2E2IJ

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dgtp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2e2iJ00
4RDUA 1XC5A 3F0CA 1A6IA 3JR9A 2XB0X 3BTCA 2NVTJ 2R93J 2AHQA 4D7NA 2MSYA 1RPWA 2LLKA 1MBKA 2PMZN 1TC3C 2OF7A 1ETOA 1GVDA 3LNQA 3CMYA 3S16J 1VFCA 1JGGA 9ANTA 3FK7A 3JREA 2YUSA 3JRHA 2L0KA 2HOTA 3BR2A 2Y30A 1U8BA 3Q3SA 4UUTA 1OFCX 3H0GJ 2R5ZB 1JUSA 2XGEA 3TEDA 2HXOA 4IHYA 1JJ8C 3G1MA 1WCMJ 1GV5A 3Q0VA 5C4XJ 3ZQLA 5FKKA 3HOYJ 2DMNA 4A3LJ 2EZKA 4IHWA 2HI3A 4IHVA 1K83J 3S1RJ 1UHSA 2DA6A 2HOAA 1FTZA 1ZKGA 1P7JA 1FIAA 4JX4A 1MNMC 1JKQC 1ORKA 1IV6A 2JWTA 2Y31A 1JT6A 4BKXA 2VKVA 2WV1A 3JRFA 1WGXA 5EG0A 4HNVA 5K7ZA 2R5YA 2VKEA 1QPIA 3GTOJ 3S1NJ 2Y2ZA 4IHXA 2DMTA 5E3LA 2DA1A 5HODA 5EGOA 4A3KJ 3JRCA 2DTZA 4XK4A 1IDYA 4C3IJ 3PO3J 3S1QJ 1NK3P 2QCOA 2LTPA 3WHBA 3PM1A 5GP9A 4XICA 4M6VA 2XPVA 2XB5A 3JRGA 2L7FP 4I6ZA 1LE8A 1IDZA 1ETKA 2O7OA 4Y7NJ 3LSRA 4V2FA 4DYQA 1BW5A 4FISA 2GLOA 3HM5A 4M3GA 1IG7A 2EZHA 3A03A 2XGDA 5F0HA 2VUMJ 4AC0A 2H1KA 4A3DJ 5FLMJ 1B72A 5IPAA 3SJMA 2DA2A 2LD5A 2NVXJ 1G2HA 1Q1VA 2LK2A 4JX5A 3QPLA 4MLOA 2LY9A 1JKPC 4AUXA 3GTKJ 2GM4A 1TWGJ 2LFBA 3E7LA 2R5YB 3BR0A 2LVSA 1MBEA 2XPWA 1DU6A 5J3LA 2DMUA 1ETYA 2L7MP 3K7AJ 4FTHA 1WH7A 5M3MJ 3S1MJ 5FKNA 1A5JA 2JA5J 3BR1A 2CQQA 4B4CA 3MN2A 5GPCA 5FKOA 2ECCA 4ABZA 3FIWA 1TWCJ 2YU9J 1LFUP 5F1JA 3TP0A 5FLVA 3RZOJ 1FEXA 1T56A 4M3BA 1AKHB 3W6VA 1IRZA 2R0QC 3HOUJ 5J1YA 5EZGA 5IP6A 3HDDA 2Y0SN 2MW8A 5IYBJ 2G0EA 1X58A 1MBFA 4DYCA 4D7MA 1YRNA 1ETWA 2I10A 1QVUA 2DMPA 2JJ7A 2O8KA 2ME0A 2D5VA 2AO9A 2L7ZA 3ZQIA 1AHDP 4A3JJ 2M0CA 2LP0A 2VPRA 1ZR2A 3I4NJ 1ETXA 3HOWJ 1HLVA 2OPTA 1I6HJ 1POGA 4D5FA 1HDPA 4A3CJ 2EZIA 2EH3A 3HGGA 1APLC 1FIPA 4C3HJ 2JA6J 2FJ1A 3RKQA 3JRAA 1AU7A 5JLWA 2TRTA 5M3FJ 1H8AC 1ITYA 3Q0UA 1W0UA 4JX6A 3HB9A 4FE4A 4D5CA 5JLXA 1RETA 3A01A 3BR6A 4LOCA 4MFDA 1ZTRA 3WHCA 5IOYA 2FX0A 1HCRA 2CQXA 2YS9A 2JA7J 1MH4A 3O8HA 3H3VK 2EZLA 5DS9A 4V2GA 5GPAA 1TWHJ 5K7HA 1MBJA 1RR7A 3BQYA 3BG9A 3TP3A 4CYCA 4GFBA 2ZB9A 2E2IJ 5E3NA 4UUSA 2DA4A 3HGYA 1JTYA 5FJ8J 3ZQCA 3FKIJ 3NAUA 1JKOC 4I76A 3BG3A 3OOUA 3IV5A 1GDTA 2H8RA 4EEFG 2ID6A 1NK2P 1U9OA 4IEJA 4MFEA 1ZK8A 1OJLA 3VPRA 3OSGA 1Y1WJ 1F36A 2M2EA 3I4MJ 3O8GA 4DW6A 2KDZA 3RZDJ 4MIMA 3BTJA 1ZR4A 1I3QJ 2XPUA 4A3FJ 3PO2J 4W97A 5M5WJ 3A01B 1PUFA 2O9LA 3M4OJ 3S2DJ 5M5YJ 2CU7A 1QVTA 3G1OA 1B8IA 2IEKA 3SDGA 3RQIA 3CQZJ 3BT9A 2EBIA 1ZQ3P 3OIOA 1UG2A 1RKWA 2FD5A 1IGNA 3CCYA 1VNDA 2LKXA 3HBLA 2JK3A 4CYCB 1VF9A 5J1RA 1H89C 2E19A 3ZQGA 4W1UA 2DMQA 4UUSB 1FTTA 2ID3A 1RESA 2CUEA 3HEFA 4A3EJ 5FKLA 2GBYA 5EG0B 2QF7A 4M3FA 3IH3A 2E1OA 1WI3A 4JP0A 2K9SA 2DN0A 2ELKA 1MBGA 2X9DA 5EGOB 1E3OC 4AYBN 3S14J 1CQTA 1OCPA 4XIDA 2E2HJ 1JTXA 4QSHA 1PUFB 2M34A 5IP7J 3HOXJ 2E2JJ 4Y52J 4XRMA 1LE8B 3GBGA 5F0CA 1ZGWA 2HOSA 5EZHA 2ECBA 1Z0XA 1EF4A 2R92J 5C4JJ 2Y9YA 1BW6A 3GTGJ 5IYCJ 3HKZN 5EEAA 4J19A 4A3IJ 1FJLA 3BR3A 4NDLA 5F27A 1DU0A 2FQ4A 3L1PA 3HOVJ 2CJJA 3TW6A 1D5YA 4FCYA 1B72B 2XGCA 2TCTA 3QQAA 2R5ZA 4QTRA 1K61A 1Y1VJ 5FKMA 1IC8A 3JRBA 3DEWA 3S17J 1ETQA 3BG5A 3LSGA 4M3DA 3C2BA 5J1UA 2NS8A 3IH2A 4MO7A 3NARA 3BQZA 2CRGA 3S15J 1U78A 2W48A 1MBHA 4C3JJ 2NVQJ 4A3GJ 1W0TA 4BY7J 1NTCA 2XRLA 2NS7A 5BNGA 2LR8A 4DYRA 1GT0C 3FK6A 4X6AJ 1JKRC 1IUFA 3B6AA 4FE7A 5C44J 1QRYA 4S0HB 4XRSG 2JN6A 2HDDA 2DA5A 4B3AA 1MSEC 3BR5A 3GTLJ 1ENHA 4C2MJ 4BBSJ 1YRNB 1JUPA 1GUUA 3D1NI 1S7EA 2MGQA 4X1EA 1WH5A 1MSFC 3CDLA 1R9TJ 5IOZA 2K40A 1TWAJ 2N8GA 1LFBA 5M5XJ 2IAIA 2K9QA 3FISA 1F43A 2X6OA 2M8GX 2L9RA 3Q0WA 5DTDA 1HDDC 3S2HJ 1HOMA 2MG4A 2P81A 2RAEA 1XG1A 2X48A 1ETVA 3UKGA 4QIWN 1GV2A 3ZQHA 1X2NA 2WB1N 2NVYJ 2JA8J 1T33A 1IJWC 2EQRA 2JMWA 3A02A 5IYDJ 1BA5A 1VI0A 5E3MA 2CUFA 1JT0A 4A93J 5E3OA 2DA7A 5C3EJ 1SFOJ 2Y9ZA 2DJNA 1WPKA 1Z77A 3MVPA 2NOGA 4A3MJ 3BTLA 4L5EA 2K9NA 5EYRA 2B63J 4B1RA 1X2MA 1OCTC 1UMQA 2XSDC 3MKLA 1BL0A 1AKHA 2HXIA 1SANA 3ZQFA 3JRDA 5IP9J 3JRIA 5F08A 3OSFA 3GTQJ 1JUMA 3LSJA 5F04A 2HQ5A 5K7FA 4M3EA 1BJZA 2WAQN 1TWFJ 2ME6A 4A3BJ 3GTMJ 4JYKA 3M3YJ 1JJ6C 3GTPJ 1H88C 1I50J 3LOCA 1HF0A 1RKTA 1B8IB 2IBDA 3K2AA 2VI6A 4A69C 1O4XA 4DZJA 2M9HA 3QPSA 1U9NA 4XRSA 4BXXJ 4DZPA 3SFIA 3TW7A 3DCFA 3HOZJ 5EF6A 2KT0A 5F0FA 3IH4A 1XS9A 3G1LA 2R7ZJ 2COBA 3ZOBA 3GTJJ 1MH3A 4G12A 2HYJA 3B6CA 3LSPA 3BTIA 4BY1J 4BBRJ 5EDNA 2DA3A 4RBOA 1P7IA
chains in the Genus database with same CATH superfamily
2QSGX 4ON0A 3D5SC 2AQFA 4L18B 3HXLA 4HQMA 4LB6B 3SZPA 2BY1A 2AHQA 2Z2SB 4BS9A 3CCMI 4OIOF 1RPWA 2RVCA 4U0WA 1S9HA 1MBKA 2Z16A 2PMZN 1AA7A 3WE2A 2OF7A 3L7WA 1TC3C 4Y13A 4LK0F 3ZMVA 4C9YA 2EILH 4HEA2 3K4JA 4IOAF 1U6GA 1F4KA 2MFZA 3R0AA 3FXOA 2L0KA 3JRHA 3BJAA 3Q3SA 1H9TA 3VEPA 3LSMA 2LC2A 4UUTA 5HLHA 2E35A 4UXNA 2XAJA 5ICGA 2LF8A 1XMKA 3FBIB 2HXOA 2KP6A 1HBXG 1FLIA 4IXAA 4IHYA 1QZZA 3F8BA 3C2GA 2DOFA 2BVLA 5LGNA 3Q0VA 1ZN2A 3EETA 3ZQLA 3MFKA 3DF8A 1TL8A 3EPZA 3CTAA 2HI3A 4BHBA 2DODA 2HOAA 4DJAA 1FTZA 2V79A 2V6CA 5CLSA 1UZCA 1IN6A 3KYDB 2DW4A 4P5OA 2DDBA 1JKQC 1G3TA 4M9ZA 1HSTA 1IV6A 2GAUA 2JWTA 2V1DA 1BC7C 1WFXA 5LHHA 1UB9A 3LA3A 2VJIA 1ZYRF 4EJUA 5EG0A 2CGPA 2BY3A 3I3LA 1YW8A 4YIIA 4ZYEA 1YW9A 3U1KA 3RJPA 1TQPA 2DA1A 1TTYA 3KP5A 3T8TA 3VDXA 4LLLA 4FQGA 3RKXA 2E1MB 4CSWA 4QWQA 3BJOA 1LNWA 3HL2A 3BY6A 4JOMA 2LTPA 4OMZA 4RAZA 3PM1A 3CCSI 4XICA 2Y0SA 3NRVA 2XPVA 1J2XA 3WE3A 3FDYA 3QU3A 4CICA 4LK1F 1F5TA 1D8JA 3FWEA 2X6YA 3LSRA 3CUOA 4DYQA 3ABKH 1WJBA 4FISA 1U5TA 4PSXA 1GHCA 3F8NA 2L5QA 3HOSA 3QYEA 4U7DA 2JQ7A 2EZHA 3WGHA 2XGDA 5F0HA 3KX2A 3VB2A 2CSOA 2HPIA 4A3DJ 3RQ4A 1KA8A 2QYOA 2DA2A 4NNJA 3N05A 3FM3A 3WTVC 2IGOA 3QPLA 2LY9A 4XBFA 1UG0A 5GADJ 4AD9A 2LFBA 4A6EA 2R5YB 4Y17A 5EJCA 4PJJA 1DU6A 3I56I 1FOWA 3BP8A 4XSZF 5J3LA 1ETYA 1X1AA 2PN6A 3K4BA 4BAYA 3AG3H 3BCAA 2NAZA 3K7AJ 5M3MJ 3S1MJ 5FKNA 1PP7U 2QWWA 2JA5J 3BC8A 1P2FA 2CQQA 4B4CA 2LRDA 1PDNC 1R71A 1KU2A 3OL3A 3ECOA 5A2QK 1Y56A 3I0TA 1IAWA 1YS6A 2YU9J 4I09A 3BG7A 3DQVC 4HW0A 4ENJA 2PX9A 5FLVA 3RZOJ 1KYZA 2E5NA 3E5UA 2L9VA 3IUOA 4KMFA 4D1QA 2QSFX 3GW2A 4FT8A 4Z2YA 5IP6A 1WVRA 1IF1A 5J4VA 1EH6A 2MLKA 4HX8A 2KKOA 2O5RA 2IS1A 1O57A 3DTKA 1X58A 1T38A 2P6TA 4DYCA 4P55A 3C18A 2CW0F 2OV7A 1ETWA 2JJ7A 4LB5A 4LFUA 1AHDP 4D0PA 1D0XA 4DBQA 2W25A 3J81Z 3L2QA 4IOCF 1HLVA 1I6HJ 3DBLB 3OV8A 3WTSC 2V26A 3S8PA 4D5FA 1B9MA 1FBQA 1HDPA 4R8HA 4HA8A 3SEZA 5D8LB 1T95A 4C3HJ 1W7PA 3MQ0A 3HSEA 3CC4I 3S3NA 2ETHA 4HNTA 3Q0UA 1R00A 1LEBA 1W0UA 4JX6A 4FE4A 1YW7A 4D5CA 3AL0C 3FXLA 3K1MA 4PGGA 4AU7A 3A01A 4DBRA 1A35A 2EJRA 3GF2A 4YG2F 3BR6A 4LOCA 5GAGJ 1Z05A 2X85A 1ZTRA 3FMQA 4IRHA 5BQTA 1AWCA 2VN2A 1HW1A 1KQ8A 2J5PA 5IOYA 1LDJA 4HBLA 1W36D 1TT5B 3T5XA 1QU3A 3O8HA 2QGUA 1EA3A 5J40A 3BPXA 1GVJA 2Q2EB 3JSOA 1MBJA 1JHFA 1QQIA 2DK5A 2LG4A 3FXKA 4CYCA 2Q1ZB 4XORA 4Y3OA 1OYWA 3U9GA 2E2IJ 4MQVA 4UUSA 1JKOC 2DA4A 3F6OA 3GFLA 3HRMA 1I39A 3I5UA 4I76A 2ISYA 3BG3A 3IV5A 1GDTA 5BPDA 4CZZA 1U9OA 2M87A 3VPRA 1OJLA 2M3AA 2M2EA 4YEJA 4M6XA 1WKMA 3HUGB 2CWEA 1E3HA 2Y48A 3RZDJ 4MIMA 3GZ5A 2MYSA 2V4JC 5E1WA 3TGNA 2IJLA 3CDIA 2E71A 4CGZA 5GAEJ 4RS8A 1R5HA 3S93A 2IW5A 3CJQB 3S2DJ 2WY7Q 4YIFA 5J6XA 1QPMA 2CU7A 4AIKA 3ESWB 3FF5A 3FHNA 1QVTA 3CDHA 1B9NA 2RNJA 1UG2A 1ZGJA 3CC2I 4KT6A 4OINF 5K1YA 2LKXA 4N9IA 3CC7I 3SXYA 2STTA 2R7VA 2JK3A 3L2CA 4DOZA 5J1RA 3FM5A 5J8FA 2DYRH 3HRUA 2H09A 4W1UA 2FOKA 2Z99A 2MLGA 2ID3A 1LQ1A 3G73A 4V19K 4M9SA 4Q48A 2GBYA 5EG0B 2ZO4A 3IH3A 1WI3A 3GLLA 4HDVA 4HF0A 4JP0A 4LG3A 2EIKH 2LSOA 2A6EF 4KIBA 2JPBA 4PGHA 2ZXWH 5E1ZB 4AYBN 3M1EA 1SEUA 1E3OC 1CQTA 2QQBA 2LY2A 1OCPA 1MDMA 4CCMA 3GZNB 3ZR8X 3HSFA 4LLGF 5E8IA 4QSHA 1PUFB 2M34A 4ESJA 4HG2A 3TOAA 1V3FA 2HYFA 3GBGA 5HS7A 2Y9YA 1T8IA 3LA2A 1U5TB 4XQFA 4BEHA 2ZMEA 1FJLA 1B4AA 1NH3A 1OKRA 1LJ9A 5F27A 3PQKA 3L1PA 3ZXSA 4L9NA 3TW6A 2HQNA 2TCTA 2XAHA 3GCMA 5TISC 1VQ6I 4MEXF 1MMSA 3KCCA 2M1BA 2V1NA 1T39A 3N97A 1BR4A 1FMVA 2Z5UA 4XKVA 4BU2A 3IH2A 5AIQA 2HTSA 2K4BA 4IO9F 2LYCA 4DQ2A 1RUOA 4C3JJ 3L00A 1UFMA 1HKQA 2V9PA 1YJWI 5K5OA 2GWRA 4II3A 2XRLA 5KCMA 1XMAA 5LRSA 1IW7F 1MMNA 4DYRA 3FK6A 5LRRA 4X6AJ 1LDDA 1XGNA 2FA5A 4KICA 4ZYDA 4FE7A 1QRYA 1OYIA 3IWZA 4FHTA 3HYIA 2KIFA 2HDDA 3S3MA 3GTLJ 4R1HA 4C2MJ 3EUKL 4BBSJ 4B43A 3WODF 4IZZA 5IT9Z 1S7EA 1FOKA 4B47A 3I54A 2N8GA 3H1CA 4YELA 1SD4A 1U2WA 1LFBA 2MABA 1D1CA 4PZJA 4RGUA 5D6FA 1BI1A 2L4MA 5CVVA 1OQYA 3H9GA 2WAQA 1HA8A 2VQHA 4EJVA 3S2HJ 3D5LA 1W7PB 5HNFA 1J5YA 4EJTA 1ETVA 2PEXA 3IC7A 4BNCA 1OCZH 2F5VA 3UKGA 1XSVA 4QIWN 2P5KA 1PP8F 1GV2A 4KT5C 3HRSA 3K1NA 5FRMA 4RGRA 1F1ZA 2RC4A 2VKDA 1USSA 3MZ8A 1BI0A 2WB1N 2M30A 3DXJF 3CO6C 5LGUA 2NVYJ 1T33A 4I01A 1O3QA 2EQRA 3ABTA 2XAFA 3A02A 3DPLC 2E7XA 2IA1A 3O6BB 1BA5A 1XSDA 4B09A 3P9IA 3IKVA 2HDCA 3SYTA 1W5CC 1DQUA 2CUFA 3NWSA 