3ASNH

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
b'KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3asnH00
1V54H 2EIMH 5B1AH 3ASOH 2DYSH 3AG1H 3WG7H 1OCOH 1OCCH 3AG3H 2EILH 2Y69H 2DYRH 2ZXWH 2EINH 3AG4H 5B3SH 3ABMH 3X2QH 5IY5H 1OCRH 1OCZH 5B1BH 3ABKH 2OCCH 3AG2H 2EIJH 3ABLH 3ASNH 1V55H 2EIKH
chains in the Genus database with same CATH superfamily
4F55A 1HW5A 4AC0A 2IPQX 4HNVA 2FU4A 4E7HA 3F8NA 1G4DA 5D4SA 2PEXA 3H9QA 5IT3A 4Y15A 1JGGA 3FXQA 2EZIA 2M7AA 1Z7LA 4M3EA 4QTRA 5HLGA 2MC3A 2MW8A 2QLZA 3CCSI 3S2WA 1EH6A 3MZYA 4ANJA 4WXDA 2NS8A 3L2CA 4FTHA 2LY2A 2XHKA 4EM1A 1R4NB 2Y0SA 2H09A 1QPIA 4L9TA 2Y0SN 2P6SA 3O2PE 5E3OA 2X6OA 2A07F 1JTYA 1MBHA 2ECCA 2GA2A 4MIMA 4D7MA 2HTJA 2VJ4A 4A2UA 3E7LA 4ESFA 2DMPA 2MSYA 3E6DA 2RAEA 5BQTA 2Y69H 3LSIA 1D1CA 5GAGJ 4O3MA 3P5JA 1SMYF 1KU2A 1NG7A 2DQRA 4ENKA 4S04A 2DK8A 4E7LA 3BWGA 2XSDC 2K4JA 1WJAA 3GXOA 3L00A 1BW6A 1YLFA 2ZMEC 2E5ZA 3R6SA 4I7HA 1RESA 3BTCA 3BZKA 3HOYJ 2Y9YA 4PDKA 2MG4A 3D5LA 3UNGC 1B6AA 5FO5A 1R71A 2IA1A 2WAEA 4YG2F 1K78B 2KFDA 2HQNA 2HZDA 2IGNA 2XB0X 3KZZA 1LNWA 4OOIA 3P9CA 2NVYJ 4LLGF 1KGSA 1BI0A 3QYBA 2VI6A 1J7KA 1ZHFA 4HAMA 1BA5A 2L2OA 2VJIA 3GW2A 1J59A 4IX7A 1RC9A 1QZZA 2ME6A 2A69F 3LAJA 2CJJA 2J5PA 1SANA 1YOVB 3K10A 2DTZA 2ZJQF 4HX4A 2DDAA 3WGIA 1HA8A 2V7FA 2WAQA 1AA7A 4M3BA 2FMYA 2WAQN 5C3EJ 4L9NA 2FUG2 2Z5UA 1JUMA 1SEUA 1W0UA 1D5YA 1KYWA 4IHVA 3CMYA 4EMSA 1UHSA 2X1CA 4CCKA 3E5QA 3G71I 2CFXA 1NG6A 1W0TA 4BGDA 1HBXG 4KYWA 4C3JJ 4XOPA 1QVUA 3GTJJ 4GXOA 2X1DA 2KDZA 3TOAA 1OR7A 2XF7A 4RLQA 3HOXJ 1A31A 3Q9SA 5C44J 2YUSA 2LSOA 1A04A 4ZC3A 4PGHA 1WJCA 1W7PD 1Y1WJ 5JHFA 2LDUA 5CYVA 3ZPLA 3C7JA 3CMMA 2XRNA 5LEKA 3FMSA 3OYMA 3BR1A 3S16J 5KAFC 1FJLA 2P0WA 3FBNB 1SFEA 2P7VB 3DQVC 3FXKA 3RYPA 2VBYA 1BR1A 3T8RA 1XN7A 2O8KA 1R6RA 1JKPC 3K6GA 1LDDA 1KU9A 2E60A 1KONA 1LVAA 1XD7A 2Y48A 2VBXA 2CQ7A 4CH7A 3G1OA 3I4NJ 5IOZA 1FOYA 2OV7A 2NS0A 3ABTA 3ZGKA 1SFXA 5L3BA 4HW0A 3WTZA 1BBYA 2LG4A 2XSJC 2DODA 3K4BA 4C9YA 1LJ9A 3WE3A 2PJRB 4HZFA 4ESBA 4Q5SF 2W7NA 3H35A 4I2OA 1HKTA 4BJTA 1OYWA 2ZJPF 4FX0A 3RIRA 1ULYA 1K6YA 2WY8Q 4M6XA 3VFZA 3W6VA 1XS9A 3QPHA 2Z1DA 2FBHA 3OSFA 3K4CA 2EIKH 4IOCF 3J7ZI 3G4SI 2O0YA 4FE4A 3DBRB 3O6BB 4CCMA 2K3FA 4E7SA 3K2AA 5TGTA 4NBQA 1W36D 2FRHA 4ZYHA 2KDOA 1OLTA 4MHGA 2CW7A 3J80Z 1LEBA 1O57A 3V8LA 4X0GA 2H6CA 2MABA 1Z9CA 2B9SA 3MQ0A 1B8IA 1BOAA 3KLOA 5EZGA 3K69A 3MD2A 5B1BH 1QU3A 2XGEA 5LRRA 1OQYA 4Y13A 3JCUC 3F23A 3K4LA 4IHYA 1ODDA 2W00A 3VSKA 3BR5A 4P9UA 2KRHA 2Z3YA 3KYLA 4N4NB 4B4CA 5FKMA 3S3OA 3WTVC 2WTEA 2VJ5A 1MGTA 4PJNA 1R5HA 3E0JB 3WU2C 1YJWI 5J6XA 3K1MA 5ILUA 2OU2A 3BTJA 3PNTA 5HNFA 3FF5A 3NWSA 5FKLA 5L3GA 1T6SA 3CTAA 4BXFA 1X4OA 5ICFA 5M5WJ 2M2EA 4U0YA 4HA8A 1J2XA 1X1AA 1IUYA 1QHHD 1E3OC 5EDNA 1HCRA 1ZK8A 2Y30A 1BC7C 2ETHA 2JSCA 3OOPA 4HF2A 3GTPJ 1Y0NA 1FX7A 3OIQA 5E1XA 3OL4A 2KPMA 2VL8A 2IRFG 3V7CA 3VODA 5ERIA 2ADUA 2EINH 3DKYA 1K7AA 1DGWY 1XSVA 3L2QA 2P5VA 4A3FJ 1IV8A 4BNCA 5EEHA 2OTJI 4LMYA 5EEGA 4O6JA 4IJAA 1J5YA 5BMZA 4DZPA 3MFKA 4JX4A 3VOEA 1T8IA 2ZMEB 3I5UA 3PFIA 4I0BA 1MNMC 3J7AO 3HOUJ 1VQOI 1YJNI 1T08B 2IT0A 3F8BA 2NS7A 3GTOJ 5CVJA 3GZNB 3CCLI 1P4AA 3GTMJ 2VKEA 2W48A 2R7UA 4EGZA 1XCBA 2QM3A 1MJ9A 1HXDA 2JVHA 2MD0A 4RMNA 4AVZA 5IYDJ 3DU6A 5FJ8J 4CHUA 2D1HA 1YW7A 2CUZA 3LSMA 5ICCA 2IS1A 4IHWA 2DU9A 1U9OA 1G59A 2E2IJ 2GOXB 3KP5A 5LBQA 1WH7A 3I64A 1WH5A 4XQFA 3PO3J 4B48A 2QCOA 1ZTRA 2DCEA 1ZELA 5E1WA 4KT5C 1RR7A 2JA2A 3L7WA 5LHIA 3CCEI 3CO6C 1AOYA 3ABUA 3LSGA 1RUOA 1WHUA 4Q48A 4JQFA 3WTSC 2IP2A 3WE2A 1ZRCA 3CP8A 2PI0A 2BOLA 5FRNA 3B6CA 1XMXA 4II3A 1W5CC 5L3DA 2GXBA 3DFGA 3Q5FA 1H9GA 1BOBA 1Y8QB 2NAZA 3BROA 1W7PA 4E70A 2PJPA 1BIBA 3L2RA 5IPAA 1MBEA 1IDZA 3O3KA 3PNVA 2BXZA 3OMYA 1WCMJ 4KMFA 2DA7A 1T56A 2M0MA 5E79C 3FXJA 1YS6A 1IN7A 2QBYA 2KKOA 5BNGA 2KLOA 3CC7I 3TO6A 4I0AA 1RZ4A 1ONVA 5L3FA 3GO5A 3CC4I 3DEUA 1TQIA 1UHWA 3FXUA 4RGSA 3TO9A 3WGHA 3JREA 1UFMA 2BHZA 2XGDA 1GLNA 4KJZA 4XR6A 5J8CA 3WTYC 2CMPA 4UVAA 1YIJI 3H92A 2XPVA 2LTPA 3L9FA 4JYKA 3OYGA 5F64A 3REOA 1P92A 1EKEA 3I59B 2XAJA 4BHPA 2JUCA 2LC2A 1JTXA 5GPCA 2E19A 3AFHA 1F4KA 2IS6A 2DK5A 5ICEA 1MBGA 3S15J 3CLOA 4UHTA 1AU7A 3OR2C 4XLFA 3LAPA 3BG9A 5TJJA 1UMQA 2HVQA 3MZ8A 3OYDA 4NDLA 5HDNA 2HGCA 2HKXA 4WXHA 4ZDPA 2Y2ZA 4BU2A 5FROA 5KNLA 3QYEA 3G6EI 2HOAA 2ZXJA 2LR8A 1GXPA 5EJCA 1R9TJ 2XKPA 4IL6C 5FLXK 2X6WA 2CRGA 3ESWB 5GP9A 2K9NA 2YU9J 3Q0WA 2QQBA 2L4AA 1E3PA 5EF6A 3ONQA 3C3WA 1MBFA 3GBGA 2WV0A 5K7HA 4A69C 2DMTA 3WU0A 4DZJA 3RKQA 4JX6A 4ENMA 1ZLKA 2KL4A 2E1OA 5LLQA 1YFHA 1WI9A 2ZBKA 3BCBA 3K1PA 4JBAA 1ZR4A 4PZJA 1IXCA 2BZTA 2K9MA 4UVCA 2FNAA 2DT5A 5K5QA 1JE8A 2CUFA 3VYTB 3BCAA 3L2UA 3LOCA 4UUVA 2K40A 4M3FA 4CDGA 2A6TA 2X48A 4MTDA 3GFJA 1VQNI 1FOKA 3AG1H 3CUQC 4FISA 4XRSG 3EPZA 3SXYA 3NRVA 4A5MA 3LFUA 4DYRA 3HOWJ 4BXXJ 1HOMA 1IN8A 4CYCB 4J01A 2OBPA 5DYMA 3ZMZA 2X6XA 1R7JA 1SD4A 2ELJA 3CJNA 4XIDA 1D0YA 5J47A 2HOEA 4FETA 4BHCA 3X2QH 3HSEA 3A2KA 4J19A 2EZHA 1U5TC 3QPTA 2HYGD 4ZZLA 1YJ9I 4GO1A 2OZUA 4KITB 3H3UA 2IW5A 2FE3A 2CO5A 2FJ1A 4DGWB 5M5XJ 2IXSA 4AU7A 1OCCH 2K7LA 1FWZA 4DNCA 5H6RA 5DS9A 4HDVA 4TV7A 2M1BA 1G3YA 3RYRA 6PAXA 2JK3A 3D5RC 1LFBA 1O3RA 3W6KB 3JSOA 3BY6A 4P1WA 2WWYA 2CGPA 1JKOC 1S7EA 1QA6A 2DOEA 1VI0A 1T0FC 2RC4A 2F5DA 4IKFA 2VKHA 2O61A 2EWNA 2H1LA 1YS7A 4LLLA 1RUNA 3S14J 1ON2A 3ZN0A 3QQAA 2CW0F 3F6VA 4ENJA 3G1MA 1K61A 5LGNA 1VQ7I 4HSTA 2CFOA 2AQEA 4QIWN 4YFKF 1NK3P 4F93B 2VOOA 2M45A 4A3IJ 4A6EA 5E8GA 3I56I 2DLLA 3HPGA 1FYLA 4NB5A 2CUEA 3V7SA 4XNFA 3WTTC 4RAZA 2L7ZA 2H8WA 4BDZA 2V1UA 1BJAA 1MSEC 4UB8C 1RRJA 2HPMA 3M3YJ 1G8XA 1YX3A 2CH0A 3DP7A 4YIFA 3MZHA 4C30A 3K0LA 3TDZC 5CLSA 4RDUA 2RQQA 1B1BA 3M8EA 2BVMA 3F72A 5FFXA 4G7HF 2F48A 1DUXC 3S3NA 4N9IA 4IQ4A 2YX7A 3Q0UA 3GLXA 5IP9J 3E6CC 1TQMA 3E5XA 3EETA 4HRIA 2IS4A 3AG4H 4V2GA 2RQPA 1FNNA 1FY7A 3H3VK 1T95A 3PNYA 2R7FA 4A3CJ 1T33A 1S7OA 3EQLF 2DI3A 2LKSA 1GV5A 4RAFA 3SJMA 1CGPA 3T5XA 2HOTA 4HDUA 1IC8A 1VQ9I 1XG1A 2L0KA 3RQIA 4N0BA 3RTRA 1QVTA 2RNGA 3QODA 2FQ4A 2ZNYA 5HDGA 2Y75A 1R5ID 4CCJA 2RV8A 1WJ5A 2ZJRF 2R5ZA 4IRGA 4KIGA 4G6DA 4ETSA 5DCMB 2KJCA 3DEWA 1U0JA 3AAFA 4M9ZA 3JRDA 1LKXA 1IN6A 4BE0A 1YQAA 2NRAC 