3X2QH

X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution.
pubmed doi rcsb
total genus 24
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3x2qH00
1V54H 3ASOH 2EIJH 2EINH 2DYSH 1OCRH 3AG4H 3X2QH 1OCZH 3ABMH 2EILH 2EIMH 2Y69H 2OCCH 3AG3H 3WG7H 3AG2H 3ASNH 5IY5H 1V55H 5B1BH 5B1AH 2EIKH 2DYRH 5B3SH 3AG1H 3ABKH 1OCCH 2ZXWH 1OCOH 3ABLH
chains in the Genus database with same CATH superfamily
4Q47A 3LFUA 3EUAA 4BQAA 4ESJA 2PG4A 3OYKA 3ZQQA 2O7OA 4PGGA 5JR3A 2AS5F 1UELB 2V1XA 4DZPA 1HKSA 4KA4A 2E2JJ 4MO7A 2HWVA 4D7MA 1Z6TA 2P0WA 1TC3C 5IY5H 4GXOA 2ZNYA 3D5LA 4I76A 4CH7A 2YS9A 2VUMJ 2ELJA 2Z5UA 4B48A 3O8HA 3CUQA 3LAPA 3L2CA 3OSFA 2BGCA 2K02A 3FXOA 4XKVA 1ZN2A 1I1GA 5HLIA 1H88C 4RAFA 2I5UA 3IV5A 4A3KJ 4RMNA 4LITA 1Y56A 1R1VA 3H5RA 3I4NJ 1VQMI 1UAAA 4RDUA 1WVRA 4ETSA 2XAFA 1T8IA 4HQEA 2VQGA 3RQIA 3G4SI 4FHTA 4ENMA 4BQOA 4RA2A 3FM5A 1FP1D 4M3DA 1RKTA 4M3BA 1XS9A 1GT0C 3FZVA 2VQHA 4AM3A 3O6BB 5LEKA 3ZQLA 2ZMEB 3GMEA 1MZBA 1QVTA 1AA7A 1V54H 1IG7A 2BEOA 4EQQA 2R5ZB 1FIAA 2CUZA 1HW1A 1NH3A 2JVHA 2FMLA 5C3EJ 3CC4I 1GV5A 1ENHA 3LSHA 2M0CA 5IP6A 3A03A 4MQVA 2OCEA 2W48A 4XKCA 1IDYA 2M4KA 2BXYA 3K7AJ 2YUSA 4AWXB 1SFEA 1FMWA 2Z1DA 1X58A 1U5TA 4BH9A 5EDNA 4RGRA 3M1CA 1HOMA 3L00A 2H1KA 3BDDA 1IAWA 2UV1A 3QRFF 4C3IJ 1MMGA 2QQAA 2EWNA 5LHIA 1Q1HA 2QENA 4XLEA 3FKJA 4M3FA 2NS8A 2HQNA 3FBNB 3JRBA 3CCRI 1JHHA 1IF1A 1ZR4A 5C4JJ 3VFZA 5CQGA 2R7VA 4JX4A 2KJBA 3W3CA 3M8EA 2KRCA 2IGKA 1VQ7I 3E97A 2LMDA 2KIQA 1YO5C 2KDZA 2QCOA 2GIVA 3LSTA 4WWCA 1YQAA 2WY8Q 4OWRB 4F55A 1UHMA 3X2QH 1USTA 3GWZA 3L2VA 1YRNB 4L0YB 1YW8A 1B4AA 1RRJA 1W36C 4HNTA 2CW7A 2KIMA 5HS7A 1DDNA 4OIOF 5F6FA 5L3EA 3LSMA 2O61A 4LLLA 3OSGA 1MGTA 1TT5B 3LMMA 3E6CC 3D5SC 1DPUA 3BZKA 3CUOA 2X6OA 5K5RA 4L0ZB 2JRMA 3COAC 4ZTFA 1ZAOA 1HSJA 5L3BA 1B72B 1BI1A 2VN2A 3W6VA 1TNTA 1RR8C 4KMUX 4DW6A 1BR1A 1YS6A 2W00A 3QYFA 4FQGA 2DPUA 2E19A 3OR2C 1BW6A 4ASNA 3RPUD 2EH3A 1MBEA 5E3NA 1HLVA 4RLFA 5J4VA 2BV6A 1W36D 4MEYF 2IA2A 1BBYA 1MSFC 1FSEA 5ERIA 4I0BA 1LNWA 2VJIA 5DUIA 4L18B 1E3HA 3SYTA 1JI8A 1KQ9A 1WJEA 3ZQCA 3C2BA 2L5QA 4V2GA 3DEUA 3IWZA 4PSWA 3TKYA 2KZVA 3LSKA 4R8HA 1S5LC 2VXZA 3AG2H 1WCMJ 1UCRA 2DFHA 1REPC 5EEAA 2XC7A 2HDWA 2ZJQF 2CV0A 2NOJB 2P81A 4BYYA 3KEYA 5FO5A 4S04A 3WTTC 4BJ5C 2DMTA 1WJ5A 2FEZA 2NNYA 2V1UA 4KISA 3AG1H 2MFZA 2DA4A 5LHGA 1K4TA 4OAYA 3BG9A 1QHHD 2OUMA 3RI4A 3U1DA 3OMYA 3GCMA 2IP2A 3M1EA 1O7LA 3DTKA 5GAEJ 1I27A 3IKVA 3GTMJ 4QTRA 4CCNA 3ECOA 3DXJF 3I55I 3TO6A 4I2OA 3C7JA 1R71A 4ABZA 1TNSA 3ZMTA 1WFXA 5F0CA 5E3LA 2NVUB 1YIJI 5D5UB 2P7VB 1WSUA 4HRIA 3CJTB 3P7NA 4BE2A 2RNGA 2R3SA 3HC7A 1A31A 1NG6A 2N8GA 4D0PA 1DU0A 2PJPA 5IT9Z 2M0MA 2LKSA 4HBLA 1G3YA 3RKXA 3ZN0A 5F64A 2LC2A 2BHYA 2D2WA 2E1CA 4FX0A 1O3SA 2IW5A 2K9MA 2EB7A 3ERED 2JA2A 3JR9A 4CDGA 1XSDA 2H6CA 4QPQA 1J09A 2DJNA 5EYRA 3N4MA 1JGGA 2EIKH 2DYRH 4LG3A 4KDPA 2HYGD 4CYCA 1Q1VA 1IUFA 3K70C 4LFUA 4NBQA 4AVPA 2F48A 4WXHA 1ETQA 4MFDA 1N78A 2QZ8A 3DKWA 1YG2A 5KHDA 3AG4H 1B8IA 2RQPA 4A5NA 2BW3A 3H5AA 3QPHA 3PSIA 5D4RA 1U78A 2MSYA 4PJ0C 2QQ9A 4YIIA 4QLCU 4A69C 3ZQGA 3OYGA 3DKYA 1QGPA 5TJJA 2JWTA 3BP8A 1PP7U 3CP2A 4E7SA 4M9SA 2FMYA 1AWCA 3OYLA 3IH3A 3AFHA 3LAJA 2B63J 1RNLA 1XMKA 5CPRB 4Y33A 1Y8RB 2IJLA 2Q1ZB 2XUBA 2Q8KA 5LD2C 3ECHA 3E3VA 4UVAA 5HLGA 4BACA 1R5GA 3ABMH 1ITYA 2W82A 1IN4A 2ETHA 3KETA 4HX4A 1B1BA 2A6EF 3S1RJ 3GLXA 1VF9A 2IGOA 4N9IA 3K69A 5EEHA 1AKHB 3GUDA 2XASA 3HB9A 4N4OB 4FASD 4J00A 4JBAA 2XIGA 2LREA 4BHCA 4V2FA 1E17A 1IW7F 1H8AC 5LFAA 3WGIA 1W7PB 2A69F 2PQ8A 4G6QA 1EH6A 2CJJA 4EJUA 2IAIA 4G9YA 4ENNA 5DCMA 1NHAA 1K7AA 1SVOA 1T6SA 3KIOA 2VPRA 3HHHA 3Q0WA 2PJRB 3OR1C 3I59B 3J81Z 3TO7A 1P6RA 3PL8A 4A3IJ 3KP2A 1XCVA 3FISA 2FNPA 3IH4A 1TZLA 2LK2A 3FXKA 2EFPA 2LNBA 2MLGA 2DO7A 2JA7J 3WODF 3MN2A 2L9RA 1MH4A 2IA1A 3HL2A 5E8IA 3P9IA 2JSPA 1QNTA 1FP2A 4PJJA 1VQLI 3HUGB 3QPSA 1HKTA 1LEBA 2VT3A 2HFHA 2Y30A 1VQ8I 4L5EA 4F92B 2FOKA 1R5ID 4A0ZA 3V8JA 5HNFA 3GF2A 3PQJA 1YJWI 1T98A 2K7LA 2EA2A 4OINF 3N97A 3LA2A 2R7RA 4A3EJ 3ZMVA 5B1AH 2VONA 3S32A 2X85A 3I53A 3GTLJ 4FX4A 4Y13A 1LFBA 2E7WA 3V8LA 3H0DA 1YW9A 2Z9OA 2DJIA 2JRTA 3OYFA 1IXCA 1YITI 4MEXF 2MBFA 2QQ8A 3CCMI 2Z16A 1ULYA 2AQEA 2VI6A 3CMMA 4KITB 3L2QA 2TCTA 4B09A 4XKBA 2LF7A 3JRFA 1O3RA 4TV7A 3LOCA 4LG0A 1HW2A 4ZDLA 2V9PA 4C3JJ 3PUBA 3VEPA 4HOBA 4HNUA 3DF8A 3Q0UA 3I5UA 4HDVA 3A4CA 2CV2A 5FFZA 1ZLJA 1V3FA 5EG0B 1R6RA 2DPDA 1JUPA 2QYOA 5LRRA 1W4MA 2NVXJ 2VOOA 5DCFA 4OIPF 4KMFA 4Q4ZF 2P8TA 2XB0X 2LH9A 3AL0C 1KA8A 3HOUJ 1YYVA 4MTDA 2E5ZA 3R0JA 2PMZN 2EIMH 2R93J 3WU2C 1A6IA 1S8NA 3I4PA 5HOOA 3P9KA 4D5FA 3OYCA 5ILUA 3GFJA 3L7WA 3OIOA 3EETA 4BXUA 1ZYRF 3GTPJ 5EEGA 1TLHB 2Q2EA 1JE8A 2FUG2 3T8RA 5HDNA 4G94A 4RB1A 1TWGJ 2IEKA 3F22A 2ZJPF 5FROA 1I39A 2MH2A 1ODDA 4F91B 2KFDA 5F04A 1NK3P 2KRFA 3S17J 3QP6A 3HBLA 4DNCA 1VQ9I 3OY9A 3ZP5A 4JX6A 3HSFA 5FKLA 1NK2P 4M9XA 2XKPA 5H6RA 3E0JB 2I8DA 4MGRA 4W97A 1XSXA 3S93A 3ZQHA 4E7HA 5J40A 4IJAA 5HLHA 1YJNI 3G1LA 3ABKH 4M9ZA 1WJCA 4FCYA 4DZJA 4G7ZF 1B9NA 3IRRA 1R1TA 4NQWB 2ZMEC 1E0EA 3DBHB 3R4KA 3J81K 1STZA 2K4JA 1HW5A 3CMEI 5BPIA 4NDLA 3C1DA 3R6SA 2HQ5A 3NRVA 4U0YA 2HKOA 3OOUA 1GVJA 1MKMA 2UZKA 2K9SA 3DWLE 3ZPLA 4A93J 1T0FA 2H09A 2PMZA 3PFYA 1RPWA 2OU2A 1FX7A 4BJTA 1I50J 1BI0A 2LBFA 2UWMA 3TQNA 4H4KC 2ZXWH 2ZJRF 2NYXA 4CCJA 1DP7P 4A3GJ 3BQYA 1IGNA 1ZREA 3HG9A 1F4KA 5LEJA 1D8JA 2RREA 2G9WA 2GM4A 2HS5A 3REOA 3WE2A 1QBJA 2JMWA 1Z67A 2DK8A 2EJRA 4OMYA 4WXDA 4QIWN 3AG3H 4M3GA 3S2WA 2V7FA 2K9QA 4M72A 2GIZA 2WV0A 4LB6B 4BEHA 1HA8A 1W5TA 3WU0A 1P4AA 3RJPA 2HPIA 3M4OJ 3BT9A 2KIUA 4WK8F 1MBJA 1OCCH 2M7AA 2XDVA 1UB9A 1FSHA 2HKXA 1DGWY 4ZH4F 1XDSA 3OYAA 3HHGA 5DV5A 4HF2A 3HTSB 3ZMUA 1N77A 1CF7A 1IO2A 3VB2A 4BXFA 2M87A 4XRMA 2D1VA 2FX0A 3RPUA 1YFHA 3KZZA 1D1BA 4NC8A 5DEQA 2H1LA 2PEXA 1TBXA 5F27A 1HC8A 1N25A 3TOAA 1OYWA 2VE8A 3ZMDA 2NS7A 3S2HJ 3MD2A 1FT9A 2GA1A 2QM3A 4MHGA 5K7HA 4XOTA 2FBIA 3ZOBA 1GXQA 3FMSA 4IZZA 4HLYA 2NXNB 2VC0A 5BPDA 3QYEA 3W2AA 1JKRC 4GGGA 4QSHA 3IL2A 5F0HA 3LSIA 5GTIC 4LLNA 4II2A 4BE0A 2R7QA 2R7WA 3BTLA 1YS7A 4HPQA 2GOMA 4Y15A 4XRSG 2CSOA 3HGGA 4I99C 3J7AY 1S7AA 3O3KA 2K40A 2GXBA 1EH8A 2W85A 5DD4A 4IF4A 2LRDA 2OA4A 3HIFA 4ZDOA 