3GTKJ

Backtracked rna polymerase ii complex with 18mer rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3gtkJ00
3B6CA 4D5CA 4C3JJ 1A5JA 1W0TA 4XK4A 4J19A 3W6VA 2Y2ZA 1ETXA 2VKVA 2P81A 2ME6A 1B8IA 2FD5A 1APLC 1HCRA 2K9QA 2L0KA 4A3LJ 4XRSG 4XRSA 1HDDC 3BQYA 1RKTA 1MNMC 3TEDA 2DMPA 3JRFA 3JRHA 3O8HA 2OF7A 2JMWA 1I6HJ 2VKEA 3RZDJ 3PM1A 4X1EA 1XG1A 3LSRA 1WCMJ 2DMNA 5F27A 4A93J 3B6AA 3BR5A 2HYJA 4D5FA 2DA6A 3I4MJ 3NARA 3CQZJ 5GPAA 4IHWA 3BTJA 2G0EA 1FIPA 3JRDA 3GTPJ 4B1RA 1AKHB 5M3MJ 4IHYA 3H0GJ 5FLVA 5IYBJ 1U9OA 1WH5A 3G1LA 2R0QC 3BG3A 4M3GA 3FISA 1ZTRA 1QVTA 1HF0A 4A3IJ 2JA5J 3JREA 2IEKA 1TWGJ 3ZQCA 5J1YA 1R9TJ 1Z77A 5FKLA 1GV2A 1TWAJ 2JJ7A 1UMQA 4BBSJ 3S1QJ 2D5VA 2NVTJ 4MO7A 2DA5A 1OCTC 4M3BA 1U9NA 2OPTA 3G1MA 3RZOJ 1WPKA 1ITYA 5J1RA 3OOUA 4MFEA 5JLXA 5BNGA 4XRMA 1HDPA 2JN6A 2IBDA 2YUSA 2DA1A 3NAUA 2E2JJ 3RKQA 2COBA 1AKHA 4B3AA 1JUMA 1I50J 1CQTA 1K61A 2LFBA 3BQZA 1SFOJ 2HOSA 4I76A 3OSFA 5FKNA 4A3GJ 2O8KA 4RDUA 3HDDA 4JYKA 5K7HA 5FJ8J 3JRGA 3E7LA 3Q0VA 1FTZA 2LP0A 4FCYA 1ZR4A 2WV1A 4DYCA 3G1OA 3HB9A 2JA6J 4BBRJ 1ZK8A 1IDYA 2FQ4A 5K7ZA 1IUFA 2DMQA 2JK3A 4BXXJ 4Y52J 1ETYA 2NVQJ 3HGYA 5C3EJ 1T33A 2DJNA 4D7NA 1X2MA 4DZPA 2LY9A 5JLWA 4JX6A 4A3KJ 4B4CA 1TWCJ 1IDZA 2FX0A 2EZKA 1MBJA 2EH3A 4GFBA 4EEFG 1TC3C 1MBHA 5E3OA 2WAQN 1NK2P 2L7FP 2VUMJ 3PO2J 2CRGA 2KDZA 4CYCB 1H88C 5EYRA 4MLOA 1NK3P 1RESA 2Y9YA 2AHQA 2EQRA 2ME0A 2ECBA 1GVDA 1H8AC 2FJ1A 2Y0SN 1ZKGA 5EG0B 4M6VA 2DA2A 1JGGA 2LTPA 3TP0A 2R92J 1K83J 3HOVJ 1YRNB 3LSPA 1AHDP 3A01B 2QF7A 3BR2A 1DU0A 1QPIA 3FK7A 3ZQFA 4G12A 5IOYA 2L9RA 5IYDJ 2EZLA 3LSJA 1XS9A 2LVSA 4DZJA 4IEJA 4CYCA 5DTDA 1ETVA 1Z0XA 2HOAA 1U8BA 2XGDA 2ZB9A 4V2FA 1S7EA 2XSDC 1DU6A 5C4JJ 1WI3A 1GT0C 4BY1J 5EDNA 3S16J 3M4OJ 4A3EJ 4V2GA 1X2NA 2VPRA 3QPLA 3Q0WA 1YRNA 4UUTA 2K40A 2Y30A 1ORKA 3LOCA 3S1RJ 2DMUA 5GP9A 1BW6A 1JT6A 2ELKA 2AO9A 2N8GA 2E19A 3DEWA 2H1KA 5J1UA 2LR8A 3TW7A 1Y1WJ 5EZHA 3S1NJ 4A3BJ 3HOWJ 4DYRA 2ID3A 2VI6A 2W48A 2M34A 4AUXA 2XGEA 1AU7A 1SANA 2Y9ZA 4DW6A 2DTZA 3RQIA 5HODA 2KT0A 2K9NA 1JKRC 3A03A 1FIAA 3DCFA 2X48A 4FE4A 1VFCA 1WH7A 1E3OC 3ZQLA 2R7ZJ 3CDLA 2HDDA 3BR6A 3MKLA 5M5YJ 2EZHA 3TP3A 4UUSB 3S1MJ 5IP6A 1A6IA 5M5WJ 1ETKA 4LOCA 3GTMJ 3QQAA 1JUPA 2EBIA 2Y31A 3MVPA 2CJJA 2GM4A 3GTGJ 2L7ZA 4A3JJ 2M0CA 2MG4A 4ABZA 4C3HJ 3OIOA 3GTJJ 1G2HA 4RBOA 4A3CJ 2YU9J 5IPAA 1D5YA 2O9LA 4M3EA 3Q0UA 3I4NJ 1HOMA 1P7IA 3VPRA 4JX4A 1T56A 2L7MP 2CUFA 3MN2A 5F08A 3FKIJ 1GUUA 1UHSA 3HKZN 3GTKJ 1JKQC 2R5ZB 1Y1VJ 4UUSA 1B72B 3LSGA 2HOTA 2XPUA 1EF4A 2CQQA 5IYCJ 1GDTA 5F0CA 5F04A 2GLOA 5E3MA 3Q3SA 1MH3A 2JWTA 3BR0A 4NDLA 2DMTA 1IG7A 5FKKA 1JJ6C 2MGQA 1QRYA 1MBGA 2LLKA 4IHVA 1FEXA 3ZQGA 1MBEA 2JA7J 5C4XJ 2LD5A 1BW5A 1JT0A 5IP7J 3BG9A 3JR9A 2MW8A 1ZGWA 3WHBA 1ZR2A 4A3FJ 1BJZA 2R5ZA 1IV6A 2H8RA 1NTCA 3GBGA 1B72A 5IP9J 1LFBA 2DA7A 3A02A 3HOUJ 4FTHA 3M3YJ 4M3FA 3WHCA 2CUEA 5C44J 1O4XA 2NVXJ 1IJWC 5M5XJ 2XB0X 3SJMA 1F43A 1JUSA 2CQXA 2XRLA 1JTXA 5FKMA 1MBKA 2X9DA 1FTTA 2PMZN 2LK2A 1LFUP 1UG2A 5FLMJ 1ZQ3P 1FJLA 3ZOBA 3S15J 1PUFB 3FIWA 4MIMA 3D1NI 5EZGA 1MSFC 2MSYA 5DS9A 2IAIA 4AYBN 5EG0A 3BG5A 2HXIA 5E3NA 1JJ8C 2QCOA 4IHXA 3A01A 1HLVA 4D7MA 2DA3A 5F0FA 1GV5A 5EF6A 4XICA 2HQ5A 1JKOC 2TRTA 4AC0A 1XC5A 1ETOA 3BTIA 3JRIA 2CU7A 1MBFA 4DYQA 1OCPA 3HOYJ 1BA5A 4MFDA 2E2HJ 2NS7A 3K2AA 3JRBA 1LE8B 2XB5A 9ANTA 1TWHJ 2WB1N 2NVYJ 4BKXA 1JKPC 1F36A 5F0HA 1PUFA 3GTOJ 1RR7A 2GBYA 1RPWA 4JX5A 3HOXJ 3BR3A 3JRCA 3ZQIA 4W97A 3SDGA 2M8GX 2ID6A 1P7JA 4QIWN 3FK6A 3IV5A 1ENHA 5FKOA 3HM5A 2R5YB 3GTQJ 1BL0A 2ECCA 3H3VK 1MH4A 1QVUA 3HEFA 1RETA 4L5EA 3PO3J 3O8GA 2XPWA 2R93J 1X58A 1OJLA 3QPSA 2LKXA 2K9SA 3BTCA 1LE8A 3BR1A 5F1JA 3S2HJ 3HBLA 1VI0A 4W1UA 5EGOB 3L1PA 2JA8J 4HNVA 2M2EA 3HOZJ 2I10A 4QTRA 2HXOA 4FISA 4C3IJ 2RAEA 4QSHA 3JRAA 1JTYA 3S14J 1Q1VA 3OSGA 2X6OA 1ETWA 1RKWA 2XPVA 4M3DA 4A3DJ 3GTLJ 4XIDA 2E2IJ 2B63J 2NS8A 4JP0A 2R5YA 2DN0A 3BTLA 1I3QJ 2DA4A 4BY7J 5E3LA 1H89C 2E1OA 1VNDA 4C2MJ 1WGXA 5K7FA 1ETQA 3HGGA 1VF9A 3TW6A 4FE7A 3S17J 5EEAA 2EZIA 3IH4A 4A3MJ 1IC8A 1IRZA 5EGOA 3BT9A 1MSEC 2XGCA 1B8IB 3IH2A 1OFCX 4Y7NJ 3CMYA 3F0CA 3K7AJ 5GPCA 1U78A 2O7OA 2M9HA 3CCYA 4A69C 1TWFJ 5M3FJ 1POGA 3IH3A 3S2DJ 4S0HB 2NOGA 3ZQHA 2HI3A 2YS9A 5IOZA 1W0UA 5J3LA 3UKGA 3C2BA 3SFIA 4X6AJ 1IGNA 2TCTA 3LNQA 4I6ZA
chains in the Genus database with same CATH superfamily
1R00A 3B6CA 1BIBA 1Y8RB 3J81Z 3OYCA 3OYAA 1W0TA 3F23A 3W6VA 3WTWC 4AVZA 1SFEA 2P81A 2XAGA 2ME6A 3CP8A 1B8IA 4HLXA 2HYFA 1WI9A 3K1PA 4E70A 3A1YA 3LMMA 1OISA 3VOEA 2STTA 2BY3A 4L0YB 5FRMA 1LJ9A 1WSUA 2LBFA 5B3SH 1A35A 1OCRH 4ZDLA 3JRHA 5FLXZ 1IRFA 2X6WA 5KAIC 4CCOA 1F4KA 3HOSA 1XG1A 4H4KC 1WCMJ 4A93J 2OCEA 2ZO4A 1HKTA 1S7AA 1JXSA 3HOTA 4ANJA 3TL4X 2ZCWA 1W5TA 1FSEA 3LSTA 2YX7A 4DQ2A 4CUGA 3AG4H 4IHWA 1IN7A 3OYFA 1FIPA 2W82A 3DKWA 3MZ8A 5IY5H 4U7DA 4CDGA 3H9JA 2YX4A 3HL2A 1AKHB 1MKMA 3LSKA 4HF1A 4FT8A 4YFXF 2R0QC 4KISA 3FISA 3I54A 3K4LA 1QVTA 1HF0A 1WJCA 2KLOA 4CH7A 1S7OA 3Q9VA 1HW2A 5J1YA 2RC4A 2ZNYA 4BDYA 1R9TJ 2IGOA 3RJPA 5B1AH 1AA7A 1M1EB 3M07A 2DPDA 2JJ7A 3DPUA 3J7YJ 1UMQA 3C7JA 1BN5A 3VFZA 2X1CA 5IT9Z 2IRFG 2BHYA 2DA5A 5KHDA 1FLIA 4YEJA 2OPTA 2EFOA 2XC7A 3HHHA 3RKXA 1FBUA 1YW7A 2FU4A 1VQKI 1XMXA 2COBA 4QLCU 3F6VA 4LLLA 3OY9A 4N9HA 3ASNH 4U88A 3BQZA 2HOSA 3FXJA 4BU2A 2ZXWH 5E1XA 1EV7A 3VYUB 4A3GJ 3MWMA 4RDUA 2H8WA 3V42A 2XSJC 5K7HA 1VQOI 4XLEA 2FNPA 3H3UA 2WV1A 4DYCA 3BDDA 3RSNA 2I5UA 1MZBA 1ZK8A 2BXZA 2FQ4A 4UB6C 4HRIA 2NVQJ 2AQEA 4C30A 2L3DA 4IXAA 1KU2A 1V4RA 2JUGA 3C3WA 4U87A 2VIXA 5JLWA 4JX6A 5TGTA 3V4GA 5LRSA 1B4AA 3CMEI 4DNCA 3PJRA 2C6YA 2UWMA 2X85A 5CQGA 3I3LA 3ZQ7A 2AQFA 1MBJA 3ZMZA 2ZSIB 2VQHA 1TC3C 2VQLA 1RC9A 3WE3A 1EH6A 3CJQB 4G94A 3J7ZI 2CRGA 1HKQA 1G3TA 4Y15A 3QWLA 5BS6A 2O03A 3IRRA 2O0YA 1IRXA 4MLOA 3L2UA 3J81K 4XSXF 2EFWA 1RESA 3IUOA 2CMPA 2AHQA 3KCCA 1N78A 5H2FC 1V5FA 3SHFA 4CZZA 4WCGA 2KIUA 2LTPA 4OMZA 2GA1A 4S05A 3W6JB 2W24A 3BR2A 5FLXK 4G12A 2NNNA 3G4SI 2XF7A 2HQAA 4X0GA 2H09A 2E60A 1VQ6I 1LNWA 4BHCA 1WZ2A 5CPRB 3KE2A 1IW7F 2MC4A 1O7FA 2ZB9A 1YG2A 1ZG1A 2ESNA 1S7EA 1DU6A 3ZRGA 2GXAA 5C4JJ 1GT0C 4G6TB 1O57A 3F8BA 3NEUA 3FMRA 4L5IA 1XSDA 1VTNC 2PJRB 2VBYA 3QPLA 3Q0WA 4GCVA 1ZGJA 4UUTA 1YRNA 2K40A 2CFXA 5TRDA 2A07F 4A0ZA 1MNEA 3A0HC 4R8HA 4V19K 4HX4A 1Z91A 4FHTA 1BR1A 4CYDA 4E7JA 4PCQA 2KIQA 2WAEA 2XAFA 3TW7A 4HPQA 1T2KA 2F48A 3EQLF 2FBKA 3H92A 3ASOH 1XCVA 5IT9K 3HOWJ 3KP6A 2TDXA 3PL8A 3KIOA 2W48A 3HPHA 3TMOA 4AU7A 4WK8F 1IO2A 3BCBA 3MKWB 1K4TA 1FOXA 2DTZA 2KT0A 5DCMB 1E2XA 4HDVA 3BZKA 3DCFA 3CF5F 3H9GA 4IOAF 1IF1A 3FBIB 1Y0NA 3LQRA 2X1EA 3CCUI 2R7ZJ 3CDLA 2FE3A 3H5NA 2R7DA 1BM9A 2V6CA 3ABLH 5HLIA 3R61A 2GOXB 4F7ZA 3DKXA 5FD6A 3SZGA 5M5YJ 3K2ZA 2EZHA 4LG0A 3ZGKA 3FDYA 1BI0A 2FOWA 3HSRA 4KT6A 3CCMI 3QQAA 1JUPA 2CJJA 2HTJA 1WJ5A 2ZC2A 1R36A 3R60A 2GM4A 3GTGJ 1B59A 3JTGA 4RAGA 1WFXA 2L2OA 4ABZA 3GTJJ 1G2HA 3GFLA 2O6GE 1KQ8A 5IPAA 4M3EA 2HZDA 1P6RA 3V7RA 4FASD 1B9NA 1P7IA 1HOMA 2QM3A 3LWFA 4PGHA 4XLHA 4JX4A 2A61A 1T56A 4RA2A 2CUFA 3KP7A 2LG4A 3MN2A 4L9TA 2IGNA 5F08A 4BEHB 4A5MA 1GUUA 1UHSA 3RKYA 4ZDPA 4EMSA 3CCRI 4FQGA 4ZTJA 3WU0A 1W36C 4BQOA 1YTYA 2K3FA 3CDHA 1K78B 3LSGA 1XCBA 2PMZA 2P5VA 3SQNA 2CQQA 3K70C 2M1BA 2E5ZA 3MZYA 2DTRA 3S93A 2QQAA 1T98A 2A5WA 4NDLA 5E3MA 1LPQA 2GLOA 4M6YA 3IWZA 5FKKA 1O7LA 3I71A 4OOIA 4ENMA 5LHHA 1HXDA 1FEXA 4LLNA 3CESA 4HEA2 1BW5A 2MC3A 4PSXA 3JR9A 2MW8A 1MMGA 1ZR2A 2JPCA 1R71A 4A3FJ 1IV6A 1NTCA 1QNTA 1FYKA 2MH2A 4IL6C 1YJWI 1WJFA 2DA7A 2DW4A 1X1DA 1I39A 3G2BA 3TKYA 3TO6A 3WGGA 5C44J 1V3FA 1IJWC 2XB0X 3VYTB 3SJMA 1F43A 3C2GA 2XRLA 3KLOA 1FTTA 3SDBA 2VONA 3HTUA 3U9GA 1LFUP 2YPRA 2O5RA 4XMYA 5K1YA 5DM6F 1YIOA 4I01A 3SEZA 2LF8A 3S15J 1PUFB 4ESFA 1H9TA 2E35A 3DP7A 1MSFC 2CW8A 3RTRA 2GA2A 4XKVA 5EG0A 4UVAA 2A3SA 3OL4A 2QCOA 1FOKA 1Z7LA 3I56I 3K10A 5EF6A 1T0FC 3FXOA 2HQ5A 1HW5A 4BE0A 1JKOC 2D1HA 3RDIA 3JW4A 2VQCA 3CDIA 1D3YA 3FXRA 4DYQA 3ABTA 3AAFA 3KP2A 3MD2A 1Y0UA 4NC8A 1BA5A 2JT1A 2RV8A 4MFDA 3RYRA 2E2HJ 3JRBA 1J0RA 9ANTA 1GLNA 5J6XA 2M7BA 2NVYJ 5LHGA 3ZN0A 1F36A 2AXTC 2CO5A 4HOBA 3HOXJ 3S3MA 5FO5A 2KJBA 3ZQIA 2DI3A 2E1MB 3SDGA 2VC0A 1CGPA 4QIWN 1T0FA 4PJ0C 3W2AA 3PNTA 1KQ9A 3CUQA 3FK6A 3E6DA 2QQ8A 4KFCA 5AIPA 2CV0A 3CJTB 3BPXA 1MH4A 2EV0A 2VN2A 1R5ID 1S5LC 2BV6A 3OR2C 1IN4A 1SD4A 2KRFA 1LVAA 3BTCA 1LE8A 3HTSB 4MTEA 3U1DA 5IT3A 1MMNA 1OCCH 2X6XA 5LHIA 2JA8J 2LMDA 4I09A 4HNVA 1DPRA 4BJTA 3T8RA 3BC8A 2GIVA 3A2KA 4QTRA 3DLLF 1MW7A 2W25A 2BBYA 4C3IJ 2RAEA 4QPQA 4QSHA 3JRAA 2Y48A 5ILSA 4GXOA 3W6KB 3DKYA 3RI4A 3I53A 2XPVA 2JPBA 2BYVE 3CMMA 2YSRA 1I3QJ 2DA4A 2HQNA 4BY7J 2RN7A 3DQVC 4F55A 1D0ZA 1VNDA 4HX7A 4C2MJ 1WGXA 2Y0SA 1H89C 2VE9A 1ETQA 