3ASNH

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3asnH00
2EINH 2EIJH 3WG7H 2DYRH 2DYSH 1OCRH 2ZXWH 1OCOH 1OCCH 2EIKH 3ASNH 5B1BH 1V55H 2Y69H 3X2QH 2EIMH 3AG3H 3ABKH 1OCZH 1V54H 3AG4H 5B3SH 5IY5H 3ASOH 2OCCH 3ABMH 5B1AH 3ABLH 3AG1H 2EILH 3AG2H
chains in the Genus database with same CATH superfamily
1MZBA 1X3UA 4Z2YA 4DQ2A 4JX4A 4OIRF 1RRJA 1QQIA 4C2MJ 1EKEA 1OQYA 3W6JB 3OYMA 3RZDJ 2GBYA 4MTDA 2DT7B 3K70C 5FLVA 4ZZDA 4HX4A 1ZQ3P 4D7MA 5M3MJ 2BY1A 2OQRA 4ZDLA 3FXLA 1RUNA 3RIRA 5HNFA 3DTIA 3V7SA 3JAMZ 3E6CC 1VFCA 3V4GA 4F52A 1U9NA 1OPCA 1O7FA 4XONA 5FLMJ 2FEZA 3EYYA 2HQ5A 4U87A 2LD5A 5TJJA 3GTMJ 4A5MA 4CCLA 1VTNC 5EZHA 4K2EA 4BNCA 3D5LA 2ZMEA 2HZDA 4FQGA 3WTWC 2VI6A 3OS2A 3CCEI 2AXLA 2IXSA 2EQRA 2NOJB 2DA3A 2DN0A 4JBAA 3ABKH 2ID6A 2VT2A 3HOXJ 3K6GA 4N9HA 2CV0A 2X6XA 2A3SA 3K4LA 4RAFA 3LAPA 1YTYA 5D8LB 1B59A 3BG7A 1Y8RB 2XGXA 2DJIA 5FROA 4A3CJ 2O8XA 1NH3A 2P4WA 3MZ8A 4N4OB 3HPGA 1JKOC 4DW6A 5EEAA 4XICA 2WAQA 3NWSA 4B3AA 3HOSA 3RTRA 4C3HJ 1APLC 2MFZA 3F3XA 3BJOA 2HWVA 2ELJA 1LVKA 1W5SA 2JUCA 3FZVA 2JVHA 2D2WA 5FRNA 4I6ZA 4HOBA 2VLAA 2OV7A 4A0YA 1MMNA 1MKMA 3E6BA 2CWEA 3S8PA 5GAGJ 2E60A 4BEHB 3SZPA 2LFBA 1G8XA 2PI0A 5L3EA 4KIGA 3KEYA 2CYYA 5ICFA 4KIFA 1Z1DA 5D5XB 2W25A 2DMPA 1QVUA 1WKMA 2K7LA 3DF8A 5KVRA 2OUMA 4JX6A 2K3PA 3PFIA 4XMYA 4Y4RA 4BL0B 4OOIA 3ERED 2E1CA 3DU6A 3K1NA 4H4KC 1GLNA 4BXFA 3KETA 2VE9A 1HKTA 1JI8A 4GRIA 1IO2A 2TRTA 4KFCA 3BCAA 4DOZA 1XDSA 4RB3C 1T08B 3CUQA 5IOYA 5C44J 3RZOJ 2V26A 3R0AA 1AKHB 2BEOA 1USTA 2QZ8A 1YIJI 3SJMA 5JLWA 1W36D 3ABUA 3AAFA 5ILUA 5FLXZ 2L0KA 4L9VA 5E8IA 3E6DA 2BW3A 2VJ4A 1TTYA 4UVCA 4CXFA 2G7HA 2BVLA 3LA3A 4Q4ZF 3A2KA 3PIPF 1P92A 1I27A 1QNTA 4C30A 4L9JA 1FYKA 1DDNA 4CGZA 2XPWA 2EFPA 2P5LC 3QODA 3H5AA 4HDUA 1W0UA 3ZP5A 2GXAA 4KISA 2R7TA 2IGMA 4G12A 2JRTA 1VNDA 1SMTA 2X6YA 2KLOA 3JRAA 2KP6A 3L2CA 2NVQJ 2JA8J 2X51A 2L9NA 5DCMB 3CMYA 1PYVA 5FB2A 1W7PA 2QLZA 2WY7Q 4LGWA 4B09A 2Z9OA 1ON2A 1PJRA 4KUMA 5JHFA 5L3FA 3JREA 2QUFA 3GEZA 3J81Z 4LG3A 1MNDA 1ZH5A 5DEQA 4XR6A 2BHZA 3A02A 3J7AY 2EWNA 4IHXA 4BEHA 5EJCA 4N4NB 3LSGA 3BT9A 4CCKA 3ROUA 3F9KA 5E1ZB 3KLOA 3RPQA 2OZ6A 5A2QK 3CJQB 2ELKA 4NQWA 2JPCA 4HF2A 1DPRA 2RKHA 2R93J 2DBBA 5HLHA 1B8IA 1G2HA 4HV6A 2HXIA 1U2WA 4E7HA 3HZJA 3HDDA 2CJJA 3QP5A 2MYSA 3KP4A 4UUSA 2M3AA 1FP1D 4GYGA 1JT6A 3HRUA 4W1UA 4HDVA 1IDZA 2PBIA 3CMEI 1VQ7I 3MEXA 4BACA 3F21A 1SFUA 2VB6A 2LYCA 1DGWY 2X6OA 2D5VA 3AFHA 2DMNA 3WHCA 3CUOA 3PJRA 2QM3A 1BI3A 3OOUA 1BI0A 3C1DA 3O8HA 2KIFA 3GTKJ 1HOMA 1QO0D 4CCOA 1UELB 3GZNB 2EINH 3WE3A 4BDZA 4PSXA 2R3SA 3HKZN 1K4SA 4PCQA 3P9IA 4RS8A 1XSDA 1JHHA 1SFOJ 1HLVA 1MMDA 2DO7A 3ASNH 1TW3A 4B47A 1IGNA 2X1EA 2JTVA 2RVCA 2P6SA 4XNFA 1U8BA 1WH7A 2BY3A 4RMNA 1U5TB 1X1BA 3PO3J 2PMHA 2KPMA 1R5GA 2A5WA 2DA4A 1LPQA 2IVMA 2WA0A 4AIHA 2V1NA 2XKPA 4BU2A 5DDGA 2Y0SA 1X58A 3MQ0A 3PFYA 3CUQC 1YLFA 1TNTA 2VKVA 1ZLJA 1MJ9A 4G6TB 5E20A 2ECBA 1D3YA 5K7ZA 2E36A 1UHSA 3AG3H 2DDBA 4UV8A 3CCVI 3HOVJ 2QBYB 3TOAA 2V7FA 1OYYA 1SVOA 2QBYA 2F5FA 1D1CA 2EFQA 1YQAA 3CF2A 4YRVA 4IHVA 2LTPA 5DYMA 1UJ8A 3A1YA 4HPQA 2MD5A 3O3KA 2JT1A 3B02A 3W2WA 2IPQX 2XASA 2JQ7A 4FT8A 3GFIA 5L3GA 3HSEA 2O5RA 3K2AA 4AM3A 3FXOA 4CO8A 3BG5A 3W6KB 3J7AO 2ZO4A 1LB2A 2V1XA 2HZTA 2KRCA 5FJ8J 3WGHA 5J4YA 3JRIA 1WJCA 1WI9A 5FFXA 4IKFA 1I6XA 1YW9A 2ZKZA 5E1XA 2J5PA 3Q9VA 2K3FA 5GTIC 3KYLA 4F91B 1X3WB 3CC2I 4ENNA 2H1LA 2R7OA 4X1EA 2GOXB 2HQAA 1E3HA 2X9DA 3IH2A 1FOWA 4F7ZA 4CZZA 4IRHA 1RC9A 3COAC 1FY7A 4ON0A 4BE1A 4P96A 4J19A 1YJ9I 3RYRA 2LK2A 2YUSA 3LA7A 3ULQB 3DCFA 4R8HA 4MFEA 1H88C 3IH3A 2O8KA 3HOZJ 3CDHA 1A5JA 3SZGA 1XTAA 2ZXHA 2K9NA 1PP8F 4M6XA 3OS0A 2YSRA 2P5VA 3H3VK 2TDXA 4Z6YA 1TWGJ 2Z3YA 3LFKA 2BZTA 1JKRC 5IT9Z 5LHGA 2H6BA 3KZZA 4R1HA 3P9CA 4HNTA 1T38A 1HDPA 1O3SA 1JKQC 1DP3A 4YEJA 1GHCA 1I1SA 3BP8A 1E0EA 1F36A 3REOA 3GZ5A 1JGSA 1MJBA 1Y1VJ 3L7WA 1F1ZA 2IJLA 4IVNA 1RNLA 3EETA 5D5WB 4PFPA 2CW8A 5FKLA 2LKPA 3KP7A 3VFZA 2K40A 3DKWA 2XRNA 5BS6A 5D5VB 2VN2A 3VOEA 2X1DA 3WTTC 1IRZA 2VXZA 5HVQC 3L1PA 2OJED 3F22A 1ZTRA 3OYGA 1AHDP 5E1WA 3SDGA 1YX3A 1Z6RA 1FJLA 3FM3A 2F4OB 3HGGA 1YW7A 1BW5A 4MEXF 3BG6A 2E1OA 1FZPB 5F08A 2R7DA 4HF1A 2XV4S 2O3FA 3CF5F 1BC7C 1YHQI 2M45A 3VDXA 4BY7J 2WAFA 2DA5A 4QSHA 2Y48A 3E7LA 1RETA 2XAGA 2OF7A 3OR1C 5EEHA 2NVUB 1VQ8I 3OYFA 4LLLA 2M34A 1TWCJ 2FSWA 1L0OC 4MNUA 1VQPI 1I1GA 3TBIA 4M3EA 2R5ZB 4BAYA 4IX7A 2KRHA 3R0JA 1SMYF 4B43A 3GVAA 4IHTA 2HOTA 3CZ6A 4EQQA 3H5NA 2R7SA 2BW3B 1BW6A 3PM1A 5ICEA 5E3NA 4O3MA 5FRMA 1J2XA 2PQ8A 5DD4A 3H9GA 3M8FA 1YRNB 3CQZJ 1T0FA 2OPTA 3CESA 4ABZA 5CVJA 3V8LA 1G3WA 2W85A 3AG2H 1F5TA 4AD9A 3FIWA 1XSVA 1HKSA 3IKVA 2F5CA 2DLLA 1HC8A 3ERMA 1R1UA 3JRGA 5LGNA 3PQJA 2DA2A 5FD6A 5J6XA 5HS7A 2COBA 1MSEC 1RKTA 1HQCA 4I2OA 3WTVC 3DKYA 3N05A 4YG2F 3NAUA 2V4JC 2FOKA 2XROA 2CG4A 3K4JA 1U0JA 5H6RA 2IS1A 2M4GA 2WAEA 5H20A 3Q0VA 4XOTA 1DUXC 1MIJA 3ZMZA 1AKHA 3I4MJ 4PDKA 4RGRA 2V9KA 5LLQA 1IZ1A 2MLKA 5IYCJ 4F92B 2LY9A 3PL8A 5LEKA 4L18B 1TT5B 3IWZA 3TO7A 3TP3A 3TW6A 2MABA 4H0EA 2KMUA 3DXJF 3SZTA 4CICA 3J7ZI 1IUYA 4E70A 3RQ4A 1EF4A 3DEEA 2ZCWA 2W82A 4C9YA 2F48A 1IN7A 5DTDA 1WRJA 3QU3A 4LK1F 3EDPA 3L2UA 3D5SC 1RR8C 3CC4I 3L2QA 3U1DA 5J1YA 3SYTA 3DKXA 4XN3A 1F43A 2NS8A 4NC8A 3BLYA 4KJZA 4ESJA 4UVBA 4NQWB 4XLPF 2W24A 2Y0MA 3LQQA 3Q5FA 1MDMA 4C2TA 4M3FA 2CMPA 2F4MB 2AQEA 3EUKL 2E71A 3DWLE 1P7JA 3L2WA 1ZGJA 4XBFA 4I0AA 4BHBA 3RKWA 1XC5A 2NNYA 2DDAA 3KP5A 2BYVE 2JPBA 2DAOA 1QPIA 2LF8A 3F72A 2VOPA 3UKGA 4FHTA 3W2VA 1XDUA 4N9IA 3HGYA 3ZMVA 3WODF 2AS5F 2P7VB 3VSKA 3BPXA 2XB0X 3V42A 1BL0A 4J00A 4IQ4A 3GTLJ 1E3PA 2H94A 3FBNB 4D1QA 4OWRB 2K9QA 1XPXA 1Z05A 2LC2A 2Y9YA 3OOPA 4KT6A 2Q8KA 1IF1A 1S72I 1QPMA 4Y7NJ 4RM3A 2MD0A 4A3LJ 1NG6A 1VQKI 3PO2J 4M6YA 2CQ7A 4M3BA 2DFFA 4A3KJ 4ZYEA 5FO5A 4UVAA 2AQFA 1BI1A 5BNGA 3CDLA 2UXXA 1P6RA 1UFMA 4HLYA 3VWBA 3G71I 3KYDB 5JI6A 2ACJA 3V8JA 4RBOA 2JJ7A 3FXKA 2RC4A 3DLLF 2CO5A 4NC6A 4UUVA 2ZFWA 1WI3A 1B9MA 4OIOF 2I8DA 3HJEA 3TO9A 2PMUA 4DZPA 3CUQB 4E7SA 3A03A 2ZXIA 3FM5A 2DU9A 4YFNF 2XSDC 4A3JJ 3S1NJ 1ZR4A 1JHFA 4O5VA 2FX0A 2IA2A 4HNVA 3O2PE 1CF7A 2HS5A 4Y15A 2XAJA 1YITI 2CQNA 2Z33A 4L5JA 4ZTFA 2E2HJ 4ZDOA 5CVUA 4XRSG 