3E0JB

X-ray structure of the complex of regulatory subunits of human dna polymerase delta
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
143
Chain Sequence
ADQLYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVTYLVSGSLIQNGHSCHKVAVVREDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYDILKSNLQNCSKFSAIQCAAAVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA polymerase subunit delta-2
publication title X-ray structure of the complex of regulatory subunits of human DNA polymerase delta.
pubmed rcsb
source organism Homo sapiens
total genus 41
structure length 143
sequence length 143
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3e0jB00
3E0JB
chains in the Genus database with same CATH superfamily
2PEXA 2PMUA 2L7MP 4FX0A 4CCJA 4LB5A 3R60A 2DOEA 4BUPA 4WF2A 2L02A 1LNWA 3I53A 2Z9OA 2DQLA 4YIIA 1VQ4I 1FOYA 3GMEA 3DKXA 1I6HJ 1WVRA 1NH3A 3OSGA 2HI3A 3C7JA 3I71A 3SFZA 2JRTA 5J1UA 4HV6A 1R1VA 2DDBA 3LA7A 4OIPF 1STZA 3TOBA 4M73A 1WPKA 1D3YA 3HGYA 3ULQB 3FMQA 2LG4A 2DYRH 1W0TA 4RLFA 3DF8A 3RDIA 2QSHX 1IO2A 1FC3A 3A4CA 3LAPA 2BOLA 1VQ7I 2LKSA 3SDGA 4N9IA 2CUJA 3ZMTA 3FXLA 2B0LA 3FXKA 4U0YA 2O7OA 2FRHA 3JSOA 3IWZA 2ZB9A 2XAGA 2MSYA 2M87A 2LTPA 2L7FP 1ZKGA 2OZ6A 3J7ZI 3S2DJ 2E2JJ 4PGHA 3ZRGA 4U7BA 3GYHX 1W7PA 2YPRA 3I9V2 3E5UA 5LBQA 1ITYA 1ON1A 5FKNA 4EJTA 3TW7A 4ENKA 4TV7A 4MFEA 4P1WA 4MGRA 1D5VA 1LVKA 2W48A 5JFRA 2H8WA 2JZYA 4MEXF 2HDCA 1WZ2A 4I2OA 2FBKA 3M1CA 3HUGB 3WGGA 2LBFB 5C3EJ 1W36D 4U0VA 2BVLA 3ZMUA 4E7HA 3CUQB 2VI6A 3K1NA 3N97A 1G3TA 1VQNI 3JRBA 1E2XA 1G8XA 1B9NA 2DDAA 2E5NA 2R3SA 3ISPA 4QWQA 4B3AA 2ME0A 5ED4A 2ZFWA 2VBWA 2XV4S 2KQRA 4UHTA 1OKRA 3O6BB 3GZNB 3K6GA 4BBSJ 1X1BA 2DK5A 5F1RA 4HQMA 1Z67A 3IP4B 2R7SA 4A3KJ 1MBHA 2ID6A 2OQRA 2E1MB 5CLSA 3RPQA 2R7DA 4BXFA 3BQZA 3IV5A 3JAMZ 1BL0A 1EH6A 3BTIA 1JUSA 5M3FJ 2CQQA 4XLNF 2I8DA 2O6GE 1W4MA 4OIQF 3DTKA 4X0GA 1MSEC 1HKTA 3G71I 2R7ZJ 2Y69H 1QRYA 1WJAA 3K1MA 4M3EA 4I0BA 4A0XA 1IJWC 3TEDA 4A3DJ 2AO9A 3P5JA 3L2VA 1FSEA 3FMSA 4Y15A 1HA8A 2K9QA 4R79A 5ICCA 2MC3A 3IAM2 4WXDA 5E79C 1UG2A 1W7PD 3OYNA 1DPRA 1B1BA 3N4MA 2HOTA 1Z77A 5B1BH 2JUGA 1W36C 1S7EA 4FISA 2D45A 2AXTC 1P7JA 3J80Z 4OIOF 1WJCA 3BG6A 4F52A 1S7AA 3I59B 2V4JC 3HEFA 2E1MC 4A0ZA 2JQ7A 2O0YA 3SQNA 1VF9A 5HVQC 2L4MA 3TQNA 2WAQN 2Y31A 3PJRA 2W4SA 3TBIA 4L5JA 1Z3YA 3QYFA 1X2NA 4IQ4A 5HLIA 4H0EA 3DU5A 3CO6C 2BY3A 1YX5A 3Q9VA 2VUMJ 1XGSA 2DFEA 2OU2A 4Y52J 1MBFA 3QU3A 4F7ZA 5F0CA 2WB1A 3WTUC 3WTVC 2LYCA 5EDNA 1T33A 5J8CA 3AFHA 4EJVA 1MMNA 3OS2A 5CVIA 1VQ5I 3S8PA 2R7FA 4AD9A 3ZP5A 3WU0A 2HZDA 3JTGA 1ETWA 2KDZA 2R0QC 1T0FA 2DBBA 4B43A 1DDNA 1E0EA 4OMZA 2PJRA 1P4WA 5FLXK 4LK0F 4WXHA 4S04A 5CQGA 3R6SA 3I64A 1NTCA 2DA5A 2STWA 3M8JA 3OYDA 3IWFA 4HNTA 2Y75A 1Y1VJ 3MFKA 2GA1A 2PMZN 3LMMA 4RGSA 5EG0B 4BE1A 3BQYA 4DOZA 2CU7A 2LR8A 4MTEA 4C3HJ 4OOIA 4BQNA 2QQ8A 3OYJA 2DPUA 1R1TA 3ONQA 4KISA 5ERIA 3HOWJ 3E1SA 1PDNC 4GRIA 4I76A 1U0JA 5HDKA 3CP8A 5HS8A 2HVQA 5K5OA 4CCLA 3ZPLA 1X4PA 2FBIA 5CYVA 2VB6A 4M71A 2QM3A 3PNYA 5GAEJ 1SAXA 1DU0A 5C4JJ 2IS6A 4IEJA 3GF2A 4XLFA 2NNNA 1C0WA 2CW8A 1T95A 2FBHA 5J40A 3MZHA 1BM9A 4LFUA 1Y39A 1R7JA 3K0LA 4QTRA 4BE2A 1OCPA 4AIHA 2F6CA 1OYIA 1TWHJ 1IV8A 3DFGA 4CDGA 4B1RA 2XGCA 2JVHA 4RAGA 5FFXA 2K9NA 4U88A 1PUFA 5LGUA 4JK1X 2QQBA 2O5RA 4AU7A 2BY0A 2CS3A 4S05A 2XVCA 3S3MA 4CZZA 4IXAA 4GGGA 3L1PA 2Y48A 3DEWA 1RRJA 1RESA 2JWTA 1QBJA 1MBJA 3J7AY 2LY2A 2BW3A 1MDMA 3J81K 1JHHA 1EH8A 5JHUA 1FNNA 1YE9A 2HKOA 3I4PA 3BR3A 3AL0B 4E70A 2XKPA 2XF7A 4NQWA 5K5QA 4B4CA 1QHGA 2HVSA 2QF7A 3CP2A 3QODA 4BQAA 3W2AA 3WU2C 2DAOA 3HIFA 1A31A 2MLKA 3GO5A 4F3QA 2VBXA 1UELB 1WFXA 2EFQA 1DU6A 2OZUA 3H92A 3W6JB 1S29A 2HNHA 3H0DA 2FXAA 4DBRA 2XF5A 5DD8A 4ZZLA 2K7LA 5DYMA 2RGVA 3H9GA 2AHQA 4IQJA 4Q4ZF 2DA2A 2RNGA 2COBA 2XHKA 2ZXIA 3K69A 5B66C 4LG0B 2DK8A 2Z99A 5D4RA 3AL0C 1Z6RA 2CUFA 2EV6A 2H94A 5FLXZ 3KYLA 4XLEA 1T0FC 5BS6A 3CZ6A 4ETSA 3EETA 1WHUA 3FKJA 2DO7A 4BH9A 1BC7C 2IGKA 2B63J 1JUPA 2F4MB 3RPUA 3PIOF 4BJ6C 2VQGA 1L3LA 2L9VA 4M3FA 3JR9A 3KP4A 4DYRA 4DZJA 1PUFB 3OYMA 4GCVA 1BI0A 3VDXA 2Y0SN 3ERMA 4AYBN 1KONA 4RAZA 1FIPA 2K4BA 1MNDA 4MEYF 2BEOA 2VKDA 2DA6A 3VYRB 3HTSB 1K6YA 2P7CB 1EV7A 2XB0X 2ZC2A 4FQGA 1W0UA 3U1KA 1A6QA 2V1NA 4XIDA 3HHHA 1O3SA 4C3JJ 1ORKA 3L2CA 4HDVA 5E1WA 2ZXWH 3H0GJ 1Z21A 5EEHA 1MJBA 5IT3A 3B02A 5JLWA 2XDVA 5EEAA 1FP1D 2JVGA 4PFPA 1OCZH 2JK3A 2VPLA 3KYCB 4A5MA 2UZKA 4MHGA 3U9GA 1QNTA 1FMWA 2D5VA 2ELJA 1E3PA 1DUXC 3GTLJ 1FMVA 4GO1A 2XAHA 2Z3YA 5BMZA 2L9RA 1BI2A 3LSIA 4EVIA 2DJIA 4A6EA 2A69F 3JRGA 1F36A 2KFDA 1U2WA 2Z2SB 2BHYA 2LF8A 1QPMA 3ZQQA 3RKQA 4AIJA 1K7AA 3CCEI 3H3VK 4OIRF 3S93A 4M3BA 1OYYA 2WWYA 3MKZA 5F6FA 1TQPA 2DT7B 1TNSA 3LA2A 3CMYA 3GX4X 3FWEA 1RR8C 1T56A 3RPUD 1K78A 4UNOA 3F9KA 1MJ9A 1S7OA 3KCCA 2NVTJ 1YHQI 4N0BA 1DP7P 3I4NJ 4BXUA 1U78A 2ZJRF 1D8KA 1WJEA 4P55A 2DTRA 4QSHA 2GA2A 4BBRJ 3R0AA 1IXSB 3OYGA 2EPFA 3HRTA 3KIOA 4RS8A 3WG7H 2R5YB 1U3EM 4JBAA 2QLZA 1O3TA 3LQRA 4AVZA 2F4IA 3ASOH 1HKQA 2ECCA 2VKHA 4HEA2 1UMQA 4GXOA 2Y0MA 2TRTA 3MAJA 3CCRI 3V8JA 3QPSA 4OAYA 1F43A 1N25A 2F5FA 2L9SA 2RV8A 2NVUB 1P2FA 3E97A 3P7NA 2H1LA 2NS8A 1A5JA 4XM3A 1Y0NA 3IH3A 4Y13A 1V5GA 5D5XB 1LVAA 3Q9SA 2Z33A 3S17J 2XPWA 4ZJZA 2KL4A 4DJAA 1XX5A 2LC2A 1TBXA 5HDNA 1F4KA 4L9NA 3ASNH 3ZGKA 2GQQA 4IHSA 1J0RA 3G1LA 1YRNA 2CJJA 3HSEA 2X51A 2K86A 1LPQA 5IYDJ 3R0JA 2JT1A 3DP7A 2R7UA 3AG3H 2JA8J 2LY1A 4PJMA 3JRDA 4A3FJ 4IHXA 3DBRB 1L0OC 3D5RC 5LGTA 2CO5A 1ZQ3P 1YI2I 2M8GX 2ZXJA 2EIMH 2YX7A 4O5VA 4BHCA 1FLIA 5IP7J 1JE8A 2IS2A 2NYXA 2MLGA 3VODA 1TP4A 4HAMA 3OR1C 3M1EA 2OA4A 1I5ZA 2X6OA 3T8TA 4KA4A 2UXNA 1ZGWA 2JMWA 4JX4A 4NC8A 5BQTA 1HSTA 5CVRA 2HQAA 4KMFA 4IOAF 1OJLA 4A2UA 5CVJA 1FBSA 2PI0A 3F8FA 1TW2A 2QCOA 3V8LA 2NVXJ 5FJ8J 3ROUA 1OFCX 3Q3SA 1BI1A 1IV6A 1FBQA 2KP6A 2ADUA 3KLNA 2CV0A 3CLOA 1GV2A 1HW5A 2EZHA 1TNTA 2XGDA 2DFHA 1ON2A 2LDUA 2WAFA 3PQKA 1AHDP 1J7KA 2EIKH 3A0BC 4EQQA 4XRSA 1O4XA 1LJ9A 4E7LA 2W84A 2OD5A 2HGCA 4ON0A 2Q2EA 1BR1A 2KRCA 1GT0C 3X2QH 4KIBA 3ERED 2HTJA 2LD5A 2PN6A 3PNTA 1SFUA 1HW1A 2K27A 2LLKA 4XN3A 4CYCB 1FIAA 2FMYA 4XR6A 2O03A 1WCMJ 1GV5A 3IRQA 2BZTA 5E3NA 2EFNA 2RQPA 4BEHB 4QLCU 1WI9A 4ZC3A 4M3DA 3DBHB 3KZZA 4UVCA 5M3MJ 2VBZA 4BS9A 1CQTA 3U1DA 2V6CA 3W6KB 1QVUA 4LIUA 2QBYA 3HJEA 1BN5A 2PFBA 3GTJJ 3CUOA 1J2XA 3FKIJ 4HG2A 3ELKA 3TDZC 4WWCA 4EGYA 5DEQA 1XB4A 2RKHA 4C2MJ 4AM3A 1ETXA 3BPXA 2RAEA 1APLC 3I3LA 3KEOA 2Z1DA 3IC7A 2XPVA 3G2BA 2ZSHB 3R4KA 4UUSB 3G73A 4IO9F 5E1ZB 3IL2A 2HU9A 4EATA 2CFXA 2L01A 2MYSA 2COMA 4HNUA 5EZHA 3KFWX 2IT0A 2KRFA 3VYSB 3NAUA 2R92J 1ZR4A 2BE5F 5A2QK 3B6AA 2X6YA 3S2HJ 1KU9A 1MD0A 2KHMA 5FKKA 1D0YA 1UHMA 1U5TA 3QP5A 1X1AA 4XRMA 2W7NA 5M5WJ 2UUZA 3LWFA 1Z1DA 1HC8A 3WG9A 1U9NA 4MLOA 2IEKA 1XS9A 5DD4A 2G7UA 1G4DA 3ZQLA 5J1YA 2X4HA 1AKHA 3E6BA 2M0MA 3O8GA 1SFEA 3EQLF 2VJ4A 4G12A 4Y33A 3AG2H 4IVNA 2DA4A 2QVOA 1G59A 1A36A 1HOMA 1SEUA 2BVMA 2L3DA 5E3LA 3RZDJ 3WTSC 2R7XA 1ZGJA 5FD5A 4M6VA 1I6XA 2UV1A 1U6GA 2XPUA 2FJ1A 3HYIA 5B5EC 3HOUJ 4M6YA 4NDLA 2F48A 1IRXA 2AQFA 5FKOA 1ZGAA 5IP6A 3DPUA 1XCVA 1FBUA 3RKYA 4IHYA 3PFIA 3Q0VA 1SVMA 1TQMA 1AOYA 1X4OA 3S15J 1ZG1A 3CC2I 2DMTA 3F3XA 3H3ZA 3CO7C 4JP0A 4CH7A 3E6DA 2P6SA 3GFLA 3GZ5A 3QPLA 4ENNA 1LQ1A 1VQ6I 2NS7A 3HTUA 5TISC 3OL3A 5D5VB 2LKPA 3LSHA 3K4JA 4IRHA 3NEUA 2F5EA 2GOXB 4FTHA 4Q48A 1VQKI 2M9HA 2EV5A 3BCBA 3NWTA 1IXCA 4X6AJ 2X1CA 3IH2A 2E19A 5L3DA 4WX9A 3E6CC 5HNHA 1EA3A 3CC7I 1YG2A 2TCTA 3DV8A 5DDGA 2DA3A 4ENMA 2O8XA 1JJ8C 