2XV4S

Structure of human rpc62 (partial)
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
532
structure length
399
Chain Sequence
MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETTMDYAEVSNTFVRLADTHFVQRCPSIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKGMYVINLHKALASLATATLESVVQERFGSRCARIFRLVLQRTFYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analysis of Hrpc62 Provides Insights Into RNA Polymerase III Transcription
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE III SUBUNIT RPC3
total genus 150
structure length 399
sequence length 532
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF05645 RNA_pol_Rpc82 RNA polymerase III subunit RPC82
S PF08221 HTH_9 RNA polymerase III subunit RPC82 helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S03
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S04
5LBQA 1H9TA 2CGPA 4R79A 1W7PD 2RNJA 1G6NA 5FFXA 2OA4A 3I53A 1ZHFA 2WV0A 3MZHA 3KLNA 1XGNA 1YW9A 4GCVA 1R5HA 1P92A 1ON2A 4LB5A 2PMHA 3HHGA 1F9NA 1P4XA 3OV8A 4CGZA 2YX7A 3WG9A 5BQTA 5L3EA 1R7JA 2K4BA 2UZKA 4A6EA 3GYHX 4I0AA 2ZJ2A 1D5VA 2A69F 1BOAA 3T1BA 2JZYA 1Z91A 4A0YA 4I0BA 4M9XA 4IXAA 4D0PA 3CTAA 4MEXF 3DEUA 4XLNF 2L01A 1XGMA 1RNLA 1AOYA 4I7HA 1XCBA 2PBIA 5F6FA 1JE8A 1R22A 4I98B 4WXHA 2XKOA 4R8HA 4NQWA 2FNPA 2J5PA 1MKMA 2EB7A 1DDNA 5LHIA 2ZXJA 2VN2A 2C6YA 2YR2A 2DT5A 1KQ9A 4YFXF 1B9MA 3LA3A 4KN4X 1L3LA 1FYLA 4KIFA 5K5RA 3KLOA 2IJLA 3IL2A 4NB5A 5JI6A 2DAOA 3JTHA 1KGSA 3GFJA 3IC7A 1BIAA 4BAYA 5J8CA 1I1SA 3I54A 3F23A 4G6QA 3TQNA 3QPTA 5HDNA 1R58A 3FZVA 2CQKA 5HVQC 3P9IA 1L0OC 3BPXA 1KYZA 4CHUA 3F72A 1G3WA 1XSDA 2WTEA 4Q48A 3KEOA 3T5XA 1T98A 2HYFA 4HX8A 1IN8A 3HOTA 2D1VA 2CO5A 5F64A 5JHUA 1TBXA 4UV9A 2Y48A 3N4MA 2IT0A 1QZYA 5J8FA 2EK5A 2QBYB 2P8TA 1ZLJA 3ZN1A 1ULYA 1B9NA 4RB2C 3IKTA 4EGYA 1IN4A 3Q5FA 2VODA 2JPBA 1RI7A 3V7SA 3D0SA 1FZPB 4EQQA 5TJJA 3E3VA 5CVJA 1YFHA 2L4AA 2XAQA 2L3DA 4LG0B 3WTZA 5K5QA 2ISYA 4ZYGA 1OPCA 1Y0UA 3FXUA 2HWVA 2KKOA 4UNOA 3F6OA 3HRUA 2ISZA 4LLNA 3B73A 5FFZA 2XAFA 3IKVA 5AIPA 2CYYA 1Q1HA 4M6YA 5LLQA 4HYEA 4RAYA 1W4MA 3RIRA 1LB2A 2GAUA 2KJBA 5D8KB 1XMAA 1USTA 1IF1A 4G7ZF 4LD5A 1F1ZA 4G94A 5HLHA 2RKHA 3KP2A 1WWXA 2KIFA 1SD7A 2LF7A 1LEBA 3RPUA 3ZMUA 2H09A 4CDGA 4LLLA 4OINF 2Z3YA 5A2QZ 1TQPA 5E1XA 5IT9Z 1STZA 1WRJA 3WE3A 3PFIA 1QO0D 1BC7C 3NEUA 4AIHA 3L00A 5FB2A 5D5XB 3MZYA 3HRMA 2ETHA 1ZN2A 1SMTA 2FA5A 2HQNA 3I58A 3KFWX 4EJOA 2OQRA 4M72A 3CUOA 3KP5A 1HW2A 2Q8KA 2Q0OA 1SD4A 1O57A 2EFPA 3DQVC 1ZRCA 1YG2A 3GEZA 4PGHA 1BIBA 1U2WA 1JHHA 1E17A 3SZPA 3SXYA 2ZCWA 