1WJAA

Solution structure of the n-terminal zn binding domain of hiv-1 integrase (d form), nmr, regularized mean structure
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Zn-binding protein
molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the N-terminal zinc binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 10
structure length 47
sequence length 47
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjaA00
1WJEA 1WJBA 3F9KA 4F3QA 1WJAA 1KONA 1WJCA 1LFPA 1MW7A 1K6YA 1WJDA 1WJFA 3HPHA 3HPGA 1E0EA
chains in the Genus database with same CATH superfamily
1UAAA 4RAZA 5IP7J 3JRDA 4RB0A 3QAHA 3UR3C 4M3BA 1D5VA 1B72B 1JT6A 2COBA 1S72I 1Z7LA 5E18F 2EFQA 2P0WA 3H35A 1V5FA 2QKLB 3BQZA 3RQ4A 4FASD 1ETQA 2F4MB 2Z99A 1D1BA 5ERIA 2RNGA 2ECBA 1VQ7I 4A3BJ 3HIFA 3CO7C 1IRGA 2WBMA 1JGGA 2ZJRF 4HF1A 4ZTFA 1EJ9A 1UHMA 1J75A 4IHYA 1IV6A 2KDOA 1MDMA 3RSNA 2ECCA 2MH9A 1OCPA 1X4PA 4IPAA 4KIFA 5BOXA 3KP2A 3OIQA 1IC8A 3JW4A 4EJTA 2XDVA 2K86A 1GHCA 3P5JA 4EEFG 2UXXA 1Y8QB 3ZMSA 4L5IA 1FC3A 1K6OA 3S3NA 2DMTA 3BJOA 1OCTC 4G7ZF 3REOA 3L2QA 3F6OA 2X0LA 1SVOA 1XSVA 1WHUA 3I4MJ 2OTLI 1U5TB 3GX4X 5K7FA 2M45A 1I6XA 3GVAA 1YS6A 5LFAA 5H20A 3E7LA 2F5VA 4J01A 2A68F 4IHTA 5F27A 1IN5A 3IP4B 5IOYA 3HOWJ 4G6QA 2E1CA 2DAOA 2FNAA 3M8EA 2GA2A 3FIWA 1KU7A 3GEZA 3MMYB 3SQNA 5L3FA 2EZHA 3OYMA 1YO5C 2QSHX 2GAUA 3Q9SA 4WF2A 2YX4A 2XGXA 3AG2H 4HF2A 4HF0A 2WB1N 4M9ZA 5DD8A 2GZWA 3PQJA 5F64A 1SMYF 3TW7A 2QZ8A 4UV8A 4KN7X 4PJLA 4BU2A 1I3QJ 2V26A 2HOAA 3RZOJ 2VKVA 3L2UA 3A01B 2LYCA 2IXSA 3TKYA 2LREA 2RN7A 3DF8A 2R0QC 2O61A 2D45A 4XIDA 4CDGA 3N97A 3IAS2 3IUOA 5D5XB 4E7IA 5K7HA 3EDPA 3IH4A 5E1XA 4LK1F 2Z16A 4KN4X 1BI2A 2KRFA 2X51A 3GFIA 2E60A 1S8NA 2P81A 1OFCX 1B4AA 1TWGJ 1KU9A 1XGSA 1X2MA 3ISPA 1Y1VJ 2PX9A 2O3FA 5HS7A 2DLLA 4HV5A 5KNLA 1ZN2A 1LPQA 3NRVA 2K7LA 3OYBA 2EBIA 4EM1A 3ABKH 2GIZA 4RAYA 1HW1A 1SFKA 5CVVA 1X2NA 2AXLA 3QYFA 1H0MA 3IWZA 3G73A 2ELKA 3ZQFA 2R7QA 2BHZA 3LOCA 3H9GA 2GOMA 3QP5A 3GZ6A 2DT5A 3ZOBA 4HNVA 3HOYJ 2DQRA 1LB2A 2A6TA 2R5YB 4A3DJ 2KDZA 3VODA 1JXSA 3O3KA 2IVMA 1JKQC 4MIMA 4EJVA 4BDZA 2HYFA 1JUPA 4RGXA 3DLLF 2EFNA 2ME6A 4PJMA 2O8KA 1YHQI 1XMXA 2R7DA 1DU6A 2M0MA 5CPRB 3DBRB 3PJRA 3UKGA 1KYZA 4F92B 3HSFA 2YS9A 5D5UB 2C6YA 1V4RA 4JYKA 4I76A 2CFXA 3QYBA 4XLNF 3DEEA 4OMYA 2PBIA 1KONA 4EGYA 4FHTA 2IT0A 1MIJA 4HA8A 2K3PA 3DQVC 3IV5A 5K1YA 1EH6A 3WU0A 1YITI 4WXCA 3EYYA 5J6XA 1ZTRA 1Z77A 4UVAA 3FHNA 2IGMA 1F5TA 2FOKA 5LRSA 4XMYA 4YRVA 4RBOA 2XPVA 2OQRA 1ON1A 3B6CA 3ZPLA 5GPCA 3M7GA 3DPUA 2OUMA 4PGGA 3KEOA 4FISA 3K2AA 4S05A 2ICWG 4Y4RA 2LC2A 3A0HC 3VEPA 1ULYA 4IQ4A 2LD5A 2VI6A 3ABUA 1FYKA 3E5XA 1RNLA 3S8PA 4CA0A 1PP7U 3R6SA 4OIRF 1HXDA 3K4BA 4BXFA 1SVMA 3RQIA 1XSXA 3IKVA 1ORKA 1R00A 3ZN0A 1ZG5A 5ICCA 1J0RA 1SFOJ 1U6GA 4KT5C 2MW8A 1S7EA 5BQTA 1U2WA 3CQZJ 5GP9A 4DJAA 4NDLA 3OOPA 2ZFUA 4XN0A 1ETOA 4ENMA 1JKOC 4FX0A 2L9VA 3LQRA 5E1ZB 2VJ4A 2E1NA 4A3FJ 4QLCU 2VIXA 4DQ2A 1A6QA 5J47A 4NNJA 2DTRA 1W4MA 4OIOF 4LITA 5DUKA 1R1VA 3HRTA 1Y0UA 3F6VA 1KU3A 3ZMZA 2ZSHB 5IP6A 2ZO4A 1BI1A 1U5TC 4UVBA 1ZHFA 4M3EA 3LA2A 4B3AA 1PP8F 1T56A 1HQCA 2FF4A 3R4KA 3JAMK 3ZQIA 3PNTA 2XHKA 1C0WA 2PMHA 3BG3A 3IL2A 4IOAF 3B02A 5IT9K 3WHCA 2Q1ZB 4BEHA 4A3MJ 2MYSA 3FXOA 4XR6A 5FKLA 1W36C 1E2XA 1G4DA 2HVRA 2MLKA 2DXIA 3BT9A 3FXQA 5FROA 1TL8A 3PFIA 3FMSA 2CUFA 1H88C 1HF0A 1WCMJ 4V2GA 1BJAA 2PG4A 3OSFA 3RCOA 3S1RJ 4BAYA 2L7FP 1QO0D 1E3OC 4MLOA 1Y1WJ 1I39A 4IOCF 5JI6A 2HOEA 2ISZA 3M3YJ 1Y39A 2E71A 1K7AA 4HEA2 4W97A 2ZSIB 2PLYA 4HLYA 4J00A 1FOKA 1JE8A 3HTUA 5KVRA 2LF7A 3BOQA 3S16J 2MC4A 3CC2I 2M8EA 4PJNA 1ZH5A 2LOOA 2M2EA 2W1OA 4R79A 5JHUA 5M5WJ 1R5ID 2CV1A 2O9LA 2M8GX 2CJJA 2CQQA 3A0BC 4F3QA 1Z6RA 3IKTA 5FKMA 2LBFA 2V6EA 4A5MA 1P4WA 3GZ5A 4XICA 3S3OA 2WC2A 3RKYA 2X6XA 3CC7I 3BJAA 3VSLA 5DEQA 2VJ5A 1XTAA 3S32A 4W1UA 1P9QC 1XGNA 1S3JA 4OIQF 3BQYA 2FNPA 2DK8A 3WG7H 1K4TA 3MZYA 3FM5A 3DEUA 3W3CA 4CYDA 2OTJI 1Z67A 5D8LB 3T8TA 3G1OA 1V54H 2COMA 1FT9A 2Z1DA 2VQCA 1LUJB 3PL8A 2NNYA 2KKOA 3K1MA 3DXJF 3FXLA 3DWLE 1E3HA 3SEZA 1U3EM 2LTPA 2QA4I 4RB3C 3OYEA 3CCYA 1KGSA 4ABZA 2X6OA 2EZLA 5BPIA 2M5WA 2XGDA 5EF6A 4RB1A 3CUQA 1I6HJ 4XRMA 4E6KG 3GTJJ 2QSGX 4Y15A 2EV5A 2W24A 2D1HA 4KITB 2R7VA 1UMQA 1W7PD 3MZ8A 1G8XA 1U8RA 1UB9A 1X1CA 3NEUA 2VKHA 2XV4S 3CMAI 3F8CA 4CZCA 4FCYA 2P4WA 2G9WA 2XPWA 2EV0A 3I4NJ 2HS5A 3ABTA 2IS4A 1ZQ3P 5L3CA 4M3GA 2EQRA 1ETWA 2BVMA 2DW4A 5E3NA 1MH3A 1BR2A 3F21A 4X0GA 3ASOH 1ZR2A 2BV6A 1WSUA 4KISA 1TW3A 3VPRA 1QQIA 2XRLA 2E1MB 1Z05A 2ELJA 3K2ZA 2IJLA 4Q48A 1CF7B 2E5ZA 4IRGA 4WX9A 3ZQGA 2NVTJ 3HDDA 4O3MA 2M0CA 2AQFA 2VJJA 3I71A 3MCZA 1U9NA 3GLLA 2DPDA 4EM0B 1Z1DA 1O3QA 3ZQCA 3LAPA 1LEBA 1FTZA 3AL0B 5B66C 1VQ4I 4HZFA 2PFBA 4ESJA 5E3LA 3G71I 4BKXA 1LDDA 4KT6A 4KDPA 1TQPA 1LJ9A 2HU9A 5GADJ 3RIRA 2ZMEB 2HR3A 1P6RA 2R7TA 4LJZF 4M9SA 3GYHX 1OMIA 2BYVE 4GGGA 1IXSB 3T8RA 3CP8A 1MMAA 5JR3A 2DBBA 1O3SA 1RZ4A 2L2OA 3BTLA 5BNGA 1WGXA 2NRAC 1T08B 3R0AA 4A6DA 1OYYA 2AHQA 1BL0A 1HOMA 1GXQA 1K78A 3HUGB 5ICGA 3TDZC 2Q2EA 3K10A 2O5RA 3JRAA 3CJTB 1ZELA 3HGYA 2WV1A 4OWRB 2LY1A 3C2BA 2NNNA 4AUXA 1DPUA 5HOOA 2ZC2A 3BWGA 2KIMA 1WFXA 5TGTA 3E6MA 3LA3A 1VQKI 2HOTA 4XK4A 1QPMA 2JA5J 3EUHC 2R7OA 3D0SA 4EVIA 4A3IJ 1MSFC 2L7KA 4F7ZA 1FSHA 3EUKL 2O0YA 5ICEA 1A31A 3PQKA 3M9AA 2EWNA 2R5YA 4BY1J 2P6SA 1O3TA 1T95A 5M5YJ 2MC3A 2HPMA 2DN0A 1BI3A 5GAEJ 3EQLF 3K1PA 2OBPA 4HV6A 1SMTA 2KT0A 2R5ZA 4AYBN 2BW3A 4HLXA 1JKRC 4CCKA 2R7XA 1G2HA 1JUSA 5LRRA 2QCOA 1VQ9I 4MEYF 4E7LA 4M3FA 1BA5A 1NH3A 2A6HF 4E7ZA 5F6FA 3CUOA 3GW2A 2Y9YA 3R0JA 2LKXA 2JA7J 2X85A 3TO7A 4ESBA 1A04A 2Y30A 2X4HA 3SZGA 2EK5A 2V79A 4IZZA 4XLCA 5C3EJ 1Z7UA 1YRNA 3FK7A 3DPLC 4P1WA 4GO1A 1NHAA 1MNMC 2YR2A 5K5OA 2K9LA 2F48A 5HDNA 4OIPF 3OYIA 3TBIA 3L7WA 3ZXSA 2IA1A 2WTEA 1T38A 3OYNA 3GBGA 4IF4A 3FXUA 2DMPA 3E5QA 3WTZA 3CC4I 3KYLA 4NC8A 5CQEA 1WJEA 4RAGA 3FXJA 5F0HA 1MBEA 2WA0A 5A2QK 4EQQA 4LG0B 4HOBA 4L9TA 3DBLB 3LAJA 1R71A 1FZPB 2WADA 4ZDLA 2FUG2 3KZIC 2VBZA 5LBQA 4L18B 1P4XA 1XN7A 4BBSJ 4CYCA 1EH8A 2VKEA 3ECHA 4BXUA 4G94A 1RKTA 5K5QA 2GA1A 5DM7F 1S7OA 2R7FA 3KIOA 2ZB9A 2BBYA 2X48A 4YIRX 4ZYHA 1R23A 3MD2A 1QA6A 1TC3C 1LE8A 4RGSA 4BJ6C 3L2CA 4A5NA 3VYUB 3LSMA 3KZZA 4BHBA 5E3OA 5EG0B 1JHHA 3HEFA 3HSRA 3FKJA 1E17A 4XM3A 1SD5A 2E1MC 1YX5A 4G6DA 2OAZA 1ZRDA 2V7FA 2ZJPF 2Q8KA 2DA5A 5EYRA 5F08A 3WGHA 3F0CA 4AVPA 2VB6A 1TQIA 3HHGA 5GPAA 1G3SA 4U0WA 4J19A 2HTJA 3CF2A 2E35A 4WWCA 3DKWA 4YFKF 1IN8A 3GTKJ 2QKMB 4D9JA 2Y48A 1GUUA 3E6BA 2XUBA 1T0FA 4M72A 3EUAA 3AKZA 2JRTA 2W25A 3V7SA 4I09A 3P9KA 2M3AA 2DA3A 3O2PE 4BBRJ 2ZMEC 1TP4A 3LQQA 4MTEA 4GRIA 3F8MA 4WK8F 1R58A 1WI9A 3HKZN 4G12A 4XLAA 4DGWB 1O7LA 1G3YA 1MJAA 5DCMB 1B9NA 1HW2A 2OPTA 1X58A 2VASA 5B1BH 1CGPA 2H6BA 2FD5A 3E1SA 3HM5A 2OCEA 2LP0A 2Q0OA 3BR2A 2KZVA 2A6EF 2UZKA 5M3MJ 1MGTA 2KIQA 3VSKA 4LG3A 1YX3A 1BBYA 4PUSA 1OKRA 3K69A 2PJRA 2YU3A 2A61A 3SYTA 2RV8A 5C4JJ 3ML6A 4KICA 3WU2C 3DU5A 2DCEA 1FP2A 4CICA 1RI7A 4XKWA 3JRBA 3FM3A 1U8BA 1DGWY 3K1NA 4ENJA 1WJ5A 5EDNA 2DO7A 1M1EB 4A2UA 5D5WB 4C3JJ 3HOSA 3GFLA 1W7PB 1ENHA 4XKCA 5BPDA 4UY8I 2GIVA 3OYHA 1B6AA 2DODA 2HNHA 3A02A 4II3A 1TT0A 1XG1A 4P9FA 4PJJA 3BTIA 1HKSA 1KQ9A 3KPHA 2CG4A 1SFEA 2KPMA 4GCVA 3PNYA 4NQWA 3J80K 2R7RA 2H94A 1QRYA 2F4OB 1ZLJA 5AIQA 2V6CA 2IP2A 2DFEA 1GDTA 2PJPA 1Q1HA 3NWTA 4FQGA 3KETA 3J7AY 3FBNB 2FXAA 2GXAA 3FHZA 1X19A 2XF7A 1OCOH 2A5YB 4YIIA 2JT1A 4CCNA 5LEJA 1RRJA 4HSTA 2DFIA 2FBHA 3OIPA 3RPUA 4UV9A 4XBFA 2QQBA 3CF5F 1UJ8A 3OYGA 