2LREA

The solution structure of the dimeric acanthaporin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
b'AMGKCSVLKKVACAAAIAGAVAACGGIDLPCVLAALKAAEGCASCFCEDHCHGVCKDLHLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acanthaporin
publication title Structure and function of a unique pore-forming protein from a pathogenic acanthamoeba.
pubmed doi rcsb
source organism Acanthamoeba culbertsoni
molecule tags Antimicrobial protein
total genus 10
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1840 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lreA00
2LREA 2LRDA
chains in the Genus database with same CATH superfamily
4UUSB 3QOEA 3CDIA 5DCFA 5IP9J 2K4BA 2XVCA 5FFZA 4I99C 2HPMA 1JXSA 4EJOA 2M4GA 2K7LA 4V19K 2MFZA 2NXNB 1U8RA 4GCVA 3E6DA 1UHWA 1NK3P 3O8HA 2PFBA 2R7FA 5LHHA 1T2KA 1KYZA 3EYYA 3WU0A 2PG4A 3FK7A 3GUDA 2ZKZA 4BEHB 3I4NJ 1HW1A 2NVQJ 2XV4S 1Y8QB 1JHHA 2M2EA 3ZGKA 4L9JA 3VEPA 2UV1A 1ZHFA 2IS4A 4NQWB 1IRGA 2WA0A 3BJAA 2TDXA 4D5CA 3CQZJ 1T0FA 5CLSA 1TL8A 5IT9Z 4BXUA 4HSRA 5J8FA 3OYFA 4KDPA 2R3SA 1WCMJ 4I0AA 2K86A 1EH6A 2L7FP 3BG9A 2EA2A 3FHNA 3FXKA 3I59B 3RQ4A 4PSXA 4C3JJ 4EQQA 1IV6A 2XROA 3SFZA 1J09A 1YJ9I 1J59A 3QU6A 4QTRA 3K70C 5LRSA 2R7SA 1U78A 2DFEA 1BI3A 3CC4I 3MQ0A 4HA8A 3ZQHA 4ESBA 3GLLA 1J2XA 2DJNA 4Y17A 3DTIA 4X1EA 2MLKA 4PJMA 1WWXA 3TO7A 1BC8C 3FDYA 4HBLA 1OJLA 5CPRB 5CVIA 4AYBA 1D5YA 3R0JA 5DS9A 3FBNB 3WTYC 2PI0A 3EUKL 4ESFA 3WU1B 1IC8A 3KP3A 5D5VB 3H92A 4AM3A 2GXAA 3V8JA 4JP0A 2B0LA 4XLEA 4CZZA 2MGQA 4FCYA 2X9DA 1FYLA 1FMVA 3M8JA 5H6QA 1IJWC 4AIDA 4LITA 1J7KA 5ICGA 5HOOA 4YIIA 1LEAA 5ICCA 1P4XA 4JK1X 3OL4A 4DOZA 1FBQA 2K9SA 4OIPF 4BACA 3GCMA 3KZYA 2RN7A 3JRCA 3ZMDA 2EJRA 3BG3A 4KNYA 3MZHA 1MBFA 1QVTA 3VB2A 4ZYGA 4RLFA 4CGZA 1W36D 4KN7X 1MSEC 1ITYA 1U6GA 1U3EM 5GAGJ 1LVKA 2DXIA 1D1BA 3JRFA 4JBAA 2G0EA 3QYEA 3M4OJ 4V2FA 1YS6A 2R0QC 3SZTA 1O3QA 1I3AA 1XN7A 3GFJA 2ECCA 3ZQ7A 2O8KA 1TWCJ 3KIOA 1KU2A 1N78A 4Q48A 2BXZA 2LY2A 2ADUA 3ZN0A 2DFHA 3ZMSA 4A0YA 4PJJA 2IS2A 1V54H 3K10A 1Z9CA 5FB2A 2QZ8A 1A6IA 2D1HA 3H36A 2MC4A 1X3UA 3FZVA 2EFOA 4A3GJ 4IRHA 4DQ2A 2VE8A 2AXTC 2BY0A 2CUFA 3LSJA 2Y75A 4B44A 1FOXA 5LHIA 1LEBA 2DOAA 1R00A 3V7RA 3S3OA 1EJ9A 1JKOC 4HG2A 2LRDA 4LLGF 4HYEA 3S16J 5D5WB 2DT7B 4L9TA 1TC3C 2DOFA 1WH7A 4DZJA 1IN8A 3PNYA 2HQRA 1MBHA 1B9NA 3FXRA 3R0AA 4LOCA 4H4KC 2VXZA 1JUSA 2I5UA 2KRCA 2ZXIA 2ISZA 9ANTA 1X19A 2XC7A 2DT5A 3MWMA 2V1UA 2LTPA 5FKLA 1R4NB 5J1YA 4BXXJ 2FMYA 4IKFA 5E20A 4XLNF 1F36A 3BZ6A 3RYRA 4KIFA 1R7JA 2K3FA 4LD5A 4XLCA 4XLPF 5DUIA 3BT9A 3D5LA 1DGWY 1B72B 1LNWA 1ODDA 4EV0A 4M6YA 2QYOA 4BU2A 2YX7A 4CCMA 2R92J 3SZPA 3ISPA 4HX8A 2LP0A 3ML6A 2MBFA 1VQLI 1A36A 5EEAA 5DYMA 2R7ZJ 2FU4A 2DA7A 3RDIA 4M3BA 2OQGA 2BHZA 3M1CA 3CUQC 1BIAA 1B8IB 1DDNA 3QYFA 5CKTA 1JGGA 4HNUA 4LK0F 5DV5A 1N75A 3DQVC 4A3CJ 1G3SA 2CW7A 3ZPLA 1JKQC 1SEUA 4X6AJ 4MEXF 3G1MA 1U5TB 1YW9A 3H9JA 2K4JA 3JREA 3BZKA 3WTSC 1VQOI 1SC7A 3JSOA 1G59A 3L2UA 2JT1A 2R93J 4IO9F 3J7ZI 3NWTA 2M4KA 3DKYA 2H1LA 2FQ4A 3CCQI 3S17J 3DP7A 3KEOA 5CQGA 3U21A 3ZXSA 1PUFA 1S8NA 2VJ4A 4DNCA 3K70D 3RIRA 3VDXA 1CQTA 3PO2J 2Q0OA 1YRNA 5J6XA 1FX7A 2XKPA 2IA0A 3BR1A 2P5LC 4BAYA 5K5OA 1GVJA 3BTCA 4GRIA 4RS8A 1TWFJ 1MBJA 1TBXA 5JHFA 2YSRA 2DA2A 4BDYA 1VQ8I 3HOUJ 1PVEA 2ZO4A 2KZVA 4CYDA 1YHQI 2EV0A 4BJ5C 2W84A 4LG0B 4WXDA 4DYQA 5HLTA 2P7CB 2QCOA 1IUFA 2PJRA 3BJOA 1X3ZB 2JRMA 2CO5A 2E7WA 2BVLA 1QPIA 5HDNA 4B4CA 1FP1D 4EJWA 3F23A 1MSFC 1RESA 2W85A 3FKJA 1H9TA 3GTOJ 3HYIA 3CJNA 2RQQA 4B1RA 2DQLA 2DYSH 1BC7C 2IBDA 2IGMA 5IY5H 3COAC 1XGOA 4NB5A 3BOQA 2XSJC 3ZQGA 1LJ9A 1PJRA 2QQ9A 1FOWA 1Z21A 1W7PB 4IRIA 3CMEI 2EQRA 4NNJA 3KZZA 5IYCJ 2JPCA 1O3TA 2FBHA 4RMNA 2R7WA 4NBQA 1H9GA 4MQ9F 1Z05A 1X1DA 2LDUA 1JE8A 3JW4A 1PP8F 3IWFA 4II2A 2E7XA 3WHBA 3M8FA 4I0BA 5JR3A 1WJCA 3WGGA 2Y0SN 1R49A 1R23A 4MFDA 5J3LA 3JRHA 5EJCA 4XRMA 4RB0A 2IRFG 2XPWA 3F72A 2L2OA 4I2OA 4ZYDA 3L2VA 3IH3A 4IZZA 2EFQA 3S1NJ 2F2EA 3A1YA 2C6YA 1R22A 2OD5A 2HEOA 4P5OA 4ABZA 1VZ0A 3PO3J 3JRBA 3O8GA 1P7IA 2HDCA 2MW8A 3SEZA 1ETYA 2PMZA 1XS9A 4A5NA 3I53A 2BE5F 4HLXA 3GMEA 3OV8A 4NC7A 3DFGA 3T1BA 1XTAA 3UR3C 2CUJA 2IA2A 1S29A 4AU7A 2MD5A 3LAPA 4BGDA 3B02A 3SXYA 1HOMA 1VQKI 1A6QA 2HXOA 5L3GA 1QZYA 4EJVA 3ECHA 5HS9A 5FLXK 3ZQCA 4IHWA 1RPWA 2BY2A 4ESJA 1BL0A 4M9XA 3JAMZ 2M3AA 1B4AA 2Z1DA 1K4TA 1IUYA 2FRHA 1KU9A 1W5TA 2GZWA 3CUQA 2HOEA 2R5YB 1V4RA 1A5JA 2ZCWA 1MKMA 2NVUB 3QPTA 4K2EA 3ABKH 1K78A 3H3ZA 5LLQA 2ICWG 3E5XA 4MNUA 4YG2F 3MFKA 5DD4A 2YS9A 3K1NA 4HZFA 2XDVA 4I02A 3M3YJ 3ZQQA 4ZZDA 1V5GA 5AIQA 2JA5J 4IHTA 3HHGA 1LB2A 2JJ7A 2JVGA 1TLHB 3DCFA 2HZTA 4BQNA 5E1XA 1Y1VJ 2PQ8A 3N4MA 1ON2A 2AQEA 2PEXA 3PJRA 4IQJA 1JKRC 1UG2A 1I39A 1O7LA 4RB2C 4CCKA 4OIRF 3DTKA 3DV8A 4UB8C 1Z7LA 1HXDA 2R5ZB 5F1RA 1BW5A 1UELB 2VKHA 2QWWA 2RC4A 3OOPA 2I8DA 3HPHA 4BBRJ 1W7PD 2E2HJ 3HOZJ 3RPUD 3I56I 2BGCA 3GBGA 1MNEA 2GIZA 2LOOA 3L1PA 5HS8A 2Y0MA 1ZG5A 2HR3A 2XAUA 1A31A 3M07A 3S93A 1OCPA 3H5AA 1ZRFA 2XAQA 1XGMA 3OS0A 4X0GA 3RKQA 4PJLA 2ZBKA 4KN4X 4CH7A 5JFRA 5JLXA 2V9KA 1OLTA 1I5ZA 2BY3A 2QGUA 3DEWA 2CS3A 3S3NA 1KQ9A 2CWEA 3JRGA 2XF6A 5ICFA 2K85A 3CDLA 2EBIA 5FD6A 4HOBA 2DYRH 4MEYF 1YW7A 2IA1A 1ZLKA 2JA7J 1R58A 3CDHA 3R6SA 3BTIA 1IGNA 4B43A 4C2MJ 3E5QA 3OYGA 2JA2A 4XONA 3WHCA 2ACJA 2XB5A 3HB9A 4G6DA 3JRDA 1YTYA 4PCQA 2LYCA 3I4MJ 5M5WJ 2EILH 4KIBA 2XHKA 3KCCA 3H9GA 3S2DJ 5KK1A 1OMIA 3W2WA 1EV7A 2KRHA 1R5ID 5A2QZ 1MMSA 3P5JA 2E36A 3F8BA 3W6KB 4HDUA 1PUEE 3ULQB 1HW2A 1Z3XA 1O3RA 1LE8B 4I01A 2DA4A 1XSXA 5IP6A 3WODF 1IN4A 2IGNA 3OYBA 1R6RA 2XAGA 4HLYA 4AD9A 4G7OF 1J0RA 4KMFA 3HOVJ 2K40A 1YFHA 2BW3B 4HAMA 2HTJA 2IP2A 3F9KA 4WK8F 4JX6A 3F8MA 3FXOA 2L9VA 5E79C 1FNNA 3K69A 2CG4A 3OSFA 2J5OA 5HNHA 1T08B 4OMYA 1P9QC 2N8GA 3S2WA 2OC6A 1UG0A 5D6FA 3QP5A 1RKWA 3DEUA 4IQ4A 4RAFA 1N25A 1F5TA 1CF7A 2YU9J 4JQFA 1AHDP 4MQVA 1FZPB 3C2GA 1FSHA 4ANJA 5FO5A 3RPQA 5IOZA 2P4WA 2V9PA 2MH2A 3R61A 1PDNC 1EA3A 2PMHA 2IEKA 1HQCA 1K83J 3HIFA 3EUHA 5B5EC 4ZTFA 1J9IA 3CMAI 5K5QA 1HBXG 1PP7U 1YQAA 2XPUA 3Q9VA 1ETQA 4L5IA 1MBEA 4U0WA 3BG7A 4G12A 3CC2I 1MH3A 2IT0A 1IDYA 3OYMA 3RI4A 1XCVA 4M9SA 2QM3A 4FE7A 2A6TA 5F08A 5DUKA 4I76A 3PSIA 1FTZA 1YX3A 2E5ZA 5M3MJ 2E1CA 1S7OA 2OU2A 2L01A 4LIUA 2HQNA 1WH5A 4EJUA 1NG6A 5IYBJ 5CJ9A 1UJ8A 1Q1VA 3M7GA 4A6DA 4B47A 2MH9A 3DLLF 1HKTA 4R79A 3GTKJ 1SFEA 5B1BH 2VPRA 4A2UA 4U7DA 2QBYB 4UUTA 2P8TA 1YITI 6PAXA 3D0SA 3K2ZA 4OOIA 4LLLA 1YLFA 4IOCF 1RZ4A 1HSTA 1TQPA 1KGSA 2JTVA 1NG7A 3HSEA 4AIKA 3KPHA 4G94A 3H0GJ 4JX4A 2G7HA 4Y15A 2V1XA 2ZJPF 1ON1A 1X1PA 5E17F 2GA1A 4S0HB 2BEOA 3C7JA 3FIWA 1RNLA 3BR6A 1O57A 2VOOA 1UHMA 3P9IA 5DCMA 2EV5A 3ERED 3H1CA 2RKHA 4C30A 2EFWA 4A3MJ 2V1NA 4M72A 3PL8A 2Q8KA 2PJPA 2DFFA 4RGSA 2IPQX 4IHYA 3FXUA 2FBIA 5LGTA 1JJ6C 4A69C 4D1QA 2F5VA 2JUGA 3KEYA 2D45A 1WJ5A 5K5RA 2K02A 2RAEA 3EPZA 1K79A 2L9NA 4XIDA 3S1QJ 2R7OA 2MYSA 3DXJF 2X85A 4PUSA 4AVZA 3LA3A 3HTSB 4BDZA 2FMLA 4EMSA 2FSWA 3GTLJ 2LLKA 4ON0A 1T6SA 2CV1A 3WE2A 2OUMA 3C2HA 2KRFA 2DA3A 2JK3A 1FOYA 2E19A 3GTJJ 4GYGA 5EYRA 3RJPA 1ZH5A 2A6EF 3NAUA 5D4SA 1Y0UA 3SDBA 2EFPA 2MC3A 2NOGA 2XB0X 2ZJQF 4IHVA 2E2JJ 1NK2P 2LY1A 2FUG2 5FKOA 4PSWA 5DM6F 2VONA 2CRGA 2LH9A 4IF4A 1S3JA 1ZYRF 1OQYA 3KYCB 3Q0UA 4IPAA 4D7NA 2L7ZA 3ECOA 1D0ZA 1S7AA 3DPUA 4OWRB 4LK1F 5M3FJ 5K7FA 3PQJA 2PLYA 5C3EJ 3JRIA 4YFXF 1WKMA 3KX2A 3MCZA 4XICA 2XF7A 1SMYF 1O4XA 2WADA 2FOWA 4UUSA 2KJBA 4XORA 3ESWB 5DM7F 4DW6A 4MHGA 2CQ7A 2NNNA 1MJAA 2Z3YA 2OAZA 4DBQA 2UXNA 2HS5A 