2XRNA 1O3TA 3F8BA 5E8GA 5ILVA 3MEXA 3HUGA 1YW8A 1FSHA 3TOAA 3CO6C 2F2EA 5CVVA 3MCZA 2GWRA 1X3UA 4WF2A 1HSTA 4AIKA 2DTRA 4L9JA 3DKWA 3PQKA 2F5EA 5HLGA 1Z7UA 5KK1A 3I59A 1MDMB 2QUFA 4RB1A 4OIPF 2X4HA 4LG0A 2V1UA 4DQ2A 1O3SA 5K1YA 4GO1A 2VOOA 3F21A 3J80K 3E5QA 4MQ9F 3HSFA 1XDUA 2QQBA 5BOXA 5D4RA 2A07F 3F8MA 4CZZA 3I0TA 2PEXA 1FPQA 1MJBA 1IRFA 5ERIA 3DXJF 2HGCA 4AVPA 4FT8A 1J2XA 2NAZA 5TRDA 4M9SA 2FBHA 4YFNF 2JRTA 1E2XA 2XVCA 2CG4A 4MHGA 2CWEA 4YFKF 4OMZA 4S05A 1WKMA 2OZ6A 1Z6TA 3C3WA 1GXPA 3IWZA 3U2RA 3EYIA 4E70A 2K4JA 4KICA 1K78A 3GZ6A 2LDUA 5FD5A 4FX4A 5AONA 2EA4A 3FMQA 3HRTA 3BROA 2UXNA 2W84A 3M1EA 4UVCA 3M7GA 1BC8C 5ED4A 4HA8A 4P9UA 4ZZDA 5JVTA 3FF5A 1XD7A 2ADUA 1XGSA 2VE9A 3KP7A 4PCQA 2XGXA 3ABUA 1G3TA 3EETA 3TKYA 4U0VA 1I1GA 2DBBA 5HDKA 1KU2A 2ESHA 3WU1B 3R61A 3CLOA 3HTSB 2W25A 3T0YA 5LHHA 1KU9A 2BGCA 5D5UB 5FLXK 3H3UA 3GWZA 4CYDA 4EGZA 2P7VB 4WX9A 4HX4A 4XRFA 2NRAC 3EYYA 4PZJA 5LHGA 2LF8A 2HKXA 4Q47A 2VBYA 3CUQC 1Z1DA 2Q2EA 5LGUA 3RDIA 4P55A 4LK0F 1PP7U 2DFIA 1FBQA 3DPLC 4BHPA 1O7LA 4Y13A 2P5VA 2XROA 4HV5A 1QBJA 5E18F 3CUQB 3C1DA 3KP6A 2D2WA 1LQ1A 3ZMTA 1KU3A 1R1VA 3WTTC 1UHMA 3LAPA 4I01A 2V9VA 2FSWA 2V1XA 4BHCA 2H6CA 3FM5A 5FO5A 2XIGA 2XUBA 1DP7P 2ACJA 2DI3A 3K0LA 5L3GA 5H6QA 2W85A 3HYIA 1LVAA 4IJAA 3T8TA 4KMUX 5DCFA 4RGSA 1BI0A 1G4DA 5BS6A 5DUIA 1W7PA 5IT9K 2CSOA 4OIOF 2OD5A 5HDGA 3R0JA 4HF2A 4EV0A 2GXBA 3RKYA 3DV8A 3Q9SA 2F5CA 2DLLA 4B8XA 4RAZA 2KRFA 3I5UA 1FWZA 2PG4A 2VXZA 1K79A 2XKPA 4ENNA 2HDCA 4HAMA 3U9GA 1IXSB 2P5KA 3TO6A 4BHBA 2QQAA 4P9FA 3SZTA 5DCMB 2O61A 5DCMA 4U7DA 1QZZA 4JK1X 2FBKA 3HIFA 3FMRA 4Q5SF 4ESFA 1QQIA 4GYIA 3IRRA 3EDPA 4HZFA 1J5YA 2FF4A 2IA1A 4L0YB 3NRVA 2XHKA 1I5ZA 2A6HF 3SHFA 2Z99A 1HW1A 2VOPA 5F1RA 2YSRA 2VBZA 5HOOA 4BXUA 1QNTA 5HS7A 1U3EM 3V8JA 2PJPA 2K27A 1I6XA 4WWCA 1R1UA 1LJ9A 2R7DA 1YTYA 5CYVA 4UUVA 1HW5A 2CFXA 3O3KA 2WC2A 4K2EA 1UFMA 1SD5A 3VFZA 2OQGA 1FLIA 2EFOA 4WXCA 3G3ZA 1WQ2A 2MH2A 3EUHA 3LSTA 1S29A 3TO7A 1BN5A 2EA2A 4GGGA 1FP1D 5DV5A 2HKOA 2PI0A 1USSA 1O7FA 3V7CA 3GX4X 2BV6A 1P6RA 2KIMA 3V8KA 2O6GE 3B02A 1ZYRF 1PUEE 1FBSA 1OYWA 2RVCA 3BWGA 2NYXA 4HF1A 1BI3A 1U8RA 1SAXA 3QP6A 2BE5F 4ESBA 3K1MA 4EM2A 4N0BA 1CF7B 2MA3A 3J7AO 3JAMZ 1HSJA 2M45A 2VC0A 1EV7A 2HTJA 2RN7A 5HLIA 1V4RA 4KFCA 2EV0A 1YO5C 2HFHA 2ZMEA 1OMIA 2ZMEB 3WGIA 3Q9VA 4G6DA 3ZMZA 1TW2A 3L7WA 4IPAA 1SMYF 1BM9A 2CW0F 4L18B 1U6GA 3RPQA 2OU2A 2QYOA 2EWNA 3S2WA 4XSZF 2HYGD 4O5VA 4U0YA 2PLYA 2MC3A 2BEOA 3QPHA 4YIIA 2W24A 3KCCA 2ZO4A 3LAJA 4KUMA 2VC1A 1VTNC 1XN7A 2ELHA 2XV4S 3AAFA 4QLCU 3GZ5A 4LJZF 1ZG3A 3LWFA 4RB3C 