2E2IJ

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dgtp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2e2iJ00
5F0FA 1NK2P 2GBYA 1Q1VA 2LY9A 1FIPA 1ETWA 2EH3A 2Y30A 2K40A 3BR3A 1MBHA 1PUFA 1HF0A 5DTDA 1ETOA 2EZKA 2JWTA 3FKIJ 3BG5A 3A03A 2EZIA 4UUSA 3LSRA 3S14J 5EZHA 4QSHA 1JGGA 5HODA 1TWAJ 5IP9J 1RR7A 3WHBA 3WHCA 2MW8A 2WB1N 3Q0UA 4BBRJ 4DZPA 2KDZA 1I3QJ 4D5FA 2FJ1A 5FLMJ 3IH2A 2NS7A 3PM1A 2XPWA 3FIWA 2K9SA 1DU0A 3TEDA 1H89C 3K7AJ 2ELKA 3JRGA 3E7LA 1WPKA 5C3EJ 5C44J 1ITYA 5F1JA 1BW6A 1ETXA 3TW6A 2D5VA 3MN2A 1X2NA 4GFBA 2NVTJ 3S2HJ 4IEJA 4XICA 1P7JA 5EGOA 2VKVA 4W97A 1ZK8A 2Y31A 4B1RA 4JX5A 1JJ8C 1XG1A 2COBA 5K7FA 3HBLA 3HDDA 5IP7J 1HDDC 2LTPA 1I6HJ 2L0KA 3ZQCA 1BJZA 1ENHA 2K9NA 9ANTA 5EYRA 3DEWA 2GM4A 3A02A 2FQ4A 1BL0A 2N8GA 5M5WJ 3FISA 2M2EA 5JLWA 2MSYA 4C3IJ 3NARA 2TCTA 2KT0A 2JMWA 1K83J 5FKMA 1AKHB 1BA5A 1GDTA 3JRCA 1Y1VJ 3JR9A 2Y0SN 3G1MA 3BT9A 2HOAA 4C2MJ 1GV2A 4BXXJ 3FK6A 2NVXJ 3HGYA 2VI6A 5BNGA 1POGA 1ETKA 1VFCA 1MBKA 2E19A 3H0GJ 4FE7A 4Y7NJ 3HGGA 1ZQ3P 5C4XJ 4XRSA 3HOZJ 3BTJA 1JKRC 4IHWA 3JRDA 4MFEA 1UHSA 2QCOA 3BQZA 3S2DJ 1X2MA 4M3GA 2M0CA 3HOUJ 2ECCA 3IV5A 3GBGA 3A01B 2CRGA 2CU7A 2YS9A 1ETVA 5FJ8J 3JREA 1MSFC 2X9DA 3ZQIA 1JUMA 3CCYA 4MIMA 2HDDA 1ZKGA 4A3KJ 3BR0A 3HM5A 3ZQFA 2DA2A 1WCMJ 3BR1A 1PUFB 3MVPA 1TWGJ 3S1QJ 3BR6A 2OPTA 3PO2J 4AC0A 2XGDA 4CYCB 4I6ZA 5M3FJ 2JK3A 2ZB9A 1DU6A 3BTIA 2DMQA 2HXOA 3M3YJ 3OIOA 2LD5A 1JT0A 3HOWJ 3OSFA 1IJWC 2EQRA 1ZTRA 5EZGA 1ZR2A 1MSEC 3GTQJ 2CUFA 1IUFA 3BTCA 2NS8A 3ZOBA 3LOCA 4DW6A 1Z77A 4J19A 2WV1A 2X6OA 1MBEA 4HNVA 2TRTA 3HOXJ 4G12A 1K61A 2E2HJ 1JT6A 2EZHA 1QVTA 4UUTA 1ETQA 4B3AA 1R9TJ 2RAEA 5F0CA 3F0CA 4A69C 3SJMA 4L5EA 4D7NA 2LR8A 3G1LA 2K9QA 1T33A 2DMTA 1CQTA 2ID3A 1B72B 1U9OA 1A6IA 1I50J 5JLXA 3OSGA 1T56A 4A3GJ 1GV5A 1AU7A 3I4MJ 2AO9A 1B8IA 5GPCA 1YRNB 1APLC 2MGQA 3CDLA 2DMNA 1GUUA 3HB9A 3GTLJ 3S15J 4UUSB 4A3JJ 1AKHA 1UMQA 3FK7A 1JKQC 1F36A 4Y52J 3LNQA 4JX6A 2JJ7A 3TW7A 4QIWN 4D5CA 3JRBA 4XIDA 4M3DA 4A93J 5E3OA 3QQAA 5F27A 3NAUA 3BQYA 4C3HJ 3LSPA 1S7EA 1ETYA 3Q0VA 1FIAA 2GLOA 1G2HA 4B4CA 3GTMJ 1IDYA 2HOTA 5GP9A 4M3EA 2LFBA 1SFOJ 3ZQLA 3HOVJ 1X58A 2XPUA 2XB5A 2HOSA 2DJNA 1YRNA 1JKPC 4FCYA 3BR2A 4JP0A 2LK2A 2L7FP 2O9LA 2Y9ZA 2R93J 5FLVA 3GTOJ 3JRIA 1IG7A 3H3VK 3IH4A 2E2JJ 1RKTA 1D5YA 2B63J 5IYDJ 4AYBN 2QF7A 1VI0A 3BTLA 1IV6A 5C4JJ 5IYCJ 2R0QC 2P81A 4BY1J 1B8IB 2XRLA 5FKLA 3S17J 2R5YA 1XC5A 2O7OA 2LLKA 2L7MP 5IPAA 2JA7J 1WGXA 3BR5A 2JA6J 1FTZA 3TP3A 3I4NJ 1HCRA 1E3OC 4D7MA 3JRFA 1ZR4A 1IC8A 1U8BA 2YU9J 2PMZN 1MBGA 3OOUA 5F04A 4M6VA 1NTCA 3LSJA 1LE8A 3S1NJ 2FD5A 3MKLA 2L9RA 2Y2ZA 5J3LA 5M5XJ 1OCTC 2W48A 1ZGWA 4BKXA 1NK3P 1IDZA 2WAQN 2CQQA 2FX0A 1TWHJ 1U78A 5E3LA 5FKOA 1H88C 2R5YB 2E1OA 3GTJJ 2DA3A 1TC3C 1MBFA 4XRSG 4X6AJ 2HXIA 1ORKA 3GTGJ 3GTKJ 4S0HB 1MH4A 3CQZJ 4FISA 4W1UA 3S1MJ 1TWFJ 4M3FA 2I10A 2DN0A 2AHQA 4RDUA 2LVSA 3HOYJ 4CYCA 2JN6A 4V2GA 2OF7A 3RKQA 4IHXA 1IGNA 3LSGA 4A3EJ 4MFDA 5GPAA 3L1PA 1MNMC 5E3MA 2JA5J 5K7HA 3VPRA 5E3NA 2YUSA 1JJ6C 2IAIA 1FTTA 1Z0XA 4X1EA 2LP0A 2VUMJ 2NVYJ 4A3CJ 5J1RA 2ECBA 3HKZN 4ABZA 2CUEA 4A3FJ 2X48A 1MBJA 2IBDA 3K2AA 1FEXA 2O8KA 2VKEA 4DYRA 1B72A 1JTYA 2EBIA 2ME6A 1WI3A 2CQXA 5EG0B 1RETA 3D1NI 1W0UA 3B6AA 2JA8J 1HDPA 4I76A 3SDGA 4XK4A 1GVDA 1UG2A 3Q0WA 3RZDJ 1H8AC 1A5JA 2DA4A 5M5YJ 1EF4A 4FTHA 3IH3A 1AHDP 3UKGA 3BG3A 4LOCA 5K7ZA 4A3MJ 4A3IJ 2M9HA 4RBOA 3G1OA 1QPIA 2H1KA 3M4OJ 4QTRA 5F08A 5IOYA 2R5ZB 4JX4A 2ID6A 1JTXA 3ZQHA 1FJLA 3C2BA 2HQ5A 1RKWA 1WH7A 5J1UA 1O4XA 3RZOJ 4DYCA 3BG9A 1OJLA 2H8RA 2XSDC 1P7IA 2ME0A 1U9NA 1JUPA 2DA6A 4IHVA 5IYBJ 5J1YA 5DS9A 2R7ZJ 4BBSJ 5FKNA 5IP6A 4AUXA 3QPLA 4A3DJ 1VF9A 3DCFA 2DA1A 2R92J 1IRZA 2HYJA 1LFUP 3JRHA 3W6VA 3JRAA 2IEKA 2DMUA 2M34A 1BW5A 2G0EA 1TWCJ 4DYQA 2NVQJ 5IOZA 5EG0A 2DMPA 1LFBA 1OFCX 3S1RJ 1MH3A 1VNDA 4C3JJ 1QRYA 1JUSA 5FKKA 2M8GX 2L7ZA 5EEAA 4V2FA 1F43A 2NOGA 2LKXA 3TP0A 4JYKA 2EZLA 3ZQGA 2DA5A 4A3LJ 3SFIA 5EF6A 4XRMA 1HLVA 1JKOC 5EDNA 3O8HA 3Q3SA 3S16J 2VPRA 4IHYA 4BY7J 1GT0C 2Y9YA 4DZJA 4EEFG 4M3BA 3QPSA 3B6CA 3A01A 2DTZA 3GTPJ 1HOMA 2XGCA 3CMYA 1W0TA 1WH5A 2XGEA 4NDLA 2R5ZA 4FE4A 4A3BJ 2XPVA 5M3MJ 2DA7A 2CJJA 1RESA 5EGOB 2E2IJ 2XB0X 1SANA 4MO7A 1LE8B 5F0HA 1QVUA 3RQIA 4MLOA 3HEFA 2HI3A 1Y1WJ 3O8GA 1XS9A 2MG4A 3PO3J 1RPWA 1OCPA
chains in the Genus database with same CATH superfamily
1NK2P 2F5DA 4RAYA 2GBYA 4PGGA 2LY9A 3N05A 5HDKA 1ERDA 2IGOA 4F3QA 3BR3A 4F92B 1MBHA 3JAMZ 2Z5UA 2JWTA 4UY8I 1DPRA 3BG5A 4ZYDA 1BI2A 2F48A 5J6XA 1ZN2A 2DQRA 5FGMA 3S14J 1YITI 2DPDA 2X6WA 1TWAJ 4U7BA 5IP9J 4Q4ZF 3FXOA 3IHUA 3SXYA 1O57A 1HW2A 4HF2A 4PSXA 3Q0UA 4QPQA 3CC7I 2CYYA 4D5FA 1TW2A 5FLMJ 3FMSA 4KT6A 2HS5A 2LSOA 1P4XA 3MEXA 4A12A 3J81K 1D3YA 2EILH 4KICA 4KA4A 1FNNA 2BE5F 2K9SA 5IY5H 4LIVA 1H89C 4IPAA 3RCOA 2HQNA 4RS8A 1LDKB 5CVVA 3CC2I 3W6KB 1P4WA 2ICWG 2R4GA 3CZ6A 1MZBA 1X2NA 2X85A 1BIAA 2KPMA 3MN2A 2D5VA 4GFBA 1U2WA 1LQ1A 2NVTJ 1K7AA 2IS4A 2EPFA 1SMTA 2HDWA 4XICA 1G3TA 1YYVA 3DTIA 3GXOA 4A0ZA 4CZCA 3K0LA 4ZYAA 2PJRA 2R7TA 4ITVA 4N9HA 1R5HA 5CYVA 1PYVA 3H3UA 1W7PA 3G6EI 1PVEA 5GTHC 3HDDA 4CCNA 5IP7J 2K3PA 2X1CA 4CDGA 1I6HJ 2E5NA 2VJ5A 4BXUA 1XGNA 1XMAA 2XVCA 3IKVA 5EYRA 1LDDA 1SFEA 3HKZA 2FQ4A 4LIUA 4KT5C 2LBFB 3FMRA 4HNUA 2ZJPF 5JLWA 5HLGA 3FHNA 1T39A 1XMKA 3GFJA 3M7GA 3I59A 1GVJA 1IO2A 5K5OA 2H09A 2NYXA 2VT2A 1YW8A 2KZGA 1K83J 1MGTA 3ASNH 3EETA 3WGGA 3G1MA 2R7VA 1YOVB 2HOAA 2JTVA 4DIQA 1Z7LA 2VBZA 4XLEA 1GLNA 5D4RA 2P5VA 1SAXA 3OS0A 1TLHB 1V54H 1POGA 4QLCU 1IRGA 1VFCA 1Z1DA 1X1CA 2QKLB 1IAWA 1WJ5A 2RGVA 3H0GJ 2LC2A 4LLGF 4Y7NJ 3HGGA 2EIJH 4CO8A 2DW4A 2QBYA 1DUXC 1T0FA 2HQAA 5DCMB 3FXRA 3H9GA 3WODF 1TL8A 2HZDA 1R22A 1UHSA 3EDPA 2RNGA 5GAHJ 1N78A 2QCOA 1Y6IA 3BQZA 5DM6F 2V1XA 3DF8A 1UAAA 2HDCA 4M3GA 3KP6A 3BROA 1I1SA 2AXTC 2F4MB 3QYFA 3J81Z 4MGRA 4YG2F 1IN5A 1K78B 1OCRH 3GLXA 2E5ZA 2BYVE 1MSFC 3RIRA 2X9DA 3CCVI 3MZHA 3CUQB 4M6YA 2HDDA 2ZXJA 1W1WE 4RLQA 3AG1H 1RUOA 4C2UA 3HRUA 5E1XA 3PO2J 5K5RA 1YX5A 2XGDA 2D1VA 2X6YA 2XC7A 4I6ZA 4AYBA 2ZB9A 3G71I 2DMQA 2HXOA 3ABTA 1EH6A 2CW8A 2NXNB 1JT0A 3F9KA 3HOWJ 1E0EA 1HKTA 2HKXA 3CJNA 5EZGA 4BJTA 3PFYA 2GXBA 2VE8A 1IUFA 3ISPA 4B47A 3BJ6A 1T95A 3AL0B 4G6DA 5BS6A 1A31A 2F5VA 3I3LA 3ABMH 4UVAA 1V5FA 1KYWA 1X3ZB 2QA4I 1PJRA 1Z05A 2MD5A 4BQNA 4CZZA 1N77A 2OU2A 3HZJA 1JT6A 1Z6RA 4NB5A 1PUEE 4Y3OA 1PP8F 3P9CA 2RAEA 5F0CA 2WAQA 3CCSI 4A69C 2DDBA 3CLOA 5F6FA 4RGSA 4E7KA 3TQNA 5F1RA 4E7IA 1FT9A 1T33A 1MMNA 1U9OA 1A6IA 5DDGA 4XSXF 1G3WA 3I53A 1LKXA 2G7UA 2JZYA 1ZYRF 2JRMA 2HTJA 2KFDA 3PSIA 3I4MJ 1RI7A 1HA8A 2NS0A 1YRNB 1APLC 2B9SA 3WU0A 3OIQA 4F52A 2DT6A 1NHAA 3BG6A 3WU1B 2X1DA 4NUBA 2CSOA 2ZXWH 4YEJA 4BE0A 4Y52J 2BY0A 2JSPA 4JX6A 1FYKA 2BY2A 2MA3A 4QIWN 4D5CA 1KQ0A 2R7WA 3QQAA 3SQNA 2ESNA 5D8KB 3NAUA 4BDZA 2VPLA 4QPOA 1I39A 4AM3A 5GADJ 1T0FC 2EB7A 1YIJI 3EPZA 5JI6A 1B59A 2VKHA 1XCVA 2XAJA 2MABA 1HKQA 5HLTA 1JKPC 2JQ7A 2DAOA 4FCYA 2ADUA 1WQ2A 4XM3A 3BR2A 4XLPF 5AIQA 3MWMA 1R58A 4CYDA 3HSEA 1XMXA 3V7CA 3QOEA 3JRIA 3HUGA 1R1VA 3F8BA 2A05A 3EYYA 1RKTA 2E2JJ 2B63J 5IYDJ 2J5PA 3BTLA 4LG0B 3GEZA 5J8FA 3E6BA 1BR2A 2MYSA 2XAUA 2ESHA 1TQMA 2R0QC 2VXZA 2Q1ZB 3DKWA 5HS8A 4BY1J 4KIFA 1B8IB 2XRLA 1MMDA 1IXRC 2F4IA 1GXQA 2QENA 3OOPA 4BACA 4GYIA 1XC5A 2O7OA 2ZMEA 2LREA 1KU3A 3KLNA 3QPTA 1HCRA 3EUKL 4AIJA 2RREA 2XDVA 2M45A 1U8BA 1MBGA 4ZYGA 3JTGA 4BDYA 4BQAA 2UXXA 2CW0F 2UUZA 3E97A 1X1BA 2UV1A 2L9RA 3U2RA 3LFUA 3CJRB 2FBKA 3QYBA 2QLZA 1OYIA 1NH3A 2M7AA 2IGNA 4YELA 1BM9A 5CPRB 4BH9A 1EKEA 5FKOA 2VASA 2PMZA 3DBLB 3C2HA 1H88C 2R5YB 2B0LA 1T08B 5CVUA 1TC3C 2V9VA 3GTGJ 2IGMA 4I0AA 3I9V2 3CQZJ 3RDIA 3S1MJ 1R6RA 2M3AA 4UXNA 5LD2C 1RC9A 1XDUA 1U6GA 2O5RA 2LMDA 4NBQA 4KNYA 2Z99A 3OIPA 4V2GA 2OF7A 1TT0A 3RKQA 1IGNA 4MTDA 2EIMH 4HLYA 4CICA 1FPQA 5GPAA 5E3MA 2K85A 3CCQI 3DV8A 3H9JA 1JJ6C 4WXDA 5DUKA 3CJQB 5DV5A 3V7RA 2NVYJ 1BC8C 2VUMJ 1S9HA 3HKZN 3J7AO 5E8IA 4A3FJ 1ZG1A 2VOOA 5LEJA 1SEUA 2IBDA 2HQRA 1G3SA 3I71A 2V7FA 1S7OA 2ZMEC 2VKEA 2RQQA 2CFXA 3HTSB 2EBIA 1U5TB 3FXKA 3OL3A 3B6AA 1J7KA 3SZTA 3W2WA 4Q47A 1BOBA 4HPQA 5GAGJ 5L3DA 1TZLA 2M0MA 3F8NA 3IH3A 3UKGA 2O3FA 3ZGKA 3ZMDA 4A3IJ 5DD4A 1MNEA 2BXZA 3KEQA 4RBOA 1W7PB 1QPIA 3M4OJ 5E1WA 2K02A 4QTRA 5F08A 5L3CA 3GZ6A 2R5ZB 2BY3A 2IA1A 2ID6A 1LB2A 4PZJA 3KZYA 2L3DA 3BCAA 3I58A 2HQ5A 3BG9A 2L9NA 2R7FA 2H8RA 1R4MB 2ME0A 4Z2YA 1U9NA 1XGOA 3DEUA 1TTYA 1HW1A 3BC8A 3KEOA 3ABLH 1ZRDA 3MKZA 4JQFA 1JUPA 2QM3A 5ICGA 4KMUX 4OIPF 4HEA2 5DUIA 5IYBJ 4G94A 1EV7A 1L3LA 1TW3A 2P6TA 3FBNB 1S8NA 2R7ZJ 1VF9A 2F6CA 2JVHA 2R92J 4NQWB 2UWMA 2K9LA 1FY7A 2HYJA 2YU3A 2Z3YA 3JRHA 4LB6B 3JRAA 2ZJRF 2A07F 4S04A 4DYQA 1TWCJ 3DP7A 3PSFA 3BZCA 1NG7A 