2LR8A 1QZEA 2YPRA 1R7JA 4M71A 4ENKA 1ZAOA 3RZDJ 2L4AA 1VQMI 2F5EA 1N25A 4AWXB 1H9TA 5IT3A 4NC7A 2D2WA 2XKPA 2JSPA 3I64A 5FLMJ 4RLFA 4JQFA 1MSEC 5D5VB 2LLKA 1DQUA 4O5VA 2K9NA 2HQRA 5FLXK 2W57A 3DEWA 3ZQQA 2X1DA 5E8IA 3OL4A 3PO3J 4V2FA 2LDUA 1KU2A 3BTJA 4XSZF 3KE2A 4F91B 3RPUD 4XORA 1FMWA 4L5JA 2FOWA 3RTRA 1X1AA 2R7ZJ 2E2IJ 3HJEA 4P55A 1XX5A 1QNTA 4CO8A 3D5SC 4OU0A 4Q47A 5GAGJ 5JLWA 1CF7A 2A69F 1I27A 4MNUA 2Z2SB 1DGRM 1XCBA 2ID3A 4G7HF 2WAQA 3I0TA 2HOSA 3P9IA 2UUZA 3H3ZA 3Q5FA 2JMWA 2MSYA 2PMZA 3RKQA 5DDGA 2IEKA 2HI3A 2K9QA 4TV7A 1ZK8A 2G7UA 3DBHB 1UCRA 2JVGA 2CYYA 3Q0WA 1SFUA 1FBSA 4A12A 4IXAA 2E7WA 4I7HA 1VQPI 3HBLA 1SAUA 3IRRA 1MNDA 3GTLJ 2DA1A 1BIBA 3CCJI 5CLSA 2EV6A 2HKOA 4B44A 2ZXJA 2LF8A 1WH7A 1IUFA 2P5VA 1S5LC 5DTDA 1NK2P 1MZBA 1BI0A 1MBHA 3GTQJ 2CV0A 2LVSA 2QQ9A 5BMZA 1EH7A 1RETA 3TGNA 1W0UA 1A35A 1ZG3A 1P2FA 3HUGA 3V8JA 4C2MJ 3HG9A 1YFHA 3L00A 3TP0A 3ZQLA 4D5FA 1NG6A 4B47A 1YW8A 5CVRA 5L3GA 5JFRA 1V55H 4EGZA 2HDDA 2F5DA 3QODA 3GXOA 2VQGA 1PUFA 2FA5A 2PMUA 5DS9A 5HLHA 1HDDC 3MZHA 3OS2A 1L3LA 2L7MP 1R1UA 2N8GA 2IGOA 4B3XA 3JRFA 1OCCH 3SDGA 3IAM2 2NVYJ 3BR5A 5FO5A 4B4CA 1YQAA 1SVLA 4XRSG 1ZREA 3BZKA 2M4GA 5LGTA 1UG0A 3N05A 3BR0A 4BJ5C 2QBYA 2Z33A 1WI3A 4GYGA 4MFEA 1OYIA 1HW5A 2V1XA 3G3ZA 2KJBA 1YW9A 2IA2A 3I53A 2DA7A 1TBXA 3HGGA 3LSPA 3GMEA 2XSJC 4HDUA 2DPUA 3M4OJ 5HS8A 2JTVA 2ZNZA 2DYRH 3DP7A 3QQAA 1MKMA 1T98A 5FD5A 1H9GA 3V7RA 1IRXA 3JRGA 3DLAA 4RS8A 1RC9A 2FBKA 4UUTA 2DA4A 2CMPA 1JTYA 2V4JC 2HYJA 2B7EA 1D8JA 2XGCA 3WE3A 2YSRA 2HYGD 1D0XA 2UV1A 2ID6A 1ITYA 3CESA 3JAMZ 3BCAA 2QEXI 3WTXC 1IDZA 2EA4A 1D5YA 3CTAA 1J2XA 3FISA 3MKYB 2OD5A 3T0YA 5IT9Z 1E3PA 2RNJA 1X1DA 1XGMA 3OOUA 3HYIA 3NQOA 4PFOA 2VKDA 3PUFA 3VDXA 1T2KA 1YG2A 2L0KA 3HRUA 1UHSA 1USTA 4HYEA 3F23A 2ESHA 3AG3H 2MFZA 1V5GA 4UB6C 4LIVA 5CVUA 3J7ZI 4HDVA 3QPHA 4E7HA 2EIJH 3QU6A 4ZZLA 1HCRA 3CDLA 3LA7A 3U1DA 5EGOB 2BZTA 3CJRB 3J7AO 2QYOA 3I4PA 3HSEA 1OR7C 2DDAA 4O6JA 4AM3A 1YOVB 2V1DA 4IHWA 4UUSB 4ZYEA 4IKFA 4PSWA 1AU7A 4M6YA 1I3AA 3T5XA 3K4LA 2JZYA 4A3EJ 2CSOA 3FXMA 1XSDA 2GWRA 1IXRC 2A05A 1ETXA 1Y6IA 2K27A 3M8FA 3AG4H 4IEJA 2VQLA 2LKSA 3S2WA 3H5AA 4QPQA 1AWCA 2NOGA 4P9UA 4XRFA 5F0FA 5KHDA 2H6CA 3KP4A 3I56I 2YUSA 1IN4A 4LOCA 5LGNA 3I3LA 1WJBA 1HDPA 5ILUA 5FKOA 3H9JA 3CDHA 5E20A 2V9PA 3BG6A 3F72A 1I5ZA 3F8BA 4CHUA 3WTUC 4UVCA 2UWMA 1QVTA 3S93A 5EEAA 4BACA 5EZGA 3F22A 2ZXWH 5ILSA 3CD6I 3W6VA 3CMEI 3W6KB 3X2QH 4RM3A 3CDIA 3AAFA 2MGQA 1ZKGA 1O7FA 2TDXA 4C30A 1XGOA 2IA0A 3C2GA 3D5RC 3LSTA 4NC6A 1N75A 4UUVA 1R5GA 4M6XA 3F9KA 2DMUA 4LB5A 1JJ6C 2V9VA 2RREA 2DFFA 3ONQA 2E2HJ 1MNEA 4BGDA 1BW6A 4FE7A 3H3VK 2LSOA 1FMVA 1B72A 4A0ZA 3SEQA 1MH4A 4BE1A 1H89C 3BCBA 2XIGA 3E6DA 3JRHA 1IRFA 1Y0NA 2B9SA 1W5SA 1ERDA 5FFXA 1VQNI 2RC4A 3QP6A 2M87A 3MVPA 1NG7A 4X1EA 3H0GJ 4AIHA 5K5RA 3DPTA 1RUOA 4P96A 4QWQA 2JVHA 2H27A 5IYDJ 2LH9A 4I99C 1WJDA 5HNHA 4PJ0C 3C7JA 3D5LA 4B48A 1TNSA 2CUEA 3TDUC 3HZJA 2M34A 4BL0B 1MDMB 2JSCA 1YYVA 4XONA 1OPCA 2H1KA 2Y69H 3B6AA 2FMYA 2JN6A 3VB2A 3CCQI 1ZRCA 5B1AH 3K70D 1MW7A 2LRDA 4GFBA 1IF1A 4C2TA 2CRGA 1YLFA 3F8NA 3C1DA 4YG2F 3ABMH 2LFBA 3QWLA 4WXHA 4ZC3A 1XB4A 5TRDA 5F1JA 1FYLA 2IPQX 2H09A 3CLQA 2O7OA 4YFNF 1FWZA 2XPUA 3L1PA 4HW0A 2FJ1A 3GTMJ 1SD4A 4G8XA 3HC7A 2WV0A 4Y33A 3IWFA 5H6RA 1U5TA 3CP2A 1BC7C 4ESFA 1IUYA 2XB0X 1EF4A 3MWMA 4MEXF 2DFHA 3S3MA 1QU3A 2XF5A 2QVOA 1FPQA 3MKLA 3W2VA 4DYQA 3ZP5A 4AIJA 5B3SH 3OWTA 1T33A 2BGCA 4N4NB 5M5XJ 5KAIC 3MFKA 3OV8A 1R49A 5B5EC 1TWHJ 3Q0UA 3LMMA 4Y52J 4CH7A 2CGPA 2WWYA 1KZHA 3WTTC 5H6QA 2AXTC 3NWSA 3V42A 2LNBA 1Z9CA 1RKWA 3FDYA 3SXYA 2Y0SA 3ZRGA 3OS1A 3A01A 4ZYAA 4B8XA 2W7NA 4HNTA 2FMLA 2P5LC 2JUCA 4DIQA 3K4JA 2E34A 5CVJA 4R8HA 3CMYA 3L9FA 3T1BA 2ME0A 3I58A 2E2JJ 4DYRA 4BXXJ 1EV7A 2EFWA 3KFWX 2PN6A 1G3WA 5JLXA 5ED4A 1GXPA 2OU2A 1WJCA 1JUMA 3TP3A 4DBQA 1TZLA 2E36A 4A0XA 4IQJA 1QVUA 3TO9A 2HQNA 3CLOA 1ZYRF 3SZTA 3GTPJ 1IN6A 2KQRA 2TCTA 4EJOA 4EV0A 2FBIA 2Y2ZA 1B8IB 3MQ0A 4AC0A 3KP5A 4PCQA 3CCRI 2AO9A 3VYTB 4ON0A 2VUMJ 3V8LA 3ZQHA 1PUEE 3GO5A 2NVUB 3LSKA 2W84A 2FSWA 2DA2A 3BR3A 2MH2A 4HPQA 4PZJA 2I5UA 4ZYDA 3KZYA 4LIUA 4A93J 2M7AA 1FOYA 2BHYA 2JRMA 5CKTA 4F52A 3B73A 4OOIA 4BDYA 1VQ8I 2KRHA 1X3UA 1JJ8C 1SAXA 2OJED 2GOXB 1XMAA 1X4OA 4V19K 5L3BA 3JTGA 2EH3A 1RPWA 3O8GA 3FMQA 4ANJA 2CV2A 2DA6A 2ISYA 3HOXJ 1CQTA 1REPC 3ABLH 2GQQA 2RAEA 1KYWA 2VXDA 4EATA 4N9HA 4U7DA 3HRSA 3UNGC 4IJAA 3ERMA 3PSIA 2JPBA 1USSA 1ETKA 1LFPA 4MHGA 1IG7A 2VBYA 4XOPA 2R3SA 4HQEA 4XLPF 2LY9A 4U0YA 2RGVA 3KLNA 3AG1H 3V7CA 5L3EA 3K7AJ 2KL4A 4BH9A 4D7MA 1MJ9A 3ULQB 2HWVA 4BQNA 2CH0A 5JHFA 4AIDA 5J8CA 4B43A 5A2QZ 2IAIA 5E8GA 3S1MJ 1IRZA 3TEDA 4ITVA 4XLEA 2F2EA 4G6TB 5D4SA 4EJWA 4IHXA 2K9MA 2A5WA 2F5FA 3ZQ7A 3J81K 2VC1A 2E19A 2DTZA 4HQMA 4RM2A 5L3DA 2RKHA 2OA4A 1ZLKA 3MKWB 4HRIA 3BROA 4G7OF 5F1RA 5AIPA 2HEOA 2MLGA 4IX7A 4CCOA 2WB1A 3I54A 2KISA 1LVKA 4Y7NJ 1RIOH 4XN3A 4IHVA 1J5YA 1AA7A 2HXIA 4UNOA 4N4OB 4CGZA 2BXYA 2VOPA 3K0LA 5CJ9A 2QSFX 4A3GJ 3ZMTA 4ENNA 2Z9OA 1XCVA 2Z5UA 1MMNA 2W85A 3OYLA 1IN7A 1IW7F 1K61A 3DKXA 1GT0C 2X1EA 4G9YA 3WE2A 2LG4A 3KP3A 4MGRA 1YTYA 1W5CC 1I50J 3WHBA 3PUBA 2XB5A 3G1LA 3BPVA 1OCZH 4KNYA 4PSXA 4RA2A 3SJMA 2QQAA 2PQ8A 3LNQA 3W6JB 2H1LA 1F9NA 1SD7A 5EGOA 3KEQA 4BEHB 1VTNC 1FTTA 4U0VA 3KYCB 4QTRA 4Y17A 4M9XA 1KQ0A 1V5EA 2X6WA 3H92A 1R1TA 2BE5F 2ZJQF 1Z21A 4DYCA 1FIPA 1P4AA 3SFIA 1ZGAA 5CVIA 4U87A 3I5UA 3VYSB 1QHGA 2EILH 2P7VB 3HB9A 5FGMA 2EZKA 3RYRA 3ZR8X 5DUIA 2CFOA 4BS9A 3U9GA 2MG4A 1FX7A 2DU9A 3BTCA 1TWFJ 4L5EA 2M1BA 3BPXA 1FNNA 1D0ZA 1VF9A 3OY9A 1VQLI 3TQNA 3EUHA 4MQ9F 2Y31A 1VQOI 2M4KA 3K4NA 3CZ6A 4H0EA 3K4KA 1RR7A 4HG2A 1WJFA 2VLAA 1D1CA 3BY6A 2JQ7A 2DDBA 1EKEA 3OMYA 1V3FA 5J4YA 1ON2A 1FEXA 5JVTA 4MFDA 1R6RA 1RUNA 2LBFB 3M1EA 4YEJA 3O8HA 5FKKA 3JR9A 1BOBA 2CQKA 2E1OA 3DCFA 1Q1VA 1S9HA 3DFGA 5E3MA 2G0EA 3FMRA 2DI3A 5J1YA 2CO5A 3J80Z 1SEUA 2IS6A 1ZGJA 2IGKA 1MJBA 4UXNA 4I01A 4Y13A 2NAZA 2VPRA 1MD0A 1QBJA 5J4VA 4L0YB 4C9YA 4LLNA 1T39A 2XAUA 4I98B 1XD7A 1DUXC 4IVNA 2L9SA 2JPCA 2LY2A 1UZCA 4HBLA 1IGNA 1S6LA 2JA8J 1MBGA 2DT7B 3L2VA 4KMUX 2HFHA 2CQ7A 3ZMDA 3VWBA 1A6IA 2CW8A 3K4MA 4E4HA 3CUQB 1ZG1A 4WXDA 3G1MA 4ZDOA 2NOJB 4GDFA 1RR8C 5FRNA 3QPSA 5LHHA 1T8IA 5LHGA 1X1PA 3BDDA 4JK1X 3TL4X 2VT2A 5FLXZ 2R93J 3TO6A 2BXZA 3MKZA 2A3SA 3CO6C 3FZVA 1BC8C 3DV8A 1ETYA 3SFZA 3I59B 3MAJA 3LSJA 5DYMA 3CCEI 2CW0F 5DD4A 1J59A 3GTOJ 2XGEA 2KZGA 4Q4ZF 3RKWA 3IRQA 3S14J 4CCLA 4N9IA 2B63J 3PNVA 2Y0MA 3IC7A 3ZN1A 1QGPA 1R36A 5LD2C 2PI0A 3C3WA 1TW2A 2L7ZA 5D8KB 3E0JB 3KCCA 2CUJA 4UHTA 1HA8A 4EJUA 1POGA 2NVXJ 5E1WA 4XSXF 2MA3A 2ZNYA 3HRMA 2O6GE 2EA2A 5HNFA 3MEXA 1O4XA 4MQVA 1HLVA 2OF7A 3KP7A 1YW7A 4L9NA 2WAFA 2STWA 1Z0XA 4Z2YA 2PEXA 3COAC 1JGSA 4JOMA 1YE9A 5CYVA 1TLHB 4U88A 4D1QA 4M3DA 2BEOA 2XVCA 1GLNA 3LL7A 4PK4A 4XNFA 1AKHB 2K5CA 1PVEA 1G3TA 2V1NA 3Q0VA 4QSHA 5D6EA 4E7SA 4IO9F 2BY1A 1WH5A 2UXNA 3E5UA 2HDCA 1KQ8A 5E17F 2ZCWA 3H1CA 3HOTA 2HGCA 5IPAA 1BR4A 2P5KA 4KUMA 2CQNA 2QLZA 2CQXA 2D1VA 3DTEA 3U21A 3FWEA 1YIOA 5IOZA 2ZMEA 1Z3YA 5HDGA 4IRHA 2RQQA 5KCMA 2XAFA 2XKOA 4F55A 4LFUA 2IGNA 3E6CC 3GTGJ 4DZJA 5H2FC 2FX0A 4AD9A 4WCGA 3HXLA 1H8AC 3PIOF 5FRMA 1APLC 1K78B 4FX4A 2Q2EB 3WGIA 4HX7A 2RDPA 2J5PA 3P9CA 3AFHA 2EB7A 1B8IA 4FT8A 3Q3SA 2LKPA 3LFUA 5D4RA 1TWCJ 1F1ZA 1VNDA 3ESWB 1D0YA 4QIWN 3OR1C 2R7UA 2QUFA 3FXRA 1DP7P 2XC7A 4Q5SF 2Z3YA 4A69C 4QPOA 2IBDA 2RQPA 3U2RA 5GAHJ 3HL2A 2P8TA 1F43A 1B9MA 1O3RA 2F5CA 2R5ZB 3KX2A 1IDYA 1GVDA 3CCUI 2GLOA 