3ASNH

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3asnH00
2EIJH 3ABMH 3X2QH 5IY5H 3ABLH 1OCCH 5B1BH 2EIMH 3AG3H 3WG7H 1OCRH 2Y69H 5B1AH 3ABKH 2EIKH 2OCCH 3AG4H 3ASOH 5B3SH 1V55H 2DYSH 3AG1H 2ZXWH 1OCOH 3ASNH 3AG2H 2DYRH 2EINH 2EILH 1OCZH 1V54H
chains in the Genus database with same CATH superfamily
1MMNA 4LK0F 3U9GA 3S32A 5E79C 1Y1WJ 1WJBA 1IN6A 4BQNA 1RKTA 4IF4A 5B1BH 1LJ9A 1T8IA 1AKHB 4RGSA 3FF5A 4A0YA 3CCVI 3E3VA 3LA3A 2MD5A 3GTQJ 4A3JJ 2F5EA 5HLTA 3ZGKA 1OKRA 2R7VA 4CO8A 2BEOA 1B9NA 2BXYA 3M9AA 4NDLA 1VQ4I 3U2RA 2DMNA 1K6YA 3LSJA 3SZGA 2IS4A 2KFDA 2PEXA 3ABTA 3DFGA 1TZLA 3F6VA 3K2ZA 4ZZLA 1UG2A 2E5NA 1G8XA 2O03A 1S72I 3CDHA 4NQWB 4O5VA 4R79A 1SVMA 1R1TA 3K9TA 1EF4A 2ELKA 5E1XA 3L2CA 1JUSA 3DP7A 1MMAA 1D0XA 4PJJA 4BQOA 1RR8C 3PSFA 3RKWA 3BROA 2DFFA 4P1WA 4KITB 3SZTA 3F72A 4EV0A 4BACA 3KP3A 3ZMVA 5FLMJ 1WSUA 2HZDA 4HX4A 1LFUP 3I53A 1JJ6C 1KGSA 4E7HA 5K7FA 1XGOA 2XB0X 4LG3A 3T8TA 5J6XA 2NVYJ 5GTHC 2ZCWA 1D3YA 1MNEA 3TEDA 4CCOA 1LVAA 3I59B 1E3PA 3H9JA 2P7VB 1TWCJ 2ZC2A 3HIFA 1EH7A 4J19A 1FLIA 4FQGA 1X3WB 3COAC 4UNOA 2VODA 3BDDA 2QQAA 3L9FA 4RS8A 3JSPA 4EM2A 1Z7UA 1TP4A 3WTYC 5ILUA 2O6GE 2QQ8A 2Z16A 5E1ZB 2R5YA 2Y30A 3JW4A 3HTSB 1IXRC 4OMZA 2DTZA 1U5TC 3JRDA 3CCLI 4A3CJ 4KA4A 1OCTC 4CH7A 2HOTA 5JVGF 2DPUA 2R3SA 4C3JJ 3WG7H 1SD6A 4U0VA 2CW0F 3O3KA 2V1DA 1VI0A 1PP8F 1SAUA 3GFMA 2LTPA 3CCQI 4N4NB 2WB1N 3GO5A 1SC7A 1YS6A 2QF7A 1OPCA 5CJ9A 1R23A 3OIPA 1VQMI 1DU0A 4GGGA 3DQVC 1AKHA 2E2HJ 3QPHA 1ZR4A 1FTZA 1QA6A 3CJNA 3OYCA 1KQ8A 4KICA 1U0JA 1MH3A 4G6TB 1MNDA 1OCCH 2QGUA 2E36A 3JRIA 1IN5A 3HUGB 3M7GA 1BR2A 2L5QA 2XAFA 2BE5F 5L3GA 2HDDA 3ABKH 2L7KA 4PUSA 2ZBKA 4HF1A 2B7EA 1T56A 3KEQA 2V9KA 3Q0VA 4IL6C 2IS2A 4NQWA 1J7KA 4BHBA 1XGNA 4UY8I 3BLYA 5D4RA 4DZJA 3BG7A 1FSEA 2MH2A 2OQRA 1DP7P 2GA2A 2EINH 1BBYA 2X0LA 3EETA 3QODA 2EFPA 4RM3A 5BNGA 3BG9A 4EATA 4X6AJ 2ACJA 1DGWY 3LQRA 2HVSA 1QVUA 3ERED 4F52A 4UB8C 2PG4A 3SYTA 2HR3A 4MLOA 3WODF 3OYKA 4E70A 1FBQA 2CG4A 1VFCA 4V2FA 2CO5A 2J5OA 4LIUA 1TW2A 4A0ZA 3BPVA 3DBRB 2R7UA 5K7ZA 2R93J 2CQXA 1VQLI 3I59A 1QGPA 3QU6A 4P55A 4RLFA 4CICA 2F5CA 3VOEA 4DNCA 2VB6A 4K2EA 3GYHX 1AA7A 2OCEA 5KAFC 3VPRA 5CQGA 2M2EA 2X1EA 4M3EA 4RAGA 4ZDPA 4AVPA 5A2QZ 2OBPA 3V7RA 1E3OC 2LC2A 2XIGA 2EV5A 3HSRA 3DLLF 2KRFA 2ZB9A 3W2AA 4CCMA 1HXDA 2K9NA 3DU5A 1VQNI 2ESNA 4AIDA 1WVRA 2XPVA 1FIAA 3NEUA 3H92A 2CUJA 2Y0SN 3LSTA 4QIWN 2MGQA 5FKMA 4P9FA 2H8RA 3LAPA 4L9TA 2CQQA 2W1OA 3K6GA 3S1QJ 2KT0A 4L5IA 1K4TA 1S7EA 1KQ9A 2CYYA 1LB2A 4DIQA 1Z1DA 3M8FA 1X2NA 2MD0A 3E5UA 3W2WA 3ZQIA 3BJAA 1MSFC 1WJEA 3QWLA 4UB6C 4F93B 2GOMA 4ENNA 4LLNA 4G94A 1YHQI 2DXIA 4CGZA 2CV2A 4XIDA 1V5EA 3ZN0A 2IEKA 3BJOA 4Y13A 1KYWA 3BG3A 1YOVB 3GXOA 3BOQA 2E1CA 1SFXA 2XAQA 1OMIA 1LDJA 2Q8KA 2HOSA 1XG1A 1WH7A 3S16J 3H5NA 3HUGA 3I0TA 1J2XA 2M7AA 3L2WA 1I6HJ 2COMA 2OV7A 1O3QA 2EA4A 2W48A 1BC8C 1LEAA 5D8LB 2DO7A 5JFRA 1D8JA 2QVOA 5EF6A 1MNMC 1HKSA 4XBFA 2EH3A 1TW3A 2IS1A 4YIRX 3CC7I 4HF0A 3Q0UA 3ZPLA 3Q5FA 1U2WA 3JTHA 3HDDA 2VBWA 1YJWI 3CO7C 2G7HA 1WI3A 2AQEA 4ETSA 1MD0A 1YW8A 2OUMA 3BC8A 3K1PA 3SHFA 1VQ7I 4Y33A 1F1ZA 2CH0A 2JRMA 2DA7A 3ZMZA 1EJ9A 4L18B 3QU3A 5CLSA 3S14J 4XRMA 2VE9A 5DS9A 3RQ4A 4BGDA 4KJZA 1PVEA 3SEQA 2HYFA 3CP2A 1ETQA 1SFOJ 1NH3A 2HDCA 4MTDA 3CD6I 2CFXA 3N97A 3U21A 3JAMZ 1DP3A 3F8BA 5GAHJ 3LWFA 3A4CA 2HTSA 1U8RA 5LRRA 1U9NA 3MZYA 2IA0A 2FMLA 2HFHA 2A68F 2M8GX 3D5SC 3ESWB 1GXPA 2LNBA 5F1RA 5E3NA 4B3XA 4LJZF 3L2RA 5FKOA 5ICFA 4ZYHA 5DCMB 3V8KA 2FXAA 2X1CA 1B4AA 1XCVA 3GWZA 3NAUA 3C2HA 2MABA 4YELA 5CVRA 1I3QJ 1HW5A 1XGSA 5F0CA 1EA3A 5AIPA 5F08A 3KYCB 4MFDA 2A6HF 3FKJA 1D1BA 2DMUA 3FXOA 4BNCA 1X58A 2XAHA 3S1MJ 2Q0OA 4ABZA 3S2HJ 4BKXA 3RKXA 4A3FJ 2VQHA 2UXXA 3OSFA 2FJ1A 5E18F 3VDXA 2EFNA 2H6BA 2XRLA 3QPSA 2PLYA 4A5MA 1TBXA 4XLHA 2E7XA 1S6LA 5IP6A 2MA3A 2KQRA 3NWSA 2CS3A 4IRHA 3FWEA 1QRYA 1T95A 5E8GA 1E17A 1E0EA 2WAQA 4IHSA 2M5WA 1HSJA 1UB9A 5FD5A 2P8TA 3FXLA 3HOSA 2M7BA 3I3LA 3I4MJ 1XGMA 4ZDOA 2RGVA 3A0HC 1ODDA 3VYUB 3KCCA 5CPRB 2QQBA 1XB4A 2L4MA 3BQYA 2FMYA 4J01A 4CYDA 1XMAA 2W85A 4ZYGA 5D4SA 4D7NA 2WC2A 1PP7U 3WTVC 4U7DA 5ICGA 1O3RA 3V7SA 4WF2A 4NC6A 3A03A 2LBFB 1PYVA 1Y8RB 4HG2A 1FC3A 1EV7A 3ABUA 3I64A 3FHZA 5CQEA 4RAYA 2R7DA 3BR2A 3CJQB 1J59A 2E5ZA 2RV8A 4XLFA 2R7SA 2R5ZB 4PK4A 5GADJ 3K7AJ 2VKHA 1ETYA 5E3LA 2GXAA 3CCUI 1Z05A 3F0CA 1ETVA 2G7UA 3PNVA 2LREA 5F0FA 1G3WA 2JA6J 2NS7A 3ZMSA 4G7ZF 5DCMA 3AG1H 1K61A 2EV6A 4FX0A 4F92B 3KIOA 4YFNF 4IOCF 4YFKF 2HZTA 1AU7A 1Z7LA 3CUQC 4U7BA 3HZJA 4DBRA 1YYVA 3HXLA 1I6XA 3MKLA 5BMZA 2K27A 1XD7A 2QUFA 3BG6A 1SVOA 5EG0B 2IW5A 3R60A 2XVCA 1Y6IA 1IRXA 2E2JJ 3SDBA 2K4BA 1YRNB 3A2KA 3WU1B 2PQ8A 4EGZA 1CQTA 2QQ9A 2ETHA 3S1NJ 3D1NI 3CDIA 3ZN1A 4AIHA 2X4HA 2UUZA 3RQIA 4A3EJ 2VT3A 5CYVA 2EZLA 3E5XA 3EUKL 1BR4A 2TRTA 4AVZA 3PO3J 2VJ5A 3DBLB 1TNSA 2FU4A 4M73A 4XLAA 2E7WA 5FLVA 1PJRA 5JLXA 3S3MA 3MQ0A 4U88A 3DCFA 3G3ZA 1SVLA 5FRMA 1P4AA 4XK4A 2ZSIB 4OU0A 2GZWA 5DM7F 2OZUA 3C3WA 2M4KA 4YEJA 4CDGA 4HLXA 1U8BA 3DTKA 3R4KA 4HNTA 1FOWA 3H0GJ 3RZOJ 4F3QA 1PUFB 2DTRA 3FMRA 3GW2A 5LLQA 3WTUC 1LVKA 2B0LA 2H1LA 3T5XA 2EJRA 1WJ5A 1T98A 1IAWA 4UV8A 4EJWA 2W24A 3FHNA 1EKEA 3OIOA 1X1AA 1DPUA 3LSGA 4UUSB 1MBHA 2EK5A 2LBFA 3SZPA 4S04A 4LG0B 5J3LA 3ZP5A 2L54A 3R61A 4H4KC 2OTJI 2HWVA 2KDZA 5J1YA 3HOZJ 3HPGA 4Y3OA 2R5ZA 1V55H 2H1KA 4D1QA 1VQ6I 2KZGA 4MNUA 3QAHA 4I6ZA 4UV9A 3IHUA 4V19K 1MIJA 5C44J 5LBQA 3G73A 3CO6C 1G6NA 2RNGA 2WADA 5LHIA 3H3UA 1RI7A 3C2GA 1G3SA 2W4SA 2FBKA 3FX3A 1PDNC 4DYQA 4G7HF 1Y1VJ 2M30A 2W7NA 4P5OA 2IA2A 4IZZA 4OIRF 4KT5C 3K4BA 5J1UA 4MQVA 1D5VA 2IP2A 4XMYA 2DODA 2HEOA 2DYSH 1MBJA 2XAUA 5EG0A 3NQOA 2ZXIA 5J47A 1JJ8C 1Z77A 3KZYA 3KLOA 2LRDA 1AHDP 3GLXA 1B72B 2NVTJ 1YRNA 2VASA 2UV1A 3FMSA 1DQUA 4A3IJ 2HOAA 4ZTJA 4MFEA 4ESFA 4S05A 3KLNA 1R1UA 1LPQA 3E1SA 4QTRA 2RQQA 1N25A 5D5WB 2YSRA 2Z2SB 5E3MA 3CMYA 5BPIA 1UMQA 5E20A 2JA8J 4BDYA 1BC7C 2K9QA 3TMOA 2LD5A 3J7AO 4O6JA 3BTCA 4UXNA 2IBDA 4MGRA 5F0HA 2V4JC 2GOXB 1O7FA 3GTGJ 5IPAA 1KONA 2KIUA 1N75A 2XPWA 3ELKA 1LFPA 2CWEA 3DKYA 4FCYA 2H09A 3P9CA 2EZKA 1XSDA 1TWAJ 1OCRH 4IKFA 3GTKJ 2L2OA 3UKGA 1R22A 1PUFA 3ZCOA 3OIQA 3OL3A 3B73A 3K1MA 3H0DA 