3CC4I

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cc4I00
2QA4I 2ZJQF 1FOXA 2ZJRF 1VQKI 3CMAI 1FOWA 1YHQI 2H8WA 2JQ7A 3CCRI 1MMSA 5GADJ 2E34A 4V19K 5DM7F 4IO9F 3CJTB 3PIOF 1VQ8I 3CC7I 3CCQI 1VQ9I 3CF5F 1YJNI 1YI2I 3CCLI 3J7YJ 3CCEI 3J7ZI 2OTLI 3DLLF 1VQ6I 3CMEI 5GAGJ 1ACIA 1FOYA 5DM6F 3I56I 1Y39A 2E36A 2ZJPF 1VQ7I 2E35A 5GAEJ 1YIJI 5JVGF 5GAHJ 3CC2I 2K3FA 3G4SI 1YJWI 1VQ4I 3CC4I 3PIPF 1VQMI 3I55I 3CD6I 1QA6A 3G6EI 3CCSI 1VQLI 4UY8I 3CCVI 1VQPI 1YJ9I 3CCMI 2OTJI 2FOWA 1HC8A 1VQOI 4IOAF 2QEXI 3CCUI 1VQNI 1VQ5I 1S72I 3G71I 2NXNB 4IOCF 3CCJI 1YITI
chains in the Genus database with same CATH superfamily
1R36A 1FOXA 4ENKA 4R79A 2P81A 4S04A 1RETA 3S1MJ 4E6KG 4LOCA 5EGOB 2LK2A 5LD2C 4CHUA 3C2GA 3RSNA 4X0GA 4KJZA 2L9RA 2WAFA 4LLGF 4V2GA 2MC3A 1R9TJ 2QVOA 1W0TA 2H1KA 1F36A 1RPWA 3BQZA 3KYLA 5JFRA 1MKMA 3K4JA 1AKHA 3WG7H 1WKMA 2DMTA 4G6TB 2JRMA 3PIOF 1S29A 3D5SC 3PNYA 4AWXB 1QBJA 2HTSA 1DGRM 5GTHC 4WXHA 1W1WE 5EDNA 2HOEA 4OINF 3RPUD 1POGA 2XUBA 2E1MC 2F2EA 3HRTA 3CCEI 2TDXA 1CGPA 1FBUA 3T8RA 1Y8QB 3OYEA 3A2KA 4ENNA 2DTZA 3HOWJ 4A69C 2IW5A 2E36A 3OS2A 1IJWC 2K4JA 3QOEA 2XAGA 4HEA2 1VQ7I 2E1NA 1MBGA 2DMQA 2GBYA 4E70A 1QQIA 1TWFJ 4HBLA 5GAHJ 5E8IA 5M5XJ 1GUUA 5BOXA 5L3BA 4QPOA 1WGXA 2Q8KA 1AOYA 2EA2A 4Y33A 1SFEA 4FE4A 5K5RA 3L2WA 1ZK8A 1YE9A 3COAC 2CRGA 4E7KA 4HQEA 3CZ6A 1UELB 2KDZA 2FBIA 3BR0A 1XMAA 1G3SA 3UKGA 1YX5A 4HSTA 3GTPJ 4EM0B 3MZHA 3F6VA 3GLLA 2BHZA 2DODA 3LFUA 2G9WA 1S7AA 3FK6A 3LSGA 4ESFA 3K7AJ 4LB6B 1D1BA 3SFIA 2EIKH 3QPSA 4RDUA 4JP0A 2G0EA 4FCYA 1R4NB 2PQ8A 3S2WA 5E3OA 3C2BA 4CGZA 1ONVA 5LEJA 4E7LA 4GFBA 5HLTA 3F6OA 5IPAA 3OYJA 4OIPF 1Y0UA 3RIRA 2LF8A 4MGRA 3V7SA 1NK2P 2EILH 4L5JA 3OYFA 2FRHA 5CVVA 4NQWB 2BVLA 2XPWA 5FKNA 1D0ZA 4MEXF 4HW0A 2E7WA 1I39A 1J2XA 4I02A 1YRNA 1YHQI 3CDHA 2HQAA 1DDNA 1IF1A 2GXAA 4Y13A 5LRRA 4ANJA 1I1GA 3HSRA 2HYJA 5LFAA 1APLC 1IRGA 4PCQA 5L3FA 1IN5A 1YS7A 2MW8A 2FD5A 2EWNA 3OS0A 5GADJ 2VPRA 3M9AA 3CJNA 1J59A 3HRSA 1BW5A 3RCOA 2Y0SA 4UUVA 3HUGA 1F1ZA 2A6EF 4LIUA 4EJVA 3E6BA 1HKSA 2PBIA 3CC7I 4HF1A 2Z9OA 1MSFC 1OCOH 3HHGA 2JUGA 2V7FA 5FLMJ 1YI2I 2XF6A 3D0SA 4ZYHA 4V2FA 2HKOA 3C3WA 5JHUA 2MH9A 4DIQA 5IP7J 3ZMTA 2VQCA 1R1TA 4A3GJ 5L3DA 1FMWA 1XGOA 4U0YA 5DM6F 2JA5J 5ICEA 3ZN0A 4G94A 4JOMA 3LQRA 3FIWA 2GXBA 2HFHA 2VIXA 2GIZA 4MLOA 4M9XA 1YFHA 2L5QA 2LF7A 1BR4A 1IZ1A 2GQQA 3JREA 3HPHA 5L3CA 3GFMA 3Q0UA 1MDMA 2ELJA 3M4OJ 1LQ1A 1H9TA 4UVBA 2EFQA 1GT0C 3SHFA 2O9LA 2MGQA 3H3ZA 3SFZA 3WHCA 4PJ0C 5D5VB 4Y15A 2XAUA 4CCNA 2CQ7A 1FWZA 2ZB9A 2ELKA 1ETXA 3OIOA 1ZRFA 2FNPA 3BT9A 4J01A 1FC3A 2HXIA 4ZH4F 1P6RA 1MBEA 3AG4H 1Z21A 2XB0X 4ZC3A 2O61A 5J8CA 1U6GA 4G6DA 1TWGJ 2ME6A 1A6QA 2ZFUA 1LFBA 3K4BA 1HDPA 2K9SA 1VQOI 2OPTA 3WU0A 4C3IJ 3O3KA 2JT1A 3RPUA 5HOOA 3LSJA 4L9TA 4Y17A 5IT9K 2O8XA 2M8GX 3CQZJ 3KE2A 4A3EJ 3AL0C 1XB4A 1FOKA 1ITYA 5LEKA 4WX9A 4I76A 5C3EJ 5M5WJ 5K5OA 1BN5A 1U5TA 3B02A 1E17A 4ZDPA 4I01A 1A36A 3EUHC 3JRBA 3BWGA 3TO9A 2BBYA 3HHHA 3GX4X 5CQEA 4XR6A 1I1SA 1FY7A 1ZRDA 4FTHA 1TT5B 3LSKA 1MBKA 3VPRA 4RM2A 4J00A 4MFEA 4TV7A 1FTZA 5J1RA 3SEQA 1TQPA 1G3YA 2M1BA 1WZ2A 1XGMA 2E34A 2UV1A 5K7HA 2QUFA 5D8KB 2DA5A 1LDJA 3JAMK 4IO9F 4Q48A 2VC0A 1YX3A 3GMEA 4G7HF 4D5FA 2P6TA 1W0UA 4IZZA 2I8DA 1P9QC 2LYCA 3DEUA 4BKXA 2CYYA 3MMYB 2X9DA 3V8LA 3CCLI 4PSXA 1XGNA 1PP8F 1XMKA 3H35A 4GYGA 5D5WB 2H94A 3CJQB 3OSGA 3V7RA 1FTTA 3S1QJ 3LAJA 5M3MJ 5IYBJ 3OSFA 4D9JA 4XQFA 2EZLA 4BAYA 1PJRA 3E5QA 3H3VK 3ASNH 2Y31A 2IXSA 2RDPA 3FZVA 2HZDA 4DJAA 1XD7A 4IRHA 3I9V2 2A61A 4L9JA 4O5VA 1OQYA 3BCAA 3I59B 4EM1A 2BEOA 3PL8A 2E71A 1Y1WJ 3Q0VA 3OOPA 1YJWI 1TP4A 3CC4I 1AWCA 4XKCA 4LJZF 1YOVB 1MNEA 3KYDB 3WTZA 3Q9VA 3VWBA 2BXZA 2V6EA 1ZG5A 3HDDA 3QODA 5EYRA 4BNCA 3NQOA 3BJ6A 3BLYA 4KFCA 5FD5A 1QA6A 5K7FA 2FMLA 2XRLA 1KYZA 2Z2SB 1KA8A 2D1HA 3D5LA 4BHPA 3SDGA 1YJ9I 3QWLA 3F9KA 3BTCA 3BPVA 3A0HC 3JTGA 1T56A 2MYSA 2DT7B 3TW6A 3ABTA 4DYRA 1SFKA 3MKZA 3TO6A 1H88C 1BOAA 2OTJI 3FHNA 1X1CA 2A6TA 3ASOH 3BROA 2XSJC 1XTAA 1I6XA 1Y56A 2BXYA 2H6BA 2KLOA 1T98A 1RKWA 1VQNI 2YU3A 3G1LA 2IS4A 3OYIA 3WG9A 3DKYA 2LKSA 4CH7A 2L54A 2TCTA 4HX8A 4BXFA 2I10A 3JR9A 3RYPA 3FXRA 3C2HA 2PN6A 1S6LA 1Y8RB 1KQ0A 3OWTA 4U0WA 4PK4A 2AO9A 1T0FA 4Y52J 5A2QZ 1FBSA 2OQGA 2ZBKA 1HQCA 4JYKA 3E6DA 1W36D 1MJ9A 2M2EA 1K7AA 2CJJA 1IGNA 1MMSA 3JSOA 5LGUA 3W2AA 2HTJA 3ZR8X 4G7ZF 2NVQJ 4CDGA 3G2BA 4XKWA 3F8NA 2F5FA 3OYBA 2KJCA 4BQAA 4QIWN 5FJ8J 1X1PA 4IRIA 3E97A 2R92J 3ELKA 2ZMEC 1Z05A 2VJ5A 2CFOA 3KZIC 1VQ8I 4E7IA 3GFIA 2IBDA 5J40A 1BJAA 2Z16A 4RGSA 2EINH 3DF8A 2IVMA 4RAFA 3IWZA 2VBZA 4EGZA 4N4OB 5C44J 4PSWA 2HI3A 4HLYA 3LSPA 4FX4A 2YS9A 5K1YA 4WCGA 2P4WA 4IL6C 2WAQA 4DNCA 4ESBA 1Y0NA 4XLPF 1FIAA 1KZHA 1SMYF 2NS8A 2KQRA 2NVYJ 3I56I 1AKHB 4WXDA 2ZJPF 2M4KA 1OFCX 1FYKA 3VDXA 3DBHB 5H20A 3OYLA 2M87A 2KRHA 3PSIA 2DA7A 2LD5A 4I98B 2FU4A 3GCMA 4A0YA 2F6CA 3BTJA 1H89C 1EJ9A 1UMQA 2QSHX 2JA2A 3F21A 1BM9A 5FKKA 5BQTA 1W7PD 1WFXA 1TZLA 1JKPC 1IDYA 1MD0A 1JKOC 1XN7A 2CSOA 2DDAA 2L7ZA 3CP2A 1XX5A 5BS6A 2D45A 2DA1A 3HSEA 1IRXA 3Q3SA 2OBPA 1LPQA 4BXUA 3CDLA 3IC7A 3IAS2 4CCMA 1V3FA 2CUZA 2ZNZA 5DUKA 1RUNA 1JHFA 2H27A 3PJRA 2FNAA 1MNMC 2JWTA 4BY7J 1FSEA 3V8JA 1ZYRF 3J81Z 2FOWA 4RAYA 1D8KA 1V5EA 2W48A 5A2QK 1FZPB 1BI3A 1Y6IA 2ID3A 2R7SA 2L9SA 2R7OA 2DCEA 2NXNB 5F64A 4FQGA 3R4KA 2HNHA 2EH3A 1OJLA 1MMGA 4CCOA 4LFUA 2XGEA 2DJNA 1UB9A 3OYKA 1Z6TA 2X6XA 3B73A 2PEXA 3CUOA 4MFDA 3C18A 3H5NA 4LMYA 2V79A 2HOAA 3WE3A 2XV4S 1QZZA 2L4MA 1ZGWA 3E7LA 2WTEA 2ELHA 5TRDA 3CCRI 1LNWA 1BL0A 2XF5A 4C30A 1P4WA 3IH2A 4AC0A 2MABA 4CXFA 3ESWB 2M5WA 1HXDA 1LDDA 1LE8A 2W1OA 2Y9YA 4JK1X 4I2OA 4XKVA 3OL4A 1SFOJ 4B3XA 2A05A 2FBKA 4NC6A 4CZZA 4HV5A 4N4NB 1U9NA 1OMIA 1HSJA 2ZC2A 3OL3A 4BBRJ 1QNTA 1YRNB 3FISA 5DDGA 4XLEA 3KIOA 3LSTA 3JRHA 1IG7A 1LDKB 2KZVA 1UZCA 5LBQA 3S3NA 3M8JA 2WY7Q 1G2HA 2EPFA 1R23A 2R5ZA 2E5NA 1LVAA 2OTLI 1FBQA 3MEXA 4WK8F 1T95A 3I71A 3CF2A 3HUGB 3IAM2 4OU0A 5DUIA 1OCTC 4M3DA 3DV8A 2K4BA 3W2VA 4YRVA 5F0FA 1HKQA 3TP3A 4NB5A 1KYWA 2P5KA 4WF2A 2MSYA 2A6HF 4BH9A 2QGUA 3SXYA 1Z9CA 5HS9A 3FBNB 1SEUA 3GTKJ 1N25A 5FFXA 3JSPA 2Z99A 1ZG1A 4A3KJ 3NWSA 4A0XA 1EV7A 2AXLA 3TP0A 4OAZA 5J47A 2P0WA 4GXOA 5CJ9A 1F43A 4ZDOA 1D0YA 5HLGA 1GLNA 3OV8A 2IEKA 3IRQA 4F92B 4KITB 1HDDC 1Z3YA 1MDMB 2D5VA 3FMQA 2HWVA 4RB0A 3TDUC 2LRDA 5ICGA 1ZGJA 2XRNA 4DYCA 1V4RA 1OISA 4I99C 5EG0A 2XROA 5DV5A 3BR6A 