2LREA 2CYYA 3HSEA 3EYIA 2HWVA 3S17J 3IH4A 5EGOA 2V9VA 1MSEC 2GWRA 3CMYA 3F0CA 3K7AJ 3CO6C 5HLGA 2NRAC 2BGCA 4Y3OA 4HBLA 1I5ZA 4S0HB 2GXBA 4XKBA 2ZFWA 3ABMH 3ZQHA 3HPGA 3UKGA 1HSJA 2A5YB 3SFIA 1DDNA 4DBRA 2WTEA 5H6QA 4O6JA 4UVCA 4ON0A 3IKTA 4I6ZA 1MIJA 2DFIA 4C3JJ 1IAWA 2RGVA 5KNLA 4N9IA 4CGZA 5ICCA 4XK4A 2XRNA 3OS2A 1D0XA 4E7IA 2R7VA 3EYYA 1YHQI 1PP7U 1MGTA 1XDSA 2VJJA 1HCRA 2DJIA 2K9QA 2L0KA 4XRSA 4I02A 3FXQA 3QYFA 3BQYA 1IUYA 3CUOA 1NH3A 5ICEA 3V8JA 1B6AA 5GAGJ 3TEDA 2DMPA 5HLTA 1G4DA 4ENKA 2OF7A 5BOXA 2FMLA 3PM1A 4X1EA 1DP7P 3LSRA 4LFUA 4HNUA 5F27A 3B6AA 3C18A 2E34A 5KVRA 3P7NA 2PX9A 4G8XA 1BR2A 1LKXA 3BR5A 3DV8A 4KYWA 2P6TA 3OS0A 2J5OA 2HYJA 4D5FA 2VL8A 2DA6A 3N4MA 2VE8A 2HZTA 2VBWA 4NQWB 1V54H 2IXSA 1TTYA 3M1CA 3TOAA 3BTJA 4O3MA 2M4GA 2O61A 1VQMI 3PNYA 4EM1A 4I98B 3C2HA 3GTPJ 2JA2A 3GF2A 3CJRB 1XGNA 4KUMA 4B1RA 2UXNA 2HKXA 2KRCA 5M3MJ 4IHYA 3H0GJ 2QYOA 2DYSH 1USTA 3G1LA 1TQMA 4M3GA 1HC8A 1UFMA 2CV1A 3T1BA 3EUKL 2O3FA 1YS6A 3JREA 4A2UA 1TWGJ 2XAUA 2HQRA 4AIKA 2R7UA 4MNUA 3G71I 1GV2A 3M9AA 1TWAJ 3GCMA 1R49A 4UV9A 2D5VA 2NVTJ 1ZHFA 3GXOA 3RZOJ 2GQQA 1ITYA 1KYWA 2E1CA 2CQ7A 4F93B 4J01A 2DFHA 3QRFF 4MFEA 4XRMA 3RPQA 3OYIA 2EK5A 2NYXA 3HKZA 2JN6A 2IBDA 2XROA 2DA1A 3NAUA 2E2JJ 1AKHA 1OKRA 1ON1A 3L2RA 4B3AA 2F2EA 1KGSA 2BOLA 4ZTFA 4D9JA 1I50J 1U3EM 2LFBA 4I76A 1IV8A 1BIAA 2P6SA 4Y17A 1FPQA 3F8FA 2K7LA 2LY1A 3QPTA 5J8FA 2ZMEC 3Q5FA 2P5KA 5FJ8J 2W57A 3GWZA 3E7LA 3QODA 3G1OA 2NAZA 3HB9A 3M8FA 2IS1A 2Y75A 1IDYA 2HDCA 2RQQA 5K7ZA 1IUFA 1X1AA 2JK3A 4BH9A 4NUBA 1ETYA 4PGGA 4BXXJ 4Y52J 5C3EJ 3EUHA 4I0AA 2F6CA 4BACA 1QPMA 1T33A 2DJNA 4D7NA 1L3LA 1BJAA 1TZLA 2MD5A 2CSOA 1FC3A 2YU3A 2IS2A 3AFHA 4A3KJ 1SVOA 3I64A 3VYSB 3PIPF 2CV2A 2RQPA 3BP8A 3MMYB 2Q8KA 5BQTA 1Z9CA 2EH3A 1U8RA 2VPLA 1NK2P 5CVIA 3PO2J 3WTTC 1IN8A 1X1CA 2PMHA 3S32A 3BZCA 4RAFA 4CYCB 3BOQA 3AG1H 2CGPA 5E1ZB 3BROA 3FMQA 4FX0A 4BAYA 3T0YA 1VQ8I 1LDKB 3OIPA 2VJIA 3HRMA 3HC7A 4XOPA 2IA0A 5DV5A 4E7ZA 1X1BA 2UUZA 2Y0SN 1WJBA 1ZKGA 4E4HA 1GXQA 2DBBA 5CVVA 4M6VA 2H6CA 4MEXF 3TP0A 3HOVJ 3LSPA 4KICA 4R79A 3WU1B 3H35A 2QF7A 1R1VA 2FBHA 1DU0A 1QPIA 3FK7A 3FXMA 3ZQFA 3TDZC 5IYDJ 3LSJA 3ZN1A 1XS9A 3HYIA 4OWRB 4M74A 3TDUC 4IEJA 5DCFA 5DUKA 5FFZA 3TOBA 1ETVA 4D1QA 3CCEI 1Z0XA 4HF2A 1O3SA 2L5QA 2BW3A 3SYTA 5KK1A 1TLHB 3RQ4A 3RIRA 4NHJA 1EH7A 2QENA 1ACIA 3LSHA 2DDAA 3BJAA 4ZC3A 2DFFA 3QU3A 4EJTA 2EINH 2BVMA 3ELKA 2L02A 4A3EJ 2XVCA 4Q5SF 4BXFA 4PZJA 3VEPA 3LAJA 1USSA 2Y30A 5KCMA 1XGMA 5FGMA 2DMUA 3VDXA 2K86A 2ELKA 2AO9A 2M87A 5L3CA 2N8GA 2HDWA 2V1XA 2M45A 3DLAA 2OQGA 5JVGF 2H1KA 3TQNA 2LR8A 3S1NJ 4YIFA 4WXHA 3KZYA 1EH8A 4P55A 3ULQB 2X6YA 1SANA 1WKMA 2Y9ZA 2P7CB 2ZSHB 2EILH 3LA3A 2PJRA 2YR2A 1FIAA 1J2XA 5KAFC 4FE4A 1VFCA 1WH7A 2JUCA 2E5NA 5A2QZ 2VOPA 5D6EA 1TQPA 3D0SA 5HLHA 2ZMEB 3KEYA 4E6KG 3CCJI 1X1PA 1VZ0A 4HF0A 5CJ9A 3TP3A 4UUSB 1FMVA 3FF5A 3OIQA 3S1MJ 5M5WJ 2DPUA 4G6QA 1QU3A 3WTSC 4LOCA 1AWCA 2LRDA 3NWTA 4M9ZA 1R6RA 2EBIA 2Y31A 4I0BA 3MVPA 4I99C 4DIQA 4EVIA 3WGIA 4A3JJ 2FEZA 4CCNA 4C3HJ 3OIOA 5DCMA 4AIJA 3L2CA 3VSLA 2O9LA 1FBSA 1LEAA 3VPRA 5L3FA 4F3QA 3ZMSA 3DEUA 4HW0A 4WX9A 4KIBA 3FKIJ 1WJDA 3HKZN 4KN7X 3K70D 4QWQA 5D5XB 1XGSA 3PSIA 3W2VA 2FXAA 2QSGX 4NB5A 1G6NA 3CC2I 2XPUA 3FXUA 2RNGA 2B7EA 1Z05A 1MMDA 1HA8A 3HZJA 5F0CA 3PUFA 3K1MA 1SMTA 2A6HF 2JRTA 4BQQA 4UNOA 3KZZA 3Q3SA 1MH3A 3MKZA 2DMTA 1G3SA 1J5YA 2MGQA 4OIRF 4KA4A 4PDKA 4RGSA 2LLKA 1FBQA 4IO9F 2EV5A 2JA7J 1W5CC 2LBFB 2ZJ2A 2UXXA 2ZBKA 4RGXA 3MZHA 4CA0A 4BEHA 5LEKA 1W7PB 2DYRH 3S3NA 2E7XA 1I1SA 1BJZA 2MD0A 3OWTA 3ZMUA 4ZZLA 2V4JC 2QQ9A 3DBLB 1OR7C 1SC7A 1K78A 4P5OA 3A02A 3LQQA 4ITVA 3HOUJ 2MLGA 3M3YJ 1Z67A 4PSWA 3WHCA 2DDBA 4BQAA 1O4XA 2NVXJ 2VLAA 3DTIA 3QAHA 2IT0A 2CQKA 5TJJA 4M6XA 5M5XJ 4FX4A 5JI6A 4DJAA 3MEXA 1TP4A 4MGRA 3E97A 2VJ4A 1MBKA 2V26A 2X9DA 1CF7B 2L54A 1TW3A 1UJ8A 4K2EA 1TT5B 3HIFA 3H5AA 1Z21A 2X4HA 3FWEA 4KNYA 5FLMJ 1TBXA 1FJLA 1D1AA 2IS4A 3BZ6A 2W84A 3TO9A 3FIWA 2CUZA 4MIMA 2KZVA 1VQ9I 3O2PE 1U5TC 4MQVA 4EATA 5DS9A 5BMZA 2HXIA 5E3NA 1OR7A 3ML6A 1JJ8C 3I59B 4PFOA 3A01A 3QP6A 4KT5C 4KMUX 2R7OA 3K6GA 4D7MA 1R5GA 3W3CA 2MABA 1GV5A 1NHAA 4XICA 2DOFA 3E5XA 4CO8A 1HSTA 4Z2YA 2LH9A 2TRTA 1T08B 1XC5A 4AC0A 3JRIA 1X4PA 1ONVA 1OCPA 2V1NA 5CQEA 2OA4A 3BCAA 2QBYB 3K2AA 1R58A 1TNSA 2GXGA 2XB5A 4GYIA 3R4KA 6PAXA 3FX3A 3GTOJ 1PUFA 1MD0A 2WY8Q 2GBYA 1RPWA 4XN0A 2V1UA 1Z3XA 4P9UA 2HU9A 2JVGA 2M5WA 3K4KA 2M8GX 2XASA 4XR6A 2QA4I 1P7JA 2QSHX 1D1BA 2X1DA 5A2QK 2E1MC 1C0WA 2DK5A 2EA4A 3FXLA 2ISYA 3EETA 3EUAA 3HM5A 2BEOA 2R5YB 3OYNA 5J4VA 4Q4ZF 3GTQJ 3H3VK 3HEFA 1RETA 3T5XA 2R93J 4LJZF 3V8KA 3J80Z 2HS5A 4N0BA 3F21A 3QPSA 2LKXA 2K9SA 3HBLA 4F92B 3L1PA 4W1UA 1IRGA 3Q9SA 1VQNI 2WAQA 2M2EA 4AIHA 1P4XA 5CVJA 4G9YA 1IN5A 2EA2A 3E5UA 4BE2A 3FXKA 1T6SA 2DT6A 3BY6A 1TNTA 2A68F 3DXJF 4RS8A 3RPUA 1K79A 4CICA 3PFIA 2L9VA 3S14J 3KYCB 2X6OA 3OSGA 1XX5A 3CCSI 3IHUA 3SZPA 3GEZA 2G7HA 2LNBA 1WRJA 1YITI 1K7AA 5HDNA 2OV7A 1BI2A 1JI8A 2E1OA 3AG2H 3ECOA 3IWFA 4KMFA 1E3HA 4XKWA 2K9MA 1VF9A 3TW6A 3KYLA 1P4AA 2FBIA 2XHKA 3H5RA 4FE7A 4PJLA 4YG2F 4RGUA 1F5TA 1MMAA 2EZIA 1IC8A 2Q0OA 1FWZA 5ERIA 3BT9A 3VB2A 2XGCA 4O5VA 1N25A 1TT0A 5GPCA 3QOPA 2UV1A 3F6OA 2COMA 3CD6I 2QVOA 4PJMA 4CXFA 1TWFJ 4M71A 4MQ9F 5M3FJ 1LQ1A 3LSMA 2EFNA 1ERDA 3DFGA 4A12A 1EA3A 3M1EA 5JHUA 2NOGA 4D0PA 2IGKA 3OR1C 4KN4X 2VKDA 5J3LA 3MFKA 3C2BA 1GVJA 1XD7A 2EB7A 1KZHA 2W4SA 3P9KA 3PIOF 3KFWX 2NNYA 5LGUA 4ZYEA 1VQ7I 4OIOF 5E18F 2DQLA 1STZA 2Y2ZA 3F8NA 4RB3C 2ZKZA 4ZDOA 1ETXA 2XKOA 1A04A 1NG7A 1U2WA 3R0AA 3ZMVA 2OTJI 2FD5A 3ECHA 3E6MA 4HA8A 3CCQI 1JE8A 4XLCA 1APLC 3GW2A 5ED4A 4LITA 2KHMA 4XRSG 3OYBA 2P0WA 3MCZA 4EGZA 2K9LA 1U5TB 1HDDC 1RKTA 1KU7A 4NNJA 1MNMC 3E6BA 3ZPLA 2GZWA 3JRFA 5F1RA 3O8HA 2JMWA 1MJBA 3AKZA 1YX3A 2RDPA 4ZYDA 4XONA 4XM3A 5DD8A 2EJRA 1J9IA 3FM5A 1O3QA 3IKVA 3I4MJ 1F9NA 1PP8F 4ENJA 3NARA 1V5GA 3ZMTA 3WE2A 2G0EA 3KPHA 3FHNA 2W7NA 2R3SA 1XN7A 1OQYA 1RUNA 5EEHA 2KMUA 1SD5A 5IYBJ 2VXZA 3L2WA 2WV0A 4P1WA 1V5EA 3BG3A 3ZMDA 2MH9A 1ZTRA 2FNAA 4L9NA 3REOA 2PG4A 1RNLA 4UB8C 2JA5J 3ZCOA 1MMSA 4BHBA 2IEKA 2Q2EB 3D5LA 1HKSA 4JOMA 2XDVA 3WGHA 1J75A 2CH0A 5LGTA 3S1QJ 4MO7A 1ZG3A 2VKHA 1X3WB 2F5EA 4Z6YA 3DBHB 4M3BA 3G1MA 3H1CA 1XPXA 2HPIA 1OCTC 2V79A 4NQWA 3U1KA 5J1RA 3OOUA 3J80K 5BNGA 2HVRA 3HRUA 4ASNA 4ZJZA 5HDKA 1E0EA 1OCOH 5D8LB 3QOEA 4BJ5C 3RKQA 1FT9A 2W00A 4MTDA 1HW1A 1I1GA 2KIFA 2KFDA 4EQQA 1JUMA 1K61A 1ZGAA 1E3PA 2DK8A 5FKNA 1ZRFA 1PJRA 2K5CA 4OINF 4XKCA 2KZGA 1DGWY 4JYKA 2KQRA 3BJ6A 4HG2A 3JRGA 3Q0VA 1FTZA 2LP0A 4LLGF 4FCYA 3ZR8X 2FA5A 4NC6A 1ZR4A 2V9KA 2JA6J 2XUBA 3BPVA 4BBRJ 3PQJA 1S9HA 4OU0A 1FNNA 5HS8A 2KPMA 3WG9A 2FMYA 3G6EI 2OJED 2QQBA 5DDGA 5D5UB 3J7AO 2A6EF 4BXUA 5E17F 5CVUA 4DZPA 3DPLC 3GUDA 4P9FA 3EPZA 5CLSA 1SMYF 1S3JA 4B4CA 1TWCJ 2DT7B 3K0LA 4PFPA 1H0MA 1U6GA 4HX8A 2FX0A 1QZEA 4R1HA 1KYZA 3KX2A 4GFBA 2H94A 4EEFG 1EKEA 1RR8C 3DWLE 1MBHA 3RYPA 2WAQN 4UUVA 2L7FP 1TL8A 1OMIA 3N05A 3V7SA 4KITB 4ZYHA 1YLFA 3JSOA 3ROUA 2H27A 1N77A 3ONQA 4ZYAA 3GFMA 1NK3P 5FRNA 3PQKA 2R7RA 1S29A 2EQRA 4E7HA 4EM2A 4NBQA 2M7AA 4GGGA 2D1VA 2ECBA 3K4BA 2Z99A 2HR3A 4EM0B 3ERED 2MYSA 5EG0B 3CF2A 2DA2A 2R92J 4RM2A 1AHDP 2OZ6A 1YO5C 2L4AA 2W1OA 2XAJA 3F9KA 2CS3A 2M8EA 5IOYA 2L9RA 4RLQA 2LF7A 2LVSA 3JAMZ 1YI2I 4DZJA 4F52A 4CYCA 2X51A 5DTDA 1UHMA 2WADA 2HOAA 4V2FA 1ZH5A 2XSDC 4HDUA 3HRSA 1WJAA 4ESJA 4BY1J 1ZRDA 5D5WB 5F64A 1FOWA 5E20A 5EDNA 1D0YA 2E7WA 3M4OJ 1X2NA 2LY2A 1LDDA 1SD7A 2Z16A 2VPRA 3L7WA 2V9PA 1MJ9A 3FHZA 5BPIA 1D5VA 3CP2A 4C9YA 3GZ5A 1QO0D 2MFZA 3DU6A 5LEJA 1D1CA 4HV6A 3CUQB 3DTKA 5GP9A 1BW6A 2XV4S 4KIFA 1ODDA 2E19A 2W85A 4L9JA 2L9SA 3K4NA 1Y1WJ 1E17A 5EZHA 4L0ZB 4A3BJ 4YRVA 2ID3A 1DPUA 2JSCA 2VI6A 4JK1X 2EV6A 2M34A 4AUXA 2XGEA 1YJNI 1AU7A 4IRGA 4EV0A 3GZ6A 2OTLI 1IXSB 2KDOA 4EJWA 1L0OC 3AL0C 3HSFA 1DQUA 1OYWA 1W4MA 3A03A 3OYLA 3DF8A 5L3EA 2X48A 1W1WE 3MAJA 4IPAA 1YIJI 1E3OC 4IJAA 3M8JA 5CVRA 1J59A 2OUMA 1P2FA 2JSPA 2F4OB 4BUPA 1X3UA 1FOYA 3BR6A 3MKLA 3BLYA 2M0MA 4G7ZF 4JQFA 1BBYA 1ETKA 4IQ4A 2FSWA 3GTMJ 2HPMA 3LA2A 1BOBA 3K4JA 2PEXA 1ZN2A 2L7ZA 5K5RA 1XSXA 2X0LA 1S72I 2M0CA 3U21A 2F5CA 4GYGA 2MG4A 2XAQA 4RBOA 2A69F 4U0WA 2STWA 4A3CJ 2YU9J 1RI7A 1D5YA 3IAS2 2Z2SB 3Q0UA 1FSHA 3GFJA 3F22A 1IXRC 1YOVB 2OU2A 4A0YA 2M30A 5K5OA 2HOEA 2L7MP 3S3OA 4Q48A 3OYKA 1Y8QB 1JKQC 3E0JB 1IXCA 1WWXA 2R5ZB 4OIQF 3UNGC 2ZMEA 4UUSA 4Q47A 1B72B 2FRHA 1EF4A 1YE9A 2OD5A 1TQIA 3HG9A 5IYCJ 3SZTA 1GDTA 1I3AA 4PK4A 4OAZA 3CCLI 2K4JA 4CSWA 2FUG2 2ETHA 3B02A 2DQRA 3BR0A 1IG7A 3CLQA 5F6FA 5E8GA 1UB9A 4G7OF 3QPHA 1WVRA 2ZXJA 3JCUC 2BY1A 4LB5A 3WTXC 1XB4A 1Y56A 2V1DA 4WXDA 3ZQGA 3U2RA 4MEYF 3KEQA 2LD5A 