5A 2HOSA 3DFGA 1TP4A 4G8XA 4QTRA 3IH2A 3K4JA 5J3LA 2M87A 3H9GA 3AKZA 2KJCA 4OIQF 2BW3A 3UNGC 2LFBA 4XOTA 2R7VA 2LMDA 1I3QJ 1U2WA 1VNDA 3BR2A 1BN5A 5HS7A 4F91B 2A69F 1SFOJ 3GTQJ 2OZUA 5DEQA 3CMAI 4HLYA 3WE3A 4G7OF 3ZQCA 2MLKA 2VL8A 3S3OA 3U1KA 2OQRA 1ZGAA 4M9XA 3HOXJ 3OOUA 5J6XA 5E17F 2PMZA 1W5SA 4BY7J 5L3EA 2LVSA 2DN0A 3E0JB 2HWVA 3VYUB 3J7AY 2H94A 3DWLE 4KMFA 5AIQA 1F9NA 2NAZA 4LLGF 1VQLI 1Z9CA 3U21A 4H0EA 3HOYJ 2R7ZJ 4BHPA 1Z77A 3L7WA 4UNOA 4R1HA 2K85A 3S1RJ 2VI6A 4YIRX 4E7JA 2Y30A 5ED4A 5C3EJ 1WJFA 3CUQA 2IPQX 3FXRA 3HTSB 3TP0A 2L9VA 3KIOA 2GBYA 3TBIA 3SDGA 3I9V2 2Z33A 3CCVI 4KFCA 1JUMA 2AQEA 1DGRM 1Y8RB 4UUSA 5TRDA 4RAZA 5J1YA 2DA4A 4D5CA 2Y31A 3SDBA 2CQNA 3I0TA 2KL4A 1FOKA 1BI0A 2MA3A 1OLTA 4MQ9F 1XB4A 2FXAA 1VQPI 2CQXA 4I02A 1MMSA 4S04A 4BDYA 4P96A 4CZZA 5IT3A 4XORA 2X1EA 1FNNA 3GX4X 1DGWY 2O0YA 2EH3A 1WJDA 4E7IA 3PO3J 4RAYA 4PGHA 3EYYA 2HZDA 2V9PA 1KQ8A 3IV5A 2L9RA 3HTUA 1ULYA 2VE9A 4BH9A 3G1OA 2LH9A 1NK2P 2HKXA 2VT2A 3T0YA 3VOEA 3CDIA 3I3LA 2H1LA 1XTAA 3GO5A 2IGMA 4CCKA 4I98B 1ENHA 1GXPA 3ECOA 2R4GA 4ZZDA 4EQQA 2QSFX 1IG7A 1JKPC 3J7YJ 1ZR2A 1QGPA 1W7PB 1LDDA 2IS6A 4IPAA 3BP8A 4S0HB 2DDBA 4IO9F 1Z67A 4PCQA 3ZCOA 3PNYA 2WA0A 3O3KA 2M0MA 4BNCA 1X1PA 1U6GA 2R7QA 3ABUA 3HYIA 3E6BA 1HC8A 2L9NA 2DQRA 1R6RA 2CYYA 5J1RA 1QU3A 1SFKA 1XCBA 5L3CA 4M6XA 2XIGA 3CCEI 4A2UA 5FKOA 3J80Z 2DODA 3R4KA 5C4JJ 2H1KA 4M6VA 4A3MJ 1FBSA 2LKSA 2K7LA 1HLVA 4IHVA 3KPHA 2VJ4A 3T5XA 3G2BA 5JVTA 2H09A 2XGXA 2H8RA 4LG0B 1HDDC 2VKHA 2XC7A 3K7AJ 4Z6YA 2M3AA 1R36A 2H6CA 3IWZA 3SQNA 2OQGA 1EV7A 2W48A 4DBQA 3V8LA 4WCGA 3QWLA 1FP1D 3JRGA 3CTAA 2EA4A 3M1EA 3MAJA 2AS5F 2F2EA 3FXOA 4S05A 2L7KA 1N25A 2JA2A 2LSOA 4HW0A 1LVKA 2J5OA 4DQ2A 1FZPB 3F23A 1R4MB 2M2EA 4I2OA 3A01B 3Q0WA 3BJOA 4J00A 1QQIA 4IXAA 2BEOA 3P5JA 2ZXJA 1LE8A 3ZN1A 3RQIA 2HPIA 4XLFA 3PIOF 3L2RA 1IDZA 4RAGA 4HV5A 3X2QH 1MSEC 3ZQLA 2EV6A 1U3EM 3A0BC 5K7HA 4YFXF 1Y0NA 4UHTA 3FISA 1SFUA 1AKHA 4LJZF 5ICCA 2CO5A 3KZZA 3BR6A 4D7NA 3F8FA 5J4YA 3FMSA 2EJRA 3RPQA 1CF7A 2NVYJ 3B6CA 4BUPA 2K9LA 2TDXA 4V2FA 1A5JA 1V5EA 4B09A 3K4NA 1UHMA 1KQ9A 5HNHA 3QRFF 2O7OA 3HRTA 2BXYA 2L0KA 2K9NA 2L7ZA 2QWWA 1FYLA 2GLOA 1TNTA 1RI7A 2WTEA 4H4KC 3MKZA 1JKOC 4MEYF 4U7BA 4U0YA 4PJLA 3ZQQA 2NVUB 3ZXSA 3TL4X 4BQAA 3GFMA 3GZ5A 2R5YB 2EV5A 2QGUA 1YIOA 2MYSA 2XV4S 2WWYA 2E36A 3K4KA 3B6AA 2ACJA 1LFUP 2E19A 2UXNA 4IHYA 3OYJA 5HDNA 1HF0A 2QBYA 2X48A 3VYSB 4ZYDA 3S93A 2M45A 4KITB 2QUFA 4YRVA 1V55H 3CCMI 2L7FP 1T98A 1R1TA 4P1WA 2EWNA 5EJCA 4LOCA 2MW8A 5D6FA 3WTYC 3G1LA 2UXXA 3CF2A 1XC5A 4FQGA 1P2FA 4AM3A 2FNAA 4MTEA 3CESA 2QCOA 2Z2SB 3KEYA 2IS1A 1R00A 2CH0A 3Q3SA 3FXUA 3FF5A 2L4AA 2K9SA 3GBGA 3K1MA 2R0QC 3KYLA 2V1XA 1MJ9A 3I71A 3OYFA 1QZEA 4G6QA 2Y48A 2VJJA 2ZJRF 1Y56A 1D0XA 2F5DA 2GXAA 3FXKA 3HJEA 1MNMC 2FEZA 4EM2A 1K61A 2ZBKA 2RDPA 1FTTA 1MDMA 4LGWA 2PFBA 3DTEA 1B4AA 5LHHA 3FIWA 3H3ZA 3EETA 1HKTA 3E5QA 5DM6F 1I6XA 5FKNA 1EH8A 3KP4A 1SC7A 3E6DA 1S29A 5CKTA 1XGOA 2X0LA 4XMYA 4O3MA 4KYWA 4AIKA 2Q2EA 2AQFA 4ENKA 3JTGA 1FLIA 1MBJA 2VJ5A 5HNFA 2DJIA 2NVTJ 1T38A 4G6TB 4OIPF 2X6XA 3GFJA 1CQTA 3MKWB 3QU3A 2EV0A 4RBOA 5L3GA 1BBYA 4JBAA 3GCMA 3A03A 5E3LA 3MKYB 2E2HJ 2CQKA 4BQOA 1U5TC 2QENA 2JPBA 3KYDB 4BDZA 1P7JA 3OS0A 3JRCA 4M3BA 5C44J 2G0EA 3BTIA 1XSDA 2HXIA 1R71A 2LTPA 3HOZJ 3CP2A 1Z7UA 2P6SA 2XDVA 4BGDA 1WJBA 4V2GA 3W2AA 1RKTA 2FX0A 3VPRA 4HNTA 4CGZA 1EH7A 1ETOA 1RR7A 3KLOA 1XDSA 2MH2A 2HYFA 2G7HA 1W36C 2NNNA 5K1YA 4XKWA 3F6OA 4UY8I 1MJBA 3KLNA 5H6QA 2DMUA 3ZGKA 2JSCA 4L5EA 4LMYA 4M3GA 5D5VB 3MMYB 3LA2A 4KIGA 2XAUA 4RM2A 4XK4A 4GYGA 3J80K 2W4SA 3LQRA 3O8HA 2QKMB 5E1ZB 3SJMA 4JP0A 4II2A 4QPOA 2ZB9A 1O3SA 1Z6TA 1BJZA 3HPGA 1JT0A 4CYCB 3K9TA 5IPAA 2BY2A 4NHJA 2BY1A 3AG4H 3EUHA 4XIDA 1DU6A 2JUGA 1U0JA 3BLYA 4EJOA 2L54A 2LREA 4B1RA 4AWXB 3KZYA 1D3YA 2ZXHA 1TZLA 4B43A 5BS6A 1KU2A 3GTKJ 3BG3A 1EA3A 4LK1F 1WRJA 5BNGA 3RCOA 1WGXA 1PP7U 2KLOA 1T33A 4FTHA 3BY6A 1HQCA 1I1GA 3LFUA 3MKLA 2DA7A 1FIAA 2E5NA 4PJ0C 4RM3A 4EVIA 1D1AA 2MD5A 1XGSA 4A0ZA 3HOWJ 2NS0A 3FXJA 4ESFA 2VXDA 2L02A 3LSIA 4UV9A 4BE1A 1RRJA 3O6BB 5M5WJ 1IZ1A 1TBXA 5AIPA 3VODA 3WHBA 1R23A 3AAFA 2E5ZA 2Z5UA 4II3A 5F1RA 3CJNA 3HXLA 5D4SA 1FBQA 4C3JJ 2OF7A 1YTYA 5KNLA 5JLXA 1JGSA 1L0OC 1MKMA 1T95A 2P6TA 5F64A 1K78A 1V5GA 1BIBA 2WB1A 2E60A 2I8DA 1P9QC 3TKYA 3GWZA 2JRTA 1TLHB 1FWZA 2KDOA 3EUHC 3RTRA 1QPIA 3H1CA 4LD5A 1TT5B 2IA2A 1W0UA 3Q9SA 2K5CA 2LYCA 3M3YJ 3KETA 5B1AH 2ZCWA 1VZ0A 2M7AA 3Q9VA 4CSWA 3BCAA 3BR0A 2YU3A 2GOXB 2PMUA 3I54A 1QPMA 2GOMA 3B02A 2MC3A 2DU9A 3C3WA 4JX6A 2A5YB 3F8NA 3K69A 3V7SA 3W6JB 1TWGJ 1W4MA 1YG2A 4I7HA 4IHTA 1MMDA 1X4PA 2BOLA 5J8FA 3GVAA 5IT9Z 1S8NA 2ELHA 2CG4A 5H6RA 3S32A 3K4BA 2ZMEC 1B1BA 4IJAA 2CSOA 1A36A 4AC0A 3CLOA 3OS2A 2OTJI 2MBFA 3MVPA 3WG7H 3CP8A 1YYVA 4F93B 3VB2A 3NRVA 4DBRA 1UELB 4BXUA 3IRRA 1NK3P 2R92J 3GFLA 5M5XJ 2ECCA 3DBRB 1UHWA 4RLFA 3V42A 1XN7A 2M30A 1GVDA 2QVOA 1MJAA 3S3NA 2E1NA 5FFZA 2O6GE 4LB5A 4AD9A 5LRSA 1W0TA 5IOYA 5HS9A 5FKKA 2W7NA 3JTHA 4MHGA 3CCUI 3GTOJ 2PX9A 1Y1WJ 2QLZA 4ETSA 1O3RA 4MLOA 5GPAA 2QA4I 2EILH 3AG3H 4CYDA 1Y1VJ 3V8JA 4R79A 1R9TJ 1YHQI 3DEEA 3H36A 2WB1N 2DOAA 2E35A 5D6EA 2ZJPF 1GVJA 4LIVA 3SZGA 3FM3A 2TRTA 3F22A 2CV1A 2KMUA 1YJNI 3WTWC 2V9KA 5EEAA 2RAEA 3CCLI 2VE8A 3N97A 2XKOA 3GTPJ 1FOWA 9ANTA 1TWHJ 2BVMA 2XAGA 3PJRA 3KFWX 1AOYA 1R5HA 3R61A 1XDUA 1QO0D 3I4PA 4I99C 2E7XA 2HOTA 1W5TA 3ZP5A 5EYRA 1ETWA 4ZYGA 4CCJA 4GO1A 5E3OA 4IZZA 5BPIA 2GXBA 3BZKA 2NNYA 3ECHA 1YS6A 4FT8A 1ZGWA 1PJRA 2RV8A 3SZTA 2CUZA 2EZIA 2JA5J 2MSYA 4CH7A 4ZJZA 5K5QA 2RREA 1H89C 1ACIA 2HU9A 1EH6A 3DU6A 4RGRA 4IRIA 1B59A 4YG2F 5F27A 2CV2A 3HC7A 4CCMA 4UXNA 1I5ZA 2KQRA 4KMUX 2NXNB 3J7ZI 2OBPA 1ZLJA 4HLXA 3L2VA 2O03A 3GTMJ 4ZYHA 2LC2A 2M8GX 4HA8A 1FOYA 2L9SA 4BL0B 3HSEA 1BR2A 3S3MA 3LSJA 2J5PA 1XGMA 2N8GA 4K2EA 2DCEA 4WXHA 2STWA 1I1SA 2DMNA 2R7XA 1S5LC 4XRSG 1B72B 4GDFA 2W82A 3HBLA 2OTLI 3OY9A 1K6YA 3RKWA 3I59B 3E5XA 4XL9A 4RB3C 1B8IB 1MBFA 4RGUA 5K7FA 3BPVA 3FM5A 3QYBA 2ZXWH 5EZGA 2JA6J 2ICWG 5H20A 4LITA 4ABZA 1FC3A 3H5AA 4XSZF 5D8LB 1YRNB 3ASOH 3TP3A 1IXSB 2Q8KA 1S3JA 4GFBA 2FMLA 4IX7A 3SYTA 1D5VA 4L9TA 2PQ8A 2KP6A 2ZO4A 4M74A 3QPLA 5CYVA 2CUEA 4BHBA 2K40A 4CA0A 2E1OA 2X4HA 2O5RA 2JA7J 2DYSH 4A3IJ 2LDUA 4C3IJ 4NUBA 3ZRGA 1IGNA 3DPTA 3BG5A 1HW1A 1SVOA 4YIIA 5E1XA 1GT0C 2A5WA 5DUKA 1OYIA 2JMWA 4BE2A 3WGHA 2BHYA 4A5NA 2GXGA 2KJBA 3AG2H 4O6JA 1ERDA 1QZYA 4OINF 1W7PA 4P9FA 1OMIA 1J75A 3DKXA 3PNVA 3RKXA 3DBHB 2VASA 1AA7A 4EJWA 5ICEA 4I0AA 4AYBA 4NB5A 2HFHA 2OZ6A 1IRFA 4B3AA 3JR9A 3IWFA 2RVCA 3W3CA 2JZYA 2V1DA 3LNQA 1IV6A 1K7AA 1LEAA 2XRNA 3BQYA 3CJTB 1R22A 2K27A 4BACA 3PSIA 1RUOA 4UVCA 2R7UA 2LY2A 4LG0A 2ID3A 1Z1DA 1KA8A 2D2WA 4A6EA 3F9KA 4OAZA 3G6EI 1A31A 1RNLA 2AXTC 5KHDA 5IT9K 2JVGA 3O2PE 1UJ8A 3M9AA 3W6KB 3QOPA 1VQOI 5E3NA 2X6YA 3TDUC 4B48A 4E7ZA 4BEHB 4RB1A 2OAZA 5J1UA 1Z05A 4HAMA 3L00A 3DEWA 3KP5A 5J4VA 2L01A 5J8CA 4IQJA 2JN6A 2NOGA 3GZ6A 2QSGX 3S2DJ 1OQYA 3KP6A 3J81Z 3OYNA 4BE0A 3RYPA 5CVUA 1RETA 4I0BA 3HDDA 1NHAA 4X0GA 3F3XA 4ESBA 3IH3A 4PUSA 1S7OA 3OSGA 3C1DA 3RKQA 1K79A 2VQLA 2V9VA 2GAUA 4KJZA 2Q1ZB 4IHXA 2X1CA 3QQAA 1ZARA 3ABKH 2DTZA 1BR4A 1SMTA 1KONA 1U8RA 4P55A 3CCQI 2FMYA 4J19A 1U9OA 3W2VA 2EZLA 1ETVA 4CICA 1J59A 3TOAA 1UCRA 3LQQA 5E1WA 2ZJ2A 3D5LA 1BL0A 3A02A 1P7IA 1U9NA 4UV8A 3S15J 3E3VA 4BQQA 4FCYA 1Z0XA 3ABLH 4IQ4A 3H0GJ 4ZDOA 1QA6A 2VC1A 1VQNI 2PJRB 2EFPA 5DCFA 2HNHA 4Y15A 5GAHJ 2DFIA 3HOTA 1ZREA 2W1OA 3CUQC 1BOBA 2R5YA 1F43A 1OYYA 1AU7A 3ZR8X 4HNVA 2PMZN 3A0HC 1P4WA 2NS8A 1O4XA 4Y33A 1P92A 3QYEA 1SD7A 2RQPA 1I3AA 1SD6A 5DTDA 5FLXZ 5E79C 2QEXI 2IEKA 3HPHA 3M1CA 3I4MJ 1D0YA 1IJWC 1R5GA 3LA3A 1FYMA 3CJQB 1I39A 3FDYA 2CFOA 2X51A 2WAQA 3AL0C 3PFYA 4OWRB 2GA2A 1IRGA 4NDLA 2K3PA 1FMWA 3HUGB 4YFKF 2VBYA 3ZMSA 2H27A 1TWFJ 5E3MA 1VQ9I 1B9MA 4IF4A 4EM1A 4G12A 3QODA 1BIAA 4OMZA 1IXCA 1DUXC 1LFPA 1WI9A 1F1ZA 1F5TA 2D45A 4IEJA 4G9YA 2E1CA 3CO6C 1GXQA 2A6TA 5HOOA 2MD0A 5DCMB 2COBA 2Y0SA 3CF5F 1HOMA 1S9HA 1S7AA 2EIMH 2XF7A 1H8AC 3S1MJ 1YS7A 2FRHA 3GLXA 4F52A 2VB6A 3HSFA 1IAWA 2KRFA 3I58A 2QKLB 1TNSA 2R7SA 2Z1DA 5KK1A 3ZMUA 2HVRA 2ECBA 3OIQA 2LP0A 2W85A 2L7MP 1YX5A 3HKZA 2YR2A 1ON2A 2LBFB 2E1MC 1O7LA 4QPQA 1J5YA 3Q5FA 1X2NA 3GEZA 2ESNA 1YOVB 3BC8A 4XONA 1MGTA 2CQQA 1F36A 1BOAA 2MG4A 2LRDA 2P8TA 1STZA 1SMYF 2ZSHB 2M4KA 3MQ0A 1TT0A 4PJJA 4ASNA 4XLCA 2O3FA 3CCSI 1QVTA 1RC9A 1JHFA 4RS8A 5EEHA 4I76A 2VIXA 2Z16A 2IVMA 4PZJA 3RIRA 1OCRH 1G59A 1MBHA 1J9IA 1MD0A 4JYKA 5DD4A 1X3WB 3V7RA 4C2TA 3RZDJ 2KPMA 3DXJF 4KT6A 1X3UA 1T2KA 4HYEA 4AU7A 5LHGA 3HM5A 1ZN2A 5E18F 3HIFA 3WU1B 3K4LA 3TO6A 5IOZA 1A04A 2IW5A 2F4MB 2OCCH 1N75A 1RZ4A 3R0AA 1WSUA 2IA0A 3OMYA 2FSWA 4FHTA 4UUTA 2GWRA 2L2OA 4AVZA 4IHWA 5LD2C 5L3BA 4CYCA 1O57A 3TMOA 2HQRA 2O8KA 3G1MA 4Y13A 3OR1C 4EATA 1QVUA 3TW7A 2XB0X 4XQFA 1SVLA 3DLAA 2ME0A 5KAIC 5CLSA 2LKPA 3L2QA 2PI0A 3U1DA 1IUYA 1D5YA 1B6AA 3M8FA 2JVHA 3ZOBA 2HYGD 2CRGA 3S8PA 5JVGF 1G2HA 2XAJA 2PMHA 2MABA 1OCCH 3K70D 2K9QA 3I55I 4CXFA 3WG9A 4XN3A 4ZDLA 1E0EA 2KRCA 2IA1A 3L09A 3W2WA 2V1NA 4KUMA 3HKZN 3JAMZ 2DLLA 3J81K 3I4NJ 1FTZA 3ZQ7A 3FZVA 3JRBA 1JKQC 1NG7A 5LGUA 1LKXA 3MD2A 4IVNA 2VQGA 3NWSA 2GIVA 3CLQA 4YELA 3FXMA 1W7PD 3OYBA 3CCRI 2M5WA 3DU5A 4M3EA 4B4CA 4ENMA 4Q48A 3OV8A 3E97A 3GTLJ 4A0YA 4PGGA 4C2UA 4J01A 4CHUA 1J09A 3M07A 4IOCF 4XKVA 4C9YA 3U9GA 4RDUA 3JRAA 2EB7A 1Y8QB 2R7WA 3F72A 3K2AA 1JKRC 2K4JA 1BI3A 1HDPA 1ZTRA 3VSLA 4GXOA 1QRYA 4XRSA 4BBRJ 2BGCA 2EIJH 3H3UA 3ESWB 1LE8B 3QP6A 4FE4A 4LK0F 3TO9A 2XPUA 1FY7A 3WU2C 3BR3A 4BAYA 5DS9A 2OPTA 4Y7NJ 2QQ9A 5F0HA 1FEXA 4PJNA 1KQ0A 3VFZA 3UR3C 3V8KA 3ML6A 1Z3XA 4XLPF 4BY1J 5CVVA 1R7JA 1Z6RA 2M34A 1S72I 2DFFA 3DTIA 3QYFA 1FYKA 1XPXA 4JX5A 3NEUA 3L2WA 1VI0A 2YX7A 3GW2A 1JJ6C 3Q0VA 1LUJB 4Q4ZF 2ETHA 2DFHA 1N78A 3LSGA 4IRHA 