3W2AA 4KDPA 1J5YA 5H2FC 1EJ9A 2XAQA 3KP2A 2IA1A 1VI0A 3K4BA 4MQVA 4IPAA 4PJLA 2GWRA 2K85A 2CV1A 2FBIA 1Z7LA 2E2JJ 2M8EA 2QQAA 3LOCA 3AL0B 4I01A 4G7OF 3MN2A 5F64A 3DTEA 5FKNA 5TGTA 1Y6IA 4RB0A 1LKXA 1MMGA 3ZQ7A 3X2QH 3CLQA 5CVRA 1KYWA 3RPUA 2YU9J 1HDDC 2IAIA 4XLAA 2Z1DA 4KNYA 1FBSA 2HKOA 3CP2A 4MTEA 4EV0A 5TRDA 2P0WA 4A3GJ 2LY1A 3C18A 1B72A 3S17J 1QGPA 2QWWA 4XKCA 1BN5A 2R7UA 2F5VA 4RB2C 3ZQFA 3S3OA 3OIQA 2CW0F 1XMKA 1XS9A 1MDMB 5FGMA 4A6EA 2DTZA 3M4OJ 4MLOA 2OAZA 1BR4A 5TISC 1UHMA 1ULYA 4DGWB 3KYCB 3U2RA 4QTRA 4A3BJ 1D0YA 4WF2A 1XD7A 3OMYA 3SEZA 2GIVA 4UV9A 2B63J 3A4CA 4AIDA 3W3CA 4MHGA 4KIBA 2CUZA 2QKLB 1WCMJ 2KISA 3Q0UA 1FWZA 3K4NA 3IAM2 2O03A 4OMZA 4A6DA 5EG0A 2HOAA 3ZXSA 1B9NA 1Z0XA 2FOWA 1LE8B 1KQ0A 2NNNA 1KONA 2LY2A 2VT3A 3IP4B 4XOPA 4D5CA 1ETQA 3OYCA 4ANJA 1TBXA 3ZPLA 3F0CA 1ZG5A 4IJAA 1OFCX 3BZ6A 1B6AA 2FF4A 1AU7A 1MBEA 3LMMA 4ZYHA 2EFOA 5IT9K 3PSFA 1T8IA 4ENJA 1WJ5A 2PJRA 4HBLA 4Q47A 1MMAA 2WC2A 1YX5A 2BXYA 2RV8A 2VPRA 1TL8A 4CYDA 2PFBA 2NVYJ 3K7AJ 2EV5A 3O8GA 1TNSA 1IV6A 1X1CA 4BXUA 1Z3YA 3O6BB 2COMA 2HQRA 1W7PD 2QVOA 1CF7B 4HNUA 2R5YA 2H6CA 2GA1A 4IHYA 2R92J 1ODDA 4OINF 3S3MA 1HW2A 1Z21A 4MEYF 3OYBA 3SDBA 1YS7A 2ZJQF 3I4NJ 2HKXA 2IGNA 4UY8I 3S14J 1ETXA 2CUFA 3G6EI 3S1MJ 1O4XA 3CCQI 4ZYGA 2W84A 3HL2A 1KQ9A 3IC7A 5IOZA 4IHSA 1GVJA 4Q5SF 3PNVA 2Z16A 4JOMA 3ZQHA 4U7BA 1JUPA 3R4KA 3CCMI 3BZCA 3WTXC 5EZGA 1IXCA 3BDDA 3VYUB 1OCPA 2DMQA 2PEXA 3KIOA 3OYKA 2KJBA 3GBGA 2P7CB 3Q0WA 2V1DA 2VL8A 1N77A 2YU3A 1BR1A 3UR3C 2OA4A 3R6SA 2EZLA 4EJUA 2UXNA 3K1MA 2MH9A 3K4MA 1IW7F 3HTSB 2CSOA 3V8KA 4LIVA 1S3JA 5F6FA 2JSPA 1BOAA 2V6EA 2CH0A 5CYVA 4QPQA 2LNBA 5CLSA 3HUGA 4LD5A 5E3MA 1HKQA 2MLGA 1T33A 4ASNA 1E3OC 3EYIA 2HPMA 3B73A 2Y31A 4ZJZA 4FASD 2DTRA 1H89C 2G0EA 1R7JA 2VODA 2GA2A 3FMSA 3MVPA 2VQHA 4IOCF 1UMQA 1D8KA 1JJ6C 3QOPA 2DI3A 2EV6A 3OWTA 1ZREA 1K61A 3E97A 1G3YA 1G4DA 1U6GA 2QQBA 3WU0A 2EB7A 4DBRA 2EFWA 1LFBA 2J5OA 3KP3A 1OYIA 3MWMA 4HYEA 4HSTA 3FXUA 4EJTA 4G94A 3CDIA 4HZFA 2R7RA 3DV8A 1M1EB 1QZZA 2ME6A 4II3A 1BA5A 2OD5A 1ERDA 4KT5C 4B44A 3MMYB 3C7JA 4OIQF 1Z7UA 3KX2A 2QQ9A 3IAS2 2E7XA 3GX4X 1MNMC 2L02A 1POGA 2YS9A 1EH7A 2KIUA 2A68F 2E5ZA 4AYBN 3ABTA 4HW0A 2CRGA 3DPTA 1Z67A 3RI4A 2M30A 1QHHD 3TKYA 3I9V2 1YS6A 1ZELA 5EGOB 1NK2P 4WK8F 3OV8A 1W0TA 3ZMUA 2EILH 4HV5A 1T56A 4PFOA 4EATA 5CJ9A 5L3CA 3KLNA 1WQ2A 1KU3A 4ENMA 1TP4A 2KT0A 2IBDA 3PNYA 1KA8A 2DODA 2EV0A 3FMQA 1V55H 4C3IJ 4A12A 2LREA 4YFKF 1IRFA 3LSRA 1HCRA 2W1OA 2KZVA 3LQRA 4L9NA 4JX5A 4HQEA 1FTTA 3MFKA 1MBGA 2ESNA 1HF0A 4KN4X 4PJNA 4HSRA 5FLXK 2ZBKA 3RKXA 4ZH4F 5F0HA 1MBFA 1OYWA 4M3GA 3NEUA 4PK4A 1CGPA 2GAUA 1A6IA 1TWHJ 2KL4A 2WB1N 4I7HA 5FFZA 3A01B 1KU9A 1LDKB 1OLTA 4TV7A 5B5EC 1K4TA 2VXDA 4L0ZB 1X3ZB 2JSCA 4XKBA 3TOBA 4EM1A 2W00A 3C3WA 3CO7C 2PMZA 2BY0A 2LDUA 1O3TA 5JHUA 3GTPJ 1KGSA 3FXRA 2XIGA 1SFKA 1D1BA 1X1PA 3I4PA 2H09A 4EM2A 1LQ1A 1B1BA 3BJAA 4BKXA 5IPAA 3H3ZA 2ID3A 1W4MA 2JVGA 3M1EA 1JXSA 2DW4A 2NYXA 2ETHA 3SFZA 2LR8A 3WHBA 2XPUA 2X0LA 5E3OA 2X85A 1ZRDA 2WV0A 3S15J 2XGEA 4QIWN 1J7KA 1R58A 1ZK8A 2A6EF 4PJ0C 4XLEA 5D6FA 5LRRA 2OCEA 4NHJA 5KAIC 1HA8A 3ZMDA 1ZYRF 2ISZA 3FK7A 2DOAA 2K86A 3AG4H 4XIDA 1E17A 4BS9A 2MC4A 1ZGWA 2DA6A 2VIXA 4M74A 2L9VA 5DUIA 4EGZA 2VUMJ 2P81A 1UZCA 1R1VA 2F2EA 3HSFA 3I58A 4AC0A 2ECCA 1ZARA 5HDGA 3VYSB 5LBQA 1TT0A 1SVLA 1GDTA 3BWGA 2HGCA 5J8FA 3BY6A 2R7FA 2EBIA 4NC7A 1MW7A 2ZB9A 2M0MA 4G7HF 1ITYA 3F8NA 5D8KB 3FHZA 2LBFA 1ZRFA 2LSOA 1OCTC 1D0XA 1MJAA 4CYCB 3QQAA 3QPTA 4LG0B 4NBQA 1FT9A 4KA4A 5FD5A 3ML6A 4IL6C 1VZ0A 4EGYA 1WFXA 1YFHA 5J1UA 3SQNA 5E79C 1LEAA 3E0JB 3HOWJ 1R00A 4E4HA 1R9TJ 3M8EA 1S7EA 1D0ZA 1N75A 1WVRA 3CCUI 2JK3A 2DMTA 2XB5A 4HG2A 3DBRB 5LGUA 2LBFB 2BHYA 4B3XA 3K2ZA 2YR2A 2AXTC 4MIMA 5IP6A 2GZWA 2AO9A 1FOXA 2LH9A 2LKXA 3KCCA 3K4CA 1R5ID 2Y69H 4P5OA 3ZCOA 4UNOA 3ZQGA 1V3FA 3RKQA 2M2EA 5D5UB 3R61A 4QWQA 2XUBA 3HHHA 5EEGA 4EVIA 4X6AJ 5GP9A 4IF4A 5HLGA 1H8AC 2DK5A 5LHIA 4UXNA 3BG9A 3CD6I 1I6HJ 4HRIA 1KQ8A 1VQ5I 3OL4A 1MSFC 4AIKA 5C3EJ 3LSTA 1S7AA 2D45A 4UB8C 4DYRA 1DPUA 4UUSB 1AWCA 2K27A 2FA5A 1EH8A 1IN4A 2VQLA 2OZUA 1X19A 4WXCA 1OMIA 4EJWA 3BC8A 2IGOA 5AIPA 1PUFA 4LJZF 1GUUA 2HPIA 2X6WA 5E17F 3G2BA 4KICA 1CQTA 4LLGF 3BR0A 4M73A 2K9LA 4JYKA 3IHUA 3H0GJ 4RGXA 1ENHA 9ANTA 4XRMA 4BGDA 4HF0A 1TZLA 1X4PA 4BJ5C 3IRQA 4KMUX 5CKTA 2MGQA 1G3TA 1OCOH 4AVPA 1OISA 1P7IA 2E1MB 1I5ZA 2JA2A 5J47A 4BQAA 3R60A 5K7FA 4GXOA 4JQFA 4XLFA 4QPOA 5KNLA 2RQQA 5F0FA 2WB1A 2ZXJA 3LSJA 1BC8C 3FX3A 3H1CA 1R4NB 5K5OA 4D0PA 2BVMA 3LSPA 1YO5C 1DU6A 3AKZA 3C2GA 5C4XJ 1IV8A 4Y3OA 1EV7A 5J4VA 2L2OA 2O6GE 1LDJA 2F6CA 3RDIA 4ENKA 4NNJA 4RDUA 1RI7A 5IP7J 4XM3A 2XKOA 3A0HC 1DQUA 2K9MA 1R36A 3I55I 3QRFF 3MKZA 1REPC 3CCJI 2DJNA 1JTXA 5E8GA 3T0YA 2DCEA 3V7CA 2IP2A 1MNEA 2D1HA 1D5YA 3HM5A 2JN6A 2ZNYA 2CFOA 3HOTA 5ICCA 3OYDA 1T2KA 3TP0A 3OYJA 3GLLA 3EUAA 3ZQQA 1A6QA 5D4SA 4E7KA 4D7NA 1O3QA 1DU0A 4QLCU 3RYPA 3GTGJ 2KIQA 1IC8A 2KJCA 1L3LA 3JRDA 4OIPF 2RGVA 2XAFA 3A01A 2Y75A 5K7HA 1FMVA 3H3UA 2CGPA 4A2UA 1XCBA 2BY2A 2I10A 4A69C 4LMYA 2G9WA 2FUG2 4S05A 2NRAC 5HDNA 2XRLA 2L54A 1UAAA 2L9RA 5F1RA 1TWFJ 3NQOA 3HYIA 4BQQA 2BE5F 1XGSA 2CU7A 2Y9ZA 3OIOA 4GYIA 4LB5A 3WTSC 1ZKGA 3WE2A 4RGSA 2P6TA 1H0MA 5EG0B 2HFHA 4XRSA 4U7DA 4IOAF 1O7LA 4IEJA 4XLCA 1RR7A 3FXQA 1QU3A 1IDYA 3RCOA 2CS3A 2EIKH 1V5FA 1YI2I 1FIAA 1JGGA 3L9FA 2PMZN 1KU7A 2ZMEC 1X1DA 3LL7A 3H35A 4BYYA 2BXZA 2IEKA 3KP6A 4L0YB 2DMUA 2XGDA 4YIRX 1SEUA 2R7WA 4ITVA 1OR7A 3DBLB 4YIFA 3E5QA 2VBWA 2IRFG 3HOYJ 1H9GA 2LMDA 4IZZA 1J59A 4A0ZA 2A6TA 3IRRA 3HRTA 2RN7A 3F6VA 2IT0A 2HXOA 2M1BA 1XCVA 1O3RA 3DLAA 3QAHA 1U8RA 2VONA 3F8MA 5KCMA 4YELA 3J7YJ 1MBHA 3S2DJ 1T6SA 1ETYA 2HDWA 2XGCA 3PSIA 4U88A 4AVZA 4HLXA 5HOOA 2ZJPF 5IYBJ 2E35A 4I0BA 1XMXA 1R4MB 3ZR8X 1ZG1A 2GXGA 1QZEA 5KK1A 5K5RA 4G8XA 1SANA 4R79A 3HC7A 2DYSH 4M9SA 5HS8A 4B48A 2O61A 4A5NA 1OKRA 3AL0C 4RLFA 1F4KA 5HLIA 2R7ZJ 3QYFA 2X4HA 4S04A 1FSEA 4II2A 1XGOA 4OU0A 3CLOA 4G6DA 3H92A 4F93B 3OYAA 2CFXA 4PZJA 2KFDA 4CCNA 3CJTB 3WU1B 3CMAI 4XLNF 3MKWB 2IS2A 2R7VA 5DM7F 2DPDA 3BPVA 4Y13A 3WU2C 2R4GA 3EPZA 3GF2A 2BV6A 3JRHA 1FTZA 4Y33A 2DQLA 3FXMA 3OSFA 3DEWA 2Q2EA 1DP7P 