2E2IJ

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dgtp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2e2iJ00
1IG7A 1OCTC 2NOGA 2P81A 4V2FA 2CRGA 2D5VA 4M6VA 4FE4A 2Y30A 4M3FA 2LTPA 3BG3A 4UUTA 4A3JJ 1VFCA 1B8IA 1NK3P 1TWCJ 4J19A 2DA6A 2M9HA 1APLC 3F0CA 2YU9J 1ITYA 4ABZA 4XICA 2FQ4A 2G0EA 5EF6A 2HQ5A 3MN2A 4A3FJ 2COBA 1BA5A 4UUSA 2ECBA 4W97A 4W1UA 3HOVJ 2AHQA 1LFUP 2LY9A 1HCRA 3ZOBA 3GTOJ 5EDNA 4S0HB 2LKXA 2M2EA 5FKOA 1JKQC 1JKRC 3BR6A 1QVTA 2EQRA 2M8GX 2EBIA 3JRCA 1A6IA 3HBLA 2DMNA 3RKQA 5FLMJ 4A3CJ 3FK7A 2DMPA 2XGCA 2HXOA 3CCYA 3I4NJ 2CQXA 4C3IJ 3RZDJ 1ZR2A 3BR5A 3S2DJ 1ZR4A 3SJMA 2IEKA 4D5CA 5EG0B 2GM4A 4NDLA 2QF7A 2EH3A 1XS9A 1F36A 1U78A 2R7ZJ 2VKVA 4D7NA 2M0CA 1G2HA 1PUFB 1IGNA 4BKXA 2ID6A 4MFDA 5FKMA 2ME6A 1RPWA 2CUEA 2ME0A 2HYJA 1FIPA 3S1QJ 2LVSA 3OSGA 1GV2A 3S2HJ 1VNDA 4A3MJ 1AHDP 3JRFA 2JA5J 3QQAA 1UHSA 4XRSA 2H1KA 1GV5A 3Q3SA 1DU6A 1FTZA 1IJWC 3LSRA 9ANTA 2OF7A 1W0UA 1BW5A 3LSPA 5F04A 1ETYA 3G1OA 3PO2J 5EGOA 3JRIA 1JUPA 5DS9A 5J1UA 2EZHA 4DYCA 1ZQ3P 2DJNA 2LLKA 3S16J 1U9NA 3HEFA 3BQZA 1BW6A 5M3FJ 4XRMA 3I4MJ 2O7OA 1ZTRA 4MLOA 2CUFA 1GDTA 2DMTA 4G12A 1D5YA 1MH4A 2HDDA 2WB1N 3JREA 3QPLA 3OIOA 3LNQA 4M3GA 1Y1WJ 1XC5A 1JUMA 2CU7A 2DA5A 2IBDA 2GLOA 2Y31A 2DA2A 2NVYJ 3BR0A 5C44J 5GP9A 2XSDC 4DZJA 3S14J 1TWGJ 4BBSJ 3OOUA 1JGGA 1JUSA 3E7LA 4HNVA 5J1RA 1LE8A 3DEWA 3HGYA 3NARA 1EF4A 4MFEA 5IOZA 1UG2A 3IV5A 3UKGA 3BG9A 5K7HA 4CYCB 1ETOA 3FISA 1MBEA 1VF9A 1BL0A 4IHXA 2DN0A 1OCPA 3G1LA 5F1JA 2YUSA 2RAEA 2XPVA 2FD5A 1RESA 1BJZA 1X58A 2Y0SN 3ZQLA 1U8BA 1JJ6C 3G1MA 1CQTA 1H8AC 1WI3A 2E2IJ 2JA6J 5IOYA 2DA7A 1GUUA 3JRGA 4A3LJ 3TP3A 2DA4A 2R93J 5C3EJ 1R9TJ 2PMZN 1ETWA 1ETXA 1GVDA 3TP0A 5M3MJ 4M3DA 3JR9A 4JP0A 2ZB9A 5F08A 5IYBJ 3TW7A 2XPWA 4JX4A 3LSJA 4FISA 5IYCJ 3HGGA 3GTMJ 2LD5A 1ETQA 4EEFG 4AYBN 3Q0VA 1AU7A 3A01A 3BTCA 4DW6A 4A3GJ 1I3QJ 2EZIA 3CQZJ 1JTXA 2XRLA 3LOCA 2L7ZA 5JLXA 4DYQA 1JTYA 2R5ZA 4IHYA 3MVPA 3HOUJ 3BTIA 3HOYJ 1MBHA 2I10A 4DYRA 3GTLJ 3VPRA 2VI6A 2R0QC 5EZHA 1OJLA 5GPCA 2MG4A 2WAQN 1LE8B 2JMWA 5M5YJ 3GBGA 1F43A 1IDYA 4BY7J 2NS8A 1B72B 4I6ZA 1IC8A 4D5FA 3PO3J 3IH4A 5IP6A 4A93J 3NAUA 1JT6A 1TWFJ 4BXXJ 2TRTA 2LFBA 3Q0UA 3JRBA 2NVTJ 3Q0WA 1MSEC 1ENHA 1QPIA 2XB0X 2XB5A 5K7FA 2K9SA 1B8IB 1RETA 2DA3A 5BNGA 1H89C 2JA7J 3GTKJ 3BTLA 4QIWN 1WCMJ 2X9DA 4A69C 4XRSG 3HOWJ 2NS7A 3HOZJ 3O8HA 2FJ1A 3D1NI 1K61A 2AO9A 1AKHA 1T33A 4UUSB 4X1EA 5DTDA 1E3OC 1ZKGA 4B4CA 2CJJA 1A5JA 2ECCA 2E19A 2XGDA 2YS9A 4Y52J 2LP0A 5J1YA 3S17J 1MBJA 3BR2A 1TC3C 4FTHA 2M34A 1IV6A 5HODA 1VI0A 4X6AJ 3ZQHA 1QVUA 3TW6A 3BR1A 4JYKA 2R5ZB 1HF0A 1Y1VJ 1K83J 1IUFA 4C3JJ 5EEAA 4AC0A 2K9QA 1RR7A 5E3NA 2ELKA 3W6VA 5C4XJ 3PM1A 1UMQA 1ZGWA 3L1PA 1W0TA 1X2MA 3JRHA 5EZGA 1XG1A 2L7FP 2E1OA 3FK6A 5F0HA 5F0FA 3QPSA 3H0GJ 3BTJA 5EYRA 3A02A 1ETVA 4LOCA 3LSGA 4DZPA 4A3DJ 1JT0A 3BR3A 4RDUA 1RKTA 2QCOA 1FTTA 2Y9ZA 5FKKA 1T56A 2L0KA 4IHWA 2JK3A 3HOXJ 1MNMC 2N8GA 4FE7A 3M4OJ 1TWHJ 3ZQCA 2JA8J 2K9NA 5F0CA 4MO7A 5EGOB 3S1RJ 3GTJJ 1U9OA 5FJ8J 1MBFA 1Q1VA 1S7EA 1X2NA 4JX6A 1WPKA 1RKWA 1WH5A 5J3LA 2CQQA 2LK2A 2HXIA 2WV1A 2NVXJ 4QTRA 2JWTA 3OSFA 5C4JJ 2GBYA 1LFBA 1NK2P 2K40A 3GTPJ 3A03A 4I76A 1HDPA 3ZQFA 3GTGJ 2DMQA 3S15J 1P7IA 1IDZA 3ZQGA 2X6OA 1JJ8C 1SANA 3HM5A 4Y7NJ 4D7MA 4XIDA 2EZKA 5GPAA 2JN6A 5F27A 2OPTA 2VPRA 5IP9J 3DCFA 1JKOC 3IH3A 4RBOA 2L9RA 3S1MJ 3FKIJ 5M5XJ 5FLVA 1MSFC 2XGEA 3BG5A 4L5EA 1TWAJ 4IEJA 4XK4A 3SFIA 1YRNA 4C2MJ 3SDGA 1MBGA 2B63J 2LR8A 1HOMA 4B1RA 3B6AA 5FKNA 2TCTA 3O8GA 1HLVA 3BQYA 1JKPC 2XPUA 1GT0C 2HOSA 3ZQIA 1WGXA 4MIMA 2FX0A 5M5WJ 3WHBA 4QSHA 5E3MA 3K2AA 3RZOJ 4BY1J 1MH3A 3HKZN 3MKLA 3FIWA 5IYDJ 1FJLA 3H3VK 3RQIA 1I50J 2R5YA 2DTZA 5FKLA 2MW8A 1QRYA 2NVQJ 4C3HJ 5IP7J 3A01B 3TEDA 5K7ZA 2KDZA 4CYCA 3M3YJ 4IHVA 1H88C 3CDLA 1POGA 1ZK8A 1ETKA 3HB9A 1ORKA 3C2BA 2DMUA 3CMYA 1FIAA 1FEXA 4FCYA 2W48A 2KT0A 5IPAA 2DA1A 5E3LA 2JJ7A 3JRAA 1Z0XA 3BT9A 1OFCX 2L7MP 1YRNB 4A3BJ 4BBRJ 1MBKA 4V2GA 2H8RA 3S1NJ 3JRDA 4JX5A 1DU0A 2HOTA 2VUMJ 2VKEA 2O9LA 1IRZA 4A3EJ 2R92J 4M3BA 1P7JA 2HOAA 2ID3A 1I6HJ 3K7AJ 2E2HJ 3WHCA 3HDDA 2Y9YA 2HI3A 2MGQA 1AKHB 2O8KA 5E3OA 5EG0A 4B3AA 4A3KJ 5JLWA 1SFOJ 2X48A 2IAIA 2R5YB 2Y2ZA 4AUXA 4A3IJ 4GFBA 3B6CA 2E2JJ 1O4XA 4M3EA 1PUFA 3GTQJ 1NTCA 1Z77A 2EZLA 1B72A 1WH7A 3IH2A 2MSYA 1HDDC
chains in the Genus database with same CATH superfamily
1IG7A 3WTTC 3KP6A 4E4HA 3RI4A 1OCTC 2ISZA 1SD6A 1RZ4A 2NOGA 3W6JB 2QQBA 1TT0A 4M6VA 1R6RA 4FE4A 2Y30A 4A3JJ 1VFCA 3K4MA 2ZMEA 4PSXA 3F0CA 5L3CA 1NG7A 2BY0A 5ILSA 4GYIA 2GOMA 3KEQA 1JHFA 5E1XA 1EKEA 3M9AA 1T08B 1EV7A 4XICA 2FQ4A 2R7XA 2R7QA 3QPHA 5EF6A 2E1MB 1E17A 4W1UA 3V8LA 3HOVJ 1NHAA 2LY9A 4PJ0C 1R5ID 2Y75A 1JKRC 3HIFA 4WWCA 4FX4A 1YTYA 1MW7A 3S3MA 2EBIA 3REOA 2K5CA 5GAHJ 4IPAA 1EJ9A 1XGSA 2VJJA 4FETA 4PDKA 3PL8A 4J00A 2HXOA 3O6BB 4C3IJ 2LMDA 3RZDJ 4L9JA 4M71A 1VQ9I 4BHPA 2QYOA 1WSUA 1ZRCA 2IEKA 2BZTA 2H6BA 3FXLA 4RA2A 3KP7A 4U0YA 2H6CA 4J01A 5FFZA 2MFZA 3I5UA 2EH3A 2W25A 1U78A 2VKVA 4CCKA 2BY1A 4B47A 3OY9A 1PUFB 4BKXA 4CCOA 2J5OA 1P4XA 2ME6A 3SYTA 1RPWA 2CUEA 2ME0A 5CJ9A 4NB5A 1MJBA 1SAUA 1K4TA 4NC8A 2MLKA 2O5RA 1Z6TA 3S2HJ 1VNDA 1WJDA 2JA5J 4Z2YA 2VQGA 3TGNA 4XRSA 1QHGA 5HLGA 3OWTA 4G6DA 4GO1A 4A0ZA 5ED4A 2O0YA 2VE8A 3DLLF 3M1EA 1XSVA 4F3QA 3G71I 4M72A 3KCCA 1IJWC 1JXSA 4EVIA 3K6GA 9ANTA 2FBHA 3CUQA 4BE2A 1BW5A 3LSPA 3P9IA 5F04A 2QM3A 1ETYA 4BQNA 1Y8QB 4CCLA 4HX8A 3PO2J 1BN5A 2IVMA 2K27A 5EGOA 3JRIA 1W1WE 2BVMA 3FX3A 3DBLB 5DS9A 5J1UA 2RNGA 3EETA 4XKVA 4Y33A 3OYHA 1ZQ3P 2Z16A 3S16J 1R23A 2BHYA 4D1QA 1N25A 3SQNA 1KQ9A 5M3FJ 4HA8A 1VQLI 1ZTRA 1B6AA 1BI2A 2RVCA 3HRSA 3F3XA 4O5VA 1GDTA 2IS1A 1MH4A 1JE8A 1VQ8I 4RB0A 3QPLA 4L0ZB 3LNQA 2JSCA 4M3GA 5E17F 1Z05A 2Q1ZB 4H4KC 1VQ7I 2DA5A 4F92B 3VB2A 2EFQA 3H9GA 1R1VA 1LEAA 4CH7A 2F5VA 2KMUA 1KYWA 1XGOA 1D3YA 1TWGJ 1D1BA 2CW7A 2XVCA 2I8DA 4YFKF 1E3PA 1G3TA 4AIJA 2QQ9A 3H9JA 4I0AA 3ZQ7A 4HNVA 2EK5A 3IL2A 1S72I 2RNJA 3HGYA 1GVJA 3RDIA 3DPUA 3DEUA 3KP5A 2BVLA 1EF4A 5CVIA 3FXKA 4KN7X 3TOBA 3MMYB 2DT7B 3M8JA 5K7HA 4YELA 1ETOA 2DT6A 3FISA 4YFNF 3CCRI 2Q8KA 5LHIA 1BL0A 3K69A 2Z3YA 2DPUA 3SDBA 3OYKA 2YUSA 2XPVA 1BJZA 2O3FA 2GXGA 2HTSA 3MEXA 4RGRA 4U0WA 4XBFA 3G1MA 4XKWA 2LF8A 4CDGA 1WI3A 3HG9A 5IOYA 1R4MB 3DFGA 3DEEA 3GUDA 3JRGA 4OU0A 3TP3A 2R93J 5C3EJ 2PMZN 3LSTA 2HQAA 4G7OF 4P96A 4LG0A 4XL9A 1T0FA 2JA2A 2PN6A 3KX2A 2LC2A 3RIRA 4FISA 3RYPA 2BV6A 4HBLA 1ZG5A 5IYCJ 5D8LB 2LD5A 5ICFA 2ACJA 1ETQA 5DD4A 2FMYA 2VASA 2H1LA 3N05A 3Q0VA 5FGMA 1QNTA 2L5QA 4I09A 2A68F 2K3PA 2XRLA 3LOCA 4XNFA 1JTYA 3ZMZA 1WI9A 2I10A 4MQ9F 3VPRA 2VI6A 1UB9A 5J6XA 1V5EA 2R0QC 1SMYF 1MNDA 4UB6C 3LFUA 1LE8B 1IDYA 5HLIA 4PJLA 1HKSA 1FMWA 2F5DA 1WJFA 3HZJA 2P6SA 2YX4A 3IH4A 5IP6A 4CICA 1MIJA 1UJ8A 3FM3A 2TRTA 3QU3A 2NVTJ 3Q0WA 3HSEA 2KL4A 1ENHA 1MSEC 2XB5A 2K9SA 1ZG3A 3KFWX 2DA3A 4HW0A 2FBIA 2PMHA 2E34A 4XM3A 4QIWN 2X9DA 2XAFA 1YS7A 4XRSG 2CSOA 1T8IA 3HOWJ 2NS7A 2BY3A 3TL4X 2FJ1A 3DP7A 3GF2A 4X1EA 3HUGA 3DBHB 1E3OC 2X6WA 4IQJA 4BU2A 3MCZA 2ECCA 2XGDA 4Y52J 1TL8A 3HRTA 2KISA 3FXOA 2PX9A 5GTIC 3OYFA 4UB8C 3DKWA 5HS9A 4G94A 3L9FA 3DWLE 3VYSB 1USSA 3ECOA 4CZZA 2K4BA 5HODA 4RB2C 4OINF 4C2UA 4X6AJ 4F7ZA 4NC6A 3PJRA 1QVUA 1PUEE 1X1CA 1ZGAA 3BR1A 4A0YA 2R5ZB 1HF0A 3SZTA 4BQQA 1Y1VJ 3ASOH 3HKZA 2W57A 1IXSB 3E5UA 1LDJA 3AFHA 4P9FA 4BACA 1M1EB 2VQCA 5FFXA 3RJPA 3JW4A 4ENMA 3EQLF 1ZAOA 2LF7A 1U0JA 3JRHA 5LFAA 1FYMA 1BJAA 5DCMA 3P9CA 1V5GA 3S3OA 1J2XA 1OR7C 3VFZA 2V1XA 3QPSA 2WBMA 5F6FA 3ZMSA 5EYRA 2ELJA 4LOCA 1MGTA 3CCUI 5KAFC 3N4MA 3BR3A 2X6YA 1QU3A 2QCOA 2OBPA 4EJOA 4MNUA 3L09A 2XF5A 1Z91A 3L00A 4GRIA 4U7BA 3OS0A 3MKWB 1O3RA 3ZPLA 1XTAA 4Q48A 3J81K 2N8GA 3I64A 3CUQB 1EH8A 1LEBA 1TWHJ 3PNYA 3CMMA 2DOEA 2OQRA 5EGOB 4FASD 4Q47A 3GTJJ 3GYHX 1Q1VA 3TO6A 3ERMA 4TV7A 1RKWA 2CQQA 1E0EA 3JTGA 2HXIA 1J59A 3UR3C 1TQIA 5HDNA 3PSFA 4LK1F 1ZRDA 2JUCA 3ZR8X 5B3SH 3KEYA 5C4JJ 2LNBA 3GWZA 2X6XA 4I76A 4HG2A 1HDPA 4OAYA 1RUOA 4BE0A 2YX7A 3G4SI 3S15J 1MMSA 2FNPA 3BLYA 5BS6A 1CGPA 2ZSHB 3KYDB 2HPIA 1JJ8C 3FMQA 4JQFA 3O3KA 2JN6A 3BJAA 4F93B 4BEHA 3H5AA 2OCCH 4KIFA 5IP9J 3GX4X 3CDHA 2PEXA 4RGXA 1IN6A 3WU0A 3I59A 4GYGA 3W2VA 3IAS2 3IWZA 5DYMA 3CMAI 1UG0A 3GFIA 3HXLA 2OU2A 3OIQA 5M5XJ 1S3JA 2A6HF 1VQNI 2CV1A 2A6TA 2F5EA 2EFWA 2M0MA 2GA1A 2DQRA 2XDVA 4IEJA 2E7WA 1WHUA 5EEHA 4C2MJ 2ZMEC 1ZHFA 1FOYA 4OOIA 3H0DA 2VC0A 1HOMA 3B6AA 2ZNYA 3WG7H 1W7PA 3BQYA 2MLGA 4IQ4A 4XN0A 2HOSA 3WGHA 2HQNA 3RYRA 1SAXA 4OIPF 3DTEA 3RZOJ 2GIVA 2L9VA 4BY1J 1HKQA 1MH3A 3P5JA 2BXYA 2AXLA 5J40A 3KP3A 3LFKA 4LG0B 2CUJA 4AIKA 3KP2A 2HDWA 5LHGA 1QZYA 3S93A 1ZH5A 3H3VK 3BDDA 1I50J 5D6EA 2R5YA 4XLNF 4R79A 1PVEA 3DPLC 2WC2A 4A6DA 3W6KB 3AG4H 