3E0JB

X-ray structure of the complex of regulatory subunits of human dna polymerase delta
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
143
Chain Sequence
ADQLYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVTYLVSGSLIQNGHSCHKVAVVREDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYDILKSNLQNCSKFSAIQCAAAVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase subunit delta-2
publication title X-ray structure of the complex of regulatory subunits of human DNA polymerase delta.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 41
structure length 143
sequence length 143
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3e0jB00
3E0JB
chains in the Genus database with same CATH superfamily
2M0CA 3B02A 2DMTA 3A4CA 2LRDA 3WTTC 2MD0A 2IVMA 2XHKA 2ZJ2A 3CUQB 3HKZA 1XX5A 2LKPA 4AWXB 2KRHA 4C3IJ 3HL2A 4U7DA 1XS9A 2PMZN 3MEXA 3ZMDA 1H8AC 1E3OC 4UUVA 3LFKA 1STZA 1O7FA 1VZ0A 2GAUA 2L9SA 4PCQA 5KAIC 2VT2A 1PYVA 4BJ5C 2L3DA 2HQNA 4YIFA 2XC7A 1MNMC 3H5AA 1V54H 2I8DA 2V6CA 1TT0A 2DFEA 3GUDA 3CJRB 3RYRA 2LFBA 2IGMA 3OS0A 1MDMA 4HDUA 4GDFA 2M4KA 5HOOA 3E3VA 2R0QC 1AWCA 1JUSA 1F1ZA 4ETSA 2P81A 5ERIA 3NQOA 4E7ZA 2VE9A 1JTXA 1PP8F 4ESJA 1B8IB 1LJ9A 3Q0WA 3MFKA 1OCCH 4FHTA 1DGRM 3L2WA 2XGXA 2X1EA 4P96A 3PM1A 3WODF 1MJBA 1TTYA 1USTA 4XK4A 2B63J 4Q4ZF 2PJRB 2HZTA 3I0TA 5E3LA 4KA4A 1H9GA 1TQIA 4UNOA 2FX0A 1DU0A 5HDKA 4G6DA 3KEQA 1SVLA 5J4YA 1UHMA 2IPQX 3GLXA 5GTIC 2VODA 5DV5A 3DTKA 5EJCA 4HV6A 4R8HA 3GXOA 1I1SA 3ZMUA 2XB5A 3H0GJ 3LOCA 2JPBA 3K0LA 3OOPA 2WB1N 1JGGA 3VYUB 2DFFA 3FHZA 4CGZA 4N9HA 4MQVA 3A2KA 3GFLA 1UAAA 2GQQA 1BJZA 3DQVC 1W5TA 2RQPA 1IRZA 3TP3A 3ABMH 2O7OA 2EZLA 2CGPA 2VJIA 3WTZA 2VQCA 1W7PA 4YELA 3QU3A 4C2MJ 4DZJA 1EJ9A 1W5CC 1SFKA 4ANJA 3SZPA 3BTLA 3DU6A 2H94A 1XTAA 1HKQA 1R22A 4BJTA 3TMOA 4XBFA 3GEZA 3R61A 3CUOA 1FSHA 4N4NB 4MO7A 3ELKA 5H6RA 1MMSA 4ZC3A 2X0LA 5E1WA 3QQAA 5DEQA 4CA0A 1D1CA 4QLCU 3SFIA 4EEFG 3P9CA 5FLMJ 3KP3A 3PFIA 2ICWG 4I02A 2A69F 3CCEI 4JOMA 2VXDA 5CKTA 3IL2A 2NRAC 3IKVA 3W3CA 4V19K 1S7AA 3V8KA 2DA5A 3HB9A 2L4MA 1OCZH 1W36C 3K1PA 3K10A 1C0WA 3FMQA 3RKWA 3VEPA 4ENNA 1Y6IA 1G3SA 1I50J 1Y1WJ 2P6SA 2PMHA 2GA2A 4I2OA 1YJ9I 3KZYA 1KONA 4PDKA 2GXGA 2JA7J 3TQNA 3V7SA 1JJ8C 1FC3A 2C6YA 1B1BA 3O3KA 3PQKA 4HPQA 5B3SH 5CVJA 2LF7A 5FLXK 2W57A 4Z2YA 3GZNB 3MVPA 5LGNA 3JRBA 3DXJF 1T38A 3G2BA 3CCVI 2QGUA 3FX3A 4G6QA 2QQ9A 2M4GA 2DFHA 2UXXA 1E3HA 3CCSI 2R7QA 3LSMA 1U3EM 2HTJA 1B9MA 1P7JA 1R1VA 4MFEA 5M5YJ 3F23A 2VC1A 5GPAA 3GTKJ 5EG0B 1D1AA 4M3BA 2P5LC 2JSPA 3K4MA 2LY1A 5F0HA 4NC8A 4BEHA 2B7EA 3F22A 1S8NA 3OYLA 4BBSJ 4CYDA 2XASA 5KHDA 3F21A 3K4CA 2JPCA 3BR3A 4BQAA 1J5YA 2W85A 3S8PA 2VXZA 4A0XA 1E0EA 4IJAA 1YX5A 1BR2A 5KVRA 3HG9A 4A3FJ 2QCOA 1LUJB 1ETWA 5D8KB 3LSGA 4MEXF 2FF4A 1W36D 3WTWC 2E1MC 1X4PA 1X19A 3OYGA 3HYIA 3CP8A 1LE8B 1X3WB 2HOEA 4LIVA 2YR2A 2JRMA 2M9HA 5B1BH 1RR8C 4F93B 5E3OA 2JVHA 4HW0A 3JRDA 5DM6F 2F5VA 1WCMJ 3Q9VA 1ZYRF 2VI6A 3OYKA 2GXBA 1TP4A 4ENMA 1MSFC 4ZJZA 2DN0A 3RQIA 1VQMI 2WY7Q 2LMDA 2Y9ZA 2OJED 4XM3A 1LPQA 4ZTJA 5TGTA 1A04A 3CJTB 5ILVA 3JAMK 3H0DA 1TWFJ 3HRSA 4A5MA 1A6QA 2IP2A 2ZFWA 1O3TA 2YX7A 4QIWN 3U21A 5GTHC 1MH4A 3I4NJ 2HZDA 2WC2A 4I0BA 3HRTA 3WG9A 4N9IA 3BR5A 1TZLA 2HPIA 3LL7A 4EJUA 1UFMA 3GTPJ 2RC4A 3LSJA 2R92J 4C9YA 2FQ4A 2KIMA 2XUBA 3I4PA 3F8FA 2L7KA 2L7ZA 5ICCA 3TO9A 4CZZA 2KISA 5LHGA 3GLLA 3S2WA 3DTIA 1OQYA 1F36A 2W24A 3S2HJ 1P9QC 1KZHA 2LBFA 3CMYA 1L3LA 2YU9J 1YYVA 2XF5A 4M73A 1XN7A 2R3SA 2NOJB 1T33A 3NAUA 1SMTA 2DDAA 2Y69H 3QPHA 4U88A 2W7NA 2Z2SB 1IV8A 1KU2A 2OV7A 3EDPA 1ZRFA 2K86A 2XAJA 4JYKA 5ED4A 5KCMA 2YSRA 3BZ6A 1R36A 3BQZA 2VOPA 3I5UA 4FASD 1F43A 4O6JA 1XMKA 1GVDA 2VPLA 1XSVA 5FFXA 1YRNB 3TO6A 3TKYA 3HM5A 4KN7X 5F6FA 2EV0A 1W0UA 2AHQA 2P4WA 1SFOJ 1PP7U 3EUAA 3JREA 2WWYA 4UUTA 1XDUA 1ULYA 3HOXJ 2H27A 1NHAA 2G7HA 2OCEA 4IL6C 4IKFA 4A5NA 1WH5A 5L3FA 4OMYA 3KZZA 3L00A 2LH9A 4M9XA 4BXUA 2QBYB 2NXNB 1UB9A 3QRFF 4ZDOA 4BQQA 3LQQA 1GDTA 3ML6A 4CCLA 3SJMA 3FK7A 2Q8KA 3ONQA 3CF2A 4OMZA 1WJFA 4EGZA 2V9VA 4PJ0C 3J81K 2R7OA 1WRJA 5FLVA 3DV8A 4U87A 2EFNA 2E36A 4FE7A 1IAWA 4HNTA 4QPOA 4DOZA 3P5JA 4FE4A 1UMQA 1ZHFA 1B72B 2HDDA 4F3QA 4KT5C 2KT0A 3KLOA 2E1NA 1OPCA 5A2QK 5IPAA 3HKZN 4MTDA 2XB0X 2ZMEA 3V8LA 3K2ZA 2RAEA 4N4OB 2HYJA 1IN5A 2CO5A 3ZCOA 4JK1X 3D5SC 2CRGA 2K9SA 4IPAA 4RB1A 1RIOH 2ME0A 3RQ4A 4KFCA 3LSIA 1WJ5A 1WJCA 5C4XJ 2ID3A 4EJVA 3KETA 3VSKA 2VPRA 2FNPA 2KKOA 2XV4S 2ZMEC 3J80Z 3L9FA 3MD2A 2B0LA 5CPRB 1MBEA 1WVRA 2QSFX 3S1MJ 4K2EA 2BV6A 1XGNA 1BN5A 2O8XA 5HNHA 4E7LA 3IAM2 3PJRA 3PO2J 2CFOA 2FOWA 2LG4A 4RM2A 1R23A 2BXYA 2MLKA 3L2UA 2MG4A 2IS1A 4IQ4A 2KIQA 2GIZA 2XPWA 4OAZA 5K5OA 5ICGA 2LYCA 1DGWY 5HDNA 1GVJA 4MTEA 4P9UA 2VLAA 5IOYA 1ZR2A 2CJJA 2XGDA 2Y75A 1Z7LA 2QENA 1ZG1A 3KEOA 5D5UB 1JE8A 4RMNA 2DK5A 4A0ZA 1O57A 2DMNA 3WGGA 2BGCA 3EQLF 3EYYA 1FBUA 4P9FA 4X0GA 3G1OA 4XIDA 2M45A 1FJLA 1FEXA 4XONA 2ZNZA 2GXAA 1YITI 1I5ZA 2P0WA 1YJNI 2DXIA 2LD5A 3WHBA 5DCMA 5DCFA 1R1UA 1Y56A 2K5CA 4XORA 2O3FA 1AOYA 3E6DA 3PNVA 1ON1A 3O8HA 3ZR8X 1R71A 2K02A 4HQEA 1RRJA 3CQZJ 1J09A 2R7VA 4GGGA 2LKSA 2VT3A 3K70C 3DWLE 3FM5A 4IHSA 2WAEA 2EA2A 2WV0A 1BC8C 3ZGKA 4CCOA 4D9JA 1HOMA 3L7WA 3ASNH 3OOUA 1U9OA 1YX3A 3K69A 4IZZA 2E2JJ 2QSGX 4LK1F 1S9HA 2QKLB 3VB2A 3DKXA 4FT8A 1OJLA 2L2OA 3N4MA 5D8LB 4Y17A 1VQ9I 2VJ5A 1F5TA 4HNUA 3I59A 2Y2ZA 3RPUA 2CQ7A 2ECBA 3I54A 4L9NA 1BA5A 3UKGA 4NDLA 2HU9A 4RDUA 3SDGA 4E6KG 2AQFA 4NUBA 1FP2A 4L5EA 2E1CA 3LWFA 3WE3A 2K9NA 3VYSB 2KRCA 1ZK8A 3RCOA 2HPMA 2RDPA 3H5RA 1FBQA 4IOCF 4CZCA 2FXAA 4D7NA 3DU5A 2UWMA 4II2A 2YX4A 4D7MA 4XKBA 4OIPF 2KJBA 4AYBN 3IKTA 1JJ6C 3JSOA 1VQ7I 2FUG2 5ICEA 2BY3A 1MDMB 5CVVA 1WKMA 2A3SA 1TWAJ 2ID6A 1W0TA 1R49A 5E79C 1R5GA 3M8EA 4DW6A 5JI6A 5D5WB 1S29A 4BAYA 5DUIA 4CYCA 2BY0A 3VWBA 3NRVA 4LMYA 3REOA 2Q2EA 3B73A 3R0AA 1EH8A 4XR6A 5D6FA 1USSA 2BOLA 2O8KA 3CESA 4HLXA 2EIJH 2E7XA 3SZGA 3WHCA 1EKEA 3FHNA 5K7ZA 2JUCA 1NK2P 4ZH4F 2FU4A 2XRLA 4MEYF 4U0YA 4X6AJ 1D1BA 2OUMA 2V7FA 2EV5A 3M8JA 2JN6A 4B8XA 3GTMJ 4RM3A 3QYBA 2EFWA 1K4TA 2HS5A 4M74A 3DBRB 4XL9A 2KPMA 3C7JA 4CUGA 1FMWA 4YFXF 3JRHA 1LEAA 3E97A 3S16J 1IF1A 2CS3A 1K78A 3K4NA 3JR9A 3V8JA 1LB2A 1Y8QB 2O03A 2QQAA 2W48A 3V7RA 1UCRA 3MZ8A 2XAUA 3A02A 4BH9A 4NHJA 3OYCA 1X1AA 3KLNA 4XRSG 4CCJA 3BG6A 1F4KA 1W7PB 1U5TA 2DA6A 3JTHA 3QWLA 1CF7B 1KQ9A 1U78A 1HF0A 3TO7A 4KYWA 4HF2A 4L9TA 2KIFA 5IT3A 1ACIA 4J19A 3K7AJ 2XF6A 1R5ID 2YUSA 2ZXHA 4UB6C 3VPRA 4RAYA 3DKYA 1U5TC 1TQMA 5DS9A 1IXCA 2JZYA 2MSYA 3VOEA 3F8NA 4YG2F 4A3DJ 4BKXA 3AAFA 1VQOI 4HZFA 4NC7A 5TJJA 1IV6A 2IA2A 1ZAOA 3R4KA 2DFIA 3S32A 3G71I 2R5ZA 2PN6A 3L09A 3GFIA 2O9LA 4EQQA 4M72A 5JLXA 1FYMA 1AKHB 2XAHA 3ERMA 4B4CA 3HJEA 3SEZA 3C3WA 4Y15A 3V4GA 1R4MB 1IDZA 1YW7A 5M5XJ 5IP6A 2DMQA 4E7HA 2JTVA 1QVTA 1Z6RA 1R6RA 2M7BA 2A6HF 1UZCA 2DK8A 4JP0A 1SD7A 2XDVA 3DEEA 3QPSA 3RYPA 3K1MA 4CXFA 4V2FA 2V9KA 1DP7P 2NOGA 3C2BA 5FO5A 4KIBA 4IHYA 3I58A 4L18B 4I01A 2K3PA 3M1CA 3WG7H 2ZJQF 5M3FJ 3FXLA 3SDBA 4KITB 1ZLJA 3MN2A 3BJAA 2L5QA 2ACJA 3P9KA 1YLFA 5E3MA 2DQLA 3LSTA 3M07A 4XN3A 1T8IA 1N78A 4A3GJ 1ERDA 3ECOA 3CCMI 2BXZA 2H1LA 3IWFA 1MMGA 3A01A 1IN4A 2IT0A 4IX7A 2VC0A 1XD7A 1FP1D 3A0BC 4L9VA 3ZQIA 1IRFA 2I10A 2L54A 2RN7A 1FYKA 1DUXC 3E6MA 5H20A 4PGHA 3DFGA 4BEHB 4WX9A 2Y31A 3DP7A 1ZRCA 3WE2A 2IA1A 1T98A 2F5FA 1ON2A 2CQXA 2HKOA 2Y0SA 3WTUC 3OYMA 4I0AA 4PGGA 2X51A 2N8GA 3OYDA 2DQRA 3OSGA 4L0ZB 3IH2A 1Z3XA 1IXSB 4U0WA 2BE5F 3OYFA 3CDHA 2BVLA 3DPUA 1T95A 4NNJA 