3X2QH

X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 24
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3x2qH00
2EIKH 3WG7H 2EINH 3AG2H 1V55H 2EIMH 2DYRH 2EIJH 3AG1H 2ZXWH 3AG3H 5B1BH 5B1AH 1OCCH 1OCZH 2DYSH 3ABMH 1OCOH 2Y69H 1OCRH 3ABKH 3ASOH 3ABLH 3AG4H 5B3SH 2EILH 3X2QH 2OCCH 1V54H 3ASNH 5IY5H
chains in the Genus database with same CATH superfamily
3QRFF 4OWRB 1PUFA 4IOAF 4A69C 3A01A 1Z21A 3LA3A 3ZOBA 4XLEA 3WG9A 1C0WA 2F5EA 4EJUA 2MH2A 3GX4X 4FX4A 1H8AC 4MGRA 1K6YA 4LMYA 3FXJA 1SFKA 3SXYA 4IRIA 1XTAA 1U0JA 1OFCX 4KUMA 1W7PB 4HEA2 5FO5A 3BTJA 4L9JA 3MVPA 2EZKA 4XRSG 1T0FA 1Y1VJ 2V79A 1ETQA 3QYFA 1RI7A 2FX0A 2XDVA 1KU2A 3FF5A 2AO9A 2MBFA 3MN2A 2L0KA 4BXFA 3V4GA 1VQ8I 1FTTA 2PN6A 2R7UA 1OMIA 1OCPA 1D0ZA 1GT0C 5IOZA 1ACIA 1LVKA 2ZMEA 1CF7B 2RVCA 3F3XA 1O57A 3FXOA 3GUDA 4YIRX 4B43A 3L00A 3FKIJ 2X6WA 3OYIA 3SYTA 2DFHA 4TV7A 3AL0B 1XGMA 1XS9A 1ZG1A 4G7OF 1J0RA 4E7KA 1RR7A 1BW5A 3D5LA 2QF7A 5B3SH 4J19A 3E3VA 2L9RA 1TWFJ 1I1SA 2ZSIB 2K27A 5F1RA 3JRGA 5BPIA 2F48A 4XN3A 5FFXA 2QBYB 3EETA 2ZNYA 5E18F 3OYBA 3LFUA 1YS6A 3H0DA 4HPQA 3OYJA 5IYCJ 3S1QJ 1U9NA 5K7ZA 3CO7C 1HC8A 3E97A 2XB0X 3ZQFA 2OJED 1VQ6I 1ZREA 2VE9A 3M9AA 3V8KA 2DFEA 1SVLA 2X48A 1XMAA 5JVTA 5KK1A 4RGXA 5BOXA 4G9YA 5KAIC 4UV8A 4Y52J 3L09A 2KL4A 1FBQA 4HW0A 4I01A 4FE7A 2HXOA 4XSXF 2VONA 3ZMDA 5FRMA 5M3MJ 2DODA 2LD5A 4LIUA 1YE9A 3PO2J 2ID6A 3BC8A 4GGGA 2LBFB 2E34A 2UWMA 2HOTA 3P7NA 1U5TA 5EZGA 4BEHB 3C7JA 2EBIA 1POGA 1WWXA 2EFWA 3HOTA 1P9QC 2DMUA 2BHZA 2NAZA 5D8LB 2F4MB 3WTTC 1MSEC 1PUEE 2ZO4A 3BTLA 5E1ZB 4S0HB 4AD9A 2HFHA 5IYBJ 5LHIA 2QZ8A 3GMEA 3KP3A 4ENJA 1Z1DA 5ERIA 2O3FA 3F21A 3IL2A 4DYCA 3BR1A 3IV5A 3ZQ7A 1T2KA 3WTXC 3G73A 2RAEA 2DYSH 5DD8A 3I59B 3PJRA 5JFRA 2H6BA 1D1BA 4NNJA 5EGOB 3WTUC 2MSYA 1K4SA 2K3PA 5HDGA 3DBRB 1ZELA 2XB5A 3BP8A 4UXNA 3BT9A 4U88A 4L5EA 2BE5F 4RAFA 1IZ1A 4M74A 3T1BA 5CQEA 2CFOA 3BLYA 5H20A 2CQ7A 5FFZA 4B8XA 1K83J 3N05A 1TC3C 5E1XA 1N78A 4CCNA 4M9SA 3GVAA 3QU6A 1MKMA 4HF0A 4HX8A 2YS9A 1WJBA 1WH7A 3KLNA 1HW5A 2ICWG 3OIQA 3QYEA 2O03A 4N4OB 2LH9A 1D1AA 3WHBA 2PX9A 4D5CA 1WH5A 4Y7NJ 4ZZDA 4KIFA 1K7AA 1BM9A 2BV6A 3CESA 4A3GJ 3LSGA 3FBIB 4PGGA 5L3FA 1VQLI 4KT6A 1VQKI 1PUFB 2OAZA 1UJ8A 1N75A 3DTIA 1YITI 1FSHA 2L7MP 2CW0F 2M0CA 1TT5B 1B6AA 5J1YA 2L7ZA 5LEKA 3B6AA 1R4NB 3G2BA 2UZKA 3W2WA 1G8XA 2FSWA 4XR6A 1WJAA 5ED4A 3NRVA 4XRFA 3GTQJ 3GTJJ 4X0GA 3ZQLA 5FD5A 3HOZJ 5GTHC 3C1DA 2H6CA 5HVQC 3H35A 1P4WA 5FKOA 1MBEA 2X85A 1BI1A 1Z67A 2R7OA 3NQOA 5EG0B 3CO6C 3TBIA 5TJJA 1S7OA 2LG4A 4A6DA 2MD5A 4ZJZA 1ULYA 3HHHA 3PQKA 4XLPF 2Z16A 3F6VA 3ZQQA 4KDPA 3BQZA 3GEZA 2VC0A 2OUMA 1OPCA 4EM1A 2DA3A 5H6QA 3WU1B 2UXXA 4PSXA 2CV1A 2WV1A 2EPFA 3L9FA 3VYSB 1GLNA 5CLSA 2OF7A 3LWFA 2XPUA 3FXRA 4W1UA 3MKYB 1XB4A 4DJAA 3OS0A 2X1CA 3I71A 4L18B 2ZCWA 5HODA 4U0VA 1T6SA 1ETWA 3QU3A 3VB2A 2HZDA 5IY5H 2M87A 3K10A 3TDUC 1B72B 4XLCA 2JJ7A 1FIAA 4CH7A 1WSUA 4IQ4A 3GBGA 3WE2A 1YJ9I 1GV5A 3CMAI 2H8RA 2ADUA 2GLOA 1X4OA 1EF4A 1SC7A 3HYIA 2O5RA 2VKEA 3IAS2 4XOTA 1AOYA 2ID3A 1S8NA 5KAFC 3AKZA 2CFXA 3K2ZA 3PSIA 2AQFA 3KCCA 3ZMUA 5IT9Z 2OQGA 1TWHJ 1PJRA 3JRDA 3CJTB 4EGYA 2W48A 3ZMTA 3IH2A 1QZEA 1A6QA 1TLHB 4HNVA 2L9VA 3HGYA 3OYNA 2XAHA 1VQMI 4HNTA 5F08A 5F1JA 2LY9A 4IRHA 2M1BA 1PP7U 1U5TB 2P7CB 3GO5A 1E2XA 4IJAA 4XBFA 2HXIA 1IG7A 1IN6A 3GTPJ 2JK3A 1R36A 4D7NA 1KU3A 2K02A 3OOUA 3ZQIA 5K5RA 4JQFA 4CYCA 2VL8A 2CJJA 3JCUC 3QYBA 1U6GA 2VIXA 4C30A 1NH3A 1VQNI 2EB7A 2KIUA 1M1EB 2LKPA 3F8NA 4FETA 3CDHA 5AIPA 3HRMA 1TNSA 1VF9A 4G6TB 3M8EA 4JX5A 4A3MJ 3RZOJ 5ILVA 2F5CA 4M9XA 4G6QA 4IF4A 2CV0A 2D1HA 2L5QA 2HDCA 2DFFA 1OYYA 2O8XA 2RNJA 1BIAA 1Z0XA 5M5XJ 1JTXA 3HUGA 3IAM2 2DA7A 3DTEA 4B48A 2DA5A 4I98B 4L9TA 1IV8A 4BXXJ 4ZDOA 5K1YA 4ESFA 2BVLA 4X1EA 4QIWN 5LGNA 3QWLA 1JUMA 2OA4A 1UB9A 1YRNA 4L9NA 2JSCA 1IXCA 2LF7A 5DCMA 4Q4ZF 2CUFA 1KU7A 1Z6RA 4RM2A 1IJWC 2KT0A 2HYGD 2IPQX 3I53A 4JK1X 3HM5A 1LPQA 4KA4A 2IEKA 4WXCA 4AUXA 2CH0A 2E5NA 4XQFA 2JSPA 3RI4A 1V54H 2QQ8A 2EJRA 3H1CA 4IL6C 5GPAA 5GPCA 1REPC 4LK1F 3I4NJ 3NARA 2DYRH 3FMQA 5EEAA 1IUYA 1A5JA 4YFXF 2VJJA 4FASD 3ZP5A 2L9SA 1E3PA 3BJAA 3PNVA 2W82A 4LGWA 2MGQA 3L2RA 1OCOH 3BR5A 3JR9A 2DO7A 4NUBA 2BW3B 3CQZJ 4ZYAA 3S8PA 2OTLI 4A2UA 4BKXA 3I4PA 1TQMA 1OR7A 3RPQA 3BCBA 2QA4I 2HVQA 3BTIA 2AHQA 3A4CA 3ZMVA 2WV0A 4AIJA 4BJTA 1ZYRF 1D5YA 4MLOA 2MD0A 4B47A 4CYDA 2GZWA 1QZZA 2E19A 2H1KA 4PGHA 2P5LC 3TMOA 3M8FA 1MNDA 5ICEA 1RETA 4YIIA 3LSIA 5C4JJ 2VJ5A 2QLZA 4MEXF 2CU7A 1Z7UA 2DTZA 4PJJA 1TT0A 4MQVA 4Y15A 2IGNA 4BUPA 1V5GA 1NK3P 1SVOA 4NB5A 1R9TJ 3KIOA 3RTRA 1XSDA 3IH3A 4PUSA 2QYOA 4MFDA 1P6RA 1I27A 1YIOA 3REOA 5GTIC 4O3MA 1ON2A 3VWBA 2K4BA 1R5ID 3B02A 4A0XA 4YFKF 2HU9A 1VQ5I 4AYBA 2QGUA 5HDKA 1EKEA 4JOMA 1MJ9A 2LY1A 2ZFUA 2XSJC 4E7HA 2EV6A 2W4SA 1WFXA 3S2WA 3FM5A 3GTMJ 2V26A 2BEOA 4R1HA 4LB5A 4OOIA 3HTUA 1B59A 2X6YA 1S29A 1VQOI 1O3TA 3ELKA 3G4SI 2G0EA 3CCJI 3OYDA 4B4CA 2DAOA 2XUBA 3D5SC 3VSLA 2IGMA 4CCJA 2HOAA 1FOXA 1BJAA 1R5GA 4GXOA 5IP9J 1RIOH 2M7BA 3RPUA 2KZGA 4GFBA 1TZLA 5DDGA 3KYCB 2M4GA 2NXNB 2Z5UA 4Y13A 2KISA 1XN7A 3O3KA 1VI0A 4HDUA 2M0MA 1WI9A 2M2EA 1R71A 1IRFA 1I5ZA 1HLVA 4OAYA 5H6RA 4LG3A 1Y0NA 3AG3H 3CUQB 3J81Z 1JKOC 1Z05A 2O6GE 2Y0SA 1CF7A 2X6XA 4LB6B 1T39A 4XOPA 1J75A 1MBHA 4JYKA 4QPQA 1TTYA 2K9MA 2IA0A 2ZB9A 2FOWA 2O61A 3HKZA 2UV1A 2CV2A 4F55A 5IP6A 1X3UA 3JSOA 2W24A 3ZMZA 2LFBA 3KEQA 5DCMB 3OYKA 1V4RA 1UG0A 2LP0A 3QP6A 5J1UA 3RQ4A 3P5JA 4A3JJ 2QBYA 3L2CA 2V1NA 1QO0D 1R22A 1Z7LA 4AU7A 2RC4A 2NVQJ 3A02A 2XAQA 4J00A 2XAGA 3R6SA 2ISZA 2CQQA 1G4DA 3I3LA 4IO9F 4LLNA 2NS0A 3H5NA 4DYRA 2F2EA 2GIVA 5BQTA 2E1OA 2VI6A 1AHDP 1I6XA 1AKHA 4HZFA 4HDVA 2JA2A 2H8WA 2XF6A 5LEJA 2FMLA 4E7IA 1HF0A 2ACJA 1T38A 4A3DJ 3WG7H 4ASNA 4U7DA 4IQJA 2IS1A 3IC7A 1VZ0A 3CC4I 5FKNA 1HBXG 1FBUA 2ME0A 3GFMA 5CVVA 3RYPA 1QA6A 4EM0B 4HF1A 3UKGA 2HQNA 3ZN0A 3L2WA 3U9GA 3N97A 2DLLA 2WAQA 5DCFA 2K4JA 1SEUA 1CGPA 2BXZA 4P5OA 1ZG5A 2E35A 5FLVA 4ZDPA 1SAUA 1RESA 3S17J 5CPRB 4BQNA 1KONA 1W0UA 3BROA 2H27A 3GLLA 2GXBA 4DBQA 3K6GA 1QHGA 2L54A 4UUSB 1GVJA 1QGPA 5J8FA 3OWTA 1RR8C 1FYLA 3H9GA 3MZHA 4V19K 2EV5A 3FX3A 1DP3A 2LKXA 1Z3YA 3RYRA 3VEPA 3HG9A 3KPHA 3WTWC 4GRIA 2B63J 