3X2QH

X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 24
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3x2qH00
3AG4H 3AG2H 3ASOH 5B1AH 3AG3H 2EIKH 5B1BH 2EILH 5IY5H 2EIMH 2EINH 1OCOH 2DYRH 3X2QH 1OCCH 1V55H 1OCRH 2ZXWH 2Y69H 3ABLH 3ABMH 2DYSH 3WG7H 2EIJH 3AG1H 1OCZH 3ABKH 1V54H 5B3SH 3ASNH 2OCCH
chains in the Genus database with same CATH superfamily
3CCUI 3B02A 3PO3J 3BG3A 3HGGA 4HDUA 3BQYA 4RLQA 3ZQQA 3CD6I 5HS7A 3PQKA 3MQ0A 4M71A 3KP5A 3VEPA 5FLVA 1T98A 2QUFA 1T33A 2FSWA 4LIVA 4P55A 2KKOA 4UNOA 4BL0B 2GXGA 5HLIA 3IP4B 5FLMJ 5ERIA 1XCBA 1ETKA 2LK2A 1IG7A 1GV2A 1VQLI 3E5UA 2YU9J 3HPGA 4BHCA 4HNVA 4BS9A 3OYGA 5HLHA 1IJWC 2J5PA 2DT5A 2QSHX 1JKQC 4GDFA 4J19A 1FX7A 2JT1A 3AKZA 4UY8I 2JUGA 3CDHA 3HOXJ 5EEHA 1D0XA 1REPC 1UG2A 1FP1D 4QPOA 4EM2A 4W1UA 1B4AA 1O57A 4XSZF 2MLGA 4I09A 4ZDOA 3FISA 3QU3A 1ZG3A 1QO0D 1HW2A 3Q0WA 4X1EA 4AIJA 1JKRC 5HDGA 3BR1A 3HB9A 1Y1WJ 5LLQA 3E6CC 2A6HF 1K6YA 3MKWB 1UZCA 4XRMA 3LNQA 5LGUA 1JXSA 1UHSA 1ZKGA 2LY9A 1P92A 3AG1H 4RS8A 3C3WA 5CVJA 3MCZA 5FRMA 3FXMA 3AG4H 1MSEC 5E18F 4AM3A 2X9DA 1U9NA 1B1BA 1AKHA 3K0LA 4BQQA 1PJRA 4V2GA 4MGRA 1K83J 2E1MC 2F5VA 2VL8A 3SZGA 1E3PA 2XIGA 3GWZA 5HDKA 3SHFA 1H89C 1FTZA 2OQRA 5L3GA 4PK4A 3UKGA 2YX7A 4Y15A 4L0ZB 4ZDLA 3L00A 1YJNI 1GDTA 2DPDA 1I3AA 3M8FA 4BXFA 3I0TA 4MIMA 1Y1VJ 3QYEA 1N75A 1RESA 2KIQA 2OZ6A 4UV8A 4KIFA 1O3SA 2BHZA 4OINF 3F8FA 3F22A 3RQ4A 3O3KA 4R8HA 5IT9Z 5HS9A 2A07F 4ZYDA 3D5RC 3CUQC 2QVOA 5JLXA 4BUPA 5GTHC 4A2UA 2OD5A 3K4NA 3CCSI 2XKPA 4A3LJ 2KIUA 3F9KA 2DFIA 2ZMEC 2GIVA 3K9TA 1I27A 5DCFA 2RQPA 4XLEA 1WZ2A 2CQ7A 2DCEA 3DU6A 5DM7F 2DK5A 3WTSC 2ELJA 4QLCU 2E7XA 3BCBA 1OQYA 2ZB9A 2CW0F 3JTGA 3ABTA 3CCEI 1FOKA 3DCFA 5HDNA 1B72B 3S17J 2Z1DA 2E5NA 4DOZA 2CSOA 2R3SA 2ICWG 3T8TA 1OR7A 5ICGA 4KT6A 4LMYA 1XD7A 1XX5A 3SJMA 1F5TA 3W2WA 3MVPA 4HOBA 1USSA 1I1GA 1W1WE 2GZWA 4XIDA 5L3EA 3GFJA 4ENMA 4ZYAA 3V7RA 3VYRB 3Q9SA 1XSDA 3HOZJ 2MD0A 2X0LA 1W7PB 3KEYA 3FMSA 3LSRA 1UHMA 1Z3XA 2DOEA 2VE8A 3C2HA 1YFHA 1H9GA 3GZ6A 3TGNA 3MMYB 2Y31A 4D7MA 3PUFA 3HRMA 1XSXA 2DOFA 3UR3C 2VQGA 1DP3A 1TTYA 1HOMA 4WWCA 3WTYC 1O7FA 1XGMA 2IPQX 1T08B 1X4PA 1LE8A 1Z6TA 3KE2A 2PEXA 3M1CA 1ETOA 3SYTA 3H5AA 4IHWA 1RRJA 2XGEA 2ZFWA 3ECOA 4IZZA 4E7IA 2VPRA 2RQQA 3VWBA 1P7JA 2E34A 3GYHX 2YX4A 4EJTA 3GZ5A 2KZVA 4S05A 2XSDC 2XSJC 2QEXI 2GIZA 2XAHA 5AIPA 2DXIA 2ZMEB 2R7DA 4EJWA 1HSTA 1SD5A 3P7NA 1XTAA 3FWEA 1U9OA 4B09A 3OYJA 3G6EI 4I7HA 3TO6A 2EK5A 4XSXF 3DV8A 3HGYA 1AA7A 3O8GA 4O5VA 2K02A 3J7YJ 2ME6A 3G1MA 3I53A 3ROUA 5CYVA 4ZH4F 4A0XA 4DYCA 3W6VA 4BJ5C 3NWSA 5LHIA 1U5TC 3CESA 3CMEI 2FNAA 1YW8A 5KCMA 4HW0A 1EA3A 1KA8A 3MEXA 1TWFJ 3ASNH 2XV4S 1ZR4A 2M1BA 1YYVA 4AIDA 3SZPA 1H88C 5LGNA 2K9LA 1I1SA 4WXHA 4RM3A 3H35A 3JRCA 3OMYA 3TW6A 3CO7C 3QAHA 1X1PA 2Z5UA 2W00A 2MYSA 1IRXA 4XK4A 4BJTA 4GO1A 5C3EJ 2L0KA 1JUMA 2RNGA 2DMTA 1PYVA 2WADA 1ON1A 5HLTA 3BLYA 4GFBA 3FHNA 2V9PA 3HOVJ 5E8IA 4KA4A 3PIPF 1ODDA 3SXYA 3WHBA 3A01A 1IRZA 4ENKA 1TNTA 1RPWA 1FSEA 3ZMDA 3FBNB 2DYRH 3I3LA 3B73A 1FPQA 3CC4I 1J5YA 4CDGA 1A35A 2PMHA 2DFHA 3E1SA 1JUSA 4XLAA 4F52A 4LB6B 3CCVI 4LB5A 1PUFB 3AL0B 1YRNA 4BXXJ 2DI3A 1V54H 4KITB 2LR8A 2JJ7A 3OV8A 2H94A 2IGMA 4OOIA 1H9TA 2XGDA 2M30A 1LVKA 1MMAA 3H9GA 5B66C 3K2ZA 1U6GA 4HRIA 2DQLA 2PQ8A 3H36A 1XMKA 3I59A 1P9QC 1TNSA 2KRHA 4CCMA 4CCOA 5HVQC 1WCMJ 2RDPA 3TO7A 2PG4A 2LREA 2D1HA 2R5YA 2H09A 4I99C 3JRAA 1TWGJ 1D8KA 2PJRA 1HCRA 4IHYA 2VOPA 2P5LC 3HSFA 1L0OC 2YPRA 2C6YA 4M3BA 2K40A 4Q48A 3GLLA 4OU0A 2A6TA 1FBSA 3G71I 2IT0A 5D4SA 1Z91A 2DA3A 2EZLA 3V42A 4UXNA 2KRCA 1Z7UA 3Q5FA 2OUMA 5FKKA 1OJLA 1SD7A 1K78A 2COMA 3GXOA 3Q9VA 2XROA 5D6EA 3LAPA 1MBEA 1KGSA 1KQ9A 2K27A 1FMVA 1R1UA 3KIOA 1E3OC 3BC8A 3GFIA 1USTA 2JWTA 3IH4A 4BDYA 3KYLA 1QU3A 4P5OA 2PBIA 2Z33A 4XLNF 2WWYA 1SMYF 1JE8A 3A4CA 1U0JA 2QSGX 2WAQN 1H0MA 2M4GA 5EGOA 3CLQA 5E79C 3S16J 1VQ5I 1MMSA 5D5WB 2GA2A 4BEHA 3BTJA 1IN6A 5EZGA 1SVLA 3CC7I 2LY1A 3CJQB 1D0YA 1F9NA 5IPAA 4KIGA 4HPQA 3I71A 2CW7A 3K70C 4NHJA 3WTWC 1JKOC 3BWGA 1IZ1A 2Q8KA 5CVUA 3IKVA 1X4OA 1MBGA 5IP6A 3K69A 3P5JA 3ZQHA 3GMEA 3NAUA 4CSWA 4AC0A 2BY1A 4OIRF 4CYDA 1W36C 4M74A 1B9MA 2KQRA 5IYDJ 3K4KA 3K1PA 4H4KC 5BQTA 3FMRA 2HNHA 2KIFA 4KIBA 1LDKB 4A3GJ 3HJEA 1HSJA 2GXAA 3M9AA 5JVTA 2W24A 2VODA 1STZA 4HBLA 4ABZA 3HRTA 2P8TA 1MIJA 2FUG2 1T38A 2F5EA 5BPIA 2VJJA 4XKCA 2M7AA 1UFMA 4E7ZA 2R5ZA 4BEHB 2STTA 2X1EA 1WJEA 2WC2A 3WGHA 4HF1A 3CJNA 4KN4X 2KL4A 2MH2A 5EJCA 3JRHA 1JHFA 4FX0A 3H3UA 3M1EA 2R0QC 4PFPA 4B8XA 2EIJH 2HXIA 1D3YA 1MMDA 4HLYA 3R61A 3EUHA 1O3RA 3ZR8X 4RAZA 2HQNA 1W0TA 2O03A 4JX4A 3KP2A 1S3JA 3MN2A 1FOYA 3F72A 3J7ZI 5LRRA 4ENJA 3VB2A 3J80Z 2WAEA 3KCCA 4BJ6C 1K4SA 3GTJJ 1Q1HA 2DA6A 2VC1A 4DZPA 2ELKA 2ACJA 2L7FP 5FFZA 3KYCB 5JVGF 4A93J 4YELA 1LEBA 1IUYA 2LKPA 4P9FA 5DYMA 4B44A 3LAJA 4IO9F 4A3EJ 5F6FA 3DQVC 5IP9J 1OFCX 2YUSA 1ETWA 4GGGA 4Y52J 4AUXA 2OQGA 3WTZA 4OAZA 4Y13A 1YJWI 3EPZA 4DW6A 1P6RA 1BW5A 2DA1A 1WJ5A 4PGHA 1ETXA 1Y8RB 2BY0A 3IC7A 2JPCA 4ETSA 3G1OA 1S29A 1YW7A 3VDXA 1VQ4I 2XF5A 1FP2A 1VQOI 4GYIA 3A2KA 3B6AA 3LMMA 5IT9K 2ELHA 3F6OA 1SD6A 4R1HA 2EV5A 2OU2A 4L9TA 3GZNB 3AFHA 1HDDC 3BPVA 3R0AA 1U8BA 1WPKA 5F64A 4HX4A 4BYYA 1X2NA 1RKTA 4CH7A 3IRQA 2DMPA 2FJ1A 1MMNA 3BTLA 2NS0A 4FASD 3BZCA 1XMAA 2MC4A 4MTEA 3V7CA 3F23A 3JREA 3ONQA 2CYYA 1FIPA 4OWRB 3JAMK 1IO2A 3L2RA 5CVIA 3S3NA 3GTQJ 2VLAA 2ZJRF 3QP5A 2LBFB 3ABMH 2XHKA 3PNYA 1G3YA 4RGSA 3VODA 1N25A 3OOPA 4KUMA 1VF9A 5EZHA 3OR1C 2MC3A 3OYFA 2A5WA 1FIAA 1ETQA 2OTJI 4G7HF 3OOUA 2KISA 1NG7A 2NVQJ 4QTRA 4CCKA 1PDNC 4LIUA 1XGSA 2NOGA 3K4MA 3HOSA 3HDDA 4D5CA 3H0DA 3DKWA 3SDBA 4NC6A 1FNNA 3S2DJ 3IAM2 1R4NB 2ZSHB 4HF0A 1U78A 2OF7A 5LHGA 1XG1A 4FHTA 2V1DA 3WTXC 3QOEA 3GTMJ 1FLIA 2QLZA 1Z7LA 4MQVA 4BY1J 3LA2A 1TLHB 1KU7A 2HU9A 1T0FC 1E3HA 4WXCA 1BJZA 1JGSA 1HXDA 4NUBA 3FXUA 3ZMVA 2DA2A 1P4XA 1LQ1A 2GM4A 1VQ8I 2VBZA 1NHAA 1X3WB 2V26A 1Z67A 2LMDA 1X58A 1D5YA 3HXLA 2JSCA 3DF8A 1R4MB 1V5EA 2L9NA 4Y33A 2Y75A 3I59B 1R5GA 3QU6A 2HOEA 2O8KA 1X3ZB 5J4VA 1LVAA 3V4GA 1I6XA 5J47A 3KLOA 1W7PA 2PJRB 2HI3A 4OAYA 2R7SA 1EH8A 2KDZA 1TW2A 4HX8A 1YO5C 1VNDA 1ZGWA 2IA1A 3REOA 4B4CA 3MZ8A 2CFOA 1O3QA 2G0EA 1I6HJ 3DBHB 