3GLLA 1LFBA 3RTRA 3MKYB 2QBYB 2HWVA 5B5EC 3LSTA 1JUSA 3U1DA 3WGIA 3OYHA 3PNYA 3HIFA 3OYMA 3H3ZA 1FP1D 1YHQI 3TP0A 2EZLA 3ZQGA 1IW7F 5FO5A 3QOPA 1MJ9A 3SFIA 5EF6A 3RPUD 3O8HA 3Q3SA 3S16J 3B73A 3ZQ7A 4DJAA 2Y9YA 4ANJA 4DZJA 3QP6A 4EEFG 3K70C 2E1NA 2XSJC 3CLQA 3W6JB 4M3BA 3QPSA 1HSTA 2CWEA 4A2UA 3CTAA 4P96A 1WH5A 3VSLA 4NDLA 1SVMA 4FE4A 4A3BJ 2XPVA 4KITB 5M3MJ 3WTUC 4YIIA 3BPVA 2CFOA 5JVTA 2HVRA 4AIDA 5EGOB 2LF8A 3HPGA 4TV7A 3LA7A 3L2UA 5F0HA 1QVUA 3HOTA 4MLOA 3HEFA 4IRHA 1R1TA 3O8GA 4MNUA 1QO0D 3CMEI 1I6XA 2MG4A 3PO3J 4GRIA 4Y13A 3GX4X 1WJEA 1Q1VA 3ZP5A 1FIPA 1VQPI 2AS5F 1EH8A 4RGXA 4G7ZF 2A6EF 1HF0A 3CP8A 2W7NA 1ONVA 3H1CA 5DTDA 4BEHA 4UUSA 3L7WA 2FRHA 3OYJA 3KP2A 3FKJA 2V6CA 2PMUA 4LD5A 4OU0A 4XKVA 4N0BA 3S3NA 5HODA 3MZYA 3GF2A 2GA1A 3HG9A 2IS2A 1XCBA 1MMAA 2TDXA 2K86A 4MQVA 2QQ9A 4ESBA 3KP3A 2OC6A 2KDZA 4H0EA 3GFMA 4B8XA 3I5UA 2IVMA 3OYLA 1VQ4I 2K3FA 2DYRH 2W82A 5BPIA 1E2XA 4EGZA 3PM1A 4OMYA 1K6YA 2LOOA 4XR6A 2VJ4A 4BXFA 5BQTA 3TEDA 1TQPA 4P5OA 3LL7A 1SD5A 2ELKA 2RVCA 3FXQA 2C6YA 3L9FA 4LG3A 5C44J 5LRSA 1ITYA 2VONA 2DK8A 1BW6A 1ETXA 4G9YA 3TW6A 4RGUA 3PIOF 5JFRA 3FX3A 2X0LA 5JHFA 3S2HJ 2QSGX 2L7KA 1P7JA 3DXJF 2QSHX 3QAHA 5LHGA 5EGOA 4RGRA 1E3HA 2DFFA 2HVQA 4BHPA 3JAMK 2OCEA 2ZBKA 2OV7A 1E3PA 4B44A 4RB0A 2Y31A 4B1RA 1Y0UA 4JX5A 4O5VA 2F5EA 3C1DA 2ISYA 1Z6TA 3L09A 2ZXIA 2COBA 4RAZA 3HBLA 4X0GA 4XLFA 5KK1A 3OYNA 4L0ZB 2LTPA 3H35A 2K9MA 4G7OF 1ENHA 2GIZA 9ANTA 3M8FA 2IA0A 3F23A 2PX9A 4JK1X 3DBHB 4LITA 5L3FA 1T38A 4A5NA 1BL0A 3FISA 2V79A 3J7YJ 5ICFA 4UV8A 2MSYA 1LPQA 1XTAA 3EUAA 2VB6A 4HDUA 2HGCA 2O6GE 4D0PA 3RJPA 3VB2A 3DTEA 3D5SC 3QPHA 4NQWA 4LFUA 4XOPA 3JR9A 2Y0SN 3EQLF 2HYGD 1IRFA 3K1NA 4C2MJ 2OBPA 3NWSA 4BXXJ 5FRNA 2VJJA 1UG0A 3DTKA 3TDUC 5BNGA 3LMMA 1ETKA 5CVJA 3TO7A 1JE8A 3S93A 1F9NA 2X6XA 1KYZA 4JOMA 3S8PA 1ZQ3P 3HPHA 1Z67A 5C4XJ 3N4MA 4F93B 3GMEA 3K6GA 2HYFA 4F91B 4U87A 5E17F 2NRAC 3R61A 4ON0A 4A0XA 1VQLI 2QEXI 4ZTFA 2ZFWA 2RKHA 1EJ9A 2RQPA 1FOXA 2W24A 3TO6A 3IV5A 1X4PA 1KQ9A 2EIKH 2CRGA 3PQJA 1UB9A 1ETVA 1IZ1A 2BVLA 3CD6I 3JREA 2XAQA 3ZQIA 3I54A 1R71A 3HM5A 2HTSA 1ZLJA 3PUFA 2F4OB 5CVRA 1D0ZA 1A04A 1LVKA 4XN3A 2L4MA 1H9TA 3UNGC 2FA5A 1B1BA 4IL6C 1TNTA 3TOBA 3CUQC 4A6EA 5FB2A 1DU6A 1QBJA 4CSWA 1U5TC 1V5EA 3H36A 4XBFA 2M4KA 3L2CA 4KN7X 1D0YA 2LD5A 5IT3A 1IJWC 1QZEA 4WXHA 5B1BH 3REOA 3BCBA 2MD0A 1ZR2A 1MSEC 3GTQJ 1WI9A 2CUFA 1WFXA 2FEZA 3BTCA 3ZOBA 3FBIB 3LOCA 2RN7A 2PLYA 2IRFG 4DW6A 3KETA 2AQEA 1Z77A 4J19A 3SFZA 2X6OA 4EGYA 1MBEA 2CGPA 4IZZA 1Z91A 3HOXJ 1IF1A 3MZ8A 2L02A 4UUTA 4B3AA 5FROA 3F0CA 2OAZA 1BI0A 1X1AA 3SJMA 4D7NA 2P7VB 4HX4A 2K9QA 5ICEA 1WKMA 3C18A 4IX7A 1CQTA 2XF5A 1B72B 3OYDA 5JLXA 4PJ0C 3SHFA 1MJAA 5IT9Z 3RKXA 4ESFA 4U0WA 3KZZA 3VDXA 2F5FA 1UHWA 3KYDB 3L2VA 3E5XA 2VC1A 3CDLA 5FFZA 3PNTA 2ZJQF 1LDJA 4BEHB 2HVSA 1GUUA 3S15J 3ZXSA 4UUSB 4P1WA 1X1PA 2EWNA 1UMQA 3FK7A 1F36A 5HLIA 3WTVC 3LNQA 3CCLI 4KISA 2JJ7A 3TO9A 3JRBA 2QQBA 2I8DA 2YX4A 5E3OA 4IRIA 2K27A 4C3HJ 3Q0VA 1G2HA 4B4CA 3GTMJ 3BOQA 3P7NA 1A6QA 4L9VA 5GP9A 2LFBA 4C30A 3T8RA 5B66C 5FD6A 4FQGA 2CUJA 1USTA 1X58A 2QSFX 3ZQLA 3HOVJ 2XB5A 2BHZA 2MLKA 3HUGB 1REPC 1OR7C 2EFNA 3CP2A 4LK0F 4OOIA 3K4LA 4LMYA 2LK2A 5AIPA 2Y9ZA 3ECOA 4NC6A 3KPHA 1YJNI 2R93J 5FLVA 4O6JA 2LBFA 2QQ8A 1IG7A 1YLFA 2DT7B 3IH4A 1D5YA 2CQKA 4A0YA 2Y0MA 4BL0B 2QVOA 4PSWA 1DGRM 4XMYA 4CCOA 1O3RA 1BJAA 1IV6A 5C4JJ 2EK5A 2FQ3A 4FHTA 5F64A 2NAZA 5EEHA 4E4HA 2STTA 4I02A 1RNLA 1JHFA 2PEXA 2COMA 2L7MP 4N4OB 2FSWA 5IPAA 2XHKA 2WY7Q 1WGXA 2FE3A 1FTZA 3TP3A 1E3OC 3AL0C 4D7MA 1W5CC 1HXDA 1IC8A 4BE1A 3DKYA 3KYCB 3OOUA 4M6VA 2WAFA 3OY9A 3CCRI 3EUHC 2YPRA 1LE8A 2V26A 2ELJA 4HSRA 2NVUB 3K10A 2ZFUA 2Y2ZA 1X1DA 4PK4A 3RSNA 3VYUB 2ZO4A 3P9IA 2W48A 2DQLA 1ON1A 2VQGA 2WAQN 5D6FA 3MKWB 3QRFF 1SVLA 1FLIA 4HX8A 4M9XA 1RZ4A 1YIOA 2MLGA 1QQIA 4WXCA 3H92A 3AAFA 1N75A 3LWFA 4B3XA 3GTJJ 4DQ2A 2HXIA 1ORKA 4PFPA 2ZJ2A 2KIFA 1FBQA 4S0HB 1XPXA 3WTZA 4XOTA 4XLAA 4ZZDA 3O6BB 1JGSA 2DN0A 3CESA 1IN4A 3ZMSA 4RDUA 3HOYJ 5LRRA 3E1SA 2Y48A 5TRDA 5L3BA 1S72I 5A2QZ 2JA5J 5K7HA 3DU6A 3VPRA 5E3NA 4KN4X 1PP7U 2GWRA 3FXMA 2IAIA 4E7LA 4KYWA 1FTTA 2LP0A 1L0OC 2FBHA 3ECHA 5KHDA 4LG0A 3TGNA 4A3CJ 5JHUA 2E35A 4EVIA 5HNHA 3X2QH 1STZA 4B43A 1M1EB 2CUEA 3HL2A 2B7EA 4XNFA 2V1NA 4HYEA 4FX0A 3P9KA 4IOAF 2O8KA 2EV0A 2ME6A 2CQXA 1W0UA 2IJLA 1D1CA 2JA8J 2P0WA 3SDGA 1FWZA 1VQ5I 1GVDA 3Q0WA 1H8AC 5M5YJ 2YX7A 3J7ZI 1FSHA 1AHDP 1OCCH 3BG3A 3LQQA 3OMYA 1TP4A 4PJMA 4RAGA 3UR3C 3RI4A 1DP3A 4RA2A 1FMWA 1JTXA 2M7BA 3KZIC 4MTEA 3ZQHA 1RIOH 1FYMA 4RB3C 3MFKA 4ZC3A 4I99C 1WJDA 4HG2A 1RKWA 1WH7A 3LSIA 4DYCA 4GO1A 3KE2A 2XSDC 1ACIA 1EA3A 2WB1A 4I98B 4D9JA 1XD7A 3LAPA 4L9JA 2UXNA 2CG4A 1QZYA 1LVAA 3ERMA 2PI0A 4WF2A 4JBAA 4EJOA 3VFZA 4KJZA 4QWQA 3CCMI 3EYIA 4BBSJ 1BI1A 5FKNA 5IP6A 2OJED 3M8EA 2A6HF 2XAGA 2DXIA 1SD7A 3DCFA 2CQ7A 2PN6A 1IN6A 1X19A 2Z2SB 3BG7A 3V42A 2IEKA 1I5ZA 2M34A 3Q9SA 1XX5A 3QP5A 2XAHA 5IOZA 2DMPA 1KU7A 1IV8A 2MBFA 1LUJB 3HJEA 1FOYA 2OA4A 3GVAA 2W85A 2WBMA 4HV5A 3Q9VA 3V8LA 4V2FA 2ZMEB 3DBRB 3T8TA 2DT5A 2PBIA 3MCZA 4AWXB 1ZRFA 2OTLI 1MDMA 4E6KG 3GZNB 2WAEA 3FHZA 5CKTA 3R0AA 3GUDA 4RB1A 3NWTA 3B6CA 3GTPJ 1HOMA 2DTZA 2XGCA 2DTRA 4R79A 2A68F 3R0JA 2HZTA 2IS1A 4BUPA 1O7FA 4EQQA 1Q1HA 3DPUA 5J47A 3QWLA 4RMNA 2DU9A 1RESA 2JVGA 2EINH 2E2IJ 4HZFA 1YE9A 4E7HA 2XIGA 2XB0X 1R49A 1SANA 1LE8B 3BP8A 1W36D 2DODA 4EM1A 3RQIA 2HI3A 3ZMUA 3COAC 2FOKA 5LHIA 1YTYA 1K78A 1MNDA 1MMGA 1OYYA 1OCPA 1WWXA 1ZGAA 4IHTA 2M1BA 3DLAA 4L9TA 1R1UA 2EH3A 1Y8RB 3KEYA 1S6LA 3F6VA 2HFHA 2DFIA 3L2QA 2E36A 2AQFA 1AOYA 1O3TA 1FP2A 2EZKA 3ZRGA 4YRVA 3A03A 4Y15A 5TISC 4MEXF 3LSRA 2VOPA 2W1OA 1NG6A 5KNLA 5EZHA 5LEKA 4HF1A 4XRFA 5D6EA 1JGGA 1OMIA 2STWA 3CDHA 4KIBA 1HC8A 3T5XA 1RR7A 3WHBA 1R4NB 2MW8A 3PQKA 4BBRJ 4DZPA 2R7SA 2IGKA 2X51A 4Q48A 3OYCA 2VIXA 4L5JA 4IF4A 5GAEJ 3V4GA 2FJ1A 3OYEA 4HQMA 4B48A 3IH2A 1DDNA 2NS7A 2WV0A 4WK8F 1MDMB 2XPWA 2CO5A 2DOAA 4H4KC 1DU0A 2WC2A 1P9QC 1YS7A 1SFUA 2RV8A 2A6TA 4HAMA 4XORA 2ELHA 3E7LA 5E20A 5C3EJ 3JRGA 4C2TA 5F1JA 1GXPA 1VQKI 3RPUA 3IRQA 2JA2A 3ABUA 4CCJA 3LA2A 4BAYA 1ZREA 3TL4X 4I2OA 4P55A 2KQRA 2ZC2A 4XKBA 4CUGA 1XSXA 2VKVA 3VYRB 1A36A 1ZK8A 2GOMA 4BS9A 4E7ZA 2Y69H 1J59A 3KP7A 2OZ6A 1XG1A 2KRHA 2ZSHB 2BY1A 4XLHA 4L9NA 3CUOA 4F7ZA 2KLOA 1SVOA 1HDDC 2Q0OA 1VZ0A 3JCUC 4IQJA 2A3SA 3OR1C 1BJZA 2K9NA 4ZYHA 4OIQF 3DEWA 2GM4A 1KU9A 2MC4A 3WTWC 2N8GA 5M5WJ 2M2EA 1MIJA 2W57A 3E0JB 2P5LC 1UJ8A 4IO9F 2K4JA 1QNTA 3TBIA 3NARA 4II3A 4B09A 2KT0A 2X4HA 4HA8A 2FXAA 2BW3B 5D4SA 4G6TB 2JMWA 3S3OA 1AKHB 3JRCA 2ISZA 3BZKA 2HOEA 3I64A 4GXOA 1FSEA 3ZMZA 2DFEA 5L3EA 4UNOA 4ETSA 2HEOA 3KLOA 3FK6A 1DPUA 2M4GA 2VI6A 4EV0A 2D1HA 3IWFA 2CUZA 2Q2EA 1MBKA 3QYEA 5E79C 1ODDA 3IWZA 4XRSA 3AKZA 3HOZJ 2M30A 1RRJA 4GDFA 3NEUA 3MQ0A 4MEYF 4EATA 2M87A 1AWCA 2E71A 2KISA 3KX2A 3S2DJ 4NNJA 1X2MA 2ZXHA 4IHSA 2FUG2 1G8XA 4CCLA 3HOUJ 2H1LA 3SEZA 3R4KA 4E7JA 1D8JA 3I0TA 2CU7A 4Y33A 5ED4A 2CQNA 3FXLA 1D0XA 5FJ8J 2W84A 2R3SA 3K4NA 2FF4A 2OD5A 2FNAA 1VQ7I 3CCYA 2W4SA 2KJCA 4K2EA 4MIMA 3SDBA 1ZKGA 2M5WA 5CJ9A 3FXUA 1PUFB 2XKOA 1WHUA 4XQFA 3S1QJ 2OPTA 3IKTA 4UVBA 3LA3A 3JW4A 4I09A 5HDGA 1W36C 2V9PA 1I27A 3RKYA 4KMFA 2H6BA 3F6OA 5LHHA 4ZDPA 3FM3A 4BHCA 2PJRB 1WVRA 3OIOA 1ZARA 5ILSA 4E70A 3OSFA 2KIQA 2DLLA 1EH7A 2WY8Q 1X4OA 5BPDA 4OMZA 2NS8A 1Y56A 3A0BC 5HDNA 4HV6A 2RC4A 1X3WB 1UZCA 1XSDA 2QGUA 4S05A 3ROUA 4HNVA 2TRTA 3S3MA 4G12A 1K61A 2EZHA 4Y17A 1ETQA 1R9TJ 1LFPA 1T6SA 2VE9A 4PJNA 3U21A 3M8JA 4YIFA 3T0YA 4MQ9F 4PJJA 4HQEA 4AD9A 2LR8A 3KIOA 3M1CA 2NOJB 2ID3A 1I50J 1JXSA 2V4JC 1GV5A 2IS6A 1AU7A 2AO9A 1B8IA 3HRTA 5GPCA 2YR2A 4P9UA 3RYRA 2MGQA 1DGWY 2EFWA 2DMNA 2EV5A 2QZ8A 4M9ZA 2ZCWA 3HB9A 2GIVA 2GOXB 3GTLJ 1Y0NA 1B9MA 3C3WA 2XRNA 1Z7UA 2J5OA 2KL4A 1IRXA 1TBXA 4OIRF 5ICCA 1G6NA 4A93J 2KHMA 2ACJA 1Z21A 3LSPA 1S7EA 1ETYA 1FIAA 2GLOA 3A0HC 5E8GA 2GXAA 4RM3A 2CW7A 1IDYA 1CF7A 4LJZF 2HOTA 1SFOJ 4NC7A 3HTUA 2XPUA 2A69F 2DJNA 2XF6A 2Z1DA 4GGGA 3MAJA 1OR7A 2L5QA 1VQMI 4JP0A 2O9LA 5CQGA 2KRFA 1R36A 4D1QA 3GTOJ 3H3VK 2A5YB 3FWEA 1YJWI 4HX7A 4L18B 2KKOA 3HSRA 3WTXC 1S5LC 2CV0A 2P81A 1WJFA 5FKLA 2XUBA 1ZG3A 2W00A 3TOAA 3W3CA 2PMHA 3AG2H 2R5YA 1O3QA 2LLKA 2QYOA 2JA7J 1JI8A 3L00A 4G8XA 4KUMA 3I4NJ 4DOZA 2EFOA 4UB8C 1J5YA 5ERIA 4EM2A 4BJ6C 1QA6A 1PDNC 5IT9K 3DPTA 2YU9J 2LRDA 1RR8C 1NTCA 4XLNF 3IAM2 3LSJA 4CHUA 3S1NJ 5LFAA 3MKLA 2L01A 1U8RA 2F2EA 5DCMA 1ZRCA 4CGZA 1V4RA 1OCTC 4ENNA 1HW5A 4BKXA 1NK3P 3EUHA 1WSUA 1BR4A 2BEOA 2FX0A 1TWHJ 1U78A 4XLCA 2LKSA 5E3LA 2HKOA 3I55I 4M71A 2E60A 3BWGA 1S3JA 5LGTA 2D45A 2E1OA 1B9NA 2DA3A 4EM0B 1W5SA 4KIGA 2RDPA 3RQ4A 2L4AA 4XRSG 5D5WB 4X6AJ 4BU2A 1QHHD 