1WJAA

Solution structure of the n-terminal zn binding domain of hiv-1 integrase (d form), nmr, regularized mean structure
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the N-terminal zinc binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Zn-binding protein
total genus 10
structure length 47
sequence length 47
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjaA00
3HPHA 1K6YA 1WJEA 1E0EA 1KONA 1WJDA 1WJFA 1WJBA 3HPGA 1WJAA 4F3QA 1LFPA 1MW7A 1WJCA 3F9KA
chains in the Genus database with same CATH superfamily
2KIMA 4B47A 2GIZA 2Z2SB 2HQRA 5CVVA 4NQWB 3CCQI 3A0BC 1WJCA 3OMYA 2R7ZJ 3VOEA 2CV2A 1WKMA 3I71A 3SDBA 1TZLA 3KIOA 2P7VB 2UUZA 2XB5A 1MH4A 1UG0A 3HKZN 2L7ZA 3M9AA 1KU2A 3K4JA 3WTTC 3QP5A 2H8WA 4Z6YA 2MA3A 1LEBA 1RETA 3V4GA 1SVLA 3SYTA 1D8KA 2KQRA 1O3RA 3LQQA 1WRJA 5M3FJ 3GLLA 3OIPA 1IC8A 4I76A 2EB7A 2K3FA 3BP8A 4NB5A 4JQFA 4XRMA 5JR3A 1D8JA 2CFXA 3L1PA 3L00A 1VQ9I 2CUEA 2O8XA 3ECHA 2R7DA 2W85A 4LFUA 1NTCA 5E3OA 1XCVA 2QKLB 3TDZC 3BR2A 5EZHA 3VFZA 2DA7A 2P5LC 3E5QA 4ENJA 3J81Z 1D3YA 1SMTA 3RSNA 4C3JJ 1ZHFA 1JTYA 3ONQA 2ID6A 4NC6A 4KA4A 3B02A 2D5VA 2F5FA 4LIVA 3OS0A 2Z1DA 3EUHC 4IZZA 1JJ6C 2ZXIA 5C44J 3G73A 2RNGA 2L7KA 2LOOA 3N05A 3I58A 2CQKA 2HKOA 4OIPF 1BIBA 1YX3A 2XRLA 4A3MJ 4I02A 2Q2EA 3FIWA 3J80K 2Z33A 1FOYA 1PUEE 4H0EA 2A5WA 1BR2A 4V19K 2E5NA 1XTAA 1ODDA 4E70A 3JRIA 1OCZH 1YW8A 1VNDA 2MFZA 3RTRA 1LFUP 3H5RA 1USSA 1EV7A 3H9QA 1VQKI 4AIDA 1YLFA 4M73A 3CP8A 2R7WA 3JRFA 1A35A 1MMAA 1P4AA 4YFXF 4P55A 1JI8A 1UHWA 1TQIA 2BHZA 1VZ0A 5IP9J 4GGGA 3VYSB 1SD6A 5F0CA 3GTKJ 5D8KB 2HXOA 3NAUA 5DS9A 4XLPF 1VQ7I 5FLVA 1WJAA 2IGKA 3U1KA 3KZZA 1VF9A 4BJ6C 5HS9A 2NVQJ 3C2GA 5E1ZB 1Z6TA 5IT9K 4DGWB 3OYNA 3Q0WA 1U3EM 3F6VA 4ENNA 4E7IA 3GEZA 5DCMA 1T6SA 5L3EA 3WG9A 3HRSA 1BBYA 1BM9A 3K4CA 1WSUA 2DFHA 3CC4I 4IPAA 1OCPA 4BQQA 3IV5A 4DZJA 4ESBA 2VXZA 4M3GA 5EEHA 4RAZA 3TP0A 1T95A 2K7LA 2QQ9A 3M8EA 5CPRB 1J9IA 4C2MJ 2V7FA 3W2VA 2XRNA 2JZYA 4XQFA 2R7OA 3FHNA 4ZYGA 3BC8A 1BI0A 2FUG2 3NRVA 3PUFA 5DDGA 2R0QC 1V5FA 2QCOA 4V2GA 1VTNC 4CXFA 3JRGA 4J00A 4AIHA 1GLNA 5E1WA 2VODA 1KYWA 1TWCJ 1FLIA 3CMMA 3JSOA 2IVMA 2MD0A 1EJ9A 1QGPA 2HQNA 4B3XA 2HNHA 2Y30A 2Q2EB 3HGGA 3F72A 4DOZA 3CTAA 1SVOA 3FKIJ 2DMQA 4YEJA 2X48A 3ESWB 4YIIA 1LEAA 1JJ8C 2E2JJ 3OL4A 4BE2A 3C18A 1DU6A 3U1DA 2R7QA 2M8GX 4KN7X 1KQ0A 3V8LA 2PMHA 2F5VA 3HZJA 4MQ9F 4QIWN 3N4MA 2UXNA 1YIOA 4O5VA 3GZNB 3ZQCA 3S16J 2HQ5A 3R61A 2LY2A 3KP5A 3CCSI 3TW6A 2OBPA 5CVRA 3FXOA 2LYCA 2EV6A 5TJJA 1JGSA 3TGNA 3CUOA 4ABZA 3DLAA 2BV6A 1FPQA 4EGZA 2HI3A 2MH9A 3OYLA 2P81A 2QSGX 1QVUA 1T0FA 3HG9A 2R5YA 4M6XA 2DMPA 2DO7A 3CCYA 5FLXZ 3HIFA 1CQTA 3MKYB 3WTWC 4AVPA 3FMRA 4O6JA 4XN0A 4WX9A 3S32A 4E7JA 2GWRA 4IJAA 1X4PA 4IKFA 2ELJA 2YPRA 2B7EA 2MABA 3B6CA 1U2WA 2CSOA 3DEWA 5CQGA 3WTUC 4FX4A 2EA4A 2JA5J 4OIQF 3OYFA 4ENMA 1MBFA 1WVRA 4NUBA 3SDGA 1IG7A 3E6DA 3LAPA 1JGGA 2E34A 2HOAA 3OS1A 1G3YA 2A69F 1C0WA 1XC5A 1DGRM 2B0LA 1R1VA 1LVAA 3JAMZ 4DBRA 1I27A 2L5QA 2G7HA 4FQGA 1QU3A 4HNUA 2KZVA 1H8AC 2MYSA 3D5LA 2CQNA 5B66C 1B9MA 4I01A 3PUBA 1ETVA 1MSFC 3M3YJ 2L54A 2IGMA 2PMZA 3RZOJ 1XB4A 3DPUA 1I5ZA 2CQQA 3HSEA 3VSKA 3JTHA 4B8XA 1ON1A 4WCGA 3HDDA 2FOWA 4KIBA 4KICA 4A3FJ 2M9HA 3OYMA 2YX7A 3JRCA 3H0DA 3OV8A 4ZDOA 4GFBA 4LLGF 1WH5A 2EFPA 5DD8A 1S9HA 4OAZA 2NAZA 4S05A 2BW3A 2LK2A 3BR6A 3LA3A 2JMWA 4M9ZA 2HVRA 3FWEA 5E18F 3PJRA 2JA7J 1YHQI 2JVGA 4X6AJ 1OCOH 2DOAA 2CH0A 2X4HA 1ON2A 2DU9A 1K6OA 3E97A 1TT5B 1MIJA 2TRTA 3O2PE 2JUGA 1QZZA 2HYGD 5DTDA 2KDOA 1EH6A 1XGOA 2HDWA 2BBYA 1HXDA 2OU2A 3H0GJ 3M4OJ 9ANTA 3CP2A 2AO9A 3AG2H 4G9YA 1ZH5A 1O4XA 5IOYA 2HU9A 3DEUA 3FBNB 4E4HA 3K4BA 3I5UA 1QZYA 1JUSA 3CCMI 1Z1DA 3TO6A 3BG5A 1B72A 1I1GA 2AQEA 1JTXA 1QZEA 3MD2A 2L9NA 4MNUA 5BQTA 3F8CA 1SFUA 3VWBA 5A2QK 2ME0A 4HLYA 1U8RA 1QA6A 3HTSB 1R6RA 4XN3A 2EFWA 3F6OA 2V6EA 4N4NB 2Y0SA 3JR9A 3P9CA 1J5YA 3S17J 4BQOA 1P4WA 1HSJA 1V4RA 4RM3A 3E0JB 5LEJA 3VYTB 1R00A 1OR7C 4IEJA 4XNFA 4AWXB 2XAHA 2H09A 1PVEA 4BL0B 4A3DJ 3HHHA 3MMYB 2EFOA 5ICGA 1ZGAA 3GCMA 5LHIA 2LRDA 1WJ5A 3WTZA 2K9QA 3HOSA 5CKTA 3GZ5A 1V54H 2OUMA 2LTPA 2GAUA 3OR2C 3PFIA 1W36D 2R93J 1HKQA 4OAYA 4P9FA 4L0ZB 2E2IJ 2W7NA 5DD4A 3X2QH 3J80Z 2JUCA 3CO6C 4U0VA 2BW3B 3RCOA 3JRAA 1HDPA 3BCBA 1X1BA 4RB0A 2DOFA 3K70D 4CHUA 4XLHA 3IAS2 3LA7A 1JHFA 2OAZA 2K40A 2JWTA 2UXXA 1TWAJ 4F3QA 1OCCH 2EWNA 4B44A 4BACA 1KU7A 3MZHA 1FMVA 4BHBA 3JRHA 4UUVA 4A3LJ 1IO2A 2ZSHB 4FHTA 2QSFX 3QRFF 2VJJA 4YRVA 3ZMVA 2CO5A 2FEZA 3I3LA 3K2AA 1R71A 2LY9A 1TWGJ 2EFNA 2DDAA 2DT7B 3R60A 4I99C 5EG0A 3MKZA 2A6TA 3UKGA 3PO2J 1PUFA 4PJ0C 5ICFA 1D5VA 2HS5A 4D5CA 2W1OA 5LHHA 1N77A 4AM3A 3E3VA 1VQ8I 1P9QC 5C4JJ 4N0BA 1ZLKA 3KP7A 1B72B 2ICWG 1HDDC 5L3BA 1FOKA 2V26A 3KP4A 3OYAA 1QQIA 3T1BA 3WTVC 2ECBA 1LDDA 1YIJI 4P9UA 2HTSA 4WXHA 3QYFA 2HDCA 4Z2YA 2EV5A 2QLZA 4A0ZA 1VQLI 1Y8QB 5LRSA 3ZMZA 2M4KA 3GTPJ 3A03A 2BOLA 3H3VK 2M0MA 4IOCF 1G6NA 4G7OF 3H9JA 1LDKB 2WY7Q 3ZQ7A 4AIJA 3NWTA 3CCVI 2HDDA 4GRIA 4NDLA 3WE3A 2ZJQF 2BY3A 5LBQA 4BKXA 5FKLA 4F93B 4RGUA 1WFXA 2IGOA 2L0KA 4B3AA 2LC2A 4ASNA 3CO7C 1ITYA 2VE8A 1HCRA 2Y0MA 1LFBA 1QNTA 4HQEA 2HXIA 4TV7A 2X6XA 1T56A 2CW7A 2O03A 4BGDA 4CDGA 3K69A 2BVMA 3O8GA 2E1OA 2W4SA 3FX3A 2XAGA 1T39A 1K6YA 3CJNA 2MGQA 1WJFA 5DYMA 2OTLI 2E1NA 5EG0B 3DBLB 4L5EA 3QPHA 5J4VA 1SFOJ 5E3NA 1GT0C 4EM2A 1PUFB 4EJOA 4UHTA 3AL0B 1UHSA 5CJ9A 3V8JA 4A3EJ 2DYRH 2VBWA 3VYUB 4A3BJ 2DQRA 2R7RA 1XN7A 2VI6A 1ZQ3P 1VQPI 2X9DA 5F08A 2R7VA 1DGWY 2LFBA 1D5YA 2COMA 4LK1F 2KZGA 4YIRX 1G8XA 4OWRB 1WH7A 2ELKA 4B4CA 2FA5A 4E7HA 1VFCA 5GPCA 2XF5A 3ZMUA 1U0JA 3T5XA 4XRSG 4RDUA 3HUGA 1HLVA 1Y1VJ 1LJ9A 3IL2A 4D1QA 2M0CA 4M72A 3FISA 2DFIA 1SD5A 1YG2A 2F4IA 3H5AA 3K6GA 1VQMI 3CLQA 1HW5A 1U9OA 2QVOA 3C2BA 2HOTA 2PJRA 5CVUA 1MMNA 2BGCA 4BXUA 2IBDA 3RPQA 2IW5A 5J47A 1SFEA 4CCOA 4RS8A 1FJLA 3ABKH 1FIAA 1TTYA 1Y6IA 1IXRC 3Q5FA 5CQEA 4EJUA 1YE9A 2VBYA 2O3FA 4LLLA 2IPQX 1SVMA 5TISC 1ZREA 1FYMA 3F22A 1LDJA 5J1UA 1BI2A 4LK0F 5DUIA 3RI4A 4G94A 3DF8A 5J8CA 2DLLA 2H1KA 4IHTA 3HOXJ 4M71A 4PGHA 5AIPA 2O6GE 3SXYA 1FC3A 2ESNA 4NBQA 2ESHA 4ZTFA 2KIFA 1FT9A 2QENA 4U7DA 4FCYA 1U6GA 4LB5A 3OIOA 1S72I 4BNCA 4CCLA 3D1NI 3BTCA 2I10A 1BOBA 1OLTA 2G7UA 2F48A 3ABUA 1TNTA 3BZCA 2STTA 3S8PA 3QOEA 2B9SA 2ZO4A 2WV1A 2R7SA 3P5JA 1BJAA 1HBXG 2KLOA 2ACJA 4HV5A 3ASNH 1S7EA 2GZWA 1FNNA 5BNGA 2FSWA 2VQHA 4OMYA 1GV5A 2F2EA 2Y31A 4XM3A 3T8RA 2JSCA 3COAC 3DTIA 4UB6C 2KMUA 4IHWA 2KFDA 2LF7A 2NS7A 3MZ8A 4CCNA 3WU2C 1XSDA 4PDKA 3VYRB 1TC3C 5A2QZ 5IYDJ 2A5YB 5ERIA 3LSHA 5IP7J 1PP8F 4I2OA 4L0YB 3ECOA 2PJRB 4RB3C 2FD5A 3KEQA 2FXAA 2XSJC 3LSTA 4I0BA 1Z21A 5J1RA 2LR8A 2TDXA 3KZIC 3ZMTA 3F23A 1W5SA 2L3DA 4ZH4F 3IUOA 2QF7A 1FX7A 4UVAA 2LKPA 3ML6A 4I98B 5F6FA 3FXLA 3FK6A 1UHMA 2LLKA 1P7IA 3BG7A 5D8LB 3I0TA 3CCLI 4BE0A 3CF5F 5GAHJ 4J19A 2IP2A 2OCCH 1WQ2A 3SFZA 4CYCA 3BDDA 2M34A 2PMZN 3FXJA 1F43A 1F36A 1ZRFA 3BR5A 2IGNA 1SAXA 3CQZJ 3ERMA 1YITI 1D1CA 4DIQA 2K5CA 1IV6A 1XCBA 5BPIA 2VOPA 2L4MA 4AYBN 1NG6A 1XGNA 3CJRB 1BOAA 4GYGA 2DPUA 3DLLF 1OCTC 2NYXA 5D4RA 3A1YA 3FDYA 2KIQA 2VC0A 5K5RA 3F8FA 5HOOA 2W24A 4FX0A 2WB1A 2W25A 3FF5A 1HF0A 5JHUA 2X1CA 1SD7A 3WU0A 5CVJA 3QP6A 4HQMA 4HDVA 4BEHA 1I39A 3WODF 4ENKA 1WHUA 2NXNB 4ANJA 2GXAA 3LMMA 5K7ZA 3D5SC 4RB2C 2DCEA 3FXUA 2FBIA 2XGEA 2I8DA 3GTJJ 4GCVA 4XK4A 1P4XA 4IHXA 2PX9A 1H89C 2EV0A 2OA4A 5D6EA 4DYQA 2W00A 3MFKA 4QLCU 1PP7U 5EEGA 3OSFA 2HPMA 3P7NA 2V9PA 3RYPA 1R5ID 2ZMEA 3OOUA 4XORA 2XF6A 5D5WB 1FSHA 4ZYDA 1BI3A 3SJMA 