4PSXA 2MH2A 1MIJA 4ON0A 1XG1A 3X2QH 4A12A 1HDDC 4UUSB 3CCJI 5JFRA 3DKWA 1V4RA 1A31A 2LKXA 4EGYA 3COAC 4C3JJ 1T39A 3D5LA 1YG2A 4DZPA 2X6XA 1MJ9A 3NEUA 4HOBA 1RUNA 4OWRB 2WBMA 1IGNA 3BR2A 4UXNA 4RAGA 1HW5A 2HKXA 4KUMA 2AS5F 2EFPA 3H9QA 1K61A 3H9GA 5JLWA 3AG4H 2X9DA 3DLLF 2ZXIA 1XCVA 2EK5A 3HOZJ 1FTTA 1R58A 5M5WJ 5DD8A 3RJPA 3HSRA 4KJZA 3OY9A 1ZG5A 2HDCA 4LG0B 4F55A 4HX7A 4AM3A 1W5SA 4FCYA 3I64A 2OBPA 2M30A 3RI4A 2RVCA 1QGPA 5LFAA 1TT5B 4MHGA 1NG7A 3BR0A 4PJNA 4CICA 2EV6A 3F8BA 3BT9A 2HTSA 2LLKA 3MKWB 1S72I 1LDKB 5HLTA 2LY2A 1WH7A 1Q1VA 3JRIA 2H8WA 3DEUA 1JGSA 1OCRH 3KP7A 4HLYA 2UZKA 4KDPA 1YOVB 2IS4A 4NQWA 3AFHA 1HC8A 5F0FA 1G3YA 3SFZA 4BUPA 5IYCJ 3ZQFA 1YW9A 4F7ZA 2WAQA 2KDZA 3ZQGA 2OD5A 2UXNA 5ILUA 2QLZA 3EPZA 4RB2C 2E60A 1YI2I 4U7BA 3IV5A 1LFBA 3OV8A 3Q3SA 4OU0A 1SD6A 4IF4A 3OR1C 1TW2A 2Z3YA 4HQMA 1QHGA 2JUGA 5J4VA 2Q0OA 4IRIA 3H5NA 2E1OA 4G7HF 2DT7B 2HDWA 4YIIA 2ISYA 2M87A 4EVIA 3HDDA 3QOPA 5JVTA 2E35A 2H6CA 4KICA 5J1RA 3HXLA 3FZVA 4AYBA 5L3BA 2QSHX 2AQEA 2KZVA 3QPTA 5K7HA 2IS2A 1ZQ3P 2JQ7A 3NARA 4E7SA 2CMPA 1O7LA 4KISA 2FQ3A 5EEAA 4AUXA 1JTYA 3NWSA 4PJJA 3K9TA 3G73A 3BCAA 1XGSA 4PK4A 3CC4I 5JVGF 3H92A 3A1YA 1HQCA 2O5RA 2HVRA 4ZZLA 4H4KC 1PUFA 4IQJA 4EATA 4XLEA 3BLYA 3QAHA 1D8JA 2STWA 2JRTA 1R00A 1LFUP 1A5JA 1ODDA 3D5RC 2NYXA 4JX6A 1FWZA 2E71A 3P7NA 1IRXA 1X3ZB 3GTJJ 5L3GA 3HRMA 1UHWA 1ZN2A 2QVOA 2VKVA 4LOCA 2ZFUA 1OYWA 1FIPA 3FISA 3MKYB 1P4XA 2V1NA 4I98B 3EUKL 4OIRF 3Q5FA 3OL3A 4GXOA 2VL8A 2O6GE 2FMLA 1SD5A 4AVZA 4BNCA 4QPQA 1PJRA 2KHMA 3CUQA 4A3BJ 2CQNA 3M3YJ 2XAQA 1Y39A 3LSHA 2JMWA 5L3DA 1FOWA 4JBAA 2QQBA 1UELB 3LNQA 2BY1A 2L0KA 3Q0UA 4H0EA 4M3DA 2L02A 3CUQC 3ZMTA 4IVNA 2IW5A 1ZTRA 3TP0A 5J47A 4RA2A 2OAZA 1JT6A 2ZNYA 3BROA 1X58A 3A03A 1X1BA 2AXTC 2VKDA 1BBYA 1WZ2A 2KRFA 1I39A 4YFKF 2MLGA 4DYRA 5D4RA 1EV7A 2CSOA 1XGOA 1D0ZA 1WGXA 4HSTA 1RI7A 4KMUX 5TISC 4LB5A 1U6GA 1ZELA 2DT6A 2LREA 2RGVA 1YFHA 3AL0C 1FSEA 2PJRA 3FWEA 4DYQA 2EZKA 3TDZC 1K4SA 2EPFA 4ZDPA 1VQKI 2WADA 4D1QA 1G6NA 1FOKA 2A61A 2K9LA 4LIUA 2GA1A 2Y0MA 5DCMB 4ZYHA 3OSFA 2JSCA 5HLGA 3PFYA 2E19A 1FYLA 2FD5A 3M4OJ 1BOBA 2HVQA 2M3AA 1B6AA 5AONA 3PNYA 2H1KA 1ETVA 4BS9A 5C3EJ 3O6BB 1IO2A 4ESFA 1OYYA 6PAXA 1CQTA 3EETA 4IHWA 4UVBA 1ENHA 1ZARA 1I27A 3HUGB 4DNCA 5E3NA 4EMSA 1YIOA 1SFEA 1O3RA 4LGWA 5IOZA 1U8BA 3QPLA 2DDBA 2HXIA 4HF0A 5L3EA 3BR1A 2IAIA 1BOAA 4Q47A 4UY8I 3GFMA 3K6GA 3W2AA 3OYEA 3N05A 1BC7C 4J01A 3CTAA 4DQ2A 4DGWB 3HOVJ 2WAFA 1U2WA 3AG3H 4C3HJ 2HVSA 3I59B 2HWVA 4I7HA 4Y52J 2ELHA 4I6ZA 2XF7A 1I6XA 2BEOA 1TWGJ 4BY1J 4ZZDA 3G1LA 1JT0A 2W82A 1YS6A 4XRSA 2EINH 3KE2A 4XMYA 2ZSIB 3FM3A 3ZQQA 3WTXC 4LFUA 1IXRC 2LR8A 2P8TA 3CZ6A 1H89C 4J00A 2W4SA 2IJLA 1R4NB 2VKEA 4HG2A 3MMYB 5LD2C 3GCMA 3FBIB 2JVGA 4M3EA 1FOYA 3F0CA 3G4SI 3OMYA 3M7GA 2Z99A 3QP5A 1D5YA 3TGNA 3RZDJ 2BBYA 2DAOA 2ZB9A 3BG9A 2XROA 3HGYA 4WXCA 4D5FA 4CYCB 3BY6A 1HA8A 1U9NA 1S6LA 2Q2EB 3HIFA 4ENKA 5FFZA 2F4IA 2ZBKA 1FT9A 3BC8A 3D0SA 3OR2C 4LK0F 5KK1A 2P5VA 2TDXA 1V5EA 2HR3A 3J80K 3CMAI 5C4JJ 3I3LA 4B3XA 4RGSA 1G4DA 2DOAA 1SAUA 4C2UA 4MLOA 3PL8A 2COMA 4V2GA 5HDGA 1K7AA 1DDNA 3GF2A 3CC7I 2FSWA 1DPRA 3V7CA 2MA3A 5CJ9A 2E5ZA 3KP2A 3M8FA 1DU6A 2P7VB 2BVMA 1XGMA 3OIOA 2LF8A 2E2IJ 5J40A 2X48A 1G2HA 5IT9Z 2PLYA 4GYGA 4B44A 3FMSA 2X1DA 3KP6A 2DLLA 2XGEA 3BJ6A 2LSOA 1K78B 4BE2A 2DA3A 3W6KB 1RKTA 4AIDA 3WTVC 2PX9A 2Y0SN 3S93A 2KFDA 1HSTA 4NBQA 5M3MJ 2XIGA 1VQPI 2R7DA 3ZN0A 1M1EB 3S2DJ 3VFZA 3ESWB 1ZKGA 3G3ZA 1JXSA 1A6IA 3HOSA 2VE8A 4IRHA 2R5YA 4BE1A 3OYNA 3FXOA 3IAS2 1B59A 5EZGA 2DCEA 2ELKA 5FKLA 4S0HB 1YTYA 2MW8A 2LNBA 3FK6A 1AHDP 2HQ5A 3TOAA 3OYAA 2MYSA 3T0YA 5BNGA 2JJ7A 2DMUA 2KL4A 2EIKH 3HSFA 4HYEA 4WK8F 1ZH5A 2FJ1A 4D0PA 2TCTA 4D5CA 3F8MA 3MQ0A 2QA4I 3H36A 4IHVA 2M8EA 2NS8A 1UHSA 5FB2A 4GYIA 5J6XA 3PNTA 2D5VA 2CW7A 2PJPA 2FE3A 2K9QA 1X2MA 4HX4A 1WI3A 3C18A 5LEJA 3DPTA 2PFBA 1N75A 4ZDLA 4IHTA 1UJ8A 1U0JA 3BJOA 1RPWA 1WPKA 2XRNA 1JUMA 4ENJA 2EBIA 2STTA 1EH6A 1EH7A 1L0OC 4QSHA 1XPXA 4BQNA 1YJWI 2EZHA 1MD0A 1X1DA 4ZYGA 4BXFA 1NH3A 2DO7A 5GPCA 1FPQA 3RKXA 3IP4B 5K5QA 1JKPC 2ELJA 2WAQN 3C2HA 3CDLA 2DA2A 3FMRA 4WXDA 1OYIA 3KEYA 2ZXWH 5DDGA 5EYRA 1BI0A 3GZ6A 2EIMH 1WI9A 2DBBA 2CQQA 1ORKA 3H35A 3OWTA 4EJWA 2H8RA 4L0YB 1KQ8A 1IG7A 3W2VA 2GZWA 2KP6A 1P4WA 5F64A 1J0RA 4XOPA 3JRAA 5F0CA 4W1UA 2XKOA 2R7TA 1P6RA 2HGCA 3ABTA 2HOSA 4HNVA 1ZGJA 2CUFA 1Y0UA 1YRNA 4HV5A 2X6OA 1BR1A 4BDZA 2P6TA 3OIPA 3UR3C 2F4MB 3OYBA 4P1WA 3F72A 3O8GA 4XLAA 2CG4A 3S1RJ 3PQJA 1TNTA 4EJTA 3S1NJ 2DA7A 1FIAA 1GV2A 2OQGA 1FOXA 3G6EI 3BPVA 4MQ9F 5F1RA 3T8RA 2GWRA 3CD6I 3CO7C 2HQAA 2X6YA 4ASNA 5FD6A 3OYHA 3OYJA 3H3ZA 1BM9A 2PI0A 3GWZA 4PZJA 1SVOA 3L2CA 3BPXA 4C30A 3SXYA 1TQPA 1Z21A 3ROUA 5J1YA 4B48A 3GW2A 4LB6B 3OYIA 3PIOF 2DJNA 3KX2A 1J9IA 1QU3A 3CC2I 1J2XA 4XLNF 3LQRA 2ADUA 5GP9A 4KIGA 4HRIA 4XKVA 2OC6A 1BR4A 2GOMA 5LGUA 1MMAA 2F5CA 1HSJA 3BZKA 5D5VB 3AG2H 2BW3A 4I76A 2HYFA 5F04A 1B4AA 4XLPF 4RGUA 1I1GA 2KIUA 1GT0C 2CQKA 1YS7A 1QZEA 2V9PA 3KCCA 1JUPA 1K6YA 2L9RA 3LA3A 1MSEC 1DQUA 4O5VA 2FBKA 1QHHD 3I4MJ 1IN7A 4XLFA 2K40A 5B1AH 2Z16A 3FKIJ 1LFPA 1FNNA 4GO1A 5D6EA 5E18F 3S1QJ 3CDIA 4IEJA 2E5NA 2YPRA 3J7YJ 1X1CA 1SFXA 3BQYA 4MNUA 4XLCA 4M6XA 3ZOBA 2VJJA 2P7CB 1Z77A 3CCLI 3ZPLA 2EJRA 3PSIA 1AU7A 3BP8A 5B66C 4IO9F 3ASOH 3ZRGA 4Z6YA 2PQ8A 5K5RA 2OF7A 1T0FC 2HI3A 4I09A 9ANTA 4DYCA 2CV1A 2VOOA 2R7UA 3DF8A 2XVCA 5KNLA 2G0EA 4L5JA 1YO5C 2O61A 3DEWA 2X6WA 1KQ0A 3BCBA 2RQQA 1MMDA 3CCYA 2L4AA 3I71A 1N77A 1Z0XA 1GXPA 1XMXA 2YS9A 3KYDB 4HAMA 3BZCA 5LRRA 1WFXA 1TL8A 1JKQC 5JR3A 1J59A 2F6CA 4UVAA 4M9ZA 2D2WA 2A05A 3SQNA 5BMZA 2BZTA 2V1DA 2KQRA 1PUFB 3K4KA 1U8RA 2FA5A 1PUEE 2ZKZA 1R5HA 2BYVE 2DA4A 5BPIA 4CDGA 2K9MA 4RB3C 1VTNC 4CHUA 3HOWJ 1N25A 1QVUA 3OL4A 1ZREA 3GTLJ 1LQ1A 1O3SA 2Z33A 2ZJPF 5EEHA 2XPVA 1SD4A 2NVYJ 1QZYA 1RESA 4RLFA 1KU7A 2DODA 4IXAA 4BYYA 4KT6A 3CMEI 2IGKA 5D5XB 3JRCA 2E1MB 2L7MP 5H2FC 2EB7A 4A2UA 1JKOC 2VN2A 3MZHA 1RC9A 3WU0A 2ECCA 4BXXJ 1ZGWA 4XSZF 1TNSA 3CLOA 3TW7A 4G9YA 1TC3C 3WGIA 2LDUA 5BPDA 2XPUA 5IY5H 4FISA 4Q5SF 2LVSA 1T08B 5C44J 1WQ2A 2HYGD 1OR7A 3KP4A 1GLNA 3CF5F 2XSDC 1E3PA 2NVUB 4E7KA 1T6SA 2CUEA 1IN6A 3LAJA 1KYZA 4AVPA 4OOIA 5HVQC 2R93J 4GRIA 1XC5A 2K27A 2ESHA 4II3A 1OLTA 1LDJA 1GV5A 3J7ZI 2FMYA 5DM7F 4X1EA 1XDSA 3GBGA 1Z9CA 1OR7C 3N97A 2A5WA 2E34A 4BU2A 2DA1A 1J75A 4OIQF 3AL0B 3JRGA 1W1WE 3ABKH 4RAFA 2RKHA 3U1KA 3BG7A 2VBXA 4PJLA 4XNFA 2QEXI 4G7OF 3CJNA 4B3AA 4FQGA 1ZGAA 2KMUA 2MGQA 3K4LA 4XN0A 4XRMA 1J7KA 1X1PA 3WGHA 1X2NA 3QYFA 3GVAA 3J7AO 3FXJA 3LMMA 1BI3A 3EYIA 1I6HJ 3RTRA 3PO3J 4XKWA 3RZOJ 1A36A 2M2EA 1ONVA 3RPQA 2A07F 5HLIA 3BDDA 4E7JA 4HDVA 4Q48A 3GZ5A 2DPUA 2L9VA 4A3KJ 1S7OA 1AA7A 4S05A 1QNTA 4WCGA 4MFDA 4XRFA 3SHFA 1NTCA 3IWZA 5EF6A 1WJAA 2LBFB 3TL4X 4RGRA 4WXHA 1HCRA 3IRRA 3BG5A 4F92B 2F5EA 3KZIC 2KJCA 4RAZA 3ZQ7A 1FBSA 1VF9A 4AIKA 1MKMA 3HHHA 3RKYA 2ZSHB 1T2KA 3NWTA 2JA5J 1SMYF 1Q1HA 2EA4A 3IH3A 5E17F 2LTPA 2WTEA 3U1DA 5EDNA 5LGTA 2NAZA 1CF7A 2DPDA 1HKTA 5LRSA 1APLC 3T5XA 1OCPA 3CMMA 2GBYA 2CW8A 2JA8J 1I3QJ 2ZCWA 2IEKA 5J8FA 4QWQA 2K4JA 1SFUA 2X1CA 4A0YA 4I99C 1E2XA 4A3LJ 3QYEA 3HOUJ 5HS7A 1Z05A 4M3FA 3V42A 2OTJI 5IP9J 3L2QA 2CH0A 1FZPB 4DIQA 3CJQB 4BHPA 3MKLA 5EGOA 4MGRA 1OCOH 1LVAA 2FOKA 4ZYDA 2L9NA 4UV9A 4ZTFA 3SYTA 1AKHA 3GTOJ 2P5KA 3HSEA 2DT5A 1QBJA 2Z9OA 4FTHA 3IH4A 3M9AA 4M6YA 3W6JB 4KN4X 4U0VA 4AC0A 4BBRJ 2M34A 3L1PA 3QP6A 2LK2A 1JI8A 2OQRA 1D0XA 2GIVA 2RNGA 2XGCA 3MWMA 4OIOF 3ZMZA 4RBOA 1K79A 1KU9A 