3CC4I

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cc4I00
1QA6A 2QA4I 1VQNI 5DM6F 2OTJI 1S72I 1VQ7I 1VQ8I 1VQ4I 3CCRI 2ZJPF 3CC2I 1YI2I 1YHQI 2NXNB 3CF5F 3CJTB 3I55I 2ZJQF 3CCVI 2OTLI 1FOWA 1YJ9I 4IOCF 1YIJI 2E35A 4IOAF 1VQPI 3CCEI 2K3FA 3PIPF 4UY8I 1FOYA 2ZJRF 3J7YJ 3CCQI 3CCUI 2FOWA 3CC4I 3PIOF 1VQ6I 3CC7I 1MMSA 1YJWI 3G6EI 3CCJI 2E34A 3CMAI 5DM7F 1VQLI 3CMEI 5GAHJ 3DLLF 3J7ZI 5GAGJ 4V19K 2E36A 2JQ7A 4IO9F 3G71I 5GADJ 1VQ9I 5JVGF 1VQMI 2QEXI 3I56I 1FOXA 1HC8A 1VQ5I 1VQOI 1Y39A 3G4SI 2H8WA 5GAEJ 3CCLI 3CCMI 1YJNI 1ACIA 1VQKI 3CCSI 3CD6I 1YITI
chains in the Genus database with same CATH superfamily
2XKOA 2Y2ZA 2OZ6A 2CQXA 2EZHA 4DBQA 4FX0A 5HNHA 1MZBA 4HLXA 1A36A 5EG0B 2LR8A 2F5EA 1HQCA 2KPMA 2XGEA 4EGYA 2M5WA 4JQFA 1RNLA 1EJ9A 5JI6A 5KAIC 3F9KA 5JR3A 4J01A 5D8LB 5D6FA 3SFIA 1UG0A 4ENJA 2R3SA 2R5YA 1O57A 2YR2A 2YU3A 1BA5A 5E8IA 5GTHC 2Z33A 2NAZA 3E7LA 2XPWA 1LNWA 3WE2A 2R7DA 3V7RA 4CHUA 1S3JA 2OQGA 4RB0A 4E4HA 5D4RA 2DYRH 4MQVA 3U2RA 4NC7A 4CCLA 2VL8A 4MFEA 2UWMA 5F64A 1FC3A 1IG7A 3F8BA 5CYVA 2CV2A 1WFXA 2P4WA 2X1DA 4F52A 2ZJRF 1FLIA 1AA7A 1XD7A 2V1DA 1HSTA 4M71A 3OV8A 3A4CA 2MBFA 2Z16A 5K5OA 3L2CA 2FOWA 3BR1A 3VSLA 4YIRX 9ANTA 2X85A 1U8RA 4QPQA 1SMYF 1LDDA 2M87A 2YUSA 2HOEA 4DOZA 2KRHA 3GF2A 3TBIA 2RN7A 1WH5A 3K4MA 3I5UA 1YG2A 5EEAA 2RGVA 1RKWA 4CYCA 1OQYA 1J59A 3ELKA 2ELJA 5K7FA 4S05A 1IN8A 1R5ID 3LSPA 4KICA 4E7KA 3I71A 3HSRA 1J2XA 2QM3A 3VYUB 1KA8A 3GZNB 1JKRC 4C2UA 4A3DJ 2NOJB 1D5VA 5HS8A 1XDUA 3WTTC 2IT0A 2VODA 1VQ9I 5L3EA 3LFUA 2R7UA 5TJJA 4BS9A 1QNTA 4BAYA 4AIKA 1X1BA 3VPRA 1B6AA 2NVYJ 1ZH5A 4BBSJ 2C6YA 2ZB9A 1O7LA 2BGCA 1SD5A 2W85A 2LY9A 1OCTC 3EUAA 3CCYA 4W97A 4A5NA 4WK8F 1TZLA 2QQBA 2FSWA 3SZTA 2ZXWH 1U8BA 5FJ8J 1R1UA 1PJRA 1V3FA 4A3LJ 1ZG1A 2WA0A 3H0GJ 1ZKGA 2A61A 2K9LA 3HYIA 1IN5A 3WHCA 2MH2A 1QO0D 1QVTA 2G9WA 3FXOA 4XL9A 1G59A 2XB0X 3HXLA 2P5VA 1S8NA 2GXAA 3BG5A 5FRNA 1ON1A 2FE3A 2JJ7A 2MA3A 3V8LA 1U3EM 1OKRA 1MNDA 1Z67A 5DEQA 4OIRF 4G6QA 2HXOA 3HL2A 1MH3A 2EV0A 2DT5A 5GP9A 2OPTA 2JN6A 4L9JA 4AYBA 3GUDA 3BQYA 4ETSA 3LFKA 2X0LA 2R92J 2KKOA 1RESA 3LSRA 1SFXA 2YS9A 4RAYA 4A3FJ 3ZN1A 1WWXA 3CTAA 2FBIA 3VB2A 1Y1WJ 1SVLA 1RR7A 1Z3XA 2HWVA 4OWRB 5FLMJ 2EIJH 2OCCH 1WHUA 2LBFB 3Q0WA 2UV1A 3JSPA 2CQ7A 1BJZA 1F5TA 1IRGA 4WXCA 4A5MA 4CCMA 3HOXJ 4XORA 4L5EA 3KX2A 2L9VA 3HSEA 4C2TA 1J0RA 3NWTA 4A0ZA 4B3XA 3BG9A 4CYCB 2CQNA 1XGSA 1FY7A 4Y7NJ 1FNNA 1BI0A 3U1DA 3P7NA 2Q2EA 1K4SA 1XPXA 4BJTA 1XB4A 5J1RA 4F55A 3E6CC 4U0YA 2XAJA 2FQ4A 1AWCA 1USTA 2KP6A 5FLXZ 1RETA 1X4OA 4M3EA 5ERIA 3AFHA 2QGUA 5EEHA 5DYMA 2DT7B 4ZYHA 4IHWA 4NC6A 3EUHA 4LB5A 1TW2A 2Y0SN 2BZTA 4KT5C 3DCFA 4AU7A 2JMWA 2L7ZA 1R5GA 2DTRA 4CSWA 3ASOH 4OIPF 3JRDA 4DW6A 2NS0A 4B3AA 2E36A 2L3DA 1ETQA 3TEDA 1TT5B 1X4PA 1WJ5A 5FKNA 2M7AA 2L54A 2AQEA 5J6XA 1I27A 3B02A 1X1CA 1XGOA 3K4BA 2KZGA 4PJ0C 4U87A 5FFZA 1ZR4A 3S14J 4XONA 3QWLA 3BTJA 5EF6A 1FMVA 1OFCX 2KIUA 1WSUA 2HZTA 4L9NA 4HW0A 4B09A 1WPKA 5JFRA 2J5OA 2IRFG 5FRMA 4A3GJ 2XHKA 1WH7A 4HV6A 4LOCA 1D0YA 1V5EA 2QUFA 1P7IA 4HOBA 3BROA 1QHHD 1QRYA 2PMZN 3T1BA 4YIFA 1R6RA 1YX3A 1Z6TA 2BY1A 5DD8A 1VQ4I 1TNSA 4F91B 2ZJPF 4TV7A 1H0MA 2NVQJ 1I50J 4RLFA 4M3DA 2DDAA 2LK2A 1Y0NA 3KYCB 3T8RA 1TLHB 2ZNYA 4MGRA 3H35A 1J09A 2VC0A 2IXSA 5HODA 3E3VA 4EJWA 1OISA 1IZ1A 2JA2A 4P55A 1WVRA 1BI2A 2HTJA 3BG3A 3LA3A 1YOVB 3PL8A 2IEKA 4OOIA 4Y3OA 3GTOJ 1BI3A 3HRSA 2ZC2A 1F9NA 2P7VB 3I53A 1IRFA 4Y13A 2XPUA 4BDYA 4AIHA 5D5UB 4FETA 1SFKA 3HOZJ 1SANA 3GTLJ 3BJOA 1K7AA 3BPVA 3OIPA 1OCCH 4Z2YA 3K4NA 1SD4A 2O8KA 2FQ3A 1TT0A 4XR6A 1TWGJ 2CW7A 3FXUA 3ZQCA 2W00A 2L9NA 1D0ZA 3DTKA 2A07F 1OCZH 4AIDA 3K2ZA 4HPQA 1ZREA 3LSKA 2E7WA 1QBJA 2QQAA 3RDIA 5LHGA 3DTIA 3OYAA 4BY1J 2OF7A 5DCMA 3A0BC 2XF6A 3SEQA 4GRIA 5DD4A 4DQ2A 4L18B 2IS1A 5LRRA 2Z99A 2KMUA 3BR2A 3R6SA 4M3FA 3IRQA 4IRGA 3BR0A 2EINH 1MBFA 1B1BA 1R5HA 1OYYA 3H3VK 4EJUA 4HDUA 4RGRA 3O8HA 4A3JJ 3RPQA 4IQ4A 3DLLF 4BHBA 4YEJA 4BQOA 2OJED 4O6JA 4L5IA 4QLCU 1MMNA 2JSPA 3L2QA 4GDFA 3ZMUA 5HDKA 1YW8A 1KQ8A 5IYBJ 3H3ZA 1GDTA 4GGGA 4B1RA 4DYRA 4PJLA 1FOXA 1S7OA 2DU9A 3P9IA 1VQOI 3C3WA 4CDGA 2ZFUA 4HQEA 2XASA 2XAFA 4I98B 2EA4A 3QU3A 2L2OA 5TRDA 3M8FA 3TW7A 2NS8A 2LKSA 5A2QZ 5DDGA 3WU2C 2M30A 1ULYA 1FYKA 3RQIA 3A1YA 3GFJA 4IF4A 4EATA 4RBOA 1DGWY 4AIJA 3CO7C 2CH0A 1S6LA 4JK1X 4DBRA 1EV7A 4M6VA 2QENA 1QA6A 3QU6A 3GCMA 2HNHA 4BNCA 2QA4I 4HSRA 2R5ZA 4XKVA 2CRGA 2O0YA 4NNJA 3RCOA 3MKZA 4OMYA 4BXXJ 2EZIA 2ISZA 1MKMA 1BR4A 5HLIA 1AU7A 3BLYA 1Z1DA 3RYRA 1ZG5A 3ZQFA 4PSWA 4EM0B 3SQNA 1HCRA 2BV6A 5C4XJ 4MFDA 2RKHA 3LQQA 1IRXA 3QYBA 2DAOA 2XUBA 4X6AJ 3C2GA 3E5XA 3ASNH 3BC8A 2KLOA 2A5YB 2R7VA 3H9JA 5M5WJ 1G3WA 3A03A 2O03A 3PUFA 2E7XA 2BVMA 4AVZA 2MC4A 3AG2H 5HDGA 1PVEA 5DCMB 2R7RA 1HOMA 5FO5A 1F4KA 3FM5A 3LAJA 1ZR2A 1KYZA 2L7FP 3DTEA 1JHFA 4BHPA 3OS1A 1UCRA 1O4XA 3S1MJ 4LLNA 1NK3P 3KZYA 4CCJA 3MKLA 2F4OB 4BQNA 2QSGX 3HJEA 4EVIA 1OR7C 3K1MA 2DA2A 4WWCA 1VFCA 2KRFA 2IGOA 1QZZA 1XMAA 2IGNA 3BR3A 1TWHJ 4EV0A 2DXIA 2ZJ2A 1NHAA 2MG4A 3C2HA 1BOBA 3FDYA 1QPMA 3KZZA 5F04A 2LY1A 2X6XA 1RC9A 1UELB 2BEOA 1U78A 4V2FA 4RS8A 2HFHA 4P5OA 1N25A 4XM3A 3OYBA 4D7NA 1EA3A 1VQLI 2L9RA 3BY6A 1C0WA 2LMDA 3DKYA 3KP6A 2JT1A 4IO9F 3W2AA 2E5ZA 3JRCA 1V5GA 2D1HA 1OMIA 4KN4X 1FSEA 2LNBA 3FXRA 3K4CA 1EH6A 5E18F 2IAIA 3AL0C 3O8GA 2R5ZB 3D5SC 3F6OA 3TDZC 4WX9A 4FE7A 1Q1HA 2QZ8A 4FX4A 2K4JA 2VBZA 2KL4A 1E0EA 2H94A 3DV8A 3ISPA 3G4SI 2VJ4A 2RREA 3U1KA 2ZFWA 2D2WA 1EH8A 4Y17A 5CJ9A 5C44J 1GXQA 2DN0A 3OYCA 5EZGA 3OYKA 2Y31A 3WTZA 5HS7A 2A6HF 3KYDB 2HEOA 3BJ6A 2WC2A 3BZKA 2AO9A 3RZDJ 1BIAA 2DK5A 1V55H 5LHHA 4C9YA 1JKOC 2W82A 3SDGA 2X6WA 2OQRA 4NHJA 4A0YA 2RQQA 4LD5A 1WJFA 1ETXA 4HQMA 2EILH 2L5QA 3H5AA 3HPGA 2MC3A 5J1UA 2DA7A 2F5CA 3R0JA 2QSFX 4A2UA 3HRTA 3BOQA 1MNMC 2HXIA 1ODDA 3TP0A 4H4KC 1R49A 2KJCA 1WJBA 4BL0B 2P6SA 1X2MA 1X3ZB 2VJ5A 4ZDOA 3W2WA 3I4NJ 1JKQC 2B9SA 2QQ9A 3CF2A 3G1OA 1RKTA 1IUFA 4BE1A 4GYGA 1SAUA 3ZMVA 1RUNA 1JUSA 1WQ2A 2ZSIB 5J47A 2VOOA 3K1NA 3WTSC 2LYCA 1YX5A 2ACJA 2XGDA 3CLQA 5EYRA 3M1CA 1YW9A 3IWZA 2R7ZJ 4W1UA 1JJ8C 5GPAA 4V2GA 2CV1A 1SVMA 2NNNA 5FLVA 1W36C 1SC7A 1TTYA 3MKYB 3K1PA 2OC6A 1W4MA 1IAWA 1GV5A 4CCNA 1HW1A 2HU9A 4ZZLA 2QBYA 3S1QJ 4UVAA 2F5FA 2LOOA 5CVIA 2HGCA 1H89C 3I3LA 1MMGA 5GAHJ 3RPUA 4XLPF 2K4BA 2LY2A 4J00A 4DJAA 1IF1A 4EJOA 2PG4A 2WTEA 4LB6B 4HF2A 2GA2A 3W2VA 2PBIA 2HQ5A 2JK3A 3G1MA 