3RJPA

Crystal structure of the dna binding domain of covr from streptococcus pyogenes
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
MYRDLVLNPQNRSVNRGDDEISLTKREYDLLNILMTNMNRVMTREELLSNVWKYDEAVETNVVDVYIRYLRGKIDIPGKESYIQTVRGMGYVIREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CovR
publication title Crystal structure of the DNA binding domain of CovR from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
molecule tags Dna binding protein
total genus 25
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2011-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rjpA00
1YW8A 2JT1A 1TLHB 5E18F 1SMTA 1Z6TA 1CF7A 1U78A 4O5VA 3I0TA 3HRTA 1H0MA 4EJVA 3QP6A 4RAYA 3V8KA 4EVIA 1UCRA 3SFZA 1IXCA 2YX7A 5FLXZ 2HDCA 2GZWA 1O3TA 3WU1B 2IT0A 1V4RA 1HKSA 2CW0F 1OMIA 2DTRA 3FM3A 5HS7A 2O6GE 1KYZA 2PN6A 3E6CC 3KEOA 4DNCA 3CJNA 2A61A 3AAFA 5D6FA 4G6QA 2Y48A 4R79A 1BBYA 1TNTA 4CO8A 3HIFA 3GO5A 4CDGA 5H6RA 2ZCWA 2BGCA 2FU4A 4U7BA 1J7KA 2A6EF 2ZMEA 4AD9A 4KYWA 3KLNA 3ZP5A 4A6EA 2BEOA 2HKXA 2O03A 1QPMA 4XSZF 1IRFA 5D8LB 6PAXA 1OYIA 3HTUA 3B73A 3EQLF 3R0JA 1I1GA 4ZZLA 1TTYA 3T0YA 3HTSB 2VODA 4S05A 3TDUC 1EV7A 1ZG3A 2G7HA 2VOPA 2WV0A 3LA3A 3ZPLA 2FMLA 2H27A 3DKWA 4P5OA 5LHGA 2CFXA 3PFIA 4EGZA 4AWXB 1LEBA 4HX4A 1T98A 4IRIA 2FOKA 3DFGA 4YG2F 2EFWA 4EJOA 5FO5A 4G7ZF 2CWEA 1P4XA 1WRJA 2PMUA 3IRQA 4MEXF 2O8XA 3VOEA 5L3CA 3K1PA 1LEAA 4E70A 2CYYA 5AONA 2DI3A 4WK8F 5DD8A 4I2OA 5K5OA 1AOYA 4XRFA 1WI9A 2BE5F 2Z3YA 3RKXA 2EV6A 3I53A 5ILSA 2KJBA 3QOPA 4Q4ZF 4U0WA 2EA2A 4IHSA 3K1MA 2F5DA 4A5NA 4LGWA 2IA1A 3B02A 4ZYHA 3HUGA 4KMUX 3ZMTA 3Q9VA 5LHHA 3DV8A 2PQ8A 3J80Z 1FWZA 2JZYA 3GLXA 1P6RA 5BS6A 1BOAA 5BMZA 2A07F 1ZH5A 1ZHFA 5HOOA 3ZMUA 2V6CA 1Y0UA 1IRGA 4IF4A 3SQNA 1XCBA 1HXDA 2GXBA 5DDGA 1MJ9A 4OIPF 4BXUA 4I7HA 3ZMVA 2HKOA 2P6TA 1UHMA 1ZGAA 3F8FA 4OINF 5IT9Z 4YFXF 5TJJA 4HF2A 2P6SA 1W7PA 5JVTA 3KP4A 3K1NA 1S8NA 2CQKA 1KU3A 3KE2A 3TDZC 3H3UA 2CSOA 2BV6A 3I64A 3HOTA 4YIFA 2IP2A 3CO6C 3T8RA 1K79A 5D6EA 3TOBA 4FHTA 4I09A 1P4WA 5FD5A 2W24A 3T8TA 3TO7A 2GXGA 1H9TA 4CYDA 2XROA 3ZMSA 5D5UB 4OIRF 5JI6A 1U5TB 3I54A 1J75A 3D5LA 2RQPA 4PGGA 5LBQA 4CZZA 2K86A 4HV6A 1E2XA 5FLXK 3RYRA 2STTA 3BY6A 2H09A 4WXDA 4RB3C 1QO0D 3T1BA 1F5TA 5EEHA 4G7HF 1BC7C 4RB1A 3ELKA 4U0VA 4M6YA 1KQ8A 4Y15A 1BJAA 1NHAA 2EK5A 3H3ZA 1G4DA 3ECHA 1WQ2A 1TQMA 1XGMA 2HTJA 4MTEA 1W7PD 3BWGA 5KVRA 2K7LA 1DPRA 1RUNA 2DQRA 3F6VA 4BHPA 4WX9A 2XUBA 4QLCU 3SZTA 5FFZA 1ZG5A 2EA4A 1MD0A 1BI2A 3QRFF 3W6KB 4L0ZB 1OR7A 3PQJA 3QPTA 1K7AA 3RJPA 1IZ1A 2DK5A 2YPRA 1J9IA 1PP7U 5L3EA 2Y0MA 4M6XA 4LLLA 1VTNC 5HS9A 3WU0A 3BOQA 5ERIA 3WGHA 3ML6A 3WTVC 3M7GA 1P92A 3V7RA 4EJUA 3I71A 1IAWA 2P5LC 5DV5A 4IXAA 5K1YA 2K4BA 2RGVA 4Q47A 4S04A 3I5UA 3FMSA 3WTYC 4ON0A 2VE9A 4L9VA 1TW3A 1DDNA 4JK1X 4HLYA 1XD7A 3BZ6A 2JPBA 1S3JA 2MA3A 2FE3A 2A6HF 3K2ZA 1REPC 3J80K 1U8RA 4U0YA 1X3UA 3LAPA 3F21A 2PEXA 2W25A 5DUKA 1BI3A 3T5XA 5ICEA 2KIUA 3SZPA 4ENNA 5CVVA 2RKHA 2GA2A 4Z2YA 1B9MA 2QBYA 1LJ9A 4P96A 4GXOA 2P8TA 4KICA 5DCMB 2UZKA 3F8CA 1R5HA 3N4MA 5F64A 1MDMA 3FXUA 3LSTA 1XN7A 3BROA 3K69A 1UB9A 2GAUA 1YIOA 5FB2A 2QENA 2NNNA 1EH6A 3DQVC 4BYYA 4GYIA 4ASNA 2ZFWA 5ILVA 1K78A 2NNYA 5ED4A 4A5MA 2MBFA 3RYPA 3FMQA 2Z99A 4M72A 5CJ9A 3E97A 2OQRA 4RGSA 1ZREA 3ERED 2CGPA 4FX4A 2VBWA 2ZJ2A 3R4KA 3BJAA 3FWEA 4FT8A 2J5OA 5EEGA 4UHTA 1BM9A 2JTVA 2V1DA 2AXLA 5E8IA 2GA1A 1GVJA 2M30A 4ZZDA 1EH8A 2DAOA 1BI0A 3BJ6A 4DQ2A 4RS8A 4KDPA 3MCZA 2VT3A 4YFNF 2P5VA 3N97A 3HSEA 4GGGA 1T6SA 3CUQB 3LQQA 1R7JA 4HDUA 3KP6A 3F6OA 2WWYA 2ACJA 3CTAA 2XAFA 2QQBA 5A2QZ 2M5WA 3R6SA 1ZLKA 2YR2A 4G94A 4UV8A 2IVMA 3U2RA 4PCQA 2HWVA 2LKPA 3FHZA 4XSXF 2FBHA 4P9FA 3JTGA 4L18B 3HSRA 2W57A 4RGUA 4MQ9F 3M1EA 2E7XA 4ESBA 1KA8A 3VODA 1J2XA 3BP8A 3R60A 2PI0A 2D45A 2VBXA 3F22A 4KA4A 1OKRA 1FX7A 2ZKZA 3ABUA 1I6XA 3L9FA 1SFXA 1RNLA 1O57A 3E6DA 1FBQA 1XGSA 4HYEA 3IHUA 1V3FA 1WKMA 2GWRA 1DP7P 3E6BA 4KIFA 1O7LA 2EFNA 2ZXJA 4P9UA 4KIGA 2BBYA 1FZPB 4Y17A 3V7CA 3FMRA 3ZQ7A 4L0YB 1L0OC 3HSFA 2A68F 1ONVA 4FX0A 3HOSA 2K27A 3JW4A 4M9SA 1RIOH 4EM1A 1KQ9A 2ZO4A 4MHGA 3GFIA 3P9KA 4I98B 1SAXA 3E6MA 1HSJA 3HYIA 4Y13A 1FYLA 2C6YA 4G7OF 2ZMEB 4KUMA 4LB6B 4HF0A 3COAC 2HZTA 3GFJA 2EB7A 1K6OA 3DPTA 4HF1A 2YSRA 5E20A 3FXRA 2O3FA 3WTSC 4ESFA 1P4AA 1LDDA 3V8LA 1O3SA 4LLGF 4LD5A 1ZRDA 3F3XA 5E1ZB 4AIKA 4H0EA 4UV9A 5LLQA 1BIAA 1D3YA 1ON1A 2Y75A 4A12A 1R00A 4HV5A 3GFMA 5E17F 2VBYA 5ICCA 4KIBA 3KP7A 2F5CA 1HSTA 3M8EA 5DCFA 3U1DA 5BPDA 1HQCA 3MZYA 4AIHA 4WWCA 1O3QA 2WC2A 1XGOA 1FBSA 3BPXA 3KFWX 3EUHA 3GX4X 1YLFA 2XV4S 4KFCA 2L02A 2FF4A 5LGUA 3CUOA 2JSCA 1FYMA 4WCGA 4LMYA 3P7NA 2A3SA 2UXNA 2MH2A 2IRFG 4A0YA 5FGMA 2X0LA 3I4PA 5HLHA 2OD5A 2STWA 4PZJA 1SMYF 2R7DA 2QZ8A 5CLSA 4XBFA 1FT9A 2L3DA 4HZFA 2OZUA 5A2QK 2DW4A 1IXSB 2PLYA 2HYFA 3J7AO 4WXCA 4GYGA 1S29A 5DEQA 1G3YA 1G3TA 3GZ6A 2FXAA 4M73A 1ZAOA 2VE8A 2F5FA 4HAMA 2TDXA 1T39A 3CO7C 4LK1F 5ILUA 3KP2A 1AWCA 1KYWA 2ZNYA 3LA2A 1P2FA 5E8GA 2L4AA 4HW0A 2DQLA 2DBBA 1E17A 2O0YA 3BPVA 2EFQA 1GXPA 1W7PB 4OMYA 1TW2A 3NEUA 2V9VA 2AS5F 2FSWA 4JBAA 1IW7F 5FD6A 1T0FA 2FMYA 4MGRA 1R1UA 1B1BA 1U5TC 2VN2A 1STZA 2KIFA 3MAJA 1U6GA 2IA2A 2UWMA 1XB4A 2LF8A 1RZ4A 1ZYRF 1JHHA 2DT5A 1WWXA 3KLOA 2GIVA 2VOOA 4I01A 3QAHA 1FBUA 5TRDA 2QQ9A 1XMAA 3WG9A 2HQRA 2HYGD 1XDSA 3E3VA 1LDJA 2R3SA 2RC4A 3KP3A 4RGRA 4I0AA 4UVBA 4PGHA 2QM3A 3PQKA 3FXQA 3GWZA 3ISPA 2VXZA 5J6XA 1HW5A 3K9TA 4IPAA 5LEKA 2RVCA 1U3EM 3LAJA 1OYWA 1LQ1A 1HBXG 1W5TA 4R8HA 4I0BA 1KU9A 1ZRCA 4KNYA 1R58A 2VBZA 5BQTA 4L5JA 4EQQA 3WGGA 2L4MA 5L3DA 1USTA 2EFPA 2HOEA 4UUVA 4MNUA 3J81Z 2QQAA 4CGZA 1QGPA 2K02A 4YIIA 4RAZA 4ENJA 1SFUA 4A0ZA 5BOXA 1MJAA 2CO5A 3ZN1A 4EV0A 3DEUA 1Q1HA 4UNOA 1W5SA 2B0LA 3C1DA 3SHFA 1IN7A 1U2WA 1R1VA 3BDDA 4KT5C 2DFIA 2ETHA 1Z7UA 4M71A 4EM0B 1TBXA 3I59B 4L9TA 4YFKF 5DCMA 4OU0A 1FY7A 2P7VB 3L2CA 3LA7A 3JAMZ 2IPQX 3WE2A 1I27A 3JSOA 1ZG1A 1BC8C 2M45A 1Z9CA 5H20A 3JSPA 1I5ZA 5JFRA 3VFZA 3O2PE 1IF1A 3GVAA 1FSEA 1Z1DA 1HW1A 4EMSA 2Z33A 2EWNA 5J8FA 1LNWA 4WXHA 5IT9K 4ENKA 2XKOA 3GXOA 5LHIA 1SD5A 2EJRA 2G9WA 3M8FA 3F72A 2QBYB 1IN6A 3EETA 4ETSA 1IN5A 2QLZA 4RB0A 5JHUA 3Q9SA 2MD5A 4KN4X 4LG0A 3CDHA 1MDMB 2FBIA 2FNAA 2GQQA 2VC0A 4CHUA 5DUIA 2XAGA 5D4SA 2XGXA 1FLIA 1ON2A 2PFBA 5E1XA 4CICA 4IRHA 3GEZA 2DO7A 4L9NA 1WSUA 2NYXA 4BAYA 4A6DA 5K5RA 3FM5A 5CVRA 1EH7A 5DD4A 2QVOA 3GF2A 1B6AA 3MFKA 2LNBA 4L5IA 3RTRA 1HW2A 1MJBA 3F23A 3EYYA 4ENMA 1R5GA 4G6DA 3C18A 4UVAA 3V8JA 5LEJA 2MLKA 3EDPA 1FP2A 2MH9A 4EGYA 1BIBA 1FSHA 3ECOA 3L09A 1R36A 4HQMA 4MQVA 1YTYA 4GCVA 1KGSA 3IWFA 1L3LA 2L54A 2MC3A 4LB5A 3RKWA 5DYMA 2VT2A 1D8KA 1S7OA 3DF8A 1YW7A 1OYYA 2M1BA 2ISYA 2X4HA 3ZMZA 2VONA 1FPQA 5CYVA 3WTZA 2Q0OA 2OU2A 3DPLC 3KCCA 3IKTA 1IUYA 1PP8F 3MQ0A 3NRVA 5LRRA 4AIJA 4XLNF 1CF7B 3TO6A 2OA4A 2KJCA 3C3WA 3D0SA 5IT3A 1F4KA 1YQAA 3J81K 3H92A 1HKTA 4Q5SF 3IL2A 2COMA 1JHFA 1TQPA 3IC7A 3ZMDA 3WTUC 2Z9OA 2V1UA 1B9NA 1TQIA 2A69F 4ESJA 4PDKA 5HLGA 4OMZA 2RDPA 3P9CA 2ELHA 4B8XA 2LSOA 4HX7A 1SD6A 2PMHA 2E1NA 1FYKA 4HLXA 1JXSA 3KZYA 3VEPA 4A0XA 1J59A 4LLNA 5HDGA 4QWQA 4B09A 1IXRC 4KMFA 5LRSA 3ABTA 3IWZA 4UVCA 2ZBKA 3KP5A 4CXFA 2UXXA 2DU9A 3KEQA 2WTEA 1D5VA 3JAMK 3BJOA 4LJZF 4KN7X 1XSVA 4NQWA 3ROUA 4R1HA 1B4AA 5CVIA 2BYVE 2D2WA 2W85A 3W6JB 3F8BA 3KETA 1T2KA 1J0RA 1GHCA 1XSDA 4MTDA 2F5EA 3HRUA 2DLLA 1PDNC 3C7JA 1R22A 2RN7A 1C0WA 2XAQA 2D1VA 2E1CA 2H6BA 1RUOA 1HKQA 3MWMA 5AIQA 2ZNZA 2PG4A 2FQ3A 1TNSA 3DP7A 4O6JA 3LWFA 2XRNA 1D8JA 4EJWA 3M9AA 2H6CA 3MZHA 3RPQA 3G3ZA 3E5UA 5D8KB 3GUDA 3MEXA 1R23A 4OIQF 1DUXC 3RKYA 2DK8A 1USSA 3V4GA 1G6NA 4IVNA 1GXQA 4BNCA 5FFXA 4ZYEA 4XLPF 3WGIA 2FEZA 3QP5A 1QZYA 4LFUA 1O3RA 1LB2A 1QBJA 1G3SA 2A5YB 4HA8A 5AIPA 2XASA 3OV8A 5BPIA 2O61A 1MKMA 2Q8KA 2V79A 2IJLA 3QU3A 2NAZA 5L3FA 2M87A 3TOAA 1U5TA 2E7WA 4K2EA 3HHGA 1YS6A 1RI7A 1IN4A 2Z5UA 4BHCA 4M9XA 2QWWA 3TKYA 2ESNA 5LGTA 1R1TA 1OPCA 3WTWC 5HVQC 2EFOA 3FX3A 4BHBA 5HDKA 3HHHA 1W4MA 5F1RA 1JGSA 1XGNA 3F8MA 5E1WA 3GFLA 2YU3A 4ZYDA 2P7CB 4G8XA 5L3GA 1O7FA 1ZARA 3RI4A 1LDKB 2KIMA 1ZLJA 2XIGA 1XMKA 4A2UA 4WF2A 2CG4A 2HQNA 2JRTA 3LQRA 1ODDA 5D5XB 1B59A 2FNPA 3E5XA 1UFMA 3LFKA 3I58A 1YS7A 4I02A 1S7AA 2Q2EA 3E5QA 1F1ZA 2VC1A 4N9IA 4NB5A 4F7ZA 4HX8A 3ULQB 4HQEA 3F8NA 5ICFA 5LGNA 3GYHX 3U9GA 1QZZA 4OOIA 1BN5A 3IKVA 3TQNA 1SD7A 1YFHA 1ZRFA 4JQFA 4N9HA 4GO1A 1Z91A 1DPUA 1YW9A 3WODF 5H6QA 3WTTC 3RIRA 2G7UA 3K0LA 2EV5A 4ZH4F 5CVJA 2PJPA 2OAZA 3S2WA 2HTSA 2DPUA 5HLIA 3JTHA 2FA5A 3KZZA 5F6FA 2ADUA 1H9GA 4TV7A 3V7SA 2HR3A 1YYVA 3R61A 5HDNA 2LF7A 4EM2A 3QU6A 5L3BA 4D0PA 4M9ZA 3NQOA 1QQIA 3I59A 2XAHA 4O3MA 3RDIA 1FNNA 1KQ0A 4U88A 3REOA 1UHWA 2IW5A 3L00A 1Z6RA 1ZN2A 2HFHA 1S6LA 2W84A 1ZGJA 4RB2C 3OOPA 2KKOA 2ISZA 2NS0A 3EYIA 3IRRA 4Q48A 5D5WB 3FF5A 2JPCA 5CVUA 3O6BB 2FBKA 3RPUA 5D5VB 5D4RA 5JR3A 2QUFA 4EJTA 5K5QA 1PUEE 5HS8A 2OBPA 4L9JA 1JE8A 1KU2A 1MGTA 2XKPA 2ESHA 4U7DA 1FOKA 1LVAA 1ULYA 2V1XA 4MEYF 1F9NA 2MLGA 1IN8A 1FP1D 2H94A 4HDVA 1YO5C 2YX4A 1MZBA 3WTXC 4HOBA 3ZN0A 4IRGA 3FZVA 2KRFA 1SFEA 3R0AA 4BQAA 2M8EA 1CGPA 1T38A 3P9IA 5KK1A 2NRAC 4M74A 2R7FA 3GW2A 3G73A 2L01A 3DXJF 1QNTA 1I1SA 2D1HA 2IA0A 1K78B 1KU7A 3HRMA 2OZ6A 3GZ5A 2HGCA 1XCVA 3SXYA 2XVCA 2FRHA 1FC3A 2RV8A 3CUQA 4AVPA 3L7WA 4LK0F 4IHTA 3WE3A 4LG0B 4P55A 3TO9A 1A04A 3CLOA 4UXNA 2QYOA 1J5YA 1SD4A 4G9YA 4RGXA 4NHJA 1G3WA 1XDUA 2LDUA 3O3KA 2XHKA 1BI1A 1XSXA 3HRSA 2F2EA 2HEOA 2PBIA 4HBLA 4ZYGA 2XAJA 2EV0A 2K4JA 4OIOF 2J5PA 3CUQC 3Q5FA 2P5KA 5J8CA 1Z05A 4IJAA 5ICGA 4N0BA 2RNJA 2DPDA 3TGNA 2P4WA 4BH9A 1YG2A 3VB2A 2OQGA 2HS5A 3QPHA
chains in the Genus database with same CATH superfamily
1YW8A 3MKZA 2JT1A 1TLHB 1TWAJ 5E18F 1SMTA 1Z6TA 2K85A 1CF7A 1U78A 2DN0A 3CJRB 4O5VA 4IHYA 1SFOJ 2X6OA 2DMTA 1S9HA 3I0TA 4NNJA 4V2FA 3HRTA 4DBQA 3MKWB 4JOMA 4YELA 1H0MA 2I5UA 1FEXA 4EJVA 2JVGA 1QHGA 1HCRA 1NG6A 3QP6A 4RAYA 3V8KA 4EVIA 1UCRA 1K6YA 3SFZA 1HF0A 3OYLA 3O8HA 1IXCA 2YX7A 3BG7A 4BJ6C 5FLXZ 3S8PA 1H88C 2L9NA 2HDCA 5IOYA 1U0JA 2GZWA 2LY1A 5E3OA 1O3TA 1TWCJ 3WU1B 3ZQCA 2IT0A 1V4RA 2G0EA 3KZIC 1G59A 2IS2A 1J09A 1HKSA 3GTLJ 2CW0F 1OMIA 2DTRA 5IP9J 4A3EJ 3FM3A 5HS7A 2O6GE 2CQNA 1KYZA 4XKBA 1VQ5I 2PN6A 1X3ZB 3E6CC 3KEOA 4DNCA 5GTIC 3CJNA 2A61A 3AAFA 3IAS2 3E7LA 4G6QA 5D6FA 5FKNA 3HBLA 3NWSA 5C4XJ 2Y48A 4R79A 1BBYA 1APLC 1Y1VJ 1TNTA 4CO8A 5GADJ 3HIFA 4H4KC 3GO5A 4CDGA 1R49A 5H6RA 2LBFB 2ZCWA 3JRFA 2BGCA 2FU4A 4EEFG 5KAFC 3IP4B 3MN2A 3GTJJ 4U7BA 1J7KA 1BR1A 2A6EF 2PX9A 2ZMEA 4FE7A 4AD9A 2ZJRF 2L7FP 2R7QA 3KLNA 3ZP5A 4A6EA 1QZEA 1YE9A 2BEOA 2HKXA 3H5NA 4UUSB 1MMGA 2O03A 3OYAA 2R7RA 1QPMA 4XSZF 1FMVA 3DPUA 1IRFA 5D8LB 2WBMA 2HOTA 3K4BA 6PAXA 3HDDA 4JYKA 1GT0C 1OYIA 2IGOA 3HTUA 5KCMA 1ETYA 3HKZA 3B73A 2AQFA 3EQLF 3UNGC 3R0JA 1I1GA 1JUSA 2DMNA 3B6CA 4ZZLA 1TTYA 3T0YA 3HTSB 2H8RA 5JHFA 2VODA 2CQ7A 4S05A 3TDUC 1EV7A 1ZG3A 2G7HA 2VOPA 2VJ5A 2WAEA 2JUGA 2V9KA 2WV0A 5DM6F 3LA3A 3ZPLA 2FMLA 2H27A 3DKWA 2MFZA 4P5OA 4PK4A 2DYRH 1ETXA 5LHGA 3FXKA 3W2VA 4XR6A 2CFXA 3PFIA 4NUBA 4AWXB 4EGZA 2JSPA 1MBKA 1PVEA 9ANTA 1LEBA 4HX4A 1T98A 4IHWA 3OYJA 4IRIA 4BE1A 2FOKA 1D0YA 3DFGA 1JGGA 4C2UA 2MW8A 1PUFB 1ITYA 4YG2F 4BL0B 2EFWA 1IRXA 4EJOA 5FO5A 4G7ZF 2CWEA 4NQWB 1VF9A 1P4XA 1WRJA 2PMUA 2XPUA 3OR2C 3IRQA 3S1QJ 1MNEA 3FXLA 4MEXF 4B1RA 3L2RA 3FK6A 2BHYA 2ECBA 2O8XA 3VOEA 5L3CA 3K1PA 1LEAA 4IHXA 4E70A 5E79C 2CYYA 5AONA 3S3OA 2DI3A 3F0CA 4WK8F 2UV1A 5DD8A 2CJJA 3H1CA 4I2OA 5C3EJ 4XICA 5K5OA 3S14J 1AOYA 4XRFA 3HGYA 1WI9A 2BE5F 4DJAA 2VKHA 1TT5B 2Z3YA 2F48A 3RKXA 2E2JJ 3BQZA 2EV6A 3KYCB 2BY3A 3I53A 5ILSA 1GLNA 2KJBA 3QOPA 4II2A 4Y7NJ 2NOJB 4Q4ZF 4U0WA 3K4MA 2EA2A 4IHSA 3K1MA 2F5DA 4A5NA 2W00A 1T08B 4LGWA 2IA1A 3B02A 4ZYHA 3HUGA 4KMUX 3DLLF 3PM1A 3ZMTA 3Q9VA 