4D7MA 5IPAA 3GLLA 2P5VA 4YRVA 4BY1J 2ACJA 4L9VA 4MTDA 3RYRA 1QHHD 3DTIA 2MGQA 3BZKA 3E3VA 4E7SA 1YFHA 1WI3A 2QGUA 2JSPA 4ANJA 1H9TA 3WTYC 1REPC 5IOZA 2XAJA 2BXYA 2FA5A 3T0YA 3GEZA 5F0HA 3ZN1A 2IBDA 2HPMA 2OTJI 3SZGA 1R5HA 3KP7A 3S3NA 4HX7A 1ZLJA 1GXQA 4O6JA 5DCMA 2X48A 4PFOA 2ZNYA 1F1ZA 3SZTA 2AXLA 3HOVJ 3BWGA 3SDBA 4ESFA 1P6RA 1HBXG 4DBQA 3ZQIA 5A2QZ 1ZR2A 2R5ZA 2M45A 1UFMA 1X1PA 3EYYA 4QIWN 2FQ4A 4OMYA 1X3ZB 3TP3A 1RIOH 1FYMA 3BR5A 1IGNA 2PJPA 2Y9ZA 4G7OF 1Y56A 1IF1A 3C2BA 1JHFA 1JTXA 5IT9K 1MNMC 2R93J 4EV0A 2L7ZA 2HWVA 3KE2A 4E6KG 2HFHA 3RTRA 4K2EA 4GDFA 4A69C 3VYTB 5E8GA 2Q8KA 4AUXA 2V7FA 4A3GJ 2QQ9A 4IRGA 3AAFA 3S1NJ 3FXJA 4RM2A 2QKLB 3QYEA 2PLYA 5FRNA 3O3KA 1F5TA 1FT9A 4RAYA 1N77A 5H6RA 1V4RA 3B6CA 2CQXA 5FLMJ 3DXJF 1XN7A 3K10A 2VLAA 3LSJA 2YU3A 3TKYA 4ESJA 1S9HA 3BZCA 1TC3C 3HKZA 1FZPB 2L4AA 4WCGA 1R49A 3I55I 3TDUC 4XKCA 2VJJA 1Y6IA 1ZYRF 4YIRX 2A6TA 5DS9A 4UY8I 3ECOA 1HDDC 1W7PB 2RREA 3CJNA 3SEZA 4HDUA 3VWBA 2XB5A 3RJPA 2E60A 3LOCA 2DJNA 3BP8A 1HLVA 2MC4A 2X6WA 4GFBA 2X1EA 4M9SA 4F93B 1WJDA 3UKGA 2CW7A 4B47A 3I54A 2DT5A 2WV1A 2HYFA 4I6ZA 4P96A 4C9YA 2XSDC 3P9KA 1ETOA 1QU3A 4E7KA 1OPCA 2LNBA 4G6QA 3E5XA 3HG9A 3JRAA 2KMUA 3G1MA 3AG1H 3ZQCA 3VEPA 4MQ9F 1J59A 1NK2P 3RIRA 2FUG2 1B8IA 1I1GA 4NBQA 3CMAI 2WC2A 1KU7A 1YX3A 5CPRB 2VQLA 1ZREA 4U0WA 1Z9CA 3VPRA 3ML6A 3RCOA 3E0JB 1XGMA 3FIWA 5J1RA 3GW2A 4LITA 4HLXA 3TO7A 5DTDA 3JRCA 4B48A 3E5QA 3UR3C 1ETVA 1UZCA 2DMUA 3BJAA 2RNJA 1ZARA 4AIKA 1IRFA 5CJ9A 3RSNA 2ESNA 4E4HA 1QPIA 1O7LA 5EGOA 1HXDA 3J7AO 3ZQFA 1BJZA 3SHFA 2PBIA 1R00A 2VXDA 3LSRA 2WADA 4Q5SF 2QUFA 3MMYB 3N05A 4HRIA 4I7HA 3GWZA 4CA0A 3LSKA 5BPIA 2LRDA 5IYBJ 5H6QA 4Y4RA 4B09A 2DXIA 5B3SH 3GTQJ 2V1UA 3B73A 3IHUA 1O3RA 2FMLA 4A5NA 5LEJA 4Q47A 3GBGA 3D0SA 3HZJA 1KYWA 1AWCA 5IT9Z 4W1UA 2P5LC 1R23A 2DMPA 4N4OB 3S14J 3MQ0A 1JKOC 2M7BA 4MNUA 2KIQA 4KNYA 3OWTA 3EUHA 3DLAA 2R7VA 4M9ZA 3L09A 5LRRA 1YQAA 4DGWB 2BV6A 3CDHA 3SYTA 3ZMDA 5JVTA 3A01A 2O9LA 1XC5A 4HNVA 1F9NA 4PSXA 1RC9A 3BR2A 3SXYA 2GWRA 2M3AA 1SD6A 2CH0A 5EEGA 3FHZA 3G3ZA 2HXOA 5F64A 3JTHA 1RI7A 4LJZF 5HNFA 2JJ7A 1VQOI 4IOCF 2XF6A 2ISYA 4R1HA 3WTTC 3L2QA 2EB7A 4M9XA 4XLCA 4BXXJ 4A3JJ 4P9FA 2EILH 3H9QA 2HKXA 3DBLB 1BIBA 1MZBA 2A61A 4MIMA 3WU1B 3HRUA 4XBFA 3CJRB 4UVBA 1V5FA 4XQFA 1I39A 4MQVA 3E7LA 3G4SI 2E1CA 5EF6A 1D1AA 2LFBA 2QQAA 2PJRB 5E17F 4G6DA 3TP0A 1IC8A 3A2KA 2OCCH 4CZCA 3O8HA 5KVRA 1PUEE 2CSOA 3ECHA 4U87A 4RB1A 5FKLA 4CCNA 3KZYA 2HEOA 2XSJC 2RN7A 4ZYHA 3WHCA 3FXUA 1ETQA 3I5UA 1R4MB 2QEXI 2VJ5A 1ENHA 4Y3OA 1TL8A 5GAGJ 3VYUB 4ZTFA 1TT5B 1ZHFA 3RZOJ 2J5PA 3MN2A 1M1EB 5JI6A 3ZMSA 5FKMA 2PG4A 1JT0A 4KT6A 5GP9A 3GVAA 3JRHA 3CQZJ 1IN4A 3DKYA 1P9QC 2DW4A 2FSWA 2HOAA 3BT9A 2CYYA 1SANA 2IA0A 3HOYJ 5BOXA 4OAZA 1LEBA 3F8NA 3BR0A 3GXOA 2NS0A 2F4OB 3NQOA 3FXQA 5K7HA 4NC7A 3QQAA 1G2HA 2DA1A 3BOQA 1KU2A 1JT6A 1BBYA 1W1WE 4RMNA 3IRRA 2EK5A 3JREA 3F8CA 3FK7A 1XMAA 4EM2A 4XSZF 1HW2A 2DN0A 2ZMEA 2OAZA 4M74A 1GVJA 3KZIC 4I01A 4PJNA 3M8FA 1OCCH 4NC6A 2FD5A 2BY1A 1BJAA 1PP7U 5LHIA 2VJIA 1MMDA 3MCZA 1S5LC 3I58A 2L9NA 1H9GA 2CV2A 2BW3B 3KEQA 1MDMB 1JXSA 4IJAA 3TMOA 3C2HA 2EV0A 3DPTA 2L7KA 5JHFA 2K40A 5DM7F 1WGXA 4NQWB 4UB8C 4XRSG 4YIFA 3HXLA 2WB1N 1YO5C 3K4MA 2VKVA 3BR1A 3LFKA 1B72A 4A6DA 3EUHC 1S72I 3F72A 4DYQA 3PIPF 4G7HF 5TGTA 2V6EA 2G9WA 1O3QA 1RNLA 3UNGC 3HOZJ 4PCQA 1EH7A 2WY7Q 3C2GA 2W57A 2EJRA 5IY5H 1ZN2A 2CUZA 1T6SA 3J81Z 3EYIA 4D7NA 2M1BA 5IOYA 3LQQA 4IRIA 4J01A 4HOBA 1K4TA 2GIVA 4R8HA 1HQCA 2LMDA 2DMQA 1WJ5A 4G9YA 2E36A 9ANTA 1V55H 4EJWA 2ESHA 5CVVA 4HW0A 3FDYA 1FY7A 2YUSA 3HGGA 2O8KA 2OV7A 3OOUA 1UJ8A 3CESA 4BDYA 4A3EJ 1V5EA 3DKWA 4LD5A 1LB2A 1ZELA 3SEQA 4EMSA 1OYWA 1CF7A 1USTA 2M4KA 4LK1F 2HQRA 2GIZA 2IVMA 4N4NB 4PSWA 4ABZA 5KK1A 4KICA 1XDSA 2G0EA 3BTCA 2E2IJ 2X85A 1MMSA 2XGEA 2QA4I 2LREA 4HZFA 1TTYA 2EIJH 3K70D 4EM1A 2B9SA 4BHBA 1IN5A 1LUJB 2RVCA 2MD0A 1LKXA 1D0ZA 1WH5A 2OQGA 3MKLA 4HX8A 3GTGJ 3HM5A 3NWSA 1VQ9I 5E3MA 1YTYA 2KJBA 3S32A 1KU3A 2CMPA 1PJRA 1MH4A 2FE3A 2OJED 5BNGA 3K7AJ 2MABA 1U9OA 2RC4A 5CQEA 1UG0A 5EZGA 4LG3A 2PQ8A 5CKTA 4BNCA 1WSUA 1K4SA 4BHPA 3F22A 5B1AH 1S3JA 2LP0A 2GZWA 2E2HJ 4OU0A 2LOOA 1LDKB 4PDKA 4FASD 4XLAA 1MJAA 4G8XA 2WBMA 4PZJA 4CYDA 2DMNA 1TLHB 2EZLA 2FEZA 2ZMEC 3BTLA 4RGRA 3GFIA 2A5WA 1MKMA 1IAWA 3H5NA 5GPCA 2IRFG 5F08A 3V8KA 5JVGF 1QZZA 5LFAA 4Y7NJ 2JTVA 3GTPJ 4PK4A 1FOXA 3K4KA 1K6OA 1ERDA 5DV5A 3WGHA 3K70C 2Y30A 1XD7A 3F23A 2VQCA 1R9TJ 4BQOA 2KKOA 4UB6C 2OPTA 4BU2A 3COAC 4I09A 1IDZA 1OCTC 2H8RA 3HC7A 1BOBA 1K78B 2A6HF 2MH2A 1POGA 4D0PA 5GTHC 2YSRA 3MKYB 4E7JA 4YELA 4CXFA 1FTTA 2HXIA 3U21A 2H1KA 2VT2A 1W5SA 1GVDA 3HOSA 1YW7A 3DEEA 5LHGA 2HYJA 2LY9A 3GTKJ 3ZXSA 3BY6A 2KIFA 1XPXA 2HOEA 2V9VA 2ZO4A 4YFNF 4L0ZB 3CTAA 1SFOJ 4XKVA 3HBLA 1KQ8A 3K9TA 3SJMA 2XRNA 1RUNA 3IUOA 1T98A 1MW7A 5D6FA 2DQRA 2IGOA 2PX9A 1U8BA 3WE2A 1FJLA 4A3CJ 2BYVE 5FB2A 1NK3P 4C3IJ 3FMRA 2JPBA 3AG4H 2LSOA 1OQYA 4NNJA 1TWFJ 4D5FA 3FZVA 1YYVA 4ESBA 1YRNB 2Z5UA 2DFFA 1BW5A 2WY8Q 2H6BA 2V9KA 3HOTA 2BGCA 4X1EA 4KN4X 3OYBA 1DQUA 3LSMA 1VQ8I 3FBIB 3RKXA 5ILUA 2R7WA 1ZRDA 2E7WA 1YS7A 5L3GA 2DLLA 4JYKA 1JJ6C 4DZPA 1TQIA 2JA6J 2EFOA 3FBNB 2VKEA 5HLGA 1WWXA 1S6LA 1Z0XA 3P9IA 4XLHA 4ZDOA 2HYGD 1KA8A 2IPQX 1LFPA 2V1DA 1MNEA 3DWLE 1XG1A 4RAFA 3MEXA 3C18A 3OS0A 3RKWA 4I98B 3FF5A 5JR3A 1VQLI 4B44A 4LMYA 1FX7A 2DODA 5FRMA 1Z6TA 2WAQA 2CWEA 3QP6A 5J3LA 1ZAOA 4CICA 2ZFUA 4HF0A 1SVLA 4FE7A 1H88C 1T2KA 2NRAC 1FTZA 3BLYA 3H9JA 4YG2F 3OYFA 1OCOH 1R22A 1A04A 2O61A 2KJCA 2ZXHA 1YIOA 4GYIA 5GPAA 2GXGA 3LSTA 2GOMA 4MO7A 3OS1A 2QENA 1H89C 4DIQA 1VQMI 4AC0A 2R4GA 4KIFA 2Q2EB 2KLOA 5AIQA 4CCKA 1LFUP 2XROA 2CQNA 2F5CA 3KPHA 3CCJI 1OLTA 1SD5A 3OYCA 1XMXA 1YOVB 4O3MA 4AVPA 2NAZA 3FM3A 3W3CA 3TGNA 1NG7A 2NNYA 2WA0A 3BG3A 4F55A 1GUUA 3HUGA 2LBFA 2GAUA 1XSVA 2BBYA 5D4SA 1GLNA 1BI3A 2LH9A 3CUQA 2DPDA 3MVPA 3WE3A 3ZCOA 2WAEA 5CVUA 2JRMA 1Z05A 1ODDA 3MKWB 2STTA 2PMZA 1J5YA 5K1YA 1JTYA 2QBYB 3LNQA 3HOXJ 2FU4A 4U7DA 1H0MA 3VSLA 4KITB 4QPQA 2OCEA 1BR2A 1DGRM 2KZGA 2MBFA 3VFZA 4ZDLA 3J80K 1CGPA 3PNVA 2YX4A 4BE0A 2ZCWA 3FM5A 1J09A 1QZYA 1JKRC 2F2EA 1MMGA 1HDPA 4IHVA 1X3UA 1G3YA 3Q0UA 2QSGX 5L3BA 3TO6A 2CFOA 4F91B 4ENJA 2M2EA 5LRSA 1U5TB 4C30A 4JX5A 1UCRA 5DUKA 3LA3A 1JKQC 5IYCJ 2MH9A 4II2A 3MWMA 2DA7A 4I0AA 3CDIA 3MZYA 1YJNI 3OMYA 3W2WA 3ZQGA 2B7EA 4BAYA 1AKHB 2E7XA 4ZH4F 1Z91A 2JN6A 4LLLA 3VSKA 4HYEA 4FHTA 4EGZA 3I59A 3QRFF 2FQ3A 4E7IA 5HLTA 3H5AA 5AIPA 3HRSA 5E20A 3HPGA 4FETA 4CCOA 2UWMA 2NXNB 4XN0A 1D5YA 5L3EA 2GBYA 3KYDB 3TL4X 4EEFG 1NG6A 2NVQJ 4C2UA 4FE4A 4L5IA 4MFDA 5D8KB 3WODF 4GYGA 2VASA 3OSFA 1U5TC 4UV9A 2BY2A 1N75A 1UHSA 2ZBKA 4HBLA 3I4MJ 2VC1A 4IPAA 3IH4A 2DCEA 2XAFA 1G3SA 4FT8A 3LL7A 4IL6C 3HPHA 3OIPA 3OYIA 2A5YB 2V9PA 3ZMVA 3E6MA 1X1DA 3CJQB 3ZQHA 3QPTA 4RB2C 3LSPA 4KDPA 5FFZA 1ZG5A 3WTXC 4BJ5C 2TDXA 1IDYA 2HR3A 3QAHA 1XSDA 2P0WA 3TOAA 2M34A 3BDDA 4LOCA 4M72A 1WJBA 3PUFA 5EG0A 1VQPI 1P7IA 2V79A 5ICFA 3F0CA 3T1BA 2ICWG 3S1MJ 4BL0B 4XLPF 2HDDA 1SAUA 2DYSH 1HKSA 1O7FA 2L54A 1WJFA 3P9CA 4G94A 4PJ0C 2F5VA 1WH7A 2IJLA 4H4KC 2DI3A 3QWLA 4LLGF 4KJZA 3CUQC 4G6TB 2A05A 2OC6A 2VOOA 2GLOA 1AA7A 2EINH 4BJTA 2JA2A 1WQ2A 5EJCA 3PQJA 4HLYA 4LIVA 2EZIA 3PSFA 4XSXF 1MMAA 1ZK8A 1BC8C 3CCQI 1T39A 1MBKA 1H8AC 1IW7F 2OF7A 3OYKA 3ZMZA 1ETYA 3W2VA 4IX7A 3KP6A 5M5XJ 2IS4A 2Y0SA 3G1OA 5DCMB 1RUOA 4AYBA 1YS6A 3PUBA 1EF4A 4UUTA 1IN7A 4E7ZA 2R7TA 5J4YA 4CHUA 4HPQA 2EFPA 4NUBA 5D8LB 3OYHA 2CUEA 2R5ZB 2R7OA 2K4JA 1ZRCA 3CCUI 