2K9MA 2JVHA 1YFHA 3OYLA 4HQEA 1JT6A 3IWFA 2JUGA 2GXGA 3CJTB 4Q47A 5TJJA 1A04A 3TO6A 4ANJA 4EJOA 1YE9A 4UUSA 2DAOA 4LG0A 3S93A 3D0SA 1D0YA 1HDPA 1IO2A 1WJCA 5BPDA 3GTLJ 3R0JA 4MO7A 3K4JA 4CCLA 4ZDLA 3BT9A 4JOMA 4XM3A 2PMHA 1QQIA 2X6OA 4HSTA 2CGPA 5F64A 1ZH5A 3F8NA 3REOA 3MZ8A 4OWRB 5D5XB 2Z33A 2NNYA 2VPRA 4HX8A 1P92A 2X48A 1FZPB 5DYMA 2FUG2 3HRSA 4E7JA 4XRSA 4ENMA 2CQKA 1W5SA 2DK8A 1VQKI 4KUMA 1FOKA 2F5DA 3ULQB 3I4NJ 1MBGA 3HGGA 4ZZDA 4GYIA 3LSRA 1SD7A 1PUEE 2MC4A 3ZMTA 2LDUA 1ZN2A 5E1WA 3S3OA 2IGNA 3CLQA 3PL8A 4UUTA 4XL9A 1WKMA 1B72A 2XSDC 3S1RJ 1NHAA 4WXCA 2MLGA 3HOVJ 5JLWA 2XROA 1GLNA 3KYLA 1ZRDA 4HRIA 3GTOJ 1Y0UA 2CJJA 2IXSA 2DA5A 3W6JB 2JZYA 3VB2A 4HX7A 3CMEI 5FKNA 2P5KA 1NTCA 1MDMB 2BHYA 5KVRA 2WA0A 1R6RA 4JK1X 2ME0A 5M5YJ 3UNGC 3P7NA 4HZFA 3VFZA 1WCMJ 3M4OJ 1Z3YA 3T0YA 4M74A 4HNVA 3LSKA 2IT0A 3PM1A 2P5VA 1R4MB 1VQ5I 2KISA 4C3IJ 3OYIA 2PMUA 1BW5A 2M3AA 4BDZA 2JPCA 2A07F 3LFUA 5DEQA 3E6MA 1D1AA 3NWTA 2ZMEC 4M9XA 2GBYA 2K5CA 2DI3A 4KMFA 3ABLH 3CDLA 4M6YA 2V9PA 3HKZA 3IV5A 3R6SA 5E3OA 5CVJA 4OAYA 1HDDC 4L0YB 2EPFA 1FBUA 4UVAA 1T39A 2B9SA 4OAZA 1B9MA 2VT2A 2WY8Q 2Y0MA 3IWZA 4QWQA 4XLCA 5L3DA 4HLYA 1DUXC 3AL0C 2RVCA 4S0HB 1B1BA 6PAXA 2WAFA 4HF2A 2VJJA 3AG2H 3IAS2 4NHJA 1RKWA 4QPOA 1O7LA 3BR5A 1BI3A 2X1DA 5IP9J 2MC3A 1W4MA 3B02A 1J0RA 3MEXA 4M3BA 3KPHA 2BY1A 3ZQGA 2KIQA 4D7MA 2D1VA 3PNTA 3PJRA 3LSHA 3DPUA 1EH6A 3K4LA 2COBA 1B6AA 2HKXA 3JREA 5IYCJ 3BTIA 4RB0A 2ZJ2A 1I27A 1T33A 4F7ZA 5K5RA 5EJCA 1WJAA 1A5JA 2PJRB 2Y69H 3Q0WA 4MEYF 5LEJA 3LNQA 1JKPC 1BR1A 3I4PA 5KHDA 3LSPA 4FETA 4II3A 3QOPA 4A0XA 2XUBA 2MBFA 2JWTA 4N0BA 2UZKA 3CCEI 5DV5A 5LFAA 4G12A 3A02A 3F6OA 5F1JA 2DMTA 4LD5A 5FLXK 1MMGA 2XHKA 4BXXJ 1VTNC 5D5UB 5TGTA 1MW7A 1LFBA 4BBRJ 3JCUC 1U5TB 5H6QA 3BR1A 3OY9A 2K7LA 2W00A 3QPTA 3Q9SA 3M1EA 3H36A 3CMMA 1J9IA 2DLLA 2OPTA 2RQPA 1IG7A 4LGWA 1YITI 3ONQA 4OIOF 1FTTA 3J81K 2M45A 1SMYF 2HPIA 1MDMA 3GTMJ 1UZCA 1ZHFA 2PX9A 1HSTA 3J7YJ 3L1PA 2B63J 4QPQA 4Y15A 1U9OA 4BU2A 3JR9A 2CMPA 2O61A 1REPC 4EM1A 3W6KB 4AYBA 2AO9A 5F04A 3WHCA 5JVTA 2BXZA 1FOXA 2JK3A 3RIRA 1GDTA 4IVNA 2H27A 3ZQQA 4PSWA 2JJ7A 1T6SA 4CSWA 2E19A 1B59A 4OIQF 2DA1A 1IGNA 2YR2A 2A6TA 1ZTRA 3CESA 2CUEA 2BZTA 4A3GJ 2EB7A 2CV1A 3FXUA 5K5OA 2WV1A 1FT9A 1BL0A 1NK2P 4H0EA 1P7JA 2VKDA 3O8HA 4B09A 1GT0C 2EBIA 1JT0A 1OJLA 2NS8A 4M71A 3RYRA 1TT0A 5K1YA 5HDKA 2GAUA 2P6SA 3DEUA 1WFXA 3HSEA 1K6OA 4WXHA 2X85A 4I0AA 2W25A 3D5RC 2IJLA 3CQZJ 4GDFA 2LF8A 4DOZA 3GFJA 3SXYA 3I5UA 5EZHA 3TP3A 1FYKA 1OCZH 1YJNI 2LH9A 2PJRA 2P4WA 5C4XJ 4ZYEA 3HHGA 3M8EA 2LMDA 3TDUC 3OYGA 2D1HA 4L9JA 2BY0A 4LFUA 3FK7A 1HCRA 1IZ1A 3TW7A 3K70C 4M3FA 1CF7B 2DT6A 5IYDJ 2E1MC 1IRFA 2Y48A 3QP5A 2K4JA 3OS1A 2K85A 4JQFA 3I56I 1U5TA 5HS9A 3ZRGA 3HM5A 1X1BA 4XQFA 2F2EA 2VIXA 3B6CA 2VJIA 2LY9A 4RB2C 2VI6A 1ZKGA 5E17F 1IUYA 3K10A 3IKVA 2HYGD 3GTJJ 2ZKZA 1U78A 3DEWA 3G71I 2LR8A 4M3DA 2D5VA 1X3ZB 4Y7NJ 1T08B 4PDKA 1ZG5A 4FASD 2DOFA 2FRHA 2E1OA 3VYTB 2DOAA 5H6RA 3KETA 1ULYA 3ZOBA 3ERMA 4BL0B 3AG4H 1KU7A 3OR2C 2E1MB 3VYSB 3HRMA 3RSNA 2VBXA 1P4XA 3KP5A 2F6CA 3QYEA 1WH5A 1ON2A 2WBMA 2VXDA 2X51A 2ZXWH 4UHTA 5KNLA 2JMWA 3H1CA 2ZFWA 1YI2I 2KL4A 4KFCA 2M9HA 3K4KA 2KIMA 3TP0A 4MQ9F 1TC3C 4DBQA 2DFEA 2M0MA 5ICEA 2DA4A 2DU9A 2BY3A 3GFIA 3HBLA 1BM9A 3RZDJ 2FOWA 3PIPF 3HOTA 2XF5A 4L0ZB 4I02A 3ZQLA 1YW7A 3DF8A 4BHPA 5EEHA 4A93J 2VC1A 4XSXF 1WJDA 2A61A 2MH9A 3BQZA 3BY6A 2EQRA 2ISYA 3PO2J 5D8KB 1I1GA 3BWGA 2A69F 5GAGJ 5LGUA 3A01B 4A3LJ 3KX2A 2AXTC 4D0PA 2LKPA 5BQTA 1BOAA 2V1NA 2VQLA 4OMYA 4JBAA 3TQNA 2ECCA 1R5HA 9ANTA 3BR0A 1QHHD 3FBNB 4BAYA 3ECHA 4A6DA 3HKZN 4I98B 1ETXA 2NRAC 3TL4X 4FT8A 2PMZA 3GBGA 3KP6A 3GTPJ 1HOMA 5EGOB 1IV8A 1F36A 4PFOA 4BE1A 1ETWA 4E6KG 2DDBA 4KN7X 2P81A 4XONA 4YIFA 1CF7A 2K9SA 4GXOA 4IHYA 5DM6F 1IXSB 4A5NA 1UG0A 3HGYA 4Z6YA 1LNWA 2PJPA 2MW8A 1GV2A 5EEGA 1K78B 1ONVA 2K9LA 3CC2I 2L9VA 1VQ9I 2TCTA 1JHFA 5GP9A 4BEHB 1JKQC 1XX5A 1NG6A 2RREA 3FKIJ 1NG7A 1UAAA 1WZ2A 1W5TA 3S2WA 2XKPA 1P2FA 4NC7A 2QYOA 2KRHA 4C2MJ 3ASNH 4O3MA 2IPQX 1QZZA 1YJ9I 2DOEA 3SFIA 5DD8A 4BYYA 1WPKA 3DWLE 3F9KA 2FQ4A 3MN2A 1OYYA 5HVQC 1J75A 3FZVA 1P9QC 3JRCA 2VLAA 4E7ZA 2YU9J 4Y17A 3GZNB 3RKYA 3TGNA 4XLEA 3BR6A 3N05A 3U1DA 4PJNA 4A2UA 1LQ1A 3E6BA 3DXJF 3E6CC 1SFKA 3OYBA 3H3ZA 2LG4A 2K3FA 3E5QA 5DUIA 3ABMH 3C7JA 3WE3A 4NNJA 4B43A 1DGRM 3EUHC 1KU2A 3FM3A 5CVIA 1FBSA 1XSXA 1N77A 1L3LA 2ZJQF 1OCPA 2E71A 1LUJB 4NBQA 1P6RA 3HSFA 2V26A 4G8XA 4IXAA 1HLVA 4L9VA 4N9IA 1MH4A 2K02A 1OR7C 3ASOH 4CHUA 1IRGA 3A01A 3T8RA 3FBIB 1ZLKA 2I10A 2BW3B 2P7CB 4KNYA 2XB5A 4ZC3A 2NVQJ 3RDIA 2O8KA 5IYBJ 3PUFA 4IRGA 3W2VA 4D5FA 3V42A 5AIQA 5IY5H 5BOXA 1JKRC 4CCJA 2XC7A 1UJ8A 3E0JB 4BXUA 1KYZA 1Z91A 1IN4A 2O3FA 3HG9A 4MTEA 1JTYA 5EGOA 3HOWJ 4MEXF 4PGGA 2BBYA 2EA2A 3HHHA 3O8GA 5D6EA 3IC7A 3M8JA 2HXOA 5FKKA 4C2UA 1TTYA 2KMUA 4BQQA 2J5PA 1FP2A 2KP6A 5KAIC 2KDOA 5ILSA 3WG9A 1K78A 1I1SA 4XN0A 4RM2A 1IW7F 2HI3A 4BEHA 5GAEJ 2DCEA 1WGXA 3CUQB 2JPBA 3BR3A 4RLQA 1AOYA 4CCNA 4FISA 2L9RA 4R8HA 3GFLA 4XICA 1GHCA 1KA8A 1ORKA 1QHGA 3QYBA 3RYPA 2RDPA 1VQOI 3PQJA 2A5WA 2F5FA 5LGNA 2IS6A 2CFOA 3JRBA 4PGHA 1ETOA 4A12A 1R49A 2HU9A 2QCOA 3ROUA 4HOBA 2FX0A 2Y31A 3TW6A 3GZ5A 1R5ID 1UHMA 1W7PB 1S7OA 2DMPA 4LLGF 4YG2F 2DN0A 5HLHA 2GA1A 1QVTA 4CUGA 5J4VA 4RB3C 5H20A 5CVUA 4LIVA 2ZSHB 4G9YA 3F21A 1R00A 3S3NA 5EYRA 1HW2A 2OQGA 3VWBA 2QA4I 2E2IJ 1WI9A 3CP8A 2DJNA 5FFZA 4XLPF 1Z21A 3J7ZI 1X3UA 1J5YA 1VQPI 3I55I 1RIOH 4EM0B 5LEKA 4G7OF 4RB1A 2GIVA 3OOPA 3E97A 4CZCA 1RRJA 1QPIA 1ZG3A 2GIZA 4IHVA 2R92J 3AKZA 1X1PA 1CGPA 4IRIA 3G6EI 5GPCA 2CUZA 2EIMH 3J80K 5HODA 2BW3A 5B66C 4GO1A 5B1AH 1C0WA 4IQ4A 3S15J 1FIPA 4WXDA 3JTGA 1MMDA 3QYFA 5EZGA 1F4KA 2R7RA 5HDGA 2L7MP 4IHWA 4U0YA 4KYWA 5B3SH 3CJRB 2M8EA 2W82A 2VOPA 1Z6TA 2LP0A 3DPTA 2ID3A 1Z0XA 1OCOH 1ITYA 1FMWA 4I09A 3EUHA 5HLIA 4BBSJ 1JHHA 5IT3A 2WAEA 2LY2A 1UFMA 1D0ZA 4BJTA 1ZG1A 1OYWA 2KZVA 4C30A 1XPXA 4I01A 2OTLI 3BCAA 1LEBA 1XSVA 4ZTFA 4V2GA 1ZYRF 3CF2A 1OISA 1ZARA 5DCFA 1Z6RA 4HV5A 4LLLA 2OA4A 4M3GA 2IVMA 3CUQA 3IH4A 1XMKA 3G2BA 4PFPA 1QU3A 5KK1A 1IDZA 2ZXJA 2P5LC 4E7LA 3CMAI 3CF5F 2PMZN 2HQRA 4WX9A 1T2KA 2BVMA 2L4AA 4UVCA 1FYLA 5DTDA 