5LHHA 3AG3H 1IV8A 3DV8A 2PQ8A 3J80Z 3KYLA 1FWZA 2JZYA 2ZSHB 3I55I 3GLXA 1P6RA 3JRHA 3FISA 3D1NI 3BQYA 2B63J 5BS6A 1BOAA 1LE8B 1I6HJ 2LRDA 5BMZA 2A07F 1ZH5A 5B1AH 3DBRB 2OV7A 4XL9A 3WG7H 1IGNA 1ZHFA 5HOOA 3BG5A 3ZMUA 1W0UA 2V6CA 3G71I 1Y0UA 2AHQA 3K7AJ 1Y8QB 3VPRA 1W0TA 1IRGA 5F0FA 2CV1A 4IF4A 3SQNA 3LSKA 2NVXJ 1XCBA 4B43A 1HXDA 2CV2A 2GXBA 5DDGA 1MJ9A 4OIPF 2TCTA 4QPOA 4BXUA 3L2QA 4I7HA 3ZMVA 3JR9A 2HKOA 2P6TA 4LOCA 2DFHA 1UHMA 3K10A 5TGTA 4JX6A 1QPIA 1ZGAA 3F8FA 4OINF 5IT9Z 3GMEA 4YFXF 1QVUA 5TJJA 4HF2A 1YRNB 2P6SA 1W7PA 1V55H 3KP4A 5JVTA 3K1NA 1S8NA 2CQKA 1KU3A 3KE2A 2LY2A 1ETWA 5EF6A 3TDZC 1SAUA 3H3UA 2CSOA 2BV6A 3LSMA 3I64A 2VQHA 3DU5A 3HOTA 4BXXJ 2IBDA 4YIFA 5M3MJ 2IP2A 2O5RA 1MMAA 3CO6C 1Z67A 2ZFUA 3T8RA 1K79A 5D6EA 2P81A 3TOBA 1FMWA 4FHTA 3OYIA 4I09A 1P4WA 2E34A 4AYBN 5FD5A 1OCCH 2E1OA 2W24A 3T8TA 3TO7A 1XG1A 2A05A 2GXGA 3ERMA 3MZ8A 4CYDA 2CMPA 1H9TA 1ERDA 2JA8J 2XROA 3ZMSA 3CCMI 5D5UB 4OIRF 5JI6A 1U5TB 3I54A 4IQ4A 1J75A 3LSPA 3D5LA 2RQPA 4PGGA 3OYEA 5LBQA 5EJCA 3SEZA 1R4MB 4F93B 3CJQB 4CZZA 3AG1H 2K86A 4HV6A 1E2XA 3S32A 1N77A 5FLXK 2BW3B 3RYRA 3JRAA 2VPRA 2STTA 2LK2A 4E4HA 3BY6A 2H09A 4M3BA 4WXDA 4AC0A 1QO0D 4RB3C 4NC8A 3T1BA 3BC8A 3VYUB 4FE4A 1F5TA 3GBGA 4Y3OA 3J7AY 5EEHA 4G7HF 1BC7C 1UJ8A 3JREA 2JA2A 3MD2A 4IL6C 4B4CA 4RB1A 3ELKA 1B72A 1X1PA 1ORKA 2RAEA 4U0VA 4M6YA 1ZGWA 1KQ8A 5B3SH 4Y15A 1TL8A 2HOAA 1BJAA 4A3DJ 1NHAA 5IP6A 4BACA 2EK5A 3H3ZA 1G4DA 1GV2A 3ECHA 1WQ2A 3ASNH 3OYBA 3JRDA 3ZQQA 1WJEA 1TQMA 1XGMA 2HTJA 4MTEA 5EG0B 1W7PD 2O9LA 3BWGA 5KVRA 2K7LA 1DPRA 4A3JJ 2DQRA 4BKXA 1RUNA 2BY0A 4LIVA 3F6VA 2R5YA 2M8GX 4BHPA 4WX9A 2DTZA 3L2UA 4FASD 2XUBA 4QLCU 3SZTA 4B47A 3CCLI 5FFZA 1ZG5A 2EA4A 2K9NA 2E5NA 1MD0A 2JK3A 1BI2A 2X6XA 2W7NA 1S7EA 3LSHA 3DKYA 3HXLA 3QRFF 3W6KB 4MIMA 4L0ZB 1OR7A 4HNTA 3F9KA 3PQJA 3QPTA 1K7AA 2Q2EB 3RJPA 1IZ1A 2DK5A 2YPRA 2ZSIB 1J9IA 3DU6A 2IS6A 5JVGF 1PP7U 5L3EA 2M7AA 2QCOA 2Y0MA 5B5EC 2HDWA 3AL0C 4M6XA 4LLLA 4XONA 4BGDA 1H8AC 3H9GA 1VTNC 5HS9A 3WU0A 5LFAA 1K61A 3BOQA 3JRIA 5ERIA 3WGHA 3ML6A 3WTVC 4LG3A 2BOLA 3M7GA 1Y56A 3HL2A 1EJ9A 2LTPA 1P92A 1U9OA 3V7RA 2X51A 3GTKJ 2DT6A 2DCEA 2ZXHA 4EJUA 2ZC2A 3W3CA 3I71A 2VKDA 1IAWA 2P5LC 5DV5A 1X1AA 4IXAA 1RKWA 2K4BA 5K1YA 2RGVA 4Q47A 4PSWA 1OR7C 4S04A 3I5UA 4XM3A 1FJLA 3FMSA 1WZ2A 5M5XJ 1X2MA 3LOCA 3WTYC 4IEJA 4ON0A 2VE9A 1OFCX 4L9VA 4RLQA 1TW3A 2M0MA 1DDNA 3TP3A 4JK1X 4RM2A 2TRTA 3OYNA 2PJRB 4IX7A 4MO7A 3W6VA 3DCFA 4HLYA 1XD7A 2WAFA 3BZ6A 2JPBA 1S3JA 2MA3A 1WH7A 4BDZA 2K9SA 1T33A 2FE3A 2A6HF 3PNYA 3K2ZA 4PJMA 4XRSA 1REPC 2R7UA 3J80K 2E2IJ 2LLKA 1U8RA 2VJ4A 4U0YA 1X3UA 5GAEJ 4XIDA 3LAPA 3F21A 2NS8A 2PEXA 4F92B 2W25A 5DUKA 1BI3A 4DYQA 3QYEA 3BZCA 3T5XA 5ICEA 2KIUA 3SZPA 1RESA 1SVMA 1B8IA 4ENNA 1FOXA 5CVVA 2RKHA 2GA2A 4Z2YA 1B9MA 2R7WA 1VQ9I 2QBYA 3TL4X 1LJ9A 2R92J 4P96A 2WB1N 5GAHJ 4GXOA 2P8TA 4KICA 1PJRA 4XNFA 5DCMB 4ITVA 2UZKA 1IC8A 2M3AA 3F8CA 1R5HA 2QSHX 1SVLA 3N4MA 2IAIA 3O8GA 5F64A 1DQUA 3S1RJ 4ZDPA 4BJ5C 2QQ8A 1MDMA 3FXUA 4BQNA 1SEUA 5FLVA 3LSTA 1XN7A 2DJNA 3RKQA 3BROA 3K69A 4DYRA 1UB9A 2GAUA 1YIOA 2DOAA 4I76A 5FB2A 2QENA 2NNNA 3ZGKA 3GTMJ 1EH6A 3DQVC 3CC4I 4BYYA 4GYIA 2JUCA 1N75A 2KP6A 2ZFWA 4ASNA 5ILVA 5J47A 1K78A 2CUZA 3BR0A 2NNYA 3ZCOA 5ED4A 4A5MA 2MBFA 3RYPA 2D5VA 3FMQA 2Z99A 3G1LA 4M72A 5CJ9A 3CLQA 4PSXA 3E97A 2OQRA 2IXSA 4RGSA 1ZREA 3ERED 2CGPA 4FX4A 2VBWA 2ZJ2A 2AQEA 3R4KA 3BJAA 4BQQA 1D5YA 2Q1ZB 3FWEA 4FT8A 2J5OA 5EEGA 4UHTA 3M3YJ 1BM9A 3SFIA 3A0BC 2JTVA 2V1DA 2FX0A 2AXLA 4BEHB 3I4MJ 5E8IA 3K4CA 4P1WA 2ZJPF 1JJ6C 2GA1A 1GVJA 3BG3A 2M30A 1QHHD 4ZZDA 2CS3A 1EH8A 4M3FA 3K70C 2DAOA 1BI0A 1RR7A 3BJ6A 3CCYA 4RAFA 4DQ2A 1E3PA 3Q3SA 4RS8A 4KDPA 3EUKL 3MCZA 4CYCB 2Y30A 2VT3A 4YFNF 2P5VA 4G6TB 3N97A 4Z6YA 3OIOA 4DYCA 2DMQA 3HSEA 4RDUA 4GGGA 2BXZA 4X6AJ 1T6SA 3CUQB 1FOWA 3HB9A 1A6QA 2NOGA 2KISA 3LQQA 2JA6J 3BZKA 1R7JA 1XTAA 2L9RA 4HDUA 2F4IA 2VJIA 3VYSB 3KP6A 3F6OA 2WWYA 2ACJA 1HLVA 3CTAA 2XAFA 2QQBA 3PO2J 2VB6A 5A2QZ 2PMZA 3K70D 2E35A 2M5WA 1H89C 4FETA 3R6SA 3U1KA 1ZLKA 2YR2A 2MG4A 4G94A 4UV8A 2IVMA 2CQQA 3M1CA 5K7FA 1R9TJ 3U2RA 4PCQA 4IZZA 2HWVA 2LKPA 3FHZA 4XSXF 1ZK8A 2FBHA 4P9FA 3JTGA 1OCPA 2MC4A 4L18B 2AXTC 3HSRA 3G1OA 4E6KG 3IH4A 4B48A 3OS2A 4XOPA 2W57A 4RGUA 4XLCA 4MQ9F 3M1EA 3BTIA 2E7XA 4ESBA 1VQKI 5H2FC 2XB5A 1KA8A 3VODA 5IYBJ 1J2XA 3BP8A 3R60A 3SYTA 4ZYAA 2D45A 2PI0A 5K7HA 2VBXA 1G2HA 3VYTB 2ICWG 2BXYA 3F22A 4KA4A 2HVQA 1OKRA 1FX7A 4Y52J 4QPQA 2ZKZA 3ABUA 3TW6A 1AKHA 2KL4A 4BJTA 1I6XA 3L9FA 1SFXA 1RNLA 1O57A 1ZTRA 3AFHA 4BE0A 3E6DA 1MBHA 1FBQA 1XGSA 3C2BA 3JCUC 1WJBA 4HYEA 4C3JJ 2Y31A 2JA5J 2YU9J 3TW7A 3IHUA 1W36C 1V3FA 1WKMA 2GWRA 2NXNB 1DP7P 3MKYB 1MSFC 2DA3A 2DA5A 4XORA 3RCOA 3E6BA 4KIFA 1NK2P 2R7XA 2LBFA 2M4GA 2YS9A 1O7LA 2EFNA 2ZXJA 1QRYA 5JLXA 4P9UA 4KIGA 2OC6A 1IRZA 2BBYA 1X58A 1FZPB 3TP0A 3Q0VA 1I50J 5IOZA 4Y17A 3V7CA 3IH2A 1VQLI 3FMRA 3ZQ7A 1DGRM 4HNVA 1JT6A 3AKZA 1WJAA 5IYDJ 2CQXA 4L0YB 1L0OC 3K4JA 3HSFA 2A68F 2HXOA 4J00A 4RA2A 1ONVA 3C2GA 2EIJH 4FX0A 1W36D 2X85A 2EILH 3HOSA 2K27A 3JW4A 4M9SA 1RIOH 3OYMA 2HOSA 4PJNA 1Y8RB 1ETVA 1A35A 2H1LA 4EM1A 1KQ9A 2ZO4A 4MHGA 3GFIA 1VQ4I 3P9KA 4I98B 4XQFA 1SAXA 3A0HC 3BCAA 3E6MA 2HQAA 1EKEA 1Q1VA 2JWTA 1HSJA 1OQYA 3HYIA 4IQJA 3S15J 4Y13A 1R6RA 1N78A 4DGWB 3CCSI 5HNHA 1FYLA 2C6YA 4G7OF 2VL8A 2ZMEB 4KUMA 4LB6B 3QYFA 4HF0A 1BW5A 5E3MA 1OLTA 1SVOA 4GRIA 3GLLA 3COAC 2IGKA 2HZTA 3GFJA 2EB7A 1TC3C 1K6OA 3MKLA 1NG7A 4C2TA 4DZJA 3DPTA 4QTRA 4HF1A 3OYGA 1OISA 2YSRA 5E20A 4JX4A 3FXRA 2DDBA 2O3FA 3LSGA 4D1QA 3WTSC 4ESFA 1P4AA 2L7MP 1LDDA 5FKMA 3CF2A 3SJMA 2XF5A 3V8LA 2EZKA 2OJED 5J1RA 2VLAA 1O3SA 2DMPA 3PSFA 4LLGF 3A01A 2O8KA 2LOOA 4LD5A 1ZRDA 1VQNI 1S5LC 1P7JA 3F3XA 3PUFA 1MBEA 5E1ZB 4AIKA 4H0EA 2R7TA 5B66C 4KISA 3Q0WA 4UV9A 5LLQA 1BIAA 1X4PA 1TWHJ 1D3YA 2L7ZA 1ON1A 2Y75A 2DOFA 3K2AA 4A12A 1R00A 4HV5A 4A3MJ 3GFMA 5E17F 2VBYA 2EIKH 5ICCA 4KIBA 4N4NB 3KP7A 1LE8A 1VNDA 2F5CA 3SEQA 1HSTA 3ZOBA 3RQ4A 3M8EA 2X48A 5DCFA 3GTOJ 1XX5A 2ECCA 3U1DA 1JJ8C 4LIUA 5BPDA 3E0JB 1HQCA 2DA7A 3H35A 1F36A 3MZYA 3G6EI 2R7VA 4AIHA 4WWCA 1X1BA 1O3QA 2V9PA 2WC2A 3H0GJ 5F08A 2JQ7A 3QODA 1XGOA 1FBSA 4HG2A 3BPXA 2K9QA 3KFWX 3BTLA 2DT7B 1A6IA 3EUHA 3GX4X 1YLFA 2XV4S 4OWRB 4KFCA 2L02A 3HOYJ 2FF4A 4KJZA 4KYWA 5LGUA 3CUOA 2JSCA 2NS7A 1FYMA 4WCGA 4LMYA 3P7NA 2A3SA 2UXNA 2MH2A 3DKXA 1UG2A 1VQPI 2IRFG 4A0YA 3CESA 2X0LA 3D5RC 5FGMA 3I4PA 5HLHA 4E7LA 2L0KA 1QA6A 1YRNA 5IPAA 2OD5A 2STWA 1ACIA 4PZJA 2ZXIA 1SMYF 2R7DA 3KYDB 4V2GA 3I56I 2QZ8A 5CLSA 4XBFA 1FT9A 4BS9A 3GTPJ 3A4CA 4BDYA 1JI8A 2L3DA 4HZFA 4E7ZA 2OZUA 5A2QK 2DW4A 3BTCA 5KHDA 1IXSB 1ZR2A 2PLYA 2NVQJ 4BQOA 2HYFA 3J7AO 4BY7J 1ETKA 4WXCA 4GYGA 4JX5A 1S29A 4AIDA 3S93A 1MNDA 3OYKA 5DEQA 1G3YA 1G3TA 2FXAA 3GZ6A 2Y2ZA 4M73A 1DP3A 2LREA 1ZAOA 2ZXWH 2VE8A 1MIJA 3BR6A 3FXMA 2F5FA 2EZHA 3HZJA 2TDXA 4HAMA 3BTJA 3QWLA 3EUHC 1T39A 2F4MB 3CO7C 4LK1F 3OR1C 5ILUA 3BG6A 3KP2A 1YI2I 1AWCA 1Y39A 3BCBA 1KYWA 2ZNYA 4XLAA 3LA2A 2WAQN 1Y1WJ 3S1MJ 1P2FA 3HOZJ 5E8GA 2L4AA 4HW0A 2DQLA 1LFPA 2DBBA 4Y4RA 1E17A 2O0YA 4YEJA 3BPVA 2EFQA 3S3NA 4XOTA 1W7PB 1GXPA 4OMYA 1TW2A 3NEUA 1YJ9I 4ANJA 3LSIA 2V9VA 2E1MB 2E19A 2AS5F 2FSWA 4YIRX 4JBAA 4DW6A 4RM3A 4B44A 1IW7F 5FD6A 3H0DA 2CU7A 2EBIA 2WY7Q 3BG9A 2KQRA 1T0FA 1E0EA 2FMYA 2NVTJ 2W4SA 3C2HA 4MGRA 3OWTA 2QSFX 3OIQA 1R1UA 1B1BA 2K3FA 2VKVA 1BA5A 4XK4A 1U5TC 2KZGA 3SDBA 2VN2A 1STZA 1ZKGA 2FOWA 2KIFA 2XGDA 3MAJA 5BNGA 1U6GA 3PNTA 2IA2A 3OYHA 2UWMA 2VIXA 3PFYA 1XB4A 2LF8A 4C3IJ 1RZ4A 1ZYRF 1JHHA 3QYBA 2DT5A 1WWXA 3KLOA 2GIVA 2JJ7A 2VOOA 1DGWY 3QAHA 4I01A 3S16J 3FKIJ 2LY9A 1Y0NA 1POGA 1FBUA 4QIWN 5TRDA 2QA4I 2QQ9A 5FJ8J 1XMAA 3WG9A 2HQRA 1YJWI 2DA1A 2HYGD 1XDSA 3H9JA 4ZJZA 3E3VA 3CDIA 1LDJA 1T0FC 2BVMA 2R3SA 2RC4A 3KP3A 4RGRA 1B72B 3FDYA 4CCJA 4I0AA 5CKTA 4UVBA 4PGHA 1JT0A 5M5YJ 1JKQC 2QM3A 4C30A 3PQKA 3FXQA 3GWZA 4M3EA 3ISPA 2VXZA 4IOCF 3CMAI 5J6XA 1HW5A 2KHMA 3K9TA 4IPAA 5LEKA 3PUBA 2DA4A 2RVCA 1D0XA 2FQ4A 5TISC 2HPMA 1U3EM 2RNGA 3LAJA 3ESWB 1OYWA 2CUFA 1LQ1A 1HBXG 1MH3A 2XSDC 1W5TA 4R8HA 4I0BA 1KU9A 2Y0SA 1ZRCA 4CH7A 4KNYA 1FIPA 1R58A 2Z2SB 2QGUA 1VQ8I 2VBZA 3CC7I 5BQTA 4L5JA 4EQQA 2JRMA 4PFPA 3WGGA 2VQGA 2L4MA 2W1OA 3GZNB 3CC2I 4BY1J 5L3DA 3ZQGA 1USTA 2EFPA 3CP2A 1MSEC 2HOEA 4ZC3A 4UUVA 3BLYA 4MNUA 2HNHA 3J81Z 1BL0A 2QQAA 1X1DA 4CGZA 1QGPA 2PMZN 3A1YA 2PJRA 2K02A 4YIIA 2E2HJ 4RAZA 2H8WA 5FROA 2MD0A 2QEXI 2OTJI 4ENJA 3BT9A 1SFUA 3OS0A 4A0ZA 2I10A 2Y9YA 5CPRB 5BOXA 1MJAA 2CO5A 3ZN1A 1Z21A 3MVPA 4EV0A 2L7KA 3SDGA 3DEUA 4F3QA 1Q1HA 1NK3P 4UNOA 3S3MA 1W5SA 4LITA 1Z0XA 2B0LA 2L5QA 2LP0A 3C1DA 4IKFA 3SHFA 1UG0A 1IN7A 2BZTA 2NVYJ 4CCLA 3ZQFA 4E7IA 1U2WA 4IO9F 1R1VA 3ZQLA 3BDDA 4KT5C 3UKGA 5KNLA 2DFIA 2LC2A 4B3AA 2ETHA 2R93J 2M2EA 5GPCA 1Z7UA 4AU7A 4M71A 4EM0B 3GTGJ 2M9HA 1TBXA 3I59B 4L9TA 1JKPC 4YFKF 2E5ZA 5DCMA 4OU0A 1FY7A 2P7VB 3L2CA 2B9SA 5F04A 2HXIA 1W5CC 2X6WA 3LA7A 3JAMZ 2IPQX 3WE2A 1I27A 3NARA 3J7ZI 3DTIA 3JSOA 1ZG1A 1A5JA 1BC8C 2M45A 1Z9CA 5H20A 3JSPA 1I5ZA 5JFRA 2VXDA 4AYBA 1RETA 1W1WE 3VFZA 1SC7A 4PJLA 1IJWC 3O2PE 1IF1A 3CCVI 3GVAA 1FSEA 1Z1DA 5DS9A 3FHNA 3PNVA 1UAAA 1HW1A 4EMSA 2Z33A 2CH0A 1X4OA 1YX3A 2K40A 2EWNA 2R7ZJ 5J8FA 4XN0A 1LNWA 4WXHA 3OOUA 4FISA 1MBJA 5M5WJ 3HM5A 2GBYA 5IT9K 4ENKA 2XKOA 3GXOA 1Z3XA 3NAUA 5LHIA 1SD5A 2EJRA 2KMUA 4XLFA 2DJIA 1GVDA 2HI3A 4AUXA 2G9WA 3M8FA 5GPAA 2CUJA 3HJEA 3F72A 2LMDA 1LPQA 3VWBA 2QBYB 5FLMJ 1LVKA 2Z1DA 3L1PA 4CUGA 1IN6A 1M1EB 3EETA 4ETSA 1IN5A 3CCRI 2QLZA 4RB0A 5JHUA 2YUSA 3Q9SA 2MD5A 1BR4A 4KN4X 3HKZN 4EATA 4LG0A 3CDHA 1MDMB 2FBIA 2FNAA 2GQQA 3LL7A 2VC0A 4CHUA 1X2NA 2ELJA 3LMMA 2NVUB 3DWLE 5IP7J 5DUIA 2XAGA 3GCMA 5D4SA 2XGXA 1AHDP 4OAZA 2LG4A 1FLIA 5J4YA 1IUFA 1ON2A 2PFBA 4D7NA 2BY2A 5E1XA 1QVTA 4CICA 3KEYA 4IRHA 3HPHA 3OS1A 5JLWA 2ME6A 1XS9A 1VQ6I 1TWGJ 3GEZA 2DO7A 4L9NA 1WSUA 3MMYB 2NYXA 4BAYA 1CQTA 2W82A 3FK7A 4A6DA 5K5RA 4E7HA 1FOYA 2HDDA 3FM5A 5CVRA 2W48A 3W2WA 2JVHA 3ABKH 2R5ZA 3ZR8X 1EH7A 5F1JA 5DD4A 4C3HJ 1VQMI 3H9QA 2QVOA 3GF2A 1IV6A 1B6AA 3MFKA 2LNBA 4L5IA 3EUAA 3RTRA 1HW2A 2GIZA 1MJBA 4E7KA 3CMMA 4A3BJ 2ZB9A 4CSWA 3F23A 3EPZA 3EYYA 1I39A 4RBOA 4ENMA 1R5GA 4G6DA 1K83J 2WV1A 3VDXA 2XGEA 3C18A 4FQGA 1LFBA 4UB6C 5F0HA 4UVAA 5EEAA 1QU3A 1ZQ3P 3V8JA 3QPLA 1E3OC 5LEJA 2EIMH 2HPIA 2E60A 4CA0A 2MLKA 2OTLI 5EZGA 1RC9A 5EGOA 1R4NB 4W1UA 5FKLA 2KFDA 3EDPA 1FP2A 2MH9A 5FKKA 4EGYA 1BIBA 1FSHA 3ECOA 2XF6A 3L09A 2HVRA 4YRVA 1R36A 2KRHA 2WY8Q 1RRJA 2DOEA 2OCCH 1TZLA 3W2AA 4HQMA 4MQVA 1YTYA 4GCVA 1IDZA 1KGSA 3IWFA 1TT0A 1L3LA 2L54A 3IH3A 1MMNA 3PJRA 2MC3A 4LB5A 3RKWA 5DYMA 2CFOA 5EDNA 2CV0A 2FJ1A 2VT2A 2JN6A 2JA7J 1D8KA 1S7OA 3DF8A 2K3PA 3G4SI 1YW7A 2V26A 3DLAA 2X1EA 1UMQA 1MBFA 4DOZA 2VQCA 1GUUA 1NH3A 1FTTA 1OYYA 2LH9A 2M1BA 2ISYA 3PL8A 2X4HA 3ZMZA 4C2MJ 4D9JA 2VONA 4NBQA 4N4OB 1FPQA 1BW6A 3OIPA 5CYVA 2AO9A 3CMEI 3S1NJ 5FRNA 3DEEA 3CCEI 3WTZA 2Q0OA 4I6ZA 2OU2A 1JTYA 4D5CA 3DPLC 3KCCA 4RMNA 3V42A 3IKTA 1IUYA 3K4KA 1PP8F 3MQ0A 3BR5A 4CCOA 3NRVA 2L9SA 2LFBA 5LRRA 2VPLA 4X0GA 4PJJA 1OCOH 4AIJA 3CD6I 1HC8A 4XLNF 4ABZA 4UY8I 1CF7B 2XRLA 3TO6A 2OA4A 2COBA 2R0QC 2GLOA 2KJCA 3C3WA 3D0SA 5J1YA 3OYFA 3PSIA 5IT3A 1F4KA 1YQAA 3J81K 3AG4H 1X19A 1Z7LA 3H92A 4L5EA 5IYCJ 1U8BA 4Q5SF 1HKTA 3IL2A 1OCZH 3B6AA 2COMA 1E3HA 1JHFA 3HG9A 4W97A 1TQPA 2EH3A 2JMWA 4UUSA 5F27A 3JRGA 3IC7A 1A36A 2EZIA 3ZMDA 3WTUC 2WB1A 3OY9A 2Z9OA 4XN3A 1UZCA 2V1UA 1AKHB 2FD5A 2DFEA 1B9NA 1TQIA 1SANA 2A69F 2FUG2 4KITB 4ESJA 3LSRA 5F0CA 4PDKA 5HLGA 4OMZA 2RDPA 4C9YA 2LD5A 4RLFA 3HEFA 2XGCA 3OL4A 3P9CA 3FXJA 2ELHA 4B8XA 2LSOA 4HX7A 1SD6A 1YJNI 2PMHA 3I3LA 2E1NA 2KDZA 1FYKA 4HLXA 1JXSA 3KZYA 3VEPA 4ZTJA 4A0XA 1J59A 4LLNA 3LSJA 1BJZA 5HDGA 3RZDJ 4M6VA 