1JKPC

Testing the water-mediated hin recombinase dna recognition by systematic mutations
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
47
Chain Sequence
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*TP*GP*TP*TP*TP*TP*TP*GP*AP*GP*AP*AP*GP*A)-3'
publication title Testing water-mediated DNA recognition by the Hin recombinase.
pubmed doi rcsb
molecule tags Dna binding protein/dna
total genus 13
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jkpC00
4B3AA 2HXOA 4W1UA 1IDZA 4A3FJ 4XRMA 3HBLA 3ZQLA 5FKLA 3JRDA 1JJ6C 3G1LA 5IP6A 5F0FA 1OFCX 4QTRA 4IHVA 5C4JJ 1LFBA 4UUSA 2VPRA 5J1UA 1B8IA 1SANA 2DA1A 1K61A 3BTCA 3HOVJ 5FKKA 5K7HA 2L7ZA 1MNMC 1WPKA 3B6CA 4DZPA 3G1MA 3ZQFA 4D5CA 5JLXA 1OCTC 1WCMJ 5JLWA 2G0EA 4A3KJ 4IHWA 2W48A 3QPLA 3QPSA 4M3DA 5GP9A 5E3MA 1NK3P 3HOYJ 1ZTRA 1BA5A 5EZHA 4A3IJ 5IYBJ 3HOXJ 1ZR4A 1T33A 3BG5A 1UHSA 1Y1VJ 2AO9A 1B72B 2Y0SN 3JRCA 2E1OA 3IV5A 4A3BJ 5EEAA 1HOMA 2HQ5A 4JX6A 3F0CA 2FJ1A 2VUMJ 2XPUA 3BR0A 4M3FA 2EBIA 5FKNA 5EDNA 2HDDA 3OSFA 3Q3SA 2DMUA 4A93J 3IH4A 2XPWA 2M9HA 2HOAA 5EGOB 2ECCA 1VNDA 1UMQA 5FKOA 4XK4A 1FIAA 5K7FA 3TP3A 3JRAA 2MSYA 1MBJA 5FLMJ 1JUMA 2LVSA 4D7NA 1GVDA 2ELKA 3LNQA 4FCYA 3LSGA 2KT0A 4IHYA 2R93J 3HEFA 2HYJA 2XB5A 1MBHA 4D7MA 1ZGWA 1X2NA 2JJ7A 3WHBA 4L5EA 2XRLA 1FEXA 4MO7A 2CQQA 1RR7A 2IAIA 1ETQA 4A3GJ 1NK2P 3FK6A 2NVXJ 2IBDA 2M0CA 5HODA 2R5YA 2DA6A 3HGYA 4B4CA 1WGXA 3CDLA 3BR1A 2JN6A 2K40A 1W0TA 3BR3A 2MGQA 3K2AA 1WH5A 5F1JA 5BNGA 2EZKA 4MLOA 3CMYA 1T56A 3E7LA 2ECBA 3FKIJ 1TC3C 3HOZJ 2DMPA 2LY9A 1ETYA 3IH3A 5IP7J 2XSDC 2DMTA 3TW7A 2NVYJ 3M4OJ 5EG0A 3O8GA 4UUSB 3L1PA 2DA4A 1B8IB 3ZQHA 2YS9A 3TP0A 5C4XJ 1IDYA 3WHCA 3BTLA 3S17J 2E2IJ 2WV1A 1U78A 3ZQIA 1W0UA 1TWAJ 5F04A 3BTJA 2WAQN 4QSHA 2DMNA 1MH4A 2K9SA 3RKQA 4IEJA 5C3EJ 2H8RA 2M8GX 2JA6J 2NS7A 1H8AC 1RESA 3LSJA 3GTLJ 4HNVA 2HOSA 1TWFJ 1Z0XA 3HOUJ 3OIOA 3SDGA 3I4NJ 3S14J 2Y9YA 2B63J 3GTMJ 3HDDA 1MH3A 3LSRA 3RZDJ 3JR9A 5M3FJ 1AKHA 3BR5A 3MVPA 3FIWA 2JK3A 5GPAA 5J1RA 4V2GA 3JRIA 2JA5J 2CJJA 2MG4A 3HB9A 3TW6A 5GPCA 4JYKA 3BG3A 1HCRA 4MFEA 4Y52J 1GV2A 5IPAA 3HOWJ 2LD5A 1MBKA 5IP9J 5M5XJ 2DN0A 3A03A 2DA7A 2DMQA 4BBRJ 2VI6A 4IHXA 2HXIA 2K9QA 1LE8B 2O8KA 2R92J 3OOUA 3S15J 1Q1VA 1K83J 1SFOJ 2DA2A 1P7JA 4M3EA 1D5YA 4MIMA 3GTJJ 5M5WJ 3CCYA 2VKVA 3HM5A 5DS9A 3Q0WA 4QIWN 2HOTA 3RZOJ 5F0HA 3GTPJ 1XS9A 3M3YJ 1LE8A 3G1OA 5J3LA 2O9LA 2EZLA 2QF7A 4ABZA 2NVTJ 3BQZA 4XRSA 4M6VA 5FJ8J 5M5YJ 2OPTA 2M34A 5C44J 1RETA 2JWTA 5E3OA 2MW8A 5F0CA 1I6HJ 2R5YB 9ANTA 2DTZA 2L0KA 2LK2A 5FLVA 4DYQA 3HGGA 4EEFG 1U8BA 4JX4A 1XC5A 1PUFB 1Y1WJ 4DW6A 5M3MJ 2ZB9A 2R7ZJ 2Y9ZA 1MBEA 1VFCA 3I4MJ 1E3OC 1WI3A 3ZQCA 1APLC 2EQRA 1JTYA 2XGCA 2HI3A 1FTZA 1TWCJ 1BL0A 2E2HJ 2P81A 3K7AJ 1I50J 1ETKA 1JGGA 5EG0B 2XPVA 4JX5A 3JRGA 1XG1A 2JA8J 4A3DJ 3GTOJ 1PUFA 1F36A 5EF6A 3S2HJ 1IC8A 4A3JJ 3S1MJ 3B6AA 4A3LJ 1ORKA 1POGA 3PM1A 3H3VK 4AUXA 2X9DA 2FD5A 2E19A 2LP0A 3H0GJ 3BTIA 3PO3J 1TWGJ 1RPWA 1IG7A 2N8GA 5J1YA 2LTPA 1FJLA 4DYRA 1G2HA 2M2EA 3GBGA 1MSFC 3S1NJ 1HLVA 1BW5A 1I3QJ 3A01A 1IV6A 2D5VA 4CYCA 1JUPA 1AKHB 4LOCA 1QRYA 3MKLA 1HF0A 3FISA 2DA3A 4I6ZA 3DEWA 3ZQGA 2AHQA 2L9RA 3W6VA 3BG9A 2O7OA 2ID6A 4X6AJ 1TWHJ 1RKTA 2ME0A 2Y30A 4FISA 3LSPA 1ETOA 2YU9J 1S7EA 3QQAA 4BBSJ 4JP0A 2LFBA 1HDPA 1ZK8A 5F08A 1ETXA 3HKZN 1QVTA 2ID3A 2LLKA 4AYBN 4GFBA 1ZQ3P 2CQXA 1ETVA 2XB0X 1VF9A 3SJMA 1A5JA 4C3JJ 2OF7A 1OJLA 1MBFA 4RBOA 4MFDA 3NARA 4BY7J 4M3BA 4AC0A 1JKPC 2RAEA 1HDDC 5FKMA 3S16J 1GDTA 1GUUA 1A6IA 1U9OA 2L7MP 5IOZA 3BT9A 3Q0UA 4XICA 1AHDP 1WH7A 2IEKA 1ITYA 2COBA 2Y2ZA 3TEDA 1JKRC 2EH3A 4A3EJ 2X48A 3RQIA 1JTXA 4G12A 4C3HJ 5IYCJ 3FK7A 4FE4A 2JMWA 3SFIA 4Y7NJ 1ENHA 2I10A 4DYCA 1GV5A 1FTTA 4FTHA 2LKXA 4X1EA 4D5FA 2CUEA 3JRFA 4BY1J 4RDUA 2R0QC 2FQ4A 2JA7J 2CRGA 2L7FP 1ZR2A 3CQZJ 4V2FA 4NDLA 1O4XA 1DU0A 3NAUA 3JRBA 1IGNA 4S0HB 1JKQC 3VPRA 1IJWC 3MN2A 2X6OA 1AU7A 3PO2J 1RKWA 1FIPA 2WB1N 1VI0A 3D1NI 1B72A 1DU6A 2R5ZB 1QPIA 5F27A 2NVQJ 2DA5A 3LOCA 1H88C 4XIDA 1IRZA 1MSEC 1X58A 3GTGJ 5IOYA 2QCOA 2EZIA 2FX0A 3UKGA 2Y31A 3BQYA 2GBYA 4A3CJ 4B1RA 1MBGA 1JJ8C 4M3GA 3S1QJ 3BR6A 2YUSA 3OSGA 4BXXJ 1U9NA 1NTCA 3A02A 3GTKJ 2TCTA 4DZJA 3BR2A 3JREA 5EZGA 1ETWA 1JUSA 2CU7A 2K9NA 2XGDA 1ZKGA 3A01B 2CUFA 4CYCB 2DJNA 2GM4A 2R5ZA 3C2BA 2ME6A 5EGOA 1GT0C 1F43A 3O8HA 4BKXA 2H1KA 5DTDA 4C3IJ 1YRNB 4UUTA 1JT0A 3Q0VA 4XRSG 5IYDJ 1BJZA 5EYRA 1JT6A 5K7ZA 3S1RJ 4I76A 2NS8A 2NOGA 1LFUP 2EZHA 4FE7A 2XGEA 3IH2A 4J19A 1BW6A 1EF4A 2GLOA 2E2JJ 1YRNA 2LR8A 1UG2A 5E3NA 3GTQJ 1IUFA 3ZOBA 5E3LA 4A69C 3DCFA 3JRHA 1JKOC 3S2DJ 1P7IA 1X2MA 1H89C 4W97A 2PMZN 2KDZA 4C2MJ 1QVUA 1Z77A 2VKEA 4A3MJ 1R9TJ 1CQTA 2TRTA 1OCPA
chains in the Genus database with same CATH superfamily
2HXOA 2O3FA 1IDZA 1HW1A 2QA4I 3E97A 2A5WA 2W00A 3CDIA 4G7ZF 4GO1A 5LEJA 3JRDA 2A6HF 3PFYA 5IP6A 4G6TB 4F3QA 2VONA 4S04A 2NAZA 4A2UA 2RGVA 4CCKA 4ZYAA 4UUSA 1R4MB 1B8IA 3DU5A 4YFNF 3QU6A 1YE9A 2QVOA 1JXSA 2F6CA 5K7HA 1MNMC 2JVGA 3B6CA 1Y8QB 3GF2A 4DZPA 3SQNA 2LOOA 1WHUA 3ZQFA 1EJ9A 2HNHA 4M72A 4GDFA 5JLXA 1SD5A 3CLOA 4IO9F 3DKYA 1OCTC 2F4OB 3DPTA 1P9QC 1YX3A 2HS5A 3K1PA 2VBWA 2L9NA 2W48A 4IHWA 2ZKZA 3HIFA 3FXLA 3HKZA 1NK3P 1RRJA 2VASA 3DFGA 1ZTRA 4YG2F 1X3UA 3SFZA 5EZHA 3ESWB 3HRUA 1ZR4A 3QU3A 2X6WA 2EINH 2E1MC 1Y1VJ 2MYSA 5DEQA 1B72B 2KIUA 2CGPA 2KISA 2R7FA 2PI0A 2IS2A 2E1OA 4XNFA 4A3BJ 1QU3A 4E7HA 5HLTA 1VQPI 1RZ4A 3KP2A 3SEZA 5L3GA 5EDNA 5L3BA 4ZZLA 1WJEA 4J01A 3Q3SA 3KYLA 5L3FA 2RREA 3WTSC 2Z9OA 4ZYHA 3IHUA 2R4GA 3ZGKA 4WX9A 4XMYA 4OIOF 3HRTA 4IRGA 2M9HA 5DCMB 1VNDA 1UMQA 1FIAA 2WC2A 2VJJA 5D5UB 3M9AA 4LB5A 3LWFA 5FLMJ 4KMFA 3P7NA 1Z3XA 3I3LA 4FCYA 1K4SA 3LSGA 2PMUA 2R93J 2X1EA 4R79A 3HEFA 4NHJA 1CF7B 2F5CA 4YIRX 2XB5A 3WTTC 4ZYDA 4NNJA 5E17F 3IP4B 3L2QA 3DBLB 3WHBA 2XRLA 1WJ5A 1YJNI 2NVXJ 3ZN1A 4E6KG 2M0CA 5GTIC 3VODA 2AXTC 1MJAA 5HODA 5JI6A 3HGYA 4K2EA 1T2KA 1YIOA 1S9HA 1X3WB 3CDLA 1GHCA 2EWNA 3BR1A 3I53A 3CF5F 3CCEI 1W0TA 2LG4A 2ISYA 2HU9A 3K2AA 3WTZA 1D8KA 5BNGA 1SFEA 2EZKA 4BNCA 4RAGA 1GVJA 1ZRFA 2KRHA 3VFZA 1YHQI 4LB6B 1T56A 3H5AA 1FSHA 3K1MA 1R22A 1RC9A 1TC3C 3HOZJ 3JSOA 4I02A 3I5UA 3OL4A 4OOIA 2IPQX 2PMHA 2E36A 1PP8F 2DMTA 1V4RA 2EFWA 2YX7A 5EG0A 3ZPLA 2W82A 4MGRA 3TP0A 3BTLA 3REOA 4CZCA 2WV1A 4KIBA 1BI0A 5F64A 4AD9A 5AIQA 3RJPA 1W0UA 4WF2A 2WAEA 5H6QA 1G4DA 2ZNYA 2IGOA 2BE5F 2F5EA 3KEYA 4Y17A 1OCCH 4G6QA 2M8GX 1TW3A 5H6RA 2ESHA 3K2ZA 4FT8A 3J7AO 2NS7A 2M7AA 4HNVA 2K3PA 2QENA 3B02A 4HSRA 2HOSA 1P6RA 2QYOA 3NWSA 4EMSA 3LQRA 4CUGA 2B63J 1FSEA 3GTMJ 2DT5A 3FBNB 3LSRA 2DDAA 2XF7A 3DTIA 5M3FJ 1AKHA 3MVPA 2JK3A 2ZJ2A 3T5XA 5J1RA 1TNTA 1U6GA 4PCQA 3NEUA 2DODA 3HB9A 4UVCA 3VB2A 1MMDA 3H9QA 3FM3A 2E60A 1MBKA 3R0JA 3QYEA 1TBXA 2E1MB 5K5QA 3ASNH 1QPMA 2HPIA 2DN0A 1UB9A 2DA7A 2DTRA 3DPLC 4C30A 4BBRJ 4IHXA 3LA2A 5ICFA 3HRSA 4LIVA 2O8KA 2EFOA 2FBIA 5IT9Z 4BE0A 2STWA 3OOUA 5FD5A 1Q1VA 1OYYA 3I59B 4KN7X 2IA0A 4M3EA 3H1CA 3LAPA 2QBYA 2FBKA 3BPVA 5M5WJ 4QPQA 4MQVA 3U2RA 2IA1A 2AS5F 3KEQA 2K5CA 4RA2A 1HQCA 2MC3A 4QIWN 4IOCF 2HOTA 3R6SA 3RZOJ 5DM6F 1TL8A 4A0YA 2IP2A 3K9TA 4U0WA 2OZ6A 1MMNA 4H0EA 4HF1A 2CG4A 2EZLA 4U88A 2HGCA 2Z3YA 1VQ6I 2L3DA 2LBFA 4M6VA 5FJ8J 2H6CA 2OPTA 1DUXC 1QZYA 1U3EM 3TMOA 2R5YB 1WVRA 5LHHA 2LK2A 4O3MA 3OWTA 2XHKA 2IRFG 1W7PD 2EIKH 2M45A 3TDZC 1T08B 3NQOA 3RSNA 2NNYA 2DQRA 2M8EA 1XC5A 4BS9A 3COAC 5M3MJ 1IN5A 2BW3A 2HVQA 1MBEA 3G71I 3W2VA 3ZQCA 1YS6A 1U5TA 2Q0OA 4BJ5C 5L3CA 3ECOA 1FTZA 4ZZDA 1BL0A 3ZQ7A 1PDNC 3PSFA 5GTHC 1U0JA 5JHFA 3HUGA 4EM1A 3JRGA 2BHYA 1A04A 3LMMA 3QP5A 2A61A 1J0RA 1IC8A 2V26A 2QUFA 1B9MA 3DKXA 1PP7U 4CCLA 1YIJI 2CFXA 2Q2EA 2R7VA 1A6QA 2H94A 3PM1A 1VQOI 1GXQA 2FNPA 3A0BC 2X9DA 3QOEA 4OMZA 3WGHA 3OS2A 2V1DA 3GFMA 3H0GJ 3BTIA 2V6EA 1TWGJ 5J1YA 2G7HA 2KZVA 1EH8A 3EUKL 4L9JA 4DYRA 1OR7C 2O5RA 2XIGA 4CICA 1SAUA 1EH6A 2PX9A 3E6MA 4PJ0C 1JUPA 3FHNA 1QRYA 3WU2C 1HF0A 1R5ID 1I3AA 3ZQGA 5JVGF 2DK8A 2ESNA 3WU1B 4LLNA 2BZTA 2O7OA 5IT9K 1OYIA 4UB8C 1TWHJ 3EDPA 1Y0NA 2H27A 3R60A 4LGWA 3RI4A 2YU9J 4BBSJ 1GXPA 1NG6A 1SEUA 4HX4A 4CCNA 1EV7A 3Q9VA 1OISA 3OV8A 1IUYA 2B9SA 1ZQ3P 3DLAA 1A5JA 1KZHA 2V1NA 3FXOA 4D1QA 2QLZA 2R7SA 2FOKA 2OF7A 1BR2A 1HW5A 2R7RA 4H4KC 4RBOA 3MZHA 2M0MA 3BDDA 3MFKA 4N9IA 2TDXA 4IRHA 3OYBA 1YFHA 2JVHA 1R5GA 1FYKA 1J09A 1U9OA 4YIIA 1STZA 3MKWB 3KLOA 3S32A 4CDGA 4BQOA 2LNBA 1AA7A 1J7KA 2COBA 5AIPA 3F21A 2Z2SB 3FXMA 1XX5A 3QPHA 1JTXA 3RQIA 4C3HJ 2OBPA 3PUBA 4BUPA 1DPRA 2KKOA 2KJCA 2I10A 4HQEA 3A2KA 3WODF 4I98B 1GV5A 3S3MA 2CUEA 5KCMA 3WGIA 2VE9A 3Q9SA 4CZZA 1YX5A 3CJRB 2Y0SA 3CQZJ 4V2FA 3CC4I 2A3SA 3K4KA 4GYGA 2OUMA 1C0WA 3ZP5A 2P6TA 4OWRB 3TKYA 2CW8A 5D8LB 1D0ZA 2EFNA 3MN2A 2X6OA 1MD0A 4HYEA 3ABLH 1T38A 1FNNA 3E5XA 1B72A 3V7SA 2ELHA 3R0AA 