3WGHA 4HDVA 4HX7A 2DK8A 3MQ0A 4EJTA 3BDDA 4GXOA 3SFZA 1MJAA 3KP4A 5ICGA 1ZRFA 4L9VA 3O2PE 1IUYA 2IVMA 4RGXA 2QM3A 1GVJA 3ZMDA 4KYWA 3LQRA 3JAMK 3GFLA 1S7OA 3HRSA 3RKWA 2FQ3A 3VOEA 1YYVA 3IHUA 4A12A 1QGPA 4MGRA 3E6CC 2DU9A 1TQMA 3H3ZA 5IT3A 1B1BA 2A6EF 4ZYEA 3N97A 1B4AA 2FEZA 3ML6A 4G7OF 5E8IA 1R1TA 5DUKA 2W57A 2P6SA 5E17F 2IPQX 3I59B 1MDMA 1U5TA 2L02A 3LA2A 2L54A 3OOPA 2UWMA 4FHTA 4CO8A 3BZ6A 3WU0A 2IP2A 1S7AA 5DDGA 2PMUA 5LEKA 5KVRA 2ESNA 1NHAA 2M87A 3EQLF 4HQMA 1RIOH 2IA0A 1W5SA 1TNSA 3RYPA 3F22A 3MFKA 2V6CA 4BQAA 1OYIA 1W5TA 4LLGF 4L5JA 1O3QA 1IN7A 1LDJA 4TV7A 5FGMA 4BYYA 2P4WA 4UVBA 1HKQA 2KIUA 1WSUA 5LGTA 1DUXC 2FXAA 2JTVA 2GQQA 3KP3A 1FSEA 1Z05A 4KT5C 4Y15A 1K6OA 1OKRA 4IF4A 1S6LA 3BY6A 5DEQA 1PP8F 1G3YA 5CLSA 2ZFWA 3QOPA 4ASNA 2ZKZA 3E97A 3CO7C 2LSOA 1GXQA 3FX3A 4JBAA 4Q4ZF 4KNYA 3M8EA 1KQ8A 3JSPA 3FWEA 4JQFA 2GXGA 5DD4A 3FXRA 2GIVA 2X0LA 1SD6A 1T6SA 1J9IA 2BBYA 4IRIA 2LKPA 1REPC 4EM0B 3LQQA 2YPRA 3T8RA 5BPDA 2GA2A 2Z9OA 4L0ZB 1IXCA 1XSXA 4ESJA 3QP5A 1R23A 2VONA 5DD8A 2DO7A 5JR3A 2FOKA 5HS9A 2MH9A 3MAJA 1ZREA 1FY7A 3U1DA 2EFNA 4R1HA 3GUDA 2LNBA 2VE8A 1HKTA 1P2FA 2R3SA 1W7PB 2QENA 2RGVA 3E6MA 5D5VB 1Z6RA 2HEOA 2VBWA 2FE3A 1ZG1A 1TNTA 1D8KA 3QRFF 4G7HF 2IA2A 4ON0A 1HQCA 5HS8A 2COMA 4I02A 3JTGA 2PN6A 4KIBA 2A61A 4A2UA 1GHCA 3DP7A 2VT2A 1PDNC 1K7AA 3J81K 1CGPA 2NS0A 4BH9A 4KMFA 4BNCA 3C18A 2TDXA 1ZGAA 1ZLKA 1FT9A 3F3XA 2XAGA 5K5OA 3GFMA 4WCGA 4HQEA 4QWQA 2GZWA 2G7UA 1XCVA 1XDSA 5BPIA 2OAZA 4YIFA 1J75A 4A0ZA 1T38A 2V79A 1I27A 2BYVE 1BI1A 5FLXZ 2DQRA 1A04A 3R4KA 1FC3A 4ZYDA 1BJAA 2IW5A 1XB4A 1ONVA 5CJ9A 1H9GA 4KDPA 2QVOA 4HLXA 4XSXF 4P96A 2QBYA 3QU3A 3J81Z 1ZRDA 3L9FA 1IN6A 2A3SA 4IRGA 2HR3A 2XASA 1UB9A 5ILUA 3WE2A 1YS6A 2G7HA 1U5TB 1LDDA 4I09A 4HBLA 3QU6A 5ICEA 4EJWA 1ZGJA 4S04A 3I71A 2YX4A 2D45A 1ZG5A 5E1ZB 5EEHA 3IWFA 1FX7A 1T2KA 1JGSA 4MTDA 4FX0A 3RJPA 2JT1A 1ON1A 5CVRA 4MQVA 5H6RA 5D6EA 3VODA 3ISPA 3J80Z 4IHTA 5E20A 5CVUA 3W6JB 1D3YA 4HOBA 2PQ8A 3JW4A 4EM1A 5LEJA 4XBFA 1S3JA 1T0FA 1TQIA 4EJVA 4A5MA 3L09A 2Z33A 4U0WA 3RKXA 1HBXG 2E7XA 4ENJA 2M5WA 4KA4A 3ERED 4B09A 4Y17A 4RGUA 2H6BA 3QAHA 4MEYF 1OR7A 3V8LA 4KN7X 3ROUA 1HXDA 3GW2A 4ZZLA 5BMZA 4RS8A 3HOSA 2MLGA 2A5YB 4M74A 3F8CA 1IZ1A 1ZH5A 2V1DA 4NHJA 3TGNA 3DFGA 1MZBA 3RI4A 4HV6A 2VT3A 4AD9A 3COAC 1MD0A 1MJ9A 3O6BB 2P6TA 4WK8F 4L9TA 2OZUA 1Z9CA 4G8XA 3CDHA 1DPUA 1AWCA 4OU0A 4PDKA 4RGRA 3WTXC 2K7LA 2QZ8A 1CF7A 1ZAOA 5D8LB 4MNUA 3VB2A 3ULQB 2P7CB 1BBYA 4YG2F 4O3MA 2ZNYA 4AIJA 3LA7A 3KEQA 2FMYA 4UXNA 1R00A 3WTWC 2NNNA 4UV8A 1R5GA 1YQAA 2DPUA 2XAJA 4EVIA 