3WTYC 2BW3B 5LEKA 5HS9A 5J8FA 4KA4A 1SC7A 1LVAA 3M8JA 3FX3A 3K6GA 1OLTA 2O03A 3DTKA 2P6TA 4JX6A 2KIUA 2ZBKA 4CCJA 3HPGA 5DM6F 4I6ZA 4HAMA 1BN5A 3R61A 1JI8A 2DMQA 3JRCA 2DYSH 2KIFA 4BQQA 2HVSA 2DOFA 3MN2A 1YRNB 2NYXA 4Y3OA 4YFXF 4ETSA 4HX8A 3R60A 4II2A 2I8DA 4DOZA 4BQAA 2ZXHA 1MMDA 2H8RA 2XSDC 3VFZA 1SANA 2YX7A 3K70C 1YJ9I 3S2HJ 1WJAA 3TW6A 1K6YA 2L3DA 4KJZA 3KP6A 2STTA 1DU0A 4FTHA 2XF6A 1IJWC 1Z91A 4NHJA 4S04A 4H4KC 3HOUJ 1JHFA 3CUQC 2QWWA 2BY3A 3A1YA 3OYCA 5JVGF 1T6SA 1U0JA 4K2EA 1U78A 1DDNA 3D1NI 1ZR4A 1LDJA 2VN2A 2TRTA 3FF5A 1GVJA 3HPHA 4GXOA 1YI2I 5C4XJ 4LG0A 5C44J 4L9JA 4DW6A 4P5OA 2HVQA 3C18A 1Y8RB 2B0LA 3O6BB 4A3CJ 2W00A 2JK3A 3GF2A 2CS3A 1ZGWA 3DKYA 1FOXA 4Z6YA 2L5QA 4NBQA 2IS1A 4CYCB 1BW5A 4LMYA 3JRIA 4CCMA 4A6EA 2K4BA 4EMSA 4AIKA 2NVQJ 2G7HA 2HZTA 1WWXA 1DPRA 1UHWA 2E7XA 4HSRA 1J09A 1AOYA 3FK6A 2Y75A 2X6YA 3RYPA 2VPLA 2DOEA 1GV2A 1LE8B 1KA8A 2K4JA 2NS8A 5EG0A 2FU4A 4LD5A 1FY7A 4A0YA 1FIAA 2WY7Q 4KFCA 1S29A 2CWEA 4IHSA 3QOEA 1YS7A 2HPIA 1O57A 3CMMA 3QOPA 2EFPA 1WPKA 1R5HA 4EM2A 3L2WA 3BG9A 3OYKA 2M30A 4MTDA 3BC8A 1YJNI 4CUGA 1QZYA 4DBRA 2WAQN 1L0OC 1D3YA 5HVQC 1FLIA 2PMZN 5CQGA 3RKXA 1LQ1A 2DJNA 5TJJA 2V1UA 5IP9J 4ZJZA 2E5NA 3QU3A 2W48A 4CSWA 1IXCA 2WY8Q 1MMGA 3BG7A 5EEHA 4OAYA 4JBAA 5BS6A 2MABA 5DCMA 1FSEA 3WTVC 1HKQA 2DK5A 4KIBA 3WODF 4AYBA 4HNUA 2K85A 3E3VA 3PM1A 2L9RA 3PO2J 2FEZA 1OYWA 3ZGKA 5LLQA 3IH2A 5J1UA 2EINH 2VOOA 3OSGA 3G4SI 4ZDPA 2NS7A 1YJWI 3SDBA 1JT0A 2FQ4A 2MD0A 1XMKA 2PJRB 2FRHA 3M07A 2K3FA 5IY5H 2VE8A 4HX4A 4A3JJ 1DP3A 1TNTA 4XLFA 1FJLA 2EFOA 4OINF 3OIOA 4FETA 5KAFC 4ASNA 5FB2A 3WG9A 4E7KA 2VODA 2VQHA 2XASA 4I2OA 3GFJA 2ZJ2A 3CJNA 1W7PA 2O8XA 2XAJA 3PFYA 4YIFA 3HOZJ 2X1CA 2M7BA 5GTIC 2M9HA 3PSFA 4NUBA 3H5RA 4BY7J 1B1BA 3EPZA 2IRFG 4C3HJ 4NQWB 3BLYA 3WGGA 3DTIA 1PYVA 4PDKA 2QF7A 2GXBA 1NK3P 1NTCA 3LFKA 5HLIA 4N0BA 3SZPA 4PGHA 2HQAA 3HHHA 4M73A 4M74A 1HKTA 4I0AA 3WTSC 3ZMVA 3ELKA 4XQFA 1WRJA 3LWFA 4YELA 3FKIJ 1F36A 2ZKZA 1OCRH 4BHCA 1D8KA 1J7KA 3LSHA 3L2RA 3S1NJ 1WKMA 4GYIA 2GXGA 3H0DA 5F0CA 2JA2A 4C2UA 5HLGA 2FE3A 4IRIA 3I59A 2A07F 2OV7A 2L4MA 3TMOA 5HODA 2Y9ZA 1VZ0A 3H9QA 6PAXA 1PDNC 1HC8A 3BZ6A 3I55I 5HLTA 3RPQA 2GM4A 1SFXA 4F93B 4BE2A 1OR7A 1B59A 1IZ1A 1UFMA 2K9SA 3H36A 1BOAA 2FQ3A 2KLOA 2EZIA 1X3WB 4RMNA 5GTHC 1UG2A 1AHDP 3JCUC 4I02A 4DZPA 1U9OA 1IAWA 3FXKA 2DOAA 4I0BA 1XC5A 2NXNB 3F3XA 2ADUA 1D1AA 4RAFA 3M1CA 1X3ZB 2LMDA 1FOWA 3H3UA 4XOTA 5DV5A 4D0PA 1G59A 4XKBA 3BG5A 3K9TA 4MO7A 1QZZA 3S2DJ 3ZCOA 2VONA 2ELHA 3KYDB 2VL8A 1QPIA 1AKHA 3HOVJ 4KMFA 3QPLA 2EJRA 1W36D 5ICFA 2L02A 3TOAA 2JJ7A 1HSTA 3W2AA 1I1SA 5LGUA 1TWAJ 5M3FJ 1VFCA 4FE4A 3VOEA 5HDKA 5AONA 1ZARA 3PIPF 3ERED 4BE0A 1FBUA 2F6CA 3HKZA 4LLLA 4AVZA 2AS5F 1LKXA 4B1RA 4M6VA 2KP6A 3GZNB 3EYIA 1BIAA 1BM9A 4E7JA 3OYJA 5D6FA 1GV5A 3LSRA 2R7WA 4DNCA 1XS9A 3IHUA 2HDWA 1X1BA 2ETHA 2VJIA 2GBYA 4BJTA 2CW7A 4BYYA 1P7IA 1ACIA 5FKNA 2QENA 2VT3A 3WU1B 4A3KJ 1WQ2A 9ANTA 2OC6A 1EA3A 1T0FC 4LGWA 2CUZA 4OMZA 2JWTA 3I9V2 3WTWC 4KIGA 1ONVA 4ZYGA 3HTSB 4ZZDA 1LFBA 3DU6A 3LSGA 3CCSI 1K83J 3A4CA 1MBFA 1OISA 3BZCA 4BQOA 2BY2A 1PUFB 1TQMA 3BR1A 4XRSA 1JKPC 2R7SA 3GFMA 2L01A 3ROUA 1IO2A 3QYEA 3TOBA 3CCMI 2HTSA 4L9VA 3A2KA 2R92J 2VBWA 1I1GA 2DT6A 3F8FA 1OJLA 5KK1A 1E0EA 2XROA 2L54A 3GLXA 2LK2A 3V8KA 2AQEA 2V9KA 5IYCJ 2ZFWA 2X9DA 5IYBJ 3L09A 1G6NA 2XAQA 2QBYB 2OQGA 2R4GA 3KLOA 1FBQA 1Z6TA 3IH3A 5K7ZA 3G2BA 2ACJA 3OS0A 3J81Z 3S17J 3G6EI 2VE9A 1LFUP 2DMNA 4ZTJA 1A36A 4R1HA 4LB6B 3W2WA 4X6AJ 1VQ6I 1MBKA 2KFDA 2VBXA 1F4KA 2JA6J 5E79C 3E97A 4B09A 1Y56A 2KJCA 1VQ5I 1N78A 3BJ6A 1OQYA 4RLQA 1W5TA 3JREA 2KMUA 1J9IA 2JUGA 3JSPA 1RESA 1MBJA 3C2HA 1YIJI 2MD5A 3VYRB 2J5OA 4RGUA 3H5NA 1BR1A 3JSOA 2QGUA 4RB2C 3CJQB 4S0HB 2XAGA 2EIMH 2RVCA 3NARA 2HKXA 5F04A 2HQ5A 2ZXIA 2QM3A 3QPTA 3KEYA 3OL3A 1IV8A 2OCCH 5EZHA 2MBFA 2CU7A 3P7NA 4U7BA 3S15J 2KHMA 5DCFA 3U1KA 1R4MB 1N77A 2L9NA 1P92A 4D5CA 2W82A 2YU9J 2I10A 5J40A 4LK0F 1Z3XA 1UELB 3Q9VA 4RGRA 2D5VA 4OAZA 4E70A 5FJ8J 4LLGF 1HBXG 4A3LJ 5ILVA 1ETVA 2IS2A 2NS0A 3ZMUA 5EJCA 2HXOA 4XLHA 2EPFA 2ESNA 2BY0A 2K02A 4JP0A 5FLVA 1TTYA 3ASNH 4IL6C 4BHPA 3CCVI 1P7JA 3NAUA 1R9TJ 3SHFA 4UUSA 1XDSA 2XRNA 4KYWA 3BR6A 4RDUA 2OZ6A 3LSIA 2EIKH 1R4NB 4BNCA 1FYMA 2DQLA 1WZ2A 1LNWA 4ZH4F 3N4MA 2KRCA 4C3IJ 1XPXA 1MMSA 2Y0SN 5J1RA 4JX4A 2XAHA 5LHIA 1VI0A 1S7AA 4NB5A 4AU7A 3GUDA 5TISC 5FFZA 4BUPA 2P7CB 3AL0C 3K4CA 3S1QJ 2H8WA 3OYAA 4XKVA 1XDUA 3OYDA 1W0TA 1LDKB 1STZA 1W1WE 1R22A 2DJIA 3OYFA 4CZZA 2OZUA 2W4SA 3RDIA 3QRFF 3CCLI 1PJRA 2IW5A 1FP1D 1HSJA 1BJZA 2VC0A 5J3LA 2F4IA 2K40A 2BVLA 3EETA 3GCMA 1K4SA 4D7NA 1JTXA 2HZDA 4L0ZB 3GWZA 1TT5B 4PFPA 4XL9A 4CXFA 5FD6A 1SD6A 3RI4A 5EEGA 1A5JA 1ODDA 1WVRA 2BOLA 1LEAA 3ECOA 3RJPA 2VXZA 3J7YJ 3V4GA 1QHHD 3JTHA 3FBIB 2QQ8A 3OR2C 4UB8C 1K79A 2WAEA 1ZRFA 3A03A 3BP8A 4JX5A
chains in the Genus database with same CATH topology
4BGDA 1UAAA 3KX2A 3UR3C 1FMVA 2BW3B 2BW3A 4CCKA 3SEQA 4BE1A 2R7XA 3BCBA 3M8JA 3K6GA 1ERDA 1OLTA 1Z7LA 4E7LA 3DTKA 3H35A 2P0WA 4E7ZA 1V5FA 2QKLB 3RQ4A 4FASD 4CCJA 1D1BA 3HPGA 1NG7A 2RNGA 1JI8A 2X85A 3DPTA 2WBMA 4BQQA 2JVHA 3SZGA 2LH9A 4IZZA 1WJDA 5HNHA 4XLCA 2HVSA 3D5LA 4B48A 4ZTFA 4Y3OA 4BL0B 2KDOA 3DPLC 4P1WA 4II2A 2I8DA 3RSNA 4DOZA 2ZXHA 4XONA 1MMDA 1X4PA 2K9LA 3OIQA 3K70C 1WJAA 2XDVA 3OYIA 3K70D 1MW7A 1K6YA 2LRDA 3TBIA 4KJZA 4C2TA 2XF6A 3ZXSA 4ZC3A 3OYNA 3GBGA 3S3NA 4H4KC 3A1YA 3OYCA 3L2QA 1U0JA 3KYLA 3HC7A 4NC8A 5CQEA 4Y33A 3CP2A 1WJEA 5LFAA 2F5VA 4J01A 2WA0A 3HPHA 3IP4B 4P5OA 3S3MA 2HVQA 1QU3A 2WADA 2XF5A 3W2VA 4ZDLA 2W00A 2FUG2 3MMYB 2CS3A 3OWTA 3DKYA 3OYMA 2L5QA 2IS1A 4N4NB 4CCMA 3LMMA 4CH7A 4HSRA 1J09A 3NWSA 2X6YA 4PJLA 4BU2A 2VPLA 3MD2A 2V26A 3V42A 4BJ6C 3VYUB 3FDYA 3LSMA 2LYCA 2IXSA 2Y0SA 3ZRGA 2LREA 3OS1A 4ZYAA 3L2UA 3FKJA 4XM3A 2W7NA 2E1MC 1YX5A 4HNTA 3IAS2 2WY7Q 3IUOA 4E7IA 2V7FA 3QOEA 4DIQA 3K4JA 2Z16A 2HPIA 2X51A 2E60A 3CMMA 2VB6A 1WJCA 4DBQA 1TZLA 3CF2A 4IQJA 3L2WA 3OYKA 3BC8A 5KNLA 2QKMB 4D9JA 2KQRA 4CUGA 4DBRA 3AKZA 3EUAA 3OYBA 5HVQC 5CQGA 2M3AA 4ZJZA 2E5NA 1SFKA 4GRIA 4CSWA 2WY8Q 1MMGA 3QYFA 3BG7A 4OAYA 3VYTB 4XLAA 4DGWB 2MABA 2R7QA 3LSKA 4HPQA 3H9GA 2GOMA 2VASA 4AYBA 4LIUA 4HNUA 2M7AA 3E1SA 2A6TA 3ZGKA 2KZVA 4BDZA 5CKTA 4F52A 4BDYA 4ZDPA 4PJMA 2KRHA 3VSKA 4LG3A 1YX3A 2M0MA 4PUSA 3SDBA 5CPRB 3PJRA 2MD0A 4F92B 2GOXB 2PJRB 2PJRA 1X4OA 3SYTA 1DP3A 3QYBA 4ANJA 2CV2A 3DU5A 4XLFA 3DEEA 1KONA 2DCEA 4FETA 4XKWA 2K3PA 3DQVC 4E7KA 2VXDA 4EATA 1DGWY 3UNGC 2VQHA 1WJ5A 3HOSA 3FHNA 2IGMA 3PSIA 3PFYA 4XMYA 4YRVA 4XKCA 1LFPA 2X1CA 2M7BA 3OYHA 3PSFA 2HNHA 4II3A 4PJJA 1TT0A 2HPMA 4NUBA 4XOPA 3DPUA 3H5RA 3EPZA 2KPMA 4NQWB 2OUMA 3BLYA 3PNYA 2R7RA 3DTIA 1PYVA 4Y4RA 2KL4A 2LC2A 4IQ4A 4BQNA 2CH0A 3NWTA 5JHFA 4B43A 3J7AY 3FBNB 3S8PA 4CA0A 1X19A 2XF7A 2HQAA 4ITVA 4CCNA 3K4BA 4XLEA 4HSTA 4BXFA 4XQFA 4YELA 3OIPA 4G6TB 2K9MA 2A5WA 3OYGA 3LSHA 4RM2A 3L2RA 3MKWB 4HRIA 3H0DA 4DJAA 2JA2A 4NC7A 2ZFUA 4XN0A 4IX7A 2JSPA 4CCOA 2WB1A 4C2UA 4RLFA 2OV7A 4JQFA 1LVKA 2VJ4A 4XN3A 3TMOA 2VIXA 1VZ0A 1AA7A 3H9QA 1DQUA 4N4OB 5HLTA 4NNJA 3ZQQA 2X1DA 4LITA 4F93B 1MMNA 3OL4A 3OYLA 4BE2A 4F91B 2ZSHB 3DKXA 3RPUD 4XORA 2KLOA 1FMWA 2X1EA 4RMNA 2LG4A 3RTRA 1X1AA 3PUBA 2DOAA 1D1AA 3D5SC 3M1CA 4PSXA 3PNTA 4XOTA 1G59A 4XKBA 3ZCOA 2Z2SB 1DGRM 2VL8A 2WAQA 4BEHB 2Q1ZB 4BEHA 2MYSA 4XR6A 2UUZA 1W36C 2PMZA 1V5EA 2X6WA 1W36D 2HVRA 2DXIA 3W2AA 5FROA 1Z21A 2JVGA 4BE0A 3HKZA 2F6CA 4U87A 4AVZA 3VYSB 1LKXA 1QHGA 3RCOA 2KP6A 1SAUA 3ZR8X 