3E0JB

X-ray structure of the complex of regulatory subunits of human dna polymerase delta
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
143
Chain Sequence
ADQLYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVTYLVSGSLIQNGHSCHKVAVVREDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYDILKSNLQNCSKFSAIQCAAAVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of the complex of regulatory subunits of human DNA polymerase delta.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DNA polymerase subunit delta-2
total genus 41
structure length 143
sequence length 143
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3e0jB00
3E0JB
chains in the Genus database with same CATH superfamily
2K9LA 3GTQJ 3DEUA 3JRFA 2Z9OA 2CQNA 2F5DA 2QSFX 1Y0NA 5FD5A 4GFBA 2GBYA 4R8HA 5JI6A 1IN4A 1SEUA 4IHSA 2L54A 2LY9A 4BNCA 1F43A 2KZVA 3ZMUA 2NNYA 3CCLI 2NS8A 4DYRA 5FRNA 2JA8J 2H1KA 3BPVA 5M5WJ 2M30A 4RLQA 1BOAA 2GOXB 2DQLA 3BOQA 3GTPJ 4ESBA 3QP5A 2DDAA 2K7LA 5JFRA 2FOKA 1XTAA 3J7YJ 2Y0MA 1RUOA 4JYKA 2OAZA 4AWXB 1B59A 4BDYA 1OR7A 2FQ4A 2AS5F 2QGUA 5F6FA 4DNCA 3JRDA 1OCTC 4H0EA 1SFXA 2BW3B 3TP0A 1CF7B 3IAS2 1QO0D 3AL0B 3E6MA 3FISA 3C18A 2ZJQF 5A2QZ 3FXQA 4IXAA 4B48A 1BM9A 3C2BA 5J8FA 5HLTA 2WAEA 3G73A 5IP9J 4D0PA 2NYXA 1YRNB 3JRCA 4LOCA 3NQOA 3BG5A 3OIQA 5FRMA 4QSHA 1D1BA 4BXXJ 1KZHA 2JMWA 2M45A 2WAQN 4HNTA 1BI2A 3G1MA 3VYUB 3HB9A 3Q9SA 4PGHA 2OBPA 5F0FA 5K7HA 4ZYDA 1B8IB 3OR1C 2MYSA 3ML6A 2FX0A 4NUBA 3BC8A 3K4CA 5GADJ 1UMQA 2H8WA 3HGYA 4YIFA 1HC8A 4BHBA 4I0BA 1ZARA 3C2GA 5H20A 3FX3A 4E4HA 5HDKA 4MHGA 1V55H 3RPUD 4XRSA 4JQFA 5TJJA 4F55A 5D5UB 2XASA 1FTZA 2E1MB 3AG1H 4EM2A 3RKWA 1IXCA 3EPZA 2Q8KA 4Q48A 2KHMA 1J7KA 3GZ6A 2DA7A 5TGTA 1Y8RB 1FSEA 2M2EA 2V1DA 3QU6A 1XSVA 3KEQA 4Y15A 5KAIC 3WTZA 1XMKA 2QKMB 2XF5A 1ETVA 2CUJA 3CJQB 5DUKA 3HTSB 4LB5A 5EZGA 4ZDLA 4HX4A 2HYJA 4DIQA 1LFUP 2E2JJ 1LVKA 2E35A 2NS0A 3I59B 4S05A 1OFCX 4LG0B 1Y0UA 2DO7A 1HW5A 5D6FA 4YELA 5DCFA 1R22A 2M4GA 5KVRA 1SANA 3OYBA 5EG0B 2V26A 1F36A 3RCOA 3HKZN 3ZQFA 4KDPA 3H35A 1SAXA 5IPAA 4PZJA 3CCVI 3U9GA 3K70D 1WSUA 5J4YA 1U9NA 4A3FJ 2FE3A 4U0WA 4CUGA 3H0DA 4OIPF 2IVMA 3L2VA 4Z6YA 2JPBA 4P9FA 4XLNF 1ZH5A 1MW7A 4OMYA 3DEWA 4IOCF 1TL8A 3K0LA 2R7QA 5M5YJ 4M3GA 3NRVA 4BY7J 1LNWA 4FHTA 5FROA 3G1LA 3K1NA 3W6JB 1WI3A 1WVRA 2HDCA 1EH7A 4ZTFA 1PUEE 3BQYA 3S1NJ 1WGXA 2NAZA 3K1PA 1LUJB 4RA2A 4XLHA 3KCCA 1X1CA 1BI1A 1KYZA 4W1UA 1IUFA 3IWFA 3F8NA 2DTRA 4S0HB 1KU7A 1VQNI 3L2UA 4B09A 1SVLA 2NVXJ 4LJZF 1RKTA 3SZPA 1BBYA 1DPRA 2EIMH 3S16J 3ZGKA 3RTRA 1JUMA 2DFFA 2E60A 3HSRA 1LDKB 3I58A 3QU3A 1Z91A 2R7DA 1IZ1A 2KRFA 5IYBJ 2STTA 1BW6A 2LOOA 3U1DA 5K5OA 1QU3A 1K6YA 4HW0A 4JBAA 2X51A 1TLHB 2EIKH 2VOOA 2FNPA 3FXOA 3K4JA 1JGSA 2LP0A 3K70C 1YLFA 1WHUA 4BJ5C 3KEYA 5H6RA 4HEA2 1ETWA 3GTMJ 1XX5A 2RAEA 4IRGA 4M3BA 1LDJA 4A0XA 2L2OA 1IV8A 4I7HA 3PSFA 3GLLA 4FCYA 3S8PA 3LSIA 3FK6A 4V2FA 3H5RA 5LFAA 1XC5A 3WHBA 4KIFA 3BTJA 3HUGB 2R7RA 1IRGA 2ZJPF 2WAQA 5D5VB 2KDOA 2O8KA 1HW1A 4ENMA 4HG2A 4AD9A 1V5FA 4XSXF 2LY2A 2BVLA 4I98B 1PJRA 4Z2YA 2XAJA 1XSXA 3S17J 4RGRA 4PFOA 1MMNA 5E3NA 2B63J 1R5ID 3FKJA 4BXUA 4I02A 5E8IA 2A6EF 1ORKA 4G8XA 2ETHA 3DLLF 1VQ7I 2DPUA 2M8EA 2M7AA 2JK3A 3FIWA 1S9HA 1T38A 3CQZJ 2JA5J 2L7FP 3H1CA 4F93B 3GFLA 4EJOA 2LBFA 1Z1DA 4OIOF 4B3AA 1K83J 5F1RA 3JAMK 3J7AO 2JSPA 2OTJI 3D5LA 3DBHB 2X4HA 3F6VA 2H6BA 2QYOA 1GVDA 2BEOA 4RM2A 1WH7A 4MO7A 1K7AA 4A3DJ 2E71A 3R4KA 4ZH4F 2R0QC 1BC8C 2IPQX 2K86A 5DD4A 1O7LA 2J5PA 4JX4A 2LREA 3HPHA 1WCMJ 2IA1A 2NOGA 4MTDA 2PMHA 2X0LA 4M9ZA 3OYMA 3GCMA 3EUHA 3I0TA 3OYHA 2VIXA 4M74A 5C3EJ 3RYPA 4DZJA 2DPDA 4M3DA 3PQJA 1QHGA 3DKXA 1U5TA 2X9DA 1Q1VA 1W7PB 3LSJA 2KIUA 3OYAA 3T8RA 2VBYA 2ZMEA 4ITVA 4A0YA 2Z99A 4RB2C 2E2IJ 3GUDA 3I5UA 4HX8A 1R1TA 4UV9A 3I59A 2OD5A 3GW2A 3MCZA 1SMTA 4M73A 3W3CA 2EA2A 4FE4A 5EG0A 2IA2A 3CLOA 4QPQA 2V6EA 1Z6TA 4G7HF 4XLAA 3F8CA 2ZXHA 2E5ZA 3CJRB 5GP9A 4EATA 1POGA 2XIGA 4ZZDA 2QSGX 1GV5A 3AG3H 3DKYA 2JQ7A 3MQ0A 4O6JA 4P5OA 1Y1WJ 3GX4X 4U87A 1Z67A 4HDUA 3GWZA 3CDLA 4E7HA 2WY7Q 4F7ZA 2FOWA 2ME0A 4J00A 1LPQA 2XUBA 1D8JA 1BIAA 3J81Z 1B8IA 4P96A 2R7UA 1E3OC 1HCRA 1JGGA 2KPMA 4U88A 5C44J 2WV1A 4X1EA 3V4GA 2VT3A 3T5XA 2O9LA 3GTLJ 2BVMA 3S2DJ 4IHYA 3BJAA 1W7PA 3JW4A 3M7GA 4MQ9F 2IEKA 3ZQLA 2RQPA 4PDKA 5IP7J 3FDYA 4KN4X 3M07A 3BCAA 5EDNA 3WTYC 3HOZJ 4U0VA 3DTEA 3O8HA 4XM3A 5EJCA 2QKLB 2HZTA 4CSWA 2UUZA 1G3TA 4XLFA 2VE9A 4KICA 1T39A 1EJ9A 2DI3A 2Z33A 3M3YJ 3F8FA 2VJJA 1UB9A 4BJ6C 4KFCA 2ZB9A 5K7ZA 1PUFA 4CYCA 5F64A 5LD2C 2KDZA 5IT9K 1OCCH 2KL4A 3W6KB 3V42A 4AC0A 1FMWA 1WWXA 2ZC2A 3GLXA 2XROA 1TQMA 3ASNH 3BZKA 1APLC 4PJ0C 3TW6A 2JA2A 3F6OA 4FTHA 4OIRF 5IT9Z 3L7WA 3IKTA 2ZXWH 3Q5FA 3CJTB 1JXSA 3BY6A 3OOUA 5JHUA 2UWMA 3A01A 1SAUA 1TNSA 3DCFA 5IT3A 5DEQA 1OKRA 1SD5A 1W1WE 3DXJF 1PDNC 2Y30A 2YU3A 4XORA 5BMZA 3BR0A 2K4BA 1IRZA 2I8DA 3DPLC 2BY0A 3RQ4A 2OU2A 2LYCA 3MAJA 3SJMA 4XQFA 1BOBA 1XDUA 2P7CB 3PFYA 3ZQQA 1LKXA 2QBYB 3ZQIA 1JI8A 4DBQA 3MWMA 1P7IA 5CLSA 2L01A 3DWLE 3S3MA 3BROA 1MNDA 4C2TA 2GA1A 2OUMA 3L2RA 2A68F 1TWHJ 3BPXA 3Q3SA 2XB5A 3KP2A 2FD5A 2KMUA 2VXDA 2DA1A 3PSIA 2EZLA 2Y69H 3QOEA 4D7MA 3PNVA 5TRDA 3H5AA 1N77A 1DQUA 2DMNA 1J0RA 1FWZA 2HGCA 2IA0A 3G3ZA 1SFOJ 4HBLA 1G59A 2GM4A 1A04A 3K69A 1VQPI 2O61A 1Y56A 4WK8F 3A02A 2O8XA 2R5YB 5GTHC 2FBHA 2HVSA 2Y48A 1IXSB 1SFUA 1AKHA 2EFPA 4DJAA 3CUQB 1R58A 4LLLA 2V1XA 4AUXA 4UUSB 4FETA 4A3EJ 1GVJA 3P7NA 3M1CA 3SEZA 5HVQC 4UB8C 3LSPA 3H3UA 2IGKA 2E2HJ 1ZYRF 1J5YA 2RREA 2DA2A 5GAGJ 3TQNA 2R4GA 4MNUA 1F9NA 4B1RA 2R7WA 2A61A 3HHGA 3ZMVA 4BE1A 4HAMA 1IXRC 1T6SA 4ZYAA 3PIPF 4IKFA 1SD6A 2IGNA 3OYGA 4KNYA 4KT6A 2HQAA 1NK2P 2RVCA 5JVTA 4LLGF 3D1NI 1T33A 5CKTA 1RESA 1N75A 2BZTA 4ESJA 1G8XA 3DU6A 1ON2A 1RPWA 1YG2A 1ULYA 3CC4I 3JAMZ 3QWLA 4H4KC 2M1BA 2XAHA 1PP7U 1Z77A 2PJRA 1OPCA 3HBLA 3ABTA 4A12A 2GXAA 2L9VA 4L9VA 2ELHA 2DOEA 4HSRA 4LITA 4E7JA 2P4WA 4ZYEA 4A69C 3BQZA 5D5XB 2QUFA 2LF8A 1U0JA 1U5TB 2R7XA 2VPLA 4NQWA 3BTLA 2ESHA 5L3FA 2CGPA 2HOAA 4L9JA 1WH5A 2E34A 1RUNA 3PUBA 4RAYA 2F5VA 3FHZA 2K4JA 2MSYA 3VOEA 4RGUA 3AKZA 4Q47A 1UG2A 2ELKA 2DCEA 1S29A 1NHAA 2JUGA 4M6VA 2EFOA 1ZHFA 2EA4A 2QZ8A 2V9KA 4A3MJ 2XHKA 4ENNA 3A01B 1OISA 2JT1A 3IAM2 2Q2EA 3PFIA 5BPDA 4ASNA 4XKBA 2BY2A 4KUMA 5FFXA 5J47A 3DEEA 2EK5A 4CCOA 3WTVC 4NC8A 5J6XA 4CA0A 5L3DA 3TMOA 1VTNC 1HA8A 2BV6A 3FM5A 4OAZA 1YYVA 1U3EM 3N4MA 2XGXA 4XMYA 3CDIA 2NRAC 2GXGA 3HZJA 1KQ9A 1ZGJA 4BYYA 3EUHC 2XRLA 2HQNA 3HIFA 3MZHA 3BR6A 3K10A 2Z2SB 4EJWA 2BE5F 3S14J 3AL0C 2QQBA 5FKNA 3BG6A 4RB0A 4HNVA 4BQAA 2DQRA 2DA5A 4M6YA 3U1KA 2OCCH 3KETA 2JJ7A 1WZ2A 2ZSHB 1KU2A 4GYIA 1G3SA 2GA2A 3ZOBA 3J7AY 3F8MA 5L3GA 3FWEA 1LB2A 1H9GA 5HS7A 1OQYA 1TT0A 2XB0X 5JVGF 4MGRA 2XSJC 4LGWA 3TO9A 2LLKA 4RGSA 2L7MP 1XN7A 1YE9A 1TP4A 2D2WA 1QPIA 3HOVJ 3PUFA 1W5SA 2HVQA 1LEAA 3I9V2 3V8KA 2FJ1A 1RC9A 3K4MA 2LMDA 3MEXA 5IOZA 2EIJH 3CJNA 2L4AA 1I5ZA 3HRTA 1GV2A 2LD5A 5ILSA 4FISA 3R0AA 5CVRA 3CMAI 3A0BC 4YFXF 2CW0F 5LEJA 4D5CA 5K7FA 4OWRB 2P81A 1UHMA 5E3OA 2L3DA 2KIMA 2MABA 1HOMA 3PIOF 2ZXIA 4LFUA 3W2VA 2R5YA 5CVIA 1RNLA 1TZLA 2DA4A 2O3FA 4BS9A 4IQJA 3CO6C 3HPGA 5E1XA 3OL4A 1JT0A 3K4KA 4XRMA 1UHWA 2NVQJ 4ENKA 4KIBA 1MJ9A 1TWFJ 2IS2A 1E2XA 3E3VA 3G2BA 3RZDJ 3OR2C 2OTLI 3S1QJ 1L0OC 4MEYF 3PNTA 4TV7A 5HDGA 2R3SA 2ZXJA 2M0CA 3A2KA 1MNMC 4JX5A 3S93A 2MD0A 1A31A 3F22A 5ERIA 2CQKA 4CGZA 5D6EA 2X48A 2V1UA 2PG4A 1IDYA 2BHYA 1FTTA 2IJLA 2JWTA 2FXAA 4IF4A 1HXDA 5DCMB 2PBIA 1R9TJ 2V1NA 5ICCA 