3ASNH

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3asnH00
1V54H 5B1AH 3AG4H 3AG1H 3AG2H 2DYSH 2EIKH 2EIJH 2Y69H 2ZXWH 3ABMH 1OCRH 3ABLH 5B3SH 1OCOH 3X2QH 2DYRH 3AG3H 1OCCH 3ABKH 2EILH 5B1BH 3ASOH 2OCCH 1OCZH 3ASNH 3WG7H 2EINH 5IY5H 2EIMH 1V55H
chains in the Genus database with same CATH superfamily
4ESJA 3ZQQA 3GZNB 1LPQA 2P6TA 2EJRA 2VC1A 3W2WA 4EM1A 2A69F 2V1UA 4UNOA 4ETSA 1FEXA 4XLCA 3LFUA 1IUFA 5DD4A 1LNWA 2VOOA 4BS9A 3O3KA 3KYCB 4A0XA 3KZIC 5TRDA 4A3EJ 2VKHA 5EGOA 1GHCA 2VJ4A 3ASNH 2PJPA 1IF1A 2X6WA 2CV1A 2YU3A 4LLLA 4HLXA 3TDZC 5HS7A 3S17J 2IAIA 1F43A 3NAUA 1IXCA 4CZCA 2L9SA 3PM1A 2KIFA 1FY7A 3LSKA 2EV6A 2CMPA 4UV9A 3KZYA 3QP5A 3CCQI 2L02A 2K02A 3BZ6A 2V9VA 2KFDA 3LFKA 3HUGB 1U78A 1FZPB 4PJJA 2KJCA 1YW8A 2V1XA 5DDGA 2Y30A 4XLPF 1SFXA 5K1YA 3FWEA 1BA5A 3VODA 2VASA 1B9MA 3H9GA 2EWNA 4XKCA 2RKHA 2K40A 3LSHA 3VSKA 2VE9A 4HF2A 3KP4A 4PFPA 3LOCA 2B0LA 2KRCA 2R7ZJ 5DEQA 3E5QA 3JSOA 5EZHA 3F22A 2KQRA 2CS3A 4XMYA 3DBLB 1WJBA 5EF6A 3MCZA 5E1ZB 1XMAA 3WE2A 2KIQA 2A3SA 5HOOA 2RVCA 4ZTFA 1JT0A 1YJNI 3J80K 5GPCA 2OD5A 4MNUA 4AC0A 5K7FA 3WTSC 3HGYA 4XORA 4U0WA 5LHHA 3JRIA 2W85A 3M8EA 3EPZA 3WU0A 4QPQA 2DLLA 2MSYA 3BR3A 4RAYA 5JLWA 4X0GA 1HDDC 1IZ1A 3FF5A 1IV8A 2LREA 2EK5A 3BG6A 4BQQA 3IC7A 2I8DA 1JKQC 3L2QA 3B6AA 3J81Z 2FBKA 2A05A 3GTKJ 2F5EA 3R60A 3FXRA 5E1WA 4BYYA 1FNNA 1I3QJ 2VBZA 3BOQA 4BDYA 2WWYA 1B4AA 3PIOF 1XPXA 2WBMA 1SVLA 1R1VA 3ZPLA 4L9NA 3SEZA 3E1SA 2XSJC 3CZ6A 2ESHA 1R5ID 2H94A 1JJ6C 4HLYA 1G6NA 2L9VA 3ZN1A 3JAMK 3RPUA 2EFQA 3VFZA 4F93B 1D0YA 1Y8RB 5GADJ 4WXDA 5B1BH 2L7MP 2RGVA 2KISA 4OIRF 3QRFF 4AIDA 1POGA 1B72B 3CUOA 4A6EA 2G7UA 2A07F 4A3CJ 4Y52J 2JZYA 3QU6A 4QSHA 4XOPA 2NS0A 1VFCA 3A0HC 3WTYC 2IGNA 1A6IA 1ZYRF 5L3EA 1Z77A 2XRLA 5D8LB 2PBIA 1G3WA 1FIAA 3ABUA 1MMNA 2CG4A 2MABA 5ILVA 3U9GA 3K4CA 4BBRJ 3C7JA 2K3PA 4N9HA 4NC6A 5L3DA 2ESNA 5KHDA 5HLTA 1G3SA 2RNGA 2E1NA 4UVCA 1TNSA 4PUSA 1YX5A 1ETYA 3FMRA 2FJ1A 3F23A 3OIOA 1QNTA 1RI7A 1QPIA 4HV5A 1ON2A 4DYQA 5BMZA 4MLOA 1QZYA 1KA8A 5GP9A 1ENHA 1BI3A 4C2TA 4M3GA 4IHWA 2IW5A 1E3OC 3GVAA 4V19K 4IHVA 2N8GA 4IF4A 4XM3A 3L2VA 1E3PA 3SFIA 1ZELA 1ORKA 2ZXJA 1E0EA 1MBKA 2XKPA 4JX4A 1R71A 1U0JA 1Y56A 5C4XJ 4B4CA 2HTSA 2DJIA 3I71A 1UJ8A 1W7PA 2IS1A 4B44A 5M5YJ 4EGYA 3CF2A 2R7QA 4XSXF 1D0XA 5HDKA 2V1NA 1LUJB 4XKVA 3OYNA 3ISPA 4C30A 2RC4A 3DFGA 3H5NA 3O8GA 2R5YA 3HOSA 4E6KG 3CMEI 2VQCA 2BW3A 2IA2A 2EFPA 2M30A 3E7LA 4M9ZA 4MEXF 2NVYJ 4KICA 3MKLA 4EATA 1B6AA 1MZBA 3BR5A 4IHSA 3ZCOA 1T6SA 2LP0A 5HLIA 4EGZA 4KFCA 5IT9Z 2EBIA 1YX3A 1ONVA 1P7JA 5J1RA 2DOEA 1I27A 2LBFA 2EFOA 3CD6I 2EA4A 3HG9A 1D0ZA 1NHAA 3SDBA 5IT3A 2ZBKA 2OU2A 2FMLA 3P9CA 3TOAA 2VQHA 4LK0F 1TZLA 4PDKA 1HC8A 2WY8Q 2TCTA 1YW9A 4BUPA 1SVOA 2Y75A 1QHHD 2WAQA 2NXNB 1XSVA 3HOZJ 3T1BA 3KEYA 1FYKA 4UUSB 2Y9YA 1Q1VA 2VLAA 3JREA 1IRGA 2VT2A 5EJCA 2CUJA 4L9VA 1K78A 2QSHX 1MMGA 3LA3A 3DKXA 3TP3A 4A5MA 1MW7A 1PUFB 2Z5UA 1FOWA 2I10A 4RMNA 3NEUA 2UZKA 2GA2A 2L4MA 3I4PA 5J47A 4NC8A 3EYYA 4FASD 2HQ5A 5HDGA 1LKXA 2Q1ZB 2UXNA 3EYIA 1E2XA 1JUPA 2VC0A 2XKOA 3F8MA 3V8JA 3IRQA 3F6OA 2MG4A 4PGHA 4BXUA 3OYLA 2E1CA 1HOMA 4HW0A 1LDDA 2WAQN 2DODA 1R5HA 1MNEA 3AL0C 2PQ8A 1X2MA 3LWFA 2QSFX 4AVPA 1Q1HA 3H92A 2R7WA 1T98A 2XRNA 2HQRA 2JPBA 4IQ4A 5FD5A 2AXLA 2HEOA 2M7BA 2BY1A 3CUQA 1FX7A 3CDHA 1HKTA 2X0LA 4H0EA 3HRSA 1NG7A 3EUHA 2X6XA 2GIZA 1K6OA 1UG2A 1X3WB 2P5VA 4UB8C 1X3ZB 5F0FA 2DMQA 2L01A 4LLGF 4CO8A 3RJPA 3W6KB 1VQ8I 3DPUA 3M1EA 2K9SA 2E35A 3BR6A 2QUFA 3ZMTA 3RIRA 3K4KA 1VTNC 4YIRX 4AIKA 1ZKGA 1MSFC 5L3BA 4M74A 3I9V2 5CJ9A 3P9IA 3I56I 1LE8B 2LKXA 2QSGX 4RLQA 3I4NJ 4G6QA 4JP0A 3T8RA 1DP3A 1KZHA 1VQ7I 4AU7A 1D1CA 1SAXA 1IRZA 5L3CA 2JQ7A 5J1YA 5J4YA 1K83J 5LRSA 1YIOA 4S04A 1ETOA 4GGGA 1T08B 2RQQA 5E1XA 5F64A 3NRVA 3S3OA 3K1PA 3RZDJ 3S2HJ 4F91B 4MIMA 1IC8A 1WZ2A 2V7FA 5L3GA 1VQ4I 4GYIA 5LGUA 2KPMA 2ZFUA 1ETWA 3Q0VA 2NNNA 4HX4A 3WGGA 4A3BJ 4BNCA 1VQ6I 5K5QA 1FYMA 2PLYA 1MD0A 3IHUA 2A6HF 2HI3A 1GXQA 2WTEA 5LEJA 3QP6A 2X6YA 4PGGA 2YU9J 2XGEA 3K7AJ 4RGRA 1UB9A 1OR7A 5KK1A 2Z9OA 2CQNA 3UKGA 1X1PA 2UUZA 2EH3A 2Z99A 3O2PE 4BL0B 4RS8A 2K9NA 2QVOA 1MGTA 2XGCA 3VB2A 3H1CA 5IPAA 2CQQA 1G3YA 1OPCA 3FBNB 1LQ1A 4P9FA 4XKWA 5H6RA 1W5TA 2IGKA 2L9RA 3ZGKA 4L9TA 2NRAC 2HDDA 2DXIA 2DA2A 4CGZA 3C3WA 1DP7P 2COMA 3CF5F 1NK2P 3IH2A 5DCFA 1UAAA 3KP2A 3OYDA 1PDNC 3I55I 4K2EA 1OJLA 1SEUA 2ZMEB 3IWZA 2NNYA 2M2EA 2HQNA 1MMAA 3GCMA 2LFBA 1V4RA 4NHJA 4IKFA 1SFOJ 3ZQGA 3BZCA 5D4SA 3GFIA 3IWFA 2R7FA 2VBXA 2K85A 4BXFA 2DQLA 4II3A 4PJMA 4G12A 5D4RA 1WWXA 3GYHX 1N75A 4RB3C 3FXJA 2MH9A 3BZKA 3WGHA 1LJ9A 3GFLA 4EJVA 1YRNB 1OCOH 3LSTA 2V4JC 2DDBA 2XASA 4KYWA 2MBFA 2UWMA 2M7AA 2VI6A 3I53A 3KP7A 5D6FA 3CCJI 1W4MA 1ZREA 3WG7H 5FFXA 3A02A 3W3CA 1R49A 1GUUA 2LR8A 2Q8KA 2DOAA 3RQIA 1HW5A 1A04A 2BGCA 3BR1A 2TDXA 2V6CA 1T0FA 3G3ZA 1H9TA 4DJAA 4ITVA 3LNQA 1A36A 1MIJA 1ZAOA 3OYEA 1PP8F 4M3FA 1R36A 3PO3J 4B3AA 1J9IA 2A68F 2CWEA 2K27A 4AM3A 5D5VB 2KHMA 1YJWI 2F5VA 3SHFA 2W82A 4D9JA 1DPUA 4X1EA 2DI3A 3GWZA 1ZRFA 3SFZA 2R7DA 1QZZA 1U8RA 4D7MA 2HDWA 5E3LA 1RC9A 2ZCWA 2KJBA 2XVCA 1XGNA 1ETKA 2ZJRF 1I39A 1BR2A 1REPC 3GMEA 3L09A 1OYYA 4KT5C 3D5SC 5FLVA 2LY9A 3MKWB 2OZ6A 4C2MJ 4IX7A 4UVBA 1XMKA 2R3SA 3HIFA 1YS6A 3TOBA 4D7NA 5F27A 5B3SH 3T0YA 2STWA 5LRRA 1OYWA 5FROA 1UHWA 3DBRB 2E36A 1H8AC 5F08A 2ELHA 2DTRA 5E8IA 2AQEA 4HF1A 1QPMA 1TWHJ 5F0CA 4RA2A 4KITB 3CP8A 1XC5A 1UZCA 5LGNA 1H0MA 2MFZA 3ZR8X 3OY9A 1L3LA 1Z3YA 3RCOA 3DBHB 4NUBA 1AOYA 3BLYA 2QWWA 1WH7A 5A2QZ 2QQBA 1FIPA 4IPAA 4NC7A 4KDPA 1Z21A 1O3TA 2BY2A 4G9YA 4WF2A 1SFUA 3DV8A 3KX2A 1WQ2A 1R22A 2DT7B 3H5AA 4W97A 5D8KB 1Y6IA 2KZVA 3VYSB 1OYIA 2VE8A 1H89C 3S3MA 2FSWA 4IHTA 1RRJA 1CQTA 2BYVE 4IJAA 2R7UA 2Z3YA 3OIPA 3RYRA 2XAQA 3M07A 3MKZA 2HGCA 2VL8A 3NARA 1BBYA 2BXZA 3DF8A 1D1AA 3SJMA 2F5FA 1IN4A 2VBWA 1O7FA 2B7EA 2NS8A 2X85A 3IP4B 4FISA 4U0VA 4BEHA 3TEDA 4OIPF 4M6XA 4RBOA 4EM0B 3I54A 5C44J 3AFHA 2GXBA 3TDUC 1BW5A 2RREA 3B73A 4V2FA 5HODA 2K5CA 3EUKL 4ZC3A 1D3YA 3BWGA 2XB0X 1I1GA 4RGSA 3ZQLA 3TW7A 3OYGA 2BY0A 3ZN0A 5EG0A 2WADA 5JHUA 3WTUC 3WTVC 2EIMH 3HGGA 3ONQA 3WG9A 3IL2A 4YG2F 1O57A 3V7CA 1S72I 2B63J 5EEAA 3CC4I 2DYSH 1Z6RA 