2J5OA 3CMMA 4CUGA 5HOOA 5F04A 5LHHA 1DP3A 2HTSA 3GFJA 4WXCA 2L0KA 4RB3C 3LFUA 4Z6YA 1QGPA 5C44J 4IKFA 3CD6I 2ZJ2A 4IHTA 1DPUA 1KYZA 3HSFA 3FISA 3EDPA 2E1OA 4D9JA 1A35A 4RGXA 5KHDA 2ZJPF 3W6VA 3PM1A 4XOPA 4HF1A 1IN8A 2KPMA 1E3HA 1X19A 1ZTRA 1V54H 4XORA 3A02A 2QWWA 1D8JA 1BOAA 4RLQA 2P4WA 2XIGA 3JCUC 3WHBA 5GADJ 3WTZA 3DLLF 1B9MA 1BW6A 3OV8A 5DCFA 2HS5A 1P4XA 4RBOA 1MH3A 4BGDA 1JGGA 3S1RJ 2V26A 3ABMH 4I99C 3FHNA 3KEYA 3DTEA 3DU6A 3ABKH 2VQHA 3S1QJ 1ULYA 2JUCA 2BHZA 2M8EA 4ZZDA 1Q1HA 1BR4A 3FK6A 2H6CA 4P5OA 5E1XA 4ZYEA 4HF2A 2CG4A 3M7GA 1T8IA 3M3YJ 5K7FA 4LLNA 1LDJA 4LG0A 1FWZA 2W25A 5LLQA 4ASNA 4WK8F 3BC8A 4A3MJ 2ETHA 4IZZA 1JGSA 4L18B 1BIAA 3K4NA 1TWAJ 3OY9A 4G7ZF 1YIJI 1BA5A 4HSRA 1U8RA 3OOPA 3NARA 2EFWA 1IXRC 2YU9J 3S2WA 2VE9A 1Q1VA 1X58A 2IXSA 1JUMA 1KZHA 3M07A 4BKXA 1QO0D 2D1HA 5L3FA 5E18F 2GXBA 2IS1A 3H36A 3HL2A 2GXAA 1KQ9A 2EH3A 1B8IB 2QZ8A 1RR7A 2FX0A 3GCMA 2Y2ZA 1A6IA 2Z16A 4M3GA 4AIDA 1FP2A 2IGNA 2LF7A 2WV0A 2K5CA 4BDZA 1IRZA 3CMEI 2KIUA 3Q5FA 3D5SC 4EM0B 2P81A 2KIMA 5JLXA 1PP8F 2VIXA 1SMTA 2OBPA 1IUYA 4I02A 4KMUX 2BXZA 1UAAA 2XAUA 2RDPA 1VFCA 2DU9A 2DT6A 3BZ6A 1FOKA 3T8RA 2FNPA 2E71A 4XOTA 1K83J 4HA8A 5EGOB 1YJ9I 3GTOJ 4CCMA 1TW3A 3S3OA 1ZG3A 2EQRA 2V1XA 4DNCA 1X2MA 3O2PE 3F8BA 1VNDA 3RQIA 4KUMA 3OL4A 2AQEA 2H27A 2VT3A 4XICA 4PJLA 2Q0OA 2ZSIB 3ABUA 3PO3J 3MZ8A 3LAJA 2XKOA 1TWGJ 3V7CA 4YFKF 4ZYAA 5K5RA 1T38A 2E1NA 4L0YB 3M8EA 2RQQA 3WTWC 4V19K 5EYRA 1J9IA 5J6XA 2M7AA 1B6AA 1XGNA 1XCBA 5KCMA 1E17A 4B3XA 4A3IJ 3BG5A 3CCMI 3K4LA 3ZQ7A 5KNLA 4AWXB 2EA2A 4Y17A 3BPVA 3JSPA 2NOJB 1RPWA 3H3UA 1P4AA 5J8FA 3KLOA 1FPQA 2VXZA 3HKZN 5ILSA 3OYEA 3QOPA 3A01B 5HODA 5BPDA 1I3AA 1RKTA 2K3FA 3F8MA 2R7RA 3RI4A 2FF4A 4L9TA 4JX6A 1Z7LA 3HSRA 5DUIA 4D1QA 2P8TA 3BG9A 3F6VA 1ZH5A 2W85A 2ZNZA 1FYLA 1ACIA 1TWCJ 2E5ZA 2FNAA 2ZKZA 2L5QA 2X9DA 2P6TA 3V4GA 5ICEA 1QA6A 3KP3A 5FGMA 2R5YA 1JI8A 5F27A 1N78A 2ME6A 1VTNC 1MIJA 5E3OA 4C2TA 1X1CA 1WRJA 4A3LJ 3DCFA 1D1BA 3PL8A 2MW8A 3LSGA 2MD5A 4UXNA 4ZTJA 3GFMA 4RA2A 3F21A 3G6EI 3D1NI 1LDDA 5D5WB 2HQNA 5FO5A 2HDWA 2NOGA 5H20A 2XGXA 3JRFA 5TRDA 2L2OA 1D0XA 2YS9A 4W97A 1SVOA 1WKMA 2VE8A 4L5EA 4PJJA 4Z2YA 4LB6B 3JRIA 3HDDA 4YFXF 3QU6A 1OR7A 3CCYA 5D5UB 3CJTB 1RKWA 2E35A 2P7VB 2CW0F 2W24A 4KT5C 3K2ZA 4A0YA 4FX4A 2VODA 5E8IA 2K85A 4UUVA 3I0TA 4L9JA 2LKXA 2D2WA 3D5LA 2DOFA 1FOWA 1OMIA 1LE8A 1I1SA 2HOSA 3EPZA 4P9UA 4A93J 2VPRA 5HS7A 2IA1A 3L9FA 1R4NB 1PYVA 3H5RA 3OIQA 4A12A 2VOPA 3ABLH 3DQVC 3EUKL 4HX4A 1R36A 1QZEA 1VI0A 2GM4A 5LEKA 4BACA 3M9AA 1GXPA 1RZ4A 4F92B 2N8GA 3R61A 1UB9A 2IW5A 2IP2A 4KIGA 3U2RA 4XKWA 3A03A 4IF4A 2VBYA 1SD7A 2R7QA 2X1DA 3OIOA 1MBEA 3ZR8X 2PMHA 2K02A 1O57A 3H1CA 1K79A 3A0HC 1DGWY 5J47A 4LGWA 5FROA 3TW6A 1R6RA 2A68F 1YJWI 2XRLA 2ZMEB 3L2RA 3Q0WA 4PUSA 4J00A 2JSCA 1IRGA 4DW6A 3CDLA 1G3WA 4JQFA 2F5DA 3VOEA 3V7SA 5LD2C 1W5CC 2IAIA 2EA4A 1HCRA 2E34A 2Y9YA 3F6OA 1R1UA 4V2FA 3FXRA 2EBIA 1XMKA 2HPIA 1Z7UA 4HV5A 5KAFC 3GTMJ 2D1VA 1OCRH 1SD4A 5F1JA 5GTIC 1GDTA 1ZRFA 1RETA 3PSIA 4NHJA 3SFIA 4RB0A 1SC7A 4S0HB 5H2FC 1EJ9A 1G6NA 3QPHA 1B72B 2LK2A 1QQIA 2VN2A 1ETKA 2XUBA 1I3QJ 5GAHJ 4EJUA 4CYCA 4CO8A 4RDUA 1XSXA 2X0LA 2KDOA 2YR2A 3QOEA 1ONVA 1Z3XA 3BCAA 4BEHA 4KFCA 1K61A 3CF2A 2Q1ZB 2IGMA 2ID3A 1KQ0A 2QYOA 4XNFA 1KGSA 1IUFA 2A3SA 1UHWA 2CV1A 4BQQA 4PGGA 1LE8B 1YLFA 2A07F 2K9MA 2OTLI 3KX2A 4ITVA 1S8NA 1YITI 2VL8A 1Y0UA 5M5YJ 3C3WA 2NVYJ 3REOA 5L3CA 1R58A 5C4XJ 2ELHA 5DM6F 2IA2A 2H09A 1FYKA 4UUSA 3J7YJ 3ZOBA 2C6YA 4B8XA 5ICGA 1B59A 3WGIA 1V3FA 1IG7A 3OR2C 3V7RA 1CF7B 2M30A 3GZ6A 2I10A 1VZ0A 2KISA 5FD6A 1FSHA 4OINF 2W82A 3NRVA 1OR7C 2ECBA 2CQKA 2KT0A 3ESWB 5ILVA 4ZYDA 3DPLC 3K4CA 3IAS2 1Y8RB 2FOKA 2MFZA 4M6XA 4V2GA 4UV8A 1MBGA 1I50J 2AS5F 2G7HA 3FX3A 4J19A 1QVTA 3RYPA 3FXMA 4CSWA 3GUDA 1J75A 2M4GA 5HS9A 4EJOA 5D6EA 1IN6A 5TJJA 3KETA 3KP2A 5LGNA 2LVSA 3C1DA 3K2AA 3HRMA 1W5TA 1TZLA 2KRHA 2QSFX 2P5KA 3H35A 3BROA 1Y1WJ 1IZ1A 2WTEA 4XONA 2K3PA 2VONA 1SFXA 2VC0A 4RM3A 4XL9A 3ZN0A 2A6EF 3EUAA 4A3BJ 3BG7A 3DEUA 2DOAA 1X3WB 3T5XA 3AKZA 3I56I 2JA7J 4XKBA 2CQ7A 3HHGA 3CCLI 3CF5F 1XDUA 4II3A 2EWNA 1EKEA 3IKTA 3CC4I 1GHCA 5HLHA 2XASA 5KAIC 4QPOA 3L7WA 1AU7A 4JOMA 3BTJA 2M5WA 3CLQA 1PVEA 5FLVA 5AONA 1MSFC 1B4AA 3FXOA 2X6XA 2ZJQF 1LEAA 1ZLKA 2K9LA 2MG4A 4CGZA 2M0CA 4DQ2A 1YW8A 2KZVA 1XGOA 1E3OC 2UXXA 4FCYA 4N9HA 2OUMA 2EZKA 3S16J 4DYCA 3L2WA 1TT0A 3L00A 4NB5A 2HZTA 2O3FA 1JKPC 1R71A 5F0FA 2XAQA 2FOWA 3CCSI 3IKVA 1P92A 4BYYA 4RGUA 4ZDPA 3BJOA 2JPCA 1SMYF 1MGTA 4IHWA 2ELKA 1I27A 3QYBA 2W00A 2CGPA 3HB9A 1D1CA 3SZPA 3PO2J 5IP9J 2MA3A 1YW9A 2ISZA 4D5CA 3KP5A 2JA5J 3L2UA 2QKMB 3CCVI 3M4OJ 1Y8QB 1FEXA 5J4VA 1XTAA 1USSA 4HSTA 4XMYA 6PAXA 3MD2A 3K4BA 2HQ5A 3TO9A 3OYAA 2XC7A 3BJ6A 2DTZA 3K1PA 3V42A 1NHAA 1R5GA 4ZYGA 4HQEA 3JW4A 3BR6A 1HSJA 4YEJA 3A1YA 1T08B 4UVAA 2HVRA 4XRFA 5HDGA 1LFBA 3JAMK 1R5ID 3RQ4A 4XK4A 2DFIA 2I5UA 3GLXA 3PFYA 4KN7X 2CRGA 1SFKA 1HF0A 4KYWA 5K7ZA 1OISA 2W1OA 3ABTA 3VB2A 2K9SA 4OWRB 3OYLA 4BY7J
chains in the Genus database with same CATH topology
4E7ZA 2R7TA 4HPQA 4CCJA 4NC7A 4NUBA 4BUPA 3OYHA 3D5RC 2R7OA 5HOOA 3CMMA 4CUGA 3DKXA 4RMNA 2IS2A 1DP3A 3LFUA 4IKFA 3OR1C 4NC8A 4D9JA 4PJNA 2HQAA 5KHDA 2LG4A 4XOPA 4RLFA 2VJIA 1MMDA 2KPMA 1X19A 2CV2A 2L9NA 2BW3B 4XORA 3A4CA 2BOLA 3TMOA 4RLQA 2CUJA 3C2HA 3DPTA 5JHFA 2L7KA 2KP6A 2CV0A 4NQWB 2WAFA 3HXLA 3K4MA 4BGDA 3EUHC 2V26A 4E7LA 3FHNA 3ZRGA 4U7BA 3KEYA 3DTEA 3DU6A 3I9V2 5TGTA 2V6EA 2VQHA 1BR1A 2KRCA 1BR4A 4P5OA 3PNTA 3UNGC 3C2GA 2WY7Q 4XN3A 2CUZA 4XR6A 4P1WA 1LVKA 3BC8A 4J01A 4BEHB 4IZZA 3K4NA 3OY9A 4HSRA 4ZC3A 1WJ5A 3M1CA 3HUGB 2IXSA 2LBFB 1W36D 4BS9A 3FDYA 2BVLA 4E7HA 2IS1A 4LIUA 3HL2A 4HG2A 2OV7A 3OOUA 2Z16A 3CESA 4BDYA 1V5EA 2IGNA 4BDZA 2K5CA 1G8XA 1ZELA 2E5NA 3SEQA 3D5SC 2KQRA 2VIXA 2M4KA 3I3LA 3K6GA 2Z1DA 4N4NB 3G2BA 4PSWA 2ZSHB 1X1BA 3IP4B 2HU9A 4EATA 1UAAA 2R7SA 2XAUA 2X85A 2MYSA 4HNUA 2E1MB 2DT6A 3VYSB 2LREA 4BXFA 3K70D 2X6YA 2KHMA 4XOTA 1D0YA 4CCMA 2MD0A 1LKXA 1D0ZA 1X1AA 2W7NA 2I8DA 3S3OA 2UUZA 3DTKA 3NWSA 4X0GA 3OL4A 2AQEA 4MLOA 3S32A 4PJLA 2ZSIB 1WJAA 2CMPA 1PJRA 3L2VA 2M0MA 4ZYAA 1HA8A 2MABA 4R79A 2VJ4A 2RQQA 3IAM2 4Y33A 5CQEA 1UG0A 3OYNA 4LG3A 1G59A 2M7AA 5CKTA 2BVMA 2R7XA 2JUGA 1W36C 5KCMA 2UV1A 4B3XA 1WJCA 2LOOA 3BG6A 4F52A 1LDKB 2V4JC 4FASD 4XLAA 2E1MC 3K4LA 2WBMA 5HVQC 5KNLA 1IRXA 3PJRA 2A5WA 2AQFA 2W4SA 3TBIA 3H5NA 1Z3YA 3QYFA 2NOJB 4IQ4A 3DU5A 5LFAA 1YX5A 3DPUA 2VXZA 3OYEA 4PK4A 3K4KA 1ERDA 3K70C 2R7RA 2WB1A 2VQCA 1Z7LA 1X4OA 4BQOA 2LYCA 4BU2A 4D1QA 4CH7A 3AFHA 3HC7A 1MMNA 3OS2A 2E5ZA 1BOBA 2L5QA 3OL3A 3LSHA 3K4JA 1JI8A 2GOXB 3S8PA 1N78A 3BCBA 3NWTA 2HZDA 2X1CA 4C2TA 1X1CA 4B43A 1E0EA 3MKYB 4E7JA 4YELA 2PJRA 5HNHA 1D1BA 3PL8A 3U21A 1EA3A 3LSGA 4ZTJA 3HOSA 5CQGA 3DEEA 3ZXSA 3M8JA 3OYDA 4HNTA 4YRVA 2HDWA 3LMMA 4BE1A 1QHHD 2L2OA 1D0XA 3DTIA 4DOZA 4PJJA 4BQNA 4XKVA 3OYJA 4E7SA 3ONQA 4KISA 2JSPA 4ANJA 3E1SA 3IUOA 4GRIA 1MW7A 2IGOA 1U0JA 3CP8A 2HPMA 2HVQA 3D5LA 3SZGA 4CCLA 1X4PA 3S3NA 3EPZA 2VB6A 4NNJA 3PNYA 4PFOA 2IS6A 3SDBA 1PYVA 3H5RA 3OIQA 4DBQA 4XLFA 2WY8Q 3EUKL 3DQVC 2CW8A 2V9KA 1T95A 3HOTA 4BACA 3OYBA 4F92B 1DQUA 4BE2A 3LSMA 2F6CA 3FBIB 4XKWA 2R7WA 2JVHA 2R7QA 2X1DA 1Y56A 3ZR8X 2O5RA 4AU7A 1DGWY 3FBNB 2CS3A 5FROA 1R6RA 4E6KG 3S3MA 4XLHA 4ZDOA 3L2RA 1LFPA 3RTRA 1MNEA 4PUSA 4J00A 3VYTB 3J7AY 3DWLE 2LY2A 4JQFA 2BW3A 2V7FA 4RM2A 5LD2C 3OS0A 2QKLB 3QYEA 1YE9A 5FRNA 4B44A 3AL0B 1N77A 5FRMA 2XF7A 1QHGA 2WAQA 2HVSA 2HPIA 3K10A 2VLAA 2ZFUA 