3AL0B 2IA0A 3TEDA 2XAUA 4YIRX 4PUSA 1H88C 2P5LC 1BC7C 4U88A 2AXTC 2KIQA 3CMYA 3OYBA 4MTEA 4Y15A 4ZYDA 2V4JC 2CW8A 4OWRB 2P0WA 2DA1A 1V5FA 2ZC2A 1QO0D 1S5LC 2IJLA 5D4RA 1OFCX 5CQGA 2LREA 2W7NA 4II3A 3JRDA 1DU0A 1W5TA 4MHGA 2L7KA 3BC8A 4E7HA 3CP2A 5HVQC 5HNHA 4L9NA 1L3LA 2VKEA 2HOTA 1RC9A 1TQPA 1WJCA 3CUQC 1YIJI 2HOAA 4M74A 5D4SA 1UZCA 4XKCA 2ZKZA 3UNGC 2BW3B 1G3SA 3OYDA 1RUNA 1WZ2A 4WF2A 2XASA 1PYVA 3A1YA 2HI3A 4RLQA 4X0GA 2K9LA 2KJBA 3NWSA 3JCUC 2LOOA 3DKYA 2X48A 5H2FC 4ZH4F 2Y2ZA 5DUKA 4ETSA 1LUJB 3RPUD 4GFBA 3B6CA 2V26A 4C9YA 1O4XA 1PUFA 2VL8A 2FUG2 1NTCA 3MKZA 2ZFWA 1FMVA 2EINH 3IH2A 2BEOA 3OYEA 2IPQX 5E8GA 1QBJA 2CUZA 3D5SC 1YLFA 1L0OC 4ESBA 1PP7U 1MMGA 3OYGA 1YQAA 1TT5B 1YW7A 2RDPA 5H6QA 2ZSIB 2LTPA 3BG3A 3BP8A 1Z7UA 2ZCWA 3FWEA 4J19A 3CMEI 3OS2A 4CCNA 2B7EA 2L54A 2KHMA 4B3XA 1X1DA 3QP6A 2EWNA 3I3LA 1HBXG 4UNOA 2Z9OA 4ABZA 2R7WA 1XSDA 2G0EA 2UWMA 1F1ZA 3A0BC 3MN2A 4A3FJ 4UUSA 5E1WA 4MGRA 2ECBA 4HF0A 2EV5A 1LFUP 2ZXJA 1HCRA 3ZOBA 3GTOJ 5EDNA 1JKQC 2OV7A 1I39A 3QU6A 1QVTA 2EQRA 2VBXA 3JRCA 3NRVA 3HHHA 1XMAA 2HYGD 2O6GE 2DMPA 1P9QC 4E7IA 3I4NJ 3QPTA 1ZR2A 1S6LA 3BR5A 2VIXA 1Z1DA 2VT3A 2HKOA 4D5CA 2GM4A 2F5CA 2CV0A 4CO8A 3EUKL 1R71A 2MYSA 1H9GA 2QF7A 2XGXA 1ZRFA 1XS9A 1T0FC 1H9TA 3WE3A 1FNNA 2DFIA 1FBUA 1IGNA 4ENJA 2ID6A 4MFDA 5FKMA 2DODA 3U9GA 4YFXF 1FIPA 2X1EA 2MH2A 3S1QJ 3OSGA 1MD0A 2MABA 2QENA 4ESFA 3JRFA 2NS0A 4RB3C 3ZP5A 3QQAA 1UHSA 3ABUA 1P6RA 1KONA 2LBFB 4BHCA 3D0SA 1GV5A 1FYKA 5HS7A 4IZZA 2HDCA 3Q3SA 2LH9A 2ZJPF 2IT0A 3K1PA 1RI7A 1G6NA 1DU6A 1FTZA 3J80Z 3HOTA 2B9SA 4BEHB 3LSRA 2ETHA 3IHUA 4HYEA 4OIOF 2HOEA 1J09A 1HQCA 4DQ2A 2MBFA 2VPLA 3CCJI 1B59A 2A61A 4ESJA 1MMNA 3RPUA 3WTUC 1A31A 3K1NA 5LBQA 2LLKA 3I55I 3CJQB 1MJ9A 2VKHA 2GXBA 1F4KA 3HEFA 3BQZA 3N97A 3I4MJ 2VKDA 2DDBA 1FLIA 2CO5A 2DMTA 4G12A 1D5YA 4AWXB 1Y6IA 4IVNA 3OIOA 4KYWA 2CQKA 5JR3A 2IBDA 2GLOA 4RGUA 1DP3A 2W1OA 2NVYJ 2W00A 4E70A 5C44J 1ONVA 1V55H 2FSWA 4DZJA 2WWYA 2WY7Q 1MNEA 2CW0F 4BBSJ 5B5EC 2R7UA 3OOUA 1JUSA 2ZXHA 3E7LA 3GLXA 1LE8A 1D0YA 4LLLA 2LG4A 1X3UA 2V6CA 4KNYA 3ZGKA 4MFEA 4OIQF 2IW5A 1Y39A 2HTJA 3UKGA 5L3DA 2GZWA 3U2RA 1VQ6I 2IS2A 4IHXA 2V7FA 2DN0A 1HSTA 5DDGA 3G1LA 4ZZDA 2HPMA 2Y0SN 1T6SA 2FD5A 1X58A 4G6TB 5J4YA 3S2WA 1IN5A 4QWQA 2XAGA 1HXDA 4XLAA 2E2IJ 4XLPF 2JA6J 1C0WA 2GOXB 1JHHA 3BG6A 2XKOA 1FWZA 4A3LJ 2DA4A 1TBXA 3JAMZ 4YIIA 4HX4A 2QBYB 1ETXA 3TP0A 2F6CA 4BJTA 4OIRF 1MMDA 3ZCOA 1KU9A 3ROUA 3OL4A 3TW7A 3W2AA 2L3DA 4PZJA 3SXYA 3HGGA 4P1WA 3GW2A 3DXJF 4EEFG 4AYBN 4A6EA 4KMFA 1K7AA 4DW6A 3TMOA 5D6FA 2HFHA 3GFMA 2M4GA 3SFZA 2VN2A 2L7ZA 4IHYA 1KA8A 4XSZF 2R5ZA 3KZZA 3CESA 4DYRA 1KQ8A 4LFUA 2P8TA 4QLCU 1KU2A 3ZRGA 2MG4A 1DPRA 2JMWA 4ZYAA 5GADJ 5M5YJ 1MJAA 5D8KB 3E5XA 1FSEA 2HWVA 2OZUA 2NS8A 1QHHD 1IC8A 4D5FA 3PO3J 2DOAA 4A93J 2R7OA 1JT6A 1TWFJ 4BXXJ 3Q0UA 3H9QA 4Y4RA 3S8PA 3CO6C 1SFUA 2NXNB 1BI3A 1X4OA 4G8XA 2DT5A 5K7FA 1KGSA 1YX3A 1B1BA 2NNNA 5LRSA 3CLQA 1G8XA 5B66C 1G4DA 3LL7A 1H89C 2FNAA 1YITI 1P92A 1WCMJ 5DCFA 4A69C 2HVRA 3HOZJ 3O8HA 3K4NA 2WAEA 3E6MA 5KCMA 1K61A 3J7ZI 5CPRB 4D0PA 2YSRA 3MKYB 4MEXF 1AKHA 1T33A 4UUSB 2MC4A 5DTDA 3WG9A 1Z7LA 4IO9F 1ZKGA 3OL3A 2DLLA 2E19A 4BQOA 3F21A 2BGCA 2LP0A 5FRNA 2LKPA 3EUHC 3CCQI 4Q4ZF 5JVTA 1QQIA 2DOFA 4FTHA 3ABKH 4FX0A 1LFPA 1IV6A 4KISA 4D9JA 4E7KA 2A6EF 3AG1H 3FBIB 2E60A 3ZQHA 1LVAA 3AKZA 3BPVA 4UXNA 3PIOF 3J7AO 4FT8A 1RNLA 4CCMA 2DK8A 4I2OA 3PFYA 5EEAA 1VQMI 3QRFF 3FXRA 3V7CA 6PAXA 3KYCB 3K9TA 2IGOA 2R7FA 3PM1A 1UMQA 3R61A 1ZGWA 1DDNA 1W0TA 1LNWA 5EZGA 4P55A 5IT9Z 1ZYRF 4N9HA 2R7RA 2E1OA 5F0HA 1A04A 5DV5A 2OJED 2DXIA 1S9HA 5AIQA 1UAAA 3H0GJ 3BTJA 2F48A 1ETVA 3LSGA 1BBYA 2LSOA 1JT0A 3LA3A 1TW2A 4E7LA 3K4CA 2WV0A 4NQWB 2Y9ZA 4HV6A 1R36A 5FKKA 2FE3A 2L0KA 3K1MA 3OYAA 3K70D 1D1CA 1IF1A 2IS6A 2FRHA 2JK3A 4Z6YA 4V19K 4RAYA 5JFRA 1ZLKA 3ZQCA 3X2QH 2JA8J 4A5MA 4C2TA 4EGZA 4MO7A 4XLFA 4IL6C 4L5IA 3S1RJ 1ZREA 1S7AA 3L2UA 2KPMA 3BPXA 2PJRB 1VQ5I 1S7EA 1X2NA 2E1MC 4JX6A 2XF7A 2ICWG 3HC7A 5J3LA 2HGCA 2RQQA 2EIMH 5BQTA 2Z99A 1KQ0A 2NRAC 4BH9A 4ZDOA 3E6DA 2JWTA 3PSIA 3OSFA 3FBNB 1LPQA 3IKVA 4RAGA 2K40A 1NK2P 4QPQA 3HHGA 1W5SA 2M5WA 2PFBA 3ZQFA 3GTGJ 4RGSA 3ZQGA 3KLOA 1ZLJA 1SANA 4Y7NJ 2WADA 5ICCA 5K1YA 1G3YA 3CF5F 3LWFA 4I99C 3U1DA 5LLQA 4N4NB 4RBOA 4BYYA 1GXPA 4M9ZA 3RKWA 1T39A 1TTYA 3PIPF 4AD9A 2F2EA 2VBWA 1MSFC 3GXOA 5LGNA 2XGEA 3BG5A 3OV8A 4L5EA 1YHQI 2X85A 4XK4A 3SFIA 5L3BA 3SDGA 1X3ZB 1USTA 3JSOA 2GA2A 2DQLA 4L9VA 1OCRH 3M8EA 1WJ5A 3O8GA 3TO9A 3C1DA 3NEUA 1HW5A 2XPUA 1GT0C 3ZQIA 3ZMUA 1U8RA 2KRHA 2O03A 1R1UA 3CD6I 4HF2A 4XOPA 4QSHA 2BW3A 2IA1A 3I53A 3K2AA 2JVHA 1WWXA 2EV0A 3MFKA 1J5YA 1T38A 3PUBA 1I5ZA 3RTRA 3ABLH 5J47A 1FJLA 1UFMA 3T5XA 1QRYA 4CZCA 2A69F 2Q2EA 3WTZA 1XPXA 5IP7J 2EV6A 3IRRA 3PNVA 5K7ZA 2KDZA 2JRMA 3DTKA 3PQJA 3SEZA 4IKFA 1WRJA 2M30A 2JTVA 3MZHA 4BJ6C 1UHWA 1T2KA 2VQHA 2K9MA 3HPHA 1WKMA 3HB9A 1ORKA 2DMUA 1U6GA 1RRJA 2W48A 2KT0A 2FF4A 1R22A 4O6JA 2HYFA 1W5CC 2JJ7A 2VXZA 3AG2H 4LGWA 3BT9A 5HDGA 2L7MP 1S8NA 3ML6A 4A3BJ 3IRQA 4BBRJ 2RV8A 3CCLI 2QGUA 4JK1X 4IF4A 2A3SA 2L01A 4AVPA 1J0RA 1BR2A 2B0LA 5DUIA 2DFFA 3G3ZA 2O9LA 3KLNA 1I27A 2L9SA 5CVVA 1P7JA 4LMYA 2J5PA 2ID3A 2MA3A 4KFCA 2E2HJ 1CF7B 2G9WA 2VQLA 4E7JA 1IRXA 1X1BA 2IGMA 1AKHB 3ZN1A 5E3OA 2O8KA 4B3AA 4A3KJ 4KICA 2LKSA 3M8FA 4N9IA 4AUXA 2R7VA 5J4VA 3E3VA 2E2JJ 1NH3A 4M3EA 1Z77A 1H0MA 2KRCA 1WH7A 4RAZA 3JTHA 2GQQA 1HDDC 2XRNA 2M3AA 3CF2A 1U5TB 3LSMA 4V2FA 2P81A 3HRMA 2CRGA 3RKXA 1UHMA 5L3EA 2KKOA 5LEJA 4EGYA 1OMIA 2STWA 2F5FA 1B8IA 1TWCJ 2LBFA 3HJEA 1KU3A 2ESNA 1APLC 2MD0A 2KLOA 3H3ZA 3DV8A 2JQ7A 2HQ5A 2NVUB 5K5OA 2COBA 5J8CA 1BA5A 2VT2A 1MKMA 3IC7A 2RKHA 1DP7P 1LDDA 2EIJH 2JVGA 4S0HB 1OKRA 2LKXA 3CZ6A 4KUMA 2A5WA 2M8GX 2QSHX 3DU6A 4LG3A 1UCRA 2X51A 2DMNA 3E5QA 3RKQA 5FLMJ 1VQKI 5KAIC 4NC7A 3IP4B 2XGCA 2R3SA 3EYYA 2C6YA 1WJBA 5D5UB 4HLYA 2M45A 3EUHA 2PMZA 3SJMA 1J75A 4HNTA 5EG0B 2Z5UA 3T0YA 4JOMA 1YW9A 2CH0A 2WTEA 4NDLA 2PJPA 1XCBA 4HSTA 4EMSA 1TP4A 4L18B 4P9UA 5H20A 1XSXA 4IXAA 4XLHA 2M0CA 2COMA 1X19A 2ZNZA 1OPCA 5L3GA 1XMKA 1FP2A 2V1UA 2HYJA 2LVSA 4LIUA 2DK5A 2L9NA 4PJMA 4BJ5C 4MTDA 4LLNA 3FXUA 4E6KG 4A3MJ 1E2XA 2CMPA 1AHDP 4LLGF 2H1KA 3FMSA 3DKXA 3VYUB 1LVKA 1WFXA 1S29A 2V6EA 4Y17A 2UUZA 4UUVA 4K2EA 2CFXA 2P7CB 4OMZA 4I98B 2IGNA 2HZTA 4A5NA 3I54A 3G1OA 3CC7I 5FD6A 2EB7A 2VBYA 3I4PA 2VONA 1JUPA 1Y0NA 5E18F 4H0EA 2AQFA 2HU9A 3FXJA 4Q5SF 2EZHA 4DYCA 3RCOA 3V4GA 1DUXC 4CUGA 2QBYA 3DQVC 4NNJA 3HPGA 3J7AY 1SFXA 3MQ0A 4MLOA 5HLHA 2CUFA 2QUFA 5KHDA 2DO7A 2QQ8A 2P7VB 2WB1N 4YIFA 3JREA 1BOAA 3F6VA 4EJTA 3HSRA 3HRUA 1Y1WJ 3H92A 1XC5A 1YIOA 2CYYA 4MEYF 1JUMA 2CU7A 1DPUA 3HTSB 1TNTA 3O2PE 2RREA 5HDKA 2KIFA 2Y31A 2DA2A 3BR0A 3WGIA 1JGSA 3CCMI 2ZO4A 5GP9A 2R7DA 2WAFA 3S14J 4U87A 3K10A 5JHUA 5HLTA 3GCMA 1SEUA 2DI3A 3OOPA 1YI2I 3DEWA 4S05A 4WXDA 2QKLB 5CVJA 1OCZH 1U5TC 3COAC 3NARA 2Q2EB 2UZKA 1ZG1A 3BG9A 1FC3A 1IN8A 3BJ6A 2Y0MA 1MBEA 2VJIA 3A0HC 4I02A 4CHUA 4CA0A 3VYRB 2RAEA 1JJ6C 1U8BA 3FKJA 3L7WA 2CFOA 5KVRA 1EA3A 1REPC 2DA7A 1GUUA 1Z21A 1XD7A 2E7XA 4Y3OA 1R9TJ 2Y48A 2XSJC 2RGVA 3F6OA 1IN7A 4M3DA 3JR9A 4JP0A 2E5NA 5F64A 1IW7F 1FX7A 2XPWA 1Z3XA 3ZXSA 3MWMA 2GXAA 3VWBA 1RR8C 3BJOA 1X3WB 1XDSA 3LA2A 4LITA 4B8XA 1IAWA 1AU7A 3A01A 1HC8A 4A3GJ 2XAJA 2V9KA 2ZJQF 3CQZJ 1K6OA 2F4IA 5F1RA 2EFNA 5LHHA 3BTIA 1K4SA 3HOYJ 1MBHA 2JZYA 1STZA 4XMYA 4P5OA 2LY1A 5EZHA 1OYWA 4BAYA 1P4AA 4IOAF 1ZARA 1F43A 1MZBA 4XLCA 2KRFA 5K5QA 4BGDA 3FM5A 3E1SA 4DBQA 4RM2A 3E97A 2A07F 3F22A 3GZ5A 3NAUA 4ON0A 1I6XA 4Y13A 3AL0C 2PBIA 2LFBA 4CXFA 1SD5A 1QPIA 2XB0X 4U0VA 2GIZA 4BXUA 3GMEA 3KETA 2DPDA 1B8IB 5CQEA 2L4AA 4NQWA 4WXCA 3GVAA 4M9XA 3CO7C 4CYDA 5D5VB 4CGZA 3T8TA 2EFPA 1KZHA 4LIVA 5CVUA 4JBAA 1XX5A 1DQUA 3D1NI 1W36D 1QPMA 1DGWY 2UV1A 4YEJA 2EJRA 2PJRA 5BPDA 3S17J 3LSKA 3QOEA 4EM1A 2QVOA 3BR2A 3K4KA 1TC3C 2LDUA 5TJJA 2M34A 2IS4A 3R4KA 4HOBA 5KNLA 3FZVA 2VXDA 4AIDA 2VOOA 2KP6A 3WTVC 1BOBA 1BIAA 3P7NA 4JYKA 3V7RA 2RC4A 3TW6A 5E8IA 3TBIA 1K83J 4HDUA 1IUFA 4C3JJ 1SMTA 4AC0A 2QWWA 3ZMVA 2K9QA 1RR7A 1IUYA 4M6YA 3W6VA 1HKTA 4EJUA 2IGKA 5GAGJ 1Y0UA 5C4XJ 2D2WA 3FXMA 4XLEA 2VLAA 2VOPA 5FROA 1X2MA 1YX5A 3H36A 2XAQA 3GFLA 1XG1A 2L7FP 3V42A 4HQMA 5LGUA 3FK6A 3NWTA 4RM3A 1YFHA 3CLOA 3E6BA 3K70C 2P6TA 1P4WA 1ODDA 1Z3YA 2EPFA 4DZPA 3G2BA 4HX7A 3CCSI 4A3DJ 3J81Z 1K79A 3I9V2 1RKTA 3KIOA 2M1BA 1HW1A 3TDUC 1T56A 4HQEA 4LB5A 1V3FA 2XROA 1MNMC 3ZMDA 4A12A 4ZZLA 3DTIA 5J8FA 4FE7A 1FOKA 2QLZA 3M4OJ 2XUBA 1FYLA 3RSNA 1VZ0A 3M7GA 1LB2A 3W3CA 5E1ZB 2G7HA 1U9OA 3KEOA 3G73A 1MBFA 5DM6F 4UVBA 2EFOA 1F5TA 1TNSA 1O3TA 3L2RA 1WPKA 2WB1A 3F9KA 1GHCA 5HS8A 3K2ZA 2H94A 1XCVA 2NVXJ 1I3AA 