3BOQA 3R0AA 2H94A 3GVAA 2ZBKA 3E6DA 4OOIA 3F8NA 2M30A 1B59A 1J0RA 2ZNZA 2A68F 1YS7A 4OIQF 4HF0A 1TTYA 3G73A 3WTYC 2EFWA 1LNWA 3SQNA 4EJUA 3P9CA 3M8FA 4O6JA 2DPDA 3LFKA 1XSVA 4EMSA 2E1NA 3DF8A 5LRSA 4OIRF 5L3FA 2O8XA 3KETA 3K1PA 1H0MA 3TDZC 1EH8A 4M9ZA 3P7NA 1V3FA 3JSOA 1F4KA 3F6VA 1OYYA 1SFEA 3TOBA 2QWWA 2JSCA 3RYRA 4U7BA 3WTVC 4LGWA 1TLHB 5A2QK 3R60A 2HS5A 2EFQA 2UXXA 5ICFA 4N9IA 2G9WA 2EJRA 3W6KB 4A6DA 2AXLA 2STTA 4AWXB 2RV8A 3C7JA 1IAWA 1YW7A 5L3CA 1EH6A 1RZ4A 3IRQA 1U5TC 2DQLA 2QLZA 4M73A 4DNCA 1JXSA 1KYWA 4ZH4F 5J6XA 2RQPA 3GO5A 1UHWA 5JFRA 1K78B 3P9KA 1U78A 2P5LC 1IXRC 4GYGA 1JHFA 2VBXA 2STWA 3WODF 2MLKA 1RUNA 4UVAA 3M9AA 1BI2A 2O3FA 5H20A 2Y0MA 3ZPLA 3FHZA 1D8JA 2DK5A 3ZMSA 4LFUA 2L4MA 2QQ9A 4ENKA 3V7RA 1IW7F 5LGNA 3NQOA 3REOA 3WGGA 1F5TA 5AIQA 2IRFG 2MBFA 2FU4A 3FMSA 4F7ZA 4Z2YA 3K9TA 4ETSA 3ZQ7A 2KJCA 4UHTA 2O0YA 3L2CA 1ZARA 1FYMA 5D4SA 2M1BA 2FRHA 3ECOA 1SFXA 4HW0A 1KQ0A 4XLPF 3I4PA 1FOKA 2E7WA 3ZN0A 2MD5A 5D6FA 2PFBA 4LMYA 6PAXA 1WI9A 3PQJA 3K69A 4IVNA 1LDKB 1FBUA 1KA8A 1RUOA 3ELKA 3WTUC 1YIOA 3E5XA 3GF2A 2M8EA 1G3SA 5CVIA 3H92A 2DW4A 4LK1F 1S8NA 4MTEA 3HSRA 4PGGA 4WXDA 2RDPA 3BPVA 4HLYA 1YLFA 4U88A 2D1HA 5ILSA 4OMYA 2WWYA 3KZYA 4L5IA 3R6SA 3F8FA 1FYKA 1TW3A 3E5UA 5LRRA 3HHHA 2HTSA 3V4GA 3ABTA 5ICCA 3HTUA 4H0EA 2HQRA 1QPMA 2FNAA 3BJ6A 3CUQA 3K1NA 3E6BA 1R36A 1IRGA 3BJOA 3TDUC 5L3BA 1FP2A 3FXQA 4LB6B 4HDUA 3VEPA 1EH7A 4IHSA 1IN5A 3DPTA 4N9HA 4M71A 4A5NA 3BP8A 4L9NA 5EEGA 2O03A 2RC4A 2YU3A 3GLXA 1FNNA 3I64A 4RB0A 2HOEA 1J59A 3BJAA 3CJNA 4CICA 4KIGA 3ECHA 3KZZA 2NNYA 1T39A 2B0LA 2E1CA 2EV5A 1HKSA 2F5DA 3MWMA 5D5WB 2OBPA 4CXFA 5FD6A 2XAHA 1B6AA 4ZYHA 1UCRA 3RTRA 2AS5F 1ODDA 2K02A 4G9YA 3WTSC 2JPCA 2R7FA 1XMKA 3ZP5A 2H27A 5DYMA 1MGTA 4A0XA 2FBIA 1SFUA 4P5OA 2HZTA 1DPRA 3GXOA 1KU7A 1LEAA 1P4AA 3KE2A 1P4WA 5L3DA 3K2ZA 1XGOA 4ENMA 2Y75A 3ZMVA 3GFIA 2GA1A 4I2OA 2Z5UA 2FMLA 3FM3A 1C0WA 2F5FA 2K86A 2J5OA 3HSEA 5E1WA 1O3RA 4M6XA 2EV6A 4IRHA 1J7KA 3D5LA 3TO9A
chains in the Genus database with same CATH superfamily
2R5YA 5LBQA 2DDBA 1H9TA 2RAEA 2CGPA 2H8WA 3KIOA 4RAFA 4R79A 1W7PD 2RNJA 2OC6A 1G6NA 5FFXA 2OA4A 2HQ5A 3I53A 4BS9A 1FMWA 1ZHFA 4NC7A 2WV0A 4QPOA 3MZHA 3D5RC 3KLNA 4NNJA 5GAHJ 1XGNA 5FROA 3K70D 1OFCX 1YW9A 3AG2H 5EJCA 4GCVA 3OYCA 1R5HA 1P92A 1ON2A 4LB5A 2PMHA 3FBNB 3HHGA 5HLTA 1F9NA 1S5LC 1P4XA 3OV8A 4CGZA 2YX7A 4PJ0C 3WG9A 5BQTA 2Y2ZA 2KZVA 5L3EA 1R7JA 3SJMA 2K4BA 2DA3A 3N05A 2UZKA 3K4JA 4QIWN 3S2DJ 2EIKH 4A6EA 1DU0A 3RPUD 4LIVA 3QOEA 1JJ6C 3W2WA 3SEQA 3GYHX 4A3DJ 1V5EA 3GTLJ 2MSYA 4I0AA 4EEFG 1HC8A 