1WJAA

Solution structure of the n-terminal zn binding domain of hiv-1 integrase (d form), nmr, regularized mean structure
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the N-terminal zinc binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Zn-binding protein
total genus 10
structure length 47
sequence length 47
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjaA00
3HPHA 1MW7A 1LFPA 1E0EA 1K6YA 1KONA 4F3QA 3HPGA 1WJAA 1WJBA 1WJCA 1WJFA 1WJEA 3F9KA 1WJDA
chains in the Genus database with same CATH superfamily
2TRTA 1JKPC 5E20A 1JGSA 1V5EA 2VQGA 4BY1J 2CQKA 1S8NA 3DLAA 1BL0A 1QZZA 3H3UA 2BGCA 5AONA 4Y7NJ 3K2ZA 4XLNF 3CMMA 4EQQA 2HYJA 2B63J 1HKSA 1T39A 4WF2A 5HNHA 2M0MA 2JTVA 1RIOH 5FKMA 4QWQA 3OL4A 1T6SA 2NVXJ 4U7DA 2X48A 3ABMH 3KX2A 5J1UA 3GMEA 3M1EA 1S3JA 1BI1A 2E7XA 3Q9VA 4EM1A 6PAXA 2VXZA 4PCQA 4C3IJ 1UZCA 5J8CA 3WTVC 3CESA 2W57A 1FOYA 1FYMA 2VC0A 4A3KJ 3K1NA 1I1SA 5JVTA 1YTYA 2PMZN 4AIJA 1LPQA 3CP2A 1I6HJ 5IP7J 1SEUA 1B59A 3IH2A 1VQ4I 5K5OA 2UZKA 2ZSHB 1HQCA 2JWTA 3ZMDA 3I9V2 1HW1A 4L9NA 5B5EC 3GTKJ 1KQ0A 2CQ7A 2OC6A 4W97A 3W6JB 5BS6A 1JI8A 2W24A 1ZLKA 2XPWA 5IYDJ 1EH8A 2VIXA 3TOBA 2V9PA 4EJWA 3S3OA 5EF6A 2L7MP 1WJAA 1O7FA 3HRSA 2KMUA 1V4RA 3TMOA 2OAZA 3Q0WA 1IRXA 4XSZF 3U9GA 2M45A 1N78A 2Z2SB 2DN0A 9ANTA 4RM3A 4G12A 1OMIA 1OCOH 4RGXA 4U87A 4RMNA 1R4NB 3EUKL 2ZXWH 1WHUA 3HOSA 1EH7A 2L3DA 4BXFA 4A3JJ 3LSKA 1DP3A 1YJ9I 2MH2A 2GIVA 3HEFA 4DBQA 3OYAA 2ZJRF 4HX4A 2L7KA 2QYOA 4CYDA 3WTYC 4HQMA 5B1BH 3OOPA 4G6DA 2OZ6A 1JHFA 5LEJA 1BW5A 1OJLA 1POGA 4J01A 2XAUA 3JRIA 1RUNA 3P5JA 5BQTA 4MO7A 1HSJA 1C0WA 3CTAA 2KL4A 2H1KA 2DFHA 1IG7A 2VJ5A 1AKHA 4NC8A 4ZC3A 2HQRA 5EZHA 3D0SA 2KIMA 1RR7A 3J7AY 3H9GA 2Y0SN 1A6QA 2AXLA 4IO9F 2JA8J 4OIPF 2E7WA 1U78A 3CC7I 3HOWJ 3DTKA 1G2HA 3RQIA 4LG0B 4CXFA 3HHHA 3RI4A 4BQOA 2OZUA 4UUSA 2QSGX 3NWSA 2EV5A 4HG2A 1GVDA 1OCPA 2KHMA 2VN2A 1QRYA 4HOBA 3J81K 4RGSA 1RKTA 3R60A 2XHKA 4BUPA 2M34A 2ESHA 3GF2A 2VBZA 1Y56A 3BJOA 3OL3A 3S1MJ 1O57A 3UKGA 2ZO4A 3S3NA 1LDDA 2L4AA 1MNEA 3TO6A 1NHAA 2ZMEB 4ZYDA 4LB6B 3GXOA 2X1CA 3KP6A 2R7RA 1MBJA 5FB2A 1U5TB 1JT6A 1OFCX 2LSOA 2LY2A 2W85A 2DT6A 2HKXA 1P6RA 2ISYA 3MKZA 3HC7A 4FX4A 2ACJA 3IKTA 2HEOA 2K9NA 2WAQN 3ZQGA 2AHQA 3LL7A 2V6EA 4AYBA 1VQMI 1KU3A 3LSMA 3TQNA 3DXJF 3QOEA 1OCRH 4N0BA 4E70A 3WHBA 3IV5A 1ZYRF 2CWEA 4F3QA 2FE3A 2OCEA 4KDPA 1FBQA 4OINF 3VSKA 3WU2C 4GFBA 5HS7A 3E5XA 4HBLA 1IUYA 3BT9A 1F9NA 4BQQA 1DU0A 2XSDC 4F92B 1SAUA 2WA0A 2DJIA 4YELA 3JRHA 2EB7A 3BTLA 2VE9A 3ZQHA 1REPC 1EV7A 2R7WA 3WU0A 4KIGA 2JMWA 4NC6A 3R4KA 3L2VA 2H09A 1WH7A 3PNTA 3RKWA 1UHWA 3GZNB 1FJLA 4M3EA 1TW2A 3OIOA 2A6HF 1HW2A 3AL0B 3FXOA 2K3FA 3SYTA 4XOPA 3FK7A 2MYSA 5F1RA 1U8BA 2W00A 3OIQA 3FKJA 1OKRA 4KT6A 4MTDA 3UNGC 3KP3A 1T33A 1W5SA 3BQZA 3LSGA 5H6RA 5FLXK 1R1TA 5C44J 1KQ8A 1BI2A 1U9NA 4I2OA 1SFXA 1E0EA 4FCYA 2C6YA 2KP6A 4W1UA 2RNGA 2ZJPF 3E3VA 2PI0A 1DPUA 1O4XA 1MMNA 3ECOA 4BBRJ 2EFOA 4IKFA 1YS6A 2LK2A 3GFIA 4IZZA 3HZJA 2WC2A 2DODA 3KEOA 2EPFA 2DMTA 2HVQA 2Z5UA 1WPKA 2XAJA 2HTSA 1IZ1A 3W6VA 2WB1A 2O3FA 1ZARA 3MQ0A 4RBOA 3CMYA 4L18B 1I3AA 2KPMA 1ZQ3P 4C3JJ 2BY3A 3HRUA 2K3PA 2JUCA 3M1CA 2XIGA 5BOXA 2HGCA 1VQNI 1L0OC 2VL8A 3OS2A 4L5JA 1JE8A 2ZMEC 4M9ZA 4UV8A 1U5TC 3AKZA 1FC3A 1RC9A 3K4NA 3CCJI 2AO9A 4Y52J 1R9TJ 1DGWY 2YS9A 3KYLA 5F08A 2FQ3A 5K5RA 2ETHA 3FKIJ 3C2HA 2E2JJ 4H4KC 2WAEA 2VKEA 2CUZA 1IGNA 2STWA 2XPUA 2OA4A 2ZKZA 4M6XA 1ETYA 2OPTA 3F9KA 1IRGA 2JPCA 4MIMA 2WV1A 3FF5A 4ZDPA 1LJ9A 2L9VA 3TW6A 1ZN2A 4LK1F 4BS9A 1S7AA 2DDBA 3CLOA 4D5FA 1VQ6I 2HR3A 2YX4A 2Z99A 3JAMZ 1STZA 2R5ZB 2ZB9A 5ILUA 2QSHX 1HDPA 2V1NA 3F8NA 1GDTA 2XRNA 4N4NB 1FIAA 1XC5A 3EUHC 1VI0A 5LHGA 5D5XB 1ZRFA 3MKLA 3HHGA 1XGNA 3TP0A 4L0ZB 3KLNA 4YIIA 4RAFA 3MKWB 4G6TB 5KAIC 3I4NJ 4RB1A 1WJEA 3BROA 3QPSA 2M0CA 2P5LC 3KETA 2KRHA 4E4HA 4XKCA 1HSTA 1SD7A 3IRRA 2HZDA 3BQYA 1K6OA 3AL0C 3LSTA 3O2PE 2BBYA 4R79A 4Q5SF 1IW7F 1K7AA 1DP7P 1WZ2A 4GGGA 3D1NI 2P5KA 3DBRB 4KIBA 2YU9J 2QQ8A 4YFXF 4UUVA 2FJ1A 2VT3A 3H5RA 3DBHB 4AC0A 1YJNI 4DYQA 3OIPA 3I59A 3P9IA 4MHGA 4I7HA 4F93B 2GA2A 1TW3A 3AG3H 3L00A 4ENKA 2OTLI 4HF1A 4M74A 2DDAA 3K4JA 2FBKA 2DMPA 1N77A 3ROUA 3RCOA 2MSYA 4PJNA 3K4CA 5CVUA 4Y13A 5ED4A 3S15J 3ZQCA 1XGOA 4QPQA 3O3KA 1Z7LA 3IAM2 3MFKA 4TV7A 1QPMA 3ABLH 1WGXA 3ZQQA 2GQQA 1XB4A 2VC1A 2ICWG 3KFWX 2DA2A 1UHMA 3K69A 1FSEA 5GAGJ 3K7AJ 2RVCA 3KEQA 4Z6YA 3OSFA 1X2NA 4LD5A 4ZTFA 4KITB 3F6VA 1FZPB 4YEJA 5ICFA 4FTHA 2CUJA 4CSWA 2XV4S 4BXUA 3K2AA 1R71A 1YQAA 3JTHA 3GTJJ 1AKHB 3CDHA 3DU6A 2HXIA 2DA5A 2Q0OA 5GAHJ 1SC7A 5HLHA 3OYMA 4D7NA 1UG2A 3Q9SA 4FQGA 3DKYA 2DPUA 2MFZA 1WQ2A 2P6SA 1LKXA 4A3IJ 2HOTA 4ESBA 5D6EA 5CLSA 4KIFA 4MGRA 1SFEA 4BBSJ 5L3CA 5FO5A 3SFIA 3M3YJ 2HQ5A 2WV0A 1NTCA 1R23A 5J4YA 4UUSB 2DCEA 1TT0A 3E97A 2WADA 3IKVA 4ZDOA 1KYZA 3MAJA 4IOAF 4M72A 4BDZA 5DCMA 2RAEA 2D1HA 2EZIA 2XGXA 4M73A 2QKLB 2XAFA 1MMGA 1J75A 4WX9A 3HGYA 1YW9A 4A6EA 1HLVA 4DOZA 3EPZA 4IOCF 3DTEA 2DI3A 4IF4A 1FBUA 2JQ7A 3JRBA 2GZWA 5TGTA 5D4RA 4ZJZA 3R0JA 2DFFA 1R36A 2LP0A 3SDGA 2O6GE 3OYGA 1BN5A 3WU1B 4QPOA 2GOXB 2YSRA 4EM0B 4NDLA 2LOOA 4BHCA 3I58A 5EDNA 1HDDC 1R5HA 4XKVA 1IRFA 5KHDA 3FXRA 3BG3A 1ZGWA 2V1UA 2IBDA 2BY2A 2DBBA 2NVUB 1XSXA 2KIQA 3TGNA 3ZOBA 3CCVI 5KAFC 1Z67A 1NH3A 5A2QZ 3T5XA 1BIAA 4B43A 2CQQA 1VQ5I 5EYRA 4HEA2 2X6XA 2LD5A 2JSCA 2IS1A 4UUTA 1MJ9A 3VOEA 5K1YA 1WJCA 3DEUA 2P7VB 3V8KA 1X19A 2Z1DA 1QHHD 5B66C 1JUMA 4RDUA 1G3TA 2VQLA 3DPTA 4MTEA 2IS2A 4LLLA 2XAQA 3L2CA 4UNOA 3EQLF 1Q1HA 5A2QK 2V7FA 2FUG2 1LB2A 5LBQA 2WWYA 2QUFA 2CQXA 1YITI 2PBIA 3DKWA 1Z91A 4OMZA 4BYYA 3I4MJ 1J59A 3S2HJ 1Z7UA 3LFUA 1U9OA 2PMUA 1WFXA 1IJWC 5K5QA 1XCBA 2LRDA 2WY7Q 1XPXA 5TJJA 2IVMA 2LKSA 3KP4A 1X3ZB 1HXDA 5HODA 2ZFWA 2YU3A 5J47A 3SQNA 2XF5A 3N4MA 1B1BA 3B73A 4V2GA 1JXSA 1JUSA 4L9JA 4XLFA 5E17F 1W7PA 2HU9A 1ZR2A 1JTYA 3E1SA 1LVAA 1X58A 1TLHB 5LLQA 1JHHA 1KQ9A 1XTAA 2BY0A 1ZK8A 3LA7A 5AIPA 2VBXA 1R58A 2IA1A 2J5PA 4EGZA 2LYCA 2ZXJA 4IRGA 4XLPF 3GTMJ 2IJLA 2V26A 2HOAA 2KJCA 4AU7A 3DQVC 1X2MA 4M3FA 5IOYA 3BR3A 1WI9A 4B4CA 2RQPA 3T1BA 5GPCA 3BJAA 4AWXB 5GTIC 3P9CA 2A61A 3TBIA 2XAGA 3FDYA 5LFAA 5D6FA 1WI3A 3HSEA 4B44A 1Z1DA 3QPTA 1R22A 1I5ZA 4II2A 1X3WB 3HB9A 3ZPLA 1S7EA 3DF8A 3PNYA 5E79C 1JJ6C 2PLYA 4G9YA 4MQVA 2W82A 3CLQA 3GFLA 2QEXI 2STTA 3HOYJ 2FU4A 2RKHA 1TWHJ 2A68F 2R3SA 5IP9J 4ZYHA 2HKOA 3NAUA 5DDGA 2V9KA 4IHSA 4DYCA 3LSPA 2DYRH 2HDCA 2KRFA 2DOAA 1PJRA 2IS6A 3QPLA 4IRHA 1K61A 4R8HA 1MD0A 2HOSA 2QZ8A 1D5VA 4L9VA 1P4XA 2CMPA 1R00A 1E3HA 3WG7H 2A07F 2E34A 3SXYA 2EILH 2P5VA 4ESFA 4P55A 3TDUC 5EJCA 3OS1A 3FBNB 2QVOA 1T8IA 1ETOA 1KYWA 2DW4A 3BZKA 4B09A 4CCMA 1TWFJ 4WXHA 1YX3A 3PUBA 1AOYA 2QQBA 1OQYA 2XGEA 1JT0A 1MW7A 1FPQA 2Z16A 3PFYA 4EMSA 1W4MA 3H92A 4F7ZA 2CW7A 5FKNA 5FFZA 2CH0A 2ZFUA 2LMDA 2QBYA 2RDPA 3BZ6A 1W7PD 4IL6C 3AG1H 4C30A 1KGSA 4F55A 3I59B 3LSHA 3ZP5A 2X6YA 2L9NA 1F36A 3T8TA 2LH9A 3NWTA 3S14J 2EFNA 1IDYA 3I4PA 5FRNA 2F4IA 4AUXA 3BPVA 3SZGA 1VZ0A 2HTJA 3QYEA 3PQJA 3ASOH 2Z3YA 2BY1A 1FLIA 1E17A 2CV2A 3HGGA 1WWXA 4RB0A 1HOMA 1UCRA 1B9NA 1FP2A 4XQFA 3D5LA 4NQWA 3CO6C 3HBLA 3V42A 5FLVA 4YRVA 3MD2A 1FMVA 4BE1A 4DJAA 3EETA 4ASNA 2V9VA 1YYVA 1U2WA 1OPCA 3OYFA 3K4LA 1MMAA 2HVRA 2OV7A 1A36A 2PFBA 2FBHA 1MBEA 4E7KA 1ACIA 2WAFA 3C1DA 3F0CA 3FX3A 4NBQA 2PJPA 5D8KB 2P8TA 3P9KA 1R5ID 4B47A 1Z9CA 4RGUA 4U0VA 4S0HB 3ZXSA 3ESWB 4CO8A 3O6BB 2K9SA 2KIFA 2M87A 2NOJB 4AIHA 3OYJA 3G1MA 2RNJA 3G1LA 3IUOA 3LA2A 2NOGA 2GXAA 3EYIA 4A6DA 3LFKA 2VJIA 