4XORA 2STTA 3LA7A 2HEOA 4QTRA 2E71A 2CG4A 2P5VA 2GBYA 1LFBA 1FY7A 3GTPJ 3D5RC 4R8HA 3A03A 1IXCA 4R1HA 4GDFA 3SZPA 1P7IA 1IDZA 2X6OA 1U3EM 1WQ2A 2GAUA 2QSGX 1BR1A 1HW2A 1G3WA 1B4AA 3QODA 2A5YB 2H8WA 5F27A 2A05A 2OPTA 4WXHA 3LMMA 3DCFA 1SVLA 1JKOC 2X0LA 1SFEA 3CP8A 1XGNA 1I1GA 3IH3A 4RS8A 3ULQB 1AA7A 1YW8A 3FKIJ 5FLVA 4KIGA 4O3MA 2HNHA 5D5WB 2K3FA 2QA4I 4UY8I 1D1AA 1KYZA 3RQ4A 3PNTA 3H5NA 2ISYA 2B63J 2DJIA 2LR8A 4DOZA 1X1AA 4B1RA 2JRTA 3ASNH 3L2CA 3BWGA 3F8BA 4EM2A 5FKNA 2TCTA 1HLVA 1JKPC 1SVOA 3HTUA 5TISC 3OMYA 3ABTA 2FX0A 1IRFA 4ZDPA 1E3HA 1SFKA 2BHZA 2OAZA 3BCBA 3WTWC 3WHBA 5E3MA 3I58A 1XDUA 1CF7A 2F4OB 2E35A 3HKZN 2JT1A 1D8KA 2KIMA 3D5LA 1N77A 3AAFA 1FT9A 4WCGA 3FIWA 5IYDJ 3K4BA 2R7SA 2OUMA 2QKMB 1D8JA 3CC4I 2KZGA 2PQ8A 2DTZA 1Z6RA 4FHTA 5FKLA 4UHTA 3OYMA 5E20A 3A01B 1R00A 3KYLA 4RLFA 2FEZA 1DGRM 4CYCA 1WVRA 2BE5F 3E0JB 1U5TA 2HKXA 4C30A 1O7LA 1POGA 1ZK8A 3T8RA 4BDZA 3C2BA 4KA4A 3HSFA 1FEXA 4BXFA 4BNCA 3H5RA 3SZGA 3WE2A 3QWLA 3R0JA 4AU7A 5E3LA 1IV8A 4XOTA 1Z0XA 3QYFA 2IXSA 4BL0B 3CTAA 1ON1A 1YRNB 2O61A 3KZIC 1MBKA 4HNUA 4V2GA 4PGGA 2DFEA 4A0XA 4OMYA 1AWCA 3S1NJ 1RIOH 4JX5A 2Q0OA 2XV4S 1I1SA 3G6EI 2EIKH 2VUMJ 2HR3A 4ZDLA 1V4RA 1IRZA 2DYRH 4A3EJ 4ZTJA 4KT6A 4A2UA 3QYBA 1LQ1A 5ICGA 1OYIA 3V7SA 4HEA2 1QZEA 3WHCA 3R0AA 3HDDA 2W24A 2V79A 1O57A 4CCJA 2DYSH 3C2HA 5EEGA 1PP8F 5EG0A 1VTNC 1K78B 3OS1A 5JLWA 2XIGA 4IHTA 2IAIA 1MDMB 3JSPA 2TDXA 4M6XA 4M9SA 5FLXZ 4ZC3A 3Q5FA 5FB2A 2FBKA 3GTQJ 1B72A 1OYYA 2VE9A 1YG2A 1QGPA 4N0BA 2D5VA 2ZXWH 4M3FA 1R49A 4UUTA 3GEZA 1NK3P 4BHBA 2OTJI 2DA6A 2M9HA 3NQOA 4EJWA 2E1NA 3R60A 4DNCA 5A2QZ 2YU9J 1ITYA 1OISA 3FMRA 2YPRA 4NUBA 2UXNA 2VBZA 4BQAA 3GO5A 2HVQA 2WA0A 4W97A 5FO5A 1Q1HA 3L2WA 1SD4A 4KT5C 2AHQA 1LDKB 4U7DA 2JUGA 2ZFUA 4OAZA 1SC7A 3F8FA 2M2EA 5FKOA 3SEQA 3BR6A 1BM9A 3BROA 5LEKA 3MZYA 3CCEI 2Y0SA 4KITB 1FOXA 4IX7A 1A6IA 2M4KA 3HBLA 5IY5H 5JVGF 3CC2I 4A3CJ 1D0ZA 3FK7A 3CCYA 4PFOA 2CQXA 2AS5F 3S2DJ 3CJRB 1YYVA 5H6RA 2JPCA 1YJWI 1ZR4A 2D45A 5KK1A 4UVAA 4EM0B 1TLHB 4HSRA 2Z1DA 3WODF 3PUFA 3B02A 1XGMA 2FOKA 2NYXA 3OR1C 2ADUA 1F36A 5DEQA 2R7ZJ 2EA4A 2DU9A 4D7NA 1ULYA 4FQGA 1G2HA 1K6YA 1X1PA 4AYBA 4IRHA 4UVCA 5D5XB 3ZMTA 3QP5A 1J7KA 1N75A 2DBBA 2K86A 5IT3A 5K5RA 1FP1D 2I5UA 4BE1A 1GV2A 4IRIA 3L2VA 5AIPA 3VYTB 3TOAA 3H3UA 1U2WA 3BZ6A 2ZMEB 3U21A 4BUPA 3Q9VA 4LJZF 2H27A 4B09A 3VSLA 1V54H 2OF7A 1W0UA 1FPQA 5HOOA 4HAMA 4XSXF 3I56I 4DJAA 2BYVE 3F8MA 3J80K 4GGGA 3LSIA 3EDPA 3GFJA 2OC6A 2EILH 4DGWB 2DJNA 2VJ5A 1U9NA 2ZJRF 1O7FA 2W82A 3K4JA 1AOYA 1BW6A 3KPHA 4XRMA 1B9NA 2O7OA 3F8NA 3WU1B 2FOWA 4HPQA 2KJCA 3TQNA 2HDDA 5ILVA 2P4WA 1W7PD 3V8JA 2YU3A 3HOSA 2XHKA 2X1DA 1ERDA 2E1CA 2FXAA 2XF6A 2FMLA 1FSHA 4PJJA 2XC7A 1S7OA 2K4JA 2XSDC 3FHZA 5ILUA 3S32A 5E79C 3VSKA 1JGGA 3R6SA 5J1RA 4B48A 3QYEA 1EH6A 2DCEA 1WJAA 2QSFX 3MD2A 2CQ7A 1R4NB 2KZVA 3P9KA 4KN4X 5LD2C 5IOZA 1R1TA 1UG2A 4DIQA 3IV5A 3ESWB 3OYLA 4CYCB 1Y56A 4E7SA 3A2KA 1D0XA 4ZYEA 3LAPA 4B43A 4I01A 3VDXA 1GLNA 1VF9A 4ENNA 1JI8A 3GLLA 2AQEA 1OCPA 2P5KA 5F1JA 1ZGJA 1J9IA 3F8CA 1RESA 3ZQLA 2KFDA 1WJEA 4AIHA 4ZJZA 2OTLI 1CQTA 4G7ZF 1H8AC 1SVMA 2KQRA 1T98A 4BS9A 4WX9A 3E6CC 4PCQA 5FRMA 1ETWA 5CVRA 5L3FA 5M3MJ 4XKBA 2E5ZA 2ZXIA 4ZTFA 4XN3A 2ZB9A 1A36A 5F08A 3W2WA 5IYBJ 4JX4A 3LSJA 5LGTA 5TRDA 3JAMK 4F55A 3DPTA 1VQPI 4L5JA 2VODA 2R7TA 2QEXI 3GTMJ 2W84A 1XN7A 3WTYC 4ENKA 3BTCA 1I3QJ 3F72A 1BC8C 2EZIA 3C2GA 3M07A 1BI1A 1GXQA 1JTXA 3HOUJ 5JLXA 2R4GA 3IKTA 4DYQA 3HL2A 2D1HA 3MVPA 4KMUX 4CSWA 2QZ8A 2OQGA 4DBRA 2JPBA 3GTLJ 4IRGA 2DFHA 3OYIA 1OJLA 5GPCA 3QOPA 2WAQN 4AM3A 1FBQA 2W85A 3GBGA 2M7BA 4II2A 1NG6A 4RAFA 3PQKA 2BY2A 4BY7J 5ICEA 3M1CA 1B72B 4I6ZA 2QQAA 2ZBKA 4S04A 1X4PA 4I0BA 3OYNA 4PGHA 1R58A 2DAOA 1ON2A 4HZFA 3JRBA 1Z9CA 4QPOA 1IO2A 5AONA 4UV8A 3SHFA 2OZ6A 1YJ9I 1FBSA 2VJ4A 1RETA 1W36C 4HLXA 5BNGA 2Z2SB 3GTKJ 2JA7J 3MZ8A 3BTLA 3C18A 3BOQA 1SD7A 3T1BA 1BR4A 3CJNA 1YOVB 2EA2A 4RMNA 4UV9A 1G59A 3WTSC 2AO9A 2PG4A 3OYCA 1IRGA 4IJAA 2IRFG 4B4CA 1TW3A 2CJJA 2Y69H 3MAJA 4G6QA 5CYVA 4F52A 1A5JA 1HA8A 2YS9A 3HYIA 2DTRA 1YS6A 1FOWA 2HS5A 2V9VA 4EATA 5J1YA 4PJNA 1MBJA 4ZYHA 1ZN2A 3I71A 2ZJ2A 4AVZA 4KJZA 1VI0A 5EJCA 1O3QA 4XQFA 1YJNI 5HNFA 1Y8RB 2Z33A 2L02A 2OCEA 4XRFA 4N4OB 1XB4A 1UELB 5GTHC 2CQNA 2MC3A 3VOEA 2MD5A 3OR2C 5E3NA 2ELKA 2UXXA 5BPIA 2HZDA 5GAEJ 3S3NA 3L1PA 4KDPA 2VB6A 5DM7F 1QA6A 2HQRA 1VQ4I 5F0FA 3FF5A 2V1DA 3TO7A 1N78A 2CGPA 3IAM2 3A02A 1IN4A 5TGTA 5IT9K 2JSPA 5B1AH 4RDUA 4HDVA 3ELKA 1FTTA 4GCVA 4IHWA 2LY2A 3HOXJ 1HSJA 1QZZA 1W4MA 5LRRA 3EPZA 2LRDA 3KP4A 2M7AA 4L0YB 3DBRB 2CV2A 3HUGB 2K9NA 5F0CA 3J7YJ 3RPQA 5DD8A 5FJ8J 4ITVA 1YO5C 4EQQA 3K0LA 1WH5A 3ZN0A 2G7UA 3EYIA 3DLAA 3IWFA 2LK2A 5JI6A 2WV1A 4GXOA 4PK4A 5FLXK 1BI0A 3ERED 2XAHA 4ANJA 3BZCA 5BOXA 3CCVI 4F91B 2PI0A 4I7HA 2DMQA 5ERIA 4RB1A 3HM5A 4D7MA 4XIDA 3U1KA 2EZKA 2WY8Q 5GPAA 2MH9A 2V1NA 5DCMB 2OA4A 4PFPA 2VPRA 2L4MA 5CLSA 2VC1A 3TDZC 3KE2A 1LJ9A 3BG7A 2K7LA 3QAHA 2L9RA 3CDIA 3S1MJ 1O3SA 5A2QK 4LB6B 3V8KA 4ZYGA 3GZ6A 4IHSA 4WK8F 2IP2A 4PSWA 1TWAJ 2YR2A 3LQQA 2X4HA 5B1BH 2NAZA 1YRNA 1MBGA 2CWEA 3ABMH 3H1CA 3KZYA 5JHFA 1IZ1A 1OQYA 1OLTA 2BBYA 3FHNA 2ESHA 3Q9SA 3LQRA 3LAJA 1WGXA 3FDYA 4MIMA 1A6QA 3OYJA 2V9PA 5M5WJ 3H35A 3OIPA 3VODA 3CJTB 4LK0F 3CUOA 4G9YA 4EJVA 2DW4A 3MKLA 4M73A 1OCCH 2RN7A 1PDNC 1MMAA 1K78A 3I0TA 3ECHA 3IUOA 1ZELA 1D5VA 3A4CA 3GZNB 4HV5A 3RQIA 2FA5A 2FU4A 4E7ZA 1MDMA 3WGGA 1OR7A 2MW8A 2NVQJ 2KDOA 4EV0A 1PJRA 4C3HJ 3WU2C 1A35A 2CS3A 1LKXA 2WAQA 5BMZA 4NHJA 1YE9A 2L2OA 4HRIA 4IHVA 3M3YJ 2LYCA 3C7JA 2BXZA 4BDYA 3CDLA 1TQMA 2K02A 3FXQA 1P2FA 4YG2F 1ETKA 1XMXA 1FIAA 3I59B 1TZLA 3BZKA 4XONA 4YRVA 4FCYA 5FD5A 5IPAA 2BOLA 2O8XA 2GWRA 3JRAA 2RQPA 1T95A 2M8EA 4G7HF 2H09A 2M87A 3LSHA 4B44A 2ELHA 3C3WA 3L2QA 4KIBA 3AG3H 1VQOI 1OCOH 2PMUA 2W4SA 3VEPA 2H8RA 1F9NA 1W7PB 3DF8A 2HVSA 2OD5A 1B9MA 3EUAA 2KIUA 2X1CA 3ISPA 5CKTA 2R92J 4M3BA 3F23A 1KU7A 1I6HJ 1R5HA 3K7AJ 3TKYA 4IOCF 3ONQA 1EH7A 2DDAA 2Y9YA 2MGQA 3B73A 3DU5A 2PLYA 2F4MB 3BY6A 2NOJB 4MQVA 4L9TA 2K85A 3ZQQA 1SFOJ 4NBQA 1R5GA 2D1VA 2NNYA 4HF1A 3BCAA 2R5YB 1ACIA 4A3IJ 2E36A 2FQ3A 3PFIA 1R7JA 2XKPA 1BIBA 1Z67A 2IA2A 3K4LA 3WTXC 1FZPB 4XR6A 1IXRC 2EZLA 4LD5A 3RKYA 1GVDA 2MSYA 4ASNA
chains in the Genus database with same CATH topology
1IG7A 1OCTC 2NOGA 2P81A 4V2FA 2CRGA 2D5VA 4M6VA 4FE4A 2Y30A 4M3FA 2LTPA 3BG3A 4UUTA 4A3JJ 1VFCA 1B8IA 1NK3P 1TWCJ 4J19A 2DA6A 2M9HA 1APLC 3F0CA 2YU9J 1ITYA 4ABZA 4XICA 2FQ4A 2G0EA 5EF6A 2HQ5A 3MN2A 4A3FJ 2COBA 1BA5A 4UUSA 2ECBA 4W97A 4W1UA 3HOVJ 2AHQA 1LFUP 2LY9A 1HCRA 3ZOBA 3GTOJ 5EDNA 4S0HB 2LKXA 2M2EA 5FKOA 1JKQC 1JKRC 3BR6A 1QVTA 2EQRA 2M8GX 2EBIA 3JRCA 1A6IA 3HBLA 2DMNA 3RKQA 5FLMJ 4A3CJ 3FK7A 2DMPA 2XGCA 2HXOA 3CCYA 3I4NJ 2CQXA 4C3IJ 3RZDJ 1ZR2A 3BR5A 3S2DJ 1ZR4A 3SJMA 2IEKA 4D5CA 5EG0B 2GM4A 4NDLA 2QF7A 2EH3A 1XS9A 1F36A 1U78A 2R7ZJ 2VKVA 4D7NA 2M0CA 1G2HA 1PUFB 1IGNA 4BKXA 2ID6A 4MFDA 5FKMA 2ME6A 1RPWA 2CUEA 2ME0A 2HYJA 1FIPA 3S1QJ 2LVSA 3OSGA 1GV2A 3S2HJ 1VNDA 4A3MJ 1AHDP 3JRFA 2JA5J 3QQAA 1UHSA 4XRSA 2H1KA 1GV5A 3Q3SA 1DU6A 1FTZA 1IJWC 3LSRA 9ANTA 2OF7A 1W0UA 1BW5A 3LSPA 5F04A 1ETYA 3G1OA 3PO2J 5EGOA 3JRIA 1JUPA 5DS9A 5J1UA 2EZHA 4DYCA 1ZQ3P 2DJNA 2LLKA 3S16J 1U9NA 3HEFA 3BQZA 1BW6A 5M3FJ 4XRMA 3I4MJ 2O7OA 1ZTRA 4MLOA 2CUFA 1GDTA 2DMTA 4G12A 1D5YA 1MH4A 2HDDA 2WB1N 3JREA 3QPLA 3OIOA 3LNQA 4M3GA 1Y1WJ 1XC5A 1JUMA 2CU7A 2DA5A 2IBDA 2GLOA 2Y31A 2DA2A 2NVYJ 3BR0A 5C44J 5GP9A 2XSDC 4DZJA 3S14J 1TWGJ 4BBSJ 3OOUA 1JGGA 1JUSA 3E7LA 4HNVA 5J1RA 1LE8A 3DEWA 3HGYA 3NARA 1EF4A 4MFEA 5IOZA 1UG2A 3IV5A 3UKGA 3BG9A 5K7HA 4CYCB 1ETOA 3FISA 1MBEA 1VF9A 1BL0A 4IHXA 2DN0A 1OCPA 3G1LA 5F1JA 2YUSA 2RAEA 2XPVA 2FD5A 1RESA 1BJZA 1X58A 2Y0SN 3ZQLA 1U8BA 1JJ6C 3G1MA 1CQTA 1H8AC 1WI3A 2E2IJ 2JA6J 5IOYA 2DA7A 1GUUA 3JRGA 4A3LJ 3TP3A 2DA4A 2R93J 5C3EJ 1R9TJ 2PMZN 1ETWA 1ETXA 1GVDA 3TP0A 5M3MJ 4M3DA 3JR9A 4JP0A 2ZB9A 5F08A 5IYBJ 3TW7A 2XPWA 4JX4A 3LSJA 4FISA 5IYCJ 3HGGA 3GTMJ 2LD5A 1ETQA 4EEFG 4AYBN 3Q0VA 1AU7A 3A01A 3BTCA 4DW6A 4A3GJ 1I3QJ 2EZIA 3CQZJ 1JTXA 2XRLA 3LOCA 2L7ZA 5JLXA 4DYQA 1JTYA 2R5ZA 4IHYA 3MVPA 3HOUJ 3BTIA 3HOYJ 1MBHA 2I10A 4DYRA 3GTLJ 3VPRA 2VI6A 2R0QC 5EZHA 1OJLA 5GPCA 2MG4A 2WAQN 1LE8B 2JMWA 5M5YJ 3GBGA 1F43A 1IDYA 4BY7J 2NS8A 1B72B 4I6ZA 1IC8A 4D5FA 3PO3J 3IH4A 5IP6A 4A93J 3NAUA 1JT6A 1TWFJ 4BXXJ 2TRTA 2LFBA 3Q0UA 3JRBA 2NVTJ 3Q0WA 1MSEC 1ENHA 1QPIA 2XB0X 2XB5A 5K7FA 2K9SA 1B8IB 1RETA 2DA3A 5BNGA 1H89C 2JA7J 3GTKJ 3BTLA 4QIWN 1WCMJ 2X9DA 4A69C 4XRSG 3HOWJ 2NS7A 3HOZJ 3O8HA 2FJ1A 3D1NI 1K61A 2AO9A 1AKHA 1T33A 4UUSB 4X1EA 5DTDA 1E3OC 1ZKGA 4B4CA 2CJJA 1A5JA 2ECCA 2E19A 2XGDA 2YS9A 4Y52J 2LP0A 