3CP2A 3QODA 3W2AA 1S9HA 3PSIA 3BLYA 3HKZA 3H9JA 3OYFA 4F3QA 4XKCA 2VJJA 1UELB 1Y6IA 3OYLA 1WFXA 2ZXHA 2A6TA 2GOMA 3OS1A 2HNHA 4DIQA 3H0DA 2R4GA 2RREA 3SEZA 2XF5A 4DBRA 2Q2EB 3VWBA 2KLOA 2E60A 4CCKA 2MC4A 1OLTA 2X6WA 2X1EA 3H9GA 3OYCA 4F93B 2KDOA 1WJDA 3QOEA 2CW7A 4B47A 1Z3XA 3BCAA 4IQJA 4BEHA 2RNGA 3W3CA 2Q1ZB 1NG7A 2IGMA 3CF2A 2ZXIA 4C9YA 1QU3A 4E7KA 2WA0A 4XNFA 3HG9A 4F55A 2KMUA 2LBFA 2CV1A 4BQQA 3AL0C 1GLNA 2LH9A 2K9MA 2FUG2 3KYLA 3ZCOA 2WAEA 4XLEA 3KX2A 4ITVA 2VL8A 3MKWB 1T0FC 2PMZA 1YX3A 3CZ6A 3FKJA 5CPRB 2VQLA 2IGKA 3RCOA 3E0JB 4BJ6C 4LITA 3VSLA 4KITB 2VQGA 4QPQA 4B48A 1BR2A 1DGRM 3UR3C 3OR2C 4ZDLA 3RSNA 4E4HA 1VZ0A 3PNVA 3OYMA 4BE0A 1J09A 3VDXA 2W82A 1OR7C 2VXDA 2WADA 1MMGA 1KONA 3MMYB 3N05A 1MNDA 3DPLC 4HRIA 3K4CA 3VYRB 2VKDA 3IAS2 2MFZA 1K6YA 3LSKA 4CA0A 2LRDA 2CFOA 4F91B 2V1NA 4CSWA 4C30A 2M4GA 4Y4RA 1Z21A 2DXIA 4II2A 2XDVA 2JVGA 1TZLA 4PFPA 2KRHA 3OMYA 3H35A 3W2WA 2VPLA 4XONA 1FMWA 3GBGA 2ELJA 2K3PA 3VSKA 4RM3A 4XL9A 1FMVA 3EUAA 3BG7A 2DOAA 3AKZA 4E7IA 5HLTA 4N4OB 3H5AA 3LSIA 4XKBA 3HPGA 2M7BA 2DJIA 4FETA 4II3A 4CCOA 3OWTA 2R7VA 3DLAA 2UWMA 4XN0A 4QPOA 2Z2SB 3TL4X 4JOMA 4DGWB 3SYTA 1NG6A 4C2UA 3ZQQA 4PSXA 2VASA 2X6XA 2M3AA 2CH0A 2K9LA 3S93A 1N75A 2KZVA 5HNFA 3MKZA 2DT7B 2DCEA 2OUMA 2XF6A 3LL7A 3RPUD 3F9KA 3HPHA 3L2WA 3OIPA 3OYIA 1TT0A 3L2QA 4XLCA 1X1DA 3H9QA 3CJQB 1WJEA 3CJRB 4ZDPA 1V5FA 3OYGA 4BJ5C 4XQFA 3QYBA 2W00A 1D1CA 4AVZA 2P0WA 2F4IA 1D1AA 2VKHA 2PJRB 4HEA2 1WJBA 3A2KA 4OAYA 4CZCA 3L2UA 2QKMB 2L9SA 4U87A 4CCNA 2XSJC 4XM3A 4BL0B 1SAUA 4HSTA 1V5GA 4XMYA 1WJFA 3MD2A 3K4BA 3OYAA 2F5VA 2XC7A 3V42A 4H4KC 2VJ5A 4ZJZA 4Y3OA 2KL4A 4DJAA 3VYUB 4YEJA 4KJZA 4ZTFA 3A1YA 2LC2A 4G6TB 2OC6A 2HVRA 1AA7A 3RQ4A 3ZGKA 4BJTA 4KT6A 2JA2A 3DKYA 3PFYA 4LIVA 3PSFA 1MMAA 1P9QC 1SFKA 2X51A 3OYKA 3W2VA 4OAZA 4IX7A 2IS4A 2W1OA 2Y0SA 2R7UA 4OWRB 4AYBA 3PUBA 2LY1A 4PJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E0J B; 
#chains in the Genus database with same CATH topology
 2PEX A;  2PMU A;  2L7M P;  4FX0 A;  4CCJ A;  4LB5 A;  3R60 A;  2DOE A;  4BUP A;  4WF2 A;  2L02 A;  1LNW A;  3I53 A;  2Z9O A;  2DQL A;  4YII A;  1VQ4 I;  1FOY A;  3GME A;  3DKX A;  1I6H J;  1WVR A;  1NH3 A;  3OSG A;  2HI3 A;  3C7J A;  3I71 A;  3SFZ A;  2JRT A;  5J1U A;  4HV6 A;  1R1V A;  2DDB A;  3LA7 A;  4OIP F;  1STZ A;  3TOB A;  4M73 A;  1WPK A;  1D3Y A;  3HGY A;  3ULQ B;  3FMQ A;  2LG4 A;  2DYR H;  1W0T A;  4RLF A;  3DF8 A;  3RDI A;  2QSH X;  1IO2 A;  1FC3 A;  3A4C A;  3LAP A;  2BOL A;  1VQ7 I;  2LKS A;  3SDG A;  4N9I A;  2CUJ A;  3ZMT A;  3FXL A;  2B0L A;  3FXK A;  4U0Y A;  2O7O A;  2FRH A;  3JSO A;  3IWZ A;  2ZB9 A;  2XAG A;  2MSY A;  2M87 A;  2LTP A;  2L7F P;  1ZKG A;  2OZ6 A;  3J7Z I;  3S2D J;  2E2J J;  4PGH A;  3ZRG A;  4U7B A;  3GYH X;  1W7P A;  2YPR A;  3I9V 2;  3E5U A;  5LBQ A;  1ITY A;  1ON1 A;  5FKN A;  4EJT A;  3TW7 A;  4ENK A;  4TV7 A;  4MFE A;  4P1W A;  4MGR A;  1D5V A;  1LVK A;  2W48 A;  5JFR A;  2H8W A;  2JZY A;  4MEX F;  2HDC A;  1WZ2 A;  4I2O A;  2FBK A;  3M1C A;  3HUG B;  3WGG A;  2LBF B;  5C3E J;  1W36 D;  4U0V A;  2BVL A;  3ZMU A;  4E7H A;  3CUQ B;  2VI6 A;  3K1N A;  3N97 A;  1G3T A;  1VQN I;  3JRB A;  1E2X A;  1G8X A;  1B9N A;  2DDA A;  2E5N A;  2R3S A;  3ISP A;  4QWQ A;  4B3A A;  2ME0 A;  5ED4 A;  2ZFW A;  2VBW A;  2XV4 S;  2KQR A;  4UHT A;  1OKR A;  3O6B B;  3GZN B;  3K6G A;  4BBS J;  1X1B A;  2DK5 A;  5F1R A;  4HQM A;  1Z67 A;  3IP4 B;  2R7S A;  4A3K J;  1MBH A;  2ID6 A;  2OQR A;  2E1M B;  5CLS A;  3RPQ A;  2R7D A;  4BXF A;  3BQZ A;  3IV5 A;  3JAM Z;  1BL0 A;  1EH6 A;  3BTI A;  1JUS A;  5M3F J;  2CQQ A;  4XLN F;  2I8D A;  2O6G E;  1W4M A;  4OIQ F;  3DTK A;  4X0G A;  1MSE C;  1HKT A;  3G71 I;  2R7Z J;  2Y69 H;  1QRY A;  1WJA A;  3K1M A;  4M3E A;  4I0B A;  4A0X A;  1IJW C;  3TED A;  4A3D J;  2AO9 A;  3P5J A;  3L2V A;  1FSE A;  3FMS A;  4Y15 A;  1HA8 A;  2K9Q A;  4R79 A;  5ICC A;  2MC3 A;  3IAM 2;  4WXD A;  5E79 C;  1UG2 A;  1W7P D;  3OYN A;  1DPR A;  1B1B A;  3N4M A;  2HOT A;  1Z77 A;  5B1B H;  2JUG A;  1W36 C;  1S7E A;  4FIS A;  2D45 A;  2AXT C;  1P7J A;  3J80 Z;  4OIO F;  1WJC A;  3BG6 A;  4F52 A;  1S7A A;  3I59 B;  2V4J C;  3HEF A;  2E1M C;  4A0Z A;  2JQ7 A;  2O0Y A;  3SQN A;  1VF9 A;  5HVQ C;  2L4M A;  3TQN A;  2WAQ N;  2Y31 A;  3PJR A;  2W4S A;  3TBI A;  4L5J A;  1Z3Y A;  3QYF A;  1X2N A;  4IQ4 A;  5HLI A;  4H0E A;  3DU5 A;  3CO6 C;  2BY3 A;  1YX5 A;  3Q9V A;  2VUM J;  1XGS A;  2DFE A;  2OU2 A;  4Y52 J;  1MBF A;  3QU3 A;  4F7Z A;  5F0C A;  2WB1 A;  3WTU C;  3WTV C;  2LYC A;  5EDN A;  1T33 A;  5J8C A;  3AFH A;  4EJV A;  1MMN A;  3OS2 A;  5CVI A;  1VQ5 I;  3S8P A;  2R7F A;  4AD9 A;  3ZP5 A;  3WU0 A;  2HZD A;  3JTG A;  1ETW A;  2KDZ A;  2R0Q C;  1T0F A;  2DBB A;  4B43 A;  1DDN A;  1E0E A;  4OMZ A;  2PJR A;  1P4W A;  5FLX K;  4LK0 F;  4WXH A;  4S04 A;  5CQG A;  3R6S A;  3I64 A;  1NTC A;  2DA5 A;  2STW A;  3M8J A;  3OYD A;  3IWF A;  4HNT A;  2Y75 A;  1Y1V J;  3MFK A;  2GA1 A;  2PMZ N;  3LMM A;  4RGS A;  5EG0 B;  4BE1 A;  3BQY A;  4DOZ A;  2CU7 A;  2LR8 A;  4MTE A;  4C3H J;  4OOI A;  4BQN A;  2QQ8 A;  3OYJ A;  2DPU A;  1R1T A;  3ONQ A;  4KIS A;  5ERI A;  3HOW J;  3E1S A;  1PDN C;  4GRI A;  4I76 A;  1U0J A;  5HDK A;  3CP8 A;  5HS8 A;  2HVQ A;  5K5O A;  4CCL A;  3ZPL A;  1X4P A;  2FBI A;  5CYV A;  2VB6 A;  4M71 A;  2QM3 A;  3PNY A;  5GAE J;  1SAX A;  1DU0 A;  5C4J J;  2IS6 A;  4IEJ A;  3GF2 A;  4XLF A;  2NNN A;  1C0W A;  2CW8 A;  1T95 A;  2FBH A;  5J40 A;  3MZH A;  1BM9 A;  4LFU A;  1Y39 A;  1R7J A;  3K0L A;  4QTR A;  4BE2 A;  1OCP A;  4AIH A;  2F6C A;  1OYI A;  1TWH J;  1IV8 A;  3DFG A;  4CDG A;  4B1R A;  2XGC A;  2JVH A;  4RAG A;  5FFX A;  2K9N A;  4U88 A;  1PUF A;  5LGU A;  4JK1 X;  2QQB A;  2O5R A;  4AU7 A;  2BY0 A;  2CS3 A;  4S05 A;  2XVC A;  3S3M A;  4CZZ A;  4IXA A;  4GGG A;  3L1P A;  2Y48 A;  3DEW A;  1RRJ A;  1RES A;  2JWT A;  1QBJ A;  1MBJ A;  3J7A Y;  2LY2 A;  2BW3 A;  1MDM A;  3J81 K;  1JHH A;  1EH8 A;  5JHU A;  1FNN A;  1YE9 A;  2HKO A;  3I4P A;  3BR3 A;  3AL0 B;  4E70 A;  2XKP A;  2XF7 A;  4NQW A;  5K5Q A;  4B4C A;  1QHG A;  2HVS A;  2QF7 A;  3CP2 A;  3QOD A;  4BQA A;  3W2A A;  3WU2 C;  2DAO A;  3HIF A;  1A31 A;  2MLK A;  3GO5 A;  4F3Q A;  2VBX A;  1UEL B;  1WFX A;  2EFQ A;  1DU6 A;  2OZU A;  3H92 A;  3W6J B;  1S29 A;  2HNH A;  3H0D A;  2FXA A;  4DBR A;  2XF5 A;  5DD8 A;  4ZZL A;  2K7L A;  5DYM A;  2RGV A;  3H9G A;  2AHQ A;  4IQJ A;  4Q4Z F;  2DA2 A;  2RNG A;  2COB A;  2XHK A;  2ZXI A;  3K69 A;  5B66 C;  4LG0 B;  2DK8 A;  2Z99 A;  5D4R A;  3AL0 C;  1Z6R A;  2CUF A;  2EV6 A;  2H94 A;  5FLX Z;  3KYL A;  4XLE A;  1T0F C;  5BS6 A;  3CZ6 A;  4ETS A;  3EET A;  1WHU A;  3FKJ A;  2DO7 A;  4BH9 A;  1BC7 C;  2IGK A;  2B63 J;  1JUP A;  2F4M B;  3RPU A;  3PIO F;  4BJ6 C;  2VQG A;  1L3L A;  2L9V A;  4M3F A;  3JR9 A;  3KP4 A;  4DYR A;  4DZJ A;  1PUF B;  3OYM A;  4GCV A;  1BI0 A;  3VDX A;  2Y0S N;  3ERM A;  4AYB N;  1KON A;  4RAZ A;  1FIP A;  2K4B A;  1MND A;  4MEY F;  2BEO A;  2VKD A;  2DA6 A;  3VYR B;  3HTS B;  1K6Y A;  2P7C B;  1EV7 A;  2XB0 X;  2ZC2 A;  4FQG A;  1W0U A;  3U1K A;  1A6Q A;  2V1N A;  4XID A;  3HHH A;  1O3S A;  4C3J J;  1ORK A;  3L2C A;  4HDV A;  5E1W A;  2ZXW H;  3H0G J;  1Z21 A;  5EEH A;  1MJB A;  5IT3 A;  3B02 A;  5JLW A;  2XDV A;  5EEA A;  1FP1 D;  2JVG A;  4PFP A;  1OCZ H;  2JK3 A;  2VPL A;  3KYC B;  