4IQJA 2OBPA 5JVGF 3H0DA 3CMYA 1VQMI 4BU2A 1UG2A 2EA2A 1UJ8A 2I8DA 4E7LA 1HC8A 1IW7F 2VKEA 5FKKA 3UNGC 3LQRA 2G0EA 1KYWA 4CCKA 1Y39A 2PLYA 1LJ9A 3M7GA 2EK5A 2IVMA 3TL4X 2V1XA 4XSZF 1ACIA 2X4HA 2R4GA 3JW4A 4FASD 5LRSA 3CCSI 4BEHA 2LP0A 2KQRA 4IZZA 2RV8A 1YLFA 4ESFA 1SEUA 1T95A 3OYNA 1XSDA 2XKPA 3RQ4A 1HA8A 2DFIA 1S72I 3FKIJ 3FXQA 1ZRFA 2IPQX 2FMYA 3KFWX 1X1PA 1U5TC 3V8JA 3SEZA 4X1EA 2IGMA 4LITA 1S7EA 2ZCWA 3KP7A 4B48A 2CMPA 3RZOJ 3HTSB 2ZJQF 1GVDA 5HVQC 4IJAA 4HX8A 3DEEA 2P7CB 5E79C 5E3LA 2IA1A 3IH4A 3RSNA 3WU0A 2EZLA 2UXNA 1VZ0A 5F1JA 2VQLA 4M6XA 3VSKA 3CJRB 2OTLI 4E7ZA 3L2WA 3SFZA 4XSXF 4EQQA 5B66C 3CESA 1X1AA 2JA7J 4HLYA 4QWQA 2LF8A 3HC7A 3I4PA 4S0HB 3K9TA 1FJLA 4LG0A 1Z6RA 1K79A 2OUMA 4C3IJ 2DFFA 4HNVA 1Z77A 1HDDC 1FYMA 2DOAA 1SFUA 4ENMA 2QBYB 1N75A 3H1CA 2HOSA 2W1OA 3DBLB 2AQFA 1T33A 2B0LA 2ME0A 2V9PA 3GTJJ 2CO5A 1ZK8A 3FZVA 1IN4A 3HHHA 4I6ZA 2DLLA 3KPHA 1HF0A 2AS5F 1LVKA 1Z7LA 2LRDA 4Y15A 3IL2A 4ZZDA 3QPLA 3AAFA 2V6CA 4BE2A 5J8CA 1QHGA 2VUMJ 1P7JA 2E34A 2ISYA 2M0CA 1AKHA 1K6OA 2GXBA 1KU2A 2QYOA 1I1GA 2KT0A 2BXZA 2PFBA 3M8EA 3S3OA 2VPRA 3KEQA 3AL0B 5ICEA 4RGUA 3JTGA 2NVUB 2A6TA 2O9LA 3RIRA 1P4WA 4YFKF 2RNJA 4BEHB 5E3MA 3WTWC 2DODA 1V4RA 5E1XA 3IRRA 3HOVJ 5LD2C 4A3EJ 4QSHA 2LBFA 1DGRM 3EUHC 2X9DA 2MLGA 2V26A 1NTCA 2WAFA 4E7SA 3VEPA 3QQAA 3CO6C 1VQ5I 5H6RA 1U0JA 2STTA 2L4MA 3IHUA 4UUSA 3BP8A 4YELA 2X1CA 5CQEA 2QQ8A 1YITI 1S7AA 2DMNA 1K83J 2CQQA 2Z9OA 1NG7A 3TO9A 1ITYA 2OV7A 4MTEA 3BJAA 1J7KA 5J8FA 3F22A 2JA5J 5LBQA 3RYPA 2PN6A 4FISA 4N9IA 3GTKJ 1Z05A 1ZGAA 1F36A 5L3GA 2IS4A 4K2EA 5LLQA 3L2RA 4HV5A 2JPCA 3TDUC 1YHQI 5ILUA 2K02A 5ILSA 3ECHA 5M3MJ 4LG0B 3K0LA 5H20A 5K1YA 3CF5F 5BQTA 1IRZA 3E97A 1U5TA 2CV0A 3GTPJ 2V9KA 3CUOA 4B44A 2LKXA 3H36A 2H1LA 2EFOA 2R7FA 2XPVA 1ETWA 2FD5A 2FEZA 1GT0C 1T39A 1IO2A 1MJBA 3E6DA 3S2WA 4XRSA 2GM4A 4IOCF 4D9JA 3LWFA 4DIQA 3M4OJ 1OLTA 5JLXA 4B4CA 3HRUA 3IUOA 1JXSA 3BT9A 1TP4A 2L7KA 3FMSA 1GHCA 1JTXA 1R1VA 1RZ4A 2XGXA 3C7JA 3CZ6A 1YS6A 2I5UA 3E1SA 1AKHB 1T38A 2K9QA 3KIOA 1BR2A 3J81K 1STZA 3J7YJ 2MSYA 1K78B 2ZXJA 3CJNA 1B72A 1UHWA 3K4JA 3DU5A 4PSXA 1P9QC 5E3OA 2WAQN 3S8PA 3VWBA 3GZ6A 4HBLA 1ZG3A 5LGNA 5M5YJ 5B1BH 4A6DA 5CKTA 3S93A 2V6EA 3EETA 5IT9Z 3OWTA 2VI6A 1E17A 4HX4A 3HUGA 2J5PA 3HOSA 4IKFA 1K4TA 3ZRGA 1SVOA 4UUSB 3LSHA 2NRAC 4AVPA 4LGWA 3G71I 2DQRA 1R9TJ 2GA1A 3OS0A 3K69A 4IXAA 3RPUD 3JCUC 2CUFA 5E3NA 4D7MA 3SXYA 1AHDP 1JT6A 4GFBA 2VQHA 2IP2A 3IWFA 4I76A 3GMEA 3FHNA 3L1PA 2HOTA 3I4MJ 1OCPA 2R0QC 1M1EB 2V79A 1G4DA 1PP8F 3DKWA 3CQZJ 3RKWA 1BC8C 4C2MJ 1IJWC 1WJDA 2LREA 4ZYEA 1U5TB 4XK4A 2EH3A 2OAZA 1T0FC 3V8KA 4F93B 3GFIA 2ZSHB 1ZRCA 4BJ5C 5FKOA 4D5FA 1XC5A 4Y52J 1I3AA 5IT3A 2JPBA 5F27A 1Z9CA 5E8GA 1L0OC 4IPAA 4IRIA 1XDSA 4KIGA 4ANJA 3AG3H 1HW5A 3TOBA 3DKXA 1W1WE 1KQ9A 1RR8C 3PSFA 1DU0A 2VXZA 2HTSA 1D1AA 4Q48A 2HQRA 2CG4A 1JUPA 1W0UA 1H88C 2W25A 3ABUA 4KDPA 1FOWA 1ZGWA 3MZYA 4RB3C 1RRJA 4RAZA 3L2VA 1B72B 3ABKH 1A04A 2Z5UA 3F8CA 3K7AJ 5L3FA 3REOA 3E6BA 4M73A 2MLKA 4OIQF 4UY8I 3ZQQA 1MW7A 4Q47A 2LVSA 4JYKA 3ZMDA 4MHGA 1Z21A 3J80K 4FCYA 4I0BA 4OMZA 1MSEC 4KN7X 3IH2A 3HUGB 3G1LA 3GZ5A 3V7CA 1DDNA 2UXXA 3LSGA 5F6FA 4MLOA 3KZIC 1B9MA 1XMKA 4HDVA 5FLXK 1BW5A 1PUFB 2LLKA 3F23A 2MW8A 4KUMA 4LJZF 4PCQA 4ZDLA 4ZTJA 1ZYRF 1B59A 4XICA 2DQLA 4F3QA 1KGSA 1ORKA 1ENHA 5FD6A 1I6XA 2DTZA 3ML6A 2P5LC 1FZPB 2XRLA 2HKXA 3HRMA 2Z3YA 2DBBA 2L01A 5GTIC 3PQKA 5DS9A 2W57A 1W36D 3RKQA 4U0WA 1XMXA 1LFPA 2GAUA 3FXMA 4N0BA 1TBXA 3ECOA 1MBKA 2RC4A 3EPZA 2QEXI 3CDLA 4N9HA 4H0EA 4DZJA 1Z7UA 3IAS2 4IVNA 3SYTA 2E5NA 1PP7U 4HF0A 5EEGA 2PJRA 1X3WB 1JE8A 1B8IA 1RI7A 2IJLA 3DPTA 3V4GA 2XRNA 3DFGA 4JX5A 2FBHA 1OPCA 1H8AC 2CU7A 4BXUA 3F8FA 2JSCA 3H3UA 2LH9A 2E60A 2GQQA 2FA5A 5FGMA 1O3QA 4P9FA 2K9MA 2XSDC 4G94A 1VQNI 1SFOJ 1W5CC 2XAHA 3JRBA 1SD7A 3S3NA 2DCEA 1VQ7I 3DF8A 2NYXA 1T0FA 3CC2I 4LIUA 1YYVA 1ZELA 3K4LA 3UR3C 2CSOA 4DZPA 3K4KA 2DA4A 3KYLA 1FBUA 5CVVA 1FWZA 5H2FC 4E7IA 2COBA 4XKBA 3GYHX 4G7OF 2VJIA 4HZFA 1LEAA 2X1EA 1DP3A 4LFUA 2LDUA 2G7HA 2MD0A 4XQFA 3JREA 2K40A 3CDHA 3NWSA 2DT6A 1XGNA 2IS6A 1MSFC 2FUG2 5JHFA 2EWNA 2CUZA 2P81A 2FNPA 2WB1A 2A6EF 2W4SA 1YS7A 2HYFA 2VBWA 5GPCA 3OL3A 1U9NA 2E1CA 4WXHA 3BR5A 4ESJA 1A6IA 1T2KA 4DYCA 2KIFA 2ELKA 5HLGA 5JVTA 3OYFA 5KAFC 1HKQA 2R93J 4U0VA 4M6YA 5H6QA 2TDXA 3BZ6A 4FHTA 4HA8A 4RGSA 4C3JJ 2JRMA 1LQ1A 4NB5A 2XIGA 2DW4A 1R7JA 2EV5A 1JGSA 4IHSA 2AXLA 3ZXSA 4KJZA 3EYIA 3EYYA 3VDXA 1N78A 1BM9A 5FFXA 1IDZA 3TO6A 4NDLA 1SAXA 1FSHA 3OYLA 3FMQA 5AONA 2OA4A 2E1OA 4I0AA 3DEWA 2MABA 2ECCA 2Y48A 3HOYJ 5FKMA 4O3MA 2PJRB 1JHHA 2DPDA 3PNVA 1B8IB 4P9UA 3F0CA 2STWA 2EBIA 3QODA 4HNTA 1L3LA 5GAGJ 1QVUA 1FOKA 4II3A 2W84A 3OYGA 1SMTA 5ICGA 5LGUA 2M8GX 3GO5A 3DPLC 3S3MA 1G2HA 2VOPA 3ZMSA 1OYWA 2YSRA 2M4KA 1TL8A 5BMZA 5F0CA 1O3SA 2HPIA 5CVUA 2JZYA 4M9ZA 4M3BA 1BBYA 2XAGA 3FWEA 3LSIA 5AIQA 3ESWB 5FB2A 3R60A 4II2A 3BZCA 5F1RA 4XNFA 4N4NB 4HEA2 2O5RA 3MD2A 5L3DA 3CCMI 4PFOA 3ERED 5DV5A 3WTUC 4ZC3A 2FBKA 1PUEE 3BDDA 3HM5A 3HHGA 4LIVA 5J4YA 5BPDA 2XROA 2ESHA 2R7OA 3ZOBA 1XCBA 3LA7A 3FKJA 2O8XA 3GWZA 1A5JA 3IKVA 3QP5A 1TW3A 4ENKA 1ETVA 2DA3A 4G9YA 3L7WA 1E3HA 1CGPA 1F43A 5E17F 4CGZA 2Y75A 3FXJA 1BR1A 2I10A 4E70A 4U7DA 4ZDPA 2ADUA 3PJRA 1Y56A 3K6GA 2CGPA 2H8RA 4AYBN 3VFZA 1D5YA 5FD5A 4RLQA 2XVCA 3OYMA 4JBAA 2OD5A 1GLNA 2VBXA 3C2BA 1UHSA 4DNCA 3NQOA 3M1EA 1BN5A 5IYDJ 1DUXC 1ZN2A 4RDUA 4LK1F 3HGGA 1SFEA 1JJ6C 5HDNA 1YRNA 2P8TA 3OIOA 1H9GA 4CH7A 4MO7A 1R71A 3CCQI 3B73A 2DA6A 3I9V2 3WTYC 1R58A 1Z91A 2VQGA 3PFIA 2O7OA 3JAMK 3MEXA 1I6HJ 1MMSA 4FQGA 3P9CA 3OSFA 1KU7A 2K3PA 2MH9A 5L3CA 3K70C 2ZKZA 2ELHA 4FTHA 1XGMA 2M8EA 1W5SA 2TCTA 3BCAA 4UB8C 4XBFA 4A3IJ 2ETHA 4LG3A 3KEOA 3CMMA 3NARA 3V7SA 3H92A 2L0KA 3D0SA 3IC7A 1XCVA 3KEYA 2KIMA 2AHQA 2W24A 2DI3A 2LG4A 3KE2A 1XG1A 3KP4A 2M45A 4RAFA 3QRFF 2EB7A 2FMLA 1P4XA 3EDPA 2VLAA 2BHZA 3WU1B 3E0JB 5DUKA 3FK6A 3H9GA 3R61A 2BY0A 1T8IA 3TO7A 2DDBA 3H5RA 5KNLA 3MVPA 2RAEA 1X58A 2AXTC 2HR3A 2KZVA 4GCVA 2IA0A 1ETOA 2LFBA 3FM3A 5HNFA 3IAM2 3F21A 2HDWA 5DM6F 1BI1A 3SJMA 2OTJI 1K61A 3GFLA 3QP6A 1OYIA 5LEJA 4FE4A 4JP0A 2PJPA 2R7WA 3DWLE 2QWWA 2VE8A 4KIBA 2F4IA 1J9IA 4OAYA 4Y33A 2ESNA 2GIZA 3FIWA 4XLNF 4N4OB 5B5EC 3PM1A 5IOYA 3CJTB 4QTRA 4XKWA 5HOOA 3ZP5A 1GXPA 1X1DA 3MZHA 2XAUA 4XN3A 5LFAA 2QSHX 1USSA 4HNUA 3M07A 3H9QA 2XF5A 1D8KA 1Z3YA 1YRNB 2DA5A 3SZGA 2GZWA 