2XGXA 1WHUA 1OLTA 2M87A 2CW8A 2HYJA 2CQ7A 2WY7Q 2R7ZJ 3HTUA 3GCMA 3BJ6A 3V7CA 3L2UA 2JSCA 1OQYA 2F48A 3GZ6A 2LSOA 4ENKA 4JP0A 4ESJA 5IT9K 4OOIA 2L9SA 2LK2A 1W7PA 3D5LA 3EUAA 4BE2A 4KDPA 4JX5A 1LKXA 2FOKA 3BCBA 3HEFA 3U1KA 2STWA 5ED4A 2LVSA 2WAQN 2Z3YA 2ZO4A 4B44A 3IRRA 1A6IA 2OD5A 2VXZA 4XRSG 4HA8A 4IEJA 1AWCA 2XAJA 1TQMA 2EV0A 3ZQ7A 2H6CA 4DYRA 2K3PA 3H3VK 3HYIA 3CCSI 3GMEA 3CCJI 4Q48A 1FYMA 3ECOA 2IAIA 1W36C 1I39A 3RJPA 5E8IA 3PNYA 3ZMUA 5D5VB 4P96A 1MSEC 4PSXA 4FHTA 1W7PD 4CXFA 2LF7A 2QBYB 1YX3A 2HPMA 4RDUA 2KPMA 3ZXSA 2MSYA 1XC5A 3F8MA 3GX4X 4AM3A 3A0BC 2YUSA 2I5UA 3P5JA 5LD2C 3IL2A 3OS2A 2D2WA 3I9V2 2EIJH 3LSMA 1IDYA 2XV4S 4TV7A 4XORA 3DBHB 3AG3H 3EPZA 3HRUA 3L7WA 2Z5UA 3H9GA 4IX7A 3LQQA 4CCKA 1UHSA 5FLXZ 4FE7A 2XF7A 4DYCA 1UHWA 4PJLA 1SFUA 2JVGA 1G3YA 2NXNB 2XRNA 4U0WA 2Y9YA 5M3MJ 1A36A 3K4CA 4BHCA 3MZHA 1IN8A 2VBZA 3BZKA 4EGYA 1X1CA 4EJTA 1RUOA 1D8KA 2XPUA 2Y75A 2L9NA 2MYSA 4YIIA 5J4YA 3J81Z 2LYCA 1TLHB 3DU6A 5BS6A 4L5JA 1MMSA 3BZCA 1NK3P 3L09A 2LOOA 4M6XA 3WE2A 3OR1C 2CSOA 1MBKA 2X9DA 2XAGA 2O9LA 3ISPA 1TWHJ 1XS9A 2ESHA 2F5VA 1KU9A 3ML6A 1OYIA 1H89C 1YW9A 1GXQA 5FFXA 2HNHA 1R1VA 1S8NA 3ZQHA 3CCYA 2QSHX 1A31A 2EFQA 2FF4A 2XKOA 3OYNA 2OF7A 1W0UA 1ZLJA 4JX6A 1RNLA 3TBIA 3MMYB 3F23A 4A3KJ 4HNUA 3WGHA 4D5CA 3FM5A 2FSWA 1BJAA 1ZQ3P 1L0OC 3K4NA 4C2TA 1D1CA 2EIKH 1Y0NA 4KIFA 2V6CA 3SEZA 5FROA 1BOBA 4GCVA 1VF9A 1JXSA 4A3DJ 3FXRA 1I50J 4I76A 1FP1D 3CZ6A 2DPDA 3IRQA 1I3AA 4GYGA 3SFZA 3CCRI 2K40A 1YLFA 2QLZA 2DFIA 2ZMEB 5B5EC 2ZFUA 2R7TA 2KIFA 1Y56A 1S3JA 2ZJRF 1HKTA 3M3YJ 3FXMA 2QBYA 2CRGA 1X2MA 3G1LA 5AONA 2IGKA 3I71A 1H9TA 5F27A 2DFHA 2GQQA 3G4SI 4GFBA 5JI6A 3DTEA 4BXFA 3AL0B 2RN7A 4XN3A 1TQIA 4HDVA 2E35A 1LDKB 4MHGA 3OYFA 2RKHA 2ELHA 2HQNA 3OSGA 1VQ8I 3KYDB 5M5WJ 3J7AY 1LE8B 3EDPA 3EYIA 5EEAA 3VODA 3OYHA 1JGSA 4XSZF 3RCOA 1YG2A 5FB2A 4M72A 1ERDA 1K83J 2AXLA 3H9QA 1FMVA 2H8WA 3QRFF 2DA3A 2DT7B 3NRVA 5L3FA 3O2PE 2A5YB 4IPAA 1X4OA 2KKOA 4EJVA 3T1BA 4OIPF 1WQ2A 4R1HA 4B47A 2DQRA 4HQMA 3V8LA 4A6EA 5HLGA 1W36D 4PZJA 3OMYA 2RAEA 2HS5A 1F43A 4B48A 2BY2A 1YIOA 1HKQA 1O3SA 4PJ0C 4RBOA 4Q4ZF 1W5CC 4BQAA 2NOGA 3AFHA 2FNAA 2KHMA 3ZQCA 3LFKA 1TWGJ 3HOXJ 1GUUA 2QENA 1U6GA 5LRSA 3PSIA 2PI0A 3TKYA 1QO0D 4KISA 1MGTA 1SANA 1HA8A 3MKZA 1F5TA 3B6AA 1TWFJ 3C2BA 4RMNA 5HS7A 1V54H 1K79A 1HC8A 1I5ZA 1RETA 2RC4A 2JA2A 4EJUA 4PJMA 4U87A 3VSLA 3CUOA 3P9KA 1H0MA 3MAJA 2R7XA 1WRJA 1ZGWA 1A35A 2KJCA 3ZR8X 2TDXA 2VBYA 3DKXA 4NB5A 2EZIA 3K0LA 1R7JA 2VKEA 1T0FC 4HYEA 4AUXA 2ZMEA 4CYCB 3FDYA 2QKLB 2X6WA 4NUBA 3TDZC 4ZJZA 1E3HA 5L3EA 1H88C 4I2OA 4AIKA 4KT6A 1RR7A 2DMQA 1Z9CA 3H5RA 3A1YA 1Y8QB 2BGCA 4HDUA 4BUPA 3W6VA 1XDUA 1QPMA 2NYXA 1IRZA 3QP6A 2Q2EB 2QKMB 4XOPA 1M1EB 2OJED 1POGA 5HS8A 4BE0A 3W3CA 2Y9ZA 1H8AC 4BY7J 3PUBA 1TNTA 4BH9A 2JRTA 2MG4A 2ZJPF 1BI1A 4IOAF 4MIMA 2XGCA 4F91B 3TOAA 3CC4I 1IJWC 3F8FA 1BIBA 1R5GA 2EFOA 2E1NA 2ECBA 1FEXA 1LE8A 4RGUA 1MBEA 4DGWB 3PIOF 2P0WA 2XGEA 2O7OA 2L7ZA 3SDGA 1RUNA 3IAM2 2QSGX 2R4GA 2K86A 3WTWC 2QEXI 2FQ3A 1IXCA 2DW4A 4X1EA 1SMTA 3MKYB 4BY1J 1USSA 2W84A 1BJZA 2YU3A 4DQ2A 5HNHA 4N9HA 2ZXHA 2LFBA 3VYRB 1H9GA 3PFYA 1SD5A 4HPQA 2JUCA 2DDAA 2IGMA 2L0KA 3MWMA 1YQAA 3FXJA 2JT1A 1XDSA 1ZR2A 1IF1A 1YS7A 4ZH4F 2A3SA 4FX4A 2CQNA 3FXQA 3OL4A 5IOZA 2F4OB 3JRFA 2HTJA 3G1OA 2NS0A 2BVLA 2ZNZA 3F8CA 3WU0A 5JR3A 1YX5A 4XKBA 2NOJB 1S7AA 4FTHA 2AQFA 2M4GA 3FISA 3OYJA 2XDVA 2C6YA 5L3BA 5K5QA 3V8JA 2QSFX 3UR3C 3BPXA 5ILVA 2LKXA 3S17J 2JTVA 4PCQA 2X6XA 1MZBA 3OS0A 2JA7J 3MVPA 2O0YA 4Y4RA 4IJAA 4Q5SF 3HJEA 2HVQA 2LKSA 1K7AA 1V5GA 1HW1A 2A05A 2GWRA 4CYCA 3EYYA 4G6QA 1S5LC 5A2QK 3OV8A 3AAFA 4RAZA 4UUVA 3GEZA 2Q2EA 4ITVA 2LLKA 3HOUJ 3WHBA 3KP7A 4DW6A 3I58A 1OFCX 1SEUA 2CUFA 4LK1F 2XF6A 2QZ8A 5C4JJ 1BI2A 2YPRA 5FO5A 1ZGAA 4LITA 4CA0A 3DKWA 2NVXJ 1V5FA 3X2QH 4ASNA 5JHUA 2L7FP 1GV5A 1T0FA 2ICWG 3G1MA 3KEYA 1X19A 2OCCH 3LOCA 1WJFA 1ZAOA 2FNPA 3PFIA 3QOEA 4G6DA 5ERIA 2ISZA 3M1CA 2WV0A 3MFKA 4FE4A 2VJ4A 4AD9A 1V4RA 1KQ0A 1DPRA 4QLCU 4ON0A 4B4CA 5HDNA 4B8XA 2GLOA 2PN6A 1TL8A 3TOBA 1QZEA 1G3TA 3CTAA 2UXNA 1JKOC 2E60A 4JYKA 1IV6A 4ENJA 4CZZA 5TISC 2V1XA 2E34A 2IGOA 1GVDA 2L01A 5M5XJ 1T38A 3KEOA 2R7WA 2D45A 4J00A 1JUPA 2X6YA 2VQGA 1JE8A 3LMMA 2XSJC 2XGDA 2BHZA 2V1UA 1X1DA 1FOYA 4LB6B 3ZMDA 1HF0A 4WWCA 4XKWA 4N4OB 4XNFA 4GRIA 1N78A 1O57A 5HOOA 4KIGA 2DK5A 3TO9A 3LSIA 2JSPA 1R71A 3K70D 2KJBA 3DPLC 1BI0A 4I99C 3IUOA 3HRTA 4WK8F 2I8DA 4RAFA 3JSOA 2R7OA 5GPAA 1SFEA 3F3XA 3PQKA 3WTZA 3O6BB 5H2FC 2G0EA 3VEPA 5HNFA 3P9IA 2VE8A 5GTIC 4AYBN 2F4IA 2FD5A 2OU2A 5FD6A 2HOEA 5CKTA 3JAMK 1ZGJA 1EH8A 3KP2A 5J8FA 3IH2A 4OINF 4X0GA 3M07A 1Q1VA 1WWXA 3Q3SA 5FRNA 3J80Z 1VZ0A 1MKMA 2Z1DA 1XCBA 1Z67A 3HC7A 4AWXB 1BIAA 4BS9A 3FIWA 4M6VA 2LY1A 3GLLA 1U3EM 3WTTC 2R0QC 2DQLA 2YX7A 4YFXF 3DLAA 2GM4A 3WTXC 5C3EJ 3E6DA 3GUDA 4II2A 3IKTA 2ELJA 4RGXA 3WGIA 2P6TA 3RKQA 1D5YA 3S2DJ 4BJ5C 3JRHA 1W1WE 3L2VA 1G2HA 2MLKA 1BN5A 1ZREA 1XMXA 2VKVA 2EILH 1KZHA 1DDNA 5FGMA 4YRVA 3OYMA 4IHTA 3BG5A 1Y39A 4HV6A 3JRGA 3I54A 4HAMA 1HBXG 4UVBA 2FEZA 4IHXA 1R9TJ 2DA6A 3L2QA 1X4PA 2G9WA 3HB9A 4A3BJ 5DDGA 1ENHA 2CW7A 1O4XA 2DJIA 3QPLA 3OYEA 2L3DA 2VN2A 3E7LA 4A3MJ 3EQLF 2JA5J 3MCZA 2PFBA 2EFWA 1P4WA 2HQAA 4XRFA 3HPHA 1YIJI 2V7FA 3TO7A 2KLOA 4I7HA 2O8XA 4Y52J 4XOTA 1USTA 2N8GA 2QM3A 2V9VA 2WTEA 3BTJA 4XLNF 1YO5C 4W97A 2R7QA 4E7KA 3DEEA 4JX4A 5IT9Z 2EZHA 1ACIA 3K1NA 1S29A 1V3FA 4EMSA 4L9NA 1VNDA 5F6FA 4AU7A 3RPUA 2OAZA 5FKLA 2BV6A 4C9YA 4RGRA 1R4NB 5CVVA 4IQJA 4KMUX 3OYAA 1BW6A 3R0AA 4E7IA 2VOOA 5L3CA 1UELB 4XR6A 1FJLA 2PBIA 1UCRA 2R7FA 3H35A 3LAJA 1R58A 2FE3A 3LL7A 4LOCA 1JI8A 1MJBA 1QNTA 4KN4X 3OWTA 2A6EF 2AS5F 3KZIC 4ZYAA 4B3AA 2ID6A 3GVAA 3L00A 5J40A 2WB1A 4Z2YA 4BJ6C 1XTAA 4D9JA 1FNNA 2OZ6A 5M3FJ 3BTLA 5LHGA 4B1RA 1G4DA 5J1RA 3FK6A 3IH3A 2HKOA 5DD4A 3RPUD 4LMYA 1F9NA 3C18A 2L02A 4HEA2 4RA2A 1GVJA 1Q1HA 2STTA 2F4MB 3S8PA 2DT5A 4DZPA 2KRCA 4I0BA 1S9HA 3NARA 1QZYA 4HSRA 1ON1A 2BOLA 2M34A 5FJ8J 1DU6A 2UWMA 1B8IB 3H5AA 2AHQA 4LB5A 5JHFA 4EQQA 4XKVA 2BYVE 2HXIA 3N4MA 4ESBA 2MFZA 4EEFG 2HDWA 2FBHA 1OR7A 3MKWB 5KCMA 1O3TA 2ME6A 3K4MA 1FWZA 2H94A 2IA1A 2DA2A 1HQCA 2Z99A 2V79A 1LDDA 4DJAA 