1JKPC

Testing the water-mediated hin recombinase dna recognition by systematic mutations
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
47
Chain Sequence
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords 5'-D(*TP*GP*TP*TP*TP*TP*TP*GP*AP*GP*AP*AP*GP*A)-3'
publication title Testing water-mediated DNA recognition by the Hin recombinase.
pubmed doi rcsb
total genus 13
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jkpC00
1B8IA 3RQIA 1HCRA 1ZR2A 4XK4A 1QPIA 1VNDA 1MBHA 3G1OA 5J1RA 3NARA 2ZB9A 2X9DA 2XGEA 2DJNA 2DMTA 2DA6A 5BNGA 1HF0A 4DYQA 4CYCA 1IJWC 2K9SA 3S1NJ 3S1RJ 1IRZA 1IDYA 4A3KJ 4W97A 4Y7NJ 2E19A 3S16J 1T33A 2K9QA 3BG9A 1NTCA 1Z77A 4B1RA 1H8AC 1CQTA 1MH4A 5JLWA 3OOUA 4L5EA 2ECBA 3HDDA 2DA3A 2LFBA 3HKZN 4A3LJ 4IHYA 4RBOA 1PUFB 1RKTA 1JUPA 2XGCA 2ID6A 3FK7A 2KT0A 3ZQLA 4V2FA 1LFBA 1ZQ3P 5IYCJ 4BBSJ 3CDLA 3BR1A 1X58A 5IPAA 3LSPA 2JA6J 1U9NA 2DMNA 2N8GA 1LE8A 3SJMA 3IH2A 2JA5J 4BY7J 2YUSA 4G12A 5F0CA 2R5ZA 1AKHB 1WH5A 1ZGWA 4IHXA 3OSGA 3BR5A 2LTPA 4EEFG 3HBLA 4A3JJ 2CU7A 1A6IA 2COBA 4D7NA 3MN2A 5E3OA 3O8HA 3S15J 4MO7A 1FEXA 5J1UA 5K7ZA 2HOSA 5FLVA 1T56A 2GBYA 1FIPA 4JX4A 1ETKA 3MKLA 3BR3A 5E3MA 1B72A 5IP9J 5IYBJ 3OIOA 1MBJA 2O7OA 1ZR4A 2DA2A 1OJLA 1Q1VA 1RKWA 3BR2A 3GTMJ 3PO2J 3QPLA 1BA5A 2CJJA 3RZDJ 2EZLA 2HXOA 3H0GJ 5IOZA 1QRYA 5EZHA 3IV5A 5HODA 1DU0A 2X48A 4BBRJ 5K7FA 3I4MJ 2ME0A 5FJ8J 5EF6A 2M0CA 1A5JA 1ETXA 2R0QC 5EYRA 2VKVA 3HGGA 2B63J 2LD5A 1JKQC 2Y9YA 3GTGJ 3H3VK 5FLMJ 2Y0SN 3GTOJ 3BTIA 4JP0A 3SFIA 4IEJA 3HOUJ 1ZTRA 4M3EA 3HB9A 2QCOA 3L1PA 4A3IJ 1JJ6C 2MG4A 4MLOA 5EEAA 1I3QJ 3BTCA 2E2IJ 2XPUA 5FKNA 4DZPA 5M5WJ 1HDPA 2IAIA 4C3IJ 2JMWA 4A3FJ 4IHWA 3CCYA 2M9HA 2DA5A 4UUSB 1G2HA 1WGXA 1W0UA 1IV6A 3TW7A 3GBGA 5C44J 3UKGA 2XGDA 5FKMA 3TP0A 3Q0UA 3HOXJ 2E2HJ 4FCYA 5K7HA 4A3EJ 5F04A 3S2DJ 3IH4A 4JX5A 2GM4A 1IGNA 3DCFA 1E3OC 4BKXA 4BXXJ 5M3MJ 2O8KA 3IH3A 4A3DJ 1IDZA 1FIAA 2HOTA 3QQAA 1U8BA 4JX6A 2VI6A 1WI3A 5DS9A 1JTXA 3CMYA 1NK2P 2LKXA 5IP7J 1TWAJ 1RR7A 5EGOB 2M8GX 1ETWA 2VKEA 2DTZA 1JT0A 1APLC 5E3NA 1Y1VJ 2HI3A 5F0HA 1IUFA 2JK3A 3ZQFA 5EG0B 2EZKA 2K40A 2JN6A 2L9RA 2XSDC 3JRIA 1TWHJ 2FD5A 4D5CA 2CQQA 9ANTA 1X2MA 2FJ1A 1SFOJ 5C3EJ 3JREA 2NS8A 1WPKA 1ZKGA 2I10A 2L7MP 3ZQHA 3CQZJ 4B3AA 5M3FJ 1DU6A 2Y31A 3BR6A 2AO9A 3LSRA 2HDDA 4MFDA 4A3CJ 2L0KA 3K2AA 4M3GA 1AHDP 3A03A 3Q0WA 2DA1A 1O4XA 2JA7J 5J1YA 2DA4A 2ID3A 3PM1A 3PO3J 1BW5A 1ORKA 3A01A 3BR0A 3ZQGA 1MBFA 3HOYJ 2E2JJ 3BT9A 1FJLA 2JJ7A 1QVTA 5C4JJ 2M34A 1JKPC 5IOYA 3M4OJ 2TCTA 3BG5A 2AHQA 4FE4A 4J19A 1MSFC 2R93J 2VUMJ 2L7ZA 2HXIA 3GTKJ 1NK3P 2RAEA 3GTQJ 1ENHA 1YRNA 2XPWA 1XG1A 3QPSA 2LVSA 1U78A 1MBKA 1BL0A 2HQ5A 4A3GJ 4ABZA 3I4NJ 2NOGA 1OCTC 3VPRA 2ECCA 4XRSA 5F27A 5IYDJ 1UHSA 4GFBA 4DYCA 5GPCA 1LE8B 1TC3C 4V2GA 3TP3A 1W0TA 4M6VA 2CRGA 3GTLJ 1P7JA 1ITYA 1GVDA 2JWTA 3TEDA 1XS9A 2OF7A 2YU9J 3B6AA 2DMPA 2LK2A 3O8GA 3ZQCA 1SANA 4LOCA 3G1MA 3NAUA 3WHBA 3F0CA 4FTHA 2O9LA 3W6VA 3A02A 5F1JA 4Y52J 4MIMA 4XIDA 1RETA 1JTYA 2FQ4A 2XRLA 2KDZA 3S1MJ 3BTJA 1Z0XA 1UMQA 4XRMA 2L7FP 1K61A 3FKIJ 1B72B 2FX0A 3G1LA 2X6OA 1UG2A 5M5YJ 1VFCA 3GTPJ 3HOVJ 3S17J 1JJ8C 1JKOC 5GP9A 4RDUA 2G0EA 1ETVA 3JRCA 4JYKA 4DW6A 2H1KA 2IBDA 2EBIA 1IG7A 2D5VA 5F08A 1FTZA 4AYBN 1ETQA 2K9NA 2TRTA 1PUFA 3LOCA 3FISA 3BTLA 3HEFA 1GV5A 4D5FA 4FE7A 5E3LA 2R5YB 3B6CA 4M3DA 2E1OA 2VPRA 1Y1WJ 1MNMC 3OSFA 3JRBA 1F36A 4M3BA 4C3HJ 1R9TJ 3S1QJ 1XC5A 2NS7A 1AKHA 2EQRA 3MVPA 2NVQJ 2HYJA 2DN0A 1JGGA 1HOMA 2HOAA 2ELKA 3TW6A 1I50J 2WB1N 1BW6A 2PMZN 2MGQA 2WAQN 3Q3SA 4A93J 3FK6A 4FISA 2EH3A 2NVYJ 1S7EA 1GDTA 4XRSG 1K83J 1JUSA 3ZQIA 3HM5A 2DMUA 2CQXA 5FKOA 2P81A 4AUXA 1MH3A 1B8IB 3HOWJ 1BJZA 3LSGA 4D7MA 1JKRC 2R7ZJ 1ZK8A 1VI0A 2DA7A 2EZHA 3LNQA 1AU7A 3E7LA 1U9OA 2Y30A 1MSEC 2LR8A 3BG3A 2YS9A 5DTDA 1H88C 4C2MJ 2OPTA 2R92J 4W1UA 4X1EA 1POGA 3ZOBA 1GV2A 1F43A 2GLOA 5FKLA 3JRHA 4CYCB 4I76A 3JRGA 4UUTA 3K7AJ 2CUFA 2M2EA 5M5XJ 3BQYA 1VF9A 3D1NI 5FKKA 1ETYA 3JRFA 1H89C 3WHCA 5J3LA 1MBGA 1QVUA 4BY1J 3SDGA 4A3MJ 2XB5A 1OCPA 3HOZJ 4X6AJ 2MSYA 4HNVA 2LP0A 3BQZA 3GTJJ 5EZGA 4MFEA 1GUUA 1OFCX 3C2BA 3HGYA 1TWGJ 4QIWN 1WH7A 2LY9A 4I6ZA 4UUSA 2R5ZB 1P7IA 4DZJA 2IEKA 5C4XJ 1MBEA 4C3JJ 3JRDA 3Q0VA 2DMQA 1RESA 1LFUP 2Y2ZA 2EZIA 3FIWA 2R5YA 2XB0X 3A01B 4AC0A 5GPAA 4S0HB 1TWCJ 2QF7A 5F0FA 1JT6A 4A3BJ 1JUMA 1IC8A 1D5YA 3LSJA 4A69C 2LLKA 4QSHA 2NVTJ 4XICA 1X2NA 3DEWA 2JA8J 3S14J 1YRNB 1EF4A 1I6HJ 3JRAA 2MW8A 2Y9ZA 5EGOA 4DYRA 1RPWA 1HDDC 2W48A 1TWFJ 4B4CA 5IP6A 4M3FA 2NVXJ 5EG0A 5EDNA 1FTTA 2H8RA 1WCMJ 1HLVA 4IHVA 3RZOJ 1ETOA 2XPVA 3M3YJ 4NDLA 4QTRA 2CUEA 3S2HJ 3JR9A 3RKQA 5JLXA 2ME6A 1GT0C 2WV1A
chains in the Genus database with same CATH superfamily
3FMSA 4II2A 2ZFWA 1BI3A 2DDAA 3ZMVA 2WY8Q 2L9VA 3HTUA 2DPUA 3TO9A 2IGOA 1VNDA 2R3SA 5J1RA 4HF0A 3DLLF 1VZ0A 3K4BA 3VDXA 1EJ9A 3ZMDA 1SFEA 2QWWA 2DMTA 2QQBA 4D1QA 1W36C 2VBZA 3FF5A 5BNGA 4XMYA 1IW7F 2J5PA 1BI0A 1LVKA 1YHQI 2A3SA 2Z9OA 4LIUA 2CUZA 3MQ0A 1IDYA 2OCEA 3OOPA 3R61A 2DFHA 5D8LB 1J7KA 1T33A 4HW0A 1O7FA 3QPTA 4PDKA 1NTCA 4B1RA 1CQTA 1T38A 3OOUA 2AQFA 3HDDA 4AIHA 2BE5F 1QO0D 3CC4I 3C2HA 3BJ6A 1RKTA 4LLGF 2K7LA 2XGCA 3DQVC 4LD5A 5E18F 2DTRA 3RKWA 4U0WA 4V2FA 1FSHA 3PSIA 4UUVA 3D0SA 1LFBA 2MYSA 3TGNA 2K02A 2LREA 2VC0A 3BR1A 1SMTA 2JA6J 3MZ8A 3ZMTA 1P92A 4M74A 2DMNA 2WBMA 5HLGA 3GXOA 2HYGD 3F8CA 1SFXA 3E0JB 2LKPA 5IY5H 1K79A 4OIRF 2ZFUA 4ON0A 5HDNA 4KDPA 4CCOA 4G12A 5F0CA 1R49A 3OSGA 3BR5A 2LTPA 5L3FA 3VYSB 4EEFG 2DBBA 4A3JJ 4D7NA 2OZUA 3O8HA 3WGGA 3S3NA 1XGSA 3F8BA 2F5VA 4RLQA 4XN0A 5K7ZA 4IX7A 4C2TA 5FLVA 2XKPA 2BY1A 2W25A 2HVRA 4JX4A 1ETKA 1UFMA 3LA3A 3MKLA 2QSGX 1KA8A 4FHTA 4CCLA 4MQVA 1ULYA 2QBYB 3PFIA 5DV5A 3RPUA 4MGRA 1MBJA 1ZGAA 3UR3C 2VJIA 1BOAA 2UUZA 5LRSA 1OJLA 1BR1A 3SZPA 1I39A 2VQCA 4B43A 4OU0A 3W3CA 3H5NA 1SVOA 4MNUA 3OS2A 2GOXB 2CW7A 2HXOA 4HSTA 5IOZA 2RN7A 2QQ8A 3QP5A 5TGTA 1W7PB 2X48A 5L3CA 4RGRA 1HA8A 3VYRB 1A5JA 2R7SA 2R0QC 2VKDA 2VKVA 4JK1X 3PNVA 4CZZA 2B63J 2KJBA 2IA2A 4Y15A 1F9NA 1JKQC 5KNLA 5E79C 2VIXA 2WAFA 3AG1H 1R00A 1ZYRF 2R7RA 4IRGA 3GTOJ 4EJUA 3SFIA 4IEJA 4YFNF 2HEOA 4XN3A 1U8RA 4M3EA 3KEOA 2QCOA 3L1PA 1USTA 2JPCA 1VQOI 3BTCA 2P5LC 1ZN2A 2IS4A 1SAUA 4HX8A 3TOBA 1VQMI 4DZPA 2MH9A 2EB7A 4GYGA 4JQFA 3I9V2 3HOTA 1Y0UA 5FB2A 2JMWA 2ZXHA 3CCYA 2DA5A 3DTEA 1G2HA 3H0DA 2VODA 4U0VA 1IXRC 5LGNA 3DU6A 1OYIA 3Q0UA 1STZA 3CCSI 5K7HA 3S2DJ 1ZHFA 1U5TB 2DODA 4Y17A 2L2OA 2LF7A 5LGTA 3K1PA 5E20A 3L00A 2EJRA 1VQ6I 2CO5A 4BKXA 1DP7P 2VLAA 2KIQA 2DOEA 1H9TA 4BAYA 1K78B 2RVCA 1OCCH 3WG9A 4BE2A 2P8TA 3PSFA 2XIGA 1U8BA 2BHYA 2ZNYA 1T08B 4E7IA 1X4PA 1JTXA 3L9FA 2LKXA 2FOWA 1D8JA 1S6LA 5D6FA 5EGOB 2M8GX 4U87A 1ETWA 2VKEA 2DTZA 1B1BA 4E7SA 4EGZA 3J80Z 2LC2A 1IUFA 2LBFB 5EG0B 2HVSA 3K4JA 4IPAA 2KRHA 2HYFA 4HNUA 1JI8A 4M9XA 3WU1B 1ZREA 1HW1A 3HRSA 1M1EB 5DEQA 3F6VA 1R4NB 4KIGA 4B48A 5L3DA 2PI0A 1LUJB 2L7KA 2NS8A 1ZKGA 1EH8A 2QQAA 3I56I 4KMUX 4WXCA 3VYUB 2NXNB 1R5GA 1IN5A 1P2FA 1DU6A 4HV5A 4IXAA 2Y31A 3BR6A 2AO9A 4P9UA 2ZMEC 5B1AH 2A05A 5JHUA 4MFDA 4EVIA 1A35A 1R1TA 2Y0SA 2K86A 2ZNZA 2E71A 3GUDA 1LQ1A 3R0JA 4HDUA 3ELKA 2VOPA 2DA4A 2ID3A 4KN4X 3PM1A 4IL6C 3PO3J 3HOYJ 3BT9A 4N4NB 5BPIA 1QVTA 1Z3YA 5C4JJ 3TDZC 4Y3OA 3DPLC 3EUKL 1JKPC 4R79A 1T0FC 2AHQA 4FE4A 2R93J 2IJLA 2Z1DA 3GTKJ 1E3HA 2KHMA 1NK3P 4KNYA 4GRIA 5BOXA 4LITA 3AL0C 3W6JB 2WADA 3M7GA 1BI1A 3ESWB 1T95A 4ESJA 3H9GA 1MZBA 1MBKA 3GZNB 3KEYA 4DQ2A 1XSXA 5GAHJ 5H6RA 2VOOA 1L0OC 3P7NA 1X1PA 3VPRA 2ECCA 3CO7C 1X3ZB 1FYKA 4EJWA 5F64A 4GYIA 4KT5C 3ZRGA 1D1AA 4V2GA 1XSDA 1W0TA 4HDVA 3S8PA 3FXUA 2XF5A 1ITYA 1YX5A 1R7JA 2JWTA 2AQEA 2KIFA 2LYCA 5KCMA 1YFHA 1HW2A 3OV8A 1VQLI 3IRRA 1Z67A 2IA0A 2LK2A 5ICFA 4HLXA 3T0YA 3FMQA 3O8GA 4R8HA 4E6KG 3ZQCA 1TTYA 4PZJA 1P9QC 4N0BA 4S05A 4XORA 4Q47A 4MIMA 1N77A 4HRIA 1JTYA 2XRLA 1X1CA 3S1MJ 1T39A 3FXMA 1WFXA 1Z0XA 4BE1A 2DJIA 3GZ5A 3HOVJ 3CCMI 4D9JA 1IV8A 2X4HA 5GP9A 4CSWA 4LG0B 2E60A 4KMFA 4BS9A 4QWQA 4JYKA 4C9YA 2VQHA 3A2KA 1BOBA 1IG7A 2EFNA 1FTZA 2DLLA 1S72I 1ETQA 3K6GA 1DUXC 3E3VA 3LOCA 2HQAA 3PQJA 3GWZA 2B0LA 4CO8A 1YI2I 2O03A 2BHZA 2R5YB 4BXUA 3RPUD 2CMPA 2R7WA 2VPRA 4L0YB 5D5XB 3ZXSA 1MNMC 3JRBA 2VASA 2EA2A 4ASNA 3ABMH 3OYKA 4C30A 3S1QJ 1K4SA 5B3SH 1JXSA 2RKHA 3I4PA 1D3YA 1RZ4A 4EJVA 2HR3A 2HYJA 2W4SA 2OCCH 1JGGA 1Z7UA 2ELKA 3TW6A 2WB1N 3K4LA 1BW6A 3OYHA 2MGQA 4GDFA 5E1WA 2ZXIA 3NRVA 1WVRA 1Z05A 2JTVA 2MD0A 2K9MA 3BP8A 1MDMA 2NVYJ 3G3ZA 4IVNA 1GDTA 2HS5A 2JSCA 2VT3A 1TZLA 3MZYA 4ENKA 5TJJA 2P81A 1FLIA 4WF2A 5HOOA 4E70A 2VJ4A 5GAEJ 1YQAA 1X1AA 2DFEA 3K9TA 3DLAA 5CPRB 4XKBA 3QWLA 2E5NA 1KU7A 1ON1A 1PJRA 2YS9A 3COAC 1H88C 5ERIA 5CQEA 2B7EA 2OPTA 3K1NA 4W1UA 2R92J 3DWLE 2VQLA 3JAMZ 3B02A 4E7JA 3FX3A 4CYCB 5CQGA 