4U87A 3BPXA 3F0CA 3BTJA 3RZDJ 3SQNA 4HBLA 4F91B 3KYLA 2Y0SN 1Z91A 4L9JA 1KQ8A 4E7KA 4LJZF 1ZELA 2ZB9A 3W6KB 2DI3A 4A0XA 2E1MB 2WA0A 4EVIA 3C7JA 1OFCX 1S5LC 1JXSA 5D5XB 1SMYF 3J7AY 2VJ5A 1U5TA 3HRMA 2CS3A 1IUYA 1TP4A 3CDIA 4PJLA 2ME6A 1STZA 4IHVA 4RAGA 2H6BA 4EJVA 3LA2A 2HFHA 3ROUA 1X2MA 5DCFA 1TWFJ 2KRCA 3DWLE 3L2QA 1QRYA 4LD5A 1WPKA 5HLGA 1J09A 2JK3A 3G3ZA 1SAUA 3OYEA 1QHGA 2GM4A 2KRFA 4BEHB 4KITB 1YS6A 3D5RC 1OISA 2OQGA 4LITA 2EIKH 2LH9A 2X6WA 1RRJA 1FP1D 3OWTA 5ILVA 5GPAA 3A0HC 4CCMA 1AHDP 1Z6RA 4FASD 3MKWB 5HDKA 2CUFA 1EH8A 1MMGA 3L7WA 3BQZA 2QM3A 1SANA 3H35A 1WGXA 4OINF 3D0SA 4JX6A 3HOZJ 3BQYA 5LGNA 1LVKA 3IHUA 4MEXF 3SZTA 1LUJB 2DODA 5FKNA 4EGYA 1X3UA 2KL4A 3K9TA 1R23A 2IA0A 2EQRA 2ZMEB 3ABLH 4MEYF 4A3GJ 2DXIA 2K02A 4G6TB 3PIOF 2Y9ZA 1R5GA 2KT0A 5F04A 1G59A 2Z3YA 2E7XA 1J59A 2PQ8A 1K4TA 4Q4ZF 2GA1A 2XC7A 3HOUJ 2L2OA 4XKVA 5EGOA 2A6EF 1OR7A 3E5UA 5BMZA 2MLGA 5E8IA 3MKLA 2IA1A 1R58A 3EUAA 4HF1A 2DQLA 1BI1A 2J5PA 1M1EB 2ZJPF 3IKTA 4HX8A 2VKHA 5JHFA 4AU7A 3BR1A 4ITVA 1SFXA 1U5TB 1JT6A 2W84A 3LSGA 3L2RA 3HYIA 3RQIA 2CRGA 3M1EA 4M3FA 4PGGA 3PFYA 4A93J 2LREA 1DP3A 3EUKL 2E1CA 2JSPA 2E60A 2VBZA 3REOA 2VIXA 3ABTA 3G2BA 1ZR4A 1P6RA 1MZBA 3EQLF 4KN4X 2OZUA 4MFEA 4F52A 5K5QA 3KLOA 1ZTRA 5LEKA 2XSDC 2XIGA 3S3OA 4M9XA 5DM7F 3GFMA 4S0HB 1TL8A 1R9TJ 2EZIA 5FKKA 3DU6A 3RIRA 1XGMA 2IA2A 3BZ6A 4XIDA 2P7CB 1RPWA 2FBHA 2VOOA 2A68F 4MTEA 4UNOA 4BY1J 2AS5F 2Z99A 3HL2A 3PM1A 1HKTA 1P2FA 1W5TA 3A02A 1YJWI 2NS8A 3MCZA 1HW1A 4Q47A 5GTIC 2NVXJ 3O8HA 4HSTA 2DA5A 4M6YA 2WAEA 1F1ZA 5L3GA 1R1UA 3WGIA 1E0EA 2BE5F 5L3FA 5DCMB 4X0GA 3V7RA 3OYGA 4U7BA 2ZC2A 4ZYHA 2DFEA 4BUPA 4I09A 5EGOB 4L18B 2EZHA 3TKYA 3PSFA 2A3SA 3I59A 3RYRA 5KCMA 4G7ZF 1W0UA 3TOBA 4KFCA 2DMUA 4QPOA 2R7TA 2GOXB 1N78A 4HZFA 2L01A 4HX4A 3ZMSA 4BXXJ 2HEOA 3B73A 4HA8A 3LOCA 1G4DA 3HPGA 4CO8A 1B59A 4RGRA 1MW7A 1T2KA 1IJWC 3MWMA 2HZTA 2BY2A 5H2FC 1SD4A 3Q9SA 4HPQA 3ZN1A 4F92B 4IHSA 4BY7J 1KZHA 1SEUA 1NG7A 2P0WA 3BJAA 2FQ3A 1ETOA 4A6DA 5KVRA 3HEFA 4BJ5C 1FOXA 4KNYA 3M8JA 2MD5A 2XAUA 2OD5A 2IXSA 2HVSA 4D5FA 2JPCA 3DXJF 3SEZA 3W2WA 1NH3A 5L3DA 3RQ4A 5IOZA 2TCTA 2RVCA 1L3LA 4N4OB 1X1AA 2OJED 1WJDA 1S3JA 3HHGA 3P9KA 4OOIA 2QYOA 5C3EJ 4UXNA 4M3EA 1MBJA 3QU3A 2VONA 1UB9A 3U9GA 3JSPA 2I5UA 2K4JA 5IYCJ 2B63J 4N9IA 5F64A 5K1YA 5BS6A 3LSRA 1J7KA 3O3KA 3KEOA 3G6EI 2R5YB 3EDPA 1XMKA 2H8RA 3KP3A 1K78A 2BXZA 1E3HA 4DYCA 3I55I 1B8IA 4DNCA 4XLCA 1Y0UA 3T0YA 4L5IA 4PSWA 1BR1A 1VQ4I 1KU3A 2JRTA 2D45A 3N97A 2Y69H 2K9NA 2XKPA 1FTZA 1IRFA 3LQRA 4CA0A 4G7HF 4AUXA 4ETSA 3FK7A 3ZQIA 3GTQJ 1ETKA 3BJ6A 2ZFUA 1I3QJ 2KP6A 4HSRA 1Z0XA 1E3PA 5CVIA 2FMLA 4CZZA 2NNNA 3LFKA 2A61A 3WG7H 2E36A 1YFHA 5LRRA 5EYRA 4RBOA 1TQMA 2BZTA 3ZQQA 5J8FA 1FSEA 5FGMA 4HX7A 2BYVE 1O3SA 1KU9A 2D1VA 2ZCWA 1U78A 1HQCA 5LGTA 3BY6A 1Y1WJ 1IRXA 1O7FA 3LSJA 1G2HA 1Z3YA 4OIRF 3ZGKA 1IDYA 2W57A 4XR6A 4ZC3A 2DA1A 2JT1A 2HPIA 2X0LA 2L9VA 3K4NA 4A12A 5DV5A 2ZXJA 1O3QA 2GA2A 2CQXA 5B3SH 2VLAA 2NVUB 2R7FA 2Z16A 4XLNF 3PIPF 3GWZA 2CJJA 2BXYA 5HNFA 1O7LA 4KYWA 3HOVJ 2DMTA 2XUBA 3J7ZI 1XDUA 3CCJI 3FMSA 1TQPA 3SZGA 4Y7NJ 5JI6A 1MSEC 2HQAA 3VPRA 1T08B 2LMDA 4LGWA 3F21A 2MLKA 3ZN0A 2QQBA 1XX5A 2DJIA 3R6SA 3S93A 3J7AO 4QWQA 1YRNA 2C6YA 4M3DA 2EFQA 2VJIA 3RKWA 1K78B 1CGPA 1CF7A 1FYKA 4H4KC 1B8IB 2IRFG 4E7ZA 4MTDA 4WK8F 2WB1N 3S1MJ 2DAOA 5ICEA 1FBSA 3G1LA 4L5JA 1OCRH 3JRBA 5L3CA 3FBIB 4ZYEA 2XDVA 3IC7A 5J40A 5GADJ 5IT9Z 2VQGA 1MBEA 1OKRA 3TO7A 5D4SA 4BXFA 4FT8A 4A3CJ 3CCUI 3W6VA 3S3MA 2DJNA 1MDMA 1BJZA 5B5EC 1LE8A 2NVTJ 1RC9A 2BHYA 1E2XA 1UFMA 4HEA2 3H1CA 1JE8A 1ACIA 2ZKZA 3AG1H 2FE3A 2XV4S 5HLTA 2VT3A 1F4KA 4NHJA 1LPQA 2MW8A 5ILSA 1T0FC 1BIAA 3EPZA 1Z7LA 2JQ7A 2FNAA 4HAMA 1X19A 5B1AH 1H9GA 4GDFA 1X4OA 2DK5A 1UMQA 3CCRI 2Y9YA 4BHPA 2VT2A 3OYCA 4Y33A 1AWCA 3LWFA 2FJ1A 3M8FA 1FTTA 1HA8A 3PNVA 4HV6A 5JLXA 2OTJI 3L2UA 2KHMA 5H20A 3W3CA 2QQ8A 1FOWA 2A6HF 3DKWA 3RKYA 3T8TA 1S6LA 1ZGWA 3W2AA 2FQ4A 2P5KA 4EJWA 5IP6A 2HTJA 3ABMH 1W1WE 2WWYA 1APLC 1AA7A 1ETYA 3HTUA 3QOPA 3RJPA 5EEAA 4N9HA 3S2DJ 1HOMA 3S14J 1GHCA 1YRNB 2O61A 2P6TA 3K7AJ 5DEQA 2CG4A 4RAYA 5E20A 1ZYRF 2HOEA 4A0YA 1CF7B 2BY1A 3E1SA 5F0HA 3JTGA 4UV8A 2FX0A 3DKYA 1UCRA 2WC2A 3DP7A 2XGCA 1FY7A 2XVCA 4PUSA 2ZJ2A 5FFXA 5IYBJ 3HSFA 2VE9A 3DBHB 4LB6B 4DJAA 5JFRA 4FISA 3WHBA 1ENHA 3GLXA 2RAEA 2P6SA 3E6MA 3U21A 4D9JA 3WTSC 2E5ZA 3ASOH 4YELA 2NNYA 1MDMB 1R22A 1MJ9A 1LE8B 4M6VA 1X3WB 2DBBA 2E35A 3GMEA 3ELKA 4IRGA 3ZQHA 3BG3A 2G9WA 3V42A 4BDYA 2VN2A 3K0LA 4B43A 1MBHA 2M4GA 2H27A 1TLHB 1IV8A 2DA3A 2M7AA 1YJ9I 2V9VA 1S8NA 4ESFA 5FD5A 1T8IA 3DTEA 1B9NA 5EZGA 3FXQA 1Y8RB 4RGXA 1TW2A 2FMYA 2NOGA 2M1BA 1R36A 1AOYA 2ZXWH 4FETA 2V1XA 4S04A 3FXKA 3HRTA 2P4WA 4A6EA 4CZCA 2WAQA 1R1TA 2VKDA 3QU6A 4CGZA 2R4GA 3I64A 4RLFA 2LP0A 4HG2A 2QA4I 1K61A 4U0YA 3ZQLA 3EUHA 3FM3A 2RREA 3E6CC 2K9LA 2R7XA 1YS7A 3QAHA 3HM5A 3WGHA 4CYDA 3CDHA 2E71A 3WGGA 4IX7A 2BY0A 2EPFA 3ZCOA 3JW4A 1QBJA 2LDUA 2F6CA 1GXQA 2DA6A 5E8GA 5HS8A 4QSHA 3TDUC 3S15J 1IUFA 2ELHA 2QZ8A 1W36C 2XASA 1IF1A 5DM6F 4EATA 3KCCA 4FE4A 4UB8C 1IGNA 4XSZF 4ZJZA 2CMPA 5HDGA 1MKMA 1UELB 1R4MB 2UZKA 1JT0A 3O6BB 3BPVA 2EILH 5IY5H 3G1MA 3NQOA 2RKHA 4A3JJ 1JKOC 2CWEA 1B4AA 4C9YA 2Q8KA 3F8NA 1GXPA 2X6OA 3DTKA 3HOTA 4FE7A 1F5TA 5D5VB 1RIOH 1J0RA 4IQ4A 5F1JA 4BBSJ 1KGSA 2CV1A 1J2XA 3FMQA 1ZN2A 3DCFA 4M74A 1G3TA 3Q9VA 4R1HA 1NK3P 5ILUA 1MNDA 1ZAOA 4M3BA 2CV0A 5FKMA 2M45A 1YTYA 4MO7A 3TP3A 3HUGB 2XROA 1JHHA 1WJEA 3HOWJ 1IXCA 4KDPA 1IRGA 2YUSA 1X58A 2OCEA 5KK1A 2ZNYA 4IF4A 3CUQC 1JKRC 1ZRDA 2KDZA 4ESJA 3IH4A 1TWHJ 2OV7A 1HKSA 3JCUC 3TMOA 3GYHX 3AL0C 2D1HA 2X85A 2M3AA 1JUPA 4A5NA 2GIVA 1DDNA 4PFPA 2L7MP 2BVLA 4RAFA 3M07A 1DQUA 4KIFA 3I4NJ 2LY1A 4BYYA 2QBYA 3HXLA 2OF7A 3OYIA 2PBIA 1ETQA 4EV0A 1Z77A 4V2FA 1ZK8A 2V1DA 3GTLJ 2W48A 4CH7A 1V5EA 1JKQC 2IS4A 1I1SA 3BROA 4JOMA 1OYWA 5M5YJ 4A3IJ 3JAMK 3BR0A 5KNLA 3OYDA 3WE2A 1YW7A 5B1BH 4DYRA 1XSVA 2QWWA 1KYZA 5E3LA 1IN8A 3K1NA 2RQPA 4DZPA 2H6CA 1XPXA 3BTLA 3MN2A 5GAEJ 3CC7I 2ETHA 1JUMA 1ZKGA 1D0XA 3IRQA 3PSIA 1A36A 1SC7A 4FTHA 3LSPA 1R49A 3GUDA 1X1CA 1RKTA 3CLOA 1Y39A 3C3WA 2DDBA 3Q0VA 3GBGA 2IS2A 3LFUA 4JK1X 5IT3A 2DT5A 3S3NA 1W7PA 2ZJRF 2COBA 4RMNA 2RC4A 3CJTB 5FJ8J 5E17F 1RKWA 1WI9A 4XMYA 4D7MA 2RQQA 5HNHA 3OYJA 4KISA 3OYHA 4MIMA 4A5MA 3MVPA 1W7PD 4XKBA 1GDTA 1D0ZA 3DEEA 4XOTA 2X51A 4EEFG 1RESA 2O8KA 4L9VA 4XICA 4I0AA 2DT6A 4UV9A 2ZFWA 5TGTA 3KPHA 1QPIA 4DW6A 1Y0NA 2MH2A 2LNBA 4G8XA 2IS6A 1F9NA 2GBYA 3KYDB 5D6FA 2L4AA 3CESA 2QBYB 4WF2A 2DYSH 3IH3A 5EF6A 3W6JB 1O57A 1RI7A 4CYCB 3CF2A 2EJRA 1X3ZB 2KRHA 3SZPA 3I54A 4XLFA 5E3MA 1BW5A 4XSXF 2ZXHA 2CUZA 2PLYA 1W4MA 3HPHA 2VPRA 4D7NA 2VL8A 1VQNI 2FRHA 2MSYA 3VDXA 4JYKA 3IAM2 3IWZA 5HLHA 1LKXA 3GO5A 1UG2A 1G3WA 2K85A 4HDUA 2M2EA 2VQCA 2E7WA 2EK5A 2JTVA 3GFJA 2HGCA 3KE2A 5BOXA 3QQAA 3K4MA 4BH9A 3S1RJ 3DU5A 1D1AA 4NNJA 3R4KA 5HODA 3NARA 5F0FA 3FHZA 1RUOA 3GF2A 1MMSA 2D2WA 4OU0A 1ZR2A 3PQJA 3Q0UA 3GXOA 2BEOA 4BBRJ 1I6XA 2CW0F 1NK2P 2W82A 5TRDA 3I56I 1GV2A 4Q48A 2XPWA 4QTRA 1Q1VA 3AKZA 1W7PB 1WCMJ 1W0TA 2GXGA 2PFBA 3S2WA 1HC8A 3J7YJ 4C30A 2CUJA 2FNPA 2VPLA 4UVCA 3E6BA 2F5CA 5FRMA 4C3HJ 1Y56A 3F8BA 3L2WA 5DUKA 5J1YA 1YQAA 1IDZA 2HOSA 1VQOI 1FBQA 2MBFA 4GYIA 3KZYA 1JKPC 2X1EA 2UWMA 2H1LA 1MBKA 3UR3C 1NHAA 4XKCA 4HW0A 3L09A 4EQQA 2IAIA 1REPC 3GTMJ 3GW2A 1YO5C 5M5WJ 4B1RA 4IRHA 1YJNI 4OIOF 3IRRA 5EDNA 1ZARA 2YS9A 3TQNA 2R92J 4K2EA 1BR4A 5K7HA 5JVTA 1E17A 2A07F 3I53A 2AXLA 3ZP5A 1ETWA 2K27A 4IXAA 