3BR6A 2JZYA 1SAUA 4FE4A 5FKMA 5JFRA 3I3LA 2M7AA 5CVIA 2R5YB 1A04A 4ZYAA 2XDVA 4E7IA 1KU2A 2WV1A 2L7KA 4LITA 4MQ9F 2JA5J 2R7QA 1PP7U 1XB4A 2VC1A 4BQNA 5K5QA 1SD4A 2OCCH 2VQGA 4A3FJ 1SC7A 1JTYA 1SFEA 2DFHA 1FIPA 4G7ZF 3FBIB 2YPRA 3DQVC 5HS9A 3CCRI 4FETA 2VPLA 3GMEA 3FHNA 1G59A 1JJ8C 2WY8Q 5EF6A 1K6OA 4B1RA 1XG1A 2GXBA 5J3LA 2QF7A 4L9TA 2HTSA 2MG4A 1VQ6I 3EQLF 1WZ2A 5BPIA 2M7BA 5ILVA 5LFAA 4WX9A 4J01A 3DU5A 2B0LA 2QSGX 2HOEA 1GXQA 3HEFA 4KITB 2JRMA 3EUHC 3IWFA 1QZYA 3ZQLA 3ESWB 3PUFA 3KPHA 2W4SA 2E19A 3OY9A 2PN6A 1V4RA 2IS4A 4BE2A 3LFUA 3F6OA 4Q48A 4KYWA 1E2XA 1XSXA 5AIQA 1Z6TA 3RJPA 1V54H 2TCTA 4EM0B 2H27A 2IW5A 2Y2ZA 1QHGA 4JP0A 5M5WJ 6PAXA 4WXDA 3CCSI 2CQXA 4KMFA 3BZKA 3JTHA 1SD5A 4I02A 1G6NA 1MBJA 2OTLI 4N0BA 2WTEA 1J9IA 3JSOA 2A61A 3KE2A 3CMMA 3OR2C 2FQ3A 2Q1ZB 3MZHA 1RUOA 2Y30A 4EJOA 3L2RA 1Q1VA 2HTJA 1YE9A 3FK6A 1WWXA 1EA3A 1ZRCA 1S29A 2RREA 1PDNC 1HSTA 1PUEE 3MZYA 3MAJA 3TO6A 4FTHA 1JUSA 1STZA 4GO1A 4ZZLA 1X2NA 4I99C 5CQGA 2STTA 3GFLA 1LDDA 1RIOH 4LFUA 2OC6A 1OCRH 2V9PA 4WWCA 2BGCA 1U78A 5EDNA 4RB1A 2B7EA 1IXSB 4CCJA 3FXJA 4CDGA 3CCLI 2HOSA 3WTYC 1W7PB 2DT5A 3RQIA 3P9KA 2QSFX 4BBRJ 1S9HA 3GW2A 3FF5A 3H9JA 3I5UA 2ZNZA 3HB9A 1VQLI 1P4AA 3QOEA 3TEDA 2QENA 2PJRB 2A05A 2KRFA 1OJLA 2ZJ2A 2Q2EB 1IAWA 3I64A 5B1BH 2ZFUA 1OR7C 2R0QC 1UB9A 1FC3A 1YJNI 3JAMK 1VQOI 2HYFA 2L5QA 3GO5A 1WSUA 1XN7A 3DP7A 3TW7A 4CUGA 2O7OA 3CC7I 4I09A 4V19K 3B6CA 1BIAA 1HW1A 4CH7A 1TLHB 1TW2A 4CA0A 2LKSA 5DM6F 2HVRA 3KEQA 2Z5UA 1BBYA 2E5NA 2XSJC 1RPWA 2XF7A 2ME0A 1ETVA 3W6VA 3BOQA 4I98B 2Q0OA 2WAQN 3MKYB 4BHCA 5IYDJ 1FSHA 3M3YJ 4P9UA 3WG7H 1VF9A 1LE8A 2R5ZA 2VBZA 1XX5A 3M9AA 2A5YB 3WG9A 4Y17A 1MD0A 1SD7A 2K02A 3OSGA 2P8TA 4BH9A 3PUBA 4BHPA 3T8TA 2BOLA 2DFEA 3I71A 4RAYA 3CO6C 3PQKA 2GQQA 5LEJA 3S1QJ 2C6YA 1Y8QB 2VQCA 4B4CA 4AYBA 5GAHJ 3ABMH 2L7MP 1IN5A 3H0DA 1ETKA 4BDYA 1Y39A 2LVSA 1NTCA 4HX8A 3JR9A 1LNWA 2FD5A 5ILSA 5HODA 2M87A 2ZC2A 2DFIA 5J40A 3GTJJ 2ISYA 3OYHA 5D6EA 3PNTA 1OCCH 2CW7A 2O0YA 4GDFA 2CUJA 4ZDPA 3CJNA 2ZSHB 3IL2A 4YFXF 3PIOF 2CUEA 4PGHA 1MGTA 3HXLA 5HDKA 4CSWA 5CPRB 1T95A 2RAEA 3I53A 3QPSA 4DYCA 1FPQA 3D5RC 1ZAOA 4RAGA 3WGGA 2DK8A 3ZGKA 3HTUA 1IXRC 3Q9SA 4XQFA 2X48A 3ZN1A 4XRFA 1KZHA 3OL3A 2ADUA 3KEOA 2A07F 4XORA 4MO7A 1J0RA 4C3JJ 2UV1A 3JRFA 1N25A 4UB6C 2LG4A 2M8GX 4LB6B 1ETWA 3I0TA 4DBQA 2F5DA 1WJDA 1J75A 2CQKA 1BJZA 3BG3A 1AA7A 2EIMH 3GLXA 5AONA 1X1AA 5M5XJ 5JVTA 2DA7A 2NVXJ 2L7FP 5GAEJ 4ZC3A 3U21A 1S8NA 3VYTB 3OS1A 1ZR2A 4G9YA 1YW8A 4XLHA 1P4WA 2NS0A 1FMWA 3CJRB 5GTHC 5FKOA 1P2FA 2BBYA 3GUDA 3LWFA 3P7NA 2DXIA 4ESFA 1P4XA 3H36A 2LOOA 4CZCA 5J1RA 4E7JA 2H1KA 3OYEA 3A0BC 2LF7A 2LP0A 4FE7A 3WGIA 5JVGF 3SXYA 4M9XA 1V5GA 1PUFB 1DGRM 2EJRA 4M3DA 4XSZF 2M0CA 2ESHA 2FBKA 4OAZA 1EH6A 4BY1J 2FQ4A 2RNJA 2GOMA 2FBHA 4XK4A 3CP8A 5LD2C 4D5FA 1R1TA 3E5UA 2L9SA 4D9JA 2XPVA 4I76A 2HNHA 3LSMA 5JLXA 2GIZA 4AUXA 3FWEA 1LFPA 4EEFG 3OYLA 3S93A 1TQIA 1SVMA 1I3AA 5C4JJ 3RKYA 4WXHA 2X1CA 4DYQA 1FBUA 1SFXA 4BBSJ 3HKZA 2UUZA 3F8CA 1X4OA 1XGMA 3GFMA 2L7ZA 2QSHX 2VKHA 1K78A 1R22A 1HXDA 5EGOA 1IRGA 2WWYA 3AG1H 3M8JA 2FMYA 2PX9A 1D1AA 3KZYA 4FISA 4ETSA 4PUSA 1S6LA 1Y56A 3CCYA 4LK0F 4XKWA 1JT0A 4NDLA 2ZXWH 4IXAA 2L4MA 4FX0A 4IO9F 2HVQA 5B3SH 1VQMI 5M5YJ 3ASOH 3TDUC 5HLTA 3HOUJ 2JUGA 2W48A 3DPLC 1IUFA 2Z2SB 3K10A 1TWAJ 5M3FJ 1T39A 1JKPC 3BCBA 1U5TC 1MH4A 2K9SA 5B1AH 2ZSIB 2EA4A 4W97A 5LGTA 4CCMA 4IRGA 5LRSA 1C0WA 1YOVB 1GXPA 5F1JA 5B66C 3NWTA 4A3IJ 2HDDA 5BPDA 3HHGA 1VQ9I 3QWLA 2NOGA 1YYVA 1K7AA 5CVVA 5EYRA 1U3EM 1IRXA 3ECOA 3SEQA 3JRBA 4BE0A 4LG0A 3HBLA 2NXNB 1HW5A 2R7XA 3FKIJ 1ETOA 2JA7J 1KYZA 2L4AA 4LLNA 3H5RA 3D1NI 4ESBA 5LHHA 2CQQA 4HAMA 2GLOA 2VOOA 4IQJA 2DYRH 2KHMA 2K4JA 2Z99A 1BOBA 1WHUA 2JA6J 3F23A 1FP2A 3IUOA 4BQOA 2I5UA 4O6JA 1OCZH 1IJWC 3N4MA 1FYMA 5F27A 5L3BA 1TQMA 2IS6A 1R6RA 3LSIA 2HI3A 1HSJA 1V5EA 2VKEA 5F04A 2IA0A 2DT6A 3G73A 3F8FA 1FOYA 3LAJA 2JMWA 3JTGA 4ZYDA 4YIIA 4ZTJA 1FBQA 2VJJA 2NAZA 3E5XA 4KN7X 3ZQIA 3U1KA 3BQZA 1GV2A 4A3EJ 1T98A 3G1MA 4HX7A 3ONQA 4RLQA 2M4KA 3RSNA 3K1PA 5GPAA 1F9NA 3BQYA 3U9GA 4PJMA 2QQ8A 3N97A 5D4RA 2L3DA 2MW8A 4UUTA 2DQRA 2G7UA 1YRNA 1FX7A 2KQRA 3JCUC 3HIFA 3K4KA 3T8RA 4MFDA 5GADJ 2D1VA 1X2MA 2HVSA 4A0XA 2Y0SN 3TDZC 1JUMA 1XGNA 4LIUA 2EZKA 4UHTA 3WTUC 1R71A 1O57A 3GXOA 3S16J 1XMAA 1IN6A 1NHAA 4L5EA 3ZRGA 1QA6A 1S5LC 2EK5A 3LA2A 5E3LA 1I3QJ 2V79A 2RNGA 1R23A 5DV5A 2JWTA 4A3DJ 3VYRB 3BJ6A 1UCRA 1MBKA 3KZIC 1Y1WJ 4PJJA 1T0FC 1FNNA 3M07A 2VJ5A 4MGRA 5E18F 4P9FA 5BMZA 2XC7A 1GV5A 3MD2A 4DNCA 1WGXA 2XVCA 5ERIA 3ECHA 1GVDA 3L09A 3SFIA 2LRDA 2E1NA 4RM2A 1YIOA 2YX4A 2GM4A 1W5CC 3F8BA 4M72A 4OAYA 2M9HA 4NUBA 3HRSA 2XHKA 2H8WA 3FDYA 4LOCA 1Z77A 5K1YA 1B8IB 3G3ZA 1A31A 2QKMB 1TQPA 3DTKA 4BXXJ 1GT0C 1W36C 4GGGA 1ONVA 1ZGAA 2A6HF 1QVTA 4P55A 5CQEA 2VKDA 3I59A 1K6YA 1FEXA 1WJAA 1ZHFA 3TQNA 3OYIA 3K69A 2F4IA 4M9ZA 1U5TA 1S7OA 1BI2A 4RAZA 1W1WE 1JE8A 1W5TA 1YG2A 3QPLA 5BOXA 2XF6A 2B9SA 4AU7A 2FNPA 1B72B 2M5WA 4GCVA 4GFBA 1Y0UA 2FXAA 1ZLKA 1UHWA 3IH4A 3OYNA 1WJEA 2FE3A 5DCMA 2MBFA 2HQNA 2VASA 3VB2A 3ELKA 3T1BA 5DCFA 2P5KA 5BQTA 1BJAA 4M6VA 4F3QA 1WH5A 3DPUA 4X0GA 4A3MJ 1ACIA 4OMYA 3I59B 1P9QC 2EZIA 1IN8A 5IY5H 5A2QZ 1VQ4I 4S0HB 3QYEA 4P1WA 3TGNA 4E7LA 1K78B 3BR1A 1QBJA 1PVEA 3E3VA 3QPHA 1LEBA 3K0LA 3FKJA 3QYBA 2E2IJ 3GTOJ 1WJBA 3JW4A 3M7GA 2ZMEB 2IGKA 2FU4A 2E34A 2EFNA 3BTLA 2XF5A 2ELHA 2K4BA 3S2HJ 3GYHX 1WPKA 2HR3A 2MH2A 3E6MA 2A69F 4XN0A 4PGGA 4CYCA 2HYJA 2NS7A 2E1MC 2EH3A 4E6KG 2V1UA 4NB5A 1UG0A 3QU6A 3L2VA 1YJWI 4FX4A 1MMSA 4FCYA 1NK3P 4IHWA 3HUGB 3NARA 2WADA 2DOEA 3NRVA 4BUPA 5IT3A 2ZJRF 3V7RA 3J80Z 5H6QA 1BIBA 1QRYA 1Z9CA 2CV2A 3DEUA 4EJVA 3S3NA 1K79A 3S2WA 1LJ9A 2W57A 2E7WA 1D8JA 1ZG3A 3BTIA 1BR2A 4U0WA 2FRHA 3I56I 3G4SI 1D5VA 4CHUA 1ZN2A 2HDCA 3KFWX 5DUKA 2RQPA 4U0YA 3GWZA 2QEXI 3LNQA 2KDZA 5L3DA 1IG7A 2EA2A 2WBMA 1B4AA 1Z91A 2VJIA 2N8GA 3BR5A 3DBHB 3B6AA 4V2GA 1Q1HA 1BM9A 2F5EA 4A93J 3T5XA 4HQMA 3IKTA 3J80K 2MSYA 1FYLA 2EZHA 3L00A 3JSPA 3M1CA 3ISPA 4Y52J 4HA8A 4EMSA 4F55A 5ED4A 4AIJA 2KZGA 4C2UA 1ON1A 1ORKA 3WTZA 2YX7A 3C2HA 1UG2A 2RDPA 1LUJB 3GTQJ 3VODA 3G1OA 3ZOBA 3UNGC 2FJ1A 3MKLA 5DS9A 3GZ6A 3HG9A 2PJPA 