2F5FA 1AA7A 1W1WE 4EM1A 3BQYA 4XM3A 1VF9A 2F5CA 3D1NI 3TKYA 3JRFA 3CTAA 3A1YA 1BR4A 2QEXI 3K0LA 1QVUA 1BM9A 1W5CC 1QBJA 3SDGA 1VQ4I 2XB5A 2Z16A 4CH7A 5KHDA 1I3AA 3RSNA 4E7ZA 4X6AJ 2W57A 4KT6A 3S3OA 3QYEA 3GTJJ 3DBLB 2QGUA 4NB5A 4MEYF 3W2AA 2QLZA 4M9ZA 3GO5A 5JR3A 3F3XA 1XN7A 2JA2A 2E1MC 4XBFA 4E4HA 4EJOA 1D0XA 2RNJA 3RTRA 1FNNA 3OY9A 2C6YA 2XASA 1GVJA 1USSA 2FE3A 2UWMA 2IEKA 1V54H 3KP3A 1XTAA 1MBEA 2ACJA 1MGTA 1ZRFA 4OMYA 1S3JA 4FQGA 3J81Z 3Q0VA 2XGXA 2DMQA 4KJZA 4B09A 1RRJA 2RDPA 5H20A 2D45A 1VQ8I 4L5IA 3A01B 5BPDA 4G6DA 2V1UA 3KP6A 2PQ8A 1R71A 2KISA 4S0HB 5KAIC 2QF7A 1R1VA 1N78A 4BJTA 2Q1ZB 4I02A 2OAZA 3CCLI 1WI9A 5LLQA 3DTIA 3WU0A 2KDOA 4RB3C 4R1HA 4IHTA 1F5TA 2NVTJ 1P4AA 5D5UB 2RC4A 3S14J 4OIOF 1JHFA 3I59A 4BGDA 2PEXA 1I27A 4DYRA 5DCMB 1TP4A 2JZYA 2DPDA 1TWFJ 4QPOA 4PJ0C 1YW9A 2ZKZA 4M3FA 3T1BA 2H8RA 1D1CA 2ZXJA 1HXDA 1HLVA 1SFUA 3RZOJ 2K85A 2GXGA 5CVJA 3RKXA 1LFPA 3F23A 3J7AY 3O6BB 2X51A 4TV7A 5JLXA 4IHSA 2F4IA 1J59A 1MKMA 1LJ9A 3RQIA 1PDNC 5HS8A 2IP2A 2Y69H 3F8FA 4XK4A 2PMUA 1MMGA 4WX9A 1MBHA 4BEHB 2UZKA 2ZB9A 1FYMA 2V9PA 5A2QK 3O3KA 4RMNA 3FBNB 3BDDA 5CKTA 4AIDA 4PK4A 4DYQA 1I5ZA 4KISA 4XLCA 1IJWC 1Y6IA 3S1RJ 2VL8A 4HEA2 4A3KJ 1QHGA 3HHHA 4AVPA 2E19A 3S32A 4Y7NJ 4XOTA 2LKSA 3EUHA 3OYCA 1Z77A 1H8AC 5JLWA 4L5EA 2WV0A 2GA2A 2JPBA 2LFBA 3HKZN 2L9NA 5FD5A 2ISZA 1FBQA 1V5EA 2ID6A 3FK7A 4OIQF 3NWTA 4XKVA 1TT5B 2HZDA 3E6CC 1ZQ3P 3LSPA 2P4WA 1GXQA 1LKXA 1YW7A 2N8GA 5LEJA 2NNNA 4HQEA 1BR2A 3IH2A 5TRDA 1QZZA 4OOIA 1AKHB 1RUOA 5D6EA 3FXQA 2CU7A 3MN2A 2HGCA 5E3OA 3S15J 3EYYA 2V1NA 1O3SA 1FEXA 3D5RC 2GBYA 1UCRA 2WC2A 1U6GA 4ZZDA 4ETSA 1FY7A 2VXDA 3BR3A 3F6OA 1B72A 5LHIA 2K4JA 1X3WB 2F4OB 3N4MA 2IW5A 2P5VA 3ERMA 3IL2A 2DOAA 1ZR4A 1IN4A 4GCVA 1S7OA 3GTMJ 2VBWA 2HKXA 1BA5A 1YJ9I 4HX7A 2CJJA 2EZLA 3IKVA 2CV0A 1AWCA 3N97A 5EZHA 2V4JC 1BIAA 2FSWA 3BROA 1H0MA 1MJBA 1BI2A 3M07A 4B8XA 5K7FA 2ME0A 5EF6A 2GA1A 4HG2A 2IGKA 3D5SC 5HLIA 1ZG5A 2AXLA 5DM7F 4FT8A 1A6QA 3GFMA 2BBYA 5FLXZ 2WA0A 1R6RA 3ABLH 2CS3A 4XLAA 2W84A 5TISC 1TQIA 5DD4A 4KN7X 1WJFA 4KIFA 3KETA 3GTGJ 5FLMJ 4XLEA 4CCJA 5IT9Z 2CFOA 3KYLA 1ZH5A 4JP0A 2RGVA 1FWZA 2LNBA 4S04A 5ICEA 2QSFX 4PJLA 1FMWA 1Y8RB 1JJ6C 1T98A 2FUG2 2E2IJ 3RKYA 1YJNI 2FOKA 3HUGB 1SMYF 4C3IJ 4BH9A 3C1DA 4IHWA 1XGMA 2M9HA 1QZEA 1W4MA 4UUSB 4L0ZB 1OR7A 3ASNH 3VWBA 1WGXA 4UVAA 2VE8A 1LDDA 5FO5A 4ZYEA 1SAXA 4UV9A 3HXLA 2EV6A 3UKGA 3ZMSA 4WWCA 4I2OA 1J75A 2E2HJ 4A3EJ 3IAS2 2OD5A 3WTSC 3DBRB 3NQOA 2A5YB 3OIPA 4JX5A 5GTHC 1OCRH 2ZMEB 2AXTC 4PFPA 2IGNA 4IRIA 2W24A 3K70D 3G4SI 3Q5FA 3VOEA 4A3DJ 1RNLA 1WQ2A 4LG3A 3PIPF 1IDZA 1DQUA 1XPXA 2HOTA 4JX6A 4M6YA 1FYLA 3ZGKA 2IS2A 3CMYA 3DV8A 1UELB 3IWFA 4ESBA 5IP7J 4I01A 4NQWA 1REPC 4F52A 1KQ8A 3E5UA 2J5OA 1JT0A 1MJ9A 2CW0F 3ECOA 1Y1VJ 3M8JA 2JK3A 4G8XA 3V8KA 2K40A 2KZVA 3ZN0A 4G6QA 3AL0B 1TWHJ 2FD5A 4CZCA 5L3EA 2ADUA 3CMMA 1S5LC 1Y0NA 2R7VA 5C3EJ 4BXFA 3LMMA 1IN8A 2R7OA 3TOAA 3DEUA 2LH9A 4BUPA 2W7NA 3BZCA 3ZQHA 4B3AA 3MKWB 3V7RA 3FXLA 3Q9SA 2HDDA 2QSHX 5FRMA 1LEAA 3WE2A 2FNAA 3A03A 2VE9A 3QOPA 1W7PA 3SZGA 2DA1A 4J01A 2GXBA 1QNTA 1OQYA 4F3QA 1IRGA 1ORKA 3ZQGA 1MBFA 2K3PA 4PJMA 3KP7A 1YTYA 1A04A 2M34A 3H9QA 2G9WA 2FBHA 2BXZA 5AONA 4RAZA 1XB4A 4DOZA 3OYAA 2FRHA 1T8IA 1MSFC 2VUMJ 2V1XA 2DYSH 2HXIA 3KE2A 2H09A 3T8TA 3V7SA 2E1NA 3GTQJ 3K4CA 3GX4X 1ZAOA 3KLOA 1VQPI 2XPWA 4LGWA 5BQTA 1VQ7I 3L2UA 1UG0A 3QPSA 4I98B 1B59A 2DOFA 2E1CA 3CUQA 1XD7A 4MTEA 1U78A 2XAHA 1B4AA 1BL0A 1OMIA 3HRMA 5LRRA 3AKZA 4A3GJ 4ABZA 3VEPA 2FEZA 2RQPA 2BY3A 1UHSA 2D2WA 3B73A 4ZTJA 3GCMA 4DYCA 2QQ9A 3TP3A 4O3MA 2VKHA 2V6CA 2M1BA 1HC8A 3FM3A 3GTLJ 2CV1A 1QU3A 3FKJA 5JFRA 3JCUC 2CH0A 1FSEA 3B6AA 4LMYA 4LK0F 5HDGA 3LFUA 4EMSA 1J0RA 5J8CA 3W6VA 3F0CA 4FTHA 4Y52J 5F1JA 1VQ5I 3FDYA 1RETA 2V7FA 3EUHC 2PX9A 3K2ZA 3LQQA 4RAGA 4AD9A 3EETA 3OYLA 1VFCA 2VONA 4E7HA 4RDUA 3ULQB 2OZ6A 3KZYA 1ETVA 3IWZA 3ZN1A 1HKTA 1KONA 3L2WA 2E36A 3DF8A 4AYBN 3BY6A 2GZWA 1W5TA 2ZSIB 1PUFA 5KK1A 4WK8F 2M7AA 2P6TA 2CG4A 2LBFA 1BC8C 5ICCA 4D5FA 2MBFA 3OS0A 5E3LA 2F4MB 3DPTA 4EATA 2W1OA 4M6XA 1Y1WJ 3AFHA 2EV0A 4DIQA 1YS7A 4Q5SF 4DJAA 5ED4A 4M3BA 3TQNA 3ASOH 3HHGA 4C3HJ 1DPRA 1R9TJ 3L2CA 2EILH 4IF4A 4P55A 4XKCA 3EPZA 1Y56A 1FT9A 3CCJI 1MMDA 2UXNA 1HOMA 2PMHA 4YEJA 3EQLF 3WTXC 3RDIA 3Q3SA 3QYBA 2VB6A 3W2WA 1SD4A 3X2QH 4FISA 2R7XA 4G7HF 3ZQIA 2MC4A 3DKWA 2VJ5A 4RB1A 5FKOA 3HYIA 5DCFA 1K6OA 2EK5A 3AG4H 3DU5A 3M8FA 1B8IB 3HOWJ 3LSGA 2GXAA 4XSZF 3CP8A 3FMRA 2DT7B 2DO7A 2DA7A 2EZHA 4XONA 1OISA 2K4BA 2E1MB 5E1ZB 3E7LA 2LR8A 4M71A 1Z1DA 3TMOA 3GLXA 3HRUA 3E1SA 2HQNA 3L09A 4OAYA 4X1EA 1POGA 3NEUA 3ZOBA 1F43A 2GLOA 4LLNA 3H36A 2KP6A 4I76A 1G3WA 3KYCB 1Z7LA 2LRDA 4BL0B 2OTLI 1N25A 4Z2YA 2M2EA 5M5XJ 4RB2C 4QLCU 3FHZA 4XKWA 1JE8A 6PAXA 5FKKA 1H89C 2LY2A 3I3LA 5J3LA 3CDIA 4ZTFA 1KYZA 4A6DA 4F93B 1OCPA 5CLSA 2FF4A 1BBYA 3DKXA 2KLOA 4HNVA 2CQ7A 3BQZA 4L18B 2RNGA 5DYMA 2CFXA 5EZGA 2WAEA 1CF7A 1XDSA 2OU2A 1NG6A 1HKQA 4MTDA 2X6WA 1EV7A 2DYRH 4HX4A 3G2BA 3ZMUA 2LY9A 1WWXA 3E97A 3JTHA 2CSOA 3H5AA 4XQFA 1IAWA 2IPQX 2F48A 1VQNI 2R5ZB 3W6KB 5DUIA 4BE0A 1O3TA 4DZJA 4IJAA 3RI4A 3ECHA 2O5RA 2FQ3A 1QA6A 1FP1D 2NOJB 3K1MA 4WXDA 2R5YA 4ENMA 2FBIA 3ISPA 3MKYB 2WB1A 4AC0A 5ICGA 3ZMZA 3L2RA 3F8NA 2K5CA 1RC9A 4CHUA 3RYRA 1WRJA 3LSHA 2L5QA 1D5YA 1R58A 2HOEA 4I7HA 2JSPA 2VT2A 2Y75A 2BXYA 2BVMA 4QSHA 1OCOH 3WODF 1OCZH 2HDWA 1I6XA 3DEWA 2JA8J 3R0AA 1W7PD 1EF4A 2MW8A 4G9YA 2K3FA 1RPWA 3LSTA 4B4CA 4EM2A 5IP6A 2QVOA 3GEZA 1B9MA 3E6DA 5EDNA 2LMDA 1SVMA 4G94A 1S9HA 1J5YA 1WCMJ 4BQNA 4KYWA 1ETOA 2LG4A 3E5QA 3IC7A 5L3GA 1DGRM 2EPFA 1UHWA 2Z3YA 2D1VA 3BPXA 3BOQA 4PJJA 2OJED 4RA2A 3BCAA 4UB6C 4CXFA 1MW7A 1ZR2A 2XROA 1VQKI 1QPIA 3CESA 3OYDA 1Q1HA 4A0XA 3G1OA 2L54A 4F92B 2NNYA 4XLHA 1E17A 2X9DA 2QYOA 2DJNA 2DA6A 4F91B 5K5QA 3CC7I 3K4MA 4CYCA 4BHBA 3S1NJ 3PUBA 4RGXA 3F22A 3KZZA 3CUQC 4AIJA 1I1SA 3V8LA 2VXZA 2X6YA 3KCCA 2ECBA 1TW2A 2DA3A 4UHTA 4PSXA 2O0YA 2QA4I 3QU3A 4ZYDA 4IHYA 4RBOA 2Z99A 4U88A 2EFPA 2L3DA 4XOPA 3TBIA 1YIJI 4UXNA 4ZJZA 4J00A 3H1CA 3CDLA 3KYDB 4CA0A 1X58A 5IPAA 1H9GA 3ZQQA 2Z5UA 3A4CA 1LE8A 4IQ4A 4Y4RA 2FXAA 2V79A 4M9SA 4AWXB 4BY7J 2YR2A 2JA5J 4HPQA 2YUSA 3ABKH 5HS7A 2GIZA 2DXIA 4IHXA 2DFFA 4RAFA 2A5WA 3FBIB 3HBLA 3PFYA 3U21A 4IOAF 3CUOA 4FX4A 1F4KA 1GLNA 1MJAA 4MO7A 5J1UA 2H27A 3QODA 1MDMB 2XAUA 1U3EM 5B5EC 4I0BA 1P6RA 4NBQA 2DT5A 4GO1A 4BHCA 4PGGA 5IYBJ 3BLYA 3OIOA 2O7OA 1LDKB 2RREA 2DA2A 1U0JA 3CD6I 1Q1VA 3ONQA 3PO2J 2IGMA 3S3MA 3QPLA 2A6HF 2MFZA 1X1BA 5DCMA 3H0GJ 2IS6A 3BJOA 3JW4A 2VN2A 5HODA 1DU0A 1FC3A 3HC7A 1TQMA 4BBRJ 3I4MJ 3I58A 2GQQA 1FOKA 1P4WA 2NS0A 4XLPF 1FOWA 4H4KC 3I54A 4A2UA 3CO6C 2MA3A 5EYRA 3HGGA 1Z9CA 2BW3A 4ZC3A 1D0ZA 3QRFF 1HKSA 2KRFA 3C2GA 2Y9YA 3H3VK 4IO9F 1DDNA 3DPUA 1RIOH 1FP2A 1ZTRA 1FOYA 3HB9A 4P96A 4A3IJ 4I0AA 3I55I 1R36A 2MG4A 2QUFA 3HKZA 1I3QJ 1KQ9A 3HPHA 3ABUA 5EEHA 5LGUA 3CCEI 4XL9A 2P0WA 4HA8A 5FKNA 2Q8KA 1IRXA 2PFBA 3R60A 5M5WJ 3QU6A 2EIJH 2IAIA 2YX4A 4A3FJ 4WXHA 2PG4A 4IQJA 1XCVA 1R5HA 2XF6A 5CVUA 4DGWB 5FD6A 5HLTA 2KPMA 4OIPF 3TW7A 5C44J 4C2UA 2XGDA 2YSRA 5E8GA 1IXSB 4Y33A 3HOXJ 1KGSA 4FCYA 3H5RA 5F04A 3IH4A 3VFZA 1IXCA 2GM4A 4YFKF 2F5EA 2BGCA 4XR6A 5FFXA 1TT0A 4UVCA 1E3OC 3C7JA 3IH3A 3PNTA 1IN6A 2VPLA 1EKEA 2HVQA 3J80K 4DBQA 2GAUA 3KPHA 4QPQA 3MAJA 1RI7A 3F9KA 4HLYA 1NK2P 3EYIA 4YFXF 2Z33A 4G7OF 3J7AO 2BYVE 3I59B 1RR7A 3OL4A 1X1DA 2XUBA 4L5JA 2IA1A 2LY1A 3GLLA 4BDZA 1ZG1A 2A07F 2Z2SB 3ZQFA 4UNOA 2EZKA 1S7AA 2L9RA 1ZG3A 4CCNA 2ZCWA 1UHMA 1X2MA 1XSVA 2MH2A 2FJ1A 3IKTA 1YX3A 3JREA 1NHAA 1HSTA 3HPGA 4ESFA 3BG6A 1SD6A 1BIBA 2L7MP 4EGYA 4CGZA 3CQZJ 5M3FJ 1R4MB 2X85A 2M4KA 2AS5F 3OR1C 2WTEA 3J7ZI 1C0WA 4BU2A 1Z6TA 2F5DA 1FMVA 3GVAA 1X4OA 1SEUA 2JA7J 1BW5A 4BQOA 3BR0A 3CCVI 1FJLA 1XMKA 2JJ7A 3LSMA 2P7CB 2VBXA 1JHHA 2ZJPF 5IOYA 2FMLA 4K2EA 4U7BA 2TCTA 3OMYA 1LB2A 3BG5A 2VQGA 1GHCA 1KYWA 2L7ZA 4RS8A 4LLLA 1KU3A 3BCBA 2RAEA 1ENHA 2HWVA 1YRNA 4BQAA 5J8FA 2EFOA 2Q2EA 3QP6A 1MIJA 2M7BA 2HPIA 3GFLA 1MNDA 1ZRDA 1IUYA 2JRMA 2X0LA 4A0ZA 2NOGA 2ESHA 5AIPA 3PJRA 4XRSA 2QKMB 1MMAA 5F27A 2CQNA 4GFBA 3HUGA 5GPCA 5K5RA 3OYJA 1TC3C 3F21A 2Q0OA 3R6SA 2YPRA 4ZDPA 2D1HA 2GIVA 3BC8A 5JI6A 1ODDA 1ACIA 3TEDA 1XS9A 2OF7A 2YU9J 4P1WA 3F72A 2IXSA 3CMAI 3BG7A 1QZYA 1YE9A 1QGPA 3U9GA 1E0EA 3RIRA 2JUCA 3NAUA 4LOCA 2O9LA 2OQRA 3KEQA 1V3FA 3LFKA 4XIDA 2CYYA 2PJRB 2FQ4A 2KDZA 1WSUA 5GTIC 1O7LA 2ICWG 3PL8A 3IHUA 1J9IA 4XRMA 1K61A 2L7FP 3FKIJ 1CGPA 1B72B 2FX0A 3G1LA 2ELJA 1UG2A 3LAJA 4NC8A 1S8NA 1D8KA 2DDBA 1TW3A 4HAMA 2OBPA 4PSWA 3GTPJ 5FFZA 2OTJI 4F55A 3BZKA 1D1BA 2IT0A 4CDGA 3BZ6A 3H9JA 2IBDA 2EBIA 2MD5A 5J47A 3WG7H 1AOYA 3A0HC 1YOVB 1T0FA 2K9NA 2TRTA 2W00A 1A36A 4II3A 3FISA 3BTLA 1Z21A 