3RJPA

Crystal structure of the dna binding domain of covr from streptococcus pyogenes
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
MYRDLVLNPQNRSVNRGDDEISLTKREYDLLNILMTNMNRVMTREELLSNVWKYDEAVETNVVDVYIRYLRGKIDIPGKESYIQTVRGMGYVIREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords CovR
publication title Crystal structure of the DNA binding domain of CovR from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
total genus 25
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2011-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rjpA00
1IZ1A 2E7WA 2V6CA 4WK8F 2XAGA 3RIRA 1FX7A 4I7HA 2P7CB 4A6DA 3P7NA 1P4WA 1K7AA 2EWNA 3SZPA 5HDNA 3KP3A 1R23A 4LFUA 1GHCA 2UZKA 3CLOA 3L9FA 5LEJA 2A07F 1KA8A 2J5OA 2VBWA 3IKVA 2GAUA 1Z91A 2LDUA 2YX7A 2HFHA 1HW1A 3K1MA 4L9TA 2P6SA 1TNTA 4UV8A 1G3WA 1B59A 1AOYA 3LQQA 1P2FA 3CJNA 3QRFF 1Z6RA 5IT9K 3K69A 4ZYEA 4BNCA 3FF5A 3VB2A 2DT5A 4CZZA 3P9IA 2WV0A 1TQMA 3SHFA 2QM3A 1OYYA 4AVPA 5CYVA 5A2QK 3CO7C 1FC3A 2CFXA 2L3DA 1ON2A 2FEZA 3QP6A 2GXGA 3F8NA 2XAJA 4U88A 1ULYA 1I5ZA 2DPDA 2XAQA 2W84A 3WE3A 2WC2A 2OAZA 3HSRA 1R58A 2FOKA 4UVCA 4MQVA 4RGSA 1FP2A 5KK1A 3LFKA 3L00A 2DK8A 1SD4A 5CVIA 3I54A 4WF2A 3DQVC 1R36A 2OZ6A 1O7LA 4RGUA 4LG0B 2ESHA 1YG2A 4IVNA 1FYMA 1MD0A 1J75A 2ZNYA 4HBLA 1D8KA 4ENMA 3RYPA 3U2RA 3I4PA 2RV8A 1BI1A 4RGRA 3T8TA 5J8CA 3E6MA 5D5XB 3E5XA 1XGSA 4PZJA 2HQNA 4LK0F 1F1ZA 1IN4A 3I59B 2DQRA 2M45A 3WODF 1F4KA 4ON0A 5E8IA 2RN7A 1KGSA 4IRGA 5HLHA 3QPTA 1TLHB 3ZMDA 2LSOA 4Y17A 2M8EA 3FMRA 1FZPB 2ADUA 1O3SA 3K1NA 2GXBA 2MC3A 1TBXA 1U2WA 4U0WA 4A0XA 5FGMA 2ELHA 2YPRA 3NQOA 4LLGF 3HRMA 4LGWA 4U0YA 4GXOA 3WTZA 1FBQA 1XSXA 2W85A 4KT5C 4Y15A 4I98B 2ZMEA 1PDNC 3GVAA 4Q5SF 4MQ9F 4YG2F 2GA2A 3W6JB 2HKOA 1E2XA 3QOPA 5J6XA 1KU7A 4JQFA 4BH9A 1KYWA 2HDCA 2STWA 2XAHA 3REOA 5KVRA 4HX8A 4HA8A 3DF8A 3BWGA 1P4AA 1T38A 1HXDA 1IN5A 2QYOA 2VC0A 4ZZDA 3GFJA 3WGGA 1STZA 2QQAA 2L54A 4MHGA 4A0ZA 1EV7A 3BROA 1XMAA 4NB5A 1KYZA 1ZLKA 1Z05A 3T8RA 1G4DA 1XN7A 4G6QA 1MDMA 4G8XA 3T0YA 2MBFA 4L9JA 2H09A 2FRHA 1ZLJA 3HRTA 2Z3YA 2OQGA 2A5YB 1B9NA 4IRHA 4KMUX 1ZAOA 2IA0A 5E17F 2QZ8A 3HOTA 2BEOA 2HTSA 4NHJA 3OV8A 2OD5A 2W25A 4ZYGA 2Z5UA 1DPUA 4BHBA 2XAFA 3WTSC 3GEZA 3ZPLA 1LEAA 2VXZA 5CVJA 4L9NA 3O6BB 1E17A 5FD6A 2OQRA 5DCMA 3O2PE 2IVMA 2YSRA 2H94A 3BJOA 3SFZA 5E8GA 2DU9A 3IWZA 3KCCA 3R4KA 1KQ8A 3QP5A 3L09A 3LSTA 2EV6A 2VE9A 2V1DA 2VBXA 3DP7A 4Q47A 3FZVA 4P5OA 1FP1D 2QLZA 2WWYA 4AIKA 3VODA 3WU1B 2B0LA 1QO0D 2OA4A 5ILVA 3LAPA 1JHFA 1EH8A 1ZN2A 3B73A 2RKHA 3BPVA 3CUQC 1CGPA 3G3ZA 3M8FA 3MEXA 2DPUA 1XD7A 3I0TA 3J81K 4OMZA 4CO8A 1BC7C 2FU4A 3TOAA 2FNPA 4ESJA 1HKQA 3I58A 2L02A 2W24A 2ZKZA 2VT2A 3EYYA 1I1GA 2Q0OA 3G73A 1U78A 2K4JA 2QBYA 2HS5A 4GYGA 1G3SA 2IPQX 1KU9A 2YU3A 3GUDA 5E1XA 1IXRC 5LHHA 1IXSB 1HW5A 4F7ZA 3C3WA 2P5LC 1J59A 2ESNA 4KIGA 1RI7A 2HYGD 3ULQB 5LBQA 4HF2A 1YW8A 3MFKA 3GFMA 5L3DA 1RUNA 3NRVA 1ON1A 3KEOA 3LWFA 5D4SA 1ZRCA 2ZCWA 2DO7A 4WXCA 3L7WA 4U0VA 2QENA 4HLXA 1R5GA 3GXOA 2O03A 2HOEA 5F64A 3WTVC 1W7PA 4HV5A 2DW4A 4KICA 3JAMZ 1OYIA 2W57A 4KUMA 4XLNF 2ZXJA 2EA2A 5FFZA 3U1DA 2K02A 4A5MA 3ERED 1MJAA 1G3TA 4ZH4F 1U3EM 4N0BA 1ZREA 4M74A 2A6EF 2MA3A 1QNTA 3WTUC 3BY6A 3E6BA 4P96A 1B6AA 1SAXA 1K6OA 2G7UA 2P4WA 1HKSA 1XSDA 3KEQA 2CSOA 3DPLC 3C1DA 1CF7A 2RNJA 3QPHA 3R60A 1H9GA 3E5QA 1WQ2A 5HDGA 4LJZF 5BOXA 3IL2A 1OYWA 2J5PA 2GIVA 5L3CA 1ZG5A 2A69F 3T1BA 2M87A 2HEOA 4MGRA 2Y0MA 3JAMK 4AWXB 3QU6A 3W6KB 4P9UA 2CW0F 5CLSA 5EEHA 1QGPA 2LF8A 2NAZA 5HVQC 3RKXA 4L18B 4XRFA 3RTRA 3T5XA 1J5YA 3KZYA 3RPQA 3V8KA 5HLGA 5D5WB 4M9SA 1O7FA 3VOEA 4XBFA 5K1YA 4EM0B 2FBHA 5HDKA 2ACJA 1KQ0A 5D8KB 4I09A 4TV7A 3DPTA 2LF7A 4UHTA 3HHHA 3HRSA 2QUFA 3M8EA 2AXLA 2GZWA 2XKOA 2KIFA 4KN4X 2VOPA 1Y0UA 2A61A 3KP6A 2EFOA 2FF4A 2P8TA 1IN8A 1JE8A 4EJTA 4AD9A 5L3FA 3WGHA 5H6RA 1R7JA 5FFXA 1IW7F 1BM9A 3QAHA 5LGUA 4KIBA 4K2EA 2BGCA 3I5UA 2PEXA 3FXQA 2M30A 3RPUA 2XGXA 3F21A 5DV5A 5JR3A 2PLYA 4UVAA 3WTXC 4WCGA 3CO6C 1REPC 1WKMA 3BJAA 3E6CC 4HW0A 4EMSA 1J7KA 1P6RA 4GCVA 4IHSA 3GO5A 2QQ9A 1IN7A 2A6HF 3LA2A 4HOBA 2FSWA 1HSJA 2FXAA 2D45A 3R0AA 4I01A 4R8HA 1B1BA 4A0YA 2VC1A 4UXNA 4HZFA 3R6SA 5BQTA 5K5OA 2OU2A 3WE2A 1BI3A 1OR7A 1QPMA 1MZBA 5F6FA 4IPAA 2BE5F 4G7OF 1LDKB 5D6FA 4EV0A 2L4AA 4OIPF 4H0EA 4ZYDA 4D0PA 3EDPA 3GF2A 4BAYA 4HDVA 2LNBA 3CUQA 1L3LA 4QLCU 4B8XA 1FBSA 5CJ9A 3EYIA 4HF1A 3U9GA 3KE2A 2Z33A 2ISZA 3KP4A 2MH9A 2XHKA 1YTYA 2ETHA 5HLIA 3QU3A 1O3RA 1HKTA 1P4XA 2PN6A 3TO7A 4O6JA 3RI4A 3P9KA 1SMYF 5AONA 3BDDA 2FNAA 1XGNA 2DFIA 3V7SA 5FD5A 3GW2A 1XB4A 1GXPA 5TJJA 5DD4A 1MKMA 1W5TA 4DQ2A 1OMIA 1R22A 4EJUA 6PAXA 4KMFA 1FSHA 2FMLA 4ENKA 2CG4A 3RYRA 2JSCA 2EJRA 3HHGA 3ECHA 4M72A 4XSXF 3ZMSA 3OOPA 2PMUA 1FYLA 4PGHA 2XIGA 3SQNA 1IUYA 1HSTA 5DD8A 5D8LB 4GGGA 1X3UA 2KKOA 3ZMTA 1K78B 3JSOA 2NNNA 5IT3A 2IA2A 4OOIA 1SD5A 1I27A 3ROUA 3RJPA 4ETSA 2HTJA 1LEBA 4P9FA 2HKXA 2FA5A 3H3ZA 4JK1X 2RDPA 2EK5A 3IKTA 1XDUA 3FMQA 2DK5A 2QQBA 4YFXF 1QZYA 3FM3A 1YFHA 1T98A 5J8FA 1S8NA 4OIOF 2V9VA 3VEPA 4LK1F 2TDXA 3H3UA 1QBJA 2DBBA 2F5EA 1YLFA 1U8RA 1JXSA 5CVRA 3FHZA 2F2EA 1KU3A 1XCBA 5BMZA 4UVBA 4XSZF 4CGZA 4UNOA 3TOBA 1UHMA 2JPBA 1O3TA 2F5DA 1R1VA 3E5UA 5ILUA 4BXUA 4M9XA 5DUKA 4QWQA 1FSEA 1P92A 4OINF 5D4RA 4RB3C 1LNWA 4OU0A 3AAFA 3V7CA 2IW5A 5HOOA 1UFMA 4HDUA 1YYVA 2H6BA 4FX4A 1XMKA 1IRFA 4EGZA 4IJAA 3WTYC 4O5VA 4HQEA 5D6EA 1A04A 2PMHA 1O57A 1UHWA 4Q48A 4LG0A 5K5QA 2C6YA 2RGVA 4LLLA 2PFBA 5L3BA 2FBIA 3TQNA 5FLXZ 2O3FA 1V3FA 5E18F 1H0MA 2K27A 1R5HA 3JSPA 2A68F 2PBIA 4IXAA 2EB7A 4CHUA 3GZ6A 3KP7A 3ZN0A 3JTGA 2DLLA 2Z99A 3ZMZA 5FO5A 4HV6A 5FB2A 2ZJ2A 3I59A 2DAOA 2HWVA 3DV8A 2FBKA 2ISYA 4HX7A 3BOQA 1Z1DA 1SFUA 2IJLA 5JFRA 2XUBA 5F1RA 3ML6A 1FNNA 1FPQA 4HAMA 1IF1A 2LKPA 3J80Z 4CXFA 5FLXK 5LHGA 2CGPA 2BYVE 3N4MA 5LRSA 1UB9A 4KA4A 5DYMA 2P5KA 1G6NA 3ZMUA 3K2ZA 4G9YA 4PGGA 1ZYRF 4CICA 3Q9SA 2K7LA 2R7DA 2JPCA 3V7RA 2P7VB 4EM2A 1ZRFA 2XASA 3FMSA 3E97A 1DUXC 3K9TA 3F8FA 3LQRA 2PI0A 2RQPA 2DTRA 3I71A 2IA1A 2JZYA 2M1BA 1MJ9A 1EH7A 1R1TA 4KNYA 3F23A 4A6EA 1DDNA 3J80K 1TTYA 1V4RA 2ZNZA 4ENNA 1USTA 1LDDA 3M9AA 1SFXA 4A12A 1S7AA 2L4MA 2JT1A 3D0SA 3F8BA 1D8JA 2K4BA 2EA4A 4E70A 4ASNA 2CYYA 2VT3A 1S7OA 3DFGA 3IWFA 3E3VA 2CWEA 2GWRA 2QWWA 3IRRA 2XKPA 2H6CA 4EJVA 4BHCA 5DUIA 1R1UA 4HYEA 1YW9A 4U7BA 3EETA 4RAZA 2D1VA 3F6OA 1RIOH 3KLOA 1TQPA 3MZHA 1YS6A 3RKWA 1PUEE 3IHUA 3KFWX 2ZBKA 3KETA 4LMYA 5K5RA 2MH2A 1B9MA 1FBUA 3K0LA 1B4AA 2O8XA 5DDGA 3KP5A 2PJPA 1EH6A 4MNUA 3TGNA 2DQLA 3CUOA 4FHTA 2ZMEB 5DCFA 1QZZA 2A3SA 4MEXF 2VN2A 2KJCA 5IT9Z 4AIJA 1T39A 2JRTA 2E1CA 3ELKA 4RB2C 4M73A 3FM5A 1MJBA 5A2QZ 2NYXA 3HTUA 1J0RA 2IT0A 3DKWA 1FOKA 4AIHA 4UUVA 1XGOA 3ZN1A 2HYFA 2DI3A 4R1HA 1BI2A 1Z6TA 1JGSA 1Z9CA 1ZRDA 2QVOA 4IHTA 2XRNA 3ZMVA 2P5VA 3HSEA 2ZO4A 1UCRA 2HR3A 4G7HF 3M1EA 1ONVA 2D1HA 4YIFA 3IC7A 1D5VA 5ERIA 4A5NA 2EFPA 2FE3A 1IN6A 5E1ZB 1TQIA 1S3JA 1TW2A 1MDMB 4YFKF 1MGTA 4S04A 4PCQA 3PFIA 3HYIA 1XDSA 1YW7A 3TDZC 2BBYA 3GWZA 5H20A 2HQRA 3RKYA 1GVJA 4G6DA 1U5TC 3H92A 3P9CA 3GYHX 1F5TA 2JTVA 4KFCA 4LB5A 2AS5F 2RC4A 3JW4A 2FMYA 1H9TA 4WXDA 3ABUA 3MZYA 5LHIA 3HIFA 1HBXG 3Q9VA 2K86A 3TO9A 3I64A 4M9ZA 2V79A 4S05A 2G9WA 3SZTA 2Q8KA 1F9NA 3MCZA 5DCMB 2MLKA 2O0YA 5E20A 3TKYA 3LA3A 3MAJA 1KU2A 3F8MA 2D2WA 2GA1A 3D5LA 4HQMA 4L0YB 4P55A 2VE8A 1O3QA 2H27A 2Y75A 2HZTA 1U6GA 1DPRA 2E1NA 1D3YA 3FX3A 2NRAC 4I02A 5LEKA 5L3GA 4YIIA 3F8CA 3F3XA 1U5TB 1FLIA 3F6VA 1IAWA 1IRGA 2OBPA 4HLYA 4L5IA 4Y13A 3HUGA 2KIUA 3GLXA 4EM1A 3EQLF 3GFIA 1YO5C 1BI0A 4LD5A 4OIQF 2G7HA 5CVUA 1FY7A 2QBYB 1ZGAA 5HS9A 4CDGA 4KYWA 2COMA 5D5UB 4BHPA 1QQIA 4RS8A 2NNYA 3ABTA 4Z2YA 1SD7A 4L9VA 3KP2A 3ECOA 1SFEA 1BIBA 2GQQA 2UXNA 1ZHFA 2KJBA 3BP8A 2BV6A 4ESBA 2EFQA 2PQ8A 1DP7P 3F72A 1I6XA 2EV5A 1ZG3A 5DEQA 5EEGA 1SMTA 2VOOA 5L3EA 2IP2A 3CTAA 5BPDA 4I0AA 1R00A 1RUOA 4N9HA 4IF4A 1GXQA 4MEYF 3BJ6A 4PDKA 2L01A 1BJAA 1LDJA 3TDUC 1W7PB 3S2WA 4N9IA 4OIRF 4EQQA 3N97A 1BN5A 5ICCA 3VFZA 1ZGJA 4FX0A 4HF0A 4OMYA 1WSUA 4CYDA 3HOSA 2E7XA 4L5JA 4XLPF 3V8JA 3ZQ7A 1FWZA 5LRRA 3F22A 1FYKA 2P6TA 5ICFA 4Q4ZF 4GYIA 5LLQA 4RB1A 1NHAA 1CF7B 1W5SA 1LJ9A 4UV9A 3FXRA 3HTSB 1XSVA 1T2KA 4BYYA 2R3SA 1J2XA 2O6GE 3JTHA 4I2OA 2X0LA 5CVVA 2PG4A 3KZZA 1K79A 1OKRA 2VONA 2V1XA 5ICEA 3IRQA 4EVIA 3MWMA 3WTTC 3GZ5A 4RB0A 3Q5FA 3BZ6A 3NEUA 4L0ZB 3J81Z 2KRFA 3RDIA 2F5FA 5JI6A 3O3KA 4M6XA 1LQ1A 4M6YA 5ILSA 2V1UA 1XGMA 3GX4X 4EJWA 3K1PA 1WI9A 2VBYA 3ISPA 2UXXA 5ED4A 2MLGA 3HSFA 2HGCA 4G94A 5HS8A 1LVAA 2Q2EA 5JHUA 1S29A 3M7GA 1BBYA 1T6SA 2CO5A 4MTEA 1C0WA 1USSA 5AIQA 1L0OC 1BC8C 2NS0A 3R0JA 3B02A 5D5VB 3EUHA 3PQJA 1S6LA 1RNLA 1TNSA 1U5TA 2FQ3A 1W7PD 4WXHA 2EFNA 2Y48A 4WWCA 3WGIA 2RVCA 4KDPA 1HW2A 2IRFG 1Z7UA 2KIMA 3WG9A 5TRDA 5BPIA 1WWXA 1RZ4A 1T0FA 4B09A 1LB2A 3I53A 3TO6A 1FT9A 4BQAA 3ZP5A 1I1SA 3E6DA 3DXJF 2OZUA 1OPCA 1ZARA 4JBAA 4RAYA 2O61A 1HQCA 2Z9OA 1YIOA 2WTEA 5H6QA 2XV4S 4MTDA 1AWCA 4U7DA 3MQ0A 3PQKA 3CDHA 1K78A 1BIAA 4RGXA 2CQKA 1ZG1A 4M71A 5HS7A 3SXYA 1G3YA 1WRJA 4LLNA 2YR2A 4KIFA 3BPXA 2EV0A 2VODA 1PP7U 3V4GA 2VBZA 3R61A 5ICGA 4HX4A 4FT8A 3CUQB 4IRIA 1VTNC 3FXUA 1W4MA 1Q1HA 3LA7A 3GFLA 1J9IA 5LGNA 3KLNA 4LB6B 5E1WA 3J7AO 1KQ9A 2STTA 4O3MA 4WX9A 4NQWA 1YQAA 1XCVA 2M5WA 4EJOA 1TW3A 2R7FA 1BOAA 3DEUA 2ZFWA 4YFNF 4I0BA 3LAJA 2MD5A 4R79A 5LGTA 1PP8F 3HRUA 2XROA 2YX4A 2UWMA 3C7JA 4ZZLA 3V8LA 1JHHA 4GO1A 1IXCA 5AIPA 1YS7A 1ZH5A 4ESFA 3COAC 1ODDA 2EFWA 3L2CA 5BS6A 5JVTA 2X4HA 4EGYA 4ZYHA 3C18A 4A2UA 3WU0A 2F5CA 3FWEA 4DNCA 4KN7X 4ENJA 3WTWC 2XVCA 1SD6A 4G7ZF
chains in the Genus database with same CATH superfamily
1IZ1A 2Y0SN 2TRTA 3D1NI 2E7WA 2V6CA 3HZJA 3VWBA 1LKXA 2O5RA 3HC7A 1MMSA 3CF5F 1WJBA 2DOFA 4WK8F 2ZJQF 2XAGA 2XF6A 3RIRA 2TCTA 1FX7A 4I7HA 4MFEA 5LFAA 3G1OA 2LK2A 3H5RA 2JA2A 2X1CA 1WJEA 2X6WA 2P7CB 1W36C 2XPVA 3OMYA 4XNFA 2OPTA 4A6DA 3OSFA 3P7NA 1P4WA 4XM3A 1RKWA 1K7AA 2EWNA 3SZPA 1LUJB 2XRLA 5HDNA 3KP3A 2KMUA 1R23A 3GTQJ 4LFUA 1GHCA 4BQQA 1FOWA 2UZKA 2K3FA 3CLOA 3OIQA 3L9FA 1E3HA 5KNLA 2JWTA 4J00A 2AXTC 5LEJA 2A07F 2R7UA 1KA8A 2J5OA 2VBWA 3IKVA 5FKMA 1XX5A 2E35A 2GAUA 1Z91A 4A3IJ 2LDUA 3KIOA 1MMGA 2YX7A 2HFHA 4DOZA 3FIWA 1HW1A 2JA6J 3MKYB 2WAQN 4XONA 3B6CA 4IX7A 3K1MA 2FJ1A 2JMWA 2P6SA 4L9TA 1TNTA 4UV8A 4D5FA 1G3WA 1B59A 3WG7H 4BACA 2E2JJ 3LQQA 1AOYA 4OAYA 5FKOA 1P2FA 3IAS2 3D5RC 3CJNA 3QRFF 1BW5A 2M4GA 1Z6RA 1N75A 5IT9K 3K69A 2VPLA 2DYSH 4A3FJ 1X1PA 4C3JJ 2ZFUA 4ZYEA 4BNCA 4CUGA 2K9MA 3FF5A 3VB2A 2DT5A 4CZZA 5E3OA 3HXLA 4IO9F 2DOAA 3P9IA 3CCQI 3LNQA 1V5GA 2WV0A 1TQMA 3SHFA 2QM3A 1ZTRA 5M5WJ 1OYYA 4AVPA 1AKHB 5CYVA 2LYCA 5A2QK 2HQ5A 3CO7C 1FC3A 2CFXA 3DEWA 2L3DA 1B72B 1ON2A 2KFDA 3HDDA 4M6VA 2XGDA 2R5YA 2DMNA 2FEZA 3QP6A 5EG0A 1CQTA 2GXGA 2LH9A 3F8NA 2IXSA 1VNDA 2OJED 2XAJA 4U88A 4UUTA 2Y31A 1ULYA 1UG2A 3K4KA 1I5ZA 3M1CA 2DPDA 2VKVA 2XAQA 2W84A 1T8IA 3BZCA 2F4MB 3WE3A 1Y39A 3ZQGA 3CZ6A 4XKBA 2WC2A 2OAZA 3HSRA 1R58A 2FOKA 1S5LC 4UVCA 4MQVA 3NAUA 4RGSA 1FP2A 1UJ8A 5KK1A 3ABMH 1MBEA 2GLOA 2K9QA 3LFKA 4FASD 5E79C 3L00A 1R9TJ 3JR9A 2DK8A 1SD4A 3Q0VA 3S3NA 5CVIA 1Z67A 3I54A 4IHXA 4WF2A 1FOXA 3DQVC 1R36A 3D5SC 2OZ6A 1O7LA 3QOEA 4RGUA 5GAEJ 5B1AH 2EIJH 2ESHA 4LG0B 1YG2A 4IVNA 1FYMA 1YITI 4BE2A 1MD0A 1J75A 2ZNYA 4HBLA 2V26A 4B43A 5K7HA 1D8KA 4ENMA 2K3PA 3RQIA 3RYPA 2XF7A 4CCMA 3U2RA 2R5ZB 2K9NA 2W48A 3I4PA 2RV8A 1BI1A 1XMXA 2RAEA 2F4OB 4RGRA 3T8TA 2MW8A 2KPMA 1WHUA 5J8CA 3E6MA 1RKTA 3I55I 4XN0A 3J7YJ 5D5XB 3E5XA 4PJLA 1XGSA 2LMDA 1S9HA 4PZJA 1DQUA 2HQNA 4LK0F 3OYHA 3GTLJ 1F1ZA 4D7NA 1AHDP 4GDFA 1IN4A 2KT0A 2VXDA 4ZC3A 1U9OA 2F5VA 2RREA 2DQRA 3I59B 3QYBA 3C2BA 2M45A 3WODF 1JKQC 1F4KA 4ON0A 5E8IA 2RN7A 1KGSA 4IRGA 5HLHA 5JLWA 3QPTA 2FX0A 2UUZA 1TLHB 3ZMDA 2LSOA 