4HDVA 2IRFG 4IOAF 4IHSA 3H9GA 1OR7C 2NVTJ 4BJTA 4BY1J 1OPCA 3S2HJ 2DAOA 2ETHA 4RB1A 3MCZA 4CO8A 2FMYA 2XKPA 3CTAA 3TOAA 5ERIA 3ZOBA 1KONA 4IRGA 1UG2A 2Y0SN 2QZ8A 3I64A 4EJOA 2NNNA 3HRMA 3LA7A 2DN0A 2EFWA 1YITI 1YW9A 4AIDA 2QA4I 2I5UA 1VZ0A 2ECBA 1T2KA 1B8IA 2DYSH 3DLAA 1N78A 2L2OA 3JRIA 2VC1A 4ITVA 2H8WA 2JQ7A 4G6QA 4BJ6C 4G7OF 4A3FJ 3MZ8A 3RQIA 4XRSG 2QQAA 1BIAA 1TWCJ 4KMFA 3L1PA 4RLFA 1U5TB 4XL9A 1W5SA 1FPQA 3S14J 4A6EA 2L9VA 1W7PA 4YIFA 3CJTB 2E60A 4G12A 4BEHA 4CCKA 4HSRA 1MJBA 2HVSA 3ECOA 1A6IA 3BR2A 2V4JC 4BUPA 3MKYB 2E19A 4PGGA 1TQIA 4ZJZA 3I4NJ 3CUQC 4E7ZA 1PVEA 2DOAA 3HG9A 5IYDJ 2VQGA 1D0XA 1FYMA 3K0LA 2DPUA 2DA4A 1VQ6I 2VUMJ 1WI3A 4A5MA 4RLQA 2H1LA 2OA4A 2ZXWH 5TISC 3WTWC 5FLXK 2VN2A 3H0GJ 2JZYA 1SD6A 5IP6A 3QAHA 1Y39A 2AHQA 2EZHA 3BJOA 1B72A 3BZKA 1IN7A 3ZP5A 3TBIA 2Y9ZA 2TRTA 2KZGA 1YIJI 2CQKA 2OD5A 3QOPA 4DZJA 2XB5A 5F04A 2L02A 1WRJA 5FKLA 3DWLE 1RIOH 2GA2A 2WWYA 1MZBA 2CV1A 4HNVA 2OC6A 4UV9A 2K7LA 1ZG3A 1HF0A 1P4XA 1SAUA 1IRZA 2ZCWA 3ZMDA 2XKOA 1QPIA 1SFXA 3TW7A 1FSHA 2BGCA 1V55H 2JRTA 4IXAA 3H92A 2IGMA 2ISZA 5F08A 2JA6J 5IY5H 1J75A 4A5NA 2VBWA 1SC7A 2WA0A 1QZEA 3M8EA 4DBRA 1YLFA 1UHSA 4LLLA 2KJBA 2NS7A 4OIRF 1GXPA 3KEOA 1NG7A 4PJLA 1DP3A 2Q0OA 4H4KC 1B6AA 2K85A 3FKIJ 4XK4A 2W4SA 2K40A 3K69A 2KRFA 4XICA 1I50J 2HVRA 1ORKA 2CUFA 1MBFA 4B09A 4M3EA 3DTKA 3IH4A 3KETA 1QVUA 4LLNA 3JRGA 2OCEA 1WCMJ 2OZUA 4M3BA 3O8GA 2V6CA 1HBXG 1ULYA 2DA6A 2IJLA 3F8BA 3CCJI 1B9MA 4LG0A 1M1EB 3M1EA 2ZJQF 2CG4A 4BE0A 4E7HA 1QRYA 4QTRA 3FXKA 2EFOA 1K4SA 3ZMSA 2V1DA 1X3WB 1A31A 1Z77A 5HNHA 2LY9A 3O8HA 1ETVA 3VB2A 2EZIA 4XMYA 5DD8A 3TQNA 2DYRH 4AVZA 2QKLB 5E17F 2R5YA 3LWFA 4M6XA 3CO6C 3P5JA 4V19K 4OWRB 3DEWA 2OAZA 2LDUA 3A01A 4A3BJ 3EPZA 3HC7A 1FYLA 1J0RA 1MBJA 1ZELA 2X85A 1ZKGA 4I09A 2A68F 5KAIC 3O2PE 4MQVA 2O8KA 3GO5A 2M45A 1X3UA 1SANA 1TC3C 1E3PA 4PFPA 1UHMA 3HKZA 2OU2A 3TKYA 5KAFC 1UCRA 3VYSB 3ZRGA 1FMVA 5H6RA 4AIKA 1IV6A 2WV1A 3S93A 4II3A 5HDGA 2DFIA 1PP7U 2IS1A 4FE7A 1R6RA 3RKYA 5FGMA 3EYIA 3RZOJ 2RAEA 1ACIA 1HW2A 2XAHA 4YG2F 4UNOA 1TW3A 1IRFA 3LSHA 4XRMA 2F4OB 3FF5A 1AHDP 2STTA 1HCRA 1EH8A 4OMYA 1R4MB 2DMUA 3M3YJ 3S17J 1USTA 1RESA 5GTIC 3CMMA 5IT3A 2IA1A 1JUMA 2MBFA 1IXCA 2WY8Q 5D5UB 5DTDA 2HGCA 3SJMA 2W24A 4HAMA 5K5QA 1R22A 2CQNA 4IQ4A 3HIFA 3DU5A 4ENJA 1IAWA 1Q1VA 4U7BA 1ZREA 2KDOA 1YTYA 5EZGA 2FX0A 1S8NA 2PMHA 4F93B 4OMZA 5BNGA 5L3GA 1JT6A 2JN6A 2OQRA 2QBYA 4C9YA 2ZO4A 5AIQA 3ISPA 1KQ8A 3HRUA 4HG2A 2AQEA 2XHKA 4UY8I 3SZTA 1HW1A 3ZMZA 5D4SA 3GTJJ 3FDYA 4PZJA 3GXOA 4CYCA 1P7JA 2K86A 2E2HJ 3OOUA 1RRJA 1X19A 1KU2A 4EGYA 1MIJA 1JT0A 4YELA 2L0KA 5LHGA 1HC8A 4NDLA 2QQ8A 3DFGA 3HB9A 1WI9A 2NOJB 3R0AA 4EQQA 4QSHA 2M0CA 2HOSA 2QWWA 3DTEA 3M1CA 3FK7A 3HJEA 4B47A 2X6YA 3VOEA 5ILSA 3ZQGA 3Q5FA 4YFNF 2COBA 3P7NA 2GZWA 2K3PA 3AKZA 4LG3A 3A1YA 1WSUA 2QM3A 4FX0A 5J8FA 5FKMA 1RNLA 4A12A 3KEYA 3JRDA 1YS6A 4X1EA 5HLHA 5FROA 3WE2A 2CW7A 2FUG2 2R7DA 1BI2A 3GLXA 5JVTA 5FO5A 5ILVA 1Z0XA 1X2MA 1IW7F 1X58A 3KLOA 2L7FP 2DT5A 2WAQN 1G3WA 1XMXA 2X4HA 3HYIA 5DM7F 3OS1A 3IKTA 2F48A 2NS0A 3EUAA 2KIMA 3ECHA 2OCCH 3S2DJ 2QLZA 1YIOA 1ZAOA 4L18B 3CCYA 3E5UA 2QQBA 1XPXA 4DBQA 1KU9A 4A2UA 2FXAA 1ZR2A 3VSKA 2N8GA 2R7ZJ 3M7GA 5CVIA 4D7NA 3BDDA 3TO7A 4JQFA 1J7KA 1R5GA 1L3LA 4Q4ZF 5E3NA 4A3DJ 2HDDA 1ZHFA 1LE8B 4S0HB 3OYMA 2BE5F 3GVAA 1A5JA 2VT3A 3BG9A 4HV6A 3HGYA 3E6MA 1R71A 1JJ8C 1WJCA 1FP2A 3ROUA 2E35A 1CF7A 5JVGF 1X4OA 3SZPA 4KIGA 5ED4A 3WU2C 4S05A 4AU7A 4FHTA 3UR3C 1TL8A 3I4MJ 2OV7A 2KL4A 3PIPF 2R5ZB 5H2FC 1O4XA 2DQLA 1PUFA 4U0VA 1MMNA 2V9VA 5BPDA 2PJRA 2NVXJ 5J4VA 5E1XA 2AS5F 1U78A 2DPDA 4F3QA 3MQ0A 2VKVA 4ZYGA 3CCSI 4I0BA 2HYFA 4MQ9F 4Q5SF 1ZLKA 2CO5A 2DJIA 3S32A 3V42A 1UG0A 4F52A 1A04A 5D5XB 1X2NA 2HQ5A 1DU6A 1BI1A 5J6XA 4A6DA 2OJED 1IXSB 1ZLJA 1YW8A 3I53A 4MEYF 2MLKA 3RPQA 4JX6A 4CUGA 5F0HA 2ZXHA 3DP7A 4RGUA 4C3HJ 2COMA 1ENHA 1I5ZA 1NHAA 4L5IA 2W25A 3CESA 3NEUA 2LKPA 3KP4A 3FWEA 3IHUA 3KZZA 3W6KB 4O6JA 3DCFA 3DPUA 4HYEA 4EEFG 1O3SA 1WWXA 1XCBA 3FM3A 2V9KA 2R93J 3ULQB 3FM5A 2R7WA 2LFBA 2M9HA 3VYTB 1Z91A 2LR8A 5EG0B 2O3FA 1TW2A 3OMYA 1BIBA 2F4IA 2R7VA 1X1BA 4XLNF 1J09A 3ZQFA 4ZZLA 3VEPA 4B8XA 4A3LJ 1UFMA 4CYDA 2VQHA 3HL2A 2PJPA 2BZTA 3HEFA 3LSIA 5KNLA 4RB3C 1X1AA 2ISYA 1LEAA 3K1MA 1G4DA 1LJ9A 3K4NA 2RNJA 4KIFA 3R6SA 2B9SA 3HSFA 3I58A 4XKBA 3F8MA 3FXLA 3ZQ7A 2XDVA 3BCBA 2HZTA 1B8IB 3RZDJ 3ONQA 3PUFA 4DZPA 1YJNI 2HDCA 4NUBA 4AVPA 2ECCA 4RMNA 2ZSHB 4RAZA 2LBFA 3ZPLA 3HM5A 5IYCJ 2NRAC 2O6GE 1YO5C 3S16J 4EJWA 3U1KA 2KIQA 2ZKZA 1FLIA 2HXOA 1REPC 2WAEA 3F23A 3MFKA 3ABKH 5E79C 1FP1D 2GXGA 3E5XA 2KMUA 1R00A 1W7PB 3PQJA 3SYTA 2ZSIB 1JI8A 2DOFA 4BEHB 1R5ID 1JHHA 3KP7A 3FKJA 2EIMH 2Q1ZB 3ZCOA 4AD9A 2JA8J 3ZQHA 1MGTA 5AIPA 3BC8A 5AONA 1MMAA 3LSMA 2FBHA 2R7FA 1EA3A 4HF2A 2BV6A 2K3FA 1JXSA 2XAFA 1XG1A 1FX7A 3I54A 3MZYA 1WJEA 5IOZA 2XAQA 3V8KA 4UV8A 4LD5A 1G59A 1U8RA 2HEOA 2E7XA 1D5VA 1F5TA 2YU9J 2ADUA 1O7LA 4QPQA 3LAPA 4IKFA 3G6EI 2KKOA 4B44A 1B72B 4XLFA 1XSDA 2NOGA 3G3ZA 1AU7A 2DFHA 4PJMA 3OYCA 2HOTA 2O7OA 2QQ9A 3EUHA 1RZ4A 1S3JA 4AM3A 4XSZF 9ANTA 2K9QA 4RB2C 1K83J 4P55A 3WTXC 3QRFF 3MN2A 4MHGA 4OOIA 4XBFA 2EZKA 4B1RA 3GF2A 3SZGA 4F91B 1P7IA 2IGNA 1BBYA 2Y48A 1H9GA 5DEQA 2W7NA 1BR2A 2V26A 2VKDA 1DU0A 4E4HA 2F5CA 3T8TA 3G73A 4MO7A 4A3IJ 2PMZA 4J19A 3I4PA 3NARA 2YR2A 1TWAJ 4ZTFA 4IHWA 2EFPA 1WPKA 2IGKA 2M7BA 3K1NA 3FBIB 3CMAI 3IKVA 4P9UA 1X3ZB 2FF4A 3RKWA 4M73A 4BGDA 2G7HA 4XIDA 3IUOA 4RAGA 2ZNYA 1SAXA 4LIVA 5LGTA 3DBRB 3ZQCA 3LA3A 4NC8A 5DCMA 3KCCA 3QU6A 2Q2EA 2LNBA 4UB6C 3KEQA 3PNVA 2CS3A 4LK1F 4UVCA 2JPBA 4BBSJ 5HLIA 3ZQIA 4LG0B 2V9PA 2L01A 2B7EA 2Z1DA 3CCQI 1VQ9I 2WV0A 3KP3A 2VKHA 3K10A 2E2JJ 1SVLA 1DPRA 2QENA 1QPMA 2JTVA 2XSDC 1UJ8A 3R60A 1PDNC 5JLWA 2R5YB 2RN7A 4UUTA 1TBXA 3A01B 2H09A 1MSEC 2X6OA 2DMNA 4KYWA 2IS2A 5EZHA 2CGPA 3DXJF 2VODA 5FRNA 2DBBA 2K02A 1IC8A 1HSTA 3FXOA 2BHYA 1QHHD 4L9NA 5M5YJ 2VOOA 3BR1A 3OR1C 3BJAA 3T1BA 4OAYA 2KFDA 2LY2A 2W84A 4WXCA 3VYRB 1IUFA 5BPIA 2QSFX 3WTYC 5E1ZB 3K6GA 2A5WA 1JGGA 2K27A 5EEGA 3TOBA 1O3RA 5LHIA 1J9IA 2XGCA 1QGPA 1MH4A 1GXQA 1TLHB 5HVQC 3A4CA 3DBLB 1QU3A 4P96A 2P8TA 2HPIA 3PNTA 3K2ZA 3J7AY 5CQGA 1IXRC 2P5LC 1ZH5A 2DDBA 4HOBA 3K70C 5FRMA 2F4MB 1IV8A 4LGWA 3GTMJ 1BR1A 1GV5A 3FXMA 5E20A 3IP4B 1R49A 4DQ2A 2CU7A 2Y30A 4XN3A 5DCFA 1ETWA 2KPMA 3I3LA 2JUCA 1VQ5I 1VFCA 5H6QA 1B4AA 3J81K 5JLXA 2QBYB 1S5LC 