4G8XA 3ASOH 1TW3A 3TBIA 3QU3A 1P7JA 5H6QA 3Q9SA 4KIFA 1SD7A 2XAUA 3HOXJ 3CC2I 2M3AA 3HYIA 3I4MJ 2E7XA 1X3ZB 2MW8A 1YJ9I 1TQPA 3C3WA 2QVOA 4EM2A 4ANJA 2P5KA 2VASA 2X6YA 3G1OA 1OISA 3D0SA 2XHKA 2FU4A 3HZJA 3F8MA 1Z05A 1Z0XA 2Z33A 4BL0B 4EGYA 4HV5A 2GLOA 3M07A 4P9FA 1IZ1A 1KYWA 2E1NA 5DS9A 1LE8A 1UJ8A 3ERMA 4UB8C 4YIFA 2DOAA 5AONA 3S3OA 2OPTA 2G7HA 4IHXA 1MH3A 2JPBA 1T56A 4L9NA 5C44J 2M8EA 1R9TJ 3LSGA 5B1BH 4DIQA 4M73A 1AOYA 3SZPA 2XAJA 2QSGX 1HXDA 3V7SA 5J8FA 2HPMA 4PGHA 4WCGA 1APLC 4J19A 2FQ4A 3OYDA 2V6EA 1RR7A 3G1MA 2W25A 3F8NA 2R7ZJ 3O2PE 4ESFA 3RZDJ 2FBKA 3V7CA 2QKMB 4BJ6C 5IPAA 1EJ9A 2CMPA 2L9NA 3O8GA 2XPVA 2DA3A 5CYVA 3F6VA 1D1CA 3JAMZ 3FK6A 5BMZA 1BL0A 3CF5F 1V5EA 1XTAA 2G0EA 1JUMA 3NQOA 3ASNH 3TDUC 5CVUA 2KL4A 3H0GJ 1KU2A 1F5TA 1MSEC 4UY8I 2R7DA 2XF5A 4X0GA 3R61A 1VTNC 3JCUC 4IEJA 5M5XJ 4IXAA 2ESHA 2L02A 3SHFA 3T8TA 1MNDA 4KUMA 4BHBA 3M9AA 2IPQX 1VQ4I 1MDMB 2VE9A 3ZN1A 2CQ7A 1FYKA 1BC7C 3QP5A 2HVRA 4PFOA 2MYSA 1SD5A 2Y2ZA 4CYCB 1XX5A 3I64A 4JYKA 2E1OA 4J01A 1PJRA 2A3SA 1SAUA 2BOLA 3BOQA 2K27A 5GAGJ 4BDYA 3SZTA 2HTSA 2DAOA 3UNGC 3KE2A 4B3XA 1U9NA 1BN5A 2DTRA 4BKXA 2BW3B 1HDPA 1W1WE 3DPLC 4L5IA 4HX7A 4OOIA 2HQRA 1FZPB 3ZCOA 1K79A 1VQOI 4KT5C 4XRSA 2K3PA 4PJLA 3DBLB 2B0LA 3I9V2 3GLLA 2JA6J 3KP7A 4AIHA 3CF2A 2EFQA 3CD6I 3I54A 1SEUA 5LLQA 3S15J 2PI0A 4JX5A 5GADJ 1UZCA 3FHNA 1NG7A 5GPAA 4P1WA 3E5UA 2ZJ2A 1F36A 2KP6A 3K4CA 1XDUA 3HSRA 1YE9A 4EV0A 4PUSA 1RZ4A 4A6EA 4GRIA 4I98B 1I5ZA 1GLNA 3TP0A 2O03A 2QQBA 2O9LA 3ABUA 3I56I 3PIPF 4C2TA 5DCMB 1SANA 4B3AA 1XGMA 2ZKZA 5HS9A 2V1NA 4L9VA 4HG2A 4ZC3A 1D3YA 4JP0A 4UB6C 3IC7A 3CZ6A 4M6VA 1YX3A 2AXLA 1W0TA 2GZWA 2E5NA 1WJAA 3H3UA 2VODA 2K5CA 1YIOA 3MZYA 2R7SA 2OQRA 3LNQA 2ZBKA 1O57A 1XG1A 3OL4A 2KZGA 5L3FA 3Q0VA 3JSPA 5C4XJ 5KK1A 1MNMC 1OCTC 4M71A 2KLOA 1VNDA 3B02A 4IRHA 3K4LA 4XOPA 3W6KB 3ML6A 3CCEI 5E79C 3EUKL 4C9YA 3RTRA 4HLXA 2EFWA 4NUBA 4YRVA 2Y31A 4Y7NJ 2DT7B 3IKTA 3FXUA 2RAEA 4XLPF 4FTHA 5JVGF 5F1JA 1ZRCA 3HRSA 3ZQ7A 2VC1A 3KP6A 4F93B 2RN7A 4UUTA 4RBOA 4GYIA 4UV8A 4A5MA 3DTEA 2A6TA 1N75A 2HZTA 2DODA 1A35A 3CCLI 4XQFA 2WB1N 2F5DA 1F43A 2QLZA 3MAJA 1S72I 3BJ6A 3FXQA 2K4BA 3KYLA 2M8GX 3JAMK 2VKDA 4W1UA 3J7AO 1W5CC 2OQGA 2MC3A 4PSXA 4PJMA 2Y48A 2XF7A 5ILSA 1Y1WJ 2E35A 4UUSB 1OLTA 2F5EA 3FXJA 3LA3A 5CJ9A 3WTYC 5D6FA 1J75A 4RM3A 1U3EM 2MC4A 1LEAA 3MEXA 5FKOA 4G12A 2QBYA 2M2EA 5E8GA 1WI3A 2EZKA 3ELKA 1EF4A 2VBXA 2VIXA 3VSLA 2ESNA 4HF0A 3MCZA 2GA2A 2GAUA 4U0VA 2RQQA 2HOEA 4Y52J 2Y0MA 3UR3C 1FYMA 2UUZA 3VSKA 1DU6A 5KNLA 2L7MP 4F3QA 2HOAA 2D45A 1HBXG 1XCBA 2G7UA 4E4HA 3K1PA 3KFWX 1FMVA 1O7FA 1WJFA 2DT5A 2KHMA 5B5EC 3V7RA 2X51A 3AAFA 1TWHJ 2O0YA 4EJWA 4Q48A 4CCOA 3RKWA 3BG6A 2W4SA 5FLVA 2NNNA 2EINH 3QPLA 4LOCA 1UHWA 1WPKA 1S29A 1VI0A 2M34A 1TT0A 4P9UA 2Q2EB 1WH5A 3T5XA 3DPTA 1W0UA 2X1DA 5ICCA 2Z2SB 5FD5A 3HRTA 4XNFA 5GPCA 3OYJA 5GAHJ 1MJ9A 2H8WA 3KP4A 1K78A 1EKEA 4KFCA 3G73A 1WRJA 1ETWA 3ZRGA 3ZGKA 4AIDA 5BS6A 1NTCA 4DYQA 1ON2A 4B8XA 2BY3A 1OCOH 4I02A 5JLXA 1YTYA 2AQFA 1X1BA 1X1AA 1Z3XA 3BZCA 5KAIC 2ECBA 2M7BA 3GTQJ 1Z6RA 4XSZF 3BR6A 4EM0B 2L7ZA 1JHFA 1KU3A 5JLWA 1UG2A 3BWGA 2ZMEA 4QWQA 1PUFA 4NC7A 3E7LA 2ME0A 1SFKA 2WAEA 3BTIA 1R1UA 1I3AA 2VBWA 2BHZA 2L0KA 2DFEA 4NC6A 1K61A 4EJTA 2AXTC 5JHUA 2R5ZA 2QGUA 1GV2A 3MMYB 1SVLA 3K6GA 2ME6A 5D8KB 1OR7A 2IS6A 1IXRC 5IYDJ 2B9SA 3BJAA 4P55A 4LB5A 2ZFUA 4FE7A 1IRGA 2RGVA 1USSA 2MD5A 1QVUA 3HJEA 2L3DA 2VBYA 1IRZA 4IHSA 3C2GA 5J1YA 2KQRA 1U8RA 1RETA 4YIRX 3R0AA 2DA5A 1PP8F 3OYEA 1PVEA 2DMNA 4HYEA 4ITVA 3K70D 1JT0A 2IRFG 3OS0A 1GHCA 2XAHA 1X19A 5LBQA 5EF6A 3BROA 4ZYDA 2VQCA 1P92A 4JK1X 5E20A 1Z7LA 3KEQA 2HYJA 2VLAA 1ETXA 1B9MA 4EMSA 1ZRDA 1V5FA 1CGPA 2RVCA 3CLQA 3RKYA 1BC8C 5IP9J 4EEFG 3KYCB 2A68F 2BE5F 1WWXA 4A3FJ 1Y0NA 3EUHC 2IS1A 2IA0A 4Q5SF 1X4PA 3AKZA 2P6TA 1ZELA 4DBRA 4BEHB 3OYBA 3HSEA 2X6WA 5E1ZB 2STTA 5IOZA 2LY9A 2P4WA 2NAZA 4WXCA 1KU9A 4CZCA 4HF1A 1YRNA 4B47A 1VQ6I 5EGOA 3SFZA 3WE3A 1VFCA 2K3FA 4OU0A 1CF7B 4AC0A 3IRQA 2V79A 2CH0A 3DPUA 3HPHA 3KPHA 1O3QA 2CWEA 1MMAA 1QPMA 5BNGA 2Y9ZA 1BI3A 2ECCA 2R92J 2M5WA 1RUOA 5D5XB 3GFMA 3IHUA 1IN8A 3MKYB 3CTAA 3HOTA 2ZB9A 4G7HF 2P7CB 1VQPI 2DDBA 3H5NA 1U8BA 1BOAA 1WHUA 4GCVA 1UMQA 2FJ1A 5AIPA 1XMAA 3FDYA 1O4XA 4U7DA 3LWFA 2LR8A 3CCJI 2EZLA 4P5OA 3HM5A 1IV8A 4N9HA 4A12A 4ENJA 2PX9A 3GTJJ 5B3SH 4XLAA 2DTZA 4RAZA 2HGCA 3DLAA 2HDCA 3K4MA 1J7KA 1P4XA 3TL4X 2VXDA 2K9LA 1BIBA 4BBRJ 1ZG5A 4IOAF 4ON0A 1WI9A 1UHSA 3RCOA 2JUGA 2R5YA 4XM3A 4G7OF 1LDKB 3KP5A 2YU9J 3FK7A 4PFPA 2LLKA 3MKWB 1ZK8A 4AUXA 5FKNA 4HEA2 4HZFA 1IDZA 1GXPA 4C3HJ 2LKPA 3K1NA 1XB4A 2DI3A 1FEXA 3V4GA 1U6GA 1IXSB 1H89C 4MLOA 3PUFA 3TGNA 3SQNA 2DCEA 1XPXA 2CW0F 1RESA 2ZXJA 3CLOA 2P5VA 4BGDA 5IYBJ 2BYVE 4CICA 3PJRA 4XLNF 2KIFA 4A3JJ 2JUCA 3WTSC 1Z21A 1A04A 1ZH5A 1CQTA 3PNYA 3ZXSA 4EVIA 4KIBA 3IUOA 5K5QA 5HS8A 5K5OA 4HSTA 3L9FA 3PO2J 5J3LA 1SFXA 1X1PA 3DEWA 2LYCA 2X1EA 1FLIA 3QPTA 4EATA 2X48A 2DOFA 4Y3OA 2P5LC 2C6YA 2L01A 4LJZF 3BC8A 5D5WB 2W7NA 4HSRA 2CUJA 2VOPA 1IUYA 5CQEA 5F08A 1TQMA 5J8CA 1GUUA 3W6JB 2DDAA 2LG4A 1XN7A 3JW4A 2CYYA 2L7FP 3HOWJ 4X6AJ 3CUQB 2M1BA 1BOBA 5LRSA 3ZMSA 1UG0A 3MFKA 1QZEA 4Y4RA 4KYWA 4PDKA 5FJ8J 1MMSA 2R7TA 1Z1DA 4B44A 3HKZN 1RKWA 2LTPA 4A3CJ 3S1QJ 3KZIC 3CCVI 1VQNI 1FY7A 4AD9A 1U2WA 1X1CA 1HCRA 1KQ8A 2L9VA 2MA3A 2VKEA 2R4GA 5FLXK 4U88A 3TO9A 3DU6A 2ZXIA 1X3WB 1VZ0A 3ROUA 3GVAA 3BG3A 2UXXA 3RYRA 4KJZA 3DFGA 3D5RC 5D5VB 3OYMA 4MQ9F 1IN6A 5EZGA 2PBIA 2V9KA 4P96A 3GEZA 2NVQJ 4OIQF 3T1BA 2BY0A 2OAZA 4QPOA 3OL3A 3C2HA 5D8LB 2FQ3A 3GTGJ 3WGGA 5F0FA 5GTHC 4DJAA 4OIRF 1W5SA 1XMXA 4CCMA 1U5TB 6PAXA 1X2NA 2B7EA 2O3FA 2FSWA 1JKPC 1S6LA 3DV8A 2H27A 4FE4A 4DYRA 1BIAA 3KYDB 4KNYA 1QZZA 2LD5A 1AKHA 1L0OC 1B6AA 2VKHA 3ABLH 4WF2A 3CQZJ 3FBIB 2ISYA 1LUJB 1RC9A 2VB6A 4GYGA 1V5GA 5JVTA 4CO8A 2FD5A 3HKZA 3BR1A 3P9CA 3VWBA 4YFXF 1WZ2A 1JGSA 2EBIA 5ICGA 1J59A 4CHUA 3OIQA 2R0QC 1I6HJ 1DQUA 2RC4A 2FXAA 2D1HA 4U0WA 1FOWA 2O6GE 5L3DA 2NVTJ 2PFBA 3OIPA 1YX5A 2KT0A 3JRDA 3V8KA 3B73A 2RKHA 1QO0D 1TW2A 1LFPA 4MIMA 2J5PA 5FKKA 4NHJA 1Y1VJ 1D8KA 2V6CA 1YOVB 2YX7A 1QRYA 2DMPA 4HW0A 4BUPA 1RUNA 3GTKJ 2ID6A 5FRMA 2EPFA 3S1MJ 1G3SA 1FBSA 1PYVA 