3C1DA 1XD7A 2MC3A 2G0EA 4RB1A 1AU7A 3PO3J 3QPTA 4WWCA 4A69C 4KJZA 1H9TA 5LHGA 4NC8A 4WXCA 1ZLJA 2GOMA 3DPTA 3FM5A 4Y4RA 1DP7P 4C2UA 2JA8J 4EJTA 2XAFA 2ECCA 4UUSA 4KMUX 5HDNA 2DTZA 1X1DA 4G6QA 3ERED 4RGSA 3CD6I 1T98A 2HWVA 3RKXA 3KX2A 1KQ9A 1FZPB 1A04A 4HRIA 2K86A 3GVAA 3K1MA 5BPDA 1TNSA 4XONA 4R8HA 2EIJH 1DU0A 1HW2A 1E3OC 1ZG3A 4PFOA 2E1MC 3H3UA 3RDIA 3DFGA 4PSXA 1YYVA 1N25A 2WADA 1UZCA 1U9NA 1FYLA 3BT9A 3IH2A 4IVNA 3HC7A 1BN5A 4LIUA 4A2UA 3PNTA 4PJJA 4II3A 2PEXA 2QUFA 4XLAA 4LOCA 2DTRA 4XOPA 1N75A 1TT0A 2OQRA 2VB6A 5D5UB 2O5RA 1IN6A 2XGXA 2XAQA 4LG3A 5JVGF 4X1EA 5F27A 1XG1A 4GXOA 4II2A 1ERDA 3S2HJ 5GTHC 2RDPA 5IPAA 1VQ5I 1MGTA 3GZ6A 2K4BA 5HS7A 3FZVA 4CUGA 3TEDA 1A5JA 3IKVA 3CMYA 2AXTC 1OPCA 1IXSB 2HZDA 2EZLA 1IN4A 3BG9A 4CCKA 4BQAA 2JPBA 2DA2A 1B1BA 2Y75A 4B48A 3B6AA 3KP6A 2CU7A 2J5OA 2NS0A 3V8KA 2WAQN 2ZMEC 3WTYC 4UUSB 3SEQA 3MZYA 2Q0OA 2EINH 4U0WA 5H6QA 4KIGA 3H36A 4PCQA 3HJEA 4F55A 2F5EA 2DA4A 2L7FP 1D1BA 1OMIA 1LQ1A 2LBFA 4HF0A 1K83J 5J6XA 3ZOBA 2CYYA 2VKVA 2V9KA 4IL6C 3QWLA 2P8TA 1ONVA 4QPQA 4RM2A 3ZMDA 3A01A 1R5HA 2M5WA 1PDNC 2IT0A 5ICCA 1S7OA 1TW3A 1USTA 5K5OA 3FXRA 2WY8Q 2O7OA 4MQVA 4Y17A 1U5TC 5FFZA 1GVJA 2Z5UA 3K2ZA 4G12A 1QHHD 2P5VA 4AYBA 2XPUA 3HRUA 1IN5A 3ZXSA 1MJBA 4JX5A 4BDZA 1V3FA 2QQAA 2QEXI 1O3TA 1VQ6I 3OOPA 5LFAA 2XAJA 3OSGA 1T33A 1FIPA 5K7FA 3K10A 1BA5A 2YR2A 1DPUA 1VI0A 1K7AA 2EA2A 2HR3A 4YG2F 1GVDA 4AVZA 3HKZA 2ADUA 2CFOA 3OYKA 4MFDA 3TBIA 3OY9A 3L2CA 2QKMB 4AD9A 2ZBKA 2R3SA 1MD0A 3I59B 4CSWA 4P96A 3HBLA 3BTIA 5LD2C 1IAWA 3CCEI 3LSIA 2LG4A 3DQVC 3M1CA 2PG4A 1XMXA 3OYBA 2RGVA 1S29A 1FWZA 3HSRA 3MAJA 1FMWA 4JX4A 3QPSA 2H94A 2O0YA 3R0AA 4I6ZA 1PYVA 3ZR8X 4EM1A 2XHKA 2F4MB 3CDLA 2KPMA 1R4NB 2X6YA 4Y3OA 1AKHA 4UY8I 4JBAA 3TW7A 1KA8A 1K79A 2WBMA 3CJQB 4ZDPA 3BR3A 2IS1A 2M8EA 1Z3XA 2VUMJ 3S1NJ 2PMUA 4ZZLA 2OC6A 5AIQA 3K1PA 4E6KG 2K9MA 1A6QA 5J4YA 3GTOJ 2HYJA 2VBXA 2XF7A 4KMFA 1WWXA 2V79A 3WU1B 2F4OB 2LBFB 1Z9CA 1XDSA 4UVBA 4IRIA 3ULQB 1ETXA 3H92A 4KT5C 5C4XJ 3FXMA 2NVYJ 3PQKA 1ULYA 1BC7C 4BS9A 3A01B 4C2TA 1ZG5A 3AG3H 2GXBA 3WTXC 3A4CA 4IHYA 4XL9A 4UUTA 5FB2A 1OQYA 3KP2A 1YW9A 3DV8A 3HOYJ 2YU3A 4HLXA 3E7LA 3VB2A 2RNJA 3U2RA 2AQFA 3QPLA 2LKSA 3TL4X 5H6RA 4EM0B 4IQJA 4M9SA 2JN6A 4B09A 4XKWA 3LNQA 1B6AA 2GLOA 5HVQC 3K4KA 2A05A 2DW4A 4RA2A 3F8MA 1X1PA 3KLNA 4LLNA 4BJTA 1D0YA 4WXDA 2V1UA 4ZDLA 4HOBA 4BE1A 4XBFA 3UNGC 3JRDA 2JRMA 3BZKA 4MLOA 2CW8A 5AONA 3WHCA 4DBQA 1EH7A 1IZ1A 3CUQA 3AG4H 3LAJA 3NEUA 1MMDA 2X1DA 2EBIA 3V7SA 3HB9A 4YFNF 5F1RA 2KJCA 1EA3A 3FKJA 2Q1ZB 2E19A 3G71I 4LMYA 1SFKA 2VJ4A 1ORKA 1FP2A 1I50J 4D0PA 1AKHB 2ZNZA 3A2KA 4J01A 1H0MA 1UJ8A 1XS9A 3OL3A 2LKXA 2DPDA 2GQQA 2IEKA 3L2VA 3I4MJ 3F9KA 4JP0A 4W1UA 3HGYA 2R5ZA 4KUMA 3IP4B 4I7HA 5CYVA 1LFPA 1UAAA 2EH3A 3KYCB 4PZJA 4HNVA 2V4JC 1A6IA 1A31A 1RUNA 2E2HJ 3E5XA 3JREA 2OZ6A 2R7UA 3CZ6A 2FF4A 3H9GA 3MQ0A 3BOQA 2EIMH 3IWFA 5M3MJ 3V7CA 2ID3A 1POGA 5CLSA 5KHDA 3CC2I 3J81K 4IO9F 1J75A 3OIQA 1R7JA 1YX5A 3AAFA 1OYIA 5FRNA 4KT6A 3PNYA 2DOEA 1P7JA 2KISA 4NC7A 3G4SI 4ZYAA 2DMNA 5FO5A 3OR1C 4L9NA 1WZ2A 5M5XJ 1EKEA 3TOAA 3P9IA 2VXDA 3K4LA 1W5CC 2K9SA 3CMEI 1P92A 4Q5SF 2CQ7A 3DBRB 3DKXA 4Y52J 4HNTA 1MNMC 2F5DA 2L9SA 3CUQB 4C3IJ 2LF8A 2Y2ZA 4OMZA 4AC0A 2WV0A 1ZG1A 1FEXA 1LNWA 1WI3A 2XKOA 4G6DA 3TO9A 1DPRA 4AIKA 2YU9J 4R79A 6PAXA 3ZPLA 5E1XA 4RLQA 1FBUA 4IOAF 1MBGA 2DN0A 5GP9A 5HLIA 3BCAA 3KFWX 3R0JA 2JVHA 1DUXC 3GTGJ 3H5NA 2ISZA 3ZQGA 4LG0A 3C2HA 3OS2A 1L0OC 2M30A 2AHQA 2FU4A 5LGUA 2R5ZB 3VEPA 2RN7A 1S7AA 1PJRA 5EJCA 5FKOA 2KKOA 2L9RA 1Q1HA 2MG4A 1HSTA 2RV8A 3I4PA 1WJBA 3QYBA 4PK4A 4HF2A 2KIUA 5FROA 3G1OA 2M7BA 3SFIA 3AFHA 2UV1A 1EF4A 3KETA 2EZKA 4XRSA 1BW6A 1QO0D 4XLEA 3NWSA 3I9V2 2XPVA 4F7ZA 3F3XA 1RR8C 1MH3A 2KJBA 2PI0A 1K4SA 4Y15A 4W97A 5J3LA 3BLYA 4A3KJ 3LSKA 3S1QJ 4CICA 2Y48A 1V55H 3K70C 3RKQA 4MGRA 4E7LA 3ZQFA 4YFKF 2HKXA 2JJ7A 4DQ2A 1MJAA 2K3PA 2LVSA 4P1WA 2PJPA 3LSMA 1GUUA 4ON0A 4BAYA 2VC1A 1QPMA 1MNEA 1OYYA 5E79C 1RNLA 3L9FA 5KAFC 2JA2A 2NRAC 2N8GA 1ZRCA 1YOVB 1ZGJA 3QYEA 5FD6A 3EYIA 5LLQA 4NQWA 3BJOA 3RPUA 1X2NA 1XGSA 3VODA 4ZTJA 2FBKA 2WAFA 3VSLA 4LG0B 5GAGJ 2YSRA 2ZSIB 4E7SA 4O3MA 2M87A 2XB0X 4MHGA 2DK8A 3BWGA 2ISYA 1TBXA 1IRZA 5FLMJ 3RPUD 5ED4A 1KONA 2VQLA 4GO1A 1IW7F 1XMAA 3ISPA 1OJLA 4Y13A 3BG6A 2QGUA 2FOKA 4HYEA 1RR7A 4U88A 4P5OA 4L9TA 3EYYA 5FLXK 3MEXA 2CGPA 1IN7A 3KEYA 2VKEA 2PN6A 2XGDA 1Z7UA 1RZ4A 3LL7A 2IJLA 3EETA 1XSXA 2O9LA 1LB2A 1Z05A 2MC4A 2V1NA 2STWA 3GFLA 2V6CA 4ZZDA 4BU2A 1V5GA 3ZRGA 1H88C 3Q3SA 2QSHX 2LD5A 2LSOA 2L02A 2DFFA 3H3ZA 2HVQA 3QODA 3GFIA 4CCJA 4EMSA 2OPTA 3GX4X 3M7GA 1YI2I 2WTEA 2HYFA 1G3SA 3PL8A 2NOJB 4XRFA 4PJNA 4BHCA 2Z9OA 1T38A 1BC8C 3DPLC 1U8BA 2VASA 5JLWA 3SHFA 1QVTA 3CMAI 4BQNA 4YIFA 1I6HJ 1BL0A 5KAIC 2YX4A 1Z67A 4PJMA 2JA6J 1I3AA
chains in the Genus database with same CATH topology
4B47A 2Z2SB 2R7VA 1DGWY 4NQWB 1IRXA 1WJCA 1G8XA 1Z3YA 3KX2A 3OMYA 4OWRB 3ZGKA 4ZC3A 4XR6A 4E7HA 4HRIA 2CV2A 2XF5A 3SDBA 1U0JA 2HPIA 1TZLA 2UUZA 4XONA 3K4NA 1UG0A 4D1QA 4PFOA 2E1MC 4PSXA 3K4JA 2F4IA 2WADA 2VLAA 3H5AA 3K6GA 2Z16A 3HC7A 2PJRA 4LIUA 1MMNA 5HNFA 3SYTA 2KQRA 3PNTA 4PJJA 4CCOA 4II3A 3SZGA 2HQAA 4XLAA 1Y6IA 3OIPA 5CQEA 4XOPA 1YE9A 1N75A 1TT0A 2DJIA 4JQFA 3S93A 2VB6A 2O5RA 2VJIA 4LG3A 1ERDA 4II2A 4H4KC 4E7ZA 2QKLB 4CUGA 3FBIB 2XDVA 4ZTFA 2HZDA 4CCKA 2VQGA 3RSNA 4BXFA 4CCLA 3ONQA 1BOBA 1OLTA 4B48A 3S3MA 3S8PA 3QOEA 4LIVA 3OS0A 2Z1DA 2R7SA 3EUHC 4IZZA 2KLOA 3SEQA 4HEA2 2ZXIA 2RNGA 2L7KA 2LOOA 3N05A 4F55A 2VQHA 1YX3A 5HLTA 4XM3A 1T0FC 1D1BA 2A5WA 1Z7LA 1BR2A 2LBFA 3EPZA 3DTIA 2E5NA 1X19A 2KMUA 2V9KA 1X4OA 2MFZA 3RTRA 3H5RA 3H9QA 4QPQA 4RM2A 4Y33A 3OYCA 4CCNA 3VYRB 3CP8A 2R7WA 1HA8A 3PNVA 3LSHA 1MMAA 3L2UA 2WY8Q 2KHMA 3W3CA 2PJRB 1JI8A 1VZ0A 4AYBA 2XSJC 3VYSB 1QHHD 1Z21A 3W2AA 3ZXSA 4BDZA 1WJAA 2IGKA 3IUOA 5LFAA 1AA7A 4BJ6C 3K10A 3C2GA 4DGWB 3OYNA 4AVZA 3HKZA 4E7IA 2CFOA 3OYKA 3TBIA 3OY9A 3BG7A 2QKMB 4CSWA 3K4CA 5LD2C 4BE0A 3E1SA 3LSIA 2LG4A 3DQVC 3M1CA 4BQQA 3OYBA 2VXZA 3DKYA 1T95A 5CPRB 2IGNA 2V7FA 4PUSA 3W2VA 4XQFA 2R7OA 3FHNA 1FMWA 3BC8A 1D1CA 4DIQA 2FUG2 2K5CA 1PYVA 3ZR8X 4DJAA 1V5FA 1NG6A 3CJRB 4J00A 2KPMA 2X6YA 3U21A 4Y3OA 4D9JA 1GLNA 2E5ZA 4YELA 3A1YA 3FDYA 2WBMA 3CJQB 4ZDPA 2IS1A 5HOOA 2WB1A 1Z3XA 3CMMA 2MD0A 2OC6A 3V42A 2X1CA 2HNHA 4B3XA 4E6KG 4BDYA 4BEHA 2K9MA 4B43A 2Q2EB 2XF7A 2M4GA 4ANJA 4DOZA 3LMMA 2M7AA 4YEJA 2LBFB 3D5SC 3DTEA 2DCEA 3OL4A 4BE2A 2I8DA 2R7QA 4BS9A 4FETA 4C2TA 2F5VA 3A4CA 4XL9A 4CZCA 2WAQA 2VKDA 2R4GA 4RLFA 2W00A 4HG2A 2LY2A 2HPMA 2RREA 2K9LA 2R7XA 3OOUA 2AQFA 2LYCA 4XORA 2XF6A 3TL4X 4IQJA 4U87A 4IX7A 3DLAA 3ZCOA 4XKWA 3OYLA 2F6CA 3HG9A 5HVQC 4F91B 3K4KA 3KYLA 3MKYB 4E7KA 4BJTA 1D0YA 1W36C 4ZDLA 1ZELA 4XN0A 4BE1A 3S32A 4E7JA 3UNGC 4EATA 2E1MB 2WA0A 1X4PA 4ZJZA 2CMPA 2ELJA 4MLOA 4IKFA 2CW8A 1UELB 4DBQA 3J7AY 2MABA 2VJ5A 5CQGA 1MMDA 2X1DA 2CS3A 4C9YA 3OYFA 4NUBA 4PJLA 3HOTA 3DTKA 1EA3A 3FKJA 3OS1A 2Q1ZB 4IQ4A 1DGRM 2CV1A 1SFKA 2VJ4A 3L2QA 2KRCA 3DWLE 4DBRA 2L5QA 3A2KA 1QU3A 4J01A 4HNUA 1MNDA 1J09A 2KZVA 2MYSA 3D5LA 3OL3A 2CV0A 3HUGB 3L2VA 3F9KA 3PUBA 1SAUA 3OYEA 1QHGA 1WJEA 4BEHB 4KITB 2IGMA 2PMZA 3IP4B 3D5RC 4LITA 1LFPA 2LH9A 2X6WA 1UAAA 3OWTA 3DPUA 4CCMA 4FASD 3MKWB 3VSKA 2V4JC 3OYMA 1MMGA 2OV7A 3H0DA 4ZDOA 3TMOA 3AL0C 3H35A 2X85A 2R7UA 1S9HA 3CZ6A 4OAZA 2M3AA 2BW3A 3H9GA 1LVKA 4PFPA 2KL4A 2BVLA 5KHDA 2HVRA 3PJRA 2JVGA 3OIQA 1DQUA 2DXIA 4G6TB 2DOAA 2LY1A 2CH0A 1YX5A 1G59A 3HXLA 5FRNA 