2IAIA 2AXTC 3WODF 1RKTA 3CZ6A 4V19K 4P9FA 4U0WA 1A6QA 3I71A 3R61A 5FLXZ 2PBIA 1JHHA 3PJRA 3EYYA 3HRMA 1IAWA 4UNOA 1KA8A 2HZTA 3CJTB 4FASD 2N8GA 4X6AJ 1USTA 3WG7H 3KP2A 1MMSA 3I9V2 4HV5A 1EH7A 4E7KA 5DV5A 5DUKA 1XX5A 2FBKA 1XSXA 2HKOA 3M9AA 4U87A 2R7VA 2ISZA 4AVPA 5F0HA 3TEDA 3C1DA 4Y4RA 4D5CA 5B1AH 4XONA 4A3EJ 3KCCA 2GAUA 2CYYA 2EQRA 3JRBA 2IEKA 2DQLA 1AHDP 2HYFA 4U7BA 3IKTA 2VBWA 1Z77A 1ZARA 2KZGA 2ID3A 4B3AA 2L02A 3ZQQA 4IF4A 4CA0A 3HOTA 2XAQA 4BUPA 3HOVJ 2LOOA 4HSRA 2V79A 5KAIC 4RB3C 1N75A 2XAFA 2D5VA 3GTLJ 1ZG5A 2DFIA 1R1UA 4GDFA 2ZXHA 4E4HA 3PL8A 2IGMA 2O3FA 3ZQCA 5HS8A 1ZR2A 2VE9A 1VQPI 1YRNB 3OYHA 2Z16A 3FKJA 3CCVI 3DBLB 4C2UA 3H36A 1BI1A 2E7WA 3CUQB 3FM3A 3K4NA 2EFOA 3EDPA 2XGCA 4UUSB 5GAEJ 2DW4A 3GFMA 3J80K 2LREA 2DXIA 2HI3A 2QENA 3BR0A 3JRCA 1DU6A 3TQNA 3OS2A 5CPRB 3WTXC 4GYGA 3BR3A 1P9QC 4MGRA 2KZVA 4LK1F 1LEAA 4L5JA 2EFNA 5CQGA 1U5TB 5F0FA 3KP6A 5GTIC 4Z6YA 2IA0A 2DTRA 3EUAA 4EJVA 1ZLJA 5D4RA 3WHBA 5LGTA 1Y56A 1N77A 1IW7F 2V6CA 4DW6A 1YG2A 3BPXA 2F4MB 4LIVA 3MKLA 2L9VA 2AO9A 5DD4A 3K7AJ 1Y1VJ 2P8TA 4DIQA 2DA3A 3CC2I 2OQGA 2JWTA 1JI8A 1OISA 4HLYA 3CESA 3WTUC 2JMWA 3D1NI 1HLVA 1IRGA 2XKOA 2X6YA 3GFIA 2M5WA 3BG5A 3V42A 4XK4A 1V54H 3CQZJ 2OAZA 5D5UB 2JSPA 3PQKA 3CP2A 2JRMA 3NEUA 1D1AA 1N25A 2QYOA 1RR8C 4A5NA 1GUUA 3MAJA 2H1KA 2VODA 3FM5A 1KYZA 2M3AA 1X3ZB 1BJZA 1O3TA 1GXQA 1QNTA 3HRSA 2E5NA 3HPHA 4MFEA 4R1HA 5DD8A 2XROA 1M1EB 4IHTA 4M9SA 2FQ3A 1IGNA 3U1KA 4F7ZA 1T39A 3MWMA 2H6BA 2PMHA 4M71A 1FT9A 3IAM2 3V4GA 1WWXA 3RQ4A 2CS3A 3HZJA 1UCRA 2R7RA 4RB0A 3K70C 2QQAA 2FXAA 1AWCA 4MEXF 4IEJA 1I39A 3SFIA 3OSGA 2JZYA 1X1DA 2A61A 3FK7A 4HF0A 1KZHA 4MNUA 1RIOH 2M7BA 2QGUA 2AHQA 2WV1A 1F9NA 1LPQA 1BI2A 1S3JA 2OCCH 2VKDA 2CQQA 3HEFA 1ZAOA 2PX9A 3HIFA 3DTIA 1X1BA 4RLFA 2R5YB 4R8HA 3SEZA 3KYCB 1YO5C 4I09A 4RB1A 4XSZF 1XGOA 3M07A 1ORKA 1EA3A 1RNLA 2BV6A 3ZCOA 4HBLA 1Z05A 2K9LA 3A01B 3F21A 1R58A 4KNYA 2EA2A 5M3MJ 4CZZA 4YFXF 3GCMA 3A4CA 4KICA 2NYXA 1FC3A 4LB5A 1K78A 3SZGA 2OD5A 2QQ9A 4W1UA 3L1PA 2OF7A 3L2VA 3BQYA 3BJOA 3W2VA 1JT6A 5HS9A 1XGSA 1WKMA 2NVUB 5E3LA 2MH2A 3S1MJ 4PSXA 1PVEA 1G3SA 1ZQ3P 2ECBA 4BL0B 3IH3A 1J0RA 5IYCJ 1GV2A 3ZP5A 2YSRA 3P7NA 4D9JA 4L0YB 3ELKA 4I6ZA 3MKZA 3HUGB 3M8JA 4BQAA 4U0VA 4FE7A 4G6QA 3S1QJ 1R1TA 3RKWA 4GCVA 2M30A 1FOWA 3PSIA 1LFUP 4KMUX 1S72I 5HLIA 2ELHA 4OU0A 3K70D 1MBJA 1G6NA 1BL0A 3ZQLA 1WRJA 2DA2A 4QWQA 3F3XA 3BT9A 3EUKL 1P6RA 2QZ8A 2H27A 4CGZA 4BE1A 1X3UA 3F22A 4EM2A 2AXLA 2O8XA 2P81A 2WC2A 3B02A 1H88C 3V8JA 2VT3A 2F5FA 4CICA 3EUHA 4AYBN 3VPRA 4AIDA 2ZCWA 4KT6A 1L3LA 1TNTA 3H1CA 3KP4A 3HM5A 2BHYA 3OY9A 4HQMA 4XSXF 1TNSA 2WBMA 4XKWA 4F91B 4E7IA 4A3KJ 2ZB9A 4I98B 2Q2EB 2NVXJ 3SYTA 3ROUA 3S1RJ 4CCLA 4EM0B 2HPIA 1V5EA 1F1ZA 4DBQA 5IY5H 1I5ZA 1HSTA 3BG3A 2VE8A 4OINF 1O3QA 3TBIA 5HDKA 3IWZA 1I1GA 1MMAA 4LG3A 4F3QA 2EIJH 3DPLC 1B9NA 4IHSA 3ZQHA 3RKYA 2RVCA 2E36A 5EG0B 3H0GJ 3HHHA 1W5SA 2JT1A 2PJRA 4XN3A 4XMYA 4HG2A 1P2FA 3BR6A 2W85A 1H9TA 4RS8A 3IL2A 3AG3H 3M1EA 1VQLI 1VQ4I 3E5UA 2BW3B 2XAHA 1QPMA 2LRDA 4U88A 1I50J 4KUMA 5F04A 2ESNA 3HOSA 5FGMA 1MIJA 3CCYA 1W1WE 2L01A 2LVSA 1ZGJA 2VT2A 3IC7A 4I99C 3FWEA 4A12A 3CCRI 3UKGA 4EJUA 2MLKA 3LSJA 1LDJA 4XKBA 1X58A 3BTLA 5B66C 3GTKJ 1VF9A 3I4MJ 3QYFA 4FQGA 3G73A 4NQWB 4A3MJ 1S5LC 4OIOF 1PP7U 2KQRA 1WQ2A 4CYDA 1U3EM 3NARA 1IO2A 1MZBA 4RGXA 4XLCA 1DGRM 3Q3SA 3RZDJ 3ERED 3SZTA 3BDDA 3EYIA 3K4JA 5ILVA 3FX3A 2LFBA 2EV5A 1BC8C 2E1NA 1CF7B 2K5CA 1R4MB 4ZH4F 2HQAA 4LG0B 3FISA 1XMKA 2KIMA 5K5RA 1TW2A 3S3MA 3QP5A 3RCOA 3KZYA 3HGYA 4EGYA 2RN7A 1FTZA 4ABZA 1TC3C 3ULQB 5LRSA 1B59A 1S29A 2KRCA 3RI4A 5KK1A 1IRXA 1BR4A 1SVMA 2VQHA 1XGNA 3PUFA 1DP7P 3A0HC 2QSGX 1U8BA 3SHFA 3TGNA 2WB1A 1TWCJ 5H2FC 2LKXA 4CZCA 3OYEA 2WB1N 2W57A 2CWEA 2L9SA 1VQ8I 3I54A 3GX4X 3QRFF 4B43A 4Y7NJ 2X51A 2PG4A 3R4KA 5F1JA 1K6OA 4ZYGA 1JKRC 1CQTA 1GVDA 4E6KG 1SAXA 4NC6A 2OQRA 1VQ5I 4EATA 5EZHA 3CCUI 3DKXA 4BKXA 1Q1VA 1DP3A 1J75A 3C18A 2W24A 4WF2A 2A3SA 1IDYA 4FX4A 4E7ZA 1XMAA 1FIAA 2ZMEA 4OMZA 1IJWC 2XV4S 3JR9A 3DEEA 5L3EA 1MKMA 1XB4A 3DV8A 4HX8A 5HVQC 4OMYA 5F6FA 2XDVA 4HNTA 1HW2A 1RETA 4M73A 1TZLA 1UHMA 1QO0D 4B1RA 1VZ0A 2NNYA 3BP8A 1IV6A 2LK2A 4AIKA 2YX4A 2ME0A 3H5RA 4G7OF 2STWA 9ANTA 1GT0C 3RZOJ 3CJQB 4EJTA 3ZMSA 1SD7A 1FLIA 1BM9A 2GIVA 2LY9A 2MBFA 2L3DA 4BS9A 2XUBA 1O7FA 3ECHA 3QPLA 5EYRA 2DA1A 3E3VA 3PSFA 3B6AA 3HXLA 4P96A 3TOBA 1QHGA 1AKHB 3FMQA 2J5OA 2DMNA 2KMUA 2P5KA 1DPRA 1PUFA 3KE2A 1D1BA 3M8FA 1DDNA 1KQ0A 2DA5A 4YFNF 3QPSA 2ESHA 3V8KA 3GTGJ 1APLC 4QPQA 3QP6A 5KCMA 5DM6F 2XIGA 3FK6A 3GF2A 1FSHA 5FKKA 1HKQA 4AIJA 3GMEA 2RNJA 1NK2P 1S8NA 1OCTC 2JRTA 3FXRA 5C4JJ 3VYUB 2IVMA 3CCQI 3LNQA 4F52A 4XRMA 3KP7A 2R3SA 1K4TA 2XAUA 2HQRA 3LSKA 2DA6A 2K9QA 1LDKB 2R0QC 4Z2YA 1IF1A 1ETYA 1Z21A 2L7FP 5TISC 3RPUD 4W97A 1MJAA 2OC6A 2NOGA 5D8LB 2CQNA 2ID6A 5DEQA 1SFUA 2BEOA 3CMAI 4B8XA 1LE8B 4XICA 4PGGA 2DFFA 2V1NA 4YIRX 2HEOA 1IXSB 2ZNZA 4XLHA 2G7UA 2MH9A 2V9PA 3BPVA 3BQZA 5J4YA 5K7FA 3S2HJ 3I59A 1UZCA 2O9LA 4C2MJ 4OAZA 4LB6B 1R36A 3KIOA 3JRIA 3NAUA 3HDDA 3TW7A 3I53A 1V5GA 2ZJ2A 5FKOA 3S93A 1XSDA 5HNHA 1P7JA 1X1PA 1MDMB 2HXOA 1MNEA 2K9SA 2MLGA 4Y17A 3TL4X 2X0LA 2BY0A 4L5EA 4DJAA 2Y9ZA 3IHUA 2L5QA 4XOTA 5GADJ 4AM3A 5E18F 3S1NJ 3M1CA 3H3ZA 3DF8A 2KRFA 1B9MA 1X3WB 2L4MA 5EGOB 3GYHX 5K1YA 1F5TA 1OCPA 4M3GA 2XC7A 1JKQC 2BBYA 2VQCA 1Z6RA 2CUJA 3AG2H 3I58A 3HSRA 2G9WA 3FHZA 1JUPA 3HSFA 1OR7C 1OMIA 1I27A 1WZ2A 2EZLA 3OV8A 1LFPA 1Y39A 4YELA 4BJ6C 1MNDA 2CW8A 4ZYEA 3OOUA 3F9KA 2ZC2A 4DOZA 1JXSA 3HC7A 2LF7A 2M87A 1ZRDA 1V5FA 5ICGA 3DPTA 3PUBA 1ZG3A 1ZGWA 4N4OB 1B72B 1IG7A 3CLQA 1WJEA 2W25A 3JRFA 2LBFB 4RA2A 2KT0A 1ZKGA 2KP6A 1O3SA 3HBLA 2GIZA 4E7JA 2LYCA 4CSWA 2LP0A 3I4PA 1Z3YA 5HODA 4CYCA 2DN0A 4NC7A 1Z0XA 4IXAA 2F5CA 5LHHA 1A36A 1K79A 3L2WA 3LSRA 5H20A 2HS5A 1X2MA 4EQQA 5FLMJ 2G0EA 2XVCA 3E6BA 4HNUA 3OYKA 4IHXA 3QOPA 2LKPA 3LA3A 2P5LC 5F08A 3ZQGA 1ZGAA 4BEHB 5IT9Z 3DWLE 1OCZH 1MH4A 1UG0A 4A93J 3OYBA 4PFOA 3B73A 2FOWA 3Q9VA 2A6HF 1O7LA 3KX2A 4XLPF 3N97A 5E3MA 4PJJA 1JHFA 1W5TA 1OYYA 1FSEA 3K9TA 2VONA 5J8FA 1HC8A 3KEQA 5M3FJ 3G1LA 3LL7A 4G8XA 1D8KA 2EILH 2A6EF 2E2HJ 2OA4A 1TWFJ 1U2WA 3KLNA 4A3GJ 5BS6A 3BZ6A 