1WJAA

Solution structure of the n-terminal zn binding domain of hiv-1 integrase (d form), nmr, regularized mean structure
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal zinc binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Zn-binding protein
molecule keywords HIV-1 INTEGRASE
total genus 10
structure length 47
sequence length 47
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjaA00
1WJDA 1WJAA 3F9KA 3HPHA 1WJFA 1WJEA 3HPGA 4F3QA 1K6YA 1E0EA 1WJBA 1MW7A 1WJCA 1KONA 1LFPA
chains in the Genus database with same CATH superfamily
3MWMA 1ONVA 2ZJ2A 4EJVA 1G3WA 3K69A 3RKWA 1MJBA 2CMPA 4JX4A 1WPKA 1D0YA 2KRFA 4XBFA 3CCJI 3A01B 5GAHJ 2V9VA 2AXTC 3LFUA 1I50J 1Y6IA 1RETA 3FF5A 3MFKA 2XC7A 1HBXG 1FT9A 5FKMA 4Q48A 3IP4B 2P7CB 4EV0A 3EQLF 1J7KA 2L9RA 3RQIA 2MD0A 2L54A 3FWEA 3FZVA 4E4HA 2CQXA 1XMAA 2H8RA 2IRFG 1ZR2A 4C2UA 4O5VA 4Z6YA 4XRFA 1MMGA 4XK4A 4DJAA 1FSEA 2VI6A 3J80K 3BR6A 4ENMA 4BHBA 2QLZA 3SZPA 3FK7A 4F92B 3MCZA 1U6GA 3V8LA 2NVTJ 5B3SH 2XAFA 4EGYA 1WJEA 1JE8A 3AG4H 5J40A 2VKVA 2HQRA 4L5EA 4L5JA 4HBLA 4ESBA 1HC8A 2VBZA 2KZVA 1E3HA 2FNPA 3G2BA 3Q0WA 4U88A 2RDPA 3HOUJ 5DYMA 3LA7A 4E7SA 5BNGA 2MD5A 5D5UB 4ZYEA 3HZJA 3CP2A 3R0AA 4RB2C 2ZNZA 1LE8A 4CCJA 1MJ9A 3IC7A 5EEGA 3GTGJ 1ETQA 4ZZLA 1W36D 1SFKA 1R5GA 2MLGA 1HXDA 4UHTA 2FUG2 4RB1A 1P92A 3FBIB 1JUSA 2VQCA 2M4KA 2P5VA 2Q2EA 3BTJA 1J75A 2R7QA 2IGNA 3GZNB 3L2CA 1RI7A 2PX9A 4UXNA 1A6IA 2GXGA 1YIOA 1SAUA 3D5RC 5CVRA 4CCOA 5M5YJ 1S6LA 2BBYA 4LB5A 3J81K 2KDZA 1IGNA 2HU9A 1O3SA 3B6AA 4G6TB 1Z3XA 1X1BA 2DU9A 5F0HA 3KP4A 5EEAA 1G3YA 4N0BA 3G4SI 4YG2F 4IRIA 2R93J 5KCMA 2NVQJ 1G3TA 5KHDA 4IHSA 3I64A 4C3HJ 1WQ2A 3LA2A 1FSHA 4S04A 2CUZA 1AOYA 3JRDA 2IPQX 4Q4ZF 5IYCJ 1T8IA 1N77A 5GTIC 4I76A 2DT5A 4MFDA 1KU3A 4A0ZA 3ROUA 3BC8A 4G9YA 2XRNA 3W6VA 2MBFA 1E17A 4P9FA 3H35A 2V1XA 3HKZN 5HS8A 2JUCA 3CMAI 4JBAA 4OMYA 3GO5A 4HX4A 3RCOA 2L0KA 1HQCA 3FMSA 2HQAA 4EGZA 1VQ4I 4ZYHA 1U2WA 4M9ZA 2HTSA 2DT6A 2V4JC 2PMZN 1OCZH 4CDGA 1V55H 2QQBA 2CJJA 2ESHA 3ZN1A 4GYGA 3ISPA 1ZTRA 2H8WA 1YTYA 3VYRB 5EZHA 1DP7P 3BZKA 5B66C 3JRAA 3C2HA 1U5TA 3R4KA 1PDNC 3B6CA 1FZPB 2DFHA 3G1OA 2GOMA 2ECBA 3S3NA 6PAXA 1WJAA 2HQ5A 2XIGA 1TNTA 5HLGA 2R7SA 2DYRH 3K4KA 5D4SA 2DXIA 1BR2A 5J3LA 3P9KA 4DGWB 2X6OA 5LGUA 3WTYC 3X2QH 5E1ZB 2HKOA 3GX4X 4Q5SF 3DEWA 2KKOA 2CSOA 1VI0A 3GBGA 5FKKA 2XGDA 4IHTA 2CO5A 2NNNA 1ACIA 5LRSA 2H6BA 5LHHA 5EG0B 3GLXA 4FISA 3QRFF 4XR6A 2IJLA 5J1UA 3LSJA 4FX0A 3S2HJ 3Q3SA 3F21A 5KK1A 1W0TA 1JUMA 1BOBA 4PGHA 4KN7X 2E60A 1IW7F 2E5NA 2R92J 4IO9F 4RAYA 3IUOA 5IT3A 3GUDA 5GTHC 1X4OA 4EJTA 3JCUC 2DJNA 1Z21A 3H36A 3RJPA 1MDMB 2WB1N 1KU7A 4WCGA 4RAFA 3BG9A 4P5OA 1GHCA 3JRCA 2K02A 2L2OA 2WAQN 1R00A 2RVCA 5FO5A 4EJWA 1HCRA 4IXAA 1MMSA 2CW0F 5ED4A 2O0YA 1NTCA 3OYEA 4B8XA 2GA1A 4WXDA 2VASA 1YIJI 2I8DA 1QQIA 1R22A 4LJZF 1CF7B 1ETWA 2K4BA 5EYRA 2LMDA 2COBA 5LRRA 1P4AA 3FXQA 3PSIA 1TWAJ 2DTRA 3BG5A 5E17F 2JA5J 2EV6A 2JT1A 5IOZA 4G7ZF 5GP9A 3M8EA 4IHXA 1QO0D 3UNGC 1R36A 1UJ8A 1BA5A 1PUFB 3BLYA 1XPXA 1ENHA 4V19K 1ZRCA 2ZJQF 3ABTA 1VQPI 3RKXA 3QQAA 1ZLJA 2BHZA 1I3AA 3BPVA 3ZN0A 2L9NA 5LHGA 2RGVA 3VYSB 1EH6A 5GPCA 3J7YJ 4BHPA 5C4XJ 1MH3A 2JZYA 4ENKA 2LTPA 1NG6A 2MG4A 2VODA 5GAGJ 5F0FA 2XAQA 1Z67A 3OY9A 1KONA 3BG3A 2X1EA 2M3AA 2YX4A 5D4RA 4XMYA 3WTUC 3HRMA 4L0YB 2B0LA 4YIRX 4LFUA 3OS0A 2Y9ZA 5K7FA 4I98B 3FX3A 4PJNA 1AWCA 5D6FA 3U1DA 4R79A 3NARA 2OTJI 3SZTA 4IOCF 3IH4A 1J5YA 1XSVA 3GVAA 3OYFA 4I2OA 2BGCA 1ZAOA 4BUPA 1L0OC 5FLXZ 3OYBA 3A0BC 2P5KA 2IAIA 2A6EF 2DO7A 1YJNI 1TL8A 3KZIC 3TDZC 3WODF 5DD4A 5E79C 4N9HA 3ZCOA 4NUBA 2LP0A 3SXYA 1D1BA 4H0EA 3DTKA 2W4SA 4JK1X 4QLCU 2EFPA 2EIMH 3B02A 1Z7UA 3OYNA 1PP8F 2E71A 2WAFA 1SFOJ 4MGRA 2LD5A 2PI0A 1GVJA 2M8GX 2CS3A 4XORA 3DPUA 1XG1A 2ZJPF 5KAFC 3WTSC 2M0CA 1OCRH 3HRTA 1OMIA 1BI1A 3CDLA 1K7AA 2GM4A 3GF2A 1X1PA 1K78B 2DMNA 3ZQQA 2FMLA 1ULYA 2Y0SN 1USSA 1VFCA 2G9WA 3S3OA 4LK1F 2IS1A 2OF7A 3SJMA 3BCAA 2E7XA 1O7FA 1OPCA 2RV8A 4FCYA 1JKQC 2DI3A 3F8MA 3JAMK 2XRLA 5LLQA 1I27A 4I01A 1HA8A 1QA6A 1JHFA 2IA2A 2A05A 1MDMA 3J7AY 4IQJA 3E6BA 2R7WA 3IH3A 1JTYA 1X2MA 1Y1WJ 1FMWA 5FROA 5GAEJ 2WA0A 3ECOA 4KICA 3CMYA 3P9CA 2VN2A 4Y4RA 4RGSA 4A3BJ 2LFBA 3TMOA 2Q0OA 2NVUB 3ZMDA 5JLWA 1USTA 3CD6I 4GCVA 3KZZA 1AKHB 5CYVA 4M3GA 1UAAA 3FKIJ 3GTPJ 3G1LA 1I1SA 3TQNA 5B1AH 1NK3P 4Y13A 4CCMA 1OCTC 1XCVA 1D1CA 1XMXA 3LAPA 3K7AJ 3L2RA 1U5TB 1WCMJ 2DA3A 3GZ5A 3R60A 1RPWA 1RC9A 1ON2A 2DMTA 2H6CA 3KEOA 4C30A 2E1OA 1FIPA 1KYWA 2GWRA 2V6CA 3O2PE 3CCVI 3W2VA 3HOTA 4OIOF 2UWMA 2O61A 2XDVA 3HHGA 2Z99A 4WXCA 2X6WA 1S3JA 2VQGA 5K7ZA 1N25A 1JKRC 3H5AA 5F1JA 2LG4A 4DZPA 4FE7A 2EINH 2DPUA 2BYVE 2M4GA 4GFBA 1MBEA 5LGTA 3CCYA 2HI3A 4NC8A 3PFYA 2L5QA 3TBIA 4MFEA 1R9TJ 2KHMA 2ELJA 1MZBA 1YLFA 2FXAA 2G7UA 3M1EA 3QOPA 4BDYA 1RRJA 5H6QA 2XAJA 1HDPA 5CVIA 3RKQA 2FOWA 4WK8F 3PO2J 3F22A 2VKEA 3AG3H 2CW7A 1S29A 4ZTFA 4MEXF 2VKHA 3MVPA 4CH7A 3OYIA 1Y8RB 3TKYA 1P6RA 2J5PA 2ZB9A 4C9YA 4I02A 1HF0A 2KRCA 1FPQA 1RKTA 2PQ8A 2WC2A 1HOMA 2ACJA 3WGGA 1IDYA 1LQ1A 1R49A 1X1CA 4Y7NJ 3IKTA 2HPMA 4Z2YA 2BVMA 3BZCA 2VJ5A 2VKDA 3DLLF 5L3FA 2XF5A 4QIWN 3MZ8A 3K1MA 5JI6A 1FLIA 1W5TA 4LIVA 4LG0B 2R4GA 4WWCA 5CJ9A 4N9IA 2L02A 3EUHA 3BY6A 2D1HA 1I6XA 2WAEA 1R1VA 4ON0A 1BR4A 2MABA 3EPZA 2K5CA 2ZMEC 3C7JA 4RAGA 3LQRA 4YELA 2H1LA 4YRVA 1OYIA 3TW7A 5IYBJ 2VE8A 1GXPA 1TT5B 5H20A 1PUFA 1LDDA 2L9SA 4MQ9F 2DJIA 1S8NA 2CG4A 2DTZA 4HV6A 3VFZA 5DUKA 4XRSA 4HQMA 3G71I 1TZLA 3HRSA 3I56I 3JRFA 3DKYA 4BEHB 1HW5A 3VYUB 2H09A 1BIBA 3HM5A 3LSKA 3CJQB 2NVXJ 1ERDA 2GA2A 2KRHA 2BY0A 2H94A 3IHUA 3RSNA 3WE3A 2QSGX 1W7PD 4NQWB 1WSUA 3H1CA 3JREA 4M3EA 1OLTA 5FKLA 1FYMA 3BJ6A 4B44A 1Z05A 3CCSI 2OA4A 5FKNA 5EGOB 1QZEA 4KYWA 1IG7A 4BJTA 2LDUA 1GVDA 3I59A 2A6TA 3WTTC 2IEKA 3PSFA 4G12A 1LKXA 5KNLA 4KA4A 3A03A 4BXUA 2VOOA 2FNAA 3ZQFA 2EIKH 1FBUA 3HOXJ 1O3RA 5IYDJ 2P5LC 3U21A 3BJAA 2JPCA 4L9NA 2V7FA 3CCUI 3LMMA 3CF2A 4CO8A 1ZYRF 2OQGA 4BJ5C 1BW6A 2ISYA 3D5LA 4MEYF 4ZDLA 3K70C 1XS9A 3JTGA 2H1KA 1XN7A 4LLNA 2ELHA 1XD7A 3SYTA 3OYHA 2DODA 2FQ3A 1UZCA 5L3CA 2A68F 3IRRA 3K1PA 4LOCA 1Z0XA 2UV1A 4RGRA 3OSFA 3BR5A 4PFPA 3VSKA 1OKRA 3HUGA 4BE0A 9ANTA 1TWHJ 3OYJA 1J0RA 2DOAA 2ZMEB 3I4NJ 1ZH5A 5IT9K 1O57A 3T1BA 2BY3A 1XSXA 3MKZA 3I55I 2L7FP 2CRGA 1BI3A 1I39A 5IPAA 4XLFA 3VOEA 2MSYA 3KYDB 1R71A 2CFOA 4NB5A 3DV8A 1S5LC 3FISA 4WXHA 5DM7F 1JJ8C 1G4DA 1R4NB 2LF8A 1IRGA 2PEXA 2VLAA 4G7OF 2L7KA 3O6BB 1RIOH 1EA3A 1MMAA 2ISZA 2CQQA 1UFMA 2QCOA 4B3XA 2E19A 2VPRA 2K85A 2VBYA 4ESFA 2R7XA 4NC7A 3PIPF 1HW1A 3L1PA 3OIPA 3ZQCA 3CLOA 3GWZA 3H9JA 3E5QA 4M9SA 5JHFA 4YEJA 1VQ7I 2HKXA 3FXJA 4ZYAA 2BW3A 5HLTA 3CC2I 2BXYA 1MBJA 2Z33A 1YW9A 3KP5A 1GUUA 5IP7J 3EETA 1IN6A 4BU2A 1VQOI 1R58A 3WHBA 4XQFA 3HHHA 4RGXA 2R5ZB 3A0HC 1WGXA 4DYRA 1SD6A 2I5UA 3ECHA 1XDUA 1D0XA 2Z16A 4FHTA 1BN5A 2AHQA 2JJ7A 3Q0VA 4RLFA 4UB8C 1H0MA 2JSPA 3BP8A 4XN3A 1TQPA 2Z2SB 1O4XA 2YX7A 2QSFX 1W1WE 5HDNA 4CYCB 1SANA 1LUJB 3BROA 1IN5A 2XASA 4L9VA 3TO6A 1VQ8I 1ITYA 4BQNA 2P6SA 2A6HF 4G7HF 3H3VK 2ME6A 4RBOA 3COAC 3KEYA 2F6CA 1LJ9A 2XPVA 2KP6A 2Q8KA 3BG7A 3Q9SA 4M3DA 4AIJA 2EV5A 1K61A 3JAMZ 1QNTA 4NDLA 1UB9A 3U1KA 4XM3A 1IF1A 4YIIA 1T39A 3K4BA 5FRMA 3GTLJ 1WJCA 2IS6A 1E3PA 1MBKA 2ZXWH 4AD9A 2VJIA 4J19A 1BR1A 2KJCA 4XLCA 3TO9A 2XSJC 4PCQA 1Y56A 4LLLA 2LY1A 2PFBA 4ZYDA 1ETXA 2EFWA 2WADA 2ZBKA 4HSTA 4HLYA 3S1NJ 1EH7A 3EUAA 3HXLA 1B8IA 3FXLA 3KEQA 3RI4A 4ZTJA 2NAZA 1YRNA 3V7RA 3WTXC 1YS7A 1YX3A 3HSEA 1V54H 3OOUA 4BL0B 4WF2A 2O7OA 