1BC7C 4IQJA 1IN4A 2YX4A 3LFKA 5FB2A 3U9GA 1XGSA 5HNFA 3ABMH 1ZGAA 2ZMEA 3D5RC 1OYWA 1LKXA 4U7DA 4CYCB 1NK3P 2UXXA 1UAAA 3RYRA 4ZZDA 4U88A 2NNYA 1FEXA 4R8HA 2CQQA 3F8FA 3GTQJ 3HKZN 4HDUA 5LLQA 3LQQA 2K9MA 1RC9A 1RR7A 1WJFA 2LY1A 4QLCU 4P9FA 2F5EA 3KX2A 3LSRA 1QHGA 2BVMA 4GCVA 1WH7A 4M6YA 3BZ6A 2M0MA 2EFNA 3AFHA 3P9CA 3KZYA 1T39A 2B0LA 2RREA 1LUJB 2BY1A 3S1RJ 5HS7A 4G8XA 2P6SA 2K9NA 4G9YA 1WVRA 2MC4A 5KVRA 1S9HA 4ON0A 1RKTA 4UUSA 5B66C 3CF5F 4HQMA 5LRSA 4GYIA 1U0JA 3J7YJ 1D1AA 2E1MB 3KYCB 2M4GA 5E8GA 4BE2A 3FX3A 3J7AO 3CMYA 3DLLF 4N0BA 4IJAA 2GWRA 1FOYA 3K4KA 1ZRCA 3OR2C 2JK3A 1XDSA 1JUPA 3TL4X 2H8RA 4RGXA 1V54H 3HOSA 2MG4A 1MBHA 4BQNA 3IRRA 3KLNA 1GHCA 3GBGA 1Z3XA 3JTHA 4RBOA 4YFKF 3E3VA 5J1UA 3F22A 1E0EA 2VI6A 4KISA 3QQAA 3LMMA 3QP6A 3CC2I 2ME0A 3A02A 2FQ3A 1VQ4I 1V5GA 3TGNA 3I55I 4DGWB 1W5TA 1FJLA 1K78A 2KT0A 3S1NJ 3DEEA 1JE8A 2K9LA 4YEJA 2R7XA 1O7FA 2HYGD 5CVUA 3L2UA 1VQLI 4KN7X 3CCVI 5E18F 1CF7B 1S7OA 1WHUA 1FT9A 3N97A 1OLTA 1MH3A 2DA2A 3B6CA 4L5EA 1N77A 4Y7NJ 3HGGA 1UHWA 1PUFB 4L0YB 2ESNA 2O0YA 4PJNA 2PJRB 5F6FA 4EJTA 1CQTA 2BW3A 2L7MP 2F5VA 2QF7A 2P7CB 1VF9A 4B4CA 3EETA 4KUMA 3HOXJ 1HA8A 2XASA 1TT0A 3U2RA 3AAFA 2CW0F 3BY6A 1VNDA 3HOUJ 4UVAA 3F72A 3I5UA 2XC7A 1V5FA 3OYHA 2RV8A 4XN0A 5J1YA 4CSWA 4HZFA 5EEAA 2VJJA 3U1DA 1IN8A 1SVOA 2X1DA 3L09A 3QPHA 4EMSA 2D1VA 2WB1A 3HXLA 4UB8C 3VODA 4AYBA 4DOZA 2Z33A 3UNGC 1ERDA 4ABZA 5E1WA 5B3SH 2RGVA 1R58A 4ZTJA 2Y2ZA 5EEHA 1U5TC 4I6ZA 2NYXA 4BYYA 1OCZH 4XOPA 1HOMA 4BE1A 1X1DA 1W5CC 2A3SA 1W4MA 3ZQLA 4IHYA 4Y3OA 4BU2A 5KHDA 5K7ZA 2HPMA 2FA5A 2Z5UA 2CQXA 5FFZA 2FOKA 4M9ZA 3CLOA 3J7ZI 2F5DA 2R0QC 1I27A 1O57A 2LMDA 3L9FA 3PUBA 4M6VA 2M7AA 5CPRB 3W6JB 5B1AH 4ESJA 3EDPA 4C2MJ 2QSGX 4L0ZB 2VL8A 2QCOA 4RM3A 1WH5A 4XLHA 4O3MA 2DOEA 2VJ4A 2FSWA 1P92A 1Z7LA 2RC4A 3WTSC 3QP5A 2VPLA 4IHTA 4KDPA 1XCVA 2LREA 5JI6A 2UWMA 3L00A 4D5CA 3G4SI 2LBFB 4P1WA 1K79A 2GOMA 2LOOA 1FIPA 1K4TA 1STZA 1U8BA 1VQMI 3IV5A 1ZN2A 3BG3A 1T38A 4KT5C 1OR7A 3H0DA 1NH3A 2HKXA 2A07F 1DGWY 4GO1A 3LNQA 2UUZA 1TNSA 1Z1DA 5E3MA 2V1XA 5M3FJ 3W6VA 2A5YB 2VKEA 3KPHA 3ML6A 3R61A 4MTDA 5IT9Z 4C3JJ 2DLLA 1GVJA 2L4AA 2V1UA 3RTRA 1NTCA 2L3DA 2R7UA 4AIJA 4BHBA 1ETYA 3CCUI 1J5YA 5ILUA 2VBXA 5ICCA 2WADA 2CUEA 2W82A 4L9VA 3G71I 3WHBA 3AL0B 2OUMA 3GWZA 4E7SA 2ESHA 2GAUA 2H6CA 3A0BC 3PFYA 3X2QH 3ZQQA 5FD6A 2O03A 4JBAA 5EJCA 1C0WA 4UHTA 3W2WA 2YPRA 2OF7A 3GEZA 3WODF 4DW6A 3KFWX 4XNFA 4RGRA 1FOWA 3F0CA 3JCUC 3MD2A 4CZCA 4XLCA 1JKQC 5KK1A 4M9SA 3CUQA 2LVSA 1OYYA 3NRVA 1GV2A 1VI0A 3JAMZ 1IDZA 3U21A 4D1QA 2KRCA 4YIIA 4I7HA 3REOA 2JA7J 1LFUP 1Q1HA 2EV6A 1SD7A 2Y0MA 1BA5A 1XSXA 3H5AA 1Z6RA 2MA3A 1LEBA 2VXZA 4HRIA 1T0FC 3PO2J 3M8FA 2M30A 3VFZA 1XSVA 3K4LA 3RKXA 3BG7A 2DT6A 4KN4X 4EATA 1KGSA 3G1MA 2HS5A 4Z2YA 3SDBA 4WWCA 2CV0A 3MAJA 3K4MA 2R7TA 3NAUA 3WGHA 4CCLA 1B1BA 2HQRA 5DCMB 2PI0A 2Q2EB 2R7QA 3NWTA 4A93J 5D6EA 2VXDA 1DP7P 2P5VA 1B9NA 3E0JB 1G6NA 2DFEA 1I3AA 1F4KA 4IEJA 3VSLA 2KISA 2IA0A 5GAEJ 4LK0F 1OCPA 3KP6A 3TDZC 3PO3J 1Z67A 2X6WA 2E2IJ 3RJPA 4M3FA 1T6SA 1VTNC 1XS9A 2X51A 2YSRA 5C4JJ 5GPCA 3OY9A 1JJ6C 1YG2A 3SEZA 2DW4A 4C2TA 1IN6A 3AG2H 3RDIA 4KIBA 3N4MA 1ON1A 1OKRA 2IS6A 4B48A 6PAXA 2W85A 4KICA 4XONA 3PM1A 2PMZN 1WJAA 3A03A 3KP2A 2PG4A 1IUYA 4RS8A 2KP6A 3CCMI 4KA4A 2J5OA 2VONA 3BR5A 2IPQX 1D8JA 5EGOA 2BY3A 4Q47A 2QEXI 4W1UA 5GP9A 5D6FA 1BI0A 3K1PA 5F0CA 4EM2A 3GZ6A 2XGXA 1S72I 3L2RA 2GLOA 3OYNA 4U87A 4IOCF 1TWHJ 2JVGA 4NNJA 3DQVC 2X48A 3R0JA 4BL0B 2ZJ2A 2LKXA 4JX5A 3H9QA 3CP8A 2RQQA 2JJ7A 2BY0A 1E3HA 1XDUA 4NC7A 2M34A 2MFZA 3ZGKA 5HDKA 4ZYDA 3WU1B 4MIMA 4R1HA 2LTPA 2WC2A 1JTXA 4KNYA 1OCRH 2HVQA 2ZXJA 4AIHA 1B59A 3W3CA 3H5RA 3DU6A 3JRFA 2W00A 3LOCA 4Z6YA 2W57A 1K61A 2DXIA 4C2UA 3GTOJ 3ZN1A 2X0LA 3K9TA 1A35A 2NVUB 2XAJA 4MTEA 3JW4A 2LSOA 2M3AA 5FLVA 2ZMEB 1R7JA 1ZARA 4PGHA 4PUSA 4A0ZA 4BDZA 1LB2A 1F9NA 2AXTC 2JSPA 1Z7UA 3L2QA 2IGOA 3S3MA 2G7UA 2CUJA 3DTIA 4XOTA 1XC5A 3P9IA 5HDNA 2JSCA 2VOPA 4CICA 4YFXF 4LB5A 4QWQA 2LC2A 3K2AA 5C4XJ 2DO7A 3CJRB 1ETQA 3M07A 5TJJA 2E5ZA 3GUDA 4IPAA 4N9IA 3F3XA 2LG4A 4HNUA 3OYDA 3ERMA 4UUSB 2DK5A 3LL7A 1AA7A 3OYGA 1L0OC 3N05A 4PJJA 2L9NA 3GW2A 3MWMA 2IT0A 3IWFA 2MH2A 2DU9A 3WTTC 1T33A 4RA2A 3V4GA 3H36A 4ASNA 5DYMA 4BDYA 1ETKA 3HBLA 3GFJA 3QPTA 3QYEA 4GRIA 1SMTA 1LFPA 2XVCA 2P7VB 3GFLA 3EYYA 2GIVA 1GVDA 4NQWA 1VQPI 3WGGA 1SFUA 1YW7A 4BXXJ 3LA2A 2VBYA 1BJZA 3OIPA 2RKHA 3DKWA 4IHXA 4NBQA 3TEDA 3L2CA 2M8EA 1X4PA 2JVHA 4A3MJ 1P4AA 3BPXA 5EF6A 3PQKA 3ZMUA 1W36C 2VASA 3TMOA 2VJIA 4W97A 2HU9A 2BOLA 4F7ZA 1YQAA 1K78B 2IA2A 3WGIA 3ERED 4D0PA 5IP9J 2CWEA 4E7JA 3AG3H 2DTRA 3HTUA 1E2XA 4FASD 1HLVA 4FT8A 4B3AA 2IP2A 5KCMA 3MKLA 5LGNA 2PFBA 3QYBA 3SQNA 1OCCH 2VB6A 1JGSA 4HNTA 5CKTA 2ZJRF 1VQKI 4OIOF 2XPUA 3VYUB 2FQ4A 3CLQA 1S7EA 3PSFA 3DKXA 2OZ6A 1H0MA 1U3EM 2VT2A 4ETSA 1GDTA 1U9OA 3BG5A 3FXUA 3IL2A 2NAZA 3RI4A 1U2WA 2BW3B 3ABUA 4XRFA 1MW7A 3RQ4A 3H1CA 1N75A 1OYIA 4NHJA 4IVNA 2CMPA 5ICFA 5LHHA 4H0EA 1ZR4A 2PX9A 1DPUA 2K5CA 3CDIA 2KIFA 1TTYA 2DQRA 2XF7A 3S3OA 3BR3A 1E3OC 2BYVE 3QPLA 1PYVA 1RI7A 4F55A 5J3LA 3MVPA 5HS8A 1JKRC 1KQ9A 3GTLJ 2Z3YA 1EF4A 5CVRA 2BY2A 2FJ1A 3QU3A 4HX7A 2R7RA 1ETOA 4BQOA 4M72A 1WJBA 2EBIA 5GAGJ 1P2FA 2XIGA 2VE9A 3C7JA 4EJUA 2VLAA 2HDWA 3K4CA 4ZDLA 4JX4A 3ZMVA 1T08B 1EH6A 3BZCA 4BQQA 3HOZJ 3H3UA 2FE3A 2IAIA 5D8LB 2A69F 4OIQF 2XPVA 1PUEE 3S15J 2QKMB 3P9KA 3HOVJ 4Y4RA 1RUOA 4X6AJ 5CVJA 3PFIA 3QYFA 4FISA 5CLSA 2EK5A 1O3QA 2CH0A 1H8AC 3CD6I 2YX7A 2EJRA 4MNUA 1TQMA 1WQ2A 3C1DA 1FNNA 1LVKA 3HTSB 1JUSA 5JHFA 1RR8C 2DMPA 2EV5A 4A3CJ 3IH3A 4GGGA 4PDKA 1MNDA 3RKQA 5CYVA 4EVIA 3J80Z 1D1CA 2JMWA 2WBMA 4XORA 2AQFA 4EV0A 3FMSA 2ZXIA 3GZ5A 4HA8A 2Y75A 3Q0WA 2B63J 3AG1H 4IX7A 5F1JA 1I6HJ 3HPGA 4A3JJ 5B1BH 2GA1A 3F8CA 4D7MA 1QO0D 2EIJH 1QVTA 5DS9A 1G8XA 4LITA 2WB1N 1WJDA 2FEZA 4AYBN 4DYQA 4IHVA 1R1UA 2E1CA 2DA3A 1R5HA 2UXNA 1WJ5A 1QZYA 2HR3A 1D5YA 2KIUA 3K70D 1YYVA 5J4YA 2EB7A 2QYOA 3GYHX 2UZKA 3L2VA 3FHZA 3FXJA 2DFFA 2X1EA 4YIRX 5BMZA 1JTYA 5JR3A 2O5RA 4XM3A 1USSA 2YUSA 4BJ5C 2GOXB 1EH7A 4CCJA 4II2A 2RNGA 4UXNA 2JPCA 5F1RA 1D3YA 2KHMA 3HZJA 3HOTA 3BOQA 2EV0A 1KU7A 2GM4A 1G3TA 2ID6A 3EUKL 1Y1VJ 1KU3A 4KMUX 1TNTA 3S8PA 1K6OA 2LH9A 2RQPA 2CW8A 2V1NA 4BHCA 4GDFA 4I0AA 3BTIA 3H9JA 4ZYAA 5HODA 5E3LA 3I59A 1BW6A 3OIQA 2E1OA 2DK8A 3FXQA 2VE8A 4HF0A 5DD4A 2CFXA 2Y69H 3CUQB 3WTUC 3ZXSA 2STWA 5FLXZ 3GTGJ 1BOBA 1ZQ3P 3DPTA 5F27A 4ENMA 3WTVC 3CMEI 3BTLA 1R1VA 4IF4A 4BACA 2PLYA 3D1NI 4B43A 3Q9SA 4KT6A 4CA0A 2EA4A 5FKOA 1DQUA 4K2EA 2D2WA 3EQLF 1NG6A 3I0TA 4M3GA 2J5PA 3BQYA 3B6AA 4HPQA 5TGTA 3KP5A 4M74A 4PFOA 2LP0A 2PMUA 4HLXA 2R3SA 3HOYJ 3OYAA 3J80K 3FMRA 5GPAA 3BP8A 1ON2A 2R4GA 1K6YA 1HW5A 3T0YA 2L7KA 4XSXF 3DPLC 2EQRA 1SD5A 1EKEA 4N9HA 1BC8C 1O3TA 2MD0A 5L3EA 2ACJA 5D4RA 4BS9A 2C6YA 5B5EC 2XGDA 3BG6A 2RVCA 4FETA 3E1SA 3G1OA 2VQLA 2MLGA 3JRCA 1SD4A 2ICWG 3O6BB 1T8IA 1MJAA 1DUXC 3CO7C 1I3QJ 3E6CC 2X1CA 3L7WA 3ABLH 3V7CA 1MMDA 4ZYEA 4P5OA 2MD5A 4XRSA 3JRAA 2ZFWA 3MKWB 2DI3A 5IOYA 2CV2A 2LLKA 1ZTRA 4HX4A 4AUXA 3GZNB 2HQNA 1ODDA 4XLAA 1HKTA 4M71A 1SVMA 1IO2A 3T5XA