1QPIA 2K85A 3M1CA 2ZC2A 4RAYA 2LMDA 1IRZA 1P4XA 1IXSB 2EZIA 2C6YA 3TGNA 3OYGA 2Y48A 4ON0A 4KUMA 3UKGA 4PUSA 4XSZF 1Z7LA 2JA2A 4MNUA 4A3CJ 4M3GA 2LF7A 4QPOA 5K5OA 3OSGA 4BXXJ 1NTCA 2GIVA 1AWCA 3GTKJ 4UB6C 4ASNA 4ZYEA 1ZKGA 4KITB 2KHMA 4XLNF 1R4NB 4CYCB 1KYZA 4XR6A 1GT0C 2XGXA 4DOZA 1G6NA 4LMYA 2VOPA 5LGNA 1NG7A 3EQLF 4A5MA 1OCZH 4KN4X 3MZYA 4AM3A 3HPGA 5ICGA 3E5QA 4V19K 1V55H 4ZJZA 3T1BA 3DU6A 2RKHA 1XMAA 1CF7A 1BJZA 3AL0C 2HVRA 1QA6A 2W25A 4XQFA 2EZHA 4FE7A 2A68F 3ONQA 3VOEA 3IH2A 2PJRA 4ZDPA 4BHBA 3V8KA 5J8FA 1SVMA 2OQRA 1LUJB 2R7OA 1UG2A 2XV4S 5LRRA 3H3UA 2L7KA 4Q47A 4HQMA 1P7IA 1X2MA 3NRVA 2F4MB 1HC8A 1K6OA 3QYFA 2X85A 4BJ6C 2PJPA 3K70D 3OYNA 2H6BA 4YIFA 2M1BA 4A3MJ 1ACIA 1LNWA 4A5NA 4W1UA 4WXDA 3ECHA 2DU9A 2CMPA 3EUHC 5FKLA 1TT0A 5J47A 1JJ6C 1R1VA 2FA5A 2Z1DA 3G1LA 2NRAC 3V4GA 2WV0A 3HG9A 1RNLA 2O6GE 2BHZA 4QTRA 2KRCA 4L9VA 1OYWA 2XROA 2WAQA 1VQLI 1E2XA 4OMYA 3D5LA 2KJBA 2NOJB 2VPRA 3OMYA 5CKTA 3VSLA 2DA1A 2DLLA 1IN4A 3E0JB 4HF0A 3FWEA 3BC8A 2PEXA 1WPKA 3K4LA 2BGCA 2P8TA 3VYSB 4M6XA 1D5VA 4D5CA 2FF4A 5J4VA 4RGUA 3OR2C 1SFKA 2VN2A 1YOVB 4AIJA 2ADUA 2XSJC 1WCMJ 3ROUA 5JLWA 1FYMA 3SZGA 4A3KJ 2K9MA 3QPLA 1I1GA 3SZPA 2IS4A 5L3EA 4L0YB 4MTDA 5E3MA 2YPRA 4KIGA 3CCVI 5DUIA 3QWLA 3BG5A 2DT7B 2R7UA 2AO9A 5DD4A 4E7IA 1HA8A 4EGZA 3IV5A 2IGMA 5EEAA 2EB7A 4XSXF 3G6EI 1Y39A 5D8KB 3J81Z 1KA8A 2XPUA 4XLPF 3GX4X 1K78B 1UG0A 1R49A 2O61A 1USTA 1XDUA 3E6BA 3F8NA 1KQ9A 1ON1A 2J5PA 2WY8Q 3FXJA 3H36A 4IPAA 1LEBA 2KP6A 5EGOB 2ECCA 2L01A 3I59A 3KYDB 2HKOA 2V79A 2W1OA 2PBIA 4XLEA 3TP3A 3JRAA 4HAMA 2OQGA 3S3OA 1FOXA 1HSJA 2DT6A 1JUMA 2GOXB 4XLHA 3LNQA 1BOBA 3EYYA 2KT0A 3ZQQA 2CV0A 4F52A 4OIRF 1BR4A 2HYJA 1I27A 3P5JA 3U9GA 1X2NA 1Z6RA 1X1CA 1K7AA 4L5EA 4G9YA 4MO7A 1R6RA 1IN6A 1ULYA 2GXBA 2L9VA 1NK2P 3FK6A 3KFWX 4P55A 3AL0B 2KDOA 3S2WA 2A5YB 3TO9A 3GEZA 4NUBA 2CUZA 2QGUA 3K4NA 2R5YA 2DA6A 2VQLA 1WGXA 2DFIA 2LC2A 4PZJA 3OYAA 2MD5A 2K40A 4NC6A 2ACJA 3VSKA 3CO6C 5DCFA 2YSRA 5GADJ 2BEOA 2X51A 4U7DA 5F1JA 2HKXA 3M8EA 3V7RA 1ZG5A 3FKIJ 1G59A 3RTRA 3M8FA 3KETA 2LY9A 3AFHA 4DJAA 2ELJA 4HLYA 1ETYA 3IH3A 5D4SA 1VZ0A 5BPIA 5CVRA 5E8GA 2XSDC 1SMYF 3M4OJ 2JZYA 3O8GA 5CQGA 1A36A 3L1PA 1IDYA 1B9NA 4PSXA 1VQ5I 2E2IJ 3F8CA 1U78A 2CQNA 3GMEA 2H09A 2X1DA 2Q8KA 1K6YA 1TWAJ 4O5VA 4BXUA 5F04A 1X1AA 4KNYA 1PUEE 1BC8C 1MMSA 1U2WA 3P9CA 3K1NA 4Y4RA 4KDPA 2JA6J 3LFUA 2MLGA 5DV5A 4E7KA 2CQKA 3L9FA 3HOUJ 3OIOA 4ZTFA 3S14J 2Y9YA 2DW4A 4B3XA 3J81K 2V4JC 3RZDJ 4DQ2A 3WU0A 4RGRA 2GA1A 1IF1A 4RM2A 2VBYA 2FOWA 2CJJA 2MG4A 4L9NA 3TW6A 3GCMA 1KGSA 2LH9A 3BG3A 3CDHA 4Y52J 1GV2A 2HDWA 2E34A 3U1KA 2IT0A 4AVZA 3F22A 4EQQA 3TO6A 2BV6A 2DYSH 3KYCB 4AYBA 1LVAA 2DMQA 2VI6A 1TZLA 3BPXA 2NS0A 1LE8B 2ISZA 4IHSA 2OZUA 3FHZA 5LFAA 2R7XA 5IY5H 3T0YA 1UCRA 1BI2A 1ZLJA 3W2WA 3VDXA 2X6XA 1D8JA 3GTJJ 3CCYA 4OIPF 2VKVA 3D5RC 5FRMA 2OTLI 5E79C 2VIXA 3H9JA 5DS9A 2CQ7A 3BG7A 4RS8A 1FMWA 3HTSB 2QQ9A 2ZBKA 4PJJA 3GTPJ 1K79A 4IHTA 4LITA 1MMGA 4II3A 1DGWY 2M4KA 2WA0A 3IC7A 4B47A 1G3WA 1QHHD 2IW5A 2NVTJ 4MEXF 1J2XA 4UXNA 4ESJA 1JGSA 2M34A 2VC0A 3I54A 2JWTA 5E3OA 5EJCA 3I9V2 1I6HJ 2MLKA 1KONA 5E1XA 5FLVA 4DYQA 2FEZA 4FX0A 3LAJA 3CUQC 3HGGA 5ICEA 2FMYA 3CCUI 4CGZA 4PGHA 1U8BA 4JX4A 2E1CA 5A2QZ 3E6CC 3GWZA 2F5DA 1R1TA 3MD2A 3VEPA 5LRSA 3IRRA 4N4OB 3CO7C 5D5XB 1JTYA 4GCVA 4IXAA 2HI3A 2VKHA 4EJUA 3F6VA 5HLHA 2STTA 4A0XA 1MJBA 4Q4ZF 2ZSHB 3K7AJ 4KISA 1I50J 1ETKA 1JGGA 2BY3A 1MMAA 5GAGJ 2X0LA 3BJOA 2VXZA 2ZCWA 3HHHA 2CV1A 2VB6A 1FYLA 4A3DJ 1PUFA 2D1HA 4IOAF 4ETSA 4KICA 2AXLA 3HSRA 3H92A 1Z67A 4XLAA 4A3LJ 1D0XA 3FXKA 1TNSA 4I0BA 1RR8C 1O7FA 4I09A 3H3VK 1X1PA 3GLXA 1ERDA 2E19A 1SMTA 2LP0A 2MBFA 3S3NA 1J9IA 2UWMA 3CC7I 5ILSA 2GOMA 3VYRB 3K70C 5J8CA 5B1AH 2HZTA 4L0ZB 1Z05A 3H3ZA 1G2HA 3IUOA 3GBGA 1MSFC 1NHAA 2ZXIA 3KLNA 1R71A 4BQNA 1HLVA 2EIMH 3BCBA 2B7EA 3FZVA 4CYCA 2FXAA 3DPUA 3QAHA 5HVQC 4LG0B 4I6ZA 1I1SA 1FWZA 1H0MA 2IJLA 3NWTA 2X6YA 3DEWA 1YITI 2KRFA 4CH7A 3FDYA 2V6CA 3BG9A 2ID6A 3RYPA 3PIPF 1YLFA 2K7LA 4Y15A 3EUAA 2ME0A 4BGDA 1MDMB 2Y30A 4FISA 5HDKA 2PLYA 3LSPA 3HXLA 2LF8A 3EETA 4XORA 3ZN0A 2M5WA 1LQ1A 2BY0A 4AIDA 1HDPA 4FQGA 2PMZA 4BJTA 2FQ3A 1ETXA 1I6XA 2MH9A 1QVTA 3WG7H 2ID3A 1LJ9A 2LLKA 3OS1A 1YG2A 1O57A 3PL8A 1ETVA 3HOSA 3CCMI 1TQMA 3FXQA 2XAJA 4C3JJ 4XN3A 1DGRM 1WKMA 3BOQA 3NARA 4MFDA 3OYFA 3ASOH 3KP6A 4M3BA 4AC0A 4JBAA 3K69A 4XLCA 1S72I 1FX7A 1HDDC 3K10A 4E7SA 5FKMA 1YW9A 2EJRA 3BJ6A 1FPQA 1IRXA 3RIRA 4XICA 1WH7A 3KP5A 1NH3A 5A2QK 1F4KA 2EV6A 3SEQA 4B48A 4G94A 2IXSA 1JKRC 2EH3A 3O3KA 4G12A 4C9YA 4FE4A 3SFIA 3FBIB 3EPZA 3LSKA 4BH9A 1BIAA 3VWBA 3P9KA 3S8PA 4HSTA 2W4SA 4EJOA 1F9NA 5ILVA 2AQFA 1R1UA 3L00A 1KU3A 4IJAA 2NVUB 2D2WA 4RDUA 2P5VA 2R0QC 3F9KA 3CUQB 4HNTA 2CRGA 3JAMZ 1Y8RB 1KQ0A 3I64A 2K02A 1DU0A 3NAUA 3K6GA 3CP2A 3OYIA 1I39A 1JKQC 1T0FA 2DCEA 3PO2J 2BXYA 4P5OA 2W57A 2QKLB 2EV0A 4MEYF 1VI0A 3TOBA 2M87A 2RVCA 5F27A 3OL3A 4CXFA 3LA3A 3QODA 2GA2A 4IL6C 1MSEC 1X58A 1W5TA 2FX0A 2K9LA 1D1CA 2RC4A 2Y31A 4B09A 3BZ6A 1K78A 1N75A 2GBYA 1E17A 1SVOA 2XDVA 5DUKA 1L3LA 1JJ8C 5AONA 5EEHA 3ABTA 2KFDA 1JE8A 4KT6A 4QLCU 4PFOA 2TCTA 3JREA 2H8WA 5J4YA 5EZGA 1MW7A 2K9NA 1XGOA 3RKWA 3HYIA 3A01B 3OYMA 2CUFA 1BBYA 3K0LA 3ZMZA 4HBLA 4DGWB 2R5ZA 5EGOA 2ME6A 4U87A 4BKXA 2H1KA 4C3IJ 4RB3C 1YRNB 3OYDA 4F93B 1JT0A 3IAM2 4BL0B 4KFCA 1ZGAA 2B0LA 4XRSG 1O3TA 3RKYA 2A6EF 3CCQI 5IYDJ 1Z7UA 5EYRA 3S1RJ 3A1YA 2P7VB 2IA2A 3DBHB 1EF4A 4XOPA 4D0PA 3WTXC 2A6TA 2GAUA 1IXRC 1OKRA 3ZRGA 1VQ4I 4BAYA 2LR8A 2QKMB 2ZXWH 1IW7F 4UHTA 4FASD 5FLXZ 1YJ9I 1H89C 2RDPA 4W97A 3F6OA 1P4WA 4L9TA 4C2MJ 1Z77A 3SYTA 5D5VB 3DEEA 1Y6IA 2CFOA 2F4IA 3HSEA 2LRDA 1S29A 2RV8A 1R9TJ 1A31A 2KMUA 1OCPA 2YU3A 1WZ2A 4U0YA 2L4AA 4XRMA 4A3FJ 1W5SA 5BPDA 3ZQLA 1Z6TA 3TOAA 2E5NA 2AQEA 1BM9A 4IHVA 1QZZA 5C4JJ 1LFBA 6PAXA 1ZLKA 5J1UA 1SANA 1K61A 3BTCA 5FO5A 2FE3A 4HRIA 5FKKA 1IV8A 5GAEJ 2L7ZA 1QQIA 2V9PA 3JAMK 2L5QA 2L02A 1XMXA 3OR1C 1EKEA 3VYUB 1T6SA 1OMIA 1Z91A 4EVIA 5LGUA 2G0EA 5KVRA 1W36D 3F8MA 3QPSA 3LFKA 1B6AA 4EATA 2Q1ZB 2ZMEC 5BS6A 3FF5A 3KP7A 2O0YA 3HOYJ 2IGNA 4AIHA 4PFPA 3WTUC 1UHSA 2Y0SN 2W84A 3JRCA 1XCBA 1V5EA 1YTYA 1X4OA 4N9HA 1XTAA 4JX6A 2P5LC 2FJ1A 1R5HA 2MABA 1MJ9A 4HA8A 4HX7A 2OC6A 1YYVA 3KZYA 1UJ8A 3OSFA 1UELB 4RLQA 1MNEA 2DXIA 4RAFA 1OPCA 2DMUA 2DO7A 3W6JB 2EIJH 2VT2A 3IH4A 2HOAA 5FKOA 1ON2A 2MSYA 4ZTJA 1FMVA 3E5UA 4MHGA 2HR3A 1QGPA 2LVSA 4D7NA 5K1YA 1HKQA 2ELKA 3CMMA 1ZYRF 1R58A 3TQNA 1U5TC 1SD6A 2LREA 1UFMA 3TDUC 3CCJI 2LKSA 4M74A 4D7MA 2JJ7A 2XKOA 1YW8A 5FLXK 4Y13A 3GZNB 1XN7A 1FEXA 4M73A 2CQQA 5DCMA 1XGMA 4BQAA 2LY1A 4P1WA 2IAIA 1ETQA 3QRFF 4RGXA 3DXJF 1JI8A 1RI7A 2IBDA 1VQNI 3JCUC 2K4BA 4BXFA 1YQAA 4B4CA 4ANJA 4RB0A 2I5UA 4IKFA 3BR3A 1ZGJA 5CLSA 4N0BA 2EPFA 4BHPA 3CMYA 4P9UA 1KU9A 2M3AA 2DFHA 2F5VA 5BQTA 2ECBA 2VQCA 4PJMA 3L2VA 4GYIA 4BACA 1FOWA 2DOAA 1IAWA 1FLIA 4YFXF 5LBQA 2JQ7A 4AIKA 3ZQHA 5C4XJ 3S17J 3HSFA 5B3SH 2UUZA 4AU7A 1XMKA 4JQFA 3WE3A 3RQ4A 3F3XA 2A07F 3B73A 3BTJA 2WAQN 5ICCA 3LQQA 3W2AA 2DMNA 2K9SA 4ENNA 4IEJA 2XAHA 4WXCA 3ULQB 4LLLA 3HRMA 1CGPA 4HEA2 1SFUA 2HYGD 2NNNA 2R7TA 3SZTA 1TWFJ 1F1ZA 3E1SA 3SDGA 2CS3A 4G8XA 2HTSA 4HF2A 1TP4A 4P96A 4A6DA 4F7ZA 3Q5FA 4XLFA 4PJNA 2FRHA 5K5RA 5HDNA 1WJDA 3ABKH 3KEOA 3JR9A 3BR5A 2ZJPF 2K4JA 3FIWA 4LG0A 1RIOH 2ZMEB 3E6DA 2MFZA 2OCEA 5HLIA 2BYVE 2XKPA 1Q1HA 4JYKA 2R7DA 4DNCA 4EJWA 1QBJA 2QBYB 1HCRA 4MFEA 3HOTA 5IPAA 2J5OA 4XBFA 2LD5A 3LSMA 2G7UA 3HOWJ 2WWYA 2GXGA 1MDMA 1BR1A 2RNJA 3A03A 1WI9A 4XL9A 2HXIA 4AVPA 3TO7A 4M71A 5B1BH 5LEKA 4RB2C 1FOKA 2R92J 2FUG2 3RPQA 5TISC 2UXNA 4Q5SF 1EA3A 1S6LA 1K83J 1SFOJ 2DA2A 1P7JA 3H0DA 1ZH5A 3BJAA 3HM5A 4E7JA 2VODA 4IF4A 3FX3A 1ZG1A 3Q0WA 2FNAA 2XAGA 3L2RA 4LK1F 5F0HA 2KIMA 1TW2A 1XS9A 3M3YJ 1UHWA 1LFPA 2ETHA 4A6EA 2F5FA 1VTNC 2ZXHA 3G1OA 1P92A 5J3LA 4ABZA 3HTUA 3OOPA 3GW2A 2DPUA 1YI2I 5HNHA 3BQZA 3ISPA 2KIFA 5M5YJ 1W5CC 4WCGA 3GXOA 3JTHA 2ZO4A 1SAXA 2CW7A 3DEUA 1REPC 2OAZA 4C2TA 2L0KA 2DOEA 3GYHX 1ZELA 2DAOA 4UNOA 1IZ1A 3H5RA 2VT3A 5KAIC 4PJLA 3OY9A 4XRFA 2RQQA 2Y9ZA 1VFCA 1E3OC 4I7HA 2IS1A 1KU7A 2VKDA 1APLC 3UR3C 1WFXA 3CUQA 1WJCA 2WB1A 2HVSA 2E2HJ 1WJAA 3PSIA 5HS7A 2XPVA 4JX5A 1YJWI 1XG1A 3CJQB 4IQ4A 2JA8J 3GTOJ 4HZFA 1FBUA 3RDIA 2OV7A 5EF6A 4BDYA 5CVVA 1XD7A 1A35A 4NQWB 2L2OA 2A05A 3B6AA 4RM3A 3SHFA 2EA4A 1POGA 3I56I 2YR2A 4AUXA 2D45A 2FD5A 3ML6A 4UVBA 4FX4A 4A12A 3KIOA 3C7JA 3PO3J 1RPWA 2DJIA 4BDZA 1IG7A 1USSA 2QEXI 1O7LA 2N8GA 3V7CA 2COMA 2OCCH 2W85A 2XAFA 3EYIA 2Z5UA 2M2EA 1OCOH 1BW5A 3A01A 5CYVA 1L0OC 3R4KA 3IWZA 2QWWA 1XGNA 4ZC3A 1LVKA 3MKLA 3ABMH 3K4CA 1DPUA 2BY2A 3FISA 2DA3A 5DYMA 3D0SA 4NC8A 1OQYA 2L9RA 3W6VA 3HL2A 1FY7A 3N97A 3DTEA 3PFIA 3QP6A 1SVLA 2W7NA 3FMRA 3OYKA 5KHDA 