3HUGA 5JFRA 3GTLJ 2GAUA 1PYVA 3BG5A 2ELHA 2G9WA 3CJRB 1UAAA 1B6AA 4C3HJ 2UWMA 3LA3A 2KIUA 1J5YA 2G0EA 5E3NA 2CV0A 3BLYA 3OR2C 2VASA 1X4OA 3SFZA 3CF5F 4CCNA 3JRGA 1IC8A 3BR0A 4OWRB 2FOWA 3VFZA 5IT9Z 2IXSA 1ONVA 2ZXIA 3KP5A 5LHHA 3OY9A 3CJQB 2X51A 4EJTA 1U0JA 5BPIA 3I71A 2PG4A 2CGPA 4PJMA 1QGPA 3CCMI 4F91B 4L0YB 3GUDA 2M2EA 3IWZA 3CJTB 2R7UA 2AQFA 1YS7A 4BEHA 3KP7A 3MZ8A 4PK4A 1F1ZA 5GP9A 4A93J 4YFNF 1B8IA 2ADUA 1OR7A 2JPBA 3Q0VA 1XMAA 4R1HA 4XBFA 2GM4A 3AG2H 4ENMA 2DLLA 3CUOA 3S1NJ 4AYBN 3BG9A 4I98B 3BTCA 4Y3OA 1B4AA 1YO5C 4HSTA 1MH4A 4XR6A 5LGTA 4KYWA 4WWCA 1KU9A 5DM6F 3K4BA 2LR8A 1EF4A 3Q5FA 3BTIA 3A1YA 5J6XA 4BH9A 1O3TA 1MGTA 1R7JA 1V5FA 2BZTA 3WE2A 2VODA 3KP2A 3E0JB 1JKRC 2FNAA 3GEZA 3K1MA 3PSIA 1X1BA 2VLAA 1J7KA 2XB0X 1BC8C 4RA2A 4L9TA 1ZRCA 2K7LA 2M9HA 4IJAA 4CDGA 2Y75A 5F6FA 3KIOA 1GT0C 1HKTA 4QIWN 2CO5A 1JKQC 4M6VA 2ISZA 2UXNA 3FXUA 3WGIA 2EZLA 3VODA 4YIFA 2EIJH 3KPHA 2FMLA 1ZG3A 2QSFX 2EFQA 1RESA 5E3OA 3GW2A 4P1WA 2L02A 3PQKA 3QAHA 4AVPA 3GFJA 1U6GA 2BV6A 3ZN1A 1FNNA 3HTSB 3JTGA 4AD9A 1W7PB 2COMA 3H0GJ 2FRHA 1SANA 1FBSA 1MNMC 4YFKF 3WTWC 2F48A 3JRAA 2HI3A 2R7DA 2JJ7A 3RIRA 3KE2A 2VKDA 1QVUA 2EJRA 3R0AA 1PUFA 1XGMA 1A5JA 3LQRA 4KISA 1ZELA 3HRMA 2VI6A 4BGDA 3DPUA 3HL2A 1ZGJA 2OQGA 3ABKH 2NVYJ 3JSPA 1SFUA 2L0KA 5DYMA 3VSLA 3L2WA 2XGDA 4ZYAA 5K7HA 2QGUA 3W6KB 1OISA 3QODA 4BHBA 1D0XA 3A0HC 3ZMUA 4IX7A 1O7LA 4PJLA 4I6ZA 3BWGA 2UUZA 2ZCWA 4FHTA 5CVVA 4BDYA 1YIOA 2R4GA 4HV6A 4Q48A 5L3EA 4DIQA 4E7ZA 5E8IA 5C4JJ 1EA3A 2RGVA 1JKOC 2VBYA 2JN6A 3K10A 3B6AA 1Z6RA 4NC7A 1T56A 2O9LA 4HX7A 2EH3A 3M7GA 3S32A 2GWRA 2JRMA 3QPHA 2M1BA 1Y0NA 5J1RA 3M4OJ 1E2XA 3VYRB 1YHQI 3ECHA 1D8KA 3H1CA 3E5QA 2IGKA 3CJNA 4OIRF 1GLNA 3H35A 4LOCA 2DK5A 4X6AJ 1USSA 3WODF 2DTZA 3CUQA 2LY9A 4E7JA 1RNLA 2X1EA 1T95A 1EKEA 1QVTA 2P81A 2F5CA 4GDFA 5HLIA 1Y8RB 5K7ZA 4I0BA 2IGMA 1IN5A 1S7OA 3RQ4A 4OU0A 1J9IA 2L9SA 3D5RC 4EVIA 3ML6A 4CUGA 1VQOI 2QBYB 2RN7A 5HDNA 2GXGA 5IP6A 1OLTA 4EJVA 1UB9A 3IHUA 4CICA 2X6WA 2DAOA 1R1VA 3W2WA 3R6SA 4A12A 1OCTC 2O03A 1HW5A 2EINH 2GLOA 2IRFG 4KNYA 4JYKA 3BG6A 2CJJA 1LFUP 2Y31A 4IHYA 1W5CC 3KLOA 2DT7B 1MNDA 4B3AA 1P4WA 4NQWB 2WBMA 5LHIA 1EJ9A 3FXQA 2HVSA 4M6YA 2HQNA 3AFHA 3GLXA 3UR3C 1SVLA 2YPRA 3L2RA 4LIVA 1QO0D 3CP8A 4PFPA 2HQAA 4HQEA 5CYVA 5EGOA 2IW5A 3N97A 3CCUI 4V2FA 3BC8A 2Y9ZA 4UB8C 1HA8A 4B1RA 2GOMA 4E7IA 1DGRM 1R4MB 1FOWA 3A01A 3ZCOA 3F8MA 4RAGA 2DYSH 4HF0A 4XLCA 1LUJB 1MIJA 4PJ0C 3OYLA 1Z05A 3HTUA 4L5IA 3OYIA 3HYIA 2P4WA 3DLLF 1USTA 1X1AA 5H6QA 3OV8A 2DA1A 2FBIA 2VOOA 3BOQA 3KYCB 5F1JA 3IP4B 4ZYEA 4BL0B 4CCOA 2V1XA 3ZMVA 1K4SA 1ZREA 3QP5A 4FASD 1J09A 3JAMK 3OYKA 2XVCA 2ZBKA 5GTHC 1MDMA 1DU6A 5E3MA 4NUBA 2Y69H 4BHPA 2JZYA 3BCAA 3WTXC 2F4OB 2JVGA 3ZQFA 3LAJA 5FROA 1SAXA 2MA3A 1P4AA 1OCCH 2JT1A 4CCLA 1XSVA 4O3MA 2BW3A 4A2UA 1ERDA 4Y17A 2BXYA 1HC8A 4CZZA 2CU7A 3FBIB 4ENJA 3FXMA 5J3LA 2COBA 2K85A 1ON2A 2OBPA 1D1BA 2R7FA 3V7SA 1Z6TA 3J80Z 3CO7C 3DV8A 3KZIC 4IHVA 2NVQJ 2LKXA 4BEHB 3IH3A 3G6EI 2LDUA 1B8IB 1W0UA 2ME6A 2M4KA 1ZH5A 3VEPA 1FSHA 3PNVA 2GA1A 1IN6A 1WRJA 2ECBA 2OCCH 1RETA 1X4PA 2HDDA 1LFBA 3E6MA 3DU5A 1NK3P 2EBIA 2L2OA 1AA7A 4KJZA 4B8XA 1TWAJ 1BR1A 3L09A 3HOVJ 2D2WA 1RRJA 2NS0A 4UB6C 2CFOA 1A31A 2DA6A 3JR9A 3FHZA 4RM2A 5CVJA 2CV1A 4B48A 1QNTA 1MH3A 2LY1A 1TBXA 4DBRA 2D45A 2ME0A 2ZJQF 4BXXJ 1S5LC 2M5WA 5ERIA 1I6XA 1TNTA 1F5TA 5CQGA 2KQRA 4KMUX 4XRMA 1XD7A 3HRTA 4L5EA 4ZDLA 2L5QA 2FMYA 1LVKA 3OYCA 2E36A 2EZHA 5E1ZB 3CQZJ 1WCMJ 3A02A 3TW7A 1K83J 4Y33A 3FXKA 5D4SA 2VJJA 1LEBA 2VE8A 3HOZJ 4D1QA 2FF4A 2EFPA 2KJBA 1D8JA 3WTUC 3MZYA 5KVRA 3HSRA 3GWZA 3CZ6A 4XKBA 1D0ZA 1EH6A 3I5UA 2OF7A 2YUSA 4JP0A 2EIMH 1Y8QB 2QLZA 1X1DA 4OIOF 1I3QJ 1IV6A 1T98A 3D5SC 1IUFA 4FETA 5E1WA 2VKHA 2FNPA 2BHZA 1XCVA 3BY6A 5KCMA 1IAWA 1Z3YA 4IEJA 4E6KG 3HKZA 3GX4X 2FX0A 2CSOA 4JK1X 3ABUA 3F21A 2V4JC 2IGOA 2L4MA 1LDKB 3DP7A 2PJRA 4EGYA 4QLCU 5E8GA 1P2FA 5J8FA 5CVIA 4IQJA 3B02A 1I50J 4G7ZF 3Q3SA 1SFOJ 2LNBA 5IOZA 1D3YA 3GTPJ 4LFUA 4XOTA 2HWVA 4XM3A 4F52A 3MCZA 1I1GA 1ZLJA 1X1CA 5FD6A 1APLC 4XICA 2CW8A 4EEFG 3CCSI 4C9YA 3DWLE 2M7BA 1R6RA 3P7NA 4N4OB 4A5MA 2E71A 2MC4A 1OR7C 2XASA 5DD8A 2O8KA 2EA4A 1Z21A 3OOUA 3GZ6A 3U21A 1VF9A 3HPHA 4EM2A 2RREA 1IRZA 4AIKA 2R7XA 2MG4A 3ELKA 5M3FJ 2PQ8A 3IC7A 3J7YJ 2O5RA 3TOAA 4JQFA 5BNGA 5IT3A 5DEQA 1TT5B 2WTEA 2L9RA 3IRQA 2A6EF 2HPIA 5LGNA 2IS4A 2LC2A 3PSFA 3VYSB 1ITYA 4RLFA 4M3BA 4DGWB 2QWWA 4RB2C 3FM5A 2MD5A 1SFKA 1H88C 1G3YA 2E60A 3VYUB 4LK0F 4IHTA 3CUQB 1SVOA 1QBJA 2EV0A 2JA2A 1UHSA 2KISA 3V8JA 2F4MB 4AIDA 5JLWA 4WK8F 4MLOA 2JSPA 1QHGA 2DA7A 3I3LA 3OYBA 2VT2A 4A0YA 2ZJ2A 4DW6A 3ISPA 1CGPA 1PP7U 3GTGJ 1V54H 2F6CA 3OYDA 2M7AA 5M3MJ 4BE0A 1R5GA 2JRTA 4IXAA 1MJAA 3RKXA 4E7SA 1A04A 4KT5C 3ZGKA 2KT0A 1TQPA 4A3GJ 1Y1VJ 1A35A 1IDZA 3ZMZA 5ILVA 3KCCA 2QM3A 1Q1VA 2Q8KA 1IXSB 4C2MJ 1XX5A 4U88A 3ASNH 2M30A 1QZYA 1DQUA 3F3XA 3EUAA 2E1NA 4N9IA 1YJWI 1BC7C 1YLFA 3OYEA 2HNHA 1HKQA 4UHTA 5DS9A 5E1XA 2Y48A 4UVBA 4D5CA 2DT5A 3IAS2 2XF6A 3PO2J 3BG7A 3R61A 1PDNC 3HG9A 1ODDA 2DOFA 5D5WB 1R49A 2XB5A 1Y6IA 4ZZDA 1LFPA 2XRLA 3BR1A 3BP8A 3K6GA 5EGOB 3I56I 5M5WJ 3QRFF 4YG2F 2R5YA 3Q0UA 1T0FA 4M71A 2DMNA 4HYEA 1F43A 5D8LB 2KZGA 3QYFA 1FWZA 5ILSA 1V5GA 2A05A 2XC7A 5LD2C 3BR5A 3CCEI 4XRFA 3CC2I 3RPQA 5TISC 2F5DA 2A6TA 3DEWA 1U3EM 2JVHA 5BPDA 2HS5A 3RYRA 3FXJA 2PMHA 4CCKA 4B3XA 1MDMB 1IO2A 1RZ4A 2GIZA 1BR4A 1S6LA 3K4MA 2FXAA 3MVPA 1FTTA 4WCGA 1YFHA 2BW3B 1GV2A 2M8EA 2TCTA 3OSGA 1BM9A 2VPRA 4XLEA 2CFXA 3GFMA 5EEGA 2W7NA 2P6TA 4RGRA 2XKOA 3F23A 3TEDA 4AVZA 4CYCA 2IP2A 2R7QA 3CUQC 1D0YA 1IV8A 3WG9A 3H9QA 4DZJA 2XAHA 1TQIA 3F8FA 1KZHA 1ETKA 1XDUA 5HOOA 3DBLB 2EFWA 1FYKA 2NRAC 1XGSA 2QF7A 1BA5A 1SD4A 4MFDA 4LJZF 1O3SA 3E6DA 2XSJC 3LSJA 3F6OA 2K02A 3PJRA 3K70D 1ULYA 2ECCA 2VJ4A 3TP3A 3CD6I 4K2EA 3HIFA 2CW0F 3KYDB 3G73A 1MBFA 1E3PA 1XDSA 4A0ZA 3PIOF 4OAZA 1DPRA 5DUIA 1AWCA 4ITVA 4LMYA 3GBGA 1BBYA 4A3LJ 4D0PA 3WGGA 3H0DA 1JJ8C 4HV5A 1LE8A 1G4DA 3B6CA 1OCZH 4EATA 1ZG1A 1ZG5A 2VPLA 3GTOJ 1SMYF 4LG3A 2R7TA 3H36A 3OS0A 5E18F 3RZDJ 1BJAA 4BJ5C 4CCJA 1VQ7I 1ETWA 2DFEA 2J5OA 1BJZA 2QKMB 3I64A 4KN7X 2HXOA 5GPAA 5C3EJ 3WTSC 3G2BA 4MFEA 3H5NA 4HDVA 1Z77A 1K79A 1RUOA 2W48A 4IQ4A 2I5UA 1ZR4A 1W36D 3I55I 4PSXA 5IYCJ 2Q2EA 4MQ9F 2ZC2A 5JHUA 3J7ZI 3SZPA 2YX7A 3CF2A 2M8GX 4G7HF 1JUPA 1LNWA 1P92A 3O8GA 5DCMB 1IN4A 4N9HA 2R5ZA 2FOKA 2FEZA 4HAMA 3WGHA 2AXTC 4XIDA 3I0TA 2NNYA 2W84A 3S17J 4Y4RA 2LFBA 2CUEA 1IF1A 4BNCA 3GVAA 4I09A 3LQQA 4UVAA 4XLAA 3RTRA 1T38A 1NG6A 2ID6A 1T2KA 2V79A 1S9HA 4HDUA 3U2RA 2DPDA 3C2GA 3TO9A 2K9MA 3CCYA 3DCFA 2ESNA 4PZJA 4ZZLA 4PGHA 3K9TA 2XDVA 1SMTA 2Z33A 4HX8A 3TL4X 4JX6A 3SJMA 3LSRA 3HSFA 2XPVA 5FKOA 3QP6A 2PJRB 1CQTA 5IT9K 2QCOA 2QA4I 4XN3A 3GYHX 3LMMA 3LWFA 2KDZA 1VQPI 2K4JA 2IAIA 3PIPF 2BEOA 2VBWA 3GZ5A 3MKYB 4NHJA 1TP4A 4E7LA 4FT8A 1GXPA 3K0LA 4ANJA 1AHDP 1J2XA 2BE5F 2VXDA 3K1PA 4BY7J 5KK1A 1HF0A 1WJDA 2VONA 1ZAOA 2F5VA 3ERED 2LF7A 2P7CB 3ZRGA 2OJED 3QQAA 5FRMA 2NVTJ 4CGZA 2D5VA 2IT0A 3EDPA 2X85A 1GV5A 2GBYA 3BR2A 3SEQA 5FJ8J 2IA0A 1BI0A 4I76A 4ZYGA 4X1EA 2Z9OA 3S16J 5KNLA 4HA8A 1UJ8A 4RAZA 3RYPA 2OUMA 4IRIA 4GRIA 2JA5J 5ICCA 2H6BA 5F0FA 1U8RA 3M8EA 3GLLA 2PMZA 3PL8A 1CF7A 1QZEA 4M9SA 4BE2A 3J81Z 5HDGA 5EEHA 1SD5A 3ABTA 2HZTA 3EYYA 4EJUA 1LDJA 5GAEJ 2DMQA 3HM5A 3M9AA 4P9FA 1O3QA 5B3SH 2G7UA 4OMYA 1WSUA 5IY5H 3A2KA 3LSIA 3H9JA 3E6CC 2R0QC 5JI6A 3A4CA 5F0CA 2V1DA 2JA7J 5IYBJ 1WJBA 2D1VA 1FIPA 1YX5A 2H94A 3S2WA 4BACA 3E5UA 