2BOLA 4PJJA 2MD5A 1XSXA 3RJPA 1HKSA 4MQ9F 1POGA 2X6YA 2DOEA 3TKYA 2A69F 2V1NA 3S2HJ 1R4MB 4WF2A 1DPRA 5BOXA 3I59A 5J4VA 3C18A 2CFXA 2JUGA 2YX4A 3E6MA 3M8JA 3DQVC 4KIFA 1ZTRA 4D0PA 4EEFG 3VODA 1IXCA 2FXAA 2LTPA 4XKCA 1BIBA 3ZR8X 4UVBA 2V9VA 1BJAA 2WV1A 3M3YJ 1E3OC 4QPOA 4YRVA 4OIOF 1ZGJA 1MH4A 4MEXF 1WI3A 5LHIA 3P5JA 1APLC 1Y8RB 5C4JJ 2PQ8A 1YTYA 3DP7A 4E7JA 4RB1A 1JUMA 2PI0A 1R00A 4MTDA 2DMUA 4PJNA 3GLXA 3GEZA 1S29A 1YW7A 3IP4B 4DYQA 1ZRDA 3CMEI 3BPXA 4BH9A 1MIJA 2XC7A 3PUBA 3MKWB 4EMSA 4Y4RA 3L09A 4G12A 3L2UA 2JVGA 5ICFA 4E7HA 2A5WA 1LFUP 4I01A 3K10A 4OINF 3TW6A 2EZKA 5DUIA 2Q1ZB 1UMQA 2KRCA 2H6BA 2UUZA 4LMYA 3ZGKA 5CVRA 1GV2A 5BPIA 2RDPA 1JKPC 5GAEJ 3JRAA 3B6CA 2DO7A 5K5RA 1K78A 3HOTA 2WV0A 4A12A 4PK4A 4HG2A 4CUGA 4C30A 2BE5F 1LDJA 4HAMA 1G6NA 2KDOA 2X48A 2ZXHA 3MAJA 4OU0A 5EJCA 2RQPA 2BVLA 4KNYA 1VI0A 4NUBA 4PUSA 1R23A 3L9FA 3ABLH 4UV8A 3GBGA 1VQ8I 4BE0A 2WB1N 1WZ2A 2HDDA 3CLOA 4I7HA 1V54H 2HVQA 2NXNB 1MMDA 3WGHA 3DU6A 2H27A 3I59B 4M3GA 2FU4A 4XRMA 4L9VA 3I55I 5KK1A 3J81Z 1D1CA 2E1MC 2GBYA 4BDZA 2P5KA 3W6KB 1WI9A 2A68F 2F5VA 1E3PA 3FISA 3P9KA 4ON0A 2VT2A 2FF4A 1YIJI 2XSJC 1MJ9A 4XMYA 3VYSB 1HSJA 2LC2A 1OCOH 3D5LA 4I09A 2KJBA 3GTGJ 1A6QA 3FXKA 4ITVA 5F0FA 5HLHA 2EJRA 2IBDA 2HS5A 4HSTA 3PIPF 1FTZA 1FOYA 2W7NA 3PNTA 3C1DA 3FBNB 1A31A 4UNOA 3ZQIA 5EGOA 2DYSH 2IW5A 2K9SA 1ZHFA 2MYSA 1OJLA 3ZMTA 5K7ZA 3BTLA 3MN2A 4XOTA 3KP2A 3CCUI 4UHTA 3LAPA 3CC4I 2Y9YA 1IGNA 5D8KB 2BHYA 2H09A 3X2QH 2R7SA 3W6JB 2HQNA 2B63J 1YE9A 1QZYA 4FT8A 3LSTA 4B8XA 1WCMJ 1IDYA 3RI4A 1N77A 3G6EI 1Q1VA 5DM7F 3KLNA 4DGWB 3CMAI 2OZUA 4WXDA 3S16J 3HTUA 4JOMA 4S04A 1FT9A 3WTXC 3PNYA 4A0XA 5D5WB 3MQ0A 5IP9J 2DMQA 4AWXB 4CYDA 4ZH4F 2K86A 1B4AA 3ERMA 5F0HA 2R5YB 3A2KA 3ZQLA 5GADJ 1XN7A 1IV6A 4P1WA 3Q9VA 1E2XA 2KIQA 4R8HA 1FP2A 5D4SA 3SZPA 4NQWA 3I64A 3IKTA 4U7BA 3O6BB 1KU9A 5TISC 1MD0A 3I54A 3WTVC 3LNQA 2F5DA 2EFQA 3QAHA 2V7FA 3Q3SA 3QOPA 3TP3A 3JRFA 1MGTA 2DFEA 4XLCA 3BG6A 2FJ1A 3WG7H 2E1NA 5KVRA 3OSGA 1CF7A 2NNYA 3HZJA 5D5VB 2ECBA 2VXDA 1T56A 3LSJA 3HDDA 2HYGD 2TRTA 2OU2A 1UZCA 4A3MJ 1HW2A 3I58A 2HOAA 1PUFA 3CJQB 2F48A 4F7ZA 2IA2A 2ZXIA 3CCRI 5IPAA 4MIMA 2NVXJ 1ERDA 2GLOA 3TQNA 3I0TA 3U21A 4BJ6C 3HBLA 1B9NA 4PZJA 4Q4ZF 2XAQA 1FP1D 2W48A 4ZYGA 2EFWA 1IXRC 3S15J 2P0WA 3RTRA 3J80Z 2QCOA 1I1SA 5EZHA 2GXGA 2RVCA 3GLLA 4KITB 2D45A 2HI3A 1HKTA 3T8TA 2DFHA 2VIXA 5HS9A 5EGOB 3CCVI 2K9NA 1WJAA 3KCCA 3SDBA 4L9TA 3ABMH 2DPUA 4UB6C 1BC7C 4I2OA 1KU3A 1MBGA 2M7BA 1I3QJ 2O3FA 1I39A 3LMMA 4UUTA 2QVOA 3OYJA 3OYHA 3F72A 3N4MA 3PSIA 1LFBA 2VBYA 1T08B 2BXYA 4LK0F 4CICA 4OAZA 2M9HA 1WKMA 3MWMA 5CQGA 3HGYA 4UXNA 2M1BA 1WGXA 3FX3A 2ZO4A 1KZHA 2JA6J 4G6TB 4A3KJ 1CQTA 1MMAA 2X6OA 4AC0A 4ZYAA 3BCBA 1FEXA 3FMRA 2Y69H 3FXLA 4PDKA 4BQAA 3PIOF 2HQAA 4YFXF 4UUVA 3FBIB 3S1RJ 1V5FA 4IHTA 3QYFA 3CC7I 2RNGA 2QKLB 3LSMA 3JSOA 3JR9A 2VB6A 1ETKA 4IHXA 6PAXA 3JRGA 3F6VA 2GWRA 4I99C 1LE8A 1EH7A 5BS6A 5IT9K 1TWFJ 3N05A 1Y0UA 3HPHA 4NQWB 4ZYDA 1T6SA 4F92B 4CCOA 1VNDA 3TOAA 2LKPA 2VJJA 4RB2C 2LD5A 4EJTA 5E1ZB 1XSVA 1LB2A 5JHUA 2M2EA 4G6DA 4HX7A 2JQ7A 3E5UA 1CF7B 4KISA 3Q9SA 3Q5FA 2L7MP 4IRHA 3K70D 2ID3A 2M3AA 3HKZA 5C3EJ 1UHMA 3HG9A 3Q0UA 4BGDA 1W7PA 2D1VA 3CUQC 3DPUA 2YU9J 2ZMEC 4MNUA 2HDCA 3J7AY 3OMYA 2CWEA 1FIPA 1P4AA 4G7HF 5L3BA 4GYIA 1DQUA 1YFHA 4Q5SF 2R7QA 2CJJA 2XDVA 1VQKI 4CXFA 1QQIA 3CD6I 4B43A 1IV8A 1O3TA 3A01A 1D0XA 2FNAA 2Q2EB 2QLZA 4A6EA 4X0GA 4CZZA 1GVJA 3ROUA 4ZTFA 3GW2A 1Y6IA 1G8XA 3DLAA 1O3RA 3G3ZA 2E1MB 3V42A 1FBSA 4RA2A 5CVJA 3A02A 4ABZA 4KA4A 2ZBKA 3JRIA 4L0ZB 2VQCA 2VKVA 3F3XA 2BYVE 1TC3C 2XGCA 4M9SA 2L02A 3OY9A 3O3KA 3D5RC 2CYYA 2CUJA 1RPWA 3O2PE 1JT0A 2H1KA 3NRVA 3IH3A 2ME6A 3WE3A 1VF9A 1EKEA 2ID6A 2GOXB 3TGNA 3EQLF 3VOEA 1ZQ3P 2IS2A 2CW8A 2PMHA 1S5LC 2K3FA 1JGGA 1MBEA 4EM1A 2XB5A 2UZKA 2K27A 3SHFA 1LE8B 2HKOA 3CP2A 4U88A 2CQKA 2M0MA 1XX5A 2ICWG 2VT3A 2NS7A 4PGHA 2D5VA 2X51A 1J5YA 1RUOA 4CA0A 4JX6A 3MCZA 5FKLA 1YIOA 2DMPA 2LF7A 2A3SA 1P92A 1JI8A 1VQ6I 3NEUA 4YIIA 2HYJA 4BY7J 1D3YA 1YO5C 2WY8Q 1S9HA 2FOKA 1R1TA 4ASNA 1RIOH 5J3LA 2Y9ZA 1LDKB 2Q0OA 4RAGA 1QPIA 2VC1A 1YJWI 3CCJI 2O6GE 2OCEA 1T98A 2L4AA 4BQQA 4R1HA 5E1WA 3OYIA 3BTCA 3KETA 4XLEA 1W7PB 4CZCA 2K85A 3ONQA 1LPQA 4NC8A 3MZ8A 5E20A 3GXOA 3GTMJ 3BTIA 4XLFA 1Y1VJ 4XOPA 4P96A 4RM3A 3F8NA 1X2NA 3M9AA 2F6CA 2FRHA 4O5VA 1D8JA 2JTVA 3HSFA 3A01B 1FIAA 1X19A 2JWTA 1SD6A 2BBYA 3LL7A 2DA1A 3OYEA 3R0AA 3I56I 5J1YA 3ZQHA 2GIVA 3PFYA 1HLVA 1MDMA 2JVHA 3OS2A 3G73A 1DPUA 1G3SA 5K5QA 3ABTA 2H8WA 2HVRA 3PQJA 3E5QA 3CCLI 3CUQA 3WGGA 1W5TA 1P6RA 2DK8A 2ZMEA 4IHVA 5EDNA 1NG6A 1VTNC 3B6AA 4JX4A 1P2FA 4KMUX 4AD9A 2PMUA 1UFMA 2DMTA 2XF7A 5DCFA 4KFCA 5LGTA 1DP7P 3OIQA 3JTHA 2K7LA 1KONA 3OR2C 4HRIA 3ZQ7A 4QIWN 4PGGA 1W0TA 1BOAA 2MGQA 3PO3J 2EV6A 1FBQA 1MBHA 4L5JA 5A2QK 2KFDA 1PDNC 1O7FA 2WY7Q 3GFMA 3ZMZA 1R36A 2VN2A 5BNGA 1F1ZA 2F4MB 2JA8J 1ZLKA 4AM3A 4A3BJ 5IOZA 3KLOA 1YJ9I 4KMFA 4KYWA 1G3TA 1Y8QB 3JAMZ 1OCRH 4IOAF 4M74A 2E2JJ 1XS9A 1LVAA 2EIKH 3QPSA 3CCEI 3GTQJ 2Y0MA 3A0HC 4XRSG 3J7AO 1HXDA 2V4JC 2WBMA 1HBXG 2BY2A 1LUJB 3ZQGA 4UVCA 4M72A 4G8XA 3HEFA 3QOEA 1AOYA 4BHCA 1J75A 2VE9A 4A93J 2R7TA 5IYCJ 2R7XA 1TQPA 4A69C 3W6VA 2E2HJ 1TQIA 3D1NI 4R79A 1DU6A 1MBJA 2WAQA 4D5CA 5F08A 4HF1A 2YPRA 1U9OA 1FTTA 3ZCOA 3N97A 1WJEA 1LEBA 4G7ZF 2EFNA 5B3SH 3WHBA 5TGTA 5K7HA 1NH3A 3BR6A 4WCGA 3DEUA 1MDMB 3OOUA 1GUUA 1UB9A 3AG4H 4LLGF 1ONVA 4XIDA 1UAAA 3DBRB 4V19K 2VONA 3CUQB 4J19A 2ZMEB 1YQAA 1R4NB 2M4GA 2CW0F 1FYLA 2Q8KA 4IL6C 3VYRB 4YFNF 3JRHA 2H6CA 5JLWA 5KHDA 2V1UA 4MEYF 3LOCA 1FX7A 2Y0SA 4EGZA 1IC8A 1TQMA 1R22A 2E2IJ 1XTAA 2FX0A 3HOUJ 2COMA 5CPRB 5FROA 3EUKL 3T5XA 4RMNA 2CFOA 4BKXA 5IP7J 1REPC 2P6TA 4BBRJ 3CDIA 4KT6A 2KDZA 3FHZA 4RGXA 3BWGA 5IP6A 1YJNI 1W7PD 2VASA 3KP3A 2ZNZA 3K2AA 1IN6A 3GVAA 4XN0A 2HZDA 2A05A 2Z2SB 1ETYA 1FMWA 5KCMA 2JRTA 1ZAOA 4PJMA 4EJVA 3OR1C 2DJNA 3HIFA 3L00A 5J40A 3R4KA 4BUPA 3GX4X 2QF7A 2EPFA 5AIPA 2MFZA 3AKZA 3OL4A 2PX9A 5ILVA 3QPHA 4GXOA 4IX7A 1K6YA 2HVSA 3HB9A 1G3YA 4A3CJ 3VYTB 2G7UA 1YI2I 1IUYA 4M9XA 4RM2A 3S32A 3COAC 1QGPA 1BL0A 2BW3A 1MJAA 4XLHA 4YG2F 1ON2A 4XLAA 3U9GA 3BQZA 3H5NA 5ICCA 2VPLA 3WG9A 1EF4A 3F8MA 2M34A 2VKDA 1WJCA 1MNEA 1ZLJA 2PMZA 4ESBA 5EG0A 1PYVA 4Z6YA 4C3HJ 2DOFA 2B7EA 3RKXA 2HPMA 4HYEA 1HDPA 2E35A 4CO8A 3S1NJ 1OR7A 1VQPI 4EM2A 1QZEA 2PEXA 5M3FJ 2NVTJ 2WADA 4XRFA 3T0YA 3ZN0A 1NK2P 5HLTA 1H9TA 3ZPLA 3LA2A 5DTDA 3HOWJ 3AG1H 5IY5H 3Q0VA 4ENNA 2WAEA 3QPTA 1IN7A 2L9SA 4UV9A 4GO1A 3TMOA 3BG7A 1A35A 2DJIA 2EQRA 3RKYA 2EFPA 1FPQA 3OOPA 2E71A 4IEJA 2N8GA 4ZJZA 4L0YB 3G2BA 5D6EA 1TWCJ 2BY3A 3PO2J 1TWAJ 3HKZN 2EIMH 3MMYB 2K5CA 5D5XB 4NBQA 2NOGA 2QKMB 2KISA 2VKHA 2GOMA 2CUEA 3S17J 5LEKA 1IXSB 3KP5A 2KHMA 3WGIA 2F2EA 3MFKA 4D1QA 1ZARA 3UKGA 2XV4S 2Z1DA 3J7ZI 4PFPA 3W3CA 3OYDA 1U6GA 3CP8A 1Z0XA 1BW6A 3FK7A 2Y30A 2WWYA 1KQ0A 1I5ZA 2LSOA 4BXFA 3QYEA 4IHYA 2O61A 3S2DJ 1LKXA 2JUCA 3WODF 5ED4A 2IGKA 5M5XJ 2CS3A 1JTYA 4BYYA 3DBHB 1D1BA 3NAUA 4LLLA 4E6KG 3IV5A 4BACA 3ULQB 1WRJA 3DXJF 5B1AH 4AUXA 1TNTA 1U2WA 5CLSA 2E19A 2BW3B 3FF5A 4I02A 4B47A 1QU3A 2YX7A 1X3UA