2OC6A 4I6ZA 4Y3OA 5J1YA 4ZYGA 5DM6F 5B1AH 3CC7I 4JOMA 3MKWB 3OSFA 4LB6B 1IF1A 2KKOA 3DKWA 3C2HA 2YUSA 4ZJZA 1YFHA 1KQ8A 1Z7UA 1WQ2A 3CCUI 4HDVA 4XONA 3KYCB 1Z0XA 3LWFA 4GO1A 2PEXA 4B47A 1GXPA 1CGPA 1H89C 4BE2A 2PFBA 1XSDA 2BW3A 2CS3A 1A35A 2ME6A 3RDIA 4M3EA 2CG4A 1ZGAA 3LQRA 4ZC3A 4BGDA 2KRCA 2XAUA 4ANJA 2KZGA 3ECOA 3M4OJ 2VODA 2Q2EB 2VQLA 4GGGA 2ZJRF 1VQ6I 3OYEA 5FLXZ 1A6QA 2HPMA 4M72A 5D8LB 5FJ8J 2PJPA 4LIUA 2NVUB 1ZR4A 3A0HC 3WTTC 1U2WA 1XMXA 1XDSA 2X6XA 5EZHA 1HDPA 2FQ3A 4XOTA 1S8NA 4MFEA 3WGIA 1IAWA 2JA6J 1XG1A 3AFHA 4Y33A 1FOYA 2HDDA 3CMYA 1NK3P 1U8RA 3LFKA 1XGOA 2AQEA 4JX6A 3GFMA 1FMVA 5FD6A 3LAJA 2MLGA 4EM1A 1FYLA 2MFZA 3KP5A 3IP4B 1SFKA 2VJIA 1A5JA 3ISPA 4CYDA 4PSWA 4IHWA 3QP6A 4CICA 3BLYA 5DUIA 2DLLA 2VBZA 1D0YA 1X4PA 1TQIA 3QPHA 2CUEA 3L09A 4ESFA 3LSHA 5H2FC 2HQRA 3PO3J 4C2UA 1USTA 3QPSA 2Z1DA 2VC1A 4YIIA 1W0TA 3F9KA 2LY1A 1SVMA 3E1SA 3S2WA 4WXDA 1AOYA 1Z6RA 4D1QA 1MMGA 2KRHA 3WU2C 4L0ZB 3BJ6A 4I76A 5F04A 2IW5A 5CJ9A 2RNJA 1MJBA 5B3SH 2WTEA 2XGCA 3OYNA 2IS4A 4DQ2A 3ESWB 4G6QA 3SHFA 2MH2A 3L2CA 4L5JA 1KU9A 3WTSC 1AHDP 3DP7A 1LFPA 1XPXA 4QTRA 4AU7A 2MC4A 5JR3A 4WF2A 2R7TA 2ZNZA 1EH8A 3KP4A 2XSDC 2LC2A 1FYMA 3E6DA 5J3LA 5HLGA 1W4MA 1UZCA 4CCJA 4E7KA 1ZG1A 1BR4A 4B8XA 1S3JA 1OCPA 3CUQC 3ELKA 2HOTA 2H6CA 5E3MA 1USSA 1FYKA 1K4TA 1K79A 6PAXA 1MMSA 1ZRFA 2VJ5A 5KNLA 3UKGA 4X6AJ 1FP2A 2HI3A 2MG4A 3OYKA 4UHTA 5EGOB 1CF7A 2WB1A 3CCRI 1VQOI 1HW2A 1OYIA 2AHQA 3RKYA 3HEFA 2K9QA 4N4NB 2DJNA 4I0AA 2AQFA 1FEXA 4Y17A 4E7LA 1RKWA 4PJJA 1GXQA 3F0CA 2ECCA 1B1BA 1XCBA 1S5LC 1IN5A 2OQGA 1TBXA 4E7ZA 5HS9A 1O3QA 3S1MJ 1BI3A 4BE0A 1Y6IA 2PI0A 2RNGA 4YIRX 2LTPA 3LSGA 5KCMA 5E18F 3ONQA 1X3ZB 3KLNA 3S32A 4XKVA 1FZPB 2CUZA 2E36A 5DYMA 2M34A 2E1OA 2KLOA 1VI0A 5IYDJ 3QYEA 4HV6A 2VOPA 5FLMJ 3HXLA 5LEKA 4F3QA 2YR2A 1ZLKA 4D7NA 3VODA 5B1BH 1JKQC 3ULQB 2XPUA 4HOBA 2ZMEC 1V4RA 1HKQA 1SMYF 1YO5C 4HRIA 3SXYA 5CPRB 1JHFA 1F5TA 2V6CA 4LK1F 3L00A 5FKMA 2N8GA 4A3KJ 2HVRA 1YW9A 2XF6A 5J1UA 2X6YA 1VFCA 4KA4A 3EDPA 5LHGA 4CZZA 2GZWA 5HOOA 2D1VA 3VDXA 3DLAA 3OS1A 4LG0A 3TL4X 3OYIA 1O4XA 4Y4RA 2M8GX 4E6KG 5LGTA 1PYVA 4BEHB 2HEOA 2VT2A 1SC7A 1I27A 1A6IA 3GZ5A 5FLVA 2O5RA 3QODA 1VQLI 2FMYA 1MBKA 4KISA 5LGUA 1XB4A 3KX2A 1FBQA 1DP7P 2QWWA 4OOIA 1W5TA 1VQ8I 4CDGA 3ZMDA 1JT6A 2YX7A 4YG2F 2HQ5A 2Y9YA 1NG6A 1Z3YA 3ROUA 2ISZA 3ZP5A 5H6QA 3WG9A 4CZCA 2IS6A 4CH7A 2EV0A 2GXBA 3REOA 2JPCA 4WWCA 2JRMA 3DQVC 2LVSA 1FIAA 2G7UA 2KT0A 3TO6A 1WJ5A 3CP8A 1K6OA 4I01A 2VKHA 2KJBA 3BR2A 4MQVA 5E1WA 2H8RA 3DPUA 3M8FA 4DOZA 3MKZA 3BG3A 3HL2A 3U2RA 4AIHA 5B5EC 3CO7C 1YJWI 2CWEA 1WJBA 3BR3A 1DU6A 2ID6A 3SEQA 4ETSA 3RSNA 2PMUA 1QRYA 2CQXA 2JUCA 1W7PD 2HKOA 1B72A 2XAFA 1UHSA 3JRIA 1P4XA 2DOFA 4UVAA 1J9IA 2ECBA 4KJZA 1IUYA 1I6XA 2DA6A 3FHNA 1PVEA 2ZFWA 3J80Z 3H0GJ 4DZPA 3VYSB 1WFXA 3C3WA 2KFDA 3SDBA 3V8JA 1T0FC 3HC7A 2BGCA 3FKIJ 4F92B 2PQ8A 3HYIA 1R1VA 4HSTA 3FM3A 2DK5A 1VNDA 3TOAA 2B7EA 4BBRJ 3S2HJ 4XRSG 2P8TA 5HODA 1I6HJ 2WA0A 2HU9A 2WBMA 2PLYA 1M1EB 4O5VA 1B72B 2F4IA 2GLOA 4CCNA 2BXYA 4UVCA 4A2UA 5ILVA 3CESA 4V19K 2WAFA 2IRFG 5FLXK 1E17A 2LKSA 5EGOA 2DTZA 2OCEA 3NWSA 4QPOA 3SFIA 4F52A 4BJTA 1T95A 3L2QA 3QRFF 4IHVA 1FJLA 4BHPA 3MFKA 1LVAA 3QQAA 4MEXF 2GAUA 2M7BA 2RKHA 2M9HA 4B44A 4A3BJ 1TQPA 2IS1A 2VQCA 2WADA 2P6TA 2L7ZA 1WKMA 2DK8A 1YIOA 3BZCA 1O7FA 3SZTA 2G0EA 2XDVA 3KZYA 1QBJA 1X19A 2TCTA 4EJUA 3KYDB 1UELB 2DJIA 2ZFUA 3BT9A 4AIKA 1SD4A 1JKOC 1TTYA 5K5RA 1RIOH 1TWCJ 3VPRA 3G4SI 3WGHA 4OIQF 1V54H 2EWNA 2KIQA 3CTAA 1BJAA 2IT0A 3I54A 1WRJA 4RAGA 5E8GA 1MBHA 1N25A 1MBJA 1VZ0A 3Q0VA 1U8BA 1MD0A 1P4WA 2DFIA 2ZNYA 2OJED 3ABMH 4WCGA 2UXNA 4A3JJ 3ZQHA 3TKYA 2B9SA 5CYVA 2DOAA 5CQGA 1RI7A 3ABUA 4AVPA 1CQTA 5GPCA 1WJAA 4EEFG 2QENA 3CCSI 2BY1A 2W48A 4RLFA 3RKXA 2DBBA 4A3IJ 3TO7A 1TWAJ 5ED4A 3RPUA 4G6DA 2TDXA 1ON1A 2DW4A 1FOKA 4E70A 3DV8A 3PO2J 3OIOA 5BQTA 1GHCA 2HPIA 1R5HA 2VBWA 2R7SA 3JCUC 2DFHA 5J8CA 5C4XJ 3SYTA 2NS7A 2QF7A 2JVHA 1DGWY 5DD8A 3GO5A 4L5EA 3ZPLA 1YI2I 1PP8F 4XR6A 2K3PA 2F6CA 2P5KA 5IYCJ 2STWA 2W82A 5AONA 5LGNA 1B9MA 1LQ1A 1P6RA 1BR2A 4RS8A 1H0MA 1TNTA 2MLKA 3FMRA 1J09A 3EYIA 2NVYJ 3KLOA 3WGGA 1UAAA 1O3TA 2KJCA 2RN7A 3BCBA 4E7SA 1R4NB 2XGDA 3FK7A 4CCMA 4MLOA 3A4CA 3IH2A 2ADUA 1ZTRA 3SZGA 4PUSA 2DT6A 1ETQA 3KYLA 2R7VA 4GDFA 1QHHD 3LOCA 2HOEA 2OZUA 4BY1J 1XGMA 5LHIA 3CC2I 2EQRA 3I64A 3X2QH 3KP3A 4PFPA 1YJNI 2VPRA 5D8KB 1QPMA 3GXOA 2DU9A 3BR1A 2GQQA 1N78A 3OYLA 4IZZA 2EINH 1LE8A 1JUPA 2GIZA 4GCVA 1T8IA 1FPQA 3RJPA 2ZKZA 2HDWA 4NC7A 4KITB 5J1RA 3BG7A 3WTXC 4G7ZF 3O3KA 2ISYA 1W36D 5JLXA 5B66C 4U7BA 1L3LA 1X1AA 4HA8A 5L3BA 2E5NA 3I4PA 4CCLA 1KA8A 2H09A 5D5WB 1GT0C 3P5JA 1JHHA 5HNFA 1X1DA 2HYFA 4Y7NJ 2PN6A 3PQKA 4EVIA 4BUPA 2QCOA 5DM7F 4S04A 3LSMA 2I10A 3SFZA 5KK1A 4I2OA 3K6GA 1HSTA 4ZYHA 2RC4A 3MZYA 4UB6C 3F72A 4RM3A 2Z3YA 1YW8A 1FOWA 3CMEI 3FBIB 4FT8A 3K1MA 4PJLA 1PUFB 1YX3A 2V9PA 3B73A 3ZXSA 2LBFB 3ZN0A 2VQGA 1ENHA 3FMSA 4XRFA 1Y1VJ 1FY7A 2EZIA 3U21A 4FQGA 3HJEA 4IHXA 3KIOA 5DCMA 4O3MA 4RMNA 1T56A 3BWGA 4N4OB 2PMZN 3M1EA 2ZSIB 2K40A 3F23A 4BHCA 1ZG5A 2RGVA 3E7LA 3RQIA 1BN5A 1SD7A 1UG0A 3HOYJ 2O6GE 2EBIA 2GWRA 4M3FA 4LD5A 1W36C 2ELJA 2R93J 2DODA 5FFZA 3V8LA 4OINF 4I09A 1F1ZA 4HLXA 3OS0A 5E1ZB 4L18B 2AO9A 2AXTC 3H92A 2QSHX 3V7RA 1MDMA 2X1DA 3I4NJ 1MGTA 2R5ZA 3J80K 2ZMEB 2L4MA 1QVTA 2CRGA 3CF2A 1IN7A 3FXJA 5BS6A 4UXNA 2VL8A 4AM3A 3JTHA 3K9TA 3TW7A 5D4SA 1OCOH 3I56I 3KFWX 1X58A 3CCYA 5DS9A 1LEBA 1HDDC 4IVNA 1K4SA 2QLZA 3FXMA 5GAHJ 1QZZA 3FF5A 4XIDA 3PNYA 1O57A 2JSCA 3CLQA 4XNFA 1BC7C 1BIBA 3GEZA 2YSRA 4QLCU 3IV5A 3HRMA 4XICA 1JE8A 2LF7A 3DTKA 4OU0A 1JUSA 3HUGA 3LSTA 1MZBA 1DGRM 1WI9A 5BPIA 1X3WB 4J19A 2CQQA 3Q9VA 2WWYA 3K2ZA 4KT5C 5DDGA 1WPKA 3H9GA 2DDBA 3HHHA 3B6AA 2EPFA 2MGQA 3I53A 5LRRA 1IDZA 3UR3C 2ICWG 5M5XJ 4EGYA 1GLNA 2BHZA 3V7CA 1XMAA 2CSOA 5TISC 2R5ZB 1JKRC 3HOUJ 3VB2A 1D3YA 1FIPA 4M6XA 5F1JA 1FSHA 2LFBA 3P9KA 1IRFA 3KE2A 4LMYA 2F5EA 1UFMA 2W85A 2K9NA 1Z05A 5CQEA 1DU0A 2EILH 1KU3A 4ZDPA 2EH3A 2MD5A 2CW8A 2DN0A 2HS5A 3OV8A 5FB2A 5F0CA 1OMIA 2HTSA 2VC0A 2ID3A 2LNBA 1BA5A 2HNHA 5LRSA 4Q4ZF 2EFNA 3M8JA 1MNEA 4KYWA 2VQHA 3HRUA 1IO2A 3H9QA 1KYWA 3QYBA 1TC3C 4FX0A 2R92J 2P0WA 5C4JJ 3MMYB 2J5OA 3LNQA 3CUOA 4B3XA 4HQEA 2K5CA 2W84A 5FKLA 4P9UA 3OS2A 4UUVA 1ACIA 1MBGA 2P5LC 4YRVA 4BEHA 2VE8A 3VFZA 2H27A 3OSGA 3DBRB 2GIVA 1NTCA 2HWVA 5FKOA 1OYYA 2QM3A 2DMTA 1R36A 4AYBA 4G12A 3JRGA 2G9WA 1R7JA 2FUG2 2A5WA 2WV0A 3E5UA 4BKXA 1G2HA 3M8EA 3O8GA 4A3CJ 3LA7A 1LFBA 1VQ5I 2L7KA 2RDPA 3WU0A 2G7HA 3ABKH 2Y0SA 3R6SA 1YTYA 1AWCA 1YS6A 4C3IJ 4G9YA 2VASA 2XPVA 1QA6A 2M3AA 2A69F 4G7OF 3K2AA 4U0YA 3BTCA 3OYJA 2JVGA 1OR7C 4E7IA 1HKSA 2HR3A 2P6SA 3BJOA 3QYFA 3VEPA 3T8TA 3RIRA 4PJNA 3D5RC 5FGMA 3MVPA 4DGWB 2Z16A 4PGGA 4KMUX 1UJ8A 2JZYA 1D0XA 3GMEA 4M9XA 3CZ6A 5GAEJ 3FMQA 3IC7A 3PJRA 2A5YB 2F4OB 2NOJB 3WE2A 2X6OA 1RR8C 1Z21A 5M3FJ 1QNTA 3HTUA 2OPTA 2WC2A 1S7OA 3K4NA 1VQ4I 3FBNB 3P9CA 3S1RJ 2CV2A 2CV1A 2W57A 4BQNA 3OYFA 4BDZA 1OYWA 1F4KA 1D1AA 1XD7A 3H3ZA 5E17F 4D9JA 2K27A 3E97A 1P9QC 4CYCB 4JP0A 1FP1D 3W2AA 4R79A 3JREA 3Q0UA 1FBSA 4WXCA 1MDMB 4IOAF 5CVUA 4PCQA 2LG4A 5BNGA 4MTEA 1O3RA 3GFIA 2Q0OA 1ZGWA 3FXUA 1S72I 3EYYA 3ZQCA 4BXFA 2F5FA 3TEDA 1MSEC 4K2EA 5GPAA 4A5MA 1EKEA 2HYGD 2ZBKA 4RAFA 5M3MJ 1DP3A 1ZRCA 1H88C 5J4VA 4A6DA 1R23A 3L2WA 1IRXA 3OMYA 2W1OA 2EV5A 5HS8A 2K3FA 1G6NA 3KEOA 4EV0A 2VI6A 1EF4A 4UUSA 4XL9A 2ESNA 3IRQA 2YX4A 4UUTA 3HOXJ 2FBKA 1HSJA 3EUKL 3O2PE 3IHUA 2W00A 2QBYA 1P7JA 1HLVA 5EEAA 