3X2QH

X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 24
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3x2qH00
1OCOH 3ABLH 1OCCH 1OCRH 2OCCH 3ABKH 2EIMH 5B1AH 5B1BH 3ABMH 2Y69H 3ASNH 3AG4H 3AG1H 2EIKH 1V55H 5IY5H 1OCZH 2DYSH 2DYRH 2EIJH 3ASOH 2EINH 3AG2H 3WG7H 2ZXWH 3X2QH 2EILH 5B3SH 3AG3H 1V54H
chains in the Genus database with same CATH superfamily
2QQ9A 5BPDA 1MSFC 2XGCA 3QPLA 2P5KA 2UUZA 5DCMA 2R7DA 3HHGA 5IT9K 2DJIA 4HX4A 1B9MA 4B8XA 5DD4A 4EMSA 4KISA 1XSVA 1QZYA 2UXNA 5JLWA 3CMEI 3L00A 3LA7A 2HU9A 5IYCJ 3EYYA 1MIJA 2CFOA 3NQOA 2R5YA 3R61A 3BG5A 2BY0A 1ERDA 2DA4A 4XM3A 2JSPA 2EZKA 2V26A 4CA0A 4F93B 5D6EA 4JBAA 5JR3A 3F22A 4Y33A 4BUPA 1FLIA 3VSKA 1IF1A 1BIBA 4B48A 1EH6A 1OYIA 4I99C 3ZMDA 4PFPA 1X58A 4KN7X 1MBKA 3RYRA 4W1UA 1BW6A 1WPKA 1WRJA 2P4WA 2K40A 1TBXA 1OKRA 4BQNA 2ETHA 1ZELA 3ZMSA 2Q2EA 5JVTA 1TP4A 1K7AA 1BL0A 2WY7Q 1MMDA 2VOPA 3HKZN 4ON0A 2E60A 3RZDJ 5C4XJ 1B1BA 4DNCA 3GVAA 2XF5A 2HKXA 2NNNA 1LUJB 2NOGA 2CRGA 2ZKZA 1YITI 1PVEA 4EJOA 4AIKA 5EJCA 3F23A 3HG9A 4X1EA 3AL0C 1YYVA 1LJ9A 3DKYA 1OYYA 2CQXA 1Z7LA 2VC0A 3DTEA 1JKPC 1D0XA 4RB0A 2EFOA 5GADJ 1TT0A 3LSIA 1BR4A 4OIRF 1NTCA 2KT0A 3FXMA 4UXNA 4H0EA 3CJTB 2DW4A 1K4SA 3GTKJ 2KIMA 1EH8A 2X85A 2KIUA 3JR9A 1D1BA 1FBQA 3FBIB 4QPOA 3U2RA 4G8XA 4QPQA 2YX4A 3K2ZA 2BOLA 4HBLA 4M6YA 4W97A 5TJJA 2M4GA 2X6XA 5EEAA 4BDYA 1B8IB 3LFUA 1UHMA 2WAFA 3K0LA 4XSXF 2K9SA 1W4MA 1USSA 2FXAA 2OBPA 4LFUA 5K5OA 5EGOB 2M30A 3LSRA 1WZ2A 2CW8A 3LA3A 4J19A 5EYRA 4IRGA 1V55H 2FBKA 3QPSA 4HX7A 3L2QA 2EBIA 3W6KB 4EJTA 1FC3A 1UG0A 3BTJA 3BZ6A 4JX5A 2EZHA 3VDXA 1I6XA 4A3GJ 1W5CC 2P0WA 2KIQA 1HF0A 1WHUA 5FGMA 3MD2A 4CHUA 4AD9A 4IF4A 3T1BA 1W5SA 2LG4A 2VXZA 2P5LC 1HSJA 4L5EA 4Z2YA 5FLXK 3NAUA 3RQ4A 1LEAA 4OIOF 1NG7A 2W24A 4LMYA 2PJRB 3E6MA 3MWMA 3J7AY 3Q0WA 4BXUA 3S8PA 2R0QC 1LFUP 4AIJA 3BR5A 1P2FA 4RGSA 4EVIA 4ZTJA 2XGDA 1I1GA 2XRLA 2AHQA 2LRDA 3OOPA 3V8LA 1YFHA 3HDDA 4ESFA 5KHDA 2FF4A 3GYHX 1BBYA 4IHYA 3MZYA 3F72A 1CF7B 1MD0A 1KZHA 1HDPA 3D0SA 3RI4A 1JJ8C 3AL0B 3IRQA 2ADUA 4G6QA 2L5QA 2IJLA 2LK2A 1I39A 3MCZA 3PQKA 2CUZA 1VQ5I 4EGYA 4Y3OA 4AVZA 3HPHA 1W1WE 3FDYA 4MHGA 4V2GA 2CSOA 2QGUA 1QHHD 2HXOA 3G1LA 2CUJA 2GXBA 3GTJJ 1RR7A 2R7WA 1D0YA 2QA4I 1XTAA 2LFBA 5HDNA 1Y0UA 3TP3A 1NH3A 4B3XA 2HPIA 2R3SA 1B4AA 2W25A 3OSFA 1T6SA 3BG7A 2DQRA 3VYTB 1W36D 1AWCA 4O3MA 5FFZA 3SDGA 2NVUB 3VYRB 2F4OB 2V9KA 1IUFA 2OQRA 1P7JA 1U8BA 2VKHA 2CS3A 3BQYA 3KP3A 3SHFA 3WHBA 2BBYA 5JFRA 3VYUB 2M9HA 5HODA 4BKXA 1ODDA 4BY1J 3SQNA 5C3EJ 2DJNA 2E7WA 3E5XA 2ZNYA 1UHWA 1A04A 3DF8A 1ZAOA 3SFZA 4KYWA 2BV6A 3J81Z 2NRAC 4B4CA 3LSTA 3PSIA 3ML6A 5LFAA 4A5NA 4EQQA 5EF6A 2ZXHA 1MMNA 1MNMC 1SD4A 3F0CA 4PJJA 1B59A 4RA2A 2NAZA 3LAPA 3FXOA 2L02A 4B09A 1O7FA 2OZ6A 2DODA 1LB2A 3JRHA 2O7OA 2STWA 2D45A 2LC2A 1BJAA 1CGPA 4U87A 4X6AJ 2HTSA 1UAAA 2XHKA 4L18B 1X1PA 2D5VA 2L7FP 2COBA 4RGUA 4IHSA 2FE3A 3HB9A 1K6OA 3FKIJ 2VONA 1YI2I 2F5FA 2W7NA 3TP0A 4PJ0C 4PUSA 1E3PA 3ZN0A 3LMMA 1R23A 2GOXB 2XAJA 3Q0UA 4XIDA 2DQLA 5ED4A 1RC9A 4CO8A 3OYFA 2EJRA 3HSRA 4MEYF 3N05A 2R7ZJ 1BIAA 3HOWJ 2XRNA 2EWNA 4DBQA 5D8KB 2FRHA 2M8GX 3J80K 1GXQA 1OR7C 3Q5FA 3L1PA 3V7CA 3L2RA 2MBFA 3BT9A 2P6TA 2EH3A 2EA2A 3ZQ7A 4IPAA 4A0XA 5E1ZB 4MQ9F 2HVSA 1OCOH 1X3UA 2E36A 3L7WA 2QLZA 1UELB 5FO5A 1UG2A 2L9SA 1T95A 1ZLKA 5K5RA 4UUVA 5B1AH 3CDIA 2RQQA 1Y8RB 1MDMA 4PFOA 3RDIA 3GTQJ 4XOPA 1BI2A 5HNFA 1EV7A 4UV8A 3HPGA 3LSKA 3FZVA 4Y7NJ 2VBWA 3FXKA 4WXDA 2YU3A 2X6WA 3J80Z 3BC8A 3RZOJ 2R5ZA 3KX2A 1XD7A 4YEJA 1OCTC 1JUMA 4JX6A 4NQWB 2Y0SN 2VQGA 3JSOA 2OPTA 4NC7A 4U7DA 4ZJZA 3CCUI 2OAZA 1O3TA 1WQ2A 3T0YA 2MYSA 2RDPA 3ASNH 5H20A 5JI6A 2HI3A 1DDNA 1QVUA 3A03A 1A6IA 2ELHA 4P5OA 2VJ5A 2YS9A 3MFKA 1VQ9I 2B0LA 4UUSB 3HC7A 4U0VA 3RJPA 3CESA 3WHCA 2E1NA 3CUQB 4CZCA 3H5RA 3HSEA 2HZTA 5J8CA 4UB6C 2RVCA 2JMWA 5KK1A 1DQUA 1RIOH 2PMZA 2QYOA 2X51A 3EETA 4P1WA 4CYCB 1ZYRF 3DPTA 1FTTA 3RKXA 3TO9A 4C3JJ 2BEOA 2AQEA 5E8GA 3FHZA 3S3OA 1SD6A 1OLTA 1RUOA 4BEHA 2PMHA 3CUOA 1Y56A 2A3SA 2BY2A 3KP4A 2STTA 5HS7A 4CYCA 2R93J 3G73A 3JTHA 1R4MB 4IRHA 2XASA 2DMTA 3G1OA 4XNFA 2K4JA 2M8EA 2VL8A 5AIQA 1VQLI 2P8TA 5EDNA 3NEUA 1WWXA 2XAHA 4BXFA 2FEZA 4E70A 5BQTA 4RB2C 4I76A 2LF7A 4YIRX 4NBQA 2KISA 4EEFG 4ENKA 4L9NA 1GDTA 3M4OJ 3JRIA 1APLC 4Q5SF 4OMYA 1TTYA 3S14J 4E7IA 3I0TA 2KLOA 4N9HA 2L7ZA 1F9NA 2E7XA 3H0GJ 4GRIA 1QU3A 3QOEA 3HSFA 4LIVA 1ON1A 1FMWA 3SXYA 2QEXI 2EINH 3KZIC 2KDOA 2XUBA 3WTTC 4IX7A 4EM1A 2WAQN 2M4KA 4IJAA 2F6CA 2DAOA 1ZGWA 5HLTA 3ZQGA 2ID3A 1SEUA 3GFLA 2QZ8A 1H88C 3MKLA 5CLSA 3H3VK 2H1KA 4RGRA 2VQLA 1Q1HA 4RM2A 2AXLA 1MJBA 2HQRA 1Z1DA 2V1NA 2BHZA 2OUMA 4KIFA 2IBDA 4KMFA 3GZNB 4PK4A 3OL4A 4LITA 3Q3SA 2PFBA 1Y1WJ 1Q1VA 3BR0A 3BG3A 1IV8A 2K85A 4HPQA 2YX7A 1FSEA 2F5EA 5C44J 1FOXA 4E6KG 3FISA 5L3EA 2FNPA 1KA8A 2ZJQF 3GCMA 1IRGA 1JT6A 4KMUX 3GEZA 1RNLA 4B44A 1D3YA 3TL4X 2EK5A 2TDXA 5JHFA 2OCCH 3C2GA 3LAJA 2A6HF 1LNWA 4KT5C 3W3CA 4AYBA 2VE8A 3QU6A 1MMAA 4EGZA 5TRDA 2JPBA 4U0WA 5DV5A 3OYMA 3E0JB 3BR3A 3BTLA 3M8EA 3O3KA 1JKRC 4I98B 2VBZA 1XDUA 1MMGA 1BW5A 3QODA 1ON2A 2R7SA 2V4JC 4CCOA 2CUFA 1UB9A 4LG0B 2JRMA 4AUXA 2BY1A 3PUFA 3KLOA 3I4NJ 1RZ4A 3GF2A 2VKDA 2CQKA 2M2EA 1KQ9A 3BCBA 3M07A 1E0EA 3OYCA 3GZ6A 3PNTA 5E8IA 4XN3A 3R6SA 5E1WA 2K5CA 4KN4X 1SFKA 4ZC3A 1BA5A 4CUGA 4N0BA 2ZMEC 3JTGA 1FBUA 2WA0A 4J01A 1LKXA 2BYVE 1LVAA 3K4NA 2B9SA 2XB5A 2GWRA 1A6QA 1JTXA 3K6GA 2HGCA 4EJWA 3A4CA 1MBFA 2GZWA 2LP0A 3GO5A 3TBIA 3ABKH 2JRTA 3PQJA 1VQOI 4EJVA 5KAFC 2RV8A 1UFMA 2PJRA 3IC7A 3GUDA 2VC1A 5JVGF 1DGWY 3K7AJ 1V5GA 2ME0A 5GAEJ 2LY2A 4DOZA 1UHSA 1K78A 3T8TA 2Z9OA 1W36C 2OC6A 2PBIA 3PO2J 2GAUA 4JP0A 1UZCA 1B72B 2GBYA 2OZUA 2UV1A 4ZDPA 1IXRC 3RKWA 3ZMZA 5IT3A 5FLXZ 4ZDLA 2KZGA 3P9KA 5L3BA 5IT9Z 3CC4I 4HF0A 2A6EF 1C0WA 4UHTA 4HW0A 3D5RC 2LMDA 4HRIA 1SD5A 2FA5A 4D5FA 1Z3XA 1XSXA 2CGPA 2O9LA 1KU2A 3H9JA 4BHBA 2DXIA 3G3ZA 2FNAA 4NC8A 4EJUA 2IGNA 4FASD 2F5VA 2K9NA 4II2A 3HTSB 2KL4A 1O57A 2OD5A 1OCCH 3BP8A 4D9JA 2BHYA 5GAHJ 2E2IJ 2DU9A 5LRRA 4BE2A 4AWXB 1ETOA 4HLXA 4E4HA 2X48A 3IRRA 1BI3A 3OSGA 2KJCA 1XGMA 4UVBA 2IVMA 1EKEA 1P6RA 4PSXA 3PO3J 2OU2A 5HDGA 3QPTA 2FOKA 3O2PE 2CMPA 3VODA 4II3A 2Y0SA 2DT6A 2V1XA 3GBGA 