3K9TA 1K83J 2KKOA 3BROA 3MCZA 4HEA2 3FMRA 3E1SA 4XL9A 2EPFA 2DA1A 1LVAA 5IP9J 3H9QA 2XAUA 4G6QA 2V9VA 4RA2A 4RGUA 1MH3A 3HRMA 1I39A 2KDOA 3GCMA 2OU2A 4AWXB 3EUHA 4BJ6C 1RESA 3BR2A 5F0CA 1J09A 2EIJH 5J8CA 4PSWA 5KAFC 3LSKA 3TMOA 2FNAA 1G3SA 2K5CA 1R5HA 3K70D 2VBXA 1FLIA 4M71A 4U0VA 2UZKA 1Y0NA 1SD6A 2ICWG 2XAHA 4V2FA 2QCOA 4DIQA 2W7NA 3SHFA 2OTJI 1LFUP 3VPRA 3D0SA 3BTCA 2UWMA 3JRCA 2FMLA 1RZ4A 4JK1X 3C2BA 2PLYA 3BR3A 1H9TA 4E7ZA 2H8RA 3QP6A 2OBPA 5GPCA 5JR3A 2KIMA 3BTJA 1RKWA 3HSRA 2OQGA 3IV5A 5HNHA 2HU9A 3I54A 3ZQCA 3RPUD 1R49A 1WJFA 2V6CA 2QA4I 3G1LA 3OIPA 2QYOA 4DZJA 5DD8A 4IRIA 2NVTJ 4XKVA 2AHQA 3VSLA 3VEPA 2QGUA 3GFJA 1NG7A 3TL4X 5KHDA 2PG4A 3FISA 3S1RJ 2HYGD 2VBYA 4XSXF 2DPUA 1N78A 2STWA 3P5JA 1USSA 2MC3A 1TC3C 3J81K 1A35A 3ZMTA 1AOYA 1A36A 4B8XA 3CTAA 1I50J 4BJTA 5ICGA 4DJAA 2O9LA 2VE8A 4WCGA 3ZMSA 3S32A 4L5IA 2LLKA 1SAXA 5FKKA 2VC0A 1FOKA 2HEOA 3HPHA 1Z3XA 2DOFA 3DFGA 3ZN0A 1VQNI 1U9OA 2MA3A 3Q3SA 2L01A 3ABLH 1HBXG 3LSHA
chains in the Genus database with same CATH topology
2EINH 2EIJH 3WG7H 2DYRH 2DYSH 1OCRH 2ZXWH 1OCOH 1OCCH 2EIKH 3ASNH 5B1BH 1V55H 2Y69H 3X2QH 2EIMH 3AG3H 3ABKH 1OCZH 1V54H 3AG4H 5B3SH 5IY5H 3ASOH 2OCCH 3ABMH 5B1AH 3ABLH 3AG1H 2EILH 3AG2H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIN H;  2EIJ H;  3WG7 H;  2DYR H;  2DYS H;  1OCR H;  2ZXW H;  1OCO H;  1OCC H;  2EIK H;  3ASN H;  5B1B H;  1V55 H;  2Y69 H;  3X2Q H;  2EIM H;  3AG3 H;  3ABK H;  1OCZ H;  1V54 H;  3AG4 H;  5B3S H;  5IY5 H;  3ASO H;  2OCC H;  3ABM H;  5B1A H;  3ABL H;  3AG1 H;  2EIL H;  3AG2 H; 
#chains in the Genus database with same CATH topology
 1MZB A;  1X3U A;  4Z2Y A;  4DQ2 A;  4JX4 A;  4OIR F;  1RRJ A;  1QQI A;  4C2M J;  1EKE A;  1OQY A;  3W6J B;  3OYM A;  3RZD J;  2GBY A;  4MTD A;  2DT7 B;  3K70 C;  5FLV A;  4ZZD A;  4HX4 A;  1ZQ3 P;  4D7M A;  5M3M J;  2BY1 A;  2OQR A;  4ZDL A;  3FXL A;  1RUN A;  3RIR A;  5HNF A;  3DTI A;  3V7S A;  3JAM Z;  3E6C C;  1VFC A;  3V4G A;  4F52 A;  1U9N A;  1OPC A;  1O7F A;  4XON A;  5FLM J;  2FEZ A;  3EYY A;  2HQ5 A;  4U87 A;  2LD5 A;  5TJJ A;  3GTM J;  4A5M A;  4CCL A;  1VTN C;  5EZH A;  4K2E A;  4BNC A;  3D5L A;  2ZME A;  2HZD A;  4FQG A;  3WTW C;  2VI6 A;  3OS2 A;  3CCE I;  2AXL A;  2IXS A;  2EQR A;  2NOJ B;  2DA3 A;  2DN0 A;  4JBA A;  3ABK H;  2ID6 A;  2VT2 A;  3HOX J;  3K6G A;  4N9H A;  2CV0 A;  2X6X A;  2A3S A;  3K4L A;  4RAF A;  3LAP A;  1YTY A;  5D8L B;  1B59 A;  3BG7 A;  1Y8R B;  2XGX A;  2DJI A;  5FRO A;  4A3C J;  2O8X A;  1NH3 A;  2P4W A;  3MZ8 A;  4N4O B;  3HPG A;  1JKO C;  4DW6 A;  5EEA A;  4XIC A;  2WAQ A;  3NWS A;  4B3A A;  3HOS A;  3RTR A;  4C3H J;  1APL C;  2MFZ A;  3F3X A;  3BJO A;  2HWV A;  2ELJ A;  1LVK A;  1W5S A;  2JUC A;  3FZV A;  2JVH A;  2D2W A;  5FRN A;  4I6Z A;  4HOB A;  2VLA A;  2OV7 A;  4A0Y A;  1MMN A;  1MKM A;  3E6B A;  2CWE A;  3S8P A;  5GAG J;  2E60 A;  4BEH B;  3SZP A;  2LFB A;  1G8X A;  2PI0 A;  5L3E A;  4KIG A;  3KEY A;  2CYY A;  5ICF A;  4KIF A;  1Z1D A;  5D5X B;  2W25 A;  2DMP A;  1QVU A;  1WKM A;  2K7L A;  3DF8 A;  5KVR A;  2OUM A;  4JX6 A;  2K3P A;  3PFI A;  4XMY A;  4Y4R A;  4BL0 B;  4OOI A;  3ERE D;  2E1C A;  3DU6 A;  3K1N A;  4H4K C;  1GLN A;  4BXF A;  3KET A;  2VE9 A;  1HKT A;  1JI8 A;  4GRI A;  1IO2 A;  2TRT A;  4KFC A;  3BCA A;  4DOZ A;  1XDS A;  4RB3 C;  1T08 B;  3CUQ A;  5IOY A;  5C44 J;  3RZO J;  2V26 A;  3R0A A;  1AKH B;  2BEO A;  1UST A;  2QZ8 A;  1YIJ I;  3SJM A;  5JLW A;  1W36 D;  3ABU A;  3AAF A;  5ILU A;  5FLX Z;  2L0K A;  4L9V A;  5E8I A;  3E6D A;  2BW3 A;  2VJ4 A;  1TTY A;  4UVC A;  4CXF A;  2G7H A;  2BVL A;  3LA3 A;  4Q4Z F;  3A2K A;  3PIP F;  1P92 A;  1I27 A;  1QNT A;  4C30 A;  4L9J A;  1FYK A;  1DDN A;  4CGZ A;  2XPW A;  2EFP A;  2P5L C;  3QOD A;  3H5A A;  4HDU A;  1W0U A;  3ZP5 A;  2GXA A;  4KIS A;  2R7T A;  2IGM A;  4G12 A;  2JRT A;  1VND A;  1SMT A;  2X6Y A;  2KLO A;  3JRA A;  2KP6 A;  3L2C A;  2NVQ J;  2JA8 J;  2X51 A;  2L9N A;  5DCM B;  3CMY A;  1PYV A;  5FB2 A;  1W7P A;  2QLZ A;  2WY7 Q;  4LGW A;  4B09 A;  2Z9O A;  1ON2 A;  1PJR A;  4KUM A;  5JHF A;  5L3F A;  3JRE A;  2QUF A;  3GEZ A;  3J81 Z;  4LG3 A;  1MND A;  1ZH5 A;  5DEQ A;  4XR6 A;  2BHZ A;  3A02 A;  3J7A Y;  2EWN A;  4IHX A;  4BEH A;  5EJC A;  4N4N B;  3LSG A;  3BT9 A;  4CCK A;  3ROU A;  3F9K A;  5E1Z B;  3KLO A;  3RPQ A;  2OZ6 A;  5A2Q K;  3CJQ B;  2ELK A;  4NQW A;  2JPC A;  4HF2 A;  1DPR A;  2RKH A;  2R93 J;  2DBB A;  5HLH A;  1B8I A;  1G2H A;  4HV6 A;  2HXI A;  1U2W A;  4E7H A;  3HZJ A;  3HDD A;  2CJJ A;  3QP5 A;  2MYS A;  3KP4 A;  4UUS A;  2M3A A;  1FP1 D;  4GYG A;  1JT6 A;  3HRU A;  4W1U A;  4HDV A;  1IDZ A;  2PBI A;  3CME I;  1VQ7 I;  3MEX A;  4BAC A;  3F21 A;  1SFU A;  2VB6 A;  2LYC A;  1DGW Y;  2X6O A;  2D5V A;  3AFH A;  2DMN A;  3WHC A;  3CUO A;  3PJR A;  2QM3 A;  1BI3 A;  3OOU A;  1BI0 A;  3C1D A;  3O8H A;  2KIF A;  3GTK J;  1HOM A;  1QO0 D;  4CCO A;  1UEL B;  3GZN B;  2EIN H;  3WE3 A;  4BDZ A;  4PSX A;  2R3S A;  3HKZ N;  1K4S A;  4PCQ A;  3P9I A;  4RS8 A;  1XSD A;  1JHH A;  1SFO J;  1HLV A;  1MMD A;  2DO7 A;  3ASN H;  1TW3 A;  4B47 A;  1IGN A;  2X1E A;  2JTV A;  2RVC A;  2P6S A;  4XNF A;  1U8B A;  1WH7 A;  2BY3 A;  4RMN A;  1U5T B;  1X1B A;  3PO3 J;  2PMH A;  2KPM A;  1R5G A;  2A5W A;  2DA4 A;  1LPQ A;  2IVM A;  2WA0 A;  4AIH A;  2V1N A;  2XKP A;  4BU2 A;  5DDG A;  2Y0S A;  1X58 A;  3MQ0 A;  3PFY A;  3CUQ C;  1YLF A;  1TNT A;  2VKV A;  1ZLJ A;  1MJ9 A;  4G6T B;  5E20 A;  2ECB A;  1D3Y A;  5K7Z A;  2E36 A;  1UHS A;  3AG3 H;  2DDB A;  4UV8 A;  3CCV I;  3HOV J;  2QBY B;  3TOA A;  2V7F A;  1OYY A;  1SVO A;  2QBY A;  2F5F A;  1D1C A;  2EFQ A;  1YQA A;  3CF2 A;  4YRV A;  4IHV A;  2LTP A;  5DYM A;  1UJ8 A;  3A1Y A;  4HPQ A;  2MD5 A;  3O3K A;  2JT1 A;  3B02 A;  3W2W A;  2IPQ X;  2XAS A;  2JQ7 A;  4FT8 A;  3GFI A;  5L3G A;  3HSE A;  2O5R A;  3K2A A;  4AM3 A;  3FXO A;  4CO8 A;  3BG5 A;  3W6K B;  3J7A O;  2ZO4 A;  1LB2 A;  2V1X A;  2HZT A;  2KRC A;  5FJ8 J;  3WGH A;  5J4Y A;  3JRI A;  1WJC A;  1WI9 A;  5FFX A;  4IKF A;  1I6X A;  1YW9 A;  2ZKZ A;  