3HSEA 4R1HA 2EB7A 3BZ6A 3CDHA 3IH4A 3UNGC 1YJ9I 2XF7A 1KONA 3LL7A 4OAYA 1B4AA 2HTJA 2D5VA 4EQQA 1JKPC 3DF8A 2DT5A 3VSLA 2IGMA 3LA2A 4N0BA 3HGGA 1MMDA 3I4MJ 1R49A 4A6EA 3WTWC 3QOPA 3CCJI 4XLPF 5E3LA 2Y9ZA 1KGSA 2GOMA 4BU2A 1D8KA 3J7ZI 3OY9A 1ERDA 1K61A 3N97A 3WHCA 2DMUA 5EEHA 4GRIA 3MKLA 3LSRA 1J75A 2RV8A 1IW7F 2L02A 1OJLA 4IX7A 4NNJA 1Z3XA 2DYRH 4ON0A 3CCQI 3FZVA 3HRSA 1EH6A 3WE3A 3BR5A 3BTIA 2JRTA 3COAC 2FA5A 1I39A 1EV7A 3CP2A 2FBIA 3JSPA 3I71A 2CH0A 1JTXA 5ICEA 3IUOA 1YRNA 4NC6A 4B43A 3AG2H 2OV7A 1X1PA 3D5SC 5F08A 3B6CA 4PJMA 4EM0B 3NWTA 2X6WA 3O6BB 2V7FA 3CCEI 1OCZH 2XGEA 3HSFA 2LSOA 2XV4S 1Z9CA 4Y52J 1ZAOA 3AAFA 1QGPA 2M4KA 1T08B 2L9RA 4KN7X 3NARA 4BACA 2HZDA 3IKVA 2W4SA 3FXRA 2VBXA 3M9AA 3L1PA 3HOSA 2F5CA 2HFHA 3Q0WA 1MH3A 2XAGA 5ICGA 1KQ0A 2M5WA 4QWQA 4RDUA 3W6VA 2MH9A 2K02A 3G6EI 2DT7B 2NNNA 2E7XA 3EETA 2E1MC 1P92A 3GF2A 3G1OA 4MIMA 4ZDOA 1JTYA 2ZO4A 2CFXA 4FASD 2W24A 5DTDA 3GYHX 4G6TB 2HXOA 4WXHA 3KZIC 1LDDA 2UZKA 3K4LA 3ZMTA 3WTUC 2OZ6A 5GTIC 2Y0SN 2DA3A 3D0SA 3GBGA 2HOSA 1S6LA 3GTGJ 1ETOA 2PX9A 4XKWA 4L9TA 1IC8A 3BP8A 1HKTA 4A3GJ 3OOPA 5BOXA 3TBIA 1IN8A 4HPQA 2E19A 1D1CA 1FT9A 1VQ9I 3GZNB 1B6AA 2YU9J 4W97A 3JRHA 4XSZF 3QAHA 4KIGA 3R61A 2QVOA 1ETKA 2R7ZJ 3E5QA 4UV8A 3ZMSA 2MW8A 3ZMZA 2L9NA 2BY3A 4YFNF 1STZA 3H5NA 3C1DA 2DAOA 4Q5SF 2CU7A 3JSOA 4J01A 1AU7A 3ZRGA 1LJ9A 3HKZA 1EA3A 2M87A 4XK4A 1XGSA 2B0LA 2HKXA 4EGZA 3RZOJ 3N05A 3MKYB 1NG7A 1WJDA 4V2GA 2DYSH 1YX5A 2PMZA 4NDLA 2CQ7A 3LAPA 2CJJA 1YQAA 1FX7A 2O7OA 3MN2A 3OYDA 1ZR2A 2CUFA 3E6CC 2VB6A 2XRNA 1X3UA 4RB3C 3CD6I 1D5VA 1OLTA 2ZJ2A 3IWZA 3DPTA 2EZHA 3EUAA 3HM5A 4EJTA 1MH4A 3P9IA 2M0MA 1ETYA 2F4MB 3RPQA 2E1NA 3CF5F 1QVUA 1DDNA 2V4JC 5HLHA 4XLCA 2KQRA 3TDZC 5LLQA 2R7FA 2DFEA 3S15J 4C30A 5FO5A 4IRHA 4CXFA 5CVVA 1AKHB 4IPAA 4LK0F 3T0YA 1X4OA 1J2XA 1H8AC 3GTJJ 3GTKJ 1S7AA 2F48A 3H36A 4LIVA 4KMFA 4UY8I 3ERED 2K85A 1QZYA 2R7OA 1BL0A 3AG4H 1X1BA 2OF7A 5D4RA 2JA7J 1MSFC 3F8BA 2XKPA 2L9SA 1H9TA 1J59A 1FLIA 1YHQI 3B02A 2LK2A 1P2FA 5JLWA 2A05A 3LFUA 1MJAA 2H1LA 2CO5A 1K78A 1S7EA 1X2MA 4IEJA 1IG7A 3BDDA 1E0EA 2LRDA 4XLEA 4ZTJA 2LKXA 2VKDA 1W0UA 3OIPA 2DMQA 3PM1A 2EFQA 1SFEA 3IH3A 3OL3A 1IV6A 4AYBN 2DXIA 4AIJA 4IL6C 3RKQA 2P5VA 1YW7A 4OMZA 4XN0A 1T2KA 1IN6A 4AVZA 2EFWA 3ECHA 4HF0A 3EQLF 2BOLA 1R5GA 4Y13A 1IGNA 5HLIA 4RGXA 2LDUA 4BQQA 1RR7A 3VYRB 2QA4I 4HV5A 2JTVA 1RZ4A 2VN2A 3VYTB 9ANTA 4L9NA 3BG9A 4BH9A 1SVOA 2CFOA 2XVCA 2XKOA 4IQ4A 1ZK8A 1HBXG 4PK4A 1U78A 2PJRB 3H9JA 1MBFA 4BQOA 1W5CC 5EEGA 3GTOJ 1R4MB 3K4BA 4XKCA 1Z7LA 1ZKGA 4GXOA 2P7VB 4II2A 2QQ9A 5F27A 1G3YA 4YEJA 3LA3A 3WG7H 5AIQA 4IHTA 3LSKA 2F2EA 4XBFA 4D5FA 3E0JB 3JRBA 4QIWN 2BXZA 5HDNA 1ODDA 1TT5B 3A1YA 4DYQA 1Q1HA 2LKPA 3ZN1A 2HXIA 1D0ZA 1JJ6C 3LMMA 3G71I 2OA4A 1ZG3A 1VQMI 1HF0A 1BW5A 5KAFC 3I55I 1BR1A 2O03A 2E7WA 4ZZLA 3CCMI 5ICFA 3TGNA 5IY5H 1P4AA 1T98A 3I3LA 5DV5A 4DYCA 4HLYA 4L0YB 1V3FA 2WY8Q 3ABLH 3E6BA 1TW3A 1BI0A 2XPWA 3K7AJ 3SQNA 4IO9F 2K9SA 4N9IA 1RRJA 4FE7A 4M9SA 2Z5UA 4HX7A 2IBDA 4I99C 3CUQA 3FXLA 1YS7A 2FEZA 1AA7A 2UV1A 1I1SA 3F21A 3OWTA 5AIPA 1QQIA 1TWGJ 4HYEA 1ZRDA 1XS9A 3H3VK 1Y8QB 4LG3A 3SDGA 2X1EA 4HF2A 1U6GA 5K1YA 3KZZA 1C0WA 1E3HA 2O0YA 1QZEA 2JN6A 2C6YA 1FNNA 2QQAA 4HNUA 2RQQA 4HQMA 4F91B 5EF6A 2KP6A 1G3WA 1ZREA 2AXLA 2EV6A 4XN3A 5EYRA 3WU1B 3RI4A 3ASOH 4UVBA 3ZQ7A 1FC3A 1VF9A 2A3SA 3A03A 1MMAA 3VWBA 5K5QA 3E5XA 4NQWB 5HNHA 1HQCA 4BL0B 2LR8A 5CVJA 1I3AA 1DUXC 1R6RA 4A5NA 2TRTA 1MBEA 2CYYA 5E20A 3LQQA 1BJZA 4C2MJ 2VKVA 4GYGA 3JRAA 1R71A 4P1WA 3HG9A 5LBQA 4HZFA 1FOXA 1I3QJ 3ZCOA 5IOYA 2Y31A 3IRRA 2CMPA 4P55A 4A3LJ 2X85A 3C7JA 1ONVA 3W2WA 4DBRA 2H94A 2COBA 2VKEA 3DFGA 1JJ8C 1MIJA 3HDDA 2IP2A 1TW2A 2FMLA 2K9MA 3OYCA 2IXSA 4II3A 3TDUC 5L3EA 1V5EA 4NHJA 2Q1ZB 2ACJA 3R60A 4HF1A 5KHDA 1R00A 3GFJA 3KP6A 3R0JA 2COMA 3TP3A 2Y75A 3FXKA 4C3HJ 2L5QA 1G4DA 1GUUA 3PL8A 1DPUA 2L0KA 3NEUA 1XCVA 1ITYA 3S3NA 2FRHA 4PSXA 1ZN2A 4NBQA 4ENJA 1NH3A 1OCRH 2FU4A 5F0HA 1T0FA 4A0ZA 5IP6A 1U5TC 2MBFA 1YIJI 4MFDA 4G94A 4CO8A 2XAQA 2QQ8A 4C3JJ 3HOWJ 4X0GA 1YITI 2D45A 3QPLA 3ERMA 3KPHA 2VUMJ 1ZLJA 2EZKA 2KIFA 2MA3A 4BBSJ 1RETA 1LE8B 3V7SA 2OQRA 4ABZA 4XOPA 3DU5A 5E79C 4RAZA 3J81K 1ZQ3P 3JR9A 3F3XA 2I5UA 4BAYA 2VXZA 2CV0A 2V9VA 1ETXA 2FSWA 2BBYA 3TOBA 3ZQGA 4RBOA 1UCRA 2X1CA 5FKKA 4N9HA 1WJFA 4B4CA 1U9OA 2KISA 4FX4A 4U7DA 4RB1A 1WJEA 2NXNB 3QPTA 2IGOA 4AIDA 3MD2A 4NB5A 2MC3A 3L9FA 1ZELA 1WJCA 4WX9A 2YS9A 4LLNA 3T1BA 3GVAA 4CCKA 2XC7A 4EMSA 2YPRA 3WODF 3NAUA 5JHFA 2VJ4A 2ZCWA 4IJAA 5J40A 2FNAA 4M71A 4L5IA 4EJVA 4CHUA 2VONA 5ILUA 3CMMA 3IL2A 4A93J 2LH9A 3S3OA 1MKMA 1IJWC 1GDTA 5A2QK 1VQKI 2V79A 1FBUA 2Y2ZA 4UNOA 3DTIA 1D5YA 3DBLB 3ZR8X 1I1GA 4DW6A 1XGNA 1YOVB 5LHHA 1X2NA 2CW7A 1Y39A 2A07F 3MZ8A 2W25A 4C9YA 4IRIA 4YFKF 2FF4A 2W7NA 2VLAA 3RYRA 3KP7A 1REPC 2NVTJ 5L3CA 2A6HF 2BYVE 1R1UA 2A6TA 2EJRA 1O3SA 1B9NA 3JTGA 2E1CA 2QEXI 1A36A 2UXXA 1V5GA 1K78B 3VSKA 4JK1X 3HOTA 1I50J 2DMPA 1E3PA 2WB1N 2D1HA 2IAIA
chains in the Genus database with same CATH topology
3RSNA 2K9LA 3UNGC 2XF7A 1KONA 3LL7A 4OAYA 3VSLA 2IGMA 2HVSA 1MMDA 4KJZA 3FHNA 2KZVA 4DJAA 2GOMA 4BU2A 3VYSB 1WFXA 4FETA 5FRNA 3SDBA 3OY9A 1T0FC 3HC7A 1ERDA 3M1CA 3SEZA 4RLQA 4F92B 2GOXB 5HVQC 4GRIA 4HSTA 2IGKA 2RREA 4IX7A 2R4GA 4NNJA 1Z3XA 2WA0A 2R7WA 4BE1A 2HU9A 2WBMA 4ZYAA 2F4IA 4BDYA 4IKFA 4CCNA 2IGNA 3OYGA 4KT6A 2HQAA 3CP2A 3CESA 2CH0A 2WAFA 5CKTA 1N75A 2BW3B 3NWSA 4QPOA 3IUOA 3IAS2 4F52A 4B43A 1T95A 4BJTA 3L2QA 3AL0B 1G8XA 3DU6A 2OV7A 3D5SC 2M7BA 4H4KC 4B44A 2IS1A 4PJMA 2VQCA 2WADA 3NWTA 4B48A 2X6WA 2V7FA 5HLTA 2PJRA 2WAEA 2XDVA 1X19A 2M4KA 3OIQA 4HSRA 4LITA 5FRMA 1D1BA 1UELB 2HZDA 4BACA 2DJIA 2ZFUA 4E7JA 2W4SA 4HNTA 3HOSA 3VYUB 3OR1C 2MYSA 1U0JA 2R7XA 2VPLA 4NUBA 2DT7B 3BC8A 3K4CA 3PUBA 2E1MC 2F5VA 4ZDOA 1VZ0A 4FASD 3AKZA 4G6TB 3C2GA 2DCEA 4E4HA 2JUGA 3RPUD 2DOAA 5CQGA 3K4LA 2V9KA 3GBGA 4JQFA 4F55A 1WJAA 2E1MB 4XKWA 3EPZA 4RLFA 3IAM2 2KHMA 3TBIA 4XKBA 5TGTA 4HPQA 1D1CA 3DEEA 4CCOA 4NC8A 2QKMB 4CA0A 3TMOA 2XF5A 2HPIA 2R7SA 1HA8A 2CUJA 3CJQB 4OAZA 4ZDLA 3SYTA 4XMYA 4DIQA 1LVKA 2L9NA 2JVHA 3EUHC 1DGWY 3H5NA 3K10A 2Z2SB 4J01A 4XR6A 2K3PA 4YELA 2F6CA 3ZRGA 3AL0C 2M4GA 3BG6A 3HKZA 2W82A 3OYBA 1EA3A 1BR2A 2V26A 3N05A 3RCOA 1NG7A 1WJDA 3H35A 3MKYB 2PMZA 1YX5A 1J09A 2ZSHB 3OYDA 1UAAA 4E7SA 3BCBA 4CCMA 3K70D 3J7AY 4MLOA 3A4CA 2VB6A 1TT0A 3SZGA 4PUSA 4CUGA 3H0DA 2DT6A 1OLTA 2XSJC 3L2VA 3DPTA 3EUAA 3KYLA 2R7VA 1QHHD 2M0MA 1YE9A 1MW7A 2R7QA 4PFPA 2V4JC 2HVQA 5FROA 3I9V2 4XLCA 1N78A 2KQRA 3OYLA 4IZZA 4ZTFA 3K4MA 4C30A 4NC7A 2HDWA 4XLHA 4KITB 3BG7A 1X1CA 1X4OA 4LIVA 1W36D 4U7BA 3L2UA 2R7OA 1X1BA 4OWRB 1X1AA 2MABA 2E5NA 4CCLA 2ZXIA 3ZGKA 2L9SA 3RTRA 3W2VA 5HNFA 1TZLA 1X1DA 2E60A 4BS9A 4IQJA 3HPGA 1LDKB 3LFUA 3OL4A 3K4KA 4BUPA 2LOOA 1QU3A 3LSMA 1K6YA 3K6GA 1E0EA 2IS2A 2LRDA 2X51A 4XLEA 4ZTJA 2VKDA 3K4JA 3G2BA 4RM3A 3OR2C 3K70C 3OIPA 3FBIB 4PJLA 1YX3A 3KEYA 4BJ5C 4HEA2 3PNTA 3OL3A 3ZXSA 2LBFB 2DXIA 2VQGA 3A2KA 3S93A 2MD0A 3U21A 2L2OA 4XN0A 3PSFA 4RMNA 4N4OB 3S8PA 3LSIA 4AVZA 2BOLA 2ZSIB 3H5RA 5LFAA 4BQQA 3VYRB 2V1NA 2OC6A 3HUGB 2R7RA 1UG0A 3VYTB 4Y3OA 4JOMA 2WAQA 1W36C 2KDOA 2CFOA 2ELJA 4HG2A 4IQ4A 1V5FA 3C2HA 4ZJZA 4PK4A 2PJRB 3H9JA 4BQOA 3OS0A 2LY2A 2BVLA 1PJRA 3K4BA 4XKCA 1Z7LA 4II2A 4PFOA 4XONA 1MMNA 2X1DA 4YEJA 4B47A 3FKJA 4BE2A 3LSKA 2BW3A 2CS3A 3E0JB 3CF2A 2VL8A 3A1YA 4ZC3A 4BGDA 2KRCA 2XAUA 4ANJA 1D0ZA 2M7AA 3LMMA 2Q2EB 2VQLA 1S9HA 4F93B 3OYEA 1BR1A 2LBFA 2HPMA 3PNYA 