5J1YA 3S17J 1MBJA 3BR2A 1TC3C 4FTHA 2M34A 1IV6A 5HODA 1VI0A 4X6AJ 3ZQHA 1QVUA 3TW6A 3BR1A 4JYKA 2R5ZB 1HF0A 1Y1VJ 1K83J 1IUFA 4C3JJ 5EEAA 4AC0A 2K9QA 1RR7A 5E3NA 2ELKA 3W6VA 5C4XJ 3PM1A 1UMQA 1ZGWA 3L1PA 1W0TA 1X2MA 3JRHA 5EZGA 1XG1A 2L7FP 2E1OA 3FK6A 5F0HA 5F0FA 3QPSA 3H0GJ 3BTJA 5EYRA 3A02A 1ETVA 4LOCA 3LSGA 4DZPA 4A3DJ 1JT0A 3BR3A 4RDUA 1RKTA 2QCOA 1FTTA 2Y9ZA 5FKKA 1T56A 2L0KA 4IHWA 2JK3A 3HOXJ 1MNMC 2N8GA 4FE7A 3M4OJ 1TWHJ 3ZQCA 2JA8J 2K9NA 5F0CA 4MO7A 5EGOB 3S1RJ 3GTJJ 1U9OA 5FJ8J 1MBFA 1Q1VA 1S7EA 1X2NA 4JX6A 1WPKA 1RKWA 1WH5A 5J3LA 2CQQA 2LK2A 2HXIA 2WV1A 2NVXJ 4QTRA 2JWTA 3OSFA 5C4JJ 2GBYA 1LFBA 1NK2P 2K40A 3GTPJ 3A03A 4I76A 1HDPA 3ZQFA 3GTGJ 2DMQA 3S15J 1P7IA 1IDZA 3ZQGA 2X6OA 1JJ8C 1SANA 3HM5A 4Y7NJ 4D7MA 4XIDA 2EZKA 5GPAA 2JN6A 5F27A 2OPTA 2VPRA 5IP9J 3DCFA 1JKOC 3IH3A 4RBOA 2L9RA 3S1MJ 3FKIJ 5M5XJ 5FLVA 1MSFC 2XGEA 3BG5A 4L5EA 1TWAJ 4IEJA 4XK4A 3SFIA 1YRNA 4C2MJ 3SDGA 1MBGA 2B63J 2LR8A 1HOMA 4B1RA 3B6AA 5FKNA 2TCTA 3O8GA 1HLVA 3BQYA 1JKPC 2XPUA 1GT0C 2HOSA 3ZQIA 1WGXA 4MIMA 2FX0A 5M5WJ 3WHBA 4QSHA 5E3MA 3K2AA 3RZOJ 4BY1J 1MH3A 3HKZN 3MKLA 3FIWA 5IYDJ 1FJLA 3H3VK 3RQIA 1I50J 2R5YA 2DTZA 5FKLA 2MW8A 1QRYA 2NVQJ 4C3HJ 5IP7J 3A01B 3TEDA 5K7ZA 2KDZA 4CYCA 3M3YJ 4IHVA 1H88C 3CDLA 1POGA 1ZK8A 1ETKA 3HB9A 1ORKA 3C2BA 2DMUA 3CMYA 1FIAA 1FEXA 4FCYA 2W48A 2KT0A 5IPAA 2DA1A 5E3LA 2JJ7A 3JRAA 1Z0XA 3BT9A 1OFCX 2L7MP 1YRNB 4A3BJ 4BBRJ 1MBKA 4V2GA 2H8RA 3S1NJ 3JRDA 4JX5A 1DU0A 2HOTA 2VUMJ 2VKEA 2O9LA 1IRZA 4A3EJ 2R92J 4M3BA 1P7JA 2HOAA 2ID3A 1I6HJ 3K7AJ 2E2HJ 3WHCA 3HDDA 2Y9YA 2HI3A 2MGQA 1AKHB 2O8KA 5E3OA 5EG0A 4B3AA 4A3KJ 5JLWA 1SFOJ 2X48A 2IAIA 2R5YB 2Y2ZA 4AUXA 4A3IJ 4GFBA 3B6CA 2E2JJ 1O4XA 4M3EA 1PUFA 3GTQJ 1NTCA 1Z77A 2EZLA 1B72A 1WH7A 3IH2A 2MSYA 1HDDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IG7 A;  1OCT C;  2NOG A;  2P81 A;  4V2F A;  2CRG A;  2D5V A;  4M6V A;  4FE4 A;  2Y30 A;  4M3F A;  2LTP A;  3BG3 A;  4UUT A;  4A3J J;  1VFC A;  1B8I A;  1NK3 P;  1TWC J;  4J19 A;  2DA6 A;  2M9H A;  1APL C;  3F0C A;  2YU9 J;  1ITY A;  4ABZ A;  4XIC A;  2FQ4 A;  2G0E A;  5EF6 A;  2HQ5 A;  3MN2 A;  4A3F J;  2COB A;  1BA5 A;  4UUS A;  2ECB A;  4W97 A;  4W1U A;  3HOV J;  2AHQ A;  1LFU P;  2LY9 A;  1HCR A;  3ZOB A;  3GTO J;  5EDN A;  4S0H B;  2LKX A;  2M2E A;  5FKO A;  1JKQ C;  1JKR C;  3BR6 A;  1QVT A;  2EQR A;  2M8G X;  2EBI A;  3JRC A;  1A6I A;  3HBL A;  2DMN A;  3RKQ A;  5FLM J;  4A3C J;  3FK7 A;  2DMP A;  2XGC A;  2HXO A;  3CCY A;  3I4N J;  2CQX A;  4C3I J;  3RZD J;  1ZR2 A;  3BR5 A;  3S2D J;  1ZR4 A;  3SJM A;  2IEK A;  4D5C A;  5EG0 B;  2GM4 A;  4NDL A;  2QF7 A;  2EH3 A;  1XS9 A;  1F36 A;  1U78 A;  2R7Z J;  2VKV A;  4D7N A;  2M0C A;  1G2H A;  1PUF B;  1IGN A;  4BKX A;  2ID6 A;  4MFD A;  5FKM A;  2ME6 A;  1RPW A;  2CUE A;  2ME0 A;  2HYJ A;  1FIP A;  3S1Q J;  2LVS A;  3OSG A;  1GV2 A;  3S2H J;  1VND A;  4A3M J;  1AHD P;  3JRF A;  2JA5 J;  3QQA A;  1UHS A;  4XRS A;  2H1K A;  1GV5 A;  3Q3S A;  1DU6 A;  1FTZ A;  1IJW C;  3LSR A;  9ANT A;  2OF7 A;  1W0U A;  1BW5 A;  3LSP A;  5F04 A;  1ETY A;  3G1O A;  3PO2 J;  5EGO A;  3JRI A;  1JUP A;  5DS9 A;  5J1U A;  2EZH A;  4DYC A;  1ZQ3 P;  2DJN A;  2LLK A;  3S16 J;  1U9N A;  3HEF A;  3BQZ A;  1BW6 A;  5M3F J;  4XRM A;  3I4M J;  2O7O A;  1ZTR A;  4MLO A;  2CUF A;  1GDT A;  2DMT A;  4G12 A;  1D5Y A;  1MH4 A;  2HDD A;  2WB1 N;  3JRE A;  3QPL A;  3OIO A;  3LNQ A;  4M3G A;  1Y1W J;  1XC5 A;  1JUM A;  2CU7 A;  2DA5 A;  2IBD A;  2GLO A;  2Y31 A;  2DA2 A;  2NVY J;  3BR0 A;  5C44 J;  5GP9 A;  2XSD C;  4DZJ A;  3S14 J;  1TWG J;  4BBS J;  3OOU A;  1JGG A;  1JUS A;  3E7L A;  4HNV A;  5J1R A;  1LE8 A;  3DEW A;  3HGY A;  3NAR A;  1EF4 A;  4MFE A;  5IOZ A;  1UG2 A;  3IV5 A;  3UKG A;  3BG9 A;  5K7H A;  4CYC B;  1ETO A;  3FIS A;  1MBE A;  1VF9 A;  1BL0 A;  4IHX A;  2DN0 A;  1OCP A;  3G1L A;  5F1J A;  2YUS A;  2RAE A;  2XPV A;  2FD5 A;  1RES A;  1BJZ A;  1X58 A;  2Y0S N;  3ZQL A;  1U8B A;  1JJ6 C;  3G1M A;  1CQT A;  1H8A C;  1WI3 A;  2E2I J;  2JA6 J;  5IOY A;  2DA7 A;  1GUU A;  3JRG A;  4A3L J;  3TP3 A;  2DA4 A;  2R93 J;  5C3E J;  1R9T J;  2PMZ N;  1ETW A;  1ETX A;  1GVD A;  3TP0 A;  5M3M J;  4M3D A;  3JR9 A;  4JP0 A;  2ZB9 A;  5F08 A;  5IYB J;  3TW7 A;  2XPW A;  4JX4 A;  3LSJ A;  4FIS A;  5IYC J;  3HGG A;  3GTM J;  2LD5 A;  1ETQ A;  4EEF G;  4AYB N;  3Q0V A;  1AU7 A;  3A01 A;  3BTC A;  4DW6 A;  4A3G J;  1I3Q J;  2EZI A;  3CQZ J;  1JTX A;  2XRL A;  3LOC A;  2L7Z A;  5JLX A;  4DYQ A;  1JTY A;  2R5Z A;  4IHY A;  3MVP A;  3HOU J;  3BTI A;  3HOY J;  1MBH A;  2I10 A;  4DYR A;  3GTL J;  3VPR A;  2VI6 A;  2R0Q C;  5EZH A;  1OJL A;  5GPC A;  2MG4 A;  2WAQ N;  1LE8 B;  2JMW A;  5M5Y J;  3GBG A;  1F43 A;  1IDY A;  4BY7 J;  2NS8 A;  1B72 B;  4I6Z A;  1IC8 A;  4D5F A;  3PO3 J;  3IH4 A;  5IP6 A;  4A93 J;  3NAU A;  1JT6 A;  1TWF J;  4BXX J;  2TRT A;  2LFB A;  3Q0U A;  3JRB A;  2NVT J;  3Q0W A;  1MSE C;  1ENH A;  1QPI A;  2XB0 X;  2XB5 A;  5K7F A;  2K9S A;  1B8I B;  1RET A;  2DA3 A;  5BNG A;  1H89 C;  2JA7 J;  3GTK J;  3BTL A;  4QIW N;  1WCM J;  2X9D A;  4A69 C;  4XRS G;  3HOW J;  2NS7 A;  3HOZ J;  3O8H A;  2FJ1 A;  3D1N I;  1K61 A;  2AO9 A;  1AKH A;  1T33 A;  4UUS B;  4X1E A;  5DTD A;  1E3O C;  1ZKG A;  4B4C A;  2CJJ A;  1A5J A;  2ECC A;  2E19 A;  2XGD A;  2YS9 A;  4Y52 J;  2LP0 A;  5J1Y A;  3S17 J;  1MBJ A;  3BR2 A;  1TC3 C;  4FTH A;  2M34 A;  1IV6 A;  5HOD A;  1VI0 A;  4X6A J;  3ZQH A;  1QVU A;  3TW6 A;  3BR1 A;  4JYK A;  2R5Z B;  1HF0 A;  1Y1V J;  1K83 J;  1IUF A;  4C3J J;  5EEA A;  4AC0 A;  2K9Q A;  1RR7 A;  5E3N A;  2ELK A;  3W6V A;  5C4X J;  3PM1 A;  1UMQ A;  1ZGW A;  3L1P A;  1W0T A;  1X2M A;  3JRH A;  5EZG A;  1XG1 A;  2L7F P;  2E1O A;  3FK6 A;  5F0H A;  5F0F A;  3QPS A;  3H0G J;  3BTJ A;  5EYR A;  3A02 A;  1ETV A;  4LOC A;  3LSG A;  4DZP A;  4A3D J;  1JT0 A;  3BR3 A;  4RDU A;  1RKT A;  2QCO A;  1FTT A;  2Y9Z A;  5FKK A;  1T56 A;  2L0K A;  4IHW A;  2JK3 A;  3HOX J;  1MNM C;  2N8G A;  4FE7 A;  3M4O J;  1TWH J;  3ZQC A;  2JA8 J;  2K9N A;  5F0C A;  4MO7 A;  5EGO B;  3S1R J;  3GTJ J;  1U9O A;  5FJ8 J;  1MBF A;  1Q1V A;  1S7E A;  1X2N A;  4JX6 A;  1WPK A;  1RKW A;  1WH5 A;  5J3L A;  2CQQ A;  2LK2 A;  2HXI A;  2WV1 A;  2NVX J;  4QTR A;  2JWT A;  3OSF A;  5C4J J;  2GBY A;  1LFB A;  1NK2 P;  2K40 A;  3GTP J;  3A03 A;  4I76 A;  1HDP A;  3ZQF A;  3GTG J;  2DMQ A;  3S15 J;  1P7I A;  1IDZ A;  3ZQG A;  2X6O A;  1JJ8 C;  1SAN A;  3HM5 A;  4Y7N J;  4D7M A;  4XID A;  2EZK A;  5GPA A;  2JN6 A;  5F27 A;  2OPT A;  2VPR A;  5IP9 J;  3DCF A;  1JKO C;  3IH3 A;  4RBO A;  2L9R A;  3S1M J;  3FKI J;  5M5X J;  5FLV A;  1MSF C;  2XGE A;  3BG5 A;  4L5E A;  1TWA J;  4IEJ A;  4XK4 A;  3SFI A;  1YRN A;  4C2M J;  3SDG A;  1MBG A;  2B63 J;  2LR8 A;  1HOM A;  4B1R A;  3B6A A;  5FKN A;  2TCT A;  3O8G A;  1HLV A;  3BQY A;  1JKP C;  2XPU A;  1GT0 C;  2HOS A;  3ZQI A;  1WGX A;  4MIM A;  2FX0 A;  5M5W J;  3WHB A;  4QSH A;  5E3M A;  3K2A A;  3RZO J;  4BY1 J;  1MH3 A;  3HKZ N;  3MKL A;  3FIW A;  5IYD J;  1FJL A;  3H3V K;  3RQI A;  1I50 J;  2R5Y A;  2DTZ A;  5FKL A;  2MW8 A;  1QRY A;  2NVQ J;  4C3H J;  5IP7 J;  3A01 B;  3TED A;  5K7Z A;  2KDZ A;  4CYC A;  3M3Y J;  4IHV A;  1H88 C;  3CDL A;  1POG A;  1ZK8 A;  1ETK A;  3HB9 A;  1ORK A;  3C2B A;  2DMU A;  3CMY A;  1FIA A;  1FEX A;  4FCY A;  2W48 A;  2KT0 A;  5IPA A;  2DA1 A;  5E3L A;  2JJ7 A;  3JRA A;  1Z0X A;  3BT9 A;  1OFC X;  2L7M P;  1YRN B;  4A3B J;  4BBR J;  1MBK A;  4V2G A;  2H8R A;  3S1N J;  3JRD A;  4JX5 A;  1DU0 A;  2HOT A;  2VUM J;  2VKE A;  2O9L A;  1IRZ A;  4A3E J;  2R92 J;  4M3B A;  1P7J A;  2HOA A;  2ID3 A;  1I6H J;  3K7A J;  2E2H J;  3WHC A;  3HDD A;  2Y9Y A;  2HI3 A;  2MGQ A;  1AKH B;  2O8K A;  5E3O A;  5EG0 A;  4B3A A;  4A3K J;  5JLW A;  1SFO J;  2X48 A;  2IAI A;  2R5Y B;  2Y2Z A;  4AUX A;  4A3I J;  4GFB A;  3B6C A;  2E2J J;  1O4X A;  4M3E A;  1PUF A;  3GTQ J;  1NTC A;  1Z77 A;  2EZL A;  1B72 A;  1WH7 A;  3IH2 A;  2MSY A;  1HDD C; 
#chains in the Genus database with same CATH topology