2ZJ2A 1D5VA 2VKVA 3VPRA 2A69F 1BOAA 2NOGA 3T1BA 1IRZA 2FX0A 3TP3A 3OR2C 2L7MP 2JZYA 2F6CA 1Z91A 3M07A 4A0YA 4I0BA 5HNHA 4M9XA 2MG4A 2R7WA 4IXAA 2KDOA 3NAUA 4NC6A 3CTAA 3ZQQA 4D0PA 4MEXF 4IKFA 3DEUA 2HVSA 4XLNF 3OS0A 2L01A 5J47A 2FJ1A 2OF7A 4AUXA 1XGMA 1RNLA 1AOYA 2HVRA 4I7HA 4MO7A 5IYDJ 2ECCA 4KISA 1XCBA 2PBIA 1WJBA 2W1OA 3K10A 5KCMA 5F6FA 4RA2A 2HQAA 2AXTC 3K4MA 1JE8A 1R22A 1OCZH 4I98B 5J1YA 4WXHA 4A3EJ 2XKOA 1ZGWA 4R8HA 3PUFA 2K3FA 1TWHJ 4NQWA 2FNPA 2MW8A 2J5PA 1MKMA 2WY7Q 1VQ7I 2EB7A 2VJ5A 1DDNA 2E1OA 4I99C 3IUOA 1ETQA 2DJIA 2ZXJA 5LHIA 1Q1VA 2L2OA 1NTCA 3I3LA 2LH9A 3ZCOA 2HOTA 2VN2A 2C6YA 2YR2A 2BHYA 3LSPA 2DT5A 1KQ9A 4YFXF 4N4NB 1NH3A 3IP4B 1B9MA 3LFUA 3LA3A 4KN4X 3O8HA 3OSFA 2KHMA 1L3LA 4J01A 1FYLA 4JX4A 2XF6A 5FJ8J 4KIFA 5K5RA 3KLOA 4F92B 4B3XA 1APLC 2IJLA 3BC8A 3DWLE 2RNGA 3IL2A 4NB5A 5JI6A 1R49A 1K4TA 3GTGJ 2DYSH 5B1BH 2DAOA 1TWGJ 3GZNB 2ZXIA 1FOWA 3JTHA 2D5VA 2WAQA 1KGSA 3GFJA 3IC7A 1BIAA 4BAYA 5J8CA 3PNVA 1I1SA 3I54A 3F23A 1FOXA 4G6QA 2Y0SN 3TQNA 2CH0A 2WAFA 3QPTA 3O8GA 2K9QA 1MSFC 5HDNA 5M5XJ 3DLAA 4XRMA 2VL8A 1R58A 1D5YA 3FZVA 1TL8A 3CC7I 1SAUA 2HDDA 4AYBA 2CQKA 2KZGA 3OSGA 2X6OA 1A5JA 3K4BA 5HVQC 4ITVA 2BY3A 3P9IA 2EZHA 3C2HA 1L0OC 3BPXA 1KYZA 4CHUA 2L9NA 2HYJA 3HGYA 4V19K 1WHUA 3F72A 1ETYA 1RC9A 1ZK8A 1VFCA 1G3WA 1XSDA 2ZSIB 4S0HB 2WTEA 4LG3A 4Q48A 2R0QC 1HF0A 3KEOA 1JKQC 4G12A 3T5XA 1T98A 3CMYA 2HYFA 2YU9J 4E7SA 4HX8A 4RDUA 1IN8A 4P1WA 2LTPA 3HOTA 2D1VA 2CO5A 5F64A 2WB1N 1JKPC 2K85A 4B48A 2VPLA 1BR4A 4YIRX 3VYRB 5JHUA 1TBXA 5KAIC 4Y7NJ 1RKWA 4UV9A 5E3NA 1SFOJ 2Y48A 2ZSHB 3N4MA 2XSJC 2IT0A 4BJ6C 1QZYA 5J8FA 2DN0A 3ERMA 2EK5A 2QBYB 2DODA 1JUMA 2P8TA 1ZLJA 3ZN1A 1ULYA 3RQ4A 1B9NA 3ABKH 3P5JA 4RB2C 3IKTA 4EGYA 1IN4A 2XSDC 3Q5FA 2HOSA 2DOFA 5JLWA 2VODA 2JPBA 1RI7A 5K7ZA 3V7SA 3D0SA 1FZPB 4EQQA 3HPGA 5TJJA 3E3VA 5CVJA 1YFHA 1FMVA 2F5VA 3DLLF 2L4AA 2XAQA 5EEAA 1GV2A 2L3DA 2IS4A 4LG0B 3WTZA 5K5QA 2ISYA 5B1AH 1X1PA 3NARA 4ZYGA 1OPCA 1Y0UA 2OJED 3FXUA 3DCFA 3JRHA 2HWVA 2KKOA 3OWTA 3VDXA 1R4MB 2QKLB 2HOAA 5M5WJ 4UNOA 2DFFA 3F6OA 5EG0A 4E7HA 3HRUA 4DBRA 2ISZA 2O9LA 2W00A 2QKMB 1X1CA 4LLNA 3B73A 3KYDB 5FFZA 3M8JA 4F52A 4BY7J 1AKHB 2XAFA 2ZJQF 1TWAJ 3IKVA 4C9YA 5AIPA 4KT6A 5TISC 1ZR2A 2E71A 5EZGA 4I76A 2CYYA 2CRGA 1RRJA 1Q1HA 4M6YA 4XICA 3FBIB 5LLQA 4HYEA 3SEZA 4RAYA 1W4MA 3BQZA 3RIRA 3J7AY 1LB2A 2GAUA 2KJBA 3S15J 5D8KB 1XMAA 2WADA 3W2AA 1USTA 2QCOA 3L2QA 2EIMH 3MKYB 1IF1A 2OCCH 4G7ZF 4AC0A 5FKLA 2WY8Q 1N78A 1FIAA 2VJ4A 4LD5A 1F1ZA 2BZTA 2VIXA 4IQ4A 2V1NA 4G94A 5HLHA 2RKHA 3KP2A 1WWXA 2KIFA 1SD7A 2LF7A 5FLVA 