4LIUA 3I3LA 2JSPA 4XNFA 3D5LA 2WY8Q 2X6XA 4RM2A 4XOTA 3AFHA 4Y33A 3DTKA 1DGRM 2AQEA 1FMVA 1AA7A 2LREA 2UV1A 3HPHA 3OYMA 3OWTA 3H9GA 2MFZA 3IP4B 1SFKA 2VJIA 3OYHA 2VIXA 4LG3A 4PSWA 3UR3C 3BLYA 1GLNA 1QHGA 3DKXA 2X1EA 3OYAA 1D0YA 1X4PA 4ITVA 3LSHA 4C2UA 4HNUA 2RQQA 2Z1DA 4F91B 2KP6A 3F9KA 2LY1A 4XN3A 3E1SA 3W3CA 4D1QA 1MMGA 2KRHA 5CQEA 4QPQA 2V6EA 4ZDPA 3OYNA 2CW8A 4XLAA 2IS4A 2ZXHA 2E5ZA 1MMAA 3VWBA 3CJRB 4EATA 4NQWB 2HNHA 5HNHA 3DKYA 3M8JA 4BL0B 1LFPA 1MNEA 4P5OA 2VQHA 1R6RA 3H9QA 4U87A 4AU7A 3QYBA 2MC4A 3MKWB 2R7TA 4E7HA 2WY7Q 4P1WA 2P0WA 3HG9A 4J00A 3MMYB 2LC2A 3ZCOA 2CMPA 2R7UA 2X85A 4B3XA 3W2WA 4CCJA 4DBRA 2KPMA 4E7KA 1BR4A 2K5CA 3OS2A 4YRVA 4BEHA 2K9MA 3OYCA 2IXSA 4II3A 1V5EA 2BVMA 2Q1ZB 2VJ5A 5KNLA 4AYBA 5KHDA 3OYKA 2WB1A 2FUG2 2A5WA 2L5QA 3PL8A 3FDYA 4N4NB 2L7KA 2AQFA 3S3NA 2Y0SA 4PSXA 4E7LA 4PJJA 3BCAA 2VASA 3DTEA 4XM3A 4CSWA 2QKLB 2M3AA 4E7ZA 2UUZA 4XLFA 3OYJA 2JVGA 1Y6IA 4BE0A 1OR7C 2RNGA 4E7IA 3LSGA 5KCMA 2VJJA 3QYFA 4X0GA 4BJ6C 3ONQA 3S32A 4PJNA 3D5RC 4XKVA 2CUZA 4DGWB 5LD2C 2Z16A 2KLOA 2KL4A 1D0XA 3QYEA 3CZ6A 3V42A 3HXLA 3PJRA 4XOPA 3DU5A 1FMWA 4F3QA 2NOJB 2JA2A 2VXZA 1Z21A 2CV0A 3K4NA 2X1CA 4HRIA 3FBNB 5CPRB 2CV2A 2CV1A 1WJFA 3OOUA 4BQNA 3OYFA 4BDZA 1WJEA 2HVRA 1SAUA 2IGOA 2XF6A 1D1AA 3MD2A 1ZELA 1WJCA 2X6YA 4D9JA 4XORA 4CCKA 2XC7A 5HOOA 1P9QC 3VDXA 3DLAA 3OS1A 2I8DA 3TL4X 3OYIA 3W2AA 5JHFA 2VJ4A 4R79A 4Y4RA 3DPLC 4E6KG 1PYVA 4BEHB 2LG4A 3RQ4A 3CMMA 2LYCA 2LH9A 3S3OA 2O5RA 3QODA 4XQFA 1BOBA 4KISA 3KX2A 3PFYA 4BXFA 3ZQQA 1LKXA 1JI8A 3DTIA 4DBQA 3ZR8X 3DWLE 3S3MA 1DP3A 2CW7A 1MNDA 4C2TA 1NG6A 2OUMA 3L2RA 1Z3YA 4C9YA 3L2WA 1IRXA 4CZCA 2W7NA 2VLAA 2IS6A 2KMUA 2VXDA 3PSIA 4CH7A 3OMYA 3QOEA 2W1OA 3PNVA 3H5AA 4XL9A 1N77A 2A6TA 3DQVC 1DQUA 1WJ5A 3CP8A 1V5GA 2VKHA 1G59A 3VSKA 3DPUA 3MKZA 4DOZA 2UWMA 3HL2A 3HOTA 3EUKL 1WJBA 2W00A 1Y56A 3SEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E0J B; 
#chains in the Genus database with same CATH topology
 2K9L A;  3GTQ J;  3DEU A;  3JRF A;  2Z9O A;  2CQN A;  2F5D A;  2QSF X;  1Y0N A;  5FD5 A;  4GFB A;  2GBY A;  4R8H A;  5JI6 A;  1IN4 A;  1SEU A;  4IHS A;  2L54 A;  2LY9 A;  4BNC A;  1F43 A;  2KZV A;  3ZMU A;  2NNY A;  3CCL I;  2NS8 A;  4DYR A;  5FRN A;  2JA8 J;  2H1K A;  3BPV A;  5M5W J;  2M30 A;  4RLQ A;  1BOA A;  2GOX B;  2DQL A;  3BOQ A;  3GTP J;  4ESB A;  3QP5 A;  2DDA A;  2K7L A;  5JFR A;  2FOK A;  1XTA A;  3J7Y J;  2Y0M A;  1RUO A;  4JYK A;  2OAZ A;  4AWX B;  1B59 A;  4BDY A;  1OR7 A;  2FQ4 A;  2AS5 F;  2QGU A;  5F6F A;  4DNC A;  3JRD A;  1OCT C;  4H0E A;  1SFX A;  2BW3 B;  3TP0 A;  1CF7 B;  3IAS 2;  1QO0 D;  3AL0 B;  3E6M A;  3FIS A;  3C18 A;  2ZJQ F;  5A2Q Z;  3FXQ A;  4IXA A;  4B48 A;  1BM9 A;  3C2B A;  5J8F A;  5HLT A;  2WAE A;  3G73 A;  5IP9 J;  4D0P A;  2NYX A;  1YRN B;  3JRC A;  4LOC A;  3NQO A;  3BG5 A;  3OIQ A;  5FRM A;  4QSH A;  1D1B A;  4BXX J;  1KZH A;  2JMW A;  2M45 A;  2WAQ N;  4HNT A;  1BI2 A;  3G1M A;  3VYU B;  3HB9 A;  3Q9S A;  4PGH A;  2OBP A;  5F0F A;  5K7H A;  4ZYD A;  1B8I B;  3OR1 C;  2MYS A;  3ML6 A;  2FX0 A;  4NUB A;  3BC8 A;  3K4C A;  5GAD J;  1UMQ A;  2H8W A;  3HGY A;  4YIF A;  1HC8 A;  4BHB A;  4I0B A;  1ZAR A;  3C2G A;  5H20 A;  3FX3 A;  4E4H A;  5HDK A;  4MHG A;  1V55 H;  3RPU D;  4XRS A;  4JQF A;  5TJJ A;  4F55 A;  5D5U B;  2XAS A;  1FTZ A;  2E1M B;  3AG1 H;  4EM2 A;  3RKW A;  1IXC A;  3EPZ A;  2Q8K A;  4Q48 A;  2KHM A;  1J7K A;  3GZ6 A;  2DA7 A;  5TGT A;  1Y8R B;  1FSE A;  2M2E A;  2V1D A;  3QU6 A;  1XSV A;  3KEQ A;  4Y15 A;  5KAI C;  3WTZ A;  1XMK A;  2QKM B;  2XF5 A;  1ETV A;  2CUJ A;  3CJQ B;  5DUK A;  3HTS B;  4LB5 A;  5EZG A;  4ZDL A;  4HX4 A;  2HYJ A;  4DIQ A;  1LFU P;  2E2J J;  1LVK A;  2E35 A;  2NS0 A;  3I59 B;  4S05 A;  1OFC X;  4LG0 B;  1Y0U A;  2DO7 A;  1HW5 A;  5D6F A;  4YEL A;  5DCF A;  1R22 A;  2M4G A;  5KVR A;  1SAN A;  3OYB A;  5EG0 B;  2V26 A;  1F36 A;  3RCO A;  3HKZ N;  3ZQF A;  4KDP A;  3H35 A;  1SAX A;  5IPA A;  4PZJ A;  3CCV I;  3U9G A;  3K70 D;  1WSU A;  5J4Y A;  1U9N A;  4A3F J;  2FE3 A;  4U0W A;  4CUG A;  3H0D A;  4OIP F;  2IVM A;  3L2V A;  4Z6Y A;  2JPB A;  4P9F A;  4XLN F;  1ZH5 A;  1MW7 A;  4OMY A;  3DEW A;  4IOC F;  1TL8 A;  3K0L A;  2R7Q A;  5M5Y J;  4M3G A;  3NRV A;  4BY7 J;  1LNW A;  4FHT A;  5FRO A;  3G1L A;  3K1N A;  3W6J B;  1WI3 A;  1WVR A;  2HDC A;  1EH7 A;  4ZTF A;  1PUE E;  3BQY A;  3S1N J;  1WGX A;  2NAZ A;  3K1P A;  1LUJ B;  4RA2 A;  4XLH A;  3KCC A;  1X1C A;  1BI1 A;  1KYZ A;  4W1U A;  1IUF A;  3IWF A;  3F8N A;  2DTR A;  4S0H B;  1KU7 A;  1VQN I;  3L2U A;  4B09 A;  1SVL A;  2NVX J;  4LJZ F;  1RKT A;  3SZP A;  1BBY A;  1DPR A;  2EIM H;  3S16 J;  3ZGK A;  3RTR A;  1JUM A;  2DFF A;  2E60 A;  3HSR A;  1LDK B;  3I58 A;  3QU3 A;  1Z91 A;  2R7D A;  1IZ1 A;  2KRF A;  5IYB J;  2STT A;  1BW6 A;  2LOO A;  3U1D A;  5K5O A;  1QU3 A;  1K6Y A;  4HW0 A;  4JBA A;  2X51 A;  1TLH B;  2EIK H;  2VOO A;  2FNP A;  3FXO A;  3K4J A;  1JGS A;  2LP0 A;  3K70 C;  1YLF A;  1WHU A;  4BJ5 C;  3KEY A;  5H6R A;  4HEA 2;  1ETW A;  3GTM J;  1XX5 A;  2RAE A;  4IRG A;  4M3B A;  1LDJ A;  4A0X A;  2L2O A;  1IV8 A;  4I7H A;  3PSF A;  3GLL A;  4FCY A;  3S8P A;  3LSI A;  3FK6 A;  4V2F A;  3H5R A;  5LFA A;  1XC5 A;  3WHB A;  4KIF A;  3BTJ A;  3HUG B;  2R7R A;  1IRG A;  2ZJP F;  2WAQ A;  5D5V B;  2KDO A;  2O8K A;  1HW1 A;  4ENM A;  4HG2 A;  4AD9 A;  1V5F A;  4XSX F;  2LY2 A;  2BVL A;  4I98 B;  1PJR A;  4Z2Y A;  2XAJ A;  1XSX A;  3S17 J;  4RGR A;  4PFO A;  1MMN A;  5E3N A;  2B63 J;  1R5I D;  3FKJ A;  4BXU A;  4I02 A;  5E8I A;  2A6E F;  1ORK A;  4G8X A;  2ETH A;  3DLL F;  1VQ7 I;  2DPU A;  2M8E A;  2M7A A;  2JK3 A;  3FIW A;  1S9H A;  1T38 A;  3CQZ J;  2JA5 J;  2L7F P;  3H1C A;  4F93 B;  3GFL A;  4EJO A;  2LBF A;  1Z1D A;  4OIO F;  4B3A A;  1K83 J;  5F1R A;  3JAM K;  3J7A O;  2JSP A;  2OTJ I;  3D5L A;  3DBH B;  2X4H A;  3F6V A;  2H6B A;  2QYO A;  1GVD A;  2BEO A;  4RM2 A;  1WH7 A;  4MO7 A;  1K7A A;  4A3D J;  2E71 A;  3R4K A;  4ZH4 F;  2R0Q C;  1BC8 C;  2IPQ X;  2K86 A;  5DD4 A;  1O7L A;  2J5P A;  4JX4 A;  2LRE A;  3HPH A;  1WCM J;  2IA1 A;  2NOG A;  4MTD A;  2PMH A;  2X0L A;  4M9Z A;  3OYM A;  3GCM A;  3EUH A;  3I0T A;  3OYH A;  2VIX A;  4M74 A;  5C3E J;  3RYP A;  4DZJ A;  2DPD A;  4M3D A;  3PQJ A;  1QHG A;  3DKX A;  1U5T A;  2X9D A;  1Q1V A;  1W7P B;  3LSJ A;  2KIU A;  3OYA A;  3T8R A;  2VBY A;  2ZME A;  4ITV A;  4A0Y A;  2Z99 A;  4RB2 C;  2E2I J;  3GUD A;  3I5U A;  4HX8 A;  1R1T A;  4UV9 A;  3I59 A;  2OD5 A;  3GW2 A;  3MCZ A;  1SMT A;  4M73 A;  3W3C A;  2EA2 A;  4FE4 A;  5EG0 A;  2IA2 A;  3CLO A;  4QPQ A;  2V6E A;  1Z6T A;  4G7H F;  4XLA A;  3F8C A;  2ZXH A;  2E5Z A;  3CJR B;  5GP9 A;  4EAT A;  1POG A;  2XIG A;  4ZZD A;  2QSG X;  1GV5 A;  3AG3 H;  3DKY A;  2JQ7 A;  3MQ0 A;  4O6J A;  4P5O A;  1Y1W J;  3GX4 X;  4U87 A;  1Z67 A;  4HDU A;  3GWZ A;  3CDL A;  4E7H A;  2WY7 Q;  4F7Z A;  2FOW A;  2ME0 A;  4J00 A;  1LPQ A;  2XUB A;  1D8J A;  1BIA A;  3J81 Z;  1B8I A;  4P96 A;  2R7U A;  1E3O C;  1HCR A;  1JGG A;  2KPM A;  4U88 A;  5C44 J;  2WV1 A;  4X1E A;  3V4G A;  2VT3 A;  3T5X A;  2O9L A;  3GTL J;  2BVM A;  3S2D J;  4IHY A;  3BJA A;  1W7P A;  3JW4 A;  3M7G A;  4MQ9 F;  2IEK A;  3ZQL A;  2RQP A;  4PDK A;  5IP7 J;  3FDY A;  4KN4 X;  3M07 A;  3BCA A;  5EDN A;  3WTY C;  3HOZ J;  4U0V A;  3DTE A;  3O8H A;  4XM3 A;  5EJC A;  2QKL B;  