1MNDA 2CFOA 4BS9A 4MLOA 4E7JA 3OYJA 4B44A 2R7WA 1D0ZA 3OY9A 2HDWA 1X1BA 2VJIA 4BJTA 2CW7A 4HEA2 2ZSIB 2CV0A 2M4KA 4J00A 3K4NA 3CZ6A 2OC6A 3K4KA 1EA3A 1T0FC 4HG2A 1WJFA 2CUZA 2MC4A 2VLAA 3HG9A 1D1CA 3I9V2 4PJNA 2LOOA 1NG6A 3OMYA 3DU6A 3LSGA 2W1OA 4B47A 4R79A 2CV1A 3A4CA 1R6RA 3QODA 4F3QA 4BQOA 2VQGA 2LBFB 2LBFA 2V6EA 4YEJA 3S3OA 2X6XA 2R7SA 1BOBA 3VSLA 3OS2A 2VJ5A 1S9HA 3S32A 1P9QC 2IGOA 4B3XA 3IAM2 3QYEA 3A2KA 2DT6A 2IS6A 1E0EA 2IGKA 2M4GA 3W3CA 1UG0A 2AQEA 2V9KA 3N05A 4C9YA 3HL2A 2XAUA 4BJ5C 2Z1DA 2VQCA 2R4GA 3PL8A 2L9SA 2LY2A 3G2BA 3OS0A 3DWLE 3SEZA 2DT7B 3L2VA 3OYEA 3VWBA 4ZTJA 2XSJC 2CW8A 3K4MA 4E4HA 3W2WA 4ZDOA 2NOJB 4E6KG 5FRNA 1Y56A 1N78A 4RLQA 4KITB 2R7VA 3TL4X 2KMUA 2JUGA 1G8XA 3C2HA 3MKZA 1X1CA 1IRXA 2VKHA 3DLAA 3VYRB 4CZCA 3H5NA 1BR1A 2CMPA 2V4JC 3CJQB 2IS4A 1D0XA 2UV1A 2ZXIA 2BVMA 3KEYA 4CCLA 3PNVA 3CESA 3OL3A 3BCAA 5LD2C 1BR2A 3MKYB 4X0GA 4U7BA 1X1DA 2KHMA 3OOUA 4PFOA 3E0JB 2CUJA 2VKDA 3VDXA 1HA8A 1N77A 4KISA 2L9NA 2E1MB 2ELJA 2W82A 5HNFA 1Z3XA 1UELB 2MFZA 1V5GA 2E5ZA 4OAZA 4LIVA 2WAFA 4E7HA 2IS2A 4JOMA 1YE9A 4D1QA 4XLHA 2AQFA 1GLNA 2VJJA 3CJRB 3LL7A 4PK4A 4XNFA 2K5CA 1OR7C 2V1NA 4E7SA 3AL0B 3HOTA 4IKFA 1BR4A 4PSWA 3DTEA 3K4LA 4KT6A 3LSIA 2HU9A 3U21A 1Y6IA 1Z3YA 2R7TA 2VQLA 2RQQA 5KCMA 2KRCA 4F55A 3H5AA 4QPQA 2IGNA 3CP8A 1MMAA 5KHDA 2L2OA 4AU7A 2RREA 1WJBA 3I3LA 4BUPA 3AL0C 3HXLA 3K4CA 3H9JA 3OYAA 4XKVA 5FRMA 3OYDA 1LDKB 3HUGB 2Q2EB 3BG6A 3K10A 2DJIA 3OYFA 2UWMA 2W4SA 2O5RA 3S93A 4BACA 1PJRA 3AFHA 1ZELA 4OWRB 2LY1A 3LFUA 5HOOA 2F4IA 2BVLA 4RM3A 1WFXA 5TGTA 2HZDA 1D0YA 4PFPA 4XL9A 3OR1C 2R7UA 3EUHC 4C30A 2R7OA 3C2GA 2L7KA 2BOLA 3D5RC 2VXZA 3EUKL 1N75A 2XC7A 3F9KA 1QHHD 3FBIB 4QPOA 1T95A 3OR2C 2WAEA 3ONQA 1MNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJE A;  1WJB A;  3F9K A;  4F3Q A;  1WJA A;  1KON A;  1WJC A;  1LFP A;  1MW7 A;  1K6Y A;  1WJD A;  1WJF A;  3HPH A;  3HPG A;  1E0E A; 
#chains in the Genus database with same CATH topology
 1UAA A;  4RAZ A;  5IP7 J;  3JRD A;  4RB0 A;  3QAH A;  3UR3 C;  4M3B A;  1D5V A;  1B72 B;  1JT6 A;  2COB A;  1S72 I;  1Z7L A;  5E18 F;  2EFQ A;  2P0W A;  3H35 A;  1V5F A;  2QKL B;  3BQZ A;  3RQ4 A;  4FAS D;  1ETQ A;  2F4M B;  2Z99 A;  1D1B A;  5ERI A;  2RNG A;  2ECB A;  1VQ7 I;  4A3B J;  3HIF A;  3CO7 C;  1IRG A;  2WBM A;  1JGG A;  2ZJR F;  4HF1 A;  4ZTF A;  1EJ9 A;  1UHM A;  1J75 A;  4IHY A;  1IV6 A;  2KDO A;  1MDM A;  3RSN A;  2ECC A;  2MH9 A;  1OCP A;  1X4P A;  4IPA A;  4KIF A;  5BOX A;  3KP2 A;  3OIQ A;  1IC8 A;  3JW4 A;  4EJT A;  2XDV A;  2K86 A;  1GHC A;  3P5J A;  4EEF G;  2UXX A;  1Y8Q B;  3ZMS A;  4L5I A;  1FC3 A;  1K6O A;  3S3N A;  2DMT A;  3BJO A;  1OCT C;  4G7Z F;  3REO A;  3L2Q A;  3F6O A;  2X0L A;  1SVO A;  1XSV A;  1WHU A;  3I4M J;  2OTL I;  1U5T B;  3GX4 X;  5K7F A;  2M45 A;  1I6X A;  3GVA A;  1YS6 A;  5LFA A;  5H20 A;  3E7L A;  2F5V A;  4J01 A;  2A68 F;  4IHT A;  5F27 A;  1IN5 A;  3IP4 B;  5IOY A;  3HOW J;  4G6Q A;  2E1C A;  2DAO A;  2FNA A;  3M8E A;  2GA2 A;  3FIW A;  1KU7 A;  3GEZ A;  3MMY B;  3SQN A;  5L3F A;  2EZH A;  3OYM A;  1YO5 C;  2QSH X;  2GAU A;  3Q9S A;  4WF2 A;  2YX4 A;  2XGX A;  3AG2 H;  4HF2 A;  4HF0 A;  2WB1 N;  4M9Z A;  5DD8 A;  2GZW A;  3PQJ A;  5F64 A;  1SMY F;  3TW7 A;  2QZ8 A;  4UV8 A;  4KN7 X;  4PJL A;  4BU2 A;  1I3Q J;  2V26 A;  2HOA A;  3RZO J;  2VKV A;  3L2U A;  3A01 B;  2LYC A;  2IXS A;  3TKY A;  2LRE A;  2RN7 A;  3DF8 A;  2R0Q C;  2O61 A;  2D45 A;  4XID A;  4CDG A;  3N97 A;  3IAS 2;  3IUO A;  5D5X B;  4E7I A;  5K7H A;  3EDP A;  3IH4 A;  5E1X A;  4LK1 F;  2Z16 A;  4KN4 X;  1BI2 A;  2KRF A;  2X51 A;  3GFI A;  2E60 A;  1S8N A;  2P81 A;  1OFC X;  1B4A A;  1TWG J;  1KU9 A;  1XGS A;  1X2M A;  3ISP A;  1Y1V J;  2PX9 A;  2O3F A;  5HS7 A;  2DLL A;  4HV5 A;  5KNL A;  1ZN2 A;  1LPQ A;  3NRV A;  2K7L A;  3OYB A;  2EBI A;  4EM1 A;  3ABK H;  2GIZ A;  4RAY A;  1HW1 A;  1SFK A;  5CVV A;  1X2N A;  2AXL A;  3QYF A;  1H0M A;  3IWZ A;  3G73 A;  2ELK A;  3ZQF A;  2R7Q A;  2BHZ A;  3LOC A;  3H9G A;  2GOM A;  3QP5 A;  3GZ6 A;  2DT5 A;  3ZOB A;  4HNV A;  3HOY J;  2DQR A;  1LB2 A;  2A6T A;  2R5Y B;  4A3D J;  2KDZ A;  3VOD A;  1JXS A;  3O3K A;  2IVM A;  1JKQ C;  4MIM A;  4EJV A;  4BDZ A;  2HYF A;  1JUP A;  4RGX A;  3DLL F;  2EFN A;  2ME6 A;  4PJM A;  2O8K A;  1YHQ I;  1XMX A;  2R7D A;  1DU6 A;  2M0M A;  5CPR B;  3DBR B;  3PJR A;  3UKG A;  1KYZ A;  4F92 B;  3HSF A;  2YS9 A;  5D5U B;  2C6Y A;  1V4R A;  4JYK A;  4I76 A;  2CFX A;  3QYB A;  4XLN F;  3DEE A;  4OMY A;  2PBI A;  1KON A;  4EGY A;  4FHT A;  2IT0 A;  1MIJ A;  4HA8 A;  2K3P A;  3DQV C;  3IV5 A;  5K1Y A;  1EH6 A;  3WU0 A;  1YIT I;  4WXC A;  3EYY A;  5J6X A;  1ZTR A;  1Z77 A;  4UVA A;  3FHN A;  2IGM A;  1F5T A;  2FOK A;  5LRS A;  4XMY A;  4YRV A;  4RBO A;  2XPV A;  2OQR A;  1ON1 A;  3B6C A;  3ZPL A;  5GPC A;  3M7G A;  3DPU A;  2OUM A;  4PGG A;  3KEO A;  4FIS A;  3K2A A;  4S05 A;  2ICW G;  4Y4R A;  2LC2 A;  3A0H C;  3VEP A;  1ULY A;  4IQ4 A;  2LD5 A;  2VI6 A;  3ABU A;  1FYK A;  3E5X A;  1RNL A;  3S8P A;  4CA0 A;  1PP7 U;  3R6S A;  4OIR F;  1HXD A;  3K4B A;  4BXF A;  1SVM A;  3RQI A;  1XSX A;  3IKV A;  1ORK A;  1R00 A;  3ZN0 A;  1ZG5 A;  5ICC A;  1J0R A;  1SFO J;  1U6G A;  4KT5 C;  2MW8 A;  1S7E A;  5BQT A;  1U2W A;  3CQZ J;  5GP9 A;  4DJA A;  4NDL A;  3OOP A;  2ZFU A;  4XN0 A;  1ETO A;  4ENM A;  1JKO C;  4FX0 A;  2L9V A;  3LQR A;  5E1Z B;  2VJ4 A;  2E1N A;  4A3F J;  4QLC U;  2VIX A;  4DQ2 A;  1A6Q A;  5J47 A;  4NNJ A;  2DTR A;  1W4M A;  4OIO F;  4LIT A;  5DUK A;  1R1V A;  3HRT A;  1Y0U A;  3F6V A;  1KU3 A;  3ZMZ A;  2ZSH B;  5IP6 A;  2ZO4 A;  1BI1 A;  1U5T C;  4UVB A;  1ZHF A;  4M3E A;  3LA2 A;  4B3A A;  1PP8 F;  1T56 A;  1HQC A;  2FF4 A;  3R4K A;  3JAM K;  3ZQI A;  3PNT A;  2XHK A;  1C0W A;  2PMH A;  3BG3 A;  3IL2 A;  4IOA F;  3B02 A;  5IT9 K;  3WHC A;  2Q1Z B;  4BEH A;  4A3M J;  2MYS A;  3FXO A;  4XR6 A;  5FKL A;  1W36 C;  1E2X A;  1G4D A;  2HVR A;  2MLK A;  2DXI A;  3BT9 A;  3FXQ A;  5FRO A;  1TL8 A;  3PFI A;  3FMS A;  2CUF A;  1H88 C;  1HF0 A;  1WCM J;  4V2G A;  1BJA A;  2PG4 A;  3OSF A;  3RCO A;  3S1R J;  4BAY A;  2L7F P;  1QO0 D;  1E3O C;  4MLO A;  1Y1W J;  1I39 A;  4IOC F;  5JI6 A;  2HOE A;  2ISZ A;  3M3Y J;  1Y39 A;  2E71 A;  1K7A A;  4HEA 2;  4W97 A;  2ZSI B;  2PLY A;  4HLY A;  4J00 A;  1FOK A;  1JE8 A;  3HTU A;  5KVR A;  2LF7 A;  3BOQ A;  3S16 J;  2MC4 A;  3CC2 I;  2M8E A;  4PJN A;  1ZH5 A;  2LOO A;  2M2E A;  2W1O A;  4R79 A;  5JHU A;  5M5W J;  1R5I D;  2CV1 A;  2O9L A;  2M8G X;  2CJJ A;  2CQQ A;  3A0B C;  4F3Q A;  1Z6R A;  3IKT A;  5FKM A;  2LBF A;  2V6E A;  4A5M A;  1P4W A;  3GZ5 A;  4XIC A;  3S3O A;  2WC2 A;  3RKY A;  2X6X A;  3CC7 I;  3BJA A;  3VSL A;  5DEQ A;  2VJ5 A;  1XTA A;  3S32 A;  4W1U A;  1P9Q C;  1XGN A;  1S3J A;  4OIQ F;  3BQY A;  2FNP A;  2DK8 A;  3WG7 H;  1K4T A;  3MZY A;  3FM5 A;  3DEU A;  3W3C A;  4CYD A;  2OTJ I;  1Z67 A;  5D8L B;  3T8T A;  3G1O A;  1V54 H;  2COM A;  1FT9 A;  2Z1D A;  2VQC A;  1LUJ B;  3PL8 A;  2NNY A;  2KKO A;  3K1M A;  3DXJ F;  3FXL A;  3DWL E;  1E3H A;  3SEZ A;  1U3E M;  2LTP A;  2QA4 I;  4RB3 C;  3OYE A;  3CCY A;  1KGS A;  4ABZ A;  2X6O A;  2EZL A;  5BPI A;  2M5W A;  2XGD A;  5EF6 A;  4RB1 A;  3CUQ A;  1I6H J;  4XRM A;  4E6K G;  3GTJ J;  2QSG X;  4Y15 A;  2EV5 A;  2W24 A;  2D1H A;  4KIT B;  2R7V A;  1UMQ A;  1W7P D;  3MZ8 A;  1G8X A;  1U8R