4KT6A 3PNYA 3OYIA 4NC7A 4ZYAA 2XC7A 2L2OA 3OR1C 4XKVA 2JUGA 4CH7A 1V5EA 2KDOA 2VXDA 3K4LA 2IS4A 4JOMA 2HDWA 3EUAA 3OYDA 3CP2A 5KNLA 3DKXA 4HNTA 2VKHA 2L9SA 2HU9A 5JHFA 3FBNB 4ITVA 3K4BA 4AU7A 4E4HA 3LSGA 4R79A 3L2RA 2AQEA 3MD2A 2L9NA 4RLQA 1D0XA 3BCAA 2LREA 3PFYA 3EUKL 3VWBA 1DP3A 1R6RA 2JVHA 2JSPA 4XN3A 2V6EA 2E60A 3H5NA 2Y0SA 3PSIA 4N4NB 2VIXA 3G2BA 4BQOA 3C2HA 3OS2A 4RM3A 3E0JB 4F52A 3VYTB 1X1CA 1OR7C 3S3OA 4XNFA 3GBGA 2IS2A 3LFUA 3S3NA 4BL0B 3DU6A 3MMYB 1PJRA 4RMNA 2LRDA 1WJ5A 4XMYA 3HOSA 5CKTA 2RQQA 5HNHA 2OUMA 3OYJA 3OR2C 1W36D 4KISA 3OYHA 4OAYA 4XKBA 3HL2A 1WJBA 1D0ZA 3DEEA 3QYBA 4PK4A 2X51A 4XOTA 2W7NA 5FROA 2M7BA 2DT6A 3AFHA 2BW3B 3RCOA 5TGTA 2UV1A 3BCBA 4HSTA 1X1BA 3K70D 4XLEA 4XLHA 2WAEA 3IAS2 3I9V2 3NWSA 2IS6A 1E0EA 4X0GA 3OYGA 4U7BA 4F3QA 3CESA 4B44A 4BACA 3BLYA 1FMVA 3CF2A 3LSKA 2ZSHB 4BUPA 2KRHA 2VJJA 4YRVA 4XLFA 3I3LA 3PSFA 2R7TA 5KCMA 4QPOA 3K70C 2GOXB 3MKZA 2DT7B 2ZXHA 1N78A 2A6TA 2CUZA 4E7LA 3HPHA 2VL8A 3VDXA 3IAM2 2W1OA 3HPGA 1LKXA 1N77A 1MW7A 2K3PA 4P1WA 1P9QC 4HPQA 4F92B 3LSMA 2VQCA 1MNEA 1NG7A 2P0WA 2JA2A 2V26A 3QYEA 3OYAA 3K4MA 3DU5A 1D1AA 4NNJA 4BJ5C 4ZTJA 2WAFA 3M8JA 3QYFA 3VSLA 2XAUA 2ZSIB 4E7SA 2IXSA 2HVSA 2M4KA 2W82A 2BOLA 3SEZA 2M0MA 3RPUD 1KONA 2VQLA 3W2WA 3AKZA 3H9JA 3RQ4A 1LDKB 3BG6A 4N4OB 4C30A 1X1AA 2WY7Q 2CUJA 1WJDA 4P5OA 2VPLA 3NWTA 2R7RA 5FRMA 4GRIA 1Y56A 3L2WA 3KEYA 3LL7A 4F93B 1WFXA 2IGOA 2X1EA 2MC4A 2V1NA 2UWMA 2LC2A 3UR3C 4BU2A 4XKCA 1V5GA 3ZRGA 2X6XA 4XLCA 4PSWA 1BR1A 2CW7A 2HVQA 4BGDA 3QODA 1BR4A 2BVMA 4CCJA 2W4SA 1K6YA 1WJFA 4CA0A 3PL8A 2NOJB 4PJNA 4KJZA 3AL0B 2ZFUA 3DPLC 4NC8A 2KP6A 4HSRA 2VASA 2GOMA 3DPTA 4Y4RA 4BQNA 4C2UA 3VYUB 3ZQQA 4PJMA 1X1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPH A;  1K6Y A;  1WJE A;  1E0E A;  1KON A;  1WJD A;  1WJF A;  1WJB A;  3HPG A;  1WJA A;  4F3Q A;  1LFP A;  1MW7 A;  1WJC A;  3F9K A; 
#chains in the Genus database with same CATH topology
 2KIM A;  4B47 A;  2GIZ A;  2Z2S B;  2HQR A;  5CVV A;  4NQW B;  3CCQ I;  3A0B C;  1WJC A;  3OMY A;  2R7Z J;  3VOE A;  2CV2 A;  1WKM A;  3I71 A;  3SDB A;  1TZL A;  3KIO A;  2P7V B;  2UUZ A;  2XB5 A;  1MH4 A;  1UG0 A;  3HKZ N;  2L7Z A;  3M9A A;  1KU2 A;  3K4J A;  3WTT C;  3QP5 A;  2H8W A;  4Z6Y A;  2MA3 A;  1LEB A;  1RET A;  3V4G A;  1SVL A;  3SYT A;  1D8K A;  2KQR A;  1O3R A;  3LQQ A;  1WRJ A;  5M3F J;  3GLL A;  3OIP A;  1IC8 A;  4I76 A;  2EB7 A;  2K3F A;  3BP8 A;  4NB5 A;  4JQF A;  4XRM A;  5JR3 A;  1D8J A;  2CFX A;  3L1P A;  3L00 A;  1VQ9 I;  2CUE A;  2O8X A;  3ECH A;  2R7D A;  2W85 A;  4LFU A;  1NTC A;  5E3O A;  1XCV A;  2QKL B;  3TDZ C;  3BR2 A;  5EZH A;  3VFZ A;  2DA7 A;  2P5L C;  3E5Q A;  4ENJ A;  3J81 Z;  1D3Y A;  1SMT A;  3RSN A;  4C3J J;  1ZHF A;  1JTY A;  3ONQ A;  2ID6 A;  4NC6 A;  4KA4 A;  3B02 A;  2D5V A;  2F5F A;  4LIV A;  3OS0 A;  2Z1D A;  3EUH C;  4IZZ A;  1JJ6 C;  2ZXI A;  5C44 J;  3G73 A;  2RNG A;  2L7K A;  2LOO A;  3N05 A;  3I58 A;  2CQK A;  2HKO A;  4OIP F;  1BIB A;  1YX3 A;  2XRL A;  4A3M J;  4I02 A;  2Q2E A;  3FIW A;  3J80 K;  2Z33 A;  1FOY A;  1PUE E;  4H0E A;  2A5W A;  1BR2 A;  4V19 K;  2E5N A;  1XTA A;  1ODD A;  4E70 A;  3JRI A;  1OCZ H;  1YW8 A;  1VND A;  2MFZ A;  3RTR A;  1LFU P;  3H5R A;  1USS A;  1EV7 A;  3H9Q A;  1VQK I;  4AID A;  1YLF A;  4M73 A;  3CP8 A;  2R7W A;  3JRF A;  1A35 A;  1MMA A;  1P4A A;  4YFX F;  4P55 A;  1JI8 A;  1UHW A;  1TQI A;  2BHZ A;  1VZ0 A;  5IP9 J;  4GGG A;  3VYS B;  1SD6 A;  5F0C A;  3GTK J;  5D8K B;  2HXO A;  3NAU A;  5DS9 A;  4XLP F;  1VQ7 I;  5FLV A;  1WJA A;  2IGK A;  3U1K A;  3KZZ A;  1VF9 A;  4BJ6 C;  5HS9 A;  2NVQ J;  3C2G A;  5E1Z B;  1Z6T A;  5IT9 K;  4DGW B;  3OYN A;  3Q0W A;  1U3E M;  3F6V A;  4ENN A;  4E7I A;  3GEZ A;  5DCM A;  1T6S A;  5L3E A;  3WG9 A;  3HRS A;  1BBY A;  1BM9 A;  3K4C A;  1WSU A;  2DFH A;  3CC4 I;  4IPA A;  1OCP A;  4BQQ A;  3IV5 A;  4DZJ A;  4ESB A;  2VXZ A;  4M3G A;  5EEH A;  4RAZ A;  3TP0 A;  1T95 A;  2K7L A;  2QQ9 A;  3M8E A;  5CPR B;  1J9I A;  4C2M J;  2V7F A;  3W2V A;  2XRN A;  2JZY A;  4XQF A;  2R7O A;  3FHN A;  4ZYG A;  3BC8 A;  1BI0 A;  2FUG 2;  3NRV A;  3PUF A;  5DDG A;  2R0Q C;  1V5F A;  2QCO A;  4V2G A;  1VTN C;  4CXF A;  3JRG A;  4J00 A;  4AIH A;  1GLN A;  5E1W A;  2VOD A;  1KYW A;  1TWC J;  1FLI A;  3CMM A;  3JSO A;  2IVM A;  2MD0 A;  1EJ9 A;  1QGP A;  2HQN A;  4B3X A;  2HNH A;  2Y30 A;  2Q2E B;  3HGG A;  3F72 A;  4DOZ A;  3CTA A;  1SVO A;  3FKI J;  2DMQ A;  4YEJ A;  2X48 A;  3ESW B;  4YII A;  1LEA A;  1JJ8 C;  2E2J J;  3OL4 A;  4BE2 A;  3C18 A;  1DU6 A;  3U1D A;  2R7Q A;  2M8G X;  4KN7 X;  1KQ0 A;  3V8L A;  2PMH A;  2F5V A;  3HZJ A;  4MQ9 F;  4QIW N;  3N4M A;  2UXN A;  1YIO A;  4O5V A;  3GZN B;  3ZQC A;  3S16 J;  2HQ5 A;  3R61 A;  2LY2 A;  3KP5 A;  3CCS I;  3TW6 A;  2OBP A;  5CVR A;  3FXO A;  2LYC A;  2EV6 A;  5TJJ A;  1JGS A;  3TGN A;  3CUO A;  4ABZ A;  3DLA A;  2BV6 A;  1FPQ A;  4EGZ A;  2HI3 A;  2MH9 A;  3OYL A;  2P81 A;  2QSG X;  1QVU A;  1T0F A;  3HG9 A;  2R5Y A;  4M6X A;  2DMP A;  2DO7 A;  3CCY A;  5FLX Z;  3HIF A;  1CQT A;  3MKY B;  3WTW C;  4AVP A;  3FMR A;  4O6J A;  4XN0 A;  4WX9 A;  3S32 A;  4E7J A;  2GWR A;  4IJA A;  1X4P A;  4IKF A;  2ELJ A;  2YPR A;  2B7E A;  2MAB A;  3B6C A;  1U2W A;  2CSO A;  3DEW A;  5CQG A;  3WTU C;  4FX4 A;  2EA4 A;  2JA5 J;  4OIQ F;  3OYF A;  4ENM A;  1MBF A;  1WVR A;  4NUB A;  3SDG A;  1IG7 A;  3E6D A;  3LAP A;  1JGG A;  2E34 A;  2HOA A;  3OS1 A;  1G3Y A;  2A69 F;  1C0W A;  1XC5 A;  1DGR M;  2B0L A;  1R1V A;  1LVA A;  3JAM Z;  4DBR A;  1I27 A;  2L5Q A;  2G7H A;  4FQG A;  1QU3 A;  4HNU A;  2KZV A;  1H8A C;  2MYS A;  3D5L A;  2CQN A;  5B66 C;  1B9M A;  4I01 A;  3PUB A;  1ETV A;  1MSF C;  3M3Y J;  2L54 A;  2IGM A;  2PMZ A;  3RZO J;  1XB4 A;  3DPU A;  1I5Z A;  2CQQ A;  3HSE A;  3VSK A;  3JTH A;  4B8X A;  1ON1 A;  4WCG A;  3HDD A;  2FOW A;  4KIB A;  4KIC A;  4A3F J;  2M9H A;  3OYM A;  2YX7 A;  3JRC A;  3H0D A;  3OV8 A;  4ZDO A;  4GFB A;  4LLG F;  1WH5 A;  2EFP A;  5DD8 A;  1S9H A;  4OAZ A;  2NAZ A;  4S05 A;  2BW3 A;  2LK2 A;  3BR6 A;  3LA3 A;  2JMW A;  4M9Z A;  2HVR A;  3FWE A;  5E18 F;  3PJR A;  2JA7 J;  1YHQ I;  2JVG A;  4X6A J;  1OCO H;  2DOA A;  2CH0 A;  2X4H A;  1ON2 A;  2DU9 A;  1K6O A;  3E97 A;  1TT5 B;  1MIJ A;  2TRT A;  3O2P E;  2JUG A;  1QZZ A;  2HYG D;  5DTD A;  2KDO A;  1EH6 A;  1XGO A;  2HDW A;  2BBY A;  1HXD A;  2OU2 A;  3H0G J;  3M4O J;  9ANT A;  3CP2 A;  2AO9 A;  3AG2 H;  4G9Y A;  1ZH5 A;  1O4X A;  5IOY A;  2HU9 A;  3DEU A;  3FBN B;  4E4H A;  3K4B A;  3I5U A;  1QZY A;  1JUS A;  3CCM I;  1Z1D A;  3TO6 A;  3BG5 A;  1B72 A;  1I1G A;  2AQE A;  1JTX A;  1QZE A;  3MD2 A;  2L9N A;  4MNU A;  5BQT A;  3F8C A;  1SFU A;  3VWB A;  5A2Q K;  2ME0 A;  4HLY A;  1U8R A;  1QA6 A;  3HTS B;  1R6R A;  4XN3 A;  2EFW A;  3F6O A;  2V6E A;  4N4N B;  2Y0S A;  3JR9 A;  3P9C A;  1J5Y A;  3S17 J;  4BQO A;  1P4W A;  1HSJ A;  1V4R A;  4RM3 A;  3E0J B;  5LEJ A;  3VYT B;  1R00 A;  1OR7 C;  4IEJ A;  4XNF A;  4AWX B;  2XAH A;  2H09 A;  1PVE A;  4BL0 B;  4A3D J;  3HHH A;  3MMY B;  2EFO A;  5ICG A;  1ZGA A;  3GCM A;  5LHI A;  2LRD A;  1WJ5 A;  3WTZ A;  2K9Q A;  3HOS A;  5CKT A;  3GZ5 A;  1V54 H;  2OUM A;  2LTP A;  2GAU A;  3OR2 C;  3PFI A;  1W36 D;  2R93 J;  1HKQ A;  4OAY A;  4P9F A;  4L0Z B;  2E2I J;  2W7N A;  5DD4 A;  3X2Q H;  3J80 Z;  2JUC A;  3CO6 C;  4U0V A;  2BW3 B;  