4RB2C 4J00A 4IZZA 3LWFA 3HGGA 2FBIA 3M7GA 1JGSA 4DBRA 1OCRH 1MJBA 4RM2A 4BBRJ 4D7NA 3AL0C 2LY1A 2QF7A 5CKTA 2E71A 1VTNC 2W1OA 3ASNH 4EEFG 1IUFA 5IP6A 4ZTJA 5DM7F 4DQ2A 1I6XA 2F2EA 4HLXA 4KA4A 3P9IA 2KISA 4XL9A 4OIRF 5GAHJ 5L3CA 3BJ6A 3ZR8X 4PFPA 2W82A 2QVOA 2MGQA 3LSHA 3ZMDA 2QEXI 3C2BA 1BIAA 5ED4A 2QSFX 3LQQA 3F6OA 1FMVA 3CJRB 4ZTFA 3F8MA 2FMLA 5B3SH 2LD5A 1BW5A 3Q0VA 3M4OJ 3QWLA 2V1DA 2K85A 2AS5F 2PQ8A 3VYSB 4C3IJ 4BQOA 1A35A 4G12A 1YW9A 4B3XA 2DYSH 3J81K 1T98A 1XCVA 1OCOH 2M9HA 4ZDLA 2DOFA 4RM3A 5F0CA 1UG2A 4CCOA 2COMA 2OCEA 2TDXA 2CSOA 2FD5A 1TP4A 1HQCA 3WTWC 2A68F 1C0WA 3GTQJ 1MH3A 1FBQA 2ZFUA 3VDXA 2XPWA 2G7HA 3O8HA 4B09A 3RPUA 2MA3A 2GOMA 2JVGA 2E2JJ 4XRFA 1IXRC 2Q1ZB 3IH4A 5CQEA 2HDCA 1LUJB 2JPCA 3OL3A 5DCMA 1DQUA 3C2HA 5CVIA 4UB6C 4ENNA 3KP3A 1IZ1A 2M34A 2M8GX 2GA1A 4ZZDA 1I3AA 3CUOA 2V1XA 4UY8I 3H0DA 1RPWA 4FT8A 2I8DA 3VYRB 2UZKA 4Y33A 1UAAA 2X85A 3H9JA 1GHCA 3JAMZ 3HOZJ 3FDYA 2WADA 2HOSA 4C2TA 3MVPA 2B0LA 1ETQA 2X4HA 1TLHB 3DPUA 5IYBJ 3CCMI 2K86A 3I55I 1U8RA 2JN6A 3OYNA 3OIOA 3JRGA 3K4KA 1D3YA 5JFRA 2E1CA 2FX0A 2JUGA 2F5EA 2YPRA 3I3LA 4JP0A 4PCQA 1YX5A 2EV0A 2VPLA 4M6VA 1FZPB 3ZMTA 1LB2A 2E1MC 5D5WB 3DBHB 1PJRA 1P4WA 4P55A 4M72A 2F4IA 3JTHA 2DJNA 2EIMH 1L0OC 2NXNB 5D5XB 3H5NA 5E20A 1Y8RB 3SDBA 2L9RA 2A05A 4KIFA 2NOJB 5JVGF 5HS7A 3IV5A 5DCFA 2L7KA 2QQ8A 3FXMA 1IRFA 3FBIB 3SFZA 4RBOA 3CCJI 1YRNA 2BY2A 2K27A 3FXOA 2DFHA 3OYCA 4NC8A 3HYIA 3HRUA 4F92B 1PYVA 3CUQA 4PJLA 2PMUA 4R79A 1S6LA 1DPUA 2R7OA 4UUSA 4II2A 2W84A 2VLAA 1WJDA 2CQXA 1XPXA 4H4KC 2C6YA 1VNDA 3S8PA 1KQ8A 3LA2A 2O6GE 3ERMA 3OYJA 3A02A 4JK1X 2EFPA 1U5TA 1Z6TA 1U9NA 1NHAA 4BY7J 4ZDOA 1R1VA 5D6FA 4L9VA 2FA5A 3ZOBA 2CV1A 2XF6A 3WG9A 4OWRB 2YU3A 1K4SA 4CCNA 1W36C 3G3ZA 3BTIA 2CV0A 5HLHA 3BJAA 4L5IA 2KIQA 4QPOA 3PQJA 4HOBA 5J1YA 4A3BJ 2COBA 2JJ7A 2VOPA 5FD5A 4GRIA 3BG7A 2R7QA 4YRVA 4FHTA 1YIOA 1T0FA 2WAFA 2JA7J 4Q47A 1OFCX 1NH3A 5DTDA 1JUSA 5D8KB 2H94A 3CO7C 1JJ8C 4ZYDA 4Y52J 3AL0B 1B8IB 1BR2A 2DT6A 1YHQI 3TW6A 2ZFWA 1PUEE 1V4RA 3KPHA 2HR3A 2KIFA 3H9GA 1ENHA 3PIOF 4RGUA 3ASOH 1D8JA 3A0BC 3J81Z 3HTUA 4BHBA 2EH3A 4IVNA 1QBJA 4EV0A 1X19A 3HTSB 4CXFA 1T38A 1D0XA 3KETA 4L18B 3K4MA 3K2ZA 2VC1A 3ZMUA 1PP8F 2Z9OA 4O5VA 1EF4A 3HJEA 2QA4I 2R4GA 1H0MA 2UXXA 2EV6A 2XF5A 3IWFA 1B4AA 3TMOA 2GXAA 2LLKA 1N78A 3LA7A 3CF2A 2VXZA 1HF0A 2PN6A 2M4KA 1MBKA 4LOCA 2KHMA 5JLWA 3S32A 2OUMA 1USSA 4UV8A 2WA0A 1ACIA 4CUGA 2GQQA 1MMGA 2R7ZJ 1OJLA 2Z2SB 1UJ8A 3E6MA 1REPC 2STTA 1VQ6I 1NTCA 5CVRA 4LK0F 2YR2A 2A5WA 2DMUA 4LIUA 3MEXA 2CV2A 2BGCA 2HWVA 2EFQA 2XB5A 4XLEA 5LGUA 1F36A 4LLNA 1FTTA 3CD6I 2FSWA 2RDPA 2UXNA 2V9KA 3HKZA 1ZN2A 2I5UA 4AYBA 3OYIA 2EK5A 2R5YA 3HKZN 2ZKZA 3OS1A 4HEA2 1TT5B 2L7MP 1TWHJ 3PO2J 2RKHA 4ITVA 4M74A 4D0PA 2A5YB 1E2XA 1KU7A 3DTKA 3HRTA 3TP3A 4A0XA 3A01A 5LHGA 2I10A 4IO9F 5DUIA 2XGXA 1QZYA 4K2EA 5TRDA 4A0ZA 1F43A 3UR3C 3KZIC 1VQMI 2XRLA 2R7XA 4ZYAA 3ZQIA 5FKNA 3I0TA 2CG4A 2IGKA 3BG6A 5CJ9A 4MQVA 4PJ0C 3RSNA 3FIWA 3MN2A 4YEJA 5J1RA 2D1VA 1H89C 1OPCA 3WHCA 2DOAA 1D0ZA 4NUBA 4M9XA 2DPUA 5FB2A 2KJBA 4A3DJ 4LFUA 4MQ9F 3VSLA 3CF5F 3RDIA 4OAYA 2WY7Q 3L09A 3PIPF 1K83J 3TO7A 1MMNA 2PLYA 1OKRA 2L9NA 3IRRA 2GWRA 4HV6A 3HUGA 1FP2A 1ZREA 2V9VA 4DYQA 2D45A 2QSHX 3LMMA 5A2QK 2EJRA 1FYKA 2DA4A 1S7AA 4WWCA 2YS9A 3VWBA 1WPKA 2F4OB 2M8EA 4PK4A 4B44A 4MEYF 2P4WA 2E1MB 1XTAA 1R23A 1W7PB 2V6EA 1TWAJ 4BH9A 1FBSA 3QOEA 3WU1B 1HDPA 3JTGA 5AONA 4Y3OA 1G2HA 5GTHC 2QBYB 2H8RA 1FBUA 3GZ5A 1TQPA 2DBBA 3DKWA 2MYSA 4MFDA 1I6HJ 4D1QA 4XLAA 4BBSJ 1V3FA 1YI2I 1SFOJ 2GLOA 1Z91A 2E35A 4DYCA 4IOAF 3FKIJ 2RGVA 2HDDA 1IN5A 1ZRFA 1HW1A 5K7ZA 2JPBA 3ZRGA 3DXJF 1E3HA 4D5FA 2NNNA 1QQIA 2E34A 2Q2EA 5LEJA 3WGGA 4IRIA 1P7IA 2JA6J 2BYVE 2HFHA 1WI3A 1XDUA 2VB6A 4HYEA 5C4XJ 4XRSA 3DU5A 3QAHA 1X4PA 5J4VA 5HOOA 1XDSA 2HYJA 3OIPA 1JT0A 5JR3A 5GPAA 4ESJA 1U78A 2ELKA 1FYMA 5EG0A 5ILSA 1P4XA 1WJBA 5J3LA 3BC8A 1G3WA 3MMYB 3KEOA 3ABLH 4A0YA 2QUFA 2QWWA 2VQGA 1TW3A 2K4BA 5CVUA 1PDNC 1SVLA 2BW3A 2UV1A 4V2FA 5IOYA 4WCGA 2EPFA 1FPQA 1DU0A 3ZN1A 2JA5J 1WFXA 1PUFB 2MD5A 2V26A 1A6IA 4PSWA 3KEYA 3OWTA 1SD5A 1KQ9A 3QU6A 2K3PA 1GVJA 2OTLI 4OIQF 2IGOA 4NNJA 5LD2C 5IT9K 4I76A 4NQWA 4CO8A 3JSPA 4LITA 3OYLA 2R7WA 1WVRA 4MLOA 3F0CA 3ZQ7A 2GXGA 4IPAA 4M3DA 4MO7A 1X1CA 2EZKA 2DDBA 1G3TA 4UXNA 4BE2A 4FCYA 4XBFA 5FRMA 1FMWA 4QLCU 4WX9A 1LVKA 1MMDA 3KFWX 1R5GA 5K5OA 3ZXSA 1CF7A 4G6TB 2ICWG 2E7XA 2P6TA 3GEZA 3TDUC 4LG0A 2LF8A 4UUTA 4BYYA 1XC5A 3OS0A 4EJOA 3MKWB 3LQRA 2RREA 2XASA 5BOXA 4I01A 1YW8A 4HF1A 5HLTA 2ISYA 1FP1D 2M0CA 1WGXA 3CDHA 1Y6IA 2CQKA 1FIPA 1ZH5A 5JLXA 2VN2A 1RI7A 2NVQJ 3W2AA 3E97A 3T0YA 3W6JB 2DMQA 3H5AA 1SVOA 2VQLA 5E1ZB 2XAGA 3DCFA 4OIPF 4M6YA 4EJWA 3GUDA 3ML6A 2L54A 2R92J 4AD9A 4BY1J 4AIHA 4LGWA 3SDGA 1Z3XA 1Z7UA 1TBXA 3ABKH 2IA2A 2ZSIB 5M5YJ 4JOMA 4ZJZA 1V55H 4KN4X 3RKXA 1H8AC 1TTYA 4G94A 3O8GA 4BQNA 3A1YA 1ON1A 5J1UA 2CU7A 3ISPA 4S0HB 2IBDA 4GYIA 2R7TA 2HDWA 1J9IA 2M4GA 2TCTA 2EB7A 2HTSA 2OPTA 5D5VB 5LFAA 2JA8J 5KVRA 3COAC 5DDGA 2TRTA 5A2QZ 1UB9A 2QKMB 4G7ZF 2ACJA 1XGMA 1UELB 1R49A 4L0ZB 3ZQFA 1POGA 4JX5A 5F27A 4GGGA 3KYDB 3FXLA 1VQKI 3U2RA 1D5VA 2GBYA 1SFKA 3NWTA 1JJ6C 1BI3A 1WSUA 1SAUA 1T2KA 1O4XA 4WXCA 1LQ1A 1E0EA 4KIBA 2DYRH 3GFLA 4BJ5C 3S17J 4RAGA 4B47A 2LH9A 3HB9A 4XKVA 5JVTA 3SQNA 4BQQA 3J7YJ 3S2DJ 2EA4A 2JQ7A 1QZEA 1AKHA 2ZXIA 3N4MA 1J09A 3IP4B 3JAMK 2FOKA 3DLLF 3OYFA 3OR1C 1HDDC 5E17F 3IH2A 3JW4A 1A5JA 1QGPA 4KFCA 2VASA 2BY3A 2VXDA 1RKWA 3JRAA 3DTEA 3QU3A 4LD5A 3PM1A 4KN7X 4N9HA 3U21A 2PFBA 2R7SA 2FF4A 2HVRA 1SD6A 3N05A 4LJZF 1SMTA 1E17A 2VKVA 1Q1HA 2R5ZB 4HX7A 2XPUA 1WJFA 3T1BA 2VC0A 3BLYA 3FMRA 4A3LJ 1ITYA 2FEZA 2AQFA 3CDLA 3U9GA 1BN5A 4ON0A 2VUMJ 2DFEA 3LSTA 3LSPA 3SEQA 1U6GA 5F1RA 2IS2A 2R7DA 4IQJA 3BR2A 3MKYB 1LE8A 1TL8A 2GM4A 2GZWA 2W4SA 3GWZA 4HPQA 5JI6A 5E3NA 3RJPA 2OJED 1TT0A 2BY1A 1S9HA 2Q8KA 2VBZA 2ZXWH 3DLAA 1ETKA 2DO7A 3ECOA 4C3HJ 2X1EA 4XN0A 5JHUA 5BPIA 2KIUA 2P7CB 1ETVA 5KHDA 4L9JA 4YIIA 1MSFC 1ERDA 3R60A 3W2WA 1QRYA 2F5VA 2QKLB 3IKVA 1ETOA 3T8TA 1MDMA 5J40A 1STZA 2X9DA 3FHNA 3D0SA 1VFCA 1HSJA 2VIXA 3BZCA 1EH8A 1FOXA 1IN4A 5CVVA 1ETWA 1YITI 2UUZA 3R0AA 2Z99A 3VEPA 3NQOA 1ZYRF 2EFWA 