4A5M A;  2UZK A;  4MHG A;  3U9G A;  1QNT A;  1FMW A;  2D5V A;  2ELJ A;  1E3P A;  1DUX C;  3GTL J;  1FMV A;  4GO1 A;  2XAH A;  2Z3Y A;  5BMZ A;  2L9R A;  1BI2 A;  3LSI A;  4EVI A;  2DJI A;  4A6E A;  2A69 F;  3JRG A;  1F36 A;  2KFD A;  1U2W A;  2Z2S B;  2BHY A;  2LF8 A;  1QPM A;  3ZQQ A;  3RKQ A;  4AIJ A;  1K7A A;  3CCE I;  3H3V K;  4OIR F;  3S93 A;  4M3B A;  1OYY A;  2WWY A;  3MKZ A;  5F6F A;  1TQP A;  2DT7 B;  1TNS A;  3LA2 A;  3CMY A;  3GX4 X;  3FWE A;  1RR8 C;  1T56 A;  3RPU D;  1K78 A;  4UNO A;  3F9K A;  1MJ9 A;  1S7O A;  3KCC A;  2NVT J;  1YHQ I;  4N0B A;  1DP7 P;  3I4N J;  4BXU A;  1U78 A;  2ZJR F;  1D8K A;  1WJE A;  4P55 A;  2DTR A;  4QSH A;  2GA2 A;  4BBR J;  3R0A A;  1IXS B;  3OYG A;  2EPF A;  3HRT A;  3KIO A;  4RS8 A;  3WG7 H;  2R5Y B;  1U3E M;  4JBA A;  2QLZ A;  1O3T A;  3LQR A;  4AVZ A;  2F4I A;  3ASO H;  1HKQ A;  2ECC A;  2VKH A;  4HEA 2;  1UMQ A;  4GXO A;  2Y0M A;  2TRT A;  3MAJ A;  3CCR I;  3V8J A;  3QPS A;  4OAY A;  1F43 A;  1N25 A;  2F5F A;  2L9S A;  2RV8 A;  2NVU B;  1P2F A;  3E97 A;  3P7N A;  2H1L A;  2NS8 A;  1A5J A;  4XM3 A;  1Y0N A;  3IH3 A;  4Y13 A;  1V5G A;  5D5X B;  1LVA A;  3Q9S A;  2Z33 A;  3S17 J;  2XPW A;  4ZJZ A;  2KL4 A;  4DJA A;  1XX5 A;  2LC2 A;  1TBX A;  5HDN A;  1F4K A;  4L9N A;  3ASN H;  3ZGK A;  2GQQ A;  4IHS A;  1J0R A;  3G1L A;  1YRN A;  2CJJ A;  3HSE A;  2X51 A;  2K86 A;  1LPQ A;  5IYD J;  3R0J A;  2JT1 A;  3DP7 A;  2R7U A;  3AG3 H;  2JA8 J;  2LY1 A;  4PJM A;  3JRD A;  4A3F J;  4IHX A;  3DBR B;  1L0O C;  3D5R C;  5LGT A;  2CO5 A;  1ZQ3 P;  1YI2 I;  2M8G X;  2ZXJ A;  2EIM H;  2YX7 A;  4O5V A;  4BHC A;  1FLI A;  5IP7 J;  1JE8 A;  2IS2 A;  2NYX A;  2MLG A;  3VOD A;  1TP4 A;  4HAM A;  3OR1 C;  3M1E A;  2OA4 A;  1I5Z A;  2X6O A;  3T8T A;  4KA4 A;  2UXN A;  1ZGW A;  2JMW A;  4JX4 A;  4NC8 A;  5BQT A;  1HST A;  5CVR A;  2HQA A;  4KMF A;  4IOA F;  1OJL A;  4A2U A;  5CVJ A;  1FBS A;  2PI0 A;  3F8F A;  1TW2 A;  2QCO A;  3V8L A;  2NVX J;  5FJ8 J;  3ROU A;  1OFC X;  3Q3S A;  1BI1 A;  1IV6 A;  1FBQ A;  2KP6 A;  2ADU A;  3KLN A;  2CV0 A;  3CLO A;  1GV2 A;  1HW5 A;  2EZH A;  1TNT A;  2XGD A;  2DFH A;  1ON2 A;  2LDU A;  2WAF A;  3PQK A;  1AHD P;  1J7K A;  2EIK H;  3A0B C;  4EQQ A;  4XRS A;  1O4X A;  1LJ9 A;  4E7L A;  2W84 A;  2OD5 A;  2HGC A;  4ON0 A;  2Q2E A;  1BR1 A;  2KRC A;  1GT0 C;  3X2Q H;  4KIB A;  3ERE D;  2HTJ A;  2LD5 A;  2PN6 A;  3PNT A;  1SFU A;  1HW1 A;  2K27 A;  2LLK A;  4XN3 A;  4CYC B;  1FIA A;  2FMY A;  4XR6 A;  2O03 A;  1WCM J;  1GV5 A;  3IRQ A;  2BZT A;  5E3N A;  2EFN A;  2RQP A;  4BEH B;  4QLC U;  1WI9 A;  4ZC3 A;  4M3D A;  3DBH B;  3KZZ A;  4UVC A;  5M3M J;  2VBZ A;  4BS9 A;  1CQT A;  3U1D A;  2V6C A;  3W6K B;  1QVU A;  4LIU A;  2QBY A;  3HJE A;  1BN5 A;  2PFB A;  3GTJ J;  3CUO A;  1J2X A;  3FKI J;  4HG2 A;  3ELK A;  3TDZ C;  4WWC A;  4EGY A;  5DEQ A;  1XB4 A;  2RKH A;  4C2M J;  4AM3 A;  1ETX A;  3BPX A;  2RAE A;  1APL C;  3I3L A;  3KEO A;  2Z1D A;  3IC7 A;  2XPV A;  3G2B A;  2ZSH B;  3R4K A;  4UUS B;  3G73 A;  4IO9 F;  5E1Z B;  3IL2 A;  2HU9 A;  4EAT A;  2CFX A;  2L01 A;  2MYS A;  2COM A;  4HNU A;  5EZH A;  3KFW X;  2IT0 A;  2KRF A;  3VYS B;  3NAU A;  2R92 J;  1ZR4 A;  2BE5 F;  5A2Q K;  3B6A A;  2X6Y A;  3S2H J;  1KU9 A;  1MD0 A;  2KHM A;  5FKK A;  1D0Y A;  1UHM A;  1U5T A;  3QP5 A;  1X1A A;  4XRM A;  2W7N A;  5M5W J;  2UUZ A;  3LWF A;  1Z1D A;  1HC8 A;  3WG9 A;  1U9N A;  4MLO A;  2IEK A;  1XS9 A;  5DD4 A;  2G7U A;  1G4D A;  3ZQL A;  5J1Y A;  2X4H A;  1AKH A;  3E6B A;  2M0M A;  3O8G A;  1SFE A;  3EQL F;  2VJ4 A;  4G12 A;  4Y33 A;  3AG2 H;  4IVN A;  2DA4 A;  2QVO A;  1G59 A;  1A36 A;  1HOM A;  1SEU A;  2BVM A;  2L3D A;  5E3L A;  3RZD J;  3WTS C;  2R7X A;  1ZGJ A;  5FD5 A;  4M6V A;  1I6X A;  2UV1 A;  1U6G A;  2XPU A;  2FJ1 A;  3HYI A;  5B5E C;  3HOU J;  4M6Y A;  4NDL A;  2F48 A;  1IRX A;  2AQF A;  5FKO A;  1ZGA A;  5IP6 A;  3DPU A;  1XCV A;  1FBU A;  3RKY A;  4IHY A;  3PFI A;  3Q0V A;  1SVM A;  1TQM A;  1AOY A;  1X4O A;  3S15 J;  1ZG1 A;  3CC2 I;  2DMT A;  3F3X A;  3H3Z A;  3CO7 C;  4JP0 A;  4CH7 A;  3E6D A;  2P6S A;  3GFL A;  3GZ5 A;  3QPL A;  4ENN A;  1LQ1 A;  1VQ6 I;  2NS7 A;  3HTU A;  5TIS C;  3OL3 A;  5D5V B;  2LKP A;  3LSH A;  3K4J A;  4IRH A;  3NEU A;  2F5E A;  2GOX B;  4FTH A;  4Q48 A;  1VQK I;  2M9H A;  2EV5 A;  3BCB A;  3NWT A;  1IXC A;  4X6A J;  2X1C A;  3IH2 A;  2E19 A;  5L3D A;  4WX9 A;  3E6C C;  5HNH A;  1EA3 A;  3CC7 I;  1YG2 A;  2TCT A;  3DV8 A;  5DDG A;  2DA3 A;  4ENM A;  2O8X A;  1JJ8 C;  4D7M A;  5IPA A;  3GLL A;  2P5V A;  4YRV A;  4BY1 J;  2ACJ A;  4L9V A;  4MTD A;  3RYR A;  1QHH D;  3DTI A;  2MGQ A;  3BZK A;  3E3V A;  4E7S A;  1YFH A;  1WI3 A;  2QGU A;  2JSP A;  4ANJ A;  1H9T A;  3WTY C;  1REP C;  5IOZ A;  2XAJ A;  2BXY A;  2FA5 A;  3T0Y A;  3GEZ A;  5F0H A;  3ZN1 A;  2IBD A;  2HPM A;  2OTJ I;  3SZG A;  1R5H A;  3KP7 A;  3S3N A;  4HX7 A;  1ZLJ A;  1GXQ A;  4O6J A;  5DCM A;  2X48 A;  4PFO A;  2ZNY A;  1F1Z A;  3SZT A;  2AXL A;  3HOV J;  3BWG A;  3SDB A;  4ESF A;  1P6R A;  1HBX G;  4DBQ A;  3ZQI A;  5A2Q Z;  1ZR2 A;  2R5Z A;  2M45 A;  1UFM A;  1X1P A;  3EYY A;  4QIW N;  2FQ4 A;  4OMY A;  1X3Z B;  3TP3 A;  1RIO H;  1FYM A;  3BR5 A;  1IGN A;  2PJP A;  2Y9Z A;  4G7O F;  1Y56 A;  1IF1 A;  3C2B A;  1JHF A;  1JTX A;  5IT9 K;  1MNM C;  2R93 J;  4EV0 A;  2L7Z A;  2HWV A;  3KE2 A;  4E6K G;  2HFH A;  3RTR A;  4K2E A;  4GDF A;  4A69 C;  3VYT B;  5E8G A;  2Q8K A;  4AUX A;  2V7F A;  4A3G J;  2QQ9 A;  4IRG A;  3AAF A;  3S1N J;  3FXJ A;  4RM2 A;  2QKL B;  3QYE A;  2PLY A;  5FRN A;  3O3K A;  1F5T A;  1FT9 A;  4RAY A;  1N77 A;  5H6R A;  1V4R A;  3B6C A;  2CQX A;  5FLM J;  3DXJ F;  1XN7 A;  3K10 A;  2VLA A;  3LSJ A;  2YU3 A;  3TKY A;  4ESJ A;  1S9H A;  3BZC A;  1TC3 C;  3HKZ A;  1FZP B;  2L4A A;  4WCG A;  1R49 A;  3I55 I;  3TDU C;  4XKC A;  2VJJ A;  1Y6I A;  1ZYR F;  4YIR X;  2A6T A;  5DS9 A;  4UY8 I;  3ECO A;  1HDD C;  1W7P B;  2RRE A;  3CJN A;  3SEZ A;  4HDU A;  3VWB A;  2XB5 A;  3RJP A;  2E60 A;  3LOC A;  2DJN A;  3BP8 A;  1HLV A;  2MC4 A;  2X6W A;  4GFB A;  2X1E A;  4M9S A;  4F93 B;  1WJD A;  3UKG A;  2CW7 A;  4B47 A;  3I54 A;  2DT5 A;  2WV1 A;  2HYF A;  4I6Z A;  4P96 A;  4C9Y A;  2XSD C;  3P9K A;  1ETO A;  1QU3 A;  4E7K A;  1OPC A;  2LNB A;  4G6Q A;  3E5X A;  3HG9 A;  3JRA A;  2KMU A;  3G1M A;  3AG1 H;  3ZQC A;  3VEP A;  4MQ9 F;  1J59 A;  1NK2 P;  3RIR A;  2FUG 2;  1B8I A;  1I1G A;  4NBQ A;  3CMA I;  2WC2 A;  1KU7 A;  1YX3 A;  5CPR B;  2VQL A;  1ZRE A;  4U0W A;  1Z9C A;  3VPR A;  3ML6 A;  3RCO A;  3E0J B;  1XGM A;  3FIW A;  5J1R A;  3GW2 A;  4LIT A;  4HLX A;  3TO7 A;  5DTD A;  3JRC A;  4B48 A;  3E5Q A;  3UR3 C;  1ETV A;  1UZC A;  2DMU A;  3BJA A;  2RNJ A;  1ZAR A;  4AIK A;  1IRF A;  5CJ9 A;  3RSN A;  2ESN A;  4E4H A;  1QPI A;  1O7L A;  5EGO A;  1HXD A;  3J7A O;  3ZQF A;  1BJZ A;  3SHF A;  2PBI A;  1R00 A;  2VXD A;  3LSR A;  2WAD A;  4Q5S F;  2QUF A;  3MMY B;  3N05 A;  4HRI A;  4I7H A;  3GWZ A;  4CA0 A;  3LSK A;  5BPI A;  2LRD A;  5IYB J;  5H6Q A;  4Y4R A;  4B09 A;  2DXI A;  5B3S H;  3GTQ J;  2V1U A;  3B73 A;  3IHU A;  1O3R A;  2FML A;  4A5N A;  5LEJ A;  4Q47 A;  3GBG A;  3D0S A;  3HZJ A;  1KYW A;  1AWC A;  5IT9 Z;  4W1U A;  2P5L C;  1R23 A;  2DMP A;  4N4O B;  3S14 J;  3MQ0 A;  1JKO C;  2M7B A;  4MNU A;  2KIQ A;  4KNY A;  3OWT A;  3EUH A;  3DLA A;  2R7V A;  4M9Z