1RZ4A 2R7XA 2R7ZJ 1IUFA 5DUKA 1G8XA 3GX4X 5F08A 2DYRH 3DBLB 1TWHJ 4EM2A 2QZ8A 2ZMEB 5FKMA 2DOFA 4JX5A 5AIPA 3ZXSA 3K4JA 4JX4A 3CCRI 5GAGJ 1WJEA 5LHHA 2NVTJ 3QODA 3BTJA 4TV7A 3E5XA 3E7LA 2HOTA 3A0HC 3SEQA 2ME6A 3F9KA 4RS8A 5E1ZB 3CCUI 1IJWC 1W7PD 1YQAA 1LDDA 4UHTA 4B09A 2VUMJ 1Z91A 3UNGC 5FLXZ 3BWGA 1D0YA 3GO5A 3CO6C 1VQ4I 5J3LA 2V1XA 2QM3A 2YU3A 4E70A 1MJAA 3WU2C 4YEJA 2R4GA 4EM1A 1P92A 4IHXA 4LLGF 3KYLA 1BI1A 2OTLI 4A3CJ 4B43A 4DBQA 5LBQA 4QTRA 3MKZA 1NK3P 5DD4A 3PUBA 1OFCX 4BHCA 2MC4A 1IDYA 2RNJA 2VQHA 4DBRA 3Q0VA 2R5YB 4AU7A 1B8IA 1HDPA 4UUSA 3TOBA 1A35A 2XKPA 3IHUA 4A6DA 3FXUA 1E17A 2OU2A 1MGTA 3ECHA 1BL0A 4LG3A 1H88C 2H6BA 2CWEA 2NS7A 3SZTA 4NB5A 4LITA 2E7WA 1Z6TA 2Z5UA 4L9JA 3ZN1A 3WTSC 2QUFA 2Y30A 2H09A 4YRVA 5IYDJ 4A69C 2IS6A 1KU3A 5BOXA 2R7WA 1V55H 3KYCB 4FX0A 4YFNF 1SANA 5JHUA 2PG4A 4KIFA 2CW0F 1VQLI 1ZG3A 2LC2A 1P2FA 4XOTA 4JQFA 4LG0A 3OS2A 1TWCJ 2D1HA 2E2HJ 2MH9A 4ESBA 4F91B 1S5LC 4E7IA 2V6EA 1DPUA 2PMUA 3DPLC 1OMIA 2DYSH 3JAMZ 1V5FA 3HHGA 2BY2A 1V3FA 2I5UA 5GAHJ 1QA6A 1IUYA 2CU7A 3J7AY 1OISA 3LSPA 3I56I 2GOXB 2XAGA 3ABUA 4EV0A 2V1UA 2JA6J 5EEGA 1XMAA 2K3FA 4LLLA 1RETA 2L01A 4HBLA 1SVMA 1TW3A 3HPGA 5CQGA 4RGXA 3QU6A 2EFOA 2OPTA 3HC7A 2UUZA 3U9GA 4EJOA 1MMNA 1RKWA 4M6VA 3M1EA 1Z7UA 3HTUA 1G3WA 2DTZA 5HNFA 2PEXA 4HEA2 3F6OA 4YIRX 1R1TA 4M71A 1RUOA 3HRUA 1IZ1A 2V4JC 1MBJA 3GTGJ 2PMZA 3S3MA 2VKHA 1SAXA 2QYOA 2IBDA 1X3UA 5CYVA 3C2GA 2W25A 3E0JB 2VB6A 1ZRDA 4PSWA 2M0MA 4A3EJ 5E8GA 1XSXA 2Y48A 2QF7A 4OINF 1GHCA 5DYMA 2D1VA 5CVRA 4AIJA 1O3QA 4M9SA 1BJAA 3DTEA 1HBXG 3HOYJ 2M8GX 3I9V2 3HEFA 1BW6A 1FTZA 3FBNB 1YE9A 1H0MA 4XQFA 5J8CA 3ZQCA 2V79A 2TRTA 2QWWA 1Z1DA 2GLOA 2IGNA 1R9TJ 2CV2A 1GXQA 3H3UA 3FXRA 5E8IA 3E5QA 5IT9K 5LLQA 1WSUA 5JHFA 2AO9A 2VBYA 2Y9YA 4GFBA 1VQ6I 1MBHA 2VQGA 2DJIA 1VQ5I 3CP2A 1YW8A 5ICFA 3TBIA 3LSKA 3ERED 2G9WA 5FD5A 2DU9A 5D4SA 4HSRA 1WJDA 2XSJC 1MNEA 4PFPA 4CCNA 1YHQI 4BHBA 2EFQA 1D8KA 1NG6A 1VNDA 4S04A 4FX4A 3K4BA 5EG0A 5KAFC 5HS9A 2BHZA 4BY7J 1B9NA 2V26A 4ITVA 1K6OA 5FRNA 1V5GA 3HGGA 4UVCA 2BW3B 5TRDA 1W4MA 2WV1A 1F9NA 5EZHA 3J81Z 3S3NA 5IYBJ 1TLHB 4CH7A 1KA8A 3RKQA 3ZQLA 2ISZA 3W6VA 1BIBA 2WB1A 3KPHA 4R1HA 2OZUA 5FKKA 3EUHA 1Y8RB 2BHYA 3LA2A 2LOOA 1HKSA 2LP0A 2RREA 1LE8A 1CGPA 5FRMA 2DOEA 5CVIA 1JHFA 1KGSA 1ZLKA 1T56A 3OS1A 5A2QZ 1U5TB 2DI3A 2W1OA 1WJBA 3IRQA 4DJAA 1PVEA 4G8XA 5E1XA 2GM4A 3S17J 4RB0A 4HF1A 2UV1A 1Y0NA 1UG2A 4WF2A 1FX7A 1WHUA 3EUHC 4XICA 1PDNC 5HODA 4BE0A 3TDUC 3S3OA 1MW7A 3FIWA 1VQ8I 2WY8Q 4B1RA 1IW7F 3JW4A 3PUFA 3H3VK 1VQNI 5F27A 2CFXA 1MBFA 2VBZA 2VJ4A 3T1BA 5DTDA 4Y13A 1FY7A 5L3CA 2R5ZB 1EA3A 1S7EA 3FF5A 3L2VA 4M3GA 1ETOA 3ZP5A 1O4XA 3TW6A 3VYTB 2X85A 1H9TA 2K4BA 3I55I 1MBKA 2PBIA 4XKCA 2ZJRF 1OCTC 3ZQHA 2DTRA 5E20A 2OA4A 3GYHX 2ZXJA 1BI2A 1P4AA 3BTIA 4G94A 5J1UA 5GAEJ 1TBXA 3AKZA 1ETQA 2FRHA 1S3JA 4XSXF 2NVQJ 1D3YA 3ISPA 4BDYA 3HZJA 1WWXA 2MC3A 3S14J 3GFJA 3QOEA 4LD5A 5LHIA 3E5UA 3VODA 4BQOA 3FXQA 2HNHA 5K1YA 2MABA 3B6CA 3HUGA 3L2RA 1RR7A 4CSWA 1XSDA 2EQRA 3VYRB 1JHHA 1P7IA 2G7UA 3JTGA 2CUJA 2F2EA 2FEZA 2VQLA 3HPHA 2Z1DA 1IRGA 1G59A 2MFZA 1BW5A 4UB8C 3A01B 1ETXA 3S15J 3FXKA 1FMVA 2F48A 4HA8A 3KP5A 3HTSB 4HX8A 1HLVA 1MH3A 2ETHA 4A3MJ 2VBWA 3IC7A 2R7FA 3HOTA 4A93J 3U2RA 1D5VA 4C2TA 4ZYEA 3LSRA 2HQRA 2RV8A 2IXSA 3K1NA 3VSLA 4B47A 3E1SA 2OCCH 2EZIA 2A6EF 3B6AA 2J5PA 5AIQA 1QPIA 2A68F 3GMEA 3W2WA 5CLSA 3BOQA 3R60A 4P5OA 3E6CC 1XCBA 4Y33A 5FJ8J 1SC7A 4P55A 3WTYC 1XB4A 4XLHA 1JKRC 4G12A 5F1JA 3KIOA 2IA0A 1IN8A 2M7AA 2QBYA 3E6BA 3RDIA 1GUUA 2D45A 1VFCA 1MBGA 2A5YB 4CO8A 3O2PE 3HBLA 3F8CA 1LKXA 3ULQB 4CCKA 3VDXA 3FDYA 3P9IA 2L7FP 4G6TB 1LEBA 1QZZA 2J5OA 4F52A 3BR6A 4G7ZF 2KDOA 4IRGA 2CUZA 3C1DA 3K70D 4FETA 3BTCA 4KNYA 5FGMA 2CYYA 3ABLH 1B72A 1QPMA 2ESNA 4Y3OA 5LEKA 1Z67A 2FBHA 2VASA 4R79A 5FROA 2NNYA 3LA7A 2HOAA 3MAJA 2M5WA 2EILH 4N0BA 4Y4RA 4PJMA 3BG3A 1QRYA 1ETKA 4ABZA 3R0JA 1Z3YA 2A6TA 2M1BA 2ZO4A 5H6QA 3FXMA 2JK3A 4W97A 1LNWA 1OKRA 2F5DA 3IUOA 2JT1A 3F6VA 3JSPA 5BQTA 2O0YA 3MZYA 4A6EA 3ZMSA 4Y7NJ 3ZMVA 2JA2A 2MD5A 3FKJA 3OIQA 3TEDA 3KFWX 4A3IJ 4AIHA 4A3JJ 1EF4A 4NQWB 2R7SA 3RPUD 4KMFA 4AD9A 1FLIA 2OZ6A 1T0FA 2VIXA 3PSFA 4NC6A 5K7FA 5IP7J 4ZYAA 3PIPF 4CCMA 5B5EC 2KLOA 1HW1A 1QQIA 2WA0A 2FNAA 4RLQA 2W00A 1ETYA 5GADJ 2R7RA 2QQ8A 4BACA 2DW4A 1POGA 3MCZA 2B9SA 4O3MA 1KYWA 2IRFG 2DMPA 1QO0D 1YIJI 2FBIA 3H9JA 2ZC2A 1SEUA 5CQEA 3RIRA 1G3TA 2EWNA 2W84A 3DBHB 4PUSA 1DP3A 3CCQI 2NNNA 3T8TA 3H1CA 1ZR4A 4E4HA 3I53A 3JCUC 5HLHA 5FKOA 5HS8A 2Q1ZB 3JRFA 1MNDA 2XAFA 4LJZF 2JWTA 3K2AA 3Q9SA 5BS6A 1BIAA 3WU1B 2HXOA 2AXLA 3R6SA 1MZBA 1K83J 2NS0A 4BL0B 2K7LA 4BGDA 4WWCA 2HFHA 1HXDA 5EGOB 3DLAA 2X4HA 2VONA 3AG1H 2LY9A 5ILSA 3DCFA 2MBFA 4GCVA 1VI0A 3RSNA 4OAYA 4L5IA 1ITYA 3G1MA 4UV8A 1IC8A 1I3AA 2K85A 4PFOA 2HEOA 2KZGA 3F3XA 1RNLA 3LAPA 1R7JA 2COBA 2QKMB 5CVUA 1Y1VJ 2F4OB 4MIMA 1HW2A 5FKNA 3CLQA 3GTQJ 3LFUA 1UG0A 2CV0A 4BJ6C 1REPC 4LLNA 4IOAF 3D1NI 2IGOA 4EM0B 2EH3A 1X4OA 2NVXJ 1LVKA
chains in the Genus database with same CATH topology
3MMYB 5LD2C 1JI8A 3FBIB 3VYSB 3A4CA 2KRCA 2JVGA 1D0XA 2RNGA 3OMYA 3RCOA 2LRDA 2HPMA 3H5RA 2MD0A 4CZCA 3HKZA 3HL2A 2R7XA 2KRHA 1G8XA 3DU5A 2UWMA 4II2A 1HA8A 1VZ0A 4XKBA 2L9SA 2Q2EB 1PYVA 4BJ5C 2FUG2 3ZXSA 2XC7A 3K4JA 2F4IA 3BC8A 3OR2C 3H5AA 1V5EA 1WJEA 2I8DA 3I3LA 1TT0A 4B3XA 3QODA 4C2UA 2DOAA 1SAUA 3VWBA 4MLOA 3PL8A 3SEQA 3CJRB 3F9KA 4XR6A 2IGMA 3OS0A 2BOLA 2M4KA 3UNGC 3CESA 5HOOA 1D0YA 3SZGA 2E5ZA 3FHNA 4E7ZA 2BVMA 4YEJA 2R4GA 3KYLA 4B44A 1D1BA 2X1DA 2OUMA 2V7FA 4B43A 4DBQA 3MKZA 3M8JA 1DGRM 4BE2A 3L2WA 3PUBA 2MC4A 2X1EA 3S93A 2VQHA 4RM3A 4DBRA 3QYBA 4AU7A 4XL9A 2KPMA 4CUGA 2PJRB 1FMWA 2CS3A 3K4NA 4LG3A 3HOSA 4BE1A 3DTKA 3OYNA 3IAS2 4LITA 2DCEA 2XAUA 3OYCA 1X1AA 4YRVA 4CCJA 2MYSA 3OYAA 3BG6A 2IS6A 2R7WA 3VYUB 2KL4A 3A2KA 1UAAA 3DQVC 2LC2A 4XOTA 4JQFA 3OS2A 2XF6A 4F91B 4E7IA 2V6EA 2VJIA 2ZXHA 2VQCA 4YELA 3DPLC 3PNTA 1SFKA 4ANJA 2CW7A 3DKYA 1V5FA 3DPTA 3DU6A 4BJTA 3TMOA 3J7AY 1N75A 4NC7A 2GOXB 4N4NB 4ZDLA 3S32A 4ZC3A 1U0JA 4CA0A 1D1CA 3HPGA 5CQGA 3SEZA 4BQNA 3HC7A 2UUZA 4JOMA 1X1DA 2VXDA 5CKTA 1MMNA 4BXFA 4E7HA 3W3CA 5HNFA 1R6RA 3IP4B 2M7BA 4HEA2 2ELJA 3C2HA 2V4JC 1W36C 2PMZA 3S3MA 2VKHA 3KEYA 2XDVA 3DEEA 3K10A 3C2GA 2V9KA 3E0JB 2VB6A 1Y6IA 3H35A 2M0MA 4PSWA 3OWTA 3W2VA 1KONA 2K3PA 2KP6A 3M1CA 3SDBA 4KITB 2L5QA 4XOPA 3DTEA 3I9V2 4XN3A 1N78A 2R7TA 1ERDA 4HPQA 3FBNB 1YE9A 1MMGA 4XQFA 4IX7A 3G2BA 1BR1A 4BDZA 2IGNA 2CV2A 2M4GA 3OIPA 3UR3C 3OYBA 4P1WA 4XLAA 4BEHB 5JHFA 2R7QA 3LSMA 2VQGA 2DJIA 3CP2A 3TBIA 3LSKA 1D1AA 2Y0SA 3OYMA 2X51A 1WJDA 2XSJC 4HSRA 2JSPA 3K4MA 1MNEA 2LY1A 3OYDA 1Z3XA 4NC8A 2HQAA 2X6YA 4PFPA 4BEHA 4CCNA 3OYLA 3OYFA 3OYHA 3OYJA 2BVLA 1NG6A 3DPUA 5KHDA 1T95A 4NNJA 3K4CA 4PSXA 3S8PA 3K4BA 2VXZA 1E0EA 1YX5A 1BR2A 4C30A 3HG9A 1Z21A 4B48A 3LSGA 1W36D 3D5LA 2E1MC 1X4PA 2V26A 2X6XA 4ITVA 3OYIA 1X19A 1V5GA 3OYGA 3CP8A 5FRNA 2BW3B 3KX2A 4OWRB 2WBMA 1QU3A 4LIVA 3S3NA 4CH7A 2WB1A 4F93B 4HRIA 4XKVA 2JVHA 2OC6A 1BR4A 2GOMA 2LOOA 1MMAA 2RREA 2F5VA 3H9QA 2BW3A 3H9GA 5FRMA 3OYKA 2ZXIA 3OS1A 4ZJZA 2WY7Q 2W1OA 1WJBA 4DJAA 4XM3A 4ZTJA 5TGTA 3OY9A 4KJZA 2UV1A 3H0DA 3EUHC 1K6YA 4F55A 1DQUA 4BE0A 3U21A 1QHHD 3S3OA 2HZDA 1MW7A 4XLFA 2WY8Q 2Z16A 5LFAA 1LFPA 1TZLA 2HPIA 3LL7A 1NG7A 4PJNA 2E5NA 4C9YA 3MKWB 2VJ4A 1LDKB 5HLTA 2LY2A 1X1CA 2L7KA 1EA3A 3L2VA 4XLCA 2VJJA 2IS4A 3VYTB 2X85A 3AFHA 3PSIA 4BUPA 3ZRGA 4XKCA 2WAQA 1T0FC 3DTIA 2CV1A 2R7UA 1P9QC 3EPZA 2E60A 2LBFA 5KNLA 