A;  1UB9 A;  1X1C A;  3NEU A;  2VKH A;  2XV4 S;  3CMA I;  3F8C A;  4CZC A;  4FCY A;  2P4W A;  2G9W A;  2XPW A;  2EV0 A;  3I4N J;  2HS5 A;  3ABT A;  2IS4 A;  1ZQ3 P;  5L3C A;  4M3G A;  2EQR A;  1ETW A;  2BVM A;  2DW4 A;  5E3N A;  1MH3 A;  1BR2 A;  3F21 A;  4X0G A;  3ASO H;  1ZR2 A;  2BV6 A;  1WSU A;  4KIS A;  1TW3 A;  3VPR A;  1QQI A;  2XRL A;  2E1M B;  1Z05 A;  2ELJ A;  3K2Z A;  2IJL A;  4Q48 A;  1CF7 B;  2E5Z A;  4IRG A;  4WX9 A;  3ZQG A;  2NVT J;  3HDD A;  4O3M A;  2M0C A;  2AQF A;  2VJJ A;  3I71 A;  3MCZ A;  1U9N A;  3GLL A;  2DPD A;  4EM0 B;  1Z1D A;  1O3Q A;  3ZQC A;  3LAP A;  1LEB A;  1FTZ A;  3AL0 B;  5B66 C;  1VQ4 I;  4HZF A;  2PFB A;  4ESJ A;  5E3L A;  3G71 I;  4BKX A;  1LDD A;  4KT6 A;  4KDP A;  1TQP A;  1LJ9 A;  2HU9 A;  5GAD J;  3RIR A;  2ZME B;  2HR3 A;  1P6R A;  2R7T A;  4LJZ F;  4M9S A;  3GYH X;  1OMI A;  2BYV E;  4GGG A;  1IXS B;  3T8R A;  3CP8 A;  1MMA A;  5JR3 A;  2DBB A;  1O3S A;  1RZ4 A;  2L2O A;  3BTL A;  5BNG A;  1WGX A;  2NRA C;  1T08 B;  3R0A A;  4A6D A;  1OYY A;  2AHQ A;  1BL0 A;  1HOM A;  1GXQ A;  1K78 A;  3HUG B;  5ICG A;  3TDZ C;  2Q2E A;  3K10 A;  2O5R A;  3JRA A;  3CJT B;  1ZEL A;  3HGY A;  2WV1 A;  4OWR B;  2LY1 A;  3C2B A;  2NNN A;  4AUX A;  1DPU A;  5HOO A;  2ZC2 A;  3BWG A;  2KIM A;  1WFX A;  5TGT A;  3E6M A;  3LA3 A;  1VQK I;  2HOT A;  4XK4 A;  1QPM A;  2JA5 J;  3EUH C;  2R7O A;  3D0S A;  4EVI A;  4A3I J;  1MSF C;  2L7K A;  4F7Z A;  1FSH A;  3EUK L;  2O0Y A;  5ICE A;  1A31 A;  3PQK A;  3M9A A;  2EWN A;  2R5Y A;  4BY1 J;  2P6S A;  1O3T A;  1T95 A;  5M5Y J;  2MC3 A;  2HPM A;  2DN0 A;  1BI3 A;  5GAE J;  3EQL F;  3K1P A;  2OBP A;  4HV6 A;  1SMT A;  2KT0 A;  2R5Z A;  4AYB N;  2BW3 A;  4HLX A;  1JKR C;  4CCK A;  2R7X A;  1G2H A;  1JUS A;  5LRR A;  2QCO A;  1VQ9 I;  4MEY F;  4E7L A;  4M3F A;  1BA5 A;  1NH3 A;  2A6H F;  4E7Z A;  5F6F A;  3CUO A;  3GW2 A;  2Y9Y A;  3R0J A;  2LKX A;  2JA7 J;  2X85 A;  3TO7 A;  4ESB A;  1A04 A;  2Y30 A;  2X4H A;  3SZG A;  2EK5 A;  2V79 A;  4IZZ A;  4XLC A;  5C3E J;  1Z7U A;  1YRN A;  3FK7 A;  3DPL C;  4P1W A;  4GO1 A;  1NHA A;  1MNM C;  2YR2 A;  5K5O A;  2K9L A;  2F48 A;  5HDN A;  4OIP F;  3OYI A;  3TBI A;  3L7W A;  3ZXS A;  2IA1 A;  2WTE A;  1T38 A;  3OYN A;  3GBG A;  4IF4 A;  3FXU A;  2DMP A;  3E5Q A;  3WTZ A;  3CC4 I;  3KYL A;  4NC8 A;  5CQE A;  1WJE A;  4RAG A;  3FXJ A;  5F0H A;  1MBE A;  2WA0 A;  5A2Q K;  4EQQ A;  4LG0 B;  4HOB A;  4L9T A;  3DBL B;  3LAJ A;  1R71 A;  1FZP B;  2WAD A;  4ZDL A;  2FUG 2;  3KZI C;  2VBZ A;  5LBQ A;  4L18 B;  1P4X A;  1XN7 A;  4BBS J;  4CYC A;  1EH8 A;  2VKE A;  3ECH A;  4BXU A;  4G94 A;  1RKT A;  5K5Q A;  2GA1 A;  5DM7 F;  1S7O A;  2R7F A;  3KIO A;  2ZB9 A;  2BBY A;  2X48 A;  4YIR X;  4ZYH A;  1R23 A;  3MD2 A;  1QA6 A;  1TC3 C;  1LE8 A;  4RGS A;  4BJ6 C;  3L2C A;  4A5N A;  3VYU B;  3LSM A;  3KZZ A;  4BHB A;  5E3O A;  5EG0 B;  1JHH A;  3HEF A;  3HSR A;  3FKJ A;  1E17 A;  4XM3 A;  1SD5 A;  2E1M C;  1YX5 A;  4G6D A;  2OAZ A;  1ZRD A;  2V7F A;  2ZJP F;  2Q8K A;  2DA5 A;  5EYR A;  5F08 A;  3WGH A;  3F0C A;  4AVP A;  2VB6 A;  1TQI A;  3HHG A;  5GPA A;  1G3S A;  4U0W A;  4J19 A;  2HTJ A;  3CF2 A;  2E35 A;  4WWC A;  3DKW A;  4YFK F;  1IN8 A;  3GTK J;  2QKM B;  4D9J A;  2Y48 A;  1GUU A;  3E6B A;  2XUB A;  1T0F A;  4M72 A;  3EUA A;  3AKZ A;  2JRT A;  2W25 A;  3V7S A;  4I09 A;  3P9K A;  2M3A A;  2DA3 A;  3O2P E;  4BBR J;  2ZME C;  1TP4 A;  3LQQ A;  4MTE A;  4GRI A;  3F8M A;  4WK8 F;  1R58 A;  1WI9 A;  3HKZ N;  4G12 A;  4XLA A;  4DGW B;  1O7L A;  1G3Y A;  1MJA A;  5DCM B;  1B9N A;  1HW2 A;  2OPT A;  1X58 A;  2VAS A;  5B1B H;  1CGP A;  2H6B A;  2FD5 A;  3E1S A;  3HM5 A;  2OCE A;  2LP0 A;  2Q0O A;  3BR2 A;  2KZV A;  2A6E F;  2UZK A;  5M3M J;  1MGT A;  2KIQ A;  3VSK A;  4LG3 A;  1YX3 A;  1BBY A;  4PUS A;  1OKR A;  3K69 A;  2PJR A;  2YU3 A;  2A61 A;  3SYT A;  2RV8 A;  5C4J J;  3ML6 A;  4KIC A;  3WU2 C;  3DU5 A;  2DCE A;  1FP2 A;  4CIC A;  1RI7 A;  4XKW A;  3JRB A;  3FM3 A;  1U8B A;  1DGW Y;  3K1N A;  4ENJ A;  1WJ5 A;  5EDN A;  2DO7 A;  1M1E B;  4A2U A;  5D5W B;  4C3J J;  3HOS A;  3GFL A;  1W7P B;  1ENH A;  4XKC A;  5BPD A;  4UY8 I;  2GIV A;  3OYH A;  1B6A A;  2DOD A;  2HNH A;  3A02 A;  4II3 A;  1TT0 A;  1XG1 A;  4P9F A;  4PJJ A;  3BTI A;  1HKS A;  1KQ9 A;  3KPH A;  2CG4 A;  1SFE A;  2KPM A;  4GCV A;  3PNY A;  4NQW A;  3J80 K;  2R7R A;  2H94 A;  1QRY A;  2F4O B;  1ZLJ A;  5AIQ A;  2V6C A;  2IP2 A;  2DFE A;  1GDT A;  2PJP A;  1Q1H A;  3NWT A;  4FQG A;  3KET A;  3J7A Y;  3FBN B;  2FXA A;  2GXA A;  3FHZ A;  1X19 A;  2XF7 A;  1OCO H;  2A5Y B;  4YII A;  2JT1 A;  4CCN A;  5LEJ A;  1RRJ A;  4HST A;  2DFI A;  2FBH A;  3OIP A;  3RPU A;  4UV9 A;  4XBF A;  2QQB A;  3CF5 F;  1UJ8 A;  3OYG A;  2LR8 A;  1QZE A;  2YPR A;  1R7J A;  4M71 A;  4ENK A;  1ZAO A;  3RZD J;  2L4A A;  1VQM I;  2F5E A;  1N25 A;  4AWX B;  1H9T A;  5IT3 A;  4NC7 A;  2D2W A;  2XKP A;  2JSP A;  3I64 A;  5FLM J;  4RLF A;  4JQF A;  1MSE C;  5D5V B;  2LLK A;  1DQU A;  4O5V A;  2K9N A;  2HQR A;  5FLX K;  2W57 A;  3DEW A;  3ZQQ A;  2X1D A;  5E8I A;  3OL4 A;  3PO3 J;  4V2F A;  2LDU A;  1KU2 A;  3BTJ A;  4XSZ F;  3KE2 A;  4F91 B;  3RPU D;  4XOR A;  1FMW A;  4L5J A;  2FOW A;  3RTR A;  1X1A A;  2R7Z J;  2E2I J;  3HJE A;  4P55 A;  1XX5 A;  1QNT A;  4CO8 A;  3D5S C;  4OU0 A;  4Q47 A;  5GAG J;  5JLW A;  1CF7 A;  2A69 F;  1I27 A;  4MNU A;  2Z2S B;  1DGR M;  1XCB A;  2ID3 A;  4G7H F;  2WAQ A;  3I0T A;  2HOS A;  3P9I A;  2UUZ A;  3H3Z A;  3Q5F A;  2JMW A;  2MSY A;  2PMZ A;  3RKQ A;  5DDG A;  2IEK A;  2HI3 A;  2K9Q A;  4TV7 A;  1ZK8 A;  2G7U A;  3DBH B;  1UCR A;  2JVG A;  2CYY A;  3Q0W A;  1SFU A;  1FBS A;  4A12 A;  4IXA A;  2E7W A;  4I7H A;  1VQP I;  3HBL A;  1SAU A;  3IRR A;  1MND A;  3GTL J;  2DA1 A;  1BIB A;  3CCJ I;  5CLS A;  2EV6 A;  2HKO A;  4B44 A;  2ZXJ A;  2LF8 A;  1WH7 A;  1IUF A;  2P5V A;  1S5L C;  5DTD A;  1NK2 P;  1MZB A;  1BI0 A;  1MBH A;  3GTQ J;  2CV0 A;  2LVS A;  2QQ9 A;  5BMZ A;  1EH7 A;  1RET A;  3TGN A;  1W0U A;  1A35 A;  1ZG3 A;  1P2F A;  3HUG A;  3V8J A;  4C2M J;  3HG9 A;  1YFH A;  3L00 A;  3TP0 A;  3ZQL A;  4D5F A;  1NG6 A;  4B47 A;  1YW8 A;  5CVR A;  5L3G A;  5JFR A;  1V55 H;  4EGZ A;  2HDD A;  2F5D A;  3QOD A;  3GXO A;  2VQG A;  1PUF A;  2FA5 A;  2PMU A;  5DS9 A;  5HLH A;  1HDD C;  3MZH A;  3OS2 A;  1L3L A;  2L7M P;  1R1U A;  2N8G A;  2IGO A;  4B3X A;  3JRF A;  1OCC H;  3SDG A;  3IAM 2;  2NVY J;  3BR5 A;  5FO5 A;  4B4C A;  1YQA A;  1SVL A;  4XRS G;  1ZRE A;  3BZK A;  2M4G A;  5LGT A;  1UG0 A;  3N05 A;  3BR0 A;  4BJ5 C;  2QBY A;  2Z33 A;  1WI3 A;  4GYG A;  4MFE A;  1OYI A;  1HW5 A;  2V1X A;  3G3Z A;  2KJB A;  1YW9 A;  2IA2 A;  3I53 A;  2DA7 A;  1TBX A;  3HGG A;  3LSP A;  3GME A;  2XSJ C;  4HDU A;  2DPU A;  3M4O J;  5HS8 A;  2JTV A;  2ZNZ A;  2DYR H;  3DP7 A;  3QQA A;  1MKM A;  1T98 A;  5FD5 A;  1H9G A;  3V7R A;  1IRX A;  3JRG A;  3DLA A;  4RS8 A;  1RC9 A;  2FBK A;  4UUT A;  2DA4 A;  2CMP A;  1JTY A;  2V4J C;  2HYJ A;  2B7E A;  1D8J A;  2XGC A;  3WE3 A;  2YSR A;  2HYG D;  1D0X A;  2UV1 A;  2ID6 A;  1ITY A;  3CES A;  3JAM Z;  3BCA A;  2QEX I;  3WTX C;  1IDZ A;  2EA4 A;  1D5Y A;  3CTA A;  1J2X A;  3FIS A;  3MKY B;  2OD5 A;  3T0Y A;  5IT9 Z;  1E3P A;  2RNJ A;  1X1D A;  1XGM A;  3OOU A;  3HYI A;  3NQO A;  4PFO A;  2VKD A;  3PUF A;  3VDX A;  1T2K A;  1YG2 A;  2L0K A;  3HRU