1A6QA 1IUFA 5FLXK 2ELKA 1R1UA 2P7CB 2GZWA 3WE2A 2DPDA 2A07F 3OWTA 4IRGA 2EZKA 1IN7A 5E20A 1HSJA 3ERMA 3H5RA 5FD6A 2VBZA 4P5OA 1GLNA 3FK7A 4M9SA 4XR6A 1F4KA 1GUUA 1JTYA 4LLLA 1VQ8I 2HZTA 1USTA 2IGNA 3OS1A 4BKXA 2D5VA 1E3HA 1LVAA 1ZH5A 4WXDA 3U2RA 4KDPA 3BR5A 3L1PA 2FQ3A 5IP6A 2CW0F 4NQWB 1E3PA 5IYBJ 1I6HJ 1OISA 1YW8A 2VC0A 3PSFA 4MFEA 3BG6A 4PFPA 1WJEA 3FBNB 5EEGA 1BC7C 3H9QA 4LFUA 3P9CA 2NVQJ 4DGWB 2HDDA 5CVJA 4FISA 1LDKB 2MH9A 1IXRC 1FIPA 2VQCA 1U5TB 3BG7A 2P5LC 2CW8A 1ZHFA 2EQRA 2XGCA 4YEJA 1DPRA 4M73A 1KYZA 2ZC2A 1KGSA 1KU9A 3T8RA 1GV2A 1ZLKA 1YE9A 5K5RA 2YX4A 2P7VB 3FXLA 4GRIA 2W57A 4DNCA 3FMRA 3S16J 2QQ8A 4PDKA 3JRFA 4BJTA 2FNPA 2Y69H 4A3CJ 1EJ9A 2YUSA 1R5ID 3MFKA 2RC4A 1O3QA 3M8EA 1IO2A 1KZHA 5FRMA 2M8EA 1MMAA 4W97A 2LY9A 4A3EJ 3WTUC 1ORKA 2IXSA 4HSTA 2JJ7A 2K3FA 2F5EA 4GCVA 4HV6A 5EDNA 3LSPA 1O3TA 3F8BA 4HBLA 1G4DA 5FLVA 1QHGA 4X1EA 5HDGA 2RGVA 4ZTFA 3GTGJ 2XPVA 3R6SA 1SFEA 2K4BA 2OU2A 2Z9OA 2BXZA 4L0YB 2IP2A 1WJ5A 2OC6A 1USSA 4QIWN 4AVPA 3JRDA 2O9LA 4WXCA 4A3LJ 1MBGA 2XB5A 3F8MA 4RGXA 3HZJA 1WVRA 3FWEA 3OOPA 3S2WA 2B63J 3CMMA 2DJNA 2PBIA 3OYMA 1B72A 2HQNA 1FSHA 2XHKA 3I59A 3MZ8A 4G94A 4A69C 5F04A 1B8IA 4GYIA 1XGNA 1TW2A 2VPRA 2OA4A 2XGEA 4P9UA 2AHQA 3HOSA 2KZVA 3MEXA 5GAEJ 2IS4A 4U7DA 1LJ9A 4OAYA 2O61A 2W00A 3PL8A 3EYIA 5F0CA 2B7EA 1LNWA 1ZK8A 3WGIA 3HOUJ 2OJED 3FHNA 4E7KA 1W5CC 3LSHA 5KCMA 2WV1A 1D8KA 3FX3A 4C2MJ 3JAMK 1BC8C 1VTNC 1DU0A 1A35A 2V6CA 1SEUA 4NNJA 5GADJ 3I53A 3CMYA 5KAFC 1TW3A 3Q0UA 2ME6A 4HQEA 1HKQA 1JTXA 4GGGA 4BS9A 3QOEA 3SZPA 2DAOA 3GFIA 2DYRH 1ZG1A 2V79A 3H92A 2DPUA 1A6IA 2CQ7A 3ZN0A 1CGPA 1K83J 2X9DA 1LDJA 5K5OA 4CZCA 2NVXJ 2F5FA 4UB6C 2BYVE 4M3FA 2XSJC 3FMQA 3JW4A 1TL8A 2DXIA 5GP9A 1V54H 4NC8A 1M1EB 4MQVA 2KFDA 3FXQA 4QWQA 1E17A 3FKJA 4ZYEA 3DQVC 2IGKA 3EUAA 5F1JA 2QYOA 1UMQA 2HXOA 2P5VA 4O5VA 1EKEA 1MH4A 2AO9A 1J2XA 3BJ6A 5HLIA 1VQ4I 4D1QA 4XICA 2ZMEB 4TV7A 2E2JJ 3BQZA 2G7UA 4BJ6C 5LRRA 3KEQA 3SFZA 4XBFA 2CUJA 3RZOJ 3IUOA 1SAXA 4DYRA 3RJPA 5M3FJ 3K0LA 5DV5A 3ZQHA 4HQMA 2R7DA 5D5WB 4AIHA 3IC7A 2BVLA 3PQKA 1MIJA 5FKLA 5JLWA 3DLLF 3QPHA 1IW7F 2FBKA 1TWCJ 3PNTA 2XROA 2KDZA 2VKEA 2R7TA 1ETXA 4ZZLA 1BR1A 3LSRA 1R49A 5B5EC 2FD5A 3C18A 3KYCB 5H2FC 4AIDA 5A2QZ 3G3ZA 4BEHA 2DDAA 1V3FA 3DPLC 3IHUA 2E2IJ 4DYQA 3AG1H 1TTYA 3TO7A 4HX8A 4N4OB 4HEA2 2PLYA 1MBEA 2D1HA 1T0FA 2KT0A 1X2MA 4KICA 4HF0A 2DO7A 5LHIA 1IC8A 1LQ1A 1OCPA 4G6DA 2W24A 1R58A 4KIBA 2JT1A 4ON0A 1FPQA 2UWMA 3TEDA 3WTTC 5EG0B 1JE8A 1H88C 1OFCX 1RKWA 3BZ6A 1UB9A 3WTXC 2VONA 3ELKA 1TWAJ 2VXZA 3VYTB 5ERIA 3LL7A 3EQLF 3NARA 3BOQA 4A3JJ 5F6FA 3K1PA 1VQ5I 4YIFA 4A12A 3R0JA 3E7LA 1BA5A 4XM3A 2M7BA 4EV0A 1PUFB 4C3HJ 4IOAF 2DOEA 1YJ9I 1JGGA 4A3FJ 3OL4A 1BI1A 2PJRA 4U0WA 5EGOB 2JUCA 4HDVA 1ZKGA 4UB8C 2HYJA 1VF9A 2DA3A 3ZQFA 3SXYA 5LEJA 1OCOH 2GQQA 3WTVC 1V5FA 4Q47A 1T0FC 2VQHA 1C0WA 5L3FA 1J0RA 1D1BA 3FBIB 1HXDA 2Q0OA 1NTCA 1X1CA 3ULQB 1XCVA 3PM1A 4ENNA 3SFIA 1X19A 1K6OA 3IAM2 3E5UA 1UHSA 1BW6A 1MW7A 3O8GA 4XRFA 3B73A 2OCEA 2HGCA 2EPFA 1P6RA 3WHCA 3JREA 1IN5A 4QLCU 1OYWA 1AHDP 4G7HF 5LGTA 3G71I 4FASD 1LPQA 3E6MA 3S1QJ 2KRHA 4A5MA 3HUGA 3K70C 3MCZA 2P5KA 2DOFA 3OYKA 1JT6A 2Y75A 1R1VA 1I27A 1OKRA 4D5FA 4XKCA 1MMNA 3VSKA 2Y2ZA 3KCCA 3IRQA 4F92B 3F6VA 4Z2YA 2PN6A 5GTHC 3F0CA 3V4GA 2V1UA 3A2KA 2JK3A 1OJLA 3AFHA 4Y52J 1S6LA 1TQIA 5DCMA 3CC2I 3K4MA 2QF7A 3A01A 4Q5SF 2FBIA 1S7EA 1UZCA 3TDZC 5EF6A 5IYDJ 5JFRA 4ENJA 5BMZA 2A05A 2V7FA 1VQ6I 3HOVJ 2XAQA 2R7FA 2R5ZB 1YO5C 4LIUA 2HTJA 5F08A 4D7MA 1OPCA 1ZG5A 1SD5A 4HF2A 4L9VA 2I5UA 2P4WA 1O7FA 3IAS2 2FQ4A 3OYEA 1VFCA 2LBFA 3LWFA 1G8XA 3KX2A 1WH7A 3N4MA 4PSXA 1E3OC 3L9FA 2VOOA 2Z3YA 2RQQA 3JRIA 1T6SA 1ETYA 2DBBA 4B44A 1RUNA 2VKVA 2ZFWA 2ISZA 3ASNH 1VQMI 5LFAA 3GUDA 4NC6A 2LOOA
chains in the Genus database with same CATH topology
4HZFA 1IN4A 1IN6A 3HHHA 1G3WA 4EMSA 3LAJA 4FX0A 1QZZA 2EFOA 1KU7A 4WF2A 4L0ZB 2COMA 3RKYA 4HF1A 3BDDA 4I09A 1FP2A 2W84A 3LAPA 2FF4A 2PEXA 2FU4A 1RIOH 4FX4A 3BJAA 2DQLA 1REPC 3RPUA 5ICGA 3WTSC 1P4XA 5L3DA 1G6NA 3BPXA 1H0MA 2JPCA 5JR3A 3K1NA 3M7GA 4G7ZF 1WWXA 5A2QK 4LLNA 2WC2A 1DDNA 3TOBA 3GF2A 4KNYA 2FOKA 2GA1A 2G9WA 3JSOA 2QZ8A 4RGSA 4EJUA 4AIJA 4KN7X 2LF7A 3GXOA 1H9GA 5ILVA 3HRUA 2VT3A 3CUQB 3ROUA 2CGPA 3HRMA 5FGMA 2KIUA 5BQTA 2NRAC 2HOEA 2EA2A 1ZGJA 5LLQA 3ZPLA 4M72A 2PG4A 5BOXA 2CFXA 3QAHA 4A6DA 4D0PA 3DF8A 2AXLA 6PAXA 4U88A 3BROA 4OIRF 1IF1A 5JHUA 2VOPA 2KIFA 5HLGA 3PQJA 3T1BA 2DW4A 1WKMA 3WGGA 1G3TA 1BJAA 5FD5A 4L5JA 5D8KB 1XSXA 4E70A 4KT5C 3HHGA 1JXSA 4NQWA 1PP8F 3ZMDA 2YSRA 1JHHA 4N9IA 1PDNC 2VN2A 2QQBA 4N0BA 2Y0MA 4HX4A 4A0XA 2HEOA 1SFXA 2F5CA 1LEBA 4B8XA 5ICFA 1U5TA 3NQOA 3L2CA 2HS5A 4MEXF 4OIOF 2ADUA 1G3YA 2A61A 3SHFA 2R3SA 4HX7A 3IKTA 1ZRCA 5CJ9A 3RDIA 2M1BA 1KU3A 2FA5A 4UUVA 1UFMA 3LFKA 1SD4A 2Z99A 3HSRA 2VBWA 3WTZA 5E8GA 1OR7A 1QBJA 4EJTA 5FB2A 5DD8A 2MLGA 3REOA 1ZRFA 2IT0A 3CO7C 5DDGA 1FX7A 3LSTA 1Y0UA 2HDCA 2HR3A 4R8HA 3MZHA 3TQNA 3DV8A 3TGNA 1CF7B 2KKOA 1BI2A 3KEOA 3F21A 1TQMA 3LA7A 1KYWA 1XD7A 3P7NA 4CO8A 2BE5F 1HSTA 2FBHA 1HBXG 1XMAA 1B9NA 2LNBA 1FSEA 4EM0B 2C6YA 2EK5A 5LGNA 5FFXA 2IRFG 1DPUA 3HRSA 2ESHA 2A6EF 3QPTA 2QBYB 3JSPA 1DP7P 2QM3A 1ODDA 2XKPA 3WODF 3E6CC 2H6BA 2K02A 3ABTA 2A3SA 5AONA 4L9JA 3KP7A 2EFQA 5HS8A 2LF8A 4WK8F 1XMKA 2HKOA 1G3SA 4BYYA 3EDPA 3KE2A 1MDMB 5BPDA 5D5UB 3F8CA 5CVRA 5TJJA 4XLNF 1LB2A 3J7AO 3CUOA 2DT5A 3PFIA 1J7KA 2ZNZA 1BM9A 2ZMEA 1GHCA 1H9TA 4UVAA 5LEKA 2XAHA 2L3DA 2FE3A 2A6HF 5ILSA 5E8IA 1ON1A 4KIFA 1XSVA 1Q1HA 2YPRA 1Z91A 4EGYA 2D1VA 1P4AA 4OU0A 1WQ2A 4JQFA 1T39A 2RNJA 1U78A 1ZAOA 4MNUA 1QNTA 1ZRDA 4KA4A 3IL2A 1HW2A 3WU0A 2XUBA 3RI4A 4F7ZA 4OMYA 4WWCA 1ZYRF 1ZG3A 2PJPA 5HLHA 4EJVA 5LBQA 2EFWA 4I01A 3DEUA 1D8JA 3R60A 1YQAA 4BHCA 4EGZA 3KP2A 2DK8A 3RYRA 1V4RA 3ISPA 1YW7A 2E7WA 3G73A 2ZNYA 4HOBA 2ISYA 2VBXA 1MZBA 4RB0A 3IKVA 2UZKA 4KN4X 4M9ZA 3ZMTA 4ESJA 3I5UA 2O8XA 1YW9A 2XAFA 1FBUA 3MWMA 4HDUA 3VEPA 1IN8A 2ZKZA 2EFNA 2B0LA 2BBYA 4ZH4F 4L5IA 1K78B 2NYXA 2OD5A 5CVIA 5DYMA 1HKSA 4LB6B 4XSXF 3P9KA 2QQAA 2W25A 3BWGA 2VODA 4JK1X 1FT9A 3K2ZA 4N9HA 3ERED 2CWEA 3ZMVA 1YFHA 2BV6A 2STTA 3COAC 1YLFA 1TQPA 5D5XB 4CDGA 2HTSA 4U0VA 2DI3A 4MGRA 3FHZA 4MTDA 2XASA 2A68F 4YFNF 3DKWA 5D4RA 5JI6A 2RN7A 3T8TA 3D0SA 3CDHA 2IJLA 5HVQC 2JTVA 2DTRA 4Y17A 5DUIA 2K86A 1L3LA 5ILUA 3QU6A 2XVCA 1ONVA 5HDKA 4M6YA 1PUEE 4UVBA 4OOIA 3V7CA 4WX9A 3GYHX 1HW5A 3MZYA 4L9NA 2WV0A 3I64A 3P9IA 5FO5A 2L4MA 2RKHA 4M71A 3ZMZA 3QP5A 4RB2C 2KIMA 1AWCA 1E2XA 5KVRA 3C7JA 4L18B 3KP3A 4IHSA 3DP7A 2DK5A 3DFGA 4G8XA 2M87A 2KJCA 4OIQF 1U2WA 1BN5A 5HS7A 2A69F 2OZUA 5DEQA 4G7OF 4HLYA 3WE3A 2MLKA 2OQRA 1ZGAA 4M9XA 5J6XA 5E17F 1W5SA 5L3EA 2HWVA 2H94A 4KMFA 5AIQA 1F9NA 2NAZA 4LLGF 1Z9CA 4H0EA 4BHPA 3L7WA 4UNOA 4R1HA 5ED4A 3CUQA 2IPQX 3FXRA 3HTSB 4KFCA 2Z33A 5TRDA 4RAZA 3I0TA 1FOKA 1BI0A 2MA3A 4MQ9F 1XB4A 2FXAA 4I02A 4S04A 4P96A 4CZZA 5IT3A 3GX4X 1FNNA 2O0YA 4RAYA 4PGHA 3EYYA 1KQ8A 3HTUA 1ULYA 2VE9A 4BH9A 2HKXA 2VT2A 3T0YA 3VOEA 3GO5A 4I98B 1GXPA 3ECOA 4ZZDA 4EQQA 1QGPA 1W7PB 1LDDA 4IPAA 3BP8A 4PCQA 3O3KA 4BNCA 1U6GA 3ABUA 3HYIA 3E6BA 2DQRA 2CYYA 1XCBA 5L3CA 4M6XA 2XIGA 4A2UA 3J80Z 3R4KA 1FBSA 2K7LA 4LG0B 3T5XA 5JVTA 2H09A 2XGXA 1R36A 2H6CA 3IWZA 3SQNA 2OQGA 1EV7A 3V8LA 4WCGA 1FP1D 2AS5F 3CTAA 2EA4A 3M1EA 3MAJA 2F2EA 4S05A 2LSOA 4HW0A 2J5OA 4DQ2A 1FZPB 3F23A 4I2OA 3BJOA 1QQIA 4IXAA 2BEOA 2ZXJA 3ZN1A 4HV5A 2EV6A 1U3EM 4YFXF 4UHTA 1SFUA 4LJZF 5ICCA 2CO5A 3KZZA 3F8FA 3FMSA 2EJRA 3RPQA 1CF7A 2TDXA 4B09A 1UHMA 1KQ9A 3QRFF 3HRTA 2QWWA 1FYLA 1TNTA 1RI7A 2WTEA 4MEYF 4U7BA 4U0YA 4BQAA 3GFMA 3GZ5A 2EV5A 1YIOA 2XV4S 2WWYA 2ACJA 2UXNA 5HDNA 2QBYA 4ZYDA 2M45A 2QUFA 1T98A 1R1TA 2EWNA 5D6FA 3WTYC 2UXXA 1P2FA 2FNAA 4MTEA 1R00A 3FXUA 3FF5A 2L4AA 3K1MA 2V1XA 1MJ9A 3I71A 4G6QA 2Y48A 2F5DA 2FEZA 4EM2A 2ZBKA 2RDPA 1MDMA 4LGWA 2PFBA 1B4AA 5LHHA 3H3ZA 3EETA 1HKTA 3E5QA 1I6XA 1EH8A 3KP4A 3E6DA 1S29A 1XGOA 2X0LA 4O3MA 4KYWA 4AIKA 2Q2EA 4ENKA 3JTGA 1FLIA 1T38A 4OIPF 3GFJA 3QU3A 2EV0A 5L3GA 1BBYA 4JBAA 2CQKA 1U5TC 2QENA 2JPBA 1XSDA 1Z7UA 2P6SA 4CGZA 1EH7A 3KLOA 1XDSA 2MH2A 2HYFA 2G7HA 2NNNA 5K1YA 3F6OA 1MJBA 3KLNA 5H6QA 2JSCA 4LMYA 5D5VB 3LA2A 4KIGA 4GYGA 3J80K 3LQRA 5E1ZB 1O3SA 1Z6TA 3K9TA 4NHJA 3EUHA 4EJOA 2L54A 4AWXB 3KZYA 1D3YA 5BS6A 1KU2A 4LK1F 1WRJA 1PP7U 3BY6A 1HQCA 1I1GA 4EVIA 2MD5A 1XGSA 4A0ZA 2NS0A 4ESFA 4UV9A 2L02A 3O6BB 1IZ1A 1TBXA 5AIPA 3VODA 1R23A 3AAFA 2Z5UA 5F1RA 3CJNA 5D4SA 1FBQA 1YTYA 1JGSA 1L0OC 1MKMA 2P6TA 5F64A 1K78A 1BIBA 3TKYA 3GWZA 2JRTA 1TLHB 1FWZA 3RTRA 4LD5A 2IA2A 3Q9SA 3KETA 2ZCWA 3Q9VA 2YU3A 2PMUA 3I54A 1QPMA 3B02A 2MC3A 2DU9A 3C3WA 2A5YB 3F8NA 3K69A 3V7SA 3W6JB 1W4MA 1YG2A 4I7HA 4IHTA 5J8FA 3GVAA 5IT9Z 1S8NA 2ELHA 2CG4A 5H6RA 1B1BA 4IJAA 2CSOA 3CLOA 2MBFA 1YYVA 3VB2A 3NRVA 4BXUA 3IRRA 3GFLA 1UHWA 1XN7A 2M30A 2QVOA 1MJAA 2E1NA 5FFZA 2O6GE 4LB5A 4AD9A 5LRSA 5HS9A 3JTHA 4MHGA 2QLZA 4ETSA 1O3RA 4CYDA 4R79A 3V8JA 5D6EA 1GVJA 3FM3A 3F22A 3WTWC 2VE8A 3N97A 2XKOA 2XAGA 3KFWX 1AOYA 1R5HA 3R61A 1XDUA 1QO0D 3I4PA 2E7XA 1W5TA 3ZP5A 5BPIA 2GXBA 4ZYGA 4GO1A 2NNYA 3ECHA 1YS6A 4FT8A 2RV8A 3SZTA 5K5QA 1EH6A 4RGRA 4IRIA 1B59A 4YG2F 4UXNA 1I5ZA 4KMUX 2OBPA 1ZLJA 4HLXA 2O03A 4ZYHA 4HA8A 3HSEA 2J5PA 1XGMA 4WXHA 4K2EA 2STWA 1I1SA 3RKWA 3I59B 3E5XA 4RB3C 4RGUA 3BPVA 3FM5A 5H20A 1FC3A 4XSZF 5D8LB 1IXSB 2Q8KA 1S3JA 2FMLA 1D5VA 4L9TA 2PQ8A 2ZO4A 4M74A 5CYVA 4BHBA 2X4HA 2LDUA 3DPTA 1HW1A 4YIIA 5E1XA 5DUKA 1OYIA 3WGHA 4A5NA 2GXGA 2KJBA 4O6JA 1QZYA 4OINF 1W7PA 4P9FA 1OMIA 1J75A 3RKXA 4EJWA 5ICEA 4I0AA 4NB5A 2HFHA 2OZ6A 1IRFA 3IWFA 2RVCA 2JZYA 2V1DA 1K7AA 1LEAA 2XRNA 1R22A 2K27A 1RUOA 4UVCA 4LG0A 1Z1DA 1KA8A 2D2WA 4A6EA 1RNLA 5IT9K 3O2PE 3M9AA 3W6KB 3QOPA 3TDUC 4RB1A 2OAZA 1Z05A 4HAMA 3L00A 3KP5A 2L01A 5J8CA 3GZ6A 3KP6A 3J81Z 3RYPA 5CVUA 4I0BA 