3MZHA 4WCGA 3D5LA 2NRAC 3R6SA 5D4RA 2JTVA 2WB1A 1Q1VA 4FISA 3KP4A 2R92J 3ULQB 4HEA2 2OTLI 3DPUA 2M8EA 2EV0A 5B1AH 1GXPA 2YS9A 3RTRA 2MH9A 1XN7A 4AIHA 4IRGA 3N4MA 4KMUX 3PIOF 2XASA 2XGCA 1UJ8A 2WAQA 2H6CA 3I4NJ 5J3LA 4GYGA 5GAEJ 3KFWX 1OYWA 4EEFG 5K1YA 1S8NA 2FF4A 4RBOA 3COAC 1XMXA 1W4MA 1Z21A 3RIRA 1XS9A 3H92A 2L5QA 3BROA 4RMNA 4U0WA 3IRRA 4Q4ZF 1RIOH 3HL2A 3AL0C 3RDIA 3T0YA 2B9SA 3OYMA 5EGOB 3GTGJ 1B59A 3A0BC 5HNFA 1WJFA 1VQMI 1WGXA 2XF7A 1OCCH 3K4BA 1IXSB 2AXTC 1OCRH 2EV6A 2A5YB 4G9YA 4M6YA 3VFZA 2MGQA 3LWFA 2WV1A 3NARA 1U3EM 1YITI 4IOAF 1BI2A 2GOMA 3ZQIA 1CF7B 1OMIA 3WGIA 3DPLC 1IN7A 2DDAA 4XLHA 1K7AA 1SFXA 1B8IB 3CF5F 4KT5C 3QQAA 4Q47A 2O8XA 4DQ2A 2K3FA 1HW1A 4BNCA 4XOTA 3OYDA 4E4HA 5EF6A 1G6NA 2JRTA 4EJVA 4IOCF 1SFKA 4Y7NJ 3MD2A 4JQFA 2LG4A 4B43A 4PSXA 3JCUC 3P9CA 5ICEA 3BY6A 3GF2A 1MNMC 4HZFA 1JUPA 4KICA 5IOYA 1GLNA 3S1RJ 1NK3P 2XB0X 1ERDA 1MW7A 4HAMA 3IUOA 3ZMSA 2NOJB 5F0HA 4IJAA 2HZTA 2LKSA 2EJRA 2VB6A 1SVMA 3AG2H 1VQ9I 3ASOH 3WTTC 4X0GA 4WX9A 3R0JA 4DBQA 3HRUA 4ENNA 3CLOA 4A6DA 3JW4A 2XAQA 3W6JB 4ZC3A 1MDMA 2DQRA 3BT9A 1W5CC 1FT9A 1K6OA 1ON2A 3GTKJ 2PLYA 2HVRA 3LA3A 1E0EA 3ZQFA 1G3TA 5K7ZA 4BHPA 2LOOA 3LA7A 5CVRA 2KRFA 1UAAA 4B3XA 1WHUA 2GBYA 1J0RA 4L9NA 2DT7B 2NVYJ 5IT3A 2HYFA 4BE0A 3J80K 2X48A 3F3XA 1J2XA 2OZUA 2HKOA 2P6SA 2HVSA 2JQ7A 1YIJI 4NDLA 2L54A 3ZP5A 4E7KA 3CTAA 4U87A 3C18A 3QODA 1WKMA 3CJRB 3GVAA 1ZTRA 1B9NA 3KLNA 4XLFA 2P6TA 2O3FA 2Z99A 4XN0A 4CCNA 5K5QA 5E3MA 1O4XA 4HF2A 3G3ZA 2ZCWA 3V8LA 4M3GA 4DJAA 2R7QA 3D0SA 3IH2A 4U0YA 2E71A 4L18B 5DD4A 4NB5A 2RGVA 1IRFA 4GCVA 5EEAA 1BA5A 5F0FA 2XUBA 2NVUB 1PUEE 1BOAA 2VQCA 4LD5A 5FJ8J 2ZO4A 1X19A 3E6MA 2KLOA 4Z2YA 5KVRA 3ZCOA 2VI6A 1ZARA 1OCOH 6PAXA 3L9FA 3TL4X 1BR1A 2FNPA 4HYEA 2EFOA 1A6IA 4IHVA 2A6EF 3OYNA 3RZOJ 1ONVA 4AYBA 3GCMA 3FXOA 2PN6A 2OBPA 1K79A 1P2FA 1VQNI 1P4AA 2IEKA 3VPRA 2P81A 2UZKA 3RCOA 1BBYA 1BC7C 2O7OA 3R4KA 2WY7Q 2ISZA 5DV5A 2HOAA 5TISC 3CCRI 4XNFA 4ZTJA 2FD5A 4HQEA 3S93A 4HV5A 1BJAA 4NNJA 4O3MA 1ULYA 3FMQA 2ESNA 3K6GA 3PNVA 3MKYB 4BKXA 3E0JB 2KFDA 3I58A 5KK1A 3BR5A 3OYHA 3RKXA 2DTRA 2VE9A 2QKLB 2QQ9A 2QZ8A 1HKTA 1BR4A 3KP6A 5JR3A 2I10A 4EQQA 4XKBA 5KNLA 2Y9YA 4A3KJ 1EH7A 3JRBA 4ESJA 1F4KA 3FM5A 2LBFA 2W4SA 3UNGC 3BTCA 4QSHA 3B6CA 2Q1ZB 3K1MA 2I8DA 1G2HA 4N4OB 2DA4A 5H6RA 2NNYA 1X1BA 1S6LA 3OIQA 4KJZA 5IYCJ 3JRDA 3IHUA 1E2XA 2ZBKA 1BI0A 4EJOA 1FEXA 2M45A 2XPVA 4C2MJ 5J6XA 1K61A 1XCVA 1IXRC 2VXZA 1XDSA 2R7WA 3ECHA 4XRSA 3OYLA 3ZMZA 2IAIA 1SFUA 4XORA 2F4MB 3SQNA 4L5IA 3KZYA 1KYWA 4RGUA 3TO9A 2CG4A 2XAFA 1PP8F 1OLTA 3K7AJ 2EPFA 4L5JA 5DD8A 3I55I 2K9MA 2Z9OA 1N78A 1MDMB 1DDNA 5GAGJ 5LHHA 2IGNA 2BBYA 3H1CA 3QYFA 4A69C 2QWWA 2L9RA 1YW9A 3PSIA 5H2FC 1DPUA 4LK0F 5TJJA 2P0WA 2DJIA 2XDVA 4XM3A 4L0YB 3CUOA 2Y30A 3HHHA 3I4PA 1JJ8C 1JHHA 1BOBA 4HSRA 2O0YA 3F0CA 3CCJI 1EV7A 2HYGD 4YIFA 2FMYA 4G12A 3H3VK 2LLKA 4M6XA 1XGOA 2R7OA 2XC7A 1DU0A 1Y56A 1ZHFA 4BBRJ 2UUZA 3H0GJ 1KZHA 2E1MB 1ZGJA 2DFEA 3HTSB 1OYIA 2JSPA 1EKEA 3EYYA 5J4YA 1A04A 4I2OA 1YX5A 4BBSJ 4AWXB 1UB9A 2K9NA 3HKZN 1GVJA 4JX5A 2NAZA 3QWLA 3T8RA 5M3MJ 2KJBA 3L1PA 3EUHC 3TOBA 1S9HA 3F8MA 4QWQA 2DT6A 4Z6YA 2MSYA 4A3MJ 2QF7A 4I0AA 1SAUA 2VKEA 4II2A 4B48A 5HODA 3ML6A 2CUFA 2BW3A 5IOZA 1G8XA 1UMQA 4DYQA 5JFRA 1SFEA 1IRGA 2CW8A 2ZXIA 2XPUA 3GX4X 3KEQA 1IV6A 1BC8C 3FXLA 4A3FJ 2F6CA 2Z2SB 4PJLA 2HPIA 3RQIA 1ZN2A 2RV8A 1YOVB 5LEKA 4G8XA 3RKYA 3J7AY 1MJ9A 3RJPA 3AG3H 2ECCA 1T56A 4MTDA 1QHGA 4PZJA 1VQKI 1ETVA 4KMFA 2V4JC 1WH7A 4AVPA 5BMZA 2CWEA 4KN7X 3J81Z 5FRNA 3VYSB 1BIAA 3DEUA 3C1DA 2KMUA 4M9ZA 3OR2C 2HR3A 3WU0A 3KZZA 4I98B 5ED4A 4B47A 4FTHA 2IGKA 2PMUA 2DU9A 3S32A 4D0PA 2XRNA 1GHCA 1QZYA 2W57A 5H6QA 5C4JJ 3RPQA 3CZ6A 1ZLKA 4JOMA 2CGPA 4C3HJ 5B5EC 5C4XJ 1KQ8A 3G2BA 2IW5A 2L4MA 3OYEA 1SAXA 1AKHB 2CS3A 4N9HA 1SEUA 4UUSA 1KU2A 3BG7A 3HM5A 2L9VA 2ZMEA 1LJ9A 1KYZA 3BTIA 2KJCA 5BNGA 1D1AA 4BE1A 5DTDA 3S8PA 4J00A 5EEGA 4A0YA 4FE7A 1MH3A 2CO5A 2LYCA 4BY7J 4CZCA 4A3BJ 1Y0NA 3G1LA 1K78B 1QNTA 4NQWA 5DDGA 3TQNA 4HDVA 2LH9A 3VYTB 1IDZA 2E1CA 4BH9A 1MNEA 2FXAA 4DYRA 1YG2A 1VTNC 3TBIA 4CXFA 3SFIA 1U8RA 4GXOA 3OYIA 2CMPA 2KIMA 1ZH5A 4D7NA 5ICCA 1R5ID 2VJIA 4E7LA 2LC2A 4IPAA 4FQGA 3H5RA 1LUJB 2FBHA 2TRTA 3ZQGA 1ACIA 2AHQA 1R36A 4A5MA 1AWCA 5EDNA 3G73A 3A0HC 5E20A 1HLVA 2FBIA 4XICA 4EMSA 1ZRDA 4I0BA 2Y0SA 4P96A 1PP7U 1YRNB 1YS6A 2UWMA 1TT5B 1OYYA 2FRHA 4I6ZA 1F43A 1R22A 2VPLA 1B72A 2RNJA 3HOWJ 3F8BA 2Q0OA 3A01B 3G4SI 1ENHA 2E35A 2EA4A 1OKRA 2VKHA 1R7JA 3OS0A 4E7JA 1Z0XA 4IF4A 4LITA 5JI6A 3CMMA 2R4GA 3T5XA 4MEXF 4XLPF 1RC9A 4XKWA 2P5VA 2M0CA 2UXNA 3HRSA 1OPCA 1PUFA 4G6QA 1CGPA 1POGA 2LDUA 4F3QA 3IL2A 3L2CA 3BZKA 2AO9A 2IVMA 4HG2A 3K10A 1NTCA 5J1YA 4DGWB 3A03A 4LJZF 3WODF 5FB2A 1W7PD 2R7XA 2VQHA 1Y6IA 2GAUA 3DP7A 2VIXA 4J01A 1SC7A 1HQCA 2E2HJ 1PVEA 2HFHA 2K7LA 4UV9A 3L09A 4CO8A 3PSFA 1Z3YA 3F8CA 1CF7A 4BQOA 2PMZA 3IV5A 1D0ZA 3HUGB 2R7FA 4RB0A 2I5UA 4HV6A 2JVHA 2X6WA 3KEOA 2ZJQF 2JZYA 2G9WA 5E3OA 2VBYA 3P9IA 5GAHJ 2F5DA 3ZPLA 2COBA 2JVGA 3GUDA 1MMGA 4RAGA 4WK8F 1X1DA 1O7LA 1YIOA 3FKIJ 3S2WA 5EYRA 1HBXG 2VN2A 5IP7J 2JA6J 4OIPF 2L2OA 3DLLF 5HOOA 3HC7A 3SFZA 1ZG5A 1MGTA 3DTEA 1FWZA 1DGRM 1I3QJ 2HKXA 4OMZA 3ZRGA 3T1BA 1WVRA 3U21A 4E7SA 2KHMA 4U0VA 3E5QA 3QOPA 3ZQ7A 1W36D 3M07A 1VQPI 3OIOA 1RR7A 1QZEA 1FOWA 1KQ0A 1ZLJA 2LF8A 1V5FA 5DCMA 3L2QA 2EBIA 3WG9A 1YJ9I 4OIOF 5JHFA 5CLSA 3BR6A 4RGXA 1LFBA 1MBFA 5CPRB 3C2GA 4CHUA 5FLXK 3ERED 4PJJA 3GFLA 2LKXA 3PFIA 4EATA 2DFFA 4Q5SF 4F55A 4OMYA 2VOOA 3ZMUA 4M9SA 4PJMA 3VOEA 3CCLI 1DP7P 4FT8A 3SZTA 3DFGA 3P9KA 3HPHA 3DTIA 1ZK8A 5F0CA 3GBGA 1R00A 3JRIA 4WF2A 2QQAA 4GRIA 5B1BH 4QIWN 3ZGKA 2BY2A 2LF7A 4RB3C 2A05A 1APLC 1X2MA 2DJNA 4M3EA 2EQRA 1XPXA 3GEZA 1W5TA 2DA5A 2NS8A 2XF6A 2W1OA 5ILSA 3KX2A 3JAMZ 1J59A 1MBJA 2CU7A 3E97A 4PUSA 5EG0B 4F93B 3U9GA 4DIQA 1BI3A 3L2WA 2PI0A 2DAOA 2R7TA 4EGZA 1HKQA 2NNNA 4ITVA 1HW5A 2IGOA 3MKLA 5FD5A 1HKSA 4YIRX 3WGGA 5E17F 2JA2A 2JA5J 2KT0A 2CUJA 5M5WJ 3EYIA 4LOCA 3QPSA 2R5ZB 2ZKZA 1T0FA 1RR8C 4F92B 2V1NA 3E3VA 1RI7A 4H0EA 2JK3A 5DUKA 3DKXA 5DEQA 2VASA 3LSJA 1R1TA 4HQMA 2L4AA 3TMOA 2BZTA 4MHGA 2DLLA 3HKZA 1KU3A 2F4IA 2ZXHA 2K4JA 3TOAA 3CCMI 3ZMTA 