3LL7A 5E3OA 2Z33A 2E1MC 4M74A 2PJRB 4J01A 1R1VA 2DJNA 5HDKA 2OCEA 4UB8C 4IRIA 1Z77A 4AIDA 3I58A 1SFUA 3BTLA 1RZ4A 3RCOA 2K9NA 2GQQA 1OYYA 2R7RA 2W1OA 2XSDC 2ZSIB 3JRIA 3ZQFA 3V4GA 3JRDA 1PUEE 4PJLA 5F08A 4HF1A 1JUMA 3LSJA 4HPQA 1D1AA 5K7FA 2IPQX 3FMSA 4D9JA 1V4RA 1TWFJ 4G7OF 3GTMJ 2BVMA 3M3YJ 2FXAA 1S72I 1BIAA 3J7YJ 1VQOI 2NNYA 3R61A 1XCVA 2EV0A 1QZEA 1XGMA 2JVHA 3J7ZI 2NOJB 1O3TA 4H4KC 3TBIA 1K78B 1RI7A 4A69C 2HNHA 3RKYA 3KLOA 4MHGA 5JI6A 2VQCA 3LSIA 1O4XA 2ZNZA 2DOAA 5FFXA 4DZJA 2ZSHB 3TO7A 4CCJA 3F3XA 1S7OA 3ZQ7A 5ILSA 3KE2A 4L0YB 4BXXJ 3P9CA 4HLXA 4BYYA 4IHTA 4ZTFA 2CFOA 4NC6A 4CUGA 1XS9A 1YYVA 4AIHA 4BE2A 4ZTJA 2NNNA 3H5AA 1P92A 3WG7H 3P9KA 4HQEA 3GUDA 3SHFA 2K4JA 1E17A 4G12A 3HJEA 3B6CA 3BTIA 1BI3A 4BQNA 2LY1A 5CKTA 5GTIC 4RDUA 4XOPA 1MDMB 4XMYA 3O3KA 2E60A 2F4MB 2XB0X 3BTCA 2BE5F 4GXOA 3K69A 4BH9A 2FSWA 3C1DA 1IN4A 2VJ5A 2VXDA 3EYYA 3H3ZA 3LAJA 2ACJA 2G9WA 2MD0A 1R58A 3AG4H 3LNQA 3CMYA 3S16J 3QYFA 3F8MA 4IQJA 2QQ9A 1JGGA 4BEHB 3TO6A 4I2OA 2ZMEB 4CCNA 1N77A 1SVOA 1D3YA 3CMMA 2HOTA 2HYGD 3BR2A 4GGGA 4S04A 4XLPF 2A69F 2G7UA 2HVQA 3KIOA 1JUSA 3PSFA 2XGEA 3K4LA 3Q9VA 2X4HA 3TEDA 2MA3A 3PFYA 4HX7A 3CUQA 3V42A 1IO2A 5C4XJ 5DCMA 4NBQA 2Q0OA 4N9HA 2KRCA 3M8EA 2HKXA 5KAFC 2DMNA 4XRFA 2EZKA 1XMXA 3F9KA 4IHVA 4F91B 3T1BA 1D1BA 5CQGA 1FIAA 1WQ2A 1MNMC 4J00A 2MC3A 2Y31A 1X3ZB 1JT6A 1SAUA 5DDGA 2VKVA 2WV1A 2XKOA 3JRFA 4R79A 2XV4S 1BJAA 4XKCA 1X1BA 4BHCA 1UELB 3HG9A 2B0LA 3WTZA 3BPVA 3FXMA 2R5YA 1KU7A 5LEKA 4EM2A 1WJAA 1QPIA 2RQPA 3DPTA 3W2AA 1XB4A 4PCQA 2WTEA 1Z3YA 2D1HA 3VFZA 5DM7F 1G3SA 3QPTA 2KIMA 5EGOA 1RNLA 2ELHA 3OL4A 3QODA 3DKWA 4XK4A 1IDYA 4CH7A 1I27A 2XRNA 2X51A 5LBQA 1WI9A 3IRRA 2ZKZA 5CVIA 4BXUA 2XB5A 3JRGA 4LLNA 2M0MA 2VPLA 4I6ZA 1LPQA 4V2FA 3ROUA 4I0AA 4XL9A 2FMYA 2CW8A 5DUKA 2VBWA 2GLOA 3HM5A 1HXDA 1B72A 3SJMA 2IGKA 5CPRB 2A5YB 3RDIA 2NVXJ 1FY7A 3QOEA 1Q1VA 4MLOA 2CV0A 1OCRH 2ELJA 3GTKJ 2IGNA 3E7LA 3BR0A 3A0BC 4XLCA 1YX3A 1X4PA 4ZH4F 3MKWB 3A4CA 2VL8A 2DMUA 3GFJA 5H2FC 3TMOA 4JBAA 2JRTA 1WH7A 3G2BA 4WXDA 4FTHA 4S05A 1I5ZA 3ZN1A 3SDBA 2Z1DA 5GPCA 5FKOA 2JUCA 2ICWG 1FBUA 1TWCJ 2WA0A 3DLLF 1LFUP 3ZGKA 5F1JA 1IRZA 3K2ZA 3OOPA 1AOYA 1TW3A 1U5TC 2CW7A 3JTGA 3ERED 4WX9A 1WSUA 5J1YA 2CUJA 4FX4A 3J7AO 4PFPA 2YPRA 2A6HF 4WCGA 1K6OA 2QKMB 1EH7A 3OR2C 1MBFA 4EGYA 2Q2EA 3SEQA 5BS6A 1Z1DA 2EWNA 1QVUA 2O8KA 4LJZF 2ME0A 1UHWA 4CDGA 2AO9A 3ZP5A 1K7AA 3TO9A 2VPRA 5D8KB 4E7KA 1ZR2A 1SAXA 2OPTA 3VSKA 2JRMA 5TRDA 4B3XA 2ZJRF 4YRVA 3HGGA 1IV8A 3OIQA 3HUGA 2MBFA 4YFXF 1YX5A 1ZLJA 5JLWA 2TRTA 3HHGA 2KZGA 2RREA 3RSNA 4KUMA 1XPXA 2BXZA 1RETA 5EEHA 2L9SA 5ICFA 3J81K 3UNGC 2A6TA 3M8FA 3CJRB 3B73A 1HCRA 1IRFA 1FOYA 2DPDA 2JA7J 1MH4A 4A5NA 1BBYA 5FLXZ 2EK5A 5JFRA 3OYHA 3H0DA 2VJ4A 4FX0A 4RAFA 2HU9A 3BQYA 1VQ8I 3WGIA 2ZFUA 3HGYA 4WF2A 1JTYA 5FJ8J 2OBPA 1X1DA 2BHYA 3FKIJ 5TJJA 2WC2A 1K4SA 2CQNA 3VYUB 2CFXA 1BOAA 3WU0A 1NK2P 2VOOA 4K2EA 2JPCA 2XHKA 3RYRA 2V1XA 3G6EI 3CCQI 1X19A 3ASOH 3OYAA 2VC0A 3WTTC 2RV8A 4KIGA 1I3QJ 2XF6A 5FRNA 2H6BA 1CGPA 3FMRA 3PO2J 4ZYGA 4N0BA 4Q47A 5ILVA 3MEXA 2KRHA 1T6SA 3CUQB 5H20A 1PUFA 2M7BA 3K6GA 3T8RA 4E7HA 5DCMB 1ZHFA 1B8IA 2IEKA 1GXPA 3RQIA 3CQZJ 2L2OA 1ZQ3P 3BZ6A 3K4KA 2QBYA 4MNUA 2EFNA 1IGNA 2OU2A 1JE8A 3HBLA 4ZDLA 1J9IA 1VQ7I 1H89C 5CVRA 2QUFA 4G7ZF 2DFEA 2JT1A 1FTTA 4YFNF 1RESA 3HEFA 3AG2H 3DPUA 2QF7A 4M3FA 2E1OA 2P7VB 3CZ6A 3SZTA 3MWMA 2B9SA 2ELKA 1W4MA 1MBGA 4BUPA 3ZQQA 4RM2A 2A5WA 5EGOB 2VBXA 1W5TA 3H36A 1Z9CA 3G3ZA 2E2HJ 4A5MA 2I5UA 5IY5H 1ZGAA 2DYSH 3J80Z 1JTXA 3BWGA 1OPCA 5IP7J 2EV6A 3S1NJ 3CP2A 3IWFA 4LD5A 3HOXJ 1ZELA 3FHZA 3F21A 2H1LA 3M1CA 3KP4A 3OS1A 4XNFA 1Z21A 3ELKA 4XRMA 2ZC2A 5E8GA 5F0CA 2IRFG 2HOSA 3LA7A 2ECBA 5EZHA 4ZZLA 2R92J 4HF2A 5HDGA 4RAYA 1Z3XA 3T0YA 5IYCJ 4NHJA 3HKZN 4A3IJ 4J19A 5JVTA 3CCEI 3MZHA 3BR3A 5D5WB 3DKYA 4AIJA 3KZYA 2FQ4A 3PIPF 3COAC 2BGCA 2CG4A 2FOWA 1B72B 3HOVJ 2XGCA 3QQAA 1S5LC 3CCVI 4QTRA 4MGRA 1R4NB 3LFKA 2E5ZA 4U7BA 1QNTA 3JRBA 3DEWA 2PBIA 1X3UA 4G8XA 3LSGA 2FRHA 1VQ5I 3C2BA 5J1UA 1I3AA 2KQRA 4WWCA 3CLQA 2CRGA 4P1WA 2R7QA 4BQQA 3S15J 1MBHA 1VQKI 1R1TA 3E1SA 3TDZC 4CYDA 3IP4B 1ODDA 2NVQJ 4XR6A 4BY7J 2J5OA 1R36A 4UNOA 4PUSA 3HHHA 4B44A 4CHUA 3KEYA 2GXAA 3REOA 4E6KG 3KZIC 1MZBA 2WV0A 4BE0A 1HKTA 4S0HB 2ZMEC 3ABUA 1TW2A 4B3AA 5HOOA 3BR5A 3ONQA 3RIRA 2O8XA 2R7DA 5E20A 2PJRA 1VQMI 1KQ0A 4P9UA 1R1UA 2HZDA 2G7HA 1DPUA 5IOZA 1FBSA 2K40A 3L09A 4L9VA 1E0EA 3GXOA 1HSJA 1YLFA 3UR3C 4AVPA 4YIRX 3Q0WA 1YE9A 2L02A 4CCLA 2CV2A 3RYPA 2V1UA 2RAEA 2K9LA 3I59A 3SQNA 5TGTA 1VQPI 1LKXA 2BZTA 1MW7A 2NRAC 4U0VA 4KDPA 1G6NA 2K27A 1BM9A 1R4MB 1KQ9A 2IA2A 2MH2A 3EUHA 3ZMSA 1K78A 1LVKA 1OCCH 2XIGA 4PJ0C 1RC9A 1J0RA 3H9QA 1REPC 1JT0A 6PAXA 4BQOA 3OY9A 2XSJC 2AS5F 2LDUA 3IAS2 4MTEA 3KP3A 4RB1A 2K3PA 3AG1H 4ENKA 2WY8Q 5E1XA 1D8KA 2CQKA 4A3MJ 2H6CA 5L3EA 2FQ3A 2E34A 5EYRA 3SZGA 2PI0A 3MZYA 4B1RA 1B59A 3IRQA 4HV5A 2YSRA 5AIPA 1AKHA 2HXIA 5LD2C 3GZ6A 4ANJA 4UVCA 3GTQJ 4RB3C 5LEJA 2GA2A 1SFXA 4G9YA 4M3EA 3CJNA 2R3SA 2MH9A 4A6DA 3WGGA 2PMZA 2ME6A 5A2QZ 1F9NA 4JYKA 3FXQA 4XN0A 3KPHA 1XDSA 2M45A 1ZAOA 4L9TA 1Y8RB 2P7CB 3P5JA 1FT9A 3K70C 1JJ6C 3OYEA 1H88C 1I50J 1J09A 3MMYB 1B8IB 1Z6RA 2IBDA 2VI6A 4ZDOA 2XGXA 4CA0A 2QBYB 2LREA 2HFHA 3QPSA 4H0EA 4DZPA 3SFIA 4I0BA 5DV5A 4WXCA 1IN7A 2HPMA 2VJJA 4UV9A 2KT0A 2YU3A 1XTAA 3VYRB 2A68F 2XF7A 4RM3A 1WJ5A 3PFIA 2COBA 4BDZA 3ZOBA 1TT0A 2R4GA 2NXNB 3GTJJ 1XGSA 2L4AA 2HYJA 4O3MA 1IN8A 3WG9A 3LSPA 1D5VA 4BXFA 4BBRJ 2VIXA 1J59A 2GXGA 2AXLA 1P7IA 1VZ0A 4G94A 1XC5A 2P6SA 3F0CA 4L5IA 4RLQA 3NQOA 1B6AA 3DEUA 1ZRDA 3HTUA 2BY0A 5J8CA 2MD5A 4D7NA 2KL4A 1YJNI 2MSYA 5L3GA 1XN7A 1ETOA 5ERIA 1GVDA 3ABLH 5E18F 1VFCA 2STWA 2DT7B 3FK7A 5LLQA 2YUSA 1WJDA 4LGWA 1IUYA 1NG7A 2R7TA 3V7SA 1U8BA 3BDDA 4PK4A 3C3WA 2ZFWA 3H0GJ 2Z3YA 4XLAA 3PNTA 1HQCA 3G1MA 3X2QH 1WCMJ 4KFCA 5CJ9A 2HVRA 3O2PE 4KMUX 5L3DA 5D5UB 4IHWA 1R5GA 1WHUA 1MGTA 2M7AA 1K83J 1MNEA 3S1RJ 2V7FA 1UHSA 2A61A 4IQ4A 2EA4A 1ACIA 1ZKGA 1P7JA 2Z9OA 2KZVA 3CESA 3QU6A 1PJRA 4BL0B 4PJNA 5IT3A 5LGTA 3KP2A 2KMUA 1WGXA 2L7KA 5FD5A 1FNNA 1J75A 3BZCA 4OAYA 4BJTA 3GFMA 2Y69H 3V8LA 3DBRB 3NEUA 2A3SA 2QENA 1IRGA 2DMTA 5E3LA 1DUXC 5HODA 4A3KJ 3JRCA 2DTZA 3CUQC 3GFIA 2IVMA 1MMAA 4C3IJ 3PO3J 3S1QJ 1G8XA 3TDUC 5F1RA 4RMNA 3A0HC 2QCOA 1WRJA 2DFHA 2YX7A 2IS2A 5GP9A 1ZREA 4M6VA 4ZYAA 3K9TA 2ZNYA 5ICCA 3CMEI 1LE8A 1O7LA 3JAMK 4HV6A 1ETKA 3I55I 4MQ9F 4GDFA 2PMHA 1N25A 2V9KA 4UVBA 3Q5FA 1BW5A 2LKSA 3I59B 2P0WA 4XLEA 3HOTA 1SD5A 3F72A 2F4IA 1IXSB 4A12A 2VUMJ 1XDUA 2NVUB 2H1KA 3BG6A 3I53A 5FLMJ 3JTHA 5IPAA 2WAEA 1LDKB 3JCUC 1G2HA 4JX5A 2LK2A 1JKPC 3E6DA 1P6RA 1X1CA 3DBHB 3FXJA 3BJ6A 4AUXA 1TWGJ 5FB2A 3CF5F 2LVSA 4IF4A 1IZ1A 2PFBA 4Q4ZF 2V6EA 2OZUA 5FFZA 2P4WA 2K5CA 3C7JA 2F48A 2IGMA 2HQRA 3DWLE 3VYSB 1MNDA 2VASA 3I9V2 4OWRB 2ECCA 2K7LA 5KAIC 3L2UA 1I1GA 3I4PA 1FYMA 2DJIA 3VOEA 4CCOA 5BMZA 2F5EA 3ZRGA 1FEXA 4M72A 4GCVA 2RGVA 1AKHB 1TQIA 2I8DA 3GMEA 4M3BA 5B1BH 3RPQA 4EQQA 2R0QC 3W6VA 4OU0A 3HOUJ 2DXIA 3F6VA 2F4OB 3GWZA 5EZGA 1WJFA 4UB6C 2M4KA 4OMYA 3KLNA 2Y0SN 2MW8A 5IYBJ 2G0EA 2VQLA 3W2WA 2I10A 2DMPA 4KN4X 2XASA 3BOQA 2D5VA 3OS2A 2R7SA 2L7ZA 3ZQIA 5HNHA 4A3JJ 2M0CA 2LP0A 5K5RA 3I4NJ 1ETXA 3HOWJ 4IKFA 2AXTC 1POGA 3C2HA 5F64A 1EH8A 2F5DA 4A3CJ 2IT0A 4HLYA 2HS5A 3OYJA 1VQNI 1FIPA 1MMDA 3QPHA 2JA6J 2FJ1A 3H5RA 3PQJA 3JRAA 3EYIA 2BOLA 3OWTA 2QSHX 5M3FJ 1H8AC 1ITYA 3RTRA 1SFKA 1D0ZA 2F2EA 1DPRA 1T2KA 1SMTA 4MFDA 2DT5A 3ABMH 1Y6IA 3KEQA 4ETSA 4I02A 2FX0A 3LMMA 2CQXA 2YS9A 3I64A 4Y15A 2FMLA 3OYFA 3FKJA 3K4NA 4V2GA 3OYMA 2JVGA 4UY8I 3OYLA 2CH0A 3V8JA 1OR7A 3MKYB 3BG9A 3ERMA 1VQLI 4GFBA 4ESFA 2ZB9A 1YG2A 5JHFA 2GXBA 1FP1D 3U21A 4EEFG 4HZFA 1YHQI 1UAAA 2R7OA 4IEJA 4AYBA 4DIQA 1ZK8A 3OSGA 1S6LA 4P96A 4G6QA 4A0ZA 1F36A 1Y1WJ 4II2A 3CCLI 3EDPA 2QZ8A 5KK1A 4DW6A 4FASD 3CCUI 1UHMA 1A31A 1ZR4A 2HQAA 1G59A 5FLXK 1BR2A 1TP4A 4EGZA 2XPUA 4A3FJ 3G4SI 1JXSA 2VBYA 1CF7B 1SD7A 1ZG1A 1ZLKA 1M1EB 3CMAI 1HW5A 3OS0A 2A07F 2LOOA 1A6QA 3DU6A 1L0OC 4QLCU 2W85A 3G1OA 4BACA 2LBFA 4HYEA 1LVAA 2CS3A 3IKTA 2EBIA 2IS4A 3K1PA 3CCYA 4DGWB 2VXZA 1YIJI 1VNDA 2L3DA 4KNYA 2R7WA 1NG6A 3IL2A 2GIVA 5FROA 2E19A 3ZMDA 3ZQGA 1YI2I 2DMQA 1FPQA 3HTSB 2XAUA 4G6DA 2CUEA 3LWFA 5FKLA 2DK8A 4F7ZA 4G7HF 3R6SA 1YFHA 1S29A 4F52A 2M8EA 2E1CA 4EATA 1P4WA 2OTJI 2K9SA 1DP3A 2K3FA 2ZJPF 4JK1X 1XGOA 5KVRA 2R7FA 1TQMA 5L3FA 4QPQA 2DTRA 4L9JA 4EJOA 2DBBA 3AAFA 2X1DA 2KISA 2OAZA 3LSHA 3ECHA 3VODA 3K10A 4Y52J 1Y0NA 5LHGA 1QBJA 3QRFF 3MCZA 1TLHB 1I6XA 1ZGWA 1LE8B 1EF4A 1Z0XA 4ZC3A 2HKOA 5C4JJ 1BW6A 3S3OA 5BOXA 2VE8A 1T98A 5EEAA 4XONA 2XF5A 3TKYA 4E4HA 3U1DA 1BN5A 2P8TA 4KYWA 5E17F 2OZ6A 1DU0A 3WTYC 2NS0A 