1K78A 5FLMJ 4HF2A 1TL8A 3I54A 1FOKA 4KUMA 5HLTA 4MEYF 3IL2A 1DDNA 4U7BA 5LRSA 4HSRA 2Y9YA 3ZR8X 2AS5F 1P7IA 1WH5A 1VQLI 3S93A 2IGNA 2WB1N 1G59A 3W2VA 2K27A 3H3ZA 4BAYA 5H20A 2F5EA 3NQOA 3BDDA 4RLQA 4KFCA 1JTXA 2DA3A 4WXDA 5B1AH 1GXQA 4ZTJA 3F8CA 1IXRC 3NRVA 2P0WA 3MZHA 4PJJA 1MSEC 4U0WA 2HOEA 2G7HA 1I39A 1MMDA 1XMKA 4KICA 3OYNA 2UV1A 5BMZA 3VDXA 4OIQF 1FT9A 5ICEA 4HLXA 1OYWA 4DNCA 2B9SA 2K9LA 1D1AA 3MN2A 3L1PA 4HNVA 2CS3A 3DEEA 1VQ9I 2MLKA 2DK8A 1J0RA 2R5YB 1YRNA 1NK2P 1ZHFA 4G94A 3I53A 4I0AA 1BOBA 3FZVA 4NB5A 1FX7A 5EEAA 2F5FA 5HS8A 2I8DA 3SEZA 3K4KA 4ENNA 2NNNA 5EZGA 2Y0SA 1TWGJ 5FLXZ 1OYIA 2H8RA 4A3DJ 2E2HJ 2RQQA 1ZTRA 4DYRA 3V7RA 1GVJA 2X6OA 5FD5A 1ORKA 1B72A 2CUFA 2X4HA 1T08B 2MD0A 5GADJ 1ETVA 1W5TA 2Q1ZB 1IXCA 3ZQLA 3QU6A 4Q4ZF 2E1MB 5FGMA 4D7MA 4S04A 5LEKA 1FEXA 4H0EA 1Z0XA 4X0GA 4ESJA 3WTZA 2DA4A 5L3FA 3S1QJ 1FY7A 1MKMA 1ON1A 2K86A 3G71I 4CH7A 5EG0A 2ID3A 1MMSA 1RKWA 3NEUA 1K4TA 1YG2A 5JR3A 5CKTA 3HXLA 1FOXA 1IN8A 5AIQA 2H27A 1JGGA 4CYCB 5D5VB 2XUBA 4II3A 1HCRA 1NG7A 4LIUA 5CVRA 2WAQA 1KONA 1ZRDA 3BR6A 1MBGA 5FFXA 3HOXJ 3VB2A 3PFIA 1S72I 1H9TA 5F64A 3LNQA 2R7VA 1K6YA 1TQMA 3QOPA 3HDDA 1I27A 2A5WA 4QSHA 2L54A 1TWCJ 3OR1C 4E7HA 5M5YJ 5ICGA 2CRGA 4XORA 2RV8A 3GTQJ 5L3BA 1P7JA 5JLXA 5DM7F 3JRDA 3MEXA 2DFIA 5J1YA 1AU7A 3K70C 1H0MA 1LE8B 2O7OA 4FE7A 2UXXA 2DXIA 4HZFA 3HJEA 2K5CA 3VYTB 4HW0A 2A69F 4XMYA 1YE9A 3GO5A 4GYIA 2K40A 2PN6A 3REOA 3FM3A 1LQ1A 3WTTC 2KRCA 2JK3A 3GCMA 5JVGF 4IVNA 2DQLA 4BU2A 3F8BA 4G6QA 4M3DA 4BKXA 3ERMA 3X2QH 2MABA 4PSWA 4O5VA 4PUSA 3HUGB 4CHUA 3L7WA 2Q2EB 1V55H 1VFCA 3BZCA 4JOMA 1T0FC 4Q47A 4O6JA 3O8HA 4RB3C 2CG4A 2R93J 4IHXA 1RPWA 1W36C 1XG1A 3BJ6A 3C3WA 3E6BA 5HVQC 2EQRA 1BW6A 4UY8I 1SD6A 3V8LA 5D5UB 4G7OF 4XKWA 3HOTA 3FISA 3FMRA 2XGCA 3A03A 4KN4X 3HPGA 4M3GA 4RS8A 2HYGD 4AM3A 1TZLA 3CC4I 4BJTA 4C2UA 2EA2A 1MZBA 1Z3XA 4A0XA 1FYLA 4XSXF 2OTJI 5JHFA 2AQEA 5CQEA 3TKYA 2E1MC 3DFGA 5F27A 5DTDA 4XRSA 3LAPA 4UVCA 3F22A 1H8AC 3HKZN 4Z2YA 1VTNC 5HDKA 2PX9A 2W25A 1UG0A 2BHYA 1WVRA 2E2IJ 2LBFA 4Y15A 3QWLA 5H2FC 3MMYB 3PM1A 3J7AO 2QQAA 3V4GA 1RI7A 3A0BC 1PUEE 2MW8A 4A69C 3RKYA 1QU3A 1X1PA 3J80K 4JX5A 1PP8F 3LOCA 4JX4A 5DCFA 3ZQ7A 1Y39A 1QA6A 5TRDA 3ZQIA 1M1EB 2XKPA 4PDKA 3H3VK 3KEYA 4GO1A 1WJFA 4C2TA 3CMAI 1BR2A 3RJPA 4OAYA 4DZPA 1SVMA 2ELKA 4NNJA 3H5AA 2ELJA 4XLHA 1YI2I 4HRIA 1FP1D 2DO7A 2EV6A 3BPXA 2NYXA 1FTZA 4LGWA 2L7FP 2EIKH 3WHCA 3BCBA 3JW4A 3SZTA 2OD5A 4ON0A 4CA0A 3W3CA 2FQ4A 1CF7B 2K4BA 4P96A 4GYGA 2RC4A 2X0LA 4LITA 3T0YA 3JSOA 2M4GA 2KKOA 2MH9A 1MSFC 2IA2A 4XNFA 5J4VA 3ULQB 2M3AA 2HDWA 2FSWA 1UMQA 4XK4A 1A6IA 2EZKA 3RDIA 4ZH4F 4ETSA 3FIWA 3MWMA 1WJ5A 4P9UA 2HPMA 4A5NA 4A3BJ 4A3FJ 2R92J 1G3WA 1QQIA 1XSDA 2XROA 2A5YB 5F04A 1BOAA 5K7FA 2ZNZA 1K78B 1PUFB 1MBHA 3S8PA 3JRFA 3S1RJ 4XL9A 4I02A 5L3GA 4PFOA 2DU9A 1UFMA 1W1WE 1FMWA 3ZMSA 2HYFA 4ABZA 2X1DA 1YW7A 3TO7A 4HNTA 5IPAA 4I01A 1G3SA 3FMQA 3DKXA 2LTPA 4FX0A 4MEXF 2KZVA 3ZMTA 3BTJA 2E1CA 3ONQA 2F2EA 3HOUJ 3N05A 3L2UA 2VB6A 2Y30A 1R1UA 3V7CA 1VQ8I 3C7JA 2N8GA 2Y0MA 4UXNA 1BIBA 1GUUA 2NAZA 2W1OA 1XN7A 1H9GA 1PVEA 2LG4A 4P5OA 5CPRB 5J40A 2BYVE 2K9QA 3OYHA 3JRCA 4XRSG 4KMFA 1IN7A 1UELB 3SDBA 1HBXG 2DOEA 4M9XA 2BOLA 1YIJI 1GHCA 1LEAA 3S2DJ 1MJBA 3FHNA 4CZCA 2KLOA 2VUMJ 4EJOA 1VNDA 1YRNB 3DPLC 2KDOA 5FKLA 1G8XA 2IPQX 4G8XA 2OU2A 3C18A 3RZOJ 4UV9A 5LGUA 1ETQA 2A3SA 3CCLI 3VWBA 1MBKA 2VQCA 5M5XJ 3FK6A 2FA5A 4JBAA 3RPUA 2BVMA 3JREA 3AAFA 4A3CJ 3IH4A 5HLGA 3FXLA 2B7EA 1XMXA 5C4XJ 4J00A 1B72B 3F72A 4S05A 2V6CA 2O8XA 4GCVA 3L2QA 2GXBA 4LG0A 3COAC 2E35A 2NXNB 4I99C 5HS9A 1RR8C 2H1LA 3L9FA 5DV5A 1X3UA 2YR2A 3CCQI 4FE4A 3DTIA 4YIRX 2E5NA 1QPIA 5EG0B 3QYBA 2E19A 2LVSA 4D9JA 1YW8A 3G1OA 2IEKA 1YOVB 4RAYA 4WXCA 2L7ZA 2QENA 1XS9A 2PEXA 4LLNA 3M8FA 2DJNA 5LRRA 4LLGF 1W0TA 2CQNA 2ZMEA 4HLYA 2DMUA 3W2AA 1U5TA 2NS7A 2O61A 2H8WA 1P9QC 3G4SI 1V3FA 1ETXA 2MLGA 3T8RA 3VPRA 1KA8A 4HNUA 4KA4A 2JUGA 4EV0A 5DUKA 2W4SA 4PGGA 2BXZA 1S29A 2L01A 4XN0A 2H6CA 2MGQA 2XF7A 2R7ZJ 1TC3C 2LLKA 4BQNA 3TDZC 4BJ6C 3CDLA 2OQRA 1E3OC 2HFHA 3CMEI 1Y1WJ 3RKQA 5FKKA 2ZSIB 3U1DA 1ZKGA 4HPQA 3M8JA 3OMYA 2X9DA 3G3ZA 3JCUC 3S3MA 3A01B 2MC3A 2I10A 3E7LA 1KU2A 3EUHA 4V19K 3WE3A 4U0YA 3C2BA 4A3MJ 2ZNYA 4QTRA 3PO3J 3PUFA 2LKPA 1D1CA 2VQHA 1B9MA 3QU3A 1DUXC 2O0YA 2ZXHA 2WY8Q 4A3EJ 4IPAA 2BVLA 2VKVA 1ENHA 3RPUD 3ZN0A 3AG4H 1G6NA 3M07A 3FWEA 2NS8A 2E1OA 5CJ9A 3KZYA 2JA6J 5HNFA 1N75A 4LB5A 2VOPA 1OYYA 2TDXA 5F0HA 2CYYA 3KZZA 1L3LA 4MNUA 4DQ2A 4J19A 1H89C 3OWTA 4XONA 3CCRI 3NARA 3U1KA 3SHFA 5E3LA 2KFDA 2EWNA 1TTYA 1Y0UA 4FISA 1WKMA 4GXOA 1VQKI 1O3RA 2LREA 1TNSA 2B0LA 1N25A 2E5ZA 1D5YA 3IWFA 2DTRA 2R7OA 2R7SA 2EK5A 1ZGAA 1KU7A 2Y2ZA 2DQRA 2LBFB 1BI3A 2QQ9A 3RSNA 2LF8A 4IHWA 3FMSA 2MBFA 2FD5A 4OOIA 5L3DA 5DD4A 1F4KA 3CDIA 4BQAA
chains in the Genus database with same CATH topology
2Z1DA 5HLTA 4U7BA 3IP4B 2VQLA 4BL0B 1V5EA 2VQGA 3DPTA 4CCOA 3DLAA 4HSRA 3ZR8X 4FASD 2IS2A 1J09A 3OYKA 2V7FA 2FUG2 3CMMA 2IGNA 3S93A 1G59A 3W2VA 4NUBA 3BCAA 5HNHA 2M0MA 2JVGA 5FROA 4RLQA 3LFUA 3OL4A 1WFXA 4CCLA 2BW3A 3KX2A 2LRDA 2WY7Q 1ERDA 4ZTJA 2P0WA 4PJJA 3FBIB 1MMDA 2VXZA 1D1BA 2XF5A 3CESA 3OYNA 2UV1A 3VDXA 4BEHB 4XLFA 2K9LA 2HU9A 1D1AA 2CS3A 2M4KA 3DEEA 3E1SA 3PNVA 3CP2A 1X4PA 2LYCA 1BOBA 3DU5A 2V26A 2ZSHB 3I9V2 2L2OA 4AU7A 1AA7A 2I8DA 4KJZA 3K4KA 3SEZA 3DQVC 1BR1A 2OC6A 2Y0SA 1JI8A 2CFOA 2VIXA 2RQQA 4RM2A 3TBIA 3FDYA 3S3OA 2CV1A 4B48A 1WJAA 5LFAA 2MD0A 2LY1A 4B44A 2KMUA 4DBRA 2Q1ZB 3TMOA 4II2A 1IRXA 5CQGA 2KQRA 2E1MB 4ZDLA 2L5QA 1N78A 3PNYA 1LVKA 2Z2SB 3OYCA 4RM3A 4X0GA 2W82A 4U87A 4RMNA 4Y33A 4CH7A 2VJJA 3EUKL 3HOSA 4D1QA 2V9KA 5CKTA 3HXLA 4BXFA 3LSKA 1DP3A 4II3A 1NG7A 4LIUA 4DBQA 3OYAA 2DOAA 2WAQA 1KONA 1PJRA 2IS6A 2L7KA 3CZ6A 4XKBA 1D0ZA 2R7VA 1K6YA 2CMPA 2A5WA 1X1DA 3OR1C 2XAUA 4J01A 4E7HA 4XORA 3D5SC 4FETA 3OS1A 2VKHA 3FBNB 2KL4A 2VJ5A 5KCMA 1Z3YA 4NC8A 4ZC3A 4E6KG 3HKZA 4CCMA 1YX3A 3PUBA 3K70C 2V4JC 1MW7A 2IGOA 1LDKB 2Z16A 3PFYA 2PJRA 3J7AY 3H9GA 2DXIA 4IQJA 2K5CA 2CW7A 1X19A 3VYTB 4XMYA 1YE9A 3DTKA 2CH0A 2ZFUA 4BQOA 4XOTA 4XM3A 3NWSA 4F52A 2KRCA 4C30A 4HG2A 3LSHA 4F55A 2X6YA 1X1CA 2L9NA 2KHMA 2CW8A 4BU2A 4C9YA 3DWLE 2M7BA 1R6RA 2LH9A 2MABA 3NWTA 4N4OB 4PUSA 3HUGB 4PSWA 4BUPA 5FRNA 2F4IA 2MC4A 1OR7C 1Y56A 2Q2EB 3OL3A 3SZGA 1VZ0A 1Z21A 3OOUA 3QYEA 3U21A 3HPHA 3S3NA 4JOMA 2RREA 1T0FC 1MNEA 2CV2A 2R7XA 4XQFA 1W36C 3D5LA 5HVQC 2X1CA 2R7RA 2O5RA 3MKZA 4XKWA 2LY2A 3HOTA 2DT6A 4JQFA 3V42A 3HC7A 4YRVA 3HPGA 3MD2A 1FMVA 4BE1A 4DJAA 2HPIA 2IS4A 2LC2A 1TZLA 3LL7A 3PSFA 2V6EA 4AYBA 3VYSB 3OYFA 4RLFA 3K4LA 1MMAA 3LSMA 4BJTA 2HVRA 3QOEA 2OV7A 4DGWB 4C2UA 4E7KA 1Z3XA 1SFKA 2WAFA 2E60A 3VYUB 4F3QA 5JHFA 4B47A 2AQEA 5CQEA 2E1MC 3ZXSA 2JA2A 3VSKA 1UG0A 4MLOA 4BQQA 2NOJB 2JSPA 2LBFA 1QHGA 3I3LA 4F92B 1SAUA 2WA0A 3OYJA 2DJIA 4YELA 3OYBA 3MMYB 3IUOA 2R7WA 2VJIA 1PYVA 1QU3A 2F6CA 3L2VA 3OYDA 2M7AA 3CJRB 4BE0A 1UAAA 4E7SA 3PNTA 2UWMA 2CV0A 3BLYA 3OR2C 3ZGKA 2VASA 1X4OA 3AL0B 3KEYA 4CCNA 1WJFA 4C2TA 1BR2A 4OWRB 4OAYA 3SYTA 4XOPA 2IXSA 2ZXIA 3OY9A 4NNJA 3H5AA 2MYSA 3CJQB 2X51A 2ELJA 2W00A 4XLHA 1U0JA 3OIQA 4HRIA 3FKJA 4KT6A 3UNGC 1DQUA 3EUAA 4PJMA 3LSGA 3OYEA 2HNHA 4F91B 3BCBA 3IAS2 1E0EA 2XF6A 4CA0A 2R7UA 3BG7A 3W3CA 3HG9A 2AQFA 2KP6A 2RNGA 4BEHA 4LITA 4PK4A 1Y6IA 1MMNA 2M4GA 1LFPA 3K6GA 4IKFA 4XNFA 4IZZA 2M3AA 2HDWA 3QYFA 1V5GA 1WJ5A 2XC7A 5LD2C 2HPMA 2HVQA 4Y3OA 4HSTA 2WB1A 4XR6A 2A6TA 3K4BA 2JVHA 2KPMA 3A1YA 2K3PA 3S8PA 1V5FA 