1LEBA 3RPUA 3ZMUA 3J7YJ 3IH2A 2H09A 5JLXA 4CDGA 3HEFA 4LLLA 1QHHD 3OR1C 3OS2A 3MZ8A 3FK6A 4OINF 2Z3YA 2Y0SA 2CV1A 5A2QZ 2GIZA 1UMQA 3QYEA 1TQPA 5GPAA 4XNFA 2Q2EB 5E1XA 3BR1A 5IT9Z 2VQGA 4RLFA 1STZA 3OYMA 1WRJA 3MKZA 1YRNA 2Y9ZA 2XF5A 2LKSA 2Y69H 4HSTA 4C3IJ 2NVQJ 3WE3A 4NQWB 3PFIA 1CQTA 2JUGA 1QO0D 1BC7C 3NEUA 4AIHA 1ZTRA 3L00A 2M7BA 4IZZA 5FB2A 2NOJB 3K4CA 5D5XB 2VASA 2R93J 3MZYA 3HRMA 2ETHA 1ZN2A 4BDYA 3MKLA 4J00A 3H35A 1SMTA 2FA5A 3TBIA 4CCJA 3AG3H 3BR6A 3BZKA 2ZXHA 2HQNA 2DMNA 1LFUP 3I58A 2LOOA 5M3MJ 1Y8RB 3KFWX 4Y52J 3OMYA 4EJOA 2OQRA 4M72A 1R4NB 3CCMI 3SFIA 3CUOA 3KP5A 1HW2A 3VWBA 2Q8KA 3ONQA 2Q0OA 1AHDP 1XX5A 3BG7A 5JHFA 1SD4A 1O57A 4IQJA 1LFPA 4ABZA 3DQVC 2EFPA 2VKEA 1IUFA 3QYBA 1ZRCA 3E7LA 3OYBA 1YG2A 2Q1ZB 2EZIA 2E1MC 3BR0A 3GEZA 1TZLA 3K4NA 4PGHA 1BIBA 1X1DA 1U2WA 3QYFA 1JHHA 2W4SA 1E17A 3GTQJ 3SZPA 1Z3YA 4C2MJ 3SXYA 4A3BJ 5EYRA 2ZCWA 1MNMC 2XRNA 1O3TA 2ME0A 3F8BA 1WCMJ 1RR8C 2XB0X 5E8GA 5ILVA 3MEXA 3HUGA 4A3KJ 4LITA 4PUSA 1YW8A 3ESWB 1FSHA 3TW6A 3BG5A 3TOAA 3CO6C 1UHSA 2GLOA 2F2EA 4CZCA 5CVVA 3CP8A 2EQRA 1UG0A 3MCZA 2GWRA 4B3AA 3HOWJ 1X3UA 4WF2A 3LMMA 1HSTA 4AIKA 2DTRA 4L9JA 4XRSA 4E7ZA 3LSMA 1R9TJ 3DKWA 3PQKA 2F5EA 2KT0A 2MGQA 1SVMA 5HLGA 2R7RA 2V4JC 1Z7UA 5KK1A 2XPUA 3I59A 1MDMB 4MFEA 2DMQA 3H0DA 2BW3A 4JX5A 2QUFA 1AU7A 4RB1A 4OIPF 2X4HA 4LG0A 2V1UA 4DQ2A 3HOXJ 1O3SA 5K1YA 4GO1A 2VOOA 2E5ZA 2LD5A 3F21A 3J80K 2ZJPF 3GTKJ 3E5QA 4MQ9F 3HSFA 1JI8A 1XDUA 2GOMA 2QQBA 4YELA 1K4SA 1XPXA 2M9HA 2KPMA 5BOXA 1QA6A 5D4RA 2A07F 3F8MA 3RQIA 4CZZA 3I0TA 4ZYAA 2PEXA 1YHQI 1FPQA 1MJBA 1YX3A 3JRGA 2CUJA 1ETVA 4A69C 1IRFA 3FXJA 5ERIA 1FTZA 4PFOA 3DXJF 2HGCA 4AVPA 4FT8A 1J2XA 3FHNA 2NAZA 5TRDA 4M9SA 2FBHA 1U0JA 2E1MB 4CCLA 4YFNF 2JRTA 1HDDC 1E2XA 2XVCA 2CG4A 2CWEA 4MHGA 4YFKF 3GLLA 4OMZA 1IDYA 2NVXJ 3I4MJ 2HNHA 4S05A 1WKMA 2OZ6A 1Z6TA 3C3WA 1GXPA 3IWZA 3U2RA 1B8IA 2JK3A 3EYIA 4E70A 4DW6A 2K4JA 4KICA 1K78A 1UJ8A 3JRDA 3BG6A 2R7SA 3GZ6A 4GDFA 2LDUA 5FD5A 4FX4A 5AONA 2EA4A 3FMQA 3HRTA 3BROA 1DP3A 2LY1A 2UXNA 1WH7A 1KZHA 4CCKA 2W84A 4XLHA 3M1EA 4UVCA 2BY0A 2ZFUA 2LRDA 2CJJA 2PMZN 3M7GA 1VQPI 1BC8C 2VXDA 5ED4A 4HA8A 2KDZA 4P9UA 4ZZDA 5JVTA 2BVLA 2W82A 2V7FA 2JA7J 3FF5A 1XD7A 4KJZA 2ADUA 3HG9A 1XGSA 2VE9A 3KP7A 1LE8B 4PCQA 2XGXA 1LE8A 4E7KA 5E79C 3ABUA 1G3TA 3EETA 1Z3XA 3ZRGA 3TKYA 2R7TA 4X6AJ 2YUSA 4U0VA 1I1GA 1YJWI 2DBBA 5HDKA 4AIDA 4QSHA 3OYHA 1KU2A 2QF7A 2ESHA 3KYCB 4BQQA 3WU1B 3R61A 3CLOA 3HTSB 2R7ZJ 2DT6A 2N8GA 3DU6A 4YRVA 2R7OA 1PYVA 2W25A 5DS9A 3A01A 3T0YA 5LHHA 1KU9A 3PIOF 2BGCA 2OV7A 1LPQA 3CCSI 3SDBA 5D5UB 