1WWXA 1FP2A 2QA4I 4FCYA 2OC6A 1D5YA 4C2TA 3MD2A 5LHIA 4ENMA 2R5ZA 2OQRA 2L9NA 3J80K 1XCBA 5HVQC 1RUNA 5EEGA 1ETQA 5JVGF 3BG5A 2E36A 2EIMH 1V5FA 1XSXA 4M3DA 4I99C 3WTXC 2ZXHA 4MO7A 2W48A 5E79C 4KISA 1FZPB 5HS9A 3QAHA 4ESBA 1W0TA 2TDXA 3DV8A 1IXRC 1UCRA 3H9JA 4NC8A 2NS7A 1LB2A 5BNGA 2L54A 2KJCA 2DCEA 4XLFA 2LR8A 2P5LC 2VE9A 1GT0C 4KA4A 3CO7C 3LSKA 4BQAA 1JKRC 2VOPA 3B6AA 5C44J 4Y33A 3SFZA 1LUJB 1HC8A 4OIPF 2EB7A 4HOBA 2O03A 4M9XA 4RGSA 3GLXA 1ENHA 1MJAA 5L3CA 1QO0D 2HDWA 1JUPA 2BHZA 4E7IA 2W24A 2FU4A 2JSCA 1MIJA 3M9AA 1GUUA 3D1NI 4GYGA 1DGRM 3K4MA 4X1EA 1MSFC 3CDLA 1R9TJ 2GIZA 4XKWA 3OYKA 3U2RA 1FYKA 3S32A 2DFIA 4Y4RA 4RB0A 3ZCOA 5M5XJ 1A36A 1R5ID 5JR3A 3FISA 1YIOA 5DEQA 2X6OA 3NWTA 2L9RA 1V55H 4LG0A 1U8RA 2EIJH 1HOMA 1TZLA 2P81A 2X48A 2EA2A 4M71A 5JHUA 3PIOF 4EV0A 2OD5A 5CVUA 3QWLA 2GZWA 2YR2A 3QYBA 5FD6A 2HGCA 1Z7LA 1V54H 1X2NA 5CYVA 2JA8J 3L2RA 2LF7A 2YX4A 2PMUA 3RPUD 4WK8F 1X4OA 1VTNC 4IPAA 3QP6A 4HDUA 3LFUA 2CO5A 4M73A 5E3MA 3AFHA 1UJ8A 2DA7A 5C3EJ 3R4KA 1SFOJ 1LFPA 2W00A 3M07A 4M6YA 3MVPA 3F23A 1FMWA 2GA1A 1Z6TA 1T08B 3HIFA 1KU3A 1X2MA 1W36C 1UMQA 3RPUA 3OYDA 1PYVA 1RR8C 1Z7UA 3MKLA 1BL0A 1SANA 3HZJA 1XX5A 1O7FA 3OSFA 2XAGA 3F8CA 2K9MA 4I7HA 2W4SA 5F04A 2HQ5A 1VQ9I 2E1NA 2EFPA 4PFOA 4NQWA 1K4TA 3HRTA 2VBZA 2WAQN 4A3BJ 3FXUA 3EUHC 1LEAA 4NC7A 1Z67A 2OCCH 3E3VA 2CYYA 2RDPA 3CP8A 1YQAA 1ZRCA 2K85A 3LOCA 2DQLA 2IXSA 1RKTA 3DEEA 2LBFB 3K2AA 4L5JA 5HS8A 2R7XA 1BC8C 4UUVA 4HAMA 3OR1C 1FSEA 4YFKF 2KFDA 3F22A 3DCFA 2ZXIA 2O3FA 1S3JA 5D4SA 2ESHA 2BXYA 5EF6A 3CCRI 5F0FA 3IH4A 2RKHA 4Q5SF 3G1LA 3DFGA 3PUFA 2CV1A 2VLAA 1ULYA 3EQLF 3R0JA 2F6CA 3V7RA 2KIUA 5CVJA 3K0LA 2PG4A 1DP7P 4RA2A 2BV6A 1ZG5A 4ZJZA 3PJRA 2DA3A 4XIDA 1W7PD 1A6IA 3JR9A 3DTIA 3CCJI 5H6QA 1XD7A 1KZHA 2NVTJ 2R93J 2E7WA 3J7AY 4IX7A 2RNGA 2PLYA 2FEZA 2LLKA 3E6CC 1ZH5A 3ISPA 2Q8KA 9ANTA 3JREA 1R7JA 3H92A 3KP6A 2IP2A 2QKLB 4XN3A 2XROA 2X1CA 3W6KB 2Y30A 3WTWC 1OISA 1USTA 2F5CA 1OFCX 3GVAA 5LFAA 2R5ZB 1FC3A 4KITB 2JTVA 3PNYA 3PSIA 1JJ8C 3N4MA 2O61A 1GV5A 4A0XA 2Y0MA 4FETA 3LAPA 2PJPA 2UZKA 1EV7A 5FKKA 3HOYJ 3KP7A 4A3LJ 2C6YA 1KONA 2H94A 2DA6A 2DQRA 4E7LA 4JX4A 2QQAA 4HX4A 1R22A 2KRFA 4KN7X 1ORKA 3H35A 1E2XA 4RBOA 2X6WA 4BDYA 3PNVA 3S2WA 4BKXA 4A0YA 1FX7A 3E5XA 4O6JA 5F6FA 5HLIA 1O3RA 4CO8A 5IT9K 2X0LA 3M7GA 2ADUA 3A1YA 3RKWA 4OOIA 2K86A 4HNVA 5K7ZA 2VKEA 4GRIA 1TNTA 2OJED 4IVNA 1FWZA 2M5WA 1HKSA 3QP5A 3CJTB 2W84A 4ZDPA 4EM0B 2Y2ZA 4GYIA 5D4RA 2H27A 4F92B 2XVCA 4IHXA 1Z91A 5ILUA 3OYCA 1H9GA 4OAZA 1YITI 2XDVA 4AWXB 5D5XB 3E6BA 1NK3P 3WU1B 3FX3A 1SD6A 1JI8A 5DD8A 3WHBA 1Y8QB 2DFFA 3MKZA 2L7FP 2WAFA 3OYBA 5KHDA 1SMYF 2FNPA 4BJ6C 1IDZA 2O7OA 4LG0B 4Y7NJ 4LIVA 4B48A 1MJBA 2CMPA 2DO7A 2WBMA 3DP7A 3E5QA 4M3GA 4BGDA 1IG7A 3KZZA 3A03A 4ZYHA 3E97A 4AC0A 2RN7A 2UUZA 4IJAA 2ZBKA 1SVLA 1I1SA 2LD5A 2AQEA 2GM4A 2ZJQF 2OTLI 3CF2A 1MBEA 2XPWA 1SVMA 3V8KA 4TV7A 4EM1A 4U88A 2HEOA 2L7MP 2D1VA 2UXNA 3OYIA 4A2UA 1QA6A 4XSXF 3L2VA 1A5JA 3BR1A 1ZRFA 3MN2A 5CQEA 5L3BA 4E7ZA 1A04A 4ABZA 2PQ8A 3FIWA 1IXCA 2FE3A 3WTUC 3TP0A 3OIPA 1T56A 4AM3A 4QPOA 2F5FA 5DYMA 1S8NA 1KGSA 4EJWA 2OUMA 1BI2A 1MD0A 3HDDA 3HSRA 3KYCB 2JSPA 2NYXA 3CD6I 4NQWB 3W6JB 2DU9A 5D6EA 4GO1A 3OYNA 4D7MA 1YRNA 4KJZA 5HDNA 2BW3A 3GO5A 3TQNA 2B7EA 1MJ9A 2ZCWA 3VYTB 1C0WA 2EZIA 4AVZA 2EH3A 1YJ9I 1APLC 4PDKA 3RKQA 1AU7A 2UV1A 4NUBA 4LMYA 1CF7A 2HZTA 3HB9A 5JLXA 2VT2A 4E70A 2DT6A 2CUZA 2RQQA 3WHCA 4ENNA 2XAQA 4HRIA 2W82A 2L01A 2O0YA 3DKXA 4XOTA 4WXHA 1PVEA 1YS7A 2ZJ2A 5FGMA 3Q9SA 3H3VK 2EZLA 4UV8A 1K79A 5DS9A 4X0GA 5GPAA 1TWHJ 2K02A 5K7HA 2EFOA 3F8FA 4NB5A 1RR7A 4LIUA 3TP3A 3L2WA 1EJ9A 3W3CA 4L0ZB 1OCOH 5E3NA 1DDNA 2GOXB 4OIQF 3ZQCA 1JHHA 2EV5A 2FBIA 3JW4A 3NAUA 2D45A 3OOUA 2H8RA 3BZKA 2ID6A 4KIFA 1FSHA 1FYLA 4MFEA 3K70D 1QHHD 1R49A 3FXRA 2BBYA 3LQRA 5HLGA 4XLHA 3H3UA 3I4MJ 2LKPA 1ONVA 3O8GA 2QVOA 2KDZA 3GTOJ 1V5EA 5J47A 3BTJA 1S7AA 3E0JB 2DAOA 2KDOA 3DTEA 4IRGA 5B66C 4W97A 1ZG3A 2JUGA 5M5WJ 3TL4X 3V7CA 3M8JA 3A01B 3GEZA 2O9LA 3M4OJ 1G4DA 3HKZA 5M5YJ 2DDAA 2FBHA 3ASNH 5ED4A 1FOXA 2HTJA 3SDGA 3BT9A 1N78A 3LSTA 3OIOA 1MMGA 5DUIA 2QQ8A 1RKWA 2DPUA 2FD5A 1H0MA 1WJEA 1OR7C 5K5QA 1BIBA 2V9VA 4UHTA 5FO5A 4RGXA 4RB2C 1YTYA 4G6TB 3G71I 5AONA 2CQ7A 4CYCB 1VF9A 2FNAA 4F55A 1D0YA 2UXXA 1X3WB 4UUSB 4UVAA 4A3EJ 4C30A 3IHUA 4RLFA 1RIOH 2R7UA 3I71A 3JSPA 1U3EM 4IHSA 1YOVB 2IS6A 2VONA 3ML6A 2KHMA 4ASNA 1Y39A 2DN0A 2X9DA 3FBNB 5D5VB 2QEXI 2FF4A 3S14J 4C2UA 2XC7A 1WJCA 2BEOA 2OQGA 1U0JA 4DNCA 1HW2A 3VWBA 2EFWA 3ZPLA 2WADA 2E2JJ 2X1EA 5HLTA 2UWMA 1QGPA 1IN5A 1E3PA 3DU5A 3OMYA 4PSWA 4XKBA 4OIRF 2O6GE 1ERDA 3GTGJ 2COMA 3KYLA 2IA0A 4BJ5C 2Y75A 4NDLA 3ZMUA 2JA2A 2CJJA 1IRXA 4E7JA 2ESNA 5J4YA 2EFQA 1K61A 1Y1VJ 1OMIA 5FKMA 4B8XA 3ULQB 1ZARA 1IC8A 3S17J 1STZA 4MEYF 5DCFA 1RRJA 5GTHC 3ZN0A 2OA4A 2XKPA 3KFWX 2NS8A 1T0FC 2EINH 3NARA 1K6YA 2VT3A 3B02A 3BLYA 1R23A 3BQZA 3KEOA 5GAHJ 4LITA 3L9FA 1BR1A 1EKEA 3AKZA 2WWYA 3IAM2 1U78A 3D5RC 3FZVA 4A3GJ 2MC4A 4XM3A 1NTCA 5ICEA 4F3QA 2P5VA 3AL0B 2VKHA 2FBKA 2KLOA 2HOEA 1IUFA 4XLNF 4XRSG 2JN6A 2DI3A 2FUG2 2A05A 3RI4A 2DA5A 2HVSA 3PUBA 1MSEC 3CLOA 4BHPA 1YRNB 3EUAA 3ZMTA 1V5GA 2MGQA 1WH5A 2BW3B 3WU2C 3PL8A 1GLNA 1TWAJ 3D0SA 4HSRA 2VB6A 4P9FA 1MKMA 1W1WE 1X1PA 2IAIA 3DLAA 2K9QA 3A2KA 1F43A 5DTDA 2M8GX 1HDDC 2JZYA 2D2WA 3H5NA 4CCKA 2BY2A 1G3YA 2MG4A 1XG1A 2H8WA 2DLLA 1N75A 1SFEA 3OYGA 2HWVA 2QLZA 3ZQHA 2VODA 1IJWC 4O5VA 2EPFA 1J7KA 2JMWA 3P7NA 3JAMZ 4EMSA 4U0YA 5IYDJ 3GX4X 1VI0A 2QM3A 1WZ2A 2BYVE 4A93J 1ON1A 4I98B 2Y9ZA 2LH9A 3ZMZA 1KU9A 4JQFA 5B3SH 2KPMA 1WPKA 1JGSA 2NOGA 1OLTA 4HSTA 4L5EA 4MTDA 1Y0UA 2B63J 1P4AA 2M4GA 1OCTC 3HPHA 3HPGA 2W57A 1VQ4I 3MAJA 1TNSA 5IP9J 3HC7A 3W2VA 1DGWY 2DOEA 1W5SA 2ISZA 5BPIA 1B1BA 2VC1A 3E6MA 1SC7A 2GOMA 4N4NB 1P9QC 4N4OB 1R6RA 1T0FA 5B5EC 3K4CA 1BJZA 1NHAA 4PJMA 4BE1A 5H6RA 1TBXA 2VQGA 2ZXJA 2KIQA 3GTPJ 4E7SA 1P4XA 3QOPA 2LMDA 1L3LA 1HF0A 4CZCA 5B1AH 1KYWA 4Z6YA 2M9HA 4U87A 1QHGA 4HNUA 1O3SA 1U9NA 3KETA 4RAGA 4XRSA 2XUBA 3TOBA 3TW7A 1Q1HA 4F93B 3HOZJ 4IL6C 3VSLA 2HR3A 4ITVA 3LQQA 2X6XA 3GYHX 1YO5C 2R7ZJ 3R60A 2KJBA 3BCBA 1GXQA 4EVIA 4CXFA 5KNLA 2W7NA 1G3WA 4ZZDA 1QZYA 1MH3A 1ON2A 2LNBA 1BOBA 3BROA 4BY1J 5EDNA 5DM6F 2WB1A 5DD4A
chains in the Genus database with same CATH topology
4RDUA 1XC5A 3F0CA 1A6IA 3JR9A 2XB0X 3BTCA 2NVTJ 2R93J 2AHQA 4D7NA 2MSYA 1RPWA 2LLKA 1MBKA 2PMZN 1TC3C 2OF7A 1ETOA 1GVDA 3LNQA 3CMYA 3S16J 1VFCA 1JGGA 9ANTA 3FK7A 3JREA 2YUSA 3JRHA 2L0KA 2HOTA 3BR2A 2Y30A 1U8BA 3Q3SA 4UUTA 1OFCX 3H0GJ 2R5ZB 1JUSA 2XGEA 3TEDA 2HXOA 4IHYA 1JJ8C 3G1MA 1WCMJ 1GV5A 3Q0VA 5C4XJ 3ZQLA 5FKKA 3HOYJ 2DMNA 4A3LJ 2EZKA 4IHWA 2HI3A 4IHVA 1K83J 3S1RJ 1UHSA 2DA6A 2HOAA 1FTZA 1ZKGA 1P7JA 1FIAA 4JX4A 1MNMC 1JKQC 1ORKA 1IV6A 2JWTA 2Y31A 1JT6A 4BKXA 2VKVA 2WV1A 3JRFA 1WGXA 5EG0A 4HNVA 5K7ZA 2R5YA 2VKEA 1QPIA 3GTOJ 3S1NJ 2Y2ZA 4IHXA 2DMTA 5E3LA 2DA1A 5HODA 5EGOA 4A3KJ 3JRCA 2DTZA 4XK4A 1IDYA 4C3IJ 3PO3J 3S1QJ 1NK3P 2QCOA 2LTPA 3WHBA 3PM1A 5GP9A 4XICA 4M6VA 2XPVA 2XB5A 3JRGA 2L7FP 4I6ZA 1LE8A 1IDZA 1ETKA 2O7OA 4Y7NJ 3LSRA 4V2FA 4DYQA 1BW5A 4FISA 2GLOA 3HM5A 4M3GA 1IG7A 2EZHA 3A03A 2XGDA 5F0HA 2VUMJ 4AC0A 2H1KA 4A3DJ 5FLMJ 1B72A 5IPAA 3SJMA 2DA2A 2LD5A 2NVXJ 1G2HA 1Q1VA 2LK2A 4JX5A 3QPLA 4MLOA 2LY9A 1JKPC 4AUXA 3GTKJ 2GM4A 1TWGJ 2LFBA 3E7LA 2R5YB 3BR0A 2LVSA 1MBEA 2XPWA 1DU6A 5J3LA 2DMUA 1ETYA 2L7MP 3K7AJ 4FTHA 1WH7A 5M3MJ 3S1MJ 5FKNA 1A5JA 2JA5J 3BR1A 2CQQA 4B4CA 3MN2A 5GPCA 5FKOA 2ECCA 4ABZA 3FIWA 1TWCJ 2YU9J 1LFUP 5F1JA 3TP0A 5FLVA 3RZOJ 1FEXA 1T56A 4M3BA 1AKHB 3W6VA 1IRZA 2R0QC 3HOUJ 5J1YA 5EZGA 5IP6A 3HDDA 2Y0SN 2MW8A 5IYBJ 2G0EA 1X58A 1MBFA 4DYCA 4D7MA 1YRNA 1ETWA 2I10A 1QVUA 2DMPA 2JJ7A 2O8KA 2ME0A 2D5VA 2AO9A 2L7ZA 3ZQIA 1AHDP 4A3JJ 2M0CA 2LP0A 2VPRA 1ZR2A 3I4NJ 1ETXA 3HOWJ 1HLVA 2OPTA 1I6HJ 1POGA 4D5FA 1HDPA 4A3CJ 2EZIA 2EH3A 3HGGA 1APLC 1FIPA 4C3HJ 2JA6J 2FJ1A 3RKQA 3JRAA 1AU7A 5JLWA 2TRTA 5M3FJ 1H8AC 1ITYA 3Q0UA 1W0UA 4JX6A 3HB9A 4FE4A 4D5CA 5JLXA 1RETA 3A01A 3BR6A 4LOCA 4MFDA 1ZTRA 3WHCA 5IOYA 2FX0A 1HCRA 2CQXA 2YS9A 2JA7J 1MH4A 3O8HA 3H3VK 2EZLA 5DS9A 4V2GA 5GPAA 1TWHJ 5K7HA 1MBJA 1RR7A 3BQYA 3BG9A 3TP3A 4CYCA 4GFBA 2ZB9A 2E2IJ 5E3NA 4UUSA 2DA4A 3HGYA 1JTYA 5FJ8J 3ZQCA 3FKIJ 3NAUA 1JKOC 4I76A 3BG3A 3OOUA 3IV5A 1GDTA 2H8RA 4EEFG 2ID6A 1NK2P 1U9OA 4IEJA 4MFEA 1ZK8A 1OJLA 3VPRA 3OSGA 1Y1WJ 1F36A 2M2EA 3I4MJ 3O8GA 4DW6A 2KDZA 3RZDJ 4MIMA 3BTJA 1ZR4A 1I3QJ 2XPUA 4A3FJ 3PO2J 4W97A 5M5WJ 3A01B 1PUFA 2O9LA 3M4OJ 3S2DJ 5M5YJ 2CU7A 1QVTA 3G1OA 1B8IA 2IEKA 3SDGA 3RQIA 3CQZJ 3BT9A 2EBIA 1ZQ3P 3OIOA 1UG2A 1RKWA 2FD5A 1IGNA 3CCYA 1VNDA 2LKXA 3HBLA 2JK3A 4CYCB 1VF9A 5J1RA 1H89C 2E19A 