1BOAA 5HS9A 4K2EA 2F4OB 5E8GA 3HOWJ 1BI0A 2FRHA 1FOXA 1OCCH 5DCMA 3PQJA 3OYLA 3E7LA 4XNFA 3BR1A 4A3KJ 3T8TA 4HOBA 2QEXI 2CQ7A 2E1MC 3K4JA 5F0CA 2R7ZJ 3IWFA 1ON1A 3NWTA 4ZYGA 3V7SA 1X1AA 4B47A 3HGYA 5EF6A 2BZTA 2EFQA 2KIQA 4N4NB 4OMZA 5CQGA 3W6JB 5GADJ 5E3LA 3V42A 3HOSA 1L3LA 3RPQA 1WHUA 3A4CA 4JP0A 2QA4I 2CGPA 2E1NA 2OAZA 2YU3A 3H92A 3OYDA 1DGWY 4IJAA 4Y33A 1QVUA 3CQZJ 5L3GA 3P9IA 2HVQA 4LGWA 4IOAF 2E7WA 5A2QK 1IRFA 1YQAA 3EYIA 5CVVA 3H3ZA 4BJ6C 4CCLA 2JWTA 3ABUA 3GTQJ 5ICGA 3LSRA 5H6RA 2KMUA 1VNDA 5D5XB 3TP0A 3PNYA 4H4KC 5J6XA 3HOZJ 3OS2A 1R23A 1IZ1A 3ESWB 2DA4A 2G7HA 2A07F 2VC1A 4L18B 3RZOJ 4FX4A 1YFHA 3R61A 1MGTA 1RNLA 2VONA 1V5GA 2W00A 3UKGA 4OIQF 3I71A 4AIDA 2FBKA 2R7FA 4X6AJ 2EFNA 4EEFG 3S32A 2R5YA 4XRSG 5GPAA 2KLOA 2EA2A 4XLNF 5DTDA 3RTRA 3JRHA 3IAS2 5HLHA 1KQ8A 1IO2A 4FETA 2O9LA 2CWEA 2LY9A 2DA2A 1F5TA 1KZHA 2R7RA 1MBFA 2HOAA 3BQZA 3ZQ7A 1HKSA 1JGSA 4U7DA 3KFWX 4UV8A 2DDAA 2KDOA 1QZZA 1STZA 2K9QA 2ZFUA 2VBWA 3QPHA 4QPOA 4ZZDA 2EH3A 1H89C 1G6NA 2GXBA 3NEUA 2QGUA 3DP7A 1VQ6I 1B9MA 2X0LA 2RQQA 4OAYA 5C44J 3W3CA 3N05A 2PJPA 1DP3A 1GV2A 5CPRB 1IV6A 5F04A 1T0FC 2DA7A 5JLXA 4CYCA 1NK2P 4IKFA 4B3AA 1VZ0A 2LOOA 3GTKJ 3Q0UA 3H0DA 4AVZA 1FYLA 3CTAA 2F5FA 1EKEA 1W5CC 2Q2EB 3BR0A 4HSRA 4XOTA 4XOPA 1G8XA 2HPIA 4LITA 3CO7C 3HUGB 2XAGA 2WAQA 1I5ZA 2R7VA 3ZQLA 4KITB 1T38A 2LVSA 4M71A 1K4TA 5J8FA 3CMEI 2MW8A 1BI2A 2ZO4A 2F4MB 2VJ4A 5J1YA 3I3LA 3M8JA 2IXSA 1H88C 1PVEA 2AXLA 2NOGA 5FFXA 3HYIA 3FM3A 4XSZF 2P6TA 2LR8A 2EZIA 3LFKA 3FKJA 4XKBA 3WGHA 1WVRA 3K4CA 4IF4A 1GT0C 1YRNB 2UZKA 1P7JA 2W57A 1WJBA 2BXZA 2MC3A 1GXQA 2CV1A 4BY1J 3HG9A 1SAXA 4ZH4F 4ASNA 4Y52J 2WY8Q 3L9FA 1MKMA 1T0FA 2NS8A 2ZNYA 2E5ZA 2M7AA 2KZGA 4XLAA 3F8FA 3M3YJ 1JJ6C 1N78A 1Z6TA 4F93B 1SVMA 1X3WB 3ZR8X 4F55A 1XTAA 2DT7B 5IP9J 4LG0A 1QPMA 4G8XA 3WHCA 4BXXJ 3OYGA 4DYQA 2K27A 5CQEA 4LG3A 2P81A 3CCQI 2R7UA 4R8HA 5M5WJ 3F72A 4DZJA 4KDPA 2HYFA 4CYDA 3E5XA 2Y75A 2DAOA 3L2UA 2QF7A 2VQHA 4E7HA 1ZGJA 4M73A 3ZMZA 2RNGA 4IZZA 2B9SA 2MYSA 1Z1DA 3FXRA 1I1GA 5B1BH 1XB4A 2OCCH 2QZ8A 3WTZA 4HRIA 4A3FJ 2KJBA 1MSFC 2CUFA 4BEHA 2E35A 4M3FA 1MSEC 3E6MA 1F9NA 4D7NA 1VQKI 3W6KB 5HNHA 1TWCJ 2EIJH 1WI9A 3K9TA 3F0CA 4KIGA 3HL2A 3PNVA 2WY7Q 1JT6A 3VEPA 2CW8A 4RM2A 2STTA 3PL8A 1RESA 1ZG5A 5LEJA 1W7PA 3JRBA 3M07A 4YFNF 5JVTA 3HGGA 3HEFA 3BPXA 4CCNA 4L5IA 2Y69H 4I0BA 3S8PA 2CQNA 2HDDA 1T6SA 4RS8A 5IT9Z 1VQMI 2BY2A 1H9TA 1QHGA 1YI2I 4BYYA 1AU7A 3I9V2 1X3UA 2X1DA 4UVAA 2E1MB 3QAHA 2COMA 2LBFA 5JR3A 2A3SA 1AHDP 1WH7A 4II2A 1FY7A 4D9JA 4KFCA 1Y0UA 3BR2A 4A12A 2QKMB 1BC7C 2EPFA 2PLYA 5C3EJ 4D5FA 2K86A 4XIDA 1A31A 3OYKA 2HEOA 4HNVA 3ZMSA 2E2JJ 4FTHA 2XKPA 4M74A 4XL9A 2DPDA 2OZUA 3ZOBA 4C2TA 3FXMA 3CC7I 3KX2A 1S9HA 4U87A 2QENA 1EJ9A 1FBQA 2M7BA 4ZJZA 4HQEA 4B48A 2FJ1A 2KQRA 2B63J 3LSHA 4UVBA 1O3TA 3LWFA 2RKHA 3S3MA 3WU0A 4EMSA 1BM9A 2HXIA 1ZR4A 5DDGA 2XKOA 1ETYA 1MBHA 1YG2A 2XF7A 2QM3A 3DPTA 4IQ4A 1V5EA 2GAUA 3ZMVA 2JA2A 4XICA 3J80Z 2LREA 1N75A 1R1UA 4UUSB 2N8GA 2DK5A 2A5YB 3MAJA 3DCFA 2HQNA 4P1WA 1FP2A 3SHFA 4IRGA 4XONA 3PM1A 3E3VA 3WU2C 2FQ4A 5D5WB 1LDJA 3K70D 3QU3A 3KYCB 4G6QA 3Q9VA 1T95A 5AIPA 1XSDA 1CGPA 5LD2C 1QVTA 3KE2A 4KIFA 4A6DA 2QVOA 2ZXHA 3MQ0A 4HW0A 2QUFA 3PO3J 1D0ZA 4M3BA 1E3OC 4CZCA 1IXCA 1MD0A 5DD8A 5KVRA 1X2NA 1TW3A 4U0WA 2LBFB 4L0ZB 4RB3C 3WE2A 2X85A 3DEUA 2STWA 5DS9A 3ABMH 1TWGJ 2HDWA 2HYGD 5IOYA 1ZLKA 2QBYA 3HJEA 3V8JA 2X51A 2QBYB 2LK2A 2K9SA 3S1MJ 4KMFA 2QWWA 2K7LA 3M9AA 1DPRA 2ZMEA 4BH9A 4GRIA 4EM0B 2XF6A 4KJZA 4LD5A 3T5XA 1S7AA 4HDUA 1XGSA 3M7GA 2Y48A 3BWGA 3S1QJ 3IWZA 3ERMA 4DBQA 4AU7A 2L3DA 3C2GA 3D5SC 3TGNA 2I10A 3SEZA 4DBRA 4BHCA 1XGNA 4LIUA 3OR2C 4G94A 3F8NA 1A36A 2QQAA 1YS6A 3GTMJ 1FBSA 2FOKA 5B5EC 2K9NA 2DFIA 4GGGA 3V4GA 4BE2A 4HF2A 2VPLA 1BJAA 3FXUA 5K7HA 4RMNA 4HF1A 3T8RA 2NS0A 2WWYA 5C4JJ 3VODA 3ULQB 2JMWA 5LBQA 1K83J 3U9GA 2E2IJ 2DW4A 3F8BA 4HG2A 5CVJA 3ZMTA 1MIJA 2BW3B 4HZFA 4UV9A 3C18A 2WV1A 2FX0A 4A93J 2M87A 1HW2A 4RA2A 2O03A 3NRVA 2NRAC 3DKWA 1ZRDA 3N97A 4Y3OA 2DMQA 1FC3A 1SD7A 3CO6C 4HF0A 4L9TA 3DWLE 2D1VA 2GIVA 1BL0A 2QQ8A 4F52A 2D5VA 3TO7A 3EYYA 2DFFA 3CDIA 3CP8A 3QODA 1KGSA 4A5MA 4BE1A 2XPWA 1YYVA 4PJ0C 5ERIA 3A2KA 2KIUA 4B4CA 5L3EA 1IUFA 4U0VA 2DBBA 3UR3C 3ZP5A 3WU1B 3QYFA 2W48A 4A69C 3G73A 5D6EA 1T98A 3QU6A 3TEDA 4IHYA 1P4XA 2Z3YA 5FJ8J 3I0TA 2TCTA 3GMEA 4PUSA 3OR1C 1WRJA 3HOYJ 2BOLA 2ICWG 2L7MP 2HOTA 2Y0SA 2ECCA 5FLMJ 4BQAA 2R7OA 4JX6A 1EF4A 1JKPC 1HDDC 4LMYA 5KAIC 3F9KA 2XPUA 2GBYA 5JFRA 2YS9A 2VXZA 4PK4A 1D5VA 4E6KG 2HYJA 4YFXF 2XAHA 3DPLC 1R7JA 1ZQ3P 1FTZA 4LK0F 5H2FC 3R6SA 5D8LB 2F48A 1RKWA 2BY1A 4OAZA 2PJRB 1POGA 3GZ6A 3OS1A 4Q47A 1B8IB 3QP6A 3BQYA 3DBRB 4RLQA 3S17J 2CV0A 2ZFWA 3I59B 4XLPF 3CF5F 3GXOA 2HR3A 4AVPA 4UNOA 3SFZA 3S2DJ 1NHAA 5LGNA 2JK3A 2GZWA 5LHIA 2BV6A 2BHYA 2WV0A 2XGCA 4CZZA 2M0MA 2XUBA 1B9NA 1R5ID 4JYKA 5DCMB 1OQYA 2QKLB 2ZSHB 3OL4A 2JRTA 1LDKB 2EJRA 3LA3A 4GXOA 1SD4A 3W2AA 3FBNB 5DV5A 3E6CC 4HYEA 3NQOA 1UCRA 3BR3A 1QZYA 4XKVA 4IX7A 2F5DA 3GFJA 2IS4A 2PMUA 4E70A 3GFMA 3K4MA 3A01A 1AKHA 3TOBA 1CF7A 2K40A 1XMKA 3K0LA 4V2GA 4ZC3A 4II3A 4XKWA 3TL4X 2VJJA 1F36A 1D3YA 3VB2A 1DQUA 2TRTA 3ZQGA 3JSOA 2JUGA 4J00A 1OCOH 4A3IJ 1W36C 2XGXA 1VTNC 1E2XA 2R7TA 2XGEA 1G2HA 5IP6A 5LFAA 4PJMA 5EZGA 3KP3A 3CZ6A 3MKLA 1MJAA 2PMZA 3VDXA 2CYYA 2ELKA 1KU9A 2VT3A 5ILVA 5D5VB 3L2WA 1QHHD 2LYCA 2LKXA 2R5YB 4PGGA 5E18F 4TV7A 1D8KA 3SEQA 4IEJA 4DOZA 2ID3A 1RUOA 3WGIA 2X9DA 4A2UA 4XN0A 3DU6A 1I6HJ 3R0JA 4RB0A 4KMUX 4ANJA 4P55A 4PZJA 1KA8A 2X6YA 3LSPA 1Z77A 2L9VA 5A2QZ 2PJRA 4HX7A 3ASOH 1FTTA 1HSJA 2G0EA 2ID6A 5L3BA 1S7EA 2FD5A 2JSCA 1A5JA 3KLOA 1D1AA 3VSLA 1SC7A 2CFXA 1T2KA 2VQLA 4UY8I 3Q5FA 2HVSA 5F1RA 5IY5H 1LEAA 3RYPA 1LE8B 4OIPF 3I58A 4W1UA 5HODA 1UG0A 1U0JA 3B73A 1ZG3A 1EH8A 4XLEA 1LVKA 5DEQA 2AS5F 2B7EA 5TJJA 3GYHX 2W1OA 1QRYA 1S7OA 2NXNB 2W7NA 4HNUA 1TNSA 2DOFA 5AONA 1IN4A 3G3ZA 1LNWA 4MTDA 4PSXA 2XSDC 2LKPA 2M5WA 1WWXA 4E7IA 1PJRA 1I3QJ 1OYWA 2D45A 2OU2A 3QPSA 2VXDA 4E7JA 3C3WA 1M1EB 2JA6J 2JQ7A 2WBMA 1ETOA 2RNJA 1MW7A 3E0JB 4OIRF 3CJNA 1J09A 1ZREA 1JHHA 3S16J 2AQEA 4KISA 3MMYB 2DQRA 4OWRB 4CUGA 2ME0A 4A3LJ 4PSWA 2E34A 2P0WA 2DK8A 4AIKA 1X3ZB 1ODDA 4BBRJ 4V2FA 2HZTA 1TLHB 5TGTA 1QBJA 1YW8A 5K5OA 1TQMA 2Y0MA 2PG4A 2PN6A 4EM2A 2W84A 3KCCA 1X1DA 3VPRA 1U5TC 3JTHA 2EILH 1V4RA 4PJJA 4AYBA 2NNYA 1FJLA 1CQTA 2KPMA 1F1ZA 1ZKGA 5E1XA 3L2VA 3KETA 2V79A 3BZ6A 5J1RA 2Z5UA 1YX5A 2OUMA 1W4MA 3GW2A 3KZYA 2R5ZA 5E3OA 4KUMA 1LB2A 4IHWA 4QPQA 2JTVA 3KLNA 4BNCA 3DBLB 4KIBA 2MA3A 1YITI 1PUEE 1VQ5I 3F6VA 2ADUA 3CJTB 1U3EM 1UHWA 4LB6B 3AL0B 3HBLA 4IRHA 1OJLA 3BJOA 3JSPA 2RQPA 2AQFA 2ZKZA 4M9XA 3FMRA 4BXFA 3LSTA 2RAEA 1A35A 1PYVA 5ICFA 1Z3YA 4CSWA 2WTEA 5FGMA 4AYBN 2K9MA 2ZSIB 2A69F 3L7WA 4HEA2 1LFBA 1SVLA 1V5FA 3S2WA 2ZC2A 3CUQC 1XC5A 1TTYA 4WX9A 1MBGA 2FMYA 2IGOA 1IRXA 1ETVA 3TW6A 3F3XA 2VL8A 4IVNA 5L3DA 1LFPA 1HKTA 1H9GA 3CC4I 5E20A 3MKYB 3VWBA 1B6AA 2K3PA 4ABZA 3LL7A 2IS2A 3N4MA 4B09A 3LQQA 1ZRFA 3HPHA 1ORKA 5J4YA 4W97A 2JVGA 2L4MA 1OR7C 5EG0A 4CGZA 1K78A 3RPUA 3SDBA 2HNHA 1Y0NA 2DOEA 2MGQA 5HDGA 4ZDPA 2DDBA 1BBYA 1XX5A 4O3MA 1U78A 2O6GE 2FBIA 2QQ9A 1FOWA 4M6XA 5J8CA 3RDIA 1MMDA 1FP1D 2V9PA 3PUBA 1TC3C 3PJRA 1LVAA 4EJOA 2KFDA 3DTEA 2BE5F 2LKSA 3BOQA 2XHKA 4NC6A 1JUPA 4O6JA 4X1EA 3DFGA 3RIRA 1LEBA 3CUQA 2P8TA 2Y2ZA 1IN8A 4UB6C 2H27A 1B72B 2Z9OA 3HSFA 2OD5A 1GLNA 2PMHA 3L09A 4XSXF 1ZARA 2LC2A 1PP7U 3FXOA 5M5XJ 4HAMA 1HKQA 4BBSJ 3O3KA 1G59A 3AL0C 3GLLA 4F7ZA 