4NNJA 1HQCA 3E5UA 5HLGA 2LOOA 3ABTA 3GTMJ 3EUAA 3EYIA 4YG2F 1W5TA 1TC3C 3M7GA 2XSDC 2IGKA 3ZRGA 2P81A 3KP5A 1PUFA 5FB2A 1FPQA 3B73A 1FTZA 2Y31A 2P7CB 3AKZA 2FD5A 4IL6C 4F7ZA 3CO7C 1S5LC 2A61A 3E97A 1YO5C 4OAYA 5IOYA 3BROA 2MABA 5L3FA 1OCPA 4IRIA 2MC3A 4HV5A 2XB0X 4Z6YA 4AVPA 2DI3A 3I56I 4CICA 4WX9A 3CP2A 1T0FC 3HIFA 1GT0C 1SVLA 3DU5A 3TKYA 1JHFA 2K27A 2RNGA 2JA7J 1NK3P 1RKWA 1PP8F 3IHUA 4XONA 3LQQA 3L9FA 3HEFA 2JVGA 3MAJA 5F64A 4CXFA 3FXRA 3RYPA 2DN0A 1I5ZA 5HNHA 3C7JA 4IEJA 5L3GA 2KIFA 1L0OC 1P4XA 1K78B 4KITB 2NS0A 4CCJA 1T0FA 1P92A 3BR6A 1JUSA 2R7XA 1YW9A 3MN2A 1ENHA 4M9ZA 4C2MJ 4A5MA 1N77A 2QF7A 1K83J 5B5EC 4ENNA 1SVOA 3GFIA 1P4AA 2R7TA 4CCKA 2HYFA 2GQQA 2VT2A 1ZR4A 3VWBA 1WJBA 1JGGA 1H8AC 4ENJA 3NARA 4QTRA 2K4BA 3HRUA 4A3MJ 1VTNC 1LPQA 2CQNA 1JKQC 2GXAA 3WG9A 3V7RA 3IKTA 3P5JA 1LE8B 2VKVA 3Q9VA 3ZCOA 3WU2C 2GIVA 2IP2A 4Y15A 1HLVA 1E3OC 1P7IA 3TW6A 3CMYA 1JHHA 5J6XA 2YU9J 3FMRA 3QPHA 5GAGJ 2QQAA 1Y39A 5JHUA 3RIRA 3TDZC 4GDFA 4L9VA 4YIIA 1U5TA 3OY9A 4G6DA 2C6YA 4IOCF 3QWLA 3ZOBA 3HOXJ 3AG2H 3WG7H 1J75A 3S2DJ 4N4OB 4RB1A 3ZPLA 2HYJA 2ZJRF 4XRSG 2DMUA 1IO2A 2JUGA 2XKPA 4MQVA 3L2UA 2Q0OA 4C3IJ 3TGNA 2Q2EB 2BXZA 3AG1H 5CVUA 4OMZA 4DZJA 1IGNA 4LJZF 3DLLF 4L5IA 1JUPA 2VIXA 4LG3A 3K1PA 4N9IA 3QP5A 4A2UA 2A6TA 4ESJA 2W85A 5F0HA 2IS2A 1XSDA 1O3QA 4LLLA 4FHTA 4XLNF 1ULYA 1DGRM 3ABMH 1JT0A 1AU7A 4BHPA 4C2TA 5DCFA 2QENA 3K4JA 1VQPI 2E35A 5TGTA 2LSOA 4HSRA 2ICWG 3KEOA 4M72A 4P9UA 3P9CA 4YFNF 5J40A 4BAYA 1S6LA 5E18F 3DKXA 2XSJC 2K86A 4BQOA 3S17J 1MZBA 1FJLA 1VQ4I 1DUXC 3I71A 1W0TA 2V9PA 1D1CA 4AU7A 1NHAA 3OYIA 2PG4A 5A2QZ 3PIPF 2PMZN 1O7LA 4HSTA 3GX4X 3E6CC 2HPMA 3GFMA 5TISC 1RPWA 2DLLA 3O6BB 4HYEA 2LNBA 5H2FC 3F21A 4IO9F 4G6TB 1M1EB 4BJ6C 1IN4A 2M45A 5CYVA 2CU7A 2VODA 1Z6RA 2IS4A 5K7HA 2IS1A 1TNTA 1XDSA 2ELJA 4PJLA 3X2QH 5DTDA 3O8HA 3H35A 4DQ2A 2CW0F 2D1HA 4RGXA 3BTIA 1G8XA 5ICFA 2CH0A 3BQZA 5HLIA 4FTHA 2H8RA 4L5JA 2ZC2A 2G7UA 1U6GA 2ZMEB 4S05A 5DM6F 2LTPA 3H5NA 2LDUA 4BEHB 5KNLA 1R5GA 2ZJPF 2H27A 1S72I 3R60A 3BZCA 1X1AA 3D5SC 2E5NA 4FE4A 2DYRH 1X4OA 4WXHA 1PP7U 1ZARA 2QSHX 2LY1A 4M71A 2K9LA 4PSWA 1KU3A 1GHCA 1Z77A 3A01B 2GM4A 3A02A 2HFHA 4M73A 4YELA 3S1RJ 3SDBA 5ICGA 2JA8J 1YIOA 5EEHA 3QYEA 3MQ0A 4P9FA 4U7BA 2BZTA 2HEOA 1V5EA 3QAHA 2HDCA 2RGVA 1Z0XA 4HQMA 1IC8A 1FX7A 1Z6TA 4V19K 3K2AA 3CCMI 4LK1F 2H6BA 2F4MB 2CUEA 4A3IJ 4CZZA 3ZMVA 3F6OA 3TOAA 4C2UA 3QYBA 4A0YA 3CF2A 1MW7A 2WY8Q 4ZYGA 1PUFB 3ECHA 1FYLA 2CV0A 2QBYA 1I3AA 1D8KA 1IDZA 1FP2A 4X0GA 4WCGA 3KYDB 4O5VA 1WKMA 5CVJA 1ETQA 3DPLC 3K4MA 3JCUC 5FROA 3K69A 1FYKA 2NS7A 1ZLJA 3SFIA 2AS5F 4V2FA 5HS9A 2ZFWA 2PLYA 1HKSA 3CJNA 3NWSA 5E3MA 1WI9A 3CJQB 4A3CJ 2HVRA 3SZPA 3HUGB 1WJ5A 2JT1A 1MBGA 3DBRB 2KPMA 2KRCA 3W6VA 3JW4A 3J81K 2M5WA 3KZZA 1F43A 4XRFA 3SZGA 3BCAA 2R7RA 4Y52J 3F3XA 5D6FA 3MKWB 4BQAA 2ZSIB 3E7LA 4OIPF 3C18A 1A35A 5KVRA 3WTYC 2EA4A 5EZGA 1XG1A 5LGUA 1Z67A 1FWZA 2LKXA 2W4SA 5F1RA 3BR1A 5D5XB 1BC8C 4C9YA 3S1MJ 1H9GA 1XX5A 2M0MA 3DEEA 3RCOA 2V1DA 4M3GA 2KZVA 3OYBA 1QHGA 4KT6A 6PAXA 2IAIA 3R0AA 1QQIA 2E2HJ 3RTRA 5GTIC 2R5ZB 4BE1A 3CMMA 4XLEA 2R7UA 1WJCA 2MD5A 3FM5A 2F2EA 1GUUA 1QZEA 5J1YA 3ZQQA 1G3SA 4PGHA 3MKYB 2WBMA 1OCRH 2HQNA 2W48A 1G3YA 4LIUA 2IA2A 1SD7A 1YE9A 2E1MB 3BG6A 4PZJA 5B1BH 2PI0A 2EFWA 3GTPJ 1JI8A 3E1SA 3HRSA 3MEXA 3JRDA 3V7SA 3G6EI 4BDZA 3ZMTA 1IZ1A 4YRVA 2WTEA 2DA2A 4HNVA 3ZQIA 3DPUA 1U5TC 3VPRA 1D5VA 3EDPA 2MSYA 4NUBA 2X4HA 5BNGA 3L2CA 1DP3A 4XLFA 2Y0MA 2VKEA 5B3SH 3WTUC 3J7ZI 2Z1DA 3HOSA 3G1MA 2BVLA 4RLFA 4HOBA 2Q1ZB 3ZQLA 1DPUA 1AKHB 1XCVA 2AXTC 2OA4A 3HUGA 3KLNA 1DU0A 4H4KC 3WTVC 4M6VA 4GCVA 2BW3B 2HDDA 3FXJA 2XAGA 2VN2A 3B02A 3ZP5A 1Y0NA 1KONA 2XKOA 5DD8A 1ZK8A 3WODF 5DDGA 1G3TA 4Q47A 1IJWC 1E3HA 1QA6A 3CCQI 4DYCA 3DEWA 1X19A 2QKMB 3W2WA 2IPQX 3T8RA 1K61A 4UY8I 3BPVA 3CLQA 4ENMA 2O61A 5FFXA 3WTXC 3H5AA 5CVVA 5DUKA 2Y2ZA 4FETA 4ZZDA 3CZ6A 1E17A 1YOVB 2P6SA 4GXOA 1GVJA 5BPIA 2XV4S 4LLNA 1WJEA 3G71I 4U88A 5M5XJ 1BJZA 4IHXA 2LBFA 2WADA 5LGNA 2IXSA 2LREA 1YG2A 3FMQA 2EQRA 4TV7A 1ZRFA 4G7OF 3F8MA 2JN6A 3A0BC 1H0MA 5EZHA 4XSZF 2O8KA 4ZZLA 3ERED 3BG9A 3C2BA 4FISA 1HOMA 3DFGA 3J7YJ 2E5ZA 3PSFA 1Y1VJ 1R00A 3WTWC 1U2WA 3S2WA 1EH7A 5M3MJ 1YHQI 1GV2A 2DK5A 1I6HJ 2V7FA 1YW7A 3I55I 3OV8A 2CW7A 1WFXA 4PDKA 2IGMA 2HDWA 4R79A 2EV6A 1LDKB 3ECOA 3EQLF 3L2WA 2V6CA 4ESBA 4ZTFA 5IYDJ 1V3FA 5DM7F 4PJMA 2J5PA 3LWFA 3PFIA 5FD5A 3WGIA 1MJAA 4E7KA 3RPUD 3KEQA 4LB6B 1BI0A 5CPRB 4R8HA 1ONVA 5GPAA 3I5UA 3KPHA 2VOOA 1YLFA 4F91B 1TNSA 2O6GE 2IA0A 3K4LA 4MEXF 3QQAA 5FKOA 2YSRA 2L9NA 2KQRA 1B8IA 3CJRB 1I1SA 3CCVI 2HOTA 2G7HA 5F08A 3KEYA 2Y9YA 1J9IA 1W7PB 3BR2A 5EEGA 1D1AA 2EV5A 2LBFB 2O03A 1OJLA 2BW3A 2MD0A 1A36A 4P55A 5FKKA 4ZYAA 4ETSA 5CQEA 3FK6A 1WSUA 3HKZA 3CCEI 3FK7A 3D5LA 4CCNA 3D1NI 1MBEA 4RBOA 1SC7A 4KFCA 4MFEA 4M74A 1TWFJ 4AC0A 3R4KA 5E3OA 4CCMA 3CMAI 2HOEA 4KJZA 1FT9A 1ZGAA 1J7KA 5AONA 5K1YA 1KGSA 3OWTA 2RNJA 1SMYF 3F9KA 4WWCA 5LD2C 4E7LA 2FOWA 2ZSHB 4BBRJ 2M0CA 3V4GA 4CDGA 2VPLA 1U9NA 5FD6A 2LF8A 2XAUA 5BOXA 1FSHA 3S16J 4A93J 3VYSB 1R5ID 3F8CA 2IW5A 5ILUA 1R22A 2DMNA 5D4SA 2VI6A 2JPCA 1S7OA 2LKSA 3DTKA 3EPZA 2H09A 1S29A 3CUQC 2HS5A 2XF7A 2JQ7A 3QOPA 2MFZA 4J00A 3M8JA 2EIKH 1ZTRA 1OQYA 4Y17A 2W82A 2DA5A 4B43A 2BGCA 1J5YA 1LDJA 2RKHA 2EIJH 4XL9A 3PNVA 5E1XA 3GTLJ 2VPRA 3KETA 1HKTA 4BHCA 2EFPA 1B72A 1U9OA 2ZB9A 3OYLA 3IWFA 1XMAA 2ECCA 2NVQJ 3AG3H 5E3LA 5GPCA 1IW7F 1OFCX 1H9TA 2L3DA 2QKLB 3QRFF 3CUQA 1VQNI 1R1TA 5HVQC 1TWGJ 1T2KA 1ACIA 3ABUA 1Z91A 4LLGF 5JLXA 2ZXIA 4NQWA 2EFQA 3OIQA 1PUEE 1X1BA 4IZZA 1QZZA 1Z21A 3I58A 2LVSA 4BH9A 1BR1A 5LEKA 4IHVA 1ZRDA 2L7MP 1L3LA 1FIAA 1RI7A 5D8LB 4FCYA 1ETWA 3CC2I 3LSHA 4GO1A 2E19A 2VLAA 3IV5A 1FOKA 3AAFA 1Y6IA 2QBYB 2DPUA 5CVRA 1N78A 1QO0D 1O3SA 1MH4A 5J1UA 1A31A 3QP6A 4GYIA 3OYAA 5IOZA 3PL8A 3ASOH 1HW5A 3I59B 5HDKA 1XGNA 1HW1A 2JWTA 2H6CA 1DP7P 4YFXF 1FOWA 4FQGA 3ABLH 2CWEA 1SMTA 2LLKA 4UVCA 4QLCU 3HZJA 4JYKA 4XN0A 1TWAJ 1VZ0A 2I5UA 2FJ1A 2CFXA 5IPAA 3OS1A 2K9QA 1ORKA 4XORA 4DGWB 2DYSH 3ULQB 1J59A 1G59A 2CYYA 2ESNA 1QPIA 2UZKA 3KP7A 2HXIA 1IRZA 1TL8A 3VEPA 2X6YA 1B6AA 4JX4A 3IH2A 3SZTA 2Z16A 1YRNB 2HNHA 2VBYA 4R1HA 3DXJF 5LBQA 