3M1CA 4XL9A 3E0JB 4PFOA 3PSIA 2VL8A 3OS2A 1X1BA 2VLAA 1FMWA 2X1DA 4CCKA 4B3XA 3AKZA 3K4NA 4HNTA 1DGWY 1BR4A 3KYLA 3DKXA 3K4MA 2KZVA 3C2HA 3ONQA 4H4KC 3N05A 2WAEA 3L2UA 2VB6A 2BW3B 2CUZA 3F9KA 4P1WA 4XLEA 2W7NA 2W1OA 4AVZA 4ZDPA 4BS9A 2R7QA 1D0YA 2LG4A 4P5OA 3H9QA 5CPRB 3OYHA 1UELB 3SDBA 2BOLA 5HOOA 3FHNA 4CZCA 2KLOA 2V1NA 3DPLC 4N4NB 2KDOA 2XSJC 1G8XA 3EUHC 3PJRA 3K70D 2VKDA 2VJ4A 3VWBA 4KISA 1ZELA 3MKWB 2VQCA 4G6TB 1WJEA 4OAZA 4ITVA 2BVMA 3GBGA 4BGDA 3DPUA 3H0DA 2KRHA 4E4HA 4XKCA 3HL2A 4EATA 2HZDA 3AL0C 2VPLA 4R79A 3VSLA 3L2WA 4J00A 4ZYAA 4LG3A 2R7TA 3OS0A 3QODA 1D0XA 4BJ5C 4CCJA 3L2QA 2QKMB 3H5RA 4IX7A 3OIPA 4F93B 3G2BA 4PJLA 3H5NA 2UUZA 3K4JA 4IQ4A 3DTIA 1N77A 4BDYA 2E5NA 2R4GA 3RCOA 1W36D 4PJNA 4PSXA 3K4CA 3QYBA 4QPQA 4DIQA 4D9JA 3CF2A 1Z7LA 3IAM2 4E7ZA 1EA3A 3K10A 3ZQQA 4NC7A 4Y4RA 3W2AA 3S32A 1P9QC 3RTRA 4XLAA 1NG6A 4ZTFA 1S9HA 4HNUA 3VYRB 3C2GA 4KITB 2K9MA 4YEJA 2JUGA 2CUJA 2IGKA 2W4SA 4CSWA 1GLNA 4XN0A 3H35A 2XF7A 2XDVA 3TL4X 4BQNA 3DU6A 4BJ6C 4E7JA 2X1EA 1T95A 3OYMA 2PJRB 3DKYA 2MFZA 1LKXA 2ZSIB 4XN3A 3LMMA 4HPQA 2IGMA 3M8JA 3OMYA 3RQ4A 3S3MA 2L9SA 3D5RC 4CUGA 3MKYB 4E7LA 1OLTA 2DCEA 1TT0A 4ANJA 2VXDA 2WADA 2X6WA 4ZDOA 1WJDA 1D1CA 2VQHA 3W2WA 2F5VA 4BDZA 3ZRGA 5FRMA 2ZXHA 2X85A 2WY8Q 2QKLB 3BG6A 3SEQA 1MMGA 2BVLA 3RPUD 2DT7B 4DOZA 1MNDA 3EPZA 5KNLA 3DTEA 5HNFA 4NQWB 2WBMA 1N75A 5TGTA 4ZJZA 2OUMA 4GRIA 2HVSA 3AFHA 3OYGA 3UR3C 3L2RA 4LIVA 2PMZA 4QPOA 2GOXB 3PL8A 3OWTA 2LOOA 4XONA 4BE2A 3CP8A 4PFPA 2HQAA 4XKVA 5KHDA 3BC8A 1HA8A 2LREA 3A2KA 3LSIA 2GOMA 4B43A 2E5ZA 4E7IA 3H9JA 1DGRM 2R7OA 3ZCOA 4HEA2 2X6XA 4XLCA 2R7SA 3A4CA 3OYLA 3OYIA 2IS1A 1WJBA 1X1AA 2LBFB 3RSNA 1YX5A 1WJCA 4BACA 1QHHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPH A;  1MW7 A;  1LFP A;  1E0E A;  1K6Y A;  1KON A;  4F3Q A;  3HPG A;  1WJA A;  1WJB A;  1WJC A;  1WJF A;  1WJE A;  3F9K A;  1WJD A; 
#chains in the Genus database with same CATH topology
 2TRT A;  1JKP C;  5E20 A;  1JGS A;  1V5E A;  2VQG A;  4BY1 J;  2CQK A;  1S8N A;  3DLA A;  1BL0 A;  1QZZ A;  3H3U A;  2BGC A;  5AON A;  4Y7N J;  3K2Z A;  4XLN F;  3CMM A;  4EQQ A;  2HYJ A;  2B63 J;  1HKS A;  1T39 A;  4WF2 A;  5HNH A;  2M0M A;  2JTV A;  1RIO H;  5FKM A;  4QWQ A;  3OL4 A;  1T6S A;  2NVX J;  4U7D A;  2X48 A;  3ABM H;  3KX2 A;  5J1U A;  3GME A;  3M1E A;  1S3J A;  1BI1 A;  2E7X A;  3Q9V A;  4EM1 A;  6PAX A;  2VXZ A;  4PCQ A;  4C3I J;  1UZC A;  5J8C A;  3WTV C;  3CES A;  2W57 A;  1FOY A;  1FYM A;  2VC0 A;  4A3K J;  3K1N A;  1I1S A;  5JVT A;  1YTY A;  2PMZ N;  4AIJ A;  1LPQ A;  3CP2 A;  1I6H J;  5IP7 J;  1SEU A;  1B59 A;  3IH2 A;  1VQ4 I;  5K5O A;  2UZK A;  2ZSH B;  1HQC A;  2JWT A;  3ZMD A;  3I9V 2;  1HW1 A;  4L9N A;  5B5E C;  3GTK J;  1KQ0 A;  2CQ7 A;  2OC6 A;  4W97 A;  3W6J B;  5BS6 A;  1JI8 A;  2W24 A;  1ZLK A;  2XPW A;  5IYD J;  1EH8 A;  2VIX A;  3TOB A;  2V9P A;  4EJW A;  3S3O A;  5EF6 A;  2L7M P;  1WJA A;  1O7F A;  3HRS A;  2KMU A;  1V4R A;  3TMO A;  2OAZ A;  3Q0W A;  1IRX A;  4XSZ F;  3U9G A;  2M45 A;  1N78 A;  2Z2S B;  2DN0 A;  9ANT A;  4RM3 A;  4G12 A;  1OMI A;  1OCO H;  4RGX A;  4U87 A;  4RMN A;  1R4N B;  3EUK L;  2ZXW H;  1WHU A;  3HOS A;  1EH7 A;  2L3D A;  4BXF A;  4A3J J;  3LSK A;  1DP3 A;  1YJ9 I;  2MH2 A;  2GIV A;  3HEF A;  4DBQ A;  3OYA A;  2ZJR F;  4HX4 A;  2L7K A;  2QYO A;  4CYD A;  3WTY C;  4HQM A;  5B1B H;  3OOP A;  4G6D A;  2OZ6 A;  1JHF A;  5LEJ A;  1BW5 A;  1OJL A;  1POG A;  4J01 A;  2XAU A;  3JRI A;  1RUN A;  3P5J A;  5BQT A;  4MO7 A;  1HSJ A;  1C0W A;  3CTA A;  2KL4 A;  2H1K A;  2DFH A;  1IG7 A;  2VJ5 A;  1AKH A;  4NC8 A;  4ZC3 A;  2HQR A;  5EZH A;  3D0S A;  2KIM A;  1RR7 A;  3J7A Y;  3H9G A;  2Y0S N;  1A6Q A;  2AXL A;  4IO9 F;  2JA8 J;  4OIP F;  2E7W A;  1U78 A;  3CC7 I;  3HOW J;  3DTK A;  1G2H A;  3RQI A;  4LG0 B;  4CXF A;  3HHH A;  3RI4 A;  4BQO A;  2OZU A;  4UUS A;  2QSG X;  3NWS A;  2EV5 A;  4HG2 A;  1GVD A;  1OCP A;  2KHM A;  2VN2 A;  1QRY A;  4HOB A;  3J81 K;  4RGS A;  1RKT A;  3R60 A;  2XHK A;  4BUP A;  2M34 A;  2ESH A;  3GF2 A;  2VBZ A;  1Y56 A;  3BJO A;  3OL3 A;  3S1M J;  1O57 A;  3UKG A;  2ZO4 A;  3S3N A;  1LDD A;  2L4A A;  1MNE A;  3TO6 A;  1NHA A;  2ZME B;  4ZYD A;  4LB6 B;  3GXO A;  2X1C A;  3KP6 A;  2R7R A;  1MBJ A;  5FB2 A;  1U5T B;  1JT6 A;  1OFC X;  2LSO A;  2LY2 A;  2W85 A;  2DT6 A;  2HKX A;  1P6R A;  2ISY A;  3MKZ A;  3HC7 A;  4FX4 A;  2ACJ A;  3IKT A;  2HEO A;  2K9N A;  2WAQ N;  3ZQG A;  2AHQ A;  3LL7 A;  2V6E A;  4AYB A;  1VQM I;  1KU3 A;  3LSM A;  3TQN A;  3DXJ F;  3QOE A;  1OCR H;  4N0B A;  4E70 A;  3WHB A;  3IV5 A;  1ZYR F;  2CWE A;  4F3Q A;  2FE3 A;  2OCE A;  4KDP A;  1FBQ A;  4OIN F;  3VSK A;  3WU2 C;  4GFB A;  5HS7 A;  3E5X A;  4HBL A;  1IUY A;  3BT9 A;  1F9N A;  4BQQ A;  1DU0 A;  2XSD C;  4F92 B;  1SAU A;  2WA0 A;  2DJI A;  4YEL A;  3JRH A;  2EB7 A;  3BTL A;  2VE9 A;  3ZQH A;  1REP C;  1EV7 A;  2R7W A;  3WU0 A;  4KIG A;  2JMW A;  4NC6 A;  3R4K A;  3L2V A;  2H09 A;  1WH7 A;  3PNT A;  3RKW A;  1UHW A;  3GZN B;  1FJL A;  4M3E A;  1TW2 A;  3OIO A;  2A6H F;  1HW2 A;  3AL0 B;  3FXO A;  2K3F A;  3SYT A;  4XOP A;  3FK7 A;  2MYS A;  5F1R A;  1U8B A;  2W00 A;  3OIQ A;  3FKJ A;  1OKR A;  4KT6 A;  4MTD A;  3UNG C;  3KP3 A;  1T33 A;  1W5S A;  3BQZ A;  3LSG A;  5H6R A;  5FLX K;  1R1T A;  5C44 J;  1KQ8 A;  1BI2 A;  1U9N A;  4I2O A;  1SFX A;  1E0E A;  4FCY A;  2C6Y A;  2KP6 A;  4W1U A;  2RNG A;  2ZJP F;  3E3V A;  2PI0 A;  1DPU A;  1O4X A;  1MMN A;  3ECO A;  4BBR J;  2EFO A;  4IKF A;  1YS6 A;  2LK2 A;  3GFI A;  4IZZ A;  3HZJ A;  2WC2 A;  2DOD A;  3KEO A;  2EPF A;  2DMT A;  2HVQ A;  2Z5U A;  1WPK A;  2XAJ A;  2HTS A;  1IZ1 A;  3W6V A;  2WB1 A;  2O3F A;  1ZAR A;  3MQ0 A;  4RBO A;  3CMY A;  4L18 B;  1I3A A;  2KPM A;  1ZQ3 P;  4C3J J;  2BY3 A;  3HRU A;  2K3P A;  2JUC A;  3M1C A;  2XIG A;  5BOX A;  2HGC A;  1VQN I;  1L0O C;  2VL8 A;  3OS2 A;  4L5J A;  1JE8 A;  2ZME C;  4M9Z A;  4UV8 A;  1U5T C;  3AKZ A;  1FC3 A;  1RC9 A;  3K4N A;  3CCJ I;  2AO9 A;  4Y52 J;  1R9T J;  1DGW Y;  2YS9 A;  3KYL A;  5F08 A;  2FQ3 A;  5K5R A;  2ETH A;  3FKI J;  3C2H A;  2E2J J;  4H4K C;  2WAE A;  2VKE A;  2CUZ A;  1IGN A;  2STW A;  2XPU A;  2OA4 A;  2ZKZ A;  4M6X A;  1ETY A;  2OPT A;  3F9K A;  1IRG A;  2JPC A;  4MIM A;  2WV1 A;  3FF5 A;  4ZDP A;  1LJ9 A;  2L9V A;  3TW6 A;  1ZN2 A;  4LK1 F;  4BS9 A;  1S7A A;  2DDB A;  3CLO A;  4D5F A;  1VQ6 I;  2HR3 A;  2YX4 A;  2Z99 A;  3JAM Z;  1STZ A;  2R5Z B;  2ZB9 A;  5ILU A;  2QSH X;  1HDP A;  2V1N A;  3F8N A;  1GDT A;  2XRN A;  4N4N B;  1FIA A;  1XC5 A;  3EUH C;  1VI0 A;  5LHG A;  5D5X B;  1ZRF A;  3MKL A;  3HHG A;  1XGN A;  3TP0 A;  4L0Z B;  3KLN A;  4YII A;  4RAF A;  3MKW B;  4G6T B;  5KAI C;  3I4N J;  4RB1 A;  1WJE A;  3BRO A;  3QPS A;  2M0C A;  2P5L C;  3KET A;  2KRH A;  4E4H A;  4XKC A;  1HST A;  1SD7 A;  3IRR A;  2HZD A;  3BQY A;  1K6O A;  3AL0 C;  3LST A;  3O2P E;  2BBY A;  4R79 A;  4Q5S F;  1IW7 F;  1K7A A;  1DP7 P;  1WZ2 A;  4GGG A;  3D1N I;  2P5K A;  3DBR B;  4KIB A;  2YU9 J;  2QQ8 A;  4YFX F;  4UUV A;  2FJ1 A;  2VT3 A;  3H5R A;  3DBH B;  4AC0 A;  1YJN I;  4DYQ A;  3OIP A;  3I59 A;  3P9I A;  4MHG A;  4I7H A;  4F93 B;  2GA2 A;  1TW3 A;  3AG3 H;  3L00 A;  4ENK A;  2OTL I;  4HF1 A;  4M74 A;  2DDA A;  3K4J A;  2FBK A;  2DMP A;  1N77 A;  3ROU A;  3RCO A;  2MSY A;  4PJN A;  3K4C A;  5CVU A;  4Y13 A;  5ED4 A;  3S15 J;  