1B8IA 2MG4A 2QYOA 4L9JA 2Y2ZA 1JJ6C 2ZNZA 1TT0A 2FE3A 3FXJA 3FK6A 2M8GX 4UB6C 5FKNA 4IHTA 4ZYEA 4EM1A 2D45A 3W3CA 1I39A 3NRVA 4LG3A 3FK7A 2L02A 2YR2A 4BQAA 3S2HJ 1IN8A 3C7JA 1WJBA 4ZDPA 4W97A 1R9TJ 5L3FA 1V3FA 4N4NB 1G3SA 2CV2A 2RREA 3MZYA 1TQIA 2CH0A 3DTKA 1B6AA 3KETA 2HQAA 1YLFA 1MSFC 2IA0A 2BW3B 4CZZA 2AS5F 3CC2I 4I76A 2ID3A 4IVNA 4XL9A 2Q2EB 2HTSA 1G4DA 3W2VA 3S1NJ 3OYBA 4IL6C 3D5SC 2LY2A 4V2FA 3L2UA 5GADJ 5M3FJ 3LSMA 1BR2A 2BYVE 4MFEA 4BAYA 2EZHA 3PQJA 2LP0A 3TP3A 2DBBA 4AU7A 3K2AA 1FMWA 1XDUA 1YE9A 5D5UB 3QYBA 1LPQA 2M3AA 1SD4A 2DMQA 4RB2C 1Z05A 5HLGA 4M3DA 4UVAA 4CUGA 2WBMA 4FX4A 3AAFA 1R58A 4FE4A 2FQ3A 4IHXA 1UCRA 3RKWA 3F6VA 3KYDB 1OISA 3PUBA 3GTLJ 3Q0VA 5M5XJ 3CMAI 4XBFA 1FY7A 4XONA 3OS2A 4BXUA 2QGUA 3WU2C 4ESFA 3VSLA 1T39A 3PO2J 1VQ6I 1BW6A 5E8GA 5TRDA 2VC0A 2GA1A 1NK2P 1JTYA 3ELKA 2QA4I 5JHUA 1BM9A 3CDIA 2VJ4A 2M34A 1JI8A 1ZRFA 2K3PA 1F36A 1EJ9A 2LTPA 4V19K 2DMUA 5AIQA 3F21A 4FCYA 5ICFA 4ON0A 2BEOA 4IRIA 1Y8QB 2Z16A 1ZRCA 4UVBA 1WI9A 4EVIA 5K7FA 2GOXB 3VYUB 3BJOA 1DQUA 4K2EA 9ANTA 4PFOA 1TP4A 4ZZLA 2ID6A 2NXNB 2F2EA 3KP3A 4RLFA 1R6RA 2W85A 2FOWA 1JGGA 1IW7F 1QGPA 4D1QA 1LFPA 4JP0A 1R71A 2VONA 2K5CA 5FKLA 5L3DA 5AONA 4EV0A 3WE2A 3N97A 4NC7A 2TCTA 5DCMB 4LG0A 5J8FA 2VJ5A 5E3NA 2QSFX 2XVCA 4XRFA 5IY5H 3OYCA 1IF1A 2KZGA 2OAZA 5F08A 3LSTA 4S04A 3QP6A 2R7UA 5HNHA 3JSOA 1W0UA 1D1CA 3ABLH 3OL3A 2W7NA 4KDPA 1QZZA 1TWHJ 2OA4A 4NBQA 5BPDA 2LNBA 4TV7A 3TW7A 3WU1B 3GFMA 3IWFA 5F1RA 3ABUA 2KPMA 3PM1A 4M3FA 3JRGA 3WHCA 1TQPA 1T8IA 3CCYA 2IS1A 2L7MP 2VT2A 4EM0B 4M6VA 3RYRA 1IAWA 3U2RA 5KHDA 2OV7A 1TW3A 4P1WA 3ZXSA 2E1OA 3RPUA 2X51A 2M5WA 2VKDA 4IQ4A 2V79A 3HUGA 2EFQA 2GWRA 3KZIC 2PJPA 1MJBA 3J7AO 3A1YA 4NC8A 3LSIA 5GP9A 4M9XA 3JRFA 1OCTC 1SMTA 2QQ8A 1O3TA 3CUQA 3CMYA 3TDZC 2OJED 3KPHA 1I5ZA 1RNLA 3H3ZA 1GVDA 1QRYA 2ADUA 4PJ0C 2A69F 4U7DA 2J5OA 1T95A 5J8CA 2IS6A 1FC3A 2DMNA 2EIMH 2ECBA 3JTHA 3K4LA 4G94A 1U5TB 2HQRA 1ORKA 3BCAA 3H9JA 1G59A 3E6DA 2AQEA 3I5UA 4A3DJ 1V4RA 1ZG1A 2ZJ2A 1ZQ3P 4CYCB 1P4WA 1VI0A 2D2WA 1WI3A 2HQ5A 2GQQA 2QCOA 2D1VA 2R7RA 2HVQA 2X1DA 2L3DA 2Y48A 1F1ZA 2IBDA 4BDZA 2LVSA 3U1DA 1HDPA 2WA0A 2WTEA 5HS8A 2FBKA 2B63J 4IKFA 2B7EA 3NQOA 1IGNA 3JR9A 3O2PE 3DPTA 2HDCA 4LLLA 3BDDA 4A3JJ 2V9KA 3DKYA 3K4JA 1JKPC 2E19A 2WB1N 1S7EA 3HYIA 1J09A 3F8NA 2N8GA 4B1RA 1MD0A 2EZIA 2AXLA 1R1VA 4A5NA 3RYPA 5CVVA 3EUKL 4E7HA 3FHZA 5FROA 2DW4A 1K4TA 3ERMA 1OCZH 2CQXA 5KAIC 4ZYHA 5D8KB 4BACA 2NVTJ 4YFKF 2QBYB 3BOQA 1TWCJ 1WJAA 2DK8A 3PNTA 3V7SA 4F7ZA 5H20A 2X6XA 1GXQA 4X6AJ 4IXAA 3L2VA 1A5JA 3Q0UA 2M2EA 5C44J 2R5YB 1S7OA 1YQAA 3BG9A 3CQZJ 3WTVC 2IXSA 3IAS2 3EDPA 4BE2A 1J75A 2VKVA 4DNCA 3WTUC 3PJRA 2O9LA 2K9QA 2BVMA 1QHHD 2JUCA 4G7OF 2ZNYA 2PX9A 2NS7A 3CDLA 2VT3A 2W82A 4RAFA 4XKVA 1FJLA 1TZLA 3S1QJ 4HNTA 3DEEA 2HWVA 4IRHA 1LB2A 3QRFF 2RC4A 1MNDA 3L7WA 3M4OJ 3C2BA 3K70D 2WY8Q 4Y17A 4EJUA 2FA5A 4HA8A 4C9YA 1Y39A 2XPWA 5E1ZB 1YX3A 4HNUA 4UB8C 3S3OA 4S0HB 1C0WA 1N77A 1TC3C 2V6CA 3S14J 1AU7A 2NVXJ 4C2UA 3BR0A 3LSKA 2IJLA 4LK1F 1QBJA 5A2QZ 2Y69H 1X1AA 3FXKA 3BP8A 2HOSA 1L3LA 1LDDA 2XAGA 3Q3SA 2X4HA 2G7HA 3FM3A 3FX3A 4KFCA 4RAYA 1BL0A 1MZBA 2FQ4A 2IA2A 3LFKA 4ZZDA 4JBAA 1ZR2A 2HXOA 4C3JJ 3RZDJ 1XB4A 1AHDP 2BE5F 1X1CA 5F04A 3HG9A 1LKXA 2L01A 2FU4A 4YRVA 4YG2F 4C3IJ 3DXJF 3CCQI 2V1UA 4FETA 1CQTA 4BHBA 3BPXA 2E2IJ 1E17A 1SVOA 1XGNA 2Y0MA 1A31A 2V6EA 2EILH 1XC5A 1S5LC 2V9VA 1FYMA 4E70A 3ZQLA 3TDUC 3GTPJ 2VUMJ 2JA7J 5A2QK 2EZKA 2MBFA 3KP7A 1SANA 2WAFA 3I56I 4I01A 4IX7A 2FOKA 2Y9ZA 3PL8A 1WFXA 5TGTA 3FXQA 3EETA 3H5NA 1JTXA 1DU6A 2VXDA 1R5HA 2R7VA 1AOYA 1LFUP 3PFYA 1VZ0A 4HSTA 4PGGA 2OCCH 1UG0A 1WSUA 4BGDA 2CQKA 3CP8A 5DUIA 5CQGA 3BQZA 5ILUA 5LD2C 2ETHA 2P7VB 4CCJA 2XAJA 1X3UA 3CP2A 3R60A 4XLCA 4N9IA 1IDYA 1WWXA 5J1UA 1D5VA 2Z3YA 2YU3A 1WQ2A 4IQJA 2H1LA 3V8KA 2BOLA 3E5XA 2KDOA 5K7HA 1JT0A 1MBHA 1MJAA 3FXRA 2FEZA 4XQFA 2CFXA 2H6BA 4A3IJ 1SFOJ 2ZFUA 5FGMA 1LEAA 5JLWA 3LSPA 2H1KA 2X6OA 4Y3OA 4I02A 3K1NA 2BGCA 3DBRB 4A0ZA 4L9VA 1TBXA 2O6GE 5EG0A 2E1NA 2IS2A 2JRMA 2B0LA 1TQMA 1GT0C 4PDKA 4BQNA 2M9HA 1UELB 3H9QA 4AYBN 2EINH 2TDXA 2VQLA 1VQ7I 1W5SA 1Z77A 3FF5A 3MKZA 2DA7A 2XKOA 2HZDA 3VSKA 1FYLA 5D5XB 2K4BA 1EH6A 4PSWA 5GPCA 2HOTA 3DLAA 4XN3A 1WH5A 2BV6A 2HS5A 3S3MA 3TP0A 5LRSA 1JT6A 4C30A 4L5EA 4D9JA 1A36A 4U7BA 3OYAA 2ZJPF 2DPUA 3DWLE 4LLNA 1RKWA 5ILVA 5L3CA 1Y0UA 2XAUA 4NQWB 3X2QH 4JYKA 1IV8A 2ZSIB 3QPHA 1FBQA 1I50J 2MFZA 2A61A 2E7WA 4CA0A 3D1NI 3FIWA 3M7GA 5BS6A 4RB1A 3K4CA 3SEZA 1RZ4A 3HBLA 4HLXA 2HDWA 3RSNA 1IXCA 3LFUA 5E1WA 4UUSB 4AD9A 2W25A 1BIBA 5DS9A 2O61A 1LE8B 1BN5A 2DDBA 3E7LA 3CUQB 2CQQA 1YHQI 2CUEA 5CJ9A 1T2KA 2Q2EA 1TWAJ 2HEOA 1M1EB 1ZAOA 4A12A 1WJDA 4UVCA 1MH4A 2RN7A 1S7AA 4DBRA 3OS1A 2ESHA 3DEWA 4OIQF 2H8WA 5LGTA 1UHWA 1ZGAA 3M8EA 2F48A 5KAFC 3I54A 5B3SH 4UUVA 1FZPB 4HX7A 2M4KA 3BR3A 4D5FA 2UV1A 2IRFG 2XGXA 4DZJA 4YFXF 4MO7A 1NG6A 1T6SA 2IP2A 3W2AA 3IH3A 3N05A 4CGZA 2ZXJA 3I64A 2CUZA 5E3LA 5LBQA 3NEUA 2BVLA 4LGWA 5FO5A 3IWZA 1YTYA 1TL8A 1FSHA 4QPQA 3ZQCA 4WXDA 2EFPA 3ZOBA 4JX6A 2LFBA 2W48A 5FKOA 3I4MJ 3HSRA 3OL4A 4RA2A 4R79A 5J1RA 5D5VB 3OY9A 4XR6A 5F1JA 4ZYGA 1ETYA 2V7FA 2NYXA 2W84A 1LDJA 1RETA 1XSVA 2CJJA 1OR7C 4XOPA 4YIIA 1NH3A 1KONA 3OWTA 3HTUA 3HIFA 1QQIA 2EIKH 1WJCA 3BJAA 4C2TA 1R49A 3WE3A 3DU5A 3MAJA 3GLXA 4MFDA 3BR2A 3U1KA 2JA8J 3LQRA 2MABA 2EB7A 2L7KA 1OCPA 5BOXA 2MD5A 1VFCA 4G6DA 1IUFA 5D8LB 1YI2I 4M72A 2LRDA 5DM6F 3HOTA 1DUXC 2EA2A 2UXXA 5F27A 3MWMA 5FKMA 3HEFA 3RPUD 2MW8A 3HOYJ 2HYJA 1G3WA 2MLKA 3ISPA 4MNUA 2L7ZA 4UHTA 2QBYA 2P4WA 4JK1X 2F5FA 4KNYA 1R23A 2E2JJ 2X85A 1H8AC 3JSPA 2ME0A 1RUOA 4Y4RA 4ESBA 5L3BA 2GLOA 1D8JA 3J81K 2ZXWH 2FMLA 4AIKA 3TEDA 3S15J 3OSFA 4RM2A 5CQEA 3EQLF 2OC6A 2M0MA 2DODA 3GTOJ 2P7CB 1DGWY 2DN0A 3WG7H 2ZC2A 4YEJA 5GPAA 1S72I 2A68F 5LEJA 3LSGA 1RUNA 3TKYA 5K5RA 3E6BA 2E36A 3GW2A 1BI1A 2CQNA 4MQ9F 2BHYA 1V55H 3GO5A 3FDYA 5CKTA 3IKTA 3QPLA 4G6TB 1MKMA 2X1CA 5E1XA 4EGYA 2STWA 2HPMA 3O8HA 4PJNA 4XRSG 2FX0A 2CV1A 1A6QA 1IC8A 2DYSH 3W6KB 1J9IA 2L9SA 2QENA 4CCLA 5FLXZ 4RDUA 1QA6A 4O6JA 3HSEA 2R7ZJ 3ABKH 3CJTB 3V8JA 2DOAA 2RAEA 1ZELA 2E5ZA 1IN5A 4PCQA 3NWTA 4YFNF 1FYKA 2D5VA 2K9SA 2WV0A 2CRGA 