2XF5A 4U7BA 2NOJB 3AKZA 2X6WA 2W7NA 3BCBA 3OR1C 2Z2SB 2RQQA 4BDYA 1QHGA 2JUGA 2OV7A 1MMDA 1N77A 3H5NA 3QOEA 2DT7B 1WFXA 2HDWA 4BQOA 2HNHA 2MABA 2F6CA 5KCMA 3L2RA 4CSWA 3HXLA 4AYBA 3VYRB 2AQEA 2KZVA 2IS2A 2CUJA 2VQLA 4FASD 2KQRA 3HPHA 3K4KA 4E7SA 2Z1DA 2VPLA 2CMPA 4KISA 1G59A 2MFZA 3NWSA 2K9MA 4PJJA 3BCAA 4PK4A 1FMVA 3A1YA 2O5RA 2HVRA 3OL4A 3EUAA 4H4KC 4IQJA 4EATA 3HOTA 4XLEA 3BLYA 4C2TA 4RLFA 2IXSA 3D5RC 4IKFA 3VSLA 4KT6A 2IGKA 4B47A 3E1SA 1IRXA 2E1MB 2LH9A 3W2WA 4ZDOA 4BQQA 2ZFUA 4CCLA 4P5OA 3MKYB 4Y33A 3ONQA 3CF2A 2V1NA 1WJFA 4XLHA 3EUKL 3OL3A 2R7OA 2M7AA 4U87A 2VL8A 4AVZA 4HNTA 1LKXA 4QPOA 1PJRA 2KHMA 4QPQA 3VDXA 3FDYA 4CCKA 4DOZA 4G6TB 1GLNA 4F3QA 4F52A 2KDOA 2CUZA 4E7KA 3K70D 3LSHA 4FETA 5HVQC 4N4OB 4GRIA 1UELB 3ZCOA 4II3A 1OLTA 3D5SC 4Y3OA 2VASA 3RQ4A 3GBGA 1OR7C 3LSIA 4R79A 2A5WA 5FROA 1WJ5A 4BU2A 1WJCA 4Y4RA 3VSKA 3AL0B 3BG7A 3MD2A 4PJMA 1X1BA 4PJLA 4XNFA 5CPRB 2VKDA 2KMUA 3K4LA 1Z3YA 4XN0A 2A6TA 4E7LA 5HNHA 3PJRA 3IAM2 2CFOA 3QYFA 2LG4A 4RM2A 3IUOA 3LMMA 3L2UA 2IS1A 3RTRA 4IQ4A 4XKWA 1D0ZA 2JA2A 4OAZA 3FKJA 3OIQA 4HSTA 2LYCA 4E7JA 1DGWY 4NQWB 2R7SA 2VLAA 3RPUD 1ZELA 2DT6A 2VIXA 3PSFA 1Z7LA 2LREA 3AL0C 4ZYAA 4CCMA 2PJRA 1AA7A 4RMNA 2KLOA 2WA0A 4RLQA 4ZDPA 2W00A 2WADA 2R7RA 4D1QA 4BACA 1WJAA 2LBFB 2K9LA 3TL4X 4LIUA 4F92B 3PFYA 4X0GA 3H9JA 5CQEA 2ZSHB 3NWTA 4XONA 1BOBA 2HVQA 2M3AA 3PNYA 2P0WA 4BS9A 4PUSA 2DXIA 1DP3A 1Y56A 2K5CA 4E4HA 4XORA 3PNVA 3ZR8X 3HUGB 2Q1ZB 1MNDA 1J09A 2R7VA 3K70C 3CMMA 3DWLE 2CW8A 4BL0B 2WAEA 4BGDA 2X1CA 3DLAA 3QYEA 3K6GA 3ZGKA 4CCOA 3OYEA 3N05A 3W2AA 3V42A 4D9JA 4J01A 3OOUA 3L2QA 4DGWB 1YX3A 4IZZA 2WAFA 2CH0A 2HVSA 3RSNA 4DIQA 3CJQB 1S9HA 4OAYA 2QKLB 2XF7A 3DKXA 2L2OA 4PFOA 4ZTFA 2L9NA 2W82A 2QKMB 3SYTA 2VJ5A 4XMYA 2ZSIB 3ZQQA 3LFUA 4HNUA 1UG0A 2CV0A 4BJ6C 3CZ6A 2HU9A 4J00A 2W4SA 2IGOA 4E6KG 2AQFA 4NUBA 1X4OA 4HG2A 1LVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E0J B; 
#chains in the Genus database with same CATH topology
 2M0C A;  3B02 A;  2DMT A;  3A4C A;  2LRD A;  3WTT C;  2MD0 A;  2IVM A;  2XHK A;  2ZJ2 A;  3CUQ B;  3HKZ A;  1XX5 A;  2LKP A;  4AWX B;  2KRH A;  4C3I J;  3HL2 A;  4U7D A;  1XS9 A;  2PMZ N;  3MEX A;  3ZMD A;  1H8A C;  1E3O C;  4UUV A;  3LFK A;  1STZ A;  1O7F A;  1VZ0 A;  2GAU A;  2L9S A;  4PCQ A;  5KAI C;  2VT2 A;  1PYV A;  4BJ5 C;  2L3D A;  2HQN A;  4YIF A;  2XC7 A;  1MNM C;  3H5A A;  1V54 H;  2I8D A;  2V6C A;  1TT0 A;  2DFE A;  3GUD A;  3CJR B;  3RYR A;  2LFB A;  2IGM A;  3OS0 A;  1MDM A;  4HDU A;  4GDF A;  2M4K A;  5HOO A;  3E3V A;  2R0Q C;  1AWC A;  1JUS A;  1F1Z A;  4ETS A;  2P81 A;  5ERI A;  3NQO A;  4E7Z A;  2VE9 A;  1JTX A;  1PP8 F;  4ESJ A;  1B8I B;  1LJ9 A;  3Q0W A;  3MFK A;  1OCC H;  4FHT A;  1DGR M;  3L2W A;  2XGX A;  2X1E A;  4P96 A;  3PM1 A;  3WOD F;  1MJB A;  1TTY A;  1UST A;  4XK4 A;  2B63 J;  4Q4Z F;  2PJR B;  2HZT A;  3I0T A;  5E3L A;  4KA4 A;  1H9G A;  1TQI A;  4UNO A;  2FX0 A;  1DU0 A;  5HDK A;  4G6D A;  3KEQ A;  1SVL A;  5J4Y A;  1UHM A;  2IPQ X;  3GLX A;  5GTI C;  2VOD A;  5DV5 A;  3DTK A;  5EJC A;  4HV6 A;  4R8H A;  3GXO A;  1I1S A;  3ZMU A;  2XB5 A;  3H0G J;  3LOC A;  2JPB A;  3K0L A;  3OOP A;  2WB1 N;  1JGG A;  3VYU B;  2DFF A;  3FHZ A;  4CGZ A;  4N9H A;  4MQV A;  3A2K A;  3GFL A;  1UAA A;  2GQQ A;  1BJZ A;  3DQV C;  1W5T A;  2RQP A;  1IRZ A;  3TP3 A;  3ABM H;  2O7O A;  2EZL A;  2CGP A;  2VJI A;  3WTZ A;  2VQC A;  1W7P A;  4YEL A;  3QU3 A;  4C2M J;  4DZJ A;  1EJ9 A;  1W5C C;  1SFK A;  4ANJ A;  3SZP A;  3BTL A;  3DU6 A;  2H94 A;  1XTA A;  1HKQ A;  1R22 A;  4BJT A;  3TMO A;  4XBF A;  3GEZ A;  3R61 A;  3CUO A;  1FSH A;  4N4N B;  4MO7 A;  3ELK A;  5H6R A;  1MMS A;  4ZC3 A;  2X0L A;  5E1W A;  3QQA A;  5DEQ A;  4CA0 A;  1D1C A;  4QLC U;  3SFI A;  4EEF G;  3P9C A;  5FLM J;  3KP3 A;  3PFI A;  2ICW G;  4I02 A;  2A69 F;  3CCE I;  4JOM A;  2VXD A;  5CKT A;  3IL2 A;  2NRA C;  3IKV A;  3W3C A;  4V19 K;  1S7A A;  3V8K A;  2DA5 A;  3HB9 A;  2L4M A;  1OCZ H;  1W36 C;  3K1P A;  3K10 A;  1C0W A;  3FMQ A;  3RKW A;  3VEP A;  4ENN A;  1Y6I A;  1G3S A;  1I50 J;  1Y1W J;  2P6S A;  2PMH A;  2GA2 A;  4I2O A;  1YJ9 I;  3KZY A;  1KON A;  4PDK A;  2GXG A;  2JA7 J;  3TQN A;  3V7S A;  1JJ8 C;  1FC3 A;  2C6Y A;  1B1B A;  3O3K A;  3PQK A;  4HPQ A;  5B3S H;  5CVJ A;  2LF7 A;  5FLX K;  2W57 A;  4Z2Y A;  3GZN B;  3MVP A;  5LGN A;  3JRB A;  3DXJ F;  1T38 A;  3G2B A;  3CCV I;  2QGU A;  3FX3 A;  4G6Q A;  2QQ9 A;  2M4G A;  2DFH A;  2UXX A;  1E3H A;  3CCS I;  2R7Q A;  3LSM A;  1U3E M;  2HTJ A;  1B9M A;  1P7J A;  1R1V A;  4MFE A;  5M5Y J;  3F23 A;  2VC1 A;  5GPA A;  3GTK J;  5EG0 B;  1D1A A;  4M3B A;  2P5L C;  2JSP A;  3K4M A;  2LY1 A;  5F0H A;  4NC8 A;  4BEH A;  2B7E A;  3F22 A;  1S8N A;  3OYL A;  4BBS J;  4CYD A;  2XAS A;  5KHD A;  3F21 A;  3K4C A;  2JPC A;  3BR3 A;  4BQA A;  1J5Y A;  2W85 A;  3S8P A;  2VXZ A;  4A0X A;  1E0E A;  4IJA A;  1YX5 A;  1BR2 A;  5KVR A;  3HG9 A;  4A3F J;  2QCO A;  1LUJ B;  1ETW A;  5D8K B;  3LSG A;  4MEX F;  2FF4 A;  1W36 D;  3WTW C;  2E1M C;  1X4P A;  1X19 A;  3OYG A;  3HYI A;  3CP8 A;  1LE8 B;  1X3W B;  2HOE A;  4LIV A;  2YR2 A;  2JRM A;  2M9H A;  5B1B H;  1RR8 C;  4F93 B;  5E3O A;  2JVH A;  4HW0 A;  3JRD A;  5DM6 F;  2F5V A;  1WCM J;  3Q9V A;  1ZYR F;  2VI6 A;  3OYK A;  2GXB A;  1TP4 A;  4ENM A;  1MSF C;  4ZJZ A;  2DN0 A;  3RQI A;  1VQM I;  2WY7 Q;  2LMD A;  2Y9Z A;  2OJE D;  4XM3 A;  1LPQ A;  4ZTJ A;  5TGT A;  1A04 A;  3CJT B;  5ILV A;  3JAM K;  3H0D A;  1TWF J;  3HRS A;  4A5M A;  1A6Q A;  2IP2 A;  2ZFW A;  1O3T A;  2YX7 A;  4QIW N;  3U21 A;  5GTH C;  1MH4 A;  3I4N J;  2HZD A;  2WC2 A;  4I0B A;  3HRT A;  3WG9 A;  4N9I A;  3BR5 A;  1TZL A;  2HPI A;  3LL7 A;  4EJU A;  1UFM A;  3GTP J;  2RC4 A;  3LSJ A;  2R92 J;  4C9Y A;  2FQ4 A;  2KIM A;  2XUB A;  3I4P A;  3F8F A;  2L7K A;  2L7Z A;  5ICC A;  3TO9 A;  4CZZ A;  2KIS A;  5LHG A;  3GLL A;  3S2W A;  3DTI A;  1OQY A;  1F36 A;  2W24 A;  3S2H J;  1P9Q C;  1KZH A;  2LBF A;  3CMY A;  1L3L A;  2YU9 J;  1YYV A;  2XF5 A;  4M73 A;  1XN7 A;  2R3S A;  2NOJ B;  1T33 A;  3NAU A;  1SMT A;  2DDA A;  2Y69 H;  3QPH A;  4U88 A;  2W7N A;  2Z2S B;  1IV8 A;  1KU2 A;  2OV7 A;  3EDP A;  1ZRF A;  2K86 A;  2XAJ A;  4JYK A;  5ED4 A;  5KCM A;  2YSR A;  3BZ6 A;  1R36 A;  3BQZ A;  2VOP A;  3I5U A;  4FAS D;  1F43 A;  4O6J A;  1XMK A;  1GVD A;  2VPL A;  1XSV A;  5FFX A;  1YRN B;  3TO6 A;  3TKY A;  3HM5 A;  4KN7 X;  5F6F A;  2EV0 A;  1W0U A;  2AHQ A;  2P4W A;  1SFO J;  1PP7 U;  3EUA A;  3JRE A;  2WWY A;  4UUT A;  1XDU A;  1ULY A;  3HOX J;  2H27 A;  1NHA A;  2G7H A;  2OCE A;  4IL6 C;  4IKF A;  4A5N A;  1WH5 A;  5L3F A;  4OMY A;  3KZZ A;  3L00 A;  2LH9 A;  4M9X A;  4BXU A;  2QBY B;  2NXN B;  1UB9 A;  3QRF F;  4ZDO A;  4BQQ A;  3LQQ A;  1GDT A;  3ML6 A;  4CCL A;  3SJM A;  3FK7 A;  2Q8K A;  3ONQ A;  3CF2 A;  4OMZ A;  1WJF A;  4EGZ A;  2V9V A;  4PJ0 C;  3J81 K;  2R7O A;  1WRJ A;  5FLV A;  3DV8 A;  4U87 A;  2EFN A;  2E36 A;  4FE7 A;  1IAW A;  4HNT A;  4QPO A;  4DOZ A;  3P5J A;  4FE4 A;  1UMQ A;  1ZHF A;  1B72 B;  2HDD A;  4F3Q A;  4KT5 C;  2KT0 A;  3KLO A;  2E1N A;  1OPC A;  5A2Q K;  5IPA A;  3HKZ N;  4MTD A;  2XB0 X;  2ZME A;  3V8L A;  3K2Z A;  2RAE A;  4N4O B;  2HYJ A;  1IN5 A;  2CO5 A;  3ZCO A;  4JK1 X;  3D5S C;  2CRG A;  2K9S A;  4IPA A;  4RB1 A;  1RIO H;  2ME0 A;  3RQ4 A;  4KFC A;  3LSI A;  1WJ5 A;  1WJC A;  5C4X J;  2ID3 