chains in the Genus database with same CATH topology
2QA4I 2ZJQF 1FOXA 2ZJRF 1VQKI 3CMAI 1FOWA 1YHQI 2H8WA 2JQ7A 3CCRI 1MMSA 5GADJ 2E34A 4V19K 5DM7F 4IO9F 3CJTB 3PIOF 1VQ8I 3CC7I 3CCQI 1VQ9I 3CF5F 1YJNI 1YI2I 3CCLI 3J7YJ 3CCEI 3J7ZI 2OTLI 3DLLF 1VQ6I 3CMEI 5GAGJ 1ACIA 1FOYA 5DM6F 3I56I 1Y39A 2E36A 2ZJPF 1VQ7I 2E35A 5GAEJ 1YIJI 5JVGF 5GAHJ 3CC2I 2K3FA 3G4SI 1YJWI 1VQ4I 3CC4I 3PIPF 1VQMI 3I55I 3CD6I 1QA6A 3G6EI 3CCSI 1VQLI 4UY8I 3CCVI 1VQPI 1YJ9I 3CCMI 2OTJI 2FOWA 1HC8A 1VQOI 4IOAF 2QEXI 3CCUI 1VQNI 1VQ5I 1S72I 3G71I 2NXNB 4IOCF 3CCJI 1YITI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 I;  2ZJQ F;  1FOX A;  2ZJR F;  1VQK I;  3CMA I;  1FOW A;  1YHQ I;  2H8W A;  2JQ7 A;  3CCR I;  1MMS A;  5GAD J;  2E34 A;  4V19 K;  5DM7 F;  4IO9 F;  3CJT B;  3PIO F;  1VQ8 I;  3CC7 I;  3CCQ I;  1VQ9 I;  3CF5 F;  1YJN I;  1YI2 I;  3CCL I;  3J7Y J;  3CCE I;  3J7Z I;  2OTL I;  3DLL F;  1VQ6 I;  3CME I;  5GAG J;  1ACI A;  1FOY A;  5DM6 F;  3I56 I;  1Y39 A;  2E36 A;  2ZJP F;  1VQ7 I;  2E35 A;  5GAE J;  1YIJ I;  5JVG F;  5GAH J;  3CC2 I;  2K3F A;  3G4S I;  1YJW I;  1VQ4 I;  3CC4 I;  3PIP F;  1VQM I;  3I55 I;  3CD6 I;  1QA6 A;  3G6E I;  3CCS I;  1VQL I;  4UY8 I;  3CCV I;  1VQP I;  1YJ9 I;  3CCM I;  2OTJ I;  2FOW A;  1HC8 A;  1VQO I;  4IOA F;  2QEX I;  3CCU I;  1VQN I;  1VQ5 I;  1S72 I;  3G71 I;  2NXN B;  4IOC F;  3CCJ I;  1YIT I; 
#chains in the Genus database with same CATH topology
 1R36 A;  1FOX A;  4ENK A;  4R79 A;  2P81 A;  4S04 A;  1RET A;  3S1M J;  4E6K G;  4LOC A;  5EGO B;  2LK2 A;  5LD2 C;  4CHU A;  3C2G A;  3RSN A;  4X0G A;  4KJZ A;  2L9R A;  2WAF A;  4LLG F;  4V2G A;  2MC3 A;  1R9T J;  2QVO A;  1W0T A;  2H1K A;  1F36 A;  1RPW A;  3BQZ A;  3KYL A;  5JFR A;  1MKM A;  3K4J A;  1AKH A;  3WG7 H;  1WKM A;  2DMT A;  4G6T B;  2JRM A;  3PIO F;  1S29 A;  3D5S C;  3PNY A;  4AWX B;  1QBJ A;  2HTS A;  1DGR M;  5GTH C;  4WXH A;  1W1W E;  5EDN A;  2HOE A;  4OIN F;  3RPU D;  1POG A;  2XUB A;  2E1M C;  2F2E A;  3HRT A;  3CCE I;  2TDX A;  1CGP A;  1FBU A;  3T8R A;  1Y8Q B;  3OYE A;  3A2K A;  4ENN A;  2DTZ A;  3HOW J;  4A69 C;  2IW5 A;  2E36 A;  3OS2 A;  1IJW C;  2K4J A;  3QOE A;  2XAG A;  4HEA 2;  1VQ7 I;  2E1N A;  1MBG A;  2DMQ A;  2GBY A;  4E70 A;  1QQI A;  1TWF J;  4HBL A;  5GAH J;  5E8I A;  5M5X J;  1GUU A;  5BOX A;  5L3B A;  4QPO A;  1WGX A;  2Q8K A;  1AOY A;  2EA2 A;  4Y33 A;  1SFE A;  4FE4 A;  5K5R A;  3L2W A;  1ZK8 A;  1YE9 A;  3COA C;  2CRG A;  4E7K A;  4HQE A;  3CZ6 A;  1UEL B;  2KDZ A;  2FBI A;  3BR0 A;  1XMA A;  1G3S A;  3UKG A;  1YX5 A;  4HST A;  3GTP J;  4EM0 B;  3MZH A;  3F6V A;  3GLL A;  2BHZ A;  2DOD A;  3LFU A;  2G9W A;  1S7A A;  3FK6 A;  3LSG A;  4ESF A;  3K7A J;  4LB6 B;  1D1B A;  3SFI A;  2EIK H;  3QPS A;  4RDU A;  4JP0 A;  2G0E A;  4FCY A;  1R4N B;  2PQ8 A;  3S2W A;  5E3O A;  3C2B A;  4CGZ A;  1ONV A;  5LEJ A;  4E7L A;  4GFB A;  5HLT A;  3F6O A;  5IPA A;  3OYJ A;  4OIP F;  1Y0U A;  3RIR A;  2LF8 A;  4MGR A;  3V7S A;  1NK2 P;  2EIL H;  4L5J A;  3OYF A;  2FRH A;  5CVV A;  4NQW B;  2BVL A;  2XPW A;  5FKN A;  1D0Z A;  4MEX F;  4HW0 A;  2E7W A;  1I39 A;  1J2X A;  4I02 A;  1YRN A;  1YHQ I;  3CDH A;  2HQA A;  1DDN A;  1IF1 A;  2GXA A;  4Y13 A;  5LRR A;  4ANJ A;  1I1G A;  3HSR A;  2HYJ A;  5LFA A;  1APL C;  1IRG A;  4PCQ A;  5L3F A;  1IN5 A;  1YS7 A;  2MW8 A;  2FD5 A;  2EWN A;  3OS0 A;  5GAD J;  2VPR A;  3M9A A;  3CJN A;  1J59 A;  3HRS A;  1BW5 A;  3RCO A;  2Y0S A;  4UUV A;  3HUG A;  1F1Z A;  2A6E F;  4LIU A;  4EJV A;  3E6B A;  1HKS A;  2PBI A;  3CC7 I;  4HF1 A;  2Z9O A;  1MSF C;  1OCO H;  3HHG A;  2JUG A;  2V7F A;  5FLM J;  1YI2 I;  2XF6 A;  3D0S A;  4ZYH A;  4V2F A;  2HKO A;  3C3W A;  5JHU A;  2MH9 A;  4DIQ A;  5IP7 J;  3ZMT A;  2VQC A;  1R1T A;  4A3G J;  5L3D A;  1FMW A;  1XGO A;  4U0Y A;  5DM6 F;  2JA5 J;  5ICE A;  3ZN0 A;  4G94 A;  4JOM A;  3LQR A;  3FIW A;  2GXB A;  2HFH A;  2VIX A;  2GIZ A;  4MLO A;  4M9X A;  1YFH A;  2L5Q A;  2LF7 A;  1BR4 A;  1IZ1 A;  2GQQ A;  3JRE A;  3HPH A;  5L3C A;  3GFM A;  3Q0U A;  1MDM A;  2ELJ A;  3M4O J;  1LQ1 A;  1H9T A;  4UVB A;  2EFQ A;  1GT0 C;  3SHF A;  2O9L A;  2MGQ A;  3H3Z A;  3SFZ A;  3WHC A;  4PJ0 C;  5D5V B;  4Y15 A;  2XAU A;  4CCN A;  2CQ7 A;  1FWZ A;  2ZB9 A;  2ELK A;  1ETX A;  3OIO A;  1ZRF A;  2FNP A;  3BT9 A;  4J01 A;  1FC3 A;  2HXI A;  4ZH4 F;  1P6R A;  1MBE A;  3AG4 H;  1Z21 A;  2XB0 X;  4ZC3 A;  2O61 A;  5J8C A;  1U6G A;  4G6D A;  1TWG J;  2ME6 A;  1A6Q A;  2ZFU A;  1LFB A;  3K4B A;  1HDP A;  2K9S A;  1VQO I;  2OPT A;  3WU0 A;  4C3I J;  3O3K A;  2JT1 A;  3RPU A;  5HOO A;  3LSJ A;  4L9T A;  4Y17 A;  5IT9 K;  2O8X A;  2M8G X;  3CQZ J;  3KE2 A;  4A3E J;  3AL0 C;  1XB4 A;  1FOK A;  1ITY A;  5LEK A;  4WX9 A;  4I76 A;  5C3E J;  5M5W J;  5K5O A;  1BN5 A;  1U5T A;  3B02 A;  1E17 A;  4ZDP A;  4I01 A;  1A36 A;  3EUH C;  3JRB A;  3BWG A;  3TO9 A;  2BBY A;  3HHH A;  3GX4 X;  5CQE A;  4XR6 A;  1I1S A;  1FY7 A;  1ZRD A;  4FTH A;  1TT5 B;  3LSK A;  1MBK A;  3VPR A;  4RM2 A;  4J00 A;  4MFE A;  4TV7 A;  1FTZ A;  5J1R A;  3SEQ A;  1TQP A;  1G3Y A;  2M1B A;  1WZ2 A;  1XGM A;  2E34 A;  2UV1 A;  5K7H A;  2QUF A;  5D8K B;  2DA5 A;  1LDJ A;  3JAM K;  4IO9 F;  4Q48 A;  2VC0 A;  1YX3 A;  3GME A;  4G7H F;  4D5F A;  2P6T A;  1W0U A;  4IZZ A;  2I8D A;  1P9Q C;  2LYC A;  3DEU A;  4BKX A;  2CYY A;  3MMY B;  2X9D A;  3V8L A;  3CCL I;  4PSX A;  1XGN A;  1PP8 F;  1XMK A;  3H35 A;  4GYG A;  5D5W B;  2H94 A;  3CJQ B;  3OSG A;  3V7R A;  1FTT A;  3S1Q J;  3LAJ A;  5M3M J;  5IYB J;  3OSF A;  4D9J A;  4XQF A;  2EZL A;  4BAY