3RCO A;  3JRA A;  1HDP A;  3BCB A;  1X1B A;  4RB0 A;  2DOF A;  3K70 D;  4CHU A;  4XLH A;  3IAS 2;  3LA7 A;  1JHF A;  2OAZ A;  2K40 A;  2JWT A;  2UXX A;  1TWA J;  4F3Q A;  1OCC H;  2EWN A;  4B44 A;  4BAC A;  1KU7 A;  3MZH A;  1FMV A;  4BHB A;  3JRH A;  4UUV A;  4A3L J;  1IO2 A;  2ZSH B;  4FHT A;  2QSF X;  3QRF F;  2VJJ A;  4YRV A;  3ZMV A;  2CO5 A;  2FEZ A;  3I3L A;  3K2A A;  1R71 A;  2LY9 A;  1TWG J;  2EFN A;  2DDA A;  2DT7 B;  3R60 A;  4I99 C;  5EG0 A;  3MKZ A;  2A6T A;  3UKG A;  3PO2 J;  1PUF A;  4PJ0 C;  5ICF A;  1D5V A;  2HS5 A;  4D5C A;  2W1O A;  5LHH A;  1N77 A;  4AM3 A;  3E3V A;  1VQ8 I;  1P9Q C;  5C4J J;  4N0B A;  1ZLK A;  3KP7 A;  1B72 B;  2ICW G;  1HDD C;  5L3B A;  1FOK A;  2V26 A;  3KP4 A;  3OYA A;  1QQI A;  3T1B A;  3WTV C;  2ECB A;  1LDD A;  1YIJ I;  4P9U A;  2HTS A;  4WXH A;  3QYF A;  2HDC A;  4Z2Y A;  2EV5 A;  2QLZ A;  4A0Z A;  1VQL I;  1Y8Q B;  5LRS A;  3ZMZ A;  2M4K A;  3GTP J;  3A03 A;  2BOL A;  3H3V K;  2M0M A;  4IOC F;  1G6N A;  4G7O F;  3H9J A;  1LDK B;  2WY7 Q;  3ZQ7 A;  4AIJ A;  3NWT A;  3CCV I;  2HDD A;  4GRI A;  4NDL A;  3WE3 A;  2ZJQ F;  2BY3 A;  5LBQ A;  4BKX A;  5FKL A;  4F93 B;  4RGU A;  1WFX A;  2IGO A;  2L0K A;  4B3A A;  2LC2 A;  4ASN A;  3CO7 C;  1ITY A;  2VE8 A;  1HCR A;  2Y0M A;  1LFB A;  1QNT A;  4HQE A;  2HXI A;  4TV7 A;  2X6X A;  1T56 A;  2CW7 A;  2O03 A;  4BGD A;  4CDG A;  3K69 A;  2BVM A;  3O8G A;  2E1O A;  2W4S A;  3FX3 A;  2XAG A;  1T39 A;  1K6Y A;  3CJN A;  2MGQ A;  1WJF A;  5DYM A;  2OTL I;  2E1N A;  5EG0 B;  3DBL B;  4L5E A;  3QPH A;  5J4V A;  1SFO J;  5E3N A;  1GT0 C;  4EM2 A;  1PUF B;  4EJO A;  4UHT A;  3AL0 B;  1UHS A;  5CJ9 A;  3V8J A;  4A3E J;  2DYR H;  2VBW A;  3VYU B;  4A3B J;  2DQR A;  2R7R A;  1XN7 A;  2VI6 A;  1ZQ3 P;  1VQP I;  2X9D A;  5F08 A;  2R7V A;  1DGW Y;  2LFB A;  1D5Y A;  2COM A;  4LK1 F;  2KZG A;  4YIR X;  1G8X A;  4OWR B;  1WH7 A;  2ELK A;  4B4C A;  2FA5 A;  4E7H A;  1VFC A;  5GPC A;  2XF5 A;  3ZMU A;  1U0J A;  3T5X A;  4XRS G;  4RDU A;  3HUG A;  1HLV A;  1Y1V J;  1LJ9 A;  3IL2 A;  4D1Q A;  2M0C A;  4M72 A;  3FIS A;  2DFI A;  1SD5 A;  1YG2 A;  2F4I A;  3H5A A;  3K6G A;  1VQM I;  3CLQ A;  1HW5 A;  1U9O A;  2QVO A;  3C2B A;  2HOT A;  2PJR A;  5CVU A;  1MMN A;  2BGC A;  4BXU A;  2IBD A;  3RPQ A;  2IW5 A;  5J47 A;  1SFE A;  4CCO A;  4RS8 A;  1FJL A;  3ABK H;  1FIA A;  1TTY A;  1Y6I A;  1IXR C;  3Q5F A;  5CQE A;  4EJU A;  1YE9 A;  2VBY A;  2O3F A;  4LLL A;  2IPQ X;  1SVM A;  5TIS C;  1ZRE A;  1FYM A;  3F22 A;  1LDJ A;  5J1U A;  1BI2 A;  4LK0 F;  5DUI A;  3RI4 A;  4G94 A;  3DF8 A;  5J8C A;  2DLL A;  2H1K A;  4IHT A;  3HOX J;  4M71 A;  4PGH A;  5AIP A;  2O6G E;  3SXY A;  1FC3 A;  2ESN A;  4NBQ A;  2ESH A;  4ZTF A;  2KIF A;  1FT9 A;  2QEN A;  4U7D A;  4FCY A;  1U6G A;  4LB5 A;  3OIO A;  1S72 I;  4BNC A;  4CCL A;  3D1N I;  3BTC A;  2I10 A;  1BOB A;  1OLT A;  2G7U A;  2F48 A;  3ABU A;  1TNT A;  3BZC A;  2STT A;  3S8P A;  3QOE A;  2B9S A;  2ZO4 A;  2WV1 A;  2R7S A;  3P5J A;  1BJA A;  1HBX G;  2KLO A;  2ACJ A;  4HV5 A;  3ASN H;  1S7E A;  2GZW A;  1FNN A;  5BNG A;  2FSW A;  2VQH A;  4OMY A;  1GV5 A;  2F2E A;  2Y31 A;  4XM3 A;  3T8R A;  2JSC A;  3COA C;  3DTI A;  4UB6 C;  2KMU A;  4IHW A;  2KFD A;  2LF7 A;  2NS7 A;  3MZ8 A;  4CCN A;  3WU2 C;  1XSD A;  4PDK A;  3VYR B;  1TC3 C;  5A2Q Z;  5IYD J;  2A5Y B;  5ERI A;  3LSH A;  5IP7 J;  1PP8 F;  4I2O A;  4L0Y B;  3ECO A;  2PJR B;  4RB3 C;  2FD5 A;  3KEQ A;  2FXA A;  2XSJ C;  3LST A;  4I0B A;  1Z21 A;  5J1R A;  2LR8 A;  2TDX A;  3KZI C;  3ZMT A;  3F23 A;  1W5S A;  2L3D A;  4ZH4 F;  3IUO A;  2QF7 A;  1FX7 A;  4UVA A;  2LKP A;  3ML6 A;  4I98 B;  5F6F A;  3FXL A;  3FK6 A;  1UHM A;  2LLK A;  1P7I A;  3BG7 A;  5D8L B;  3I0T A;  3CCL I;  4BE0 A;  3CF5 F;  5GAH J;  4J19 A;  2IP2 A;  2OCC H;  1WQ2 A;  3SFZ A;  4CYC A;  3BDD A;  2M34 A;  2PMZ N;  3FXJ A;  1F43 A;  1F36 A;  1ZRF A;  3BR5 A;  2IGN A;  1SAX A;  3CQZ J;  3ERM A;  1YIT I;  1D1C A;  4DIQ A;  2K5C A;  1IV6 A;  1XCB A;  5BPI A;  2VOP A;  2L4M A;  4AYB N;  1NG6 A;  1XGN A;  3CJR B;  1BOA A;  4GYG A;  2DPU A;  3DLL F;  1OCT C;  2NYX A;  5D4R A;  3A1Y A;  3FDY A;  2KIQ A;  2VC0 A;  5K5R A;  3F8F A;  5HOO A;  2W24 A;  4FX0 A;  2WB1 A;  2W25 A;  3FF5 A;  1HF0 A;  5JHU A;  2X1C A;  1SD7 A;  3WU0 A;  5CVJ A;  3QP6 A;  4HQM A;  4HDV A;  4BEH A;  1I39 A;  3WOD F;  4ENK A;  1WHU A;  2NXN B;  4ANJ A;  2GXA A;  3LMM A;  5K7Z A;  3D5S C;  4RB2 C;  2DCE A;  3FXU A;  2FBI A;  2XGE A;  2I8D A;  3GTJ J;  4GCV A;  4XK4 A;  1P4X A;  4IHX A;  2PX9 A;  1H89 C;  2EV0 A;  2OA4 A;  5D6E A;  4DYQ A;  2W00 A;  3MFK A;  4QLC U;  1PP7 U;  5EEG A;  3OSF A;  2HPM A;  3P7N A;  2V9P A;  3RYP A;  1R5I D;  2ZME A;  3OOU A;  4XOR A;  2XF6 A;  5D5W B;  1FSH A;  4ZYD A;  1BI3 A;  3SJM A;  4U87 A;  3BPX A;  3F0C A;  3BTJ A;  3RZD J;  3SQN A;  4HBL A;  4F91 B;  3KYL A;  2Y0S N;  1Z91 A;  4L9J A;  1KQ8 A;  4E7K A;  4LJZ F;  1ZEL A;  2ZB9 A;  3W6K B;  2DI3 A;  4A0X A;  2E1M B;  2WA0 A;  4EVI A;  3C7J A;  1OFC X;  1S5L C;  1JXS A;  5D5X B;  1SMY F;  3J7A Y;  2VJ5 A;  1U5T A;  3HRM A;  2CS3 A;  1IUY A;  1TP4 A;  3CDI A;  4PJL A;  2ME6 A;  1STZ A;  4IHV A;  4RAG A;  2H6B A;  4EJV A;  3LA2 A;  2HFH A;  3ROU A;  1X2M A;  5DCF A;  1TWF J;  2KRC A;  3DWL E;  3L2Q A;  1QRY A;  4LD5 A;  1WPK A;  5HLG A;  1J09 A;  2JK3 A;  3G3Z A;  1SAU A;  3OYE A;  1QHG A;  2GM4 A;  2KRF A;  4BEH B;  4KIT B;  1YS6 A;  3D5R C;  1OIS A;  2OQG A;  4LIT A;  2EIK H;  2LH9 A;  2X6W A;  1RRJ A;  1FP1 D;  3OWT A;  5ILV A;  5GPA A;  3A0H C;  4CCM A;  1AHD P;  1Z6R A;  4FAS D;  3MKW B;  5HDK A;  2CUF A;  1EH8 A;  1MMG A;  3L7W A;  3BQZ A;  2QM3 A;  1SAN A;  3H35 A;  1WGX A;  4OIN F;  3D0S A;  4JX6 A;  3HOZ J;  3BQY A;  5LGN A;  1LVK A;  3IHU A;  4MEX F;  3SZT A;  1LUJ B;  2DOD A;  5FKN A;  4EGY A;  1X3U A;  2KL4 A;  3K9T A;  1R23 A;  2IA0 A;  2EQR A;  2ZME B;  3ABL H;  4MEY F;  4A3G J;  2DXI A;  2K02 A;  4G6T B;  3PIO F;  2Y9Z A;  1R5G A;  2KT0 A;  5F04 A;  1G59 A;  2Z3Y A;  2E7X A;  1J59 A;  2PQ8 A;  1K4T A;  4Q4Z F;  2GA1 A;  2XC7 A;  3HOU J;  2L2O A;  4XKV A;  5EGO A;  2A6E F;  1OR7 A;  3E5U A;  5BMZ A;  2MLG A;  5E8I A;  3MKL A;  2IA1 A;  1R58 A;  3EUA A;  4HF1 A;  2DQL A;  1BI1 A;  2J5P A;  1M1E B;  2ZJP F;  3IKT A;  4HX8 A;  2VKH A;  5JHF A;  4AU7 A;  3BR1 A;  4ITV A;  1SFX A;  1U5T B;  1JT6 A;  2W84 A;  3LSG A;  3L2R A;  3HYI A;  3RQI A;  2CRG A;  3M1E A;  4M3F A;  4PGG A;  3PFY A;  4A93 J;  2LRE A;  1DP3 A;  3EUK L;  2E1C A;  2JSP A;  2E60 A;  2VBZ A;  3REO A;  2VIX A;  3ABT A;  3G2B A;  1ZR4 A;  1P6R A;  1MZB A;  3EQL F;  4KN4 X;  2OZU A;  4MFE A;  4F52 A;  5K5Q A;  3KLO A;  1ZTR A;  5LEK A;  2XSD C;  2XIG A;  3S3O A;  4M9X A;  5DM7 F;  3GFM A;  4S0H B;  1TL8 A;  1R9T J;  2EZI A;  5FKK A;  3DU6 A;  3RIR A;  1XGM A;  2IA2 A;  3BZ6 A;  4XID A;  2P7C B;  1RPW A;  2FBH A;  2VOO A;  2A68 F;  4MTE A;  4UNO A;  4BY1 J;  2AS5 F;  2Z99 A;  3HL2 A;  3PM1 A;  1HKT A;  1P2F A;  1W5T A;  3A02 A;  1YJW I;  2NS8 A;  3MCZ A;  1HW1 A;  4Q47 A;  5GTI C;  2NVX J;  3O8H A;  4HST A;  2DA5 A;  4M6Y A;  2WAE A;  1F1Z A;  5L3G A;  1R1U A;  3WGI A;  1E0E A;  2BE5 F;  5L3F A;  5DCM B;  4X0G A;  3V7R A;  3OYG A;  4U7B A;  2ZC2 A;  4ZYH A;  2DFE A;  4BUP A;  4I09 A;  5EGO B;  4L18 B;  2EZH A;  3TKY A;  3PSF A;  2A3S A;  3I59 A;  3RYR A;  5KCM A;  4G7Z