1NHAA 3F3XA 4ESBA 1S7OA 3C1DA 1K79A 2V9VA 2GAUA 1ZARA 1SMTA 1U8RA 4P55A 2FMYA 4CICA 1J59A 3TOAA 1UCRA 5E1WA 3LQQA 2ZJ2A 3D5LA 4UV8A 3E3VA 2VC1A 2EFPA 5DCFA 4Y15A 2DFIA 3HOTA 1ZREA 3CUQC 1OYYA 1P4WA 1P92A 1SD7A 2RQPA 1SD6A 5FLXZ 1R5GA 3LA3A 1FYMA 2GA2A 1IRGA 4YFKF 2VBYA 3ZMSA 2H27A 1B9MA 4IF4A 4EM1A 1BIAA 4OMZA 1IXCA 1DUXC 1WI9A 1F1ZA 1F5TA 2D45A 4G9YA 2E1CA 3CO6C 1GXQA 5HOOA 5DCMB 1S7AA 1YS7A 2FRHA 3GLXA 3HSFA 1IAWA 2KRFA 3I58A 1TNSA 5KK1A 3ZMUA 2W85A 2YR2A 1ON2A 1O7LA 1J5YA 3Q5FA 3GEZA 2ESNA 1MGTA 1BOAA 2P8TA 1STZA 1SMYF 3MQ0A 4ASNA 2O3FA 1JHFA 4RS8A 5EEHA 2IVMA 4PZJA 3RIRA 1J9IA 1MD0A 5DD4A 3V7RA 3DXJF 1T2KA 1X3UA 4HYEA 5LHGA 1ZN2A 5E18F 3HIFA 3WU1B 3TO6A 1A04A 2IW5A 1RZ4A 3R0AA 1WSUA 2IA0A 4FHTA 2FSWA 2GWRA 5L3BA 1O57A 2HQRA 4Y13A 5CLSA 2LKPA 2PI0A 3U1DA 1IUYA 1B6AA 3M8FA 2HYGD 2XAJA 2PMHA 4CXFA 3WG9A 2IA1A 3L09A 4KUMA 3JAMZ 2DLLA 3J81K 3ZQ7A 3FZVA 5LGUA 4IVNA 2GIVA 1W7PD 2M5WA 4ENMA 4Q48A 3OV8A 3E97A 4A0YA 4PGGA 4CHUA 3U9GA 2EB7A 3F72A 2K4JA 1BI3A 4GXOA 2BGCA 3H3UA 3QP6A 4LK0F 3TO9A 1FY7A 4BAYA 2QQ9A 1KQ0A 3VFZA 3V8KA 3ML6A 4XLPF 5CVVA 1R7JA 1Z6RA 1FYKA 3NEUA 2YX7A 3GW2A 4Q4ZF 2ETHA 4IRHA 5FLXK 2P7CB 1R1UA 2GZWA 3WE2A 2DPDA 2A07F 4IRGA 1IN7A 5E20A 1HSJA 5FD6A 2VBZA 4P5OA 4M9SA 1F4KA 4LLLA 2HZTA 1USTA 1LVAA 1ZH5A 4WXDA 3U2RA 4KDPA 2FQ3A 2CW0F 1YW8A 2VC0A 5EEGA 1BC7C 4LFUA 3P9CA 5CVJA 1LDKB 2MH9A 1IXRC 1U5TB 2P5LC 1ZHFA 1DPRA 4M73A 1KYZA 3T8RA 1KGSA 1KU9A 1ZLKA 5K5RA 2YX4A 2P7VB 2W57A 4DNCA 3FMRA 4PDKA 2FNPA 3MFKA 2RC4A 1O3QA 3M8EA 2M8EA 3WTUC 2F5EA 4GCVA 4HV6A 1O3TA 3F8BA 4HBLA 1G4DA 5HDGA 2RGVA 3R6SA 1SFEA 2K4BA 2OU2A 2Z9OA 4L0YB 2IP2A 1USSA 4AVPA 4WXCA 3F8MA 4RGXA 3OOPA 3FWEA 3S2WA 2PBIA 2HQNA 1FSHA 2XHKA 3I59A 4G94A 4GYIA 1XGNA 1TW2A 2OA4A 4P9UA 3HOSA 3MEXA 4U7DA 1LJ9A 2O61A 3EYIA 1LNWA 3WGIA 1D8KA 3FX3A 3JAMK 1BC8C 1VTNC 2V6CA 3I53A 1TW3A 4HQEA 1HKQA 4GGGA 3SZPA 2DAOA 3GFIA 1ZG1A 2V79A 3H92A 2DPUA 3ZN0A 1CGPA 1LDJA 5K5OA 2F5FA 2BYVE 3FMQA 3JW4A 4MQVA 3FXQA 4QWQA 1E17A 4ZYEA 3DQVC 2QYOA 2P5VA 4O5VA 1J2XA 3BJ6A 5HLIA 2ZMEB 4TV7A 2G7UA 5LRRA 3KEQA 3SFZA 4XBFA 1SAXA 3RJPA 3K0LA 5DV5A 4HQMA 2R7DA 5D5WB 4AIHA 3IC7A 3PQKA 3QPHA 1IW7F 2FBKA 2XROA 4ZZLA 3C18A 5A2QZ 3G3ZA 3DPLC 1V3FA 3IHUA 1TTYA 3TO7A 4HX8A 2PLYA 2D1HA 1T0FA 4KICA 4HF0A 2DO7A 5LHIA 1LQ1A 4G6DA 2W24A 1R58A 4KIBA 2JT1A 4ON0A 1FPQA 2UWMA 3WTTC 1JE8A 3BZ6A 1UB9A 3WTXC 2VONA 3ELKA 2VXZA 5ERIA 3EQLF 3BOQA 5F6FA 3K1PA 4YIFA 4A12A 3R0JA 4EV0A 1BI1A 4U0WA 4HDVA 3SXYA 5LEJA 2GQQA 3WTVC 4Q47A 1C0WA 5L3FA 1J0RA 1HXDA 2Q0OA 3ULQB 1XCVA 4ENNA 1K6OA 3E5UA 4XRFA 3B73A 2HGCA 1P6RA 1IN5A 4QLCU 1OYWA 4G7HF 5LGTA 3E6MA 4A5MA 3HUGA 3MCZA 2P5KA 1R1VA 2Y75A 1I27A 1OKRA 3KCCA 3IRQA 3F6VA 4Z2YA 2PN6A 3V4GA 2V1UA 1S6LA 1TQIA 5DCMA 4Q5SF 2FBIA 3TDZC 5JFRA 4ENJA 5BMZA 2XAQA 2R7FA 1YO5C 2HTJA 1ZG5A 1OPCA 1SD5A 4HF2A 4L9VA 2P4WA 1O7FA 3LWFA 3N4MA 3L9FA 2VOOA 2Z3YA 1T6SA 2DBBA 1RUNA 2ISZA 2ZFWA 3GUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HZF A;  1IN4 A;  1IN6 A;  3HHH A;  1G3W A;  4EMS A;  3LAJ A;  4FX0 A;  1QZZ A;  2EFO A;  1KU7 A;  4WF2 A;  4L0Z B;  2COM A;  3RKY A;  4HF1 A;  3BDD A;  4I09 A;  1FP2 A;  2W84 A;  3LAP A;  2FF4 A;  2PEX A;  2FU4 A;  1RIO H;  4FX4 A;  3BJA A;  2DQL A;  1REP C;  3RPU A;  5ICG A;  3WTS C;  1P4X A;  5L3D A;  1G6N A;  3BPX A;  1H0M A;  2JPC A;  5JR3 A;  3K1N A;  3M7G A;  4G7Z F;  1WWX A;  5A2Q K;  4LLN A;  2WC2 A;  1DDN A;  3TOB A;  3GF2 A;  4KNY A;  2FOK A;  2GA1 A;  2G9W A;  3JSO A;  2QZ8 A;  4RGS A;  4EJU A;  4AIJ A;  4KN7 X;  2LF7 A;  3GXO A;  1H9G A;  5ILV A;  3HRU A;  2VT3 A;  3CUQ B;  3ROU A;  2CGP A;  3HRM A;  5FGM A;  2KIU A;  5BQT A;  2NRA C;  2HOE A;  2EA2 A;  1ZGJ A;  5LLQ A;  3ZPL A;  4M72 A;  2PG4 A;  5BOX A;  2CFX A;  3QAH A;  4A6D A;  4D0P A;  3DF8 A;  2AXL A;  6PAX A;  4U88 A;  3BRO A;  4OIR F;  1IF1 A;  5JHU A;  2VOP A;  2KIF A;  5HLG A;  3PQJ A;  3T1B A;  2DW4 A;  1WKM A;  3WGG A;  1G3T A;  1BJA A;  5FD5 A;  4L5J A;  5D8K B;  1XSX A;  4E70 A;  4KT5 C;  3HHG A;  1JXS A;  4NQW A;  1PP8 F;  3ZMD A;  2YSR A;  1JHH A;  4N9I A;  1PDN C;  2VN2 A;  2QQB A;  4N0B A;  2Y0M A;  4HX4 A;  4A0X A;  2HEO A;  1SFX A;  2F5C A;  1LEB A;  4B8X A;  5ICF A;  1U5T A;  3NQO A;  3L2C A;  2HS5 A;  4MEX F;  4OIO F;  2ADU A;  1G3Y A;  2A61 A;  3SHF A;  2R3S A;  4HX7 A;  3IKT A;  1ZRC A;  5CJ9 A;  3RDI A;  2M1B A;  1KU3 A;  2FA5 A;  4UUV A;  1UFM A;  3LFK A;  1SD4 A;  2Z99 A;  3HSR A;  2VBW A;  3WTZ A;  5E8G A;  1OR7 A;  1QBJ A;  4EJT A;  5FB2 A;  5DD8 A;  2MLG A;  3REO A;  1ZRF A;  2IT0 A;  3CO7 C;  5DDG A;  1FX7 A;  3LST A;  1Y0U A;  2HDC A;  2HR3 A;  4R8H A;  3MZH A;  3TQN A;  3DV8 A;  3TGN A;  1CF7 B;  2KKO A;  1BI2 A;  3KEO A;  3F21 A;  1TQM A;  3LA7 A;  1KYW A;  1XD7 A;  3P7N A;  4CO8 A;  2BE5 F;  1HST A;  2FBH A;  1HBX G;  1XMA A;  1B9N A;  2LNB A;  1FSE A;  4EM0 B;  2C6Y A;  2EK5 A;  5LGN A;  5FFX A;  2IRF G;  1DPU A;  3HRS A;  2ESH A;  2A6E F;  3QPT A;  2QBY B;  3JSP A;  1DP7 P;  2QM3 A;  1ODD A;  2XKP A;  3WOD F;  3E6C C;  2H6B A;  2K02 A;  3ABT A;  2A3S A;  5AON A;  4L9J A;  3KP7 A;  2EFQ A;  5HS8 A;  2LF8 A;  4WK8 F;  1XMK A;  2HKO A;  1G3S A;  4BYY A;  3EDP A;  3KE2 A;  1MDM B;  5BPD A;  5D5U B;  3F8C A;  5CVR A;  5TJJ A;  4XLN F;  1LB2 A;  3J7A O;  3CUO A;  2DT5 A;  3PFI A;  1J7K A;  2ZNZ A;  1BM9 A;  2ZME A;  1GHC A;  1H9T A;  4UVA A;  5LEK A;  2XAH A;  2L3D A;  2FE3 A;  2A6H F;  5ILS A;  5E8I A;  1ON1 A;  4KIF A;  1XSV A;  1Q1H A;  2YPR A;  1Z91 A;  4EGY A;  2D1V A;  1P4A A;  4OU0 A;  1WQ2 A;  4JQF A;  1T39 A;  2RNJ A;  1U78 A;  1ZAO A;  4MNU A;  1QNT A;  1ZRD A;  4KA4 A;  3IL2 A;  1HW2 A;  3WU0 A;  2XUB A;  3RI4 A;  4F7Z A;  4OMY A;  4WWC A;  1ZYR F;  1ZG3 A;  2PJP A;  5HLH A;  4EJV A;  5LBQ A;  2EFW A;  4I01 A;  3DEU A;  1D8J A;  3R60 A;  1YQA A;  4BHC A;  4EGZ A;  3KP2 A;  2DK8 A;  3RYR A;  1V4R A;  3ISP A;  1YW7 A;  2E7W A;  3G73 A;  2ZNY A;  4HOB A;  2ISY A;  2VBX A;  1MZB A;  4RB0 A;  3IKV A;  2UZK A;  4KN4 X;  4M9Z A;  3ZMT A;  4ESJ A;  3I5U A;  2O8X A;  1YW9 A;  2XAF A;  1FBU A;  3MWM A;  4HDU A;  3VEP A;  1IN8 A;  2ZKZ A;  2EFN A;  2B0L A;  2BBY A;  4ZH4 F;  4L5I A;  1K78 B;  2NYX A;  2OD5 A;  5CVI A;  5DYM A;  1HKS A;  4LB6 B;  4XSX F;  3P9K A;  2QQA A;  2W25 A;  3BWG A;  2VOD A;  4JK1 X;  1FT9 A;  3K2Z A;  4N9H A;  3ERE D;  2CWE A;  3ZMV A;  1YFH A;  2BV6 A;  2STT A;  3COA C;  1YLF A;  1TQP A;  5D5X B;  4CDG A;  2HTS A;  4U0V A;  2DI3 A;  4MGR A;  3FHZ A;  4MTD A;  2XAS A;  2A68 F;  4YFN F;  3DKW A;  5D4R A;  5JI6 A;  2RN7 A;  3T8T A;  3D0S A;  3CDH A;  2IJL A;  5HVQ C;  2JTV A;  2DTR A;  4Y17 A;  5DUI A;  2K86 A;  1L3L A;  5ILU A;  3QU6 A;  2XVC A;  1ONV A;  5HDK A;  4M6Y A;  1PUE E;  4UVB A;  4OOI A;  3V7C A;  4WX9 A;  3GYH X;  1HW5 A;  3MZY A;  4L9N A;  2WV0 A;  3I64 A;  3P9I A;  5FO5 A;  2L4M A;  2RKH A;  4M71 A;  3ZMZ A;  3QP5 A;  4RB2 C;  2KIM A;  1AWC A;  1E2X A;  5KVR A;  3C7J A;  4L18 B;  3KP3 A;  4IHS A;  3DP7 A;  2DK5 A;  3DFG A;  4G8X A;  2M87 A;  2KJC A;  4OIQ F;  1U2W A;  1BN5 A;  5HS7 A;  2A69 F;  2OZU A;  5DEQ A;  4G7O F;  4HLY A;  3WE3 A;  2MLK A;  2OQR A;  1ZGA A;  4M9X A;  5J6X A;  5E17 F;  1W5S A;  5L3E A;  2HWV A;  2H94 A;  4KMF A;  5AIQ A;  1F9N A;  2NAZ A;  4LLG F;  1Z9C A;  4H0E A;  4BHP A;  3L7W A;  4UNO A;  4R1H A;  5ED4 A;  3CUQ A;  2IPQ X;  3FXR A;  3HTS B;  4KFC A;  2Z33 A;  5TRD A;  4RAZ A;  3I0T A;  1FOK A;  1BI0 A;  2MA3 A;  4MQ9 F;  1XB4 A;  2FXA A;  4I02 A;  4S04 A;  4P96 A;  4CZZ A;  5IT3 A;  3GX4 X;  1FNN A;  2O0Y A;  4RAY A;  4PGH A;  3EYY A;  1KQ8 A;  3HTU A;  1ULY A;  2VE9 A;  4BH9 A;  2HKX A;  2VT2 A;  3T0Y A;  3VOE A;  3GO5 A;  4I98 B;  1GXP A;  3ECO A;  4ZZD A;  4EQQ A;  1QGP A;  1W7P B;  1LDD A;  4IPA A;  3BP8 A;  4PCQ A;  3O3K A;  4BNC A;  1U6G A;  3ABU A;  3HYI A;  3E6B A;  2DQR A;  2CYY A;  1XCB A;  5L3C A;  4M6X A;  2XIG A;  4A2U A;  3J80 Z;  3R4K A;  1FBS A;  2K7L A;  4LG0 B;  3T5X A;  5JVT A;  2H09 A;  2XGX A;  1R36 A;  2H6C A;  3IWZ A;  3SQN A;  2OQG A;  1EV7 A;  3V8L A;  4WCG A;  1FP1 D;  2AS5 F;  3CTA A;  2EA4 A;  3M1E A;  3MAJ A;  2F2E A;  4S05 A;  2LSO A;  4HW0 A;  2J5O A;  4DQ2 A;  1FZP B;  3F23 A;  4I2O A;  3BJO A;  1QQI A;  4IXA A;  2BEO A;  2ZXJ A;  3ZN1 A;  4HV5 A;  2EV6 A;  1U3E M;  4YFX F;  4UHT A;  1SFU A;  4LJZ F;  5ICC A;  2CO5 A;  3KZZ A;  3F8F A;  3FMS A;  2EJR A;  3RPQ A;  1CF7 A;  2TDX A;  4B09 A;  1UHM A;  1KQ9 A;  3QRF F;  3HRT A;  2QWW A;  1FYL A;  1TNT A;  1RI7 A;  2WTE A;  4MEY F;  4U7B A;  4U0Y A;  4BQA A;  3GFM A;  3GZ5 A;  2EV5 A;  1YIO A;  2XV4 S;  2WWY A;  2ACJ A;  2UXN A;  5HDN A;  2QBY A;  4ZYD A;  2M45 A;  2QUF A;  1T98 A;  1R1T A;  2EWN A;  5D6F A;  3WTY C;  2UXX A;  1P2F A;  2FNA A;  4MTE A;  1R00 A;  3FXU A;  3FF5 A;  2L4A A;  3K1M A;  2V1X A;  1MJ9 A;  3I71 A;  4G6Q A;  2Y48 A;  2F5D A;  2FEZ A;  4EM2 A;  2ZBK A;  2RDP A;  1MDM A;  4LGW A;  2PFB A;  1B4A A;  5LHH A;  3H3Z A;  3EET A;  1HKT A;  3E5Q A;  1I6X A;  1EH8 A;  3KP4 A;  3E6D A;  1S29 A;  1XGO A;  2X0L A;  4O3M A;  4KYW A;  4AIK A;  2Q2E A;  4ENK A;  3JTG A;  1FLI A;  1T38 A;  4OIP F;  3GFJ A;  3QU3 A;  2EV0 A;  5L3G A;  1BBY A;  4JBA A;  2CQK A;  1U5T C;  2QEN A;  2JPB A;  1XSD A;  1Z7U A;  2P6S A;  4CGZ A;  1EH7 A;  3KLO A;  1XDS A;  2MH2 A;  2HYF A;  2G7H A;  2NNN A;  5K1Y A;  3F6O A;  1MJB A;  3KLN A;  5H6Q A;  2JSC A;  4LMY A;  5D5V B;  3LA2 A;  4KIG A;  4GYG A;  3J80 K;  3LQR A;  5E1Z B;  1O3S A;  1Z6T A;  3K9T A;  4NHJ A;  3EUH A;  4EJO A;  2L54 A;  4AWX B;  3KZY A;  1D3Y A;  5BS6 A;  1KU2 A;  4LK1 F;  1WRJ A;  1PP7 U;  3BY6 A;  1HQC A;  1I1G A;  4EVI A;  2MD5 A;  1XGS A;  4A0Z A;  2NS0 A;  4ESF