1KQ8A 5CVUA 1RUOA 1BOAA 3PQJA 2DFFA 1R23A 3J7ZI 1N25A 5CPRB 3S93A 2DOFA 3I4PA 3BCAA 2BBYA 4KJZA 2BVMA 2VXDA 2LFBA 4U0VA 1UHMA 3CC2I 3HHGA 1ZK8A 5F08A 3HKZN 5HOOA 1W36C 4AYBN 3LA7A 2BY1A 5TJJA 2CQXA 1KYWA 2XB0X 3SJMA 1N77A 1S3JA 1O3QA 1O3SA 4RMNA 2HQRA 4LG3A 2L9SA 3J80K 1WRJA 4BY7J 5J6XA 4YELA 4BYYA 3S16J 5KNLA 1GDTA 3H35A 1GUUA 2E71A 1J75A 1W7PB 2L7MP 4FHTA 3BT9A 3Q0UA 3ABUA 1W1WE 4CA0A 4F91B 3ERMA 1Y56A 2ZFWA 1ITYA 5B66C 2QSGX 3TEDA 5FROA 1EH7A 4PDKA 3F23A 3H9GA 5FGMA 4HLXA 2JMWA 5FFXA 4Y7NJ 2X4HA 5DD8A 3BROA 4DYCA 1FTTA 4F55A 4FTHA 4L18B 2P6SA 3I0TA 2P5KA 4KIFA 1E3HA 1GLNA 4QWQA 4X1EA 4OINF 4BU2A 3OYCA 4II2A 4D5FA 1VQKI 4IX7A 1I5ZA 4BY1J 2FQ4A 3ZCOA 4IQJA 4ITVA 2L7FP 1ZR2A 2HEOA 3JRBA 1IGNA 3PNYA 3IKVA 3I58A 3IAS2 4NB5A 4BE2A 1AU7A 4CCOA 5TGTA 3BZCA 1FIPA 4XONA 3D1NI 4HNUA 2NVQJ 3BY6A 3TL4X 1DDNA 5ED4A 1FP2A 5FB2A 4X0GA 1H88C 3GTGJ 3CCLI 4RLFA 3MAJA 5HS8A 4HPQA 4OAZA 4B1RA 3GO5A 2CSOA 5KK1A 2JRTA 5F6FA 3BR6A 1U9NA 3CF2A 4YEJA 2IGKA 4I01A 3C18A 2ZNZA 5CQEA 2XGDA 1D1BA 1ETWA 1JUSA 2CU7A 2JUGA 4KA4A 3CCSI 2GWRA 2DJNA 2GM4A 2CWEA 1TLHB 2PJRB 1F43A 4B43A 2ZSIB 3KP4A 2OU2A 4UUTA 1X4PA 3BZKA 2MA3A 3RKXA 4N4NB 1DP3A 1FT9A 4HX8A 5K7ZA 1JT6A 3G3ZA 4I76A 4D9JA 2VE8A 4HV5A 5LHGA 1B4AA 4UVAA 1B59A 3U1DA 1TQIA 2CO5A 2XGEA 2NYXA 5FD6A 4Q48A 1BW6A 2BOLA 5LHIA 2ZFUA 2F2EA 3K4MA 3QYBA 3KZIC 2GLOA 3LL7A 2E2JJ 1V3FA 1H9GA 3DP7A 3RPUA 1G3TA 3GLLA 5HLGA 1QNTA 1OR7A 2HZDA 4Z6YA 1LDKB 5E3LA 3ZOBA 2JSCA 1N78A 1JKOC 5KAFC 3RCOA 5D6FA 2H1LA 2PMZN 1QO0D 2KDZA 2V1UA 4I99C 3CUOA 3OYHA 1IRFA 4R8HA 3MMYB 1ZREA 2Z33A 3AG4H 2RNGA 4G7OF 4M9SA 3HJEA 1MIJA 2W24A 4B3AA 4S05A 3DQVC 4CCMA 3N4MA 2EFQA 2QQ8A 1X3ZB 3HBLA 2DK5A 2O8XA 3AKZA 2WY7Q 2WAFA 3DTKA 1KU2A 5F0FA 1OFCX 2UZKA 2VL8A 3E3VA 1OCRH 3PNVA 3HOVJ 1MNDA 3SXYA 3I55I 1SFXA 3WTWC 4XKWA 3J7AY 1B1BA 2QQBA 5CJ9A 4TV7A 1S7AA 2QQAA 4ZDOA 3G1MA 3M7GA 4MTEA 2XUBA 5D5WB 4PSWA 2D1VA 3T8RA 3UNGC 3L2UA 3WGGA 2CH0A 2K3FA 3FXUA 1XDSA 2G9WA 2XAQA 4M3DA 5GP9A 3DLLF 1YW7A 4GXOA 1TQPA 2NXNB 1BA5A 4A3IJ 1VQMI 1QZEA 5J40A 2FU4A 5IYBJ 3HOXJ 1T33A 1T8IA 4CSWA 1ZRDA 3LSTA 4EV0A 2I8DA 1WSUA 2HFHA 2ZMEA 3GFJA 2E5ZA 5FFZA 4IRIA 3BLYA 1HOMA 2Y0MA 2HQ5A 1H9TA 3F0CA 2VUMJ 2Z16A 2OD5A 3BR0A 4M3FA 2LDUA 2EBIA 1JHHA 5FKNA 2HDDA 5LLQA 2Z99A 3DKWA 4I0AA 2V9KA 4M9ZA 1E3PA 1Z9CA 3JTGA 2LYCA 2MH2A 2V9VA 3U21A 1R00A 3AG1H 2A69F 2KIQA 3KP3A 1HXDA 4U7BA 2K27A 4A93J 2XPWA 3GUDA 2XC7A 1LEAA 4E4HA 1DP7P 3M8JA 4XK4A 5H20A 2VBXA 3MWMA 3C2HA 5K7FA 1MBJA 1XSDA 5DDGA 5D6EA 1GVDA 5L3DA 5BOXA 4CCJA 4IHYA 2XAUA 2QZ8A 4XKVA 4ZYGA 2HPMA 2GZWA 1ZARA 1LPQA 5TRDA 1MBHA 1ZGWA 1BN5A 5E18F 1PJRA 1T39A 2KLOA 3PQKA 1RR7A 2JPCA 4A3GJ 2RQPA 1PVEA 3MEXA 3O2PE 3FMQA 4BEHB 3G2BA 1X1DA 3K4JA 4PK4A 1SD7A 3DBRB 4EM0B 2JN6A 1IN7A 3W6KB 2EV5A 2MGQA 2EK5A 1IXCA 1G3YA 1XSXA 3BG6A 1WH5A 3CJTB 4M6YA 4MLOA 2JT1A 2CV2A 4IVNA 3E7LA 1IO2A 4LD5A 2ZJQF 2KPMA 1BC7C 2DMPA 3WTYC 1ONVA 1UAAA 1HKSA 5IP7J 1MZBA 3KX2A 3TW7A 2NVYJ 4UUSB 2DA4A 1B8IB 2YS9A 5ERIA 3WHCA 2JPBA 1XSVA 2V1XA 3CESA 3ZQIA 2DBBA 2DI3A 4G7HF 3X2QH 5HDGA 3DWLE 2X1CA 4NQWA 3IKTA 1IN8A 1HKTA 3OIQA 1D1AA 2DDBA 4QSHA 3ZMTA 1MH4A 1QHGA 2LSOA 4DIQA 1G3SA 5C3EJ 3GZ6A 3RKQA 1R7JA 3J7YJ 2H8RA 2FSWA 3HZJA 1H8AC 1RESA 3LSJA 3GTLJ 2Y69H 3FMSA 1LDJA 1Z21A 1Z0XA 2OA4A 2BXZA 3I4NJ 2CW0F 4GGGA 5E8IA 4NBQA 3C2GA 3EUHA 3P9IA 1MH3A 4EJVA 3HDDA 2JSPA 1MKMA 4WXHA 4PGGA 5GPAA 4DBRA 2DFEA 1LB2A 4V2GA 3JRIA 2JA5J 1ODDA 1T98A 3DV8A 5GPCA 2P4WA 4WK8F 3ERED 3D5SC 3BP8A 3AG2H 5B5EC 2VJ5A 3A4CA 4AWXB 2XF5A 1S7OA 2VOOA 3V42A 1OLTA 5IP9J 4NC7A 5M5XJ 2VJ4A 5FRNA 3CMEI 4RAZA 3ZMUA 2K9QA 2Y75A 3RYRA 2QSFX 3ELKA 2MD0A 1JHFA 3S15J 2HOEA 2L54A 2MC4A 4HDUA 3O6BB 2DPDA 3WTVC 1D5YA 4CO8A 4MIMA 2IS6A 4LIUA 2EILH 3IL2A 4BQQA 2V7FA 2VC1A 3V8JA 5JR3A 1BJAA 1LE8A 4L5JA 4XOTA 1S5LC 2O9LA 2QF7A 1W7PA 3M07A 5CVJA 2OJED 3ZMSA 4GRIA 4XRSA 1T0FC 2F48A 5LD2C 5DM7F 3A0HC 5C44J 3L2WA 3ZXSA 5GAHJ 3FKJA 1RETA 2MW8A 5F0CA 1WJFA 9ANTA 2DTZA 1J5YA 1FBQA 4IZZA 5LGTA 2QM3A 1LDDA 4EEFG 4WWCA 3KCCA 3WG9A 1ZN2A 3GZ5A 4XKBA 4XM3A 1PUFB 2BVLA 1Y1WJ 4DW6A 1X1BA 2PQ8A 2VQHA 1M1EB 2ZB9A 3CZ6A 1V54H 3WE2A 2R7ZJ 4ENKA 3I4MJ 3ZMDA 1WI3A 4E7LA 1P4AA 2EQRA 2XGCA 3ZR8X 1XGSA 4LK0F 1TWCJ 4UY8I 2RN7A 2P81A 3K4BA 1WWXA 4HV6A 3VYTB 4BHCA 5EG0B 1VQ7I 3FM5A 1K4TA 4XN0A 4L5IA 2PFBA 1SC7A 2VJIA 1F36A 1D0YA 5E1WA 3S2HJ 4HOBA 2PG4A 3IWFA 1E0EA 2EFPA 1Y0UA 4ENJA 4A3JJ 3S1MJ 2JTVA 4ZDLA 2UV1A 1ORKA 4JOMA 1AOYA 3MQ0A 2HDCA 3CJNA 4HG2A 2CYYA 3CLQA 3AAFA 4E7ZA 5D4RA 1Z3YA 3OYJA 1ZHFA 2LTPA 1FJLA 5HS9A 3SDBA 3CCRI 4CHUA 1ZAOA 4I2OA 3C1DA 3S1NJ 4UUVA 1I3QJ 4EGYA 1IV6A 2D5VA 1VQ8I 4UV8A 2DQLA 3M1EA 1BI3A 2KL4A 4LOCA 4UV9A 1AKHB 3GVAA 2R3SA 1FBSA 1V5GA 2YX4A 4C2UA 3PUFA 2ZJRF 2AHQA 3TBIA 2WTEA 4OAYA 1RUNA 2HYFA 1ZG3A 1DQUA 2PN6A 3CP8A 2DYRH 4Y33A 4X6AJ 3QPTA 1RKTA 4ESBA 2JUCA 1LKXA 2HQNA 4DBQA 2L4MA 1ETOA 1S7EA 3QQAA 1Z1DA 4JP0A 2E7WA 1U8RA 3BWGA 3F8FA 2QSHX 4KT5C 5ILUA 4YRVA 1MGTA 3KPHA 4GFBA 5CVIA 1VF9A 3R61A 4FETA 1G8XA 2IVMA 2R7QA 3OYEA 1HSTA 4B44A 4ZH4F 4ESFA 1OJLA 1MBFA 1XCVA 3CMAI 2R7WA 2M4GA 2FMLA 2HTJA 2HQAA 4HW0A 1TT5B 2RAEA 1JKPC 2KZGA 4OU0A 4J00A 4A0ZA 1A6IA 3AG3H 5IOZA 2LBFB 1AHDP 3GFIA 4P9FA 5E20A 1WJBA 2IEKA 2XASA 3N05A 2Y2ZA 4XKCA 2FBHA 4A3EJ 1YS7A 2X48A 3HC7A 3MKZA 5IYCJ 3FK7A 5EEGA 3MKYB 2E35A 2E1NA 4MQ9F 3PIOF 1ENHA 2VBZA 2XF6A 3G4SI 4KYWA 4B8XA 2BW3B 2VLAA 2LKXA 4LLGF 3MCZA 1U5TB 2ZXJA 5JHUA 1BI1A 3JRFA 5F1RA 2E7XA 1FP1D 2M7BA 2WBMA 4O6JA 3J80Z 3G73A 2JA7J 3L7WA 1XPXA 2EA2A 3HUGB 3H5NA 3MZ8A 3JSPA 2OTJI 4NDLA 1O4XA 3CD6I 3DF8A 2LY2A 4F92B 4G6DA 3PJRA 2UXXA 2P7CB 4S0HB 3QOPA 4LJZF 3VPRA 1IJWC 1RKWA 2WB1N 1YO5C 2O03A 1SD4A 2R5ZB 1DU6A 2DA5A 1V5FA 3CTAA 2K86A 3F72A 3LOCA 4XIDA 4ENMA 1O3RA 2XRNA 2Q2EB 5IOYA 2QCOA 3PNTA 1T95A 1PYVA 1WQ2A 3BQYA 4YFKF 4HDVA 2KQRA 1MBGA 3S1QJ 2WADA 2YUSA 1TTYA 3F8BA 3T8TA 3A02A 4EJTA 1S8NA 1F5TA 4DZJA 3BR2A 1UZCA 1R36A 5JVTA 1J59A 3OYLA 4RGSA 5HNFA 1IRGA 3C2BA 2VQGA 3GFLA 3V8LA 2JRMA 3O8HA 1HW2A 4R1HA 3I71A 3C3WA 4LFUA 5DTDA 2CUJA 4KMUX 2VPLA 1ZRCA 3OIPA 5E1ZB 2HWVA 3LSIA 4OIQF 3Q0VA 3LSHA 3HPHA 2P0WA 1X19A 1FOYA 2ICWG 2NS8A 2NOGA 4CYDA 3OS0A 1LFUP 2XVCA 2M30A 3IRQA 2GQQA 5IT3A 3W3CA 3KZZA 4J19A 1D3YA 3JW4A 2GXAA 4E70A 4Y3OA 1P2FA 4M9XA 1XB4A 3L2CA 4Z2YA 1FZPB 4BE1A 1YRNA 5E3NA 3GTQJ 1BIBA 1IUFA 4JK1X 5JFRA 4A69C 3DCFA 4BEHA 4EM2A 3JRHA 1HBXG 3S2DJ 3L09A 3ZMVA 1FC3A 1W4MA 2LKPA 2GIZA 5BMZA 1QVUA 4RB1A 2VKEA 3KE2A 3RPUD 1VQ9I 5H2FC 1CQTA 2TRTA 3FXRA
chains in the Genus database with same CATH topology
4B3AA 2HXOA 4W1UA 1IDZA 4A3FJ 4XRMA 3HBLA 3ZQLA 5FKLA 3JRDA 1JJ6C 3G1LA 5IP6A 5F0FA 1OFCX 4QTRA 4IHVA 5C4JJ 1LFBA 4UUSA 2VPRA 5J1UA 1B8IA 1SANA 2DA1A 1K61A 3BTCA 3HOVJ 5FKKA 5K7HA 2L7ZA 1MNMC 1WPKA 3B6CA 4DZPA 3G1MA 3ZQFA 4D5CA 5JLXA 1OCTC 1WCMJ 5JLWA 2G0EA 4A3KJ 4IHWA 2W48A 3QPLA 3QPSA 4M3DA 5GP9A 5E3MA 1NK3P 3HOYJ 1ZTRA 1BA5A 5EZHA 4A3IJ 5IYBJ 3HOXJ 1ZR4A 1T33A 3BG5A 1UHSA 1Y1VJ 2AO9A 1B72B 2Y0SN 3JRCA 2E1OA 3IV5A 4A3BJ 5EEAA 1HOMA 2HQ5A 4JX6A 3F0CA 2FJ1A 2VUMJ 2XPUA 3BR0A 4M3FA 2EBIA 5FKNA 5EDNA 2HDDA 3OSFA 3Q3SA 2DMUA 4A93J 3IH4A 2XPWA 2M9HA 2HOAA 5EGOB 2ECCA 1VNDA 1UMQA 5FKOA 4XK4A 1FIAA 5K7FA 3TP3A 3JRAA 2MSYA 1MBJA 5FLMJ 1JUMA 2LVSA 4D7NA 1GVDA 2ELKA 3LNQA 4FCYA 3LSGA 2KT0A 4IHYA 2R93J 3HEFA 2HYJA 2XB5A 1MBHA 4D7MA 1ZGWA 1X2NA 2JJ7A 3WHBA 4L5EA 2XRLA 1FEXA 4MO7A 2CQQA 1RR7A 2IAIA 1ETQA 4A3GJ 1NK2P 3FK6A 2NVXJ 2IBDA 2M0CA 5HODA 2R5YA 2DA6A 3HGYA 4B4CA 1WGXA 3CDLA 3BR1A 2JN6A 2K40A 1W0TA 3BR3A 2MGQA 3K2AA 1WH5A 5F1JA 5BNGA 2EZKA 4MLOA 3CMYA 1T56A 3E7LA 2ECBA 3FKIJ 1TC3C 3HOZJ 2DMPA 2LY9A 1ETYA 3IH3A 5IP7J 2XSDC 2DMTA 3TW7A 2NVYJ 3M4OJ 5EG0A 3O8GA 4UUSB 3L1PA 2DA4A 1B8IB 3ZQHA 2YS9A 3TP0A 5C4XJ 1IDYA 3WHCA 3BTLA 3S17J 2E2IJ 2WV1A 1U78A 3ZQIA 1W0UA 1TWAJ 5F04A 3BTJA 2WAQN 4QSHA 2DMNA 1MH4A 2K9SA 3RKQA 4IEJA 5C3EJ 2H8RA 2M8GX 2JA6J 2NS7A 1H8AC 1RESA 3LSJA 3GTLJ 4HNVA 2HOSA 1TWFJ 1Z0XA 3HOUJ 3OIOA 3SDGA 3I4NJ 3S14J 2Y9YA 2B63J 3GTMJ 3HDDA 1MH3A 3LSRA 3RZDJ 3JR9A 5M3FJ 1AKHA 3BR5A 3MVPA 3FIWA 2JK3A 5GPAA 5J1RA 4V2GA 3JRIA 2JA5J 2CJJA 2MG4A 3HB9A 3TW6A 5GPCA 4JYKA 3BG3A 1HCRA 4MFEA 4Y52J 1GV2A 5IPAA 3HOWJ 2LD5A 1MBKA 5IP9J 5M5XJ 2DN0A 3A03A 2DA7A 2DMQA 4BBRJ 2VI6A 4IHXA 2HXIA 2K9QA 1LE8B 2O8KA 2R92J 3OOUA 3S15J 1Q1VA 1K83J 1SFOJ 2DA2A 1P7JA 4M3EA 1D5YA 4MIMA 3GTJJ 5M5WJ 3CCYA 2VKVA 3HM5A 5DS9A 3Q0WA 4QIWN 2HOTA 3RZOJ 5F0HA 3GTPJ 1XS9A 3M3YJ 1LE8A 3G1OA 5J3LA 2O9LA 2EZLA 2QF7A 4ABZA 2NVTJ 3BQZA 4XRSA 4M6VA 5FJ8J 5M5YJ 2OPTA 2M34A 5C44J 1RETA 2JWTA 5E3OA 2MW8A 5F0CA 1I6HJ 2R5YB 9ANTA 2DTZA 2L0KA 2LK2A 5FLVA 4DYQA 3HGGA 4EEFG 1U8BA 4JX4A 1XC5A 1PUFB 1Y1WJ 4DW6A 5M3MJ 2ZB9A 2R7ZJ 2Y9ZA 