3ABUA 2PMUA 1JT0A 2PJPA 3BG9A 4CZCA 3AG3H 4H0EA 1ZGWA 4IKFA 4YELA 2R7FA 2CWEA 1ZLJA 3GBGA 1O3RA 1LFBA 2B9SA 1X4OA 2DFEA 2CUEA 2FF4A 2DOAA 5D6FA 2EWNA 3JAMK 1T39A 2VBXA 3J7AY 1MDMB 1R1TA 4YIIA 3E5QA 4BNCA 2CQXA 3VWBA 1JTXA 2WWYA 3NRVA 1YX5A 4LIVA 2ACJA 2LK2A 2BXYA 3GLXA 1IZ1A 4P96A 4IZZA 1K4SA 4WWCA 5GTHC 1UG2A 2ZJRF 1ZQ3P 3WTZA 2QKMB 1FMWA 3HUGB 3GFIA 2DCEA 1R22A 5EZGA 3X2QH 3K9TA 2MSYA 3RKWA 2QEXI 1KA8A 2ZNZA 1W7PA 4AYBN 2JQ7A 3BG5A 3CC7I 1SAUA 3HHGA 3OYJA 5JR3A 4IHXA 2BE5F 3IC7A 1DGRM 1N75A 1U0JA 4BL0B 2DA3A 2Z33A 3W2WA 5F0FA 1FZPB 1FP2A 2PN6A 4HZFA 4YFKF 1LDJA 3BTIA 4LMYA 4C2TA 4XN3A 3EDPA 2L01A 1A36A 4LK1F 5DYMA 3SFZA 3OS1A 4RB0A 4CHUA 4I2OA 4LGWA 2GOMA 1CF7A 4ESBA 1G3YA 2OQRA 2NS7A 3GO5A 1OYIA 2HGCA 3AL0B 2WB1N 2KKOA 1UELB 4OMYA 4CCJA 1JKPC 5F0HA 2E36A 3D5RC 3ISPA 3CJNA 4JX5A 3RPUD 3V8LA 3DBRB 3JRCA 2K27A 1Z1DA 4PJJA 4W97A 4EJUA 3I59A 2BHZA 2ID6A 3KYDB 4PJNA 3C1DA 2KRHA 1FYMA 2OZUA 1XMAA 3WTUC 4B8XA 1ENHA 4A6DA 5HDGA 3WTVC 1LB2A 2EFQA 5D4SA 2PQ8A 2KP6A 2ECCA 1ZELA 2ADUA 5B66C 5EEGA 3F72A 3O8GA 3H36A 1P9QC 2ELJA 4HNTA 1YW8A 4CCLA 2QBYA 4XQFA 3KP3A 3WU2C 3BR1A 2UZKA 4U0VA 1VI0A 2Z3YA 3L09A 1SFKA 2IA2A 5JFRA 1T38A 4XNFA 3O6BB 3HOZJ 1FYLA 2VC1A 1W36D 2HXOA 3GLLA 1JTYA 2GAUA 1Q1VA 1ETWA 1QZZA 1K6OA 4M3DA 2DT5A 4E7SA 2B63J 4JP0A 5AONA 4II3A 2R5YA 2DN0A 1VQLI 5E3LA 5BPDA 2FOKA 5K7FA 3HGGA 3HXLA 4FETA 5EEAA 2F4IA 5FROA 1B8IB 1J09A 3IH2A 4U0YA 4ZZDA 1SFXA 2O7OA 3A4CA 4L18B 1G59A 2O8XA 2HNHA 2EIKH 3CCYA 4A69C 3LFUA 1VQPI 4L5JA 5LLQA 1UHWA 2HI3A 2YS9A 1YW9A 4U7BA 2IGMA 4GRIA 4XBFA 1IGNA 3OL3A 2DXIA 4X6AJ 3P9IA 5JVTA 4RB2C 3S2WA 4IVNA 4XRFA 4BE1A 2BW3B 3P9CA 4D5CA 1XGOA 1A5JA 2XKPA 3H0DA 4JBAA 4J19A 2JZYA 4J00A 3QP5A 2VKVA 3CO7C 3COAC 3GYHX 1FY7A 3K1NA 5E1WA 5LBQA 4XSZF 1REPC 4A3LJ 2DU9A 4KDPA 3ABKH 1P92A 4OIPF 4UVBA 1XTAA 2CW0F 2PBIA 4B47A 3P5JA 1T95A 1KQ0A 3E1SA 5H20A 1I6HJ 4IRHA 1IN6A 2VKEA 3RZDJ 1QBJA 2DMNA 3OV8A 1UCRA 4C2UA 1AOYA 2XAHA 2D2WA 4E7KA 3FM3A 2I8DA 2P7VB 3MKYB 1B9MA 4Y4RA 2OAZA 3OYDA 1RZ4A 5GPAA 3CQZJ 3IL2A 4XLPF 1MNDA 1V55H 2MA3A 3JRDA 5LD2C 5L3DA 2OC6A 1U5TA 5FLVA 1U9OA 3I55I 1WH5A 2ELHA 3HJEA 1UG0A 1Z7UA 3BWGA 4RLFA 4A3IJ 3QYEA 2WAFA 3ZQCA 2QWWA 1Z77A 5GAEJ 5FKLA 3L2QA 2L7KA 2MLKA 1Z3YA 4BBSJ 1S8NA 2H1LA 2R7SA 1ON2A 3H9QA 4HSTA 5DM7F 4XL9A 3GMEA 2LKPA 1G8XA 1U9NA 2H6BA 3O3KA 4BYYA 1WPKA 1T8IA 1PDNC 2VOOA 5JLXA 3VODA 2IW5A 1HDPA 2XIGA 1KU9A 2YUSA 1Z6TA 1RUOA 2R7XA 2QUFA 1LFPA 4RAYA 1MJAA 5CKTA 3F8CA 2LDUA 5ICGA 1CQTA 1W5SA 4RAZA 1SFOJ 3I0TA 1XMKA 2QSFX 5D4RA 2Q2EA 5J4YA 3LL7A 3OSFA 1PYVA 2A6TA 2O8KA 2VASA 3LSIA 3HDDA 4AM3A 1R5HA 3TO7A 3PSFA 4DOZA 4DBQA 5HVQC 2KIMA 1QGPA 4RGRA 2K3PA 4E7LA 3ERMA 5CYVA 1LEBA 2DMQA 2PFBA 4HAMA 1OPCA 2E1NA 3HGYA 3R6SA 3TBIA 1DUXC 2QZ8A 4I7HA 2V6EA 4IF4A 1K6YA 3OYEA 2QLZA 1X2MA 1YYVA 3R0JA 2V7FA 1A6QA 2LY9A 4N4OB 4BDZA 4LB6B 4HSRA 2A05A 3N97A 3T8TA 4HQMA 1IDZA 2KL4A 2EZKA 2VJ5A 3GVAA 2CG4A 3S8PA 3JSPA 2IA1A 3OYMA 5E3OA 2P4WA 1SD6A 2VUMJ 5LFAA 3FMSA 1HBXG 2HVQA 2KDZA 4RMNA 1GHCA 1H88C 5EYRA 2CQNA 3OYHA 2WY7Q 3FBNB 5B5EC 2D45A 4II2A 1ZYRF 2P8TA 2Y9YA 4GDFA 4XLNF 4B3XA 4BHPA 3K4CA 4ETSA 2ME0A 1GVDA 1H8AC 2FJ1A 3ESWB 1QZYA 2VXDA 3KEOA 1FP1D 3KP5A 1JGGA 2JRMA 1K83J 2DAOA 1YRNB 3A01B 1ULYA 4M73A 4M72A 5GAHJ 2R7WA 3CC4I 3K69A 2DO7A 1SVMA 2CFOA 2EZLA 1QA6A 1EJ9A 5H6RA 1A31A 1SFUA 2Z1DA 2M3AA 4IX7A 1Z6RA 1OYYA 2E71A 2XGDA 1U8BA 2L4MA 1Y39A 5TISC 2NS0A 1WI3A 4ZYGA 2Z9OA 3S16J 1YQAA 1YFHA 1P4WA 5ICFA 2BZTA 4V2GA 4EGYA 4BS9A 1R1UA 5J47A 4UHTA 2HTSA 3LAPA 1ORKA 1YJ9I 3LOCA 3S1RJ 4RM3A 5B1BH 4B43A 1JT6A 5AIQA 4IRIA 3CCVI 3CUQC 3DEWA 2JVHA 1XSVA 4LG0B 2M4KA 5J1UA 4WXCA 5K5QA 3IP4B 2LKSA 4DYRA 5HNFA 3CMAI 4A5NA 3I9V2 4GO1A 2ISZA 2XF5A 1KU3A 4DW6A 2PI0A 3RQIA 5HODA 1PUEE 3M7GA 2K9NA 1JKRC 5ILUA 3DEEA 2LC2A 4M9XA 1X3ZB 1BI3A 2LOOA 3IAM2 3ZQLA 2HDDA 2OBPA 3LFKA 2WBMA 2WA0A 3E3VA 4AWXB 3BG6A 4QPOA 4AVPA 2B0LA 5IP6A 2L9NA 1A6IA 4WF2A 2EFPA 3DU5A 3G3ZA 1B1BA 5LRRA 2CUJA 3D5SC 3UR3C 2ESHA 3VYRB 4AD9A 3FKJA 5L3BA 2HEOA 2HYGD 4B48A 5FD5A 3PFYA 2WC2A 3CLOA 2ZJPF 3I4NJ 2R7TA 3I4PA 4LIUA 4XORA 2Q1ZB 2QKLB 3RCOA 2XF6A 3V7CA 1OCZH 3HRTA 3GTKJ 2F5FA 4F91B 2VBZA 2QGUA 4A6EA 3GZNB 1Y1VJ 1KONA 5FB2A 4UY8I 4RB1A 4M9SA 4UV8A 1F1ZA 2HOTA 2RNJA 4LK0F 3BG7A 3DPTA 4LD5A 1D8KA 2NXNB 2NVUB 3IRQA 3BJOA 2IP2A 5F04A 2JTVA 2JWTA 1GXPA 3JTHA 4AYBA 1JJ6C 1D8JA 1QRYA 5LGNA 4G7HF 3OYGA 1MBGA 4IHVA 1OLTA 2BY2A 3M8EA 1MBEA 1WQ2A 4Y13A 1W7PD 2K4BA 4N4NB 5C4XJ 5HS7A 2BVLA 4BQNA 5GADJ 3G73A 5IP7J 4KIGA 4EJOA 1RRJA 3DTEA 3WHBA 2R5ZA 2H8RA 4B09A 4HV5A 1B72A 5IP9J 1TW2A 3ZQQA 2ZJQF 4FTHA 2Y69H 4M3FA 1WHUA 2J5PA 1R4NB 5JHFA 2EIMH 2RVCA 2F5VA 1R7JA 2ZXHA 2WB1A 1JUSA 3I58A 1PVEA 3NWSA 5FKMA 3ZP5A 4HQEA 2PMZN 1J7KA 1YS7A 3NQOA 2G9WA 1JGSA 1Q1HA 3ZOBA 3PUBA 3VSKA 3D1NI 4Y33A 1SVLA 2IAIA 2R4GA 3I5UA 2F4MB 4CCMA 3ZXSA 2PLYA 1HLVA 4CCKA 2EPFA 3FZVA 3CTAA 2VODA 1QQIA 2FQ3A 4G6DA 1LUJB 1BC7C 3KETA 4PUSA 1MDMA 1ZG5A 1ETOA 2BY0A 2P5LC 2MBFA 2CU7A 1BR4A 1MBFA 3OMYA 4AIDA 4EJVA 2XGXA 2DOEA 2F5DA 3F8MA 3HOYJ 2RREA 1HQCA 5J40A 3GX4X 2K02A 4MHGA 2R7QA 1I6XA 5DD4A 1LE8B 1TWHJ 2CW7A 2ICWG 1XDUA 4TV7A 4BKXA 3HUGA 3WG7H 2HVSA 1RR7A 3WODF 3BR3A 3H3ZA 1SEUA 2HKOA 1O3TA 1RIOH 5FFXA 1LVKA 1SAXA 3KP4A 3SXYA 5J8CA 5HS9A 5GTIC 1QHHD 5E79C 2IJLA 3CZ6A 1NG6A 4LG3A 3KZIC 4NC7A 4XLAA 3IV5A 1BC8C 3TGNA 2GIZA 3PNVA 3OOPA 1I27A 5FKOA 3E6CC 1BL0A 1VQ5I 5E8IA 1QVUA 4L5EA 5EJCA 3PO3J 2XPWA 1VQ4I 2LSOA 1BOAA 1UAAA 3B73A 1X58A 1OJLA 1Y6IA 2Y0MA 2ZFUA 5F1JA 3S2HJ 5EGOB 3EUHC 2AS5F 3KLNA 1ZLKA 2VT2A 1JHFA 1R4MB 4BJ6C 1R23A 2Z5UA 4UXNA 3LA7A 3L9FA 2I10A 2IVMA 4YIRX 1JHHA 4B44A 1DP3A 3L2VA 1ZRCA 1WJEA 4HYEA 4FISA 4IQJA 1S6LA 2ZXIA 4S04A 5ILVA 1RKWA 2VT3A 4A3DJ 2NOJB 3K4MA 4L9VA 3GTLJ 4XIDA 2E2IJ 5L3GA 2NS8A 3QYBA 1UZCA 3BTLA 4ZH4F 2AXLA 1FX7A 1ZARA 3SEQA 5D5VB 5D8KB 2G7UA 3MQ0A 2DODA 2KISA 2KJCA 4A3MJ 4A0XA 1H9GA 1IRZA 3QU6A 1BI1A 2VQGA 4XOTA 2K85A 2EIJH 4OAYA 4IOCF 2DLLA 1OFCX 4YFNF 4Y7NJ 4ENNA 2RKHA 1U78A 4DGWB 2M9HA 4BGDA 4IHTA 2IPQX 2VB6A 1X19A 5HOOA 1G3WA 1ZREA 4HLYA 1POGA 1ZAOA 3IH3A 3S2DJ 5DUIA 1QHGA 5HNHA 5IOZA 3L00A 1W0UA 4IHSA 3F3XA 3WTYC 2IS6A 2HFHA 2TCTA 3LNQA 2OCCH 4XLFA 5DEQA 2LYCA 3A0BC 4KJZA
chains in the Genus database with same CATH topology
3B6CA 4D5CA 4C3JJ 1A5JA 1W0TA 4XK4A 4J19A 3W6VA 2Y2ZA 1ETXA 2VKVA 2P81A 2ME6A 1B8IA 2FD5A 1APLC 1HCRA 2K9QA 2L0KA 4A3LJ 4XRSG 4XRSA 1HDDC 3BQYA 1RKTA 1MNMC 3TEDA 2DMPA 3JRFA 3JRHA 3O8HA 2OF7A 2JMWA 1I6HJ 2VKEA 3RZDJ 3PM1A 4X1EA 1XG1A 3LSRA 1WCMJ 2DMNA 5F27A 4A93J 3B6AA 3BR5A 2HYJA 4D5FA 2DA6A 3I4MJ 3NARA 3CQZJ 5GPAA 4IHWA 3BTJA 2G0EA 1FIPA 3JRDA 3GTPJ 4B1RA 1AKHB 5M3MJ 4IHYA 3H0GJ 5FLVA 5IYBJ 1U9OA 1WH5A 3G1LA 2R0QC 3BG3A 4M3GA 3FISA 1ZTRA 1QVTA 1HF0A 4A3IJ 2JA5J 3JREA 2IEKA 1TWGJ 3ZQCA 5J1YA 1R9TJ 1Z77A 5FKLA 1GV2A 1TWAJ 2JJ7A 1UMQA 4BBSJ 3S1QJ 2D5VA 2NVTJ 4MO7A 2DA5A 1OCTC 4M3BA 1U9NA 2OPTA 3G1MA 3RZOJ 1WPKA 1ITYA 5J1RA 3OOUA 4MFEA 5JLXA 5BNGA 4XRMA 1HDPA 2JN6A 2IBDA 2YUSA 2DA1A 3NAUA 2E2JJ 3RKQA 2COBA 1AKHA 4B3AA 1JUMA 1I50J 1CQTA 1K61A 2LFBA 3BQZA 1SFOJ 2HOSA 4I76A 3OSFA 5FKNA 4A3GJ 2O8KA 4RDUA 3HDDA 4JYKA 5K7HA 5FJ8J 3JRGA 3E7LA 3Q0VA 1FTZA 2LP0A 4FCYA 1ZR4A 2WV1A 4DYCA 3G1OA 3HB9A 2JA6J 4BBRJ 1ZK8A 1IDYA 2FQ4A 5K7ZA 1IUFA 2DMQA 2JK3A 4BXXJ 4Y52J 1ETYA 2NVQJ 3HGYA 5C3EJ 1T33A 2DJNA 4D7NA 1X2MA 4DZPA 2LY9A 5JLWA 4JX6A 4A3KJ 4B4CA 1TWCJ 1IDZA 2FX0A 2EZKA 1MBJA 2EH3A 4GFBA 4EEFG 1TC3C 1MBHA 5E3OA 2WAQN 1NK2P 2L7FP 2VUMJ 3PO2J 2CRGA 2KDZA 4CYCB 1H88C 5EYRA 4MLOA 1NK3P 1RESA 2Y9YA 2AHQA 2EQRA 2ME0A 2ECBA 1GVDA 1H8AC 2FJ1A 2Y0SN 1ZKGA 5EG0B 4M6VA 2DA2A 1JGGA 2LTPA 3TP0A 2R92J 1K83J 3HOVJ 1YRNB 3LSPA 1AHDP 3A01B 2QF7A 3BR2A 1DU0A 1QPIA 3FK7A 3ZQFA 4G12A 5IOYA 2L9RA 5IYDJ 2EZLA 3LSJA 1XS9A 2LVSA 4DZJA 4IEJA 4CYCA 5DTDA 1ETVA 1Z0XA 2HOAA 1U8BA 2XGDA 2ZB9A 4V2FA 1S7EA 2XSDC 1DU6A 5C4JJ 1WI3A 1GT0C 4BY1J 5EDNA 3S16J 3M4OJ 4A3EJ 4V2GA 1X2NA 2VPRA 3QPLA 3Q0WA 1YRNA 4UUTA 2K40A 2Y30A 1ORKA 3LOCA 3S1RJ 2DMUA 5GP9A 1BW6A 1JT6A 2ELKA 2AO9A 2N8GA 2E19A 3DEWA 2H1KA 5J1UA 2LR8A 3TW7A 1Y1WJ 5EZHA 3S1NJ 4A3BJ 3HOWJ 4DYRA 2ID3A 2VI6A 2W48A 2M34A 4AUXA 2XGEA 1AU7A 1SANA 2Y9ZA 4DW6A 2DTZA 3RQIA 5HODA 2KT0A 2K9NA 1JKRC 3A03A 1FIAA 3DCFA 2X48A 4FE4A 1VFCA 1WH7A 1E3OC 3ZQLA 2R7ZJ 3CDLA 2HDDA 3BR6A 3MKLA 5M5YJ 2EZHA 3TP3A 4UUSB 3S1MJ 5IP6A 1A6IA 5M5WJ 1ETKA 4LOCA 3GTMJ 3QQAA 1JUPA 2EBIA 2Y31A 3MVPA 2CJJA 2GM4A 3GTGJ 2L7ZA 4A3JJ 2M0CA 2MG4A 4ABZA 4C3HJ 3OIOA 3GTJJ 1G2HA 4RBOA 4A3CJ 2YU9J 5IPAA 1D5YA 2O9LA 4M3EA 3Q0UA 3I4NJ 1HOMA 1P7IA 3VPRA 4JX4A 1T56A 2L7MP 2CUFA 3MN2A 5F08A 3FKIJ 1GUUA 1UHSA 3HKZN 3GTKJ 1JKQC 2R5ZB 1Y1VJ 