1GV5A 3MFKA 3PIOF 3RCOA 2UV1A 2L01A 2XAGA 3B6CA 2MLGA 1YS6A 2E1OA 1LEBA 1W36D 4A5NA 2HZTA 1TNSA 1PP8F 3OSFA 3OWTA 1F36A 2M8EA 3ABTA 1EH6A 4U7DA 5H2FC 2HPMA 1XC5A 2QZ8A 1YG2A 2M0MA 3SXYA 4BJ5C 4FETA 2NVQJ 3CF5F 1I50J 4ZYHA 3IRQA 3LQRA 2PMZN 2WAQN 1WKMA 2A69F 3K70C 5BMZA 3TDUC 2IRFG 2NAZA 3FK6A 3N05A 5J6XA 1S7EA 2DK8A 1K83J 1JUSA 2QBYA 4Z6YA 3RJPA 3U2RA 2A61A 2MABA 4A0YA 4D7MA 1JKRC 3JAMK 2ZJ2A 5K1YA 1XX5A 1VI0A 4HOBA 1FX7A 4LJZF 1SVLA 2M5WA 3OYMA 4Q4ZF 2DU9A 2TDXA 1AU7A 3ZP5A 1HW5A 5DTDA 2V1DA 4HNTA 1W5SA 4C2MJ 2B9SA 3V7CA 2GOMA 1MMSA 3BPVA 2G7HA 4AU7A 3MEXA 1IF1A 1ERDA 2P5KA 5FKLA 1G3YA 2STTA 3GMEA 3CLQA 3JRGA 3K7AJ 2CUFA 2HFHA 2R7QA 4RAYA 3QYFA 1ETYA 3FHNA 3HOSA 2P6SA 4NQWB 4I99C 2V6EA 4BY1J 4KFCA 1GXPA 4PUSA 1R23A 5J4YA 2NRAC 3JTGA 5DUKA 3OL3A 4AYBA 1XMAA 3VYTB 1YJWI 3LAPA 2WY7Q 1DPUA 1OYWA 3ZR8X 3SQNA 3EDPA 3AG3H 3J81K 1G8XA 1GUUA 1OFCX 1YYVA 2KZGA 3HGYA 3HRTA 4XLFA 3SEQA 4GGGA 1BJAA 3K69A 4RGUA 1QPMA 2PJPA 3BJAA 4XNFA 3WU2C 2E34A 5C4XJ 2XRNA 3AG2H 3QAHA 4C3JJ 3JRDA 1IRFA 1FPQA 1LFUP 1U5TA 1PUEE 1P4XA 3FIWA 4BJ6C 5GPAA 4P5OA 3CJRB 2EA4A 3PNYA 1K78A 1JT6A 1KU2A 2F2EA 4A3BJ 4AIKA 3Q9VA 2BY0A 2KRCA 3LSJA 2LLKA 3OR2C 2L02A 1DGWY 4XICA 1G59A 2ZXWH 3IAM2 2I8DA 4UV8A 1ZGJA 3RYPA 1EA3A 2DI3A 2Y9ZA 1I6HJ 5EGOA 4A6EA 3O2PE 3CUQB 2F6CA 3SHFA 5EG0A 1FTTA 5JHFA 4UB8C 1FOXA 2ZJQF 1YIOA 1EH7A 2KQRA 3KP2A 5HNFA 3L2QA 4FX0A 3M3YJ 1G6NA 4QTRA 2CUEA 3S2HJ 2HKOA 2V9VA 4HSRA 1HSJA 2ME6A 1GT0C 2WV1A 4ZDLA 1B8IA 2K27A 1HCRA 5HLHA 2M4GA 5FRNA 3SYTA 1Z6RA 5B66C 3AAFA 2EIKH 3NARA 3CJTB 4MQ9F 4E7KA 5LHGA 2O8XA 3V4GA 5FROA 2XGEA 3R4KA 1HF0A 1B6AA 1IZ1A 2OQGA 4LIVA 1X19A 2H8WA 1KQ0A 1F1ZA 3CJNA 1OKRA 3M1CA 2K9SA 2H6CA 1IRZA 2V26A 3HTSB 3FXJA 2FNPA 4YIFA 4W97A 1UZCA 5F6FA 3S16J 5A2QZ 2K9QA 2JQ7A 2CGPA 3BG9A 1HQCA 1MH4A 1TL8A 1D5VA 5AIQA 3KLNA 3VODA 2DQRA 1T6SA 2LDUA 4A3LJ 1PUFB 5GADJ 3CCRI 1JUPA 1UJ8A 2BVLA 4UVBA 2KT0A 2ESNA 1OLTA 3HSEA 5CYVA 3ZQLA 2KL4A 2CUJA 3BWGA 3KFWX 4PFOA 4XSXF 3QPHA 5IYCJ 4BBSJ 2MLKA 2M30A 1Z91A 3OYBA 1U9NA 2R7FA 3WGIA 4MHGA 3SJMA 2O3FA 1O57A 2A68F 2XVCA 4RB0A 5GAGJ 1ZARA 2R5ZA 1WH5A 3K4NA 4ZYAA 1ZGWA 3L2VA 3NWSA 2RV8A 1A6IA 2COBA 1O3QA 2XF7A 1XGNA 3T5XA 3OIQA 3P9CA 3WE3A 5LFAA 5D5WB 3WTVC 4HF1A 2R7UA 4AVZA 2CWEA 3DKYA 3CMEI 1T56A 2PBIA 4M72A 3H3UA 2HOSA 1FIPA 1OR7C 4IOCF 2ZO4A 2DQLA 5E3MA 1Y39A 2IS1A 5IP9J 3I53A 5CJ9A 1N75A 4PJNA 4LG0A 3D5LA 1RKWA 3BR2A 1PYVA 4HBLA 2JRTA 3V42A 5DM6F 3RZDJ 1LDJA 3DFGA 5FLXK 1QRYA 4O5VA 1YW8A 3IV5A 3REOA 2HTSA 4A5MA 5IT9K 5FJ8J 1V4RA 2DT6A 3WTUC 1RUNA 2XAJA 1JGSA 1FBSA 1LNWA 2M0CA 3SEZA 1ETXA 1T2KA 3MKZA 2CV2A 2LD5A 2E5ZA 2A6EF 5EJCA 2BEOA 4V19K 4WCGA 3GZ6A 2BY2A 2Y0SN 3BTIA 1J2XA 3TL4X 1ZLKA 1G4DA 3HOUJ 3VSLA 4G6TB 2QENA 2DCEA 1TNTA 5JVTA 2FMYA 4MLOA 5ILUA 5EEAA 3G71I 3ERED 2XPUA 5H6QA 1CF7B 1KU9A 2KFDA 1G3SA 2K9LA 2ETHA 2BV6A 1HDPA 3K10A 4NC7A 4OINF 4CCKA 1WJCA 4B44A 1XGOA 3EUAA 5DD8A 1E2XA 4L9JA 1W0UA 1O3RA 1IV6A 2RQQA 1SC7A 3GBGA 2DW4A 5FKMA 1X3UA 3TP0A 2XKOA 3OYNA 3KX2A 4RGSA 2M87A 1E3PA 3P9KA 5BS6A 1YLFA 2VC1A 4L9VA 1IGNA 2CQKA 1Z3XA 3DCFA 4Q48A 5IT3A 3P5JA 1OYYA 4BXXJ 5M3MJ 3K4KA 4X0GA 1XCBA 3E5XA 2O8KA 2JVHA 1FIAA 4UY8I 3GYHX 2X6XA 3S93A 3QQAA 4NC6A 1UAAA 4BHPA 2VI6A 1WJ5A 3ZPLA 1WI3A 5KVRA 3FWEA 5DS9A 2H94A 4ZDOA 3SFZA 3LSIA 3OS1A 2HQRA 1TWAJ 1J09A 4ENJA 4GXOA 3F8MA 2L4MA 3LSKA 4CCMA 3OYIA 3FXKA 4RLFA 1APLC 1Y8QB 2HI3A 5F0HA 5E3NA 4OMZA 1RR8C 1B9NA 1QQIA 3H92A 3RQ4A 4CICA 2JN6A 1LVAA 5B1BH 2XSDC 1WZ2A 3C18A 3HSRA 3HZJA 3M8EA 4O6JA 4YELA 4D5CA 3GFJA 3JRIA 3FXRA 3LL7A 2CQQA 9ANTA 1SFOJ 3MCZA 1WPKA 2I10A 1U5TC 3C3WA 5KAFC 1WHUA 2NYXA 2BZTA 5JVGF 3LSRA 4MEXF 5HS9A 3RPQA 5LBQA 4A3CJ 2L0KA 3GW2A 3K2AA 4M3GA 1AHDP 4ENNA 2ELHA 3Q0WA 1O4XA 5J1YA 5LHHA 3LA7A 1BN5A 1G3TA 2ZBKA 2KJCA 3I71A 3FXOA 3A01A 1NG7A 2PLYA 2E2JJ 4PGHA 1V55H 2XHKA 2ZC2A 2FU4A 4M73A 2JVGA 3M4OJ 4A12A 4BACA 4BDYA 4EQQA 4J19A 5E17F 3IP4B 1R22A 3WTZA 4NUBA 2QKLB 4PCQA 4BYYA 2COMA 2YU3A 2GWRA 3CJQB 1XG1A 2VBYA 3HSFA 3LWFA 4BNCA 5HNHA 4OAZA 2LVSA 5EEGA 3FZVA 3WTWC 3L7WA 1ZLJA 2HQ5A 4BQQA 3DEEA 3I4NJ 3P9IA 1OCTC 4EJTA 1IN7A 5IYDJ 2CW8A 4HQMA 4HZFA 2E7XA 1LE8B 4IKFA 1K6YA 4U0YA 4M6VA 3CF2A 2XAFA 3CDHA 2CRGA 4XRFA 3GFIA 1D0YA 1P7JA 1GVDA 2EINH 2IVMA 2ISYA 1XMXA 2W82A 4RM3A 2DMPA 2O61A 3OYFA 2A6TA 2H1LA 4YRVA 4BEHA 1SANA 4H0EA 2L9SA 3G1MA 3WHBA 5HVQC 3A02A 3CCQI 1WJBA 2DAOA 3HIFA 2HU9A 3FM5A 5J4VA 4L9TA 3BTJA 4KIBA 1UMQA 2KMUA 4KA4A 5D4SA 1PP7U 1DP3A 2LSOA 2X6OA 1OPCA 3OYEA 4IRHA 5D4RA 4E7LA 5M5YJ 5FGMA 3MWMA 3DXJF 3VB2A 1JJ8C 3S17J 1JKOC 4YG2F 1HBXG 2G0EA 2M45A 3HL2A 3ML6A 3JRCA 2DFIA 1IO2A 4DW6A 4DBRA 2H1KA 5CVRA 1U2WA 3PUFA 3LA2A 2D5VA 5F08A 3CCUI 1TQPA 3S2WA 2JT1A 3HEFA 3T8RA 3CP2A 4FE7A 3I0TA 3ZCOA 1QHHD 4M3DA 3PQKA 1I1GA 3I64A 4CYDA 2EWNA 2VJJA 4HYEA 1SD5A 2OA4A 2X1DA 2STWA 2BW3B 2Y48A 2XV4S 2G7UA 3W2VA 4JOMA 2X1CA 1S29A 4YIIA 3GF2A 2NS7A 2EV5A 1AKHA 2WWYA 4XLNF 2EQRA 3M9AA 3WTYC 3A0BC 2MC3A 3MVPA 1R5ID 4ANJA 3J7YJ 2DN0A 4AM3A 2HOAA 2OC6A 2DK5A 3H35A 5E1XA 4D0PA 3CZ6A 4P9FA 5D8KB 2HTJA 3G73A 1L3LA 1K7AA 4A93J 1MD0A 1NH3A 4KUMA 5DDGA 2KIMA 3I5UA 2EH3A 2OUMA 4XRSG 1UB9A 2JUGA 5J40A 3KZIC 2HNHA 3HM5A 4NNJA 2DMUA 2CQXA 1YITI 4G7ZF 5L3BA 1ZELA 3WTTC 4AUXA 2OV7A 1MH3A 1BJZA 4HF2A 1TBXA 1SD7A 2R7ZJ 1ZK8A 3ZQ7A 3V8JA 4ITVA 3LNQA 4I09A 1U9OA 2Y30A 1MSEC 4RM2A 2W85A 3MMYB 3BG3A 3E6MA 4ZZLA 2EFWA 3MZHA 2NVUB 2EIMH 1R1UA 3UNGC 5LEKA 4LK1F 1GV2A 3DBHB 2HDCA 3JRHA 4UUTA 3VSKA 1WJAA 2LF8A 3HG9A 4LB5A 2I5UA 4CUGA 1YO5C 3QOEA 3KP5A 5ILVA 3WHCA 4ZYGA 3WGHA 3SZTA 1MBGA 4A3MJ 4FASD 1A31A 4EV0A 2R4GA 1KZHA 4KITB 4IZZA 2ZSHB 2PJRA 3HOZJ 2MSYA 2LP0A 3H3ZA 3MD2A 4F7ZA 5E8IA 3M1EA 4KICA 2XAQA 4MFEA 2E7WA 2Y0MA 4YIRX 3C2BA 4QIWN 1TWGJ 4Y13A 5CVIA 1WH7A 1WJEA 4I6ZA 2M3AA 4UUSA 3IUOA 3TO7A 3SDBA 2V9KA 1P7IA 4OWRB 3ROUA 3E6BA 4B3XA 1FBUA 3DTKA 1ONVA 1V5FA 1FZPB 1ZRCA 2KKOA 4B47A 1V5GA 4NHJA 2O6GE 2X1EA 3U1DA 1RESA 2BOLA 3U1KA 2Y2ZA 2EZIA 3DP7A 4LFUA 4N9HA 2XB0X 2ZMEA 2XC7A 2PMZA 2WAQA 4JBAA 5F1RA 4N4OB 3CLOA 1XDUA 2FBKA 2YX7A 1TWCJ 4HV6A 3TO6A 2EFQA 5F0FA 2R7TA 4DNCA 1JUMA 1WJDA 1IC8A 1ON2A 2QM3A 2R7DA 1PVEA 4A69C 3KIOA 5K5OA 1TLHB 2KIUA 2XDVA 3G6EI 4L9NA 3CC2I 1X2NA 1MNEA 1YRNB 2FA5A 4EM0B 3JRAA 2Q2EB 5D5VB 1VQ9I 1BC7C 4N9IA 1SFKA 2H6BA 3JSPA 1HDDC 2W48A 5CVVA 2E35A 1K4TA 2XSJC 2NVXJ 1MMNA 4ZH4F 3HJEA 1VTNC 2L4AA 4IHVA 3OYGA 2XPVA 2PN6A 3JSOA 2LOOA 1LPQA 4NDLA 2P7VB 2UXXA 5LD2C 3JR9A 3RKQA 5HDKA 5ILSA 2ZJRF 3KP4A 4LB6B
chains in the Genus database with same CATH topology
1B8IA 3RQIA 1HCRA 1ZR2A 4XK4A 1QPIA 1VNDA 1MBHA 3G1OA 5J1RA 3NARA 2ZB9A 2X9DA 2XGEA 2DJNA 2DMTA 2DA6A 5BNGA 1HF0A 4DYQA 4CYCA 1IJWC 2K9SA 3S1NJ 3S1RJ 1IRZA 1IDYA 4A3KJ 4W97A 4Y7NJ 2E19A 3S16J 1T33A 2K9QA 3BG9A 1NTCA 1Z77A 4B1RA 1H8AC 1CQTA 1MH4A 5JLWA 3OOUA 4L5EA 2ECBA 3HDDA 2DA3A 2LFBA 3HKZN 4A3LJ 4IHYA 4RBOA 1PUFB 1RKTA 1JUPA 2XGCA 2ID6A 3FK7A 2KT0A 3ZQLA 4V2FA 1LFBA 1ZQ3P 5IYCJ 4BBSJ 3CDLA 3BR1A 1X58A 5IPAA 3LSPA 2JA6J 1U9NA 2DMNA 2N8GA 1LE8A 3SJMA 3IH2A 2JA5J 4BY7J 2YUSA 4G12A 5F0CA 2R5ZA 1AKHB 1WH5A 1ZGWA 4IHXA 3OSGA 3BR5A 2LTPA 4EEFG 3HBLA 4A3JJ 2CU7A 1A6IA 2COBA 4D7NA 3MN2A 5E3OA 3O8HA 3S15J 4MO7A 1FEXA 5J1UA 5K7ZA 2HOSA 5FLVA 1T56A 2GBYA 1FIPA 4JX4A 1ETKA 3MKLA 3BR3A 5E3MA 1B72A 5IP9J 5IYBJ 3OIOA 1MBJA 2O7OA 1ZR4A 2DA2A 1OJLA 1Q1VA 1RKWA 3BR2A 3GTMJ 3PO2J 3QPLA 1BA5A 2CJJA 3RZDJ 2EZLA 2HXOA 3H0GJ 5IOZA 1QRYA 5EZHA 3IV5A 5HODA 1DU0A 2X48A 4BBRJ 5K7FA 3I4MJ 2ME0A 5FJ8J 5EF6A 2M0CA 1A5JA 1ETXA 2R0QC 5EYRA 2VKVA 3HGGA 2B63J 2LD5A 1JKQC 2Y9YA 3GTGJ 3H3VK 5FLMJ 2Y0SN 3GTOJ 3BTIA 4JP0A 3SFIA 4IEJA 3HOUJ 1ZTRA 4M3EA 3HB9A 2QCOA 3L1PA 4A3IJ 1JJ6C 2MG4A 4MLOA 5EEAA 1I3QJ 3BTCA 2E2IJ 2XPUA 5FKNA 4DZPA 5M5WJ 1HDPA 2IAIA 4C3IJ 2JMWA 4A3FJ 4IHWA 3CCYA 2M9HA 2DA5A 4UUSB 1G2HA 1WGXA 1W0UA 1IV6A 3TW7A 3GBGA 5C44J 3UKGA 2XGDA 5FKMA 3TP0A 3Q0UA 3HOXJ 2E2HJ 4FCYA 5K7HA 4A3EJ 5F04A 3S2DJ 3IH4A 4JX5A 2GM4A 1IGNA 3DCFA 1E3OC 4BKXA 4BXXJ 5M3MJ 2O8KA 3IH3A 4A3DJ 1IDZA 1FIAA 2HOTA 3QQAA 1U8BA 4JX6A 2VI6A 1WI3A 5DS9A 1JTXA 3CMYA 1NK2P 2LKXA 5IP7J 1TWAJ 1RR7A 5EGOB 2M8GX 1ETWA 2VKEA 2DTZA 1JT0A 1APLC 5E3NA 1Y1VJ 2HI3A 5F0HA 1IUFA 2JK3A 3ZQFA 5EG0B 2EZKA 2K40A 2JN6A 2L9RA 2XSDC 3JRIA 1TWHJ 2FD5A 4D5CA 2CQQA 9ANTA 1X2MA 2FJ1A 1SFOJ 5C3EJ 3JREA 2NS8A 1WPKA 1ZKGA 2I10A 2L7MP 3ZQHA 3CQZJ 4B3AA 5M3FJ 1DU6A 2Y31A 3BR6A 2AO9A 3LSRA 2HDDA 4MFDA 4A3CJ 2L0KA 3K2AA 4M3GA 1AHDP 3A03A 3Q0WA 2DA1A 1O4XA 2JA7J 5J1YA 2DA4A 2ID3A 3PM1A 3PO3J 1BW5A 1ORKA 3A01A 3BR0A 3ZQGA 1MBFA 3HOYJ 2E2JJ 3BT9A 1FJLA 2JJ7A 1QVTA 5C4JJ 2M34A 1JKPC 5IOYA 3M4OJ 2TCTA 3BG5A 2AHQA 4FE4A 4J19A 1MSFC 2R93J 2VUMJ 2L7ZA 2HXIA 3GTKJ 1NK3P 2RAEA 3GTQJ 1ENHA 1YRNA 