2DA1A 3HDDA 4D5CA 1YJWI 1T08B 4CHUA 2MFZA 1F4KA 3L00A 4DNCA 1R1TA 2VB6A 4KT6A 2OTLI 2IGKA 2EBIA 1P4WA 5J4VA 4DW6A 4BAYA 1UHSA 5FB2A 2KIMA 1JTXA 3ERED 3KP7A 4ITVA 2HDCA 1ZGWA 5J47A 1WJ5A 1U9NA 2VIXA 3FDYA 4I6ZA 4LLGF 3GTOJ 1WKMA 4EJUA 3GFIA 2F5EA 4MTEA 3MZHA 1IRZA 3ZQIA 2JVHA 2GLOA 1Q1VA 4R1HA 5K5QA 3OOPA 4FASD 3CJRB 2V1DA 4UUSA 2Z1DA 3AKZA 1MMNA 5CVUA 3FXKA 2DA6A 3H5RA 1JI8A 3E6DA 3JW4A 4NQWA 4U7BA 2HWVA 2JN6A 5BPIA 1HLVA 3JR9A 1YOVB 2FBHA 4CCKA 3A02A 3AG2H 3DLAA 2IA1A 2EQRA 1J2XA 2O3FA 4GO1A 2TDXA 3PFIA 2DQLA 2J5OA 3ZRGA 3BCBA 3J7AO 4BACA 2CV2A 3PUFA 2BEOA 5CLSA 3D0SA 3RYRA 2R7DA 5FLXK 2CU7A 3CESA 3BG6A 1J59A 3KP6A 4ENNA 2V6EA 4KN4X 3S1RJ 3M8FA 3AAFA 4BDZA 1APLC 3DU5A 3LOCA 1DU0A 1GDTA 3A1YA 4PDKA 4UUTA 1TT0A 3K6GA 4M6YA 4F3QA 3NAUA 4EQQA 2NVYJ 4MO7A 5K5RA 3HPGA 2M9HA 2JPBA 1B72A 3DBHB 4ESJA 2CQKA 3OYAA 1SD5A 2OC6A 3HIFA 3CCEI 1BW5A 3OSGA 4DIQA 3E97A 5HOOA 1YJ9I 4D7MA 3RPUD 1Z9CA 4EATA 3FK6A 1B1BA 3NWSA 3EDPA 3MN2A 2NYXA 4QWQA 2O8XA 3REOA 5E8IA 4Y15A 2FU4A 3CCRI 2OV7A 2VOPA 3DTIA 2GOXB 2IBDA 2R0QC 5JVGF 3QPTA 1OFCX 5E3MA 1D5YA 4CICA 2M2EA 2ETHA 1OR7A 3ZXSA 4QTRA 1IAWA 5F27A 1SFXA 2M8EA 3O8GA 4G6DA 1D8JA 4A0YA 3M4OJ 4BQOA 4X0GA 5HDKA 2CH0A 3F6OA 1U8BA 5BOXA 1SVOA 3I4MJ 2VBXA 3ABLH 1X4PA 1XGOA 1UMQA 2F5CA 4HV5A 2EB7A 5F64A 3E5UA 3DKXA 5ILUA 2V9KA 4PJLA 5FLVA 1ZELA 1MH4A 4DQ2A 1FIAA 3DF8A 3CUQB 1C0WA 4JX5A 5HLIA 3C2BA 4RAZA 2Y30A 2FA5A 2XVCA 2PBIA 2YR2A 3V7CA 4MLOA 4KNYA 1UG2A 5FD5A 3H0GJ 2O8KA 5TISC 4MHGA 2OZ6A 2X4HA 4CA0A 1FWZA 5EJCA 1Z91A 3JRGA 4ZDOA 2YSRA 4QSHA 2O5RA 2OPTA 2C6YA 2A61A 2W24A 1NG7A 1LPQA 3U2RA 3TP3A 1FOKA 4NHJA 2X6XA 3EUHC 2F5VA 5CKTA 3CCLI 3WTVC 4ENJA 5BMZA 4NBQA 3K4LA 3HTSB 1DU6A 2DMUA 4FE4A 1T56A 2YPRA 5BPDA 2A5WA 2VUMJ 1Q1HA 1UHMA 5E1WA 4KT5C 1TW2A 3ZPLA 4UUVA 2EFOA 2F2EA 2DA5A 5K1YA 1RR7A 3KYLA 4J01A 3CDHA 2E1CA 2LH9A 4Y17A 1DGRM 4A3DJ 4RGUA 2DN0A 4A3CJ 2P4WA 4HNTA 2EV0A 4AM3A 2NS7A 2LF7A 2XB5A 1O3QA 1BC8C 3GCMA 2LSOA 2JA7J 1KU2A 1VQ9I 3QYEA 5DCFA 1S72I 1JKOC 2ZCWA 5EEHA 1IXRC 3QP5A 2HVRA 1FNNA 1MNEA 1W7PB 2HS5A 2MH9A 4C2MJ 3QOEA 4AC0A 1ZG1A 2DLLA 1IC8A 3PNTA 2V1NA 4I7HA 3HKZA 2GIZA 3KPHA 1U8RA 3OV8A 2IP2A 1FOYA 4IPAA 4RDUA 2R3SA 2BVLA 3FM5A 2HXOA 5AIQA 3HC7A 4BS9A 1R6RA 4XLHA 1OISA 2DFEA 2MLKA 3CCMI 1MNMC 3I4PA 1FEXA 1OCPA 2HZDA 4CXFA 1J9IA 4IL6C 3MZYA 2EZKA 2M34A 3H9QA 3ZGKA 1X58A 3DQVC 4NNJA 1SMTA 3FHZA 3S15J 1VF9A 1OYYA 2IVMA 3CLQA 4L9JA 1HSTA 3P5JA 1IUYA 5TRDA 2CUJA 2D2WA 4HA8A 3ONQA 4OOIA 1Y1VJ 5FKOA 2HFHA 2HOEA 1DPUA 5FRNA 3HRUA 3LSGA 3TOAA 3OMYA 1K4SA 1DDNA 2EA4A 4E7ZA 3MEXA 2UXXA 2QYOA 3VYTB 4C3JJ 4EM1A 2FF4A 3G6EI 3IRQA 3OIOA 3F23A 4A3JJ 1FMVA 3D1NI 1YW7A 3S14J 2HGCA 3J81Z 4U0YA 3GFLA 3I5UA 3IL2A 3BDDA 5F08A 3SQNA 2DMPA 4EVIA 1AA7A 2GXAA 1A04A 3GEZA 1GV5A 2Y9YA 1EV7A 1WJFA 4A3MJ 1NH3A 2RN7A 2ZXIA 4FQGA 4B43A 2HOSA 1ETKA 4S05A 4XRMA 1R4MB 3ABKH 4OU0A 3BT9A 2LNBA 4FT8A 1YO5C 2VC0A 3OWTA 3RKYA 2CUEA 2IW5A 3AFHA 5EGOA 1IXSB 4BGDA 4DYCA 1U9OA 3KP2A 3E1SA 4A3EJ 5F6FA 1MNDA 2F4IA 4D0PA 1QPIA 1SMYF 1X19A 5LEKA 4XKCA 4D1QA 2LLKA 2JA8J 3I54A 2KT0A 1JXSA 2IA0A 2Y31A 4P96A 4A0XA 3I53A 3MD2A 5ICCA 1SEUA 4P9UA 3ML6A 1KQ9A 5HS7A 2YU9J 1IDZA 4A5NA 5BQTA 3OIQA 1ZGAA 5M3FJ 4I99C 3BTIA 4AIHA 2GQQA 4JOMA 3J7ZI 1QGPA 3GTJJ 1W5SA 3JRIA 2XAUA 3O8HA 1IN7A 3FMQA 4JQFA 4OINF 2MH2A 4IHVA 4I0AA 3H5NA 1TQIA 3FIWA 3K4NA 1VQLI 4GYIA 1DUXC 4M72A 5FD6A 2XB0X 1RR8C 2OQRA 3SDGA 3TDUC 3OYCA 4N4OB 2V1UA 3T0YA 2EK5A 2KL4A 5D8KB 4AWXB 1KYZA 1XGMA 1UELB 1TBXA 1ZK8A 1XDSA 1W0UA 1Z6RA 2LY2A 1H8AC 2OJED 1F43A 1WZ2A 4HPQA 3H9GA 5E3NA 4ETSA 1SFUA 4B1RA 2FEZA 3F8CA 1TP4A 4BQQA 4UVCA 4AUXA 3RQ4A 2M45A 5BS6A 4HLXA 2EZLA 1E0EA 3LAJA 2ZXJA 2L7ZA 3ELKA 3K10A 2EWNA 2VE9A 1WH5A 1IJWC 2OBPA 2M1BA 3OL3A 2QSHX 2EZHA 2KIFA 2E36A 4M6VA 2FSWA 3LSIA 3PQKA 2K9LA 1A6QA 2L01A 2VT2A 5DM6F 1P9QC 2WB1A 2OCEA 4A3GJ 3P7NA 4A6EA 2W85A 3L2QA 1K6YA 3PIOF 3W2WA 1FYKA 1Z7LA 3EUKL 1Y39A 4PFOA 1BIAA 2L4AA 5ICEA 1VQNI 5ILSA 2YUSA 1XCBA 1ZN2A 4YIFA 3BTCA 3K2AA 3HOVJ 1REPC 1G3SA 3IV5A 3FHNA 1P2FA 2AO9A 3WTWC 4HDVA 1K6OA 1ZHFA 3LNQA 4E7KA 2KISA 5HVQC 2NOJB 1RUNA 2XV4S 2P7VB 3M1CA 3MKWB 4I09A 1K79A 3QWLA 4MQVA 1JT0A 2LRDA 1WFXA 5DUIA 3BTLA 2FE3A 4YFKF 4BKXA 3C1DA 3CMMA 1B59A 3S93A 2HTJA 5HNFA 3V8KA 2W82A 4F91B 5M3MJ 2DYSH 2IGMA 2JRMA 3ZMUA 1P7IA 3WG9A 2UUZA 2RC4A 2RREA 3CUOA 3HTUA 3G1MA 2M30A 3WG7H 1BJZA 3IAM2 1WJDA 1TWFJ 1SFEA 4GDFA 2E2HJ 1B4AA 4HX8A 3ASNH 2XROA 2IT0A 1V3FA 1YHQI 3KIOA 1O7LA 2K4JA 2W25A 2MC4A 5FFZA 2ESNA 3HSRA 2Q1ZB 5EDNA 1YE9A 1T33A 4MIMA 3SFIA 2K3FA 1RZ4A 3QPLA 4MNUA 4RM3A 1JGGA 3IKVA 4C3IJ 3K1NA 2X1CA 3QYBA 4E7LA 3IH2A 3ZQHA 1R5HA 3OYMA 2ZJRF 3H3UA 3LSMA 3HB9A 1WI3A 3AG1H 5JHUA 3K2ZA 3RZDJ 1QU3A 1IV8A 3SZGA 4S0HB 1LFUP 1Y8QB 3DXJF 2V26A 2DCEA 3DEEA 1KQ0A 1FX7A 2UXNA 4BY7J 2X48A
chains in the Genus database with same CATH topology
1GLNA 2XF5A 2LC2A 4LIVA 2R4GA 2CMPA 1D0YA 3OYKA 1G59A 3AL0C 2WAEA 1BR4A 2MABA 3EPZA 2K5CA 4XL9A 2MFZA 3LFUA 1Y6IA 4YELA 4C2TA 4YRVA 2VB6A 2XC7A 3KX2A 1S9HA 4KT6A 4U87A 2IGKA 3IP4B 2M7BA 4ZJZA 4B48A 2KQRA 2L9SA 2MD0A 3LSHA 4E4HA 4ITVA 2DJIA 3S3MA 4C2UA 1WJ5A 2VIXA 3FDYA 1MMGA 4DJAA 2XF7A 3DPTA 2JVHA 1TZLA 1V5EA 4IQ4A 2JA2A 4FASD 2LREA 1N75A 3CJRB 3DKYA 3VYUB 4BEHB 3LSKA 2Z1DA 3AKZA 1MMNA 3CJQB 1ERDA 3RSNA 2KRHA 3H5RA 1JI8A 4P1WA 4F92B 4XONA 4NQWB 4U7BA 1WJEA 1OLTA 4CCKA 3K70D 3DLAA 4B44A 1T95A 2KZVA 3ZRGA 5LD2C 3BCBA 4BACA 3G2BA 2CV2A 2ZXHA 4BJTA 3CESA 4E7SA 3BG6A 2A6TA 1D0ZA 2V6EA 3PSFA 4BDZA 1LKXA 4CZCA 5KNLA 3DU5A 3CP2A 3A1YA 2LBFB 3U21A 2X85A 4CCJA 1TT0A 3K6GA 2V7FA 3LMMA 4F3QA 3CF2A 1W36D 4BJ5C 1SFKA 4ZDLA 3D5LA 3K70C 2HDWA 3HPGA 3SYTA 3OYHA 2X51A 2FUG2 3FBIB 2VQCA 2M4KA 3OYAA 2UV1A 2R7QA 2IGNA 2OC6A 4PFPA 3VSKA 4DIQA 5HOOA 4BE0A 4GRIA 2DOAA 3RPUD 3OYJA 2XF6A 4EATA 1SAUA 3D5RC 3NWSA 4CCOA 4KJZA 2HU9A 4G6TB 4DBQA 2OV7A 1Z3XA 3MKZA 4AU7A 1X1BA 3DTIA 2GOXB 3C2GA 3D5SC 4XLFA 3SEZA 5KCMA 4DBRA 4LIUA 3OR2C 5KHDA 2CFOA 3ZXSA 4BE2A 2VPLA 2CUZA 4BQOA 4X0GA 2CH0A 4RMNA 2VLAA 2L7KA 1N77A 1EA3A 1MMAA 4B3XA 1X4PA 2R7XA 4NC7A 3OIPA 3DKXA 4HG2A 3H9JA 2V9KA 5JHFA 2BW3B 3BC8A 4PJLA 4YEJA 4ZYAA 2BW3A 5HLTA 1ZELA 3H35A 3RCOA 4Y3OA 4BU2A 4MLOA 4XQFA 2HQAA 3DWLE 2DT6A 2V4JC 4CA0A 4F52A 4ZDOA 1D0XA 2Z16A 2O5RA 3CP8A 3QODA 4BE1A 1NG7A 4RLFA 3VYRB 2X6XA 3EUHC 2F5VA 2JSPA 5CKTA 3A2KA 4XN3A 2Z2SB 3K4LA 3C2HA 2A5WA 3UR3C 3QYFA 2GOMA 4BQNA 3S3NA 1WJAA 2R7SA 3K4KA 3KYLA 4J01A 3KEYA 4PUSA 2LH9A 2F6CA 3OR1C 2DXIA 1DGRM 1BR2A 2KP6A 2BOLA 3BG7A 4DGWB 4HNTA 2Y0SA 2R7OA 3F9KA 3GBGA 4XM3A 5FRMA 3K4BA 3QYEA 2VXZA 4PK4A 1WJCA 4E6KG 2IS6A 3DPLC 2VJIA 1BR1A 2HVRA 1MNEA 4XLCA 2XSJC 4XR6A 1Y56A 2LY1A 3QOEA 2WADA 4OAZA 2PJRB 4HSTA 3OS1A 3EUAA 3PNTA 3HXLA 4RLQA 2V1NA 3HKZA 2CV0A 1BOBA 2E60A 4ZTJA 2E5NA 1YX3A 3OOUA 3IUOA 4BL0B 2BVLA 1X4OA 3HC7A 4BS9A 1Z21A 1R6RA 4XLHA 2M0MA 4P5OA 2HZDA 3OYLA 2QKLB 2ZSHB 4XNFA 3ZGKA 3OL4A 3H9QA 2L2OA 1LDKB 2E1MC 3DQVC 3W2AA 3K4JA 3FBNB 4NNJA 3NWTA 4XKVA 3OYEA 1X1AA 4B47A 4IX7A 2VASA 2IS4A 4N4NB 2I8DA 5CQGA 2CUJA 3K4MA 3V42A 3HOSA 3A4CA 3ONQA 3OYDA 1DGWY 5FRNA 4ZC3A 3PSIA 4Y33A 3LSGA 4II3A 4XKWA 2HVQA 3OMYA 3TL4X 2VJJA 4BJ6C 1DQUA 4CCLA 2JUGA 3UNGC 4E7ZA 4J00A 3BLYA 1W36C 2KMUA 2R7TA 3VYTB 5LFAA 3PNYA 1FMVA 4PJMA 4H4KC 2L9NA 3OS2A 3CZ6A 3VYSB 2PMZA 3VDXA 1V5GA 2W00A 1AA7A 3L2WA 1QHHD 2LYCA 1NG6A 1WJFA 3S32A 3OY9A 2KLOA 3SEQA 4DOZA 1KONA 2X1EA 2M3AA 3IAS2 3RTRA 4XMYA 2ZXIA 4XN0A 4FETA 4B43A 3DU6A 3OS0A 2R7RA 4ANJA 