1XGNA 1STZA 2CH0A 2EK5A 5C44J 4YIRX 1QNTA 1USTA 3KETA 3D1NI 3RZDJ 2QLZA 2KJCA 1ETOA 2LG4A 2GM4A 4L0ZB 3K4BA 1KYWA 1P6RA 3DWLE 1IO2A 1YO5C 4A3DJ 3MAJA 1GT0C 1P92A 1J75A 1RRJA 1UCRA 5LHGA 3I3LA 3OL3A 2A6HF 5EEHA 4BEHA 3G3ZA 1QQIA 1QRYA 3ROUA 1FSEA 4E7ZA 4BE0A 2DA1A 1IDZA 4A93J 3EDPA 4XSXF 2F5FA 4PGHA 4PK4A 4NQWA 2LREA 2EZLA 2K3PA 2ZSHB 1NTCA 1H8AC 4W97A 5ILSA 2WAEA 3DU6A 4L5EA 1MIJA 4A6EA 4BYYA 2ETHA 2WB1N 3OYAA 2DJIA 2M87A 3DF8A 3CMYA 1DU0A 3I59A 3AAFA 1RIOH 1HF0A 3CF2A 3TO6A 3WG9A 4BS9A 2ELJA 1VFCA 1BOBA 3U1KA 5H20A 1OCZH 3OYCA 3C3WA 3QQAA 3VYUB 4BY1J 5GTIC 1VQ6I 2V7FA 2QSFX 4JYKA 2VB6A 4L5JA 1JTXA 4RAZA 3S3MA 3OYLA 1AOYA 5HLHA 3OOUA 1JJ8C 5IPAA 3V8KA 2QSGX 4DZPA 3NWSA 1R1TA 1XG1A 3FBIB 1V55H 1TZLA 2DMQA 3G2BA 4IEJA 1HCRA 2DO7A 1ZGAA 2L5QA 4BUPA 1Z0XA 4RA2A 2HU9A 3IRRA 2M9HA 4S04A 3BP8A 2NNYA 2R7VA 2FXAA 5H6RA 3MKYB 3K1PA 5TGTA 2F5DA 1ZLJA 3DLAA 2LKPA 3W6JB 1ETVA 2OCCH 1MDMB 3ONQA 2KPMA 5LD2C 3F6VA 2DPDA 1YG2A 4A0ZA 1R36A 1U5TC 4E7IA 2VOPA 4R1HA 5GAHJ 2F4OB 2JN6A 1BOAA 3HDDA 3I64A 2YUSA 2NS8A 1Q1HA 1DQUA 4BJTA 5HDKA 2AQFA 4S05A 1OR7C 4ASNA 3TOAA 5F0FA 3ZMZA 3S2HJ 3GF2A 4XOPA 5BS6A 3FXJA 1I27A 2PBIA 2LMDA 1MJ9A 4DIQA 2ZB9A 3P9CA 3Q0WA 1WHUA 4KT5C 1C0WA 2OBPA 3OWTA 1LFUP 5K7HA 1FLIA 2EIJH 3HM5A 2R7QA 3G1LA 4BHCA 1Z6TA 3HG9A 1E2XA 2WAQA 3M8EA 3VYRB 2QA4I 1G8XA 2QQAA 2E1OA 2VE9A 3ERMA 4IVNA 1MNMC 2HXIA 2V9VA 3VSLA 2CV0A 2HQ5A 1REPC 2DN0A 4ZDOA 3HOXJ 3OY9A 3MKWB 1HA8A 4CA0A 1SVMA 2XKOA 4XL9A 3H0DA 4PGGA 2Z2SB 4ENMA 4EJTA 1ZR4A 3F22A 1G3TA 5D8LB 2KISA 2G7UA 1OYIA 3V42A 2K9MA 3F6OA 1MNDA 4XN3A 4E4HA 3HRTA 1Z3YA 4E7HA 2W1OA 2ZFUA 3B6AA 2HWVA 3IUOA 4XKWA 3G6EI 3S1MJ 1VQ5I 2BVMA 1G4DA 4M74A 1UHSA 4I09A 5KHDA 1OYWA 3B73A 2WV0A 1Y39A 4NUBA 3T8TA 2IJLA 3FHZA 1JI8A 5FKKA 2W57A 2L4MA 2XGXA 5HLGA 4C2UA 2VUMJ 2XUBA 3I0TA 1QO0D 1QPMA 1HDPA 3L00A 3KZIC 4HV5A 5LRRA 4XNFA 4LB5A 3H3UA 1RR7A 1FEXA 2ISYA 4ZYHA 4A0XA 2DU9A 2ZXJA 4O6JA 1IF1A 4KT6A 1SFKA 1IAWA 2XRLA 3IH4A 3W6VA 1OFCX 2A61A 1AKHB 2Y2ZA 3LSRA 3GYHX 2QEXI 4RBOA 4YFNF 5LFAA 5ICEA 4MO7A 1HSJA 5F64A 5E8IA 3WU2C 1MMGA 3OYIA 1FP2A 2LC2A 1B72A 1YIOA 4UVAA 3SFIA 2YPRA 1X4OA 2ZMEC 4CO8A 4WX9A 3HPGA 1OYYA 2OJED 2HNHA 5D5XB 4NC8A 1M1EB 3GWZA 3E6BA 5IP7J 3DPTA 4XLAA 5TRDA 1VNDA 4ZZLA 1T38A 3MZYA 5EG0B 1TP4A 5TISC 3CJRB 1WI3A 1IXSB 1B8IA 2F5CA 1AA7A 3D5SC 3IP4B 3GXOA 3CJTB 1YX5A 1SVOA 2X4HA 5J40A 1HW5A 5KCMA 3LFUA 2VI6A 1IRZA 1W5SA 4E7JA 2VQHA 3K9TA 2DDBA 3GEZA 1FT9A 3K6GA 1FBUA 4E7SA 4U0VA 3CCSI 2Y9ZA 3HL2A 2BXYA 5LGNA 2KIFA 1S72I 1OCTC 1X2NA 1MZBA 4XSZF 1T56A 3A02A 1U5TA 3J81K 3LA7A 5BPIA 1XC5A 3K4JA 2OZ6A 1BBYA 2JSPA 1B6AA 2Q2EB 3C18A 3OS2A 1FYMA 3PFYA 4FHTA 3HOTA 2KIMA 3LSGA 5JI6A 1BI2A 2FX0A 3MZ8A 3G73A 2XF5A 2RV8A 3ZQFA 3S8PA 4FQGA 5D5UB 4EEFG 1X1CA 3LSMA 3ZMUA 2DQRA 4F91B 1TT5B 5IT3A 4A3KJ 2M0CA 3BR0A 3WTTC 4LB6B 1R4MB 2WY7Q 1TWHJ 2QQBA 1UFMA 3AG2H 1P4AA 4BY7J 5E3NA 3WGIA 2MG4A 5CVUA 1SAUA 1RI7A 3TDUC 4KICA 3VYSB 2DCEA 1T95A 3HGGA 2FQ3A 1XMAA 4ZDPA 3GX4X 1BN5A 1RKTA 4LG0A 2K27A 2R7DA 4HF2A 3U2RA 2B63J 1E17A 3RZOJ 3Q0VA 3MN2A 5FLMJ 2XPVA 3GTGJ 5TJJA 2MLGA 2I10A 2H6CA 3GFIA 4XLFA 3AFHA 3ZMTA 2BHYA 4Y7NJ 2TRTA 5LEJA 4CHUA 2JUCA 2HKXA 4B3AA 1I1SA 3L2RA 3J80K 4GFBA 4DBRA 1IG7A 3HKZN 1S5LC 1BA5A 4V2GA 3F3XA 2HQAA 3DBLB 4U87A 5HS7A 1XMKA 1T39A 2M1BA 2LBFB 1UZCA 3BTJA 1H89C 2ZMEB 2JWTA 1R9TJ 4A3IJ 2Z33A 1W7PA 2GXGA 2BZTA 3EETA 3RPUA 1LFBA 4CYCB 3G71I 1FPQA 3ASNH 3IHUA 4EVIA 2YX4A 2CW8A 4RB1A 2G9WA 3L7WA 3TP0A 2H6BA 2ME0A 4RM3A 1P4WA 2D2WA 4I6ZA 1RR8C 1ZR2A 2VBZA 4U88A 1JTYA 4IX7A 1IRXA 1E3HA 5FLVA 5L3DA 4YEJA 1FIPA 2DFIA 1MMDA 2RDPA 1ENHA 2QSHX 3GFMA 3FX3A 1W5CC 3HZJA 2VT2A 4J01A 4D7MA 3E6MA 1F1ZA 5HODA 3GW2A 3L2QA 1UB9A 2JQ7A 1Z6RA 3AL0C 2JA8J 1J5YA 1D1CA 4IHXA 2JA6J 3CCMI 2NS7A 3CCJI 3CUOA 3VYTB 3CLOA 1Y8RB 1IV8A 5FRMA 3REOA 3HOWJ 2NOJB 1TWGJ 4GO1A 5CVVA 1BM9A 4W1UA 1YJNI 1D3YA 2OV7A 2ME6A 2CU7A 2HI3A 2QUFA 4LJZF 3ZN1A 4BJ6C 3FF5A 4WF2A 3E1SA 3TGNA 1IN6A 5HNFA 3TO9A 1FYKA 4E6KG 1LDJA 2BYVE 2ZXWH 1HKQA 2IVMA 3SHFA 3TBIA 4FX4A 2R5YA 4BQAA 3V4GA 1QVUA 4BHBA 3BZCA 3NRVA 2OTJI 2W24A 2KP6A 2GA2A 5EGOB 5J1RA 4UVBA 3EQLF 4XBFA 2HVSA 4HX4A 5FD5A 3K7AJ 3QU3A 4M6VA 5KAFC 4WWCA 3ZQLA 4M3EA 2RQPA 4BH9A 1JHFA 2KDOA 3RKYA 2FJ1A 1EH8A 1P7JA 1U0JA 2GOMA 4HQEA 4HQMA 4OU0A 2A05A 1SD7A 3HRSA 2DA6A 3OYJA 4C2TA 2VL8A 1ZTRA 4ZDLA 2STTA 1OCCH 3BG6A 2E60A 3VWBA 4KISA 3GTPJ 2CSOA 1WJFA 4NHJA 3FISA 4DYCA 2R5ZA 2R7XA 2DW4A 4O3MA 1LDKB 2HZDA 4CXFA 1EF4A 4CCLA 3FWEA 2H8RA 4XMYA 3K1MA 1SFOJ 3IRQA 3DKWA 4DGWB 5IT9K 2HOAA 1A35A 1QHHD 3B6CA 2KHMA 5E18F 3OYNA 1XMXA 3BR2A 2H27A 1R1VA 5FKMA 1LPQA 2XRNA 2EA4A 1FJLA 3MKZA 2F6CA 4ITVA 2GIVA 2A5YB 3OIQA 4M3FA 1F9NA 1Z91A 2EFNA 2LF8A 5L3FA 3J7YJ 3I5UA 1D1AA 2FA5A 2XAHA 1SAXA 4N9IA 2DOEA 3PIOF 3Q5FA 4UB6C 3KP4A 2UZKA 4XR6A 4A3LJ 3MKLA 5J4VA 3TL4X 1U9NA 1HKSA 4AYBN 3AL0B 1BJAA 3ZRGA 3O2PE 4B09A 5KAIC 1LKXA 2P5KA 3FMQA 4KJZA 3TW6A 5LEKA 3O3KA 1FWZA 2OQRA 2KZGA 3WTZA 3K4CA 2BBYA 1BR2A 3WE3A 4ZH4F 3K0LA 3HOYJ 1VQ7I 3HUGB 3OMYA 1PYVA 1I6XA 3HJEA 3PNVA 3SDGA 1JKPC 1T0FC 2KMUA 3GZ5A 2ECBA 4FX0A 2PX9A 1WQ2A 4QPOA 3N97A 1I3QJ 1ZARA 4HV6A 2XGEA 1ZG3A 2P6SA 1IRFA 3LWFA 2L9SA 2VC1A 1LE8A 1X4PA 3DBRB 3IKTA 1ZREA 1O7FA 5DEQA 1AU7A 2Y0SA 1I1GA 2DMPA 3DU5A 2VT3A 5E1ZB 5HVQC 2GBYA 1B1BA 2DLLA 2Y30A 4M71A 5J4YA 1RC9A 1Y0NA 4UHTA 1FTTA 2FNPA 3A01B 1K6OA 2QVOA 2BW3A 3QPHA 5EDNA 2E34A 1LQ1A 2GLOA 1MGTA 2O03A 2O5RA 1IXRC 2W00A 1UMQA 2Z16A 2ID3A 2M30A 3HSFA 1BI0A 4FE4A 3LSPA 4RAGA 3LQRA 2LKXA 3KP5A 2VBWA 5HLIA 4A3EJ 3FM5A 5IOYA 1O3SA 2YR2A 4XN0A 3RYPA 4UUVA 4FTHA 1BIBA 1R71A 5F1JA 3RKWA 5FLXZ 4D0PA 2E35A 1VQNI 3R4KA 2Z9OA 2R7TA 4G6TB 3E6CC 1XPXA 3QOPA 5ILUA 3F8CA 5BOXA 2KIUA 2X6XA 4L9NA 2YU3A 3AKZA 1VF9A 4LG3A 3KEQA 4BKXA 3FMRA 3IV5A 2HTSA 5C4XJ 1BI1A 2Y69H 2D5VA 3RCOA 1EKEA 4YELA 5FFXA 1ERDA 3R60A 2M7AA 2ZSIB 1MBKA 4CDGA 2CYYA 5FKNA 4C3HJ 3L2WA 3GTQJ 2KQRA 4YIFA 3RKXA 1ZKGA 2D1VA 3KP2A 2OCEA 2FE3A 3KLNA 3ZR8X 1XGSA 2E5NA 4U7BA 3D5RC 1VQMI 1OISA 1P2FA 1FMWA 2BV6A 2FOKA 1LVAA 5JLWA 2K5CA 3KFWX 4XKBA 2NS0A 2EWNA 3BR3A 3BCBA 1W0TA 3PM1A 1ZQ3P 3K2AA 5GTHC 1U9OA 2VBYA 2ZFWA 1R1UA 3JCUC 1FBSA 2VQCA 3TOBA 4Z6YA 1TWAJ 2CJJA 3QPSA 1BR4A 3BWGA 4NDLA 4BL0B 4L9VA 2QBYA 2V79A 2XASA 1YIJI 3ZP5A 2LKSA 5F04A 1WI9A 2DK5A 3OYHA 3JSPA 3ZCOA 2LK2A 1X1BA 2R7RA 3OYKA 5F0CA 1FOKA 4CCOA 4E70A 1MD0A 2HYJA 4J00A 3DEEA 3KE2A 4CCJA 5ERIA 4Y33A 1X1AA 2NVTJ 5JVTA 4Q47A 5AIPA 1TQMA 1T98A 2P5VA 2W7NA 1WRJA 2GAUA 1VI0A 3ABLH 2DI3A 3IL2A 2M8GX 4XK4A 2WWYA 3CCLI 1YYVA 3GFLA 2HYGD 3BLYA 2NAZA 2L02A 4N4NB 2L7KA 2E1NA 2EV6A 4RLQA 5J47A 2XSDC 1BW6A 2JRTA 2VASA 2E71A 3BDDA 2ELHA 3CCVI 1D0YA 5LBQA 2FNAA 2CFXA 2E2IJ 4C9YA 4UV8A 4WXHA 3BC8A 3RSNA 2UWMA 1A04A 4G8XA 3Q9SA 1TQIA 4F52A 2RNGA 4HNVA 4NC6A 2FD5A 2IGOA 4QIWN 4ZYEA 4Y52J 1ZGWA 2O8XA 3UNGC 4LGWA 3L2CA 4OINF 3OR2C 4L18B 3LSIA 1SD6A 4MTDA 2VKEA 2FF4A 1CGPA 3VPRA 4KMUX 3A4CA 2P7VB 1JUPA 5CVRA 1W4MA 2O3FA 5EZGA 3QYBA 2W82A 3MD2A 2MABA 5FROA 4IXAA 4P9FA 3CD6I 5J8CA 1DUXC 5AONA 3PFIA 3CJQB 2WV1A 3BPXA 4D9JA 3QPLA 2NYXA 4ZTJA 4G6QA 2DTZA 5GP9A 5E3MA 4A3BJ 1D8KA 2W4SA 4AIHA 2CQKA 1YJWI 1L0OC 4A12A 2HYFA 3X2QH 1LFPA 4LFUA 1KZHA 4G7HF 1YS7A 4HW0A 5FRNA 1QA6A 2X48A 3HRMA 5D6EA 2LVSA 2X6YA 2XGDA 5BQTA 3EYIA 3PUBA 4PDKA 2RREA 2IS6A 1D0XA 1HLVA 1X58A 1OKRA 2DODA 4LIVA 2BY1A 1FY7A 3KP7A 4FISA 2P0WA 4LMYA 3WG7H 5E3LA 4CICA 3OSGA 4GGGA 1XDUA 2V26A 3BQYA 2STWA 2JPBA 3WTUC 2MD0A 2EB7A 2KT0A 