5FLXK 2TCTA 4DZJA 3H3UA 3GWZA 3OIQA 4CYDA 2P7VB 4EGZA 4WX9A 4HX4A 4XRFA 4Y4RA 4IHYA 4E6KG 5E3MA 1S9HA 2DA5A 3TEDA 2NRAC 3EYYA 4QPQA 1IV8A 5EG0B 1LVKA 4PZJA 5LHGA 2LF8A 5CQGA 2HKXA 4Q47A 2VBYA 3OYLA 1MBGA 2CFOA 3PSIA 3CUQC 4PJLA 1Z1DA 5IP6A 2Q2EA 5LGUA 3CCJI 3RDIA 4P55A 4LK0F 4CCMA 2B9SA 1PP7U 2DFIA 1FBQA 3PUBA 3DPLC 4BHPA 1O7LA 2PX9A 4Y13A 1PJRA 2P5VA 2VQLA 2XROA 5C3EJ 4HV5A 2DYRH 3RKQA 3BCBA 3UR3C 1QBJA 4FTHA 1LKXA 5E18F 3CUQB 3C1DA 3KP6A 3ZOBA 1VQMI 2JVGA 4OAYA 2D2WA 1LQ1A 4XQFA 2JJ7A 1KU3A 3ZMTA 4DIQA 1R1VA 3WTTC 1UHMA 2HVQA 3EUAA 3LAPA 4I01A 2V9VA 2DCEA 2FSWA 2V1XA 4BHCA 2H6CA 3HOZJ 3FM5A 2K9NA 2V26A 4IHXA 5FO5A 5GP9A 2XIGA 2XUBA 5IPAA 2BHZA 1DP7P 2ECBA 2ACJA 3RZDJ 3F9KA 2DI3A 3K0LA 3PIPF 1TT0A 3H9QA 5L3GA 5H6QA 2W85A 3HYIA 1LVAA 1JTXA 3OYEA 4IJAA 3T8TA 4KMUX 1EKEA 3H9GA 4XM3A 3ZQIA 5DM6F 4PFPA 1ACIA 1VQNI 2HPIA 3DTIA 4RGSA 5DCFA 1D0ZA 4HNUA 2DMUA 2JUCA 1BI0A 1G4DA 3HXLA 4HSRA 2KRCA 5GADJ 5BS6A 4KITB 5DUIA 1W7PA 1QHGA 3MVPA 2IS6A 4A3IJ 5IT9K 2VQHA 3CMEI 2XGEA 4W1UA 2CSOA 4OIOF 2DOAA 1D1CA 3K70C 2OD5A 5HDGA 4B47A 3R0JA 4HF2A 4EV0A 2GXBA 3RKYA 3DV8A 3Q9SA 4M3FA 2EBIA 2F5CA 4IHVA 4JYKA 1GV5A 3Q3SA 2BY2A 2DLLA 3HPHA 4B8XA 4RAZA 4OAZA 2KRFA 3I5UA 1FWZA 2PG4A 2VXZA 1K79A 2XKPA 4M6VA 4ENNA 4CH7A 4A3GJ 2HDCA 4HAMA 1WJCA 3U9GA 2PMZA 3WHCA 1IXSB 2P5KA 3TO6A 4BHBA 4DYRA 2QQAA 3CCQI 2JVHA 3M3YJ 4P9FA 3SZTA 5DCMB 2O61A 5DCMA 4U7DA 2ELJA 1QZZA 4JK1X 1X1AA 2FBKA 1WJDA 3HIFA 3FMRA 3BR2A 3HGGA 3VYSB 4M3EA 2KMUA 2I10A 4Q5SF 2X6XA 4YEJA 4ESFA 2JSPA 3F0CA 1QQIA 3GBGA 3S1MJ 4GYIA 1S7EA 3IRRA 3EDPA 4HZFA 2EINH 1X2NA 1J5YA 3BCAA 3BTIA 2FF4A 4DJAA 1EF4A 4B43A 1MIJA 2IA1A 1BL0A 4L0YB 3NRVA 2XHKA 2KL4A 3JRFA 4XLAA 3EUKL 1I39A 4RBOA 1I5ZA 1K83J 2A6HF 3SDGA 1Z7LA 1HW1A 2Z99A 3SHFA 1U8BA 2VOPA 1YRNB 4CSWA 5F1RA 2YSRA 2VBZA 2DFHA 1QU3A 5HOOA 3JRCA 4BXUA 5H2FC 1BR1A 1QNTA 2X51A 5HS7A 1U3EM 2GOXB 4IOCF 4CUGA 1JUSA 3V8JA 4D1QA 2PJPA 4D7NA 2K27A 1I6XA 1D1AA 4WWCA 2HU9A 1R1UA 1LJ9A 3IAM2 2R7DA 1BOBA 1YTYA 5CYVA 2A5WA 2LY9A 3CC4I 4UUVA 2IGMA 1HW5A 1Y1VJ 2CFXA 3O3KA 4L5EA 4DGWB 3HC7A 2WC2A 4K2EA 1UFMA 2LFBA 3GTMJ 1SD5A 3K6GA 5J3LA 3CF5F 1XC5A 5GPCA 3A0HC 3VFZA 2OQGA 1AA7A 1JUPA 1FLIA 4UUSA 2HDWA 4CCNA 2EFOA 3DKYA 4WXCA 4JP0A 3G3ZA 1YX5A 1WQ2A 2MH2A 3EUHA 3LSTA 3QODA 1S29A 1U9NA 4H4KC 3TO7A 2Y9YA 2R7QA 1BN5A 2EA2A 4GGGA 1FP1D 5DV5A 1SVOA 3S93A 2HKOA 5CQEA 2PI0A 1USSA 1O7FA 2ELKA 3V7CA 1MW7A 3GX4X 2BV6A 1P6RA 2KIMA 3MMYB 5IOZA 3PM1A 3FKJA 3V8KA 1Z0XA 1YE9A 2O6GE 3B02A 3FDYA 1ZYRF 2F4MB 4RLQA 2ZJRF 1FBSA 1OYWA 1PUEE 2RVCA 3BWGA 1SC7A 2NYXA 