1MBEA 1VFCA 3I4MJ 1E3OC 1WI3A 3ZQCA 1APLC 2EQRA 1JTYA 2XGCA 2HI3A 1FTZA 1TWCJ 1BL0A 2E2HJ 2P81A 3K7AJ 1I50J 1ETKA 1JGGA 5EG0B 2XPVA 4JX5A 3JRGA 1XG1A 2JA8J 4A3DJ 3GTOJ 1PUFA 1F36A 5EF6A 3S2HJ 1IC8A 4A3JJ 3S1MJ 3B6AA 4A3LJ 1ORKA 1POGA 3PM1A 3H3VK 4AUXA 2X9DA 2FD5A 2E19A 2LP0A 3H0GJ 3BTIA 3PO3J 1TWGJ 1RPWA 1IG7A 2N8GA 5J1YA 2LTPA 1FJLA 4DYRA 1G2HA 2M2EA 3GBGA 1MSFC 3S1NJ 1HLVA 1BW5A 1I3QJ 3A01A 1IV6A 2D5VA 4CYCA 1JUPA 1AKHB 4LOCA 1QRYA 3MKLA 1HF0A 3FISA 2DA3A 4I6ZA 3DEWA 3ZQGA 2AHQA 2L9RA 3W6VA 3BG9A 2O7OA 2ID6A 4X6AJ 1TWHJ 1RKTA 2ME0A 2Y30A 4FISA 3LSPA 1ETOA 2YU9J 1S7EA 3QQAA 4BBSJ 4JP0A 2LFBA 1HDPA 1ZK8A 5F08A 1ETXA 3HKZN 1QVTA 2ID3A 2LLKA 4AYBN 4GFBA 1ZQ3P 2CQXA 1ETVA 2XB0X 1VF9A 3SJMA 1A5JA 4C3JJ 2OF7A 1OJLA 1MBFA 4RBOA 4MFDA 3NARA 4BY7J 4M3BA 4AC0A 1JKPC 2RAEA 1HDDC 5FKMA 3S16J 1GDTA 1GUUA 1A6IA 1U9OA 2L7MP 5IOZA 3BT9A 3Q0UA 4XICA 1AHDP 1WH7A 2IEKA 1ITYA 2COBA 2Y2ZA 3TEDA 1JKRC 2EH3A 4A3EJ 2X48A 3RQIA 1JTXA 4G12A 4C3HJ 5IYCJ 3FK7A 4FE4A 2JMWA 3SFIA 4Y7NJ 1ENHA 2I10A 4DYCA 1GV5A 1FTTA 4FTHA 2LKXA 4X1EA 4D5FA 2CUEA 3JRFA 4BY1J 4RDUA 2R0QC 2FQ4A 2JA7J 2CRGA 2L7FP 1ZR2A 3CQZJ 4V2FA 4NDLA 1O4XA 1DU0A 3NAUA 3JRBA 1IGNA 4S0HB 1JKQC 3VPRA 1IJWC 3MN2A 2X6OA 1AU7A 3PO2J 1RKWA 1FIPA 2WB1N 1VI0A 3D1NI 1B72A 1DU6A 2R5ZB 1QPIA 5F27A 2NVQJ 2DA5A 3LOCA 1H88C 4XIDA 1IRZA 1MSEC 1X58A 3GTGJ 5IOYA 2QCOA 2EZIA 2FX0A 3UKGA 2Y31A 3BQYA 2GBYA 4A3CJ 4B1RA 1MBGA 1JJ8C 4M3GA 3S1QJ 3BR6A 2YUSA 3OSGA 4BXXJ 1U9NA 1NTCA 3A02A 3GTKJ 2TCTA 4DZJA 3BR2A 3JREA 5EZGA 1ETWA 1JUSA 2CU7A 2K9NA 2XGDA 1ZKGA 3A01B 2CUFA 4CYCB 2DJNA 2GM4A 2R5ZA 3C2BA 2ME6A 5EGOA 1GT0C 1F43A 3O8HA 4BKXA 2H1KA 5DTDA 4C3IJ 1YRNB 4UUTA 1JT0A 3Q0VA 4XRSG 5IYDJ 1BJZA 5EYRA 1JT6A 5K7ZA 3S1RJ 4I76A 2NS8A 2NOGA 1LFUP 2EZHA 4FE7A 2XGEA 3IH2A 4J19A 1BW6A 1EF4A 2GLOA 2E2JJ 1YRNA 2LR8A 1UG2A 5E3NA 3GTQJ 1IUFA 3ZOBA 5E3LA 4A69C 3DCFA 3JRHA 1JKOC 3S2DJ 1P7IA 1X2MA 1H89C 4W97A 2PMZN 2KDZA 4C2MJ 1QVUA 1Z77A 2VKEA 4A3MJ 1R9TJ 1CQTA 2TRTA 1OCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3A A;  2HXO A;  4W1U A;  1IDZ A;  4A3F J;  4XRM A;  3HBL A;  3ZQL A;  5FKL A;  3JRD A;  1JJ6 C;  3G1L A;  5IP6 A;  5F0F A;  1OFC X;  4QTR A;  4IHV A;  5C4J J;  1LFB A;  4UUS A;  2VPR A;  5J1U A;  1B8I A;  1SAN A;  2DA1 A;  1K61 A;  3BTC A;  3HOV J;  5FKK A;  5K7H A;  2L7Z A;  1MNM C;  1WPK A;  3B6C A;  4DZP A;  3G1M A;  3ZQF A;  4D5C A;  5JLX A;  1OCT C;  1WCM J;  5JLW A;  2G0E A;  4A3K J;  4IHW A;  2W48 A;  3QPL A;  3QPS A;  4M3D A;  5GP9 A;  5E3M A;  1NK3 P;  3HOY J;  1ZTR A;  1BA5 A;  5EZH A;  4A3I J;  5IYB J;  3HOX J;  1ZR4 A;  1T33 A;  3BG5 A;  1UHS A;  1Y1V J;  2AO9 A;  1B72 B;  2Y0S N;  3JRC A;  2E1O A;  3IV5 A;  4A3B J;  5EEA A;  1HOM A;  2HQ5 A;  4JX6 A;  3F0C A;  2FJ1 A;  2VUM J;  2XPU A;  3BR0 A;  4M3F A;  2EBI A;  5FKN A;  5EDN A;  2HDD A;  3OSF A;  3Q3S A;  2DMU A;  4A93 J;  3IH4 A;  2XPW A;  2M9H A;  2HOA A;  5EGO B;  2ECC A;  1VND A;  1UMQ A;  5FKO A;  4XK4 A;  1FIA A;  5K7F A;  3TP3 A;  3JRA A;  2MSY A;  1MBJ A;  5FLM J;  1JUM A;  2LVS A;  4D7N A;  1GVD A;  2ELK A;  3LNQ A;  4FCY A;  3LSG A;  2KT0 A;  4IHY A;  2R93 J;  3HEF A;  2HYJ A;  2XB5 A;  1MBH A;  4D7M A;  1ZGW A;  1X2N A;  2JJ7 A;  3WHB A;  4L5E A;  2XRL A;  1FEX A;  4MO7 A;  2CQQ A;  1RR7 A;  2IAI A;  1ETQ A;  4A3G J;  1NK2 P;  3FK6 A;  2NVX J;  2IBD A;  2M0C A;  5HOD A;  2R5Y A;  2DA6 A;  3HGY A;  4B4C A;  1WGX A;  3CDL A;  3BR1 A;  2JN6 A;  2K40 A;  1W0T A;  3BR3 A;  2MGQ A;  3K2A A;  1WH5 A;  5F1J A;  5BNG A;  2EZK A;  4MLO A;  3CMY A;  1T56 A;  3E7L A;  2ECB A;  3FKI J;  1TC3 C;  3HOZ J;  2DMP A;  2LY9 A;  1ETY A;  3IH3 A;  5IP7 J;  2XSD C;  2DMT A;  3TW7 A;  2NVY J;  3M4O J;  5EG0 A;  3O8G A;  4UUS B;  3L1P A;  2DA4 A;  1B8I B;  3ZQH A;  2YS9 A;  3TP0 A;  5C4X J;  1IDY A;  3WHC A;  3BTL A;  3S17 J;  2E2I J;  2WV1 A;  1U78 A;  3ZQI A;  1W0U A;  1TWA J;  5F04 A;  3BTJ A;  2WAQ N;  4QSH A;  2DMN A;  1MH4 A;  2K9S A;  3RKQ A;  4IEJ A;  5C3E J;  2H8R A;  2M8G X;  2JA6 J;  2NS7 A;  1H8A C;  1RES A;  3LSJ A;  3GTL J;  4HNV A;  2HOS A;  1TWF J;  1Z0X A;  3HOU J;  3OIO A;  3SDG A;  3I4N J;  3S14 J;  2Y9Y A;  2B63 J;  3GTM J;  3HDD A;  1MH3 A;  3LSR A;  3RZD J;  3JR9 A;  5M3F J;  1AKH A;  3BR5 A;  3MVP A;  3FIW A;  2JK3 A;  5GPA A;  5J1R A;  4V2G A;  3JRI A;  2JA5 J;  2CJJ A;  2MG4 A;  3HB9 A;  3TW6 A;  5GPC A;  4JYK A;  3BG3 A;  1HCR A;  4MFE A;  4Y52 J;  1GV2 A;  5IPA A;  3HOW J;  2LD5 A;  1MBK A;  5IP9 J;  5M5X J;  2DN0 A;  3A03 A;  2DA7 A;  2DMQ A;  4BBR J;  2VI6 A;  4IHX A;  2HXI A;  2K9Q A;  1LE8 B;  2O8K A;  2R92 J;  3OOU A;  3S15 J;  1Q1V A;  1K83 J;  1SFO J;  2DA2 A;  1P7J A;  4M3E A;  1D5Y A;  4MIM A;  3GTJ J;  5M5W J;  3CCY A;  2VKV A;  3HM5 A;  5DS9 A;  3Q0W A;  4QIW N;  2HOT A;  3RZO J;  5F0H A;  3GTP J;  1XS9 A;  3M3Y J;  1LE8 A;  3G1O A;  5J3L A;  2O9L A;  2EZL A;  2QF7 A;  4ABZ A;  2NVT J;  3BQZ A;  4XRS A;  4M6V A;  5FJ8 J;  5M5Y J;  2OPT A;  2M34 A;  5C44 J;  1RET A;  2JWT A;  5E3O A;  2MW8 A;  5F0C A;  1I6H J;  2R5Y B;  9ANT A;  2DTZ A;  2L0K A;  2LK2 A;  5FLV A;  4DYQ A;  3HGG A;  4EEF G;  1U8B A;  4JX4 A;  1XC5 A;  1PUF B;  1Y1W J;  4DW6 A;  5M3M J;  2ZB9 A;  2R7Z J;  2Y9Z A;  1MBE A;  1VFC A;  3I4M J;  1E3O C;  1WI3 A;  3ZQC A;  1APL C;  2EQR A;  1JTY A;  2XGC A;  2HI3 A;  1FTZ A;  1TWC J;  1BL0 A;  2E2H J;  2P81 A;  3K7A J;  1I50 J;  1ETK A;  1JGG A;  5EG0 B;  2XPV A;  4JX5 A;  3JRG A;  1XG1 A;  2JA8 J;  4A3D J;  3GTO J;  1PUF A;  1F36 A;  5EF6 A;  3S2H J;  1IC8 A;  4A3J J;  3S1M J;  3B6A A;  4A3L J;  1ORK A;  1POG A;  3PM1 A;  3H3V K;  4AUX A;  2X9D A;  2FD5 A;  2E19 A;  2LP0 A;  3H0G J;  3BTI A;  3PO3 J;  1TWG J;  1RPW A;  1IG7 A;  2N8G A;  5J1Y A;  2LTP A;  1FJL A;  4DYR A;  1G2H A;  2M2E A;  3GBG A;  1MSF C;  3S1N J;  1HLV A;  1BW5 A;  1I3Q J;  3A01 A;  1IV6 A;  2D5V A;  4CYC A;  1JUP A;  1AKH B;  4LOC A;  1QRY A;  3MKL A;  1HF0 A;  3FIS A;  2DA3 A;  4I6Z A;  3DEW A;  3ZQG A;  2AHQ A;  2L9R A;  3W6V A;  3BG9 A;  2O7O A;  2ID6 A;  4X6A J;  1TWH J;  1RKT A;  2ME0 A;  2Y30 A;  4FIS A;  3LSP A;  1ETO A;  2YU9 J;  1S7E A;  3QQA A;  4BBS J;  4JP0 A;  2LFB A;  1HDP A;  1ZK8 A;  5F08 A;  1ETX A;  3HKZ N;  1QVT A;  2ID3 A;  2LLK A;  4AYB N;  4GFB A;  1ZQ3 P;  2CQX A;  1ETV A;  2XB0 X;  1VF9 A;  3SJM A;  1A5J A;  4C3J J;  2OF7 A;  1OJL A;  1MBF A;  4RBO A;  4MFD A;  3NAR A;  4BY7 J;  4M3B A;  4AC0 A;  1JKP C;  2RAE A;  1HDD C;  5FKM A;  3S16 J;  1GDT A;  1GUU A;  1A6I A;  1U9O A;  2L7M P;  5IOZ A;  3BT9 A;  3Q0U A;  4XIC A;  1AHD P;  1WH7 A;  2IEK A;  1ITY A;  2COB A;  2Y2Z A;  3TED A;  1JKR C;  2EH3 A;  4A3E J;  2X48 A;  3RQI A;  1JTX A;  4G12 A;  4C3H J;  5IYC J;  3FK7 A;  4FE4 A;  2JMW A;  3SFI A;  4Y7N J;  1ENH A;  2I10 A;  4DYC A;  1GV5 A;  1FTT A;  4FTH A;  2LKX A;  4X1E A;  4D5F A;  2CUE A;  3JRF A;  4BY1 J;  4RDU A;  2R0Q C;  2FQ4 A;  2JA7 J;  2CRG A;  2L7F P;  1ZR2 A;  3CQZ J;  4V2F A;  4NDL A;  1O4X A;  1DU0 A;  3NAU A;  3JRB A;  1IGN A;  4S0H B;  1JKQ C;  3VPR A;  1IJW C;  3MN2 A;  2X6O A;  1AU7 A;  3PO2 J;  1RKW A;  1FIP A;  2WB1 N;  1VI0 A;  3D1N I;  1B72 A;  1DU6 A;  2R5Z B;  1QPI A;  5F27 A;  2NVQ J;  2DA5 A;  3LOC A;  1H88 C;  4XID A;  1IRZ A;  1MSE C;  1X58 A;  3GTG J;  5IOY A;  2QCO A;  2EZI A;  2FX0 A;  3UKG A;  2Y31 A;  3BQY A;  2GBY A;  4A3C J;  4B1R A;  1MBG A;  1JJ8 C;  4M3G A;  3S1Q J;  3BR6 A;  2YUS A;  3OSG A;  4BXX J;  1U9N A;  1NTC A;  3A02 A;  3GTK J;  2TCT A;  4DZJ A;  3BR2 A;  3JRE A;  5EZG A;  1ETW A;  1JUS A;  2CU7 A;  2K9N A;  2XGD A;  1ZKG A;  3A01 B;  2CUF A;  4CYC B;  2DJN A;  2GM4 A;  2R5Z A;  3C2B A;  2ME6 A;  5EGO A;  1GT0 C;  1F43 A;  3O8H A;  4BKX A;  2H1K A;  5DTD A;  4C3I J;  1YRN B;  4UUT A;  1JT0 A;  3Q0V A;  4XRS G;  5IYD J;  1BJZ A;  5EYR A;  1JT6 A;  5K7Z A;  3S1R J;  4I76 A;  2NS8 A;  2NOG A;  1LFU P;  2EZH A;  4FE7 A;  2XGE A;  3IH2 A;  4J19 A;  1BW6 A;  1EF4 A;  2GLO A;  2E2J J;  1YRN A;  2LR8 A;  1UG2 A;  5E3N A;  3GTQ J;  1IUF A;  3ZOB A;  5E3L A;  4A69 C;  3DCF A;  3JRH A;  1JKO C;  3S2D J;  1P7I A;  1X2M A;  1H89 C;  4W97 A;  2PMZ N;  2KDZ A;  4C2M J;  1QVU A;  1Z77 A;  2VKE A;  4A3M J;  1R9T J;  1CQT A;  2TRT A;  1OCP A; 
#chains in the Genus database with same CATH topology