3ZQGA 4W1UA 2DMQA 4UUSB 1FTTA 2ID3A 1RESA 2CUEA 3HEFA 4A3EJ 5FKLA 2GBYA 5EG0B 2QF7A 4M3FA 3IH3A 2E1OA 1WI3A 4JP0A 2K9SA 2DN0A 2ELKA 1MBGA 2X9DA 5EGOB 1E3OC 4AYBN 3S14J 1CQTA 1OCPA 4XIDA 2E2HJ 1JTXA 4QSHA 1PUFB 2M34A 5IP7J 3HOXJ 2E2JJ 4Y52J 4XRMA 1LE8B 3GBGA 5F0CA 1ZGWA 2HOSA 5EZHA 2ECBA 1Z0XA 1EF4A 2R92J 5C4JJ 2Y9YA 1BW6A 3GTGJ 5IYCJ 3HKZN 5EEAA 4J19A 4A3IJ 1FJLA 3BR3A 4NDLA 5F27A 1DU0A 2FQ4A 3L1PA 3HOVJ 2CJJA 3TW6A 1D5YA 4FCYA 1B72B 2XGCA 2TCTA 3QQAA 2R5ZA 4QTRA 1K61A 1Y1VJ 5FKMA 1IC8A 3JRBA 3DEWA 3S17J 1ETQA 3BG5A 3LSGA 4M3DA 3C2BA 5J1UA 2NS8A 3IH2A 4MO7A 3NARA 3BQZA 2CRGA 3S15J 1U78A 2W48A 1MBHA 4C3JJ 2NVQJ 4A3GJ 1W0TA 4BY7J 1NTCA 2XRLA 2NS7A 5BNGA 2LR8A 4DYRA 1GT0C 3FK6A 4X6AJ 1JKRC 1IUFA 3B6AA 4FE7A 5C44J 1QRYA 4S0HB 4XRSG 2JN6A 2HDDA 2DA5A 4B3AA 1MSEC 3BR5A 3GTLJ 1ENHA 4C2MJ 4BBSJ 1YRNB 1JUPA 1GUUA 3D1NI 1S7EA 2MGQA 4X1EA 1WH5A 1MSFC 3CDLA 1R9TJ 5IOZA 2K40A 1TWAJ 2N8GA 1LFBA 5M5XJ 2IAIA 2K9QA 3FISA 1F43A 2X6OA 2M8GX 2L9RA 3Q0WA 5DTDA 1HDDC 3S2HJ 1HOMA 2MG4A 2P81A 2RAEA 1XG1A 2X48A 1ETVA 3UKGA 4QIWN 1GV2A 3ZQHA 1X2NA 2WB1N 2NVYJ 2JA8J 1T33A 1IJWC 2EQRA 2JMWA 3A02A 5IYDJ 1BA5A 1VI0A 5E3MA 2CUFA 1JT0A 4A93J 5E3OA 2DA7A 5C3EJ 1SFOJ 2Y9ZA 2DJNA 1WPKA 1Z77A 3MVPA 2NOGA 4A3MJ 3BTLA 4L5EA 2K9NA 5EYRA 2B63J 4B1RA 1X2MA 1OCTC 1UMQA 2XSDC 3MKLA 1BL0A 1AKHA 2HXIA 1SANA 3ZQFA 3JRDA 5IP9J 3JRIA 5F08A 3OSFA 3GTQJ 1JUMA 3LSJA 5F04A 2HQ5A 5K7FA 4M3EA 1BJZA 2WAQN 1TWFJ 2ME6A 4A3BJ 3GTMJ 4JYKA 3M3YJ 1JJ6C 3GTPJ 1H88C 1I50J 3LOCA 1HF0A 1RKTA 1B8IB 2IBDA 3K2AA 2VI6A 4A69C 1O4XA 4DZJA 2M9HA 3QPSA 1U9NA 4XRSA 4BXXJ 4DZPA 3SFIA 3TW7A 3DCFA 3HOZJ 5EF6A 2KT0A 5F0FA 3IH4A 1XS9A 3G1LA 2R7ZJ 2COBA 3ZOBA 3GTJJ 1MH3A 4G12A 2HYJA 3B6CA 3LSPA 3BTIA 4BY1J 4BBRJ 5EDNA 2DA3A 4RBOA 1P7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RDU A;  1XC5 A;  3F0C A;  1A6I A;  3JR9 A;  2XB0 X;  3BTC A;  2NVT J;  2R93 J;  2AHQ A;  4D7N A;  2MSY A;  1RPW A;  2LLK A;  1MBK A;  2PMZ N;  1TC3 C;  2OF7 A;  1ETO A;  1GVD A;  3LNQ A;  3CMY A;  3S16 J;  1VFC A;  1JGG A;  9ANT A;  3FK7 A;  3JRE A;  2YUS A;  3JRH A;  2L0K A;  2HOT A;  3BR2 A;  2Y30 A;  1U8B A;  3Q3S A;  4UUT A;  1OFC X;  3H0G J;  2R5Z B;  1JUS A;  2XGE A;  3TED A;  2HXO A;  4IHY A;  1JJ8 C;  3G1M A;  1WCM J;  1GV5 A;  3Q0V A;  5C4X J;  3ZQL A;  5FKK A;  3HOY J;  2DMN A;  4A3L J;  2EZK A;  4IHW A;  2HI3 A;  4IHV A;  1K83 J;  3S1R J;  1UHS A;  2DA6 A;  2HOA A;  1FTZ A;  1ZKG A;  1P7J A;  1FIA A;  4JX4 A;  1MNM C;  1JKQ C;  1ORK A;  1IV6 A;  2JWT A;  2Y31 A;  1JT6 A;  4BKX A;  2VKV A;  2WV1 A;  3JRF A;  1WGX A;  5EG0 A;  4HNV A;  5K7Z A;  2R5Y A;  2VKE A;  1QPI A;  3GTO J;  3S1N J;  2Y2Z A;  4IHX A;  2DMT A;  5E3L A;  2DA1 A;  5HOD A;  5EGO A;  4A3K J;  3JRC A;  2DTZ A;  4XK4 A;  1IDY A;  4C3I J;  3PO3 J;  3S1Q J;  1NK3 P;  2QCO A;  2LTP A;  3WHB A;  3PM1 A;  5GP9 A;  4XIC A;  4M6V A;  2XPV A;  2XB5 A;  3JRG A;  2L7F P;  4I6Z A;  1LE8 A;  1IDZ A;  1ETK A;  2O7O A;  4Y7N J;  3LSR A;  4V2F A;  4DYQ A;  1BW5 A;  4FIS A;  2GLO A;  3HM5 A;  4M3G A;  1IG7 A;  2EZH A;  3A03 A;  2XGD A;  5F0H A;  2VUM J;  4AC0 A;  2H1K A;  4A3D J;  5FLM J;  1B72 A;  5IPA A;  3SJM A;  2DA2 A;  2LD5 A;  2NVX J;  1G2H A;  1Q1V A;  2LK2 A;  4JX5 A;  3QPL A;  4MLO A;  2LY9 A;  1JKP C;  4AUX A;  3GTK J;  2GM4 A;  1TWG J;  2LFB A;  3E7L A;  2R5Y B;  3BR0 A;  2LVS A;  1MBE A;  2XPW A;  1DU6 A;  5J3L A;  2DMU A;  1ETY A;  2L7M P;  3K7A J;  4FTH A;  1WH7 A;  5M3M J;  3S1M J;  5FKN A;  1A5J A;  2JA5 J;  3BR1 A;  2CQQ A;  4B4C A;  3MN2 A;  5GPC A;  5FKO A;  2ECC A;  4ABZ A;  3FIW A;  1TWC J;  2YU9 J;  1LFU P;  5F1J A;  3TP0 A;  5FLV A;  3RZO J;  1FEX A;  1T56 A;  4M3B A;  1AKH B;  3W6V A;  1IRZ A;  2R0Q C;  3HOU J;  5J1Y A;  5EZG A;  5IP6 A;  3HDD A;  2Y0S N;  2MW8 A;  5IYB J;  2G0E A;  1X58 A;  1MBF A;  4DYC A;  4D7M A;  1YRN A;  1ETW A;  2I10 A;  1QVU A;  2DMP A;  2JJ7 A;  2O8K A;  2ME0 A;  2D5V A;  2AO9 A;  2L7Z A;  3ZQI A;  1AHD P;  4A3J J;  2M0C A;  2LP0 A;  2VPR A;  1ZR2 A;  3I4N J;  1ETX A;  3HOW J;  1HLV A;  2OPT A;  1I6H J;  1POG A;  4D5F A;  1HDP A;  4A3C J;  2EZI A;  2EH3 A;  3HGG A;  1APL C;  1FIP A;  4C3H J;  2JA6 J;  2FJ1 A;  3RKQ A;  3JRA A;  1AU7 A;  5JLW A;  2TRT A;  5M3F J;  1H8A C;  1ITY A;  3Q0U A;  1W0U A;  4JX6 A;  3HB9 A;  4FE4 A;  4D5C A;  5JLX A;  1RET A;  3A01 A;  3BR6 A;  4LOC A;  4MFD A;  1ZTR A;  3WHC A;  5IOY A;  2FX0 A;  1HCR A;  2CQX A;  2YS9 A;  2JA7 J;  1MH4 A;  3O8H A;  3H3V K;  2EZL A;  5DS9 A;  4V2G A;  5GPA A;  1TWH J;  5K7H A;  1MBJ A;  1RR7 A;  3BQY A;  3BG9 A;  3TP3 A;  4CYC A;  4GFB A;  2ZB9 A;  2E2I J;  5E3N A;  4UUS A;  2DA4 A;  3HGY A;  1JTY A;  5FJ8 J;  3ZQC A;  3FKI J;  3NAU A;  1JKO C;  4I76 A;  3BG3 A;  3OOU A;  3IV5 A;  1GDT A;  2H8R A;  4EEF G;  2ID6 A;  1NK2 P;  1U9O A;  4IEJ A;  4MFE A;  1ZK8 A;  1OJL A;  3VPR A;  3OSG A;  1Y1W J;  1F36 A;  2M2E A;  3I4M J;  3O8G A;  4DW6 A;  2KDZ A;  3RZD J;  4MIM A;  3BTJ A;  1ZR4 A;  1I3Q J;  2XPU A;  4A3F J;  3PO2 J;  4W97 A;  5M5W J;  3A01 B;  1PUF A;  2O9L A;  3M4O J;  3S2D J;  5M5Y J;  2CU7 A;  1QVT A;  3G1O A;  1B8I A;  2IEK A;  3SDG A;  3RQI A;  3CQZ J;  3BT9 A;  2EBI A;  1ZQ3 P;  3OIO A;  1UG2 A;  1RKW A;  2FD5 A;  1IGN A;  3CCY A;  1VND A;  2LKX A;  3HBL A;  2JK3 A;  4CYC B;  1VF9 A;  5J1R A;  1H89 C;  2E19 A;  3ZQG A;  4W1U A;  2DMQ A;  4UUS B;  1FTT A;  2ID3 A;  1RES A;  2CUE A;  3HEF A;  4A3E J;  5FKL A;  2GBY A;  5EG0 B;  2QF7 A;  4M3F A;  3IH3 A;  2E1O A;  1WI3 A;  4JP0 A;  2K9S A;  2DN0 A;  2ELK A;  1MBG A;  2X9D A;  5EGO B;  1E3O C;  4AYB N;  3S14 J;  1CQT A;  1OCP A;  4XID A;  2E2H J;  1JTX A;  4QSH A;  1PUF B;  2M34 A;  5IP7 J;  3HOX J;  2E2J J;  4Y52 J;  4XRM A;  1LE8 B;  3GBG A;  5F0C A;  1ZGW A;  2HOS A;  5EZH A;  2ECB A;  1Z0X A;  1EF4 A;  2R92 J;  5C4J J;  2Y9Y A;  1BW6 A;  3GTG J;  5IYC J;  3HKZ N;  5EEA A;  4J19 A;  4A3I J;  1FJL A;  3BR3 A;  4NDL A;  5F27 A;  1DU0 A;  2FQ4 A;  3L1P A;  3HOV J;  2CJJ A;  3TW6 A;  1D5Y A;  4FCY A;  1B72 B;  2XGC A;  2TCT A;  3QQA A;  2R5Z A;  4QTR A;  1K61 A;  1Y1V J;  5FKM A;  1IC8 A;  3JRB A;  3DEW A;  3S17 J;  1ETQ A;  3BG5 A;  3LSG A;  4M3D A;  3C2B A;  5J1U A;  2NS8 A;  3IH2 A;  4MO7 A;  3NAR A;  3BQZ A;  2CRG A;  3S15 J;  1U78 A;  2W48 A;  1MBH A;  4C3J J;  2NVQ J;  4A3G J;  1W0T A;  4BY7 J;  1NTC A;  2XRL A;  2NS7 A;  5BNG A;  2LR8 A;  4DYR A;  1GT0 C;  3FK6 A;  4X6A J;  1JKR C;  1IUF A;  3B6A A;  4FE7 A;  5C44 J;  1QRY A;  4S0H B;  4XRS G;  2JN6 A;  2HDD A;  2DA5 A;  4B3A A;  1MSE C;  3BR5 A;  3GTL J;  1ENH A;  4C2M J;  4BBS J;  1YRN B;  1JUP A;  1GUU A;  3D1N I;  1S7E A;  2MGQ A;  4X1E A;  1WH5 A;  1MSF C;  3CDL A;  1R9T J;  5IOZ A;  2K40 A;  1TWA J;  2N8G A;  1LFB A;  5M5X J;  2IAI A;  2K9Q A;  3FIS A;  1F43 A;  2X6O A;  2M8G X;  2L9R A;  3Q0W A;  5DTD A;  1HDD C;  3S2H J;  1HOM A;  2MG4 A;  2P81 A;  2RAE A;  1XG1 A;  2X48 A;  1ETV A;  3UKG A;  4QIW N;  1GV2 A;  3ZQH A;  1X2N A;  2WB1 N;  2NVY J;  2JA8 J;  1T33 A;  1IJW C;  2EQR A;  2JMW A;  3A02 A;  5IYD J;  1BA5 A;  1VI0 A;  5E3M A;  2CUF A;  1JT0 A;  4A93 J;  5E3O A;  2DA7 A;  5C3E J;  1SFO J;  2Y9Z A;  2DJN A;  1WPK A;  1Z77 A;  3MVP A;  2NOG A;  4A3M J;  3BTL A;  4L5E A;  2K9N A;  5EYR A;  2B63 J;  4B1R A;  1X2M A;  1OCT C;  1UMQ A;  2XSD C;  3MKL A;  1BL0 A;  1AKH A;  2HXI A;  1SAN A;  3ZQF A;  3JRD A;  5IP9 J;  3JRI A;  5F08 A;  3OSF A;  3GTQ J;  1JUM A;  3LSJ A;  5F04 A;  2HQ5 A;  5K7F A;  4M3E A;  1BJZ A;  2WAQ N;  1TWF J;  2ME6 A;  4A3B J;  3GTM J;  4JYK A;  3M3Y J;  1JJ6 C;  3GTP J;  1H88 C;  1I50 J;  3LOC A;  1HF0 A;  1RKT A;  1B8I B;  2IBD A;  3K2A A;  2VI6 A;  4A69 C;  1O4X A;  4DZJ A;  2M9H A;  3QPS A;  1U9N A;  4XRS A;  4BXX J;  4DZP A;  3SFI A;  3TW7 A;  3DCF A;  3HOZ J;  5EF6 A;  2KT0 A;  5F0F A;  3IH4 A;  1XS9 A;  3G1L A;  2R7Z J;  2COB A;  3ZOB A;  3GTJ J;  1MH3 A;  4G12 A;  2HYJ A;  3B6C A;  3LSP A;  3BTI A;  4BY1 J;  4BBR J;  5EDN A;  2DA3 A;  4RBO A;  1P7I A; 
#chains in the Genus database with same CATH topology