4QWQA 4B09A 1IXRC 1VQOI 4KMFA 5FRMA 1RR8C 2MABA 5LRSA 3HGGA 3ABTA 1ETQA 5K7ZA 3IWZA 4UVCA 2ZBKA 3KP5A 4JP0A 4CXFA 3WHBA 3CP8A 2UXXA 1PUFA 2DU9A 5FKOA 3KEQA 2WTEA 4V19K 1D5VA 3JAMK 2ID3A 5CQEA 3BJOA 3KPHA 4LJZF 4KN7X 5C4JJ 1OJLA 1XSVA 4NQWA 1D1BA 3ROUA 3IV5A 2IS4A 1F43A 1Y6IA 2CW8A 4R1HA 1B4AA 4S0HB 5CVIA 2KRCA 3DBLB 2BYVE 2D2WA 3FBNB 3OSFA 2L2OA 2W85A 3W6JB 2CRGA 3F8BA 2Y69H 4XLHA 1BR2A 1G8XA 3KETA 1VI0A 2XB0X 4FCYA 1T2KA 1J0RA 1GHCA 3G1MA 1XSDA 5GAGJ 3OMYA 1MMDA 4MTDA 2GOMA 2F5EA 3HRUA 2DLLA 3QPSA 3H5RA 3GTQJ 3BR3A 2ZMEC 3NWTA 2LR8A 1PDNC 3C7JA 2VASA 1R22A 1WPKA 3RSNA 4BE2A 2DYSH 2RN7A 1C0WA 4A3CJ 1LUJB 2XAQA 4BXFA 2D1VA 1NTCA 2E1CA 2H6BA 1RUOA 1S72I 1HKQA 3MWMA 4B3XA 4BBSJ 2IGMA 2CUEA 5AIQA 3N05A 3HOXJ 2V7FA 2K5CA 3A2KA 2ZNZA 3OYDA 2M0CA 3CMYA 2A6TA 2OUMA 2PG4A 3ASOH 2FQ3A 2KDOA 1TNSA 3DP7A 4NC7A 4O6JA 3LWFA 1A31A 4GDFA 2XRNA 1D8JA 3S2DJ 3ZRGA 4AM3A 4EJWA 3M9AA 1YX5A 2KIQA 2R7SA 2H6CA 4DIQA 4IHVA 1FIAA 1KONA 3M8JA 2H1KA 3MZHA 3RPQA 4UB8C 1WJCA 3G3ZA 3E5UA 5D8KB 1TWFJ 4DZPA 3A01B 1T95A 3GUDA 1ZR4A 1XC5A 2Y0SN 3MEXA 4XRMA 2XPWA 1R23A 1WFXA 4BBRJ 1GV5A 2V1NA 3D5SC 4OIQF 1DUXC 3RKYA 2IS1A 2L9VA 1XMXA 2DK8A 1USSA 1VFCA 1V54H 3V4GA 1G6NA 4IVNA 4IOAF 1GXQA 4BNCA 1EF4A 3CF5F 5FFXA 4ZYEA 4HEA2 4U87A 4HSTA 4XLPF 3WGIA 2FEZA 3QP5A 1QZYA 3HUGB 4ZDOA 3CDLA 4LFUA 3L2WA 5LD2C 1O3RA 1R71A 4XMYA 1LB2A 1QBJA 4A3IJ 1G3SA 2A5YB 4HA8A 5AIPA 2XASA 2EZLA 3PIPF 1MW7A 1V5EA 2DDAA 2LKSA 1WI3A 3OV8A 5BPIA 2O61A 1MKMA 2Q8KA 2V79A 5C44J 2I8DA 3OYCA 3BR2A 5J1UA 4ZTFA 3H36A 3WU2C 4FTHA 2IJLA 1PYVA 1WHUA 3A03A 2RQQA 3QU3A 1IO2A 4G12A 4NDLA 2NAZA 5L3FA 2M87A 2Y9ZA 4QSHA 2HQ5A 3K6GA 3TOAA 1U5TA 1YOVB 2E7WA 3P5JA 4K2EA 3HHGA 1YS6A 1RI7A 4MLOA 1IN4A 2Z5UA 3TBIA 2Z16A 4M9XA 2QWWA 3TKYA 4BHCA 2ESNA 5J3LA 2HVSA 2KLOA 5EYRA 1R5ID 3S2HJ 2BW3A 2X1DA 1DU6A 1K4SA 5LGTA 1K4TA 1R1TA 5E3NA 1OPCA 1BOBA 5HVQC 3WTWC 2EFOA 3U21A 4NC6A 3FX3A 4BHBA 5HDKA 3HHHA 1W4MA 3ZQIA 2K9LA 2VI6A 5F1RA 3HOVJ 4HSRA 3DBHB 3I4NJ 1JGSA 2V4JC 4BUPA 3I9V2 1XGNA 3F8MA 2UUZA 5E1WA 2XC7A 3G2BA 2BHZA 3GFLA 2YU3A 4ZYDA 2P7CB 3HOWJ 2BY1A 4A93J 1JTXA 3IAM2 3LFUA 4G8XA 5L3GA 1O7FA 1ZARA 3RI4A 1LDKB 2X6YA 3BR1A 1WVRA 2R7OA 2OF7A 2KIMA 2R4GA 5CQGA 1ZLJA 2XIGA 1XMKA 3H5AA 4A2UA 4WF2A 2CG4A 2HQNA 2JRTA 2KT0A 3LQRA 3ZXSA 5EG0A 1ODDA 5D5XB 1B59A 2XAUA 2FNPA 1X1CA 3DEWA 2LKXA 3E5XA 1UFMA 1JUMA 3LFKA 4MFEA 3I58A 2E1MC 1WJDA 2QKMB 2LYCA 1YS7A 4XKWA 3J7YJ 2RREA 3OL3A 4GFBA 4I02A 4M3DA 5HNFA 2ID6A 1S7AA 2Q2EA 3E5QA 4XLEA 1F1ZA 4M3GA 2VC1A 4N9IA 4NB5A 4F7ZA 2WA0A 4HX8A 3ULQB 1D1AA 3VYRB 4HQEA 3F8NA 5ICFA 5LGNA 3GYHX 3U9GA 1QZZA 4OOIA 1BN5A 1T8IA 3IKVA 3TQNA 1SD7A 5GP9A 3ABMH 3JRCA 3AL0B 1WJ5A 1YFHA 2M34A 1JUPA 3CCUI 1ZRFA 4JQFA 1Z77A 2QSGX 4N9HA 1N25A 4GO1A 1Z91A 4CCKA 2VQLA 2V6EA 1DPUA 1OCTC 1I3AA 3CJTB 4A3LJ 1YW9A 3DTEA 5GTHC 3WODF 5H6QA 2GM4A 3WTTC 3CZ6A 1MMSA 4AVZA 4CZCA 3RIRA 2G7UA 4A3KJ 3K0LA 2EV5A 4ZH4F 4HRIA 2QF7A 5CVJA 2R5YB 2VUMJ 3Q0UA 2PJPA 2OAZA 2XSJC 5B1BH 3S2WA 3IUOA 5IY5H 2HTSA 2DPUA 2ZJQF 2X1CA 1UHSA 2B7EA 5HLIA 3E1SA 4XRSG 2ELKA 3JTHA 2FA5A 4DBRA 2IEKA 3KZZA 5F6FA 2OCEA 2ADUA 3TEDA 1WCMJ 3TMOA 1H9GA 1Z3YA 4TV7A 3V7SA 1KZHA 2HR3A 4OAYA 3HC7A 1MBGA 1RPWA 3HPGA 1YYVA 4BU2A 4ZDLA 2K9MA 1HOMA 3R61A 5HDNA 2LF7A 3FIWA 2XPVA 2F4OB 4EM2A 2DA6A 4PFOA 3A02A 4KT6A 1WGXA 2VKEA 3CQZJ 3QU6A 2DMUA 2CW7A 5L3BA 4D0PA 3WHCA 1V5GA 4Y33A 5HLTA 3H3VK 4M9ZA 3NQOA 2M4KA 4A3FJ 1QQIA 1MNMC 1ENHA 3QQAA 1SFKA 3I59A 5DTDA 2XAHA 4O3MA 3HOUJ 3RDIA 1FNNA 3M07A 1DU0A 1I3QJ 4II3A 1KQ0A 3UR3C 4U88A 5EZHA 4CCMA 3SZGA 3VSKA 3REOA 2E71A 1ETOA 1UHWA 2IW5A 3L00A 2DA2A 1HDPA 1Z6RA 4D7MA 1ZN2A 4J19A 2HFHA 1S6LA 2W84A 2MGQA 1V5FA 1ZGJA 2LVSA 2QKLB 4RB2C 1P7IA 3OOPA 2KKOA 4I99C 2ISZA 2NS0A 1ZELA 3EYIA 3IRRA 4Q48A 5D5WB 2DFFA 3FF5A 2JPCA 5CVUA 3O6BB 2FBKA 3RPUA 5D5VB 3ZQHA 3CCJI 5D4RA 5JR3A 3KX2A 4E7JA 2QUFA 4F91B 2KPMA 4EJTA 2XDVA 3ONQA 1YHQI 2WAQA 2WADA 5K5QA 1PUEE 3FXOA 2VJJA 5HS8A 2OBPA 3JRBA 4L9JA 1JE8A 1KU2A 4HPQA 1JKOC 1MGTA 1XPXA 2E36A 2XKPA 2ESHA 4PJ0C 4U7DA 1FOKA 1LVAA 1ULYA 2V1XA 1WJFA 4MEYF 1F9NA 3ABLH 1UELB 2MLGA 2HZDA 3FKJA 1LKXA 1IN8A 2HU9A 1B8IB 1FP1D 3M4OJ 1EA3A 4XKVA 2H94A 5KAIC 3QOEA 4HDVA 1YO5C 2YX4A 1MZBA 4XKCA 3WTXC 4HOBA 3ZN0A 4IRGA 3FZVA 3RZOJ 5M3FJ 2KRFA 1SFEA 3R0AA 4BQAA 1HA8A 2M8EA 4BEHA 1CGPA 3PIOF 3P9IA 1T38A 5KK1A 1IG7A 2NRAC 4M74A 2EQRA 2IGNA 2R7FA 1T56A 2P0WA 3GW2A 1IDYA 2F6CA 4HNUA 3G73A 2L01A 3DXJF 3L2VA 1YIJI 1AA7A 2DODA 4MFDA 1QNTA 2XF7A 4X1EA 1I1SA 1LFUP 4CYCA 2D1HA 2IA0A 1K78B 1O4XA 1KU7A 3HRMA 2OZ6A 3GZ5A 2HGCA 1XCVA 3SXYA 2ME0A 3X2QH 2F5VA 2EPFA 2XVCA 2FRHA 2N8GA 1FC3A 2RV8A 3CUQA 4J01A 4UUTA 3RPUD 3L7WA 4AVPA 5J40A 2MSYA 4LK0F 4IHTA 3WE3A 4LG0B 5DM7F 2GXAA 1MH4A 4F52A 3FBIB 4P55A 3TO9A 1D0ZA 1A04A 3CLOA 4UXNA 1VQ7I 1P9QC 2OPTA 2GOXB 3DTKA 2QYOA 1J5YA 1SD4A 1RKTA 4G9YA 4RGXA 4NHJA 1G3WA 3AG2H 1XDUA 1FTZA 4D5FA 1D1CA 1VZ0A 3K4LA 2LDUA 3O3KA 2XHKA 1BI1A 1TP4A 4E7SA 1OCRH 2DXIA 2BVLA 1XSXA 2EINH 3KIOA 3HRSA 2X9DA 2F2EA 2R5ZB 1YITI 2HEOA 2MYSA 1AU7A 2PBIA 1X3WB 4HBLA 3CCQI 3OSGA 4ZYGA 2XAJA 2EV0A 2K4JA 4OIOF 1JKRC 2KZVA 5HODA 2J5PA 3CUQC 3Q5FA 2P5KA 5J8CA 2HYJA 4PUSA 3RQIA 1Z05A 4IJAA 5E3LA 5ICGA 4N0BA 2RNJA 1HDDC 4A3GJ 3K4NA 2O7OA 2M7BA 4F55A 3LNQA 2DPDA 1U9NA 2A5WA 3TGNA 4CCNA 3S17J 2P4WA 4BH9A 1YG2A 3VB2A 4RAGA 2OQGA 1GDTA 4A69C 5EGOB 1WH5A 5J4VA 3PO3J 2HS5A 3VSLA 3QPHA
chains in the Genus database with same CATH topology
1YW8A 2JT1A 1TLHB 5E18F 1SMTA 1Z6TA 1CF7A 1U78A 4O5VA 3I0TA 3HRTA 1H0MA 4EJVA 3QP6A 4RAYA 3V8KA 4EVIA 1UCRA 3SFZA 1IXCA 2YX7A 5FLXZ 2HDCA 2GZWA 1O3TA 3WU1B 2IT0A 1V4RA 1HKSA 2CW0F 1OMIA 2DTRA 3FM3A 5HS7A 2O6GE 1KYZA 2PN6A 3E6CC 3KEOA 4DNCA 3CJNA 2A61A 3AAFA 5D6FA 4G6QA 2Y48A 4R79A 1BBYA 1TNTA 4CO8A 3HIFA 3GO5A 4CDGA 5H6RA 2ZCWA 2BGCA 2FU4A 4U7BA 1J7KA 2A6EF 2ZMEA 4AD9A 4KYWA 3KLNA 3ZP5A 4A6EA 2BEOA 2HKXA 2O03A 1QPMA 4XSZF 1IRFA 5D8LB 6PAXA 1OYIA 3HTUA 3B73A 3EQLF 3R0JA 1I1GA 4ZZLA 1TTYA 3T0YA 3HTSB 2VODA 4S05A 3TDUC 1EV7A 1ZG3A 2G7HA 2VOPA 2WV0A 3LA3A 3ZPLA 2FMLA 2H27A 3DKWA 4P5OA 5LHGA 2CFXA 3PFIA 4EGZA 4AWXB 1LEBA 4HX4A 1T98A 4IRIA 2FOKA 3DFGA 4YG2F 2EFWA 4EJOA 5FO5A 4G7ZF 2CWEA 1P4XA 1WRJA 2PMUA 3IRQA 4MEXF 2O8XA 3VOEA 5L3CA 3K1PA 1LEAA 4E70A 2CYYA 5AONA 2DI3A 4WK8F 5DD8A 4I2OA 5K5OA 1AOYA 4XRFA 1WI9A 2BE5F 2Z3YA 3RKXA 2EV6A 3I53A 5ILSA 2KJBA 3QOPA 4Q4ZF 4U0WA 2EA2A 4IHSA 3K1MA 2F5DA 4A5NA 4LGWA 2IA1A 3B02A 4ZYHA 3HUGA 4KMUX 3ZMTA 3Q9VA 5LHHA 3DV8A 2PQ8A 3J80Z 1FWZA 2JZYA 3GLXA 1P6RA 5BS6A 1BOAA 5BMZA 2A07F 1ZH5A 1ZHFA 5HOOA 3ZMUA 2V6CA 1Y0UA 1IRGA 4IF4A 3SQNA 1XCBA 1HXDA 2GXBA 5DDGA 1MJ9A 4OIPF 4BXUA 4I7HA 3ZMVA 2HKOA 2P6TA 1UHMA 1ZGAA 3F8FA 4OINF 5IT9Z 4YFXF 5TJJA 4HF2A 2P6SA 1W7PA 5JVTA 3KP4A 3K1NA 1S8NA 2CQKA 1KU3A 3KE2A 3TDZC 3H3UA 2CSOA 2BV6A 3I64A 3HOTA 4YIFA 2IP2A 3CO6C 3T8RA 1K79A 5D6EA 3TOBA 4FHTA 4I09A 1P4WA 5FD5A 2W24A 3T8TA 3TO7A 2GXGA 1H9TA 4CYDA 2XROA 3ZMSA 5D5UB 4OIRF 5JI6A 1U5TB 3I54A 1J75A 3D5LA 2RQPA 4PGGA 5LBQA 4CZZA 2K86A 4HV6A 1E2XA 5FLXK 3RYRA 2STTA 3BY6A 2H09A 4WXDA 4RB3C 1QO0D 3T1BA 1F5TA 5EEHA 4G7HF 1BC7C 4RB1A 3ELKA 4U0VA 4M6YA 1KQ8A 4Y15A 1BJAA 1NHAA 2EK5A 3H3ZA 1G4DA 3ECHA 1WQ2A 1TQMA 1XGMA 2HTJA 4MTEA 1W7PD 3BWGA 5KVRA 2K7LA 1DPRA 1RUNA 2DQRA 3F6VA 4BHPA 4WX9A 2XUBA 4QLCU 3SZTA 5FFZA 1ZG5A 2EA4A 1MD0A 1BI2A 3QRFF 3W6KB 4L0ZB 1OR7A 3PQJA 3QPTA 1K7AA 3RJPA 1IZ1A 2DK5A 2YPRA 1J9IA 1PP7U 5L3EA 2Y0MA 4M6XA 4LLLA 1VTNC 5HS9A 3WU0A 3BOQA 5ERIA 3WGHA 3ML6A 3WTVC 3M7GA 1P92A 3V7RA 4EJUA 3I71A 1IAWA 2P5LC 5DV5A 4IXAA 5K1YA 2K4BA 2RGVA 4Q47A 4S04A 3I5UA 3FMSA 3WTYC 4ON0A 2VE9A 4L9VA 1TW3A 1DDNA 4JK1X 4HLYA 1XD7A 3BZ6A 2JPBA 1S3JA 2MA3A 2FE3A 2A6HF 3K2ZA 1REPC 3J80K 1U8RA 4U0YA 1X3UA 3LAPA 3F21A 2PEXA 2W25A 5DUKA 1BI3A 3T5XA 5ICEA 2KIUA 3SZPA 4ENNA 5CVVA 2RKHA 2GA2A 4Z2YA 1B9MA 2QBYA 1LJ9A 4P96A 4GXOA 2P8TA 4KICA 5DCMB 2UZKA 3F8CA 1R5HA 3N4MA 5F64A 1MDMA 3FXUA 3LSTA 1XN7A 3BROA 3K69A 1UB9A 2GAUA 1YIOA 5FB2A 2QENA 2NNNA 1EH6A 3DQVC 4BYYA 4GYIA 4ASNA 2ZFWA 5ILVA 1K78A 2NNYA 5ED4A 4A5MA 2MBFA 3RYPA 3FMQA 2Z99A 4M72A 5CJ9A 3E97A 2OQRA 4RGSA 1ZREA 3ERED 2CGPA 4FX4A 2VBWA 2ZJ2A 3R4KA 3BJAA 3FWEA 4FT8A 2J5OA 5EEGA 4UHTA 1BM9A 2JTVA 2V1DA 2AXLA 5E8IA 2GA1A 1GVJA 2M30A 4ZZDA 1EH8A 2DAOA 1BI0A 3BJ6A 4DQ2A 4RS8A 4KDPA 3MCZA 2VT3A 4YFNF 2P5VA 3N97A 3HSEA 4GGGA 1T6SA 3CUQB 3LQQA 1R7JA 4HDUA 3KP6A 3F6OA 2WWYA 2ACJA 3CTAA 2XAFA 2QQBA 5A2QZ 2M5WA 3R6SA 1ZLKA 2YR2A 4G94A 4UV8A 2IVMA 3U2RA 4PCQA 2HWVA 2LKPA 3FHZA 4XSXF 2FBHA 4P9FA 3JTGA 4L18B 3HSRA 2W57A 4RGUA 4MQ9F 3M1EA 2E7XA 4ESBA 1KA8A 3VODA 1J2XA 3BP8A 3R60A 2PI0A 2D45A 2VBXA 3F22A 4KA4A 1OKRA 1FX7A 2ZKZA 3ABUA 1I6XA 3L9FA 1SFXA 1RNLA 1O57A 3E6DA 1FBQA 1XGSA 4HYEA 3IHUA 1V3FA 1WKMA 2GWRA 1DP7P 3E6BA 4KIFA 1O7LA 2EFNA 2ZXJA 4P9UA 4KIGA 2BBYA 1FZPB 4Y17A 3V7CA 3FMRA 3ZQ7A 4L0YB 1L0OC 3HSFA 2A68F 1ONVA 4FX0A 3HOSA 2K27A 3JW4A 4M9SA 1RIOH 4EM1A 1KQ9A 2ZO4A 4MHGA 3GFIA 3P9KA 4I98B 1SAXA 3E6MA 1HSJA 3HYIA 4Y13A 1FYLA 2C6YA 4G7OF 2ZMEB 4KUMA 4LB6B 4HF0A 3COAC 2HZTA 3GFJA 2EB7A 1K6OA 3DPTA 4HF1A 2YSRA 5E20A 3FXRA 2O3FA 3WTSC 4ESFA 1P4AA 1LDDA 3V8LA 1O3SA 4LLGF 4LD5A 1ZRDA 3F3XA 5E1ZB 4AIKA 4H0EA 4UV9A 5LLQA 1BIAA 1D3YA 1ON1A 2Y75A 4A12A 1R00A 4HV5A 3GFMA 5E17F 2VBYA 5ICCA 4KIBA 3KP7A 2F5CA 1HSTA 3M8EA 5DCFA 3U1DA 5BPDA 1HQCA 3MZYA 4AIHA 4WWCA 1O3QA 2WC2A 1XGOA 1FBSA 3BPXA 3KFWX 3EUHA 3GX4X 1YLFA 2XV4S 4KFCA 2L02A 2FF4A 5LGUA 3CUOA 2JSCA 1FYMA 4WCGA 4LMYA 3P7NA 2A3SA 2UXNA 2MH2A 2IRFG 4A0YA 5FGMA 2X0LA 3I4PA 5HLHA 2OD5A 2STWA 4PZJA 1SMYF 2R7DA 2QZ8A 5CLSA 4XBFA 1FT9A 2L3DA 4HZFA 2OZUA 5A2QK 2DW4A 1IXSB 2PLYA 2HYFA 3J7AO 4WXCA 4GYGA 1S29A 5DEQA 1G3YA 1G3TA 3GZ6A 2FXAA 4M73A 1ZAOA 2VE8A 2F5FA 4HAMA 2TDXA 1T39A 3CO7C 4LK1F 5ILUA 3KP2A 1AWCA 1KYWA 2ZNYA 3LA2A 1P2FA 5E8GA 2L4AA 4HW0A 2DQLA 2DBBA 1E17A 2O0YA 3BPVA 2EFQA 1GXPA 1W7PB 4OMYA 1TW2A 3NEUA 2V9VA 2AS5F 2FSWA 4JBAA 1IW7F 5FD6A 1T0FA 2FMYA 4MGRA 1R1UA 1B1BA 1U5TC 2VN2A 1STZA 2KIFA 3MAJA 1U6GA 2IA2A 2UWMA 1XB4A 2LF8A 1RZ4A 1ZYRF 1JHHA 2DT5A 1WWXA 3KLOA 2GIVA 2VOOA 4I01A 3QAHA 1FBUA 5TRDA 2QQ9A 1XMAA 3WG9A 2HQRA 2HYGD 1XDSA 3E3VA 1LDJA 2R3SA 2RC4A 3KP3A 4RGRA 4I0AA 4UVBA 4PGHA 2QM3A 3PQKA 3FXQA 3GWZA 3ISPA 2VXZA 5J6XA 1HW5A 3K9TA 4IPAA 5LEKA 2RVCA 1U3EM 3LAJA 1OYWA 1LQ1A 1HBXG 1W5TA 4R8HA 4I0BA 1KU9A 1ZRCA 4KNYA 1R58A 2VBZA 5BQTA 4L5JA 4EQQA 3WGGA 2L4MA 5L3DA 1USTA 2EFPA 2HOEA 4UUVA 4MNUA 3J81Z 2QQAA 4CGZA 1QGPA 2K02A 4YIIA 4RAZA 4ENJA 1SFUA 4A0ZA 5BOXA 1MJAA 2CO5A 3ZN1A 4EV0A 3DEUA 1Q1HA 4UNOA 1W5SA 2B0LA 3C1DA 3SHFA 1IN7A 1U2WA 1R1VA 3BDDA 4KT5C 2DFIA 2ETHA 1Z7UA 4M71A 4EM0B 1TBXA 3I59B 4L9TA 4YFKF 5DCMA 4OU0A 1FY7A 2P7VB 3L2CA 3LA7A 3JAMZ 2IPQX 3WE2A 1I27A 3JSOA 1ZG1A 1BC8C 2M45A 1Z9CA 5H20A 3JSPA 1I5ZA 5JFRA 3VFZA 3O2PE 1IF1A 3GVAA 1FSEA 1Z1DA 1HW1A 4EMSA 2Z33A 2EWNA 5J8FA 1LNWA 4WXHA 5IT9K 4ENKA 2XKOA 3GXOA 5LHIA 1SD5A 2EJRA 2G9WA 3M8FA 3F72A 2QBYB 1IN6A 3EETA 4ETSA 1IN5A 2QLZA 4RB0A 5JHUA 3Q9SA 2MD5A 4KN4X 4LG0A 3CDHA 1MDMB 2FBIA 2FNAA 2GQQA 2VC0A 4CHUA 5DUIA 2XAGA 5D4SA 2XGXA 1FLIA 1ON2A 2PFBA 5E1XA 4CICA 4IRHA 3GEZA 2DO7A 4L9NA 1WSUA 2NYXA 4BAYA 4A6DA 5K5RA 3FM5A 5CVRA 1EH7A 5DD4A 2QVOA 3GF2A 1B6AA 3MFKA 2LNBA 4L5IA 3RTRA 1HW2A 1MJBA 3F23A 3EYYA 4ENMA 1R5GA 4G6DA 3C18A 4UVAA 3V8JA 5LEJA 2MLKA 3EDPA 1FP2A 2MH9A 4EGYA 1BIBA 1FSHA 3ECOA 3L09A 1R36A 4HQMA 4MQVA 1YTYA 4GCVA 1KGSA 3IWFA 1L3LA 2L54A 2MC3A 4LB5A 3RKWA 5DYMA 2VT2A 1D8KA 1S7OA 3DF8A 1YW7A 1OYYA 2M1BA 2ISYA 2X4HA 3ZMZA 2VONA 1FPQA 5CYVA 3WTZA 2Q0OA 2OU2A 3DPLC 3KCCA 3IKTA 1IUYA 1PP8F 3MQ0A 3NRVA 5LRRA 4AIJA 4XLNF 1CF7B 3TO6A 2OA4A 2KJCA 3C3WA 3D0SA 5IT3A 1F4KA 1YQAA 3J81K 3H92A 1HKTA 