3HUGA 1Y0UA 4E6KG 3U2RA 2R7XA 2ZC2A 4D1QA 3H35A 5E17F 1FTZA 1F9NA 1ETOA 1G59A 4YELA 4XN3A 1FBQA 1K4SA 3OWTA 3MKZA 2JZYA 3HEFA 3SZGA 2VKVA 2Z3YA 3CDHA 2DBBA 3JREA 3VPRA 1JTYA 3GZNB 5HDKA 2XGDA 2IBDA 2EZHA 3V42A 1OMIA 1LPQA 4A0XA 2F4IA 2M9HA 1XGSA 4A3MJ 1R36A 3GXOA 3PNTA 2HTJA 2QA4I 2FE3A 1KQ0A 3IH2A 3QODA 4RAYA 5JFRA 3W2WA 4PK4A 1ORKA 2PLYA 1HQCA 2K86A 1C0WA 1ZKGA 4OMZA 3LA7A 3VYTB 4CUGA 2RDPA 1BI2A 2W24A 4XLFA 1ACIA 1H9TA 2XRLA 4NB5A 4L5JA 4M6XA 4IO9F 4V19K 1D0XA 3PQKA 1QA6A 4XONA 4B43A 4LIUA 3S2DJ 2WAQN 5FD6A 1S3JA 5L3GA 2XV4S 2L2OA 2LDUA 2L4MA 1R7JA 3PFIA 1ETKA 2E1MB 1I6XA 4AIKA 5HDGA 4RAGA 3J80K 4BAYA 4B1RA 1L3LA 3TMOA 3DBRB 4F7ZA 3CCQI 4LK1F 1FTTA 2LOOA 3CJRB 3BG5A 4YFKF 4AVZA 2OTLI 4HNVA 3AL0B 2NRAC 5IYCJ 3FXLA 1OQYA 3BJOA 3FHZA 3SXYA 4GFBA 1RIOH 4M3EA 1OCRH 1ERDA 4KIGA 3HOSA 3DCFA 3E6DA 3FXRA 2FA5A 1FIPA 4I01A 2CU7A 5J47A 3A01A 3SJMA 3ISPA 4XRFA 3TOBA 1G6NA 2ACJA 4BQNA 1VQ5I 3JRIA 1BR4A 2A61A 1G4DA 3S3MA 1T2KA 1G3TA 1S7EA 2MD0A 3A0BC 3DKXA 3F0CA 1POGA 3K2ZA 4IQ4A 5EZHA 3BQZA 1IN5A 2FRHA 1SC7A 3CMYA 1ZTRA 2Y0SN 3FMQA 5J1UA 4CA0A 5IT3A 1TWAJ 4OAZA 1J9IA 2E34A 3F8CA 3BR0A 4CCKA 1K78B 1HSTA 2ZSHB 2DW4A 4RGUA 4A6DA 1FC3A 3NWTA 4NQWA 4ZYGA 2FOWA 1KONA 1SMYF 3QOEA 4MFEA 3JRHA 1OFCX 5FKMA 1ZGJA 5B66C 2COBA 2WAQA 3I0TA 3ZQIA 9ANTA 1PUFB 1WGXA 2LVSA 1FOYA 1B8IB 4ZYAA 4C30A 2DFFA 2XGCA 2BVMA 1OCPA 3EQLF 3GZ6A 5TISC 2A5YB 2LY1A 2GWRA 3WTUC 2HZDA 1E3OC 4XORA 5DTDA 3LL7A 3OOPA 2DQRA 1T0FC 4DQ2A 4FISA 2OCCH 2W1OA 1PDNC 3RQ4A 2QKLB 3SEQA 3EYIA 1QQIA 3ESWB 1TL8A 1D0ZA 3PNVA 5HLTA 4XSXF 1LKXA 3UKGA 2M30A 5E3MA 2F5FA 1Z3YA 2F2EA 2MGQA 1JJ8C 2L4AA 4LMYA 2E36A 1P4WA 1R23A 2F4OB 4CYDA 2AO9A 1R5HA 1XGNA 3B6AA 4ZTJA 4D7NA 4E7JA 2K85A 4E7LA 4HV6A 1DUXC 3EUHA 1MBKA 1E3PA 3IAS2 2Y0SA 3E5XA 5FFXA 5HNHA 1K6OA 1R58A 3OYNA 2WTEA 1LJ9A 3E6BA 1R49A 3I3LA 1U9OA 2KPMA 4DYCA 3T0YA 3RKQA 2HXOA 5KAFC 4IL6C 5CKTA 3L09A 2DK5A 3JRAA 4X1EA 1T33A 2DN0A 2WBMA 1Z7UA 2XPWA 5DYMA 1HF0A 4E7KA 3A0HC 1LQ1A 2W57A 1J5YA 3TW7A 5M5WJ 4HDUA 2DYSH 5E3OA 4R79A 2IT0A 2E60A 3VYUB 5EGOB 5A2QK 4IHYA 3TEDA 1O3TA 3E5QA 5EJCA 2STWA 1GVDA 3B6CA 1W7PD 3F8FA 4FT8A 2HOTA 1LVKA 4II3A 1X4OA 1VQKI 1J2XA 1TQIA 2YSRA 1F1ZA 2H8RA 3ABTA 4BDZA 2CFXA 1OYYA 3BZ6A 2ZXHA 2DOEA 2V1DA 3H3ZA 3NARA 1SVMA 3I58A 3QU6A 3CCUI 3CO7C 3U9GA 2JA8J 1R00A 2VL8A 2RV8A 1AU7A 2IXSA 2E2IJ 5J1RA 1KU7A 2M4GA 2KJCA 3HOYJ 1U0JA 3GFLA 1IC8A 1ETYA 2DA1A 4UHTA 5LGUA 4EGZA 1KYZA 2BBYA 4CXFA 2MG4A 3DQVC 4C2UA 3SFIA 1T95A 3QQAA 5TRDA 3OV8A 2DU9A 3ZR8X 1TWCJ 4LLGF 2R5YB 2VJ5A 1TWFJ 2JN6A 4ESBA 2DA7A 4LG0B 1XSVA 4MNUA 4ZZLA 4O5VA 4GO1A 3K10A 2NVYJ 3IP4B 3Q3SA 5D6EA 5E18F 1A6QA 4IKFA 2HDDA 4BU2A 4ENKA 2I10A 1P9QC 2EV6A 3JRGA 5F1RA 2A05A 1Z91A 2WAFA 3BLYA 1JJ6C 1ZGWA 1D5YA 2GXGA 5FRNA 4HA8A 2YPRA 2IVMA 4Z2YA 4BQQA 1LFUP 1R22A 2CQXA 2DQLA 2JJ7A 3HRUA 1X1DA 1JKOC 1T08B 2OJED 3OS2A 4O6JA 2CUEA 2EIJH 2HVQA 2WWYA 2BZTA 3J7YJ 2X4HA 4FETA 3BTJA 3K9TA 3WTVC 1K6YA 2WC2A 1S7OA 2H94A 2WB1A 3KLOA 2GXAA 5GP9A 4RM2A 1SFUA 3K4NA 4IHTA 3RIRA 1FNNA 4ZDPA 1D0YA 3NWSA 3PSFA 4IHWA 1E2XA 2BY1A 2EZIA 4RGXA 3L1PA 3L2WA 3CUQC 2DA2A 2W84A 5HVQC 1MBFA 4G6TB 4NNJA 1BR2A 2OF7A 2Y75A 4UUVA 4KN4X 2A6HF 3FXMA 2DXIA 2HOSA 2K9NA 1JTXA 2A5WA 3OS1A 2R7UA 2Q0OA 1LVAA 1OKRA 1ETVA 1Z77A 2HNHA 4M6YA 2QWWA 3HOZJ 1ONVA 3RYPA 1YLFA 1MDMA 5DD8A 1ZG3A 3WHCA 2WY7Q 5E1WA 3F21A 4IQJA 2RNJA 4ZYHA 1SD6A 4IVNA 3WG9A 1V4RA 1MBHA 2DMUA 1PUEE 1J0RA 3HGYA 4D9JA 4I6ZA 2XPUA 2JVGA 1WJBA 3KZYA 4KT6A 1ZR2A 2UXNA 3BCAA 3OYIA 4RB3C 3OYHA 1OJLA 3CJNA 4G6DA 2CRGA 1QZYA 4PCQA 4DOZA 2VJJA 3CCSI 2WADA 3VODA 3HXLA 2HXIA 1H0MA 1JT6A 3CDLA 2HVSA 3HOVJ 5K7FA 2CO5A 4HQMA 1OPCA 2XGEA 4UV9A 3WU1B 2IS2A 1JKQC 2LBFB 5D4SA 2XROA 2FNAA 2OZ6A 1JXSA 2PMHA 1H9GA 3KLNA 1M1EB 2V9VA 1U5TC 2BXZA 2YU3A 2MLKA 3H92A 3R60A 4A3DJ 4BNCA 1MJAA 3M8FA 2EV0A 3GZ5A 3GW2A 3CESA 2L9SA 2L54A 2LSOA 5KCMA 4BY7J 1FJLA 2QSFX 3G6EI 1FOXA 2R7OA 3JTHA 4YEJA 4I0AA 4YFNF 1MD0A 2JTVA 3GBGA 3RDIA 2MH9A 3U1KA 2OC6A 4H0EA 1ON1A 3ZQFA 4RS8A 4LGWA 4RGSA 1R4MB 2XGXA 3A2KA 2F6CA 5FLXZ 3CMAI 3H9GA 3MZ8A 3BG7A 1Y8QB 2EA4A 3NAUA 2BY2A 4K2EA 3GTOJ 1IJWC 5ICFA 2XRNA 1BW5A 2YR2A 5FLMJ 4U7BA 2PMUA 2ELKA 2CGPA 1MNEA 3H9QA 2XF6A 3RPQA 2QUFA 1S9HA 4RLQA 2VQLA 2BVLA 4IX7A 2R7FA 3K4JA 4IRIA 1ZGAA 5K7ZA 1B72A 2OBPA 5M3FJ 2LP0A 3QYBA 3PO3J 1P7IA 1BJAA 2XSDC 1LB2A 3DLLF 2KISA 3Q5FA 1ZLKA 5H20A 1A5JA 4XBFA 2YX4A 4DGWB 4ZYEA 3WTZA 1D1AA 4WX9A 2IGMA 2CQQA 5AIQA 4A3BJ 3HPGA 3N05A 4F52A 3U21A 1G2HA 4EJOA 4Z6YA 2KMUA 1XC5A 4BS9A 2LKXA 5TGTA 2KKOA 3M8JA 5BOXA 3G2BA 4IHVA 1X2MA 2XB5A 3FX3A 2EILH 3VDXA 2DT6A 1RI7A 1V55H 1FPQA 4IPAA 4RB0A 3RZOJ 1FWZA 3QAHA 3SDBA 3FIWA 2O8XA 1DPRA 4XIDA 3TP3A 1DGRM 2DMQA 2JK3A 2MABA 4AYBN 2COMA 5KVRA 5J6XA 1ZRFA 1X3UA 3BPXA 5IT9K 5J4YA 2L7KA 1MMDA 4I7HA 2JT1A 3H36A 4N0BA 4LIVA 3WTWC 4UUSA 3BTCA 2QF7A 3LSPA 3L2UA 1OCZH 3F3XA 4L9JA 2JA5J 5LGNA 1EH7A 4KN7X 1A36A 2Y69H 5DM6F 2ZCWA 3I71A 1WH7A 4XN0A 3J7ZI 1SAXA 2F4MB 2LY2A 4PJNA 5HODA 3BR2A 2E1MC 3TW6A 4XLHA 1LE8B 3IWFA 4XKWA 5LGTA 2TRTA 4E7IA 4XMYA 3S14J 4IRGA 2O8KA 2D5VA 3PM1A 2ZSIB 2EK5A 3GO5A 1DP3A 4KICA 5FB2A 1XD7A 2JSCA 2GQQA 3FM3A 2OTJI 3E6MA 2X1CA 2CV1A 2ID3A 1MIJA 4MTEA 2DFIA 2V26A 1YW7A 3BCBA 1OYIA 4PZJA 1D5VA 2FF4A 2DLLA 5CVIA 3WG7H 2HR3A 1JUSA 5DM7F 3KP3A 5CVRA 2M45A 5H2FC 3LQQA 3EPZA 2CUFA 3NEUA 3WHBA 1ZG1A 4IOCF 5FGMA 3L2RA 1YI2I 2X6XA 4AU7A 3KCCA 5M3MJ 5IP7J 4UXNA 1TTYA 3C18A 2J5OA 4AIJA 5CVVA 2TDXA 5DDGA 4GDFA 2GOXB 2XKOA 4JQFA 3WTXC 4JOMA 5JHFA 1G3WA 3A01B 2IGNA 2LFBA 3M7GA 3JTGA 1R4NB 2ZNZA 4AYBA 2V4JC 3MKLA 1EA3A 3K2AA 3MZHA 2ELHA 2F5VA 3HTUA 1I1SA 1IRFA 1B59A 4XR6A 2CW8A 2ADUA 2HEOA 4LD5A 5LHHA 3S8PA 4L9TA 5E1XA 1GDTA 1IRXA 3ULQB 4S05A 3J80Z 3BPVA 1T38A 1Z9CA 2GBYA 3MQ0A 1TP4A 3A1YA 2F5CA 2EFNA 1MBGA 1FYLA 3CP8A 3MWMA 3GYHX 4BXXJ 4RB2C 3S3NA 1QU3A 3WGHA 1MW7A 1ZARA 3F9KA 1OR7C 2PN6A 3BR5A 1K83J 4XICA 4CSWA 3EYYA 3S16J 2O5RA 1P2FA 3LSJA 1WKMA 4EM1A 3ZMZA 3JRCA 4D5CA 4YG2F 3KX2A 2WA0A 3A02A 1KGSA 3F23A 1WQ2A 4N4NB 2VPLA 1Y6IA 4I09A 2X0LA 4CGZA 1W7PA 2XVCA 3F6OA 4B4CA 4XL9A 2X9DA 3HRMA 3PIOF 2DA6A 2ICWG 3FKIJ 2E2HJ 4A3LJ 3W2VA 1HKQA 1SMTA 2KDOA 4ZZDA 1QPIA 