chains in the Genus database with same CATH topology
1QA6A 2QA4I 1VQNI 5DM6F 2OTJI 1S72I 1VQ7I 1VQ8I 1VQ4I 3CCRI 2ZJPF 3CC2I 1YI2I 1YHQI 2NXNB 3CF5F 3CJTB 3I55I 2ZJQF 3CCVI 2OTLI 1FOWA 1YJ9I 4IOCF 1YIJI 2E35A 4IOAF 1VQPI 3CCEI 2K3FA 3PIPF 4UY8I 1FOYA 2ZJRF 3J7YJ 3CCQI 3CCUI 2FOWA 3CC4I 3PIOF 1VQ6I 3CC7I 1MMSA 1YJWI 3G6EI 3CCJI 2E34A 3CMAI 5DM7F 1VQLI 3CMEI 5GAHJ 3DLLF 3J7ZI 5GAGJ 4V19K 2E36A 2JQ7A 4IO9F 3G71I 5GADJ 1VQ9I 5JVGF 1VQMI 2QEXI 3I56I 1FOXA 1HC8A 1VQ5I 1VQOI 1Y39A 3G4SI 2H8WA 5GAEJ 3CCLI 3CCMI 1YJNI 1ACIA 1VQKI 3CCSI 3CD6I 1YITI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QA6 A;  2QA4 I;  1VQN I;  5DM6 F;  2OTJ I;  1S72 I;  1VQ7 I;  1VQ8 I;  1VQ4 I;  3CCR I;  2ZJP F;  3CC2 I;  1YI2 I;  1YHQ I;  2NXN B;  3CF5 F;  3CJT B;  3I55 I;  2ZJQ F;  3CCV I;  2OTL I;  1FOW A;  1YJ9 I;  4IOC F;  1YIJ I;  2E35 A;  4IOA F;  1VQP I;  3CCE I;  2K3F A;  3PIP F;  4UY8 I;  1FOY A;  2ZJR F;  3J7Y J;  3CCQ I;  3CCU I;  2FOW A;  3CC4 I;  3PIO F;  1VQ6 I;  3CC7 I;  1MMS A;  1YJW I;  3G6E I;  3CCJ I;  2E34 A;  3CMA I;  5DM7 F;  1VQL I;  3CME I;  5GAH J;  3DLL F;  3J7Z I;  5GAG J;  4V19 K;  2E36 A;  2JQ7 A;  4IO9 F;  3G71 I;  5GAD J;  1VQ9 I;  5JVG F;  1VQM I;  2QEX I;  3I56 I;  1FOX A;  1HC8 A;  1VQ5 I;  1VQO I;  1Y39 A;  3G4S I;  2H8W A;  5GAE J;  3CCL I;  3CCM I;  1YJN I;  1ACI A;  1VQK I;  3CCS I;  3CD6 I;  1YIT I; 
#chains in the Genus database with same CATH topology
 2XKO A;  2Y2Z A;  2OZ6 A;  2CQX A;  2EZH A;  4DBQ A;  4FX0 A;  5HNH A;  1MZB A;  4HLX A;  1A36 A;  5EG0 B;  2LR8 A;  2F5E A;  1HQC A;  2KPM A;  2XGE A;  4EGY A;  2M5W A;  4JQF A;  1RNL A;  1EJ9 A;  5JI6 A;  5KAI C;  3F9K A;  5JR3 A;  4J01 A;  5D8L B;  5D6F A;  3SFI A;  1UG0 A;  4ENJ A;  2R3S A;  2R5Y A;  1O57 A;  2YR2 A;  2YU3 A;  1BA5 A;  5E8I A;  5GTH C;  2Z33 A;  2NAZ A;  3E7L A;  2XPW A;  1LNW A;  3WE2 A;  2R7D A;  3V7R A;  4CHU A;  1S3J A;  2OQG A;  4RB0 A;  4E4H A;  5D4R A;  2DYR H;  4MQV A;  3U2R A;  4NC7 A;  4CCL A;  2VL8 A;  4MFE A;  2UWM A;  5F64 A;  1FC3 A;  1IG7 A;  3F8B A;  5CYV A;  2CV2 A;  1WFX A;  2P4W A;  2X1D A;  4F52 A;  2ZJR F;  1FLI A;  1AA7 A;  1XD7 A;  2V1D A;  1HST A;  4M71 A;  3OV8 A;  3A4C A;  2MBF A;  2Z16 A;  5K5O A;  3L2C A;  2FOW A;  3BR1 A;  3VSL A;  4YIR X;  9ANT A;  2X85 A;  1U8R A;  4QPQ A;  1SMY F;  1LDD A;  2M87 A;  2YUS A;  2HOE A;  4DOZ A;  2KRH A;  3GF2 A;  3TBI A;  2RN7 A;  1WH5 A;  3K4M A;  3I5U A;  1YG2 A;  5EEA A;  2RGV A;  1RKW A;  4CYC A;  1OQY A;  1J59 A;  3ELK A;  2ELJ A;  5K7F A;  4S05 A;  1IN8 A;  1R5I D;  3LSP A;  4KIC A;  4E7K A;  3I71 A;  3HSR A;  1J2X A;  2QM3 A;  3VYU B;  1KA8 A;  3GZN B;  1JKR C;  4C2U A;  4A3D J;  2NOJ B;  1D5V A;  5HS8 A;  1XDU A;  3WTT C;  2IT0 A;  2VOD A;  1VQ9 I;  5L3E A;  3LFU A;  2R7U A;  5TJJ A;  4BS9 A;  1QNT A;  4BAY A;  4AIK A;  1X1B A;  3VPR A;  1B6A A;  2NVY J;  1ZH5 A;  4BBS J;  2C6Y A;  2ZB9 A;  1O7L A;  2BGC A;  1SD5 A;  2W85 A;  2LY9 A;  1OCT C;  3EUA A;  3CCY A;  4W97 A;  4A5N A;  4WK8 F;  1TZL A;  2QQB A;  2FSW A;  3SZT A;  2ZXW H;  1U8B A;  5FJ8 J;  1R1U A;  1PJR A;  1V3F A;  4A3L J;  1ZG1 A;  2WA0 A;  3H0G J;  1ZKG A;  2A61 A;  2K9L A;  3HYI A;  1IN5 A;  3WHC A;  2MH2 A;  1QO0 D;  1QVT A;  2G9W A;  3FXO A;  4XL9 A;  1G59 A;  2XB0 X;  3HXL A;  2P5V A;  1S8N A;  2GXA A;  3BG5 A;  5FRN A;  1ON1 A;  2FE3 A;  2JJ7 A;  2MA3 A;  3V8L A;  1U3E M;  1OKR A;  1MND A;  1Z67 A;  5DEQ A;  4OIR F;  4G6Q A;  2HXO A;  3HL2 A;  1MH3 A;  2EV0 A;  2DT5 A;  5GP9 A;  2OPT A;  2JN6 A;  4L9J A;  4AYB A;  3GUD A;  3BQY A;  4ETS A;  3LFK A;  2X0L A;  2R92 J;  2KKO A;  1RES A;  3LSR A;  1SFX A;  2YS9 A;  4RAY A;  4A3F J;  3ZN1 A;  1WWX A;  3CTA A;  2FBI A;  3VB2 A;  1Y1W J;  1SVL A;  1RR7 A;  1Z3X A;  2HWV A;  4OWR B;  5FLM J;  2EIJ H;  2OCC H;  1WHU A;  2LBF B;  3Q0W A;  2UV1 A;  3JSP A;  2CQ7 A;  1BJZ A;  1F5T A;  1IRG A;  4WXC A;  4A5M A;  4CCM A;  3HOX J;  4XOR A;  4L5E A;  3KX2 A;  2L9V A;  3HSE A;  4C2T A;  1J0R A;  3NWT A;  4A0Z A;  4B3X A;  3BG9 A;  4CYC B;  2CQN A;  1XGS A;  1FY7 A;  4Y7N J;  1FNN A;  1BI0 A;  3U1D A;  3P7N A;  2Q2E A;  1K4S A;  1XPX A;  4BJT A;  1XB4 A;  5J1R A;  4F55 A;  3E6C C;  4U0Y A;  2XAJ A;  2FQ4 A;  1AWC A;  1UST A;  2KP6 A;  5FLX Z;  1RET A;  1X4O A;  4M3E A;  5ERI A;  3AFH A;  2QGU A;  5EEH A;  5DYM A;  2DT7 B;  4ZYH A;  4IHW A;  4NC6 A;  3EUH A;  4LB5 A;  1TW2 A;  2Y0S N;  2BZT A;  4KT5 C;  3DCF A;  4AU7 A;  2JMW A;  2L7Z A;  1R5G A;  2DTR A;  4CSW A;  3ASO H;  4OIP F;  3JRD A;  4DW6 A;  2NS0 A;  4B3A A;  2E36 A;  2L3D A;  1ETQ A;  3TED A;  1TT5 B;  1X4P A;  1WJ5 A;  5FKN A;  2M7A A;  2L54 A;  2AQE A;  5J6X A;  1I27 A;  3B02 A;  1X1C A;  1XGO A;  3K4B A;  2KZG A;  4PJ0 C;  4U87 A;  5FFZ A;  1ZR4 A;  3S14 J;  4XON A;  3QWL A;  3BTJ A;  5EF6 A;  1FMV A;  1OFC X;  2KIU A;  1WSU A;  2HZT A;  4L9N A;  4HW0 A;  4B09 A;  1WPK A;  5JFR A;  2J5O A;  2IRF G;  5FRM A;  4A3G J;  2XHK A;  1WH7 A;  4HV6 A;  4LOC A;  1D0Y A;  1V5E A;  2QUF A;  1P7I A;  4HOB A;  3BRO A;  1QHH D;  1QRY A;  2PMZ N;  3T1B A;  4YIF A;  1R6R A;  1YX3 A;  1Z6T A;  2BY1 A;  5DD8 A;  1VQ4 I;  1TNS A;  4F91 B;  2ZJP F;  4TV7 A;  1H0M A;  2NVQ J;  1I50 J;  4RLF A;  4M3D A;  2DDA A;  2LK2 A;  1Y0N A;  3KYC B;  3T8R A;  1TLH B;  2ZNY A;  4MGR A;  3H35 A;  1J09 A;  2VC0 A;  2IXS A;  5HOD A;  3E3V A;  4EJW A;  1OIS A;  1IZ1 A;  2JA2 A;  4P55 A;  1WVR A;  1BI2 A;  2HTJ A;  3BG3 A;  3LA3 A;  1YOV B;  3PL8 A;  2IEK A;  4OOI A;  4Y3O A;  3GTO J;  1BI3 A;  3HRS A;  2ZC2 A;  1F9N A;  2P7V B;  3I53 A;  1IRF A;  