4Q5SF 3IL2A 2COMA 1JHFA 1TQPA 3IC7A 3ZMDA 3WTUC 2Z9OA 2V1UA 1B9NA 1TQIA 2A69F 4ESJA 4PDKA 5HLGA 4OMZA 2RDPA 3P9CA 2ELHA 4B8XA 2LSOA 4HX7A 1SD6A 2PMHA 2E1NA 1FYKA 4HLXA 1JXSA 3KZYA 3VEPA 4A0XA 1J59A 4LLNA 5HDGA 4QWQA 4B09A 1IXRC 4KMFA 5LRSA 3ABTA 3IWZA 4UVCA 2ZBKA 3KP5A 4CXFA 2UXXA 2DU9A 3KEQA 2WTEA 1D5VA 3JAMK 3BJOA 4LJZF 4KN7X 1XSVA 4NQWA 3ROUA 4R1HA 1B4AA 5CVIA 2BYVE 2D2WA 2W85A 3W6JB 3F8BA 3KETA 1T2KA 1J0RA 1GHCA 1XSDA 4MTDA 2F5EA 3HRUA 2DLLA 1PDNC 3C7JA 1R22A 2RN7A 1C0WA 2XAQA 2D1VA 2E1CA 2H6BA 1RUOA 1HKQA 3MWMA 5AIQA 2ZNZA 2PG4A 2FQ3A 1TNSA 3DP7A 4O6JA 3LWFA 2XRNA 1D8JA 4EJWA 3M9AA 2H6CA 3MZHA 3RPQA 3G3ZA 3E5UA 5D8KB 3GUDA 3MEXA 1R23A 4OIQF 1DUXC 3RKYA 2DK8A 1USSA 3V4GA 1G6NA 4IVNA 1GXQA 4BNCA 5FFXA 4ZYEA 4XLPF 3WGIA 2FEZA 3QP5A 1QZYA 4LFUA 1O3RA 1LB2A 1QBJA 1G3SA 2A5YB 4HA8A 5AIPA 2XASA 3OV8A 5BPIA 2O61A 1MKMA 2Q8KA 2V79A 2IJLA 3QU3A 2NAZA 5L3FA 2M87A 3TOAA 1U5TA 2E7WA 4K2EA 3HHGA 1YS6A 1RI7A 1IN4A 2Z5UA 4BHCA 4M9XA 2QWWA 3TKYA 2ESNA 5LGTA 1R1TA 1OPCA 3WTWC 5HVQC 2EFOA 3FX3A 4BHBA 5HDKA 3HHHA 1W4MA 5F1RA 1JGSA 1XGNA 3F8MA 5E1WA 3GFLA 2YU3A 4ZYDA 2P7CB 4G8XA 5L3GA 1O7FA 1ZARA 3RI4A 1LDKB 2KIMA 1ZLJA 2XIGA 1XMKA 4A2UA 4WF2A 2CG4A 2HQNA 2JRTA 3LQRA 1ODDA 5D5XB 1B59A 2FNPA 3E5XA 1UFMA 3LFKA 3I58A 1YS7A 4I02A 1S7AA 2Q2EA 3E5QA 1F1ZA 2VC1A 4N9IA 4NB5A 4F7ZA 4HX8A 3ULQB 4HQEA 3F8NA 5ICFA 5LGNA 3GYHX 3U9GA 1QZZA 4OOIA 1BN5A 3IKVA 3TQNA 1SD7A 1YFHA 1ZRFA 4JQFA 4N9HA 4GO1A 1Z91A 1DPUA 1YW9A 3WODF 5H6QA 3WTTC 3RIRA 2G7UA 3K0LA 2EV5A 4ZH4F 5CVJA 2PJPA 2OAZA 3S2WA 2HTSA 2DPUA 5HLIA 3JTHA 2FA5A 3KZZA 5F6FA 2ADUA 1H9GA 4TV7A 3V7SA 2HR3A 1YYVA 3R61A 5HDNA 2LF7A 4EM2A 3QU6A 5L3BA 4D0PA 4M9ZA 3NQOA 1QQIA 3I59A 2XAHA 4O3MA 3RDIA 1FNNA 1KQ0A 4U88A 3REOA 1UHWA 2IW5A 3L00A 1Z6RA 1ZN2A 2HFHA 1S6LA 2W84A 1ZGJA 4RB2C 3OOPA 2KKOA 2ISZA 2NS0A 3EYIA 3IRRA 4Q48A 5D5WB 3FF5A 2JPCA 5CVUA 3O6BB 2FBKA 3RPUA 5D5VB 5D4RA 5JR3A 2QUFA 4EJTA 5K5QA 1PUEE 5HS8A 2OBPA 4L9JA 1JE8A 1KU2A 1MGTA 2XKPA 2ESHA 4U7DA 1FOKA 1LVAA 1ULYA 2V1XA 4MEYF 1F9NA 2MLGA 1IN8A 1FP1D 2H94A 4HDVA 1YO5C 2YX4A 1MZBA 3WTXC 4HOBA 3ZN0A 4IRGA 3FZVA 2KRFA 1SFEA 3R0AA 4BQAA 2M8EA 1CGPA 1T38A 3P9IA 5KK1A 2NRAC 4M74A 2R7FA 3GW2A 3G73A 2L01A 3DXJF 1QNTA 1I1SA 2D1HA 2IA0A 1K78B 1KU7A 3HRMA 2OZ6A 3GZ5A 2HGCA 1XCVA 3SXYA 2XVCA 2FRHA 1FC3A 2RV8A 3CUQA 4AVPA 3L7WA 4LK0F 4IHTA 3WE3A 4LG0B 4P55A 3TO9A 1A04A 3CLOA 4UXNA 2QYOA 1J5YA 1SD4A 4G9YA 4RGXA 4NHJA 1G3WA 1XDUA 2LDUA 3O3KA 2XHKA 1BI1A 1XSXA 3HRSA 2F2EA 2HEOA 2PBIA 4HBLA 4ZYGA 2XAJA 2EV0A 2K4JA 4OIOF 2J5PA 3CUQC 3Q5FA 2P5KA 5J8CA 1Z05A 4IJAA 5ICGA 4N0BA 2RNJA 2DPDA 3TGNA 2P4WA 4BH9A 1YG2A 3VB2A 2OQGA 2HS5A 3QPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW8 A;  2JT1 A;  1TLH B;  5E18 F;  1SMT A;  1Z6T A;  1CF7 A;  1U78 A;  4O5V A;  3I0T A;  3HRT A;  1H0M A;  4EJV A;  3QP6 A;  4RAY A;  3V8K A;  4EVI A;  1UCR A;  3SFZ A;  1IXC A;  2YX7 A;  5FLX Z;  2HDC A;  2GZW A;  1O3T A;  3WU1 B;  2IT0 A;  1V4R A;  1HKS A;  2CW0 F;  1OMI A;  2DTR A;  3FM3 A;  5HS7 A;  2O6G E;  1KYZ A;  2PN6 A;  3E6C C;  3KEO A;  4DNC A;  3CJN A;  2A61 A;  3AAF A;  5D6F A;  4G6Q A;  2Y48 A;  4R79 A;  1BBY A;  1TNT A;  4CO8 A;  3HIF A;  3GO5 A;  4CDG A;  5H6R A;  2ZCW A;  2BGC A;  2FU4 A;  4U7B A;  1J7K A;  2A6E F;  2ZME A;  4AD9 A;  4KYW A;  3KLN A;  3ZP5 A;  4A6E A;  2BEO A;  2HKX A;  2O03 A;  1QPM A;  4XSZ F;  1IRF A;  5D8L B;  6PAX A;  1OYI A;  3HTU A;  3B73 A;  3EQL F;  3R0J A;  1I1G A;  4ZZL A;  1TTY A;  3T0Y A;  3HTS B;  2VOD A;  4S05 A;  3TDU C;  1EV7 A;  1ZG3 A;  2G7H A;  2VOP A;  2WV0 A;  3LA3 A;  3ZPL A;  2FML A;  2H27 A;  3DKW A;  4P5O A;  5LHG A;  2CFX A;  3PFI A;  4EGZ A;  4AWX B;  1LEB A;  4HX4 A;  1T98 A;  4IRI A;  2FOK A;  3DFG A;  4YG2 F;  2EFW A;  4EJO A;  5FO5 A;  4G7Z F;  2CWE A;  1P4X A;  1WRJ A;  2PMU A;  3IRQ A;  4MEX F;  2O8X A;  3VOE A;  5L3C A;  3K1P A;  1LEA A;  4E70 A;  2CYY A;  5AON A;  2DI3 A;  4WK8 F;  5DD8 A;  4I2O A;  5K5O A;  1AOY A;  4XRF A;  1WI9 A;  2BE5 F;  2Z3Y A;  3RKX A;  2EV6 A;  3I53 A;  5ILS A;  2KJB A;  3QOP A;  4Q4Z F;  4U0W A;  2EA2 A;  4IHS A;  3K1M A;  2F5D A;  4A5N A;  4LGW A;  2IA1 A;  3B02 A;  4ZYH A;  3HUG A;  4KMU X;  3ZMT A;  3Q9V A;  5LHH A;  3DV8 A;  2PQ8 A;  3J80 Z;  1FWZ A;  2JZY A;  3GLX A;  1P6R A;  5BS6 A;  1BOA A;  5BMZ A;  2A07 F;  1ZH5 A;  1ZHF A;  5HOO A;  3ZMU A;  2V6C A;  1Y0U A;  1IRG A;  4IF4 A;  3SQN A;  1XCB A;  1HXD A;  2GXB A;  5DDG A;  1MJ9 A;  4OIP F;  4BXU A;  4I7H A;  3ZMV A;  2HKO A;  2P6T A;  1UHM A;  1ZGA A;  3F8F A;  4OIN F;  5IT9 Z;  4YFX F;  5TJJ A;  4HF2 A;  2P6S A;  1W7P A;  5JVT A;  3KP4 A;  3K1N A;  1S8N A;  2CQK A;  1KU3 A;  3KE2 A;  3TDZ C;  3H3U A;  2CSO A;  2BV6 A;  3I64 A;  3HOT A;  4YIF A;  2IP2 A;  3CO6 C;  3T8R A;  1K79 A;  5D6E A;  3TOB A;  4FHT A;  4I09 A;  1P4W A;  5FD5 A;  2W24 A;  3T8T A;  3TO7 A;  2GXG A;  1H9T A;  4CYD A;  2XRO A;  3ZMS A;  5D5U B;  4OIR F;  5JI6 A;  1U5T B;  3I54 A;  1J75 A;  3D5L A;  2RQP A;  4PGG A;  5LBQ A;  4CZZ A;  2K86 A;  4HV6 A;  1E2X A;  5FLX K;  3RYR A;  2STT A;  3BY6 A;  2H09 A;  4WXD A;  4RB3 C;  1QO0 D;  3T1B A;  1F5T A;  5EEH A;  4G7H F;  1BC7 C;  4RB1 A;  3ELK A;  4U0V A;  4M6Y A;  1KQ8 A;  4Y15 A;  1BJA A;  1NHA A;  2EK5 A;  3H3Z A;  1G4D A;  3ECH A;  1WQ2 A;  1TQM A;  1XGM A;  2HTJ A;  4MTE A;  1W7P D;  3BWG A;  5KVR A;  2K7L A;  1DPR A;  1RUN A;  2DQR A;  3F6V A;  4BHP A;  4WX9 A;  2XUB A;  4QLC U;  3SZT A;  5FFZ A;  1ZG5 A;  2EA4 A;  1MD0 A;  1BI2 A;  3QRF F;  3W6K B;  4L0Z B;  1OR7 A;  3PQJ A;  3QPT A;  1K7A A;  3RJP A;  1IZ1 A;  2DK5 A;  2YPR A;  1J9I A;  1PP7 U;  5L3E A;  2Y0M A;  4M6X A;  4LLL A;  1VTN C;  5HS9 A;  3WU0 A;  3BOQ A;  5ERI A;  3WGH A;  3ML6 A;  3WTV C;  3M7G A;  1P92 A;  3V7R A;  4EJU A;  3I71 A;  1IAW A;  2P5L C;  5DV5 A;  4IXA A;  5K1Y A;  2K4B A;  2RGV A;  4Q47 A;  4S04 A;  3I5U A;  3FMS A;  3WTY C;  4ON0 A;  2VE9 A;  4L9V A;  1TW3 A;  1DDN A;  4JK1 X;  4HLY A;  1XD7 A;  3BZ6 A;  2JPB A;  1S3J A;  2MA3 A;  2FE3 A;  2A6H F;  3K2Z A;  1REP C;  3J80 K;  1U8R A;  4U0Y A;  1X3U A;  3LAP A;  3F21 A;  2PEX A;  2W25 A;  5DUK A;  1BI3 A;  3T5X A;  5ICE A;  2KIU A;  3SZP A;  4ENN A;  5CVV A;  2RKH A;  2GA2 A;  4Z2Y A;  1B9M A;  2QBY A;  1LJ9 A;  4P96 A;  4GXO A;  2P8T A;  4KIC A;  5DCM B;  2UZK A;  3F8C A;  1R5H A;  3N4M A;  5F64 A;  1MDM A;  3FXU A;  3LST A;  1XN7 A;  3BRO A;  3K69 A;  1UB9 A;  2GAU A;  1YIO A;  5FB2 A;  2QEN A;  2NNN A;  1EH6 A;  3DQV C;  4BYY A;  4GYI A;  4ASN A;  2ZFW A;  5ILV A;  1K78 A;  2NNY A;  5ED4 A;  4A5M A;  2MBF A;  3RYP A;  3FMQ A;  2Z99 A;  4M72 A;  5CJ9 A;  3E97 A;  2OQR A;  4RGS A;  1ZRE A;  3ERE D;  2CGP A;  4FX4 A;  2VBW A;  2ZJ2 A;  3R4K A;  3BJA A;  3FWE A;  4FT8 A;  2J5O A;  5EEG A;  4UHT A;  1BM9 A;  2JTV A;  2V1D A;  2AXL A;  5E8I A;  2GA1 A;  1GVJ A;  2M30 A;  4ZZD A;  1EH8 A;  2DAO A;  1BI0 A;  3BJ6 A;  4DQ2 A;  4RS8 A;  4KDP A;  3MCZ A;  2VT3 A;  4YFN F;  2P5V A;  3N97 A;  3HSE A;  4GGG A;  1T6S A;  3CUQ B;  3LQQ A;  1R7J A;  4HDU A;  3KP6 A;  3F6O A;  2WWY A;  2ACJ A;  3CTA A;  2XAF A;  2QQB A;  5A2Q Z;  2M5W A;  3R6S A;  1ZLK A;  2YR2 A;  4G94 A;  4UV8 A;  2IVM A;  3U2R A;  4PCQ A;  2HWV A;  2LKP A;  3FHZ A;  4XSX F;  2FBH A;  4P9F A;  3JTG A;  4L18 B;  3HSR A;  2W57 A;  4RGU A;  4MQ9 F;  3M1E A;  2E7X A;  4ESB A;  1KA8 A;  3VOD A;  1J2X A;  3BP8 A;  3R60 A;  2PI0 A;  2D45 A;  2VBX A;  3F22 A;  4KA4 A;  1OKR A;  1FX7 A;  2ZKZ A;  3ABU A;  1I6X A;  3L9F A;  1SFX A;  1RNL A;  1O57 A;  3E6D A;  1FBQ A;  1XGS A;  4HYE A;  3IHU A;  1V3F A;  1WKM A;  2GWR A;  1DP7 P;  3E6B A;  4KIF A;  1O7L A;  2EFN A;  2ZXJ A;  4P9U A;  4KIG A;  2BBY A;  1FZP B;  4Y17 A;  3V7C A;  3FMR A;  3ZQ7 A;  4L0Y B;  1L0O C;  3HSF A;  2A68 F;  1ONV A;  4FX0 A;  3HOS A;  2K27 A;  3JW4 A;  4M9S A;  1RIO H;  4EM1 A;  1KQ9 A;  2ZO4 A;  4MHG A;  3GFI A;  3P9K A;  4I98 B;  1SAX A;  3E6M A;  1HSJ A;  3HYI A;  4Y13 A;  1FYL A;  2C6Y A;  4G7O F;  2ZME B;  4KUM A;  4LB6 B;  4HF0 A;  3COA C;  2HZT A;  3GFJ A;  2EB7 A;  1K6O A;  3DPT A;  4HF1 A;  2YSR A;  5E20 A;  3FXR A;  2O3F A;  3WTS C;  4ESF A;  1P4A A;  1LDD A;  3V8L A;  1O3S A;  4LLG F;  4LD5 A;  1ZRD A;  3F3X A;  5E1Z B;  4AIK A;  4H0E A;  4UV9 A;  5LLQ A;  1BIA A;  1D3Y A;  1ON1 A;  2Y75 A;  4A12 A;  1R00 A;  4HV5 A;  3GFM A;  5E17 F;  2VBY A;  5ICC A;  4KIB A;  3KP7 A;  2F5C A;  1HST A;  3M8E A;  5DCF A;  3U1D A;  5BPD A;  1HQC A;  3MZY A;  4AIH A;  4WWC A;  1O3Q A;  2WC2 A;  1XGO A;  1FBS A;  3BPX A;  3KFW X;  3EUH A;  3GX4 X;  1YLF A;  2XV4 S;  4KFC A;  2L02 A;  2FF4 A;  5LGU A;  3CUO A;  2JSC A;  1FYM A;  4WCG A;  4LMY A;  3P7N A;  2A3S A;  2UXN A;  2MH2 A;  2IRF G;  4A0Y A;  5FGM A;  2X0L A;  3I4P A;  5HLH A;  2OD5 A;  2STW A;  4PZJ A;  1SMY F;  2R7D A;  2QZ8 A;  5CLS A;  4XBF A;  1FT9 A;  2L3D A;  4HZF A;  2OZU A;  5A2Q K;  2DW4 A;  1IXS B;  2PLY A;  2HYF A;  3J7A O;  4WXC A;  4GYG A;  1S29 A;  5DEQ A;  1G3Y A;  1G3T A;  3GZ6 A;  2FXA A;  4M73 A;  1ZAO A;  2VE8 A;  2F5F A;  4HAM A;  2TDX A;  1T39 A;  3CO7 C;  4LK1 F;  5ILU A;  3KP2 A;  1AWC A;  1KYW A;  2ZNY A;  3LA2 A;  1P2F A;  5E8G A;  2L4A A;  4HW0 A;  2DQL A;  2DBB A;  1E17 A;  2O0Y A;  3BPV A;  2EFQ A;  1GXP A;  1W7P B;  4OMY A;  1TW2 A;  3NEU A;  2V9V A;  2AS5 F;  2FSW A;  4JBA A;  1IW7 F;  5FD6 A;  1T0F A;  2FMY A;  4MGR A;  1R1U A;  1B1B A;  1U5T C;  2VN2 A;  1STZ A;  2KIF A;  3MAJ A;  1U6G A;  2IA2 A;  2UWM A;  1XB4 A;  2LF8 A;  1RZ4 A;  1ZYR F;  1JHH A;  2DT5 A;  1WWX A;  3KLO A;  2GIV A;  2VOO A;  4I01 A;  3QAH A;  1FBU A;  5TRD A;  2QQ9 A;  1XMA A;  3WG9 A;  2HQR A;  2HYG D;  1XDS A;  3E3V A;  1LDJ A;  2R3S A;  2RC4 A;  3KP3 A;  4RGR A;  4I0A A;  4UVB A;  4PGH A;  2QM3 A;  3PQK A;  3FXQ A;  3GWZ A;  3ISP A;  2VXZ A;  5J6X A;  1HW5 A;  3K9T A;  4IPA A;  5LEK A;  2RVC A;  1U3E M;  3LAJ A;  1OYW A;  1LQ1 A;  1HBX G;  1W5T A;  4R8H A;  4I0B A;  1KU9 A;  1ZRC A;  4KNY A;  1R58 A;  2VBZ A;  5BQT A;  4L5J A;  4EQQ A;  3WGG A;  2L4M A;  5L3D A;  1UST A;  2EFP A;  2HOE A;  4UUV A;  4MNU A;  3J81 Z;  2QQA A;  4CGZ A;  1QGP A;  2K02 A;  4YII A;  4RAZ A;  4ENJ A;  1SFU A;  4A0Z A;  5BOX A;  1MJA A;  2CO5 A;  3ZN1 A;  4EV0 A;  3DEU A;  1Q1H A;  4UNO A;  1W5S A;  2B0L A;  3C1D A;  3SHF A;  1IN7 A;  1U2W A;  1R1V A;  3BDD A;  4KT5 C;  2DFI A;  2ETH A;  1Z7U A;  4M71 A;  4EM0 B;  1TBX A;  3I59 B;  4L9T A;  4YFK F;  5DCM A;  4OU0 A;  1FY7 A;  2P7V B;  3L2C A;  3LA7 A;  3JAM Z;  2IPQ X;  3WE2 A;  1I27 A;  3JSO A;  1ZG1 A;  1BC8 C;  2M45 A;  1Z9C A;  5H20 A;  3JSP A;  1I5Z A;  5JFR A;  3VFZ A;  3O2P E;  1IF1 A;  3GVA A;  1FSE A;  1Z1D A;  1HW1 A;  4EMS A;  2Z33 A;  2EWN A;  5J8F A;  1LNW A;  4WXH A;  5IT9 K;  4ENK A;  2XKO A;  3GXO A;  5LHI A;  1SD5 A;  2EJR A;  2G9W A;  3M8F A;  3F72 A;  2QBY B;  1IN6 A;  3EET A;  4ETS A;  1IN5 A;  2QLZ A;  4RB0 A;  5JHU A;  3Q9S A;  2MD5 A;  4KN4 X;  4LG0 A;  3CDH A;  1MDM B;  2FBI A;  2FNA A;  2GQQ A;  2VC0 A;  4CHU A;  5DUI A;  2XAG A;  5D4S A;  2XGX A;  1FLI A;  1ON2 A;  2PFB A;  5E1X A;  4CIC A;  4IRH A;  3GEZ A;  2DO7 A;  4L9N A;  1WSU A;  2NYX A;  4BAY A;  4A6D A;  5K5R A;  3FM5 A;  5CVR A;  1EH7 A;  5DD4 A;  2QVO A;  3GF2 A;  1B6A A;  3MFK A;  2LNB A;  4L5I A;  3RTR A;  1HW2 A;  1MJB A;  3F23 A;  3EYY A;  4ENM A;  1R5G A;  4G6D A;  3C18 A;  4UVA A;  3V8J A;  5LEJ A;  2MLK A;  3EDP A;  1FP2 A;  2MH9 A;  4EGY A;  1BIB A;  1FSH A;  3ECO A;  3L09 A;  1R36 A;  4HQM A;  4MQV A;  1YTY A;  4GCV A;  1KGS A;  3IWF A;  1L3L A;  2L54 A;  2MC3 A;  