2WC2A 2CQNA 1ZG1A 2HOTA 4M73A 2XAJA 5FGMA 4L0YB 4ENNA 4ZC3A 4TV7A 4F93B 2A07F 4R8HA 1T33A 3DKXA 4M6XA 3TMOA 2VKDA 3U9GA 2GWRA 5HDGA 3KYDB 1YI2I 3I58A 2EZIA 5CQEA 4BE2A 4UY8I 4BHPA 4YRVA 2DTRA 3IC7A 1SANA 2ZNYA 2VODA 3FXMA 2F4IA 2Z99A 3PNTA 4D5FA 2RGVA 5B66C 1DPUA 1S7EA 1XB4A 4BBSJ 5DD8A 4Y4RA 1GV5A 2K9QA 1GXPA 2PMZN 2VQGA 1SVLA 3M9AA 3HC7A 2A68F 2X51A 5M5XJ 4YFKF 2X1DA 1VQ9I 3E5UA 3DTEA 4ZYAA 2HPIA 4F92B 2M8EA 4I98B 1MDMA 3K4MA 2HGCA 3I54A 3JAMK 3I4PA 4XRSG 4RGRA 3TKYA 3ELKA 2DPUA 3I9V2 1Z1DA 3LSTA 4B3XA 1K6YA 5H2FC 4ZJZA 4KITB 1GDTA 5B1AH 3UKGA 2Y31A 3S15J 3PQKA 1N77A 1K7AA 1I6HJ 4XRSA 1QZEA 2EH3A 3HXLA 2IW5A 4QPQA 1TW2A 3C1DA 3K4LA 2F48A 3QRFF 3NQOA 2LR8A 2VN2A 2A5WA 4F55A 5EF6A 5GPCA 4BNCA 3H5NA 1JGSA 3H3VK 1G3WA 1TNTA 2NRAC 4RB3C 1ACIA 1R5GA 1T8IA 2ZNZA 2V6CA 2Y48A 3C2BA 4AC0A 3CTAA 1ZRDA 1TNSA 5BNGA 1X2MA 4IL6C 2OF7A 3CP8A 1PUFB 3NEUA 4JOMA 1FC3A 5CYVA 3PIPF 3LNQA 2NVXJ 2DBBA 1HC8A 2H1KA 3J7AO 3LQQA 3HHHA 5L3EA 1WSUA 3VFZA 2UXXA 3BTLA 1YRNB 2L3DA 2X6OA 4RGUA 2WBMA 4I7HA 3CO7C 3GLXA 4HX7A 3L09A 3OYEA 2KDZA 2VLAA 3CESA 4EM0B 2HDDA 4F7ZA 2ZXHA 5JVGF 1IW7F 2HKOA 3TP3A 4MTEA 4HRIA 4KFCA 2KL4A 3LOCA 1BR1A 2X6WA 2PJRB 4XKCA 2DAOA 2J5PA 3JR9A 2LNBA 4Q4ZF 2DMUA 3F21A 3GTMJ 4KA4A 3KP6A 1HDDC 5L3CA 1QBJA 2VIXA 4IHSA 3LL7A 2QENA 5L3BA 4RDUA 3U1DA 1XSDA 1GUUA 2Z5UA 3GZ6A 1XSVA 3AG1H 1IN5A 5DDGA 2HOSA 1GV2A 3A03A 1ZN2A 1H0MA 1NH3A 3GO5A 3LAJA 3H35A 3MEXA 4ENJA 1QGPA 3J7AY 4KYWA 1KA8A 3S32A 1KQ8A 2LFBA 3CO6C 3BY6A 2CW0F 4OIOF 5FJ8J 3LFKA 4P9UA 2XGCA 3ZOBA 2VBXA 3W3CA 1ZK8A 1AKHA 5A2QK 1YOVB 1APLC 1WGXA 5GADJ 3MVPA 4XQFA 3IWZA 4JX5A 2WB1A 1SD5A 1OR7A 2XAFA 3LA2A 2ESNA 5DTDA 3Q3SA 3TW7A 4FASD 3SJMA 2AS5F 4GDFA 4XKVA 3LSKA 4QWQA 1UAAA 4M9ZA 2O6GE 1B9MA 3FXLA 1H88C 2GXBA 1IN7A 1ETXA 2EZHA 1BJZA 2O0YA 3WTVC 4IOAF 1WZ2A 1KONA 5EG0A 3CCUI 5E3OA 4AVPA 2PMUA 2Y9YA 4E7KA 1V3FA 1V5FA 4XM3A 1I50J 1WVRA 2DMTA 2KLOA 3ABTA 1MW7A 1IZ1A 4C3IJ 5K1YA 1ONVA 5K7ZA 1TT0A 3V8LA 4II3A 3HSRA 4A3JJ 4GYIA 3GVAA 4IJAA 4MLOA 4HNTA 2ZJ2A 1MMAA 2CUEA 3GZNB 1S9HA 2X1CA 1XX5A 3QAHA 2LY9A 1E0EA 2Q2EA 3T0YA 4QLCU 3DPLC 3CUQB 4OMZA 4PZJA 2DMNA 2OA4A 2V4JC 2M45A 2DT6A 2JVHA 2O7OA 3A0HC 2RVCA 4IRGA 3VSKA 3DBHB 5ILVA 1GHCA 2COMA 2EIMH 3WTWC 3FKIJ 3A2KA 1K78B 3CLQA 2EIKH 2R4GA 2A69F 2AXLA 1D8JA 4AUXA 3F8FA 5GAEJ 3RQIA 2CV2A 5C4JJ 3HRUA 1WJAA 4WXCA 4CZCA 3CMMA 1AWCA 1LDDA 2OZUA 1D5VA 3BROA 4DJAA 2V6EA 4EM2A 3BPVA 1Y1WJ 1JT6A 4Y3OA 5F6FA 2RNJA 2LD5A 2HVRA 5LGUA 2M0MA 2ELKA 5E1WA 1K61A 4XOTA 4AIJA 1KU7A 4RAYA 1IXCA 3CCRI 2AHQA 5E8GA 3HBLA 2F4MB 1VTNC 2EPFA 2VXDA 3E3VA 1U2WA 4G9YA 4FETA 4UVCA 1USSA 4CCNA 3ZMVA 4FT8A 4J19A 3HOSA 2LBFA 2VKVA 3EUHC 2CMPA 2ZMEA 1RUNA 1DU6A 4PJNA 3P9KA 2CUZA 3QWLA 1XD7A 1VQPI 3MMYB 4ENKA 1DPRA 4HF0A 2O61A 1ZRCA 4CYCA 5F0HA 3P7NA 5M5YJ 3K4KA 1E3OC 3S1RJ 2KKOA 2F5EA 2CGPA 2L7MP 2QKMB 1SMTA 3VODA 1G2HA 2B9SA 3OIPA 2X0LA 3H5RA 2VPLA 3IAS2 3V7CA 1Z67A 2ZJRF 2ESHA 3SYTA 3BQZA 5J1UA 3KLOA 5IYDJ 3LMMA 2A3SA 4OAYA 1KQ0A 2KFDA 3M1EA 4WCGA 2M5WA 2W25A 3ASOH 2B7EA 3FMSA 2K9NA 2COBA 2AO9A 3FXQA 3JTHA 1GVDA 3SQNA 4M3GA 4OAZA 3A0BC 4F3QA 2R7UA 1WPKA 4O5VA 4P55A 5BPDA 5BMZA 3OYDA 1G6NA 2HVQA 3WGHA 4BXFA 3JTGA 3FM3A 3BCAA 4QSHA 3F0CA 4A5MA 1F4KA 3ABUA 5EZHA 3QODA 1WFXA 2DK8A 1SFUA 4EM1A 3E7LA 3ZQIA 2EINH 2OTLI 1TTYA 4AWXB 2M7BA 1DP3A 1QHGA 1ORKA 2E1MC 3I71A 1K4SA 4MFEA 4PFOA 3F8NA 1OCRH 2H09A 4HDVA 1WJBA 2WAFA 3S14J 5EGOA 1FIAA 1ZELA 2PN6A 4XLHA 2XIGA 3E0JB 2L54A 3IKVA 5D4RA 2VJ5A 4EGYA 2IGKA 2WY8Q 1YW8A 1U8BA 4HF1A 1B59A 3N05A 2QQ8A 2H94A 3G4SI 3J81Z 3OIOA 3CC7I 1POGA 4EATA 4BE1A 1CF7B 2NVYJ 2L9RA 5KVRA 2JSCA 3TEDA 2QF7A 2CQQA 1X3WB 5KNLA 2DA5A 1MBGA 1RUOA 1XDSA 2H8WA 3HGYA 2V1DA 4CSWA 4XRFA 3TDZC 1S6LA 4KUMA 2BOLA 2VJIA 1GXQA 3BR5A 3PUFA 4BQQA 1TW3A 3NARA 5EEGA 4HPQA 1F43A 3QP6A 4UXNA 4GXOA 1LUJB 2K9LA 4E7LA 3ABMH 1SFXA 1YE9A 2W48A 3TQNA 1ETWA 2FEZA 2EZKA 2IAIA 2VJJA 3HEFA 2JZYA 4A3FJ 3I55I 2QKLB 3SEQA 2L4AA 4RGXA 1XCBA 1JUMA 2DDAA 1ZGJA 4N0BA 5CVJA 3E97A 1GLNA 5F27A 4P1WA 3OS1A 1RETA 2X1EA 3O6BB 4HEA2 3CP2A 1SD4A 1Z77A 1QZZA 1E3PA 2LF7A 3CF5F 3T5XA 4B48A 1W36C 3WTXC 1MH4A 2VQLA 4B8XA 4OIQF 3RTRA 4N4OB 3PSFA 4EGZA 1ULYA 3J80Z 1KU3A 1Y56A 3SZGA 4MGRA 4P96A 2HFHA 3HKZA 2GOXB 4PFPA 3AG4H 3HUGA 1DGRM 2L0KA 5DCMB 3BG5A 2FBKA 4BQOA 5ED4A 3CZ6A 1DP7P 2JMWA 1ZAOA 4HSTA 3AG3H 1Y6IA 4G7ZF 2E1MB 1W0UA 1JT0A 4Z2YA 4UNOA 1MMNA 4H0EA 4Y13A 2ZC2A 3FK6A 4MIMA 4M3DA 3EUAA 3LSHA 3KYLA 3G1OA 3OR1C 4UV9A 5GPAA 1Z7UA 4U0YA 4Q5SF 2ID6A 3A01A 4ETSA 3V7SA 2TCTA 3VOEA 4CUGA 1QU3A 3IH2A 2IXSA 4KIGA 1G3YA 1EH7A 2UUZA 3CCEI 4RM2A 2WAQN 1WJEA 5B3SH 3W2AA 1L3LA 1ETKA 5JHUA 4N9HA 3BJ6A 2VC0A 2KIQA 2CQXA 2WTEA 3IAM2 1R5HA 4PJ0C 1OPCA 2P6TA 2Q1ZB 3T8RA 3H9QA 1VQ4I 2M34A 2MSYA 5D8KB 1WJDA 3HTUA 4LLNA 1NHAA 1W1WE 3L9FA 1V5EA 2LSOA 2O9LA 2OPTA 3W2VA 3K4NA 1OCOH 2CFOA 2GQQA 2MA3A 2HDWA 1MJBA 4DYRA 2IS1A 3CCYA 2P81A 3JRAA
chains in the Genus database with same CATH topology
3HC7A 2X51A 3QOEA 2X1DA 2LYCA 1SAUA 2HPMA 3VYSB 2DCEA 1T95A 3DTEA 3H9GA 4ZYAA 2HPIA 4F92B 4ZDPA 2M4GA 3K4MA 3W2WA 2KRHA 2MFZA 1Z3XA 3I9V2 4XLFA 4B3XA 2IGNA 3OYBA 1R6RA 3AFHA 1K6YA 4ZJZA 4KITB 4BEHB 2BW3B 1N77A 3L2RA 4DBRA 3HXLA 3ZGKA 3F9KA 4QPQA 2UV1A 3K4LA 2IS4A 4NQWB 2HQAA 2WA0A 4U87A 2A5WA 2LBFB 4F55A 3H5NA 4HSRA 3OYFA 5HNHA 3FHNA 3RQ4A 1P9QC 4PSXA 2OC6A 1UG0A 1J09A 2CW8A 3K70C 4IQ4A 2R7SA 4RM3A 4JQFA 3CP8A 3C2GA 4JOMA 4IX7A 1IRXA 4ANJA 3DTIA 4YEJA 4PJMA 1MMDA 1EA3A 3FDYA 4ZTFA 2WBMA 5CPRB 4AYBA 4J01A 3OYEA 3FBNB 2VLAA 3L2QA 3CESA 2ZXHA 3EUKL 3BG7A 3AL0C 4HRIA 2KL4A 4XLEA 1BR1A 1D1CA 2X6WA 2PJRB 4XKCA 3OYMA 1FMVA 3M8JA 3VYTB 2A6TA 3PSIA 1YX3A 4LITA 2E5ZA 5FRMA 2NOJB 4LIUA 5HOOA 2VIXA 2OV7A 1NG6A 3LL7A 4BJ6C 4B47A 3OL4A 4DOZA 3E1SA 4R79A 5HNFA 4E6KG 4BACA 3TBIA 3H35A 1NG7A 2KP6A 3J7AY 4RLFA 3S32A 2HVSA 1W36D 1LVKA 2DXIA 1D1BA 3W3CA 4XQFA 3QYEA 2KDOA 2WB1A 4C30A 1U0JA 2GOMA 2V1NA 3PL8A 4FASD 4XKVA 3OYJA 3LSKA 4D1QA 4C2TA 2F5VA 2JUGA 2VL8A 3KEYA 4ZDLA 1UAAA 1N78A 2LY2A 1WJ5A 3BG6A 2E60A 3VWBA 4KISA 1WJFA 3EPZA 2L9NA 2R7OA 2R7XA 2MYSA 1LDKB 1KONA 2HZDA 4PJJA 2X85A 4CCLA 4PUSA 4E7KA 2IS2A 4AVZA 1V5FA 3K10A 4XMYA 4XM3A 4BDZA 4DGWB 2KLOA 2MC4A 1MW7A 1QHHD 1TT0A 2KHMA 4II3A 4B44A 2CV1A 3OYNA 2DOAA 3S3OA 2OUMA 3C2HA 4HG2A 2LRDA 4MLOA 4HNTA 3MKZA 1MMAA 2F6CA 4ITVA 2DT7B 3OIQA 3SDBA 1S9HA 2X1CA 1D1AA 3PNYA 1E0EA 2LY1A 2FUG2 3DPLC 4PSWA 4XR6A 2V4JC 2LH9A 2DT6A 2JVHA 2VXZA 4H4KC 3TL4X 3VSKA 3AL0B 3ZRGA 2KRCA 2ZXIA 3A2KA 1LKXA 1D0ZA 3DPUA 1X19A 4OWRB 2XC7A 4KJZA 3K4CA 1BR2A 2R4GA 4IKFA 3KX2A 3HUGB 2XF7A 1PYVA 3OMYA 3PNVA 2WADA 2CV2A 1WJAA 4CZCA 4XORA 3CMMA 1T0FC 2KMUA 4XLCA 4DJAA 2V6EA 3D5LA 1DGWY 4DBQA 4QPOA 2CH0A 4Y3OA 4BU2A 4CCMA 2LG4A 2HVRA 2M0MA 3K4BA 2L9SA 3DWLE 4XOTA 1X4PA 2Y0SA 3I3LA 3DU5A 3OL3A 5HVQC 2VXDA 3M1CA 4BEHA 3QYFA 5CKTA 4E7ZA 2BW3A 4FETA 4BE0A 4HNUA 4PK4A 1N75A 4CCNA 2LREA 2K3PA 3DQVC 2O5RA 3HOSA 2ZSHB 2CW7A 2LBFA 2W00A 2Z16A 2WAEA 3DU6A 3EUHC 2CMPA 3H9JA 4PJNA 3OYAA 2CUZA 2DJIA 3MMYB 1G59A 3L2UA 4XN0A 3CF2A 4BS9A 2ELJA 1BOBA 3K4KA 3NWTA 3OYCA 2M4KA 3DKYA 3VYUB 2QKMB 2R7TA 4G6TB 2V7FA 3OIPA 5CQGA 3U21A 3H5RA 3ZXSA 2VPLA 2VB6A 3IAS2 2X6XA 3AKZA 2VJ4A 4LG3A 3SYTA 3OYLA 3K70D 3S3MA 3VDXA 3OOUA 3LMMA 4OAYA 3RCOA 4YELA 3NWSA 1ERDA 2M7AA 2ZSIB 3FBIB 1TZLA 3G2BA 3L2WA 2L5QA 4BUPA 2HU9A 2R7VA 2KQRA 4GRIA 5JHFA 3MKYB 5TGTA 4BDYA 4OAZA 3ZR8X 2E5NA 4F3QA 3DLAA 4U7BA 2R7UA 3D5RC 2KZVA 1FMWA 4BJ5C 3ONQA 2KPMA 