5E1X A;  2J5P A;  3Q9V A;  2K3F A;  5GTI C;  3KYL A;  4F91 B;  1X3W B;  3CC2 I;  4ENN A;  2H1L A;  2R7O A;  4X1E A;  2GOX B;  2HQA A;  1E3H A;  2X9D A;  3IH2 A;  1FOW A;  4F7Z A;  4CZZ A;  4IRH A;  1RC9 A;  3COA C;  1FY7 A;  4ON0 A;  4BE1 A;  4P96 A;  4J19 A;  1YJ9 I;  3RYR A;  2LK2 A;  2YUS A;  3LA7 A;  3ULQ B;  3DCF A;  4R8H A;  4MFE A;  1H88 C;  3IH3 A;  2O8K A;  3HOZ J;  3CDH A;  1A5J A;  3SZG A;  1XTA A;  2ZXH A;  2K9N A;  1PP8 F;  4M6X A;  3OS0 A;  2YSR A;  2P5V A;  3H3V K;  2TDX A;  4Z6Y A;  1TWG J;  2Z3Y A;  3LFK A;  2BZT A;  1JKR C;  5IT9 Z;  5LHG A;  2H6B A;  3KZZ A;  4R1H A;  3P9C A;  4HNT A;  1T38 A;  1HDP A;  1O3S A;  1JKQ C;  1DP3 A;  4YEJ A;  1GHC A;  1I1S A;  3BP8 A;  1E0E A;  1F36 A;  3REO A;  3GZ5 A;  1JGS A;  1MJB A;  1Y1V J;  3L7W A;  1F1Z A;  2IJL A;  4IVN A;  1RNL A;  3EET A;  5D5W B;  4PFP A;  2CW8 A;  5FKL A;  2LKP A;  3KP7 A;  3VFZ A;  2K40 A;  3DKW A;  2XRN A;  5BS6 A;  5D5V B;  2VN2 A;  3VOE A;  2X1D A;  3WTT C;  1IRZ A;  2VXZ A;  5HVQ C;  3L1P A;  2OJE D;  3F22 A;  1ZTR A;  3OYG A;  1AHD P;  5E1W A;  3SDG A;  1YX3 A;  1Z6R A;  1FJL A;  3FM3 A;  2F4O B;  3HGG A;  1YW7 A;  1BW5 A;  4MEX F;  3BG6 A;  2E1O A;  1FZP B;  5F08 A;  2R7D A;  4HF1 A;  2XV4 S;  2O3F A;  3CF5 F;  1BC7 C;  1YHQ I;  2M45 A;  3VDX A;  4BY7 J;  2WAF A;  2DA5 A;  4QSH A;  2Y48 A;  3E7L A;  1RET A;  2XAG A;  2OF7 A;  3OR1 C;  5EEH A;  2NVU B;  1VQ8 I;  3OYF A;  4LLL A;  2M34 A;  1TWC J;  2FSW A;  1L0O C;  4MNU A;  1VQP I;  1I1G A;  3TBI A;  4M3E A;  2R5Z B;  4BAY A;  4IX7 A;  2KRH A;  3R0J A;  1SMY F;  4B43 A;  3GVA A;  4IHT A;  2HOT A;  3CZ6 A;  4EQQ A;  3H5N A;  2R7S A;  2BW3 B;  1BW6 A;  3PM1 A;  5ICE A;  5E3N A;  4O3M A;  5FRM A;  1J2X A;  2PQ8 A;  5DD4 A;  3H9G A;  3M8F A;  1YRN B;  3CQZ J;  1T0F A;  2OPT A;  3CES A;  4ABZ A;  5CVJ A;  3V8L A;  1G3W A;  2W85 A;  3AG2 H;  1F5T A;  4AD9 A;  3FIW A;  1XSV A;  1HKS A;  3IKV A;  2F5C A;  2DLL A;  1HC8 A;  3ERM A;  1R1U A;  3JRG A;  5LGN A;  3PQJ A;  2DA2 A;  5FD6 A;  5J6X A;  5HS7 A;  2COB A;  1MSE C;  1RKT A;  1HQC A;  4I2O A;  3WTV C;  3DKY A;  3N05 A;  4YG2 F;  3NAU A;  2V4J C;  2FOK A;  2XRO A;  2CG4 A;  3K4J A;  1U0J A;  5H6R A;  2IS1 A;  2M4G A;  2WAE A;  5H20 A;  3Q0V A;  4XOT A;  1DUX C;  1MIJ A;  3ZMZ A;  1AKH A;  3I4M J;  4PDK A;  4RGR A;  2V9K A;  5LLQ A;  1IZ1 A;  2MLK A;  5IYC J;  4F92 B;  2LY9 A;  3PL8 A;  5LEK A;  4L18 B;  1TT5 B;  3IWZ A;  3TO7 A;  3TP3 A;  3TW6 A;  2MAB A;  4H0E A;  2KMU A;  3DXJ F;  3SZT A;  4CIC A;  3J7Z I;  1IUY A;  4E70 A;  3RQ4 A;  1EF4 A;  3DEE A;  2ZCW A;  2W82 A;  4C9Y A;  2F48 A;  1IN7 A;  5DTD A;  1WRJ A;  3QU3 A;  4LK1 F;  3EDP A;  3L2U A;  3D5S C;  1RR8 C;  3CC4 I;  3L2Q A;  3U1D A;  5J1Y A;  3SYT A;  3DKX A;  4XN3 A;  1F43 A;  2NS8 A;  4NC8 A;  3BLY A;  4KJZ A;  4ESJ A;  4UVB A;  4NQW B;  4XLP F;  2W24 A;  2Y0M A;  3LQQ A;  3Q5F A;  1MDM A;  4C2T A;  4M3F A;  2CMP A;  2F4M B;  2AQE A;  3EUK L;  2E71 A;  3DWL E;  1P7J A;  3L2W A;  1ZGJ A;  4XBF A;  4I0A A;  4BHB A;  3RKW A;  1XC5 A;  2NNY A;  2DDA A;  3KP5 A;  2BYV E;  2JPB A;  2DAO A;  1QPI A;  2LF8 A;  3F72 A;  2VOP A;  3UKG A;  4FHT A;  3W2V A;  1XDU A;  4N9I A;  3HGY A;  3ZMV A;  3WOD F;  2AS5 F;  2P7V B;  3VSK A;  3BPX A;  2XB0 X;  3V42 A;  1BL0 A;  4J00 A;  4IQ4 A;  3GTL J;  1E3P A;  2H94 A;  3FBN B;  4D1Q A;  4OWR B;  2K9Q A;  1XPX A;  1Z05 A;  2LC2 A;  2Y9Y A;  3OOP A;  4KT6 A;  2Q8K A;  1IF1 A;  1S72 I;  1QPM A;  4Y7N J;  4RM3 A;  2MD0 A;  4A3L J;  1NG6 A;  1VQK I;  3PO2 J;  4M6Y A;  2CQ7 A;  4M3B A;  2DFF A;  4A3K J;  4ZYE A;  5FO5 A;  4UVA A;  2AQF A;  1BI1 A;  5BNG A;  3CDL A;  2UXX A;  1P6R A;  1UFM A;  4HLY A;  3VWB A;  3G71 I;  3KYD B;  5JI6 A;  2ACJ A;  3V8J A;  4RBO A;  2JJ7 A;  3FXK A;  2RC4 A;  3DLL F;  2CO5 A;  4NC6 A;  4UUV A;  2ZFW A;  1WI3 A;  1B9M A;  4OIO F;  2I8D A;  3HJE A;  3TO9 A;  2PMU A;  4DZP A;  3CUQ B;  4E7S A;  3A03 A;  2ZXI A;  3FM5 A;  2DU9 A;  4YFN F;  2XSD C;  4A3J J;  3S1N J;  1ZR4 A;  1JHF A;  4O5V A;  2FX0 A;  2IA2 A;  4HNV A;  3O2P E;  1CF7 A;  2HS5 A;  4Y15 A;  2XAJ A;  1YIT I;  2CQN A;  2Z33 A;  4L5J A;  4ZTF A;  2E2H J;  4ZDO A;  5CVU A;  4XRS G;  3W2A A;  4KDP A;  1J5Y A;  5H2F C;  1EJ9 A;  2XAQ A;  3KP2 A;  2IA1 A;  1VI0 A;  3K4B A;  4MQV A;  4IPA A;  4PJL A;  2GWR A;  2K85 A;  2CV1 A;  2FBI A;  1Z7L A;  2E2J J;  2M8E A;  2QQA A;  3LOC A;  3AL0 B;  4I01 A;  4G7O F;  3MN2 A;  5F64 A;  3DTE A;  5FKN A;  5TGT A;  1Y6I A;  4RB0 A;  1LKX A;  1MMG A;  3ZQ7 A;  3X2Q H;  3CLQ A;  5CVR A;  1KYW A;  3RPU A;  2YU9 J;  1HDD C;  2IAI A;  4XLA A;  2Z1D A;  4KNY A;  1FBS A;  2HKO A;  3CP2 A;  4MTE A;  4EV0 A;  5TRD A;  2P0W A;  4A3G J;  2LY1 A;  3C18 A;  1B72 A;  3S17 J;  1QGP A;  2QWW A;  4XKC A;  1BN5 A;  2R7U A;  2F5V A;  4RB2 C;  3ZQF A;  3S3O A;  3OIQ A;  2CW0 F;  1XMK A;  1XS9 A;  1MDM B;  5FGM A;  4A6E A;  2DTZ A;  3M4O J;  4MLO A;  2OAZ A;  1BR4 A;  5TIS C;  1UHM A;  1ULY A;  4DGW B;  3KYC B;  3U2R A;  4QTR A;  4A3B J;  1D0Y A;  4WF2 A;  1XD7 A;  3OMY A;  3SEZ A;  2GIV A;  4UV9 A;  2B63 J;  3A4C A;  4AID A;  3W3C A;  4MHG A;  4KIB A;  2CUZ A;  2QKL B;  1WCM J;  2KIS A;  3Q0U A;  1FWZ A;  3K4N A;  3IAM 2;  2O03 A;  4OMZ A;  4A6D A;  5EG0 A;  2HOA A;  3ZXS A;  1B9N A;  1Z0X A;  2FOW A;  1LE8 B;  1KQ0 A;  2NNN A;  1KON A;  2LY2 A;  2VT3 A;  3IP4 B;  4XOP A;  4D5C A;  1ETQ A;  3OYC A;  4ANJ A;  1TBX A;  3ZPL A;  3F0C A;  1ZG5 A;  4IJA A;  1OFC X;  3BZ6 A;  1B6A A;  2FF4 A;  1AU7 A;  1MBE A;  3LMM A;  4ZYH A;  2EFO A;  5IT9 K;  3PSF A;  1T8I A;  4ENJ A;  1WJ5 A;  2PJR A;  4HBL A;  4Q47 A;  1MMA A;  2WC2 A;  1YX5 A;  2BXY A;  2RV8 A;  2VPR A;  1TL8 A;  4CYD A;  2PFB A;  2NVY J;  3K7A J;  2EV5 A;  3O8G A;  1TNS A;  1IV6 A;  1X1C A;  4BXU A;  1Z3Y A;  3O6B B;  2COM A;  2HQR A;  1W7P D;  2QVO A;  1CF7 B;  4HNU A;  2R5Y A;  2H6C A;  2GA1 A;  4IHY A;  2R92 J;  1ODD A;  4OIN F;  3S3M A;  1HW2 A;  1Z21 A;  4MEY F;  3OYB A;  3SDB A;  1YS7 A;  2ZJQ F;  3I4N J;  2HKX A;  2IGN A;  4UY8 I;  3S14 J;  1ETX A;  2CUF A;  3G6E I;  3S1M J;  1O4X