2XPWA 1XG1A 3QPSA 2LVSA 1U78A 1MBKA 1BL0A 2HQ5A 4A3GJ 4ABZA 3I4NJ 2NOGA 1OCTC 3VPRA 2ECCA 4XRSA 5F27A 5IYDJ 1UHSA 4GFBA 4DYCA 5GPCA 1LE8B 1TC3C 4V2GA 3TP3A 1W0TA 4M6VA 2CRGA 3GTLJ 1P7JA 1ITYA 1GVDA 2JWTA 3TEDA 1XS9A 2OF7A 2YU9J 3B6AA 2DMPA 2LK2A 3O8GA 3ZQCA 1SANA 4LOCA 3G1MA 3NAUA 3WHBA 3F0CA 4FTHA 2O9LA 3W6VA 3A02A 5F1JA 4Y52J 4MIMA 4XIDA 1RETA 1JTYA 2FQ4A 2XRLA 2KDZA 3S1MJ 3BTJA 1Z0XA 1UMQA 4XRMA 2L7FP 1K61A 3FKIJ 1B72B 2FX0A 3G1LA 2X6OA 1UG2A 5M5YJ 1VFCA 3GTPJ 3HOVJ 3S17J 1JJ8C 1JKOC 5GP9A 4RDUA 2G0EA 1ETVA 3JRCA 4JYKA 4DW6A 2H1KA 2IBDA 2EBIA 1IG7A 2D5VA 5F08A 1FTZA 4AYBN 1ETQA 2K9NA 2TRTA 1PUFA 3LOCA 3FISA 3BTLA 3HEFA 1GV5A 4D5FA 4FE7A 5E3LA 2R5YB 3B6CA 4M3DA 2E1OA 2VPRA 1Y1WJ 1MNMC 3OSFA 3JRBA 1F36A 4M3BA 4C3HJ 1R9TJ 3S1QJ 1XC5A 2NS7A 1AKHA 2EQRA 3MVPA 2NVQJ 2HYJA 2DN0A 1JGGA 1HOMA 2HOAA 2ELKA 3TW6A 1I50J 2WB1N 1BW6A 2PMZN 2MGQA 2WAQN 3Q3SA 4A93J 3FK6A 4FISA 2EH3A 2NVYJ 1S7EA 1GDTA 4XRSG 1K83J 1JUSA 3ZQIA 3HM5A 2DMUA 2CQXA 5FKOA 2P81A 4AUXA 1MH3A 1B8IB 3HOWJ 1BJZA 3LSGA 4D7MA 1JKRC 2R7ZJ 1ZK8A 1VI0A 2DA7A 2EZHA 3LNQA 1AU7A 3E7LA 1U9OA 2Y30A 1MSEC 2LR8A 3BG3A 2YS9A 5DTDA 1H88C 4C2MJ 2OPTA 2R92J 4W1UA 4X1EA 1POGA 3ZOBA 1GV2A 1F43A 2GLOA 5FKLA 3JRHA 4CYCB 4I76A 3JRGA 4UUTA 3K7AJ 2CUFA 2M2EA 5M5XJ 3BQYA 1VF9A 3D1NI 5FKKA 1ETYA 3JRFA 1H89C 3WHCA 5J3LA 1MBGA 1QVUA 4BY1J 3SDGA 4A3MJ 2XB5A 1OCPA 3HOZJ 4X6AJ 2MSYA 4HNVA 2LP0A 3BQZA 3GTJJ 5EZGA 4MFEA 1GUUA 1OFCX 3C2BA 3HGYA 1TWGJ 4QIWN 1WH7A 2LY9A 4I6ZA 4UUSA 2R5ZB 1P7IA 4DZJA 2IEKA 5C4XJ 1MBEA 4C3JJ 3JRDA 3Q0VA 2DMQA 1RESA 1LFUP 2Y2ZA 2EZIA 3FIWA 2R5YA 2XB0X 3A01B 4AC0A 5GPAA 4S0HB 1TWCJ 2QF7A 5F0FA 1JT6A 4A3BJ 1JUMA 1IC8A 1D5YA 3LSJA 4A69C 2LLKA 4QSHA 2NVTJ 4XICA 1X2NA 3DEWA 2JA8J 3S14J 1YRNB 1EF4A 1I6HJ 3JRAA 2MW8A 2Y9ZA 5EGOA 4DYRA 1RPWA 1HDDC 2W48A 1TWFJ 4B4CA 5IP6A 4M3FA 2NVXJ 5EG0A 5EDNA 1FTTA 2H8RA 1WCMJ 1HLVA 4IHVA 3RZOJ 1ETOA 2XPVA 3M3YJ 4NDLA 4QTRA 2CUEA 3S2HJ 3JR9A 3RKQA 5JLXA 2ME6A 1GT0C 2WV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B8I A;  3RQI A;  1HCR A;  1ZR2 A;  4XK4 A;  1QPI A;  1VND A;  1MBH A;  3G1O A;  5J1R A;  3NAR A;  2ZB9 A;  2X9D A;  2XGE A;  2DJN A;  2DMT A;  2DA6 A;  5BNG A;  1HF0 A;  4DYQ A;  4CYC A;  1IJW C;  2K9S A;  3S1N J;  3S1R J;  1IRZ A;  1IDY A;  4A3K J;  4W97 A;  4Y7N J;  2E19 A;  3S16 J;  1T33 A;  2K9Q A;  3BG9 A;  1NTC A;  1Z77 A;  4B1R A;  1H8A C;  1CQT A;  1MH4 A;  5JLW A;  3OOU A;  4L5E A;  2ECB A;  3HDD A;  2DA3 A;  2LFB A;  3HKZ N;  4A3L J;  4IHY A;  4RBO A;  1PUF B;  1RKT A;  1JUP A;  2XGC A;  2ID6 A;  3FK7 A;  2KT0 A;  3ZQL A;  4V2F A;  1LFB A;  1ZQ3 P;  5IYC J;  4BBS J;  3CDL A;  3BR1 A;  1X58 A;  5IPA A;  3LSP A;  2JA6 J;  1U9N A;  2DMN A;  2N8G A;  1LE8 A;  3SJM A;  3IH2 A;  2JA5 J;  4BY7 J;  2YUS A;  4G12 A;  5F0C A;  2R5Z A;  1AKH B;  1WH5 A;  1ZGW A;  4IHX A;  3OSG A;  3BR5 A;  2LTP A;  4EEF G;  3HBL A;  4A3J J;  2CU7 A;  1A6I A;  2COB A;  4D7N A;  3MN2 A;  5E3O A;  3O8H A;  3S15 J;  4MO7 A;  1FEX A;  5J1U A;  5K7Z A;  2HOS A;  5FLV A;  1T56 A;  2GBY A;  1FIP A;  4JX4 A;  1ETK A;  3MKL A;  3BR3 A;  5E3M A;  1B72 A;  5IP9 J;  5IYB J;  3OIO A;  1MBJ A;  2O7O A;  1ZR4 A;  2DA2 A;  1OJL A;  1Q1V A;  1RKW A;  3BR2 A;  3GTM J;  3PO2 J;  3QPL A;  1BA5 A;  2CJJ A;  3RZD J;  2EZL A;  2HXO A;  3H0G J;  5IOZ A;  1QRY A;  5EZH A;  3IV5 A;  5HOD A;  1DU0 A;  2X48 A;  4BBR J;  5K7F A;  3I4M J;  2ME0 A;  5FJ8 J;  5EF6 A;  2M0C A;  1A5J A;  1ETX A;  2R0Q C;  5EYR A;  2VKV A;  3HGG A;  2B63 J;  2LD5 A;  1JKQ C;  2Y9Y A;  3GTG J;  3H3V K;  5FLM J;  2Y0S N;  3GTO J;  3BTI A;  4JP0 A;  3SFI A;  4IEJ A;  3HOU J;  1ZTR A;  4M3E A;  3HB9 A;  2QCO A;  3L1P A;  4A3I J;  1JJ6 C;  2MG4 A;  4MLO A;  5EEA A;  1I3Q J;  3BTC A;  2E2I J;  2XPU A;  5FKN A;  4DZP A;  5M5W J;  1HDP A;  2IAI A;  4C3I J;  2JMW A;  4A3F J;  4IHW A;  3CCY A;  2M9H A;  2DA5 A;  4UUS B;  1G2H A;  1WGX A;  1W0U A;  1IV6 A;  3TW7 A;  3GBG A;  5C44 J;  3UKG A;  2XGD A;  5FKM A;  3TP0 A;  3Q0U A;  3HOX J;  2E2H J;  4FCY A;  5K7H A;  4A3E J;  5F04 A;  3S2D J;  3IH4 A;  4JX5 A;  2GM4 A;  1IGN A;  3DCF A;  1E3O C;  4BKX A;  4BXX J;  5M3M J;  2O8K A;  3IH3 A;  4A3D J;  1IDZ A;  1FIA A;  2HOT A;  3QQA A;  1U8B A;  4JX6 A;  2VI6 A;  1WI3 A;  5DS9 A;  1JTX A;  3CMY A;  1NK2 P;  2LKX A;  5IP7 J;  1TWA J;  1RR7 A;  5EGO B;  2M8G X;  1ETW A;  2VKE A;  2DTZ A;  1JT0 A;  1APL C;  5E3N A;  1Y1V J;  2HI3 A;  5F0H A;  1IUF A;  2JK3 A;  3ZQF A;  5EG0 B;  2EZK A;  2K40 A;  2JN6 A;  2L9R A;  2XSD C;  3JRI A;  1TWH J;  2FD5 A;  4D5C A;  2CQQ A;  9ANT A;  1X2M A;  2FJ1 A;  1SFO J;  5C3E J;  3JRE A;  2NS8 A;  1WPK A;  1ZKG A;  2I10 A;  2L7M P;  3ZQH A;  3CQZ J;  4B3A A;  5M3F J;  1DU6 A;  2Y31 A;  3BR6 A;  2AO9 A;  3LSR A;  2HDD A;  4MFD A;  4A3C J;  2L0K A;  3K2A A;  4M3G A;  1AHD P;  3A03 A;  3Q0W A;  2DA1 A;  1O4X A;  2JA7 J;  5J1Y A;  2DA4 A;  2ID3 A;  3PM1 A;  3PO3 J;  1BW5 A;  1ORK A;  3A01 A;  3BR0 A;  3ZQG A;  1MBF A;  3HOY J;  2E2J J;  3BT9 A;  1FJL A;  2JJ7 A;  1QVT A;  5C4J J;  2M34 A;  1JKP C;  5IOY A;  3M4O J;  2TCT A;  3BG5 A;  2AHQ A;  4FE4 A;  4J19 A;  1MSF C;  2R93 J;  2VUM J;  2L7Z A;  2HXI A;  3GTK J;  1NK3 P;  2RAE A;  3GTQ J;  1ENH A;  1YRN A;  2XPW A;  1XG1 A;  3QPS A;  2LVS A;  1U78 A;  1MBK A;  1BL0 A;  2HQ5 A;  4A3G J;  4ABZ A;  3I4N J;  2NOG A;  1OCT C;  3VPR A;  2ECC A;  4XRS A;  5F27 A;  5IYD J;  1UHS A;  4GFB A;  4DYC A;  5GPC A;  1LE8 B;  1TC3 C;  4V2G A;  3TP3 A;  1W0T A;  4M6V A;  2CRG A;  3GTL J;  1P7J A;  1ITY A;  1GVD A;  2JWT A;  3TED A;  1XS9 A;  2OF7 A;  2YU9 J;  3B6A A;  2DMP A;  2LK2 A;  3O8G A;  3ZQC A;  1SAN A;  4LOC A;  3G1M A;  3NAU A;  3WHB A;  3F0C A;  4FTH A;  2O9L A;  3W6V A;  3A02 A;  5F1J A;  4Y52 J;  4MIM A;  4XID A;  1RET A;  1JTY A;  2FQ4 A;  2XRL A;  2KDZ A;  3S1M J;  3BTJ A;  1Z0X A;  1UMQ A;  4XRM A;  2L7F P;  1K61 A;  3FKI J;  1B72 B;  2FX0 A;  3G1L A;  2X6O A;  1UG2 A;  5M5Y J;  1VFC A;  3GTP J;  3HOV J;  3S17 J;  1JJ8 C;  1JKO C;  5GP9 A;  4RDU A;  2G0E A;  1ETV A;  3JRC A;  4JYK A;  4DW6 A;  2H1K A;  2IBD A;  2EBI A;  1IG7 A;  2D5V A;  5F08 A;  1FTZ A;  4AYB N;  1ETQ A;  2K9N A;  2TRT A;  1PUF A;  3LOC A;  3FIS A;  3BTL A;  3HEF A;  1GV5 A;  4D5F A;  4FE7 A;  5E3L A;  2R5Y B;  3B6C A;  4M3D A;  2E1O A;  2VPR A;  1Y1W J;  1MNM C;  3OSF A;  3JRB A;  1F36 A;  4M3B A;  4C3H J;  1R9T J;  3S1Q J;  1XC5 A;  2NS7 A;  1AKH A;  2EQR A;  3MVP A;  2NVQ J;  2HYJ A;  2DN0 A;  1JGG A;  1HOM A;  2HOA A;  2ELK A;  3TW6 A;  1I50 J;  2WB1 N;  1BW6 A;  2PMZ N;  2MGQ A;  2WAQ N;  3Q3S A;  4A93 J;  3FK6 A;  4FIS A;  2EH3 A;  2NVY J;  1S7E A;  1GDT A;  4XRS G;  1K83 J;  1JUS A;  3ZQI A;  3HM5 A;  2DMU A;  2CQX A;  5FKO A;  2P81 A;  4AUX A;  1MH3 A;  1B8I B;  3HOW J;  1BJZ A;  3LSG A;  4D7M A;  1JKR C;  2R7Z J;  1ZK8 A;  1VI0 A;  2DA7 A;  2EZH A;  3LNQ A;  1AU7 A;  3E7L A;  1U9O A;  2Y30 A;  1MSE C;  2LR8 A;  3BG3 A;  2YS9 A;  5DTD A;  1H88 C;  4C2M J;  2OPT A;  2R92 J;  4W1U A;  4X1E A;  1POG A;  3ZOB A;  1GV2 A;  1F43 A;  2GLO A;  5FKL A;  3JRH A;  4CYC B;  4I76 A;  3JRG A;  4UUT A;  3K7A J;  2CUF A;  2M2E A;  5M5X J;  3BQY A;  1VF9 A;  3D1N I;  5FKK A;  1ETY A;  3JRF A;  1H89 C;  3WHC A;  5J3L A;  1MBG A;  1QVU A;  4BY1 J;  3SDG A;  4A3M J;  2XB5 A;  1OCP A;  3HOZ J;  4X6A J;  2MSY A;  4HNV A;  2LP0 A;  3BQZ A;  3GTJ J;  5EZG A;  4MFE A;  1GUU A;  1OFC X;  3C2B A;  3HGY A;  1TWG J;  4QIW N;  1WH7 A;  2LY9 A;  4I6Z A;  4UUS A;  2R5Z B;  1P7I A;  4DZJ A;  2IEK A;  5C4X J;  1MBE A;  4C3J J;  3JRD A;  3Q0V A;  2DMQ A;  1RES A;  1LFU P;  2Y2Z A;  2EZI A;  3FIW A;  2R5Y A;  2XB0 X;  3A01 B;  4AC0 A;  5GPA A;  4S0H B;  1TWC J;  2QF7 A;  5F0F A;  1JT6 A;  4A3B J;  1JUM A;  1IC8 A;  1D5Y A;  3LSJ A;  4A69 C;  2LLK A;  4QSH A;  2NVT J;  4XIC A;  1X2N A;  3DEW A;  2JA8 J;  3S14 J;  1YRN B;  1EF4 A;  1I6H J;  3JRA A;  2MW8 A;  2Y9Z A;  5EGO A;  4DYR A;  1RPW A;  1HDD C;  2W48 A;  1TWF J;  4B4C A;  5IP6 A;  4M3F A;  2NVX J;  5EG0 A;  5EDN A;  1FTT A;  2H8R A;  1WCM J;  1HLV A;  4IHV A;  3RZO J;  1ETO A;  2XPV A;  3M3Y J;  4NDL A;  4QTR A;  2CUE A;  3S2H J;  3JR9 A;  3RKQ A;  5JLX A;  2ME6 A;  1GT0 C;  2WV1 A; 
#chains in the Genus database with same CATH topology