2H8RA 2M9HA 2HKXA 1WCMJ 2WV0A 3ABMH 3ABLH 3JRGA 1WJEA 1KU7A 2X48A 3MVPA 4E7JA 1TBXA 2Z33A 4OAZA 3WTTC 1W36C 4L0YB 3BCAA 2PX9A 4JX6A 1FMVA 2K86A 5JLXA 1MBHA 2HXOA 2FRHA 3D1NI 3ASOH 5HS9A 2HXIA 1T38A 1QO0D 2CQKA 1KYZA 3K1NA 5IP6A 3S2WA 5FLXK 3U2RA 3AG4H 2YR2A 1I5ZA 5F6FA 2D1HA 1J5YA 3OR1C 1IRXA 2DW4A 2HWVA 3Q0WA 3NWTA 4Y17A 3K70D 1CF7B 1JHFA 2BE5F 3ZRGA 2ELJA 2MA3A 4XLEA 3PQKA 1HCRA 4AYBN 3GTOJ 1JUSA 4OAYA 1KU3A 4XSZF 3JRAA 3OYFA 4I99C 1EH7A 1E17A 3B6CA 1V5FA 1XCBA 4GYGA 1YTYA 4HNUA 4BKXA 3PFIA 2E34A 3BQZA 4DBRA 4ESFA 3OYHA 1KQ8A 1BW6A 3FDYA 4XQFA 1A5JA 2KMUA 2JSCA 1XDUA 3VWBA 3CCUI 5EDNA 1WJCA 3CJRB 3BC8A 5FO5A 5IYDJ 1Y0UA 4RAGA 1U5TB 3BCBA 4R79A 2D1VA 1K4SA 4XIDA 1OISA 3L1PA 3S1RJ 4DYRA 3KYLA 2KLOA 1VQPI 2NVUB 1K61A 1YITI 2IA0A 3K2AA 3K4BA 3L2UA 4A2UA 1GVJA 3OWTA 4CSWA 1IDZA 1XS9A 1KYWA 1YJ9I 2XSDC 3VEPA 4MQVA 3OMYA 3TL4X 1ZRCA 2HPIA 3F8NA 1ZR2A 2Q2EB 1ZR4A 2FD5A 2VJIA 2DMNA 1VI0A 3PUBA 1R1TA 5ED4A 2EA2A 2XHKA 4CXFA 5CQGA 1OLTA 2PMZA 5KVRA 2ISYA 3ULQB 1NG6A 1WJ5A 1EKEA 1P6RA 4KIFA 2HYGD 4M72A 3LA7A 2O9LA 1SAUA 3FXOA 4PSWA 3RDIA 2EV5A 2DBBA 3F21A 3J7ZI 2CUEA 3GW2A 2DCEA 2EIJH 2Y69H 5E20A 5LHGA 4ENMA 1X3UA 3PQJA 4RB0A 1AKHA 4UB6C 5F1JA 1LFPA 3RQ4A 2E2IJ 2LF7A 4YELA 2VPLA 4I98B 2YX4A 4MTEA 2MGQA 2HU9A 4KMFA 1PJRA 3A4CA 1FLIA 1EH8A 1S9HA 4I01A 5GTIC 2PMZN 4KUMA 1RR7A 2DK8A 4NB5A 4BHCA 2GZWA 4J19A 2HS5A 2M4KA 2GIVA 4L18B 4QPOA 1MJAA 3HTUA 2HYJA 3LSIA 4D1QA 3K4LA 5DYMA 4U7DA 2R93J 1W5SA 1HLVA 2VT3A 4DBQA 1U6GA 4D0PA 3AKZA 4N4NB 5B5EC 2A6TA 3H3UA 3W2VA 2L9NA 2JA2A 2JPCA 2ZB9A 1W0UA 3H35A 1XG1A 3G6EI 5IY5H 2XGXA 4Y13A 2PEXA 4N9IA 4P55A 1MJ9A 4ZYEA 5GTHC 1RUNA 4NQWB 1MDMB 3K0LA 2V9PA 1FJLA 3KLNA 2M34A 2O61A 4OIOF 4PFOA 4BE0A 4ZDPA 3QU3A 3ERED 4RGXA 1F4KA 1LDKB 2IP2A 3BQYA 1TWAJ 1WJAA 1P9QC 1S3JA 4D5FA 3FXMA 2DJNA 3BT9A 1XN7A 1RESA 3IKTA 2ZJPF 3GZ5A 3HM5A 2DK5A 5M3FJ 4I6ZA 1DQUA 4QLCU 2JSPA 3GLXA 2XPWA 1MJBA 3OSFA 2BXYA 1K79A 2KRHA 2ZC2A 5HS8A 3V8KA 1VQ5I 4HA8A 3AL0B 2ZNYA 3C2BA 5C3EJ 2P7CB 1U5TC 2VONA 1MMDA 5CPRB 2DFFA 3HKZA 1ACIA 3LMMA 2MC4A 1YLFA 4II2A 2VUMJ 1LEBA 4RDUA 4XLAA 3OSGA 3B02A 2FBHA 4N0BA 1YO5C 4I09A 1KU2A 5HLHA 3MZYA 2LG4A 2Q0OA 3MQ0A 1MMSA 2XAHA 4I76A 1WH5A 3LSGA 3UR3C 3HUGA 1GXPA 2ACJA 1IUYA 2VIXA 4M9XA 1D5YA 4PSXA 2PMUA 2E5ZA 3K6GA 1RNLA 2G0EA 4YIFA 1ZGJA 4LMYA 3DTKA 2IEKA 4AWXB 1VF9A 1J2XA 2J5PA 2ZXWH 1V5EA 3FM5A 1SANA 5IYBJ 3ABTA 4ABZA 1IAWA 5KNLA 3HKZN 4DQ2A 1RKTA 5BQTA 5ICCA 2R5ZB 2DPDA 5JI6A 1X4OA 4A69C 1G4DA 2XGDA 1BI0A 4ENKA 3MAJA 4P5OA 3RKWA 2O8KA 4YFKF 1USTA 3S32A 5J6XA 2O6GE 3T8TA 3V8LA 3OYJA 2AS5F 4HAMA 5ICFA 4EJWA 5FKLA 3RZOJ 3AAFA 4ENNA 2ZJQF 1OMIA 3V4GA 4HZFA 1I50J 1V54H 4HOBA 3W6JB 3ZMUA 2YPRA 4OU0A 4A93J 1YE9A 3AG1H 3S8PA 1S7EA 2LH9A 2PG4A 5M5XJ 4Q5SF 4ZTJA 1R5GA 1HDPA 2P5KA 2WY7Q 4FE4A 2X1EA 2QZ8A 2CJJA 2Y48A 4M6VA 4Q47A 4MQ9F 3BY6A 4JX5A 1AHDP 3M1CA 5E18F 2DMTA 2PJRB 4FETA 4S0HB 1D5VA 1TP4A 5CYVA 3ZQIA 2IS2A 3FKIJ 2HZDA 2W57A 3M3YJ 2KDZA 4R1HA 3PL8A 5KCMA 5J3LA 4YFNF 4UV8A 3M9AA 3KEQA 2XAUA 2ECBA 2R4GA 2OC6A 5JHFA 3V7RA 4B48A 4AUXA 4E4HA 2DA5A 3K9TA 1ZG5A 1QQIA 2VBYA 3PSIA 3G1LA 3HB9A 1MNDA 5CQEA 2FA5A 1SD7A 3I3LA 1F1ZA 1FT9A 1RETA 1MNMC 1YHQI 1B9NA 2IXSA 3CMMA 2O8XA 2PI0A 4HRIA 4KIGA 1B72A 1WKMA 2QQ8A 2A5YB 1SD6A 1HF0A 5DV5A 1U3EM 4RGUA 3H9JA 3BG7A 4XLHA 1BC8C 5HDNA 3PIPF 3DEEA 2QKLB 3UNGC 1ZH5A 2FQ4A 2LNBA 4YRVA 1UCRA 4BHPA 4GRIA 3K4NA 5FKMA 3HOUJ 1CGPA 3W6VA 1YW7A 2LSOA 1HKSA 1JUMA 3K4JA 4A6DA 5GAEJ 5K5RA 3U1DA 2EFNA 1IN8A 5AIQA 2JWTA 4E7ZA 4S05A 1G59A 1WI9A 2LK2A 4FX0A 3SZPA 4OOIA 1B8IB 2ZFWA 1R7JA 2M1BA 2P6SA 1S7AA 4F52A 4P9UA 3OYCA 4A0YA 3TQNA 4G7ZF 3N97A 2IA1A 4YIIA 4IHYA 2M3AA 3M7GA 4QIWN 4BE2A 2R7SA 1I6HJ 5D5WB 5FB2A 2XIGA 2DA6A 3HSEA 1ZLKA 1HQCA 1T56A 2DU9A 4DZPA 3RKYA 3E6MA 2FQ3A 1A35A 2JTVA 4KN7X 3HOYJ 4CCKA 4DGWB 2VJJA 2J5OA 2QBYB 5TGTA 2HKOA 5JR3A 2FE3A 4UUTA 3QOPA 2XV4S 4KMUX 3WHBA 2IS4A 3TMOA 4HX8A 3OS2A 1BIBA 5HNFA 2E1MC 2DA7A 4E7IA 5AIPA 1R1UA 1ZQ3P 3F3XA 2E19A 4JQFA 3LAPA 1S8NA 2HOEA 5J40A 1V3FA 2XAFA 4OIQF 2NVQJ 1YOVB 3HXLA 3EUHC 3EDPA 2JA8J 1R9TJ 4UHTA 2KIMA 3EETA 1IGNA 2JUCA 4OWRB 4BGDA 2B9SA 3A03A 1XMXA 2YS9A 5ILUA 5LLQA 4J01A 3PFYA 3IAM2 4XR6A 2M5WA 4UUSA 1FYLA 3MKYB 2GWRA 3OS1A 3ZMVA 1R58A 2QQ9A 3CCLI 1KQ0A 1SMTA 5FKNA 2Z16A 1R4MB 2F5CA 1X1BA 3HPHA 5C4JJ 1PUFA 3HHHA 5D6EA 3GBGA 3CJNA 2E71A 2GXGA 2RAEA 3ABKH 1BI2A 1Z67A 4LD5A 3DPLC 4CYCB 4CA0A 1FPQA 2CUFA 1HSTA 4H4KC 2M0MA 3DKYA 1WFXA 1U2WA 4I0BA 4V2GA 1HXDA 3ZQFA 3CCMI 3H5RA 1P2FA 1P4WA 2G9WA 5JVGF 2A61A 4O6JA 4LG0A 2FU4A 4F55A 3HOTA 1DU6A 3FK7A 3W2AA 1UHSA 3CCSI 3GXOA 4QWQA 5LD2C 5FJ8J 1O3QA 5ICEA 2FOWA 1Z3XA 3FXLA 5FRMA 2DTZA 1R4NB 1UFMA 4BH9A 1J59A 3J81K 1TTYA 2R7XA 4NBQA 2W00A 3FISA 4G8XA 1IJWC 4HQMA 4M3BA 5CVRA 3HDDA 1R23A 3R4KA 3VYUB 2ECCA 4C3HJ 5BOXA 1JI8A 1RKWA 1TNTA 3CQZJ 1RR8C 1RZ4A 4LK1F 2X4HA 5DM7F 4I2OA 3GTPJ 2HYFA 2BVMA 2MW8A 3ZQ7A 4KISA 1BR1A 1GV5A 3GLLA 3HJEA 4XRFA 2EB7A 1STZA 4CICA 2NAZA 2OJED 2P8TA 2BBYA 3JRFA 1OFCX 3QPTA 3E5XA 1MH3A 4A12A 1LE8A 4DIQA 3HEFA 5IOZA 2WC2A 2FEZA 3K2ZA 3FZVA 3S1QJ 4ZDOA 5EEHA 2DFIA 4C3JJ 3J80Z 3LAJA 1N25A 4CHUA 3PNTA 3MFKA 2JA7J 3A2KA 3F9KA 2MLGA 1PVEA 1D8JA 1FOKA 2XPUA 2ZSIB 3CC7I 4JK1X 5BNGA 1O3SA 2IGOA 2LMDA 5E3OA 1LVAA 4UVAA 2NVXJ 4ZDLA 1ZRDA 4E7KA 4C9YA 2DN0A 2KT0A 4P1WA 3DCFA 4FQGA 2P7VB 4EVIA 2IRFG 4A0ZA 2KZGA 3DP7A 2KL4A 2W48A 3O6BB 1YG2A 4LITA 2CH0A 5DCMB 3F8CA 4GCVA 4ZYHA 1QVTA 3CCRI 3FK6A 3ERMA 4ENJA 2JA5J 3JAMZ 2AQFA 5TISC 1P92A 2GAUA 3M8JA 1E3HA 1FTTA 2W1OA 4FCYA 2D5VA 3G1MA 2MLKA 3E6BA 3HSRA 1UHMA 4BJ5C 1ITYA 2LOOA 3GZ6A 5GPAA 4OMYA 3DTIA 1USSA 3VSLA 3R61A 1XB4A 1F9NA 3MD2A 4Y15A 4IL6C 2ME6A 3L2WA 1FP2A 2ZXHA 2I5UA 3OOPA 4FT8A 2CU7A 4N4OB 2R7RA 1LB2A 3CMAI 4IQJA 4ZJZA 1BJAA 1Z7UA 1I6XA 2ZMEA 1VQNI 4L9JA 5IT9K 3I59B 2R92J 3ESWB 2BZTA 5HNHA 1YS7A 2V9KA 1OCCH 1Y8QB 3RI4A 3LQRA 3SXYA 3OIQA 1F5TA 4G7OF 3A01B 4BBSJ 5ERIA 2GA1A 3Q5FA 2VODA 2LD5A 1G3TA 3E97A 1GT0C 4CCMA 3D5RC 5GAGJ 1TT0A 3E6CC 1YRNA 3TW6A 4LLNA 2ELKA 4QTRA 1VQOI 2OZUA 3JCUC 3P5JA 5IP7J 4PJ0C 2CW7A 1VQ9I 1M1EB 4GFBA 3MZHA 2QM3A 4UY8I 4XRSG 1MBFA 1FOYA 2UV1A 4PK4A 1JKPC 5EGOB 2PN6A 