4LB5 A;  3RKW A;  5DYM A;  2VT2 A;  1D8K A;  1S7O A;  3DF8 A;  1YW7 A;  1OYY A;  2M1B A;  2ISY A;  2X4H A;  3ZMZ A;  2VON A;  1FPQ A;  5CYV A;  3WTZ A;  2Q0O A;  2OU2 A;  3DPL C;  3KCC A;  3IKT A;  1IUY A;  1PP8 F;  3MQ0 A;  3NRV A;  5LRR A;  4AIJ A;  4XLN F;  1CF7 B;  3TO6 A;  2OA4 A;  2KJC A;  3C3W A;  3D0S A;  5IT3 A;  1F4K A;  1YQA A;  3J81 K;  3H92 A;  1HKT A;  4Q5S F;  3IL2 A;  2COM A;  1JHF A;  1TQP A;  3IC7 A;  3ZMD A;  3WTU C;  2Z9O A;  2V1U A;  1B9N A;  1TQI A;  2A69 F;  4ESJ A;  4PDK A;  5HLG A;  4OMZ A;  2RDP A;  3P9C A;  2ELH A;  4B8X A;  2LSO A;  4HX7 A;  1SD6 A;  2PMH A;  2E1N A;  1FYK A;  4HLX A;  1JXS A;  3KZY A;  3VEP A;  4A0X A;  1J59 A;  4LLN A;  5HDG A;  4QWQ A;  4B09 A;  1IXR C;  4KMF A;  5LRS A;  3ABT A;  3IWZ A;  4UVC A;  2ZBK A;  3KP5 A;  4CXF A;  2UXX A;  2DU9 A;  3KEQ A;  2WTE A;  1D5V A;  3JAM K;  3BJO A;  4LJZ F;  4KN7 X;  1XSV A;  4NQW A;  3ROU A;  4R1H A;  1B4A A;  5CVI A;  2BYV E;  2D2W A;  2W85 A;  3W6J B;  3F8B A;  3KET A;  1T2K A;  1J0R A;  1GHC A;  1XSD A;  4MTD A;  2F5E A;  3HRU A;  2DLL A;  1PDN C;  3C7J A;  1R22 A;  2RN7 A;  1C0W A;  2XAQ A;  2D1V A;  2E1C A;  2H6B A;  1RUO A;  1HKQ A;  3MWM A;  5AIQ A;  2ZNZ A;  2PG4 A;  2FQ3 A;  1TNS A;  3DP7 A;  4O6J A;  3LWF A;  2XRN A;  1D8J A;  4EJW A;  3M9A A;  2H6C A;  3MZH A;  3RPQ A;  3G3Z A;  3E5U A;  5D8K B;  3GUD A;  3MEX A;  1R23 A;  4OIQ F;  1DUX C;  3RKY A;  2DK8 A;  1USS A;  3V4G A;  1G6N A;  4IVN A;  1GXQ A;  4BNC A;  5FFX A;  4ZYE A;  4XLP F;  3WGI A;  2FEZ A;  3QP5 A;  1QZY A;  4LFU A;  1O3R A;  1LB2 A;  1QBJ A;  1G3S A;  2A5Y B;  4HA8 A;  5AIP A;  2XAS A;  3OV8 A;  5BPI A;  2O61 A;  1MKM A;  2Q8K A;  2V79 A;  2IJL A;  3QU3 A;  2NAZ A;  5L3F A;  2M87 A;  3TOA A;  1U5T A;  2E7W A;  4K2E A;  3HHG A;  1YS6 A;  1RI7 A;  1IN4 A;  2Z5U A;  4BHC A;  4M9X A;  2QWW A;  3TKY A;  2ESN A;  5LGT A;  1R1T A;  1OPC A;  3WTW C;  5HVQ C;  2EFO A;  3FX3 A;  4BHB A;  5HDK A;  3HHH A;  1W4M A;  5F1R A;  1JGS A;  1XGN A;  3F8M A;  5E1W A;  3GFL A;  2YU3 A;  4ZYD A;  2P7C B;  4G8X A;  5L3G A;  1O7F A;  1ZAR A;  3RI4 A;  1LDK B;  2KIM A;  1ZLJ A;  2XIG A;  1XMK A;  4A2U A;  4WF2 A;  2CG4 A;  2HQN A;  2JRT A;  3LQR A;  1ODD A;  5D5X B;  1B59 A;  2FNP A;  3E5X A;  1UFM A;  3LFK A;  3I58 A;  1YS7 A;  4I02 A;  1S7A A;  2Q2E A;  3E5Q A;  1F1Z A;  2VC1 A;  4N9I A;  4NB5 A;  4F7Z A;  4HX8 A;  3ULQ B;  4HQE A;  3F8N A;  5ICF A;  5LGN A;  3GYH X;  3U9G A;  1QZZ A;  4OOI A;  1BN5 A;  3IKV A;  3TQN A;  1SD7 A;  1YFH A;  1ZRF A;  4JQF A;  4N9H A;  4GO1 A;  1Z91 A;  1DPU A;  1YW9 A;  3WOD F;  5H6Q A;  3WTT C;  3RIR A;  2G7U A;  3K0L A;  2EV5 A;  4ZH4 F;  5CVJ A;  2PJP A;  2OAZ A;  3S2W A;  2HTS A;  2DPU A;  5HLI A;  3JTH A;  2FA5 A;  3KZZ A;  5F6F A;  2ADU A;  1H9G A;  4TV7 A;  3V7S A;  2HR3 A;  1YYV A;  3R61 A;  5HDN A;  2LF7 A;  4EM2 A;  3QU6 A;  5L3B A;  4D0P A;  4M9Z A;  3NQO A;  1QQI A;  3I59 A;  2XAH A;  4O3M A;  3RDI A;  1FNN A;  1KQ0 A;  4U88 A;  3REO A;  1UHW A;  2IW5 A;  3L00 A;  1Z6R A;  1ZN2 A;  2HFH A;  1S6L A;  2W84 A;  1ZGJ A;  4RB2 C;  3OOP A;  2KKO A;  2ISZ A;  2NS0 A;  3EYI A;  3IRR A;  4Q48 A;  5D5W B;  3FF5 A;  2JPC A;  5CVU A;  3O6B B;  2FBK A;  3RPU A;  5D5V B;  5D4R A;  5JR3 A;  2QUF A;  4EJT A;  5K5Q A;  1PUE E;  5HS8 A;  2OBP A;  4L9J A;  1JE8 A;  1KU2 A;  1MGT A;  2XKP A;  2ESH A;  4U7D A;  1FOK A;  1LVA A;  1ULY A;  2V1X A;  4MEY F;  1F9N A;  2MLG A;  1IN8 A;  1FP1 D;  2H94 A;  4HDV A;  1YO5 C;  2YX4 A;  1MZB A;  3WTX C;  4HOB A;  3ZN0 A;  4IRG A;  3FZV A;  2KRF A;  1SFE A;  3R0A A;  4BQA A;  2M8E A;  1CGP A;  1T38 A;  3P9I A;  5KK1 A;  2NRA C;  4M74 A;  2R7F A;  3GW2 A;  3G73 A;  2L01 A;  3DXJ F;  1QNT A;  1I1S A;  2D1H A;  2IA0 A;  1K78 B;  1KU7 A;  3HRM A;  2OZ6 A;  3GZ5 A;  2HGC A;  1XCV A;  3SXY A;  2XVC A;  2FRH A;  1FC3 A;  2RV8 A;  3CUQ A;  4AVP A;  3L7W A;  4LK0 F;  4IHT A;  3WE3 A;  4LG0 B;  4P55 A;  3TO9 A;  1A04 A;  3CLO A;  4UXN A;  2QYO A;  1J5Y A;  1SD4 A;  4G9Y A;  4RGX A;  4NHJ A;  1G3W A;  1XDU A;  2LDU A;  3O3K A;  2XHK A;  1BI1 A;  1XSX A;  3HRS A;  2F2E A;  2HEO A;  2PBI A;  4HBL A;  4ZYG A;  2XAJ A;  2EV0 A;  2K4J A;  4OIO F;  2J5P A;  3CUQ C;  3Q5F A;  2P5K A;  5J8C A;  1Z05 A;  4IJA A;  5ICG A;  4N0B A;  2RNJ A;  2DPD A;  3TGN A;  2P4W A;  4BH9 A;  1YG2 A;  3VB2 A;  2OQG A;  2HS5 A;  3QPH A; 
#chains in the Genus database with same CATH topology
 1YW8 A;  3MKZ A;  2JT1 A;  1TLH B;  1TWA J;  5E18 F;  1SMT A;  1Z6T A;  2K85 A;  1CF7 A;  1U78 A;  2DN0 A;  3CJR B;  4O5V A;  4IHY A;  1SFO J;  2X6O A;  2DMT A;  1S9H A;  3I0T A;  4NNJ A;  4V2F A;  3HRT A;  4DBQ A;  3MKW B;  4JOM A;  4YEL A;  1H0M A;  2I5U A;  1FEX A;  4EJV A;  2JVG A;  1QHG A;  1HCR A;  1NG6 A;  3QP6 A;  4RAY A;  3V8K A;  4EVI A;  1UCR A;  1K6Y A;  3SFZ A;  1HF0 A;  3OYL A;  3O8H A;  1IXC A;  2YX7 A;  3BG7 A;  4BJ6 C;  5FLX Z;  3S8P A;  1H88 C;  2L9N A;  2HDC A;  5IOY A;  1U0J A;  2GZW A;  2LY1 A;  5E3O A;  1O3T A;  1TWC J;  3WU1 B;  3ZQC A;  2IT0 A;  1V4R A;  2G0E A;  3KZI C;  1G59 A;  2IS2 A;  1J09 A;  1HKS A;  3GTL J;  2CW0 F;  1OMI A;  2DTR A;  5IP9 J;  4A3E J;  3FM3 A;  5HS7 A;  2O6G E;  2CQN A;  1KYZ A;  4XKB A;  1VQ5 I;  2PN6 A;  1X3Z B;  3E6C C;  3KEO A;  4DNC A;  5GTI C;  3CJN A;  2A61 A;  3AAF A;  3IAS 2;  3E7L A;  4G6Q A;  5D6F A;  5FKN A;  3HBL A;  3NWS A;  5C4X J;  2Y48 A;  4R79 A;  1BBY A;  1APL C;  1Y1V J;  1TNT A;  4CO8 A;  5GAD J;  3HIF A;  4H4K C;  3GO5 A;  4CDG A;  1R49 A;  5H6R A;  2LBF B;  2ZCW A;  3JRF A;  2BGC A;  2FU4 A;  4EEF G;  5KAF C;  3IP4 B;  3MN2 A;  3GTJ J;  4U7B A;  1J7K A;  1BR1 A;  2A6E F;  2PX9 A;  2ZME A;  4FE7 A;  4AD9 A;  2ZJR F;  2L7F P;  2R7Q A;  3KLN A;  3ZP5 A;  4A6E A;  1QZE A;  1YE9 A;  2BEO A;  2HKX A;  3H5N A;  4UUS B;  1MMG A;  2O03 A;  3OYA A;  2R7R A;  1QPM A;  4XSZ F;  1FMV A;  3DPU A;  1IRF A;  5D8L B;  2WBM A;  2HOT A;  3K4B A;  6PAX A;  3HDD A;  4JYK A;  1GT0 C;  1OYI A;  2IGO A;  3HTU A;  5KCM A;  1ETY A;  3HKZ A;  3B73 A;  2AQF A;  3EQL F;  3UNG C;  3R0J A;  1I1G A;  1JUS A;  2DMN A;  3B6C A;  4ZZL A;  1TTY A;  3T0Y A;  3HTS B;  2H8R A;  5JHF A;  2VOD A;  2CQ7 A;  4S05 A;  3TDU C;  1EV7 A;  1ZG3 A;  2G7H A;  2VOP A;  2VJ5 A;  2WAE A;  2JUG A;  2V9K A;  2WV0 A;  5DM6 F;  3LA3 A;  3ZPL A;  2FML A;  2H27 A;  3DKW A;  2MFZ A;  4P5O A;  4PK4 A;  2DYR H;  1ETX A;  5LHG A;  3FXK A;  3W2V A;  4XR6 A;  2CFX A;  3PFI A;  4NUB A;  4AWX B;  4EGZ A;  2JSP A;  1MBK A;  1PVE A;  9ANT A;  1LEB A;  4HX4 A;  1T98 A;  4IHW A;  3OYJ A;  4IRI A;  4BE1 A;  2FOK A;  1D0Y A;  3DFG A;  1JGG A;  4C2U A;  2MW8 A;  1PUF B;  1ITY A;  4YG2 F;  4BL0 B;  2EFW A;  1IRX A;  4EJO A;  5FO5 A;  4G7Z F;  2CWE A;  4NQW B;  1VF9 A;  1P4X A;  1WRJ A;  2PMU A;  2XPU A;  3OR2 C;  3IRQ A;  3S1Q J;  1MNE A;  3FXL A;  4MEX F;  4B1R A;  3L2R A;  3FK6 A;  2BHY A;  2ECB A;  2O8X A;  3VOE A;  5L3C A;  3K1P A;  1LEA A;  4IHX A;  4E70 A;  5E79 C;  2CYY A;  5AON A;  3S3O A;  2DI3 A;  3F0C A;  4WK8 F;  2UV1 A;  5DD8 A;  2CJJ A;  3H1C A;  4I2O A;  5C3E J;  4XIC A;  5K5O A;  3S14 J;  1AOY A;  4XRF A;  3HGY A;  1WI9 A;  2BE5 F;  4DJA A;  2VKH A;  1TT5 B;  2Z3Y A;  2F48 A;  3RKX A;  2E2J J;  3BQZ A;  2EV6 A;  3KYC B;  2BY3 A;  3I53 A;  5ILS A;  1GLN A;  2KJB A;  3QOP A;  4II2 A;  4Y7N J;  2NOJ B;  4Q4Z F;  4U0W A;  3K4M A;  2EA2 A;  4IHS A;  3K1M A;  2F5D A;  4A5N A;  2W00 A;  1T08 B;  4LGW A;  2IA1 A;  3B02 A;  4ZYH A;  3HUG A;  4KMU X;  3DLL F;  3PM1 A;  3ZMT A;  3Q9V A;  5LHH A;  3AG3 H;  1IV8 A;  3DV8 A;  2PQ8 A;  3J80 Z;  3KYL A;  1FWZ A;  2JZY A;  2ZSH B;  3I55 I;  3GLX A;  1P6R A;  3JRH A;  3FIS A;  3D1N I;  3BQY A;  2B63 J;  5BS6 A;  1BOA A;  1LE8 B;  1I6H J;  2LRD A;  5BMZ A;  2A07 F;  1ZH5 A;  5B1A H;  3DBR B;  2OV7 A;  4XL9 A;  3WG7 H;  1IGN A;  1ZHF A;  5HOO A;  3BG5 A;  3ZMU A;  1W0U A;  2V6C A;  3G71 I;  1Y0U A;  2AHQ A;  3K7A J;  1Y8Q B;  3VPR A;  1W0T A;  1IRG A;  5F0F A;  2CV1 A;  4IF4 A;  3SQN A;  3LSK A;  2NVX J;  1XCB A;  4B43 A;  1HXD A;  2CV2 A;  2GXB A;  5DDG A;  1MJ9 A;  4OIP F;  2TCT A;  4QPO A;  4BXU A;  3L2Q A;  4I7H A;  3ZMV A;  3JR9 A;  2HKO A;  2P6T A;  4LOC A;  2DFH A;  1UHM A;  3K10 A;  5TGT A;  4JX6 A;  1QPI A;  1ZGA A;  3F8F A;  4OIN F;  5IT9 Z;  3GME A;  4YFX F;  1QVU A;  5TJJ A;  4HF2 A;  1YRN B;  2P6S A;  1W7P A;  1V55 H;  3KP4 A;  5JVT A;  3K1N A;  1S8N A;  2CQK A;  1KU3 A;  3KE2 A;  2LY2 A;  1ETW A;  5EF6 A;  3TDZ C;  1SAU A;  3H3U A;  2CSO A;  2BV6 A;  3LSM A;  3I64 A;  2VQH A;  3DU5 A;  3HOT A;  4BXX J;  2IBD A;  4YIF A;  5M3M J;  2IP2 A;  2O5R A;  1MMA A;  3CO6 C;  1Z67 A;  2ZFU A;  3T8R A;  1K79 A;  5D6E A;  2P81 A;  3TOB A;  1FMW A;  4FHT A;  3OYI A;  4I09 A;  1P4W A;  2E34 A;  4AYB N;  5FD5 A;  1OCC H;  2E1O A;  2W24 A;  3T8T A;  3TO7 A;  1XG1 A;  2A05 A;  2GXG A;  3ERM A;  3MZ8 A;  4CYD A;  2CMP A;  1H9T A;  1ERD A;  2JA8 J;  2XRO A;  3ZMS A;  3CCM I;  5D5U B;  4OIR F;  5JI6 A;  1U5T B;  3I54 A;  4IQ4 A;  1J75 A;  3LSP A;  3D5L A;  2RQP A;  4PGG A;  3OYE A;  5LBQ A;  5EJC A;  3SEZ A;  1R4M B;  4F93 B;  3CJQ B;  4CZZ A;  3AG1 H;  2K86 A;  4HV6 A;  1E2X A;  3S32 A;  1N77 A;  5FLX K;  2BW3 B;  3RYR A;  3JRA A;  2VPR A;  2STT A;  2LK2 A;  4E4H A;  3BY6 A;  2H09 A;  4M3B A;  4WXD A;  4AC0 A;  1QO0 D;  4RB3 C;  4NC8 A;  3T1B A;  3BC8 A;  3VYU B;  4FE4 A;  1F5T A;  3GBG A;  4Y3O A;  3J7A Y;  5EEH A;  4G7H F;  1BC7 C;  1UJ8 A;  3JRE A;  2JA2 A;  3MD2 A;  4IL6 C;  4B4C A;  4RB1 A;  3ELK A;  1B72 A;  1X1P A;  1ORK A;  2RAE A;  4U0V A;  4M6Y A;  1ZGW A;  1KQ8 A;  5B3S H;  4Y15 A;  1TL8 A;  2HOA A;  1BJA A;  4A3D J;  1NHA A;  5IP6 A;  4BAC A;  2EK5 A;  3H3Z A;  1G4D A;  1GV2 A;  3ECH A;  1WQ2 A;  3ASN H;  3OYB A;  3JRD A;  3ZQQ A;  1WJE A;  1TQM A;  1XGM A;  2HTJ A;  4MTE A;  5EG0 B;  1W7P D;  2O9L A;  3BWG A;  5KVR A;  2K7L A;  1DPR A;  4A3J J;  2DQR A;  4BKX A;  1RUN A;  2BY0 A;  4LIV A;  3F6V A;  2R5Y A;  2M8G X;  4BHP A;  4WX9 A;  2DTZ A;  3L2U A;  4FAS D;  2XUB A;  4QLC U;  3SZT A;  4B47 A;  3CCL I;  5FFZ A;  1ZG5 A;  2EA4 A;  2K9N A;  2E5N A;  1MD0 A;  2JK3 A;  1BI2 A;  2X6X A;  2W7N A;  1S7E A;  3LSH A;  3DKY A;  3HXL A;  3QRF F;  3W6K B;  4MIM A;  4L0Z B;  1OR7 A;  4HNT A;  3F9K A;  3PQJ A;  3QPT A;  1K7A A;  2Q2E B;  3RJP A;  1IZ1 A;  2DK5 A;  2YPR A;  2ZSI B;  1J9I A;  3DU6 A;  2IS6 A;  5JVG F;  1PP7 U;  5L3E A;  2M7A A;  2QCO A;  2Y0M A;  5B5E C;  2HDW A;  3AL0 C;  4M6X A;  4LLL A;  4XON A;  4BGD A;  1H8A C;  3H9G A;  1VTN C;  5HS9 A;  3WU0 A;  5LFA A;  1K61 A;  3BOQ A;  3JRI A;  5ERI A;  3WGH A;  3ML6 A;  3WTV C;  4LG3 A;  2BOL A;  3M7G A;  1Y56 A;  3HL2 A;  1EJ9 A;  2LTP A;  1P92 A;  1U9O A;  3V7R A;  2X51 A;  3GTK J;  2DT6 A;  2DCE A;  2ZXH A;  4EJU A;  2ZC2 A;  3W3C A;  3I71 A;  2VKD A;  1IAW A;  2P5L C;  5DV5 A;  1X1A A;  4IXA A;  1RKW A;  2K4B A;  5K1Y A;  2RGV A;  4Q47 A;  4PSW A;  1OR7 C;  4S04 A;  3I5U A;  4XM3 A;  1FJL A;  3FMS A;  1WZ2 A;  5M5X J;  1X2M A;  3LOC A;  3WTY C;  4IEJ A;  4ON0 A;  2VE9 A;  1OFC X;  4L9V A;  4RLQ A;  1TW3 A;  2M0M A;  1DDN A;  3TP3 A;  4JK1 X;  4RM2 A;  2TRT A;  3OYN A;  2PJR B;  4IX7 A;  4MO7 A;  3W6V A;  3DCF A;  4HLY A;  1XD7 A;  2WAF A;  3BZ6 A;  2JPB A;  1S3J A;  2MA3 A;  1WH7 A;  4BDZ A;  2K9S A;  1T33 A;  2FE3 A;  2A6H F;  3PNY A;  3K2Z A;  4PJM A;  4XRS A;  1REP C;  2R7U A;  3J80 K;  2E2I J;  2LLK A;  1U8R A;  2VJ4 A;  4U0Y A;  1X3U A;  5GAE J;  4XID A;  3LAP A;  3F21 A;  2NS8 A;  2PEX A;  4F92 B;  2W25 A;  5DUK A;  1BI3 A;  4DYQ A;  3QYE