5LD2C 2K5CA 4XKBA 5HLTA 2PJRA 3OYDA 4E7IA 2HVQA 4BXFA 2BVLA 3BCBA 3BCAA 3QODA 1WFXA 3FKJA 1DQUA 2VQCA 4BJTA 2RQQA 2AQFA 1BR4A 1OR7C 4BL0B 2IGMA 2M7BA 4XOPA 1DP3A 1QHGA 2E1MC 2XSJC 3OYHA 4PFOA 3ZCOA 4DIQA 2R7RA 1X1BA 3OYKA 1PJRA 1WJBA 2WAFA 4CCOA 1ZELA 3OWTA 4XLHA 1Z21A 3E0JB 3DEEA 4J00A 4CCJA 2VJ5A 2IGKA 2WY8Q 4Y33A 3N05A 4NNJA 2R7QA 3HG9A 3VYRB 2WAQA 1X1AA 4RMNA 2R7WA 4EATA 1X1DA 4BE1A 1G8XA 4II2A 2W7NA 1WJCA 3VSLA 2CV0A 3BLYA 5KNLA 4ZDOA 3OY9A 3MKWB 2L2OA 1HA8A 3L2VA 4CA0A 4IZZA 4XL9A 3H0DA 4N4NB 2L7KA 2Z2SB 3A1YA 4RLQA 4CSWA 4P5OA 1VZ0A 2VASA 2BOLA 2VJIA 4BQQA 4HPQA 1D0YA 3SEZA 3V42A 2K9MA 2PMZA 2K9LA 4E7LA 4C9YA 1MNDA 1YE9A 4XN3A 4E4HA 3BC8A 3RSNA 4NC7A 1Z3YA 4E7HA 2UWMA 2W1OA 2ZFUA 2VJJA 3UR3C 4F52A 2CUJA 3IUOA 4XKWA 2RNGA 4AU7A 4BGDA 2BVMA 2IGOA 2QKLB 3SEQA 3UNGC 5KHDA 3OR2C 3LSIA 4NUBA 1GLNA 3OS1A 4P1WA 1JI8A 3A4CA 2X1EA 2M3AA 2Z1DA 4HEA2 3CP2A 4C2UA 3QYBA 2W82A 3MD2A 2MABA 5FROA 4B48A 1W36C 4XNFA 2VQLA 3RTRA 4N4OB 3PSFA 3CJQB 1Y56A 3SZGA 4D9JA 4KT6A 1SFKA 3HKZA 2XDVA 2GOXB 3ZQQA 4PFPA 1V5GA 4ZTJA 2JVGA 1DGRM 2W4SA 5LFAA 4BQNA 4BQOA 1LFPA 3CZ6A 2AQEA 4HSTA 1MMGA 3OYIA 3PJRA 5FRNA 2LC2A 4IQJA 1Y6IA 2E1MB 1X4OA 2X6YA 3HPGA 4CCKA 3PUBA 1MMNA 2RREA 2HNHA 3DTKA 2IS6A 1D0XA 4NC8A 1Z7LA 4LIVA 3DPTA 4XLAA 3EUAA 3LSHA 3KYLA 2P0WA 1UELB 2VKHA 3CJRB 2I8DA 2V26A 3HPHA 3OR1C 2MD0A 1AA7A 3D5SC 3IP4B 3RPUD 3GBGA 4CUGA 1MNEA 2LOOA 1QU3A 1YX5A 5KCMA 3LFUA 2IXSA 4E7JA 2XAUA 2VQHA 2UUZA 4ZC3A 3K6GA 4RM2A 4E7SA 4F93B 3S93A 3H5AA 3HL2A 1WJEA 3W2AA 3OS0A 4X0GA 3DKXA 4PJLA 3K4JA 3TMOA 4CH7A 2VKDA 2V9KA 1OLTA 2CS3A 2JSPA 3S3NA 2Q2EB 5CQEA 4BE2A 2XF6A 3OS2A 3IAM2 3PFYA 3HOTA 2Q1ZB 3LSGA 3H9QA 4YRVA 1WJDA 2F4IA 2XF5A 3PNTA 3S8PA 1V5EA 1X1CA 3LSMA 3W2VA 4Y4RA 3K4NA 4F91B 2VQGA 2CFOA 4B43A 3OYGA 2JA2A 2WY7Q 4XONA 2HDWA 2IS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRE A;  2LRD A; 
#chains in the Genus database with same CATH topology
 4UUS B;  3QOE A;  3CDI A;  5DCF A;  5IP9 J;  2K4B A;  2XVC A;  5FFZ A;  4I99 C;  2HPM A;  1JXS A;  4EJO A;  2M4G A;  2K7L A;  4V19 K;  2MFZ A;  2NXN B;  1U8R A;  4GCV A;  3E6D A;  1UHW A;  1NK3 P;  3O8H A;  2PFB A;  2R7F A;  5LHH A;  1T2K A;  1KYZ A;  3EYY A;  3WU0 A;  2PG4 A;  3FK7 A;  3GUD A;  2ZKZ A;  4BEH B;  3I4N J;  1HW1 A;  2NVQ J;  2XV4 S;  1Y8Q B;  1JHH A;  2M2E A;  3ZGK A;  4L9J A;  3VEP A;  2UV1 A;  1ZHF A;  2IS4 A;  4NQW B;  1IRG A;  2WA0 A;  3BJA A;  2TDX A;  4D5C A;  3CQZ J;  1T0F A;  5CLS A;  1TL8 A;  5IT9 Z;  4BXU A;  4HSR A;  5J8F A;  3OYF A;  4KDP A;  2R3S A;  1WCM J;  4I0A A;  2K86 A;  1EH6 A;  2L7F P;  3BG9 A;  2EA2 A;  3FHN A;  3FXK A;  3I59 B;  3RQ4 A;  4PSX A;  4C3J J;  4EQQ A;  1IV6 A;  2XRO A;  3SFZ A;  1J09 A;  1YJ9 I;  1J59 A;  3QU6 A;  4QTR A;  3K70 C;  5LRS A;  2R7S A;  1U78 A;  2DFE A;  1BI3 A;  3CC4 I;  3MQ0 A;  4HA8 A;  3ZQH A;  4ESB A;  3GLL A;  1J2X A;  2DJN A;  4Y17 A;  3DTI A;  4X1E A;  2MLK A;  4PJM A;  1WWX A;  3TO7 A;  1BC8 C;  3FDY A;  4HBL A;  1OJL A;  5CPR B;  5CVI A;  4AYB A;  1D5Y A;  3R0J A;  5DS9 A;  3FBN B;  3WTY C;  2PI0 A;  3EUK L;  4ESF A;  3WU1 B;  1IC8 A;  3KP3 A;  5D5V B;  3H92 A;  4AM3 A;  2GXA A;  3V8J A;  4JP0 A;  2B0L A;  4XLE A;  4CZZ A;  2MGQ A;  4FCY A;  2X9D A;  1FYL A;  1FMV A;  3M8J A;  5H6Q A;  1IJW C;  4AID A;  4LIT A;  1J7K A;  5ICG A;  5HOO A;  4YII A;  1LEA A;  5ICC A;  1P4X A;  4JK1 X;  3OL4 A;  4DOZ A;  1FBQ A;  2K9S A;  4OIP F;  4BAC A;  3GCM A;  3KZY A;  2RN7 A;  3JRC A;  3ZMD A;  2EJR A;  3BG3 A;  4KNY A;  3MZH A;  1MBF A;  1QVT A;  3VB2 A;  4ZYG A;  4RLF A;  4CGZ A;  1W36 D;  4KN7 X;  1MSE C;  1ITY A;  1U6G A;  1U3E M;  5GAG J;  1LVK A;  2DXI A;  1D1B A;  3JRF A;  4JBA A;  2G0E A;  3QYE A;  3M4O J;  4V2F A;  1YS6 A;  2R0Q C;  3SZT A;  1O3Q A;  1I3A A;  1XN7 A;  3GFJ A;  2ECC A;  3ZQ7 A;  2O8K A;  1TWC J;  3KIO A;  1KU2 A;  1N78 A;  4Q48 A;  2BXZ A;  2LY2 A;  2ADU A;  3ZN0 A;  2DFH A;  3ZMS A;  4A0Y A;  4PJJ A;  2IS2 A;  1V54 H;  3K10 A;  1Z9C A;  5FB2 A;  2QZ8 A;  1A6I A;  2D1H A;  3H36 A;  2MC4 A;  1X3U A;  3FZV A;  2EFO A;  4A3G J;  4IRH A;  4DQ2 A;  2VE8 A;  2AXT C;  2BY0 A;  2CUF A;  3LSJ A;  2Y75 A;  4B44 A;  1FOX A;  5LHI A;  1LEB A;  2DOA A;  1R00 A;  3V7R A;  3S3O A;  1EJ9 A;  1JKO C;  4HG2 A;  2LRD A;  4LLG F;  4HYE A;  3S16 J;  5D5W B;  2DT7 B;  4L9T A;  1TC3 C;  2DOF A;  1WH7 A;  4DZJ A;  1IN8 A;  3PNY A;  2HQR A;  1MBH A;  1B9N A;  3FXR A;  3R0A A;  4LOC A;  4H4K C;  2VXZ A;  1JUS A;  2I5U A;  2KRC A;  2ZXI A;  2ISZ A;  9ANT A;  1X19 A;  2XC7 A;  2DT5 A;  3MWM A;  2V1U A;  2LTP A;  5FKL A;  1R4N B;  5J1Y A;  4BXX J;  2FMY A;  4IKF A;  5E20 A;  4XLN F;  1F36 A;  3BZ6 A;  3RYR A;  4KIF A;  1R7J A;  2K3F A;  4LD5 A;  4XLC A;  4XLP F;  5DUI A;  3BT9 A;  3D5L A;  1DGW Y;  1B72 B;  1LNW A;  1ODD A;  4EV0 A;  4M6Y A;  2QYO A;  4BU2 A;  2YX7 A;  4CCM A;  2R92 J;  3SZP A;  3ISP A;  4HX8 A;  2LP0 A;  3ML6 A;  2MBF A;  1VQL I;  1A36 A;  5EEA A;  5DYM A;  2R7Z J;  2FU4 A;  2DA7 A;  3RDI A;  4M3B A;  2OQG A;  2BHZ A;  3M1C A;  3CUQ C;  1BIA A;  1B8I B;  1DDN A;  3QYF A;  5CKT A;  1JGG A;  4HNU A;  4LK0 F;  5DV5 A;  1N75 A;  3DQV C;  4A3C J;  1G3S A;  2CW7 A;  3ZPL A;  1JKQ C;  1SEU A;  4X6A J;  4MEX F;  3G1M A;  1U5T B;  1YW9 A;  3H9J A;  2K4J A;  3JRE A;  3BZK A;  3WTS C;  1VQO I;  1SC7 A;  3JSO A;  1G59 A;  3L2U A;  2JT1 A;  2R93 J;  4IO9 F;  3J7Z I;  3NWT A;  2M4K A;  3DKY A;  2H1L A;  2FQ4 A;  3CCQ I;  3S17 J;  3DP7 A;  3KEO A;  5CQG A;  3U21 A;  3ZXS A;  1PUF A;  1S8N A;  2VJ4 A;  4DNC A;  3K70 D;  3RIR A;  3VDX A;  1CQT A;  3PO2 J;  2Q0O A;  1YRN A;  5J6X A;  1FX7 A;  2XKP A;  2IA0 A;  3BR1 A;  2P5L C;  4BAY A;  5K5O A;  1GVJ A;  3BTC A;  4GRI A;  4RS8 A;  1TWF J;  1MBJ A;  1TBX A;  5JHF A;  2YSR A;  2DA2 A;  4BDY A;  1VQ8 I;  3HOU J;  1PVE A;  2ZO4 A;  2KZV A;  4CYD A;  1YHQ I;  2EV0 A;  4BJ5 C;  2W84 A;  4LG0 B;  4WXD A;  4DYQ A;  5HLT A;  2P7C B;  2QCO A;  1IUF A;  2PJR A;  3BJO A;  1X3Z B;  2JRM A;  2CO5 A;  2E7W A;  2BVL A;  1QPI A;  5HDN A;  4B4C A;  1FP1 D;  4EJW A;  3F23 A;  1MSF C;  1RES A;  2W85 A;  3FKJ A;  1H9T A;  3GTO J;  3HYI A;  3CJN A;  2RQQ A;  4B1R A;  2DQL A;  2DYS H;  1BC7 C;  2IBD A;  2IGM A;  5IY5 H;  3COA C;  1XGO A;  4NB5 A;  3BOQ A;  2XSJ C;  3ZQG A;  1LJ9 A;  1PJR A;  2QQ9 A;  1FOW A;  1Z21 A;  1W7P B;  4IRI A;  3CME I;  2EQR A;  4NNJ A;  3KZZ A;  5IYC J;  2JPC A;  1O3T A;  2FBH A;  4RMN A;  2R7W A;  4NBQ A;  1H9G A;  4MQ9 F;  1Z05 A;  1X1D A;  2LDU A;  1JE8 A;  3JW4 A;  1PP8 F;  3IWF A;  4II2 A;  2E7X A;  3WHB A;  3M8F A;  4I0B A;  5JR3 A;  1WJC A;  3WGG A;  2Y0S N;  1R49 A;  1R23 A;  4MFD A;  5J3L A;  3JRH A;  5EJC A;  4XRM A;  4RB0 A;  2IRF G;  2XPW A;  3F72 A;  2L2O A;  4I2O A;  4ZYD A;  3L2V A;  3IH3 A;  4IZZ A;  2EFQ A;  3S1N J;  2F2E A;  3A1Y A;  2C6Y A;  1R22 A;  2OD5 A;  2HEO A;  4P5O A;  4ABZ A;  1VZ0 A;  3PO3 J;  3JRB A;  3O8G A;  1P7I A;  2HDC A;  2MW8 A;  3SEZ A;  1ETY A;  2PMZ A;  1XS9 A;  4A5N A;  3I53 A;  2BE5 F;  4HLX A;  3GME A;  3OV8 A;  4NC7 A;  3DFG A;  3T1B A;  1XTA A;  3UR3 C;  2CUJ A;  2IA2 A;  1S29 A;  4AU7 A;  2MD5 A;  3LAP A;  4BGD A;  3B02 A;  3SXY A;  1HOM A;  1VQK I;  1A6Q A;  2HXO A;  5L3G A;  1QZY A;  4EJV A;  3ECH A;  5HS9 A;  5FLX K;  3ZQC A;  4IHW A;  1RPW A;  2BY2 A;  4ESJ A;  1BL0 A;  4M9X A;  3JAM Z;  2M3A A;  1B4A A;  2Z1D A;  1K4T A;  1IUY