3E0JB

X-ray structure of the complex of regulatory subunits of human dna polymerase delta
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
143
Chain Sequence
ADQLYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVTYLVSGSLIQNGHSCHKVAVVREDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYDILKSNLQNCSKFSAIQCAAAVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase subunit delta-2
publication title X-ray structure of the complex of regulatory subunits of human DNA polymerase delta.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 41
structure length 143
sequence length 143
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3e0jB00
3E0JB
chains in the Genus database with same CATH superfamily
3TP3A 3QPHA 1UZCA 4LG0B 2MSYA 3SZTA 4RAGA 5F08A 4XORA 3ZRGA 3CO7C 2X6OA 1MBFA 2OV7A 2QLZA 3OYJA 2V1NA 1GT0C 1H89C 4Y33A 1ODDA 2FMLA 2D45A 1YO5C 1UMQA 4RBOA 3HOTA 3CUQB 2KIQA 4CGZA 1VF9A 4M9SA 2BVMA 3V42A 5EDNA 3HOXJ 4FETA 4E7JA 2O8XA 3WTVC 2KQRA 5CLSA 1K4SA 4LB5A 1ZGAA 4BJ6C 1Z9CA 2R7UA 1A35A 1RZ4A 5DTDA 2GLOA 2M4KA 3DCFA 2WTEA 2F48A 4XKCA 4CYCA 2LMDA 2R7FA 1A5JA 3ZQFA 1Z67A 2ELJA 2JWTA 4ZYDA 4HA8A 2R5YB 1B9MA 1Z7LA 1QPMA 2V79A 2HOAA 2ZMEA 3FM3A 1S7AA 1SVLA 2AXTC 2YR2A 2ZO4A 4MTEA 1VQ7I 1Z3YA 3VYSB 2X1DA 2DYRH 4CO8A 2X48A 4JK1X 3KE2A 2Y0SN 2EIJH 3WODF 2NVTJ 3ZQCA 1B9NA 2MFZA 1D1AA 4XRSA 2LF7A 5EGOB 3E0JB 2GXAA 2VQCA 1IN8A 3TKYA 1OLTA 3PO2J 1IRZA 3NWTA 3E5QA 2NXNB 5D8LB 2OPTA 4RGUA 2XKPA 1LFBA 4IL6C 1USSA 5HOOA 3BJAA 2LNBA 3FX3A 4BHCA 3FK7A 4PK4A 5GADJ 2Y0MA 2YS9A 3LSKA 3CCSI 4BH9A 2M5WA 3VEPA 2A6HF 2DMQA 1XSDA 1B8IA 4A93J 1LJ9A 2K40A 4H4KC 4LK1F 1U5TA 4LLGF 2LKPA 2QZ8A 5KHDA 1JJ8C 4IHYA 1WGXA 1VQ5I 2K3PA 1V4RA 2ZXIA 2HXIA 4XSZF 2VOPA 5JVGF 1YQAA 1S5LC 1H88C 1FTZA 3S3MA 3HRUA 2OQGA 4BACA 1LQ1A 4A3CJ 1FTTA 4IQ4A 2DPUA 3CLQA 3F9KA 4YIRX 2HR3A 1TW3A 3HKZA 2JA2A 2X6XA 2F2EA 3S2DJ 4W97A 1E2XA 3K4MA 3KLNA 1ERDA 2BW3A 3CESA 3EYYA 4JOMA 5DM7F 3DLLF 1OCTC 2EZIA 1BOAA 4G7ZF 2VQLA 1Y1VJ 1KQ9A 3KYDB 3CF2A 3QU3A 4LIUA 4AWXB 1JXSA 3OL4A 1R6RA 2W00A 1YX5A 2PN6A 3QQAA 2PJRB 3CCJI 1P7IA 3IKVA 3ZMTA 1XDUA 3ZMVA 3O8GA 4UVAA 1MJAA 1F43A 4U7BA 2DFHA 3K6GA 2D2WA 1ZGJA 4KT5C 4A6EA 1D5VA 1UFMA 1STZA 1IZ1A 2H6BA 3ZXSA 2ZXHA 3MVPA 3FXLA 3NRVA 4Y3OA 3WTXC 2ZC2A 2FX0A 1W36D 4XRMA 2K9QA 4ASNA 2JVGA 1SD4A 2VONA 1W7PD 2NVYJ 1XGSA 3L1PA 4P5OA 2LF8A 1F4KA 5C4XJ 3RZOJ 2DTZA 1XCBA 4Y13A 4B3AA 2WBMA 2A6TA 2BE5F 2KPMA 4ANJA 2VUMJ 3LFUA 1GXPA 1IN7A 3TBIA 1TZLA 3JCUC 1AU7A 3K1MA 1OISA 4D0PA 2GZWA 5FKOA 3BR2A 3HRMA 4YIIA 3KP3A 5LLQA 3F6OA 1SMTA 4M9XA 4XL9A 3BZ6A 2M45A 5KAIC 3ZN1A 2ZJQF 3MZYA 2GIZA 3HPGA 3I53A 1PJRA 2BY1A 1WJAA 3FHZA 3GZNB 3K7AJ 2ME6A 4J19A 5FKNA 5CYVA 5DCFA 4PGHA 3FXQA 1YRNB 1ZYRF 3WGIA 4BGDA 3QOEA 2PI0A 1TWAJ 3W6VA 4NQWB 5K7FA 2HDDA 3AG2H 4V2GA 3DLAA 3HYIA 4BDYA 1SD7A 2AS5F 3F23A 3UKGA 1MIJA 3HGGA 5LRSA 2NYXA 4OIOF 4UV8A 3CDLA 2C6YA 4UUTA 3E6CC 1N75A 3BY6A 3E6DA 1RPWA 4L9TA 2R7RA 2EV6A 1IXRC 2BHZA 4BE1A 3KYCB 3VB2A 2RC4A 3JTGA 3HOWJ 2Z3YA 4BQQA 3P9CA 3ABKH 2FBIA 3Q0VA 2DOAA 2GQQA 3IC7A 2JRTA 5E8GA 1MMAA 3GYHX 4B4CA 2DLLA 1V3FA 3N4MA 1NTCA 2O7OA 2H94A 3CP8A 3I55I 2QVOA 2DFFA 1LEBA 3GFJA 4KN7X 2HYFA 2V6CA 5J47A 3LOCA 3ZQIA 1U8RA 4O3MA 3VDXA 3L2RA 3ROUA 2AQFA 4G8XA 3F8BA 1R36A 3A0BC 1RRJA 4WF2A 5K5OA 2GXBA 2XUBA 3BC8A 2RREA 2LTPA 3FMQA 4PJ0C 1BIBA 1TTYA 2DK5A 4M6VA 5LHHA 4IHTA 3Q9SA 3H5AA 2CRGA 1D5YA 1RUOA 4NC8A 3B02A 5DM6F 3AFHA 4FHTA 3GTOJ 3U9GA 1JTYA 4QPQA 4L5IA 3CMAI 5FKMA 3CP2A 4HF0A 4IOCF 5L3BA 1ZELA 2IGOA 1JHHA 1XGNA 1QA6A 4N4NB 3LAPA 2R5ZA 2Z5UA 2OJED 3JAMK 4OOIA 3ZGKA 5D5VB 1S7EA 1X19A 3ZPLA 3MMYB 6PAXA 3WTWC 1SVMA 1DP3A 3BLYA 2JQ7A 1P2FA 5KVRA 2B0LA 2VLAA 4XIDA 5E1XA 2JPCA 5DDGA 5EEAA 3QOPA 4XKBA 3WGGA 4XK4A 1HA8A 2LH9A 1U9NA 2V6EA 4KIFA 1H8AC 3K4BA 2CS3A 3F8NA 5GPCA 4JX4A 4KJZA 1U8BA 2CJJA 3LSRA 2MC4A 2W7NA 5HNFA 1BJZA 3BCBA 3D0SA 2A5YB 3DU6A 4LK0F 2CH0A 1VQOI 1XGOA 1S8NA 1TT0A 1MBJA 2E1NA 2Y0SA 4NC6A 2O61A 1FBQA 4G94A 2L4MA 3BTCA 3OYLA 1G3SA 4G12A 1W5SA 1ZQ3P 2DA1A 4RM2A 2FEZA 4ZYHA 2O6GE 3BPVA 2L3DA 1G8XA 4BJTA 3ZOBA 4KN4X 1XMKA 3VYRB 1F36A 2ZJRF 4ESFA 2TRTA 4OINF 4BXFA 1X1AA 2YSRA 1MSEC 2ECBA 4ENNA 2BVLA 5E79C 2M4GA 2R7DA 4HX7A 3C18A 3QP6A 1A6IA 1P4XA 1JJ6C 4CICA 4QLCU 1KU9A 3NEUA 2O0YA 1IRXA 1YW7A 1JUMA 1SANA 1F5TA 3I3LA 4GYIA 2WV0A 3F8MA 4HYEA 5CQEA 5F6FA 1YLFA 1LE8B 1RKTA 2DMPA 1C0WA 2OTJI 3KX2A 4PJMA 5ICFA 4XLNF 1BI1A 1K83J 2LRDA 2RDPA 1R5HA 1X3WB 3LNQA 3F21A 2HVRA 2TDXA 3K0LA 2E36A 2XROA 1TL8A 2RNGA 1RR7A 4EJUA 5K7HA 5HODA 4MEXF 1BL0A 5CVUA 1G3TA 2NS7A 1YW8A 3MKWB 2FOKA 2JSCA 5FFZA 3I71A 2P6TA 3IRRA 4OIPF 3KEQA 4L5EA 3TO7A 3KP6A 3S17J 4KNYA 1EV7A 4E6KG 4PSXA 3HBLA 4E7ZA 2IW5A 1KU2A 4PSWA 2N8GA 5D4RA 2GXGA 1F9NA 1X1CA 4PCQA 3JRHA 2WA0A 1XDSA 1W0UA 4A3FJ 5BPIA 2WC2A 2H8WA 2QKLB 3FBIB 4L0YB 3FXJA 1P9QC 1XSVA 3HG9A 3KLOA 4A3KJ 4HSTA 2BHYA 4L0ZB 4Q47A 2H09A 2LKSA 3TMOA 2P0WA 2ACJA 3ASNH 1JUSA 1V54H 2B7EA 3BG9A 3J7YJ 2Z1DA 2WADA 3H35A 1FYMA 2V26A 3WTTC 2DA5A 3GLLA 4I0BA 2VXZA 2KISA 1FSEA 2AXLA 4G6TB 5H20A 3SZPA 4DZPA 2O9LA 3IWZA 1Z6TA 2IAIA 4HQMA 3WE2A 4BEHA 3ABTA 2X6YA 3CCRI 3D1NI 2KIUA 4GXOA 3K4CA 2PQ8A 2B9SA 3FXOA 1FC3A 2XAQA 1XB4A 1AOYA 1E3PA 2IPQX 3GTLJ 3R0JA 1TQIA 5L3EA 3I59A 1NG7A 2VKVA 4ZDPA 4K2EA 1FEXA 1SD5A 1T6SA 1WKMA 1WI9A 4YIFA 2NNYA 1D1CA 5IYCJ 3K4NA 2ID3A 4XLHA 4XMYA 1Y8RB 3L2UA 5M3FJ 2CQNA 4M3BA 2FXAA 1ENHA 1B72B 1R71A 2MABA 1FPQA 2L7FP 1RNLA 1DQUA 3ABLH 1V5GA 2P81A 1H9GA 3OY9A 1LFPA 4AVPA 4UXNA 4DYCA 3A02A 5BS6A 1KYZA 1B6AA 1YIOA 2O5RA 1VZ0A 1OR7C 3TQNA 1EKEA 2IS6A 3L09A 1T0FC 3HKZN 5DCMA 5F1JA 1YE9A 2RV8A 1XTAA 1EF4A 2NNNA 1YS7A 2ZXWH 2COBA 3EPZA 1UJ8A 2XPUA 1ITYA 1LPQA 4E70A 3FWEA 4UUSB 4B47A 1JT0A 2BY0A 1NG6A 1G3WA 2EQRA 4N4OB 1FOXA 4BE2A 1QHGA 3TOAA 3JRFA 1ZG1A 3DKXA 1HKSA 3EYIA 4KDPA 3RQIA 4DW6A 1MD0A 2ZCWA 3K9TA 3SZGA 5DYMA 3KETA 3S3OA 1ETXA 4YRVA 3DU5A 3W2WA 2UZKA 3FXRA 3G3ZA 4M3GA 5GAEJ 3M1CA 3DF8A 1R22A 1D0ZA 2YUSA 1KGSA 1JT6A 3T8RA 1ZR2A 1LKXA 1W5CC 1LB2A 1BI3A 1GHCA 1TT5B 1BW6A 3GMEA 4M74A 3CC7I 2P6SA 2XF7A 3EUAA 2M34A 2I8DA 1XX5A 3CLOA 2FBHA 2J5OA 4XN3A 1YIJI 3GTJJ 2P4WA 4LG0A 4BAYA 2KDOA 2VE8A 2HPMA 2UXNA 1BA5A 1YW9A 3ECOA 1WJ5A 1ZARA 3RQ4A 4Q4ZF 3FBNB 2L0KA 1S6LA 1LDKB 2ID6A 2GA1A 3MCZA 2MC3A 2MG4A 3GTPJ 3KP7A 5FROA 3CUQA 4A0ZA 1VQ6I 5HLGA 2GAUA 3JTHA 2YX7A 1W36C 1QO0D 5EEHA 4D5CA 1T38A 2FD5A 3PQJA 4XKWA 1JHFA 4WXCA 2KJCA 4WK8F 3COAC 2DA7A 1ZREA 3I4MJ 2DA2A 5HDGA 2Y9ZA 3SQNA 2H27A 1TWFJ 1O3TA 1FT9A 2G7HA 5LHGA 3GTGJ 1DP7P 1D8JA 4PFPA 3W6JB 2VJJA 3HDDA 3WTZA 4KIGA 4MFDA 2R5YA 4XICA 4MO7A 1OCRH 5F0FA 3RKQA 4ZZDA 2E1OA 4EJTA 3TDUC 1T2KA 3I54A 3LSGA 4ZYAA 1H9TA 4HOBA 2HQNA 4ABZA 1FP1D 4KISA 3GZ6A 1I6XA 1QZZA 2LP0A 2EFOA 3ERED 1LDDA 2QUFA 3PQKA 4OIQF 4UB6C 4OIRF 5EGOA 2E71A 3Q0UA 4PFOA 3BR1A 3S2WA 1FWZA 4OWRB 4BHPA 3G2BA 2HPIA 3U2RA 2YU3A 3EQLF 3ZR8X 3BG3A 2FUG2 5D5WB 2CV0A 1WJFA 3JREA 3H1CA 3VYUB 5EF6A 3GEZA 1CF7B 2VASA 3HHGA 3HUGB 4A3IJ 2LYCA 2H8RA 1A04A 1AKHB 2NAZA 3K4KA 1J75A 2EH3A 2CQ7A 2NOGA 2VKHA 2OCCH 5HDKA 4YELA 4EJWA 1WJCA 2IS2A 5IOZA 2DI3A 4G6QA 1OYYA 1Y0NA 5LBQA 4IHVA 1K4TA 1OMIA 1MJBA 4N0BA 1FOKA 2LLKA 4OMZA 3SDGA 2UWMA 1CQTA 1IGNA 1DGRM 5DS9A 2OZUA 1ZG5A 5E1WA 5HVQC 5FJ8J 3K1PA 4A69C 5L3GA 4WCGA 3MKZA 3ZN0A 3WHCA 3KP2A 3ONQA 4XOTA 3CCEI 1RC9A 5C4JJ 3DFGA 4M6YA 2EJRA 3QYFA 2Q2EA 4DBQA 4EQQA 4KITB 1ZH5A 2PJRA 2EZKA 3ISPA 1UB9A 4XRSG 2KZVA 2ELKA 2MD0A 1IUFA 1QRYA 4ENKA 3OS0A 1GV2A 