A;  3CCQ I;  4ZYG A;  2W84 A;  3HL2 A;  1KQ9 A;  3IC7 A;  5IOZ A;  4IHS A;  1GVJ A;  4Q5S F;  3PNV A;  2Z16 A;  4JOM A;  3ZQH A;  4U7B A;  1JUP A;  3R4K A;  3CCM I;  3BZC A;  3WTX C;  5EZG A;  1IXC A;  3BDD A;  3VYU B;  1OCP A;  2DMQ A;  2PEX A;  3KIO A;  3OYK A;  2KJB A;  3GBG A;  2P7C B;  3Q0W A;  2V1D A;  2VL8 A;  1N77 A;  2YU3 A;  1BR1 A;  3UR3 C;  2OA4 A;  3R6S A;  2EZL A;  4EJU A;  2UXN A;  3K1M A;  2MH9 A;  3K4M A;  1IW7 F;  3HTS B;  2CSO A;  3V8K A;  4LIV A;  1S3J A;  5F6F A;  2JSP A;  1BOA A;  2V6E A;  2CH0 A;  5CYV A;  4QPQ A;  2LNB A;  5CLS A;  3HUG A;  4LD5 A;  5E3M A;  1HKQ A;  2MLG A;  1T33 A;  4ASN A;  1E3O C;  3EYI A;  2HPM A;  3B73 A;  2Y31 A;  4ZJZ A;  4FAS D;  2DTR A;  1H89 C;  2G0E A;  1R7J A;  2VOD A;  2GA2 A;  3FMS A;  3MVP A;  2VQH A;  4IOC F;  1UMQ A;  1D8K A;  1JJ6 C;  3QOP A;  2DI3 A;  2EV6 A;  3OWT A;  1ZRE A;  1K61 A;  3E97 A;  1G3Y A;  1G4D A;  1U6G A;  2QQB A;  3WU0 A;  2EB7 A;  4DBR A;  2EFW A;  1LFB A;  2J5O A;  3KP3 A;  1OYI A;  3MWM A;  4HYE A;  4HST A;  3FXU A;  4EJT A;  4G94 A;  3CDI A;  4HZF A;  2R7R A;  3DV8 A;  1M1E B;  1QZZ A;  2ME6 A;  4II3 A;  1BA5 A;  2OD5 A;  1ERD A;  4KT5 C;  4B44 A;  3MMY B;  3C7J A;  4OIQ F;  1Z7U A;  3KX2 A;  2QQ9 A;  3IAS 2;  2E7X A;  3GX4 X;  1MNM C;  2L02 A;  1POG A;  2YS9 A;  1EH7 A;  2KIU A;  2A68 F;  2E5Z A;  4AYB N;  3ABT A;  4HW0 A;  2CRG A;  3DPT A;  1Z67 A;  3RI4 A;  2M30 A;  1QHH D;  3TKY A;  3I9V 2;  1YS6 A;  1ZEL A;  5EGO B;  1NK2 P;  4WK8 F;  3OV8 A;  1W0T A;  3ZMU A;  2EIL H;  4HV5 A;  1T56 A;  4PFO A;  4EAT A;  5CJ9 A;  5L3C A;  3KLN A;  1WQ2 A;  1KU3 A;  4ENM A;  1TP4 A;  2KT0 A;  2IBD A;  3PNY A;  1KA8 A;  2DOD A;  2EV0 A;  3FMQ A;  1V55 H;  4C3I J;  4A12 A;  2LRE A;  4YFK F;  1IRF A;  3LSR A;  1HCR A;  2W1O A;  2KZV A;  3LQR A;  4L9N A;  4JX5 A;  4HQE A;  1FTT A;  3MFK A;  1MBG A;  2ESN A;  1HF0 A;  4KN4 X;  4PJN A;  4HSR A;  5FLX K;  2ZBK A;  3RKX A;  4ZH4 F;  5F0H A;  1MBF A;  1OYW A;  4M3G A;  3NEU A;  4PK4 A;  1CGP A;  2GAU A;  1A6I A;  1TWH J;  2KL4 A;  2WB1 N;  4I7H A;  5FFZ A;  3A01 B;  1KU9 A;  1LDK B;  1OLT A;  4TV7 A;  5B5E C;  1K4T A;  2VXD A;  4L0Z B;  1X3Z B;  2JSC A;  4XKB A;  3TOB A;  4EM1 A;  2W00 A;  3C3W A;  3CO7 C;  2PMZ A;  2BY0 A;  2LDU A;  1O3T A;  5JHU A;  3GTP J;  1KGS A;  3FXR A;  2XIG A;  1SFK A;  1D1B A;  1X1P A;  3I4P A;  2H09 A;  4EM2 A;  1LQ1 A;  1B1B A;  3BJA A;  4BKX A;  5IPA A;  3H3Z A;  2ID3 A;  1W4M A;  2JVG A;  3M1E A;  1JXS A;  2DW4 A;  2NYX A;  2ETH A;  3SFZ A;  2LR8 A;  3WHB A;  2XPU A;  2X0L A;  5E3O A;  2X85 A;  1ZRD A;  2WV0 A;  3S15 J;  2XGE A;  4QIW N;  1J7K A;  1R58 A;  1ZK8 A;  2A6E F;  4PJ0 C;  4XLE A;  5D6F A;  5LRR A;  2OCE A;  4NHJ A;  5KAI C;  1HA8 A;  3ZMD A;  1ZYR F;  2ISZ A;  3FK7 A;  2DOA A;  2K86 A;  3AG4 H;  4XID A;  1E17 A;  4BS9 A;  2MC4 A;  1ZGW A;  2DA6 A;  2VIX A;  4M74 A;  2L9V A;  5DUI A;  4EGZ A;  2VUM J;  2P81 A;  1UZC A;  1R1V A;  2F2E A;  3HSF A;  3I58 A;  4AC0 A;  2ECC A;  1ZAR A;  5HDG A;  3VYS B;  5LBQ A;  1TT0 A;  1SVL A;  1GDT A;  3BWG A;  2HGC A;  5J8F A;  3BY6 A;  2R7F A;  2EBI A;  4NC7 A;  1MW7 A;  2ZB9 A;  2M0M A;  4G7H F;  1ITY A;  3F8N A;  5D8K B;  3FHZ A;  2LBF A;  1ZRF A;  2LSO A;  1OCT C;  1D0X A;  1MJA A;  4CYC B;  3QQA A;  3QPT A;  4LG0 B;  4NBQ A;  1FT9 A;  4KA4 A;  5FD5 A;  3ML6 A;  4IL6 C;  1VZ0 A;  4EGY A;  1WFX A;  1YFH A;  5J1U A;  3SQN A;  5E79 C;  1LEA A;  3E0J B;  3HOW J;  1R00 A;  4E4H A;  1R9T J;  3M8E A;  1S7E A;  1D0Z A;  1N75 A;  1WVR A;  3CCU I;  2JK3 A;  2DMT A;  2XB5 A;  4HG2 A;  3DBR B;  5LGU A;  2LBF B;  2BHY A;  4B3X A;  3K2Z A;  2YR2 A;  2AXT C;  4MIM A;  5IP6 A;  2GZW A;  2AO9 A;  1FOX A;  2LH9 A;  2LKX A;  3KCC A;  3K4C A;  1R5I D;  2Y69 H;  4P5O A;  3ZCO A;  4UNO A;  3ZQG A;  1V3F A;  3RKQ A;  2M2E A;  5D5U B;  3R61 A;  4QWQ A;  2XUB A;  3HHH A;  5EEG A;  4EVI A;  4X6A J;  5GP9 A;  4IF4 A;  5HLG A;  1H8A C;  2DK5 A;  5LHI A;  4UXN A;  3BG9 A;  3CD6 I;  1I6H J;  4HRI A;  1KQ8 A;  1VQ5 I;  3OL4 A;  1MSF C;  4AIK A;  5C3E J;  3LST A;  1S7A A;  2D45 A;  4UB8 C;  4DYR A;  1DPU A;  4UUS B;  1AWC A;  2K27 A;  2FA5 A;  1EH8 A;  1IN4 A;  2VQL A;  2OZU A;  1X19 A;  4WXC A;  1OMI A;  4EJW A;  3BC8 A;  2IGO A;  5AIP A;  1PUF A;  4LJZ F;  1GUU A;  2HPI A;  2X6W A;  5E17 F;  3G2B A;  4KIC A;  1CQT A;  4LLG F;  3BR0 A;  4M73 A;  2K9L A;  4JYK A;  3IHU A;  3H0G J;  4RGX A;  1ENH A;  9ANT A;  4XRM A;  4BGD A;  4HF0 A;  1TZL A;  1X4P A;  4BJ5 C;  3IRQ A;  4KMU X;  5CKT A;  2MGQ A;  1G3T A;  1OCO H;  4AVP A;  1OIS A;  1P7I A;  2E1M B;  1I5Z A;  2JA2 A;  5J47 A;  4BQA A;  3R60 A;  5K7F A;  4GXO A;  4JQF A;  4XLF A;  4QPO A;  5KNL A;  2RQQ A;  5F0F A;  2WB1 A;  2ZXJ A;  3LSJ A;  1BC8 C;  3FX3 A;  3H1C A;  1R4N B;  5K5O A;  4D0P A;  2BVM A;  3LSP A;  1YO5 C;  1DU6 A;  3AKZ A;  3C2G A;  5C4X J;  1IV8 A;  4Y3O A;  1EV7 A;  5J4V A;  2L2O A;  2O6G E;  1LDJ A;  2F6C A;  3RDI A;  4ENK A;  4NNJ A;  4RDU A;  1RI7 A;  5IP7 J;  4XM3 A;  2XKO A;  3A0H C;  1DQU A;  2K9M A;  1R36 A;  3I55 I;  3QRF F;  3MKZ A;  1REP C;  3CCJ I;  2DJN A;  1JTX A;  5E8G A;  3T0Y A;  2DCE A;  3V7C A;  2IP2 A;  1MNE A;  2D1H A;  1D5Y A;  3HM5 A;  2JN6 A;  2ZNY A;  2CFO A;  3HOT A;  5ICC A;  3OYD A;  1T2K A;  3TP0 A;  3OYJ A;  3GLL A;  3EUA A;  3ZQQ A;  1A6Q A;  5D4S A;  4E7K A;  4D7N A;  1O3Q A;  1DU0 A;  4QLC U;  3RYP A;  3GTG J;  2KIQ A;  1IC8 A;  2KJC A;  1L3L A;  3JRD A;  4OIP F;  2RGV A;  2XAF A;  3A01 A;  2Y75 A;  5K7H A;  1FMV A;  3H3U A;  2CGP A;  4A2U A;  1XCB A;  2BY2 A;  2I10 A;  4A69 C;  4LMY A;  2G9W A;  2FUG 2;  4S05 A;  2NRA C;  5HDN A;  2XRL A;  2L54 A;  1UAA A;  2L9R A;  5F1R A;  1TWF J;  3NQO A;  3HYI A;  4BQQ A;  2BE5 F;  1XGS A;  2CU7 A;  2Y9Z A;  3OIO A;  4GYI A;  4LB5 A;  3WTS C;  1ZKG A;  3WE2 A;  4RGS A;  2P6T A;  1H0M A;  5EG0 B;  2HFH A;  4XRS A;  4U7D A;  4IOA F;  1O7L A;  4IEJ A;  4XLC A;  1RR7 A;  3FXQ A;  1QU3 A;  1IDY A;  3RCO A;  2CS3 A;  2EIK H;  1V5F A;  1YI2 I;  1FIA A;  1JGG A;  3L9F A;  2PMZ N;  1KU7 A;  2ZME C;  1X1D A;  3LL7 