 1IG7 A;  3WTT C;  3KP6 A;  4E4H A;  3RI4 A;  1OCT C;  2ISZ A;  1SD6 A;  1RZ4 A;  2NOG A;  3W6J B;  2QQB A;  1TT0 A;  4M6V A;  1R6R A;  4FE4 A;  2Y30 A;  4A3J J;  1VFC A;  3K4M A;  2ZME A;  4PSX A;  3F0C A;  5L3C A;  1NG7 A;  2BY0 A;  5ILS A;  4GYI A;  2GOM A;  3KEQ A;  1JHF A;  5E1X A;  1EKE A;  3M9A A;  1T08 B;  1EV7 A;  4XIC A;  2FQ4 A;  2R7X A;  2R7Q A;  3QPH A;  5EF6 A;  2E1M B;  1E17 A;  4W1U A;  3V8L A;  3HOV J;  1NHA A;  2LY9 A;  4PJ0 C;  1R5I D;  2Y75 A;  1JKR C;  3HIF A;  4WWC A;  4FX4 A;  1YTY A;  1MW7 A;  3S3M A;  2EBI A;  3REO A;  2K5C A;  5GAH J;  4IPA A;  1EJ9 A;  1XGS A;  2VJJ A;  4FET A;  4PDK A;  3PL8 A;  4J00 A;  2HXO A;  3O6B B;  4C3I J;  2LMD A;  3RZD J;  4L9J A;  4M71 A;  1VQ9 I;  4BHP A;  2QYO A;  1WSU A;  1ZRC A;  2IEK A;  2BZT A;  2H6B A;  3FXL A;  4RA2 A;  3KP7 A;  4U0Y A;  2H6C A;  4J01 A;  5FFZ A;  2MFZ A;  3I5U A;  2EH3 A;  2W25 A;  1U78 A;  2VKV A;  4CCK A;  2BY1 A;  4B47 A;  3OY9 A;  1PUF B;  4BKX A;  4CCO A;  2J5O A;  1P4X A;  2ME6 A;  3SYT A;  1RPW A;  2CUE A;  2ME0 A;  5CJ9 A;  4NB5 A;  1MJB A;  1SAU A;  1K4T A;  4NC8 A;  2MLK A;  2O5R A;  1Z6T A;  3S2H J;  1VND A;  1WJD A;  2JA5 J;  4Z2Y A;  2VQG A;  3TGN A;  4XRS A;  1QHG A;  5HLG A;  3OWT A;  4G6D A;  4GO1 A;  4A0Z A;  5ED4 A;  2O0Y A;  2VE8 A;  3DLL F;  3M1E A;  1XSV A;  4F3Q A;  3G71 I;  4M72 A;  3KCC A;  1IJW C;  1JXS A;  4EVI A;  3K6G A;  9ANT A;  2FBH A;  3CUQ A;  4BE2 A;  1BW5 A;  3LSP A;  3P9I A;  5F04 A;  2QM3 A;  1ETY A;  4BQN A;  1Y8Q B;  4CCL A;  4HX8 A;  3PO2 J;  1BN5 A;  2IVM A;  2K27 A;  5EGO A;  3JRI A;  1W1W E;  2BVM A;  3FX3 A;  3DBL B;  5DS9 A;  5J1U A;  2RNG A;  3EET A;  4XKV A;  4Y33 A;  3OYH A;  1ZQ3 P;  2Z16 A;  3S16 J;  1R23 A;  2BHY A;  4D1Q A;  1N25 A;  3SQN A;  1KQ9 A;  5M3F J;  4HA8 A;  1VQL I;  1ZTR A;  1B6A A;  1BI2 A;  2RVC A;  3HRS A;  3F3X A;  4O5V A;  1GDT A;  2IS1 A;  1MH4 A;  1JE8 A;  1VQ8 I;  4RB0 A;  3QPL A;  4L0Z B;  3LNQ A;  2JSC A;  4M3G A;  5E17 F;  1Z05 A;  2Q1Z B;  4H4K C;  1VQ7 I;  2DA5 A;  4F92 B;  3VB2 A;  2EFQ A;  3H9G A;  1R1V A;  1LEA A;  4CH7 A;  2F5V A;  2KMU A;  1KYW A;  1XGO A;  1D3Y A;  1TWG J;  1D1B A;  2CW7 A;  2XVC A;  2I8D A;  4YFK F;  1E3P A;  1G3T A;  4AIJ A;  2QQ9 A;  3H9J A;  4I0A A;  3ZQ7 A;  4HNV A;  2EK5 A;  3IL2 A;  1S72 I;  2RNJ A;  3HGY A;  1GVJ A;  3RDI A;  3DPU A;  3DEU A;  3KP5 A;  2BVL A;  1EF4 A;  5CVI A;  3FXK A;  4KN7 X;  3TOB A;  3MMY B;  2DT7 B;  3M8J A;  5K7H A;  4YEL A;  1ETO A;  2DT6 A;  3FIS A;  4YFN F;  3CCR I;  2Q8K A;  5LHI A;  1BL0 A;  3K69 A;  2Z3Y A;  2DPU A;  3SDB A;  3OYK A;  2YUS A;  2XPV A;  1BJZ A;  2O3F A;  2GXG A;  2HTS A;  3MEX A;  4RGR A;  4U0W A;  4XBF A;  3G1M A;  4XKW A;  2LF8 A;  4CDG A;  1WI3 A;  3HG9 A;  5IOY A;  1R4M B;  3DFG A;  3DEE A;  3GUD A;  3JRG A;  4OU0 A;  3TP3 A;  2R93 J;  5C3E J;  2PMZ N;  3LST A;  2HQA A;  4G7O F;  4P96 A;  4LG0 A;  4XL9 A;  1T0F A;  2JA2 A;  2PN6 A;  3KX2 A;  2LC2 A;  3RIR A;  4FIS A;  3RYP A;  2BV6 A;  4HBL A;  1ZG5 A;  5IYC J;  5D8L B;  2LD5 A;  5ICF A;  2ACJ A;  1ETQ A;  5DD4 A;  2FMY A;  2VAS A;  2H1L A;  3N05 A;  3Q0V A;  5FGM A;  1QNT A;  2L5Q A;  4I09 A;  2A68 F;  2K3P A;  2XRL A;  3LOC A;  4XNF A;  1JTY A;  3ZMZ A;  1WI9 A;  2I10 A;  4MQ9 F;  3VPR A;  2VI6 A;  1UB9 A;  5J6X A;  1V5E A;  2R0Q C;  1SMY F;  1MND A;  4UB6 C;  3LFU A;  1LE8 B;  1IDY A;  5HLI A;  4PJL A;  1HKS A;  1FMW A;  2F5D A;  1WJF A;  3HZJ A;  2P6S A;  2YX4 A;  3IH4 A;  5IP6 A;  4CIC A;  1MIJ A;  1UJ8 A;  3FM3 A;  2TRT A;  3QU3 A;  2NVT J;  3Q0W A;  3HSE A;  2KL4 A;  1ENH A;  1MSE C;  2XB5 A;  2K9S A;  1ZG3 A;  3KFW X;  2DA3 A;  4HW0 A;  2FBI A;  2PMH A;  2E34 A;  4XM3 A;  4QIW N;  2X9D A;  2XAF A;  1YS7 A;  4XRS G;  2CSO A;  1T8I A;  3HOW J;  2NS7 A;  2BY3 A;  3TL4 X;  2FJ1 A;  3DP7 A;  3GF2 A;  4X1E A;  3HUG A;  3DBH B;  1E3O C;  2X6W A;  4IQJ A;  4BU2 A;  3MCZ A;  2ECC A;  2XGD A;  4Y52 J;  1TL8 A;  3HRT A;  2KIS A;  3FXO A;  2PX9 A;  5GTI C;  3OYF A;  4UB8 C;  3DKW A;  5HS9 A;  4G94 A;  3L9F A;  3DWL E;  3VYS B;  1USS A;  3ECO A;  4CZZ A;  2K4B A;  5HOD A;  4RB2 C;  4OIN F;  4C2U A;  4X6A J;  4F7Z A;  4NC6 A;  3PJR A;  1QVU A;  1PUE E;  1X1C A;  1ZGA A;  3BR1 A;  4A0Y A;  2R5Z B;  1HF0 A;  3SZT A;  4BQQ A;  1Y1V J;  3ASO H;  3HKZ A;  2W57 A;  1IXS B;  3E5U A;  1LDJ A;  3AFH A;  4P9F A;  4BAC A;  1M1E B;  2VQC A;  5FFX A;  3RJP A;  3JW4 A;  4ENM A;  3EQL F;  1ZAO A;  2LF7 A;  1U0J A;  3JRH A;  5LFA A;  1FYM A;  1BJA A;  5DCM A;  3P9C A;  1V5G A;  3S3O A;  1J2X A;  1OR7 C;  3VFZ A;  2V1X A;  3QPS A;  2WBM A;  5F6F A;  3ZMS A;  5EYR A;  2ELJ A;  4LOC A;  1MGT A;  3CCU I;  5KAF C;  3N4M A;  3BR3 A;  2X6Y A;  1QU3 A;  2QCO A;  2OBP A;  4EJO A;  4MNU A;  3L09 A;  2XF5 A;  1Z91 A;  3L00 A;  4GRI A;  4U7B A;  3OS0 A;  3MKW B;  1O3R A;  3ZPL A;  1XTA A;  4Q48 A;  3J81 K;  2N8G A;  3I64 A;  3CUQ B;  1EH8 A;  1LEB A;  1TWH J;  3PNY A;  3CMM A;  2DOE A;  2OQR A;  5EGO B;  4FAS D;  4Q47 A;  3GTJ J;  3GYH X;  1Q1V A;  3TO6 A;  3ERM A;  4TV7 A;  1RKW A;  2CQQ A;  1E0E A;  3JTG A;  2HXI A;  1J59 A;  3UR3 C;  1TQI A;  5HDN A;  3PSF A;  4LK1 F;  1ZRD A;  2JUC A;  3ZR8 X;  5B3S H;  3KEY A;  5C4J J;  2LNB A;  3GWZ A;  2X6X A;  4I76 A;  4HG2 A;  1HDP A;  4OAY A;  1RUO A;  4BE0 A;  2YX7 A;  3G4S I;  3S15 J;  1MMS A;  2FNP A;  3BLY A;  5BS6 A;  1CGP A;  2ZSH B;  3KYD B;  2HPI A;  1JJ8 C;  3FMQ A;  4JQF A;  3O3K A;  2JN6 A;  3BJA A;  4F93 B;  4BEH A;  3H5A A;  2OCC H;  4KIF A;  5IP9 J;  3GX4 X;  3CDH A;  2PEX A;  4RGX A;  1IN6 A;  3WU0 A;  3I59 A;  4GYG A;  3W2V A;  3IAS 2;  3IWZ A;  5DYM A;  3CMA I;  1UG0 A;  3GFI A;  3HXL A;  2OU2 A;  3OIQ A;  5M5X J;  1S3J A;  2A6H F;  1VQN I;  2CV1 A;  2A6T A;  2F5E A;  2EFW A;  2M0M A;  2GA1 A;  2DQR A;  2XDV A;  4IEJ A;  2E7W A;  1WHU A;  5EEH A;  4C2M J;  2ZME C;  1ZHF A;  1FOY A;  4OOI A;  3H0D A;  2VC0 A;  1HOM A;  3B6A A;  2ZNY A;  3WG7 H;  1W7P A;  3BQY A;  2MLG A;  4IQ4 A;  4XN0 A;  2HOS A;  3WGH A;  2HQN A;  3RYR A;  1SAX A;  4OIP F;  3DTE A;  3RZO J;  2GIV A;  2L9V A;  4BY1 J;  1HKQ A;  1MH3 A;  3P5J A;  2BXY A;  2AXL A;  5J40 A;  3KP3 A;  3LFK A;  4LG0 B;  2CUJ A;  4AIK A;  3KP2 A;  2HDW A;  5LHG A;  1QZY A;  3S93 A;  1ZH5 A;  3H3V K;  3BDD A;  1I50 J;  5D6E A;  2R5Y A;  4XLN F;  4R79 A;  1PVE A;  3DPL C;  2WC2 A;  4A6D A;  3W6K B;  3AG4 H;  3AL0 B;  2IA0 A;  3TED A;  2XAU A;  4YIR X;  4PUS A;  1H88 C;  2P5L C;  1BC7 C;  4U88 A;  2AXT C;  2KIQ A;  3CMY A;  3OYB A;  4MTE A;  4Y15 A;  4ZYD A;  2V4J C;  2CW8 A;  4OWR B;  2P0W A;  2DA1 A;  1V5F A;  2ZC2 A;  1QO0 D;  1S5L C;  2IJL A;  5D4R A;  1OFC X;  5CQG A;  2LRE A;  2W7N A;  4II3 A;  3JRD A;  1DU0 A;  1W5T A;  4MHG A;  2L7K A;  3BC8 A;  4E7H A;  3CP2 A;  5HVQ C;  5HNH A;  4L9N A;  1L3L A;  2VKE A;  2HOT A;  1RC9 A;  1TQP A;  1WJC A;  3CUQ C;  1YIJ I;  2HOA A;  4M74 A;  5D4S A;  1UZC A;  4XKC A;  2ZKZ A;  3UNG C;  2BW3 B;  1G3S A;  3OYD A;  1RUN A;  1WZ2 A;  4WF2 A;  2XAS A;  1PYV A;  3A1Y A;  2HI3 A;  4RLQ A;  4X0G A;  2K9L A;  2KJB A;  3NWS A;  3JCU C;  2LOO A;  3DKY A;  2X48 A;  5H2F C;  4ZH4 F;  2Y2Z A;  5DUK A;  4ETS A;  1LUJ B;  3RPU D;  4GFB A;  3B6C A;  2V26 A;  4C9Y A;  1O4X A;  1PUF A;  2VL8 A;  2FUG 2;  1NTC A;  3MKZ A;  2ZFW A;  1FMV A;  2EIN H;  3IH2 A;  2BEO A;  3OYE A;  2IPQ X;  5E8G A;  1QBJ A;  2CUZ A;  3D5S C;  1YLF A;  1L0O C;  4ESB A;  1PP7 U;  1MMG A;  3OYG A;  1YQA A;  1TT5 B;  1YW7 A;  2RDP A;  5H6Q A;  2ZSI B;  2LTP A;  3BG3 A;  3BP8 A;  1Z7U A;  2ZCW A;  3FWE A;  4J19 A;  3CME I;  3OS2 A;  4CCN A;  2B7E A;  2L54 A;  2KHM A;  4B3X A;  1X1D A;  3QP6 A;  2EWN A;  3I3L A;  1HBX G;  4UNO A;  2Z9O A;  4ABZ A;  2R7W A;  1XSD A;  2G0E A;  2UWM A;  1F1Z A;  3A0B C;  3MN2 A;  4A3F J;  4UUS A;  5E1W A;  4MGR A;  2ECB A;  4HF0 A;  2EV5 A;  1LFU P;  2ZXJ A;  1HCR A;  3ZOB A;  3GTO J;  5EDN A;  1JKQ C;  2OV7 A;  1I39 A;  3QU6 A;  1QVT A;  2EQR A;  2VBX A;  3JRC A;  3NRV A;  3HHH A;  1XMA A;  2HYG D;  2O6G E;  2DMP A;  1P9Q C;  4E7I A;  3I4N J;  3QPT A;  1ZR2 A;  1S6L A;  3BR5 A;  2VIX A;  1Z1D A;  2VT3 A;  2HKO A;  4D5C A;  2GM4 A;  2F5C A;  2CV0 A;  4CO8 A;  3EUK L;  1R71 A;  2MYS A;  1H9G A;  2QF7 A;  2XGX A;  1ZRF A;  1XS9 A;  1T0F C;  1H9T A;  3WE3 A;  1FNN A;  2DFI A;  1FBU A;  1IGN A;  4ENJ A;  2ID6 A;  4MFD A;  5FKM A;  2DOD A;  3U9G A;  4YFX F;  1FIP A;  2X1E A;  2MH2 A;  3S1Q J;  3OSG A;  1MD0 A;  2MAB A;  2QEN A;  4ESF A;  3JRF A;  2NS0 A;  4RB3 C;  3ZP5 A;  3QQA A;  1UHS A;  3ABU A;  1P6R A;  1KON A;  2LBF B;  4BHC A;  3D0S A;  1GV5 A;  1FYK A;  5HS7 A;  4IZZ A;  2HDC A;  3Q3S A;  2LH9 A;  2ZJP F;  2IT0 A;  3K1P A;  1RI7 A;  1G6N A;  1DU6 A;  1FTZ A;  3J80 Z;  3HOT A;  2B9S A;  4BEH B;  3LSR A;  2ETH A;  3IHU A;  4HYE A;  4OIO F;  2HOE A;  1J09 A;  1HQC A;  4DQ2 A;  2MBF A;  2VPL A;  3CCJ I;  1B59 A;  2A61 A;  4ESJ A;  1MMN A;  3RPU A;  3WTU C;  1A31 A;  3K1N A;  5LBQ A;  2LLK A;  3I55 I;  3CJQ B;  1MJ9 A;  2VKH A;  2GXB A;  1F4K A;  3HEF A;  3BQZ A;  3N97 A;  3I4M J;  2VKD A;  2DDB A;  1FLI A;  2CO5 A;  2DMT A;  4G12 A;  1D5Y A;  4AWX B;  1Y6I A;  4IVN A;  3OIO A;  4KYW A;  2CQK A;  5JR3 A;  2IBD A;  2GLO A;  4RGU A;  1DP3 A;  2W1O A;  2NVY J;  2W00 A;  4E70 A;  5C44 J;  1ONV A;  1V55 H;  2FSW A;  4DZJ A;  2WWY A;  2WY7 Q;  1MNE A;  2CW0 F;  4BBS J;  5B5E C;  2R7U A;  3OOU A;  1JUS A;  2ZXH A;  3E7L A;  3GLX A;  1LE8 A;  1D0Y A;  4LLL A;  2LG4 A;  1X3U A;  2V6C A;  4KNY A;  3ZGK A;  4MFE A;  4OIQ F;  2IW5 A;  1Y39 A;  2HTJ A;  3UKG A;  5L3D A;  2GZW A;  3U2R A;  1VQ6 I;  2IS2 A;  4IHX A;  2V7F A;  2DN0 A;  1HST A;  5DDG A;  3G1L A;  4ZZD A;  2HPM A;  2Y0S N;  1T6S A;  2FD5 A;  1X58 A;  4G6T B;  5J4Y A;  3S2W A;  1IN5 A;  4QWQ A;  2XAG A;  1HXD A;  4XLA A;  2E2I J;  4XLP F;  2JA6 J;  1C0W A;  2GOX B;  1JHH A;  3BG6 A;  2XKO A;  1FWZ A;  4A3L J;  2DA4 A;  1TBX A;  3JAM Z;  4YII A;  4HX4 A;  2QBY B;  1ETX A;  3TP0 A;  2F6C A;  4BJT A;  4OIR F;  1MMD A;  3ZCO A;  1KU9 A;  3ROU A;  3OL4 A;  3TW7 A;  3W2A A;  2L3D A;  4PZJ A;  3SXY A;  3HGG A;  4P1W A;  3GW2 A;  3DXJ F;  4EEF G;  4AYB N;  4A6E A;  4KMF A;  1K7A A;  4DW6 A;  3TMO A;  5D6F A;  2HFH A;  3GFM A;  2M4G A;  3SFZ A;  2VN2 A;  2L7Z A;  4IHY A;  1KA8 A;  4XSZ F;  2R5Z A;  3KZZ A;  3CES A;  4DYR A;  1KQ8 A;  4LFU A;  2P8T A;  4QLC U;  1KU2 A;  3ZRG A;  2MG4 A;  1DPR A;  2JMW A;  4ZYA A;  5GAD J;  5M5Y J;  1MJA A;  5D8K B;  3E5X A;  1FSE A;  2HWV A;  2OZU A;  2NS8 A;  1QHH D;  1IC8 A;  4D5F A;  3PO3 J;  2DOA A;  4A93 J;  2R7O A;  1JT6 A;  1TWF J;  4BXX J;  3Q0U A;  3H9Q A;  4Y4R A;  3S8P A;  3CO6 C;  1SFU A;  2NXN B;  1BI3 A;  1X4O A;  4G8X A;  2DT5 A;  5K7F A;  1KGS A;  1YX3 A;  1B1B A;  2NNN A;  5LRS A;  3CLQ A;  1G8X A;  5B66 C;  1G4D A;  3LL7 A;  1H89 C;  2FNA A;  1YIT I;  1P92 A;  1WCM J;  5DCF A;  4A69 C;  2HVR A;  3HOZ J;  3O8H A;  3K4N A;  2WAE A;  3E6M A;  5KCM A;  1K61 A;  3J7Z I;  5CPR B;  4D0P A;  2YSR A;  3MKY B;  4MEX F;  1AKH A;  1T33 A;  4UUS B;  2MC4 A;  5DTD A;  3WG9 A;  1Z7L A;  4IO9 F;  1ZKG A;  3OL3 A;  2DLL A;  2E19 A;  4BQO A;  3F21 A;  2BGC A;  2LP0 A;  5FRN A;  2LKP A;  3EUH C;  3CCQ I;  4Q4Z F;  5JVT A;  1QQI A;  2DOF A;  4FTH A;  3ABK H;  4FX0 A;  1LFP A;  1IV6 A;  4KIS A;  4D9J A;  4E7K A;  2A6E F;  3AG1 H;  3FBI B;  2E60 A;  3ZQH A;  1LVA A;  3AKZ A;  3BPV A;  4UXN A;  3PIO F;  3J7A O;  4FT8 A;  1RNL A;  4CCM A;  2DK8 A;  4I2O A;  3PFY A;  5EEA A;  1VQM I;  3QRF F;  3FXR A;  3V7C A;  6PAX A;  3KYC B;  3K9T A;  2IGO A;  2R7F A;  3PM1 A;  1UMQ A;  3R61 A;  1ZGW A;  1DDN A;  1W0T A;  1LNW A;  5EZG A;  4P55 A;  5IT9 Z;  1ZYR F;  4N9H A;  2R7R A;  2E1O A;  5F0H A;  1A04 A;  5DV5 A;  2OJE D;  2DXI A;  1S9H A;  5AIQ A;  1UAA A;  3H0G J;  3BTJ A;  2F48 A;  1ETV A;  3LSG A;  1BBY A;  2LSO A;  1JT0 A;  3LA3 A;  1TW2 A;  4E7L A;  3K4C A;  2WV0 A;  4NQW B;  2Y9Z A;  4HV6 A;  1R36 A;  5FKK A;  2FE3 A;  2L0K A;  3K1M A;  3OYA A;  3K70 D;  1D1C A;  1IF1 A;  2IS6 A;  2FRH A;  2JK3 A;  4Z6Y A;  4V19 K;  4RAY A;  5JFR A;  1ZLK A;  3ZQC A;  3X2Q H;  2JA8 J;  4A5M A;  4C2T A;  4EGZ A;  4MO7 A;  4XLF A;  4IL6 C;  4L5I A;  3S1R J;  1ZRE A;  1S7A A;  3L2U A;  2KPM A;  3BPX A;  2PJR B;  1VQ5 I;  1S7E A;  1X2N A;  2E1M C;  4JX6 A;  2XF7 A;  2ICW G;  3HC7 A;  5J3L A;  2HGC A;  2RQQ A;  2EIM H;  5BQT A;  2Z99 A;  1KQ0 A;  2NRA C;  4BH9 A;  4ZDO A;  3E6D A;  2JWT A;  3PSI A;  3OSF A;  3FBN B;  1LPQ A;  3IKV A;  4RAG A;  2K40 A;  1NK2 P;  4QPQ A;  3HHG A;  1W5S A;  2M5W A;  2PFB A;  3ZQF A;  3GTG J;  4RGS A;  3ZQG A;  3KLO A;  1ZLJ A;  1SAN A;  4Y7N J;  2WAD A;  5ICC A;  5K1Y A;  1G3Y A;  3CF5 F;  3LWF A;  4I99 C;  3U1D A;  5LLQ A;  4N4N B;  4RBO A;  4BYY A;  1GXP A;  4M9Z A;  3RKW A;  1T39 A;  1TTY A;  3PIP F;  4AD9 A;  2F2E A;  2VBW A;  1MSF C;  3GXO A;  5LGN A;  2XGE A;  3BG5 A;  3OV8 A;  4L5E A;  1YHQ I;  2X85 A;  4XK4 A;  3SFI A;  5L3B A;  3SDG A;  1X3Z B;  1UST A;  3JSO A;  2GA2 A;  2DQL A;  4L9V A;  1OCR H;  3M8E A;  1WJ5 A;  3O8G A;  3TO9 A;  3C1D A;  3NEU A;  1HW5 A;  2XPU A;  1GT0 C;  3ZQI A;  3ZMU A;  1U8R A;  2KRH A;  2O03 A;  1R1U A;  3CD6 I;  4HF2 A;  4XOP A;  4QSH A;  2BW3 A;  2IA1 A;  3I53 A;  3K2A A;  2JVH A;  1WWX A;  2EV0 A;  3MFK A;  1J5Y A;  1T38 A;  3PUB A;  1I5Z A;  3RTR A;  3ABL H;  5J47 A;  1FJL A;  1UFM A;  3T5X A;  1QRY A;  4CZC A;  2A69 F;  2Q2E A;  3WTZ A;  1XPX A;  5IP7 J;  2EV6 A;  3IRR A;  3PNV A;  5K7Z A;  2KDZ A;  2JRM A;  3DTK A;  3PQJ A;  3SEZ A;  4IKF A;  1WRJ A;  2M30 A;  2JTV A;  3MZH A;  4BJ6 C;  1UHW A;  1T2K A;  2VQH A;  2K9M A;  3HPH A;  1WKM A;  3HB9 A;  1ORK A;  2DMU A;  1U6G A;  1RRJ A;  2W48 A;  2KT0 A;  2FF4 A;  1R22 A;  4O6J A;  2HYF A;  1W5C C;  2JJ7 A;  2VXZ A;  3AG2 H;  4LGW A;  3BT9 A;  5HDG A;  2L7M P;  1S8N A;  3ML6 A;  4A3B J;  3IRQ A;  4BBR J;  2RV8 A;  3CCL I;  2QGU A;  4JK1 X;  4IF4 A;  2A3S A;  2L01 A;  4AVP A;  1J0R A;  1BR2 A;  2B0L A;  5DUI A;  2DFF A;  3G3Z A;  2O9L A;  3KLN A;  1I27 A;  2L9S A;  5CVV A;  1P7J A;  4LMY A;  2J5P A;  2ID3 A;  2MA3 A;  4KFC A;  2E2H J;  1CF7 B;  2G9W A;  2VQL A;  4E7J A;  1IRX A;  1X1B A;  2IGM A;  1AKH B;  3ZN1 A;  5E3O A;  2O8K A;  4B3A A;  4A3K J;  4KIC A;  2LKS A;  3M8F A;  4N9I A;  4AUX A;  2R7V A;  5J4V A;  3E3V A;  2E2J J;  1NH3 A;  4M3E A;  1Z77 A;  1H0M A;  2KRC A;  1WH7 A;  4RAZ A;  3JTH A;  2GQQ A;  1HDD C;  2XRN A;  2M3A A;  3CF2 A;  1U5T B;  3LSM A;  4V2F A;  2P81 A;  3HRM A;  2CRG A;  3RKX A;  1UHM A;  5L3E A;  2KKO A;  5LEJ A;  4EGY A;  1OMI A;  2STW A;  2F5F A;  1B8I A;  1TWC J;  2LBF A;  3HJE A;  1KU3 A;  2ESN A;  1APL C;  2MD0 A;  2KLO A;  3H3Z A;  3DV8 A;  2JQ7 A;  2HQ5 A;  2NVU B;  5K5O A;  2COB A;  5J8C A;  1BA5 A;  2VT2 A;  1MKM A;  3IC7 A;  2RKH A;  1DP7 P;  1LDD A;  2EIJ H;  2JVG A;  4S0H B;  1OKR A;  2LKX A;  3CZ6 A;  4KUM A;  2A5W A;  2M8G X;  2QSH X;  3DU6 A;  4LG3 A;  1UCR A;  2X51 A;  2DMN A;  3E5Q A;  3RKQ A;  5FLM J;  1VQK I;  5KAI C;  4NC7 A;  3IP4 B;  2XGC A;  2R3S A;  3EYY A;  2C6Y A;  1WJB A;  5D5U B;  4HLY A;  2M45 A;  3EUH A;  2PMZ A;  3SJM A;  1J75 A;  4HNT A;  5EG0 B;  2Z5U A;  3T0Y A;  4JOM A;  1YW9 A;  2CH0 A;  2WTE A;  4NDL A;  2PJP A;  1XCB A;  4HST A;  4EMS A;  1TP4 A;  4L18 B;  4P9U A;  5H20 A;  1XSX A;  4IXA A;  4XLH A;  2M0C A;  2COM A;  1X19 A;  2ZNZ A;  1OPC A;  5L3G A;  1XMK A;  1FP2 A;  2V1U A;  2HYJ A;  2LVS A;  4LIU A;  2DK5 A;  2L9N A;  4PJM A;  4BJ5 C;  4MTD A;  4LLN A;  3FXU A;  4E6K G;  4A3M J;  1E2X A;  2CMP A;  1AHD P;  4LLG F;  2H1K A;  3FMS A;  3DKX A;  3VYU B;  1LVK A;  1WFX A;  1S29 A;  2V6E A;  4Y17 A;  2UUZ A;  4UUV A;  4K2E A;  2CFX A;  2P7C B;  4OMZ A;  4I98 B;  2IGN A;  2HZT A;  4A5N A;  3I54 A;  3G1O A;  3CC7 I;  5FD6 A;  2EB7 A;  2VBY A;  3I4P A;  2VON A;  1JUP A;  1Y0N A;  5E18 F;  4H0E A;  2AQF A;  2HU9 A;  3FXJ A;  4Q5S F;  2EZH A;  4DYC A;  3RCO A;  3V4G A;  1DUX C;  4CUG A;  2QBY A;  3DQV C;  4NNJ A;  3HPG A;  3J7A Y;  1SFX A;  3MQ0 A;  4MLO A;  5HLH A;  2CUF A;  2QUF A;  5KHD A;  2DO7 A;  2QQ8 A;  2P7V B;  2WB1 N;  4YIF A;  3JRE A;  1BOA A;  3F6V A;  4EJT A;  3HSR A;  3HRU A;  1Y1W J;  3H92 A;  1XC5 A;  1YIO A;  2CYY A;  4MEY F;  1JUM A;  2CU7 A;  1DPU A;  3HTS B;  1TNT A;  3O2P E;  2RRE A;  5HDK A;  2KIF A;  2Y31 A;  2DA2 A;  3BR0 A;  3WGI A;  1JGS A;  3CCM I;  2ZO4 A;  5GP9 A;  2R7D A;  2WAF A;  3S14 J;  4U87 A;  3K10 A;  5JHU A;  5HLT A;  3GCM A;  1SEU A;  2DI3 A;  3OOP A;  1YI2 I;  3DEW A;  4S05 A;  4WXD A;  2QKL B;  5CVJ A;  1OCZ H;  1U5T C;  3COA C;  3NAR A;  2Q2E B;  2UZK A;  1ZG1 A;  3BG9 A;  1FC3 A;  1IN8 A;  3BJ6 A;  2Y0M A;  1MBE A;  2VJI A;  3A0H C;  4I02 A;  4CHU A;  4CA0 A;  3VYR B;  2RAE A;  1JJ6 C;  1U8B A;  3FKJ A;  3L7W A;  2CFO A;  5KVR A;  1EA3 A;  1REP C;  2DA7 A;  1GUU A;  1Z21 A;  1XD7 A;  2E7X A;  4Y3O A;  1R9T J;  2Y48 A;  2XSJ C;  2RGV A;  3F6O A;  1IN7 A;  4M3D A;  3JR9 A;  4JP0 A;  2E5N A;  5F64 A;  1IW7 F;  1FX7 A;  2XPW A;  1Z3X A;  3ZXS A;  3MWM A;  2GXA A;  3VWB A;  1RR8 C;  3BJO A;  1X3W B;  1XDS A;  3LA2 A;  4LIT A;  4B8X A;  1IAW A;  1AU7 A;  3A01 A;  1HC8 A;  4A3G J;  2XAJ A;  2V9K A;  2ZJQ F;  3CQZ J;  1K6O A;  2F4I A;  5F1R A;  2EFN A;  5LHH A;  3BTI A;  1K4S A;  3HOY J;  1MBH A;  2JZY A;  1STZ A;  4XMY A;  4P5O A;  2LY1 A;  5EZH A;  1OYW A;  4BAY A;  1P4A A;  4IOA F;  1ZAR A;  1F43 A;  1MZB A;  4XLC A;  2KRF A;  5K5Q A;  4BGD A;  3FM5 A;  3E1S A;  4DBQ A;  4RM2 A;  3E97 A;  2A07 F;  3F22 A;  3GZ5 A;  3NAU A;  4ON0 A;  1I6X A;  4Y13 A;  3AL0 C;  2PBI A;  2LFB A;  4CXF A;  1SD5 A;  1QPI A;  2XB0 X;  4U0V