2PX9A 1Y56A 3FK6A 1I1GA 3DKWA 2L5QA 3I56I 3L2VA 3S1RJ 2EIKH 3BWGA 3C7JA 1LFUP 5KCMA 1O3RA 3H3VK 2K3FA 5FD6A 5M3MJ 3FISA 4XLPF 5BPDA 4X6AJ 2HEOA 3CDIA 4M3EA 1J0RA 2COMA 4BQNA 1FSHA 3S1QJ 5F1RA 3CMYA 2V4JC 4C3IJ 3G71I 3CF5F 3W2AA 3V8LA 4D7MA 2DFEA 1FZPB 4Y17A 1X4PA 2M8GX 4HX4A 2FOWA 2MLKA 2DXIA 3BZCA 1FX7A 5TJJA 1SFXA 2BBYA 4NBQA 3ZCOA 4S05A 3P5JA 3HPHA 1SFOJ 2VC0A 4NC7A 4HNTA 2E1MC 4EATA 4JX6A 3M9AA 3E6BA 4IHSA 3GO5A 1WFXA 4D5FA 2W85A 1BI0A 4KFCA 4FX4A 1XD7A 2K85A 3PJRA 3OV8A 2JJ7A 2ETHA 1YRNA 1HC8A 4BKXA 2Q8KA 1R4NB 2QKMB 2IA1A 4IPAA 3F72A 4NQWA 3W3CA 4CCKA 4RGRA 3LSHA 2E35A 4EEFG 1MBEA 2HQ5A 2MH2A 1R58A 4ZDLA 4HLYA 2VBWA 3HGYA 1SD6A 2BGCA 5EZHA 3OYGA 3VPRA 2DJNA 4MTDA 4NB5A 1D1BA 2HOEA 4AIJA 2QQBA 5CVIA 3J7AY 4S0HB 4UB8C 4RA2A 5FGMA 4BXUA 3VFZA 1S72I 1R7JA 2MYSA 3ASOH 2QENA 4R1HA 3HOSA 2VJ5A 2Q2EB 3REOA 1ORKA 4FE7A 2Y9YA 1T95A 1MZBA 4F52A 1B1BA 3IUOA 3J81Z 4BXXJ 2VPLA 2LY2A 2K4BA 4EM1A 4XRFA 2VJ4A 1FJLA 1VFCA 2CWEA 2KL4A 5K5QA 3T1BA 1SFUA 2EA2A 1QHHD 2DA4A 1PP7U 3BR0A 4KIBA 2ISYA 2EILH 2EA4A 2JMWA 2RGVA 3M07A 2M3AA 4F3QA 2NS0A 2DT6A 2LBFB 4I76A 4HNVA 4CDGA 5HLTA 4BNCA 4IZZA 2HQAA 2KFDA 2W24A 2A3SA 5ICGA 3D5RC 2IA0A 2GIVA 1MMSA 4DGWB 5J1YA 1APLC 1X1DA 3DQVC 1FLIA 4ZDOA 1RESA 3AAFA 3K69A 2E7XA 3OYIA 4FX0A 3QWLA 2IGKA 1RKWA 4ZTJA 2XAUA 3JRCA 2FU4A 2XC7A 2F5CA 3PNVA 2HNHA 2XB0X 4WWCA 3MQ0A 1OCOH 3M8JA 3H92A 3IH3A 4HG2A 2A61A 4L9VA 3MWMA 2CMPA 1JKPC 4LMYA 1BN5A 4E7LA 3JAMZ 2ZXJA 4XNFA 4J01A 2KRCA 2LY9A 3S93A 2OTLI 1YOVB 4W1UA 4DYRA 3FMSA 1IUYA 3RKXA 4IX7A 1SMYF 1VQ9I 2W4SA 2OC6A 2DDBA 2L7KA 1SAUA 3QPLA 4RAFA 1IDYA 1JUPA 2M2EA 4NNJA 3F8CA 1KYWA 1ZHFA 3J7ZI 4LB6B 5HLHA 4CCNA 4U0WA 1QZYA 5K1YA 3IAM2 1IJWC 1EJ9A 1X4OA 4A3JJ 3DPTA 4N9IA 3M4OJ 2IS1A 2R7VA 5M5YJ 4JX5A 4Z2YA 2XB5A 3J80Z 3OYHA 1HSTA 4EV0A 3BT9A 1UELB 4I0AA 3HSEA 1J59A 4JBAA 2ZJ2A 5DUKA 5LFAA 2HWVA 5JLXA 5AIPA 1V5FA 5L3CA 3O2PE 3EUHC 3S8PA 4C3JJ 3RYPA 2Z33A 3AKZA 2NOJB 2DFIA 2K9LA 2E2IJ 1YI2I 5B3SH 2EV0A 1LUJB 1QNTA 2WV1A 4WXHA 2I10A 2E1MB 5TGTA 4A6DA 2CUFA 1BR1A 1Q1HA 4KA4A 3L2CA 2GA2A 5A2QK 4I01A 3OYAA 3A01B 1LE8A 2GM4A 5TRDA 2LREA 3LL7A 3QPSA 3SDBA 3DTKA 2OU2A 2VJIA 3KP5A 5GP9A 3LMMA 3U1DA 1R1UA 3RKWA 2XF5A 4AU7A 4PUSA 3OYEA 4X0GA 1FYKA 3HZJA 1MMGA 4HZFA 4XN0A 1WJEA 4XLFA 4YFKF 1YHQI 4B1RA 2Y75A 5ILSA 4DQ2A 2STWA 1YJNI 1B4AA 2DW4A 3L2WA 1FP2A 3HRTA 2G7UA 1Z6RA 2X9DA 3OYFA 5E18F 4CA0A 1XMXA 5J8FA 2VKDA 2XPVA 5J8CA 1TLHB 3WU0A 4QIWN 2VOOA 4BQAA 2XGEA 4M3FA 3G73A 4BJ5C 4EM2A 3RPUA 3WGHA 5J40A 1GVJA 4MFEA 2VBXA 3BROA 4J00A 3D5SC 5FKLA 4U7DA 2CUJA 5CKTA 3JRGA 1I5ZA 1ZTRA 1SEUA 4ITVA 1HKTA 3HTSB 4U0YA 3BTJA 1TWHJ 5J6XA 3JRIA 3M1EA 2DODA 3E5UA 4C30A 5H2FC 1IF1A 2NS8A 3C2BA 4PDKA 3HOVJ 2DAOA 1I39A 4P9FA 4GO1A 2IXSA 2R7WA 1MW7A 1K7AA 4RM3A 2IA2A 2K27A 5IPAA 2VN2A 3Q3SA 1MDMB 3GTKJ 2DMUA 2E19A 3RIRA 1S29A 2QSFX 4NUBA 1D0XA 4G6DA 4IVNA 4U87A 2H1LA 3TP0A 3BJ6A 4P55A 4D1QA 4LIVA 1IG7A 4HV5A 2BZTA 3AG3H 2CW8A 2QF7A 4CZZA 5HS7A 3H0GJ 3HSFA 4BHBA 5K7ZA 3P9IA 2AO9A 1I6HJ 1PYVA 3ULQB 3IH4A 5F0HA 3HB9A 1MBKA 2CUZA 3DKYA 5FRMA 1ZK8A 1L0OC 1FBUA 1I3AA 2V9KA 4FQGA 4HNUA 1IRGA 2CO5A 1ZR4A 4E7KA 3B6AA 1MKMA 2Y2ZA 4AIDA 1BR4A 3ZMDA 2Y48A 3W2VA 4Y7NJ 1T98A 2KLOA 1AWCA 2E1CA 2HTSA 4HLXA 1B72A 2EIMH 4KT6A 3CJTB 1L3LA 1X2MA 3FXMA 1VQKI 3HOYJ 1LEAA 4M6XA 3KFWX 4RB2C 3PM1A 5E1ZB 1HW5A 3CC4I 3JSPA 2DK8A 3KYLA 3E3VA 1EH7A 4EJVA 2BEOA 3NQOA 3ML6A 3UNGC 4E4HA 2PEXA 1O3SA 3KEYA 1H0MA 1QQIA 1XMAA 2HZDA 1O7FA 4UHTA 3DV8A 3GWZA 3GFLA 4CXFA 4OAZA 3I58A 4LLNA 2W1OA 3F6VA 4UUSA 2XSJC 4XOPA 1KZHA 2LY1A 3RDIA 5HS9A 1I3QJ 2YPRA 1W4MA 2VIXA 2WY8Q 5FFXA 2E5NA 4HF1A 5FLXZ 4CHUA 3K2AA 3CTAA 1K79A 2R92J 1OQYA 4NHJA 3DTIA 3K70D 3BP8A 4DNCA 3H9QA 3BQZA 2CFOA 2X6WA 5H6QA 2K02A 1ZKGA 2D5VA 5GTIC 3T5XA 1OCCH 3A2KA 4XBFA 2FBKA 1FMWA 5CVRA 3QYEA 3L00A 4BY7J 5IY5H 4QSHA 2PBIA 2GOMA 1BJAA 2OD5A 4CUGA 4EM0B 3LA3A 3E6MA 3ZMZA 4I02A 1WVRA 2DCEA 3F0CA 3V8KA 3G4SI 2FE3A 3DEUA 2LFBA 4MEYF 4G9YA 2A6EF 2WAQA 3PSIA 4AM3A 1BBYA 2XASA 2ZSHB 2HOTA 1F1ZA 5IT3A 4I98B 4ZH4F 3BDDA 4A3BJ 3SFIA 1O57A 3QRFF 2P5KA 1CGPA 3B6CA 1U0JA 5M5XJ 2DQLA 2QCOA 3I5UA 4MQ9F 3LFKA 3FXUA 3SXYA 3BZKA 5D6FA 2ISZA 3DBHB 3HSRA 2VE9A 3EUKL 3W6KB 1Y39A 4I2OA 1IN4A 1PUFB 3CCVI 4CYDA 5AIQA 3MEXA 3BR6A 4HAMA 2WAEA 3TEDA 2RQQA 4U0VA 1ETWA 2KJBA 3LQQA 5FD5A 5LRRA 4AC0A 1S3JA 2HI3A 2JA8J 3AL0C 2WY7Q 5C3EJ 3DEEA 2CW7A 2VBZA 1FYLA 1S7OA 1E17A 4YG2F 2DMNA 3ZMUA 2WWYA 2L7ZA 4LITA 1X2NA 5EYRA 2ZSIB 1I27A 1YTYA 2Y31A 1HCRA 5K5RA 3K4LA 2RVCA 5ICCA 1A36A 4A12A 2VQHA 3T0YA 3G1MA 2G0EA 1Q1VA 3RJPA 1ETVA 4RB3C 3K4JA 2ICWG 3BOQA 5E20A 2L54A 5JHUA 4IRIA 5KAFC 5FB2A 1XPXA 2L2OA 3OSFA 4HF2A 2X1CA 3IWFA 1QPIA 2CGPA 4I6ZA 3PO3J 1IV6A 5L3DA 1IO2A 5C44J 1ZRFA 1JGSA 2EFNA 2NVUB 2LKXA 1IC8A 4XLAA 2QSHX 2M0CA 1UAAA 5BNGA 1HSJA 3WTYC 2QYOA 1CF7A 3OWTA 4A3GJ 3HUGA 2J5PA 1E3OC 1AKHA 2HFHA 3QYBA 3S1NJ 2WAFA 3ZQHA 1W1WE 1O4XA 2XV4S 4MLOA 4DIQA 3PUBA 3R6SA 2X51A 2K86A 1OFCX 4LOCA 2HZTA 2IT0A 3OIOA 3C2GA 2AQEA 4ON0A 1ZGWA 1K6YA 3FHNA 3BTIA 1OR7A 3ZQ7A 2L02A 4RDUA 1TQPA 1T0FA 4R8HA 1G3YA 2VT2A 1YJ9I 2HOSA 3H9JA 4D9JA 2HDCA 1Z91A 5EEGA 3N05A 1N77A 5IT9K 3OYCA 1WH7A 2VC1A 4DBRA 2E60A 2L7MP 2R0QC 4Q5SF 4S04A 1ON2A 4AIHA 4U88A 3CUOA 5EJCA 2LR8A 3HM5A 4ZTFA 2IEKA 2XAJA 1FBSA 5DD4A 4KICA 4Y52J 1USTA 1JKRC 3BTLA 1W0TA 2EZLA 4LLLA 2XGCA 4XLEA 4AD9A 1ZG3A 2XF6A 2F4IA 2JK3A 1G6NA 3GUDA 2DJIA 3HXLA 4A3DJ 3V7CA 2M1BA 2W48A 4V19K 2XSDC 1G59A 4ENJA 2ESNA 1MNEA 1DU6A 3I4PA 1XS9A 1U3EM 4BU2A 2M87A 3IAS2 2F5DA 4IF4A 2VB6A 3LSTA 1DPRA 3LQRA 2VODA 2HGCA 2E34A 5D6EA 5E8IA 1XC5A 4C2MJ 2HVQA 3MFKA 5LEKA 1MBGA 2JA6J 1LVAA 3E97A 3JRBA 3RKYA 2X0LA 1X3ZB 2X1EA 2ZMEC 3A4CA 4EGYA 1W7PA 3I64A 2UUZA 1NHAA 2BXYA 4MIMA 3WTSC 1VQPI 2FQ4A 2L9NA 3K2ZA 3L7WA 3S32A 1WRJA 4FCYA 4IHXA 1EH8A 4PZJA 1PVEA 1GV5A 3CCYA 5B1AH 1ETQA 2QWWA 5DUIA 1UHMA 5FKKA 3AL0B 3CDHA 4M9ZA 4C3HJ 3BG7A 3CJQB 2PMZN 2Z99A 4UUVA 4JYKA 3WU2C 3CCMI 4A5MA 1BM9A 1K6OA 5F27A 1IXSB 1FNNA 2M0MA 3GTQJ 1FOWA 1S9HA 2JA5J 5B5EC 1X3UA 4PJLA 1P4WA 4GYGA 1TW2A 5ERIA 4C2UA 2CU7A 2HKXA 2Z16A 1SFEA 1UHWA 2ZJPF 2NRAC 3ELKA 2DYSH 3CJRB 2OQRA 3GBGA 1U5TC 3E1SA 2K4JA 2D1HA 2JN6A 2FF4A 2BOLA 2XRLA 3IV5A 1WCMJ 2JSPA 1E3HA 4HX8A 5J1RA 5ILVA 4A3MJ 1WPKA 2MA3A 2KP6A 2F4OB 1ACIA 2LBFA 2OUMA 4ZYGA 3NARA 4WXDA 3CQZJ 2L9VA 1P4AA 2DOEA 4A3LJ 5LGTA 3FMRA 3BG5A 1IN6A 4RLFA 1BOBA 5J4YA 1AHDP 1T08B 2XKOA 4AIKA 5KK1A 3PFIA 4BBRJ 3LAJA 2R3SA 2BY3A 2ECCA 3HTUA 1WWXA 3BG6A 1UG2A 3OR2C 1J09A 4FISA 5KNLA 1KQ0A 2NVQJ 2HVSA 3VODA 4FASD 4UV9A 5HLIA 5EG0B 5AONA 3WU1B 3R0AA 5EZGA 1BC8C 1BR2A 4XLCA 3ZMSA 2KRHA 1W7PB 4BS9A 4KYWA 2D1VA 2LD5A 5IYDJ 3OIQA 1DUXC 4F55A 2K5CA 4XM3A 2CSOA 3G1LA 1XCVA 3ERMA 3GLXA 2M7BA 1LNWA 1ETYA 3RZDJ 1ZRDA 1N78A 3T8TA 2LG4A 3BR5A 2FNPA 5ED4A 5L3FA 3HEFA 3JRDA 2PG4A 3E5XA 3Q0WA 2DPDA 1T33A 3M8EA 1DPUA 2GOXB 1KU3A 2W57A 5GAHJ 1YITI 1BI2A 1SVOA 4LGWA 4YEJA 5F04A 1WSUA 3SYTA 3F3XA 3DBLB 4DYQA 3HC7A 3WG7H 1POGA 4F92B 1RETA 5CVJA 5FLVA 1VQ4I 3C3WA 3S1MJ 1WHUA 2XGXA 3WTUC 2P7CB 4QTRA 1JTXA 1KQ8A 3ECHA 4IO9F 3SJMA 3PNTA 2CQKA 1NK3P 3C1DA 4P1WA 2R7TA 2QQAA 4E7HA 2L9RA 1R00A 1NH3A 2KHMA 5LEJA 3HL2A 1Z05A 2K9NA 3CMEI 3SFZA 3LSJA 1Z77A 1J2XA 5ICEA 1G4DA 1QZEA 3LWFA 1MJ9A 4CYCB 3OR1C 4YFXF 3H0DA 3PIOF 3B73A 4M73A 5GAGJ 3IHUA 1R5ID 4G7OF 2M7AA 3A01A 4II2A 3L2QA 4UY8I 2ZMEB 1WJDA 2XAFA 4CCOA 5A2QZ 4PGGA 3FIWA 2UV1A 3HRSA 3M3YJ 1UHSA 4LG3A 2Q0OA 1FIPA 2JA7J 1G2HA 3V7SA 2FJ1A 2UXXA 