2HI3A 3K0LA 2HU9A 2PJRA 3I59A 1ZHFA 2ZFWA 2XAGA 1KZHA 2Y9YA 3IAM2 3VOEA 4M74A 3FMRA 3DTIA 3BY6A 2AHQA 1BA5A 2EQRA 1FBUA 3P5JA 2VT2A 4A2UA 2NOGA 4R1HA 3K4KA 4HX8A 1EV7A 5CLSA 2OV7A 2XSJC 2VJ4A 3K1MA 1IV6A 1MMNA 3D1NI 4C2MJ 4DBQA 2CS3A 1YHQI 3H3VK 2WV1A 4XK4A 2QEXI 1IN7A 2H6BA 1XGOA 3LQRA 2XAQA 3GFIA 1HDDC 3CC7I 3CJQB 3CCYA 3EDPA 4HAMA 5ED4A 3CDIA 2HYFA 1ZQ3P 2EFOA 2A07F 3M3YJ 3SDGA 5L3CA 1T39A 3FWEA 3LSRA 1BM9A 3DP7A 1SFOJ 4CCLA 3H1CA 5BQTA 5JI6A 3QWLA 1AHDP 3G71I 3K4BA 1FOKA 3VYRB 5IOYA 4Y17A 3LFKA 3Q9VA 2E71A 1SD4A 2JQ7A 1LDDA 2CQKA 4CZZA 3SEZA 4S0HB 2OZUA 3E1SA 1G8XA 4BBSJ 1LDJA 3BR3A 3FF5A 2CG4A 4BE1A 4UNOA 1WJDA 3QOPA 5K1YA 1UFMA 3DU5A 2VBZA 4E70A 2ZO4A 4UVBA 4E7ZA 4BHPA 3G3ZA 5DUKA 3GX4X 3F72A 5M5YJ 1Y39A 2CFOA 1BJZA 2ISZA 3JSOA 5ILVA 1MJBA 4U87A 4BY1J 2KRHA 3VYSB 4XLCA 1I3QJ 3H9JA 4UVCA 3F8BA 2JPCA 2QSHX 2IS4A 5A2QZ 4LK0F 4ZJZA 5EG0A 3KEOA 2LF8A 4A0YA 2OD5A 4O3MA 2CQNA 3HDDA 1QHGA 5CVJA 2HQAA 4EJVA 2NS0A 3MVPA 2P6SA 2QBYB 2FBHA 2EV5A 3RSNA 3CO6C 3S1NJ 3ONQA 5ICEA 3DEEA 3TDZC 2Z99A
chains in the Genus database with same CATH topology
1V54H 3ASOH 2EIJH 2EINH 2DYSH 1OCRH 3AG4H 3X2QH 1OCZH 3ABMH 2EILH 2EIMH 2Y69H 2OCCH 3AG3H 3WG7H 3AG2H 3ASNH 5IY5H 1V55H 5B1BH 5B1AH 2EIKH 2DYRH 5B3SH 3AG1H 3ABKH 1OCCH 2ZXWH 1OCOH 3ABLH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V54 H;  3ASO H;  2EIJ H;  2EIN H;  2DYS H;  1OCR H;  3AG4 H;  3X2Q H;  1OCZ H;  3ABM H;  2EIL H;  2EIM H;  2Y69 H;  2OCC H;  3AG3 H;  3WG7 H;  3AG2 H;  3ASN H;  5IY5 H;  1V55 H;  5B1B H;  5B1A H;  2EIK H;  2DYR H;  5B3S H;  3AG1 H;  3ABK H;  1OCC H;  2ZXW H;  1OCO H;  3ABL H; 
#chains in the Genus database with same CATH topology
 4Q47 A;  3LFU A;  3EUA A;  4BQA A;  4ESJ A;  2PG4 A;  3OYK A;  3ZQQ A;  2O7O A;  4PGG A;  5JR3 A;  2AS5 F;  1UEL B;  2V1X A;  4DZP A;  1HKS A;  4KA4 A;  2E2J J;  4MO7 A;  2HWV A;  4D7M A;  1Z6T A;  2P0W A;  1TC3 C;  5IY5 H;  4GXO A;  2ZNY A;  3D5L A;  4I76 A;  4CH7 A;  2YS9 A;  2VUM J;  2ELJ A;  2Z5U A;  4B48 A;  3O8H A;  3CUQ A;  3LAP A;  3L2C A;  3OSF A;  2BGC A;  2K02 A;  3FXO A;  4XKV A;  1ZN2 A;  1I1G A;  5HLI A;  1H88 C;  4RAF A;  2I5U A;  3IV5 A;  4A3K J;  4RMN A;  4LIT A;  1Y56 A;  1R1V A;  3H5R A;  3I4N J;  1VQM I;  1UAA A;  4RDU A;  1WVR A;  4ETS A;  2XAF A;  1T8I A;  4HQE A;  2VQG A;  3RQI A;  3G4S I;  4FHT A;  4ENM A;  4BQO A;  4RA2 A;  3FM5 A;  1FP1 D;  4M3D A;  1RKT A;  4M3B A;  1XS9 A;  1GT0 C;  3FZV A;  2VQH A;  4AM3 A;  3O6B B;  5LEK A;  3ZQL A;  2ZME B;  3GME A;  1MZB A;  1QVT A;  1AA7 A;  1V54 H;  1IG7 A;  2BEO A;  4EQQ A;  2R5Z B;  1FIA A;  2CUZ A;  1HW1 A;  1NH3 A;  2JVH A;  2FML A;  5C3E J;  3CC4 I;  1GV5 A;  1ENH A;  3LSH A;  2M0C A;  5IP6 A;  3A03 A;  4MQV A;  2OCE A;  2W48 A;  4XKC A;  1IDY A;  2M4K A;  2BXY A;  3K7A J;  2YUS A;  4AWX B;  1SFE A;  1FMW A;  2Z1D A;  1X58 A;  1U5T A;  4BH9 A;  5EDN A;  4RGR A;  3M1C A;  1HOM A;  3L00 A;  2H1K A;  3BDD A;  1IAW A;  2UV1 A;  3QRF F;  4C3I J;  1MMG A;  2QQA A;  2EWN A;  5LHI A;  1Q1H A;  2QEN A;  4XLE A;  3FKJ A;  4M3F A;  2NS8 A;  2HQN A;  3FBN B;  3JRB A;  3CCR I;  1JHH A;  1IF1 A;  1ZR4 A;  5C4J J;  3VFZ A;  5CQG A;  2R7V A;  4JX4 A;  2KJB A;  3W3C A;  3M8E A;  2KRC A;  2IGK A;  1VQ7 I;  3E97 A;  2LMD A;  2KIQ A;  1YO5 C;  2KDZ A;  2QCO A;  2GIV A;  3LST A;  4WWC A;  1YQA A;  2WY8 Q;  4OWR B;  4F55 A;  1UHM A;  3X2Q H;  1UST A;  3GWZ A;  3L2V A;  1YRN B;  4L0Y B;  1YW8 A;  1B4A A;  1RRJ A;  1W36 C;  4HNT A;  2CW7 A;  2KIM A;  5HS7 A;  1DDN A;  4OIO F;  5F6F A;  5L3E A;  3LSM A;  2O61 A;  4LLL A;  3OSG A;  1MGT A;  1TT5 B;  3LMM A;  3E6C C;  3D5S C;  1DPU A;  3BZK A;  3CUO A;  2X6O A;  5K5R A;  4L0Z B;  2JRM A;  3COA C;  4ZTF A;  1ZAO A;  1HSJ A;  5L3B A;  1B72 B;  1BI1 A;  2VN2 A;  3W6V A;  1TNT A;  1RR8 C;  4KMU X;  4DW6 A;  1BR1 A;  1YS6 A;  2W00 A;  3QYF A;  4FQG A;  2DPU A;  2E19 A;  3OR2 C;  1BW6 A;  4ASN A;  3RPU D;  2EH3 A;  1MBE A;  5E3N A;  1HLV A;  4RLF A;  5J4V A;  2BV6 A;  1W36 D;  4MEY F;  2IA2 A;  1BBY A;  1MSF C;  1FSE A;  5ERI A;  4I0B A;  1LNW A;  2VJI A;  5DUI A;  4L18 B;  1E3H A;  3SYT A;  1JI8 A;  1KQ9 A;  1WJE A;  3ZQC A;  3C2B A;  2L5Q A;  4V2G A;  3DEU A;  3IWZ A;  4PSW A;  3TKY A;  2KZV A;  3LSK A;  4R8H A;  1S5L C;  2VXZ A;  3AG2 H;  1WCM J;  1UCR A;  2DFH A;  1REP C;  5EEA A;  2XC7 A;  2HDW A;  2ZJQ F;  2CV0 A;  2NOJ B;  2P81 A;  4BYY A;  3KEY A;  5FO5 A;  4S04 A;  3WTT C;  4BJ5 C;  2DMT A;  1WJ5 A;  2FEZ A;  2NNY A;  2V1U A;  4KIS A;  3AG1 H;  2MFZ A;  2DA4 A;  5LHG A;  1K4T A;  4OAY A;  3BG9 A;  1QHH D;  2OUM A;  3RI4 A;  3U1D A;  3OMY A;  3GCM A;  2IP2 A;  3M1E A;  1O7L A;  3DTK A;  5GAE J;  1I27 A;  3IKV A;  3GTM J;  4QTR A;  4CCN A;  3ECO A;  3DXJ F;  3I55 I;  3TO6 A;  4I2O A;  3C7J A;  1R71 A;  4ABZ A;  1TNS A;  3ZMT A;  1WFX A;  5F0C A;  5E3L A;  2NVU B;  1YIJ I;  5D5U B;  2P7V B;  1WSU A;  4HRI A;  3CJT B;  3P7N A;  4BE2 A;  2RNG A;  2R3S A;  3HC7 A;  1A31 A;  1NG6 A;  2N8G A;  4D0P A;  1DU0 A;  2PJP A;  5IT9 Z;  2M0M A;  2LKS A;  4HBL A;  1G3Y A;  3RKX A;  3ZN0 A;  5F64 A;  2LC2 A;  2BHY A;  2D2W A;  2E1C A;  4FX0 A;  1O3S A;  2IW5 A;  2K9M A;  2EB7 A;  3ERE D;  2JA2 A;  3JR9 A;  4CDG A;  1XSD A;  2H6C A;  4QPQ A;  1J09 A;  2DJN A;  5EYR A;  3N4M A;  1JGG A;  2EIK H;  2DYR H;  4LG3 A;  4KDP A;  2HYG D;  4CYC A;  1Q1V A;  1IUF A;  3K70 C;  4LFU A;  4NBQ A;  4AVP A;  2F48 A;  4WXH A;  1ETQ A;  4MFD A;  1N78 A;  2QZ8 A;  3DKW A;  1YG2 A;  5KHD A;  3AG4 H;  1B8I A;  2RQP A;  4A5N A;  2BW3 A;  3H5A A;  3QPH A;  3PSI A;  5D4R A;  1U78 A;  2MSY A;  4PJ0 C;  2QQ9 A;  4YII A;  4QLC U;  4A69 C;  3ZQG A;  3OYG A;  3DKY A;  1QGP A;  5TJJ A;  2JWT A;  3BP8 A;  1PP7 U;  3CP2 A;  4E7S A;  4M9S A;  2FMY A;  1AWC A;  3OYL A;  3IH3 A;  3AFH A;  3LAJ A;  2B63 J;  1RNL A;  1XMK A;  5CPR B;  4Y33 A;  1Y8R B;  2IJL A;  2Q1Z B;  2XUB A;  2Q8K A;  5LD2 C;  3ECH A;  3E3V A;  4UVA A;  5HLG A;  4BAC A;  1R5G A;  3ABM H;  1ITY A;  2W82 A;  1IN4 A;  2ETH A;  3KET A;  4HX4 A;  1B1B A;  2A6E F;  3S1R J;  3GLX A;  1VF9 A;  2IGO A;  4N9I A;  