3ZQC A;  1XGO A;  4QPQ A;  3O3K A;  1Z7L A;  3IAM 2;  3MFK A;  4TV7 A;  1QPM A;  3ABL H;  1WGX A;  3ZQQ A;  2GQQ A;  1XB4 A;  2VC1 A;  2ICW G;  3KFW X;  2DA2 A;  1UHM A;  3K69 A;  1FSE A;  5GAG J;  3K7A J;  2RVC A;  3KEQ A;  4Z6Y A;  3OSF A;  1X2N A;  4LD5 A;  4ZTF A;  4KIT B;  3F6V A;  1FZP B;  4YEJ A;  5ICF A;  4FTH A;  2CUJ A;  4CSW A;  2XV4 S;  4BXU A;  3K2A A;  1R71 A;  1YQA A;  3JTH A;  3GTJ J;  1AKH B;  3CDH A;  3DU6 A;  2HXI A;  2DA5 A;  2Q0O A;  5GAH J;  1SC7 A;  5HLH A;  3OYM A;  4D7N A;  1UG2 A;  3Q9S A;  4FQG A;  3DKY A;  2DPU A;  2MFZ A;  1WQ2 A;  2P6S A;  1LKX A;  4A3I J;  2HOT A;  4ESB A;  5D6E A;  5CLS A;  4KIF A;  4MGR A;  1SFE A;  4BBS J;  5L3C A;  5FO5 A;  3SFI A;  3M3Y J;  2HQ5 A;  2WV0 A;  1NTC A;  1R23 A;  5J4Y A;  4UUS B;  2DCE A;  1TT0 A;  3E97 A;  2WAD A;  3IKV A;  4ZDO A;  1KYZ A;  3MAJ A;  4IOA F;  4M72 A;  4BDZ A;  5DCM A;  2RAE A;  2D1H A;  2EZI A;  2XGX A;  4M73 A;  2QKL B;  2XAF A;  1MMG A;  1J75 A;  4WX9 A;  3HGY A;  1YW9 A;  4A6E A;  1HLV A;  4DOZ A;  3EPZ A;  4IOC F;  3DTE A;  2DI3 A;  4IF4 A;  1FBU A;  2JQ7 A;  3JRB A;  2GZW A;  5TGT A;  5D4R A;  4ZJZ A;  3R0J A;  2DFF A;  1R36 A;  2LP0 A;  3SDG A;  2O6G E;  3OYG A;  1BN5 A;  3WU1 B;  4QPO A;  2GOX B;  2YSR A;  4EM0 B;  4NDL A;  2LOO A;  4BHC A;  3I58 A;  5EDN A;  1HDD C;  1R5H A;  4XKV A;  1IRF A;  5KHD A;  3FXR A;  3BG3 A;  1ZGW A;  2V1U A;  2IBD A;  2BY2 A;  2DBB A;  2NVU B;  1XSX A;  2KIQ A;  3TGN A;  3ZOB A;  3CCV I;  5KAF C;  1Z67 A;  1NH3 A;  5A2Q Z;  3T5X A;  1BIA A;  4B43 A;  2CQQ A;  1VQ5 I;  5EYR A;  4HEA 2;  2X6X A;  2LD5 A;  2JSC A;  2IS1 A;  4UUT A;  1MJ9 A;  3VOE A;  5K1Y A;  1WJC A;  3DEU A;  2P7V B;  3V8K A;  1X19 A;  2Z1D A;  1QHH D;  5B66 C;  1JUM A;  4RDU A;  1G3T A;  2VQL A;  3DPT A;  4MTE A;  2IS2 A;  4LLL A;  2XAQ A;  3L2C A;  4UNO A;  3EQL F;  1Q1H A;  5A2Q K;  2V7F A;  2FUG 2;  1LB2 A;  5LBQ A;  2WWY A;  2QUF A;  2CQX A;  1YIT I;  2PBI A;  3DKW A;  1Z91 A;  4OMZ A;  4BYY A;  3I4M J;  1J59 A;  3S2H J;  1Z7U A;  3LFU A;  1U9O A;  2PMU A;  1WFX A;  1IJW C;  5K5Q A;  1XCB A;  2LRD A;  2WY7 Q;  1XPX A;  5TJJ A;  2IVM A;  2LKS A;  3KP4 A;  1X3Z B;  1HXD A;  5HOD A;  2ZFW A;  2YU3 A;  5J47 A;  3SQN A;  2XF5 A;  3N4M A;  1B1B A;  3B73 A;  4V2G A;  1JXS A;  1JUS A;  4L9J A;  4XLF A;  5E17 F;  1W7P A;  2HU9 A;  1ZR2 A;  1JTY A;  3E1S A;  1LVA A;  1X58 A;  1TLH B;  5LLQ A;  1JHH A;  1KQ9 A;  1XTA A;  2BY0 A;  1ZK8 A;  3LA7 A;  5AIP A;  2VBX A;  1R58 A;  2IA1 A;  2J5P A;  4EGZ A;  2LYC A;  2ZXJ A;  4IRG A;  4XLP F;  3GTM J;  2IJL A;  2V26 A;  2HOA A;  2KJC A;  4AU7 A;  3DQV C;  1X2M A;  4M3F A;  5IOY A;  3BR3 A;  1WI9 A;  4B4C A;  2RQP A;  3T1B A;  5GPC A;  3BJA A;  4AWX B;  5GTI C;  3P9C A;  2A61 A;  3TBI A;  2XAG A;  3FDY A;  5LFA A;  5D6F A;  1WI3 A;  3HSE A;  4B44 A;  1Z1D A;  3QPT A;  1R22 A;  1I5Z A;  4II2 A;  1X3W B;  3HB9 A;  3ZPL A;  1S7E A;  3DF8 A;  3PNY A;  5E79 C;  1JJ6 C;  2PLY A;  4G9Y A;  4MQV A;  2W82 A;  3CLQ A;  3GFL A;  2QEX I;  2STT A;  3HOY J;  2FU4 A;  2RKH A;  1TWH J;  2A68 F;  2R3S A;  5IP9 J;  4ZYH A;  2HKO A;  3NAU A;  5DDG A;  2V9K A;  4IHS A;  4DYC A;  3LSP A;  2DYR H;  2HDC A;  2KRF A;  2DOA A;  1PJR A;  2IS6 A;  3QPL A;  4IRH A;  1K61 A;  4R8H A;  1MD0 A;  2HOS A;  2QZ8 A;  1D5V A;  4L9V A;  1P4X A;  2CMP A;  1R00 A;  1E3H A;  3WG7 H;  2A07 F;  2E34 A;  3SXY A;  2EIL H;  2P5V A;  4ESF A;  4P55 A;  3TDU C;  5EJC A;  3OS1 A;  3FBN B;  2QVO A;  1T8I A;  1ETO A;  1KYW A;  2DW4 A;  3BZK A;  4B09 A;  4CCM A;  1TWF J;  4WXH A;  1YX3 A;  3PUB A;  1AOY A;  2QQB A;  1OQY A;  2XGE A;  1JT0 A;  1MW7 A;  1FPQ A;  2Z16 A;  3PFY A;  4EMS A;  1W4M A;  3H92 A;  4F7Z A;  2CW7 A;  5FKN A;  5FFZ A;  2CH0 A;  2ZFU A;  2LMD A;  2QBY A;  2RDP A;  3BZ6 A;  1W7P D;  4IL6 C;  3AG1 H;  4C30 A;  1KGS A;  4F55 A;  3I59 B;  3LSH A;  3ZP5 A;  2X6Y A;  2L9N A;  1F36 A;  3T8T A;  2LH9 A;  3NWT A;  3S14 J;  2EFN A;  1IDY A;  3I4P A;  5FRN A;  2F4I A;  4AUX A;  3BPV A;  3SZG A;  1VZ0 A;  2HTJ A;  3QYE A;  3PQJ A;  3ASO H;  2Z3Y A;  2BY1 A;  1FLI A;  1E17 A;  2CV2 A;  3HGG A;  1WWX A;  4RB0 A;  1HOM A;  1UCR A;  1B9N A;  1FP2 A;  4XQF A;  3D5L A;  4NQW A;  3CO6 C;  3HBL A;  3V42 A;  5FLV A;  4YRV A;  3MD2 A;  1FMV A;  4BE1 A;  4DJA A;  3EET A;  4ASN A;  2V9V A;  1YYV A;  1U2W A;  1OPC A;  3OYF A;  3K4L A;  1MMA A;  2HVR A;  2OV7 A;  1A36 A;  2PFB A;  2FBH A;  1MBE A;  4E7K A;  1ACI A;  2WAF A;  3C1D A;  3F0C A;  3FX3 A;  4NBQ A;  2PJP A;  5D8K B;  2P8T A;  3P9K A;  1R5I D;  4B47 A;  1Z9C A;  4RGU A;  4U0V A;  4S0H B;  3ZXS A;  3ESW B;  4CO8 A;  3O6B B;  2K9S A;  2KIF A;  2M87 A;  2NOJ B;  4AIH A;  3OYJ A;  3G1M A;  2RNJ A;  3G1L A;  3IUO A;  3LA2 A;  2NOG A;  2GXA A;  3EYI A;  4A6D A;  3LFK A;  2VJI A;  3HUG A;  5JFR A;  3GTL J;  2GAU A;  1PYV A;  3BG5 A;  2ELH A;  2G9W A;  3CJR B;  1UAA A;  1B6A A;  4C3H J;  2UWM A;  3LA3 A;  2KIU A;  1J5Y A;  2G0E A;  5E3N A;  2CV0 A;  3BLY A;  3OR2 C;  2VAS A;  1X4O A;  3SFZ A;  3CF5 F;  4CCN A;  3JRG A;  1IC8 A;  3BR0 A;  4OWR B;  2FOW A;  3VFZ A;  5IT9 Z;  2IXS A;  1ONV A;  2ZXI A;  3KP5 A;  5LHH A;  3OY9 A;  3CJQ B;  2X51 A;  4EJT A;  1U0J A;  5BPI A;  3I71 A;  2PG4 A;  2CGP A;  4PJM A;  1QGP A;  3CCM I;  4F91 B;  4L0Y B;  3GUD A;  2M2E A;  3IWZ A;  3CJT B;  2R7U A;  2AQF A;  1YS7 A;  4BEH A;  3KP7 A;  3MZ8 A;  4PK4 A;  1F1Z A;  5GP9 A;  4A93 J;  4YFN F;  1B8I A;  2ADU A;  1OR7 A;  2JPB A;  3Q0V A;  1XMA A;  4R1H A;  4XBF A;  2GM4 A;  3AG2 H;  4ENM A;  2DLL A;  3CUO A;  3S1N J;  4AYB N;  3BG9 A;  4I98 B;  3BTC A;  4Y3O A;  1B4A A;  1YO5 C;  4HST A;  1MH4 A;  4XR6 A;  5LGT A;  4KYW A;  4WWC A;  1KU9 A;  5DM6 F;  3K4B A;  2LR8 A;  1EF4 A;  3Q5F A;  3BTI A;  3A1Y A;  5J6X A;  4BH9 A;  1O3T A;  1MGT A;  1R7J A;  1V5F A;  2BZT A;  3WE2 A;  2VOD A;  3KP2 A;  3E0J B;  1JKR C;  2FNA A;  3GEZ A;  3K1M A;  3PSI A;  1X1B A;  2VLA A;  1J7K A;  2XB0 X;  1BC8 C;  4RA2 A;  4L9T A;  1ZRC A;  2K7L A;  2M9H A;  4IJA A;  4CDG A;  2Y75 A;  5F6F A;  3KIO A;  1GT0 C;  1HKT A;  4QIW N;  2CO5 A;  1JKQ C;  4M6V A;  2ISZ A;  2UXN A;  3FXU A;  3WGI A;  2EZL A;  3VOD A;  4YIF A;  2EIJ H;  3KPH A;  2FML A;  1ZG3 A;  2QSF X;  2EFQ A;  1RES A;  5E3O A;  3GW2 A;  4P1W A;  2L02 A;  3PQK A;  3QAH A;  4AVP A;  3GFJ A;  1U6G A;  2BV6 A;  3ZN1 A;  1FNN A;  3HTS B;  3JTG A;  4AD9 A;  1W7P B;  2COM A;  3H0G J;  2FRH A;  1SAN A;  1FBS A;  1MNM C;  4YFK F;  3WTW C;  2F48 A;  3JRA A;  2HI3 A;  2R7D A;  2JJ7 A;  3RIR A;  3KE2 A;  2VKD A;  1QVU A;  2EJR A;  3R0A A;  1PUF A;  1XGM A;  1A5J A;  3LQR A;  4KIS A;  1ZEL A;  3HRM A;  2VI6 A;  4BGD A;  3DPU A;  3HL2 A;  1ZGJ A;  2OQG A;  3ABK H;  2NVY J;  3JSP A;  1SFU A;  2L0K A;  5DYM A;  3VSL A;  3L2W A;  2XGD A;  4ZYA A;  5K7H A;  2QGU A;  3W6K B;  1OIS A;  3QOD A;  4BHB A;  1D0X A;  3A0H C;  3ZMU A;  4IX7 A;  1O7L A;  4PJL A;  4I6Z A;  3BWG A;  2UUZ A;  2ZCW A;  4FHT A;  5CVV A;  4BDY A;  1YIO A;  2R4G A;  4HV6 A;  4Q48 A;  5L3E A;  4DIQ A;  4E7Z A;  5E8I A;  5C4J J;  1EA3 A;  2RGV A;  1JKO C;  2VBY A;  2JN6 A;  3K10 A;  3B6A A;  1Z6R A;  4NC7 A;  1T56 A;  2O9L A;  4HX7 A;  2EH3 A;  3M7G A;  3S32 A;  2GWR A;  2JRM A;  3QPH A;  2M1B A;  1Y0N A;  5J1R A;  3M4O J;  1E2X A;  3VYR B;  1YHQ I;  3ECH A;  1D8K A;  3H1C A;  3E5Q A;  2IGK A;  3CJN A;  4OIR F;  1GLN A;  3H35 