2X6YA 3OWTA 4PJNA 2PJRA 3AFHA 4R79A 2KDOA 4BGDA 3E1SA 2ZFUA 1MNDA 2F4IA 1D1AA 4QPOA 3VSLA 3OYFA 1X19A 4BUPA 4XKCA 3OYBA 4D1QA 2VQLA 2RQQA 2HVSA 3MD2A 4OAYA 3W3CA 3N05A 3ZCOA 4NUBA 1DP3A 1D1BA 5CPRB 3DTKA 1T0FC 3OIQA 2W4SA 4IKFA 1UG0A 1U0JA 1VZ0A 2LOOA 4XLEA 1LVKA 4JOMA 3OYNA 3H0DA 4AVZA 2WAFA 2XAUA 2W1OA 4JQFA 2Q2EB 4HSRA 4XOTA 4XOPA 2W7NA 2CS3A 4XORA 4HNUA 1G8XA 2HPIA 3DPUA 4LITA 3HUGB 2WAQA 2R7VA 4KITB 3H5NA 3K4NA 4PSXA 4E7IA 3OYCA 1PJRA 4N4OB 2VJ4A 3I3LA 2KL4A 2IXSA 2VXDA 3M8JA 3ZQQA 4E7JA 2WBMA 1MW7A 3E0JB 1UELB 1J09A 3S3OA 2IS1A 2AQEA 4KISA 3BCAA 3MMYB 4OWRB 2LY2A 4CUGA 3FKJA 4PSWA 4HPQA 2P0WA 3H9GA 3K4CA 4XKBA 4BQQA 1WJBA 5TGTA 2CV1A 1HA8A 3HG9A 3RQ4A 3J7AY 1X1DA 2WY8Q 4IQJA 1E0EA 2R7WA 3K10A 1FMWA 4PJJA 4AYBA 5FROA 2WA0A 2E5ZA 3OL3A 2KPMA 2M7AA 4XLAA 4Y4RA 1N78A 3L2VA 4F93B 3LSIA 3ZR8X 1YX5A 2OUMA 3TMOA 4F55A 2DT7B 2K9LA 1P9QC 2WB1A 3OYGA 4QPQA 1UAAA 5CQEA 4LG3A 2R7UA 3L2QA 1K6YA 3W2WA 1Z7LA 3EUKL 4PFOA 4CCMA 3AL0B 1D1CA 2AQFA 3FHNA 4BXFA 3L2RA 1PYVA 1Z3YA 4CSWA 3L2UA 4E7KA 5HVQC 2VQHA 4E7HA 2K9MA 2ZSIB 2NOJB 4HEA2 2RNGA 1V5FA 3M1CA 3MKWB 4IZZA 2MYSA 4C30A 3W2VA 2IGOA 2LRDA 3HOTA 2UWMA 2XDVA 1IRXA 1WFXA 4HRIA 2VL8A 1LFPA 2X6WA 2VQGA 3MKYB 3CMMA 3VWBA 3H5AA 3S93A 4BEHA 5HNFA 2K3PA 2W82A 3LL7A 2IS2A 4F91B 2LG4A 3HPHA 5HNHA 2IGMA 2UUZA 2RREA 2M4GA 2JVGA 3HL2A 3IAM2 1OR7C 3PNVA 2WY7Q 1WJDA 2CW8A 4RM2A 3PL8A 4NC8A 3PFYA 2L5QA 3TBIA 3SDBA 2HNHA 2KHMA 2ELJA 4BDYA 4ZDPA 4CCNA 2MC4A 3S8PA 2Q1ZB 1YE9A 4RM3A 2CW7A 1QHGA 4ZTFA 2X1CA 3QYBA 3I9V2 2VKHA 1MMDA 2X1DA 4CH7A 3OYIA 4E7LA 3PUBA 2E1MB 3PJRA 3OYMA 4C9YA 2LBFA 3LSMA 3DTEA 2KRCA 4II2A 4D9JA 1QU3A 1X1CA 3SZGA 2V26A 2DCEA 2QKMB 3DEEA 2HPMA 2BVMA 2VJ5A 2VKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJD A;  1WJA A;  3F9K A;  3HPH A;  1WJF A;  1WJE A;  3HPG A;  4F3Q A;  1K6Y A;  1E0E A;  1WJB A;  1MW7 A;  1WJC A;  1KON A;  1LFP A; 
#chains in the Genus database with same CATH topology
 3MWM A;  1ONV A;  2ZJ2 A;  4EJV A;  1G3W A;  3K69 A;  3RKW A;  1MJB A;  2CMP A;  4JX4 A;  1WPK A;  1D0Y A;  2KRF A;  4XBF A;  3CCJ I;  3A01 B;  5GAH J;  2V9V A;  2AXT C;  3LFU A;  1I50 J;  1Y6I A;  1RET A;  3FF5 A;  3MFK A;  2XC7 A;  1HBX G;  1FT9 A;  5FKM A;  4Q48 A;  3IP4 B;  2P7C B;  4EV0 A;  3EQL F;  1J7K A;  2L9R A;  3RQI A;  2MD0 A;  2L54 A;  3FWE A;  3FZV A;  4E4H A;  2CQX A;  1XMA A;  2H8R A;  2IRF G;  1ZR2 A;  4C2U A;  4O5V A;  4Z6Y A;  4XRF A;  1MMG A;  4XK4 A;  4DJA A;  1FSE A;  2VI6 A;  3J80 K;  3BR6 A;  4ENM A;  4BHB A;  2QLZ A;  3SZP A;  3FK7 A;  4F92 B;  3MCZ A;  1U6G A;  3V8L A;  2NVT J;  5B3S H;  2XAF A;  4EGY A;  1WJE A;  1JE8 A;  3AG4 H;  5J40 A;  2VKV A;  2HQR A;  4L5E A;  4L5J A;  4HBL A;  4ESB A;  1HC8 A;  2VBZ A;  2KZV A;  1E3H A;  2FNP A;  3G2B A;  3Q0W A;  4U88 A;  2RDP A;  3HOU J;  5DYM A;  3LA7 A;  4E7S A;  5BNG A;  2MD5 A;  5D5U B;  4ZYE A;  3HZJ A;  3CP2 A;  3R0A A;  4RB2 C;  2ZNZ A;  1LE8 A;  4CCJ A;  1MJ9 A;  3IC7 A;  5EEG A;  3GTG J;  1ETQ A;  4ZZL A;  1W36 D;  1SFK A;  1R5G A;  2MLG A;  1HXD A;  4UHT A;  2FUG 2;  4RB1 A;  1P92 A;  3FBI B;  1JUS A;  2VQC A;  2M4K A;  2P5V A;  2Q2E A;  3BTJ A;  1J75 A;  2R7Q A;  2IGN A;  3GZN B;  3L2C A;  1RI7 A;  2PX9 A;  4UXN A;  1A6I A;  2GXG A;  1YIO A;  1SAU A;  3D5R C;  5CVR A;  4CCO A;  5M5Y J;  1S6L A;  2BBY A;  4LB5 A;  3J81 K;  2KDZ A;  1IGN A;  2HU9 A;  1O3S A;  3B6A A;  4G6T B;  1Z3X A;  1X1B A;  2DU9 A;  5F0H A;  3KP4 A;  5EEA A;  1G3Y A;  4N0B A;  3G4S I;  4YG2 F;  4IRI A;  2R93 J;  5KCM A;  2NVQ J;  1G3T A;  5KHD A;  4IHS A;  3I64 A;  4C3H J;  1WQ2 A;  3LA2 A;  1FSH A;  4S04 A;  2CUZ A;  1AOY A;  3JRD A;  2IPQ X;  4Q4Z F;  5IYC J;  1T8I A;  1N77 A;  5GTI C;  4I76 A;  2DT5 A;  4MFD A;  1KU3 A;  4A0Z A;  3ROU A;  3BC8 A;  4G9Y A;  2XRN A;  3W6V A;  2MBF A;  1E17 A;  4P9F A;  3H35 A;  2V1X A;  3HKZ N;  5HS8 A;  2JUC A;  3CMA I;  4JBA A;  4OMY A;  3GO5 A;  4HX4 A;  3RCO A;  2L0K A;  1HQC A;  3FMS A;  2HQA A;  4EGZ A;  1VQ4 I;  4ZYH A;  1U2W A;  4M9Z A;  2HTS A;  2DT6 A;  2V4J C;  2PMZ N;  1OCZ H;  4CDG A;  1V55 H;  2QQB A;  2CJJ A;  2ESH A;  3ZN1 A;  4GYG A;  3ISP A;  1ZTR A;  2H8W A;  1YTY A;  3VYR B;  5EZH A;  1DP7 P;  3BZK A;  5B66 C;  3JRA A;  3C2H A;  1U5T A;  3R4K A;  1PDN C;  3B6C A;  1FZP B;  2DFH A;  3G1O A;  2GOM A;  2ECB A;  3S3N A;  6PAX A;  1WJA A;  2HQ5 A;  2XIG A;  1TNT A;  5HLG A;  2R7S A;  2DYR H;  3K4K A;  5D4S A;  2DXI A;  1BR2 A;  5J3L A;  3P9K A;  4DGW B;  2X6O A;  5LGU A;  3WTY C;  3X2Q H;  5E1Z B;  2HKO A;  3GX4 X;  4Q5S F;  3DEW A;  2KKO A;  2CSO A;  1VI0 A;  3GBG A;  5FKK A;  2XGD A;  4IHT A;  2CO5 A;  2NNN A;  1ACI A;  5LRS A;  2H6B A;  5LHH A;  5EG0 B;  3GLX A;  4FIS A;  3QRF F;  4XR6 A;  2IJL A;  5J1U A;  3LSJ A;  4FX0 A;  3S2H J;  3Q3S A;  3F21 A;  5KK1 A;  1W0T A;  1JUM A;  1BOB A;  4PGH A;  4KN7 X;  2E60 A;  1IW7 F;  2E5N A;  2R92 J;  4IO9 F;  4RAY A;  3IUO A;  5IT3 A;  3GUD A;  5GTH C;  1X4O A;  4EJT A;  3JCU C;  2DJN A;  1Z21 A;  3H36 A;  3RJP A;  1MDM B;  2WB1 N;  1KU7 A;  4WCG A;  4RAF A;  3BG9 A;  4P5O A;  1GHC A;  3JRC A;  2K02 A;  2L2O A;  2WAQ N;  1R00 A;  2RVC A;  5FO5 A;  4EJW A;  1HCR A;  4IXA A;  1MMS A;  2CW0 F;  5ED4 A;  2O0Y A;  1NTC A;  3OYE A;  4B8X A;  2GA1 A;  4WXD A;  2VAS A;  1YIJ I;  2I8D A;  1QQI A;  1R22 A;  4LJZ F;  1CF7 B;  1ETW A;  2K4B A;  5EYR A;  2LMD A;  2COB A;  5LRR A;  1P4A A;  3FXQ A;  3PSI A;  1TWA J;  2DTR A;  3BG5 A;  5E17 F;  2JA5 J;  2EV6 A;  2JT1 A;  5IOZ A;  4G7Z F;  5GP9 A;  3M8E A;  4IHX A;  1QO0 D;  3UNG C;  1R36 A;  1UJ8 A;  1BA5 A;  1PUF B;  3BLY A;  1XPX A;  1ENH A;  4V19 K;  1ZRC A;  2ZJQ F;  3ABT A;  1VQP I;  3RKX A;  3QQA A;  1ZLJ A;  2BHZ A;  1I3A A;  3BPV A;  3ZN0 A;  2L9N A;  5LHG A;  2RGV A;  3VYS B;  1EH6 A;  5GPC A;  3J7Y J;  4BHP A;  5C4X J;  1MH3 A;  2JZY A;  4ENK A;  2LTP A;  1NG6 A;  2MG4 A;  2VOD A;  5GAG J;  5F0F A;  2XAQ A;  1Z67 A;  3OY9 A;  1KON A;  3BG3 A;  2X1E A;  2M3A A;  2YX4 A;  5D4R A;  4XMY A;  3WTU C;  3HRM A;  4L0Y B;  2B0L A;  4YIR X;  4LFU A;  3OS0 A;  2Y9Z A;  5K7F A;  4I98 B;  3FX3 A;  4PJN A;  1AWC A;  5D6F A;  3U1D A;  4R79 A;  3NAR A;  2OTJ I;  3SZT A;  4IOC F;  3IH4 A;  1J5Y A;  1XSV A;  3GVA A;  3OYF A;  4I2O A;  2BGC A;  1ZAO A;  4BUP A;  1L0O C;  5FLX Z;  3OYB A;  3A0B C;  2P5K A;  2IAI A;  2A6E F;  2DO7 A;  1YJN I;  1TL8 A;  3KZI C;  3TDZ C;  3WOD F;  5DD4 A;  5E79 C;  4N9H A;  3ZCO A;  4NUB A;  2LP0 A;  3SXY A;  1D1B A;  4H0E A;  3DTK A;  2W4S A;  4JK1 X;  4QLC U;  2EFP A;  2EIM H;  3B02 A;  1Z7U A;  3OYN A;  1PP8 F;  2E71 A;  2WAF A;  1SFO J;  4MGR A;  2LD5 A;  2PI0 A;  1GVJ A;  2M8G X;  2CS3 A;  4XOR A;  3DPU A;  1XG1 A;  2ZJP F;  5KAF C;  3WTS C;  2M0C A;  1OCR H;  3HRT A;  1OMI A;  1BI1 A;  3CDL A;  1K7A A;  2GM4 A;  3GF2 A;  1X1P A;  1K78 B;  2DMN A;  3ZQQ A;  2FML A;  1ULY A;  2Y0S N;  1USS A;  1VFC A;  2G9W A;  3S3O A;  4LK1 F;  2IS1 A;  2OF7 A;  3SJM A;  3BCA A;  2E7X A;  1O7F A;  1OPC A;  2RV8 A;  4FCY A;  1JKQ C;  2DI3 A;  3F8M A;  3JAM K;  2XRL A;  5LLQ A;  1I27 A;  4I01 A;  1HA8 A;  1QA6 A;  1JHF A;  2IA2 A;  2A05 A;  1MDM A;  3J7A Y;  4IQJ A;  3E6B A;  2R7W A;  3IH3 A;  1JTY A;  1X2M A;  1Y1W J;  1FMW A;  5FRO A;  5GAE J;  2WA0 A;  3ECO A;  4KIC A;  3CMY A;  3P9C A;  2VN2 A;  4Y4R A;  4RGS A;  4A3B J;  2LFB A;  3TMO A;  2Q0O A;  2NVU B;  3ZMD A;  5JLW A;  1UST A;  