 3FMS A;  4II2 A;  2ZFW A;  1BI3 A;  2DDA A;  3ZMV A;  2WY8 Q;  2L9V A;  3HTU A;  2DPU A;  3TO9 A;  2IGO A;  1VND A;  2R3S A;  5J1R A;  4HF0 A;  3DLL F;  1VZ0 A;  3K4B A;  3VDX A;  1EJ9 A;  3ZMD A;  1SFE A;  2QWW A;  2DMT A;  2QQB A;  4D1Q A;  1W36 C;  2VBZ A;  3FF5 A;  5BNG A;  4XMY A;  1IW7 F;  2J5P A;  1BI0 A;  1LVK A;  1YHQ I;  2A3S A;  2Z9O A;  4LIU A;  2CUZ A;  3MQ0 A;  1IDY A;  2OCE A;  3OOP A;  3R61 A;  2DFH A;  5D8L B;  1J7K A;  1T33 A;  4HW0 A;  1O7F A;  3QPT A;  4PDK A;  1NTC A;  4B1R A;  1CQT A;  1T38 A;  3OOU A;  2AQF A;  3HDD A;  4AIH A;  2BE5 F;  1QO0 D;  3CC4 I;  3C2H A;  3BJ6 A;  1RKT A;  4LLG F;  2K7L A;  2XGC A;  3DQV C;  4LD5 A;  5E18 F;  2DTR A;  3RKW A;  4U0W A;  4V2F A;  1FSH A;  3PSI A;  4UUV A;  3D0S A;  1LFB A;  2MYS A;  3TGN A;  2K02 A;  2LRE A;  2VC0 A;  3BR1 A;  1SMT A;  2JA6 J;  3MZ8 A;  3ZMT A;  1P92 A;  4M74 A;  2DMN A;  2WBM A;  5HLG A;  3GXO A;  2HYG D;  3F8C A;  1SFX A;  3E0J B;  2LKP A;  5IY5 H;  1K79 A;  4OIR F;  2ZFU A;  4ON0 A;  5HDN A;  4KDP A;  4CCO A;  4G12 A;  5F0C A;  1R49 A;  3OSG A;  3BR5 A;  2LTP A;  5L3F A;  3VYS B;  4EEF G;  2DBB A;  4A3J J;  4D7N A;  2OZU A;  3O8H A;  3WGG A;  3S3N A;  1XGS A;  3F8B A;  2F5V A;  4RLQ A;  4XN0 A;  5K7Z A;  4IX7 A;  4C2T A;  5FLV A;  2XKP A;  2BY1 A;  2W25 A;  2HVR A;  4JX4 A;  1ETK A;  1UFM A;  3LA3 A;  3MKL A;  2QSG X;  1KA8 A;  4FHT A;  4CCL A;  4MQV A;  1ULY A;  2QBY B;  3PFI A;  5DV5 A;  3RPU A;  4MGR A;  1MBJ A;  1ZGA A;  3UR3 C;  2VJI A;  1BOA A;  2UUZ A;  5LRS A;  1OJL A;  1BR1 A;  3SZP A;  1I39 A;  2VQC A;  4B43 A;  4OU0 A;  3W3C A;  3H5N A;  1SVO A;  4MNU A;  3OS2 A;  2GOX B;  2CW7 A;  2HXO A;  4HST A;  5IOZ A;  2RN7 A;  2QQ8 A;  3QP5 A;  5TGT A;  1W7P B;  2X48 A;  5L3C A;  4RGR A;  1HA8 A;  3VYR B;  1A5J A;  2R7S A;  2R0Q C;  2VKD A;  2VKV A;  4JK1 X;  3PNV A;  4CZZ A;  2B63 J;  2KJB A;  2IA2 A;  4Y15 A;  1F9N A;  1JKQ C;  5KNL A;  5E79 C;  2VIX A;  2WAF A;  3AG1 H;  1R00 A;  1ZYR F;  2R7R A;  4IRG A;  3GTO J;  4EJU A;  3SFI A;  4IEJ A;  4YFN F;  2HEO A;  4XN3 A;  1U8R A;  4M3E A;  3KEO A;  2QCO A;  3L1P A;  1UST A;  2JPC A;  1VQO I;  3BTC A;  2P5L C;  1ZN2 A;  2IS4 A;  1SAU A;  4HX8 A;  3TOB A;  1VQM I;  4DZP A;  2MH9 A;  2EB7 A;  4GYG A;  4JQF A;  3I9V 2;  3HOT A;  1Y0U A;  5FB2 A;  2JMW A;  2ZXH A;  3CCY A;  2DA5 A;  3DTE A;  1G2H A;  3H0D A;  2VOD A;  4U0V A;  1IXR C;  5LGN A;  3DU6 A;  1OYI A;  3Q0U A;  1STZ A;  3CCS I;  5K7H A;  3S2D J;  1ZHF A;  1U5T B;  2DOD A;  4Y17 A;  2L2O A;  2LF7 A;  5LGT A;  3K1P A;  5E20 A;  3L00 A;  2EJR A;  1VQ6 I;  2CO5 A;  4BKX A;  1DP7 P;  2VLA A;  2KIQ A;  2DOE A;  1H9T A;  4BAY A;  1K78 B;  2RVC A;  1OCC H;  3WG9 A;  4BE2 A;  2P8T A;  3PSF A;  2XIG A;  1U8B A;  2BHY A;  2ZNY A;  1T08 B;  4E7I A;  1X4P A;  1JTX A;  3L9F A;  2LKX A;  2FOW A;  1D8J A;  1S6L A;  5D6F A;  5EGO B;  2M8G X;  4U87 A;  1ETW A;  2VKE A;  2DTZ A;  1B1B A;  4E7S A;  4EGZ A;  3J80 Z;  2LC2 A;  1IUF A;  2LBF B;  5EG0 B;  2HVS A;  3K4J A;  4IPA A;  2KRH A;  2HYF A;  4HNU A;  1JI8 A;  4M9X A;  3WU1 B;  1ZRE A;  1HW1 A;  3HRS A;  1M1E B;  5DEQ A;  3F6V A;  1R4N B;  4KIG A;  4B48 A;  5L3D A;  2PI0 A;  1LUJ B;  2L7K A;  2NS8 A;  1ZKG A;  1EH8 A;  2QQA A;  3I56 I;  4KMU X;  4WXC A;  3VYU B;  2NXN B;  1R5G A;  1IN5 A;  1P2F A;  1DU6 A;  4HV5 A;  4IXA A;  2Y31 A;  3BR6 A;  2AO9 A;  4P9U A;  2ZME C;  5B1A H;  2A05 A;  5JHU A;  4MFD A;  4EVI A;  1A35 A;  1R1T A;  2Y0S A;  2K86 A;  2ZNZ A;  2E71 A;  3GUD A;  1LQ1 A;  3R0J A;  4HDU A;  3ELK A;  2VOP A;  2DA4 A;  2ID3 A;  4KN4 X;  3PM1 A;  4IL6 C;  3PO3 J;  3HOY J;  3BT9 A;  4N4N B;  5BPI A;  1QVT A;  1Z3Y A;  5C4J J;  3TDZ C;  4Y3O A;  3DPL C;  3EUK L;  1JKP C;  4R79 A;  1T0F C;  2AHQ A;  4FE4 A;  2R93 J;  2IJL A;  2Z1D A;  3GTK J;  1E3H A;  2KHM A;  1NK3 P;  4KNY A;  4GRI A;  5BOX A;  4LIT A;  3AL0 C;  3W6J B;  2WAD A;  3M7G A;  1BI1 A;  3ESW B;  1T95 A;  4ESJ A;  3H9G A;  1MZB A;  1MBK A;  3GZN B;  3KEY A;  4DQ2 A;  1XSX A;  5GAH J;  5H6R A;  2VOO A;  1L0O C;  3P7N A;  1X1P A;  3VPR A;  2ECC A;  3CO7 C;  1X3Z B;  1FYK A;  4EJW A;  5F64 A;  4GYI A;  4KT5 C;  3ZRG A;  1D1A A;  4V2G A;  1XSD A;  1W0T A;  4HDV A;  3S8P A;  3FXU A;  2XF5 A;  1ITY A;  1YX5 A;  1R7J A;  2JWT A;  2AQE A;  2KIF A;  2LYC A;  5KCM A;  1YFH A;  1HW2 A;  3OV8 A;  1VQL I;  3IRR A;  1Z67 A;  2IA0 A;  2LK2 A;  5ICF A;  4HLX A;  3T0Y A;  3FMQ A;  3O8G A;  4R8H A;  4E6K G;  3ZQC A;  1TTY A;  4PZJ A;  1P9Q C;  4N0B A;  4S05 A;  4XOR A;  4Q47 A;  4MIM A;  1N77 A;  4HRI A;  1JTY A;  2XRL A;  1X1C A;  3S1M J;  1T39 A;  3FXM A;  1WFX A;  1Z0X A;  4BE1 A;  2DJI A;  3GZ5 A;  3HOV J;  3CCM I;  4D9J A;  1IV8 A;  2X4H A;  5GP9 A;  4CSW A;  4LG0 B;  2E60 A;  4KMF A;  4BS9 A;  4QWQ A;  4JYK A;  4C9Y A;  2VQH A;  3A2K A;  1BOB A;  1IG7 A;  2EFN A;  1FTZ A;  2DLL A;  1S72 I;  1ETQ A;  3K6G A;  1DUX C;  3E3V A;  3LOC A;  2HQA A;  3PQJ A;  3GWZ A;  2B0L A;  4CO8 A;  1YI2 I;  2O03 A;  2BHZ A;  2R5Y B;  4BXU A;  3RPU D;  2CMP A;  2R7W A;  2VPR A;  4L0Y B;  5D5X B;  3ZXS A;  1MNM C;  3JRB A;  2VAS A;  2EA2 A;  4ASN A;  3ABM H;  3OYK A;  4C30 A;  3S1Q J;  1K4S A;  5B3S H;  1JXS A;  2RKH A;  3I4P A;  1D3Y A;  1RZ4 A;  4EJV A;  2HR3 A;  2HYJ A;  2W4S A;  2OCC H;  1JGG A;  1Z7U A;  2ELK A;  3TW6 A;  2WB1 N;  3K4L A;  1BW6 A;  3OYH A;  2MGQ A;  4GDF A;  5E1W A;  2ZXI A;  3NRV A;  1WVR A;  1Z05 A;  2JTV A;  2MD0 A;  2K9M A;  3BP8 A;  1MDM A;  2NVY J;  3G3Z A;  4IVN A;  1GDT A;  2HS5 A;  2JSC A;  2VT3 A;  1TZL A;  3MZY A;  4ENK A;  5TJJ A;  2P81 A;  1FLI A;  4WF2 A;  5HOO A;  4E70 A;  2VJ4 A;  5GAE J;  1YQA A;  1X1A A;  2DFE A;  3K9T A;  3DLA A;  5CPR B;  4XKB A;  3QWL A;  2E5N A;  1KU7 A;  1ON1 A;  1PJR A;  2YS9 A;  3COA C;  1H88 C;  5ERI A;  5CQE A;  2B7E A;  2OPT A;  3K1N A;  4W1U A;  2R92 J;  3DWL E;  2VQL A;  3JAM Z;  3B02 A;  4E7J A;  3FX3 A;  4CYC B;  5CQG A;  2F5F A;  1AA7 A;  1W1W E;  4EM1 A;  3BQY A;  4XM3 A;  1VF9 A;  2F5C A;  3D1N I;  3TKY A;  3JRF A;  3CTA A;  3A1Y A;  1BR4 A;  2QEX I;  3K0L A;  1QVU A;  1BM9 A;  1W5C C;  1QBJ A;  3SDG A;  1VQ4 I;  2XB5 A;  2Z16 A;  4CH7 A;  5KHD A;  1I3A A;  3RSN A;  4E7Z A;  4X6A J;  2W57 A;  4KT6 A;  3S3O A;  3QYE A;  3GTJ J;  3DBL B;  2QGU A;  4NB5 A;  4MEY F;  3W2A A;  2QLZ A;  4M9Z A;  3GO5 A;  5JR3 A;  3F3X A;  1XN7 A;  2JA2 A;  2E1M C;  4XBF A;  4E4H A;  4EJO A;  1D0X A;  2RNJ A;  3RTR A;  1FNN A;  3OY9 A;  2C6Y A;  2XAS A;  1GVJ A;  1USS A;  2FE3 A;  2UWM A;  2IEK A;  1V54 H;  3KP3 A;  1XTA A;  1MBE A;  2ACJ A;  1MGT A;  1ZRF A;  4OMY A;  1S3J A;  4FQG A;  3J81 Z;  3Q0V A;  2XGX A;  2DMQ A;  4KJZ A;  4B09 A;  1RRJ A;  2RDP A;  5H20 A;  2D45 A;  1VQ8 I;  4L5I A;  3A01 B;  5BPD A;  4G6D A;  2V1U A;  3KP6 A;  2PQ8 A;  1R71 A;  2KIS A;  4S0H B;  5KAI C;  2QF7 A;  1R1V A;  1N78 A;  4BJT A;  2Q1Z B;  4I02 A;  2OAZ A;  3CCL I;  1WI9 A;  5LLQ A;  3DTI A;  3WU0 A;  2KDO A;  4RB3 C;  4R1H A;  4IHT A;  1F5T A;  2NVT J;  1P4A A;  5D5U B;  2RC4 A;  3S14 J;  4OIO F;  1JHF A;  3I59 A;  4BGD A;  2PEX A;  1I27 A;  4DYR A;  5DCM B;  1TP4 A;  2JZY A;  2DPD A;  1TWF J;  4QPO A;  4PJ0 C;  1YW9 A;  2ZKZ A;  4M3F A;  3T1B A;  2H8R A;  1D1C A;  2ZXJ A;  1HXD A;  1HLV A;  1SFU A;  3RZO J;  2K85 A;  2GXG A;  5CVJ A;  3RKX A;  1LFP A;  3F23 A;  3J7A Y;  3O6B B;  2X51 A;  4TV7 A;  5JLX A;  4IHS A;  2F4I A;  1J59 A;  1MKM A;  1LJ9 A;  3RQI A;  1PDN C;  5HS8 A;  2IP2 A;  2Y69 H;  3F8F A;  4XK4 A;  2PMU A;  1MMG A;  4WX9 A;  1MBH A;  4BEH B;  2UZK A;  2ZB9 A;  1FYM A;  2V9P A;  5A2Q K;  3O3K A;  4RMN A;  3FBN B;  3BDD A;  5CKT A;  4AID A;  4PK4 A;  4DYQ A;  1I5Z A;  4KIS A;  4XLC A;  1IJW C;  1Y6I A;  3S1R J;  2VL8 A;  4HEA 2;  4A3K J;  1QHG A;  3HHH A;  4AVP A;  2E19 A;  3S32 A;  4Y7N J;  4XOT A;  2LKS A;  3EUH A;  3OYC A;  1Z77 A;  1H8A C;  5JLW A;  4L5E A;  2WV0 A;  2GA2 A;  2JPB A;  2LFB A;  3HKZ N;  2L9N A;  5FD5 A;  2ISZ A;  1FBQ A;  1V5E A;  2ID6 A;  3FK7 A;  4OIQ F;  3NWT A;  4XKV A;  1TT5 B;  2HZD A;  3E6C C;  1ZQ3 P;  3LSP A;  2P4W A;  1GXQ A;  1LKX A;  1YW7 A;  2N8G A;  5LEJ A;  2NNN A;  4HQE A;  1BR2 A;  3IH2 A;  5TRD A;  1QZZ A;  4OOI A;  1AKH B;  1RUO A;  5D6E A;  3FXQ A;  2CU7 A;  3MN2 A;  2HGC A;  5E3O A;  3S15 J;  3EYY A;  2V1N A;  1O3S A;  1FEX A;  3D5R C;  2GBY A;  1UCR A;  2WC2 A;  1U6G A;  4ZZD A;  4ETS A;  1FY7 A;  2VXD A;  3BR3 A;  3F6O A;  1B72 A;  5LHI A;  2K4J A;  1X3W B;  2F4O B;  3N4M A;  2IW5 A;  2P5V A;  3ERM A;  3IL2 A;  2DOA A;  1ZR4 A;  1IN4 A;  4GCV A;  1S7O A;  3GTM J;  2VBW A;  2HKX A;  1BA5 A;  1YJ9 I;  4HX7 A;  2CJJ A;  2EZL A;  3IKV A;  2CV0 A;  1AWC A;  3N97 A;  5EZH A;  2V4J C;  1BIA A;  2FSW A;  3BRO A;  1H0M A;  1MJB A;  1BI2 A;  3M07 A;  4B8X A;  5K7F A;  2ME0 A;  5EF6 A;  2GA1 A;  4HG2 A;  2IGK A;  3D5S C;  5HLI A;  1ZG5 A;  2AXL A;  5DM7 F;  4FT8 A;  1A6Q A;  3GFM A;  2BBY A;  5FLX Z;  2WA0 A;  