1P6RA 4FTHA 3SHFA 1YYVA 5F64A 2O03A 4IRHA 3TDZC 3WHBA 2STTA 2KDZA 2QBYA 5JR3A 3DXJF 5JVTA 4GDFA 2WAQN 4HDVA 3K70C 2H6CA 2OZ6A 2IP2A 3MAJA 4A5NA 1FOYA 3OYNA 3TW7A 2LDUA 1FIAA 1SAXA 3A0HC 2LVSA 4RGXA 2EBIA 3S2HJ 1VI0A 1IAWA 3DTEA 1IRFA 3PL8A 4JP0A 3OMYA 2EWNA 4Y15A 2FQ3A 2HS5A 2RNJA 1QBJA 1YX3A 1XSXA 2ZNYA 3ESWB 1TBXA 1B8IB 3ZQGA 5LHIA 1U5TB 4IJAA 1P7JA 4MQVA 3OYDA 2MBFA 2O8KA 3PIPF 2MGQA 3GCMA 3CC2I 1MH4A 2LSOA 3NWSA 1KONA 2IGMA 5DV5A 5GTHC 4MNUA 2GBYA 2V1XA 2PLYA 4QPOA 3MKLA 3H3UA 4F91B 2W84A 1MDMA 3WG9A 2HTJA 2R7OA 3IP4B 4UNOA 3BCAA 1Y1WJ 5B1BH 2HU9A 2BW3B 4RB1A 5B66C 2G9WA 2DT5A 3OYKA 4BE0A 3CMMA 3OS1A 4HW0A 1WJBA 5E3MA 3J81K 3S15J 2PJPA 2XVCA 1T56A 4BQOA 1GDTA 3GXOA 4IHWA 2YX4A 1R9TJ 1LVKA 2R7QA 1BIAA 4CZCA 3TGNA 4HEA2 1E0EA 1ZLKA 1JE8A 1LDJA 3DP7A 3IH2A 1OPCA 3JR9A 2HKOA 4N9HA 3U21A 4AYBN 4C9YA 3GFMA 1TP4A 1VQ8I 3LSIA 2DOFA 1HLVA 5LGUA 1QVUA 3SEZA 4A3EJ 1DGWY 2KMUA 2CYYA 1UG0A 2KZGA 1HKQA 3O8HA 3TW6A 1MH3A 2KT0A 5HS8A 4B48A 2QBYB 2EB7A 2PMZA 1XGMA 1ONVA 3KIOA 2EPFA 4B43A 1VQNI 2RKHA 4E7IA 2CV1A 1RUNA 3OOUA 2PFBA 2IRFG 3E7LA 1D8KA 2I5UA 2EFPA 3RPQA 2JUCA 4P96A 2K7LA 2CQQA 1Z7UA 1JGGA 1IW7F 2F4MB 2GWRA 1GXQA 5BMZA 2OAZA 4RLQA 3JSOA 3KEOA 3MZHA 3R4KA 4ZYEA 3H3ZA 1HW2A 3S14J 1SC7A 3H5NA 1HQCA 2HYJA 1BW5A 2OBPA 3GVAA 4TV7A 4ETSA 1N25A 2V9PA 3HOUJ 2CG4A 3RCOA 3PUFA 2R7ZJ 3L9FA 3V8JA 3QPTA 2K9SA 3EUHA 2XAHA 3R61A 4GRIA 4FE4A 2PMUA 3M8FA 1I1SA 3KPHA 4I09A 3KZYA 1PP8F 5E3LA 2JZYA 2LOOA 4O6JA 2JUGA 5D5UB 2BYVE 2VXDA 2EFWA 2P8TA 4L18B 3N97A 4XSXF 2Z2SB 4LJZF 5E3OA 4IXAA 2E2JJ 4EGZA 4IQJA 1TC3C 4G7HF 3K1NA 5BQTA 2BV6A 3KZIC 1Z21A 2QGUA 3J80K 2BY2A 4BY1J 1VNDA 4I7HA 5J1UA 1MNDA 1PDNC 1ZLJA 1AA7A 2F5VA 4OMYA 2K9MA 1IV8A 4UVCA 2R93J 2FRHA 5HNHA 2QSGX 3OL3A 2DO7A 4ZZLA 4O5VA 1UCRA 2ZFWA 1EA3A 1J5YA 2Z9OA 2W25A 5FRNA 2LC2A 1HDPA 4LFUA 3HHHA 3H5RA 2VT3A 4F7ZA 3X2QH 9ANTA 3CO6C 4HSRA 2ZKZA 2P5LC 1PUFA 1IXCA 2E7WA 2P5VA 2R4GA 3R60A 4BL0B 2HXOA 1Y6IA 5CPRB 1IDZA 5IP7J 3BQYA 4V2FA 2CFXA 2V1DA 5LD2C 3TO6A 1OCZH 1MGTA 2OCEA 2L9SA 1Z0XA 2OF7A 1XN7A 4RS8A 2WB1N 4ESJA 2DMTA 2FA5A 4L5JA 4EVIA 2JVHA 2DA3A 5IYBJ 1MMDA 4X1EA 3C2HA 4XONA 5JFRA 1ON1A 3MD2A 3NAUA 4L9NA 5J3LA 3QU6A 1HOMA 2XIGA 4FT8A 2A5WA 2B63J 1WI3A 4DZJA 4ESBA 2R5ZB 1OJLA 4NDLA 4F93B 4II3A 3FZVA 3KZZA 4BYYA 3LSMA 4H0EA 3QP5A 4M72A 3VSKA 4XR6A 2RQPA 1JI8A 4BUPA 1SFKA 4AUXA 2EFQA 4RMNA 4GFBA 3OYMA 2O3FA 1FY7A 2A69F 5E17F 4HPQA 4OAYA 4PJNA 1ULYA 1DDNA 2MW8A 3ZP5A 5CQGA 1YJWI 2FSWA 2R7SA 4AVZA 1QGPA 1FMVA 2MD5A 3JW4A 4B44A 3EETA 2KKOA 2QA4I 4YFNF 2L01A 2IVMA 4HV6A 1ZN2A 2DQRA 4QWQA 4RAYA 4IKFA 1MBHA 1U78A 3H36A 3S3NA 2LK2A 2M8EA 2HYGD 4CCMA 2JTVA 1P92A 3QODA 4CCLA 1HF0A 4ZJZA 3A03A 4Y4RA 3HIFA 1QVTA 4Q48A 4ENMA 4KUMA 1T39A 1TQMA 3TL4X 4C2TA 1HDDC 2CW0F 3P9KA 4RB0A 3CCUI 5FLMJ 2ZNZA 2A68F 1REPC 4WX9A 2ZB9A 1MNMC 2RN7A 2JT1A 5CVVA 2ELHA 2QQ8A 2DA6A 3GX4X 3VWBA 5F0CA 3RSNA 4BBSJ 1A6QA 2YU9J 5CJ9A 2F5EA 3BR3A 4I99C 3MZ8A 1WQ2A 1NK2P 1MSFC 3DPLC 2ADUA 3RPUD 2DBBA 5E3NA 5IT9Z 2F6CA 4IOAF 5J4VA 2EZHA 5D4SA 3V4GA 4DOZA 1QU3A 4RGSA 3U1KA 2ZFUA 3M7GA 4B3XA 1YS6A 4M71A 1TNTA 2W82A 2Y69H 3F8FA 2DU9A 3LA7A 3CCLI 3BPXA 1R1VA 1JKOC 3OYBA 1R23A 1T8IA 4A0XA 1ZAOA 3J7AO 1Z3XA 1YG2A 5M5WJ 2IJLA 1ETOA 1RIOH 1IN5A 1TWCJ 3CJNA 2V9VA 1A31A 4HDUA 4CH7A 2KIFA 3OOPA 3CUQC 2CV2A 3FXKA 1OCPA 3KP4A 3WE3A 3H9GA 4MGRA 2CQXA 2JPBA 2VBYA 1O3QA 1HW1A 3CD6I 4DJAA 1J7KA 4UVBA 3RI4A 1RI7A 3ABUA 2JRMA 2KIMA 3D5LA 3DBRB 2IBDA 3BJOA 2RAEA 2XAGA 1R49A 4MHGA 1JKQC 3DWLE 2L4AA 4CCJA 2V7FA 3KCCA 3CZ6A 3DPUA 2M9HA 1U6GA 3FM5A 5FLXK 3OSGA 3G6EI 4AYBA 3GZ5A 3RTRA 1U9OA 2EINH 2Q1ZB 1Y8QB 4A2UA 5IP9J 4EJOA 1OYIA 2E5ZA 2V1UA 3VOEA 1B59A 4ZC3A 3VYTB 2NVXJ 3FKIJ 4HQEA 3ABMH 3P7NA 5IOYA 2QQ9A 3AG1H 4P9UA 1KU7A 1D3YA 3DEWA 2MH9A 4B09A 2VQGA 4XKVA 1Z1DA 3IKTA 4GCVA 4XQFA 2AHQA 1WZ2A 3GW2A 4HBLA 2A05A 2DTRA 2OA4A 5H6RA 4BEHB 5JHFA 4B8XA 1EH6A 4KMUX 2X4HA 2QM3A 5DD8A 1K78A 2DT7B 1Y0UA 3AG4H 4BDZA 5IP6A 5GPAA 2R7XA 4IEJA 1J9IA 1O7LA 4R79A 2DN0A 2TCTA 2ESHA 3IL2A 3PFYA 3FKJA 1VQLI 3I59B 4E7SA 1GUUA 3FDYA 1TWGJ 3F22A 1GLNA 1ETKA 2XGDA 5JLWA 1GVDA 1V55H 3LSPA 2XRNA 2IS4A 2BXZA 3O6BB 1U2WA 5ILUA 1PUEE 2CUEA 1KA8A 2XHKA 3MKYB 5D5XB 3EDPA 3UR3C 3K10A 3CCQI 3PNYA 5D8KB 2FNAA 1I50J 3HJEA 1TNSA 5HDNA 5DEQA 3ZQLA 4LD5A 1R5GA 4L9JA 2H1KA 3LA2A 1X1BA 1YFHA 5LGNA 3OIPA 4KMFA 2IGNA 2QEXI 3I9V2 5JI6A 3TO9A 5DCMB 3SEQA 1W5TA 3S16J 4Z6YA 3FF5A 4JQFA 1R4MB 2PMHA 4RAZA 2MLGA 1XG1A 3PSFA 5FO5A 1DU0A 2KRFA 2VI6A 3G1OA 4IRGA 1ZRCA 1M1EB 2P7VB 2VPRA 3V7RA 3I4NJ 2HQRA 3JRAA 1X58A 3Q9VA 4M3DA 3Q5FA 3OS2A 3RYRA 2VL8A 5EG0A 4D7NA 3GTMJ 1OYWA 2DDAA 2X85A 4CSWA 4A0YA 3GF2A 3A1YA 3IRQA 1R1TA 3VSLA 3ZQQA 2E2HJ 4OU0A 1V5EA 4EMSA 3HOZJ 3I0TA 1D0YA 3QAHA 1BC7C 1WH5A 2EV5A 3O3KA 1K61A 4HRIA 1OKRA 2EK5A 2ZBKA 2ME0A 4GGGA 2M30A 2WB1A 1HXDA 2XPWA 4PJJA 2FMYA 5TISC 1VQMI 2F5FA 1VTNC 1RR8C 3MN2A 3TOBA 1K78B 3GFIA 1HBXG 2A07F 5BOXA 2VKEA 1MMNA 2Y30A 1X1PA 2HDWA 2XDVA
chains in the Genus database with same CATH topology
1T0FC 4NUBA 1D0XA 1YE9A 4U87A 4XORA 3ZRGA 4D1QA 2OV7A 4LIVA 3EPZA 3OYJA 2CW8A 2V1NA 3K70C 4Y33A 3HOTA 2IS6A 4B47A 3OYNA 3V42A 1NG6A 2BVMA 4N4OB 1PYVA 4FETA 4E7JA 2CUZA 2KQRA 3DKYA 3DTEA 5FRMA 4BE2A 1QHGA 3PL8A 2V9KA 3DKXA 3OMYA 4HNUA 4E7KA 4BJ6C 1YX3A 2R7UA 1BR4A 3SZGA 2M4KA 3S3OA 3W2VA 2KLOA 3OYDA 4XKCA 4YRVA 3DU5A 4KT6A 2ELJA 3NWSA 3W2WA 1KONA 2IGMA 1Z7LA 3M1CA 1D0ZA 3KYLA 4QPOA 1LKXA 3UNGC 4F91B 4E4HA 1Z3YA 3VYSB 2R7OA 2X1DA 2XF7A 3EUAA 3IP4B 3KEYA 2I8DA 4XN3A 2MFZA 1D1AA 3BCAA 2KDOA 2HPMA 3E0JB 2HZDA 3RQ4A 2HU9A 1WJ5A 2BW3B 2VQCA 3FBNB 3OYKA 1LDKB 4BE0A 1OLTA 3CMMA 4OAZA 3NWTA 5FROA 2W1OA 3OS1A 1WJBA 2XSJC 4XOPA 1W36C 2LY1A 4BQOA 2VIXA 2WY8Q 4XKWA 5HOOA 2E5NA 1LVKA 2R7QA 4CZCA 4HEA2 4PK4A 1E0EA 3LSKA 3DTIA 3K70D 3H9QA 2CFOA 3U21A 4C9YA 2X6WA 3LSIA 4H4KC 5KHDA 4PFPA 2VJJA 3SEZA 1DGWY 2KMUA 2K3PA 2ZXIA 1UG0A 3A2KA 1FMWA 3QYEA 4B48A 3S3MA 2PMZA 4BACA 2GOMA 4IQ4A 4CUGA 4B43A 3LSGA 3F9KA 4ZYAA 4E7IA 2CV1A 2DCEA 3OOUA 4KISA 3HKZA 2JA2A 2X6XA 2WAQA 3K4MA 3PSIA 1ERDA 2ZSHB 2BW3A 3CESA 4JOMA 4PFOA 4RLQA 2VQLA 4OWRB 3CF2A 4LIUA 1U0JA 3G2BA 3OL4A 2HPIA 1R6RA 2W00A 1YX5A 3H5NA 2PJRB 3ZR8X 3EUKL 2FUG2 3RCOA 2CV0A 4U7BA 1WJFA 3K6GA 3VYUB 2VASA 3HUGB 2LYCA 4GRIA 3ZXSA 2ZXHA 4Y3OA 3K4KA 2WAEA 2RQQA 1W36D 2VKHA 2JVGA 2LOOA 3AL0C 2JUGA 2WY7Q 3DEEA 2VXDA 4YELA 2CW7A 1WJCA 4P5OA 2IS2A 2Z2SB 4IQJA 2WBMA 4LITA 2A6TA 2KPMA 4ANJA 2ZSIB 2UWMA 3LFUA 3TBIA 1TZLA 1DGRM 3K4LA 1Z21A 2VQHA 1MNDA 5HVQC 1AA7A 2F5VA 3K4JA 2K9MA 3MKZA 4XL9A 5HNHA 3OL3A 3ONQA 4XOTA 2L2OA 2X1CA 3HPGA 1PJRA 1EA3A 5FRNA 3QYFA 4DBQA 1WJAA 2LC2A 3H5RA 4KITB 2PJRA 2KZVA 4HSRA 2MD0A 4XLAA 1UAAA 3OS0A 4BL0B 2R4GA 4BGDA 3QOEA 1Y56A 3OWTA 1Y6IA 4NQWB 5CPRB 2L5QA 3L2VA 3QYBA 5LD2C 2WAFA 3DLAA 4BDYA 5KCMA 2L9SA 4MLOA 4DIQA 3PUBA 2X51A 2JVHA 1MMDA 4XONA 3C2HA 4BQNA 3MD2A 1N75A 2V4JC 3W2AA 3C2GA 2AQEA 2R7RA 1K6YA 3FHNA 2A5WA 1X4PA 4F93B 4BE1A 4II3A 2DXIA 4BQQA 3H9JA 4D9JA 3LSMA 2DOAA 3VSKA 1N77A 3N05A 4XR6A 1MMAA 3ZCOA 1JI8A 4BUPA 1SFKA 3OYCA 3HPHA 4RMNA 4NC7A 3OYMA 4HNTA 2E1MC 4EATA 4DBRA 2E60A 3CP8A 1WFXA 4HPQA 4OAYA 4PJNA 4ZTFA 2R7SA 5CQGA 4AVZA 3VDXA 1FMVA 3L2RA 2AQFA 4B44A 3PJRA 3BC8A 2RREA 4IKFA 2QKMB 3S3NA 3W3CA 4CCKA 4CCMA 3LSHA 4XLEA 3QODA 4CCLA 3H5AA 2XF6A 4ZDLA 4ZJZA 3OYGA 4NC8A 2F4IA 4Y4RA 2DJIA 3AFHA 3HXLA 1D1BA 3J7AY 3TL4X 4C2TA 4QPQA 3CP2A 2MYSA 1G59A 1ZELA 3HOSA 2VJ5A 2IGOA 2Q2EB 4N4NB 3ZGKA 1MNEA 1T95A 