3ABMH 5ILUA 4UY8I 5HDNA 5IOYA 4BU2A 2ESHA 2VBYA 3I59A 3I5UA 4AIDA 1UAAA 3BCAA 4FT8A 1JI8A 2VXZA 5EGOA 3TP3A 4JX6A 3VOEA 1JJ8C 2IVMA 2FJ1A 3MD2A 5HS9A 2QEXI 4HX4A 2KKOA 1CQTA 1G6NA 1QU3A 3U2RA 3NAUA 3OYLA 3H5AA 1NTCA 4XSZF 2WB1A 3DEEA 2HYFA 4YIFA 4IVNA 3RSNA 3CDLA 4ANJA 1O3RA 2FD5A 1ON1A 4M9ZA 1MBKA 5F64A 2A07F 2K5CA 3BWGA 3S2HJ 5FLXK 1T56A 2FQ4A 3I58A 2NS8A 4Y4RA 3WE3A 3CC2I 3FIWA 1MMNA 1XSXA 3ZQGA 2A6TA 1I39A 4WX9A 3MKWB 4WXHA 5GAHJ 1P4AA 2YPRA 3KP2A 3WU2C 3PIOF 2M34A 1IN8A 4XKBA 4YRVA 3COAC 1GDTA 3HZJA 2L7KA 3OR1C 3ZPLA 1X2NA 1XGNA 3CDIA 3F6OA 2XPVA 1G3TA 1XCVA 3K69A 2DOEA 2CSOA 3NWTA 1LUJB 4NC7A 4II2A 1D3YA 3OYMA 4BNCA 4P1WA 1SMYF 5ICFA 3S3NA 1A04A 4CXFA 1QPIA 4HG2A 2FF4A 3D1NI 1TP4A 1XDSA 2TRTA 2MA3A 1ODDA 2L9NA 4EVIA 5J47A 4DOZA 1W0TA 4D0PA 1XPXA 5EG0A 2IS4A 3DPTA 2Y2ZA 2WWYA 3S93A 4XLNF 3V42A 4L5JA 3KEOA 2OTJI 3B73A 2RQQA 1IC8A 1HW2A 1P2FA 3LAPA 4OMYA 3JRIA 3BPVA 4QPOA 4HOBA 4BS9A 3J7ZI 5FD6A 3CC7I 1F1ZA 3H36A 3VYTB 3DV8A 5FKKA 3KP6A 2HDWA 3PUFA 1WHUA 3T0YA 4CZZA 4UVAA 4F52A 3JW4A 5CVUA 4PDKA 1VTNC 2GXGA 1FZPB 1WGXA 1NK2P 3GW2A 3CCYA 2PJPA 1B72A 2W00A 4PSWA 5AIQA 4HBLA 1MBJA 4A3EJ 2R0QC 1QRYA 3C2HA 3K70C 1XC5A 2LREA 1OCZH 4V2GA 1IRGA 3MMYB 3B6CA 1FOWA 2OV7A 4ETSA 2DOAA 2DT7B 2J5OA 4M71A 3I0TA 2WY7Q 2M3AA 3H9QA 4HLXA 4P9UA 2IS2A 1AKHB 3CJRB 3TO6A 1A6IA 4RLFA 2EZHA 1OYIA 1VFCA 1XX5A 1EA3A 5K7HA 4RM3A 5KNLA 2ISYA 4OAZA 5CVJA 3TGNA 2BGCA 2ELHA 3CJQB 1IN4A 3KFWX 1R1TA 1ONVA 4DNCA 1D0YA 3IKVA 1F9NA 1QVUA 1MMGA 5B1AH 1G3SA 3E5QA 5E3LA 1EV7A 3FKJA 3RIRA 4OIOF 1UMQA 3RKWA 2CW8A 2JUGA 3DBHB 2FU4A 4BACA 5FROA 5J4VA 3HPGA 3F8BA 4AVZA 2GA1A 2Z1DA 3HHGA 3QOEA 1LQ1A 2E1NA 4HV6A 2NVUB 3X2QH 1XMKA 2F5FA 4HQEA 3KP7A 3AAFA 3F8FA 2XC7A 2H1LA 4EGZA 2HQRA 2KZVA 3OYGA 2DMNA 3CUOA 4I0BA 3JREA 2KRFA 4BXUA 4Z2YA 4E7LA 2DI3A 2DA4A 2M7AA 4E6KG 2HR3A 2ZFWA 4BE2A 1BC7C 5LHHA 3DWLE 1LKXA 5CVIA 2GQQA 1WZ2A 4RMNA 4L9VA 3NEUA 1NG6A 4HSTA 2HKOA 3ZN1A 2QENA 3GFLA 3LSRA 5EEGA 3J7AO 2E71A 2CO5A 1HA8A 2KHMA 4Y3OA 1W36D 2M4KA 1MJBA 4M72A 3RKXA 4IKFA 5FRNA 2Q2EB 4G7ZF 3CCVI 4HA8A 2NS7A 3RJPA 4A3FJ 3GTKJ 5E3MA 1E0EA 1IAWA 1TL8A 1Y8RB 4CCKA 1XCBA 1ZGWA 2Y30A 3Q0VA 4U7BA 4DZPA 3J7AY 4ZH4F 1YFHA 2X1DA 3EUKL 3WGHA 2XF5A 1ZLJA 1XGOA 2ZBKA 1BJZA 2DQLA 1WCMJ 3W6VA 2VOPA 1VNDA 3DXJF 2LKSA 4UUTA 4ZTJA 1EJ9A 3D0SA 3IHUA 2YU3A 2P5KA 3GXOA 2OBPA 2IA1A 2PMUA 2CYYA 5D5WB 4OINF 2NOGA 1N77A 5FLXZ 1Y56A 5D4RA 2L02A 4UVBA 3BTCA 2KRCA 2CWEA 2W84A 1P7JA 5D8KB 2VKVA 3H92A 3S1RJ 2WY8Q 3PNTA 4A3IJ 2O0YA 5LGUA 5FB2A 4RA2A 2RNGA 3ABKH 4L0ZB 1DPUA 5M5WJ 4UB6C 3ZXSA 3S32A 2JQ7A 4G12A 3EDPA 2BW3A 4HF2A 1TW3A 3VYUB 2O9LA 4AYBN 3CLOA 2R7DA 3FXUA 1DP7P 4E7SA 1EH7A 4AM3A 3G1LA 1GUUA 2PQ8A 3PO3J 4QWQA 4BDZA 2CUEA 5FLMJ 5IT3A 4BH9A 3W3CA 3FXMA 3P9KA 5ICGA 2JA7J 4HNUA 1XD7A 3FK7A 1HXDA 2DMQA 3EQLF 3ZCOA 3A0BC 3K1PA 2DK8A 1S5LC 1UHMA 3BG9A 1IGNA 3I55I 1ZTRA 2BY1A 1U78A 4AVPA 1X1DA 4CZCA 3DKWA 2MG4A 3NWSA 3JRFA 2QCOA 2PMZA 1F36A 4B44A 2RV8A 3MKLA 2ZMEC 1FYKA 3OYAA 1J5YA 1T08B 3FISA 1LDDA 2F5DA 2EFNA 5JVGF 3LMMA 3K9TA 1HSJA 5BNGA 1HQCA 2YUSA 3ASOH 1O7LA 4M6XA 1STZA 2ELKA 2DA6A 4EJWA 3HGGA 3EUHA 4BQOA 4DBRA 2V4JC 1RPWA 2Y0SN 2LDUA 5F27A 3IUOA 4M3FA 3KP5A 4IPAA 2V9PA 4LG0A 1TWGJ 1GV2A 4I7HA 1W4MA 2V1DA 1O3QA 2EIJH 2RREA 1FIPA 5LRRA 1LDKB 2KJCA 3WGIA 1OCCH 3OL3A 4RB3C 1G59A 2OZ6A 1R1UA 1JTYA 3LA7A 4JX4A 1H9TA 3TW6A 3GTLJ 1KYZA 1RUNA 4ITVA 1U3EM 1YJNI 3HKZN 1O3SA 3DLAA 3V7CA 1B9MA 5J4YA 1KU9A 1T33A 2K9LA 2XAUA 1GXQA 4A3LJ 5BMZA 2IGOA 2N8GA 2XGCA 5CJ9A 4FCYA 2DPDA 3FXKA 3CCMI 3EUAA 4CCMA 2FNPA 5TRDA 4A5NA 2P6TA 1DU0A 4D5FA 1ZLKA 1IN5A 1ZG3A 3R0AA 1ETVA 1ZN2A 4RGSA 3V8LA 3N4MA 3VPRA 3BY6A 3FZVA 5L3GA 2CRGA 3U1DA 2DMTA 3OY9A 4EEFG 2R4GA 5B1BH 5HS7A 2LOOA 4M3GA 1Q1HA 3FXQA 3BJOA 2B7EA 3LSTA 4ZYEA 4XRSA 2E1CA 2IRFG 2KQRA 1U5TC 3CUQA 3H3ZA 3C2GA 4I76A 2VOOA 3E6MA 4MNUA 3A03A 1Y39A 1R23A 1GVDA 4C3IJ 4CCLA 2IA2A 3OSFA 4CDGA 3ZR8X 1XSVA 2EH3A 1SD7A 2ZXJA 3HOUJ 4G6DA 1KQ9A 3IP4B 2P5VA 4ZYGA 3OL4A 2EINH 3BR0A 1YX3A 3CTAA 2WAQN 2Y31A 3SJMA 3WHCA 1VQPI 1SFUA 3FBNB 2R5ZB 3SHFA 5LFAA 2FQ3A 3GFJA 1BL0A 2C6YA 1BN5A 1MJAA 4ESJA 1X1AA 4LFUA 5LRSA 3A1YA 2I10A 2EK5A 3EYIA 5CKTA 3ECOA 4FQGA 3VODA 3LSKA 4NDLA 3C2BA 5J3LA 1J09A 3W2AA 2LVSA 5CYVA 1F43A 2IGKA 5DEQA 2OQRA 3KETA 2HWVA 5E3OA 3K4NA 4F91B 2FBHA 2LMDA 4DGWB 2NVTJ 2NOJB 4KITB 2FEZA 2ZSHB 3C18A 3DEWA 2MC3A 4KMFA 2W1OA 4FHTA 1I50J 4IOCF 2MABA 2VQGA 2L7FP 3IWFA 3RKQA 3K4BA 1NG7A 1IDZA 2DFIA 1Y1WJ 4IHWA 2V9KA 1ZK8A 2XAJA 3ULQB 3TW7A 2EA4A 1JHFA 1FMWA 1YW9A 2WB1N 5D4SA 3LQQA 5F6FA 4A12A 4EMSA 3FHZA 2NNYA 2E2IJ 1W1WE 1WJFA 4CO8A 3HOVJ 3CCEI 4MHGA 2HI3A 4UUSA 2BHYA 2JVGA 4C2MJ 2EFQA 4BHPA 3PFYA 3KZIC 2IBDA 5HS8A 3JAMK 3E1SA 4ENMA 1LB2A 2E7XA 2Y69H 3DU5A 4XK4A 2J5PA 4DQ2A 4EJVA 1MDMB 2JMWA 3RDIA 4XN0A 2K40A 5D6EA 1B8IB 2DTRA 2KLOA 3T8RA 4UV9A 4OIRF 1K4TA 3E6CC 2EWNA 1WKMA 3H3UA 1LDJA 3L2UA 3OOPA 3ZQHA 3E5UA 2KRHA 2HTSA 1UG2A 3TDZC 5D5XB 2KP6A 1USTA 3PUBA 3ESWB 3K70D 1R1VA 1SD5A 3IKTA 4YFNF 3G6EI 1I6HJ 2V6EA 2PJRB 2JVHA 2LSOA 1RKTA 5B5EC 1L3LA 1EH8A 3BQYA 4R8HA 1K6OA 1ZRDA 1K79A 1G3WA 2LR8A 4DIQA 1RUOA 2EQRA 1K61A 3SDGA 2A05A 2VJ4A 2OPTA 3P9CA 3RKYA 4LG0B 2M8EA 3CD6I 3RZDJ 2PEXA 2R7RA 4GYGA 3PQJA 1L0OC 1USSA 3I54A 3M8JA 5EF6A 2HYJA 2JA6J 2DXIA 4X6AJ 1Z77A 3ABUA 2DA2A 1E3OC 3R61A 1KGSA 3UR3C 2W7NA 4EJTA 4XICA 4ZC3A 2STWA 4ZTFA 2V1XA 5CVRA 1XDUA 2A3SA 2MW8A 2LLKA 5M5YJ 5E8GA 3L2VA 4M3DA 4U0WA 4NQWA 3L1PA 2D5VA 2CUJA 3BZ6A 3WTYC 3M1EA 2Y9YA 1WVRA 2L4AA 2LF8A 4RAZA 2OCEA 2BY3A 5FGMA 2WA0A 1W5SA 1QPMA 3CJNA 3DBLB 2LC2A 4U87A 3QQAA 1V5EA 2ECBA 3HJEA 3W2VA 2XIGA 5JLWA 5DTDA 3CCRI 3K4CA 1ITYA 1HDPA 4DYQA 3QPLA 1IV6A 5DUKA 2YX4A 1D5VA 1LFBA 4F3QA 3OSGA 3K4KA 2A68F 1UZCA 5J8CA 2KJBA 4XNFA 2XF7A 2DOFA 1YHQI 2TDXA 2WAFA 4A0ZA 4D7MA 1RC9A 3E6BA 1FEXA 2VE8A 5J40A 2Y0MA 4QLCU 2CQXA 3HOSA 5E17F 4WWCA 2LRDA 3LSJA 2L3DA 2EZLA 2STTA 2I5UA 1ENHA 3FM3A 5FKMA 4BAYA 3EYYA 3HRSA 3JRBA 2QVOA 1JHHA 1FMVA 1OYWA 3F0CA 1RRJA 2COMA 4LLGF 2EFPA 1MMDA 1DGWY 2ECCA 2G7UA 5EJCA 2CQNA 5GAEJ 2VUMJ 1JT6A 4I0AA 1BR4A 3DTKA 1E3HA 3PFIA 4M3EA 5DV5A 5FJ8J 4AIHA 4S05A 2FUG2 4HV5A 3MWMA 2UXNA 2XASA 