2V4JC 2VPRA 4PJMA 2FNPA 2Q0OA 1YE9A 3U1DA 5EGOA 4AUXA 4S05A 2NVTJ 4RAYA 1EV7A 1Z1DA 2HXIA 1MD0A 4GFBA 4Q4ZF 1YTYA 4EVIA 1OYIA 5E8IA 2JTVA 3V7RA 3TKYA 3F8FA 2OZ6A 2BXYA 4UVBA 2EBIA 3RPQA 1MW7A 2ZSHB 5AIPA 3EUHC 3OYAA 4XKCA 4XORA 4BXUA 2B63J 3IUOA 2BE5F 5IP7J 3LFKA 2IJLA 5EEAA 2PMZA 2LNBA 3FZVA 5FD6A 3HHGA 4U7DA 1W4MA 4QSHA 2PMZN 3BOQA 3IAS2 2HVSA 5FLVA 2O03A 1I1SA 1X2NA 1B72A 3SZPA 2DAOA 4BACA 3C2GA 3CDIA 2Z33A 4NHJA 2LBFA 2MC4A 4XM3A 2UWMA 5B5EC 4HQEA 3HL2A 3MCZA 2ZO4A 1GDTA 4PUSA 1Y0UA 2DPDA 2R93J 3VB2A 4UV9A 1HKSA 3GVAA 4KISA 3IRQA 2O5RA 2LMDA 4H0EA 2B7EA 5H6QA 3ZMVA 3F8CA 4A3JJ 1R00A 3GLLA 5D6EA 1KU3A 5AIQA 2HU9A 3E1SA 5BPDA 4BEHA 3W3CA 3HG9A 4XLNF 2DT7B 3D5SC 3JRHA 4IRHA 4KDPA 3K1NA 1SC7A 2MFZA 2VJJA 3ABMH 4A6DA 4I02A 1I3QJ 1YYVA 2Y0MA 3TP0A 2DJIA 2F6CA 2HQ5A 1ZG1A 3GZ6A 3AKZA 4RGRA 1IRZA 1FEXA 2BVLA 2D2WA 3CMEI 4ASNA 2K02A 4P5OA 4AWXB 3G2BA 1Z67A 3J7AY 4WK8F 1ETXA 3R0JA 2O7OA 4BDYA 2HNHA 5FFZA 4BAYA 3P9KA 2Y31A 1EJ9A 4X1EA 1R22A 4MTEA 1TWGJ 3PFYA 4G9YA 3A03A
chains in the Genus database with same CATH topology
1V54H 2EIMH 5B1AH 3ASOH 2DYSH 3AG1H 3WG7H 1OCOH 1OCCH 3AG3H 2EILH 2Y69H 2DYRH 2ZXWH 2EINH 3AG4H 5B3SH 3ABMH 3X2QH 5IY5H 1OCRH 1OCZH 5B1BH 3ABKH 2OCCH 3AG2H 2EIJH 3ABLH 3ASNH 1V55H 2EIKH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V54 H;  2EIM H;  5B1A H;  3ASO H;  2DYS H;  3AG1 H;  3WG7 H;  1OCO H;  1OCC H;  3AG3 H;  2EIL H;  2Y69 H;  2DYR H;  2ZXW H;  2EIN H;  3AG4 H;  5B3S H;  3ABM H;  3X2Q H;  5IY5 H;  1OCR H;  1OCZ H;  5B1B H;  3ABK H;  2OCC H;  3AG2 H;  2EIJ H;  3ABL H;  3ASN H;  1V55 H;  2EIK H; 
#chains in the Genus database with same CATH topology
 4F55 A;  1HW5 A;  4AC0 A;  2IPQ X;  4HNV A;  2FU4 A;  4E7H A;  3F8N A;  1G4D A;  5D4S A;  2PEX A;  3H9Q A;  5IT3 A;  4Y15 A;  1JGG A;  3FXQ A;  2EZI A;  2M7A A;  1Z7L A;  4M3E A;  4QTR A;  5HLG A;  2MC3 A;  2MW8 A;  2QLZ A;  3CCS I;  3S2W A;  1EH6 A;  3MZY A;  4ANJ A;  4WXD A;  2NS8 A;  3L2C A;  4FTH A;  2LY2 A;  2XHK A;  4EM1 A;  1R4N B;  2Y0S A;  2H09 A;  1QPI A;  4L9T A;  2Y0S N;  2P6S A;  3O2P E;  5E3O A;  2X6O A;  2A07 F;  1JTY A;  1MBH A;  2ECC A;  2GA2 A;  4MIM A;  4D7M A;  2HTJ A;  2VJ4 A;  4A2U A;  3E7L A;  4ESF A;  2DMP A;  2MSY A;  3E6D A;  2RAE A;  5BQT A;  2Y69 H;  3LSI A;  1D1C A;  5GAG J;  4O3M A;  3P5J A;  1SMY F;  1KU2 A;  1NG7 A;  2DQR A;  4ENK A;  4S04 A;  2DK8 A;  4E7L A;  3BWG A;  2XSD C;  2K4J A;  1WJA A;  3GXO A;  3L00 A;  1BW6 A;  1YLF A;  2ZME C;  2E5Z A;  3R6S A;  4I7H A;  1RES A;  3BTC A;  3BZK A;  3HOY J;  2Y9Y A;  4PDK A;  2MG4 A;  3D5L A;  3UNG C;  1B6A A;  5FO5 A;  1R71 A;  2IA1 A;  2WAE A;  4YG2 F;  1K78 B;  2KFD A;  2HQN A;  2HZD A;  2IGN A;  2XB0 X;  3KZZ A;  1LNW A;  4OOI A;  3P9C A;  2NVY J;  4LLG F;  1KGS A;  1BI0 A;  3QYB A;  2VI6 A;  1J7K A;  1ZHF A;  4HAM A;  1BA5 A;  2L2O A;  2VJI A;  3GW2 A;  1J59 A;  4IX7 A;  1RC9 A;  1QZZ A;  2ME6 A;  2A69 F;  3LAJ A;  2CJJ A;  2J5P A;  1SAN A;  1YOV B;  3K10 A;  2DTZ A;  2ZJQ F;  4HX4 A;  2DDA A;  3WGI A;  1HA8 A;  2V7F A;  2WAQ A;  1AA7 A;  4M3B A;  2FMY A;  2WAQ N;  5C3E J;  4L9N A;  2FUG 2;  2Z5U A;  1JUM A;  1SEU A;  1W0U A;  1D5Y A;  1KYW A;  4IHV A;  3CMY A;  4EMS A;  1UHS A;  2X1C A;  4CCK A;  3E5Q A;  3G71 I;  2CFX A;  1NG6 A;  1W0T A;  4BGD A;  1HBX G;  4KYW A;  4C3J J;  4XOP A;  1QVU A;  3GTJ J;  4GXO A;  2X1D A;  2KDZ A;  3TOA A;  1OR7 A;  2XF7 A;  4RLQ A;  3HOX J;  1A31 A;  3Q9S A;  5C44 J;  2YUS A;  2LSO A;  1A04 A;  4ZC3 A;  4PGH A;  1WJC A;  1W7P D;  1Y1W J;  5JHF A;  2LDU A;  5CYV A;  3ZPL A;  3C7J A;  3CMM A;  2XRN A;  5LEK A;  3FMS A;  3OYM A;  3BR1 A;  3S16 J;  5KAF C;  1FJL A;  2P0W A;  3FBN B;  1SFE A;  2P7V B;  3DQV C;  3FXK A;  3RYP A;  2VBY A;  1BR1 A;  3T8R A;  1XN7 A;  2O8K A;  1R6R A;  1JKP C;  3K6G A;  1LDD A;  1KU9 A;  2E60 A;  1KON A;  1LVA A;  1XD7 A;  2Y48 A;  2VBX A;  2CQ7 A;  4CH7 A;  3G1O A;  3I4N J;  5IOZ A;  1FOY A;  2OV7 A;  2NS0 A;  3ABT A;  3ZGK A;  1SFX A;  5L3B A;  4HW0 A;  3WTZ A;  1BBY A;  2LG4 A;  2XSJ C;  2DOD A;  3K4B A;  4C9Y A;  1LJ9 A;  3WE3 A;  2PJR B;  4HZF A;  4ESB A;  4Q5S F;  2W7N A;  3H35 A;  4I2O A;  1HKT A;  4BJT A;  1OYW A;  2ZJP F;  4FX0 A;  3RIR A;  1ULY A;  1K6Y A;  2WY8 Q;  4M6X A;  3VFZ A;  3W6V A;  1XS9 A;  3QPH A;  2Z1D A;  2FBH A;  3OSF A;  3K4C A;  2EIK H;  4IOC F;  3J7Z I;  3G4S I;  2O0Y A;  4FE4 A;  3DBR B;  3O6B B;  4CCM A;  2K3F A;  4E7S A;  3K2A A;  5TGT A;  4NBQ A;  1W36 D;  2FRH A;  4ZYH A;  2KDO A;  1OLT A;  4MHG A;  2CW7 A;  3J80 Z;  1LEB A;  1O57 A;  3V8L A;  4X0G A;  2H6C A;  2MAB A;  1Z9C A;  2B9S A;  3MQ0 A;  1B8I A;  1BOA A;  3KLO A;  5EZG A;  3K69 A;  3MD2 A;  5B1B H;  1QU3 A;  2XGE A;  5LRR A;  1OQY A;  4Y13 A;  3JCU C;  3F23 A;  3K4L A;  4IHY A;  1ODD A;  2W00 A;  3VSK A;  3BR5 A;  4P9U A;  2KRH A;  2Z3Y A;  3KYL A;  4N4N B;  4B4C A;  5FKM A;  3S3O A;  3WTV C;  2WTE A;  2VJ5 A;  1MGT A;  4PJN A;  1R5H A;  3E0J B;  3WU2 C;  1YJW I;  5J6X A;  3K1M A;  5ILU A;  2OU2 A;  3BTJ A;  3PNT A;  5HNF A;  3FF5 A;  3NWS A;  5FKL A;  5L3G A;  1T6S A;  3CTA A;  4BXF A;  1X4O A;  5ICF A;  5M5W J;  2M2E A;  4U0Y A;  4HA8 A;  1J2X A;  1X1A A;  1IUY A;  1QHH D;  1E3O C;  5EDN A;  1HCR A;  1ZK8 A;  2Y30 A;  1BC7 C;  2ETH A;  2JSC A;  3OOP A;  4HF2 A;  3GTP J;  1Y0N A;  1FX7 A;  3OIQ A;  5E1X A;  3OL4 A;  2KPM A;  2VL8 A;  2IRF G;  3V7C A;  3VOD A;  5ERI A;  2ADU A;  2EIN H;  3DKY A;  1K7A A;  1DGW Y;  1XSV A;  3L2Q A;  2P5V A;  4A3F J;  1IV8 A;  4BNC A;  5EEH A;  2OTJ I;  4LMY A;  5EEG A;  4O6J A;  4IJA A;  1J5Y A;  5BMZ A;  4DZP A;  3MFK A;  4JX4 A;  3VOE A;  1T8I A;  2ZME B;  3I5U A;  3PFI A;  4I0B A;  1MNM C;  3J7A O;  3HOU J;  1VQO I;  1YJN I;  1T08 B;  2IT0 A;  3F8B A;  2NS7 A;  3GTO J;  5CVJ A;  3GZN B;  3CCL I;  1P4A A;  3GTM J;  2VKE A;  2W48 A;  2R7U A;  4EGZ A;  1XCB A;  2QM3 A;  1MJ9 A;  1HXD A;  2JVH A;  2MD0 A;  4RMN A;  4AVZ A;  5IYD J;  3DU6 A;  5FJ8 J;  4CHU A;  2D1H A;  1YW7 A;  2CUZ A;  3LSM A;  5ICC A;  2IS1 A;  4IHW A;  2DU9 A;  1U9O A;  1G59 A;  2E2I J;  2GOX B;  3KP5 A;  5LBQ A;  1WH7 A;  3I64 A;  1WH5 A;  4XQF A;  3PO3 J;  4B48 A;  2QCO A;  1ZTR A;  2DCE A;  1ZEL A;  5E1W A;  4KT5 C;  1RR7 A;  2JA2 A;  3L7W A;  5LHI A;  3CCE I;  3CO6 C;  1AOY A;  3ABU A;  3LSG A;  1RUO A;  1WHU A;  4Q48 A;  4JQF A;  3WTS C;  2IP2 A;  3WE2 A;  1ZRC A;  3CP8 A;  2PI0 A;  2BOL A;  5FRN A;  3B6C A;  1XMX A;  4II3 A;  1W5C C;  5L3D A;  2GXB A;  3DFG A;  3Q5F A;  1H9G A;  1BOB A;  1Y8Q B;  2NAZ A;  3BRO A;  1W7P A;  4E70 A;  2PJP A;  1BIB A;  3L2R A;  5IPA A;  1MBE A;  1IDZ A;  3O3K A;  3PNV A;  2BXZ A;  3OMY A;  1WCM J;  4KMF A;  2DA7 A;  1T56 A;  2M0M A;  5E79 C;  3FXJ A;  1YS6 A;  1IN7 A;  2QBY A;  2KKO A;  5BNG A;  2KLO A;  3CC7 I;  3TO6 A;  4I0A A;  1RZ4 A;  1ONV A;  5L3F A;  3GO5 A;  3CC4 I;  3DEU A;  1TQI A;  1UHW A;  3FXU A;  4RGS A;  3TO9 A;  3WGH A;  3JRE A;  1UFM A;  2BHZ A;  2XGD A;  1GLN A;  4KJZ A;  4XR6 A;  5J8C A;  3WTY C;  2CMP A;  4UVA A;  1YIJ I;  3H92 A;  2XPV A;  2LTP A;  3L9F A;  4JYK A;  3OYG A;  5F64 A;  3REO A;  1P92 A;  1EKE A;  3I59 B;  2XAJ A;  4BHP A;  2JUC A;  2LC2 A;  1JTX A;  5GPC A;  2E19 A;  3AFH A;  1F4K A;  2IS6 A;  2DK5 A;  5ICE A;  1MBG A;  3S15 J;  3CLO A;  4UHT A;  1AU7 A;  3OR2 C;  4XLF A;  3LAP A;  3BG9 A;  5TJJ A;  1UMQ A;  2HVQ A;  3MZ8 A;  3OYD A;  4NDL A;  5HDN A;  2HGC A;  2HKX A;  4WXH A;  4ZDP A;  2Y2Z A;  4BU2 A;  5FRO A;  5KNL A;  3QYE A;  3G6E I;  2HOA A;  2ZXJ A;  2LR8 A;  1GXP A;  5EJC A;  1R9T J;  2XKP A;  4IL6 C;  5FLX K;  2X6W A;  2CRG A;  3ESW B;  5GP9 A;  2K9N A;  2YU9 J;  3Q0W A;  2QQB A;  2L4A A;  1E3P A;  5EF6 A;  3ONQ A;  3C3W A;  1MBF A;  3GBG A;  2WV0 A;  5K7H A;  4A69 C;  2DMT A;  3WU0 A;  4DZJ A;  3RKQ A;  4JX6 A;  4ENM A;  1ZLK A;  2KL4 A;  2E1O A;  5LLQ A;  1YFH A;  1WI9 A;  2ZBK A;  3BCB A;  3K1P A;  4JBA A;  1ZR4 A;  4PZJ A;  1IXC A;  2BZT A;  2K9M A;  4UVC A;  2FNA A;  2DT5 A;  5K5Q A;  1JE8 A;  2CUF A;  3VYT B;  3BCA A;  3L2U A;  3LOC A;  4UUV A;  2K40 A;  4M3F A;  4CDG A;  2A6T A;  2X48 A;  4MTD A;  3GFJ A;  1VQN I;  1FOK A;  3AG1 H;  3CUQ C;  4FIS A;  4XRS G;  3EPZ A;  3SXY A;  3NRV A;  4A5M A;  3LFU A;  4DYR A;  3HOW J;  4BXX J;  1HOM A;  1IN8 A;  4CYC B;  4J01 A;  2OBP A;  5DYM A;  3ZMZ A;  2X6X A;  1R7J A;  1SD4 A;  2ELJ A;  3CJN A;  4XID A;  1D0Y A;  5J47 A;  2HOE A;  4FET A;  4BHC A;  3X2Q H;  3HSE A;  3A2K A;  4J19 A;  2EZH A;  1U5T C;  3QPT A;  2HYG D;  4ZZL A;  1YJ9 I;  4GO1 A;  2OZU A;  4KIT B;  3H3U A;  2IW5 A;  2FE3 A;  2CO5 A;  2FJ1 A;  4DGW B;  5M5X J;  2IXS A;  4AU7 A;  1OCC H;  2K7L A;  1FWZ A;  4DNC A;  5H6R A;  5DS9 A;  4HDV A;  4TV7 A;  2M1B A;  1G3Y A;  3RYR A;  6PAX A;  2JK3 A;  3D5R C;  1LFB A;  1O3R A;  3W6K B;  3JSO A;  3BY6 A;  4P1W A;  2WWY A;  2CGP A;  1JKO C;  1S7E A;  1QA6 A;  2DOE A;  1VI0 A;  1T0F C;  2RC4 A;  2F5D A;  4IKF A;  2VKH A;  2O61 A;  2EWN A;  2H1L A;  1YS7 A;  4LLL A;  1RUN A;  3S14 J;  1ON2 A;  3ZN0 A;  3QQA A;  2CW0 F;  3F6V A;  4ENJ A;  3G1M A;  1K61 A;  5LGN A;  1VQ7 I;  4HST A;  2CFO A;  2AQE A;  4QIW N;  4YFK F;  1NK3 P;  4F93 B;  2VOO A;  2M45 A;  4A3I J;  4A6E A;  5E8G A;  3I56 I;  2DLL A;  3HPG A;  1FYL A;  4NB5 A;  2CUE A;  3V7S A;  4XNF A;  3WTT C;  4RAZ A;  2L7Z A;  2H8W A;  4BDZ A;  2V1U A;  1BJA A;  1MSE C;  4UB8 C;  1RRJ A;  2HPM A;  3M3Y J;  1G8X A;  1YX3 A;  2CH0 A;  3DP7 A;  4YIF A;  3MZH A;  4C30 A;  3K0L A;  3TDZ C;  5CLS A;  4RDU A;  2RQQ A;  1B1B A;  3M8E A;  2BVM A;  3F72 A;  5FFX A;  4G7H F;  2F48 A;  1DUX C;  3S3N A;  4N9I A;  4IQ4 A;  2YX7 A;  3Q0U A;  3GLX A;  5IP9 J;  3E6C C;  1TQM A;  3E5X A;  3EET A;  4HRI A;  2IS4 A;  3AG4 H;  4V2G A;  2RQP A;  1FNN A;  1FY7 A;  3H3V K;  1T95 A;  3PNY A;  2R7F A;  4A3C J;  1T33 A;  1S7O A;  3EQL F;  2DI3 A;  2LKS A;  1GV5 A;  4RAF A;  3SJM A;  1CGP A;  3T5X A;  2HOT A;  4HDU A;  1IC8 A;  1VQ9 I;  1XG1 A;  2L0K A;  3RQI A;  4N0B A;  3RTR A;  1QVT A;  2RNG A;  3QOD A;  2FQ4 A;  2ZNY A;  5HDG A;  2Y75 A;  1R5I D;  4CCJ A;  2RV8 A;  1WJ5 A;  2ZJR F;  2R5Z A;  4IRG A;  4KIG A;  4G6D A;  4ETS A;  5DCM B;  2KJC A;  3DEW A;  1U0J A;  3AAF A;  4M9Z A;  3JRD A;  1LKX A;  1IN6 A;  4BE0 A;  1YQA A;  2NRA C;  2IAI A;  2AXT C;  3WOD F;  1RKT A;  3CZ6 A;  4V19 K;  4P9F A;  4U0W A;  1A6Q A;  3I71 A;  3R61 A;  5FLX Z;  2PBI A;  1JHH A;  3PJR A;  3EYY A;  3HRM A;  1IAW A;  4UNO A;  1KA8 A;  2HZT A;  3CJT B;  4FAS D;  2N8G A;  4X6A J;  1UST A;  3WG7 H;  3KP2 A;  1MMS A;  3I9V 2;  4HV5 A;  1EH7 A;  4E7K A;  5DV5 A;  5DUK A;  1XX5 A;  2FBK A;  1XSX A;  2HKO A;  3M9A A;  4U87 A;  2R7V A;  2ISZ A;  4AVP A;  5F0H A;  3TED A;  3C1D A;  4Y4R A;  4D5C A;  5B1A H;  4XON A;  4A3E J;  3KCC A;  2GAU A;  2CYY A;  2EQR A;  3JRB A;  2IEK A;  2DQL A;  1AHD P;  2HYF A;  4U7B A;  3IKT A;  2VBW A;  1Z77 A;  1ZAR A;  2KZG A;  2ID3 A;  4B3A A;  2L02 A;  3ZQQ A;  4IF4 A;  4CA0 A;  3HOT A;  2XAQ A;  4BUP A;  3HOV J;  2LOO A;  4HSR A;  2V79 A;  5KAI C;  4RB3 C;  1N75 A;  2XAF A;  2D5V A;  3GTL J;  1ZG5 A;  2DFI A;  1R1U A;  4GDF A;  2ZXH A;  4E4H A;  3PL8 A;  2IGM A;  2O3F A;  3ZQC A;  5HS8 A;  1ZR2 A;  2VE9 A;  1VQP I;  1YRN B;  3OYH A;  2Z16 A;  3FKJ A;  3CCV I;  3DBL B;  4C2U A;  3H36 A;  1BI1 A;  2E7W A;  3CUQ B;  3FM3 A;  3K4N A;  2EFO A;  3EDP A;  2XGC A;  4UUS B;  5GAE J;  2DW4 A;  3GFM A;  3J80 K;  2LRE A;  2DXI A;  2HI3 A;  2QEN A;  3BR0 A;  3JRC A;  1DU6 A;  3TQN A;  3OS2 A;  5CPR B;  3WTX C;  4GYG A;  3BR3 A;  1P9Q C;  4MGR A;  2KZV A;  4LK1 F;  1LEA A;  4L5J A;  2EFN A;  5CQG A;  1U5T B;  5F0F A;  3KP6 A;  5GTI C;  4Z6Y A;  2IA0 A;  2DTR A;  3EUA A;  4EJV A;  1ZLJ A;  5D4R A;  3WHB A;  5LGT A;  1Y56 A;  1N77 A;  1IW7 F;  2V6C A;  4DW6 A;  1YG2 A;  3BPX A;  2F4M B;  4LIV A;  3MKL A;  2L9V A;  2AO9 A;  5DD4 A;  3K7A J;  1Y1V J;  2P8T A;  4DIQ A;  2DA3 A;  3CC2 I;  2OQG A;  2JWT A;  1JI8 A;  1OIS A;  4HLY A;  3CES A;  3WTU C;  2JMW A;  3D1N I;  1HLV A;  1IRG A;  2XKO A;  2X6Y A;  3GFI A;  2M5W A;  3BG5 A;  3V42 A;  4XK4 A;  1V54 H;  3CQZ J;  2OAZ A;  5D5U B;  2JSP A;  3PQK A;  3CP2 A;  2JRM A;  3NEU A;  1D1A A;  1N25 A;  2QYO A;  1RR8 C;  4A5N A;  