1TC3C 3GTGJ 3GTLJ 3BTJA 3CMYA 4LIUA 4AD9A 5BPDA 1WVRA 3BDDA 2E7WA 2M45A 2JN6A 4XK4A 3TGNA 1IO2A 1BJZA 4YFXF 3SZGA 4HDUA 2AXTC 3HOWJ 1SD5A 2LY2A 4HF0A 3KP5A 3OYAA 3I0TA 3D0SA 1LFUP 1AU7A 4Y7NJ 2VKEA 4MHGA 2L7FP 1W0TA 3IH4A 1A6QA 1S6LA 2E2HJ 3CLOA 2GBYA 2X51A 3ROUA 3BPXA 4XN0A 5EEGA 2F48A 4A3MJ 2OV7A 5IOYA 5EYRA 4C2UA 3EQLF 1C0WA 1ETQA 1Z1DA 3KCCA 2M0CA 3L2CA 3KYDB 3L00A 2IS6A 5ILSA 1WPKA 4HNVA 4A5NA 4XICA 5CVVA 5LFAA 2WB1A 1ZGWA 3HYIA 3TO6A 4WK8F 2OPTA 2QQAA 3SQNA 1L0OC 3OL3A 3ZQCA 5FGMA 3ECHA 3DEWA 2JVHA 1V55H 3ELKA 1P4AA 1TW2A 4L5JA 2CW0F 4HQEA 4BE1A 4G6DA 1TQPA 3DQVC 3HC7A 4XBFA 3VOEA 1IXRC 1ODDA 1G8XA 2O5RA 4XLNF 4O5VA 2XPVA 2YUSA 4A3IJ 3FXKA 3QPSA 2LLKA 3S93A 2O7OA 4IRGA 2X1CA 3R0JA 1DPRA 4MEYF 1G2HA 2IVMA 1X4PA 2CYYA 2WB1N 2MC3A 3TO7A 2DFEA 1ZK8A 1ZG3A 5LHIA 1AWCA 1HW1A 2K9LA 1TL8A 1ZLJA 3CDIA 1W36D 2H1KA 4CCLA 1ETVA 4IRIA 2HDCA 3FXQA 2RNJA 3IUOA 3E5UA 2VXZA 3Q9VA 4R8HA 2H27A 1MBJA 1QHGA 5CKTA 2AHQA 4E7HA 3WHCA 2XROA 3HOXJ 1TLHB 1SFEA 2E5NA 4A3JJ 3C18A 2C6YA 3DU6A 3J7YJ 3JW4A 1TW3A 3KP6A 1HKQA 1OCZH 1RPWA 2A6EF 2DOFA 1AA7A 2KDOA 1JKRC 2QKMB 5EZGA 3QPHA 2DO7A 3REOA 1W1WE 3LSMA 1B1BA 2GQQA 4B8XA 2P4WA 5E3NA 2FXAA 2GOMA 2XF5A 3CDLA 4BQOA 4CDGA 4HX7A 4UUVA 2VOPA 1WJDA 4ASNA 2ZSHB 4B3XA 2E1OA 2OA4A 3OS0A 2LVSA 2EFWA 3OOUA 3CCVI 4D5CA 4XOTA 3K10A 4BAYA 1BL0A 2M87A 4E7SA 4AIJA 3O8HA 4DOZA 4BJTA 4L5IA 2F4MB 3OYBA 2G7HA 4BXXJ 1YYVA 3MWMA 2FBIA 1CF7A 4A3LJ 1YFHA 3QOEA 2W24A 2EZIA 5FD6A 5JVTA 1MSEC 1Z91A 2QENA 3HRTA 2DMUA 2E60A 2JMWA 3FMQA 2HVSA 2DA1A 5GAHJ 4LOCA 2RV8A 1W7PB 3E6DA 3JRBA 2GOXB 4HSRA 3E0JB 3GFMA 3BPVA 2OAZA 2XDVA 1WSUA 4Q48A 2ADUA 1IN6A 4IO9F 4U88A 4WXHA 2GXAA 4HPQA 4HDVA 2R5YB 2L7ZA 2DA3A 2H6CA 5B66C 3G4SI 2BW3B 1EV7A 5K5OA 3FBIB 5J4VA 3FIWA 2IT0A 1U5TA 4I7HA 1T39A 1KGSA 3CESA 5FKOA 5F0HA 1Z9CA 5IYCJ 4IXAA 5KAFC 5DS9A 3QAHA 4ZYGA 4WCGA 2DA4A 4Z2YA 2YSRA 4RM3A 1DGRM 2FMYA 3OV8A 2LBFB 3H0DA 1Y1WJ 3D5LA 3HBLA 4HV6A 3TKYA 4J00A 4NNJA 4HSTA 1RUOA 1R00A 2EZHA 5LEKA 2L2OA 1I3AA 2L0KA 1TQIA 1EA3A 3I64A 3QYEA 4CZZA 5D5XB 2Q2EA 1BI1A 4XN3A 1EF4A 2TRTA 1JHHA 1TQMA 1H9GA 4DYCA 1O7LA 1APLC 3IKVA 4IOAF 2V26A 3EUAA 3HRUA 1K78B 3JSPA 2XB5A 1UELB 4L0ZB 2CQ7A 1ZHFA 2JA6J 1FTZA 2X6OA 2EINH 3JTHA 3TP0A 4PCQA 2DT6A 3CCEI 1IDYA 4RAFA 2FX0A 3FKJA 4U7BA 1JGSA 3S14J 1QGPA 3Q3SA 3PUFA 3M8FA 5A2QK 2LC2A 3K4MA 2L4AA 4YEJA 1UG0A 4U87A 1X1CA 2ID6A 1TT5B 2DQRA 3NWSA 4OMZA 2QEXI 4WX9A 2IPQX 2KRFA 2Y0SA 2D2WA 4U0YA 2HVRA 2F2EA 2E1MB 2NS7A 4E7LA 2CV2A 1S29A 2MYSA 5LGTA 2GLOA 1OCPA 2XF6A 1SC7A 3JRHA 3KIOA 3HRMA 3CUQB 1N77A 3AG2H 2VQGA 1X58A 2L7KA 4F3QA 2DDAA 1Y1VJ 1XGOA 1RIOH 3R0AA 2XAGA 2Z1DA 2FF4A 1VZ0A 1S7OA 5DTDA 3HZJA 2EPFA 3RKXA 1ZARA 2H8WA 3BG3A 3SZTA 1JJ8C 4PJLA 1DU0A 2O03A 2MH2A 4B09A 2O0YA 3WU2C 4X6AJ 2P5LC 1XTAA 4CYDA 1P4XA 3S2DJ 2O3FA 3RYPA 2K9MA 4LB6B 4KN4X 2STTA 4IVNA 3BG5A 3SDGA 1KONA 3GF2A 4NQWA 2Y0SN 2DFHA 3IAS2 1MDMA 2OTJI 5J1UA 1F36A 3DXJF 4BACA 4EJOA 3ZQHA 1FMWA 1OCTC 2QA4I 3BJ6A 6PAXA 1U9OA 2W25A 3G71I 2F4OB 1BC7C 2R0QC 3WE3A 2ZKZA 1X2NA 4KT6A 3PSFA 4XONA 1SVMA 2NYXA 3I58A 1T95A 3CC2I 3BG9A 1Y0NA 3H36A 2K4BA 3C2GA 4RB1A 1LFBA 4C3IJ 5K7HA 1FWZA 3A1YA 1HA8A 3RPUD 4ANJA 1WJFA 2VN2A 1MBEA 2HTJA 4G6TB 1QVUA 5H6QA 2W4SA 3QPLA 1LEAA 2DAOA 2QCOA 4EV0A 5B1AH 1Y39A 2LY1A 3ZXSA 2COBA 2QYOA 1XGSA 1VQLI 5E8GA 3G2BA 5HLGA 4HG2A 2JK3A 4HYEA 4XL9A 2Y31A 1Z6TA 3QYBA 2HQAA 2MD0A 3HPGA 3WGIA 5H2FC 1FC3A 1WRJA 1BOBA 3LSRA 2A5WA 3LSJA 4BU2A 2XAJA 4GXOA 2L3DA 3FX3A 2VB6A 4RAZA 4Q4ZF 3BROA 3GEZA 1B59A 3LQQA 3CLQA 1JTXA 2IGMA 2VQLA 3GTJJ 2EIKH 1NK3P 3S1NJ 1K7AA 3PNYA 3FXUA 2R5ZA 3HSFA 5M3MJ 3Q0UA 4XNFA 4BDZA 4LG0B 4Y3OA 1BIAA 2AO9A 4ZZDA 3KPHA 3BP8A 3CO7C 2K9QA 4IOCF 3I5UA 2DYRH 4BY7J 1HW2A 2P81A 5D5UB 3KETA 3COAC 2ZXIA 4LJZF 3PJRA 5FLMJ 2H1LA 2HOSA 3BR2A 1ZN2A 1WHUA 4BY1J 1W7PD 1XGMA 5FLXZ 3HOVJ 2OQRA 1FOXA 2KP6A 3K1MA 1R6RA 2E2JJ 1GLNA 1X19A 3TBIA 3C2HA 3DU5A 3NQOA 1WGXA 4F7ZA 4ZYDA 4LB5A 2F4IA 3V42A 5K7ZA 2BY3A 2FNAA 1IXSB 1A31A 2NOGA 2PJRA 1QA6A 4OINF 3MN2A 4EJTA 2RN7A 5J8CA 1JKOC 3X2QH 4B47A 4EMSA 5F04A 3CUQC 3T5XA 3SEQA 1TWCJ 4KNYA 4DW6A 1V5GA 3DLAA 5TJJA 1KQ9A 2JRTA 3LA2A 4WXCA 3JRDA 3MZ8A 2F6CA 5E79C 4JOMA 3L7WA 4CCOA 4KA4A 5HVQC 5IP9J 4G94A 3ZMSA 4IZZA 4IEJA 4PJNA 1GDTA 2M4GA 4JBAA 5FFZA 3TO9A 5J8FA 4FX4A 1XCVA 4B43A 4ZH4F 2HVQA 4Y33A 2BOLA 3IH3A 3BR0A 3F8BA 3BTLA 2OTLI 3MMYB 3KEOA 2EILH 5CVIA 4FTHA 3G1OA 1YI2I 3DKWA 2VJ5A 2V1DA 1BM9A 4W1UA 2X1DA 3CO6C 4CUGA 3L2RA 1IG7A 2VPRA 3S3NA 1J0RA 3OYKA 2IJLA 2CGPA 1LDJA 3K69A 4MO7A 3ZMDA 1ERDA 1Z05A 2ME0A 2QGUA 2DT5A 1IW7F 3R6SA 4EQQA 2CW8A 3JTGA 1JE8A 1PYVA 2Z2SB 4FHTA 4JYKA 1QBJA 2DPUA 4O3MA 2P0WA 1B8IA 4RLFA 3J7AY 3I4MJ 1BR4A 3MEXA 4KIBA 1VNDA 3H0GJ 2Y0MA 4IRHA 4DNCA 2X9DA 4I0AA 2XC7A 1FSHA 1OR7C 5LBQA 3P9KA 2WA0A 2RDPA 2JT1A 3M4OJ 3KE2A 3LL7A 3N4MA 4EJUA 1PP7U 4M73A 5F1RA 3KP3A 3RTRA 1BOAA 4LGWA 2CQXA 4B1RA 1T2KA 2OF7A 4LFUA 1O3RA 2OCEA 1ON1A 2ISZA 4BJ6C 3Q9SA 3CJTB 2VXDA 3BJOA 4E70A 1K4TA 4UXNA 2QBYA 3VDXA 4EM2A 1ZG1A 2M8EA 2ICWG 3C1DA 3GX4X 4GDFA 1J75A 3KFWX 3F0CA 5DD8A 2V6EA 3VYTB 4ESBA 4BEHB 3H3VK 2HFHA 2YX7A 2NOJB 3KLOA 4WWCA 2K3FA 2ID3A 5BPIA 2DMPA 2Y9ZA 2CUZA 2BEOA 3LSPA 1XSDA 2CFXA 3OYMA 3J7AO 1IN5A 2W84A 3A0BC 2W7NA 3RSNA 4AIHA 9ANTA 4Z6YA 2OUMA 3CTAA 4RM2A 5JFRA 3WTZA 2QF7A 1X1DA 5EG0B 2GM4A 1JXSA 1PUEE 4XRSA 1YQAA 2KKOA 3WTXC 5E3MA 3SYTA 3FHZA 3JRCA 4P96A 5CVUA 1FBUA 2FUG2 5KAIC 1EH6A 1KU9A 3VYRB 2UXXA 1XDSA 5DM6F 4AVZA 2HR3A 4MFDA 4MTDA 5L3FA 1FP1D 4CYCA 2OQGA 3QYFA 1T0FC 2CO5A 3JR9A 4A3FJ 4CCJA 1XSXA 4ZYAA 3S15J 2R7VA 2JUGA 1Z0XA 3DTEA 4HEA2 1DUXC 4M6YA 1T33A 4LG3A 4MFEA 5DUKA 4M3EA 2Y2ZA 1JTYA 3QQAA 3GFJA 4CCNA 4RB2C 2HOAA 2IBDA 2H6BA 2EZLA 4HNTA 1SFKA 3IV5A 3IRRA 2ZO4A 2H09A 4PZJA 1LVKA 1NTCA 5CVJA 3HL2A 1UMQA 3HHGA 3S1MJ 2VKDA 3G73A 3ECOA 2WAFA 5FRNA 4A3GJ 5BS6A 3QWLA 5ICGA 4BQAA 3OR2C 4GO1A 4XLFA 1FSEA 3CJQB 1NH3A 3ZOBA 4NDLA 3OYIA 1I1SA 4G7HF 2BHYA 4M3DA 3CCYA 3DWLE 2LDUA 2K7LA 2EQRA 2XUBA 4Y4RA 1XX5A 1D8KA 3FHNA 4XRMA 2CRGA 2VKVA 3CP2A 2M8GX 3RPQA 2L5QA 3F8FA 1BN5A 5H20A 1H88C 3HTSB 3VPRA 3DEUA 2PFBA 2WV1A 1DGWY 1D1BA 1SD4A 2BHZA 4FE7A 1TWFJ 3QODA 1U8BA 