F;  1W0U A;  3TOB A;  4KFC A;  2DMU A;  4QPO A;  2R7T A;  2GOX B;  1N78 A;  4HZF A;  2L01 A;  4HX4 A;  3ZMS A;  4BXX J;  2HEO A;  3B73 A;  4HA8 A;  3LOC A;  1G4D A;  3HPG A;  4CO8 A;  1B59 A;  4RGR A;  1MW7 A;  1T2K A;  1IJW C;  3MWM A;  2HZT A;  2BY2 A;  5H2F C;  1SD4 A;  3Q9S A;  4HPQ A;  3ZN1 A;  4F92 B;  4IHS A;  4BY7 J;  1KZH A;  1SEU A;  1NG7 A;  2P0W A;  3BJA A;  2FQ3 A;  1ETO A;  4A6D A;  5KVR A;  3HEF A;  4BJ5 C;  1FOX A;  4KNY A;  3M8J A;  2MD5 A;  2XAU A;  2OD5 A;  2IXS A;  2HVS A;  4D5F A;  2JPC A;  3DXJ F;  3SEZ A;  3W2W A;  1NH3 A;  5L3D A;  3RQ4 A;  5IOZ A;  2TCT A;  2RVC A;  1L3L A;  4N4O B;  1X1A A;  2OJE D;  1WJD A;  1S3J A;  3HHG A;  3P9K A;  4OOI A;  2QYO A;  5C3E J;  4UXN A;  4M3E A;  1MBJ A;  3QU3 A;  2VON A;  1UB9 A;  3U9G A;  3JSP A;  2I5U A;  2K4J A;  5IYC J;  2B63 J;  4N9I A;  5F64 A;  5K1Y A;  5BS6 A;  3LSR A;  1J7K A;  3O3K A;  3KEO A;  3G6E I;  2R5Y B;  3EDP A;  1XMK A;  2H8R A;  3KP3 A;  1K78 A;  2BXZ A;  1E3H A;  4DYC A;  3I55 I;  1B8I A;  4DNC A;  4XLC A;  1Y0U A;  3T0Y A;  4L5I A;  4PSW A;  1BR1 A;  1VQ4 I;  1KU3 A;  2JRT A;  2D45 A;  3N97 A;  2Y69 H;  2K9N A;  2XKP A;  1FTZ A;  1IRF A;  3LQR A;  4CA0 A;  4G7H F;  4AUX A;  4ETS A;  3FK7 A;  3ZQI A;  3GTQ J;  1ETK A;  3BJ6 A;  2ZFU A;  1I3Q J;  2KP6 A;  4HSR A;  1Z0X A;  1E3P A;  5CVI A;  2FML A;  4CZZ A;  2NNN A;  3LFK A;  2A61 A;  3WG7 H;  2E36 A;  1YFH A;  5LRR A;  5EYR A;  4RBO A;  1TQM A;  2BZT A;  3ZQQ A;  5J8F A;  1FSE A;  5FGM A;  4HX7 A;  2BYV E;  1O3S A;  1KU9 A;  2D1V A;  2ZCW A;  1U78 A;  1HQC A;  5LGT A;  3BY6 A;  1Y1W J;  1IRX A;  1O7F A;  3LSJ A;  1G2H A;  1Z3Y A;  4OIR F;  3ZGK A;  1IDY A;  2W57 A;  4XR6 A;  4ZC3 A;  2DA1 A;  2JT1 A;  2HPI A;  2X0L A;  2L9V A;  3K4N A;  4A12 A;  5DV5 A;  2ZXJ A;  1O3Q A;  2GA2 A;  2CQX A;  5B3S H;  2VLA A;  2NVU B;  2R7F A;  2Z16 A;  4XLN F;  3PIP F;  3GWZ A;  2CJJ A;  2BXY A;  5HNF A;  1O7L A;  4KYW A;  3HOV J;  2DMT A;  2XUB A;  3J7Z I;  1XDU A;  3CCJ I;  3FMS A;  1TQP A;  3SZG A;  4Y7N J;  5JI6 A;  1MSE C;  2HQA A;  3VPR A;  1T08 B;  2LMD A;  4LGW A;  3F21 A;  2MLK A;  3ZN0 A;  2QQB A;  1XX5 A;  2DJI A;  3R6S A;  3S93 A;  3J7A O;  4QWQ A;  1YRN A;  2C6Y A;  4M3D A;  2EFQ A;  2VJI A;  3RKW A;  1K78 B;  1CGP A;  1CF7 A;  1FYK A;  4H4K C;  1B8I B;  2IRF G;  4E7Z A;  4MTD A;  4WK8 F;  2WB1 N;  3S1M J;  2DAO A;  5ICE A;  1FBS A;  3G1L A;  4L5J A;  1OCR H;  3JRB A;  5L3C A;  3FBI B;  4ZYE A;  2XDV A;  3IC7 A;  5J40 A;  5GAD J;  5IT9 Z;  2VQG A;  1MBE A;  1OKR A;  3TO7 A;  5D4S A;  4BXF A;  4FT8 A;  4A3C J;  3CCU I;  3W6V A;  3S3M A;  2DJN A;  1MDM A;  1BJZ A;  5B5E C;  1LE8 A;  2NVT J;  1RC9 A;  2BHY A;  1E2X A;  1UFM A;  4HEA 2;  3H1C A;  1JE8 A;  1ACI A;  2ZKZ A;  3AG1 H;  2FE3 A;  2XV4 S;  5HLT A;  2VT3 A;  1F4K A;  4NHJ A;  1LPQ A;  2MW8 A;  5ILS A;  1T0F C;  1BIA A;  3EPZ A;  1Z7L A;  2JQ7 A;  2FNA A;  4HAM A;  1X19 A;  5B1A H;  1H9G A;  4GDF A;  1X4O A;  2DK5 A;  1UMQ A;  3CCR I;  2Y9Y A;  4BHP A;  2VT2 A;  3OYC A;  4Y33 A;  1AWC A;  3LWF A;  2FJ1 A;  3M8F A;  1FTT A;  1HA8 A;  3PNV A;  4HV6 A;  5JLX A;  2OTJ I;  3L2U A;  2KHM A;  5H20 A;  3W3C A;  2QQ8 A;  1FOW A;  2A6H F;  3DKW A;  3RKY A;  3T8T A;  1S6L A;  1ZGW A;  3W2A A;  2FQ4 A;  2P5K A;  4EJW A;  5IP6 A;  2HTJ A;  3ABM H;  1W1W E;  2WWY A;  1APL C;  1AA7 A;  1ETY A;  3HTU A;  3QOP A;  3RJP A;  5EEA A;  4N9H A;  3S2D J;  1HOM A;  3S14 J;  1GHC A;  1YRN B;  2O61 A;  2P6T A;  3K7A J;  5DEQ A;  2CG4 A;  4RAY A;  5E20 A;  1ZYR F;  2HOE A;  4A0Y A;  1CF7 B;  2BY1 A;  3E1S A;  5F0H A;  3JTG A;  4UV8 A;  2FX0 A;  3DKY A;  1UCR A;  2WC2 A;  3DP7 A;  2XGC A;  1FY7 A;  2XVC A;  4PUS A;  2ZJ2 A;  5FFX A;  5IYB J;  3HSF A;  2VE9 A;  3DBH B;  4LB6 B;  4DJA A;  5JFR A;  4FIS A;  3WHB A;  1ENH A;  3GLX A;  2RAE A;  2P6S A;  3E6M A;  3U21 A;  4D9J A;  3WTS C;  2E5Z A;  3ASO H;  4YEL A;  2NNY A;  1MDM B;  1R22 A;  1MJ9 A;  1LE8 B;  4M6V A;  1X3W B;  2DBB A;  2E35 A;  3GME A;  3ELK A;  4IRG A;  3ZQH A;  3BG3 A;  2G9W A;  3V42 A;  4BDY A;  2VN2 A;  3K0L A;  4B43 A;  1MBH A;  2M4G A;  2H27 A;  1TLH B;  1IV8 A;  2DA3 A;  2M7A A;  1YJ9 I;  2V9V A;  1S8N A;  4ESF A;  5FD5 A;  1T8I A;  3DTE A;  1B9N A;  5EZG A;  3FXQ A;  1Y8R B;  4RGX A;  1TW2 A;  2FMY A;  2NOG A;  2M1B A;  1R36 A;  1AOY A;  2ZXW H;  4FET A;  2V1X A;  4S04 A;  3FXK A;  3HRT A;  2P4W A;  4A6E A;  4CZC A;  2WAQ A;  1R1T A;  2VKD A;  3QU6 A;  4CGZ A;  2R4G A;  3I64 A;  4RLF A;  2LP0 A;  4HG2 A;  2QA4 I;  1K61 A;  4U0Y A;  3ZQL A;  3EUH A;  3FM3 A;  2RRE A;  3E6C C;  2K9L A;  2R7X A;  1YS7 A;  3QAH A;  3HM5 A;  3WGH A;  4CYD A;  3CDH A;  2E71 A;  3WGG A;  4IX7 A;  2BY0 A;  2EPF A;  3ZCO A;  3JW4 A;  1QBJ A;  2LDU A;  2F6C A;  1GXQ A;  2DA6 A;  5E8G A;  5HS8 A;  4QSH A;  3TDU C;  3S15 J;  1IUF A;  2ELH A;  2QZ8 A;  1W36 C;  2XAS A;  1IF1 A;  5DM6 F;  4EAT A;  3KCC A;  4FE4 A;  4UB8 C;  1IGN A;  4XSZ F;  4ZJZ A;  2CMP A;  5HDG A;  1MKM A;  1UEL B;  1R4M B;  2UZK A;  1JT0 A;  3O6B B;  3BPV A;  2EIL H;  5IY5 H;  3G1M A;  3NQO A;  2RKH A;  4A3J J;  1JKO C;  2CWE A;  1B4A A;  4C9Y A;  2Q8K A;  3F8N A;  1GXP A;  2X6O A;  3DTK A;  3HOT A;  4FE7 A;  1F5T A;  5D5V B;  1RIO H;  1J0R A;  4IQ4 A;  5F1J A;  4BBS J;  1KGS A;  2CV1 A;  1J2X A;  3FMQ A;  1ZN2 A;  3DCF A;  4M74 A;  1G3T A;  3Q9V A;  4R1H A;  1NK3 P;  5ILU A;  1MND A;  1ZAO A;  4M3B A;  2CV0 A;  5FKM A;  2M45 A;  1YTY A;  4MO7 A;  3TP3 A;  3HUG B;  2XRO A;  1JHH A;  1WJE A;  3HOW J;  1IXC A;  4KDP A;  1IRG A;  2YUS A;  1X58 A;  2OCE A;  5KK1 A;  2ZNY A;  4IF4 A;  3CUQ C;  1JKR C;  1ZRD A;  2KDZ A;  4ESJ A;  3IH4 A;  1TWH J;  2OV7 A;  1HKS A;  3JCU C;  3TMO A;  3GYH X;  3AL0 C;  2D1H A;  2X85 A;  2M3A A;  1JUP A;  4A5N A;  2GIV A;  1DDN A;  4PFP A;  2L7M P;  2BVL A;  4RAF A;  3M07 A;  1DQU A;  4KIF A;  3I4N J;  2LY1 A;  4BYY A;  2QBY A;  3HXL A;  2OF7 A;  3OYI A;  2PBI A;  1ETQ A;  4EV0 A;  1Z77 A;  4V2F A;  1ZK8 A;  2V1D A;  3GTL J;  2W48 A;  4CH7 A;  1V5E A;  1JKQ C;  2IS4 A;  1I1S A;  3BRO A;  4JOM A;  1OYW A;  5M5Y J;  4A3I J;  3JAM K;  3BR0 A;  5KNL A;  3OYD A;  3WE2 A;  1YW7 A;  5B1B H;  4DYR A;  1XSV A;  2QWW A;  1KYZ A;  5E3L A;  1IN8 A;  3K1N A;  2RQP A;  4DZP A;  2H6C A;  1XPX A;  3BTL A;  3MN2 A;  5GAE J;  3CC7 I;  2ETH A;  1JUM A;  1ZKG A;  1D0X A;  3IRQ A;  3PSI A;  1A36 A;  1SC7 A;  4FTH A;  3LSP A;  1R49 A;  3GUD A;  1X1C A;  1RKT A;  3CLO A;  1Y39 A;  3C3W A;  2DDB A;  3Q0V A;  3GBG A;  2IS2 A;  3LFU A;  4JK1 X;  5IT3 A;  2DT5 A;  3S3N A;  1W7P A;  2ZJR F;  2COB A;  4RMN A;  2RC4 A;  3CJT B;  5FJ8 J;  5E17 F;  1RKW A;  1WI9 A;  4XMY A;  4D7M A;  2RQQ A;  5HNH A;  3OYJ A;  4KIS A;  3OYH A;  4MIM A;  4A5M A;  3MVP A;  1W7P D;  4XKB A;  1GDT A;  1D0Z A;  3DEE A;  4XOT A;  2X51 A;  4EEF G;  1RES A;  2O8K A;  4L9V A;  4XIC A;  4I0A A;  2DT6 A;  4UV9 A;  2ZFW A;  5TGT A;  3KPH A;  1QPI A;  4DW6 A;  1Y0N A;  2MH2 A;  2LNB A;  4G8X A;  2IS6 A;  1F9N A;  2GBY A;  3KYD B;  5D6F A;  2L4A A;  3CES A;  2QBY B;  4WF2 A;  2DYS H;  3IH3 A;  5EF6 A;  3W6J B;  1O57 A;  1RI7 A;  4CYC B;  3CF2 A;  2EJR A;  1X3Z B;  2KRH A;  3SZP A;  3I54 A;  4XLF A;  5E3M A;  1BW5 A;  4XSX F;  2ZXH A;  2CUZ A;  2PLY A;  1W4M A;  3HPH A;  2VPR A;  4D7N A;  2VL8 A;  1VQN I;  2FRH A;  2MSY A;  3VDX A;  4JYK A;  3IAM 2;  3IWZ A;  5HLH A;  1LKX A;  