4Y17A 4JYKA 2M8EA 3FMRA 3H5AA 3FXMA 2JA7J 2R4GA 4M3FA 1NTCA 1FZPB 1JKPC 2R7XA 3PUFA 1WJAA 2ADUA 2A05A 1I3AA 1O3SA 3K1NA 2GXBA 2MC3A 1DP3A 3RKQA 3OR2C 2IS4A 1TBXA 1U2WA 4U0WA 3SJMA 4A0XA 2E1MC 5FGMA 2ELHA 2YPRA 3NQOA 3S1RJ 4LLGF 4BXXJ 3HRMA 4LGWA 4U0YA 2NVUB 4GXOA 3WTZA 4XOTA 2AQEA 5EZGA 1FBQA 1XSXA 2W85A 2CQ7A 4KT5C 5J3LA 3SFIA 3JRDA 4Y15A 4W1UA 4I98B 2ZMEA 2JN6A 3GVAA 1PDNC 4Q5SF 4MQ9F 1W36D 4YG2F 2GA2A 2X6XA 3W6JB 2HKOA 2BW3A 1E2XA 3I9V2 5F0HA 3QOPA 3NARA 4ZTFA 5J6XA 3LSJA 1KU7A 4JQFA 3OYCA 2AQFA 4BH9A 1KYWA 1YJWI 2HDCA 2CUFA 2STWA 3OL4A 1ETQA 2R7SA 2EZHA 4BE0A 2IGNA 4MFDA 3PFYA 2XAHA 3REOA 2ID6A 2JSPA 3H9JA 5KVRA 1TZLA 3PJRA 4CA0A 4NC8A 4HX8A 4HA8A 4FISA 2XF5A 3VYSB 3DF8A 3BWGA 2OC6A 3CMEI 2F4IA 1P4AA 2H8RA 1T38A 1HXDA 3M4OJ 4C2UA 3OY9A 3IH2A 2MFZA 3FHNA 1IN5A 2QYOA 3Q3SA 2VC0A 3WHCA 4ZZDA 3ZQIA 1Z21A 3M3YJ 5IOZA 4FE4A 3GFJA 4A3JJ 3WGGA 1STZA 3L1PA 1YOVB 2F6CA 4Y7NJ 2QQAA 2L54A 4MHGA 4A0ZA 1IDYA 1EV7A 3BROA 3FXOA 1W5CC 1XMAA 4NB5A 2BOLA 2IS6A 4CSWA 1SVOA 4V19K 1KYZA 1ZLKA 1RESA 3CP8A 4A3KJ 3BTIA 1Z05A 3T8RA 3IH3A 1XN7A 1G4DA 4G6QA 1MDMA 4G8XA 3T0YA 2UV1A 2MABA 3E7LA 2V1NA 2MBFA 3QODA 4D1QA 4L9JA 1IGNA 1YRNA 3VYTB 2H09A 3CCUI 2FRHA 3CCVI 1ZLJA 3HRTA 5IYBJ 5FLMJ 1QA6A 2Z3YA 2OQGA 2ZSHB 2A5YB 3ZRGA 2DA5A 1IG7A 2EIKH 1B9NA 1MBFA 4IRHA 2LBFB 1QPIA 2L9VA 1YJ9I 1N77A 1R6RA 4B48A 3Q0UA 4KMUX 1WCMJ 1ZAOA 2HVQA 2IA0A 3S8PA 3CCSI 5E17F 2QZ8A 5FKNA 3HOTA 2HI3A 2BEOA 2HTSA 3SDGA 4BJ6C 4NHJA 1WJFA 3OV8A 4RAFA 2OD5A 2W25A 4ZYGA 2Z5UA 2XC7A 3FISA 1DPUA 3A0BC 1UELB 1Y1VJ 4BHBA 2VQLA 3EUAA 2A6TA 2QEXI 3VSLA 4IOAF 3S2HJ 3ZCOA 2XAFA 3HB9A 3WTSC 4BDZA 3GEZA 3ZPLA 1LEAA 2VXZA 4CYCB 5CVJA 1X4PA 4L9NA 3DLLF 3O6BB 1E17A 3TEDA 5FD6A 3J7AY 1ZKGA 2OQRA 1D5YA 5DCMA 4DYCA 3CQZJ 2WADA 2IVMA 2KDOA 3O2PE 2YSRA 4BBSJ 1WJCA 2H94A 3JRFA 1R71A 4DW6A 2LY9A 3BJOA 3S2DJ 3SFZA 1OR7C 5E8GA 2DU9A 3IWZA 3KCCA 3R4KA 1JKOC 2OTLI 1KQ8A 4XLFA 1HCRA 3LFUA 3QP5A 1VQNI 3L09A 3LSTA 2EV6A 2Z1DA 4RDUA 3HOUJ 2DMQA 2VE9A 1MNEA 3CDIA 3JRHA 5LD2C 2V1DA 2VBXA 3DP7A 4IQJA 4Q47A 1QU3A 3FZVA 4P5OA 1FP1D 2QLZA 3GBGA 2WWYA 1FIAA 3CCYA 3VODA 3WU1B 4AIKA 2B0LA 1QO0D 2OA4A 1TT5B 2XAUA 5CQGA 1JHFA 5ILVA 1Y0NA 3LAPA 1EH8A 3ZQCA 2CRGA 1ZN2A 3K4BA 4ZTJA 2KISA 1RRJA 3B73A 1MBKA 2RKHA 3BPVA 3CUQC 1YI2I 3G3ZA 1CGPA 3PO3J 3M8FA 3MEXA 2DPUA 3CF2A 1XD7A 3I0TA 2OUMA 3FDYA 3J81K 2HOTA 4OMZA 4CO8A 1BC7C 2FU4A 3TOAA 2FNPA 3FKIJ 1R5ID 2M34A 4D9JA 4F93B 1R4NB 4ESJA 1HKQA 3I58A 2L02A 2W24A 4RM2A 2ZKZA 2BVLA 2VT2A 3EYYA 1I1GA 2Q0OA 2XSJC 2ELKA 2CJJA 2CS3A 3G73A 2EQRA 1U78A 2K4JA 2QBYA 2G0EA 2HS5A 4GYGA 4ITVA 1G3SA 1ETXA 2IPQX 4KISA 1KU9A 5EZHA 2LR8A 4E7LA 4CCNA 2YU3A 1YX5A 3GUDA 3CC7I 5E1XA 3ASOH 4DYQA 4XLCA 1ETWA 1IXRC 5LHHA 3JRCA 4JX4A 1IXSB 3VYRB 4BJ5C 1OFCX 1HW5A 4F7ZA 1JTXA 2ZSIB 3C3WA 2CW8A 5CPRB 2P5LC 1J59A 2ESNA 2X48A 3HPGA 4KIGA 4DYRA 1RI7A 2KHMA 3BR0A 1ZR2A 5F27A 2HYGD 3PIPF 3ULQB 5LBQA 4HF2A 1X1CA 1YW8A 3I3LA 3MFKA 1HC8A 4YELA 2LRDA 3GFMA 4QSHA 5L3DA 1RUNA 2GXAA 4CCKA 3NRVA 1VQOI 3LSIA 1JKRC 2WAEA 1ON1A 3IV5A 1WVRA 3KEOA 3LWFA 5D4SA 1ZRCA 4XORA 2ZCWA 3H0GJ 5GAGJ 2DO7A 4WXCA 1E3OC 3L7WA 1TT0A 1MBHA 3CJQB 2QENA 3F0CA 4HLXA 4U0VA 4XLHA 1W0UA 1R5GA 3GXOA 3KYDB 2VQGA 2O03A 2HOEA 5F64A 2JVHA 3WTVC 1EF4A 1W7PA 4HV5A 3OYFA 2DW4A 4KICA 4M3GA 3JAMZ 1OYIA 2WV1A 2W57A 1X1DA 4NDLA 3S1NJ 3ZR8X 3KZIC 3LSKA 4KUMA 2ZXJA 4XLNF 2EA2A 5FFZA 2HVRA 3U1DA 2K02A 4A5MA 3ERED 1MJAA 4IHVA 3M07A 3G6EI 1FJLA 1G3TA 4ZH4F 1U3EM 1PYVA 4N0BA 1ZREA 4M74A 2A6EF 2MA3A 1F43A 1QNTA 3OOUA 3WTUC 3DTIA 2QF7A 3PNVA 4FCYA 3BY6A 3E6BA 4P96A 1B6AA 1SAXA 1K6OA 2G7UA 3JRAA 3OYBA 4M3EA 3CJTB 2B9SA 2P4WA 1HKSA 1XSDA 4F55A 2OF7A 3KEQA 2CSOA 3DPLC 2L7FP 3C1DA 4A3BJ 1CF7A 3I56I 2RNJA 4UY8I 2VKHA 3QPHA 3ABLH 1D1AA 3R60A 4XLEA 1LE8B 2IBDA 1H9GA 3E5QA 3PUBA 1QHGA 1WQ2A 5HDGA 2LC2A 2BY3A 1JTYA 4LJZF 4RLFA 4PK4A 5BOXA 3HUGB 3IL2A 3I4NJ 2DOEA 1OYWA 3A03A 1WJ5A 4LIVA 2CQNA 2J5PA 2GIVA 2KZGA 5L3CA 1ZG5A 3ZQQA 2A69F 3PO2J 3T1BA 1AU7A 2M87A 2HEOA 2NVTJ 3OS2A 2NXNB 4MGRA 2Y0MA 1A31A 1I50J 3DCFA 4I76A 1UHSA 3JAMK 1JJ6C 1FTTA 4AWXB 3QU6A 1KONA 3W6KB 3TP3A 2CW0F 2EINH 4P9UA 5CLSA 5EEHA 1QGPA 2LF8A 3AL0C 2IAIA 2NAZA 5HVQC 3RKXA 4L18B 4W97A 3TBIA 4XRFA 2DMUA 3RTRA 3T5XA 1J5YA 5DS9A 3JCUC 4UB8C 3KZYA 3RPQA 3V8KA 2LFBA 2L5QA 2XPUA 5HLGA 4B4CA 5D5WB 4BS9A 4M9SA 4B47A 1O7FA 3VOEA 3CCJI 4DBRA 4XBFA 2PJRB 5K1YA 4EM0B 4QTRA 1RR7A 4LIUA 1XG1A 2FBHA 5DM6F 1X4OA 5HDKA 1N78A 2ACJA 1KQ0A 5D8KB 3FKJA 2BVMA 4I09A 4TV7A 3DPTA 2LF7A 4UHTA 5EDNA 3HHHA 3HRSA 3RCOA 3UNGC 2LKXA 4N4OB 1BJZA 2QUFA 9ANTA 3BQZA 3M8EA 2KDZA 2AXLA 2GZWA 2XKOA 4MIMA 2KIFA 4KN4X 2H1LA 3W2WA 2LY1A 1VFCA 2VOPA 1Y0UA 2HXIA 2A61A 4G6TB 3KP6A 2EFOA 2FF4A 1W1WE 2P8TA 1IN8A 1JE8A 4EJTA 4AD9A 5L3FA 3WGHA 2DJNA 5H6RA 1R7JA 5FFXA 2F48A 5GADJ 1IW7F 1BM9A 3HL2A 3QAHA 5LGUA 4KITB 4KIBA 2ZXWH 1AA7A 3VSKA 5BNGA 4K2EA 2BGCA 3I5UA 5EJCA 2PEXA 3FXQA 1P7JA 2M30A 3RPUA 1M1EB 1S7EA 3CCMI 2XGXA 3F21A 4MLOA 5DV5A 4XICA 2NS7A 5JR3A 3K6GA 5J4VA 4P1WA 2PLYA 2VJJA 1WH5A 4UVAA 3WTXC 1PJRA 1MBGA 3H3VK 4WCGA 3FXLA 3AL0B 3CO6C 1REPC 2K85A 3G71I 2WA0A 2CFOA 1WKMA 3BJAA 4XRSG 3E6CC 4HW0A 4EMSA 1J7KA 1VQ7I 1P6RA 1D1CA 3S3OA 2QSFX 3SZGA 4GCVA 4IHSA 3A1YA 3GO5A 2QQ9A 4X0GA 1IN7A 2A6HF 3LA2A 4HOBA 3V42A 4V2GA 2FSWA 1HSJA 2FXAA 2GBYA 4AM3A 3KYCB 2D45A 1SEUA 5IY5H 3R0AA 4I01A 2HXOA 4PFOA 3ZQFA 1X1BA 4R8HA 1B1BA 2L0KA 4A0YA 2VC1A 1TP4A 2JK3A 4F3QA 4XQFA 4EEFG 4UXNA 3HJEA 2DN0A 1VI0A 4HZFA 3DTKA 3R6SA 2JA8J 5BQTA 3BR6A 5K5OA 2OU2A 3WE2A 2HU9A 1ETOA 4A3CJ 2FOWA 2GM4A 1BI3A 1OR7A 1QPMA 1MZBA 5F6FA 4IPAA 3MKZA 2BE5F 4G7OF 2XPWA 4RMNA 1LDKB 2JRMA 3HM5A 3TMOA 2W4SA 5D6FA 4DJAA 4EV0A 2Z16A 2HVSA 2L4AA 3RZOJ 4OIPF 3VDXA 4H0EA 4ZYDA 4M3BA 2BHYA 4D0PA 1JGGA 3EDPA 3GF2A 2W82A 2Y9YA 1YX3A 4BAYA 2H1KA 4NC6A 4HDVA 4UUSB 2LNBA 1ZQ3P 3CUQA 3E0JB 4QLCU 1L3LA 4B8XA 1FBSA 3HOWJ 5CJ9A 3EYIA 4HF1A 3U9GA 1K6YA 2HZDA 1HDPA 2R0QC 2X6OA 2MGQA 4A3LJ 3KE2A 4C3HJ 2Z33A 2ISZA 3KP4A 2ZB9A 1IV8A 2XGEA 2MH9A 2N8GA 2XHKA 1YTYA 2ETHA 5HLIA 1VQ4I 3CC4I 3QU3A 2BZTA 3W6VA 1O3RA 1HKTA 1P4XA 2PN6A 2E5NA 4C2TA 3MMYB 4AUXA 3BCAA 3H36A 3TO7A 4AIDA 5CQEA 4DGWB 1DGWY 4O6JA 3RI4A 3P9KA 1SMYF 2DA4A 3ZQHA 1EKEA 5AONA 3BDDA 5EGOB 2FNAA 1XGNA 3HOYJ 2DXIA 2Q2EB 5C3EJ 1BW6A 2DFIA 3RZDJ 1PVEA 1T33A 1WI3A 4PUSA 1WFXA 3V7SA 5FD5A 2Y9ZA 3GW2A 2EZKA 2V4JC 1XB4A 1GXPA 3F9KA 1D1BA 2DMPA 5H2FC 4IKFA 4IL6C 5TJJA 5B3SH 5DD4A 1MKMA 4BBRJ 3A02A 1ZR4A 1W5TA 5B1BH 2NOJB 3S16J 4N4NB 4DQ2A 1B8IB 4XK4A 3HPHA 1OMIA 4BY7J 1H88C 3B6AA 2L9SA 1J09A 1R22A 4EJUA 3CCEI 6PAXA 4KMFA 1ETYA 1FSHA 2FMLA 3ONQA 1Z3XA 4HG2A 1LVKA 4HNTA 4ENKA 4IQ4A 2CG4A 3RYRA 3OYMA 3E1SA 1IRZA 3BC8A 2AO9A 2HOAA 2JSCA 2EJRA 1WH7A 3HHGA 2V9PA 3OYDA 3ECHA 4HSTA 1DU0A 2CUJA 4M72A 4XSXF 3FBNB 3ZMSA 3OOPA 2W1OA 4EATA 3SDBA 2ID3A 2PMUA 1FYLA 2EH3A 4A3EJ 3BG7A 1RR8C 4PGHA 2XIGA 3SQNA 1SVLA 2ELJA 2EIMH 1D0YA 4HNVA 2CUZA 3BTCA 1IUYA 2WBMA 1HSTA 5DD8A 1UMQA 2KRCA 4J19A 2FQ4A 4GGGA 1X3UA 2VPRA 2DTZA 5D8LB 4C9YA 5F1JA 2KKOA 1PUFB 3PNTA 3ZMTA 1K78B 3PL8A 3PNYA 1FMWA 3JSOA 4IZZA 2MG4A 2R7RA 4RAGA 1SC7A 4E4HA 3L2UA 2NNNA 3TL4X 3CCRI 5IT3A 4XLAA 4FQGA 2IA2A 4OOIA 1Y8QB 2HPMA 2QKLB 1SD5A 1I27A 3ROUA 4BE1A 1UG0A 3RJPA 2M7BA 3OYNA 4ETSA 2HTJA 2ZJPF 1LEBA 3BG3A 4P9FA 2HKXA 1I39A 2FA5A 2CQQA 4Z6YA 3MKWB 3ZQLA 5E3NA 3J7ZI 4A69C 4BDYA 2B7EA 2R93J 1TL8A 3H3ZA 1ENHA 2VL8A 5HODA 2NVQJ 4GFBA 5J1RA 4JK1X 2RDPA 2X1DA 2EK5A 3IKTA 4AYBA 3K2AA 1XDUA 2EZLA 3FMQA 2DK5A 3HGGA 3K7AJ 3L2VA 3CC2I 2DT7B 4RBOA 4NQWB 1RPWA 2QQBA 4YFXF 4XIDA 5C4JJ 3K4LA 2D5VA 1IDZA 2HOSA 1QZYA 3FM3A 4NBQA 1YFHA 1T98A 5J8FA 1S8NA 1JT0A 4XR6A 4OIOF 2V9VA 4KT6A 4LOCA 1VQ9I 3U21A 3VEPA 4YEJA 4LK1F 2KL4A 3KX2A 3ZGKA 2TDXA 3N05A 3H3UA 1QBJA 3I4MJ 2DBBA 4BL0B 2F5EA 1AKHA 4ZDLA 5J1UA 1YLFA 1U8RA 5FLVA 1JXSA 5CVRA 3QYEA 3FHZA 2F2EA 1KU3A 1XCBA 3W2VA 5BMZA 2X1EA 2BY2A 4UVBA 1B72A 4XSZF 4AU7A 4CGZA 4UNOA 3TOBA 1UHMA 2KZVA 5IP6A 2JPBA 1O3TA 2F5DA 1P7IA 3CD6I 1R1VA 5KCMA 3E5UA 4G12A 5ILUA 4BXUA 4M9XA 5DUKA 3RSNA 4QWQA 1FSEA 1P92A 3H35A 4GRIA 4OINF 5D4RA 2R7WA 1K4SA 1Z77A 1Q1VA 3OWTA 4RB3C 1LNWA 4OU0A 2RNGA 5GTIC 3AAFA 2AHQA 3V7CA 2IW5A 3H9GA 5HOOA 1UFMA 4HDUA 1HF0A 5M5YJ 3S1QJ 1YYVA 2H6BA 3P5JA 4QIWN 4FX4A 1XMKA 1IRFA 1TC3C 3LSPA 4EGZA 3IUOA 4IJAA 3WTYC 4O5VA 2I8DA 1GLNA 2K5CA 4AYBN 4HQEA 1ETVA 5D6EA 1MSFC 1SVMA 2XSDC 2PMZN 1A04A 3JREA 2PMHA 1O57A 1UHWA 1BR4A 4Q48A 2HPIA 3DBRB 4HEA2 4LG0A 1N25A 5K5QA 2C6YA 5F0CA 2RGVA 2EZIA 4LLLA 1OLTA 2PFBA 1U0JA 5L3BA 1MMNA 2FBIA 3TQNA 5FLXZ 1VQ6I 2O3FA 4FE7A 2R5ZA 1V3FA 5E18F 1H0MA 2K27A 1R5HA 2A5WA 3S32A 3BR3A 3CMAI 3JSPA 2A68F 2PBIA 4IXAA 1MH4A 2BXZA 2EB7A 5EGOA 4DIQA 4CHUA 3WHBA 3MD2A 3GZ6A 3S93A 4BY1J 1X2MA 4X1EA 2Y30A 3IAM2 2EILH 3KP7A 3ZN0A 3JTGA 2DLLA 2M3AA 2Z99A 1S72I 4CZCA 3S17J 3ZMZA 5FO5A 4HV6A 5K7FA 5FB2A 1LFPA 3K4MA 2ZJ2A 3I59A 2DAOA 2HWVA 3DV8A 4IEJA 5M3MJ 4A3GJ 2FBKA 2ISYA 2L9RA 3HBLA 3BOQA 4HX7A 3AKZA 1Z1DA 1I3QJ 3OYAA 1SFUA 2DT6A 5CKTA 5HLTA 1FTZA 3QYFA 2IJLA 3VYUB 5JFRA 2XUBA 3QWLA 4II2A 5F1RA 4YIRX 3ML6A 3HGYA 1FNNA 5KHDA 1FPQA 3SYTA 1QHHD 3JRIA 3CMYA 3GTGJ 3PSFA 4B44A 5IP7J 2DODA 2QKMB 3VPRA 3HOVJ 1Z3YA 2JA5J 4HAMA 1IF1A 2LKPA 3J80Z 4BQOA 4CXFA 5FLXK 5LHGA 2CGPA 2BYVE 3BQYA 5IPAA 3N4MA 5LRSA 1UB9A 3JRBA 1MBJA 2CW7A 4KA4A 5DYMA 2P5KA 2X51A 1G6NA 1LPQA 1XC5A 5C44J 2H8WA 4IOCF 2HQAA 3ZMUA 3K2ZA 4G9YA 4PGGA 1ZYRF 1F36A 2MSYA 1Z0XA 4CICA 2R5YB 1APLC 1VQ8I 3Q9SA 5EG0B 1TWFJ 2K7LA 2R7DA 2JPCA 3ZXSA 3V7RA 2M8GX 2WY8Q 1G8XA 2P7VB 5DTDA 4EM2A 4E6KG 1ZRFA 2XASA 3FMSA 3K10A 1IV6A 3S1MJ 3GCMA 3E97A 1DUXC 3FXJA 1BR1A 3K9TA 3F8FA 3H9QA 2O7OA 3LQRA 1RETA 3MKLA 1NK3P 1GV2A 5B5EC 2PI0A 1D0ZA 1HA8A 3PSIA 1A5JA 1BOBA 2RQPA 1YHQI 2DTRA 2V6EA 3I71A 2IA1A 2JZYA 2JJ7A 2IEKA 2M1BA 1MJ9A 2DFFA 4M3DA 1EH7A 2K40A 1R1TA 5FRNA 4KNYA 1VF9A 4A6EA 3F23A 1QVTA 2EPFA 1DDNA 1U9NA 3J80K 1MH3A 2ECCA 1TTYA 1V4RA 2ZNZA 3QPSA 1USTA 3HG9A 4ENNA 1LDDA 3BTLA 3M9AA 1SFXA 5J40A 4A12A 1S7AA 2EBIA 2L4MA 2ZMEC 1ZGWA 2JT1A 3D0SA 3F8BA 3L2WA 1D8JA 2L7ZA 3DWLE 4JX5A 2K4BA 1ZK8A 1OQYA 3G4SI 4KJZA 2EA4A 4ASNA 4E70A 2CYYA 2VT3A 5GP9A 1S7OA 3W2AA 3DFGA 1OCPA 3IWFA 3O8HA 4BKXA 1X1AA 1MMDA 3E3VA 1V5EA 2CWEA 4B1RA 4FTHA 2GWRA 2M0MA 2QWWA 3IRRA 2XKPA 2H6CA 4EJVA 1IC8A 1V55H 5EYRA 2DJIA 4BHCA 5DUIA 2LBFA 1R1UA 4XKWA 5FKKA 4FETA 4HYEA 1YW9A 2O9LA 1Y56A 4U7BA 3EETA 1A35A 1XPXA 2E19A 3LSMA 4RAZA 2JUCA 2D1VA 3F6OA 2HYJA 1RIOH 1P9QC 3KLOA 3AFHA 5EF6A 1TQPA 4UB6C 3MZHA 1YS6A 2Z2SB 4ANJA 3RKWA 1PUEE 3IHUA 3KFWX 2XDVA 2ZBKA 2HNHA 1MSEC 1VQMI 3KETA 1UAAA 1POGA 4LMYA 5K5RA 2OCCH 2MH2A 4AC0A 3K4NA 2ZXIA 1B9MA 1FBUA 2DDAA 3K0LA 1B4AA 1D0XA 3IH4A 5GTHC 2O8XA 4BEHB 3SEZA 4CYCA 5DDGA 3KP5A 2PJPA 2CV0A 1EH6A 4MNUA 3TGNA 4X6AJ 4CCOA 2DQLA 3CUOA 1K4TA 2E2IJ 2JUGA 2K9LA 4RA2A 4FHTA 2ZMEB 5DCFA 1QZZA 2A3SA 4MEXF 2VN2A 4E7KA 2BW3B 2KJCA 1DGRM 1Z7LA 3KEYA 5IT9Z 4AIJA 3OS1A 1T39A 2JRTA 2LVSA 2E1CA 1ERDA 3OR1C 3CP2A 3M8JA 3ELKA 4RB2C 5TGTA 2M2EA 4M73A 3S3MA 2E1OA 1FEXA 4DBQA 2CU7A 3O8GA 2ME6A 2R92J 2LLKA 3FM5A 1OCRH 1MJBA 5A2QZ 2NYXA 4RLQA 3BR5A 3Q0WA 3HTUA 1J0RA 2QCOA 2IT0A 3DKWA 1FOKA 4AIHA 4F92B 2RQQA 4UUVA 1XGOA 5M5XJ 3ZN1A 2HYFA 3K70D 4AVZA 2DI3A 5C4XJ 4R1HA 5B66C 1BI2A 2X9DA 5IOYA 1Z6TA 1JGSA 4C3IJ 4IHYA 3TP0A 1Z9CA 5M3FJ 3ABKH 1ZRDA 2QVOA 2GIZA 3U1KA 4IHTA 1O4XA 2XRNA 2VKEA 3ZMVA 2P5VA 3HSEA 4XOPA 2ZO4A 1UCRA 2HR3A 1SFKA 4G7HF 3M1EA 1ONVA 2D1HA 4YIFA 3IC7A 1D5VA 3BG6A 5ERIA 4A5NA 3FK6A 1UZCA 2MD0A 2EFPA 2V7FA 3FXKA 2FE3A 1TWGJ 1IN6A 5FKLA 2WAFA 5E1ZB 3S15J 1TQIA 1S3JA 1TW2A 1JI8A 1MDMB 3A01B 4C30A 1GT0C 2LD5A 2KIQA 4YFKF 5IYDJ 1MGTA 4S04A 4PCQA 3PFIA 3PM1A 2VQHA 1YRNB 3HYIA 3GLLA 3GTMJ 4LG3A 3CMMA 