3K69 A;  5EEH A;  1AKH B;  3GUD A;  2XAS A;  3HB9 A;  4N4O B;  4FAS D;  4J00 A;  4JBA A;  2XIG A;  2LRE A;  4BHC A;  4V2F A;  1E17 A;  1IW7 F;  1H8A C;  5LFA A;  3WGI A;  1W7P B;  2A69 F;  2PQ8 A;  4G6Q A;  1EH6 A;  2CJJ A;  4EJU A;  2IAI A;  4G9Y A;  4ENN A;  5DCM A;  1NHA A;  1K7A A;  1SVO A;  1T6S A;  3KIO A;  2VPR A;  3HHH A;  3Q0W A;  2PJR B;  3OR1 C;  3I59 B;  3J81 Z;  3TO7 A;  1P6R A;  3PL8 A;  4A3I J;  3KP2 A;  1XCV A;  3FIS A;  2FNP A;  3IH4 A;  1TZL A;  2LK2 A;  3FXK A;  2EFP A;  2LNB A;  2MLG A;  2DO7 A;  2JA7 J;  3WOD F;  3MN2 A;  2L9R A;  1MH4 A;  2IA1 A;  3HL2 A;  5E8I A;  3P9I A;  2JSP A;  1QNT A;  1FP2 A;  4PJJ A;  1VQL I;  3HUG B;  3QPS A;  1HKT A;  1LEB A;  2VT3 A;  2HFH A;  2Y30 A;  1VQ8 I;  4L5E A;  4F92 B;  2FOK A;  1R5I D;  4A0Z A;  3V8J A;  5HNF A;  3GF2 A;  3PQJ A;  1YJW I;  1T98 A;  2K7L A;  2EA2 A;  4OIN F;  3N97 A;  3LA2 A;  2R7R A;  4A3E J;  3ZMV A;  5B1A H;  2VON A;  3S32 A;  2X85 A;  3I53 A;  3GTL J;  4FX4 A;  4Y13 A;  1LFB A;  2E7W A;  3V8L A;  3H0D A;  1YW9 A;  2Z9O A;  2DJI A;  2JRT A;  3OYF A;  1IXC A;  1YIT I;  4MEX F;  2MBF A;  2QQ8 A;  3CCM I;  2Z16 A;  1ULY A;  2AQE A;  2VI6 A;  3CMM A;  4KIT B;  3L2Q A;  2TCT A;  4B09 A;  4XKB A;  2LF7 A;  3JRF A;  1O3R A;  4TV7 A;  3LOC A;  4LG0 A;  1HW2 A;  4ZDL A;  2V9P A;  4C3J J;  3PUB A;  3VEP A;  4HOB A;  4HNU A;  3DF8 A;  3Q0U A;  3I5U A;  4HDV A;  3A4C A;  2CV2 A;  5FFZ A;  1ZLJ A;  1V3F A;  5EG0 B;  1R6R A;  2DPD A;  1JUP A;  2QYO A;  5LRR A;  1W4M A;  2NVX J;  2VOO A;  5DCF A;  4OIP F;  4KMF A;  4Q4Z F;  2P8T A;  2XB0 X;  2LH9 A;  3AL0 C;  1KA8 A;  3HOU J;  1YYV A;  4MTD A;  2E5Z A;  3R0J A;  2PMZ N;  2EIM H;  2R93 J;  3WU2 C;  1A6I A;  1S8N A;  3I4P A;  5HOO A;  3P9K A;  4D5F A;  3OYC A;  5ILU A;  3GFJ A;  3L7W A;  3OIO A;  3EET A;  4BXU A;  1ZYR F;  3GTP J;  5EEG A;  1TLH B;  2Q2E A;  1JE8 A;  2FUG 2;  3T8R A;  5HDN A;  4G94 A;  4RB1 A;  1TWG J;  2IEK A;  3F22 A;  2ZJP F;  5FRO A;  1I39 A;  2MH2 A;  1ODD A;  4F91 B;  2KFD A;  5F04 A;  1NK3 P;  2KRF A;  3S17 J;  3QP6 A;  3HBL A;  4DNC A;  1VQ9 I;  3OY9 A;  3ZP5 A;  4JX6 A;  3HSF A;  5FKL A;  1NK2 P;  4M9X A;  2XKP A;  5H6R A;  3E0J B;  2I8D A;  4MGR A;  4W97 A;  1XSX A;  3S93 A;  3ZQH A;  4E7H A;  5J40 A;  4IJA A;  5HLH A;  1YJN I;  3G1L A;  3ABK H;  4M9Z A;  1WJC A;  4FCY A;  4DZJ A;  4G7Z F;  1B9N A;  3IRR A;  1R1T A;  4NQW B;  2ZME C;  1E0E A;  3DBH B;  3R4K A;  3J81 K;  1STZ A;  2K4J A;  1HW5 A;  3CME I;  5BPI A;  4NDL A;  3C1D A;  3R6S A;  2HQ5 A;  3NRV A;  4U0Y A;  2HKO A;  3OOU A;  1GVJ A;  1MKM A;  2UZK A;  2K9S A;  3DWL E;  3ZPL A;  4A93 J;  1T0F A;  2H09 A;  2PMZ A;  3PFY A;  1RPW A;  2OU2 A;  1FX7 A;  4BJT A;  1I50 J;  1BI0 A;  2LBF A;  2UWM A;  3TQN A;  4H4K C;  2ZXW H;  2ZJR F;  2NYX A;  4CCJ A;  1DP7 P;  4A3G J;  3BQY A;  1IGN A;  1ZRE A;  3HG9 A;  1F4K A;  5LEJ A;  1D8J A;  2RRE A;  2G9W A;  2GM4 A;  2HS5 A;  3REO A;  3WE2 A;  1QBJ A;  2JMW A;  1Z67 A;  2DK8 A;  2EJR A;  4OMY A;  4WXD A;  4QIW N;  3AG3 H;  4M3G A;  3S2W A;  2V7F A;  2K9Q A;  4M72 A;  2GIZ A;  2WV0 A;  4LB6 B;  4BEH A;  1HA8 A;  1W5T A;  3WU0 A;  1P4A A;  3RJP A;  2HPI A;  3M4O J;  3BT9 A;  2KIU A;  4WK8 F;  1MBJ A;  1OCC H;  2M7A A;  2XDV A;  1UB9 A;  1FSH A;  2HKX A;  1DGW Y;  4ZH4 F;  1XDS A;  3OYA A;  3HHG A;  5DV5 A;  4HF2 A;  3HTS B;  3ZMU A;  1N77 A;  1CF7 A;  1IO2 A;  3VB2 A;  4BXF A;  2M87 A;  4XRM A;  2D1V A;  2FX0 A;  3RPU A;  1YFH A;  3KZZ A;  1D1B A;  4NC8 A;  5DEQ A;  2H1L A;  2PEX A;  1TBX A;  5F27 A;  1HC8 A;  1N25 A;  3TOA A;  1OYW A;  2VE8 A;  3ZMD A;  2NS7 A;  3S2H J;  3MD2 A;  1FT9 A;  2GA1 A;  2QM3 A;  4MHG A;  5K7H A;  4XOT A;  2FBI A;  3ZOB A;  1GXQ A;  3FMS A;  4IZZ A;  4HLY A;  2NXN B;  2VC0 A;  5BPD A;  3QYE A;  3W2A A;  1JKR C;  4GGG A;  4QSH A;  3IL2 A;  5F0H A;  3LSI A;  5GTI C;  4LLN A;  4II2 A;  4BE0 A;  2R7Q A;  2R7W A;  3BTL A;  1YS7 A;  4HPQ A;  2GOM A;  4Y15 A;  4XRS G;  2CSO A;  3HGG A;  4I99 C;  3J7A Y;  1S7A A;  3O3K A;  2K40 A;  2GXB A;  1EH8 A;  2W85 A;  5DD4 A;  4IF4 A;  2LRD A;  2OA4 A;  3HIF A;  4ZDO A;  4G8X A;  3ASO H;  1TW3 A;  3TBI A;  3QU3 A;  1P7J A;  5H6Q A;  3Q9S A;  4KIF A;  1SD7 A;  2XAU A;  3HOX J;  3CC2 I;  2M3A A;  3HYI A;  3I4M J;  2E7X A;  1X3Z B;  2MW8 A;  1YJ9 I;  1TQP A;  3C3W A;  2QVO A;  4EM2 A;  4ANJ A;  2P5K A;  2VAS A;  2X6Y A;  3G1O A;  1OIS A;  3D0S A;  2XHK A;  2FU4 A;  3HZJ A;  3F8M A;  1Z05 A;  1Z0X A;  2Z33 A;  4BL0 B;  4EGY A;  4HV5 A;  2GLO A;  3M07 A;  4P9F A;  1IZ1 A;  1KYW A;  2E1N A;  5DS9 A;  1LE8 A;  1UJ8 A;  3ERM A;  4UB8 C;  4YIF A;  2DOA A;  5AON A;  3S3O A;  2OPT A;  2G7H A;  4IHX A;  1MH3 A;  2JPB A;  1T56 A;  4L9N A;  5C44 J;  2M8E A;  1R9T J;  3LSG A;  5B1B H;  4DIQ A;  4M73 A;  1AOY A;  3SZP A;  2XAJ A;  2QSG X;  1HXD A;  3V7S A;  5J8F A;  2HPM A;  4PGH A;  4WCG A;  1APL C;  4J19 A;  2FQ4 A;  3OYD A;  2V6E A;  1RR7 A;  3G1M A;  2W25 A;  3F8N A;  2R7Z J;  3O2P E;  4ESF A;  3RZD J;  2FBK A;  3V7C A;  2QKM B;  4BJ6 C;  5IPA A;  1EJ9 A;  2CMP A;  2L9N A;  3O8G A;  2XPV A;  2DA3 A;  5CYV A;  3F6V A;  1D1C A;  3JAM Z;  3FK6 A;  5BMZ A;  1BL0 A;  3CF5 F;  1V5E A;  1XTA A;  2G0E A;  1JUM A;  3NQO A;  3ASN H;  3TDU C;  5CVU A;  2KL4 A;  3H0G J;  1KU2 A;  1F5T A;  1MSE C;  4UY8 I;  2R7D A;  2XF5 A;  4X0G A;  3R61 A;  1VTN C;  3JCU C;  4IEJ A;  5M5X J;  4IXA A;  2ESH A;  2L02 A;  3SHF A;  3T8T A;  1MND A;  4KUM A;  4BHB A;  3M9A A;  2IPQ X;  1VQ4 I;  1MDM B;  2VE9 A;  3ZN1 A;  2CQ7 A;  1FYK A;  1BC7 C;  3QP5 A;  2HVR A;  4PFO A;  2MYS A;  1SD5 A;  2Y2Z A;  4CYC B;  1XX5 A;  3I64 A;  4JYK A;  2E1O A;  4J01 A;  1PJR A;  2A3S A;  1SAU A;  2BOL A;  3BOQ A;  2K27 A;  5GAG J;  4BDY A;  3SZT A;  2HTS A;  2DAO A;  3UNG C;  3KE2 A;  4B3X A;  1U9N A;  1BN5 A;  2DTR A;  4BKX A;  2BW3 B;  1HDP A;  1W1W E;  3DPL C;  4L5I A;  4HX7 A;  4OOI A;  2HQR A;  1FZP B;  3ZCO A;  1K79 A;  1VQO I;  4KT5 C;  4XRS A;  2K3P A;  4PJL A;  3DBL B;  2B0L A;  3I9V 2;  3GLL A;  2JA6 J;  3KP7 A;  4AIH A;  3CF2 A;  2EFQ A;  3CD6 I;  3I54 A;  1SEU A;  5LLQ A;  3S15 J;  2PI0 A;  4JX5 A;  5GAD J;  1UZC A;  3FHN A;  1NG7 A;  5GPA A;  4P1W A;  3E5U A;  2ZJ2 A;  1F36 A;  2KP6 A;  3K4C A;  1XDU A;  3HSR A;  1YE9 A;  4EV0 A;  4PUS A;  1RZ4 A;  4A6E A;  4GRI A;  4I98 B;  1I5Z A;  1GLN A;  3TP0 A;  2O03 A;  2QQB A;  2O9L A;  3ABU A;  3I56 I;  3PIP F;  4C2T A;  5DCM B;  1SAN A;  4B3A A;  1XGM A;  2ZKZ A;  5HS9 A;  2V1N A;  4L9V A;  4HG2 A;  4ZC3 A;  1D3Y A;  4JP0 A;  4UB6 C;  3IC7 A;  3CZ6 A;  4M6V A;  1YX3 A;  2AXL A;  1W0T A;  2GZW A;  2E5N A;  1WJA A;  3H3U A;  2VOD A;  2K5C A;  1YIO A;  3MZY A;  2R7S A;  2OQR A;  3LNQ A;  2ZBK A;  1O57 A;  1XG1 A;  3OL4 A;  2KZG A;  5L3F A;  3Q0V A;  3JSP A;  5C4X J;  5KK1 A;  1MNM C;  1OCT C;  4M71 A;  2KLO A;  1VND A;  3B02 A;  4IRH A;  3K4L A;  4XOP A;  3W6K B;  3ML6 A;  3CCE I;  5E79 C;  3EUK L;  4C9Y A;  3RTR A;  4HLX A;  2EFW A;  4NUB A;  4YRV A;  2Y31 A;  4Y7N J;  2DT7 B;  3IKT A;  3FXU A;  2RAE A;  4XLP F;  4FTH A;  5JVG F;  5F1J A;  1ZRC A;  3HRS A;  3ZQ7 A;  2VC1 A;  3KP6 A;  4F93 B;  2RN7 A;  4UUT A;  4RBO A;  4GYI A;  4UV8 A;  4A5M A;  3DTE A;  2A6T A;  1N75 A;  2HZT A;  2DOD A;  1A35 A;  3CCL I;  4XQF A;  2WB1 N;  2F5D A;  1F43 A;  2QLZ A;  3MAJ A;  1S72 I;  3BJ6 A;  3FXQ A;  2K4B A;  3KYL A;  2M8G X;  3JAM K;  2VKD A;  4W1U A;  3J7A O;  1W5C C;  2OQG A;  2MC3 A;  4PSX A;  4PJM A;  2Y48 A;  2XF7 A;  5ILS A;  1Y1W J;  2E35 A;  4UUS B;  1OLT A;  2F5E A;  3FXJ A;  3LA3 A;  5CJ9 A;  3WTY C;  5D6F A;  1J75 A;  4RM3 A;  1U3E M;  2MC4 A;  1LEA A;  3MEX A;  5FKO A;  4G12 A;  2QBY A;  2M2E A;  5E8G A;  1WI3 A;  2EZK A;  3ELK A;  1EF4 A;  2VBX A;  2VIX A;  3VSL A;  2ESN A;  4HF0 A;  3MCZ A;  2GA2 A;  2GAU A;  4U0V A;  2RQQ A;  2HOE A;  4Y52 J;  2Y0M A;  3UR3 C;  1FYM A;  2UUZ A;  3VSK A;  1DU6 A;  5KNL A;  2L7M P;  4F3Q A;  2HOA A;  2D45 A;  1HBX G;  1XCB A;  2G7U A;  4E4H A;  3K1P A;  3KFW X;  1FMV A;  1O7F A;  1WJF A;  2DT5 A;  2KHM A;  5B5E C;  3V7R A;  2X51 A;  3AAF A;  1TWH J;  2O0Y A;  4EJW A;  4Q48 A;  4CCO A;  3RKW A;  3BG6 A;  2W4S A;  5FLV A;  2NNN A;  2EIN H;  3QPL A;  4LOC A;  1UHW A;  1WPK A;  1S29 A;  1VI0 A;  2M34 A;  1TT0 A;  4P9U A;  2Q2E B;  1WH5 A;  3T5X A;  3DPT A;  1W0U A;  2X1D A;  5ICC A;  2Z2S B;  5FD5 A;  3HRT A;  4XNF A;  5GPC A;  3OYJ A;  5GAH J;  1MJ9 A;  2H8W A;  3KP4 A;  1K78 A;  1EKE A;  4KFC A;  3G73 A;  1WRJ A;  1ETW A;  3ZRG A;  3ZGK A;  4AID A;  5BS6 A;  1NTC A;  4DYQ A;  1ON2 A;  4B8X A;  2BY3 A;  1OCO H;  4I02 A;  5JLX A;  1YTY A;  2AQF A;  1X1B A;  1X1A A;  1Z3X A;  3BZC A;  5KAI C;  2ECB A;  2M7B A;  3GTQ J;  1Z6R A;  4XSZ F;  3BR6 A;  4EM0 B;  2L7Z A;  1JHF A;  1KU3 A;  5JLW A;  1UG2 A;  3BWG A;  2ZME A;  4QWQ A;  1PUF A;  4NC7 A;  3E7L A;  2ME0 A;  1SFK A;  2WAE A;  3BTI A;  1R1U A;  1I3A A;  2VBW A;  2BHZ A;  2L0K A;  2DFE A;  4NC6 A;  1K61 A;  4EJT A;  2AXT C;  5JHU A;  2R5Z A;  2QGU A;  1GV2 A;  3MMY B;  1SVL A;  3K6G A;  2ME6 A;  5D8K B;  1OR7 A;  2IS6 A;  1IXR C;  5IYD J;  2B9S A;  3BJA A;  4P55 A;  4LB5 A;  2ZFU A;  4FE7 A;  1IRG A;  2RGV A;  1USS A;  2MD5 A;  1QVU A;  3HJE A;  2L3D A;  2VBY A;  1IRZ A;  4IHS A;  3C2G A;  5J1Y A;  2KQR A;  1U8R A;  1RET A;  4YIR X;  3R0A A;  2DA5 A;  1PP8 F;  3OYE A;  1PVE A;  2DMN A;  4HYE A;  4ITV A;  3K70 D;  1JT0 A;  2IRF G;  3OS0 A;  1GHC A;  2XAH A;  1X19 A;  5LBQ A;  5EF6 A;  3BRO A;  4ZYD A;  2VQC A;  1P92 A;  4JK1 X;  5E20 A;  1Z7L A;  3KEQ A;  2HYJ A;  2VLA A;  1ETX A;  1B9M A;  4EMS A;  1ZRD A;  1V5F A;  1CGP A;  2RVC A;  3CLQ A;  3RKY A;  1BC8 C;  5IP9 J;  4EEF G;  3KYC B;  2A68 F;  2BE5 F;  1WWX A;  4A3F J;  1Y0N A;  3EUH C;  2IS1 A;  2IA0 A;  4Q5S F;  1X4P A;  3AKZ A;  2P6T A;  1ZEL A;  4DBR A;  4BEH B;  3OYB A;  3HSE A;  2X6W A;  5E1Z B;  2STT A;  5IOZ A;  2LY9 A;  2P4W A;  2NAZ A;  4WXC A;  1KU9 A;  4CZC A;  4HF1 A;  1YRN A;  4B47 A;  1VQ6 I;  5EGO A;  3SFZ A;  3WE3 A;  1VFC A;  2K3F A;  4OU0 A;  1CF7 B;  4AC0 A;  3IRQ A;  2V79 A;  2CH0 A;  3DPU A;  3HPH A;  3KPH A;  1O3Q A;  2CWE A;  1MMA A;  1QPM A;  5BNG A;  2Y9Z A;  1BI3 A;  2ECC A;  2R92 J;  2M5W A;  1RUO A;  5D5X B;  3GFM A;  3IHU A;  1IN8 A;  3MKY B;  3CTA A;  3HOT A;  2ZB9 A;  4G7H F;  2P7C B;  1VQP I;  2DDB A;  3H5N A;  1U8B A;  1BOA A;  1WHU A;  4GCV A;  1UMQ A;  2FJ1 A;  5AIP A;  1XMA A;  3FDY A;  1O4X A;  4U7D A;  3LWF A;  2LR8 A;  3CCJ I;  2EZL A;  4P5O A;  3HM5 A;  1IV8 A;  4N9H A;  4A12 A;  4ENJ A;  2PX9 A;  3GTJ J;  5B3S H;  4XLA A;  2DTZ A;  4RAZ A;  2HGC A;  3DLA A;  2HDC A;  3K4M A;  1J7K A;  1P4X A;  3TL4 X;  2VXD A;  2K9L A;  1BIB A;  4BBR J;  1ZG5 A;  4IOA F;  4ON0 A;  1WI9 A;  1UHS A;  3RCO A;  2JUG A;  2R5Y A;  4XM3 A;  4G7O F;  1LDK B;  3KP5 A;  2YU9 J;  3FK7 A;  4PFP A;  2LLK A;  3MKW B;  1ZK8 A;  4AUX A;  5FKN A;  4HEA 2;  4HZF A;  1IDZ A;  1GXP A;  4C3H J;  2LKP A;  3K1N A;  1XB4 A;  2DI3 A;  1FEX A;  3V4G A;  1U6G A;  1IXS B;  1H89 C;  4MLO A;  3PUF A;  3TGN A;  3SQN A;  2DCE A;  1XPX A;  2CW0 F;  1RES A;  2ZXJ A;  3CLO A;  2P5V A;  4BGD A;  5IYB J;  2BYV E;  4CIC A;  3PJR A;  4XLN F;  2KIF A;  4A3J J;  2JUC A;  3WTS C;  1Z21 A;  1A04 A;  1ZH5 A;  1CQT A;  3PNY A;  3ZXS A;  4EVI A;  4KIB A;  3IUO A;  5K5Q A;  5HS8 A;  5K5O A;  4HST A;  3L9F A;  3PO2 J;  5J3L A;  1SFX A;  1X1P A;  3DEW A;  2LYC A;  2X1E A;  1FLI A;  3QPT A;  4EAT A;  2X48 A;  2DOF A;  4Y3O A;  2P5L C;  2C6Y A;  2L01 A;  4LJZ F;  3BC8 A;  5D5W B;  2W7N A;  4HSR A;  2CUJ A;  2VOP A;  1IUY A;  5CQE A;  5F08 A;  1TQM A;  5J8C A;  1GUU A;  3W6J B;  2DDA A;  2LG4 A;  1XN7 A;  3JW4 A;  2CYY A;  2L7F P;  3HOW J;  4X6A J;  3CUQ B;  2M1B A;  1BOB A;  5LRS A;  3ZMS A;  1UG0 A;  3MFK A;  1QZE A;  4Y4R A;  4KYW A;  4PDK A;  5FJ8 J;  1MMS A;  2R7T A;  1Z1D A;  4B44 A;  3HKZ N;  1RKW A;  2LTP A;  4A3C J;  3S1Q J;  3KZI C;  3CCV I;  1VQN I;  1FY7 A;  4AD9 A;  1U2W A;  1X1C A;  1HCR A;  1KQ8 A;  2L9V A;  2MA3 A;  2VKE A;  2R4G A;  5FLX K;  4U88 A;  3TO9 A;  3DU6 A;  2ZXI A;  1X3W B;  1VZ0 A;  3ROU A;  3GVA A;  3BG3 A;  2UXX A;  3RYR A;  4KJZ A;  3DFG A;  3D5R C;  5D5V B;  3OYM A;  4MQ9 F;  1IN6 A;  5EZG A;  