1GUU A;  3MAJ A;  2H1K A;  2VOD A;  3FM5 A;  1KYZ A;  2M3A A;  1X3Z B;  1BJZ A;  1O3T A;  1GXQ A;  1QNT A;  3HRS A;  2E5N A;  3HPH A;  4MFE A;  4R1H A;  5DD8 A;  2XRO A;  1M1E B;  4IHT A;  4M9S A;  2FQ3 A;  1IGN A;  3U1K A;  4F7Z A;  1T39 A;  3MWM A;  2H6B A;  2PMH A;  4M71 A;  1FT9 A;  3IAM 2;  3V4G A;  1WWX A;  3RQ4 A;  2CS3 A;  3HZJ A;  1UCR A;  2R7R A;  4RB0 A;  3K70 C;  2QQA A;  2FXA A;  1AWC A;  4MEX F;  4IEJ A;  1I39 A;  3SFI A;  3OSG A;  2JZY A;  1X1D A;  2A61 A;  3FK7 A;  4HF0 A;  1KZH A;  4MNU A;  1RIO H;  2M7B A;  2QGU A;  2AHQ A;  2WV1 A;  1F9N A;  1LPQ A;  1BI2 A;  1S3J A;  2OCC H;  2VKD A;  2CQQ A;  3HEF A;  1ZAO A;  2PX9 A;  3HIF A;  3DTI A;  1X1B A;  4RLF A;  2R5Y B;  4R8H A;  3SEZ A;  3KYC B;  1YO5 C;  4I09 A;  4RB1 A;  4XSZ F;  1XGO A;  3M07 A;  1ORK A;  1EA3 A;  1RNL A;  2BV6 A;  3ZCO A;  4HBL A;  1Z05 A;  2K9L A;  3A01 B;  3F21 A;  1R58 A;  4KNY A;  2EA2 A;  5M3M J;  4CZZ A;  4YFX F;  3GCM A;  3A4C A;  4KIC A;  2NYX A;  1FC3 A;  4LB5 A;  1K78 A;  3SZG A;  2OD5 A;  2QQ9 A;  4W1U A;  3L1P A;  2OF7 A;  3L2V A;  3BQY A;  3BJO A;  3W2V A;  1JT6 A;  5HS9 A;  1XGS A;  1WKM A;  2NVU B;  5E3L A;  2MH2 A;  3S1M J;  4PSX A;  1PVE A;  1G3S A;  1ZQ3 P;  2ECB A;  4BL0 B;  3IH3 A;  1J0R A;  5IYC J;  1GV2 A;  3ZP5 A;  2YSR A;  3P7N A;  4D9J A;  4L0Y B;  3ELK A;  4I6Z A;  3MKZ A;  3HUG B;  3M8J A;  4BQA A;  4U0V A;  4FE7 A;  4G6Q A;  3S1Q J;  1R1T A;  3RKW A;  4GCV A;  2M30 A;  1FOW A;  3PSI A;  1LFU P;  4KMU X;  1S72 I;  5HLI A;  2ELH A;  4OU0 A;  3K70 D;  1MBJ A;  1G6N A;  1BL0 A;  3ZQL A;  1WRJ A;  2DA2 A;  4QWQ A;  3F3X A;  3BT9 A;  3EUK L;  1P6R A;  2QZ8 A;  2H27 A;  4CGZ A;  4BE1 A;  1X3U A;  3F22 A;  4EM2 A;  2AXL A;  2O8X A;  2P81 A;  2WC2 A;  3B02 A;  1H88 C;  3V8J A;  2VT3 A;  2F5F A;  4CIC A;  3EUH A;  4AYB N;  3VPR A;  4AID A;  2ZCW A;  4KT6 A;  1L3L A;  1TNT A;  3H1C A;  3KP4 A;  3HM5 A;  2BHY A;  3OY9 A;  4HQM A;  4XSX F;  1TNS A;  2WBM A;  4XKW A;  4F91 B;  4E7I A;  4A3K J;  2ZB9 A;  4I98 B;  2Q2E B;  2NVX J;  3SYT A;  3ROU A;  3S1R J;  4CCL A;  4EM0 B;  2HPI A;  1V5E A;  1F1Z A;  4DBQ A;  5IY5 H;  1I5Z A;  1HST A;  3BG3 A;  2VE8 A;  4OIN F;  1O3Q A;  3TBI A;  5HDK A;  3IWZ A;  1I1G A;  1MMA A;  4LG3 A;  4F3Q A;  2EIJ H;  3DPL C;  1B9N A;  4IHS A;  3ZQH A;  3RKY A;  2RVC A;  2E36 A;  5EG0 B;  3H0G J;  3HHH A;  1W5S A;  2JT1 A;  2PJR A;  4XN3 A;  4XMY A;  4HG2 A;  1P2F A;  3BR6 A;  2W85 A;  1H9T A;  4RS8 A;  3IL2 A;  3AG3 H;  3M1E A;  1VQL I;  1VQ4 I;  3E5U A;  2BW3 B;  2XAH A;  1QPM A;  2LRD A;  4U88 A;  1I50 J;  4KUM A;  5F04 A;  2ESN A;  3HOS A;  5FGM A;  1MIJ A;  3CCY A;  1W1W E;  2L01 A;  2LVS A;  1ZGJ A;  2VT2 A;  3IC7 A;  4I99 C;  3FWE A;  4A12 A;  3CCR I;  3UKG A;  4EJU A;  2MLK A;  3LSJ A;  1LDJ A;  4XKB A;  1X58 A;  3BTL A;  5B66 C;  3GTK J;  1VF9 A;  3I4M J;  3QYF A;  4FQG A;  3G73 A;  4NQW B;  4A3M J;  1S5L C;  4OIO F;  1PP7 U;  2KQR A;  1WQ2 A;  4CYD A;  1U3E M;  3NAR A;  1IO2 A;  1MZB A;  4RGX A;  4XLC A;  1DGR M;  3Q3S A;  3RZD J;  3ERE D;  3SZT A;  3BDD A;  3EYI A;  3K4J A;  5ILV A;  3FX3 A;  2LFB A;  2EV5 A;  1BC8 C;  2E1N A;  1CF7 B;  2K5C A;  1R4M B;  4ZH4 F;  2HQA A;  4LG0 B;  3FIS A;  1XMK A;  2KIM A;  5K5R A;  1TW2 A;  3S3M A;  3QP5 A;  3RCO A;  3KZY A;  3HGY A;  4EGY A;  2RN7 A;  1FTZ A;  4ABZ A;  1TC3 C;  3ULQ B;  5LRS A;  1B59 A;  1S29 A;  2KRC A;  3RI4 A;  5KK1 A;  1IRX A;  1BR4 A;  1SVM A;  2VQH A;  1XGN A;  3PUF A;  1DP7 P;  3A0H C;  2QSG X;  1U8B A;  3SHF A;  3TGN A;  2WB1 A;  1TWC J;  5H2F C;  2LKX A;  4CZC A;  3OYE A;  2WB1 N;  2W57 A;  2CWE A;  2L9S A;  1VQ8 I;  3I54 A;  3GX4 X;  3QRF F;  4B43 A;  4Y7N J;  2X51 A;  2PG4 A;  3R4K A;  5F1J A;  1K6O A;  4ZYG A;  1JKR C;  1CQT A;  1GVD A;  4E6K G;  1SAX A;  4NC6 A;  2OQR A;  1VQ5 I;  4EAT A;  5EZH A;  3CCU I;  3DKX A;  4BKX A;  1Q1V A;  1DP3 A;  1J75 A;  3C18 A;  2W24 A;  4WF2 A;  2A3S A;  1IDY A;  4FX4 A;  4E7Z A;  1XMA A;  1FIA A;  2ZME A;  4OMZ A;  1IJW C;  2XV4 S;  3JR9 A;  3DEE A;  5L3E A;  1MKM A;  1XB4 A;  3DV8 A;  4HX8 A;  5HVQ C;  4OMY A;  5F6F A;  2XDV A;  4HNT A;  1HW2 A;  1RET A;  4M73 A;  1TZL A;  1UHM A;  1QO0 D;  4B1R A;  1VZ0 A;  2NNY A;  3BP8 A;  1IV6 A;  2LK2 A;  4AIK A;  2YX4 A;  2ME0 A;  3H5R A;  4G7O F;  2STW A;  9ANT A;  1GT0 C;  3RZO J;  3CJQ B;  4EJT A;  3ZMS A;  1SD7 A;  1FLI A;  1BM9 A;  2GIV A;  2LY9 A;  2MBF A;  2L3D A;  4BS9 A;  2XUB A;  1O7F A;  3ECH A;  3QPL A;  5EYR A;  2DA1 A;  3E3V A;  3PSF A;  3B6A A;  3HXL A;  4P96 A;  3TOB A;  1QHG A;  1AKH B;  3FMQ A;  2J5O A;  2DMN A;  2KMU A;  2P5K A;  1DPR A;  1PUF A;  3KE2 A;  1D1B A;  3M8F A;  1DDN A;  1KQ0 A;  2DA5 A;  4YFN F;  3QPS A;  2ESH A;  3V8K A;  3GTG J;  1APL C;  4QPQ A;  3QP6 A;  5KCM A;  5DM6 F;  2XIG A;  3FK6 A;  3GF2 A;  1FSH A;  5FKK A;  1HKQ A;  4AIJ A;  3GME A;  2RNJ A;  1NK2 P;  1S8N A;  1OCT C;  2JRT A;  3FXR A;  5C4J J;  3VYU B;  2IVM A;  3CCQ I;  3LNQ A;  4F52 A;  4XRM A;  3KP7 A;  2R3S A;  1K4T A;  2XAU A;  2HQR A;  3LSK A;  2DA6 A;  2K9Q A;  1LDK B;  2R0Q C;  4Z2Y A;  1IF1 A;  1ETY A;  1Z21 A;  2L7F P;  5TIS C;  3RPU D;  4W97 A;  1MJA A;  2OC6 A;  2NOG A;  5D8L B;  2CQN A;  2ID6 A;  5DEQ A;  1SFU A;  2BEO A;  3CMA I;  4B8X A;  1LE8 B;  4XIC A;  4PGG A;  2DFF A;  2V1N A;  4YIR X;  2HEO A;  1IXS B;  2ZNZ A;  4XLH A;  2G7U A;  2MH9 A;  2V9P A;  3BPV A;  3BQZ A;  5J4Y A;  5K7F A;  3S2H J;  3I59 A;  1UZC A;  2O9L A;  4C2M J;  4OAZ A;  4LB6 B;  1R36 A;  3KIO A;  3JRI A;  3NAU A;  3HDD A;  3TW7 A;  3I53 A;  1V5G A;  2ZJ2 A;  5FKO A;  3S93 A;  1XSD A;  5HNH A;  1P7J A;  1X1P A;  1MDM B;  2HXO A;  1MNE A;  2K9S A;  2MLG A;  4Y17 A;  3TL4 X;  2X0L A;  2BY0 A;  4L5E A;  4DJA A;  2Y9Z A;  3IHU A;  2L5Q A;  4XOT A;  5GAD J;  4AM3 A;  5E18 F;  3S1N J;  3M1C A;  3H3Z A;  3DF8 A;  2KRF A;  1B9M A;  1X3W B;  2L4M A;  5EGO B;  3GYH X;  5K1Y A;  1F5T A;  1OCP A;  4M3G A;  2XC7 A;  1JKQ C;  2BBY A;  2VQC A;  1Z6R A;  2CUJ A;  3AG2 H;  3I58 A;  3HSR A;  2G9W A;  3FHZ A;  1JUP A;  3HSF A;  1OR7 C;  1OMI A;  1I27 A;  1WZ2 A;  2EZL A;  