 2HXO A;  2O3F A;  1IDZ A;  1HW1 A;  2QA4 I;  3E97 A;  2A5W A;  2W00 A;  3CDI A;  4G7Z F;  4GO1 A;  5LEJ A;  3JRD A;  2A6H F;  3PFY A;  5IP6 A;  4G6T B;  4F3Q A;  2VON A;  4S04 A;  2NAZ A;  4A2U A;  2RGV A;  4CCK A;  4ZYA A;  4UUS A;  1R4M B;  1B8I A;  3DU5 A;  4YFN F;  3QU6 A;  1YE9 A;  2QVO A;  1JXS A;  2F6C A;  5K7H A;  1MNM C;  2JVG A;  3B6C A;  1Y8Q B;  3GF2 A;  4DZP A;  3SQN A;  2LOO A;  1WHU A;  3ZQF A;  1EJ9 A;  2HNH A;  4M72 A;  4GDF A;  5JLX A;  1SD5 A;  3CLO A;  4IO9 F;  3DKY A;  1OCT C;  2F4O B;  3DPT A;  1P9Q C;  1YX3 A;  2HS5 A;  3K1P A;  2VBW A;  2L9N A;  2W48 A;  4IHW A;  2ZKZ A;  3HIF A;  3FXL A;  3HKZ A;  1NK3 P;  1RRJ A;  2VAS A;  3DFG A;  1ZTR A;  4YG2 F;  1X3U A;  3SFZ A;  5EZH A;  3ESW B;  3HRU A;  1ZR4 A;  3QU3 A;  2X6W A;  2EIN H;  2E1M C;  1Y1V J;  2MYS A;  5DEQ A;  1B72 B;  2KIU A;  2CGP A;  2KIS A;  2R7F A;  2PI0 A;  2IS2 A;  2E1O A;  4XNF A;  4A3B J;  1QU3 A;  4E7H A;  5HLT A;  1VQP I;  1RZ4 A;  3KP2 A;  3SEZ A;  5L3G A;  5EDN A;  5L3B A;  4ZZL A;  1WJE A;  4J01 A;  3Q3S A;  3KYL A;  5L3F A;  2RRE A;  3WTS C;  2Z9O A;  4ZYH A;  3IHU A;  2R4G A;  3ZGK A;  4WX9 A;  4XMY A;  4OIO F;  3HRT A;  4IRG A;  2M9H A;  5DCM B;  1VND A;  1UMQ A;  1FIA A;  2WC2 A;  2VJJ A;  5D5U B;  3M9A A;  4LB5 A;  3LWF A;  5FLM J;  4KMF A;  3P7N A;  1Z3X A;  3I3L A;  4FCY A;  1K4S A;  3LSG A;  2PMU A;  2R93 J;  2X1E A;  4R79 A;  3HEF A;  4NHJ A;  1CF7 B;  2F5C A;  4YIR X;  2XB5 A;  3WTT C;  4ZYD A;  4NNJ A;  5E17 F;  3IP4 B;  3L2Q A;  3DBL B;  3WHB A;  2XRL A;  1WJ5 A;  1YJN I;  2NVX J;  3ZN1 A;  4E6K G;  2M0C A;  5GTI C;  3VOD A;  2AXT C;  1MJA A;  5HOD A;  5JI6 A;  3HGY A;  4K2E A;  1T2K A;  1YIO A;  1S9H A;  1X3W B;  3CDL A;  1GHC A;  2EWN A;  3BR1 A;  3I53 A;  3CF5 F;  3CCE I;  1W0T A;  2LG4 A;  2ISY A;  2HU9 A;  3K2A A;  3WTZ A;  1D8K A;  5BNG A;  1SFE A;  2EZK A;  4BNC A;  4RAG A;  1GVJ A;  1ZRF A;  2KRH A;  3VFZ A;  1YHQ I;  4LB6 B;  1T56 A;  3H5A A;  1FSH A;  3K1M A;  1R22 A;  1RC9 A;  1TC3 C;  3HOZ J;  3JSO A;  4I02 A;  3I5U A;  3OL4 A;  4OOI A;  2IPQ X;  2PMH A;  2E36 A;  1PP8 F;  2DMT A;  1V4R A;  2EFW A;  2YX7 A;  5EG0 A;  3ZPL A;  2W82 A;  4MGR A;  3TP0 A;  3BTL A;  3REO A;  4CZC A;  2WV1 A;  4KIB A;  1BI0 A;  5F64 A;  4AD9 A;  5AIQ A;  3RJP A;  1W0U A;  4WF2 A;  2WAE A;  5H6Q A;  1G4D A;  2ZNY A;  2IGO A;  2BE5 F;  2F5E A;  3KEY A;  4Y17 A;  1OCC H;  4G6Q A;  2M8G X;  1TW3 A;  5H6R A;  2ESH A;  3K2Z A;  4FT8 A;  3J7A O;  2NS7 A;  2M7A A;  4HNV A;  2K3P A;  2QEN A;  3B02 A;  4HSR A;  2HOS A;  1P6R A;  2QYO A;  3NWS A;  4EMS A;  3LQR A;  4CUG A;  2B63 J;  1FSE A;  3GTM J;  2DT5 A;  3FBN B;  3LSR A;  2DDA A;  2XF7 A;  3DTI A;  5M3F J;  1AKH A;  3MVP A;  2JK3 A;  2ZJ2 A;  3T5X A;  5J1R A;  1TNT A;  1U6G A;  4PCQ A;  3NEU A;  2DOD A;  3HB9 A;  4UVC A;  3VB2 A;  1MMD A;  3H9Q A;  3FM3 A;  2E60 A;  1MBK A;  3R0J A;  3QYE A;  1TBX A;  2E1M B;  5K5Q A;  3ASN H;  1QPM A;  2HPI A;  2DN0 A;  1UB9 A;  2DA7 A;  2DTR A;  3DPL C;  4C30 A;  4BBR J;  4IHX A;  3LA2 A;  5ICF A;  3HRS A;  4LIV A;  2O8K A;  2EFO A;  2FBI A;  5IT9 Z;  4BE0 A;  2STW A;  3OOU A;  5FD5 A;  1Q1V A;  1OYY A;  3I59 B;  4KN7 X;  2IA0 A;  4M3E A;  3H1C A;  3LAP A;  2QBY A;  2FBK A;  3BPV A;  5M5W J;  4QPQ A;  4MQV A;  3U2R A;  2IA1 A;  2AS5 F;  3KEQ A;  2K5C A;  4RA2 A;  1HQC A;  2MC3 A;  4QIW N;  4IOC F;  2HOT A;  3R6S A;  3RZO J;  5DM6 F;  1TL8 A;  4A0Y A;  2IP2 A;  3K9T A;  4U0W A;  2OZ6 A;  1MMN A;  4H0E A;  4HF1 A;  2CG4 A;  2EZL A;  4U88 A;  2HGC A;  2Z3Y A;  1VQ6 I;  2L3D A;  2LBF A;  4M6V A;  5FJ8 J;  2H6C A;  2OPT A;  1DUX C;  1QZY A;  1U3E M;  3TMO A;  2R5Y B;  1WVR A;  5LHH A;  2LK2 A;  4O3M A;  3OWT A;  2XHK A;  2IRF G;  1W7P D;  2EIK H;  2M45 A;  3TDZ C;  1T08 B;  3NQO A;  3RSN A;  2NNY A;  2DQR A;  2M8E A;  1XC5 A;  4BS9 A;  3COA C;  5M3M J;  1IN5 A;  2BW3 A;  2HVQ A;  1MBE A;  3G71 I;  3W2V A;  3ZQC A;  1YS6 A;  1U5T A;  2Q0O A;  4BJ5 C;  5L3C A;  3ECO A;  1FTZ A;  4ZZD A;  1BL0 A;  3ZQ7 A;  1PDN C;  3PSF A;  5GTH C;  1U0J A;  5JHF A;  3HUG A;  4EM1 A;  3JRG A;  2BHY A;  1A04 A;  3LMM A;  3QP5 A;  2A61 A;  1J0R A;  1IC8 A;  2V26 A;  2QUF A;  1B9M A;  3DKX A;  1PP7 U;  4CCL A;  1YIJ I;  2CFX A;  2Q2E A;  2R7V A;  1A6Q A;  2H94 A;  3PM1 A;  1VQO I;  1GXQ A;  2FNP A;  3A0B C;  2X9D A;  3QOE A;  4OMZ A;  3WGH A;  3OS2 A;  2V1D A;  3GFM A;  3H0G J;  3BTI A;  2V6E A;  1TWG J;  5J1Y A;  2G7H A;  2KZV A;  1EH8 A;  3EUK L;  4L9J A;  4DYR A;  1OR7 C;  2O5R A;  2XIG A;  4CIC A;  1SAU A;  1EH6 A;  2PX9 A;  3E6M A;  4PJ0 C;  1JUP A;  3FHN A;  1QRY A;  3WU2 C;  1HF0 A;  1R5I D;  1I3A A;  3ZQG A;  5JVG F;  2DK8 A;  2ESN A;  3WU1 B;  4LLN A;  2BZT A;  2O7O A;  5IT9 K;  1OYI A;  4UB8 C;  1TWH J;  3EDP A;  1Y0N A;  2H27 A;  3R60 A;  4LGW A;  3RI4 A;  2YU9 J;  4BBS J;  1GXP A;  1NG6 A;  1SEU A;  4HX4 A;  4CCN A;  1EV7 A;  3Q9V A;  1OIS A;  3OV8 A;  1IUY A;  2B9S A;  1ZQ3 P;  3DLA A;  1A5J A;  1KZH A;  2V1N A;  3FXO A;  4D1Q A;  2QLZ A;  2R7S A;  2FOK A;  2OF7 A;  1BR2 A;  1HW5 A;  2R7R A;  4H4K C;  4RBO A;  3MZH A;  2M0M A;  3BDD A;  3MFK A;  4N9I A;  2TDX A;  4IRH A;  3OYB A;  1YFH A;  2JVH A;  1R5G A;  1FYK A;  1J09 A;  1U9O A;  4YII A;  1STZ A;  3MKW B;  3KLO A;  3S32 A;  4CDG A;  4BQO A;  2LNB A;  1AA7 A;  1J7K A;  2COB A;  5AIP A;  3F21 A;  2Z2S B;  3FXM A;  1XX5 A;  3QPH A;  1JTX A;  3RQI A;  4C3H J;  2OBP A;  3PUB A;  4BUP A;  1DPR A;  2KKO A;  2KJC A;  2I10 A;  4HQE A;  3A2K A;  3WOD F;  4I98 B;  1GV5 A;  3S3M A;  2CUE A;  5KCM A;  3WGI A;  2VE9 A;  3Q9S A;  4CZZ A;  1YX5 A;  3CJR B;  2Y0S A;  3CQZ J;  4V2F A;  3CC4 I;  2A3S A;  3K4K A;  4GYG A;  2OUM A;  1C0W A;  3ZP5 A;  2P6T A;  4OWR B;  3TKY A;  2CW8 A;  5D8L B;  1D0Z A;  2EFN A;  3MN2 A;  2X6O A;  1MD0 A;  4HYE A;  3ABL H;  1T38 A;  1FNN A;  3E5X A;  1B72 A;  3V7S A;  2ELH A;  3R0A A;  1QPI A;  2K85 A;  3M1C A;  2ZC2 A;  4RAY A;  2LMD A;  1IRZ A;  1P4X A;  1IXS B;  2EZI A;  2C6Y A;  3TGN A;  3OYG A;  2Y48 A;  4ON0 A;  4KUM A;  3UKG A;  4PUS A;  4XSZ F;  1Z7L A;  2JA2 A;  4MNU A;  4A3C J;  4M3G A;  2LF7 A;  4QPO A;  5K5O A;  3OSG A;  4BXX J;  1NTC A;  2GIV A;  1AWC A;  3GTK J;  4UB6 C;  4ASN A;  4ZYE A;  1ZKG A;  4KIT B;  2KHM A;  4XLN F;  1R4N B;  4CYC B;  1KYZ A;  4XR6 A;  1GT0 C;  2XGX A;  4DOZ A;  1G6N A;  4LMY A;  2VOP A;  5LGN A;  1NG7 A;  3EQL F;  4A5M A;  1OCZ H;  4KN4 X;  3MZY A;  4AM3 A;  3HPG A;  5ICG A;  3E5Q A;  4V19 K;  1V55 H;  4ZJZ A;  3T1B A;  3DU6 A;  2RKH A;  1XMA A;  1CF7 A;  1BJZ A;  3AL0 C;  2HVR A;  1QA6 A;  2W25 A;  4XQF A;  2EZH A;  4FE7 A;  2A68 F;  3ONQ A;  3VOE A;  3IH2 A;  2PJR A;  4ZDP A;  4BHB A;  3V8K A;  5J8F A;  1SVM A;  2OQR A;  1LUJ B;  2R7O A;  1UG2 A;  2XV4 S;  5LRR A;  3H3U A;  2L7K A;  4Q47 A;  4HQM A;  1P7I A;  1X2M A;  3NRV A;  2F4M B;  1HC8 A;  1K6O A;  3QYF A;  2X85 A;  4BJ6 C;  2PJP A;  3K70 D;  3OYN A;  2H6B A;  4YIF A;  2M1B A;  4A3M J;  1ACI A;  1LNW A;  4A5N A;  4W1U A;  4WXD A;  3ECH A;  2DU9 A;  2CMP A;  3EUH C;  5FKL A;  1TT0 A;  5J47 A;  1JJ6 C;  1R1V A;  2FA5 A;  2Z1D A;  3G1L A;  2NRA C;  3V4G A;  2WV0 A;  3HG9 A;  1RNL A;  2O6G E;  2BHZ A;  4QTR A;  2KRC A;  4L9V A;  1OYW A;  2XRO A;  2WAQ A;  1VQL I;  1E2X A;  4OMY A;  3D5L A;  2KJB A;  2NOJ B;  2VPR A;  3OMY A;  5CKT A;  3VSL A;  2DA1 A;  2DLL A;  1IN4 A;  3E0J B;  4HF0 A;  3FWE A;  3BC8 A;  2PEX A;  1WPK A;  3K4L A;  2BGC A;  2P8T A;  3VYS B;  4M6X A;  1D5V A;  4D5C A;  2FF4 A;  5J4V A;  4RGU A;  3OR2 C;  1SFK A;  2VN2 A;  1YOV B;  4AIJ A;  2ADU A;  2XSJ C;  1WCM J;  3ROU A;  5JLW A;  1FYM A;  3SZG A;  4A3K J;  2K9M A;  3QPL A;  1I1G A;  3SZP A;  2IS4 A;  5L3E A;  4L0Y B;  4MTD A;  5E3M A;  2YPR A;  4KIG A;  3CCV I;  5DUI A;  3QWL A;  3BG5 A;  2DT7 B;  2R7U A;  2AO9 A;  5DD4 A;  4E7I A;  1HA8 A;  4EGZ A;  3IV5 A;  2IGM A;  5EEA A;  2EB7 A;  4XSX F;  3G6E I;  1Y39 A;  5D8K B;  3J81 Z;  1KA8 A;  2XPU A;  4XLP F;  3GX4 X;  1K78 B;  1UG0 A;  1R49 A;  2O61 A;  1UST A;  1XDU A;  3E6B A;  3F8N A;  1KQ9 A;  1ON1 A;  2J5P A;  2WY8 Q;  3FXJ A;  3H36 A;  4IPA A;  1LEB A;  2KP6 A;  5EGO B;  2ECC A;  2L01 A;  3I59 A;  3KYD B;  2HKO A;  2V79 A;  2W1O A;  2PBI A;  4XLE A;  3TP3 A;  3JRA A;  4HAM A;  2OQG A;  3S3O A;  1FOX A;  1HSJ A;  2DT6 A;  1JUM A;  2GOX B;  4XLH A;  3LNQ A;  1BOB A;  3EYY A;  2KT0 A;  3ZQQ A;  2CV0 A;  4F52 A;  4OIR F;  1BR4 A;  2HYJ A;  1I27 A;  3P5J A;  3U9G A;  1X2N A;  1Z6R A;  1X1C A;  1K7A A;  4L5E A;  4G9Y A;  4MO7 A;  1R6R A;  1IN6 A;  1ULY A;  2GXB A;  2L9V A;  1NK2 P;  3FK6 A;  3KFW X;  4P55 A;  3AL0 B;  2KDO A;  3S2W A;  2A5Y B;  3TO9 A;  3GEZ A;  4NUB A;  2CUZ A;  2QGU A;  3K4N A;  2R5Y A;  2DA6 A;  2VQL A;  1WGX A;  2DFI A;  2LC2 A;  4PZJ A;  3OYA A;  2MD5 A;  2K40 A;  4NC6 A;  2ACJ A;  3VSK A;  3CO6 C;  5DCF A;  2YSR A;  5GAD J;  2BEO A;  2X51 A;  4U7D A;  5F1J A;  2HKX A;  3M8E A;  