A;  4EJV A;  3KET A;  3VSK A;  2VPR A;  2FNP A;  2KKO A;  2XV4 S;  2ZME C;  3J80 Z;  3L9F A;  3MD2 A;  2B0L A;  5CPR B;  1MBE A;  1WVR A;  2QSF X;  3S1M J;  4K2E A;  2BV6 A;  1XGN A;  1BN5 A;  2O8X A;  5HNH A;  4E7L A;  3IAM 2;  3PJR A;  3PO2 J;  2CFO A;  2FOW A;  2LG4 A;  4RM2 A;  1R23 A;  2BXY A;  2MLK A;  3L2U A;  2MG4 A;  2IS1 A;  4IQ4 A;  2KIQ A;  2GIZ A;  2XPW A;  4OAZ A;  5K5O A;  5ICG A;  2LYC A;  1DGW Y;  5HDN A;  1GVJ A;  4MTE A;  4P9U A;  2VLA A;  5IOY A;  1ZR2 A;  2CJJ A;  2XGD A;  2Y75 A;  1Z7L A;  2QEN A;  1ZG1 A;  3KEO A;  5D5U B;  1JE8 A;  4RMN A;  2DK5 A;  4A0Z A;  1O57 A;  2DMN A;  3WGG A;  2BGC A;  3EQL F;  3EYY A;  1FBU A;  4P9F A;  4X0G A;  3G1O A;  4XID A;  2M45 A;  1FJL A;  1FEX A;  4XON A;  2ZNZ A;  2GXA A;  1YIT I;  1I5Z A;  2P0W A;  1YJN I;  2DXI A;  2LD5 A;  3WHB A;  5DCM A;  5DCF A;  1R1U A;  1Y56 A;  2K5C A;  4XOR A;  2O3F A;  1AOY A;  3E6D A;  3PNV A;  1ON1 A;  3O8H A;  3ZR8 X;  1R71 A;  2K02 A;  4HQE A;  1RRJ A;  3CQZ J;  1J09 A;  2R7V A;  4GGG A;  2LKS A;  2VT3 A;  3K70 C;  3DWL E;  3FM5 A;  4IHS A;  2WAE A;  2EA2 A;  2WV0 A;  1BC8 C;  3ZGK A;  4CCO A;  4D9J A;  1HOM A;  3L7W A;  3ASN H;  3OOU A;  1U9O A;  1YX3 A;  3K69 A;  4IZZ A;  2E2J J;  2QSG X;  4LK1 F;  1S9H A;  2QKL B;  3VB2 A;  3DKX A;  4FT8 A;  1OJL A;  2L2O A;  3N4M A;  5D8L B;  4Y17 A;  1VQ9 I;  2VJ5 A;  1F5T A;  4HNU A;  3I59 A;  2Y2Z A;  3RPU A;  2CQ7 A;  2ECB A;  3I54 A;  4L9N A;  1BA5 A;  3UKG A;  4NDL A;  2HU9 A;  4RDU A;  3SDG A;  4E6K G;  2AQF A;  4NUB A;  1FP2 A;  4L5E A;  2E1C A;  3LWF A;  3WE3 A;  2K9N A;  3VYS B;  2KRC A;  1ZK8 A;  3RCO A;  2HPM A;  2RDP A;  3H5R A;  1FBQ A;  4IOC F;  4CZC A;  2FXA A;  4D7N A;  3DU5 A;  2UWM A;  4II2 A;  2YX4 A;  4D7M A;  4XKB A;  4OIP F;  2KJB A;  4AYB N;  3IKT A;  1JJ6 C;  3JSO A;  1VQ7 I;  2FUG 2;  5ICE A;  2BY3 A;  1MDM B;  5CVV A;  1WKM A;  2A3S A;  1TWA J;  2ID6 A;  1W0T A;  1R49 A;  5E79 C;  1R5G A;  3M8E A;  4DW6 A;  5JI6 A;  5D5W B;  1S29 A;  4BAY A;  5DUI A;  4CYC A;  2BY0 A;  3VWB A;  3NRV A;  4LMY A;  3REO A;  2Q2E A;  3B73 A;  3R0A A;  1EH8 A;  4XR6 A;  5D6F A;  1USS A;  2BOL A;  2O8K A;  3CES A;  4HLX A;  2EIJ H;  2E7X A;  3SZG A;  3WHC A;  1EKE A;  3FHN A;  5K7Z A;  2JUC A;  1NK2 P;  4ZH4 F;  2FU4 A;  2XRL A;  4MEY F;  4U0Y A;  4X6A J;  1D1B A;  2OUM A;  2V7F A;  2EV5 A;  3M8J A;  2JN6 A;  4B8X A;  3GTM J;  4RM3 A;  3QYB A;  2EFW A;  1K4T A;  2HS5 A;  4M74 A;  3DBR B;  4XL9 A;  2KPM A;  3C7J A;  4CUG A;  1FMW A;  4YFX F;  3JRH A;  1LEA A;  3E97 A;  3S16 J;  1IF1 A;  2CS3 A;  1K78 A;  3K4N A;  3JR9 A;  3V8J A;  1LB2 A;  1Y8Q B;  2O03 A;  2QQA A;  2W48 A;  3V7R A;  1UCR A;  3MZ8 A;  2XAU A;  3A02 A;  4BH9 A;  4NHJ A;  3OYC A;  1X1A A;  3KLN A;  4XRS G;  4CCJ A;  3BG6 A;  1F4K A;  1W7P B;  1U5T A;  2DA6 A;  3JTH A;  3QWL A;  1CF7 B;  1KQ9 A;  1U78 A;  1HF0 A;  3TO7 A;  4KYW A;  4HF2 A;  4L9T A;  2KIF A;  5IT3 A;  1ACI A;  4J19 A;  3K7A J;  2XF6 A;  1R5I D;  2YUS A;  2ZXH A;  4UB6 C;  3VPR A;  4RAY A;  3DKY A;  1U5T C;  1TQM A;  5DS9 A;  1IXC A;  2JZY A;  2MSY A;  3VOE A;  3F8N A;  4YG2 F;  4A3D J;  4BKX A;  3AAF A;  1VQO I;  4HZF A;  4NC7 A;  5TJJ A;  1IV6 A;  2IA2 A;  1ZAO A;  3R4K A;  2DFI A;  3S32 A;  3G71 I;  2R5Z A;  2PN6 A;  3L09 A;  3GFI A;  2O9L A;  4EQQ A;  4M72 A;  5JLX A;  1FYM A;  1AKH B;  2XAH A;  3ERM A;  4B4C A;  3HJE A;  3SEZ A;  3C3W A;  4Y15 A;  3V4G A;  1R4M B;  1IDZ A;  1YW7 A;  5M5X J;  5IP6 A;  2DMQ A;  4E7H A;  2JTV A;  1QVT A;  1Z6R A;  1R6R A;  2M7B A;  2A6H F;  1UZC A;  2DK8 A;  4JP0 A;  1SD7 A;  2XDV A;  3DEE A;  3QPS A;  3RYP A;  3K1M A;  4CXF A;  4V2F A;  2V9K A;  1DP7 P;  2NOG A;  3C2B A;  5FO5 A;  4KIB A;  4IHY A;  3I58 A;  4L18 B;  4I01 A;  2K3P A;  3M1C A;  3WG7 H;  2ZJQ F;  5M3F J;  3FXL A;  3SDB A;  4KIT B;  1ZLJ A;  3MN2 A;  3BJA A;  2L5Q A;  2ACJ A;  3P9K A;  1YLF A;  5E3M A;  2DQL A;  3LST A;  3M07 A;  4XN3 A;  1T8I A;  1N78 A;  4A3G J;  1ERD A;  3ECO A;  3CCM I;  2BXZ A;  2H1L A;  3IWF A;  1MMG A;  3A01 A;  1IN4 A;  2IT0 A;  4IX7 A;  2VC0 A;  1XD7 A;  1FP1 D;  3A0B C;  4L9V A;  3ZQI A;  1IRF A;  2I10 A;  2L54 A;  2RN7 A;  1FYK A;  1DUX C;  3E6M A;  5H20 A;  4PGH A;  3DFG A;  4BEH B;  4WX9 A;  2Y31 A;  3DP7 A;  1ZRC A;  3WE2 A;  2IA1 A;  1T98 A;  2F5F A;  1ON2 A;  2CQX A;  2HKO A;  2Y0S A;  3WTU C;  3OYM A;  4I0A A;  4PGG A;  2X51 A;  2N8G A;  3OYD A;  2DQR A;  3OSG A;  4L0Z B;  3IH2 A;  1Z3X A;  1IXS B;  4U0W A;  2BE5 F;  3OYF A;  3CDH A;  2BVL A;  3DPU A;  1T95 A;  4NNJ A;  4PSX A;  2MH2 A;  1MIJ A;  4ON0 A;  1XG1 A;  3X2Q H;  4A12 A;  1HDD C;  4UUS B;  3CCJ I;  5JFR A;  3DKW A;  1V4R A;  1A31 A;  2LKX A;  4EGY A;  3COA C;  4C3J J;  1T39 A;  3D5L A;  1YG2 A;  4DZP A;  2X6X A;  1MJ9 A;  3NEU A;  4HOB A;  1RUN A;  4OWR B;  2WBM A;  1IGN A;  3BR2 A;  4UXN A;  4RAG A;  1HW5 A;  2HKX A;  4KUM A;  2AS5 F;  2EFP A;  3H9Q A;  1K61 A;  3H9G A;  5JLW A;  3AG4 H;  2X9D A;  3DLL F;  2ZXI A;  1XCV A;  2EK5 A;  3HOZ J;  1FTT A;  1R58 A;  5M5W J;  5DD8 A;  3RJP A;  3HSR A;  4KJZ A;  3OY9 A;  1ZG5 A;  2HDC A;  4LG0 B;  4F55 A;  4HX7 A;  4AM3 A;  1W5S A;  4FCY A;  3I64 A;  2OBP A;  2M30 A;  3RI4 A;  2RVC A;  1QGP A;  5LFA A;  1TT5 B;  4MHG A;  1NG7 A;  3BR0 A;  4PJN A;  4CIC A;  2EV6 A;  3F8B A;  3BT9 A;  2HTS A;  2LLK A;  3MKW B;  1S72 I;  1LDK B;  5HLT A;  2LY2 A;  1WH7 A;  1Q1V A;  3JRI A;  2H8W A;  3DEU A;  1JGS A;  1OCR H;  3KP7 A;  4HLY A;  2UZK A;  4KDP A;  1YOV B;  2IS4 A;  4NQW A;  3AFH A;  1HC8 A;  5F0F A;  1G3Y A;  3SFZ A;  4BUP A;  5IYC J;  3ZQF A;  1YW9 A;  4F7Z A;  2WAQ A;  2KDZ A;  3ZQG A;  2OD5 A;  2UXN A;  5ILU A;  2QLZ A;  3EPZ A;  4RB2 C;  2E60 A;  1YI2 I;  4U7B A;  3IV5 A;  1LFB A;  3OV8 A;  3Q3S A;  4OU0 A;  1SD6 A;  4IF4 A;  3OR1 C;  1TW2 A;  2Z3Y A;  4HQM A;  1QHG A;  2JUG A;  5J4V A;  2Q0O A;  4IRI A;  3H5N A;  2E1O A;  4G7H F;  2DT7 B;  2HDW A;  4YII A;  2ISY A;  2M87 A;  4EVI A;  3HDD A;  3QOP A;  5JVT A;  2E35 A;  2H6C A;  4KIC A;  5J1R A;  3HXL A;  3FZV A;  4AYB A;  5L3B A;  2QSH X;  2AQE A;  2KZV A;  3QPT A;  5K7H A;  2IS2 A;  1ZQ3 P;  2JQ7 A;  3NAR A;  4E7S A;  2CMP A;  1O7L A;  4KIS A;  2FQ3 A;  5EEA A;  4AUX A;  1JTY A;  3NWS A;  4PJJ A;  3K9T A;  3G73 A;  3BCA A;  1XGS A;  4PK4 A;  3CC4 I;  5JVG F;  3H92 A;  3A1Y A;  1HQC A;  2O5R A;  2HVR A;  4ZZL A;  4H4K C;  1PUF A;  4IQJ A;  4EAT A;  4XLE A;  3BLY A;  3QAH A;  1D8J A;  2STW A;  2JRT A;  1R00 A;  1LFU P;  1A5J A;  1ODD A;  3D5R C;  2NYX A;  4JX6 A;  1FWZ A;  2E71 A;  3P7N A;  1IRX A;  1X3Z B;  3GTJ J;  5L3G A;  3HRM A;  1UHW A;  1ZN2 A;  2QVO A;  2VKV A;  4LOC A;  2ZFU A;  1OYW A;  1FIP A;  3FIS A;  3MKY B;  1P4X A;  2V1N A;  4I98 B;  3EUK L;  4OIR F;  3Q5F A;  3OL3 A;  4GXO A;  2VL8 A;  2O6G E;  2FML A;  1SD5 A;  4AVZ A;  4BNC A;  4QPQ A;  1PJR A;  2KHM A;  3CUQ A;  4A3B J;  2CQN A;  3M3Y J;  2XAQ A;  1Y39 A;  3LSH A;  2JMW A;  5L3D A;  1FOW A;  4JBA A;  2QQB A;  1UEL B;  3LNQ A;  2BY1 A;  2L0K A;  3Q0U A;  4H0E A;  4M3D A;  2L02 A;  3CUQ C;  3ZMT A;  4IVN A;  2IW5 A;  1ZTR A;  3TP0 A;  5J47 A;  4RA2 A;  2OAZ A;  1JT6 A;  2ZNY A;  3BRO A;  1X58 A;  3A03 A;  1X1B A;  2AXT C;  2VKD A;  1BBY A;  1WZ2 A;  2KRF A;  1I39 A;  4YFK F;  2MLG A;  4DYR A;  5D4R A;  1EV7 A;  2CSO A;  1XGO A;  1D0Z A;  1WGX A;  4HST A;  1RI7 A;  4KMU X;  5TIS C;  4LB5 A;  1U6G A;  