3OV8 A;  1LFP A;  1Y39 A;  4YEL A;  4BJ6 C;  1MND A;  2CW8 A;  4ZYE A;  3OOU A;  3F9K A;  2ZC2 A;  4DOZ A;  1JXS A;  3HC7 A;  2LF7 A;  2M87 A;  1ZRD A;  1V5F A;  5ICG A;  3DPT A;  3PUB A;  1ZG3 A;  1ZGW A;  4N4O B;  1B72 B;  1IG7 A;  3CLQ A;  1WJE A;  2W25 A;  3JRF A;  2LBF B;  4RA2 A;  2KT0 A;  1ZKG A;  2KP6 A;  1O3S A;  3HBL A;  2GIZ A;  4E7J A;  2LYC A;  4CSW A;  2LP0 A;  3I4P A;  1Z3Y A;  5HOD A;  4CYC A;  2DN0 A;  4NC7 A;  1Z0X A;  4IXA A;  2F5C A;  5LHH A;  1A36 A;  1K79 A;  3L2W A;  3LSR A;  5H20 A;  2HS5 A;  1X2M A;  4EQQ A;  5FLM J;  2G0E A;  2XVC A;  3E6B A;  4HNU A;  3OYK A;  4IHX A;  3QOP A;  2LKP A;  3LA3 A;  2P5L C;  5F08 A;  3ZQG A;  1ZGA A;  4BEH B;  5IT9 Z;  3DWL E;  1OCZ H;  1MH4 A;  1UG0 A;  4A93 J;  3OYB A;  4PFO A;  3B73 A;  2FOW A;  3Q9V A;  2A6H F;  1O7L A;  3KX2 A;  4XLP F;  3N97 A;  5E3M A;  4PJJ A;  1JHF A;  1W5T A;  1OYY A;  1FSE A;  3K9T A;  2VON A;  5J8F A;  1HC8 A;  3KEQ A;  5M3F J;  3G1L A;  3LL7 A;  4G8X A;  1D8K A;  2EIL H;  2A6E F;  2E2H J;  2OA4 A;  1TWF J;  1U2W A;  3KLN A;  4A3G J;  5BS6 A;  3BZ6 A;  4RB2 C;  4J00 A;  4IZZ A;  3LWF A;  3HGG A;  2FBI A;  3M7G A;  1JGS A;  4DBR A;  1OCR H;  1MJB A;  4RM2 A;  4BBR J;  4D7N A;  3AL0 C;  2LY1 A;  2QF7 A;  5CKT A;  2E71 A;  1VTN C;  2W1O A;  3ASN H;  4EEF G;  1IUF A;  5IP6 A;  4ZTJ A;  5DM7 F;  4DQ2 A;  1I6X A;  2F2E A;  4HLX A;  4KA4 A;  3P9I A;  2KIS A;  4XL9 A;  4OIR F;  5GAH J;  5L3C A;  3BJ6 A;  3ZR8 X;  4PFP A;  2W82 A;  2QVO A;  2MGQ A;  3LSH A;  3ZMD A;  2QEX I;  3C2B A;  1BIA A;  5ED4 A;  2QSF X;  3LQQ A;  3F6O A;  1FMV A;  3CJR B;  4ZTF A;  3F8M A;  2FML A;  5B3S H;  2LD5 A;  1BW5 A;  3Q0V A;  3M4O J;  3QWL A;  2V1D A;  2K85 A;  2AS5 F;  2PQ8 A;  3VYS B;  4C3I J;  4BQO A;  1A35 A;  4G12 A;  1YW9 A;  4B3X A;  2DYS H;  3J81 K;  1T98 A;  1XCV A;  1OCO H;  2M9H A;  4ZDL A;  2DOF A;  4RM3 A;  5F0C A;  1UG2 A;  4CCO A;  2COM A;  2OCE A;  2TDX A;  2CSO A;  2FD5 A;  1TP4 A;  1HQC A;  3WTW C;  2A68 F;  1C0W A;  3GTQ J;  1MH3 A;  1FBQ A;  2ZFU A;  3VDX A;  2XPW A;  2G7H A;  3O8H A;  4B09 A;  3RPU A;  2MA3 A;  2GOM A;  2JVG A;  2E2J J;  4XRF A;  1IXR C;  2Q1Z B;  3IH4 A;  5CQE A;  2HDC A;  1LUJ B;  2JPC A;  3OL3 A;  5DCM A;  1DQU A;  3C2H A;  5CVI A;  4UB6 C;  4ENN A;  3KP3 A;  1IZ1 A;  2M34 A;  2M8G X;  2GA1 A;  4ZZD A;  1I3A A;  3CUO A;  2V1X A;  4UY8 I;  3H0D A;  1RPW A;  4FT8 A;  2I8D A;  3VYR B;  2UZK A;  4Y33 A;  1UAA A;  2X85 A;  3H9J A;  1GHC A;  3JAM Z;  3HOZ J;  3FDY A;  2WAD A;  2HOS A;  4C2T A;  3MVP A;  2B0L A;  1ETQ A;  2X4H A;  1TLH B;  3DPU A;  5IYB J;  3CCM I;  2K86 A;  3I55 I;  1U8R A;  2JN6 A;  3OYN A;  3OIO A;  3JRG A;  3K4K A;  1D3Y A;  5JFR A;  2E1C A;  2FX0 A;  2JUG A;  2F5E A;  2YPR A;  3I3L A;  4JP0 A;  4PCQ A;  1YX5 A;  2EV0 A;  2VPL A;  4M6V A;  1FZP B;  3ZMT A;  1LB2 A;  2E1M C;  5D5W B;  3DBH B;  1PJR A;  1P4W A;  4P55 A;  4M72 A;  2F4I A;  3JTH A;  2DJN A;  2EIM H;  1L0O C;  2NXN B;  5D5X B;  3H5N A;  5E20 A;  1Y8R B;  3SDB A;  2L9R A;  2A05 A;  4KIF A;  2NOJ B;  5JVG F;  5HS7 A;  3IV5 A;  5DCF A;  2L7K A;  2QQ8 A;  3FXM A;  1IRF A;  3FBI B;  3SFZ A;  4RBO A;  3CCJ I;  1YRN A;  2BY2 A;  2K27 A;  3FXO A;  2DFH A;  3OYC A;  4NC8 A;  3HYI A;  3HRU A;  4F92 B;  1PYV A;  3CUQ A;  4PJL A;  2PMU A;  4R79 A;  1S6L A;  1DPU A;  2R7O A;  4UUS A;  4II2 A;  2W84 A;  2VLA A;  1WJD A;  2CQX A;  1XPX A;  4H4K C;  2C6Y A;  1VND A;  3S8P A;  1KQ8 A;  3LA2 A;  2O6G E;  3ERM A;  3OYJ A;  3A02 A;  4JK1 X;  2EFP A;  1U5T A;  1Z6T A;  1U9N A;  1NHA A;  4BY7 J;  4ZDO A;  1R1V A;  5D6F A;  4L9V A;  2FA5 A;  3ZOB A;  2CV1 A;  2XF6 A;  3WG9 A;  4OWR B;  2YU3 A;  1K4S A;  4CCN A;  1W36 C;  3G3Z A;  3BTI A;  2CV0 A;  5HLH A;  3BJA A;  4L5I A;  2KIQ A;  4QPO A;  3PQJ A;  4HOB A;  5J1Y A;  4A3B J;  2COB A;  2JJ7 A;  2VOP A;  5FD5 A;  4GRI A;  3BG7 A;  2R7Q A;  4YRV A;  4FHT A;  1YIO A;  1T0F A;  2WAF A;  2JA7 J;  4Q47 A;  1OFC X;  1NH3 A;  5DTD A;  1JUS A;  5D8K B;  2H94 A;  3CO7 C;  1JJ8 C;  4ZYD A;  4Y52 J;  3AL0 B;  1B8I B;  1BR2 A;  2DT6 A;  1YHQ I;  3TW6 A;  2ZFW A;  1PUE E;  1V4R A;  3KPH A;  2HR3 A;  2KIF A;  3H9G A;  1ENH A;  3PIO F;  4RGU A;  3ASO H;  1D8J A;  3A0B C;  3J81 Z;  3HTU A;  4BHB A;  2EH3 A;  4IVN A;  1QBJ A;  4EV0 A;  1X19 A;  3HTS B;  4CXF A;  1T38 A;  1D0X A;  3KET A;  4L18 B;  3K4M A;  3K2Z A;  2VC1 A;  3ZMU A;  1PP8 F;  2Z9O A;  4O5V A;  1EF4 A;  3HJE A;  2QA4 I;  2R4G A;  1H0M A;  2UXX A;  2EV6 A;  2XF5 A;  3IWF A;  1B4A A;  3TMO A;  2GXA A;  2LLK A;  1N78 A;  3LA7 A;  3CF2 A;  2VXZ A;  1HF0 A;  2PN6 A;  2M4K A;  1MBK A;  4LOC A;  2KHM A;  5JLW A;  3S32 A;  2OUM A;  1USS A;  4UV8 A;  2WA0 A;  1ACI A;  4CUG A;  2GQQ A;  1MMG A;  2R7Z J;  1OJL A;  2Z2S B;  1UJ8 A;  3E6M A;  1REP C;  2STT A;  1VQ6 I;  1NTC A;  5CVR A;  4LK0 F;  2YR2 A;  2A5W A;  2DMU A;  4LIU A;  3MEX A;  2CV2 A;  2BGC A;  2HWV A;  2EFQ A;  2XB5 A;  4XLE A;  5LGU A;  1F36 A;  4LLN A;  1FTT A;  3CD6 I;  2FSW A;  2RDP A;  2UXN A;  2V9K A;  3HKZ A;  1ZN2 A;  2I5U A;  4AYB A;  3OYI A;  2EK5 A;  2R5Y A;  3HKZ N;  2ZKZ A;  3OS1 A;  4HEA 2;  1TT5 B;  2L7M P;  1TWH J;  3PO2 J;  2RKH A;  4ITV A;  4M74 A;  4D0P A;  2A5Y B;  1E2X A;  1KU7 A;  3DTK A;  3HRT A;  3TP3 A;  4A0X A;  3A01 A;  5LHG A;  2I10 A;  4IO9 F;  5DUI A;  2XGX A;  1QZY A;  4K2E A;  5TRD A;  4A0Z A;  1F43 A;  3UR3 C;  3KZI C;  1VQM I;  2XRL A;  2R7X A;  4ZYA A;  3ZQI A;  5FKN A;  3I0T A;  2CG4 A;  2IGK A;  3BG6 A;  5CJ9 A;  4MQV A;  4PJ0 C;  3RSN A;  3FIW A;  3MN2 A;  4YEJ A;  5J1R A;  2D1V A;  1H89 C;  1OPC A;  3WHC A;  2DOA A;  1D0Z A;  4NUB A;  4M9X A;  2DPU A;  5FB2 A;  2KJB A;  4A3D J;  4LFU A;  4MQ9 F;  3VSL A;  3CF5 F;  3RDI A;  4OAY A;  2WY7 Q;  3L09 A;  3PIP F;  1K83 J;  3TO7 A;  1MMN A;  2PLY A;  1OKR A;  2L9N A;  3IRR A;  2GWR A;  4HV6 A;  3HUG A;  1FP2 A;  1ZRE A;  2V9V A;  4DYQ A;  2D45 A;  2QSH X;  3LMM A;  5A2Q K;  2EJR A;  1FYK A;  2DA4 A;  1S7A A;  4WWC A;  2YS9 A;  3VWB A;  1WPK A;  2F4O B;  2M8E A;  4PK4 A;  4B44 A;  4MEY F;  2P4W A;  2E1M B;  1XTA A;  1R23 A;  