1R6R A;  3ABL H;  2CS3 A;  4XLA A;  2W84 A;  5TIS C;  1TQI A;  5DD4 A;  4KN7 X;  1WJF A;  4KIF A;  3KET A;  3GTG J;  5FLM J;  4XLE A;  4CCJ A;  5IT9 Z;  2CFO A;  3KYL A;  1ZH5 A;  4JP0 A;  2RGV A;  1FWZ A;  2LNB A;  4S04 A;  5ICE A;  2QSF X;  4PJL A;  1FMW A;  1Y8R B;  1JJ6 C;  1T98 A;  2FUG 2;  2E2I J;  3RKY A;  1YJN I;  2FOK A;  3HUG B;  1SMY F;  4C3I J;  4BH9 A;  3C1D A;  4IHW A;  1XGM A;  2M9H A;  1QZE A;  1W4M A;  4UUS B;  4L0Z B;  1OR7 A;  3ASN H;  3VWB A;  1WGX A;  4UVA A;  2VE8 A;  1LDD A;  5FO5 A;  4ZYE A;  1SAX A;  4UV9 A;  3HXL A;  2EV6 A;  3UKG A;  3ZMS A;  4WWC A;  4I2O A;  1J75 A;  2E2H J;  4A3E J;  3IAS 2;  2OD5 A;  3WTS C;  3DBR B;  3NQO A;  2A5Y B;  3OIP A;  4JX5 A;  5GTH C;  1OCR H;  2ZME B;  2AXT C;  4PFP A;  2IGN A;  4IRI A;  2W24 A;  3K70 D;  3G4S I;  3Q5F A;  3VOE A;  4A3D J;  1RNL A;  1WQ2 A;  4LG3 A;  3PIP F;  1IDZ A;  1DQU A;  1XPX A;  2HOT A;  4JX6 A;  4M6Y A;  1FYL A;  3ZGK A;  2IS2 A;  3CMY A;  3DV8 A;  1UEL B;  3IWF A;  4ESB A;  5IP7 J;  4I01 A;  4NQW A;  1REP C;  4F52 A;  1KQ8 A;  3E5U A;  2J5O A;  1JT0 A;  1MJ9 A;  2CW0 F;  3ECO A;  1Y1V J;  3M8J A;  2JK3 A;  4G8X A;  3V8K A;  2K40 A;  2KZV A;  3ZN0 A;  4G6Q A;  3AL0 B;  1TWH J;  2FD5 A;  4CZC A;  5L3E A;  2ADU A;  3CMM A;  1S5L C;  1Y0N A;  2R7V A;  5C3E J;  4BXF A;  3LMM A;  1IN8 A;  2R7O A;  3TOA A;  3DEU A;  2LH9 A;  4BUP A;  2W7N A;  3BZC A;  3ZQH A;  4B3A A;  3MKW B;  3V7R A;  3FXL A;  3Q9S A;  2HDD A;  2QSH X;  5FRM A;  1LEA A;  3WE2 A;  2FNA A;  3A03 A;  2VE9 A;  3QOP A;  1W7P A;  3SZG A;  2DA1 A;  4J01 A;  2GXB A;  1QNT A;  1OQY A;  4F3Q A;  1IRG A;  1ORK A;  3ZQG A;  1MBF A;  2K3P A;  4PJM A;  3KP7 A;  1YTY A;  1A04 A;  2M34 A;  3H9Q A;  2G9W A;  2FBH A;  2BXZ A;  5AON A;  4RAZ A;  1XB4 A;  4DOZ A;  3OYA A;  2FRH A;  1T8I A;  1MSF C;  2VUM J;  2V1X A;  2DYS H;  2HXI A;  3KE2 A;  2H09 A;  3T8T A;  3V7S A;  2E1N A;  3GTQ J;  3K4C A;  3GX4 X;  1ZAO A;  3KLO A;  1VQP I;  2XPW A;  4LGW A;  5BQT A;  1VQ7 I;  3L2U A;  1UG0 A;  3QPS A;  4I98 B;  1B59 A;  2DOF A;  2E1C A;  3CUQ A;  1XD7 A;  4MTE A;  1U78 A;  2XAH A;  1B4A A;  1BL0 A;  1OMI A;  3HRM A;  5LRR A;  3AKZ A;  4A3G J;  4ABZ A;  3VEP A;  2FEZ A;  2RQP A;  2BY3 A;  1UHS A;  2D2W A;  3B73 A;  4ZTJ A;  3GCM A;  4DYC A;  2QQ9 A;  3TP3 A;  4O3M A;  2VKH A;  2V6C A;  2M1B A;  1HC8 A;  3FM3 A;  3GTL J;  2CV1 A;  1QU3 A;  3FKJ A;  5JFR A;  3JCU C;  2CH0 A;  1FSE A;  3B6A A;  4LMY A;  4LK0 F;  5HDG A;  3LFU A;  4EMS A;  1J0R A;  5J8C A;  3W6V A;  3F0C A;  4FTH A;  4Y52 J;  5F1J A;  1VQ5 I;  3FDY A;  1RET A;  2V7F A;  3EUH C;  2PX9 A;  3K2Z A;  3LQQ A;  4RAG A;  4AD9 A;  3EET A;  3OYL A;  1VFC A;  2VON A;  4E7H A;  4RDU A;  3ULQ B;  2OZ6 A;  3KZY A;  1ETV A;  3IWZ A;  3ZN1 A;  1HKT A;  1KON A;  3L2W A;  2E36 A;  3DF8 A;  4AYB N;  3BY6 A;  2GZW A;  1W5T A;  2ZSI B;  1PUF A;  5KK1 A;  4WK8 F;  2M7A A;  2P6T A;  2CG4 A;  2LBF A;  1BC8 C;  5ICC A;  4D5F A;  2MBF A;  3OS0 A;  5E3L A;  2F4M B;  3DPT A;  4EAT A;  2W1O A;  4M6X A;  1Y1W J;  3AFH A;  2EV0 A;  4DIQ A;  1YS7 A;  4Q5S F;  4DJA A;  5ED4 A;  4M3B A;  3TQN A;  3ASO H;  3HHG A;  4C3H J;  1DPR A;  1R9T J;  3L2C A;  2EIL H;  4IF4 A;  4P55 A;  4XKC A;  3EPZ A;  1Y56 A;  1FT9 A;  3CCJ I;  1MMD A;  2UXN A;  1HOM A;  2PMH A;  4YEJ A;  3EQL F;  3WTX C;  3RDI A;  3Q3S A;  3QYB A;  2VB6 A;  3W2W A;  1SD4 A;  3X2Q H;  4FIS A;  2R7X A;  4G7H F;  3ZQI A;  2MC4 A;  3DKW A;  2VJ5 A;  4RB1 A;  5FKO A;  3HYI A;  5DCF A;  1K6O A;  2EK5 A;  3AG4 H;  3DU5 A;  3M8F A;  1B8I B;  3HOW J;  3LSG A;  2GXA A;  4XSZ F;  3CP8 A;  3FMR A;  2DT7 B;  2DO7 A;  2DA7 A;  2EZH A;  4XON A;  1OIS A;  2K4B A;  2E1M B;  5E1Z B;  3E7L A;  2LR8 A;  4M71 A;  1Z1D A;  3TMO A;  3GLX A;  3HRU A;  3E1S A;  2HQN A;  3L09 A;  4OAY A;  4X1E A;  1POG A;  3NEU A;  3ZOB A;  1F43 A;  2GLO A;  4LLN A;  3H36 A;  2KP6 A;  4I76 A;  1G3W A;  3KYC B;  1Z7L A;  2LRD A;  4BL0 B;  2OTL I;  1N25 A;  4Z2Y A;  2M2E A;  5M5X J;  4RB2 C;  4QLC U;  3FHZ A;  4XKW A;  1JE8 A;  6PAX A;  5FKK A;  1H89 C;  2LY2 A;  3I3L A;  5J3L A;  3CDI A;  4ZTF A;  1KYZ A;  4A6D A;  4F93 B;  1OCP A;  5CLS A;  2FF4 A;  1BBY A;  3DKX A;  2KLO A;  4HNV A;  2CQ7 A;  3BQZ A;  4L18 B;  2RNG A;  5DYM A;  2CFX A;  5EZG A;  2WAE A;  1CF7 A;  1XDS A;  2OU2 A;  1NG6 A;  1HKQ A;  4MTD A;  2X6W A;  1EV7 A;  2DYR H;  4HX4 A;  3G2B A;  3ZMU A;  2LY9 A;  1WWX A;  3E97 A;  3JTH A;  2CSO A;  3H5A A;  4XQF A;  1IAW A;  2IPQ X;  2F48 A;  1VQN I;  2R5Z B;  3W6K B;  5DUI A;  4BE0 A;  1O3T A;  4DZJ A;  4IJA A;  3RI4 A;  3ECH A;  2O5R A;  2FQ3 A;  1QA6 A;  1FP1 D;  2NOJ B;  3K1M A;  4WXD A;  2R5Y A;  4ENM A;  2FBI A;  3ISP A;  3MKY B;  2WB1 A;  4AC0 A;  5ICG A;  3ZMZ A;  3L2R A;  3F8N A;  2K5C A;  1RC9 A;  4CHU A;  3RYR A;  1WRJ A;  3LSH A;  2L5Q A;  1D5Y A;  1R58 A;  2HOE A;  4I7H A;  2JSP A;  2VT2 A;  2Y75 A;  2BXY A;  2BVM A;  4QSH A;  1OCO H;  3WOD F;  1OCZ H;  2HDW A;  1I6X A;  3DEW A;  2JA8 J;  3R0A A;  1W7P D;  1EF4 A;  2MW8 A;  4G9Y A;  2K3F A;  1RPW A;  3LST A;  4B4C A;  4EM2 A;  5IP6 A;  2QVO A;  3GEZ A;  1B9M A;  3E6D A;  5EDN A;  2LMD A;  1SVM A;  4G94 A;  1S9H A;  1J5Y A;  1WCM J;  4BQN A;  4KYW A;  1ETO A;  2LG4 A;  3E5Q A;  3IC7 A;  5L3G A;  1DGR M;  2EPF A;  1UHW A;  2Z3Y A;  2D1V A;  3BPX A;  3BOQ A;  4PJJ A;  2OJE D;  4RA2 A;  3BCA A;  4UB6 C;  4CXF A;  1MW7 A;  1ZR2 A;  2XRO A;  1VQK I;  1QPI A;  3CES A;  3OYD A;  1Q1H A;  4A0X A;  3G1O A;  2L54 A;  4F92 B;  2NNY A;  4XLH A;  1E17 A;  2X9D A;  2QYO A;  2DJN A;  2DA6 A;  4F91 B;  5K5Q A;  3CC7 I;  3K4M A;  4CYC A;  4BHB A;  3S1N J;  3PUB A;  4RGX A;  3F22 A;  3KZZ A;  3CUQ C;  4AIJ A;  1I1S A;  3V8L A;  2VXZ A;  2X6Y A;  3KCC A;  2ECB A;  1TW2 A;  2DA3 A;  4UHT A;  4PSX A;  2O0Y A;  2QA4 I;  3QU3 A;  4ZYD A;  4IHY A;  4RBO A;  2Z99 A;  4U88 A;  2EFP A;  2L3D A;  4XOP A;  3TBI A;  1YIJ I;  4UXN A;  4ZJZ A;  4J00 A;  3H1C A;  3CDL A;  3KYD B;  4CA0 A;  1X58 A;  5IPA A;  1H9G A;  3ZQQ A;  2Z5U A;  3A4C A;  1LE8 A;  4IQ4 A;  4Y4R A;  2FXA A;  2V79 A;  4M9S A;  4AWX B;  4BY7 J;  2YR2 A;  2JA5 J;  4HPQ A;  2YUS A;  3ABK H;  5HS7 A;  2GIZ A;  2DXI A;  4IHX A;  2DFF A;  4RAF A;  2A5W A;  3FBI B;  3HBL A;  3PFY A;  3U21 A;  4IOA F;  3CUO A;  4FX4 A;  1F4K A;  1GLN A;  1MJA A;  4MO7 A;  5J1U A;  2H27 A;  3QOD A;  1MDM B;  2XAU A;  1U3E M;  5B5E C;  4I0B A;  1P6R A;  4NBQ A;  2DT5 A;  4GO1 A;  4BHC A;  4PGG A;  5IYB J;  3BLY A;  3OIO A;  2O7O A;  1LDK B;  2RRE A;  2DA2 A;  1U0J A;  3CD6 I;  1Q1V A;  3ONQ A;  3PO2 J;  2IGM A;  3S3M A;  3QPL A;  2A6H F;  2MFZ A;  1X1B A;  5DCM A;  3H0G J;  2IS6 A;  3BJO A;  3JW4 A;  2VN2 A;  5HOD A;  1DU0 A;  1FC3 A;  3HC7 A;  1TQM A;  4BBR J;  3I4M J;  3I58 A;  2GQQ A;  1FOK A;  1P4W A;  2NS0 A;  4XLP F;  1FOW A;  4H4K C;  3I54 A;  4A2U A;  3CO6 C;  2MA3 A;  5EYR A;  3HGG A;  1Z9C A;  2BW3 A;  4ZC3 A;  1D0Z A;  3QRF F;  1HKS A;  2KRF A;  3C2G A;  2Y9Y A;  3H3V K;  4IO9 F;  1DDN A;  3DPU A;  1RIO H;  1FP2 A;  1ZTR A;  1FOY A;  3HB9 A;  4P96 A;  4A3I J;  4I0A A;  3I55 I;  1R36 A;  2MG4 A;  2QUF A;  3HKZ A;  1I3Q J;  1KQ9 A;  3HPH A;  3ABU A;  5EEH A;  5LGU A;  3CCE I;  4XL9 A;  2P0W A;  4HA8 A;  5FKN A;  2Q8K A;  1IRX A;  2PFB A;  3R60 A;  5M5W J;  3QU6 A;  2EIJ H;  2IAI A;  2YX4 A;  4A3F J;  4WXH A;  2PG4 A;  4IQJ A;  1XCV A;  1R5H A;  2XF6 A;  5CVU A;  4DGW B;  5FD6 A;  5HLT A;  2KPM A;  4OIP F;  3TW7 A;  5C44 J;  4C2U A;  2XGD A;  2YSR A;  5E8G A;  1IXS B;  4Y33 A;  3HOX J;  1KGS A;  4FCY A;  3H5R A;  5F04 A;  3IH4 A;  3VFZ A;  1IXC A;  2GM4 A;  4YFK F;  2F5E A;  2BGC A;  4XR6 A;  5FFX A;  1TT0 A;  4UVC A;  1E3O C;  3C7J A;  3IH3 A;  3PNT A;  1IN6 A;  2VPL A;  1EKE A;  2HVQ A;  3J80 K;  4DBQ A;  2GAU A;  3KPH A;  4QPQ A;  3MAJ A;  1RI7 A;  3F9K A;  4HLY A;  1NK2 P;  3EYI A;  4YFX F;  2Z33 A;  4G7O F;  3J7A O;  2BYV E;  3I59 B;  1RR7 A;  3OL4 A;  1X1D A;  2XUB A;  4L5J A;  2IA1 A;  2LY1 A;  3GLL A;  4BDZ A;  1ZG1 A;  2A07 F;  2Z2S B;  3ZQF A;  4UNO A;  2EZK A;  1S7A A;  2L9R A;  1ZG3 A;  4CCN A;  2ZCW A;  1UHM A;  1X2M A;  1XSV A;  2MH2 A;  2FJ1 A;  3IKT A;  1YX3 A;  3JRE A;  1NHA A;  1HST A;  3HPG A;  4ESF A;  3BG6 A;  1SD6 A;  1BIB A;  2L7M P;  4EGY A;  4CGZ A;  3CQZ J;  5M3F J;  1R4M B;  2X85 A;  2M4K A;  2AS5 F;  3OR1 C;  2WTE A;  3J7Z I;  1C0W A;  4BU2 A;  1Z6T A;  2F5D A;  1FMV A;  3GVA A;  1X4O A;  1SEU A;  2JA7 J;  1BW5 A;  4BQO A;  3BR0 A;  3CCV I;  1FJL A;  1XMK A;  2JJ7 A;  3LSM A;  2P7C B;  2VBX A;  1JHH A;  2ZJP F;  5IOY A;  2FML A;  4K2E A;  4U7B A;  2TCT