4UUSA 1B72B 3LSGA 2HOTA 2XPUA 1EF4A 2CQQA 5IYCJ 1GDTA 5F0CA 5F04A 2GLOA 5E3MA 3Q3SA 1MH3A 2JWTA 3BR0A 4NDLA 2DMTA 1IG7A 5FKKA 1JJ6C 2MGQA 1QRYA 1MBGA 2LLKA 4IHVA 1FEXA 3ZQGA 1MBEA 2JA7J 5C4XJ 2LD5A 1BW5A 1JT0A 5IP7J 3BG9A 3JR9A 2MW8A 1ZGWA 3WHBA 1ZR2A 4A3FJ 1BJZA 2R5ZA 1IV6A 2H8RA 1NTCA 3GBGA 1B72A 5IP9J 1LFBA 2DA7A 3A02A 3HOUJ 4FTHA 3M3YJ 4M3FA 3WHCA 2CUEA 5C44J 1O4XA 2NVXJ 1IJWC 5M5XJ 2XB0X 3SJMA 1F43A 1JUSA 2CQXA 2XRLA 1JTXA 5FKMA 1MBKA 2X9DA 1FTTA 2PMZN 2LK2A 1LFUP 1UG2A 5FLMJ 1ZQ3P 1FJLA 3ZOBA 3S15J 1PUFB 3FIWA 4MIMA 3D1NI 5EZGA 1MSFC 2MSYA 5DS9A 2IAIA 4AYBN 5EG0A 3BG5A 2HXIA 5E3NA 1JJ8C 2QCOA 4IHXA 3A01A 1HLVA 4D7MA 2DA3A 5F0FA 1GV5A 5EF6A 4XICA 2HQ5A 1JKOC 2TRTA 4AC0A 1XC5A 1ETOA 3BTIA 3JRIA 2CU7A 1MBFA 4DYQA 1OCPA 3HOYJ 1BA5A 4MFDA 2E2HJ 2NS7A 3K2AA 3JRBA 1LE8B 2XB5A 9ANTA 1TWHJ 2WB1N 2NVYJ 4BKXA 1JKPC 1F36A 5F0HA 1PUFA 3GTOJ 1RR7A 2GBYA 1RPWA 4JX5A 3HOXJ 3BR3A 3JRCA 3ZQIA 4W97A 3SDGA 2M8GX 2ID6A 1P7JA 4QIWN 3FK6A 3IV5A 1ENHA 5FKOA 3HM5A 2R5YB 3GTQJ 1BL0A 2ECCA 3H3VK 1MH4A 1QVUA 3HEFA 1RETA 4L5EA 3PO3J 3O8GA 2XPWA 2R93J 1X58A 1OJLA 3QPSA 2LKXA 2K9SA 3BTCA 1LE8A 3BR1A 5F1JA 3S2HJ 3HBLA 1VI0A 4W1UA 5EGOB 3L1PA 2JA8J 4HNVA 2M2EA 3HOZJ 2I10A 4QTRA 2HXOA 4FISA 4C3IJ 2RAEA 4QSHA 3JRAA 1JTYA 3S14J 1Q1VA 3OSGA 2X6OA 1ETWA 1RKWA 2XPVA 4M3DA 4A3DJ 3GTLJ 4XIDA 2E2IJ 2B63J 2NS8A 4JP0A 2R5YA 2DN0A 3BTLA 1I3QJ 2DA4A 4BY7J 5E3LA 1H89C 2E1OA 1VNDA 4C2MJ 1WGXA 5K7FA 1ETQA 3HGGA 1VF9A 3TW6A 4FE7A 3S17J 5EEAA 2EZIA 3IH4A 4A3MJ 1IC8A 1IRZA 5EGOA 3BT9A 1MSEC 2XGCA 1B8IB 3IH2A 1OFCX 4Y7NJ 3CMYA 3F0CA 3K7AJ 5GPCA 1U78A 2O7OA 2M9HA 3CCYA 4A69C 1TWFJ 5M3FJ 1POGA 3IH3A 3S2DJ 4S0HB 2NOGA 3ZQHA 2HI3A 2YS9A 5IOZA 1W0UA 5J3LA 3UKGA 3C2BA 3SFIA 4X6AJ 1IGNA 2TCTA 3LNQA 4I6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6C A;  4D5C A;  4C3J J;  1A5J A;  1W0T A;  4XK4 A;  4J19 A;  3W6V A;  2Y2Z A;  1ETX A;  2VKV A;  2P81 A;  2ME6 A;  1B8I A;  2FD5 A;  1APL C;  1HCR A;  2K9Q A;  2L0K A;  4A3L J;  4XRS G;  4XRS A;  1HDD C;  3BQY A;  1RKT A;  1MNM C;  3TED A;  2DMP A;  3JRF A;  3JRH A;  3O8H A;  2OF7 A;  2JMW A;  1I6H J;  2VKE A;  3RZD J;  3PM1 A;  4X1E A;  1XG1 A;  3LSR A;  1WCM J;  2DMN A;  5F27 A;  4A93 J;  3B6A A;  3BR5 A;  2HYJ A;  4D5F A;  2DA6 A;  3I4M J;  3NAR A;  3CQZ J;  5GPA A;  4IHW A;  3BTJ A;  2G0E A;  1FIP A;  3JRD A;  3GTP J;  4B1R A;  1AKH B;  5M3M J;  4IHY A;  3H0G J;  5FLV A;  5IYB J;  1U9O A;  1WH5 A;  3G1L A;  2R0Q C;  3BG3 A;  4M3G A;  3FIS A;  1ZTR A;  1QVT A;  1HF0 A;  4A3I J;  2JA5 J;  3JRE A;  2IEK A;  1TWG J;  3ZQC A;  5J1Y A;  1R9T J;  1Z77 A;  5FKL A;  1GV2 A;  1TWA J;  2JJ7 A;  1UMQ A;  4BBS J;  3S1Q J;  2D5V A;  2NVT J;  4MO7 A;  2DA5 A;  1OCT C;  4M3B A;  1U9N A;  2OPT A;  3G1M A;  3RZO J;  1WPK A;  1ITY A;  5J1R A;  3OOU A;  4MFE A;  5JLX A;  5BNG A;  4XRM A;  1HDP A;  2JN6 A;  2IBD A;  2YUS A;  2DA1 A;  3NAU A;  2E2J J;  3RKQ A;  2COB A;  1AKH A;  4B3A A;  1JUM A;  1I50 J;  1CQT A;  1K61 A;  2LFB A;  3BQZ A;  1SFO J;  2HOS A;  4I76 A;  3OSF A;  5FKN A;  4A3G J;  2O8K A;  4RDU A;  3HDD A;  4JYK A;  5K7H A;  5FJ8 J;  3JRG A;  3E7L A;  3Q0V A;  1FTZ A;  2LP0 A;  4FCY A;  1ZR4 A;  2WV1 A;  4DYC A;  3G1O A;  3HB9 A;  2JA6 J;  4BBR J;  1ZK8 A;  1IDY A;  2FQ4 A;  5K7Z A;  1IUF A;  2DMQ A;  2JK3 A;  4BXX J;  4Y52 J;  1ETY A;  2NVQ J;  3HGY A;  5C3E J;  1T33 A;  2DJN A;  4D7N A;  1X2M A;  4DZP A;  2LY9 A;  5JLW A;  4JX6 A;  4A3K J;  4B4C A;  1TWC J;  1IDZ A;  2FX0 A;  2EZK A;  1MBJ A;  2EH3 A;  4GFB A;  4EEF G;  1TC3 C;  1MBH A;  5E3O A;  2WAQ N;  1NK2 P;  2L7F P;  2VUM J;  3PO2 J;  2CRG A;  2KDZ A;  4CYC B;  1H88 C;  5EYR A;  4MLO A;  1NK3 P;  1RES A;  2Y9Y A;  2AHQ A;  2EQR A;  2ME0 A;  2ECB A;  1GVD A;  1H8A C;  2FJ1 A;  2Y0S N;  1ZKG A;  5EG0 B;  4M6V A;  2DA2 A;  1JGG A;  2LTP A;  3TP0 A;  2R92 J;  1K83 J;  3HOV J;  1YRN B;  3LSP A;  1AHD P;  3A01 B;  2QF7 A;  3BR2 A;  1DU0 A;  1QPI A;  3FK7 A;  3ZQF A;  4G12 A;  5IOY A;  2L9R A;  5IYD J;  2EZL A;  3LSJ A;  1XS9 A;  2LVS A;  4DZJ A;  4IEJ A;  4CYC A;  5DTD A;  1ETV A;  1Z0X A;  2HOA A;  1U8B A;  2XGD A;  2ZB9 A;  4V2F A;  1S7E A;  2XSD C;  1DU6 A;  5C4J J;  1WI3 A;  1GT0 C;  4BY1 J;  5EDN A;  3S16 J;  3M4O J;  4A3E J;  4V2G A;  1X2N A;  2VPR A;  3QPL A;  3Q0W A;  1YRN A;  4UUT A;  2K40 A;  2Y30 A;  1ORK A;  3LOC A;  3S1R J;  2DMU A;  5GP9 A;  1BW6 A;  1JT6 A;  2ELK A;  2AO9 A;  2N8G A;  2E19 A;  3DEW A;  2H1K A;  5J1U A;  2LR8 A;  3TW7 A;  1Y1W J;  5EZH A;  3S1N J;  4A3B J;  3HOW J;  4DYR A;  2ID3 A;  2VI6 A;  2W48 A;  2M34 A;  4AUX A;  2XGE A;  1AU7 A;  1SAN A;  2Y9Z A;  4DW6 A;  2DTZ A;  3RQI A;  5HOD A;  2KT0 A;  2K9N A;  1JKR C;  3A03 A;  1FIA A;  3DCF A;  2X48 A;  4FE4 A;  1VFC A;  1WH7 A;  1E3O C;  3ZQL A;  2R7Z J;  3CDL A;  2HDD A;  3BR6 A;  3MKL A;  5M5Y J;  2EZH A;  3TP3 A;  4UUS B;  3S1M J;  5IP6 A;  1A6I A;  5M5W J;  1ETK A;  4LOC A;  3GTM J;  3QQA A;  1JUP A;  2EBI A;  2Y31 A;  3MVP A;  2CJJ A;  2GM4 A;  3GTG J;  2L7Z A;  4A3J J;  2M0C A;  2MG4 A;  4ABZ A;  4C3H J;  3OIO A;  3GTJ J;  1G2H A;  4RBO A;  4A3C J;  2YU9 J;  5IPA A;  1D5Y A;  2O9L A;  4M3E A;  3Q0U A;  3I4N J;  1HOM A;  1P7I A;  3VPR A;  4JX4 A;  1T56 A;  2L7M P;  2CUF A;  3MN2 A;  5F08 A;  3FKI J;  1GUU A;  1UHS A;  3HKZ N;  3GTK J;  1JKQ C;  2R5Z B;  1Y1V J;  4UUS A;  1B72 B;  3LSG A;  2HOT A;  2XPU A;  1EF4 A;  2CQQ A;  5IYC J;  1GDT A;  5F0C A;  5F04 A;  2GLO A;  5E3M A;  3Q3S A;  1MH3 A;  2JWT A;  3BR0 A;  4NDL A;  2DMT A;  1IG7 A;  5FKK A;  1JJ6 C;  2MGQ A;  1QRY A;  1MBG A;  2LLK A;  4IHV A;  1FEX A;  3ZQG A;  1MBE A;  2JA7 J;  5C4X J;  2LD5 A;  1BW5 A;  1JT0 A;  5IP7 J;  3BG9 A;  3JR9 A;  2MW8 A;  1ZGW A;  3WHB A;  1ZR2 A;  4A3F J;  1BJZ A;  2R5Z A;  1IV6 A;  2H8R A;  1NTC A;  3GBG A;  1B72 A;  5IP9 J;  1LFB A;  2DA7 A;  3A02 A;  3HOU J;  4FTH A;  3M3Y J;  4M3F A;  3WHC A;  2CUE A;  5C44 J;  1O4X A;  2NVX J;  1IJW C;  5M5X J;  2XB0 X;  3SJM A;  1F43 A;  1JUS A;  2CQX A;  2XRL A;  1JTX A;  5FKM A;  1MBK A;  2X9D A;  1FTT A;  2PMZ N;  2LK2 A;  1LFU P;  1UG2 A;  5FLM J;  1ZQ3 P;  1FJL A;  3ZOB A;  3S15 J;  1PUF B;  3FIW A;  4MIM A;  3D1N I;  5EZG A;  1MSF C;  2MSY A;  5DS9 A;  2IAI A;  4AYB N;  5EG0 A;  3BG5 A;  2HXI A;  5E3N A;  1JJ8 C;  2QCO A;  4IHX A;  3A01 A;  1HLV A;  4D7M A;  2DA3 A;  5F0F A;  1GV5 A;  5EF6 A;  4XIC A;  2HQ5 A;  1JKO C;  2TRT A;  4AC0 A;  1XC5 A;  1ETO A;  3BTI A;  3JRI A;  2CU7 A;  1MBF A;  4DYQ A;  1OCP A;  3HOY J;  1BA5 A;  4MFD A;  2E2H J;  2NS7 A;  3K2A A;  3JRB A;  1LE8 B;  2XB5 A;  9ANT A;  1TWH J;  2WB1 N;  2NVY J;  4BKX A;  1JKP C;  1F36 A;  5F0H A;  1PUF A;  3GTO J;  1RR7 A;  2GBY A;  1RPW A;  4JX5 A;  3HOX J;  3BR3 A;  3JRC A;  3ZQI A;  4W97 A;  3SDG A;  2M8G X;  2ID6 A;  1P7J A;  4QIW N;  3FK6 A;  3IV5 A;  1ENH A;  5FKO A;  3HM5 A;  2R5Y B;  3GTQ J;  1BL0 A;  2ECC A;  3H3V K;  1MH4 A;  1QVU A;  3HEF A;  1RET A;  4L5E A;  3PO3 J;  3O8G A;  2XPW A;  2R93 J;  1X58 A;  1OJL A;  3QPS A;  2LKX A;  2K9S A;  3BTC A;  1LE8 A;  3BR1 A;  5F1J A;  3S2H J;  3HBL A;  1VI0 A;  4W1U A;  5EGO B;  3L1P A;  2JA8 J;  4HNV A;  2M2E A;  3HOZ J;  2I10 A;  4QTR A;  2HXO A;  4FIS A;  4C3I J;  2RAE A;  4QSH A;  3JRA A;  1JTY A;  3S14 J;  1Q1V A;  3OSG A;  2X6O A;  1ETW A;  1RKW A;  2XPV A;  4M3D A;  4A3D J;  3GTL J;  4XID A;  2E2I J;  2B63 J;  2NS8 A;  4JP0 A;  2R5Y A;  2DN0 A;  3BTL A;  1I3Q J;  2DA4 A;  4BY7 J;  5E3L A;  1H89 C;  2E1O A;  1VND A;  4C2M J;  1WGX A;  5K7F A;  1ETQ A;  3HGG A;  1VF9 A;  3TW6 A;  4FE7 A;  3S17 J;  5EEA A;  2EZI A;  3IH4 A;  4A3M J;  1IC8 A;  1IRZ A;  5EGO A;  3BT9 A;  1MSE C;  2XGC A;  1B8I B;  3IH2 A;  1OFC X;  4Y7N J;  3CMY A;  3F0C A;  3K7A J;  5GPC A;  1U78 A;  2O7O A;  2M9H A;  3CCY A;  4A69 C;  1TWF J;  5M3F J;  1POG A;  3IH3 A;  3S2D J;  4S0H B;  2NOG A;  3ZQH A;  2HI3 A;  2YS9 A;  5IOZ A;  1W0U A;  5J3L A;  3UKG A;  3C2B A;  3SFI A;  4X6A J;  1IGN A;  2TCT A;  3LNQ A;  4I6Z A; 
#chains in the Genus database with same CATH topology