A;  4UV9 A;  2L02 A;  3O6B B;  1IZ1 A;  1TBX A;  5AIP A;  3VOD A;  1R23 A;  3AAF A;  2Z5U A;  5F1R A;  3CJN A;  5D4S A;  1FBQ A;  1YTY A;  1JGS A;  1L0O C;  1MKM A;  2P6T A;  5F64 A;  1K78 A;  1BIB A;  3TKY A;  3GWZ A;  2JRT A;  1TLH B;  1FWZ A;  3RTR A;  4LD5 A;  2IA2 A;  3Q9S A;  3KET A;  2ZCW A;  3Q9V A;  2YU3 A;  2PMU A;  3I54 A;  1QPM A;  3B02 A;  2MC3 A;  2DU9 A;  3C3W A;  2A5Y B;  3F8N A;  3K69 A;  3V7S A;  3W6J B;  1W4M A;  1YG2 A;  4I7H A;  4IHT A;  5J8F A;  3GVA A;  5IT9 Z;  1S8N A;  2ELH A;  2CG4 A;  5H6R A;  1B1B A;  4IJA A;  2CSO A;  3CLO A;  2MBF A;  1YYV A;  3VB2 A;  3NRV A;  4BXU A;  3IRR A;  3GFL A;  1UHW A;  1XN7 A;  2M30 A;  2QVO A;  1MJA A;  2E1N A;  5FFZ A;  2O6G E;  4LB5 A;  4AD9 A;  5LRS A;  5HS9 A;  3JTH A;  4MHG A;  2QLZ A;  4ETS A;  1O3R A;  4CYD A;  4R79 A;  3V8J A;  5D6E A;  1GVJ A;  3FM3 A;  3F22 A;  3WTW C;  2VE8 A;  3N97 A;  2XKO A;  2XAG A;  3KFW X;  1AOY A;  1R5H A;  3R61 A;  1XDU A;  1QO0 D;  3I4P A;  2E7X A;  1W5T A;  3ZP5 A;  5BPI A;  2GXB A;  4ZYG A;  4GO1 A;  2NNY A;  3ECH A;  1YS6 A;  4FT8 A;  2RV8 A;  3SZT A;  5K5Q A;  1EH6 A;  4RGR A;  4IRI A;  1B59 A;  4YG2 F;  4UXN A;  1I5Z A;  4KMU X;  2OBP A;  1ZLJ A;  4HLX A;  2O03 A;  4ZYH A;  4HA8 A;  3HSE A;  2J5P A;  1XGM A;  4WXH A;  4K2E A;  2STW A;  1I1S A;  3RKW A;  3I59 B;  3E5X A;  4RB3 C;  4RGU A;  3BPV A;  3FM5 A;  5H20 A;  1FC3 A;  4XSZ F;  5D8L B;  1IXS B;  2Q8K A;  1S3J A;  2FML A;  1D5V A;  4L9T A;  2PQ8 A;  2ZO4 A;  4M74 A;  5CYV A;  4BHB A;  2X4H A;  2LDU A;  3DPT A;  1HW1 A;  4YII A;  5E1X A;  5DUK A;  1OYI A;  3WGH A;  4A5N A;  2GXG A;  2KJB A;  4O6J A;  1QZY A;  4OIN F;  1W7P A;  4P9F A;  1OMI A;  1J75 A;  3RKX A;  4EJW A;  5ICE A;  4I0A A;  4NB5 A;  2HFH A;  2OZ6 A;  1IRF A;  3IWF A;  2RVC A;  2JZY A;  2V1D A;  1K7A A;  1LEA A;  2XRN A;  1R22 A;  2K27 A;  1RUO A;  4UVC A;  4LG0 A;  1Z1D A;  1KA8 A;  2D2W A;  4A6E A;  1RNL A;  5IT9 K;  3O2P E;  3M9A A;  3W6K B;  3QOP A;  3TDU C;  4RB1 A;  2OAZ A;  1Z05 A;  4HAM A;  3L00 A;  3KP5 A;  2L01 A;  5J8C A;  3GZ6 A;  3KP6 A;  3J81 Z;  3RYP A;  5CVU A;  4I0B A;  1NHA A;  3F3X A;  4ESB A;  1S7O A;  3C1D A;  1K79 A;  2V9V A;  2GAU A;  1ZAR A;  1SMT A;  1U8R A;  4P55 A;  2FMY A;  4CIC A;  1J59 A;  3TOA A;  1UCR A;  5E1W A;  3LQQ A;  2ZJ2 A;  3D5L A;  4UV8 A;  3E3V A;  2VC1 A;  2EFP A;  5DCF A;  4Y15 A;  2DFI A;  3HOT A;  1ZRE A;  3CUQ C;  1OYY A;  1P4W A;  1P92 A;  1SD7 A;  2RQP A;  1SD6 A;  5FLX Z;  1R5G A;  3LA3 A;  1FYM A;  2GA2 A;  1IRG A;  4YFK F;  2VBY A;  3ZMS A;  2H27 A;  1B9M A;  4IF4 A;  4EM1 A;  1BIA A;  4OMZ A;  1IXC A;  1DUX C;  1WI9 A;  1F1Z A;  1F5T A;  2D45 A;  4G9Y A;  2E1C A;  3CO6 C;  1GXQ A;  5HOO A;  5DCM B;  1S7A A;  1YS7 A;  2FRH A;  3GLX A;  3HSF A;  1IAW A;  2KRF A;  3I58 A;  1TNS A;  5KK1 A;  3ZMU A;  2W85 A;  2YR2 A;  1ON2 A;  1O7L A;  1J5Y A;  3Q5F A;  3GEZ A;  2ESN A;  1MGT A;  1BOA A;  2P8T A;  1STZ A;  1SMY F;  3MQ0 A;  4ASN A;  2O3F A;  1JHF A;  4RS8 A;  5EEH A;  2IVM A;  4PZJ A;  3RIR A;  1J9I A;  1MD0 A;  5DD4 A;  3V7R A;  3DXJ F;  1T2K A;  1X3U A;  4HYE A;  5LHG A;  1ZN2 A;  5E18 F;  3HIF A;  3WU1 B;  3TO6 A;  1A04 A;  2IW5 A;  1RZ4 A;  3R0A A;  1WSU A;  2IA0 A;  4FHT A;  2FSW A;  2GWR A;  5L3B A;  1O57 A;  2HQR A;  4Y13 A;  5CLS A;  2LKP A;  2PI0 A;  3U1D A;  1IUY A;  1B6A A;  3M8F A;  2HYG D;  2XAJ A;  2PMH A;  4CXF A;  3WG9 A;  2IA1 A;  3L09 A;  4KUM A;  3JAM Z;  2DLL A;  3J81 K;  3ZQ7 A;  3FZV A;  5LGU A;  4IVN A;  2GIV A;  1W7P D;  2M5W A;  4ENM A;  4Q48 A;  3OV8 A;  3E97 A;  4A0Y A;  4PGG A;  4CHU A;  3U9G A;  2EB7 A;  3F72 A;  2K4J A;  1BI3 A;  4GXO A;  2BGC A;  3H3U A;  3QP6 A;  4LK0 F;  3TO9 A;  1FY7 A;  4BAY A;  2QQ9 A;  1KQ0 A;  3VFZ A;  3V8K A;  3ML6 A;  4XLP F;  5CVV A;  1R7J A;  1Z6R A;  1FYK A;  3NEU A;  2YX7 A;  3GW2 A;  4Q4Z F;  2ETH A;  4IRH A;  5FLX K;  2P7C B;  1R1U A;  2GZW A;  3WE2 A;  2DPD A;  2A07 F;  4IRG A;  1IN7 A;  5E20 A;  1HSJ A;  5FD6 A;  2VBZ A;  4P5O A;  4M9S A;  1F4K A;  4LLL A;  2HZT A;  1UST A;  1LVA A;  1ZH5 A;  4WXD A;  3U2R A;  4KDP A;  2FQ3 A;  2CW0 F;  1YW8 A;  2VC0 A;  5EEG A;  1BC7 C;  4LFU A;  3P9C A;  5CVJ A;  1LDK B;  2MH9 A;  1IXR C;  1U5T B;  2P5L C;  1ZHF A;  1DPR A;  4M73 A;  1KYZ A;  3T8R A;  1KGS A;  1KU9 A;  1ZLK A;  5K5R A;  2YX4 A;  2P7V B;  2W57 A;  4DNC A;  3FMR A;  4PDK A;  2FNP A;  3MFK A;  2RC4 A;  1O3Q A;  3M8E A;  2M8E A;  3WTU C;  2F5E A;  4GCV A;  4HV6 A;  1O3T A;  3F8B A;  4HBL A;  1G4D A;  5HDG A;  2RGV A;  3R6S A;  1SFE A;  2K4B A;  2OU2 A;  2Z9O A;  4L0Y B;  2IP2 A;  1USS A;  4AVP A;  4WXC A;  3F8M A;  4RGX A;  3OOP A;  3FWE A;  3S2W A;  2PBI A;  2HQN A;  1FSH A;  2XHK A;  3I59 A;  4G94 A;  4GYI A;  1XGN A;  1TW2 A;  2OA4 A;  4P9U A;  3HOS A;  3MEX A;  4U7D A;  1LJ9 A;  2O61 A;  3EYI A;  1LNW A;  3WGI A;  1D8K A;  3FX3 A;  3JAM K;  1BC8 C;  1VTN C;  2V6C A;  3I53 A;  1TW3 A;  4HQE A;  1HKQ A;  4GGG A;  3SZP A;  2DAO A;  3GFI A;  1ZG1 A;  2V79 A;  3H92 A;  2DPU A;  3ZN0 A;  1CGP A;  1LDJ A;  5K5O A;  2F5F A;  2BYV E;  3FMQ A;  3JW4 A;  4MQV A;  3FXQ A;  4QWQ A;  1E17 A;  4ZYE A;  3DQV C;  2QYO A;  2P5V A;  4O5V A;  1J2X A;  3BJ6 A;  5HLI A;  2ZME B;  4TV7 A;  2G7U A;  5LRR A;  3KEQ A;  3SFZ A;  4XBF A;  1SAX A;  3RJP A;  3K0L A;  5DV5 A;  4HQM A;  2R7D A;  5D5W B;  4AIH A;  3IC7 A;  3PQK A;  3QPH A;  1IW7 F;  2FBK A;  2XRO A;  4ZZL A;  3C18 A;  5A2Q Z;  3G3Z A;  3DPL C;  1V3F A;  3IHU A;  1TTY A;  3TO7 A;  4HX8 A;  2PLY A;  2D1H A;  1T0F A;  4KIC A;  4HF0 A;  2DO7 A;  5LHI A;  1LQ1 A;  4G6D A;  2W24 A;  1R58 A;  4KIB A;  2JT1 A;  4ON0 A;  1FPQ A;  2UWM A;  3WTT C;  1JE8 A;  3BZ6 A;  1UB9 A;  3WTX C;  2VON A;  3ELK A;  2VXZ A;  5ERI A;  3EQL F;  3BOQ A;  5F6F A;  3K1P A;  4YIF A;  4A12 A;  3R0J A;  4EV0 A;  1BI1 A;  4U0W A;  4HDV A;  3SXY A;  5LEJ A;  2GQQ A;  3WTV C;  4Q47 A;  1C0W A;  5L3F A;  1J0R A;  1HXD A;  2Q0O A;  3ULQ B;  1XCV A;  4ENN A;  1K6O A;  3E5U A;  4XRF A;  3B73 A;  2HGC A;  1P6R A;  1IN5 A;  4QLC U;  1OYW A;  4G7H F;  5LGT A;  3E6M A;  4A5M A;  3HUG A;  3MCZ A;  2P5K A;  1R1V A;  2Y75 A;  1I27 A;  1OKR A;  3KCC A;  3IRQ A;  3F6V A;  4Z2Y A;  2PN6 A;  3V4G A;  2V1U A;  1S6L A;  1TQI A;  5DCM A;  4Q5S F;  2FBI A;  3TDZ C;  5JFR A;  4ENJ A;  5BMZ A;  2XAQ A;  2R7F A;  1YO5 C;  2HTJ A;  1ZG5 A;  1OPC A;  1SD5 A;  4HF2 A;  4L9V A;  2P4W A;  1O7F A;  3LWF A;  3N4M A;  3L9F A;  2VOO A;  2Z3Y A;  1T6S A;  2DBB A;  1RUN A;  2ISZ A;  2ZFW A;  3GUD A; 
#chains in the Genus database with same CATH topology
 1R4N B;  4HZF A;  1IN4 A;  1IN6 A;  3HHH A;  2LY1 A;  1G3W A;  4EMS A;  3LAJ A;  4FX0 A;  1QZZ A;  2EFO A;  1KU7 A;  4WF2 A;  4MFD A;  4AYB N;  4L0Z B;  2COM A;  3RKY A;  4KIS A;  2HVS A;  3L2U A;  4HF1 A;  2R7R A;  3BDD A;  4I09 A;  1FP2 A;  2W84 A;  1IV8 A;  3LAP A;  2FF4 A;  1YIT I;  2PEX A;  3A1Y A;  3BR1 A;  1Z7L A;  1GV5 A;  2FU4 A;  4XNF A;  3FK6 A;  4FX4 A;  1RIO H;  3FKI J;  4NBQ A;  3OYC A;  4M3D A;  5C4X J;  3OIO A;  3BJA A;  2DQL A;  1REP C;  3RPU A;  3HG9 A;  5ICG A;  3WTS C;  1WPK A;  2F4O B;  2MFZ A;  4HPQ A;  1IRZ A;  1P4X A;  5L3D A;  1G6N A;  3DKY A;  3RSN A;  3BPX A;  1H0M A;  2JPC A;  4MO7 A;  5JR3 A;  1W1W E;  5HOD A;  3K1N A;  2KIQ A;  2BW3 B;  3M7G A;  5M5Y J;  1FMV A;  2X85 A;  4G7Z F;  2WAE A;  1RES A;  1WWX A;  2NOJ B;  5A2Q K;  1EF4 A;  1XG1 A;  3N05 A;  5GAG J;  3NWT A;  4LLN A;  2WC2 A;  1DDN A;  3TOB A;  4A3B J;  2DA1 A;  3GF2 A;  2CS3 A;  4KNY A;  1POG A;  2FOK A;  2WAF A;  2GA1 A;  2EIK H;  2G9W A;  1WHU A;  2LLK A;  3JSO A;  3UKG A;  2QZ8 A;  4RGS A;  4EJU A;  3HB9 A;  4AIJ A;  4RMN A;  4KN7 X;  4BJ5 C;  2LF7 A;  2HQ5 A;  3GXO A;  2CMP A;  1H9G A;  4E4H A;  1UAA A;  5ILV A;  4HG2 A;  1MBK A;  3JCU C;  3BTJ A;  5TIS C;  3OYI A;  1VQ7 I;  3HRU A;  2IAI A;  3DPU A;  5B3S H;  1XX5 A;  2X1D A;  2HI3 A;  2VT3 A;  4HSR A;  3CUQ B;  3ROU A;  2CJJ A;  2CGP A;  3HRM A;  2DMP A;  5FGM A;  2KIU A;  2I10 A;  5BQT A;  2FOW A;  1SAN A;  2NRA C;  3H0D A;  4UUS B;  2HOE A;  2EA2 A;  1ZGJ A;  5LLQ A;  3ZPL A;  2JA8 J;  3HEF A;  4M72 A;  3HL2 A;  4JX4 A;  2PG4 A;  1JUS A;  3EPZ A;  4I6Z A;  2YS9 A;  2CW7 A;  5BOX A;  2CFX A;  1X1B A;  3QAH A;  4A6D A;  3S1N J;  4D0P A;  3GZN B;  3BTC A;  2R93 J;  3DF8 A;  1X58 A;  2AXL A;  2V4J C;  6PAX A;  1OCT C;  4U88 A;  3AL0 B;  5EZH A;  2IBD A;  3BRO A;  5CQE A;  1YI2 I;  2OUM A;  3S14 J;  3DTK A;  1JUP A;  4MIM A;  4OIR F;  1IF1 A;  1RPW A;  5JHU A;  5K7Z A;  2E34 A;  2VOP A;  2WAQ N;  1JI8 A;  2KIF A;  2JRM A;  1XS9 A;  4V19 K;  5HLG A;  3PQJ A;  1K4T A;  3T1B A;  2DW4 A;  1WKM A;  2HOA A;  4A93 J;  3CC4 I;  2M9H A;  3CC7 I;  3WGG A;  1G3T A;  1BJA A;  2Y9Y A;  4ZTJ A;  1X1A A;  4L5J A;  5FD5 A;  5D8K B;  4PFO A;  3M8J A;  4RAF A;  1XSX A;  4B47 A;  4E7S A;  3K4C A;  4E70 A;  1Z3Y A;  3OL3 A;  3VYR B;  4DIQ A;  4KT5 C;  3RQ4 A;  3LMM A;  3HHG A;  1JXS A;  2XPW A;  4NQW A;  2Y0S N;  1PP8 F;  3ZMD A;  2UUZ A;  2YSR A;  1JHH A;  4N9I A;  4RA2 A;  1PDN C;  4C30 A;  2E1M B;  2VN2 A;  2QQB A;  2LR8 A;  4N0B A;  4BU2 A;  2Y0M A;  4HX4 A;  4A0X A;  1MND A;  3LOC A;  2HEO A;  4XRM A;  2LD5 A;  2V6E A;  1SFX A;  2F5C A;  1D0Z A;  4EEF G;  1LEB A;  4B8X A;  4E7H A;  5ICF A;  1U5T A;  3NQO A;  3L2C A;  1ZQ3 P;  2HS5 A;  4MEX F;  4OIO F;  2ADU A;  2NS7 A;  3EUK L;  1HCR A;  1G3Y A;  2A61 A;  3BCB A;  3SHF A;  2R3S A;  4HX7 A;  1WJC A;  2EIN H;  3IKT A;  1ZRC A;  3CD6 I;  5CJ9 A;  3RDI A;  4XLA A;  2M1B A;  1KU3 A;  2OV7 A;  2FA5 A;  4UUV A;  2F6C A;  5FRO A;  1UFM A;  3LFK A;  1SD4 A;  2Z99 A;  3HSR A;  3PUB A;  2VBW A;  2HVQ A;  2ZJQ F;  3D5R