4F52A 1X19A 3VWBA 3IUOA 3RSNA 4BU2A 2VPLA 2LY2A 3IAS2 3MMYB 2VB6A 2VJ4A 1DP3A 3BLYA 2VLAA 2KL4A 3DPLC 3RPUD 2HVQA 1QHHD 4XKBA 2F6CA 1HA8A 2LH9A 2V6EA 2X1EA 3K4BA 4DOZA 1QU3A 2M3AA 4F3QA 2ZFUA 3A4CA 2CS3A 2DT6A 2UUZA 2LBFB 4B3XA 4KJZA 2L9NA 5HLTA 2MC4A 2W82A 2W7NA 5HNFA 3S32A 2HQAA 4IZZA 3BCBA 3OYBA 3D5RC 3DU6A 4DGWB 2CH0A 1TT0A 1X1DA 1Z3XA 3DQVC 4ZDOA 2Y0SA 3AL0B 3OYLA 3OYIA 3BG7A 2IGKA 3CJQB 4CH7A 4ZTJA 2XAUA 2CV2A 2XC7A 4RM2A 3H9GA 3PNVA 2HNHA 4DJAA 1G8XA 4BJTA 2M0MA 1S9HA 3M8JA 3D5LA 4PJLA 4HG2A 3VYRB 2CMPA 3DWLE 4BXFA 4C2UA 1X1AA 2Z16A 2BVLA 4CCJA 2M4GA 2V7FA 4E7LA 3CZ6A 4XNFA 4J01A 3DPUA 2KRCA 3S93A 3CJRB 3GBGA 3E1SA 4AYBA 3RTRA 2BOLA 2Q1ZB 1IRXA 4IX7A 2JSPA 3I3LA 2E5ZA 5CQEA 4ZC3A 2W4SA 2OC6A 3VYTB 2KP6A 2L7KA 3KX2A 4PJMA 1SAUA 2LRDA 4NNJA 2LBFA 2OUMA 2HVRA 4CCNA 2VQGA 4XKVA 2RNGA 3IAM2 4XQFA 4RLFA 1X4OA 1BOBA 3DPTA 2IS1A 2R7VA 4BEHB 3MKWB 5JHFA 3OYHA 2DT7B 4BDZA 1UELB 4E6KG 3BG6A 4PSXA 2R7XA 4R79A 3OR2C 4E7ZA 1J09A 5KNLA 2HVSA 3PFYA 5LFAA 3FKJA 4PSWA 4FASD 4E7SA 1X1CA 1V5FA 2WA0A 3FDYA 3EUHC 3S8PA 1GLNA 1BR2A 4XLCA 2KRHA 4BS9A 2QKLB 3FBIB 3AKZA 2NOJB 2K9LA 1P9QC 3OIQA 2IS4A 4F55A 3HG9A 2K5CA 4XM3A 4HSTA 2M7BA 2E1MB 5TGTA 3TMOA 1BR1A 2P0WA 3MKYB 1N78A 3OYAA 3UR3C 3K10A 2LG4A 3PNYA 2LREA 3LL7A 2Z1DA 2WADA 3H35A 3SDBA 3DTKA 2VJIA 2V26A 3LMMA 2XF5A 4AU7A 4PUSA 3OYEA 2VXZA 4X0GA 1X1BA 3OIPA 1MMGA 2GOXB 2IGNA 4G6TB 4XN0A 1WJEA 4XLFA 3I9V2 3SEQA 4YEJA 3SYTA 4JQFA 3HC7A 4F92B 3L2WA 4BEHA 2X6YA 3PSFA 3OYFA 3K4CA 4CA0A 2VKDA 3PNTA 4P1WA 4BJ5C 2R7TA 3OS2A 4E7HA 1NG7A 2VL8A 4ZDPA 4J00A 3D5SC 2KHMA 2X85A 1D1CA 4CSWA 3K4NA 3HL2A 2CUJA 4XLHA 4XMYA 5CKTA 3A1YA 3L2UA 4ITVA 3VSLA 3ZQQA 1V5EA 1D0YA 3OR1C 2MABA 3H0DA 4C30A 4HRIA 1DQUA 1V5GA 3OY9A 2R7WA 2M7AA 2IXSA 1LFPA 1MW7A 4II2A 3L2QA 1WJDA 2WB1A 4CCOA 4RM3A 2O5RA 4PJJA 1VZ0A 2UV1A 4LG3A 1OR7C 1MMNA 2HDWA 2XDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E0J B; 
#chains in the Genus database with same CATH topology
 3TP3 A;  3QPH A;  1UZC A;  4LG0 B;  2MSY A;  3SZT A;  4RAG A;  5F08 A;  4XOR A;  3ZRG A;  3CO7 C;  2X6O A;  1MBF A;  2OV7 A;  2QLZ A;  3OYJ A;  2V1N A;  1GT0 C;  1H89 C;  4Y33 A;  1ODD A;  2FML A;  2D45 A;  1YO5 C;  1UMQ A;  4RBO A;  3HOT A;  3CUQ B;  2KIQ A;  4CGZ A;  1VF9 A;  4M9S A;  2BVM A;  3V42 A;  5EDN A;  3HOX J;  4FET A;  4E7J A;  2O8X A;  3WTV C;  2KQR A;  5CLS A;  1K4S A;  4LB5 A;  1ZGA A;  4BJ6 C;  1Z9C A;  2R7U A;  1A35 A;  1RZ4 A;  5DTD A;  2GLO A;  2M4K A;  3DCF A;  2WTE A;  2F48 A;  4XKC A;  4CYC A;  2LMD A;  2R7F A;  1A5J A;  3ZQF A;  1Z67 A;  2ELJ A;  2JWT A;  4ZYD A;  4HA8 A;  2R5Y B;  1B9M A;  1Z7L A;  1QPM A;  2V79 A;  2HOA A;  2ZME A;  3FM3 A;  1S7A A;  1SVL A;  2AXT C;  2YR2 A;  2ZO4 A;  4MTE A;  1VQ7 I;  1Z3Y A;  3VYS B;  2X1D A;  2DYR H;  4CO8 A;  2X48 A;  4JK1 X;  3KE2 A;  2Y0S N;  2EIJ H;  3WOD F;  2NVT J;  3ZQC A;  1B9N A;  2MFZ A;  1D1A A;  4XRS A;  2LF7 A;  5EGO B;  3E0J B;  2GXA A;  2VQC A;  1IN8 A;  3TKY A;  1OLT A;  3PO2 J;  1IRZ A;  3NWT A;  3E5Q A;  2NXN B;  5D8L B;  2OPT A;  4RGU A;  2XKP A;  1LFB A;  4IL6 C;  1USS A;  5HOO A;  3BJA A;  2LNB A;  3FX3 A;  4BHC A;  3FK7 A;  4PK4 A;  5GAD J;  2Y0M A;  2YS9 A;  3LSK A;  3CCS I;  4BH9 A;  2M5W A;  3VEP A;  2A6H F;  2DMQ A;  1XSD A;  1B8I A;  4A93 J;  1LJ9 A;  2K40 A;  4H4K C;  4LK1 F;  1U5T A;  4LLG F;  2LKP A;  2QZ8 A;  5KHD A;  1JJ8 C;  4IHY A;  1WGX A;  1VQ5 I;  2K3P A;  1V4R A;  2ZXI A;  2HXI A;  4XSZ F;  2VOP A;  5JVG F;  1YQA A;  1S5L C;  1H88 C;  1FTZ A;  3S3M A;  3HRU A;  2OQG A;  4BAC A;  1LQ1 A;  4A3C J;  1FTT A;  4IQ4 A;  2DPU A;  3CLQ A;  3F9K A;  4YIR X;  2HR3 A;  1TW3 A;  3HKZ A;  2JA2 A;  2X6X A;  2F2E A;  3S2D J;  4W97 A;  1E2X A;  3K4M A;  3KLN A;  1ERD A;  2BW3 A;  3CES A;  3EYY A;  4JOM A;  5DM7 F;  3DLL F;  1OCT C;  2EZI A;  1BOA A;  4G7Z F;  2VQL A;  1Y1V J;  1KQ9 A;  3KYD B;  3CF2 A;  3QU3 A;  4LIU A;  4AWX B;  1JXS A;  3OL4 A;  1R6R A;  2W00 A;  1YX5 A;  2PN6 A;  3QQA A;  2PJR B;  3CCJ I;  1P7I A;  3IKV A;  3ZMT A;  1XDU A;  3ZMV A;  3O8G A;  4UVA A;  1MJA A;  1F43 A;  4U7B A;  2DFH A;  3K6G A;  2D2W A;  1ZGJ A;  4KT5 C;  4A6E A;  1D5V A;  1UFM A;  1STZ A;  1IZ1 A;  2H6B A;  3ZXS A;  2ZXH A;  3MVP A;  3FXL A;  3NRV A;  4Y3O A;  3WTX C;  2ZC2 A;  2FX0 A;  1W36 D;  4XRM A;  2K9Q A;  4ASN A;  2JVG A;  1SD4 A;  2VON A;  1W7P D;  2NVY J;  1XGS A;  3L1P A;  4P5O A;  2LF8 A;  1F4K A;  5C4X J;  3RZO J;  2DTZ A;  1XCB A;  4Y13 A;  4B3A A;  2WBM A;  2A6T A;  2BE5 F;  2KPM A;  4ANJ A;  2VUM J;  3LFU A;  1GXP A;  1IN7 A;  3TBI A;  1TZL A;  3JCU C;  1AU7 A;  3K1M A;  1OIS A;  4D0P A;  2GZW A;  5FKO A;  3BR2 A;  3HRM A;  4YII A;  3KP3 A;  5LLQ A;  3F6O A;  1SMT A;  4M9X A;  4XL9 A;  3BZ6 A;  2M45 A;  5KAI C;  3ZN1 A;  2ZJQ F;  3MZY A;  2GIZ A;  3HPG A;  3I53 A;  1PJR A;  2BY1 A;  1WJA A;  3FHZ A;  3GZN B;  3K7A J;  2ME6 A;  4J19 A;  5FKN A;  5CYV A;  5DCF A;  4PGH A;  3FXQ A;  1YRN B;  1ZYR F;  3WGI A;  4BGD A;  3QOE A;  2PI0 A;  1TWA J;  3W6V A;  4NQW B;  5K7F A;  2HDD A;  3AG2 H;  4V2G A;  3DLA A;  3HYI A;  4BDY A;  1SD7 A;  2AS5 F;  3F23 A;  3UKG A;  1MIJ A;  3HGG A;  5LRS A;  2NYX A;  4OIO F;  4UV8 A;  3CDL A;  2C6Y A;  4UUT A;  3E6C C;  1N75 A;  3BY6 A;  3E6D A;  1RPW A;  4L9T A;  2R7R A;  2EV6 A;  1IXR C;  2BHZ A;  4BE1 A;  3KYC B;  3VB2 A;  2RC4 A;  3JTG A;  3HOW J;  2Z3Y A;  4BQQ A;  3P9C A;  3ABK H;  2FBI A;  3Q0V A;  2DOA A;  2GQQ A;  3IC7 A;  2JRT A;  5E8G A;  1MMA A;  3GYH X;  4B4C A;  2DLL A;  1V3F A;  3N4M A;  1NTC A;  2O7O A;  2H94 A;  3CP8 A;  3I55 I;  2QVO A;  2DFF A;  1LEB A;  3GFJ A;  4KN7 X;  2HYF A;  2V6C A;  5J47 A;  3LOC A;  3ZQI A;  1U8R A;  4O3M A;  3VDX A;  3L2R A;  3ROU A;  2AQF A;  4G8X A;  3F8B A;  1R36 A;  3A0B C;  1RRJ A;  4WF2 A;  5K5O A;  2GXB A;  2XUB A;  3BC8 A;  2RRE A;  2LTP A;  3FMQ A;  4PJ0 C;  1BIB A;  1TTY A;  2DK5 A;  4M6V A;  5LHH A;  4IHT A;  3Q9S A;  3H5A A;  2CRG A;  1D5Y A;  1RUO A;  4NC8 A;  3B02 A;  5DM6 F;  3AFH A;  4FHT A;  3GTO J;  3U9G A;  1JTY A;  4QPQ A;  4L5I A;  3CMA I;  5FKM A;  3CP2 A;  4HF0 A;  4IOC F;  5L3B A;  1ZEL A;  2IGO A;  1JHH A;  1XGN A;  1QA6 A;  4N4N B;  3LAP A;  2R5Z A;  2Z5U A;  2OJE D;  3JAM K;  4OOI A;  3ZGK A;  5D5V B;  1S7E A;  1X19 A;  3ZPL A;  3MMY B;  6PAX A;  3WTW C;  1SVM A;  1DP3 A;  3BLY A;  2JQ7 A;  1P2F A;  5KVR A;  2B0L A;  2VLA A;  4XID A;  5E1X A;  2JPC A;  5DDG A;  5EEA A;  3QOP A;  4XKB A;  3WGG A;  4XK4 A;  1HA8 A;  2LH9 A;  1U9N A;  2V6E A;  4KIF A;  1H8A C;  3K4B A;  2CS3 A;  3F8N A;  5GPC A;  4JX4 A;  4KJZ A;  1U8B A;  2CJJ A;  3LSR A;  2MC4 A;  2W7N A;  5HNF A;  1BJZ A;  3BCB A;  3D0S A;  2A5Y B;  3DU6 A;  4LK0 F;  2CH0 A;  1VQO I;  1XGO A;  1S8N A;  1TT0 A;  1MBJ A;  2E1N A;  2Y0S A;  4NC6 A;  2O61 A;  1FBQ A;  4G94 A;  2L4M A;  3BTC A;  3OYL A;  1G3S A;  4G12 A;  1W5S A;  1ZQ3 P;  2DA1 A;  4RM2 A;  2FEZ A;  4ZYH A;  2O6G E;  3BPV A;  2L3D A;  1G8X A;  4BJT A;  3ZOB A;  4KN4 X;  1XMK A;  3VYR B;  1F36 A;  2ZJR F;  4ESF A;  2TRT A;  4OIN F;  4BXF A;  1X1A A;  2YSR A;  1MSE C;  2ECB A;  4ENN A;  2BVL A;  5E79 C;  2M4G A;  2R7D A;  4HX7 A;  3C18 A;  3QP6 A;  1A6I A;  1P4X A;  1JJ6 C;  4CIC A;  4QLC U;  1KU9 A;  3NEU A;  2O0Y A;  1IRX A;  1YW7 A;  1JUM A;  1SAN A;  1F5T A;  3I3L A;  4GYI A;  2WV0 A;  3F8M A;  4HYE A;  5CQE A;  5F6F A;  1YLF A;  1LE8 B;  1RKT A;  2DMP