4Y13 A;  2XPU A;  4BDY A;  4AIH A;  5D5U B;  4FET A;  1SFK A;  3HOZ J;  1SAN A;  3GTL J;  3BJO A;  1K7A A;  3BPV A;  3OIP A;  1OCC H;  4Z2Y A;  3K4N A;  1SD4 A;  2O8K A;  2FQ3 A;  1TT0 A;  4XR6 A;  1TWG J;  2CW7 A;  3FXU A;  3ZQC A;  2W00 A;  2L9N A;  1D0Z A;  3DTK A;  2A07 F;  1OCZ H;  4AID A;  3K2Z A;  4HPQ A;  1ZRE A;  3LSK A;  2E7W A;  1QBJ A;  2QQA A;  3RDI A;  5LHG A;  3DTI A;  3OYA A;  4BY1 J;  2OF7 A;  5DCM A;  3A0B C;  2XF6 A;  3SEQ A;  4GRI A;  5DD4 A;  4DQ2 A;  4L18 B;  2IS1 A;  5LRR A;  2Z99 A;  2KMU A;  3BR2 A;  3R6S A;  4M3F A;  3IRQ A;  4IRG A;  3BR0 A;  2EIN H;  1MBF A;  1B1B A;  1R5H A;  1OYY A;  3H3V K;  4EJU A;  4HDU A;  4RGR A;  3O8H A;  4A3J J;  3RPQ A;  4IQ4 A;  3DLL F;  4BHB A;  4YEJ A;  4BQO A;  2OJE D;  4O6J A;  4L5I A;  4QLC U;  1MMN A;  2JSP A;  3L2Q A;  4GDF A;  3ZMU A;  5HDK A;  1YW8 A;  1KQ8 A;  5IYB J;  3H3Z A;  1GDT A;  4GGG A;  4B1R A;  4DYR A;  4PJL A;  1FOX A;  1S7O A;  2DU9 A;  3P9I A;  1VQO I;  3C3W A;  4CDG A;  2ZFU A;  4HQE A;  2XAS A;  2XAF A;  4I98 B;  2EA4 A;  3QU3 A;  2L2O A;  5TRD A;  3M8F A;  3TW7 A;  2NS8 A;  2LKS A;  5A2Q Z;  5DDG A;  3WU2 C;  2M30 A;  1ULY A;  1FYK A;  3RQI A;  3A1Y A;  3GFJ A;  4IF4 A;  4EAT A;  4RBO A;  1DGW Y;  4AIJ A;  3CO7 C;  2CH0 A;  1S6L A;  4JK1 X;  4DBR A;  1EV7 A;  4M6V A;  2QEN A;  1QA6 A;  3QU6 A;  3GCM A;  2HNH A;  4BNC A;  2QA4 I;  4HSR A;  2R5Z A;  4XKV A;  2CRG A;  2O0Y A;  4NNJ A;  3RCO A;  3MKZ A;  4OMY A;  4BXX J;  2EZI A;  2ISZ A;  1MKM A;  1BR4 A;  5HLI A;  1AU7 A;  3BLY A;  1Z1D A;  3RYR A;  1ZG5 A;  3ZQF A;  4PSW A;  4EM0 B;  3SQN A;  1HCR A;  2BV6 A;  5C4X J;  4MFD A;  2RKH A;  3LQQ A;  1IRX A;  3QYB A;  2DAO A;  2XUB A;  4X6A J;  3C2G A;  3E5X A;  3ASN H;  3BC8 A;  2KLO A;  2A5Y B;  2R7V A;  3H9J A;  5M5W J;  1G3W A;  3A03 A;  2O03 A;  3PUF A;  2E7X A;  2BVM A;  4AVZ A;  2MC4 A;  3AG2 H;  5HDG A;  1PVE A;  5DCM B;  2R7R A;  1HOM A;  5FO5 A;  1F4K A;  3FM5 A;  3LAJ A;  1ZR2 A;  1KYZ A;  2L7F P;  3DTE A;  1JHF A;  4BHP A;  3OS1 A;  1UCR A;  1O4X A;  3S1M J;  4LLN A;  1NK3 P;  3KZY A;  4CCJ A;  3MKL A;  2F4O B;  4BQN A;  2QSG X;  3HJE A;  4EVI A;  1OR7 C;  3K1M A;  2DA2 A;  4WWC A;  1VFC A;  2KRF A;  2IGO A;  1QZZ A;  1XMA A;  2IGN A;  3BR3 A;  1TWH J;  4EV0 A;  2DXI A;  2ZJ2 A;  1NHA A;  2MG4 A;  3C2H A;  1BOB A;  3FDY A;  1QPM A;  3KZZ A;  5F04 A;  2LY1 A;  2X6X A;  1RC9 A;  1UEL B;  2BEO A;  1U78 A;  4V2F A;  4RS8 A;  2HFH A;  4P5O A;  1N25 A;  4XM3 A;  3OYB A;  4D7N A;  1EA3 A;  1VQL I;  2L9R A;  3BY6 A;  1C0W A;  2LMD A;  3DKY A;  3KP6 A;  2JT1 A;  4IO9 F;  3W2A A;  2E5Z A;  3JRC A;  1V5G A;  2D1H A;  1OMI A;  4KN4 X;  1FSE A;  2LNB A;  3FXR A;  3K4C A;  1EH6 A;  5E18 F;  2IAI A;  3AL0 C;  3O8G A;  2R5Z B;  3D5S C;  3F6O A;  3TDZ C;  4WX9 A;  4FE7 A;  1Q1H A;  2QZ8 A;  4FX4 A;  2K4J A;  2VBZ A;  2KL4 A;  1E0E A;  2H94 A;  3DV8 A;  3ISP A;  3G4S I;  2VJ4 A;  2RRE A;  3U1K A;  2ZFW A;  2D2W A;  1EH8 A;  4Y17 A;  5CJ9 A;  5C44 J;  1GXQ A;  2DN0 A;  3OYC A;  5EZG A;  3OYK A;  2Y31 A;  3WTZ A;  5HS7 A;  2A6H F;  3KYD B;  2HEO A;  3BJ6 A;  2WC2 A;  3BZK A;  2AO9 A;  3RZD J;  1BIA A;  2DK5 A;  1V55 H;  5LHH A;  4C9Y A;  1JKO C;  2W82 A;  3SDG A;  2X6W A;  2OQR A;  4NHJ A;  4A0Y A;  2RQQ A;  4LD5 A;  1WJF A;  1ETX A;  4HQM A;  2EIL H;  2L5Q A;  3H5A A;  3HPG A;  2MC3 A;  5J1U A;  2DA7 A;  2F5C A;  3R0J A;  2QSF X;  4A2U A;  3HRT A;  3BOQ A;  1MNM C;  2HXI A;  1ODD A;  3TP0 A;  4H4K C;  1R49 A;  2KJC A;  1WJB A;  4BL0 B;  2P6S A;  1X2M A;  1X3Z B;  2VJ5 A;  4ZDO A;  3W2W A;  3I4N J;  1JKQ C;  2B9S A;  2QQ9 A;  3CF2 A;  3G1O A;  1RKT A;  1IUF A;  4BE1 A;  4GYG A;  1SAU A;  3ZMV A;  1RUN A;  1JUS A;  1WQ2 A;  2ZSI B;  5J47 A;  2VOO A;  3K1N A;  3WTS C;  2LYC A;  1YX5 A;  2ACJ A;  2XGD A;  3CLQ A;  5EYR A;  3M1C A;  1YW9 A;  3IWZ A;  2R7Z J;  4W1U A;  1JJ8 C;  5GPA A;  4V2G A;  2CV1 A;  1SVM A;  2NNN A;  5FLV A;  1W36 C;  1SC7 A;  1TTY A;  3MKY B;  3K1P A;  2OC6 A;  1W4M A;  1IAW A;  1GV5 A;  4CCN A;  1HW1 A;  2HU9 A;  4ZZL A;  2QBY A;  3S1Q J;  4UVA A;  2F5F A;  2LOO A;  5CVI A;  2HGC A;  1H89 C;  3I3L A;  1MMG A;  5GAH J;  3RPU A;  4XLP F;  2K4B A;  2LY2 A;  4J00 A;  4DJA A;  1IF1 A;  4EJO A;  2PG4 A;  2WTE A;  4LB6 B;  4HF2 A;  2GA2 A;  3W2V A;  2PBI A;  2HQ5 A;  2JK3 A;  3G1M A;  4IQJ A;  2OBP A;  5JVG F;  3H0D A;  3CMY A;  1VQM I;  4BU2 A;  1UG2 A;  2EA2 A;  1UJ8 A;  2I8D A;  4E7L A;  1HC8 A;  1IW7 F;  2VKE A;  5FKK A;  3UNG C;  3LQR A;  2G0E A;  1KYW A;  4CCK A;  1Y39 A;  2PLY A;  1LJ9 A;  3M7G A;  2EK5 A;  2IVM A;  3TL4 X;  2V1X A;  4XSZ F;  1ACI A;  2X4H A;  2R4G A;  3JW4 A;  4FAS D;  5LRS A;  3CCS I;  4BEH A;  2LP0 A;  2KQR A;  4IZZ A;  2RV8 A;  1YLF A;  4ESF A;  1SEU A;  1T95 A;  3OYN A;  1XSD A;  2XKP A;  3RQ4 A;  1HA8 A;  2DFI A;  1S72 I;  3FKI J;  3FXQ A;  1ZRF A;  2IPQ X;  2FMY A;  3KFW X;  1X1P A;  1U5T C;  3V8J A;  3SEZ A;  4X1E A;  2IGM A;  4LIT A;  1S7E A;  2ZCW A;  3KP7 A;  4B48 A;  2CMP A;  3RZO J;  3HTS B;  2ZJQ F;  1GVD A;  5HVQ C;  4IJA A;  4HX8 A;  3DEE A;  2P7C B;  5E79 C;  5E3L A;  2IA1 A;  3IH4 A;  3RSN A;  3WU0 A;  2EZL A;  2UXN A;  1VZ0 A;  5F1J A;  2VQL A;  4M6X A;  3VSK A;  3CJR B;  2OTL I;  4E7Z A;  3L2W A;  3SFZ A;  4XSX F;  4EQQ A;  5B66 C;  3CES A;  1X1A A;  2JA7 J;  4HLY A;  4QWQ A;  2LF8 A;  3HC7 A;  3I4P A;  4S0H B;  3K9T A;  1FJL A;  4LG0 A;  1Z6R A;  1K79 A;  2OUM A;  4C3I J;  2DFF A;  4HNV A;  1Z77 A;  1HDD C;  1FYM A;  2DOA A;  1SFU A;  4ENM A;  2QBY B;  1N75 A;  3H1C A;  2HOS A;  2W1O A;  3DBL B;  2AQF A;  1T33 A;  2B0L A;  2ME0 A;  2V9P A;  3GTJ J;  2CO5 A;  1ZK8 A;  3FZV A;  1IN4 A;  3HHH A;  4I6Z A;  2DLL A;  3KPH A;  1HF0 A;  2AS5 F;  1LVK A;  1Z7L A;  2LRD A;  4Y15 A;  3IL2 A;  4ZZD A;  3QPL A;  3AAF A;  2V6C A;  4BE2 A;  5J8C A;  1QHG A;  2VUM J;  1P7J A;  2E34 A;  2ISY A;  2M0C A;  1AKH A;  1K6O A;  2GXB A;  1KU2 A;  2QYO A;  1I1G A;  2KT0 A;  2BXZ A;  2PFB A;  3M8E A;  3S3O A;  2VPR A;  3KEQ A;  3AL0 B;  5ICE A;  4RGU A;  3JTG A;  2NVU B;  2A6T A;  2O9L A;  3RIR A;  1P4W A;  4YFK F;  2RNJ A;  4BEH B;  5E3M A;  3WTW C;  2DOD A;  1V4R A;  5E1X A;  3IRR A;  3HOV J;  5LD2 C;  4A3E J;  4QSH A;  2LBF A;  1DGR M;  3EUH C;  2X9D A;  2MLG A;  2V26 A;  1NTC A;  2WAF