C;  1D1C A;  3WTZ A;  3DCF A;  5FRN A;  1X3Z B;  5E8G A;  1VQK I;  1OR7 A;  2CUF A;  1T08 B;  1QBJ A;  4EJT A;  5FB2 A;  4F55 A;  5DD8 A;  1WI3 A;  2MLG A;  3REO A;  2XSD C;  1ZRF A;  2IT0 A;  2BY0 A;  5J40 A;  3CO7 C;  3BTL A;  1WH5 A;  1APL C;  4W1U A;  5DDG A;  2L5Q A;  3ZQI A;  5B66 C;  1FX7 A;  3LSK A;  4XOP A;  3LST A;  1Y0U A;  4DZP A;  1AKH B;  2HR3 A;  4R8H A;  2HDC A;  3CQZ J;  4IKF A;  3MZH A;  3TQN A;  4BBS J;  3DV8 A;  3TGN A;  4U87 A;  1PVE A;  1CF7 B;  1Z21 A;  2KKO A;  1BI2 A;  4DJA A;  3KEO A;  3F21 A;  2XGD A;  2ID6 A;  3DBL B;  1TQM A;  3LA7 A;  1KYW A;  2UV1 A;  1WZ2 A;  5J47 A;  4Y3O A;  1XD7 A;  3P7N A;  1LFB A;  4CO8 A;  1MSF C;  1MMG A;  2F5V A;  1X4O A;  2X6O A;  2BE5 F;  4XLH A;  2WY8 Q;  1HST A;  2FBH A;  1HBX G;  1XMA A;  3CJR B;  1B9N A;  5FKM A;  2JWT A;  2LNB A;  1FSE A;  2R7O A;  4EM0 B;  2ZFU A;  1NH3 A;  4ZC3 A;  2C6Y A;  2EK5 A;  5LGN A;  5FFX A;  2IRF G;  1DPU A;  5F0F A;  3HRS A;  1OR7 C;  5DM7 F;  3PO2 J;  3H3V K;  2ESH A;  2A6E F;  3QPT A;  3BT9 A;  2QBY B;  1DP3 A;  3QPS A;  1WCM J;  5CQG A;  3JSP A;  1DP7 P;  2QM3 A;  1ODD A;  2K9M A;  2XKP A;  3WOD F;  3E6C C;  2H6B A;  2P81 A;  2K02 A;  3ABT A;  2A3S A;  2BY3 A;  3CZ6 A;  5AON A;  4L9J A;  3KP7 A;  2EFQ A;  5HS8 A;  1JJ8 C;  3G4S I;  1T56 A;  2LF8 A;  4WK8 F;  1ITY A;  1UG0 A;  2DFE A;  1XMK A;  2HKO A;  1YJW I;  4A3K J;  4CUG A;  2ELJ A;  1U8B A;  1G3S A;  5TGT A;  4BYY A;  2VJI A;  4HRI A;  3JRH A;  2EZH A;  4A3G J;  3EDP A;  3KE2 A;  4CCN A;  1MDM B;  5BPD A;  4BXF A;  2B9S A;  2TCT A;  5D5U B;  5IY5 H;  3F8C A;  5CVR A;  1T8I A;  1YX3 A;  5HLT A;  5TJJ A;  4XLN F;  5IP9 J;  3RPU D;  2XF6 A;  3D1N I;  1LB2 A;  1ZR4 A;  4X6A J;  3H5N A;  4XN0 A;  3CUO A;  4ZDP A;  2DT5 A;  2DA5 A;  4PJM A;  3PFI A;  3J7A O;  1J7K A;  2ZNZ A;  1BM9 A;  2ZME A;  3C2G A;  2DA6 A;  2WY7 Q;  1GHC A;  4DW6 A;  1H9T A;  4UVA A;  2Q2E B;  5LEK A;  2XAH A;  5M3M J;  3S2H J;  2KZG A;  2L3D A;  2DMQ A;  2FE3 A;  2A6H F;  5ILS A;  5E8I A;  3GTJ J;  1ON1 A;  4KIF A;  1XSV A;  1Q1H A;  1WJA A;  2YPR A;  1OCZ H;  5GTI C;  1Z91 A;  3LSM A;  4DYC A;  2WBM A;  3PIP F;  4HNU A;  3OYG A;  2MGQ A;  4EGY A;  3ZQG A;  3CME I;  4A3D J;  2D1V A;  2HQA A;  4AUX A;  1P4A A;  4OU0 A;  1WQ2 A;  3TW6 A;  4JQF A;  4B3X A;  1T39 A;  2RNJ A;  4BXX J;  1U78 A;  3IP4 B;  4XLE A;  1ZAO A;  2H8W A;  2GM4 A;  4MNU A;  1Y6I A;  1QNT A;  1ZRD A;  4KA4 A;  3CDL A;  3IL2 A;  1HW2 A;  4JOM A;  4IL6 C;  3WU0 A;  4D9J A;  2XUB A;  2HPM A;  5EG0 A;  3RI4 A;  1YRN A;  3HGY A;  3VWB A;  4F7Z A;  1SAU A;  4OMY A;  4WWC A;  1DQU A;  1K4S A;  2BHZ A;  1ZYR F;  1ZG3 A;  2PJP A;  3S17 J;  3GLL A;  2DT6 A;  4N4N B;  5HLH A;  3W6V A;  1MH3 A;  3OYA A;  4EJV A;  5LBQ A;  4PK4 A;  2EFW A;  1BW5 A;  2VPL A;  4I01 A;  2ZXI A;  3DEU A;  1PUF A;  1D8J A;  4LG3 A;  3R60 A;  1YQA A;  4BHC A;  1ETQ A;  4EGZ A;  3ABM H;  3KP2 A;  1ZEL A;  2DK8 A;  4E7L A;  1V4R A;  3ISP A;  3RYR A;  5EGO A;  1YW7 A;  5IP7 J;  1PYV A;  2E7W A;  2ZNY A;  3G73 A;  2V26 A;  1NG6 A;  4HOB A;  2ISY A;  5GPC A;  2FUG 2;  2VBX A;  3CCY A;  1UG2 A;  3OR2 C;  1WFX A;  4FE7 A;  1MZB A;  2VKD A;  2IS2 A;  4RB0 A;  2M0C A;  2E71 A;  4DZJ A;  3IKV A;  5JHF A;  2UZK A;  2JSP A;  1N77 A;  3K6G A;  3ONQ A;  5B1B H;  4KN4 X;  4M9Z A;  3ZMT A;  4ESJ A;  2IGO A;  3I5U A;  2X6W A;  2VLA A;  3IH4 A;  2O8X A;  1YW9 A;  2XAF A;  2LK2 A;  1FBU A;  3SEZ A;  3MWM A;  4HDU A;  3VEP A;  1XMX A;  1TC3 C;  1IN8 A;  1I50 J;  2M4G A;  2ZKZ A;  2EFN A;  2B0L A;  2BBY A;  3NAU A;  4ZH4 F;  4L5I A;  3D5S C;  4CCO A;  1K78 B;  4NC7 A;  2LG4 A;  2NYX A;  2OD5 A;  5CVI A;  2ZSI B;  2DT7 B;  2WAD A;  5DYM A;  1HKS A;  4E6K G;  4LB6 B;  1Y39 A;  1IRX A;  3GME A;  2MC4 A;  3I56 I;  4XSX F;  3P9K A;  3OSF A;  1YIJ I;  3VDX A;  3OIP A;  2QQA A;  2W25 A;  2QSH X;  3BWG A;  2F48 A;  3C2B A;  2DMT A;  4Y4R A;  4JK1 X;  1FT9 A;  2VOD A;  3K2Z A;  4N9H A;  3ERE D;  1FOX A;  2CWE A;  2FJ1 A;  4RLQ A;  3C2H A;  3ZMV A;  1YFH A;  2BV6 A;  2STT A;  3COA C;  3M4O J;  3OYL A;  2R5Z A;  4FET A;  1YLF A;  3KZI C;  1TQP A;  4BQN A;  5D5X B;  1MNE A;  4CDG A;  3H35 A;  2HTS A;  1W36 D;  4U0V A;  2DI3 A;  3H9J A;  4MGR A;  3FHZ A;  2GIZ A;  4MTD A;  5FJ8 J;  2XAS A;  4DOZ A;  2A68 F;  1SVM A;  4YFN F;  2CV0 A;  3DKW A;  5D4R A;  5JI6 A;  2RN7 A;  2VUM J;  3T8T A;  3D0S A;  4ZYA A;  3CDH A;  2IJL A;  2RNG A;  5HVQ C;  3PUF A;  2KIS A;  3CCJ I;  2Y9Z A;  2JTV A;  2DTR A;  4Y17 A;  1X1D A;  5DUI A;  2K86 A;  2LKX A;  2BZT A;  4ANJ A;  3A4C A;  1L3L A;  4CCL A;  5ILU A;  2DA2 A;  1IDY A;  2P0W A;  3HGG A;  2XVC A;  3QU6 A;  4PSW A;  4QSH A;  2HDW A;  5IYC J;  1ONV A;  2XF5 A;  4M6Y A;  5HDK A;  1FJL A;  1PUE E;  4UVB A;  3MN2 A;  1QHH D;  5CPR B;  3OYD A;  3K10 A;  2XRL A;  4ITV A;  4F3Q A;  2F4I A;  1GDT A;  4OOI A;  3SEQ A;  3V7C A;  4WX9 A;  3GYH X;  1HW5 A;  4XKB A;  3BG9 A;  1Q1V A;  2EBI A;  3MZY A;  4L9N A;  2WV0 A;  3I64 A;  3P9I A;  2CU7 A;  5FO5 A;  2RKH A;  2L4M A;  3BZC A;  4M71 A;  1RR8 C;  1ETK A;  3ZMZ A;  3QP5 A;  4RB2 C;  2YU9 J;  1HA8 A;  2KIM A;  1AWC A;  3E1S A;  1E2X A;  3OYH A;  5KVR A;  3C7J A;  5FLM J;  2KHM A;  4L18 B;  2JQ7 A;  3KP3 A;  4IHS A;  3DP7 A;  2DK5 A;  2HOS A;  3DFG A;  1TP4 A;  4G8X A;  4QTR A;  3IH2 A;  3K4J A;  5J3L A;  2M87 A;  3H9G A;  3AKZ A;  2KJC A;  4OIQ F;  2BW3 A;  3UNG C;  2LFB A;  4XOT A;  2R7V A;  2LMD A;  1I3Q J;  1U2W A;  1VND A;  3BR2 A;  1BN5 A;  5HS7 A;  4F91 B;  2A69 F;  1SFO J;  3GTQ J;  2OZU A;  5DEQ A;  3CMA I;  4HLY A;  3WE3 A;  4G7O F;  3ZQC A;  2MLK A;  2VL8 A;  3S3O A;  3U1K A;  2OQR A;  1ZGA A;  4M9X A;  3HOX J;  3OOU A;  5J6X A;  5E17 F;  2PMZ A;  1W5S A;  4BY7 J;  5L3E A;  2LVS A;  2DN0 A;  3E0J B;  2HWV A;  3VYU B;  3J7A Y;  2H94 A;  3DWL E;  4KMF A;  5AIQ A;  1F9N A;  2NAZ A;  4LLG F;  1VQL I;  1Z9C A;  3U21 A;  4H0E A;  3HOY J;  2R7Z J;  4BHP A;  1Z77 A;  3L7W A;  4UNO A;  4R1H A;  2K85 A;  3S1R J;  2VI6 A;  4YIR X;  4E7J A;  2Y30 A;  5ED4 A;  5C3E J;  1WJF A;  3CUQ A;  2IPQ X;  3FXR A;  3HTS B;  3TP0 A;  2L9V A;  3KIO A;  2GBY A;  3TBI A;  3SDG A;  3I9V 2;  2Z33 A;  3CCV I;  4KFC A;  1JUM A;  2AQE A;  1DGR M;  1Y8R B;  4UUS A;  5TRD A;  4RAZ A;  5J1Y A;  2DA4 A;  4D5C A;  2Y31 A;  3SDB A;  2CQN A;  3I0T A;  2KL4 A;  1FOK A;  1BI0 A;  2MA3 A;  1OLT A;  4MQ9 F;  1XB4 A;  2FXA A;  1VQP I;  2CQX A;  4I02 A;  1MMS A;  4S04 A;  4BDY A;  4P96 A;  4CZZ A;  5IT3 A;  4XOR A;  2X1E A;  1FNN A;  3GX4 X;  1DGW Y;  2O0Y A;  2EH3 A;  1WJD A;  4E7I A;  3PO3 J;  4RAY A;  4PGH A;  3EYY A;  2HZD A;  2V9P A;  1KQ8 A;  3IV5 A;  2L9R A;  3HTU A;  1ULY A;  2VE9 A;  4BH9 A;  3G1O A;  2LH9 A;  1NK2 P;  2HKX A;  2VT2 A;  3T0Y A;  3VOE A;  3CDI A;  3I3L A;  2H1L A;  1XTA A;  3GO5 A;  2IGM A;  4CCK A;  4I98 B;  1ENH A;  1GXP A;  3ECO A;  2R4G A;  4ZZD A;  4EQQ A;  2QSF X;  1IG7 A;  1JKP C;  3J7Y J;  1ZR2 A;  1QGP A;  1W7P B;  1LDD A;  2IS6 A;  4IPA A;  3BP8 A;  4S0H B;  2DDB A;  4IO9 F;  1Z67 A;  4PCQ A;  3ZCO A;  3PNY A;  2WA0 A;  3O3K A;  2M0M A;  4BNC A;  1X1P A;  1U6G A;  2R7Q A;  3ABU A;  3HYI A;  3E6B A;  1HC8 A;  2L9N A;  2DQR A;  1R6R A;  2CYY A;  5J1R A;  1QU3 A;  1SFK A;  1XCB A;  5L3C A;  4M6X A;  2XIG A;  3CCE I;  4A2U A;  5FKO A;  3J80 Z;  2DOD A;  3R4K A;  5C4J J;  2H1K A;  4M6V A;  4A3M J;  1FBS A;  2LKS A;  2K7L A;  1HLV A;  4IHV A;  3KPH A;  2VJ4 A;  3T5X A;  3G2B A;  5JVT A;  2H09 A;  2XGX A;  2H8R A;  4LG0 B;  1HDD C;  2VKH A;  2XC7 A;  3K7A J;  4Z6Y A;  2M3A A;  1R36 A;  2H6C A;  3IWZ A;  3SQN A;  2OQG A;  1EV7 A;  2W48 A;  4DBQ A;  3V8L A;  4WCG A;  3QWL A;  1FP1 D;  3JRG A;  3CTA A;  2EA4 A;  3M1E A;  3MAJ A;  2AS5 F;  2F2E A;  3FXO A;  4S05 A;  2L7K A;  1N25 A;  2JA2 A;  2LSO A;  4HW0 A;  1LVK A;  2J5O A;  4DQ2 A;  1FZP B;  3F23 A;  1R4M B;  2M2E A;  4I2O A;  3A01 B;  3Q0W A;  3BJO A;  4J00 A;  1QQI A;  4IXA A;  2BEO A;  3P5J A;  2ZXJ A;  1LE8 A;  3ZN1 A;  3RQI A;  2HPI A;  4XLF A;  3PIO F;  3L2R A;  1IDZ A;  4RAG A;  4HV5 A;  3X2Q H;  1MSE C;  3ZQL A;  2EV6 A;  1U3E M;  3A0B C;  5K7H A;  4YFX F;  1Y0N A;  4UHT A;  3FIS A;  1SFU A;  1AKH A;  4LJZ F;  5ICC A;  2CO5 A;  3KZZ A;  3BR6 A;  4D7N A;  3F8F A;  5J4Y A;  3FMS A;  2EJR A;  3RPQ A;  1CF7 A;  2NVY J;  3B6C A;  4BUP A;  2K9L A;  2TDX A;  4V2F A;  1A5J A;  1V5E A;  4B09 A;  3K4N A;  1UHM A;  1KQ9 A;  5HNH A;  3QRF F;  2O7O A;  3HRT A;  2BXY A;  2L0K A;  2K9N A;  2L7Z A;  2QWW A;  1FYL A;  2GLO A;  1TNT A;  1RI7 A;  2WTE A;  4H4K C;  3MKZ A;  1JKO C;  4MEY F;  4U7B A;  4U0Y A;  4PJL A;  3ZQQ A;  2NVU B;  3ZXS A;  3TL4 X;  4BQA A;  3GFM A;  3GZ5 A;  2R5Y B;  2EV5 A;  2QGU A;  1YIO A;  2MYS A;  2XV4 S;  2WWY A;  2E36 A;  3K4K A;  3B6A A;  2ACJ A;  1LFU P;  2E19 A;  2UXN A;  4IHY A;  3OYJ A;  5HDN A;  1HF0 A;  2QBY A;  2X48 A;  3VYS B;  4ZYD A;  3S93 A;  2M45 A;  4KIT B;  2QUF A;  4YRV A;  1V55 H;  3CCM I;  2L7F P;  1T98 A;  1R1T A;  4P1W A;  2EWN A;  5EJC A;  4LOC A;  2MW8 A;  5D6F A;  3WTY C;  3G1L A;  2UXX A;  3CF2 A;  1XC5 A;  4FQG A;  1P2F A;  4AM3 A;  2FNA A;  4MTE A;  3CES A;  2QCO A;  2Z2S B;  3KEY A;  2IS1 A;  1R00 A;  2CH0 A;  3Q3S A;  3FXU A;  3FF5 A;  2L4A A;  2K9S A;  3GBG A;  3K1M A;  2R0Q C;  3KYL A;  2V1X A;  1MJ9 A;  3I71 A;  3OYF A;  1QZE A;  4G6Q A;  2Y48 A;  2VJJ A;  2ZJR F;  1Y56 A;  1D0X A;  2F5D A;  2GXA A;  3FXK A;  3HJE A;  1MNM C;  2FEZ A;  4EM2 A;  1K61 A;  2ZBK A;  2RDP A;  1FTT A;  1MDM A;  4LGW A;  2PFB A;  3DTE A;  1B4A A;  5LHH A;  3FIW A;  3H3Z A;  3EET A;  1HKT A;  3E5Q A;  5DM6 F;  1I6X A;  5FKN A;  1EH8 A;  3KP4 A;  1SC7 A;  3E6D A;  1S29 A;  5CKT A;  