3F9KA 1KQ0A 1X1PA 3JRAA 3G3ZA 3GZ5A 3M1CA 5AONA 1GHCA 1S7AA 4A0YA 4F92B 2E36A 3FWEA 1MIJA 5JI6A 4Q5SF 2YR2A 5GP9A 2R3SA 4XIDA 1MMAA 2HKXA 4UHTA 1SFXA 1YQAA 4LK0F 3VYRB 4ABZA 2A5WA 1WRJA 2ZNZA 3F8CA 4PJMA 2KIFA 2VC1A 4QTRA 2R7WA 2QSHX 4FX0A 3LFKA 1FOKA 1JKRC 1BC8C 1MZBA 1ETOA 4S04A 2A6EF 4E7ZA 1HCRA 1PYVA 3TOBA 2CW7A 1WJEA 1QBJA 2IXSA 3R4KA 4CCOA 2GBYA 2ZJ2A 2VKHA 2HOEA 3S1NJ 1OR7C 1IO2A 1HKSA 1MBFA 1AA7A 1FBSA 2L4MA 3DU6A 2X6OA 5LGTA 4G94A 2XHKA 3G1OA 3JAMZ 2FNAA 2M8GX 3G1MA 3HSRA 4AC0A 5DUIA 1X2MA 2BOLA 4MTDA 2ZXWH 1JKPC 1TQIA 3PNYA 2R7ZJ 4E4HA 2Q2EA 3F8MA 1GXPA 1SD6A 4WF2A 4GCVA 2V9VA 2MFZA 3BR2A 1J59A 5L3EA 1HKTA 4EV0A 2Z99A 1VQ9I 4UNOA 2D45A 1FY7A 3E5XA 1X3WB 1WJCA 5LHGA 2KDZA 1D8KA 4YEJA 3Q0UA 2K9SA 5E20A 2BVMA 2E1MC 1BA5A 1ETKA 5KCMA 3K4MA 2KDOA 3QAHA 2AQEA 3TEDA 1OKRA 4RB2C 3WTSC 4RS8A 4PJNA 2A61A 4EATA 1A36A 3AG2H 3DLLF 4RLQA 4Z6YA 2GM4A 3V7SA 1P4XA 2JUCA 4C9YA 4OIPF 4O6JA 3W6JB 1X58A 1X19A 2ETHA 3V8JA 3SZGA 1R4MB 1S7EA 4B3XA 3GTOJ 1Y8QB 4NQWB 4XKCA 3GLXA 3QODA 5GADJ 1H0MA 1LVAA 4KJZA 1ZGJA 3ZMSA 4M6YA 3DPUA 2PMZN 4G7HF 2VPLA 2HQAA 1O7FA 3I9V2 3RQIA 1ZGAA 4IEJA 2D2WA 4EQQA 3SEQA 1ZQ3P 2KMUA 3BZCA 4F7ZA 1F4KA 1FP1D 2A69F 3GF2A 5E8IA 3MZ8A 2V6CA 5KHDA 5LLQA 4CGZA 1MMSA 4HAMA 4IHXA 5D5VB 4I02A 2X9DA 3SZPA 1RZ4A 3I56I 4BGDA 2LNBA 2X51A 5DS9A 1LFPA 3GZNB 2ZXHA 1BOBA 2JWTA 2E7WA 2GA2A 3DKYA 5DYMA 1IRZA 4RB1A 3L7WA 1YO5C 4C3JJ 3ABTA 2VT3A 1VQ4I 1T8IA 1ZAOA 1MD0A 2K9QA 3PL8A 4HSRA 1YX5A 2L01A 1U8BA 2H09A 1MNEA 3I64A 4KN4X 1YYVA 3HBLA 2Z9OA 5E1WA 3GYHX 3TQNA 3E0JB 2X1EA 2BY0A 4XLFA 1BW6A 2GOMA 1FX7A 2MYSA 1K78B 2MLGA 3AL0C 4QSHA 3HRUA 3ERED 1D0XA 5H2FC 5IT9K 2K3FA 1QQIA 4IHSA 4YELA 4OIQF 4EM2A 2Z3YA 4DW6A 2R7VA 5F0FA 1QNTA 3CP8A 1BI2A 2PI0A 1IXSB 1JUPA 2YX7A 3TKYA 4AWXB 5EDNA 4BY1J 3KE2A 1LEBA 3ZGKA 3O8GA 2V7FA 4PFPA 3ECHA 1FOYA 2R7SA 1B4AA 1I1GA 1ETYA 2CQKA 2BZTA 4BY7J 1SVMA 4H4KC 4BQQA 2XROA 2JZYA 2P7VB 4FISA 2LK2A 2QQ9A 2O8KA 3F72A 2JPBA 2FOKA 4XMYA 5DD4A 5BPDA 3FDYA 3SZTA 1IDYA 5L3CA 3GCMA 3OIOA 3JRHA 2XSDC 3GTGJ 2FBIA 2X4HA 1IN7A 3S15J 3K0LA 3E7LA 2HVRA 2EFOA 1KZHA 5LBQA 1UHSA 3GFIA 3KYLA 3TO7A 4XLAA 1ZHFA 2CUZA 4RAYA 1O4XA 4XLHA 4F93B 3OYEA 1SMTA 2I8DA 4UB8C 1OCTC 2E2JJ 2DJNA 2DU9A 3CP2A 3E6DA 3S14J 4JBAA 4XKVA 1BI0A 5DM6F 1JKQC 1TBXA 3SFZA 2VBZA 1ETXA 2QSFX 3HSFA 2BBYA 2R5ZA 2KFDA 4PK4A 4P55A 3K4JA 4IZZA 3OYCA 4RAGA 3M4OJ 4LIVA 3CCLI 2WC2A 4BQAA 3AG4H 3OIPA 4LD5A 1T95A 2BYVE 1TQPA 4KNYA 2R92J 4Y17A 5B66C 5JHFA 3LL7A 4XONA 3C3WA 2XKPA 5D6FA 3TO9A 2VKDA 2AXTC 2RN7A 1ZR2A 1B1BA 1BR2A 2DJIA 4JP0A 2VBXA 2VT2A 4BBRJ 4MO7A 1IRXA 1B9NA 2GOXB 1Z3XA 2DQRA 2XGEA 3QPSA 4LOCA 2XRLA 2RQPA 5L3DA 1AU7A 4MFEA 3WTZA 3K1NA 2VN2A 3HB9A 3QOPA 2HEOA 1QHHD 2GIZA 3BG6A 4LJZF 3SFIA 4BYYA 2PG4A 3CCQI 2AS5F 4GDFA 4IRGA 4NC8A 2Y75A 3A01B 2HPMA 4A3BJ 1PVEA 3CMYA 4L0YB 4LITA 4XL9A 4FE4A 1J9IA 1MGTA 4R79A 4IHYA 2DW4A 3HSEA 3IWZA 1IF1A 2HTJA 3O8HA 4KISA 5E3NA 3KZYA 2DT5A 3BDDA 1ZARA 4WK8F 1JXSA 2CG4A 4ESBA 4ENKA 3G71I 4IHVA 3CMEI 4BE1A 2X0LA 1FC3A 3KYDB 4Q48A 3LAJA 1X1CA 4OU0A 3HRTA 1IW7F 4Y33A 4W97A 2RGVA 2Q0OA 2Q8KA 1BOAA 2BY2A 4A3CJ 3OS2A 4A3KJ 2DK5A 4MQ9F 1UCRA 2CMPA 1DQUA 2DMPA 4ZYHA 4G8XA 3DQVC 1MDMA 1T0FC 3TOAA 3LNQA 3M7GA 2W57A 2ZMEB 1YS7A 5EZHA 3J7YJ 3TL4X 5LD2C 1B8IA 3FMSA 4ZZLA 3BR3A 2B9SA 1DPRA 2LY2A 1U8RA 3OR2C 2ZJQF 4M3BA 3TP0A 3U21A 3JTGA 1RNLA 3WODF 2DA1A 1Z6TA 1YOVB 1U2WA 3LSMA 1H88C 2ESNA 1J7KA 5ICCA 1QZYA 2IW5A 5IP7J 1LJ9A 5CQGA 3CF5F 4P96A 3HPHA 3H5RA 1D8JA 4XRMA 4O5VA 2PJRA 4XM3A 3H0GJ 4BHBA 1WPKA 2ZXIA 3I4MJ 3KEYA 5KVRA 3BPXA 1ZR4A 1APLC 4C2UA 3AFHA 2W25A 4NC6A 1IUFA 3T5XA 4AIKA 2VODA 2G7HA 1W5CC 2ZJPF 4E7JA 2P0WA 1QVTA 4KIGA 1FWZA 1R49A 2JA5J 1OQYA 2COBA 1XMXA 3HXLA 1FPQA 5K7FA 1X1BA 3JRCA 1I3AA 2XKOA 1FYMA 1NHAA 1V5FA 2B0LA 1Y0UA 4J01A 3O2PE 3DFGA 5C3EJ 1YJWI 4IHTA 2HNHA 3QP5A 4RGRA 1JUSA 2XAFA 3K1MA 3BR6A 4L5IA 1R7JA 1UELB 1YIJI 4IXAA 5JR3A 2GWRA 1DGRM 4RBOA 4BE0A 3DF8A 4IX7A 3Q9VA 3SQNA 2V1UA 3CLQA 2D1VA 2EZIA 2JPCA 2R7FA 3J81K 1J2XA 3HIFA 5GAGJ 4FTHA 2GAUA 3CCSI 4HQMA 4UVCA 2FXAA 5A2QK 1Y6IA 2M5WA 3MCZA 2PBIA 2IS6A 3IRRA 5D5UB 3Q0WA 4ZYDA 1OLTA 1Z91A 3SDBA 4BBSJ 1HKQA 1HOMA 3K4LA 2YSRA 4HYEA 5DM7F 3CCUI 2WBMA 1JJ6C 1BI3A 4N4NB 3AG1H 1S3JA 3Q9SA 2OC6A 4C3HJ 3HC7A 2K85A 2JRMA 3BG7A 3FK6A 3BJ6A 3QPTA 2HDDA 1WQ2A 1HSTA 2G9WA 2XRNA 1DUXC 2MLKA 1YLFA 1KQ8A 1H9GA 1DU6A 4I99C 2OCCH 3FXLA 3MQ0A 2PFBA 4V2FA 2NVYJ 2QWWA 4D1QA 2K9NA 4CHUA 1JE8A 4CICA 2R7TA 2A6HF 2XVCA 4N0BA 5HNFA 2PLYA 1YG2A 3WU0A 1MW7A 3UNGC 1SFOJ 4UUVA 1S72I 4GYIA 3F22A 3VDXA 1ZH5A 2TCTA 5IYDJ 1HW1A 1R00A 1FJLA 3OMYA 2IJLA 3R0JA 1R6RA 2IT0A 2Z33A 3GWZA 2VBWA 1BBYA 2HZTA 1LNWA 4PJLA 4RB0A 1DDNA 1FP2A 2WADA 3CF2A 1UFMA 2EV0A 2MH9A 5IPAA 1ORKA 1F5TA 3OYHA 5HLIA 2A5YB 5M3FJ 4PFOA 1Q1VA 5K5QA 4XKWA 3U1KA 5EEHA 2R5YA 1R5HA 1PDNC 3LA2A 2JN6A 3F23A 2FMYA 4B3AA 1RKWA 1MH3A 4GO1A 2QKLB 2DDAA 3RPUD 2P4WA 2MC4A 1S9HA 5BS6A 2F4OB 3WGGA 3DCFA 2VQHA 3HOXJ 3W6KB 1G3YA 3OV8A 1VQ7I 3OYFA 1W7PD 2GXAA 3JTHA 4PJ0C 4BJ5C 5C4XJ 1JGSA 2F6CA 3H3VK 4I2OA 4KIBA 2IAIA 1T98A 3K2AA 4A5MA 4D9JA 4H0EA 1A31A 2FBKA 2IP2A 2NNNA 3QPHA 3S2DJ 1MH4A 2NRAC 1WJ5A 3BZKA 3J80K 2E60A 1UHWA 1LFUP 4I09A 1FTZA 2FE3A 3BOQA 2QM3A 2Y48A 2M45A 2HPIA 1W36C 2LTPA 5F0HA 1LE8A 2H94A 5TISC 1MNMC 4PZJA 4KMUX 5F04A 3ML6A 4ZDLA 3IH4A 2QSGX 2LYCA 1D1CA 2UUZA 2VPRA 4II3A 3V7RA 1FNNA 2VQLA 2VXDA 3ERMA 1R58A 4KICA 3DP7A 1ZRFA 3CZ6A 2VB6A 4XORA 1ZKGA 1KA8A 2KPMA 2Y9ZA 4NHJA 2YU9J 3BG3A 3EUHC 1YI2I 1SANA 1SFEA 1TWCJ 4HX7A 2DT6A 2HGCA 4E70A 3DKXA 5HNHA 2Z2SB 1YTYA 4YG2F 1Z9CA 2DBBA 2WTEA 2L2OA 1HDDC 4M73A 3VFZA 5HLTA 1LEAA 4P9FA 3WTVC 4Q47A 2QQBA 4CYCB 3S1MJ 6PAXA 9ANTA 4N9IA 2OD5A 2BXYA 3HOWJ 3Q3SA 3A0HC 4RDUA 5JLXA 1FT9A 4OMZA 2HVSA 3ABLH 2HQ5A 4K2EA 5E79C 3O6BB 2EILH 2P81A 3ASNH 4KFCA 5F0CA 1W7PA 3KLOA 4CSWA 1JGGA 2XGXA 3SEZA 3ZRGA 4EJOA 2K86A 1G2HA 4MIMA 4BJ6C 3RCOA 3M3YJ 3HEFA 5K5OA 2XV4S 3DPLC 3IRQA 3HUGB 1BR1A 4KYWA 2FRHA 1X4PA 1XGSA 5A2QZ 3GZ6A 2VLAA 1I3QJ 2P6SA 3CUQC 3HL2A 4BL0B 3K7AJ 2XPWA 3JSPA 5HLGA 1U9OA 1SD4A 5ILSA 2NYXA 2M9HA 1E17A 2W85A 5J6XA 2CS3A 1YRNB 2NVXJ 3L2QA 3LSPA 2R7XA 1ERDA 2E2HJ 1K78A 