3GO5 A;  1UG2 A;  1G3W A;  2K85 A;  4HDU A;  2M2E A;  2VQC A;  2E7W A;  2EK5 A;  2JTV A;  3GFJ A;  2HGC A;  3KE2 A;  5BOX A;  3QQA A;  3K4M A;  4BH9 A;  3S1R J;  3DU5 A;  1D1A A;  4NNJ A;  3R4K A;  5HOD A;  3NAR A;  5F0F A;  3FHZ A;  1RUO A;  3GF2 A;  1MMS A;  2D2W A;  4OU0 A;  1ZR2 A;  3PQJ A;  3Q0U A;  3GXO A;  2BEO A;  4BBR J;  1I6X A;  2CW0 F;  1NK2 P;  2W82 A;  5TRD A;  3I56 I;  1GV2 A;  4Q48 A;  2XPW A;  4QTR A;  1Q1V A;  3AKZ A;  1W7P B;  1WCM J;  1W0T A;  2GXG A;  2PFB A;  3S2W A;  1HC8 A;  3J7Y J;  4C30 A;  2CUJ A;  2FNP A;  2VPL A;  4UVC A;  3E6B A;  2F5C A;  5FRM A;  4C3H J;  1Y56 A;  3F8B A;  3L2W A;  5DUK A;  5J1Y A;  1YQA A;  1IDZ A;  2HOS A;  1VQO I;  1FBQ A;  2MBF A;  4GYI A;  3KZY A;  1JKP C;  2X1E A;  2UWM A;  2H1L A;  1MBK A;  3UR3 C;  1NHA A;  4XKC A;  4HW0 A;  3L09 A;  4EQQ A;  2IAI A;  1REP C;  3GTM J;  3GW2 A;  1YO5 C;  5M5W J;  4B1R A;  4IRH A;  1YJN I;  4OIO F;  3IRR A;  5EDN A;  1ZAR A;  2YS9 A;  3TQN A;  2R92 J;  4K2E A;  1BR4 A;  5K7H A;  5JVT A;  1E17 A;  2A07 F;  3I53 A;  2AXL A;  3ZP5 A;  1ETW A;  2K27 A;  4IXA A;  3C1D A;  1XD7 A;  2MC3 A;  2G0E A;  4RB1 A;  1AU7 A;  3PO3 J;  3QPT A;  4WWC A;  4A69 C;  4KJZ A;  1H9T A;  5LHG A;  4NC8 A;  4WXC A;  1ZLJ A;  2GOM A;  3DPT A;  3FM5 A;  4Y4R A;  1DP7 P;  4C2U A;  2JA8 J;  4EJT A;  2XAF A;  2ECC A;  4UUS A;  4KMU X;  5HDN A;  2DTZ A;  1X1D A;  4G6Q A;  3ERE D;  4RGS A;  3CD6 I;  1T98 A;  2HWV A;  3RKX A;  3KX2 A;  1KQ9 A;  1FZP B;  1A04 A;  4HRI A;  2K86 A;  3GVA A;  3K1M A;  5BPD A;  1TNS A;  4XON A;  4R8H A;  2EIJ H;  1DU0 A;  1HW2 A;  1E3O C;  1ZG3 A;  4PFO A;  2E1M C;  3H3U A;  3RDI A;  3DFG A;  4PSX A;  1YYV A;  1N25 A;  2WAD A;  1UZC A;  1U9N A;  1FYL A;  3BT9 A;  3IH2 A;  4IVN A;  3HC7 A;  1BN5 A;  4LIU A;  4A2U A;  3PNT A;  4PJJ A;  4II3 A;  2PEX A;  2QUF A;  4XLA A;  4LOC A;  2DTR A;  4XOP A;  1N75 A;  1TT0 A;  2OQR A;  2VB6 A;  5D5U B;  2O5R A;  1IN6 A;  2XGX A;  2XAQ A;  4LG3 A;  5JVG F;  4X1E A;  5F27 A;  1XG1 A;  4GXO A;  4II2 A;  1ERD A;  3S2H J;  5GTH C;  2RDP A;  5IPA A;  1VQ5 I;  1MGT A;  3GZ6 A;  2K4B A;  5HS7 A;  3FZV A;  4CUG A;  3TED A;  1A5J A;  3IKV A;  3CMY A;  2AXT C;  1OPC A;  1IXS B;  2HZD A;  2EZL A;  1IN4 A;  3BG9 A;  4CCK A;  4BQA A;  2JPB A;  2DA2 A;  1B1B A;  2Y75 A;  4B48 A;  3B6A A;  3KP6 A;  2CU7 A;  2J5O A;  2NS0 A;  3V8K A;  2WAQ N;  2ZME C;  3WTY C;  4UUS B;  3SEQ A;  3MZY A;  2Q0O A;  2EIN H;  4U0W A;  5H6Q A;  4KIG A;  3H36 A;  4PCQ A;  3HJE A;  4F55 A;  2F5E A;  2DA4 A;  2L7F P;  1D1B A;  1OMI A;  1LQ1 A;  2LBF A;  4HF0 A;  1K83 J;  5J6X A;  3ZOB A;  2CYY A;  2VKV A;  2V9K A;  4IL6 C;  3QWL A;  2P8T A;  1ONV A;  4QPQ A;  4RM2 A;  3ZMD A;  3A01 A;  1R5H A;  2M5W A;  1PDN C;  2IT0 A;  5ICC A;  1S7O A;  1TW3 A;  1UST A;  5K5O A;  3FXR A;  2WY8 Q;  2O7O A;  4MQV A;  4Y17 A;  1U5T C;  5FFZ A;  1GVJ A;  2Z5U A;  3K2Z A;  4G12 A;  1QHH D;  2P5V A;  4AYB A;  2XPU A;  3HRU A;  1IN5 A;  3ZXS A;  1MJB A;  4JX5 A;  4BDZ A;  1V3F A;  2QQA A;  2QEX I;  1O3T A;  1VQ6 I;  3OOP A;  5LFA A;  2XAJ A;  3OSG A;  1T33 A;  1FIP A;  5K7F A;  3K10 A;  1BA5 A;  2YR2 A;  1DPU A;  1VI0 A;  1K7A A;  2EA2 A;  2HR3 A;  4YG2 F;  1GVD A;  4AVZ A;  3HKZ A;  2ADU A;  2CFO A;  3OYK A;  4MFD A;  3TBI A;  3OY9 A;  3L2C A;  2QKM B;  4AD9 A;  2ZBK A;  2R3S A;  1MD0 A;  3I59 B;  4CSW A;  4P96 A;  3HBL A;  3BTI A;  5LD2 C;  1IAW A;  3CCE I;  3LSI A;  2LG4 A;  3DQV C;  3M1C A;  2PG4 A;  1XMX A;  3OYB A;  2RGV A;  1S29 A;  1FWZ A;  3HSR A;  3MAJ A;  1FMW A;  4JX4 A;  3QPS A;  2H94 A;  2O0Y A;  3R0A A;  4I6Z A;  1PYV A;  3ZR8 X;  4EM1 A;  2XHK A;  2F4M B;  3CDL A;  2KPM A;  1R4N B;  2X6Y A;  4Y3O A;  1AKH A;  4UY8 I;  4JBA A;  3TW7 A;  1KA8 A;  1K79 A;  2WBM A;  3CJQ B;  4ZDP A;  3BR3 A;  2IS1 A;  2M8E A;  1Z3X A;  2VUM J;  3S1N J;  2PMU A;  4ZZL A;  2OC6 A;  5AIQ A;  3K1P A;  4E6K G;  2K9M A;  1A6Q A;  5J4Y A;  3GTO J;  2HYJ A;  2VBX A;  2XF7 A;  4KMF A;  1WWX A;  2V79 A;  3WU1 B;  2F4O B;  2LBF B;  1Z9C A;  1XDS A;  4UVB A;  4IRI A;  3ULQ B;  1ETX A;  3H92 A;  4KT5 C;  5C4X J;  3FXM A;  2NVY J;  3PQK A;  1ULY A;  1BC7 C;  4BS9 A;  3A01 B;  4C2T A;  1ZG5 A;  3AG3 H;  2GXB A;  3WTX C;  3A4C A;  4IHY A;  4XL9 A;  4UUT A;  5FB2 A;  1OQY A;  3KP2 A;  1YW9 A;  3DV8 A;  3HOY J;  2YU3 A;  4HLX A;  3E7L A;  3VB2 A;  2RNJ A;  3U2R A;  2AQF A;  3QPL A;  2LKS A;  3TL4 X;  5H6R A;  4EM0 B;  4IQJ A;  4M9S A;  2JN6 A;  4B09 A;  4XKW A;  3LNQ A;  1B6A A;  2GLO A;  5HVQ C;  3K4K A;  2A05 A;  2DW4 A;  4RA2 A;  3F8M A;  1X1P A;  3KLN A;  4LLN A;  4BJT A;  1D0Y A;  4WXD A;  2V1U A;  4ZDL A;  4HOB A;  4BE1 A;  4XBF A;  3UNG C;  3JRD A;  2JRM A;  3BZK A;  4MLO A;  2CW8 A;  5AON A;  3WHC A;  4DBQ A;  1EH7 A;  1IZ1 A;  3CUQ A;  3AG4 H;  3LAJ A;  3NEU A;  1MMD A;  2X1D A;  2EBI A;  3V7S A;  3HB9 A;  4YFN F;  5F1R A;  2KJC A;  1EA3 A;  3FKJ A;  2Q1Z B;  2E19 A;  3G71 I;  4LMY A;  1SFK A;  2VJ4 A;  1ORK A;  1FP2 A;  1I50 J;  4D0P A;  1AKH B;  2ZNZ A;  3A2K A;  4J01 A;  1H0M A;  1UJ8 A;  1XS9 A;  3OL3 A;  2LKX A;  2DPD A;  2GQQ A;  2IEK A;  3L2V A;  3I4M J;  3F9K A;  4JP0 A;  4W1U A;  3HGY A;  2R5Z A;  4KUM A;  3IP4 B;  4I7H A;  5CYV A;  1LFP A;  1UAA A;  2EH3 A;  3KYC B;  4PZJ A;  4HNV A;  2V4J C;  1A6I A;  1A31 A;  1RUN A;  2E2H J;  3E5X A;  3JRE A;  2OZ6 A;  2R7U A;  3CZ6 A;  2FF4 A;  3H9G A;  3MQ0 A;  3BOQ A;  2EIM H;  3IWF A;  5M3M J;  3V7C A;  2ID3 A;  1POG A;  5CLS A;  5KHD A;  3CC2 I;  3J81 K;  4IO9 F;  1J75 A;  3OIQ A;  1R7J A;  1YX5 A;  3AAF A;  1OYI A;  5FRN A;  4KT6 A;  3PNY A;  2DOE A;  1P7J A;  2KIS A;  4NC7 A;  3G4S I;  4ZYA A;  2DMN A;  5FO5 A;  3OR1 C;  4L9N A;  1WZ2 A;  5M5X J;  1EKE A;  3TOA A;  3P9I A;  2VXD A;  3K4L A;  1W5C C;  2K9S A;  3CME I;  1P92 A;  4Q5S F;  2CQ7 A;  3DBR B;  3DKX A;  4Y52 J;  4HNT A;  1MNM C;  2F5D A;  2L9S A;  3CUQ B;  4C3I J;  2LF8 A;  2Y2Z A;  4OMZ A;  4AC0 A;  2WV0 A;  1ZG1 A;  1FEX A;  1LNW A;  1WI3 A;  2XKO A;  4G6D A;  3TO9 A;  1DPR A;  4AIK A;  2YU9 J;  4R79 A;  6PAX A;  3ZPL A;  5E1X A;  4RLQ A;  1FBU A;  4IOA F;  1MBG A;  2DN0 A;  5GP9 A;  5HLI A;  3BCA A;  3KFW X;  3R0J A;  2JVH A;  1DUX C;  3GTG J;  3H5N A;  2ISZ A;  3ZQG A;  4LG0 A;  3C2H A;  3OS2 A;  1L0O C;  2M30 A;  2AHQ A;  2FU4 A;  5LGU A;  2R5Z B;  3VEP A;  2RN7 A;  1S7A A;  1PJR A;  5EJC A;  5FKO A;  2KKO A;  2L9R A;  1Q1H A;  2MG4 A;  1HST A;  2RV8 A;  3I4P A;  1WJB A;  3QYB A;  4PK4 A;  4HF2 A;  2KIU A;  5FRO A;  3G1O A;  2M7B A;  3SFI A;  3AFH A;  2UV1 A;  1EF4 A;  3KET A;  2EZK A;  4XRS A;  1BW6 A;  1QO0 D;  4XLE A;  3NWS A;  3I9V 2;  2XPV A;  4F7Z A;  3F3X A;  1RR8 C;  1MH3 A;  2KJB A;  2PI0 A;  1K4S A;  4Y15 A;  4W97 A;  5J3L A;  3BLY A;  4A3K J;  3LSK A;  3S1Q J;  4CIC A;  2Y48 A;  1V55 H;  3K70 C;  3RKQ A;  4MGR A;  4E7L A;  3ZQF A;  4YFK F;  2HKX A;  2JJ7 A;  4DQ2 A;  1MJA A;  2K3P A;  2LVS A;  4P1W A;  2PJP A;  3LSM A;  1GUU A;  4ON0 A;  4BAY A;  2VC1 A;  1QPM A;  1MNE A;  1OYY A;  5E79 C;  1RNL A;  3L9F A;  5KAF C;  2JA2 A;  2NRA C;  2N8G A;  1ZRC A;  1YOV B;  1ZGJ A;  3QYE A;  5FD6 A;  3EYI A;  5LLQ A;  4NQW A;  3BJO A;  3RPU A;  1X2N A;  1XGS A;  3VOD A;  4ZTJ A;  2FBK A;  2WAF A;  3VSL A;  4LG0 B;  5GAG J;  2YSR A;  2ZSI B;  4E7S A;  4O3M A;  2M87 A;  2XB0 X;  4MHG A;  2DK8 A;  3BWG A;  2ISY A;  1TBX A;  1IRZ A;  5FLM J;  3RPU D;  5ED4 A;  1KON A;  2VQL A;  4GO1 A;  1IW7 F;  1XMA A;  3ISP A;  1OJL A;  4Y13 A;  3BG6 A;  2QGU A;  2FOK A;  4HYE A;  1RR7 A;  4U88 A;  4P5O A;  4L9T A;  3EYY A;  5FLX K;  3MEX A;  2CGP A;  1IN7 A;  3KEY A;  2VKE A;  2PN6 A;  2XGD A;  1Z7U A;  1RZ4 A;  3LL7 A;  2IJL A;  3EET A;  1XSX A;  2O9L A;  1LB2 A;  1Z05 A;  2MC4 A;  2V1N A;  2STW A;  3GFL A;  2V6C A;  4ZZD A;  4BU2 A;  1V5G A;  3ZRG A;  1H88 C;  3Q3S A;  2QSH X;  2LD5 A;  2LSO A;  2L02 A;  2DFF A;  3H3Z A;  2HVQ A;  3QOD A;  3GFI A;  4CCJ A;  4EMS A;  2OPT A;  3GX4 X;  3M7G A;  1YI2 I;  2WTE A;  2HYF A;  1G3S A;  3PL8 A;  2NOJ B;  4XRF A;  4PJN A;  4BHC A;  2Z9O A;  1T38 A;  1BC8 C;  3DPL C;  1U8B A;  2VAS A;  5JLW A;  3SHF A;  1QVT A;  3CMA I;  4BQN A;  4YIF A;  1I6H J;  1BL0 A;  5KAI C;  2YX4 A;  1Z67 A;  4PJM A;  2JA6 J;  1I3A A; 