1XGO A;  2X0L A;  4XMY A;  4O3M A;  4KYW A;  4AIK A;  2Q2E A;  2AQF A;  4ENK A;  3JTG A;  1FLI A;  1MBJ A;  2VJ5 A;  5HNF A;  2DJI A;  2NVT J;  1T38 A;  4G6T B;  4OIP F;  2X6X A;  3GFJ A;  1CQT A;  3MKW B;  3QU3 A;  2EV0 A;  4RBO A;  5L3G A;  1BBY A;  4JBA A;  3GCM A;  3A03 A;  5E3L A;  3MKY B;  2E2H J;  2CQK A;  4BQO A;  1U5T C;  2QEN A;  2JPB A;  3KYD B;  4BDZ A;  1P7J A;  3OS0 A;  3JRC A;  4M3B A;  5C44 J;  2G0E A;  3BTI A;  1XSD A;  2HXI A;  1R71 A;  2LTP A;  3HOZ J;  3CP2 A;  1Z7U A;  2P6S A;  2XDV A;  4BGD A;  1WJB A;  4V2G A;  3W2A A;  1RKT A;  2FX0 A;  3VPR A;  4HNT A;  4CGZ A;  1EH7 A;  1ETO A;  1RR7 A;  3KLO A;  1XDS A;  2MH2 A;  2HYF A;  2G7H A;  1W36 C;  2NNN A;  5K1Y A;  4XKW A;  3F6O A;  4UY8 I;  1MJB A;  3KLN A;  5H6Q A;  2DMU A;  3ZGK A;  2JSC A;  4L5E A;  4LMY A;  4M3G A;  5D5V B;  3MMY B;  3LA2 A;  4KIG A;  2XAU A;  4RM2 A;  4XK4 A;  4GYG A;  3J80 K;  2W4S A;  3LQR A;  3O8H A;  2QKM B;  5E1Z B;  3SJM A;  4JP0 A;  4II2 A;  4QPO A;  2ZB9 A;  1O3S A;  1Z6T A;  1BJZ A;  3HPG A;  1JT0 A;  4CYC B;  3K9T A;  5IPA A;  2BY2 A;  4NHJ A;  2BY1 A;  3AG4 H;  3EUH A;  4XID A;  1DU6 A;  2JUG A;  1U0J A;  3BLY A;  4EJO A;  2L54 A;  2LRE A;  4B1R A;  4AWX B;  3KZY A;  1D3Y A;  2ZXH A;  1TZL A;  4B43 A;  5BS6 A;  1KU2 A;  3GTK J;  3BG3 A;  1EA3 A;  4LK1 F;  1WRJ A;  5BNG A;  3RCO A;  1WGX A;  1PP7 U;  2KLO A;  1T33 A;  4FTH A;  3BY6 A;  1HQC A;  1I1G A;  3LFU A;  3MKL A;  2DA7 A;  1FIA A;  2E5N A;  4PJ0 C;  4RM3 A;  4EVI A;  1D1A A;  2MD5 A;  1XGS A;  4A0Z A;  3HOW J;  2NS0 A;  3FXJ A;  4ESF A;  2VXD A;  2L02 A;  3LSI A;  4UV9 A;  4BE1 A;  1RRJ A;  3O6B B;  5M5W J;  1IZ1 A;  1TBX A;  5AIP A;  3VOD A;  3WHB A;  1R23 A;  3AAF A;  2E5Z A;  2Z5U A;  4II3 A;  5F1R A;  3CJN A;  3HXL A;  5D4S A;  1FBQ A;  4C3J J;  2OF7 A;  1YTY A;  5KNL A;  5JLX A;  1JGS A;  1L0O C;  1MKM A;  1T95 A;  2P6T A;  5F64 A;  1K78 A;  1V5G A;  1BIB A;  2WB1 A;  2E60 A;  2I8D A;  1P9Q C;  3TKY A;  3GWZ A;  2JRT A;  1TLH B;  1FWZ A;  2KDO A;  3EUH C;  3RTR A;  1QPI A;  3H1C A;  4LD5 A;  1TT5 B;  2IA2 A;  1W0U A;  3Q9S A;  2K5C A;  2LYC A;  3M3Y J;  3KET A;  5B1A H;  2ZCW A;  1VZ0 A;  2M7A A;  3Q9V A;  4CSW A;  3BCA A;  3BR0 A;  2YU3 A;  2GOX B;  2PMU A;  3I54 A;  1QPM A;  2GOM A;  3B02 A;  2MC3 A;  2DU9 A;  3C3W A;  4JX6 A;  2A5Y B;  3F8N A;  3K69 A;  3V7S A;  3W6J B;  1TWG J;  1W4M A;  1YG2 A;  4I7H A;  4IHT A;  1MMD A;  1X4P A;  2BOL A;  5J8F A;  3GVA A;  5IT9 Z;  1S8N A;  2ELH A;  2CG4 A;  5H6R A;  3S32 A;  3K4B A;  2ZME C;  1B1B A;  4IJA A;  2CSO A;  1A36 A;  4AC0 A;  3CLO A;  3OS2 A;  2OTJ I;  2MBF A;  3MVP A;  3WG7 H;  3CP8 A;  1YYV A;  4F93 B;  3VB2 A;  3NRV A;  4DBR A;  1UEL B;  4BXU A;  3IRR A;  1NK3 P;  2R92 J;  3GFL A;  5M5X J;  2ECC A;  3DBR B;  1UHW A;  4RLF A;  3V42 A;  1XN7 A;  2M30 A;  1GVD A;  2QVO A;  1MJA A;  3S3N A;  2E1N A;  5FFZ A;  2O6G E;  4LB5 A;  4AD9 A;  5LRS A;  1W0T A;  5IOY A;  5HS9 A;  5FKK A;  2W7N A;  3JTH A;  4MHG A;  3CCU I;  3GTO J;  2PX9 A;  1Y1W J;  2QLZ A;  4ETS A;  1O3R A;  4MLO A;  5GPA A;  2QA4 I;  2EIL H;  3AG3 H;  4CYD A;  1Y1V J;  3V8J A;  4R79 A;  1R9T J;  1YHQ I;  3DEE A;  3H36 A;  2WB1 N;  2DOA A;  2E35 A;  5D6E A;  2ZJP F;  1GVJ A;  4LIV A;  3SZG A;  3FM3 A;  2TRT A;  3F22 A;  2CV1 A;  2KMU A;  1YJN I;  3WTW C;  2V9K A;  5EEA A;  2RAE A;  3CCL I;  2VE8 A;  3N97 A;  2XKO A;  3GTP J;  1FOW A;  9ANT A;  1TWH J;  2BVM A;  2XAG A;  3PJR A;  3KFW X;  1AOY A;  1R5H A;  3R61 A;  1XDU A;  1QO0 D;  3I4P A;  4I99 C;  2E7X A;  2HOT A;  1W5T A;  3ZP5 A;  5EYR A;  1ETW A;  4ZYG A;  4CCJ A;  4GO1 A;  5E3O A;  4IZZ A;  5BPI A;  2GXB A;  3BZK A;  2NNY A;  3ECH A;  1YS6 A;  4FT8 A;  1ZGW A;  1PJR A;  2RV8 A;  3SZT A;  2CUZ A;  2EZI A;  2JA5 J;  2MSY A;  4CH7 A;  4ZJZ A;  5K5Q A;  2RRE A;  1H89 C;  1ACI A;  2HU9 A;  1EH6 A;  3DU6 A;  4RGR A;  4IRI A;  1B59 A;  4YG2 F;  5F27 A;  2CV2 A;  3HC7 A;  4CCM A;  4UXN A;  1I5Z A;  2KQR A;  4KMU X;  2NXN B;  3J7Z I;  2OBP A;  1ZLJ A;  4HLX A;  3L2V A;  2O03 A;  3GTM J;  4ZYH A;  2LC2 A;  2M8G X;  4HA8 A;  1FOY A;  2L9S A;  4BL0 B;  3HSE A;  1BR2 A;  3S3M A;  3LSJ A;  2J5P A;  1XGM A;  2N8G A;  4K2E A;  2DCE A;  4WXH A;  2STW A;  1I1S A;  2DMN A;  2R7X A;  1S5L C;  4XRS G;  1B72 B;  4GDF A;  2W82 A;  3HBL A;  2OTL I;  3OY9 A;  1K6Y A;  3RKW A;  3I59 B;  3E5X A;  4XL9 A;  4RB3 C;  1B8I B;  1MBF A;  4RGU A;  5K7F A;  3BPV A;  3FM5 A;  3QYB A;  2ZXW H;  5EZG A;  2JA6 J;  2ICW G;  5H20 A;  4LIT A;  4ABZ A;  1FC3 A;  3H5A A;  4XSZ F;  5D8L B;  1YRN B;  3ASO H;  3TP3 A;  1IXS B;  2Q8K A;  1S3J A;  4GFB A;  2FML A;  4IX7 A;  3SYT A;  1D5V A;  4L9T A;  2PQ8 A;  2KP6 A;  2ZO4 A;  4M74 A;  3QPL A;  5CYV A;  2CUE A;  4BHB A;  2K40 A;  4CA0 A;  2E1O A;  2X4H A;  2O5R A;  2JA7 J;  2DYS H;  4A3I J;  2LDU A;  4C3I J;  4NUB A;  3ZRG A;  1IGN A;  3DPT A;  3BG5 A;  1HW1 A;  1SVO A;  4YII A;  5E1X A;  1GT0 C;  2A5W A;  5DUK A;  1OYI A;  2JMW A;  4BE2 A;  3WGH A;  2BHY A;  4A5N A;  2GXG A;  2KJB A;  3AG2 H;  4O6J A;  1ERD A;  1QZY A;  4OIN F;  1W7P A;  4P9F A;  1OMI A;  1J75 A;  3DKX A;  3PNV A;  3RKX A;  3DBH B;  2VAS A;  1AA7 A;  4EJW A;  5ICE A;  4I0A A;  4AYB A;  4NB5 A;  2HFH A;  2OZ6 A;  1IRF A;  4B3A A;  3JR9 A;  3IWF A;  2RVC A;  3W3C A;  2JZY A;  2V1D A;  3LNQ A;  1IV6 A;  1K7A A;  1LEA A;  2XRN A;  3BQY A;  3CJT B;  1R22 A;  2K27 A;  4BAC A;  3PSI A;  1RUO A;  4UVC A;  2R7U A;  2LY2 A;  4LG0 A;  2ID3 A;  1Z1D A;  1KA8 A;  2D2W A;  4A6E A;  3F9K A;  4OAZ A;  3G6E I;  1A31 A;  1RNL A;  2AXT C;  5KHD A;  5IT9 K;  2JVG A;  3O2P E;  1UJ8 A;  3M9A A;  3W6K B;  3QOP A;  1VQO I;  5E3N A;  2X6Y A;  3TDU C;  4B48 A;  4E7Z A;  4BEH B;  4RB1 A;  2OAZ A;  5J1U A;  1Z05 A;  4HAM A;  3L00 A;  3DEW A;  3KP5 A;  5J4V A;  2L01 A;  5J8C A;  4IQJ A;  2JN6 A;  2NOG A;  3GZ6 A;  2QSG X;  3S2D J;  1OQY A;  3KP6 A;  3J81 Z;  3OYN A;  4BE0 A;  3RYP A;  5CVU A;  1RET A;  4I0B A;  3HDD A;  1NHA A;  4X0G A;  3F3X A;  4ESB A;  3IH3 A;  4PUS A;  1S7O A;  3OSG A;  3C1D A;  3RKQ A;  1K79 A;  2VQL A;  2V9V A;  2GAU A;  4KJZ A;  2Q1Z B;  4IHX A;  2X1C A;  3QQA A;  1ZAR A;  3ABK H;  2DTZ A;  1BR4 A;  1SMT A;  1KON A;  1U8R A;  4P55 A;  3CCQ I;  2FMY A;  4J19 A;  1U9O A;  3W2V A;  2EZL A;  1ETV A;  4CIC A;  1J59 A;  3TOA A;  1UCR A;  3LQQ A;  5E1W A;  2ZJ2 A;  3D5L A;  1BL0 A;  3A02 A;  1P7I A;  1U9N A;  4UV8 A;  3S15 J;  3E3V A;  4BQQ A;  4FCY A;  1Z0X A;  3ABL H;  4IQ4 A;  3H0G J;  4ZDO A;  1QA6 A;  2VC1 A;  1VQN I;  2PJR B;  2EFP A;  5DCF A;  2HNH A;  4Y15 A;  5GAH J;  2DFI A;  3HOT A;  1ZRE A;  2W1O A;  3CUQ C;  1BOB A;  2R5Y A;  1F43 A;  1OYY A;  1AU7 A;  3ZR8 X;  4HNV A;  2PMZ N;  3A0H C;  1P4W A;  2NS8 A;  1O4X A;  4Y33 A;  1P92 A;  3QYE A;  1SD7 A;  2RQP A;  1I3A A;  1SD6 A;  5DTD A;  5FLX Z;  5E79 C;  2QEX I;  2IEK A;  3HPH A;  3M1C A;  3I4M J;  1D0Y A;  1IJW C;  1R5G A;  3LA3 A;  1FYM A;  3CJQ B;  1I39 A;  3FDY A;  2CFO A;  2X51 A;  2WAQ A;  3AL0 C;  3PFY A;  4OWR B;  2GA2 A;  1IRG A;  4NDL A;  2K3P A;  1FMW A;  3HUG B;  4YFK F;  2VBY A;  3ZMS A;  2H27 A;  1TWF J;  5E3M A;  1VQ9 I;  1B9M A;  4IF4 A;  4EM1 A;  4G12 A;  3QOD A;  1BIA A;  4OMZ A;  1IXC A;  1DUX C;  1LFP A;  1WI9 A;  1F1Z A;  1F5T A;  2D45 A;  4IEJ A;  4G9Y A;  2E1C A;  3CO6 C;  1GXQ A;  2A6T A;  5HOO A;  2MD0 A;  5DCM B;  2COB A;  2Y0S A;  3CF5 F;  1HOM A;  1S9H A;  1S7A A;  2EIM H;  2XF7 A;  1H8A C;  3S1M J;  1YS7 A;  2FRH A;  3GLX A;  4F52 A;  2VB6 A;  3HSF A;  1IAW A;  2KRF A;  3I58 A;  2QKL B;  1TNS A;  2R7S A;  2Z1D A;  5KK1 A;  3ZMU A;  2HVR A;  2ECB A;  3OIQ A;  2LP0 A;  2W85 A;  2L7M P;  1YX5 A;  3HKZ A;  2YR2 A;  1ON2 A;  2LBF B;  2E1M C;  1O7L A;  4QPQ A;  1J5Y A;  3Q5F A;  1X2N A;  3GEZ A;  2ESN A;  1YOV B;  3BC8 A;  4XON A;  1MGT A;  2CQQ A;  1F36 A;  1BOA A;  2MG4 A;  2LRD A;  2P8T A;  1STZ A;  1SMY F;  2ZSH B;  2M4K A;  3MQ0 A;  1TT0 A;  4PJJ A;  4ASN A;  4XLC A;  2O3F A;  3CCS I;  1QVT A;  1RC9 A;  1JHF A;  4RS8 A;  5EEH A;  4I76 A;  2VIX A;  2Z16 A;  2IVM A;  4PZJ A;  3RIR A;  1OCR H;  1G59 A;  1MBH A;  1J9I A;  1MD0 A;  4JYK A;  5DD4 A;  1X3W B;  3V7R A;  4C2T A;  3RZD J;  2KPM A;  3DXJ F;  4KT6 A;  1X3U A;  1T2K A;  4HYE A;  4AU7 A;  5LHG A;  3HM5 A;  1ZN2 A;  5E18 F;  3HIF A;  3WU1 B;  3K4L A;  3TO6 A;  5IOZ A;  1A04 A;  2IW5 A;  2F4M B;  2OCC H;  1N75 A;  1RZ4 A;  3R0A A;  1WSU A;  2IA0 A;  3OMY A;  2FSW A;  4FHT A;  4UUT A;  2GWR A;  2L2O A;  4AVZ A;  4IHW A;  5LD2 C;  5L3B A;  4CYC A;  1O57 A;  3TMO A;  2HQR A;  2O8K A;  3G1M A;  4Y13 A;  3OR1 C;  4EAT A;  1QVU A;  3TW7 A;  2XB0 X;  4XQF A;  1SVL A;  3DLA A;  2ME0 A;  5KAI C;  5CLS A;  2LKP A;  3L2Q A;  2PI0 A;  3U1D A;  1IUY A;  1D5Y A;  1B6A A;  3M8F A;  2JVH A;  3ZOB A;  2HYG D;  2CRG A;  3S8P A;  5JVG F;  1G2H A;  2XAJ A;  2PMH A;  2MAB A;  1OCC H;  3K70 D;  2K9Q A;  3I55 I;  4CXF A;  3WG9 A;  4XN3 A;  4ZDL A;  1E0E A;  2KRC A;  2IA1 A;  3L09 A;  3W2W A;  2V1N A;  4KUM A;  3HKZ N;  3JAM Z;  2DLL A;  3J81 K;  3I4N J;  1FTZ A;  3ZQ7 A;  3FZV A;  3JRB A;  1JKQ C;  1NG7 A;  5LGU A;  1LKX A;  3MD2 A;  4IVN A;  2VQG A;  3NWS A;  2GIV A;  3CLQ A;  4YEL A;  3FXM A;  1W7P D;  3OYB A;  3CCR I;  2M5W A;  3DU5 A;  4M3E A;  4B4C A;  4ENM A;  4Q48 A;  3OV8 A;  3E97 A;  3GTL J;  4A0Y A;  4PGG A;  4C2U A;  4J01 A;  4CHU A;  1J09 A;  3M07 A;  4IOC F;  4XKV A;  4C9Y A;  3U9G A;  4RDU A;  3JRA A;  2EB7 A;  1Y8Q B;  2R7W A;  3F72 A;  3K2A A;  1JKR C;  2K4J A;  1BI3 A;  1HDP A;  1ZTR A;  3VSL A;  4GXO A;  1QRY A;  4XRS A;  4BBR J;  2BGC A;  2EIJ H;  3H3U A;  3ESW B;  1LE8 B;  3QP6 A;  4FE4 A;  4LK0 F;  3TO9 A;  