A;  1C0W A;  2OTJ I;  3KX2 A;  4PJM A;  5ICF A;  4XLN F;  1BI1 A;  1K83 J;  2LRD A;  2RDP A;  1R5H A;  1X3W B;  3LNQ A;  3F21 A;  2HVR A;  2TDX A;  3K0L A;  2E36 A;  2XRO A;  1TL8 A;  2RNG A;  1RR7 A;  4EJU A;  5K7H A;  5HOD A;  4MEX F;  1BL0 A;  5CVU A;  1G3T A;  2NS7 A;  1YW8 A;  3MKW B;  2FOK A;  2JSC A;  5FFZ A;  3I71 A;  2P6T A;  3IRR A;  4OIP F;  3KEQ A;  4L5E A;  3TO7 A;  3KP6 A;  3S17 J;  4KNY A;  1EV7 A;  4E6K G;  4PSX A;  3HBL A;  4E7Z A;  2IW5 A;  1KU2 A;  4PSW A;  2N8G A;  5D4R A;  2GXG A;  1F9N A;  1X1C A;  4PCQ A;  3JRH A;  2WA0 A;  1XDS A;  1W0U A;  4A3F J;  5BPI A;  2WC2 A;  2H8W A;  2QKL B;  3FBI B;  4L0Y B;  3FXJ A;  1P9Q C;  1XSV A;  3HG9 A;  3KLO A;  4A3K J;  4HST A;  2BHY A;  4L0Z B;  4Q47 A;  2H09 A;  2LKS A;  3TMO A;  2P0W A;  2ACJ A;  3ASN H;  1JUS A;  1V54 H;  2B7E A;  3BG9 A;  3J7Y J;  2Z1D A;  2WAD A;  3H35 A;  1FYM A;  2V26 A;  3WTT C;  2DA5 A;  3GLL A;  4I0B A;  2VXZ A;  2KIS A;  1FSE A;  2AXL A;  4G6T B;  5H20 A;  3SZP A;  4DZP A;  2O9L A;  3IWZ A;  1Z6T A;  2IAI A;  4HQM A;  3WE2 A;  4BEH A;  3ABT A;  2X6Y A;  3CCR I;  3D1N I;  2KIU A;  4GXO A;  3K4C A;  2PQ8 A;  2B9S A;  3FXO A;  1FC3 A;  2XAQ A;  1XB4 A;  1AOY A;  1E3P A;  2IPQ X;  3GTL J;  3R0J A;  1TQI A;  5L3E A;  3I59 A;  1NG7 A;  2VKV A;  4ZDP A;  4K2E A;  1FEX A;  1SD5 A;  1T6S A;  1WKM A;  1WI9 A;  4YIF A;  2NNY A;  1D1C A;  5IYC J;  3K4N A;  2ID3 A;  4XLH A;  4XMY A;  1Y8R B;  3L2U A;  5M3F J;  2CQN A;  4M3B A;  2FXA A;  1ENH A;  1B72 B;  1R71 A;  2MAB A;  1FPQ A;  2L7F P;  1RNL A;  1DQU A;  3ABL H;  1V5G A;  2P81 A;  1H9G A;  3OY9 A;  1LFP A;  4AVP A;  4UXN A;  4DYC A;  3A02 A;  5BS6 A;  1KYZ A;  1B6A A;  1YIO A;  2O5R A;  1VZ0 A;  1OR7 C;  3TQN A;  1EKE A;  2IS6 A;  3L09 A;  1T0F C;  3HKZ N;  5DCM A;  5F1J A;  1YE9 A;  2RV8 A;  1XTA A;  1EF4 A;  2NNN A;  1YS7 A;  2ZXW H;  2COB A;  3EPZ A;  1UJ8 A;  2XPU A;  1ITY A;  1LPQ A;  4E70 A;  3FWE A;  4UUS B;  4B47 A;  1JT0 A;  2BY0 A;  1NG6 A;  1G3W A;  2EQR A;  4N4O B;  1FOX A;  4BE2 A;  1QHG A;  3TOA A;  3JRF A;  1ZG1 A;  3DKX A;  1HKS A;  3EYI A;  4KDP A;  3RQI A;  4DW6 A;  1MD0 A;  2ZCW A;  3K9T A;  3SZG A;  5DYM A;  3KET A;  3S3O A;  1ETX A;  4YRV A;  3DU5 A;  3W2W A;  2UZK A;  3FXR A;  3G3Z A;  4M3G A;  5GAE J;  3M1C A;  3DF8 A;  1R22 A;  1D0Z A;  2YUS A;  1KGS A;  1JT6 A;  3T8R A;  1ZR2 A;  1LKX A;  1W5C C;  1LB2 A;  1BI3 A;  1GHC A;  1TT5 B;  1BW6 A;  3GME A;  4M74 A;  3CC7 I;  2P6S A;  2XF7 A;  3EUA A;  2M34 A;  2I8D A;  1XX5 A;  3CLO A;  2FBH A;  2J5O A;  4XN3 A;  1YIJ I;  3GTJ J;  2P4W A;  4LG0 A;  4BAY A;  2KDO A;  2VE8 A;  2HPM A;  2UXN A;  1BA5 A;  1YW9 A;  3ECO A;  1WJ5 A;  1ZAR A;  3RQ4 A;  4Q4Z F;  3FBN B;  2L0K A;  1S6L A;  1LDK B;  2ID6 A;  2GA1 A;  3MCZ A;  2MC3 A;  2MG4 A;  3GTP J;  3KP7 A;  5FRO A;  3CUQ A;  4A0Z A;  1VQ6 I;  5HLG A;  2GAU A;  3JTH A;  2YX7 A;  1W36 C;  1QO0 D;  5EEH A;  4D5C A;  1T38 A;  2FD5 A;  3PQJ A;  4XKW A;  1JHF A;  4WXC A;  2KJC A;  4WK8 F;  3COA C;  2DA7 A;  1ZRE A;  3I4M J;  2DA2 A;  5HDG A;  2Y9Z A;  3SQN A;  2H27 A;  1TWF J;  1O3T A;  1FT9 A;  2G7H A;  5LHG A;  3GTG J;  1DP7 P;  1D8J A;  4PFP A;  3W6J B;  2VJJ A;  3HDD A;  3WTZ A;  4KIG A;  4MFD A;  2R5Y A;  4XIC A;  4MO7 A;  1OCR H;  5F0F A;  3RKQ A;  4ZZD A;  2E1O A;  4EJT A;  3TDU C;  1T2K A;  3I54 A;  3LSG A;  4ZYA A;  1H9T A;  4HOB A;  2HQN A;  4ABZ A;  1FP1 D;  4KIS A;  3GZ6 A;  1I6X A;  1QZZ A;  2LP0 A;  2EFO A;  3ERE D;  1LDD A;  2QUF A;  3PQK A;  4OIQ F;  4UB6 C;  4OIR F;  5EGO A;  2E71 A;  3Q0U A;  4PFO A;  3BR1 A;  3S2W A;  1FWZ A;  4OWR B;  4BHP A;  3G2B A;  2HPI A;  3U2R A;  2YU3 A;  3EQL F;  3ZR8 X;  3BG3 A;  2FUG 2;  5D5W B;  2CV0 A;  1WJF A;  3JRE A;  3H1C A;  3VYU B;  5EF6 A;  3GEZ A;  1CF7 B;  2VAS A;  3HHG A;  3HUG B;  4A3I J;  2LYC A;  2H8R A;  1A04 A;  1AKH B;  2NAZ A;  3K4K A;  1J75 A;  2EH3 A;  2CQ7 A;  2NOG A;  2VKH A;  2OCC H;  5HDK A;  4YEL A;  4EJW A;  1WJC A;  2IS2 A;  5IOZ A;  2DI3 A;  4G6Q A;  1OYY A;  1Y0N A;  5LBQ A;  4IHV A;  1K4T A;  1OMI A;  1MJB A;  4N0B A;  1FOK A;  2LLK A;  4OMZ A;  3SDG A;  2UWM A;  1CQT A;  1IGN A;  1DGR M;  5DS9 A;  2OZU A;  1ZG5 A;  5E1W A;  5HVQ C;  5FJ8 J;  3K1P A;  4A69 C;  5L3G A;  4WCG A;  3MKZ A;  3ZN0 A;  3WHC A;  3KP2 A;  3ONQ A;  4XOT A;  3CCE I;  1RC9 A;  5C4J J;  3DFG A;  4M6Y A;  2EJR A;  3QYF A;  2Q2E A;  4DBQ A;  4EQQ A;  4KIT B;  1ZH5 A;  2PJR A;  2EZK A;  3ISP A;  1UB9 A;  4XRS G;  2KZV A;  2ELK A;  2MD0 A;  1IUF A;  1QRY A;  4ENK A;  3OS0 A;  1GV2 A;  2PX9 A;  1Y56 A;  3FK6 A;  1I1G A;  3DKW A;  2L5Q A;  3I56 I;  3L2V A;  3S1R J;  2EIK H;  3BWG A;  3C7J A;  1LFU P;  5KCM A;  1O3R A;  3H3V K;  2K3F A;  5FD6 A;  5M3M J;  3FIS A;  4XLP F;  5BPD A;  4X6A J;  2HEO A;  3CDI A;  4M3E A;  1J0R A;  2COM A;  4BQN A;  1FSH A;  3S1Q J;  5F1R A;  3CMY A;  2V4J C;  4C3I J;  3G71 I;  3CF5 F;  3W2A A;  3V8L A;  4D7M A;  2DFE A;  1FZP B;  4Y17 A;  1X4P A;  2M8G X;  4HX4 A;  2FOW A;  2MLK A;  2DXI A;  3BZC A;  1FX7 A;  5TJJ A;  1SFX A;  2BBY A;  4NBQ A;  3ZCO A;  4S05 A;  3P5J A;  3HPH A;  1SFO J;  2VC0 A;  4NC7 A;  4HNT A;  2E1M C;  4EAT A;  4JX6 A;  3M9A A;  3E6B A;  4IHS A;  3GO5 A;  1WFX A;  4D5F A;  2W85 A;  1BI0 A;  4KFC A;  4FX4 A;  1XD7 A;  2K85 A;  3PJR A;  3OV8 A;  2JJ7 A;  2ETH A;  1YRN A;  1HC8 A;  4BKX A;  2Q8K A;  1R4N B;  2QKM B;  2IA1 A;  4IPA A;  3F72 A;  4NQW A;  3W3C A;  4CCK A;  4RGR A;  3LSH A;  2E35 A;  4EEF G;  1MBE A;  2HQ5 A;  2MH2 A;  1R58 A;  4ZDL A;  4HLY A;  2VBW A;  3HGY A;  1SD6 A;  2BGC A;  5EZH A;  3OYG A;  3VPR A;  2DJN A;  4MTD A;  4NB5 A;  1D1B A;  2HOE A;  4AIJ A;  2QQB A;  5CVI A;  3J7A Y;  4S0H B;  4UB8 C;  4RA2 A;  5FGM A;  4BXU A;  3VFZ A;  1S72 I;  1R7J A;  2MYS A;  3ASO H;  2QEN A;  4R1H A;  3HOS A;  2VJ5 A;  2Q2E B;  3REO A;  1ORK A;  4FE7 A;  2Y9Y A;  1T95 A;  1MZB A;  4F52 A;  1B1B A;  3IUO A;  3J81 Z;  4BXX J;  2VPL A;  2LY2 A;  2K4B A;  4EM1 A;  4XRF A;  2VJ4 A;  1FJL A;  1VFC A;  2CWE A;  2KL4 A;  5K5Q A;  3T1B A;  1SFU A;  2EA2 A;  1QHH D;  2DA4 A;  1PP7 U;  3BR0 A;  4KIB A;  2ISY A;  2EIL H;  2EA4 A;  2JMW A;  2RGV A;  3M07 A;  2M3A A;  4F3Q A;  2NS0 A;  2DT6 A;  2LBF B;  4I76 A;  4HNV A;  4CDG A;  5HLT A;  4BNC A;  4IZZ A;  2HQA A;  2KFD A;  2W24 A;  2A3S A;  5ICG A;  3D5R C;  2IA0 A;  2GIV A;  1MMS A;  4DGW B;  5J1Y A;  1APL C;  1X1D A;  3DQV C;  1FLI A;  4ZDO A;  1RES A;  3AAF A;  3K69 A;  2E7X A;  3OYI A;  4FX0 A;  3QWL A;  2IGK A;  1RKW A;  4ZTJ A;  2XAU A;  3JRC A;  2FU4 A;  2XC7 A;  2F5C A;  3PNV A;  2HNH A;  2XB0 X;  4WWC A;  3MQ0 A;  1OCO H;  3M8J A;  3H92 A;  3IH3 A;  4HG2 A;  2A61 A;  4L9V A;  3MWM A;  2CMP A;  1JKP C;  4LMY A;  1BN5 A;  4E7L A;  3JAM Z;  2ZXJ A;  4XNF A;  4J01 A;  2KRC A;  2LY9 A;  3S93 A;  2OTL I;  1YOV B;  4W1U A;  4DYR A;  3FMS A;  1IUY A;  3RKX A;  4IX7 A;  1SMY F;  1VQ9 I;  2W4S A;  2OC6 A;  2DDB A;  2L7K A;  1SAU A;  3QPL A;  4RAF A;  1IDY A;  1JUP A;  2M2E A;  4NNJ A;  3F8C A;  1KYW A;  1ZHF A;  3J7Z I;  4LB6 B;  5HLH A;  4CCN A;  4U0W A;  1QZY A;  5K1Y A;  3IAM 2;  1IJW C;  1EJ9 A;  1X4O A;  4A3J J;  3DPT A;  4N9I A;  3M4O J;  2IS1 A;  2R7V A;  5M5Y J;  4JX5 A;  4Z2Y A;  2XB5 A;  3J80 Z;  3OYH A;  1HST A;  4EV0 A;  3BT9 A;  1UEL B;  4I0A A;  3HSE A;  1J59 A;  4JBA A;  2ZJ2 A;  5DUK A;  5LFA A;  2HWV A;  5JLX A;  5AIP A;  1V5F A;  