2DA1A 1T08B 4QPOA 3QPLA 1XDSA 4JX6A 1YW7A 1E0EA 3EUHC 3TDZC 1IUFA 2E34A 2BBYA 1LFUP 3GWZA 1MIJA 2HQRA 5H20A 3RKYA 4E7JA 1NK2P 1TWHJ 1GVJA 1MNDA 4G6DA 4PFPA 3UKGA 4Y33A 1U5TC 1HOMA 2OTJI 3K4JA 3H92A 4DZPA 3P9CA 3GYHX 1F5TA 2JTVA 2VLAA 3FBIB 4KFCA 4LB5A 2E5ZA 2AS5F 2RC4A 2IGKA 3JW4A 2FMYA 3S14J 1H9TA 3LSGA 4WXDA 3ABUA 2QA4I 3MZYA 2O8KA 2OCEA 5LHIA 1X3WB 1T0FC 3HIFA 1WZ2A 1HBXG 2ECBA 3Q9VA 1VQLI 2K86A 3TO9A 1ACIA 3RQ4A 3I64A 2VUMJ 3BG9A 4M9ZA 3ERMA 2V79A 3UR3C 4S05A 2CMPA 4U87A 3CJRB 2ZJRF 2G9WA 3SZTA 2M4KA 4CCLA 4E7IA 4Y52J 2Q8KA 1WGXA 3SEQA 1F9NA 3MCZA 5DCMB 1XTAA 2ICWG 2MLKA 2O0YA 5E20A 5IP9J 4HSRA 2VJIA 3TKYA 3LA3A 3MAJA 4XRSA 1KU2A 3F8MA 2D2WA 4HRIA 2GA1A 3D5LA 4ZJZA 4HQMA 4L0YB 3FK7A 4II3A 4P55A 1E3PA 2M9HA 2VE8A 1O3QA 2H27A 2L7MP 3C2HA 1EA3A 3OIOA 2Y75A 2QSGX 2HZTA 1U6GA 1DPRA 2E1NA 1D3YA 3FX3A 3IP4B 2NRAC 4I02A 5LEKA 5L3GA 4ZDOA 4YIIA 3GTPJ 3F8CA 4BUPA 3F3XA 1U5TB 5GAHJ 5J47A 1FLIA 3F6VA 1IAWA 1IRGA 3EUKL 2OBPA 1LE8A 4HLYA 2L2OA 2ZXHA 2LREA 3A2KA 1BA5A 2VKDA 3CESA 5FROA 4L5IA 4Y13A 3HUGA 1G59A 2KIUA 3HKZA 3GLXA 5EEAA 1SAUA 2LKSA 4EM1A 3EQLF 3GFIA 3BTJA 4BQNA 3K4CA 1T56A 1YO5C 1BI0A 4LD5A 4OIQF 2JVGA 2G7HA 2DA3A 5CVUA 4PSXA 1FY7A 2QBYB 1ZGAA 5HS9A 3MZ8A 4CDGA 3GTJJ 1EJ9A 4KYWA 1HDDC 1V5FA 3ASNH 2COMA 5D5UB 3AG1H 4BHPA 1QQIA 1U8BA 2IS1A 3LL7A 4A93J 4RS8A 2NNYA 4BGDA 1NG6A 3TW6A 3ABTA 4Z2YA 2VASA 1SD7A 4L9VA 4S0HB 5K7ZA 3KP2A 3G1LA 2YU9J 3ECOA 1SFEA 1BIBA 2GQQA 3ZOBA 2YUSA 2UXNA 2LP0A 4I6ZA 3CCLI 2R7ZJ 5F08A 1ZHFA 2PJRA 2KJBA 3BP8A 2BV6A 1JT6A 1BR2A 2EFQA 2GOXB 4BEHA 4ESBA 2PQ8A 1DP7P 3F72A 1I6XA 3CDLA 2EV5A 1ZG3A 5DEQA 5EEGA 1JUSA 1SMTA 3DTEA 3X2QH 1H8AC 2VOOA 5L3EA 2IP2A 4B3AA 3CTAA 5BPDA 4ZYAA 4YRVA 4I0AA 2W7NA 5F04A 2E71A 4XMYA 4QPQA 1A6IA 5JVGF 3GTOJ 1R00A 1VZ0A 2FUG2 2MC4A 3ESWB 1A6QA 1RUOA 2DA6A 3L2RA 5TISC 2VJ5A 4N9HA 4IF4A 1IO2A 1OCTC 1GXQA 3DEEA 4MEYF 2JQ7A 5FJ8J 1ORKA 2KLOA 1IJWC 2VIXA 3BJ6A 3HKZN 2DFEA 4PDKA 2L01A 3HEFA 1BJAA 4H4KC 2IGOA 2CQXA 3C2GA 1LDJA 3KYLA 3TDUC 1W7PB 3S2WA 1QVUA 4E7ZA 4N9IA 4OIRF 4EQQA 3BT9A 3OL3A 3N97A 2WB1A 4Y4RA 3DPUA 1MW7A 2PMZA 1BN5A 2L9NA 2Q1ZB 5ICCA 4BXFA 3VFZA 1ZGJA 4FX0A 4F52A 4HF0A 3DU5A 4OMYA 1G2HA 2BXYA 1WSUA 4CYDA 2NS8A 3HOSA 2BY1A 1GVDA 4MO7A 1Y6IA 2E7XA 4L5JA 2XB5A 4XLPF 4ZDPA 2NVXJ 3V8JA 3ZQ7A 4BJTA 1KZHA 1FWZA 5LRRA 1OCZH 3F22A 1FYKA 2P6TA 5ICFA 4Q4ZF 4A3MJ 4GYIA 1ZELA 2E1MB 5E3MA 4XKCA 5E3LA 5LLQA 4RB1A 3QQAA 3OYJA 2XB0X 5HNHA 4BU2A 1X2NA 2COBA 3A01A 1NHAA 5J1YA 2VI6A 2BHZA 1CF7B 3HOZJ 5JLXA 2QGUA 4XRMA 1W5SA 1LJ9A 4IHWA 3H0DA 4UV9A 1JUMA 1QRYA 3FXRA 4V2FA 3HTSB 1XSVA 5F0FA 3LSRA 2CV1A 1T2KA 4BYYA 2R3SA 2DFHA 2E60A 1R49A 3LSHA 1J2XA 1LFBA 2QQ8A 1X19A 2O6GE 3JTHA 4XKVA 1GUUA 1FMVA 4I2OA 2X0LA 1T95A 2NVYJ 2ME0A 5CVVA 2PG4A 3KZZA 2YS9A 1K79A 3H5NA 1OKRA 2VONA 2V1XA 5GPAA 1HLVA 4OAZA 5ICEA 3AG3H 2DDBA 3IRQA 4EVIA 2IGMA 2W00A 3MWMA 3WTTC 3GZ5A 1JUPA 2VQCA 4RB0A 3Q5FA 3NWSA 4J01A 4UUSA 3A0HC 2WB1N 3BZ6A 1TWCJ 3NEUA 4L0ZB 3J81Z 1QZEA 2OV7A 2KRFA 2X6YA 3OSGA 3RDIA 1H89C 2F5FA 5JI6A 3O3KA 4M6XA 1LQ1A 4M6YA 5ILSA 3BZKA 2V1UA 2M7AA 2R7VA 3OYIA 1XGMA 3GX4X 1A36A 2L7KA 2NOGA 3W3CA 4EJWA 3K1PA 1I6HJ 1WI9A 2LOOA 2I5UA 4XL9A 2VBYA 3ISPA 2UXXA 3JRGA 3TW7A 3OIPA 5ED4A 2MLGA 3HSFA 2HGCA 4NUBA 4G94A 2E2HJ 3BR1A 5HS8A 1LVAA 1VQKI 2Q2EA 5GPCA 5JHUA 1S29A 3M7GA 4E7HA 1BBYA 1T6SA 2CO5A 3OS0A 2I10A 4MTEA 1C0WA 4PJ0C 1USSA 3OYGA 4PJJA 5AIQA 2LTPA 1L0OC 1BC8C 2NS0A 3R0JA 3B02A 2LY2A 4RM3A 5D5VB 2MYSA 3K70C 3EUHA 4I99C 3PQJA 4F91B 4HNUA 1S6LA 1RNLA 1B8IA 1YJNI 2K9SA 1TNSA 1U5TA 2FQ3A 1W7PD 3AG4H 4WXHA 2EFNA 2Y48A 3DKXA 4WWCA 3WGIA 1ETKA 2DA2A 2RVCA 4NNJA 1Y8RB 1TWAJ 4KDPA 1HW2A 2IRFG 1Z7UA 3DLAA 2KIMA 2R7TA 3WG9A 1SFOJ 5TRDA 1OISA 1W0TA 5BPIA 2X85A 1WWXA 5JHFA 1RZ4A 3OYKA 1DU6A 1T0FA 4B09A 1LB2A 3DKYA 3I53A 3OYLA 3TO6A 3WU2C 2DMTA 1FT9A 3G2BA 4BQAA 3ZP5A 1I1SA 3E6DA 2KRHA 3DXJF 2OZUA 1OPCA 2B63J 1ZARA 4JBAA 4RAYA 1R4MB 3DU6A 1HQCA 2Z9OA 2O61A 1YIOA 3G1MA 2KP6A 2VJ4A 2WTEA 5H6QA 2XV4S 1VQ5I 3AG2H 4MTDA 3HOXJ 1AWCA 4CCJA 4U7DA 5KAFC 4Y3OA 2IS2A 3MQ0A 2PX9A 1X58A 2HDWA 3PQKA 1PUFA 3CDHA 1K78A 1BIAA 4RGXA 2XGCA 3NWTA 1GDTA 2CQKA 1ZG1A 4M71A 1VQPI 5HS7A 3SXYA 1G3YA 1WRJA 4LLNA 2YR2A 4KIFA 2CH0A 3BPXA 2EV0A 2VODA 4CH7A 4ABZA 3MN2A 3V4GA 1YE9A 1OJLA 4XN3A 1PP7U 2VBZA 2CUEA 3BLYA 3KPHA 3R61A 5ICGA 5J4YA 4D7MA 1Y1WJ 1X3ZB 2E36A 2KQRA 4PSWA 1ITYA 4HX4A 4FT8A 2DYRH 3CUQB 1FIPA 1NG7A 2FD5A 3PIOF 3L2QA 3DBLB 3BR2A 4IRIA 1VTNC 1GV5A 2LG4A 2QSHX 1SANA 3FXUA 2P81A 2DCEA 2R7OA 3GMEA 1OCCH 1W4MA 1MMAA 2CV2A 2BY0A 4NC7A 1Q1HA 3LA7A 2HDDA 3GFLA 1J9IA 1RC9A 5LGNA 3KLNA 4LB6B 3OYEA 5E1WA 3J7AO 1IRXA 1KQ9A 1WPKA 2STTA 5KAIC 2Y0SA 2P0WA 4O3MA 4WX9A 4NQWA 1YQAA 1XCVA 2Y2ZA 2V9KA 4A3DJ 4OWRB 2M5WA 1YIJI 3MVPA 3H1CA 1OCOH 4EJOA 3EPZA 1TW3A 2R7FA 1K61A 2WY7Q 1JJ8C 3BG5A 1BOAA 3DEUA 2ZFWA 1FOYA 4PJNA 4YFNF 4I0BA 4PJMA 3LAJA 2MD5A 4R79A 5LGTA 1PP8F 3HRUA 2XROA 1BL0A 2YX4A 4LITA 4HPQA 2UWMA 3C7JA 2DA7A 4ZZLA 3V8LA 1JHHA 2R7QA 3A4CA 4GO1A 4B3XA 1IXCA 4DZJA 5AIPA 1YS7A 3RPUD 2ZC2A 3GTKJ 1ZH5A 3DBHB 4D5CA 4ESFA 1XS9A 3COAC 1ODDA 1NH3A 2EFWA 4JP0A 5DM7F 5HNFA 3CLQA 5FRMA 2VB6A 4C2MJ 1MNMC 1K83J 3L2CA 5BS6A 3LOCA 5JVTA 4L5EA 2X4HA 2M0CA 4EGYA 4ZYHA 3C18A 2WAQA 4A2UA 3BCBA 3WU0A 2F5CA 3FWEA 4DNCA 2Y69H 2GOMA 3GZNB 4KN7X 1WJDA 5IYCJ 4ENJA 4E7SA 3WTWC 2XVCA 4JOMA 3LMMA 1V54H 1SD6A 4G7ZF
chains in the Genus database with same CATH topology
1IZ1A 2E7WA 2V6CA 4WK8F 2XAGA 3RIRA 1FX7A 4I7HA 2P7CB 4A6DA 3P7NA 1P4WA 1K7AA 2EWNA 3SZPA 5HDNA 3KP3A 1R23A 4LFUA 1GHCA 2UZKA 3CLOA 3L9FA 5LEJA 2A07F 1KA8A 2J5OA 2VBWA 3IKVA 2GAUA 1Z91A 2LDUA 2YX7A 2HFHA 1HW1A 3K1MA 4L9TA 2P6SA 1TNTA 4UV8A 1G3WA 1B59A 1AOYA 3LQQA 1P2FA 3CJNA 3QRFF 1Z6RA 5IT9K 3K69A 4ZYEA 4BNCA 3FF5A 3VB2A 2DT5A 4CZZA 3P9IA 2WV0A 1TQMA 3SHFA 2QM3A 1OYYA 4AVPA 5CYVA 5A2QK 3CO7C 1FC3A 2CFXA 2L3DA 1ON2A 2FEZA 3QP6A 2GXGA 3F8NA 2XAJA 4U88A 1ULYA 1I5ZA 2DPDA 2XAQA 2W84A 3WE3A 2WC2A 2OAZA 3HSRA 1R58A 2FOKA 4UVCA 4MQVA 4RGSA 1FP2A 5KK1A 3LFKA 3L00A 2DK8A 1SD4A 5CVIA 3I54A 4WF2A 3DQVC 1R36A 2OZ6A 1O7LA 4RGUA 4LG0B 2ESHA 1YG2A 4IVNA 1FYMA 1MD0A 1J75A 2ZNYA 4HBLA 1D8KA 4ENMA 3RYPA 3U2RA 3I4PA 2RV8A 1BI1A 4RGRA 3T8TA 5J8CA 3E6MA 5D5XB 3E5XA 1XGSA 4PZJA 2HQNA 4LK0F 1F1ZA 1IN4A 3I59B 2DQRA 2M45A 3WODF 1F4KA 4ON0A 5E8IA 2RN7A 1KGSA 4IRGA 5HLHA 3QPTA 1TLHB 3ZMDA 2LSOA 4Y17A 2M8EA 3FMRA 1FZPB 2ADUA 1O3SA 3K1NA 2GXBA 2MC3A 1TBXA 1U2WA 4U0WA 4A0XA 5FGMA 2ELHA 2YPRA 3NQOA 4LLGF 3HRMA 4LGWA 4U0YA 4GXOA 3WTZA 1FBQA 1XSXA 2W85A 4KT5C 4Y15A 4I98B 2ZMEA 1PDNC 3GVAA 4Q5SF 4MQ9F 4YG2F 2GA2A 3W6JB 2HKOA 1E2XA 3QOPA 5J6XA 1KU7A 4JQFA 4BH9A 1KYWA 2HDCA 2STWA 2XAHA 3REOA 5KVRA 4HX8A 4HA8A 3DF8A 3BWGA 1P4AA 1T38A 1HXDA 1IN5A 2QYOA 2VC0A 4ZZDA 3GFJA 3WGGA 1STZA 2QQAA 2L54A 4MHGA 4A0ZA 1EV7A 3BROA 1XMAA 4NB5A 1KYZA 1ZLKA 1Z05A 3T8RA 1G4DA 1XN7A 4G6QA 1MDMA 4G8XA 3T0YA 2MBFA 4L9JA 2H09A 2FRHA 1ZLJA 3HRTA 2Z3YA 2OQGA 2A5YB 1B9NA 4IRHA 4KMUX 1ZAOA 2IA0A 5E17F 2QZ8A 3HOTA 2BEOA 2HTSA 4NHJA 3OV8A 2OD5A 2W25A 4ZYGA 2Z5UA 1DPUA 4BHBA 2XAFA 3WTSC 3GEZA 3ZPLA 1LEAA 2VXZA 5CVJA 4L9NA 3O6BB 1E17A 5FD6A 2OQRA 5DCMA 3O2PE 2IVMA 2YSRA 2H94A 3BJOA 3SFZA 5E8GA 2DU9A 3IWZA 3KCCA 3R4KA 1KQ8A 3QP5A 3L09A 3LSTA 2EV6A 2VE9A 2V1DA 2VBXA 3DP7A 4Q47A 3FZVA 4P5OA 1FP1D 2QLZA 2WWYA 4AIKA 3VODA 3WU1B 2B0LA 1QO0D 2OA4A 5ILVA 3LAPA 1JHFA 1EH8A 1ZN2A 3B73A 2RKHA 3BPVA 3CUQC 1CGPA 3G3ZA 3M8FA 3MEXA 2DPUA 1XD7A 3I0TA 3J81K 4OMZA 4CO8A 1BC7C 2FU4A 3TOAA 2FNPA 4ESJA 1HKQA 3I58A 2L02A 2W24A 2ZKZA 2VT2A 3EYYA 1I1GA 2Q0OA 3G73A 1U78A 2K4JA 2QBYA 2HS5A 4GYGA 1G3SA 2IPQX 1KU9A 2YU3A 3GUDA 5E1XA 1IXRC 5LHHA 1IXSB 1HW5A 4F7ZA 3C3WA 2P5LC 1J59A 2ESNA 4KIGA 1RI7A 2HYGD 3ULQB 5LBQA 4HF2A 1YW8A 3MFKA 3GFMA 5L3DA 1RUNA 3NRVA 1ON1A 3KEOA 3LWFA 5D4SA 1ZRCA 2ZCWA 2DO7A 4WXCA 3L7WA 4U0VA 2QENA 4HLXA 1R5GA 3GXOA 2O03A 2HOEA 5F64A 3WTVC 1W7PA 4HV5A 2DW4A 4KICA 3JAMZ 1OYIA 2W57A 4KUMA 4XLNF 2ZXJA 2EA2A 5FFZA 3U1DA 2K02A 4A5MA 3ERED 1MJAA 1G3TA 4ZH4F 1U3EM 4N0BA 1ZREA 4M74A 2A6EF 2MA3A 1QNTA 3WTUC 3BY6A 3E6BA 4P96A 1B6AA 1SAXA 1K6OA 2G7UA 2P4WA 1HKSA 1XSDA 3KEQA 2CSOA 3DPLC 3C1DA 1CF7A 2RNJA 3QPHA 3R60A 1H9GA 3E5QA 1WQ2A 5HDGA 4LJZF 5BOXA 3IL2A 1OYWA 2J5PA 2GIVA 5L3CA 1ZG5A 2A69F 3T1BA 2M87A 2HEOA 4MGRA 2Y0MA 3JAMK 4AWXB 3QU6A 3W6KB 4P9UA 2CW0F 5CLSA 5EEHA 1QGPA 2LF8A 2NAZA 5HVQC 3RKXA 4L18B 4XRFA 3RTRA 3T5XA 1J5YA 3KZYA 3RPQA 3V8KA 5HLGA 5D5WB 4M9SA 1O7FA 3VOEA 4XBFA 5K1YA 4EM0B 2FBHA 5HDKA 2ACJA 1KQ0A 5D8KB 4I09A 4TV7A 3DPTA 2LF7A 4UHTA 3HHHA 3HRSA 2QUFA 3M8EA 2AXLA 2GZWA 2XKOA 2KIFA 4KN4X 2VOPA 1Y0UA 2A61A 3KP6A 2EFOA 2FF4A 2P8TA 1IN8A 1JE8A 4EJTA 4AD9A 5L3FA 3WGHA 5H6RA 1R7JA 5FFXA 1IW7F 1BM9A 3QAHA 5LGUA 4KIBA 4K2EA 2BGCA 3I5UA 2PEXA 3FXQA 2M30A 3RPUA 2XGXA 3F21A 5DV5A 5JR3A 2PLYA 4UVAA 3WTXC 4WCGA 3CO6C 1REPC 1WKMA 3BJAA 3E6CC 4HW0A 4EMSA 1J7KA 1P6RA 4GCVA 4IHSA 3GO5A 2QQ9A 1IN7A 2A6HF 3LA2A 4HOBA 2FSWA 1HSJA 2FXAA 2D45A 3R0AA 4I01A 4R8HA 1B1BA 4A0YA 2VC1A 4UXNA 4HZFA 3R6SA 5BQTA 5K5OA 2OU2A 3WE2A 1BI3A 1OR7A 1QPMA 1MZBA 5F6FA 4IPAA 2BE5F 4G7OF 1LDKB 5D6FA 4EV0A 2L4AA 4OIPF 4H0EA 4ZYDA 4D0PA 3EDPA 3GF2A 4BAYA 4HDVA 2LNBA 3CUQA 1L3LA 4QLCU 4B8XA 1FBSA 5CJ9A 3EYIA 4HF1A 3U9GA 3KE2A 2Z33A 2ISZA 3KP4A 2MH9A 2XHKA 1YTYA 2ETHA 5HLIA 3QU3A 1O3RA 1HKTA 1P4XA 2PN6A 3TO7A 4O6JA 3RI4A 3P9KA 1SMYF 5AONA 3BDDA 2FNAA 1XGNA 2DFIA 3V7SA 5FD5A 3GW2A 1XB4A 1GXPA 5TJJA 5DD4A 1MKMA 1W5TA 4DQ2A 1OMIA 1R22A 4EJUA 6PAXA 4KMFA 1FSHA 2FMLA 4ENKA 2CG4A 3RYRA 2JSCA 2EJRA 3HHGA 3ECHA 4M72A 4XSXF 3ZMSA 3OOPA 2PMUA 1FYLA 4PGHA 2XIGA 3SQNA 1IUYA 1HSTA 5DD8A 5D8LB 4GGGA 1X3UA 2KKOA 3ZMTA 1K78B 3JSOA 2NNNA 5IT3A 2IA2A 4OOIA 1SD5A 1I27A 3ROUA 3RJPA 4ETSA 2HTJA 1LEBA 4P9FA 2HKXA 2FA5A 3H3ZA 4JK1X 2RDPA 2EK5A 3IKTA 1XDUA 3FMQA 2DK5A 2QQBA 4YFXF 1QZYA 3FM3A 1YFHA 1T98A 5J8FA 1S8NA 4OIOF 2V9VA 3VEPA 4LK1F 2TDXA 3H3UA 1QBJA 2DBBA 2F5EA 1YLFA 1U8RA 1JXSA 5CVRA 3FHZA 2F2EA 1KU3A 1XCBA 5BMZA 4UVBA 4XSZF 4CGZA 4UNOA 3TOBA 1UHMA 2JPBA 1O3TA 2F5DA 1R1VA 3E5UA 5ILUA 4BXUA 4M9XA 5DUKA 4QWQA 1FSEA 1P92A 4OINF 5D4RA 4RB3C 1LNWA 4OU0A 3AAFA 3V7CA 2IW5A 5HOOA 1UFMA 4HDUA 1YYVA 2H6BA 4FX4A 1XMKA 1IRFA 4EGZA 4IJAA 3WTYC 4O5VA 4HQEA 5D6EA 1A04A 2PMHA 1O57A 1UHWA 4Q48A 4LG0A 5K5QA 2C6YA 2RGVA 4LLLA 2PFBA 5L3BA 2FBIA 3TQNA 5FLXZ 2O3FA 1V3FA 5E18F 1H0MA 2K27A 1R5HA 3JSPA 2A68F 2PBIA 4IXAA 2EB7A 4CHUA 3GZ6A 3KP7A 3ZN0A 3JTGA 2DLLA 2Z99A 3ZMZA 5FO5A 4HV6A 5FB2A 2ZJ2A 3I59A 2DAOA 2HWVA 3DV8A 2FBKA 2ISYA 4HX7A 3BOQA 1Z1DA 1SFUA 2IJLA 5JFRA 2XUBA 5F1RA 3ML6A 1FNNA 1FPQA 4HAMA 1IF1A 2LKPA 3J80Z 4CXFA 5FLXK 5LHGA 2CGPA 2BYVE 3N4MA 5LRSA 1UB9A 4KA4A 5DYMA 2P5KA 1G6NA 3ZMUA 3K2ZA 4G9YA 4PGGA 1ZYRF 4CICA 3Q9SA 2K7LA 2R7DA 2JPCA 3V7RA 2P7VB 4EM2A 1ZRFA 2XASA 3FMSA 3E97A 1DUXC 3K9TA 3F8FA 3LQRA 2PI0A 2RQPA 2DTRA 3I71A 2IA1A 2JZYA 2M1BA 1MJ9A 1EH7A 1R1TA 4KNYA 3F23A 4A6EA 1DDNA 3J80K 1TTYA 1V4RA 2ZNZA 4ENNA 1USTA 1LDDA 3M9AA 1SFXA 4A12A 1S7AA 2L4MA 2JT1A 3D0SA 3F8BA 1D8JA 2K4BA 2EA4A 4E70A 4ASNA 2CYYA 2VT3A 1S7OA 3DFGA 3IWFA 3E3VA 2CWEA 2GWRA 2QWWA 3IRRA 2XKPA 2H6CA 4EJVA 4BHCA 5DUIA 1R1UA 4HYEA 1YW9A 4U7BA 3EETA 4RAZA 2D1VA 3F6OA 1RIOH 3KLOA 1TQPA 3MZHA 1YS6A 3RKWA 1PUEE 3IHUA 3KFWX 2ZBKA 3KETA 4LMYA 5K5RA 2MH2A 1B9MA 1FBUA 3K0LA 1B4AA 2O8XA 5DDGA 3KP5A 2PJPA 1EH6A 4MNUA 3TGNA 2DQLA 3CUOA 4FHTA 2ZMEB 5DCFA 1QZZA 2A3SA 4MEXF 2VN2A 2KJCA 5IT9Z 4AIJA 1T39A 2JRTA 2E1CA 3ELKA 4RB2C 4M73A 3FM5A 1MJBA 5A2QZ 2NYXA 3HTUA 1J0RA 2IT0A 3DKWA 1FOKA 4AIHA 4UUVA 1XGOA 3ZN1A 2HYFA 2DI3A 4R1HA 1BI2A 1Z6TA 1JGSA 1Z9CA 1ZRDA 2QVOA 4IHTA 2XRNA 3ZMVA 2P5VA 3HSEA 2ZO4A 1UCRA 2HR3A 4G7HF 3M1EA 1ONVA 2D1HA 4YIFA 3IC7A 1D5VA 