A;  3OMY A;  1LB2 A;  3BG5 A;  2VQG A;  1GHC A;  1KYW A;  2L7Z A;  4RS8 A;  4LLL A;  1KU3 A;  3BCB A;  2RAE A;  1ENH A;  2HWV A;  1YRN A;  4BQA A;  5J8F A;  2EFO A;  2Q2E A;  3QP6 A;  1MIJ A;  2M7B A;  2HPI A;  3GFL A;  1MND A;  1ZRD A;  1IUY A;  2JRM A;  2X0L A;  4A0Z A;  2NOG A;  2ESH A;  5AIP A;  3PJR A;  4XRS A;  2QKM B;  1MMA A;  5F27 A;  2CQN A;  4GFB A;  3HUG A;  5GPC A;  5K5R A;  3OYJ A;  1TC3 C;  3F21 A;  2Q0O A;  3R6S A;  2YPR A;  4ZDP A;  2D1H A;  2GIV A;  3BC8 A;  5JI6 A;  1ODD A;  1ACI A;  3TED A;  1XS9 A;  2OF7 A;  2YU9 J;  4P1W A;  3F72 A;  2IXS A;  3CMA I;  3BG7 A;  1QZY A;  1YE9 A;  1QGP A;  3U9G A;  1E0E A;  3RIR A;  2JUC A;  3NAU A;  4LOC A;  2O9L A;  2OQR A;  3KEQ A;  1V3F A;  3LFK A;  4XID A;  2CYY A;  2PJR B;  2FQ4 A;  2KDZ A;  1WSU A;  5GTI C;  1O7L A;  2ICW G;  3PL8 A;  3IHU A;  1J9I A;  4XRM A;  1K61 A;  2L7F P;  3FKI J;  1CGP A;  1B72 B;  2FX0 A;  3G1L A;  2ELJ A;  1UG2 A;  3LAJ A;  4NC8 A;  1S8N A;  1D8K A;  2DDB A;  1TW3 A;  4HAM A;  2OBP A;  4PSW A;  3GTP J;  5FFZ A;  2OTJ I;  4F55 A;  3BZK A;  1D1B A;  2IT0 A;  4CDG A;  3BZ6 A;  3H9J A;  2IBD A;  2EBI A;  2MD5 A;  5J47 A;  3WG7 H;  1AOY A;  3A0H C;  1YOV B;  1T0F A;  2K9N A;  2TRT A;  2W00 A;  1A36 A;  4II3 A;  3FIS A;  3BTL A;  1Z21 A;  1GV5 A;  3MFK A;  3PIO F;  3RCO A;  2UV1 A;  2L01 A;  2XAG A;  3B6C A;  2MLG A;  1YS6 A;  2E1O A;  1LEB A;  1W36 D;  4A5N A;  2HZT A;  1TNS A;  1PP8 F;  3OSF A;  3OWT A;  1F36 A;  2M8E A;  3ABT A;  1EH6 A;  4U7D A;  5H2F C;  2HPM A;  1XC5 A;  2QZ8 A;  1YG2 A;  2M0M A;  3SXY A;  4BJ5 C;  4FET A;  2NVQ J;  3CF5 F;  1I50 J;  4ZYH A;  3IRQ A;  3LQR A;  2PMZ N;  2WAQ N;  1WKM A;  2A69 F;  3K70 C;  5BMZ A;  3TDU C;  2IRF G;  2NAZ A;  3FK6 A;  3N05 A;  5J6X A;  1S7E A;  2DK8 A;  1K83 J;  1JUS A;  2QBY A;  4Z6Y A;  3RJP A;  3U2R A;  2A61 A;  2MAB A;  4A0Y A;  4D7M A;  1JKR C;  3JAM K;  2ZJ2 A;  5K1Y A;  1XX5 A;  1VI0 A;  4HOB A;  1FX7 A;  4LJZ F;  1SVL A;  2M5W A;  3OYM A;  4Q4Z F;  2DU9 A;  2TDX A;  1AU7 A;  3ZP5 A;  1HW5 A;  5DTD A;  2V1D A;  4HNT A;  1W5S A;  4C2M J;  2B9S A;  3V7C A;  2GOM A;  1MMS A;  3BPV A;  2G7H A;  4AU7 A;  3MEX A;  1IF1 A;  1ERD A;  2P5K A;  5FKL A;  1G3Y A;  2STT A;  3GME A;  3CLQ A;  3JRG A;  3K7A J;  2CUF A;  2HFH A;  2R7Q A;  4RAY A;  3QYF A;  1ETY A;  3FHN A;  3HOS A;  2P6S A;  4NQW B;  4I99 C;  2V6E A;  4BY1 J;  4KFC A;  1GXP A;  4PUS A;  1R23 A;  5J4Y A;  2NRA C;  3JTG A;  5DUK A;  3OL3 A;  4AYB A;  1XMA A;  3VYT B;  1YJW I;  3LAP A;  2WY7 Q;  1DPU A;  1OYW A;  3ZR8 X;  3SQN A;  3EDP A;  3AG3 H;  3J81 K;  1G8X A;  1GUU A;  1OFC X;  1YYV A;  2KZG A;  3HGY A;  3HRT A;  4XLF A;  3SEQ A;  4GGG A;  1BJA A;  3K69 A;  4RGU A;  1QPM A;  2PJP A;  3BJA A;  4XNF A;  3WU2 C;  2E34 A;  5C4X J;  2XRN A;  3AG2 H;  3QAH A;  4C3J J;  3JRD A;  1IRF A;  1FPQ A;  1LFU P;  1U5T A;  1PUE E;  1P4X A;  3FIW A;  4BJ6 C;  5GPA A;  4P5O A;  3CJR B;  2EA4 A;  3PNY A;  1K78 A;  1JT6 A;  1KU2 A;  2F2E A;  4A3B J;  4AIK A;  3Q9V A;  2BY0 A;  2KRC A;  3LSJ A;  2LLK A;  3OR2 C;  2L02 A;  1DGW Y;  4XIC A;  1G59 A;  2ZXW H;  3IAM 2;  2I8D A;  4UV8 A;  1ZGJ A;  3RYP A;  1EA3 A;  2DI3 A;  2Y9Z A;  1I6H J;  5EGO A;  4A6E A;  3O2P E;  3CUQ B;  2F6C A;  3SHF A;  5EG0 A;  1FTT A;  5JHF A;  4UB8 C;  1FOX A;  2ZJQ F;  1YIO A;  1EH7 A;  2KQR A;  3KP2 A;  5HNF A;  3L2Q A;  4FX0 A;  3M3Y J;  1G6N A;  4QTR A;  2CUE A;  3S2H J;  2HKO A;  2V9V A;  4HSR A;  1HSJ A;  2ME6 A;  1GT0 C;  2WV1 A;  4ZDL A;  1B8I A;  2K27 A;  1HCR A;  5HLH A;  2M4G A;  5FRN A;  3SYT A;  1Z6R A;  5B66 C;  3AAF A;  2EIK H;  3NAR A;  3CJT B;  4MQ9 F;  4E7K A;  5LHG A;  2O8X A;  3V4G A;  5FRO A;  2XGE A;  3R4K A;  1HF0 A;  1B6A A;  1IZ1 A;  2OQG A;  4LIV A;  1X19 A;  2H8W A;  1KQ0 A;  1F1Z A;  3CJN A;  1OKR A;  3M1C A;  2K9S A;  2H6C A;  1IRZ A;  2V26 A;  3HTS B;  3FXJ A;  2FNP A;  4YIF A;  4W97 A;  1UZC A;  5F6F A;  3S16 J;  5A2Q Z;  2K9Q A;  2JQ7 A;  2CGP A;  3BG9 A;  1HQC A;  1MH4 A;  1TL8 A;  1D5V A;  5AIQ A;  3KLN A;  3VOD A;  2DQR A;  1T6S A;  2LDU A;  4A3L J;  1PUF B;  5GAD J;  3CCR I;  1JUP A;  1UJ8 A;  2BVL A;  4UVB A;  2KT0 A;  2ESN A;  1OLT A;  3HSE A;  5CYV A;  3ZQL A;  2KL4 A;  2CUJ A;  3BWG A;  3KFW X;  4PFO A;  4XSX F;  3QPH A;  5IYC J;  4BBS J;  2MLK A;  2M30 A;  1Z91 A;  3OYB A;  1U9N A;  2R7F A;  3WGI A;  4MHG A;  3SJM A;  2O3F A;  1O57 A;  2A68 F;  2XVC A;  4RB0 A;  5GAG J;  1ZAR A;  2R5Z A;  1WH5 A;  3K4N A;  4ZYA A;  1ZGW A;  3L2V A;  3NWS A;  2RV8 A;  1A6I A;  2COB A;  1O3Q A;  2XF7 A;  1XGN A;  3T5X A;  3OIQ A;  3P9C A;  3WE3 A;  5LFA A;  5D5W B;  3WTV C;  4HF1 A;  2R7U A;  4AVZ A;  2CWE A;  3DKY A;  3CME I;  1T56 A;  2PBI A;  4M72 A;  3H3U A;  2HOS A;  1FIP A;  1OR7 C;  4IOC F;  2ZO4 A;  2DQL A;  5E3M A;  1Y39 A;  2IS1 A;  5IP9 J;  3I53 A;  5CJ9 A;  1N75 A;  4PJN A;  4LG0 A;  3D5L A;  1RKW A;  3BR2 A;  1PYV A;  4HBL A;  2JRT A;  3V42 A;  5DM6 F;  3RZD J;  1LDJ A;  3DFG A;  5FLX K;  1QRY A;  4O5V A;  1YW8 A;  3IV5 A;  3REO A;  2HTS A;  4A5M A;  5IT9 K;  5FJ8 J;  1V4R A;  2DT6 A;  3WTU C;  1RUN A;  2XAJ A;  1JGS A;  1FBS A;  1LNW A;  2M0C A;  3SEZ A;  1ETX A;  1T2K A;  3MKZ A;  2CV2 A;  2LD5 A;  2E5Z A;  2A6E F;  5EJC A;  2BEO A;  4V19 K;  4WCG A;  3GZ6 A;  2BY2 A;  2Y0S N;  3BTI A;  1J2X A;  3TL4 X;  1ZLK A;  1G4D A;  3HOU J;  3VSL A;  4G6T B;  2QEN A;  2DCE A;  1TNT A;  5JVT A;  2FMY A;  4MLO A;  5ILU A;  5EEA A;  3G71 I;  3ERE D;  2XPU A;  5H6Q A;  1CF7 B;  1KU9 A;  2KFD A;  1G3S A;  2K9L A;  2ETH A;  2BV6 A;  1HDP A;  3K10 A;  4NC7 A;  4OIN F;  4CCK A;  1WJC A;  4B44 A;  1XGO A;  3EUA A;  5DD8 A;  1E2X A;  4L9J A;  1W0U A;  1O3R A;  1IV6 A;  2RQQ A;  1SC7 A;  3GBG A;  2DW4 A;  5FKM A;  1X3U A;  3TP0 A;  2XKO A;  3OYN A;  3KX2 A;  4RGS A;  2M87 A;  1E3P A;  3P9K A;  5BS6 A;  1YLF A;  2VC1 A;  4L9V A;  1IGN A;  2CQK A;  1Z3X A;  3DCF A;  4Q48 A;  5IT3 A;  3P5J A;  1OYY A;  4BXX J;  5M3M J;  3K4K A;  4X0G A;  1XCB A;  3E5X A;  2O8K A;  2JVH A;  1FIA A;  4UY8 I;  3GYH X;  2X6X A;  3S93 A;  3QQA A;  4NC6 A;  1UAA A;  4BHP A;  2VI6 A;  1WJ5 A;  3ZPL A;  1WI3 A;  5KVR A;  3FWE A;  5DS9 A;  2H94 A;  4ZDO A;  3SFZ A;  3LSI A;  3OS1 A;  2HQR A;  1TWA J;  1J09 A;  4ENJ A;  4GXO A;  3F8M A;  2L4M A;  3LSK A;  4CCM A;  3OYI A;  3FXK A;  4RLF A;  1APL C;  1Y8Q B;  2HI3 A;  5F0H A;  5E3N A;  4OMZ A;  1RR8 C;  1B9N A;  1QQI A;  3H92 A;  3RQ4 A;  4CIC A;  2JN6 A;  1LVA A;  5B1B H;  2XSD C;  1WZ2 A;  3C18 A;  3HSR A;  3HZJ A;  3M8E A;  4O6J A;  4YEL A;  4D5C A;  3GFJ A;  3JRI A;  3FXR A;  3LL7 A;  2CQQ A;  9ANT A;  1SFO J;  3MCZ A;  1WPK A;  2I10 A;  1U5T C;  3C3W A;  5KAF C;  1WHU A;  2NYX A;  2BZT A;  5JVG F;  3LSR A;  4MEX F;  5HS9 A;  3RPQ A;  5LBQ A;  4A3C J;  2L0K A;  3GW2 A;  3K2A A;  4M3G A;  1AHD P;  4ENN A;  2ELH A;  3Q0W A;  1O4X A;  5J1Y A;  5LHH A;  3LA7 A;  1BN5 A;  1G3T A;  2ZBK A;  2KJC A;  3I71 A;  3FXO A;  3A01 A;  1NG7 A;  2PLY A;  2E2J J;  4PGH A;  1V55 H;  2XHK A;  2ZC2 A;  2FU4 A;  4M73 A;  2JVG A;  3M4O J;  4A12 A;  4BAC A;  4BDY A;  4EQQ A;  4J19 A;  5E17 F;  3IP4 B;  1R22 A;  3WTZ A;  4NUB A;  2QKL B;  4PCQ A;  4BYY A;  2COM A;  2YU3 A;  2GWR A;  3CJQ B;  1XG1 A;  2VBY A;  3HSF A;  3LWF A;  4BNC A;  5HNH A;  4OAZ A;  2LVS A;  5EEG A;  3FZV A;  3WTW C;  3L7W A;  1ZLJ A;  2HQ5 A;  4BQQ A;  3DEE A;  3I4N J;  3P9I A;  1OCT C;  4EJT A;  1IN7 A;  5IYD J;  2CW8 A;  4HQM A;  4HZF A;  2E7X A;  1LE8 B;  4IKF A;  1K6Y A;  4U0Y A;  4M6V A;  3CF2 A;  2XAF A;  3CDH A;  2CRG A;  4XRF A;  3GFI A;  1D0Y A;  1P7J A;  1GVD A;  2EIN H;  2IVM A;  2ISY A;  1XMX A;  2W82 A;  4RM3 A;  2DMP A;  2O61 A;  3OYF A;  2A6T A;  2H1L A;  4YRV A;  4BEH A;  1SAN A;  4H0E A;  2L9S A;  3G1M A;  3WHB A;  5HVQ C;  3A02 A;  3CCQ I;  1WJB A;  2DAO A;  3HIF A;  2HU9 A;  3FM5 A;  5J4V A;  4L9T A;  3BTJ A;  4KIB A;  1UMQ A;  2KMU A;  4KA4 A;  5D4S A;  1PP7 U;  1DP3 A;  2LSO A;  2X6O A;  1OPC A;  3OYE A;  4IRH A;  5D4R A;  4E7L A;  5M5Y J;  5FGM A;  3MWM A;  3DXJ F;  3VB2 A;  1JJ8 C;  3S17 J;  1JKO C;  4YG2 F;  1HBX G;  2G0E A;  2M45 A;  3HL2 A;  3ML6 A;  3JRC A;  2DFI A;  1IO2 A;  4DW6 A;  4DBR A;  2H1K A;  5CVR A;  1U2W A;  3PUF A;  3LA2 A;  2D5V A;  5F08 A;  3CCU I;  1TQP A;  3S2W A;  2JT1 A;  3HEF A;  3T8R A;  3CP2 A;  4FE7 A;  3I0T A;  3ZCO A;  1QHH D;  4M3D A;  3PQK A;  1I1G A;  3I64 A;  4CYD A;  2EWN A;  2VJJ A;  4HYE A;  1SD5 A;  2OA4 A;  2X1D A;  2STW A;  2BW3 B;  2Y48 A;  2XV4 S;  2G7U A;  3W2V A;  4JOM A;  2X1C A;  1S29 A;  4YII A;  3GF2 A;  2NS7 A;  2EV5 A;  1AKH A;  