5L3C A;  3O2P E;  3EUH C;  3S8P A;  4C3J J;  3RYP A;  2Z33 A;  3AKZ A;  2NOJ B;  2DFI A;  2K9L A;  2E2I J;  1YI2 I;  5B3S H;  2EV0 A;  1LUJ B;  1QNT A;  2WV1 A;  4WXH A;  2I10 A;  2E1M B;  5TGT A;  4A6D A;  2CUF A;  1BR1 A;  1Q1H A;  4KA4 A;  3L2C A;  2GA2 A;  5A2Q K;  4I01 A;  3OYA A;  3A01 B;  1LE8 A;  2GM4 A;  5TRD A;  2LRE A;  3LL7 A;  3QPS A;  3SDB A;  3DTK A;  2OU2 A;  2VJI A;  3KP5 A;  5GP9 A;  3LMM A;  3U1D A;  1R1U A;  3RKW A;  2XF5 A;  4AU7 A;  4PUS A;  3OYE A;  4X0G A;  1FYK A;  3HZJ A;  1MMG A;  4HZF A;  4XN0 A;  1WJE A;  4XLF A;  4YFK F;  1YHQ I;  4B1R A;  2Y75 A;  5ILS A;  4DQ2 A;  2STW A;  1YJN I;  1B4A A;  2DW4 A;  3L2W A;  1FP2 A;  3HRT A;  2G7U A;  1Z6R A;  2X9D A;  3OYF A;  5E18 F;  4CA0 A;  1XMX A;  5J8F A;  2VKD A;  2XPV A;  5J8C A;  1TLH B;  3WU0 A;  4QIW N;  2VOO A;  4BQA A;  2XGE A;  4M3F A;  3G73 A;  4BJ5 C;  4EM2 A;  3RPU A;  3WGH A;  5J40 A;  1GVJ A;  4MFE A;  2VBX A;  3BRO A;  4J00 A;  3D5S C;  5FKL A;  4U7D A;  2CUJ A;  5CKT A;  3JRG A;  1I5Z A;  1ZTR A;  1SEU A;  4ITV A;  1HKT A;  3HTS B;  4U0Y A;  3BTJ A;  1TWH J;  5J6X A;  3JRI A;  3M1E A;  2DOD A;  3E5U A;  4C30 A;  5H2F C;  1IF1 A;  2NS8 A;  3C2B A;  4PDK A;  3HOV J;  2DAO A;  1I39 A;  4P9F A;  4GO1 A;  2IXS A;  2R7W A;  1MW7 A;  1K7A A;  4RM3 A;  2IA2 A;  2K27 A;  5IPA A;  2VN2 A;  3Q3S A;  1MDM B;  3GTK J;  2DMU A;  2E19 A;  3RIR A;  1S29 A;  2QSF X;  4NUB A;  1D0X A;  4G6D A;  4IVN A;  4U87 A;  2H1L A;  3TP0 A;  3BJ6 A;  4P55 A;  4D1Q A;  4LIV A;  1IG7 A;  4HV5 A;  2BZT A;  3AG3 H;  2CW8 A;  2QF7 A;  4CZZ A;  5HS7 A;  3H0G J;  3HSF A;  4BHB A;  5K7Z A;  3P9I A;  2AO9 A;  1I6H J;  1PYV A;  3ULQ B;  3IH4 A;  5F0H A;  3HB9 A;  1MBK A;  2CUZ A;  3DKY A;  5FRM A;  1ZK8 A;  1L0O C;  1FBU A;  1I3A A;  2V9K A;  4FQG A;  4HNU A;  1IRG A;  2CO5 A;  1ZR4 A;  4E7K A;  3B6A A;  1MKM A;  2Y2Z A;  4AID A;  1BR4 A;  3ZMD A;  2Y48 A;  3W2V A;  4Y7N J;  1T98 A;  2KLO A;  1AWC A;  2E1C A;  2HTS A;  4HLX A;  1B72 A;  2EIM H;  4KT6 A;  3CJT B;  1L3L A;  1X2M A;  3FXM A;  1VQK I;  3HOY J;  1LEA A;  4M6X A;  3KFW X;  4RB2 C;  3PM1 A;  5E1Z B;  1HW5 A;  3CC4 I;  3JSP A;  2DK8 A;  3KYL A;  3E3V A;  1EH7 A;  4EJV A;  2BEO A;  3NQO A;  3ML6 A;  3UNG C;  4E4H A;  2PEX A;  1O3S A;  3KEY A;  1H0M A;  1QQI A;  1XMA A;  2HZD A;  1O7F A;  4UHT A;  3DV8 A;  3GWZ A;  3GFL A;  4CXF A;  4OAZ A;  3I58 A;  4LLN A;  2W1O A;  3F6V A;  4UUS A;  2XSJ C;  4XOP A;  1KZH A;  2LY1 A;  3RDI A;  5HS9 A;  1I3Q J;  2YPR A;  1W4M A;  2VIX A;  2WY8 Q;  5FFX A;  2E5N A;  4HF1 A;  5FLX Z;  4CHU A;  3K2A A;  3CTA A;  1K79 A;  2R92 J;  1OQY A;  4NHJ A;  3DTI A;  3K70 D;  3BP8 A;  4DNC A;  3H9Q A;  3BQZ A;  2CFO A;  2X6W A;  5H6Q A;  2K02 A;  1ZKG A;  2D5V A;  5GTI C;  3T5X A;  1OCC H;  3A2K A;  4XBF A;  2FBK A;  1FMW A;  5CVR A;  3QYE A;  3L00 A;  4BY7 J;  5IY5 H;  4QSH A;  2PBI A;  2GOM A;  1BJA A;  2OD5 A;  4CUG A;  4EM0 B;  3LA3 A;  3E6M A;  3ZMZ A;  4I02 A;  1WVR A;  2DCE A;  3F0C A;  3V8K A;  3G4S I;  2FE3 A;  3DEU A;  2LFB A;  4MEY F;  4G9Y A;  2A6E F;  2WAQ A;  3PSI A;  4AM3 A;  1BBY A;  2XAS A;  2ZSH B;  2HOT A;  1F1Z A;  5IT3 A;  4I98 B;  4ZH4 F;  3BDD A;  4A3B J;  3SFI A;  1O57 A;  3QRF F;  2P5K A;  1CGP A;  3B6C A;  1U0J A;  5M5X J;  2DQL A;  2QCO A;  3I5U A;  4MQ9 F;  3LFK A;  3FXU A;  3SXY A;  3BZK A;  5D6F A;  2ISZ A;  3DBH B;  3HSR A;  2VE9 A;  3EUK L;  3W6K B;  1Y39 A;  4I2O A;  1IN4 A;  1PUF B;  3CCV I;  4CYD A;  5AIQ A;  3MEX A;  3BR6 A;  4HAM A;  2WAE A;  3TED A;  2RQQ A;  4U0V A;  1ETW A;  2KJB A;  3LQQ A;  5FD5 A;  5LRR A;  4AC0 A;  1S3J A;  2HI3 A;  2JA8 J;  3AL0 C;  2WY7 Q;  5C3E J;  3DEE A;  2CW7 A;  2VBZ A;  1FYL A;  1S7O A;  1E17 A;  4YG2 F;  2DMN A;  3ZMU A;  2WWY A;  2L7Z A;  4LIT A;  1X2N A;  5EYR A;  2ZSI B;  1I27 A;  1YTY A;  2Y31 A;  1HCR A;  5K5R A;  3K4L A;  2RVC A;  5ICC A;  1A36 A;  4A12 A;  2VQH A;  3T0Y A;  3G1M A;  2G0E A;  1Q1V A;  3RJP A;  1ETV A;  4RB3 C;  3K4J A;  2ICW G;  3BOQ A;  5E20 A;  2L54 A;  5JHU A;  4IRI A;  5KAF C;  5FB2 A;  1XPX A;  2L2O A;  3OSF A;  4HF2 A;  2X1C A;  3IWF A;  1QPI A;  2CGP A;  4I6Z A;  3PO3 J;  1IV6 A;  5L3D A;  1IO2 A;  5C44 J;  1ZRF A;  1JGS A;  2EFN A;  2NVU B;  2LKX A;  1IC8 A;  4XLA A;  2QSH X;  2M0C A;  1UAA A;  5BNG A;  1HSJ A;  3WTY C;  2QYO A;  1CF7 A;  3OWT A;  4A3G J;  3HUG A;  2J5P A;  1E3O C;  1AKH A;  2HFH A;  3QYB A;  3S1N J;  2WAF A;  3ZQH A;  1W1W E;  1O4X A;  2XV4 S;  4MLO A;  4DIQ A;  3PUB A;  3R6S A;  2X51 A;  2K86 A;  1OFC X;  4LOC A;  2HZT A;  2IT0 A;  3OIO A;  3C2G A;  2AQE A;  4ON0 A;  1ZGW A;  1K6Y A;  3FHN A;  3BTI A;  1OR7 A;  3ZQ7 A;  2L02 A;  4RDU A;  1TQP A;  1T0F A;  4R8H A;  1G3Y A;  2VT2 A;  1YJ9 I;  2HOS A;  3H9J A;  4D9J A;  2HDC A;  1Z91 A;  5EEG A;  3N05 A;  1N77 A;  5IT9 K;  3OYC A;  1WH7 A;  2VC1 A;  4DBR A;  2E60 A;  2L7M P;  2R0Q C;  4Q5S F;  4S04 A;  1ON2 A;  4AIH A;  4U88 A;  3CUO A;  5EJC A;  2LR8 A;  3HM5 A;  4ZTF A;  2IEK A;  2XAJ A;  1FBS A;  5DD4 A;  4KIC A;  4Y52 J;  1UST A;  1JKR C;  3BTL A;  1W0T A;  2EZL A;  4LLL A;  2XGC A;  4XLE A;  4AD9 A;  1ZG3 A;  2XF6 A;  2F4I A;  2JK3 A;  1G6N A;  3GUD A;  2DJI A;  3HXL A;  4A3D J;  3V7C A;  2M1B A;  2W48 A;  4V19 K;  2XSD C;  1G59 A;  4ENJ A;  2ESN A;  1MNE A;  1DU6 A;  3I4P A;  1XS9 A;  1U3E M;  4BU2 A;  2M87 A;  3IAS 2;  2F5D A;  4IF4 A;  2VB6 A;  3LST A;  1DPR A;  3LQR A;  2VOD A;  2HGC A;  2E34 A;  5D6E A;  5E8I A;  1XC5 A;  4C2M J;  2HVQ A;  3MFK A;  5LEK A;  1MBG A;  2JA6 J;  1LVA A;  3E97 A;  3JRB A;  3RKY A;  2X0L A;  1X3Z B;  2X1E A;  2ZME C;  3A4C A;  4EGY A;  1W7P A;  3I64 A;  2UUZ A;  1NHA A;  2BXY A;  4MIM A;  3WTS C;  1VQP I;  2FQ4 A;  2L9N A;  3K2Z A;  3L7W A;  3S32 A;  1WRJ A;  4FCY A;  4IHX A;  1EH8 A;  4PZJ A;  1PVE A;  1GV5 A;  3CCY A;  5B1A H;  1ETQ A;  2QWW A;  5DUI A;  1UHM A;  5FKK A;  3AL0 B;  3CDH A;  4M9Z A;  4C3H J;  3BG7 A;  3CJQ B;  2PMZ N;  2Z99 A;  4UUV A;  4JYK A;  3WU2 C;  3CCM I;  4A5M A;  1BM9 A;  1K6O A;  5F27 A;  1IXS B;  1FNN A;  2M0M A;  3GTQ J;  1FOW A;  1S9H A;  2JA5 J;  5B5E C;  1X3U A;  4PJL A;  1P4W A;  4GYG A;  1TW2 A;  5ERI A;  4C2U A;  2CU7 A;  2HKX A;  2Z16 A;  1SFE A;  1UHW A;  2ZJP F;  2NRA C;  3ELK A;  2DYS H;  3CJR B;  2OQR A;  3GBG A;  1U5T C;  3E1S A;  2K4J A;  2D1H A;  2JN6 A;  2FF4 A;  2BOL A;  2XRL A;  3IV5 A;  1WCM J;  2JSP A;  1E3H A;  4HX8 A;  5J1R A;  5ILV A;  4A3M J;  1WPK A;  2MA3 A;  2KP6 A;  2F4O B;  1ACI A;  2LBF A;  2OUM A;  4ZYG A;  3NAR A;  4WXD A;  3CQZ J;  2L9V A;  1P4A A;  2DOE A;  4A3L J;  5LGT A;  3FMR A;  3BG5 A;  1IN6 A;  4RLF A;  1BOB A;  5J4Y A;  1AHD P;  1T08 B;  2XKO A;  4AIK A;  5KK1 A;  3PFI A;  4BBR J;  3LAJ A;  2R3S A;  2BY3 A;  2ECC A;  3HTU A;  1WWX A;  3BG6 A;  1UG2 A;  3OR2 C;  1J09 A;  4FIS A;  5KNL A;  1KQ0 A;  2NVQ J;  2HVS A;  3VOD A;  4FAS D;  4UV9 A;  5HLI A;  5EG0 B;  5AON A;  3WU1 B;  3R0A A;  5EZG A;  1BC8 C;  1BR2 A;  4XLC A;  3ZMS A;  2KRH A;  1W7P B;  4BS9 A;  4KYW A;  2D1V A;  2LD5 A;  5IYD J;  3OIQ A;  1DUX C;  4F55 A;  2K5C A;  4XM3 A;  2CSO A;  3G1L A;  1XCV A;  3ERM A;  3GLX A;  2M7B A;  1LNW A;  1ETY A;  3RZD J;  1ZRD A;  1N78 A;  3T8T A;  2LG4 A;  3BR5 A;  2FNP A;  5ED4 A;  5L3F A;  3HEF A;  3JRD A;  2PG4 A;  3E5X A;  3Q0W A;  2DPD A;  1T33 A;  3M8E A;  1DPU A;  2GOX B;  1KU3 A;  2W57 A;  5GAH J;  1YIT I;  