A;  2FRH A;  1KU9 A;  1W5T A;  2GZW A;  3CUQ A;  2HOE A;  2R5Y B;  1V4R A;  1A5J A;  2ZCW A;  1MKM A;  2NVU B;  3QPT A;  4K2E A;  3ABK H;  1K78 A;  3H3Z A;  5LLQ A;  2ICW G;  3E5X A;  4MNU A;  4YG2 F;  3MFK A;  5DD4 A;  2YS9 A;  3K1N A;  4HZF A;  2XDV A;  4I02 A;  3M3Y J;  3ZQQ A;  4ZZD A;  1V5G A;  5AIQ A;  2JA5 J;  4IHT A;  3HHG A;  1LB2 A;  2JJ7 A;  2JVG A;  1TLH B;  3DCF A;  2HZT A;  4BQN A;  5E1X A;  1Y1V J;  2PQ8 A;  3N4M A;  1ON2 A;  2AQE A;  2PEX A;  3PJR A;  4IQJ A;  1JKR C;  1UG2 A;  1I39 A;  1O7L A;  4RB2 C;  4CCK A;  4OIR F;  3DTK A;  3DV8 A;  4UB8 C;  1Z7L A;  1HXD A;  2R5Z B;  5F1R A;  1BW5 A;  1UEL B;  2VKH A;  2QWW A;  2RC4 A;  3OOP A;  2I8D A;  3HPH A;  4BBR J;  1W7P D;  2E2H J;  3HOZ J;  3RPU D;  3I56 I;  2BGC A;  3GBG A;  1MNE A;  2GIZ A;  2LOO A;  3L1P A;  5HS8 A;  2Y0M A;  1ZG5 A;  2HR3 A;  2XAU A;  1A31 A;  3M07 A;  3S93 A;  1OCP A;  3H5A A;  1ZRF A;  2XAQ A;  1XGM A;  3OS0 A;  4X0G A;  3RKQ A;  4PJL A;  2ZBK A;  4KN4 X;  4CH7 A;  5JFR A;  5JLX A;  2V9K A;  1OLT A;  1I5Z A;  2BY3 A;  2QGU A;  3DEW A;  2CS3 A;  3S3N A;  1KQ9 A;  2CWE A;  3JRG A;  2XF6 A;  5ICF A;  2K85 A;  3CDL A;  2EBI A;  5FD6 A;  4HOB A;  2DYR H;  4MEY F;  1YW7 A;  2IA1 A;  1ZLK A;  2JA7 J;  1R58 A;  3CDH A;  3R6S A;  3BTI A;  1IGN A;  4B43 A;  4C2M J;  3E5Q A;  3OYG A;  2JA2 A;  4XON A;  3WHC A;  2ACJ A;  2XB5 A;  3HB9 A;  4G6D A;  3JRD A;  1YTY A;  4PCQ A;  2LYC A;  3I4M J;  5M5W J;  2EIL H;  4KIB A;  2XHK A;  3KCC A;  3H9G A;  3S2D J;  5KK1 A;  1OMI A;  3W2W A;  1EV7 A;  2KRH A;  1R5I D;  5A2Q Z;  1MMS A;  3P5J A;  2E36 A;  3F8B A;  3W6K B;  4HDU A;  1PUE E;  3ULQ B;  1HW2 A;  1Z3X A;  1O3R A;  1LE8 B;  4I01 A;  2DA4 A;  1XSX A;  5IP6 A;  3WOD F;  1IN4 A;  2IGN A;  3OYB A;  1R6R A;  2XAG A;  4HLY A;  4AD9 A;  4G7O F;  1J0R A;  4KMF A;  3HOV J;  2K40 A;  1YFH A;  2BW3 B;  4HAM A;  2HTJ A;  2IP2 A;  3F9K A;  4WK8 F;  4JX6 A;  3F8M A;  3FXO A;  2L9V A;  5E79 C;  1FNN A;  3K69 A;  2CG4 A;  3OSF A;  2J5O A;  5HNH A;  1T08 B;  4OMY A;  1P9Q C;  2N8G A;  3S2W A;  2OC6 A;  1UG0 A;  5D6F A;  3QP5 A;  1RKW A;  3DEU A;  4IQ4 A;  4RAF A;  1N25 A;  1F5T A;  1CF7 A;  2YU9 J;  4JQF A;  1AHD P;  4MQV A;  1FZP B;  3C2G A;  1FSH A;  4ANJ A;  5FO5 A;  3RPQ A;  5IOZ A;  2P4W A;  2V9P A;  2MH2 A;  3R61 A;  1PDN C;  1EA3 A;  2PMH A;  2IEK A;  1HQC A;  1K83 J;  3HIF A;  3EUH A;  5B5E C;  4ZTF A;  1J9I A;  3CMA I;  5K5Q A;  1HBX G;  1PP7 U;  1YQA A;  2XPU A;  3Q9V A;  1ETQ A;  4L5I A;  1MBE A;  4U0W A;  3BG7 A;  4G12 A;  3CC2 I;  1MH3 A;  2IT0 A;  1IDY A;  3OYM A;  3RI4 A;  1XCV A;  4M9S A;  2QM3 A;  4FE7 A;  2A6T A;  5F08 A;  5DUK A;  4I76 A;  3PSI A;  1FTZ A;  1YX3 A;  2E5Z A;  5M3M J;  2E1C A;  1S7O A;  2OU2 A;  2L01 A;  4LIU A;  2HQN A;  1WH5 A;  4EJU A;  1NG6 A;  5IYB J;  5CJ9 A;  1UJ8 A;  1Q1V A;  3M7G A;  4A6D A;  4B47 A;  2MH9 A;  3DLL F;  1HKT A;  4R79 A;  3GTK J;  1SFE A;  5B1B H;  2VPR A;  4A2U A;  4U7D A;  2QBY B;  4UUT A;  2P8T A;  1YIT I;  6PAX A;  3D0S A;  3K2Z A;  4OOI A;  4LLL A;  1YLF A;  4IOC F;  1RZ4 A;  1HST A;  1TQP A;  1KGS A;  2JTV A;  1NG7 A;  3HSE A;  4AIK A;  3KPH A;  4G94 A;  3H0G J;  4JX4 A;  2G7H A;  4Y15 A;  2V1X A;  2ZJP F;  1ON1 A;  1X1P A;  5E17 F;  2GA1 A;  4S0H B;  2BEO A;  3C7J A;  3FIW A;  1RNL A;  3BR6 A;  1O57 A;  2VOO A;  1UHM A;  3P9I A;  5DCM A;  2EV5 A;  3ERE D;  3H1C A;  2RKH A;  4C30 A;  2EFW A;  4A3M J;  2V1N A;  4M72 A;  3PL8 A;  2Q8K A;  2PJP A;  2DFF A;  4RGS A;  2IPQ X;  4IHY A;  3FXU A;  2FBI A;  5LGT A;  1JJ6 C;  4A69 C;  4D1Q A;  2F5V A;  2JUG A;  3KEY A;  2D45 A;  1WJ5 A;  5K5R A;  2K02 A;  2RAE A;  3EPZ A;  1K79 A;  2L9N A;  4XID A;  3S1Q J;  2R7O A;  2MYS A;  3DXJ F;  2X85 A;  4PUS A;  4AVZ A;  3LA3 A;  3HTS B;  4BDZ A;  2FML A;  4EMS A;  2FSW A;  3GTL J;  2LLK A;  4ON0 A;  1T6S A;  2CV1 A;  3WE2 A;  2OUM A;  3C2H A;  2KRF A;  2DA3 A;  2JK3 A;  1FOY A;  2E19 A;  3GTJ J;  4GYG A;  5EYR A;  3RJP A;  1ZH5 A;  2A6E F;  3NAU A;  5D4S A;  1Y0U A;  3SDB A;  2EFP A;  2MC3 A;  2NOG A;  2XB0 X;  2ZJQ F;  4IHV A;  2E2J J;  1NK2 P;  2LY1 A;  2FUG 2;  5FKO A;  4PSW A;  5DM6 F;  2VON A;  2CRG A;  2LH9 A;  4IF4 A;  1S3J A;  1ZYR F;  1OQY A;  3KYC B;  3Q0U A;  4IPA A;  4D7N A;  2L7Z A;  3ECO A;  1D0Z A;  1S7A A;  3DPU A;  4OWR B;  4LK1 F;  5M3F J;  5K7F A;  3PQJ A;  2PLY A;  5C3E J;  3JRI A;  4YFX F;  1WKM A;  3KX2 A;  3MCZ A;  4XIC A;  2XF7 A;  1SMY F;  1O4X A;  2WAD A;  2FOW A;  4UUS A;  2KJB A;  4XOR A;  3ESW B;  5DM7 F;  4DW6 A;  4MHG A;  2CQ7 A;  2NNN A;  1MJA A;  2Z3Y A;  2OAZ A;  4DBQ A;  2UXN A;  2HS5 A;  1XGN A;  1STZ A;  2CH0 A;  2EK5 A;  5C44 J;  4YIR X;  1QNT A;  1UST A;  3KET A;  3D1N I;  3RZD J;  2QLZ A;  2KJC A;  1ETO A;  2LG4 A;  2GM4 A;  4L0Z B;  3K4B A;  1KYW A;  1P6R A;  3DWL E;  1IO2 A;  1YO5 C;  4A3D J;  3MAJ A;  1GT0 C;  1P92 A;  1J75 A;  1RRJ A;  1UCR A;  5LHG A;  3I3L A;  3OL3 A;  2A6H F;  5EEH A;  4BEH A;  3G3Z A;  1QQI A;  1QRY A;  3ROU A;  1FSE A;  4E7Z A;  4BE0 A;  2DA1 A;  1IDZ A;  4A93 J;  3EDP A;  4XSX F;  2F5F A;  4PGH A;  4PK4 A;  4NQW A;  2LRE A;  2EZL A;  2K3P A;  2ZSH B;  1NTC A;  1H8A C;  4W97 A;  5ILS A;  2WAE A;  3DU6 A;  4L5E A;  1MIJ A;  4A6E A;  4BYY A;  2ETH A;  2WB1 N;  3OYA A;  2DJI A;  2M87 A;  3DF8 A;  3CMY A;  1DU0 A;  3I59 A;  3AAF A;  1RIO H;  1HF0 A;  3CF2 A;  3TO6 A;  3WG9 A;  4BS9 A;  2ELJ A;  1VFC A;  1BOB A;  3U1K A;  5H20 A;  1OCZ H;  3OYC A;  3C3W A;  3QQA A;  3VYU B;  4BY1 J;  5GTI C;  1VQ6 I;  2V7F A;  2QSF X;  4JYK A;  2VB6 A;  4L5J A;  1JTX A;  4RAZ A;  3S3M A;  3OYL A;  1AOY A;  5HLH A;  3OOU A;  1JJ8 C;  5IPA A;  3V8K A;  2QSG X;  4DZP A;  3NWS A;  1R1T A;  1XG1 A;  3FBI B;  1V55 H;  1TZL A;  2DMQ A;  3G2B A;  4IEJ A;  1HCR A;  2DO7 A;  1ZGA A;  2L5Q A;  4BUP A;  1Z0X A;  4RA2 A;  2HU9 A;  3IRR A;  2M9H A;  4S04 A;  3BP8 A;  2NNY A;  2R7V A;  2FXA A;  5H6R A;  3MKY B;  3K1P A;  5TGT A;  2F5D A;  1ZLJ A;  3DLA A;  2LKP A;  3W6J B;  1ETV A;  2OCC H;  1MDM B;  3ONQ A;  2KPM A;  5LD2 C;  3F6V A;  2DPD A;  1YG2 A;  4A0Z A;  1R36 A;  1U5T C;  4E7I A;  2VOP A;  4R1H A;  5GAH J;  2F4O B;  2JN6 A;  1BOA A;  3HDD A;  3I64 A;  2YUS A;  2NS8 A;  1Q1H A;  1DQU A;  4BJT A;  5HDK A;  2AQF A;  4S05 A;  1OR7 C;  4ASN A;  3TOA A;  5F0F A;  3ZMZ A;  3S2H J;  3GF2 A;  4XOP A;  5BS6 A;  3FXJ A;  1I27 A;  2PBI A;  2LMD A;  1MJ9 A;  4DIQ A;  2ZB9 A;  3P9C A;  3Q0W A;  1WHU A;  4KT5 C;  1C0W A;  2OBP A;  3OWT A;  1LFU P;  5K7H A;  1FLI A;  2EIJ H;  3HM5 A;  2R7Q A;  3G1L A;  4BHC A;  1Z6T A;  3HG9 A;  1E2X A;  2WAQ A;  3M8E A;  3VYR B;  2QA4 I;  1G8X A;  2QQA A;  2E1O A;  2VE9 A;  3ERM A;  4IVN A;  1MNM C;  2HXI A;  2V9V A;  3VSL A;  2CV0 A;  2HQ5 A;  1REP C;  2DN0 A;  4ZDO A;  3HOX J;  3OY9 A;  3MKW B;  1HA8 A;  4CA0 A;  1SVM A;  2XKO A;  4XL9 A;  3H0D A;  4PGG A;  2Z2S B;  4ENM A;  4EJT A;  1ZR4 A;  3F22 A;  1G3T A;  5D8L B;  2KIS A;  2G7U A;  1OYI A;  3V42 A;  2K9M A;  3F6O A;  1MND A;  4XN3 A;  4E4H A;  3HRT A;  1Z3Y A;  4E7H A;  2W1O A;  2ZFU A;  3B6A A;  2HWV A;  3IUO A;  4XKW A;  3G6E I;  3S1M J;  1VQ5 I;  2BVM A;  1G4D A;  4M74 A;  1UHS A;  4I09 A;  5KHD A;  1OYW A;  3B73 A;  2WV0 A;  1Y39 A;  4NUB A;  3T8T A;  2IJL A;  3FHZ A;  1JI8 A;  5FKK A;  2W57 A;  2L4M A;  2XGX A;  5HLG A;  4C2U A;  2VUM J;  2XUB A;  3I0T A;  1QO0 D;  1QPM A;  1HDP A;  