A;  3L09 A;  5LRR A;  1YQA A;  4DGW B;  2BV6 A;  3CDH A;  3SYT A;  3ZMD A;  5JVT A;  3A01 A;  2O9L A;  1XC5 A;  4HNV A;  1F9N A;  4PSX A;  1RC9 A;  3BR2 A;  3SXY A;  2GWR A;  2M3A A;  1SD6 A;  2CH0 A;  5EEG A;  3FHZ A;  3G3Z A;  2HXO A;  5F64 A;  3JTH A;  1RI7 A;  4LJZ F;  5HNF A;  2JJ7 A;  1VQO I;  4IOC F;  2XF6 A;  2ISY A;  4R1H A;  3WTT C;  3L2Q A;  2EB7 A;  4M9X A;  4XLC A;  4BXX J;  4A3J J;  4P9F A;  2EIL H;  3H9Q A;  2HKX A;  3DBL B;  1BIB A;  1MZB A;  2A61 A;  4MIM A;  3WU1 B;  3HRU A;  4XBF A;  3CJR B;  4UVB A;  1V5F A;  4XQF A;  1I39 A;  4MQV A;  3E7L A;  3G4S I;  2E1C A;  5EF6 A;  1D1A A;  2LFB A;  2QQA A;  2PJR B;  5E17 F;  4G6D A;  3TP0 A;  1IC8 A;  3A2K A;  2OCC H;  4CZC A;  3O8H A;  5KVR A;  1PUE E;  2CSO A;  3ECH A;  4U87 A;  4RB1 A;  5FKL A;  4CCN A;  3KZY A;  2HEO A;  2XSJ C;  2RN7 A;  4ZYH A;  3WHC A;  3FXU A;  1ETQ A;  3I5U A;  1R4M B;  2QEX I;  2VJ5 A;  1ENH A;  4Y3O A;  1TL8 A;  5GAG J;  3VYU B;  4ZTF A;  1TT5 B;  1ZHF A;  3RZO J;  2J5P A;  3MN2 A;  1M1E B;  5JI6 A;  3ZMS A;  5FKM A;  2PG4 A;  1JT0 A;  4KT6 A;  5GP9 A;  3GVA A;  3JRH A;  3CQZ J;  1IN4 A;  3DKY A;  1P9Q C;  2DW4 A;  2FSW A;  2HOA A;  3BT9 A;  2CYY A;  1SAN A;  2IA0 A;  3HOY J;  5BOX A;  4OAZ A;  1LEB A;  3F8N A;  3BR0 A;  3GXO A;  2NS0 A;  2F4O B;  3NQO A;  3FXQ A;  5K7H A;  4NC7 A;  3QQA A;  1G2H A;  2DA1 A;  3BOQ A;  1KU2 A;  1JT6 A;  1BBY A;  1W1W E;  4RMN A;  3IRR A;  2EK5 A;  3JRE A;  3F8C A;  3FK7 A;  1XMA A;  4EM2 A;  4XSZ F;  1HW2 A;  2DN0 A;  2ZME A;  2OAZ A;  4M74 A;  1GVJ A;  3KZI C;  4I01 A;  4PJN A;  3M8F A;  1OCC H;  4NC6 A;  2FD5 A;  2BY1 A;  1BJA A;  1PP7 U;  5LHI A;  2VJI A;  1MMD A;  3MCZ A;  1S5L C;  3I58 A;  2L9N A;  1H9G A;  2CV2 A;  2BW3 B;  3KEQ A;  1MDM B;  1JXS A;  4IJA A;  3TMO A;  3C2H A;  2EV0 A;  3DPT A;  2L7K A;  5JHF A;  2K40 A;  5DM7 F;  1WGX A;  4NQW B;  4UB8 C;  4XRS G;  4YIF A;  3HXL A;  2WB1 N;  1YO5 C;  3K4M A;  2VKV A;  3BR1 A;  3LFK A;  1B72 A;  4A6D A;  3EUH C;  1S72 I;  3F72 A;  4DYQ A;  3PIP F;  4G7H F;  5TGT A;  2V6E A;  2G9W A;  1O3Q A;  1RNL A;  3UNG C;  3HOZ J;  4PCQ A;  1EH7 A;  2WY7 Q;  3C2G A;  2W57 A;  2EJR A;  5IY5 H;  1ZN2 A;  2CUZ A;  1T6S A;  3J81 Z;  3EYI A;  4D7N A;  2M1B A;  5IOY A;  3LQQ A;  4IRI A;  4J01 A;  4HOB A;  1K4T A;  2GIV A;  4R8H A;  1HQC A;  2LMD A;  2DMQ A;  1WJ5 A;  4G9Y A;  2E36 A;  9ANT A;  1V55 H;  4EJW A;  2ESH A;  5CVV A;  4HW0 A;  3FDY A;  1FY7 A;  2YUS A;  3HGG A;  2O8K A;  2OV7 A;  3OOU A;  1UJ8 A;  3CES A;  4BDY A;  4A3E J;  1V5E A;  3DKW A;  4LD5 A;  1LB2 A;  1ZEL A;  3SEQ A;  4EMS A;  1OYW A;  1CF7 A;  1UST A;  2M4K A;  4LK1 F;  2HQR A;  2GIZ A;  2IVM A;  4N4N B;  4PSW A;  4ABZ A;  5KK1 A;  4KIC A;  1XDS A;  2G0E A;  3BTC A;  2E2I J;  2X85 A;  1MMS A;  2XGE A;  2QA4 I;  2LRE A;  4HZF A;  1TTY A;  2EIJ H;  3K70 D;  4EM1 A;  2B9S A;  4BHB A;  1IN5 A;  1LUJ B;  2RVC A;  2MD0 A;  1LKX A;  1D0Z A;  1WH5 A;  2OQG A;  3MKL A;  4HX8 A;  3GTG J;  3HM5 A;  3NWS A;  1VQ9 I;  5E3M A;  1YTY A;  2KJB A;  3S32 A;  1KU3 A;  2CMP A;  1PJR A;  1MH4 A;  2FE3 A;  2OJE D;  5BNG A;  3K7A J;  2MAB A;  1U9O A;  2RC4 A;  5CQE A;  1UG0 A;  5EZG A;  4LG3 A;  2PQ8 A;  5CKT A;  4BNC A;  1WSU A;  1K4S A;  4BHP A;  3F22 A;  5B1A H;  1S3J A;  2LP0 A;  2GZW A;  2E2H J;  4OU0 A;  2LOO A;  1LDK B;  4PDK A;  4FAS D;  4XLA A;  1MJA A;  4G8X A;  2WBM A;  4PZJ A;  4CYD A;  2DMN A;  1TLH B;  2EZL A;  2FEZ A;  2ZME C;  3BTL A;  4RGR A;  3GFI A;  2A5W A;  1MKM A;  1IAW A;  3H5N A;  5GPC A;  2IRF G;  5F08 A;  3V8K A;  5JVG F;  1QZZ A;  5LFA A;  4Y7N J;  2JTV A;  3GTP J;  4PK4 A;  1FOX A;  3K4K A;  1K6O A;  1ERD A;  5DV5 A;  3WGH A;  3K70 C;  2Y30 A;  1XD7 A;  3F23 A;  2VQC A;  1R9T J;  4BQO A;  2KKO A;  4UB6 C;  2OPT A;  4BU2 A;  3COA C;  4I09 A;  1IDZ A;  1OCT C;  2H8R A;  3HC7 A;  1BOB A;  1K78 B;  2A6H F;  2MH2 A;  1POG A;  4D0P A;  5GTH C;  2YSR A;  3MKY B;  4E7J A;  4YEL A;  4CXF A;  1FTT A;  2HXI A;  3U21 A;  2H1K A;  2VT2 A;  1W5S A;  1GVD A;  3HOS A;  1YW7 A;  3DEE A;  5LHG A;  2HYJ A;  2LY9 A;  3GTK J;  3ZXS A;  3BY6 A;  2KIF A;  1XPX A;  2HOE A;  2V9V A;  2ZO4 A;  4YFN F;  4L0Z B;  3CTA A;  1SFO J;  4XKV A;  3HBL A;  1KQ8 A;  3K9T A;  3SJM A;  2XRN A;  1RUN A;  3IUO A;  1T98 A;  1MW7 A;  5D6F A;  2DQR A;  2IGO A;  2PX9 A;  1U8B A;  3WE2 A;  1FJL A;  4A3C J;  2BYV E;  5FB2 A;  1NK3 P;  4C3I J;  3FMR A;  2JPB A;  3AG4 H;  2LSO A;  1OQY A;  4NNJ A;  1TWF J;  4D5F A;  3FZV A;  1YYV A;  4ESB A;  1YRN B;  2Z5U A;  2DFF A;  1BW5 A;  2WY8 Q;  2H6B A;  2V9K A;  3HOT A;  2BGC A;  4X1E A;  4KN4 X;  3OYB A;  1DQU A;  3LSM A;  1VQ8 I;  3FBI B;  3RKX A;  5ILU A;  2R7W A;  1ZRD A;  2E7W A;  1YS7 A;  5L3G A;  2DLL A;  4JYK A;  1JJ6 C;  4DZP A;  1TQI A;  2JA6 J;  2EFO A;  3FBN B;  2VKE A;  5HLG A;  1WWX A;  1S6L A;  1Z0X A;  3P9I A;  4XLH A;  4ZDO A;  2HYG D;  1KA8 A;  2IPQ X;  1LFP A;  2V1D A;  1MNE A;  3DWL E;  1XG1 A;  4RAF A;  3MEX A;  3C18 A;  3OS0 A;  3RKW A;  4I98 B;  3FF5 A;  5JR3 A;  1VQL I;  4B44 A;  4LMY A;  1FX7 A;  2DOD A;  5FRM A;  1Z6T A;  2WAQ A;  2CWE A;  3QP6 A;  5J3L A;  1ZAO A;  4CIC A;  2ZFU A;  4HF0 A;  1SVL A;  4FE7 A;  1H88 C;  1T2K A;  2NRA C;  1FTZ A;  3BLY A;  3H9J A;  4YG2 F;  3OYF A;  1OCO H;  1R22 A;  1A04 A;  2O61 A;  2KJC A;  2ZXH A;  1YIO A;  4GYI A;  5GPA A;  2GXG A;  3LST A;  2GOM A;  4MO7 A;  3OS1 A;  2QEN A;  1H89 C;  4DIQ A;  1VQM I;  4AC0 A;  2R4G A;  4KIF A;  2Q2E B;  2KLO A;  5AIQ A;  4CCK A;  1LFU P;  2XRO A;  2CQN A;  2F5C A;  3KPH A;  3CCJ I;  1OLT A;  1SD5 A;  3OYC A;  1XMX A;  1YOV B;  4O3M A;  4AVP A;  2NAZ A;  3FM3 A;  3W3C A;  3TGN A;  1NG7 A;  2NNY A;  2WA0 A;  3BG3 A;  4F55 A;  1GUU A;  3HUG A;  2LBF A;  2GAU A;  1XSV A;  2BBY A;  5D4S A;  1GLN A;  1BI3 A;  2LH9 A;  3CUQ A;  2DPD A;  3MVP A;  3WE3 A;  3ZCO A;  2WAE A;  5CVU A;  2JRM A;  1Z05 A;  1ODD A;  3MKW B;  2STT A;  2PMZ A;  1J5Y A;  5K1Y A;  1JTY A;  2QBY B;  3LNQ A;  3HOX J;  2FU4 A;  4U7D A;  1H0M A;  3VSL A;  4KIT B;  4QPQ A;  2OCE A;  1BR2 A;  1DGR M;  2KZG A;  2MBF A;  3VFZ A;  4ZDL A;  3J80 K;  1CGP A;  3PNV A;  2YX4 A;  4BE0 A;  2ZCW A;  3FM5 A;  1J09 A;  1QZY A;  1JKR C;  2F2E A;  1MMG A;  1HDP A;  4IHV A;  1X3U A;  1G3Y A;  3Q0U A;  2QSG X;  5L3B A;  3TO6 A;  2CFO A;  4F91 B;  4ENJ A;  2M2E A;  5LRS A;  1U5T B;  4C30 A;  4JX5 A;  1UCR A;  5DUK A;  3LA3 A;  1JKQ C;  5IYC J;  2MH9 A;  4II2 A;  3MWM A;  2DA7 A;  4I0A A;  3CDI A;  3MZY A;  1YJN I;  3OMY A;  3W2W A;  3ZQG A;  2B7E A;  4BAY A;  1AKH B;  2E7X A;  4ZH4 F;  1Z91 A;  2JN6 A;  4LLL A;  3VSK A;  4HYE A;  4FHT A;  4EGZ A;  3I59 A;  3QRF F;  2FQ3 A;  4E7I A;  5HLT A;  3H5A A;  5AIP A;  3HRS A;  5E20 A;  3HPG A;  4FET A;  4CCO A;  2UWM A;  2NXN B;  4XN0 A;  1D5Y A;  5L3E A;  2GBY A;  3KYD B;  3TL4 X;  4EEF G;  1NG6 A;  2NVQ J;  4C2U A;  4FE4 A;  4L5I A;  4MFD A;  5D8K B;  3WOD F;  4GYG A;  2VAS A;  3OSF A;  1U5T C;  4UV9 A;  2BY2 A;  1N75 A;  1UHS A;  2ZBK A;  4HBL A;  3I4M J;  2VC1 A;  4IPA A;  3IH4 A;  2DCE A;  2XAF A;  1G3S A;  4FT8 A;  3LL7 A;  4IL6 C;  3HPH A;  3OIP A;  3OYI A;  2A5Y B;  2V9P A;  3ZMV A;  3E6M A;  1X1D A;  3CJQ B;  3ZQH A;  3QPT A;  4RB2 C;  3LSP A;  4KDP A;  5FFZ A;  1ZG5 A;  3WTX C;  4BJ5 C;  2TDX A;  1IDY A;  2HR3 A;  3QAH A;  1XSD A;  2P0W A;  3TOA A;  2M34 A;  3BDD A;  4LOC A;  4M72 A;  1WJB A;  