5ERIA 4A5NA 2EFPA 2FE3A 1IN6A 5E1ZB 1TQIA 1S3JA 1TW2A 1MDMB 4YFKF 1MGTA 4S04A 4PCQA 3PFIA 3HYIA 1XDSA 1YW7A 3TDZC 2BBYA 3GWZA 5H20A 2HQRA 3RKYA 1GVJA 4G6DA 1U5TC 3H92A 3P9CA 3GYHX 1F5TA 2JTVA 4KFCA 4LB5A 2AS5F 2RC4A 3JW4A 2FMYA 1H9TA 4WXDA 3ABUA 3MZYA 5LHIA 3HIFA 1HBXG 3Q9VA 2K86A 3TO9A 3I64A 4M9ZA 2V79A 4S05A 2G9WA 3SZTA 2Q8KA 1F9NA 3MCZA 5DCMB 2MLKA 2O0YA 5E20A 3TKYA 3LA3A 3MAJA 1KU2A 3F8MA 2D2WA 2GA1A 3D5LA 4HQMA 4L0YB 4P55A 2VE8A 1O3QA 2H27A 2Y75A 2HZTA 1U6GA 1DPRA 2E1NA 1D3YA 3FX3A 2NRAC 4I02A 5LEKA 5L3GA 4YIIA 3F8CA 3F3XA 1U5TB 1FLIA 3F6VA 1IAWA 1IRGA 2OBPA 4HLYA 4L5IA 4Y13A 3HUGA 2KIUA 3GLXA 4EM1A 3EQLF 3GFIA 1YO5C 1BI0A 4LD5A 4OIQF 2G7HA 5CVUA 1FY7A 2QBYB 1ZGAA 5HS9A 4CDGA 4KYWA 2COMA 5D5UB 4BHPA 1QQIA 4RS8A 2NNYA 3ABTA 4Z2YA 1SD7A 4L9VA 3KP2A 3ECOA 1SFEA 1BIBA 2GQQA 2UXNA 1ZHFA 2KJBA 3BP8A 2BV6A 4ESBA 2EFQA 2PQ8A 1DP7P 3F72A 1I6XA 2EV5A 1ZG3A 5DEQA 5EEGA 1SMTA 2VOOA 5L3EA 2IP2A 3CTAA 5BPDA 4I0AA 1R00A 1RUOA 4N9HA 4IF4A 1GXQA 4MEYF 3BJ6A 4PDKA 2L01A 1BJAA 1LDJA 3TDUC 1W7PB 3S2WA 4N9IA 4OIRF 4EQQA 3N97A 1BN5A 5ICCA 3VFZA 1ZGJA 4FX0A 4HF0A 4OMYA 1WSUA 4CYDA 3HOSA 2E7XA 4L5JA 4XLPF 3V8JA 3ZQ7A 1FWZA 5LRRA 3F22A 1FYKA 2P6TA 5ICFA 4Q4ZF 4GYIA 5LLQA 4RB1A 1NHAA 1CF7B 1W5SA 1LJ9A 4UV9A 3FXRA 3HTSB 1XSVA 1T2KA 4BYYA 2R3SA 1J2XA 2O6GE 3JTHA 4I2OA 2X0LA 5CVVA 2PG4A 3KZZA 1K79A 1OKRA 2VONA 2V1XA 5ICEA 3IRQA 4EVIA 3MWMA 3WTTC 3GZ5A 4RB0A 3Q5FA 3BZ6A 3NEUA 4L0ZB 3J81Z 2KRFA 3RDIA 2F5FA 5JI6A 3O3KA 4M6XA 1LQ1A 4M6YA 5ILSA 2V1UA 1XGMA 3GX4X 4EJWA 3K1PA 1WI9A 2VBYA 3ISPA 2UXXA 5ED4A 2MLGA 3HSFA 2HGCA 4G94A 5HS8A 1LVAA 2Q2EA 5JHUA 1S29A 3M7GA 1BBYA 1T6SA 2CO5A 4MTEA 1C0WA 1USSA 5AIQA 1L0OC 1BC8C 2NS0A 3R0JA 3B02A 5D5VB 3EUHA 3PQJA 1S6LA 1RNLA 1TNSA 1U5TA 2FQ3A 1W7PD 4WXHA 2EFNA 2Y48A 4WWCA 3WGIA 2RVCA 4KDPA 1HW2A 2IRFG 1Z7UA 2KIMA 3WG9A 5TRDA 5BPIA 1WWXA 1RZ4A 1T0FA 4B09A 1LB2A 3I53A 3TO6A 1FT9A 4BQAA 3ZP5A 1I1SA 3E6DA 3DXJF 2OZUA 1OPCA 1ZARA 4JBAA 4RAYA 2O61A 1HQCA 2Z9OA 1YIOA 2WTEA 5H6QA 2XV4S 4MTDA 1AWCA 4U7DA 3MQ0A 3PQKA 3CDHA 1K78A 1BIAA 4RGXA 2CQKA 1ZG1A 4M71A 5HS7A 3SXYA 1G3YA 1WRJA 4LLNA 2YR2A 4KIFA 3BPXA 2EV0A 2VODA 1PP7U 3V4GA 2VBZA 3R61A 5ICGA 4HX4A 4FT8A 3CUQB 4IRIA 1VTNC 3FXUA 1W4MA 1Q1HA 3LA7A 3GFLA 1J9IA 5LGNA 3KLNA 4LB6B 5E1WA 3J7AO 1KQ9A 2STTA 4O3MA 4WX9A 4NQWA 1YQAA 1XCVA 2M5WA 4EJOA 1TW3A 2R7FA 1BOAA 3DEUA 2ZFWA 4YFNF 4I0BA 3LAJA 2MD5A 4R79A 5LGTA 1PP8F 3HRUA 2XROA 2YX4A 2UWMA 3C7JA 4ZZLA 3V8LA 1JHHA 4GO1A 1IXCA 5AIPA 1YS7A 1ZH5A 4ESFA 3COAC 1ODDA 2EFWA 3L2CA 5BS6A 5JVTA 2X4HA 4EGYA 4ZYHA 3C18A 4A2UA 3WU0A 2F5CA 3FWEA 4DNCA 4KN7X 4ENJA 3WTWC 2XVCA 1SD6A 4G7ZF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IZ1 A;  2E7W A;  2V6C A;  4WK8 F;  2XAG A;  3RIR A;  1FX7 A;  4I7H A;  2P7C B;  4A6D A;  3P7N A;  1P4W A;  1K7A A;  2EWN A;  3SZP A;  5HDN A;  3KP3 A;  1R23 A;  4LFU A;  1GHC A;  2UZK A;  3CLO A;  3L9F A;  5LEJ A;  2A07 F;  1KA8 A;  2J5O A;  2VBW A;  3IKV A;  2GAU A;  1Z91 A;  2LDU A;  2YX7 A;  2HFH A;  1HW1 A;  3K1M A;  4L9T A;  2P6S A;  1TNT A;  4UV8 A;  1G3W A;  1B59 A;  1AOY A;  3LQQ A;  1P2F A;  3CJN A;  3QRF F;  1Z6R A;  5IT9 K;  3K69 A;  4ZYE A;  4BNC A;  3FF5 A;  3VB2 A;  2DT5 A;  4CZZ A;  3P9I A;  2WV0 A;  1TQM A;  3SHF A;  2QM3 A;  1OYY A;  4AVP A;  5CYV A;  5A2Q K;  3CO7 C;  1FC3 A;  2CFX A;  2L3D A;  1ON2 A;  2FEZ A;  3QP6 A;  2GXG A;  3F8N A;  2XAJ A;  4U88 A;  1ULY A;  1I5Z A;  2DPD A;  2XAQ A;  2W84 A;  3WE3 A;  2WC2 A;  2OAZ A;  3HSR A;  1R58 A;  2FOK A;  4UVC A;  4MQV A;  4RGS A;  1FP2 A;  5KK1 A;  3LFK A;  3L00 A;  2DK8 A;  1SD4 A;  5CVI A;  3I54 A;  4WF2 A;  3DQV C;  1R36 A;  2OZ6 A;  1O7L A;  4RGU A;  4LG0 B;  2ESH A;  1YG2 A;  4IVN A;  1FYM A;  1MD0 A;  1J75 A;  2ZNY A;  4HBL A;  1D8K A;  4ENM A;  3RYP A;  3U2R A;  3I4P A;  2RV8 A;  1BI1 A;  4RGR A;  3T8T A;  5J8C A;  3E6M A;  5D5X B;  3E5X A;  1XGS A;  4PZJ A;  2HQN A;  4LK0 F;  1F1Z A;  1IN4 A;  3I59 B;  2DQR A;  2M45 A;  3WOD F;  1F4K A;  4ON0 A;  5E8I A;  2RN7 A;  1KGS A;  4IRG A;  5HLH A;  3QPT A;  1TLH B;  3ZMD A;  2LSO A;  4Y17 A;  2M8E A;  3FMR A;  1FZP B;  2ADU A;  1O3S A;  3K1N A;  2GXB A;  2MC3 A;  1TBX A;  1U2W A;  4U0W A;  4A0X A;  5FGM A;  2ELH A;  2YPR A;  3NQO A;  4LLG F;  3HRM A;  4LGW A;  4U0Y A;  4GXO A;  3WTZ A;  1FBQ A;  1XSX A;  2W85 A;  4KT5 C;  4Y15 A;  4I98 B;  2ZME A;  1PDN C;  3GVA A;  4Q5S F;  4MQ9 F;  4YG2 F;  2GA2 A;  3W6J B;  2HKO A;  1E2X A;  3QOP A;  5J6X A;  1KU7 A;  4JQF A;  4BH9 A;  1KYW A;  2HDC A;  2STW A;  2XAH A;  3REO A;  5KVR A;  4HX8 A;  4HA8 A;  3DF8 A;  3BWG A;  1P4A A;  1T38 A;  1HXD A;  1IN5 A;  2QYO A;  2VC0 A;  4ZZD A;  3GFJ A;  3WGG A;  1STZ A;  2QQA A;  2L54 A;  4MHG A;  4A0Z A;  1EV7 A;  3BRO A;  1XMA A;  4NB5 A;  1KYZ A;  1ZLK A;  1Z05 A;  3T8R A;  1G4D A;  1XN7 A;  4G6Q A;  1MDM A;  4G8X A;  3T0Y A;  2MBF A;  4L9J A;  2H09 A;  2FRH A;  1ZLJ A;  3HRT A;  2Z3Y A;  2OQG A;  2A5Y B;  1B9N A;  4IRH A;  4KMU X;  1ZAO A;  2IA0 A;  5E17 F;  2QZ8 A;  3HOT A;  2BEO A;  2HTS A;  4NHJ A;  3OV8 A;  2OD5 A;  2W25 A;  4ZYG A;  2Z5U A;  1DPU A;  4BHB A;  2XAF A;  3WTS C;  3GEZ A;  3ZPL A;  1LEA A;  2VXZ A;  5CVJ A;  4L9N A;  3O6B B;  1E17 A;  5FD6 A;  2OQR A;  5DCM A;  3O2P E;  2IVM A;  2YSR A;  2H94 A;  3BJO A;  3SFZ A;  5E8G A;  2DU9 A;  3IWZ A;  3KCC A;  3R4K A;  1KQ8 A;  3QP5 A;  3L09 A;  3LST A;  2EV6 A;  2VE9 A;  2V1D A;  2VBX A;  3DP7 A;  4Q47 A;  3FZV A;  4P5O A;  1FP1 D;  2QLZ A;  2WWY A;  4AIK A;  3VOD A;  3WU1 B;  2B0L A;  1QO0 D;  2OA4 A;  5ILV A;  3LAP A;  1JHF A;  1EH8 A;  1ZN2 A;  3B73 A;  2RKH A;  3BPV A;  3CUQ C;  1CGP A;  3G3Z A;  3M8F A;  3MEX A;  2DPU A;  1XD7 A;  3I0T A;  3J81 K;  4OMZ A;  4CO8 A;  1BC7 C;  2FU4 A;  3TOA A;  2FNP A;  4ESJ A;  1HKQ A;  3I58 A;  2L02 A;  2W24 A;  2ZKZ A;  2VT2 A;  3EYY A;  1I1G A;  2Q0O A;  3G73 A;  1U78 A;  2K4J A;  2QBY A;  2HS5 A;  4GYG A;  1G3S A;  2IPQ X;  1KU9 A;  2YU3 A;  3GUD A;  5E1X A;  1IXR C;  5LHH A;  1IXS B;  1HW5 A;  4F7Z A;  3C3W A;  2P5L C;  1J59 A;  2ESN A;  4KIG A;  1RI7 A;  2HYG D;  3ULQ B;  5LBQ A;  4HF2 A;  1YW8 A;  3MFK A;  3GFM A;  5L3D A;  1RUN A;  3NRV A;  1ON1 A;  3KEO A;  3LWF A;  5D4S A;  1ZRC A;  2ZCW A;  2DO7 A;  4WXC A;  3L7W A;  4U0V A;  2QEN A;  4HLX A;  1R5G A;  3GXO A;  2O03 A;  2HOE A;  5F64 A;  3WTV C;  1W7P A;  4HV5 A;  2DW4 A;  4KIC A;  3JAM Z;  1OYI A;  2W57 A;  4KUM A;  4XLN F;  2ZXJ A;  2EA2 A;  5FFZ A;  3U1D A;  2K02 A;  4A5M A;  3ERE D;  1MJA A;  1G3T A;  4ZH4 F;  1U3E M;  4N0B A;  1ZRE A;  4M74 A;  2A6E F;  2MA3 A;  1QNT A;  3WTU C;  3BY6 A;  3E6B A;  4P96 A;  1B6A A;  1SAX A;  1K6O A;  2G7U A;  2P4W A;  1HKS A;  1XSD A;  3KEQ A;  2CSO A;  3DPL C;  3C1D A;  1CF7 A;  2RNJ A;  3QPH A;  3R60 A;  1H9G A;  3E5Q A;  1WQ2 A;  5HDG A;  4LJZ F;  5BOX A;  3IL2 A;  1OYW A;  2J5P A;  2GIV A;  5L3C A;  1ZG5 A;  2A69 F;  3T1B A;  2M87 A;  2HEO A;  4MGR A;  2Y0M A;  3JAM K;  4AWX B;  3QU6 A;  3W6K B;  4P9U A;  2CW0 F;  5CLS A;  5EEH A;  1QGP A;  2LF8 A;  2NAZ A;  5HVQ C;  3RKX A;  4L18 B;  4XRF A;  3RTR A;  3T5X A;  1J5Y A;  3KZY A;  3RPQ A;  3V8K A;  5HLG A;  5D5W B;  4M9S A;  1O7F A;  3VOE A;  4XBF A;  5K1Y A;  4EM0 B;  2FBH A;  5HDK A;  2ACJ A;  1KQ0 A;  5D8K B;  4I09 A;  4TV7 A;  3DPT A;  2LF7 A;  4UHT A;  3HHH A;  3HRS A;  2QUF A;  3M8E A;  2AXL A;  2GZW A;  2XKO A;  2KIF A;  4KN4 X;  2VOP A;  1Y0U A;  2A61 A;  3KP6 A;  2EFO A;  2FF4 A;  2P8T A;  1IN8 A;  1JE8 A;  4EJT A;  4AD9 A;  5L3F A;  3WGH A;  5H6R A;  1R7J A;  5FFX A;  1IW7 F;  1BM9 A;  3QAH A;  5LGU A;  4KIB A;  4K2E A;  2BGC A;  3I5U A;  2PEX A;  3FXQ A;  2M30 A;  3RPU A;  2XGX A;  3F21 A;  5DV5 A;  5JR3 A;  2PLY A;  4UVA A;  3WTX C;  4WCG A;  3CO6 C;  1REP C;  1WKM A;  3BJA A;  3E6C C;  4HW0 A;  4EMS A;  1J7K A;  1P6R A;  4GCV A;  4IHS A;  3GO5 A;  2QQ9 A;  1IN7 A;  2A6H F;  3LA2 A;  4HOB A;  2FSW A;  1HSJ A;  2FXA A;  2D45 A;  3R0A A;  4I01 A;  4R8H A;  1B1B A;  4A0Y A;  2VC1 A;  4UXN A;  4HZF A;  3R6S A;  5BQT A;  5K5O A;  2OU2 A;  3WE2 A;  1BI3 A;  1OR7 A;  1QPM A;  1MZB A;  5F6F A;  4IPA A;  2BE5 F;  4G7O F;  1LDK B;  5D6F A;  4EV0 A;  2L4A A;  4OIP F;  4H0E A;  4ZYD A;  4D0P A;  3EDP A;  3GF2 A;  4BAY A;  4HDV A;  2LNB A;  3CUQ A;  1L3L A;  4QLC U;  4B8X A;  1FBS A;  5CJ9 A;  3EYI A;  4HF1 A;  3U9G A;  3KE2 A;  2Z33 A;  2ISZ A;  3KP4 A;  2MH9 A;  2XHK A;  1YTY A;  2ETH A;  5HLI A;  3QU3 A;  1O3R A;  1HKT A;  1P4X A;  2PN6 A;  3TO7 A;  4O6J A;  3RI4 A;  3P9K A;  1SMY F;  5AON A;  3BDD A;  2FNA A;  1XGN A;  2DFI A;  3V7S A;  5FD5 A;  3GW2 A;  1XB4 A;  1GXP A;  5TJJ A;  5DD4 A;  1MKM A;  1W5T A;  4DQ2 A;  1OMI A;  1R22 A;  4EJU A;  6PAX A;  4KMF A;  1FSH A;  2FML A;  4ENK A;  2CG4 A;  3RYR A;  2JSC A;  2EJR A;  3HHG A;  3ECH A;  4M72 A;  4XSX F;  3ZMS A;  3OOP A;  2PMU A;  1FYL A;  4PGH A;  2XIG A;  3SQN A;  1IUY A;  1HST A;  5DD8 A;  5D8L B;  4GGG A;  1X3U A;  2KKO A;  3ZMT A;  1K78 B;  3JSO A;  2NNN A;  5IT3 A;  2IA2 A;  4OOI A;  1SD5 A;  1I27 A;  3ROU A;  3RJP A;  4ETS A;  2HTJ A;  1LEB A;  4P9F A;  2HKX A;  2FA5 A;  3H3Z A;  4JK1 X;  2RDP A;  2EK5 A;  3IKT A;  1XDU A;  3FMQ A;  2DK5 A;  2QQB A;  4YFX F;  1QZY A;  3FM3 A;  1YFH A;  1T98 A;  5J8F A;  1S8N A;  4OIO F;  2V9V A;  3VEP A;  4LK1 F;  2TDX A;  3H3U A;  1QBJ A;  2DBB A;  2F5E A;  1YLF A;  1U8R A;  1JXS A;  5CVR A;  3FHZ A;  2F2E A;  1KU3 A;  1XCB A;  5BMZ A;  4UVB A;  4XSZ F;  4CGZ A;  4UNO A;  3TOB A;  1UHM A;  2JPB A;  1O3T A;  2F5D A;  1R1V A;  3E5U A;  5ILU A;  4BXU A;  4M9X A;  5DUK A;  4QWQ A;  1FSE A;  1P92 A;  4OIN F;  5D4R A;  4RB3 C;  1LNW A;  4OU0 A;  3AAF A;  3V7C A;  2IW5 A;  5HOO A;  1UFM A;  4HDU A;  1YYV A;  2H6B A;  4FX4 A;  1XMK A;  1IRF A;  4EGZ A;  4IJA A;  3WTY C;  4O5V A;  4HQE A;  5D6E A;  1A04 A;  2PMH A;  1O57 A;  1UHW A;  4Q48 A;  4LG0 A;  5K5Q A;  2C6Y A;  2RGV A;  4LLL A;  2PFB A;  5L3B A;  2FBI A;  3TQN A;  5FLX Z;  2O3F A;  1V3F A;  5E18 F;  1H0M A;  2K27 A;  1R5H A;  3JSP A;  2A68 F;  2PBI A;  4IXA A;  2EB7 A;  4CHU A;  3GZ6 A;  3KP7 A;  3ZN0 A;  3JTG A;  2DLL A;  2Z99 A;  3ZMZ A;  5FO5 A;  4HV6 A;  5FB2 A;  2ZJ2 A;  3I59 A;  2DAO A;  2HWV A;  3DV8 A;  2FBK A;  2ISY A;  4HX7 A;  3BOQ A;  1Z1D A;  1SFU A;  2IJL A;  5JFR A;  2XUB A;  5F1R A;  3ML6 A;  1FNN A;  1FPQ A;  4HAM A;  1IF1 A;  2LKP A;  3J80 Z;  4CXF A;  5FLX K;  5LHG A;  2CGP A;  2BYV E;  3N4M A;  5LRS A;  1UB9 A;  4KA4 A;  5DYM A;  2P5K A;  1G6N A;  3ZMU A;  3K2Z A;  4G9Y A;  4PGG A;  1ZYR F;  4CIC A;  3Q9S A;  2K7L A;  2R7D A;  2JPC A;  3V7R A;  2P7V B;  4EM2 A;  1ZRF A;  2XAS A;  3FMS A;  3E97 A;  1DUX C;  3K9T A;  3F8F A;  3LQR A;  2PI0 A;  2RQP A;  2DTR A;  3I71 A;  2IA1 A;  2JZY A;  2M1B A;  1MJ9 A;  1EH7 A;  1R1T A;  4KNY A;  3F23 A;  4A6E A;  1DDN A;  3J80 K;  1TTY A;  1V4R A;  2ZNZ A;  4ENN A;  1UST A;  1LDD A;  3M9A A;  1SFX A;  4A12 A;  1S7A A;  2L4M A;  2JT1 A;  3D0S A;  3F8B A;  1D8J A;  2K4B A;  2EA4 A;  4E70 A;  4ASN A;  2CYY A;  2VT3 A;  1S7O A;  3DFG A;  3IWF A;  3E3V A;  2CWE A;  2GWR A;  2QWW A;  3IRR A;  2XKP A;  2H6C A;  4EJV A;  4BHC A;  5DUI A;  1R1U A;  4HYE A;  1YW9 A;  4U7B A;  3EET A;  4RAZ A;  2D1V A;  3F6O A;  1RIO H;  3KLO A;  1TQP A;  3MZH A;  1YS6 A;  3RKW A;  1PUE E;  3IHU A;  3KFW X;  2ZBK A;  3KET A;  4LMY A;  5K5R A;  2MH2 A;  1B9M A;  1FBU A;  3K0L A;  1B4A A;  2O8X A;  5DDG A;  3KP5 A;  2PJP A;  1EH6 A;  4MNU A;  3TGN A;  2DQL A;  3CUO A;  4FHT A;  2ZME B;  5DCF A;  1QZZ A;  2A3S A;  4MEX F;  2VN2 A;  2KJC A;  5IT9 Z;  4AIJ A;  