3CD6 I;  4GCV A;  3KZZ A;  1AKH B;  5CYV A;  4M3G A;  1UAA A;  3FKI J;  3GTP J;  3G1L A;  1I1S A;  3TQN A;  5B1A H;  1NK3 P;  4Y13 A;  4CCM A;  1OCT C;  1XCV A;  1D1C A;  1XMX A;  3LAP A;  3K7A J;  3L2R A;  1U5T B;  1WCM J;  2DA3 A;  3GZ5 A;  3R60 A;  1RPW A;  1RC9 A;  1ON2 A;  2DMT A;  2H6C A;  3KEO A;  4C30 A;  2E1O A;  1FIP A;  1KYW A;  2GWR A;  2V6C A;  3O2P E;  3CCV I;  3W2V A;  3HOT A;  4OIO F;  2UWM A;  2O61 A;  2XDV A;  3HHG A;  2Z99 A;  4WXC A;  2X6W A;  1S3J A;  2VQG A;  5K7Z A;  1N25 A;  1JKR C;  3H5A A;  5F1J A;  2LG4 A;  4DZP A;  4FE7 A;  2EIN H;  2DPU A;  2BYV E;  2M4G A;  4GFB A;  1MBE A;  5LGT A;  3CCY A;  2HI3 A;  4NC8 A;  3PFY A;  2L5Q A;  3TBI A;  4MFE A;  1R9T J;  2KHM A;  2ELJ A;  1MZB A;  1YLF A;  2FXA A;  2G7U A;  3M1E A;  3QOP A;  4BDY A;  1RRJ A;  5H6Q A;  2XAJ A;  1HDP A;  5CVI A;  3RKQ A;  2FOW A;  4WK8 F;  3PO2 J;  3F22 A;  2VKE A;  3AG3 H;  2CW7 A;  1S29 A;  4ZTF A;  4MEX F;  2VKH A;  3MVP A;  4CH7 A;  3OYI A;  1Y8R B;  3TKY A;  1P6R A;  2J5P A;  2ZB9 A;  4C9Y A;  4I02 A;  1HF0 A;  2KRC A;  1FPQ A;  1RKT A;  2PQ8 A;  2WC2 A;  1HOM A;  2ACJ A;  3WGG A;  1IDY A;  1LQ1 A;  1R49 A;  1X1C A;  4Y7N J;  3IKT A;  2HPM A;  4Z2Y A;  2BVM A;  3BZC A;  2VJ5 A;  2VKD A;  3DLL F;  5L3F A;  2XF5 A;  4QIW N;  3MZ8 A;  3K1M A;  5JI6 A;  1FLI A;  1W5T A;  4LIV A;  4LG0 B;  2R4G A;  4WWC A;  5CJ9 A;  4N9I A;  2L02 A;  3EUH A;  3BY6 A;  2D1H A;  1I6X A;  2WAE A;  1R1V A;  4ON0 A;  1BR4 A;  2MAB A;  3EPZ A;  2K5C A;  2ZME C;  3C7J A;  4RAG A;  3LQR A;  4YEL A;  2H1L A;  4YRV A;  1OYI A;  3TW7 A;  5IYB J;  2VE8 A;  1GXP A;  1TT5 B;  5H20 A;  1PUF A;  1LDD A;  2L9S A;  4MQ9 F;  2DJI A;  1S8N A;  2CG4 A;  2DTZ A;  4HV6 A;  3VFZ A;  5DUK A;  4XRS A;  4HQM A;  3G71 I;  1TZL A;  3HRS A;  3I56 I;  3JRF A;  3DKY A;  4BEH B;  1HW5 A;  3VYU B;  2H09 A;  1BIB A;  3HM5 A;  3LSK A;  3CJQ B;  2NVX J;  1ERD A;  2GA2 A;  2KRH A;  2BY0 A;  2H94 A;  3IHU A;  3RSN A;  3WE3 A;  2QSG X;  1W7P D;  4NQW B;  1WSU A;  3H1C A;  3JRE A;  4M3E A;  1OLT A;  5FKL A;  1FYM A;  3BJ6 A;  4B44 A;  1Z05 A;  3CCS I;  2OA4 A;  5FKN A;  5EGO B;  1QZE A;  4KYW A;  1IG7 A;  4BJT A;  2LDU A;  1GVD A;  3I59 A;  2A6T A;  3WTT C;  2IEK A;  3PSF A;  4G12 A;  1LKX A;  5KNL A;  4KA4 A;  3A03 A;  4BXU A;  2VOO A;  2FNA A;  3ZQF A;  2EIK H;  1FBU A;  3HOX J;  1O3R A;  5IYD J;  2P5L C;  3U21 A;  3BJA A;  2JPC A;  4L9N A;  2V7F A;  3CCU I;  3LMM A;  3CF2 A;  4CO8 A;  1ZYR F;  2OQG A;  4BJ5 C;  1BW6 A;  2ISY A;  3D5L A;  4MEY F;  4ZDL A;  3K70 C;  1XS9 A;  3JTG A;  2H1K A;  1XN7 A;  4LLN A;  2ELH A;  1XD7 A;  3SYT A;  3OYH A;  2DOD A;  2FQ3 A;  1UZC A;  5L3C A;  2A68 F;  3IRR A;  3K1P A;  4LOC A;  1Z0X A;  2UV1 A;  4RGR A;  3OSF A;  3BR5 A;  4PFP A;  3VSK A;  1OKR A;  3HUG A;  4BE0 A;  9ANT A;  1TWH J;  3OYJ A;  1J0R A;  2DOA A;  2ZME B;  3I4N J;  1ZH5 A;  5IT9 K;  1O57 A;  3T1B A;  2BY3 A;  1XSX A;  3MKZ A;  3I55 I;  2L7F P;  2CRG A;  1BI3 A;  1I39 A;  5IPA A;  4XLF A;  3VOE A;  2MSY A;  3KYD B;  1R71 A;  2CFO A;  4NB5 A;  3DV8 A;  1S5L C;  3FIS A;  4WXH A;  5DM7 F;  1JJ8 C;  1G4D A;  1R4N B;  2LF8 A;  1IRG A;  2PEX A;  2VLA A;  4G7O F;  2L7K A;  3O6B B;  1RIO H;  1EA3 A;  1MMA A;  2ISZ A;  2CQQ A;  1UFM A;  2QCO A;  4B3X A;  2E19 A;  2VPR A;  2K85 A;  2VBY A;  4ESF A;  2R7X A;  4NC7 A;  3PIP F;  1HW1 A;  3L1P A;  3OIP A;  3ZQC A;  3CLO A;  3GWZ A;  3H9J A;  3E5Q A;  4M9S A;  5JHF A;  4YEJ A;  1VQ7 I;  2HKX A;  3FXJ A;  4ZYA A;  2BW3 A;  5HLT A;  3CC2 I;  2BXY A;  1MBJ A;  2Z33 A;  1YW9 A;  3KP5 A;  1GUU A;  5IP7 J;  3EET A;  1IN6 A;  4BU2 A;  1VQO I;  1R58 A;  3WHB A;  4XQF A;  3HHH A;  4RGX A;  2R5Z B;  3A0H C;  1WGX A;  4DYR A;  1SD6 A;  2I5U A;  3ECH A;  1XDU A;  1D0X A;  2Z16 A;  4FHT A;  1BN5 A;  2AHQ A;  2JJ7 A;  3Q0V A;  4RLF A;  4UB8 C;  1H0M A;  2JSP A;  3BP8 A;  4XN3 A;  1TQP A;  2Z2S B;  1O4X A;  2YX7 A;  2QSF X;  1W1W E;  5HDN A;  4CYC B;  1SAN A;  1LUJ B;  3BRO A;  1IN5 A;  2XAS A;  4L9V A;  3TO6 A;  1VQ8 I;  1ITY A;  4BQN A;  2P6S A;  2A6H F;  4G7H F;  3H3V K;  2ME6 A;  4RBO A;  3COA C;  3KEY A;  2F6C A;  1LJ9 A;  2XPV A;  2KP6 A;  2Q8K A;  3BG7 A;  3Q9S A;  4M3D A;  4AIJ A;  2EV5 A;  1K61 A;  3JAM Z;  1QNT A;  4NDL A;  1UB9 A;  3U1K A;  4XM3 A;  1IF1 A;  4YII A;  1T39 A;  3K4B A;  5FRM A;  3GTL J;  1WJC A;  2IS6 A;  1E3P A;  1MBK A;  2ZXW H;  4AD9 A;  2VJI A;  4J19 A;  1BR1 A;  2KJC A;  4XLC A;  3TO9 A;  2XSJ C;  4PCQ A;  1Y56 A;  4LLL A;  2LY1 A;  2PFB A;  4ZYD A;  1ETX A;  2EFW A;  2WAD A;  2ZBK A;  4HST A;  4HLY A;  3S1N J;  1EH7 A;  3EUA A;  3HXL A;  1B8I A;  3FXL A;  3KEQ A;  3RI4 A;  4ZTJ A;  2NAZ A;  1YRN A;  3V7R A;  3WTX C;  1YS7 A;  1YX3 A;  3HSE A;  1V54 H;  3OOU A;  4BL0 B;  4WF2 A;  2O7O A;  1BOA A;  5HS9 A;  4K2E A;  2F4O B;  5E8G A;  3HOW J;  1BI0 A;  2FRH A;  1FOX A;  1OCC H;  5DCM A;  3PQJ A;  3OYL A;  3E7L A;  4XNF A;  3BR1 A;  4A3K J;  3T8T A;  4HOB A;  2QEX I;  2CQ7 A;  2E1M C;  3K4J A;  5F0C A;  2R7Z J;  3IWF A;  1ON1 A;  3NWT A;  4ZYG A;  3V7S A;  1X1A A;  4B47 A;  3HGY A;  5EF6 A;  2BZT A;  2EFQ A;  2KIQ A;  4N4N B;  4OMZ A;  5CQG A;  3W6J B;  5GAD J;  5E3L A;  3V42 A;  3HOS A;  1L3L A;  3RPQ A;  1WHU A;  3A4C A;  4JP0 A;  2QA4 I;  2CGP A;  2E1N A;  2OAZ A;  2YU3 A;  3H92 A;  3OYD A;  1DGW Y;  4IJA A;  4Y33 A;  1QVU A;  3CQZ J;  5L3G A;  3P9I A;  2HVQ A;  4LGW A;  4IOA F;  2E7W A;  5A2Q K;  1IRF A;  1YQA A;  3EYI A;  5CVV A;  3H3Z A;  4BJ6 C;  4CCL A;  2JWT A;  3ABU A;  3GTQ J;  5ICG A;  3LSR A;  5H6R A;  2KMU A;  1VND A;  5D5X B;  3TP0 A;  3PNY A;  4H4K C;  5J6X A;  3HOZ J;  3OS2 A;  1R23 A;  1IZ1 A;  3ESW B;  2DA4 A;  2G7H A;  2A07 F;  2VC1 A;  4L18 B;  3RZO J;  4FX4 A;  1YFH A;  3R61 A;  1MGT A;  1RNL A;  2VON A;  1V5G A;  2W00 A;  3UKG A;  4OIQ F;  3I71 A;  4AID A;  2FBK A;  2R7F A;  4X6A J;  2EFN A;  4EEF G;  3S32 A;  2R5Y A;  4XRS G;  5GPA A;  2KLO A;  2EA2 A;  4XLN F;  5DTD A;  3RTR A;  3JRH A;  3IAS 2;  5HLH A;  1KQ8 A;  1IO2 A;  4FET A;  2O9L A;  2CWE A;  2LY9 A;  2DA2 A;  1F5T A;  1KZH A;  2R7R A;  1MBF A;  2HOA A;  3BQZ A;  3ZQ7 A;  1HKS A;  1JGS A;  4U7D A;  3KFW X;  4UV8 A;  2DDA A;  2KDO A;  1QZZ A;  1STZ A;  2K9Q A;  2ZFU A;  2VBW A;  3QPH A;  4QPO A;  4ZZD A;  2EH3 A;  1H89 C;  1G6N A;  2GXB A;  3NEU A;  2QGU A;  3DP7 A;  1VQ6 I;  1B9M A;  2X0L A;  2RQQ A;  4OAY A;  5C44 J;  3W3C A;  3N05 A;  2PJP A;  1DP3 A;  1GV2 A;  5CPR B;  1IV6 A;  5F04 A;  1T0F C;  2DA7 A;  5JLX A;  4CYC A;  1NK2 P;  4IKF A;  4B3A A;  1VZ0 A;  2LOO A;  3GTK J;  3Q0U A;  3H0D A;  4AVZ A;  1FYL A;  3CTA A;  2F5F A;  1EKE A;  1W5C C;  2Q2E B;  3BR0 A;  4HSR A;  4XOT A;  4XOP A;  1G8X A;  2HPI A;  4LIT A;  3CO7 C;  3HUG B;  2XAG A;  2WAQ A;  1I5Z A;  2R7V A;  3ZQL A;  4KIT B;  1T38 A;  2LVS A;  4M71 A;  1K4T A;  5J8F A;  3CME I;  2MW8 A;  1BI2 A;  2ZO4 A;  2F4M B;  2VJ4 A;  5J1Y A;  3I3L A;  3M8J A;  2IXS A;  1H88 C;  1PVE A;  2AXL A;  2NOG A;  5FFX A;  3HYI A;  3FM3 A;  4XSZ F;  2P6T A;  2LR8 A;  2EZI A;  3LFK A;  3FKJ A;  4XKB A;  3WGH A;  1WVR A;  3K4C A;  4IF4 A;  1GT0 C;  1YRN B;  2UZK A;  1P7J A;  2W57 A;  1WJB A;  2BXZ A;  2MC3 A;  1GXQ A;  2CV1 A;  4BY1 J;  3HG9 A;  1SAX A;  4ZH4 F;  4ASN A;  4Y52 J;  2WY8 Q;  3L9F A;  1MKM A;  1T0F A;  2NS8 A;  2ZNY A;  2E5Z A;  2M7A A;  2KZG A;  4XLA A;  3F8F A;  3M3Y J;  1JJ6 