4AIJA 3WGGA 3K2AA 1FSHA 5EDNA 1K4SA 2VUMJ 2HGCA 4HBLA 4W1UA 3SQNA 3WU2C 2NAZA 5ICCA 3Q9VA 1APLC 3ZQFA 1JTXA 1ZELA 2OC6A 2Q1ZB 4XKCA 3VSKA 2JQ7A 1STZA 2WWYA 1A6QA 1RESA 3C1DA 3BZ6A 3WTSC 2NNNA 1MJAA 1IN7A 4QSHA 5TRDA 3RPQA 2FBIA 5J8CA 1IUFA 3DV8A 1MBFA 3GF2A 2CV0A 3HOYJ 3KFWX 1QBJA 2QWWA 5DUKA 5IOYA 5IP7J 2ZNYA 2M0CA 2O5RA 1ETKA 1G59A 4WCGA 1SAXA 4E7SA 1BA5A 2HQ5A 2FA5A 4C3HJ 5LHHA 3CCMI 1JGGA 3FXKA 3DTIA 1E2XA 1W0TA 3IP4B 2JN6A 4P9UA 5K7HA 2ADUA 1FPQA 2VPLA 4E4HA 2Y0SA 1JUMA 3FMQA 2VQCA 3JRAA 1MJ9A 4AC0A 1RC9A 4KIBA 3OYDA 2W57A 4NC8A 1TQPA 2DBBA 3CLOA 1TT5B 1RPWA 3QQAA 1YTYA 3RTRA 1SD4A 1FX7A 3HL2A 2VL8A 2GXBA 4ZYDA 2IRFG 2RNJA 1Z3XA 1ZK8A 3KE2A 2Y2ZA 2XASA 2VC0A 3V4GA 2Z9OA 1IC8A 2M1BA 1R36A 1RZ4A 2YX4A 1XN7A 4F55A 3LA2A 1FY7A 3KZZA 3BP8A 3LA7A 2HVRA 2VONA 2R5YB 2NVUB 4EVIA 3RI4A 4IO9F 3SJMA 3KP4A 3F22A 3MD2A 5LGTA 1B8IA 1KU3A 2YS9A 3K69A 1J09A 4M9SA 4A69C 2CU7A 2V6EA 4M9ZA 1P7IA 2DYRH 2EWNA 4L5EA 1ZRCA 1ZRFA 3OOUA 5D6FA 4HW0A
chains in the Genus database with same CATH topology
2EIJH 3ABMH 3X2QH 5IY5H 3ABLH 1OCCH 5B1BH 2EIMH 3AG3H 3WG7H 1OCRH 2Y69H 5B1AH 3ABKH 2EIKH 2OCCH 3AG4H 3ASOH 5B3SH 1V55H 2DYSH 3AG1H 2ZXWH 1OCOH 3ASNH 3AG2H 2DYRH 2EINH 2EILH 1OCZH 1V54H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIJ H;  3ABM H;  3X2Q H;  5IY5 H;  3ABL H;  1OCC H;  5B1B H;  2EIM H;  3AG3 H;  3WG7 H;  1OCR H;  2Y69 H;  5B1A H;  3ABK H;  2EIK H;  2OCC H;  3AG4 H;  3ASO H;  5B3S H;  1V55 H;  2DYS H;  3AG1 H;  2ZXW H;  1OCO H;  3ASN H;  3AG2 H;  2DYR H;  2EIN H;  2EIL H;  1OCZ H;  1V54 H; 
#chains in the Genus database with same CATH topology
 1MMN A;  4LK0 F;  3U9G A;  3S32 A;  5E79 C;  1Y1W J;  1WJB A;  1IN6 A;  4BQN A;  1RKT A;  4IF4 A;  5B1B H;  1LJ9 A;  1T8I A;  1AKH B;  4RGS A;  3FF5 A;  4A0Y A;  3CCV I;  3E3V A;  3LA3 A;  2MD5 A;  3GTQ J;  4A3J J;  2F5E A;  5HLT A;  3ZGK A;  1OKR A;  2R7V A;  4CO8 A;  2BEO A;  1B9N A;  2BXY A;  3M9A A;  4NDL A;  1VQ4 I;  3U2R A;  2DMN A;  1K6Y A;  3LSJ A;  3SZG A;  2IS4 A;  2KFD A;  2PEX A;  3ABT A;  3DFG A;  1TZL A;  3F6V A;  3K2Z A;  4ZZL A;  1UG2 A;  2E5N A;  1G8X A;  2O03 A;  1S72 I;  3CDH A;  4NQW B;  4O5V A;  4R79 A;  1SVM A;  1R1T A;  3K9T A;  1EF4 A;  2ELK A;  5E1X A;  3L2C A;  1JUS A;  3DP7 A;  1MMA A;  1D0X A;  4PJJ A;  4BQO A;  1RR8 C;  3PSF A;  3RKW A;  3BRO A;  2DFF A;  4P1W A;  4KIT B;  3SZT A;  3F72 A;  4EV0 A;  4BAC A;  3KP3 A;  3ZMV A;  5FLM J;  1WSU A;  2HZD A;  4HX4 A;  1LFU P;  3I53 A;  1JJ6 C;  1KGS A;  4E7H A;  5K7F A;  1XGO A;  2XB0 X;  4LG3 A;  3T8T A;  5J6X A;  2NVY J;  5GTH C;  2ZCW A;  1D3Y A;  1MNE A;  3TED A;  4CCO A;  1LVA A;  3I59 B;  1E3P A;  3H9J A;  2P7V B;  1TWC J;  2ZC2 A;  3HIF A;  1EH7 A;  4J19 A;  1FLI A;  4FQG A;  1X3W B;  3COA C;  4UNO A;  2VOD A;  3BDD A;  2QQA A;  3L9F A;  4RS8 A;  3JSP A;  4EM2 A;  1Z7U A;  1TP4 A;  3WTY C;  5ILU A;  2O6G E;  2QQ8 A;  2Z16 A;  5E1Z B;  2R5Y A;  2Y30 A;  3JW4 A;  3HTS B;  1IXR C;  4OMZ A;  2DTZ A;  1U5T C;  3JRD A;  3CCL I;  4A3C J;  4KA4 A;  1OCT C;  4CH7 A;  2HOT A;  5JVG F;  2DPU A;  2R3S A;  4C3J J;  3WG7 H;  1SD6 A;  4U0V A;  2CW0 F;  3O3K A;  2V1D A;  1VI0 A;  1PP8 F;  1SAU A;  3GFM A;  2LTP A;  3CCQ I;  4N4N B;  2WB1 N;  3GO5 A;  1SC7 A;  1YS6 A;  2QF7 A;  1OPC A;  5CJ9 A;  1R23 A;  3OIP A;  1VQM I;  1DU0 A;  4GGG A;  3DQV C;  1AKH A;  2E2H J;  3QPH A;  1ZR4 A;  1FTZ A;  1QA6 A;  3CJN A;  3OYC A;  1KQ8 A;  4KIC A;  1U0J A;  1MH3 A;  4G6T B;  1MND A;  1OCC H;  2QGU A;  2E36 A;  3JRI A;  1IN5 A;  3HUG B;  3M7G A;  1BR2 A;  2L5Q A;  2XAF A;  2BE5 F;  5L3G A;  2HDD A;  3ABK H;  2L7K A;  4PUS A;  2ZBK A;  4HF1 A;  2B7E A;  1T56 A;  3KEQ A;  2V9K A;  3Q0V A;  4IL6 C;  2IS2 A;  4NQW A;  1J7K A;  4BHB A;  1XGN A;  4UY8 I;  3BLY A;  5D4R A;  4DZJ A;  3BG7 A;  1FSE A;  2MH2 A;  2OQR A;  1DP7 P;  2GA2 A;  2EIN H;  1BBY A;  2X0L A;  3EET A;  3QOD A;  2EFP A;  4RM3 A;  5BNG A;  3BG9 A;  4EAT A;  4X6A J;  2ACJ A;  1DGW Y;  3LQR A;  2HVS A;  1QVU A;  3ERE D;  4F52 A;  4UB8 C;  2PG4 A;  3SYT A;  2HR3 A;  4MLO A;  3WOD F;  3OYK A;  4E70 A;  1FBQ A;  2CG4 A;  1VFC A;  4V2F A;  2CO5 A;  2J5O A;  4LIU A;  1TW2 A;  4A0Z A;  3BPV A;  3DBR B;  2R7U A;  5K7Z A;  2R93 J;  2CQX A;  1VQL I;  3I59 A;  1QGP A;  3QU6 A;  4P55 A;  4RLF A;  4CIC A;  2F5C A;  3VOE A;  4DNC A;  2VB6 A;  4K2E A;  3GYH X;  1AA7 A;  2OCE A;  5KAF C;  3VPR A;  5CQG A;  2M2E A;  2X1E A;  4M3E A;  4RAG A;  4ZDP A;  4AVP A;  5A2Q Z;  2OBP A;  3V7R A;  1E3O C;  2LC2 A;  2XIG A;  2EV5 A;  3HSR A;  3DLL F;  2KRF A;  2ZB9 A;  3W2A A;  4CCM A;  1HXD A;  2K9N A;  3DU5 A;  1VQN I;  2ESN A;  4AID A;  1WVR A;  2XPV A;  1FIA A;  3NEU A;  3H92 A;  2CUJ A;  2Y0S N;  3LST A;  4QIW N;  2MGQ A;  5FKM A;  4P9F A;  2H8R A;  3LAP A;  4L9T A;  2CQQ A;  2W1O A;  3K6G A;  3S1Q J;  2KT0 A;  4L5I A;  1K4T A;  1S7E A;  1KQ9 A;  2CYY A;  1LB2 A;  4DIQ A;  1Z1D A;  3M8F A;  1X2N A;  2MD0 A;  3E5U A;  3W2W A;  3ZQI A;  3BJA A;  1MSF C;  1WJE A;  3QWL A;  4UB6 C;  4F93 B;  2GOM A;  4ENN A;  4LLN A;  4G94 A;  1YHQ I;  2DXI A;  4CGZ A;  2CV2 A;  4XID A;  1V5E A;  3ZN0 A;  2IEK A;  3BJO A;  4Y13 A;  1KYW A;  3BG3 A;  1YOV B;  3GXO A;  3BOQ A;  2E1C A;  1SFX A;  2XAQ A;  1OMI A;  1LDJ A;  2Q8K A;  2HOS A;  1XG1 A;  1WH7 A;  3S16 J;  3H5N A;  3HUG A;  3I0T A;  1J2X A;  2M7A A;  3L2W A;  1I6H J;  2COM A;  2OV7 A;  1O3Q A;  2EA4 A;  2W48 A;  1BC8 C;  1LEA A;  5D8L B;  2DO7 A;  5JFR A;  1D8J A;  2QVO A;  5EF6 A;  1MNM C;  1HKS A;  4XBF A;  2EH3 A;  1TW3 A;  2IS1 A;  4YIR X;  3CC7 I;  4HF0 A;  3Q0U A;  3ZPL A;  3Q5F A;  1U2W A;  3JTH A;  3HDD A;  2VBW A;  1YJW I;  3CO7 C;  2G7H A;  1WI3 A;  2AQE A;  4ETS A;  1MD0 A;  1YW8 A;  2OUM A;  3BC8 A;  3K1P A;  3SHF A;  1VQ7 I;  4Y33 A;  1F1Z A;  2CH0 A;  2JRM A;  2DA7 A;  3ZMZ A;  1EJ9 A;  4L18 B;  3QU3 A;  5CLS A;  3S14 J;  4XRM A;  2VE9 A;  5DS9 A;  3RQ4 A;  4BGD A;  4KJZ A;  1PVE A;  3SEQ A;  2HYF A;  3CP2 A;  1ETQ A;  1SFO J;  1NH3 A;  2HDC A;  4MTD A;  3CD6 I;  2CFX A;  3N97 A;  3U21 A;  3JAM Z;  1DP3 A;  3F8B A;  5GAH J;  