 2QSG X;  4ON0 A;  3D5S C;  2AQF A;  4L18 B;  3HXL A;  4HQM A;  4LB6 B;  3SZP A;  2BY1 A;  2AHQ A;  2Z2S B;  4BS9 A;  3CCM I;  4OIO F;  1RPW A;  2RVC A;  4U0W A;  1S9H A;  1MBK A;  2Z16 A;  2PMZ N;  1AA7 A;  3WE2 A;  2OF7 A;  3L7W A;  1TC3 C;  4Y13 A;  4LK0 F;  3ZMV A;  4C9Y A;  2EIL H;  4HEA 2;  3K4J A;  4IOA F;  1U6G A;  1F4K A;  2MFZ A;  3R0A A;  3FXO A;  2L0K A;  3JRH A;  3BJA A;  3Q3S A;  1H9T A;  3VEP A;  3LSM A;  2LC2 A;  4UUT A;  5HLH A;  2E35 A;  4UXN A;  2XAJ A;  5ICG A;  2LF8 A;  1XMK A;  3FBI B;  2HXO A;  2KP6 A;  1HBX G;  1FLI A;  4IXA A;  4IHY A;  1QZZ A;  3F8B A;  3C2G A;  2DOF A;  2BVL A;  5LGN A;  3Q0V A;  1ZN2 A;  3EET A;  3ZQL A;  3MFK A;  3DF8 A;  1TL8 A;  3EPZ A;  3CTA A;  2HI3 A;  4BHB A;  2DOD A;  2HOA A;  4DJA A;  1FTZ A;  2V79 A;  2V6C A;  5CLS A;  1UZC A;  1IN6 A;  3KYD B;  2DW4 A;  4P5O A;  2DDB A;  1JKQ C;  1G3T A;  4M9Z A;  1HST A;  1IV6 A;  2GAU A;  2JWT A;  2V1D A;  1BC7 C;  1WFX A;  5LHH A;  1UB9 A;  3LA3 A;  2VJI A;  1ZYR F;  4EJU A;  5EG0 A;  2CGP A;  2BY3 A;  3I3L A;  1YW8 A;  4YII A;  4ZYE A;  1YW9 A;  3U1K A;  3RJP A;  1TQP A;  2DA1 A;  1TTY A;  3KP5 A;  3T8T A;  3VDX A;  4LLL A;  4FQG A;  3RKX A;  2E1M B;  4CSW A;  4QWQ A;  3BJO A;  1LNW A;  3HL2 A;  3BY6 A;  4JOM A;  2LTP A;  4OMZ A;  4RAZ A;  3PM1 A;  3CCS I;  4XIC A;  2Y0S A;  3NRV A;  2XPV A;  1J2X A;  3WE3 A;  3FDY A;  3QU3 A;  4CIC A;  4LK1 F;  1F5T A;  1D8J A;  3FWE A;  2X6Y A;  3LSR A;  3CUO A;  4DYQ A;  3ABK H;  1WJB A;  4FIS A;  1U5T A;  4PSX A;  1GHC A;  3F8N A;  2L5Q A;  3HOS A;  3QYE A;  4U7D A;  2JQ7 A;  2EZH A;  3WGH A;  2XGD A;  5F0H A;  3KX2 A;  3VB2 A;  2CSO A;  2HPI A;  4A3D J;  3RQ4 A;  1KA8 A;  2QYO A;  2DA2 A;  4NNJ A;  3N05 A;  3FM3 A;  3WTV C;  2IGO A;  3QPL A;  2LY9 A;  4XBF A;  1UG0 A;  5GAD J;  4AD9 A;  2LFB A;  4A6E A;  2R5Y B;  4Y17 A;  5EJC A;  4PJJ A;  1DU6 A;  3I56 I;  1FOW A;  3BP8 A;  4XSZ F;  5J3L A;  1ETY A;  1X1A A;  2PN6 A;  3K4B A;  4BAY A;  3AG3 H;  3BCA A;  2NAZ A;  3K7A J;  5M3M J;  3S1M J;  5FKN A;  1PP7 U;  2QWW A;  2JA5 J;  3BC8 A;  1P2F A;  2CQQ A;  4B4C A;  2LRD A;  1PDN C;  1R71 A;  1KU2 A;  3OL3 A;  3ECO A;  5A2Q K;  1Y56 A;  3I0T A;  1IAW A;  1YS6 A;  2YU9 J;  4I09 A;  3BG7 A;  3DQV C;  4HW0 A;  4ENJ A;  2PX9 A;  5FLV A;  3RZO J;  1KYZ A;  2E5N A;  3E5U A;  2L9V A;  3IUO A;  4KMF A;  4D1Q A;  2QSF X;  3GW2 A;  4FT8 A;  4Z2Y A;  5IP6 A;  1WVR A;  1IF1 A;  5J4V A;  1EH6 A;  2MLK A;  4HX8 A;  2KKO A;  2O5R A;  2IS1 A;  1O57 A;  3DTK A;  1X58 A;  1T38 A;  2P6T A;  4DYC A;  4P55 A;  3C18 A;  2CW0 F;  2OV7 A;  1ETW A;  2JJ7 A;  4LB5 A;  4LFU A;  1AHD P;  4D0P A;  1D0X A;  4DBQ A;  2W25 A;  3J81 Z;  3L2Q A;  4IOC F;  1HLV A;  1I6H J;  3DBL B;  3OV8 A;  3WTS C;  2V26 A;  3S8P A;  4D5F A;  1B9M A;  1FBQ A;  1HDP A;  4R8H A;  4HA8 A;  3SEZ A;  5D8L B;  1T95 A;  4C3H J;  1W7P A;  3MQ0 A;  3HSE A;  3CC4 I;  3S3N A;  2ETH A;  4HNT A;  3Q0U A;  1R00 A;  1LEB A;  1W0U A;  4JX6 A;  4FE4 A;  1YW7 A;  4D5C A;  3AL0 C;  3FXL A;  3K1M A;  4PGG A;  4AU7 A;  3A01 A;  4DBR A;  1A35 A;  2EJR A;  3GF2 A;  4YG2 F;  3BR6 A;  4LOC A;  5GAG J;  1Z05 A;  2X85 A;  1ZTR A;  3FMQ A;  4IRH A;  5BQT A;  1AWC A;  2VN2 A;  1HW1 A;  1KQ8 A;  2J5P A;  5IOY A;  1LDJ A;  4HBL A;  1W36 D;  1TT5 B;  3T5X A;  1QU3 A;  3O8H A;  2QGU A;  1EA3 A;  5J40 A;  3BPX A;  1GVJ A;  2Q2E B;  3JSO A;  1MBJ A;  1JHF A;  1QQI A;  2DK5 A;  2LG4 A;  3FXK A;  4CYC A;  2Q1Z B;  4XOR A;  4Y3O A;  1OYW A;  3U9G A;  2E2I J;  4MQV A;  4UUS A;  1JKO C;  2DA4 A;  3F6O A;  3GFL A;  3HRM A;  1I39 A;  3I5U A;  4I76 A;  2ISY A;  3BG3 A;  3IV5 A;  1GDT A;  5BPD A;  4CZZ A;  1U9O A;  2M87 A;  3VPR A;  1OJL A;  2M3A A;  2M2E A;  4YEJ A;  4M6X A;  1WKM A;  3HUG B;  2CWE A;  1E3H A;  2Y48 A;  3RZD J;  4MIM A;  3GZ5 A;  2MYS A;  2V4J C;  5E1W A;  3TGN A;  2IJL A;  3CDI A;  2E71 A;  4CGZ A;  5GAE J;  4RS8 A;  1R5H A;  3S93 A;  2IW5 A;  3CJQ B;  3S2D J;  2WY7 Q;  4YIF A;  5J6X A;  1QPM A;  2CU7 A;  4AIK A;  3ESW B;  3FF5 A;  3FHN A;  1QVT A;  3CDH A;  1B9N A;  2RNJ A;  1UG2 A;  1ZGJ A;  3CC2 I;  4KT6 A;  4OIN F;  5K1Y A;  2LKX A;  4N9I A;  3CC7 I;  3SXY A;  2STT A;  2R7V A;  2JK3 A;  3L2C A;  4DOZ A;  5J1R A;  3FM5 A;  5J8F A;  2DYR H;  3HRU A;  2H09 A;  4W1U A;  2FOK A;  2Z99 A;  2MLG A;  2ID3 A;  1LQ1 A;  3G73 A;  4V19 K;  4M9S A;  4Q48 A;  2GBY A;  5EG0 B;  2ZO4 A;  3IH3 A;  1WI3 A;  3GLL A;  4HDV A;  4HF0 A;  4JP0 A;  4LG3 A;  2EIK H;  2LSO A;  2A6E F;  4KIB A;  2JPB A;  4PGH A;  2ZXW H;  5E1Z B;  4AYB N;  3M1E A;  1SEU A;  1E3O C;  1CQT A;  2QQB A;  2LY2 A;  1OCP A;  1MDM A;  4CCM A;  3GZN B;  3ZR8 X;  3HSF A;  4LLG F;  5E8I A;  4QSH A;  1PUF B;  2M34 A;  4ESJ A;  4HG2 A;  3TOA A;  1V3F A;  2HYF A;  3GBG A;  5HS7 A;  2Y9Y A;  1T8I A;  3LA2 A;  1U5T B;  4XQF A;  4BEH A;  2ZME A;  1FJL A;  1B4A A;  1NH3 A;  1OKR A;  1LJ9 A;  5F27 A;  3PQK A;  3L1P A;  3ZXS A;  4L9N A;  3TW6 A;  2HQN A;  2TCT A;  2XAH A;  3GCM A;  5TIS C;  1VQ6 I;  4MEX F;  1MMS A;  3KCC A;  2M1B A;  2V1N A;  1T39 A;  3N97 A;  1BR4 A;  1FMV A;  2Z5U A;  4XKV A;  4BU2 A;  3IH2 A;  5AIQ A;  2HTS A;  2K4B A;  4IO9 F;  2LYC A;  4DQ2 A;  1RUO A;  4C3J J;  3L00 A;  1UFM A;  1HKQ A;  2V9P A;  1YJW I;  5K5O A;  2GWR A;  4II3 A;  2XRL A;  5KCM A;  1XMA A;  5LRS A;  1IW7 F;  1MMN A;  4DYR A;  3FK6 A;  5LRR A;  4X6A J;  1LDD A;  1XGN A;  2FA5 A;  4KIC A;  4ZYD A;  4FE7 A;  1QRY A;  1OYI A;  3IWZ A;  4FHT A;  3HYI A;  2KIF A;  2HDD A;  3S3M A;  3GTL J;  4R1H A;  4C2M J;  3EUK L;  4BBS J;  4B43 A;  3WOD F;  4IZZ A;  5IT9 Z;  1S7E A;  1FOK A;  4B47 A;  3I54 A;  2N8G A;  3H1C A;  4YEL A;  1SD4 A;  1U2W A;  1LFB A;  2MAB A;  1D1C A;  4PZJ A;  4RGU A;  5D6F A;  1BI1 A;  2L4M A;  5CVV A;  1OQY A;  3H9G A;  2WAQ A;  1HA8 A;  2VQH A;  4EJV A;  3S2H J;  3D5L A;  1W7P B;  5HNF A;  1J5Y A;  4EJT A;  1ETV A;  2PEX A;  3IC7 A;  4BNC A;  1OCZ H;  2F5V A;  3UKG A;  1XSV A;  4QIW N;  2P5K A;  1PP8 F;  1GV2 A;  4KT5 C;  3HRS A;  3K1N A;  5FRM A;  4RGR A;  1F1Z A;  2RC4 A;  2VKD A;  1USS A;  3MZ8 A;  1BI0 A;  2WB1 N;  2M30 A;  3DXJ F;  3CO6 C;  5LGU A;  2NVY J;  1T33 A;  4I01 A;  1O3Q A;  2EQR A;  3ABT A;  2XAF A;  3A02 A;  3DPL C;  2E7X A;  2IA1 A;  3O6B B;  1BA5 A;  1XSD A;  4B09 A;  3P9I A;  3IKV A;  2HDC A;  3SYT A;  1W5C C;  1DQU A;  2CUF A;  3NWS A;  3LL7 A;  5E3O A;  2Z33 A;  2E1M C;  4M74 A;  2PJR B;  4J01 A;  1R1V A;  2DJN A;  5HDK A;  2OCE A;  4UB8 C;  4IRI A;  1Z77 A;  4AID A;  3I58 A;  1SFU A;  3BTL A;  1RZ4 A;  3RCO A;  2K9N A;  2GQQ A;  1OYY A;  2R7R A;  2W1O A;  2XSD C;  2ZSI B;  3JRI A;  3ZQF A;  3V4G A;  3JRD A;  1PUE E;  4PJL A;  5F08 A;  4HF1 A;  1JUM A;  3LSJ A;  4HPQ A;  1D1A A;  5K7F A;  2IPQ X;  3FMS A;  4D9J A;  1V4R A;  1TWF J;  4G7O F;  3GTM J;  2BVM A;  3M3Y J;  2FXA A;  1S72 I;  1BIA A;  3J7Y J;  1VQO I;  2NNY A;  3R61 A;  1XCV A;  2EV0 A;  1QZE A;  1XGM A;  2JVH A;  3J7Z I;  2NOJ B;  1O3T A;  4H4K C;  3TBI A;  1K78 B;  1RI7 A;  4A69 C;  2HNH A;  3RKY A;  3KLO A;  4MHG A;  5JI6 A;  2VQC A;  3LSI A;  1O4X A;  2ZNZ A;  2DOA A;  5FFX A;  4DZJ A;  2ZSH B;  3TO7 A;  4CCJ A;  3F3X A;  1S7O A;  3ZQ7 A;  5ILS A;  3KE2 A;  4L0Y B;  4BXX J;  3P9C A;  4HLX A;  4BYY A;  4IHT A;  4ZTF A;  2CFO A;  4NC6 A;  4CUG A;  1XS9 A;  1YYV A;  4AIH A;  4BE2 A;  4ZTJ A;  2NNN A;  3H5A A;  1P92 A;  3WG7 H;  3P9K A;  4HQE A;  3GUD A;  3SHF A;  2K4J A;  1E17 A;  4G12 A;  3HJE A;  3B6C A;  3BTI A;  1BI3 A;  4BQN A;  2LY1 A;  5CKT A;  5GTI C;  4RDU A;  4XOP A;  1MDM B;  4XMY A;  3O3K A;  2E60 A;  2F4M B;  2XB0 X;  3BTC A;  2BE5 F;  4GXO A;  3K69 A;  4BH9 A;  2FSW A;  3C1D A;  1IN4 A;  2VJ5 A;  2VXD A;  3EYY A;  3H3Z A;  3LAJ A;  2ACJ A;  2G9W A;  2MD0 A;  1R58 A;  3AG4 H;  3LNQ A;  3CMY A;  3S16 J;  3QYF A;  3F8M A;  4IQJ A;  2QQ9 A;  1JGG A;  4BEH B;  3TO6 A;  4I2O A;  2ZME B;  4CCN A;  1N77 A;  1SVO A;  1D3Y A;  3CMM A;  2HOT A;  2HYG D;  3BR2 A;  4GGG A;  4S04 A;  4XLP F;  2A69 F;  2G7U A;  2HVQ A;  3KIO A;  1JUS A;  3PSF A;  2XGE A;  3K4L A;  3Q9V A;  2X4H A;  3TED A;  2MA3 A;  3PFY A;  4HX7 A;  3CUQ A;  3V42 A;  1IO2 A;  5C4X J;  5DCM A;  4NBQ A;  2Q0O A;  4N9H A;  2KRC A;  3M8E A;  2HKX A;  5KAF C;  2DMN A;  4XRF A;  2EZK A;  1XMX A;  3F9K A;  4IHV A;  4F91 B;  3T1B A;  1D1B A;  5CQG A;  1FIA A;  1WQ2 A;  1MNM C;  4J00 A;  2MC3 A;  2Y31 A;  1X3Z B;  1JT6 A;  1SAU A;  5DDG A;  2VKV A;  2WV1 A;  2XKO A;  3JRF A;  4R79 A;  2XV4 S;  1BJA A;  4XKC A;  1X1B A;  4BHC A;  1UEL B;  3HG9 A;  2B0L A;  3WTZ A;  3BPV A;  3FXM A;  2R5Y A;  1KU7 A;  5LEK A;  4EM2 A;  1WJA A;  1QPI A;  2RQP A;  3DPT A;  3W2A A;  1XB4 A;  4PCQ A;  2WTE A;  1Z3Y A;  2D1H A;  3VFZ A;  5DM7 F;  1G3S A;  3QPT A;  2KIM A;  5EGO A;  1RNL A;  2ELH A;  3OL4 A;  3QOD A;  3DKW A;  4XK4 A;  1IDY A;  4CH7 A;  1I27 A;  2XRN A;  2X51 A;  5LBQ A;  1WI9 A;  3IRR A;  2ZKZ A;  5CVI A;  4BXU A;  2XB5 A;  3JRG A;  4LLN A;  2M0M A;  2VPL A;  4I6Z A;  1LPQ A;  4V2F A;  3ROU A;  4I0A A;  4XL9 A;  2FMY A;  2CW8 A;  5DUK