3LSHA 1WI3A 3MFKA 2OZUA 1P92A 5TGTA 3HTSB 4B09A 2KIMA 2ZKZA 4CUGA 5J1RA 4KT5C 2FA5A 1X3ZB 3MEXA 2QUFA 1ZRCA 3OS1A 2JRTA 3HOYJ 3PM1A 3S16J 3A2KA 3MKZA 1YW7A 1P7IA 2RDPA 3FMRA 1BIBA 1TNTA 4WXDA 4ON0A 2CGPA 3ISPA 4LLLA 4BHCA 2WAEA 4MEYF 4NBQA 2R5YB 2VJIA 3BG5A 2ZJRF 2EIKH 4HLYA 4MTEA 1V55H 3M07A 4CA0A 3ONQA 4DZJA 1FLIA 3LQRA 2AXLA 3HDDA 1XG1A 2LBFA 1PP8F 2ZC2A 2ME6A 2Q1ZB 4BEHA 2DPUA 2R7QA 2P8TA 3ZQCA 2HOSA 3P9IA 1A35A 2HS5A 2DN0A 2QQAA 1W5TA 1MBGA 3D5RC 3CMMA 4B1RA 3R60A 2K7LA 4WCGA 1TWAJ 1KYWA 5L3BA 2EIMH 4C2TA 1SAXA 3VSKA 1S6LA 3DEUA 5C44J 1JT0A 2EA2A 1MSFC 4RGUA 2VASA 2ELJA 3ROUA 3FHNA 5HLHA 3KP4A 2QKMB 4ENNA 2KIQA 4KN7X 4HRIA 2E1MB 1OCRH 2O7OA 2PMHA 2XGDA 1N25A 3S3OA 3LOCA 1AWCA 2F4IA 2RKHA 1LE8B 3S3MA 5FKLA 5JHUA 2E5ZA 4A6EA 2JA8J 4U0YA 2DDBA 1WJDA 1YW8A 3KX2A 5EYRA 3J80Z 1H89C 1OISA 1V3FA 2VQCA 2R93J 4A93J 3MZYA 4BDYA 3PIPF 3Q5FA 3H9JA 1IXRC 3MAJA 4PCQA 3PSFA 2F5VA 3EPZA 2OU2A 3KZZA 4N9HA 2JTVA 1FSEA 4I6ZA 1TW2A 4M6VA 1OJLA 5HOOA 2JT1A 2M30A 3T8TA 2DCEA 1EH6A
chains in the Genus database with same CATH topology
2EIKH 3WG7H 2EINH 3AG2H 1V55H 2EIMH 2DYRH 2EIJH 3AG1H 2ZXWH 3AG3H 5B1BH 5B1AH 1OCCH 1OCZH 2DYSH 3ABMH 1OCOH 2Y69H 1OCRH 3ABKH 3ASOH 3ABLH 3AG4H 5B3SH 2EILH 3X2QH 2OCCH 1V54H 3ASNH 5IY5H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIK H;  3WG7 H;  2EIN H;  3AG2 H;  1V55 H;  2EIM H;  2DYR H;  2EIJ H;  3AG1 H;  2ZXW H;  3AG3 H;  5B1B H;  5B1A H;  1OCC H;  1OCZ H;  2DYS H;  3ABM H;  1OCO H;  2Y69 H;  1OCR H;  3ABK H;  3ASO H;  3ABL H;  3AG4 H;  5B3S H;  2EIL H;  3X2Q H;  2OCC H;  1V54 H;  3ASN H;  5IY5 H; 
#chains in the Genus database with same CATH topology
 3QRF F;  4OWR B;  1PUF A;  4IOA F;  4A69 C;  3A01 A;  1Z21 A;  3LA3 A;  3ZOB A;  4XLE A;  3WG9 A;  1C0W A;  2F5E A;  4EJU A;  2MH2 A;  3GX4 X;  4FX4 A;  1H8A C;  4MGR A;  1K6Y A;  4LMY A;  3FXJ A;  1SFK A;  3SXY A;  4IRI A;  1XTA A;  1U0J A;  1OFC X;  4KUM A;  1W7P B;  4HEA 2;  5FO5 A;  3BTJ A;  4L9J A;  3MVP A;  2EZK A;  4XRS G;  1T0F A;  1Y1V J;  2V79 A;  1ETQ A;  3QYF A;  1RI7 A;  2FX0 A;  2XDV A;  1KU2 A;  3FF5 A;  2AO9 A;  2MBF A;  3MN2 A;  2L0K A;  4BXF A;  3V4G A;  1VQ8 I;  1FTT A;  2PN6 A;  2R7U A;  1OMI A;  1OCP A;  1D0Z A;  1GT0 C;  5IOZ A;  1ACI A;  1LVK A;  2ZME A;  1CF7 B;  2RVC A;  3F3X A;  1O57 A;  3FXO A;  3GUD A;  4YIR X;  4B43 A;  3L00 A;  3FKI J;  2X6W A;  3OYI A;  3SYT A;  2DFH A;  4TV7 A;  3AL0 B;  1XGM A;  1XS9 A;  1ZG1 A;  4G7O F;  1J0R A;  4E7K A;  1RR7 A;  1BW5 A;  3D5L A;  2QF7 A;  5B3S H;  4J19 A;  3E3V A;  2L9R A;  1TWF J;  1I1S A;  2ZSI B;  2K27 A;  5F1R A;  3JRG A;  5BPI A;  2F48 A;  4XN3 A;  5FFX A;  2QBY B;  3EET A;  2ZNY A;  5E18 F;  3OYB A;  3LFU A;  1YS6 A;  3H0D A;  4HPQ A;  3OYJ A;  5IYC J;  3S1Q J;  1U9N A;  5K7Z A;  3CO7 C;  1HC8 A;  3E97 A;  2XB0 X;  3ZQF A;  2OJE D;  1VQ6 I;  1ZRE A;  2VE9 A;  3M9A A;  3V8K A;  2DFE A;  1SVL A;  2X48 A;  1XMA A;  5JVT A;  5KK1 A;  4RGX A;  5BOX A;  4G9Y A;  5KAI C;  4UV8 A;  4Y52 J;  3L09 A;  2KL4 A;  1FBQ A;  4HW0 A;  4I01 A;  4FE7 A;  2HXO A;  4XSX F;  2VON A;  3ZMD A;  5FRM A;  5M3M J;  2DOD A;  2LD5 A;  4LIU A;  1YE9 A;  3PO2 J;  2ID6 A;  3BC8 A;  4GGG A;  2LBF B;  2E34 A;  2UWM A;  2HOT A;  3P7N A;  1U5T A;  5EZG A;  4BEH B;  3C7J A;  2EBI A;  1POG A;  1WWX A;  2EFW A;  3HOT A;  1P9Q C;  2DMU A;  2BHZ A;  2NAZ A;  5D8L B;  2F4M B;  3WTT C;  1MSE C;  1PUE E;  2ZO4 A;  3BTL A;  5E1Z B;  4S0H B;  4AD9 A;  2HFH A;  5IYB J;  5LHI A;  2QZ8 A;  3GME A;  3KP3 A;  4ENJ A;  1Z1D A;  5ERI A;  2O3F A;  3F21 A;  3IL2 A;  4DYC A;  3BR1 A;  3IV5 A;  3ZQ7 A;  1T2K A;  3WTX C;  3G73 A;  2RAE A;  2DYS H;  5DD8 A;  3I59 B;  3PJR A;  5JFR A;  2H6B A;  1D1B A;  4NNJ A;  5EGO B;  3WTU C;  2MSY A;  1K4S A;  2K3P A;  5HDG A;  3DBR B;  1ZEL A;  2XB5 A;  3BP8 A;  4UXN A;  3BT9 A;  4U88 A;  4L5E A;  2BE5 F;  4RAF A;  1IZ1 A;  4M74 A;  3T1B A;  5CQE A;  2CFO A;  3BLY A;  5H20 A;  2CQ7 A;  5FFZ A;  4B8X A;  1K83 J;  3N05 A;  1TC3 C;  5E1X A;  1N78 A;  4CCN A;  4M9S A;  3GVA A;  3QU6 A;  1MKM A;  4HF0 A;  4HX8 A;  2YS9 A;  1WJB A;  1WH7 A;  3KLN A;  1HW5 A;  2ICW G;  3OIQ A;  3QYE A;  2O03 A;  4N4O B;  2LH9 A;  1D1A A;  3WHB A;  2PX9 A;  4D5C A;  1WH5 A;  4Y7N J;  4ZZD A;  4KIF A;  1K7A A;  1BM9 A;  2BV6 A;  3CES A;  4A3G J;  3LSG A;  3FBI B;  4PGG A;  5L3F A;  1VQL I;  4KT6 A;  1VQK I;  1PUF B;  2OAZ A;  1UJ8 A;  1N75 A;  3DTI A;  1YIT I;  1FSH A;  2L7M P;  2CW0 F;  2M0C A;  1TT5 B;  1B6A A;  5J1Y A;  2L7Z A;  5LEK A;  3B6A A;  1R4N B;  3G2B A;  2UZK A;  3W2W A;  1G8X A;  2FSW A;  4XR6 A;  1WJA A;  5ED4 A;  3NRV A;  4XRF A;  3GTQ J;  3GTJ J;  4X0G A;  3ZQL A;  5FD5 A;  3HOZ J;  5GTH C;  3C1D A;  2H6C A;  5HVQ C;  3H35 A;  1P4W A;  5FKO A;  1MBE A;  2X85 A;  1BI1 A;  1Z67 A;  2R7O A;  3NQO A;  5EG0 B;  3CO6 C;  3TBI A;  5TJJ A;  1S7O A;  2LG4 A;  4A6D A;  2MD5 A;  4ZJZ A;  1ULY A;  3HHH A;  3PQK A;  4XLP F;  2Z16 A;  3F6V A;  3ZQQ A;  4KDP A;  3BQZ A;  3GEZ A;  2VC0 A;  2OUM A;  1OPC A;  4EM1 A;  2DA3 A;  5H6Q A;  3WU1 B;  2UXX A;  4PSX A;  2CV1 A;  2WV1 A;  2EPF A;  3L9F A;  3VYS B;  1GLN A;  5CLS A;  2OF7 A;  3LWF A;  2XPU A;  3FXR A;  4W1U A;  3MKY B;  1XB4 A;  4DJA A;  3OS0 A;  2X1C A;  3I71 A;  4L18 B;  2ZCW A;  5HOD A;  4U0V A;  1T6S A;  1ETW A;  3QU3 A;  3VB2 A;  2HZD A;  5IY5 H;  2M87 A;  3K10 A;  3TDU C;  1B72 B;  4XLC A;  2JJ7 A;  1FIA A;  4CH7 A;  1WSU A;  4IQ4 A;  3GBG A;  3WE2 A;  1YJ9 I;  1GV5 A;  3CMA I;  2H8R A;  2ADU A;  2GLO A;  1X4O A;  1EF4 A;  1SC7 A;  3HYI A;  2O5R A;  2VKE A;  3IAS 2;  4XOT A;  1AOY A;  2ID3 A;  1S8N A;  5KAF C;  3AKZ A;  2CFX A;  3K2Z A;  3PSI A;  2AQF A;  3KCC A;  3ZMU A;  5IT9 Z;  2OQG A;  1TWH J;  1PJR A;  3JRD A;  3CJT B;  4EGY A;  2W48 A;  3ZMT A;  3IH2 A;  1QZE A;  1A6Q A;  1TLH B;  4HNV A;  2L9V A;  3HGY A;  3OYN A;  2XAH A;  1VQM I;  4HNT A;  5F08 A;  5F1J A;  2LY9 A;  4IRH A;  2M1B A;  1PP7 U;  1U5T B;  2P7C B;  3GO5 A;  1E2X A;  4IJA A;  4XBF A;  2HXI A;  1IG7 A;  1IN6 A;  3GTP J;  2JK3 A;  1R36 A;  4D7N A;  1KU3 A;  2K02 A;  3OOU A;  