3PUF A;  5EG0 A;  1VQP I;  1P7I A;  2V79 A;  5ICF A;  3F0C A;  3T1B A;  2ICW G;  3S1M J;  4BL0 B;  4XLP F;  2HDD A;  1SAU A;  2DYS H;  1HKS A;  1O7F A;  2L54 A;  1WJF A;  3P9C A;  4G94 A;  4PJ0 C;  2F5V A;  1WH7 A;  2IJL A;  4H4K C;  2DI3 A;  3QWL A;  4LLG F;  4KJZ A;  3CUQ C;  4G6T B;  2A05 A;  2OC6 A;  2VOO A;  2GLO A;  1AA7 A;  2EIN H;  4BJT A;  2JA2 A;  1WQ2 A;  5EJC A;  3PQJ A;  4HLY A;  4LIV A;  2EZI A;  3PSF A;  4XSX F;  1MMA A;  1ZK8 A;  1BC8 C;  3CCQ I;  1T39 A;  1MBK A;  1H8A C;  1IW7 F;  2OF7 A;  3OYK A;  3ZMZ A;  1ETY A;  3W2V A;  4IX7 A;  3KP6 A;  5M5X J;  2IS4 A;  2Y0S A;  3G1O A;  5DCM B;  1RUO A;  4AYB A;  1YS6 A;  3PUB A;  1EF4 A;  4UUT A;  1IN7 A;  4E7Z A;  2R7T A;  5J4Y A;  4CHU A;  4HPQ A;  2EFP A;  4NUB A;  5D8L B;  3OYH A;  2CUE A;  2R5Z B;  2R7O A;  2K4J A;  1ZRC A;  3CCU I;  2J5O A;  3CMM A;  4CUG A;  5HOO A;  5F04 A;  5LHH A;  1DP3 A;  2HTS A;  3GFJ A;  4WXC A;  2L0K A;  4RB3 C;  3LFU A;  4Z6Y A;  1QGP A;  5C44 J;  4IKF A;  3CD6 I;  2ZJ2 A;  4IHT A;  1DPU A;  1KYZ A;  3HSF A;  3FIS A;  3EDP A;  2E1O A;  4D9J A;  1A35 A;  4RGX A;  5KHD A;  2ZJP F;  3W6V A;  3PM1 A;  4XOP A;  4HF1 A;  1IN8 A;  2KPM A;  1E3H A;  1X19 A;  1ZTR A;  1V54 H;  4XOR A;  3A02 A;  2QWW A;  1D8J A;  1BOA A;  4RLQ A;  2P4W A;  2XIG A;  3JCU C;  3WHB A;  5GAD J;  3WTZ A;  3DLL F;  1B9M A;  1BW6 A;  3OV8 A;  5DCF A;  2HS5 A;  1P4X A;  4RBO A;  1MH3 A;  4BGD A;  1JGG A;  3S1R J;  2V26 A;  3ABM H;  4I99 C;  3FHN A;  3KEY A;  3DTE A;  3DU6 A;  3ABK H;  2VQH A;  3S1Q J;  1ULY A;  2JUC A;  2BHZ A;  2M8E A;  4ZZD A;  1Q1H A;  1BR4 A;  3FK6 A;  2H6C A;  4P5O A;  5E1X A;  4ZYE A;  4HF2 A;  2CG4 A;  3M7G A;  1T8I A;  3M3Y J;  5K7F A;  4LLN A;  1LDJ A;  4LG0 A;  1FWZ A;  2W25 A;  5LLQ A;  4ASN A;  4WK8 F;  3BC8 A;  4A3M J;  2ETH A;  4IZZ A;  1JGS A;  4L18 B;  1BIA A;  3K4N A;  1TWA J;  3OY9 A;  4G7Z F;  1YIJ I;  1BA5 A;  4HSR A;  1U8R A;  3OOP A;  3NAR A;  2EFW A;  1IXR C;  2YU9 J;  3S2W A;  2VE9 A;  1Q1V A;  1X58 A;  2IXS A;  1JUM A;  1KZH A;  3M07 A;  4BKX A;  1QO0 D;  2D1H A;  5L3F A;  5E18 F;  2GXB A;  2IS1 A;  3H36 A;  3HL2 A;  2GXA A;  1KQ9 A;  2EH3 A;  1B8I B;  2QZ8 A;  1RR7 A;  2FX0 A;  3GCM A;  2Y2Z A;  1A6I A;  2Z16 A;  4M3G A;  4AID A;  1FP2 A;  2IGN A;  2LF7 A;  2WV0 A;  2K5C A;  4BDZ A;  1IRZ A;  3CME I;  2KIU A;  3Q5F A;  3D5S C;  4EM0 B;  2P81 A;  2KIM A;  5JLX A;  1PP8 F;  2VIX A;  1SMT A;  2OBP A;  1IUY A;  4I02 A;  4KMU X;  2BXZ A;  1UAA A;  2XAU A;  2RDP A;  1VFC A;  2DU9 A;  2DT6 A;  3BZ6 A;  1FOK A;  3T8R A;  2FNP A;  2E71 A;  4XOT A;  1K83 J;  4HA8 A;  5EGO B;  1YJ9 I;  3GTO J;  4CCM A;  1TW3 A;  3S3O A;  1ZG3 A;  2EQR A;  2V1X A;  4DNC A;  1X2M A;  3O2P E;  3F8B A;  1VND A;  3RQI A;  4KUM A;  3OL4 A;  2AQE A;  2H27 A;  2VT3 A;  4XIC A;  4PJL A;  2Q0O A;  2ZSI B;  3ABU A;  3PO3 J;  3MZ8 A;  3LAJ A;  2XKO A;  1TWG J;  3V7C A;  4YFK F;  4ZYA A;  5K5R A;  1T38 A;  2E1N A;  4L0Y B;  3M8E A;  2RQQ A;  3WTW C;  4V19 K;  5EYR A;  1J9I A;  5J6X A;  2M7A A;  1B6A A;  1XGN A;  1XCB A;  5KCM A;  1E17 A;  4B3X A;  4A3I J;  3BG5 A;  3CCM I;  3K4L A;  3ZQ7 A;  5KNL A;  4AWX B;  2EA2 A;  4Y17 A;  3BPV A;  3JSP A;  2NOJ B;  1RPW A;  3H3U A;  1P4A A;  5J8F A;  3KLO A;  1FPQ A;  2VXZ A;  3HKZ N;  5ILS A;  3OYE A;  3QOP A;  3A01 B;  5HOD A;  5BPD A;  1I3A A;  1RKT A;  2K3F A;  3F8M A;  2R7R A;  3RI4 A;  2FF4 A;  4L9T A;  4JX6 A;  1Z7L A;  3HSR A;  5DUI A;  4D1Q A;  2P8T A;  3BG9 A;  3F6V A;  1ZH5 A;  2W85 A;  2ZNZ A;  1FYL A;  1ACI A;  1TWC J;  2E5Z A;  2FNA A;  2ZKZ A;  2L5Q A;  2X9D A;  2P6T A;  3V4G A;  5ICE A;  1QA6 A;  3KP3 A;  5FGM A;  2R5Y A;  1JI8 A;  5F27 A;  1N78 A;  2ME6 A;  1VTN C;  1MIJ A;  5E3O A;  4C2T A;  1X1C A;  1WRJ A;  4A3L J;  3DCF A;  1D1B A;  3PL8 A;  2MW8 A;  3LSG A;  2MD5 A;  4UXN A;  4ZTJ A;  3GFM A;  4RA2 A;  3F21 A;  3G6E I;  3D1N I;  1LDD A;  5D5W B;  2HQN A;  5FO5 A;  2HDW A;  2NOG A;  5H20 A;  2XGX A;  3JRF A;  5TRD A;  2L2O A;  1D0X A;  2YS9 A;  4W97 A;  1SVO A;  1WKM A;  2VE8 A;  4L5E A;  4PJJ A;  4Z2Y A;  4LB6 B;  3JRI A;  3HDD A;  4YFX F;  3QU6 A;  1OR7 A;  3CCY A;  5D5U B;  3CJT B;  1RKW A;  2E35 A;  2P7V B;  2CW0 F;  2W24 A;  4KT5 C;  3K2Z A;  4A0Y A;  4FX4 A;  2VOD A;  5E8I A;  2K85 A;  4UUV A;  3I0T A;  4L9J A;  2LKX A;  2D2W A;  3D5L A;  2DOF A;  1FOW A;  1OMI A;  1LE8 A;  1I1S A;  2HOS A;  3EPZ A;  4P9U A;  4A93 J;  2VPR A;  5HS7 A;  2IA1 A;  3L9F A;  1R4N B;  1PYV A;  3H5R A;  3OIQ A;  4A12 A;  2VOP A;  3ABL H;  3DQV C;  3EUK L;  4HX4 A;  1R36 A;  1QZE A;  1VI0 A;  2GM4 A;  5LEK A;  4BAC A;  3M9A A;  1GXP A;  1RZ4 A;  4F92 B;  2N8G A;  3R61 A;  1UB9 A;  2IW5 A;  2IP2 A;  4KIG A;  3U2R A;  4XKW A;  3A03 A;  4IF4 A;  2VBY A;  1SD7 A;  2R7Q A;  2X1D A;  3OIO A;  1MBE A;  3ZR8 X;  2PMH A;  2K02 A;  1O57 A;  3H1C A;  1K79 A;  3A0H C;  1DGW Y;  5J47 A;  4LGW A;  5FRO A;  3TW6 A;  1R6R A;  2A68 F;  1YJW I;  2XRL A;  2ZME B;  3L2R A;  3Q0W A;  4PUS A;  4J00 A;  2JSC A;  1IRG A;  4DW6 A;  3CDL A;  1G3W A;  4JQF A;  2F5D A;  3VOE A;  3V7S A;  5LD2 C;  1W5C C;  2IAI A;  2EA4 A;  1HCR A;  2E34 A;  2Y9Y A;  3F6O A;  1R1U A;  4V2F A;  3FXR A;  2EBI A;  1XMK A;  2HPI A;  1Z7U A;  4HV5 A;  5KAF C;  3GTM J;  2D1V A;  1OCR H;  1SD4 A;  5F1J A;  5GTI C;  1GDT A;  1ZRF A;  1RET A;  3PSI A;  4NHJ A;  3SFI A;  4RB0 A;  1SC7 A;  4S0H B;  5H2F C;  1EJ9 A;  1G6N A;  3QPH A;  1B72 B;  2LK2 A;  1QQI A;  2VN2 A;  1ETK A;  2XUB A;  1I3Q J;  5GAH J;  4EJU A;  4CYC A;  4CO8 A;  4RDU A;  1XSX A;  2X0L A;  2KDO A;  2YR2 A;  3QOE A;  1ONV A;  1Z3X A;  3BCA A;  4BEH A;  4KFC A;  1K61 A;  3CF2 A;  2Q1Z B;  2IGM A;  2ID3 A;  1KQ0 A;  2QYO A;  4XNF A;  1KGS A;  1IUF A;  2A3S A;  1UHW A;  2CV1 A;  4BQQ A;  4PGG A;  1LE8 B;  1YLF A;  2A07 F;  2K9M A;  2OTL I;  3KX2 A;  4ITV A;  1S8N A;  1YIT I;  2VL8 A;  1Y0U A;  5M5Y J;  3C3W A;  2NVY J;  3REO A;  5L3C A;  1R58 A;  5C4X J;  2ELH A;  5DM6 F;  2IA2 A;  2H09 A;  1FYK A;  4UUS A;  3J7Y J;  3ZOB A;  2C6Y A;  4B8X A;  5ICG A;  1B59 A;  3WGI A;  1V3F A;  1IG7 A;  3OR2 C;  3V7R A;  1CF7 B;  2M30 A;  3GZ6 A;  2I10 A;  1VZ0 A;  2KIS A;  5FD6 A;  1FSH A;  4OIN F;  2W82 A;  3NRV A;  1OR7 C;  2ECB A;  2CQK A;  2KT0 A;  3ESW B;  5ILV A;  4ZYD A;  3DPL C;  3K4C A;  3IAS 2;  1Y8R B;  2FOK A;  2MFZ A;  4M6X A;  4V2G A;  4UV8 A;  1MBG A;  1I50 J;  2AS5 F;  2G7H A;  3FX3 A;  4J19 A;  1QVT A;  3RYP A;  3FXM A;  4CSW A;  3GUD A;  1J75 A;  2M4G A;  5HS9 A;  4EJO A;  5D6E A;  1IN6 A;  5TJJ A;  3KET A;  3KP2 A;  5LGN A;  2LVS A;  3C1D A;  3K2A A;  3HRM A;  1W5T A;  1TZL A;  2KRH A;  2QSF X;  2P5K A;  3H35 A;  3BRO A;  1Y1W J;  1IZ1 A;  2WTE A;  4XON A;  2K3P A;  2VON A;  1SFX A;  2VC0 A;  4RM3 A;  4XL9 A;  3ZN0 A;  2A6E F;  3EUA A;  4A3B J;  3BG7 A;  3DEU A;  2DOA A;  1X3W B;  3T5X A;  3AKZ A;  3I56 I;  2JA7 J;  4XKB A;  2CQ7 A;  3HHG A;  3CCL I;  3CF5 F;  1XDU A;  4II3 A;  2EWN A;  1EKE A;  3IKT A;  3CC4 I;  1GHC A;  5HLH A;  2XAS A;  5KAI C;  4QPO A;  3L7W A;  1AU7 A;  4JOM A;  3BTJ A;  2M5W A;  3CLQ A;  1PVE A;  5FLV A;  5AON A;  1MSF C;  1B4A A;  3FXO A;  2X6X A;  2ZJQ F;  1LEA A;  1ZLK A;  2K9L A;  2MG4 A;  4CGZ A;  2M0C A;  4DQ2 A;  1YW8 A;  2KZV A;  1XGO A;  1E3O C;  2UXX A;  4FCY A;  4N9H A;  2OUM A;  2EZK A;  3S16 J;  4DYC A;  3L2W A;  1TT0 A;  3L00 A;  4NB5 A;  2HZT A;  2O3F A;  1JKP C;  1R71 A;  5F0F A;  2XAQ A;  2FOW A;  3CCS I;  3IKV A;  1P92 A;  4BYY A;  4RGU A;  4ZDP A;  3BJO A;  2JPC A;  1SMY F;  1MGT A;  4IHW A;  2ELK A;  1I27 A;  3QYB A;  2W00 A;  2CGP A;  3HB9 A;  1D1C A;  3SZP A;  3PO2 J;  5IP9 J;  2MA3 A;  1YW9 A;  2ISZ A;  4D5C A;  3KP5 A;  2JA5 J;  3L2U A;  2QKM B;  3CCV I;  3M4O J;  1Y8Q B;  1FEX A;  5J4V A;  1XTA A;  1USS A;  4HST A;  4XMY A;  6PAX A;  3MD2 A;  3K4B A;  2HQ5 A;  3TO9 A;  3OYA A;  2XC7 A;  3BJ6 A;  2DTZ A;  3K1P A;  3V42 A;  1NHA A;  1R5G A;  4ZYG A;  4HQE A;  3JW4 A;  3BR6 A;  1HSJ A;  4YEJ A;  3A1Y A;  1T08 B;  4UVA A;  2HVR A;  4XRF A;  5HDG A;  1LFB A;  3JAM K;  1R5I D;  3RQ4 A;  4XK4 A;  2DFI A;  2I5U A;  3GLX A;  3PFY A;  4KN7 X;  2CRG A;  1SFK A;  1HF0 A;  4KYW A;  5K7Z A;  1OIS A;  2W1O A;  3ABT A;  3VB2 A;  2K9S A;  4OWR B;  3OYL A;  4BY7 J; 