1ZEL A;  2DT6 A;  2LRE A;  2RGV A;  1YFH A;  3AL0 C;  1FSE A;  2PJR A;  3FWE A;  4DYQ A;  2EZK A;  3TDZ C;  1K4S A;  2EPF A;  4ZDP A;  1VQK I;  2WAD A;  4D1Q A;  1G6N A;  1FOK A;  2A61 A;  2K9L A;  4LIU A;  2GA1 A;  2Y0M A;  5DCM B;  4ZYH A;  3OSF A;  2JSC A;  5HLG A;  3PFY A;  2E19 A;  1FYL A;  2FD5 A;  3M4O J;  1BOB A;  2HVQ A;  2M3A A;  1B6A A;  5AON A;  3PNY A;  2H1K A;  1ETV A;  4BS9 A;  5C3E J;  3O6B B;  1IO2 A;  4ESF A;  1OYY A;  6PAX A;  1CQT A;  3EET A;  4IHW A;  4UVB A;  1ENH A;  1ZAR A;  1I27 A;  3HUG B;  4DNC A;  5E3N A;  4EMS A;  1YIO A;  1SFE A;  1O3R A;  4LGW A;  5IOZ A;  1U8B A;  3QPL A;  2DDB A;  2HXI A;  4HF0 A;  5L3E A;  3BR1 A;  2IAI A;  1BOA A;  4Q47 A;  4UY8 I;  3GFM A;  3K6G A;  3W2A A;  3OYE A;  3N05 A;  1BC7 C;  4J01 A;  3CTA A;  4DQ2 A;  4DGW B;  3HOV J;  2WAF A;  1U2W A;  3AG3 H;  4C3H J;  2HVS A;  3I59 B;  2HWV A;  4I7H A;  4Y52 J;  2ELH A;  4I6Z A;  2XF7 A;  1I6X A;  2BEO A;  1TWG J;  4BY1 J;  4ZZD A;  3G1L A;  1JT0 A;  2W82 A;  1YS6 A;  4XRS A;  2EIN H;  3KE2 A;  4XMY A;  2ZSI B;  3FM3 A;  3ZQQ A;  3WTX C;  4LFU A;  1IXR C;  2LR8 A;  2P8T A;  3CZ6 A;  1H89 C;  4J00 A;  2W4S A;  2IJL A;  1R4N B;  2VKE A;  4HG2 A;  3MMY B;  5LD2 C;  3GCM A;  3FBI B;  2JVG A;  4M3E A;  1FOY A;  3F0C A;  3G4S I;  3OMY A;  3M7G A;  2Z99 A;  3QP5 A;  1D5Y A;  3TGN A;  3RZD J;  2BBY A;  2DAO A;  2ZB9 A;  3BG9 A;  2XRO A;  3HGY A;  4WXC A;  4D5F A;  4CYC B;  3BY6 A;  1HA8 A;  1U9N A;  1S6L A;  2Q2E B;  3HIF A;  4ENK A;  5FFZ A;  2F4I A;  2ZBK A;  1FT9 A;  3BC8 A;  3D0S A;  3OR2 C;  4LK0 F;  5KK1 A;  2P5V A;  2TDX A;  1V5E A;  2HR3 A;  3J80 K;  3CMA I;  5C4J J;  3I3L A;  4B3X A;  4RGS A;  1G4D A;  2DOA A;  1SAU A;  4C2U A;  4MLO A;  3PL8 A;  2COM A;  4V2G A;  5HDG A;  1K7A A;  1DDN A;  3GF2 A;  3CC7 I;  2FSW A;  1DPR A;  3V7C A;  2MA3 A;  5CJ9 A;  2E5Z A;  3KP2 A;  3M8F A;  1DU6 A;  2P7V B;  2BVM A;  1XGM A;  3OIO A;  2LF8 A;  2E2I J;  5J40 A;  2X48 A;  1G2H A;  5IT9 Z;  2PLY A;  4GYG A;  4B44 A;  3FMS A;  2X1D A;  3KP6 A;  2DLL A;  2XGE A;  3BJ6 A;  2LSO A;  1K78 B;  4BE2 A;  2DA3 A;  3W6K B;  1RKT A;  4AID A;  3WTV C;  2PX9 A;  2Y0S N;  3S93 A;  2KFD A;  1HST A;  4NBQ A;  5M3M J;  2XIG A;  1VQP I;  2R7D A;  3ZN0 A;  1M1E B;  3S2D J;  3VFZ A;  3ESW B;  1ZKG A;  3G3Z A;  1JXS A;  1A6I A;  3HOS A;  2VE8 A;  4IRH A;  2R5Y A;  4BE1 A;  3OYN A;  3FXO A;  3IAS 2;  1B59 A;  5EZG A;  2DCE A;  2ELK A;  5FKL A;  4S0H B;  1YTY A;  2MW8 A;  2LNB A;  3FK6 A;  1AHD P;  2HQ5 A;  3TOA A;  3OYA A;  2MYS A;  3T0Y A;  5BNG A;  2JJ7 A;  2DMU A;  2KL4 A;  2EIK H;  3HSF A;  4HYE A;  4WK8 F;  1ZH5 A;  2FJ1 A;  4D0P A;  2TCT A;  4D5C A;  3F8M A;  3MQ0 A;  2QA4 I;  3H36 A;  4IHV A;  2M8E A;  2NS8 A;  1UHS A;  5FB2 A;  4GYI A;  5J6X A;  3PNT A;  2D5V A;  2CW7 A;  2PJP A;  2FE3 A;  2K9Q A;  1X2M A;  4HX4 A;  1WI3 A;  3C18 A;  5LEJ A;  3DPT A;  2PFB A;  1N75 A;  4ZDL A;  4IHT A;  1UJ8 A;  1U0J A;  3BJO A;  1RPW A;  1WPK A;  2XRN A;  1JUM A;  4ENJ A;  2EBI A;  2STT A;  1EH6 A;  1EH7 A;  1L0O C;  4QSH A;  1XPX A;  4BQN A;  1YJW I;  2EZH A;  1MD0 A;  1X1D A;  4ZYG A;  4BXF A;  1NH3 A;  2DO7 A;  5GPC A;  1FPQ A;  3RKX A;  3IP4 B;  5K5Q A;  1JKP C;  2ELJ A;  2WAQ N;  3C2H A;  3CDL A;  2DA2 A;  3FMR A;  4WXD A;  1OYI A;  3KEY A;  2ZXW H;  5DDG A;  5EYR A;  1BI0 A;  3GZ6 A;  2EIM H;  1WI9 A;  2DBB A;  2CQQ A;  1ORK A;  3H35 A;  3OWT A;  4EJW A;  2H8R A;  4L0Y B;  1KQ8 A;  1IG7 A;  3W2V A;  2GZW A;  2KP6 A;  1P4W A;  5F64 A;  1J0R A;  4XOP A;  3JRA A;  5F0C A;  4W1U A;  2XKO A;  2R7T A;  1P6R A;  2HGC A;  3ABT A;  2HOS A;  4HNV A;  1ZGJ A;  2CUF A;  1Y0U A;  1YRN A;  4HV5 A;  2X6O A;  1BR1 A;  4BDZ A;  2P6T A;  3OIP A;  3UR3 C;  2F4M B;  3OYB A;  4P1W A;  3F72 A;  3O8G A;  4XLA A;  2CG4 A;  3S1R J;  3PQJ A;  1TNT A;  4EJT A;  3S1N J;  2DA7 A;  1FIA A;  1GV2 A;  2OQG A;  1FOX A;  3G6E I;  3BPV A;  4MQ9 F;  5F1R A;  3T8R A;  2GWR A;  3CD6 I;  3CO7 C;  2HQA A;  2X6Y A;  4ASN A;  5FD6 A;  3OYH A;  3OYJ A;  3H3Z A;  1BM9 A;  2PI0 A;  3GWZ A;  4PZJ A;  1SVO A;  3L2C A;  3BPX A;  4C30 A;  3SXY A;  1TQP A;  1Z21 A;  3ROU A;  5J1Y A;  4B48 A;  3GW2 A;  4LB6 B;  3OYI A;  3PIO F;  2DJN A;  3KX2 A;  1J9I A;  1QU3 A;  3CC2 I;  1J2X A;  4XLN F;  3LQR A;  2ADU A;  5GP9 A;  4KIG A;  4HRI A;  4XKV A;  2OC6 A;  1BR4 A;  2GOM A;  5LGU A;  1MMA A;  2F5C A;  1HSJ A;  3BZK A;  5D5V B;  3AG2 H;  2BW3 A;  4I76 A;  2HYF A;  5F04 A;  1B4A A;  4XLP F;  4RGU A;  1I1G A;  2KIU A;  1GT0 C;  2CQK A;  1YS7 A;  1QZE A;  2V9P A;  3KCC A;  1JUP A;  1K6Y A;  2L9R A;  3LA3 A;  1MSE C;  1DQU A;  4O5V A;  2FBK A;  1QHH D;  3I4M J;  1IN7 A;  4XLF A;  2K40 A;  5B1A H;  2Z16 A;  3FKI J;  1LFP A;  1FNN A;  4GO1 A;  5D6E A;  5E18 F;  3S1Q J;  3CDI A;  4IEJ A;  2E5N A;  2YPR A;  3J7Y J;  1X1C A;  1SFX A;  3BQY A;  4MNU A;  4XLC A;  4M6X A;  3ZOB A;  2VJJ A;  2P7C B;  1Z77 A;  3CCL I;  3ZPL A;  2EJR A;  3PSI A;  1AU7 A;  3BP8 A;  5B66 C;  4IO9 F;  3ASO H;  3ZRG A;  4Z6Y A;  2PQ8 A;  5K5R A;  2OF7 A;  1T0F C;  2HI3 A;  4I09 A;  9ANT A;  4DYC A;  2CV1 A;  2VOO A;  2R7U A;  3DF8 A;  2XVC A;  5KNL A;  2G0E A;  4L5J A;  1YO5 C;  2O61 A;  3DEW A;  2X6W A;  1KQ0 A;  3BCB A;  2RQQ A;  1MMD A;  3CCY A;  2L4A A;  3I71 A;  1N77 A;  1Z0X A;  1GXP A;  1XMX A;  2YS9 A;  3KYD B;  4HAM A;  3BZC A;  5LRR A;  1WFX A;  1TL8 A;  1JKQ C;  5JR3 A;  1J59 A;  2F6C A;  4UVA A;  4M9Z A;  2D2W A;  2A05 A;  3SQN A;  5BMZ A;  2BZT A;  2V1D A;  2KQR A;  1PUF B;  3K4K A;  1U8R A;  2FA5 A;  1PUE E;  2ZKZ A;  1R5H A;  2BYV E;  2DA4 A;  5BPI A;  4CDG A;  2K9M A;  4RB3 C;  1VTN C;  4CHU A;  3HOW J;  1N25 A;  1QVU A;  3OL4 A;  1ZRE A;  3GTL J;  1LQ1 A;  1O3S A;  2Z33 A;  2ZJP F;  5EEH A;  2XPV A;  1SD4 A;  2NVY J;  1QZY A;  1RES A;  4RLF A;  1KU7 A;  2DOD A;  4IXA A;  4BYY A;  4KT6 A;  3CME I;  2IGK A;  5D5X B;  3JRC A;  2E1M B;  2L7M P;  5H2F C;  2EB7 A;  4A2U A;  1JKO C;  2VN2 A;  3MZH A;  1RC9 A;  3WU0 A;  2ECC A;  4BXX J;  1ZGW A;  4XSZ F;  1TNS A;  3CLO A;  3TW7 A;  4G9Y A;  1TC3 C;  3WGI A;  2LDU A;  5BPD A;  2XPU A;  5IY5 H;  4FIS A;  4Q5S F;  2LVS A;  1T08 B;  5C44 J;  1WQ2 A;  2HYG D;  1OR7 A;  3KP4 A;  1GLN A;  3CF5 F;  2XSD C;  1E3P A;  2NVU B;  4E7K A;  1T6S A;  2CUE A;  1IN6 A;  3LAJ A;  1KYZ A;  4AVP A;  4OOI A;  5HVQ C;  2R93 J;  4GRI A;  1XC5 A;  2K27 A;  2ESH A;  4II3 A;  1OLT A;  1LDJ A;  1GV5 A;  3J7Z I;  2FMY A;  5DM7 F;  4X1E A;  1XDS A;  3GBG A;  1Z9C A;  1OR7 C;  3N97 A;  2A5W A;  2E34 A;  4BU2 A;  2DA1 A;  1J75 A;  4OIQ F;  3AL0 B;  3JRG A;  1W1W E;  3ABK H;  4RAF A;  2RKH A;  3U1K A;  3BG7 A;  2VBX A;  4PJL A;  4XNF A;  2QEX I;  4G7O F;  3CJN A;  4B3A A;  4FQG A;  1ZGA A;  2KMU A;  2MGQ A;  3K4L A;  4XN0 A;  4XRM A;  1J7K A;  1X1P A;  3WGH A;  1X2N A;  3QYF A;  3GVA A;  3J7A O;  3FXJ A;  3LMM A;  1BI3 A;  3EYI A;  1I6H J;  3RTR A;  3PO3 J;  4XKW A;  3RZO J;  1A36 A;  2M2E A;  1ONV A;  3RPQ A;  2A07 F;  5HLI A;  3BDD A;  4E7J A;  4HDV A;  4Q48 A;  3GZ5 A;  2DPU A;  2L9V A;  4A3K J;  1S7O A;  1AA7 A;  4S05 A;  1QNT A;  4WCG A;  4MFD A;  4XRF A;  3SHF A;  1NTC A;  3IWZ A;  5EF6 A;  1WJA A;  2LBF B;  3TL4 X;  4RGR A;  4WXH A;  1HCR A;  3IRR A;  3BG5 A;  4F92 B;  2F5E A;  3KZI C;  2KJC A;  4RAZ A;  3ZQ7 A;  1FBS A;  1VF9 A;  4AIK A;  1MKM A;  3HHH A;  3RKY A;  2ZSH B;  1T2K A;  3NWT A;  2JA5 J;  