3ZQI A;  5K5R A;  4JQF A;  4CYC A;  2VL8 A;  2CJJ A;  3JCU C;  3QYB A;  1U6G A;  2VIX A;  4C30 A;  1NH3 A;  1VQN I;  2EB7 A;  2KIU A;  1M1E B;  2LKP A;  3F8N A;  4FET A;  3CDH A;  5AIP A;  3HRM A;  1TNS A;  1VF9 A;  4G6T B;  3M8E A;  4JX5 A;  4A3M J;  3RZO J;  5ILV A;  2F5C A;  4M9X A;  4G6Q A;  4IF4 A;  2CV0 A;  2D1H A;  2L5Q A;  2HDC A;  2DFF A;  1OYY A;  2O8X A;  2RNJ A;  1BIA A;  1Z0X A;  5M5X J;  1JTX A;  3HUG A;  3IAM 2;  2DA7 A;  3DTE A;  4B48 A;  2DA5 A;  4I98 B;  4L9T A;  1IV8 A;  4BXX J;  4ZDO A;  5K1Y A;  4ESF A;  2BVL A;  4X1E A;  4QIW N;  5LGN A;  3QWL A;  1JUM A;  2OA4 A;  1UB9 A;  1YRN A;  4L9N A;  2JSC A;  1IXC A;  2LF7 A;  5DCM A;  4Q4Z F;  2CUF A;  1KU7 A;  1Z6R A;  4RM2 A;  1IJW C;  2KT0 A;  2HYG D;  2IPQ X;  3I53 A;  4JK1 X;  3HM5 A;  1LPQ A;  4KA4 A;  2IEK A;  4WXC A;  4AUX A;  2CH0 A;  2E5N A;  4XQF A;  2JSP A;  3RI4 A;  1V54 H;  2QQ8 A;  2EJR A;  3H1C A;  4IL6 C;  5GPA A;  5GPC A;  1REP C;  4LK1 F;  3I4N J;  3NAR A;  2DYR H;  3FMQ A;  5EEA A;  1IUY A;  1A5J A;  4YFX F;  2VJJ A;  4FAS D;  3ZP5 A;  2L9S A;  1E3P A;  3BJA A;  3PNV A;  2W82 A;  4LGW A;  2MGQ A;  3L2R A;  1OCO H;  3BR5 A;  3JR9 A;  2DO7 A;  4NUB A;  2BW3 B;  3CQZ J;  4ZYA A;  3S8P A;  2OTL I;  4A2U A;  4BKX A;  3I4P A;  1TQM A;  1OR7 A;  3RPQ A;  3BCB A;  2QA4 I;  2HVQ A;  3BTI A;  2AHQ A;  3A4C A;  3ZMV A;  2WV0 A;  4AIJ A;  4BJT A;  1ZYR F;  1D5Y A;  4MLO A;  2MD0 A;  4B47 A;  4CYD A;  2GZW A;  1QZZ A;  2E19 A;  2H1K A;  4PGH A;  2P5L C;  3TMO A;  3M8F A;  1MND A;  5ICE A;  1RET A;  4YII A;  3LSI A;  5C4J J;  2VJ5 A;  2QLZ A;  4MEX F;  2CU7 A;  1Z7U A;  2DTZ A;  4PJJ A;  1TT0 A;  4MQV A;  4Y15 A;  2IGN A;  4BUP A;  1V5G A;  1NK3 P;  1SVO A;  4NB5 A;  1R9T J;  3KIO A;  3RTR A;  1XSD A;  3IH3 A;  4PUS A;  2QYO A;  4MFD A;  1P6R A;  1I27 A;  1YIO A;  3REO A;  5GTI C;  4O3M A;  1ON2 A;  3VWB A;  2K4B A;  1R5I D;  3B02 A;  4A0X A;  4YFK F;  2HU9 A;  1VQ5 I;  4AYB A;  2QGU A;  5HDK A;  1EKE A;  4JOM A;  1MJ9 A;  2LY1 A;  2ZFU A;  2XSJ C;  4E7H A;  2EV6 A;  2W4S A;  1WFX A;  3S2W A;  3FM5 A;  3GTM J;  2V26 A;  2BEO A;  4R1H A;  4LB5 A;  4OOI A;  3HTU A;  1B59 A;  2X6Y A;  1S29 A;  1VQO I;  1O3T A;  3ELK A;  3G4S I;  2G0E A;  3CCJ I;  3OYD A;  4B4C A;  2DAO A;  2XUB A;  3D5S C;  3VSL A;  2IGM A;  4CCJ A;  2HOA A;  1FOX A;  1BJA A;  1R5G A;  4GXO A;  5IP9 J;  1RIO H;  2M7B A;  3RPU A;  2KZG A;  4GFB A;  1TZL A;  5DDG A;  3KYC B;  2M4G A;  2NXN B;  2Z5U A;  4Y13 A;  2KIS A;  1XN7 A;  3O3K A;  1VI0 A;  4HDU A;  2M0M A;  1WI9 A;  2M2E A;  1R71 A;  1IRF A;  1I5Z A;  1HLV A;  4OAY A;  5H6R A;  4LG3 A;  1Y0N A;  3AG3 H;  3CUQ B;  3J81 Z;  1JKO C;  1Z05 A;  2O6G E;  2Y0S A;  1CF7 A;  2X6X A;  4LB6 B;  1T39 A;  4XOP A;  1J75 A;  1MBH A;  4JYK A;  4QPQ A;  1TTY A;  2K9M A;  2IA0 A;  2ZB9 A;  2FOW A;  2O61 A;  3HKZ A;  2UV1 A;  2CV2 A;  4F55 A;  5IP6 A;  1X3U A;  3JSO A;  2W24 A;  3ZMZ A;  2LFB A;  3KEQ A;  5DCM B;  3OYK A;  1V4R A;  1UG0 A;  2LP0 A;  3QP6 A;  5J1U A;  3RQ4 A;  3P5J A;  4A3J J;  2QBY A;  3L2C A;  2V1N A;  1QO0 D;  1R22 A;  1Z7L A;  4AU7 A;  2RC4 A;  2NVQ J;  3A02 A;  2XAQ A;  4J00 A;  2XAG A;  3R6S A;  2ISZ A;  2CQQ A;  1G4D A;  3I3L A;  4IO9 F;  4LLN A;  2NS0 A;  3H5N A;  4DYR A;  2F2E A;  2GIV A;  5BQT A;  2E1O A;  2VI6 A;  1AHD P;  1I6X A;  1AKH A;  4HZF A;  4HDV A;  2JA2 A;  2H8W A;  2XF6 A;  5LEJ A;  2FML A;  4E7I A;  1HF0 A;  2ACJ A;  1T38 A;  4A3D J;  3WG7 H;  4ASN A;  4U7D A;  4IQJ A;  2IS1 A;  3IC7 A;  1VZ0 A;  3CC4 I;  5FKN A;  1HBX G;  1FBU A;  2ME0 A;  3GFM A;  5CVV A;  3RYP A;  1QA6 A;  4EM0 B;  4HF1 A;  3UKG A;  2HQN A;  3ZN0 A;  3L2W A;  3U9G A;  3N97 A;  2DLL A;  2WAQ A;  5DCF A;  2K4J A;  1SEU A;  1CGP A;  2BXZ A;  4P5O A;  1ZG5 A;  2E35 A;  5FLV A;  4ZDP A;  1SAU A;  1RES A;  3S17 J;  5CPR B;  4BQN A;  1KON A;  1W0U A;  3BRO A;  2H27 A;  3GLL A;  2GXB A;  4DBQ A;  3K6G A;  1QHG A;  2L54 A;  4UUS B;  1GVJ A;  1QGP A;  5J8F A;  3OWT A;  1RR8 C;  1FYL A;  3H9G A;  3MZH A;  4V19 K;  2EV5 A;  3FX3 A;  1DP3 A;  2LKX A;  1Z3Y A;  3RYR A;  3VEP A;  3HG9 A;  3KPH A;  3WTW C;  4GRI A;  2B63 J;  3ABM H;  5ILU A;  4UY8 I;  5HDN A;  5IOY A;  4BU2 A;  2ESH A;  2VBY A;  3I59 A;  3I5U A;  4AID A;  1UAA A;  3BCA A;  4FT8 A;  1JI8 A;  2VXZ A;  5EGO A;  3TP3 A;  4JX6 A;  3VOE A;  1JJ8 C;  2IVM A;  2FJ1 A;  3MD2 A;  5HS9 A;  2QEX I;  4HX4 A;  2KKO A;  1CQT A;  1G6N A;  1QU3 A;  3U2R A;  3NAU A;  3OYL A;  3H5A A;  1NTC A;  4XSZ F;  2WB1 A;  3DEE A;  2HYF A;  4YIF A;  4IVN A;  3RSN A;  3CDL A;  4ANJ A;  1O3R A;  2FD5 A;  1ON1 A;  4M9Z A;  1MBK A;  5F64 A;  2A07 F;  2K5C A;  3BWG A;  3S2H J;  5FLX K;  1T56 A;  2FQ4 A;  3I58 A;  2NS8 A;  4Y4R A;  3WE3 A;  3CC2 I;  3FIW A;  1MMN A;  1XSX A;  3ZQG A;  2A6T A;  1I39 A;  4WX9 A;  3MKW B;  4WXH A;  5GAH J;  1P4A A;  2YPR A;  3KP2 A;  3WU2 C;  3PIO F;  2M34 A;  1IN8 A;  4XKB A;  4YRV A;  3COA C;  1GDT A;  3HZJ A;  2L7K A;  3OR1 C;  3ZPL A;  1X2N A;  1XGN A;  3CDI A;  3F6O A;  2XPV A;  1G3T A;  1XCV A;  3K69 A;  2DOE A;  2CSO A;  3NWT A;  1LUJ B;  4NC7 A;  4II2 A;  1D3Y A;  3OYM A;  4BNC A;  4P1W A;  1SMY F;  5ICF A;  3S3N A;  1A04 A;  4CXF A;  1QPI A;  4HG2 A;  2FF4 A;  3D1N I;  1TP4 A;  1XDS A;  2TRT A;  2MA3 A;  1ODD A;  2L9N A;  4EVI A;  5J47 A;  4DOZ A;  1W0T A;  4D0P A;  1XPX A;  5EG0 A;  2IS4 A;  3DPT A;  2Y2Z A;  2WWY A;  3S93 A;  4XLN F;  3V42 A;  4L5J A;  3KEO A;  2OTJ I;  3B73 A;  2RQQ A;  1IC8 A;  1HW2 A;  1P2F A;  3LAP A;  4OMY A;  3JRI A;  3BPV A;  4QPO A;  4HOB A;  4BS9 A;  3J7Z I;  5FD6 A;  3CC7 I;  1F1Z A;  3H36 A;  3VYT B;  3DV8 A;  5FKK A;  3KP6 A;  2HDW A;  3PUF A;  1WHU A;  3T0Y A;  4CZZ A;  4UVA A;  4F52 A;  3JW4 A;  5CVU A;  4PDK A;  1VTN C;  2GXG A;  1FZP B;  1WGX A;  1NK2 P;  3GW2 A;  3CCY A;  2PJP A;  1B72 A;  2W00 A;  4PSW A;  5AIQ A;  4HBL A;  1MBJ A;  4A3E J;  2R0Q C;  1QRY A;  3C2H A;  3K70 C;  1XC5 A;  2LRE A;  1OCZ H;  4V2G A;  1IRG A;  3MMY B;  3B6C A;  1FOW A;  2OV7 A;  4ETS A;  2DOA A;  2DT7 B;  2J5O A;  4M71 A;  3I0T A;  2WY7 Q;  2M3A A;  3H9Q A;  