A;  4LOC A;  2DK5 A;  4X6A J;  1USS A;  3WOD F;  2DTZ A;  3CUQ A;  2LY9 A;  4E7J A;  1RNL A;  2X1E A;  1T95 A;  1EKE A;  1QVT A;  2P81 A;  2F5C A;  4GDF A;  5HLI A;  1Y8R B;  5K7Z A;  4I0B A;  2IGM A;  1IN5 A;  1S7O A;  3RQ4 A;  4OU0 A;  1J9I A;  2L9S A;  3D5R C;  4EVI A;  3ML6 A;  4CUG A;  1VQO I;  2QBY B;  2RN7 A;  5HDN A;  2GXG A;  5IP6 A;  1OLT A;  4EJV A;  1UB9 A;  3IHU A;  4CIC A;  2X6W A;  2DAO A;  1R1V A;  3W2W A;  3R6S A;  4A12 A;  1OCT C;  2O03 A;  1HW5 A;  2EIN H;  2GLO A;  2IRF G;  4KNY A;  4JYK A;  3BG6 A;  2CJJ A;  1LFU P;  2Y31 A;  4IHY A;  1W5C C;  3KLO A;  2DT7 B;  1MND A;  4B3A A;  1P4W A;  4NQW B;  2WBM A;  5LHI A;  1EJ9 A;  3FXQ A;  2HVS A;  4M6Y A;  2HQN A;  3AFH A;  3GLX A;  3UR3 C;  1SVL A;  2YPR A;  3L2R A;  4LIV A;  1QO0 D;  3CP8 A;  4PFP A;  2HQA A;  4HQE A;  5CYV A;  5EGO A;  2IW5 A;  3N97 A;  3CCU I;  4V2F A;  3BC8 A;  2Y9Z A;  4UB8 C;  1HA8 A;  4B1R A;  2GOM A;  4E7I A;  1DGR M;  1R4M B;  1FOW A;  3A01 A;  3ZCO A;  3F8M A;  4RAG A;  2DYS H;  4HF0 A;  4XLC A;  1LUJ B;  1MIJ A;  4PJ0 C;  3OYL A;  1Z05 A;  3HTU A;  4L5I A;  3OYI A;  3HYI A;  2P4W A;  3DLL F;  1UST A;  1X1A A;  5H6Q A;  3OV8 A;  2DA1 A;  2FBI A;  2VOO A;  3BOQ A;  3KYC B;  5F1J A;  3IP4 B;  4ZYE A;  4BL0 B;  4CCO A;  2V1X A;  3ZMV A;  1K4S A;  1ZRE A;  3QP5 A;  4FAS D;  1J09 A;  3JAM K;  3OYK A;  2XVC A;  2ZBK A;  5GTH C;  1MDM A;  1DU6 A;  5E3M A;  4NUB A;  2Y69 H;  4BHP A;  2JZY A;  3BCA A;  3WTX C;  2F4O B;  2JVG A;  3ZQF A;  3LAJ A;  5FRO A;  1SAX A;  2MA3 A;  1P4A A;  1OCC H;  2JT1 A;  4CCL A;  1XSV A;  4O3M A;  2BW3 A;  4A2U A;  1ERD A;  4Y17 A;  2BXY A;  1HC8 A;  4CZZ A;  2CU7 A;  3FBI B;  4ENJ A;  3FXM A;  5J3L A;  2COB A;  2K85 A;  1ON2 A;  2OBP A;  1D1B A;  2R7F A;  3V7S A;  1Z6T A;  3J80 Z;  3CO7 C;  3DV8 A;  3KZI C;  4IHV A;  2NVQ J;  2LKX A;  4BEH B;  3IH3 A;  3G6E I;  2LDU A;  1B8I B;  1W0U A;  2ME6 A;  2M4K A;  1ZH5 A;  3VEP A;  1FSH A;  3PNV A;  2GA1 A;  1IN6 A;  1WRJ A;  2ECB A;  2OCC H;  1RET A;  1X4P A;  2HDD A;  1LFB A;  3E6M A;  3DU5 A;  1NK3 P;  2EBI A;  2L2O A;  1AA7 A;  4KJZ A;  4B8X A;  1TWA J;  1BR1 A;  3L09 A;  3HOV J;  2D2W A;  1RRJ A;  2NS0 A;  4UB6 C;  2CFO A;  1A31 A;  2DA6 A;  3JR9 A;  3FHZ A;  4RM2 A;  5CVJ A;  2CV1 A;  4B48 A;  1QNT A;  1MH3 A;  2LY1 A;  1TBX A;  4DBR A;  2D45 A;  2ME0 A;  2ZJQ F;  4BXX J;  1S5L C;  2M5W A;  5ERI A;  1I6X A;  1TNT A;  1F5T A;  5CQG A;  2KQR A;  4KMU X;  4XRM A;  1XD7 A;  3HRT A;  4L5E A;  4ZDL A;  2L5Q A;  2FMY A;  1LVK A;  3OYC A;  2E36 A;  2EZH A;  5E1Z B;  3CQZ J;  1WCM J;  3A02 A;  3TW7 A;  1K83 J;  4Y33 A;  3FXK A;  5D4S A;  2VJJ A;  1LEB A;  2VE8 A;  3HOZ J;  4D1Q A;  2FF4 A;  2EFP A;  2KJB A;  1D8J A;  3WTU C;  3MZY A;  5KVR A;  3HSR A;  3GWZ A;  3CZ6 A;  4XKB A;  1D0Z A;  1EH6 A;  3I5U A;  2OF7 A;  2YUS A;  4JP0 A;  2EIM H;  1Y8Q B;  2QLZ A;  1X1D A;  4OIO F;  1I3Q J;  1IV6 A;  1T98 A;  3D5S C;  1IUF A;  4FET A;  5E1W A;  2VKH A;  2FNP A;  2BHZ A;  1XCV A;  3BY6 A;  5KCM A;  1IAW A;  1Z3Y A;  4IEJ A;  4E6K G;  3HKZ A;  3GX4 X;  2FX0 A;  2CSO A;  4JK1 X;  3ABU A;  3F21 A;  2V4J C;  2IGO A;  2L4M A;  1LDK B;  3DP7 A;  2PJR A;  4EGY A;  4QLC U;  5E8G A;  1P2F A;  5J8F A;  5CVI A;  4IQJ A;  3B02 A;  1I50 J;  4G7Z F;  3Q3S A;  1SFO J;  2LNB A;  5IOZ A;  1D3Y A;  3GTP J;  4LFU A;  4XOT A;  2HWV A;  4XM3 A;  4F52 A;  3MCZ A;  1I1G A;  1ZLJ A;  1X1C A;  5FD6 A;  1APL C;  4XIC A;  2CW8 A;  4EEF G;  3CCS I;  4C9Y A;  3DWL E;  2M7B A;  1R6R A;  3P7N A;  4N4O B;  4A5M A;  2E71 A;  2MC4 A;  1OR7 C;  2XAS A;  5DD8 A;  2O8K A;  2EA4 A;  1Z21 A;  3OOU A;  3GZ6 A;  3U21 A;  1VF9 A;  3HPH A;  4EM2 A;  2RRE A;  1IRZ A;  4AIK A;  2R7X A;  2MG4 A;  3ELK A;  5M3F J;  2PQ8 A;  3IC7 A;  3J7Y J;  2O5R A;  3TOA A;  4JQF A;  5BNG A;  5IT3 A;  5DEQ A;  1TT5 B;  2WTE A;  2L9R A;  3IRQ A;  2A6E F;  2HPI A;  5LGN A;  2IS4 A;  2LC2 A;  3PSF A;  3VYS B;  1ITY A;  4RLF A;  4M3B A;  4DGW B;  2QWW A;  4RB2 C;  3FM5 A;  2MD5 A;  1SFK A;  1H88 C;  1G3Y A;  2E60 A;  3VYU B;  4LK0 F;  4IHT A;  3CUQ B;  1SVO A;  1QBJ A;  2EV0 A;  2JA2 A;  1UHS A;  2KIS A;  3V8J A;  2F4M B;  4AID A;  5JLW A;  4WK8 F;  4MLO A;  2JSP A;  1QHG A;  2DA7 A;  3I3L A;  3OYB A;  2VT2 A;  4A0Y A;  2ZJ2 A;  4DW6 A;  3ISP A;  1CGP A;  1PP7 U;  3GTG J;  1V54 H;  2F6C A;  3OYD A;  2M7A A;  5M3M J;  4BE0 A;  1R5G A;  2JRT A;  4IXA A;  1MJA A;  3RKX A;  4E7S A;  1A04 A;  4KT5 C;  3ZGK A;  2KT0 A;  1TQP A;  4A3G J;  1Y1V J;  1A35 A;  1IDZ A;  3ZMZ A;  5ILV A;  3KCC A;  2QM3 A;  1Q1V A;  2Q8K A;  1IXS B;  4C2M J;  1XX5 A;  4U88 A;  3ASN H;  2M30 A;  1QZY A;  1DQU A;  3F3X A;  3EUA A;  2E1N A;  4N9I A;  1YJW I;  1BC7 C;  1YLF A;  3OYE A;  2HNH A;  1HKQ A;  4UHT A;  5DS9 A;  5E1X A;  2Y48 A;  4UVB A;  4D5C A;  2DT5 A;  3IAS 2;  2XF6 A;  3PO2 J;  3BG7 A;  3R61 A;  1PDN C;  3HG9 A;  1ODD A;  2DOF A;  5D5W B;  1R49 A;  2XB5 A;  1Y6I A;  4ZZD A;  1LFP A;  2XRL A;  3BR1 A;  3BP8 A;  3K6G A;  5EGO B;  3I56 I;  5M5W J;  3QRF F;  4YG2 F;  2R5Y A;  3Q0U A;  1T0F A;  4M71 A;  2DMN A;  4HYE A;  1F43 A;  5D8L B;  2KZG A;  3QYF A;  1FWZ A;  5ILS A;  1V5G A;  2A05 A;  2XC7 A;  5LD2 C;  3BR5 A;  3CCE I;  4XRF A;  3CC2 I;  3RPQ A;  5TIS C;  2F5D A;  2A6T A;  3DEW A;  1U3E M;  2JVH A;  5BPD A;  2HS5 A;  3RYR A;  3FXJ A;  2PMH A;  4CCK A;  4B3X A;  1MDM B;  1IO2 A;  1RZ4 A;  2GIZ A;  1BR4 A;  1S6L A;  3K4M A;  2FXA A;  3MVP A;  1FTT A;  4WCG A;  1YFH A;  2BW3 B;  1GV2 A;  2M8E A;  2TCT A;  3OSG A;  1BM9 A;  2VPR A;  4XLE A;  2CFX A;  3GFM A;  5EEG A;  2W7N A;  2P6T A;  4RGR A;  2XKO A;  3F23 A;  3TED A;  4AVZ A;  4CYC A;  2IP2 A;  2R7Q A;  3CUQ C;  1D0Y A;  1IV8 A;  3WG9 A;  3H9Q A;  4DZJ A;  2XAH A;  1TQI A;  3F8F A;  1KZH A;  1ETK A;  1XDU A;  5HOO A;  3DBL B;  2EFW A;  1FYK A;  2NRA C;  1XGS A;  2QF7 A;  1BA5 A;  1SD4 A;  4MFD A;  4LJZ F;  1O3S A;  3E6D A;  2XSJ C;  3LSJ A;  3F6O A;  2K02 A;  3PJR A;  3K70 D;  1ULY A;  2ECC A;  2VJ4 A;  3TP3 A;  3CD6 I;  4K2E A;  3HIF A;  2CW0 F;  3KYD B;  3G73 A;  1MBF A;  1E3P A;  1XDS A;  4A0Z A;  3PIO F;  4OAZ A;  1DPR A;  5DUI A;  1AWC A;  4ITV A;  4LMY A;  3GBG A;  1BBY A;  4A3L J;  4D0P A;  3WGG A;  3H0D A;  1JJ8 C;  4HV5 A;  1LE8 A;  1G4D A;  3B6C A;  1OCZ H;  4EAT A;  1ZG1 A;  1ZG5 A;  2VPL A;  3GTO J;  1SMY F;  4LG3 A;  2R7T A;  3H36 A;  3OS0 A;  5E18 F;  3RZD J;  1BJA A;  4BJ5 C;  4CCJ A;  1VQ7 I;  1ETW A;  2DFE A;  2J5O A;  1BJZ A;  2QKM B;  3I64 A;  4KN7 X;  2HXO A;  5GPA A;  5C3E J;  3WTS C;  3G2B A;  4MFE A;  3H5N A;  4HDV A;  1Z77 A;  1K79 A;  1RUO A;  2W48 A;  4IQ4 A;  2I5U A;  1ZR4 A;  1W36 D;  3I55 I;  4PSX A;  5IYC J;  2Q2E A;  4MQ9 F;  2ZC2 A;  5JHU A;  3J7Z I;  3SZP A;  2YX7 A;  3CF2 A;  2M8G X;  4G7H F;  1JUP A;  1LNW A;  1P92 A;  3O8G A;  5DCM B;  1IN4 A;  4N9H A;  2R5Z A;  2FOK A;  2FEZ A;  4HAM A;  3WGH A;  2AXT C;  4XID A;  3I0T A;  2NNY A;  2W84 A;  3S17 J;  4Y4R A;  2LFB A;  2CUE A;  1IF1 A;  4BNC A;  3GVA A;  4I09 A;  3LQQ A;  4UVA A;  4XLA A;  3RTR A;  1T38 A;  1NG6 A;  2ID6 A;  1T2K A;  2V79 A;  1S9H A;  4HDU A;  3U2R A;  2DPD A;  3C2G A;  3TO9 A;  2K9M A;  3CCY A;  3DCF A;  2ESN A;  4PZJ A;  4ZZL A;  4PGH A;  3K9T A;  2XDV A;  1SMT A;  2Z33 A;  4HX8 A;  3TL4 X;  4JX6 A;  3SJM A;  3LSR A;  3HSF A;  2XPV A;  5FKO A;  3QP6 A;  2PJR B;  1CQT A;  5IT9 K;  2QCO A;  