1T39 A;  2JRT A;  2E1C A;  3ELK A;  4RB2 C;  4M73 A;  3FM5 A;  1MJB A;  5A2Q Z;  2NYX A;  3HTU A;  1J0R A;  2IT0 A;  3DKW A;  1FOK A;  4AIH A;  4UUV A;  1XGO A;  3ZN1 A;  2HYF A;  2DI3 A;  4R1H A;  1BI2 A;  1Z6T A;  1JGS A;  1Z9C A;  1ZRD A;  2QVO A;  4IHT A;  2XRN A;  3ZMV A;  2P5V A;  3HSE A;  2ZO4 A;  1UCR A;  2HR3 A;  4G7H F;  3M1E A;  1ONV A;  2D1H A;  4YIF A;  3IC7 A;  1D5V A;  5ERI A;  4A5N A;  2EFP A;  2FE3 A;  1IN6 A;  5E1Z B;  1TQI A;  1S3J A;  1TW2 A;  1MDM B;  4YFK F;  1MGT A;  4S04 A;  4PCQ A;  3PFI A;  3HYI A;  1XDS A;  1YW7 A;  3TDZ C;  2BBY A;  3GWZ A;  5H20 A;  2HQR A;  3RKY A;  1GVJ A;  4G6D A;  1U5T C;  3H92 A;  3P9C A;  3GYH X;  1F5T A;  2JTV A;  4KFC A;  4LB5 A;  2AS5 F;  2RC4 A;  3JW4 A;  2FMY A;  1H9T A;  4WXD A;  3ABU A;  3MZY A;  5LHI A;  3HIF A;  1HBX G;  3Q9V A;  2K86 A;  3TO9 A;  3I64 A;  4M9Z A;  2V79 A;  4S05 A;  2G9W A;  3SZT A;  2Q8K A;  1F9N A;  3MCZ A;  5DCM B;  2MLK A;  2O0Y A;  5E20 A;  3TKY A;  3LA3 A;  3MAJ A;  1KU2 A;  3F8M A;  2D2W A;  2GA1 A;  3D5L A;  4HQM A;  4L0Y B;  4P55 A;  2VE8 A;  1O3Q A;  2H27 A;  2Y75 A;  2HZT A;  1U6G A;  1DPR A;  2E1N A;  1D3Y A;  3FX3 A;  2NRA C;  4I02 A;  5LEK A;  5L3G A;  4YII A;  3F8C A;  3F3X A;  1U5T B;  1FLI A;  3F6V A;  1IAW A;  1IRG A;  2OBP A;  4HLY A;  4L5I A;  4Y13 A;  3HUG A;  2KIU A;  3GLX A;  4EM1 A;  3EQL F;  3GFI A;  1YO5 C;  1BI0 A;  4LD5 A;  4OIQ F;  2G7H A;  5CVU A;  1FY7 A;  2QBY B;  1ZGA A;  5HS9 A;  4CDG A;  4KYW A;  2COM A;  5D5U B;  4BHP A;  1QQI A;  4RS8 A;  2NNY A;  3ABT A;  4Z2Y A;  1SD7 A;  4L9V A;  3KP2 A;  3ECO A;  1SFE A;  1BIB A;  2GQQ A;  2UXN A;  1ZHF A;  2KJB A;  3BP8 A;  2BV6 A;  4ESB A;  2EFQ A;  2PQ8 A;  1DP7 P;  3F72 A;  1I6X A;  2EV5 A;  1ZG3 A;  5DEQ A;  5EEG A;  1SMT A;  2VOO A;  5L3E A;  2IP2 A;  3CTA A;  5BPD A;  4I0A A;  1R00 A;  1RUO A;  4N9H A;  4IF4 A;  1GXQ A;  4MEY F;  3BJ6 A;  4PDK A;  2L01 A;  1BJA A;  1LDJ A;  3TDU C;  1W7P B;  3S2W A;  4N9I A;  4OIR F;  4EQQ A;  3N97 A;  1BN5 A;  5ICC A;  3VFZ A;  1ZGJ A;  4FX0 A;  4HF0 A;  4OMY A;  1WSU A;  4CYD A;  3HOS A;  2E7X A;  4L5J A;  4XLP F;  3V8J A;  3ZQ7 A;  1FWZ A;  5LRR A;  3F22 A;  1FYK A;  2P6T A;  5ICF A;  4Q4Z F;  4GYI A;  5LLQ A;  4RB1 A;  1NHA A;  1CF7 B;  1W5S A;  1LJ9 A;  4UV9 A;  3FXR A;  3HTS B;  1XSV A;  1T2K A;  4BYY A;  2R3S A;  1J2X A;  2O6G E;  3JTH A;  4I2O A;  2X0L A;  5CVV A;  2PG4 A;  3KZZ A;  1K79 A;  1OKR A;  2VON A;  2V1X A;  5ICE A;  3IRQ A;  4EVI A;  3MWM A;  3WTT C;  3GZ5 A;  4RB0 A;  3Q5F A;  3BZ6 A;  3NEU A;  4L0Z B;  3J81 Z;  2KRF A;  3RDI A;  2F5F A;  5JI6 A;  3O3K A;  4M6X A;  1LQ1 A;  4M6Y A;  5ILS A;  2V1U A;  1XGM A;  3GX4 X;  4EJW A;  3K1P A;  1WI9 A;  2VBY A;  3ISP A;  2UXX A;  5ED4 A;  2MLG A;  3HSF A;  2HGC A;  4G94 A;  5HS8 A;  1LVA A;  2Q2E A;  5JHU A;  1S29 A;  3M7G A;  1BBY A;  1T6S A;  2CO5 A;  4MTE A;  1C0W A;  1USS A;  5AIQ A;  1L0O C;  1BC8 C;  2NS0 A;  3R0J A;  3B02 A;  5D5V B;  3EUH A;  3PQJ A;  1S6L A;  1RNL A;  1TNS A;  1U5T A;  2FQ3 A;  1W7P D;  4WXH A;  2EFN A;  2Y48 A;  4WWC A;  3WGI A;  2RVC A;  4KDP A;  1HW2 A;  2IRF G;  1Z7U A;  2KIM A;  3WG9 A;  5TRD A;  5BPI A;  1WWX A;  1RZ4 A;  1T0F A;  4B09 A;  1LB2 A;  3I53 A;  3TO6 A;  1FT9 A;  4BQA A;  3ZP5 A;  1I1S A;  3E6D A;  3DXJ F;  2OZU A;  1OPC A;  1ZAR A;  4JBA A;  4RAY A;  2O61 A;  1HQC A;  2Z9O A;  1YIO A;  2WTE A;  5H6Q A;  2XV4 S;  4MTD A;  1AWC A;  4U7D A;  3MQ0 A;  3PQK A;  3CDH A;  1K78 A;  1BIA A;  4RGX A;  2CQK A;  1ZG1 A;  4M71 A;  5HS7 A;  3SXY A;  1G3Y A;  1WRJ A;  4LLN A;  2YR2 A;  4KIF A;  3BPX A;  2EV0 A;  2VOD A;  1PP7 U;  3V4G A;  2VBZ A;  3R61 A;  5ICG A;  4HX4 A;  4FT8 A;  3CUQ B;  4IRI A;  1VTN C;  3FXU A;  1W4M A;  1Q1H A;  3LA7 A;  3GFL A;  1J9I A;  5LGN A;  3KLN A;  4LB6 B;  5E1W A;  3J7A O;  1KQ9 A;  2STT A;  4O3M A;  4WX9 A;  4NQW A;  1YQA A;  1XCV A;  2M5W A;  4EJO A;  1TW3 A;  2R7F A;  1BOA A;  3DEU A;  2ZFW A;  4YFN F;  4I0B A;  3LAJ A;  2MD5 A;  4R79 A;  5LGT A;  1PP8 F;  3HRU A;  2XRO A;  2YX4 A;  2UWM A;  3C7J A;  4ZZL A;  3V8L A;  1JHH A;  4GO1 A;  1IXC A;  5AIP A;  1YS7 A;  1ZH5 A;  4ESF A;  3COA C;  1ODD A;  2EFW A;  3L2C A;  5BS6 A;  5JVT A;  2X4H A;  4EGY A;  4ZYH A;  3C18 A;  4A2U A;  3WU0 A;  2F5C A;  3FWE A;  4DNC A;  4KN7 X;  4ENJ A;  3WTW C;  2XVC A;  1SD6 A;  4G7Z F; 
#chains in the Genus database with same CATH topology
 1IZ1 A;  2Y0S N;  2TRT A;  3D1N I;  2E7W A;  2V6C A;  3HZJ A;  3VWB A;  1LKX A;  2O5R A;  3HC7 A;  1MMS A;  3CF5 F;  1WJB A;  2DOF A;  4WK8 F;  2ZJQ F;  2XAG A;  2XF6 A;  3RIR A;  2TCT A;  1FX7 A;  4I7H A;  4MFE A;  5LFA A;  3G1O A;  2LK2 A;  3H5R A;  2JA2 A;  2X1C A;  1WJE A;  2X6W A;  2P7C B;  1W36 C;  2XPV A;  3OMY A;  4XNF A;  2OPT A;  4A6D A;  3OSF A;  3P7N A;  1P4W A;  4XM3 A;  1RKW A;  1K7A A;  2EWN A;  3SZP A;  1LUJ B;  2XRL A;  5HDN A;  3KP3 A;  2KMU A;  1R23 A;  3GTQ J;  4LFU A;  1GHC A;  4BQQ A;  1FOW A;  2UZK A;  2K3F A;  3CLO A;  3OIQ A;  3L9F A;  1E3H A;  5KNL A;  2JWT A;  4J00 A;  2AXT C;  5LEJ A;  2A07 F;  2R7U A;  1KA8 A;  2J5O A;  2VBW A;  3IKV A;  5FKM A;  1XX5 A;  2E35 A;  2GAU A;  1Z91 A;  4A3I J;  2LDU A;  3KIO A;  1MMG A;  2YX7 A;  2HFH A;  4DOZ A;  3FIW A;  1HW1 A;  2JA6 J;  3MKY B;  2WAQ N;  4XON A;  3B6C A;  4IX7 A;  3K1M A;  2FJ1 A;  2JMW A;  2P6S A;  4L9T A;  1TNT A;  4UV8 A;  4D5F A;  1G3W A;  1B59 A;  3WG7 H;  4BAC A;  2E2J J;  3LQQ A;  1AOY A;  4OAY A;  5FKO A;  1P2F A;  3IAS 2;  3D5R C;  3CJN A;  3QRF F;  1BW5 A;  2M4G A;  1Z6R A;  1N75 A;  5IT9 K;  3K69 A;  2VPL A;  2DYS H;  4A3F J;  1X1P A;  4C3J J;  2ZFU A;  4ZYE A;  4BNC A;  4CUG A;  2K9M A;  3FF5 A;  3VB2 A;  2DT5 A;  4CZZ A;  5E3O A;  3HXL A;  4IO9 F;  2DOA A;  3P9I A;  3CCQ I;  3LNQ A;  1V5G A;  2WV0 A;  1TQM A;  3SHF A;  2QM3 A;  1ZTR A;  5M5W J;  1OYY A;  4AVP A;  1AKH B;  5CYV A;  2LYC A;  5A2Q K;  2HQ5 A;  3CO7 C;  1FC3 A;  2CFX A;  3DEW A;  2L3D A;  1B72 B;  1ON2 A;  2KFD A;  3HDD A;  4M6V A;  2XGD A;  2R5Y A;  2DMN A;  2FEZ A;  3QP6 A;  5EG0 A;  1CQT A;  2GXG A;  2LH9 A;  3F8N A;  2IXS A;  1VND A;  2OJE D;  2XAJ A;  4U88 A;  4UUT A;  2Y31 A;  1ULY A;  1UG2 A;  3K4K A;  1I5Z A;  3M1C A;  2DPD A;  2VKV A;  2XAQ A;  2W84 A;  1T8I A;  3BZC A;  2F4M B;  3WE3 A;  1Y39 A;  3ZQG A;  3CZ6 A;  4XKB A;  2WC2 A;  2OAZ A;  3HSR A;  1R58 A;  2FOK A;  1S5L C;  4UVC A;  4MQV A;  3NAU A;  4RGS A;  1FP2 A;  1UJ8 A;  5KK1 A;  3ABM H;  1MBE A;  2GLO A;  2K9Q A;  3LFK A;  4FAS D;  5E79 C;  3L00 A;  1R9T J;  3JR9 A;  2DK8 A;  1SD4 A;  3Q0V A;  3S3N A;  5CVI A;  1Z67 A;  3I54 A;  4IHX A;  4WF2 A;  1FOX A;  3DQV C;  1R36 A;  3D5S C;  2OZ6 A;  1O7L A;  3QOE A;  4RGU A;  5GAE J;  5B1A H;  2EIJ H;  2ESH A;  4LG0 B;  1YG2 A;  4IVN A;  1FYM A;  1YIT I;  4BE2 A;  1MD0 A;  1J75 A;  2ZNY A;  4HBL A;  2V26 A;  4B43 A;  5K7H A;  1D8K A;  4ENM A;  2K3P A;  3RQI A;  3RYP A;  2XF7 A;  4CCM A;  3U2R A;  2R5Z B;  2K9N A;  2W48 A;  3I4P A;  2RV8 A;  1BI1 A;  1XMX A;  2RAE A;  2F4O B;  4RGR A;  3T8T A;  2MW8 A;  2KPM A;  1WHU A;  5J8C A;  3E6M A;  1RKT A;  3I55 I;  4XN0 A;  3J7Y J;  5D5X B;  3E5X A;  4PJL A;  1XGS A;  2LMD A;  1S9H A;  4PZJ A;  1DQU A;  2HQN A;  4LK0 F;  3OYH A;  3GTL J;  1F1Z A;  4D7N A;  1AHD P;  4GDF A;  1IN4 A;  2KT0 A;  2VXD A;  4ZC3 A;  1U9O A;  2F5V A;  2RRE A;  2DQR A;  3I59 B;  3QYB A;  3C2B A;  2M45 A;  3WOD F;  1JKQ C;  1F4K A;  4ON0 A;  5E8I A;  2RN7 A;  1KGS A;  4IRG A;  5HLH A;  5JLW A;  3QPT A;  2FX0 A;  2UUZ A;  1TLH B;  3ZMD A;  2LSO A;  4Y17 A;  4JYK A;  2M8E A;  3FMR A;  3H5A A;  3FXM A;  2JA7 J;  2R4G A;  4M3F A;  1NTC A;  1FZP B;  1JKP C;  2R7X A;  3PUF A;  1WJA A;  2ADU A;  2A05 A;  1I3A A;  1O3S A;  3K1N A;  2GXB A;  2MC3 A;  1DP3 A;  3RKQ A;  3OR2 C;  2IS4 A;  1TBX A;  1U2W A;  4U0W A;  3SJM A;  4A0X A;  2E1M C;  5FGM A;  2ELH A;  2YPR A;  3NQO A;  3S1R J;  4LLG F;  4BXX J;  3HRM A;  4LGW A;  4U0Y A;  2NVU B;  4GXO A;  3WTZ A;  4XOT A;  2AQE A;  5EZG A;  1FBQ A;  1XSX A;  2W85 A;  2CQ7 A;  4KT5 C;  5J3L A;  3SFI A;  3JRD A;  4Y15 A;  4W1U A;  4I98 B;  2ZME A;  2JN6 A;  3GVA A;  1PDN C;  4Q5S F;  4MQ9 F;  1W36 D;  4YG2 F;  2GA2 A;  2X6X A;  3W6J B;  2HKO A;  2BW3 A;  1E2X A;  3I9V 2;  5F0H A;  3QOP A;  3NAR A;  4ZTF A;  5J6X A;  3LSJ A;  1KU7 A;  4JQF A;  3OYC A;  2AQF A;  4BH9 A;  1KYW A;  1YJW I;  2HDC A;  2CUF A;  2STW A;  3OL4 A;  1ETQ A;  2R7S A;  2EZH A;  4BE0 A;  2IGN A;  4MFD A;  3PFY A;  2XAH A;  3REO A;  2ID6 A;  2JSP A;  3H9J A;  5KVR A;  1TZL A;  3PJR A;  4CA0 A;  4NC8 A;  4HX8 A;  4HA8 A;  4FIS A;  2XF5 A;  3VYS B;  3DF8 A;  3BWG A;  2OC6 A;  3CME I;  2F4I A;  1P4A A;  2H8R A;  1T38 A;  1HXD A;  3M4O J;  4C2U A;  3OY9 A;  3IH2 A;  2MFZ A;  3FHN A;  1IN5 A;  2QYO A;  3Q3S A;  2VC0 A;  3WHC A;  4ZZD A;  3ZQI A;  1Z21 A;  3M3Y J;  5IOZ A;  4FE4 A;  3GFJ A;  4A3J J;  3WGG A;  1STZ A;  3L1P A;  1YOV B;  2F6C A;  4Y7N J;  2QQA A;  2L54 A;  4MHG A;  4A0Z A;  1IDY A;  1EV7 A;  3BRO A;  3FXO A;  1W5C C;  1XMA A;  4NB5 A;  2BOL A;  2IS6 A;  4CSW A;  1SVO A;  4V19 K;  1KYZ A;  1ZLK A;  1RES A;  3CP8 A;  4A3K J;  3BTI A;  1Z05 A;  3T8R A;  3IH3 A;  1XN7 A;  1G4D A;  4G6Q A;  1MDM A;  4G8X A;  3T0Y A;  2UV1 A;  2MAB A;  3E7L A;  2V1N A;  2MBF A;  3QOD A;  4D1Q A;  4L9J A;  1IGN A;  1YRN A;  3VYT B;  2H09 A;  3CCU I;  2FRH A;  3CCV I;  1ZLJ A;  3HRT A;  5IYB J;  5FLM J;  1QA6 A;  2Z3Y A;  2OQG A;  2ZSH B;  2A5Y B;  3ZRG A;  2DA5 A;  1IG7 A;  2EIK H;  1B9N A;  1MBF A;  4IRH A;  2LBF B;  1QPI A;  2L9V A;  1YJ9 I;  1N77 A;  1R6R A;  4B48 A;  3Q0U A;  4KMU X;  1WCM J;  1ZAO A;  2HVQ A;  2IA0 A;  3S8P A;  3CCS I;  5E17 F;  2QZ8 A;  5FKN A;  3HOT A;  2HI3 A;  2BEO A;  2HTS A;  3SDG A;  4BJ6 C;  4NHJ A;  1WJF A;  3OV8 A;  4RAF A;  2OD5 A;  2W25 A;  4ZYG A;  2Z5U A;  2XC7 A;  3FIS A;  1DPU A;  3A0B C;  1UEL B;  1Y1V J;  4BHB A;  2VQL A;  3EUA A;  2A6T A;  2QEX I;  3VSL A;  4IOA F;  3S2H J;  3ZCO A;  2XAF A;  3HB9 A;  3WTS C;  4BDZ A;  3GEZ A;  3ZPL A;  1LEA A;  2VXZ A;  4CYC B;  5CVJ A;  1X4P A;  4L9N A;  3DLL F;  3O6B B;  1E17 A;  3TED A;  5FD6 A;  3J7A Y;  1ZKG A;  2OQR A;  1D5Y A;  5DCM A;  4DYC A;  3CQZ J;  2WAD A;  2IVM A;  2KDO A;  3O2P E;  2YSR A;  4BBS J;  1WJC A;  2H94 A;  3JRF A;  1R71 A;  4DW6 A;  2LY9 A;  3BJO A;  3S2D J;  3SFZ A;  1OR7 C;  5E8G A;  2DU9 A;  3IWZ A;  3KCC A;  3R4K A;  1JKO C;  2OTL I;  1KQ8 A;  4XLF A;  1HCR A;  3LFU A;  3QP5 A;  1VQN I;  3L09 A;  3LST A;  2EV6 A;  2Z1D A;  4RDU A;  3HOU J;  2DMQ A;  2VE9 A;  1MNE A;  3CDI A;  3JRH A;  5LD2 C;  2V1D A;  2VBX A;  3DP7 A;  4IQJ A;  4Q47 A;  1QU3 A;  3FZV A;  4P5O A;  1FP1 D;  2QLZ A;  3GBG A;  2WWY A;  1FIA A;  3CCY A;  3VOD A;  3WU1 B;  4AIK A;  2B0L A;  1QO0 D;  2OA4 A;  1TT5 B;  2XAU A;  5CQG A;  1JHF A;  5ILV A;  1Y0N A;  3LAP A;  1EH8 A;  3ZQC A;  2CRG A;  1ZN2 A;  3K4B A;  4ZTJ A;  2KIS A;  1RRJ A;  3B73 A;  1MBK A;  2RKH A;  3BPV A;  3CUQ C;  1YI2 I;  3G3Z A;  1CGP A;  3PO3 J;  3M8F A;  3MEX A;  2DPU A;  3CF2 A;  1XD7 A;  3I0T A;  2OUM A;  3FDY A;  3J81 K;  2HOT A;  4OMZ A;  4CO8 A;  1BC7 C;  2FU4 A;  3TOA A;  2FNP A;  3FKI J;  1R5I D;  2M34 A;  4D9J A;  4F93 B;  1R4N B;  4ESJ A;  1HKQ A;  3I58 A;  2L02 A;  2W24 A;  4RM2 A;  2ZKZ A;  2BVL A;  2VT2 A;  3EYY A;  1I1G A;  2Q0O A;  2XSJ C;  2ELK A;  2CJJ A;  2CS3 A;  3G73 A;  2EQR A;  1U78 A;  2K4J A;  2QBY A;  2G0E A;  2HS5 A;  4GYG A;  4ITV A;  1G3S A;  1ETX A;  2IPQ X;  4KIS A;  1KU9 A;  5EZH A;  2LR8 A;  4E7L A;  4CCN A;  2YU3 A;  1YX5 A;  