A;  2VBW A;  2GLO A;  3HM5 A;  1HXD A;  1B72 A;  3SJM A;  2IGK A;  5CPR B;  2A5Y B;  3RDI A;  2NVX J;  1FY7 A;  3QOE A;  1Q1V A;  4MLO A;  2CV0 A;  1OCR H;  2ELJ A;  3GTK J;  2IGN A;  3E7L A;  3BR0 A;  3A0B C;  4XLC A;  1YX3 A;  1X4P A;  4ZH4 F;  3MKW B;  3A4C A;  2VL8 A;  2DMU A;  3GFJ A;  5H2F C;  3TMO A;  4JBA A;  2JRT A;  1WH7 A;  3G2B A;  4WXD A;  4FTH A;  4S05 A;  1I5Z A;  3ZN1 A;  3SDB A;  2Z1D A;  5GPC A;  5FKO A;  2JUC A;  2ICW G;  1FBU A;  1TWC J;  2WA0 A;  3DLL F;  1LFU P;  3ZGK A;  5F1J A;  1IRZ A;  3K2Z A;  3OOP A;  1AOY A;  1TW3 A;  1U5T C;  2CW7 A;  3JTG A;  3ERE D;  4WX9 A;  1WSU A;  5J1Y A;  2CUJ A;  4FX4 A;  3J7A O;  4PFP A;  2YPR A;  2A6H F;  4WCG A;  1K6O A;  2QKM B;  1EH7 A;  3OR2 C;  1MBF A;  4EGY A;  2Q2E A;  3SEQ A;  5BS6 A;  1Z1D A;  2EWN A;  1QVU A;  2O8K A;  4LJZ F;  2ME0 A;  1UHW A;  4CDG A;  2AO9 A;  3ZP5 A;  1K7A A;  3TO9 A;  2VPR A;  5D8K B;  4E7K A;  1ZR2 A;  1SAX A;  2OPT A;  3VSK A;  2JRM A;  5TRD A;  4B3X A;  2ZJR F;  4YRV A;  3HGG A;  1IV8 A;  3OIQ A;  3HUG A;  2MBF A;  4YFX F;  1YX5 A;  1ZLJ A;  5JLW A;  2TRT A;  3HHG A;  2KZG A;  2RRE A;  3RSN A;  4KUM A;  1XPX A;  2BXZ A;  1RET A;  5EEH A;  2L9S A;  5ICF A;  3J81 K;  3UNG C;  2A6T A;  3M8F A;  3CJR B;  3B73 A;  1HCR A;  1IRF A;  1FOY A;  2DPD A;  2JA7 J;  1MH4 A;  4A5N A;  1BBY A;  5FLX Z;  2EK5 A;  5JFR A;  3OYH A;  3H0D A;  2VJ4 A;  4FX0 A;  4RAF A;  2HU9 A;  3BQY A;  1VQ8 I;  3WGI A;  2ZFU A;  3HGY A;  4WF2 A;  1JTY A;  5FJ8 J;  2OBP A;  1X1D A;  2BHY A;  3FKI J;  5TJJ A;  2WC2 A;  1K4S A;  2CQN A;  3VYU B;  2CFX A;  1BOA A;  3WU0 A;  1NK2 P;  2VOO A;  4K2E A;  2JPC A;  2XHK A;  3RYR A;  2V1X A;  3G6E I;  3CCQ I;  1X19 A;  3ASO H;  3OYA A;  2VC0 A;  3WTT C;  2RV8 A;  4KIG A;  1I3Q J;  2XF6 A;  5FRN A;  2H6B A;  1CGP A;  3FMR A;  3PO2 J;  4ZYG A;  4N0B A;  4Q47 A;  5ILV A;  3MEX A;  2KRH A;  1T6S A;  3CUQ B;  5H20 A;  1PUF A;  2M7B A;  3K6G A;  3T8R A;  4E7H A;  5DCM B;  1ZHF A;  1B8I A;  2IEK A;  1GXP A;  3RQI A;  3CQZ J;  2L2O A;  1ZQ3 P;  3BZ6 A;  3K4K A;  2QBY A;  4MNU A;  2EFN A;  1IGN A;  2OU2 A;  1JE8 A;  3HBL A;  4ZDL A;  1J9I A;  1VQ7 I;  1H89 C;  5CVR A;  2QUF A;  4G7Z F;  2DFE A;  2JT1 A;  1FTT A;  4YFN F;  1RES A;  3HEF A;  3AG2 H;  3DPU A;  2QF7 A;  4M3F A;  2E1O A;  2P7V B;  3CZ6 A;  3SZT A;  3MWM A;  2B9S A;  2ELK A;  1W4M A;  1MBG A;  4BUP A;  3ZQQ A;  4RM2 A;  2A5W A;  5EGO B;  2VBX A;  1W5T A;  3H36 A;  1Z9C A;  3G3Z A;  2E2H J;  4A5M A;  2I5U A;  5IY5 H;  1ZGA A;  2DYS H;  3J80 Z;  1JTX A;  3BWG A;  1OPC A;  5IP7 J;  2EV6 A;  3S1N J;  3CP2 A;  3IWF A;  4LD5 A;  3HOX J;  1ZEL A;  3FHZ A;  3F21 A;  2H1L A;  3M1C A;  3KP4 A;  3OS1 A;  4XNF A;  1Z21 A;  3ELK A;  4XRM A;  2ZC2 A;  5E8G A;  5F0C A;  2IRF G;  2HOS A;  3LA7 A;  2ECB A;  5EZH A;  4ZZL A;  2R92 J;  4HF2 A;  5HDG A;  4RAY A;  1Z3X A;  3T0Y A;  5IYC J;  4NHJ A;  3HKZ N;  4A3I J;  4J19 A;  5JVT A;  3CCE I;  3MZH A;  3BR3 A;  5D5W B;  3DKY A;  4AIJ A;  3KZY A;  2FQ4 A;  3PIP F;  3COA C;  2BGC A;  2CG4 A;  2FOW A;  1B72 B;  3HOV J;  2XGC A;  3QQA A;  1S5L C;  3CCV I;  4QTR A;  4MGR A;  1R4N B;  3LFK A;  2E5Z A;  4U7B A;  1QNT A;  3JRB A;  3DEW A;  2PBI A;  1X3U A;  4G8X A;  3LSG A;  2FRH A;  1VQ5 I;  3C2B A;  5J1U A;  1I3A A;  2KQR A;  4WWC A;  3CLQ A;  2CRG A;  4P1W A;  2R7Q A;  4BQQ A;  3S15 J;  1MBH A;  1VQK I;  1R1T A;  3E1S A;  3TDZ C;  4CYD A;  3IP4 B;  1ODD A;  2NVQ J;  4XR6 A;  4BY7 J;  2J5O A;  1R36 A;  4UNO A;  4PUS A;  3HHH A;  4B44 A;  4CHU A;  3KEY A;  2GXA A;  3REO A;  4E6K G;  3KZI C;  1MZB A;  2WV0 A;  4BE0 A;  1HKT A;  4S0H B;  2ZME C;  3ABU A;  1TW2 A;  4B3A A;  5HOO A;  3BR5 A;  3ONQ A;  3RIR A;  2O8X A;  2R7D A;  5E20 A;  2PJR A;  1VQM I;  1KQ0 A;  4P9U A;  1R1U A;  2HZD A;  2G7H A;  1DPU A;  5IOZ A;  1FBS A;  2K40 A;  3L09 A;  4L9V A;  1E0E A;  3GXO A;  1HSJ A;  1YLF A;  3UR3 C;  4AVP A;  4YIR X;  3Q0W A;  1YE9 A;  2L02 A;  4CCL A;  2CV2 A;  3RYP A;  2V1U A;  2RAE A;  2K9L A;  3I59 A;  3SQN A;  5TGT A;  1VQP I;  1LKX A;  2BZT A;  1MW7 A;  2NRA C;  4U0V A;  4KDP A;  1G6N A;  2K27 A;  1BM9 A;  1R4M B;  1KQ9 A;  2IA2 A;  2MH2 A;  3EUH A;  3ZMS A;  1K78 A;  1LVK A;  1OCC H;  2XIG A;  4PJ0 C;  1RC9 A;  1J0R A;  3H9Q A;  1REP C;  1JT0 A;  6PAX A;  4BQO A;  3OY9 A;  2XSJ C;  2AS5 F;  2LDU A;  3IAS 2;  4MTE A;  3KP3 A;  4RB1 A;  2K3P A;  3AG1 H;  4ENK A;  2WY8 Q;  5E1X A;  1D8K A;  2CQK A;  4A3M J;  2H6C A;  5L3E A;  2FQ3 A;  2E34 A;  5EYR A;  3SZG A;  2PI0 A;  3MZY A;  4B1R A;  1B59 A;  3IRQ A;  4HV5 A;  2YSR A;  5AIP A;  1AKH A;  2HXI A;  5LD2 C;  3GZ6 A;  4ANJ A;  4UVC A;  3GTQ J;  4RB3 C;  5LEJ A;  2GA2 A;  1SFX A;  4G9Y A;  4M3E A;  3CJN A;  2R3S A;  2MH9 A;  4A6D A;  3WGG A;  2PMZ A;  2ME6 A;  5A2Q Z;  1F9N A;  4JYK A;  3FXQ A;  4XN0 A;  3KPH A;  1XDS A;  2M45 A;  1ZAO A;  4L9T A;  1Y8R B;  2P7C B;  3P5J A;  1FT9 A;  3K70 C;  1JJ6 C;  3OYE A;  1H88 C;  1I50 J;  1J09 A;  3MMY B;  1B8I B;  1Z6R A;  2IBD A;  2VI6 A;  4ZDO A;  2XGX A;  4CA0 A;  2QBY B;  2LRE A;  2HFH A;  3QPS A;  4H0E A;  4DZP A;  3SFI A;  4I0B A;  5DV5 A;  4WXC A;  1IN7 A;  2HPM A;  2VJJ A;  4UV9 A;  2KT0 A;  2YU3 A;  1XTA A;  3VYR B;  2A68 F;  2XF7 A;  4RM3 A;  1WJ5 A;  3PFI A;  2COB A;  4BDZ A;  3ZOB A;  1TT0 A;  2R4G A;  2NXN B;  3GTJ J;  1XGS A;  2L4A A;  2HYJ A;  4O3M A;  1IN8 A;  3WG9 A;  3LSP A;  1D5V A;  4BXF A;  4BBR J;  2VIX A;  1J59 A;  2GXG A;  2AXL A;  1P7I A;  1VZ0 A;  4G94 A;  1XC5 A;  2P6S A;  3F0C A;  4L5I A;  4RLQ A;  3NQO A;  1B6A A;  3DEU A;  1ZRD A;  3HTU A;  2BY0 A;  5J8C A;  2MD5 A;  4D7N A;  2KL4 A;  1YJN I;  2MSY A;  5L3G A;  1XN7 A;  1ETO A;  5ERI A;  1GVD A;  3ABL H;  5E18 F;  1VFC A;  2STW A;  2DT7 B;  3FK7 A;  5LLQ A;  2YUS A;  1WJD A;  4LGW A;  1IUY A;  1NG7 A;  2R7T A;  3V7S A;  1U8B A;  3BDD A;  4PK4 A;  3C3W A;  2ZFW A;  3H0G J;  2Z3Y A;  4XLA A;  3PNT A;  1HQC A;  3G1M A;  3X2Q H;  1WCM J;  4KFC A;  5CJ9 A;  2HVR A;  3O2P E;  4KMU X;  5L3D A;  5D5U B;  4IHW A;  1R5G A;  1WHU A;  1MGT A;  2M7A A;  1K83 J;  1MNE A;  3S1R J;  2V7F A;  1UHS A;  2A61 A;  4IQ4 A;  2EA4 A;  1ACI A;  1ZKG A;  1P7J A;  2Z9O A;  2KZV A;  3CES A;  3QU6 A;  1PJR A;  4BL0 B;  4PJN A;  5IT3 A;  5LGT A;  3KP2 A;  2KMU A;  1WGX A;  2L7K A;  5FD5 A;  1FNN A;  1J75 A;  3BZC A;  4OAY A;  4BJT A;  3GFM A;  2Y69 H;  3V8L A;  3DBR B;  3NEU A;  2A3S A;  2QEN A;  1IRG A;  2DMT A;  5E3L A;  1DUX C;  5HOD A;  4A3K J;  3JRC A;  2DTZ A;  3CUQ C;  3GFI A;  2IVM A;  1MMA A;  4C3I J;  3PO3 J;  3S1Q J;  1G8X A;  3TDU C;  5F1R A;  4RMN A;  3A0H C;  2QCO A;  1WRJ A;  2DFH A;  2YX7 A;  2IS2 A;  5GP9 A;  1ZRE A;  4M6V A;  4ZYA A;  3K9T A;  2ZNY A;  5ICC A;  3CME I;  1LE8 A;  1O7L A;  3JAM K;  4HV6 A;  1ETK A;  3I55 I;  4MQ9 F;  4GDF A;  2PMH A;  1N25 A;  2V9K A;  4UVB A;  3Q5F A;  1BW5 A;  2LKS A;  3I59 B;  2P0W A;  4XLE A;  3HOT A;  1SD5 A;  3F72 A;  2F4I A;  1IXS B;  4A12 A;  2VUM J;  1XDU A;  2NVU B;  2H1K A;  3BG6 A;  3I53 A;  5FLM J;  3JTH A;  5IPA A;  2WAE A;  1LDK B;  3JCU C;  1G2H A;  4JX5 A;  2LK2 A;  1JKP C;  3E6D A;  1P6R A;  1X1C A;  3DBH B;  3FXJ A;  3BJ6 A;  4AUX A;  1TWG J;  5FB2 A;  3CF5 F;  2LVS A;  4IF4 A;  1IZ1 A;  2PFB A;  4Q4Z F;  2V6E A;  2OZU A;  5FFZ A;  2P4W A;  2K5C A;  3C7J A;  2F48 A;  2IGM A;  2HQR A;  3DWL E;  3VYS B;  1MND A;  2VAS A;  3I9V 2;  4OWR B;  2ECC A;  2K7L A;  5KAI C;  3L2U A;  1I1G A;  3I4P A;  1FYM A;  2DJI A;  3VOE A;  4CCO A;  5BMZ A;  2F5E A;  3ZRG A;  1FEX A;  4M72 A;  4GCV A;  2RGV A;  1AKH B;  1TQI A;  2I8D A;  3GME A;  4M3B A;  5B1B H;  3RPQ A;  4EQQ A;  2R0Q C;  3W6V A;  4OU0 A;  3HOU J;  2DXI A;  3F6V A;  2F4O B;  3GWZ A;  5EZG A;  1WJF A;  4UB6 C;  2M4K A;  4OMY A;  3KLN A;  2Y0S N;  2MW8 A;  5IYB J;  2G0E A;  2VQL A;  3W2W A;  2I10 A;  2DMP A;  4KN4 X;  2XAS A;  3BOQ A;  2D5V A;  3OS2 A;  2R7S A;  2L7Z A;  3ZQI A;  5HNH A;  4A3J J;  2M0C A;  2LP0 A;  5K5R A;  3I4N J;  1ETX A;  3HOW J;  4IKF A;  2AXT C;  1POG A;  3C2H A;  5F64 A;  1EH8 A;  2F5D A;  4A3C J;  2IT0 A;  4HLY A;  2HS5 A;  3OYJ A;  1VQN I;  1FIP A;  1MMD A;  3QPH A;  2JA6 J;  2FJ1 A;  3H5R A;  3PQJ A;  3JRA A;  3EYI A;  2BOL A;  3OWT A;  2QSH X;  5M3F J;  1H8A C;  1ITY A;  3RTR A;  1SFK A;  1D0Z A;  2F2E A;  1DPR A;  1T2K A;  1SMT A;  4MFD A;  2DT5 A;  3ABM H;  1Y6I A;  3KEQ A;  4ETS A;  4I02 A;  2FX0 A;  3LMM A;  2CQX A;  2YS9 A;  3I64 A;  4Y15 A;  2FML A;  3OYF A;  3FKJ A;  3K4N A;  4V2G A;  3OYM A;  2JVG A;  4UY8 I;  3OYL A;  2CH0 A;  3V8J A;  1OR7 