2WWY A;  4XLN F;  2EQR A;  3M9A A;  3WTY C;  3A0B C;  2MC3 A;  3MVP A;  1R5I D;  4ANJ A;  3J7Y J;  2DN0 A;  4AM3 A;  2HOA A;  2OC6 A;  2DK5 A;  3H35 A;  5E1X A;  4D0P A;  3CZ6 A;  4P9F A;  5D8K B;  2HTJ A;  3G73 A;  1L3L A;  1K7A A;  4A93 J;  1MD0 A;  1NH3 A;  4KUM A;  5DDG A;  2KIM A;  3I5U A;  2EH3 A;  2OUM A;  4XRS G;  1UB9 A;  2JUG A;  5J40 A;  3KZI C;  2HNH A;  3HM5 A;  4NNJ A;  2DMU A;  2CQX A;  1YIT I;  4G7Z F;  5L3B A;  1ZEL A;  3WTT C;  4AUX A;  2OV7 A;  1MH3 A;  1BJZ A;  4HF2 A;  1TBX A;  1SD7 A;  2R7Z J;  1ZK8 A;  3ZQ7 A;  3V8J A;  4ITV A;  3LNQ A;  4I09 A;  1U9O A;  2Y30 A;  1MSE C;  4RM2 A;  2W85 A;  3MMY B;  3BG3 A;  3E6M A;  4ZZL A;  2EFW A;  3MZH A;  2NVU B;  2EIM H;  1R1U A;  3UNG C;  5LEK A;  4LK1 F;  1GV2 A;  3DBH B;  2HDC A;  3JRH A;  4UUT A;  3VSK A;  1WJA A;  2LF8 A;  3HG9 A;  4LB5 A;  2I5U A;  4CUG A;  1YO5 C;  3QOE A;  3KP5 A;  5ILV A;  3WHC A;  4ZYG A;  3WGH A;  3SZT A;  1MBG A;  4A3M J;  4FAS D;  1A31 A;  4EV0 A;  2R4G A;  1KZH A;  4KIT B;  4IZZ A;  2ZSH B;  2PJR A;  3HOZ J;  2MSY A;  2LP0 A;  3H3Z A;  3MD2 A;  4F7Z A;  5E8I A;  3M1E A;  4KIC A;  2XAQ A;  4MFE A;  2E7W A;  2Y0M A;  4YIR X;  3C2B A;  4QIW N;  1TWG J;  4Y13 A;  5CVI A;  1WH7 A;  1WJE A;  4I6Z A;  2M3A A;  4UUS A;  3IUO A;  3TO7 A;  3SDB A;  2V9K A;  1P7I A;  4OWR B;  3ROU A;  3E6B A;  4B3X A;  1FBU A;  3DTK A;  1ONV A;  1V5F A;  1FZP B;  1ZRC A;  2KKO A;  4B47 A;  1V5G A;  4NHJ A;  2O6G E;  2X1E A;  3U1D A;  1RES A;  2BOL A;  3U1K A;  2Y2Z A;  2EZI A;  3DP7 A;  4LFU A;  4N9H A;  2XB0 X;  2ZME A;  2XC7 A;  2PMZ A;  2WAQ A;  4JBA A;  5F1R A;  4N4O B;  3CLO A;  1XDU A;  2FBK A;  2YX7 A;  1TWC J;  4HV6 A;  3TO6 A;  2EFQ A;  5F0F A;  2R7T A;  4DNC A;  1JUM A;  1WJD A;  1IC8 A;  1ON2 A;  2QM3 A;  2R7D A;  1PVE A;  4A69 C;  3KIO A;  5K5O A;  1TLH B;  2KIU A;  2XDV A;  3G6E I;  4L9N A;  3CC2 I;  1X2N A;  1MNE A;  1YRN B;  2FA5 A;  4EM0 B;  3JRA A;  2Q2E B;  5D5V B;  1VQ9 I;  1BC7 C;  4N9I A;  1SFK A;  2H6B A;  3JSP A;  1HDD C;  2W48 A;  5CVV A;  2E35 A;  1K4T A;  2XSJ C;  2NVX J;  1MMN A;  4ZH4 F;  3HJE A;  1VTN C;  2L4A A;  4IHV A;  3OYG A;  2XPV A;  2PN6 A;  3JSO A;  2LOO A;  1LPQ A;  4NDL A;  2P7V B;  2UXX A;  5LD2 C;  3JR9 A;  3RKQ A;  5HDK A;  5ILS A;  2ZJR F;  3KP4 A;  4LB6 B; 
#chains in the Genus database with same CATH homology
 1B8I A;  3RQI A;  1HCR A;  1ZR2 A;  4XK4 A;  1QPI A;  1VND A;  1MBH A;  3G1O A;  5J1R A;  3NAR A;  2ZB9 A;  2X9D A;  2XGE A;  2DJN A;  2DMT A;  2DA6 A;  5BNG A;  1HF0 A;  4DYQ A;  4CYC A;  1IJW C;  2K9S A;  3S1N J;  3S1R J;  1IRZ A;  1IDY A;  4A3K J;  4W97 A;  4Y7N J;  2E19 A;  3S16 J;  1T33 A;  2K9Q A;  3BG9 A;  1NTC A;  1Z77 A;  4B1R A;  1H8A C;  1CQT A;  1MH4 A;  5JLW A;  3OOU A;  4L5E A;  2ECB A;  3HDD A;  2DA3 A;  2LFB A;  3HKZ N;  4A3L J;  4IHY A;  4RBO A;  1PUF B;  1RKT A;  1JUP A;  2XGC A;  2ID6 A;  3FK7 A;  2KT0 A;  3ZQL A;  4V2F A;  1LFB A;  1ZQ3 P;  5IYC J;  4BBS J;  3CDL A;  3BR1 A;  1X58 A;  5IPA A;  3LSP A;  2JA6 J;  1U9N A;  2DMN A;  2N8G A;  1LE8 A;  3SJM A;  3IH2 A;  2JA5 J;  4BY7 J;  2YUS A;  4G12 A;  5F0C A;  2R5Z A;  1AKH B;  1WH5 A;  1ZGW A;  4IHX A;  3OSG A;  3BR5 A;  2LTP A;  4EEF G;  3HBL A;  4A3J J;  2CU7 A;  1A6I A;  2COB A;  4D7N A;  3MN2 A;  5E3O A;  3O8H A;  3S15 J;  4MO7 A;  1FEX A;  5J1U A;  5K7Z A;  2HOS A;  5FLV A;  1T56 A;  2GBY A;  1FIP A;  4JX4 A;  1ETK A;  3MKL A;  3BR3 A;  5E3M A;  1B72 A;  5IP9 J;  5IYB J;  3OIO A;  1MBJ A;  2O7O A;  1ZR4 A;  2DA2 A;  1OJL A;  1Q1V A;  1RKW A;  3BR2 A;  3GTM J;  3PO2 J;  3QPL A;  1BA5 A;  2CJJ A;  3RZD J;  2EZL A;  2HXO A;  3H0G J;  5IOZ A;  1QRY A;  5EZH A;  3IV5 A;  5HOD A;  1DU0 A;  2X48 A;  4BBR J;  5K7F A;  3I4M J;  2ME0 A;  5FJ8 J;  5EF6 A;  2M0C A;  1A5J A;  1ETX A;  2R0Q C;  5EYR A;  2VKV A;  3HGG A;  2B63 J;  2LD5 A;  1JKQ C;  2Y9Y A;  3GTG J;  3H3V K;  5FLM J;  2Y0S N;  3GTO J;  3BTI A;  4JP0 A;  3SFI A;  4IEJ A;  3HOU J;  1ZTR A;  4M3E A;  3HB9 A;  2QCO A;  3L1P A;  4A3I J;  1JJ6 C;  2MG4 A;  4MLO A;  5EEA A;  1I3Q J;  3BTC A;  2E2I J;  2XPU A;  5FKN A;  4DZP A;  5M5W J;  1HDP A;  2IAI A;  4C3I J;  2JMW A;  4A3F J;  4IHW A;  3CCY A;  2M9H A;  2DA5 A;  4UUS B;  1G2H A;  1WGX A;  1W0U A;  1IV6 A;  3TW7 A;  3GBG A;  5C44 J;  3UKG A;  2XGD A;  5FKM A;  3TP0 A;  3Q0U A;  3HOX J;  2E2H J;  4FCY A;  5K7H A;  4A3E J;  5F04 A;  3S2D J;  3IH4 A;  4JX5 A;  2GM4 A;  1IGN A;  3DCF A;  1E3O C;  4BKX A;  4BXX J;  5M3M J;  2O8K A;  3IH3 A;  4A3D J;  1IDZ A;  1FIA A;  2HOT A;  3QQA A;  1U8B A;  4JX6 A;  2VI6 A;  1WI3 A;  5DS9 A;  1JTX A;  3CMY A;  1NK2 P;  2LKX A;  5IP7 J;  1TWA J;  1RR7 A;  5EGO B;  2M8G X;  1ETW A;  2VKE A;  2DTZ A;  1JT0 A;  1APL C;  5E3N A;  1Y1V J;  2HI3 A;  5F0H A;  1IUF A;  2JK3 A;  3ZQF A;  5EG0 B;  2EZK A;  2K40 A;  2JN6 A;  2L9R A;  2XSD C;  3JRI A;  1TWH J;  2FD5 A;  4D5C A;  2CQQ A;  9ANT A;  1X2M A;  2FJ1 A;  1SFO J;  5C3E J;  3JRE A;  2NS8 A;  1WPK A;  1ZKG A;  2I10 A;  2L7M P;  3ZQH A;  3CQZ J;  4B3A A;  5M3F J;  1DU6 A;  2Y31 A;  3BR6 A;  2AO9 A;  3LSR A;  2HDD A;  4MFD A;  4A3C J;  2L0K A;  3K2A A;  4M3G A;  1AHD P;  3A03 A;  3Q0W A;  2DA1 A;  1O4X A;  2JA7 J;  5J1Y A;  2DA4 A;  2ID3 A;  3PM1 A;  3PO3 J;  1BW5 A;  1ORK A;  3A01 A;  3BR0 A;  3ZQG A;  1MBF A;  3HOY J;  2E2J J;  3BT9 A;  1FJL A;  2JJ7 A;  1QVT A;  5C4J J;  2M34 A;  1JKP C;  5IOY A;  3M4O J;  2TCT A;  3BG5 A;  2AHQ A;  4FE4 A;  4J19 A;  1MSF C;  2R93 J;  2VUM J;  2L7Z A;  2HXI A;  3GTK J;  1NK3 P;  2RAE A;  3GTQ J;  1ENH A;  1YRN A;  2XPW A;  1XG1 A;  3QPS A;  2LVS A;  1U78 A;  1MBK A;  1BL0 A;  2HQ5 A;  4A3G J;  4ABZ A;  3I4N J;  2NOG A;  1OCT C;  3VPR A;  2ECC A;  4XRS A;  5F27 A;  5IYD J;  1UHS A;  4GFB A;  4DYC A;  5GPC A;  1LE8 B;  1TC3 C;  4V2G A;  3TP3 A;  1W0T A;  4M6V A;  2CRG A;  3GTL J;  1P7J A;  1ITY A;  1GVD A;  2JWT A;  3TED A;  1XS9 A;  2OF7 A;  2YU9 J;  3B6A A;  2DMP A;  2LK2 A;  3O8G A;  3ZQC A;  1SAN A;  4LOC A;  3G1M A;  3NAU A;  3WHB A;  3F0C A;  4FTH A;  2O9L A;  3W6V A;  3A02 A;  5F1J A;  4Y52 J;  4MIM A;  4XID A;  1RET A;  1JTY A;  2FQ4 A;  2XRL A;  2KDZ A;  3S1M J;  3BTJ A;  1Z0X A;  1UMQ A;  4XRM A;  2L7F P;  1K61 A;  3FKI J;  1B72 B;  2FX0 A;  3G1L A;  2X6O A;  1UG2 A;  5M5Y J;  1VFC A;  3GTP J;  3HOV J;  3S17 J;  1JJ8 C;  1JKO C;  5GP9 A;  4RDU A;  2G0E A;  1ETV A;  3JRC A;  4JYK A;  4DW6 A;  2H1K A;  2IBD A;  2EBI A;  1IG7 A;  2D5V A;  5F08 A;  1FTZ A;  4AYB N;  1ETQ A;  2K9N A;  2TRT A;  1PUF A;  3LOC A;  3FIS A;  3BTL A;  3HEF A;  1GV5 A;  4D5F A;  4FE7 A;  5E3L A;  2R5Y B;  3B6C A;  4M3D A;  2E1O A;  2VPR A;  1Y1W J;  1MNM C;  3OSF A;  3JRB A;  1F36 A;  4M3B A;  4C3H J;  1R9T J;  3S1Q J;  1XC5 A;  2NS7 A;  1AKH A;  2EQR A;  3MVP A;  2NVQ J;  2HYJ A;  2DN0 A;  1JGG A;  1HOM A;  2HOA A;  2ELK A;  3TW6 A;  1I50 J;  2WB1 N;  1BW6 A;  2PMZ N;  2MGQ A;  2WAQ N;  3Q3S A;  4A93 J;  3FK6 A;  4FIS A;  2EH3 A;  2NVY J;  1S7E A;  1GDT A;  4XRS G;  1K83 J;  1JUS A;  3ZQI A;  3HM5 A;  2DMU A;  2CQX A;  5FKO A;  2P81 A;  4AUX A;  1MH3 A;  1B8I B;  3HOW J;  1BJZ A;  3LSG A;  4D7M A;  1JKR C;  2R7Z J;  1ZK8 A;  1VI0 A;  2DA7 A;  2EZH A;  3LNQ A;  1AU7 A;  3E7L A;  1U9O A;  2Y30 A;  1MSE C;  2LR8 A;  3BG3 A;  2YS9 A;  5DTD A;  1H88 C;  4C2M J;  2OPT A;  2R92 J;  4W1U A;  4X1E A;  1POG A;  3ZOB A;  1GV2 A;  1F43 A;  2GLO A;  5FKL A;  3JRH A;  4CYC B;  4I76 A;  3JRG A;  4UUT A;  3K7A J;  2CUF A;  2M2E A;  5M5X J;  3BQY A;  1VF9 A;  3D1N I;  5FKK A;  1ETY A;  3JRF A;  1H89 C;  3WHC A;  5J3L A;  1MBG A;  1QVU A;  4BY1 J;  3SDG A;  4A3M J;  2XB5 A;  1OCP A;  3HOZ J;  4X6A J;  2MSY A;  4HNV A;  2LP0 A;  3BQZ A;  3GTJ J;  5EZG A;  4MFE A;  1GUU A;  1OFC X;  3C2B A;  3HGY A;  1TWG J;  4QIW N;  1WH7 A;  2LY9 A;  4I6Z A;  4UUS A;  2R5Z B;  1P7I A;  4DZJ A;  2IEK A;  5C4X J;  1MBE A;  4C3J J;  3JRD A;  3Q0V A;  2DMQ A;  1RES A;  1LFU P;  2Y2Z A;  2EZI A;  3FIW A;  2R5Y A;  2XB0 X;  3A01 B;  4AC0 A;  5GPA A;  4S0H B;  1TWC J;  2QF7 A;  5F0F A;  1JT6 A;  4A3B J;  1JUM A;  1IC8 A;  1D5Y A;  3LSJ A;  4A69 C;  2LLK A;  4QSH A;  2NVT J;  4XIC A;  1X2N A;  3DEW A;  2JA8 J;  3S14 J;  1YRN B;  1EF4 A;  1I6H J;  3JRA A;  2MW8 A;  2Y9Z A;  5EGO A;  4DYR A;  1RPW A;  1HDD C;  2W48 A;  1TWF J;  4B4C A;  5IP6 A;  4M3F A;  2NVX J;  5EG0 A;  5EDN A;  1FTT A;  2H8R A;  1WCM J;  1HLV A;  4IHV A;  3RZO J;  1ETO A;  2XPV A;  3M3Y J;  4NDL A;  4QTR A;  2CUE A;  3S2H J;  3JR9 A;  3RKQ A;  5JLX A;  2ME6 A;  1GT0 C;  2WV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...