3GUD A;  3CC7 I;  5E1X A;  3ASO H;  4DYQ A;  4XLC A;  1ETW A;  1IXR C;  5LHH A;  3JRC A;  4JX4 A;  1IXS B;  3VYR B;  4BJ5 C;  1OFC X;  1HW5 A;  4F7Z A;  1JTX A;  2ZSI B;  3C3W A;  2CW8 A;  5CPR B;  2P5L C;  1J59 A;  2ESN A;  2X48 A;  3HPG A;  4KIG A;  4DYR A;  1RI7 A;  2KHM A;  3BR0 A;  1ZR2 A;  5F27 A;  2HYG D;  3PIP F;  3ULQ B;  5LBQ A;  4HF2 A;  1X1C A;  1YW8 A;  3I3L A;  3MFK A;  1HC8 A;  4YEL A;  2LRD A;  3GFM A;  4QSH A;  5L3D A;  1RUN A;  2GXA A;  4CCK A;  3NRV A;  1VQO I;  3LSI A;  1JKR C;  2WAE A;  1ON1 A;  3IV5 A;  1WVR A;  3KEO A;  3LWF A;  5D4S A;  1ZRC A;  4XOR A;  2ZCW A;  3H0G J;  5GAG J;  2DO7 A;  4WXC A;  1E3O C;  3L7W A;  1TT0 A;  1MBH A;  3CJQ B;  2QEN A;  3F0C A;  4HLX A;  4U0V A;  4XLH A;  1W0U A;  1R5G A;  3GXO A;  3KYD B;  2VQG A;  2O03 A;  2HOE A;  5F64 A;  2JVH A;  3WTV C;  1EF4 A;  1W7P A;  4HV5 A;  3OYF A;  2DW4 A;  4KIC A;  4M3G A;  3JAM Z;  1OYI A;  2WV1 A;  2W57 A;  1X1D A;  4NDL A;  3S1N J;  3ZR8 X;  3KZI C;  3LSK A;  4KUM A;  2ZXJ A;  4XLN F;  2EA2 A;  5FFZ A;  2HVR A;  3U1D A;  2K02 A;  4A5M A;  3ERE D;  1MJA A;  4IHV A;  3M07 A;  3G6E I;  1FJL A;  1G3T A;  4ZH4 F;  1U3E M;  1PYV A;  4N0B A;  1ZRE A;  4M74 A;  2A6E F;  2MA3 A;  1F43 A;  1QNT A;  3OOU A;  3WTU C;  3DTI A;  2QF7 A;  3PNV A;  4FCY A;  3BY6 A;  3E6B A;  4P96 A;  1B6A A;  1SAX A;  1K6O A;  2G7U A;  3JRA A;  3OYB A;  4M3E A;  3CJT B;  2B9S A;  2P4W A;  1HKS A;  1XSD A;  4F55 A;  2OF7 A;  3KEQ A;  2CSO A;  3DPL C;  2L7F P;  3C1D A;  4A3B J;  1CF7 A;  3I56 I;  2RNJ A;  4UY8 I;  2VKH A;  3QPH A;  3ABL H;  1D1A A;  3R60 A;  4XLE A;  1LE8 B;  2IBD A;  1H9G A;  3E5Q A;  3PUB A;  1QHG A;  1WQ2 A;  5HDG A;  2LC2 A;  2BY3 A;  1JTY A;  4LJZ F;  4RLF A;  4PK4 A;  5BOX A;  3HUG B;  3IL2 A;  3I4N J;  2DOE A;  1OYW A;  3A03 A;  1WJ5 A;  4LIV A;  2CQN A;  2J5P A;  2GIV A;  2KZG A;  5L3C A;  1ZG5 A;  3ZQQ A;  2A69 F;  3PO2 J;  3T1B A;  1AU7 A;  2M87 A;  2HEO A;  2NVT J;  3OS2 A;  2NXN B;  4MGR A;  2Y0M A;  1A31 A;  1I50 J;  3DCF A;  4I76 A;  1UHS A;  3JAM K;  1JJ6 C;  1FTT A;  4AWX B;  3QU6 A;  1KON A;  3W6K B;  3TP3 A;  2CW0 F;  2EIN H;  4P9U A;  5CLS A;  5EEH A;  1QGP A;  2LF8 A;  3AL0 C;  2IAI A;  2NAZ A;  5HVQ C;  3RKX A;  4L18 B;  4W97 A;  3TBI A;  4XRF A;  2DMU A;  3RTR A;  3T5X A;  1J5Y A;  5DS9 A;  3JCU C;  4UB8 C;  3KZY A;  3RPQ A;  3V8K A;  2LFB A;  2L5Q A;  2XPU A;  5HLG A;  4B4C A;  5D5W B;  4BS9 A;  4M9S A;  4B47 A;  1O7F A;  3VOE A;  3CCJ I;  4DBR A;  4XBF A;  2PJR B;  5K1Y A;  4EM0 B;  4QTR A;  1RR7 A;  4LIU A;  1XG1 A;  2FBH A;  5DM6 F;  1X4O A;  5HDK A;  1N78 A;  2ACJ A;  1KQ0 A;  5D8K B;  3FKJ A;  2BVM A;  4I09 A;  4TV7 A;  3DPT A;  2LF7 A;  4UHT A;  5EDN A;  3HHH A;  3HRS A;  3RCO A;  3UNG C;  2LKX A;  4N4O B;  1BJZ A;  2QUF A;  9ANT A;  3BQZ A;  3M8E A;  2KDZ A;  2AXL A;  2GZW A;  2XKO A;  4MIM A;  2KIF A;  4KN4 X;  2H1L A;  3W2W A;  2LY1 A;  1VFC A;  2VOP A;  1Y0U A;  2HXI A;  2A61 A;  4G6T B;  3KP6 A;  2EFO A;  2FF4 A;  1W1W E;  2P8T A;  1IN8 A;  1JE8 A;  4EJT A;  4AD9 A;  5L3F A;  3WGH A;  2DJN A;  5H6R A;  1R7J A;  5FFX A;  2F48 A;  5GAD J;  1IW7 F;  1BM9 A;  3HL2 A;  3QAH A;  5LGU A;  4KIT B;  4KIB A;  2ZXW H;  1AA7 A;  3VSK A;  5BNG A;  4K2E A;  2BGC A;  3I5U A;  5EJC A;  2PEX A;  3FXQ A;  1P7J A;  2M30 A;  3RPU A;  1M1E B;  1S7E A;  3CCM I;  2XGX A;  3F21 A;  4MLO A;  5DV5 A;  4XIC A;  2NS7 A;  5JR3 A;  3K6G A;  5J4V A;  4P1W A;  2PLY A;  2VJJ A;  1WH5 A;  4UVA A;  3WTX C;  1PJR A;  1MBG A;  3H3V K;  4WCG A;  3FXL A;  3AL0 B;  3CO6 C;  1REP C;  2K85 A;  3G71 I;  2WA0 A;  2CFO A;  1WKM A;  3BJA A;  4XRS G;  3E6C C;  4HW0 A;  4EMS A;  1J7K A;  1VQ7 I;  1P6R A;  1D1C A;  3S3O A;  2QSF X;  3SZG A;  4GCV A;  4IHS A;  3A1Y A;  3GO5 A;  2QQ9 A;  4X0G A;  1IN7 A;  2A6H F;  3LA2 A;  4HOB A;  3V42 A;  4V2G A;  2FSW A;  1HSJ A;  2FXA A;  2GBY A;  4AM3 A;  3KYC B;  2D45 A;  1SEU A;  5IY5 H;  3R0A A;  4I01 A;  2HXO A;  4PFO A;  3ZQF A;  1X1B A;  4R8H A;  1B1B A;  2L0K A;  4A0Y A;  2VC1 A;  1TP4 A;  2JK3 A;  4F3Q A;  4XQF A;  4EEF G;  4UXN A;  3HJE A;  2DN0 A;  1VI0 A;  4HZF A;  3DTK A;  3R6S A;  2JA8 J;  5BQT A;  3BR6 A;  5K5O A;  2OU2 A;  3WE2 A;  2HU9 A;  1ETO A;  4A3C J;  2FOW A;  2GM4 A;  1BI3 A;  1OR7 A;  1QPM A;  1MZB A;  5F6F A;  4IPA A;  3MKZ A;  2BE5 F;  4G7O F;  2XPW A;  4RMN A;  1LDK B;  2JRM A;  3HM5 A;  3TMO A;  2W4S A;  5D6F A;  4DJA A;  4EV0 A;  2Z16 A;  2HVS A;  2L4A A;  3RZO J;  4OIP F;  3VDX A;  4H0E A;  4ZYD A;  4M3B A;  2BHY A;  4D0P A;  1JGG A;  3EDP A;  3GF2 A;  2W82 A;  2Y9Y A;  1YX3 A;  4BAY A;  2H1K A;  4NC6 A;  4HDV A;  4UUS B;  2LNB A;  1ZQ3 P;  3CUQ A;  3E0J B;  4QLC U;  1L3L A;  4B8X A;  1FBS A;  3HOW J;  5CJ9 A;  3EYI A;  4HF1 A;  3U9G A;  1K6Y A;  2HZD A;  1HDP A;  2R0Q C;  2X6O A;  2MGQ A;  4A3L J;  3KE2 A;  4C3H J;  2Z33 A;  2ISZ A;  3KP4 A;  2ZB9 A;  1IV8 A;  2XGE A;  2MH9 A;  2N8G A;  2XHK A;  1YTY A;  2ETH A;  5HLI A;  1VQ4 I;  3CC4 I;  3QU3 A;  2BZT A;  3W6V A;  1O3R A;  1HKT A;  1P4X A;  2PN6 A;  2E5N A;  4C2T A;  3MMY B;  4AUX A;  3BCA A;  3H36 A;  3TO7 A;  4AID A;  5CQE A;  4DGW B;  1DGW Y;  4O6J A;  3RI4 A;  3P9K A;  1SMY F;  2DA4 A;  3ZQH A;  1EKE A;  5AON A;  3BDD A;  5EGO B;  2FNA A;  1XGN A;  3HOY J;  2DXI A;  2Q2E B;  5C3E J;  1BW6 A;  2DFI A;  3RZD J;  1PVE A;  1T33 A;  1WI3 A;  4PUS A;  1WFX A;  3V7S A;  5FD5 A;  2Y9Z A;  3GW2 A;  2EZK A;  2V4J C;  1XB4 A;  1GXP A;  3F9K A;  1D1B A;  2DMP A;  5H2F C;  4IKF A;  4IL6 C;  5TJJ A;  5B3S H;  5DD4 A;  1MKM A;  4BBR J;  3A02 A;  1ZR4 A;  1W5T A;  5B1B H;  2NOJ B;  3S16 J;  4N4N B;  4DQ2 A;  1B8I B;  4XK4 A;  3HPH A;  1OMI A;  4BY7 J;  1H88 C;  3B6A A;  2L9S A;  1J09 A;  1R22 A;  4EJU A;  3CCE I;  6PAX A;  4KMF A;  1ETY A;  1FSH A;  2FML A;  3ONQ A;  1Z3X A;  4HG2 A;  1LVK A;  4HNT A;  4ENK A;  4IQ4 A;  2CG4 A;  3RYR A;  3OYM A;  3E1S A;  1IRZ A;  3BC8 A;  2AO9 A;  2HOA A;  2JSC A;  2EJR A;  1WH7 A;  3HHG A;  2V9P A;  3OYD A;  3ECH A;  4HST A;  1DU0 A;  2CUJ A;  4M72 A;  4XSX F;  3FBN B;  3ZMS A;  3OOP A;  2W1O A;  4EAT A;  3SDB A;  2ID3 A;  2PMU A;  1FYL A;  2EH3 A;  4A3E J;  3BG7 A;  1RR8 C;  4PGH A;  2XIG A;  3SQN A;  1SVL A;  2ELJ A;  2EIM H;  1D0Y A;  4HNV A;  2CUZ A;  3BTC A;  1IUY A;  2WBM A;  1HST A;  5DD8 A;  1UMQ A;  2KRC A;  4J19 A;  2FQ4 A;  4GGG A;  1X3U A;  2VPR A;  2DTZ A;  5D8L B;  4C9Y A;  5F1J A;  2KKO A;  1PUF B;  3PNT A;  3ZMT A;  1K78 B;  3PL8 A;  3PNY A;  1FMW A;  3JSO A;  4IZZ A;  2MG4 A;  2R7R A;  4RAG A;  1SC7 A;  4E4H A;  3L2U A;  2NNN A;  3TL4 X;  3CCR I;  5IT3 A;  4XLA A;  4FQG A;  2IA2 A;  4OOI A;  1Y8Q B;  2HPM A;  2QKL B;  1SD5 A;  1I27 A;  3ROU A;  4BE1 A;  1UG0 A;  3RJP A;  2M7B A;  3OYN A;  4ETS A;  2HTJ A;  2ZJP F;  1LEB A;  3BG3 A;  4P9F A;  2HKX A;  1I39 A;  2FA5 A;  2CQQ A;  4Z6Y A;  3MKW B;  3ZQL A;  5E3N A;  3J7Z I;  4A69 C;  4BDY A;  2B7E A;  2R93 J;  1TL8 A;  3H3Z A;  1ENH A;  2VL8 A;  5HOD A;  2NVQ J;  4GFB A;  5J1R A;  4JK1 X;  2RDP A;  2X1D A;  2EK5 A;  3IKT A;  4AYB A;  3K2A A;  1XDU A;  2EZL A;  3FMQ A;  2DK5 A;  3HGG A;  3K7A J;  3L2V A;  3CC2 I;  2DT7 B;  4RBO A;  4NQW B;  1RPW A;  2QQB A;  4YFX F;  4XID A;  5C4J J;  3K4L A;  2D5V A;  1IDZ A;  2HOS A;  1QZY A;  3FM3 A;  4NBQ A;  1YFH A;  1T98 A;  5J8F A;  1S8N A;  1JT0 A;  4XR6 A;  4OIO F;  2V9V A;  4KT6 A;  4LOC A;  1VQ9 I;  3U21 A;  3VEP A;  4YEJ A;  4LK1 F;  2KL4 A;  3KX2 A;  3ZGK A;  2TDX A;  3N05 A;  3H3U A;  1QBJ A;  3I4M J;  2DBB A;  4BL0 B;  2F5E A;  1AKH A;  4ZDL A;  5J1U A;  1YLF A;  1U8R A;  5FLV A;  1JXS A;  5CVR A;  3QYE A;  3FHZ A;  2F2E A;  1KU3 A;  1XCB A;  3W2V A;  5BMZ A;  2X1E A;  2BY2 A;  4UVB A;  1B72 A;  4XSZ F;  4AU7 A;  4CGZ A;  4UNO A;  3TOB A;  1UHM A;  2KZV A;  5IP6 A;  2JPB A;  1O3T A;  2F5D A;  1P7I A;  3CD6 I;  1R1V A;  5KCM A;  3E5U A;  4G12 A;  5ILU A;  4BXU A;  4M9X A;  5DUK A;  3RSN A;  4QWQ A;  1FSE A;  1P92 A;  3H35 A;  4GRI A;  4OIN F;  5D4R A;  2R7W A;  1K4S A;  1Z77 A;  1Q1V A;  3OWT A;  4RB3 C;  1LNW A;  4OU0 A;  2RNG A;  5GTI C;  3AAF A;  2AHQ A;  3V7C A;  2IW5 A;  3H9G A;  5HOO A;  1UFM A;  4HDU A;  1HF0 A;  5M5Y J;  3S1Q J;  1YYV A;  2H6B A;  3P5J A;  4QIW N;  4FX4 A;  1XMK A;  1IRF A;  1TC3 C;  3LSP A;  4EGZ A;  3IUO A;  4IJA A;  3WTY C;  4O5V A;  2I8D A;  1GLN A;  2K5C A;  4AYB N;  4HQE A;  1ETV A;  5D6E A;  1MSF C;  1SVM A;  2XSD C;  2PMZ N;  1A04 A;  3JRE A;  2PMH A;  1O57 A;  1UHW A;  1BR4 A;  4Q48 A;  2HPI A;  3DBR B;  4HEA 2;  4LG0 A;  1N25 A;  5K5Q A;  2C6Y A;  5F0C A;  2RGV A;  2EZI A;  4LLL A;  1OLT A;  2PFB A;  1U0J A;  5L3B A;  1MMN A;  2FBI A;  3TQN A;  5FLX Z;  1VQ6 I;  2O3F A;  4FE7 A;  2R5Z A;  1V3F A;  5E18 F;  1H0M A;  2K27 A;  1R5H A;  2A5W A;  3S32 A;  3BR3 A;  3CMA I;  3JSP A;  2A68 F;  2PBI A;  4IXA A;  1MH4 A;  2BXZ A;  2EB7 A;  5EGO A;  4DIQ A;  4CHU A;  3WHB A;  3MD2 A;  3GZ6 A;  3S93 A;  4BY1 J;  1X2M A;  4X1E A;  2Y30 A;  3IAM 2;  2EIL H;  3KP7 A;  3ZN0 A;  3JTG A;  2DLL A;  2M3A A;  2Z99 A;  1S72 I;  4CZC A;  3S17 J;  3ZMZ A;  5FO5 A;  4HV6 A;  5K7F A;  5FB2 A;  1LFP A;  3K4M A;  2ZJ2 A;  3I59 A;  2DAO A;  2HWV A;  3DV8 A;  4IEJ A;  5M3M J;  4A3G J;  2FBK A;  2ISY A;  2L9R A;  3HBL A;  3BOQ A;  4HX7 A;  3AKZ A;  1Z1D A;  1I3Q J;  3OYA A;  1SFU A;  2DT6 A;  5CKT A;  5HLT A;  1FTZ A;  3QYF A;  2IJL A;  3VYU B;  5JFR A;  2XUB A;  3QWL A;  4II2 A;  5F1R A;  4YIR X;  3ML6 A;  3HGY A;  1FNN A;  5KHD A;  1FPQ A;  3SYT A;  1QHH D;  3JRI A;  3CMY A;  3GTG J;  3PSF A;  4B44 A;  5IP7 J;  2DOD A;  2QKM B;  3VPR A;  3HOV J;  1Z3Y A;  2JA5 J;  4HAM A;  1IF1 A;  2LKP A;  3J80 Z;  4BQO A;  4CXF A;  5FLX K;  5LHG A;  2CGP A;  2BYV E;  3BQY A;  5IPA A;  3N4M A;  5LRS A;  1UB9 A;  3JRB A;  1MBJ A;  2CW7 A;  4KA4 A;  5DYM A;  2P5K A;  2X51 A;  1G6N A;  1LPQ A;  1XC5 A;  5C44 J;  2H8W A;  4IOC F;  2HQA A;  3ZMU A;  3K2Z A;  4G9Y A;  4PGG A;  1ZYR F;  1F36 A;  2MSY A;  1Z0X A;  4CIC A;  2R5Y B;  1APL C;  1VQ8 I;  3Q9S A;  5EG0 B;  1TWF J;  2K7L A;  2R7D A;  2JPC A;  3ZXS A;  3V7R A;  2M8G X;  2WY8 Q;  1G8X A;  2P7V B;  5DTD A;  4EM2 A;  4E6K G;  1ZRF A;  2XAS A;  3FMS A;  3K10 A;  1IV6 A;  3S1M J;  3GCM A;  3E97 A;  1DUX C;  3FXJ A;  1BR1 A;  3K9T A;  3F8F A;  3H9Q A;  2O7O A;  3LQR A;  1RET A;  3MKL A;  1NK3 P;  1GV2 A;  5B5E C;  2PI0 A;  1D0Z A;  1HA8 A;  3PSI A;  1A5J A;  1BOB A;  2RQP A;  1YHQ I;  2DTR A;  2V6E A;  3I71 A;  2IA1 A;  2JZY A;  2JJ7 A;  2IEK A;  2M1B A;  1MJ9 A;  2DFF A;  4M3D A;  1EH7 A;  2K40 A;  1R1T A;  5FRN A;  4KNY A;  1VF9 A;  4A6E A;  3F23 A;  1QVT A;  2EPF A;  1DDN A;  1U9N A;  3J80 K;  1MH3 A;  2ECC A;  1TTY A;  1V4R A;  2ZNZ A;  3QPS A;  1UST A;  3HG9 A;  4ENN A;  1LDD A;  3BTL A;  3M9A A;  1SFX A;  5J40 A;  4A12 A;  1S7A A;  2EBI A;  2L4M A;  2ZME C;  1ZGW A;  2JT1 A;  3D0S A;  3F8B A;  3L2W A;  1D8J A;  2L7Z A;  3DWL E;  4JX5 A;  2K4B A;  1ZK8 A;  1OQY A;  3G4S I;  4KJZ A;  2EA4 A;  4ASN A;  4E70 A;  2CYY A;  2VT3 A;  5GP9 A;  1S7O A;  3W2A A;  3DFG A;  1OCP A;  3IWF A;  3O8H A;  4BKX A;  1X1A A;  1MMD A;  3E3V A;  1V5E A;  2CWE A;  4B1R A;  4FTH A;  2GWR A;  2M0M A;  2QWW A;  3IRR A;  2XKP A;  2H6C A;  4EJV A;  1IC8 A;  1V55 H;  5EYR A;  2DJI A;  4BHC A;  5DUI A;  2LBF A;  1R1U A;  4XKW A;  5FKK A;  4FET A;  4HYE A;  1YW9 A;  2O9L A;  1Y56 A;  4U7B A;  3EET A;  1A35 A;  1XPX A;  2E19 A;  3LSM A;  4RAZ A;  2JUC A;  2D1V A;  3F6O A;  2HYJ A;  1RIO H;  1P9Q C;  3KLO A;  3AFH A;  5EF6 A;  1TQP A;  4UB6 C;  3MZH A;  1YS6 A;  2Z2S B;  