A;  4E7S A;  3VEP A;  3QQA A;  3CO6 C;  1VQ5 I;  5H6R A;  1U0J A;  2STT A;  2L4M A;  3IHU A;  4UUS A;  3BP8 A;  4YEL A;  2X1C A;  5CQE A;  2QQ8 A;  1YIT I;  1S7A A;  2DMN A;  1K83 J;  2CQQ A;  2Z9O A;  1NG7 A;  3TO9 A;  1ITY A;  2OV7 A;  4MTE A;  3BJA A;  1J7K A;  5J8F A;  3F22 A;  2JA5 J;  5LBQ A;  3RYP A;  2PN6 A;  4FIS A;  4N9I A;  3GTK J;  1Z05 A;  1ZGA A;  1F36 A;  5L3G A;  2IS4 A;  4K2E A;  5LLQ A;  3L2R A;  4HV5 A;  2JPC A;  3TDU C;  1YHQ I;  5ILU A;  2K02 A;  5ILS A;  3ECH A;  5M3M J;  4LG0 B;  3K0L A;  5H20 A;  5K1Y A;  3CF5 F;  5BQT A;  1IRZ A;  3E97 A;  1U5T A;  2CV0 A;  3GTP J;  2V9K A;  3CUO A;  4B44 A;  2LKX A;  3H36 A;  2H1L A;  2EFO A;  2R7F A;  2XPV A;  1ETW A;  2FD5 A;  2FEZ A;  1GT0 C;  1T39 A;  1IO2 A;  1MJB A;  3E6D A;  3S2W A;  4XRS A;  2GM4 A;  4IOC F;  4D9J A;  3LWF A;  4DIQ A;  3M4O J;  1OLT A;  5JLX A;  4B4C A;  3HRU A;  3IUO A;  1JXS A;  3BT9 A;  1TP4 A;  2L7K A;  3FMS A;  1GHC A;  1JTX A;  1R1V A;  1RZ4 A;  2XGX A;  3C7J A;  3CZ6 A;  1YS6 A;  2I5U A;  3E1S A;  1AKH B;  1T38 A;  2K9Q A;  3KIO A;  1BR2 A;  3J81 K;  1STZ A;  3J7Y J;  2MSY A;  1K78 B;  2ZXJ A;  3CJN A;  1B72 A;  1UHW A;  3K4J A;  3DU5 A;  4PSX A;  1P9Q C;  5E3O A;  2WAQ N;  3S8P A;  3VWB A;  3GZ6 A;  4HBL A;  1ZG3 A;  5LGN A;  5M5Y J;  5B1B H;  4A6D A;  5CKT A;  3S93 A;  2V6E A;  3EET A;  5IT9 Z;  3OWT A;  2VI6 A;  1E17 A;  4HX4 A;  3HUG A;  2J5P A;  3HOS A;  4IKF A;  1K4T A;  3ZRG A;  1SVO A;  4UUS B;  3LSH A;  2NRA C;  4AVP A;  4LGW A;  3G71 I;  2DQR A;  1R9T J;  2GA1 A;  3OS0 A;  3K69 A;  4IXA A;  3RPU D;  3JCU C;  2CUF A;  5E3N A;  4D7M A;  3SXY A;  1AHD P;  1JT6 A;  4GFB A;  2VQH A;  2IP2 A;  3IWF A;  4I76 A;  3GME A;  3FHN A;  3L1P A;  2HOT A;  3I4M J;  1OCP A;  2R0Q C;  1M1E B;  2V79 A;  1G4D A;  1PP8 F;  3DKW A;  3CQZ J;  3RKW A;  1BC8 C;  4C2M J;  1IJW C;  1WJD A;  2LRE A;  4ZYE A;  1U5T B;  4XK4 A;  2EH3 A;  2OAZ A;  1T0F C;  3V8K A;  4F93 B;  3GFI A;  2ZSH B;  1ZRC A;  4BJ5 C;  5FKO A;  4D5F A;  1XC5 A;  4Y52 J;  1I3A A;  5IT3 A;  2JPB A;  5F27 A;  1Z9C A;  5E8G A;  1L0O C;  4IPA A;  4IRI A;  1XDS A;  4KIG A;  4ANJ A;  3AG3 H;  1HW5 A;  3TOB A;  3DKX A;  1W1W E;  1KQ9 A;  1RR8 C;  3PSF A;  1DU0 A;  2VXZ A;  2HTS A;  1D1A A;  4Q48 A;  2HQR A;  2CG4 A;  1JUP A;  1W0U A;  1H88 C;  2W25 A;  3ABU A;  4KDP A;  1FOW A;  1ZGW A;  3MZY A;  4RB3 C;  1RRJ A;  4RAZ A;  3L2V A;  1B72 B;  3ABK H;  1A04 A;  2Z5U A;  3F8C A;  3K7A J;  5L3F A;  3REO A;  3E6B A;  4M73 A;  2MLK A;  4OIQ F;  4UY8 I;  3ZQQ A;  1MW7 A;  4Q47 A;  2LVS A;  4JYK A;  3ZMD A;  4MHG A;  1Z21 A;  3J80 K;  4FCY A;  4I0B A;  4OMZ A;  1MSE C;  4KN7 X;  3IH2 A;  3HUG B;  3G1L A;  3GZ5 A;  3V7C A;  1DDN A;  2UXX A;  3LSG A;  5F6F A;  4MLO A;  3KZI C;  1B9M A;  1XMK A;  4HDV A;  5FLX K;  1BW5 A;  1PUF B;  2LLK A;  3F23 A;  2MW8 A;  4KUM A;  4LJZ F;  4PCQ A;  4ZDL A;  4ZTJ A;  1ZYR F;  1B59 A;  4XIC A;  2DQL A;  4F3Q A;  1KGS A;  1ORK A;  1ENH A;  5FD6 A;  1I6X A;  2DTZ A;  3ML6 A;  2P5L C;  1FZP B;  2XRL A;  2HKX A;  3HRM A;  2Z3Y A;  2DBB A;  2L01 A;  5GTI C;  3PQK A;  5DS9 A;  2W57 A;  1W36 D;  3RKQ A;  4U0W A;  1XMX A;  1LFP A;  2GAU A;  3FXM A;  4N0B A;  1TBX A;  3ECO A;  1MBK A;  2RC4 A;  3EPZ A;  2QEX I;  3CDL A;  4N9H A;  4H0E A;  4DZJ A;  1Z7U A;  3IAS 2;  4IVN A;  3SYT A;  2E5N A;  1PP7 U;  4HF0 A;  5EEG A;  2PJR A;  1X3W B;  1JE8 A;  1B8I A;  1RI7 A;  2IJL A;  3DPT A;  3V4G A;  2XRN A;  3DFG A;  4JX5 A;  2FBH A;  1OPC A;  1H8A C;  2CU7 A;  4BXU A;  3F8F A;  2JSC A;  3H3U A;  2LH9 A;  2E60 A;  2GQQ A;  2FA5 A;  5FGM A;  1O3Q A;  4P9F A;  2K9M A;  2XSD C;  4G94 A;  1VQN I;  1SFO J;  1W5C C;  2XAH A;  3JRB A;  1SD7 A;  3S3N A;  2DCE A;  1VQ7 I;  3DF8 A;  2NYX A;  1T0F A;  3CC2 I;  4LIU A;  1YYV A;  1ZEL A;  3K4L A;  3UR3 C;  2CSO A;  4DZP A;  3K4K A;  2DA4 A;  3KYL A;  1FBU A;  5CVV A;  1FWZ A;  5H2F C;  4E7I A;  2COB A;  4XKB A;  3GYH X;  4G7O F;  2VJI A;  4HZF A;  1LEA A;  2X1E A;  1DP3 A;  4LFU A;  2LDU A;  2G7H A;  2MD0 A;  4XQF A;  3JRE A;  2K40 A;  3CDH A;  3NWS A;  2DT6 A;  1XGN A;  2IS6 A;  1MSF C;  2FUG 2;  5JHF A;  2EWN A;  2CUZ A;  2P81 A;  2FNP A;  2WB1 A;  2A6E F;  2W4S A;  1YS7 A;  2HYF A;  2VBW A;  5GPC A;  3OL3 A;  1U9N A;  2E1C A;  4WXH A;  3BR5 A;  4ESJ A;  1A6I A;  1T2K A;  4DYC A;  2KIF A;  2ELK A;  5HLG A;  5JVT A;  3OYF A;  5KAF C;  1HKQ A;  2R93 J;  4U0V A;  4M6Y A;  5H6Q A;  2TDX A;  3BZ6 A;  4FHT A;  4HA8 A;  4RGS A;  4C3J J;  2JRM A;  1LQ1 A;  4NB5 A;  2XIG A;  2DW4 A;  1R7J A;  2EV5 A;  1JGS A;  4IHS A;  2AXL A;  3ZXS A;  4KJZ A;  3EYI A;  3EYY A;  3VDX A;  1N78 A;  1BM9 A;  5FFX A;  1IDZ A;  3TO6 A;  4NDL A;  1SAX A;  1FSH A;  3OYL A;  3FMQ A;  5AON A;  2OA4 A;  2E1O A;  4I0A A;  3DEW A;  2MAB A;  2ECC A;  2Y48 A;  3HOY J;  5FKM A;  4O3M A;  2PJR B;  1JHH A;  2DPD A;  3PNV A;  1B8I B;  4P9U A;  3F0C A;  2STW A;  2EBI A;  3QOD A;  4HNT A;  1L3L A;  5GAG J;  1QVU A;  1FOK A;  4II3 A;  2W84 A;  3OYG A;  1SMT A;  5ICG A;  5LGU A;  2M8G X;  3GO5 A;  3DPL C;  3S3M A;  1G2H A;  2VOP A;  3ZMS A;  1OYW A;  2YSR A;  2M4K A;  1TL8 A;  5BMZ A;  5F0C A;  1O3S A;  2HPI A;  5CVU A;  2JZY A;  4M9Z A;  4M3B A;  1BBY A;  2XAG A;  3FWE A;  3LSI A;  5AIQ A;  3ESW B;  5FB2 A;  3R60 A;  4II2 A;  3BZC A;  5F1R A;  4XNF A;  4N4N B;  4HEA 2;  2O5R A;  3MD2 A;  5L3D A;  3CCM I;  4PFO A;  3ERE D;  5DV5 A;  3WTU C;  4ZC3 A;  2FBK A;  1PUE E;  3BDD A;  3HM5 A;  3HHG A;  4LIV A;  5J4Y A;  5BPD A;  2XRO A;  2ESH A;  2R7O A;  3ZOB A;  1XCB A;  3LA7 A;  3FKJ A;  2O8X A;  3GWZ A;  1A5J A;  3IKV A;  3QP5 A;  1TW3 A;  4ENK A;  1ETV A;  2DA3 A;  4G9Y A;  3L7W A;  1E3H A;  1CGP A;  1F43 A;  5E17 F;  4CGZ A;  2Y75 A;  3FXJ A;  1BR1 A;  2I10 A;  4E70 A;  4U7D A;  4ZDP A;  2ADU A;  3PJR A;  1Y56 A;  3K6G A;  2CGP A;  2H8R A;  4AYB N;  3VFZ A;  1D5Y A;  5FD5 A;  4RLQ A;  2XVC A;  3OYM A;  4JBA A;  2OD5 A;  1GLN A;  2VBX A;  3C2B A;  1UHS A;  4DNC A;  3NQO A;  3M1E A;  1BN5 A;  5IYD J;  1DUX C;  1ZN2 A;  4RDU A;  4LK1 F;  3HGG A;  1SFE A;  1JJ6 C;  5HDN A;  1YRN A;  2P8T A;  3OIO A;  1H9G A;  4CH7 A;  4MO7 A;  1R71 A;  3CCQ I;  3B73 A;  2DA6 A;  3I9V 2;  3WTY C;  1R58 A;  1Z91 A;  2VQG A;  3PFI A;  2O7O A;  3JAM K;  3MEX A;  1I6H J;  1MMS A;  