4I09A 3OYEA 2Z33A 4A3BJ 1ZR2A 2XGXA 2W84A 1ITYA 2L9RA 3MVPA 4MGRA 2P5VA 1ZG3A 1BOBA 2KJBA 4S0HB 1HBXG 4RLQA 2M1BA 4ZDOA 3BY6A 2QCOA 4M3FA 4ZYHA 3BLYA 1ZN2A 4F3QA 1VQ6I 1DU6A 2EZLA 2QM3A 4DIQA 1SANA 4FE7A 4GGGA 4IQ4A 1X1CA 1STZA 3OYDA 3HHHA 2A5YB 3FXLA 3L09A 5EG0A 3WTZA 5ILVA 2QVOA 1R5HA 3BZKA 1FBSA 3ROUA 2ZFUA 3TQNA 4A3KJ 2R92J 4G94A 5F0FA 2Y75A 3GXOA 3SYTA 2Y69H 1QRYA 3IH3A 3QYFA 4LG0A 3ZN1A 3CCJI 3FKJA 3Q9SA 4D1QA 4A12A 1O3RA 3IKVA 1AKHA 1R71A 1Z9CA 1OR7A 3I4MJ 4CCLA 4OWRB 2O0YA 2FQ4A 2L4MA 4XRMA 2LR8A 3JRAA 2PEXA 3SJMA 4ANJA 1R6RA 2TCTA 3TO6A 2WV1A 2TRTA 2E1MC 4IKFA 1ETVA 1BM9A 3VFZA 5HLHA 5M5YJ 1RUNA 4K2EA 4DYQA 2ISZA 2DA6A 2Z3YA 3K9TA 4BE0A 1EJ9A 1MNEA 4BYYA 3GTOJ 2FBIA 3RQIA 4D7MA 3FIWA 1NG6A 4CSWA 4HAMA 3E6BA 3ZXSA 3A0HC 2JSCA 4XKCA 1OPCA 4IOAF 2VXDA 3KYLA 2ME6A 5CJ9A 5FKNA 3HRTA 4PJNA 5B66C 2CV1A 1HC8A 1E2XA 2QQBA 3TOBA 2WB1N 2CO5A 3DWLE 3KP2A 2W1OA 2EB7A 1QGPA 4HQEA 2ZBKA 3CDLA 2K3FA 3E5QA 1SFOJ 1YRNA 3HOUJ 4EATA 1X2NA 4WK8F 2KMUA 5D4RA 2GOMA 4Y4RA 4D7NA 3DQVC 1U8RA 2LH9A 1XB4A 2DO7A 2VB6A 4U0YA 3JRGA 1A5JA 2DFEA 1U78A 4A3FJ 3EUKL 4M3BA 3V42A 2H1LA 4EM2A 3BWGA 1EA3A 1SVMA 2M7AA 4BU2A 1QVTA 3DU6A 1AOYA 3HOZJ 1GV5A 1X3WB 3HL2A 2QSFX 3CCRI 3CC7I 3OL3A 2Y48A 1V4RA 3U9GA 3VOEA 2OTJI 1BN5A 2ZMEA 4RAFA 3MMYB 5FLMJ 1VQ7I 3CP8A 2NYXA 1ZH5A 4IVNA 4NDLA 4BNCA 4XKBA 2WC2A 4XBFA 2BXYA 3JSPA 1OMIA 2HQ5A 4UVAA 5F27A 5E17F 2JA6J 2OQGA 4HZFA 1YX3A 5IP7J 4BACA 2FQ3A 5BMZA 1XN7A 2BY3A 4HEA2 5AIPA 1LEBA 3V8KA 1JTYA 3IUOA 2MH9A 4HF2A 2RC4A 4A3LJ 2GIZA 2XVCA 5DEQA 2CQ7A 1IXCA 3LSPA 5LHIA 2E1OA 3GLLA 4A3DJ 1TQMA 3SEZA 3TW7A 2A07F 4OOIA 1IRFA 3TO7A 1R36A 2GLOA 1W7PD 3FBNB 1ZRCA 3TMOA 1I27A 3K4CA 4LOCA 5KCMA 1GVDA 4F92B 4O6JA 5C4JJ 1PDNC 1J09A 4ZYDA 1FZPB 1VQKI 1T8IA 4NHJA 2NVYJ 4JK1X 5E79C 3HRMA 3NRVA 4YIFA 3PFYA 2R7VA 1XPXA 5D5UB 2NS8A 3ESWB 3LFKA 3S2HJ 5J4YA 1SFXA 1IRXA 2DOAA 2MGQA 1SAUA 3M8FA 2IS6A 4RB3C 2M7BA 5LRSA 5A2QK 4HDUA 3PUBA 4M9SA 2WAEA 1IDYA 1ZGJA 2HOSA 2XPVA 1WJFA 4RMNA 2RREA 1BI1A 3U21A 4QIWN 2DPDA 1XS9A 2J5OA 4L9TA 2L4AA 3CQZJ 2G0EA 3H1CA 3VB2A 4E7JA 4HA8A 3LL7A 3S1NJ 1S3JA 3M3YJ 5DYMA 2R4GA 4I0AA 3IH4A 3N97A 3OYJA 3DP7A 1YX5A 5ERIA 1HDDC 3DLAA 2ZXWH 3HGGA 2EILH 3UKGA 3FWEA 2PJPA 4BXXJ 4ASNA 3BTCA 3PJRA 2B7EA 3OR1C 3J7AO 2GA1A 2H8WA 1LFBA 2X1DA 3COAC 2F4IA 3KZYA 2DA3A 3LOCA 3E6DA 1ETYA 3BOQA 2VQHA 3G4SI 2E1CA 1R9TJ 1K79A 4WF2A 3ERMA 3WE2A 2V1UA 2R5YB 1XMXA 2A5WA 3C3WA 1REPC 1ZKGA 2WB1A 5GTHC 4ZH4F 2O5RA 4L9JA 3CD6I 3I59A 1UCRA 1IN7A 1BOAA 3T5XA 4RAYA 1BC7C 2IGOA 9ANTA 3F8NA 1HA8A 5J1RA 4RS8A 1WJDA 3U1DA 1W0UA 4IHWA 3LQRA 5H6RA 2MW8A 4AIHA 4LGWA 1JGSA 3Q0VA 1KQ0A 1WI3A 3AFHA 2CG4A 4M3EA 3JRCA 4FX4A 1LE8A 3S1QJ 2P7VB 3K1NA 2L7KA 3ZMUA 1N25A 4XLAA 5F04A 1XMKA 4MNUA 5FJ8J 4HLYA 3W6JB 2NXNB 1YQAA 4OU0A 2VBXA 4I02A 2Z99A 1F4KA 1VNDA 3OYGA 3ONQA 2NNYA 3I3LA 5CKTA 2NVTJ 2JJ7A 2OCEA 2CQQA 5CQGA 1TWHJ 2XC7A 3GZ5A 2OF7A 4A3JJ 3BJOA 5GP9A 5FKLA 3MZ8A 1GXPA 1H89C 3H3UA 2F5DA 3DKWA 2LYCA 1HSTA 5DUIA 1GLNA 1Y8QB 2BE5F 3FX3A 1X1DA 1LQ1A 3F8BA 2A69F 1MSEC 2X9DA 1V5FA 3HOTA 1XGOA 1U0JA 5F1JA 2MG4A 4EM0B 1Z3YA 3I53A 4XQFA 3CDHA 1T08B 2ZNZA 4Y13A 4CGZA 3PNYA 4G7ZF 4F55A 1YS7A 1VI0A 3ZQHA 3K10A 3H3ZA 3K4KA 1POGA 3KYCB 3EUHC 2JA5J 2DA1A 3QU3A 3K70C 2XF6A 2DTRA 2HVQA 2DMQA 1MDMB 2IA1A 5L3CA 1FNNA 1IAWA 1OCZH 2JUCA 2HYGD 1F5TA 2FX0A 2E71A 4MFDA 2GXGA 2ECBA 4RM3A 2DFFA 4YFKF 2XPUA 2Z2SB 1TW3A 1FOYA 1K6YA 5EG0B 3WGGA 2XROA 2ACJA 3IAS2 1X2MA 1UJ8A 4OINF 1T56A 2VE9A 5FRMA 1EF4A 1IV6A 3HTUA 5LGTA 3FM3A 1WVRA 2Y30A 1YJ9I 2L54A 3S15J 4G12A 1IUYA 3JRFA 2EZIA 2M3AA 3DTIA 4AIDA 4D5CA 3BJ6A 1MGTA 4A6EA 1OISA 3ELKA 2HOAA 4BY7J 3CO6C 5M3FJ 1ETKA 2M87A 2IRFG 3M9AA 3HOVJ 3RPUA 2CV2A 2FMYA 3JRBA 5FRNA 3RKYA 1KYWA 4ITVA 2QUFA 1WJAA 4PCQA 3F8FA 1MNDA 1YTYA 1U5TB 3OYHA 1XC5A 2V9VA 3GMEA 3ISPA 1Z7UA 1ZG5A 1TT5B 1XGSA 2X0LA 3K70D 3N4MA 2XDVA 1NK2P 1R58A 1TWCJ 4FX0A 1K4TA 2DMPA 2ID6A 2JA2A 1OYWA 1KU9A 1SFEA 3C2HA 3K1MA 4HX8A 3PIOF 1IG7A 1FY7A 3E3VA 2I10A 3LSMA 1TQIA 2K7LA 2DT5A 4E7ZA 4IQJA 3F6VA 2R7OA 1RR8C 5ICCA 1RKTA 1Z05A 1JJ6C 1YW8A 4A0ZA 2X6OA 4MTEA 5ILSA 3H92A 1B9NA 3GFJA 1D5YA 2UXXA 2YUSA 1AA7A 2A05A 2NVXJ 2HQAA 4N4NB 3A1YA 3BDDA 1X4PA 4C3HJ 4IHTA 3BPXA 2M34A 1HXDA 3I9V2 1MJ9A 1S7EA 1VQ8I 4DZPA 5M5WJ 3EUHA 1YS6A 4G9YA 5HS8A 3ZGKA 3REOA 2V79A 3S93A 4XICA 4KICA 2O3FA 3H0DA 1AHDP 3OR2C 1G3WA 3IWZA 3BJAA 2K9MA 3DBHB 2JZYA 1YIJI 3S3NA 2X1EA 1O4XA 3LA2A 4KUMA 2H94A 1F36A 2EIMH 5IYBJ 2W57A 3P9IA 1ZG1A 3H9QA 1ZQ3P 3NWTA 3GLXA 2R7QA 4OAZA 3TDUC 2WAQA 1RETA 3B6CA 2X1CA 1IN8A 5J3LA 3C1DA 4BJTA 5LHGA 4JOMA 4D0PA 1CQTA 5FLVA 4HDVA 1TW2A 2ZCWA 5BS6A 1S8NA 2YR2A 4IXAA 1YJNI 2LKPA 5CVIA 4BQQA 2WWYA 3LSGA 2HR3A 2PMUA 4RAGA 5FKMA 4M9XA 2OJED 4A6DA 4RDUA 3JAMZ 4I6ZA 5EGOA 2ISYA 1G4DA 4RAZA 2MC4A 4A3EJ 2LY9A 2XIGA 1D8JA 4I2OA 3P7NA 5IP6A 2KP6A 3I54A 2ELKA 2JK3A 3GW2A 5DCMB 4GFBA 3HOYJ 2HZDA 5K5QA 3ZR8X 2XPWA 1R7JA 2XAFA 3RKQA 4KIBA 2WV0A 1IN6A 2AQFA 3VSLA 3OS2A 1BR2A 4MLOA 5D5VB 4BS9A 2JVHA 2VT3A 4XLCA 3CCYA 3A01A 2VQCA 1LFPA 3WGHA 2A68F 2D2WA 4ABZA 2N8GA 4DW6A 1P9QC 5L3DA 4B3AA 4UNOA 1F1ZA 2OTLI 2K02A 4HNUA 1LVKA 3HGYA 3WE3A 4I01A 1KQ8A 5ICEA 3DV8A 2F5CA 1WH7A 2O8XA 3OIOA 1V54H 3CTAA 2E2JJ 1LDDA 2KKOA 1JE8A 4E7HA 2UWMA 1T38A 1TQPA 3SEQA 4KDPA 2Y9ZA 2FBHA 2EV0A 3KFWX 4F52A 2NOJB 4NB5A 4NC6A 3AG4H 2PX9A 4MTDA 1KYZA 4P96A 4KNYA 5J8FA 2R7FA 3UR3C 2KRHA 3FXQA 2DFIA 2FSWA 2EPFA 3CLOA 1RESA 3R0JA 3HXLA 4G7HF 4I7HA 3CCLI 5KAIC 2QWWA 4BL0B 2KFDA 1FMVA 1S9HA 3MKZA 2Q8KA 3I4PA 3FHNA 3OOUA 4AM3A 2MLGA 2ZXJA 1JXSA 1WCMJ 1DPRA 2AO9A 3FXUA 4HNTA 1W7PA 2D1VA 4DYRA 1PYVA 1YJWI 3OS0A 1I3QJ 4XLPF 2DTZA 3G2BA 5F0CA 4EV0A 3KIOA 4UV9A 3S32A 1FEXA 2I8DA 3WTSC 2KRFA 5E3NA 1VFCA 5H6QA 2DOEA 3KCCA 3ZQCA 1VQMI 1R4NB 1X3ZB 1TLHB 3RPQA 5K7FA 4OIQF 3DEUA 4LK0F 2DDAA 3S3MA 2K3PA 4Q48A 1JKOC 1HW2A 1MKMA 1UMQA 2GA2A 4XR6A 4HV6A 2MA3A 3IAM2 4XMYA 4WXCA 3FF5A 4BBSJ 4DBRA 1R1VA 1USTA 4LB5A 2FU4A 1CF7A 4I0BA 4L0YB 3HYIA 1S7AA 1IN5A 1WGXA 1QPMA 2FMLA 2BVMA 3WU1B 3IP4B 3OYNA 2HKOA 1QBJA 2ESHA 1XCBA 2DBBA 3O8GA 4XKWA 3LNQA 2VJIA 2IEKA 1J2XA 2DK8A 4XLHA 4KIGA 2XAQA 5LLQA 1IXSB 3V8JA 1ZREA 4E7SA 4AYBN 1P4WA 2PQ8A 3WU0A 1MMSA 1T33A 3GWZA 3CF5F 2CJJA 3W2VA 2E34A 3HJEA 3MZHA 1I50J 2PN6A 3B6AA 4S04A 2ZJ2A 1VF9A 2DT7B 2QSGX 5LEJA 2W00A 4HG2A 2YPRA 5F6FA 3A2KA 4MIMA 1SAXA 4M6XA 3JREA 4FT8A 3L2VA 4XOTA 2L9VA 1G2HA 2L2OA 3OIPA 3DCFA 4GYGA 3KP6A 3KE2A 2KHMA 5IP9J 2RN7A 1MH3A 2OV7A 2L0KA 3GTGJ 4MO7A 2IT0A 2XGEA 2ZO4A 1T98A 1WH5A 2VJJA 4C30A 1QNTA 3TEDA 2KDZA 3JAMK 1RRJA 3UNGC 1N75A 2DOFA 3PM1A 1MBJA 2MH2A 2DDBA 4KA4A 4CYDA 2FUG2 1FIPA 2F48A 1FP1D 2EFNA 1KU7A 2DFHA 5J4VA 4LD5A 4L0ZB 5DS9A 1T39A 4UUTA 5E20A 5IY5H 3OYKA 4A69C 5D5WB 2DA7A 4QWQA 2Z5UA 2G9WA 4ZYEA 2LD5A 4QSHA 4XRSA 1U3EM 4UUSA 4XK4A 3HBLA 3DBLB 3M1EA 5HOOA 3ZQFA 3FMSA 1J0RA 4HF1A 5LHHA 1G6NA 4B47A 3M1CA 4BGDA 3HM5A 3IL2A 3W2AA 2VJ4A 2COMA 4B1RA 4BJ5C 3H36A 2VASA 2QQ8A 4JQFA 2RAEA 3RSNA 3CCSI 2HTJA 2HWVA 1SFUA 2V6EA 2DCEA 1R49A 3H9GA 4CH7A 1TZLA 2MLKA 3OMYA 3LSJA 1FYMA 3K4BA 1HCRA 2B63J 3U1KA 1D0ZA 4UB8C 4M3DA 4PGGA 1ETXA 3I64A 5J47A 1HKQA 4XKVA 1R1UA 4Q4ZF 2RQPA 2VUMJ 1MBHA 4DJAA 2JTVA 5K7ZA 2L01A 1ZHFA 1PJRA
chains in the Genus database with same CATH topology
1OCOH 3ABLH 1OCCH 1OCRH 2OCCH 3ABKH 2EIMH 5B1AH 5B1BH 3ABMH 2Y69H 3ASNH 3AG4H 3AG1H 2EIKH 1V55H 5IY5H 1OCZH 2DYSH 2DYRH 2EIJH 3ASOH 2EINH 3AG2H 3WG7H 2ZXWH 3X2QH 2EILH 5B3SH 3AG3H 1V54H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCO H;  3ABL H;  1OCC H;  1OCR H;  2OCC H;  3ABK H;  2EIM H;  5B1A H;  5B1B H;  3ABM H;  2Y69 H;  3ASN H;  3AG4 H;  3AG1 H;  2EIK H;  1V55 H;  5IY5 H;  1OCZ H;  2DYS H;  2DYR H;  2EIJ H;  3ASO H;  2EIN H;  3AG2 H;  3WG7 H;  2ZXW H;  3X2Q H;  2EIL H;  5B3S H;  3AG3 H;  1V54 H; 
#chains in the Genus database with same CATH topology
 2QQ9 A;  5BPD A;  1MSF C;  2XGC A;  3QPL A;  2P5K A;  2UUZ A;  5DCM A;  2R7D A;  3HHG A;  5IT9 K;  2DJI A;  4HX4 A;  1B9M A;  4B8X A;  5DD4 A;  4EMS A;  4KIS A;  1XSV A;  1QZY A;  2UXN A;  5JLW A;  3CME I;  3L00 A;  3LA7 A;  2HU9 A;  5IYC J;  3EYY A;  1MIJ A;  2CFO A;  3NQO A;  2R5Y A;  3R61 A;  3BG5 A;  2BY0 A;  1ERD A;  2DA4 A;  4XM3 A;  2JSP A;  2EZK A;  2V26 A;  4CA0 A;  4F93 B;  5D6E A;  4JBA A;  5JR3 A;  3F22 A;  4Y33 A;  4BUP A;  1FLI A;  3VSK A;  1IF1 A;  1BIB A;  4B48 A;  1EH6 A;  1OYI A;  4I99 C;  3ZMD A;  4PFP A;  1X58 A;  4KN7 X;  1MBK A;  3RYR A;  4W1U A;  1BW6 A;  1WPK A;  1WRJ A;  2P4W A;  2K40 A;  1TBX A;  1OKR A;  4BQN A;  2ETH A;  1ZEL A;  3ZMS A;  2Q2E A;  5JVT A;  1TP4 A;  1K7A A;  1BL0 A;  2WY7 Q;  1MMD A;  2VOP A;  3HKZ N;  4ON0 A;  2E60 A;  3RZD J;  5C4X J;  1B1B A;  4DNC A;  3GVA A;  2XF5 A;  2HKX A;  2NNN A;  1LUJ B;  2NOG A;  2CRG A;  2ZKZ A;  1YIT I;  1PVE A;  4EJO A;  4AIK A;  5EJC A;  3F23 A;  3HG9 A;  4X1E A;  3AL0 C;  1YYV A;  1LJ9 A;  3DKY A;  1OYY A;  2CQX A;  1Z7L A;  2VC0 A;  3DTE A;  1JKP C;  1D0X A;  4RB0 A;  2EFO A;  5GAD J;  1TT0 A;  3LSI A;  1BR4 A;  4OIR F;  1NTC A;  2KT0 A;  3FXM A;  4UXN A;  4H0E A;  3CJT B;  2DW4 A;  1K4S A;  3GTK J;  2KIM A;  1EH8 A;  2X85 A;  2KIU A;  3JR9 A;  1D1B A;  1FBQ A;  3FBI B;  4QPO A;  3U2R A;  4G8X A;  4QPQ A;  2YX4 A;  3K2Z A;  2BOL A;  4HBL A;  4M6Y A;  4W97 A;  5TJJ A;  2M4G A;  2X6X A;  5EEA A;  4BDY A;  1B8I B;  3LFU A;  1UHM A;  2WAF A;  3K0L A;  4XSX F;  2K9S A;  1W4M A;  1USS A;  2FXA A;  2OBP A;  4LFU A;  5K5O A;  5EGO B;  2M30 A;  3LSR A;  1WZ2 A;  2CW8 A;  3LA3 A;  4J19 A;  5EYR A;  4IRG A;  1V55 H;  2FBK A;  3QPS A;  4HX7 A;  3L2Q A;  2EBI A;  3W6K B;  4EJT A;  1FC3 A;  1UG0 A;  3BTJ A;  3BZ6 A;  4JX5 A;  2EZH A;  3VDX A;  1I6X A;  4A3G J;  1W5C C;  2P0W A;  2KIQ A;  1HF0 A;  1WHU A;  5FGM A;  3MD2 A;  4CHU A;  4AD9 A;  4IF4 A;  3T1B A;  1W5S A;  2LG4 A;  2VXZ A;  2P5L C;  1HSJ A;  4L5E A;  4Z2Y A;  5FLX K;  3NAU A;  3RQ4 A;  1LEA A;  4OIO F;  1NG7 A;  2W24 A;  4LMY A;  2PJR B;  3E6M A;  3MWM A;  3J7A Y;  3Q0W A;  4BXU A;  3S8P A;  2R0Q C;  1LFU P;  4AIJ A;  3BR5 A;  1P2F A;  4RGS A;  4EVI A;  4ZTJ A;  2XGD A;  1I1G A;  2XRL A;  2AHQ A;  2LRD A;  3OOP A;  3V8L A;  1YFH A;  3HDD A;  4ESF A;  5KHD A;  2FF4 A;  3GYH X;  1BBY A;  4IHY A;  3MZY A;  3F72 A;  1CF7 B;  1MD0 A;  1KZH A;  1HDP A;  3D0S A;  3RI4 A;  1JJ8 C;  3AL0 B;  3IRQ A;  2ADU A;  4G6Q A;  2L5Q A;  2IJL A;  2LK2 A;  1I39 A;  3MCZ A;  3PQK A;  2CUZ A;  1VQ5 I;  4EGY A;  4Y3O A;  4AVZ A;  3HPH A;  1W1W E;  3FDY A;  4MHG A;  4V2G A;  2CSO A;  2QGU A;  1QHH D;  2HXO A;  3G1L A;  2CUJ A;  2GXB A;  3GTJ J;  1RR7 A;  2R7W A;  1D0Y A;  2QA4 I;  1XTA A;  2LFB A;  5HDN A;  1Y0U A;  3TP3 A;  1NH3 A;  4B3X A;  2HPI A;  2R3S A;  1B4A A;  2W25 A;  3OSF A;  1T6S A;  3BG7 A;  2DQR A;  3VYT B;  1W36 D;  1AWC A;  4O3M A;  5FFZ A;  3SDG A;  2NVU B;  3VYR B;  2F4O B;  2V9K A;  1IUF A;  2OQR A;  1P7J A;  1U8B A;  2VKH A;  2CS3 A;  3BQY A;  3KP3 A;  3SHF A;  3WHB A;  2BBY A;  5JFR A;  3VYU B;  2M9H A;  5HOD A;  4BKX A;  1ODD A;  4BY1 J;  3SQN A;  5C3E J;  2DJN A;  2E7W A;  3E5X A;  2ZNY A;  1UHW A;  1A04 A;  3DF8 A;  1ZAO A;  3SFZ A;  4KYW A;  2BV6 A;  3J81 Z;  2NRA C;  4B4C A;  3LST A;  3PSI A;  3ML6 A;  5LFA A;  4A5N A;  4EQQ A;  5EF6 A;  2ZXH A;  1MMN A;  1MNM C;  1SD4 A;  3F0C A;  4PJJ A;  1B59 A;  4RA2 A;  2NAZ A;  3LAP A;  3FXO A;  2L02 A;  4B09 A;  1O7F A;  2OZ6 A;  2DOD A;  1LB2 A;  3JRH A;  2O7O A;  2STW A;  2D45 A;  2LC2 A;  1BJA A;  1CGP A;  4U87 A;  4X6A J;  2HTS A;  1UAA A;  2XHK A;  4L18 B;  1X1P A;  2D5V A;  2L7F P;  2COB A;  4RGU A;  4IHS A;  2FE3 A;  3HB9 A;  1K6O A;  3FKI J;  2VON A;  1YI2 I;  2F5F A;  2W7N A;  3TP0 A;  4PJ0 C;  4PUS A;  1E3P A;  3ZN0 A;  3LMM A;  1R23 A;  2GOX B;  2XAJ A;  3Q0U A;  4XID A;  2DQL A;  5ED4 A;  1RC9 A;  4CO8 A;  3OYF A;  2EJR A;  3HSR A;  4MEY F;  3N05 A;  2R7Z J;  1BIA A;  3HOW J;  2XRN A;  2EWN A;  4DBQ A;  5D8K B;  2FRH A;  2M8G X;  3J80 K;  1GXQ A;  1OR7 C;  3Q5F A;  3L1P A;  3V7C A;  3L2R A;  2MBF A;  3BT9 A;  2P6T A;  2EH3 A;  2EA2 A;  3ZQ7 A;  4IPA A;  4A0X A;  5E1Z B;  4MQ9 F;  2HVS A;  1OCO H;  1X3U A;  2E36 A;  3L7W A;  2QLZ A;  1UEL B;  5FO5 A;  1UG2 A;  2L9S A;  1T95 A;  1ZLK A;  5K5R A;  4UUV A;  5B1A H;  3CDI A;  2RQQ A;  1Y8R B;  1MDM A;  4PFO A;  