2HDDA 5K5OA 1P7IA 4G7ZF 2AQFA 2QKMB 1ITYA 2K85A 4IEJA 1IN4A 1J7KA 3LSHA 1U5TA 2EFNA 3ESWB 4IHSA 3HZJA 3FKJA 1WRJA 1FOXA 4XMYA 1QPMA 3ZN0A 2XRLA 5LFAA 1FTTA 2EH3A 4MLOA 4CYCA 2CV0A 2JPBA 3FZVA 4E6KG 2DTZA 4N0BA 3ZN1A 2EWNA 4MEYF 5GTIC 1HA8A 4II3A 4A3CJ 2H27A 4KYWA 2JN6A 2F5CA 5IYBJ 4ZJZA 3S1MJ 4LFUA 2O5RA 2QM3A 4ZTFA 2EFWA 1EF4A 3MFKA 3QPTA 1Z6RA 2BXYA 2DO7A 2E60A 3SEQA 2Y0SN 2P5KA 4ANJA 4KISA 2M7BA 4U88A 2RVCA 2XB5A 2H8RA 4F91B 4LG0B 2MA3A 3O6BB 3OSGA 3OYKA 5J40A 3M3YJ 2HTJA 2VBWA 3M8JA 5M5YJ 3A02A 2BXZA 1HC8A 2G7UA 4UUTA 2QQBA 4ASNA 4BU2A 2BY3A 3BG5A 5FD6A 3CO6C 2OCEA 3HHGA 3BZ6A 3RI4A 2HGCA 2JMWA 2KP6A 2R93J 1GUUA 3I9V2 3SDGA 4RGRA 2LD5A 4A6EA 3CF2A 3LOCA 2GXBA 2F4OB 1QVTA 4LLGF 3BJ6A 3BG6A 2LSOA 1Z9CA 1ZYRF 2PFBA 2X6YA 2RKHA 3FBIB 1V5GA 1FBUA 2ISYA 3OIPA 1D1BA 1KU9A 1U2WA 3EUAA 4AVZA 2V1XA 4M73A 2IS4A 2M87A 3RKQA 1QVUA 1Z1DA 1GV5A 1LNWA 4B3AA 2A3SA 2PMZN 2YSRA 2OPTA 3LQQA 5FFXA 4P9UA 3DBLB 3HOUJ 1HF0A 1QPIA 1ZREA 2VBXA 1YS7A 3LL7A 1DPRA 4CICA 1MBKA 5D6FA 2K86A
chains in the Genus database with same CATH topology
3AG4H 3AG2H 3ASOH 5B1AH 3AG3H 2EIKH 5B1BH 2EILH 5IY5H 2EIMH 2EINH 1OCOH 2DYRH 3X2QH 1OCCH 1V55H 1OCRH 2ZXWH 2Y69H 3ABLH 3ABMH 2DYSH 3WG7H 2EIJH 3AG1H 1OCZH 3ABKH 1V54H 5B3SH 3ASNH 2OCCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG4 H;  3AG2 H;  3ASO H;  5B1A H;  3AG3 H;  2EIK H;  5B1B H;  2EIL H;  5IY5 H;  2EIM H;  2EIN H;  1OCO H;  2DYR H;  3X2Q H;  1OCC H;  1V55 H;  1OCR H;  2ZXW H;  2Y69 H;  3ABL H;  3ABM H;  2DYS H;  3WG7 H;  2EIJ H;  3AG1 H;  1OCZ H;  3ABK H;  1V54 H;  5B3S H;  3ASN H;  2OCC H; 
#chains in the Genus database with same CATH topology
 3CCU I;  3B02 A;  3PO3 J;  3BG3 A;  3HGG A;  4HDU A;  3BQY A;  4RLQ A;  3ZQQ A;  3CD6 I;  5HS7 A;  3PQK A;  3MQ0 A;  4M71 A;  3KP5 A;  3VEP A;  5FLV A;  1T98 A;  2QUF A;  1T33 A;  2FSW A;  4LIV A;  4P55 A;  2KKO A;  4UNO A;  4BL0 B;  2GXG A;  5HLI A;  3IP4 B;  5FLM J;  5ERI A;  1XCB A;  1ETK A;  2LK2 A;  1IG7 A;  1GV2 A;  1VQL I;  3E5U A;  2YU9 J;  3HPG A;  4BHC A;  4HNV A;  4BS9 A;  3OYG A;  5HLH A;  1IJW C;  2J5P A;  2DT5 A;  2QSH X;  1JKQ C;  4GDF A;  4J19 A;  1FX7 A;  2JT1 A;  3AKZ A;  4UY8 I;  2JUG A;  3CDH A;  3HOX J;  5EEH A;  1D0X A;  1REP C;  1UG2 A;  1FP1 D;  4QPO A;  4EM2 A;  4W1U A;  1B4A A;  1O57 A;  4XSZ F;  2MLG A;  4I09 A;  4ZDO A;  3FIS A;  3QU3 A;  1ZG3 A;  1QO0 D;  1HW2 A;  3Q0W A;  4X1E A;  4AIJ A;  1JKR C;  5HDG A;  3BR1 A;  3HB9 A;  1Y1W J;  5LLQ A;  3E6C C;  2A6H F;  1K6Y A;  3MKW B;  1UZC A;  4XRM A;  3LNQ A;  5LGU A;  1JXS A;  1UHS A;  1ZKG A;  2LY9 A;  1P92 A;  3AG1 H;  4RS8 A;  3C3W A;  5CVJ A;  3MCZ A;  5FRM A;  3FXM A;  3AG4 H;  1MSE C;  5E18 F;  4AM3 A;  2X9D A;  1U9N A;  1B1B A;  1AKH A;  3K0L A;  4BQQ A;  1PJR A;  4V2G A;  4MGR A;  1K83 J;  2E1M C;  2F5V A;  2VL8 A;  3SZG A;  1E3P A;  2XIG A;  3GWZ A;  5HDK A;  3SHF A;  1H89 C;  1FTZ A;  2OQR A;  5L3G A;  4PK4 A;  3UKG A;  2YX7 A;  4Y15 A;  4L0Z B;  4ZDL A;  3L00 A;  1YJN I;  1GDT A;  2DPD A;  1I3A A;  3M8F A;  4BXF A;  3I0T A;  4MIM A;  1Y1V J;  3QYE A;  1N75 A;  1RES A;  2KIQ A;  2OZ6 A;  4UV8 A;  4KIF A;  1O3S A;  2BHZ A;  4OIN F;  3F8F A;  3F22 A;  3RQ4 A;  3O3K A;  4R8H A;  5IT9 Z;  5HS9 A;  2A07 F;  4ZYD A;  3D5R C;  3CUQ C;  2QVO A;  5JLX A;  4BUP A;  5GTH C;  4A2U A;  2OD5 A;  3K4N A;  3CCS I;  2XKP A;  4A3L J;  2KIU A;  3F9K A;  2DFI A;  2ZME C;  2GIV A;  3K9T A;  1I27 A;  5DCF A;  2RQP A;  4XLE A;  1WZ2 A;  2CQ7 A;  2DCE A;  3DU6 A;  5DM7 F;  2DK5 A;  3WTS C;  2ELJ A;  4QLC U;  2E7X A;  3BCB A;  1OQY A;  2ZB9 A;  2CW0 F;  3JTG A;  3ABT A;  3CCE I;  1FOK A;  3DCF A;  5HDN A;  1B72 B;  3S17 J;  2Z1D A;  2E5N A;  4DOZ A;  2CSO A;  2R3S A;  2ICW G;  3T8T A;  1OR7 A;  5ICG A;  4KT6 A;  4LMY A;  1XD7 A;  1XX5 A;  3SJM A;  1F5T A;  3W2W A;  3MVP A;  4HOB A;  1USS A;  1I1G A;  1W1W E;  2GZW A;  4XID A;  5L3E A;  3GFJ A;  4ENM A;  4ZYA A;  3V7R A;  3VYR B;  3Q9S A;  1XSD A;  3HOZ J;  2MD0 A;  2X0L A;  1W7P B;  3KEY A;  3FMS A;  3LSR A;  1UHM A;  1Z3X A;  2DOE A;  2VE8 A;  3C2H A;  1YFH A;  1H9G A;  3GZ6 A;  3TGN A;  3MMY B;  2Y31 A;  4D7M A;  3PUF A;  3HRM A;  1XSX A;  2DOF A;  3UR3 C;  2VQG A;  1DP3 A;  1TTY A;  1HOM A;  4WWC A;  3WTY C;  1O7F A;  1XGM A;  2IPQ X;  1T08 B;  1X4P A;  1LE8 A;  1Z6T A;  3KE2 A;  2PEX A;  3M1C A;  1ETO A;  3SYT A;  3H5A A;  4IHW A;  1RRJ A;  2XGE A;  2ZFW A;  3ECO A;  4IZZ A;  4E7I A;  2VPR A;  2RQQ A;  3VWB A;  1P7J A;  2E34 A;  3GYH X;  2YX4 A;  4EJT A;  3GZ5 A;  2KZV A;  4S05 A;  2XSD C;  2XSJ C;  2QEX I;  2GIZ A;  2XAH A;  5AIP A;  2DXI A;  2ZME B;  2R7D A;  4EJW A;  1HST A;  1SD5 A;  3P7N A;  1XTA A;  3FWE A;  1U9O A;  4B09 A;  3OYJ A;  3G6E I;  4I7H A;  3TO6 A;  2EK5 A;  4XSX F;  3DV8 A;  3HGY A;  1AA7 A;  3O8G A;  4O5V A;  2K02 A;  3J7Y J;  2ME6 A;  3G1M A;  3I53 A;  3ROU A;  5CYV A;  4ZH4 F;  4A0X A;  4DYC A;  3W6V A;  4BJ5 C;  3NWS A;  5LHI A;  1U5T C;  3CES A;  3CME I;  2FNA A;  1YW8 A;  5KCM A;  4HW0 A;  1EA3 A;  1KA8 A;  3MEX A;  1TWF J;  3ASN H;  2XV4 S;  1ZR4 A;  2M1B A;  1YYV A;  4AID A;  3SZP A;  1H88 C;  5LGN A;  2K9L A;  1I1S A;  4WXH A;  4RM3 A;  3H35 A;  3JRC A;  3OMY A;  3TW6 A;  3CO7 C;  3QAH A;  1X1P A;  2Z5U A;  2W00 A;  2MYS A;  1IRX A;  4XK4 A;  4BJT A;  4GO1 A;  5C3E J;  2L0K A;  1JUM A;  2RNG A;  2DMT A;  1PYV A;  2WAD A;  1ON1 A;  5HLT A;  3BLY A;  4GFB A;  3FHN A;  2V9P A;  3HOV J;  5E8I A;  4KA4 A;  3PIP F;  1ODD A;  3SXY A;  3WHB A;  3A01 A;  1IRZ A;  4ENK A;  1TNT A;  1RPW A;  1FSE A;  3ZMD A;  3FBN B;  2DYR H;  3I3L A;  3B73 A;  1FPQ A;  3CC4 I;  1J5Y A;  4CDG A;  1A35 A;  2PMH A;  2DFH A;  3E1S A;  1JUS A;  4XLA A;  4F52 A;  4LB6 B;  3CCV I;  4LB5 A;  1PUF B;  3AL0 B;  1YRN A;  4BXX J;  2DI3 A;  1V54 H;  4KIT B;  2LR8 A;  2JJ7 A;  3OV8 A;  2H94 A;  2IGM A;  4OOI A;  1H9T A;  2XGD A;  2M30 A;  1LVK A;  1MMA A;  3H9G A;  5B66 C;  3K2Z A;  1U6G A;  4HRI A;  2DQL A;  2PQ8 A;  3H36 A;  1XMK A;  3I59 A;  1P9Q C;  1TNS A;  2KRH A;  4CCM A;  4CCO A;  5HVQ C;  1WCM J;  2RDP A;  3TO7 A;  2PG4 A;  