4TV7A 3K70C 4ZZLA 1QRYA 1FBQA 3BTCA 5M5WJ 1HSJA 2LRDA 4XKBA 1O4XA 2D45A 3WU1B 2HOTA 2L54A 2V79A 3F6VA 1EJ9A 3U21A 2LKSA 1IV6A 2JVGA 2ZMEC 3DLLF 2WAEA 2ZJ2A 3ML6A 1OCRH 3FM3A 1QU3A 2BV6A 3DPTA 4A3DJ 3H9QA 4HBLA 1J7KA 5CLSA 4ON0A 2F5DA 2QLZA 2CFOA 4A3KJ 2HZTA 4EEFG 1JT6A 4LIVA 1IN7A 2LKPA 2EZKA 1ZGAA 2ZNZA 5DCMA 3WODF 4F92B 1X1AA 1ZTRA 3KZZA 1W5CC 2PMHA 4KJZA 1J09A 3L9FA 1MH4A 3GTQJ 4M9SA 3N05A 2ETHA 2RQPA 4IHXA 1P7IA 2CSOA 2BVLA 2FOKA 1N78A 1HBXG 1AKHB 2KIUA 4AYBA 1FBSA 3E3VA 3ZP5A 1OQYA 2CV0A 1U9NA 1YIJI 1ETXA 3U1KA 1GVDA 3AG3H 2EV0A 1T8IA 3V7SA 1XD7A 3GO5A 1MBGA 2R7OA 2MD5A 2FNPA 2LYCA 3BJAA 1OKRA 2OCCH 5E17F 3BTIA 3RKQA 1K6YA 1SMYF 1DDNA 4DZJA 3OL4A 2JJ7A 2LTPA 1S5LC 2OBPA 4CH7A 1JGGA 1GV2A 3S16J 1Z7LA 5DUIA 3GUDA 1MKMA 4BQNA 3F72A 3H3ZA 1VQKI 4L5EA 5FKKA 2NVTJ 4MGRA 3I59A 4I02A 1ULYA 1TWGJ 2HNHA 1QZEA 2K4JA 3ZMZA 4M71A 4BHBA 2E7XA 3FMSA 2LF8A 2R7TA 1VQMI 2XF7A 1WI3A 3PNVA 3A01A 2JRMA 1IRFA 3WTWC 3PO2J 3GTMJ 5AONA 2HPMA 3P7NA
chains in the Genus database with same CATH topology
1V54H 5B1AH 3AG4H 3AG1H 3AG2H 2DYSH 2EIKH 2EIJH 2Y69H 2ZXWH 3ABMH 1OCRH 3ABLH 5B3SH 1OCOH 3X2QH 2DYRH 3AG3H 1OCCH 3ABKH 2EILH 5B1BH 3ASOH 2OCCH 1OCZH 3ASNH 3WG7H 2EINH 5IY5H 2EIMH 1V55H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V54 H;  5B1A H;  3AG4 H;  3AG1 H;  3AG2 H;  2DYS H;  2EIK H;  2EIJ H;  2Y69 H;  2ZXW H;  3ABM H;  1OCR H;  3ABL H;  5B3S H;  1OCO H;  3X2Q H;  2DYR H;  3AG3 H;  1OCC H;  3ABK H;  2EIL H;  5B1B H;  3ASO H;  2OCC H;  1OCZ H;  3ASN H;  3WG7 H;  2EIN H;  5IY5 H;  2EIM H;  1V55 H; 
#chains in the Genus database with same CATH topology
 4ESJ A;  3ZQQ A;  3GZN B;  1LPQ A;  2P6T A;  2EJR A;  2VC1 A;  3W2W A;  4EM1 A;  2A69 F;  2V1U A;  4UNO A;  4ETS A;  1FEX A;  4XLC A;  3LFU A;  1IUF A;  5DD4 A;  1LNW A;  2VOO A;  4BS9 A;  3O3K A;  3KYC B;  4A0X A;  3KZI C;  5TRD A;  4A3E J;  2VKH A;  5EGO A;  1GHC A;  2VJ4 A;  3ASN H;  2PJP A;  1IF1 A;  2X6W A;  2CV1 A;  2YU3 A;  4LLL A;  4HLX A;  3TDZ C;  5HS7 A;  3S17 J;  2IAI A;  1F43 A;  3NAU A;  1IXC A;  4CZC A;  2L9S A;  3PM1 A;  2KIF A;  1FY7 A;  3LSK A;  2EV6 A;  2CMP A;  4UV9 A;  3KZY A;  3QP5 A;  3CCQ I;  2L02 A;  2K02 A;  3BZ6 A;  2V9V A;  2KFD A;  3LFK A;  3HUG B;  1U78 A;  1FZP B;  4PJJ A;  2KJC A;  1YW8 A;  2V1X A;  5DDG A;  2Y30 A;  4XLP F;  1SFX A;  5K1Y A;  3FWE A;  1BA5 A;  3VOD A;  2VAS A;  1B9M A;  3H9G A;  2EWN A;  4XKC A;  2RKH A;  2K40 A;  3LSH A;  3VSK A;  2VE9 A;  4HF2 A;  3KP4 A;  4PFP A;  3LOC A;  2B0L A;  2KRC A;  2R7Z J;  5DEQ A;  3E5Q A;  3JSO A;  5EZH A;  3F22 A;  2KQR A;  2CS3 A;  4XMY A;  3DBL B;  1WJB A;  5EF6 A;  3MCZ A;  5E1Z B;  1XMA A;  3WE2 A;  2KIQ A;  2A3S A;  5HOO A;  2RVC A;  4ZTF A;  1JT0 A;  1YJN I;  3J80 K;  5GPC A;  2OD5 A;  4MNU A;  4AC0 A;  5K7F A;  3WTS C;  3HGY A;  4XOR A;  4U0W A;  5LHH A;  3JRI A;  2W85 A;  3M8E A;  3EPZ A;  3WU0 A;  4QPQ A;  2DLL A;  2MSY A;  3BR3 A;  4RAY A;  5JLW A;  4X0G A;  1HDD C;  1IZ1 A;  3FF5 A;  1IV8 A;  2LRE A;  2EK5 A;  3BG6 A;  4BQQ A;  3IC7 A;  2I8D A;  1JKQ C;  3L2Q A;  3B6A A;  3J81 Z;  2FBK A;  2A05 A;  3GTK J;  2F5E A;  3R60 A;  3FXR A;  5E1W A;  4BYY A;  1FNN A;  1I3Q J;  2VBZ A;  3BOQ A;  4BDY A;  2WWY A;  1B4A A;  3PIO F;  1XPX A;  2WBM A;  1SVL A;  1R1V A;  3ZPL A;  4L9N A;  3SEZ A;  3E1S A;  2XSJ C;  3CZ6 A;  2ESH A;  1R5I D;  2H94 A;  1JJ6 C;  4HLY A;  1G6N A;  2L9V A;  3ZN1 A;  3JAM K;  3RPU A;  2EFQ A;  3VFZ A;  4F93 B;  1D0Y A;  1Y8R B;  5GAD J;  4WXD A;  5B1B H;  2L7M P;  2RGV A;  2KIS A;  4OIR F;  3QRF F;  4AID A;  1POG A;  1B72 B;  3CUO A;  4A6E A;  2G7U A;  2A07 F;  4A3C J;  4Y52 J;  2JZY A;  3QU6 A;  4QSH A;  4XOP A;  2NS0 A;  1VFC A;  3A0H C;  3WTY C;  2IGN A;  1A6I A;  1ZYR F;  5L3E A;  1Z77 A;  2XRL A;  5D8L B;  2PBI A;  1G3W A;  1FIA A;  3ABU A;  1MMN A;  2CG4 A;  2MAB A;  5ILV A;  3U9G A;  3K4C A;  4BBR J;  3C7J A;  2K3P A;  4N9H A;  4NC6 A;  5L3D A;  2ESN A;  5KHD A;  5HLT A;  1G3S A;  2RNG A;  2E1N A;  4UVC A;  1TNS A;  4PUS A;  1YX5 A;  1ETY A;  3FMR A;  2FJ1 A;  3F23 A;  3OIO A;  1QNT A;  1RI7 A;  1QPI A;  4HV5 A;  1ON2 A;  4DYQ A;  5BMZ A;  4MLO A;  1QZY A;  1KA8 A;  5GP9 A;  1ENH A;  1BI3 A;  4C2T A;  4M3G A;  4IHW A;  2IW5 A;  1E3O C;  3GVA A;  4V19 K;  4IHV A;  2N8G A;  4IF4 A;  4XM3 A;  3L2V A;  1E3P A;  3SFI A;  1ZEL A;  1ORK A;  2ZXJ A;  1E0E A;  1MBK A;  2XKP A;  4JX4 A;  1R71 A;  1U0J A;  1Y56 A;  5C4X J;  4B4C A;  2HTS A;  2DJI A;  3I71 A;  1UJ8 A;  1W7P A;  2IS1 A;  4B44 A;  5M5Y J;  4EGY A;  3CF2 A;  2R7Q A;  4XSX F;  1D0X A;  5HDK A;  2V1N A;  1LUJ B;  4XKV A;  3OYN A;  3ISP A;  4C30 A;  2RC4 A;  3DFG A;  3H5N A;  3O8G A;  2R5Y A;  3HOS A;  4E6K G;  3CME I;  2VQC A;  2BW3 A;  2IA2 A;  2EFP A;  2M30 A;  3E7L A;  4M9Z A;  4MEX F;  2NVY J;  4KIC A;  3MKL A;  4EAT A;  1B6A A;  1MZB A;  3BR5 A;  4IHS A;  3ZCO A;  1T6S A;  2LP0 A;  5HLI A;  4EGZ A;  4KFC A;  5IT9 Z;  2EBI A;  1YX3 A;  1ONV A;  1P7J A;  5J1R A;  2DOE A;  1I27 A;  2LBF A;  2EFO A;  3CD6 I;  2EA4 A;  3HG9 A;  1D0Z A;  1NHA A;  3SDB A;  5IT3 A;  2ZBK A;  2OU2 A;  2FML A;  3P9C A;  3TOA A;  2VQH A;  4LK0 F;  1TZL A;  4PDK A;  1HC8 A;  2WY8 Q;  2TCT A;  1YW9 A;  4BUP A;  1SVO A;  2Y75 A;  1QHH D;  2WAQ A;  2NXN B;  1XSV A;  3HOZ J;  3T1B A;  3KEY A;  1FYK A;  4UUS B;  2Y9Y A;  1Q1V A;  2VLA A;  3JRE A;  1IRG A;  2VT2 A;  5EJC A;  2CUJ A;  4L9V A;  1K78 A;  2QSH X;  1MMG A;  3LA3 A;  3DKX A;  3TP3 A;  4A5M A;  1MW7 A;  1PUF B;  2Z5U A;  1FOW A;  2I10 A;  4RMN A;  3NEU A;  2UZK A;  2GA2 A;  2L4M A;  3I4P A;  5J47 A;  4NC8 A;  3EYY A;  4FAS D;  2HQ5 A;  5HDG A;  1LKX A;  2Q1Z B;  2UXN A;  3EYI A;  1E2X A;  1JUP A;  2VC0 A;  2XKO A;  3F8M A;  3V8J A;  3IRQ A;  3F6O A;  2MG4 A;  4PGH A;  4BXU A;  3OYL A;  2E1C A;  1HOM A;  4HW0 A;  1LDD A;  2WAQ N;  2DOD A;  1R5H A;  1MNE A;  3AL0 C;  2PQ8 A;  1X2M A;  3LWF A;  2QSF X;  4AVP A;  1Q1H A;  3H92 A;  2R7W A;  1T98 A;  2XRN A;  2HQR A;  2JPB A;  4IQ4 A;  5FD5 A;  2AXL A;  2HEO A;  2M7B A;  2BY1 A;  3CUQ A;  1FX7 A;  3CDH A;  1HKT A;  2X0L A;  