2HZT A;  4CSW A;  2UUZ A;  1G3T A;  4XLF A;  2VE9 A;  4KIC A;  1T39 A;  1EJ9 A;  2DI3 A;  2Z33 A;  3M3Y J;  3F8F A;  2VJJ A;  1UB9 A;  4BJ6 C;  4KFC A;  2ZB9 A;  5K7Z A;  1PUF A;  4CYC A;  5F64 A;  5LD2 C;  2KDZ A;  5IT9 K;  1OCC H;  2KL4 A;  3W6K B;  3V42 A;  4AC0 A;  1FMW A;  1WWX A;  2ZC2 A;  3GLX A;  2XRO A;  1TQM A;  3ASN H;  3BZK A;  1APL C;  4PJ0 C;  3TW6 A;  2JA2 A;  3F6O A;  4FTH A;  4OIR F;  5IT9 Z;  3L7W A;  3IKT A;  2ZXW H;  3Q5F A;  3CJT B;  1JXS A;  3BY6 A;  3OOU A;  5JHU A;  2UWM A;  3A01 A;  1SAU A;  1TNS A;  3DCF A;  5IT3 A;  5DEQ A;  1OKR A;  1SD5 A;  1W1W E;  3DXJ F;  1PDN C;  2Y30 A;  2YU3 A;  4XOR A;  5BMZ A;  3BR0 A;  2K4B A;  1IRZ A;  2I8D A;  3DPL C;  2BY0 A;  3RQ4 A;  2OU2 A;  2LYC A;  3MAJ A;  3SJM A;  4XQF A;  1BOB A;  1XDU A;  2P7C B;  3PFY A;  3ZQQ A;  1LKX A;  2QBY B;  3ZQI A;  1JI8 A;  4DBQ A;  3MWM A;  1P7I A;  5CLS A;  2L01 A;  3DWL E;  3S3M A;  3BRO A;  1MND A;  4C2T A;  2GA1 A;  2OUM A;  3L2R A;  2A68 F;  1TWH J;  3BPX A;  3Q3S A;  2XB5 A;  3KP2 A;  2FD5 A;  2KMU A;  2VXD A;  2DA1 A;  3PSI A;  2EZL A;  2Y69 H;  3QOE A;  4D7M A;  3PNV A;  5TRD A;  3H5A A;  1N77 A;  1DQU A;  2DMN A;  1J0R A;  1FWZ A;  2HGC A;  2IA0 A;  3G3Z A;  1SFO J;  4HBL A;  1G59 A;  2GM4 A;  1A04 A;  3K69 A;  1VQP I;  2O61 A;  1Y56 A;  4WK8 F;  3A02 A;  2O8X A;  2R5Y B;  5GTH C;  2FBH A;  2HVS A;  2Y48 A;  1IXS B;  1SFU A;  1AKH A;  2EFP A;  4DJA A;  3CUQ B;  1R58 A;  4LLL A;  2V1X A;  4AUX A;  4UUS B;  4FET A;  4A3E J;  1GVJ A;  3P7N A;  3M1C A;  3SEZ A;  5HVQ C;  4UB8 C;  3LSP A;  3H3U A;  2IGK A;  2E2H J;  1ZYR F;  1J5Y A;  2RRE A;  2DA2 A;  5GAG J;  3TQN A;  2R4G A;  4MNU A;  1F9N A;  4B1R A;  2R7W A;  2A61 A;  3HHG A;  3ZMV A;  4BE1 A;  4HAM A;  1IXR C;  1T6S A;  4ZYA A;  3PIP F;  4IKF A;  1SD6 A;  2IGN A;  3OYG A;  4KNY A;  4KT6 A;  2HQA A;  1NK2 P;  2RVC A;  5JVT A;  4LLG F;  3D1N I;  1T33 A;  5CKT A;  1RES A;  1N75 A;  2BZT A;  4ESJ A;  1G8X A;  3DU6 A;  1ON2 A;  1RPW A;  1YG2 A;  1ULY A;  3CC4 I;  3JAM Z;  3QWL A;  4H4K C;  2M1B A;  2XAH A;  1PP7 U;  1Z77 A;  2PJR A;  1OPC A;  3HBL A;  3ABT A;  4A12 A;  2GXA A;  2L9V A;  4L9V A;  2ELH A;  2DOE A;  4HSR A;  4LIT A;  4E7J A;  2P4W A;  4ZYE A;  4A69 C;  3BQZ A;  5D5X B;  2QUF A;  2LF8 A;  1U0J A;  1U5T B;  2R7X A;  2VPL A;  4NQW A;  3BTL A;  2ESH A;  5L3F A;  2CGP A;  2HOA A;  4L9J A;  1WH5 A;  2E34 A;  1RUN A;  3PUB A;  4RAY A;  2F5V A;  3FHZ A;  2K4J A;  2MSY A;  3VOE A;  4RGU A;  3AKZ A;  4Q47 A;  1UG2 A;  2ELK A;  2DCE A;  1S29 A;  1NHA A;  2JUG A;  4M6V A;  2EFO A;  1ZHF A;  2EA4 A;  2QZ8 A;  2V9K A;  4A3M J;  2XHK A;  4ENN A;  3A01 B;  1OIS A;  2JT1 A;  3IAM 2;  2Q2E A;  3PFI A;  5BPD A;  4ASN A;  4XKB A;  2BY2 A;  4KUM A;  5FFX A;  5J47 A;  3DEE A;  2EK5 A;  4CCO A;  3WTV C;  4NC8 A;  5J6X A;  4CA0 A;  5L3D A;  3TMO A;  1VTN C;  1HA8 A;  2BV6 A;  3FM5 A;  4OAZ A;  1YYV A;  1U3E M;  3N4M A;  2XGX A;  4XMY A;  3CDI A;  2NRA C;  2GXG A;  3HZJ A;  1KQ9 A;  1ZGJ A;  4BYY A;  3EUH C;  2XRL A;  2HQN A;  3HIF A;  3MZH A;  3BR6 A;  3K10 A;  2Z2S B;  4EJW A;  2BE5 F;  3S14 J;  3AL0 C;  2QQB A;  5FKN A;  3BG6 A;  4RB0 A;  4HNV A;  4BQA A;  2DQR A;  2DA5 A;  4M6Y A;  3U1K A;  2OCC H;  3KET A;  2JJ7 A;  1WZ2 A;  2ZSH B;  1KU2 A;  4GYI A;  1G3S A;  2GA2 A;  3ZOB A;  3J7A Y;  3F8M A;  5L3G A;  3FWE A;  1LB2 A;  1H9G A;  5HS7 A;  1OQY A;  1TT0 A;  2XB0 X;  5JVG F;  4MGR A;  2XSJ C;  4LGW A;  3TO9 A;  2LLK A;  4RGS A;  2L7M P;  1XN7 A;  1YE9 A;  1TP4 A;  2D2W A;  1QPI A;  3HOV J;  3PUF A;  1W5S A;  2HVQ A;  1LEA A;  3I9V 2;  3V8K A;  2FJ1 A;  1RC9 A;  3K4M A;  2LMD A;  3MEX A;  5IOZ A;  2EIJ H;  3CJN A;  2L4A A;  1I5Z A;  3HRT A;  1GV2 A;  2LD5 A;  5ILS A;  4FIS A;  3R0A A;  5CVR A;  3CMA I;  3A0B C;  4YFX F;  2CW0 F;  5LEJ A;  4D5C A;  5K7F A;  4OWR B;  2P81 A;  1UHM A;  5E3O A;  2L3D A;  2KIM A;  2MAB A;  1HOM A;  3PIO F;  2ZXI A;  4LFU A;  3W2V A;  2R5Y A;  5CVI A;  1RNL A;  1TZL A;  2DA4 A;  2O3F A;  4BS9 A;  4IQJ A;  3CO6 C;  3HPG A;  5E1X A;  3OL4 A;  1JT0 A;  3K4K A;  4XRM A;  1UHW A;  2NVQ J;  4ENK A;  4KIB A;  1MJ9 A;  1TWF J;  2IS2 A;  1E2X A;  3E3V A;  3G2B A;  3RZD J;  3OR2 C;  2OTL I;  3S1Q J;  1L0O C;  4MEY F;  3PNT A;  4TV7 A;  5HDG A;  2R3S A;  2ZXJ A;  2M0C A;  3A2K A;  1MNM C;  4JX5 A;  3S93 A;  2MD0 A;  1A31 A;  3F22 A;  5ERI A;  2CQK A;  4CGZ A;  5D6E A;  2X48 A;  2V1U A;  2PG4 A;  1IDY A;  2BHY A;  1FTT A;  2IJL A;  2JWT A;  2FXA A;  4IF4 A;  1HXD A;  5DCM B;  2PBI A;  1R9T J;  2V1N A;  5ICC A;  2OC6 A;  4I6Z A;  4Y3O A;  5J1Y A;  4ZYG A;  5DM6 F;  5B1A H;  3CC7 I;  4JOM A;  3MKW B;  3OSF A;  4LB6 B;  1IF1 A;  2KKO A;  3DKW A;  3C2H A;  2YUS A;  4ZJZ A;  1YFH A;  1KQ8 A;  1Z7U A;  1WQ2 A;  3CCU I;  4HDV A;  4XON A;  3KYC B;  1Z0X A;  3LWF A;  4GO1 A;  2PEX A;  4B47 A;  1GXP A;  1CGP A;  1H89 C;  4BE2 A;  2PFB A;  1XSD A;  2BW3 A;  2CS3 A;  1A35 A;  2ME6 A;  3RDI A;  4M3E A;  2CG4 A;  1ZGA A;  3LQR A;  4ZC3 A;  4BGD A;  2KRC A;  2XAU A;  4ANJ A;  2KZG A;  3ECO A;  3M4O J;  2VOD A;  2Q2E B;  2VQL A;  4GGG A;  2ZJR F;  1VQ6 I;  3OYE A;  5FLX Z;  1A6Q A;  2HPM A;  4M72 A;  5D8L B;  5FJ8 J;  2PJP A;  4LIU A;  2NVU B;  1ZR4 A;  3A0H C;  3WTT C;  1U2W A;  1XMX A;  1XDS A;  2X6X A;  5EZH A;  1HDP A;  2FQ3 A;  4XOT A;  1S8N A;  4MFE A;  3WGI A;  1IAW A;  2JA6 J;  1XG1 A;  3AFH A;  4Y33 A;  1FOY A;  2HDD A;  3CMY A;  1NK3 P;  1U8R A;  3LFK A;  1XGO A;  2AQE A;  4JX6 A;  3GFM A;  1FMV A;  5FD6 A;  3LAJ A;  2MLG A;  4EM1 A;  1FYL A;  2MFZ A;  3KP5 A;  3IP4 B;  1SFK A;  2VJI A;  1A5J A;  3ISP A;  4CYD A;  4PSW A;  4IHW A;  3QP6 A;  4CIC A;  3BLY A;  5DUI A;  2DLL A;  2VBZ A;  1D0Y A;  1X4P A;  1TQI A;  3QPH A;  2CUE A;  3L09 A;  4ESF A;  3LSH A;  5H2F C;  2HQR A;  3PO3 J;  4C2U A;  1UST A;  3QPS A;  2Z1D A;  2VC1 A;  4YII A;  1W0T A;  3F9K A;  2LY1 A;  1SVM A;  3E1S A;  3S2W A;  4WXD A;  1AOY A;  1Z6R A;  4D1Q A;  1MMG A;  2KRH A;  3WU2 C;  4L0Z B;  3BJ6 A;  4I76 A;  5F04 A;  2IW5 A;  5CJ9 A;  2RNJ A;  1MJB A;  5B3S H;  2WTE A;  2XGC A;  3OYN A;  2IS4 A;  4DQ2 A;  3ESW B;  4G6Q A;  3SHF A;  2MH2 A;  3L2C A;  4L5J A;  1KU9 A;  3WTS C;  1AHD P;  3DP7 A;  1LFP A;  1XPX A;  4QTR A;  4AU7 A;  2MC4 A;  5JR3 A;  4WF2 A;  2R7T A;  2ZNZ A;  1EH8 A;  3KP4 A;  2XSD C;  2LC2 A;  1FYM A;  3E6D A;  5J3L A;  5HLG A;  1W4M A;  1UZC A;  4CCJ A;  4E7K A;  1ZG1 A;  1BR4 A;  4B8X A;  1S3J A;  1OCP A;  3CUQ C;  3ELK A;  2HOT A;  2H6C A;  5E3M A;  1USS A;  1FYK A;  1K4T A;  1K79 A;  6PAX A;  1MMS A;  1ZRF A;  2VJ5 A;  5KNL A;  3UKG A;  4X6A J;  1FP2 A;  2HI3 A;  2MG4 A;  3OYK A;  4UHT A;  5EGO B;  1CF7 A;  2WB1 A;  3CCR I;  1VQO I;  1HW2 A;  1OYI A;  2AHQ A;  3RKY A;  3HEF A;  2K9Q A;  4N4N B;  2DJN A;  4I0A A;  2AQF A;  1FEX A;  4Y17 A;  4E7L A;  1RKW A;  4PJJ A;  1GXQ A;  3F0C A;  2ECC A;  1B1B A;  1XCB A;  1S5L C;  1IN5 A;  2OQG A;  1TBX A;  4E7Z A;  5HS9 A;  1O3Q A;  3S1M J;  1BI3 A;  4BE0 A;  1Y6I A;  2PI0 A;  2RNG A;  4YIR X;  2LTP A;  3LSG A;  5KCM A;  5E18 F;  3ONQ A;  1X3Z B;  3KLN A;  3S32 A;  4XKV A;  1FZP B;  2CUZ A;  2E36 A;  5DYM A;  2M34 A;  2E1O A;  2KLO A;  1VI0 A;  5IYD J;  3QYE A;  4HV6 A;  2VOP A;  5FLM J;  3HXL A;  5LEK A;  4F3Q A;  2YR2 A;  1ZLK A;  4D7N A;  3VOD A;  5B1B H;  1JKQ C;  3ULQ B;  2XPU A;  4HOB A;  2ZME C;  1V4R A;  1HKQ A;  1SMY F;  1YO5 