 1R00 A;  3B6C A;  1BIB A;  1Y8R B;  3J81 Z;  3OYC A;  3OYA A;  1W0T A;  3F23 A;  3W6V A;  3WTW C;  4AVZ A;  1SFE A;  2P81 A;  2XAG A;  2ME6 A;  3CP8 A;  1B8I A;  4HLX A;  2HYF A;  1WI9 A;  3K1P A;  4E70 A;  3A1Y A;  3LMM A;  1OIS A;  3VOE A;  2STT A;  2BY3 A;  4L0Y B;  5FRM A;  1LJ9 A;  1WSU A;  2LBF A;  5B3S H;  1A35 A;  1OCR H;  4ZDL A;  3JRH A;  5FLX Z;  1IRF A;  2X6W A;  5KAI C;  4CCO A;  1F4K A;  3HOS A;  1XG1 A;  4H4K C;  1WCM J;  4A93 J;  2OCE A;  2ZO4 A;  1HKT A;  1S7A A;  1JXS A;  3HOT A;  4ANJ A;  3TL4 X;  2ZCW A;  1W5T A;  1FSE A;  3LST A;  2YX7 A;  4DQ2 A;  4CUG A;  3AG4 H;  4IHW A;  1IN7 A;  3OYF A;  1FIP A;  2W82 A;  3DKW A;  3MZ8 A;  5IY5 H;  4U7D A;  4CDG A;  3H9J A;  2YX4 A;  3HL2 A;  1AKH B;  1MKM A;  3LSK A;  4HF1 A;  4FT8 A;  4YFX F;  2R0Q C;  4KIS A;  3FIS A;  3I54 A;  3K4L A;  1QVT A;  1HF0 A;  1WJC A;  2KLO A;  4CH7 A;  1S7O A;  3Q9V A;  1HW2 A;  5J1Y A;  2RC4 A;  2ZNY A;  4BDY A;  1R9T J;  2IGO A;  3RJP A;  5B1A H;  1AA7 A;  1M1E B;  3M07 A;  2DPD A;  2JJ7 A;  3DPU A;  3J7Y J;  1UMQ A;  3C7J A;  1BN5 A;  3VFZ A;  2X1C A;  5IT9 Z;  2IRF G;  2BHY A;  2DA5 A;  5KHD A;  1FLI A;  4YEJ A;  2OPT A;  2EFO A;  2XC7 A;  3HHH A;  3RKX A;  1FBU A;  1YW7 A;  2FU4 A;  1VQK I;  1XMX A;  2COB A;  4QLC U;  3F6V A;  4LLL A;  3OY9 A;  4N9H A;  3ASN H;  4U88 A;  3BQZ A;  2HOS A;  3FXJ A;  4BU2 A;  2ZXW H;  5E1X A;  1EV7 A;  3VYU B;  4A3G J;  3MWM A;  4RDU A;  2H8W A;  3V42 A;  2XSJ C;  5K7H A;  1VQO I;  4XLE A;  2FNP A;  3H3U A;  2WV1 A;  4DYC A;  3BDD A;  3RSN A;  2I5U A;  1MZB A;  1ZK8 A;  2BXZ A;  2FQ4 A;  4UB6 C;  4HRI A;  2NVQ J;  2AQE A;  4C30 A;  2L3D A;  4IXA A;  1KU2 A;  1V4R A;  2JUG A;  3C3W A;  4U87 A;  2VIX A;  5JLW A;  4JX6 A;  5TGT A;  3V4G A;  5LRS A;  1B4A A;  3CME I;  4DNC A;  3PJR A;  2C6Y A;  2UWM A;  2X85 A;  5CQG A;  3I3L A;  3ZQ7 A;  2AQF A;  1MBJ A;  3ZMZ A;  2ZSI B;  2VQH A;  1TC3 C;  2VQL A;  1RC9 A;  3WE3 A;  1EH6 A;  3CJQ B;  4G94 A;  3J7Z I;  2CRG A;  1HKQ A;  1G3T A;  4Y15 A;  3QWL A;  5BS6 A;  2O03 A;  3IRR A;  2O0Y A;  1IRX A;  4MLO A;  3L2U A;  3J81 K;  4XSX F;  2EFW A;  1RES A;  3IUO A;  2CMP A;  2AHQ A;  3KCC A;  1N78 A;  5H2F C;  1V5F A;  3SHF A;  4CZZ A;  4WCG A;  2KIU A;  2LTP A;  4OMZ A;  2GA1 A;  4S05 A;  3W6J B;  2W24 A;  3BR2 A;  5FLX K;  4G12 A;  2NNN A;  3G4S I;  2XF7 A;  2HQA A;  4X0G A;  2H09 A;  2E60 A;  1VQ6 I;  1LNW A;  4BHC A;  1WZ2 A;  5CPR B;  3KE2 A;  1IW7 F;  2MC4 A;  1O7F A;  2ZB9 A;  1YG2 A;  1ZG1 A;  2ESN A;  1S7E A;  1DU6 A;  3ZRG A;  2GXA A;  5C4J J;  1GT0 C;  4G6T B;  1O57 A;  3F8B A;  3NEU A;  3FMR A;  4L5I A;  1XSD A;  1VTN C;  2PJR B;  2VBY A;  3QPL A;  3Q0W A;  4GCV A;  1ZGJ A;  4UUT A;  1YRN A;  2K40 A;  2CFX A;  5TRD A;  2A07 F;  4A0Z A;  1MNE A;  3A0H C;  4R8H A;  4V19 K;  4HX4 A;  1Z91 A;  4FHT A;  1BR1 A;  4CYD A;  4E7J A;  4PCQ A;  2KIQ A;  2WAE A;  2XAF A;  3TW7 A;  4HPQ A;  1T2K A;  2F48 A;  3EQL F;  2FBK A;  3H92 A;  3ASO H;  1XCV A;  5IT9 K;  3HOW J;  3KP6 A;  2TDX A;  3PL8 A;  3KIO A;  2W48 A;  3HPH A;  3TMO A;  4AU7 A;  4WK8 F;  1IO2 A;  3BCB A;  3MKW B;  1K4T A;  1FOX A;  2DTZ A;  2KT0 A;  5DCM B;  1E2X A;  4HDV A;  3BZK A;  3DCF A;  3CF5 F;  3H9G A;  4IOA F;  1IF1 A;  3FBI B;  1Y0N A;  3LQR A;  2X1E A;  3CCU I;  2R7Z J;  3CDL A;  2FE3 A;  3H5N A;  2R7D A;  1BM9 A;  2V6C A;  3ABL H;  5HLI A;  3R61 A;  2GOX B;  4F7Z A;  3DKX A;  5FD6 A;  3SZG A;  5M5Y J;  3K2Z A;  2EZH A;  4LG0 A;  3ZGK A;  3FDY A;  1BI0 A;  2FOW A;  3HSR A;  4KT6 A;  3CCM I;  3QQA A;  1JUP A;  2CJJ A;  2HTJ A;  1WJ5 A;  2ZC2 A;  1R36 A;  3R60 A;  2GM4 A;  3GTG J;  1B59 A;  3JTG A;  4RAG A;  1WFX A;  2L2O A;  4ABZ A;  3GTJ J;  1G2H A;  3GFL A;  2O6G E;  1KQ8 A;  5IPA A;  4M3E A;  2HZD A;  1P6R A;  3V7R A;  4FAS D;  1B9N A;  1P7I A;  1HOM A;  2QM3 A;  3LWF A;  4PGH A;  4XLH A;  4JX4 A;  2A61 A;  1T56 A;  4RA2 A;  2CUF A;  3KP7 A;  2LG4 A;  3MN2 A;  4L9T A;  2IGN A;  5F08 A;  4BEH B;  4A5M A;  1GUU A;  1UHS A;  3RKY A;  4ZDP A;  4EMS A;  3CCR I;  4FQG A;  4ZTJ A;  3WU0 A;  1W36 C;  4BQO A;  1YTY A;  2K3F A;  3CDH A;  1K78 B;  3LSG A;  1XCB A;  2PMZ A;  2P5V A;  3SQN A;  2CQQ A;  3K70 C;  2M1B A;  2E5Z A;  3MZY A;  2DTR A;  3S93 A;  2QQA A;  1T98 A;  2A5W A;  4NDL A;  5E3M A;  1LPQ A;  2GLO A;  4M6Y A;  3IWZ A;  5FKK A;  1O7L A;  3I71 A;  4OOI A;  4ENM A;  5LHH A;  1HXD A;  1FEX A;  4LLN A;  3CES A;  4HEA 2;  1BW5 A;  2MC3 A;  4PSX A;  3JR9 A;  2MW8 A;  1MMG A;  1ZR2 A;  2JPC A;  1R71 A;  4A3F J;  1IV6 A;  1NTC A;  1QNT A;  1FYK A;  2MH2 A;  4IL6 C;  1YJW I;  1WJF A;  2DA7 A;  2DW4 A;  1X1D A;  1I39 A;  3G2B A;  3TKY A;  3TO6 A;  3WGG A;  5C44 J;  1V3F A;  1IJW C;  2XB0 X;  3VYT B;  3SJM A;  1F43 A;  3C2G A;  2XRL A;  3KLO A;  1FTT A;  3SDB A;  2VON A;  3HTU A;  3U9G A;  1LFU P;  2YPR A;  2O5R A;  4XMY A;  5K1Y A;  5DM6 F;  1YIO A;  4I01 A;  3SEZ A;  2LF8 A;  3S15 J;  1PUF B;  4ESF A;  1H9T A;  2E35 A;  3DP7 A;  1MSF C;  2CW8 A;  3RTR A;  2GA2 A;  4XKV A;  5EG0 A;  4UVA A;  2A3S A;  3OL4 A;  2QCO A;  1FOK A;  1Z7L A;  3I56 I;  3K10 A;  5EF6 A;  1T0F C;  3FXO A;  2HQ5 A;  1HW5 A;  4BE0 A;  1JKO C;  2D1H A;  3RDI A;  3JW4 A;  2VQC A;  3CDI A;  1D3Y A;  3FXR A;  4DYQ A;  3ABT A;  3AAF A;  3KP2 A;  3MD2 A;  1Y0U A;  4NC8 A;  1BA5 A;  2JT1 A;  2RV8 A;  4MFD A;  3RYR A;  2E2H J;  3JRB A;  1J0R A;  9ANT A;  1GLN A;  5J6X A;  2M7B A;  2NVY J;  5LHG A;  3ZN0 A;  1F36 A;  2AXT C;  2CO5 A;  4HOB A;  3HOX J;  3S3M A;  5FO5 A;  2KJB A;  3ZQI A;  2DI3 A;  2E1M B;  3SDG A;  2VC0 A;  1CGP A;  4QIW N;  1T0F A;  4PJ0 C;  3W2A A;  3PNT A;  1KQ9 A;  3CUQ A;  3FK6 A;  3E6D A;  2QQ8 A;  4KFC A;  5AIP A;  2CV0 A;  3CJT B;  3BPX A;  1MH4 A;  2EV0 A;  2VN2 A;  1R5I D;  1S5L C;  2BV6 A;  3OR2 C;  1IN4 A;  1SD4 A;  2KRF A;  1LVA A;  3BTC A;  1LE8 A;  3HTS B;  4MTE A;  3U1D A;  5IT3 A;  1MMN A;  1OCC H;  2X6X A;  5LHI A;  2JA8 J;  2LMD A;  4I09 A;  4HNV A;  1DPR A;  4BJT A;  3T8R A;  3BC8 A;  2GIV A;  3A2K A;  4QTR A;  3DLL F;  1MW7 A;  2W25 A;  2BBY A;  4C3I J;  2RAE A;  4QPQ A;  4QSH A;  3JRA A;  2Y48 A;  5ILS A;  4GXO A;  3W6K B;  3DKY A;  3RI4 A;  3I53 A;  2XPV A;  2JPB A;  2BYV E;  3CMM A;  2YSR A;  1I3Q J;  2DA4 A;  2HQN A;  4BY7 J;  2RN7 A;  3DQV C;  4F55 A;  1D0Z A;  1VND A;  4HX7 A;  4C2M J;  1WGX A;  2Y0S A;  1H89 C;  2VE9 A;  1ETQ A;  2LRE A;  2CYY A;  3HSE A;  3EYI A;  2HWV A;  3S17 J;  3IH4 A;  5EGO A;  2V9V A;  1MSE C;  2GWR A;  3CMY A;  3F0C A;  3K7A J;  3CO6 C;  5HLG A;  2NRA C;  2BGC A;  4Y3O A;  4HBL A;  1I5Z A;  4S0H B;  2GXB A;  4XKB A;  2ZFW A;  3ABM H;  3ZQH A;  3HPG A;  3UKG A;  1HSJ A;  2A5Y B;  3SFI A;  1DDN A;  4DBR A;  2WTE A;  5H6Q A;  4O6J A;  4UVC A;  4ON0 A;  3IKT A;  4I6Z A;  1MIJ A;  2DFI A;  4C3J J;  1IAW A;  2RGV A;  5KNL A;  4N9I A;  4CGZ A;  5ICC A;  4XK4 A;  2XRN A;  3OS2 A;  1D0X A;  4E7I A;  2R7V A;  3EYY A;  1YHQ I;  1PP7 U;  1MGT A;  1XDS A;  2VJJ A;  1HCR A;  2DJI A;  2K9Q A;  2L0K A;  4XRS A;  4I02 A;  3FXQ A;  3QYF A;  3BQY A;  1IUY A;  3CUO A;  1NH3 A;  5ICE A;  3V8J A;  1B6A A;  5GAG J;  3TED A;  2DMP A;  5HLT A;  1G4D A;  4ENK A;  2OF7 A;  5BOX A;  2FML A;  3PM1 A;  4X1E A;  1DP7 P;  3LSR A;  4LFU A;  4HNU A;  5F27 A;  3B6A A;  3C18 A;  2E34 A;  5KVR A;  3P7N A;  2PX9 A;  4G8X A;  1BR2 A;  1LKX A;  3BR5 A;  3DV8 A;  4KYW A;  2P6T A;  3OS0 A;  2J5O A;  2HYJ A;  4D5F A;  2VL8 A;  2DA6 A;  3N4M A;  2VE8 A;  2HZT A;  2VBW A;  4NQW B;  1V54 H;  2IXS A;  1TTY A;  3M1C A;  3TOA A;  3BTJ A;  4O3M A;  2M4G A;  2O61 A;  1VQM I;  3PNY A;  4EM1 A;  4I98 B;  3C2H A;  3GTP J;  2JA2 A;  3GF2 A;  3CJR B;  1XGN A;  4KUM A;  4B1R A;  2UXN A;  2HKX A;  2KRC A;  5M3M J;  4IHY A;  3H0G J;  2QYO A;  2DYS H;  1UST A;  3G1L A;  1TQM A;  4M3G A;  1HC8 A;  1UFM A;  2CV1 A;  3T1B A;  3EUK L;  2O3F A;  1YS6 A;  3JRE A;  4A2U A;  1TWG J;  2XAU A;  2HQR A;  4AIK A;  2R7U A;  4MNU A;  3G71 I;  1GV2 A;  3M9A A;  1TWA J;  3GCM A;  1R49 A;  4UV9 A;  2D5V A;  2NVT J;  1ZHF A;  3GXO A;  3RZO J;  2GQQ A;  1ITY A;  1KYW A;  2E1C A;  2CQ7 A;  4F93 B;  4J01 A;  2DFH A;  3QRF F;  4MFE A;  4XRM A;  3RPQ A;  3OYI A;  2EK5 A;  2NYX A;  3HKZ A;  2JN6 A;  2IBD A;  2XRO A;  2DA1 A;  3NAU A;  2E2J J;  1AKH A;  1OKR A;  1ON1 A;  3L2R A;  4B3A A;  2F2E A;  1KGS A;  2BOL A;  4ZTF A;  4D9J A;  1I50 J;  1U3E M;  2LFB A;  4I76 A;  1IV8 A;  1BIA A;  2P6S A;  4Y17 A;  1FPQ A;  3F8F A;  2K7L A;  2LY1 A;  3QPT A;  5J8F A;  2ZME C;  3Q5F A;  2P5K A;  5FJ8 J;  2W57 A;  3GWZ A;  3E7L A;  3QOD A;  3G1O A;  2NAZ A;  3HB9 A;  3M8F A;  2IS1 A;  2Y75 A;  1IDY A;  2HDC A;  2RQQ A;  5K7Z A;  1IUF A;  1X1A A;  2JK3 A;  4BH9 A;  4NUB A;  1ETY A;  4PGG A;  4BXX J;  4Y52 J;  5C3E J;  3EUH A;  4I0A A;  2F6C A;  4BAC A;  1QPM A;  1T33 A;  2DJN A;  4D7N A;  1L3L A;  1BJA A;  1TZL A;  2MD5 A;  2CSO A;  1FC3 A;  2YU3 A;  2IS2 A;  3AFH A;  4A3K J;  1SVO A;  3I64 A;  3VYS B;  3PIP F;  2CV2 A;  2RQP A;  3BP8 A;  3MMY B;  2Q8K A;  5BQT A;  1Z9C A;  2EH3 A;  1U8R A;  2VPL A;  1NK2 