4H0E A;  3HRS A;  1NG7 A;  3EUH A;  2X6X A;  2GIZ A;  1K6O A;  1UG2 A;  1X3W B;  2P5V A;  4UB8 C;  1X3Z B;  5F0F A;  2DMQ A;  2L01 A;  4LLG F;  4CO8 A;  3RJP A;  3W6K B;  1VQ8 I;  3DPU A;  3M1E A;  2K9S A;  2E35 A;  3BR6 A;  2QUF A;  3ZMT A;  3RIR A;  3K4K A;  1VTN C;  4YIR X;  4AIK A;  1ZKG A;  1MSF C;  5L3B A;  4M74 A;  3I9V 2;  5CJ9 A;  3P9I A;  3I56 I;  1LE8 B;  2LKX A;  2QSG X;  4RLQ A;  3I4N J;  4G6Q A;  4JP0 A;  3T8R A;  1DP3 A;  1KZH A;  1VQ7 I;  4AU7 A;  1D1C A;  1SAX A;  1IRZ A;  5L3C A;  2JQ7 A;  5J1Y A;  5J4Y A;  1K83 J;  5LRS A;  1YIO A;  4S04 A;  1ETO A;  4GGG A;  1T08 B;  2RQQ A;  5E1X A;  5F64 A;  3NRV A;  3S3O A;  3K1P A;  3RZD J;  3S2H J;  4F91 B;  4MIM A;  1IC8 A;  1WZ2 A;  2V7F A;  5L3G A;  1VQ4 I;  4GYI A;  5LGU A;  2KPM A;  2ZFU A;  1ETW A;  3Q0V A;  2NNN A;  4HX4 A;  3WGG A;  4A3B J;  4BNC A;  1VQ6 I;  5K5Q A;  1FYM A;  2PLY A;  1MD0 A;  3IHU A;  2A6H F;  2HI3 A;  1GXQ A;  2WTE A;  5LEJ A;  3QP6 A;  2X6Y A;  4PGG A;  2YU9 J;  2XGE A;  3K7A J;  4RGR A;  1UB9 A;  1OR7 A;  5KK1 A;  2Z9O A;  2CQN A;  3UKG A;  1X1P A;  2UUZ A;  2EH3 A;  2Z99 A;  3O2P E;  4BL0 B;  4RS8 A;  2K9N A;  2QVO A;  1MGT A;  2XGC A;  3VB2 A;  3H1C A;  5IPA A;  2CQQ A;  1G3Y A;  1OPC A;  3FBN B;  1LQ1 A;  4P9F A;  4XKW A;  5H6R A;  1W5T A;  2IGK A;  2L9R A;  3ZGK A;  4L9T A;  2NRA C;  2HDD A;  2DXI A;  2DA2 A;  4CGZ A;  3C3W A;  1DP7 P;  2COM A;  3CF5 F;  1NK2 P;  3IH2 A;  5DCF A;  1UAA A;  3KP2 A;  3OYD A;  1PDN C;  3I55 I;  4K2E A;  1OJL A;  1SEU A;  2ZME B;  3IWZ A;  2NNY A;  2M2E A;  2HQN A;  1MMA A;  3GCM A;  2LFB A;  1V4R A;  4NHJ A;  4IKF A;  1SFO J;  3ZQG A;  3BZC A;  5D4S A;  3GFI A;  3IWF A;  2R7F A;  2VBX A;  2K85 A;  4BXF A;  2DQL A;  4II3 A;  4PJM A;  4G12 A;  5D4R A;  1WWX A;  3GYH X;  1N75 A;  4RB3 C;  3FXJ A;  2MH9 A;  3BZK A;  3WGH A;  1LJ9 A;  3GFL A;  4EJV A;  1YRN B;  1OCO H;  3LST A;  2V4J C;  2DDB A;  2XAS A;  4KYW A;  2MBF A;  2UWM A;  2M7A A;  2VI6 A;  3I53 A;  3KP7 A;  5D6F A;  3CCJ I;  1W4M A;  1ZRE A;  3WG7 H;  5FFX A;  3A02 A;  3W3C A;  1R49 A;  1GUU A;  2LR8 A;  2Q8K A;  2DOA A;  3RQI A;  1HW5 A;  1A04 A;  2BGC A;  3BR1 A;  2TDX A;  2V6C A;  1T0F A;  3G3Z A;  1H9T A;  4DJA A;  4ITV A;  3LNQ A;  1A36 A;  1MIJ A;  1ZAO A;  3OYE A;  1PP8 F;  4M3F A;  1R36 A;  3PO3 J;  4B3A A;  1J9I A;  2A68 F;  2CWE A;  2K27 A;  4AM3 A;  5D5V B;  2KHM A;  1YJW I;  2F5V A;  3SHF A;  2W82 A;  4D9J A;  1DPU A;  4X1E A;  2DI3 A;  3GWZ A;  1ZRF A;  3SFZ A;  2R7D A;  1QZZ A;  1U8R A;  4D7M A;  2HDW A;  5E3L A;  1RC9 A;  2ZCW A;  2KJB A;  2XVC A;  1XGN A;  1ETK A;  2ZJR F;  1I39 A;  1BR2 A;  1REP C;  3GME A;  3L09 A;  1OYY A;  4KT5 C;  3D5S C;  5FLV A;  2LY9 A;  3MKW B;  2OZ6 A;  4C2M J;  4IX7 A;  4UVB A;  1XMK A;  2R3S A;  3HIF A;  1YS6 A;  3TOB A;  4D7N A;  5F27 A;  5B3S H;  3T0Y A;  2STW A;  5LRR A;  1OYW A;  5FRO A;  1UHW A;  3DBR B;  2E36 A;  1H8A C;  5F08 A;  2ELH A;  2DTR A;  5E8I A;  2AQE A;  4HF1 A;  1QPM A;  1TWH J;  5F0C A;  4RA2 A;  4KIT B;  3CP8 A;  1XC5 A;  1UZC A;  5LGN A;  1H0M A;  2MFZ A;  3ZR8 X;  3OY9 A;  1L3L A;  1Z3Y A;  3RCO A;  3DBH B;  4NUB A;  1AOY A;  3BLY A;  2QWW A;  1WH7 A;  5A2Q Z;  2QQB A;  1FIP A;  4IPA A;  4NC7 A;  4KDP A;  1Z21 A;  1O3T A;  2BY2 A;  4G9Y A;  4WF2 A;  1SFU A;  3DV8 A;  3KX2 A;  1WQ2 A;  1R22 A;  2DT7 B;  3H5A A;  4W97 A;  5D8K B;  1Y6I A;  2KZV A;  3VYS B;  1OYI A;  2VE8 A;  1H89 C;  3S3M A;  2FSW A;  4IHT A;  1RRJ A;  1CQT A;  2BYV E;  4IJA A;  2R7U A;  2Z3Y A;  3OIP A;  3RYR A;  2XAQ A;  3M07 A;  3MKZ A;  2HGC A;  2VL8 A;  3NAR A;  1BBY A;  2BXZ A;  3DF8 A;  1D1A A;  3SJM A;  2F5F A;  1IN4 A;  2VBW A;  1O7F A;  2B7E A;  2NS8 A;  2X85 A;  3IP4 B;  4FIS A;  4U0V A;  4BEH A;  3TED A;  4OIP F;  4M6X A;  4RBO A;  4EM0 B;  3I54 A;  5C44 J;  3AFH A;  2GXB A;  3TDU C;  1BW5 A;  2RRE A;  3B73 A;  4V2F A;  5HOD A;  2K5C A;  3EUK L;  4ZC3 A;  1D3Y A;  3BWG A;  2XB0 X;  1I1G A;  4RGS A;  3ZQL A;  3TW7 A;  3OYG A;  2BY0 A;  3ZN0 A;  5EG0 A;  2WAD A;  5JHU A;  3WTU C;  3WTV C;  2EIM H;  3HGG A;  3ONQ A;  3WG9 A;  3IL2 A;  4YG2 F;  1O57 A;  3V7C A;  1S72 I;  2B63 J;  5EEA A;  3CC4 I;  2DYS H;  1Z6R A;  2H8R A;  2M9H A;  2HKX A;  1WCM J;  2WV0 A;  3ABM H;  3ABL H;  3JRG A;  1WJE A;  1KU7 A;  2X48 A;  3MVP A;  4E7J A;  1TBX A;  2Z33 A;  4OAZ A;  3WTT C;  1W36 C;  4L0Y B;  3BCA A;  2PX9 A;  4JX6 A;  1FMV A;  2K86 A;  5JLX A;  1MBH A;  2HXO A;  2FRH A;  3D1N I;  3ASO H;  5HS9 A;  2HXI A;  1T38 A;  1QO0 D;  2CQK A;  1KYZ A;  3K1N A;  5IP6 A;  3S2W A;  5FLX K;  3U2R A;  3AG4 H;  2YR2 A;  1I5Z A;  5F6F A;  2D1H A;  1J5Y A;  3OR1 C;  1IRX A;  2DW4 A;  2HWV A;  3Q0W A;  3NWT A;  4Y17 A;  3K70 D;  1CF7 B;  1JHF A;  2BE5 F;  3ZRG A;  2ELJ A;  2MA3 A;  4XLE A;  3PQK A;  1HCR A;  4AYB N;  3GTO J;  1JUS A;  4OAY A;  1KU3 A;  4XSZ F;  3JRA A;  3OYF A;  4I99 C;  1EH7 A;  1E17 A;  3B6C A;  1V5F A;  1XCB A;  4GYG A;  1YTY A;  4HNU A;  4BKX A;  3PFI A;  2E34 A;  3BQZ A;  4DBR A;  4ESF A;  3OYH A;  1KQ8 A;  1BW6 A;  3FDY A;  4XQF A;  1A5J A;  2KMU A;  2JSC A;  1XDU A;  3VWB A;  3CCU I;  5EDN A;  1WJC A;  3CJR B;  3BC8 A;  5FO5 A;  5IYD J;  1Y0U A;  4RAG A;  1U5T B;  3BCB A;  4R79 A;  2D1V A;  1K4S A;  4XID A;  1OIS A;  3L1P A;  3S1R J;  4DYR A;  3KYL A;  2KLO A;  1VQP I;  2NVU B;  1K61 A;  1YIT I;  2IA0 A;  3K2A A;  3K4B A;  3L2U A;  4A2U A;  1GVJ A;  3OWT A;  4CSW A;  1IDZ A;  1XS9 A;  1KYW A;  1YJ9 I;  2XSD C;  3VEP A;  4MQV A;  3OMY A;  3TL4 X;  1ZRC A;  2HPI A;  3F8N A;  1ZR2 A;  2Q2E B;  1ZR4 A;  2FD5 A;  2VJI A;  2DMN A;  1VI0 A;  3PUB A;  1R1T A;  5ED4 A;  2EA2 A;  2XHK A;  4CXF A;  5CQG A;  1OLT A;  2PMZ A;  5KVR A;  2ISY A;  3ULQ B;  1NG6 A;  1WJ5 A;  1EKE A;  1P6R A;  4KIF A;  2HYG D;  4M72 A;  3LA7 A;  2O9L A;  1SAU A;  3FXO A;  4PSW A;  3RDI A;  2EV5 A;  2DBB A;  3F21 A;  3J7Z I;  2CUE A;  3GW2 A;  2DCE A;  2EIJ H;  2Y69 H;  5E20 A;  5LHG A;  4ENM A;  1X3U A;  3PQJ A;  4RB0 A;  1AKH A;  4UB6 C;  5F1J A;  1LFP A;  3RQ4 A;  2E2I J;  2LF7 A;  4YEL A;  2VPL A;  4I98 B;  2YX4 A;  