2E7WA 3GTKJ 4FISA 4FT8A 3MMYB 4RLFA 5K1YA 1QZZA 3AFHA 2F5CA 5ILUA 1GHCA 2Y0SA 4EJTA 1T98A 2AHQA 1Z3YA 2DJIA 3K1PA 2JN6A 5H6RA 2FBIA 4IHXA 3LSGA 2K7LA 2VBYA 3BY6A 3L1PA 5J4VA 4A6DA 1WZ2A 4I0BA 4IVNA 1XGSA 3WTTC 2G9WA 1XB4A 4X1EA 2BGCA 5H20A 5J1RA 2ECBA 1MKMA 3G2BA 4ABZA 2MFZA 3PNVA 2DI3A 2X48A 1T8IA 1MBJA 4ZDLA 5BOXA 2K4BA 3DFGA 4KDPA 1P6RA 1B72A 4BJ5C 1JTYA 1XSVA 3KP4A 4XL9A 3ZMTA 3D1NI 1D1BA 2HNHA 4OWRB 1HDPA 2LKPA 1QU3A 3WTSC 4BE2A 2CH0A 3IC7A 2KIUA 3JTHA 1UG2A 3K4CA 3QU3A 3H5RA 3LFKA 4FTHA 4F55A 2EV6A 5K7ZA 2R7XA 2L9VA 2JRTA 2M9HA 2VL8A 2NNYA 3OS1A 3G1OA 4AIKA 4LLNA 4ENKA 4JX4A 1FJLA 1K6OA 1C0WA 2O8XA 1H0MA 4YFKF 4R1HA 2I5UA 3H9QA 3NRVA 4ZJZA 3ERED 3R60A 3ELKA 5L3GA 2CV1A 4C9YA 5CQEA 2GXGA 4G7HF 4M9SA 3PIPF 1KU2A 5LGUA 1YG2A 2X1EA 3FMQA 1KZHA 1KGSA 2OTJI 2ZNZA 1CF7B 1K4TA 4HNTA 1U5TA 3L2RA 3B02A 2ZSIB 2LF7A 3CMMA 1KQ8A 3K70D 5J1YA 3BJAA 2Z33A 5DS9A 1S7AA 4NC8A 5E18F 3ASOH 1V5GA 4A3DJ 3W2AA 2DA1A 2L54A 2XGXA 1T2KA 1ZGJA 5LLQA 3SZPA 2VKDA 1LFUP 3GYHX 1HQCA 2G0EA 5LGNA 2NVQJ 3HXLA 3TKYA 1D5VA 1TT5B 3LSMA 2UZKA 1MH3A 1BN5A 1P92A 2DCEA 3E6MA 3LSHA 3IAS2 2FNPA 2M8GX 2EFQA 2HPIA 2O03A 2DOEA 1J2XA 2PJPA 1J09A 2XKPA 3VWBA 4XRMA 3BPXA 4XN0A 1HLVA 3QU6A 1OISA 2CS3A 5EDNA 1JKOC 4CCKA 2VPRA 2XROA 4IHYA 3JSPA 3G3ZA 3M1EA 2CMPA 2BHYA 3CMYA 3CMAI 2QKMB 1W0TA 2XGEA 3LAJA 1TQIA 4FX4A 2DA7A 2CJJA 2IA2A 3O2PE 2GA2A 3Q5FA 1R23A 3PJRA 2VBXA 1SFXA 6PAXA 4LK1F 2DDAA 5D5UB 5HS9A 4PJLA 3K2ZA 1RPWA 1W4MA 5B1AH 3V8KA 5F0FA 3A2KA 3DPLC 1V3FA 2VN2A 2XASA 3IP4B 2H6CA 4HBLA 1ETWA 2LG4A 2Y30A 2K40A 4M74A 2P7CB 1UFMA 3OYIA 2R7RA 4WCGA 1PUFA 1OKRA 3FF5A 1YFHA 1ETOA 3FKIJ 4OINF 2EZIA 5K5QA 3VYTB 1R7JA 1XN7A 1LEBA 4XSZF 4QSHA 4IKFA 2GAUA 4U7DA 3OR2C 5DYMA 4XKWA 5FLXK 1R5GA 4II2A 3WHCA 2WB1N 3FZVA 4LGWA 4L0YB 1F4KA 1I3QJ 1ZG5A 3ZPLA 2H94A 1VQNI 2VXDA 1U0JA 3CF2A 1UELB 1W7PD 2JUCA 5HNFA 3FIWA 3HRMA 3C2GA 1FBUA 5JVGF 3K7AJ 2ETHA 3SEQA 2NNNA 4GYGA 3RKWA 1I1GA 1WPKA 2R7QA 5CLSA 3CF5F 4BNCA 4OIOF 4LB5A 1KA8A 3ABKH 1O3SA 4IEJA 2E34A 3OWTA 1W5TA 5BMZA 4J01A 1YW7A 2EFPA 2HU9A 2QQAA 5HVQC 4W97A 4EMSA 3CCJI 1IN8A 2PG4A 1JJ8C 2OZUA 1IN7A 3HYIA 5K7FA 1YS6A 1LJ9A 1SAUA 2L0KA 3DLLF 3ZQCA 3U1KA 4IXAA 3E5QA 4DBQA 3A02A 2FMLA 4HW0A 1MD0A 1OCZH 1QGPA 2KMUA 2V1UA 1ZELA 2K5CA 3WU2C 5D5XB 4ESJA 2E1MB 4Y4RA 2EA4A 3MD2A 1J9IA 5EJCA 3LSKA 4C3IJ 3E5UA 2TCTA 1FMVA 3GZ5A 3K4JA 3ZQQA 3D5RC 1UHMA 2LDUA 3AG3H 3OYBA 2ZKZA 5FKMA 2Z9OA 5FFXA 1BA5A 1YJ9I 1GDTA 4N9IA 4E7SA 1Y1VJ 1CGPA 2BXYA 3HSFA 1WJBA 3VOEA 3BT9A 1IXCA 3CDIA 1GV2A 1ZHFA 5FD5A 2OQGA 2FU4A 2NVXJ 3HGYA 3PL8A 4CA0A 4ZYEA 3F8MA 4PUSA 2BOLA 2E19A 1FOKA 4UUVA 1FYLA 4UVCA 3M07A 2IW5A 4FE7A 3VYSB 3W2VA 1YX3A 5DEQA 3JSOA 1Z3XA 4PFOA 2BVMA 2MH9A 3BTJA 2BV6A 1BC7C 1JKRC 4HDVA 2IPQX 4IHWA 3ZN0A 3JRDA 4MFEA 2KP6A 3ZCOA 1KONA 1P4AA 4PDKA 4LLLA 1BBYA 2M0CA 1S29A 2ECCA 5DM7F 4UHTA 1XGMA 3GBGA 3A01B 2Q2EB 2P4WA 2YS9A 4EJUA 1X3UA 4RB2C 3M9AA 4U0YA 4P9FA 1JUMA 4UV9A 3WG9A 3S2WA 4A3KJ 3BR0A 1P2FA 3ZQFA 2DA2A 1WCMJ 1MW7A 1D1AA 1SD6A 3BR1A 4AIHA 5CVIA 4ASNA 5FLXZ 3GWZA 3MVPA 1TWGJ 4ZZLA 3BR6A 4AC0A 4FETA 4CYCB 1J75A 3BZ6A 4AU7A 2LNBA 5M3FJ 2JK3A 4BQQA 3U9GA 4YFNF 2KJBA 2L9SA 3BTIA 1VTNC 3BLYA 2E7XA 3M3YJ 2XAFA 3FXJA 2P8TA 2EQRA 2DK5A 2IXSA 1ZTRA 2VT3A 3IRRA 1HSJA 3CCEI 4AVZA 2A61A 3K1MA 2OCCH 1FX7A 2LY1A 4IQ4A 2G7HA 4BHBA 1LEAA 1OYWA 1RUNA 2ZNYA 3ZR8X 2WV1A 3FDYA 3E3VA 1G3YA 2KIMA 2E2HJ 5J8CA 3ZMVA 1LNWA 3IL2A 1QVTA 1FC3A 1OCOH 3ONQA 1O7LA 1SFKA 2HR3A 3OV8A 5FRMA 1Z9CA 3H0DA 4MHGA 3GCMA 4L5EA 2GZWA 3G1LA 3HHHA 3KCCA 4I01A 1WRJA 3QODA 2DMTA 2VBWA 2KRCA 4HLXA 5A2QK 3OSGA 3KP5A 1T56A 2DYSH 4A3GJ 3J80K 1F5TA 3L2WA 3DQVC 5D8LB 4ZTJA 1JHHA 3WG7H 3KYLA 1YI2I 2H8WA 4A3JJ 2CV2A 1AKHA 3F22A 5AONA 1JKQC 4FASD 4OAZA 4DGWB 3H5NA 5KAFC 2JSCA 3TW7A 4M73A 1HBXG 1D8KA 4XIDA 4M3DA 3DU5A 4R8HA 2LH9A 2FMYA 2O0YA 5F27A 5LBQA 1FZPB 3V7SA 3BQYA 3F8FA 2P5KA 1A35A 1VQ8I 5JR3A 4EJVA 4PGHA 3A4CA 4M3EA 3SYTA 4BGDA 2GQQA 2BW3A 2HOSA 3NQOA 1YRNA 2R7DA 4IJAA 3OYFA 1K4SA 3CC4I 5J40A 1UCRA 2L7FP 4CCMA 4HRIA 1BR1A 5E1ZB 2R7OA 3WE3A 2LY2A 2Z16A 2VJIA 4AYBN 2QF7A 1VI0A 3HC7A 5DCFA 1TNSA 2VLAA 3S32A 3V8JA 2MC3A 3E6CC 5IYCJ 2R7UA 2LYCA 4ENJA 1U3EM 5HLHA 4IOCF 2M8EA 2Q8KA 3K4MA 3S17J 2PQ8A 2V9KA 1IXSB 2DPUA 3VODA 1FBSA 3C7JA 3PUBA 3BR5A 2JA6J 1B6AA 4G6QA 3J7AY 3OYAA 3GFLA 3N97A 1OQYA 3JRFA 1ZR4A 3O3KA 2PMZN 5F04A 1QPMA 3DEEA 3H5AA 3K69A 2FD5A 3HOSA 5KCMA 1DP7P 3DWLE 4EJWA 5KAIC 3I4PA 1ON2A 5J3LA 5M5XJ 3D0SA 3R6SA 5TJJA 2FOWA 3T1BA 5D5VB 1ZGWA 1IDZA 3HRSA 1G59A 1MMSA 2CQQA 3K4BA 2P6SA 3AG4H 4GCVA 3RYPA 2XV4S 5EEGA 2EJRA 2MH2A 4KFCA 2DBBA 2BBYA 1MBFA 3CO7C 2VODA 4M6XA 4AVPA 5H2FC 1MH4A 3K9TA 3BJOA 1YO5C 4W1UA 4L5IA 1TWFJ 1R00A 2VC0A 4M3FA 2I10A 1G4DA 1BOAA 1VQ6I 2LVSA 1SD4A 2HPMA 2E1CA 3CJTB 4CYCA 3GW2A 2JPBA 1QHGA 2DFHA 3GO5A 1N25A 4A3EJ 1DQUA 2Y75A 4MFDA 1ZLKA 1ULYA 2JT1A 1MNMC 2V1DA 2YUSA 2A5WA 1Z0XA 2XF7A 1E17A 1OLTA 4A5MA 2AXLA 1BIBA 2JPCA 4CXFA 4DBRA 3K2AA 5TGTA 1FEXA 4WX9A 5B3SH 4N4NB 4DYRA 4IRGA 4XONA 3FM5A 4M72A 2W25A 5EG0B 2KDOA 1WI3A 1RETA 5KVRA 4I76A 3IUOA 4XK4A 1A5JA 3RZDJ 1EF4A 2DA4A 3BDDA 4OAYA 4LOCA 4A3MJ 1V55H 1Y39A 2E1MC 1USSA 2H1KA 3F8CA 3I59B 1YQAA 2OQRA 5IOYA 3SZGA 5J4YA 1ZH5A 3C2BA 2QWWA 3WE2A 3ULQB 2QUFA 1O4XA 5J1UA 3RZOJ 2IP2A 1OJLA 3LQRA 1WJAA 3J80Z 3CCUI 1P7IA 2WWYA 4YFXF 3ML6A 2WA0A 1AA7A 3PFIA 4UB6C 3WTYC 2DA6A 3P5JA 2OUMA 1R5ID 4IHVA 3RPQA 3TDZC 2VQHA 3GFIA 4PCQA 4YIRX 3TMOA 3CO6C 4AUXA 5GTIC 3QPLA 4WWCA 4Q5SF 2L2OA 1IRZA 1Y8QB 2KZVA 3CUQA 3W6VA 2RNJA 4I7HA 2DMUA 4CH7A 4XKCA 1BW5A 3OS2A 3E6DA 2YSRA 5EG0A 1OFCX 1SMYF 4U88A 3S1RJ 1OPCA 1VNDA 4C3JJ 1QRYA 5FKKA 2DO7A 3F21A 1BI3A 2L7ZA 4HOBA 5EEAA 2V6EA 2WTEA 4BYYA 1IUYA 1F43A 2NOGA 2LKXA 1ZAOA 4HF0A 1I3AA 4JYKA 2EA2A 4RM2A 2DA5A 3K4KA 4A3LJ 1WJCA 3WGHA 4ZDOA 5DD8A 3F72A 2BZTA 1SC7A 3D5LA 4BY7J 1GT0C 2O61A 1F1ZA 1B4AA 4NHJA 3A01A 3G73A 3G4SI 4J00A 1XDSA 4BQOA 2IT0A 2VQLA 3KFWX 3ESWB 2R5ZA 1FOWA 4DNCA 3VEPA 4Z6YA 1MJBA 3ZN1A 1VQOI 2PFBA 2JUGA 3OYGA 2DOFA 4O3MA 3A1YA 4ZH4F 5ILVA 5HOOA 3DKXA 1K79A 4RAFA 1J0RA 4MO7A 1YW9A 4U0VA 3VSKA 3I56I 1VQ9I 2D2WA 3F3XA 3OL4A 1Y1WJ 3HHGA 5H6QA 2VQCA 2H27A 1H9GA 2WADA 1XS9A 1HKSA 5HS7A 4HSTA 4V19K 3OYKA 4ENMA
chains in the Genus database with same CATH topology
5F0FA 1NK2P 2GBYA 1Q1VA 2LY9A 1FIPA 1ETWA 2EH3A 2Y30A 2K40A 3BR3A 1MBHA 1PUFA 1HF0A 5DTDA 1ETOA 2EZKA 2JWTA 3FKIJ 3BG5A 3A03A 2EZIA 4UUSA 3LSRA 3S14J 5EZHA 4QSHA 1JGGA 5HODA 1TWAJ 5IP9J 1RR7A 3WHBA 3WHCA 2MW8A 2WB1N 3Q0UA 4BBRJ 4DZPA 2KDZA 1I3QJ 4D5FA 2FJ1A 5FLMJ 3IH2A 2NS7A 3PM1A 2XPWA 3FIWA 2K9SA 1DU0A 3TEDA 1H89C 3K7AJ 2ELKA 3JRGA 3E7LA 1WPKA 5C3EJ 5C44J 1ITYA 5F1JA 1BW6A 1ETXA 3TW6A 2D5VA 3MN2A 1X2NA 4GFBA 2NVTJ 3S2HJ 4IEJA 4XICA 1P7JA 5EGOA 2VKVA 4W97A 1ZK8A 2Y31A 4B1RA 4JX5A 1JJ8C 1XG1A 2COBA 5K7FA 3HBLA 3HDDA 5IP7J 1HDDC 2LTPA 1I6HJ 2L0KA 3ZQCA 1BJZA 1ENHA 2K9NA 9ANTA 5EYRA 3DEWA 2GM4A 3A02A 2FQ4A 1BL0A 2N8GA 5M5WJ 3FISA 2M2EA 5JLWA 2MSYA 4C3IJ 3NARA 2TCTA 2KT0A 2JMWA 1K83J 5FKMA 1AKHB 1BA5A 1GDTA 3JRCA 1Y1VJ 3JR9A 2Y0SN 3G1MA 3BT9A 2HOAA 4C2MJ 1GV2A 4BXXJ 3FK6A 2NVXJ 3HGYA 2VI6A 5BNGA 1POGA 1ETKA 1VFCA 1MBKA 2E19A 3H0GJ 4FE7A 4Y7NJ 3HGGA 1ZQ3P 5C4XJ 4XRSA 3HOZJ 3BTJA 1JKRC 4IHWA 3JRDA 4MFEA 1UHSA 2QCOA 3BQZA 3S2DJ 1X2MA 4M3GA 2M0CA 3HOUJ 2ECCA 3IV5A 3GBGA 3A01B 2CRGA 2CU7A 2YS9A 1ETVA 5FJ8J 3JREA 1MSFC 2X9DA 3ZQIA 1JUMA 3CCYA 4MIMA 2HDDA 1ZKGA 4A3KJ 3BR0A 3HM5A 3ZQFA 2DA2A 1WCMJ 3BR1A 1PUFB 3MVPA 1TWGJ 3S1QJ 3BR6A 2OPTA 3PO2J 4AC0A 2XGDA 4CYCB 4I6ZA 5M3FJ 2JK3A 2ZB9A 1DU6A 3BTIA 2DMQA 2HXOA 3M3YJ 3OIOA 2LD5A 1JT0A 3HOWJ 3OSFA 1IJWC 2EQRA 1ZTRA 5EZGA 1ZR2A 1MSEC 3GTQJ 2CUFA 1IUFA 3BTCA 2NS8A 3ZOBA 3LOCA 4DW6A 1Z77A 4J19A 2WV1A 2X6OA 1MBEA 4HNVA 2TRTA 3HOXJ 4G12A 1K61A 2E2HJ 1JT6A 2EZHA 1QVTA 4UUTA 1ETQA 4B3AA 1R9TJ 2RAEA 5F0CA 3F0CA 4A69C 3SJMA 4L5EA 4D7NA 2LR8A 3G1LA 2K9QA 1T33A 2DMTA 1CQTA 2ID3A 1B72B 1U9OA 1A6IA 1I50J 5JLXA 3OSGA 1T56A 4A3GJ 1GV5A 1AU7A 3I4MJ 2AO9A 1B8IA 5GPCA 1YRNB 1APLC 2MGQA 3CDLA 2DMNA 1GUUA 3HB9A 3GTLJ 3S15J 4UUSB 4A3JJ 1AKHA 1UMQA 3FK7A 1JKQC 1F36A 4Y52J 3LNQA 4JX6A 2JJ7A 3TW7A 4QIWN 4D5CA 3JRBA 4XIDA 4M3DA 4A93J 5E3OA 3QQAA 5F27A 3NAUA 3BQYA 4C3HJ 3LSPA 1S7EA 1ETYA 3Q0VA 1FIAA 2GLOA 1G2HA 4B4CA 3GTMJ 1IDYA 2HOTA 5GP9A 4M3EA 2LFBA 1SFOJ 3ZQLA 3HOVJ 1X58A 2XPUA 2XB5A 2HOSA 2DJNA 1YRNA 1JKPC 4FCYA 3BR2A 4JP0A 2LK2A 2L7FP 2O9LA 2Y9ZA 2R93J 5FLVA 3GTOJ 3JRIA 1IG7A 3H3VK 3IH4A 2E2JJ 1RKTA 1D5YA 2B63J 5IYDJ 4AYBN 2QF7A 1VI0A 3BTLA 1IV6A 5C4JJ 5IYCJ 2R0QC 2P81A 4BY1J 1B8IB 2XRLA 5FKLA 3S17J 2R5YA 1XC5A 2O7OA 2LLKA 2L7MP 5IPAA 2JA7J 1WGXA 3BR5A 2JA6J 1FTZA 3TP3A 3I4NJ 