A;  3MKY B;  3BG9 A;  3ERM A;  1VQL I;  4GFB A;  4ESF A;  2ZB9 A;  1YG2 A;  5JHF A;  2GXB A;  1FP1 D;  3U21 A;  4EEF G;  4HZF A;  1YHQ I;  1UAA A;  2R7O A;  4IEJ A;  4AYB A;  4DIQ A;  1ZK8 A;  3OSG A;  1S6L A;  4P96 A;  4G6Q A;  4A0Z A;  1F36 A;  1Y1W J;  4II2 A;  3CCL I;  3EDP A;  2QZ8 A;  5KK1 A;  4DW6 A;  4FAS D;  3CCU I;  1UHM A;  1A31 A;  1ZR4 A;  2HQA A;  1G59 A;  5FLX K;  1BR2 A;  1TP4 A;  4EGZ A;  2XPU A;  4A3F J;  3G4S I;  1JXS A;  2VBY A;  1CF7 B;  1SD7 A;  1ZG1 A;  1ZLK A;  1M1E B;  3CMA I;  1HW5 A;  3OS0 A;  2A07 F;  2LOO A;  1A6Q A;  3DU6 A;  1L0O C;  4QLC U;  2W85 A;  3G1O A;  4BAC A;  2LBF A;  4HYE A;  1LVA A;  2CS3 A;  3IKT A;  2EBI A;  2IS4 A;  3K1P A;  3CCY A;  4DGW B;  2VXZ A;  1YIJ I;  1VND A;  2L3D A;  4KNY A;  2R7W A;  1NG6 A;  3IL2 A;  2GIV A;  5FRO A;  2E19 A;  3ZMD A;  3ZQG A;  1YI2 I;  2DMQ A;  1FPQ A;  3HTS B;  2XAU A;  4G6D A;  2CUE A;  3LWF A;  5FKL A;  2DK8 A;  4F7Z A;  4G7H F;  3R6S A;  1YFH A;  1S29 A;  4F52 A;  2M8E A;  2E1C A;  4EAT A;  1P4W A;  2OTJ I;  2K9S A;  1DP3 A;  2K3F A;  2ZJP F;  4JK1 X;  1XGO A;  5KVR A;  2R7F A;  1TQM A;  5L3F A;  4QPQ A;  2DTR A;  4L9J A;  4EJO A;  2DBB A;  3AAF A;  2X1D A;  2KIS A;  2OAZ A;  3LSH A;  3ECH A;  3VOD A;  3K10 A;  4Y52 J;  1Y0N A;  5LHG A;  1QBJ A;  3QRF F;  3MCZ A;  1TLH B;  1I6X A;  1ZGW A;  1LE8 B;  1EF4 A;  1Z0X A;  4ZC3 A;  2HKO A;  5C4J J;  1BW6 A;  3S3O A;  5BOX A;  2VE8 A;  1T98 A;  5EEA A;  4XON A;  2XF5 A;  3TKY A;  4E4H A;  3U1D A;  1BN5 A;  2P8T A;  4KYW A;  5E17 F;  2OZ6 A;  1DU0 A;  3WTY C;  2NS0 A;  1WWX A;  1FP2 A;  2QA4 I;  4FCY A;  2OC6 A;  1D5Y A;  4C2T A;  3MD2 A;  5LHI A;  4ENM A;  2R5Z A;  2OQR A;  2L9N A;  3J80 K;  1XCB A;  5HVQ C;  1RUN A;  5EEG A;  1ETQ A;  5JVG F;  3BG5 A;  2E36 A;  2EIM H;  1V5F A;  1XSX A;  4M3D A;  4I99 C;  3WTX C;  2ZXH A;  4MO7 A;  2W48 A;  5E79 C;  4KIS A;  1FZP B;  5HS9 A;  3QAH A;  4ESB A;  1W0T A;  2TDX A;  3DV8 A;  1IXR C;  1UCR A;  3H9J A;  4NC8 A;  2NS7 A;  1LB2 A;  5BNG A;  2L54 A;  2KJC A;  2DCE A;  4XLF A;  2LR8 A;  2P5L C;  2VE9 A;  1GT0 C;  4KA4 A;  3CO7 C;  3LSK A;  4BQA A;  1JKR C;  2VOP A;  3B6A A;  5C44 J;  4Y33 A;  3SFZ A;  1LUJ B;  1HC8 A;  4OIP F;  2EB7 A;  4HOB A;  2O03 A;  4M9X A;  4RGS A;  3GLX A;  1ENH A;  1MJA A;  5L3C A;  1QO0 D;  2HDW A;  1JUP A;  2BHZ A;  4E7I A;  2W24 A;  2FU4 A;  2JSC A;  1MIJ A;  3M9A A;  1GUU A;  3D1N I;  4GYG A;  1DGR M;  3K4M A;  4X1E A;  1MSF C;  3CDL A;  1R9T J;  2GIZ A;  4XKW A;  3OYK A;  3U2R A;  1FYK A;  3S32 A;  2DFI A;  4Y4R A;  4RB0 A;  3ZCO A;  5M5X J;  1A36 A;  1R5I D;  5JR3 A;  3FIS A;  1YIO A;  5DEQ A;  2X6O A;  3NWT A;  2L9R A;  1V55 H;  4LG0 A;  1U8R A;  2EIJ H;  1HOM A;  1TZL A;  2P81 A;  2X48 A;  2EA2 A;  4M71 A;  5JHU A;  3PIO F;  4EV0 A;  2OD5 A;  5CVU A;  3QWL A;  2GZW A;  2YR2 A;  3QYB A;  5FD6 A;  2HGC A;  1Z7L A;  1V54 H;  1X2N A;  5CYV A;  2JA8 J;  3L2R A;  2LF7 A;  2YX4 A;  2PMU A;  3RPU D;  4WK8 F;  1X4O A;  1VTN C;  4IPA A;  3QP6 A;  4HDU A;  3LFU A;  2CO5 A;  4M73 A;  5E3M A;  3AFH A;  1UJ8 A;  2DA7 A;  5C3E J;  3R4K A;  1SFO J;  1LFP A;  2W00 A;  3M07 A;  4M6Y A;  3MVP A;  3F23 A;  1FMW A;  2GA1 A;  1Z6T A;  1T08 B;  3HIF A;  1KU3 A;  1X2M A;  1W36 C;  1UMQ A;  3RPU A;  3OYD A;  1PYV A;  1RR8 C;  1Z7U A;  3MKL A;  1BL0 A;  1SAN A;  3HZJ A;  1XX5 A;  1O7F A;  3OSF A;  2XAG A;  3F8C A;  2K9M A;  4I7H A;  2W4S A;  5F04 A;  2HQ5 A;  1VQ9 I;  2E1N A;  2EFP A;  4PFO A;  4NQW A;  1K4T A;  3HRT A;  2VBZ A;  2WAQ N;  4A3B J;  3FXU A;  3EUH C;  1LEA A;  4NC7 A;  1Z67 A;  2OCC H;  3E3V A;  2CYY A;  2RDP A;  3CP8 A;  1YQA A;  1ZRC A;  2K85 A;  3LOC A;  2DQL A;  2IXS A;  1RKT A;  3DEE A;  2LBF B;  3K2A A;  4L5J A;  5HS8 A;  2R7X A;  1BC8 C;  4UUV A;  4HAM A;  3OR1 C;  1FSE A;  4YFK F;  2KFD A;  3F22 A;  3DCF A;  2ZXI A;  2O3F A;  1S3J A;  5D4S A;  2ESH A;  2BXY A;  5EF6 A;  3CCR I;  5F0F A;  3IH4 A;  2RKH A;  4Q5S F;  3G1L A;  3DFG A;  3PUF A;  2CV1 A;  2VLA A;  1ULY A;  3EQL F;  3R0J A;  2F6C A;  3V7R A;  2KIU A;  5CVJ A;  3K0L A;  2PG4 A;  1DP7 P;  4RA2 A;  2BV6 A;  1ZG5 A;  4ZJZ A;  3PJR A;  2DA3 A;  4XID A;  1W7P D;  1A6I A;  3JR9 A;  3DTI A;  3CCJ I;  5H6Q A;  1XD7 A;  1KZH A;  2NVT J;  2R93 J;  2E7W A;  3J7A Y;  4IX7 A;  2RNG A;  2PLY A;  2FEZ A;  2LLK A;  3E6C C;  1ZH5 A;  3ISP A;  2Q8K A;  9ANT A;  3JRE A;  1R7J A;  3H92 A;  3KP6 A;  2IP2 A;  2QKL B;  4XN3 A;  2XRO A;  2X1C A;  3W6K B;  2Y30 A;  3WTW C;  1OIS A;  1UST A;  2F5C A;  1OFC X;  3GVA A;  5LFA A;  2R5Z B;  1FC3 A;  4KIT B;  2JTV A;  3PNY A;  3PSI A;  1JJ8 C;  3N4M A;  2O61 A;  1GV5 A;  4A0X A;  2Y0M A;  4FET A;  3LAP A;  2PJP A;  2UZK A;  1EV7 A;  5FKK A;  3HOY J;  3KP7 A;  4A3L J;  2C6Y A;  1KON A;  2H94 A;  2DA6 A;  2DQR A;  4E7L A;  4JX4 A;  2QQA A;  4HX4 A;  1R22 A;  2KRF A;  4KN7 X;  1ORK A;  3H35 A;  1E2X A;  4RBO A;  2X6W A;  4BDY A;  3PNV A;  3S2W A;  4BKX A;  4A0Y A;  1FX7 A;  3E5X A;  4O6J A;  5F6F A;  5HLI A;  1O3R A;  4CO8 A;  5IT9 K;  2X0L A;  3M7G A;  2ADU A;  3A1Y A;  3RKW A;  4OOI A;  2K86 A;  4HNV A;  5K7Z A;  2VKE A;  4GRI A;  1TNT A;  2OJE D;  4IVN A;  1FWZ A;  2M5W A;  1HKS A;  3QP5 A;  3CJT B;  2W84 A;  4ZDP A;  4EM0 B;  2Y2Z A;  4GYI A;  5D4R A;  2H27 A;  4F92 B;  2XVC A;  4IHX A;  1Z91 A;  5ILU A;  3OYC A;  1H9G A;  4OAZ A;  1YIT I;  2XDV A;  4AWX B;  5D5X B;  3E6B A;  1NK3 P;  3WU1 B;  3FX3 A;  1SD6 A;  1JI8 A;  5DD8 A;  3WHB A;  1Y8Q B;  2DFF A;  3MKZ A;  2L7F P;  2WAF A;  3OYB A;  5KHD A;  1SMY F;  2FNP A;  4BJ6 C;  1IDZ A;  2O7O A;  4LG0 B;  4Y7N J;  4LIV A;  4B48 A;  1MJB A;  2CMP A;  2DO7 A;  2WBM A;  3DP7 A;  3E5Q A;  4M3G A;  4BGD A;  1IG7 A;  3KZZ A;  3A03 A;  4ZYH A;  3E97 A;  4AC0 A;  2RN7 A;  2UUZ A;  4IJA A;  2ZBK A;  1SVL A;  1I1S A;  2LD5 A;  2AQE A;  2GM4 A;  2ZJQ F;  2OTL I;  3CF2 A;  1MBE A;  2XPW A;  1SVM A;  3V8K A;  4TV7 A;  4EM1 A;  4U88 A;  2HEO A;  2L7M P;  2D1V A;  2UXN A;  3OYI A;  4A2U A;  1QA6 A;  4XSX F;  3L2V A;  1A5J A;  3BR1 A;  1ZRF A;  3MN2 A;  5CQE A;  5L3B A;  4E7Z A;  1A04 A;  4ABZ A;  2PQ8 A;  3FIW A;  1IXC A;  2FE3 A;  3WTU C;  3TP0 A;  3OIP A;  1T56 A;  4AM3 A;  4QPO A;  2F5F A;  5DYM A;  1S8N A;  1KGS A;  4EJW A;  2OUM A;  1BI2 A;  1MD0 A;  3HDD A;  3HSR A;  3KYC B;  2JSP A;  2NYX A;  3CD6 I;  4NQW B;  3W6J B;  2DU9 A;  5D6E A;  4GO1 A;  3OYN A;  4D7M A;  1YRN A;  4KJZ A;  5HDN A;  2BW3 A;  3GO5 A;  3TQN A;  2B7E A;  1MJ9 A;  2ZCW A;  3VYT B;  1C0W A;  2EZI A;  4AVZ A;  2EH3 A;  1YJ9 I;  1APL C;  4PDK A;  3RKQ A;  1AU7 A;  2UV1 A;  4NUB A;  4LMY A;  1CF7 A;  2HZT A;  3HB9 A;  5JLX A;  2VT2 A;  4E70 A;  2DT6 A;  2CUZ A;  2RQQ A;  3WHC A;  4ENN A;  2XAQ A;  4HRI A;  2W82 A;  2L01 A;  2O0Y A;  3DKX A;  4XOT A;  4WXH A;  1PVE A;  1YS7 A;  2ZJ2 A;  5FGM A;  3Q9S A;  3H3V K;  2EZL A;  4UV8 A;  1K79 A;  5DS9 A;  4X0G A;  5GPA A;  1TWH J;  2K02 A;  5K7H A;  2EFO A;  3F8F A;  4NB5 A;  1RR7 A;  4LIU A;  3TP3 A;  3L2W A;  1EJ9 A;  3W3C A;  4L0Z B;  1OCO H;  5E3N A;  1DDN A;  2GOX B;  4OIQ F;  3ZQC A;  1JHH A;  2EV5 A;  2FBI A;  3JW4 A;  3NAU A;  2D45 A;  3OOU A;  2H8R A;  3BZK A;  2ID6 A;  4KIF A;  1FSH A;  1FYL A;  4MFE A;  3K70 D;  1QHH D;  1R49 A;  3FXR A;  2BBY A;  3LQR A;  5HLG A;  4XLH A;  3H3U A;  3I4M J;  2LKP A;  1ONV A;  3O8G A;  2QVO A;  2KDZ A;  3GTO J;  1V5E A;  5J47 A;  3BTJ A;  1S7A A;  3E0J B;  2DAO A;  2KDO A;  3DTE A;  4IRG A;  5B66 C;  4W97 A;  1ZG3 A;  2JUG A;  5M5W J;  3TL4 X;  3V7C A;  3M8J A;  3A01 B;  3GEZ A;  2O9L A;  3M4O J;  1G4D A;  3HKZ A;  5M5Y J;  2DDA A;  2FBH A;  3ASN H;  5ED4 A;  1FOX A;  2HTJ A;  3SDG A;  3BT9 A;  1N78 A;  3LST A;  3OIO A;  1MMG A;  5DUI A;  2QQ8 A;  1RKW A;  2DPU A;  2FD5 A;  1H0M A;  1WJE A;  1OR7 C;  5K5Q A;  1BIB A;  2V9V A;  4UHT A;  5FO5 A;  4RGX A;  4RB2 C;  1YTY A;  4G6T B;  3G71 I;  5AON A;  2CQ7 A;  4CYC B;  1VF9 A;  2FNA A;  4F55 A;  1D0Y A;  2UXX A;  1X3W B;  4UUS B;  4UVA A;  4A3E J;  4C30 A;  3IHU A;  4RLF A;  1RIO H;  2R7U A;  3I71 A;  3JSP A;  1U3E M;  4IHS A;  1YOV B;  2IS6 A;  2VON A;  3ML6 A;  2KHM A;  4ASN A;  1Y39 A;  2DN0 A;  2X9D A;  3FBN B;  5D5V B;  2QEX I;  2FF4 A;  3S14 J;  4C2U A;  2XC7 A;  1WJC A;  2BEO A;  2OQG A;  1U0J A;  4DNC A;  1HW2 A;  3VWB A;  2EFW A;  3ZPL A;  2WAD A;  2E2J J;  2X1E A;  5HLT A;  2UWM A;  1QGP A;  1IN5 A;  1E3P A;  3DU5 A;  3OMY A;  4PSW A;  4XKB A;  4OIR F;  2O6G E;  1ERD A;  3GTG J;  2COM A;  3KYL A;  2IA0 A;  4BJ5 C;  2Y75 A;  4NDL A;  3ZMU A;  2JA2 A;  2CJJ A;  1IRX A;  4E7J