4ANJ A;  3RKW A;  1PUE E;  3IHU A;  3KFW X;  2XDV A;  2ZBK A;  2HNH A;  1MSE C;  1VQM I;  3KET A;  1UAA A;  1POG A;  4LMY A;  5K5R A;  2OCC H;  2MH2 A;  4AC0 A;  3K4N A;  2ZXI A;  1B9M A;  1FBU A;  2DDA A;  3K0L A;  1B4A A;  1D0X A;  3IH4 A;  5GTH C;  2O8X A;  4BEH B;  3SEZ A;  4CYC A;  5DDG A;  3KP5 A;  2PJP A;  2CV0 A;  1EH6 A;  4MNU A;  3TGN A;  4X6A J;  4CCO A;  2DQL A;  3CUO A;  1K4T A;  2E2I J;  2JUG A;  2K9L A;  4RA2 A;  4FHT A;  2ZME B;  5DCF A;  1QZZ A;  2A3S A;  4MEX F;  2VN2 A;  4E7K A;  2BW3 B;  2KJC A;  1DGR M;  1Z7L A;  3KEY A;  5IT9 Z;  4AIJ A;  3OS1 A;  1T39 A;  2JRT A;  2LVS A;  2E1C A;  1ERD A;  3OR1 C;  3CP2 A;  3M8J A;  3ELK A;  4RB2 C;  5TGT A;  2M2E A;  4M73 A;  3S3M A;  2E1O A;  1FEX A;  4DBQ A;  2CU7 A;  3O8G A;  2ME6 A;  2R92 J;  2LLK A;  3FM5 A;  1OCR H;  1MJB A;  5A2Q Z;  2NYX A;  4RLQ A;  3BR5 A;  3Q0W A;  3HTU A;  1J0R A;  2QCO A;  2IT0 A;  3DKW A;  1FOK A;  4AIH A;  4F92 B;  2RQQ A;  4UUV A;  1XGO A;  5M5X J;  3ZN1 A;  2HYF A;  3K70 D;  4AVZ A;  2DI3 A;  5C4X J;  4R1H A;  5B66 C;  1BI2 A;  2X9D A;  5IOY A;  1Z6T A;  1JGS A;  4C3I J;  4IHY A;  3TP0 A;  1Z9C A;  5M3F J;  3ABK H;  1ZRD A;  2QVO A;  2GIZ A;  3U1K A;  4IHT A;  1O4X A;  2XRN A;  2VKE A;  3ZMV A;  2P5V A;  3HSE A;  4XOP A;  2ZO4 A;  1UCR A;  2HR3 A;  1SFK A;  4G7H F;  3M1E A;  1ONV A;  2D1H A;  4YIF A;  3IC7 A;  1D5V A;  3BG6 A;  5ERI A;  4A5N A;  3FK6 A;  1UZC A;  2MD0 A;  2EFP A;  2V7F A;  3FXK A;  2FE3 A;  1TWG J;  1IN6 A;  5FKL A;  2WAF A;  5E1Z B;  3S15 J;  1TQI A;  1S3J A;  1TW2 A;  1JI8 A;  1MDM B;  3A01 B;  4C30 A;  1GT0 C;  2LD5 A;  2KIQ A;  4YFK F;  5IYD J;  1MGT A;  4S04 A;  4PCQ A;  3PFI A;  3PM1 A;  2VQH A;  1YRN B;  3HYI A;  3GLL A;  3GTM J;  4LG3 A;  3CMM A;  2DA1 A;  1T08 B;  4QPO A;  3QPL A;  1XDS A;  4JX6 A;  1YW7 A;  1E0E A;  3EUH C;  3TDZ C;  1IUF A;  2E34 A;  2BBY A;  1LFU P;  3GWZ A;  1MIJ A;  2HQR A;  5H20 A;  3RKY A;  4E7J A;  1NK2 P;  1TWH J;  1GVJ A;  1MND A;  4G6D A;  4PFP A;  3UKG A;  4Y33 A;  1U5T C;  1HOM A;  2OTJ I;  3K4J A;  3H92 A;  4DZP A;  3P9C A;  3GYH X;  1F5T A;  2JTV A;  2VLA A;  3FBI B;  4KFC A;  4LB5 A;  2E5Z A;  2AS5 F;  2RC4 A;  2IGK A;  3JW4 A;  2FMY A;  3S14 J;  1H9T A;  3LSG A;  4WXD A;  3ABU A;  2QA4 I;  3MZY A;  2O8K A;  2OCE A;  5LHI A;  1X3W B;  1T0F C;  3HIF A;  1WZ2 A;  1HBX G;  2ECB A;  3Q9V A;  1VQL I;  2K86 A;  3TO9 A;  1ACI A;  3RQ4 A;  3I64 A;  2VUM J;  3BG9 A;  4M9Z A;  3ERM A;  2V79 A;  3UR3 C;  4S05 A;  2CMP A;  4U87 A;  3CJR B;  2ZJR F;  2G9W A;  3SZT A;  2M4K A;  4CCL A;  4E7I A;  4Y52 J;  2Q8K A;  1WGX A;  3SEQ A;  1F9N A;  3MCZ A;  5DCM B;  1XTA A;  2ICW G;  2MLK A;  2O0Y A;  5E20 A;  5IP9 J;  4HSR A;  2VJI A;  3TKY A;  3LA3 A;  3MAJ A;  4XRS A;  1KU2 A;  3F8M A;  2D2W A;  4HRI A;  2GA1 A;  3D5L A;  4ZJZ A;  4HQM A;  4L0Y B;  3FK7 A;  4II3 A;  4P55 A;  1E3P A;  2M9H A;  2VE8 A;  1O3Q A;  2H27 A;  2L7M P;  3C2H A;  1EA3 A;  3OIO A;  2Y75 A;  2QSG X;  2HZT A;  1U6G A;  1DPR A;  2E1N A;  1D3Y A;  3FX3 A;  3IP4 B;  2NRA C;  4I02 A;  5LEK A;  5L3G A;  4ZDO A;  4YII A;  3GTP J;  3F8C A;  4BUP A;  3F3X A;  1U5T B;  5GAH J;  5J47 A;  1FLI A;  3F6V A;  1IAW A;  1IRG A;  3EUK L;  2OBP A;  1LE8 A;  4HLY A;  2L2O A;  2ZXH A;  2LRE A;  3A2K A;  1BA5 A;  2VKD A;  3CES A;  5FRO A;  4L5I A;  4Y13 A;  3HUG A;  1G59 A;  2KIU A;  3HKZ A;  3GLX A;  5EEA A;  1SAU A;  2LKS A;  4EM1 A;  3EQL F;  3GFI A;  3BTJ A;  4BQN A;  3K4C A;  1T56 A;  1YO5 C;  1BI0 A;  4LD5 A;  4OIQ F;  2JVG A;  2G7H A;  2DA3 A;  5CVU A;  4PSX A;  1FY7 A;  2QBY B;  1ZGA A;  5HS9 A;  3MZ8 A;  4CDG A;  3GTJ J;  1EJ9 A;  4KYW A;  1HDD C;  1V5F A;  3ASN H;  2COM A;  5D5U B;  3AG1 H;  4BHP A;  1QQI A;  1U8B A;  2IS1 A;  3LL7 A;  4A93 J;  4RS8 A;  2NNY A;  4BGD A;  1NG6 A;  3TW6 A;  3ABT A;  4Z2Y A;  2VAS A;  1SD7 A;  4L9V A;  4S0H B;  5K7Z A;  3KP2 A;  3G1L A;  2YU9 J;  3ECO A;  1SFE A;  1BIB A;  2GQQ A;  3ZOB A;  2YUS A;  2UXN A;  2LP0 A;  4I6Z A;  3CCL I;  2R7Z J;  5F08 A;  1ZHF A;  2PJR A;  2KJB A;  3BP8 A;  2BV6 A;  1JT6 A;  1BR2 A;  2EFQ A;  2GOX B;  4BEH A;  4ESB A;  2PQ8 A;  1DP7 P;  3F72 A;  1I6X A;  3CDL A;  2EV5 A;  1ZG3 A;  5DEQ A;  5EEG A;  1JUS A;  1SMT A;  3DTE A;  3X2Q H;  1H8A C;  2VOO A;  5L3E A;  2IP2 A;  4B3A A;  3CTA A;  5BPD A;  4ZYA A;  4YRV A;  4I0A A;  2W7N A;  5F04 A;  2E71 A;  4XMY A;  4QPQ A;  1A6I A;  5JVG F;  3GTO J;  1R00 A;  1VZ0 A;  2FUG 2;  2MC4 A;  3ESW B;  1A6Q A;  1RUO A;  2DA6 A;  3L2R A;  5TIS C;  2VJ5 A;  4N9H A;  4IF4 A;  1IO2 A;  1OCT C;  1GXQ A;  3DEE A;  4MEY F;  2JQ7 A;  5FJ8 J;  1ORK A;  2KLO A;  1IJW C;  2VIX A;  3BJ6 A;  3HKZ N;  2DFE A;  4PDK A;  2L01 A;  3HEF A;  1BJA A;  4H4K C;  2IGO A;  2CQX A;  3C2G A;  1LDJ A;  3KYL A;  3TDU C;  1W7P B;  3S2W A;  1QVU A;  4E7Z A;  4N9I A;  4OIR F;  4EQQ A;  3BT9 A;  3OL3 A;  3N97 A;  2WB1 A;  4Y4R A;  3DPU A;  1MW7 A;  2PMZ A;  1BN5 A;  2L9N A;  2Q1Z B;  5ICC A;  4BXF A;  3VFZ A;  1ZGJ A;  4FX0 A;  4F52 A;  4HF0 A;  3DU5 A;  4OMY A;  1G2H A;  2BXY A;  1WSU A;  4CYD A;  2NS8 A;  3HOS A;  2BY1 A;  1GVD A;  4MO7 A;  1Y6I A;  2E7X A;  4L5J A;  2XB5 A;  4XLP F;  4ZDP A;  2NVX J;  3V8J A;  3ZQ7 A;  4BJT A;  1KZH A;  1FWZ A;  5LRR A;  1OCZ H;  3F22 A;  1FYK A;  2P6T A;  5ICF A;  4Q4Z F;  4A3M J;  4GYI A;  1ZEL A;  2E1M B;  5E3M A;  4XKC A;  5E3L A;  5LLQ A;  4RB1 A;  3QQA A;  3OYJ A;  2XB0 X;  5HNH A;  4BU2 A;  1X2N A;  2COB A;  3A01 A;  1NHA A;  5J1Y A;  2VI6 A;  2BHZ A;  1CF7 B;  3HOZ J;  5JLX A;  2QGU A;  4XRM A;  1W5S A;  1LJ9 A;  4IHW A;  3H0D A;  4UV9 A;  1JUM A;  1QRY A;  3FXR A;  4V2F A;  3HTS B;  1XSV A;  5F0F A;  3LSR A;  2CV1 A;  1T2K A;  4BYY A;  2R3S A;  2DFH A;  2E60 A;  1R49 A;  3LSH A;  1J2X A;  1LFB A;  2QQ8 A;  1X19 A;  2O6G E;  3JTH A;  4XKV A;  1GUU A;  1FMV A;  4I2O A;  2X0L A;  1T95 A;  2NVY J;  2ME0 A;  5CVV A;  2PG4 A;  3KZZ A;  2YS9 A;  1K79 A;  3H5N A;  1OKR A;  2VON A;  2V1X A;  5GPA A;  1HLV A;  4OAZ A;  5ICE A;  3AG3 H;  2DDB A;  3IRQ A;  4EVI A;  2IGM A;  2W00 A;  3MWM A;  3WTT C;  3GZ5 A;  1JUP A;  2VQC A;  4RB0 A;  3Q5F A;  3NWS A;  4J01 A;  4UUS A;  3A0H C;  2WB1 N;  3BZ6 A;  1TWC J;  3NEU A;  4L0Z B;  3J81 Z;  1QZE A;  2OV7 A;  2KRF A;  2X6Y A;  3OSG A;  3RDI A;  1H89 C;  2F5F A;  5JI6 A;  3O3K A;  4M6X A;  1LQ1 A;  4M6Y A;  5ILS A;  3BZK A;  2V1U A;  2M7A A;  2R7V A;  3OYI A;  1XGM A;  3GX4 X;  1A36 A;  2L7K A;  2NOG A;  3W3C A;  4EJW A;  3K1P A;  1I6H J;  1WI9 A;  2LOO A;  2I5U A;  4XL9 A;  2VBY A;  3ISP A;  2UXX A;  3JRG A;  3TW7 A;  3OIP A;  5ED4 A;  2MLG A;  3HSF A;  2HGC A;  4NUB A;  4G94 A;  2E2H J;  3BR1 A;  5HS8 A;  1LVA A;  1VQK I;  2Q2E A;  5GPC A;  5JHU A;  1S29 A;  3M7G A;  4E7H A;  1BBY A;  1T6S A;  2CO5 A;  3OS0 A;  2I10 A;  4MTE A;  1C0W A;  4PJ0 C;  1USS A;  3OYG A;  4PJJ A;  5AIQ A;  2LTP A;  1L0O C;  1BC8 C;  2NS0 A;  3R0J A;  3B02 A;  2LY2 A;  4RM3 A;  5D5V B;  2MYS A;  3K70 C;  3EUH A;  4I99 C;  3PQJ A;  4F91 B;  4HNU A;  1S6L A;  1RNL A;  1B8I A;  1YJN I;  2K9S A;  1TNS A;  1U5T A;  2FQ3 A;  1W7P D;  3AG4 H;  4WXH A;  2EFN A;  2Y48 A;  3DKX A;  4WWC A;  3WGI A;  1ETK A;  2DA2 A;  2RVC A;  4NNJ A;  1Y8R B;  1TWA J;  4KDP A;  1HW2 A;  2IRF G;  1Z7U A;  3DLA A;  2KIM A;  2R7T A;  3WG9 A;  1SFO J;  5TRD A;  1OIS A;  1W0T A;  5BPI A;  2X85 A;  1WWX A;  5JHF A;  1RZ4 A;  3OYK A;  1DU6 A;  1T0F A;  4B09 A;  1LB2 A;  3DKY A;  3I53 A;  3OYL A;  3TO6 A;  3WU2 C;  2DMT A;  1FT9 A;  3G2B A;  4BQA A;  3ZP5 A;  1I1S A;  3E6D A;  2KRH A;  3DXJ F;  2OZU A;  1OPC A;  2B63 J;  1ZAR A;  4JBA A;  4RAY A;  1R4M B;  3DU6 A;  1HQC A;  2Z9O A;  2O61 A;  1YIO A;  3G1M A;  2KP6 A;  2VJ4 A;  2WTE A;  5H6Q A;  2XV4 S;  1VQ5 I;  3AG2 H;  4MTD A;  3HOX J;  1AWC A;  4CCJ A;  4U7D A;  5KAF C;  4Y3O A;  2IS2 A;  3MQ0 A;  2PX9 A;  1X58 A;  2HDW A;  3PQK A;  1PUF A;  3CDH A;  1K78 A;  1BIA A;  4RGX A;  2XGC A;  3NWT A;  1GDT A;  2CQK A;  1ZG1 A;  4M71 A;  1VQP I;  5HS7 A;  3SXY A;  1G3Y A;  1WRJ A;  4LLN A;  2YR2 A;  4KIF A;  2CH0 A;  3BPX A;  2EV0 A;  2VOD A;  4CH7 A;  4ABZ A;  3MN2 A;  3V4G A;  1YE9 A;  1OJL A;  4XN3 A;  1PP7 U;  2VBZ A;  2CUE A;  3BLY A;  3KPH A;  3R61 A;  5ICG A;  5J4Y A;  4D7M A;  1Y1W J;  1X3Z B;  2E36 A;  2KQR A;  4PSW A;  1ITY A;  4HX4 A;  4FT8 A;  2DYR H;  3CUQ B;  1FIP A;  1NG7 A;  2FD5 A;  3PIO F;  3L2Q A;  3DBL B;  3BR2 A;  4IRI A;  1VTN C;  1GV5 A;  2LG4 A;  2QSH X;  1SAN A;  3FXU A;  2P81 A;  2DCE A;  2R7O A;  3GME A;  1OCC H;  1W4M A;  1MMA A;  2CV2 A;  2BY0 A;  4NC7 A;  1Q1H A;  3LA7 A;  2HDD A;  3GFL A;  1J9I A;  1RC9 A;  5LGN A;  3KLN A;  4LB6 B;  3OYE A;  5E1W A;  3J7A O;  1IRX A;  1KQ9 A;  1WPK A;  2STT A;  5KAI C;  2Y0S A;  2P0W A;  4O3M A;  4WX9 A;  4NQW A;  1YQA A;  1XCV A;  2Y2Z A;  2V9K A;  4A3D J;  4OWR B;  2M5W A;  1YIJ I;  3MVP A;  3H1C A;  1OCO H;  4EJO A;  3EPZ A;  1TW3 A;  2R7F A;  1K61 A;  2WY7 Q;  1JJ8 C;  3BG5 A;  1BOA A;  3DEU A;  2ZFW A;  1FOY A;  4PJN A;  4YFN F;  4I0B A;  4PJM A;  3LAJ A;  2MD5 A;  4R79 A;  5LGT A;  1PP8 F;  3HRU A;  2XRO A;  1BL0 A;  2YX4 A;  4LIT A;  4HPQ A;  2UWM A;  3C7J A;  2DA7 A;  4ZZL A;  3V8L A;  1JHH A;  2R7Q A;  3A4C A;  4GO1 A;  4B3X A;  1IXC A;  4DZJ A;  5AIP A;  1YS7 A;  3RPU D;  2ZC2 A;  3GTK J;  1ZH5 A;  3DBH B;  4D5C A;  4ESF A;  1XS9 A;  3COA C;  1ODD A;  1NH3 A;  2EFW A;  4JP0 A;  5DM7 F;  5HNF A;  3CLQ A;  5FRM A;  2VB6 A;  4C2M J;  1MNM C;  1K83 J;  3L2C A;  5BS6 A;  3LOC A;  5JVT A;  4L5E A;  2X4H A;  2M0C A;  4EGY A;  4ZYH A;  3C18 A;  2WAQ A;  4A2U A;  3BCB A;  3WU0 A;  2F5C A;  3FWE A;  4DNC A;  2Y69 H;  2GOM A;  3GZN B;  4KN7 X;  1WJD A;  5IYC J;  4ENJ A;  4E7S A;  3WTW C;  2XVC A;  4JOM A;  3LMM A;  1V54 H;  1SD6 A;  4G7Z F; 
#chains in the Genus database with same CATH homology