3V7R A;  1ZG5 A;  3FKI J;  1G59 A;  3RTR A;  3M8F A;  3KET A;  2LY9 A;  3AFH A;  4DJA A;  2ELJ A;  4HLY A;  1ETY A;  3IH3 A;  5D4S A;  1VZ0 A;  5BPI A;  5CVR A;  5E8G A;  2XSD C;  1SMY F;  3M4O J;  2JZY A;  3O8G A;  5CQG A;  1A36 A;  3L1P A;  1IDY A;  1B9N A;  4PSX A;  1VQ5 I;  2E2I J;  3F8C A;  1U78 A;  2CQN A;  3GME A;  2H09 A;  2X1D A;  2Q8K A;  1K6Y A;  1TWA J;  4O5V A;  4BXU A;  5F04 A;  1X1A A;  4KNY A;  1PUE E;  1BC8 C;  1MMS A;  1U2W A;  3P9C A;  3K1N A;  4Y4R A;  4KDP A;  2JA6 J;  3LFU A;  2MLG A;  5DV5 A;  4E7K A;  2CQK A;  3L9F A;  3HOU J;  3OIO A;  4ZTF A;  3S14 J;  2Y9Y A;  2DW4 A;  4B3X A;  3J81 K;  2V4J C;  3RZD J;  4DQ2 A;  3WU0 A;  4RGR A;  2GA1 A;  1IF1 A;  4RM2 A;  2VBY A;  2FOW A;  2CJJ A;  2MG4 A;  4L9N A;  3TW6 A;  3GCM A;  1KGS A;  2LH9 A;  3BG3 A;  3CDH A;  4Y52 J;  1GV2 A;  2HDW A;  2E34 A;  3U1K A;  2IT0 A;  4AVZ A;  3F22 A;  4EQQ A;  3TO6 A;  2BV6 A;  2DYS H;  3KYC B;  4AYB A;  1LVA A;  2DMQ A;  2VI6 A;  1TZL A;  3BPX A;  2NS0 A;  1LE8 B;  2ISZ A;  4IHS A;  2OZU A;  3FHZ A;  5LFA A;  2R7X A;  5IY5 H;  3T0Y A;  1UCR A;  1BI2 A;  1ZLJ A;  3W2W A;  3VDX A;  2X6X A;  1D8J A;  3GTJ J;  3CCY A;  4OIP F;  2VKV A;  3D5R C;  5FRM A;  2OTL I;  5E79 C;  2VIX A;  3H9J A;  5DS9 A;  2CQ7 A;  3BG7 A;  4RS8 A;  1FMW A;  3HTS B;  2QQ9 A;  2ZBK A;  4PJJ A;  3GTP J;  1K79 A;  4IHT A;  4LIT A;  1MMG A;  4II3 A;  1DGW Y;  2M4K A;  2WA0 A;  3IC7 A;  4B47 A;  1G3W A;  1QHH D;  2IW5 A;  2NVT J;  4MEX F;  1J2X A;  4UXN A;  4ESJ A;  1JGS A;  2M34 A;  2VC0 A;  3I54 A;  2JWT A;  5E3O A;  5EJC A;  3I9V 2;  1I6H J;  2MLK A;  1KON A;  5E1X A;  5FLV A;  4DYQ A;  2FEZ A;  4FX0 A;  3LAJ A;  3CUQ C;  3HGG A;  5ICE A;  2FMY A;  3CCU I;  4CGZ A;  4PGH A;  1U8B A;  4JX4 A;  2E1C A;  5A2Q Z;  3E6C C;  3GWZ A;  2F5D A;  1R1T A;  3MD2 A;  3VEP A;  5LRS A;  3IRR A;  4N4O B;  3CO7 C;  5D5X B;  1JTY A;  4GCV A;  4IXA A;  2HI3 A;  2VKH A;  4EJU A;  3F6V A;  5HLH A;  2STT A;  4A0X A;  1MJB A;  4Q4Z F;  2ZSH B;  3K7A J;  4KIS A;  1I50 J;  1ETK A;  1JGG A;  2BY3 A;  1MMA A;  5GAG J;  2X0L A;  3BJO A;  2VXZ A;  2ZCW A;  3HHH A;  2CV1 A;  2VB6 A;  1FYL A;  4A3D J;  1PUF A;  2D1H A;  4IOA F;  4ETS A;  4KIC A;  2AXL A;  3HSR A;  3H92 A;  1Z67 A;  4XLA A;  4A3L J;  1D0X A;  3FXK A;  1TNS A;  4I0B A;  1RR8 C;  1O7F A;  4I09 A;  3H3V K;  1X1P A;  3GLX A;  1ERD A;  2E19 A;  1SMT A;  2LP0 A;  2MBF A;  3S3N A;  1J9I A;  2UWM A;  3CC7 I;  5ILS A;  2GOM A;  3VYR B;  3K70 C;  5J8C A;  5B1A H;  2HZT A;  4L0Z B;  1Z05 A;  3H3Z A;  1G2H A;  3IUO A;  3GBG A;  1MSF C;  1NHA A;  2ZXI A;  3KLN A;  1R71 A;  4BQN A;  1HLV A;  2EIM H;  3BCB A;  2B7E A;  3FZV A;  4CYC A;  2FXA A;  3DPU A;  3QAH A;  5HVQ C;  4LG0 B;  4I6Z A;  1I1S A;  1FWZ A;  1H0M A;  2IJL A;  3NWT A;  2X6Y A;  3DEW A;  1YIT I;  2KRF A;  4CH7 A;  3FDY A;  2V6C A;  3BG9 A;  2ID6 A;  3RYP A;  3PIP F;  1YLF A;  2K7L A;  4Y15 A;  3EUA A;  2ME0 A;  4BGD A;  1MDM B;  2Y30 A;  4FIS A;  5HDK A;  2PLY A;  3LSP A;  3HXL A;  2LF8 A;  3EET A;  4XOR A;  3ZN0 A;  2M5W A;  1LQ1 A;  2BY0 A;  4AID A;  1HDP A;  4FQG A;  2PMZ A;  4BJT A;  2FQ3 A;  1ETX A;  1I6X A;  2MH9 A;  1QVT A;  3WG7 H;  2ID3 A;  1LJ9 A;  2LLK A;  3OS1 A;  1YG2 A;  1O57 A;  3PL8 A;  1ETV A;  3HOS A;  3CCM I;  1TQM A;  3FXQ A;  2XAJ A;  4C3J J;  4XN3 A;  1DGR M;  1WKM A;  3BOQ A;  3NAR A;  4MFD A;  3OYF A;  3ASO H;  3KP6 A;  4M3B A;  4AC0 A;  4JBA A;  3K69 A;  4XLC A;  1S72 I;  1FX7 A;  1HDD C;  3K10 A;  4E7S A;  5FKM A;  1YW9 A;  2EJR A;  3BJ6 A;  1FPQ A;  1IRX A;  3RIR A;  4XIC A;  1WH7 A;  3KP5 A;  1NH3 A;  5A2Q K;  1F4K A;  2EV6 A;  3SEQ A;  4B48 A;  4G94 A;  2IXS A;  1JKR C;  2EH3 A;  3O3K A;  4G12 A;  4C9Y A;  4FE4 A;  3SFI A;  3FBI B;  3EPZ A;  3LSK A;  4BH9 A;  1BIA A;  3VWB A;  3P9K A;  3S8P A;  4HST A;  2W4S A;  4EJO A;  1F9N A;  5ILV A;  2AQF A;  1R1U A;  3L00 A;  1KU3 A;  4IJA A;  2NVU B;  2D2W A;  4RDU A;  2P5V A;  2R0Q C;  3F9K A;  3CUQ B;  4HNT A;  2CRG A;  3JAM Z;  1Y8R B;  1KQ0 A;  3I64 A;  2K02 A;  1DU0 A;  3NAU A;  3K6G A;  3CP2 A;  3OYI A;  1I39 A;  1JKQ C;  1T0F A;  2DCE A;  3PO2 J;  2BXY A;  4P5O A;  2W57 A;  2QKL B;  2EV0 A;  4MEY F;  1VI0 A;  3TOB A;  2M87 A;  2RVC A;  5F27 A;  3OL3 A;  4CXF A;  3LA3 A;  3QOD A;  2GA2 A;  4IL6 C;  1MSE C;  1X58 A;  1W5T A;  2FX0 A;  2K9L A;  1D1C A;  2RC4 A;  2Y31 A;  4B09 A;  3BZ6 A;  1K78 A;  1N75 A;  2GBY A;  1E17 A;  1SVO A;  2XDV A;  5DUK A;  1L3L A;  1JJ8 C;  5AON A;  5EEH A;  3ABT A;  2KFD A;  1JE8 A;  4KT6 A;  4QLC U;  4PFO A;  2TCT A;  3JRE A;  2H8W A;  5J4Y A;  5EZG A;  1MW7 A;  2K9N A;  1XGO A;  3RKW A;  3HYI A;  3A01 B;  3OYM A;  2CUF A;  1BBY A;  3K0L A;  3ZMZ A;  4HBL A;  4DGW B;  2R5Z A;  5EGO A;  2ME6 A;  4U87 A;  4BKX A;  2H1K A;  4C3I J;  4RB3 C;  1YRN B;  3OYD A;  4F93 B;  1JT0 A;  3IAM 2;  4BL0 B;  4KFC A;  1ZGA A;  2B0L A;  4XRS G;  1O3T A;  3RKY A;  2A6E F;  3CCQ I;  5IYD J;  1Z7U A;  5EYR A;  3S1R J;  3A1Y A;  2P7V B;  2IA2 A;  3DBH B;  1EF4 A;  4XOP A;  4D0P A;  3WTX C;  2A6T A;  2GAU A;  1IXR C;  1OKR A;  3ZRG A;  1VQ4 I;  4BAY A;  2LR8 A;  2QKM B;  2ZXW H;  1IW7 F;  4UHT A;  4FAS D;  5FLX Z;  1YJ9 I;  1H89 C;  2RDP A;  4W97 A;  3F6O A;  1P4W A;  4L9T A;  4C2M J;  1Z77 A;  3SYT A;  5D5V B;  3DEE A;  1Y6I A;  2CFO A;  2F4I A;  3HSE A;  2LRD A;  1S29 A;  2RV8 A;  1R9T J;  1A31 A;  2KMU A;  1OCP A;  2YU3 A;  1WZ2 A;  4U0Y A;  2L4A A;  4XRM A;  4A3F J;  1W5S A;  5BPD A;  3ZQL A;  1Z6T A;  3TOA A;  2E5N A;  2AQE A;  1BM9 A;  4IHV A;  1QZZ A;  5C4J J;  1LFB A;  6PAX A;  1ZLK A;  5J1U A;  1SAN A;  1K61 A;  3BTC A;  5FO5 A;  2FE3 A;  4HRI A;  5FKK A;  1IV8 A;  5GAE J;  2L7Z A;  1QQI A;  2V9P A;  3JAM K;  2L5Q A;  2L02 A;  1XMX A;  3OR1 C;  1EKE A;  3VYU B;  1T6S A;  1OMI A;  1Z91 A;  4EVI A;  5LGU A;  2G0E A;  5KVR A;  1W36 D;  3F8M A;  3QPS A;  3LFK A;  1B6A A;  4EAT A;  2Q1Z B;  2ZME C;  5BS6 A;  3FF5 A;  3KP7 A;  2O0Y A;  3HOY J;  2IGN A;  4AIH A;  4PFP A;  3WTU C;  1UHS A;  2Y0S N;  2W84 A;  3JRC A;  1XCB A;  1V5E A;  1YTY A;  1X4O A;  4N9H A;  1XTA A;  4JX6 A;  2P5L C;  2FJ1 A;  1R5H A;  2MAB A;  1MJ9 A;  4HA8 A;  4HX7 A;  2OC6 A;  1YYV A;  3KZY A;  1UJ8 A;  3OSF A;  1UEL B;  4RLQ A;  1MNE A;  2DXI A;  4RAF A;  1OPC A;  2DMU A;  2DO7 A;  3W6J B;  2EIJ H;  2VT2 A;  3IH4 A;  2HOA A;  5FKO A;  1ON2 A;  2MSY A;  4ZTJ A;  1FMV A;  3E5U A;  4MHG A;  2HR3 A;  1QGP A;  2LVS A;  4D7N A;  5K1Y A;  1HKQ A;  2ELK A;  3CMM A;  1ZYR F;  1R58 A;  3TQN A;  1U5T C;  1SD6 A;  2LRE A;  1UFM A;  3TDU C;  3CCJ I;  2LKS A;  4M74 A;  4D7M A;  2JJ7 A;  2XKO A;  1YW8 A;  5FLX K;  4Y13 A;  3GZN B;  1XN7 A;  1FEX A;  4M73 A;  2CQQ A;  5DCM A;  1XGM A;  4BQA A;  2LY1 A;  4P1W A;  2IAI A;  1ETQ A;  3QRF F;  4RGX A;  3DXJ F;  1JI8 A;  1RI7 A;  2IBD A;  1VQN I;  3JCU C;  2K4B A;  4BXF A;  1YQA A;  4B4C A;  4ANJ A;  4RB0 A;  2I5U A;  4IKF A;  3BR3 A;  1ZGJ A;  5CLS A;  4N0B A;  2EPF A;  4BHP A;  3CMY A;  4P9U A;  1KU9 A;  2M3A A;  2DFH A;  2F5V A;  5BQT A;  2ECB A;  2VQC A;  4PJM A;  3L2V A;  4GYI A;  4BAC A;  1FOW A;  2DOA A;  1IAW A;  1FLI A;  4YFX F;  5LBQ A;  2JQ7 A;  4AIK A;  3ZQH A;  5C4X J;  3S17 J;  3HSF A;  5B3S H;  2UUZ A;  4AU7 A;  1XMK A;  4JQF A;  3WE3 A;  3RQ4 A;  3F3X A;  2A07 F;  3B73 A;  3BTJ A;  2WAQ N;  5ICC A;  3LQQ A;  3W2A A;  2DMN A;  2K9S A;  4ENN A;  4IEJ A;  2XAH A;  4WXC A;  3ULQ B;  4LLL A;  3HRM A;  1CGP A;  4HEA 2;  1SFU A;  2HYG D;  2NNN A;  2R7T A;  3SZT A;  1TWF J;  1F1Z A;  3E1S A;  3SDG A;  2CS3 A;  4G8X A;  2HTS A;  4HF2 A;  1TP4 A;  4P96 A;  4A6D A;  4F7Z A;  3Q5F A;  4XLF A;  4PJN A;  2FRH A;  5K5R A;  5HDN A;  1WJD A;  3ABK H;  3KEO A;  3JR9 A;  3BR5 A;  2ZJP F;  2K4J A;  3FIW A;  4LG0 A;  1RIO H;  2ZME B;  3E6D A;  2MFZ A;  2OCE A;  5HLI A;  2BYV E;  2XKP A;  1Q1H A;  4JYK A;  2R7D A;  4DNC A;  4EJW A;  1QBJ A;  2QBY B;  1HCR A;  4MFE A;  3HOT A;  5IPA A;  2J5O A;  4XBF A;  2LD5 A;  3LSM A;  2G7U A;  3HOW J;  2WWY A;  2GXG A;  1MDM A;  1BR1 A;  2RNJ A;  3A03 A;  1WI9 A;  4XL9 A;  2HXI A;  4AVP A;  3TO7 A;  4M71 A;  5B1B H;  5LEK A;  4RB2 C;  1FOK A;  2R92 J;  2FUG 2;  3RPQ A;  5TIS C;  2UXN A;  4Q5S F;  1EA3 A;  1S6L A;  1K83 J;  1SFO J;  2DA2 A;  1P7J A;  3H0D A;  1ZH5 A;  3BJA A;  3HM5 A;  4E7J A;  2VOD A;  4IF4 A;  3FX3 A;  1ZG1 A;  3Q0W A;  2FNA A;  2XAG A;  3L2R A;  4LK1 F;  5F0H A;  2KIM A;  1TW2 A;  1XS9 A;  3M3Y J;  1UHW A;  1LFP A;  2ETH A;  4A6E A;  2F5F A;  1VTN C;  2ZXH A;  3G1O A;  1P92 A;  5J3L A;  4ABZ A;  3HTU A;  3OOP A;  3GW2 A;  2DPU A;  1YI2 I;  5HNH A;  