A;  3BZC A;  3T5X A;  5ICE A;  2KIU A;  3SZP A;  1RES A;  1SVM A;  1B8I A;  4ENN A;  1FOX A;  5CVV A;  2RKH A;  2GA2 A;  4Z2Y A;  1B9M A;  2R7W A;  1VQ9 I;  2QBY A;  3TL4 X;  1LJ9 A;  2R92 J;  4P96 A;  2WB1 N;  5GAH J;  4GXO A;  2P8T A;  4KIC A;  1PJR A;  4XNF A;  5DCM B;  4ITV A;  2UZK A;  1IC8 A;  2M3A A;  3F8C A;  1R5H A;  2QSH X;  1SVL A;  3N4M A;  2IAI A;  3O8G A;  5F64 A;  1DQU A;  3S1R J;  4ZDP A;  4BJ5 C;  2QQ8 A;  1MDM A;  3FXU A;  4BQN A;  1SEU A;  5FLV A;  3LST A;  1XN7 A;  2DJN A;  3RKQ A;  3BRO A;  3K69 A;  4DYR A;  1UB9 A;  2GAU A;  1YIO A;  2DOA A;  4I76 A;  5FB2 A;  2QEN A;  2NNN A;  3ZGK A;  3GTM J;  1EH6 A;  3DQV C;  3CC4 I;  4BYY A;  4GYI A;  2JUC A;  1N75 A;  2KP6 A;  2ZFW A;  4ASN A;  5ILV A;  5J47 A;  1K78 A;  2CUZ A;  3BR0 A;  2NNY A;  3ZCO A;  5ED4 A;  4A5M A;  2MBF A;  3RYP A;  2D5V A;  3FMQ A;  2Z99 A;  3G1L A;  4M72 A;  5CJ9 A;  3CLQ A;  4PSX A;  3E97 A;  2OQR A;  2IXS A;  4RGS A;  1ZRE A;  3ERE D;  2CGP A;  4FX4 A;  2VBW A;  2ZJ2 A;  2AQE A;  3R4K A;  3BJA A;  4BQQ A;  1D5Y A;  2Q1Z B;  3FWE A;  4FT8 A;  2J5O A;  5EEG A;  4UHT A;  3M3Y J;  1BM9 A;  3SFI A;  3A0B C;  2JTV A;  2V1D A;  2FX0 A;  2AXL A;  4BEH B;  3I4M J;  5E8I A;  3K4C A;  4P1W A;  2ZJP F;  1JJ6 C;  2GA1 A;  1GVJ A;  3BG3 A;  2M30 A;  1QHH D;  4ZZD A;  2CS3 A;  1EH8 A;  4M3F A;  3K70 C;  2DAO A;  1BI0 A;  1RR7 A;  3BJ6 A;  3CCY A;  4RAF A;  4DQ2 A;  1E3P A;  3Q3S A;  4RS8 A;  4KDP A;  3EUK L;  3MCZ A;  4CYC B;  2Y30 A;  2VT3 A;  4YFN F;  2P5V A;  4G6T B;  3N97 A;  4Z6Y A;  3OIO A;  4DYC A;  2DMQ A;  3HSE A;  4RDU A;  4GGG A;  2BXZ A;  4X6A J;  1T6S A;  3CUQ B;  1FOW A;  3HB9 A;  1A6Q A;  2NOG A;  2KIS A;  3LQQ A;  2JA6 J;  3BZK A;  1R7J A;  1XTA A;  2L9R A;  4HDU A;  2F4I A;  2VJI A;  3VYS B;  3KP6 A;  3F6O A;  2WWY A;  2ACJ A;  1HLV A;  3CTA A;  2XAF A;  2QQB A;  3PO2 J;  2VB6 A;  5A2Q Z;  2PMZ A;  3K70 D;  2E35 A;  2M5W A;  1H89 C;  4FET A;  3R6S A;  3U1K A;  1ZLK A;  2YR2 A;  2MG4 A;  4G94 A;  4UV8 A;  2IVM A;  2CQQ A;  3M1C A;  5K7F A;  1R9T J;  3U2R A;  4PCQ A;  4IZZ A;  2HWV A;  2LKP A;  3FHZ A;  4XSX F;  1ZK8 A;  2FBH A;  4P9F A;  3JTG A;  1OCP A;  2MC4 A;  4L18 B;  2AXT C;  3HSR A;  3G1O A;  4E6K G;  3IH4 A;  4B48 A;  3OS2 A;  4XOP A;  2W57 A;  4RGU A;  4XLC A;  4MQ9 F;  3M1E A;  3BTI A;  2E7X A;  4ESB A;  1VQK I;  5H2F C;  2XB5 A;  1KA8 A;  3VOD A;  5IYB J;  1J2X A;  3BP8 A;  3R60 A;  3SYT A;  4ZYA A;  2D45 A;  2PI0 A;  5K7H A;  2VBX A;  1G2H A;  3VYT B;  2ICW G;  2BXY A;  3F22 A;  4KA4 A;  2HVQ A;  1OKR A;  1FX7 A;  4Y52 J;  4QPQ A;  2ZKZ A;  3ABU A;  3TW6 A;  1AKH A;  2KL4 A;  4BJT A;  1I6X A;  3L9F A;  1SFX A;  1RNL A;  1O57 A;  1ZTR A;  3AFH A;  4BE0 A;  3E6D A;  1MBH A;  1FBQ A;  1XGS A;  3C2B A;  3JCU C;  1WJB A;  4HYE A;  4C3J J;  2Y31 A;  2JA5 J;  2YU9 J;  3TW7 A;  3IHU A;  1W36 C;  1V3F A;  1WKM A;  2GWR A;  2NXN B;  1DP7 P;  3MKY B;  1MSF C;  2DA3 A;  2DA5 A;  4XOR A;  3RCO A;  3E6B A;  4KIF A;  1NK2 P;  2R7X A;  2LBF A;  2M4G A;  2YS9 A;  1O7L A;  2EFN A;  2ZXJ A;  1QRY A;  5JLX A;  4P9U A;  4KIG A;  2OC6 A;  1IRZ A;  2BBY A;  1X58 A;  1FZP B;  3TP0 A;  3Q0V A;  1I50 J;  5IOZ A;  4Y17 A;  3V7C A;  3IH2 A;  1VQL I;  3FMR A;  3ZQ7 A;  1DGR M;  4HNV A;  1JT6 A;  3AKZ A;  1WJA A;  5IYD J;  2CQX A;  4L0Y B;  1L0O C;  3K4J A;  3HSF A;  2A68 F;  2HXO A;  4J00 A;  4RA2 A;  1ONV A;  3C2G A;  2EIJ H;  4FX0 A;  1W36 D;  2X85 A;  2EIL H;  3HOS A;  2K27 A;  3JW4 A;  4M9S A;  1RIO H;  3OYM A;  2HOS A;  4PJN A;  1Y8R B;  1ETV A;  1A35 A;  2H1L A;  4EM1 A;  1KQ9 A;  2ZO4 A;  4MHG A;  3GFI A;  1VQ4 I;  3P9K A;  4I98 B;  4XQF A;  1SAX A;  3A0H C;  3BCA A;  3E6M A;  2HQA A;  1EKE A;  1Q1V A;  2JWT A;  1HSJ A;  1OQY A;  3HYI A;  4IQJ A;  3S15 J;  4Y13 A;  1R6R A;  1N78 A;  4DGW B;  3CCS I;  5HNH A;  1FYL A;  2C6Y A;  4G7O F;  2VL8 A;  2ZME B;  4KUM A;  4LB6 B;  3QYF A;  4HF0 A;  1BW5 A;  5E3M A;  1OLT A;  1SVO A;  4GRI A;  3GLL A;  3COA C;  2IGK A;  2HZT A;  3GFJ A;  2EB7 A;  1TC3 C;  1K6O A;  3MKL A;  1NG7 A;  4C2T A;  4DZJ A;  3DPT A;  4QTR A;  4HF1 A;  3OYG A;  1OIS A;  2YSR A;  5E20 A;  4JX4 A;  3FXR A;  2DDB A;  2O3F A;  3LSG A;  4D1Q A;  3WTS C;  4ESF A;  1P4A A;  2L7M P;  1LDD A;  5FKM A;  3CF2 A;  3SJM A;  2XF5 A;  3V8L A;  2EZK A;  2OJE D;  5J1R A;  2VLA A;  1O3S A;  2DMP A;  3PSF A;  4LLG F;  3A01 A;  2O8K A;  2LOO A;  4LD5 A;  1ZRD A;  1VQN I;  1S5L C;  1P7J A;  3F3X A;  3PUF A;  1MBE A;  5E1Z B;  4AIK A;  4H0E A;  2R7T A;  5B66 C;  4KIS A;  3Q0W A;  4UV9 A;  5LLQ A;  1BIA A;  1X4P A;  1TWH J;  1D3Y A;  2L7Z A;  1ON1 A;  2Y75 A;  2DOF A;  3K2A A;  4A12 A;  1R00 A;  4HV5 A;  4A3M J;  3GFM A;  5E17 F;  2VBY A;  2EIK H;  5ICC A;  4KIB A;  4N4N B;  3KP7 A;  1LE8 A;  1VND A;  2F5C A;  3SEQ A;  1HST A;  3ZOB A;  3RQ4 A;  3M8E A;  2X48 A;  5DCF A;  3GTO J;  1XX5 A;  2ECC A;  3U1D A;  1JJ8 C;  4LIU A;  5BPD A;  3E0J B;  1HQC A;  2DA7 A;  3H35 A;  1F36 A;  3MZY A;  3G6E I;  2R7V A;  4AIH A;  4WWC A;  1X1B A;  1O3Q A;  2V9P A;  2WC2 A;  3H0G J;  5F08 A;  2JQ7 A;  3QOD A;  1XGO A;  1FBS A;  4HG2 A;  3BPX A;  2K9Q A;  3KFW X;  3BTL A;  2DT7 B;  1A6I A;  3EUH A;  3GX4 X;  1YLF A;  2XV4 S;  4OWR B;  4KFC A;  2L02 A;  3HOY J;  2FF4 A;  4KJZ A;  4KYW A;  5LGU A;  3CUO A;  2JSC A;  2NS7 A;  1FYM A;  4WCG A;  4LMY A;  3P7N A;  2A3S A;  2UXN A;  2MH2 A;  3DKX A;  1UG2 A;  1VQP I;  2IRF G;  4A0Y A;  3CES A;  2X0L A;  3D5R C;  5FGM A;  3I4P A;  5HLH A;  4E7L A;  2L0K A;  1QA6 A;  1YRN A;  5IPA A;  2OD5 A;  2STW A;  1ACI A;  4PZJ A;  2ZXI A;  1SMY F;  2R7D A;  3KYD B;  4V2G A;  3I56 I;  2QZ8 A;  5CLS A;  4XBF A;  1FT9 A;  4BS9 A;  3GTP J;  3A4C A;  4BDY A;  1JI8 A;  2L3D A;  4HZF A;  4E7Z A;  2OZU A;  5A2Q K;  2DW4 A;  3BTC A;  5KHD A;  1IXS B;  1ZR2 A;  2PLY A;  2NVQ J;  4BQO A;  2HYF A;  3J7A O;  4BY7 J;  1ETK A;  4WXC A;  4GYG A;  4JX5 A;  1S29 A;  4AID A;  3S93 A;  1MND A;  3OYK A;  5DEQ A;  1G3Y A;  1G3T A;  2FXA A;  3GZ6 A;  2Y2Z A;  4M73 A;  1DP3 A;  2LRE A;  1ZAO A;  2ZXW H;  2VE8 A;  1MIJ A;  3BR6 A;  3FXM A;  2F5F A;  2EZH A;  3HZJ A;  2TDX A;  4HAM A;  3BTJ A;  3QWL A;  3EUH C;  1T39 A;  2F4M B;  3CO7 C;  4LK1 F;  3OR1 C;  5ILU A;  3BG6 A;  3KP2 A;  1YI2 I;  1AWC A;  1Y39 A;  3BCB A;  1KYW A;  2ZNY A;  4XLA A;  3LA2 A;  2WAQ N;  1Y1W J;  3S1M J;  1P2F A;  3HOZ J;  5E8G A;  2L4A A;  4HW0 A;  2DQL A;  1LFP A;  2DBB A;  4Y4R A;  1E17 A;  2O0Y A;  4YEJ A;  3BPV A;  2EFQ A;  3S3N A;  4XOT A;  1W7P B;  1GXP A;  4OMY A;  1TW2 A;  3NEU A;  1YJ9 I;  4ANJ A;  3LSI A;  2V9V A;  2E1M B;  2E19 A;  2AS5 F;  2FSW A;  4YIR X;  4JBA A;  4DW6 A;  4RM3 A;  4B44 A;  1IW7 F;  5FD6 A;  3H0D A;  2CU7 A;  2EBI A;  2WY7 Q;  3BG9 A;  2KQR A;  1T0F A;  1E0E A;  2FMY A;  2NVT J;  2W4S A;  3C2H A;  4MGR A;  3OWT A;  2QSF X;  3OIQ A;  1R1U A;  1B1B A;  2K3F A;  2VKV A;  1BA5 A;  4XK4 A;  1U5T C;  2KZG A;  3SDB A;  2VN2 A;  1STZ A;  1ZKG A;  2FOW A;  2KIF A;  2XGD A;  3MAJ A;  5BNG A;  1U6G A;  3PNT A;  2IA2 A;  3OYH A;  2UWM A;  2VIX A;  3PFY A;  1XB4 A;  2LF8 A;  4C3I J;  1RZ4 A;  1ZYR F;  1JHH A;  3QYB A;  2DT5 A;  1WWX A;  3KLO A;  2GIV A;  2JJ7 A;  2VOO A;  1DGW Y;  3QAH A;  4I01 A;  3S16 J;  3FKI J;  2LY9 A;  1Y0N A;  1POG A;  1FBU A;  4QIW N;  5TRD A;  2QA4 I;  2QQ9 A;  5FJ8 J;  1XMA A;  3WG9 A;  2HQR A;  1YJW I;  2DA1 A;  2HYG D;  1XDS A;  3H9J A;  4ZJZ A;  3E3V A;  3CDI A;  1LDJ A;  1T0F C;  2BVM A;  2R3S A;  2RC4 A;  3KP3 A;  4RGR A;  1B72 B;  3FDY A;  4CCJ A;  4I0A A;  5CKT A;  4UVB A;  4PGH A;  1JT0 A;  5M5Y J;  1JKQ C;  2QM3 A;  4C30 A;  3PQK A;  3FXQ A;  3GWZ A;  4M3E A;  3ISP A;  2VXZ A;  4IOC F;  3CMA I;  5J6X A;  1HW5 A;  2KHM A;  3K9T A;  4IPA A;  5LEK A;  3PUB A;  2DA4 A;  2RVC A;  1D0X A;  2FQ4 A;  5TIS C;  2HPM A;  1U3E M;  2RNG A;  3LAJ A;  3ESW B;  1OYW A;  2CUF A;  1LQ1 A;  1HBX G;  1MH3 A;  2XSD C;  1W5T A;  4R8H A;  4I0B A;  1KU9 A;  2Y0S A;  1ZRC A;  4CH7 A;  4KNY A;  1FIP A;  1R58 A;  2Z2S B;  2QGU A;  1VQ8 I;  2VBZ A;  3CC7 I;  5BQT A;  4L5J A;  4EQQ A;  2JRM A;  4PFP A;  3WGG A;  2VQG A;  2L4M A;  2W1O A;  3GZN B;  3CC2 I;  4BY1 J;  5L3D A;  3ZQG A;  1UST A;  2EFP A;  3CP2 A;  1MSE C;  2HOE A;  4ZC3 A;  4UUV A;  3BLY A;  4MNU A;  2HNH A;  3J81 Z;  1BL0 A;  2QQA A;  1X1D A;  4CGZ A;  1QGP A;  2PMZ N;  3A1Y A;  2PJR A;  2K02 A;  4YII A;  2E2H J;  4RAZ A;  2H8W A;  5FRO A;  2MD0 A;  2QEX I;  2OTJ I;  4ENJ A;  3BT9 A;  1SFU A;  3OS0 A;  4A0Z A;  2I10 A;  2Y9Y A;  5CPR B;  5BOX A;  1MJA A;  2CO5 A;  3ZN1 A;  1Z21 A;  3MVP A;  4EV0 A;  2L7K A;  3SDG A;  3DEU A;  4F3Q A;  1Q1H A;  1NK3 P;  4UNO A;  3S3M A;  1W5S A;  4LIT A;  1Z0X A;  2B0L A;  2L5Q A;  2LP0 A;  3C1D A;  4IKF A;  3SHF A;  1UG0 A;  1IN7 A;  2BZT A;  2NVY J;  4CCL A;  3ZQF A;  4E7I A;  1U2W A;  4IO9 F;  1R1V A;  3ZQL A;  3BDD A;  4KT5 C;  3UKG A;  5KNL A;  2DFI A;  2LC2 A;  4B3A A;  2ETH A;  2R93 J;  2M2E A;  5GPC A;  1Z7U A;  4AU7 A;  4M71 A;  4EM0 B;  3GTG J;  2M9H A;  1TBX A;  3I59 B;  4L9T A;  1JKP C;  4YFK F;  2E5Z A;  5DCM A;  4OU0 A;  1FY7 A;  2P7V B;  3L2C A;  2B9S A;  5F04 A;  2HXI A;  1W5C C;  2X6W A;  3LA7 A;  3JAM Z;  2IPQ X;  3WE2 A;  1I27 A;  3NAR A;  3J7Z I;  3DTI A;  3JSO A;  1ZG1 A;  1A5J A;  1BC8 C;  2M45 A;  1Z9C A;  5H20 A;  3JSP A;  1I5Z A;  5JFR A;  2VXD A;  4AYB A;  1RET A;  1W1W E;  3VFZ A;  1SC7 A;  4PJL A;  1IJW C;  3O2P E;  1IF1 A;  3CCV I;  3GVA A;  1FSE A;  1Z1D A;  5DS9 A;  3FHN A;  3PNV A;  1UAA A;  1HW1 A;  4EMS A;  2Z33 A;  2CH0 A;  1X4O A;  1YX3 A;  2K40 A;  2EWN A;  2R7Z J;  5J8F A;  4XN0 A;  1LNW A;  4WXH A;  3OOU A;  4FIS A;  1MBJ A;  5M5W J;  3HM5 A;  2GBY A;  5IT9 K;  4ENK A;  2XKO A;  3GXO A;  1Z3X A;  3NAU A;  5LHI A;  1SD5 A;  2EJR A;  2KMU A;  4XLF A;  2DJI A;  1GVD A;  2HI3 A;  4AUX A;  2G9W A;  3M8F A;  5GPA A;  2CUJ A;  3HJE A;  3F72 A;  2LMD A;  1LPQ A;  3VWB A;  2QBY B;  5FLM J;  1LVK A;  2Z1D A;  3L1P A;  4CUG A;  1IN6 A;  1M1E B;  3EET A;  4ETS A;  1IN5 A;  3CCR I;  2QLZ A;  4RB0 A;  5JHU A;  2YUS A;  3Q9S A;  2MD5 A;  1BR4 A;  4KN4 X;  3HKZ N;  4EAT A;  4LG0 A;  3CDH A;  1MDM B;  2FBI A;  2FNA A;  2GQQ A;  3LL7 A;  2VC0 A;  4CHU A;  1X2N A;  2ELJ A;  3LMM A;  2NVU B;  3DWL E;  5IP7 J;  5DUI A;  2XAG A;  3GCM A;  5D4S A;  2XGX A;  1AHD P;  4OAZ A;  2LG4 A;  1FLI A;  5J4Y A;  1IUF A;  1ON2 A;  2PFB A;  4D7N A;  2BY2 A;  5E1X A;  1QVT A;  4CIC A;  3KEY A;  4IRH A;  3HPH A;  3OS1 A;  5JLW A;  2ME6 A;  1XS9 A;  1VQ6 I;  1TWG J;  3GEZ A;  2DO7 A;  4L9N A;  1WSU A;  3MMY B;  2NYX A;  4BAY A;  1CQT A;  2W82 A;  3FK7 A;  4A6D A;  5K5R A;  4E7H A;  1FOY A;  2HDD A;  3FM5 A;  5CVR A;  2W48 A;  3W2W A;  2JVH A;  3ABK H;  2R5Z A;  3ZR8 X;  1EH7 A;  5F1J A;  5DD4 A;  4C3H J;  1VQM I;  3H9Q A;  2QVO A;  3GF2 A;  1IV6 A;  1B6A A;  3MFK A;  2LNB A;  4L5I A;  3EUA A;  3RTR A;  1HW2 A;  2GIZ A;  1MJB A;  4E7K A;  3CMM A;  4A3B J;  2ZB9 A;  4CSW A;  3F23 A;  3EPZ A;  3EYY A;  1I39 A;  4RBO A;  4ENM A;  1R5G A;  4G6D A;  1K83 J;  2WV1 A;  3VDX A;  2XGE A;  3C18 A;  4FQG A;  1LFB A;  4UB6 C;  5F0H A;  4UVA A;  5EEA A;  1QU3 A;  1ZQ3 P;  3V8J A;  3QPL A;  1E3O C;  5LEJ A;  2EIM H;  2HPI A;  2E60 A;  4CA0 A;  2MLK A;  2OTL I;  5EZG A;  1RC9 A;  5EGO A;  1R4N B;  4W1U A;  5FKL A;  2KFD A;  3EDP A;  1FP2 A;  2MH9 A;  5FKK A;  4EGY A;  1BIB A;  1FSH A;  3ECO A;  2XF6 A;  3L09 A;  2HVR A;  4YRV A;  1R36 A;  2KRH A;  2WY8 Q;  1RRJ A;  2DOE A;  2OCC H;  1TZL A;  3W2A A;  4HQM A;  4MQV A;  1YTY A;  4GCV A;  1IDZ A;  1KGS A;  