#chains in the Genus database with same CATH homology
 4B47 A;  2Z2S B;  2R7V A;  1DGW Y;  4NQW B;  1IRX A;  1WJC A;  1G8X A;  1Z3Y A;  3KX2 A;  3OMY A;  4OWR B;  3ZGK A;  4ZC3 A;  4XR6 A;  4E7H A;  4HRI A;  2CV2 A;  2XF5 A;  3SDB A;  1U0J A;  2HPI A;  1TZL A;  2UUZ A;  4XON A;  3K4N A;  1UG0 A;  4D1Q A;  4PFO A;  2E1M C;  4PSX A;  3K4J A;  2F4I A;  2WAD A;  2VLA A;  3H5A A;  3K6G A;  2Z16 A;  3HC7 A;  2PJR A;  4LIU A;  1MMN A;  5HNF A;  3SYT A;  2KQR A;  3PNT A;  4PJJ A;  4CCO A;  4II3 A;  3SZG A;  2HQA A;  4XLA A;  1Y6I A;  3OIP A;  5CQE A;  4XOP A;  1YE9 A;  1N75 A;  1TT0 A;  2DJI A;  4JQF A;  3S93 A;  2VB6 A;  2O5R A;  2VJI A;  4LG3 A;  1ERD A;  4II2 A;  4H4K C;  4E7Z A;  2QKL B;  4CUG A;  3FBI B;  2XDV A;  4ZTF A;  2HZD A;  4CCK A;  2VQG A;  3RSN A;  4BXF A;  4CCL A;  3ONQ A;  1BOB A;  1OLT A;  4B48 A;  3S3M A;  3S8P A;  3QOE A;  4LIV A;  3OS0 A;  2Z1D A;  2R7S A;  3EUH C;  4IZZ A;  2KLO A;  3SEQ A;  4HEA 2;  2ZXI A;  2RNG A;  2L7K A;  2LOO A;  3N05 A;  4F55 A;  2VQH A;  1YX3 A;  5HLT A;  4XM3 A;  1T0F C;  1D1B A;  2A5W A;  1Z7L A;  1BR2 A;  2LBF A;  3EPZ A;  3DTI A;  2E5N A;  1X19 A;  2KMU A;  2V9K A;  1X4O A;  2MFZ A;  3RTR A;  3H5R A;  3H9Q A;  4QPQ A;  4RM2 A;  4Y33 A;  3OYC A;  4CCN A;  3VYR B;  3CP8 A;  2R7W A;  1HA8 A;  3PNV A;  3LSH A;  1MMA A;  3L2U A;  2WY8 Q;  2KHM A;  3W3C A;  2PJR B;  1JI8 A;  1VZ0 A;  4AYB A;  2XSJ C;  3VYS B;  1QHH D;  1Z21 A;  3W2A A;  3ZXS A;  4BDZ A;  1WJA A;  2IGK A;  3IUO A;  5LFA A;  1AA7 A;  4BJ6 C;  3K10 A;  3C2G A;  4DGW B;  3OYN A;  4AVZ A;  3HKZ A;  4E7I A;  2CFO A;  3OYK A;  3TBI A;  3OY9 A;  3BG7 A;  2QKM B;  4CSW A;  3K4C A;  5LD2 C;  4BE0 A;  3E1S A;  3LSI A;  2LG4 A;  3DQV C;  3M1C A;  4BQQ A;  3OYB A;  2VXZ A;  3DKY A;  1T95 A;  5CPR B;  2IGN A;  2V7F A;  4PUS A;  3W2V A;  4XQF A;  2R7O A;  3FHN A;  1FMW A;  3BC8 A;  1D1C A;  4DIQ A;  2FUG 2;  2K5C A;  1PYV A;  3ZR8 X;  4DJA A;  1V5F A;  1NG6 A;  3CJR B;  4J00 A;  2KPM A;  2X6Y A;  3U21 A;  4Y3O A;  4D9J A;  1GLN A;  2E5Z A;  4YEL A;  3A1Y A;  3FDY A;  2WBM A;  3CJQ B;  4ZDP A;  2IS1 A;  5HOO A;  2WB1 A;  1Z3X A;  3CMM A;  2MD0 A;  2OC6 A;  3V42 A;  2X1C A;  2HNH A;  4B3X A;  4E6K G;  4BDY A;  4BEH A;  2K9M A;  4B43 A;  2Q2E B;  2XF7 A;  2M4G A;  4ANJ A;  4DOZ A;  3LMM A;  2M7A A;  4YEJ A;  2LBF B;  3D5S C;  3DTE A;  2DCE A;  3OL4 A;  4BE2 A;  2I8D A;  2R7Q A;  4BS9 A;  4FET A;  4C2T A;  2F5V A;  3A4C A;  4XL9 A;  4CZC A;  2WAQ A;  2VKD A;  2R4G A;  4RLF A;  2W00 A;  4HG2 A;  2LY2 A;  2HPM A;  2RRE A;  2K9L A;  2R7X A;  3OOU A;  2AQF A;  2LYC A;  4XOR A;  2XF6 A;  3TL4 X;  4IQJ A;  4U87 A;  4IX7 A;  3DLA A;  3ZCO A;  4XKW A;  3OYL A;  2F6C A;  3HG9 A;  5HVQ C;  4F91 B;  3K4K A;  3KYL A;  3MKY B;  4E7K A;  4BJT A;  1D0Y A;  1W36 C;  4ZDL A;  1ZEL A;  4XN0 A;  4BE1 A;  3S32 A;  4E7J A;  3UNG C;  4EAT A;  2E1M B;  2WA0 A;  1X4P A;  4ZJZ A;  2CMP A;  2ELJ A;  4MLO A;  4IKF A;  2CW8 A;  1UEL B;  4DBQ A;  3J7A Y;  2MAB A;  2VJ5 A;  5CQG A;  1MMD A;  2X1D A;  2CS3 A;  4C9Y A;  3OYF A;  4NUB A;  4PJL A;  3HOT A;  3DTK A;  1EA3 A;  3FKJ A;  3OS1 A;  2Q1Z B;  4IQ4 A;  1DGR M;  2CV1 A;  1SFK A;  2VJ4 A;  3L2Q A;  2KRC A;  3DWL E;  4DBR A;  2L5Q A;  3A2K A;  1QU3 A;  4J01 A;  4HNU A;  1MND A;  1J09 A;  2KZV A;  2MYS A;  3D5L A;  3OL3 A;  2CV0 A;  3HUG B;  3L2V A;  3F9K A;  3PUB A;  1SAU A;  3OYE A;  1QHG A;  1WJE A;  4BEH B;  4KIT B;  2IGM A;  2PMZ A;  3IP4 B;  3D5R C;  4LIT A;  1LFP A;  2LH9 A;  2X6W A;  1UAA A;  3OWT A;  3DPU A;  4CCM A;  4FAS D;  3MKW B;  3VSK A;  2V4J C;  3OYM A;  1MMG A;  2OV7 A;  3H0D A;  4ZDO A;  3TMO A;  3AL0 C;  3H35 A;  2X85 A;  2R7U A;  1S9H A;  3CZ6 A;  4OAZ A;  2M3A A;  2BW3 A;  3H9G A;  1LVK A;  4PFP A;  2KL4 A;  2BVL A;  5KHD A;  2HVR A;  3PJR A;  2JVG A;  3OIQ A;  1DQU A;  2DXI A;  4G6T B;  2DOA A;  2LY1 A;  2CH0 A;  1YX5 A;  1G59 A;  3HXL A;  5FRN A;  4KT6 A;  3PNY A;  3OYI A;  4NC7 A;  4ZYA A;  2XC7 A;  2L2O A;  3OR1 C;  4XKV A;  2JUG A;  4CH7 A;  1V5E A;  2KDO A;  2VXD A;  3K4L A;  2IS4 A;  4JOM A;  2HDW A;  3EUA A;  3OYD A;  3CP2 A;  5KNL A;  3DKX A;  4HNT A;  2VKH A;  2L9S A;  2HU9 A;  5JHF A;  3FBN B;  4ITV A;  3K4B A;  4AU7 A;  4E4H A;  3LSG A;  4R79 A;  3L2R A;  2AQE A;  3MD2 A;  2L9N A;  4RLQ A;  1D0X A;  3BCA A;  2LRE A;  3PFY A;  3EUK L;  3VWB A;  1DP3 A;  1R6R A;  2JVH A;  2JSP A;  4XN3 A;  2V6E A;  2E60 A;  3H5N A;  2Y0S A;  3PSI A;  4N4N B;  2VIX A;  3G2B A;  4BQO A;  3C2H A;  3OS2 A;  4RM3 A;  3E0J B;  4F52 A;  3VYT B;  1X1C A;  1OR7 C;  3S3O A;  4XNF A;  3GBG A;  2IS2 A;  3LFU A;  3S3N A;  4BL0 B;  3DU6 A;  3MMY B;  1PJR A;  4RMN A;  2LRD A;  1WJ5 A;  4XMY A;  3HOS A;  5CKT A;  2RQQ A;  5HNH A;  2OUM A;  3OYJ A;  3OR2 C;  1W36 D;  4KIS A;  3OYH A;  4OAY A;  4XKB A;  3HL2 A;  1WJB A;  1D0Z A;  3DEE A;  3QYB A;  4PK4 A;  2X51 A;  4XOT A;  2W7N A;  5FRO A;  2M7B A;  2DT6 A;  3AFH A;  2BW3 B;  3RCO A;  5TGT A;  2UV1 A;  3BCB A;  4HST A;  1X1B A;  3K70 D;  4XLE A;  4XLH A;  2WAE A;  3IAS 2;  3I9V 2;  3NWS A;  2IS6 A;  1E0E A;  4X0G A;  3OYG A;  4U7B A;  4F3Q A;  3CES A;  4B44 A;  4BAC A;  3BLY A;  1FMV A;  3CF2 A;  3LSK A;  2ZSH B;  4BUP A;  2KRH A;  2VJJ A;  4YRV A;  4XLF A;  3I3L A;  3PSF A;  2R7T A;  5KCM A;  4QPO A;  3K70 C;  2GOX B;  3MKZ A;  2DT7 B;  2ZXH A;  1N78 A;  2A6T A;  2CUZ A;  4E7L A;  3HPH A;  2VL8 A;  3VDX A;  3IAM 2;  2W1O A;  3HPG A;  1LKX A;  1N77 A;  1MW7 A;  2K3P A;  4P1W A;  1P9Q C;  4HPQ A;  4F92 B;  3LSM A;  2VQC A;  1MNE A;  1NG7 A;  2P0W A;  2JA2 A;  2V26 A;  3QYE A;  3OYA A;  3K4M A;  3DU5 A;  1D1A A;  4NNJ A;  4BJ5 C;  4ZTJ A;  2WAF A;  3M8J A;  3QYF A;  3VSL A;  2XAU A;  2ZSI B;  4E7S A;  2IXS A;  2HVS A;  2M4K A;  2W82 A;  2BOL A;  3SEZ A;  2M0M A;  3RPU D;  1KON A;  2VQL A;  3W2W A;  3AKZ A;  3H9J A;  3RQ4 A;  1LDK B;  3BG6 A;  4N4O B;  4C30 A;  1X1A A;  2WY7 Q;  2CUJ A;  1WJD A;  4P5O A;  2VPL A;  3NWT A;  2R7R A;  5FRM A;  4GRI A;  1Y56 A;  3L2W A;  3KEY A;  3LL7 A;  4F93 B;  1WFX A;  2IGO A;  2X1E A;  2MC4 A;  2V1N A;  2UWM A;  2LC2 A;  3UR3 C;  4BU2 A;  4XKC A;  1V5G A;  3ZRG A;  2X6X A;  4XLC A;  4PSW A;  1BR1 A;  2CW7 A;  2HVQ A;  4BGD A;  3QOD A;  1BR4 A;  2BVM A;  4CCJ A;  2W4S A;  1K6Y A;  1WJF A;  4CA0 A;  3PL8 A;  2NOJ B;  4PJN A;  4KJZ A;  3AL0 B;  2ZFU A;  3DPL C;  4NC8 A;  2KP6 A;  4HSR A;  2VAS A;  2GOM A;  3DPT A;  4Y4R A;  4BQN A;  4C2U A;  3VYU B;  3ZQQ A;  4PJM A;  1X1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...