A;  1PJR A;  3E5Q A;  3H3V K;  3ASN H;  2Y31 A;  2IXS A;  2RDP A;  3FZV A;  2HZD A;  4DJA A;  1XD7 A;  4IRH A;  3I9V 2;  2A61 A;  4L9J A;  4O5V A;  1OQY A;  3BCA A;  3I59 B;  4EM1 A;  2BEO A;  3PL8 A;  2E71 A;  1Y1W J;  3Q0V A;  3OOP A;  1YJW I;  1TP4 A;  3CC4 I;  1AWC A;  4XKC A;  4LJZ F;  1YOV B;  1MNE A;  3KYD B;  3WTZ A;  3Q9V A;  3VWB A;  2BXZ A;  2V6E A;  1ZG5 A;  3HDD A;  3QOD A;  5EYR A;  4BNC A;  3NQO A;  3BJ6 A;  3BLY A;  4KFC A;  5FD5 A;  1QA6 A;  5K7F A;  2FML A;  2XRL A;  1KYZ A;  2Z2S B;  1KA8 A;  2D1H A;  3D5L A;  4BHP A;  3SDG A;  1YJ9 I;  3QWL A;  3F9K A;  3BTC A;  3BPV A;  3A0H C;  3JTG A;  1T56 A;  2MYS A;  2DT7 B;  3TW6 A;  3ABT A;  4DYR A;  1SFK A;  3MKZ A;  3TO6 A;  1H88 C;  1BOA A;  2OTJ I;  3FHN A;  1X1C A;  2A6T A;  3ASO H;  3BRO A;  2XSJ C;  1XTA A;  1I6X A;  1Y56 A;  2BXY A;  2H6B A;  2KLO A;  1T98 A;  1RKW A;  1VQN I;  2YU3 A;  3G1L A;  2IS4 A;  3OYI A;  3WG9 A;  3DKY A;  2LKS A;  4CH7 A;  2L54 A;  2TCT A;  4HX8 A;  4BXF A;  2I10 A;  3JR9 A;  3RYP A;  3FXR A;  3C2H A;  2PN6 A;  1S6L A;  1Y8R B;  1KQ0 A;  3OWT A;  4U0W A;  4PK4 A;  2AO9 A;  1T0F A;  4Y52 J;  5A2Q Z;  1FBS A;  2OQG A;  2ZBK A;  1HQC A;  4JYK A;  3E6D A;  1W36 D;  1MJ9 A;  2M2E A;  1K7A A;  2CJJ A;  1IGN A;  1MMS A;  3JSO A;  5LGU A;  3W2A A;  2HTJ A;  3ZR8 X;  4G7Z F;  2NVQ J;  4CDG A;  3G2B A;  4XKW A;  3F8N A;  2F5F A;  3OYB A;  2KJC A;  4BQA A;  4QIW N;  5FJ8 J;  1X1P A;  4IRI A;  3E97 A;  2R92 J;  3ELK A;  2ZME C;  1Z05 A;  2VJ5 A;  2CFO A;  3KZI C;  1VQ8 I;  4E7I A;  3GFI A;  2IBD A;  5J40 A;  1BJA A;  2Z16 A;  4RGS A;  2EIN H;  3DF8 A;  2IVM A;  4RAF A;  3IWZ A;  2VBZ A;  4EGZ A;  4N4O B;  5C44 J;  4PSW A;  2HI3 A;  4HLY A;  3LSP A;  4FX4 A;  2YS9 A;  5K1Y A;  4WCG A;  2P4W A;  4IL6 C;  2WAQ A;  4DNC A;  4ESB A;  1Y0N A;  4XLP F;  1FIA A;  1KZH A;  1SMY F;  2NS8 A;  2KQR A;  2NVY J;  3I56 I;  1AKH B;  4WXD A;  2ZJP F;  2M4K A;  1OFC X;  1FYK A;  3VDX A;  3DBH B;  5H20 A;  3OYL A;  2M87 A;  2KRH A;  3PSI A;  2DA7 A;  2LD5 A;  4I98 B;  2FU4 A;  3GCM A;  4A0Y A;  2F6C A;  3BTJ A;  1H89 C;  1EJ9 A;  1UMQ A;  2QSH X;  2JA2 A;  3F21 A;  1BM9 A;  5FKK A;  5BQT A;  1W7P D;  1WFX A;  1TZL A;  1JKP C;  1IDY A;  1MD0 A;  1JKO C;  1XN7 A;  2CSO A;  2DDA A;  2L7Z A;  3CP2 A;  1XX5 A;  5BS6 A;  2D45 A;  2DA1 A;  3HSE A;  1IRX A;  3Q3S A;  2OBP A;  1LPQ A;  4BXU A;  3CDL A;  3IC7 A;  3IAS 2;  4CCM A;  1V3F A;  2CUZ A;  2ZNZ A;  5DUK A;  1RUN A;  1JHF A;  2H27 A;  3PJR A;  2FNA A;  1MNM C;  2JWT A;  4BY7 J;  1FSE A;  3V8J A;  1ZYR F;  3J81 Z;  2FOW A;  4RAY A;  1D8K A;  1V5E A;  2W48 A;  5A2Q K;  1FZP B;  1BI3 A;  1Y6I A;  2ID3 A;  2R7S A;  2L9S A;  2R7O A;  2DCE A;  2NXN B;  5F64 A;  4FQG A;  3R4K A;  2HNH A;  2EH3 A;  1OJL A;  1MMG A;  4CCO A;  4LFU A;  2XGE A;  2DJN A;  1UB9 A;  3OYK A;  1Z6T A;  2X6X A;  3B73 A;  2PEX A;  3CUO A;  4MFD A;  3C18 A;  3H5N A;  4LMY A;  2V79 A;  2HOA A;  3WE3 A;  2XV4 S;  1QZZ A;  2L4M A;  1ZGW A;  3E7L A;  2WTE A;  2ELH A;  5TRD A;  3CCR I;  1LNW A;  1BL0 A;  2XF5 A;  4C30 A;  1P4W A;  3IH2 A;  4AC0 A;  2MAB A;  4CXF A;  3ESW B;  2M5W A;  1HXD A;  1LDD A;  1LE8 A;  2W1O A;  2Y9Y A;  4JK1 X;  4I2O A;  4XKV A;  3OL4 A;  1SFO J;  4B3X A;  2A05 A;  2FBK A;  4NC6 A;  4CZZ A;  4HV5 A;  4N4N B;  1U9N A;  1OMI A;  1HSJ A;  2ZC2 A;  3OL3 A;  4BBR J;  1QNT A;  1YRN B;  3FIS A;  5DDG A;  4XLE A;  3KIO A;  3LST A;  3JRH A;  1IG7 A;  1LDK B;  2KZV A;  1UZC A;  5LBQ A;  3S3N A;  3M8J A;  2WY7 Q;  1G2H A;  2EPF A;  1R23 A;  2R5Z A;  2E5N A;  1LVA A;  2OTL I;  1FBQ A;  3MEX A;  4WK8 F;  1T95 A;  3I71 A;  3CF2 A;  3HUG B;  3IAM 2;  4OU0 A;  5DUI A;  1OCT C;  4M3D A;  3DV8 A;  2K4B A;  3W2V A;  4YRV A;  5F0F A;  1HKQ A;  3TP3 A;  4NB5 A;  1KYW A;  2P5K A;  4WF2 A;  2MSY A;  2A6H F;  4BH9 A;  2QGU A;  3SXY A;  1Z9C A;  5HS9 A;  3FBN B;  1SEU A;  3GTK J;  1N25 A;  5FFX A;  3JSP A;  2Z99 A;  1ZG1 A;  4A3K J;  3NWS A;  4A0X A;  1EV7 A;  2AXL A;  3TP0 A;  4OAZ A;  5J47 A;  2P0W A;  4GXO A;  5CJ9 A;  1F43 A;  4ZDO A;  1D0Y A;  5HLG A;  1GLN A;  3OV8 A;  2IEK A;  3IRQ A;  4F92 B;  4KIT B;  1HDD C;  1Z3Y A;  1MDM B;  2D5V A;  3FMQ A;  2HWV A;  4RB0 A;  3TDU C;  2LRD A;  5ICG A;  1ZGJ A;  2XRN A;  4DYC A;  1V4R A;  1OIS A;  4I99 C;  5EG0 A;  2XRO A;  5DV5 A;  3BR6 A;  4HDV A;  2IRF G;  4IOA F;  4IHS A;  3H9G A;  1OR7 C;  2NVT J;  4BJT A;  4BY1 J;  1OPC A;  3S2H J;  2DAO A;  2ETH A;  4RB1 A;  3MCZ A;  4CO8 A;  2FMY A;  2XKP A;  3CTA A;  3TOA A;  5ERI A;  3ZOB A;  1KON A;  4IRG A;  1UG2 A;  2Y0S N;  2QZ8 A;  3I64 A;  4EJO A;  2NNN A;  3HRM A;  3LA7 A;  2DN0 A;  2EFW A;  1YIT I;  1YW9 A;  4AID A;  2QA4 I;  2I5U A;  1VZ0 A;  2ECB A;  1T2K A;  1B8I A;  2DYS H;  3DLA A;  1N78 A;  2L2O A;  3JRI A;  2VC1 A;  4ITV A;  2H8W A;  2JQ7 A;  4G6Q A;  4BJ6 C;  4G7O F;  4A3F J;  3MZ8 A;  3RQI A;  4XRS G;  2QQA A;  1BIA A;  1TWC J;  4KMF A;  3L1P A;  4RLF A;  1U5T B;  4XL9 A;  1W5S A;  1FPQ A;  3S14 J;  4A6E A;  2L9V A;  1W7P A;  4YIF A;  3CJT B;  2E60 A;  4G12 A;  4BEH A;  4CCK A;  4HSR A;  1MJB A;  2HVS A;  3ECO A;  1A6I A;  3BR2 A;  2V4J C;  4BUP A;  3MKY B;  2E19 A;  4PGG A;  1TQI A;  4ZJZ A;  3I4N J;  3CUQ C;  4E7Z A;  1PVE A;  2DOA A;  3HG9 A;  5IYD J;  2VQG A;  1D0X A;  1FYM A;  3K0L A;  2DPU A;  2DA4 A;  1VQ6 I;  2VUM J;  1WI3 A;  4A5M A;  4RLQ A;  2H1L A;  2OA4 A;  2ZXW H;  5TIS C;  3WTW C;  5FLX K;  2VN2 A;  3H0G J;  2JZY A;  1SD6 A;  5IP6 A;  3QAH A;  1Y39 A;  2AHQ A;  2EZH A;  3BJO A;  1B72 A;  3BZK A;  1IN7 A;  3ZP5 A;  3TBI A;  2Y9Z A;  2TRT A;  2KZG A;  1YIJ I;  2CQK A;  2OD5 A;  3QOP A;  4DZJ A;  2XB5 A;  5F04 A;  2L02 A;  1WRJ A;  5FKL A;  3DWL E;  1RIO H;  2GA2 A;  2WWY A;  1MZB A;  2CV1 A;  4HNV A;  2OC6 A;  4UV9 A;  2K7L A;  1ZG3 A;  1HF0 A;  1P4X A;  1SAU A;  1IRZ A;  2ZCW A;  3ZMD A;  2XKO A;  1QPI A;  1SFX A;  3TW7 A;  1FSH A;  2BGC A;  1V55 H;  2JRT A;  4IXA A;  3H92 A;  2IGM A;  2ISZ A;  5F08 A;  2JA6 J;  5IY5 H;  1J75 A;  4A5N A;  2VBW A;  1SC7 A;  2WA0 A;  1QZE A;  3M8E A;  4DBR A;  1YLF A;  1UHS A;  4LLL A;  2KJB A;  2NS7 A;  4OIR F;  1GXP A;  3KEO A;  1NG7 A;  4PJL A;  1DP3 A;  2Q0O A;  4H4K C;  1B6A A;  2K85 A;  3FKI J;  4XK4 A;  2W4S A;  2K40 A;  3K69 A;  2KRF A;  4XIC A;  1I50 