1HCRA 1E3OC 4D7MA 3JRFA 1ZR4A 1IC8A 1U8BA 2YU9J 2PMZN 1MBGA 3OOUA 5F04A 4M6VA 1NTCA 3LSJA 1LE8A 3S1NJ 2FD5A 3MKLA 2L9RA 2Y2ZA 5J3LA 5M5XJ 1OCTC 2W48A 1ZGWA 4BKXA 1NK3P 1IDZA 2WAQN 2CQQA 2FX0A 1TWHJ 1U78A 5E3LA 5FKOA 1H88C 2R5YB 2E1OA 3GTJJ 2DA3A 1TC3C 1MBFA 4XRSG 4X6AJ 2HXIA 1ORKA 3GTGJ 3GTKJ 4S0HB 1MH4A 3CQZJ 4FISA 4W1UA 3S1MJ 1TWFJ 4M3FA 2I10A 2DN0A 2AHQA 4RDUA 2LVSA 3HOYJ 4CYCA 2JN6A 4V2GA 2OF7A 3RKQA 4IHXA 1IGNA 3LSGA 4A3EJ 4MFDA 5GPAA 3L1PA 1MNMC 5E3MA 2JA5J 5K7HA 3VPRA 5E3NA 2YUSA 1JJ6C 2IAIA 1FTTA 1Z0XA 4X1EA 2LP0A 2VUMJ 2NVYJ 4A3CJ 5J1RA 2ECBA 3HKZN 4ABZA 2CUEA 4A3FJ 2X48A 1MBJA 2IBDA 3K2AA 1FEXA 2O8KA 2VKEA 4DYRA 1B72A 1JTYA 2EBIA 2ME6A 1WI3A 2CQXA 5EG0B 1RETA 3D1NI 1W0UA 3B6AA 2JA8J 1HDPA 4I76A 3SDGA 4XK4A 1GVDA 1UG2A 3Q0WA 3RZDJ 1H8AC 1A5JA 2DA4A 5M5YJ 1EF4A 4FTHA 3IH3A 1AHDP 3UKGA 3BG3A 4LOCA 5K7ZA 4A3MJ 4A3IJ 2M9HA 4RBOA 3G1OA 1QPIA 2H1KA 3M4OJ 4QTRA 5F08A 5IOYA 2R5ZB 4JX4A 2ID6A 1JTXA 3ZQHA 1FJLA 3C2BA 2HQ5A 1RKWA 1WH7A 5J1UA 1O4XA 3RZOJ 4DYCA 3BG9A 1OJLA 2H8RA 2XSDC 1P7IA 2ME0A 1U9NA 1JUPA 2DA6A 4IHVA 5IYBJ 5J1YA 5DS9A 2R7ZJ 4BBSJ 5FKNA 5IP6A 4AUXA 3QPLA 4A3DJ 1VF9A 3DCFA 2DA1A 2R92J 1IRZA 2HYJA 1LFUP 3JRHA 3W6VA 3JRAA 2IEKA 2DMUA 2M34A 1BW5A 2G0EA 1TWCJ 4DYQA 2NVQJ 5IOZA 5EG0A 2DMPA 1LFBA 1OFCX 3S1RJ 1MH3A 1VNDA 4C3JJ 1QRYA 1JUSA 5FKKA 2M8GX 2L7ZA 5EEAA 4V2FA 1F43A 2NOGA 2LKXA 3TP0A 4JYKA 2EZLA 3ZQGA 2DA5A 4A3LJ 3SFIA 5EF6A 4XRMA 1HLVA 1JKOC 5EDNA 3O8HA 3Q3SA 3S16J 2VPRA 4IHYA 4BY7J 1GT0C 2Y9YA 4DZJA 4EEFG 4M3BA 3QPSA 3B6CA 3A01A 2DTZA 3GTPJ 1HOMA 2XGCA 3CMYA 1W0TA 1WH5A 2XGEA 4NDLA 2R5ZA 4FE4A 4A3BJ 2XPVA 5M3MJ 2DA7A 2CJJA 1RESA 5EGOB 2E2IJ 2XB0X 1SANA 4MO7A 1LE8B 5F0HA 1QVUA 3RQIA 4MLOA 3HEFA 2HI3A 1Y1WJ 3O8GA 1XS9A 2MG4A 3PO3J 1RPWA 1OCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F0F A;  1NK2 P;  2GBY A;  1Q1V A;  2LY9 A;  1FIP A;  1ETW A;  2EH3 A;  2Y30 A;  2K40 A;  3BR3 A;  1MBH A;  1PUF A;  1HF0 A;  5DTD A;  1ETO A;  2EZK A;  2JWT A;  3FKI J;  3BG5 A;  3A03 A;  2EZI A;  4UUS A;  3LSR A;  3S14 J;  5EZH A;  4QSH A;  1JGG A;  5HOD A;  1TWA J;  5IP9 J;  1RR7 A;  3WHB A;  3WHC A;  2MW8 A;  2WB1 N;  3Q0U A;  4BBR J;  4DZP A;  2KDZ A;  1I3Q J;  4D5F A;  2FJ1 A;  5FLM J;  3IH2 A;  2NS7 A;  3PM1 A;  2XPW A;  3FIW A;  2K9S A;  1DU0 A;  3TED A;  1H89 C;  3K7A J;  2ELK A;  3JRG A;  3E7L A;  1WPK A;  5C3E J;  5C44 J;  1ITY A;  5F1J A;  1BW6 A;  1ETX A;  3TW6 A;  2D5V A;  3MN2 A;  1X2N A;  4GFB A;  2NVT J;  3S2H J;  4IEJ A;  4XIC A;  1P7J A;  5EGO A;  2VKV A;  4W97 A;  1ZK8 A;  2Y31 A;  4B1R A;  4JX5 A;  1JJ8 C;  1XG1 A;  2COB A;  5K7F A;  3HBL A;  3HDD A;  5IP7 J;  1HDD C;  2LTP A;  1I6H J;  2L0K A;  3ZQC A;  1BJZ A;  1ENH A;  2K9N A;  9ANT A;  5EYR A;  3DEW A;  2GM4 A;  3A02 A;  2FQ4 A;  1BL0 A;  2N8G A;  5M5W J;  3FIS A;  2M2E A;  5JLW A;  2MSY A;  4C3I J;  3NAR A;  2TCT A;  2KT0 A;  2JMW A;  1K83 J;  5FKM A;  1AKH B;  1BA5 A;  1GDT A;  3JRC A;  1Y1V J;  3JR9 A;  2Y0S N;  3G1M A;  3BT9 A;  2HOA A;  4C2M J;  1GV2 A;  4BXX J;  3FK6 A;  2NVX J;  3HGY A;  2VI6 A;  5BNG A;  1POG A;  1ETK A;  1VFC A;  1MBK A;  2E19 A;  3H0G J;  4FE7 A;  4Y7N J;  3HGG A;  1ZQ3 P;  5C4X J;  4XRS A;  3HOZ J;  3BTJ A;  1JKR C;  4IHW A;  3JRD A;  4MFE A;  1UHS A;  2QCO A;  3BQZ A;  3S2D J;  1X2M A;  4M3G A;  2M0C A;  3HOU J;  2ECC A;  3IV5 A;  3GBG A;  3A01 B;  2CRG A;  2CU7 A;  2YS9 A;  1ETV A;  5FJ8 J;  3JRE A;  1MSF C;  2X9D A;  3ZQI A;  1JUM A;  3CCY A;  4MIM A;  2HDD A;  1ZKG A;  4A3K J;  3BR0 A;  3HM5 A;  3ZQF A;  2DA2 A;  1WCM J;  3BR1 A;  1PUF B;  3MVP A;  1TWG J;  3S1Q J;  3BR6 A;  2OPT A;  3PO2 J;  4AC0 A;  2XGD A;  4CYC B;  4I6Z A;  5M3F J;  2JK3 A;  2ZB9 A;  1DU6 A;  3BTI A;  2DMQ A;  2HXO A;  3M3Y J;  3OIO A;  2LD5 A;  1JT0 A;  3HOW J;  3OSF A;  1IJW C;  2EQR A;  1ZTR A;  5EZG A;  1ZR2 A;  1MSE C;  3GTQ J;  2CUF A;  1IUF A;  3BTC A;  2NS8 A;  3ZOB A;  3LOC A;  4DW6 A;  1Z77 A;  4J19 A;  2WV1 A;  2X6O A;  1MBE A;  4HNV A;  2TRT A;  3HOX J;  4G12 A;  1K61 A;  2E2H J;  1JT6 A;  2EZH A;  1QVT A;  4UUT A;  1ETQ A;  4B3A A;  1R9T J;  2RAE A;  5F0C A;  3F0C A;  4A69 C;  3SJM A;  4L5E A;  4D7N A;  2LR8 A;  3G1L A;  2K9Q A;  1T33 A;  2DMT A;  1CQT A;  2ID3 A;  1B72 B;  1U9O A;  1A6I A;  1I50 J;  5JLX A;  3OSG A;  1T56 A;  4A3G J;  1GV5 A;  1AU7 A;  3I4M J;  2AO9 A;  1B8I A;  5GPC A;  1YRN B;  1APL C;  2MGQ A;  3CDL A;  2DMN A;  1GUU A;  3HB9 A;  3GTL J;  3S15 J;  4UUS B;  4A3J J;  1AKH A;  1UMQ A;  3FK7 A;  1JKQ C;  1F36 A;  4Y52 J;  3LNQ A;  4JX6 A;  2JJ7 A;  3TW7 A;  4QIW N;  4D5C A;  3JRB A;  4XID A;  4M3D A;  4A93 J;  5E3O A;  3QQA A;  5F27 A;  3NAU A;  3BQY A;  4C3H J;  3LSP A;  1S7E A;  1ETY A;  3Q0V A;  1FIA A;  2GLO A;  1G2H A;  4B4C A;  3GTM J;  1IDY A;  2HOT A;  5GP9 A;  4M3E A;  2LFB A;  1SFO J;  3ZQL A;  3HOV J;  1X58 A;  2XPU A;  2XB5 A;  2HOS A;  2DJN A;  1YRN A;  1JKP C;  4FCY A;  3BR2 A;  4JP0 A;  2LK2 A;  2L7F P;  2O9L A;  2Y9Z A;  2R93 J;  5FLV A;  3GTO J;  3JRI A;  1IG7 A;  3H3V K;  3IH4 A;  2E2J J;  1RKT A;  1D5Y A;  2B63 J;  5IYD J;  4AYB N;  2QF7 A;  1VI0 A;  3BTL A;  1IV6 A;  5C4J J;  5IYC J;  2R0Q C;  2P81 A;  4BY1 J;  1B8I B;  2XRL A;  5FKL A;  3S17 J;  2R5Y A;  1XC5 A;  2O7O A;  2LLK A;  2L7M P;  5IPA A;  2JA7 J;  1WGX A;  3BR5 A;  2JA6 J;  1FTZ A;  3TP3 A;  3I4N J;  1HCR A;  1E3O C;  4D7M A;  3JRF A;  1ZR4 A;  1IC8 A;  1U8B A;  2YU9 J;  2PMZ N;  1MBG A;  3OOU A;  5F04 A;  4M6V A;  1NTC A;  3LSJ A;  1LE8 A;  3S1N J;  2FD5 A;  3MKL A;  2L9R A;  2Y2Z A;  5J3L A;  5M5X J;  1OCT C;  2W48 A;  1ZGW A;  4BKX A;  1NK3 P;  1IDZ A;  2WAQ N;  2CQQ A;  2FX0 A;  1TWH J;  1U78 A;  5E3L A;  5FKO A;  1H88 C;  2R5Y B;  2E1O A;  3GTJ J;  2DA3 A;  1TC3 C;  1MBF A;  4XRS G;  4X6A J;  2HXI A;  1ORK A;  3GTG J;  3GTK J;  4S0H B;  1MH4 A;  3CQZ J;  4FIS A;  4W1U A;  3S1M J;  1TWF J;  4M3F A;  2I10 A;  2DN0 A;  2AHQ A;  4RDU A;  2LVS A;  3HOY J;  4CYC A;  2JN6 A;  4V2G A;  2OF7 A;  3RKQ A;  4IHX A;  1IGN A;  3LSG A;  4A3E J;  4MFD A;  5GPA A;  3L1P A;  1MNM C;  5E3M A;  2JA5 J;  5K7H A;  3VPR A;  5E3N A;  2YUS A;  1JJ6 C;  2IAI A;  1FTT A;  1Z0X A;  4X1E A;  2LP0 A;  2VUM J;  2NVY J;  4A3C J;  5J1R A;  2ECB A;  3HKZ N;  4ABZ A;  2CUE A;  4A3F J;  2X48 A;  1MBJ A;  2IBD A;  3K2A A;  1FEX A;  2O8K A;  2VKE A;  4DYR A;  1B72 A;  1JTY A;  2EBI A;  2ME6 A;  1WI3 A;  2CQX A;  5EG0 B;  1RET A;  3D1N I;  1W0U A;  3B6A A;  2JA8 J;  1HDP A;  4I76 A;  3SDG A;  4XK4 A;  1GVD A;  1UG2 A;  3Q0W A;  3RZD J;  1H8A C;  1A5J A;  2DA4 A;  5M5Y J;  1EF4 A;  4FTH A;  3IH3 A;  1AHD P;  3UKG A;  3BG3 A;  4LOC A;  5K7Z A;  4A3M J;  4A3I J;  2M9H A;  4RBO A;  3G1O A;  1QPI A;  2H1K A;  3M4O J;  4QTR A;  5F08 A;  5IOY A;  2R5Z B;  4JX4 A;  2ID6 A;  1JTX A;  3ZQH A;  1FJL A;  3C2B A;  2HQ5 A;  1RKW A;  1WH7 A;  5J1U A;  1O4X A;  3RZO J;  4DYC A;  3BG9 A;  1OJL A;  2H8R A;  2XSD C;  1P7I A;  2ME0 A;  1U9N A;  1JUP A;  2DA6 A;  4IHV A;  5IYB J;  5J1Y A;  5DS9 A;  2R7Z J;  4BBS J;  5FKN A;  5IP6 A;  4AUX A;  3QPL A;  4A3D J;  1VF9 A;  3DCF A;  2DA1 A;  2R92 J;  1IRZ A;  2HYJ A;  1LFU P;  3JRH A;  3W6V A;  3JRA A;  2IEK A;  2DMU A;  2M34 A;  1BW5 A;  2G0E A;  1TWC J;  4DYQ A;  2NVQ J;  5IOZ A;  5EG0 A;  2DMP A;  1LFB A;  1OFC X;  3S1R J;  1MH3 A;  1VND A;  4C3J J;  1QRY A;  1JUS A;  5FKK A;  2M8G X;  2L7Z A;  5EEA A;  4V2F A;  1F43 A;  2NOG A;  2LKX A;  3TP0 A;  4JYK A;  2EZL A;  3ZQG A;  2DA5 A;  4A3L J;  3SFI A;  5EF6 A;  4XRM A;  1HLV A;  1JKO C;  5EDN A;  3O8H A;  3Q3S A;  3S16 J;  2VPR A;  4IHY A;  4BY7 J;  1GT0 C;  2Y9Y A;  4DZJ A;  4EEF G;  4M3B A;  3QPS A;  3B6C A;  3A01 A;  2DTZ A;  3GTP J;  1HOM A;  2XGC A;  3CMY A;  1W0T A;  1WH5 A;  2XGE A;  4NDL A;  2R5Z A;  4FE4 A;  4A3B J;  2XPV A;  5M3M J;  2DA7 A;  2CJJ A;  1RES A;  5EGO B;  2E2I J;  2XB0 X;  1SAN A;  4MO7 A;  1LE8 B;  5F0H A;  1QVU A;  3RQI A;  4MLO A;  3HEF A;  2HI3 A;  1Y1W J;  3O8G A;  1XS9 A;  2MG4 A;  3PO3 J;  1RPW A;  1OCP A; 
#chains in the Genus database with same CATH topology