2PBI A;  2V9K A;  4P96 A;  3GEZ A;  2NVQ J;  4OIQ F;  3T1B A;  2BY0 A;  2OAZ A;  4QPO A;  3OL3 A;  3C2H A;  5D8L B;  2FQ3 A;  3GTG J;  3WGG A;  5F0F A;  5GTH C;  4DJA A;  4OIR F;  1W5S A;  1XMX A;  4CCM A;  1U5T B;  6PAX A;  1X2N A;  2B7E A;  2O3F A;  2FSW A;  1JKP C;  1S6L A;  3DV8 A;  2H27 A;  4FE4 A;  4DYR A;  1BIA A;  3KYD B;  4KNY A;  1QZZ A;  2LD5 A;  1AKH A;  1L0O C;  1B6A A;  2VKH A;  3ABL H;  4WF2 A;  3CQZ J;  3FBI B;  2ISY A;  1LUJ B;  1RC9 A;  2VB6 A;  4GYG A;  1V5G A;  5JVT A;  4CO8 A;  2FD5 A;  3HKZ A;  3BR1 A;  3P9C A;  3VWB A;  4YFX F;  1WZ2 A;  1JGS A;  2EBI A;  5ICG A;  1J59 A;  4CHU A;  3OIQ A;  2R0Q C;  1I6H J;  1DQU A;  2RC4 A;  2FXA A;  2D1H A;  4U0W A;  1FOW A;  2O6G E;  5L3D A;  2NVT J;  2PFB A;  3OIP A;  1YX5 A;  2KT0 A;  3JRD A;  3V8K A;  3B73 A;  2RKH A;  1QO0 D;  1TW2 A;  1LFP A;  4MIM A;  2J5P A;  5FKK A;  4NHJ A;  1Y1V J;  1D8K A;  2V6C A;  1YOV B;  2YX7 A;  1QRY A;  2DMP A;  4HW0 A;  4BUP A;  1RUN A;  3GTK J;  2ID6 A;  5FRM A;  2EPF A;  3S1M J;  1G3S A;  1FBS A;  1PYV A;  3HUG A;  1Y0U A;  4E6K G;  3U2R A;  2R7X A;  2ZC2 A;  4D1Q A;  3H35 A;  5E17 F;  1FTZ A;  1F9N A;  1ETO A;  1G59 A;  4YEL A;  4XN3 A;  1FBQ A;  1K4S A;  3OWT A;  3MKZ A;  2JZY A;  3HEF A;  3SZG A;  2VKV A;  2Z3Y A;  3CDH A;  2DBB A;  3JRE A;  3VPR A;  1JTY A;  3GZN B;  5HDK A;  2XGD A;  2IBD A;  2EZH A;  3V42 A;  1OMI A;  1LPQ A;  4A0X A;  2F4I A;  2M9H A;  1XGS A;  4A3M J;  1R36 A;  3GXO A;  3PNT A;  2HTJ A;  2QA4 I;  2FE3 A;  1KQ0 A;  3IH2 A;  3QOD A;  4RAY A;  5JFR A;  3W2W A;  4PK4 A;  1ORK A;  2PLY A;  1HQC A;  2K86 A;  1C0W A;  1ZKG A;  4OMZ A;  3LA7 A;  3VYT B;  4CUG A;  2RDP A;  1BI2 A;  2W24 A;  4XLF A;  1ACI A;  1H9T A;  2XRL A;  4NB5 A;  4L5J A;  4M6X A;  4IO9 F;  4V19 K;  1D0X A;  3PQK A;  1QA6 A;  4XON A;  4B43 A;  4LIU A;  3S2D J;  2WAQ N;  5FD6 A;  1S3J A;  5L3G A;  2XV4 S;  2L2O A;  2LDU A;  2L4M A;  1R7J A;  3PFI A;  1ETK A;  2E1M B;  1I6X A;  4AIK A;  5HDG A;  4RAG A;  3J80 K;  4BAY A;  4B1R A;  1L3L A;  3TMO A;  3DBR B;  4F7Z A;  3CCQ I;  4LK1 F;  1FTT A;  2LOO A;  3CJR B;  3BG5 A;  4YFK F;  4AVZ A;  2OTL I;  4HNV A;  3AL0 B;  2NRA C;  5IYC J;  3FXL A;  1OQY A;  3BJO A;  3FHZ A;  3SXY A;  4GFB A;  1RIO H;  4M3E A;  1OCR H;  1ERD A;  4KIG A;  3HOS A;  3DCF A;  3E6D A;  3FXR A;  2FA5 A;  1FIP A;  4I01 A;  2CU7 A;  5J47 A;  3A01 A;  3SJM A;  3ISP A;  4XRF A;  3TOB A;  1G6N A;  2ACJ A;  4BQN A;  1VQ5 I;  3JRI A;  1BR4 A;  2A61 A;  1G4D A;  3S3M A;  1T2K A;  1G3T A;  1S7E A;  2MD0 A;  3A0B C;  3DKX A;  3F0C A;  1POG A;  3K2Z A;  4IQ4 A;  5EZH A;  3BQZ A;  1IN5 A;  2FRH A;  1SC7 A;  3CMY A;  1ZTR A;  2Y0S N;  3FMQ A;  5J1U A;  4CA0 A;  5IT3 A;  1TWA J;  4OAZ A;  1J9I A;  2E34 A;  3F8C A;  3BR0 A;  4CCK A;  1K78 B;  1HST A;  2ZSH B;  2DW4 A;  4RGU A;  4A6D A;  1FC3 A;  3NWT A;  4NQW A;  4ZYG A;  2FOW A;  1KON A;  1SMY F;  3QOE A;  4MFE A;  3JRH A;  1OFC X;  5FKM A;  1ZGJ A;  5B66 C;  2COB A;  2WAQ A;  3I0T A;  3ZQI A;  9ANT A;  1PUF B;  1WGX A;  2LVS A;  1FOY A;  1B8I B;  4ZYA A;  4C30 A;  2DFF A;  2XGC A;  2BVM A;  1OCP A;  3EQL F;  3GZ6 A;  5TIS C;  2A5Y B;  2LY1 A;  2GWR A;  3WTU C;  2HZD A;  1E3O C;  4XOR A;  5DTD A;  3LL7 A;  3OOP A;  2DQR A;  1T0F C;  4DQ2 A;  4FIS A;  2OCC H;  2W1O A;  1PDN C;  3RQ4 A;  2QKL B;  3SEQ A;  3EYI A;  1QQI A;  3ESW B;  1TL8 A;  1D0Z A;  3PNV A;  5HLT A;  4XSX F;  1LKX A;  3UKG A;  2M30 A;  5E3M A;  2F5F A;  1Z3Y A;  2F2E A;  2MGQ A;  1JJ8 C;  2L4A A;  4LMY A;  2E36 A;  1P4W A;  1R23 A;  2F4O B;  4CYD A;  2AO9 A;  1R5H A;  1XGN A;  3B6A A;  4ZTJ A;  4D7N A;  4E7J A;  2K85 A;  4E7L A;  4HV6 A;  1DUX C;  3EUH A;  1MBK A;  1E3P A;  3IAS 2;  2Y0S A;  3E5X A;  5FFX A;  5HNH A;  1K6O A;  1R58 A;  3OYN A;  2WTE A;  1LJ9 A;  3E6B A;  1R49 A;  3I3L A;  1U9O A;  2KPM A;  4DYC A;  3T0Y A;  3RKQ A;  2HXO A;  5KAF C;  4IL6 C;  5CKT A;  3L09 A;  2DK5 A;  3JRA A;  4X1E A;  1T33 A;  2DN0 A;  2WBM A;  1Z7U A;  2XPW A;  5DYM A;  1HF0 A;  4E7K A;  3A0H C;  1LQ1 A;  2W57 A;  1J5Y A;  3TW7 A;  5M5W J;  4HDU A;  2DYS H;  5E3O A;  4R79 A;  2IT0 A;  2E60 A;  3VYU B;  5EGO B;  5A2Q K;  4IHY A;  3TED A;  1O3T A;  3E5Q A;  5EJC A;  2STW A;  1GVD A;  3B6C A;  1W7P D;  3F8F A;  4FT8 A;  2HOT A;  1LVK A;  4II3 A;  1X4O A;  1VQK I;  1J2X A;  1TQI A;  2YSR A;  1F1Z A;  2H8R A;  3ABT A;  4BDZ A;  2CFX A;  1OYY A;  3BZ6 A;  2ZXH A;  2DOE A;  2V1D A;  3H3Z A;  3NAR A;  1SVM A;  3I58 A;  3QU6 A;  3CCU I;  3CO7 C;  3U9G A;  2JA8 J;  1R00 A;  2VL8 A;  2RV8 A;  1AU7 A;  2IXS A;  2E2I J;  5J1R A;  1KU7 A;  2M4G A;  2KJC A;  3HOY J;  1U0J A;  3GFL A;  1IC8 A;  1ETY A;  2DA1 A;  4UHT A;  5LGU A;  4EGZ A;  1KYZ A;  2BBY A;  4CXF A;  2MG4 A;  3DQV C;  4C2U A;  3SFI A;  1T95 A;  3QQA A;  5TRD A;  3OV8 A;  2DU9 A;  3ZR8 X;  1TWC J;  4LLG F;  2R5Y B;  2VJ5 A;  1TWF J;  2JN6 A;  4ESB A;  2DA7 A;  4LG0 B;  1XSV A;  4MNU A;  4ZZL A;  4O5V A;  4GO1 A;  3K10 A;  2NVY J;  3IP4 B;  3Q3S A;  5D6E A;  5E18 F;  1A6Q A;  4IKF A;  2HDD A;  4BU2 A;  4ENK A;  2I10 A;  1P9Q C;  2EV6 A;  3JRG A;  5F1R A;  2A05 A;  1Z91 A;  2WAF A;  3BLY A;  1JJ6 C;  1ZGW A;  1D5Y A;  2GXG A;  5FRN A;  4HA8 A;  2YPR A;  2IVM A;  4Z2Y A;  4BQQ A;  1LFU P;  1R22 A;  2CQX A;  2DQL A;  2JJ7 A;  3HRU A;  1X1D A;  1JKO C;  1T08 B;  2OJE D;  3OS2 A;  4O6J A;  2CUE A;  2EIJ H;  2HVQ A;  2WWY A;  2BZT A;  3J7Y J;  2X4H A;  4FET A;  3BTJ A;  3K9T A;  3WTV C;  1K6Y A;  2WC2 A;  1S7O A;  2H94 A;  2WB1 A;  3KLO A;  2GXA A;  5GP9 A;  4RM2 A;  1SFU A;  3K4N A;  4IHT A;  3RIR A;  1FNN A;  4ZDP A;  1D0Y A;  3NWS A;  3PSF A;  4IHW A;  1E2X A;  2BY1 A;  2EZI A;  4RGX A;  3L1P A;  3L2W A;  3CUQ C;  2DA2 A;  2W84 A;  5HVQ C;  1MBF A;  4G6T B;  4NNJ A;  1BR2 A;  2OF7 A;  2Y75 A;  4UUV A;  4KN4 X;  2A6H F;  3FXM A;  2DXI A;  2HOS A;  2K9N A;  1JTX A;  2A5W A;  3OS1 A;  2R7U A;  2Q0O A;  1LVA A;  1OKR A;  1ETV A;  1Z77 A;  2HNH A;  4M6Y A;  2QWW A;  3HOZ J;  1ONV A;  3RYP A;  1YLF A;  1MDM A;  5DD8 A;  1ZG3 A;  3WHC A;  2WY7 Q;  5E1W A;  3F21 A;  4IQJ A;  2RNJ A;  4ZYH