3L00 A;  3KZI C;  4HV5 A;  5LRR A;  4XNF A;  4LB5 A;  3H3U A;  1RR7 A;  1FEX A;  2ISY A;  4ZYH A;  4A0X A;  2DU9 A;  2ZXJ A;  4O6J A;  1IF1 A;  4KT6 A;  1SFK A;  1IAW A;  2XRL A;  3IH4 A;  3W6V A;  1OFC X;  2A61 A;  1AKH B;  2Y2Z A;  3LSR A;  3GYH X;  2QEX I;  4RBO A;  4YFN F;  5LFA A;  5ICE A;  4MO7 A;  1HSJ A;  5F64 A;  5E8I A;  3WU2 C;  1MMG A;  3OYI A;  1FP2 A;  2LC2 A;  1B72 A;  1YIO A;  4UVA A;  3SFI A;  2YPR A;  1X4O A;  2ZME C;  4CO8 A;  4WX9 A;  3HPG A;  1OYY A;  2OJE D;  2HNH A;  5D5X B;  4NC8 A;  1M1E B;  3GWZ A;  3E6B A;  5IP7 J;  3DPT A;  4XLA A;  5TRD A;  1VND A;  4ZZL A;  1T38 A;  3MZY A;  5EG0 B;  1TP4 A;  5TIS C;  3CJR B;  1WI3 A;  1IXS B;  1B8I A;  2F5C A;  1AA7 A;  3D5S C;  3IP4 B;  3GXO A;  3CJT B;  1YX5 A;  1SVO A;  2X4H A;  5J40 A;  1HW5 A;  5KCM A;  3LFU A;  2VI6 A;  1IRZ A;  1W5S A;  4E7J A;  2VQH A;  3K9T A;  2DDB A;  3GEZ A;  1FT9 A;  3K6G A;  1FBU A;  4E7S A;  4U0V A;  3CCS I;  2Y9Z A;  3HL2 A;  2BXY A;  5LGN A;  2KIF A;  1S72 I;  1OCT C;  1X2N A;  1MZB A;  4XSZ F;  1T56 A;  3A02 A;  1U5T A;  3J81 K;  3LA7 A;  5BPI A;  1XC5 A;  3K4J A;  2OZ6 A;  1BBY A;  2JSP A;  1B6A A;  2Q2E B;  3C18 A;  3OS2 A;  1FYM A;  3PFY A;  4FHT A;  3HOT A;  2KIM A;  3LSG A;  5JI6 A;  1BI2 A;  2FX0 A;  3MZ8 A;  3G73 A;  2XF5 A;  2RV8 A;  3ZQF A;  3S8P A;  4FQG A;  5D5U B;  4EEF G;  1X1C A;  3LSM A;  3ZMU A;  2DQR A;  4F91 B;  1TT5 B;  5IT3 A;  4A3K J;  2M0C A;  3BR0 A;  3WTT C;  4LB6 B;  1R4M B;  2WY7 Q;  1TWH J;  2QQB A;  1UFM A;  3AG2 H;  1P4A A;  4BY7 J;  5E3N A;  3WGI A;  2MG4 A;  5CVU A;  1SAU A;  1RI7 A;  3TDU C;  4KIC A;  3VYS B;  2DCE A;  1T95 A;  3HGG A;  2FQ3 A;  1XMA A;  4ZDP A;  3GX4 X;  1BN5 A;  1RKT A;  4LG0 A;  2K27 A;  2R7D A;  4HF2 A;  3U2R A;  2B63 J;  1E17 A;  3RZO J;  3Q0V A;  3MN2 A;  5FLM J;  2XPV A;  3GTG J;  5TJJ A;  2MLG A;  2I10 A;  2H6C A;  3GFI A;  4XLF A;  3AFH A;  3ZMT A;  2BHY A;  4Y7N J;  2TRT A;  5LEJ A;  4CHU A;  2JUC A;  2HKX A;  4B3A A;  1I1S A;  3L2R A;  3J80 K;  4GFB A;  4DBR A;  1IG7 A;  3HKZ N;  1S5L C;  1BA5 A;  4V2G A;  3F3X A;  2HQA A;  3DBL B;  4U87 A;  5HS7 A;  1XMK A;  1T39 A;  2M1B A;  2LBF B;  1UZC A;  3BTJ A;  1H89 C;  2ZME B;  2JWT A;  1R9T J;  4A3I J;  2Z33 A;  1W7P A;  2GXG A;  2BZT A;  3EET A;  3RPU A;  1LFB A;  4CYC B;  3G71 I;  1FPQ A;  3ASN H;  3IHU A;  4EVI A;  2YX4 A;  2CW8 A;  4RB1 A;  2G9W A;  3L7W A;  3TP0 A;  2H6B A;  2ME0 A;  4RM3 A;  1P4W A;  2D2W A;  4I6Z A;  1RR8 C;  1ZR2 A;  2VBZ A;  4U88 A;  1JTY A;  4IX7 A;  1IRX A;  1E3H A;  5FLV A;  5L3D A;  4YEJ A;  1FIP A;  2DFI A;  1MMD A;  2RDP A;  1ENH A;  2QSH X;  3GFM A;  3FX3 A;  1W5C C;  3HZJ A;  2VT2 A;  4J01 A;  4D7M A;  3E6M A;  1F1Z A;  5HOD A;  3GW2 A;  3L2Q A;  1UB9 A;  2JQ7 A;  1Z6R A;  3AL0 C;  2JA8 J;  1J5Y A;  1D1C A;  4IHX A;  2JA6 J;  3CCM I;  2NS7 A;  3CCJ I;  3CUO A;  3VYT B;  3CLO A;  1Y8R B;  1IV8 A;  5FRM A;  3REO A;  3HOW J;  2NOJ B;  1TWG J;  4GO1 A;  5CVV A;  1BM9 A;  4W1U A;  1YJN I;  1D3Y A;  2OV7 A;  2ME6 A;  2CU7 A;  2HI3 A;  2QUF A;  4LJZ F;  3ZN1 A;  4BJ6 C;  3FF5 A;  4WF2 A;  3E1S A;  3TGN A;  1IN6 A;  5HNF A;  3TO9 A;  1FYK A;  4E6K G;  1LDJ A;  2BYV E;  2ZXW H;  1HKQ A;  2IVM A;  3SHF A;  3TBI A;  4FX4 A;  2R5Y A;  4BQA A;  3V4G A;  1QVU A;  4BHB A;  3BZC A;  3NRV A;  2OTJ I;  2W24 A;  2KP6 A;  2GA2 A;  5EGO B;  5J1R A;  4UVB A;  3EQL F;  4XBF A;  2HVS A;  4HX4 A;  5FD5 A;  3K7A J;  3QU3 A;  4M6V A;  5KAF C;  4WWC A;  3ZQL A;  4M3E A;  2RQP A;  4BH9 A;  1JHF A;  2KDO A;  3RKY A;  2FJ1 A;  1EH8 A;  1P7J A;  1U0J A;  2GOM A;  4HQE A;  4HQM A;  4OU0 A;  2A05 A;  1SD7 A;  3HRS A;  2DA6 A;  3OYJ A;  4C2T A;  2VL8 A;  1ZTR A;  4ZDL A;  2STT A;  1OCC H;  3BG6 A;  2E60 A;  3VWB A;  4KIS A;  3GTP J;  2CSO A;  1WJF A;  4NHJ A;  3FIS A;  4DYC A;  2R5Z A;  2R7X A;  2DW4 A;  4O3M A;  1LDK B;  2HZD A;  4CXF A;  1EF4 A;  4CCL A;  3FWE A;  2H8R A;  4XMY A;  3K1M A;  1SFO J;  3IRQ A;  3DKW A;  4DGW B;  5IT9 K;  2HOA A;  1A35 A;  1QHH D;  3B6C A;  2KHM A;  5E18 F;  3OYN A;  1XMX A;  3BR2 A;  2H27 A;  1R1V A;  5FKM A;  1LPQ A;  2XRN A;  2EA4 A;  1FJL A;  3MKZ A;  2F6C A;  4ITV A;  2GIV A;  2A5Y B;  3OIQ A;  4M3F A;  1F9N A;  1Z91 A;  2EFN A;  2LF8 A;  5L3F A;  3J7Y J;  3I5U A;  1D1A A;  2FA5 A;  2XAH A;  1SAX A;  4N9I A;  2DOE A;  3PIO F;  3Q5F A;  4UB6 C;  3KP4 A;  2UZK A;  4XR6 A;  4A3L J;  3MKL A;  5J4V A;  3TL4 X;  1U9N A;  1HKS A;  4AYB N;  3AL0 B;  1BJA A;  3ZRG A;  3O2P E;  4B09 A;  5KAI C;  1LKX A;  2P5K A;  3FMQ A;  4KJZ A;  3TW6 A;  5LEK A;  3O3K A;  1FWZ A;  2OQR A;  2KZG A;  3WTZ A;  3K4C A;  2BBY A;  1BR2 A;  3WE3 A;  4ZH4 F;  3K0L A;  3HOY J;  1VQ7 I;  3HUG B;  3OMY A;  1PYV A;  1I6X A;  3HJE A;  3PNV A;  3SDG A;  1JKP C;  1T0F C;  2KMU A;  3GZ5 A;  2ECB A;  4FX0 A;  2PX9 A;  1WQ2 A;  4QPO A;  3N97 A;  1I3Q J;  1ZAR A;  4HV6 A;  2XGE A;  1ZG3 A;  2P6S A;  1IRF A;  3LWF A;  2L9S A;  2VC1 A;  1LE8 A;  1X4P A;  3DBR B;  3IKT A;  1ZRE A;  1O7F A;  5DEQ A;  1AU7 A;  2Y0S A;  1I1G A;  2DMP A;  3DU5 A;  2VT3 A;  5E1Z B;  5HVQ C;  2GBY A;  1B1B A;  2DLL A;  2Y30 A;  4M71 A;  5J4Y A;  1RC9 A;  1Y0N A;  4UHT A;  1FTT A;  2FNP A;  3A01 B;  1K6O A;  2QVO A;  2BW3 A;  3QPH A;  5EDN A;  2E34 A;  1LQ1 A;  2GLO A;  1MGT A;  2O03 A;  2O5R A;  1IXR C;  2W00 A;  1UMQ A;  2Z16 A;  2ID3 A;  2M30 A;  3HSF A;  1BI0 A;  4FE4 A;  3LSP A;  4RAG A;  3LQR A;  2LKX A;  3KP5 A;  2VBW A;  5HLI A;  4A3E J;  3FM5 A;  5IOY A;  1O3S A;  2YR2 A;  4XN0 A;  3RYP A;  4UUV A;  4FTH A;  1BIB A;  1R71 A;  5F1J A;  3RKW A;  5FLX Z;  4D0P A;  2E35 A;  1VQN I;  3R4K A;  2Z9O A;  2R7T A;  4G6T B;  3E6C C;  1XPX A;  3QOP A;  5ILU A;  3F8C A;  5BOX A;  2KIU A;  2X6X A;  4L9N A;  2YU3 A;  3AKZ A;  1VF9 A;  4LG3 A;  3KEQ A;  4BKX A;  3FMR A;  3IV5 A;  2HTS A;  5C4X J;  1BI1 A;  2Y69 H;  2D5V A;  3RCO A;  1EKE A;  4YEL A;  5FFX A;  1ERD A;  3R60 A;  2M7A A;  2ZSI B;  1MBK A;  4CDG A;  2CYY A;  5FKN A;  4C3H J;  3L2W A;  3GTQ J;  2KQR A;  4YIF A;  3RKX A;  1ZKG A;  2D1V A;  3KP2 A;  2OCE A;  2FE3 A;  3KLN A;  3ZR8 X;  1XGS A;  2E5N A;  4U7B A;  3D5R C;  1VQM I;  1OIS A;  1P2F A;  1FMW A;  2BV6 A;  2FOK A;  1LVA A;  5JLW A;  2K5C A;  3KFW X;  4XKB A;  2NS0 A;  2EWN A;  3BR3 A;  3BCB A;  1W0T A;  3PM1 A;  1ZQ3 P;  3K2A A;  5GTH C;  1U9O A;  2VBY A;  2ZFW A;  1R1U A;  3JCU C;  1FBS A;  2VQC A;  3TOB A;  4Z6Y A;  1TWA J;  2CJJ A;  3QPS A;  1BR4 A;  3BWG A;  4NDL A;  4BL0 B;  4L9V A;  2QBY A;  2V79 A;  2XAS A;  1YIJ I;  3ZP5 A;  2LKS A;  5F04 A;  1WI9 A;  2DK5 A;  3OYH A;  3JSP A;  3ZCO A;  2LK2 A;  1X1B A;  2R7R A;  3OYK A;  5F0C A;  1FOK A;  4CCO A;  4E70 A;  1MD0 A;  2HYJ A;  4J00 A;  3DEE A;  3KE2 A;  4CCJ A;  5ERI A;  4Y33 A;  1X1A A;  2NVT J;  5JVT A;  4Q47 A;  5AIP A;  1TQM A;  1T98 A;  2P5V A;  2W7N A;  1WRJ A;  2GAU A;  1VI0 A;  3ABL H;  2DI3 A;  3IL2 A;  2M8G X;  4XK4 A;  2WWY A;  3CCL I;  1YYV A;  3GFL A;  2HYG D;  3BLY A;  2NAZ A;  2L02 A;  4N4N B;  2L7K A;  2E1N A;  2EV6 A;  4RLQ A;  5J47 A;  2XSD C;  1BW6 A;  2JRT A;  2VAS A;  2E71 A;  3BDD A;  2ELH A;  3CCV I;  1D0Y A;  5LBQ A;  2FNA A;  2CFX A;  2E2I J;  4C9Y A;  4UV8 A;  4WXH A;  3BC8 A;  3RSN A;  2UWM A;  1A04 A;  4G8X A;  3Q9S A;  1TQI A;  4F52 A;  2RNG A;  4HNV A;  4NC6 A;  2FD5 A;  2IGO A;  4QIW N;  4ZYE A;  4Y52 J;  1ZGW A;  2O8X A;  3UNG C;  