3RDI A;  3GTQ J;  4XOP A;  1BI2 A;  5HNF A;  1EV7 A;  4UV8 A;  3HPG A;  3LSK A;  3FZV A;  4Y7N J;  2VBW A;  3FXK A;  4WXD A;  2YU3 A;  2X6W A;  3J80 Z;  3BC8 A;  3RZO J;  2R5Z A;  3KX2 A;  1XD7 A;  4YEJ A;  1OCT C;  1JUM A;  4JX6 A;  4NQW B;  2Y0S N;  2VQG A;  3JSO A;  2OPT A;  4NC7 A;  4U7D A;  4ZJZ A;  3CCU I;  2OAZ A;  1O3T A;  1WQ2 A;  3T0Y A;  2MYS A;  2RDP A;  3ASN H;  5H20 A;  5JI6 A;  2HI3 A;  1DDN A;  1QVU A;  3A03 A;  1A6I A;  2ELH A;  4P5O A;  2VJ5 A;  2YS9 A;  3MFK A;  1VQ9 I;  2B0L A;  4UUS B;  3HC7 A;  4U0V A;  3RJP A;  3CES A;  3WHC A;  2E1N A;  3CUQ B;  4CZC A;  3H5R A;  3HSE A;  2HZT A;  5J8C A;  4UB6 C;  2RVC A;  2JMW A;  5KK1 A;  1DQU A;  1RIO H;  2PMZ A;  2QYO A;  2X51 A;  3EET A;  4P1W A;  4CYC B;  1ZYR F;  3DPT A;  1FTT A;  3RKX A;  3TO9 A;  4C3J J;  2BEO A;  2AQE A;  5E8G A;  3FHZ A;  3S3O A;  1SD6 A;  1OLT A;  1RUO A;  4BEH A;  2PMH A;  3CUO A;  1Y56 A;  2A3S A;  2BY2 A;  3KP4 A;  2STT A;  5HS7 A;  4CYC A;  2R93 J;  3G73 A;  3JTH A;  1R4M B;  4IRH A;  2XAS A;  2DMT A;  3G1O A;  4XNF A;  2K4J A;  2M8E A;  2VL8 A;  5AIQ A;  1VQL I;  2P8T A;  5EDN A;  3NEU A;  1WWX A;  2XAH A;  4BXF A;  2FEZ A;  4E70 A;  5BQT A;  4RB2 C;  4I76 A;  2LF7 A;  4YIR X;  4NBQ A;  2KIS A;  4EEF G;  4ENK A;  4L9N A;  1GDT A;  3M4O J;  3JRI A;  1APL C;  4Q5S F;  4OMY A;  1TTY A;  3S14 J;  4E7I A;  3I0T A;  2KLO A;  4N9H A;  2L7Z A;  1F9N A;  2E7X A;  3H0G J;  4GRI A;  1QU3 A;  3QOE A;  3HSF A;  4LIV A;  1ON1 A;  1FMW A;  3SXY A;  2QEX I;  2EIN H;  3KZI C;  2KDO A;  2XUB A;  3WTT C;  4IX7 A;  4EM1 A;  2WAQ N;  2M4K A;  4IJA A;  2F6C A;  2DAO A;  1ZGW A;  5HLT A;  3ZQG A;  2ID3 A;  1SEU A;  3GFL A;  2QZ8 A;  1H88 C;  3MKL A;  5CLS A;  3H3V K;  2H1K A;  4RGR A;  2VQL A;  1Q1H A;  4RM2 A;  2AXL A;  1MJB A;  2HQR A;  1Z1D A;  2V1N A;  2BHZ A;  2OUM A;  4KIF A;  2IBD A;  4KMF A;  3GZN B;  4PK4 A;  3OL4 A;  4LIT A;  3Q3S A;  2PFB A;  1Y1W J;  1Q1V A;  3BR0 A;  3BG3 A;  1IV8 A;  2K85 A;  4HPQ A;  2YX7 A;  1FSE A;  2F5E A;  5C44 J;  1FOX A;  4E6K G;  3FIS A;  5L3E A;  2FNP A;  1KA8 A;  2ZJQ F;  3GCM A;  1IRG A;  1JT6 A;  4KMU X;  3GEZ A;  1RNL A;  4B44 A;  1D3Y A;  3TL4 X;  2EK5 A;  2TDX A;  5JHF A;  2OCC H;  3C2G A;  3LAJ A;  2A6H F;  1LNW A;  4KT5 C;  3W3C A;  4AYB A;  2VE8 A;  3QU6 A;  1MMA A;  4EGZ A;  5TRD A;  2JPB A;  4U0W A;  5DV5 A;  3OYM A;  3E0J B;  3BR3 A;  3BTL A;  3M8E A;  3O3K A;  1JKR C;  4I98 B;  2VBZ A;  1XDU A;  1MMG A;  1BW5 A;  3QOD A;  1ON2 A;  2R7S A;  2V4J C;  4CCO A;  2CUF A;  1UB9 A;  4LG0 B;  2JRM A;  4AUX A;  2BY1 A;  3PUF A;  3KLO A;  3I4N J;  1RZ4 A;  3GF2 A;  2VKD A;  2CQK A;  2M2E A;  1KQ9 A;  3BCB A;  3M07 A;  1E0E A;  3OYC A;  3GZ6 A;  3PNT A;  5E8I A;  4XN3 A;  3R6S A;  5E1W A;  2K5C A;  4KN4 X;  1SFK A;  4ZC3 A;  1BA5 A;  4CUG A;  4N0B A;  2ZME C;  3JTG A;  1FBU A;  2WA0 A;  4J01 A;  1LKX A;  2BYV E;  1LVA A;  3K4N A;  2B9S A;  2XB5 A;  2GWR A;  1A6Q A;  1JTX A;  3K6G A;  2HGC A;  4EJW A;  3A4C A;  1MBF A;  2GZW A;  2LP0 A;  3GO5 A;  3TBI A;  3ABK H;  2JRT A;  3PQJ A;  1VQO I;  4EJV A;  5KAF C;  2RV8 A;  1UFM A;  2PJR A;  3IC7 A;  3GUD A;  2VC1 A;  5JVG F;  1DGW Y;  3K7A J;  1V5G A;  2ME0 A;  5GAE J;  2LY2 A;  4DOZ A;  1UHS A;  1K78 A;  3T8T A;  2Z9O A;  1W36 C;  2OC6 A;  2PBI A;  3PO2 J;  2GAU A;  4JP0 A;  1UZC A;  1B72 B;  2GBY A;  2OZU A;  2UV1 A;  4ZDP A;  1IXR C;  3RKW A;  3ZMZ A;  5IT3 A;  5FLX Z;  4ZDL A;  2KZG A;  3P9K A;  5L3B A;  5IT9 Z;  3CC4 I;  4HF0 A;  2A6E F;  1C0W A;  4UHT A;  4HW0 A;  3D5R C;  2LMD A;  4HRI A;  1SD5 A;  2FA5 A;  4D5F A;  1Z3X A;  1XSX A;  2CGP A;  2O9L A;  1KU2 A;  3H9J A;  4BHB A;  2DXI A;  3G3Z A;  2FNA A;  4NC8 A;  4EJU A;  2IGN A;  4FAS D;  2F5V A;  2K9N A;  4II2 A;  3HTS B;  2KL4 A;  1O57 A;  2OD5 A;  1OCC H;  3BP8 A;  4D9J A;  2BHY A;  5GAH J;  2E2I J;  2DU9 A;  5LRR A;  4BE2 A;  4AWX B;  1ETO A;  4HLX A;  4E4H A;  2X48 A;  3IRR A;  1BI3 A;  3OSG A;  2KJC A;  1XGM A;  4UVB A;  2IVM A;  1EKE A;  1P6R A;  4PSX A;  3PO3 J;  2OU2 A;  5HDG A;  3QPT A;  2FOK A;  3O2P E;  2CMP A;  3VOD A;  4II3 A;  2Y0S A;  2DT6 A;  2V1X A;  3GBG A;  4NNJ A;  1HQC A;  3E5U A;  5HLG A;  2LOO A;  3ABT A;  3GTM J;  3EUA A;  3EYI A;  4YG2 F;  1W5T A;  1TC3 C;  3M7G A;  2XSD C;  2IGK A;  3ZRG A;  2P81 A;  3KP5 A;  1PUF A;  5FB2 A;  1FPQ A;  3B73 A;  1FTZ A;  2Y31 A;  2P7C B;  3AKZ A;  2FD5 A;  4IL6 C;  4F7Z A;  3CO7 C;  1S5L C;  2A61 A;  3E97 A;  1YO5 C;  4OAY A;  5IOY A;  3BRO A;  2MAB A;  5L3F A;  1OCP A;  4IRI A;  2MC3 A;  4HV5 A;  2XB0 X;  4Z6Y A;  4AVP A;  2DI3 A;  3I56 I;  4CIC A;  4WX9 A;  3CP2 A;  1T0F C;  3HIF A;  1GT0 C;  1SVL A;  3DU5 A;  3TKY A;  1JHF A;  2K27 A;  2RNG A;  2JA7 J;  1NK3 P;  1RKW A;  1PP8 F;  3IHU A;  4XON A;  3LQQ A;  3L9F A;  3HEF A;  2JVG A;  3MAJ A;  5F64 A;  4CXF A;  3FXR A;  3RYP A;  2DN0 A;  1I5Z A;  5HNH A;  3C7J A;  4IEJ A;  5L3G A;  2KIF A;  1L0O C;  1P4X A;  1K78 B;  4KIT B;  2NS0 A;  4CCJ A;  1T0F A;  1P92 A;  3BR6 A;  1JUS A;  2R7X A;  1YW9 A;  3MN2 A;  1ENH A;  4M9Z A;  4C2M J;  4A5M A;  1N77 A;  2QF7 A;  1K83 J;  5B5E C;  4ENN A;  1SVO A;  3GFI A;  1P4A A;  2R7T A;  4CCK A;  2HYF A;  2GQQ A;  2VT2 A;  1ZR4 A;  3VWB A;  1WJB A;  1JGG A;  1H8A C;  4ENJ A;  3NAR A;  4QTR A;  2K4B A;  3HRU A;  4A3M J;  1VTN C;  1LPQ A;  2CQN A;  1JKQ C;  2GXA A;  3WG9 A;  3V7R A;  3IKT A;  3P5J A;  1LE8 B;  2VKV A;  3Q9V A;  3ZCO A;  3WU2 C;  2GIV A;  2IP2 A;  4Y15 A;  1HLV A;  1E3O C;  1P7I A;  3TW6 A;  3CMY A;  1JHH A;  5J6X A;  2YU9 J;  3FMR A;  3QPH A;  5GAG J;  2QQA A;  1Y39 A;  5JHU A;  3RIR A;  3TDZ C;  4GDF A;  4L9V A;  4YII A;  1U5T A;  3OY9 A;  4G6D A;  2C6Y A;  4IOC F;  3QWL A;  3ZOB A;  3HOX J;  3AG2 H;  3WG7 H;  1J75 A;  3S2D J;  4N4O B;  4RB1 A;  3ZPL A;  2HYJ A;  2ZJR F;  4XRS G;  2DMU A;  1IO2 A;  2JUG A;  2XKP A;  4MQV A;  3L2U A;  2Q0O A;  4C3I J;  3TGN A;  2Q2E B;  2BXZ A;  3AG1 H;  5CVU A;  4OMZ A;  4DZJ A;  1IGN A;  4LJZ F;  3DLL F;  4L5I A;  1JUP A;  2VIX A;  4LG3 A;  3K1P A;  4N9I A;  3QP5 A;  4A2U A;  2A6T A;  4ESJ A;  2W85 A;  