3LWF A;  3A4C A;  2HTS A;  1U8R A;  5LRR A;  1U9N A;  3MZY A;  2IA0 A;  2FML A;  2HFH A;  2A68 F;  2M8G X;  3D5S C;  3ESW B;  1GXP A;  2LNB A;  5F1R A;  5E3N A;  4B3X A;  4LJZ F;  3L2R A;  5FKO A;  5ICF A;  4ZYH A;  5DCM B;  3V8K A;  2FXA A;  2X1C A;  1B4A A;  1XCV A;  3GWZ A;  3NAU A;  3C2H A;  2MAB A;  4YEL A;  5CVR A;  1I3Q J;  1HW5 A;  1XGS A;  5F0C A;  1EA3 A;  5AIP A;  5F08 A;  3KYC B;  4MFD A;  2A6H F;  3FKJ A;  1D1B A;  2DMU A;  3FXO A;  4BNC A;  1X58 A;  2XAH A;  3S1M J;  2Q0O A;  4ABZ A;  3S2H J;  4BKX A;  3RKX A;  4A3F J;  2VQH A;  2UXX A;  3OSF A;  2FJ1 A;  5E18 F;  3VDX A;  2EFN A;  2H6B A;  2XRL A;  3QPS A;  2PLY A;  4A5M A;  1TBX A;  4XLH A;  2E7X A;  1S6L A;  5IP6 A;  2MA3 A;  2KQR A;  3NWS A;  2CS3 A;  4IRH A;  3FWE A;  1QRY A;  1T95 A;  5E8G A;  1E17 A;  1E0E A;  2WAQ A;  4IHS A;  2M5W A;  1HSJ A;  1UB9 A;  5FD5 A;  2P8T A;  3FXL A;  3HOS A;  2M7B A;  3I3L A;  3I4M J;  1XGM A;  4ZDO A;  2RGV A;  3A0H C;  1ODD A;  3VYU B;  3KCC A;  5CPR B;  2QQB A;  1XB4 A;  2L4M A;  3BQY A;  2FMY A;  4J01 A;  4CYD A;  1XMA A;  2W85 A;  4ZYG A;  5D4S A;  4D7N A;  2WC2 A;  1PP7 U;  3WTV C;  4U7D A;  5ICG A;  1O3R A;  3V7S A;  4WF2 A;  4NC6 A;  3A03 A;  2LBF B;  1PYV A;  1Y8R B;  4HG2 A;  1FC3 A;  1EV7 A;  3ABU A;  3I64 A;  3FHZ A;  5CQE A;  4RAY A;  2R7D A;  3BR2 A;  3CJQ B;  1J59 A;  2E5Z A;  2RV8 A;  4XLF A;  2R7S A;  2R5Z B;  4PK4 A;  5GAD J;  3K7A J;  2VKH A;  1ETY A;  5E3L A;  2GXA A;  3CCU I;  1Z05 A;  3F0C A;  1ETV A;  2G7U A;  3PNV A;  2LRE A;  5F0F A;  1G3W A;  2JA6 J;  2NS7 A;  3ZMS A;  4G7Z F;  5DCM A;  3AG1 H;  1K61 A;  2EV6 A;  4FX0 A;  4F92 B;  3KIO A;  4YFN F;  4IOC F;  4YFK F;  2HZT A;  1AU7 A;  1Z7L A;  3CUQ C;  4U7B A;  3HZJ A;  4DBR A;  1YYV A;  3HXL A;  1I6X A;  3MKL A;  5BMZ A;  2K27 A;  1XD7 A;  2QUF A;  3BG6 A;  1SVO A;  5EG0 B;  2IW5 A;  3R60 A;  2XVC A;  1Y6I A;  1IRX A;  2E2J J;  3SDB A;  2K4B A;  1YRN B;  3A2K A;  3WU1 B;  2PQ8 A;  4EGZ A;  1CQT A;  2QQ9 A;  2ETH A;  3S1N J;  3D1N I;  3CDI A;  3ZN1 A;  4AIH A;  2X4H A;  2UUZ A;  3RQI A;  4A3E J;  2VT3 A;  5CYV A;  2EZL A;  3E5X A;  3EUK L;  1BR4 A;  2TRT A;  4AVZ A;  3PO3 J;  2VJ5 A;  3DBL B;  1TNS A;  2FU4 A;  4M73 A;  4XLA A;  2E7W A;  5FLV A;  1PJR A;  5JLX A;  3S3M A;  3MQ0 A;  4U88 A;  3DCF A;  3G3Z A;  1SVL A;  5FRM A;  1P4A A;  4XK4 A;  2ZSI B;  4OU0 A;  2GZW A;  5DM7 F;  2OZU A;  3C3W A;  2M4K A;  4YEJ A;  4CDG A;  4HLX A;  1U8B A;  3DTK A;  3R4K A;  4HNT A;  1FOW A;  3H0G J;  3RZO J;  4F3Q A;  1PUF B;  2DTR A;  3FMR A;  3GW2 A;  5LLQ A;  3WTU C;  1LVK A;  2B0L A;  2H1L A;  3T5X A;  2EJR A;  1WJ5 A;  1T98 A;  1IAW A;  4UV8 A;  4EJW A;  2W24 A;  3FHN A;  1EKE A;  3OIO A;  1X1A A;  1DPU A;  3LSG A;  4UUS B;  1MBH A;  2EK5 A;  2LBF A;  3SZP A;  4S04 A;  4LG0 B;  5J3L A;  3ZP5 A;  2L54 A;  3R61 A;  4H4K C;  2OTJ I;  2HWV A;  2KDZ A;  5J1Y A;  3HOZ J;  3HPG A;  4Y3O A;  2R5Z A;  1V55 H;  2H1K A;  4D1Q A;  1VQ6 I;  2KZG A;  4MNU A;  3QAH A;  4I6Z A;  4UV9 A;  3IHU A;  4V19 K;  1MIJ A;  5C44 J;  5LBQ A;  3G73 A;  3CO6 C;  1G6N A;  2RNG A;  2WAD A;  5LHI A;  3H3U A;  1RI7 A;  3C2G A;  1G3S A;  2W4S A;  2FBK A;  3FX3 A;  1PDN C;  4DYQ A;  4G7H F;  1Y1V J;  2M30 A;  2W7N A;  4P5O A;  2IA2 A;  4IZZ A;  4OIR F;  4KT5 C;  3K4B A;  5J1U A;  4MQV A;  1D5V A;  2IP2 A;  4XMY A;  2DOD A;  2HEO A;  2DYS H;  1MBJ A;  2XAU A;  5EG0 A;  3NQO A;  2ZXI A;  5J47 A;  1JJ8 C;  1Z77 A;  3KZY A;  3KLO A;  2LRD A;  1AHD P;  3GLX A;  1B72 B;  2NVT J;  1YRN A;  2VAS A;  2UV1 A;  3FMS A;  1DQU A;  4A3I J;  2HOA A;  4ZTJ A;  4MFE A;  4ESF A;  4S05 A;  3KLN A;  1R1U A;  1LPQ A;  3E1S A;  4QTR A;  2RQQ A;  1N25 A;  5D5W B;  2YSR A;  2Z2S B;  5E3M A;  3CMY A;  5BPI A;  1UMQ A;  5E20 A;  2JA8 J;  4BDY A;  1BC7 C;  2K9Q A;  3TMO A;  2LD5 A;  3J7A O;  4O6J A;  3BTC A;  4UXN A;  2IBD A;  4MGR A;  5F0H A;  2V4J C;  2GOX B;  1O7F A;  3GTG J;  5IPA A;  1KON A;  2KIU A;  1N75 A;  2XPW A;  3ELK A;  1LFP A;  2CWE A;  3DKY A;  4FCY A;  2H09 A;  3P9C A;  2EZK A;  1XSD A;  1TWA J;  1OCR H;  4IKF A;  3GTK J;  2L2O A;  3UKG A;  1R22 A;  1PUF A;  3ZCO A;  3OIQ A;  3OL3 A;  3B73 A;  3K1M A;  3H0D A;  2K9M A;  2JVH A;  1YFH A;  3OYL A;  4HQE A;  1JT6 A;  3IWF A;  2JUG A;  2GXG A;  3CJT B;  4Q47 A;  5TJJ A;  1A04 A;  3TO6 A;  4ANJ A;  4EJO A;  1YE9 A;  4UUS A;  2DAO A;  4LG0 A;  3S93 A;  3D0S A;  1D0Y A;  1HDP A;  1IO2 A;  1WJC A;  5BPD A;  3GTL J;  3R0J A;  4MO7 A;  3K4J A;  4CCL A;  4ZDL A;  3BT9 A;  4JOM A;  4XM3 A;  2PMH A;  1QQI A;  2X6O A;  4HST A;  2CGP A;  5F64 A;  1ZH5 A;  3F8N A;  3REO A;  3MZ8 A;  4OWR B;  5D5X B;  2Z33 A;  2NNY A;  2VPR A;  4HX8 A;  1P92 A;  2X48 A;  1FZP B;  5DYM A;  2FUG 2;  3HRS A;  4E7J A;  4XRS A;  4ENM A;  2CQK A;  1W5S A;  2DK8 A;  1VQK I;  4KUM A;  1FOK A;  2F5D A;  3ULQ B;  3I4N J;  1MBG A;  3HGG A;  4ZZD A;  4GYI A;  3LSR A;  1SD7 A;  1PUE E;  2MC4 A;  3ZMT A;  2LDU A;  1ZN2 A;  5E1W A;  3S3O A;  2IGN A;  3CLQ A;  3PL8 A;  4UUT A;  4XL9 A;  1WKM A;  1B72 A;  2XSD C;  3S1R J;  1NHA A;  4WXC A;  2MLG A;  3HOV J;  5JLW A;  2XRO A;  1GLN A;  3KYL A;  1ZRD A;  4HRI A;  3GTO J;  1Y0U A;  2CJJ A;  2IXS A;  2DA5 A;  3W6J B;  2JZY A;  3VB2 A;  4HX7 A;  3CME I;  5FKN A;  2P5K A;  1NTC A;  1MDM B;  2BHY A;  5KVR A;  2WA0 A;  1R6R A;  4JK1 X;  2ME0 A;  5M5Y J;  3UNG C;  3P7N A;  4HZF A;  3VFZ A;  1WCM J;  3M4O J;  1Z3Y A;  3T0Y A;  4M74 A;  4HNV A;  3LSK A;  2IT0 A;  3PM1 A;  2P5V A;  1R4M B;  1VQ5 I;  2KIS A;  4C3I J;  3OYI A;  2PMU A;  1BW5 A;  2M3A A;  4BDZ A;  2JPC A;  2A07 F;  3LFU A;  5DEQ A;  3E6M A;  1D1A A;  3NWT A;  2ZME C;  4M9X A;  2GBY A;  2K5C A;  2DI3 A;  4KMF A;  3ABL H;  3CDL A;  4M6Y A;  2V9P A;  3HKZ A;  3IV5 A;  3R6S A;  5E3O A;  5CVJ A;  4OAY A;  1HDD C;  4L0Y B;  2EPF A;  1FBU A;  4UVA A;  1T39 A;  2B9S A;  4OAZ A;  1B9M A;  2VT2 A;  2WY8 Q;  2Y0M A;  3IWZ A;  4QWQ A;  4XLC A;  5L3D A;  4HLY A;  1DUX C;  3AL0 C;  2RVC A;  4S0H B;  1B1B A;  6PAX A;  2WAF A;  4HF2 A;  2VJJ A;  3AG2 H;  3IAS 2;  4NHJ A;  1RKW A;  4QPO A;  1O7L