J;  2HVR A;  1ORK A;  2CUF A;  1MBF A;  4B09 A;  4M3E A;  3DTK A;  3IH4 A;  3KET A;  1QVU A;  4LLN A;  3JRG A;  2OCE A;  1WCM J;  2OZU A;  4M3B A;  3O8G A;  2V6C A;  1HBX G;  1ULY A;  2DA6 A;  2IJL A;  3F8B A;  3CCJ I;  1B9M A;  4LG0 A;  1M1E B;  3M1E A;  2ZJQ F;  2CG4 A;  4BE0 A;  4E7H A;  1QRY A;  4QTR A;  3FXK A;  2EFO A;  1K4S A;  3ZMS A;  2V1D A;  1X3W B;  1A31 A;  1Z77 A;  5HNH A;  2LY9 A;  3O8H A;  1ETV A;  3VB2 A;  2EZI A;  4XMY A;  5DD8 A;  3TQN A;  2DYR H;  4AVZ A;  2QKL B;  5E17 F;  2R5Y A;  3LWF A;  4M6X A;  3CO6 C;  3P5J A;  4V19 K;  4OWR B;  3DEW A;  2OAZ A;  2LDU A;  3A01 A;  4A3B J;  3EPZ A;  3HC7 A;  1FYL A;  1J0R A;  1MBJ A;  1ZEL A;  2X85 A;  1ZKG A;  4I09 A;  2A68 F;  5KAI C;  3O2P E;  4MQV A;  2O8K A;  3GO5 A;  2M45 A;  1X3U A;  1SAN A;  1TC3 C;  1E3P A;  4PFP A;  1UHM A;  3HKZ A;  2OU2 A;  3TKY A;  5KAF C;  1UCR A;  3VYS B;  3ZRG A;  1FMV A;  5H6R A;  4AIK A;  1IV6 A;  2WV1 A;  3S93 A;  4II3 A;  5HDG A;  2DFI A;  1PP7 U;  2IS1 A;  4FE7 A;  1R6R A;  3RKY A;  5FGM A;  3EYI A;  3RZO J;  2RAE A;  1ACI A;  1HW2 A;  2XAH A;  4YG2 F;  4UNO A;  1TW3 A;  1IRF A;  3LSH A;  4XRM A;  2F4O B;  3FF5 A;  1AHD P;  2STT A;  1HCR A;  1EH8 A;  4OMY A;  1R4M B;  2DMU A;  3M3Y J;  3S17 J;  1UST A;  1RES A;  5GTI C;  3CMM A;  5IT3 A;  2IA1 A;  1JUM A;  2MBF A;  1IXC A;  2WY8 Q;  5D5U B;  5DTD A;  2HGC A;  3SJM A;  2W24 A;  4HAM A;  5K5Q A;  1R22 A;  2CQN A;  4IQ4 A;  3HIF A;  3DU5 A;  4ENJ A;  1IAW A;  1Q1V A;  4U7B A;  1ZRE A;  2KDO A;  1YTY A;  5EZG A;  2FX0 A;  1S8N A;  2PMH A;  4F93 B;  4OMZ A;  5BNG A;  5L3G A;  1JT6 A;  2JN6 A;  2OQR A;  2QBY A;  4C9Y A;  2ZO4 A;  5AIQ A;  3ISP A;  1KQ8 A;  3HRU A;  4HG2 A;  2AQE A;  2XHK A;  4UY8 I;  3SZT A;  1HW1 A;  3ZMZ A;  5D4S A;  3GTJ J;  3FDY A;  4PZJ A;  3GXO A;  4CYC A;  1P7J A;  2K86 A;  2E2H J;  3OOU A;  1RRJ A;  1X19 A;  1KU2 A;  4EGY A;  1MIJ A;  1JT0 A;  4YEL A;  2L0K A;  5LHG A;  1HC8 A;  4NDL A;  2QQ8 A;  3DFG A;  3HB9 A;  1WI9 A;  2NOJ B;  3R0A A;  4EQQ A;  4QSH A;  2M0C A;  2HOS A;  2QWW A;  3DTE A;  3M1C A;  3FK7 A;  3HJE A;  4B47 A;  2X6Y A;  3VOE A;  5ILS A;  3ZQG A;  3Q5F A;  4YFN F;  2COB A;  3P7N A;  2GZW A;  2K3P A;  3AKZ A;  4LG3 A;  3A1Y A;  1WSU A;  2QM3 A;  4FX0 A;  5J8F A;  5FKM A;  1RNL A;  4A12 A;  3KEY A;  3JRD A;  1YS6 A;  4X1E A;  5HLH A;  5FRO A;  3WE2 A;  2CW7 A;  2FUG 2;  2R7D A;  1BI2 A;  3GLX A;  5JVT A;  5FO5 A;  5ILV A;  1Z0X A;  1X2M A;  1IW7 F;  1X58 A;  3KLO A;  2L7F P;  2DT5 A;  2WAQ N;  1G3W A;  1XMX A;  2X4H A;  3HYI A;  5DM7 F;  3OS1 A;  3IKT A;  2F48 A;  2NS0 A;  3EUA A;  2KIM A;  3ECH A;  2OCC H;  3S2D J;  2QLZ A;  1YIO A;  1ZAO A;  4L18 B;  3CCY A;  3E5U A;  2QQB A;  1XPX A;  4DBQ A;  1KU9 A;  4A2U A;  2FXA A;  1ZR2 A;  3VSK A;  2N8G A;  2R7Z J;  3M7G A;  5CVI A;  4D7N A;  3BDD A;  3TO7 A;  4JQF A;  1J7K A;  1R5G A;  1L3L A;  4Q4Z F;  5E3N A;  4A3D J;  2HDD A;  1ZHF A;  1LE8 B;  4S0H B;  3OYM A;  2BE5 F;  3GVA A;  1A5J A;  2VT3 A;  3BG9 A;  4HV6 A;  3HGY A;  3E6M A;  1R71 A;  1JJ8 C;  1WJC A;  1FP2 A;  3ROU A;  2E35 A;  1CF7 A;  5JVG F;  1X4O A;  3SZP A;  4KIG A;  5ED4 A;  3WU2 C;  4S05 A;  4AU7 A;  4FHT A;  3UR3 C;  1TL8 A;  3I4M J;  2OV7 A;  2KL4 A;  3PIP F;  2R5Z B;  5H2F C;  1O4X A;  2DQL A;  1PUF A;  4U0V A;  1MMN A;  2V9V A;  5BPD A;  2PJR A;  2NVX J;  5J4V A;  5E1X A;  2AS5 F;  1U78 A;  2DPD A;  4F3Q A;  3MQ0 A;  2VKV A;  4ZYG A;  3CCS I;  4I0B A;  2HYF A;  4MQ9 F;  4Q5S F;  1ZLK A;  2CO5 A;  2DJI A;  3S32 A;  3V42 A;  1UG0 A;  4F52 A;  1A04 A;  5D5X B;  1X2N A;  2HQ5 A;  1DU6 A;  1BI1 A;  5J6X A;  4A6D A;  2OJE D;  1IXS B;  1ZLJ A;  1YW8 A;  3I53 A;  4MEY F;  2MLK A;  3RPQ A;  4JX6 A;  4CUG A;  5F0H A;  2ZXH A;  3DP7 A;  4RGU A;  4C3H J;  2COM A;  1ENH A;  1I5Z A;  1NHA A;  4L5I A;  2W25 A;  3CES A;  3NEU A;  2LKP A;  3KP4 A;  3FWE A;  3IHU A;  3KZZ A;  3W6K B;  4O6J A;  3DCF A;  3DPU A;  4HYE A;  4EEF G;  1O3S A;  1WWX A;  1XCB A;  3FM3 A;  2V9K A;  2R93 J;  3ULQ B;  3FM5 A;  2R7W A;  2LFB A;  2M9H A;  3VYT B;  1Z91 A;  2LR8 A;  5EG0 B;  2O3F A;  1TW2 A;  3OMY A;  1BIB A;  2F4I A;  2R7V A;  1X1B A;  4XLN F;  1J09 A;  3ZQF A;  4ZZL A;  3VEP A;  4B8X A;  4A3L J;  1UFM A;  4CYD A;  2VQH A;  3HL2 A;  2PJP A;  2BZT A;  3HEF A;  3LSI A;  5KNL A;  4RB3 C;  1X1A A;  2ISY A;  1LEA A;  3K1M A;  1G4D A;  1LJ9 A;  3K4N A;  2RNJ A;  4KIF A;  3R6S A;  2B9S A;  3HSF A;  3I58 A;  4XKB A;  3F8M A;  3FXL A;  3ZQ7 A;  2XDV A;  3BCB A;  2HZT A;  1B8I B;  3RZD J;  3ONQ A;  3PUF A;  4DZP A;  1YJN I;  2HDC A;  4NUB A;  4AVP A;  2ECC A;  4RMN A;  2ZSH B;  4RAZ A;  2LBF A;  3ZPL A;  3HM5 A;  5IYC J;  2NRA C;  2O6G E;  1YO5 C;  3S16 J;  4EJW A;  3U1K A;  2KIQ A;  2ZKZ A;  1FLI A;  2HXO A;  1REP C;  2WAE A;  3F23 A;  3MFK A;  3ABK H;  5E79 C;  1FP1 D;  2GXG A;  3E5X A;  2KMU A;  1R00 A;  1W7P B;  3PQJ A;  3SYT A;  2ZSI B;  1JI8 A;  2DOF A;  4BEH B;  1R5I D;  1JHH A;  3KP7 A;  3FKJ A;  2EIM H;  2Q1Z B;  3ZCO A;  4AD9 A;  2JA8 J;  3ZQH A;  1MGT A;  5AIP A;  3BC8 A;  5AON A;  1MMA A;  3LSM A;  2FBH A;  2R7F A;  1EA3 A;  4HF2 A;  2BV6 A;  2K3F A;  1JXS A;  2XAF A;  1XG1 A;  1FX7 A;  3I54 A;  3MZY A;  1WJE A;  5IOZ A;  2XAQ A;  3V8K A;  4UV8 A;  4LD5 A;  1G59 A;  1U8R A;  2HEO A;  2E7X A;  1D5V A;  1F5T A;  2YU9 J;  2ADU A;  1O7L A;  4QPQ A;  3LAP A;  4IKF A;  3G6E I;  2KKO A;  4B44 A;  1B72 B;  4XLF A;  1XSD A;  2NOG A;  3G3Z A;  1AU7 A;  2DFH A;  4PJM A;  3OYC A;  2HOT A;  2O7O A;  2QQ9 A;  3EUH A;  1RZ4 A;  1S3J A;  4AM3 A;  4XSZ F;  9ANT A;  2K9Q A;  4RB2 C;  1K83 J;  4P55 A;  3WTX C;  3QRF F;  3MN2 A;  4MHG A;  4OOI A;  4XBF A;  2EZK A;  4B1R A;  3GF2 A;  3SZG A;  4F91 B;  1P7I A;  2IGN A;  1BBY A;  2Y48 A;  1H9G A;  5DEQ A;  2W7N A;  1BR2 A;  2V26 A;  2VKD A;  1DU0 A;  4E4H A;  2F5C A;  3T8T A;  3G73 A;  4MO7 A;  4A3I J;  2PMZ A;  4J19 A;  3I4P A;  3NAR A;  2YR2 A;  1TWA J;  4ZTF A;  4IHW A;  2EFP A;  1WPK A;  2IGK A;  2M7B A;  3K1N A;  3FBI B;  3CMA I;  3IKV A;  4P9U A;  1X3Z B;  2FF4 A;  3RKW A;  4M73 A;  4BGD A;  2G7H A;  4XID A;  3IUO A;  4RAG A;  2ZNY A;  1SAX A;  4LIV A;  5LGT A;  3DBR B;  3ZQC A;  3LA3 A;  4NC8 A;  5DCM A;  3KCC A;  3QU6 A;  2Q2E A;  2LNB A;  4UB6 C;  3KEQ A;  3PNV A;  2CS3 A;  4LK1 F;  