 1NK2 P;  2F5D A;  4RAY A;  2GBY A;  4PGG A;  2LY9 A;  3N05 A;  5HDK A;  1ERD A;  2IGO A;  4F3Q A;  3BR3 A;  4F92 B;  1MBH A;  3JAM Z;  2Z5U A;  2JWT A;  4UY8 I;  1DPR A;  3BG5 A;  4ZYD A;  1BI2 A;  2F48 A;  5J6X A;  1ZN2 A;  2DQR A;  5FGM A;  3S14 J;  1YIT I;  2DPD A;  2X6W A;  1TWA J;  4U7B A;  5IP9 J;  4Q4Z F;  3FXO A;  3IHU A;  3SXY A;  1O57 A;  1HW2 A;  4HF2 A;  4PSX A;  3Q0U A;  4QPQ A;  3CC7 I;  2CYY A;  4D5F A;  1TW2 A;  5FLM J;  3FMS A;  4KT6 A;  2HS5 A;  2LSO A;  1P4X A;  3MEX A;  4A12 A;  3J81 K;  1D3Y A;  2EIL H;  4KIC A;  4KA4 A;  1FNN A;  2BE5 F;  2K9S A;  5IY5 H;  4LIV A;  1H89 C;  4IPA A;  3RCO A;  2HQN A;  4RS8 A;  1LDK B;  5CVV A;  3CC2 I;  3W6K B;  1P4W A;  2ICW G;  2R4G A;  3CZ6 A;  1MZB A;  1X2N A;  2X85 A;  1BIA A;  2KPM A;  3MN2 A;  2D5V A;  4GFB A;  1U2W A;  1LQ1 A;  2NVT J;  1K7A A;  2IS4 A;  2EPF A;  1SMT A;  2HDW A;  4XIC A;  1G3T A;  1YYV A;  3DTI A;  3GXO A;  4A0Z A;  4CZC A;  3K0L A;  4ZYA A;  2PJR A;  2R7T A;  4ITV A;  4N9H A;  1R5H A;  5CYV A;  1PYV A;  3H3U A;  1W7P A;  3G6E I;  1PVE A;  5GTH C;  3HDD A;  4CCN A;  5IP7 J;  2K3P A;  2X1C A;  4CDG A;  1I6H J;  2E5N A;  2VJ5 A;  4BXU A;  1XGN A;  1XMA A;  2XVC A;  3IKV A;  5EYR A;  1LDD A;  1SFE A;  3HKZ A;  2FQ4 A;  4LIU A;  4KT5 C;  2LBF B;  3FMR A;  4HNU A;  2ZJP F;  5JLW A;  5HLG A;  3FHN A;  1T39 A;  1XMK A;  3GFJ A;  3M7G A;  3I59 A;  1GVJ A;  1IO2 A;  5K5O A;  2H09 A;  2NYX A;  2VT2 A;  1YW8 A;  2KZG A;  1K83 J;  1MGT A;  3ASN H;  3EET A;  3WGG A;  3G1M A;  2R7V A;  1YOV B;  2HOA A;  2JTV A;  4DIQ A;  1Z7L A;  2VBZ A;  4XLE A;  1GLN A;  5D4R A;  2P5V A;  1SAX A;  3OS0 A;  1TLH B;  1V54 H;  1POG A;  4QLC U;  1IRG A;  1VFC A;  1Z1D A;  1X1C A;  2QKL B;  1IAW A;  1WJ5 A;  2RGV A;  3H0G J;  2LC2 A;  4LLG F;  4Y7N J;  3HGG A;  2EIJ H;  4CO8 A;  2DW4 A;  2QBY A;  1DUX C;  1T0F A;  2HQA A;  5DCM B;  3FXR A;  3H9G A;  3WOD F;  1TL8 A;  2HZD A;  1R22 A;  1UHS A;  3EDP A;  2RNG A;  5GAH J;  1N78 A;  2QCO A;  1Y6I A;  3BQZ A;  5DM6 F;  2V1X A;  3DF8 A;  1UAA A;  2HDC A;  4M3G A;  3KP6 A;  3BRO A;  1I1S A;  2AXT C;  2F4M B;  3QYF A;  3J81 Z;  4MGR A;  4YG2 F;  1IN5 A;  1K78 B;  1OCR H;  3GLX A;  2E5Z A;  2BYV E;  1MSF C;  3RIR A;  2X9D A;  3CCV I;  3MZH A;  3CUQ B;  4M6Y A;  2HDD A;  2ZXJ A;  1W1W E;  4RLQ A;  3AG1 H;  1RUO A;  4C2U A;  3HRU A;  5E1X A;  3PO2 J;  5K5R A;  1YX5 A;  2XGD A;  2D1V A;  2X6Y A;  2XC7 A;  4I6Z A;  4AYB A;  2ZB9 A;  3G71 I;  2DMQ A;  2HXO A;  3ABT A;  1EH6 A;  2CW8 A;  2NXN B;  1JT0 A;  3F9K A;  3HOW J;  1E0E A;  1HKT A;  2HKX A;  3CJN A;  5EZG A;  4BJT A;  3PFY A;  2GXB A;  2VE8 A;  1IUF A;  3ISP A;  4B47 A;  3BJ6 A;  1T95 A;  3AL0 B;  4G6D A;  5BS6 A;  1A31 A;  2F5V A;  3I3L A;  3ABM H;  4UVA A;  1V5F A;  1KYW A;  1X3Z B;  2QA4 I;  1PJR A;  1Z05 A;  2MD5 A;  4BQN A;  4CZZ A;  1N77 A;  2OU2 A;  3HZJ A;  1JT6 A;  1Z6R A;  4NB5 A;  1PUE E;  4Y3O A;  1PP8 F;  3P9C A;  2RAE A;  5F0C A;  2WAQ A;  3CCS I;  4A69 C;  2DDB A;  3CLO A;  5F6F A;  4RGS A;  4E7K A;  3TQN A;  5F1R A;  4E7I A;  1FT9 A;  1T33 A;  1MMN A;  1U9O A;  1A6I A;  5DDG A;  4XSX F;  1G3W A;  3I53 A;  1LKX A;  2G7U A;  2JZY A;  1ZYR F;  2JRM A;  2HTJ A;  2KFD A;  3PSI A;  3I4M J;  1RI7 A;  1HA8 A;  2NS0 A;  1YRN B;  1APL C;  2B9S A;  3WU0 A;  3OIQ A;  4F52 A;  2DT6 A;  1NHA A;  3BG6 A;  3WU1 B;  2X1D A;  4NUB A;  2CSO A;  2ZXW H;  4YEJ A;  4BE0 A;  4Y52 J;  2BY0 A;  2JSP A;  4JX6 A;  1FYK A;  2BY2 A;  2MA3 A;  4QIW N;  4D5C A;  1KQ0 A;  2R7W A;  3QQA A;  3SQN A;  2ESN A;  5D8K B;  3NAU A;  4BDZ A;  2VPL A;  4QPO A;  1I39 A;  4AM3 A;  5GAD J;  1T0F C;  2EB7 A;  1YIJ I;  3EPZ A;  5JI6 A;  1B59 A;  2VKH A;  1XCV A;  2XAJ A;  2MAB A;  1HKQ A;  5HLT A;  1JKP C;  2JQ7 A;  2DAO A;  4FCY A;  2ADU A;  1WQ2 A;  4XM3 A;  3BR2 A;  4XLP F;  5AIQ A;  3MWM A;  1R58 A;  4CYD A;  3HSE A;  1XMX A;  3V7C A;  3QOE A;  3JRI A;  3HUG A;  1R1V A;  3F8B A;  2A05 A;  3EYY A;  1RKT A;  2E2J J;  2B63 J;  5IYD J;  2J5P A;  3BTL A;  4LG0 B;  3GEZ A;  5J8F A;  3E6B A;  1BR2 A;  2MYS A;  2XAU A;  2ESH A;  1TQM A;  2R0Q C;  2VXZ A;  2Q1Z B;  3DKW A;  5HS8 A;  4BY1 J;  4KIF A;  1B8I B;  2XRL A;  1MMD A;  1IXR C;  2F4I A;  1GXQ A;  2QEN A;  3OOP A;  4BAC A;  4GYI A;  1XC5 A;  2O7O A;  2ZME A;  2LRE A;  1KU3 A;  3KLN A;  3QPT A;  1HCR A;  3EUK L;  4AIJ A;  2RRE A;  2XDV A;  2M45 A;  1U8B A;  1MBG A;  4ZYG A;  3JTG A;  4BDY A;  4BQA A;  2UXX A;  2CW0 F;  2UUZ A;  3E97 A;  1X1B A;  2UV1 A;  2L9R A;  3U2R A;  3LFU A;  3CJR B;  2FBK A;  3QYB A;  2QLZ A;  1OYI A;  1NH3 A;  2M7A A;  2IGN A;  4YEL A;  1BM9 A;  5CPR B;  4BH9 A;  1EKE A;  5FKO A;  2VAS A;  2PMZ A;  3DBL B;  3C2H A;  1H88 C;  2R5Y B;  2B0L A;  1T08 B;  5CVU A;  1TC3 C;  2V9V A;  3GTG J;  2IGM A;  4I0A A;  3I9V 2;  3CQZ J;  3RDI A;  3S1M J;  1R6R A;  2M3A A;  4UXN A;  5LD2 C;  1RC9 A;  1XDU A;  1U6G A;  2O5R A;  2LMD A;  4NBQ A;  4KNY A;  2Z99 A;  3OIP A;  4V2G A;  2OF7 A;  1TT0 A;  3RKQ A;  1IGN A;  4MTD A;  2EIM H;  4HLY A;  4CIC A;  1FPQ A;  5GPA A;  5E3M A;  2K85 A;  3CCQ I;  3DV8 A;  3H9J A;  1JJ6 C;  4WXD A;  5DUK A;  3CJQ B;  5DV5 A;  3V7R A;  2NVY J;  1BC8 C;  2VUM J;  1S9H A;  3HKZ N;  3J7A O;  5E8I A;  4A3F J;  1ZG1 A;  2VOO A;  5LEJ A;  1SEU A;  2IBD A;  2HQR A;  1G3S A;  3I71 A;  2V7F A;  1S7O A;  2ZME C;  2VKE A;  2RQQ A;  2CFX A;  3HTS B;  2EBI A;  1U5T B;  3FXK A;  3OL3 A;  3B6A A;  1J7K A;  3SZT A;  3W2W A;  4Q47 A;  1BOB A;  4HPQ A;  5GAG J;  5L3D A;  1TZL A;  2M0M A;  3F8N A;  3IH3 A;  3UKG A;  2O3F A;  3ZGK A;  3ZMD A;  4A3I J;  5DD4 A;  1MNE A;  2BXZ A;  3KEQ A;  4RBO A;  1W7P B;  1QPI A;  3M4O J;  5E1W A;  2K02 A;  4QTR A;  5F08 A;  5L3C A;  3GZ6 A;  2R5Z B;  2BY3 A;  2IA1 A;  2ID6 A;  1LB2 A;  4PZJ A;  3KZY A;  2L3D A;  3BCA A;  3I58 A;  2HQ5 A;  3BG9 A;  2L9N A;  2R7F A;  2H8R A;  1R4M B;  2ME0 A;  4Z2Y A;  1U9N A;  1XGO A;  3DEU A;  1TTY A;  1HW1 A;  3BC8 A;  3KEO A;  3ABL H;  1ZRD A;  3MKZ A;  4JQF A;  1JUP A;  2QM3 A;  5ICG A;  4KMU X;  4OIP F;  4HEA 2;  5DUI A;  5IYB J;  4G94 A;  1EV7 A;  1L3L A;  1TW3 A;  2P6T A;  3FBN B;  1S8N A;  2R7Z J;  1VF9 A;  2F6C A;  2JVH A;  2R92 J;  4NQW B;  2UWM A;  2K9L A;  1FY7 A;  2HYJ A;  2YU3 A;  2Z3Y A;  3JRH A;  4LB6 B;  3JRA A;  2ZJR F;  2A07 F;  4S04 A;  4DYQ A;  1TWC J;  3DP7 A;  3PSF A;  3BZC A;  1NG7 A;  3GLL A;  1LFB A;  3RTR A;  3MKY B;  2QBY B;  2HWV A;  5B5E C;  3LST A;  1JUS A;  3U1D A;  3WGI A;  3OYH A;  3PNY A;  3HIF A;  3OYM A;  3H3Z A;  1FP1 D;  1YHQ I;  3TP0 A;  2EZL A;  3ZQG A;  1IW7 F;  5FO5 A;  3QOP A;  1MJ9 A;  3SFI A;  5EF6 A;  3RPU D;  3O8H A;  3Q3S A;  3S16 J;  3B73 A;  3ZQ7 A;  4DJA A;  2Y9Y A;  4ANJ A;  4DZJ A;  3QP6 A;  4EEF G;  3K70 C;  2E1N A;  2XSJ C;  3CLQ A;  3W6J B;  4M3B A;  3QPS A;  1HST A;  2CWE A;  4A2U A;  3CTA A;  4P96 A;  1WH5 A;  3VSL A;  4NDL A;  1SVM A;  4FE4 A;  4A3B J;  2XPV A;  4KIT B;  5M3M J;  3WTU C;  4YII A;  3BPV A;  2CFO A;  5JVT A;  2HVR A;  4AID A;  5EGO B;  2LF8 A;  3HPG A;  4TV7 A;  3LA7 A;  3L2U A;  5F0H A;  1QVU A;  3HOT A;  4MLO A;  3HEF A;  4IRH A;  1R1T A;  3O8G A;  4MNU A;  1QO0 D;  3CME I;  1I6X A;  2MG4 A;  3PO3 J;  4GRI A;  4Y13 A;  3GX4 X;  1WJE A;  1Q1V A;  3ZP5 A;  1FIP A;  1VQP I;  2AS5 F;  1EH8 A;  4RGX A;  4G7Z F;  2A6E F;  1HF0 A;  3CP8 A;  2W7N A;  1ONV A;  3H1C A;  5DTD A;  4BEH A;  4UUS A;  3L7W A;  2FRH A;  3OYJ A;  3KP2 A;  3FKJ A;  2V6C A;  2PMU A;  4LD5 A;  4OU0 A;  4XKV A;  4N0B A;  3S3N A;  5HOD A;  3MZY A;  3GF2 A;  2GA1 A;  3HG9 A;  2IS2 A;  1XCB A;  1MMA A;  2TDX A;  2K86 A;  4MQV A;  2QQ9 A;  4ESB A;  3KP3 A;  2OC6 A;  2KDZ A;  4H0E A;  3GFM A;  4B8X A;  3I5U A;  2IVM A;  3OYL A;  1VQ4 I;  2K3F A;  2DYR H;  2W82 A;  5BPI A;  1E2X A;  4EGZ A;  3PM1 A;  4OMY A;  1K6Y A;  2LOO A;  4XR6 A;  2VJ4 A;  4BXF A;  5BQT A;  3TED A;  1TQP A;  4P5O A;  3LL7 A;  1SD5 A;  2ELK A;  2RVC A;  3FXQ A;  2C6Y A;  3L9F A;  4LG3 A;  5C44 J;  5LRS A;  1ITY A;  2VON A;  2DK8 A;  1BW6 A;  1ETX A;  4G9Y A;  3TW6 A;  4RGU A;  3PIO F;  5JFR A;  3FX3 A;  2X0L A;  5JHF A;  3S2H J;  2QSG X;  2L7K A;  1P7J A;  3DXJ F;  2QSH X;  3QAH A;  5LHG A;  5EGO A;  4RGR A;  1E3H A;  2DFF A;  2HVQ A;  4BHP A;  3JAM K;  2OCE A;  2ZBK A;  2OV7 A;  1E3P A;  4B44 A;  4RB0 A;  2Y31 A;  4B1R A;  1Y0U A;  4JX5 A;  4O5V A;  2F5E A;  3C1D A;  2ISY A;  1Z6T A;  3L09 A;  2ZXI A;  2COB A;  4RAZ A;  3HBL A;  4X0G A;  4XLF A;  5KK1 A;  3OYN A;  4L0Z B;  2LTP A;  3H35 A;  2K9M A;  4G7O F;  1ENH A;  2GIZ A;  9ANT A;  3M8F A;  2IA0 A;  3F23 A;  2PX9 A;  4JK1 X;  3DBH B;  4LIT A;  5L3F A;  1T38 A;  4A5N A;  1BL0 A;  3FIS A;  2V79 A;  3J7Y J;  5ICF A;  4UV8 A;  2MSY A;  1LPQ A;  1XTA A;  3EUA A;  2VB6 A;  4HDU A;  2HGC A;  2O6G E;  4D0P A;  3RJP A;  3VB2 A;  3DTE A;  3D5S C;  3QPH A;  4NQW A;  4LFU A;  4XOP A;  3JR9 A;  2Y0S N;  3EQL F;  2HYG D;  1IRF A;  3K1N A;  4C2M J;  2OBP A;  3NWS A;  4BXX J;  5FRN A;  2VJJ A;  1UG0 A;  3DTK A;  3TDU C;  5BNG A;  3LMM A;  1ETK A;  5CVJ A;  3TO7 A;  1JE8 A;  3S93 