2QA4 I;  4XN3 A;  3GYH X;  3LMM A;  3LWF A;  2KDZ A;  1VQP I;  2K4J A;  2IAI A;  3PIP F;  2BEO A;  2VBW A;  3GZ5 A;  3MKY B;  4NHJ A;  1TP4 A;  4E7L A;  4FT8 A;  1GXP A;  3K0L A;  4ANJ A;  1AHD P;  1J2X A;  2BE5 F;  2VXD A;  3K1P A;  4BY7 J;  5KK1 A;  1HF0 A;  1WJD A;  2VON A;  1ZAO A;  2F5V A;  3ERE D;  2LF7 A;  2P7C B;  3ZRG A;  2OJE D;  3QQA A;  5FRM A;  2NVT J;  4CGZ A;  2D5V A;  2IT0 A;  3EDP A;  2X85 A;  1GV5 A;  2GBY A;  3BR2 A;  3SEQ A;  5FJ8 J;  2IA0 A;  1BI0 A;  4I76 A;  4ZYG A;  4X1E A;  2Z9O A;  3S16 J;  5KNL A;  4HA8 A;  1UJ8 A;  4RAZ A;  3RYP A;  2OUM A;  4IRI A;  4GRI A;  2JA5 J;  5ICC A;  2H6B A;  5F0F A;  1U8R A;  3M8E A;  3GLL A;  2PMZ A;  3PL8 A;  1CF7 A;  1QZE A;  4M9S A;  4BE2 A;  3J81 Z;  5HDG A;  5EEH A;  1SD5 A;  3ABT A;  2HZT A;  3EYY A;  4EJU A;  1LDJ A;  5GAE J;  2DMQ A;  3HM5 A;  3M9A A;  4P9F A;  1O3Q A;  5B3S H;  2G7U A;  4OMY A;  1WSU A;  5IY5 H;  3A2K A;  3LSI A;  3H9J A;  3E6C C;  2R0Q C;  5JI6 A;  3A4C A;  5F0C A;  2V1D A;  2JA7 J;  5IYB J;  1WJB A;  2D1V A;  1FIP A;  1YX5 A;  2H94 A;  3S2W A;  4BAC A;  3E5U A;  1K78 A;  5FLM J;  4HF2 A;  1TL8 A;  3I54 A;  1FOK A;  4KUM A;  5HLT A;  4MEY F;  3IL2 A;  1DDN A;  4U7B A;  5LRS A;  4HSR A;  2Y9Y A;  3ZR8 X;  2AS5 F;  1P7I A;  1WH5 A;  1VQL I;  3S93 A;  2IGN A;  2WB1 N;  1G59 A;  3W2V A;  2K27 A;  3H3Z A;  4BAY A;  5H20 A;  2F5E A;  3NQO A;  3BDD A;  4RLQ A;  4KFC A;  1JTX A;  2DA3 A;  4WXD A;  5B1A H;  1GXQ A;  4ZTJ A;  3F8C A;  1IXR C;  3NRV A;  2P0W A;  3MZH A;  4PJJ A;  1MSE C;  4U0W A;  2HOE A;  2G7H A;  1I39 A;  1MMD A;  1XMK A;  4KIC A;  3OYN A;  2UV1 A;  5BMZ A;  3VDX A;  4OIQ F;  1FT9 A;  5ICE A;  4HLX A;  1OYW A;  4DNC A;  2B9S A;  2K9L A;  1D1A A;  3MN2 A;  3L1P A;  4HNV A;  2CS3 A;  3DEE A;  1VQ9 I;  2MLK A;  2DK8 A;  1J0R A;  2R5Y B;  1YRN A;  1NK2 P;  1ZHF A;  4G94 A;  3I53 A;  4I0A A;  1BOB A;  3FZV A;  4NB5 A;  1FX7 A;  5EEA A;  2F5F A;  5HS8 A;  2I8D A;  3SEZ A;  3K4K A;  4ENN A;  2NNN A;  5EZG A;  2Y0S A;  1TWG J;  5FLX Z;  1OYI A;  2H8R A;  4A3D J;  2E2H J;  2RQQ A;  1ZTR A;  4DYR A;  3V7R A;  1GVJ A;  2X6O A;  5FD5 A;  1ORK A;  1B72 A;  2CUF A;  2X4H A;  1T08 B;  2MD0 A;  5GAD J;  1ETV A;  1W5T A;  2Q1Z B;  1IXC A;  3ZQL A;  3QU6 A;  4Q4Z F;  2E1M B;  5FGM A;  4D7M A;  4S04 A;  5LEK A;  1FEX A;  4H0E A;  1Z0X A;  4X0G A;  4ESJ A;  3WTZ A;  2DA4 A;  5L3F A;  3S1Q J;  1FY7 A;  1MKM A;  1ON1 A;  2K86 A;  3G71 I;  4CH7 A;  5EG0 A;  2ID3 A;  1MMS A;  1RKW A;  3NEU A;  1K4T A;  1YG2 A;  5JR3 A;  5CKT A;  3HXL A;  1FOX A;  1IN8 A;  5AIQ A;  2H27 A;  1JGG A;  4CYC B;  5D5V B;  2XUB A;  4II3 A;  1HCR A;  1NG7 A;  4LIU A;  5CVR A;  2WAQ A;  1KON A;  1ZRD A;  3BR6 A;  1MBG A;  5FFX A;  3HOX J;  3VB2 A;  3PFI A;  1S72 I;  1H9T A;  5F64 A;  3LNQ A;  2R7V A;  1K6Y A;  1TQM A;  3QOP A;  3HDD A;  1I27 A;  2A5W A;  4QSH A;  2L54 A;  1TWC J;  3OR1 C;  4E7H A;  5M5Y J;  5ICG A;  2CRG A;  4XOR A;  2RV8 A;  3GTQ J;  5L3B A;  1P7J A;  5JLX A;  5DM7 F;  3JRD A;  3MEX A;  2DFI A;  5J1Y A;  1AU7 A;  3K70 C;  1H0M A;  1LE8 B;  2O7O A;  4FE7 A;  2UXX A;  2DXI A;  4HZF A;  3HJE A;  2K5C A;  3VYT B;  4HW0 A;  2A69 F;  4XMY A;  1YE9 A;  3GO5 A;  4GYI A;  2K40 A;  2PN6 A;  3REO A;  3FM3 A;  1LQ1 A;  3WTT C;  2KRC A;  2JK3 A;  3GCM A;  5JVG F;  4IVN A;  2DQL A;  4BU2 A;  3F8B A;  4G6Q A;  4M3D A;  4BKX A;  3ERM A;  3X2Q H;  2MAB A;  4PSW A;  4O5V A;  4PUS A;  3HUG B;  4CHU A;  3L7W A;  2Q2E B;  1V55 H;  1VFC A;  3BZC A;  4JOM A;  1T0F C;  4Q47 A;  4O6J A;  3O8H A;  4RB3 C;  2CG4 A;  2R93 J;  4IHX A;  1RPW A;  1W36 C;  1XG1 A;  3BJ6 A;  3C3W A;  3E6B A;  5HVQ C;  2EQR A;  1BW6 A;  4UY8 I;  1SD6 A;  3V8L A;  5D5U B;  4G7O F;  4XKW A;  3HOT A;  3FIS A;  3FMR A;  2XGC A;  3A03 A;  4KN4 X;  3HPG A;  4M3G A;  4RS8 A;  2HYG D;  4AM3 A;  1TZL A;  3CC4 I;  4BJT A;  4C2U A;  2EA2 A;  1MZB A;  1Z3X A;  4A0X A;  1FYL A;  4XSX F;  2OTJ I;  5JHF A;  2AQE A;  5CQE A;  3TKY A;  2E1M C;  3DFG A;  5F27 A;  5DTD A;  4XRS A;  3LAP A;  4UVC A;  3F22 A;  1H8A C;  3HKZ N;  4Z2Y A;  1VTN C;  5HDK A;  2PX9 A;  2W25 A;  1UG0 A;  2BHY A;  1WVR A;  2E2I J;  2LBF A;  4Y15 A;  3QWL A;  5H2F C;  3MMY B;  3PM1 A;  3J7A O;  2QQA A;  3V4G A;  1RI7 A;  3A0B C;  1PUE E;  2MW8 A;  4A69 C;  3RKY A;  1QU3 A;  1X1P A;  3J80 K;  4JX5 A;  1PP8 F;  3LOC A;  4JX4 A;  5DCF A;  3ZQ7 A;  1Y39 A;  1QA6 A;  5TRD A;  3ZQI A;  1M1E B;  2XKP A;  4PDK A;  3H3V K;  3KEY A;  4GO1 A;  1WJF A;  4C2T A;  3CMA I;  1BR2 A;  3RJP A;  4OAY A;  4DZP A;  1SVM A;  2ELK A;  4NNJ A;  3H5A A;  2ELJ A;  4XLH A;  1YI2 I;  4HRI A;  1FP1 D;  2DO7 A;  2EV6 A;  3BPX A;  2NYX A;  1FTZ A;  4LGW A;  2L7F P;  2EIK H;  3WHC A;  3BCB A;  3JW4 A;  3SZT A;  2OD5 A;  4ON0 A;  4CA0 A;  3W3C A;  2FQ4 A;  1CF7 B;  2K4B A;  4P96 A;  4GYG A;  2RC4 A;  2X0L A;  4LIT A;  3T0Y A;  3JSO A;  2M4G A;  2KKO A;  2MH9 A;  1MSF C;  2IA2 A;  4XNF A;  5J4V A;  3ULQ B;  2M3A A;  2HDW A;  2FSW A;  1UMQ A;  4XK4 A;  1A6I A;  2EZK A;  3RDI A;  4ZH4 F;  4ETS A;  3FIW A;  3MWM A;  1WJ5 A;  4P9U A;  2HPM A;  4A5N A;  4A3B J;  4A3F J;  2R92 J;  1G3W A;  1QQI A;  1XSD A;  2XRO A;  2A5Y B;  5F04 A;  1BOA A;  5K7F A;  2ZNZ A;  1K78 B;  1PUF B;  1MBH A;  3S8P A;  3JRF A;  3S1R J;  4XL9 A;  4I02 A;  5L3G A;  4PFO A;  2DU9 A;  1UFM A;  1W1W E;  1FMW A;  3ZMS A;  2HYF A;  4ABZ A;  2X1D A;  1YW7 A;  3TO7 A;  4HNT A;  5IPA A;  4I01 A;  1G3S A;  3FMQ A;  3DKX A;  2LTP A;  4FX0 A;  4MEX F;  2KZV A;  3ZMT A;  3BTJ A;  2E1C A;  3ONQ A;  2F2E A;  3HOU J;  3N05 A;  3L2U A;  2VB6 A;  2Y30 A;  1R1U A;  3V7C A;  1VQ8 I;  3C7J A;  2N8G A;  2Y0M A;  4UXN A;  1BIB A;  1GUU A;  2NAZ A;  2W1O A;  1XN7 A;  1H9G A;  1PVE A;  2LG4 A;  4P5O A;  5CPR B;  5J40 A;  2BYV E;  2K9Q A;  3OYH A;  3JRC A;  4XRS G;  4KMF A;  1IN7 A;  1UEL B;  3SDB A;  1HBX G;  2DOE A;  4M9X A;  2BOL A;  1YIJ I;  1GHC A;  1LEA A;  3S2D J;  1MJB A;  3FHN A;  4CZC A;  2KLO A;  2VUM J;  4EJO A;  1VND A;  1YRN B;  3DPL C;  2KDO A;  5FKL A;  1G8X A;  2IPQ X;  4G8X A;  2OU2 A;  3C18 A;  3RZO J;  4UV9 A;  5LGU A;  1ETQ A;  2A3S A;  3CCL I;  3VWB A;  1MBK A;  2VQC A;  5M5X J;  3FK6 A;  2FA5 A;  4JBA A;  3RPU A;  2BVM A;  3JRE A;  3AAF A;  4A3C J;  3IH4 A;  5HLG A;  3FXL A;  2B7E A;  1XMX A;  5C4X J;  4J00 A;  1B72 B;  3F72 A;  4S05 A;  2V6C A;  2O8X A;  4GCV A;  3L2Q A;  2GXB A;  4LG0 A;  3COA C;  2E35 A;  2NXN B;  4I99 C;  5HS9 A;  1RR8 C;  2H1L A;  3L9F A;  5DV5 A;  1X3U A;  2YR2 A;  3CCQ I;  4FE4 A;  3DTI A;  4YIR X;  2E5N A;  1QPI A;  5EG0 B;  3QYB A;  2E19 A;  2LVS A;  4D9J A;  1YW8 A;  3G1O A;  2IEK A;  1YOV B;  4RAY A;  4WXC A;  2L7Z A;  2QEN A;  1XS9 A;  2PEX A;  4LLN A;  3M8F A;  2DJN A;  5LRR A;  4LLG F;  1W0T A;  2CQN A;  2ZME A;  4HLY A;  2DMU A;  3W2A A;  1U5T A;  2NS7 A;  2O61 A;  2H8W A;  1P9Q C;  3G4S I;  1V3F A;  1ETX A;  2MLG A;  3T8R A;  3VPR A;  1KA8 A;  4HNU A;  4KA4 A;  2JUG A;  4EV0 A;  5DUK A;  2W4S A;  4PGG A;  2BXZ A;  1S29 A;  2L01 A;  4XN0 A;  2H6C A;  2MGQ A;  2XF7 A;  2R7Z J;  1TC3 C;  2LLK A;  4BQN A;  3TDZ C;  4BJ6 C;  3CDL A;  2OQR A;  1E3O C;  2HFH A;  3CME I;  1Y1W J;  3RKQ A;  5FKK A;  2ZSI B;  3U1D A;  1ZKG A;  4HPQ A;  3M8J A;  3OMY A;  2X9D A;  3G3Z A;  3JCU C;  3S3M A;  3A01 B;  2MC3 A;  2I10 A;  3E7L A;  1KU2 A;  3EUH A;  4V19 K;  3WE3 A;  4U0Y A;  3C2B A;  4A3M J;  2ZNY A;  4QTR A;  3PO3 J;  3PUF A;  2LKP A;  1D1C A;  2VQH A;  1B9M A;  3QU3 A;  1DUX C;  2O0Y A;  2ZXH A;  2WY8 Q;  4A3E J;  4IPA A;  2BVL A;  2VKV A;  1ENH A;  3RPU D;  3ZN0 A;  3AG4 H;  1G6N A;  3M07 A;  3FWE A;  2NS8 A;  2E1O A;  5CJ9 A;  3KZY A;  2JA6 J;  5HNF A;  1N75 A;  4LB5 A;  2VOP A;  1OYY A;  2TDX A;  5F0H A;  2CYY A;  3KZZ A;  1L3L A;  4MNU A;  4DQ2 A;  4J19 A;  1H89 C;  3OWT A;  4XON A;  3CCR I;  3NAR A;  3U1K A;  3SHF A;  5E3L A;  2KFD A;  2EWN A;  1TTY A;  1Y0U A;  4FIS A;  1WKM A;  4GXO A;  1VQK I;  1O3R A;  2LRE A;  1TNS A;  2B0L A;  1N25 A;  2E5Z A;  1D5Y A;  3IWF A;  2DTR A;  2R7O A;  2R7S A;  2EK5 A;  1ZGA A;  1KU7 A;  2Y2Z A;  2DQR A;  2LBF B;  1BI3 A;  2QQ9 A;  3RSN A;  2LF8 A;  4IHW A;  3FMS A;  2MBF A;  2FD5 A;  4OOI A;  5L3D A;  5DD4 A;  1F4K A;  3CDI A;  4BQA A; 