 1IZ1 A;  2E7W A;  2V6C A;  4WK8 F;  2XAG A;  3RIR A;  1FX7 A;  4I7H A;  2P7C B;  4A6D A;  3P7N A;  1P4W A;  1K7A A;  2EWN A;  3SZP A;  5HDN A;  3KP3 A;  1R23 A;  4LFU A;  1GHC A;  2UZK A;  3CLO A;  3L9F A;  5LEJ A;  2A07 F;  1KA8 A;  2J5O A;  2VBW A;  3IKV A;  2GAU A;  1Z91 A;  2LDU A;  2YX7 A;  2HFH A;  1HW1 A;  3K1M A;  4L9T A;  2P6S A;  1TNT A;  4UV8 A;  1G3W A;  1B59 A;  1AOY A;  3LQQ A;  1P2F A;  3CJN A;  3QRF F;  1Z6R A;  5IT9 K;  3K69 A;  4ZYE A;  4BNC A;  3FF5 A;  3VB2 A;  2DT5 A;  4CZZ A;  3P9I A;  2WV0 A;  1TQM A;  3SHF A;  2QM3 A;  1OYY A;  4AVP A;  5CYV A;  5A2Q K;  3CO7 C;  1FC3 A;  2CFX A;  2L3D A;  1ON2 A;  2FEZ A;  3QP6 A;  2GXG A;  3F8N A;  2XAJ A;  4U88 A;  1ULY A;  1I5Z A;  2DPD A;  2XAQ A;  2W84 A;  3WE3 A;  2WC2 A;  2OAZ A;  3HSR A;  1R58 A;  2FOK A;  4UVC A;  4MQV A;  4RGS A;  1FP2 A;  5KK1 A;  3LFK A;  3L00 A;  2DK8 A;  1SD4 A;  5CVI A;  3I54 A;  4WF2 A;  3DQV C;  1R36 A;  2OZ6 A;  1O7L A;  4RGU A;  4LG0 B;  2ESH A;  1YG2 A;  4IVN A;  1FYM A;  1MD0 A;  1J75 A;  2ZNY A;  4HBL A;  1D8K A;  4ENM A;  3RYP A;  3U2R A;  3I4P A;  2RV8 A;  1BI1 A;  4RGR A;  3T8T A;  5J8C A;  3E6M A;  5D5X B;  3E5X A;  1XGS A;  4PZJ A;  2HQN A;  4LK0 F;  1F1Z A;  1IN4 A;  3I59 B;  2DQR A;  2M45 A;  3WOD F;  1F4K A;  4ON0 A;  5E8I A;  2RN7 A;  1KGS A;  4IRG A;  5HLH A;  3QPT A;  1TLH B;  3ZMD A;  2LSO A;  4Y17 A;  2M8E A;  3FMR A;  1FZP B;  2ADU A;  1O3S A;  3K1N A;  2GXB A;  2MC3 A;  1TBX A;  1U2W A;  4U0W A;  4A0X A;  5FGM A;  2ELH A;  2YPR A;  3NQO A;  4LLG F;  3HRM A;  4LGW A;  4U0Y A;  4GXO A;  3WTZ A;  1FBQ A;  1XSX A;  2W85 A;  4KT5 C;  4Y15 A;  4I98 B;  2ZME A;  1PDN C;  3GVA A;  4Q5S F;  4MQ9 F;  4YG2 F;  2GA2 A;  3W6J B;  2HKO A;  1E2X A;  3QOP A;  5J6X A;  1KU7 A;  4JQF A;  4BH9 A;  1KYW A;  2HDC A;  2STW A;  2XAH A;  3REO A;  5KVR A;  4HX8 A;  4HA8 A;  3DF8 A;  3BWG A;  1P4A A;  1T38 A;  1HXD A;  1IN5 A;  2QYO A;  2VC0 A;  4ZZD A;  3GFJ A;  3WGG A;  1STZ A;  2QQA A;  2L54 A;  4MHG A;  4A0Z A;  1EV7 A;  3BRO A;  1XMA A;  4NB5 A;  1KYZ A;  1ZLK A;  1Z05 A;  3T8R A;  1G4D A;  1XN7 A;  4G6Q A;  1MDM A;  4G8X A;  3T0Y A;  2MBF A;  4L9J A;  2H09 A;  2FRH A;  1ZLJ A;  3HRT A;  2Z3Y A;  2OQG A;  2A5Y B;  1B9N A;  4IRH A;  4KMU X;  1ZAO A;  2IA0 A;  5E17 F;  2QZ8 A;  3HOT A;  2BEO A;  2HTS A;  4NHJ A;  3OV8 A;  2OD5 A;  2W25 A;  4ZYG A;  2Z5U A;  1DPU A;  4BHB A;  2XAF A;  3WTS C;  3GEZ A;  3ZPL A;  1LEA A;  2VXZ A;  5CVJ A;  4L9N A;  3O6B B;  1E17 A;  5FD6 A;  2OQR A;  5DCM A;  3O2P E;  2IVM A;  2YSR A;  2H94 A;  3BJO A;  3SFZ A;  5E8G A;  2DU9 A;  3IWZ A;  3KCC A;  3R4K A;  1KQ8 A;  3QP5 A;  3L09 A;  3LST A;  2EV6 A;  2VE9 A;  2V1D A;  2VBX A;  3DP7 A;  4Q47 A;  3FZV A;  4P5O A;  1FP1 D;  2QLZ A;  2WWY A;  4AIK A;  3VOD A;  3WU1 B;  2B0L A;  1QO0 D;  2OA4 A;  5ILV A;  3LAP A;  1JHF A;  1EH8 A;  1ZN2 A;  3B73 A;  2RKH A;  3BPV A;  3CUQ C;  1CGP A;  3G3Z A;  3M8F A;  3MEX A;  2DPU A;  1XD7 A;  3I0T A;  3J81 K;  4OMZ A;  4CO8 A;  1BC7 C;  2FU4 A;  3TOA A;  2FNP A;  4ESJ A;  1HKQ A;  3I58 A;  2L02 A;  2W24 A;  2ZKZ A;  2VT2 A;  3EYY A;  1I1G A;  2Q0O A;  3G73 A;  1U78 A;  2K4J A;  2QBY A;  2HS5 A;  4GYG A;  1G3S A;  2IPQ X;  1KU9 A;  2YU3 A;  3GUD A;  5E1X A;  1IXR C;  5LHH A;  1IXS B;  1HW5 A;  4F7Z A;  3C3W A;  2P5L C;  1J59 A;  2ESN A;  4KIG A;  1RI7 A;  2HYG D;  3ULQ B;  5LBQ A;  4HF2 A;  1YW8 A;  3MFK A;  3GFM A;  5L3D A;  1RUN A;  3NRV A;  1ON1 A;  3KEO A;  3LWF A;  5D4S A;  1ZRC A;  2ZCW A;  2DO7 A;  4WXC A;  3L7W A;  4U0V A;  2QEN A;  4HLX A;  1R5G A;  3GXO A;  2O03 A;  2HOE A;  5F64 A;  3WTV C;  1W7P A;  4HV5 A;  2DW4 A;  4KIC A;  3JAM Z;  1OYI A;  2W57 A;  4KUM A;  4XLN F;  2ZXJ A;  2EA2 A;  5FFZ A;  3U1D A;  2K02 A;  4A5M A;  3ERE D;  1MJA A;  1G3T A;  4ZH4 F;  1U3E M;  4N0B A;  1ZRE A;  4M74 A;  2A6E F;  2MA3 A;  1QNT A;  3WTU C;  3BY6 A;  3E6B A;  4P96 A;  1B6A A;  1SAX A;  1K6O A;  2G7U A;  2P4W A;  1HKS A;  1XSD A;  3KEQ A;  2CSO A;  3DPL C;  3C1D A;  1CF7 A;  2RNJ A;  3QPH A;  3R60 A;  1H9G A;  3E5Q A;  1WQ2 A;  5HDG A;  4LJZ F;  5BOX A;  3IL2 A;  1OYW A;  2J5P A;  2GIV A;  5L3C A;  1ZG5 A;  2A69 F;  3T1B A;  2M87 A;  2HEO A;  4MGR A;  2Y0M A;  3JAM K;  4AWX B;  3QU6 A;  3W6K B;  4P9U A;  2CW0 F;  5CLS A;  5EEH A;  1QGP A;  2LF8 A;  2NAZ A;  5HVQ C;  3RKX A;  4L18 B;  4XRF A;  3RTR A;  3T5X A;  1J5Y A;  3KZY A;  3RPQ A;  3V8K A;  5HLG A;  5D5W B;  4M9S A;  1O7F A;  3VOE A;  4XBF A;  5K1Y A;  4EM0 B;  2FBH A;  5HDK A;  2ACJ A;  1KQ0 A;  5D8K B;  4I09 A;  4TV7 A;  3DPT A;  2LF7 A;  4UHT A;  3HHH A;  3HRS A;  2QUF A;  3M8E A;  2AXL A;  2GZW A;  2XKO A;  2KIF A;  4KN4 X;  2VOP A;  1Y0U A;  2A61 A;  3KP6 A;  2EFO A;  2FF4 A;  2P8T A;  1IN8 A;  1JE8 A;  4EJT A;  4AD9 A;  5L3F A;  3WGH A;  5H6R A;  1R7J A;  5FFX A;  1IW7 F;  1BM9 A;  3QAH A;  5LGU A;  4KIB A;  4K2E A;  2BGC A;  3I5U A;  2PEX A;  3FXQ A;  2M30 A;  3RPU A;  2XGX A;  3F21 A;  5DV5 A;  5JR3 A;  2PLY A;  4UVA A;  3WTX C;  4WCG A;  3CO6 C;  1REP C;  1WKM A;  3BJA A;  3E6C C;  4HW0 A;  4EMS A;  1J7K A;  1P6R A;  4GCV A;  4IHS A;  3GO5 A;  2QQ9 A;  1IN7 A;  2A6H F;  3LA2 A;  4HOB A;  2FSW A;  1HSJ A;  2FXA A;  2D45 A;  3R0A A;  4I01 A;  4R8H A;  1B1B A;  4A0Y A;  2VC1 A;  4UXN A;  4HZF A;  3R6S A;  5BQT A;  5K5O A;  2OU2 A;  3WE2 A;  1BI3 A;  1OR7 A;  1QPM A;  1MZB A;  5F6F A;  4IPA A;  2BE5 F;  4G7O F;  1LDK B;  5D6F A;  4EV0 A;  2L4A A;  4OIP F;  4H0E A;  4ZYD A;  4D0P A;  3EDP A;  3GF2 A;  4BAY A;  4HDV A;  2LNB A;  3CUQ A;  1L3L A;  4QLC U;  4B8X A;  1FBS A;  5CJ9 A;  3EYI A;  4HF1 A;  3U9G A;  3KE2 A;  2Z33 A;  2ISZ A;  3KP4 A;  2MH9 A;  2XHK A;  1YTY A;  2ETH A;  5HLI A;  3QU3 A;  1O3R A;  1HKT A;  1P4X A;  2PN6 A;  3TO7 A;  4O6J A;  3RI4 A;  3P9K A;  1SMY F;  5AON A;  3BDD A;  2FNA A;  1XGN A;  2DFI A;  3V7S A;  5FD5 A;  3GW2 A;  1XB4 A;  1GXP A;  5TJJ A;  5DD4 A;  1MKM A;  1W5T A;  4DQ2 A;  1OMI A;  1R22 A;  4EJU A;  6PAX A;  4KMF A;  1FSH A;  2FML A;  4ENK A;  2CG4 A;  3RYR A;  2JSC A;  2EJR A;  3HHG A;  3ECH A;  4M72 A;  4XSX F;  3ZMS A;  3OOP A;  2PMU A;  1FYL A;  4PGH A;  2XIG A;  3SQN A;  1IUY A;  1HST A;  5DD8 A;  5D8L B;  4GGG A;  1X3U A;  2KKO A;  3ZMT A;  1K78 B;  3JSO A;  2NNN A;  5IT3 A;  2IA2 A;  4OOI A;  1SD5 A;  1I27 A;  3ROU A;  3RJP A;  4ETS A;  2HTJ A;  1LEB A;  4P9F A;  2HKX A;  2FA5 A;  3H3Z A;  4JK1 X;  2RDP A;  2EK5 A;  3IKT A;  1XDU A;  3FMQ A;  2DK5 A;  2QQB A;  4YFX F;  1QZY A;  3FM3 A;  1YFH A;  1T98 A;  5J8F A;  1S8N A;  4OIO F;  2V9V A;  3VEP A;  4LK1 F;  2TDX A;  3H3U A;  1QBJ A;  2DBB A;  2F5E A;  1YLF A;  1U8R A;  1JXS A;  5CVR A;  3FHZ A;  2F2E A;  1KU3 A;  1XCB A;  5BMZ A;  4UVB A;  4XSZ F;  4CGZ A;  4UNO A;  3TOB A;  1UHM A;  2JPB A;  1O3T A;  2F5D A;  1R1V A;  3E5U A;  5ILU A;  4BXU A;  4M9X A;  5DUK A;  4QWQ A;  1FSE A;  1P92 A;  4OIN F;  5D4R A;  4RB3 C;  1LNW A;  4OU0 A;  3AAF A;  3V7C A;  2IW5 A;  5HOO A;  1UFM A;  4HDU A;  1YYV A;  2H6B A;  4FX4 A;  1XMK A;  1IRF A;  4EGZ A;  4IJA A;  3WTY C;  4O5V A;  4HQE A;  5D6E A;  1A04 A;  2PMH A;  1O57 A;  1UHW A;  4Q48 A;  4LG0 A;  5K5Q A;  2C6Y A;  2RGV A;  4LLL A;  2PFB A;  5L3B A;  2FBI A;  3TQN A;  5FLX Z;  2O3F A;  1V3F A;  5E18 F;  1H0M A;  2K27 A;  1R5H A;  3JSP A;  2A68 F;  2PBI A;  4IXA A;  2EB7 A;  4CHU A;  3GZ6 A;  3KP7 A;  3ZN0 A;  3JTG A;  2DLL A;  2Z99 A;  3ZMZ A;  5FO5 A;  4HV6 A;  5FB2 A;  2ZJ2 A;  3I59 A;  2DAO A;  2HWV A;  3DV8 A;  2FBK A;  2ISY A;  4HX7 A;  3BOQ A;  1Z1D A;  1SFU A;  2IJL A;  5JFR A;  2XUB A;  5F1R A;  3ML6 A;  1FNN A;  1FPQ A;  4HAM A;  1IF1 A;  2LKP A;  3J80 Z;  4CXF A;  5FLX K;  5LHG A;  2CGP A;  2BYV E;  3N4M A;  5LRS A;  1UB9 A;  4KA4 A;  5DYM A;  2P5K A;  1G6N A;  3ZMU A;  3K2Z A;  4G9Y A;  4PGG A;  1ZYR F;  4CIC A;  3Q9S A;  2K7L A;  2R7D A;  2JPC A;  3V7R A;  2P7V B;  4EM2 A;  1ZRF A;  2XAS A;  3FMS A;  3E97 A;  1DUX C;  3K9T A;  3F8F A;  3LQR A;  2PI0 A;  2RQP A;  2DTR A;  3I71 A;  2IA1 A;  2JZY A;  2M1B A;  1MJ9 A;  1EH7 A;  1R1T A;  4KNY A;  3F23 A;  4A6E A;  1DDN A;  3J80 K;  1TTY A;  1V4R A;  2ZNZ A;  4ENN A;  1UST A;  1LDD A;  3M9A A;  1SFX A;  4A12 A;  1S7A A;  2L4M A;  2JT1 A;  3D0S A;  3F8B A;  1D8J A;  2K4B A;  2EA4 A;  4E70 A;  4ASN A;  2CYY A;  2VT3 A;  1S7O A;  3DFG A;  3IWF A;  3E3V A;  2CWE A;  2GWR A;  2QWW A;  3IRR A;  2XKP A;  2H6C A;  4EJV A;  4BHC A;  5DUI A;  1R1U A;  4HYE A;  1YW9 A;  4U7B A;  3EET A;  4RAZ A;  2D1V A;  3F6O A;  1RIO H;  3KLO A;  1TQP A;  3MZH A;  1YS6 A;  3RKW A;  1PUE E;  3IHU A;  3KFW X;  2ZBK A;  3KET A;  4LMY A;  5K5R A;  2MH2 A;  1B9M A;  1FBU A;  3K0L A;  1B4A A;  2O8X A;  5DDG A;  3KP5 A;  2PJP A;  1EH6 A;  4MNU A;  3TGN A;  2DQL A;  3CUO A;  4FHT A;  2ZME B;  5DCF A;  1QZZ A;  2A3S A;  4MEX F;  2VN2 A;  2KJC A;  5IT9 Z;  4AIJ A;  1T39 A;  2JRT A;  2E1C A;  3ELK A;  4RB2 C;  4M73 A;  3FM5 A;  1MJB A;  5A2Q Z;  2NYX A;  3HTU A;  1J0R A;  2IT0 A;  3DKW A;  1FOK A;  4AIH A;  4UUV A;  1XGO A;  3ZN1 A;  2HYF A;  2DI3 A;  4R1H A;  1BI2 A;  1Z6T A;  1JGS A;  1Z9C A;  1ZRD A;  2QVO A;  4IHT A;  2XRN A;  3ZMV A;  2P5V A;  3HSE A;  2ZO4 A;  1UCR A;  2HR3 A;  4G7H F;  3M1E A;  1ONV A;  2D1H A;  4YIF A;  3IC7 A;  1D5V A;  5ERI A;  4A5N A;  2EFP A;  2FE3 A;  1IN6 A;  5E1Z B;  1TQI A;  1S3J A;  1TW2 A;  1MDM B;  4YFK F;  1MGT A;  4S04 A;  4PCQ A;  3PFI A;  3HYI A;  1XDS A;  1YW7 A;  3TDZ C;  2BBY A;  3GWZ A;  5H20 A;  2HQR A;  3RKY A;  1GVJ A;  4G6D A;  1U5T C;  3H92 A;  3P9C A;  3GYH X;  1F5T A;  2JTV A;  4KFC A;  4LB5 A;  2AS5 F;  2RC4 A;  3JW4 A;  2FMY A;  1H9T A;  4WXD A;  3ABU A;  3MZY A;  5LHI A;  3HIF A;  1HBX G;  3Q9V A;  2K86 A;  3TO9 A;  3I64 A;  4M9Z A;  2V79 A;  4S05 A;  2G9W A;  3SZT A;  2Q8K A;  1F9N A;  3MCZ A;  5DCM B;  2MLK A;  2O0Y A;  5E20 A;  3TKY A;  3LA3 A;  3MAJ A;  1KU2 A;  3F8M A;  2D2W A;  2GA1 A;  3D5L A;  4HQM A;  4L0Y B;  4P55 A;  2VE8 A;  1O3Q A;  2H27 A;  2Y75 A;  2HZT A;  1U6G A;  1DPR A;  2E1N A;  1D3Y A;  3FX3 A;  2NRA C;  4I02 A;  5LEK A;  5L3G A;  4YII A;  3F8C A;  3F3X A;  1U5T B;  1FLI A;  3F6V A;  1IAW A;  1IRG A;  2OBP A;  4HLY A;  4L5I A;  4Y13 A;  3HUG A;  2KIU A;  3GLX A;  4EM1 A;  3EQL F;  3GFI A;  1YO5 C;  1BI0 A;  4LD5 A;  4OIQ F;  2G7H A;  5CVU A;  1FY7 A;  2QBY B;  1ZGA A;  5HS9 A;  4CDG A;  4KYW A;  2COM A;  5D5U B;  4BHP A;  1QQI A;  4RS8 A;  2NNY A;  3ABT A;  4Z2Y A;  1SD7 A;  4L9V A;  3KP2 A;  3ECO A;  1SFE A;  1BIB A;  2GQQ A;  2UXN A;  1ZHF A;  2KJB A;  3BP8 A;  2BV6 A;  4ESB A;  2EFQ A;  2PQ8 A;  1DP7 P;  3F72 A;  1I6X A;  2EV5 A;  1ZG3 A;  5DEQ A;  5EEG A;  1SMT A;  2VOO A;  5L3E A;  2IP2 A;  3CTA A;  5BPD A;  4I0A A;  1R00 A;  1RUO A;  4N9H A;  4IF4 A;  1GXQ A;  4MEY F;  3BJ6 A;  4PDK A;  2L01 A;  1BJA A;  1LDJ A;  3TDU C;  1W7P B;  3S2W A;  4N9I A;  4OIR F;  4EQQ A;  3N97 A;  1BN5 A;  5ICC A;  3VFZ A;  1ZGJ A;  4FX0 A;  4HF0 A;  4OMY A;  1WSU A;  4CYD A;  3HOS A;  2E7X A;  4L5J A;  4XLP F;  3V8J A;  3ZQ7 A;  1FWZ A;  5LRR A;  3F22 A;  1FYK A;  2P6T A;  5ICF A;  4Q4Z F;  4GYI A;  5LLQ A;  4RB1 A;  1NHA A;  1CF7 B;  1W5S A;  1LJ9 A;  4UV9 A;  3FXR A;  3HTS B;  1XSV A;  1T2K A;  4BYY A;  2R3S A;  1J2X A;  2O6G E;  3JTH A;  4I2O A;  2X0L A;  5CVV A;  2PG4 A;  3KZZ A;  1K79 A;  1OKR A;  2VON A;  2V1X A;  5ICE A;  3IRQ A;  4EVI A;  3MWM A;  3WTT C;  3GZ5 A;  4RB0 A;  3Q5F A;  3BZ6 A;  3NEU A;  4L0Z B;  3J81 Z;  2KRF A;  3RDI A;  2F5F A;  5JI6 A;  3O3K A;  4M6X A;  1LQ1 A;  4M6Y A;  5ILS A;  2V1U A;  1XGM A;  3GX4 X;  4EJW A;  3K1P A;  1WI9 A;  2VBY A;  3ISP A;  2UXX A;  5ED4 A;  2MLG A;  3HSF A;  2HGC A;  4G94 A;  5HS8 A;  1LVA A;  2Q2E A;  5JHU A;  1S29 A;  3M7G A;  1BBY A;  1T6S A;  2CO5 A;  4MTE A;  1C0W A;  1USS A;  5AIQ A;  1L0O C;  1BC8 C;  2NS0 A;  3R0J A;  3B02 A;  5D5V B;  3EUH A;  3PQJ A;  1S6L A;  1RNL A;  1TNS A;  1U5T A;  2FQ3 A;  1W7P D;  4WXH A;  2EFN A;  2Y48 A;  4WWC A;  3WGI A;  2RVC A;  4KDP A;  1HW2 A;  2IRF G;  1Z7U A;  2KIM A;  3WG9 A;  5TRD A;  5BPI A;  1WWX A;  1RZ4 A;  1T0F A;  4B09 A;  1LB2 A;  3I53 A;  3TO6 A;  1FT9 A;  4BQA A;  3ZP5 A;  1I1S A;  3E6D A;  3DXJ F;  2OZU A;  1OPC A;  1ZAR A;  4JBA A;  4RAY A;  2O61 A;  1HQC A;  2Z9O A;  1YIO A;  2WTE A;  5H6Q A;  2XV4 S;  4MTD A;  1AWC A;  4U7D A;  3MQ0 A;  3PQK A;  3CDH A;  1K78 A;  1BIA A;  4RGX A;  2CQK A;  1ZG1 A;  4M71 A;  5HS7 A;  3SXY A;  1G3Y A;  1WRJ A;  4LLN A;  2YR2 A;  4KIF A;  3BPX A;  2EV0 A;  2VOD A;  1PP7 U;  3V4G A;  2VBZ A;  3R61 A;  5ICG A;  4HX4 A;  4FT8 A;  3CUQ B;  4IRI A;  1VTN C;  3FXU A;  1W4M A;  1Q1H A;  3LA7 A;  3GFL A;  1J9I A;  5LGN A;  3KLN A;  4LB6 B;  5E1W A;  3J7A O;  1KQ9 A;  2STT A;  4O3M A;  4WX9 A;  4NQW A;  1YQA A;  1XCV A;  2M5W A;  4EJO A;  1TW3 A;  2R7F A;  1BOA A;  3DEU A;  2ZFW A;  4YFN F;  4I0B A;  3LAJ A;  2MD5 A;  4R79 A;  5LGT A;  1PP8 F;  3HRU A;  2XRO A;  2YX4 A;  2UWM A;  3C7J A;  4ZZL A;  3V8L A;  1JHH A;  4GO1 A;  1IXC A;  5AIP A;  1YS7 A;  1ZH5 A;  4ESF A;  3COA C;  1ODD A;  2EFW A;  3L2C A;  5BS6 A;  5JVT A;  2X4H A;  4EGY A;  4ZYH A;  3C18 A;  4A2U A;  3WU0 A;  2F5C A;  3FWE A;  4DNC A;  4KN7 X;  4ENJ A;  3WTW C;  2XVC A;  1SD6 A;  4G7Z F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...