4MTE A;  2MGQ A;  2HU9 A;  4KMF A;  1PJR A;  3A4C A;  1FLI A;  1EH8 A;  1S9H A;  4I01 A;  5GTI C;  2PMZ N;  4KUM A;  1RR7 A;  2DK8 A;  4NB5 A;  4BHC A;  2GZW A;  4J19 A;  2HS5 A;  2M4K A;  2GIV A;  4L18 B;  4QPO A;  1MJA A;  3HTU A;  2HYJ A;  3LSI A;  4D1Q A;  3K4L A;  5DYM A;  4U7D A;  2R93 J;  1W5S A;  1HLV A;  2VT3 A;  4DBQ A;  1U6G A;  4D0P A;  3AKZ A;  4N4N B;  5B5E C;  2A6T A;  3H3U A;  3W2V A;  2L9N A;  2JA2 A;  2JPC A;  2ZB9 A;  1W0U A;  3H35 A;  1XG1 A;  3G6E I;  5IY5 H;  2XGX A;  4Y13 A;  2PEX A;  4N9I A;  4P55 A;  1MJ9 A;  4ZYE A;  5GTH C;  1RUN A;  4NQW B;  1MDM B;  3K0L A;  2V9P A;  1FJL A;  3KLN A;  2M34 A;  2O61 A;  4OIO F;  4PFO A;  4BE0 A;  4ZDP A;  3QU3 A;  3ERE D;  4RGX A;  1F4K A;  1LDK B;  2IP2 A;  3BQY A;  1TWA J;  1WJA A;  1P9Q C;  1S3J A;  4D5F A;  3FXM A;  2DJN A;  3BT9 A;  1XN7 A;  1RES A;  3IKT A;  2ZJP F;  3GZ5 A;  3HM5 A;  2DK5 A;  5M3F J;  4I6Z A;  1DQU A;  4QLC U;  2JSP A;  3GLX A;  2XPW A;  1MJB A;  3OSF A;  2BXY A;  1K79 A;  2KRH A;  2ZC2 A;  5HS8 A;  3V8K A;  1VQ5 I;  4HA8 A;  3AL0 B;  2ZNY A;  3C2B A;  5C3E J;  2P7C B;  1U5T C;  2VON A;  1MMD A;  5CPR B;  2DFF A;  3HKZ A;  1ACI A;  3LMM A;  2MC4 A;  1YLF A;  4II2 A;  2VUM J;  1LEB A;  4RDU A;  4XLA A;  3OSG A;  3B02 A;  2FBH A;  4N0B A;  1YO5 C;  4I09 A;  1KU2 A;  5HLH A;  3MZY A;  2LG4 A;  2Q0O A;  3MQ0 A;  1MMS A;  2XAH A;  4I76 A;  1WH5 A;  3LSG A;  3UR3 C;  3HUG A;  1GXP A;  2ACJ A;  1IUY A;  2VIX A;  4M9X A;  1D5Y A;  4PSX A;  2PMU A;  2E5Z A;  3K6G A;  1RNL A;  2G0E A;  4YIF A;  1ZGJ A;  4LMY A;  3DTK A;  2IEK A;  4AWX B;  1VF9 A;  1J2X A;  2J5P A;  2ZXW H;  1V5E A;  3FM5 A;  1SAN A;  5IYB J;  3ABT A;  4ABZ A;  1IAW A;  5KNL A;  3HKZ N;  4DQ2 A;  1RKT A;  5BQT A;  5ICC A;  2R5Z B;  2DPD A;  5JI6 A;  1X4O A;  4A69 C;  1G4D A;  2XGD A;  1BI0 A;  4ENK A;  3MAJ A;  4P5O A;  3RKW A;  2O8K A;  4YFK F;  1UST A;  3S32 A;  5J6X A;  2O6G E;  3T8T A;  3V8L A;  3OYJ A;  2AS5 F;  4HAM A;  5ICF A;  4EJW A;  5FKL A;  3RZO J;  3AAF A;  4ENN A;  2ZJQ F;  1OMI A;  3V4G A;  4HZF A;  1I50 J;  1V54 H;  4HOB A;  3W6J B;  3ZMU A;  2YPR A;  4OU0 A;  4A93 J;  1YE9 A;  3AG1 H;  3S8P A;  1S7E A;  2LH9 A;  2PG4 A;  5M5X J;  4Q5S F;  4ZTJ A;  1R5G A;  1HDP A;  2P5K A;  2WY7 Q;  4FE4 A;  2X1E A;  2QZ8 A;  2CJJ A;  2Y48 A;  4M6V A;  4Q47 A;  4MQ9 F;  3BY6 A;  4JX5 A;  1AHD P;  3M1C A;  5E18 F;  2DMT A;  2PJR B;  4FET A;  4S0H B;  1D5V A;  1TP4 A;  5CYV A;  3ZQI A;  2IS2 A;  3FKI J;  2HZD A;  2W57 A;  3M3Y J;  2KDZ A;  4R1H A;  3PL8 A;  5KCM A;  5J3L A;  4YFN F;  4UV8 A;  3M9A A;  3KEQ A;  2XAU A;  2ECB A;  2R4G A;  2OC6 A;  5JHF A;  3V7R A;  4B48 A;  4AUX A;  4E4H A;  2DA5 A;  3K9T A;  1ZG5 A;  1QQI A;  2VBY A;  3PSI A;  3G1L A;  3HB9 A;  1MND A;  5CQE A;  2FA5 A;  1SD7 A;  3I3L A;  1F1Z A;  1FT9 A;  1RET A;  1MNM C;  1YHQ I;  1B9N A;  2IXS A;  3CMM A;  2O8X A;  2PI0 A;  4HRI A;  4KIG A;  1B72 A;  1WKM A;  2QQ8 A;  2A5Y B;  1SD6 A;  1HF0 A;  5DV5 A;  1U3E M;  4RGU A;  3H9J A;  3BG7 A;  4XLH A;  1BC8 C;  5HDN A;  3PIP F;  3DEE A;  2QKL B;  3UNG C;  1ZH5 A;  2FQ4 A;  2LNB A;  4YRV A;  1UCR A;  4BHP A;  4GRI A;  3K4N A;  5FKM A;  3HOU J;  1CGP A;  3W6V A;  1YW7 A;  2LSO A;  1HKS A;  1JUM A;  3K4J A;  4A6D A;  5GAE J;  5K5R A;  3U1D A;  2EFN A;  1IN8 A;  5AIQ A;  2JWT A;  4E7Z A;  4S05 A;  1G59 A;  1WI9 A;  2LK2 A;  4FX0 A;  3SZP A;  4OOI A;  1B8I B;  2ZFW A;  1R7J A;  2M1B A;  2P6S A;  1S7A A;  4F52 A;  4P9U A;  3OYC A;  4A0Y A;  3TQN A;  4G7Z F;  3N97 A;  2IA1 A;  4YII A;  4IHY A;  2M3A A;  3M7G A;  4QIW N;  4BE2 A;  2R7S A;  1I6H J;  5D5W B;  5FB2 A;  2XIG A;  2DA6 A;  3HSE A;  1ZLK A;  1HQC A;  1T56 A;  2DU9 A;  4DZP A;  3RKY A;  3E6M A;  2FQ3 A;  1A35 A;  2JTV A;  4KN7 X;  3HOY J;  4CCK A;  4DGW B;  2VJJ A;  2J5O A;  2QBY B;  5TGT A;  2HKO A;  5JR3 A;  2FE3 A;  4UUT A;  3QOP A;  2XV4 S;  4KMU X;  3WHB A;  2IS4 A;  3TMO A;  4HX8 A;  3OS2 A;  1BIB A;  5HNF A;  2E1M C;  2DA7 A;  4E7I A;  5AIP A;  1R1U A;  1ZQ3 P;  3F3X A;  2E19 A;  4JQF A;  3LAP A;  1S8N A;  2HOE A;  5J40 A;  1V3F A;  2XAF A;  4OIQ F;  2NVQ J;  1YOV B;  3HXL A;  3EUH C;  3EDP A;  2JA8 J;  1R9T J;  4UHT A;  2KIM A;  3EET A;  1IGN A;  2JUC A;  4OWR B;  4BGD A;  2B9S A;  3A03 A;  1XMX A;  2YS9 A;  5ILU A;  5LLQ A;  4J01 A;  3PFY A;  3IAM 2;  4XR6 A;  2M5W A;  4UUS A;  1FYL A;  3MKY B;  2GWR A;  3OS1 A;  3ZMV A;  1R58 A;  2QQ9 A;  3CCL I;  1KQ0 A;  1SMT A;  5FKN A;  2Z16 A;  1R4M B;  2F5C A;  1X1B A;  3HPH A;  5C4J J;  1PUF A;  3HHH A;  5D6E A;  3GBG A;  3CJN A;  2E71 A;  2GXG A;  2RAE A;  3ABK H;  1BI2 A;  1Z67 A;  4LD5 A;  3DPL C;  4CYC B;  4CA0 A;  1FPQ A;  2CUF A;  1HST A;  4H4K C;  2M0M A;  3DKY A;  1WFX A;  1U2W A;  4I0B A;  4V2G A;  1HXD A;  3ZQF A;  3CCM I;  3H5R A;  1P2F A;  1P4W A;  2G9W A;  5JVG F;  2A61 A;  4O6J A;  4LG0 A;  2FU4 A;  4F55 A;  3HOT A;  1DU6 A;  3FK7 A;  3W2A A;  1UHS A;  3CCS I;  3GXO A;  4QWQ A;  5LD2 C;  5FJ8 J;  1O3Q A;  5ICE A;  2FOW A;  1Z3X A;  3FXL A;  5FRM A;  2DTZ A;  1R4N B;  1UFM A;  4BH9 A;  1J59 A;  3J81 K;  1TTY A;  2R7X A;  4NBQ A;  2W00 A;  3FIS A;  4G8X A;  1IJW C;  4HQM A;  4M3B A;  5CVR A;  3HDD A;  1R23 A;  3R4K A;  3VYU B;  2ECC A;  4C3H J;  5BOX A;  1JI8 A;  1RKW A;  1TNT A;  3CQZ J;  1RR8 C;  1RZ4 A;  4LK1 F;  2X4H A;  5DM7 F;  4I2O A;  3GTP J;  2HYF A;  2BVM A;  2MW8 A;  3ZQ7 A;  4KIS A;  1BR1 A;  1GV5 A;  3GLL A;  3HJE A;  4XRF A;  2EB7 A;  1STZ A;  4CIC A;  2NAZ A;  2OJE D;  2P8T A;  2BBY A;  3JRF A;  1OFC X;  3QPT A;  3E5X A;  1MH3 A;  4A12 A;  1LE8 A;  4DIQ A;  3HEF A;  5IOZ A;  2WC2 A;  2FEZ A;  3K2Z A;  3FZV A;  3S1Q J;  4ZDO A;  5EEH A;  2DFI A;  4C3J J;  3J80 Z;  3LAJ A;  1N25 A;  4CHU A;  3PNT A;  3MFK A;  2JA7 J;  3A2K A;  3F9K A;  2MLG A;  1PVE A;  1D8J A;  1FOK A;  2XPU A;  2ZSI B;  3CC7 I;  4JK1 X;  5BNG A;  1O3S A;  2IGO A;  2LMD A;  5E3O A;  1LVA A;  4UVA A;  2NVX J;  4ZDL A;  1ZRD A;  4E7K A;  4C9Y A;  2DN0 A;  2KT0 A;  4P1W A;  3DCF A;  4FQG A;  2P7V B;  4EVI A;  2IRF G;  4A0Z A;  2KZG A;  3DP7 A;  2KL4 A;  2W48 