1SMY F;  1Q1H A;  2EA4 A;  3IH3 A;  5E17 F;  2LTP A;  2WTE A;  3U1D A;  5EDN A;  5LGT A;  2NAZ A;  1CF7 A;  2DPD A;  1HKT A;  5LRS A;  1APL C;  3T5X A;  1OCP A;  3CMM A;  2GBY A;  2CW8 A;  2JA8 J;  1I3Q J;  2ZCW A;  2IEK A;  5J8F A;  4QWQ A;  2K4J A;  1SFU A;  2X1C A;  4A0Y A;  4I99 C;  1E2X A;  4A3L J;  3QYE A;  3HOU J;  5HS7 A;  1Z05 A;  4M3F A;  3V42 A;  2OTJ I;  5IP9 J;  3L2Q A;  2CH0 A;  1FZP B;  4DIQ A;  3CJQ B;  4BHP A;  3MKL A;  5EGO A;  4MGR A;  1OCO H;  1LVA A;  2FOK A;  4ZYD A;  2L9N A;  4UV9 A;  4ZTF A;  3SYT A;  1AKH A;  3GTO J;  2P5K A;  3HSE A;  2DT5 A;  1QBJ A;  2Z9O A;  4FTH A;  3IH4 A;  3M9A A;  4M6Y A;  3W6J B;  4KN4 X;  4U0V A;  4AC0 A;  4BBR J;  2M34 A;  3L1P A;  3QP6 A;  2LK2 A;  1JI8 A;  2OQR A;  1D0X A;  2GIV A;  2RNG A;  2XGC A;  3MWM A;  4OIO F;  3ZMZ A;  4RBO A;  1K79 A;  1KU9 A;  1RZ4 A;  2R7X A;  2R7Z J;  1IUF A;  5DUK A;  1G8X A;  3GX4 X;  5F08 A;  2DYR H;  3DBL B;  1TWH J;  4EM2 A;  2QZ8 A;  2ZME B;  5FKM A;  2DOF A;  4JX5 A;  5AIP A;  3ZXS A;  3K4J A;  4JX4 A;  3CCR I;  5GAG J;  1WJE A;  5LHH A;  2NVT J;  3QOD A;  3BTJ A;  4TV7 A;  3E5X A;  3E7L A;  2HOT A;  3A0H C;  3SEQ A;  2ME6 A;  3F9K A;  4RS8 A;  5E1Z B;  3CCU I;  1IJW C;  1W7P D;  1YQA A;  1LDD A;  4UHT A;  4B09 A;  2VUM J;  1Z91 A;  3UNG C;  5FLX Z;  3BWG A;  1D0Y A;  3GO5 A;  3CO6 C;  1VQ4 I;  5J3L A;  2V1X A;  2QM3 A;  2YU3 A;  4E70 A;  1MJA A;  3WU2 C;  4YEJ A;  2R4G A;  4EM1 A;  1P92 A;  4IHX A;  4LLG F;  3KYL A;  1BI1 A;  2OTL I;  4A3C J;  4B43 A;  4DBQ A;  5LBQ A;  4QTR A;  3MKZ A;  1NK3 P;  5DD4 A;  3PUB A;  1OFC X;  4BHC A;  2MC4 A;  1IDY A;  2RNJ A;  2VQH A;  4DBR A;  3Q0V A;  2R5Y B;  4AU7 A;  1B8I A;  1HDP A;  4UUS A;  3TOB A;  1A35 A;  2XKP A;  3IHU A;  4A6D A;  3FXU A;  1E17 A;  2OU2 A;  1MGT A;  3ECH A;  1BL0 A;  4LG3 A;  1H88 C;  2H6B A;  2CWE A;  2NS7 A;  3SZT A;  4NB5 A;  4LIT A;  2E7W A;  1Z6T A;  2Z5U A;  4L9J A;  3ZN1 A;  3WTS C;  2QUF A;  2Y30 A;  2H09 A;  4YRV A;  5IYD J;  4A69 C;  2IS6 A;  1KU3 A;  5BOX A;  2R7W A;  1V55 H;  3KYC B;  4FX0 A;  4YFN F;  1SAN A;  5JHU A;  2PG4 A;  4KIF A;  2CW0 F;  1VQL I;  1ZG3 A;  2LC2 A;  1P2F A;  4XOT A;  4JQF A;  4LG0 A;  3OS2 A;  1TWC J;  2D1H A;  2E2H J;  2MH9 A;  4ESB A;  4F91 B;  1S5L C;  4E7I A;  2V6E A;  1DPU A;  2PMU A;  3DPL C;  1OMI A;  2DYS H;  3JAM Z;  1V5F A;  3HHG A;  2BY2 A;  1V3F A;  2I5U A;  5GAH J;  1QA6 A;  1IUY A;  2CU7 A;  3J7A Y;  1OIS A;  3LSP A;  3I56 I;  2GOX B;  2XAG A;  3ABU A;  4EV0 A;  2V1U A;  2JA6 J;  5EEG A;  1XMA A;  2K3F A;  4LLL A;  1RET A;  2L01 A;  4HBL A;  1SVM A;  1TW3 A;  3HPG A;  5CQG A;  4RGX A;  3QU6 A;  2EFO A;  2OPT A;  3HC7 A;  2UUZ A;  3U9G A;  4EJO A;  1MMN A;  1RKW A;  4M6V A;  3M1E A;  1Z7U A;  3HTU A;  1G3W A;  2DTZ A;  5HNF A;  2PEX A;  4HEA 2;  3F6O A;  4YIR X;  1R1T A;  4M71 A;  1RUO A;  3HRU A;  1IZ1 A;  2V4J C;  1MBJ A;  3GTG J;  2PMZ A;  3S3M A;  2VKH A;  1SAX A;  2QYO A;  2IBD A;  1X3U A;  5CYV A;  3C2G A;  2W25 A;  3E0J B;  2VB6 A;  1ZRD A;  4PSW A;  2M0M A;  4A3E J;  5E8G A;  1XSX A;  2Y48 A;  2QF7 A;  4OIN F;  1GHC A;  5DYM A;  2D1V A;  5CVR A;  4AIJ A;  1O3Q A;  4M9S A;  1BJA A;  3DTE A;  1HBX G;  3HOY J;  2M8G X;  3I9V 2;  3HEF A;  1BW6 A;  1FTZ A;  3FBN B;  1YE9 A;  1H0M A;  4XQF A;  5J8C A;  3ZQC A;  2V79 A;  2TRT A;  2QWW A;  1Z1D A;  2GLO A;  2IGN A;  1R9T J;  2CV2 A;  1GXQ A;  3H3U A;  3FXR A;  5E8I A;  3E5Q A;  5IT9 K;  5LLQ A;  1WSU A;  5JHF A;  2AO9 A;  2VBY A;  2Y9Y A;  4GFB A;  1VQ6 I;  1MBH A;  2VQG A;  2DJI A;  1VQ5 I;  3CP2 A;  1YW8 A;  5ICF A;  3TBI A;  3LSK A;  3ERE D;  2G9W A;  5FD5 A;  2DU9 A;  5D4S A;  4HSR A;  1WJD A;  2XSJ C;  1MNE A;  4PFP A;  4CCN A;  1YHQ I;  4BHB A;  2EFQ A;  1D8K A;  1NG6 A;  1VND A;  4S04 A;  4FX4 A;  3K4B A;  5EG0 A;  5KAF C;  5HS9 A;  2BHZ A;  4BY7 J;  1B9N A;  2V26 A;  4ITV A;  1K6O A;  5FRN A;  1V5G A;  3HGG A;  4UVC A;  2BW3 B;  5TRD A;  1W4M A;  2WV1 A;  1F9N A;  5EZH A;  3J81 Z;  3S3N A;  5IYB J;  1TLH B;  4CH7 A;  1KA8 A;  3RKQ A;  3ZQL A;  2ISZ A;  3W6V A;  1BIB A;  2WB1 A;  3KPH A;  4R1H A;  2OZU A;  5FKK A;  3EUH A;  1Y8R B;  2BHY A;  3LA2 A;  2LOO A;  1HKS A;  2LP0 A;  2RRE A;  1LE8 A;  1CGP A;  5FRM A;  2DOE A;  5CVI A;  1JHF A;  1KGS A;  1ZLK A;  1T56 A;  3OS1 A;  5A2Q Z;  1U5T B;  2DI3 A;  2W1O A;  1WJB A;  3IRQ A;  4DJA A;  1PVE A;  4G8X A;  5E1X A;  2GM4 A;  3S17 J;  4RB0 A;  4HF1 A;  2UV1 A;  1Y0N A;  1UG2 A;  4WF2 A;  1FX7 A;  1WHU A;  3EUH C;  4XIC A;  1PDN C;  5HOD A;  4BE0 A;  3TDU C;  3S3O A;  1MW7 A;  3FIW A;  1VQ8 I;  2WY8 Q;  4B1R A;  1IW7 F;  3JW4 A;  3PUF A;  3H3V K;  1VQN I;  5F27 A;  2CFX A;  1MBF A;  2VBZ A;  2VJ4 A;  3T1B A;  5DTD A;  4Y13 A;  1FY7 A;  5L3C A;  2R5Z B;  1EA3 A;  1S7E A;  3FF5 A;  3L2V A;  4M3G A;  1ETO A;  3ZP5 A;  1O4X A;  3TW6 A;  3VYT B;  2X85 A;  1H9T A;  2K4B A;  3I55 I;  1MBK A;  2PBI A;  4XKC A;  2ZJR F;  1OCT C;  3ZQH A;  2DTR A;  5E20 A;  2OA4 A;  3GYH X;  2ZXJ A;  1BI2 A;  1P4A A;  3BTI A;  4G94 A;  5J1U A;  5GAE J;  1TBX A;  3AKZ A;  1ETQ A;  2FRH A;  1S3J A;  4XSX F;  2NVQ J;  1D3Y A;  3ISP A;  4BDY A;  3HZJ A;  1WWX A;  2MC3 A;  3S14 J;  3GFJ A;  3QOE A;  4LD5 A;  5LHI A;  3E5U A;  3VOD A;  4BQO A;  3FXQ A;  2HNH A;  5K1Y A;  2MAB A;  3B6C A;  3HUG A;  3L2R A;  1RR7 A;  4CSW A;  1XSD A;  2EQR A;  3VYR B;  1JHH A;  1P7I A;  2G7U A;  3JTG A;  2CUJ A;  2F2E A;  2FEZ A;  2VQL A;  3HPH A;  2Z1D A;  1IRG A;  1G59 A;  2MFZ A;  1BW5 A;  4UB8 C;  3A01 B;  1ETX A;  3S15 J;  3FXK A;  1FMV A;  2F48 A;  4HA8 A;  3KP5 A;  3HTS B;  4HX8 A;  1HLV A;  1MH3 A;  2ETH A;  4A3M J;  2VBW A;  3IC7 A;  2R7F A;  3HOT A;  4A93 J;  3U2R A;  1D5V A;  4C2T A;  4ZYE A;  3LSR A;  2HQR A;  2RV8 A;  2IXS A;  3K1N A;  3VSL A;  4B47 A;  3E1S A;  2OCC H;  2EZI A;  2A6E F;  3B6A A;  2J5P A;  5AIQ A;  1QPI A;  2A68 F;  3GME A;  3W2W A;  5CLS A;  3BOQ A;  3R60 A;  4P5O A;  3E6C C;  1XCB A;  4Y33 A;  5FJ8 J;  1SC7 A;  4P55 A;  3WTY C;  1XB4 A;  4XLH A;  1JKR C;  4G12 A;  5F1J A;  3KIO A;  2IA0 A;  1IN8 A;  2M7A A;  2QBY A;  3E6B A;  3RDI A;  1GUU A;  2D45 A;  1VFC A;  1MBG A;  2A5Y B;  4CO8 A;  3O2P E;  3HBL A;  3F8C A;  1LKX A;  3ULQ B;  4CCK A;  3VDX A;  3FDY A;  3P9I A;  2L7F P;  4G6T B;  1LEB A;  1QZZ A;  2J5O A;  4F52 A;  3BR6 A;  4G7Z F;  2KDO A;  4IRG A;  2CUZ A;  3C1D A;  3K70 D;  4FET A;  3BTC A;  4KNY A;  5FGM A;  2CYY A;  3ABL H;  1B72 A;  1QPM A;  2ESN A;  4Y3O A;  5LEK A;  1Z67 A;  2FBH A;  2VAS A;  4R79 A;  5FRO A;  2NNY A;  3LA7 A;  2HOA A;  3MAJ A;  2M5W A;  2EIL H;  4N0B A;  4Y4R A;  4PJM A;  3BG3 A;  1QRY A;  1ETK A;  4ABZ A;  3R0J A;  1Z3Y A;  2A6T A;  2M1B A;  2ZO4 A;  5H6Q A;  3FXM A;  2JK3 A;  4W97 A;  1LNW A;  1OKR A;  2F5D A;  3IUO A;  2JT1 A;  3F6V A;  3JSP A;  5BQT A;  2O0Y A;  3MZY A;  4A6E A;  3ZMS A;  4Y7N J;  3ZMV A;  2JA2 A;  2MD5 A;  3FKJ A;  3OIQ A;  3TED A;  3KFW X;  4A3I J;  4AIH A;  4A3J J;  1EF4 A;  4NQW B;  2R7S A;  3RPU D;  4KMF A;  4AD9 A;  1FLI A;  2OZ6 A;  1T0F A;  2VIX A;  3PSF A;  4NC6 A;  5K7F A;  5IP7 J;  4ZYA A;  3PIP F;  4CCM A;  5B5E C;  2KLO A;  1HW1 A;  1QQI A;  2WA0 A;  2FNA A;  4RLQ A;  2W00 A;  1ETY A;  5GAD J;  2R7R A;  2QQ8 A;  4BAC A;  2DW4 A;  1POG A;  3MCZ A;  2B9S A;  4O3M A;  1KYW A;  2IRF G;  2DMP A;  1QO0 D;  1YIJ I;  2FBI A;  3H9J A;  2ZC2 A;  1SEU A;  5CQE A;  3RIR A;  1G3T A;  2EWN A;  2W84 A;  3DBH B;  4PUS A;  1DP3 A;  3CCQ I;  2NNN A;  3T8T A;  3H1C A;  1ZR4 A;  4E4H A;  3I53 A;  3JCU C;  5HLH A;  5FKO A;  5HS8 A;  2Q1Z B;  3JRF A;  1MND A;  2XAF A;  4LJZ F;  2JWT A;  3K2A A;  3Q9S A;  5BS6 A;  1BIA A;  3WU1 B;  2HXO A;  2AXL A;  3R6S A;  1MZB A;  1K83 J;  2NS0 A;  4BL0 B;  2K7L A;  4BGD A;  4WWC A;  2HFH A;  1HXD A;  5EGO B;  3DLA A;  2X4H A;  2VON A;  3AG1 H;  2LY9 A;  5ILS A;  3DCF A;  2MBF A;  4GCV A;  1VI0 A;  3RSN A;  4OAY A;  4L5I A;  1ITY A;  3G1M A;  4UV8 A;  1IC8 A;  1I3A A;  2K85 A;  4PFO A;  2HEO A;  2KZG A;  3F3X A;  1RNL A;  3LAP A;  1R7J A;  2COB A;  2QKM B;  5CVU A;  1Y1V J;  2F4O B;  4MIM A;  1HW2 A;  5FKN A;  3CLQ A;  3GTQ J;  3LFU A;  1UG0 A;  2CV0 A;  4BJ6 C;  1REP C;  4LLN A;  4IOA F;  3D1N I;  2IGO A;  4EM0 B;  2EH3 A;  1X4O A;  2NVX J;  1LVK A; 