A;  1F9N A;  2X6X A;  1KYZ A;  4JOM A;  3S8P A;  1ZQ3 P;  3HPH A;  1Z67 A;  5C4X J;  3N4M A;  4F93 B;  3GME A;  3K6G A;  2HYF A;  4F91 B;  4U87 A;  5E17 F;  2NRA C;  3R61 A;  4ON0 A;  4A0X A;  1VQL I;  2QEX I;  4ZTF A;  2ZFW A;  2RKH A;  1EJ9 A;  2RQP A;  1FOX A;  2W24 A;  3TO6 A;  3IV5 A;  1X4P A;  1KQ9 A;  2EIK H;  2CRG A;  3PQJ A;  1UB9 A;  1ETV A;  1IZ1 A;  2BVL A;  3CD6 I;  3JRE A;  2XAQ A;  3ZQI A;  3I54 A;  1R71 A;  3HM5 A;  2HTS A;  1ZLJ A;  3PUF A;  2F4O B;  5CVR A;  1D0Z A;  1A04 A;  1LVK A;  4XN3 A;  2L4M A;  1H9T A;  3UNG C;  2FA5 A;  1B1B A;  4IL6 C;  1TNT A;  3TOB A;  3CUQ C;  4A6E A;  5FB2 A;  1DU6 A;  1QBJ A;  4CSW A;  1U5T C;  1V5E A;  3H36 A;  4XBF A;  2M4K A;  3L2C A;  4KN7 X;  1D0Y A;  2LD5 A;  5IT3 A;  1IJW C;  1QZE A;  4WXH A;  5B1B H;  3REO A;  3BCB A;  2MD0 A;  1ZR2 A;  1MSE C;  3GTQ J;  1WI9 A;  2CUF A;  1WFX A;  2FEZ A;  3BTC A;  3ZOB A;  3FBI B;  3LOC A;  2RN7 A;  2PLY A;  2IRF G;  4DW6 A;  3KET A;  2AQE A;  1Z77 A;  4J19 A;  3SFZ A;  2X6O A;  4EGY A;  1MBE A;  2CGP A;  4IZZ A;  1Z91 A;  3HOX J;  1IF1 A;  3MZ8 A;  2L02 A;  4UUT A;  4B3A A;  5FRO A;  3F0C A;  2OAZ A;  1BI0 A;  1X1A A;  3SJM A;  4D7N A;  2P7V B;  4HX4 A;  2K9Q A;  5ICE A;  1WKM A;  3C18 A;  4IX7 A;  1CQT A;  2XF5 A;  1B72 B;  3OYD A;  5JLX A;  4PJ0 C;  3SHF A;  1MJA A;  5IT9 Z;  3RKX A;  4ESF A;  4U0W A;  3KZZ A;  3VDX A;  2F5F A;  1UHW A;  3KYD B;  3L2V A;  3E5X A;  2VC1 A;  3CDL A;  5FFZ A;  3PNT A;  2ZJQ F;  1LDJ A;  4BEH B;  2HVS A;  1GUU A;  3S15 J;  3ZXS A;  4UUS B;  4P1W A;  1X1P A;  2EWN A;  1UMQ A;  3FK7 A;  1F36 A;  5HLI A;  3WTV C;  3LNQ A;  3CCL I;  4KIS A;  2JJ7 A;  3TO9 A;  3JRB A;  2QQB A;  2I8D A;  2YX4 A;  5E3O A;  4IRI A;  2K27 A;  4C3H J;  3Q0V A;  1G2H A;  4B4C A;  3GTM J;  3BOQ A;  3P7N A;  1A6Q A;  4L9V A;  5GP9 A;  2LFB A;  4C30 A;  3T8R A;  5B66 C;  5FD6 A;  4FQG A;  2CUJ A;  1UST A;  1X58 A;  2QSF X;  3ZQL A;  3HOV J;  2XB5 A;  2BHZ A;  2MLK A;  3HUG B;  1REP C;  1OR7 C;  2EFN A;  3CP2 A;  4LK0 F;  4OOI A;  3K4L A;  4LMY A;  2LK2 A;  5AIP A;  2Y9Z A;  3ECO A;  4NC6 A;  3KPH A;  1YJN I;  2R93 J;  5FLV A;  4O6J A;  2LBF A;  2QQ8 A;  1IG7 A;  1YLF A;  2DT7 B;  3IH4 A;  1D5Y A;  2CQK A;  4A0Y A;  2Y0M A;  4BL0 B;  2QVO A;  4PSW A;  1DGR M;  4XMY A;  4CCO A;  1O3R A;  1BJA A;  1IV6 A;  5C4J J;  2EK5 A;  2FQ3 A;  4FHT A;  5F64 A;  2NAZ A;  5EEH A;  4E4H A;  2STT A;  4I02 A;  1RNL A;  1JHF A;  2PEX A;  2COM A;  2L7M P;  4N4O B;  2FSW A;  5IPA A;  2XHK A;  2WY7 Q;  1WGX A;  2FE3 A;  1FTZ A;  3TP3 A;  1E3O C;  3AL0 C;  4D7M A;  1W5C C;  1HXD A;  1IC8 A;  4BE1 A;  3DKY A;  3KYC B;  3OOU A;  4M6V A;  2WAF A;  3OY9 A;  3CCR I;  3EUH C;  2YPR A;  1LE8 A;  2V26 A;  2ELJ A;  4HSR A;  2NVU B;  3K10 A;  2ZFU A;  2Y2Z A;  1X1D A;  4PK4 A;  3RSN A;  3VYU B;  2ZO4 A;  3P9I A;  2W48 A;  2DQL A;  1ON1 A;  2VQG A;  2WAQ N;  5D6F A;  3MKW B;  3QRF F;  1SVL A;  1FLI A;  4HX8 A;  4M9X A;  1RZ4 A;  1YIO A;  2MLG A;  1QQI A;  4WXC A;  3H92 A;  3AAF A;  1N75 A;  3LWF A;  4B3X A;  3GTJ J;  4DQ2 A;  2HXI A;  1ORK A;  4PFP A;  2ZJ2 A;  2KIF A;  1FBQ A;  4S0H B;  1XPX A;  3WTZ A;  4XOT A;  4XLA A;  4ZZD A;  3O6B B;  1JGS A;  2DN0 A;  3CES A;  1IN4 A;  3ZMS A;  4RDU A;  3HOY J;  5LRR A;  3E1S A;  2Y48 A;  5TRD A;  5L3B A;  1S72 I;  5A2Q Z;  2JA5 J;  5K7H A;  3DU6 A;  3VPR A;  5E3N A;  4KN4 X;  1PP7 U;  2GWR A;  3FXM A;  2IAI A;  4E7L A;  4KYW A;  1FTT A;  2LP0 A;  1L0O C;  2FBH A;  3ECH A;  5KHD A;  4LG0 A;  3TGN A;  4A3C J;  5JHU A;  2E35 A;  4EVI A;  5HNH A;  3X2Q H;  1STZ A;  4B43 A;  1M1E B;  2CUE A;  3HL2 A;  2B7E A;  4XNF A;  2V1N A;  4HYE A;  4FX0 A;  3P9K A;  4IOA F;  2O8K A;  2EV0 A;  2ME6 A;  2CQX A;  1W0U A;  2IJL A;  1D1C A;  2JA8 J;  2P0W A;  3SDG A;  1FWZ A;  1VQ5 I;  1GVD A;  3Q0W A;  1H8A C;  5M5Y J;  2YX7 A;  3J7Z I;  1FSH A;  1AHD P;  1OCC H;  3BG3 A;  3LQQ A;  3OMY A;  1TP4 A;  4PJM A;  4RAG A;  3UR3 C;  3RI4 A;  1DP3 A;  4RA2 A;  1FMW A;  1JTX A;  2M7B A;  3KZI C;  4MTE A;  3ZQH A;  1RIO H;  1FYM A;  4RB3 C;  3MFK A;  4ZC3 A;  4I99 C;  1WJD A;  4HG2 A;  1RKW A;  1WH7 A;  3LSI A;  4DYC A;  4GO1 A;  3KE2 A;  2XSD C;  1ACI A;  1EA3 A;  2WB1 A;  4I98 B;  4D9J A;  1XD7 A;  3LAP A;  4L9J A;  2UXN A;  2CG4 A;  1QZY A;  1LVA A;  3ERM A;  2PI0 A;  4WF2 A;  4JBA A;  4EJO A;  3VFZ A;  4KJZ A;  4QWQ A;  3CCM I;  3EYI A;  4BBS J;  1BI1 A;  5FKN A;  5IP6 A;  2OJE D;  3M8E A;  2A6H F;  2XAG A;  2DXI A;  1SD7 A;  3DCF A;  2CQ7 A;  2PN6 A;  1IN6 A;  1X19 A;  2Z2S B;  3BG7 A;  3V42 A;  2IEK A;  1I5Z A;  2M34 A;  3Q9S A;  1XX5 A;  3QP5 A;  2XAH A;  5IOZ A;  2DMP A;  1KU7 A;  1IV8 A;  2MBF A;  1LUJ B;  3HJE A;  1FOY A;  2OA4 A;  3GVA A;  2W85 A;  2WBM A;  4HV5 A;  3Q9V A;  3V8L A;  4V2F A;  2ZME B;  3DBR B;  3T8T A;  2DT5 A;  2PBI A;  3MCZ A;  4AWX B;  1ZRF A;  2OTL I;  1MDM A;  4E6K G;  3GZN B;  2WAE A;  3FHZ A;  5CKT A;  3R0A A;  3GUD A;  4RB1 A;  3NWT A;  3B6C A;  3GTP J;  1HOM A;  2DTZ A;  2XGC A;  2DTR A;  4R79 A;  2A68 F;  3R0J A;  2HZT A;  2IS1 A;  4BUP A;  1O7F A;  4EQQ A;  1Q1H A;  3DPU A;  5J47 A;  3QWL A;  4RMN A;  2DU9 A;  1RES A;  2JVG A;  2EIN H;  2E2I J;  4HZF A;  1YE9 A;  4E7H A;  2XIG A;  2XB0 X;  1R49 A;  1SAN A;  1LE8 B;  3BP8 A;  1W36 D;  2DOD A;  4EM1 A;  3RQI A;  2HI3 A;  3ZMU A;  3COA C;  2FOK A;  5LHI A;  1YTY A;  1K78 A;  1MND A;  1MMG A;  1OYY A;  1OCP A;  1WWX A;  1ZGA A;  4IHT A;  2M1B A;  3DLA A;  4L9T A;  1R1U A;  2EH3 A;  1Y8R B;  3KEY A;  1S6L A;  3F6V A;  2HFH A;  2DFI A;  3L2Q A;  2E36 A;  2AQF A;  1AOY A;  1O3T A;  1FP2 A;  2EZK A;  3ZRG A;  4YRV A;  3A03 A;  4Y15 A;  5TIS C;  4MEX F;  3LSR A;  2VOP A;  2W1O A;  1NG6 A;  5KNL A;  5EZH A;  5LEK A;  4HF1 A;  4XRF A;  5D6E A;  1JGG A;  1OMI A;  2STW A;  3CDH A;  4KIB A;  1HC8 A;  3T5X A;  1RR7 A;  3WHB A;  1R4N B;  2MW8 A;  3PQK A;  4BBR J;  4DZP A;  2R7S A;  2IGK A;  2X51 A;  4Q48 A;  3OYC A;  2VIX A;  4L5J A;  4IF4 A;  5GAE J;  3V4G A;  2FJ1 A;  3OYE A;  4HQM A;  4B48 A;  3IH2 A;  1DDN A;  2NS7 A;  2WV0 A;  4WK8 F;  1MDM B;  2XPW A;  2CO5 A;  2DOA A;  4H4K C;  1DU0 A;  2WC2 A;  1P9Q C;  1YS7 A;  1SFU A;  2RV8 A;  2A6T A;  4HAM A;  4XOR A;  2ELH A;  3E7L A;  5E20 A;  5C3E J;  3JRG A;  4C2T A;  5F1J A;  1GXP A;  1VQK I;  3RPU A;  3IRQ A;  2JA2 A;  3ABU A;  4CCJ A;  3LA2 A;  4BAY A;  1ZRE A;  3TL4 X;  4I2O A;  4P55 A;  2KQR A;  2ZC2 A;  4XKB A;  4CUG A;  1XSX A;  2VKV A;  3VYR B;  1A36 A;  1ZK8 A;  2GOM A;  4BS9 A;  4E7Z A;  2Y69 H;  1J59 A;  3KP7 A;  2OZ6 A;  1XG1 A;  2KRH A;  2ZSH B;  2BY1 A;  4XLH A;  4L9N A;  3CUO A;  4F7Z A;  2KLO A;  1SVO A;  1HDD C;  2Q0O A;  1VZ0 A;  3JCU C;  4IQJ A;  2A3S A;  3OR1 C;  1BJZ A;  2K9N A;  4ZYH A;  4OIQ F;  3DEW A;  2GM4 A;  1KU9 A;  2MC4 A;  3WTW C;  2N8G A;  5M5W J;  2M2E A;  1MIJ A;  2W57 A;  3E0J B;  2P5L C;  1UJ8 A;  4IO9 F;  2K4J A;  1QNT A;  3TBI A;  3NAR A;  4II3 A;  4B09 A;  2KT0 A;  2X4H A;  4HA8 A;  2FXA A;  2BW3 B;  5D4S A;  4G6T B;  2JMW A;  3S3O A;  1AKH B;  3JRC A;  2ISZ A;  3BZK A;  2HOE A;  3I64 A;  4GXO A;  1FSE A;  3ZMZ A;  2DFE A;  5L3E A;  4UNO A;  4ETS A;  2HEO A;  3KLO A;  3FK6 A;  1DPU A;  2M4G A;  2VI6 A;  4EV0 A;  2D1H A;  3IWF A;  2CUZ A;  2Q2E A;  1MBK A;  3QYE A;  5E79 C;  1ODD A;  3IWZ A;  4XRS A;  3AKZ A;  3HOZ J;  2M30 A;  1RRJ A;  4GDF A;  3NEU A;  3MQ0 A;  4MEY F;  4EAT A;  2M87 A;  1AWC A;  2E71 A;  2KIS A;  3KX2 A;  3S2D J;  4NNJ A;  1X2M A;  2ZXH A;  4IHS A;  2FUG 2;  1G8X A;  4CCL A;  3HOU J;  2H1L A;  3SEZ A;  3R4K A;  4E7J A;  1D8J A;  3I0T A;  2CU7 A;  4Y33 A;  5ED4 A;  2CQN A;  3FXL A;  1D0X A;  5FJ8 J;  2W84 A;  2R3S A;  3K4N A;  2FF4 A;  2OD5 A;  2FNA A;  1VQ7 I;  3CCY A;  2W4S A;  2KJC A;  4K2E A;  4MIM A;  3SDB A;  1ZKG A;  2M5W A;  5CJ9 A;  3FXU A;  1PUF B;  2XKO A;  1WHU A;  4XQF A;  3S1Q J;  2OPT A;  3IKT A;  4UVB A;  3LA3 A;  3JW4 A;  4I09 A;  5HDG A;  1W36 C;  2V9P A;  1I27 A;  3RKY A;  4KMF A;  2H6B A;  3F6O A;  5LHH A;  4ZDP A;  3FM3 A;  4BHC A;  2PJR B;  1WVR A;  3OIO A;  1ZAR A;  5ILS A;  4E70 A;  3OSF A;  2KIQ A;  2DLL A;  1EH7 A;  2WY8 Q;  1X4O A;  5BPD A;  4OMZ A;  2NS8 A;  1Y56 A;  3A0B C;  5HDN A;  4HV6 A;  2RC4 A;  1X3W B;  1UZC A;  1XSD A;  2QGU A;  4S05 A;  3ROU A;  4HNV A;  2TRT A;  3S3M A;  4G12 A;  1K61 A;  2EZH A;  4Y17 A;  1ETQ A;  1R9T J;  1LFP A;  1T6S A;  2VE9 A;  4PJN A;  3U21 A;  3M8J A;  4YIF A;  3T0Y A;  4MQ9 F;  4PJJ A;  4HQE A;  4AD9 A;  2LR8 A;  3KIO A;  3M1C A;  2NOJ B;  2ID3 A;  1I50 J;  1JXS A;  2V4J C;  1GV5 A;  2IS6 A;  1AU7 A;  2AO9 A;  1B8I A;  3HRT A;  5GPC A;  2YR2 A;  4P9U A;  3RYR A;  2MGQ A;  1DGW Y;  2EFW A;  2DMN A;  2EV5 A;  2QZ8 A;  4M9Z A;  2ZCW A;  3HB9 A;  2GIV A;  2GOX B;  3GTL J;  1Y0N A;  1B9M A;  3C3W A;  2XRN A;  1Z7U A;  2J5O A;  2KL4 A;  1IRX A;  1TBX A;  4OIR F;  5ICC A;  1G6N A;  4A93 J;  2KHM A;  2ACJ A;  1Z21 A;  3LSP A;  1S7E A;  1ETY A;  1FIA A;  2GLO A;  3A0H C;  5E8G A;  2GXA A;  4RM3 A;  2CW7 A;  1IDY A;  1CF7 A;  4LJZ F;  2HOT A;  1SFO J;  4NC7 A;  3HTU A;  2XPU A;  2A69 F;  2DJN A;  2XF6 A;  2Z1D A;  4GGG A;  3MAJ A;  1OR7 A;  2L5Q A;  1VQM I;  4JP0 A;  2O9L A;  5CQG A;  2KRF A;  1R36 A;  4D1Q A;  3GTO J;  3H3V K;  2A5Y B;  3FWE A;  1YJW I;  4HX7 A;  4L18 B;  2KKO A;  3HSR A;  3WTX C;  1S5L C;  2CV0 A;  2P81 A;  1WJF A;  5FKL A;  2XUB A;  1ZG3 A;  2W00 A;  3TOA A;  3W3C A;  2PMH A;  3AG2 H;  2R5Y A;  1O3Q A;  2LLK A;  2QYO A;  2JA7 J;  1JI8 A;  3L00 A;  4G8X A;  4KUM A;  3I4N J;  4DOZ A;  2EFO A;  4UB8 C;  1J5Y A;  5ERI A;  4EM2 A;  4BJ6 C;  1QA6 A;  1PDN C;  5IT9 K;  3DPT A;  2YU9 J;  2LRD A;  1RR8 C;  1NTC A;  4XLN F;  3IAM 2;  3LSJ A;  4CHU A;  3S1N J;  5LFA A;  3MKL A;  2L01 A;  1U8R A;  2F2E A;  5DCM A;  1ZRC A;  4CGZ A;  1V4R A;  1OCT C;  4ENN A;  1HW5 A;  4BKX A;  1NK3 P;  3EUH A;  1WSU A;  1BR4 A;  2BEO A;  2FX0 A;  1TWH J;  1U78 A;  4XLC A;  2LKS A;  5E3L A;  2HKO A;  3I55 I;  4M71 A;  2E60 A;  3BWG A;  1S3J A;  5LGT A;  2D45 A;  2E1O A;  1B9N A;  2DA3 A;  4EM0 B;  1W5S A;  4KIG A;  2RDP A;  3RQ4 A;  2L4A A;  4XRS G;  5D5W B;  4X6A J;  4BU2 A;  1QHH D;  2E7W A;  3GTK J;  4FIS A;  4FT8 A;  3MMY B;  4RLF A;  5K1Y A;  1QZZ A;  3AFH A;  2F5C A;  5ILU A;  1GHC A;  2Y0S A;  4EJT A;  1T98 A;  2AHQ A;  1Z3Y A;  2DJI A;  3K1P A;  2JN6 A;  5H6R A;  2FBI A;  4IHX A;  3LSG A;  2K7L A;  2VBY A;  3BY6 A;  3L1P A;  5J4V A;  4A6D A;  1WZ2 A;  4I0B A;  4IVN A;  1XGS A;  3WTT C;  2G9W A;  1XB4 A;  4X1E A;  2BGC A;  5H20 A;  5J1R A;  2ECB A;  1MKM A;  3G2B A;  4ABZ A;  2MFZ A;  3PNV A;  2DI3 A;  2X48 A;  1T8I A;  1MBJ A;  4ZDL A;  5BOX A;  2K4B A;  3DFG A;  4KDP A;  1P6R A;  1B72 A;  4BJ5 C;  1JTY A;  1XSV A;  3KP4 A;  4XL9 A;  3ZMT A;  3D1N I;  1D1B A;  2HNH A;  4OWR B;  1HDP A;  2LKP A;  1QU3 A;  3WTS C;  4BE2 A;  2CH0 A;  3IC7 A;  2KIU A;  3JTH A;  1UG2 A;  3K4C A;  3QU3 A;  3H5R A;  3LFK A;  4FTH A;  4F55 A;  2EV6 A;  5K7Z A;  2R7X A;  2L9V A;  2JRT A;  2M9H A;  2VL8 A;  2NNY A;  3OS1 A;  3G1O A;  4AIK A;  4LLN A;  4ENK A;  4JX4 A;  1FJL A;  1K6O A;  1C0W A;  2O8X A;  1H0M A;  4YFK F;  4R1H A;  2I5U A;  3H9Q A;  3NRV A;  4ZJZ A;  3ERE D;  3R60 A;  3ELK A;  5L3G A;  2CV1 A;  4C9Y A;  5CQE A;  2GXG A;  4G7H F;  4M9S A;  3PIP F;  1KU2 A;  5LGU A;  1YG2 A;  2X1E A;  3FMQ A;  1KZH A;  1KGS A;  2OTJ I;  2ZNZ A;  1CF7 B;  1K4T A;  4HNT A;  1U5T A;  3L2R A;  3B02 A;  2ZSI B;  2LF7 A;  3CMM A;  1KQ8 A;  3K70 D;  5J1Y A;  3BJA A;  2Z33 A;  5DS9 A;  1S7A A;  4NC8 A;  5E18 F;  3ASO H;  1V5G A;  4A3D J;  3W2A A;  2DA1 A;  2L54 A;  2XGX A;  1T2K A;  1ZGJ A;  5LLQ A;  3SZP A;  2VKD A;  1LFU P;  3GYH X;  1HQC A;  2G0E A;  5LGN A;  2NVQ J;  3HXL A;  3TKY A;  1D5V A;  1TT5 B;  3LSM A;  2UZK A;  1MH3 A;  1BN5 A;  1P92 A;  2DCE A;  3E6M A;  3LSH A;  3IAS 2;  2FNP A;  2M8G X;  2EFQ A;  2HPI A;  2O03 A;  2DOE A;  1J2X A;  2PJP A;  1J09 A;  2XKP A;  3VWB A;  4XRM A;  3BPX A;  4XN0 A;  1HLV A;  3QU6 A;  1OIS A;  2CS3 A;  5EDN A;  1JKO C;  4CCK A;  2VPR A;  2XRO A;  4IHY A;  3JSP A;  3G3Z A;  3M1E A;  2CMP A;  2BHY A;  3CMY A;  3CMA I;  2QKM B;  1W0T A;  2XGE A;  3LAJ A;  1TQI A;  4FX4 A;  2DA7 A;  2CJJ A;  2IA2 A;  3O2P E;  2GA2 A;  3Q5F A;  1R23 A;  3PJR A;  2VBX A;  1SFX A;  6PAX A;  4LK1 F;  2DDA A;  5D5U B;  5HS9 A;  4PJL A;  3K2Z A;  1RPW A;  1W4M A;  5B1A H;  3V8K A;  5F0F A;  3A2K A;  3DPL C;  1V3F A;  2VN2 A;  2XAS A;  3IP4 B;  2H6C A;  4HBL A;  1ETW A;  2LG4 A;  2Y30 A;  2K40 A;  4M74 A;  2P7C B;  1UFM A;  3OYI A;  2R7R A;  4WCG A;  1PUF A;  1OKR A;  3FF5 A;  1YFH A;  1ETO A;  3FKI J;  4OIN F;  2EZI A;  5K5Q A;  3VYT B;  1R7J A;  1XN7 A;  1LEB A;  4XSZ F;  4QSH A;  4IKF A;  2GAU A;  4U7D A;  3OR2 C;  5DYM A;  4XKW A;  5FLX K;  1R5G A;  4II2 A;  3WHC A;  2WB1 N;  3FZV A;  4LGW A;  4L0Y B;  1F4K A;  1I3Q J;  1ZG5 A;  3ZPL A;  2H94 A;  1VQN I;  2VXD A;  1U0J A;  3CF2 A;  1UEL B;  1W7P D;  2JUC A;  5HNF A;  3FIW A;  3HRM A;  3C2G A;  1FBU A;  5JVG F;  3K7A J;  2ETH A;  3SEQ A;  2NNN A;  4GYG A;  3RKW A;  1I1G A;  1WPK A;  2R7Q A;  5CLS A;  3CF5 F;  4BNC A;  4OIO F;  4LB5 A;  1KA8 A;  3ABK H;  1O3S A;  4IEJ A;  2E34 A;  3OWT A;  1W5T A;  5BMZ A;  4J01 A;  1YW7 A;  2EFP A;  2HU9 A;  2QQA A;  5HVQ C;  4W97 A;  4EMS A;  3CCJ I;  1IN8 A;  2PG4 A;  1JJ8 C;  2OZU A;  1IN7 A;  3HYI A;  5K7F A;  1YS6 A;  1LJ9 A;  1SAU A;  2L0K A;  3DLL F;  3ZQC A;  3U1K A;  4IXA A;  3E5Q A;  4DBQ A;  3A02 A;  2FML A;  4HW0 A;  1MD0 A;  1OCZ H;  1QGP A;  2KMU A;  2V1U A;  1ZEL A;  2K5C A;  3WU2 C;  5D5X B;  4ESJ A;  2E1M B;  4Y4R A;  2EA4 A;  3MD2 A;  1J9I A;  5EJC A;  3LSK A;  4C3I J;  3E5U A;  2TCT A;  1FMV A;  3GZ5 A;  3K4J A;  3ZQQ A;  3D5R C;  1UHM A;  2LDU A;  3AG3 H;  3OYB A;  2ZKZ A;  5FKM A;  2Z9O A;  5FFX A;  1BA5 A;  1YJ9 I;  1GDT A;  4N9I A;  4E7S A;  1Y1V J;  1CGP A;  2BXY A;  3HSF A;  1WJB A;  3VOE A;  3BT9 A;  1IXC A;  3CDI A;  1GV2 A;  1ZHF A;  5FD5 A;  2OQG A;  2FU4 A;  2NVX J;  3HGY A;  3PL8 A;  4CA0 A;  4ZYE A;  3F8M A;  4PUS A;  2BOL A;  2E19 A;  1FOK A;  4UUV A;  1FYL A;  4UVC A;  3M07 A;  2IW5 A;  4FE7 A;  3VYS B;  3W2V A;  1YX3 A;  5DEQ A;  3JSO A;  1Z3X A;  4PFO A;  2BVM A;  2MH9 A;  3BTJ A;  2BV6 A;  1BC7 C;  1JKR C;  4HDV A;  2IPQ X;  4IHW A;  3ZN0 A;  3JRD A;  4MFE A;  2KP6 A;  3ZCO A;  1KON A;  1P4A A;  4PDK A;  4LLL A;  1BBY A;  2M0C A;  1S29 A;  2ECC A;  5DM7 F;  4UHT A;  1XGM A;  3GBG A;  3A01 B;  2Q2E B;  2P4W A;  2YS9 A;  4EJU A;  1X3U A;  4RB2 C;  3M9A A;  4U0Y A;  4P9F A;  1JUM A;  4UV9 A;  3WG9 A;  3S2W A;  4A3K J;  3BR0 A;  1P2F A;  3ZQF A;  2DA2 A;  1WCM J;  1MW7 A;  1D1A A;  1SD6 A;  3BR1 A;  4AIH A;  5CVI A;  4ASN A;  5FLX Z;  3GWZ A;  3MVP A;  1TWG J;  4ZZL A;  3BR6 A;  4AC0 A;  4FET A;  4CYC B;  1J75 A;  3BZ6 A;  4AU7 A;  2LNB A;  5M3F J;  2JK3 A;  4BQQ A;  3U9G A;  4YFN F;  2KJB A;  2L9S A;  3BTI A;  1VTN C;  3BLY A;  2E7X A;  3M3Y J;  2XAF A;  3FXJ A;  2P8T A;  2EQR A;  2DK5 A;  2IXS A;  1ZTR A;  2VT3 A;  3IRR A;  1HSJ A;  3CCE I;  4AVZ A;  2A61 A;  3K1M A;  2OCC H;  1FX7 A;  2LY1 A;  4IQ4 A;  2G7H A;  4BHB A;  1LEA A;  1OYW A;  1RUN A;  2ZNY A;  3ZR8 X;  2WV1 A;  3FDY A;  3E3V A;  1G3Y A;  2KIM A;  2E2H J;  5J8C A;  3ZMV A;  1LNW A;  3IL2 A;  1QVT A;  1FC3 A;  1OCO H;  3ONQ A;  1O7L A;  1SFK A;  2HR3 A;  3OV8 A;  5FRM A;  1Z9C A;  3H0D A;  4MHG A;  3GCM A;  4L5E A;  2GZW A;  3G1L A;  3HHH A;  3KCC A;  4I01 A;  1WRJ A;  3QOD A;  2DMT A;  2VBW A;  2KRC A;  4HLX A;  5A2Q K;  3OSG A;  3KP5 A;  1T56 A;  2DYS H;  4A3G J;  3J80 K;  1F5T A;  3L2W A;  3DQV C;  5D8L B;  4ZTJ A;  1JHH A;  3WG7 H;  3KYL A;  1YI2 I;  2H8W A;  4A3J J;  2CV2 A;  1AKH A;  3F22 A;  5AON A;  1JKQ C;  4FAS D;  4OAZ A;  4DGW B;  3H5N A;  5KAF C;  2JSC A;  3TW7 A;  4M73 A;  1HBX G;  1D8K A;  4XID A;  4M3D A;  3DU5 A;  4R8H A;  2LH9 A;  2FMY A;  2O0Y A;  5F27 A;  5LBQ A;  1FZP B;  3V7S A;  3BQY A;  3F8F A;  2P5K A;  1A35 A;  1VQ8 I;  5JR3 A;  4EJV A;  4PGH A;  3A4C A;  4M3E A;  3SYT A;  4BGD A;  2GQQ A;  2BW3 A;  2HOS A;  3NQO A;  1YRN A;  2R7D A;  4IJA A;  3OYF A;  1K4S A;  3CC4 I;  5J40 A;  1UCR A;  2L7F P;  4CCM A;  4HRI A;  1BR1 A;  5E1Z B;  2R7O A;  3WE3 A;  2LY2 A;  2Z16 A;  2VJI A;  4AYB N;  2QF7 A;  1VI0 A;  3HC7 A;  5DCF A;  1TNS A;  2VLA A;  3S32 A;  3V8J A;  2MC3 A;  3E6C C;  5IYC J;  2R7U A;  2LYC A;  4ENJ A;  1U3E M;  5HLH A;  4IOC F;  2M8E A;  2Q8K A;  3K4M A;  3S17 J;  2PQ8 A;  2V9K A;  1IXS B;  2DPU A;  3VOD A;  1FBS A;  3C7J A;  3PUB A;  3BR5 A;  2JA6 J;  1B6A A;  4G6Q A;  3J7A Y;  3OYA A;  3GFL A;  3N97 A;  1OQY A;  3JRF A;  1ZR4 A;  3O3K A;  2PMZ N;  5F04 A;  1QPM A;  3DEE A;  3H5A A;  3K69 A;  2FD5 A;  3HOS A;  5KCM A;  1DP7 P;  3DWL E;  4EJW A;  5KAI C;  3I4P A;  1ON2 A;  5J3L A;  5M5X J;  3D0S A;  3R6S A;  5TJJ A;  2FOW A;  3T1B A;  5D5V B;  1ZGW A;  1IDZ A;  3HRS A;  1G59 A;  1MMS A;  2CQQ A;  3K4B A;  2P6S A;  3AG4 H;  4GCV A;  3RYP A;  2XV4 S;  5EEG A;  2EJR A;  2MH2 A;  4KFC A;  2DBB A;  2BBY A;  1MBF A;  3CO7 C;  2VOD A;  4M6X A;  4AVP A;  5H2F C;  1MH4 A;  3K9T A;  3BJO A;  1YO5 