2XPU A;  1FY7 A;  3WU2 C;  3BR3 A;  4BAY A;  5DS9 A;  2OPT A;  4Y7N J;  2QQ9 A;  5F0H A;  1FEX A;  4PJN A;  1KQ0 A;  3VFZ A;  3UR3 C;  3V8K A;  3ML6 A;  1Z3X A;  4XLP F;  4BY1 J;  5CVV A;  1R7J A;  1Z6R A;  2M34 A;  1S72 I;  2DFF A;  3DTI A;  3QYF A;  1FYK A;  1XPX A;  4JX5 A;  3NEU A;  3L2W A;  1VI0 A;  2YX7 A;  3GW2 A;  1JJ6 C;  3Q0V A;  1LUJ B;  4Q4Z F;  2ETH A;  2DFH A;  1N78 A;  3LSG A;  4IRH A;  1A6Q A;  1IUF A;  5FLX K;  2ELK A;  1R1U A;  2P7C B;  2GZW A;  3WE2 A;  2DPD A;  2A07 F;  3OWT A;  4IRG A;  2EZK A;  1IN7 A;  5E20 A;  1HSJ A;  3ERM A;  3H5R A;  5FD6 A;  2VBZ A;  4P5O A;  1GLN A;  3FK7 A;  4M9S A;  4XR6 A;  1F4K A;  1GUU A;  1JTY A;  4LLL A;  1VQ8 I;  2HZT A;  1UST A;  2IGN A;  3OS1 A;  4BKX A;  2D5V A;  1E3H A;  1LVA A;  1ZH5 A;  4WXD A;  3U2R A;  4KDP A;  3BR5 A;  3L1P A;  2FQ3 A;  5IP6 A;  2CW0 F;  4NQW B;  1E3P A;  5IYB J;  1I6H J;  1OIS A;  1YW8 A;  2VC0 A;  3PSF A;  4MFE A;  3BG6 A;  4PFP A;  1WJE A;  3FBN B;  5EEG A;  1BC7 C;  3H9Q A;  4LFU A;  3P9C A;  2NVQ J;  4DGW B;  2HDD A;  5CVJ A;  4FIS A;  1LDK B;  2MH9 A;  1IXR C;  1FIP A;  2VQC A;  1U5T B;  3BG7 A;  2P5L C;  2CW8 A;  1ZHF A;  2EQR A;  2XGC A;  4YEJ A;  1DPR A;  4M73 A;  1KYZ A;  2ZC2 A;  1KGS A;  1KU9 A;  3T8R A;  1GV2 A;  1ZLK A;  1YE9 A;  5K5R A;  2YX4 A;  2P7V B;  3FXL A;  4GRI A;  2W57 A;  4DNC A;  3FMR A;  3S16 J;  2QQ8 A;  4PDK A;  3JRF A;  4BJT A;  2FNP A;  2Y69 H;  4A3C J;  1EJ9 A;  2YUS A;  1R5I D;  3MFK A;  2RC4 A;  1O3Q A;  3M8E A;  1IO2 A;  1KZH A;  5FRM A;  2M8E A;  1MMA A;  4W97 A;  2LY9 A;  4A3E J;  3WTU C;  1ORK A;  2IXS A;  4HST A;  2JJ7 A;  2K3F A;  2F5E A;  4GCV A;  4HV6 A;  5EDN A;  3LSP A;  1O3T A;  3F8B A;  4HBL A;  1G4D A;  5FLV A;  1QHG A;  4X1E A;  5HDG A;  2RGV A;  4ZTF A;  3GTG J;  2XPV A;  3R6S A;  1SFE A;  2K4B A;  2OU2 A;  2Z9O A;  2BXZ A;  4L0Y B;  2IP2 A;  1WJ5 A;  2OC6 A;  1USS A;  4QIW N;  4AVP A;  3JRD A;  2O9L A;  4WXC A;  4A3L J;  1MBG A;  2XB5 A;  3F8M A;  4RGX A;  3HZJ A;  1WVR A;  3FWE A;  3OOP A;  3S2W A;  2B63 J;  3CMM A;  2DJN A;  2PBI A;  3OYM A;  1B72 A;  2HQN A;  1FSH A;  2XHK A;  3I59 A;  3MZ8 A;  4G94 A;  4A69 C;  5F04 A;  1B8I A;  4GYI A;  1XGN A;  1TW2 A;  2VPR A;  2OA4 A;  2XGE A;  4P9U A;  2AHQ A;  3HOS A;  2KZV A;  3MEX A;  5GAE J;  2IS4 A;  4U7D A;  1LJ9 A;  4OAY A;  2O61 A;  2W00 A;  3PL8 A;  3EYI A;  5F0C A;  2B7E A;  1LNW A;  1ZK8 A;  3WGI A;  3HOU J;  2OJE D;  3FHN A;  4E7K A;  1W5C C;  3LSH A;  5KCM A;  2WV1 A;  1D8K A;  3FX3 A;  4C2M J;  3JAM K;  1BC8 C;  1VTN C;  1DU0 A;  1A35 A;  2V6C A;  1SEU A;  4NNJ A;  5GAD J;  3I53 A;  3CMY A;  5KAF C;  1TW3 A;  3Q0U A;  2ME6 A;  4HQE A;  1HKQ A;  1JTX A;  4GGG A;  4BS9 A;  3QOE A;  3SZP A;  2DAO A;  3GFI A;  2DYR H;  1ZG1 A;  2V79 A;  3H92 A;  2DPU A;  1A6I A;  2CQ7 A;  3ZN0 A;  1CGP A;  1K83 J;  2X9D A;  1LDJ A;  5K5O A;  4CZC A;  2NVX J;  2F5F A;  4UB6 C;  2BYV E;  4M3F A;  2XSJ C;  3FMQ A;  3JW4 A;  1TL8 A;  2DXI A;  5GP9 A;  1V54 H;  4NC8 A;  1M1E B;  4MQV A;  2KFD A;  3FXQ A;  4QWQ A;  1E17 A;  3FKJ A;  4ZYE A;  3DQV C;  2IGK A;  3EUA A;  5F1J A;  2QYO A;  1UMQ A;  2HXO A;  2P5V A;  4O5V A;  1EKE A;  1MH4 A;  2AO9 A;  1J2X A;  3BJ6 A;  5HLI A;  1VQ4 I;  4D1Q A;  4XIC A;  2ZME B;  4TV7 A;  2E2J J;  3BQZ A;  2G7U A;  4BJ6 C;  5LRR A;  3KEQ A;  3SFZ A;  4XBF A;  2CUJ A;  3RZO J;  3IUO A;  1SAX A;  4DYR A;  3RJP A;  5M3F J;  3K0L A;  5DV5 A;  3ZQH A;  4HQM A;  2R7D A;  5D5W B;  4AIH A;  3IC7 A;  2BVL A;  3PQK A;  1MIJ A;  5FKL A;  5JLW A;  3DLL F;  3QPH A;  1IW7 F;  2FBK A;  1TWC J;  3PNT A;  2XRO A;  2KDZ A;  2VKE A;  2R7T A;  1ETX A;  4ZZL A;  1BR1 A;  3LSR A;  1R49 A;  5B5E C;  2FD5 A;  3C18 A;  3KYC B;  5H2F C;  4AID A;  5A2Q Z;  3G3Z A;  4BEH A;  2DDA A;  1V3F A;  3DPL C;  3IHU A;  2E2I J;  4DYQ A;  3AG1 H;  1TTY A;  3TO7 A;  4HX8 A;  4N4O B;  4HEA 2;  2PLY A;  1MBE A;  2D1H A;  1T0F A;  2KT0 A;  1X2M A;  4KIC A;  4HF0 A;  2DO7 A;  5LHI A;  1IC8 A;  1LQ1 A;  1OCP A;  4G6D A;  2W24 A;  1R58 A;  4KIB A;  2JT1 A;  4ON0 A;  1FPQ A;  2UWM A;  3TED A;  3WTT C;  5EG0 B;  1JE8 A;  1H88 C;  1OFC X;  1RKW A;  3BZ6 A;  1UB9 A;  3WTX C;  2VON A;  3ELK A;  1TWA J;  2VXZ A;  3VYT B;  5ERI A;  3LL7 A;  3EQL F;  3NAR A;  3BOQ A;  4A3J J;  5F6F A;  3K1P A;  1VQ5 I;  4YIF A;  4A12 A;  3R0J A;  3E7L A;  1BA5 A;  4XM3 A;  2M7B A;  4EV0 A;  1PUF B;  4C3H J;  4IOA F;  2DOE A;  1YJ9 I;  1JGG A;  4A3F J;  3OL4 A;  1BI1 A;  2PJR A;  4U0W A;  5EGO B;  2JUC A;  4HDV A;  1ZKG A;  4UB8 C;  2HYJ A;  1VF9 A;  2DA3 A;  3ZQF A;  3SXY A;  5LEJ A;  1OCO H;  2GQQ A;  3WTV C;  1V5F A;  4Q47 A;  1T0F C;  2VQH A;  1C0W A;  5L3F A;  1J0R A;  1D1B A;  3FBI B;  1HXD A;  2Q0O A;  1NTC A;  1X1C A;  3ULQ B;  1XCV A;  3PM1 A;  4ENN A;  3SFI A;  1X19 A;  1K6O A;  3IAM 2;  3E5U A;  1UHS A;  1BW6 A;  1MW7 A;  3O8G A;  4XRF A;  3B73 A;  2OCE A;  2HGC A;  2EPF A;  1P6R A;  3WHC A;  3JRE A;  1IN5 A;  4QLC U;  1OYW A;  1AHD P;  4G7H F;  5LGT A;  3G71 I;  4FAS D;  1LPQ A;  3E6M A;  3S1Q J;  2KRH A;  4A5M A;  3HUG A;  3K70 C;  3MCZ A;  2P5K A;  2DOF A;  3OYK A;  1JT6 A;  2Y75 A;  1R1V A;  1I27 A;  1OKR A;  4D5F A;  4XKC A;  1MMN A;  3VSK A;  2Y2Z A;  3KCC A;  3IRQ A;  4F92 B;  3F6V A;  4Z2Y A;  2PN6 A;  5GTH C;  3F0C A;  3V4G A;  2V1U A;  3A2K A;  2JK3 A;  1OJL A;  3AFH A;  4Y52 J;  1S6L A;  1TQI A;  5DCM A;  3CC2 I;  3K4M A;  2QF7 A;  3A01 A;  4Q5S F;  2FBI A;  1S7E A;  1UZC A;  3TDZ C;  5EF6 A;  5IYD J;  5JFR A;  4ENJ A;  5BMZ A;  2A05 A;  2V7F A;  1VQ6 I;  3HOV J;  2XAQ A;  2R7F A;  2R5Z B;  1YO5 C;  4LIU A;  2HTJ A;  5F08 A;  4D7M A;  1OPC A;  1ZG5 A;  1SD5 A;  4HF2 A;  4L9V A;  2I5U A;  2P4W A;  1O7F A;  3IAS 2;  2FQ4 A;  3OYE A;  1VFC A;  2LBF A;  3LWF A;  1G8X A;  3KX2 A;  1WH7 A;  3N4M A;  4PSX A;  1E3O C;  3L9F A;  2VOO A;  2Z3Y A;  2RQQ A;  3JRI A;  1T6S A;  1ETY A;  2DBB A;  4B44 A;  1RUN A;  2VKV A;  2ZFW A;  2ISZ A;  3ASN H;  1VQM I;  5LFA A;  3GUD A;  4NC6 A;  2LOO A; 
#chains in the Genus database with same CATH homology
 4HZF A;  1IN4 A;  1IN6 A;  3HHH A;  1G3W A;  4EMS A;  3LAJ A;  4FX0 A;  1QZZ A;  2EFO A;  1KU7 A;  4WF2 A;  4L0Z B;  2COM A;  3RKY A;  4HF1 A;  3BDD A;  4I09 A;  1FP2 A;  2W84 A;  3LAP A;  2FF4 A;  2PEX A;  2FU4 A;  1RIO H;  4FX4 A;  3BJA A;  2DQL A;  1REP C;  3RPU A;  5ICG A;  3WTS C;  1P4X A;  5L3D A;  1G6N A;  3BPX A;  1H0M A;  2JPC A;  5JR3 A;  3K1N A;  3M7G A;  4G7Z F;  1WWX A;  5A2Q K;  4LLN A;  2WC2 A;  1DDN A;  3TOB A;  3GF2 A;  4KNY A;  2FOK A;  2GA1 A;  2G9W A;  3JSO A;  2QZ8 A;  4RGS A;  4EJU A;  4AIJ A;  4KN7 X;  2LF7 A;  3GXO A;  1H9G A;  5ILV A;  3HRU A;  2VT3 A;  3CUQ B;  3ROU A;  2CGP A;  3HRM A;  5FGM A;  2KIU A;  5BQT A;  2NRA C;  2HOE A;  2EA2 A;  1ZGJ A;  5LLQ A;  3ZPL A;  4M72 A;  2PG4 A;  5BOX A;  2CFX A;  3QAH A;  4A6D A;  4D0P A;  3DF8 A;  2AXL A;  6PAX A;  4U88 A;  3BRO A;  4OIR F;  1IF1 A;  5JHU A;  2VOP A;  2KIF A;  5HLG A;  3PQJ A;  3T1B A;  2DW4 A;  1WKM A;  3WGG A;  1G3T A;  1BJA A;  5FD5 A;  4L5J A;  5D8K B;  1XSX A;  4E70 A;  4KT5 C;  3HHG A;  1JXS A;  4NQW A;  1PP8 F;  3ZMD A;  2YSR A;  1JHH A;  4N9I A;  1PDN C;  2VN2 A;  2QQB A;  4N0B A;  2Y0M A;  4HX4 A;  4A0X A;  2HEO A;  1SFX A;  2F5C A;  1LEB A;  4B8X A;  5ICF A;  1U5T A;  3NQO A;  3L2C A;  2HS5 A;  4MEX F;  4OIO F;  2ADU A;  1G3Y A;  2A61 A;  3SHF A;  2R3S A;  4HX7 A;  3IKT A;  1ZRC A;  5CJ9 A;  3RDI A;  2M1B A;  1KU3 A;  2FA5 A;  4UUV A;  1UFM A;  3LFK A;  1SD4 A;  2Z99 A;  3HSR A;  2VBW A;  3WTZ A;  5E8G A;  1OR7 A;  1QBJ A;  4EJT A;  5FB2 A;  5DD8 A;  2MLG A;  3REO A;  1ZRF A;  2IT0 A;  3CO7 C;  5DDG A;  1FX7 A;  3LST A;  1Y0U A;  2HDC A;  2HR3 A;  4R8H A;  3MZH A;  3TQN A;  3DV8 A;  3TGN A;  1CF7 B;  2KKO A;  1BI2 A;  3KEO A;  3F21 A;  1TQM A;  3LA7 A;  1KYW A;  1XD7 A;  3P7N A;  4CO8 A;  2BE5 F;  1HST A;  2FBH A;  1HBX G;  1XMA A;  1B9N A;  2LNB A;  1FSE A;  4EM0 B;  2C6Y A;  2EK5 A;  5LGN A;  5FFX A;  2IRF G;  1DPU A;  3HRS A;  2ESH A;  2A6E F;  3QPT A;  2QBY B;  3JSP A;  1DP7 P;  2QM3 A;  1ODD A;  2XKP A;  3WOD F;  3E6C C;  2H6B A;  2K02 A;  3ABT A;  2A3S A;  5AON A;  4L9J A;  3KP7 A;  2EFQ A;  5HS8 A;  2LF8 A;  4WK8 F;  1XMK A;  2HKO A;  1G3S A;  4BYY A;  3EDP A;  3KE2 A;  1MDM B;  5BPD A;  5D5U B;  3F8C A;  5CVR A;  5TJJ A;  4XLN F;  1LB2 A;  3J7A O;  3CUO A;  2DT5 A;  3PFI A;  1J7K A;  2ZNZ A;  1BM9 A;  2ZME A;  1GHC A;  1H9T A;  4UVA A;  5LEK A;  2XAH A;  2L3D A;  2FE3 A;  2A6H F;  5ILS A;  5E8I A;  1ON1 A;  4KIF A;  1XSV A;  1Q1H A;  2YPR A;  1Z91 A;  4EGY A;  2D1V A;  1P4A A;  4OU0 A;  1WQ2 A;  4JQF A;  1T39 A;  2RNJ A;  1U78 A;  1ZAO A;  4MNU A;  1QNT A;  1ZRD A;  4KA4 A;  3IL2 A;  1HW2 A;  3WU0 A;  2XUB A;  3RI4 A;  4F7Z A;  4OMY A;  4WWC A;  1ZYR F;  1ZG3 A;  2PJP A;  5HLH A;  4EJV A;  5LBQ A;  2EFW A;  4I01 A;  3DEU A;  1D8J A;  3R60 A;  1YQA A;  4BHC A;  4EGZ A;  3KP2 A;  2DK8 A;  3RYR A;  1V4R A;  3ISP A;  1YW7 A;  2E7W A;  3G73 A;  2ZNY A;  4HOB A;  2ISY A;  2VBX A;  1MZB A;  4RB0 A;  3IKV A;  2UZK A;  4KN4 X;  4M9Z A;  3ZMT A;  4ESJ A;  3I5U A;  2O8X A;  1YW9 A;  2XAF A;  1FBU A;  3MWM A;  4HDU A;  3VEP A;  1IN8 A;  2ZKZ A;  2EFN A;  2B0L A;  2BBY A;  4ZH4 F;  4L5I A;  1K78 B;  2NYX A;  2OD5 A;  5CVI A;  5DYM A;  1HKS A;  4LB6 B;  4XSX F;  3P9K A;  2QQA A;  2W25 A;  3BWG A;  2VOD A;  4JK1 X;  1FT9 A;  3K2Z A;  4N9H A;  3ERE D;  2CWE A;  3ZMV A;  1YFH A;  2BV6 A;  2STT A;  3COA C;  1YLF A;  1TQP A;  5D5X B;  4CDG A;  2HTS A;  4U0V A;  2DI3 A;  4MGR A;  3FHZ A;  4MTD A;  2XAS A;  2A68 F;  4YFN F;  3DKW A;  5D4R A;  5JI6 A;  2RN7 A;  3T8T A;  3D0S A;  3CDH A;  2IJL