4UVC A;  2JPB A;  4BBS J;  5HLI A;  3ZQI A;  4LG0 B;  2V9P A;  2L01 A;  2B7E A;  2Z1D A;  3CCQ I;  1VQ9 I;  2WV0 A;  3KP3 A;  2VKH A;  3K10 A;  2E2J J;  1SVL A;  1DPR A;  2QEN A;  1QPM A;  2JTV A;  2XSD C;  1UJ8 A;  3R60 A;  1PDN C;  5JLW A;  2R5Y B;  2RN7 A;  4UUT A;  1TBX A;  3A01 B;  2H09 A;  1MSE C;  2X6O A;  2DMN A;  4KYW A;  2IS2 A;  5EZH A;  2CGP A;  3DXJ F;  2VOD A;  5FRN A;  2DBB A;  2K02 A;  1IC8 A;  1HST A;  3FXO A;  2BHY A;  1QHH D;  4L9N A;  5M5Y J;  2VOO A;  3BR1 A;  3OR1 C;  3BJA A;  3T1B A;  4OAY A;  2KFD A;  2LY2 A;  2W84 A;  4WXC A;  3VYR B;  1IUF A;  5BPI A;  2QSF X;  3WTY C;  5E1Z B;  3K6G A;  2A5W A;  1JGG A;  2K27 A;  5EEG A;  3TOB A;  1O3R A;  5LHI A;  1J9I A;  2XGC A;  1QGP A;  1MH4 A;  1GXQ A;  1TLH B;  5HVQ C;  3A4C A;  3DBL B;  1QU3 A;  4P96 A;  2P8T A;  2HPI A;  3PNT A;  3K2Z A;  3J7A Y;  5CQG A;  1IXR C;  2P5L C;  1ZH5 A;  2DDB A;  4HOB A;  3K70 C;  5FRM A;  2F4M B;  1IV8 A;  4LGW A;  3GTM J;  1BR1 A;  1GV5 A;  3FXM A;  5E20 A;  3IP4 B;  1R49 A;  4DQ2 A;  2CU7 A;  2Y30 A;  4XN3 A;  5DCF A;  1ETW A;  2KPM A;  3I3L A;  2JUC A;  1VQ5 I;  1VFC A;  5H6Q A;  1B4A A;  3J81 K;  5JLX A;  2QBY B;  1S5L C;  1BC7 C;  4IQJ A;  1IN4 A;  2YX4 A;  3LFK A;  5FB2 A;  3U9G A;  1XGS A;  5HNF A;  3ABM H;  1ZGA A;  2ZME A;  3D5R C;  1OYW A;  1LKX A;  4U7D A;  4CYC B;  1NK3 P;  2UXX A;  1UAA A;  3RYR A;  4ZZD A;  4U88 A;  2NNY A;  1FEX A;  4R8H A;  2CQQ A;  3F8F A;  3GTQ J;  3HKZ N;  4HDU A;  5LLQ A;  3LQQ A;  2K9M A;  1RC9 A;  1RR7 A;  1WJF A;  2LY1 A;  4QLC U;  4P9F A;  2F5E A;  3KX2 A;  3LSR A;  1QHG A;  2BVM A;  4GCV A;  1WH7 A;  4M6Y A;  3BZ6 A;  2M0M A;  2EFN A;  3AFH A;  3P9C A;  3KZY A;  1T39 A;  2B0L A;  2RRE A;  1LUJ B;  2BY1 A;  3S1R J;  5HS7 A;  4G8X A;  2P6S A;  2K9N A;  4G9Y A;  1WVR A;  2MC4 A;  5KVR A;  1S9H A;  4ON0 A;  1RKT A;  4UUS A;  5B66 C;  3CF5 F;  4HQM A;  5LRS A;  4GYI A;  1U0J A;  3J7Y J;  1D1A A;  2E1M B;  3KYC B;  2M4G A;  5E8G A;  4BE2 A;  3FX3 A;  3J7A O;  3CMY A;  3DLL F;  4N0B A;  4IJA A;  2GWR A;  1FOY A;  3K4K A;  1ZRC A;  3OR2 C;  2JK3 A;  1XDS A;  1JUP A;  3TL4 X;  2H8R A;  4RGX A;  1V54 H;  3HOS A;  2MG4 A;  1MBH A;  4BQN A;  3IRR A;  3KLN A;  1GHC A;  3GBG A;  1Z3X A;  3JTH A;  4RBO A;  4YFK F;  3E3V A;  5J1U A;  3F22 A;  1E0E A;  2VI6 A;  4KIS A;  3QQA A;  3LMM A;  3QP6 A;  3CC2 I;  2ME0 A;  3A02 A;  2FQ3 A;  1VQ4 I;  1V5G A;  3TGN A;  3I55 I;  4DGW B;  1W5T A;  1FJL A;  1K78 A;  2KT0 A;  3S1N J;  3DEE A;  1JE8 A;  2K9L A;  4YEJ A;  2R7X A;  1O7F A;  2HYG D;  5CVU A;  3L2U A;  1VQL I;  4KN7 X;  3CCV I;  5E18 F;  1CF7 B;  1S7O A;  1WHU A;  1FT9 A;  3N97 A;  1OLT A;  1MH3 A;  2DA2 A;  3B6C A;  4L5E A;  1N77 A;  4Y7N J;  3HGG A;  1UHW A;  1PUF B;  4L0Y B;  2ESN A;  2O0Y A;  4PJN A;  2PJR B;  5F6F A;  4EJT A;  1CQT A;  2BW3 A;  2L7M P;  2F5V A;  2QF7 A;  2P7C B;  1VF9 A;  4B4C A;  3EET A;  4KUM A;  3HOX J;  1HA8 A;  2XAS A;  1TT0 A;  3U2R A;  3AAF A;  2CW0 F;  3BY6 A;  1VND A;  3HOU J;  4UVA A;  3F72 A;  3I5U A;  2XC7 A;  1V5F A;  3OYH A;  2RV8 A;  4XN0 A;  5J1Y A;  4CSW A;  4HZF A;  5EEA A;  2VJJ A;  3U1D A;  1IN8 A;  1SVO A;  2X1D A;  3L09 A;  3QPH A;  4EMS A;  2D1V A;  2WB1 A;  3HXL A;  4UB8 C;  3VOD A;  4AYB A;  4DOZ A;  2Z33 A;  3UNG C;  1ERD A;  4ABZ A;  5E1W A;  5B3S H;  2RGV A;  1R58 A;  4ZTJ A;  2Y2Z A;  5EEH A;  1U5T C;  4I6Z A;  2NYX A;  4BYY A;  1OCZ H;  4XOP A;  1HOM A;  4BE1 A;  1X1D A;  1W5C C;  2A3S A;  1W4M A;  3ZQL A;  4IHY A;  4Y3O A;  4BU2 A;  5KHD A;  5K7Z A;  2HPM A;  2FA5 A;  2Z5U A;  2CQX A;  5FFZ A;  2FOK A;  4M9Z A;  3CLO A;  3J7Z I;  2F5D A;  2R0Q C;  1I27 A;  1O57 A;  2LMD A;  3L9F A;  3PUB A;  4M6V A;  2M7A A;  5CPR B;  3W6J B;  5B1A H;  4ESJ A;  3EDP A;  4C2M J;  2QSG X;  4L0Z B;  2VL8 A;  2QCO A;  4RM3 A;  1WH5 A;  4XLH A;  4O3M A;  2DOE A;  2VJ4 A;  2FSW A;  1P92 A;  1Z7L A;  2RC4 A;  3WTS C;  3QP5 A;  2VPL A;  4IHT A;  4KDP A;  1XCV A;  2LRE A;  5JI6 A;  2UWM A;  3L00 A;  4D5C A;  3G4S I;  2LBF B;  4P1W A;  1K79 A;  2GOM A;  2LOO A;  1FIP A;  1K4T A;  1STZ A;  1U8B A;  1VQM I;  3IV5 A;  1ZN2 A;  3BG3 A;  1T38 A;  4KT5 C;  1OR7 A;  3H0D A;  1NH3 A;  2HKX A;  2A07 F;  1DGW Y;  4GO1 A;  3LNQ A;  2UUZ A;  1TNS A;  1Z1D A;  5E3M A;  2V1X A;  5M3F J;  3W6V A;  2A5Y B;  2VKE A;  3KPH A;  3ML6 A;  3R61 A;  4MTD A;  5IT9 Z;  4C3J J;  2DLL A;  1GVJ A;  2L4A A;  2V1U A;  3RTR A;  1NTC A;  2L3D A;  2R7U A;  4AIJ A;  4BHB A;  1ETY A;  3CCU I;  1J5Y A;  5ILU A;  2VBX A;  5ICC A;  2WAD A;  2CUE A;  2W82 A;  4L9V A;  3G71 I;  3WHB A;  3AL0 B;  2OUM A;  3GWZ A;  4E7S A;  2ESH A;  2GAU A;  2H6C A;  3A0B C;  3PFY A;  3X2Q H;  3ZQQ A;  5FD6 A;  2O03 A;  4JBA A;  5EJC A;  1C0W A;  4UHT A;  3W2W A;  2YPR A;  2OF7 A;  3GEZ A;  3WOD F;  4DW6 A;  3KFW X;  4XNF A;  4RGR A;  1FOW A;  3F0C A;  3JCU C;  3MD2 A;  4CZC A;  4XLC A;  1JKQ C;  5KK1 A;  4M9S A;  3CUQ A;  2LVS A;  1OYY A;  3NRV A;  1GV2 A;  1VI0 A;  3JAM Z;  1IDZ A;  3U21 A;  4D1Q A;  2KRC A;  4YII A;  4I7H A;  3REO A;  2JA7 J;  1LFU P;  1Q1H A;  2EV6 A;  1SD7 A;  2Y0M A;  1BA5 A;  1XSX A;  3H5A A;  1Z6R A;  2MA3 A;  1LEB A;  2VXZ A;  4HRI A;  1T0F C;  3PO2 J;  3M8F A;  2M30 A;  3VFZ A;  1XSV A;  3K4L A;  3RKX A;  3BG7 A;  2DT6 A;  4KN4 X;  4EAT A;  1KGS A;  3G1M A;  2HS5 A;  4Z2Y A;  3SDB A;  4WWC A;  2CV0 A;  3MAJ A;  3K4M A;  2R7T A;  3NAU A;  3WGH A;  4CCL A;  1B1B A;  2HQR A;  5DCM B;  2PI0 A;  2Q2E B;  2R7Q A;  3NWT A;  4A93 J;  5D6E A;  2VXD A;  1DP7 P;  2P5V A;  1B9N A;  3E0J B;  1G6N A;  2DFE A;  1I3A A;  1F4K A;  4IEJ A;  3VSL A;  2KIS A;  2IA0 A;  5GAE J;  4LK0 F;  1OCP A;  3KP6 A;  3TDZ C;  3PO3 J;  1Z67 A;  2X6W A;  2E2I J;  3RJP A;  4M3F A;  1T6S A;  1VTN C;  1XS9 A;  2X51 A;  2YSR A;  5C4J J;  5GPC A;  3OY9 A;  1JJ6 C;  1YG2 A;  3SEZ A;  2DW4 A;  4C2T A;  1IN6 A;  3AG2 H;  3RDI A;  4KIB A;  3N4M A;  1ON1 A;  1OKR A;  2IS6 A;  4B48 A;  6PAX A;  2W85 A;  4KIC A;  4XON A;  3PM1 A;  2PMZ N;  1WJA A;  3A03 A;  3KP2 A;  2PG4 A;  1IUY A;  4RS8 A;  2KP6 A;  3CCM I;  4KA4 A;  2J5O A;  2VON A;  3BR5 A;  2IPQ X;  1D8J A;  5EGO A;  2BY3 A;  4Q47 A;  2QEX I;  4W1U A;  5GP9 A;  5D6F A;  1BI0 A;  3K1P A;  5F0C A;  4EM2 A;  3GZ6 A;  2XGX A;  1S72 I;  3L2R A;  2GLO A;  3OYN A;  4U87 