A;  3H35 A;  4BYY A;  2BXZ A;  2IEK A;  3KP6 A;  4L0Y B;  2DMU A;  2XGD A;  4YIR X;  1SEU A;  2R7W A;  4ITV A;  1OR7 A;  3DBL B;  4YIF A;  3E5Q A;  2VBW A;  2IRF G;  3HOY J;  1H9G A;  2LMD A;  4IZZ A;  1J59 A;  4A0Z A;  2A6T A;  3IRR A;  3HRT A;  2RN7 A;  3F6V A;  2IT0 A;  2HXO A;  2M1B A;  1XCV A;  1O3R A;  3DLA A;  3QAH A;  1U8R A;  2VON A;  3F8M A;  5KCM A;  4YEL A;  3J7Y J;  1MBH A;  3S2D J;  1T6S A;  1ETY A;  2HDW A;  2XGC A;  3PSI A;  4U88 A;  4AVZ A;  4HLX A;  5HOO A;  2ZJP F;  5IYB J;  2E35 A;  4I0B A;  1XMX A;  1R4M B;  3ZR8 X;  1ZG1 A;  2GXG A;  1QZE A;  5KK1 A;  5K5R A;  4G8X A;  1SAN A;  4R79 A;  3HC7 A;  2DYS H;  4M9S A;  5HS8 A;  4B48 A;  2O61 A;  4A5N A;  1OKR A;  3AL0 C;  4RLF A;  1F4K A;  5HLI A;  2R7Z J;  3QYF A;  2X4H A;  4S04 A;  1FSE A;  4II2 A;  1XGO A;  4OU0 A;  3CLO A;  4G6D A;  3H92 A;  4F93 B;  3OYA A;  2CFX A;  4PZJ A;  2KFD A;  4CCN A;  3CJT B;  3WU1 B;  3CMA I;  4XLN F;  3MKW B;  2IS2 A;  2R7V A;  5DM7 F;  2DPD A;  3BPV A;  4Y13 A;  3WU2 C;  2R4G A;  3EPZ A;  3GF2 A;  2BV6 A;  3JRH A;  1FTZ A;  4Y33 A;  2DQL A;  3FXM A;  3OSF A;  3DEW A;  2Q2E A;  1DP7 P;  3BR6 A;  2JZY A;  1SAU A;  4FE4 A;  5FKM A;  5JFR A;  3I3L A;  2M7A A;  5CVI A;  2R5Y B;  1A04 A;  4ZYA A;  2XDV A;  4E7I A;  1KU2 A;  2WV1 A;  2L7K A;  4LIT A;  4MQ9 F;  2JA5 J;  2R7Q A;  1PP7 U;  1XB4 A;  2VC1 A;  4BQN A;  5K5Q A;  1SD4 A;  2OCC H;  2VQG A;  4A3F J;  1SC7 A;  1JTY A;  1SFE A;  2DFH A;  1FIP A;  4G7Z F;  3FBI B;  2YPR A;  3DQV C;  5HS9 A;  3CCR I;  4FET A;  2VPL A;  3GME A;  3FHN A;  1G59 A;  1JJ8 C;  2WY8 Q;  5EF6 A;  1K6O A;  4B1R A;  1XG1 A;  2GXB A;  5J3L A;  2QF7 A;  4L9T A;  2HTS A;  2MG4 A;  1VQ6 I;  3EQL F;  1WZ2 A;  5BPI A;  2M7B A;  5ILV A;  5LFA A;  4WX9 A;  4J01 A;  3DU5 A;  2B0L A;  2QSG X;  2HOE A;  1GXQ A;  3HEF A;  4KIT B;  2JRM A;  3EUH C;  3IWF A;  1QZY A;  3ZQL A;  3ESW B;  3PUF A;  3KPH A;  2W4S A;  2E19 A;  3OY9 A;  2PN6 A;  1V4R A;  2IS4 A;  4BE2 A;  3LFU A;  3F6O A;  4Q48 A;  4KYW A;  1E2X A;  1XSX A;  5AIQ A;  1Z6T A;  3RJP A;  1V54 H;  2TCT A;  4EM0 B;  2H27 A;  2IW5 A;  2Y2Z A;  1QHG A;  4JP0 A;  5M5W J;  6PAX A;  4WXD A;  3CCS I;  2CQX A;  4KMF A;  3BZK A;  3JTH A;  1SD5 A;  4I02 A;  1G6N A;  1MBJ A;  2OTL I;  4N0B A;  2WTE A;  1J9I A;  3JSO A;  2A61 A;  3KE2 A;  3CMM A;  3OR2 C;  2FQ3 A;  2Q1Z B;  3MZH A;  1RUO A;  2Y30 A;  4EJO A;  3L2R A;  1Q1V A;  2HTJ A;  1YE9 A;  3FK6 A;  1WWX A;  1EA3 A;  1ZRC A;  1S29 A;  2RRE A;  1PDN C;  1HST A;  1PUE E;  3MZY A;  3MAJ A;  3TO6 A;  4FTH A;  1JUS A;  1STZ A;  4GO1 A;  4ZZL A;  1X2N A;  4I99 C;  5CQG A;  2STT A;  3GFL A;  1LDD A;  1RIO H;  4LFU A;  2OC6 A;  1OCR H;  2V9P A;  4WWC A;  2BGC A;  1U78 A;  5EDN A;  4RB1 A;  2B7E A;  1IXS B;  4CCJ A;  3FXJ A;  4CDG A;  3CCL I;  2HOS A;  3WTY C;  1W7P B;  2DT5 A;  3RQI A;  3P9K A;  2QSF X;  4BBR J;  1S9H A;  3GW2 A;  3FF5 A;  3H9J A;  3I5U A;  2ZNZ A;  3HB9 A;  1VQL I;  1P4A A;  3QOE A;  3TED A;  2QEN A;  2PJR B;  2A05 A;  2KRF A;  1OJL A;  2ZJ2 A;  2Q2E B;  1IAW A;  3I64 A;  5B1B H;  2ZFU A;  1OR7 C;  2R0Q C;  1UB9 A;  1FC3 A;  1YJN I;  3JAM K;  1VQO I;  2HYF A;  2L5Q A;  3GO5 A;  1WSU A;  1XN7 A;  3DP7 A;  3TW7 A;  4CUG A;  2O7O A;  3CC7 I;  4I09 A;  4V19 K;  3B6C A;  1BIA A;  1HW1 A;  4CH7 A;  1TLH B;  1TW2 A;  4CA0 A;  2LKS A;  5DM6 F;  2HVR A;  3KEQ A;  2Z5U A;  1BBY A;  2E5N A;  2XSJ C;  1RPW A;  2XF7 A;  2ME0 A;  1ETV A;  3W6V A;  3BOQ A;  4I98 B;  2Q0O A;  2WAQ N;  3MKY B;  4BHC A;  5IYD J;  1FSH A;  3M3Y J;  4P9U A;  3WG7 H;  1VF9 A;  1LE8 A;  2R5Z A;  2VBZ A;  1XX5 A;  3M9A A;  2A5Y B;  3WG9 A;  4Y17 A;  1MD0 A;  1SD7 A;  2K02 A;  3OSG A;  2P8T A;  4BH9 A;  3PUB A;  4BHP A;  3T8T A;  2BOL A;  2DFE A;  3I71 A;  4RAY A;  3CO6 C;  3PQK A;  2GQQ A;  5LEJ A;  3S1Q J;  2C6Y A;  1Y8Q B;  2VQC A;  4B4C A;  4AYB A;  5GAH J;  3ABM H;  2L7M P;  1IN5 A;  3H0D A;  1ETK A;  4BDY A;  1Y39 A;  2LVS A;  1NTC A;  4HX8 A;  3JR9 A;  1LNW A;  2FD5 A;  5ILS A;  5HOD A;  2M87 A;  2ZC2 A;  2DFI A;  5J40 A;  3GTJ J;  2ISY A;  3OYH A;  5D6E A;  3PNT A;  1OCC H;  2CW7 A;  2O0Y A;  4GDF A;  2CUJ A;  4ZDP A;  3CJN A;  2ZSH B;  3IL2 A;  4YFX F;  3PIO F;  2CUE A;  4PGH A;  1MGT A;  3HXL A;  5HDK A;  4CSW A;  5CPR B;  1T95 A;  2RAE A;  3I53 A;  3QPS A;  4DYC A;  1FPQ A;  3D5R C;  1ZAO A;  4RAG A;  3WGG A;  2DK8 A;  3ZGK A;  3HTU A;  1IXR C;  3Q9S A;  4XQF A;  2X48 A;  3ZN1 A;  4XRF A;  1KZH A;  3OL3 A;  2ADU A;  3KEO A;  2A07 F;  4XOR A;  4MO7 A;  1J0R A;  4C3J J;  2UV1 A;  3JRF A;  1N25 A;  4UB6 C;  2LG4 A;  2M8G X;  4LB6 B;  1ETW A;  3I0T A;  4DBQ A;  2F5D A;  1WJD A;  1J75 A;  2CQK A;  1BJZ A;  3BG3 A;  1AA7 A;  2EIM H;  3GLX A;  5AON A;  1X1A A;  5M5X J;  5JVT A;  2DA7 A;  2NVX J;  2L7F P;  5GAE J;  4ZC3 A;  3U21 A;  1S8N A;  3VYT B;  3OS1 A;  1ZR2 A;  4G9Y A;  1YW8 A;  4XLH A;  1P4W A;  2NS0 A;  1FMW A;  3CJR B;  5GTH C;  5FKO A;  1P2F A;  2BBY A;  3GUD A;  3LWF A;  3P7N A;  2DXI A;  4ESF A;  1P4X A;  3H36 A;  2LOO A;  4CZC A;  5J1R A;  4E7J A;  2H1K A;  3OYE A;  3A0B C;  2LF7 A;  2LP0 A;  4FE7 A;  3WGI A;  5JVG F;  3SXY A;  4M9X A;  1V5G A;  1PUF B;  1DGR M;  2EJR A;  4M3D A;  4XSZ F;  2M0C A;  2ESH A;  2FBK A;  4OAZ A;  1EH6 A;  4BY1 J;  2FQ4 A;  2RNJ A;  2GOM A;  2FBH A;  4XK4 A;  3CP8 A;  5LD2 C;  4D5F A;  1R1T A;  3E5U A;  2L9S A;  4D9J A;  2XPV A;  4I76 A;  2HNH A;  3LSM A;  5JLX A;  2GIZ A;  4AUX A;  3FWE A;  1LFP A;  4EEF G;  3OYL A;  3S93 A;  1TQI A;  1SVM A;  1I3A A;  5C4J J;  3RKY A;  4WXH A;  2X1C A;  4DYQ A;  1FBU A;  1SFX A;  4BBS J;  3HKZ A;  2UUZ A;  3F8C A;  1X4O A;  1XGM A;  3GFM A;  2L7Z A;  2QSH X;  2VKH A;  1K78 A;  1R22 A;  1HXD A;  5EGO A;  1IRG A;  2WWY A;  3AG1 H;  3M8J A;  2FMY A;  2PX9 A;  1D1A A;  3KZY A;  4FIS A;  4ETS A;  4PUS A;  1S6L A;  1Y56 A;  3CCY A;  4LK0 F;  4XKW A;  1JT0 A;  4NDL A;  2ZXW H;  4IXA A;  2L4M A;  4FX0 A;  4IO9 F;  2HVQ A;  5B3S H;  1VQM I;  5M5Y J;  3ASO H;  3TDU C;  5HLT A;  3HOU J;  2JUG A;  2W48 A;  3DPL C;  1IUF A;  2Z2S B;  3K10 A;  1TWA J;  5M3F