A;  5HVQ C;  2JTV A;  2DTR A;  4Y17 A;  5DUI A;  2K86 A;  1L3L A;  5ILU A;  3QU6 A;  2XVC A;  1ONV A;  5HDK A;  4M6Y A;  1PUE E;  4UVB A;  4OOI A;  3V7C A;  4WX9 A;  3GYH X;  1HW5 A;  3MZY A;  4L9N A;  2WV0 A;  3I64 A;  3P9I A;  5FO5 A;  2L4M A;  2RKH A;  4M71 A;  3ZMZ A;  3QP5 A;  4RB2 C;  2KIM A;  1AWC A;  1E2X A;  5KVR A;  3C7J A;  4L18 B;  3KP3 A;  4IHS A;  3DP7 A;  2DK5 A;  3DFG A;  4G8X A;  2M87 A;  2KJC A;  4OIQ F;  1U2W A;  1BN5 A;  5HS7 A;  2A69 F;  2OZU A;  5DEQ A;  4G7O F;  4HLY A;  3WE3 A;  2MLK A;  2OQR A;  1ZGA A;  4M9X A;  5J6X A;  5E17 F;  1W5S A;  5L3E A;  2HWV A;  2H94 A;  4KMF A;  5AIQ A;  1F9N A;  2NAZ A;  4LLG F;  1Z9C A;  4H0E A;  4BHP A;  3L7W A;  4UNO A;  4R1H A;  5ED4 A;  3CUQ A;  2IPQ X;  3FXR A;  3HTS B;  4KFC A;  2Z33 A;  5TRD A;  4RAZ A;  3I0T A;  1FOK A;  1BI0 A;  2MA3 A;  4MQ9 F;  1XB4 A;  2FXA A;  4I02 A;  4S04 A;  4P96 A;  4CZZ A;  5IT3 A;  3GX4 X;  1FNN A;  2O0Y A;  4RAY A;  4PGH A;  3EYY A;  1KQ8 A;  3HTU A;  1ULY A;  2VE9 A;  4BH9 A;  2HKX A;  2VT2 A;  3T0Y A;  3VOE A;  3GO5 A;  4I98 B;  1GXP A;  3ECO A;  4ZZD A;  4EQQ A;  1QGP A;  1W7P B;  1LDD A;  4IPA A;  3BP8 A;  4PCQ A;  3O3K A;  4BNC A;  1U6G A;  3ABU A;  3HYI A;  3E6B A;  2DQR A;  2CYY A;  1XCB A;  5L3C A;  4M6X A;  2XIG A;  4A2U A;  3J80 Z;  3R4K A;  1FBS A;  2K7L A;  4LG0 B;  3T5X A;  5JVT A;  2H09 A;  2XGX A;  1R36 A;  2H6C A;  3IWZ A;  3SQN A;  2OQG A;  1EV7 A;  3V8L A;  4WCG A;  1FP1 D;  2AS5 F;  3CTA A;  2EA4 A;  3M1E A;  3MAJ A;  2F2E A;  4S05 A;  2LSO A;  4HW0 A;  2J5O A;  4DQ2 A;  1FZP B;  3F23 A;  4I2O A;  3BJO A;  1QQI A;  4IXA A;  2BEO A;  2ZXJ A;  3ZN1 A;  4HV5 A;  2EV6 A;  1U3E M;  4YFX F;  4UHT A;  1SFU A;  4LJZ F;  5ICC A;  2CO5 A;  3KZZ A;  3F8F A;  3FMS A;  2EJR A;  3RPQ A;  1CF7 A;  2TDX A;  4B09 A;  1UHM A;  1KQ9 A;  3QRF F;  3HRT A;  2QWW A;  1FYL A;  1TNT A;  1RI7 A;  2WTE A;  4MEY F;  4U7B A;  4U0Y A;  4BQA A;  3GFM A;  3GZ5 A;  2EV5 A;  1YIO A;  2XV4 S;  2WWY A;  2ACJ A;  2UXN A;  5HDN A;  2QBY A;  4ZYD A;  2M45 A;  2QUF A;  1T98 A;  1R1T A;  2EWN A;  5D6F A;  3WTY C;  2UXX A;  1P2F A;  2FNA A;  4MTE A;  1R00 A;  3FXU A;  3FF5 A;  2L4A A;  3K1M A;  2V1X A;  1MJ9 A;  3I71 A;  4G6Q A;  2Y48 A;  2F5D A;  2FEZ A;  4EM2 A;  2ZBK A;  2RDP A;  1MDM A;  4LGW A;  2PFB A;  1B4A A;  5LHH A;  3H3Z A;  3EET A;  1HKT A;  3E5Q A;  1I6X A;  1EH8 A;  3KP4 A;  3E6D A;  1S29 A;  1XGO A;  2X0L A;  4O3M A;  4KYW A;  4AIK A;  2Q2E A;  4ENK A;  3JTG A;  1FLI A;  1T38 A;  4OIP F;  3GFJ A;  3QU3 A;  2EV0 A;  5L3G A;  1BBY A;  4JBA A;  2CQK A;  1U5T C;  2QEN A;  2JPB A;  1XSD A;  1Z7U A;  2P6S A;  4CGZ A;  1EH7 A;  3KLO A;  1XDS A;  2MH2 A;  2HYF A;  2G7H A;  2NNN A;  5K1Y A;  3F6O A;  1MJB A;  3KLN A;  5H6Q A;  2JSC A;  4LMY A;  5D5V B;  3LA2 A;  4KIG A;  4GYG A;  3J80 K;  3LQR A;  5E1Z B;  1O3S A;  1Z6T A;  3K9T A;  4NHJ A;  3EUH A;  4EJO A;  2L54 A;  4AWX B;  3KZY A;  1D3Y A;  5BS6 A;  1KU2 A;  4LK1 F;  1WRJ A;  1PP7 U;  3BY6 A;  1HQC A;  1I1G A;  4EVI A;  2MD5 A;  1XGS A;  4A0Z A;  2NS0 A;  4ESF A;  4UV9 A;  2L02 A;  3O6B B;  1IZ1 A;  1TBX A;  5AIP A;  3VOD A;  1R23 A;  3AAF A;  2Z5U A;  5F1R A;  3CJN A;  5D4S A;  1FBQ A;  1YTY A;  1JGS A;  1L0O C;  1MKM A;  2P6T A;  5F64 A;  1K78 A;  1BIB A;  3TKY A;  3GWZ A;  2JRT A;  1TLH B;  1FWZ A;  3RTR A;  4LD5 A;  2IA2 A;  3Q9S A;  3KET A;  2ZCW A;  3Q9V A;  2YU3 A;  2PMU A;  3I54 A;  1QPM A;  3B02 A;  2MC3 A;  2DU9 A;  3C3W A;  2A5Y B;  3F8N A;  3K69 A;  3V7S A;  3W6J B;  1W4M A;  1YG2 A;  4I7H A;  4IHT A;  5J8F A;  3GVA A;  5IT9 Z;  1S8N A;  2ELH A;  2CG4 A;  5H6R A;  1B1B A;  4IJA A;  2CSO A;  3CLO A;  2MBF A;  1YYV A;  3VB2 A;  3NRV A;  4BXU A;  3IRR A;  3GFL A;  1UHW A;  1XN7 A;  2M30 A;  2QVO A;  1MJA A;  2E1N A;  5FFZ A;  2O6G E;  4LB5 A;  4AD9 A;  5LRS A;  5HS9 A;  3JTH A;  4MHG A;  2QLZ A;  4ETS A;  1O3R A;  4CYD A;  4R79 A;  3V8J A;  5D6E A;  1GVJ A;  3FM3 A;  3F22 A;  3WTW C;  2VE8 A;  3N97 A;  2XKO A;  2XAG A;  3KFW X;  1AOY A;  1R5H A;  3R61 A;  1XDU A;  1QO0 D;  3I4P A;  2E7X A;  1W5T A;  3ZP5 A;  5BPI A;  2GXB A;  4ZYG A;  4GO1 A;  2NNY A;  3ECH A;  1YS6 A;  4FT8 A;  2RV8 A;  3SZT A;  5K5Q A;  1EH6 A;  4RGR A;  4IRI A;  1B59 A;  4YG2 F;  4UXN A;  1I5Z A;  4KMU X;  2OBP A;  1ZLJ A;  4HLX A;  2O03 A;  4ZYH A;  4HA8 A;  3HSE A;  2J5P A;  1XGM A;  4WXH A;  4K2E A;  2STW A;  1I1S A;  3RKW A;  3I59 B;  3E5X A;  4RB3 C;  4RGU A;  3BPV A;  3FM5 A;  5H20 A;  1FC3 A;  4XSZ F;  5D8L B;  1IXS B;  2Q8K A;  1S3J A;  2FML A;  1D5V A;  4L9T A;  2PQ8 A;  2ZO4 A;  4M74 A;  5CYV A;  4BHB A;  2X4H A;  2LDU A;  3DPT A;  1HW1 A;  4YII A;  5E1X A;  5DUK A;  1OYI A;  3WGH A;  4A5N A;  2GXG A;  2KJB A;  4O6J A;  1QZY A;  4OIN F;  1W7P A;  4P9F A;  1OMI A;  1J75 A;  3RKX A;  4EJW A;  5ICE A;  4I0A A;  4NB5 A;  2HFH A;  2OZ6 A;  1IRF A;  3IWF A;  2RVC A;  2JZY A;  2V1D A;  1K7A A;  1LEA A;  2XRN A;  1R22 A;  2K27 A;  1RUO A;  4UVC A;  4LG0 A;  1Z1D A;  1KA8 A;  2D2W A;  4A6E A;  1RNL A;  5IT9 K;  3O2P E;  3M9A A;  3W6K B;  3QOP A;  3TDU C;  4RB1 A;  2OAZ A;  1Z05 A;  4HAM A;  3L00 A;  3KP5 A;  2L01 A;  5J8C A;  3GZ6 A;  3KP6 A;  3J81 Z;  3RYP A;  5CVU A;  4I0B A;  1NHA A;  3F3X A;  4ESB A;  1S7O A;  3C1D A;  1K79 A;  2V9V A;  2GAU A;  1ZAR A;  1SMT A;  1U8R A;  4P55 A;  2FMY A;  4CIC A;  1J59 A;  3TOA A;  1UCR A;  5E1W A;  3LQQ A;  2ZJ2 A;  3D5L A;  4UV8 A;  3E3V A;  2VC1 A;  2EFP A;  5DCF A;  4Y15 A;  2DFI A;  3HOT A;  1ZRE A;  3CUQ C;  1OYY A;  1P4W A;  1P92 A;  1SD7 A;  2RQP A;  1SD6 A;  5FLX Z;  1R5G A;  3LA3 A;  1FYM A;  2GA2 A;  1IRG A;  4YFK F;  2VBY A;  3ZMS A;  2H27 A;  1B9M A;  4IF4 A;  4EM1 A;  1BIA A;  4OMZ A;  1IXC A;  1DUX C;  1WI9 A;  1F1Z A;  1F5T A;  2D45 A;  4G9Y A;  2E1C A;  3CO6 C;  1GXQ A;  5HOO A;  5DCM B;  1S7A A;  1YS7 A;  2FRH A;  3GLX A;  3HSF A;  1IAW A;  2KRF A;  3I58 A;  1TNS A;  5KK1 A;  3ZMU A;  2W85 A;  2YR2 A;  1ON2 A;  1O7L A;  1J5Y A;  3Q5F A;  3GEZ A;  2ESN A;  1MGT A;  1BOA A;  2P8T A;  1STZ A;  1SMY F;  3MQ0 A;  4ASN A;  2O3F A;  1JHF A;  4RS8 A;  5EEH A;  2IVM A;  4PZJ A;  3RIR A;  1J9I A;  1MD0 A;  5DD4 A;  3V7R A;  3DXJ F;  1T2K A;  1X3U A;  4HYE A;  5LHG A;  1ZN2 A;  5E18 F;  3HIF A;  3WU1 B;  3TO6 A;  1A04 A;  2IW5 A;  1RZ4 A;  3R0A A;  1WSU A;  2IA0 A;  4FHT A;  2FSW A;  2GWR A;  5L3B A;  1O57 A;  2HQR A;  4Y13 A;  5CLS A;  2LKP A;  2PI0 A;  3U1D A;  1IUY A;  1B6A A;  3M8F A;  2HYG D;  2XAJ A;  2PMH A;  4CXF A;  3WG9 A;  2IA1 A;  3L09 A;  4KUM A;  3JAM Z;  2DLL A;  3J81 K;  3ZQ7 A;  3FZV A;  5LGU A;  4IVN A;  2GIV A;  1W7P D;  2M5W A;  4ENM A;  4Q48 A;  3OV8 A;  3E97 A;  4A0Y A;  4PGG A;  4CHU A;  3U9G A;  2EB7 A;  3F72 A;  2K4J A;  1BI3 A;  4GXO A;  2BGC A;  3H3U A;  3QP6 A;  4LK0 F;  3TO9 A;  1FY7 A;  4BAY A;  2QQ9 A;  1KQ0 A;  3VFZ A;  3V8K A;  3ML6 A;  4XLP F;  5CVV A;  1R7J A;  1Z6R A;  1FYK A;  3NEU A;  2YX7 A;  3GW2 A;  4Q4Z F;  2ETH A;  4IRH A;  5FLX K;  2P7C B;  1R1U A;  2GZW A;  3WE2 A;  2DPD A;  2A07 F;  4IRG A;  1IN7 A;  5E20 A;  1HSJ A;  5FD6 A;  2VBZ A;  4P5O A;  4M9S A;  1F4K A;  4LLL A;  2HZT A;  1UST A;  1LVA A;  1ZH5 A;  4WXD A;  3U2R A;  4KDP A;  2FQ3 A;  2CW0 F;  1YW8 A;  2VC0 A;  5EEG A;  1BC7 C;  4LFU A;  3P9C A;  5CVJ A;  1LDK B;  2MH9 A;  1IXR C;  1U5T B;  2P5L C;  1ZHF A;  1DPR A;  4M73 A;  1KYZ A;  3T8R A;  1KGS A;  1KU9 A;  1ZLK A;  5K5R A;  2YX4 A;  2P7V B;  2W57 A;  4DNC A;  3FMR A;  4PDK A;  2FNP A;  3MFK A;  2RC4 A;  1O3Q A;  3M8E A;  2M8E A;  3WTU C;  2F5E A;  4GCV A;  4HV6 A;  1O3T A;  3F8B A;  4HBL A;  1G4D A;  5HDG A;  2RGV A;  3R6S A;  1SFE A;  2K4B A;  2OU2 A;  2Z9O A;  4L0Y B;  2IP2 A;  1USS A;  4AVP A;  4WXC A;  3F8M A;  4RGX A;  3OOP A;  3FWE A;  3S2W A;  2PBI A;  2HQN A;  1FSH A;  2XHK A;  3I59 A;  4G94 A;  4GYI A;  1XGN A;  1TW2 A;  2OA4 A;  4P9U A;  3HOS A;  3MEX A;  4U7D A;  1LJ9 A;  2O61 A;  3EYI A;  1LNW A;  3WGI A;  1D8K A;  3FX3 A;  3JAM K;  1BC8 C;  1VTN C;  2V6C A;  3I53 A;  1TW3 A;  4HQE A;  1HKQ A;  4GGG A;  3SZP A;  2DAO A;  3GFI A;  1ZG1 A;  2V79 A;  3H92 A;  2DPU A;  3ZN0 A;  1CGP A;  1LDJ A;  5K5O A;  2F5F A;  2BYV E;  3FMQ A;  3JW4 A;  4MQV A;  3FXQ A;  4QWQ A;  1E17 A;  4ZYE A;  3DQV C;  2QYO A;  2P5V A;  4O5V A;  1J2X A;  3BJ6 A;  5HLI A;  2ZME B;  4TV7 A;  2G7U A;  5LRR A;  3KEQ A;  3SFZ A;  4XBF A;  1SAX A;  3RJP A;  3K0L A;  5DV5 A;  4HQM A;  2R7D A;  5D5W B;  4AIH A;  3IC7 A;  3PQK A;  3QPH A;  1IW7 F;  2FBK A;  2XRO A;  4ZZL A;  3C18 A;  5A2Q Z;  3G3Z A;  3DPL C;  1V3F A;  3IHU A;  1TTY A;  3TO7 A;  4HX8 A;  2PLY A;  2D1H A;  1T0F A;  4KIC A;  4HF0 A;  2DO7 A;  5LHI A;  1LQ1 A;  4G6D A;  2W24 A;  1R58 A;  4KIB A;  2JT1 A;  4ON0 A;  1FPQ A;  2UWM A;  3WTT C;  1JE8 A;  3BZ6 A;  1UB9 A;  3WTX C;  2VON A;  3ELK A;  2VXZ A;  5ERI A;  3EQL F;  3BOQ A;  5F6F A;  3K1P A;  4YIF A;  4A12 A;  3R0J A;  4EV0 A;  1BI1 A;  4U0W A;  4HDV A;  3SXY A;  5LEJ A;  2GQQ A;  3WTV C;  4Q47 A;  1C0W A;  5L3F A;  1J0R A;  1HXD A;  2Q0O A;  3ULQ B;  1XCV A;  4ENN A;  1K6O A;  3E5U A;  4XRF A;  3B73 A;  2HGC A;  1P6R A;  1IN5 A;  4QLC U;  1OYW A;  4G7H F;  5LGT A;  3E6M A;  4A5M A;  3HUG A;  3MCZ A;  2P5K A;  1R1V A;  2Y75 A;  1I27 A;  1OKR A;  3KCC A;  3IRQ A;  3F6V A;  4Z2Y A;  2PN6 A;  3V4G A;  2V1U A;  1S6L A;  1TQI A;  5DCM A;  4Q5S F;  2FBI A;  3TDZ C;  5JFR A;  4ENJ A;  5BMZ A;  2XAQ A;  2R7F A;  1YO5 C;  2HTJ A;  1ZG5 A;  1OPC A;  1SD5 A;  4HF2 A;  4L9V A;  2P4W A;  1O7F A;  3LWF A;  3N4M A;  3L9F A;  2VOO A;  2Z3Y A;  1T6S A;  2DBB A;  1RUN A;  2ISZ A;  2ZFW A;  3GUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...