5F0H A;  2IS2 A;  1XSD A;  1O3Q A;  4LLL A;  4FHT A;  4XLN F;  1ULY A;  1DGR M;  3ABM H;  1JT0 A;  1AU7 A;  4BHP A;  4C2T A;  5DCF A;  2QEN A;  3K4J A;  1VQP I;  2E35 A;  5TGT A;  2LSO A;  4HSR A;  2ICW G;  3KEO A;  4M72 A;  4P9U A;  3P9C A;  4YFN F;  5J40 A;  4BAY A;  1S6L A;  5E18 F;  3DKX A;  2XSJ C;  2K86 A;  4BQO A;  3S17 J;  1MZB A;  1FJL A;  1VQ4 I;  1DUX C;  3I71 A;  1W0T A;  2V9P A;  1D1C A;  4AU7 A;  1NHA A;  3OYI A;  2PG4 A;  5A2Q Z;  3PIP F;  2PMZ N;  1O7L A;  4HST A;  3GX4 X;  3E6C C;  2HPM A;  3GFM A;  5TIS C;  1RPW A;  2DLL A;  3O6B B;  4HYE A;  2LNB A;  5H2F C;  3F21 A;  4IO9 F;  4G6T B;  1M1E B;  4BJ6 C;  1IN4 A;  2M45 A;  5CYV A;  2CU7 A;  2VOD A;  1Z6R A;  2IS4 A;  5K7H A;  2IS1 A;  1TNT A;  1XDS A;  2ELJ A;  4PJL A;  3X2Q H;  5DTD A;  3O8H A;  3H35 A;  4DQ2 A;  2CW0 F;  2D1H A;  4RGX A;  3BTI A;  1G8X A;  5ICF A;  2CH0 A;  3BQZ A;  5HLI A;  4FTH A;  2H8R A;  4L5J A;  2ZC2 A;  2G7U A;  1U6G A;  2ZME B;  4S05 A;  5DM6 F;  2LTP A;  3H5N A;  2LDU A;  4BEH B;  5KNL A;  1R5G A;  2ZJP F;  2H27 A;  1S72 I;  3R60 A;  3BZC A;  1X1A A;  3D5S C;  2E5N A;  4FE4 A;  2DYR H;  1X4O A;  4WXH A;  1PP7 U;  1ZAR A;  2QSH X;  2LY1 A;  4M71 A;  2K9L A;  4PSW A;  1KU3 A;  1GHC A;  1Z77 A;  3A01 B;  2GM4 A;  3A02 A;  2HFH A;  4M73 A;  4YEL A;  3S1R J;  3SDB A;  5ICG A;  2JA8 J;  1YIO A;  5EEH A;  3QYE A;  3MQ0 A;  4P9F A;  4U7B A;  2BZT A;  2HEO A;  1V5E A;  3QAH A;  2HDC A;  2RGV A;  1Z0X A;  4HQM A;  1IC8 A;  1FX7 A;  1Z6T A;  4V19 K;  3K2A A;  3CCM I;  4LK1 F;  2H6B A;  2F4M B;  2CUE A;  4A3I J;  4CZZ A;  3ZMV A;  3F6O A;  3TOA A;  4C2U A;  3QYB A;  4A0Y A;  3CF2 A;  1MW7 A;  2WY8 Q;  4ZYG A;  1PUF B;  3ECH A;  1FYL A;  2CV0 A;  2QBY A;  1I3A A;  1D8K A;  1IDZ A;  1FP2 A;  4X0G A;  4WCG A;  3KYD B;  4O5V A;  1WKM A;  5CVJ A;  1ETQ A;  3DPL C;  3K4M A;  3JCU C;  5FRO A;  3K69 A;  1FYK A;  2NS7 A;  1ZLJ A;  3SFI A;  2AS5 F;  4V2F A;  5HS9 A;  2ZFW A;  2PLY A;  1HKS A;  3CJN A;  3NWS A;  5E3M A;  1WI9 A;  3CJQ B;  4A3C J;  2HVR A;  3SZP A;  3HUG B;  1WJ5 A;  2JT1 A;  1MBG A;  3DBR B;  2KPM A;  2KRC A;  3W6V A;  3JW4 A;  3J81 K;  2M5W A;  3KZZ A;  1F43 A;  4XRF A;  3SZG A;  3BCA A;  2R7R A;  4Y52 J;  3F3X A;  5D6F A;  3MKW B;  4BQA A;  2ZSI B;  3E7L A;  4OIP F;  3C18 A;  1A35 A;  5KVR A;  3WTY C;  2EA4 A;  5EZG A;  1XG1 A;  5LGU A;  1Z67 A;  1FWZ A;  2LKX A;  2W4S A;  5F1R A;  3BR1 A;  5D5X B;  1BC8 C;  4C9Y A;  3S1M J;  1H9G A;  1XX5 A;  2M0M A;  3DEE A;  3RCO A;  2V1D A;  4M3G A;  2KZV A;  3OYB A;  1QHG A;  4KT6 A;  6PAX A;  2IAI A;  3R0A A;  1QQI A;  2E2H J;  3RTR A;  5GTI C;  2R5Z B;  4BE1 A;  3CMM A;  4XLE A;  2R7U A;  1WJC A;  2MD5 A;  3FM5 A;  2F2E A;  1GUU A;  1QZE A;  5J1Y A;  3ZQQ A;  1G3S A;  4PGH A;  3MKY B;  2WBM A;  1OCR H;  2HQN A;  2W48 A;  1G3Y A;  4LIU A;  2IA2 A;  1SD7 A;  1YE9 A;  2E1M B;  3BG6 A;  4PZJ A;  5B1B H;  2PI0 A;  2EFW A;  3GTP J;  1JI8 A;  3E1S A;  3HRS A;  3MEX A;  3JRD A;  3V7S A;  3G6E I;  4BDZ A;  3ZMT A;  1IZ1 A;  4YRV A;  2WTE A;  2DA2 A;  4HNV A;  3ZQI A;  3DPU A;  1U5T C;  3VPR A;  1D5V A;  3EDP A;  2MSY A;  4NUB A;  2X4H A;  5BNG A;  3L2C A;  1DP3 A;  4XLF A;  2Y0M A;  2VKE A;  5B3S H;  3WTU C;  3J7Z I;  2Z1D A;  3HOS A;  3G1M A;  2BVL A;  4RLF A;  4HOB A;  2Q1Z B;  3ZQL A;  1DPU A;  1AKH B;  1XCV A;  2AXT C;  2OA4 A;  3HUG A;  3KLN A;  1DU0 A;  4H4K C;  3WTV C;  4M6V A;  4GCV A;  2BW3 B;  2HDD A;  3FXJ A;  2XAG A;  2VN2 A;  3B02 A;  3ZP5 A;  1Y0N A;  1KON A;  2XKO A;  5DD8 A;  1ZK8 A;  3WOD F;  5DDG A;  1G3T A;  4Q47 A;  1IJW C;  1E3H A;  1QA6 A;  3CCQ I;  4DYC A;  3DEW A;  1X19 A;  2QKM B;  3W2W A;  2IPQ X;  3T8R A;  1K61 A;  4UY8 I;  3BPV A;  3CLQ A;  4ENM A;  2O61 A;  5FFX A;  3WTX C;  3H5A A;  5CVV A;  5DUK A;  2Y2Z A;  4FET A;  4ZZD A;  3CZ6 A;  1E17 A;  1YOV B;  2P6S A;  4GXO A;  1GVJ A;  5BPI A;  2XV4 S;  4LLN A;  1WJE A;  3G71 I;  4U88 A;  5M5X J;  1BJZ A;  4IHX A;  2LBF A;  2WAD A;  5LGN A;  2IXS A;  2LRE A;  1YG2 A;  3FMQ A;  2EQR A;  4TV7 A;  1ZRF A;  4G7O F;  3F8M A;  2JN6 A;  3A0B C;  1H0M A;  5EZH A;  4XSZ F;  2O8K A;  4ZZL A;  3ERE D;  3BG9 A;  3C2B A;  4FIS A;  1HOM A;  3DFG A;  3J7Y J;  2E5Z A;  3PSF A;  1Y1V J;  1R00 A;  3WTW C;  1U2W A;  3S2W A;  1EH7 A;  5M3M J;  1YHQ I;  1GV2 A;  2DK5 A;  1I6H J;  2V7F A;  1YW7 A;  3I55 I;  3OV8 A;  2CW7 A;  1WFX A;  4PDK A;  2IGM A;  2HDW A;  4R79 A;  2EV6 A;  1LDK B;  3ECO A;  3EQL F;  3L2W A;  2V6C A;  4ESB A;  4ZTF A;  5IYD J;  1V3F A;  5DM7 F;  4PJM A;  2J5P A;  3LWF A;  3PFI A;  5FD5 A;  3WGI A;  1MJA A;  4E7K A;  3RPU D;  3KEQ A;  4LB6 B;  1BI0 A;  5CPR B;  4R8H A;  1ONV A;  5GPA A;  3I5U A;  3KPH A;  2VOO A;  1YLF A;  4F91 B;  1TNS A;  2O6G E;  2IA0 A;  3K4L A;  4MEX F;  3QQA A;  5FKO A;  2YSR A;  2L9N A;  2KQR A;  1B8I A;  3CJR B;  1I1S A;  3CCV I;  2HOT A;  2G7H A;  5F08 A;  3KEY A;  2Y9Y A;  1J9I A;  1W7P B;  3BR2 A;  5EEG A;  1D1A A;  2EV5 A;  2LBF B;  2O03 A;  1OJL A;  2BW3 A;  2MD0 A;  1A36 A;  4P55 A;  5FKK A;  4ZYA A;  4ETS A;  5CQE A;  3FK6 A;  1WSU A;  3HKZ A;  3CCE I;  3FK7 A;  3D5L A;  4CCN A;  3D1N I;  1MBE A;  4RBO A;  1SC7 A;  4KFC A;  4MFE A;  4M74 A;  1TWF J;  4AC0 A;  3R4K A;  5E3O A;  4CCM A;  3CMA I;  2HOE A;  4KJZ A;  1FT9 A;  1ZGA A;  1J7K A;  5AON A;  5K1Y A;  1KGS A;  3OWT A;  2RNJ A;  1SMY F;  3F9K A;  4WWC A;  5LD2 C;  4E7L A;  2FOW A;  2ZSH B;  4BBR J;  2M0C A;  3V4G A;  4CDG A;  2VPL A;  1U9N A;  5FD6 A;  2LF8 A;  2XAU A;  5BOX A;  1FSH A;  3S16 J;  4A93 J;  3VYS B;  1R5I D;  3F8C A;  2IW5 A;  5ILU A;  1R22 A;  2DMN A;  5D4S A;  2VI6 A;  2JPC A;  1S7O A;  2LKS A;  3DTK A;  3EPZ A;  2H09 A;  1S29 A;  3CUQ C;  2HS5 A;  2XF7 A;  2JQ7 A;  3QOP A;  2MFZ A;  4J00 A;  3M8J A;  2EIK H;  1ZTR A;  1OQY A;  4Y17 A;  2W82 A;  2DA5 A;  4B43 A;  2BGC A;  1J5Y A;  1LDJ A;  2RKH A;  2EIJ H;  4XL9 A;  3PNV A;  5E1X A;  3GTL J;  2VPR A;  3KET A;  1HKT A;  4BHC A;  2EFP A;  1B72 A;  1U9O A;  2ZB9 A;  3OYL A;  3IWF A;  1XMA A;  2ECC A;  2NVQ J;  3AG3 H;  5E3L A;  5GPC A;  1IW7 F;  1OFC X;  1H9T A;  