2LRE A;  2D1H A;  2R5Y A;  2H09 A;  4I99 C;  3JRA A;  1TWG J;  1D8K A;  2PJR A;  1HCR A;  4IHY A;  2VOP A;  2P5L C;  3HSF A;  1L0O C;  2YPR A;  2C6Y A;  4M3B A;  2K40 A;  4Q48 A;  3GLL A;  4OU0 A;  2A6T A;  1FBS A;  3G71 I;  2IT0 A;  5D4S A;  1Z91 A;  2DA3 A;  2EZL A;  3V42 A;  4UXN A;  2KRC A;  1Z7U A;  3Q5F A;  2OUM A;  5FKK A;  1OJL A;  1SD7 A;  1K78 A;  2COM A;  3GXO A;  3Q9V A;  2XRO A;  5D6E A;  3LAP A;  1MBE A;  1KGS A;  1KQ9 A;  2K27 A;  1FMV A;  1R1U A;  3KIO A;  1E3O C;  3BC8 A;  3GFI A;  1UST A;  2JWT A;  3IH4 A;  4BDY A;  3KYL A;  1QU3 A;  4P5O A;  2PBI A;  2Z33 A;  4XLN F;  2WWY A;  1SMY F;  1JE8 A;  3A4C A;  1U0J A;  2QSG X;  2WAQ N;  1H0M A;  2M4G A;  5EGO A;  3CLQ A;  5E79 C;  3S16 J;  1VQ5 I;  1MMS A;  5D5W B;  2GA2 A;  4BEH A;  3BTJ A;  1IN6 A;  5EZG A;  1SVL A;  3CC7 I;  2LY1 A;  3CJQ B;  1D0Y A;  1F9N A;  5IPA A;  4KIG A;  4HPQ A;  3I71 A;  2CW7 A;  3K70 C;  4NHJ A;  3WTW C;  1JKO C;  3BWG A;  1IZ1 A;  2Q8K A;  5CVU A;  3IKV A;  1X4O A;  1MBG A;  5IP6 A;  3K69 A;  3P5J A;  3ZQH A;  3GME A;  3NAU A;  4CSW A;  4AC0 A;  2BY1 A;  4OIR F;  4CYD A;  1W36 C;  4M74 A;  1B9M A;  2KQR A;  5IYD J;  3K4K A;  3K1P A;  4H4K C;  5BQT A;  3FMR A;  2HNH A;  2KIF A;  4KIB A;  1LDK B;  4A3G J;  3HJE A;  1HSJ A;  2GXA A;  3M9A A;  5JVT A;  2W24 A;  2VOD A;  1STZ A;  4HBL A;  4ABZ A;  3HRT A;  2P8T A;  1MIJ A;  2FUG 2;  1T38 A;  2F5E A;  5BPI A;  2VJJ A;  4XKC A;  2M7A A;  1UFM A;  4E7Z A;  2R5Z A;  4BEH B;  2STT A;  2X1E A;  1WJE A;  2WC2 A;  3WGH A;  4HF1 A;  3CJN A;  4KN4 X;  2KL4 A;  2MH2 A;  5EJC A;  3JRH A;  1JHF A;  4FX0 A;  3H3U A;  3M1E A;  2R0Q C;  4PFP A;  4B8X A;  2EIJ H;  2HXI A;  1D3Y A;  1MMD A;  4HLY A;  3R61 A;  3EUH A;  1O3R A;  3ZR8 X;  4RAZ A;  2HQN A;  1W0T A;  2O03 A;  4JX4 A;  3KP2 A;  1S3J A;  3MN2 A;  1FOY A;  3F72 A;  3J7Z I;  5LRR A;  4ENJ A;  3VB2 A;  3J80 Z;  2WAE A;  3KCC A;  4BJ6 C;  1K4S A;  3GTJ J;  1Q1H A;  2DA6 A;  2VC1 A;  4DZP A;  2ELK A;  2ACJ A;  2L7F P;  5FFZ A;  3KYC B;  5JVG F;  4A93 J;  4YEL A;  1LEB A;  1IUY A;  2LKP A;  4P9F A;  5DYM A;  4B44 A;  3LAJ A;  4IO9 F;  4A3E J;  5F6F A;  3DQV C;  5IP9 J;  1OFC X;  2YUS A;  1ETW A;  4GGG A;  4Y52 J;  4AUX A;  2OQG A;  3WTZ A;  4OAZ A;  4Y13 A;  1YJW I;  3EPZ A;  4DW6 A;  1P6R A;  1BW5 A;  2DA1 A;  1WJ5 A;  4PGH A;  1ETX A;  1Y8R B;  2BY0 A;  3IC7 A;  2JPC A;  4ETS A;  3G1O A;  1S29 A;  1YW7 A;  3VDX A;  1VQ4 I;  2XF5 A;  1FP2 A;  1VQO I;  4GYI A;  3A2K A;  3B6A A;  3LMM A;  5IT9 K;  2ELH A;  3F6O A;  1SD6 A;  4R1H A;  2EV5 A;  2OU2 A;  4L9T A;  3GZN B;  3AFH A;  1HDD C;  3BPV A;  3R0A A;  1U8B A;  1WPK A;  5F64 A;  4HX4 A;  4BYY A;  1X2N A;  1RKT A;  4CH7 A;  3IRQ A;  2DMP A;  2FJ1 A;  1MMN A;  3BTL A;  2NS0 A;  4FAS D;  3BZC A;  1XMA A;  2MC4 A;  4MTE A;  3V7C A;  3F23 A;  3JRE A;  3ONQ A;  2CYY A;  1FIP A;  4OWR B;  3JAM K;  1IO2 A;  3L2R A;  5CVI A;  3S3N A;  3GTQ J;  2VLA A;  2ZJR F;  3QP5 A;  2LBF B;  3ABM H;  2XHK A;  3PNY A;  1G3Y A;  4RGS A;  3VOD A;  1N25 A;  3OOP A;  4KUM A;  1VF9 A;  5EZH A;  3OR1 C;  2MC3 A;  3OYF A;  2A5W A;  1FIA A;  1ETQ A;  2OTJ I;  4G7H F;  3OOU A;  2KIS A;  1NG7 A;  2NVQ J;  4QTR A;  4CCK A;  1PDN C;  4LIU A;  1XGS A;  2NOG A;  3K4M A;  3HOS A;  3HDD A;  4D5C A;  3H0D A;  3DKW A;  3SDB A;  4NC6 A;  1FNN A;  3S2D J;  3IAM 2;  1R4N B;  2ZSH B;  4HF0 A;  1U78 A;  2OF7 A;  5LHG A;  1XG1 A;  4FHT A;  2V1D A;  3WTX C;  3QOE A;  3GTM J;  1FLI A;  2QLZ A;  1Z7L A;  4MQV A;  4BY1 J;  3LA2 A;  1TLH B;  1KU7 A;  2HU9 A;  1T0F C;  1E3H A;  4WXC A;  1BJZ A;  1JGS A;  1HXD A;  4NUB A;  3FXU A;  3ZMV A;  2DA2 A;  1P4X A;  1LQ1 A;  2GM4 A;  1VQ8 I;  2VBZ A;  1NHA A;  1X3W B;  2V26 A;  1Z67 A;  2LMD A;  1X58 A;  1D5Y A;  3HXL A;  2JSC A;  3DF8 A;  1R4M B;  1V5E A;  2L9N A;  4Y33 A;  2Y75 A;  3I59 B;  1R5G A;  3QU6 A;  2HOE A;  2O8K A;  1X3Z B;  5J4V A;  1LVA A;  3V4G A;  1I6X A;  5J47 A;  3KLO A;  1W7P A;  2PJR B;  2HI3 A;  4OAY A;  2R7S A;  1EH8 A;  2KDZ A;  1TW2 A;  4HX8 A;  1YO5 C;  1VND A;  1ZGW A;  2IA1 A;  3REO A;  4B4C A;  3MZ8 A;  2CFO A;  1O3Q A;  2G0E A;  1I6H J;  3DBH B;  3MZH A;  4WCG A;  3D5L A;  2NRA C;  3R6S A;  5D4R A;  2JTV A;  2WB1 A;  1Q1V A;  4FIS A;  3KP4 A;  2R92 J;  3ULQ B;  4HEA 2;  2OTL I;  3DPU A;  2M8E A;  2EV0 A;  5B1A H;  1GXP A;  2YS9 A;  3RTR A;  2MH9 A;  1XN7 A;  4AIH A;  4IRG A;  3N4M A;  4KMU X;  3PIO F;  2XAS A;  2XGC A;  1UJ8 A;  2WAQ A;  2H6C A;  3I4N J;  5J3L A;  4GYG A;  5GAE J;  3KFW X;  1OYW A;  4EEF G;  5K1Y A;  1S8N A;  2FF4 A;  4RBO A;  3COA C;  1XMX A;  1W4M A;  1Z21 A;  3RIR A;  1XS9 A;  3H92 A;  2L5Q A;  3BRO A;  4RMN A;  4U0W A;  3IRR A;  4Q4Z F;  1RIO H;  3HL2 A;  3AL0 C;  3RDI A;  3T0Y A;  2B9S A;  3OYM A;  5EGO B;  3GTG J;  1B59 A;  3A0B C;  5HNF A;  1WJF A;  1VQM I;  1WGX A;  2XF7 A;  1OCC H;  3K4B A;  1IXS B;  2AXT C;  1OCR H;  2EV6 A;  2A5Y B;  4G9Y A;  4M6Y A;  3VFZ A;  2MGQ A;  3LWF A;  2WV1 A;  3NAR A;  1U3E M;  1YIT I;  4IOA F;  1BI2 A;  2GOM A;  3ZQI A;  1CF7 B;  1OMI A;  3WGI A;  3DPL C;  1IN7 A;  2DDA A;  4XLH A;  1K7A A;  1SFX A;  1B8I B;  3CF5 F;  4KT5 C;  3QQA A;  4Q47 A;  2O8X A;  4DQ2 A;  2K3F A;  1HW1 A;  4BNC A;  4XOT A;  3OYD A;  4E4H A;  5EF6 A;  1G6N A;  2JRT A;  4EJV A;  4IOC F;  1SFK A;  4Y7N J;  3MD2 A;  4JQF A;  2LG4 A;  4B43 A;  4PSX A;  3JCU C;  3P9C A;  5ICE A;  3BY6 A;  3GF2 A;  1MNM C;  4HZF A;  1JUP A;  4KIC A;  5IOY A;  1GLN A;  3S1R J;  1NK3 P;  2XB0 X;  1ERD A;  1MW7 A;  4HAM A;  3IUO A;  3ZMS A;  2NOJ B;  5F0H A;  4IJA A;  2HZT A;  2LKS A;  2EJR A;  2VB6 A;  1SVM A;  3AG2 H;  1VQ9 I;  3ASO H;  3WTT C;  4X0G A;  4WX9 A;  3R0J A;  4DBQ A;  3HRU A;  4ENN A;  3CLO A;  4A6D A;  3JW4 A;  2XAQ A;  3W6J B;  4ZC3 A;  1MDM A;  2DQR A;  3BT9 A;  1W5C C;  1FT9 A;  1K6O A;  1ON2 A;  3GTK J;  2PLY A;  2HVR A;  3LA3 A;  1E0E A;  3ZQF A;  1G3T A;  5K7Z A;  4BHP A;  2LOO A;  3LA7 A;  5CVR A;  2KRF A;  1UAA A;  4B3X A;  1WHU A;  2GBY A;  1J0R A;  4L9N A;  2DT7 B;  2NVY J;  5IT3 A;  2HYF A;  4BE0 A;  3J80 K;  2X48 A;  3F3X A;  1J2X A;  