4LGW A;  3L2C A;  4OIN F;  3OR2 C;  4L18 B;  3LSI A;  1SD6 A;  4MTD A;  2VKE A;  2FF4 A;  1CGP A;  3VPR A;  4KMU X;  3A4C A;  2P7V B;  1JUP A;  5CVR A;  1W4M A;  2O3F A;  5EZG A;  3QYB A;  2W82 A;  3MD2 A;  2MAB A;  5FRO A;  4IXA A;  4P9F A;  3CD6 I;  5J8C A;  1DUX C;  5AON A;  3PFI A;  3CJQ B;  2WV1 A;  3BPX A;  4D9J A;  3QPL A;  2NYX A;  4ZTJ A;  4G6Q A;  2DTZ A;  5GP9 A;  5E3M A;  4A3B J;  1D8K A;  2W4S A;  4AIH A;  2CQK A;  1YJW I;  1L0O C;  4A12 A;  2HYF A;  3X2Q H;  1LFP A;  4LFU A;  1KZH A;  4G7H F;  1YS7 A;  4HW0 A;  5FRN A;  1QA6 A;  2X48 A;  3HRM A;  5D6E A;  2LVS A;  2X6Y A;  2XGD A;  5BQT A;  3EYI A;  3PUB A;  4PDK A;  2RRE A;  2IS6 A;  1D0X A;  1HLV A;  1X58 A;  1OKR A;  2DOD A;  4LIV A;  2BY1 A;  1FY7 A;  3KP7 A;  4FIS A;  2P0W A;  4LMY A;  3WG7 H;  5E3L A;  4CIC A;  3OSG A;  4GGG A;  1XDU A;  2V26 A;  3BQY A;  2STW A;  2JPB A;  3WTU C;  2MD0 A;  2EB7 A;  2KT0 A;  2WC2 A;  2CQN A;  1ZG1 A;  2HOT A;  4M73 A;  2XAJ A;  5FGM A;  4L0Y B;  4ENN A;  4ZC3 A;  4TV7 A;  4F93 B;  2A07 F;  4R8H A;  1T33 A;  3DKX A;  4M6X A;  3TMO A;  2VKD A;  3U9G A;  2GWR A;  5HDG A;  3KYD B;  1YI2 I;  3I58 A;  2EZI A;  5CQE A;  4BE2 A;  4UY8 I;  4BHP A;  4YRV A;  2DTR A;  3IC7 A;  1SAN A;  2ZNY A;  2VOD A;  3FXM A;  2F4I A;  2Z99 A;  3PNT A;  4D5F A;  2RGV A;  5B66 C;  1DPU A;  1S7E A;  1XB4 A;  4BBS J;  5DD8 A;  4Y4R A;  1GV5 A;  2K9Q A;  1GXP A;  2PMZ N;  2VQG A;  1SVL A;  3M9A A;  3HC7 A;  2A68 F;  2X51 A;  5M5X J;  4YFK F;  2X1D A;  1VQ9 I;  3E5U A;  3DTE A;  4ZYA A;  2HPI A;  4F92 B;  2M8E A;  4I98 B;  1MDM A;  3K4M A;  2HGC A;  3I54 A;  3JAM K;  3I4P A;  4XRS G;  4RGR A;  3TKY A;  3ELK A;  2DPU A;  3I9V 2;  1Z1D A;  3LST A;  4B3X A;  1K6Y A;  5H2F C;  4ZJZ A;  4KIT B;  1GDT A;  5B1A H;  3UKG A;  2Y31 A;  3S15 J;  3PQK A;  1N77 A;  1K7A A;  1I6H J;  4XRS A;  1QZE A;  2EH3 A;  3HXL A;  2IW5 A;  4QPQ A;  1TW2 A;  3C1D A;  3K4L A;  2F48 A;  3QRF F;  3NQO A;  2LR8 A;  2VN2 A;  2A5W A;  4F55 A;  5EF6 A;  5GPC A;  4BNC A;  3H5N A;  1JGS A;  3H3V K;  1G3W A;  1TNT A;  2NRA C;  4RB3 C;  1ACI A;  1R5G A;  1T8I A;  2ZNZ A;  2V6C A;  2Y48 A;  3C2B A;  4AC0 A;  3CTA A;  1ZRD A;  1TNS A;  5BNG A;  1X2M A;  4IL6 C;  2OF7 A;  3CP8 A;  1PUF B;  3NEU A;  4JOM A;  1FC3 A;  5CYV A;  3PIP F;  3LNQ A;  2NVX J;  2DBB A;  1HC8 A;  2H1K A;  3J7A O;  3LQQ A;  3HHH A;  5L3E A;  1WSU A;  3VFZ A;  2UXX A;  3BTL A;  1YRN B;  2L3D A;  2X6O A;  4RGU A;  2WBM A;  4I7H A;  3CO7 C;  3GLX A;  4HX7 A;  3L09 A;  3OYE A;  2KDZ A;  2VLA A;  3CES A;  4EM0 B;  2HDD A;  4F7Z A;  2ZXH A;  5JVG F;  1IW7 F;  2HKO A;  3TP3 A;  4MTE A;  4HRI A;  4KFC A;  2KL4 A;  3LOC A;  1BR1 A;  2X6W A;  2PJR B;  4XKC A;  2DAO A;  2J5P A;  3JR9 A;  2LNB A;  4Q4Z F;  2DMU A;  3F21 A;  3GTM J;  4KA4 A;  3KP6 A;  1HDD C;  5L3C A;  1QBJ A;  2VIX A;  4IHS A;  3LL7 A;  2QEN A;  5L3B A;  4RDU A;  3U1D A;  1XSD A;  1GUU A;  2Z5U A;  3GZ6 A;  1XSV A;  3AG1 H;  1IN5 A;  5DDG A;  2HOS A;  1GV2 A;  3A03 A;  1ZN2 A;  1H0M A;  1NH3 A;  3GO5 A;  3LAJ A;  3H35 A;  3MEX A;  4ENJ A;  1QGP A;  3J7A Y;  4KYW A;  1KA8 A;  3S32 A;  1KQ8 A;  2LFB A;  3CO6 C;  3BY6 A;  2CW0 F;  4OIO F;  5FJ8 J;  3LFK A;  4P9U A;  2XGC A;  3ZOB A;  2VBX A;  3W3C A;  1ZK8 A;  1AKH A;  5A2Q K;  1YOV B;  1APL C;  1WGX A;  5GAD J;  3MVP A;  4XQF A;  3IWZ A;  4JX5 A;  2WB1 A;  1SD5 A;  1OR7 A;  2XAF A;  3LA2 A;  2ESN A;  5DTD A;  3Q3S A;  3TW7 A;  4FAS D;  3SJM A;  2AS5 F;  4GDF A;  4XKV A;  3LSK A;  4QWQ A;  1UAA A;  4M9Z A;  2O6G E;  1B9M A;  3FXL A;  1H88 C;  2GXB A;  1IN7 A;  1ETX A;  2EZH A;  1BJZ A;  2O0Y A;  3WTV C;  4IOA F;  1WZ2 A;  1KON A;  5EG0 A;  3CCU I;  5E3O A;  4AVP A;  2PMU A;  2Y9Y A;  4E7K A;  1V3F A;  1V5F A;  4XM3 A;  1I50 J;  1WVR A;  2DMT A;  2KLO A;  3ABT A;  1MW7 A;  1IZ1 A;  4C3I J;  5K1Y A;  1ONV A;  5K7Z A;  1TT0 A;  3V8L A;  4II3 A;  3HSR A;  4A3J J;  4GYI A;  3GVA A;  4IJA A;  4MLO A;  4HNT A;  2ZJ2 A;  1MMA A;  2CUE A;  3GZN B;  1S9H A;  2X1C A;  1XX5 A;  3QAH A;  2LY9 A;  1E0E A;  2Q2E A;  3T0Y A;  4QLC U;  3DPL C;  3CUQ B;  4OMZ A;  4PZJ A;  2DMN A;  2OA4 A;  2V4J C;  2M45 A;  2DT6 A;  2JVH A;  2O7O A;  3A0H C;  2RVC A;  4IRG A;  3VSK A;  3DBH B;  5ILV A;  1GHC A;  2COM A;  2EIM H;  3WTW C;  3FKI J;  3A2K A;  1K78 B;  3CLQ A;  2EIK H;  2R4G A;  2A69 F;  2AXL A;  1D8J A;  4AUX A;  3F8F A;  5GAE J;  3RQI A;  2CV2 A;  5C4J J;  3HRU A;  1WJA A;  4WXC A;  4CZC A;  3CMM A;  1AWC A;  1LDD A;  2OZU A;  1D5V A;  3BRO A;  4DJA A;  2V6E A;  4EM2 A;  3BPV A;  1Y1W J;  1JT6 A;  4Y3O A;  5F6F A;  2RNJ A;  2LD5 A;  2HVR A;  5LGU A;  2M0M A;  2ELK A;  5E1W A;  1K61 A;  4XOT A;  4AIJ A;  1KU7 A;  4RAY A;  1IXC A;  3CCR I;  2AHQ A;  5E8G A;  3HBL A;  2F4M B;  1VTN C;  2EPF A;  2VXD A;  3E3V A;  1U2W A;  4G9Y A;  4FET A;  4UVC A;  1USS A;  4CCN A;  3ZMV A;  4FT8 A;  4J19 A;  3HOS A;  2LBF A;  2VKV A;  3EUH C;  2CMP A;  2ZME A;  1RUN A;  1DU6 A;  4PJN A;  3P9K A;  2CUZ A;  3QWL A;  1XD7 A;  1VQP I;  3MMY B;  4ENK A;  1DPR A;  4HF0 A;  2O61 A;  1ZRC A;  4CYC A;  5F0H A;  3P7N A;  5M5Y J;  3K4K A;  1E3O C;  3S1R J;  2KKO A;  2F5E A;  2CGP A;  2L7M P;  2QKM B;  1SMT A;  3VOD A;  1G2H A;  2B9S A;  3OIP A;  2X0L A;  3H5R A;  2VPL A;  3IAS 2;  3V7C A;  1Z67 A;  2ZJR F;  2ESH A;  3SYT A;  3BQZ A;  5J1U A;  3KLO A;  5IYD J;  3LMM A;  2A3S A;  4OAY A;  1KQ0 A;  2KFD A;  3M1E A;  4WCG A;  2M5W A;  2W25 A;  3ASO H;  2B7E A;  3FMS A;  2K9N A;  2COB A;  2AO9 A;  3FXQ A;  3JTH A;  1GVD A;  3SQN A;  4M3G A;  4OAZ A;  3A0B C;  4F3Q A;  2R7U A;  1WPK A;  4O5V A;  4P55 A;  5BPD A;  5BMZ A;  3OYD A;  1G6N A;  2HVQ A;  3WGH A;  4BXF A;  3JTG A;  3FM3 A;  3BCA A;  4QSH A;  3F0C A;  4A5M A;  1F4K A;  3ABU A;  5EZH A;  3QOD A;  1WFX A;  2DK8 A;  1SFU A;  4EM1 A;  3E7L A;  3ZQI A;  2EIN H;  2OTL I;  1TTY A;  4AWX B;  2M7B A;  1DP3 A;  1QHG A;  1ORK A;  2E1M C;  3I71 A;  1K4S A;  4MFE A;  4PFO A;  3F8N A;  1OCR H;  2H09 A;  4HDV A;  1WJB A;  2WAF A;  3S14 J;  5EGO A;  1FIA A;  1ZEL A;  2PN6 A;  4XLH A;  2XIG A;  3E0J B;  2L54 A;  3IKV A;  5D4R A;  2VJ5 A;  4EGY A;  2IGK A;  2WY8 Q;  1YW8 A;  1U8B A;  4HF1 A;  1B59 A;  3N05 A;  2QQ8 A;  2H94 A;  3G4S I;  3J81 Z;  3OIO A;  3CC7 I;  1POG A;  4EAT A;  4BE1 A;  1CF7 B;  2NVY J;  2L9R A;  5KVR A;  2JSC A;  3TED A;  2QF7 A;  2CQQ A;  1X3W B;  5KNL A;  2DA5 A;  1MBG A;  1RUO A;  1XDS A;  2H8W A;  3HGY A;  2V1D A;  4CSW A;  4XRF A;  3TDZ C;  1S6L A;  4KUM A;  2BOL A;  2VJI A;  1GXQ A;  3BR5 A;  3PUF A;  4BQQ A;  1TW3 A;  3NAR A;  5EEG A;  4HPQ A;  1F43 A;  3QP6 A;  4UXN A;  4GXO A;  1LUJ B;  2K9L A;  4E7L A;  3ABM H;  1SFX A;  1YE9 A;  2W48 A;  3TQN A;  1ETW A;  2FEZ A;  2EZK A;  2IAI A;  2VJJ A;  3HEF A;  2JZY A;  4A3F J;  3I55 I;  2QKL B;  3SEQ A;  2L4A A;  4RGX A;  1XCB A;  1JUM A;  2DDA A;  1ZGJ A;  4N0B A;  5CVJ A;  3E97 A;  1GLN A;  5F27 A;  4P1W A;  3OS1 A;  1RET A;  2X1E A;  3O6B B;  4HEA 2;  3CP2 A;  1SD4 A;  1Z77 A;  1QZZ A;  1E3P A;  2LF7 A;  3CF5 F;  3T5X A;  4B48 A;  1W36 C;  3WTX C;  1MH4 A;  2VQL A;  4B8X A;  4OIQ F;  3RTR A;  4N4O B;  3PSF A;  4EGZ A;  1ULY A;  3J80 Z;  1KU3 A;  1Y56 A;  3SZG A;  4MGR A;  4P96 A;  2HFH A;  3HKZ A;  2GOX B;  4PFP A;  3AG4 H;  3HUG A;  1DGR M;  2L0K A;  5DCM B;  3BG5 A;  2FBK A;  4BQO A;  5ED4 A;  3CZ6 A;  1DP7 P;  2JMW A;  1ZAO A;  4HST A;  3AG3 H;  1Y6I A;  4G7Z F;  2E1M B;  1W0U A;  1JT0 A;  4Z2Y A;  4UNO A;  1MMN A;  4H0E A;  4Y13 A;  2ZC2 A;  3FK6 A;  4MIM A;  4M3D A;  3EUA A;  3LSH A;  3KYL A;  3G1O A;  3OR1 C;  4UV9 A;  5GPA A;  1Z7U A;  4U0Y A;  4Q5S F;  2ID6 A;  3A01 A;  4ETS A;  3V7S A;  2TCT A;  3VOE A;  4CUG A;  1QU3 A;  3IH2 A;  2IXS A;  4KIG A;  1G3Y A;  1EH7 A;  2UUZ A;  3CCE I;  4RM2 A;  2WAQ N;  1WJE A;  5B3S H;  3W2A A;  1L3L A;  1ETK A;  5JHU A;  4N9H A;  3BJ6 A;  2VC0 A;  2KIQ A;  2CQX A;  2WTE A;  3IAM 2;  1R5H A;  4PJ0 C;  1OPC A;  2P6T A;  2Q1Z B;  3T8R A;  3H9Q A;  1VQ4 I;  2M34 A;  2MSY A;  5D8K B;  1WJD A;  3HTU A;  4LLN A;  1NHA A;  1W1W E;  3L9F A;  1V5E A;  2LSO A;  2O9L A;  2OPT A;  3W2V A;  3K4N A;  1OCO H;  2CFO A;  2GQQ A;  2MA3 A;  2HDW A;  1MJB A;  4DYR A;  2IS1 A;  3CCY A;  2P81 A;  3JRA A; 