1BI2 A;  1SVO A;  4LGW A;  4YEJ A;  5F04 A;  1WSU A;  3SYT A;  3F3X A;  3DBL B;  4DYQ A;  3HC7 A;  3WG7 H;  1POG A;  4F92 B;  1RET A;  5CVJ A;  5FLV A;  1VQ4 I;  3C3W A;  3S1M J;  1WHU A;  2XGX A;  3WTU C;  2P7C B;  4QTR A;  1JTX A;  1KQ8 A;  3ECH A;  4IO9 F;  3SJM A;  3PNT A;  2CQK A;  1NK3 P;  3C1D A;  4P1W A;  2R7T A;  2QQA A;  4E7H A;  2L9R A;  1R00 A;  1NH3 A;  2KHM A;  5LEJ A;  3HL2 A;  1Z05 A;  2K9N A;  3CME I;  3SFZ A;  3LSJ A;  1Z77 A;  1J2X A;  5ICE A;  1G4D A;  1QZE A;  3LWF A;  1MJ9 A;  4CYC B;  3OR1 C;  4YFX F;  3H0D A;  3PIO F;  3B73 A;  4M73 A;  5GAG J;  3IHU A;  1R5I D;  4G7O F;  2M7A A;  3A01 A;  4II2 A;  3L2Q A;  4UY8 I;  2ZME B;  1WJD A;  2XAF A;  4CCO A;  5A2Q Z;  4PGG A;  3FIW A;  2UV1 A;  3HRS A;  3M3Y J;  1UHS A;  4LG3 A;  2Q0O A;  1FIP A;  2JA7 J;  1G2H A;  3V7S A;  2FJ1 A;  2UXX A;  1P6R A;  4FTH A;  3SHF A;  1YYV A;  5F64 A;  2O03 A;  4IRH A;  3TDZ C;  3WHB A;  2STT A;  2KDZ A;  2QBY A;  5JR3 A;  3DXJ F;  5JVT A;  4GDF A;  2WAQ N;  4HDV A;  3K70 C;  2H6C A;  2OZ6 A;  2IP2 A;  3MAJ A;  4A5N A;  1FOY A;  3OYN A;  3TW7 A;  2LDU A;  1FIA A;  1SAX A;  3A0H C;  2LVS A;  4RGX A;  2EBI A;  3S2H J;  1VI0 A;  1IAW A;  3DTE A;  1IRF A;  3PL8 A;  4JP0 A;  3OMY A;  2EWN A;  4Y15 A;  2FQ3 A;  2HS5 A;  2RNJ A;  1QBJ A;  1YX3 A;  1XSX A;  2ZNY A;  3ESW B;  1TBX A;  1B8I B;  3ZQG A;  5LHI A;  1U5T B;  4IJA A;  1P7J A;  4MQV A;  3OYD A;  2MBF A;  2O8K A;  3PIP F;  2MGQ A;  3GCM A;  3CC2 I;  1MH4 A;  2LSO A;  3NWS A;  1KON A;  2IGM A;  5DV5 A;  5GTH C;  4MNU A;  2GBY A;  2V1X A;  2PLY A;  4QPO A;  3MKL A;  3H3U A;  4F91 B;  2W84 A;  1MDM A;  3WG9 A;  2HTJ A;  2R7O A;  3IP4 B;  4UNO A;  3BCA A;  1Y1W J;  5B1B H;  2HU9 A;  2BW3 B;  4RB1 A;  5B66 C;  2G9W A;  2DT5 A;  3OYK A;  4BE0 A;  3CMM A;  3OS1 A;  4HW0 A;  1WJB A;  5E3M A;  3J81 K;  3S15 J;  2PJP A;  2XVC A;  1T56 A;  4BQO A;  1GDT A;  3GXO A;  4IHW A;  2YX4 A;  1R9T J;  1LVK A;  2R7Q A;  1BIA A;  4CZC A;  3TGN A;  4HEA 2;  1E0E A;  1ZLK A;  1JE8 A;  1LDJ A;  3DP7 A;  3IH2 A;  1OPC A;  3JR9 A;  2HKO A;  4N9H A;  3U21 A;  4AYB N;  4C9Y A;  3GFM A;  1TP4 A;  1VQ8 I;  3LSI A;  2DOF A;  1HLV A;  5LGU A;  1QVU A;  3SEZ A;  4A3E J;  1DGW Y;  2KMU A;  2CYY A;  1UG0 A;  2KZG A;  1HKQ A;  3O8H A;  3TW6 A;  1MH3 A;  2KT0 A;  5HS8 A;  4B48 A;  2QBY B;  2EB7 A;  2PMZ A;  1XGM A;  1ONV A;  3KIO A;  2EPF A;  4B43 A;  1VQN I;  2RKH A;  4E7I A;  2CV1 A;  1RUN A;  3OOU A;  2PFB A;  2IRF G;  3E7L A;  1D8K A;  2I5U A;  2EFP A;  3RPQ A;  2JUC A;  4P96 A;  2K7L A;  2CQQ A;  1Z7U A;  1JGG A;  1IW7 F;  2F4M B;  2GWR A;  1GXQ A;  5BMZ A;  2OAZ A;  4RLQ A;  3JSO A;  3KEO A;  3MZH A;  3R4K A;  4ZYE A;  3H3Z A;  1HW2 A;  3S14 J;  1SC7 A;  3H5N A;  1HQC A;  2HYJ A;  1BW5 A;  2OBP A;  3GVA A;  4TV7 A;  4ETS A;  1N25 A;  2V9P A;  3HOU J;  2CG4 A;  3RCO A;  3PUF A;  2R7Z J;  3L9F A;  3V8J A;  3QPT A;  2K9S A;  3EUH A;  2XAH A;  3R61 A;  4GRI A;  4FE4 A;  2PMU A;  3M8F A;  1I1S A;  3KPH A;  4I09 A;  3KZY A;  1PP8 F;  5E3L A;  2JZY A;  2LOO A;  4O6J A;  2JUG A;  5D5U B;  2BYV E;  2VXD A;  2EFW A;  2P8T A;  4L18 B;  3N97 A;  4XSX F;  2Z2S B;  4LJZ F;  5E3O A;  4IXA A;  2E2J J;  4EGZ A;  4IQJ A;  1TC3 C;  4G7H F;  3K1N A;  5BQT A;  2BV6 A;  3KZI C;  1Z21 A;  2QGU A;  3J80 K;  2BY2 A;  4BY1 J;  1VND A;  4I7H A;  5J1U A;  1MND A;  1PDN C;  1ZLJ A;  1AA7 A;  2F5V A;  4OMY A;  2K9M A;  1IV8 A;  4UVC A;  2R93 J;  2FRH A;  5HNH A;  2QSG X;  3OL3 A;  2DO7 A;  4ZZL A;  4O5V A;  1UCR A;  2ZFW A;  1EA3 A;  1J5Y A;  2Z9O A;  2W25 A;  5FRN A;  2LC2 A;  1HDP A;  4LFU A;  3HHH A;  3H5R A;  2VT3 A;  4F7Z A;  3X2Q H;  9ANT A;  3CO6 C;  4HSR A;  2ZKZ A;  2P5L C;  1PUF A;  1IXC A;  2E7W A;  2P5V A;  2R4G A;  3R60 A;  4BL0 B;  2HXO A;  1Y6I A;  5CPR B;  1IDZ A;  5IP7 J;  3BQY A;  4V2F A;  2CFX A;  2V1D A;  5LD2 C;  3TO6 A;  1OCZ H;  1MGT A;  2OCE A;  2L9S A;  1Z0X A;  2OF7 A;  1XN7 A;  4RS8 A;  2WB1 N;  4ESJ A;  2DMT A;  2FA5 A;  4L5J A;  4EVI A;  2JVH A;  2DA3 A;  5IYB J;  1MMD A;  4X1E A;  3C2H A;  4XON A;  5JFR A;  1ON1 A;  3MD2 A;  3NAU A;  4L9N A;  5J3L A;  3QU6 A;  1HOM A;  2XIG A;  4FT8 A;  2A5W A;  2B63 J;  1WI3 A;  4DZJ A;  4ESB A;  2R5Z B;  1OJL A;  4NDL A;  4F93 B;  4II3 A;  3FZV A;  3KZZ A;  4BYY A;  3LSM A;  4H0E A;  3QP5 A;  4M72 A;  3VSK A;  4XR6 A;  2RQP A;  1JI8 A;  4BUP A;  1SFK A;  4AUX A;  2EFQ A;  4RMN A;  4GFB A;  3OYM A;  2O3F A;  1FY7 A;  2A69 F;  5E17 F;  4HPQ A;  4OAY A;  4PJN A;  1ULY A;  1DDN A;  2MW8 A;  3ZP5 A;  5CQG A;  1YJW I;  2FSW A;  2R7S A;  4AVZ A;  1QGP A;  1FMV A;  2MD5 A;  3JW4 A;  4B44 A;  3EET A;  2KKO A;  2QA4 I;  4YFN F;  2L01 A;  2IVM A;  4HV6 A;  1ZN2 A;  2DQR A;  4QWQ A;  4RAY A;  4IKF A;  1MBH A;  1U78 A;  3H36 A;  3S3N A;  2LK2 A;  2M8E A;  2HYG D;  4CCM A;  2JTV A;  1P92 A;  3QOD A;  4CCL A;  1HF0 A;  4ZJZ A;  3A03 A;  4Y4R A;  3HIF A;  1QVT A;  4Q48 A;  4ENM A;  4KUM A;  1T39 A;  1TQM A;  3TL4 X;  4C2T A;  1HDD C;  2CW0 F;  3P9K A;  4RB0 A;  3CCU I;  5FLM J;  2ZNZ A;  2A68 F;  1REP C;  4WX9 A;  2ZB9 A;  1MNM C;  2RN7 A;  2JT1 A;  5CVV A;  2ELH A;  2QQ8 A;  2DA6 A;  3GX4 X;  3VWB A;  5F0C A;  3RSN A;  4BBS J;  1A6Q A;  2YU9 J;  5CJ9 A;  2F5E A;  3BR3 A;  4I99 C;  3MZ8 A;  1WQ2 A;  1NK2 P;  1MSF C;  3DPL C;  2ADU A;  3RPU D;  2DBB A;  5E3N A;  5IT9 Z;  2F6C A;  4IOA F;  5J4V A;  2EZH A;  5D4S A;  3V4G A;  4DOZ A;  1QU3 A;  4RGS A;  3U1K A;  2ZFU A;  3M7G A;  4B3X A;  1YS6 A;  4M71 A;  1TNT A;  2W82 A;  2Y69 H;  3F8F A;  2DU9 A;  3LA7 A;  3CCL I;  3BPX A;  1R1V A;  1JKO C;  3OYB A;  1R23 A;  1T8I A;  4A0X A;  1ZAO A;  3J7A O;  1Z3X A;  1YG2 A;  5M5W J;  2IJL A;  1ETO A;  1RIO H;  1IN5 A;  1TWC J;  3CJN A;  2V9V A;  1A31 A;  4HDU A;  4CH7 A;  2KIF A;  3OOP A;  3CUQ C;  2CV2 A;  3FXK A;  1OCP A;  3KP4 A;  3WE3 A;  3H9G A;  4MGR A;  2CQX A;  2JPB A;  2VBY A;  1O3Q A;  1HW1 A;  3CD6 I;  4DJA A;  1J7K A;  4UVB A;  3RI4 A;  1RI7 A;  3ABU A;  2JRM A;  2KIM A;  3D5L A;  3DBR B;  2IBD A;  3BJO A;  2RAE A;  2XAG A;  1R49 A;  4MHG A;  1JKQ C;  3DWL E;  2L4A A;  4CCJ A;  2V7F A;  3KCC A;  3CZ6 A;  3DPU A;  2M9H A;  1U6G A;  3FM5 A;  5FLX K;  3OSG A;  3G6E I;  4AYB A;  3GZ5 A;  3RTR A;  1U9O A;  2EIN H;  2Q1Z B;  1Y8Q B;  4A2U A;  5IP9 J;  4EJO A;  1OYI A;  2E5Z A;  2V1U A;  3VOE A;  1B59 A;  4ZC3 A;  3VYT B;  2NVX J;  3FKI J;  4HQE A;  3ABM H;  3P7N A;  5IOY A;  2QQ9 A;  3AG1 H;  4P9U A;  1KU7 A;  1D3Y A;  3DEW A;  2MH9 A;  4B09 A;  2VQG A;  4XKV A;  1Z1D A;  3IKT A;  4GCV A;  4XQF A;  2AHQ A;  1WZ2 A;  3GW2 A;  4HBL A;  2A05 A;  2DTR A;  2OA4 A;  5H6R A;  4BEH B;  5JHF A;  4B8X A;  1EH6 A;  4KMU X;  2X4H A;  2QM3 A;  5DD8 A;  1K78 A;  2DT7 B;  1Y0U A;  3AG4 H;  4BDZ A;  5IP6 A;  5GPA A;  2R7X A;  4IEJ A;  1J9I A;  1O7L A;  4R79 A;  2DN0 A;  2TCT A;  2ESH A;  3IL2 A;  3PFY A;  3FKJ A;  1VQL I;  3I59 B;  4E7S A;  1GUU A;  3FDY A;  1TWG J;  3F22 A;  1GLN A;  1ETK A;  2XGD A;  5JLW A;  1GVD A;  1V55 H;  3LSP A;  2XRN A;  2IS4 A;  2BXZ A;  3O6B B;  1U2W A;  5ILU A;  1PUE E;  2CUE A;  1KA8 A;  2XHK A;  3MKY B;  5D5X B;  3EDP A;  3UR3 C;  3K10 A;  3CCQ I;  3PNY A;  5D8K B;  2FNA A;  1I50 J;  3HJE A;  1TNS A;  5HDN A;  5DEQ A;  3ZQL A;  4LD5 A;  1R5G A;  4L9J A;  2H1K A;  3LA2 A;  1X1B A;  1YFH A;  5LGN A;  3OIP A;  4KMF A;  2IGN A;  2QEX I;  3I9V 2;  5JI6 A;  3TO9 A;  5DCM B;  3SEQ A;  1W5T A;  3S16 J;  4Z6Y A;  3FF5 A;  4JQF A;  1R4M B;  2PMH A;  4RAZ A;  2MLG A;  1XG1 A;  3PSF A;  5FO5 A;  1DU0 A;  2KRF A;  2VI6 A;  3G1O A;  4IRG A;  1ZRC A;  1M1E B;  2P7V B;  2VPR A;  3V7R A;  3I4N J;  2HQR A;  3JRA A;  1X58 A;  3Q9V A;  4M3D A;  3Q5F A;  3OS2 A;  3RYR A;  2VL8 A;  5EG0 A;  4D7N A;  3GTM J;  1OYW A;  2DDA A;  2X85 A;  4CSW A;  4A0Y A;  3GF2 A;  3A1Y A;  3IRQ A;  1R1T A;  3VSL A;  3ZQQ A;  2E2H J;  4OU0 A;  1V5E A;  4EMS A;  3HOZ J;  3I0T A;  1D0Y A;  3QAH A;  1BC7 C;  1WH5 A;  2EV5 A;  3O3K A;  1K61 A;  4HRI A;  1OKR A;  2EK5 A;  2ZBK A;  2ME0 A;  4GGG A;  2M30 A;  2WB1 A;  1HXD A;  2XPW A;  4PJJ A;  2FMY A;  5TIS C;  1VQM I;  2F5F A;  1VTN C;  1RR8 C;  3MN2 A;  3TOB A;  1K78 B;  3GFI A;  1HBX G;  2A07 F;  5BOX A;  2VKE A;  1MMN A;  2Y30 A;  1X1P A;  2HDW A;  2XDV A; 