A;  3O6B B;  1YG2 A;  4LIT A;  2CH0 A;  5DCM B;  3F8C A;  4GCV A;  4ZYH A;  1QVT A;  3CCR I;  3FK6 A;  3ERM A;  4ENJ A;  2JA5 J;  3JAM Z;  2AQF A;  5TIS C;  1P92 A;  2GAU A;  3M8J A;  1E3H A;  1FTT A;  2W1O A;  4FCY A;  2D5V A;  3G1M A;  2MLK A;  3E6B A;  3HSR A;  1UHM A;  4BJ5 C;  1ITY A;  2LOO A;  3GZ6 A;  5GPA A;  4OMY A;  3DTI A;  1USS A;  3VSL A;  3R61 A;  1XB4 A;  1F9N A;  3MD2 A;  4Y15 A;  4IL6 C;  2ME6 A;  3L2W A;  1FP2 A;  2ZXH A;  2I5U A;  3OOP A;  4FT8 A;  2CU7 A;  4N4O B;  2R7R A;  1LB2 A;  3CMA I;  4IQJ A;  4ZJZ A;  1BJA A;  1Z7U A;  1I6X A;  2ZME A;  1VQN I;  4L9J A;  5IT9 K;  3I59 B;  2R92 J;  3ESW B;  2BZT A;  5HNH A;  1YS7 A;  2V9K A;  1OCC H;  1Y8Q B;  3RI4 A;  3LQR A;  3SXY A;  3OIQ A;  1F5T A;  4G7O F;  3A01 B;  4BBS J;  5ERI A;  2GA1 A;  3Q5F A;  2VOD A;  2LD5 A;  1G3T A;  3E97 A;  1GT0 C;  4CCM A;  3D5R C;  5GAG J;  1TT0 A;  3E6C C;  1YRN A;  3TW6 A;  4LLN A;  2ELK A;  4QTR A;  1VQO I;  2OZU A;  3JCU C;  3P5J A;  5IP7 J;  4PJ0 C;  2CW7 A;  1VQ9 I;  1M1E B;  4GFB A;  3MZH A;  2QM3 A;  4UY8 I;  4XRS G;  1MBF A;  1FOY A;  2UV1 A;  4PK4 A;  1JKP C;  5EGO B;  2PN6 A;  1TC3 C;  3GTG J;  3GTL J;  3BTJ A;  3CMY A;  4LIU A;  4AD9 A;  5BPD A;  1WVR A;  3BDD A;  2E7W A;  2M45 A;  2JN6 A;  4XK4 A;  3TGN A;  1IO2 A;  1BJZ A;  4YFX F;  3SZG A;  4HDU A;  2AXT C;  3HOW J;  1SD5 A;  2LY2 A;  4HF0 A;  3KP5 A;  3OYA A;  3I0T A;  3D0S A;  1LFU P;  1AU7 A;  4Y7N J;  2VKE A;  4MHG A;  2L7F P;  1W0T A;  3IH4 A;  1A6Q A;  1S6L A;  2E2H J;  3CLO A;  2GBY A;  2X51 A;  3ROU A;  3BPX A;  4XN0 A;  5EEG A;  2F48 A;  4A3M J;  2OV7 A;  5IOY A;  5EYR A;  4C2U A;  3EQL F;  1C0W A;  1ETQ A;  1Z1D A;  3KCC A;  2M0C A;  3L2C A;  3KYD B;  3L00 A;  2IS6 A;  5ILS A;  1WPK A;  4HNV A;  4A5N A;  4XIC A;  5CVV A;  5LFA A;  2WB1 A;  1ZGW A;  3HYI A;  3TO6 A;  4WK8 F;  2OPT A;  2QQA A;  3SQN A;  1L0O C;  3OL3 A;  3ZQC A;  5FGM A;  3ECH A;  3DEW A;  2JVH A;  1V55 H;  3ELK A;  1P4A A;  1TW2 A;  4L5J A;  2CW0 F;  4HQE A;  4BE1 A;  4G6D A;  1TQP A;  3DQV C;  3HC7 A;  4XBF A;  3VOE A;  1IXR C;  1ODD A;  1G8X A;  2O5R A;  4XLN F;  4O5V A;  2XPV A;  2YUS A;  4A3I J;  3FXK A;  3QPS A;  2LLK A;  3S93 A;  2O7O A;  4IRG A;  2X1C A;  3R0J A;  1DPR A;  4MEY F;  1G2H A;  2IVM A;  1X4P A;  2CYY A;  2WB1 N;  2MC3 A;  3TO7 A;  2DFE A;  1ZK8 A;  1ZG3 A;  5LHI A;  1AWC A;  1HW1 A;  2K9L A;  1TL8 A;  1ZLJ A;  3CDI A;  1W36 D;  2H1K A;  4CCL A;  1ETV A;  4IRI A;  2HDC A;  3FXQ A;  2RNJ A;  3IUO A;  3E5U A;  2VXZ A;  3Q9V A;  4R8H A;  2H27 A;  1MBJ A;  1QHG A;  5CKT A;  2AHQ A;  4E7H A;  3WHC A;  2XRO A;  3HOX J;  1TLH B;  1SFE A;  2E5N A;  4A3J J;  3C18 A;  2C6Y A;  3DU6 A;  3J7Y J;  3JW4 A;  1TW3 A;  3KP6 A;  1HKQ A;  1OCZ H;  1RPW A;  2A6E F;  2DOF A;  1AA7 A;  2KDO A;  1JKR C;  2QKM B;  5EZG A;  3QPH A;  2DO7 A;  3REO A;  1W1W E;  3LSM A;  1B1B A;  2GQQ A;  4B8X A;  2P4W A;  5E3N A;  2FXA A;  2GOM A;  2XF5 A;  3CDL A;  4BQO A;  4CDG A;  4HX7 A;  4UUV A;  2VOP A;  1WJD A;  4ASN A;  2ZSH B;  4B3X A;  2E1O A;  2OA4 A;  3OS0 A;  2LVS A;  2EFW A;  3OOU A;  3CCV I;  4D5C A;  4XOT A;  3K10 A;  4BAY A;  1BL0 A;  2M87 A;  4E7S A;  4AIJ A;  3O8H A;  4DOZ A;  4BJT A;  4L5I A;  2F4M B;  3OYB A;  2G7H A;  4BXX J;  1YYV A;  3MWM A;  2FBI A;  1CF7 A;  4A3L J;  1YFH A;  3QOE A;  2W24 A;  2EZI A;  5FD6 A;  5JVT A;  1MSE C;  1Z91 A;  2QEN A;  3HRT A;  2DMU A;  2E60 A;  2JMW A;  3FMQ A;  2HVS A;  2DA1 A;  5GAH J;  4LOC A;  2RV8 A;  1W7P B;  3E6D A;  3JRB A;  2GOX B;  4HSR A;  3E0J B;  3GFM A;  3BPV A;  2OAZ A;  2XDV A;  1WSU A;  4Q48 A;  2ADU A;  1IN6 A;  4IO9 F;  4U88 A;  4WXH A;  2GXA A;  4HPQ A;  4HDV A;  2R5Y B;  2L7Z A;  2DA3 A;  2H6C A;  5B66 C;  3G4S I;  2BW3 B;  1EV7 A;  5K5O A;  3FBI B;  5J4V A;  3FIW A;  2IT0 A;  1U5T A;  4I7H A;  1T39 A;  1KGS A;  3CES A;  5FKO A;  5F0H A;  1Z9C A;  5IYC J;  4IXA A;  5KAF C;  5DS9 A;  3QAH A;  4ZYG A;  4WCG A;  2DA4 A;  4Z2Y A;  2YSR A;  4RM3 A;  1DGR M;  2FMY A;  3OV8 A;  2LBF B;  3H0D A;  1Y1W J;  3D5L A;  3HBL A;  4HV6 A;  3TKY A;  4J00 A;  4NNJ A;  4HST A;  1RUO A;  1R00 A;  2EZH A;  5LEK A;  2L2O A;  1I3A A;  2L0K A;  1TQI A;  1EA3 A;  3I64 A;  3QYE A;  4CZZ A;  5D5X B;  2Q2E A;  1BI1 A;  4XN3 A;  1EF4 A;  2TRT A;  1JHH A;  1TQM A;  1H9G A;  4DYC A;  1O7L A;  1APL C;  3IKV A;  4IOA F;  2V26 A;  3EUA A;  3HRU A;  1K78 B;  3JSP A;  2XB5 A;  1UEL B;  4L0Z B;  2CQ7 A;  1ZHF A;  2JA6 J;  1FTZ A;  2X6O A;  2EIN H;  3JTH A;  3TP0 A;  4PCQ A;  2DT6 A;  3CCE I;  1IDY A;  4RAF A;  2FX0 A;  3FKJ A;  4U7B A;  1JGS A;  3S14 J;  1QGP A;  3Q3S A;  3PUF A;  3M8F A;  5A2Q K;  2LC2 A;  3K4M A;  2L4A A;  4YEJ A;  1UG0 A;  4U87 A;  1X1C A;  2ID6 A;  1TT5 B;  2DQR A;  3NWS A;  4OMZ A;  2QEX I;  4WX9 A;  2IPQ X;  2KRF A;  2Y0S A;  2D2W A;  4U0Y A;  2HVR A;  2F2E A;  2E1M B;  2NS7 A;  4E7L A;  2CV2 A;  1S29 A;  2MYS A;  5LGT A;  2GLO A;  1OCP A;  2XF6 A;  1SC7 A;  3JRH A;  3KIO A;  3HRM A;  3CUQ B;  1N77 A;  3AG2 H;  2VQG A;  1X58 A;  2L7K A;  4F3Q A;  2DDA A;  1Y1V J;  1XGO A;  1RIO H;  3R0A A;  2XAG A;  2Z1D A;  2FF4 A;  1VZ0 A;  1S7O A;  5DTD A;  3HZJ A;  2EPF A;  3RKX A;  1ZAR A;  2H8W A;  3BG3 A;  3SZT A;  1JJ8 C;  4PJL A;  1DU0 A;  2O03 A;  2MH2 A;  4B09 A;  2O0Y A;  3WU2 C;  4X6A J;  2P5L C;  1XTA A;  4CYD A;  1P4X A;  3S2D J;  2O3F A;  3RYP A;  2K9M A;  4LB6 B;  4KN4 X;  2STT A;  4IVN A;  3BG5 A;  3SDG A;  1KON A;  3GF2 A;  4NQW A;  2Y0S N;  2DFH A;  3IAS 2;  1MDM A;  2OTJ I;  5J1U A;  1F36 A;  3DXJ F;  4BAC A;  4EJO A;  3ZQH A;  1FMW A;  1OCT C;  2QA4 I;  3BJ6 A;  6PAX A;  1U9O A;  2W25 A;  3G71 I;  2F4O B;  1BC7 C;  2R0Q C;  3WE3 A;  2ZKZ A;  1X2N A;  4KT6 A;  3PSF A;  4XON A;  1SVM A;  2NYX A;  3I58 A;  1T95 A;  3CC2 I;  3BG9 A;  1Y0N A;  3H36 A;  2K4B A;  3C2G A;  4RB1 A;  1LFB A;  4C3I J;  5K7H A;  1FWZ A;  3A1Y A;  1HA8 A;  3RPU D;  4ANJ A;  1WJF A;  2VN2 A;  1MBE A;  2HTJ A;  4G6T B;  1QVU A;  5H6Q A;  2W4S A;  3QPL A;  1LEA A;  2DAO A;  2QCO A;  4EV0 A;  5B1A H;  1Y39 A;  2LY1 A;  3ZXS A;  2COB A;  2QYO A;  1XGS