C;  1N78 A;  1Z6T A;  4F93 B;  1SVM A;  1X3W B;  3ZR8 X;  4F55 A;  1XTA A;  2DT7 B;  5IP9 J;  4LG0 A;  1QPM A;  4G8X A;  3WHC A;  4BXX J;  3OYG A;  4DYQ A;  2K27 A;  5CQE A;  4LG3 A;  2P81 A;  3CCQ I;  2R7U A;  4R8H A;  5M5W J;  3F72 A;  4DZJ A;  4KDP A;  2HYF A;  4CYD A;  3E5X A;  2Y75 A;  2DAO A;  3L2U A;  2QF7 A;  2VQH A;  4E7H A;  1ZGJ A;  4M73 A;  3ZMZ A;  2RNG A;  4IZZ A;  2B9S A;  2MYS A;  1Z1D A;  3FXR A;  1I1G A;  5B1B H;  1XB4 A;  2OCC H;  2QZ8 A;  3WTZ A;  4HRI A;  4A3F J;  2KJB A;  1MSF C;  2CUF A;  4BEH A;  2E35 A;  4M3F A;  1MSE C;  3E6M A;  1F9N A;  4D7N A;  1VQK I;  3W6K B;  5HNH A;  1TWC J;  2EIJ H;  1WI9 A;  3K9T A;  3F0C A;  4KIG A;  3HL2 A;  3PNV A;  2WY7 Q;  1JT6 A;  3VEP A;  2CW8 A;  4RM2 A;  2STT A;  3PL8 A;  1RES A;  1ZG5 A;  5LEJ A;  1W7P A;  3JRB A;  3M07 A;  4YFN F;  5JVT A;  3HGG A;  3HEF A;  3BPX A;  4CCN A;  4L5I A;  2Y69 H;  4I0B A;  3S8P A;  2CQN A;  2HDD A;  1T6S A;  4RS8 A;  5IT9 Z;  1VQM I;  2BY2 A;  1H9T A;  1QHG A;  1YI2 I;  4BYY A;  1AU7 A;  3I9V 2;  1X3U A;  2X1D A;  4UVA A;  2E1M B;  3QAH A;  2COM A;  2LBF A;  5JR3 A;  2A3S A;  1AHD P;  1WH7 A;  4II2 A;  1FY7 A;  4D9J A;  4KFC A;  1Y0U A;  3BR2 A;  4A12 A;  2QKM B;  1BC7 C;  2EPF A;  2PLY A;  5C3E J;  4D5F A;  2K86 A;  4XID A;  1A31 A;  3OYK A;  2HEO A;  4HNV A;  3ZMS A;  2E2J J;  4FTH A;  2XKP A;  4M74 A;  4XL9 A;  2DPD A;  2OZU A;  3ZOB A;  4C2T A;  3FXM A;  3CC7 I;  3KX2 A;  1S9H A;  4U87 A;  2QEN A;  1EJ9 A;  1FBQ A;  2M7B A;  4ZJZ A;  4HQE A;  4B48 A;  2FJ1 A;  2KQR A;  2B63 J;  3LSH A;  4UVB A;  1O3T A;  3LWF A;  2RKH A;  3S3M A;  3WU0 A;  4EMS A;  1BM9 A;  2HXI A;  1ZR4 A;  5DDG A;  2XKO A;  1ETY A;  1MBH A;  1YG2 A;  2XF7 A;  2QM3 A;  3DPT A;  4IQ4 A;  1V5E A;  2GAU A;  3ZMV A;  2JA2 A;  4XIC A;  3J80 Z;  2LRE A;  1N75 A;  1R1U A;  4UUS B;  2N8G A;  2DK5 A;  2A5Y B;  3MAJ A;  3DCF A;  2HQN A;  4P1W A;  1FP2 A;  3SHF A;  4IRG A;  4XON A;  3PM1 A;  3E3V A;  3WU2 C;  2FQ4 A;  5D5W B;  1LDJ A;  3K70 D;  3QU3 A;  3KYC B;  4G6Q A;  3Q9V A;  1T95 A;  5AIP A;  1XSD A;  1CGP A;  5LD2 C;  1QVT A;  3KE2 A;  4KIF A;  4A6D A;  2QVO A;  2ZXH A;  3MQ0 A;  4HW0 A;  2QUF A;  3PO3 J;  1D0Z A;  4M3B A;  1E3O C;  4CZC A;  1IXC A;  1MD0 A;  5DD8 A;  5KVR A;  1X2N A;  1TW3 A;  4U0W A;  2LBF B;  4L0Z B;  4RB3 C;  3WE2 A;  2X85 A;  3DEU A;  2STW A;  5DS9 A;  3ABM H;  1TWG J;  2HDW A;  2HYG D;  5IOY A;  1ZLK A;  2QBY A;  3HJE A;  3V8J A;  2X51 A;  2QBY B;  2LK2 A;  2K9S A;  3S1M J;  4KMF A;  2QWW A;  2K7L A;  3M9A A;  1DPR A;  2ZME A;  4BH9 A;  4GRI A;  4EM0 B;  2XF6 A;  4KJZ A;  4LD5 A;  3T5X A;  1S7A A;  4HDU A;  1XGS A;  3M7G A;  2Y48 A;  3BWG A;  3S1Q J;  3IWZ A;  3ERM A;  4DBQ A;  4AU7 A;  2L3D A;  3C2G A;  3D5S C;  3TGN A;  2I10 A;  3SEZ A;  4DBR A;  4BHC A;  1XGN A;  4LIU A;  3OR2 C;  4G94 A;  3F8N A;  1A36 A;  2QQA A;  1YS6 A;  3GTM J;  1FBS A;  2FOK A;  5B5E C;  2K9N A;  2DFI A;  4GGG A;  3V4G A;  4BE2 A;  4HF2 A;  2VPL A;  1BJA A;  3FXU A;  5K7H A;  4RMN A;  4HF1 A;  3T8R A;  2NS0 A;  2WWY A;  5C4J J;  3VOD A;  3ULQ B;  2JMW A;  5LBQ A;  1K83 J;  3U9G A;  2E2I J;  2DW4 A;  3F8B A;  4HG2 A;  5CVJ A;  3ZMT A;  1MIJ A;  2BW3 B;  4HZF A;  4UV9 A;  3C18 A;  2WV1 A;  2FX0 A;  4A93 J;  2M87 A;  1HW2 A;  4RA2 A;  2O03 A;  3NRV A;  2NRA C;  3DKW A;  1ZRD A;  3N97 A;  4Y3O A;  2DMQ A;  1FC3 A;  1SD7 A;  3CO6 C;  4HF0 A;  4L9T A;  3DWL E;  2D1V A;  2GIV A;  1BL0 A;  2QQ8 A;  4F52 A;  2D5V A;  3TO7 A;  3EYY A;  2DFF A;  3CDI A;  3CP8 A;  3QOD A;  1KGS A;  4A5M A;  4BE1 A;  2XPW A;  1YYV A;  4PJ0 C;  5ERI A;  3A2K A;  2KIU A;  4B4C A;  5L3E A;  1IUF A;  4U0V A;  2DBB A;  3UR3 C;  3ZP5 A;  3WU1 B;  3QYF A;  2W48 A;  4A69 C;  3G73 A;  5D6E A;  1T98 A;  3QU6 A;  3TED A;  4IHY A;  1P4X A;  2Z3Y A;  5FJ8 J;  3I0T A;  2TCT A;  3GME A;  4PUS A;  3OR1 C;  1WRJ A;  3HOY J;  2BOL A;  2ICW G;  2L7M P;  2HOT A;  2Y0S A;  2ECC A;  5FLM J;  4BQA A;  2R7O A;  4JX6 A;  1EF4 A;  1JKP C;  1HDD C;  4LMY A;  5KAI C;  3F9K A;  2XPU A;  2GBY A;  5JFR A;  2YS9 A;  2VXZ A;  4PK4 A;  1D5V A;  4E6K G;  2HYJ A;  4YFX F;  2XAH A;  3DPL C;  1R7J A;  1ZQ3 P;  1FTZ A;  4LK0 F;  5H2F C;  3R6S A;  5D8L B;  2F48 A;  1RKW A;  2BY1 A;  4OAZ A;  2PJR B;  1POG A;  3GZ6 A;  3OS1 A;  4Q47 A;  1B8I B;  3QP6 A;  3BQY A;  3DBR B;  4RLQ A;  3S17 J;  2CV0 A;  2ZFW A;  3I59 B;  4XLP F;  3CF5 F;  3GXO A;  2HR3 A;  4AVP A;  4UNO A;  3SFZ A;  3S2D J;  1NHA A;  5LGN A;  2JK3 A;  2GZW A;  5LHI A;  2BV6 A;  2BHY A;  2WV0 A;  2XGC A;  4CZZ A;  2M0M A;  2XUB A;  1B9N A;  1R5I D;  4JYK A;  5DCM B;  1OQY A;  2QKL B;  2ZSH B;  3OL4 A;  2JRT A;  1LDK B;  2EJR A;  3LA3 A;  4GXO A;  1SD4 A;  3W2A A;  3FBN B;  5DV5 A;  3E6C C;  4HYE A;  3NQO A;  1UCR A;  3BR3 A;  1QZY A;  4XKV A;  4IX7 A;  2F5D A;  3GFJ A;  2IS4 A;  2PMU A;  4E70 A;  3GFM A;  3K4M A;  3A01 A;  1AKH A;  3TOB A;  1CF7 A;  2K40 A;  1XMK A;  3K0L A;  4V2G A;  4ZC3 A;  4II3 A;  4XKW A;  3TL4 X;  2VJJ A;  1F36 A;  1D3Y A;  3VB2 A;  1DQU A;  2TRT A;  3ZQG A;  3JSO A;  2JUG A;  4J00 A;  1OCO H;  4A3I J;  1W36 C;  2XGX A;  1VTN C;  1E2X A;  2R7T A;  2XGE A;  1G2H A;  5IP6 A;  5LFA A;  4PJM A;  5EZG A;  3KP3 A;  3CZ6 A;  3MKL A;  1MJA A;  2PMZ A;  3VDX A;  2CYY A;  2ELK A;  1KU9 A;  2VT3 A;  5ILV A;  5D5V B;  3L2W A;  1QHH D;  2LYC A;  2LKX A;  2R5Y B;  4PGG A;  5E18 F;  4TV7 A;  1D8K A;  3SEQ A;  4IEJ A;  4DOZ A;  2ID3 A;  1RUO A;  3WGI A;  2X9D A;  4A2U A;  4XN0 A;  3DU6 A;  1I6H J;  3R0J A;  4RB0 A;  4KMU X;  4ANJ A;  4P55 A;  4PZJ A;  1KA8 A;  2X6Y A;  3LSP A;  1Z77 A;  2L9V A;  5A2Q Z;  2PJR A;  4HX7 A;  3ASO H;  1FTT A;  1HSJ A;  2G0E A;  2ID6 A;  5L3B A;  1S7E A;  2FD5 A;  2JSC A;  1A5J A;  3KLO A;  1D1A A;  3VSL A;  1SC7 A;  2CFX A;  1T2K A;  2VQL A;  4UY8 I;  3Q5F A;  2HVS A;  5F1R A;  5IY5 H;  1LEA A;  3RYP A;  1LE8 B;  4OIP F;  3I58 A;  4W1U A;  5HOD A;  1UG0 A;  1U0J A;  3B73 A;  1ZG3 A;  1EH8 A;  4XLE A;  1LVK A;  5DEQ A;  2AS5 F;  2B7E A;  5TJJ A;  3GYH X;  2W1O A;  1QRY A;  1S7O A;  2NXN B;  2W7N A;  4HNU A;  1TNS A;  2DOF A;  5AON A;  1IN4 A;  3G3Z A;  1LNW A;  4MTD A;  4PSX A;  2XSD C;  2LKP A;  2M5W A;  1WWX A;  4E7I A;  1PJR A;  1I3Q J;  1OYW A;  2D45 A;  2OU2 A;  3QPS A;  2VXD A;  4E7J A;  3C3W A;  1M1E B;  2JA6 J;  2JQ7 A;  2WBM A;  1ETO A;  2RNJ A;  1MW7 A;  3E0J B;  4OIR F;  3CJN A;  1J09 A;  1ZRE A;  1JHH A;  3S16 J;  2AQE A;  4KIS A;  3MMY B;  2DQR A;  4OWR B;  4CUG A;  2ME0 A;  4A3L J;  4PSW A;  2E34 A;  2P0W A;  2DK8 A;  4AIK A;  1X3Z B;  1ODD A;  4BBR J;  4V2F A;  2HZT A;  1TLH B;  5TGT A;  1QBJ A;  1YW8 A;  5K5O A;  1TQM A;  2Y0M A;  2PG4 A;  2PN6 A;  4EM2 A;  2W84 A;  3KCC A;  1X1D A;  3VPR A;  1U5T C;  3JTH A;  2EIL H;  1V4R A;  4PJJ A;  4AYB A;  2NNY A;  1FJL A;  1CQT A;  2KPM A;  1F1Z A;  1ZKG A;  5E1X A;  3L2V A;  3KET A;  2V79 A;  3BZ6 A;  5J1R A;  2Z5U A;  1YX5 A;  2OUM A;  1W4M A;  3GW2 A;  3KZY A;  2R5Z A;  5E3O A;  4KUM A;  1LB2 A;  4IHW A;  4QPQ A;  2JTV A;  3KLN A;  4BNC A;  3DBL B;  4KIB A;  2MA3 A;  1YIT I;  1PUE E;  1VQ5 I;  3F6V A;  2ADU A;  3CJT B;  1U3E M;  1UHW A;  4LB6 B;  3AL0 B;  3HBL A;  4IRH A;  1OJL A;  3BJO A;  3JSP A;  2RQP A;  2AQF A;  2ZKZ A;  4M9X A;  3FMR A;  4BXF A;  3LST A;  2RAE A;  1A35 A;  1PYV A;  5ICF A;  1Z3Y A;  4CSW A;  2WTE A;  5FGM A;  4AYB N;  2K9M A;  2ZSI B;  