#chains in the Genus database with same CATH homology
 2Z1D A;  5HLT A;  4U7B A;  3IP4 B;  2VQL A;  4BL0 B;  1V5E A;  2VQG A;  3DPT A;  4CCO A;  3DLA A;  4HSR A;  3ZR8 X;  4FAS D;  2IS2 A;  1J09 A;  3OYK A;  2V7F A;  2FUG 2;  3CMM A;  2IGN A;  3S93 A;  1G59 A;  3W2V A;  4NUB A;  3BCA A;  5HNH A;  2M0M A;  2JVG A;  5FRO A;  4RLQ A;  3LFU A;  3OL4 A;  1WFX A;  4CCL A;  2BW3 A;  3KX2 A;  2LRD A;  2WY7 Q;  1ERD A;  4ZTJ A;  2P0W A;  4PJJ A;  3FBI B;  1MMD A;  2VXZ A;  1D1B A;  2XF5 A;  3CES A;  3OYN A;  2UV1 A;  3VDX A;  4BEH B;  4XLF A;  2K9L A;  2HU9 A;  1D1A A;  2CS3 A;  2M4K A;  3DEE A;  3E1S A;  3PNV A;  3CP2 A;  1X4P A;  2LYC A;  1BOB A;  3DU5 A;  2V26 A;  2ZSH B;  3I9V 2;  2L2O A;  4AU7 A;  1AA7 A;  2I8D A;  4KJZ A;  3K4K A;  3SEZ A;  3DQV C;  1BR1 A;  2OC6 A;  2Y0S A;  1JI8 A;  2CFO A;  2VIX A;  2RQQ A;  4RM2 A;  3TBI A;  3FDY A;  3S3O A;  2CV1 A;  4B48 A;  1WJA A;  5LFA A;  2MD0 A;  2LY1 A;  4B44 A;  2KMU A;  4DBR A;  2Q1Z B;  3TMO A;  4II2 A;  1IRX A;  5CQG A;  2KQR A;  2E1M B;  4ZDL A;  2L5Q A;  1N78 A;  3PNY A;  1LVK A;  2Z2S B;  3OYC A;  4RM3 A;  4X0G A;  2W82 A;  4U87 A;  4RMN A;  4Y33 A;  4CH7 A;  2VJJ A;  3EUK L;  3HOS A;  4D1Q A;  2V9K A;  5CKT A;  3HXL A;  4BXF A;  3LSK A;  1DP3 A;  4II3 A;  1NG7 A;  4LIU A;  4DBQ A;  3OYA A;  2DOA A;  2WAQ A;  1KON A;  1PJR A;  2IS6 A;  2L7K A;  3CZ6 A;  4XKB A;  1D0Z A;  2R7V A;  1K6Y A;  2CMP A;  2A5W A;  1X1D A;  3OR1 C;  2XAU A;  4J01 A;  4E7H A;  4XOR A;  3D5S C;  4FET A;  3OS1 A;  2VKH A;  3FBN B;  2KL4 A;  2VJ5 A;  5KCM A;  1Z3Y A;  4NC8 A;  4ZC3 A;  4E6K G;  3HKZ A;  4CCM A;  1YX3 A;  3PUB A;  3K70 C;  2V4J C;  1MW7 A;  2IGO A;  1LDK B;  2Z16 A;  3PFY A;  2PJR A;  3J7A Y;  3H9G A;  2DXI A;  4IQJ A;  2K5C A;  2CW7 A;  1X19 A;  3VYT B;  4XMY A;  1YE9 A;  3DTK A;  2CH0 A;  2ZFU A;  4BQO A;  4XOT A;  4XM3 A;  3NWS A;  4F52 A;  2KRC A;  4C30 A;  4HG2 A;  3LSH A;  4F55 A;  2X6Y A;  1X1C A;  2L9N A;  2KHM A;  2CW8 A;  4BU2 A;  4C9Y A;  3DWL E;  2M7B A;  1R6R A;  2LH9 A;  2MAB A;  3NWT A;  4N4O B;  4PUS A;  3HUG B;  4PSW A;  4BUP A;  5FRN A;  2F4I A;  2MC4 A;  1OR7 C;  1Y56 A;  2Q2E B;  3OL3 A;  3SZG A;  1VZ0 A;  1Z21 A;  3OOU A;  3QYE A;  3U21 A;  3HPH A;  3S3N A;  4JOM A;  2RRE A;  1T0F C;  1MNE A;  2CV2 A;  2R7X A;  4XQF A;  1W36 C;  3D5L A;  5HVQ C;  2X1C A;  2R7R A;  2O5R A;  3MKZ A;  4XKW A;  2LY2 A;  3HOT A;  2DT6 A;  4JQF A;  3V42 A;  3HC7 A;  4YRV A;  3HPG A;  3MD2 A;  1FMV A;  4BE1 A;  4DJA A;  2HPI A;  2IS4 A;  2LC2 A;  1TZL A;  3LL7 A;  3PSF A;  2V6E A;  4AYB A;  3VYS B;  3OYF A;  4RLF A;  3K4L A;  1MMA A;  3LSM A;  4BJT A;  2HVR A;  3QOE A;  2OV7 A;  4DGW B;  4C2U A;  4E7K A;  1Z3X A;  1SFK A;  2WAF A;  2E60 A;  3VYU B;  4F3Q A;  5JHF A;  4B47 A;  2AQE A;  5CQE A;  2E1M C;  3ZXS A;  2JA2 A;  3VSK A;  1UG0 A;  4MLO A;  4BQQ A;  2NOJ B;  2JSP A;  2LBF A;  1QHG A;  3I3L A;  4F92 B;  1SAU A;  2WA0 A;  3OYJ A;  2DJI A;  4YEL A;  3OYB A;  3MMY B;  3IUO A;  2R7W A;  2VJI A;  1PYV A;  1QU3 A;  2F6C A;  3L2V A;  3OYD A;  2M7A A;  3CJR B;  4BE0 A;  1UAA A;  4E7S A;  3PNT A;  2UWM A;  2CV0 A;  3BLY A;  3OR2 C;  3ZGK A;  2VAS A;  1X4O A;  3AL0 B;  3KEY A;  4CCN A;  1WJF A;  4C2T A;  1BR2 A;  4OWR B;  4OAY A;  3SYT A;  4XOP A;  2IXS A;  2ZXI A;  3OY9 A;  4NNJ A;  3H5A A;  2MYS A;  3CJQ B;  2X51 A;  2ELJ A;  2W00 A;  4XLH A;  1U0J A;  3OIQ A;  4HRI A;  3FKJ A;  4KT6 A;  3UNG C;  1DQU A;  3EUA A;  4PJM A;  3LSG A;  3OYE A;  2HNH A;  4F91 B;  3BCB A;  3IAS 2;  1E0E A;  2XF6 A;  4CA0 A;  2R7U A;  3BG7 A;  3W3C A;  3HG9 A;  2AQF A;  2KP6 A;  2RNG A;  4BEH A;  4LIT A;  4PK4 A;  1Y6I A;  1MMN A;  2M4G A;  1LFP A;  3K6G A;  4IKF A;  4XNF A;  4IZZ A;  2M3A A;  2HDW A;  3QYF A;  1V5G A;  1WJ5 A;  2XC7 A;  5LD2 C;  2HPM A;  2HVQ A;  4Y3O A;  4HST A;  2WB1 A;  4XR6 A;  2A6T A;  3K4B A;  2JVH A;  2KPM A;  3A1Y A;  2K3P A;  3S8P A;  1V5F A;  3M1C A;  4XL9 A;  3E0J B;  4PFO A;  3PSI A;  2VL8 A;  3OS2 A;  1X1B A;  2VLA A;  1FMW A;  2X1D A;  4CCK A;  4B3X A;  3AKZ A;  3K4N A;  4HNT A;  1DGW Y;  1BR4 A;  3KYL A;  3DKX A;  3K4M A;  2KZV A;  3C2H A;  3ONQ A;  4H4K C;  3N05 A;  2WAE A;  3L2U A;  2VB6 A;  2BW3 B;  2CUZ A;  3F9K A;  4P1W A;  4XLE A;  2W7N A;  2W1O A;  4AVZ A;  4ZDP A;  4BS9 A;  2R7Q A;  1D0Y A;  2LG4 A;  4P5O A;  3H9Q A;  5CPR B;  3OYH A;  1UEL B;  3SDB A;  2BOL A;  5HOO A;  3FHN A;  4CZC A;  2KLO A;  2V1N A;  3DPL C;  4N4N B;  2KDO A;  2XSJ C;  1G8X A;  3EUH C;  3PJR A;  3K70 D;  2VKD A;  2VJ4 A;  3VWB A;  4KIS A;  1ZEL A;  3MKW B;  2VQC A;  4G6T B;  1WJE A;  4OAZ A;  4ITV A;  2BVM A;  3GBG A;  4BGD A;  3DPU A;  3H0D A;  2KRH A;  4E4H A;  4XKC A;  3HL2 A;  4EAT A;  2HZD A;  3AL0 C;  2VPL A;  4R79 A;  3VSL A;  3L2W A;  4J00 A;  4ZYA A;  4LG3 A;  2R7T A;  3OS0 A;  3QOD A;  1D0X A;  4BJ5 C;  4CCJ A;  3L2Q A;  2QKM B;  3H5R A;  4IX7 A;  3OIP A;  4F93 B;  3G2B A;  4PJL A;  3H5N A;  2UUZ A;  3K4J A;  4IQ4 A;  3DTI A;  1N77 A;  4BDY A;  2E5N A;  2R4G A;  3RCO A;  1W36 D;  4PJN A;  4PSX A;  3K4C A;  3QYB A;  4QPQ A;  4DIQ A;  4D9J A;  3CF2 A;  1Z7L A;  3IAM 2;  4E7Z A;  1EA3 A;  3K10 A;  3ZQQ A;  4NC7 A;  4Y4R A;  3W2A A;  3S32 A;  1P9Q C;  3RTR A;  4XLA A;  1NG6 A;  4ZTF A;  1S9H A;  4HNU A;  3VYR B;  3C2G A;  4KIT B;  2K9M A;  4YEJ A;  2JUG A;  2CUJ A;  2IGK A;  2W4S A;  4CSW A;  1GLN A;  4XN0 A;  3H35 A;  2XF7 A;  2XDV A;  3TL4 X;  4BQN A;  3DU6 A;  4BJ6 C;  4E7J A;  2X1E A;  1T95 A;  3OYM A;  2PJR B;  3DKY A;  2MFZ A;  1LKX A;  2ZSI B;  4XN3 A;  3LMM A;  4HPQ A;  2IGM A;  3M8J A;  3OMY A;  3RQ4 A;  3S3M A;  2L9S A;  3D5R C;  4CUG A;  3MKY B;  4E7L A;  1OLT A;  2DCE A;  1TT0 A;  4ANJ A;  2VXD A;  2WAD A;  2X6W A;  4ZDO A;  1WJD A;  1D1C A;  2VQH A;  3W2W A;  2F5V A;  4BDZ A;  3ZRG A;  5FRM A;  2ZXH A;  2X85 A;  2WY8 Q;  2QKL B;  3BG6 A;  3SEQ A;  1MMG A;  2BVL A;  3RPU D;  2DT7 B;  4DOZ A;  1MND A;  3EPZ A;  5KNL A;  3DTE A;  5HNF A;  4NQW B;  2WBM A;  1N75 A;  5TGT A;  4ZJZ A;  2OUM A;  4GRI A;  2HVS A;  3AFH A;  3OYG A;  3UR3 C;  3L2R A;  4LIV A;  2PMZ A;  4QPO A;  2GOX B;  3PL8 A;  3OWT A;  2LOO A;  4XON A;  4BE2 A;  3CP8 A;  4PFP A;  2HQA A;  4XKV A;  5KHD A;  3BC8 A;  1HA8 A;  2LRE A;  3A2K A;  3LSI A;  2GOM A;  4B43 A;  2E5Z A;  4E7I A;  3H9J A;  1DGR M;  2R7O A;  3ZCO A;  4HEA 2;  2X6X A;  4XLC A;  2R7S A;  3A4C A;  3OYL A;  3OYI A;  2IS1 A;  1WJB A;  1X1A A;  2LBF B;  3RSN A;  1YX5 A;  1WJC A;  4BAC A;  1QHH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...