3IWF A;  1TT0 A;  1L3L A;  2L54 A;  3IH3 A;  1MMN A;  3PJR A;  2MC3 A;  4LB5 A;  3RKW A;  5DYM A;  2CFO A;  5EDN A;  2CV0 A;  2FJ1 A;  2VT2 A;  2JN6 A;  2JA7 J;  1D8K A;  1S7O A;  3DF8 A;  2K3P A;  3G4S I;  1YW7 A;  2V26 A;  3DLA A;  2X1E A;  1UMQ A;  1MBF A;  4DOZ A;  2VQC A;  1GUU A;  1NH3 A;  1FTT A;  1OYY A;  2LH9 A;  2M1B A;  2ISY A;  3PL8 A;  2X4H A;  3ZMZ A;  4C2M J;  4D9J A;  2VON A;  4NBQ A;  4N4O B;  1FPQ A;  1BW6 A;  3OIP A;  5CYV A;  2AO9 A;  3CME I;  3S1N J;  5FRN A;  3DEE A;  3CCE I;  3WTZ A;  2Q0O A;  4I6Z A;  2OU2 A;  1JTY A;  4D5C A;  3DPL C;  3KCC A;  4RMN A;  3V42 A;  3IKT A;  1IUY A;  3K4K A;  1PP8 F;  3MQ0 A;  3BR5 A;  4CCO A;  3NRV A;  2L9S A;  2LFB A;  5LRR A;  2VPL A;  4X0G A;  4PJJ A;  1OCO H;  4AIJ A;  3CD6 I;  1HC8 A;  4XLN F;  4ABZ A;  4UY8 I;  1CF7 B;  2XRL A;  3TO6 A;  2OA4 A;  2COB A;  2R0Q C;  2GLO A;  2KJC A;  3C3W A;  3D0S A;  5J1Y A;  3OYF A;  3PSI A;  5IT3 A;  1F4K A;  1YQA A;  3J81 K;  3AG4 H;  1X19 A;  1Z7L A;  3H92 A;  4L5E A;  5IYC J;  1U8B A;  4Q5S F;  1HKT A;  3IL2 A;  1OCZ H;  3B6A A;  2COM A;  1E3H A;  1JHF A;  3HG9 A;  4W97 A;  1TQP A;  2EH3 A;  2JMW A;  4UUS A;  5F27 A;  3JRG A;  3IC7 A;  1A36 A;  2EZI A;  3ZMD A;  3WTU C;  2WB1 A;  3OY9 A;  2Z9O A;  4XN3 A;  1UZC A;  2V1U A;  1AKH B;  2FD5 A;  2DFE A;  1B9N A;  1TQI A;  1SAN A;  2A69 F;  2FUG 2;  4KIT B;  4ESJ A;  3LSR A;  5F0C A;  4PDK A;  5HLG A;  4OMZ A;  2RDP A;  4C9Y A;  2LD5 A;  4RLF A;  3HEF A;  2XGC A;  3OL4 A;  3P9C A;  3FXJ A;  2ELH A;  4B8X A;  2LSO A;  4HX7 A;  1SD6 A;  1YJN I;  2PMH A;  3I3L A;  2E1N A;  2KDZ A;  1FYK A;  4HLX A;  1JXS A;  3KZY A;  3VEP A;  4ZTJ A;  4A0X A;  1J59 A;  4LLN A;  3LSJ A;  1BJZ A;  5HDG A;  3RZD J;  4M6V A;  4QWQ A;  4B09 A;  1IXR C;  1VQO I;  4KMF A;  5FRM A;  1RR8 C;  2MAB A;  5LRS A;  3HGG A;  3ABT A;  1ETQ A;  5K7Z A;  3IWZ A;  4UVC A;  2ZBK A;  3KP5 A;  4JP0 A;  4CXF A;  3WHB A;  3CP8 A;  2UXX A;  1PUF A;  2DU9 A;  5FKO A;  3KEQ A;  2WTE A;  4V19 K;  1D5V A;  3JAM K;  2ID3 A;  5CQE A;  3BJO A;  3KPH A;  4LJZ F;  4KN7 X;  5C4J J;  1OJL A;  1XSV A;  4NQW A;  1D1B A;  3ROU A;  3IV5 A;  2IS4 A;  1F43 A;  1Y6I A;  2CW8 A;  4R1H A;  1B4A A;  4S0H B;  5CVI A;  2KRC A;  3DBL B;  2BYV E;  2D2W A;  3FBN B;  3OSF A;  2L2O A;  2W85 A;  3W6J B;  2CRG A;  3F8B A;  2Y69 H;  4XLH A;  1BR2 A;  1G8X A;  3KET A;  1VI0 A;  2XB0 X;  4FCY A;  1T2K A;  1J0R A;  1GHC A;  3G1M A;  1XSD A;  5GAG J;  3OMY A;  1MMD A;  4MTD A;  2GOM A;  2F5E A;  3HRU A;  2DLL A;  3QPS A;  3H5R A;  3GTQ J;  3BR3 A;  2ZME C;  3NWT A;  2LR8 A;  1PDN C;  3C7J A;  2VAS A;  1R22 A;  1WPK A;  3RSN A;  4BE2 A;  2DYS H;  2RN7 A;  1C0W A;  4A3C J;  1LUJ B;  2XAQ A;  4BXF A;  2D1V A;  1NTC A;  2E1C A;  2H6B A;  1RUO A;  1S72 I;  1HKQ A;  3MWM A;  4B3X A;  4BBS J;  2IGM A;  2CUE A;  5AIQ A;  3N05 A;  3HOX J;  2V7F A;  2K5C A;  3A2K A;  2ZNZ A;  3OYD A;  2M0C A;  3CMY A;  2A6T A;  2OUM A;  2PG4 A;  3ASO H;  2FQ3 A;  2KDO A;  1TNS A;  3DP7 A;  4NC7 A;  4O6J A;  3LWF A;  1A31 A;  4GDF A;  2XRN A;  1D8J A;  3S2D J;  3ZRG A;  4AM3 A;  4EJW A;  3M9A A;  1YX5 A;  2KIQ A;  2R7S A;  2H6C A;  4DIQ A;  4IHV A;  1FIA A;  1KON A;  3M8J A;  2H1K A;  3MZH A;  3RPQ A;  4UB8 C;  1WJC A;  3G3Z A;  3E5U A;  5D8K B;  1TWF J;  4DZP A;  3A01 B;  1T95 A;  3GUD A;  1ZR4 A;  1XC5 A;  2Y0S N;  3MEX A;  4XRM A;  2XPW A;  1R23 A;  1WFX A;  4BBR J;  1GV5 A;  2V1N A;  3D5S C;  4OIQ F;  1DUX C;  3RKY A;  2IS1 A;  2L9V A;  1XMX A;  2DK8 A;  1USS A;  1VFC A;  1V54 H;  3V4G A;  1G6N A;  4IVN A;  4IOA F;  1GXQ A;  4BNC A;  1EF4 A;  3CF5 F;  5FFX A;  4ZYE A;  4HEA 2;  4U87 A;  4HST A;  4XLP F;  3WGI A;  2FEZ A;  3QP5 A;  1QZY A;  3HUG B;  4ZDO A;  3CDL A;  4LFU A;  3L2W A;  5LD2 C;  1O3R A;  1R71 A;  4XMY A;  1LB2 A;  1QBJ A;  4A3I J;  1G3S A;  2A5Y B;  4HA8 A;  5AIP A;  2XAS A;  2EZL A;  3PIP F;  1MW7 A;  1V5E A;  2DDA A;  2LKS A;  1WI3 A;  3OV8 A;  5BPI A;  2O61 A;  1MKM A;  2Q8K A;  2V79 A;  5C44 J;  2I8D A;  3OYC A;  3BR2 A;  5J1U A;  4ZTF A;  3H36 A;  3WU2 C;  4FTH A;  2IJL A;  1PYV A;  1WHU A;  3A03 A;  2RQQ A;  3QU3 A;  1IO2 A;  4G12 A;  4NDL A;  2NAZ A;  5L3F A;  2M87 A;  2Y9Z A;  4QSH A;  2HQ5 A;  3K6G A;  3TOA A;  1U5T A;  1YOV B;  2E7W A;  3P5J A;  4K2E A;  3HHG A;  1YS6 A;  1RI7 A;  4MLO A;  1IN4 A;  2Z5U A;  3TBI A;  2Z16 A;  4M9X A;  2QWW A;  3TKY A;  4BHC A;  2ESN A;  5J3L A;  2HVS A;  2KLO A;  5EYR A;  1R5I D;  3S2H J;  2BW3 A;  2X1D A;  1DU6 A;  1K4S A;  5LGT A;  1K4T A;  1R1T A;  5E3N A;  1OPC A;  1BOB A;  5HVQ C;  3WTW C;  2EFO A;  3U21 A;  4NC6 A;  3FX3 A;  4BHB A;  5HDK A;  3HHH A;  1W4M A;  3ZQI A;  2K9L A;  2VI6 A;  5F1R A;  3HOV J;  4HSR A;  3DBH B;  3I4N J;  1JGS A;  2V4J C;  4BUP A;  3I9V 2;  1XGN A;  3F8M A;  2UUZ A;  5E1W A;  2XC7 A;  3G2B A;  2BHZ A;  3GFL A;  2YU3 A;  4ZYD A;  2P7C B;  3HOW J;  2BY1 A;  4A93 J;  1JTX A;  3IAM 2;  3LFU A;  4G8X A;  5L3G A;  1O7F A;  1ZAR A;  3RI4 A;  1LDK B;  2X6Y A;  3BR1 A;  1WVR A;  2R7O A;  2OF7 A;  2KIM A;  2R4G A;  5CQG A;  1ZLJ A;  2XIG A;  1XMK A;  3H5A A;  4A2U A;  4WF2 A;  2CG4 A;  2HQN A;  2JRT A;  2KT0 A;  3LQR A;  3ZXS A;  5EG0 A;  1ODD A;  5D5X B;  1B59 A;  2XAU A;  2FNP A;  1X1C A;  3DEW A;  2LKX A;  3E5X A;  1UFM A;  1JUM A;  3LFK A;  4MFE A;  3I58 A;  2E1M C;  1WJD A;  2QKM B;  2LYC A;  1YS7 A;  4XKW A;  3J7Y J;  2RRE A;  3OL3 A;  4GFB A;  4I02 A;  4M3D A;  5HNF A;  2ID6 A;  1S7A A;  2Q2E A;  3E5Q A;  4XLE A;  1F1Z A;  4M3G A;  2VC1 A;  4N9I A;  4NB5 A;  4F7Z A;  2WA0 A;  4HX8 A;  3ULQ B;  1D1A A;  3VYR B;  4HQE A;  3F8N A;  5ICF A;  5LGN A;  3GYH X;  3U9G A;  1QZZ A;  4OOI A;  1BN5 A;  1T8I A;  3IKV A;  3TQN A;  1SD7 A;  5GP9 A;  3ABM H;  3JRC A;  3AL0 B;  1WJ5 A;  1YFH A;  2M34 A;  1JUP A;  3CCU I;  1ZRF A;  4JQF A;  1Z77 A;  2QSG X;  4N9H A;  1N25 A;  4GO1 A;  1Z91 A;  4CCK A;  2VQL A;  2V6E A;  1DPU A;  1OCT C;  1I3A A;  3CJT B;  4A3L J;  1YW9 A;  3DTE A;  5GTH C;  3WOD F;  5H6Q A;  2GM4 A;  3WTT C;  3CZ6 A;  1MMS A;  4AVZ A;  4CZC A;  3RIR A;  2G7U A;  4A3K J;  3K0L A;  2EV5 A;  4ZH4 F;  4HRI A;  2QF7 A;  5CVJ A;  2R5Y B;  2VUM J;  3Q0U A;  2PJP A;  2OAZ A;  2XSJ C;  5B1B H;  3S2W A;  3IUO A;  5IY5 H;  2HTS A;  2DPU A;  2ZJQ F;  2X1C A;  1UHS A;  2B7E A;  5HLI A;  3E1S A;  4XRS G;  2ELK A;  3JTH A;  2FA5 A;  4DBR A;  2IEK A;  3KZZ A;  5F6F A;  2OCE A;  2ADU A;  3TED A;  1WCM J;  3TMO A;  1H9G A;  1Z3Y A;  4TV7 A;  3V7S A;  1KZH A;  2HR3 A;  4OAY A;  3HC7 A;  1MBG A;  1RPW A;  3HPG A;  1YYV A;  4BU2 A;  4ZDL A;  2K9M A;  1HOM A;  3R61 A;  5HDN A;  2LF7 A;  3FIW A;  2XPV A;  2F4O B;  4EM2 A;  2DA6 A;  4PFO A;  3A02 A;  4KT6 A;  1WGX A;  2VKE A;  3CQZ J;  3QU6 A;  2DMU A;  2CW7 A;  5L3B A;  4D0P A;  3WHC A;  1V5G A;  4Y33 A;  5HLT A;  3H3V K;  4M9Z A;  3NQO A;  2M4K A;  4A3F J;  1QQI A;  1MNM C;  1ENH A;  3QQA A;  1SFK A;  3I59 A;  5DTD A;  2XAH A;  4O3M A;  3HOU J;  3RDI A;  1FNN A;  3M07 A;  1DU0 A;  1I3Q J;  4II3 A;  1KQ0 A;  3UR3 C;  4U88 A;  5EZH A;  4CCM A;  3SZG A;  3VSK A;  3REO A;  2E71 A;  1ETO A;  1UHW A;  2IW5 A;  3L00 A;  2DA2 A;  1HDP A;  1Z6R A;  4D7M A;  1ZN2 A;  4J19 A;  2HFH A;  1S6L A;  2W84 A;  2MGQ A;  1V5F A;  1ZGJ A;  2LVS A;  2QKL B;  4RB2 C;  1P7I A;  3OOP A;  2KKO A;  4I99 C;  2ISZ A;  2NS0 A;  1ZEL A;  3EYI A;  3IRR A;  4Q48 A;  5D5W B;  2DFF A;  3FF5 A;  2JPC A;  5CVU A;  3O6B B;  2FBK A;  3RPU A;  5D5V B;  3ZQH A;  3CCJ I;  5D4R A;  5JR3 A;  3KX2 A;  4E7J A;  2QUF A;  4F91 B;  2KPM A;  4EJT A;  2XDV A;  3ONQ A;  1YHQ I;  2WAQ A;  2WAD A;  5K5Q A;  1PUE E;  3FXO A;  2VJJ A;  5HS8 A;  2OBP A;  3JRB A;  4L9J A;  1JE8 A;  1KU2 A;  4HPQ A;  1JKO C;  1MGT A;  1XPX A;  2E36 A;  2XKP A;  2ESH A;  4PJ0 C;  4U7D A;  1FOK A;  1LVA A;  1ULY A;  2V1X A;  1WJF A;  4MEY F;  1F9N A;  3ABL H;  1UEL B;  2MLG A;  2HZD A;  3FKJ A;  1LKX A;  1IN8 A;  2HU9 A;  1B8I B;  1FP1 D;  3M4O J;  1EA3 A;  4XKV A;  2H94 A;  5KAI C;  3QOE A;  4HDV A;  1YO5 C;  2YX4 A;  1MZB A;  4XKC A;  3WTX C;  4HOB A;  3ZN0 A;  4IRG A;  3FZV A;  3RZO J;  5M3F J;  2KRF A;  1SFE A;  3R0A A;  4BQA A;  1HA8 A;  2M8E A;  4BEH A;  1CGP A;  3PIO F;  3P9I A;  1T38 A;  5KK1 A;  1IG7 A;  2NRA C;  4M74 A;  2EQR A;  2IGN A;  2R7F A;  1T56 A;  2P0W A;  3GW2 A;  1IDY A;  2F6C A;  4HNU A;  3G73 A;  2L01 A;  3DXJ F;  3L2V A;  1YIJ I;  1AA7 A;  2DOD A;  4MFD A;  1QNT A;  2XF7 A;  4X1E A;  1I1S A;  1LFU P;  4CYC A;  2D1H A;  2IA0 A;  1K78 B;  1O4X A;  1KU7 A;  3HRM A;  2OZ6 A;  3GZ5 A;  2HGC A;  1XCV A;  3SXY A;  2ME0 A;  3X2Q H;  2F5V A;  2EPF A;  2XVC A;  2FRH A;  2N8G A;  1FC3 A;  2RV8 A;  3CUQ A;  4J01 A;  4UUT A;  3RPU D;  3L7W A;  4AVP A;  5J40 A;  2MSY A;  4LK0 F;  4IHT A;  3WE3 A;  4LG0 B;  5DM7 F;  2GXA A;  1MH4 A;  4F52 A;  3FBI B;  4P55 A;  3TO9 A;  1D0Z A;  1A04 A;  3CLO A;  4UXN A;  1VQ7 I;  1P9Q C;  2OPT A;  2GOX B;  3DTK A;  2QYO A;  1J5Y A;  1SD4 A;  1RKT A;  4G9Y A;  4RGX A;  4NHJ A;  1G3W A;  3AG2 H;  1XDU A;  1FTZ A;  4D5F A;  1D1C A;  1VZ0 A;  3K4L A;  2LDU A;  3O3K A;  2XHK A;  1BI1 A;  1TP4 A;  4E7S A;  1OCR H;  2DXI A;  2BVL A;  1XSX A;  2EIN H;  3KIO A;  3HRS A;  2X9D A;  2F2E A;  2R5Z B;  1YIT I;  2HEO A;  2MYS A;  1AU7 A;  2PBI A;  1X3W B;  4HBL A;  3CCQ I;  3OSG A;  4ZYG A;  2XAJ A;  2EV0 A;  2K4J A;  4OIO F;  1JKR C;  2KZV A;  5HOD A;  2J5P A;  3CUQ C;  3Q5F A;  2P5K A;  5J8C A;  2HYJ A;  4PUS A;  3RQI A;  1Z05 A;  4IJA A;  5E3L A;  5ICG A;  4N0B A;  2RNJ A;  1HDD C;  4A3G J;  3K4N A;  2O7O A;  2M7B A;  4F55 A;  3LNQ A;  2DPD A;  1U9N A;  2A5W A;  3TGN A;  4CCN A;  3S17 J;  2P4W A;  4BH9 A;  1YG2 A;  3VB2 A;  4RAG A;  2OQG A;  1GDT A;  4A69 C;  5EGO B;  1WH5 A;  5J4V A;  3PO3 J;  2HS5 A;  3VSL A;  3QPH A; 
#chains in the Genus database with same CATH homology