A;  1UHS A;  1UST A;  4HYE A;  3F23 A;  2ESH A;  3AG3 H;  2MFZ A;  1V5G A;  4UB6 C;  4LIV A;  5CVU A;  3J7Z I;  4HDV A;  3QPH A;  4E7H A;  2EIJ H;  3QU6 A;  4ZZL A;  1HCR A;  3CDL A;  3LA7 A;  3U1D A;  5EGO B;  2BZT A;  3CJR B;  3J7A O;  2QYO A;  3I4P A;  3HSE A;  1OR7 C;  2DDA A;  4O6J A;  4AM3 A;  1YOV B;  2V1D A;  4IHW A;  4UUS B;  4ZYE A;  4IKF A;  4PSW A;  1AU7 A;  4M6Y A;  1I3A A;  3T5X A;  3K4L A;  2JZY A;  4A3E J;  2CSO A;  3FXM A;  1XSD A;  2GWR A;  1IXR C;  2A05 A;  1ETX A;  1Y6I A;  2K27 A;  3M8F A;  3AG4 H;  4IEJ A;  2VQL A;  2LKS A;  3S2W A;  3H5A A;  4QPQ A;  1AWC A;  2NOG A;  4P9U A;  4XRF A;  5F0F A;  5KHD A;  2H6C A;  3KP4 A;  3I56 I;  2YUS A;  1IN4 A;  4LOC A;  5LGN A;  3I3L A;  1WJB A;  1HDP A;  5ILU A;  5FKO A;  3H9J A;  3CDH A;  5E20 A;  2V9P A;  3BG6 A;  3F72 A;  1I5Z A;  3F8B A;  4CHU A;  3WTU C;  4UVC A;  2UWM A;  1QVT A;  3S93 A;  5EEA A;  4BAC A;  5EZG A;  3F22 A;  2ZXW H;  5ILS A;  3CD6 I;  3W6V A;  3CME I;  3W6K B;  3X2Q H;  4RM3 A;  3CDI A;  3AAF A;  2MGQ A;  1ZKG A;  1O7F A;  2TDX A;  4C30 A;  1XGO A;  2IA0 A;  3C2G A;  3D5R C;  3LST A;  4NC6 A;  1N75 A;  4UUV A;  1R5G A;  4M6X A;  3F9K A;  2DMU A;  4LB5 A;  1JJ6 C;  2V9V A;  2RRE A;  2DFF A;  3ONQ A;  2E2H J;  1MNE A;  4BGD A;  1BW6 A;  4FE7 A;  3H3V K;  2LSO A;  1FMV A;  1B72 A;  4A0Z A;  3SEQ A;  1MH4 A;  4BE1 A;  1H89 C;  3BCB A;  2XIG A;  3E6D A;  3JRH A;  1IRF A;  1Y0N A;  2B9S A;  1W5S A;  1ERD A;  5FFX A;  1VQN I;  2RC4 A;  3QP6 A;  2M87 A;  3MVP A;  1NG7 A;  4X1E A;  3H0G J;  4AIH A;  5K5R A;  3DPT A;  1RUO A;  4P96 A;  4QWQ A;  2JVH A;  2H27 A;  5IYD J;  2LH9 A;  4I99 C;  1WJD A;  5HNH A;  4PJ0 C;  3C7J A;  3D5L A;  4B48 A;  1TNS A;  2CUE A;  3TDU C;  3HZJ A;  2M34 A;  4BL0 B;  1MDM B;  2JSC A;  1YYV A;  4XON A;  1OPC A;  2H1K A;  2Y69 H;  3B6A A;  2FMY A;  2JN6 A;  3VB2 A;  3CCQ I;  1ZRC A;  5B1A H;  3K70 D;  1MW7 A;  2LRD A;  4GFB A;  1IF1 A;  4C2T A;  2CRG A;  1YLF A;  3F8N A;  3C1D A;  4YG2 F;  3ABM H;  2LFB A;  3QWL A;  4WXH A;  4ZC3 A;  1XB4 A;  5TRD A;  5F1J A;  1FYL A;  2IPQ X;  2H09 A;  3CLQ A;  2O7O A;  4YFN F;  1FWZ A;  2XPU A;  3L1P A;  4HW0 A;  2FJ1 A;  3GTM J;  1SD4 A;  4G8X A;  3HC7 A;  2WV0 A;  4Y33 A;  3IWF A;  5H6R A;  1U5T A;  3CP2 A;  1BC7 C;  4ESF A;  1IUY A;  2XB0 X;  1EF4 A;  3MWM A;  4MEX F;  2DFH A;  3S3M A;  1QU3 A;  2XF5 A;  2QVO A;  1FPQ A;  3MKL A;  3W2V A;  4DYQ A;  3ZP5 A;  4AIJ A;  5B3S H;  3OWT A;  1T33 A;  2BGC A;  4N4N B;  5M5X J;  5KAI C;  3MFK A;  3OV8 A;  1R49 A;  5B5E C;  1TWH J;  3Q0U A;  3LMM A;  4Y52 J;  4CH7 A;  2CGP A;  2WWY A;  1KZH A;  3WTT C;  5H6Q A;  2AXT C;  3NWS A;  3V42 A;  2LNB A;  1Z9C A;  1RKW A;  3FDY A;  3SXY A;  2Y0S A;  3ZRG A;  3OS1 A;  3A01 A;  4ZYA A;  4B8X A;  2W7N A;  4HNT A;  2FML A;  2P5L C;  2JUC A;  4DIQ A;  3K4J A;  2E34 A;  5CVJ A;  4R8H A;  3CMY A;  3L9F A;  3T1B A;  2ME0 A;  3I58 A;  2E2J J;  4DYR A;  4BXX J;  1EV7 A;  2EFW A;  3KFW X;  2PN6 A;  1G3W A;  5JLX A;  5ED4 A;  1GXP A;  2OU2 A;  1WJC A;  1JUM A;  3TP3 A;  4DBQ A;  1TZL A;  2E36 A;  4A0X A;  4IQJ A;  1QVU A;  3TO9 A;  2HQN A;  3CLO A;  1ZYR F;  3SZT A;  3GTP J;  1IN6 A;  2KQR A;  2TCT A;  4EJO A;  4EV0 A;  2FBI A;  2Y2Z A;  1B8I B;  3MQ0 A;  4AC0 A;  3KP5 A;  4PCQ A;  3CCR I;  2AO9 A;  3VYT B;  4ON0 A;  2VUM J;  3V8L A;  3ZQH A;  1PUE E;  3GO5 A;  2NVU B;  3LSK A;  2W84 A;  2FSW A;  2DA2 A;  3BR3 A;  2MH2 A;  4HPQ A;  4PZJ A;  2I5U A;  4ZYD A;  3KZY A;  4LIU A;  4A93 J;  2M7A A;  1FOY A;  2BHY A;  2JRM A;  5CKT A;  4F52 A;  3B73 A;  4OOI A;  4BDY A;  1VQ8 I;  2KRH A;  1X3U A;  1JJ8 C;  1SAX A;  2OJE D;  2GOX B;  1XMA A;  1X4O A;  4V19 K;  5L3B A;  3JTG A;  2EH3 A;  1RPW A;  3O8G A;  3FMQ A;  4ANJ A;  2CV2 A;  2DA6 A;  2ISY A;  3HOX J;  1CQT A;  1REP C;  3ABL H;  2GQQ A;  2RAE A;  1KYW A;  2VXD A;  4EAT A;  4N9H A;  4U7D A;  3HRS A;  3UNG C;  4IJA A;  3ERM A;  3PSI A;  2JPB A;  1USS A;  1ETK A;  1LFP A;  4MHG A;  1IG7 A;  2VBY A;  4XOP A;  2R3S A;  4HQE A;  4XLP F;  2LY9 A;  4U0Y A;  2RGV A;  3KLN A;  3AG1 H;  3V7C A;  5L3E A;  3K7A J;  2KL4 A;  4BH9 A;  4D7M A;  1MJ9 A;  3ULQ B;  2HWV A;  4BQN A;  2CH0 A;  5JHF A;  4AID A;  5J8C A;  4B43 A;  5A2Q Z;  2IAI A;  5E8G A;  3S1M J;  1IRZ A;  3TED A;  4ITV A;  4XLE A;  2F2E A;  4G6T B;  5D4S A;  4EJW A;  4IHX A;  2K9M A;  2A5W A;  2F5F A;  3ZQ7 A;  3J81 K;  2VC1 A;  2E19 A;  2DTZ A;  4HQM A;  4RM2 A;  5L3D A;  2RKH A;  2OA4 A;  1ZLK A;  3MKW B;  4HRI A;  3BRO A;  4G7O F;  5F1R A;  5AIP A;  2HEO A;  2MLG A;  4IX7 A;  4CCO A;  2WB1 A;  3I54 A;  2KIS A;  1LVK A;  4Y7N J;  1RIO H;  4XN3 A;  4IHV A;  1J5Y A;  1AA7 A;  2HXI A;  4UNO A;  4N4O B;  4CGZ A;  2BXY A;  2VOP A;  3K0L A;  5CJ9 A;  2QSF X;  4A3G J;  3ZMT A;  4ENN A;  2Z9O A;  1XCV A;  2Z5U A;  1MMN A;  2W85 A;  3OYL A;  1IN7 A;  1IW7 F;  1K61 A;  3DKX A;  1GT0 C;  2X1E A;  4G9Y A;  3WE2 A;  2LG4 A;  3KP3 A;  4MGR A;  1YTY A;  1W5C C;  1I50 J;  3WHB A;  3PUB A;  2XB5 A;  3G1L A;  3BPV A;  1OCZ H;  4KNY A;  4PSX A;  4RA2 A;  3SJM A;  2QQA A;  2PQ8 A;  3LNQ A;  3W6J B;  2H1L A;  1F9N A;  1SD7 A;  5EGO A;  3KEQ A;  4BEH B;  1VTN C;  1FTT A;  4U0V A;  3KYC B;  4QTR A;  4Y17 A;  4M9X A;  1KQ0 A;  1V5E A;  2X6W A;  3H92 A;  1R1T A;  2BE5 F;  2ZJQ F;  1Z21 A;  4DYC A;  1FIP A;  1P4A A;  3SFI A;  1ZGA A;  5CVI A;  4U87 A;  3I5U A;  3VYS B;  1QHG A;  2EIL H;  2P7V B;  3HB9 A;  5FGM A;  2EZK A;  3RYR A;  3ZR8 X;  5DUI A;  2CFO A;  4BS9 A;  3U9G A;  2MG4 A;  1FX7 A;  2DU9 A;  3BTC A;  1TWF J;  4L5E A;  2M1B A;  3BPX A;  1FNN A;  1D0Z A;  1VF9 A;  3OY9 A;  1VQL I;  3TQN A;  3EUH A;  4MQ9 F;  2Y31 A;  1VQO I;  2M4K A;  3K4N A;  3CZ6 A;  4H0E A;  3K4K A;  1RR7 A;  4HG2 A;  1WJF A;  2VLA A;  1D1C A;  3BY6 A;  2JQ7 A;  2DDB A;  1EKE A;  3OMY A;  1V3F A;  5J4Y A;  1ON2 A;  1FEX A;  5JVT A;  4MFD A;  1R6R A;  1RUN A;  2LBF B;  3M1E A;  4YEJ A;  3O8H A;  5FKK A;  3JR9 A;  1BOB A;  2CQK A;  2E1O A;  3DCF A;  1Q1V A;  1S9H A;  3DFG A;  5E3M A;  2G0E A;  3FMR A;  2DI3 A;  5J1Y A;  2CO5 A;  3J80 Z;  1SEU A;  2IS6 A;  1ZGJ A;  2IGK A;  1MJB A;  4UXN A;  4I01 A;  4Y13 A;  2NAZ A;  2VPR A;  1MD0 A;  1QBJ A;  5J4V A;  4L0Y B;  4C9Y A;  4LLN A;  1T39 A;  2XAU A;  4I98 B;  1XD7 A;  1DUX C;  4IVN A;  2L9S A;  2JPC A;  2LY2 A;  1UZC A;  4HBL A;  1IGN A;  1S6L A;  2JA8 J;  1MBG A;  2DT7 B;  3L2V A;  4KMU X;  2HFH A;  2CQ7 A;  3ZMD A;  3VWB A;  1A6I A;  2CW8 A;  3K4M A;  4E4H A;  3CUQ B;  1ZG1 A;  4WXD A;  3G1M A;  4ZDO A;  2NOJ B;  4GDF A;  1RR8 C;  5FRN A;  3QPS A;  5LHH A;  1T8I A;  5LHG A;  1X1P A;  3BDD A;  4JK1 X;  3TL4 X;  2VT2 A;  5FLX Z;  2R93 J;  3TO6 A;  2BXZ A;  3MKZ A;  2A3S A;  3CO6 C;  3FZV A;  1BC8 C;  3DV8 A;  1ETY A;  3SFZ A;  3I59 B;  3MAJ A;  3LSJ A;  5DYM A;  3CCE I;  2CW0 F;  5DD4 A;  1J59 A;  3GTO J;  2XGE A;  2KZG A;  4Q4Z F;  3RKW A;  3IRQ A;  3S14 J;  4CCL A;  4N9I A;  2B63 J;  3PNV A;  2Y0M A;  3IC7 A;  3ZN1 A;  1QGP A;  1R36 A;  5LD2 C;  2PI0 A;  3C3W A;  1TW2 A;  2L7Z A;  5D8K B;  3E0J B;  3KCC A;  2CUJ A;  4UHT A;  1HA8 A;  4EJU A;  1POG A;  2NVX J;  5E1W A;  4XSX F;  2MA3 A;  2ZNY A;  3HRM A;  2O6G E;  2EA2 A;  5HNF A;  3MEX A;  1O4X A;  4MQV A;  1HLV A;  2OF7 A;  3KP7 A;  1YW7 A;  4L9N A;  2WAF A;  2STW A;  1Z0X A;  4Z2Y A;  2PEX A;  3COA C;  1JGS A;  4JOM A;  1YE9 A;  5CYV A;  1TLH B;  4U88 