P;  5CVI A;  3PO2 J;  3WTT C;  1IN8 A;  1X1C A;  2PMH A;  3S32 A;  3BZC A;  4RAF A;  4CYC B;  3BOQ A;  3AG1 H;  2CGP A;  5E1Z B;  3BRO A;  3FMQ A;  4FX0 A;  4BAY A;  3T0Y A;  1VQ8 I;  1LDK B;  3OIP A;  2VJI A;  3HRM A;  3HC7 A;  4XOP A;  2IA0 A;  5DV5 A;  4E7Z A;  1X1B A;  2UUZ A;  2Y0S N;  1WJB A;  1ZKG A;  4E4H A;  1GXQ A;  2DBB A;  5CVV A;  4M6V A;  2H6C A;  4MEX F;  3TP0 A;  3HOV J;  3LSP A;  4KIC A;  4R79 A;  3WU1 B;  3H35 A;  2QF7 A;  1R1V A;  2FBH A;  1DU0 A;  1QPI A;  3FK7 A;  3FXM A;  3ZQF A;  3TDZ C;  5IYD J;  3LSJ A;  3ZN1 A;  1XS9 A;  3HYI A;  4OWR B;  4M74 A;  3TDU C;  4IEJ A;  5DCF A;  5DUK A;  5FFZ A;  3TOB A;  1ETV A;  4D1Q A;  3CCE I;  1Z0X A;  4HF2 A;  1O3S A;  2L5Q A;  2BW3 A;  3SYT A;  5KK1 A;  1TLH B;  3RQ4 A;  3RIR A;  4NHJ A;  1EH7 A;  2QEN A;  1ACI A;  3LSH A;  2DDA A;  3BJA A;  4ZC3 A;  2DFF A;  3QU3 A;  4EJT A;  2EIN H;  2BVM A;  3ELK A;  2L02 A;  4A3E J;  2XVC A;  4Q5S F;  4BXF A;  4PZJ A;  3VEP A;  3LAJ A;  1USS A;  2Y30 A;  5KCM A;  1XGM A;  5FGM A;  2DMU A;  3VDX A;  2K86 A;  2ELK A;  2AO9 A;  2M87 A;  5L3C A;  2N8G A;  2HDW A;  2V1X A;  2M45 A;  3DLA A;  2OQG A;  5JVG F;  2H1K A;  3TQN A;  2LR8 A;  3S1N J;  4YIF A;  4WXH A;  3KZY A;  1EH8 A;  4P55 A;  3ULQ B;  2X6Y A;  1SAN A;  1WKM A;  2Y9Z A;  2P7C B;  2ZSH B;  2EIL H;  3LA3 A;  2PJR A;  2YR2 A;  1FIA A;  1J2X A;  5KAF C;  4FE4 A;  1VFC A;  1WH7 A;  2JUC A;  2E5N A;  5A2Q Z;  2VOP A;  5D6E A;  1TQP A;  3D0S A;  5HLH A;  2ZME B;  3KEY A;  4E6K G;  3CCJ I;  1X1P A;  1VZ0 A;  4HF0 A;  5CJ9 A;  3TP3 A;  4UUS B;  1FMV A;  3FF5 A;  3OIQ A;  3S1M J;  5M5W J;  2DPU A;  4G6Q A;  1QU3 A;  3WTS C;  4LOC A;  1AWC A;  2LRD A;  3NWT A;  4M9Z A;  1R6R A;  2EBI A;  2Y31 A;  4I0B A;  3MVP A;  4I99 C;  4DIQ A;  4EVI A;  3WGI A;  4A3J J;  2FEZ A;  4CCN A;  4C3H J;  3OIO A;  5DCM A;  4AIJ A;  3L2C A;  3VSL A;  2O9L A;  1FBS A;  1LEA A;  3VPR A;  5L3F A;  4F3Q A;  3ZMS A;  3DEU A;  4HW0 A;  4WX9 A;  4KIB A;  3FKI J;  1WJD A;  3HKZ N;  4KN7 X;  3K70 D;  4QWQ A;  5D5X B;  1XGS A;  3PSI A;  3W2V A;  2FXA A;  2QSG X;  4NB5 A;  1G6N A;  3CC2 I;  2XPU A;  3FXU A;  2RNG A;  2B7E A;  1Z05 A;  1MMD A;  1HA8 A;  3HZJ A;  5F0C A;  3PUF A;  3K1M A;  1SMT A;  2A6H F;  2JRT A;  4BQQ A;  4UNO A;  3KZZ A;  3Q3S A;  1MH3 A;  3MKZ A;  2DMT A;  1G3S A;  1J5Y A;  2MGQ A;  4OIR F;  4KA4 A;  4PDK A;  4RGS A;  2LLK A;  1FBQ A;  4IO9 F;  2EV5 A;  2JA7 J;  1W5C C;  2LBF B;  2ZJ2 A;  2UXX A;  2ZBK A;  4RGX A;  3MZH A;  4CA0 A;  4BEH A;  5LEK A;  1W7P B;  2DYR H;  3S3N A;  2E7X A;  1I1S A;  1BJZ A;  2MD0 A;  3OWT A;  3ZMU A;  4ZZL A;  2V4J C;  2QQ9 A;  3DBL B;  1OR7 C;  1SC7 A;  1K78 A;  4P5O A;  3A02 A;  3LQQ A;  4ITV A;  3HOU J;  2MLG A;  3M3Y J;  1Z67 A;  4PSW A;  3WHC A;  2DDB A;  4BQA A;  1O4X A;  2NVX J;  2VLA A;  3DTI A;  3QAH A;  2IT0 A;  2CQK A;  5TJJ A;  4M6X A;  5M5X J;  4FX4 A;  5JI6 A;  4DJA A;  3MEX A;  1TP4 A;  4MGR A;  3E97 A;  2VJ4 A;  1MBK A;  2V26 A;  2X9D A;  1CF7 B;  2L54 A;  1TW3 A;  1UJ8 A;  4K2E A;  1TT5 B;  3HIF A;  3H5A A;  1Z21 A;  2X4H A;  3FWE A;  4KNY A;  5FLM J;  1TBX A;  1FJL A;  1D1A A;  2IS4 A;  3BZ6 A;  2W84 A;  3TO9 A;  3FIW A;  2CUZ A;  4MIM A;  2KZV A;  1VQ9 I;  3O2P E;  1U5T C;  4MQV A;  4EAT A;  5DS9 A;  5BMZ A;  2HXI A;  5E3N A;  1OR7 A;  3ML6 A;  1JJ8 C;  3I59 B;  4PFO A;  3A01 A;  3QP6 A;  4KT5 C;  4KMU X;  2R7O A;  3K6G A;  4D7M A;  1R5G A;  3W3C A;  2MAB A;  1GV5 A;  1NHA A;  4XIC A;  2DOF A;  3E5X A;  4CO8 A;  1HST A;  4Z2Y A;  2LH9 A;  2TRT A;  1T08 B;  1XC5 A;  4AC0 A;  3JRI A;  1X4P A;  1ONV A;  1OCP A;  2V1N A;  5CQE A;  2OA4 A;  3BCA A;  2QBY B;  3K2A A;  1R58 A;  1TNS A;  2GXG A;  2XB5 A;  4GYI A;  3R4K A;  6PAX A;  3FX3 A;  3GTO J;  1PUF A;  1MD0 A;  2WY8 Q;  2GBY A;  1RPW A;  4XN0 A;  2V1U A;  1Z3X A;  4P9U A;  2HU9 A;  2JVG A;  2M5W A;  3K4K A;  2M8G X;  2XAS A;  4XR6 A;  2QA4 I;  1P7J A;  2QSH X;  1D1B A;  2X1D A;  5A2Q K;  2E1M C;  1C0W A;  2DK5 A;  2EA4 A;  3FXL A;  2ISY A;  3EET A;  3EUA A;  3HM5 A;  2BEO A;  2R5Y B;  3OYN A;  5J4V A;  4Q4Z F;  3GTQ J;  3H3V K;  3HEF A;  1RET A;  3T5X A;  2R93 J;  4LJZ F;  3V8K A;  3J80 Z;  2HS5 A;  4N0B A;  3F21 A;  3QPS A;  2LKX A;  2K9S A;  3HBL A;  4F92 B;  3L1P A;  4W1U A;  1IRG A;  3Q9S A;  1VQN I;  2WAQ A;  2M2E A;  4AIH A;  1P4X A;  5CVJ A;  4G9Y A;  1IN5 A;  2EA2 A;  3E5U A;  4BE2 A;  3FXK A;  1T6S A;  2DT6 A;  3BY6 A;  1TNT A;  2A68 F;  3DXJ F;  4RS8 A;  3RPU A;  1K79 A;  4CIC A;  3PFI A;  2L9V A;  3S14 J;  3KYC B;  2X6O A;  3OSG A;  1XX5 A;  3CCS I;  3IHU A;  3SZP A;  3GEZ A;  2G7H A;  2LNB A;  1WRJ A;  1YIT I;  1K7A A;  5HDN A;  2OV7 A;  1BI2 A;  1JI8 A;  2E1O A;  3AG2 H;  3ECO A;  3IWF A;  4KMF A;  1E3H A;  4XKW A;  2K9M A;  1VF9 A;  3TW6 A;  3KYL A;  1P4A A;  2FBI A;  2XHK A;  3H5R A;  4FE7 A;  4PJL A;  4YG2 F;  4RGU A;  1F5T A;  1MMA A;  2EZI A;  1IC8 A;  2Q0O A;  1FWZ A;  5ERI A;  3BT9 A;  3VB2 A;  2XGC A;  4O5V A;  1N25 A;  1TT0 A;  5GPC A;  3QOP A;  2UV1 A;  3F6O A;  2COM A;  3CD6 I;  2QVO A;  4PJM A;  4CXF A;  1TWF J;  4M71 A;  4MQ9 F;  5M3F J;  1LQ1 A;  3LSM A;  2EFN A;  1ERD A;  3DFG A;  4A12 A;  1EA3 A;  3M1E A;  5JHU A;  2NOG A;  4D0P A;  2IGK A;  3OR1 C;  4KN4 X;  2VKD A;  5J3L A;  3MFK A;  3C2B A;  1GVJ A;  1XD7 A;  2EB7 A;  1KZH A;  2W4S A;  3P9K A;  3PIO F;  3KFW X;  2NNY A;  5LGU A;  4ZYE A;  1VQ7 I;  4OIO F;  5E18 F;  2DQL A;  1STZ A;  2Y2Z A;  3F8N A;  4RB3 C;  2ZKZ A;  4ZDO A;  1ETX A;  2XKO A;  1A04 A;  1NG7 A;  1U2W A;  3R0A A;  3ZMV A;  2OTJ I;  2FD5 A;  3ECH A;  3E6M A;  4HA8 A;  3CCQ I;  1JE8 A;  4XLC A;  1APL C;  3GW2 A;  5ED4 A;  4LIT A;  2KHM A;  4XRS G;  3OYB A;  2P0W A;  3MCZ A;  4EGZ A;  2K9L A;  1U5T B;  1HDD C;  1RKT A;  1KU7 A;  4NNJ A;  1MNM C;  3E6B A;  3ZPL A;  2GZW A;  3JRF A;  5F1R A;  3O8H A;  2JMW A;  1MJB A;  3AKZ A;  1YX3 A;  2RDP A;  4ZYD A;  4XON A;  4XM3 A;  5DD8 A;  2EJR A;  1J9I A;  3FM5 A;  1O3Q A;  3IKV A;  3I4M J;  1F9N A;  1PP8 F;  4ENJ A;  3NAR A;  1V5G A;  3ZMT A;  3WE2 A;  2G0E A;  3KPH A;  3FHN A;  2W7N A;  2R3S A;  1XN7 A;  1OQY A;  1RUN A;  5EEH A;  2KMU A;  1SD5 A;  5IYB J;  2VXZ A;  3L2W A;  2WV0 A;  4P1W A;  1V5E A;  3BG3 A;  3ZMD A;  2MH9 A;  1ZTR A;  2FNA A;  4L9N A;  3REO A;  2PG4 A;  1RNL A;  4UB8 C;  2JA5 J;  3ZCO A;  1MMS A;  4BHB A;  2IEK A;  2Q2E B;  3D5L A;  1HKS A;  4JOM A;  2XDV A;  3WGH A;  1J75 A;  2CH0 A;  5LGT A;  3S1Q J;  4MO7 A;  1ZG3 A;  2VKH A;  1X3W B;  2F5E A;  4Z6Y A;  3DBH B;  4M3B A;  3G1M A;  3H1C A;  1XPX A;  2HPI A;  1OCT C;  2V79 A;  4NQW A;  3U1K A;  5J1R A;  3OOU A;  3J80 K;  5BNG A;  2HVR A;  3HRU A;  4ASN A;  4ZJZ A;  5HDK A;  1E0E A;  1OCO H;  5D8L B;  3QOE A;  4BJ5 C;  3RKQ A;  1FT9 A;  2W00 A;  4MTD A;  1HW1 A;  1I1G A;  2KIF A;  2KFD A;  4EQQ A;  1JUM A;  1K61 A;  1ZGA A;  1E3P A;  2DK8 A;  5FKN A;  1ZRF A;  1PJR A;  2K5C A;  4OIN F;  4XKC A;  2KZG A;  1DGW Y;  4JYK A;  2KQR A;  3BJ6 A;  4HG2 A;  3JRG A;  3Q0V A;  1FTZ A;  2LP0 A;  4LLG F;  4FCY A;  3ZR8 X;  2FA5 A;  4NC6 A;  1ZR4 A;  2V9K A;  2JA6 J;  2XUB A;  3BPV A;  4BBR J;  3PQJ A;  1S9H A;  4OU0 A;  1FNN A;  5HS8 A;  2KPM A;  3WG9 A;  2FMY A;  3G6E I;  2OJE D;  2QQB A;  5DDG A;  5D5U B;  3J7A O;  2A6E F;  4BXU A;  5E17 F;  5CVU A;  4DZP A;  3DPL C;  3GUD A;  4P9F A;  3EPZ A;  5CLS A;  1SMY F;  1S3J A;  4B4C A;  1TWC J;  2DT7 B;  3K0L A;  4PFP A;  1H0M A;  1U6G A;  4HX8 A;  2FX0 A;  1QZE A;  4R1H A;  1KYZ A;  3KX2 A;  4GFB A;  2H94 A;  4EEF G;  1EKE A;  1RR8 C;  3DWL E;  1MBH A;  3RYP A;  2WAQ N;  4UUV A;  2L7F P;  1TL8 A;  1OMI A;  3N05 A;  3V7S A;  4KIT B;  4ZYH A;  1YLF A;  3JSO A;  3ROU A;  2H27 A;  1N77 A;  3ONQ A;  4ZYA A;  3GFM A;  1NK3 P;  5FRN A;  3PQK A;  2R7R A;  1S29 A;  2EQR A;  4E7H A;  4EM2 A;  4NBQ A;  2M7A A;  4GGG A;  2D1V A;  2ECB A;  3K4B A;  2Z99 A;  2HR3 A;  4EM0 B;  3ERE D;  2MYS A;  5EG0 B;  3CF2 A;  2DA2 A;  2R92 J;  4RM2 A;  1AHD P;  2OZ6 A;  1YO5 C;  2L4A A;  2W1O A;  2XAJ A;  3F9K A;  2CS3 A;  2M8E A;  5IOY A;  2L9R A;  4RLQ A;  2LF7 A;  2LVS A;  3JAM Z;  1YI2 I;  4DZJ A;  4F52 A;  4CYC A;  2X51 A;  5DTD A;  1UHM A;  2WAD A;  2HOA A;  4V2F A;  1ZH5 A;  2XSD C;  4HDU A;  3HRS A;  1WJA A;  4ESJ A;  4BY1 J;  1ZRD A;  5D5W B;  5F64 A;  1FOW A;  5E20 A;  5EDN A;  1D0Y A;  2E7W A;  3M4O J;  1X2N A;  2LY2 A;  1LDD A;  1SD7 A;  2Z16 A;  2VPR A;  3L7W A;  2V9P A;  1MJ9 A;  3FHZ A;  5BPI A;  1D5V A;  3CP2 A;  4C9Y A;  3GZ5 A;  1QO0 D;  2MFZ A;  3DU6 A;  5LEJ A;  1D1C A;  4HV6 A;  3CUQ B;  3DTK A;  5GP9 A;  1BW6 A;  2XV4 S;  4KIF A;  1ODD A;  2E19 A;  2W85 A;  4L9J A;  2L9S A;  3K4N A;  1Y1W J;  1E17 A;  5EZH A;  4L0Z B;  4A3B J;  4YRV A;  2ID3 A;  1DPU A;  2JSC A;  2VI6 A;  4JK1 X;  2EV6 A;  2M34 A;  4AUX A;  2XGE A;  1YJN I;  1AU7 A;  4IRG A;  4EV0 A;  3GZ6 A;  2OTL I;  1IXS B;  2KDO A;  4EJW A;  1L0O C;  3AL0 C;  3HSF A;  1DQU A;  1OYW A;  1W4M A;  3A03 A;  3OYL A;  3DF8 A;  5L3E A;  2X48 A;  1W1W E;  3MAJ A;  4IPA A;  1YIJ I;  1E3O C;  4IJA A;  3M8J A;  5CVR A;  1J59 A;  2OUM A;  1P2F A;  2JSP A;  2F4O B;  4BUP A;  1X3U A;  1FOY A;  3BR6 A;  3MKL A;  3BLY A;  2M0M A;  4G7Z F;  4JQF A;  1BBY A;  1ETK A;  4IQ4 A;  2FSW A;  3GTM J;  2HPM A;  3LA2 A;  1BOB A;  3K4J A;  2PEX A;  1ZN2 A;  2L7Z A;  5K5R A;  1XSX A;  2X0L A;  1S72 I;  2M0C A;  3U21 A;  2F5C A;  4GYG A;  2MG4 A;  2XAQ A;  4RBO A;  2A69 F;  4U0W A;  2STW A;  4A3C J;  2YU9 J;  1RI7 A;  1D5Y A;  3IAS 2;  2Z2S B;  3Q0U A;  1FSH A;  3GFJ A;  3F22 A;  1IXR C;  1YOV B;  2OU2 A;  4A0Y A;  2M30 A;  5K5O A;  2HOE A;  2L7M P;  3S3O A;  4Q48 A;  3OYK A;  1Y8Q B;  1JKQ C;  3E0J B;  1IXC A;  1WWX A;  2R5Z B;  4OIQ F;  3UNG C;  2ZME A;  4UUS A;  4Q47 A;  1B72 B;  2FRH A;  1EF4 A;  1YE9 A;  2OD5 A;  1TQI A;  3HG9 A;  5IYC J;  3SZT A;  1GDT A;  1I3A A;  4PK4 A;  4OAZ A;  3CCL I;  2K4J A;  4CSW A;  2FUG 2;  2ETH A;  3B02 A;  2DQR A;  3BR0 A;  1IG7 A;  3CLQ A;  5F6F A;  5E8G A;  1UB9 A;  4G7O F;  3QPH A;  1WVR A;  2ZXJ A;  3JCU C;  2BY1 A;  4LB5 A;  3WTX C;  1XB4 A;  1Y56 A;  2V1D A;  4WXD A;  3ZQG A;  3U2R A;  4MEY F;  3KEQ A;  2LD5 A;  3ABU A;  2PMU A;  1JT0 A;  2PJP A;  3BG9 A;  4CZC A;  3AG3 H;  4H0E A;  1ZGW A;  4IKF A;  4YEL A;  2R7F A;  2CWE A;  1ZLJ A;  3GBG A;  1O3R A;  1LFB A;  2B9S A;  1X4O A;  2DFE A;  2CUE A;  2FF4 A;  2DOA A;  5D6F A;  2EWN A;  3JAM K;  1T39 A;  2VBX A;  3J7A Y;  1MDM B;  1R1T A;  4YII A;  3E5Q A;  4BNC A;  2CQX A;  3VWB A;  1JTX A;  2WWY A;  3NRV A;  1YX5 A;  4LIV A;  2ACJ A;  2LK2 A;  2BXY A;  3GLX A;  1IZ1 A;  4P96 A;  4IZZ A;  1K4S A;  4WWC A;  5GTH C;  1UG2 A;  2ZJR F;  1ZQ3 P;  3WTZ A;  2QKM B;  1FMW A;  3HUG B;  3GFI A;  2DCE A;  1R22 A;  5EZG A;  3X2Q H;  3K9T A;  2MSY A;  3RKW A;  2QEX I;  1KA8 A;  2ZNZ A;  1W7P A;  4AYB N;  2JQ7 A;  3BG5 A;  3CC7 I;  1SAU A;  3HHG A;  3OYJ A;  5JR3 A;  4IHX A;  2BE5 F;  3IC7 A;  1DGR M;  1N75 A;  1U0J A;  4BL0 B;  2DA3 A;  2Z33 A;  3W2W A;  5F0F A;  1FZP B;  1FP2 A;  2PN6 A;  4HZF A;  4YFK F;  1LDJ A;  3BTI A;  4LMY A;  4C2T A;  4XN3 A;  3EDP A;  2L01 A;  1A36 A;  4LK1 F;  5DYM A;  3SFZ A;  3OS1 A;  4RB0 A;  4CHU A;  4I2O A;  4LGW A;  2GOM A;  1CF7 A;  4ESB A;  1G3Y A;  2OQR A;  2NS7 A;  3GO5 A;  1OYI A;  2HGC A;  3AL0 B;  2WB1 N;  2KKO A;  1UEL B;  4OMY A;  4CCJ A;  1JKP C;  5F0H A;  2E36 A;  3D5R C;  3ISP A;  3CJN A;  4JX5 A;  3RPU D;  3V8L A;  3DBR B;  3JRC A;  2K27 A;  1Z1D A;  4PJJ A;  4W97 A;  4EJU A;  3I59 A;  2BHZ A;  2ID6 A;  3KYD B;  4PJN A;  3C1D A;  2KRH A;  1FYM A;  2OZU A;  1XMA A;  3WTU C;  4B8X A;  1ENH A;  4A6D A;  5HDG A;  3WTV C;  1LB2 A;  2EFQ A;  5D4S A;  2PQ8 A;  2KP6 A;  2ECC A;  1ZEL A;  2ADU A;  5B66 C;  5EEG A;  3F72 A;  3O8G A;  3H36 A;  1P9Q C;  2ELJ A;  4HNT A;  1YW8 A;  4CCL A;  2QBY A;  4XQF A;  3KP3 A;  3WU2 C;  3BR1 A;  2UZK A;  4U0V A;  1VI0 A;  2Z3Y A;  3L09 A;  1SFK A;  2IA2 A;  5JFR A;  1T38 A;  4XNF A;  3O6B B;  3HOZ J;  1FYL A;  2VC1 A;  1W36 D;  2HXO A;  3GLL A;  1JTY A;  2GAU A;  1Q1V A;  1ETW A;  1QZZ A;  1K6O A;  4M3D A;  2DT5 A;  4E7S A;  2B63 J;  4JP0 A;  5AON A;  4II3 A;  2R5Y A;  2DN0 A;  1VQL I;  5E3L A;  5BPD A;  2FOK A;  5K7F A;  3HGG A;  3HXL A;  4FET A;  5EEA A;  2F4I A;  5FRO A;  1B8I B;  1J09 A;  3IH2 A;  4U0Y A;  4ZZD A;  1SFX A;  2O7O A;  3A4C A;  4L18 B;  1G59 A;  2O8X A;  2HNH A;  2EIK H;  3CCY A;  4A69 C;  3LFU A;  1VQP I;  4L5J A;  5LLQ A;  1UHW A;  2HI3 A;  2YS9 A;  1YW9 A;  4U7B A;  2IGM A;  4GRI A;  4XBF A;  1IGN A;  3OL3 A;  2DXI A;  4X6A J;  3P9I A;  5JVT A;  4RB2 C;  3S2W A;  4IVN A;  4XRF A;  4BE1 A;  2BW3 B;  3P9C A;  4D5C A;  1XGO A;  1A5J A;  2XKP A;  3H0D A;  4JBA A;  4J19 A;  2JZY A;  4J00 A;  3QP5 A;  2VKV A;  3CO7 C;  3COA C;  3GYH X;  1FY7 A;  3K1N A;  5E1W A;  5LBQ A;  4XSZ F;  1REP C;  4A3L J;  2DU9 A;  4KDP A;  3ABK H;  1P92 A;  4OIP F;  4UVB A;  1XTA A;  2CW0 F;  2PBI A;  4B47 A;  3P5J A;  1T95 A;  1KQ0 A;  3E1S A;  5H20 A;  1I6H J;  4IRH A;  1IN6 A;  2VKE A;  3RZD J;  1QBJ A;  2DMN A;  3OV8 A;  1UCR A;  4C2U A;  1AOY A;  2XAH A;  2D2W A;  4E7K A;  3FM3 A;  2I8D A;  2P7V B;  3MKY B;  1B9M A;  4Y4R A;  2OAZ A;  3OYD A;  1RZ4 A;  5GPA A;  3CQZ J;  3IL2 A;  4XLP F;  1MND A;  1V55 H;  2MA3 A;  3JRD A;  5LD2 C;  5L3D A;  2OC6 A;  1U5T A;  5FLV A;  1U9O A;  3I55 I;  1WH5 A;  2ELH A;  3HJE A;  1UG0 A;  1Z7U A;  3BWG A;  4RLF A;  4A3I J;  3QYE A;  2WAF A;  3ZQC A;  2QWW A;  1Z77 A;  5GAE J;  5FKL A;  3L2Q A;  2L7K A;  2MLK A;  1Z3Y A;  4BBS J;  1S8N A;  2H1L A;  2R7S A;  1ON2 A;  3H9Q A;  4HST A;  5DM7 F;  4XL9 A;  3GME A;  2LKP A;  1G8X A;  1U9N A;  2H6B A;  3O3K A;  4BYY A;  1WPK A;  1T8I A;  1PDN C;  2VOO A;  5JLX A;  3VOD A;  2IW5 A;  1HDP A;  2XIG A;  1KU9 A;  2YUS A;  1Z6T A;  1RUO A;  2R7X A;  2QUF A;  1LFP A;  4RAY A;  1MJA A;  5CKT A;  3F8C A;  2LDU A;  5ICG A;  1CQT A;  1W5S A;  4RAZ A;  1SFO J;  3I0T A;  1XMK A;  2QSF X;  5D4R A;  2Q2E A;  5J4Y A;  3LL7 A;  3OSF A;  1PYV A;  2A6T A;  2O8K A;  2VAS A;  3LSI A;  3HDD A;  4AM3 A;  1R5H A;  3TO7 A;  3PSF A;  4DOZ A;  4DBQ A;  5HVQ C;  2KIM A;  1QGP A;  4RGR A;  2K3P A;  4E7L A;  3ERM A;  5CYV A;  1LEB A;  2DMQ A;  2PFB A;  4HAM A;  1OPC A;  2E1N A;  3HGY A;  3R6S A;  3TBI A;  1DUX C;  2QZ8 A;  4I7H A;  2V6E A;  4IF4 A;  1K6Y A;  3OYE A;  2QLZ A;  1X2M A;  1YYV A;  3R0J A;  2V7F A;  1A6Q A;  2LY9 A;  4N4O B;  4BDZ A;  4LB6 B;  4HSR A;  2A05 A;  3N97 A;  3T8T A;  4HQM A;  1IDZ A;  2KL4 A;  2EZK A;  2VJ5 A;  3GVA A;  2CG4 A;  3S8P A;  3JSP A;  2IA1 A;  3OYM A;  5E3O A;  2P4W A;  1SD6 A;  2VUM J;  5LFA A;  3FMS A;  1HBX G;  2HVQ A;  2KDZ A;  4RMN A;  1GHC A;  1H88 C;  5EYR A;  2CQN A;  3OYH A;  2WY7 Q;  3FBN B;  5B5E C;  2D45 A;  4II2 A;  1ZYR F;  2P8T A;  2Y9Y A;  4GDF A;  4XLN F;  4B3X A;  4BHP A;  3K4C A;  4ETS A;  2ME0 A;  1GVD A;  1H8A C;  2FJ1 A;  3ESW B;  1QZY A;  2VXD A;  3KEO A;  1FP1 D;  3KP5 A;  1JGG A;  2JRM A;  1K83 J;  2DAO A;  1YRN B;  3A01 B;  1ULY A;  4M73 A;  4M72 A;  5GAH J;  2R7W A;  3CC4 I;  3K69 A;  2DO7 A;  1SVM A;  2CFO A;  2EZL A;  1QA6 A;  1EJ9 A;  5H6R A;  1A31 A;  1SFU A;  2Z1D A;  2M3A A;  4IX7 A;  1Z6R A;  1OYY A;  2E71 A;  2XGD A;  1U8B A;  2L4M A;  1Y39 A;  5TIS C;  2NS0 A;  1WI3 A;  4ZYG A;  2Z9O A;  3S16 J;  1YQA A;  1YFH A;  1P4W A;  5ICF A;  2BZT A;  4V2G A;  4EGY A;  4BS9 A;  1R1U A;  5J47 A;  4UHT A;  2HTS A;  3LAP A;  1ORK A;  1YJ9 I;  3LOC A;  3S1R J;  4RM3 A;  5B1B H;  4B43 A;  1JT6 A;  5AIQ A;  4IRI A;  3CCV I;  3CUQ C;  3DEW A;  2JVH A;  1XSV A;  4LG0 B;  2M4K A;  5J1U A;  4WXC A;  5K5Q A;  3IP4 B;  2LKS A;  4DYR A;  5HNF A;  3CMA I;  4A5N A;  3I9V 2;  4GO1 A;  2ISZ A;  2XF5 A;  1KU3 A;  4DW6 A;  2PI0 A;  3RQI A;  5HOD A;  1PUE E;  3M7G A;  2K9N A;  1JKR C;  5ILU A;  3DEE A;  2LC2 A;  4M9X A;  1X3Z B;  1BI3 A;  2LOO A;  3IAM 2;  3ZQL A;  2HDD A;  2OBP A;  3LFK A;  2WBM A;  2WA0 A;  3E3V A;  4AWX B;  3BG6 A;  4QPO A;  4AVP A;  2B0L A;  5IP6 A;  2L9N A;  1A6I A;  4WF2 A;  2EFP A;  3DU5 A;  3G3Z A;  1B1B A;  5LRR A;  2CUJ A;  3D5S C;  3UR3 C;  2ESH A;  3VYR B;  4AD9 A;  3FKJ A;  5L3B A;  2HEO A;  2HYG D;  4B48 A;  5FD5 A;  3PFY A;  2WC2 A;  3CLO A;  2ZJP F;  3I4N J;  2R7T A;  3I4P A;  4LIU A;  4XOR A;  2Q1Z B;  2QKL B;  3RCO A;  2XF6 A;  3V7C A;  1OCZ H;  3HRT A;  3GTK J;  2F5F A;  4F91 B;  2VBZ A;  2QGU A;  4A6E A;  3GZN B;  1Y1V J;  1KON A;  5FB2 A;  4UY8 I;  4RB1 A;  4M9S A;  4UV8 A;  1F1Z A;  2HOT A;  2RNJ A;  4LK0 F;  3BG7 A;  3DPT A;  4LD5 A;  1D8K A;  2NXN B;  2NVU B;  3IRQ A;  3BJO A;  2IP2 A;  5F04 A;  2JTV A;  2JWT A;  1GXP A;  3JTH A;  4AYB A;  1JJ6 C;  1D8J A;  1QRY A;  5LGN A;  4G7H F;  3OYG A;  1MBG A;  4IHV A;  1OLT A;  2BY2 A;  3M8E A;  1MBE A;  1WQ2 A;  4Y13 A;  1W7P D;  2K4B A;  4N4N B;  5C4X J;  5HS7 A;  2BVL A;  4BQN A;  5GAD J;  3G73 A;  5IP7 J;  4KIG A;  4EJO A;  1RRJ A;  3DTE A;  3WHB A;  2R5Z A;  2H8R A;  4B09 A;  4HV5 A;  1B72 A;  5IP9 J;  1TW2 A;  3ZQQ A;  2ZJQ F;  4FTH A;  2Y69 H;  4M3F A;  1WHU A;  2J5P A;  1R4N B;  5JHF A;  2EIM H;  2RVC A;  2F5V A;  1R7J A;  2ZXH