2A69 F;  3L7W A;  4HEA 2;  1LFB A;  1SVL A;  1V5F A;  3S2W A;  2ZC2 A;  3CUQ C;  1XC5 A;  1TTY A;  4WX9 A;  1MBG A;  2FMY A;  2IGO A;  1IRX A;  1ETV A;  3TW6 A;  3F3X A;  2VL8 A;  4IVN A;  5L3D A;  1LFP A;  1HKT A;  1H9G A;  3CC4 I;  5E20 A;  3MKY B;  3VWB A;  1B6A A;  2K3P A;  4ABZ A;  3LL7 A;  2IS2 A;  3N4M A;  4B09 A;  3LQQ A;  1ZRF A;  3HPH A;  1ORK A;  5J4Y A;  4W97 A;  2JVG A;  2L4M A;  1OR7 C;  5EG0 A;  4CGZ A;  1K78 A;  3RPU A;  3SDB A;  2HNH A;  1Y0N A;  2DOE A;  2MGQ A;  5HDG A;  4ZDP A;  2DDB A;  1BBY A;  1XX5 A;  4O3M A;  1U78 A;  2O6G E;  2FBI A;  2QQ9 A;  1FOW A;  4M6X A;  5J8C A;  3RDI A;  1MMD A;  1FP1 D;  2V9P A;  3PUB A;  1TC3 C;  3PJR A;  1LVA A;  4EJO A;  2KFD A;  3DTE A;  2BE5 F;  2LKS A;  3BOQ A;  2XHK A;  4NC6 A;  1JUP A;  4O6J A;  4X1E A;  3DFG A;  3RIR A;  1LEB A;  3CUQ A;  2P8T A;  2Y2Z A;  1IN8 A;  4UB6 C;  2H27 A;  1B72 B;  2Z9O A;  3HSF A;  2OD5 A;  1GLN A;  2PMH A;  3L09 A;  4XSX F;  1ZAR A;  2LC2 A;  1PP7 U;  3FXO A;  5M5X J;  4HAM A;  1HKQ A;  4BBS J;  3O3K A;  1G59 A;  3AL0 C;  3GLL A;  4F7Z A;  2DA1 A;  3HDD A;  4D5C A;  1YJW I;  1T08 B;  4CHU A;  2MFZ A;  1F4K A;  3L00 A;  4DNC A;  1R1T A;  2VB6 A;  4KT6 A;  2OTL I;  2IGK A;  2EBI A;  1P4W A;  5J4V A;  4DW6 A;  4BAY A;  1UHS A;  5FB2 A;  2KIM A;  1JTX A;  3ERE D;  3KP7 A;  4ITV A;  2HDC A;  1ZGW A;  5J47 A;  1WJ5 A;  1U9N A;  2VIX A;  3FDY A;  4I6Z A;  4LLG F;  3GTO J;  1WKM A;  4EJU A;  3GFI A;  2F5E A;  4MTE A;  3MZH A;  1IRZ A;  3ZQI A;  2JVH A;  2GLO A;  1Q1V A;  4R1H A;  5K5Q A;  3OOP A;  4FAS D;  3CJR B;  2V1D A;  4UUS A;  2Z1D A;  3AKZ A;  1MMN A;  5CVU A;  3FXK A;  2DA6 A;  3H5R A;  1JI8 A;  3E6D A;  3JW4 A;  4NQW A;  4U7B A;  2HWV A;  2JN6 A;  5BPI A;  1HLV A;  3JR9 A;  1YOV B;  2FBH A;  4CCK A;  3A02 A;  3AG2 H;  3DLA A;  2IA1 A;  2EQR A;  1J2X A;  2O3F A;  4GO1 A;  2TDX A;  3PFI A;  2DQL A;  2J5O A;  3ZRG A;  3BCB A;  3J7A O;  4BAC A;  2CV2 A;  3PUF A;  2BEO A;  5CLS A;  3D0S A;  3RYR A;  2R7D A;  5FLX K;  2CU7 A;  3CES A;  3BG6 A;  1J59 A;  3KP6 A;  4ENN A;  2V6E A;  4KN4 X;  3S1R J;  3M8F A;  3AAF A;  4BDZ A;  1APL C;  3DU5 A;  3LOC A;  1DU0 A;  1GDT A;  3A1Y A;  4PDK A;  4UUT A;  1TT0 A;  3K6G A;  4M6Y A;  4F3Q A;  3NAU A;  4EQQ A;  2NVY J;  4MO7 A;  5K5R A;  3HPG A;  2M9H A;  2JPB A;  1B72 A;  3DBH B;  4ESJ A;  2CQK A;  3OYA A;  1SD5 A;  2OC6 A;  3HIF A;  3CCE I;  1BW5 A;  3OSG A;  4DIQ A;  3E97 A;  5HOO A;  1YJ9 I;  4D7M A;  3RPU D;  1Z9C A;  4EAT A;  3FK6 A;  1B1B A;  3NWS A;  3EDP A;  3MN2 A;  2NYX A;  4QWQ A;  2O8X A;  3REO A;  5E8I A;  4Y15 A;  2FU4 A;  3CCR I;  2OV7 A;  2VOP A;  3DTI A;  2GOX B;  2IBD A;  2R0Q C;  5JVG F;  3QPT A;  1OFC X;  5E3M A;  1D5Y A;  4CIC A;  2M2E A;  2ETH A;  1OR7 A;  3ZXS A;  4QTR A;  1IAW A;  5F27 A;  1SFX A;  2M8E A;  3O8G A;  4G6D A;  1D8J A;  4A0Y A;  3M4O J;  4BQO A;  4X0G A;  5HDK A;  2CH0 A;  3F6O A;  1U8B A;  5BOX A;  1SVO A;  3I4M J;  2VBX A;  3ABL H;  1X4P A;  1XGO A;  1UMQ A;  2F5C A;  4HV5 A;  2EB7 A;  5F64 A;  3E5U A;  3DKX A;  5ILU A;  2V9K A;  4PJL A;  5FLV A;  1ZEL A;  1MH4 A;  4DQ2 A;  1FIA A;  3DF8 A;  3CUQ B;  1C0W A;  4JX5 A;  5HLI A;  3C2B A;  4RAZ A;  2Y30 A;  2FA5 A;  2XVC A;  2PBI A;  2YR2 A;  3V7C A;  4MLO A;  4KNY A;  1UG2 A;  5FD5 A;  3H0G J;  2O8K A;  5TIS C;  4MHG A;  2OZ6 A;  2X4H A;  4CA0 A;  1FWZ A;  5EJC A;  1Z91 A;  3JRG A;  4ZDO A;  2YSR A;  4QSH A;  2O5R A;  2OPT A;  2C6Y A;  2A61 A;  2W24 A;  1NG7 A;  1LPQ A;  3U2R A;  3TP3 A;  1FOK A;  4NHJ A;  2X6X A;  3EUH C;  2F5V A;  5CKT A;  3CCL I;  3WTV C;  4ENJ A;  5BMZ A;  4NBQ A;  3K4L A;  3HTS B;  1DU6 A;  2DMU A;  4FE4 A;  1T56 A;  2YPR A;  5BPD A;  2A5W A;  2VUM J;  1Q1H A;  1UHM A;  5E1W A;  4KT5 C;  1TW2 A;  3ZPL A;  4UUV A;  2EFO A;  2F2E A;  2DA5 A;  5K1Y A;  1RR7 A;  3KYL A;  4J01 A;  3CDH A;  2E1C A;  2LH9 A;  4Y17 A;  1DGR M;  4A3D J;  4RGU A;  2DN0 A;  4A3C J;  2P4W A;  4HNT A;  2EV0 A;  4AM3 A;  2NS7 A;  2LF7 A;  2XB5 A;  1O3Q A;  1BC8 C;  3GCM A;  2LSO A;  2JA7 J;  1KU2 A;  1VQ9 I;  3QYE A;  5DCF A;  1S72 I;  1JKO C;  2ZCW A;  5EEH A;  1IXR C;  3QP5 A;  2HVR A;  1FNN A;  1MNE A;  1W7P B;  2HS5 A;  2MH9 A;  4C2M J;  3QOE A;  4AC0 A;  1ZG1 A;  2DLL A;  1IC8 A;  3PNT A;  2V1N A;  4I7H A;  3HKZ A;  2GIZ A;  3KPH A;  1U8R A;  3OV8 A;  2IP2 A;  1FOY A;  4IPA A;  4RDU A;  2R3S A;  2BVL A;  3FM5 A;  2HXO A;  5AIQ A;  3HC7 A;  4BS9 A;  1R6R A;  4XLH A;  1OIS A;  2DFE A;  2MLK A;  3CCM I;  1MNM C;  3I4P A;  1FEX A;  1OCP A;  2HZD A;  4CXF A;  1J9I A;  4IL6 C;  3MZY A;  2EZK A;  2M34 A;  3H9Q A;  3ZGK A;  1X58 A;  3DQV C;  4NNJ A;  1SMT A;  3FHZ A;  3S15 J;  1VF9 A;  1OYY A;  2IVM A;  3CLQ A;  4L9J A;  1HST A;  3P5J A;  1IUY A;  5TRD A;  2CUJ A;  2D2W A;  4HA8 A;  3ONQ A;  4OOI A;  1Y1V J;  5FKO A;  2HFH A;  2HOE A;  1DPU A;  5FRN A;  3HRU A;  3LSG A;  3TOA A;  3OMY A;  1K4S A;  1DDN A;  2EA4 A;  4E7Z A;  3MEX A;  2UXX A;  2QYO A;  3VYT B;  4C3J J;  4EM1 A;  2FF4 A;  3G6E I;  3IRQ A;  3OIO A;  3F23 A;  4A3J J;  1FMV A;  3D1N I;  1YW7 A;  3S14 J;  2HGC A;  3J81 Z;  4U0Y A;  3GFL A;  3I5U A;  3IL2 A;  3BDD A;  5F08 A;  3SQN A;  2DMP A;  4EVI A;  1AA7 A;  2GXA A;  1A04 A;  3GEZ A;  1GV5 A;  2Y9Y A;  1EV7 A;  1WJF A;  4A3M J;  1NH3 A;  2RN7 A;  2ZXI A;  4FQG A;  4B43 A;  2HOS A;  1ETK A;  4S05 A;  4XRM A;  1R4M B;  3ABK H;  4OU0 A;  3BT9 A;  2LNB A;  4FT8 A;  1YO5 C;  2VC0 A;  3OWT A;  3RKY A;  2CUE A;  2IW5 A;  3AFH A;  5EGO A;  1IXS B;  4BGD A;  4DYC A;  1U9O A;  3KP2 A;  3E1S A;  4A3E J;  5F6F A;  1MND A;  2F4I A;  4D0P A;  1QPI A;  1SMY F;  1X19 A;  5LEK A;  4XKC A;  4D1Q A;  2LLK A;  2JA8 J;  3I54 A;  2KT0 A;  1JXS A;  2IA0 A;  2Y31 A;  4P96 A;  4A0X A;  3I53 A;  3MD2 A;  5ICC A;  1SEU A;  4P9U A;  3ML6 A;  1KQ9 A;  5HS7 A;  2YU9 J;  1IDZ A;  4A5N A;  5BQT A;  3OIQ A;  1ZGA A;  5M3F J;  4I99 C;  3BTI A;  4AIH A;  2GQQ A;  4JOM A;  3J7Z I;  1QGP A;  3GTJ J;  1W5S A;  3JRI A;  2XAU A;  3O8H A;  1IN7 A;  3FMQ A;  4JQF A;  4OIN F;  2MH2 A;  4IHV A;  4I0A A;  3H5N A;  1TQI A;  3FIW A;  3K4N A;  1VQL I;  4GYI A;  1DUX C;  4M72 A;  5FD6 A;  2XB0 X;  1RR8 C;  2OQR A;  3SDG A;  3TDU C;  3OYC A;  4N4O B;  2V1U A;  3T0Y A;  2EK5 A;  2KL4 A;  5D8K B;  4AWX B;  1KYZ A;  1XGM A;  1UEL B;  1TBX A;  1ZK8 A;  1XDS A;  1W0U A;  1Z6R A;  2LY2 A;  1H8A C;  2OJE D;  1F43 A;  1WZ2 A;  4HPQ A;  3H9G A;  5E3N A;  4ETS A;  1SFU A;  4B1R A;  2FEZ A;  3F8C A;  1TP4 A;  4BQQ A;  4UVC A;  4AUX A;  3RQ4 A;  2M45 A;  5BS6 A;  4HLX A;  2EZL A;  1E0E A;  3LAJ A;  2ZXJ A;  2L7Z A;  3ELK A;  3K10 A;  2EWN A;  2VE9 A;  1WH5 A;  1IJW C;  2OBP A;  2M1B A;  3OL3 A;  2QSH X;  2EZH A;  2KIF A;  2E36 A;  4M6V A;  2FSW A;  3LSI A;  3PQK A;  2K9L A;  1A6Q A;  2L01 A;  2VT2 A;  5DM6 F;  1P9Q C;  2WB1 A;  2OCE A;  4A3G J;  3P7N A;  4A6E A;  2W85 A;  3L2Q A;  1K6Y A;  3PIO F;  3W2W A;  1FYK A;  1Z7L A;  3EUK L;  1Y39 A;  4PFO A;  1BIA A;  2L4A A;  5ICE A;  1VQN I;  5ILS A;  2YUS A;  1XCB A;  1ZN2 A;  4YIF A;  3BTC A;  3K2A A;  3HOV J;  1REP C;  1G3S A;  3IV5 A;  3FHN A;  1P2F A;  2AO9 A;  3WTW C;  4HDV A;  1K6O A;  1ZHF A;  3LNQ A;  4E7K A;  2KIS A;  5HVQ C;  2NOJ B;  1RUN A;  2XV4 S;  2P7V B;  3M1C A;  3MKW B;  4I09 A;  1K79 A;  3QWL A;  4MQV A;  1JT0 A;  2LRD A;  1WFX A;  5DUI A;  3BTL A;  2FE3 A;  4YFK F;  4BKX A;  3C1D A;  3CMM A;  1B59 A;  3S93 A;  2HTJ A;  5HNF A;  3V8K A;  2W82 A;  4F91 B;  5M3M J;  2DYS H;  2IGM A;  2JRM A;  3ZMU A;  1P7I A;  3WG9 A;  2UUZ A;  2RC4 A;  2RRE A;  3CUO A;  3HTU A;  3G1M A;  2M30 A;  3WG7 H;  1BJZ A;  3IAM 2;  1WJD A;  1TWF J;  1SFE A;  4GDF A;  2E2H J;  1B4A A;  4HX8 A;  3ASN H;  2XRO A;  2IT0 A;  1V3F A;  1YHQ I;  3KIO A;  1O7L A;  2K4J A;  2W25 A;  2MC4 A;  5FFZ A;  2ESN A;  3HSR A;  2Q1Z B;  5EDN A;  1YE9 A;  1T33 A;  4MIM A;  3SFI A;  2K3F A;  1RZ4 A;  3QPL A;  4MNU A;  4RM3 A;  1JGG A;  3IKV A;  4C3I J;  3K1N A;  2X1C A;  3QYB A;  4E7L A;  3IH2 A;  3ZQH A;  1R5H A;  3OYM A;  2ZJR F;  3H3U A;  3LSM A;  3HB9 A;  1WI3 A;  3AG1 H;  5JHU A;  3K2Z A;  3RZD J;  1QU3 A;  1IV8 A;  3SZG A;  4S0H B;  1LFU P;  1Y8Q B;  3DXJ F;  2V26 A;  2DCE A;  3DEE A;  1KQ0 A;  1FX7 A;  2UXN A;  4BY7 J;  2X48 A; 