A;  4D1Q A;  4M3D A;  2BEO A;  2XVC A;  1GLN A;  3LL7 A;  4PK4 A;  4XNF A;  1AKH B;  2K5C A;  1PVE A;  1G3T A;  2V1N A;  3Q0V A;  4QSH A;  5D6E A;  4E7S A;  4IO9 F;  2BY1 A;  1WH5 A;  2UXN A;  3E5U A;  2HDC A;  1KQ8 A;  5E17 F;  2ZCW A;  3H1C A;  3HOT A;  2HGC A;  5IPA A;  1BR4 A;  2P5K A;  4KUM A;  2CQN A;  2QLZ A;  2CQX A;  2D1V A;  3DTE A;  3U21 A;  3FWE A;  1YIO A;  5IOZ A;  2ZME A;  1Z3Y A;  5HDG A;  4IRH A;  2RQQ A;  5KCM A;  2XAF A;  2XKO A;  4F55 A;  4LFU A;  2IGN A;  3E6C C;  3GTG J;  4DZJ A;  5H2F C;  2FX0 A;  4AD9 A;  4WCG A;  3HXL A;  1H8A C;  3PIO F;  5FRM A;  1APL C;  1K78 B;  4FX4 A;  2Q2E B;  3WGI A;  4HX7 A;  2RDP A;  2J5P A;  3P9C A;  3AFH A;  2EB7 A;  1B8I A;  4FT8 A;  3Q3S A;  2LKP A;  3LFU A;  5D4R A;  1TWC J;  1F1Z A;  1VND A;  3ESW B;  1D0Y A;  4QIW N;  3OR1 C;  2R7U A;  2QUF A;  3FXR A;  1DP7 P;  2XC7 A;  4Q5S F;  2Z3Y A;  4A69 C;  4QPO A;  2IBD A;  2RQP A;  3U2R A;  5GAH J;  3HL2 A;  2P8T A;  1F43 A;  1B9M A;  1O3R A;  2F5C A;  2R5Z B;  3KX2 A;  1IDY A;  1GVD A;  3CCU I;  2GLO A;  3WTY C;  2BW3 B;  5LEK A;  5HS9 A;  5J8F A;  4KA4 A;  1SC7 A;  1LVA A;  3M8J A;  3FX3 A;  3K6G A;  1OLT A;  2O03 A;  3DTK A;  2P6T A;  4JX6 A;  2KIU A;  2ZBK A;  4CCJ A;  3HPG A;  5DM6 F;  4I6Z A;  4HAM A;  1BN5 A;  3R61 A;  1JI8 A;  2DMQ A;  3JRC A;  2DYS H;  2KIF A;  4BQQ A;  2HVS A;  2DOF A;  3MN2 A;  1YRN B;  2NYX A;  4Y3O A;  4YFX F;  4ETS A;  4HX8 A;  3R60 A;  4II2 A;  2I8D A;  4DOZ A;  4BQA A;  2ZXH A;  1MMD A;  2H8R A;  2XSD C;  3VFZ A;  1SAN A;  2YX7 A;  3K70 C;  1YJ9 I;  3S2H J;  1WJA A;  3TW6 A;  1K6Y A;  2L3D A;  4KJZ A;  3KP6 A;  2STT A;  1DU0 A;  4FTH A;  2XF6 A;  1IJW C;  1Z91 A;  4NHJ A;  4S04 A;  4H4K C;  3HOU J;  1JHF A;  3CUQ C;  2QWW A;  2BY3 A;  3A1Y A;  3OYC A;  5JVG F;  1T6S A;  1U0J A;  4K2E A;  1U78 A;  1DDN A;  3D1N I;  1ZR4 A;  1LDJ A;  2VN2 A;  2TRT A;  3FF5 A;  1GVJ A;  3HPH A;  4GXO A;  1YI2 I;  5C4X J;  4LG0 A;  5C44 J;  4L9J A;  4DW6 A;  4P5O A;  2HVQ A;  3C18 A;  1Y8R B;  2B0L A;  3O6B B;  4A3C J;  2W00 A;  2JK3 A;  3GF2 A;  2CS3 A;  1ZGW A;  3DKY A;  1FOX A;  4Z6Y A;  2L5Q A;  4NBQ A;  2IS1 A;  4CYC B;  1BW5 A;  4LMY A;  3JRI A;  4CCM A;  4A6E A;  2K4B A;  4EMS A;  4AIK A;  2NVQ J;  2G7H A;  2HZT A;  1WWX A;  1DPR A;  1UHW A;  2E7X A;  4HSR A;  1J09 A;  1AOY A;  3FK6 A;  2Y75 A;  2X6Y A;  3RYP A;  2VPL A;  2DOE A;  1GV2 A;  1LE8 B;  1KA8 A;  2K4J A;  2NS8 A;  5EG0 A;  2FU4 A;  4LD5 A;  1FY7 A;  4A0Y A;  1FIA A;  2WY7 Q;  4KFC A;  1S29 A;  2CWE A;  4IHS A;  3QOE A;  1YS7 A;  2HPI A;  1O57 A;  3CMM A;  3QOP A;  2EFP A;  1WPK A;  1R5H A;  4EM2 A;  3L2W A;  3BG9 A;  3OYK A;  2M30 A;  4MTD A;  3BC8 A;  1YJN I;  4CUG A;  1QZY A;  4DBR A;  2WAQ N;  1L0O C;  1D3Y A;  5HVQ C;  1FLI A;  2PMZ N;  5CQG A;  3RKX A;  1LQ1 A;  2DJN A;  5TJJ A;  2V1U A;  5IP9 J;  4ZJZ A;  2E5N A;  3QU3 A;  2W48 A;  4CSW A;  1IXC A;  2WY8 Q;  1MMG A;  3BG7 A;  5EEH A;  4OAY A;  4JBA A;  5BS6 A;  2MAB A;  5DCM A;  1FSE A;  3WTV C;  1HKQ A;  2DK5 A;  4KIB A;  3WOD F;  4AYB A;  4HNU A;  2K85 A;  3E3V A;  3PM1 A;  2L9R A;  3PO2 J;  2FEZ A;  1OYW A;  3ZGK A;  5LLQ A;  3IH2 A;  5J1U A;  2EIN H;  2VOO A;  3OSG A;  3G4S I;  4ZDP A;  2NS7 A;  1YJW I;  3SDB A;  1JT0 A;  2FQ4 A;  2MD0 A;  1XMK A;  2PJR B;  2FRH A;  3M07 A;  2K3F A;  5IY5 H;  2VE8 A;  4HX4 A;  4A3J J;  1DP3 A;  1TNT A;  4XLF A;  1FJL A;  2EFO A;  4OIN F;  3OIO A;  4FET A;  5KAF C;  4ASN A;  5FB2 A;  3WG9 A;  4E7K A;  2VOD A;  2VQH A;  2XAS A;  4I2O A;  3GFJ A;  2ZJ2 A;  3CJN A;  1W7P A;  2O8X A;  2XAJ A;  3PFY A;  4YIF A;  3HOZ J;  2X1C A;  2M7B A;  5GTI C;  2M9H A;  3PSF A;  4NUB A;  3H5R A;  4BY7 J;  1B1B A;  3EPZ A;  2IRF G;  4C3H J;  4NQW B;  3BLY A;  3WGG A;  3DTI A;  1PYV A;  4PDK A;  2QF7 A;  2GXB A;  1NK3 P;  1NTC A;  3LFK A;  5HLI A;  4N0B A;  3SZP A;  4PGH A;  2HQA A;  3HHH A;  4M73 A;  4M74 A;  1HKT A;  4I0A A;  3WTS C;  3ZMV A;  3ELK A;  4XQF A;  1WRJ A;  3LWF A;  4YEL A;  3FKI J;  1F36 A;  2ZKZ A;  1OCR H;  4BHC A;  1D8K A;  1J7K A;  3LSH A;  3L2R A;  3S1N J;  1WKM A;  4GYI A;  2GXG A;  3H0D A;  5F0C A;  2JA2 A;  4C2U A;  5HLG A;  2FE3 A;  4IRI A;  3I59 A;  2A07 F;  2OV7 A;  2L4M A;  3TMO A;  5HOD A;  2Y9Z A;  1VZ0 A;  3H9Q A;  6PAX A;  1PDN C;  1HC8 A;  3BZ6 A;  3I55 I;  5HLT A;  3RPQ A;  2GM4 A;  1SFX A;  4F93 B;  4BE2 A;  1OR7 A;  1B59 A;  1IZ1 A;  1UFM A;  2K9S A;  3H36 A;  1BOA A;  2FQ3 A;  2KLO A;  2EZI A;  1X3W B;  4RMN A;  5GTH C;  1UG2 A;  1AHD P;  3JCU C;  4I02 A;  4DZP A;  1U9O A;  1IAW A;  3FXK A;  2DOA A;  4I0B A;  1XC5 A;  2NXN B;  3F3X A;  2ADU A;  1D1A A;  4RAF A;  3M1C A;  1X3Z B;  2LMD A;  1FOW A;  3H3U A;  4XOT A;  5DV5 A;  4D0P A;  1G59 A;  4XKB A;  3BG5 A;  3K9T A;  4MO7 A;  1QZZ A;  3S2D J;  3ZCO A;  2VON A;  2ELH A;  3KYD B;  2VL8 A;  1QPI A;  1AKH A;  3HOV J;  4KMF A;  3QPL A;  2EJR A;  1W36 D;  5ICF A;  2L02 A;  3TOA A;  2JJ7 A;  1HST A;  3W2A A;  1I1S A;  5LGU A;  1TWA J;  5M3F J;  1VFC A;  4FE4 A;  3VOE A;  5HDK A;  5AON A;  1ZAR A;  3PIP F;  3ERE D;  4BE0 A;  1FBU A;  2F6C A;  3HKZ A;  4LLL A;  4AVZ A;  2AS5 F;  1LKX A;  4B1R A;  4M6V A;  2KP6 A;  3GZN B;  3EYI A;  1BIA A;  1BM9 A;  4E7J A;  3OYJ A;  5D6F A;  1GV5 A;  3LSR A;  2R7W A;  4DNC A;  1XS9 A;  3IHU A;  2HDW A;  1X1B A;  2ETH A;  2VJI A;  2GBY A;  4BJT A;  2CW7 A;  4BYY A;  1P7I A;  1ACI A;  5FKN A;  2QEN A;  2VT3 A;  3WU1 B;  4A3K J;  1WQ2 A;  9ANT A;  2OC6 A;  1EA3 A;  1T0F C;  4LGW A;  2CUZ A;  4OMZ A;  2JWT A;  3I9V 2;  3WTW C;  4KIG A;  1ONV A;  4ZYG A;  3HTS B;  4ZZD A;  1LFB A;  3DU6 A;  3LSG A;  3CCS I;  1K83 J;  3A4C A;  1MBF A;  1OIS A;  3BZC A;  4BQO A;  2BY2 A;  1PUF B;  1TQM A;  3BR1 A;  4XRS A;  1JKP C;  2R7S A;  3GFM A;  2L01 A;  3ROU A;  1IO2 A;  3QYE A;  3TOB A;  3CCM I;  2HTS A;  4L9V A;  3A2K A;  2R92 J;  2VBW A;  1I1G A;  2DT6 A;  3F8F A;  1OJL A;  5KK1 A;  1E0E A;  2XRO A;  2L54 A;  3GLX A;  2LK2 A;  3V8K A;  2AQE A;  2V9K A;  5IYC J;  2ZFW A;  2X9D A;  5IYB J;  3L09 A;  1G6N A;  2XAQ A;  2QBY B;  2OQG A;  2R4G A;  3KLO A;  1FBQ A;  1Z6T A;  3IH3 A;  5K7Z A;  3G2B A;  2ACJ A;  3OS0 A;  3J81 Z;  3S17 J;  3G6E I;  2VE9 A;  1LFU P;  2DMN A;  4ZTJ A;  1A36 A;  4R1H A;  4LB6 B;  3W2W A;  4X6A J;  1VQ6 I;  1MBK A;  2KFD A;  2VBX A;  1F4K A;  2JA6 J;  5E79 C;  3E97 A;  4B09 A;  1Y56 A;  2KJC A;  1VQ5 I;  1N78 A;  3BJ6 A;  1OQY A;  4RLQ A;  1W5T A;  3JRE A;  2KMU A;  1J9I A;  2JUG A;  3JSP A;  1RES A;  1MBJ A;  3C2H A;  1YIJ I;  2MD5 A;  3VYR B;  2J5O A;  4RGU A;  3H5N A;  1BR1 A;  3JSO A;  2QGU A;  4RB2 C;  3CJQ B;  4S0H B;  2XAG A;  2EIM H;  2RVC A;  3NAR A;  2HKX A;  5F04 A;  2HQ5 A;  2ZXI A;  2QM3 A;  3QPT A;  3KEY A;  3OL3 A;  1IV8 A;  2OCC H;  5EZH A;  2MBF A;  2CU7 A;  3P7N A;  4U7B A;  3S15 J;  2KHM A;  5DCF A;  3U1K A;  1R4M B;  1N77 A;  2L9N A;  1P92 A;  4D5C A;  2W82 A;  2YU9 J;  2I10 A;  5J40 A;  4LK0 F;  1Z3X A;  1UEL B;  3Q9V A;  4RGR A;  2D5V A;  4OAZ A;  4E70 A;  5FJ8 J;  4LLG F;  1HBX G;  4A3L J;  5ILV A;  1ETV A;  2IS2 A;  2NS0 A;  3ZMU A;  5EJC A;  2HXO A;  4XLH A;  2EPF A;  2ESN A;  2BY0 A;  2K02 A;  4JP0 A;  5FLV A;  1TTY A;  3ASN H;  4IL6 C;  4BHP A;  3CCV I;  1P7J A;  3NAU A;  1R9T J;  3SHF A;  4UUS A;  1XDS A;  2XRN A;  4KYW A;  3BR6 A;  4RDU A;  2OZ6 A;  3LSI A;  2EIK H;  1R4N B;  4BNC A;  1FYM A;  2DQL A;  1WZ2 A;  1LNW A;  4ZH4 F;  3N4M A;  2KRC A;  4C3I J;  1XPX A;  1MMS A;  2Y0S N;  5J1R A;  4JX4 A;  2XAH A;  5LHI A;  1VI0 A;  1S7A A;  4NB5 A;  4AU7 A;  3GUD A;  5TIS C;  5FFZ A;  4BUP A;  2P7C B;  3AL0 C;  3K4C A;  3S1Q J;  2H8W A;  3OYA A;  4XKV A;  1XDU A;  3OYD A;  1W0T A;  1LDK B;  1STZ A;  1W1W E;  1R22 A;  2DJI A;  3OYF A;  4CZZ A;  2OZU A;  2W4S A;  3RDI A;  3QRF F;  3CCL I;  1PJR A;  2IW5 A;  1FP1 D;  1HSJ A;  1BJZ A;  2VC0 A;  5J3L A;  2F4I A;  2K40 A;  2BVL A;  3EET A;  3GCM A;  1K4S A;  4D7N A;  1JTX A;  2HZD A;  4L0Z B;  3GWZ A;  1TT5 B;  4PFP A;  4XL9 A;  4CXF A;  5FD6 A;  1SD6 A;  3RI4 A;  5EEG A;  1A5J A;  1ODD A;  1WVR A;  2BOL A;  1LEA A;  3ECO A;  3RJP A;  2VXZ A;  3J7Y J;  3V4G A;  1QHH D;  3JTH A;  3FBI B;  2QQ8 A;  3OR2 C;  4UB8 C;  1K79 A;  2WAE A;  1ZRF A;  3A03 A;  3BP8 A;  4JX5 A; 