C;  4HRI A;  3SXY A;  5CPR B;  1JHF A;  1F5T A;  2V6C A;  4LK1 F;  3L00 A;  5FKM A;  2N8G A;  4A3K J;  2HVR A;  1YW9 A;  2XF6 A;  5J1U A;  2X6Y A;  1VFC A;  4KA4 A;  3EDP A;  5LHG A;  4CZZ A;  2GZW A;  5HOO A;  2D1V A;  3VDX A;  3DLA A;  3OS1 A;  4LG0 A;  3TL4 X;  3OYI A;  1O4X A;  4Y4R A;  2M8G X;  4E6K G;  5LGT A;  1PYV A;  4BEH B;  2HEO A;  2VT2 A;  1SC7 A;  1I27 A;  1A6I A;  3GZ5 A;  5FLV A;  2O5R A;  3QOD A;  1VQL I;  2FMY A;  1MBK A;  4KIS A;  5LGU A;  1XB4 A;  3KX2 A;  1FBQ A;  1DP7 P;  2QWW A;  4OOI A;  1W5T A;  1VQ8 I;  4CDG A;  3ZMD A;  1JT6 A;  2YX7 A;  4YG2 F;  2HQ5 A;  2Y9Y A;  1NG6 A;  1Z3Y A;  3ROU A;  2ISZ A;  3ZP5 A;  5H6Q A;  3WG9 A;  4CZC A;  2IS6 A;  4CH7 A;  2EV0 A;  2GXB A;  3REO A;  2JPC A;  4WWC A;  2JRM A;  3DQV C;  2LVS A;  1FIA A;  2G7U A;  2KT0 A;  3TO6 A;  1WJ5 A;  3CP8 A;  1K6O A;  4I01 A;  2VKH A;  2KJB A;  3BR2 A;  4MQV A;  5E1W A;  2H8R A;  3DPU A;  3M8F A;  4DOZ A;  3MKZ A;  3BG3 A;  3HL2 A;  3U2R A;  4AIH A;  5B5E C;  3CO7 C;  1YJW I;  2CWE A;  1WJB A;  3BR3 A;  1DU6 A;  2ID6 A;  3SEQ A;  4ETS A;  3RSN A;  2PMU A;  1QRY A;  2CQX A;  2JUC A;  1W7P D;  2HKO A;  1B72 A;  2XAF A;  1UHS A;  3JRI A;  1P4X A;  2DOF A;  4UVA A;  1J9I A;  2ECB A;  4KJZ A;  1IUY A;  1I6X A;  2DA6 A;  3FHN A;  1PVE A;  2ZFW A;  3J80 Z;  3H0G J;  4DZP A;  3VYS B;  1WFX A;  3C3W A;  2KFD A;  3SDB A;  3V8J A;  1T0F C;  3HC7 A;  2BGC A;  3FKI J;  4F92 B;  2PQ8 A;  3HYI A;  1R1V A;  4HST A;  3FM3 A;  2DK5 A;  1VND A;  3TOA A;  2B7E A;  4BBR J;  3S2H J;  4XRS G;  2P8T A;  5HOD A;  1I6H J;  2WA0 A;  2HU9 A;  2WBM A;  2PLY A;  1M1E B;  4O5V A;  1B72 B;  2F4I A;  2GLO A;  4CCN A;  2BXY A;  4UVC A;  4A2U A;  5ILV A;  3CES A;  4V19 K;  2WAF A;  2IRF G;  5FLX K;  1E17 A;  2LKS A;  5EGO A;  2DTZ A;  2OCE A;  3NWS A;  4QPO A;  3SFI A;  4F52 A;  4BJT A;  1T95 A;  3L2Q A;  3QRF F;  4IHV A;  1FJL A;  4BHP A;  3MFK A;  1LVA A;  3QQA A;  4MEX F;  2GAU A;  2M7B A;  2RKH A;  2M9H A;  4B44 A;  4A3B J;  1TQP A;  2IS1 A;  2VQC A;  2WAD A;  2P6T A;  2L7Z A;  1WKM A;  2DK8 A;  1YIO A;  3BZC A;  1O7F A;  3SZT A;  2G0E A;  2XDV A;  3KZY A;  1QBJ A;  1X19 A;  2TCT A;  4EJU A;  3KYD B;  1UEL B;  2DJI A;  2ZFU A;  3BT9 A;  4AIK A;  1SD4 A;  1JKO C;  1TTY A;  5K5R A;  1RIO H;  1TWC J;  3VPR A;  3G4S I;  3WGH A;  4OIQ F;  1V54 H;  2EWN A;  2KIQ A;  3CTA A;  1BJA A;  2IT0 A;  3I54 A;  1WRJ A;  4RAG A;  5E8G A;  1MBH A;  1N25 A;  1MBJ A;  1VZ0 A;  3Q0V A;  1U8B A;  1MD0 A;  1P4W A;  2DFI A;  2ZNY A;  2OJE D;  3ABM H;  4WCG A;  2UXN A;  4A3J J;  3ZQH A;  3TKY A;  2B9S A;  5CYV A;  2DOA A;  5CQG A;  1RI7 A;  3ABU A;  4AVP A;  1CQT A;  5GPC A;  1WJA A;  4EEF G;  2QEN A;  3CCS I;  2BY1 A;  2W48 A;  4RLF A;  3RKX A;  2DBB A;  4A3I J;  3TO7 A;  1TWA J;  5ED4 A;  3RPU A;  4G6D A;  2TDX A;  1ON1 A;  2DW4 A;  1FOK A;  4E70 A;  3DV8 A;  3PO2 J;  3OIO A;  5BQT A;  1GHC A;  2HPI A;  1R5H A;  2VBW A;  2R7S A;  3JCU C;  2DFH A;  5J8C A;  5C4X J;  3SYT A;  2NS7 A;  2QF7 A;  2JVH A;  1DGW Y;  5DD8 A;  3GO5 A;  4L5E A;  3ZPL A;  1YI2 I;  1PP8 F;  4XR6 A;  2K3P A;  2F6C A;  2P5K A;  5IYC J;  2STW A;  2W82 A;  5AON A;  5LGN A;  1B9M A;  1LQ1 A;  1P6R A;  1BR2 A;  4RS8 A;  1H0M A;  1TNT A;  2MLK A;  3FMR A;  1J09 A;  3EYI A;  2NVY J;  3KLO A;  3WGG A;  1UAA A;  1O3T A;  2KJC A;  2RN7 A;  3BCB A;  4E7S A;  1R4N B;  2XGD A;  3FK7 A;  4CCM A;  4MLO A;  3A4C A;  3IH2 A;  2ADU A;  1ZTR A;  3SZG A;  4PUS A;  2DT6 A;  1ETQ A;  3KYL A;  2R7V A;  4GDF A;  1QHH D;  3LOC A;  2HOE A;  2OZU A;  4BY1 J;  1XGM A;  5LHI A;  3CC2 I;  2EQR A;  3I64 A;  3X2Q H;  3KP3 A;  4PFP A;  1YJN I;  2VPR A;  5D8K B;  1QPM A;  3GXO A;  2DU9 A;  3BR1 A;  2GQQ A;  1N78 A;  3OYL A;  4IZZ A;  2EIN H;  1LE8 A;  1JUP A;  2GIZ A;  4GCV A;  1T8I A;  1FPQ A;  3RJP A;  2ZKZ A;  2HDW A;  4NC7 A;  4KIT B;  5J1R A;  3BG7 A;  3WTX C;  4G7Z F;  3O3K A;  2ISY A;  1W36 D;  5JLX A;  5B66 C;  4U7B A;  1L3L A;  1X1A A;  4HA8 A;  5L3B A;  2E5N A;  3I4P A;  4CCL A;  1KA8 A;  2H09 A;  5D5W B;  1GT0 C;  3P5J A;  1JHH A;  5HNF A;  1X1D A;  2HYF A;  4Y7N J;  2PN6 A;  3PQK A;  4EVI A;  4BUP A;  2QCO A;  5DM7 F;  4S04 A;  3LSM A;  2I10 A;  3SFZ A;  5KK1 A;  4I2O A;  3K6G A;  1HST A;  4ZYH A;  2RC4 A;  3MZY A;  4UB6 C;  3F72 A;  4RM3 A;  2Z3Y A;  1YW8 A;  1FOW A;  3CME I;  3FBI B;  4FT8 A;  3K1M A;  4PJL A;  1PUF B;  1YX3 A;  2V9P A;  3B73 A;  3ZXS A;  2LBF B;  3ZN0 A;  2VQG A;  1ENH A;  3FMS A;  4XRF A;  1Y1V J;  1FY7 A;  2EZI A;  3U21 A;  4FQG A;  3HJE A;  4IHX A;  3KIO A;  5DCM A;  4O3M A;  4RMN A;  1T56 A;  3BWG A;  4N4O B;  2PMZ N;  3M1E A;  2ZSI B;  2K40 A;  3F23 A;  4BHC A;  1ZG5 A;  2RGV A;  3E7L A;  3RQI A;  1BN5 A;  1SD7 A;  1UG0 A;  3HOY J;  2O6G E;  2EBI A;  2GWR A;  4M3F A;  4LD5 A;  1W36 C;  2ELJ A;  2R93 J;  2DOD A;  5FFZ A;  3V8L A;  4OIN F;  4I09 A;  1F1Z A;  4HLX A;  3OS0 A;  5E1Z B;  4L18 B;  2AO9 A;  2AXT C;  3H92 A;  2QSH X;  3V7R A;  1MDM A;  2X1D A;  3I4N J;  1MGT A;  2R5Z A;  3J80 K;  2ZME B;  2L4M A;  1QVT A;  2CRG A;  3CF2 A;  1IN7 A;  3FXJ A;  5BS6 A;  4UXN A;  2VL8 A;  4AM3 A;  3JTH A;  3K9T A;  3TW7 A;  5D4S A;  1OCO H;  3I56 I;  3KFW X;  1X58 A;  3CCY A;  5DS9 A;  1LEB A;  1HDD C;  4IVN A;  1K4S A;  2QLZ A;  3FXM A;  5GAH J;  1QZZ A;  3FF5 A;  4XID A;  3PNY A;  1O57 A;  2JSC A;  3CLQ A;  4XNF A;  1BC7 C;  1BIB A;  3GEZ A;  2YSR A;  4QLC U;  3IV5 A;  3HRM A;  4XIC A;  1JE8 A;  2LF7 A;  3DTK A;  4OU0 A;  1JUS A;  3HUG A;  3LST A;  1MZB A;  1DGR M;  1WI9 A;  5BPI A;  1X3W B;  4J19 A;  2CQQ A;  3Q9V A;  2WWY A;  3K2Z A;  4KT5 C;  5DDG A;  1WPK A;  3H9G A;  2DDB A;  3HHH A;  3B6A A;  2EPF A;  2MGQ A;  3I53 A;  5LRR A;  1IDZ A;  3UR3 C;  2ICW G;  5M5X J;  4EGY A;  1GLN A;  2BHZ A;  3V7C A;  1XMA A;  2CSO A;  5TIS C;  2R5Z B;  1JKR C;  3HOU J;  3VB2 A;  1D3Y A;  1FIP A;  4M6X A;  5F1J A;  1FSH A;  2LFB A;  3P9K A;  1IRF A;  3KE2 A;  4LMY A;  2F5E A;  1UFM A;  2W85 A;  2K9N A;  1Z05 A;  5CQE A;  1DU0 A;  2EIL H;  1KU3 A;  4ZDP A;  2EH3 A;  2MD5 A;  2CW8 A;  2DN0 A;  2HS5 A;  3OV8 A;  5FB2 A;  5F0C A;  1OMI A;  2HTS A;  2VC0 A;  2ID3 A;  2LNB A;  1BA5 A;  2HNH A;  5LRS A;  4Q4Z F;  2EFN A;  3M8J A;  1MNE A;  4KYW A;  2VQH A;  3HRU A;  1IO2 A;  3H9Q A;  1KYW A;  3QYB A;  1TC3 C;  4FX0 A;  2R92 J;  2P0W A;  5C4J J;  3MMY B;  2J5O A;  3LNQ A;  3CUO A;  4B3X A;  4HQE A;  2K5C A;  2W84 A;  5FKL A;  4P9U A;  3OS2 A;  4UUV A;  1ACI A;  1MBG A;  2P5L C;  4YRV A;  4BEH A;  2VE8 A;  3VFZ A;  2H27 A;  3OSG A;  3DBR B;  2GIV A;  1NTC A;  2HWV A;  5FKO A;  1OYY A;  2QM3 A;  2DMT A;  1R36 A;  4AYB A;  4G12 A;  3JRG A;  2G9W A;  1R7J A;  2FUG 2;  2A5W A;  2WV0 A;  3E5U A;  4BKX A;  1G2H A;  3M8E A;  3O8G A;  4A3C J;  3LA7 A;  1LFB A;  1VQ5 I;  2L7K A;  2RDP A;  3WU0 A;  2G7H A;  3ABK H;  2Y0S A;  3R6S A;  1YTY A;  1AWC A;  1YS6 A;  4C3I J;  4G9Y A;  2VAS A;  2XPV A;  1QA6 A;  2M3A A;  2A69 F;  4G7O F;  3K2A A;  4U0Y A;  3BTC A;  3OYJ A;  2JVG A;  1OR7 C;  4E7I A;  1HKS A;  2HR3 A;  2P6S A;  3BJO A;  3QYF A;  3VEP A;  3T8T A;  3RIR A;  4PJN A;  3D5R C;  5FGM A;  3MVP A;  4DGW B;  2Z16 A;  4PGG A;  4KMU X;  1UJ8 A;  2JZY A;  1D0X A;  3GME A;  4M9X A;  3CZ6 A;  5GAE J;  3FMQ A;  3IC7 A;  3PJR A;  2A5Y B;  2F4O B;  2NOJ B;  3WE2 A;  2X6O A;  1RR8 C;  1Z21 A;  5M3F J;  1QNT A;  3HTU A;  2OPT A;  2WC2 A;  1S7O