A;  2ESN A;  5J4Y A;  2EFQ A;  1K61 A;  1Y1V J;  1OMI A;  5FKM A;  4B8X A;  3ULQ B;  1ZAR A;  1IC8 A;  3S17 J;  1STZ A;  4MEY F;  5DCF A;  1RRJ A;  5GTH C;  3ZN0 A;  2OA4 A;  2XKP A;  3KFW X;  2NS8 A;  1T0F C;  2EIN H;  3NAR A;  1K6Y A;  2VT3 A;  3B02 A;  3BLY A;  1R23 A;  3BQZ A;  3KEO A;  5GAH J;  4LIT A;  3L9F A;  1BR1 A;  1EKE A;  3AKZ A;  2WWY A;  3IAM 2;  1U78 A;  3D5R C;  3FZV A;  4A3G J;  2MC4 A;  4XM3 A;  1NTC A;  5ICE A;  4F3Q A;  2P5V A;  3AL0 B;  2VKH A;  2FBK A;  2KLO A;  2HOE A;  1IUF A;  4XLN F;  4XRS G;  2JN6 A;  2DI3 A;  2FUG 2;  2A05 A;  3RI4 A;  2DA5 A;  2HVS A;  3PUB A;  1MSE C;  3CLO A;  4BHP A;  1YRN B;  3EUA A;  3ZMT A;  1V5G A;  2MGQ A;  1WH5 A;  2BW3 B;  3WU2 C;  3PL8 A;  1GLN A;  1TWA J;  3D0S A;  4HSR A;  2VB6 A;  4P9F A;  1MKM A;  1W1W E;  1X1P A;  2IAI A;  3DLA A;  2K9Q A;  3A2K A;  1F43 A;  5DTD A;  2M8G X;  1HDD C;  2JZY A;  2D2W A;  3H5N A;  4CCK A;  2BY2 A;  1G3Y A;  2MG4 A;  1XG1 A;  2H8W A;  2DLL A;  1N75 A;  1SFE A;  3OYG A;  2HWV A;  2QLZ A;  3ZQH A;  2VOD A;  1IJW C;  4O5V A;  2EPF A;  1J7K A;  2JMW A;  3P7N A;  3JAM Z;  4EMS A;  4U0Y A;  5IYD J;  3GX4 X;  1VI0 A;  2QM3 A;  1WZ2 A;  2BYV E;  4A93 J;  1ON1 A;  4I98 B;  2Y9Z A;  2LH9 A;  3ZMZ A;  1KU9 A;  4JQF A;  5B3S H;  2KPM A;  1WPK A;  1JGS A;  2NOG A;  1OLT A;  4HST A;  4L5E A;  4MTD A;  1Y0U A;  2B63 J;  1P4A A;  2M4G A;  1OCT C;  3HPH A;  3HPG A;  2W57 A;  1VQ4 I;  3MAJ A;  1TNS A;  5IP9 J;  3HC7 A;  3W2V A;  1DGW Y;  2DOE A;  1W5S A;  2ISZ A;  5BPI A;  1B1B A;  2VC1 A;  3E6M A;  1SC7 A;  2GOM A;  4N4N B;  1P9Q C;  4N4O B;  1R6R A;  1T0F A;  5B5E C;  3K4C A;  1BJZ A;  1NHA A;  4PJM A;  4BE1 A;  5H6R A;  1TBX A;  2VQG A;  2ZXJ A;  2KIQ A;  3GTP J;  4E7S A;  1P4X A;  3QOP A;  2LMD A;  1L3L A;  1HF0 A;  4CZC A;  5B1A H;  1KYW A;  4Z6Y A;  2M9H A;  4U87 A;  1QHG A;  4HNU A;  1O3S A;  1U9N A;  3KET A;  4RAG A;  4XRS A;  2XUB A;  3TOB A;  3TW7 A;  1Q1H A;  4F93 B;  3HOZ J;  4IL6 C;  3VSL A;  2HR3 A;  4ITV A;  3LQQ A;  2X6X A;  3GYH X;  1YO5 C;  2R7Z J;  3R60 A;  2KJB A;  3BCB A;  1GXQ A;  4EVI A;  4CXF A;  5KNL A;  2W7N A;  1G3W A;  4ZZD A;  1QZY A;  1MH3 A;  1ON2 A;  2LNB A;  1BOB A;  3BRO A;  4BY1 J;  5EDN A;  5DM6 F;  2WB1 A;  5DD4 A; 
#chains in the Genus database with same CATH homology
 4RDU A;  1XC5 A;  3F0C A;  1A6I A;  3JR9 A;  2XB0 X;  3BTC A;  2NVT J;  2R93 J;  2AHQ A;  4D7N A;  2MSY A;  1RPW A;  2LLK A;  1MBK A;  2PMZ N;  1TC3 C;  2OF7 A;  1ETO A;  1GVD A;  3LNQ A;  3CMY A;  3S16 J;  1VFC A;  1JGG A;  9ANT A;  3FK7 A;  3JRE A;  2YUS A;  3JRH A;  2L0K A;  2HOT A;  3BR2 A;  2Y30 A;  1U8B A;  3Q3S A;  4UUT A;  1OFC X;  3H0G J;  2R5Z B;  1JUS A;  2XGE A;  3TED A;  2HXO A;  4IHY A;  1JJ8 C;  3G1M A;  1WCM J;  1GV5 A;  3Q0V A;  5C4X J;  3ZQL A;  5FKK A;  3HOY J;  2DMN A;  4A3L J;  2EZK A;  4IHW A;  2HI3 A;  4IHV A;  1K83 J;  3S1R J;  1UHS A;  2DA6 A;  2HOA A;  1FTZ A;  1ZKG A;  1P7J A;  1FIA A;  4JX4 A;  1MNM C;  1JKQ C;  1ORK A;  1IV6 A;  2JWT A;  2Y31 A;  1JT6 A;  4BKX A;  2VKV A;  2WV1 A;  3JRF A;  1WGX A;  5EG0 A;  4HNV A;  5K7Z A;  2R5Y A;  2VKE A;  1QPI A;  3GTO J;  3S1N J;  2Y2Z A;  4IHX A;  2DMT A;  5E3L A;  2DA1 A;  5HOD A;  5EGO A;  4A3K J;  3JRC A;  2DTZ A;  4XK4 A;  1IDY A;  4C3I J;  3PO3 J;  3S1Q J;  1NK3 P;  2QCO A;  2LTP A;  3WHB A;  3PM1 A;  5GP9 A;  4XIC A;  4M6V A;  2XPV A;  2XB5 A;  3JRG A;  2L7F P;  4I6Z A;  1LE8 A;  1IDZ A;  1ETK A;  2O7O A;  4Y7N J;  3LSR A;  4V2F A;  4DYQ A;  1BW5 A;  4FIS A;  2GLO A;  3HM5 A;  4M3G A;  1IG7 A;  2EZH A;  3A03 A;  2XGD A;  5F0H A;  2VUM J;  4AC0 A;  2H1K A;  4A3D J;  5FLM J;  1B72 A;  5IPA A;  3SJM A;  2DA2 A;  2LD5 A;  2NVX J;  1G2H A;  1Q1V A;  2LK2 A;  4JX5 A;  3QPL A;  4MLO A;  2LY9 A;  1JKP C;  4AUX A;  3GTK J;  2GM4 A;  1TWG J;  2LFB A;  3E7L A;  2R5Y B;  3BR0 A;  2LVS A;  1MBE A;  2XPW A;  1DU6 A;  5J3L A;  2DMU A;  1ETY A;  2L7M P;  3K7A J;  4FTH A;  1WH7 A;  5M3M J;  3S1M J;  5FKN A;  1A5J A;  2JA5 J;  3BR1 A;  2CQQ A;  4B4C A;  3MN2 A;  5GPC A;  5FKO A;  2ECC A;  4ABZ A;  3FIW A;  1TWC J;  2YU9 J;  1LFU P;  5F1J A;  3TP0 A;  5FLV A;  3RZO J;  1FEX A;  1T56 A;  4M3B A;  1AKH B;  3W6V A;  1IRZ A;  2R0Q C;  3HOU J;  5J1Y A;  5EZG A;  5IP6 A;  3HDD A;  2Y0S N;  2MW8 A;  5IYB J;  2G0E A;  1X58 A;  1MBF A;  4DYC A;  4D7M A;  1YRN A;  1ETW A;  2I10 A;  1QVU A;  2DMP A;  2JJ7 A;  2O8K A;  2ME0 A;  2D5V A;  2AO9 A;  2L7Z A;  3ZQI A;  1AHD P;  4A3J J;  2M0C A;  2LP0 A;  2VPR A;  1ZR2 A;  3I4N J;  1ETX A;  3HOW J;  1HLV A;  2OPT A;  1I6H J;  1POG A;  4D5F A;  1HDP A;  4A3C J;  2EZI A;  2EH3 A;  3HGG A;  1APL C;  1FIP A;  4C3H J;  2JA6 J;  2FJ1 A;  3RKQ A;  3JRA A;  1AU7 A;  5JLW A;  2TRT A;  5M3F J;  1H8A C;  1ITY A;  3Q0U A;  1W0U A;  4JX6 A;  3HB9 A;  4FE4 A;  4D5C A;  5JLX A;  1RET A;  3A01 A;  3BR6 A;  4LOC A;  4MFD A;  1ZTR A;  3WHC A;  5IOY A;  2FX0 A;  1HCR A;  2CQX A;  2YS9 A;  2JA7 J;  1MH4 A;  3O8H A;  3H3V K;  2EZL A;  5DS9 A;  4V2G A;  5GPA A;  1TWH J;  5K7H A;  1MBJ A;  1RR7 A;  3BQY A;  3BG9 A;  3TP3 A;  4CYC A;  4GFB A;  2ZB9 A;  2E2I J;  5E3N A;  4UUS A;  2DA4 A;  3HGY A;  1JTY A;  5FJ8 J;  3ZQC A;  3FKI J;  3NAU A;  1JKO C;  4I76 A;  3BG3 A;  3OOU A;  3IV5 A;  1GDT A;  2H8R A;  4EEF G;  2ID6 A;  1NK2 P;  1U9O A;  4IEJ A;  4MFE A;  1ZK8 A;  1OJL A;  3VPR A;  3OSG A;  1Y1W J;  1F36 A;  2M2E A;  3I4M J;  3O8G A;  4DW6 A;  2KDZ A;  3RZD J;  4MIM A;  3BTJ A;  1ZR4 A;  1I3Q J;  2XPU A;  4A3F J;  3PO2 J;  4W97 A;  5M5W J;  3A01 B;  1PUF A;  2O9L A;  3M4O J;  3S2D J;  5M5Y J;  2CU7 A;  1QVT A;  3G1O A;  1B8I A;  2IEK A;  3SDG A;  3RQI A;  3CQZ J;  3BT9 A;  2EBI A;  1ZQ3 P;  3OIO A;  1UG2 A;  1RKW A;  2FD5 A;  1IGN A;  3CCY A;  1VND A;  2LKX A;  3HBL A;  2JK3 A;  4CYC B;  1VF9 A;  5J1R A;  1H89 C;  2E19 A;  3ZQG A;  4W1U A;  2DMQ A;  4UUS B;  1FTT A;  2ID3 A;  1RES A;  2CUE A;  3HEF A;  4A3E J;  5FKL A;  2GBY A;  5EG0 B;  2QF7 A;  4M3F A;  3IH3 A;  2E1O A;  1WI3 A;  4JP0 A;  2K9S A;  2DN0 A;  2ELK A;  1MBG A;  2X9D A;  5EGO B;  1E3O C;  4AYB N;  3S14 J;  1CQT A;  1OCP A;  4XID A;  2E2H J;  1JTX A;  4QSH A;  1PUF B;  2M34 A;  5IP7 J;  3HOX J;  2E2J J;  4Y52 J;  4XRM A;  1LE8 B;  3GBG A;  5F0C A;  1ZGW A;  2HOS A;  5EZH A;  2ECB A;  1Z0X A;  1EF4 A;  2R92 J;  5C4J J;  2Y9Y A;  1BW6 A;  3GTG J;  5IYC J;  3HKZ N;  5EEA A;  4J19 A;  4A3I J;  1FJL A;  3BR3 A;  4NDL A;  5F27 A;  1DU0 A;  2FQ4 A;  3L1P A;  3HOV J;  2CJJ A;  3TW6 A;  1D5Y A;  4FCY A;  1B72 B;  2XGC A;  2TCT A;  3QQA A;  2R5Z A;  4QTR A;  1K61 A;  1Y1V J;  5FKM A;  1IC8 A;  3JRB A;  3DEW A;  3S17 J;  1ETQ A;  3BG5 A;  3LSG A;  4M3D A;  3C2B A;  5J1U A;  2NS8 A;  3IH2 A;  4MO7 A;  3NAR A;  3BQZ A;  2CRG A;  3S15 J;  1U78 A;  2W48 A;  1MBH A;  4C3J J;  2NVQ J;  4A3G J;  1W0T A;  4BY7 J;  1NTC A;  2XRL A;  2NS7 A;  5BNG A;  2LR8 A;  4DYR A;  1GT0 C;  3FK6 A;  4X6A J;  1JKR C;  1IUF A;  3B6A A;  4FE7 A;  5C44 J;  1QRY A;  4S0H B;  4XRS G;  2JN6 A;  2HDD A;  2DA5 A;  4B3A A;  1MSE C;  3BR5 A;  3GTL J;  1ENH A;  4C2M J;  4BBS J;  1YRN B;  1JUP A;  1GUU A;  3D1N I;  1S7E A;  2MGQ A;  4X1E A;  1WH5 A;  1MSF C;  3CDL A;  1R9T J;  5IOZ A;  2K40 A;  1TWA J;  2N8G A;  1LFB A;  5M5X J;  2IAI A;  2K9Q A;  3FIS A;  1F43 A;  2X6O A;  2M8G X;  2L9R A;  3Q0W A;  5DTD A;  1HDD C;  3S2H J;  1HOM A;  2MG4 A;  2P81 A;  2RAE A;  1XG1 A;  2X48 A;  1ETV A;  3UKG A;  4QIW N;  1GV2 A;  3ZQH A;  1X2N A;  2WB1 N;  2NVY J;  2JA8 J;  1T33 A;  1IJW C;  2EQR A;  2JMW A;  3A02 A;  5IYD J;  1BA5 A;  1VI0 A;  5E3M A;  2CUF A;  1JT0 A;  4A93 J;  5E3O A;  2DA7 A;  5C3E J;  1SFO J;  2Y9Z A;  2DJN A;  1WPK A;  1Z77 A;  3MVP A;  2NOG A;  4A3M J;  3BTL A;  4L5E A;  2K9N A;  5EYR A;  2B63 J;  4B1R A;  1X2M A;  1OCT C;  1UMQ A;  2XSD C;  3MKL A;  1BL0 A;  1AKH A;  2HXI A;  1SAN A;  3ZQF A;  3JRD A;  5IP9 J;  3JRI A;  5F08 A;  3OSF A;  3GTQ J;  1JUM A;  3LSJ A;  5F04 A;  2HQ5 A;  5K7F A;  4M3E A;  1BJZ A;  2WAQ N;  1TWF J;  2ME6 A;  4A3B J;  3GTM J;  4JYK A;  3M3Y J;  1JJ6 C;  3GTP J;  1H88 C;  1I50 J;  3LOC A;  1HF0 A;  1RKT A;  1B8I B;  2IBD A;  3K2A A;  2VI6 A;  4A69 C;  1O4X A;  4DZJ A;  2M9H A;  3QPS A;  1U9N A;  4XRS A;  4BXX J;  4DZP A;  3SFI A;  3TW7 A;  3DCF A;  3HOZ J;  5EF6 A;  2KT0 A;  5F0F A;  3IH4 A;  1XS9 A;  3G1L A;  2R7Z J;  2COB A;  3ZOB A;  3GTJ J;  1MH3 A;  4G12 A;  2HYJ A;  3B6C A;  3LSP A;  3BTI A;  4BY1 J;  4BBR J;  5EDN A;  2DA3 A;  4RBO A;  1P7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...