 1YW8 A;  2JT1 A;  1TLH B;  5E18 F;  1SMT A;  1Z6T A;  1CF7 A;  1U78 A;  4O5V A;  3I0T A;  3HRT A;  1H0M A;  4EJV A;  3QP6 A;  4RAY A;  3V8K A;  4EVI A;  1UCR A;  3SFZ A;  1IXC A;  2YX7 A;  5FLX Z;  2HDC A;  2GZW A;  1O3T A;  3WU1 B;  2IT0 A;  1V4R A;  1HKS A;  2CW0 F;  1OMI A;  2DTR A;  3FM3 A;  5HS7 A;  2O6G E;  1KYZ A;  2PN6 A;  3E6C C;  3KEO A;  4DNC A;  3CJN A;  2A61 A;  3AAF A;  5D6F A;  4G6Q A;  2Y48 A;  4R79 A;  1BBY A;  1TNT A;  4CO8 A;  3HIF A;  3GO5 A;  4CDG A;  5H6R A;  2ZCW A;  2BGC A;  2FU4 A;  4U7B A;  1J7K A;  2A6E F;  2ZME A;  4AD9 A;  4KYW A;  3KLN A;  3ZP5 A;  4A6E A;  2BEO A;  2HKX A;  2O03 A;  1QPM A;  4XSZ F;  1IRF A;  5D8L B;  6PAX A;  1OYI A;  3HTU A;  3B73 A;  3EQL F;  3R0J A;  1I1G A;  4ZZL A;  1TTY A;  3T0Y A;  3HTS B;  2VOD A;  4S05 A;  3TDU C;  1EV7 A;  1ZG3 A;  2G7H A;  2VOP A;  2WV0 A;  3LA3 A;  3ZPL A;  2FML A;  2H27 A;  3DKW A;  4P5O A;  5LHG A;  2CFX A;  3PFI A;  4EGZ A;  4AWX B;  1LEB A;  4HX4 A;  1T98 A;  4IRI A;  2FOK A;  3DFG A;  4YG2 F;  2EFW A;  4EJO A;  5FO5 A;  4G7Z F;  2CWE A;  1P4X A;  1WRJ A;  2PMU A;  3IRQ A;  4MEX F;  2O8X A;  3VOE A;  5L3C A;  3K1P A;  1LEA A;  4E70 A;  2CYY A;  5AON A;  2DI3 A;  4WK8 F;  5DD8 A;  4I2O A;  5K5O A;  1AOY A;  4XRF A;  1WI9 A;  2BE5 F;  2Z3Y A;  3RKX A;  2EV6 A;  3I53 A;  5ILS A;  2KJB A;  3QOP A;  4Q4Z F;  4U0W A;  2EA2 A;  4IHS A;  3K1M A;  2F5D A;  4A5N A;  4LGW A;  2IA1 A;  3B02 A;  4ZYH A;  3HUG A;  4KMU X;  3ZMT A;  3Q9V A;  5LHH A;  3DV8 A;  2PQ8 A;  3J80 Z;  1FWZ A;  2JZY A;  3GLX A;  1P6R A;  5BS6 A;  1BOA A;  5BMZ A;  2A07 F;  1ZH5 A;  1ZHF A;  5HOO A;  3ZMU A;  2V6C A;  1Y0U A;  1IRG A;  4IF4 A;  3SQN A;  1XCB A;  1HXD A;  2GXB A;  5DDG A;  1MJ9 A;  4OIP F;  4BXU A;  4I7H A;  3ZMV A;  2HKO A;  2P6T A;  1UHM A;  1ZGA A;  3F8F A;  4OIN F;  5IT9 Z;  4YFX F;  5TJJ A;  4HF2 A;  2P6S A;  1W7P A;  5JVT A;  3KP4 A;  3K1N A;  1S8N A;  2CQK A;  1KU3 A;  3KE2 A;  3TDZ C;  3H3U A;  2CSO A;  2BV6 A;  3I64 A;  3HOT A;  4YIF A;  2IP2 A;  3CO6 C;  3T8R A;  1K79 A;  5D6E A;  3TOB A;  4FHT A;  4I09 A;  1P4W A;  5FD5 A;  2W24 A;  3T8T A;  3TO7 A;  2GXG A;  1H9T A;  4CYD A;  2XRO A;  3ZMS A;  5D5U B;  4OIR F;  5JI6 A;  1U5T B;  3I54 A;  1J75 A;  3D5L A;  2RQP A;  4PGG A;  5LBQ A;  4CZZ A;  2K86 A;  4HV6 A;  1E2X A;  5FLX K;  3RYR A;  2STT A;  3BY6 A;  2H09 A;  4WXD A;  4RB3 C;  1QO0 D;  3T1B A;  1F5T A;  5EEH A;  4G7H F;  1BC7 C;  4RB1 A;  3ELK A;  4U0V A;  4M6Y A;  1KQ8 A;  4Y15 A;  1BJA A;  1NHA A;  2EK5 A;  3H3Z A;  1G4D A;  3ECH A;  1WQ2 A;  1TQM A;  1XGM A;  2HTJ A;  4MTE A;  1W7P D;  3BWG A;  5KVR A;  2K7L A;  1DPR A;  1RUN A;  2DQR A;  3F6V A;  4BHP A;  4WX9 A;  2XUB A;  4QLC U;  3SZT A;  5FFZ A;  1ZG5 A;  2EA4 A;  1MD0 A;  1BI2 A;  3QRF F;  3W6K B;  4L0Z B;  1OR7 A;  3PQJ A;  3QPT A;  1K7A A;  3RJP A;  1IZ1 A;  2DK5 A;  2YPR A;  1J9I A;  1PP7 U;  5L3E A;  2Y0M A;  4M6X A;  4LLL A;  1VTN C;  5HS9 A;  3WU0 A;  3BOQ A;  5ERI A;  3WGH A;  3ML6 A;  3WTV C;  3M7G A;  1P92 A;  3V7R A;  4EJU A;  3I71 A;  1IAW A;  2P5L C;  5DV5 A;  4IXA A;  5K1Y A;  2K4B A;  2RGV A;  4Q47 A;  4S04 A;  3I5U A;  3FMS A;  3WTY C;  4ON0 A;  2VE9 A;  4L9V A;  1TW3 A;  1DDN A;  4JK1 X;  4HLY A;  1XD7 A;  3BZ6 A;  2JPB A;  1S3J A;  2MA3 A;  2FE3 A;  2A6H F;  3K2Z A;  1REP C;  3J80 K;  1U8R A;  4U0Y A;  1X3U A;  3LAP A;  3F21 A;  2PEX A;  2W25 A;  5DUK A;  1BI3 A;  3T5X A;  5ICE A;  2KIU A;  3SZP A;  4ENN A;  5CVV A;  2RKH A;  2GA2 A;  4Z2Y A;  1B9M A;  2QBY A;  1LJ9 A;  4P96 A;  4GXO A;  2P8T A;  4KIC A;  5DCM B;  2UZK A;  3F8C A;  1R5H A;  3N4M A;  5F64 A;  1MDM A;  3FXU A;  3LST A;  1XN7 A;  3BRO A;  3K69 A;  1UB9 A;  2GAU A;  1YIO A;  5FB2 A;  2QEN A;  2NNN A;  1EH6 A;  3DQV C;  4BYY A;  4GYI A;  4ASN A;  2ZFW A;  5ILV A;  1K78 A;  2NNY A;  5ED4 A;  4A5M A;  2MBF A;  3RYP A;  3FMQ A;  2Z99 A;  4M72 A;  5CJ9 A;  3E97 A;  2OQR A;  4RGS A;  1ZRE A;  3ERE D;  2CGP A;  4FX4 A;  2VBW A;  2ZJ2 A;  3R4K A;  3BJA A;  3FWE A;  4FT8 A;  2J5O A;  5EEG A;  4UHT A;  1BM9 A;  2JTV A;  2V1D A;  2AXL A;  5E8I A;  2GA1 A;  1GVJ A;  2M30 A;  4ZZD A;  1EH8 A;  2DAO A;  1BI0 A;  3BJ6 A;  4DQ2 A;  4RS8 A;  4KDP A;  3MCZ A;  2VT3 A;  4YFN F;  2P5V A;  3N97 A;  3HSE A;  4GGG A;  1T6S A;  3CUQ B;  3LQQ A;  1R7J A;  4HDU A;  3KP6 A;  3F6O A;  2WWY A;  2ACJ A;  3CTA A;  2XAF A;  2QQB A;  5A2Q Z;  2M5W A;  3R6S A;  1ZLK A;  2YR2 A;  4G94 A;  4UV8 A;  2IVM A;  3U2R A;  4PCQ A;  2HWV A;  2LKP A;  3FHZ A;  4XSX F;  2FBH A;  4P9F A;  3JTG A;  4L18 B;  3HSR A;  2W57 A;  4RGU A;  4MQ9 F;  3M1E A;  2E7X A;  4ESB A;  1KA8 A;  3VOD A;  1J2X A;  3BP8 A;  3R60 A;  2PI0 A;  2D45 A;  2VBX A;  3F22 A;  4KA4 A;  1OKR A;  1FX7 A;  2ZKZ A;  3ABU A;  1I6X A;  3L9F A;  1SFX A;  1RNL A;  1O57 A;  3E6D A;  1FBQ A;  1XGS A;  4HYE A;  3IHU A;  1V3F A;  1WKM A;  2GWR A;  1DP7 P;  3E6B A;  4KIF A;  1O7L A;  2EFN A;  2ZXJ A;  4P9U A;  4KIG A;  2BBY A;  1FZP B;  4Y17 A;  3V7C A;  3FMR A;  3ZQ7 A;  4L0Y B;  1L0O C;  3HSF A;  2A68 F;  1ONV A;  4FX0 A;  3HOS A;  2K27 A;  3JW4 A;  4M9S A;  1RIO H;  4EM1 A;  1KQ9 A;  2ZO4 A;  4MHG A;  3GFI A;  3P9K A;  4I98 B;  1SAX A;  3E6M A;  1HSJ A;  3HYI A;  4Y13 A;  1FYL A;  2C6Y A;  4G7O F;  2ZME B;  4KUM A;  4LB6 B;  4HF0 A;  3COA C;  2HZT A;  3GFJ A;  2EB7 A;  1K6O A;  3DPT A;  4HF1 A;  2YSR A;  5E20 A;  3FXR A;  2O3F A;  3WTS C;  4ESF A;  1P4A A;  1LDD A;  3V8L A;  1O3S A;  4LLG F;  4LD5 A;  1ZRD A;  3F3X A;  5E1Z B;  4AIK A;  4H0E A;  4UV9 A;  5LLQ A;  1BIA A;  1D3Y A;  1ON1 A;  2Y75 A;  4A12 A;  1R00 A;  4HV5 A;  3GFM A;  5E17 F;  2VBY A;  5ICC A;  4KIB A;  3KP7 A;  2F5C A;  1HST A;  3M8E A;  5DCF A;  3U1D A;  5BPD A;  1HQC A;  3MZY A;  4AIH A;  4WWC A;  1O3Q A;  2WC2 A;  1XGO A;  1FBS A;  3BPX A;  3KFW X;  3EUH A;  3GX4 X;  1YLF A;  2XV4 S;  4KFC A;  2L02 A;  2FF4 A;  5LGU A;  3CUO A;  2JSC A;  1FYM A;  4WCG A;  4LMY A;  3P7N A;  2A3S A;  2UXN A;  2MH2 A;  2IRF G;  4A0Y A;  5FGM A;  2X0L A;  3I4P A;  5HLH A;  2OD5 A;  2STW A;  4PZJ A;  1SMY F;  2R7D A;  2QZ8 A;  5CLS A;  4XBF A;  1FT9 A;  2L3D A;  4HZF A;  2OZU A;  5A2Q K;  2DW4 A;  1IXS B;  2PLY A;  2HYF A;  3J7A O;  4WXC A;  4GYG A;  1S29 A;  5DEQ A;  1G3Y A;  1G3T A;  3GZ6 A;  2FXA A;  4M73 A;  1ZAO A;  2VE8 A;  2F5F A;  4HAM A;  2TDX A;  1T39 A;  3CO7 C;  4LK1 F;  5ILU A;  3KP2 A;  1AWC A;  1KYW A;  2ZNY A;  3LA2 A;  1P2F A;  5E8G A;  2L4A A;  4HW0 A;  2DQL A;  2DBB A;  1E17 A;  2O0Y A;  3BPV A;  2EFQ A;  1GXP A;  1W7P B;  4OMY A;  1TW2 A;  3NEU A;  2V9V A;  2AS5 F;  2FSW A;  4JBA A;  1IW7 F;  5FD6 A;  1T0F A;  2FMY A;  4MGR A;  1R1U A;  1B1B A;  1U5T C;  2VN2 A;  1STZ A;  2KIF A;  3MAJ A;  1U6G A;  2IA2 A;  2UWM A;  1XB4 A;  2LF8 A;  1RZ4 A;  1ZYR F;  1JHH A;  2DT5 A;  1WWX A;  3KLO A;  2GIV A;  2VOO A;  4I01 A;  3QAH A;  1FBU A;  5TRD A;  2QQ9 A;  1XMA A;  3WG9 A;  2HQR A;  2HYG D;  1XDS A;  3E3V A;  1LDJ A;  2R3S A;  2RC4 A;  3KP3 A;  4RGR A;  4I0A A;  4UVB A;  4PGH A;  2QM3 A;  3PQK A;  3FXQ A;  3GWZ A;  3ISP A;  2VXZ A;  5J6X A;  1HW5 A;  3K9T A;  4IPA A;  5LEK A;  2RVC A;  1U3E M;  3LAJ A;  1OYW A;  1LQ1 A;  1HBX G;  1W5T A;  4R8H A;  4I0B A;  1KU9 A;  1ZRC A;  4KNY A;  1R58 A;  2VBZ A;  5BQT A;  4L5J A;  4EQQ A;  3WGG A;  2L4M A;  5L3D A;  1UST A;  2EFP A;  2HOE A;  4UUV A;  4MNU A;  3J81 Z;  2QQA A;  4CGZ A;  1QGP A;  2K02 A;  4YII A;  4RAZ A;  4ENJ A;  1SFU A;  4A0Z A;  5BOX A;  1MJA A;  2CO5 A;  3ZN1 A;  4EV0 A;  3DEU A;  1Q1H A;  4UNO A;  1W5S A;  2B0L A;  3C1D A;  3SHF A;  1IN7 A;  1U2W A;  1R1V A;  3BDD A;  4KT5 C;  2DFI A;  2ETH A;  1Z7U A;  4M71 A;  4EM0 B;  1TBX A;  3I59 B;  4L9T A;  4YFK F;  5DCM A;  4OU0 A;  1FY7 A;  2P7V B;  3L2C A;  3LA7 A;  3JAM Z;  2IPQ X;  3WE2 A;  1I27 A;  3JSO A;  1ZG1 A;  1BC8 C;  2M45 A;  1Z9C A;  5H20 A;  3JSP A;  1I5Z A;  5JFR A;  3VFZ A;  3O2P E;  1IF1 A;  3GVA A;  1FSE A;  1Z1D A;  1HW1 A;  4EMS A;  2Z33 A;  2EWN A;  5J8F A;  1LNW A;  4WXH A;  5IT9 K;  4ENK A;  2XKO A;  3GXO A;  5LHI A;  1SD5 A;  2EJR A;  2G9W A;  3M8F A;  3F72 A;  2QBY B;  1IN6 A;  3EET A;  4ETS A;  1IN5 A;  2QLZ A;  4RB0 A;  5JHU A;  3Q9S A;  2MD5 A;  4KN4 X;  4LG0 A;  3CDH A;  1MDM B;  2FBI A;  2FNA A;  2GQQ A;  2VC0 A;  4CHU A;  5DUI A;  2XAG A;  5D4S A;  2XGX A;  1FLI A;  1ON2 A;  2PFB A;  5E1X A;  4CIC A;  4IRH A;  3GEZ A;  2DO7 A;  4L9N A;  1WSU A;  2NYX A;  4BAY A;  4A6D A;  5K5R A;  3FM5 A;  5CVR A;  1EH7 A;  5DD4 A;  2QVO A;  3GF2 A;  1B6A A;  3MFK A;  2LNB A;  4L5I A;  3RTR A;  1HW2 A;  1MJB A;  3F23 A;  3EYY A;  4ENM A;  1R5G A;  4G6D A;  3C18 A;  4UVA A;  3V8J A;  5LEJ A;  2MLK A;  3EDP A;  1FP2 A;  2MH9 A;  4EGY A;  1BIB A;  1FSH A;  3ECO A;  3L09 A;  1R36 A;  4HQM A;  4MQV A;  1YTY A;  4GCV A;  1KGS A;  3IWF A;  1L3L A;  2L54 A;  2MC3 A;  4LB5 A;  3RKW A;  5DYM A;  2VT2 A;  1D8K A;  1S7O A;  3DF8 A;  1YW7 A;  1OYY A;  2M1B A;  2ISY A;  2X4H A;  3ZMZ A;  2VON A;  1FPQ A;  5CYV A;  3WTZ A;  2Q0O A;  2OU2 A;  3DPL C;  3KCC A;  3IKT A;  1IUY A;  1PP8 F;  3MQ0 A;  3NRV A;  5LRR A;  4AIJ A;  4XLN F;  1CF7 B;  3TO6 A;  2OA4 A;  2KJC A;  3C3W A;  3D0S A;  5IT3 A;  1F4K A;  1YQA A;  3J81 K;  3H92 A;  1HKT A;  4Q5S F;  3IL2 A;  2COM A;  1JHF A;  1TQP A;  3IC7 A;  3ZMD A;  3WTU C;  2Z9O A;  2V1U A;  1B9N A;  1TQI A;  2A69 F;  4ESJ A;  4PDK A;  5HLG A;  4OMZ A;  2RDP A;  3P9C A;  2ELH A;  4B8X A;  2LSO A;  4HX7 A;  1SD6 A;  2PMH A;  2E1N A;  1FYK A;  4HLX A;  1JXS A;  3KZY A;  3VEP A;  4A0X A;  1J59 A;  4LLN A;  5HDG A;  4QWQ A;  4B09 A;  1IXR C;  4KMF A;  5LRS A;  3ABT A;  3IWZ A;  4UVC A;  2ZBK A;  3KP5 A;  4CXF A;  2UXX A;  2DU9 A;  3KEQ A;  2WTE A;  1D5V A;  3JAM K;  3BJO A;  4LJZ F;  4KN7 X;  1XSV A;  4NQW A;  3ROU A;  4R1H A;  1B4A A;  5CVI A;  2BYV E;  2D2W A;  2W85 A;  3W6J B;  3F8B A;  3KET A;  1T2K A;  1J0R A;  1GHC A;  1XSD A;  4MTD A;  2F5E A;  3HRU A;  2DLL A;  1PDN C;  3C7J A;  1R22 A;  2RN7 A;  1C0W A;  2XAQ A;  2D1V A;  2E1C A;  2H6B A;  1RUO A;  1HKQ A;  3MWM A;  5AIQ A;  2ZNZ A;  2PG4 A;  2FQ3 A;  1TNS A;  3DP7 A;  4O6J A;  3LWF A;  2XRN A;  1D8J A;  4EJW A;  3M9A A;  2H6C A;  3MZH A;  3RPQ A;  3G3Z A;  3E5U A;  5D8K B;  3GUD A;  3MEX A;  1R23 A;  4OIQ F;  1DUX C;  3RKY A;  2DK8 A;  1USS A;  3V4G A;  1G6N A;  4IVN A;  1GXQ A;  4BNC A;  5FFX A;  4ZYE A;  4XLP F;  3WGI A;  2FEZ A;  3QP5 A;  1QZY A;  4LFU A;  1O3R A;  1LB2 A;  1QBJ A;  1G3S A;  2A5Y B;  4HA8 A;  5AIP A;  2XAS A;  3OV8 A;  5BPI A;  2O61 A;  1MKM A;  2Q8K A;  2V79 A;  2IJL A;  3QU3 A;  2NAZ A;  5L3F A;  2M87 A;  3TOA A;  1U5T A;  2E7W A;  4K2E A;  3HHG A;  1YS6 A;  1RI7 A;  1IN4 A;  2Z5U A;  4BHC A;  4M9X A;  2QWW A;  3TKY A;  2ESN A;  5LGT A;  1R1T A;  1OPC A;  3WTW C;  5HVQ C;  2EFO A;  3FX3 A;  4BHB A;  5HDK A;  3HHH A;  1W4M A;  5F1R A;  1JGS A;  1XGN A;  3F8M A;  5E1W A;  3GFL A;  2YU3 A;  4ZYD A;  2P7C B;  4G8X A;  5L3G A;  1O7F A;  1ZAR A;  3RI4 A;  1LDK B;  2KIM A;  1ZLJ A;  2XIG A;  1XMK A;  4A2U A;  4WF2 A;  2CG4 A;  2HQN A;  2JRT A;  3LQR A;  1ODD A;  5D5X B;  1B59 A;  2FNP A;  3E5X A;  1UFM A;  3LFK A;  3I58 A;  1YS7 A;  4I02 A;  1S7A A;  2Q2E A;  3E5Q A;  1F1Z A;  2VC1 A;  4N9I A;  4NB5 A;  4F7Z A;  4HX8 A;  3ULQ B;  4HQE A;  3F8N A;  5ICF A;  5LGN A;  3GYH X;  3U9G A;  1QZZ A;  4OOI A;  1BN5 A;  3IKV A;  3TQN A;  1SD7 A;  1YFH A;  1ZRF A;  4JQF A;  4N9H A;  4GO1 A;  1Z91 A;  1DPU A;  1YW9 A;  3WOD F;  5H6Q A;  3WTT C;  3RIR A;  2G7U A;  3K0L A;  2EV5 A;  4ZH4 F;  5CVJ A;  2PJP A;  2OAZ A;  3S2W A;  2HTS A;  2DPU A;  5HLI A;  3JTH A;  2FA5 A;  3KZZ A;  5F6F A;  2ADU A;  1H9G A;  4TV7 A;  3V7S A;  2HR3 A;  1YYV A;  3R61 A;  5HDN A;  2LF7 A;  4EM2 A;  3QU6 A;  5L3B A;  4D0P A;  4M9Z A;  3NQO A;  1QQI A;  3I59 A;  2XAH A;  4O3M A;  3RDI A;  1FNN A;  1KQ0 A;  4U88 A;  3REO A;  1UHW A;  2IW5 A;  3L00 A;  1Z6R A;  1ZN2 A;  2HFH A;  1S6L A;  2W84 A;  1ZGJ A;  4RB2 C;  3OOP A;  2KKO A;  2ISZ A;  2NS0 A;  3EYI A;  3IRR A;  4Q48 A;  5D5W B;  3FF5 A;  2JPC A;  5CVU A;  3O6B B;  2FBK A;  3RPU A;  5D5V B;  5D4R A;  5JR3 A;  2QUF A;  4EJT A;  5K5Q A;  1PUE E;  5HS8 A;  2OBP A;  4L9J A;  1JE8 A;  1KU2 A;  1MGT A;  2XKP A;  2ESH A;  4U7D A;  1FOK A;  1LVA A;  1ULY A;  2V1X A;  4MEY F;  1F9N A;  2MLG A;  1IN8 A;  1FP1 D;  2H94 A;  4HDV A;  1YO5 C;  2YX4 A;  1MZB A;  3WTX C;  4HOB A;  3ZN0 A;  4IRG A;  3FZV A;  2KRF A;  1SFE A;  3R0A A;  4BQA A;  2M8E A;  1CGP A;  1T38 A;  3P9I A;  5KK1 A;  2NRA C;  4M74 A;  2R7F A;  3GW2 A;  3G73 A;  2L01 A;  3DXJ F;  1QNT A;  1I1S A;  2D1H A;  2IA0 A;  1K78 B;  1KU7 A;  3HRM A;  2OZ6 A;  3GZ5 A;  2HGC A;  1XCV A;  3SXY A;  2XVC A;  2FRH A;  1FC3 A;  2RV8 A;  3CUQ A;  4AVP A;  3L7W A;  4LK0 F;  4IHT A;  3WE3 A;  4LG0 B;  4P55 A;  3TO9 A;  1A04 A;  3CLO A;  4UXN A;  2QYO A;  1J5Y A;  1SD4 A;  4G9Y A;  4RGX A;  4NHJ A;  1G3W A;  1XDU A;  2LDU A;  3O3K A;  2XHK A;  1BI1 A;  1XSX A;  3HRS A;  2F2E A;  2HEO A;  2PBI A;  4HBL A;  4ZYG A;  2XAJ A;  2EV0 A;  2K4J A;  4OIO F;  2J5P A;  3CUQ C;  3Q5F A;  2P5K A;  5J8C A;  1Z05 A;  4IJA A;  5ICG A;  4N0B A;  2RNJ A;  2DPD A;  3TGN A;  2P4W A;  4BH9 A;  1YG2 A;  3VB2 A;  2OQG A;  2HS5 A;  3QPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...