C;  4W1U A;  4L5I A;  1TWF J;  1R00 A;  2VC0 A;  4M3F A;  2I10 A;  1G4D A;  1BOA A;  1VQ6 I;  2LVS A;  1SD4 A;  2HPM A;  2E1C A;  3CJT B;  4CYC A;  3GW2 A;  2JPB A;  1QHG A;  2DFH A;  3GO5 A;  1N25 A;  4A3E J;  1DQU A;  2Y75 A;  4MFD A;  1ZLK A;  1ULY A;  2JT1 A;  1MNM C;  2V1D A;  2YUS A;  2A5W A;  1Z0X A;  2XF7 A;  1E17 A;  1OLT A;  4A5M A;  2AXL A;  1BIB A;  2JPC A;  4CXF A;  4DBR A;  3K2A A;  5TGT A;  1FEX A;  4WX9 A;  5B3S H;  4N4N B;  4DYR A;  4IRG A;  4XON A;  3FM5 A;  4M72 A;  2W25 A;  5EG0 B;  2KDO A;  1WI3 A;  1RET A;  5KVR A;  4I76 A;  3IUO A;  4XK4 A;  1A5J A;  3RZD J;  1EF4 A;  2DA4 A;  3BDD A;  4OAY A;  4LOC A;  4A3M J;  1V55 H;  1Y39 A;  2E1M C;  1USS A;  2H1K A;  3F8C A;  3I59 B;  1YQA A;  2OQR A;  5IOY A;  3SZG A;  5J4Y A;  1ZH5 A;  3C2B A;  2QWW A;  3WE2 A;  3ULQ B;  2QUF A;  1O4X A;  5J1U A;  3RZO J;  2IP2 A;  1OJL A;  3LQR A;  1WJA A;  3J80 Z;  3CCU I;  1P7I A;  2WWY A;  4YFX F;  3ML6 A;  2WA0 A;  1AA7 A;  3PFI A;  4UB6 C;  3WTY C;  2DA6 A;  3P5J A;  2OUM A;  1R5I D;  4IHV A;  3RPQ A;  3TDZ C;  2VQH A;  3GFI A;  4PCQ A;  4YIR X;  3TMO A;  3CO6 C;  4AUX A;  5GTI C;  3QPL A;  4WWC A;  4Q5S F;  2L2O A;  1IRZ A;  1Y8Q B;  2KZV A;  3CUQ A;  3W6V A;  2RNJ A;  4I7H A;  2DMU A;  4CH7 A;  4XKC A;  1BW5 A;  3OS2 A;  3E6D A;  2YSR A;  5EG0 A;  1OFC X;  1SMY F;  4U88 A;  3S1R J;  1OPC A;  1VND A;  4C3J J;  1QRY A;  5FKK A;  2DO7 A;  3F21 A;  1BI3 A;  2L7Z A;  4HOB A;  5EEA A;  2V6E A;  2WTE A;  4BYY A;  1IUY A;  1F43 A;  2NOG A;  2LKX A;  1ZAO A;  4HF0 A;  1I3A A;  4JYK A;  2EA2 A;  4RM2 A;  2DA5 A;  3K4K A;  4A3L J;  1WJC A;  3WGH A;  4ZDO A;  5DD8 A;  3F72 A;  2BZT A;  1SC7 A;  3D5L A;  4BY7 J;  1GT0 C;  2O61 A;  1F1Z A;  1B4A A;  4NHJ A;  3A01 A;  3G73 A;  3G4S I;  4J00 A;  1XDS A;  4BQO A;  2IT0 A;  2VQL A;  3KFW X;  3ESW B;  2R5Z A;  1FOW A;  4DNC A;  3VEP A;  4Z6Y A;  1MJB A;  3ZN1 A;  1VQO I;  2PFB A;  2JUG A;  3OYG A;  2DOF A;  4O3M A;  3A1Y A;  4ZH4 F;  5ILV A;  5HOO A;  3DKX A;  1K79 A;  4RAF A;  1J0R A;  4MO7 A;  1YW9 A;  4U0V A;  3VSK A;  3I56 I;  1VQ9 I;  2D2W A;  3F3X A;  3OL4 A;  1Y1W J;  3HHG A;  5H6Q A;  2VQC A;  2H27 A;  1H9G A;  2WAD A;  1XS9 A;  1HKS A;  5HS7 A;  4HST A;  4V19 K;  3OYK A;  4ENM A; 
#chains in the Genus database with same CATH homology
 5F0F A;  1NK2 P;  2GBY A;  1Q1V A;  2LY9 A;  1FIP A;  1ETW A;  2EH3 A;  2Y30 A;  2K40 A;  3BR3 A;  1MBH A;  1PUF A;  1HF0 A;  5DTD A;  1ETO A;  2EZK A;  2JWT A;  3FKI J;  3BG5 A;  3A03 A;  2EZI A;  4UUS A;  3LSR A;  3S14 J;  5EZH A;  4QSH A;  1JGG A;  5HOD A;  1TWA J;  5IP9 J;  1RR7 A;  3WHB A;  3WHC A;  2MW8 A;  2WB1 N;  3Q0U A;  4BBR J;  4DZP A;  2KDZ A;  1I3Q J;  4D5F A;  2FJ1 A;  5FLM J;  3IH2 A;  2NS7 A;  3PM1 A;  2XPW A;  3FIW A;  2K9S A;  1DU0 A;  3TED A;  1H89 C;  3K7A J;  2ELK A;  3JRG A;  3E7L A;  1WPK A;  5C3E J;  5C44 J;  1ITY A;  5F1J A;  1BW6 A;  1ETX A;  3TW6 A;  2D5V A;  3MN2 A;  1X2N A;  4GFB A;  2NVT J;  3S2H J;  4IEJ A;  4XIC A;  1P7J A;  5EGO A;  2VKV A;  4W97 A;  1ZK8 A;  2Y31 A;  4B1R A;  4JX5 A;  1JJ8 C;  1XG1 A;  2COB A;  5K7F A;  3HBL A;  3HDD A;  5IP7 J;  1HDD C;  2LTP A;  1I6H J;  2L0K A;  3ZQC A;  1BJZ A;  1ENH A;  2K9N A;  9ANT A;  5EYR A;  3DEW A;  2GM4 A;  3A02 A;  2FQ4 A;  1BL0 A;  2N8G A;  5M5W J;  3FIS A;  2M2E A;  5JLW A;  2MSY A;  4C3I J;  3NAR A;  2TCT A;  2KT0 A;  2JMW A;  1K83 J;  5FKM A;  1AKH B;  1BA5 A;  1GDT A;  3JRC A;  1Y1V J;  3JR9 A;  2Y0S N;  3G1M A;  3BT9 A;  2HOA A;  4C2M J;  1GV2 A;  4BXX J;  3FK6 A;  2NVX J;  3HGY A;  2VI6 A;  5BNG A;  1POG A;  1ETK A;  1VFC A;  1MBK A;  2E19 A;  3H0G J;  4FE7 A;  4Y7N J;  3HGG A;  1ZQ3 P;  5C4X J;  4XRS A;  3HOZ J;  3BTJ A;  1JKR C;  4IHW A;  3JRD A;  4MFE A;  1UHS A;  2QCO A;  3BQZ A;  3S2D J;  1X2M A;  4M3G A;  2M0C A;  3HOU J;  2ECC A;  3IV5 A;  3GBG A;  3A01 B;  2CRG A;  2CU7 A;  2YS9 A;  1ETV A;  5FJ8 J;  3JRE A;  1MSF C;  2X9D A;  3ZQI A;  1JUM A;  3CCY A;  4MIM A;  2HDD A;  1ZKG A;  4A3K J;  3BR0 A;  3HM5 A;  3ZQF A;  2DA2 A;  1WCM J;  3BR1 A;  1PUF B;  3MVP A;  1TWG J;  3S1Q J;  3BR6 A;  2OPT A;  3PO2 J;  4AC0 A;  2XGD A;  4CYC B;  4I6Z A;  5M3F J;  2JK3 A;  2ZB9 A;  1DU6 A;  3BTI A;  2DMQ A;  2HXO A;  3M3Y J;  3OIO A;  2LD5 A;  1JT0 A;  3HOW J;  3OSF A;  1IJW C;  2EQR A;  1ZTR A;  5EZG A;  1ZR2 A;  1MSE C;  3GTQ J;  2CUF A;  1IUF A;  3BTC A;  2NS8 A;  3ZOB A;  3LOC A;  4DW6 A;  1Z77 A;  4J19 A;  2WV1 A;  2X6O A;  1MBE A;  4HNV A;  2TRT A;  3HOX J;  4G12 A;  1K61 A;  2E2H J;  1JT6 A;  2EZH A;  1QVT A;  4UUT A;  1ETQ A;  4B3A A;  1R9T J;  2RAE A;  5F0C A;  3F0C A;  4A69 C;  3SJM A;  4L5E A;  4D7N A;  2LR8 A;  3G1L A;  2K9Q A;  1T33 A;  2DMT A;  1CQT A;  2ID3 A;  1B72 B;  1U9O A;  1A6I A;  1I50 J;  5JLX A;  3OSG A;  1T56 A;  4A3G J;  1GV5 A;  1AU7 A;  3I4M J;  2AO9 A;  1B8I A;  5GPC A;  1YRN B;  1APL C;  2MGQ A;  3CDL A;  2DMN A;  1GUU A;  3HB9 A;  3GTL J;  3S15 J;  4UUS B;  4A3J J;  1AKH A;  1UMQ A;  3FK7 A;  1JKQ C;  1F36 A;  4Y52 J;  3LNQ A;  4JX6 A;  2JJ7 A;  3TW7 A;  4QIW N;  4D5C A;  3JRB A;  4XID A;  4M3D A;  4A93 J;  5E3O A;  3QQA A;  5F27 A;  3NAU A;  3BQY A;  4C3H J;  3LSP A;  1S7E A;  1ETY A;  3Q0V A;  1FIA A;  2GLO A;  1G2H A;  4B4C A;  3GTM J;  1IDY A;  2HOT A;  5GP9 A;  4M3E A;  2LFB A;  1SFO J;  3ZQL A;  3HOV J;  1X58 A;  2XPU A;  2XB5 A;  2HOS A;  2DJN A;  1YRN A;  1JKP C;  4FCY A;  3BR2 A;  4JP0 A;  2LK2 A;  2L7F P;  2O9L A;  2Y9Z A;  2R93 J;  5FLV A;  3GTO J;  3JRI A;  1IG7 A;  3H3V K;  3IH4 A;  2E2J J;  1RKT A;  1D5Y A;  2B63 J;  5IYD J;  4AYB N;  2QF7 A;  1VI0 A;  3BTL A;  1IV6 A;  5C4J J;  5IYC J;  2R0Q C;  2P81 A;  4BY1 J;  1B8I B;  2XRL A;  5FKL A;  3S17 J;  2R5Y A;  1XC5 A;  2O7O A;  2LLK A;  2L7M P;  5IPA A;  2JA7 J;  1WGX A;  3BR5 A;  2JA6 J;  1FTZ A;  3TP3 A;  3I4N J;  1HCR A;  1E3O C;  4D7M A;  3JRF A;  1ZR4 A;  1IC8 A;  1U8B A;  2YU9 J;  2PMZ N;  1MBG A;  3OOU A;  5F04 A;  4M6V A;  1NTC A;  3LSJ A;  1LE8 A;  3S1N J;  2FD5 A;  3MKL A;  2L9R A;  2Y2Z A;  5J3L A;  5M5X J;  1OCT C;  2W48 A;  1ZGW A;  4BKX A;  1NK3 P;  1IDZ A;  2WAQ N;  2CQQ A;  2FX0 A;  1TWH J;  1U78 A;  5E3L A;  5FKO A;  1H88 C;  2R5Y B;  2E1O A;  3GTJ J;  2DA3 A;  1TC3 C;  1MBF A;  4XRS G;  4X6A J;  2HXI A;  1ORK A;  3GTG J;  3GTK J;  4S0H B;  1MH4 A;  3CQZ J;  4FIS A;  4W1U A;  3S1M J;  1TWF J;  4M3F A;  2I10 A;  2DN0 A;  2AHQ A;  4RDU A;  2LVS A;  3HOY J;  4CYC A;  2JN6 A;  4V2G A;  2OF7 A;  3RKQ A;  4IHX A;  1IGN A;  3LSG A;  4A3E J;  4MFD A;  5GPA A;  3L1P A;  1MNM C;  5E3M A;  2JA5 J;  5K7H A;  3VPR A;  5E3N A;  2YUS A;  1JJ6 C;  2IAI A;  1FTT A;  1Z0X A;  4X1E A;  2LP0 A;  2VUM J;  2NVY J;  4A3C J;  5J1R A;  2ECB A;  3HKZ N;  4ABZ A;  2CUE A;  4A3F J;  2X48 A;  1MBJ A;  2IBD A;  3K2A A;  1FEX A;  2O8K A;  2VKE A;  4DYR A;  1B72 A;  1JTY A;  2EBI A;  2ME6 A;  1WI3 A;  2CQX A;  5EG0 B;  1RET A;  3D1N I;  1W0U A;  3B6A A;  2JA8 J;  1HDP A;  4I76 A;  3SDG A;  4XK4 A;  1GVD A;  1UG2 A;  3Q0W A;  3RZD J;  1H8A C;  1A5J A;  2DA4 A;  5M5Y J;  1EF4 A;  4FTH A;  3IH3 A;  1AHD P;  3UKG A;  3BG3 A;  4LOC A;  5K7Z A;  4A3M J;  4A3I J;  2M9H A;  4RBO A;  3G1O A;  1QPI A;  2H1K A;  3M4O J;  4QTR A;  5F08 A;  5IOY A;  2R5Z B;  4JX4 A;  2ID6 A;  1JTX A;  3ZQH A;  1FJL A;  3C2B A;  2HQ5 A;  1RKW A;  1WH7 A;  5J1U A;  1O4X A;  3RZO J;  4DYC A;  3BG9 A;  1OJL A;  2H8R A;  2XSD C;  1P7I A;  2ME0 A;  1U9N A;  1JUP A;  2DA6 A;  4IHV A;  5IYB J;  5J1Y A;  5DS9 A;  2R7Z J;  4BBS J;  5FKN A;  5IP6 A;  4AUX A;  3QPL A;  4A3D J;  1VF9 A;  3DCF A;  2DA1 A;  2R92 J;  1IRZ A;  2HYJ A;  1LFU P;  3JRH A;  3W6V A;  3JRA A;  2IEK A;  2DMU A;  2M34 A;  1BW5 A;  2G0E A;  1TWC J;  4DYQ A;  2NVQ J;  5IOZ A;  5EG0 A;  2DMP A;  1LFB A;  1OFC X;  3S1R J;  1MH3 A;  1VND A;  4C3J J;  1QRY A;  1JUS A;  5FKK A;  2M8G X;  2L7Z A;  5EEA A;  4V2F A;  1F43 A;  2NOG A;  2LKX A;  3TP0 A;  4JYK A;  2EZL A;  3ZQG A;  2DA5 A;  4A3L J;  3SFI A;  5EF6 A;  4XRM A;  1HLV A;  1JKO C;  5EDN A;  3O8H A;  3Q3S A;  3S16 J;  2VPR A;  4IHY A;  4BY7 J;  1GT0 C;  2Y9Y A;  4DZJ A;  4EEF G;  4M3B A;  3QPS A;  3B6C A;  3A01 A;  2DTZ A;  3GTP J;  1HOM A;  2XGC A;  3CMY A;  1W0T A;  1WH5 A;  2XGE A;  4NDL A;  2R5Z A;  4FE4 A;  4A3B J;  2XPV A;  5M3M J;  2DA7 A;  2CJJ A;  1RES A;  5EGO B;  2E2I J;  2XB0 X;  1SAN A;  4MO7 A;  1LE8 B;  5F0H A;  1QVU A;  3RQI A;  4MLO A;  3HEF A;  2HI3 A;  1Y1W J;  3O8G A;  1XS9 A;  2MG4 A;  3PO3 J;  1RPW A;  1OCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...