2OZU A;  2HKO A;  2P6S A;  2HVS A;  2JQ7 A;  1YIJ I;  4NDL A;  2L54 A;  3ZP5 A;  4E7K A;  3CTA A;  4U87 A;  3C18 A;  3QOD A;  1WKM A;  3CJR B;  3GVA A;  1ZTR A;  1B9N A;  3KLN A;  4XLF A;  2P6T A;  2O3F A;  2Z99 A;  4XN0 A;  4CCN A;  5K5Q A;  5E3M A;  1O4X A;  4HF2 A;  3G3Z A;  2ZCW A;  3V8L A;  4M3G A;  4DJA A;  2R7Q A;  3D0S A;  3IH2 A;  4U0Y A;  2E71 A;  4L18 B;  5DD4 A;  4NB5 A;  2RGV A;  1IRF A;  4GCV A;  5EEA A;  1BA5 A;  5F0F A;  2XUB A;  2NVU B;  1PUE E;  1BOA A;  2VQC A;  4LD5 A;  5FJ8 J;  2ZO4 A;  1X19 A;  3E6M A;  2KLO A;  4Z2Y A;  5KVR A;  3ZCO A;  2VI6 A;  1ZAR A;  1OCO H;  6PAX A;  3L9F A;  3TL4 X;  1BR1 A;  2FNP A;  4HYE A;  2EFO A;  1A6I A;  4IHV A;  2A6E F;  3OYN A;  3RZO J;  1ONV A;  4AYB A;  3GCM A;  3FXO A;  2PN6 A;  2OBP A;  1K79 A;  1P2F A;  1VQN I;  1P4A A;  2IEK A;  3VPR A;  2P81 A;  2UZK A;  3RCO A;  1BBY A;  1BC7 C;  2O7O A;  3R4K A;  2WY7 Q;  2ISZ A;  5DV5 A;  2HOA A;  5TIS C;  3CCR I;  4XNF A;  4ZTJ A;  2FD5 A;  4HQE A;  3S93 A;  4HV5 A;  1BJA A;  4NNJ A;  4O3M A;  1ULY A;  3FMQ A;  2ESN A;  3K6G A;  3PNV A;  3MKY B;  4BKX A;  3E0J B;  2KFD A;  3I58 A;  5KK1 A;  3BR5 A;  3OYH A;  3RKX A;  2DTR A;  2VE9 A;  2QKL B;  2QQ9 A;  2QZ8 A;  1HKT A;  1BR4 A;  3KP6 A;  5JR3 A;  2I10 A;  4EQQ A;  4XKB A;  5KNL A;  2Y9Y A;  4A3K J;  1EH7 A;  3JRB A;  4ESJ A;  1F4K A;  3FM5 A;  2LBF A;  2W4S A;  3UNG C;  3BTC A;  4QSH A;  3B6C A;  2Q1Z B;  3K1M A;  2I8D A;  1G2H A;  4N4O B;  2DA4 A;  5H6R A;  2NNY A;  1X1B A;  1S6L A;  3OIQ A;  4KJZ A;  5IYC J;  3JRD A;  3IHU A;  1E2X A;  2ZBK A;  1BI0 A;  4EJO A;  1FEX A;  2M45 A;  2XPV A;  4C2M J;  5J6X A;  1K61 A;  1XCV A;  1IXR C;  2VXZ A;  1XDS A;  2R7W A;  3ECH A;  4XRS A;  3OYL A;  3ZMZ A;  2IAI A;  1SFU A;  4XOR A;  2F4M B;  3SQN A;  4L5I A;  3KZY A;  1KYW A;  4RGU A;  3TO9 A;  2CG4 A;  2XAF A;  1PP8 F;  1OLT A;  3K7A J;  2EPF A;  4L5J A;  5DD8 A;  3I55 I;  2K9M A;  2Z9O A;  1N78 A;  1MDM B;  1DDN A;  5GAG J;  5LHH A;  2IGN A;  2BBY A;  3H1C A;  3QYF A;  4A69 C;  2QWW A;  2L9R A;  1YW9 A;  3PSI A;  5H2F C;  1DPU A;  4LK0 F;  5TJJ A;  2P0W A;  2DJI A;  2XDV A;  4XM3 A;  4L0Y B;  3CUO A;  2Y30 A;  3HHH A;  3I4P A;  1JJ8 C;  1JHH A;  1BOB A;  4HSR A;  2O0Y A;  3F0C A;  3CCJ I;  1EV7 A;  2HYG D;  4YIF A;  2FMY A;  4G12 A;  3H3V K;  2LLK A;  4M6X A;  1XGO A;  2R7O A;  2XC7 A;  1DU0 A;  1Y56 A;  1ZHF A;  4BBR J;  2UUZ A;  3H0G J;  1KZH A;  2E1M B;  1ZGJ A;  2DFE A;  3HTS B;  1OYI A;  2JSP A;  1EKE A;  3EYY A;  5J4Y A;  1A04 A;  4I2O A;  1YX5 A;  4BBS J;  4AWX B;  1UB9 A;  2K9N A;  3HKZ N;  1GVJ A;  4JX5 A;  2NAZ A;  3QWL A;  3T8R A;  5M3M J;  2KJB A;  3L1P A;  3EUH C;  3TOB A;  1S9H A;  3F8M A;  4QWQ A;  2DT6 A;  4Z6Y A;  2MSY A;  4A3M J;  2QF7 A;  4I0A A;  1SAU A;  2VKE A;  4II2 A;  4B48 A;  5HOD A;  3ML6 A;  2CUF A;  2BW3 A;  5IOZ A;  1G8X A;  1UMQ A;  4DYQ A;  5JFR A;  1SFE A;  1IRG A;  2CW8 A;  2ZXI A;  2XPU A;  3GX4 X;  3KEQ A;  1IV6 A;  1BC8 C;  3FXL A;  4A3F J;  2F6C A;  2Z2S B;  4PJL A;  2HPI A;  3RQI A;  1ZN2 A;  2RV8 A;  1YOV B;  5LEK A;  4G8X A;  3RKY A;  3J7A Y;  1MJ9 A;  3RJP A;  3AG3 H;  2ECC A;  1T56 A;  4MTD A;  1QHG A;  4PZJ A;  1VQK I;  1ETV A;  4KMF A;  2V4J C;  1WH7 A;  4AVP A;  5BMZ A;  2CWE A;  4KN7 X;  3J81 Z;  5FRN A;  3VYS B;  1BIA A;  3DEU A;  3C1D A;  2KMU A;  4M9Z A;  3OR2 C;  2HR3 A;  3WU0 A;  3KZZ A;  4I98 B;  5ED4 A;  4B47 A;  4FTH A;  2IGK A;  2PMU A;  2DU9 A;  3S32 A;  4D0P A;  2XRN A;  1GHC A;  1QZY A;  2W57 A;  5H6Q A;  5C4J J;  3RPQ A;  3CZ6 A;  1ZLK A;  4JOM A;  2CGP A;  4C3H J;  5B5E C;  5C4X J;  1KQ8 A;  3G2B A;  2IW5 A;  2L4M A;  3OYE A;  1SAX A;  1AKH B;  2CS3 A;  4N9H A;  1SEU A;  4UUS A;  1KU2 A;  3BG7 A;  3HM5 A;  2L9V A;  2ZME A;  1LJ9 A;  1KYZ A;  3BTI A;  2KJC A;  5BNG A;  1D1A A;  4BE1 A;  5DTD A;  3S8P A;  4J00 A;  5EEG A;  4A0Y A;  4FE7 A;  1MH3 A;  2CO5 A;  2LYC A;  4BY7 J;  4CZC A;  4A3B J;  1Y0N A;  3G1L A;  1K78 B;  1QNT A;  4NQW A;  5DDG A;  3TQN A;  4HDV A;  2LH9 A;  3VYT B;  1IDZ A;  2E1C A;  4BH9 A;  1MNE A;  2FXA A;  4DYR A;  1YG2 A;  1VTN C;  3TBI A;  4CXF A;  3SFI A;  1U8R A;  4GXO A;  3OYI A;  2CMP A;  2KIM A;  1ZH5 A;  4D7N A;  5ICC A;  1R5I D;  2VJI A;  4E7L A;  2LC2 A;  4IPA A;  4FQG A;  3H5R A;  1LUJ B;  2FBH A;  2TRT A;  3ZQG A;  1ACI A;  2AHQ A;  1R36 A;  4A5M A;  1AWC A;  5EDN A;  3G73 A;  3A0H C;  5E20 A;  1HLV A;  2FBI A;  4XIC A;  4EMS A;  1ZRD A;  4I0B A;  2Y0S A;  4P96 A;  1PP7 U;  1YRN B;  1YS6 A;  2UWM A;  1TT5 B;  1OYY A;  2FRH A;  4I6Z A;  1F43 A;  1R22 A;  2VPL A;  1B72 A;  2RNJ A;  3HOW J;  3F8B A;  2Q0O A;  3A01 B;  3G4S I;  1ENH A;  2E35 A;  2EA4 A;  1OKR A;  2VKH A;  1R7J A;  3OS0 A;  4E7J A;  1Z0X A;  4IF4 A;  4LIT A;  5JI6 A;  3CMM A;  2R4G A;  3T5X A;  4MEX F;  4XLP F;  1RC9 A;  4XKW A;  2P5V A;  2M0C A;  2UXN A;  3HRS A;  1OPC A;  1PUF A;  4G6Q A;  1CGP A;  1POG A;  2LDU A;  4F3Q A;  3IL2 A;  3L2C A;  3BZK A;  2AO9 A;  2IVM A;  4HG2 A;  3K10 A;  1NTC A;  5J1Y A;  4DGW B;  3A03 A;  4LJZ F;  3WOD F;  5FB2 A;  1W7P D;  2R7X A;  2VQH A;  1Y6I A;  2GAU A;  3DP7 A;  2VIX A;  4J01 A;  1SC7 A;  1HQC A;  2E2H J;  1PVE A;  2HFH A;  2K7L A;  4UV9 A;  3L09 A;  4CO8 A;  3PSF A;  1Z3Y A;  3F8C A;  1CF7 A;  4BQO A;  2PMZ A;  3IV5 A;  1D0Z A;  3HUG B;  2R7F A;  4RB0 A;  2I5U A;  4HV6 A;  2JVH A;  2X6W A;  3KEO A;  2ZJQ F;  2JZY A;  2G9W A;  5E3O A;  2VBY A;  3P9I A;  5GAH J;  2F5D A;  3ZPL A;  2COB A;  2JVG A;  3GUD A;  1MMG A;  4RAG A;  4WK8 F;  1X1D A;  1O7L A;  1YIO A;  3FKI J;  3S2W A;  5EYR A;  1HBX G;  2VN2 A;  5IP7 J;  2JA6 J;  4OIP F;  2L2O A;  3DLL F;  5HOO A;  3HC7 A;  3SFZ A;  1ZG5 A;  1MGT A;  3DTE A;  1FWZ A;  1DGR M;  1I3Q J;  2HKX A;  4OMZ A;  3ZRG A;  3T1B A;  1WVR A;  3U21 A;  4E7S A;  2KHM A;  4U0V A;  3E5Q A;  3QOP A;  3ZQ7 A;  1W36 D;  3M07 A;  1VQP I;  3OIO A;  1RR7 A;  1QZE A;  1FOW A;  1KQ0 A;  1ZLJ A;  2LF8 A;  1V5F A;  5DCM A;  3L2Q A;  2EBI A;  3WG9 A;  1YJ9 I;  4OIO F;  5JHF A;  5CLS A;  3BR6 A;  4RGX A;  1LFB A;  1MBF A;  5CPR B;  3C2G A;  4CHU A;  5FLX K;  