#chains in the Genus database with same CATH homology
 3HC7 A;  2X51 A;  3QOE A;  2X1D A;  2LYC A;  1SAU A;  2HPM A;  3VYS B;  2DCE A;  1T95 A;  3DTE A;  3H9G A;  4ZYA A;  2HPI A;  4F92 B;  4ZDP A;  2M4G A;  3K4M A;  3W2W A;  2KRH A;  2MFZ A;  1Z3X A;  3I9V 2;  4XLF A;  4B3X A;  2IGN A;  3OYB A;  1R6R A;  3AFH A;  1K6Y A;  4ZJZ A;  4KIT B;  4BEH B;  2BW3 B;  1N77 A;  3L2R A;  4DBR A;  3HXL A;  3ZGK A;  3F9K A;  4QPQ A;  2UV1 A;  3K4L A;  2IS4 A;  4NQW B;  2HQA A;  2WA0 A;  4U87 A;  2A5W A;  2LBF B;  4F55 A;  3H5N A;  4HSR A;  3OYF A;  5HNH A;  3FHN A;  3RQ4 A;  1P9Q C;  4PSX A;  2OC6 A;  1UG0 A;  1J09 A;  2CW8 A;  3K70 C;  4IQ4 A;  2R7S A;  4RM3 A;  4JQF A;  3CP8 A;  3C2G A;  4JOM A;  4IX7 A;  1IRX A;  4ANJ A;  3DTI A;  4YEJ A;  4PJM A;  1MMD A;  1EA3 A;  3FDY A;  4ZTF A;  2WBM A;  5CPR B;  4AYB A;  4J01 A;  3OYE A;  3FBN B;  2VLA A;  3L2Q A;  3CES A;  2ZXH A;  3EUK L;  3BG7 A;  3AL0 C;  4HRI A;  2KL4 A;  4XLE A;  1BR1 A;  1D1C A;  2X6W A;  2PJR B;  4XKC A;  3OYM A;  1FMV A;  3M8J A;  3VYT B;  2A6T A;  3PSI A;  1YX3 A;  4LIT A;  2E5Z A;  5FRM A;  2NOJ B;  4LIU A;  5HOO A;  2VIX A;  2OV7 A;  1NG6 A;  3LL7 A;  4BJ6 C;  4B47 A;  3OL4 A;  4DOZ A;  3E1S A;  4R79 A;  5HNF A;  4E6K G;  4BAC A;  3TBI A;  3H35 A;  1NG7 A;  2KP6 A;  3J7A Y;  4RLF A;  3S32 A;  2HVS A;  1W36 D;  1LVK A;  2DXI A;  1D1B A;  3W3C A;  4XQF A;  3QYE A;  2KDO A;  2WB1 A;  4C30 A;  1U0J A;  2GOM A;  2V1N A;  3PL8 A;  4FAS D;  4XKV A;  3OYJ A;  3LSK A;  4D1Q A;  4C2T A;  2F5V A;  2JUG A;  2VL8 A;  3KEY A;  4ZDL A;  1UAA A;  1N78 A;  2LY2 A;  1WJ5 A;  3BG6 A;  2E60 A;  3VWB A;  4KIS A;  1WJF A;  3EPZ A;  2L9N A;  2R7O A;  2R7X A;  2MYS A;  1LDK B;  1KON A;  2HZD A;  4PJJ A;  2X85 A;  4CCL A;  4PUS A;  4E7K A;  2IS2 A;  4AVZ A;  1V5F A;  3K10 A;  4XMY A;  4XM3 A;  4BDZ A;  4DGW B;  2KLO A;  2MC4 A;  1MW7 A;  1QHH D;  1TT0 A;  2KHM A;  4II3 A;  4B44 A;  2CV1 A;  3OYN A;  2DOA A;  3S3O A;  2OUM A;  3C2H A;  4HG2 A;  2LRD A;  4MLO A;  4HNT A;  3MKZ A;  1MMA A;  2F6C A;  4ITV A;  2DT7 B;  3OIQ A;  3SDB A;  1S9H A;  2X1C A;  1D1A A;  3PNY A;  1E0E A;  2LY1 A;  2FUG 2;  3DPL C;  4PSW A;  4XR6 A;  2V4J C;  2LH9 A;  2DT6 A;  2JVH A;  2VXZ A;  4H4K C;  3TL4 X;  3VSK A;  3AL0 B;  3ZRG A;  2KRC A;  2ZXI A;  3A2K A;  1LKX A;  1D0Z A;  3DPU A;  1X19 A;  4OWR B;  2XC7 A;  4KJZ A;  3K4C A;  1BR2 A;  2R4G A;  4IKF A;  3KX2 A;  3HUG B;  2XF7 A;  1PYV A;  3OMY A;  3PNV A;  2WAD A;  2CV2 A;  1WJA A;  4CZC A;  4XOR A;  3CMM A;  1T0F C;  2KMU A;  4XLC A;  4DJA A;  2V6E A;  3D5L A;  1DGW Y;  4DBQ A;  4QPO A;  2CH0 A;  4Y3O A;  4BU2 A;  4CCM A;  2LG4 A;  2HVR A;  2M0M A;  3K4B A;  2L9S A;  3DWL E;  4XOT A;  1X4P A;  2Y0S A;  3I3L A;  3DU5 A;  3OL3 A;  5HVQ C;  2VXD A;  3M1C A;  4BEH A;  3QYF A;  5CKT A;  4E7Z A;  2BW3 A;  4FET A;  4BE0 A;  4HNU A;  4PK4 A;  1N75 A;  4CCN A;  2LRE A;  2K3P A;  3DQV C;  2O5R A;  3HOS A;  2ZSH B;  2CW7 A;  2LBF A;  2W00 A;  2Z16 A;  2WAE A;  3DU6 A;  3EUH C;  2CMP A;  3H9J A;  4PJN A;  3OYA A;  2CUZ A;  2DJI A;  3MMY B;  1G59 A;  3L2U A;  4XN0 A;  3CF2 A;  4BS9 A;  2ELJ A;  1BOB A;  3K4K A;  3NWT A;  3OYC A;  2M4K A;  3DKY A;  3VYU B;  2QKM B;  2R7T A;  4G6T B;  2V7F A;  3OIP A;  5CQG A;  3U21 A;  3H5R A;  3ZXS A;  2VPL A;  2VB6 A;  3IAS 2;  2X6X A;  3AKZ A;  2VJ4 A;  4LG3 A;  3SYT A;  3OYL A;  3K70 D;  3S3M A;  3VDX A;  3OOU A;  3LMM A;  4OAY A;  3RCO A;  4YEL A;  3NWS A;  1ERD A;  2M7A A;  2ZSI B;  3FBI B;  1TZL A;  3G2B A;  3L2W A;  2L5Q A;  4BUP A;  2HU9 A;  2R7V A;  2KQR A;  4GRI A;  5JHF A;  3MKY B;  5TGT A;  4BDY A;  4OAZ A;  3ZR8 X;  2E5N A;  4F3Q A;  3DLA A;  4U7B A;  2R7U A;  3D5R C;  2KZV A;  1FMW A;  4BJ5 C;  3ONQ A;  2KPM A;  5LD2 C;  2K5C A;  4XKB A;  5HLT A;  2PJR A;  3OYD A;  4E7I A;  2HVQ A;  4BXF A;  2BVL A;  3BCB A;  3BCA A;  3QOD A;  1WFX A;  3FKJ A;  1DQU A;  2VQC A;  4BJT A;  2RQQ A;  2AQF A;  1BR4 A;  1OR7 C;  4BL0 B;  2IGM A;  2M7B A;  4XOP A;  1DP3 A;  1QHG A;  2E1M C;  2XSJ C;  3OYH A;  4PFO A;  3ZCO A;  4DIQ A;  2R7R A;  1X1B A;  3OYK A;  1PJR A;  1WJB A;  2WAF A;  4CCO A;  1ZEL A;  3OWT A;  4XLH A;  1Z21 A;  3E0J B;  3DEE A;  4J00 A;  4CCJ A;  2VJ5 A;  2IGK A;  2WY8 Q;  4Y33 A;  3N05 A;  4NNJ A;  2R7Q A;  3HG9 A;  3VYR B;  2WAQ A;  1X1A A;  4RMN A;  2R7W A;  4EAT A;  1X1D A;  4BE1 A;  1G8X A;  4II2 A;  2W7N A;  1WJC A;  3VSL A;  2CV0 A;  3BLY A;  5KNL A;  4ZDO A;  3OY9 A;  3MKW B;  2L2O A;  1HA8 A;  3L2V A;  4CA0 A;  4IZZ A;  4XL9 A;  3H0D A;  4N4N B;  2L7K A;  2Z2S B;  3A1Y A;  4RLQ A;  4CSW A;  4P5O A;  1VZ0 A;  2VAS A;  2BOL A;  2VJI A;  4BQQ A;  4HPQ A;  1D0Y A;  3SEZ A;  3V42 A;  2K9M A;  2PMZ A;  2K9L A;  4E7L A;  4C9Y A;  1MND A;  1YE9 A;  4XN3 A;  4E4H A;  3BC8 A;  3RSN A;  4NC7 A;  1Z3Y A;  4E7H A;  2UWM A;  2W1O A;  2ZFU A;  2VJJ A;  3UR3 C;  4F52 A;  2CUJ A;  3IUO A;  4XKW A;  2RNG A;  4AU7 A;  4BGD A;  2BVM A;  2IGO A;  2QKL B;  3SEQ A;  3UNG C;  5KHD A;  3OR2 C;  3LSI A;  4NUB A;  1GLN A;  3OS1 A;  4P1W A;  1JI8 A;  3A4C A;  2X1E A;  2M3A A;  2Z1D A;  4HEA 2;  3CP2 A;  4C2U A;  3QYB A;  2W82 A;  3MD2 A;  2MAB A;  5FRO A;  4B48 A;  1W36 C;  4XNF A;  2VQL A;  3RTR A;  4N4O B;  3PSF A;  3CJQ B;  1Y56 A;  3SZG A;  4D9J A;  4KT6 A;  1SFK A;  3HKZ A;  2XDV A;  2GOX B;  3ZQQ A;  4PFP A;  1V5G A;  4ZTJ A;  2JVG A;  1DGR M;  2W4S A;  5LFA A;  4BQN A;  4BQO A;  1LFP A;  3CZ6 A;  2AQE A;  4HST A;  1MMG A;  3OYI A;  3PJR A;  5FRN A;  2LC2 A;  4IQJ A;  1Y6I A;  2E1M B;  1X4O A;  2X6Y A;  3HPG A;  4CCK A;  3PUB A;  1MMN A;  2RRE A;  2HNH A;  3DTK A;  2IS6 A;  1D0X A;  4NC8 A;  1Z7L A;  4LIV A;  3DPT A;  4XLA A;  3EUA A;  3LSH A;  3KYL A;  2P0W A;  1UEL B;  2VKH A;  3CJR B;  2I8D A;  2V26 A;  3HPH A;  3OR1 C;  2MD0 A;  1AA7 A;  3D5S C;  3IP4 B;  3RPU D;  3GBG A;  4CUG A;  1MNE A;  2LOO A;  1QU3 A;  1YX5 A;  5KCM A;  3LFU A;  2IXS A;  4E7J A;  2XAU A;  2VQH A;  2UUZ A;  4ZC3 A;  3K6G A;  4RM2 A;  4E7S A;  4F93 B;  3S93 A;  3H5A A;  3HL2 A;  1WJE A;  3W2A A;  3OS0 A;  4X0G A;  3DKX A;  4PJL A;  3K4J A;  3TMO A;  4CH7 A;  2VKD A;  2V9K A;  1OLT A;  2CS3 A;  2JSP A;  3S3N A;  2Q2E B;  5CQE A;  4BE2 A;  2XF6 A;  3OS2 A;  3IAM 2;  3PFY A;  3HOT A;  2Q1Z B;  3LSG A;  3H9Q A;  4YRV A;  1WJD A;  2F4I A;  2XF5 A;  3PNT A;  3S8P A;  1V5E A;  1X1C A;  3LSM A;  3W2V A;  4Y4R A;  3K4N A;  4F91 B;  2VQG A;  2CFO A;  4B43 A;  3OYG A;  2JA2 A;  2WY7 Q;  4XON A;  2HDW A;  2IS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...