4HLX A;  4P9U A;  2IS2 A;  1AKH B;  3CJR B;  3TO6 A;  1A6I A;  4RLF A;  2EZH A;  1OYI A;  1VFC A;  1XX5 A;  1EA3 A;  5K7H A;  4RM3 A;  5KNL A;  2ISY A;  4OAZ A;  5CVJ A;  3TGN A;  2BGC A;  2ELH A;  3CJQ B;  1IN4 A;  3KFW X;  1R1T A;  1ONV A;  4DNC A;  1D0Y A;  3IKV A;  1F9N A;  1QVU A;  1MMG A;  5B1A H;  1G3S A;  3E5Q A;  5E3L A;  1EV7 A;  3FKJ A;  3RIR A;  4OIO F;  1UMQ A;  3RKW A;  2CW8 A;  2JUG A;  3DBH B;  2FU4 A;  4BAC A;  5FRO A;  5J4V A;  3HPG A;  3F8B A;  4AVZ A;  2GA1 A;  2Z1D A;  3HHG A;  3QOE A;  1LQ1 A;  2E1N A;  4HV6 A;  2NVU B;  3X2Q H;  1XMK A;  2F5F A;  4HQE A;  3KP7 A;  3AAF A;  3F8F A;  2XC7 A;  2H1L A;  4EGZ A;  2HQR A;  2KZV A;  3OYG A;  2DMN A;  3CUO A;  4I0B A;  3JRE A;  2KRF A;  4BXU A;  4Z2Y A;  4E7L A;  2DI3 A;  2DA4 A;  2M7A A;  4E6K G;  2HR3 A;  2ZFW A;  4BE2 A;  1BC7 C;  5LHH A;  3DWL E;  1LKX A;  5CVI A;  2GQQ A;  1WZ2 A;  4RMN A;  4L9V A;  3NEU A;  1NG6 A;  4HST A;  2HKO A;  3ZN1 A;  2QEN A;  3GFL A;  3LSR A;  5EEG A;  3J7A O;  2E71 A;  2CO5 A;  1HA8 A;  2KHM A;  4Y3O A;  1W36 D;  2M4K A;  1MJB A;  4M72 A;  3RKX A;  4IKF A;  5FRN A;  2Q2E B;  4G7Z F;  3CCV I;  4HA8 A;  2NS7 A;  3RJP A;  4A3F J;  3GTK J;  5E3M A;  1E0E A;  1IAW A;  1TL8 A;  1Y8R B;  4CCK A;  1XCB A;  1ZGW A;  2Y30 A;  3Q0V A;  4U7B A;  4DZP A;  3J7A Y;  4ZH4 F;  1YFH A;  2X1D A;  3EUK L;  3WGH A;  2XF5 A;  1ZLJ A;  1XGO A;  2ZBK A;  1BJZ A;  2DQL A;  1WCM J;  3W6V A;  2VOP A;  1VND A;  3DXJ F;  2LKS A;  4UUT A;  4ZTJ A;  1EJ9 A;  3D0S A;  3IHU A;  2YU3 A;  2P5K A;  3GXO A;  2OBP A;  2IA1 A;  2PMU A;  2CYY A;  5D5W B;  4OIN F;  2NOG A;  1N77 A;  5FLX Z;  1Y56 A;  5D4R A;  2L02 A;  4UVB A;  3BTC A;  2KRC A;  2CWE A;  2W84 A;  1P7J A;  5D8K B;  2VKV A;  3H92 A;  3S1R J;  2WY8 Q;  3PNT A;  4A3I J;  2O0Y A;  5LGU A;  5FB2 A;  4RA2 A;  2RNG A;  3ABK H;  4L0Z B;  1DPU A;  5M5W J;  4UB6 C;  3ZXS A;  3S32 A;  2JQ7 A;  4G12 A;  3EDP A;  2BW3 A;  4HF2 A;  1TW3 A;  3VYU B;  2O9L A;  4AYB N;  3CLO A;  2R7D A;  3FXU A;  1DP7 P;  4E7S A;  1EH7 A;  4AM3 A;  3G1L A;  1GUU A;  2PQ8 A;  3PO3 J;  4QWQ A;  4BDZ A;  2CUE A;  5FLM J;  5IT3 A;  4BH9 A;  3W3C A;  3FXM A;  3P9K A;  5ICG A;  2JA7 J;  4HNU A;  1XD7 A;  3FK7 A;  1HXD A;  2DMQ A;  3EQL F;  3ZCO A;  3A0B C;  3K1P A;  2DK8 A;  1S5L C;  1UHM A;  3BG9 A;  1IGN A;  3I55 I;  1ZTR A;  2BY1 A;  1U78 A;  4AVP A;  1X1D A;  4CZC A;  3DKW A;  2MG4 A;  3NWS A;  3JRF A;  2QCO A;  2PMZ A;  1F36 A;  4B44 A;  2RV8 A;  3MKL A;  2ZME C;  1FYK A;  3OYA A;  1J5Y A;  1T08 B;  3FIS A;  1LDD A;  2F5D A;  2EFN A;  5JVG F;  3LMM A;  3K9T A;  1HSJ A;  5BNG A;  1HQC A;  2YUS A;  3ASO H;  1O7L A;  4M6X A;  1STZ A;  2ELK A;  2DA6 A;  4EJW A;  3HGG A;  3EUH A;  4BQO A;  4DBR A;  2V4J C;  1RPW A;  2Y0S N;  2LDU A;  5F27 A;  3IUO A;  4M3F A;  3KP5 A;  4IPA A;  2V9P A;  4LG0 A;  1TWG J;  1GV2 A;  4I7H A;  1W4M A;  2V1D A;  1O3Q A;  2EIJ H;  2RRE A;  1FIP A;  5LRR A;  1LDK B;  2KJC A;  3WGI A;  1OCC H;  3OL3 A;  4RB3 C;  1G59 A;  2OZ6 A;  1R1U A;  1JTY A;  3LA7 A;  4JX4 A;  1H9T A;  3TW6 A;  3GTL J;  1KYZ A;  1RUN A;  4ITV A;  1U3E M;  1YJN I;  3HKZ N;  1O3S A;  3DLA A;  3V7C A;  1B9M A;  5J4Y A;  1KU9 A;  1T33 A;  2K9L A;  2XAU A;  1GXQ A;  4A3L J;  5BMZ A;  2IGO A;  2N8G A;  2XGC A;  5CJ9 A;  4FCY A;  2DPD A;  3FXK A;  3CCM I;  3EUA A;  4CCM A;  2FNP A;  5TRD A;  4A5N A;  2P6T A;  1DU0 A;  4D5F A;  1ZLK A;  1IN5 A;  1ZG3 A;  3R0A A;  1ETV A;  1ZN2 A;  4RGS A;  3V8L A;  3N4M A;  3VPR A;  3BY6 A;  3FZV A;  5L3G A;  2CRG A;  3U1D A;  2DMT A;  3OY9 A;  4EEF G;  2R4G A;  5B1B H;  5HS7 A;  2LOO A;  4M3G A;  1Q1H A;  3FXQ A;  3BJO A;  2B7E A;  3LST A;  4ZYE A;  4XRS A;  2E1C A;  2IRF G;  2KQR A;  1U5T C;  3CUQ A;  3H3Z A;  3C2G A;  4I76 A;  2VOO A;  3E6M A;  4MNU A;  3A03 A;  1Y39 A;  1R23 A;  1GVD A;  4C3I J;  4CCL A;  2IA2 A;  3OSF A;  4CDG A;  3ZR8 X;  1XSV A;  2EH3 A;  1SD7 A;  2ZXJ A;  3HOU J;  4G6D A;  1KQ9 A;  3IP4 B;  2P5V A;  4ZYG A;  3OL4 A;  2EIN H;  3BR0 A;  1YX3 A;  3CTA A;  2WAQ N;  2Y31 A;  3SJM A;  3WHC A;  1VQP I;  1SFU A;  3FBN B;  2R5Z B;  3SHF A;  5LFA A;  2FQ3 A;  3GFJ A;  1BL0 A;  2C6Y A;  1BN5 A;  1MJA A;  4ESJ A;  1X1A A;  4LFU A;  5LRS A;  3A1Y A;  2I10 A;  2EK5 A;  3EYI A;  5CKT A;  3ECO A;  4FQG A;  3VOD A;  3LSK A;  4NDL A;  3C2B A;  5J3L A;  1J09 A;  3W2A A;  2LVS A;  5CYV A;  1F43 A;  2IGK A;  5DEQ A;  2OQR A;  3KET A;  2HWV A;  5E3O A;  3K4N A;  4F91 B;  2FBH A;  2LMD A;  4DGW B;  2NVT J;  2NOJ B;  4KIT B;  2FEZ A;  2ZSH B;  3C18 A;  3DEW A;  2MC3 A;  4KMF A;  2W1O A;  4FHT A;  1I50 J;  4IOC F;  2MAB A;  2VQG A;  2L7F P;  3IWF A;  3RKQ A;  3K4B A;  1NG7 A;  1IDZ A;  2DFI A;  1Y1W J;  4IHW A;  2V9K A;  1ZK8 A;  2XAJ A;  3ULQ B;  3TW7 A;  2EA4 A;  1JHF A;  1FMW A;  1YW9 A;  2WB1 N;  5D4S A;  3LQQ A;  5F6F A;  4A12 A;  4EMS A;  3FHZ A;  2NNY A;  2E2I J;  1W1W E;  1WJF A;  4CO8 A;  3HOV J;  3CCE I;  4MHG A;  2HI3 A;  4UUS A;  2BHY A;  2JVG A;  4C2M J;  2EFQ A;  4BHP A;  3PFY A;  3KZI C;  2IBD A;  5HS8 A;  3JAM K;  3E1S A;  4ENM A;  1LB2 A;  2E7X A;  2Y69 H;  3DU5 A;  4XK4 A;  2J5P A;  4DQ2 A;  4EJV A;  1MDM B;  2JMW A;  3RDI A;  4XN0 A;  2K40 A;  5D6E A;  1B8I B;  2DTR A;  2KLO A;  3T8R A;  4UV9 A;  4OIR F;  1K4T A;  3E6C C;  2EWN A;  1WKM A;  3H3U A;  1LDJ A;  3L2U A;  3OOP A;  3ZQH A;  3E5U A;  2KRH A;  2HTS A;  1UG2 A;  3TDZ C;  5D5X B;  2KP6 A;  1UST A;  3PUB A;  3ESW B;  3K70 D;  1R1V A;  1SD5 A;  3IKT A;  4YFN F;  3G6E I;  1I6H J;  2V6E A;  2PJR B;  2JVH A;  2LSO A;  1RKT A;  5B5E C;  1L3L A;  1EH8 A;  3BQY A;  4R8H A;  1K6O A;  1ZRD A;  1K79 A;  1G3W A;  2LR8 A;  4DIQ A;  1RUO A;  2EQR A;  1K61 A;  3SDG A;  2A05 A;  2VJ4 A;  2OPT A;  3P9C A;  3RKY A;  4LG0 B;  2M8E A;  3CD6 I;  3RZD J;  2PEX A;  2R7R A;  4GYG A;  3PQJ A;  1L0O C;  1USS A;  3I54 A;  3M8J A;  5EF6 A;  2HYJ A;  2JA6 J;  2DXI A;  4X6A J;  1Z77 A;  3ABU A;  2DA2 A;  1E3O C;  3R61 A;  1KGS A;  3UR3 C;  2W7N A;  4EJT A;  4XIC A;  4ZC3 A;  2STW A;  4ZTF A;  2V1X A;  5CVR A;  1XDU A;  2A3S A;  2MW8 A;  2LLK A;  5M5Y J;  