3ERE D;  4PJJ A;  3GFL A;  2LKX A;  3PFI A;  4EAT A;  2DFF A;  4Q5S F;  4F55 A;  4OMY A;  2VOO A;  3ZMU A;  4M9S A;  4PJM A;  3VOE A;  3CCL I;  1DP7 P;  4FT8 A;  3SZT A;  3DFG A;  3P9K A;  3HPH A;  3DTI A;  1ZK8 A;  5F0C A;  3GBG A;  1R00 A;  3JRI A;  4WF2 A;  2QQA A;  4GRI A;  5B1B H;  4QIW N;  3ZGK A;  2BY2 A;  2LF7 A;  4RB3 C;  2A05 A;  1APL C;  1X2M A;  2DJN A;  4M3E A;  2EQR A;  1XPX A;  3GEZ A;  1W5T A;  2DA5 A;  2NS8 A;  2XF6 A;  2W1O A;  5ILS A;  3KX2 A;  3JAM Z;  1J59 A;  1MBJ A;  2CU7 A;  3E97 A;  4PUS A;  5EG0 B;  4F93 B;  3U9G A;  4DIQ A;  1BI3 A;  3L2W A;  2PI0 A;  2DAO A;  2R7T A;  4EGZ A;  1HKQ A;  2NNN A;  4ITV A;  1HW5 A;  2IGO A;  3MKL A;  5FD5 A;  1HKS A;  4YIR X;  3WGG A;  5E17 F;  2JA2 A;  2JA5 J;  2KT0 A;  2CUJ A;  5M5W J;  3EYI A;  4LOC A;  3QPS A;  2R5Z B;  2ZKZ A;  1T0F A;  1RR8 C;  4F92 B;  2V1N A;  3E3V A;  1RI7 A;  4H0E A;  2JK3 A;  5DUK A;  3DKX A;  5DEQ A;  2VAS A;  3LSJ A;  1R1T A;  4HQM A;  2L4A A;  3TMO A;  2BZT A;  4MHG A;  2DLL A;  3HKZ A;  1KU3 A;  2F4I A;  2ZXH A;  2K4J A;  3TOA A;  3CCM I;  3ZMT A;  1B8I A;  2MG4 A;  2QYO A;  4L9J A;  2Y2Z A;  1JJ6 C;  2ZNZ A;  1TT0 A;  2FE3 A;  3FXJ A;  3FK6 A;  2M8G X;  4UB6 C;  5FKN A;  4IHT A;  4ZYE A;  4EM1 A;  2D45 A;  3W3C A;  1I39 A;  3NRV A;  4LG3 A;  3FK7 A;  2L02 A;  2YR2 A;  4BQA A;  3S2H J;  1IN8 A;  3C7J A;  1WJB A;  4ZDP A;  4W97 A;  1R9T J;  5L3F A;  1V3F A;  4N4N B;  1G3S A;  2CV2 A;  2RRE A;  3MZY A;  1TQI A;  2CH0 A;  3DTK A;  1B6A A;  3KET A;  2HQA A;  1YLF A;  1MSF C;  2IA0 A;  2BW3 B;  4CZZ A;  2AS5 F;  3CC2 I;  4I76 A;  2ID3 A;  4IVN A;  4XL9 A;  2Q2E B;  2HTS A;  1G4D A;  3W2V A;  3S1N J;  3OYB A;  4IL6 C;  3D5S C;  2LY2 A;  4V2F A;  3L2U A;  5GAD J;  5M3F J;  3LSM A;  1BR2 A;  2BYV E;  4MFE A;  4BAY A;  2EZH A;  3PQJ A;  2LP0 A;  3TP3 A;  2DBB A;  4AU7 A;  3K2A A;  1FMW A;  1XDU A;  1YE9 A;  5D5U B;  3QYB A;  1LPQ A;  2M3A A;  1SD4 A;  2DMQ A;  4RB2 C;  1Z05 A;  5HLG A;  4M3D A;  4UVA A;  4CUG A;  2WBM A;  4FX4 A;  3AAF A;  1R58 A;  4FE4 A;  2FQ3 A;  4IHX A;  1UCR A;  3RKW A;  3F6V A;  3KYD B;  1OIS A;  3PUB A;  3GTL J;  3Q0V A;  5M5X J;  3CMA I;  4XBF A;  1FY7 A;  4XON A;  3OS2 A;  4BXU A;  2QGU A;  3WU2 C;  4ESF A;  3VSL A;  1T39 A;  3PO2 J;  1VQ6 I;  1BW6 A;  5E8G A;  5TRD A;  2VC0 A;  2GA1 A;  1NK2 P;  1JTY A;  3ELK A;  2QA4 I;  5JHU A;  1BM9 A;  3CDI A;  2VJ4 A;  2M34 A;  1JI8 A;  1ZRF A;  2K3P A;  1F36 A;  1EJ9 A;  2LTP A;  4V19 K;  2DMU A;  5AIQ A;  3F21 A;  4FCY A;  5ICF A;  4ON0 A;  2BEO A;  4IRI A;  1Y8Q B;  2Z16 A;  1ZRC A;  4UVB A;  1WI9 A;  4EVI A;  5K7F A;  2GOX B;  3VYU B;  3BJO A;  1DQU A;  4K2E A;  9ANT A;  4PFO A;  1TP4 A;  4ZZL A;  2ID6 A;  2NXN B;  2F2E A;  3KP3 A;  4RLF A;  1R6R A;  2W85 A;  2FOW A;  1JGG A;  1IW7 F;  1QGP A;  4D1Q A;  1LFP A;  4JP0 A;  1R71 A;  2VON A;  2K5C A;  5FKL A;  5L3D A;  5AON A;  4EV0 A;  3WE2 A;  3N97 A;  4NC7 A;  2TCT A;  5DCM B;  4LG0 A;  5J8F A;  2VJ5 A;  5E3N A;  2QSF X;  2XVC A;  4XRF A;  5IY5 H;  3OYC A;  1IF1 A;  2KZG A;  2OAZ A;  5F08 A;  3LST A;  4S04 A;  3QP6 A;  2R7U A;  5HNH A;  3JSO A;  1W0U A;  1D1C A;  3ABL H;  3OL3 A;  2W7N A;  4KDP A;  1QZZ A;  1TWH J;  2OA4 A;  4NBQ A;  5BPD A;  2LNB A;  4TV7 A;  3TW7 A;  3WU1 B;  3GFM A;  3IWF A;  5F1R A;  3ABU A;  2KPM A;  3PM1 A;  4M3F A;  3JRG A;  3WHC A;  1TQP A;  1T8I A;  3CCY A;  2IS1 A;  2L7M P;  2VT2 A;  4EM0 B;  4M6V A;  3RYR A;  1IAW A;  3U2R A;  5KHD A;  2OV7 A;  1TW3 A;  4P1W A;  3ZXS A;  2E1O A;  3RPU A;  2X51 A;  2M5W A;  2VKD A;  4IQ4 A;  2V79 A;  3HUG A;  2EFQ A;  2GWR A;  3KZI C;  2PJP A;  1MJB A;  3J7A O;  3A1Y A;  4NC8 A;  3LSI A;  5GP9 A;  4M9X A;  3JRF A;  1OCT C;  1SMT A;  2QQ8 A;  1O3T A;  3CUQ A;  3CMY A;  3TDZ C;  2OJE D;  3KPH A;  1I5Z A;  1RNL A;  3H3Z A;  1GVD A;  1QRY A;  2ADU A;  4PJ0 C;  2A69 F;  4U7D A;  2J5O A;  1T95 A;  5J8C A;  2IS6 A;  1FC3 A;  2DMN A;  2EIM H;  2ECB A;  3JTH A;  3K4L A;  4G94 A;  1U5T B;  2HQR A;  1ORK A;  3BCA A;  3H9J A;  1G59 A;  3E6D A;  2AQE A;  3I5U A;  4A3D J;  1V4R A;  1ZG1 A;  2ZJ2 A;  1ZQ3 P;  4CYC B;  1P4W A;  1VI0 A;  2D2W A;  1WI3 A;  2HQ5 A;  2GQQ A;  2QCO A;  2D1V A;  2R7R A;  2HVQ A;  2X1D A;  2L3D A;  2Y48 A;  1F1Z A;  2IBD A;  4BDZ A;  2LVS A;  3U1D A;  1HDP A;  2WA0 A;  2WTE A;  5HS8 A;  2FBK A;  2B63 J;  4IKF A;  2B7E A;  3NQO A;  1IGN A;  3JR9 A;  3O2P E;  3DPT A;  2HDC A;  4LLL A;  3BDD A;  4A3J J;  2V9K A;  3DKY A;  3K4J A;  1JKP C;  2E19 A;  2WB1 N;  1S7E A;  3HYI A;  1J09 A;  3F8N A;  2N8G A;  4B1R A;  1MD0 A;  2EZI A;  2AXL A;  1R1V A;  4A5N A;  3RYP A;  5CVV A;  3EUK L;  4E7H A;  3FHZ A;  5FRO A;  2DW4 A;  1K4T A;  3ERM A;  1OCZ H;  2CQX A;  5KAI C;  4ZYH A;  5D8K B;  4BAC A;  2NVT J;  4YFK F;  2QBY B;  3BOQ A;  1TWC J;  1WJA A;  2DK8 A;  3PNT A;  3V7S A;  4F7Z A;  5H20 A;  2X6X A;  1GXQ A;  4X6A J;  4IXA A;  3L2V A;  1A5J A;  3Q0U A;  2M2E A;  5C44 J;  2R5Y B;  1S7O A;  1YQA A;  3BG9 A;  3CQZ J;  3WTV C;  2IXS A;  3IAS 2;  3EDP A;  4BE2 A;  1J75 A;  2VKV A;  4DNC A;  3WTU C;  3PJR A;  2O9L A;  2K9Q A;  2BVM A;  1QHH D;  2JUC A;  4G7O F;  2ZNY A;  2PX9 A;  2NS7 A;  3CDL A;  2VT3 A;  2W82 A;  4RAF A;  4XKV A;  1FJL A;  1TZL A;  3S1Q J;  4HNT A;  3DEE A;  2HWV A;  4IRH A;  1LB2 A;  3QRF F;  2RC4 A;  1MND A;  3L7W A;  3M4O J;  3C2B A;  3K70 D;  2WY8 Q;  4Y17 A;  4EJU A;  2FA5 A;  4HA8 A;  4C9Y A;  1Y39 A;  2XPW A;  5E1Z B;  1YX3 A;  4HNU A;  4UB8 C;  3S3O A;  4S0H B;  1C0W A;  1N77 A;  1TC3 C;  2V6C A;  3S14 J;  1AU7 A;  2NVX J;  4C2U A;  3BR0 A;  3LSK A;  2IJL A;  4LK1 F;  1QBJ A;  5A2Q Z;  2Y69 H;  1X1A A;  3FXK A;  3BP8 A;  2HOS A;  1L3L A;  1LDD A;  2XAG A;  3Q3S A;  2X4H A;  2G7H A;  3FM3 A;  3FX3 A;  4KFC A;  4RAY A;  1BL0 A;  1MZB A;  2FQ4 A;  2IA2 A;  3LFK A;  4ZZD A;  4JBA A;  1ZR2 A;  2HXO A;  4C3J J;  3RZD J;  1XB4 A;  1AHD P;  2BE5 F;  1X1C A;  5F04 A;  3HG9 A;  1LKX A;  2L01 A;  2FU4 A;  4YRV A;  4YG2 F;  4C3I J;  3DXJ F;  3CCQ I;  2V1U A;  4FET A;  1CQT A;  4BHB A;  3BPX A;  2E2I J;  1E17 A;  1SVO A;  1XGN A;  2Y0M A;  