4FQG A;  3P9C A;  3OSF A;  1KU7 A;  2K3P A;  2MH9 A;  5L3C A;  3K70 C;  2ZKZ A;  2ELH A;  4FTH A;  1XGM A;  2M8E A;  1W5S A;  2TCT A;  3BCA A;  4UB8 C;  4XBF A;  4A3I J;  2ETH A;  4LG3 A;  3KEO A;  3CMM A;  3NAR A;  3V7S A;  3H92 A;  2L0K A;  3D0S A;  3IC7 A;  1XCV A;  3KEY A;  2KIM A;  2AHQ A;  2W24 A;  2DI3 A;  2LG4 A;  3KE2 A;  1XG1 A;  3KP4 A;  2M45 A;  4RAF A;  3QRF F;  2EB7 A;  2FML A;  1P4X A;  3EDP A;  2VLA A;  2BHZ A;  3WU1 B;  3E0J B;  5DUK A;  3FK6 A;  3H9G A;  3R61 A;  2BY0 A;  1T8I A;  3TO7 A;  2DDB A;  3H5R A;  5KNL A;  3MVP A;  2RAE A;  1X58 A;  2AXT C;  2HR3 A;  2KZV A;  4GCV A;  2IA0 A;  1ETO A;  2LFB A;  3FM3 A;  5HNF A;  3IAM 2;  3F21 A;  2HDW A;  5DM6 F;  1BI1 A;  3SJM A;  2OTJ I;  1K61 A;  3GFL A;  3QP6 A;  1OYI A;  5LEJ A;  4FE4 A;  4JP0 A;  2PJP A;  2R7W A;  3DWL E;  2QWW A;  2VE8 A;  4KIB A;  2F4I A;  1J9I A;  4OAY A;  4Y33 A;  2ESN A;  2GIZ A;  3FIW A;  4XLN F;  4N4O B;  5B5E C;  3PM1 A;  5IOY A;  3CJT B;  4QTR A;  4XKW A;  5HOO A;  3ZP5 A;  1GXP A;  1X1D A;  3MZH A;  2XAU A;  4XN3 A;  5LFA A;  2QSH X;  1USS A;  4HNU A;  3M07 A;  3H9Q A;  2XF5 A;  1D8K A;  1Z3Y A;  1YRN B;  2DA5 A;  3SZG A;  2GZW A;  2BOL A;  4PJJ A;  2MD5 A;  1XSX A;  3RJP A;  1HKS A;  4MQ9 F;  1POG A;  2X6Y A;  2DOE A;  3TKY A;  2A69 F;  2V1N A;  3S2H J;  1R4M B;  4WF2 A;  1DPR A;  5BOX A;  3I59 A;  5J4V A;  3C18 A;  2CFX A;  2JUG A;  2YX4 A;  3E6M A;  3M8J A;  3DQV C;  4KIF A;  1ZTR A;  4D0P A;  4EEF G;  3VOD A;  1IXC A;  2FXA A;  2LTP A;  4XKC A;  1BIB A;  3ZR8 X;  4UVB A;  2V9V A;  1BJA A;  2WV1 A;  3M3Y J;  1E3O C;  4QPO A;  4YRV A;  4OIO F;  1ZGJ A;  1MH4 A;  4MEX F;  1WI3 A;  5LHI A;  3P5J A;  1APL C;  1Y8R B;  5C4J J;  2PQ8 A;  1YTY A;  3DP7 A;  4E7J A;  4RB1 A;  1JUM A;  2PI0 A;  1R00 A;  4MTD A;  2DMU A;  4PJN A;  3GLX A;  3GEZ A;  1S29 A;  1YW7 A;  3IP4 B;  4DYQ A;  1ZRD A;  3CME I;  3BPX A;  4BH9 A;  1MIJ A;  2XC7 A;  3PUB A;  3MKW B;  4EMS A;  4Y4R A;  3L09 A;  4G12 A;  3L2U A;  2JVG A;  5ICF A;  4E7H A;  2A5W A;  1LFU P;  4I01 A;  3K10 A;  4OIN F;  3TW6 A;  2EZK A;  5DUI A;  2Q1Z B;  1UMQ A;  2KRC A;  2H6B A;  2UUZ A;  4LMY A;  3ZGK A;  5CVR A;  1GV2 A;  5BPI A;  2RDP A;  1JKP C;  5GAE J;  3JRA A;  3B6C A;  2DO7 A;  5K5R A;  1K78 A;  3HOT A;  2WV0 A;  4A12 A;  4PK4 A;  4HG2 A;  4CUG A;  4C30 A;  2BE5 F;  1LDJ A;  4HAM A;  1G6N A;  2KDO A;  2X48 A;  2ZXH A;  3MAJ A;  4OU0 A;  5EJC A;  2RQP A;  2BVL A;  4KNY A;  1VI0 A;  4NUB A;  4PUS A;  1R23 A;  3L9F A;  3ABL H;  4UV8 A;  3GBG A;  1VQ8 I;  4BE0 A;  2WB1 N;  1WZ2 A;  2HDD A;  3CLO A;  4I7H A;  1V54 H;  2HVQ A;  2NXN B;  1MMD A;  3WGH A;  3DU6 A;  2H27 A;  3I59 B;  4M3G A;  2FU4 A;  4XRM A;  4L9V A;  3I55 I;  5KK1 A;  3J81 Z;  1D1C A;  2E1M C;  2GBY A;  4BDZ A;  2P5K A;  3W6K B;  1WI9 A;  2A68 F;  2F5V A;  1E3P A;  3FIS A;  3P9K A;  4ON0 A;  2VT2 A;  2FF4 A;  1YIJ I;  2XSJ C;  1MJ9 A;  4XMY A;  3VYS B;  1HSJ A;  2LC2 A;  1OCO H;  3D5L A;  4I09 A;  2KJB A;  3GTG J;  1A6Q A;  3FXK A;  4ITV A;  5F0F A;  5HLH A;  2EJR A;  2IBD A;  2HS5 A;  4HST A;  3PIP F;  1FTZ A;  1FOY A;  2W7N A;  3PNT A;  3C1D A;  3FBN B;  1A31 A;  4UNO A;  3ZQI A;  5EGO A;  2DYS H;  2IW5 A;  2K9S A;  1ZHF A;  2MYS A;  1OJL A;  3ZMT A;  5K7Z A;  3BTL A;  3MN2 A;  4XOT A;  3KP2 A;  3CCU I;  4UHT A;  3LAP A;  3CC4 I;  2Y9Y A;  1IGN A;  5D8K B;  2BHY A;  2H09 A;  3X2Q H;  2R7S A;  3W6J B;  2HQN A;  2B63 J;  1YE9 A;  1QZY A;  4FT8 A;  3LST A;  4B8X A;  1WCM J;  1IDY A;  3RI4 A;  1N77 A;  3G6E I;  1Q1V A;  5DM7 F;  3KLN A;  4DGW B;  3CMA I;  2OZU A;  4WXD A;  3S16 J;  3HTU A;  4JOM A;  4S04 A;  1FT9 A;  3WTX C;  3PNY A;  4A0X A;  5D5W B;  3MQ0 A;  5IP9 J;  2DMQ A;  4AWX B;  4CYD A;  4ZH4 F;  2K86 A;  1B4A A;  3ERM A;  5F0H A;  2R5Y B;  3A2K A;  3ZQL A;  5GAD J;  1XN7 A;  1IV6 A;  4P1W A;  3Q9V A;  1E2X A;  2KIQ A;  4R8H A;  1FP2 A;  5D4S A;  3SZP A;  4NQW A;  3I64 A;  3IKT A;  4U7B A;  3O6B B;  1KU9 A;  5TIS C;  1MD0 A;  3I54 A;  3WTV C;  3LNQ A;  2F5D A;  2EFQ A;  3QAH A;  2V7F A;  3Q3S A;  3QOP A;  3TP3 A;  3JRF A;  1MGT A;  2DFE A;  4XLC A;  3BG6 A;  2FJ1 A;  3WG7 H;  2E1N A;  5KVR A;  3OSG A;  1CF7 A;  2NNY A;  3HZJ A;  5D5V B;  2ECB A;  2VXD A;  1T56 A;  3LSJ A;  3HDD A;  2HYG D;  2TRT A;  2OU2 A;  1UZC A;  4A3M J;  1HW2 A;  3I58 A;  2HOA A;  1PUF A;  3CJQ B;  2F48 A;  4F7Z A;  2IA2 A;  2ZXI A;  3CCR I;  5IPA A;  4MIM A;  2NVX J;  1ERD A;  2GLO A;  3TQN A;  3I0T A;  3U21 A;  4BJ6 C;  3HBL A;  1B9N A;  4PZJ A;  4Q4Z F;  2XAQ A;  1FP1 D;  2W48 A;  4ZYG A;  2EFW A;  1IXR C;  3S15 J;  2P0W A;  3RTR A;  3J80 Z;  2QCO A;  1I1S A;  5EZH A;  2GXG A;  2RVC A;  3GLL A;  4KIT B;  2D45 A;  2HI3 A;  1HKT A;  3T8T A;  2DFH A;  2VIX A;  5HS9 A;  5EGO B;  3CCV I;  2K9N A;  1WJA A;  3KCC A;  3SDB A;  4L9T A;  3ABM H;  2DPU A;  4UB6 C;  1BC7 C;  4I2O A;  1KU3 A;  1MBG A;  2M7B A;  1I3Q J;  2O3F A;  1I39 A;  3LMM A;  4UUT A;  2QVO A;  3OYJ A;  3OYH A;  3F72 A;  3N4M A;  3PSI A;  1LFB A;  2VBY A;  1T08 B;  2BXY A;  4LK0 F;  4CIC A;  4OAZ A;  2M9H A;  1WKM A;  3MWM A;  5CQG A;  3HGY A;  4UXN A;  2M1B A;  1WGX A;  3FX3 A;  2ZO4 A;  1KZH A;  2JA6 J;  4G6T B;  4A3K J;  1CQT A;  1MMA A;  2X6O A;  4AC0 A;  4ZYA A;  3BCB A;  1FEX A;  3FMR A;  2Y69 H;  3FXL A;  4PDK A;  4BQA A;  3PIO F;  2HQA A;  4YFX F;  4UUV A;  3FBI B;  3S1R J;  1V5F A;  4IHT A;  3QYF A;  3CC7 I;  2RNG A;  2QKL B;  3LSM A;  3JSO A;  3JR9 A;  2VB6 A;  1ETK A;  4IHX A;  6PAX A;  3JRG A;  3F6V A;  2GWR A;  4I99 C;  1LE8 A;  1EH7 A;  5BS6 A;  5IT9 K;  1TWF J;  3N05 A;  1Y0U A;  3HPH A;  4NQW B;  4ZYD A;  1T6S A;  4F92 B;  4CCO A;  1VND A;  3TOA A;  2LKP A;  2VJJ A;  4RB2 C;  2LD5 A;  4EJT A;  5E1Z B;  1XSV A;  1LB2 A;  5JHU A;  2M2E A;  4G6D A;  4HX7 A;  2JQ7 A;  3E5U A;  1CF7 B;  4KIS A;  3Q9S A;  3Q5F A;  2L7M P;  4IRH A;  3K70 D;  2ID3 A;  2M3A A;  3HKZ A;  5C3E J;  1UHM A;  3HG9 A;  3Q0U A;  4BGD A;  1W7P A;  2D1V A;  3CUQ C;  3DPU A;  2YU9 J;  2ZME C;  4MNU A;  2HDC A;  3J7A Y;  3OMY A;  2CWE A;  1FIP A;  1P4A A;  4G7H F;  5L3B A;  4GYI A;  1DQU A;  1YFH A;  4Q5S F;  2R7Q A;  2CJJ A;  2XDV A;  1VQK I;  4CXF A;  1QQI A;  3CD6 I;  4B43 A;  1IV8 A;  1O3T A;  3A01 A;  1D0X A;  2FNA A;  2Q2E B;  2QLZ A;  4A6E A;  4X0G A;  4CZZ A;  1GVJ A;  3ROU A;  4ZTF A;  3GW2 A;  1Y6I A;  1G8X A;  3DLA A;  1O3R A;  3G3Z A;  2E1M B;  3V42 A;  1FBS A;  4RA2 A;  5CVJ A;  3A02 A;  4ABZ A;  4KA4 A;  2ZBK A;  3JRI A;  4L0Z B;  2VQC A;  2VKV A;  3F3X A;  2BYV E;  1TC3 C;  2XGC A;  4M9S A;  2L02 A;  3OY9 A;  3O3K A;  3D5R C;  2CYY A;  2CUJ A;  1RPW A;  3O2P E;  1JT0 A;  2H1K A;  3NRV A;  3IH3 A;  2ME6 A;  3WE3 A;  1VF9 A;  1EKE A;  2ID6 A;  2GOX B;  3TGN A;  3EQL F;  3VOE A;  1ZQ3 P;  2IS2 A;  2CW8 A;  2PMH A;  1S5L C;  2K3F A;  1JGG A;  1MBE A;  4EM1 A;  2XB5 A;  2UZK A;  2K27 A;  3SHF A;  1LE8 B;  2HKO A;  3CP2 A;  4U88 A;  2CQK A;  2M0M A;  1XX5 A;  2ICW G;  2VT3 A;  2NS7 A;  4PGH A;  2D5V A;  2X51 A;  1J5Y A;  1RUO A;  4CA0 A;  4JX6 A;  3MCZ A;  5FKL A;  1YIO A;  2DMP A;  2LF7 A;  2A3S A;  1P92 A;  1JI8 A;  1VQ6 I;  3NEU A;  4YII A;  2HYJ A;  4BY7 J;  1D3Y A;  1YO5 C;  2WY8 Q;  1S9H A;  2FOK A;  1R1T A;  4ASN A;  1RIO H;  5J3L A;  2Y9Z A;  1LDK B;  2Q0O A;  4RAG A;  1QPI A;  2VC1 A;  1YJW I;  3CCJ I;  2O6G E;  2OCE A;  1T98 A;  2L4A A;  4BQQ A;  4R1H A;  5E1W A;  3OYI A;  3BTC A;  3KET A;  4XLE A;  1W7P B;  4CZC A;  2K85 A;  3ONQ A;  1LPQ A;  4NC8 A;  3MZ8 A;  5E20 A;  3GXO A;  3GTM J;  3BTI A;  4XLF A;  1Y1V J;  4XOP A;  4P96 A;  4RM3 A;  3F8N A;  1X2N A;  3M9A A;  2F6C A;  2FRH A;  4O5V A;  1D8J A;  2JTV A;  3HSF A;  3A01 B;  1FIA A;  1X19 A;  2JWT A;  1SD6 A;  2BBY A;  3LL7 A;  2DA1 A;  3OYE A;  3R0A A;  3I56 I;  5J1Y A;  3ZQH A;  2GIV A;  3PFY A;  1HLV A;  1MDM A;  2JVH A;  3OS2 A;  3G73 A;  1DPU A;  1G3S A;  5K5Q A;  3ABT A;  2H8W A;  2HVR A;  3PQJ A;  3E5Q A;  3CCL I;  3CUQ A;  3WGG A;  1W5T A;  1P6R A;  2DK8 A;  2ZME A;  4IHV A;  5EDN A;  1NG6 A;  1VTN C;  3B6A A;  4JX4 A;  1P2F A;  4KMU X;  4AD9 A;  2PMU A;  1UFM A;  2DMT A;  2XF7 A;  5DCF A;  4KFC A;  5LGT A;  1DP7 P;  3OIQ A;  3JTH A;  2K7L A;  1KON A;  3OR2 C;  4HRI A;  3ZQ7 A;  4QIW N;  4PGG A;  1W0T A;  1BOA A;  2MGQ A;  3PO3 J;  2EV6 A;  1FBQ A;  1MBH A;  4L5J A;  5A2Q K;  2KFD A;  1PDN C;  1O7F A;  2WY7 Q;  3GFM A;  3ZMZ A;  1R36 A;  2VN2 A;  5BNG A;  1F1Z A;  2F4M B;  2JA8 J;  1ZLK A;  4AM3 A;  4A3B J;  5IOZ A;  3KLO A;  1YJ9 I;  4KMF A;  4KYW A;  1G3T A;  1Y8Q B;  3JAM Z;  1OCR H;  4IOA F;  4M74 A;  2E2J J;  1XS9 A;  1LVA A;  2EIK H;  3QPS A;  3CCE I;  3GTQ J;  2Y0M A;  3A0H C;  4XRS G;  3J7A O;  1HXD A;  2V4J C;  2WBM A;  1HBX G;  2BY2 A;  1LUJ B;  3ZQG A;  4UVC A;  4M72 A;  4G8X A;  3HEF A;  3QOE A;  1AOY A;  4BHC A;  1J75 A;  2VE9 A;  4A93 J;  2R7T A;  5IYC J;  2R7X A;  1TQP A;  4A69 C;  3W6V A;  2E2H J;  1TQI A;  3D1N I;  4R79 A;  1DU6 A;  1MBJ A;  2WAQ A;  4D5C A;  5F08 A;  4HF1 A;  2YPR A;  1U9O A;  1FTT A;  3ZCO A;  3N97 A;  1WJE A;  1LEB A;  4G7Z F;  2EFN A;  5B3S H;  3WHB A;  5TGT A;  5K7H A;  1NH3 A;  3BR6 A;  4WCG A;  3DEU A;  1MDM B;  3OOU A;  1GUU A;  1UB9 A;  3AG4 H;  4LLG F;  1ONV A;  4XID A;  1UAA A;  3DBR B;  4V19 K;  2VON A;  3CUQ B;  4J19 A;  2ZME B;  1YQA A;  1R4N B;  2M4G A;  2CW0 F;  1FYL A;  2Q8K A;  4IL6 C;  3VYR B;  4YFN F;  3JRH A;  2H6C A;  5JLW A;  5KHD A;  2V1U A;  4MEY F;  3LOC A;  1FX7 A;  2Y0S A;  4EGZ A;  1IC8 A;  1TQM A;  1R22 A;  2E2I J;  1XTA A;  2FX0 A;  3HOU J;  2COM A;  5CPR B;  5FRO A;  3EUK L;  3T5X A;  4RMN A;  2CFO A;  4BKX A;  5IP7 J;  1REP C;  2P6T A;  4BBR J;  3CDI A;  4KT6 A;  2KDZ A;  3FHZ A;  4RGX A;  3BWG A;  5IP6 A;  1YJN I;  1W7P D;  2VAS A;  3KP3 A;  2ZNZ A;  3K2A A;  1IN6 A;  3GVA A;  4XN0 A;  2HZD A;  2A05 A;  2Z2S B;  1ETY A;  1FMW A;  5KCM A;  2JRT A;  1ZAO A;  4PJM A;  4EJV A;  3OR1 C;  2DJN A;  3HIF A;  3L00 A;  5J40 A;  3R4K A;  4BUP A;  3GX4 X;  2QF7 A;  2EPF A;  5AIP A;  2MFZ A;  3AKZ A;  3OL4 A;  2PX9 A;  5ILV A;  3QPH A;  4GXO A;  4IX7 A;  1K6Y A;  2HVS A;  3HB9 A;  1G3Y A;  4A3C J;  3VYT B;  2G7U A;  1YI2 I;  1IUY A;  4M9X A;  4RM2 A;  3S32 A;  3COA C;  1QGP A;  1BL0 A;  2BW3 A;  1MJA A;  4XLH A;  4YG2 F;  1ON2 A;  4XLA A;  3U9G A;  3BQZ A;  3H5N A;  5ICC A;  2VPL A;  3WG9 A;  1EF4 A;  3F8M A;  2M34 A;  2VKD A;  1WJC A;  1MNE A;  1ZLJ A;  2PMZ A;  4ESB A;  5EG0 A;  1PYV A;  4Z6Y A;  4C3H J;  2DOF A;  2B7E A;  3RKX A;  2HPM A;  4HYE A;  1HDP A;  2E35 A;  4CO8 A;  3S1N J;  1OR7 A;  1VQP I;  4EM2 A;  1QZE A;  2PEX A;  5M3F J;  2NVT J;  2WAD A;  4XRF A;  3T0Y A;  3ZN0 A;  1NK2 P;  5HLT A;  1H9T A;  3ZPL A;  3LA2 A;  5DTD A;  3HOW J;  3AG1 H;  5IY5 H;  3Q0V A;  4ENN A;  2WAE A;  3QPT A;  1IN7 A;  2L9S A;  4UV9 A;  4GO1 A;  3TMO A;  3BG7 A;  1A35 A;  2DJI A;  2EQR A;  3RKY A;  2EFP A;  1FPQ A;  3OOP A;  2E71 A;  4IEJ A;  2N8G A;  4ZJZ A;  4L0Y B;  3G2B A;  5D6E A;  1TWC J;  2BY3 A;  3PO2 J;  1TWA J;  3HKZ N;  2EIM H;  3MMY B;  2K5C A;  5D5X B;  4NBQ A;  2NOG A;  2QKM B;  2KIS A;  2VKH A;  2GOM A;  2CUE A;  3S17 J;  5LEK A;  1IXS B;  3KP5 A;  2KHM A;  3WGI A;  2F2E A;  3MFK A;  4D1Q A;  1ZAR A;  3UKG A;  2XV4 S;  2Z1D A;  3J7Z I;  4PFP A;  3W3C A;  3OYD A;  1U6G A;  3CP8 A;  1Z0X A;  1BW6 A;  3FK7 A;  2Y30 A;  2WWY A;  1KQ0 A;  1I5Z A;  2LSO A;  4BXF A;  3QYE A;  4IHY A;  2O61 A;  3S2D J;  1LKX A;  2JUC A;  3WOD F;  5ED4 A;  2IGK A;  5M5X J;  2CS3 A;  1JTY A;  4BYY A;  3DBH B;  1D1B A;  3NAU A;  4LLL A;  4E6K G;  3IV5 A;  4BAC A;  3ULQ B;  1WRJ A;  3DXJ F;  5B1A H;  4AUX A;  1TNT A;  1U2W A;  5CLS A;  2E19 A;  2BW3 B;  3FF5 A;  4I02 A;  4B47 A;  1QU3 A;  2YX7 A;  1X3U A; 
#chains in the Genus database with same CATH homology
 1QA6 A;  2QA4 I;  1VQN I;  5DM6 F;  2OTJ I;  1S72 I;  1VQ7 I;  1VQ8 I;  1VQ4 I;  3CCR I;  2ZJP F;  3CC2 I;  1YI2 I;  1YHQ I;  2NXN B;  3CF5 F;  3CJT B;  3I55 I;  2ZJQ F;  3CCV I;  2OTL I;  1FOW A;  1YJ9 I;  4IOC F;  1YIJ I;  2E35 A;  4IOA F;  1VQP I;  3CCE I;  2K3F A;  3PIP F;  4UY8 I;  1FOY A;  2ZJR F;  3J7Y J;  3CCQ I;  3CCU I;  2FOW A;  3CC4 I;  3PIO F;  1VQ6 I;  3CC7 I;  1MMS A;  1YJW I;  3G6E I;  3CCJ I;  2E34 A;  3CMA I;  5DM7 F;  1VQL I;  3CME I;  5GAH J;  3DLL F;  3J7Z I;  5GAG J;  4V19 K;  2E36 A;  2JQ7 A;  4IO9 F;  3G71 I;  5GAD J;  1VQ9 I;  5JVG F;  1VQM I;  2QEX I;  3I56 I;  1FOX A;  1HC8 A;  1VQ5 I;  1VQO I;  1Y39 A;  3G4S I;  2H8W A;  5GAE J;  3CCL I;  3CCM I;  1YJN I;  1ACI A;  1VQK I;  3CCS I;  3CD6 I;  1YIT I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...