5E8G A;  3L2V A;  4M3D A;  4U0W A;  4NQW A;  3L1P A;  2D5V A;  2CUJ A;  3BZ6 A;  3WTY C;  3M1E A;  2Y9Y A;  1WVR A;  2L4A A;  2LF8 A;  4RAZ A;  2OCE A;  2BY3 A;  5FGM A;  2WA0 A;  1W5S A;  1QPM A;  3CJN A;  3DBL B;  2LC2 A;  4U87 A;  3QQA A;  1V5E A;  2ECB A;  3HJE A;  3W2V A;  2XIG A;  5JLW A;  5DTD A;  3CCR I;  3K4C A;  1ITY A;  1HDP A;  4DYQ A;  3QPL A;  1IV6 A;  5DUK A;  2YX4 A;  1D5V A;  1LFB A;  4F3Q A;  3OSG A;  3K4K A;  2A68 F;  1UZC A;  5J8C A;  2KJB A;  4XNF A;  2XF7 A;  2DOF A;  1YHQ I;  2TDX A;  2WAF A;  4A0Z A;  4D7M A;  1RC9 A;  3E6B A;  1FEX A;  2VE8 A;  5J40 A;  2Y0M A;  4QLC U;  2CQX A;  3HOS A;  5E17 F;  4WWC A;  2LRD A;  3LSJ A;  2L3D A;  2EZL A;  2STT A;  2I5U A;  1ENH A;  3FM3 A;  5FKM A;  4BAY A;  3EYY A;  3HRS A;  3JRB A;  2QVO A;  1JHH A;  1FMV A;  1OYW A;  3F0C A;  1RRJ A;  2COM A;  4LLG F;  2EFP A;  1MMD A;  1DGW Y;  2ECC A;  2G7U A;  5EJC A;  2CQN A;  5GAE J;  2VUM J;  1JT6 A;  4I0A A;  1BR4 A;  3DTK A;  1E3H A;  3PFI A;  4M3E A;  5DV5 A;  5FJ8 J;  4AIH A;  4S05 A;  2FUG 2;  4HV5 A;  3MWM A;  2UXN A;  2XAS A;  3F9K A;  1KQ0 A;  1X1P A;  3JRA A;  3G3Z A;  3GZ5 A;  3M1C A;  5AON A;  1GHC A;  1S7A A;  4A0Y A;  4F92 B;  2E36 A;  3FWE A;  1MIJ A;  5JI6 A;  4Q5S F;  2YR2 A;  5GP9 A;  2R3S A;  4XID A;  1MMA A;  2HKX A;  4UHT A;  1SFX A;  1YQA A;  4LK0 F;  3VYR B;  4ABZ A;  2A5W A;  1WRJ A;  2ZNZ A;  3F8C A;  4PJM A;  2KIF A;  2VC1 A;  4QTR A;  2R7W A;  2QSH X;  4FX0 A;  3LFK A;  1FOK A;  1JKR C;  1BC8 C;  1MZB A;  1ETO A;  4S04 A;  2A6E F;  4E7Z A;  1HCR A;  1PYV A;  3TOB A;  2CW7 A;  1WJE A;  1QBJ A;  2IXS A;  3R4K A;  4CCO A;  2GBY A;  2ZJ2 A;  2VKH A;  2HOE A;  3S1N J;  1OR7 C;  1IO2 A;  1HKS A;  1MBF A;  1AA7 A;  1FBS A;  2L4M A;  3DU6 A;  2X6O A;  5LGT A;  4G94 A;  2XHK A;  3G1O A;  3JAM Z;  2FNA A;  2M8G X;  3G1M A;  3HSR A;  4AC0 A;  5DUI A;  1X2M A;  2BOL A;  4MTD A;  2ZXW H;  1JKP C;  1TQI A;  3PNY A;  2R7Z J;  4E4H A;  2Q2E A;  3F8M A;  1GXP A;  1SD6 A;  4WF2 A;  4GCV A;  2V9V A;  2MFZ A;  3BR2 A;  1J59 A;  5L3E A;  1HKT A;  4EV0 A;  2Z99 A;  1VQ9 I;  4UNO A;  2D45 A;  1FY7 A;  3E5X A;  1X3W B;  1WJC A;  5LHG A;  2KDZ A;  1D8K A;  4YEJ A;  3Q0U A;  2K9S A;  5E20 A;  2BVM A;  2E1M C;  1BA5 A;  1ETK A;  5KCM A;  3K4M A;  2KDO A;  3QAH A;  2AQE A;  3TED A;  1OKR A;  4RB2 C;  3WTS C;  4RS8 A;  4PJN A;  2A61 A;  4EAT A;  1A36 A;  3AG2 H;  3DLL F;  4RLQ A;  4Z6Y A;  2GM4 A;  3V7S A;  1P4X A;  2JUC A;  4C9Y A;  4OIP F;  4O6J A;  3W6J B;  1X58 A;  1X19 A;  2ETH A;  3V8J A;  3SZG A;  1R4M B;  1S7E A;  4B3X A;  3GTO J;  1Y8Q B;  4NQW B;  4XKC A;  3GLX A;  3QOD A;  5GAD J;  1H0M A;  1LVA A;  4KJZ A;  1ZGJ A;  3ZMS A;  4M6Y A;  3DPU A;  2PMZ N;  4G7H F;  2VPL A;  2HQA A;  1O7F A;  3I9V 2;  3RQI A;  1ZGA A;  4IEJ A;  2D2W A;  4EQQ A;  3SEQ A;  1ZQ3 P;  2KMU A;  3BZC A;  4F7Z A;  1F4K A;  1FP1 D;  2A69 F;  3GF2 A;  5E8I A;  3MZ8 A;  2V6C A;  5KHD A;  5LLQ A;  4CGZ A;  1MMS A;  4HAM A;  4IHX A;  5D5V B;  4I02 A;  2X9D A;  3SZP A;  1RZ4 A;  3I56 I;  4BGD A;  2LNB A;  2X51 A;  5DS9 A;  1LFP A;  3GZN B;  2ZXH A;  1BOB A;  2JWT A;  2E7W A;  2GA2 A;  3DKY A;  5DYM A;  1IRZ A;  4RB1 A;  3L7W A;  1YO5 C;  4C3J J;  3ABT A;  2VT3 A;  1VQ4 I;  1T8I A;  1ZAO A;  1MD0 A;  2K9Q A;  3PL8 A;  4HSR A;  1YX5 A;  2L01 A;  1U8B A;  2H09 A;  1MNE A;  3I64 A;  4KN4 X;  1YYV A;  3HBL A;  2Z9O A;  5E1W A;  3GYH X;  3TQN A;  3E0J B;  2X1E A;  2BY0 A;  4XLF A;  1BW6 A;  2GOM A;  1FX7 A;  2MYS A;  1K78 B;  2MLG A;  3AL0 C;  4QSH A;  3HRU A;  3ERE D;  1D0X A;  5H2F C;  5IT9 K;  2K3F A;  1QQI A;  4IHS A;  4YEL A;  4OIQ F;  4EM2 A;  2Z3Y A;  4DW6 A;  2R7V A;  5F0F A;  1QNT A;  3CP8 A;  1BI2 A;  2PI0 A;  1IXS B;  1JUP A;  2YX7 A;  3TKY A;  4AWX B;  5EDN A;  4BY1 J;  3KE2 A;  1LEB A;  3ZGK A;  3O8G A;  2V7F A;  4PFP A;  3ECH A;  1FOY A;  2R7S A;  1B4A A;  1I1G A;  1ETY A;  2CQK A;  2BZT A;  4BY7 J;  1SVM A;  4H4K C;  4BQQ A;  2XRO A;  2JZY A;  2P7V B;  4FIS A;  2LK2 A;  2QQ9 A;  2O8K A;  3F72 A;  2JPB A;  2FOK A;  4XMY A;  5DD4 A;  5BPD A;  3FDY A;  3SZT A;  1IDY A;  5L3C A;  3GCM A;  3OIO A;  3JRH A;  2XSD C;  3GTG J;  2FBI A;  2X4H A;  1IN7 A;  3S15 J;  3K0L A;  3E7L A;  2HVR A;  2EFO A;  1KZH A;  5LBQ A;  1UHS A;  3GFI A;  3KYL A;  3TO7 A;  4XLA A;  1ZHF A;  2CUZ A;  4RAY A;  1O4X A;  4XLH A;  4F93 B;  3OYE A;  1SMT A;  2I8D A;  4UB8 C;  1OCT C;  2E2J J;  2DJN A;  2DU9 A;  3CP2 A;  3E6D A;  3S14 J;  4JBA A;  4XKV A;  1BI0 A;  5DM6 F;  1JKQ C;  1TBX A;  3SFZ A;  2VBZ A;  1ETX A;  2QSF X;  3HSF A;  2BBY A;  2R5Z A;  2KFD A;  4PK4 A;  4P55 A;  3K4J A;  4IZZ A;  3OYC A;  4RAG A;  3M4O J;  4LIV A;  3CCL I;  2WC2 A;  4BQA A;  3AG4 H;  3OIP A;  4LD5 A;  1T95 A;  2BYV E;  1TQP A;  4KNY A;  2R92 J;  4Y17 A;  5B66 C;  5JHF A;  3LL7 A;  4XON A;  3C3W A;  2XKP A;  5D6F A;  3TO9 A;  2VKD A;  2AXT C;  2RN7 A;  1ZR2 A;  1B1B A;  1BR2 A;  2DJI A;  4JP0 A;  2VBX A;  2VT2 A;  4BBR J;  4MO7 A;  1IRX A;  1B9N A;  2GOX B;  1Z3X A;  2DQR A;  2XGE A;  3QPS A;  4LOC A;  2XRL A;  2RQP A;  5L3D A;  1AU7 A;  4MFE A;  3WTZ A;  3K1N A;  2VN2 A;  3HB9 A;  3QOP A;  2HEO A;  1QHH D;  2GIZ A;  3BG6 A;  4LJZ F;  3SFI A;  4BYY A;  2PG4 A;  3CCQ I;  2AS5 F;  4GDF A;  4IRG A;  4NC8 A;  2Y75 A;  3A01 B;  2HPM A;  4A3B J;  1PVE A;  3CMY A;  4L0Y B;  4LIT A;  4XL9 A;  4FE4 A;  1J9I A;  1MGT A;  4R79 A;  4IHY A;  2DW4 A;  3HSE A;  3IWZ A;  1IF1 A;  2HTJ A;  3O8H A;  4KIS A;  5E3N A;  3KZY A;  2DT5 A;  3BDD A;  1ZAR A;  4WK8 F;  1JXS A;  2CG4 A;  4ESB A;  4ENK A;  3G71 I;  4IHV A;  3CME I;  4BE1 A;  2X0L A;  1FC3 A;  3KYD B;  4Q48 A;  3LAJ A;  1X1C A;  4OU0 A;  3HRT A;  1IW7 F;  4Y33 A;  4W97 A;  2RGV A;  2Q0O A;  2Q8K A;  1BOA A;  2BY2 A;  4A3C J;  3OS2 A;  4A3K J;  2DK5 A;  4MQ9 F;  1UCR A;  2CMP A;  1DQU A;  2DMP A;  4ZYH A;  4G8X A;  3DQV C;  1MDM A;  1T0F C;  3TOA A;  3LNQ A;  3M7G A;  2W57 A;  2ZME B;  1YS7 A;  5EZH A;  3J7Y J;  3TL4 X;  5LD2 C;  1B8I A;  3FMS A;  4ZZL A;  3BR3 A;  2B9S A;  1DPR A;  2LY2 A;  1U8R A;  3OR2 C;  2ZJQ F;  4M3B A;  3TP0 A;  