A;  3K4N A;  1VQ4 I;  3FBN B;  3P9C A;  3S1R J;  2CV2 A;  2CV1 A;  2W57 A;  4BQN A;  3OYF A;  4BDZ A;  1OYW A;  1F4K A;  1D1A A;  1XD7 A;  3H3Z A;  5E17 F;  4D9J A;  2K27 A;  3E97 A;  1P9Q C;  4CYC B;  4JP0 A;  1FP1 D;  3W2A A;  4R79 A;  3JRE A;  3Q0U A;  1FBS A;  4WXC A;  1MDM B;  4IOA F;  5CVU A;  4PCQ A;  2LG4 A;  5BNG A;  4MTE A;  1O3R A;  3GFI A;  2Q0O A;  1ZGW A;  3FXU A;  1S72 I;  3EYY A;  3ZQC A;  4BXF A;  2F5F A;  3TED A;  1MSE C;  4K2E A;  5GPA A;  4A5M A;  1EKE A;  2HYG D;  2ZBK A;  4RAF A;  5M3M J;  1DP3 A;  1ZRC A;  1H88 C;  5J4V A;  4A6D A;  1R23 A;  3L2W A;  1IRX A;  3OMY A;  2W1O A;  2EV5 A;  5HS8 A;  2K3F A;  1G6N A;  3KEO A;  4EV0 A;  2VI6 A;  1EF4 A;  4UUS A;  4XL9 A;  2ESN A;  3IRQ A;  2YX4 A;  4UUT A;  3HOX J;  2FBK A;  1HSJ A;  3EUK L;  3O2P E;  3IHU A;  2W00 A;  2QBY A;  1P7J A;  1HLV A;  5EEA A;  3HSE A;  4R1H A;  2EB7 A;  3BZ6 A;  3CDH A;  3IH4 A;  3UNG C;  1YJ9 I;  2XF7 A;  1KON A;  3LL7 A;  4OAY A;  1B4A A;  2HTJ A;  2D5V A;  4EQQ A;  1JKP C;  3DF8 A;  2DT5 A;  3VSL A;  2IGM A;  3LA2 A;  4N0B A;  3HGG A;  1MMD A;  3I4M J;  1R49 A;  4A6E A;  3WTW C;  3QOP A;  3CCJ I;  4XLP F;  5E3L A;  2Y9Z A;  1KGS A;  2GOM A;  4BU2 A;  1D8K A;  3J7Z I;  3OY9 A;  1ERD A;  1K61 A;  3N97 A;  3WHC A;  2DMU A;  5EEH A;  4GRI A;  3MKL A;  3LSR A;  1J75 A;  2RV8 A;  1IW7 F;  2L02 A;  1OJL A;  4IX7 A;  4NNJ A;  1Z3X A;  2DYR H;  4ON0 A;  3CCQ I;  3FZV A;  3HRS A;  1EH6 A;  3WE3 A;  3BR5 A;  3BTI A;  2JRT A;  3COA C;  2FA5 A;  1I39 A;  1EV7 A;  3CP2 A;  2FBI A;  3JSP A;  3I71 A;  2CH0 A;  1JTX A;  5ICE A;  3IUO A;  1YRN A;  4NC6 A;  4B43 A;  3AG2 H;  2OV7 A;  1X1P A;  3D5S C;  5F08 A;  3B6C A;  4PJM A;  4EM0 B;  3NWT A;  2X6W A;  3O6B B;  2V7F A;  3CCE I;  1OCZ H;  2XGE A;  3HSF A;  2LSO A;  2XV4 S;  1Z9C A;  4Y52 J;  1ZAO A;  3AAF A;  1QGP A;  2M4K A;  1T08 B;  2L9R A;  4KN7 X;  3NAR A;  4BAC A;  2HZD A;  3IKV A;  2W4S A;  3FXR A;  2VBX A;  3M9A A;  3L1P A;  3HOS A;  2F5C A;  2HFH A;  3Q0W A;  1MH3 A;  2XAG A;  5ICG A;  1KQ0 A;  2M5W A;  4QWQ A;  4RDU A;  3W6V A;  2MH9 A;  2K02 A;  3G6E I;  2DT7 B;  2NNN A;  2E7X A;  3EET A;  2E1M C;  1P92 A;  3GF2 A;  3G1O A;  4MIM A;  4ZDO A;  1JTY A;  2ZO4 A;  2CFX A;  4FAS D;  2W24 A;  5DTD A;  3GYH X;  4G6T B;  2HXO A;  4WXH A;  3KZI C;  1LDD A;  2UZK A;  3K4L A;  3ZMT A;  3WTU C;  2OZ6 A;  5GTI C;  2Y0S N;  2DA3 A;  3D0S A;  3GBG A;  2HOS A;  1S6L A;  3GTG J;  1ETO A;  2PX9 A;  4XKW A;  4L9T A;  1IC8 A;  3BP8 A;  1HKT A;  4A3G J;  3OOP A;  5BOX A;  3TBI A;  1IN8 A;  4HPQ A;  2E19 A;  1D1C A;  1FT9 A;  1VQ9 I;  3GZN B;  1B6A A;  2YU9 J;  4W97 A;  3JRH A;  4XSZ F;  3QAH A;  4KIG A;  3R61 A;  2QVO A;  1ETK A;  2R7Z J;  3E5Q A;  4UV8 A;  3ZMS A;  2MW8 A;  3ZMZ A;  2L9N A;  2BY3 A;  4YFN F;  1STZ A;  3H5N A;  3C1D A;  2DAO A;  4Q5S F;  2CU7 A;  3JSO A;  4J01 A;  1AU7 A;  3ZRG A;  1LJ9 A;  3HKZ A;  1EA3 A;  2M87 A;  4XK4 A;  1XGS A;  2B0L A;  2HKX A;  4EGZ A;  3RZO J;  3N05 A;  3MKY B;  1NG7 A;  1WJD A;  4V2G A;  2DYS H;  1YX5 A;  2PMZ A;  4NDL A;  2CQ7 A;  3LAP A;  2CJJ A;  1YQA A;  1FX7 A;  2O7O A;  3MN2 A;  3OYD A;  1ZR2 A;  2CUF A;  3E6C C;  2VB6 A;  2XRN A;  1X3U A;  4RB3 C;  3CD6 I;  1D5V A;  1OLT A;  2ZJ2 A;  3IWZ A;  3DPT A;  2EZH A;  3EUA A;  3HM5 A;  4EJT A;  1MH4 A;  3P9I A;  2M0M A;  1ETY A;  2F4M B;  3RPQ A;  2E1N A;  3CF5 F;  1QVU A;  1DDN A;  2V4J C;  5HLH A;  4XLC A;  2KQR A;  3TDZ C;  5LLQ A;  2R7F A;  2DFE A;  3S15 J;  4C30 A;  5FO5 A;  4IRH A;  4CXF A;  5CVV A;  1AKH B;  4IPA A;  4LK0 F;  3T0Y A;  1X4O A;  1J2X A;  1H8A C;  3GTJ J;  3GTK J;  1S7A A;  2F48 A;  3H36 A;  4LIV A;  4KMF A;  4UY8 I;  3ERE D;  2K85 A;  1QZY A;  2R7O A;  1BL0 A;  3AG4 H;  1X1B A;  2OF7 A;  5D4R A;  2JA7 J;  1MSF C;  3F8B A;  2XKP A;  2L9S A;  1H9T A;  1J59 A;  1FLI A;  1YHQ I;  3B02 A;  2LK2 A;  1P2F A;  5JLW A;  2A05 A;  3LFU A;  1MJA A;  2H1L A;  2CO5 A;  1K78 A;  1S7E A;  1X2M A;  4IEJ A;  1IG7 A;  3BDD A;  1E0E A;  2LRD A;  4XLE A;  4ZTJ A;  2LKX A;  2VKD A;  1W0U A;  3OIP A;  2DMQ A;  3PM1 A;  2EFQ A;  1SFE A;  3IH3 A;  3OL3 A;  1IV6 A;  4AYB N;  2DXI A;  4AIJ A;  4IL6 C;  3RKQ A;  2P5V A;  1YW7 A;  4OMZ A;  4XN0 A;  1T2K A;  1IN6 A;  4AVZ A;  2EFW A;  3ECH A;  4HF0 A;  3EQL F;  2BOL A;  1R5G A;  4Y13 A;  1IGN A;  5HLI A;  4RGX A;  2LDU A;  4BQQ A;  1RR7 A;  3VYR B;  2QA4 I;  4HV5 A;  2JTV A;  1RZ4 A;  2VN2 A;  3VYT B;  9ANT A;  4L9N A;  3BG9 A;  4BH9 A;  1SVO A;  2CFO A;  2XVC A;  2XKO A;  4IQ4 A;  1ZK8 A;  1HBX G;  4PK4 A;  1U78 A;  2PJR B;  3H9J A;  1MBF A;  4BQO A;  1W5C C;  5EEG A;  3GTO J;  1R4M B;  3K4B A;  4XKC A;  1Z7L A;  1ZKG A;  4GXO A;  2P7V B;  4II2 A;  2QQ9 A;  5F27 A;  1G3Y A;  4YEJ A;  3LA3 A;  3WG7 H;  5AIQ A;  4IHT A;  3LSK A;  2F2E A;  4XBF A;  4D5F A;  3E0J B;  3JRB A;  4QIW N;  2BXZ A;  5HDN A;  1ODD A;  1TT5 B;  3A1Y A;  4DYQ A;  1Q1H A;  2LKP A;  3ZN1 A;  2HXI A;  1D0Z A;  1JJ6 C;  3LMM A;  3G71 I;  2OA4 A;  1ZG3 A;  1VQM I;  1HF0 A;  1BW5 A;  5KAF C;  3I55 I;  1BR1 A;  2O03 A;  2E7W A;  4ZZL A;  3CCM I;  5ICF A;  3TGN A;  5IY5 H;  1P4A A;  1T98 A;  3I3L A;  5DV5 A;  4DYC A;  4HLY A;  4L0Y B;  1V3F A;  2WY8 Q;  3ABL H;  3E6B A;  1TW3 A;  1BI0 A;  2XPW A;  3K7A J;  3SQN A;  4IO9 F;  2K9S A;  4N9I A;  1RRJ A;  4FE7 A;  4M9S A;  2Z5U A;  4HX7 A;  2IBD A;  4I99 C;  3CUQ A;  3FXL A;  1YS7 A;  2FEZ A;  1AA7 A;  2UV1 A;  1I1S A;  3F21 A;  3OWT A;  5AIP A;  1QQI A;  1TWG J;  4HYE A;  1ZRD A;  1XS9 A;  3H3V K;  1Y8Q B;  4LG3 A;  3SDG A;  2X1E A;  4HF2 A;  1U6G A;  5K1Y A;  3KZZ A;  1C0W A;  1E3H A;  2O0Y A;  1QZE A;  2JN6 A;  2C6Y A;  1FNN A;  2QQA A;  4HNU A;  2RQQ A;  4HQM A;  4F91 B;  5EF6 A;  2KP6 A;  1G3W A;  1ZRE A;  2AXL A;  2EV6 A;  4XN3 A;  5EYR A;  3WU1 B;  3RI4 A;  3ASO H;  4UVB A;  3ZQ7 A;  1FC3 A;  1VF9 A;  2A3S A;  3A03 A;  1MMA A;  3VWB A;  5K5Q A;  3E5X A;  4NQW B;  5HNH A;  1HQC A;  4BL0 B;  2LR8 A;  5CVJ A;  1I3A A;  1DUX C;  1R6R A;  4A5N A;  2TRT A;  1MBE A;  2CYY A;  5E20 A;  3LQQ A;  1BJZ A;  4C2M J;  2VKV A;  4GYG A;  3JRA A;  1R71 A;  4P1W A;  3HG9 A;  5LBQ A;  4HZF A;  1FOX A;  1I3Q J;  3ZCO A;  5IOY A;  2Y31 A;  3IRR A;  2CMP A;  4P55 A;  4A3L J;  2X85 A;  3C7J A;  1ONV A;  3W2W A;  4DBR A;  2H94 A;  2COB A;  2VKE A;  3DFG A;  1JJ8 C;  1MIJ A;  3HDD A;  2IP2 A;  1TW2 A;  2FML A;  2K9M A;  3OYC A;  2IXS A;  4II3 A;  3TDU C;  5L3E A;  1V5E A;  4NHJ A;  2Q1Z B;  2ACJ A;  3R60 A;  4HF1 A;  5KHD A;  1R00 A;  3GFJ A;  3KP6 A;  3R0J A;  2COM A;  3TP3 A;  2Y75 A;  3FXK A;  4C3H J;  2L5Q A;  1G4D A;  1GUU A;  3PL8 A;  1DPU A;  2L0K A;  3NEU A;  1XCV A;  1ITY A;  3S3N A;  2FRH A;  4PSX A;  1ZN2 A;  4NBQ A;  4ENJ A;  1NH3 A;  1OCR H;  2FU4 A;  5F0H A;  1T0F A;  4A0Z A;  5IP6 A;  1U5T C;  2MBF A;  1YIJ I;  4MFD A;  4G94 A;  4CO8 A;  2XAQ A;  2QQ8 A;  4C3J J;  3HOW J;  4X0G A;  1YIT I;  2D45 A;  3QPL A;  3ERM A;  3KPH A;  2VUM J;  1ZLJ A;  2EZK A;  2KIF A;  2MA3 A;  4BBS J;  1RET A;  1LE8 B;  3V7S A;  2OQR A;  4ABZ A;  4XOP A;  3DU5 A;  5E79 C;  4RAZ A;  3J81 K;  1ZQ3 P;  3JR9 A;  3F3X A;  2I5U A;  4BAY A;  2VXZ A;  2CV0 A;  2V9V A;  1ETX A;  2FSW A;  2BBY A;  3TOB A;  3ZQG A;  4RBO A;  1UCR A;  2X1C A;  5FKK A;  4N9H A;  1WJF A;  4B4C A;  1U9O A;  2KIS A;  4FX4 A;  4U7D A;  4RB1 A;  1WJE A;  2NXN B;  3QPT A;  2IGO A;  4AID A;  3MD2 A;  4NB5 A;  2MC3 A;  3L9F A;  1ZEL A;  1WJC A;  4WX9 A;  2YS9 A;  4LLN A;  3T1B A;  3GVA A;  4CCK A;  2XC7 A;  4EMS A;  2YPR A;  3WOD F;  3NAU A;  5JHF A;  2VJ4 A;  2ZCW A;  4IJA A;  5J40 A;  2FNA A;  4M71 A;  4L5I A;  4EJV A;  4CHU A;  2VON A;  5ILU A;  3CMM A;  3IL2 A;  4A93 J;  2LH9 A;  3S3O A;  1MKM A;  1IJW C;  1GDT A;  5A2Q K;  1VQK I;  2V79 A;  1FBU A;  2Y2Z A;  4UNO A;  3DTI A;  1D5Y A;  3DBL B;  3ZR8 X;  1I1G A;  4DW6 A;  1XGN A;  1YOV B;  5LHH A;  1X2N A;  2CW7 A;  1Y39 A;  2A07 F;  3MZ8 A;  2W25 A;  4C9Y A;  4IRI A;  4YFK F;  2FF4 A;  2W7N A;  2VLA A;  3RYR A;  3KP7 A;  1REP C;  2NVT J;  5L3C A;  2A6H F;  2BYV E;  1R1U A;  2A6T A;  2EJR A;  1O3S A;  1B9N A;  3JTG A;  2E1C A;  2QEX I;  1A36 A;  2UXX A;  1V5G A;  1K78 B;  3VSK A;  4JK1 X;  3HOT A;  1I50 J;  2DMP A;  1E3P A;  2WB1 N;  2D1H A;  2IAI A; 