#chains in the Genus database with same CATH homology
 4E7Z A;  2R7T A;  4HPQ A;  4CCJ A;  4NC7 A;  4NUB A;  4BUP A;  3OYH A;  3D5R C;  2R7O A;  5HOO A;  3CMM A;  4CUG A;  3DKX A;  4RMN A;  2IS2 A;  1DP3 A;  3LFU A;  4IKF A;  3OR1 C;  4NC8 A;  4D9J A;  4PJN A;  2HQA A;  5KHD A;  2LG4 A;  4XOP A;  4RLF A;  2VJI A;  1MMD A;  2KPM A;  1X19 A;  2CV2 A;  2L9N A;  2BW3 B;  4XOR A;  3A4C A;  2BOL A;  3TMO A;  4RLQ A;  2CUJ A;  3C2H A;  3DPT A;  5JHF A;  2L7K A;  2KP6 A;  2CV0 A;  4NQW B;  2WAF A;  3HXL A;  3K4M A;  4BGD A;  3EUH C;  2V26 A;  4E7L A;  3FHN A;  3ZRG A;  4U7B A;  3KEY A;  3DTE A;  3DU6 A;  3I9V 2;  5TGT A;  2V6E A;  2VQH A;  1BR1 A;  2KRC A;  1BR4 A;  4P5O A;  3PNT A;  3UNG C;  3C2G A;  2WY7 Q;  4XN3 A;  2CUZ A;  4XR6 A;  4P1W A;  1LVK A;  3BC8 A;  4J01 A;  4BEH B;  4IZZ A;  3K4N A;  3OY9 A;  4HSR A;  4ZC3 A;  1WJ5 A;  3M1C A;  3HUG B;  2IXS A;  2LBF B;  1W36 D;  4BS9 A;  3FDY A;  2BVL A;  4E7H A;  2IS1 A;  4LIU A;  3HL2 A;  4HG2 A;  2OV7 A;  3OOU A;  2Z16 A;  3CES A;  4BDY A;  1V5E A;  2IGN A;  4BDZ A;  2K5C A;  1G8X A;  1ZEL A;  2E5N A;  3SEQ A;  3D5S C;  2KQR A;  2VIX A;  2M4K A;  3I3L A;  3K6G A;  2Z1D A;  4N4N B;  3G2B A;  4PSW A;  2ZSH B;  1X1B A;  3IP4 B;  2HU9 A;  4EAT A;  1UAA A;  2R7S A;  2XAU A;  2X85 A;  2MYS A;  4HNU A;  2E1M B;  2DT6 A;  3VYS B;  2LRE A;  4BXF A;  3K70 D;  2X6Y A;  2KHM A;  4XOT A;  1D0Y A;  4CCM A;  2MD0 A;  1LKX A;  1D0Z A;  1X1A A;  2W7N A;  2I8D A;  3S3O A;  2UUZ A;  3DTK A;  3NWS A;  4X0G A;  3OL4 A;  2AQE A;  4MLO A;  3S32 A;  4PJL A;  2ZSI B;  1WJA A;  2CMP A;  1PJR A;  3L2V A;  2M0M A;  4ZYA A;  1HA8 A;  2MAB A;  4R79 A;  2VJ4 A;  2RQQ A;  3IAM 2;  4Y33 A;  5CQE A;  1UG0 A;  3OYN A;  4LG3 A;  1G59 A;  2M7A A;  5CKT A;  2BVM A;  2R7X A;  2JUG A;  1W36 C;  5KCM A;  2UV1 A;  4B3X A;  1WJC A;  2LOO A;  3BG6 A;  4F52 A;  1LDK B;  2V4J C;  4FAS D;  4XLA A;  2E1M C;  3K4L A;  2WBM A;  5HVQ C;  5KNL A;  1IRX A;  3PJR A;  2A5W A;  2AQF A;  2W4S A;  3TBI A;  3H5N A;  1Z3Y A;  3QYF A;  2NOJ B;  4IQ4 A;  3DU5 A;  5LFA A;  1YX5 A;  3DPU A;  2VXZ A;  3OYE A;  4PK4 A;  3K4K A;  1ERD A;  3K70 C;  2R7R A;  2WB1 A;  2VQC A;  1Z7L A;  1X4O A;  4BQO A;  2LYC A;  4BU2 A;  4D1Q A;  4CH7 A;  3AFH A;  3HC7 A;  1MMN A;  3OS2 A;  2E5Z A;  1BOB A;  2L5Q A;  3OL3 A;  3LSH A;  3K4J A;  1JI8 A;  2GOX B;  3S8P A;  1N78 A;  3BCB A;  3NWT A;  2HZD A;  2X1C A;  4C2T A;  1X1C A;  4B43 A;  1E0E A;  3MKY B;  4E7J A;  4YEL A;  2PJR A;  5HNH A;  1D1B A;  3PL8 A;  3U21 A;  1EA3 A;  3LSG A;  4ZTJ A;  3HOS A;  5CQG A;  3DEE A;  3ZXS A;  3M8J A;  3OYD A;  4HNT A;  4YRV A;  2HDW A;  3LMM A;  4BE1 A;  1QHH D;  2L2O A;  1D0X A;  3DTI A;  4DOZ A;  4PJJ A;  4BQN A;  4XKV A;  3OYJ A;  4E7S A;  3ONQ A;  4KIS A;  2JSP A;  4ANJ A;  3E1S A;  3IUO A;  4GRI A;  1MW7 A;  2IGO A;  1U0J A;  3CP8 A;  2HPM A;  2HVQ A;  3D5L A;  3SZG A;  4CCL A;  1X4P A;  3S3N A;  3EPZ A;  2VB6 A;  4NNJ A;  3PNY A;  4PFO A;  2IS6 A;  3SDB A;  1PYV A;  3H5R A;  3OIQ A;  4DBQ A;  4XLF A;  2WY8 Q;  3EUK L;  3DQV C;  2CW8 A;  2V9K A;  1T95 A;  3HOT A;  4BAC A;  3OYB A;  4F92 B;  1DQU A;  4BE2 A;  3LSM A;  2F6C A;  3FBI B;  4XKW A;  2R7W A;  2JVH A;  2R7Q A;  2X1D A;  1Y56 A;  3ZR8 X;  2O5R A;  4AU7 A;  1DGW Y;  3FBN B;  2CS3 A;  5FRO A;  1R6R A;  4E6K G;  3S3M A;  4XLH A;  4ZDO A;  3L2R A;  1LFP A;  3RTR A;  1MNE A;  4PUS A;  4J00 A;  3VYT B;  3J7A Y;  3DWL E;  2LY2 A;  4JQF A;  2BW3 A;  2V7F A;  4RM2 A;  5LD2 C;  3OS0 A;  2QKL B;  3QYE A;  1YE9 A;  5FRN A;  4B44 A;  3AL0 B;  1N77 A;  5FRM A;  2XF7 A;  1QHG A;  2WAQ A;  2HVS A;  2HPI A;  3K10 A;  2VLA A;  2ZFU A;  3CP2 A;  3QOD A;  3W2A A;  1S9H A;  3PSI A;  3BLY A;  3HKZ A;  3H9J A;  3OYF A;  4F3Q A;  4XKC A;  2VJJ A;  1UEL B;  1Y6I A;  3OYL A;  1WFX A;  2ZXH A;  2A6T A;  2GOM A;  3OS1 A;  2HNH A;  4DIQ A;  3H0D A;  2R4G A;  2RRE A;  3SEZ A;  2XF5 A;  4DBR A;  2Q2E B;  3VWB A;  2KLO A;  2E60 A;  4CCK A;  2MC4 A;  1OLT A;  2X6W A;  2X1E A;  3H9G A;  3OYC A;  4F93 B;  2KDO A;  1WJD A;  3QOE A;  2CW7 A;  4B47 A;  1Z3X A;  3BCA A;  4IQJ A;  4BEH A;  2RNG A;  3W3C A;  2Q1Z B;  1NG7 A;  2IGM A;  3CF2 A;  2ZXI A;  4C9Y A;  1QU3 A;  4E7K A;  2WA0 A;  4XNF A;  3HG9 A;  4F55 A;  2KMU A;  2LBF A;  2CV1 A;  4BQQ A;  3AL0 C;  1GLN A;  2LH9 A;  2K9M A;  2FUG 2;  3KYL A;  3ZCO A;  2WAE A;  4XLE A;  3KX2 A;  4ITV A;  2VL8 A;  3MKW B;  1T0F C;  2PMZ A;  1YX3 A;  3CZ6 A;  3FKJ A;  5CPR B;  2VQL A;  2IGK A;  3RCO A;  3E0J B;  4BJ6 C;  4LIT A;  3VSL A;  4KIT B;  2VQG A;  4QPQ A;  4B48 A;  1BR2 A;  1DGR M;  3UR3 C;  3OR2 C;  4ZDL A;  3RSN A;  4E4H A;  1VZ0 A;  3PNV A;  3OYM A;  4BE0 A;  1J09 A;  3VDX A;  2W82 A;  1OR7 C;  2VXD A;  2WAD A;  1MMG A;  1KON A;  3MMY B;  3N05 A;  1MND A;  3DPL C;  4HRI A;  3K4C A;  3VYR B;  2VKD A;  3IAS 2;  2MFZ A;  1K6Y A;  3LSK A;  4CA0 A;  2LRD A;  2CFO A;  4F91 B;  2V1N A;  4CSW A;  4C30 A;  2M4G A;  4Y4R A;  1Z21 A;  2DXI A;  4II2 A;  2XDV A;  2JVG A;  1TZL A;  4PFP A;  2KRH A;  3OMY A;  3H35 A;  3W2W A;  2VPL A;  4XON A;  1FMW A;  3GBG A;  2ELJ A;  2K3P A;  3VSK A;  4RM3 A;  4XL9 A;  1FMV A;  3EUA A;  3BG7 A;  2DOA A;  3AKZ A;  4E7I A;  5HLT A;  4N4O B;  3H5A A;  3LSI A;  4XKB A;  3HPG A;  2M7B A;  2DJI A;  4FET A;  4II3 A;  4CCO A;  3OWT A;  2R7V A;  3DLA A;  2UWM A;  4XN0 A;  4QPO A;  2Z2S B;  3TL4 X;  4JOM A;  4DGW B;  3SYT A;  1NG6 A;  4C2U A;  3ZQQ A;  4PSX A;  2VAS A;  2X6X A;  2M3A A;  2CH0 A;  2K9L A;  3S93 A;  1N75 A;  2KZV A;  5HNF A;  3MKZ A;  2DT7 B;  2DCE A;  2OUM A;  2XF6 A;  3LL7 A;  3RPU D;  3F9K A;  3HPH A;  3L2W A;  3OIP A;  3OYI A;  1TT0 A;  3L2Q A;  4XLC A;  1X1D A;  3H9Q A;  3CJQ B;  1WJE A;  3CJR B;  4ZDP A;  1V5F A;  3OYG A;  4BJ5 C;  4XQF A;  3QYB A;  2W00 A;  1D1C A;  4AVZ A;  2P0W A;  2F4I A;  1D1A A;  2VKH A;  2PJR B;  4HEA 2;  1WJB A;  3A2K A;  4OAY A;  4CZC A;  3L2U A;  2QKM B;  2L9S A;  4U87 A;  4CCN A;  2XSJ C;  4XM3 A;  4BL0 B;  1SAU A;  4HST A;  1V5G A;  4XMY A;  1WJF A;  3MD2 A;  3K4B A;  3OYA A;  2F5V A;  2XC7 A;  3V42 A;  4H4K C;  2VJ5 A;  4ZJZ A;  4Y3O A;  2KL4 A;  4DJA A;  3VYU B;  4YEJ A;  4KJZ A;  4ZTF A;  3A1Y A;  2LC2 A;  4G6T B;  2OC6 A;  2HVR A;  1AA7 A;  3RQ4 A;  3ZGK A;  4BJT A;  4KT6 A;  2JA2 A;  3DKY A;  3PFY A;  4LIV A;  3PSF A;  1MMA A;  1P9Q C;  1SFK A;  2X51 A;  3OYK A;  3W2V A;  4OAZ A;  4IX7 A;  2IS4 A;  2W1O A;  2Y0S A;  2R7U A;  4OWR B;  4AYB A;  3PUB A;  2LY1 A;  4PJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...