A;  2WB1 A;  1JUS A;  3I58 A;  1PVE A;  3NWS A;  5FKM A;  3ZP5 A;  4HQE A;  2PMZ N;  1J7K A;  1YS7 A;  3NQO A;  2G9W A;  1JGS A;  1Q1H A;  3ZOB A;  3PUB A;  3VSK A;  3D1N I;  4Y33 A;  1SVL A;  2IAI A;  2R4G A;  3I5U A;  2F4M B;  4CCM A;  3ZXS A;  2PLY A;  1HLV A;  4CCK A;  2EPF A;  3FZV A;  3CTA A;  2VOD A;  1QQI A;  2FQ3 A;  4G6D A;  1LUJ B;  1BC7 C;  3KET A;  4PUS A;  1MDM A;  1ZG5 A;  1ETO A;  2BY0 A;  2P5L C;  2MBF A;  2CU7 A;  1BR4 A;  1MBF A;  3OMY A;  4AID A;  4EJV A;  2XGX A;  2DOE A;  2F5D A;  3F8M A;  3HOY J;  2RRE A;  1HQC A;  5J40 A;  3GX4 X;  2K02 A;  4MHG A;  2R7Q A;  1I6X A;  5DD4 A;  1LE8 B;  1TWH J;  2CW7 A;  2ICW G;  1XDU A;  4TV7 A;  4BKX A;  3HUG A;  3WG7 H;  2HVS A;  1RR7 A;  3WOD F;  3BR3 A;  3H3Z A;  1SEU A;  2HKO A;  1O3T A;  1RIO H;  5FFX A;  1LVK A;  1SAX A;  3KP4 A;  3SXY A;  5J8C A;  5HS9 A;  5GTI C;  1QHH D;  5E79 C;  2IJL A;  3CZ6 A;  1NG6 A;  4LG3 A;  3KZI C;  4NC7 A;  4XLA A;  3IV5 A;  1BC8 C;  3TGN A;  2GIZ A;  3PNV A;  3OOP A;  1I27 A;  5FKO A;  3E6C C;  1BL0 A;  1VQ5 I;  5E8I A;  1QVU A;  4L5E A;  5EJC A;  3PO3 J;  2XPW A;  1VQ4 I;  2LSO A;  1BOA A;  1UAA A;  3B73 A;  1X58 A;  1OJL A;  1Y6I A;  2Y0M A;  2ZFU A;  5F1J A;  3S2H J;  5EGO B;  3EUH C;  2AS5 F;  3KLN A;  1ZLK A;  2VT2 A;  1JHF A;  1R4M B;  4BJ6 C;  1R23 A;  2Z5U A;  4UXN A;  3LA7 A;  3L9F A;  2I10 A;  2IVM A;  4YIR X;  1JHH A;  4B44 A;  1DP3 A;  3L2V A;  1ZRC A;  1WJE A;  4HYE A;  4FIS A;  4IQJ A;  1S6L A;  2ZXI A;  4S04 A;  5ILV A;  1RKW A;  2VT3 A;  4A3D J;  2NOJ B;  3K4M A;  4L9V A;  3GTL J;  4XID A;  2E2I J;  5L3G A;  2NS8 A;  3QYB A;  1UZC A;  3BTL A;  4ZH4 F;  2AXL A;  1FX7 A;  1ZAR A;  3SEQ A;  5D5V B;  5D8K B;  2G7U A;  3MQ0 A;  2DOD A;  2KIS A;  2KJC A;  4A3M J;  4A0X A;  1H9G A;  1IRZ A;  3QU6 A;  1BI1 A;  2VQG A;  4XOT A;  2K85 A;  2EIJ H;  4OAY A;  4IOC F;  2DLL A;  1OFC X;  4YFN F;  4Y7N J;  4ENN A;  2RKH A;  1U78 A;  4DGW B;  2M9H A;  4BGD A;  4IHT A;  2IPQ X;  2VB6 A;  1X19 A;  5HOO A;  1G3W A;  1ZRE A;  4HLY A;  1POG A;  1ZAO A;  3IH3 A;  3S2D J;  5DUI A;  1QHG A;  5HNH A;  5IOZ A;  3L00 A;  1W0U A;  4IHS A;  3F3X A;  3WTY C;  2IS6 A;  2HFH A;  2TCT A;  3LNQ A;  2OCC H;  4XLF A;  5DEQ A;  2LYC A;  3A0B C;  4KJZ A; 
#chains in the Genus database with same CATH homology
 3B6C A;  4D5C A;  4C3J J;  1A5J A;  1W0T A;  4XK4 A;  4J19 A;  3W6V A;  2Y2Z A;  1ETX A;  2VKV A;  2P81 A;  2ME6 A;  1B8I A;  2FD5 A;  1APL C;  1HCR A;  2K9Q A;  2L0K A;  4A3L J;  4XRS G;  4XRS A;  1HDD C;  3BQY A;  1RKT A;  1MNM C;  3TED A;  2DMP A;  3JRF A;  3JRH A;  3O8H A;  2OF7 A;  2JMW A;  1I6H J;  2VKE A;  3RZD J;  3PM1 A;  4X1E A;  1XG1 A;  3LSR A;  1WCM J;  2DMN A;  5F27 A;  4A93 J;  3B6A A;  3BR5 A;  2HYJ A;  4D5F A;  2DA6 A;  3I4M J;  3NAR A;  3CQZ J;  5GPA A;  4IHW A;  3BTJ A;  2G0E A;  1FIP A;  3JRD A;  3GTP J;  4B1R A;  1AKH B;  5M3M J;  4IHY A;  3H0G J;  5FLV A;  5IYB J;  1U9O A;  1WH5 A;  3G1L A;  2R0Q C;  3BG3 A;  4M3G A;  3FIS A;  1ZTR A;  1QVT A;  1HF0 A;  4A3I J;  2JA5 J;  3JRE A;  2IEK A;  1TWG J;  3ZQC A;  5J1Y A;  1R9T J;  1Z77 A;  5FKL A;  1GV2 A;  1TWA J;  2JJ7 A;  1UMQ A;  4BBS J;  3S1Q J;  2D5V A;  2NVT J;  4MO7 A;  2DA5 A;  1OCT C;  4M3B A;  1U9N A;  2OPT A;  3G1M A;  3RZO J;  1WPK A;  1ITY A;  5J1R A;  3OOU A;  4MFE A;  5JLX A;  5BNG A;  4XRM A;  1HDP A;  2JN6 A;  2IBD A;  2YUS A;  2DA1 A;  3NAU A;  2E2J J;  3RKQ A;  2COB A;  1AKH A;  4B3A A;  1JUM A;  1I50 J;  1CQT A;  1K61 A;  2LFB A;  3BQZ A;  1SFO J;  2HOS A;  4I76 A;  3OSF A;  5FKN A;  4A3G J;  2O8K A;  4RDU A;  3HDD A;  4JYK A;  5K7H A;  5FJ8 J;  3JRG A;  3E7L A;  3Q0V A;  1FTZ A;  2LP0 A;  4FCY A;  1ZR4 A;  2WV1 A;  4DYC A;  3G1O A;  3HB9 A;  2JA6 J;  4BBR J;  1ZK8 A;  1IDY A;  2FQ4 A;  5K7Z A;  1IUF A;  2DMQ A;  2JK3 A;  4BXX J;  4Y52 J;  1ETY A;  2NVQ J;  3HGY A;  5C3E J;  1T33 A;  2DJN A;  4D7N A;  1X2M A;  4DZP A;  2LY9 A;  5JLW A;  4JX6 A;  4A3K J;  4B4C A;  1TWC J;  1IDZ A;  2FX0 A;  2EZK A;  1MBJ A;  2EH3 A;  4GFB A;  4EEF G;  1TC3 C;  1MBH A;  5E3O A;  2WAQ N;  1NK2 P;  2L7F P;  2VUM J;  3PO2 J;  2CRG A;  2KDZ A;  4CYC B;  1H88 C;  5EYR A;  4MLO A;  1NK3 P;  1RES A;  2Y9Y A;  2AHQ A;  2EQR A;  2ME0 A;  2ECB A;  1GVD A;  1H8A C;  2FJ1 A;  2Y0S N;  1ZKG A;  5EG0 B;  4M6V A;  2DA2 A;  1JGG A;  2LTP A;  3TP0 A;  2R92 J;  1K83 J;  3HOV J;  1YRN B;  3LSP A;  1AHD P;  3A01 B;  2QF7 A;  3BR2 A;  1DU0 A;  1QPI A;  3FK7 A;  3ZQF A;  4G12 A;  5IOY A;  2L9R A;  5IYD J;  2EZL A;  3LSJ A;  1XS9 A;  2LVS A;  4DZJ A;  4IEJ A;  4CYC A;  5DTD A;  1ETV A;  1Z0X A;  2HOA A;  1U8B A;  2XGD A;  2ZB9 A;  4V2F A;  1S7E A;  2XSD C;  1DU6 A;  5C4J J;  1WI3 A;  1GT0 C;  4BY1 J;  5EDN A;  3S16 J;  3M4O J;  4A3E J;  4V2G A;  1X2N A;  2VPR A;  3QPL A;  3Q0W A;  1YRN A;  4UUT A;  2K40 A;  2Y30 A;  1ORK A;  3LOC A;  3S1R J;  2DMU A;  5GP9 A;  1BW6 A;  1JT6 A;  2ELK A;  2AO9 A;  2N8G A;  2E19 A;  3DEW A;  2H1K A;  5J1U A;  2LR8 A;  3TW7 A;  1Y1W J;  5EZH A;  3S1N J;  4A3B J;  3HOW J;  4DYR A;  2ID3 A;  2VI6 A;  2W48 A;  2M34 A;  4AUX A;  2XGE A;  1AU7 A;  1SAN A;  2Y9Z A;  4DW6 A;  2DTZ A;  3RQI A;  5HOD A;  2KT0 A;  2K9N A;  1JKR C;  3A03 A;  1FIA A;  3DCF A;  2X48 A;  4FE4 A;  1VFC A;  1WH7 A;  1E3O C;  3ZQL A;  2R7Z J;  3CDL A;  2HDD A;  3BR6 A;  3MKL A;  5M5Y J;  2EZH A;  3TP3 A;  4UUS B;  3S1M J;  5IP6 A;  1A6I A;  5M5W J;  1ETK A;  4LOC A;  3GTM J;  3QQA A;  1JUP A;  2EBI A;  2Y31 A;  3MVP A;  2CJJ A;  2GM4 A;  3GTG J;  2L7Z A;  4A3J J;  2M0C A;  2MG4 A;  4ABZ A;  4C3H J;  3OIO A;  3GTJ J;  1G2H A;  4RBO A;  4A3C J;  2YU9 J;  5IPA A;  1D5Y A;  2O9L A;  4M3E A;  3Q0U A;  3I4N J;  1HOM A;  1P7I A;  3VPR A;  4JX4 A;  1T56 A;  2L7M P;  2CUF A;  3MN2 A;  5F08 A;  3FKI J;  1GUU A;  1UHS A;  3HKZ N;  3GTK J;  1JKQ C;  2R5Z B;  1Y1V J;  4UUS A;  1B72 B;  3LSG A;  2HOT A;  2XPU A;  1EF4 A;  2CQQ A;  5IYC J;  1GDT A;  5F0C A;  5F04 A;  2GLO A;  5E3M A;  3Q3S A;  1MH3 A;  2JWT A;  3BR0 A;  4NDL A;  2DMT A;  1IG7 A;  5FKK A;  1JJ6 C;  2MGQ A;  1QRY A;  1MBG A;  2LLK A;  4IHV A;  1FEX A;  3ZQG A;  1MBE A;  2JA7 J;  5C4X J;  2LD5 A;  1BW5 A;  1JT0 A;  5IP7 J;  3BG9 A;  3JR9 A;  2MW8 A;  1ZGW A;  3WHB A;  1ZR2 A;  4A3F J;  1BJZ A;  2R5Z A;  1IV6 A;  2H8R A;  1NTC A;  3GBG A;  1B72 A;  5IP9 J;  1LFB A;  2DA7 A;  3A02 A;  3HOU J;  4FTH A;  3M3Y J;  4M3F A;  3WHC A;  2CUE A;  5C44 J;  1O4X A;  2NVX J;  1IJW C;  5M5X J;  2XB0 X;  3SJM A;  1F43 A;  1JUS A;  2CQX A;  2XRL A;  1JTX A;  5FKM A;  1MBK A;  2X9D A;  1FTT A;  2PMZ N;  2LK2 A;  1LFU P;  1UG2 A;  5FLM J;  1ZQ3 P;  1FJL A;  3ZOB A;  3S15 J;  1PUF B;  3FIW A;  4MIM A;  3D1N I;  5EZG A;  1MSF C;  2MSY A;  5DS9 A;  2IAI A;  4AYB N;  5EG0 A;  3BG5 A;  2HXI A;  5E3N A;  1JJ8 C;  2QCO A;  4IHX A;  3A01 A;  1HLV A;  4D7M A;  2DA3 A;  5F0F A;  1GV5 A;  5EF6 A;  4XIC A;  2HQ5 A;  1JKO C;  2TRT A;  4AC0 A;  1XC5 A;  1ETO A;  3BTI A;  3JRI A;  2CU7 A;  1MBF A;  4DYQ A;  1OCP A;  3HOY J;  1BA5 A;  4MFD A;  2E2H J;  2NS7 A;  3K2A A;  3JRB A;  1LE8 B;  2XB5 A;  9ANT A;  1TWH J;  2WB1 N;  2NVY J;  4BKX A;  1JKP C;  1F36 A;  5F0H A;  1PUF A;  3GTO J;  1RR7 A;  2GBY A;  1RPW A;  4JX5 A;  3HOX J;  3BR3 A;  3JRC A;  3ZQI A;  4W97 A;  3SDG A;  2M8G X;  2ID6 A;  1P7J A;  4QIW N;  3FK6 A;  3IV5 A;  1ENH A;  5FKO A;  3HM5 A;  2R5Y B;  3GTQ J;  1BL0 A;  2ECC A;  3H3V K;  1MH4 A;  1QVU A;  3HEF A;  1RET A;  4L5E A;  3PO3 J;  3O8G A;  2XPW A;  2R93 J;  1X58 A;  1OJL A;  3QPS A;  2LKX A;  2K9S A;  3BTC A;  1LE8 A;  3BR1 A;  5F1J A;  3S2H J;  3HBL A;  1VI0 A;  4W1U A;  5EGO B;  3L1P A;  2JA8 J;  4HNV A;  2M2E A;  3HOZ J;  2I10 A;  4QTR A;  2HXO A;  4FIS A;  4C3I J;  2RAE A;  4QSH A;  3JRA A;  1JTY A;  3S14 J;  1Q1V A;  3OSG A;  2X6O A;  1ETW A;  1RKW A;  2XPV A;  4M3D A;  4A3D J;  3GTL J;  4XID A;  2E2I J;  2B63 J;  2NS8 A;  4JP0 A;  2R5Y A;  2DN0 A;  3BTL A;  1I3Q J;  2DA4 A;  4BY7 J;  5E3L A;  1H89 C;  2E1O A;  1VND A;  4C2M J;  1WGX A;  5K7F A;  1ETQ A;  3HGG A;  1VF9 A;  3TW6 A;  4FE7 A;  3S17 J;  5EEA A;  2EZI A;  3IH4 A;  4A3M J;  1IC8 A;  1IRZ A;  5EGO A;  3BT9 A;  1MSE C;  2XGC A;  1B8I B;  3IH2 A;  1OFC X;  4Y7N J;  3CMY A;  3F0C A;  3K7A J;  5GPC A;  1U78 A;  2O7O A;  2M9H A;  3CCY A;  4A69 C;  1TWF J;  5M3F J;  1POG A;  3IH3 A;  3S2D J;  4S0H B;  2NOG A;  3ZQH A;  2HI3 A;  2YS9 A;  5IOZ A;  1W0U A;  5J3L A;  3UKG A;  3C2B A;  3SFI A;  4X6A J;  1IGN A;  2TCT A;  3LNQ A;  4I6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...