2L3D A;  2QKL B;  3QRF F;  3CUQ A;  1VQN I;  1R1T A;  5HVQ C;  1TWG J;  1T2K A;  1ACI A;  3ABU A;  1Z91 A;  4LLG F;  5JLX A;  2ZXI A;  4NQW A;  2EFQ A;  3OIQ A;  1PUE E;  1X1B A;  4IZZ A;  1QZZ A;  1Z21 A;  3I58 A;  2LVS A;  4BH9 A;  1BR1 A;  5LEK A;  4IHV A;  1ZRD A;  2L7M P;  1L3L A;  1FIA A;  1RI7 A;  5D8L B;  4FCY A;  1ETW A;  3CC2 I;  3LSH A;  4GO1 A;  2E19 A;  2VLA A;  3IV5 A;  1FOK A;  3AAF A;  1Y6I A;  2QBY B;  2DPU A;  5CVR A;  1N78 A;  1QO0 D;  1O3S A;  1MH4 A;  5J1U A;  1A31 A;  3QP6 A;  4GYI A;  3OYA A;  5IOZ A;  3PL8 A;  3ASO H;  1HW5 A;  3I59 B;  5HDK A;  1XGN A;  1HW1 A;  2JWT A;  2H6C A;  1DP7 P;  4YFX F;  1FOW A;  4FQG A;  3ABL H;  2CWE A;  1SMT A;  2LLK A;  4UVC A;  4QLC U;  3HZJ A;  4JYK A;  4XN0 A;  1TWA J;  1VZ0 A;  2I5U A;  2FJ1 A;  2CFX A;  5IPA A;  3OS1 A;  2K9Q A;  1ORK A;  4XOR A;  4DGW B;  2DYS H;  3ULQ B;  1J59 A;  1G59 A;  2CYY A;  2ESN A;  1QPI A;  2UZK A;  3KP7 A;  2HXI A;  1IRZ A;  1TL8 A;  3VEP A;  2X6Y A;  1B6A A;  4JX4 A;  3IH2 A;  3SZT A;  2Z16 A;  1YRN B;  2HNH A;  2VBY A;  4R1H A;  3DXJ F;  5LBQ A;  4I09 A;  3OYE A;  2Z33 A;  4A3B J;  1ZR2 A;  2XGX A;  2W84 A;  1ITY A;  2L9R A;  3MVP A;  4MGR A;  2P5V A;  1ZG3 A;  1BOB A;  2KJB A;  4S0H B;  1HBX G;  4RLQ A;  2M1B A;  4ZDO A;  3BY6 A;  2QCO A;  4M3F A;  4ZYH A;  3BLY A;  1ZN2 A;  4F3Q A;  1VQ6 I;  1DU6 A;  2EZL A;  2QM3 A;  4DIQ A;  1SAN A;  4FE7 A;  4GGG A;  4IQ4 A;  1X1C A;  1STZ A;  3OYD A;  3HHH A;  2A5Y B;  3FXL A;  3L09 A;  5EG0 A;  3WTZ A;  5ILV A;  2QVO A;  1R5H A;  3BZK A;  1FBS A;  3ROU A;  2ZFU A;  3TQN A;  4A3K J;  2R92 J;  4G94 A;  5F0F A;  2Y75 A;  3GXO A;  3SYT A;  2Y69 H;  1QRY A;  3IH3 A;  3QYF A;  4LG0 A;  3ZN1 A;  3CCJ I;  3FKJ A;  3Q9S A;  4D1Q A;  4A12 A;  1O3R A;  3IKV A;  1AKH A;  1R71 A;  1Z9C A;  1OR7 A;  3I4M J;  4CCL A;  4OWR B;  2O0Y A;  2FQ4 A;  2L4M A;  4XRM A;  2LR8 A;  3JRA A;  2PEX A;  3SJM A;  4ANJ A;  1R6R A;  2TCT A;  3TO6 A;  2WV1 A;  2TRT A;  2E1M C;  4IKF A;  1ETV A;  1BM9 A;  3VFZ A;  5HLH A;  5M5Y J;  1RUN A;  4K2E A;  4DYQ A;  2ISZ A;  2DA6 A;  2Z3Y A;  3K9T A;  4BE0 A;  1EJ9 A;  1MNE A;  4BYY A;  3GTO J;  2FBI A;  3RQI A;  4D7M A;  3FIW A;  1NG6 A;  4CSW A;  4HAM A;  3E6B A;  3ZXS A;  3A0H C;  2JSC A;  4XKC A;  1OPC A;  4IOA F;  2VXD A;  3KYL A;  2ME6 A;  5CJ9 A;  5FKN A;  3HRT A;  4PJN A;  5B66 C;  2CV1 A;  1HC8 A;  1E2X A;  2QQB A;  3TOB A;  2WB1 N;  2CO5 A;  3DWL E;  3KP2 A;  2W1O A;  2EB7 A;  1QGP A;  4HQE A;  2ZBK A;  3CDL A;  2K3F A;  3E5Q A;  1SFO J;  1YRN A;  3HOU J;  4EAT A;  1X2N A;  4WK8 F;  2KMU A;  5D4R A;  2GOM A;  4Y4R A;  4D7N A;  3DQV C;  1U8R A;  2LH9 A;  1XB4 A;  2DO7 A;  2VB6 A;  4U0Y A;  3JRG A;  1A5J A;  2DFE A;  1U78 A;  4A3F J;  3EUK L;  4M3B A;  3V42 A;  2H1L A;  4EM2 A;  3BWG A;  1EA3 A;  1SVM A;  2M7A A;  4BU2 A;  1QVT A;  3DU6 A;  1AOY A;  3HOZ J;  1GV5 A;  1X3W B;  3HL2 A;  2QSF X;  3CCR I;  3CC7 I;  3OL3 A;  2Y48 A;  1V4R A;  3U9G A;  3VOE A;  2OTJ I;  1BN5 A;  2ZME A;  4RAF A;  3MMY B;  5FLM J;  1VQ7 I;  3CP8 A;  2NYX A;  1ZH5 A;  4IVN A;  4NDL A;  4BNC A;  4XKB A;  2WC2 A;  4XBF A;  2BXY A;  3JSP A;  1OMI A;  2HQ5 A;  4UVA A;  5F27 A;  5E17 F;  2JA6 J;  2OQG A;  4HZF A;  1YX3 A;  5IP7 J;  4BAC A;  2FQ3 A;  5BMZ A;  1XN7 A;  2BY3 A;  4HEA 2;  5AIP A;  1LEB A;  3V8K A;  1JTY A;  3IUO A;  2MH9 A;  4HF2 A;  2RC4 A;  4A3L J;  2GIZ A;  2XVC A;  5DEQ A;  2CQ7 A;  1IXC A;  3LSP A;  5LHI A;  2E1O A;  3GLL A;  4A3D J;  1TQM A;  3SEZ A;  3TW7 A;  2A07 F;  4OOI A;  1IRF A;  3TO7 A;  1R36 A;  2GLO A;  1W7P D;  3FBN B;  1ZRC A;  3TMO A;  1I27 A;  3K4C A;  4LOC A;  5KCM A;  1GVD A;  4F92 B;  4O6J A;  5C4J J;  1PDN C;  1J09 A;  4ZYD A;  1FZP B;  1VQK I;  1T8I A;  4NHJ A;  2NVY J;  4JK1 X;  5E79 C;  3HRM A;  3NRV A;  4YIF A;  3PFY A;  2R7V A;  1XPX A;  5D5U B;  2NS8 A;  3ESW B;  3LFK A;  3S2H J;  5J4Y A;  1SFX A;  1IRX A;  2DOA A;  2MGQ A;  1SAU A;  3M8F A;  2IS6 A;  4RB3 C;  2M7B A;  5LRS A;  5A2Q K;  4HDU A;  3PUB A;  4M9S A;  2WAE A;  1IDY A;  1ZGJ A;  2HOS A;  2XPV A;  1WJF A;  4RMN A;  2RRE A;  1BI1 A;  3U21 A;  4QIW N;  2DPD A;  1XS9 A;  2J5O A;  4L9T A;  2L4A A;  3CQZ J;  2G0E A;  3H1C A;  3VB2 A;  4E7J A;  4HA8 A;  3LL7 A;  3S1N J;  1S3J A;  3M3Y J;  5DYM A;  2R4G A;  4I0A A;  3IH4 A;  3N97 A;  3OYJ A;  3DP7 A;  1YX5 A;  5ERI A;  1HDD C;  3DLA A;  2ZXW H;  3HGG A;  2EIL H;  3UKG A;  3FWE A;  2PJP A;  4BXX J;  4ASN A;  3BTC A;  3PJR A;  2B7E A;  3OR1 C;  3J7A O;  2GA1 A;  2H8W A;  1LFB A;  2X1D A;  3COA C;  2F4I A;  3KZY A;  2DA3 A;  3LOC A;  3E6D A;  1ETY A;  3BOQ A;  2VQH A;  3G4S I;  2E1C A;  1R9T J;  1K79 A;  4WF2 A;  3ERM A;  3WE2 A;  2V1U A;  2R5Y B;  1XMX A;  2A5W A;  3C3W A;  1REP C;  1ZKG A;  2WB1 A;  5GTH C;  4ZH4 F;  2O5R A;  4L9J A;  3CD6 I;  3I59 A;  1UCR A;  1IN7 A;  1BOA A;  3T5X A;  4RAY A;  1BC7 C;  2IGO A;  9ANT A;  3F8N A;  1HA8 A;  5J1R A;  4RS8 A;  1WJD A;  3U1D A;  1W0U A;  4IHW A;  3LQR A;  5H6R A;  2MW8 A;  4AIH A;  4LGW A;  1JGS A;  3Q0V A;  1KQ0 A;  1WI3 A;  3AFH A;  2CG4 A;  4M3E A;  3JRC A;  4FX4 A;  1LE8 A;  3S1Q J;  2P7V B;  3K1N A;  2L7K A;  3ZMU A;  1N25 A;  4XLA A;  5F04 A;  1XMK A;  4MNU A;  5FJ8 J;  4HLY A;  3W6J B;  2NXN B;  1YQA A;  4OU0 A;  2VBX A;  4I02 A;  2Z99 A;  1F4K A;  1VND A;  3OYG A;  3ONQ A;  2NNY A;  3I3L A;  5CKT A;  2NVT J;  2JJ7 A;  2OCE A;  2CQQ A;  5CQG A;  1TWH J;  2XC7 A;  3GZ5 A;  2OF7 A;  4A3J J;  3BJO A;  5GP9 A;  5FKL A;  3MZ8 A;  1GXP A;  1H89 C;  3H3U A;  2F5D A;  3DKW A;  2LYC A;  1HST A;  5DUI A;  1GLN A;  1Y8Q B;  2BE5 F;  3FX3 A;  1X1D A;  1LQ1 A;  3F8B A;  2A69 F;  1MSE C;  2X9D A;  1V5F A;  3HOT A;  1XGO A;  1U0J A;  5F1J A;  2MG4 A;  4EM0 B;  1Z3Y A;  3I53 A;  4XQF A;  3CDH A;  1T08 B;  2ZNZ A;  4Y13 A;  4CGZ A;  3PNY A;  4G7Z F;  4F55 A;  1YS7 A;  1VI0 A;  3ZQH A;  3K10 A;  3H3Z A;  3K4K A;  1POG A;  3KYC B;  3EUH C;  2JA5 J;  2DA1 A;  3QU3 A;  3K70 C;  2XF6 A;  2DTR A;  2HVQ A;  2DMQ A;  1MDM B;  2IA1 A;  5L3C A;  1FNN A;  1IAW A;  1OCZ H;  2JUC A;  2HYG D;  1F5T A;  2FX0 A;  2E71 A;  