J;  1T39 A;  1JKP C;  3BCB A;  1U5T C;  1MH4 A;  2K9S A;  5B1A H;  2ZSI B;  2EA4 A;  4W97 A;  5LGT A;  4CCM A;  4IRG A;  5LRS A;  1C0W A;  1YOV B;  1GXP A;  5F1J A;  5B66 C;  3NWT A;  4A3I J;  2HDD A;  5BPD A;  3HHG A;  1VQ9 I;  3QWL A;  2NOG A;  1YYV A;  1K7A A;  5CVV A;  5EYR A;  1U3E M;  1IRX A;  3ECO A;  3SEQ A;  3JRB A;  4BE0 A;  4LG0 A;  3HBL A;  2NXN B;  1HW5 A;  2R7X A;  3FKI J;  1ETO A;  2JA7 J;  1KYZ A;  2L4A A;  4LLN A;  3H5R A;  3D1N I;  4ESB A;  5LHH A;  2CQQ A;  4HAM A;  2GLO A;  2VOO A;  4IQJ A;  2DYR H;  2KHM A;  2K4J A;  2Z99 A;  1BOB A;  1WHU A;  2JA6 J;  3F23 A;  1FP2 A;  3IUO A;  4BQO A;  2I5U A;  4O6J A;  1OCZ H;  1IJW C;  3N4M A;  1FYM A;  5F27 A;  5L3B A;  1TQM A;  2IS6 A;  1R6R A;  3LSI A;  2HI3 A;  1HSJ A;  1V5E A;  2VKE A;  5F04 A;  2IA0 A;  2DT6 A;  3G73 A;  3F8F A;  1FOY A;  3LAJ A;  2JMW A;  3JTG A;  4ZYD A;  4YII A;  4ZTJ A;  1FBQ A;  2VJJ A;  2NAZ A;  3E5X A;  4KN7 X;  3ZQI A;  3U1K A;  3BQZ A;  1GV2 A;  4A3E J;  1T98 A;  3G1M A;  4HX7 A;  3ONQ A;  4RLQ A;  2M4K A;  3RSN A;  3K1P A;  5GPA A;  1F9N A;  3BQY A;  3U9G A;  4PJM A;  2QQ8 A;  3N97 A;  5D4R A;  2L3D A;  2MW8 A;  4UUT A;  2DQR A;  2G7U A;  1YRN A;  1FX7 A;  2KQR A;  3JCU C;  3HIF A;  3K4K A;  3T8R A;  4MFD A;  5GAD J;  2D1V A;  1X2M A;  2HVS A;  4A0X A;  2Y0S N;  3TDZ C;  1JUM A;  1XGN A;  4LIU A;  2EZK A;  4UHT A;  3WTU C;  1R71 A;  1O57 A;  3GXO A;  3S16 J;  1XMA A;  1IN6 A;  1NHA A;  4L5E A;  3ZRG A;  1QA6 A;  1S5L C;  2EK5 A;  3LA2 A;  5E3L A;  1I3Q J;  2V79 A;  2RNG A;  1R23 A;  5DV5 A;  2JWT A;  4A3D J;  3VYR B;  3BJ6 A;  1UCR A;  1MBK A;  3KZI C;  1Y1W J;  4PJJ A;  1T0F C;  1FNN A;  3M07 A;  2VJ5 A;  4MGR A;  5E18 F;  4P9F A;  5BMZ A;  2XC7 A;  1GV5 A;  3MD2 A;  4DNC A;  1WGX A;  2XVC A;  5ERI A;  3ECH A;  1GVD A;  3L09 A;  3SFI A;  2LRD A;  2E1N A;  4RM2 A;  1YIO A;  2YX4 A;  2GM4 A;  1W5C C;  3F8B A;  4M72 A;  4OAY A;  2M9H A;  4NUB A;  3HRS A;  2XHK A;  2H8W A;  3FDY A;  4LOC A;  1Z77 A;  5K1Y A;  1B8I B;  3G3Z A;  1A31 A;  2QKM B;  1TQP A;  3DTK A;  4BXX J;  1GT0 C;  1W36 C;  4GGG A;  1ONV A;  1ZGA A;  2A6H F;  1QVT A;  4P55 A;  5CQE A;  2VKD A;  3I59 A;  1K6Y A;  1FEX A;  1WJA A;  1ZHF A;  3TQN A;  3OYI A;  3K69 A;  2F4I A;  4M9Z A;  1U5T A;  1S7O A;  1BI2 A;  4RAZ A;  1W1W E;  1JE8 A;  1W5T A;  1YG2 A;  3QPL A;  5BOX A;  2XF6 A;  2B9S A;  4AU7 A;  2FNP A;  1B72 B;  2M5W A;  4GCV A;  4GFB A;  1Y0U A;  2FXA A;  1ZLK A;  1UHW A;  3IH4 A;  3OYN A;  1WJE A;  2FE3 A;  5DCM A;  2MBF A;  2HQN A;  2VAS A;  3VB2 A;  3ELK A;  3T1B A;  5DCF A;  2P5K A;  5BQT A;  1BJA A;  4M6V A;  4F3Q A;  1WH5 A;  3DPU A;  4X0G A;  4A3M J;  1ACI A;  4OMY A;  3I59 B;  1P9Q C;  2EZI A;  1IN8 A;  5IY5 H;  5A2Q Z;  1VQ4 I;  4S0H B;  3QYE A;  4P1W A;  3TGN A;  4E7L A;  1K78 B;  3BR1 A;  1QBJ A;  1PVE A;  3E3V A;  3QPH A;  1LEB A;  3K0L A;  3FKJ A;  3QYB A;  2E2I J;  3GTO J;  1WJB A;  3JW4 A;  3M7G A;  2ZME B;  2IGK A;  2FU4 A;  2E34 A;  2EFN A;  3BTL A;  2XF5 A;  2ELH A;  2K4B A;  3S2H J;  3GYH X;  1WPK A;  2HR3 A;  2MH2 A;  3E6M A;  2A69 F;  4XN0 A;  4PGG A;  4CYC A;  2HYJ A;  2NS7 A;  2E1M C;  2EH3 A;  4E6K G;  2V1U A;  4NB5 A;  1UG0 A;  3QU6 A;  3L2V A;  1YJW I;  4FX4 A;  1MMS A;  4FCY A;  1NK3 P;  4IHW A;  3HUG B;  3NAR A;  2WAD A;  2DOE A;  3NRV A;  4BUP A;  5IT3 A;  2ZJR F;  3V7R A;  3J80 Z;  5H6Q A;  1BIB A;  1QRY A;  1Z9C A;  2CV2 A;  3DEU A;  4EJV A;  3S3N A;  1K79 A;  3S2W A;  1LJ9 A;  2W57 A;  2E7W A;  1D8J A;  1ZG3 A;  3BTI A;  1BR2 A;  4U0W A;  2FRH A;  3I56 I;  3G4S I;  1D5V A;  4CHU A;  1ZN2 A;  2HDC A;  3KFW X;  5DUK A;  2RQP A;  4U0Y A;  3GWZ A;  2QEX I;  3LNQ A;  2KDZ A;  5L3D A;  1IG7 A;  2EA2 A;  2WBM A;  1B4A A;  1Z91 A;  2VJI A;  2N8G A;  3BR5 A;  3DBH B;  3B6A A;  4V2G A;  1Q1H A;  1BM9 A;  2F5E A;  4A93 J;  3T5X A;  4HQM A;  3IKT A;  3J80 K;  2MSY A;  1FYL A;  2EZH A;  3L00 A;  3JSP A;  3M1C A;  3ISP A;  4Y52 J;  4HA8 A;  4EMS A;  4F55 A;  5ED4 A;  4AIJ A;  2KZG A;  4C2U A;  1ON1 A;  1ORK A;  3WTZ A;  2YX7 A;  3C2H A;  1UG2 A;  2RDP A;  1LUJ B;  3GTQ J;  3VOD A;  3G1O A;  3ZOB A;  3UNG C;  2FJ1 A;  3MKL A;  5DS9 A;  3GZ6 A;  3HG9 A;  2PJP A;  3K9T A;  1K83 J;  2KKO A;  3BRO A;  3MCZ A;  4HEA 2;  3FMR A;  3E1S A;  4XL9 A;  2EPF A;  2DA1 A;  1LVA A;  5IP9 J;  3H9Q A;  2XAU A;  4G6Q A;  2V9V A;  4RA2 A;  4RGU A;  1MH3 A;  3HRM A;  1I39 A;  2KDO A;  3GCM A;  2OU2 A;  4AWX B;  3EUH A;  4BJ6 C;  1RES A;  3BR2 A;  5F0C A;  1J09 A;  2EIJ H;  5J8C A;  4PSW A;  5KAF C;  3LSK A;  3TMO A;  2FNA A;  1G3S A;  2K5C A;  1R5H A;  3K70 D;  2VBX A;  1FLI A;  4M71 A;  4U0V A;  2UZK A;  1Y0N A;  1SD6 A;  2ICW G;  2XAH A;  4V2F A;  2QCO A;  4DIQ A;  2W7N A;  3SHF A;  2OTJ I;  1LFU P;  3VPR A;  3D0S A;  3BTC A;  2UWM A;  3JRC A;  2FML A;  1RZ4 A;  4JK1 X;  3C2B A;  2PLY A;  3BR3 A;  1H9T A;  4E7Z A;  2H8R A;  3QP6 A;  2OBP A;  5GPC A;  5JR3 A;  2KIM A;  3BTJ A;  1RKW A;  3HSR A;  2OQG A;  3IV5 A;  5HNH A;  2HU9 A;  3I54 A;  3ZQC A;  3RPU D;  1R49 A;  1WJF A;  2V6C A;  2QA4 I;  3G1L A;  3OIP A;  2QYO A;  4DZJ A;  5DD8 A;  4IRI A;  2NVT J;  4XKV A;  2AHQ A;  3VSL A;  3VEP A;  2QGU A;  3GFJ A;  1NG7 A;  3TL4 X;  5KHD A;  2PG4 A;  3FIS A;  3S1R J;  2HYG D;  2VBY A;  4XSX F;  2DPU A;  1N78 A;  2STW A;  3P5J A;  1USS A;  2MC3 A;  1TC3 C;  3J81 K;  1A35 A;  3ZMT A;  1AOY A;  1A36 A;  4B8X A;  3CTA A;  1I50 J;  4BJT A;  5ICG A;  4DJA A;  2O9L A;  2VE8 A;  4WCG A;  3ZMS A;  3S32 A;  4L5I A;  2LLK A;  1SAX A;  5FKK A;  2VC0 A;  1FOK A;  2HEO A;  3HPH A;  1Z3X A;  2DOF A;  3DFG A;  3ZN0 A;  1VQN I;  1U9O A;  2MA3 A;  3Q3S A;  2L01 A;  3ABL H;  1HBX G;  3LSH A; 
#chains in the Genus database with same CATH homology
 2EIN H;  2EIJ H;  3WG7 H;  2DYR H;  2DYS H;  1OCR H;  2ZXW H;  1OCO H;  1OCC H;  2EIK H;  3ASN H;  5B1B H;  1V55 H;  2Y69 H;  3X2Q H;  2EIM H;  3AG3 H;  3ABK H;  1OCZ H;  1V54 H;  3AG4 H;  5B3S H;  5IY5 H;  3ASO H;  2OCC H;  3ABM H;  5B1A H;  3ABL H;  3AG1 H;  2EIL H;  3AG2 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...