#chains in the Genus database with same CATH homology
 1GLN A;  2XF5 A;  2LC2 A;  4LIV A;  2R4G A;  2CMP A;  1D0Y A;  3OYK A;  1G59 A;  3AL0 C;  2WAE A;  1BR4 A;  2MAB A;  3EPZ A;  2K5C A;  4XL9 A;  2MFZ A;  3LFU A;  1Y6I A;  4YEL A;  4C2T A;  4YRV A;  2VB6 A;  2XC7 A;  3KX2 A;  1S9H A;  4KT6 A;  4U87 A;  2IGK A;  3IP4 B;  2M7B A;  4ZJZ A;  4B48 A;  2KQR A;  2L9S A;  2MD0 A;  3LSH A;  4E4H A;  4ITV A;  2DJI A;  3S3M A;  4C2U A;  1WJ5 A;  2VIX A;  3FDY A;  1MMG A;  4DJA A;  2XF7 A;  3DPT A;  2JVH A;  1TZL A;  1V5E A;  4IQ4 A;  2JA2 A;  4FAS D;  2LRE A;  1N75 A;  3CJR B;  3DKY A;  3VYU B;  4BEH B;  3LSK A;  2Z1D A;  3AKZ A;  1MMN A;  3CJQ B;  1ERD A;  3RSN A;  2KRH A;  3H5R A;  1JI8 A;  4P1W A;  4F92 B;  4XON A;  4NQW B;  4U7B A;  1WJE A;  1OLT A;  4CCK A;  3K70 D;  3DLA A;  4B44 A;  1T95 A;  2KZV A;  3ZRG A;  5LD2 C;  3BCB A;  4BAC A;  3G2B A;  2CV2 A;  2ZXH A;  4BJT A;  3CES A;  4E7S A;  3BG6 A;  2A6T A;  1D0Z A;  2V6E A;  3PSF A;  4BDZ A;  1LKX A;  4CZC A;  5KNL A;  3DU5 A;  3CP2 A;  3A1Y A;  2LBF B;  3U21 A;  2X85 A;  4CCJ A;  1TT0 A;  3K6G A;  2V7F A;  3LMM A;  4F3Q A;  3CF2 A;  1W36 D;  4BJ5 C;  1SFK A;  4ZDL A;  3D5L A;  3K70 C;  2HDW A;  3HPG A;  3SYT A;  3OYH A;  2X51 A;  2FUG 2;  3FBI B;  2VQC A;  2M4K A;  3OYA A;  2UV1 A;  2R7Q A;  2IGN A;  2OC6 A;  4PFP A;  3VSK A;  4DIQ A;  5HOO A;  4BE0 A;  4GRI A;  2DOA A;  3RPU D;  3OYJ A;  2XF6 A;  4EAT A;  1SAU A;  3D5R C;  3NWS A;  4CCO A;  4KJZ A;  2HU9 A;  4G6T B;  4DBQ A;  2OV7 A;  1Z3X A;  3MKZ A;  4AU7 A;  1X1B A;  3DTI A;  2GOX B;  3C2G A;  3D5S C;  4XLF A;  3SEZ A;  5KCM A;  4DBR A;  4LIU A;  3OR2 C;  5KHD A;  2CFO A;  3ZXS A;  4BE2 A;  2VPL A;  2CUZ A;  4BQO A;  4X0G A;  2CH0 A;  4RMN A;  2VLA A;  2L7K A;  1N77 A;  1EA3 A;  1MMA A;  4B3X A;  1X4P A;  2R7X A;  4NC7 A;  3OIP A;  3DKX A;  4HG2 A;  3H9J A;  2V9K A;  5JHF A;  2BW3 B;  3BC8 A;  4PJL A;  4YEJ A;  4ZYA A;  2BW3 A;  5HLT A;  1ZEL A;  3H35 A;  3RCO A;  4Y3O A;  4BU2 A;  4MLO A;  4XQF A;  2HQA A;  3DWL E;  2DT6 A;  2V4J C;  4CA0 A;  4F52 A;  4ZDO A;  1D0X A;  2Z16 A;  2O5R A;  3CP8 A;  3QOD A;  4BE1 A;  1NG7 A;  4RLF A;  3VYR B;  2X6X A;  3EUH C;  2F5V A;  2JSP A;  5CKT A;  3A2K A;  4XN3 A;  2Z2S B;  3K4L A;  3C2H A;  2A5W A;  3UR3 C;  3QYF A;  2GOM A;  4BQN A;  3S3N A;  1WJA A;  2R7S A;  3K4K A;  3KYL A;  4J01 A;  3KEY A;  4PUS A;  2LH9 A;  2F6C A;  3OR1 C;  2DXI A;  1DGR M;  1BR2 A;  2KP6 A;  2BOL A;  3BG7 A;  4DGW B;  4HNT A;  2Y0S A;  2R7O A;  3F9K A;  3GBG A;  4XM3 A;  5FRM A;  3K4B A;  3QYE A;  2VXZ A;  4PK4 A;  1WJC A;  4E6K G;  2IS6 A;  3DPL C;  2VJI A;  1BR1 A;  2HVR A;  1MNE A;  4XLC A;  2XSJ C;  4XR6 A;  1Y56 A;  2LY1 A;  3QOE A;  2WAD A;  4OAZ A;  2PJR B;  4HST A;  3OS1 A;  3EUA A;  3PNT A;  3HXL A;  4RLQ A;  2V1N A;  3HKZ A;  2CV0 A;  1BOB A;  2E60 A;  4ZTJ A;  2E5N A;  1YX3 A;  3OOU A;  3IUO A;  4BL0 B;  2BVL A;  1X4O A;  3HC7 A;  4BS9 A;  1Z21 A;  1R6R A;  4XLH A;  2M0M A;  4P5O A;  2HZD A;  3OYL A;  2QKL B;  2ZSH B;  4XNF A;  3ZGK A;  3OL4 A;  3H9Q A;  2L2O A;  1LDK B;  2E1M C;  3DQV C;  3W2A A;  3K4J A;  3FBN B;  4NNJ A;  3NWT A;  4XKV A;  3OYE A;  1X1A A;  4B47 A;  4IX7 A;  2VAS A;  2IS4 A;  4N4N B;  2I8D A;  5CQG A;  2CUJ A;  3K4M A;  3V42 A;  3HOS A;  3A4C A;  3ONQ A;  3OYD A;  1DGW Y;  5FRN A;  4ZC3 A;  3PSI A;  4Y33 A;  3LSG A;  4II3 A;  4XKW A;  2HVQ A;  3OMY A;  3TL4 X;  2VJJ A;  4BJ6 C;  1DQU A;  4CCL A;  2JUG A;  3UNG C;  4E7Z A;  4J00 A;  3BLY A;  1W36 C;  2KMU A;  2R7T A;  3VYT B;  5LFA A;  3PNY A;  1FMV A;  4PJM A;  4H4K C;  2L9N A;  3OS2 A;  3CZ6 A;  3VYS B;  2PMZ A;  3VDX A;  1V5G A;  2W00 A;  1AA7 A;  3L2W A;  1QHH D;  2LYC A;  1NG6 A;  1WJF A;  3S32 A;  3OY9 A;  2KLO A;  3SEQ A;  4DOZ A;  1KON A;  2X1E A;  2M3A A;  3IAS 2;  3RTR A;  4XMY A;  2ZXI A;  4XN0 A;  4FET A;  4B43 A;  3DU6 A;  3OS0 A;  2R7R A;  4ANJ A;  2X6Y A;  3OWT A;  4PJN A;  2PJR A;  3AFH A;  4R79 A;  2KDO A;  4BGD A;  3E1S A;  2ZFU A;  1MND A;  2F4I A;  1D1A A;  4QPO A;  3VSL A;  3OYF A;  1X19 A;  4BUP A;  4XKC A;  3OYB A;  4D1Q A;  2VQL A;  2RQQ A;  2HVS A;  3MD2 A;  4OAY A;  3W3C A;  3N05 A;  3ZCO A;  4NUB A;  1DP3 A;  1D1B A;  5CPR B;  3DTK A;  1T0F C;  3OIQ A;  2W4S A;  4IKF A;  1UG0 A;  1U0J A;  1VZ0 A;  2LOO A;  4XLE A;  1LVK A;  4JOM A;  3OYN A;  3H0D A;  4AVZ A;  2WAF A;  2XAU A;  2W1O A;  4JQF A;  2Q2E B;  4HSR A;  4XOT A;  4XOP A;  2W7N A;  2CS3 A;  4XOR A;  4HNU A;  1G8X A;  2HPI A;  3DPU A;  4LIT A;  3HUG B;  2WAQ A;  2R7V A;  4KIT B;  3H5N A;  3K4N A;  4PSX A;  4E7I A;  3OYC A;  1PJR A;  4N4O B;  2VJ4 A;  3I3L A;  2KL4 A;  2IXS A;  2VXD A;  3M8J A;  3ZQQ A;  4E7J A;  2WBM A;  1MW7 A;  3E0J B;  1UEL B;  1J09 A;  3S3O A;  2IS1 A;  2AQE A;  4KIS A;  3BCA A;  3MMY B;  4OWR B;  2LY2 A;  4CUG A;  3FKJ A;  4PSW A;  4HPQ A;  2P0W A;  3H9G A;  3K4C A;  4XKB A;  4BQQ A;  1WJB A;  5TGT A;  2CV1 A;  1HA8 A;  3HG9 A;  3RQ4 A;  3J7A Y;  1X1D A;  2WY8 Q;  4IQJ A;  1E0E A;  2R7W A;  3K10 A;  1FMW A;  4PJJ A;  4AYB A;  5FRO A;  2WA0 A;  2E5Z A;  3OL3 A;  2KPM A;  2M7A A;  4XLA A;  4Y4R A;  1N78 A;  3L2V A;  4F93 B;  3LSI A;  3ZR8 X;  1YX5 A;  2OUM A;  3TMO A;  4F55 A;  2DT7 B;  2K9L A;  1P9Q C;  2WB1 A;  3OYG A;  4QPQ A;  1UAA A;  5CQE A;  4LG3 A;  2R7U A;  3L2Q A;  1K6Y A;  3W2W A;  1Z7L A;  3EUK L;  4PFO A;  4CCM A;  3AL0 B;  1D1C A;  2AQF A;  3FHN A;  4BXF A;  3L2R A;  1PYV A;  1Z3Y A;  4CSW A;  3L2U A;  4E7K A;  5HVQ C;  2VQH A;  4E7H A;  2K9M A;  2ZSI B;  2NOJ B;  4HEA 2;  2RNG A;  1V5F A;  3M1C A;  3MKW B;  4IZZ A;  2MYS A;  4C30 A;  3W2V A;  2IGO A;  2LRD A;  3HOT A;  2UWM A;  2XDV A;  1IRX A;  1WFX A;  4HRI A;  2VL8 A;  1LFP A;  2X6W A;  2VQG A;  3MKY B;  3CMM A;  3VWB A;  3H5A A;  3S93 A;  4BEH A;  5HNF A;  2K3P A;  2W82 A;  3LL7 A;  2IS2 A;  4F91 B;  2LG4 A;  3HPH A;  5HNH A;  2IGM A;  2UUZ A;  2RRE A;  2M4G A;  2JVG A;  3HL2 A;  3IAM 2;  1OR7 C;  3PNV A;  2WY7 Q;  1WJD A;  2CW8 A;  4RM2 A;  3PL8 A;  4NC8 A;  3PFY A;  2L5Q A;  3TBI A;  3SDB A;  2HNH A;  2KHM A;  2ELJ A;  4BDY A;  4ZDP A;  4CCN A;  2MC4 A;  3S8P A;  2Q1Z B;  1YE9 A;  4RM3 A;  2CW7 A;  1QHG A;  4ZTF A;  2X1C A;  3QYB A;  3I9V 2;  2VKH A;  1MMD A;  2X1D A;  4CH7 A;  3OYI A;  4E7L A;  3PUB A;  2E1M B;  3PJR A;  3OYM A;  4C9Y A;  2LBF A;  3LSM A;  3DTE A;  2KRC A;  4II2 A;  4D9J A;  1QU3 A;  1X1C A;  3SZG A;  2V26 A;  2DCE A;  2QKM B;  3DEE A;  2HPM A;  2BVM A;  2VJ5 A;  2VKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...