#chains in the Genus database with same CATH homology
 3MMY B;  5LD2 C;  1JI8 A;  3FBI B;  3VYS B;  3A4C A;  2KRC A;  2JVG A;  1D0X A;  2RNG A;  3OMY A;  3RCO A;  2LRD A;  2HPM A;  3H5R A;  2MD0 A;  4CZC A;  3HKZ A;  3HL2 A;  2R7X A;  2KRH A;  1G8X A;  3DU5 A;  2UWM A;  4II2 A;  1HA8 A;  1VZ0 A;  4XKB A;  2L9S A;  2Q2E B;  1PYV A;  4BJ5 C;  2FUG 2;  3ZXS A;  2XC7 A;  3K4J A;  2F4I A;  3BC8 A;  3OR2 C;  3H5A A;  1V5E A;  1WJE A;  2I8D A;  3I3L A;  1TT0 A;  4B3X A;  3QOD A;  4C2U A;  2DOA A;  1SAU A;  3VWB A;  4MLO A;  3PL8 A;  3SEQ A;  3CJR B;  3F9K A;  4XR6 A;  2IGM A;  3OS0 A;  2BOL A;  2M4K A;  3UNG C;  3CES A;  5HOO A;  1D0Y A;  3SZG A;  2E5Z A;  3FHN A;  4E7Z A;  2BVM A;  4YEJ A;  2R4G A;  3KYL A;  4B44 A;  1D1B A;  2X1D A;  2OUM A;  2V7F A;  4B43 A;  4DBQ A;  3MKZ A;  3M8J A;  1DGR M;  4BE2 A;  3L2W A;  3PUB A;  2MC4 A;  2X1E A;  3S93 A;  2VQH A;  4RM3 A;  4DBR A;  3QYB A;  4AU7 A;  4XL9 A;  2KPM A;  4CUG A;  2PJR B;  1FMW A;  2CS3 A;  3K4N A;  4LG3 A;  3HOS A;  4BE1 A;  3DTK A;  3OYN A;  3IAS 2;  4LIT A;  2DCE A;  2XAU A;  3OYC A;  1X1A A;  4YRV A;  4CCJ A;  2MYS A;  3OYA A;  3BG6 A;  2IS6 A;  2R7W A;  3VYU B;  2KL4 A;  3A2K A;  1UAA A;  3DQV C;  2LC2 A;  4XOT A;  4JQF A;  3OS2 A;  2XF6 A;  4F91 B;  4E7I A;  2V6E A;  2VJI A;  2ZXH A;  2VQC A;  4YEL A;  3DPL C;  3PNT A;  1SFK A;  4ANJ A;  2CW7 A;  3DKY A;  1V5F A;  3DPT A;  3DU6 A;  4BJT A;  3TMO A;  3J7A Y;  1N75 A;  4NC7 A;  2GOX B;  4N4N B;  4ZDL A;  3S32 A;  4ZC3 A;  1U0J A;  4CA0 A;  1D1C A;  3HPG A;  5CQG A;  3SEZ A;  4BQN A;  3HC7 A;  2UUZ A;  4JOM A;  1X1D A;  2VXD A;  5CKT A;  1MMN A;  4BXF A;  4E7H A;  3W3C A;  5HNF A;  1R6R A;  3IP4 B;  2M7B A;  4HEA 2;  2ELJ A;  3C2H A;  2V4J C;  1W36 C;  2PMZ A;  3S3M A;  2VKH A;  3KEY A;  2XDV A;  3DEE A;  3K10 A;  3C2G A;  2V9K A;  3E0J B;  2VB6 A;  1Y6I A;  3H35 A;  2M0M A;  4PSW A;  3OWT A;  3W2V A;  1KON A;  2K3P A;  2KP6 A;  3M1C A;  3SDB A;  4KIT B;  2L5Q A;  4XOP A;  3DTE A;  3I9V 2;  4XN3 A;  1N78 A;  2R7T A;  1ERD A;  4HPQ A;  3FBN B;  1YE9 A;  1MMG A;  4XQF A;  4IX7 A;  3G2B A;  1BR1 A;  4BDZ A;  2IGN A;  2CV2 A;  2M4G A;  3OIP A;  3UR3 C;  3OYB A;  4P1W A;  4XLA A;  4BEH B;  5JHF A;  2R7Q A;  3LSM A;  2VQG A;  2DJI A;  3CP2 A;  3TBI A;  3LSK A;  1D1A A;  2Y0S A;  3OYM A;  2X51 A;  1WJD A;  2XSJ C;  4HSR A;  2JSP A;  3K4M A;  1MNE A;  2LY1 A;  3OYD A;  1Z3X A;  4NC8 A;  2HQA A;  2X6Y A;  4PFP A;  4BEH A;  4CCN A;  3OYL A;  3OYF A;  3OYH A;  3OYJ A;  2BVL A;  1NG6 A;  3DPU A;  5KHD A;  1T95 A;  4NNJ A;  3K4C A;  4PSX A;  3S8P A;  3K4B A;  2VXZ A;  1E0E A;  1YX5 A;  1BR2 A;  4C30 A;  3HG9 A;  1Z21 A;  4B48 A;  3LSG A;  1W36 D;  3D5L A;  2E1M C;  1X4P A;  2V26 A;  2X6X A;  4ITV A;  3OYI A;  1X19 A;  1V5G A;  3OYG A;  3CP8 A;  5FRN A;  2BW3 B;  3KX2 A;  4OWR B;  2WBM A;  1QU3 A;  4LIV A;  3S3N A;  4CH7 A;  2WB1 A;  4F93 B;  4HRI A;  4XKV A;  2JVH A;  2OC6 A;  1BR4 A;  2GOM A;  2LOO A;  1MMA A;  2RRE A;  2F5V A;  3H9Q A;  2BW3 A;  3H9G A;  5FRM A;  3OYK A;  2ZXI A;  3OS1 A;  4ZJZ A;  2WY7 Q;  2W1O A;  1WJB A;  4DJA A;  4XM3 A;  4ZTJ A;  5TGT A;  3OY9 A;  4KJZ A;  2UV1 A;  3H0D A;  3EUH C;  1K6Y A;  4F55 A;  1DQU A;  4BE0 A;  3U21 A;  1QHH D;  3S3O A;  2HZD A;  1MW7 A;  4XLF A;  2WY8 Q;  2Z16 A;  5LFA A;  1LFP A;  1TZL A;  2HPI A;  3LL7 A;  1NG7 A;  4PJN A;  2E5N A;  4C9Y A;  3MKW B;  2VJ4 A;  1LDK B;  5HLT A;  2LY2 A;  1X1C A;  2L7K A;  1EA3 A;  3L2V A;  4XLC A;  2VJJ A;  2IS4 A;  3VYT B;  2X85 A;  3AFH A;  3PSI A;  4BUP A;  3ZRG A;  4XKC A;  2WAQ A;  1T0F C;  3DTI A;  2CV1 A;  2R7U A;  1P9Q C;  3EPZ A;  2E60 A;  2LBF A;  5KNL A;  2XF5 A;  4U7B A;  2NOJ B;  3AKZ A;  2X6W A;  2W7N A;  3BCB A;  3OR1 C;  2Z2S B;  2RQQ A;  4BDY A;  1QHG A;  2JUG A;  2OV7 A;  1MMD A;  1N77 A;  3H5N A;  3QOE A;  2DT7 B;  1WFX A;  2HDW A;  4BQO A;  2HNH A;  2MAB A;  2F6C A;  5KCM A;  3L2R A;  4CSW A;  3HXL A;  4AYB A;  3VYR B;  2AQE A;  2KZV A;  2IS2 A;  2CUJ A;  2VQL A;  4FAS D;  2KQR A;  3HPH A;  3K4K A;  4E7S A;  2Z1D A;  2VPL A;  2CMP A;  4KIS A;  1G59 A;  2MFZ A;  3NWS A;  2K9M A;  4PJJ A;  3BCA A;  4PK4 A;  1FMV A;  3A1Y A;  2O5R A;  2HVR A;  3OL4 A;  3EUA A;  4H4K C;  4IQJ A;  4EAT A;  3HOT A;  4XLE A;  3BLY A;  4C2T A;  4RLF A;  2IXS A;  3D5R C;  4IKF A;  3VSL A;  4KT6 A;  2IGK A;  4B47 A;  3E1S A;  1IRX A;  2E1M B;  2LH9 A;  3W2W A;  4ZDO A;  4BQQ A;  2ZFU A;  4CCL A;  4P5O A;  3MKY B;  4Y33 A;  3ONQ A;  3CF2 A;  2V1N A;  1WJF A;  4XLH A;  3EUK L;  3OL3 A;  2R7O A;  2M7A A;  4U87 A;  2VL8 A;  4AVZ A;  4HNT A;  1LKX A;  4QPO A;  1PJR A;  2KHM A;  4QPQ A;  3VDX A;  3FDY A;  4CCK A;  4DOZ A;  4G6T B;  1GLN A;  4F3Q A;  4F52 A;  2KDO A;  2CUZ A;  4E7K A;  3K70 D;  3LSH A;  4FET A;  5HVQ C;  4N4O B;  4GRI A;  1UEL B;  3ZCO A;  4II3 A;  1OLT A;  3D5S C;  4Y3O A;  2VAS A;  3RQ4 A;  3GBG A;  1OR7 C;  3LSI A;  4R79 A;  2A5W A;  5FRO A;  1WJ5 A;  4BU2 A;  1WJC A;  4Y4R A;  3VSK A;  3AL0 B;  3BG7 A;  3MD2 A;  4PJM A;  1X1B A;  4PJL A;  4XNF A;  5CPR B;  2VKD A;  2KMU A;  3K4L A;  1Z3Y A;  4XN0 A;  2A6T A;  4E7L A;  5HNH A;  3PJR A;  3IAM 2;  2CFO A;  3QYF A;  2LG4 A;  4RM2 A;  3IUO A;  3LMM A;  3L2U A;  2IS1 A;  3RTR A;  4IQ4 A;  4XKW A;  1D0Z A;  2JA2 A;  4OAZ A;  3FKJ A;  3OIQ A;  4HST A;  2LYC A;  4E7J A;  1DGW Y;  4NQW B;  2R7S A;  2VLA A;  3RPU D;  1ZEL A;  2DT6 A;  2VIX A;  3PSF A;  1Z7L A;  2LRE A;  3AL0 C;  4ZYA A;  4CCM A;  2PJR A;  1AA7 A;  4RMN A;  2KLO A;  2WA0 A;  4RLQ A;  4ZDP A;  2W00 A;  2WAD A;  2R7R A;  4D1Q A;  4BAC A;  1WJA A;  2LBF B;  2K9L A;  3TL4 X;  4LIU A;  4F92 B;  3PFY A;  4X0G A;  3H9J A;  5CQE A;  2ZSH B;  3NWT A;  4XON A;  1BOB A;  2HVQ A;  2M3A A;  3PNY A;  2P0W A;  4BS9 A;  4PUS A;  2DXI A;  1DP3 A;  1Y56 A;  2K5C A;  4E4H A;  4XOR A;  3PNV A;  3ZR8 X;  3HUG B;  2Q1Z B;  1MND A;  1J09 A;  2R7V A;  3K70 C;  3CMM A;  3DWL E;  2CW8 A;  4BL0 B;  2WAE A;  4BGD A;  2X1C A;  3DLA A;  3QYE A;  3K6G A;  3ZGK A;  4CCO A;  3OYE A;  3N05 A;  3W2A A;  3V42 A;  4D9J A;  4J01 A;  3OOU A;  3L2Q A;  4DGW B;  1YX3 A;  4IZZ A;  2WAF A;  2CH0 A;  2HVS A;  3RSN A;  4DIQ A;  3CJQ B;  1S9H A;  4OAY A;  2QKL B;  2XF7 A;  3DKX A;  2L2O A;  4PFO A;  4ZTF A;  2L9N A;  2W82 A;  2QKM B;  3SYT A;  2VJ5 A;  4XMY A;  2ZSI B;  3ZQQ A;  3LFU A;  4HNU A;  1UG0 A;  2CV0 A;  4BJ6 C;  3CZ6 A;  2HU9 A;  4J00 A;  2W4S A;  2IGO A;  4E6K G;  2AQF A;  4NUB A;  1X4O A;  4HG2 A;  1LVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...