4MFD A;  2GXG A;  2ECB A;  4RM3 A;  2DFF A;  4YFK F;  2XPU A;  2Z2S B;  1TW3 A;  1FOY A;  1K6Y A;  5EG0 B;  3WGG A;  2XRO A;  2ACJ A;  3IAS 2;  1X2M A;  1UJ8 A;  4OIN F;  1T56 A;  2VE9 A;  5FRM A;  1EF4 A;  1IV6 A;  3HTU A;  5LGT A;  3FM3 A;  1WVR A;  2Y30 A;  1YJ9 I;  2L54 A;  3S15 J;  4G12 A;  1IUY A;  3JRF A;  2EZI A;  2M3A A;  3DTI A;  4AID A;  4D5C A;  3BJ6 A;  1MGT A;  4A6E A;  1OIS A;  3ELK A;  2HOA A;  4BY7 J;  3CO6 C;  5M3F J;  1ETK A;  2M87 A;  2IRF G;  3M9A A;  3HOV J;  3RPU A;  2CV2 A;  2FMY A;  3JRB A;  5FRN A;  3RKY A;  1KYW A;  4ITV A;  2QUF A;  1WJA A;  4PCQ A;  3F8F A;  1MND A;  1YTY A;  1U5T B;  3OYH A;  1XC5 A;  2V9V A;  3GME A;  3ISP A;  1Z7U A;  1ZG5 A;  1TT5 B;  1XGS A;  2X0L A;  3K70 D;  3N4M A;  2XDV A;  1NK2 P;  1R58 A;  1TWC J;  4FX0 A;  1K4T A;  2DMP A;  2ID6 A;  2JA2 A;  1OYW A;  1KU9 A;  1SFE A;  3C2H A;  3K1M A;  4HX8 A;  3PIO F;  1IG7 A;  1FY7 A;  3E3V A;  2I10 A;  3LSM A;  1TQI A;  2K7L A;  2DT5 A;  4E7Z A;  4IQJ A;  3F6V A;  2R7O A;  1RR8 C;  5ICC A;  1RKT A;  1Z05 A;  1JJ6 C;  1YW8 A;  4A0Z A;  2X6O A;  4MTE A;  5ILS A;  3H92 A;  1B9N A;  3GFJ A;  1D5Y A;  2UXX A;  2YUS A;  1AA7 A;  2A05 A;  2NVX J;  2HQA A;  4N4N B;  3A1Y A;  3BDD A;  1X4P A;  4C3H J;  4IHT A;  3BPX A;  2M34 A;  1HXD A;  3I9V 2;  1MJ9 A;  1S7E A;  1VQ8 I;  4DZP A;  5M5W J;  3EUH A;  1YS6 A;  4G9Y A;  5HS8 A;  3ZGK A;  3REO A;  2V79 A;  3S93 A;  4XIC A;  4KIC A;  2O3F A;  3H0D A;  1AHD P;  3OR2 C;  1G3W A;  3IWZ A;  3BJA A;  2K9M A;  3DBH B;  2JZY A;  1YIJ I;  3S3N A;  2X1E A;  1O4X A;  3LA2 A;  4KUM A;  2H94 A;  1F36 A;  2EIM H;  5IYB J;  2W57 A;  3P9I A;  1ZG1 A;  3H9Q A;  1ZQ3 P;  3NWT A;  3GLX A;  2R7Q A;  4OAZ A;  3TDU C;  2WAQ A;  1RET A;  3B6C A;  2X1C A;  1IN8 A;  5J3L A;  3C1D A;  4BJT A;  5LHG A;  4JOM A;  4D0P A;  1CQT A;  5FLV A;  4HDV A;  1TW2 A;  2ZCW A;  5BS6 A;  1S8N A;  2YR2 A;  4IXA A;  1YJN I;  2LKP A;  5CVI A;  4BQQ A;  2WWY A;  3LSG A;  2HR3 A;  2PMU A;  4RAG A;  5FKM A;  4M9X A;  2OJE D;  4A6D A;  4RDU A;  3JAM Z;  4I6Z A;  5EGO A;  2ISY A;  1G4D A;  4RAZ A;  2MC4 A;  4A3E J;  2LY9 A;  2XIG A;  1D8J A;  4I2O A;  3P7N A;  5IP6 A;  2KP6 A;  3I54 A;  2ELK A;  2JK3 A;  3GW2 A;  5DCM B;  4GFB A;  3HOY J;  2HZD A;  5K5Q A;  3ZR8 X;  2XPW A;  1R7J A;  2XAF A;  3RKQ A;  4KIB A;  2WV0 A;  1IN6 A;  2AQF A;  3VSL A;  3OS2 A;  1BR2 A;  4MLO A;  5D5V B;  4BS9 A;  2JVH A;  2VT3 A;  4XLC A;  3CCY A;  3A01 A;  2VQC A;  1LFP A;  3WGH A;  2A68 F;  2D2W A;  4ABZ A;  2N8G A;  4DW6 A;  1P9Q C;  5L3D A;  4B3A A;  4UNO A;  1F1Z A;  2OTL I;  2K02 A;  4HNU A;  1LVK A;  3HGY A;  3WE3 A;  4I01 A;  1KQ8 A;  5ICE A;  3DV8 A;  2F5C A;  1WH7 A;  2O8X A;  3OIO A;  1V54 H;  3CTA A;  2E2J J;  1LDD A;  2KKO A;  1JE8 A;  4E7H A;  2UWM A;  1T38 A;  1TQP A;  3SEQ A;  4KDP A;  2Y9Z A;  2FBH A;  2EV0 A;  3KFW X;  4F52 A;  2NOJ B;  4NB5 A;  4NC6 A;  3AG4 H;  2PX9 A;  4MTD A;  1KYZ A;  4P96 A;  4KNY A;  5J8F A;  2R7F A;  3UR3 C;  2KRH A;  3FXQ A;  2DFI A;  2FSW A;  2EPF A;  3CLO A;  1RES A;  3R0J A;  3HXL A;  4G7H F;  4I7H A;  3CCL I;  5KAI C;  2QWW A;  4BL0 B;  2KFD A;  1FMV A;  1S9H A;  3MKZ A;  2Q8K A;  3I4P A;  3FHN A;  3OOU A;  4AM3 A;  2MLG A;  2ZXJ A;  1JXS A;  1WCM J;  1DPR A;  2AO9 A;  3FXU A;  4HNT A;  1W7P A;  2D1V A;  4DYR A;  1PYV A;  1YJW I;  3OS0 A;  1I3Q J;  4XLP F;  2DTZ A;  3G2B A;  5F0C A;  4EV0 A;  3KIO A;  4UV9 A;  3S32 A;  1FEX A;  2I8D A;  3WTS C;  2KRF A;  5E3N A;  1VFC A;  5H6Q A;  2DOE A;  3KCC A;  3ZQC A;  1VQM I;  1R4N B;  1X3Z B;  1TLH B;  3RPQ A;  5K7F A;  4OIQ F;  3DEU A;  4LK0 F;  2DDA A;  3S3M A;  2K3P A;  4Q48 A;  1JKO C;  1HW2 A;  1MKM A;  1UMQ A;  2GA2 A;  4XR6 A;  4HV6 A;  2MA3 A;  3IAM 2;  4XMY A;  4WXC A;  3FF5 A;  4BBS J;  4DBR A;  1R1V A;  1UST A;  4LB5 A;  2FU4 A;  1CF7 A;  4I0B A;  4L0Y B;  3HYI A;  1S7A A;  1IN5 A;  1WGX A;  1QPM A;  2FML A;  2BVM A;  3WU1 B;  3IP4 B;  3OYN A;  2HKO A;  1QBJ A;  2ESH A;  1XCB A;  2DBB A;  3O8G A;  4XKW A;  3LNQ A;  2VJI A;  2IEK A;  1J2X A;  2DK8 A;  4XLH A;  4KIG A;  2XAQ A;  5LLQ A;  1IXS B;  3V8J A;  1ZRE A;  4E7S A;  4AYB N;  1P4W A;  2PQ8 A;  3WU0 A;  1MMS A;  1T33 A;  3GWZ A;  3CF5 F;  2CJJ A;  3W2V A;  2E34 A;  3HJE A;  3MZH A;  1I50 J;  2PN6 A;  3B6A A;  4S04 A;  2ZJ2 A;  1VF9 A;  2DT7 B;  2QSG X;  5LEJ A;  2W00 A;  4HG2 A;  2YPR A;  5F6F A;  3A2K A;  4MIM A;  1SAX A;  4M6X A;  3JRE A;  4FT8 A;  3L2V A;  4XOT A;  2L9V A;  1G2H A;  2L2O A;  3OIP A;  3DCF A;  4GYG A;  3KP6 A;  3KE2 A;  2KHM A;  5IP9 J;  2RN7 A;  1MH3 A;  2OV7 A;  2L0K A;  3GTG J;  4MO7 A;  2IT0 A;  2XGE A;  2ZO4 A;  1T98 A;  1WH5 A;  2VJJ A;  4C30 A;  1QNT A;  3TED A;  2KDZ A;  3JAM K;  1RRJ A;  3UNG C;  1N75 A;  2DOF A;  3PM1 A;  1MBJ A;  2MH2 A;  2DDB A;  4KA4 A;  4CYD A;  2FUG 2;  1FIP A;  2F48 A;  1FP1 D;  2EFN A;  1KU7 A;  2DFH A;  5J4V A;  4LD5 A;  4L0Z B;  5DS9 A;  1T39 A;  4UUT A;  5E20 A;  5IY5 H;  3OYK A;  4A69 C;  5D5W B;  2DA7 A;  4QWQ A;  2Z5U A;  2G9W A;  4ZYE A;  2LD5 A;  4QSH A;  4XRS A;  1U3E M;  4UUS A;  4XK4 A;  3HBL A;  3DBL B;  3M1E A;  5HOO A;  3ZQF A;  3FMS A;  1J0R A;  4HF1 A;  5LHH A;  1G6N A;  4B47 A;  3M1C A;  4BGD A;  3HM5 A;  3IL2 A;  3W2A A;  2VJ4 A;  2COM A;  4B1R A;  4BJ5 C;  3H36 A;  2VAS A;  2QQ8 A;  4JQF A;  2RAE A;  3RSN A;  3CCS I;  2HTJ A;  2HWV A;  1SFU A;  2V6E A;  2DCE A;  1R49 A;  3H9G A;  4CH7 A;  1TZL A;  2MLK A;  3OMY A;  3LSJ A;  1FYM A;  3K4B A;  1HCR A;  2B63 J;  3U1K A;  1D0Z A;  4UB8 C;  4M3D A;  4PGG A;  1ETX A;  3I64 A;  5J47 A;  1HKQ A;  4XKV A;  1R1U A;  4Q4Z F;  2RQP A;  2VUM J;  1MBH A;  4DJA A;  2JTV A;  5K7Z A;  2L01 A;  1ZHF A;  1PJR A; 
#chains in the Genus database with same CATH homology
 1OCO H;  3ABL H;  1OCC H;  1OCR H;  2OCC H;  3ABK H;  2EIM H;  5B1A H;  5B1B H;  3ABM H;  2Y69 H;  3ASN H;  3AG4 H;  3AG1 H;  2EIK H;  1V55 H;  5IY5 H;  1OCZ H;  2DYS H;  2DYR H;  2EIJ H;  3ASO H;  2EIN H;  3AG2 H;  3WG7 H;  2ZXW H;  3X2Q H;  2EIL H;  5B3S H;  3AG3 H;  1V54 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...