A;  2GIZ A;  4BXU A;  3GME A;  3KET A;  2DPD A;  1B8I B;  5CQE A;  2L4A A;  4NQW A;  4WXC A;  3GVA A;  4M9X A;  3CO7 C;  4CYD A;  5D5V B;  4CGZ A;  3T8T A;  2EFP A;  1KZH A;  4LIV A;  5CVU A;  4JBA A;  1XX5 A;  1DQU A;  3D1N I;  1W36 D;  1QPM A;  1DGW Y;  2UV1 A;  4YEJ A;  2EJR A;  2PJR A;  5BPD A;  3S17 J;  3LSK A;  3QOE A;  4EM1 A;  2QVO A;  3BR2 A;  3K4K A;  1TC3 C;  2LDU A;  5TJJ A;  2M34 A;  2IS4 A;  3R4K A;  4HOB A;  5KNL A;  3FZV A;  2VXD A;  4AID A;  2VOO A;  2KP6 A;  3WTV C;  1BOB A;  1BIA A;  3P7N A;  4JYK A;  3V7R A;  2RC4 A;  3TW6 A;  5E8I A;  3TBI A;  1K83 J;  4HDU A;  1IUF A;  4C3J J;  1SMT A;  4AC0 A;  2QWW A;  3ZMV A;  2K9Q A;  1RR7 A;  1IUY A;  4M6Y A;  3W6V A;  1HKT A;  4EJU A;  2IGK A;  5GAG J;  1Y0U A;  5C4X J;  2D2W A;  3FXM A;  4XLE A;  2VLA A;  2VOP A;  5FRO A;  1X2M A;  1YX5 A;  3H36 A;  2XAQ A;  3GFL A;  1XG1 A;  2L7F P;  3V42 A;  4HQM A;  5LGU A;  3FK6 A;  3NWT A;  4RM3 A;  1YFH A;  3CLO A;  3E6B A;  3K70 C;  2P6T A;  1P4W A;  1ODD A;  1Z3Y A;  2EPF A;  4DZP A;  3G2B A;  4HX7 A;  3CCS I;  4A3D J;  3J81 Z;  1K79 A;  3I9V 2;  1RKT A;  3KIO A;  2M1B A;  1HW1 A;  3TDU C;  1T56 A;  4HQE A;  4LB5 A;  1V3F A;  2XRO A;  1MNM C;  3ZMD A;  4A12 A;  4ZZL A;  3DTI A;  5J8F A;  4FE7 A;  1FOK A;  2QLZ A;  3M4O J;  2XUB A;  1FYL A;  3RSN A;  1VZ0 A;  3M7G A;  1LB2 A;  3W3C A;  5E1Z B;  2G7H A;  1U9O A;  3KEO A;  3G73 A;  1MBF A;  5DM6 F;  4UVB A;  2EFO A;  1F5T A;  1TNS A;  1O3T A;  3L2R A;  1WPK A;  2WB1 A;  3F9K A;  1GHC A;  5HS8 A;  3K2Z A;  2H94 A;  1XCV A;  2NVX J;  1I3A A;  4XOR A;  2STT A;  3LA7 A;  2HEO A;  4QTR A;  2E71 A;  2CG4 A;  2P5V A;  2GBY A;  1LFB A;  1FY7 A;  3GTP J;  3D5R C;  4R8H A;  3A03 A;  1IXC A;  4R1H A;  4GDF A;  3SZP A;  1P7I A;  1IDZ A;  2X6O A;  1U3E M;  1WQ2 A;  2GAU A;  2QSG X;  1BR1 A;  1HW2 A;  1G3W A;  1B4A A;  3QOD A;  2A5Y B;  2H8W A;  5F27 A;  2A05 A;  2OPT A;  4WXH A;  3LMM A;  3DCF A;  1SVL A;  1JKO C;  2X0L A;  1SFE A;  3CP8 A;  1XGN A;  1I1G A;  3IH3 A;  4RS8 A;  3ULQ B;  1AA7 A;  1YW8 A;  3FKI J;  5FLV A;  4KIG A;  4O3M A;  2HNH A;  5D5W B;  2K3F A;  2QA4 I;  4UY8 I;  1D1A A;  1KYZ A;  3RQ4 A;  3PNT A;  3H5N A;  2ISY A;  2B63 J;  2DJI A;  2LR8 A;  4DOZ A;  1X1A A;  4B1R A;  2JRT A;  3ASN H;  3L2C A;  3BWG A;  3F8B A;  4EM2 A;  5FKN A;  2TCT A;  1HLV A;  1JKP C;  1SVO A;  3HTU A;  5TIS C;  3OMY A;  3ABT A;  2FX0 A;  1IRF A;  4ZDP A;  1E3H A;  1SFK A;  2BHZ A;  2OAZ A;  3BCB A;  3WTW C;  3WHB A;  5E3M A;  3I58 A;  1XDU A;  1CF7 A;  2F4O B;  2E35 A;  3HKZ N;  2JT1 A;  1D8K A;  2KIM A;  3D5L A;  1N77 A;  3AAF A;  1FT9 A;  4WCG A;  3FIW A;  5IYD J;  3K4B A;  2R7S A;  2OUM A;  2QKM B;  1D8J A;  3CC4 I;  2KZG A;  2PQ8 A;  2DTZ A;  1Z6R A;  4FHT A;  5FKL A;  4UHT A;  3OYM A;  5E20 A;  3A01 B;  1R00 A;  3KYL A;  4RLF A;  2FEZ A;  1DGR M;  4CYC A;  1WVR A;  2BE5 F;  3E0J B;  1U5T A;  2HKX A;  4C30 A;  1O7L A;  1POG A;  1ZK8 A;  3T8R A;  4BDZ A;  3C2B A;  4KA4 A;  3HSF A;  1FEX A;  4BXF A;  4BNC A;  3H5R A;  3SZG A;  3WE2 A;  3QWL A;  3R0J A;  4AU7 A;  5E3L A;  1IV8 A;  4XOT A;  1Z0X A;  3QYF A;  2IXS A;  4BL0 B;  3CTA A;  1ON1 A;  1YRN B;  2O61 A;  3KZI C;  1MBK A;  4HNU A;  4V2G A;  4PGG A;  2DFE A;  4A0X A;  4OMY A;  1AWC A;  3S1N J;  1RIO H;  4JX5 A;  2Q0O A;  2XV4 S;  1I1S A;  3G6E I;  2EIK H;  2VUM J;  2HR3 A;  4ZDL A;  1V4R A;  1IRZ A;  2DYR H;  4A3E J;  4ZTJ A;  4KT6 A;  4A2U A;  3QYB A;  1LQ1 A;  5ICG A;  1OYI A;  3V7S A;  4HEA 2;  1QZE A;  3WHC A;  3R0A A;  3HDD A;  2W24 A;  2V79 A;  1O57 A;  4CCJ A;  2DYS H;  3C2H A;  5EEG A;  1PP8 F;  5EG0 A;  1VTN C;  1K78 B;  3OS1 A;  5JLW A;  2XIG A;  4IHT A;  2IAI A;  1MDM B;  3JSP A;  2TDX A;  4M6X A;  4M9S A;  5FLX Z;  4ZC3 A;  3Q5F A;  5FB2 A;  2FBK A;  3GTQ J;  1B72 A;  1OYY A;  2VE9 A;  1YG2 A;  1QGP A;  4N0B A;  2D5V A;  2ZXW H;  4M3F A;  1R49 A;  4UUT A;  3GEZ A;  1NK3 P;  4BHB A;  2OTJ I;  2DA6 A;  2M9H A;  3NQO A;  4EJW A;  2E1N A;  3R60 A;  4DNC A;  5A2Q Z;  2YU9 J;  1ITY A;  1OIS A;  3FMR A;  2YPR A;  4NUB A;  2UXN A;  2VBZ A;  4BQA A;  3GO5 A;  2HVQ A;  2WA0 A;  4W97 A;  5FO5 A;  1Q1H A;  3L2W A;  1SD4 A;  4KT5 C;  2AHQ A;  1LDK B;  4U7D A;  2JUG A;  2ZFU A;  4OAZ A;  1SC7 A;  3F8F A;  2M2E A;  5FKO A;  3SEQ A;  3BR6 A;  1BM9 A;  3BRO A;  5LEK A;  3MZY A;  3CCE I;  2Y0S A;  4KIT B;  1FOX A;  4IX7 A;  1A6I A;  2M4K A;  3HBL A;  5IY5 H;  5JVG F;  3CC2 I;  4A3C J;  1D0Z A;  3FK7 A;  3CCY A;  4PFO A;  2CQX A;  2AS5 F;  3S2D J;  3CJR B;  1YYV A;  5H6R A;  2JPC A;  1YJW I;  1ZR4 A;  2D45 A;  5KK1 A;  4UVA A;  4EM0 B;  1TLH B;  4HSR A;  2Z1D A;  3WOD F;  3PUF A;  3B02 A;  1XGM A;  2FOK A;  2NYX A;  3OR1 C;  2ADU A;  1F36 A;  5DEQ A;  2R7Z J;  2EA4 A;  2DU9 A;  4D7N A;  1ULY A;  4FQG A;  1G2H A;  1K6Y A;  1X1P A;  4AYB A;  4IRH A;  4UVC A;  5D5X B;  3ZMT A;  3QP5 A;  1J7K A;  1N75 A;  2DBB A;  2K86 A;  5IT3 A;  5K5R A;  1FP1 D;  2I5U A;  4BE1 A;  1GV2 A;  4IRI A;  3L2V A;  5AIP A;  3VYT B;  3TOA A;  3H3U A;  1U2W A;  3BZ6 A;  2ZME B;  3U21 A;  4BUP A;  3Q9V A;  4LJZ F;  2H27 A;  4B09 A;  3VSL A;  1V54 H;  2OF7 A;  1W0U A;  1FPQ A;  5HOO A;  4HAM A;  4XSX F;  3I56 I;  4DJA A;  2BYV E;  3F8M A;  3J80 K;  4GGG A;  3LSI A;  3EDP A;  3GFJ A;  2OC6 A;  2EIL H;  4DGW B;  2DJN A;  2VJ5 A;  1U9N A;  2ZJR F;  1O7F A;  2W82 A;  3K4J A;  1AOY A;  1BW6 A;  3KPH A;  4XRM A;  1B9N A;  2O7O A;  3F8N A;  3WU1 B;  2FOW A;  4HPQ A;  2KJC A;  3TQN A;  2HDD A;  5ILV A;  2P4W A;  1W7P D;  3V8J A;  2YU3 A;  3HOS A;  2XHK A;  2X1D A;  1ERD A;  2E1C A;  2FXA A;  2XF6 A;  2FML A;  1FSH A;  4PJJ A;  2XC7 A;  1S7O A;  2K4J A;  2XSD C;  3FHZ A;  5ILU A;  3S32 A;  5E79 C;  3VSK A;  1JGG A;  3R6S A;  5J1R A;  4B48 A;  3QYE A;  1EH6 A;  2DCE A;  1WJA A;  2QSF X;  3MD2 A;  2CQ7 A;  1R4N B;  2KZV A;  3P9K A;  4KN4 X;  5LD2 C;  5IOZ A;  1R1T A;  1UG2 A;  4DIQ A;  3IV5 A;  3ESW B;  3OYL A;  4CYC B;  1Y56 A;  4E7S A;  3A2K A;  1D0X A;  4ZYE A;  3LAP A;  4B43 A;  4I01 A;  3VDX A;  1GLN A;  1VF9 A;  4ENN A;  1JI8 A;  3GLL A;  2AQE A;  1OCP A;  2P5K A;  5F1J A;  1ZGJ A;  1J9I A;  3F8C A;  1RES A;  3ZQL A;  2KFD A;  1WJE A;  4AIH A;  4ZJZ A;  2OTL I;  1CQT A;  4G7Z F;  1H8A C;  1SVM A;  2KQR A;  1T98 A;  4BS9 A;  4WX9 A;  3E6C C;  4PCQ A;  5FRM A;  1ETW A;  5CVR A;  5L3F A;  5M3M J;  4XKB A;  2E5Z A;  2ZXI A;  4ZTF A;  4XN3 A;  2ZB9 A;  1A36 A;  5F08 A;  3W2W A;  5IYB J;  4JX4 A;  3LSJ A;  5LGT A;  5TRD A;  3JAM K;  4F55 A;  3DPT A;  1VQP I;  4L5J A;  2VOD A;  2R7T A;  2QEX I;  3GTM J;  2W84 A;  1XN7 A;  3WTY C;  4ENK A;  3BTC A;  1I3Q J;  3F72 A;  1BC8 C;  2EZI A;  3C2G A;  3M07 A;  1BI1 A;  1GXQ A;  1JTX A;  3HOU J;  5JLX A;  2R4G A;  3IKT A;  4DYQ A;  3HL2 A;  2D1H A;  3MVP A;  4KMU X;  4CSW A;  2QZ8 A;  2OQG A;  4DBR A;  2JPB A;  3GTL J;  4IRG A;  2DFH A;  3OYI A;  1OJL A;  5GPC A;  3QOP A;  2WAQ N;  4AM3 A;  1FBQ A;  2W85 A;  3GBG A;  2M7B A;  4II2 A;  1NG6 A;  4RAF A;  3PQK A;  2BY2 A;  4BY7 J;  5ICE A;  3M1C A;  1B72 B;  4I6Z A;  2QQA A;  2ZBK A;  4S04 A;  1X4P A;  4I0B A;  3OYN A;  4PGH A;  1R58 A;  2DAO A;  1ON2 A;  4HZF A;  3JRB A;  1Z9C A;  4QPO A;  1IO2 A;  5AON A;  4UV8 A;  3SHF A;  2OZ6 A;  1YJ9 I;  1FBS A;  2VJ4 A;  1RET A;  1W36 C;  4HLX A;  5BNG A;  2Z2S B;  3GTK J;  2JA7 J;  3MZ8 A;  3BTL A;  3C18 A;  3BOQ A;  1SD7 A;  3T1B A;  1BR4 A;  3CJN A;  1YOV B;  2EA2 A;  4RMN A;  4UV9 A;  1G59 A;  3WTS C;  2AO9 A;  2PG4 A;  3OYC A;  1IRG A;  4IJA A;  2IRF G;  4B4C A;  1TW3 A;  2CJJ A;  2Y69 H;  3MAJ A;  4G6Q A;  5CYV A;  4F52 A;  1A5J A;  1HA8 A;  2YS9 A;  3HYI A;  2DTR A;  1YS6 A;  1FOW A;  2HS5 A;  2V9V A;  4EAT A;  5J1Y A;  4PJN A;  1MBJ A;  4ZYH A;  1ZN2 A;  3I71 A;  2ZJ2 A;  4AVZ A;  4KJZ A;  1VI0 A;  5EJC A;  1O3Q A;  4XQF A;  1YJN I;  5HNF A;  1Y8R B;  2Z33 A;  2L02 A;  2OCE A;  4XRF A;  4N4O B;  1XB4 A;  1UEL B;  5GTH C;  2CQN A;  2MC3 A;  3VOE A;  2MD5 A;  3OR2 C;  5E3N A;  2ELK A;  2UXX A;  5BPI A;  2HZD A;  5GAE J;  3S3N A;  3L1P A;  4KDP A;  2VB6 A;  5DM7 F;  1QA6 A;  2HQR A;  1VQ4 I;  5F0F A;  3FF5 A;  2V1D A;  3TO7 A;  1N78 A;  2CGP A;  3IAM 2;  3A02 A;  1IN4 A;  5TGT A;  5IT9 K;  2JSP A;  5B1A H;  4RDU A;  4HDV A;  3ELK A;  1FTT A;  4GCV A;  4IHW A;  2LY2 A;  3HOX J;  1HSJ A;  1QZZ A;  1W4M A;  5LRR A;  3EPZ A;  2LRD A;  3KP4 A;  2M7A A;  4L0Y B;  3DBR B;  2CV2 A;  3HUG B;  2K9N A;  5F0C A;  3J7Y J;  3RPQ A;  5DD8 A;  5FJ8 J;  4ITV A;  1YO5 C;  4EQQ A;  3K0L A;  1WH5 A;  3ZN0 A;  2G7U A;  3EYI A;  3DLA A;  3IWF