#chains in the Genus database with same CATH homology
 4BGD A;  1UAA A;  3KX2 A;  3UR3 C;  1FMV A;  2BW3 B;  2BW3 A;  4CCK A;  3SEQ A;  4BE1 A;  2R7X A;  3BCB A;  3M8J A;  3K6G A;  1ERD A;  1OLT A;  1Z7L A;  4E7L A;  3DTK A;  3H35 A;  2P0W A;  4E7Z A;  1V5F A;  2QKL B;  3RQ4 A;  4FAS D;  4CCJ A;  1D1B A;  3HPG A;  1NG7 A;  2RNG A;  1JI8 A;  2X85 A;  3DPT A;  2WBM A;  4BQQ A;  2JVH A;  3SZG A;  2LH9 A;  4IZZ A;  1WJD A;  5HNH A;  4XLC A;  2HVS A;  3D5L A;  4B48 A;  4ZTF A;  4Y3O A;  4BL0 B;  2KDO A;  3DPL C;  4P1W A;  4II2 A;  2I8D A;  3RSN A;  4DOZ A;  2ZXH A;  4XON A;  1MMD A;  1X4P A;  2K9L A;  3OIQ A;  3K70 C;  1WJA A;  2XDV A;  3OYI A;  3K70 D;  1MW7 A;  1K6Y A;  2LRD A;  3TBI A;  4KJZ A;  4C2T A;  2XF6 A;  3ZXS A;  4ZC3 A;  3OYN A;  3GBG A;  3S3N A;  4H4K C;  3A1Y A;  3OYC A;  3L2Q A;  1U0J A;  3KYL A;  3HC7 A;  4NC8 A;  5CQE A;  4Y33 A;  3CP2 A;  1WJE A;  5LFA A;  2F5V A;  4J01 A;  2WA0 A;  3HPH A;  3IP4 B;  4P5O A;  3S3M A;  2HVQ A;  1QU3 A;  2WAD A;  2XF5 A;  3W2V A;  4ZDL A;  2W00 A;  2FUG 2;  3MMY B;  2CS3 A;  3OWT A;  3DKY A;  3OYM A;  2L5Q A;  2IS1 A;  4N4N B;  4CCM A;  3LMM A;  4CH7 A;  4HSR A;  1J09 A;  3NWS A;  2X6Y A;  4PJL A;  4BU2 A;  2VPL A;  3MD2 A;  2V26 A;  3V42 A;  4BJ6 C;  3VYU B;  3FDY A;  3LSM A;  2LYC A;  2IXS A;  2Y0S A;  3ZRG A;  2LRE A;  3OS1 A;  4ZYA A;  3L2U A;  3FKJ A;  4XM3 A;  2W7N A;  2E1M C;  1YX5 A;  4HNT A;  3IAS 2;  2WY7 Q;  3IUO A;  4E7I A;  2V7F A;  3QOE A;  4DIQ A;  3K4J A;  2Z16 A;  2HPI A;  2X51 A;  2E60 A;  3CMM A;  2VB6 A;  1WJC A;  4DBQ A;  1TZL A;  3CF2 A;  4IQJ A;  3L2W A;  3OYK A;  3BC8 A;  5KNL A;  2QKM B;  4D9J A;  2KQR A;  4CUG A;  4DBR A;  3AKZ A;  3EUA A;  3OYB A;  5HVQ C;  5CQG A;  2M3A A;  4ZJZ A;  2E5N A;  1SFK A;  4GRI A;  4CSW A;  2WY8 Q;  1MMG A;  3QYF A;  3BG7 A;  4OAY A;  3VYT B;  4XLA A;  4DGW B;  2MAB A;  2R7Q A;  3LSK A;  4HPQ A;  3H9G A;  2GOM A;  2VAS A;  4AYB A;  4LIU A;  4HNU A;  2M7A A;  3E1S A;  2A6T A;  3ZGK A;  2KZV A;  4BDZ A;  5CKT A;  4F52 A;  4BDY A;  4ZDP A;  4PJM A;  2KRH A;  3VSK A;  4LG3 A;  1YX3 A;  2M0M A;  4PUS A;  3SDB A;  5CPR B;  3PJR A;  2MD0 A;  4F92 B;  2GOX B;  2PJR B;  2PJR A;  1X4O A;  3SYT A;  1DP3 A;  3QYB A;  4ANJ A;  2CV2 A;  3DU5 A;  4XLF A;  3DEE A;  1KON A;  2DCE A;  4FET A;  4XKW A;  2K3P A;  3DQV C;  4E7K A;  2VXD A;  4EAT A;  1DGW Y;  3UNG C;  2VQH A;  1WJ5 A;  3HOS A;  3FHN A;  2IGM A;  3PSI A;  3PFY A;  4XMY A;  4YRV A;  4XKC A;  1LFP A;  2X1C A;  2M7B A;  3OYH A;  3PSF A;  2HNH A;  4II3 A;  4PJJ A;  1TT0 A;  2HPM A;  4NUB A;  4XOP A;  3DPU A;  3H5R A;  3EPZ A;  2KPM A;  4NQW B;  2OUM A;  3BLY A;  3PNY A;  2R7R A;  3DTI A;  1PYV A;  4Y4R A;  2KL4 A;  2LC2 A;  4IQ4 A;  4BQN A;  2CH0 A;  3NWT A;  5JHF A;  4B43 A;  3J7A Y;  3FBN B;  3S8P A;  4CA0 A;  1X19 A;  2XF7 A;  2HQA A;  4ITV A;  4CCN A;  3K4B A;  4XLE A;  4HST A;  4BXF A;  4XQF A;  4YEL A;  3OIP A;  4G6T B;  2K9M A;  2A5W A;  3OYG A;  3LSH A;  4RM2 A;  3L2R A;  3MKW B;  4HRI A;  3H0D A;  4DJA A;  2JA2 A;  4NC7 A;  2ZFU A;  4XN0 A;  4IX7 A;  2JSP A;  4CCO A;  2WB1 A;  4C2U A;  4RLF A;  2OV7 A;  4JQF A;  1LVK A;  2VJ4 A;  4XN3 A;  3TMO A;  2VIX A;  1VZ0 A;  1AA7 A;  3H9Q A;  1DQU A;  4N4O B;  5HLT A;  4NNJ A;  3ZQQ A;  2X1D A;  4LIT A;  4F93 B;  1MMN A;  3OL4 A;  3OYL A;  4BE2 A;  4F91 B;  2ZSH B;  3DKX A;  3RPU D;  4XOR A;  2KLO A;  1FMW A;  2X1E A;  4RMN A;  2LG4 A;  3RTR A;  1X1A A;  3PUB A;  2DOA A;  1D1A A;  3D5S C;  3M1C A;  4PSX A;  3PNT A;  4XOT A;  1G59 A;  4XKB A;  3ZCO A;  2Z2S B;  1DGR M;  2VL8 A;  2WAQ A;  4BEH B;  2Q1Z B;  4BEH A;  2MYS A;  4XR6 A;  2UUZ A;  1W36 C;  2PMZ A;  1V5E A;  2X6W A;  1W36 D;  2HVR A;  2DXI A;  3W2A A;  5FRO A;  1Z21 A;  2JVG A;  4BE0 A;  3HKZ A;  2F6C A;  4U87 A;  4AVZ A;  3VYS B;  1LKX A;  1QHG A;  3RCO A;  2KP6 A;  1SAU A;  3ZR8 X;  1MND A;  2CFO A;  4BS9 A;  4MLO A;  4E7J A;  3OYJ A;  4B44 A;  2R7W A;  1D0Z A;  3OY9 A;  2HDW A;  1X1B A;  2VJI A;  4BJT A;  2CW7 A;  4HEA 2;  2ZSI B;  2CV0 A;  2M4K A;  4J00 A;  3K4N A;  3CZ6 A;  2OC6 A;  3K4K A;  1EA3 A;  1T0F C;  4HG2 A;  1WJF A;  2CUZ A;  2MC4 A;  2VLA A;  3HG9 A;  1D1C A;  3I9V 2;  4PJN A;  2LOO A;  1NG6 A;  3OMY A;  3DU6 A;  3LSG A;  2W1O A;  4B47 A;  4R79 A;  2CV1 A;  3A4C A;  1R6R A;  3QOD A;  4F3Q A;  4BQO A;  2VQG A;  2LBF B;  2LBF A;  2V6E A;  4YEJ A;  3S3O A;  2X6X A;  2R7S A;  1BOB A;  3VSL A;  3OS2 A;  2VJ5 A;  1S9H A;  3S32 A;  1P9Q C;  2IGO A;  4B3X A;  3IAM 2;  3QYE A;  3A2K A;  2DT6 A;  2IS6 A;  1E0E A;  2IGK A;  2M4G A;  3W3C A;  1UG0 A;  2AQE A;  2V9K A;  3N05 A;  4C9Y A;  3HL2 A;  2XAU A;  4BJ5 C;  2Z1D A;  2VQC A;  2R4G A;  3PL8 A;  2L9S A;  2LY2 A;  3G2B A;  3OS0 A;  3DWL E;  3SEZ A;  2DT7 B;  3L2V A;  3OYE A;  3VWB A;  4ZTJ A;  2XSJ C;  2CW8 A;  3K4M A;  4E4H A;  3W2W A;  4ZDO A;  2NOJ B;  4E6K G;  5FRN A;  1Y56 A;  1N78 A;  4RLQ A;  4KIT B;  2R7V A;  3TL4 X;  2KMU A;  2JUG A;  1G8X A;  3C2H A;  3MKZ A;  1X1C A;  1IRX A;  2VKH A;  3DLA A;  3VYR B;  4CZC A;  3H5N A;  1BR1 A;  2CMP A;  2V4J C;  3CJQ B;  2IS4 A;  1D0X A;  2UV1 A;  2ZXI A;  2BVM A;  3KEY A;  4CCL A;  3PNV A;  3CES A;  3OL3 A;  3BCA A;  5LD2 C;  1BR2 A;  3MKY B;  4X0G A;  4U7B A;  1X1D A;  2KHM A;  3OOU A;  4PFO A;  3E0J B;  2CUJ A;  2VKD A;  3VDX A;  1HA8 A;  1N77 A;  4KIS A;  2L9N A;  2E1M B;  2ELJ A;  2W82 A;  5HNF A;  1Z3X A;  1UEL B;  2MFZ A;  1V5G A;  2E5Z A;  4OAZ A;  4LIV A;  2WAF A;  4E7H A;  2IS2 A;  4JOM A;  1YE9 A;  4D1Q A;  4XLH A;  2AQF A;  1GLN A;  2VJJ A;  3CJR B;  3LL7 A;  4PK4 A;  4XNF A;  2K5C A;  1OR7 C;  2V1N A;  4E7S A;  3AL0 B;  3HOT A;  4IKF A;  1BR4 A;  4PSW A;  3DTE A;  3K4L A;  4KT6 A;  3LSI A;  2HU9 A;  3U21 A;  1Y6I A;  1Z3Y A;  2R7T A;  2VQL A;  2RQQ A;  5KCM A;  2KRC A;  4F55 A;  3H5A A;  4QPQ A;  2IGN A;  3CP8 A;  1MMA A;  5KHD A;  2L2O A;  4AU7 A;  2RRE A;  1WJB A;  3I3L A;  4BUP A;  3AL0 C;  3HXL A;  3K4C A;  3H9J A;  3OYA A;  4XKV A;  5FRM A;  3OYD A;  1LDK B;  3HUG B;  2Q2E B;  3BG6 A;  3K10 A;  2DJI A;  3OYF A;  2UWM A;  2W4S A;  2O5R A;  3S93 A;  4BAC A;  1PJR A;  3AFH A;  1ZEL A;  4OWR B;  2LY1 A;  3LFU A;  5HOO A;  2F4I A;  2BVL A;  4RM3 A;  1WFX A;  5TGT A;  2HZD A;  1D0Y A;  4PFP A;  4XL9 A;  3OR1 C;  2R7U A;  3EUH C;  4C30 A;  2R7O A;  3C2G A;  2L7K A;  2BOL A;  3D5R C;  2VXZ A;  3EUK L;  1N75 A;  2XC7 A;  3F9K A;  1QHH D;  3FBI B;  4QPO A;  1T95 A;  3OR2 C;  2WAE A;  3ONQ A;  1MNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...