1W7P B;  2V6E A;  1TWA J;  4BH9 A;  1FBS A;  3QOE A;  3WU1 B;  1HDP A;  3JTG A;  5AON A;  4Y3O A;  1G2H A;  5GTH C;  2QBY B;  2H8R A;  1FBU A;  3GZ5 A;  1TQP A;  2DBB A;  3DKW A;  2MYS A;  4MFD A;  1I6H J;  4D1Q A;  4XLA A;  4BBS J;  1V3F A;  1YI2 I;  1SFO J;  2GLO A;  1Z91 A;  2E35 A;  4DYC A;  4IOA F;  3FKI J;  2RGV A;  2HDD A;  1IN5 A;  1ZRF A;  1HW1 A;  5K7Z A;  2JPB A;  3ZRG A;  3DXJ F;  1E3H A;  4D5F A;  2NNN A;  1QQI A;  2E34 A;  2Q2E A;  5LEJ A;  3WGG A;  4IRI A;  1P7I A;  2JA6 J;  2BYV E;  2HFH A;  1WI3 A;  1XDU A;  2VB6 A;  4HYE A;  5C4X J;  4XRS A;  3DU5 A;  3QAH A;  1X4P A;  5J4V A;  5HOO A;  1XDS A;  2HYJ A;  3OIP A;  1JT0 A;  5JR3 A;  5GPA A;  4ESJ A;  1U78 A;  2ELK A;  1FYM A;  5EG0 A;  5ILS A;  1P4X A;  1WJB A;  5J3L A;  3BC8 A;  1G3W A;  3MMY B;  3KEO A;  3ABL H;  4A0Y A;  2QUF A;  2QWW A;  2VQG A;  1TW3 A;  2K4B A;  5CVU A;  1PDN C;  1SVL A;  2BW3 A;  2UV1 A;  4V2F A;  5IOY A;  4WCG A;  2EPF A;  1FPQ A;  1DU0 A;  3ZN1 A;  2JA5 J;  1WFX A;  1PUF B;  2MD5 A;  2V26 A;  1A6I A;  4PSW A;  3KEY A;  3OWT A;  1SD5 A;  1KQ9 A;  3QU6 A;  2K3P A;  1GVJ A;  2OTL I;  4OIQ F;  2IGO A;  4NNJ A;  5LD2 C;  5IT9 K;  4I76 A;  4NQW A;  4CO8 A;  3JSP A;  4LIT A;  3OYL A;  2R7W A;  1WVR A;  4MLO A;  3F0C A;  3ZQ7 A;  2GXG A;  4IPA A;  4M3D A;  4MO7 A;  1X1C A;  2EZK A;  2DDB A;  1G3T A;  4UXN A;  4BE2 A;  4FCY A;  4XBF A;  5FRM A;  1FMW A;  4QLC U;  4WX9 A;  1LVK A;  1MMD A;  3KFW X;  1R5G A;  5K5O A;  3ZXS A;  1CF7 A;  4G6T B;  2ICW G;  2E7X A;  2P6T A;  3GEZ A;  3TDU C;  4LG0 A;  2LF8 A;  4UUT A;  4BYY A;  1XC5 A;  3OS0 A;  4EJO A;  3MKW B;  3LQR A;  2RRE A;  2XAS A;  5BOX A;  4I01 A;  1YW8 A;  4HF1 A;  5HLT A;  2ISY A;  1FP1 D;  2M0C A;  1WGX A;  3CDH A;  1Y6I A;  2CQK A;  1FIP A;  1ZH5 A;  5JLX A;  2VN2 A;  1RI7 A;  2NVQ J;  3W2A A;  3E97 A;  3T0Y A;  3W6J B;  2DMQ A;  3H5A A;  1SVO A;  2VQL A;  5E1Z B;  2XAG A;  3DCF A;  4OIP F;  4M6Y A;  4EJW A;  3GUD A;  3ML6 A;  2L54 A;  2R92 J;  4AD9 A;  4BY1 J;  4AIH A;  4LGW A;  3SDG A;  1Z3X A;  1Z7U A;  1TBX A;  3ABK H;  2IA2 A;  2ZSI B;  5M5Y J;  4JOM A;  4ZJZ A;  1V55 H;  4KN4 X;  3RKX A;  1H8A C;  1TTY A;  4G94 A;  3O8G A;  4BQN A;  3A1Y A;  1ON1 A;  5J1U A;  2CU7 A;  3ISP A;  4S0H B;  2IBD A;  4GYI A;  2R7T A;  2HDW A;  1J9I A;  2M4G A;  2TCT A;  2EB7 A;  2HTS A;  2OPT A;  5D5V B;  5LFA A;  2JA8 J;  5KVR A;  3COA C;  5DDG A;  2TRT A;  5A2Q Z;  1UB9 A;  2QKM B;  4G7Z F;  2ACJ A;  1XGM A;  1UEL B;  1R49 A;  4L0Z B;  3ZQF A;  1POG A;  4JX5 A;  5F27 A;  4GGG A;  3KYD B;  3FXL A;  1VQK I;  3U2R A;  1D5V A;  2GBY A;  1SFK A;  3NWT A;  1JJ6 C;  1BI3 A;  1WSU A;  1SAU A;  1T2K A;  1O4X A;  4WXC A;  1LQ1 A;  1E0E A;  4KIB A;  2DYR H;  3GFL A;  4BJ5 C;  3S17 J;  4RAG A;  4B47 A;  2LH9 A;  3HB9 A;  4XKV A;  5JVT A;  3SQN A;  4BQQ A;  3J7Y J;  3S2D J;  2EA4 A;  2JQ7 A;  1QZE A;  1AKH A;  2ZXI A;  3N4M A;  1J09 A;  3IP4 B;  3JAM K;  2FOK A;  3DLL F;  3OYF A;  3OR1 C;  1HDD C;  5E17 F;  3IH2 A;  3JW4 A;  1A5J A;  1QGP A;  4KFC A;  2VAS A;  2BY3 A;  2VXD A;  1RKW A;  3JRA A;  3DTE A;  3QU3 A;  4LD5 A;  3PM1 A;  4KN7 X;  4N9H A;  3U21 A;  2PFB A;  2R7S A;  2FF4 A;  2HVR A;  1SD6 A;  3N05 A;  4LJZ F;  1SMT A;  1E17 A;  2VKV A;  1Q1H A;  2R5Z B;  4HX7 A;  2XPU A;  1WJF A;  3T1B A;  2VC0 A;  3BLY A;  3FMR A;  4A3L J;  1ITY A;  2FEZ A;  2AQF A;  3CDL A;  3U9G A;  1BN5 A;  4ON0 A;  2VUM J;  2DFE A;  3LST A;  3LSP A;  3SEQ A;  1U6G A;  5F1R A;  2IS2 A;  2R7D A;  4IQJ A;  3BR2 A;  3MKY B;  1LE8 A;  1TL8 A;  2GM4 A;  2GZW A;  2W4S A;  3GWZ A;  4HPQ A;  5JI6 A;  5E3N A;  3RJP A;  2OJE D;  1TT0 A;  2BY1 A;  1S9H A;  2Q8K A;  2VBZ A;  2ZXW H;  3DLA A;  1ETK A;  2DO7 A;  3ECO A;  4C3H J;  2X1E A;  4XN0 A;  5JHU A;  5BPI A;  2KIU A;  2P7C B;  1ETV A;  5KHD A;  4L9J A;  4YII A;  1MSF C;  1ERD A;  3R60 A;  3W2W A;  1QRY A;  2F5V A;  2QKL B;  3IKV A;  1ETO A;  3T8T A;  1MDM A;  5J40 A;  1STZ A;  2X9D A;  3FHN A;  3D0S A;  1VFC A;  1HSJ A;  2VIX A;  3BZC A;  1EH8 A;  1FOX A;  1IN4 A;  5CVV A;  1ETW A;  1YIT I;  2UUZ A;  3R0A A;  2Z99 A;  3VEP A;  3NQO A;  1ZYR F;  2EFW A;  2V4J C;  2VPR A;  4PJM A;  2FNP A;  2Q0O A;  1YE9 A;  3U1D A;  5EGO A;  4AUX A;  4S05 A;  2NVT J;  4RAY A;  1EV7 A;  1Z1D A;  2HXI A;  1MD0 A;  4GFB A;  4Q4Z F;  1YTY A;  4EVI A;  1OYI A;  5E8I A;  2JTV A;  3V7R A;  3TKY A;  3F8F A;  2OZ6 A;  2BXY A;  4UVB A;  2EBI A;  3RPQ A;  1MW7 A;  2ZSH B;  5AIP A;  3EUH C;  3OYA A;  4XKC A;  4XOR A;  4BXU A;  2B63 J;  3IUO A;  2BE5 F;  5IP7 J;  3LFK A;  2IJL A;  5EEA A;  2PMZ A;  2LNB A;  3FZV A;  5FD6 A;  3HHG A;  4U7D A;  1W4M A;  4QSH A;  2PMZ N;  3BOQ A;  3IAS 2;  2HVS A;  5FLV A;  2O03 A;  1I1S A;  1X2N A;  1B72 A;  3SZP A;  2DAO A;  4BAC A;  3C2G A;  3CDI A;  2Z33 A;  4NHJ A;  2LBF A;  2MC4 A;  4XM3 A;  2UWM A;  5B5E C;  4HQE A;  3HL2 A;  3MCZ A;  2ZO4 A;  1GDT A;  4PUS A;  1Y0U A;  2DPD A;  2R93 J;  3VB2 A;  4UV9 A;  1HKS A;  3GVA A;  4KIS A;  3IRQ A;  2O5R A;  2LMD A;  4H0E A;  2B7E A;  5H6Q A;  3ZMV A;  3F8C A;  4A3J J;  1R00 A;  3GLL A;  5D6E A;  1KU3 A;  5AIQ A;  2HU9 A;  3E1S A;  5BPD A;  4BEH A;  3W3C A;  3HG9 A;  4XLN F;  2DT7 B;  3D5S C;  3JRH A;  4IRH A;  4KDP A;  3K1N A;  1SC7 A;  2MFZ A;  2VJJ A;  3ABM H;  4A6D A;  4I02 A;  1I3Q J;  1YYV A;  2Y0M A;  3TP0 A;  2DJI A;  2F6C A;  2HQ5 A;  1ZG1 A;  3GZ6 A;  3AKZ A;  4RGR A;  1IRZ A;  1FEX A;  2BVL A;  2D2W A;  3CME I;  4ASN A;  2K02 A;  4P5O A;  4AWX B;  3G2B A;  1Z67 A;  3J7A Y;  4WK8 F;  1ETX A;  3R0J A;  2O7O A;  4BDY A;  2HNH A;  5FFZ A;  4BAY A;  3P9K A;  2Y31 A;  1EJ9 A;  4X1E A;  1R22 A;  4MTE A;  1TWG J;  3PFY A;  4G9Y A;  3A03 A; 
#chains in the Genus database with same CATH homology
 1V54 H;  2EIM H;  5B1A H;  3ASO H;  2DYS H;  3AG1 H;  3WG7 H;  1OCO H;  1OCC H;  3AG3 H;  2EIL H;  2Y69 H;  2DYR H;  2ZXW H;  2EIN H;  3AG4 H;  5B3S H;  3ABM H;  3X2Q H;  5IY5 H;  1OCR H;  1OCZ H;  5B1B H;  3ABK H;  2OCC H;  3AG2 H;  2EIJ H;  3ABL H;  3ASN H;  1V55 H;  2EIK H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...