A;  2LK2 A;  5JI6 A;  2WV1 A;  4GXO A;  4PK4 A;  5FLX K;  1BI0 A;  3ERE D;  2XAH A;  4ANJ A;  3BZC A;  5BOX A;  3CCV I;  4F91 B;  2PI0 A;  4I7H A;  2DMQ A;  5ERI A;  4RB1 A;  3HM5 A;  4D7M A;  4XID A;  3U1K A;  2EZK A;  2WY8 Q;  5GPA A;  2MH9 A;  2V1N A;  5DCM B;  2OA4 A;  4PFP A;  2VPR A;  2L4M A;  5CLS A;  2VC1 A;  3TDZ C;  3KE2 A;  1LJ9 A;  3BG7 A;  2K7L A;  3QAH A;  2L9R A;  3CDI A;  3S1M J;  1O3S A;  5A2Q K;  4LB6 B;  3V8K A;  4ZYG A;  3GZ6 A;  4IHS A;  4WK8 F;  2IP2 A;  4PSW A;  1TWA J;  2YR2 A;  3LQQ A;  2X4H A;  5B1B H;  2NAZ A;  1YRN A;  1MBG A;  2CWE A;  3ABM H;  3H1C A;  3KZY A;  5JHF A;  1IZ1 A;  1OQY A;  1OLT A;  2BBY A;  3FHN A;  2ESH A;  3Q9S A;  3LQR A;  3LAJ A;  1WGX A;  3FDY A;  4MIM A;  1A6Q A;  3OYJ A;  2V9P A;  5M5W J;  3H35 A;  3OIP A;  3VOD A;  3CJT B;  4LK0 F;  3CUO A;  4G9Y A;  4EJV A;  2DW4 A;  3MKL A;  4M73 A;  1OCC H;  2RN7 A;  1PDN C;  1MMA A;  1K78 A;  3I0T A;  3ECH A;  3IUO A;  1ZEL A;  1D5V A;  3A4C A;  3GZN B;  4HV5 A;  3RQI A;  2FA5 A;  2FU4 A;  4E7Z A;  1MDM A;  3WGG A;  1OR7 A;  2MW8 A;  2NVQ J;  2KDO A;  4EV0 A;  1PJR A;  4C3H J;  3WU2 C;  1A35 A;  2CS3 A;  1LKX A;  2WAQ A;  5BMZ A;  4NHJ A;  1YE9 A;  2L2O A;  4HRI A;  4IHV A;  3M3Y J;  2LYC A;  3C7J A;  2BXZ A;  4BDY A;  3CDL A;  1TQM A;  2K02 A;  3FXQ A;  1P2F A;  4YG2 F;  1ETK A;  1XMX A;  1FIA A;  3I59 B;  1TZL A;  3BZK A;  4XON A;  4YRV A;  4FCY A;  5FD5 A;  5IPA A;  2BOL A;  2O8X A;  2GWR A;  3JRA A;  2RQP A;  1T95 A;  2M8E A;  4G7H F;  2H09 A;  2M87 A;  3LSH A;  4B44 A;  2ELH A;  3C3W A;  3L2Q A;  4KIB A;  3AG3 H;  1VQO I;  1OCO H;  2PMU A;  2W4S A;  3VEP A;  2H8R A;  1F9N A;  1W7P B;  3DF8 A;  2HVS A;  2OD5 A;  1B9M A;  3EUA A;  2KIU A;  2X1C A;  3ISP A;  5CKT A;  2R92 J;  4M3B A;  3F23 A;  1KU7 A;  1I6H J;  1R5H A;  3K7A J;  3TKY A;  4IOC F;  3ONQ A;  1EH7 A;  2DDA A;  2Y9Y A;  2MGQ A;  3B73 A;  3DU5 A;  2PLY A;  2F4M B;  3BY6 A;  2NOJ B;  4MQV A;  4L9T A;  2K85 A;  3ZQQ A;  1SFO J;  4NBQ A;  1R5G A;  2D1V A;  2NNY A;  4HF1 A;  3BCA A;  2R5Y B;  1ACI A;  4A3I J;  2E36 A;  2FQ3 A;  3PFI A;  1R7J A;  2XKP A;  1BIB A;  1Z67 A;  2IA2 A;  3K4L A;  3WTX C;  1FZP B;  4XR6 A;  1IXR C;  2EZL A;  4LD5 A;  3RKY A;  1GVD A;  2MSY A;  4ASN A; 
#chains in the Genus database with same CATH homology
 1IG7 A;  1OCT C;  2NOG A;  2P81 A;  4V2F A;  2CRG A;  2D5V A;  4M6V A;  4FE4 A;  2Y30 A;  4M3F A;  2LTP A;  3BG3 A;  4UUT A;  4A3J J;  1VFC A;  1B8I A;  1NK3 P;  1TWC J;  4J19 A;  2DA6 A;  2M9H A;  1APL C;  3F0C A;  2YU9 J;  1ITY A;  4ABZ A;  4XIC A;  2FQ4 A;  2G0E A;  5EF6 A;  2HQ5 A;  3MN2 A;  4A3F J;  2COB A;  1BA5 A;  4UUS A;  2ECB A;  4W97 A;  4W1U A;  3HOV J;  2AHQ A;  1LFU P;  2LY9 A;  1HCR A;  3ZOB A;  3GTO J;  5EDN A;  4S0H B;  2LKX A;  2M2E A;  5FKO A;  1JKQ C;  1JKR C;  3BR6 A;  1QVT A;  2EQR A;  2M8G X;  2EBI A;  3JRC A;  1A6I A;  3HBL A;  2DMN A;  3RKQ A;  5FLM J;  4A3C J;  3FK7 A;  2DMP A;  2XGC A;  2HXO A;  3CCY A;  3I4N J;  2CQX A;  4C3I J;  3RZD J;  1ZR2 A;  3BR5 A;  3S2D J;  1ZR4 A;  3SJM A;  2IEK A;  4D5C A;  5EG0 B;  2GM4 A;  4NDL A;  2QF7 A;  2EH3 A;  1XS9 A;  1F36 A;  1U78 A;  2R7Z J;  2VKV A;  4D7N A;  2M0C A;  1G2H A;  1PUF B;  1IGN A;  4BKX A;  2ID6 A;  4MFD A;  5FKM A;  2ME6 A;  1RPW A;  2CUE A;  2ME0 A;  2HYJ A;  1FIP A;  3S1Q J;  2LVS A;  3OSG A;  1GV2 A;  3S2H J;  1VND A;  4A3M J;  1AHD P;  3JRF A;  2JA5 J;  3QQA A;  1UHS A;  4XRS A;  2H1K A;  1GV5 A;  3Q3S A;  1DU6 A;  1FTZ A;  1IJW C;  3LSR A;  9ANT A;  2OF7 A;  1W0U A;  1BW5 A;  3LSP A;  5F04 A;  1ETY A;  3G1O A;  3PO2 J;  5EGO A;  3JRI A;  1JUP A;  5DS9 A;  5J1U A;  2EZH A;  4DYC A;  1ZQ3 P;  2DJN A;  2LLK A;  3S16 J;  1U9N A;  3HEF A;  3BQZ A;  1BW6 A;  5M3F J;  4XRM A;  3I4M J;  2O7O A;  1ZTR A;  4MLO A;  2CUF A;  1GDT A;  2DMT A;  4G12 A;  1D5Y A;  1MH4 A;  2HDD A;  2WB1 N;  3JRE A;  3QPL A;  3OIO A;  3LNQ A;  4M3G A;  1Y1W J;  1XC5 A;  1JUM A;  2CU7 A;  2DA5 A;  2IBD A;  2GLO A;  2Y31 A;  2DA2 A;  2NVY J;  3BR0 A;  5C44 J;  5GP9 A;  2XSD C;  4DZJ A;  3S14 J;  1TWG J;  4BBS J;  3OOU A;  1JGG A;  1JUS A;  3E7L A;  4HNV A;  5J1R A;  1LE8 A;  3DEW A;  3HGY A;  3NAR A;  1EF4 A;  4MFE A;  5IOZ A;  1UG2 A;  3IV5 A;  3UKG A;  3BG9 A;  5K7H A;  4CYC B;  1ETO A;  3FIS A;  1MBE A;  1VF9 A;  1BL0 A;  4IHX A;  2DN0 A;  1OCP A;  3G1L A;  5F1J A;  2YUS A;  2RAE A;  2XPV A;  2FD5 A;  1RES A;  1BJZ A;  1X58 A;  2Y0S N;  3ZQL A;  1U8B A;  1JJ6 C;  3G1M A;  1CQT A;  1H8A C;  1WI3 A;  2E2I J;  2JA6 J;  5IOY A;  2DA7 A;  1GUU A;  3JRG A;  4A3L J;  3TP3 A;  2DA4 A;  2R93 J;  5C3E J;  1R9T J;  2PMZ N;  1ETW A;  1ETX A;  1GVD A;  3TP0 A;  5M3M J;  4M3D A;  3JR9 A;  4JP0 A;  2ZB9 A;  5F08 A;  5IYB J;  3TW7 A;  2XPW A;  4JX4 A;  3LSJ A;  4FIS A;  5IYC J;  3HGG A;  3GTM J;  2LD5 A;  1ETQ A;  4EEF G;  4AYB N;  3Q0V A;  1AU7 A;  3A01 A;  3BTC A;  4DW6 A;  4A3G J;  1I3Q J;  2EZI A;  3CQZ J;  1JTX A;  2XRL A;  3LOC A;  2L7Z A;  5JLX A;  4DYQ A;  1JTY A;  2R5Z A;  4IHY A;  3MVP A;  3HOU J;  3BTI A;  3HOY J;  1MBH A;  2I10 A;  4DYR A;  3GTL J;  3VPR A;  2VI6 A;  2R0Q C;  5EZH A;  1OJL A;  5GPC A;  2MG4 A;  2WAQ N;  1LE8 B;  2JMW A;  5M5Y J;  3GBG A;  1F43 A;  1IDY A;  4BY7 J;  2NS8 A;  1B72 B;  4I6Z A;  1IC8 A;  4D5F A;  3PO3 J;  3IH4 A;  5IP6 A;  4A93 J;  3NAU A;  1JT6 A;  1TWF J;  4BXX J;  2TRT A;  2LFB A;  3Q0U A;  3JRB A;  2NVT J;  3Q0W A;  1MSE C;  1ENH A;  1QPI A;  2XB0 X;  2XB5 A;  5K7F A;  2K9S A;  1B8I B;  1RET A;  2DA3 A;  5BNG A;  1H89 C;  2JA7 J;  3GTK J;  3BTL A;  4QIW N;  1WCM J;  2X9D A;  4A69 C;  4XRS G;  3HOW J;  2NS7 A;  3HOZ J;  3O8H A;  2FJ1 A;  3D1N I;  1K61 A;  2AO9 A;  1AKH A;  1T33 A;  4UUS B;  4X1E A;  5DTD A;  1E3O C;  1ZKG A;  4B4C A;  2CJJ A;  1A5J A;  2ECC A;  2E19 A;  2XGD A;  2YS9 A;  4Y52 J;  2LP0 A;  5J1Y A;  3S17 J;  1MBJ A;  3BR2 A;  1TC3 C;  4FTH A;  2M34 A;  1IV6 A;  5HOD A;  1VI0 A;  4X6A J;  3ZQH A;  1QVU A;  3TW6 A;  3BR1 A;  4JYK A;  2R5Z B;  1HF0 A;  1Y1V J;  1K83 J;  1IUF A;  4C3J J;  5EEA A;  4AC0 A;  2K9Q A;  1RR7 A;  5E3N A;  2ELK A;  3W6V A;  5C4X J;  3PM1 A;  1UMQ A;  1ZGW A;  3L1P A;  1W0T A;  1X2M A;  3JRH A;  5EZG A;  1XG1 A;  2L7F P;  2E1O A;  3FK6 A;  5F0H A;  5F0F A;  3QPS A;  3H0G J;  3BTJ A;  5EYR A;  3A02 A;  1ETV A;  4LOC A;  3LSG A;  4DZP A;  4A3D J;  1JT0 A;  3BR3 A;  4RDU A;  1RKT A;  2QCO A;  1FTT A;  2Y9Z A;  5FKK A;  1T56 A;  2L0K A;  4IHW A;  2JK3 A;  3HOX J;  1MNM C;  2N8G A;  4FE7 A;  3M4O J;  1TWH J;  3ZQC A;  2JA8 J;  2K9N A;  5F0C A;  4MO7 A;  5EGO B;  3S1R J;  3GTJ J;  1U9O A;  5FJ8 J;  1MBF A;  1Q1V A;  1S7E A;  1X2N A;  4JX6 A;  1WPK A;  1RKW A;  1WH5 A;  5J3L A;  2CQQ A;  2LK2 A;  2HXI A;  2WV1 A;  2NVX J;  4QTR A;  2JWT A;  3OSF A;  5C4J J;  2GBY A;  1LFB A;  1NK2 P;  2K40 A;  3GTP J;  3A03 A;  4I76 A;  1HDP A;  3ZQF A;  3GTG J;  2DMQ A;  3S15 J;  1P7I A;  1IDZ A;  3ZQG A;  2X6O A;  1JJ8 C;  1SAN A;  3HM5 A;  4Y7N J;  4D7M A;  4XID A;  2EZK A;  5GPA A;  2JN6 A;  5F27 A;  2OPT A;  2VPR A;  5IP9 J;  3DCF A;  1JKO C;  3IH3 A;  4RBO A;  2L9R A;  3S1M J;  3FKI J;  5M5X J;  5FLV A;  1MSF C;  2XGE A;  3BG5 A;  4L5E A;  1TWA J;  4IEJ A;  4XK4 A;  3SFI A;  1YRN A;  4C2M J;  3SDG A;  1MBG A;  2B63 J;  2LR8 A;  1HOM A;  4B1R A;  3B6A A;  5FKN A;  2TCT A;  3O8G A;  1HLV A;  3BQY A;  1JKP C;  2XPU A;  1GT0 C;  2HOS A;  3ZQI A;  1WGX A;  4MIM A;  2FX0 A;  5M5W J;  3WHB A;  4QSH A;  5E3M A;  3K2A A;  3RZO J;  4BY1 J;  1MH3 A;  3HKZ N;  3MKL A;  3FIW A;  5IYD J;  1FJL A;  3H3V K;  3RQI A;  1I50 J;  2R5Y A;  2DTZ A;  5FKL A;  2MW8 A;  1QRY A;  2NVQ J;  4C3H J;  5IP7 J;  3A01 B;  3TED A;  5K7Z A;  2KDZ A;  4CYC A;  3M3Y J;  4IHV A;  1H88 C;  3CDL A;  1POG A;  1ZK8 A;  1ETK A;  3HB9 A;  1ORK A;  3C2B A;  2DMU A;  3CMY A;  1FIA A;  1FEX A;  4FCY A;  2W48 A;  2KT0 A;  5IPA A;  2DA1 A;  5E3L A;  2JJ7 A;  3JRA A;  1Z0X A;  3BT9 A;  1OFC X;  2L7M P;  1YRN B;  4A3B J;  4BBR J;  1MBK A;  4V2G A;  2H8R A;  3S1N J;  3JRD A;  4JX5 A;  1DU0 A;  2HOT A;  2VUM J;  2VKE A;  2O9L A;  1IRZ A;  4A3E J;  2R92 J;  4M3B A;  1P7J A;  2HOA A;  2ID3 A;  1I6H J;  3K7A J;  2E2H J;  3WHC A;  3HDD A;  2Y9Y A;  2HI3 A;  2MGQ A;  1AKH B;  2O8K A;  5E3O A;  5EG0 A;  4B3A A;  4A3K J;  5JLW A;  1SFO J;  2X48 A;  2IAI A;  2R5Y B;  2Y2Z A;  4AUX A;  4A3I J;  4GFB A;  3B6C A;  2E2J J;  1O4X A;  4M3E A;  1PUF A;  3GTQ J;  1NTC A;  1Z77 A;  2EZL A;  1B72 A;  1WH7 A;  3IH2 A;  2MSY A;  1HDD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...