A;  4IOC F;  1TWH J;  2JVG A;  4NNJ A;  3DQV C;  2X48 A;  3R0J A;  4BL0 B;  2ZJ2 A;  2LKX A;  4JX5 A;  3H9Q A;  3CP8 A;  2RQQ A;  2JJ7 A;  2BY0 A;  1E3H A;  1XDU A;  4NC7 A;  2M34 A;  2MFZ A;  3ZGK A;  5HDK A;  4ZYD A;  3WU1 B;  4MIM A;  4R1H A;  2LTP A;  2WC2 A;  1JTX A;  4KNY A;  1OCR H;  2HVQ A;  2ZXJ A;  4AIH A;  1B59 A;  3W3C A;  3H5R A;  3DU6 A;  3JRF A;  2W00 A;  3LOC A;  4Z6Y A;  2W57 A;  1K61 A;  2DXI A;  4C2U A;  3GTO J;  3ZN1 A;  2X0L A;  3K9T A;  1A35 A;  2NVU B;  2XAJ A;  4MTE A;  3JW4 A;  2LSO A;  2M3A A;  5FLV A;  2ZME B;  1R7J A;  1ZAR A;  4PGH A;  4PUS A;  4A0Z A;  4BDZ A;  1LB2 A;  1F9N A;  2AXT C;  2JSP A;  1Z7U A;  3L2Q A;  2IGO A;  3S3M A;  2G7U A;  2CUJ A;  3DTI A;  4XOT A;  1XC5 A;  3P9I A;  5HDN A;  2JSC A;  2VOP A;  4CIC A;  4YFX F;  4LB5 A;  4QWQ A;  2LC2 A;  3K2A A;  5C4X J;  2DO7 A;  3CJR B;  1ETQ A;  3M07 A;  5TJJ A;  2E5Z A;  3GUD A;  4IPA A;  4N9I A;  3F3X A;  2LG4 A;  4HNU A;  3OYD A;  3ERM A;  4UUS B;  2DK5 A;  3LL7 A;  1AA7 A;  3OYG A;  1L0O C;  3N05 A;  4PJJ A;  2L9N A;  3GW2 A;  3MWM A;  2IT0 A;  3IWF A;  2MH2 A;  2DU9 A;  3WTT C;  1T33 A;  4RA2 A;  3V4G A;  3H36 A;  4ASN A;  5DYM A;  4BDY A;  1ETK A;  3HBL A;  3GFJ A;  3QPT A;  3QYE A;  4GRI A;  1SMT A;  1LFP A;  2XVC A;  2P7V B;  3GFL A;  3EYY A;  2GIV A;  1GVD A;  4NQW A;  1VQP I;  3WGG A;  1SFU A;  1YW7 A;  4BXX J;  3LA2 A;  2VBY A;  1BJZ A;  3OIP A;  2RKH A;  3DKW A;  4IHX A;  4NBQ A;  3TED A;  3L2C A;  2M8E A;  1X4P A;  2JVH A;  4A3M J;  1P4A A;  3BPX A;  5EF6 A;  3PQK A;  3ZMU A;  1W36 C;  2VAS A;  3TMO A;  2VJI A;  4W97 A;  2HU9 A;  2BOL A;  4F7Z A;  1YQA A;  1K78 B;  2IA2 A;  3WGI A;  3ERE D;  4D0P A;  5IP9 J;  2CWE A;  4E7J A;  3AG3 H;  2DTR A;  3HTU A;  1E2X A;  4FAS D;  1HLV A;  4FT8 A;  4B3A A;  2IP2 A;  5KCM A;  3MKL A;  5LGN A;  2PFB A;  3QYB A;  3SQN A;  1OCC H;  2VB6 A;  1JGS A;  4HNT A;  5CKT A;  2ZJR F;  1VQK I;  4OIO F;  2XPU A;  3VYU B;  2FQ4 A;  3CLQ A;  1S7E A;  3PSF A;  3DKX A;  2OZ6 A;  1H0M A;  1U3E M;  2VT2 A;  4ETS A;  1GDT A;  1U9O A;  3BG5 A;  3FXU A;  3IL2 A;  2NAZ A;  3RI4 A;  1U2W A;  2BW3 B;  3ABU A;  4XRF A;  1MW7 A;  3RQ4 A;  3H1C A;  1N75 A;  1OYI A;  4NHJ A;  4IVN A;  2CMP A;  5ICF A;  5LHH A;  4H0E A;  1ZR4 A;  2PX9 A;  1DPU A;  2K5C A;  3CDI A;  2KIF A;  1TTY A;  2DQR A;  2XF7 A;  3S3O A;  3BR3 A;  1E3O C;  2BYV E;  3QPL A;  1PYV A;  1RI7 A;  4F55 A;  5J3L A;  3MVP A;  5HS8 A;  1JKR C;  1KQ9 A;  3GTL J;  2Z3Y A;  1EF4 A;  5CVR A;  2BY2 A;  2FJ1 A;  3QU3 A;  4HX7 A;  2R7R A;  1ETO A;  4BQO A;  4M72 A;  1WJB A;  2EBI A;  5GAG J;  1P2F A;  2XIG A;  2VE9 A;  3C7J A;  4EJU A;  2VLA A;  2HDW A;  3K4C A;  4ZDL A;  4JX4 A;  3ZMV A;  1T08 B;  1EH6 A;  3BZC A;  4BQQ A;  3HOZ J;  3H3U A;  2FE3 A;  2IAI A;  5D8L B;  2A69 F;  4OIQ F;  2XPV A;  1PUE E;  3S15 J;  2QKM B;  3P9K A;  3HOV J;  4Y4R A;  1RUO A;  4X6A J;  5CVJ A;  3PFI A;  3QYF A;  4FIS A;  5CLS A;  2EK5 A;  1O3Q A;  2CH0 A;  1H8A C;  3CD6 I;  2YX7 A;  2EJR A;  4MNU A;  1TQM A;  1WQ2 A;  3C1D A;  1FNN A;  1LVK A;  3HTS B;  1JUS A;  5JHF A;  1RR8 C;  2DMP A;  2EV5 A;  4A3C J;  3IH3 A;  4GGG A;  4PDK A;  1MND A;  3RKQ A;  5CYV A;  4EVI A;  3J80 Z;  1D1C A;  2JMW A;  2WBM A;  4XOR A;  2AQF A;  4EV0 A;  3FMS A;  2ZXI A;  3GZ5 A;  4HA8 A;  2Y75 A;  3Q0W A;  2B63 J;  3AG1 H;  4IX7 A;  5F1J A;  1I6H J;  3HPG A;  4A3J J;  5B1B H;  2GA1 A;  3F8C A;  4D7M A;  1QO0 D;  2EIJ H;  1QVT A;  5DS9 A;  1G8X A;  4LIT A;  2WB1 N;  1WJD A;  2FEZ A;  4AYB N;  4DYQ A;  4IHV A;  1R1U A;  2E1C A;  2DA3 A;  1R5H A;  2UXN A;  1WJ5 A;  1QZY A;  2HR3 A;  1D5Y A;  2KIU A;  3K70 D;  1YYV A;  5J4Y A;  2EB7 A;  2QYO A;  3GYH X;  2UZK A;  3L2V A;  3FHZ A;  3FXJ A;  2DFF A;  2X1E A;  4YIR X;  5BMZ A;  1JTY A;  5JR3 A;  2O5R A;  4XM3 A;  1USS A;  2YUS A;  4BJ5 C;  2GOX B;  1EH7 A;  4CCJ A;  4II2 A;  2RNG A;  4UXN A;  2JPC A;  5F1R A;  1D3Y A;  2KHM A;  3HZJ A;  3HOT A;  3BOQ A;  2EV0 A;  1KU7 A;  2GM4 A;  1G3T A;  2ID6 A;  3EUK L;  1Y1V J;  1KU3 A;  4KMU X;  1TNT A;  3S8P A;  1K6O A;  2LH9 A;  2RQP A;  2CW8 A;  2V1N A;  4BHC A;  4GDF A;  4I0A A;  3BTI A;  3H9J A;  4ZYA A;  5HOD A;  5E3L A;  3I59 A;  1BW6 A;  3OIQ A;  2E1O A;  2DK8 A;  3FXQ A;  2VE8 A;  4HF0 A;  5DD4 A;  2CFX A;  2Y69 H;  3CUQ B;  3WTU C;  3ZXS A;  2STW A;  5FLX Z;  3GTG J;  1BOB A;  1ZQ3 P;  3DPT A;  5F27 A;  4ENM A;  3WTV C;  3CME I;  3BTL A;  1R1V A;  4IF4 A;  4BAC A;  2PLY A;  3D1N I;  4B43 A;  3Q9S A;  4KT6 A;  4CA0 A;  2EA4 A;  5FKO A;  1DQU A;  4K2E A;  2D2W A;  3EQL F;  1NG6 A;  3I0T A;  4M3G A;  2J5P A;  3BQY A;  3B6A A;  4HPQ A;  5TGT A;  3KP5 A;  4M74 A;  4PFO A;  2LP0 A;  2PMU A;  4HLX A;  2R3S A;  3HOY J;  3OYA A;  3J80 K;  3FMR A;  5GPA A;  3BP8 A;  1ON2 A;  2R4G A;  1K6Y A;  1HW5 A;  3T0Y A;  2L7K A;  4XSX F;  3DPL C;  2EQR A;  1SD5 A;  1EKE A;  4N9H A;  1BC8 C;  1O3T A;  2MD0 A;  5L3E A;  2ACJ A;  5D4R A;  4BS9 A;  2C6Y A;  5B5E C;  2XGD A;  3BG6 A;  2RVC A;  4FET A;  3E1S A;  3G1O A;  2VQL A;  2MLG A;  3JRC A;  1SD4 A;  2ICW G;  3O6B B;  1T8I A;  1MJA A;  1DUX C;  3CO7 C;  1I3Q J;  3E6C C;  2X1C A;  3L7W A;  3ABL H;  3V7C A;  1MMD A;  4ZYE A;  4P5O A;  2MD5 A;  4XRS A;  3JRA A;  2ZFW A;  3MKW B;  2DI3 A;  5IOY A;  2CV2 A;  2LLK A;  1ZTR A;  4HX4 A;  4AUX A;  3GZN B;  2HQN A;  1ODD A;  4XLA A;  1HKT A;  4M71 A;  1SVM A;  1IO2 A;  3T5X A; 
#chains in the Genus database with same CATH homology
 2QA4 I;  2ZJQ F;  1FOX A;  2ZJR F;  1VQK I;  3CMA I;  1FOW A;  1YHQ I;  2H8W A;  2JQ7 A;  3CCR I;  1MMS A;  5GAD J;  2E34 A;  4V19 K;  5DM7 F;  4IO9 F;  3CJT B;  3PIO F;  1VQ8 I;  3CC7 I;  3CCQ I;  1VQ9 I;  3CF5 F;  1YJN I;  1YI2 I;  3CCL I;  3J7Y J;  3CCE I;  3J7Z I;  2OTL I;  3DLL F;  1VQ6 I;  3CME I;  5GAG J;  1ACI A;  1FOY A;  5DM6 F;  3I56 I;  1Y39 A;  2E36 A;  2ZJP F;  1VQ7 I;  2E35 A;  5GAE J;  1YIJ I;  5JVG F;  5GAH J;  3CC2 I;  2K3F A;  3G4S I;  1YJW I;  1VQ4 I;  3CC4 I;  3PIP F;  1VQM I;  3I55 I;  3CD6 I;  1QA6 A;  3G6E I;  3CCS I;  1VQL I;  4UY8 I;  3CCV I;  1VQP I;  1YJ9 I;  3CCM I;  2OTJ I;  2FOW A;  1HC8 A;  1VQO I;  4IOA F;  2QEX I;  3CCU I;  1VQN I;  1VQ5 I;  1S72 I;  3G71 I;  2NXN B;  4IOC F;  3CCJ I;  1YIT I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...