3U21 A;  3JTG A;  1RNL A;  3WOD F;  2DA1 A;  1Z6T A;  1YOV B;  1U2W A;  3LSM A;  1H88 C;  2ESN A;  1J7K A;  5ICC A;  1QZY A;  2IW5 A;  5IP7 J;  1LJ9 A;  5CQG A;  3CF5 F;  4P96 A;  3HPH A;  3H5R A;  1D8J A;  4XRM A;  4O5V A;  2PJR A;  4XM3 A;  3H0G J;  4BHB A;  1WPK A;  2ZXI A;  3I4M J;  3KEY A;  5KVR A;  3BPX A;  1ZR4 A;  1APL C;  4C2U A;  3AFH A;  2W25 A;  4NC6 A;  1IUF A;  3T5X A;  4AIK A;  2VOD A;  2G7H A;  1W5C C;  2ZJP F;  4E7J A;  2P0W A;  1QVT A;  4KIG A;  1FWZ A;  1R49 A;  2JA5 J;  1OQY A;  2COB A;  1XMX A;  3HXL A;  1FPQ A;  5K7F A;  1X1B A;  3JRC A;  1I3A A;  2XKO A;  1FYM A;  1NHA A;  1V5F A;  2B0L A;  1Y0U A;  4J01 A;  3O2P E;  3DFG A;  5C3E J;  1YJW I;  4IHT A;  2HNH A;  3QP5 A;  4RGR A;  1JUS A;  2XAF A;  3K1M A;  3BR6 A;  4L5I A;  1R7J A;  1UEL B;  1YIJ I;  4IXA A;  5JR3 A;  2GWR A;  1DGR M;  4RBO A;  4BE0 A;  3DF8 A;  4IX7 A;  3Q9V A;  3SQN A;  2V1U A;  3CLQ A;  2D1V A;  2EZI A;  2JPC A;  2R7F A;  3J81 K;  1J2X A;  3HIF A;  5GAG J;  4FTH A;  2GAU A;  3CCS I;  4HQM A;  4UVC A;  2FXA A;  5A2Q K;  1Y6I A;  2M5W A;  3MCZ A;  2PBI A;  2IS6 A;  3IRR A;  5D5U B;  3Q0W A;  4ZYD A;  1OLT A;  1Z91 A;  3SDB A;  4BBS J;  1HKQ A;  1HOM A;  3K4L A;  2YSR A;  4HYE A;  5DM7 F;  3CCU I;  2WBM A;  1JJ6 C;  1BI3 A;  4N4N B;  3AG1 H;  1S3J A;  3Q9S A;  2OC6 A;  4C3H J;  3HC7 A;  2K85 A;  2JRM A;  3BG7 A;  3FK6 A;  3BJ6 A;  3QPT A;  2HDD A;  1WQ2 A;  1HST A;  2G9W A;  2XRN A;  1DUX C;  2MLK A;  1YLF A;  1KQ8 A;  1H9G A;  1DU6 A;  4I99 C;  2OCC H;  3FXL A;  3MQ0 A;  2PFB A;  4V2F A;  2NVY J;  2QWW A;  4D1Q A;  2K9N A;  4CHU A;  1JE8 A;  4CIC A;  2R7T A;  2A6H F;  2XVC A;  4N0B A;  5HNF A;  2PLY A;  1YG2 A;  3WU0 A;  1MW7 A;  3UNG C;  1SFO J;  4UUV A;  1S72 I;  4GYI A;  3F22 A;  3VDX A;  1ZH5 A;  2TCT A;  5IYD J;  1HW1 A;  1R00 A;  1FJL A;  3OMY A;  2IJL A;  3R0J A;  1R6R A;  2IT0 A;  2Z33 A;  3GWZ A;  2VBW A;  1BBY A;  2HZT A;  1LNW A;  4PJL A;  4RB0 A;  1DDN A;  1FP2 A;  2WAD A;  3CF2 A;  1UFM A;  2EV0 A;  2MH9 A;  5IPA A;  1ORK A;  1F5T A;  3OYH A;  5HLI A;  2A5Y B;  5M3F J;  4PFO A;  1Q1V A;  5K5Q A;  4XKW A;  3U1K A;  5EEH A;  2R5Y A;  1R5H A;  1PDN C;  3LA2 A;  2JN6 A;  3F23 A;  2FMY A;  4B3A A;  1RKW A;  1MH3 A;  4GO1 A;  2QKL B;  2DDA A;  3RPU D;  2P4W A;  2MC4 A;  1S9H A;  5BS6 A;  2F4O B;  3WGG A;  3DCF A;  2VQH A;  3HOX J;  3W6K B;  1G3Y A;  3OV8 A;  1VQ7 I;  3OYF A;  1W7P D;  2GXA A;  3JTH A;  4PJ0 C;  4BJ5 C;  5C4X J;  1JGS A;  2F6C A;  3H3V K;  4I2O A;  4KIB A;  2IAI A;  1T98 A;  3K2A A;  4A5M A;  4D9J A;  4H0E A;  1A31 A;  2FBK A;  2IP2 A;  2NNN A;  3QPH A;  3S2D J;  1MH4 A;  2NRA C;  1WJ5 A;  3BZK A;  3J80 K;  2E60 A;  1UHW A;  1LFU P;  4I09 A;  1FTZ A;  2FE3 A;  3BOQ A;  2QM3 A;  2Y48 A;  2M45 A;  2HPI A;  1W36 C;  2LTP A;  5F0H A;  1LE8 A;  2H94 A;  5TIS C;  1MNM C;  4PZJ A;  4KMU X;  5F04 A;  3ML6 A;  4ZDL A;  3IH4 A;  2QSG X;  2LYC A;  1D1C A;  2UUZ A;  2VPR A;  4II3 A;  3V7R A;  1FNN A;  2VQL A;  2VXD A;  3ERM A;  1R58 A;  4KIC A;  3DP7 A;  1ZRF A;  3CZ6 A;  2VB6 A;  4XOR A;  1ZKG A;  1KA8 A;  2KPM A;  2Y9Z A;  4NHJ A;  2YU9 J;  3BG3 A;  3EUH C;  1YI2 I;  1SAN A;  1SFE A;  1TWC J;  4HX7 A;  2DT6 A;  2HGC A;  4E70 A;  3DKX A;  5HNH A;  2Z2S B;  1YTY A;  4YG2 F;  1Z9C A;  2DBB A;  2WTE A;  2L2O A;  1HDD C;  4M73 A;  3VFZ A;  5HLT A;  1LEA A;  4P9F A;  3WTV C;  4Q47 A;  2QQB A;  4CYC B;  3S1M J;  6PAX A;  9ANT A;  4N9I A;  2OD5 A;  2BXY A;  3HOW J;  3Q3S A;  3A0H C;  4RDU A;  5JLX A;  1FT9 A;  4OMZ A;  2HVS A;  3ABL H;  2HQ5 A;  4K2E A;  5E79 C;  3O6B B;  2EIL H;  2P81 A;  3ASN H;  4KFC A;  5F0C A;  1W7P A;  3KLO A;  4CSW A;  1JGG A;  2XGX A;  3SEZ A;  3ZRG A;  4EJO A;  2K86 A;  1G2H A;  4MIM A;  4BJ6 C;  3RCO A;  3M3Y J;  3HEF A;  5K5O A;  2XV4 S;  3DPL C;  3IRQ A;  3HUG B;  1BR1 A;  4KYW A;  2FRH A;  1X4P A;  1XGS A;  5A2Q Z;  3GZ6 A;  2VLA A;  1I3Q J;  2P6S A;  3CUQ C;  3HL2 A;  4BL0 B;  3K7A J;  2XPW A;  3JSP A;  5HLG A;  1U9O A;  1SD4 A;  5ILS A;  2NYX A;  2M9H A;  1E17 A;  2W85 A;  5J6X A;  2CS3 A;  1YRN B;  2NVX J;  3L2Q A;  3LSP A;  2R7X A;  1ERD A;  2E2H J;  1K78 A;  3LSH A;  1WI3 A;  3MFK A;  2OZU A;  1P92 A;  5TGT A;  3HTS B;  4B09 A;  2KIM A;  2ZKZ A;  4CUG A;  5J1R A;  4KT5 C;  2FA5 A;  1X3Z B;  3MEX A;  2QUF A;  1ZRC A;  3OS1 A;  2JRT A;  3HOY J;  3PM1 A;  3S16 J;  3A2K A;  3MKZ A;  1YW7 A;  1P7I A;  2RDP A;  3FMR A;  1BIB A;  1TNT A;  4WXD A;  4ON0 A;  2CGP A;  3ISP A;  4LLL A;  4BHC A;  2WAE A;  4MEY F;  4NBQ A;  2R5Y B;  2VJI A;  3BG5 A;  2ZJR F;  2EIK H;  4HLY A;  4MTE A;  1V55 H;  3M07 A;  4CA0 A;  3ONQ A;  4DZJ A;  1FLI A;  3LQR A;  2AXL A;  3HDD A;  1XG1 A;  2LBF A;  1PP8 F;  2ZC2 A;  2ME6 A;  2Q1Z B;  4BEH A;  2DPU A;  2R7Q A;  2P8T A;  3ZQC A;  2HOS A;  3P9I A;  1A35 A;  2HS5 A;  2DN0 A;  2QQA A;  1W5T A;  1MBG A;  3D5R C;  3CMM A;  4B1R A;  3R60 A;  2K7L A;  4WCG A;  1TWA J;  1KYW A;  5L3B A;  2EIM H;  4C2T A;  1SAX A;  3VSK A;  1S6L A;  3DEU A;  5C44 J;  1JT0 A;  2EA2 A;  1MSF C;  4RGU A;  2VAS A;  2ELJ A;  3ROU A;  3FHN A;  5HLH A;  3KP4 A;  2QKM B;  4ENN A;  2KIQ A;  4KN7 X;  4HRI A;  2E1M B;  1OCR H;  2O7O A;  2PMH A;  2XGD A;  1N25 A;  3S3O A;  3LOC A;  1AWC A;  2F4I A;  2RKH A;  1LE8 B;  3S3M A;  5FKL A;  5JHU A;  2E5Z A;  4A6E A;  2JA8 J;  4U0Y A;  2DDB A;  1WJD A;  1YW8 A;  3KX2 A;  5EYR A;  3J80 Z;  1H89 C;  1OIS A;  1V3F A;  2VQC A;  2R93 J;  4A93 J;  3MZY A;  4BDY A;  3PIP F;  3Q5F A;  3H9J A;  1IXR C;  3MAJ A;  4PCQ A;  3PSF A;  2F5V A;  3EPZ A;  2OU2 A;  3KZZ A;  4N9H A;  2JTV A;  1FSE A;  4I6Z A;  1TW2 A;  4M6V A;  1OJL A;  5HOO A;  2JT1 A;  2M30 A;  3T8T A;  2DCE A;  1EH6 A; 
#chains in the Genus database with same CATH homology
 2EIK H;  3WG7 H;  2EIN H;  3AG2 H;  1V55 H;  2EIM H;  2DYR H;  2EIJ H;  3AG1 H;  2ZXW H;  3AG3 H;  5B1B H;  5B1A H;  1OCC H;  1OCZ H;  2DYS H;  3ABM H;  1OCO H;  2Y69 H;  1OCR H;  3ABK H;  3ASO H;  3ABL H;  3AG4 H;  5B3S H;  2EIL H;  3X2Q H;  2OCC H;  1V54 H;  3ASN H;  5IY5 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...