#chains in the Genus database with same CATH homology
 3RSN A;  2K9L A;  3UNG C;  2XF7 A;  1KON A;  3LL7 A;  4OAY A;  3VSL A;  2IGM A;  2HVS A;  1MMD A;  4KJZ A;  3FHN A;  2KZV A;  4DJA A;  2GOM A;  4BU2 A;  3VYS B;  1WFX A;  4FET A;  5FRN A;  3SDB A;  3OY9 A;  1T0F C;  3HC7 A;  1ERD A;  3M1C A;  3SEZ A;  4RLQ A;  4F92 B;  2GOX B;  5HVQ C;  4GRI A;  4HST A;  2IGK A;  2RRE A;  4IX7 A;  2R4G A;  4NNJ A;  1Z3X A;  2WA0 A;  2R7W A;  4BE1 A;  2HU9 A;  2WBM A;  4ZYA A;  2F4I A;  4BDY A;  4IKF A;  4CCN A;  2IGN A;  3OYG A;  4KT6 A;  2HQA A;  3CP2 A;  3CES A;  2CH0 A;  2WAF A;  5CKT A;  1N75 A;  2BW3 B;  3NWS A;  4QPO A;  3IUO A;  3IAS 2;  4F52 A;  4B43 A;  1T95 A;  4BJT A;  3L2Q A;  3AL0 B;  1G8X A;  3DU6 A;  2OV7 A;  3D5S C;  2M7B A;  4H4K C;  4B44 A;  2IS1 A;  4PJM A;  2VQC A;  2WAD A;  3NWT A;  4B48 A;  2X6W A;  2V7F A;  5HLT A;  2PJR A;  2WAE A;  2XDV A;  1X19 A;  2M4K A;  3OIQ A;  4HSR A;  4LIT A;  5FRM A;  1D1B A;  1UEL B;  2HZD A;  4BAC A;  2DJI A;  2ZFU A;  4E7J A;  2W4S A;  4HNT A;  3HOS A;  3VYU B;  3OR1 C;  2MYS A;  1U0J A;  2R7X A;  2VPL A;  4NUB A;  2DT7 B;  3BC8 A;  3K4C A;  3PUB A;  2E1M C;  2F5V A;  4ZDO A;  1VZ0 A;  4FAS D;  3AKZ A;  4G6T B;  3C2G A;  2DCE A;  4E4H A;  2JUG A;  3RPU D;  2DOA A;  5CQG A;  3K4L A;  2V9K A;  3GBG A;  4JQF A;  4F55 A;  1WJA A;  2E1M B;  4XKW A;  3EPZ A;  4RLF A;  3IAM 2;  2KHM A;  3TBI A;  4XKB A;  5TGT A;  4HPQ A;  1D1C A;  3DEE A;  4CCO A;  4NC8 A;  2QKM B;  4CA0 A;  3TMO A;  2XF5 A;  2HPI A;  2R7S A;  1HA8 A;  2CUJ A;  3CJQ B;  4OAZ A;  4ZDL A;  3SYT A;  4XMY A;  4DIQ A;  1LVK A;  2L9N A;  2JVH A;  3EUH C;  1DGW Y;  3H5N A;  3K10 A;  2Z2S B;  4J01 A;  4XR6 A;  2K3P A;  4YEL A;  2F6C A;  3ZRG A;  3AL0 C;  2M4G A;  3BG6 A;  3HKZ A;  2W82 A;  3OYB A;  1EA3 A;  1BR2 A;  2V26 A;  3N05 A;  3RCO A;  1NG7 A;  1WJD A;  3H35 A;  3MKY B;  2PMZ A;  1YX5 A;  1J09 A;  2ZSH B;  3OYD A;  1UAA A;  4E7S A;  3BCB A;  4CCM A;  3K70 D;  3J7A Y;  4MLO A;  3A4C A;  2VB6 A;  1TT0 A;  3SZG A;  4PUS A;  4CUG A;  3H0D A;  2DT6 A;  1OLT A;  2XSJ C;  3L2V A;  3DPT A;  3EUA A;  3KYL A;  2R7V A;  1QHH D;  2M0M A;  1YE9 A;  1MW7 A;  2R7Q A;  4PFP A;  2V4J C;  2HVQ A;  5FRO A;  3I9V 2;  4XLC A;  1N78 A;  2KQR A;  3OYL A;  4IZZ A;  4ZTF A;  3K4M A;  4C30 A;  4NC7 A;  2HDW A;  4XLH A;  4KIT B;  3BG7 A;  1X1C A;  1X4O A;  4LIV A;  1W36 D;  4U7B A;  3L2U A;  2R7O A;  1X1B A;  4OWR B;  1X1A A;  2MAB A;  2E5N A;  4CCL A;  2ZXI A;  3ZGK A;  2L9S A;  3RTR A;  3W2V A;  5HNF A;  1TZL A;  1X1D A;  2E60 A;  4BS9 A;  4IQJ A;  3HPG A;  1LDK B;  3LFU A;  3OL4 A;  3K4K A;  4BUP A;  2LOO A;  1QU3 A;  3LSM A;  1K6Y A;  3K6G A;  1E0E A;  2IS2 A;  2LRD A;  2X51 A;  4XLE A;  4ZTJ A;  2VKD A;  3K4J A;  3G2B A;  4RM3 A;  3OR2 C;  3K70 C;  3OIP A;  3FBI B;  4PJL A;  1YX3 A;  3KEY A;  4BJ5 C;  4HEA 2;  3PNT A;  3OL3 A;  3ZXS A;  2LBF B;  2DXI A;  2VQG A;  3A2K A;  3S93 A;  2MD0 A;  3U21 A;  2L2O A;  4XN0 A;  3PSF A;  4RMN A;  4N4O B;  3S8P A;  3LSI A;  4AVZ A;  2BOL A;  2ZSI B;  3H5R A;  5LFA A;  4BQQ A;  3VYR B;  2V1N A;  2OC6 A;  3HUG B;  2R7R A;  1UG0 A;  3VYT B;  4Y3O A;  4JOM A;  2WAQ A;  1W36 C;  2KDO A;  2CFO A;  2ELJ A;  4HG2 A;  4IQ4 A;  1V5F A;  3C2H A;  4ZJZ A;  4PK4 A;  2PJR B;  3H9J A;  4BQO A;  3OS0 A;  2LY2 A;  2BVL A;  1PJR A;  3K4B A;  4XKC A;  1Z7L A;  4II2 A;  4PFO A;  4XON A;  1MMN A;  2X1D A;  4YEJ A;  4B47 A;  3FKJ A;  4BE2 A;  3LSK A;  2BW3 A;  2CS3 A;  3E0J B;  3CF2 A;  2VL8 A;  3A1Y A;  4ZC3 A;  4BGD A;  2KRC A;  2XAU A;  4ANJ A;  1D0Z A;  2M7A A;  3LMM A;  2Q2E B;  2VQL A;  1S9H A;  4F93 B;  3OYE A;  1BR1 A;  2LBF A;  2HPM A;  3PNY A;  4LIU A;  3I3L A;  2JSP A;  4XNF A;  3D5L A;  2WY8 Q;  2X6X A;  4RM2 A;  4XOT A;  3AFH A;  4Y33 A;  3DTK A;  1DGR M;  2AQE A;  1FMV A;  1AA7 A;  2LRE A;  2UV1 A;  3HPH A;  3OYM A;  3OWT A;  3H9G A;  2MFZ A;  3IP4 B;  1SFK A;  2VJI A;  3OYH A;  2VIX A;  4LG3 A;  4PSW A;  3UR3 C;  3BLY A;  1GLN A;  1QHG A;  3DKX A;  2X1E A;  3OYA A;  1D0Y A;  1X4P A;  4ITV A;  3LSH A;  4C2U A;  4HNU A;  2RQQ A;  2Z1D A;  4F91 B;  2KP6 A;  3F9K A;  2LY1 A;  4XN3 A;  3E1S A;  3W3C A;  4D1Q A;  1MMG A;  2KRH A;  5CQE A;  4QPQ A;  2V6E A;  4ZDP A;  3OYN A;  2CW8 A;  4XLA A;  2IS4 A;  2ZXH A;  2E5Z A;  1MMA A;  3VWB A;  3CJR B;  4EAT A;  4NQW B;  2HNH A;  5HNH A;  3DKY A;  3M8J A;  4BL0 B;  1LFP A;  1MNE A;  4P5O A;  2VQH A;  1R6R A;  3H9Q A;  4U87 A;  4AU7 A;  3QYB A;  2MC4 A;  3MKW B;  2R7T A;  4E7H A;  2WY7 Q;  4P1W A;  2P0W A;  3HG9 A;  4J00 A;  3MMY B;  2LC2 A;  3ZCO A;  2CMP A;  2R7U A;  2X85 A;  4B3X A;  3W2W A;  4CCJ A;  4DBR A;  2KPM A;  4E7K A;  1BR4 A;  2K5C A;  3OS2 A;  4YRV A;  4BEH A;  2K9M A;  3OYC A;  2IXS A;  4II3 A;  1V5E A;  2BVM A;  2Q1Z B;  2VJ5 A;  5KNL A;  4AYB A;  5KHD A;  3OYK A;  2WB1 A;  2FUG 2;  2A5W A;  2L5Q A;  3PL8 A;  3FDY A;  4N4N B;  2L7K A;  2AQF A;  3S3N A;  2Y0S A;  4PSX A;  4E7L A;  4PJJ A;  3BCA A;  2VAS A;  3DTE A;  4XM3 A;  4CSW A;  2QKL B;  2M3A A;  4E7Z A;  2UUZ A;  4XLF A;  3OYJ A;  2JVG A;  1Y6I A;  4BE0 A;  1OR7 C;  2RNG A;  4E7I A;  3LSG A;  5KCM A;  2VJJ A;  3QYF A;  4X0G A;  4BJ6 C;  3ONQ A;  3S32 A;  4PJN A;  3D5R C;  4XKV A;  2CUZ A;  4DGW B;  5LD2 C;  2Z16 A;  2KLO A;  2KL4 A;  1D0X A;  3QYE A;  3CZ6 A;  3V42 A;  3HXL A;  3PJR A;  4XOP A;  3DU5 A;  1FMW A;  4F3Q A;  2NOJ B;  2JA2 A;  2VXZ A;  1Z21 A;  2CV0 A;  3K4N A;  2X1C A;  4HRI A;  3FBN B;  5CPR B;  2CV2 A;  2CV1 A;  1WJF A;  3OOU A;  4BQN A;  3OYF A;  4BDZ A;  1WJE A;  2HVR A;  1SAU A;  2IGO A;  2XF6 A;  1D1A A;  3MD2 A;  1ZEL A;  1WJC A;  2X6Y A;  4D9J A;  4XOR A;  4CCK A;  2XC7 A;  5HOO A;  1P9Q C;  3VDX A;  3DLA A;  3OS1 A;  2I8D A;  3TL4 X;  3OYI A;  3W2A A;  5JHF A;  2VJ4 A;  4R79 A;  4Y4R A;  3DPL C;  4E6K G;  1PYV A;  4BEH B;  2LG4 A;  3RQ4 A;  3CMM A;  2LYC A;  2LH9 A;  3S3O A;  2O5R A;  3QOD A;  4XQF A;  1BOB A;  4KIS A;  3KX2 A;  3PFY A;  4BXF A;  3ZQQ A;  1LKX A;  1JI8 A;  3DTI A;  4DBQ A;  3ZR8 X;  3DWL E;  3S3M A;  1DP3 A;  2CW7 A;  1MND A;  4C2T A;  1NG6 A;  2OUM A;  3L2R A;  1Z3Y A;  4C9Y A;  3L2W A;  1IRX A;  4CZC A;  2W7N A;  2VLA A;  2IS6 A;  2KMU A;  2VXD A;  3PSI A;  4CH7 A;  3OMY A;  3QOE A;  2W1O A;  3PNV A;  3H5A A;  4XL9 A;  1N77 A;  2A6T A;  3DQV C;  1DQU A;  1WJ5 A;  3CP8 A;  1V5G A;  2VKH A;  1G59 A;  3VSK A;  3DPU A;  3MKZ A;  4DOZ A;  2UWM A;  3HL2 A;  3HOT A;  3EUK L;  1WJB A;  2W00 A;  1Y56 A;  3SEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...