A;  3BR5 A;  1BI3 A;  2X1D A;  5IP9 J;  2MC3 A;  1W4M A;  3B02 A;  1J0R A;  3MEX A;  4M3B A;  3KPH A;  2BY1 A;  3ZQG A;  2KIQ A;  4D7M A;  2D1V A;  3PNT A;  3PJR A;  3LSH A;  3DPU A;  1EH6 A;  3K4L A;  2COB A;  1B6A A;  2HKX A;  3JRE A;  5IYC J;  3BTI A;  4RB0 A;  2ZJ2 A;  1I27 A;  1T33 A;  4F7Z A;  5K5R A;  5EJC A;  1WJA A;  1A5J A;  2PJR B;  2Y69 H;  3Q0W A;  4MEY F;  5LEJ A;  3LNQ A;  1JKP C;  1BR1 A;  3I4P A;  5KHD A;  3LSP A;  4FET A;  4II3 A;  3QOP A;  4A0X A;  2XUB A;  2MBF A;  2JWT A;  4N0B A;  2UZK A;  3CCE I;  5DV5 A;  5LFA A;  4G12 A;  3A02 A;  3F6O A;  5F1J A;  2DMT A;  4LD5 A;  5FLX K;  1MMG A;  2XHK A;  4BXX J;  1VTN C;  5D5U B;  5TGT A;  1MW7 A;  1LFB A;  4BBR J;  3JCU C;  1U5T B;  5H6Q A;  3BR1 A;  3OY9 A;  2K7L A;  2W00 A;  3QPT A;  3Q9S A;  3M1E A;  3H36 A;  3CMM A;  1J9I A;  2DLL A;  2OPT A;  2RQP A;  1IG7 A;  4LGW A;  1YIT I;  3ONQ A;  4OIO F;  1FTT A;  3J81 K;  2M45 A;  1SMY F;  2HPI A;  1MDM A;  3GTM J;  1UZC A;  1ZHF A;  2PX9 A;  1HST A;  3J7Y J;  3L1P A;  2B63 J;  4QPQ A;  4Y15 A;  1U9O A;  4BU2 A;  3JR9 A;  2CMP A;  2O61 A;  1REP C;  4EM1 A;  3W6K B;  4AYB A;  2AO9 A;  5F04 A;  3WHC A;  5JVT A;  2BXZ A;  1FOX A;  2JK3 A;  3RIR A;  1GDT A;  4IVN A;  2H27 A;  3ZQQ A;  4PSW A;  2JJ7 A;  1T6S A;  4CSW A;  2E19 A;  1B59 A;  4OIQ F;  2DA1 A;  1IGN A;  2YR2 A;  2A6T A;  1ZTR A;  3CES A;  2CUE A;  2BZT A;  4A3G J;  2EB7 A;  2CV1 A;  3FXU A;  5K5O A;  2WV1 A;  1FT9 A;  1BL0 A;  1NK2 P;  4H0E A;  1P7J A;  2VKD A;  3O8H A;  4B09 A;  1GT0 C;  2EBI A;  1JT0 A;  1OJL A;  2NS8 A;  4M71 A;  3RYR A;  1TT0 A;  5K1Y A;  5HDK A;  2GAU A;  2P6S A;  3DEU A;  1WFX A;  3HSE A;  1K6O A;  4WXH A;  2X85 A;  4I0A A;  2W25 A;  3D5R C;  2IJL A;  3CQZ J;  4GDF A;  2LF8 A;  4DOZ A;  3GFJ A;  3SXY A;  3I5U A;  5EZH A;  3TP3 A;  1FYK A;  1OCZ H;  1YJN I;  2LH9 A;  2PJR A;  2P4W A;  5C4X J;  4ZYE A;  3HHG A;  3M8E A;  2LMD A;  3TDU C;  3OYG A;  2D1H A;  4L9J A;  2BY0 A;  4LFU A;  3FK7 A;  1HCR A;  1IZ1 A;  3TW7 A;  3K70 C;  4M3F A;  1CF7 B;  2DT6 A;  5IYD J;  2E1M C;  1IRF A;  2Y48 A;  3QP5 A;  2K4J A;  3OS1 A;  2K85 A;  4JQF A;  3I56 I;  1U5T A;  5HS9 A;  3ZRG A;  3HM5 A;  1X1B A;  4XQF A;  2F2E A;  2VIX A;  3B6C A;  2VJI A;  2LY9 A;  4RB2 C;  2VI6 A;  1ZKG A;  5E17 F;  1IUY A;  3K10 A;  3IKV A;  2HYG D;  3GTJ J;  2ZKZ A;  1U78 A;  3DEW A;  3G71 I;  2LR8 A;  4M3D A;  2D5V A;  1X3Z B;  4Y7N J;  1T08 B;  4PDK A;  1ZG5 A;  4FAS D;  2DOF A;  2FRH A;  2E1O A;  3VYT B;  2DOA A;  5H6R A;  3KET A;  1ULY A;  3ZOB A;  3ERM A;  4BL0 B;  3AG4 H;  1KU7 A;  3OR2 C;  2E1M B;  3VYS B;  3HRM A;  3RSN A;  2VBX A;  1P4X A;  3KP5 A;  2F6C A;  3QYE A;  1WH5 A;  1ON2 A;  2WBM A;  2VXD A;  2X51 A;  2ZXW H;  4UHT A;  5KNL A;  2JMW A;  3H1C A;  2ZFW A;  1YI2 I;  2KL4 A;  4KFC A;  2M9H A;  3K4K A;  2KIM A;  3TP0 A;  4MQ9 F;  1TC3 C;  4DBQ A;  2DFE A;  2M0M A;  5ICE A;  2DA4 A;  2DU9 A;  2BY3 A;  3GFI A;  3HBL A;  1BM9 A;  3RZD J;  2FOW A;  3PIP F;  3HOT A;  2XF5 A;  4L0Z B;  4I02 A;  3ZQL A;  1YW7 A;  3DF8 A;  4BHP A;  5EEH A;  4A93 J;  2VC1 A;  4XSX F;  1WJD A;  2A61 A;  2MH9 A;  3BQZ A;  3BY6 A;  2EQR A;  2ISY A;  3PO2 J;  5D8K B;  1I1G A;  3BWG A;  2A69 F;  5GAG J;  5LGU A;  3A01 B;  4A3L J;  3KX2 A;  2AXT C;  4D0P A;  2LKP A;  5BQT A;  1BOA A;  2V1N A;  2VQL A;  4OMY A;  4JBA A;  3TQN A;  2ECC A;  1R5H A;  9ANT A;  3BR0 A;  1QHH D;  3FBN B;  4BAY A;  3ECH A;  4A6D A;  3HKZ N;  4I98 B;  1ETX A;  2NRA C;  3TL4 X;  4FT8 A;  2PMZ A;  3GBG A;  3KP6 A;  3GTP J;  1HOM A;  5EGO B;  1IV8 A;  1F36 A;  4PFO A;  4BE1 A;  1ETW A;  4E6K G;  2DDB A;  4KN7 X;  2P81 A;  4XON A;  4YIF A;  1CF7 A;  2K9S A;  4GXO A;  4IHY A;  5DM6 F;  1IXS B;  4A5N A;  1UG0 A;  3HGY A;  4Z6Y A;  1LNW A;  2PJP A;  2MW8 A;  1GV2 A;  5EEG A;  1K78 B;  1ONV A;  2K9L A;  3CC2 I;  2L9V A;  1VQ9 I;  2TCT A;  1JHF A;  5GP9 A;  4BEH B;  1JKQ C;  1XX5 A;  1NG6 A;  2RRE A;  3FKI J;  1NG7 A;  1UAA A;  1WZ2 A;  1W5T A;  3S2W A;  2XKP A;  1P2F A;  4NC7 A;  2QYO A;  2KRH A;  4C2M J;  3ASN H;  4O3M A;  2IPQ X;  1QZZ A;  1YJ9 I;  2DOE A;  3SFI A;  5DD8 A;  4BYY A;  1WPK A;  3DWL E;  3F9K A;  2FQ4 A;  3MN2 A;  1OYY A;  5HVQ C;  1J75 A;  3FZV A;  1P9Q C;  3JRC A;  2VLA A;  4E7Z A;  2YU9 J;  4Y17 A;  3GZN B;  3RKY A;  3TGN A;  4XLE A;  3BR6 A;  3N05 A;  3U1D A;  4PJN A;  4A2U A;  1LQ1 A;  3E6B A;  3DXJ F;  3E6C C;  1SFK A;  3OYB A;  3H3Z A;  2LG4 A;  2K3F A;  3E5Q A;  5DUI A;  3ABM H;  3C7J A;  3WE3 A;  4NNJ A;  4B43 A;  1DGR M;  3EUH C;  1KU2 A;  3FM3 A;  5CVI A;  1FBS A;  1XSX A;  1N77 A;  1L3L A;  2ZJQ F;  1OCP A;  2E71 A;  1LUJ B;  4NBQ A;  1P6R A;  3HSF A;  2V26 A;  4G8X A;  4IXA A;  1HLV A;  4L9V A;  4N9I A;  1MH4 A;  2K02 A;  1OR7 C;  3ASO H;  4CHU A;  1IRG A;  3A01 A;  3T8R A;  3FBI B;  1ZLK A;  2I10 A;  2BW3 B;  2P7C B;  4KNY A;  2XB5 A;  4ZC3 A;  2NVQ J;  3RDI A;  2O8K A;  5IYB J;  3PUF A;  4IRG A;  3W2V A;  4D5F A;  3V42 A;  5AIQ A;  5IY5 H;  5BOX A;  1JKR C;  4CCJ A;  2XC7 A;  1UJ8 A;  3E0J B;  4BXU A;  1KYZ A;  1Z91 A;  1IN4 A;  2O3F A;  3HG9 A;  4MTE A;  1JTY A;  5EGO A;  3HOW J;  4MEX F;  4PGG A;  2BBY A;  2EA2 A;  3HHH A;  3O8G A;  5D6E A;  3IC7 A;  3M8J A;  2HXO A;  5FKK A;  4C2U A;  1TTY A;  2KMU A;  4BQQ A;  2J5P A;  1FP2 A;  2KP6 A;  5KAI C;  2KDO A;  5ILS A;  3WG9 A;  1K78 A;  1I1S A;  4XN0 A;  4RM2 A;  1IW7 F;  2HI3 A;  4BEH A;  5GAE J;  2DCE A;  1WGX A;  3CUQ B;  2JPB A;  3BR3 A;  4RLQ A;  1AOY A;  4CCN A;  4FIS A;  2L9R A;  4R8H A;  3GFL A;  4XIC A;  1GHC A;  1KA8 A;  1ORK A;  1QHG A;  3QYB A;  3RYP A;  2RDP A;  1VQO I;  3PQJ A;  2A5W A;  2F5F A;  5LGN A;  2IS6 A;  2CFO A;  3JRB A;  4PGH A;  1ETO A;  4A12 A;  1R49 A;  2HU9 A;  2QCO A;  3ROU A;  4HOB A;  2FX0 A;  2Y31 A;  3TW6 A;  3GZ5 A;  1R5I D;  1UHM A;  1W7P B;  1S7O A;  2DMP A;  4LLG F;  4YG2 F;  2DN0 A;  5HLH A;  2GA1 A;  1QVT A;  4CUG A;  5J4V A;  4RB3 C;  5H20 A;  5CVU A;  4LIV A;  2ZSH B;  4G9Y A;  3F21 A;  1R00 A;  3S3N A;  5EYR A;  1HW2 A;  2OQG A;  3VWB A;  2QA4 I;  2E2I J;  1WI9 A;  3CP8 A;  2DJN