1A31 A;  2V6E A;  2EIL H;  1XC5 A;  1S5L C;  2V9V A;  1FYM A;  4E70 A;  3ZQL A;  3TDU C;  3GTP J;  2VUM J;  2JA7 J;  5A2Q K;  2EZK A;  2MBF A;  3KP7 A;  1SAN A;  2WAF A;  3I56 I;  4I01 A;  4IX7 A;  2FOK A;  2Y9Z A;  3PL8 A;  1WFX A;  5TGT A;  3FXQ A;  3EET A;  3H5N A;  1JTX A;  1DU6 A;  2VXD A;  1R5H A;  2R7V A;  1AOY A;  1LFU P;  3PFY A;  1VZ0 A;  4HST A;  4PGG A;  2OCC H;  1UG0 A;  1WSU A;  4BGD A;  2CQK A;  3CP8 A;  5DUI A;  5CQG A;  3BQZ A;  5ILU A;  5LD2 C;  2ETH A;  2P7V B;  4CCJ A;  2XAJ A;  1X3U A;  3CP2 A;  3R60 A;  4XLC A;  4N9I A;  1IDY A;  1WWX A;  5J1U A;  1D5V A;  2Z3Y A;  2YU3 A;  1WQ2 A;  4IQJ A;  2H1L A;  3V8K A;  2BOL A;  3E5X A;  2KDO A;  5K7H A;  1JT0 A;  1MBH A;  1MJA A;  3FXR A;  2FEZ A;  4XQF A;  2CFX A;  2H6B A;  4A3I J;  1SFO J;  2ZFU A;  5FGM A;  1LEA A;  5JLW A;  3LSP A;  2H1K A;  2X6O A;  4Y3O A;  4I02 A;  3K1N A;  2BGC A;  3DBR B;  4A0Z A;  4L9V A;  1TBX A;  2O6G E;  5EG0 A;  2E1N A;  2IS2 A;  2JRM A;  2B0L A;  1TQM A;  1GT0 C;  4PDK A;  4BQN A;  2M9H A;  1UEL B;  3H9Q A;  4AYB N;  2EIN H;  2TDX A;  2VQL A;  1VQ7 I;  1W5S A;  1Z77 A;  3FF5 A;  3MKZ A;  2DA7 A;  2XKO A;  2HZD A;  3VSK A;  1FYL A;  5D5X B;  2K4B A;  1EH6 A;  4PSW A;  5GPC A;  2HOT A;  3DLA A;  4XN3 A;  1WH5 A;  2BV6 A;  2HS5 A;  3S3M A;  3TP0 A;  5LRS A;  1JT6 A;  4C30 A;  4L5E A;  4D9J A;  1A36 A;  4U7B A;  3OYA A;  2ZJP F;  2DPU A;  3DWL E;  4LLN A;  1RKW A;  5ILV A;  5L3C A;  1Y0U A;  2XAU A;  4NQW B;  3X2Q H;  4JYK A;  1IV8 A;  2ZSI B;  3QPH A;  1FBQ A;  1I50 J;  2MFZ A;  2A61 A;  2E7W A;  4CA0 A;  3D1N I;  3FIW A;  3M7G A;  5BS6 A;  4RB1 A;  3K4C A;  3SEZ A;  1RZ4 A;  3HBL A;  4HLX A;  2HDW A;  3RSN A;  1IXC A;  3LFU A;  5E1W A;  4UUS B;  4AD9 A;  2W25 A;  1BIB A;  5DS9 A;  2O61 A;  1LE8 B;  1BN5 A;  2DDB A;  3E7L A;  3CUQ B;  2CQQ A;  1YHQ I;  2CUE A;  5CJ9 A;  1T2K A;  2Q2E A;  1TWA J;  2HEO A;  1M1E B;  1ZAO A;  4A12 A;  1WJD A;  4UVC A;  1MH4 A;  2RN7 A;  1S7A A;  4DBR A;  3OS1 A;  2ESH A;  3DEW A;  4OIQ F;  2H8W A;  5LGT A;  1UHW A;  1ZGA A;  3M8E A;  2F48 A;  5KAF C;  3I54 A;  5B3S H;  4UUV A;  1FZP B;  4HX7 A;  2M4K A;  3BR3 A;  4D5F A;  2UV1 A;  2IRF G;  2XGX A;  4DZJ A;  4YFX F;  4MO7 A;  1NG6 A;  1T6S A;  2IP2 A;  3W2A A;  3IH3 A;  3N05 A;  4CGZ A;  2ZXJ A;  3I64 A;  2CUZ A;  5E3L A;  5LBQ A;  3NEU A;  2BVL A;  4LGW A;  5FO5 A;  3IWZ A;  1YTY A;  1TL8 A;  1FSH A;  4QPQ A;  3ZQC A;  4WXD A;  2EFP A;  3ZOB A;  4JX6 A;  2LFB A;  2W48 A;  5FKO A;  3I4M J;  3HSR A;  3OL4 A;  4RA2 A;  4R79 A;  5J1R A;  5D5V B;  3OY9 A;  4XR6 A;  5F1J A;  4ZYG A;  1ETY A;  2V7F A;  2NYX A;  2W84 A;  1LDJ A;  1RET A;  1XSV A;  2CJJ A;  1OR7 C;  4XOP A;  4YII A;  1NH3 A;  1KON A;  3OWT A;  3HTU A;  3HIF A;  1QQI A;  2EIK H;  1WJC A;  3BJA A;  4C2T A;  1R49 A;  3WE3 A;  3DU5 A;  3MAJ A;  3GLX A;  4MFD A;  3BR2 A;  3U1K A;  2JA8 J;  3LQR A;  2MAB A;  2EB7 A;  2L7K A;  1OCP A;  5BOX A;  2MD5 A;  1VFC A;  4G6D A;  1IUF A;  5D8L B;  1YI2 I;  4M72 A;  2LRD A;  5DM6 F;  3HOT A;  1DUX C;  2EA2 A;  2UXX A;  5F27 A;  3MWM A;  5FKM A;  3HEF A;  3RPU D;  2MW8 A;  3HOY J;  2HYJ A;  1G3W A;  2MLK A;  3ISP A;  4MNU A;  2L7Z A;  4UHT A;  2QBY A;  2P4W A;  4JK1 X;  2F5F A;  4KNY A;  1R23 A;  2E2J J;  2X85 A;  1H8A C;  3JSP A;  2ME0 A;  1RUO A;  4Y4R A;  4ESB A;  5L3B A;  2GLO A;  1D8J A;  3J81 K;  2ZXW H;  2FML A;  4AIK A;  3TED A;  3S15 J;  3OSF A;  4RM2 A;  5CQE A;  3EQL F;  2OC6 A;  2M0M A;  2DOD A;  3GTO J;  2P7C B;  1DGW Y;  2DN0 A;  3WG7 H;  2ZC2 A;  4YEJ A;  5GPA A;  1S72 I;  2A68 F;  5LEJ A;  3LSG A;  1RUN A;  3TKY A;  5K5R A;  3E6B A;  2E36 A;  3GW2 A;  1BI1 A;  2CQN A;  4MQ9 F;  2BHY A;  1V55 H;  3GO5 A;  3FDY A;  5CKT A;  3IKT A;  3QPL A;  4G6T B;  1MKM A;  2X1C A;  5E1X A;  4EGY A;  2STW A;  2HPM A;  3O8H A;  4PJN A;  4XRS G;  2FX0 A;  2CV1 A;  1A6Q A;  1IC8 A;  2DYS H;  3W6K B;  1J9I A;  2L9S A;  2QEN A;  4CCL A;  5FLX Z;  4RDU A;  1QA6 A;  4O6J A;  3HSE A;  2R7Z J;  3ABK H;  3CJT B;  3V8J A;  2DOA A;  2RAE A;  1ZEL A;  2E5Z A;  1IN5 A;  4PCQ A;  3NWT A;  4YFN F;  1FYK A;  2D5V A;  2K9S A;  2WV0 A;  2CRG A;  2HDD A;  5K5O A;  1P7I A;  4G7Z F;  2AQF A;  2QKM B;  1ITY A;  2K85 A;  4IEJ A;  1IN4 A;  1J7K A;  3LSH A;  1U5T A;  2EFN A;  3ESW B;  4IHS A;  3HZJ A;  3FKJ A;  1WRJ A;  1FOX A;  4XMY A;  1QPM A;  3ZN0 A;  2XRL A;  5LFA A;  1FTT A;  2EH3 A;  4MLO A;  4CYC A;  2CV0 A;  2JPB A;  3FZV A;  4E6K G;  2DTZ A;  4N0B A;  3ZN1 A;  2EWN A;  4MEY F;  5GTI C;  1HA8 A;  4II3 A;  4A3C J;  2H27 A;  4KYW A;  2JN6 A;  2F5C A;  5IYB J;  4ZJZ A;  3S1M J;  4LFU A;  2O5R A;  2QM3 A;  4ZTF A;  2EFW A;  1EF4 A;  3MFK A;  3QPT A;  1Z6R A;  2BXY A;  2DO7 A;  2E60 A;  3SEQ A;  2Y0S N;  2P5K A;  4ANJ A;  4KIS A;  2M7B A;  4U88 A;  2RVC A;  2XB5 A;  2H8R A;  4F91 B;  4LG0 B;  2MA3 A;  3O6B B;  3OSG A;  3OYK A;  5J40 A;  3M3Y J;  2HTJ A;  2VBW A;  3M8J A;  5M5Y J;  3A02 A;  2BXZ A;  1HC8 A;  2G7U A;  4UUT A;  2QQB A;  4ASN A;  4BU2 A;  2BY3 A;  3BG5 A;  5FD6 A;  3CO6 C;  2OCE A;  3HHG A;  3BZ6 A;  3RI4 A;  2HGC A;  2JMW A;  2KP6 A;  2R93 J;  1GUU A;  3I9V 2;  3SDG A;  4RGR A;  2LD5 A;  4A6E A;  3CF2 A;  3LOC A;  2GXB A;  2F4O B;  1QVT A;  4LLG F;  3BJ6 A;  3BG6 A;  2LSO A;  1Z9C A;  1ZYR F;  2PFB A;  2X6Y A;  2RKH A;  3FBI B;  1V5G A;  1FBU A;  2ISY A;  3OIP A;  1D1B A;  1KU9 A;  1U2W A;  3EUA A;  4AVZ A;  2V1X A;  4M73 A;  2IS4 A;  2M87 A;  3RKQ A;  1QVU A;  1Z1D A;  1GV5 A;  1LNW A;  4B3A A;  2A3S A;  2PMZ N;  2YSR A;  2OPT A;  3LQQ A;  5FFX A;  4P9U A;  3DBL B;  3HOU J;  1HF0 A;  1QPI A;  1ZRE A;  2VBX A;  1YS7 A;  3LL7 A;  1DPR A;  4CIC A;  1MBK A;  5D6F A;  2K86 A; 
#chains in the Genus database with same CATH homology
 3AG4 H;  3AG2 H;  3ASO H;  5B1A H;  3AG3 H;  2EIK H;  5B1B H;  2EIL H;  5IY5 H;  2EIM H;  2EIN H;  1OCO H;  2DYR H;  3X2Q H;  1OCC H;  1V55 H;  1OCR H;  2ZXW H;  2Y69 H;  3ABL H;  3ABM H;  2DYS H;  3WG7 H;  2EIJ H;  3AG1 H;  1OCZ H;  3ABK H;  1V54 H;  5B3S H;  3ASN H;  2OCC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...