3BQZ A;  3ISP A;  2KIF A;  5M5Y J;  1W5C C;  4WCG A;  3GXO A;  3JTH A;  2ZO4 A;  1SAX A;  2CW7 A;  3DEU A;  1REP C;  2OAZ A;  4C2T A;  2L0K A;  2DOE A;  3GYH X;  1ZEL A;  2DAO A;  4UNO A;  1IZ1 A;  3H5R A;  2VT3 A;  5KAI C;  4PJL A;  3OY9 A;  4XRF A;  2RQQ A;  2Y9Z A;  1VFC A;  1E3O C;  4I7H A;  2IS1 A;  1KU7 A;  2VKD A;  1APL C;  3UR3 C;  1WFX A;  3CUQ A;  1WJC A;  2WB1 A;  2HVS A;  2E2H J;  1WJA A;  3PSI A;  5HS7 A;  2XPV A;  4JX5 A;  1YJW I;  1XG1 A;  3CJQ B;  4IQ4 A;  2JA8 J;  3GTO J;  4HZF A;  1FBU A;  3RDI A;  2OV7 A;  5EF6 A;  4BDY A;  5CVV A;  1XD7 A;  1A35 A;  4NQW B;  2L2O A;  2A05 A;  3B6A A;  4RM3 A;  3SHF A;  2EA4 A;  1POG A;  3I56 I;  2YR2 A;  4AUX A;  2D45 A;  2FD5 A;  3ML6 A;  4UVB A;  4FX4 A;  4A12 A;  3KIO A;  3C7J A;  3PO3 J;  1RPW A;  2DJI A;  4BDZ A;  1IG7 A;  1USS A;  2QEX I;  1O7L A;  2N8G A;  3V7C A;  2COM A;  2OCC H;  2W85 A;  2XAF A;  3EYI A;  2Z5U A;  2M2E A;  1OCO H;  1BW5 A;  3A01 A;  5CYV A;  1L0O C;  3R4K A;  3IWZ A;  2QWW A;  1XGN A;  4ZC3 A;  1LVK A;  3MKL A;  3ABM H;  3K4C A;  1DPU A;  2BY2 A;  3FIS A;  2DA3 A;  5DYM A;  3D0S A;  4NC8 A;  1OQY A;  2L9R A;  3W6V A;  3HL2 A;  1FY7 A;  3N97 A;  3DTE A;  3PFI A;  3QP6 A;  1SVL A;  2W7N A;  3FMR A;  3OYK A;  5KHD A;  1KQ8 A;  5CVU A;  1RUO A;  1BOA A;  3PQJ A;  2DFF A;  1R23 A;  3J7Z I;  1N25 A;  5CPR B;  3S93 A;  2DOF A;  3I4P A;  3BCA A;  2BBY A;  4KJZ A;  2BVM A;  2VXD A;  2LFB A;  4U0V A;  1UHM A;  3CC2 I;  3HHG A;  1ZK8 A;  5F08 A;  3HKZ N;  5HOO A;  1W36 C;  4AYB N;  3LA7 A;  2BY1 A;  5TJJ A;  2CQX A;  1KYW A;  2XB0 X;  3SJM A;  1N77 A;  1S3J A;  1O3Q A;  1O3S A;  4RMN A;  2HQR A;  4LG3 A;  2L9S A;  3J80 K;  1WRJ A;  4BY7 J;  5J6X A;  4YEL A;  4BYY A;  3S16 J;  5KNL A;  1GDT A;  3H35 A;  1GUU A;  2E71 A;  1J75 A;  1W7P B;  2L7M P;  4FHT A;  3BT9 A;  3Q0U A;  3ABU A;  1W1W E;  4CA0 A;  4F91 B;  3ERM A;  1Y56 A;  2ZFW A;  1ITY A;  5B66 C;  2QSG X;  3TED A;  5FRO A;  1EH7 A;  4PDK A;  3F23 A;  3H9G A;  5FGM A;  4HLX A;  2JMW A;  5FFX A;  4Y7N J;  2X4H A;  5DD8 A;  3BRO A;  4DYC A;  1FTT A;  4F55 A;  4FTH A;  4L18 B;  2P6S A;  3I0T A;  2P5K A;  4KIF A;  1E3H A;  1GLN A;  4QWQ A;  4X1E A;  4OIN F;  4BU2 A;  3OYC A;  4II2 A;  4D5F A;  1VQK I;  4IX7 A;  1I5Z A;  4BY1 J;  2FQ4 A;  3ZCO A;  4IQJ A;  4ITV A;  2L7F P;  1ZR2 A;  2HEO A;  3JRB A;  1IGN A;  3PNY A;  3IKV A;  3I58 A;  3IAS 2;  4NB5 A;  4BE2 A;  1AU7 A;  4CCO A;  5TGT A;  3BZC A;  1FIP A;  4XON A;  3D1N I;  4HNU A;  2NVQ J;  3BY6 A;  3TL4 X;  1DDN A;  5ED4 A;  1FP2 A;  5FB2 A;  4X0G A;  1H88 C;  3GTG J;  3CCL I;  4RLF A;  3MAJ A;  5HS8 A;  4HPQ A;  4OAZ A;  4B1R A;  3GO5 A;  2CSO A;  5KK1 A;  2JRT A;  5F6F A;  3BR6 A;  1U9N A;  3CF2 A;  4YEJ A;  2IGK A;  4I01 A;  3C18 A;  2ZNZ A;  5CQE A;  2XGD A;  1D1B A;  1ETW A;  1JUS A;  2CU7 A;  2JUG A;  4KA4 A;  3CCS I;  2GWR A;  2DJN A;  2GM4 A;  2CWE A;  1TLH B;  2PJR B;  1F43 A;  4B43 A;  2ZSI B;  3KP4 A;  2OU2 A;  4UUT A;  1X4P A;  3BZK A;  2MA3 A;  3RKX A;  4N4N B;  1DP3 A;  1FT9 A;  4HX8 A;  5K7Z A;  1JT6 A;  3G3Z A;  4I76 A;  4D9J A;  2VE8 A;  4HV5 A;  5LHG A;  1B4A A;  4UVA A;  1B59 A;  3U1D A;  1TQI A;  2CO5 A;  2XGE A;  2NYX A;  5FD6 A;  4Q48 A;  1BW6 A;  2BOL A;  5LHI A;  2ZFU A;  2F2E A;  3K4M A;  3QYB A;  3KZI C;  2GLO A;  3LL7 A;  2E2J J;  1V3F A;  1H9G A;  3DP7 A;  3RPU A;  1G3T A;  3GLL A;  5HLG A;  1QNT A;  1OR7 A;  2HZD A;  4Z6Y A;  1LDK B;  5E3L A;  3ZOB A;  2JSC A;  1N78 A;  1JKO C;  5KAF C;  3RCO A;  5D6F A;  2H1L A;  2PMZ N;  1QO0 D;  2KDZ A;  2V1U A;  4I99 C;  3CUO A;  3OYH A;  1IRF A;  4R8H A;  3MMY B;  1ZRE A;  2Z33 A;  3AG4 H;  2RNG A;  4G7O F;  4M9S A;  3HJE A;  1MIJ A;  2W24 A;  4B3A A;  4S05 A;  3DQV C;  4CCM A;  3N4M A;  2EFQ A;  2QQ8 A;  1X3Z B;  3HBL A;  2DK5 A;  2O8X A;  3AKZ A;  2WY7 Q;  2WAF A;  3DTK A;  1KU2 A;  5F0F A;  1OFC X;  2UZK A;  2VL8 A;  3E3V A;  1OCR H;  3PNV A;  3HOV J;  1MND A;  3SXY A;  3I55 I;  1SFX A;  3WTW C;  4XKW A;  3J7A Y;  1B1B A;  2QQB A;  5CJ9 A;  4TV7 A;  1S7A A;  2QQA A;  4ZDO A;  3G1M A;  3M7G A;  4MTE A;  2XUB A;  5D5W B;  4PSW A;  2D1V A;  3T8R A;  3UNG C;  3L2U A;  3WGG A;  2CH0 A;  2K3F A;  3FXU A;  1XDS A;  2G9W A;  2XAQ A;  4M3D A;  5GP9 A;  3DLL F;  1YW7 A;  4GXO A;  1TQP A;  2NXN B;  1BA5 A;  4A3I J;  1VQM I;  1QZE A;  5J40 A;  2FU4 A;  5IYB J;  3HOX J;  1T33 A;  1T8I A;  4CSW A;  1ZRD A;  3LST A;  4EV0 A;  2I8D A;  1WSU A;  2HFH A;  2ZME A;  3GFJ A;  2E5Z A;  5FFZ A;  4IRI A;  3BLY A;  1HOM A;  2Y0M A;  2HQ5 A;  1H9T A;  3F0C A;  2VUM J;  2Z16 A;  2OD5 A;  3BR0 A;  4M3F A;  2LDU A;  2EBI A;  1JHH A;  5FKN A;  2HDD A;  5LLQ A;  2Z99 A;  3DKW A;  4I0A A;  2V9K A;  4M9Z A;  1E3P A;  1Z9C A;  3JTG A;  2LYC A;  2MH2 A;  2V9V A;  3U21 A;  1R00 A;  3AG1 H;  2A69 F;  2KIQ A;  3KP3 A;  1HXD A;  4U7B A;  2K27 A;  4A93 J;  2XPW A;  3GUD A;  2XC7 A;  1LEA A;  4E4H A;  1DP7 P;  3M8J A;  4XK4 A;  5H20 A;  2VBX A;  3MWM A;  3C2H A;  5K7F A;  1MBJ A;  1XSD A;  5DDG A;  5D6E A;  1GVD A;  5L3D A;  5BOX A;  4CCJ A;  4IHY A;  2XAU A;  2QZ8 A;  4XKV A;  4ZYG A;  2HPM A;  2GZW A;  1ZAR A;  1LPQ A;  5TRD A;  1MBH A;  1ZGW A;  1BN5 A;  5E18 F;  1PJR A;  1T39 A;  2KLO A;  3PQK A;  1RR7 A;  2JPC A;  4A3G J;  2RQP A;  1PVE A;  3MEX A;  3O2P E;  3FMQ A;  4BEH B;  3G2B A;  1X1D A;  3K4J A;  4PK4 A;  1SD7 A;  3DBR B;  4EM0 B;  2JN6 A;  1IN7 A;  3W6K B;  2EV5 A;  2MGQ A;  2EK5 A;  1IXC A;  1G3Y A;  1XSX A;  3BG6 A;  1WH5 A;  3CJT B;  4M6Y A;  4MLO A;  2JT1 A;  2CV2 A;  4IVN A;  3E7L A;  1IO2 A;  4LD5 A;  2ZJQ F;  2KPM A;  1BC7 C;  2DMP A;  3WTY C;  1ONV A;  1UAA A;  1HKS A;  5IP7 J;  1MZB A;  3KX2 A;  3TW7 A;  2NVY J;  4UUS B;  2DA4 A;  1B8I B;  2YS9 A;  5ERI A;  3WHC A;  2JPB A;  1XSV A;  2V1X A;  3CES A;  3ZQI A;  2DBB A;  2DI3 A;  4G7H F;  3X2Q H;  5HDG A;  3DWL E;  2X1C A;  4NQW A;  3IKT A;  1IN8 A;  1HKT A;  3OIQ A;  1D1A A;  2DDB A;  4QSH A;  3ZMT A;  1MH4 A;  1QHG A;  2LSO A;  4DIQ A;  1G3S A;  5C3E J;  3GZ6 A;  3RKQ A;  1R7J A;  3J7Y J;  2H8R A;  2FSW A;  3HZJ A;  1H8A C;  1RES A;  3LSJ A;  3GTL J;  2Y69 H;  3FMS A;  1LDJ A;  1Z21 A;  1Z0X A;  2OA4 A;  2BXZ A;  3I4N J;  2CW0 F;  4GGG A;  5E8I A;  4NBQ A;  3C2G A;  3EUH A;  3P9I A;  1MH3 A;  4EJV A;  3HDD A;  2JSP A;  1MKM A;  4WXH A;  4PGG A;  5GPA A;  4DBR A;  2DFE A;  1LB2 A;  4V2G A;  3JRI A;  2JA5 J;  1ODD A;  1T98 A;  3DV8 A;  5GPC A;  2P4W A;  4WK8 F;  3ERE D;  3D5S C;  3BP8 A;  3AG2 H;  5B5E C;  2VJ5 A;  3A4C A;  4AWX B;  2XF5 A;  1S7O A;  2VOO A;  3V42 A;  1OLT A;  5IP9 J;  4NC7 A;  5M5X J;  2VJ4 A;  5FRN A;  3CME I;  4RAZ A;  3ZMU A;  2K9Q A;  2Y75 A;  3RYR A;  2QSF X;  3ELK A;  2MD0 A;  1JHF A;  3S15 J;  2HOE A;  2L54 A;  2MC4 A;  4HDU A;  3O6B B;  2DPD A;  3WTV C;  1D5Y A;  4CO8 A;  4MIM A;  2IS6 A;  4LIU A;  2EIL H;  3IL2 A;  4BQQ A;  2V7F A;  2VC1 A;  3V8J A;  5JR3 A;  1BJA A;  1LE8 A;  4L5J A;  4XOT A;  1S5L C;  2O9L A;  2QF7 A;  1W7P A;  3M07 A;  5CVJ A;  2OJE D;  3ZMS A;  4GRI A;  4XRS A;  1T0F C;  2F48 A;  5LD2 C;  5DM7 F;  3A0H C;  5C44 J;  3L2W A;  3ZXS A;  5GAH J;  3FKJ A;  1RET A;  2MW8 A;  5F0C A;  1WJF A;  9ANT A;  2DTZ A;  1J5Y A;  1FBQ A;  4IZZ A;  5LGT A;  2QM3 A;  1LDD A;  4EEF G;  4WWC A;  3KCC A;  3WG9 A;  1ZN2 A;  3GZ5 A;  4XKB A;  4XM3 A;  1PUF B;  2BVL A;  1Y1W J;  4DW6 A;  1X1B A;  2PQ8 A;  2VQH A;  1M1E B;  2ZB9 A;  3CZ6 A;  1V54 H;  3WE2 A;  2R7Z J;  4ENK A;  3I4M J;  3ZMD A;  1WI3 A;  4E7L A;  1P4A A;  2EQR A;  2XGC A;  3ZR8 X;  1XGS A;  4LK0 F;  1TWC J;  4UY8 I;  2RN7 A;  2P81 A;  3K4B A;  1WWX A;  4HV6 A;  3VYT B;  4BHC A;  5EG0 B;  1VQ7 I;  3FM5 A;  1K4T A;  4XN0 A;  4L5I A;  2PFB A;  1SC7 A;  2VJI A;  1F36 A;  1D0Y A;  5E1W A;  3S2H J;  4HOB A;  2PG4 A;  3IWF A;  1E0E A;  2EFP A;  1Y0U A;  4ENJ A;  4A3J J;  3S1M J;  2JTV A;  4ZDL A;  2UV1 A;  1ORK A;  4JOM A;  1AOY A;  3MQ0 A;  2HDC A;  3CJN A;  4HG2 A;  2CYY A;  3CLQ A;  3AAF A;  4E7Z A;  5D4R A;  1Z3Y A;  3OYJ A;  1ZHF A;  2LTP A;  1FJL A;  5HS9 A;  3SDB A;  3CCR I;  4CHU A;  1ZAO A;  4I2O A;  3C1D A;  3S1N J;  4UUV A;  1I3Q J;  4EGY A;  1IV6 A;  2D5V A;  1VQ8 I;  4UV8 A;  2DQL A;  3M1E A;  1BI3 A;  2KL4 A;  4LOC A;  4UV9 A;  1AKH B;  3GVA A;  2R3S A;  1FBS A;  1V5G A;  2YX4 A;  4C2U A;  3PUF A;  2ZJR F;  2AHQ A;  3TBI A;  2WTE A;  4OAY A;  1RUN A;  2HYF A;  1ZG3 A;  1DQU A;  2PN6 A;  3CP8 A;  2DYR H;  4Y33 A;  4X6A J;  3QPT A;  1RKT A;  4ESB A;  2JUC A;  1LKX A;  2HQN A;  4DBQ A;  2L4M A;  1ETO A;  1S7E A;  3QQA A;  1Z1D A;  4JP0 A;  2E7W A;  1U8R A;  3BWG A;  3F8F