A;  1VQL I;  5E8G A;  3G2B A;  5HLG A;  4HG2 A;  2JK3 A;  4HYE A;  4XL9 A;  2Y31 A;  1Z6T A;  3QYB A;  2HQA A;  2MD0 A;  3HPG A;  3WGI A;  5H2F C;  1FC3 A;  1WRJ A;  1BOB A;  3LSR A;  2A5W A;  3LSJ A;  4BU2 A;  2XAJ A;  4GXO A;  2L3D A;  3FX3 A;  2VB6 A;  4RAZ A;  4Q4Z F;  3BRO A;  3GEZ A;  1B59 A;  3LQQ A;  3CLQ A;  1JTX A;  2IGM A;  2VQL A;  3GTJ J;  2EIK H;  1NK3 P;  3S1N J;  1K7A A;  3PNY A;  3FXU A;  2R5Z A;  3HSF A;  5M3M J;  3Q0U A;  4XNF A;  4BDZ A;  4LG0 B;  4Y3O A;  1BIA A;  2AO9 A;  4ZZD A;  3KPH A;  3BP8 A;  3CO7 C;  2K9Q A;  4IOC F;  3I5U A;  2DYR H;  4BY7 J;  1HW2 A;  2P81 A;  5D5U B;  3KET A;  3COA C;  2ZXI A;  4LJZ F;  3PJR A;  5FLM J;  2H1L A;  2HOS A;  3BR2 A;  1ZN2 A;  1WHU A;  4BY1 J;  1W7P D;  1XGM A;  5FLX Z;  3HOV J;  2OQR A;  1FOX A;  2KP6 A;  3K1M A;  1R6R A;  2E2J J;  1GLN A;  1X19 A;  3TBI A;  3C2H A;  3DU5 A;  3NQO A;  1WGX A;  4F7Z A;  4ZYD A;  4LB5 A;  2F4I A;  3V42 A;  5K7Z A;  2BY3 A;  2FNA A;  1IXS B;  1A31 A;  2NOG A;  2PJR A;  1QA6 A;  4OIN F;  3MN2 A;  4EJT A;  2RN7 A;  5J8C A;  1JKO C;  3X2Q H;  4B47 A;  4EMS A;  5F04 A;  3CUQ C;  3T5X A;  3SEQ A;  1TWC J;  4KNY A;  4DW6 A;  1V5G A;  3DLA A;  5TJJ A;  1KQ9 A;  2JRT A;  3LA2 A;  4WXC A;  3JRD A;  3MZ8 A;  2F6C A;  5E79 C;  4JOM A;  3L7W A;  4CCO A;  4KA4 A;  5HVQ C;  5IP9 J;  4G94 A;  3ZMS A;  4IZZ A;  4IEJ A;  4PJN A;  1GDT A;  2M4G A;  4JBA A;  5FFZ A;  3TO9 A;  5J8F A;  4FX4 A;  1XCV A;  4B43 A;  4ZH4 F;  2HVQ A;  4Y33 A;  2BOL A;  3IH3 A;  3BR0 A;  3F8B A;  3BTL A;  2OTL I;  3MMY B;  3KEO A;  2EIL H;  5CVI A;  4FTH A;  3G1O A;  1YI2 I;  3DKW A;  2VJ5 A;  2V1D A;  1BM9 A;  4W1U A;  2X1D A;  3CO6 C;  4CUG A;  3L2R A;  1IG7 A;  2VPR A;  3S3N A;  1J0R A;  3OYK A;  2IJL A;  2CGP A;  1LDJ A;  3K69 A;  4MO7 A;  3ZMD A;  1ERD A;  1Z05 A;  2ME0 A;  2QGU A;  2DT5 A;  1IW7 F;  3R6S A;  4EQQ A;  2CW8 A;  3JTG A;  1JE8 A;  1PYV A;  2Z2S B;  4FHT A;  4JYK A;  1QBJ A;  2DPU A;  4O3M A;  2P0W A;  1B8I A;  4RLF A;  3J7A Y;  3I4M J;  1BR4 A;  3MEX A;  4KIB A;  1VND A;  3H0G J;  2Y0M A;  4IRH A;  4DNC A;  2X9D A;  4I0A A;  2XC7 A;  1FSH A;  1OR7 C;  5LBQ A;  3P9K A;  2WA0 A;  2RDP A;  2JT1 A;  3M4O J;  3KE2 A;  3LL7 A;  3N4M A;  4EJU A;  1PP7 U;  4M73 A;  5F1R A;  3KP3 A;  3RTR A;  1BOA A;  4LGW A;  2CQX A;  4B1R A;  1T2K A;  2OF7 A;  4LFU A;  1O3R A;  2OCE A;  1ON1 A;  2ISZ A;  4BJ6 C;  3Q9S A;  3CJT B;  2VXD A;  3BJO A;  4E70 A;  1K4T A;  4UXN A;  2QBY A;  3VDX A;  4EM2 A;  1ZG1 A;  2M8E A;  2ICW G;  3C1D A;  3GX4 X;  4GDF A;  1J75 A;  3KFW X;  3F0C A;  5DD8 A;  2V6E A;  3VYT B;  4ESB A;  4BEH B;  3H3V K;  2HFH A;  2YX7 A;  2NOJ B;  3KLO A;  4WWC A;  2K3F A;  2ID3 A;  5BPI A;  2DMP A;  2Y9Z A;  2CUZ A;  2BEO A;  3LSP A;  1XSD A;  2CFX A;  3OYM A;  3J7A O;  1IN5 A;  2W84 A;  3A0B C;  2W7N A;  3RSN A;  4AIH A;  9ANT A;  4Z6Y A;  2OUM A;  3CTA A;  4RM2 A;  5JFR A;  3WTZ A;  2QF7 A;  1X1D A;  5EG0 B;  2GM4 A;  1JXS A;  1PUE E;  4XRS A;  1YQA A;  2KKO A;  3WTX C;  5E3M A;  3SYT A;  3FHZ A;  3JRC A;  4P96 A;  5CVU A;  1FBU A;  2FUG 2;  5KAI C;  1EH6 A;  1KU9 A;  3VYR B;  2UXX A;  1XDS A;  5DM6 F;  4AVZ A;  2HR3 A;  4MFD A;  4MTD A;  5L3F A;  1FP1 D;  4CYC A;  2OQG A;  3QYF A;  1T0F C;  2CO5 A;  3JR9 A;  4A3F J;  4CCJ A;  1XSX A;  4ZYA A;  3S15 J;  2R7V A;  2JUG A;  1Z0X A;  3DTE A;  4HEA 2;  1DUX C;  4M6Y A;  1T33 A;  4LG3 A;  4MFE A;  5DUK A;  4M3E A;  2Y2Z A;  1JTY A;  3QQA A;  3GFJ A;  4CCN A;  4RB2 C;  2HOA A;  2IBD A;  2H6B A;  2EZL A;  4HNT A;  1SFK A;  3IV5 A;  3IRR A;  2ZO4 A;  2H09 A;  4PZJ A;  1LVK A;  1NTC A;  5CVJ A;  3HL2 A;  1UMQ A;  3HHG A;  3S1M J;  2VKD A;  3G73 A;  3ECO A;  2WAF A;  5FRN A;  4A3G J;  5BS6 A;  3QWL A;  5ICG A;  4BQA A;  3OR2 C;  4GO1 A;  4XLF A;  1FSE A;  3CJQ B;  1NH3 A;  3ZOB A;  4NDL A;  3OYI A;  1I1S A;  4G7H F;  2BHY A;  4M3D A;  3CCY A;  3DWL E;  2LDU A;  2K7L A;  2EQR A;  2XUB A;  4Y4R A;  1XX5 A;  1D8K A;  3FHN A;  4XRM A;  2CRG A;  2VKV A;  3CP2 A;  2M8G X;  3RPQ A;  2L5Q A;  3F8F A;  1BN5 A;  5H20 A;  1H88 C;  3HTS B;  3VPR A;  3DEU A;  2PFB A;  2WV1 A;  1DGW Y;  1D1B A;  1SD4 A;  2BHZ A;  4FE7 A;  1TWF J;  3QOD A;  1U8B A;  4TV7 A;  3K70 C;  4ZZL A;  1QRY A;  1FBQ A;  3BTC A;  5M5W J;  1HSJ A;  2LRD A;  4XKB A;  1O4X A;  2D45 A;  3WU1 B;  2HOT A;  2L54 A;  2V79 A;  3F6V A;  1EJ9 A;  3U21 A;  2LKS A;  1IV6 A;  2JVG A;  2ZME C;  3DLL F;  2WAE A;  2ZJ2 A;  3ML6 A;  1OCR H;  3FM3 A;  1QU3 A;  2BV6 A;  3DPT A;  4A3D J;  3H9Q A;  4HBL A;  1J7K A;  5CLS A;  4ON0 A;  2F5D A;  2QLZ A;  2CFO A;  4A3K J;  2HZT A;  4EEF G;  1JT6 A;  4LIV A;  1IN7 A;  2LKP A;  2EZK A;  1ZGA A;  2ZNZ A;  5DCM A;  3WOD F;  4F92 B;  1X1A A;  1ZTR A;  3KZZ A;  1W5C C;  2PMH A;  4KJZ A;  1J09 A;  3L9F A;  1MH4 A;  3GTQ J;  4M9S A;  3N05 A;  2ETH A;  2RQP A;  4IHX A;  1P7I A;  2CSO A;  2BVL A;  2FOK A;  1N78 A;  1HBX G;  1AKH B;  2KIU A;  4AYB A;  1FBS A;  3E3V A;  3ZP5 A;  1OQY A;  2CV0 A;  1U9N A;  1YIJ I;  1ETX A;  3U1K A;  1GVD A;  3AG3 H;  2EV0 A;  1T8I A;  3V7S A;  1XD7 A;  3GO5 A;  1MBG A;  2R7O A;  2MD5 A;  2FNP A;  2LYC A;  3BJA A;  1OKR A;  2OCC H;  5E17 F;  3BTI A;  3RKQ A;  1K6Y A;  1SMY F;  1DDN A;  4DZJ A;  3OL4 A;  2JJ7 A;  2LTP A;  1S5L C;  2OBP A;  4CH7 A;  1JGG A;  1GV2 A;  3S16 J;  1Z7L A;  5DUI A;  3GUD A;  1MKM A;  4BQN A;  3F72 A;  3H3Z A;  1VQK I;  4L5E A;  5FKK A;  2NVT J;  4MGR A;  3I59 A;  4I02 A;  1ULY A;  1TWG J;  2HNH A;  1QZE A;  2K4J A;  3ZMZ A;  4M71 A;  4BHB A;  2E7X A;  3FMS A;  2LF8 A;  2R7T A;  1VQM I;  2XF7 A;  1WI3 A;  3PNV A;  3A01 A;  2JRM A;  1IRF A;  3WTW C;  3PO2 J;  3GTM J;  5AON A;  2HPM A;  3P7N A; 
#chains in the Genus database with same CATH homology
 1V54 H;  5B1A H;  3AG4 H;  3AG1 H;  3AG2 H;  2DYS H;  2EIK H;  2EIJ H;  2Y69 H;  2ZXW H;  3ABM H;  1OCR H;  3ABL H;  5B3S H;  1OCO H;  3X2Q H;  2DYR H;  3AG3 H;  1OCC H;  3ABK H;  2EIL H;  5B1B H;  3ASO H;  2OCC H;  1OCZ H;  3ASN H;  3WG7 H;  2EIN H;  5IY5 H;  2EIM H;  1V55 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...