A;  5FFZ A;  4XLP F;  1Z21 A;  3J7Z I;  1X3U A;  1J5Y A;  1VQP I;  3I55 I;  1RIO H;  4EM0 B;  5LEK A;  4G7O F;  4RB1 A;  2GIV A;  3OOP A;  3E97 A;  4CZC A;  1RRJ A;  1QPI A;  1ZG3 A;  2GIZ A;  4IHV A;  2R92 J;  3AKZ A;  1X1P A;  1CGP A;  4IRI A;  3G6E I;  5GPC A;  2CUZ A;  2EIM H;  3J80 K;  5HOD A;  2BW3 A;  5B66 C;  4GO1 A;  5B1A H;  1C0W A;  4IQ4 A;  3S15 J;  1FIP A;  4WXD A;  3JTG A;  1MMD A;  3QYF A;  5EZG A;  1F4K A;  2R7R A;  5HDG A;  2L7M P;  4IHW A;  4U0Y A;  4KYW A;  5B3S H;  3CJR B;  2M8E A;  2W82 A;  2VOP A;  1Z6T A;  2LP0 A;  3DPT A;  2ID3 A;  1Z0X A;  1OCO H;  1ITY A;  1FMW A;  4I09 A;  3EUH A;  5HLI A;  4BBS J;  1JHH A;  5IT3 A;  2WAE A;  2LY2 A;  1UFM A;  1D0Z A;  4BJT A;  1ZG1 A;  1OYW A;  2KZV A;  4C30 A;  1XPX A;  4I01 A;  2OTL I;  3BCA A;  1LEB A;  1XSV A;  4ZTF A;  4V2G A;  1ZYR F;  3CF2 A;  1OIS A;  1ZAR A;  5DCF A;  1Z6R A;  4HV5 A;  4LLL A;  2OA4 A;  4M3G A;  2IVM A;  3CUQ A;  3IH4 A;  1XMK A;  3G2B A;  4PFP A;  1QU3 A;  5KK1 A;  1IDZ A;  2ZXJ A;  2P5L C;  4E7L A;  3CMA I;  3CF5 F;  2PMZ N;  2HQR A;  4WX9 A;  1T2K A;  2BVM A;  2L4A A;  4UVC A;  1FYL A;  5DTD A;  2XGX A;  1WHU A;  1OLT A;  2M87 A;  2CW8 A;  2HYJ A;  2CQ7 A;  2WY7 Q;  2R7Z J;  3HTU A;  3GCM A;  3BJ6 A;  3V7C A;  3L2U A;  2JSC A;  1OQY A;  2F48 A;  3GZ6 A;  2LSO A;  4ENK A;  4JP0 A;  4ESJ A;  5IT9 K;  4OOI A;  2L9S A;  2LK2 A;  1W7P A;  3D5L A;  3EUA A;  4BE2 A;  4KDP A;  4JX5 A;  1LKX A;  2FOK A;  3BCB A;  3HEF A;  3U1K A;  2STW A;  5ED4 A;  2LVS A;  2WAQ N;  2Z3Y A;  2ZO4 A;  4B44 A;  3IRR A;  1A6I A;  2OD5 A;  2VXZ A;  4XRS G;  4HA8 A;  4IEJ A;  1AWC A;  2XAJ A;  1TQM A;  2EV0 A;  3ZQ7 A;  2H6C A;  4DYR A;  2K3P A;  3H3V K;  3HYI A;  3CCS I;  3GME A;  3CCJ I;  4Q48 A;  1FYM A;  3ECO A;  2IAI A;  1W36 C;  1I39 A;  3RJP A;  5E8I A;  3PNY A;  3ZMU A;  5D5V B;  4P96 A;  1MSE C;  4PSX A;  4FHT A;  1W7P D;  4CXF A;  2LF7 A;  2QBY B;  1YX3 A;  2HPM A;  4RDU A;  2KPM A;  3ZXS A;  2MSY A;  1XC5 A;  3F8M A;  3GX4 X;  4AM3 A;  3A0B C;  2YUS A;  2I5U A;  3P5J A;  5LD2 C;  3IL2 A;  3OS2 A;  2D2W A;  3I9V 2;  2EIJ H;  3LSM A;  1IDY A;  2XV4 S;  4TV7 A;  4XOR A;  3DBH B;  3AG3 H;  3EPZ A;  3HRU A;  3L7W A;  2Z5U A;  3H9G A;  4IX7 A;  3LQQ A;  4CCK A;  1UHS A;  5FLX Z;  4FE7 A;  2XF7 A;  4DYC A;  1UHW A;  4PJL A;  1SFU A;  2JVG A;  1G3Y A;  2NXN B;  2XRN A;  4U0W A;  2Y9Y A;  5M3M J;  1A36 A;  3K4C A;  4BHC A;  3MZH A;  1IN8 A;  2VBZ A;  3BZK A;  4EGY A;  1X1C A;  4EJT A;  1RUO A;  1D8K A;  2XPU A;  2Y75 A;  2L9N A;  2MYS A;  4YII A;  5J4Y A;  3J81 Z;  2LYC A;  1TLH B;  3DU6 A;  5BS6 A;  4L5J A;  1MMS A;  3BZC A;  1NK3 P;  3L09 A;  2LOO A;  4M6X A;  3WE2 A;  3OR1 C;  2CSO A;  1MBK A;  2X9D A;  2XAG A;  2O9L A;  3ISP A;  1TWH J;  1XS9 A;  2ESH A;  2F5V A;  1KU9 A;  3ML6 A;  1OYI A;  1H89 C;  1YW9 A;  1GXQ A;  5FFX A;  2HNH A;  1R1V A;  1S8N A;  3ZQH A;  3CCY A;  2QSH X;  1A31 A;  2EFQ A;  2FF4 A;  2XKO A;  3OYN A;  2OF7 A;  1W0U A;  1ZLJ A;  4JX6 A;  1RNL A;  3TBI A;  3MMY B;  3F23 A;  4A3K J;  4HNU A;  3WGH A;  4D5C A;  3FM5 A;  2FSW A;  1BJA A;  1ZQ3 P;  1L0O C;  3K4N A;  4C2T A;  1D1C A;  2EIK H;  1Y0N A;  4KIF A;  2V6C A;  3SEZ A;  5FRO A;  1BOB A;  4GCV A;  1VF9 A;  1JXS A;  4A3D J;  3FXR A;  1I50 J;  4I76 A;  1FP1 D;  3CZ6 A;  2DPD A;  3IRQ A;  1I3A A;  4GYG A;  3SFZ A;  3CCR I;  2K40 A;  1YLF A;  2QLZ A;  2DFI A;  2ZME B;  5B5E C;  2ZFU A;  2R7T A;  2KIF A;  1Y56 A;  1S3J A;  2ZJR F;  1HKT A;  3M3Y J;  3FXM A;  2QBY A;  2CRG A;  1X2M A;  3G1L A;  5AON A;  2IGK A;  3I71 A;  1H9T A;  5F27 A;  2DFH A;  2GQQ A;  3G4S I;  4GFB A;  5JI6 A;  3DTE A;  4BXF A;  3AL0 B;  2RN7 A;  4XN3 A;  1TQI A;  4HDV A;  2E35 A;  1LDK B;  4MHG A;  3OYF A;  2RKH A;  2ELH A;  2HQN A;  3OSG A;  1VQ8 I;  3KYD B;  5M5W J;  3J7A Y;  1LE8 B;  3EDP A;  3EYI A;  5EEA A;  3VOD A;  3OYH A;  1JGS A;  4XSZ F;  3RCO A;  1YG2 A;  5FB2 A;  4M72 A;  1ERD A;  1K83 J;  2AXL A;  3H9Q A;  1FMV A;  2H8W A;  3QRF F;  2DA3 A;  2DT7 B;  3NRV A;  5L3F A;  3O2P E;  2A5Y B;  4IPA A;  1X4O A;  2KKO A;  4EJV A;  3T1B A;  4OIP F;  1WQ2 A;  4R1H A;  4B47 A;  2DQR A;  4HQM A;  3V8L A;  4A6E A;  5HLG A;  1W36 D;  4PZJ A;  3OMY A;  2RAE A;  2HS5 A;  1F43 A;  4B48 A;  2BY2 A;  1YIO A;  1HKQ A;  1O3S A;  4PJ0 C;  4RBO A;  4Q4Z F;  1W5C C;  4BQA A;  2NOG A;  3AFH A;  2FNA A;  2KHM A;  3ZQC A;  3LFK A;  1TWG J;  3HOX J;  1GUU A;  2QEN A;  1U6G A;  5LRS A;  3PSI A;  2PI0 A;  3TKY A;  1QO0 D;  4KIS A;  1MGT A;  1SAN A;  1HA8 A;  3MKZ A;  1F5T A;  3B6A A;  1TWF J;  3C2B A;  4RMN A;  5HS7 A;  1V54 H;  1K79 A;  1HC8 A;  1I5Z A;  1RET A;  2RC4 A;  2JA2 A;  4EJU A;  4PJM A;  4U87 A;  3VSL A;  3CUO A;  3P9K A;  1H0M A;  3MAJ A;  2R7X A;  1WRJ A;  1ZGW A;  1A35 A;  2KJC A;  3ZR8 X;  2TDX A;  2VBY A;  3DKX A;  4NB5 A;  2EZI A;  3K0L A;  1R7J A;  2VKE A;  1T0F C;  4HYE A;  4AUX A;  2ZME A;  4CYC B;  3FDY A;  2QKL B;  2X6W A;  4NUB A;  3TDZ C;  4ZJZ A;  1E3H A;  5L3E A;  1H88 C;  4I2O A;  4AIK A;  4KT6 A;  1RR7 A;  2DMQ A;  1Z9C A;  3H5R A;  3A1Y A;  1Y8Q B;  2BGC A;  4HDU A;  4BUP A;  3W6V A;  1XDU A;  1QPM A;  2NYX A;  1IRZ A;  3QP6 A;  2Q2E B;  2QKM B;  4XOP A;  1M1E B;  2OJE D;  1POG A;  5HS8 A;  4BE0 A;  3W3C A;  2Y9Z A;  1H8A C;  4BY7 J;  3PUB A;  1TNT A;  4BH9 A;  2JRT A;  2MG4 A;  2ZJP F;  1BI1 A;  4IOA F;  4MIM A;  2XGC A;  4F91 B;  3TOA A;  3CC4 I;  1IJW C;  3F8F A;  1BIB A;  1R5G A;  2EFO A;  2E1N A;  2ECB A;  1FEX A;  1LE8 A;  4RGU A;  1MBE A;  4DGW B;  3PIO F;  2P0W A;  2XGE A;  2O7O A;  2L7Z A;  3SDG A;  1RUN A;  3IAM 2;  2QSG X;  2R4G A;  2K86 A;  3WTW C;  2QEX I;  2FQ3 A;  1IXC A;  2DW4 A;  4X1E A;  1SMT A;  3MKY B;  4BY1 J;  1USS A;  2W84 A;  1BJZ A;  2YU3 A;  4DQ2 A;  5HNH A;  4N9H A;  2ZXH A;  2LFB A;  3VYR B;  1H9G A;  3PFY A;  1SD5 A;  4HPQ A;  2JUC A;  2DDA A;  2IGM A;  2L0K A;  3MWM A;  1YQA A;  3FXJ A;  2JT1 A;  1XDS A;  1ZR2 A;  1IF1 A;  1YS7 A;  4ZH4 F;  2A3S A;  4FX4 A;  2CQN A;  3FXQ A;  3OL4 A;  5IOZ A;  2F4O B;  3JRF A;  2HTJ A;  3G1O A;  2NS0 A;  2BVL A;  2ZNZ A;  3F8C A;  3WU0 A;  5JR3 A;  1YX5 A;  4XKB A;  2NOJ B;  1S7A A;  4FTH A;  2AQF A;  2M4G A;  3FIS A;  3OYJ A;  2XDV A;  2C6Y A;  5L3B A;  5K5Q A;  3V8J A;  2QSF X;  3UR3 C;  3BPX A;  5ILV A;  2LKX A;  3S17 J;  2JTV A;  4PCQ A;  2X6X A;  1MZB A;  3OS0 A;  2JA7 J;  3MVP A;  2O0Y A;  4Y4R A;  4IJA A;  4Q5S F;  3HJE A;  2HVQ A;  2LKS A;  1K7A A;  1V5G A;  1HW1 A;  2A05 A;  2GWR A;  4CYC A;  3EYY A;  4G6Q A;  1S5L C;  5A2Q K;  3OV8 A;  3AAF A;  4RAZ A;  4UUV A;  3GEZ A;  2Q2E A;  4ITV A;  2LLK A;  3HOU J;  3WHB A;  3KP7 A;  4DW6 A;  3I58 A;  1OFC X;  1SEU A;  2CUF A;  4LK1 F;  2XF6 A;  2QZ8 A;  5C4J J;  1BI2 A;  2YPR A;  5FO5 A;  1ZGA A;  4LIT A;  4CA0 A;  3DKW A;  2NVX J;  1V5F A;  3X2Q H;  4ASN A;  5JHU A;  2L7F P;  1GV5 A;  1T0F A;  2ICW G;  3G1M A;  3KEY A;  1X19 A;  2OCC H;  3LOC A;  1WJF A;  1ZAO A;  2FNP A;  3PFI A;  3QOE A;  4G6D A;  5ERI A;  2ISZ A;  3M1C A;  2WV0 A;  3MFK A;  4FE4 A;  2VJ4 A;  4AD9 A;  1V4R A;  1KQ0 A;  1DPR A;  4QLC U;  4ON0 A;  4B4C A;  5HDN A;  4B8X A;  2GLO A;  2PN6 A;  1TL8 A;  3TOB A;  1QZE A;  1G3T A;  3CTA A;  2UXN A;  1JKO C;  2E60 A;  4JYK A;  1IV6 A;  4ENJ A;  4CZZ A;  5TIS C;  2V1X A;  2E34 A;  2IGO A;  1GVD A;  2L01 A;  5M5X J;  1T38 A;  3KEO A;  2R7W A;  2D45 A;  4J00 A;  1JUP A;  2X6Y A;  2VQG A;  1JE8 A;  3LMM A;  2XSJ C;  2XGD A;  2BHZ A;  2V1U A;  1X1D A;  1FOY A;  4LB6 B;  3ZMD A;  1HF0 A;  4WWC A;  4XKW A;  4N4O B;  4XNF A;  4GRI A;  1N78 A;  1O57 A;  5HOO A;  4KIG A;  2DK5 A;  3TO9 A;  3LSI A;  2JSP A;  1R71 A;  3K70 D;  2KJB A;  3DPL C;  1BI0 A;  4I99 C;  3IUO A;  3HRT A;  4WK8 F;  2I8D A;  4RAF A;  3JSO A;  2R7O A;  5GPA A;  1SFE A;  3F3X A;  3PQK A;  3WTZ A;  3O6B B;  5H2F C;  2G0E A;  3VEP A;  5HNF A;  3P9I A;  2VE8 A;  5GTI C;  4AYB N;  2F4I A;  2FD5 A;  2OU2 A;  5FD6 A;  2HOE A;  5CKT A;  3JAM K;  1ZGJ A;  1EH8 A;  3KP2 A;  5J8F A;  3IH2 A;  4OIN F;  4X0G A;  3M07 A;  1Q1V A;  1WWX A;  3Q3S A;  5FRN A;  3J80 Z;  1VZ0 A;  1MKM A;  2Z1D A;  1XCB A;  1Z67 A;  3HC7 A;  4AWX B;  1BIA A;  4BS9 A;  3FIW A;  4M6V A;  2LY1 A;  3GLL A;  1U3E M;  3WTT C;  2R0Q C;  2DQL A;  2YX7 A;  4YFX F;  3DLA A;  2GM4 A;  3WTX C;  5C3E J;  3E6D A;  3GUD A;  4II2 A;  3IKT A;  2ELJ A;  4RGX A;  3WGI A;  2P6T A;  3RKQ A;  1D5Y A;  3S2D J;  4BJ5 C;  3JRH A;  1W1W E;  3L2V A;  1G2H A;  2MLK A;  1BN5 A;  1ZRE A;  1XMX A;  2VKV A;  2EIL H;  1KZH A;  1DDN A;  5FGM A;  4YRV A;  3OYM A;  4IHT A;  3BG5 A;  1Y39 A;  4HV6 A;  3JRG A;  3I54 A;  4HAM A;  1HBX G;  4UVB A;  2FEZ A;  4IHX A;  1R9T J;  2DA6 A;  3L2Q A;  1X4P A;  2G9W A;  3HB9 A;  4A3B J;  5DDG A;  1ENH A;  2CW7 A;  1O4X A;  2DJI A;  3QPL A;  3OYE A;  2L3D A;  2VN2 A;  3E7L A;  4A3M J;  3EQL F;  2JA5 J;  3MCZ A;  2PFB A;  2EFW A;  1P4W A;  2HQA A;  4XRF A;  3HPH A;  1YIJ I;  2V7F A;  3TO7 A;  2KLO A;  4I7H A;  2O8X A;  4Y52 J;  4XOT A;  1UST A;  2N8G A;  2QM3 A;  2V9V A;  2WTE A;  3BTJ A;  4XLN F;  1YO5 C;  4W97 A;  2R7Q A;  4E7K A;  3DEE A;  4JX4 A;  5IT9 Z;  2EZH A;  1ACI A;  3K1N A;  1S29 A;  1V3F A;  4EMS A;  4L9N A;  1VND A;  5F6F A;  4AU7 A;  3RPU A;  2OAZ A;  5FKL A;  2BV6 A;  4C9Y A;  4RGR A;  1R4N B;  5CVV A;  4IQJ A;  4KMU X;  3OYA A;  1BW6 A;  3R0A A;  4E7I A;  2VOO A;  5L3C A;  1UEL B;  4XR6 A;  1FJL A;  2PBI A;  1UCR A;  2R7F A;  3H35 A;  3LAJ A;  1R58 A;  2FE3 A;  3LL7 A;  4LOC A;  1JI8 A;  1MJB A;  1QNT A;  4KN4 X;  3OWT A;  2A6E F;  2AS5 F;  3KZI C;  4ZYA A;  4B3A A;  2ID6 A;  3GVA A;  3L00 A;  5J40 A;  2WB1 A;  4Z2Y A;  4BJ6 C;  1XTA A;  4D9J A;  1FNN A;  2OZ6 A;  5M3F J;  3BTL A;  5LHG A;  4B1R A;  1G4D A;  5J1R A;  3FK6 A;  3IH3 A;  2HKO A;  5DD4 A;  3RPU D;  4LMY A;  1F9N A;  3C18 A;  2L02 A;  4HEA 2;  4RA2 A;  1GVJ A;  1Q1H A;  2STT A;  2F4M B;  3S8P A;  2DT5 A;  4DZP A;  2KRC A;  4I0B A;  1S9H A;  3NAR A;  1QZY A;  4HSR A;  1ON1 A;  2BOL A;  2M34 A;  5FJ8 J;  1DU6 A;  2UWM A;  1B8I B;  3H5A A;  2AHQ A;  4LB5 A;  5JHF A;  4EQQ A;  4XKV A;  2BYV E;  2HXI A;  3N4M A;  4ESB A;  2MFZ A;  4EEF G;  2HDW A;  2FBH A;  1OR7 A;  3MKW B;  5KCM A;  1O3T A;  2ME6 A;  3K4M A;  1FWZ A;  2H94 A;  2IA1 A;  2DA2 A;  1HQC A;  2Z99 A;  2V79 A;  1LDD A;  4DJA A;  4AIJ A;  3WGG A;  3K2A A;  1FSH A;  5EDN A;  1K4S A;  2VUM J;  2HGC A;  4HBL A;  4W1U A;  3SQN A;  3WU2 C;  2NAZ A;  5ICC A;  3Q9V A;  1APL C;  3ZQF A;  1JTX A;  1ZEL A;  2OC6 A;  2Q1Z B;  4XKC A;  3VSK A;  2JQ7 A;  1STZ A;  2WWY A;  1A6Q A;  1RES A;  3C1D A;  3BZ6 A;  3WTS C;  2NNN A;  1MJA A;  1IN7 A;  4QSH A;  5TRD A;  3RPQ A;  2FBI A;  5J8C A;  1IUF A;  3DV8 A;  1MBF A;  3GF2 A;  2CV0 A;  3HOY J;  3KFW X;  1QBJ A;  2QWW A;  5DUK A;  5IOY A;  5IP7 J;  2ZNY A;  2M0C A;  2O5R A;  1ETK A;  1G59 A;  4WCG A;  1SAX A;  4E7S A;  1BA5 A;  2HQ5 A;  2FA5 A;  4C3H J;  5LHH A;  3CCM I;  1JGG A;  3FXK A;  3DTI A;  1E2X A;  1W0T A;  3IP4 B;  2JN6 A;  4P9U A;  5K7H A;  2ADU A;  1FPQ A;  2VPL A;  4E4H A;  2Y0S A;  1JUM A;  3FMQ A;  2VQC A;  3JRA A;  1MJ9 A;  4AC0 A;  1RC9 A;  4KIB A;  3OYD A;  2W57 A;  4NC8 A;  1TQP A;  2DBB A;  3CLO A;  1TT5 B;  1RPW A;  3QQA A;  1YTY A;  3RTR A;  1SD4 A;  1FX7 A;  3HL2 A;  2VL8 A;  2GXB A;  4ZYD A;  2IRF G;  2RNJ A;  1Z3X A;  1ZK8 A;  3KE2 A;  2Y2Z A;  2XAS A;  2VC0 A;  3V4G A;  2Z9O A;  1IC8 A;  2M1B A;  1R36 A;  1RZ4 A;  2YX4 A;  1XN7 A;  4F55 A;  3LA2 A;  1FY7 A;  3KZZ A;  3BP8 A;  3LA7 A;  2HVR A;  2VON A;  2R5Y B;  2NVU B;  4EVI A;  3RI4 A;  4IO9 F;  3SJM A;  3KP4 A;  3F22 A;  3MD2 A;  5LGT A;  1B8I A;  1KU3 A;  2YS9 A;  3K69 A;  1J09 A;  4M9S A;  4A69 C;  2CU7 A;  2V6E A;  4M9Z A;  1P7I A;  2DYR H;  2EWN A;  4L5E A;  1ZRC A;  1ZRF A;  3OOU A;  5D6F A;  4HW0 A; 
#chains in the Genus database with same CATH homology
 2EIJ H;  3ABM H;  3X2Q H;  5IY5 H;  3ABL H;  1OCC H;  5B1B H;  2EIM H;  3AG3 H;  3WG7 H;  1OCR H;  2Y69 H;  5B1A H;  3ABK H;  2EIK H;  2OCC H;  3AG4 H;  3ASO H;  5B3S H;  1V55 H;  2DYS H;  3AG1 H;  2ZXW H;  1OCO H;  3ASN H;  3AG2 H;  2DYR H;  2EIN H;  2EIL H;  1OCZ H;  1V54 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...