A;  2QSH X;  4KT5 C;  5ILU A;  4YRV A;  1MGT A;  3KPH A;  4GFB A;  5CVI A;  1VF9 A;  3R61 A;  4FET A;  1G8X A;  2IVM A;  2R7Q A;  3OYE A;  1HST A;  4B44 A;  4ZH4 F;  4ESF A;  1OJL A;  1MBF A;  1XCV A;  3CMA I;  2R7W A;  2M4G A;  2FML A;  2HTJ A;  2HQA A;  4HW0 A;  1TT5 B;  2RAE A;  1JKP C;  2KZG A;  4OU0 A;  4J00 A;  4A0Z A;  1A6I A;  3AG3 H;  5IOZ A;  2LBF B;  1AHD P;  3GFI A;  4P9F A;  5E20 A;  1WJB A;  2IEK A;  2XAS A;  3N05 A;  2Y2Z A;  4XKC A;  2FBH A;  4A3E J;  1YS7 A;  2X48 A;  3HC7 A;  3MKZ A;  5IYC J;  3FK7 A;  5EEG A;  3MKY B;  2E35 A;  2E1N A;  4MQ9 F;  3PIO F;  1ENH A;  2VBZ A;  2XF6 A;  3G4S I;  4KYW A;  4B8X A;  2BW3 B;  2VLA A;  2LKX A;  4LLG F;  3MCZ A;  1U5T B;  2ZXJ A;  5JHU A;  1BI1 A;  3JRF A;  5F1R A;  2E7X A;  1FP1 D;  2M7B A;  2WBM A;  4O6J A;  3J80 Z;  3G73 A;  2JA7 J;  3L7W A;  1XPX A;  2EA2 A;  3HUG B;  3H5N A;  3MZ8 A;  3JSP A;  2OTJ I;  4NDL A;  1O4X A;  3CD6 I;  3DF8 A;  2LY2 A;  4F92 B;  4G6D A;  3PJR A;  2UXX A;  2P7C B;  4S0H B;  3QOP A;  4LJZ F;  3VPR A;  1IJW C;  1RKW A;  2WB1 N;  1YO5 C;  2O03 A;  1SD4 A;  2R5Z B;  1DU6 A;  2DA5 A;  1V5F A;  3CTA A;  2K86 A;  3F72 A;  3LOC A;  4XID A;  4ENM A;  1O3R A;  2XRN A;  2Q2E B;  5IOY A;  2QCO A;  3PNT A;  1T95 A;  1PYV A;  1WQ2 A;  3BQY A;  4YFK F;  4HDV A;  2KQR A;  1MBG A;  3S1Q J;  2WAD A;  2YUS A;  1TTY A;  3F8B A;  3T8T A;  3A02 A;  4EJT A;  1S8N A;  1F5T A;  4DZJ A;  3BR2 A;  1UZC A;  1R36 A;  5JVT A;  1J59 A;  3OYL A;  4RGS A;  5HNF A;  1IRG A;  3C2B A;  2VQG A;  3GFL A;  3V8L A;  2JRM A;  3O8H A;  1HW2 A;  4R1H A;  3I71 A;  3C3W A;  4LFU A;  5DTD A;  2CUJ A;  4KMU X;  2VPL A;  1ZRC A;  3OIP A;  5E1Z B;  2HWV A;  3LSI A;  4OIQ F;  3Q0V A;  3LSH A;  3HPH A;  2P0W A;  1X19 A;  1FOY A;  2ICW G;  2NS8 A;  2NOG A;  4CYD A;  3OS0 A;  1LFU P;  2XVC A;  2M30 A;  3IRQ A;  2GQQ A;  5IT3 A;  3W3C A;  3KZZ A;  4J19 A;  1D3Y A;  3JW4 A;  2GXA A;  4E70 A;  4Y3O A;  1P2F A;  4M9X A;  1XB4 A;  3L2C A;  4Z2Y A;  1FZP B;  4BE1 A;  1YRN A;  5E3N A;  3GTQ J;  1BIB A;  1IUF A;  4JK1 X;  5JFR A;  4A69 C;  3DCF A;  4BEH A;  4EM2 A;  3JRH A;  1HBX G;  3S2D J;  3L09 A;  3ZMV A;  1FC3 A;  1W4M A;  2LKP A;  2GIZ A;  5BMZ A;  1QVU A;  4RB1 A;  2VKE A;  3KE2 A;  3RPU D;  1VQ9 I;  5H2F C;  1CQT A;  2TRT A;  3FXR A; 
#chains in the Genus database with same CATH homology
 4B3A A;  2HXO A;  4W1U A;  1IDZ A;  4A3F J;  4XRM A;  3HBL A;  3ZQL A;  5FKL A;  3JRD A;  1JJ6 C;  3G1L A;  5IP6 A;  5F0F A;  1OFC X;  4QTR A;  4IHV A;  5C4J J;  1LFB A;  4UUS A;  2VPR A;  5J1U A;  1B8I A;  1SAN A;  2DA1 A;  1K61 A;  3BTC A;  3HOV J;  5FKK A;  5K7H A;  2L7Z A;  1MNM C;  1WPK A;  3B6C A;  4DZP A;  3G1M A;  3ZQF A;  4D5C A;  5JLX A;  1OCT C;  1WCM J;  5JLW A;  2G0E A;  4A3K J;  4IHW A;  2W48 A;  3QPL A;  3QPS A;  4M3D A;  5GP9 A;  5E3M A;  1NK3 P;  3HOY J;  1ZTR A;  1BA5 A;  5EZH A;  4A3I J;  5IYB J;  3HOX J;  1ZR4 A;  1T33 A;  3BG5 A;  1UHS A;  1Y1V J;  2AO9 A;  1B72 B;  2Y0S N;  3JRC A;  2E1O A;  3IV5 A;  4A3B J;  5EEA A;  1HOM A;  2HQ5 A;  4JX6 A;  3F0C A;  2FJ1 A;  2VUM J;  2XPU A;  3BR0 A;  4M3F A;  2EBI A;  5FKN A;  5EDN A;  2HDD A;  3OSF A;  3Q3S A;  2DMU A;  4A93 J;  3IH4 A;  2XPW A;  2M9H A;  2HOA A;  5EGO B;  2ECC A;  1VND A;  1UMQ A;  5FKO A;  4XK4 A;  1FIA A;  5K7F A;  3TP3 A;  3JRA A;  2MSY A;  1MBJ A;  5FLM J;  1JUM A;  2LVS A;  4D7N A;  1GVD A;  2ELK A;  3LNQ A;  4FCY A;  3LSG A;  2KT0 A;  4IHY A;  2R93 J;  3HEF A;  2HYJ A;  2XB5 A;  1MBH A;  4D7M A;  1ZGW A;  1X2N A;  2JJ7 A;  3WHB A;  4L5E A;  2XRL A;  1FEX A;  4MO7 A;  2CQQ A;  1RR7 A;  2IAI A;  1ETQ A;  4A3G J;  1NK2 P;  3FK6 A;  2NVX J;  2IBD A;  2M0C A;  5HOD A;  2R5Y A;  2DA6 A;  3HGY A;  4B4C A;  1WGX A;  3CDL A;  3BR1 A;  2JN6 A;  2K40 A;  1W0T A;  3BR3 A;  2MGQ A;  3K2A A;  1WH5 A;  5F1J A;  5BNG A;  2EZK A;  4MLO A;  3CMY A;  1T56 A;  3E7L A;  2ECB A;  3FKI J;  1TC3 C;  3HOZ J;  2DMP A;  2LY9 A;  1ETY A;  3IH3 A;  5IP7 J;  2XSD C;  2DMT A;  3TW7 A;  2NVY J;  3M4O J;  5EG0 A;  3O8G A;  4UUS B;  3L1P A;  2DA4 A;  1B8I B;  3ZQH A;  2YS9 A;  3TP0 A;  5C4X J;  1IDY A;  3WHC A;  3BTL A;  3S17 J;  2E2I J;  2WV1 A;  1U78 A;  3ZQI A;  1W0U A;  1TWA J;  5F04 A;  3BTJ A;  2WAQ N;  4QSH A;  2DMN A;  1MH4 A;  2K9S A;  3RKQ A;  4IEJ A;  5C3E J;  2H8R A;  2M8G X;  2JA6 J;  2NS7 A;  1H8A C;  1RES A;  3LSJ A;  3GTL J;  4HNV A;  2HOS A;  1TWF J;  1Z0X A;  3HOU J;  3OIO A;  3SDG A;  3I4N J;  3S14 J;  2Y9Y A;  2B63 J;  3GTM J;  3HDD A;  1MH3 A;  3LSR A;  3RZD J;  3JR9 A;  5M3F J;  1AKH A;  3BR5 A;  3MVP A;  3FIW A;  2JK3 A;  5GPA A;  5J1R A;  4V2G A;  3JRI A;  2JA5 J;  2CJJ A;  2MG4 A;  3HB9 A;  3TW6 A;  5GPC A;  4JYK A;  3BG3 A;  1HCR A;  4MFE A;  4Y52 J;  1GV2 A;  5IPA A;  3HOW J;  2LD5 A;  1MBK A;  5IP9 J;  5M5X J;  2DN0 A;  3A03 A;  2DA7 A;  2DMQ A;  4BBR J;  2VI6 A;  4IHX A;  2HXI A;  2K9Q A;  1LE8 B;  2O8K A;  2R92 J;  3OOU A;  3S15 J;  1Q1V A;  1K83 J;  1SFO J;  2DA2 A;  1P7J A;  4M3E A;  1D5Y A;  4MIM A;  3GTJ J;  5M5W J;  3CCY A;  2VKV A;  3HM5 A;  5DS9 A;  3Q0W A;  4QIW N;  2HOT A;  3RZO J;  5F0H A;  3GTP J;  1XS9 A;  3M3Y J;  1LE8 A;  3G1O A;  5J3L A;  2O9L A;  2EZL A;  2QF7 A;  4ABZ A;  2NVT J;  3BQZ A;  4XRS A;  4M6V A;  5FJ8 J;  5M5Y J;  2OPT A;  2M34 A;  5C44 J;  1RET A;  2JWT A;  5E3O A;  2MW8 A;  5F0C A;  1I6H J;  2R5Y B;  9ANT A;  2DTZ A;  2L0K A;  2LK2 A;  5FLV A;  4DYQ A;  3HGG A;  4EEF G;  1U8B A;  4JX4 A;  1XC5 A;  1PUF B;  1Y1W J;  4DW6 A;  5M3M J;  2ZB9 A;  2R7Z J;  2Y9Z A;  1MBE A;  1VFC A;  3I4M J;  1E3O C;  1WI3 A;  3ZQC A;  1APL C;  2EQR A;  1JTY A;  2XGC A;  2HI3 A;  1FTZ A;  1TWC J;  1BL0 A;  2E2H J;  2P81 A;  3K7A J;  1I50 J;  1ETK A;  1JGG A;  5EG0 B;  2XPV A;  4JX5 A;  3JRG A;  1XG1 A;  2JA8 J;  4A3D J;  3GTO J;  1PUF A;  1F36 A;  5EF6 A;  3S2H J;  1IC8 A;  4A3J J;  3S1M J;  3B6A A;  4A3L J;  1ORK A;  1POG A;  3PM1 A;  3H3V K;  4AUX A;  2X9D A;  2FD5 A;  2E19 A;  2LP0 A;  3H0G J;  3BTI A;  3PO3 J;  1TWG J;  1RPW A;  1IG7 A;  2N8G A;  5J1Y A;  2LTP A;  1FJL A;  4DYR A;  1G2H A;  2M2E A;  3GBG A;  1MSF C;  3S1N J;  1HLV A;  1BW5 A;  1I3Q J;  3A01 A;  1IV6 A;  2D5V A;  4CYC A;  1JUP A;  1AKH B;  4LOC A;  1QRY A;  3MKL A;  1HF0 A;  3FIS A;  2DA3 A;  4I6Z A;  3DEW A;  3ZQG A;  2AHQ A;  2L9R A;  3W6V A;  3BG9 A;  2O7O A;  2ID6 A;  4X6A J;  1TWH J;  1RKT A;  2ME0 A;  2Y30 A;  4FIS A;  3LSP A;  1ETO A;  2YU9 J;  1S7E A;  3QQA A;  4BBS J;  4JP0 A;  2LFB A;  1HDP A;  1ZK8 A;  5F08 A;  1ETX A;  3HKZ N;  1QVT A;  2ID3 A;  2LLK A;  4AYB N;  4GFB A;  1ZQ3 P;  2CQX A;  1ETV A;  2XB0 X;  1VF9 A;  3SJM A;  1A5J A;  4C3J J;  2OF7 A;  1OJL A;  1MBF A;  4RBO A;  4MFD A;  3NAR A;  4BY7 J;  4M3B A;  4AC0 A;  1JKP C;  2RAE A;  1HDD C;  5FKM A;  3S16 J;  1GDT A;  1GUU A;  1A6I A;  1U9O A;  2L7M P;  5IOZ A;  3BT9 A;  3Q0U A;  4XIC A;  1AHD P;  1WH7 A;  2IEK A;  1ITY A;  2COB A;  2Y2Z A;  3TED A;  1JKR C;  2EH3 A;  4A3E J;  2X48 A;  3RQI A;  1JTX A;  4G12 A;  4C3H J;  5IYC J;  3FK7 A;  4FE4 A;  2JMW A;  3SFI A;  4Y7N J;  1ENH A;  2I10 A;  4DYC A;  1GV5 A;  1FTT A;  4FTH A;  2LKX A;  4X1E A;  4D5F A;  2CUE A;  3JRF A;  4BY1 J;  4RDU A;  2R0Q C;  2FQ4 A;  2JA7 J;  2CRG A;  2L7F P;  1ZR2 A;  3CQZ J;  4V2F A;  4NDL A;  1O4X A;  1DU0 A;  3NAU A;  3JRB A;  1IGN A;  4S0H B;  1JKQ C;  3VPR A;  1IJW C;  3MN2 A;  2X6O A;  1AU7 A;  3PO2 J;  1RKW A;  1FIP A;  2WB1 N;  1VI0 A;  3D1N I;  1B72 A;  1DU6 A;  2R5Z B;  1QPI A;  5F27 A;  2NVQ J;  2DA5 A;  3LOC A;  1H88 C;  4XID A;  1IRZ A;  1MSE C;  1X58 A;  3GTG J;  5IOY A;  2QCO A;  2EZI A;  2FX0 A;  3UKG A;  2Y31 A;  3BQY A;  2GBY A;  4A3C J;  4B1R A;  1MBG A;  1JJ8 C;  4M3G A;  3S1Q J;  3BR6 A;  2YUS A;  3OSG A;  4BXX J;  1U9N A;  1NTC A;  3A02 A;  3GTK J;  2TCT A;  4DZJ A;  3BR2 A;  3JRE A;  5EZG A;  1ETW A;  1JUS A;  2CU7 A;  2K9N A;  2XGD A;  1ZKG A;  3A01 B;  2CUF A;  4CYC B;  2DJN A;  2GM4 A;  2R5Z A;  3C2B A;  2ME6 A;  5EGO A;  1GT0 C;  1F43 A;  3O8H A;  4BKX A;  2H1K A;  5DTD A;  4C3I J;  1YRN B;  4UUT A;  1JT0 A;  3Q0V A;  4XRS G;  5IYD J;  1BJZ A;  5EYR A;  1JT6 A;  5K7Z A;  3S1R J;  4I76 A;  2NS8 A;  2NOG A;  1LFU P;  2EZH A;  4FE7 A;  2XGE A;  3IH2 A;  4J19 A;  1BW6 A;  1EF4 A;  2GLO A;  2E2J J;  1YRN A;  2LR8 A;  1UG2 A;  5E3N A;  3GTQ J;  1IUF A;  3ZOB A;  5E3L A;  4A69 C;  3DCF A;  3JRH A;  1JKO C;  3S2D J;  1P7I A;  1X2M A;  1H89 C;  4W97 A;  2PMZ N;  2KDZ A;  4C2M J;  1QVU A;  1Z77 A;  2VKE A;  4A3M J;  1R9T J;  1CQT A;  2TRT A;  1OCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...