A;  1SD6 A;  4IVN A;  3WG9 A;  1V4R A;  1MBH A;  2DMU A;  1PUE E;  1J0R A;  3HGY A;  4D9J A;  4I6Z A;  2XPU A;  2JVG A;  1WJB A;  3KZY A;  4KT6 A;  1ZR2 A;  2UXN A;  3BCA A;  3OYI A;  4RB3 C;  3OYH A;  1OJL A;  3CJN A;  4G6D A;  2CRG A;  1QZY A;  4PCQ A;  4DOZ A;  2VJJ A;  3CCS I;  2WAD A;  3VOD A;  3HXL A;  2HXI A;  1H0M A;  1JT6 A;  3CDL A;  2HVS A;  3HOV J;  5K7F A;  2CO5 A;  4HQM A;  1OPC A;  2XGE A;  4UV9 A;  3WU1 B;  2IS2 A;  1JKQ C;  2LBF B;  5D4S A;  2XRO A;  2FNA A;  2OZ6 A;  1JXS A;  2PMH A;  1H9G A;  3KLN A;  1M1E B;  2V9V A;  1U5T C;  2BXZ A;  2YU3 A;  2MLK A;  3H92 A;  3R60 A;  4A3D J;  4BNC A;  1MJA A;  3M8F A;  2EV0 A;  3GZ5 A;  3GW2 A;  3CES A;  2L9S A;  2L54 A;  2LSO A;  5KCM A;  4BY7 J;  1FJL A;  2QSF X;  3G6E I;  1FOX A;  2R7O A;  3JTH A;  4YEJ A;  4I0A A;  4YFN F;  1MD0 A;  2JTV A;  3GBG A;  3RDI A;  2MH9 A;  3U1K A;  2OC6 A;  4H0E A;  1ON1 A;  3ZQF A;  4RS8 A;  4LGW A;  4RGS A;  1R4M B;  2XGX A;  3A2K A;  2F6C A;  5FLX Z;  3CMA I;  3H9G A;  3MZ8 A;  3BG7 A;  1Y8Q B;  2EA4 A;  3NAU A;  2BY2 A;  4K2E A;  3GTO J;  1IJW C;  5ICF A;  2XRN A;  1BW5 A;  2YR2 A;  5FLM J;  4U7B A;  2PMU A;  2ELK A;  2CGP A;  1MNE A;  3H9Q A;  2XF6 A;  3RPQ A;  2QUF A;  1S9H A;  4RLQ A;  2VQL A;  2BVL A;  4IX7 A;  2R7F A;  3K4J A;  4IRI A;  1ZGA A;  5K7Z A;  1B72 A;  2OBP A;  5M3F J;  2LP0 A;  3QYB A;  3PO3 J;  1P7I A;  1BJA A;  2XSD C;  1LB2 A;  3DLL F;  2KIS A;  3Q5F A;  1ZLK A;  5H20 A;  1A5J A;  4XBF A;  2YX4 A;  4DGW B;  4ZYE A;  3WTZ A;  1D1A A;  4WX9 A;  2IGM A;  2CQQ A;  5AIQ A;  4A3B J;  3HPG A;  3N05 A;  4F52 A;  3U21 A;  1G2H A;  4EJO A;  4Z6Y A;  2KMU A;  1XC5 A;  4BS9 A;  2LKX A;  5TGT A;  2KKO A;  3M8J A;  5BOX A;  3G2B A;  4IHV A;  1X2M A;  2XB5 A;  3FX3 A;  2EIL H;  3VDX A;  2DT6 A;  1RI7 A;  1V55 H;  1FPQ A;  4IPA A;  4RB0 A;  3RZO J;  1FWZ A;  3QAH A;  3SDB A;  3FIW A;  2O8X A;  1DPR A;  4XID A;  3TP3 A;  1DGR M;  2DMQ A;  2JK3 A;  2MAB A;  4AYB N;  2COM A;  5KVR A;  5J6X A;  1ZRF A;  1X3U A;  3BPX A;  5IT9 K;  5J4Y A;  2L7K A;  1MMD A;  4I7H A;  2JT1 A;  3H36 A;  4N0B A;  4LIV A;  3WTW C;  4UUS A;  3BTC A;  2QF7 A;  3LSP A;  3L2U A;  1OCZ H;  3F3X A;  4L9J A;  2JA5 J;  5LGN A;  1EH7 A;  4KN7 X;  1A36 A;  2Y69 H;  5DM6 F;  2ZCW A;  3I71 A;  1WH7 A;  4XN0 A;  3J7Z I;  1SAX A;  2F4M B;  2LY2 A;  4PJN A;  5HOD A;  3BR2 A;  2E1M C;  3TW6 A;  4XLH A;  1LE8 B;  3IWF A;  4XKW A;  5LGT A;  2TRT A;  4E7I A;  4XMY A;  3S14 J;  4IRG A;  2O8K A;  2D5V A;  3PM1 A;  2ZSI B;  2EK5 A;  3GO5 A;  1DP3 A;  4KIC A;  5FB2 A;  1XD7 A;  2JSC A;  2GQQ A;  3FM3 A;  2OTJ I;  3E6M A;  2X1C A;  2CV1 A;  2ID3 A;  1MIJ A;  4MTE A;  2DFI A;  2V26 A;  1YW7 A;  3BCB A;  1OYI A;  4PZJ A;  1D5V A;  2FF4 A;  2DLL A;  5CVI A;  3WG7 H;  2HR3 A;  1JUS A;  5DM7 F;  3KP3 A;  5CVR A;  2M45 A;  5H2F C;  3LQQ A;  3EPZ A;  2CUF A;  3NEU A;  3WHB A;  1ZG1 A;  4IOC F;  5FGM A;  3L2R A;  1YI2 I;  2X6X A;  4AU7 A;  3KCC A;  5M3M J;  5IP7 J;  4UXN A;  1TTY A;  3C18 A;  2J5O A;  4AIJ A;  5CVV A;  2TDX A;  5DDG A;  4GDF A;  2GOX B;  2XKO A;  4JQF A;  3WTX C;  4JOM A;  5JHF A;  1G3W A;  3A01 B;  2IGN A;  2LFB A;  3M7G A;  3JTG A;  1R4N B;  2ZNZ A;  4AYB A;  2V4J C;  3MKL A;  1EA3 A;  3K2A A;  3MZH A;  2ELH A;  2F5V A;  3HTU A;  1I1S A;  1IRF A;  1B59 A;  4XR6 A;  2CW8 A;  2ADU A;  2HEO A;  4LD5 A;  5LHH A;  3S8P A;  4L9T A;  5E1X A;  1GDT A;  1IRX A;  3ULQ B;  4S05 A;  3J80 Z;  3BPV A;  1T38 A;  1Z9C A;  2GBY A;  3MQ0 A;  1TP4 A;  3A1Y A;  2F5C A;  2EFN A;  1MBG A;  1FYL A;  3CP8 A;  3MWM A;  3GYH X;  4BXX J;  4RB2 C;  3S3N A;  1QU3 A;  3WGH A;  1MW7 A;  1ZAR A;  3F9K A;  1OR7 C;  2PN6 A;  3BR5 A;  1K83 J;  4XIC A;  4CSW A;  3EYY A;  3S16 J;  2O5R A;  1P2F A;  3LSJ A;  1WKM A;  4EM1 A;  3ZMZ A;  3JRC A;  4D5C A;  4YG2 F;  3KX2 A;  2WA0 A;  3A02 A;  1KGS A;  3F23 A;  1WQ2 A;  4N4N B;  2VPL A;  1Y6I A;  4I09 A;  2X0L A;  4CGZ A;  1W7P A;  2XVC A;  3F6O A;  4B4C A;  4XL9 A;  2X9D A;  3HRM A;  3PIO F;  2DA6 A;  2ICW G;  3FKI J;  2E2H J;  4A3L J;  3W2V A;  1HKQ A;  1SMT A;  2KDO A;  4ZZD A;  1QPI A;  2HI3 A;  3K0L A;  2HU9 A;  2PJR A;  3I59 A;  1ZHF A;  2ZFW A;  2XAG A;  1KZH A;  2Y9Y A;  3IAM 2;  3VOE A;  4M74 A;  3FMR A;  3DTI A;  3BY6 A;  2AHQ A;  1BA5 A;  2EQR A;  1FBU A;  3P5J A;  2VT2 A;  4A2U A;  2NOG A;  4R1H A;  3K4K A;  4HX8 A;  1EV7 A;  5CLS A;  2OV7 A;  2XSJ C;  2VJ4 A;  3K1M A;  1IV6 A;  1MMN A;  3D1N I;  4C2M J;  4DBQ A;  2CS3 A;  1YHQ I;  3H3V K;  2WV1 A;  4XK4 A;  2QEX I;  1IN7 A;  2H6B A;  1XGO A;  3LQR A;  2XAQ A;  3GFI A;  1HDD C;  3CC7 I;  3CJQ B;  3CCY A;  3EDP A;  4HAM A;  5ED4 A;  3CDI A;  2HYF A;  1ZQ3 P;  2EFO A;  2A07 F;  3M3Y J;  3SDG A;  5L3C A;  1T39 A;  3FWE A;  3LSR A;  1BM9 A;  3DP7 A;  1SFO J;  4CCL A;  3H1C A;  5BQT A;  5JI6 A;  3QWL A;  1AHD P;  3G71 I;  3K4B A;  1FOK A;  3VYR B;  5IOY A;  4Y17 A;  3LFK A;  3Q9V A;  2E71 A;  1SD4 A;  2JQ7 A;  1LDD A;  2CQK A;  4CZZ A;  3SEZ A;  4S0H B;  2OZU A;  3E1S A;  1G8X A;  4BBS J;  1LDJ A;  3BR3 A;  3FF5 A;  2CG4 A;  4BE1 A;  4UNO A;  1WJD A;  3QOP A;  5K1Y A;  1UFM A;  3DU5 A;  2VBZ A;  4E70 A;  2ZO4 A;  4UVB A;  4E7Z A;  4BHP A;  3G3Z A;  5DUK A;  3GX4 X;  3F72 A;  5M5Y J;  1Y39 A;  2CFO A;  1BJZ A;  2ISZ A;  3JSO A;  5ILV A;  1MJB A;  4U87 A;  4BY1 J;  2KRH A;  3VYS B;  4XLC A;  1I3Q J;  3H9J A;  4UVC A;  3F8B A;  2JPC A;  2QSH X;  2IS4 A;  5A2Q Z;  4LK0 F;  4ZJZ A;  5EG0 A;  3KEO A;  2LF8 A;  4A0Y A;  2OD5 A;  4O3M A;  2CQN A;  3HDD A;  1QHG A;  5CVJ A;  2HQA A;  4EJV A;  2NS0 A;  3MVP A;  2P6S A;  2QBY B;  2FBH A;  2EV5 A;  3RSN A;  3CO6 C;  3S1N J;  3ONQ A;  5ICE A;  3DEE A;  3TDZ C;  2Z99 A; 
#chains in the Genus database with same CATH homology
 1V54 H;  3ASO H;  2EIJ H;  2EIN H;  2DYS H;  1OCR H;  3AG4 H;  3X2Q H;  1OCZ H;  3ABM H;  2EIL H;  2EIM H;  2Y69 H;  2OCC H;  3AG3 H;  3WG7 H;  3AG2 H;  3ASN H;  5IY5 H;  1V55 H;  5B1B H;  5B1A H;  2EIK H;  2DYR H;  5B3S H;  3AG1 H;  3ABK H;  1OCC H;  2ZXW H;  1OCO H;  3ABL H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...