#chains in the Genus database with same CATH homology
 1T0F C;  4NUB A;  1D0X A;  1YE9 A;  4U87 A;  4XOR A;  3ZRG A;  4D1Q A;  2OV7 A;  4LIV A;  3EPZ A;  3OYJ A;  2CW8 A;  2V1N A;  3K70 C;  4Y33 A;  3HOT A;  2IS6 A;  4B47 A;  3OYN A;  3V42 A;  1NG6 A;  2BVM A;  4N4O B;  1PYV A;  4FET A;  4E7J A;  2CUZ A;  2KQR A;  3DKY A;  3DTE A;  5FRM A;  4BE2 A;  1QHG A;  3PL8 A;  2V9K A;  3DKX A;  3OMY A;  4HNU A;  4E7K A;  4BJ6 C;  1YX3 A;  2R7U A;  1BR4 A;  3SZG A;  2M4K A;  3S3O A;  3W2V A;  2KLO A;  3OYD A;  4XKC A;  4YRV A;  3DU5 A;  4KT6 A;  2ELJ A;  3NWS A;  3W2W A;  1KON A;  2IGM A;  1Z7L A;  3M1C A;  1D0Z A;  3KYL A;  4QPO A;  1LKX A;  3UNG C;  4F91 B;  4E4H A;  1Z3Y A;  3VYS B;  2R7O A;  2X1D A;  2XF7 A;  3EUA A;  3IP4 B;  3KEY A;  2I8D A;  4XN3 A;  2MFZ A;  1D1A A;  3BCA A;  2KDO A;  2HPM A;  3E0J B;  2HZD A;  3RQ4 A;  2HU9 A;  1WJ5 A;  2BW3 B;  2VQC A;  3FBN B;  3OYK A;  1LDK B;  4BE0 A;  1OLT A;  3CMM A;  4OAZ A;  3NWT A;  5FRO A;  2W1O A;  3OS1 A;  1WJB A;  2XSJ C;  4XOP A;  1W36 C;  2LY1 A;  4BQO A;  2VIX A;  2WY8 Q;  4XKW A;  5HOO A;  2E5N A;  1LVK A;  2R7Q A;  4CZC A;  4HEA 2;  4PK4 A;  1E0E A;  3LSK A;  3DTI A;  3K70 D;  3H9Q A;  2CFO A;  3U21 A;  4C9Y A;  2X6W A;  3LSI A;  4H4K C;  5KHD A;  4PFP A;  2VJJ A;  3SEZ A;  1DGW Y;  2KMU A;  2K3P A;  2ZXI A;  1UG0 A;  3A2K A;  1FMW A;  3QYE A;  4B48 A;  3S3M A;  2PMZ A;  4BAC A;  2GOM A;  4IQ4 A;  4CUG A;  4B43 A;  3LSG A;  3F9K A;  4ZYA A;  4E7I A;  2CV1 A;  2DCE A;  3OOU A;  4KIS A;  3HKZ A;  2JA2 A;  2X6X A;  2WAQ A;  3K4M A;  3PSI A;  1ERD A;  2ZSH B;  2BW3 A;  3CES A;  4JOM A;  4PFO A;  4RLQ A;  2VQL A;  4OWR B;  3CF2 A;  4LIU A;  1U0J A;  3G2B A;  3OL4 A;  2HPI A;  1R6R A;  2W00 A;  1YX5 A;  3H5N A;  2PJR B;  3ZR8 X;  3EUK L;  2FUG 2;  3RCO A;  2CV0 A;  4U7B A;  1WJF A;  3K6G A;  3VYU B;  2VAS A;  3HUG B;  2LYC A;  4GRI A;  3ZXS A;  2ZXH A;  4Y3O A;  3K4K A;  2WAE A;  2RQQ A;  1W36 D;  2VKH A;  2JVG A;  2LOO A;  3AL0 C;  2JUG A;  2WY7 Q;  3DEE A;  2VXD A;  4YEL A;  2CW7 A;  1WJC A;  4P5O A;  2IS2 A;  2Z2S B;  4IQJ A;  2WBM A;  4LIT A;  2A6T A;  2KPM A;  4ANJ A;  2ZSI B;  2UWM A;  3LFU A;  3TBI A;  1TZL A;  1DGR M;  3K4L A;  1Z21 A;  2VQH A;  1MND A;  5HVQ C;  1AA7 A;  2F5V A;  3K4J A;  2K9M A;  3MKZ A;  4XL9 A;  5HNH A;  3OL3 A;  3ONQ A;  4XOT A;  2L2O A;  2X1C A;  3HPG A;  1PJR A;  1EA3 A;  5FRN A;  3QYF A;  4DBQ A;  1WJA A;  2LC2 A;  3H5R A;  4KIT B;  2PJR A;  2KZV A;  4HSR A;  2MD0 A;  4XLA A;  1UAA A;  3OS0 A;  4BL0 B;  2R4G A;  4BGD A;  3QOE A;  1Y56 A;  3OWT A;  1Y6I A;  4NQW B;  5CPR B;  2L5Q A;  3L2V A;  3QYB A;  5LD2 C;  2WAF A;  3DLA A;  4BDY A;  5KCM A;  2L9S A;  4MLO A;  4DIQ A;  3PUB A;  2X51 A;  2JVH A;  1MMD A;  4XON A;  3C2H A;  4BQN A;  3MD2 A;  1N75 A;  2V4J C;  3W2A A;  3C2G A;  2AQE A;  2R7R A;  1K6Y A;  3FHN A;  2A5W A;  1X4P A;  4F93 B;  4BE1 A;  4II3 A;  2DXI A;  4BQQ A;  3H9J A;  4D9J A;  3LSM A;  2DOA A;  3VSK A;  1N77 A;  3N05 A;  4XR6 A;  1MMA A;  3ZCO A;  1JI8 A;  4BUP A;  1SFK A;  3OYC A;  3HPH A;  4RMN A;  4NC7 A;  3OYM A;  4HNT A;  2E1M C;  4EAT A;  4DBR A;  2E60 A;  3CP8 A;  1WFX A;  4HPQ A;  4OAY A;  4PJN A;  4ZTF A;  2R7S A;  5CQG A;  4AVZ A;  3VDX A;  1FMV A;  3L2R A;  2AQF A;  4B44 A;  3PJR A;  3BC8 A;  2RRE A;  4IKF A;  2QKM B;  3S3N A;  3W3C A;  4CCK A;  4CCM A;  3LSH A;  4XLE A;  3QOD A;  4CCL A;  3H5A A;  2XF6 A;  4ZDL A;  4ZJZ A;  3OYG A;  4NC8 A;  2F4I A;  4Y4R A;  2DJI A;  3AFH A;  3HXL A;  1D1B A;  3J7A Y;  3TL4 X;  4C2T A;  4QPQ A;  3CP2 A;  2MYS A;  1G59 A;  1ZEL A;  3HOS A;  2VJ5 A;  2IGO A;  2Q2E B;  4N4N B;  3ZGK A;  1MNE A;  1T95 A;  4F52 A;  1X19 A;  3VWB A;  3IUO A;  3RSN A;  4BU2 A;  2VPL A;  2LY2 A;  3IAS 2;  3MMY B;  2VB6 A;  2VJ4 A;  1DP3 A;  3BLY A;  2VLA A;  2KL4 A;  3DPL C;  3RPU D;  2HVQ A;  1QHH D;  4XKB A;  2F6C A;  1HA8 A;  2LH9 A;  2V6E A;  2X1E A;  3K4B A;  4DOZ A;  1QU3 A;  2M3A A;  4F3Q A;  2ZFU A;  3A4C A;  2CS3 A;  2DT6 A;  2UUZ A;  2LBF B;  4B3X A;  4KJZ A;  2L9N A;  5HLT A;  2MC4 A;  2W82 A;  2W7N A;  5HNF A;  3S32 A;  2HQA A;  4IZZ A;  3BCB A;  3OYB A;  3D5R C;  3DU6 A;  4DGW B;  2CH0 A;  1TT0 A;  1X1D A;  1Z3X A;  3DQV C;  4ZDO A;  2Y0S A;  3AL0 B;  3OYL A;  3OYI A;  3BG7 A;  2IGK A;  3CJQ B;  4CH7 A;  4ZTJ A;  2XAU A;  2CV2 A;  2XC7 A;  4RM2 A;  3H9G A;  3PNV A;  2HNH A;  4DJA A;  1G8X A;  4BJT A;  2M0M A;  1S9H A;  3M8J A;  3D5L A;  4PJL A;  4HG2 A;  3VYR B;  2CMP A;  3DWL E;  4BXF A;  4C2U A;  1X1A A;  2Z16 A;  2BVL A;  4CCJ A;  2M4G A;  2V7F A;  4E7L A;  3CZ6 A;  4XNF A;  4J01 A;  3DPU A;  2KRC A;  3S93 A;  3CJR B;  3GBG A;  3E1S A;  4AYB A;  3RTR A;  2BOL A;  2Q1Z B;  1IRX A;  4IX7 A;  2JSP A;  3I3L A;  2E5Z A;  5CQE A;  4ZC3 A;  2W4S A;  2OC6 A;  3VYT B;  2KP6 A;  2L7K A;  3KX2 A;  4PJM A;  1SAU A;  2LRD A;  4NNJ A;  2LBF A;  2OUM A;  2HVR A;  4CCN A;  2VQG A;  4XKV A;  2RNG A;  3IAM 2;  4XQF A;  4RLF A;  1X4O A;  1BOB A;  3DPT A;  2IS1 A;  2R7V A;  4BEH B;  3MKW B;  5JHF A;  3OYH A;  2DT7 B;  4BDZ A;  1UEL B;  4E6K G;  3BG6 A;  4PSX A;  2R7X A;  4R79 A;  3OR2 C;  4E7Z A;  1J09 A;  5KNL A;  2HVS A;  3PFY A;  5LFA A;  3FKJ A;  4PSW A;  4FAS D;  4E7S A;  1X1C A;  1V5F A;  2WA0 A;  3FDY A;  3EUH C;  3S8P A;  1GLN A;  1BR2 A;  4XLC A;  2KRH A;  4BS9 A;  2QKL B;  3FBI B;  3AKZ A;  2NOJ B;  2K9L A;  1P9Q C;  3OIQ A;  2IS4 A;  4F55 A;  3HG9 A;  2K5C A;  4XM3 A;  4HST A;  2M7B A;  2E1M B;  5TGT A;  3TMO A;  1BR1 A;  2P0W A;  3MKY B;  1N78 A;  3OYA A;  3UR3 C;  3K10 A;  2LG4 A;  3PNY A;  2LRE A;  3LL7 A;  2Z1D A;  2WAD A;  3H35 A;  3SDB A;  3DTK A;  2VJI A;  2V26 A;  3LMM A;  2XF5 A;  4AU7 A;  4PUS A;  3OYE A;  2VXZ A;  4X0G A;  1X1B A;  3OIP A;  1MMG A;  2GOX B;  2IGN A;  4G6T B;  4XN0 A;  1WJE A;  4XLF A;  3I9V 2;  3SEQ A;  4YEJ A;  3SYT A;  4JQF A;  3HC7 A;  4F92 B;  3L2W A;  4BEH A;  2X6Y A;  3PSF A;  3OYF A;  3K4C A;  4CA0 A;  2VKD A;  3PNT A;  4P1W A;  4BJ5 C;  2R7T A;  3OS2 A;  4E7H A;  1NG7 A;  2VL8 A;  4ZDP A;  4J00 A;  3D5S C;  2KHM A;  2X85 A;  1D1C A;  4CSW A;  3K4N A;  3HL2 A;  2CUJ A;  4XLH A;  4XMY A;  5CKT A;  3A1Y A;  3L2U A;  4ITV A;  3VSL A;  3ZQQ A;  1V5E A;  1D0Y A;  3OR1 C;  2MAB A;  3H0D A;  4C30 A;  4HRI A;  1DQU A;  1V5G A;  3OY9 A;  2R7W A;  2M7A A;  2IXS A;  1LFP A;  1MW7 A;  4II2 A;  3L2Q A;  1WJD A;  2WB1 A;  4CCO A;  4RM3 A;  2O5R A;  4PJJ A;  1VZ0 A;  2UV1 A;  4LG3 A;  1OR7 C;  1MMN A;  2HDW A;  2XDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...