4HF1A 1BI3A 1U8RA 1VF9A 3FXLA 1SAXA 4BEHA 2E2HJ 3HZJA 3QP6A 4HPQA 2BE5F 4ESBA 3K1MA 1FTTA 4UB6C 4EM2A 2LKXA 2KIQA 1W0TA 2JMWA 5IOYA 2LK2A 2UUZA 4N0BA 1CF7B 2K9SA 2MA3A 3J7AO 3JAMZ 1HSJA 4X0GA 4F93B 2M45A 1I50J 1EV7A 2HTJA 2RN7A 2VC0A 1V4RA 5HLIA 3I56I 2IBDA 2IXSA 4KFCA 2CUFA 2EV0A 2CV0A 1YO5C 1MMDA 2VKHA 1M1EB 2CUZA 1X4PA 2HFHA 1K61A 2ZMEA 1B72A 1OMIA 4BBSJ 5FRMA 2ZMEB 1B72B 3WGIA 3Q9VA 4G6DA 4XLEA 3BTLA 4M3BA 3ZMZA 1QRYA 4BQNA 4I6ZA 1TW2A 3L7WA 2NXNB 4IPAA 1SMYF 1BM9A 2CW0F 4PJJA 4L18B 3LSHA 1VQ4I 1U6GA 1OCPA 1RKTA 3RPQA 5C44J 2OU2A 3AKZA 2H1LA 1JTYA 3S1QJ 2O7OA 1R6RA 2QYOA 2EWNA 4UB8C 2ZMEC 3S2WA 4XSZF 2IS2A 3VYTB 2DOEA 2F4IA 2HYGD 4O5VA 2EIJH 4U0YA 2PLYA 2MC3A 2E2IJ 5C4XJ 1WJ5A 3H3VK 2BEOA 3QPHA 3OIPA 2E34A 4ZDLA 4YIIA 4B4CA 3LSKA 2W24A 3KCCA 1POGA 2ZO4A 4KUMA 3LAJA 2VC1A 4XIDA 1VTNC 1XN7A 2ELHA 2XV4S 3AAFA 3JR9A 3FIWA 2O5RA 3BLYA 4QLCU 1IC8A 4RM3A 2LREA 3ZQLA 3GZ5A 1MBFA 2CU7A 2CUEA 1ZG3A 4LJZF 3L2WA 3LWFA 1QPIA 1MNDA 1HA8A 4FE7A 4BE2A 4RB3C 2DXIA 3WGHA 3PJRA 4DOZA 4HDVA 4HX7A 2DK8A 3MQ0A 1KONA 4F3QA 4EJTA 3BDDA 2LBFB 2L7FP 4GXOA 3Q0UA 3SFZA 1MJAA 4ANJA 2QEXI 2H8RA 3GTOJ 3KP4A 1IDZA 5ICGA 4A3MJ 1ZRFA 1A35A 2L7KA 4L9VA 3O2PE 5FRNA 2LMDA 4BE0A 1IUYA 2IVMA 2MYSA 1ERDA 4RGXA 2QM3A 3VSKA 2X85A 3C2BA 2L0KA 1W36D 1GVJA 3ZMDA 4KYWA 1YI2I 3LQRA 5LD2C 3TL4X 3JAMK 3GTPJ 3GFLA 3L2VA 1S7OA 4D5CA 3UNGC 3HRSA 2IAIA 3RKWA 2FQ3A 3VOEA 4BE1A 1YYVA 5F0CA 1S72I 3IHUA 4A12A 1QGPA 4MGRA 3E6CC 2DU9A 1GUUA 4C3HJ 1TQMA 3H3ZA 3NWSA 5IT3A 3FXMA 4BGDA 2QSFX 3AL0B 2FUG2 1B1BA 2CQXA 2A6EF 3LL7A 4D7MA 4ZYEA 3N97A 1B4AA 2CQ7A 4UUTA 3IV5A 2FEZA 3ML6A 4G7OF 5E8IA 4XL9A 3U1KA 5M5YJ 1R1TA 4XKCA 4F55A 5DUKA 3QWLA 1FOYA 3VYUB 2W57A 2P6SA 2JA5J 5E17F 2IPQX 3I59B 1MDMA 1U5TA 2B63J 1HOMA 2L02A 4V2GA 3IAS2 1ENHA 1PVEA 4GFBA 3LA2A 2Z2SB 3AL0C 2L54A 2MFZA 3OOPA 2XRLA 2UWMA 4FHTA 4CO8A 1W0UA 3BZ6A 2I8DA 3WU0A 3A2KA 1FEXA 3K4KA 1K6YA 3G1OA 4N4OB 1DGWY 2GBYA 1ORKA 2IP2A 1S7AA 1A6IA 5GTIC 5DDGA 3C2GA 4PJMA 2PMUA 5LEKA 5KVRA 5KNLA 1O4XA 1X1BA 2ESNA 1NHAA 2M87A 3EQLF 4HQMA 1RIOH 2IA0A 1W5SA 5B66C 1TNSA 3RYPA 3M1CA 2DA4A 3F22A 3MFKA 5FKOA 2V6CA 4BQAA 1OYIA 1OISA 1W5TA 2WB1A 4LLGF 4L5JA 1O3QA 5M3FJ 1IN7A 3DBLB 1LDJA 1VQOI 4TV7A 4AVZA 5FGMA 3J7ZI 1V5GA 5B3SH 4BYYA 1F43A 4FCYA 4BEHB 3H0GJ 2P4WA 2X1EA 4UVBA 5TGTA 1HKQA 2KIUA 2JN6A 3CMAI 2NS8A 1X58A 2HI3A 4XR6A 2PJRB 2LP0A 1WSUA 5LGTA 2MC4A 1DUXC 2COBA 4E7JA 4BUPA 2FXAA 2EZLA 2JTVA 2GQQA 3KP3A 1FSEA 1Z05A 1VQ8I 5K7HA 4KT5C 4Y15A 1OCCH 1K6OA 4AYBN 1OKRA 4BU2A 5EZHA 4IF4A 1SFKA 4BQOA 1WPKA 5CPRB 1S6LA 3WU2C 3CCUI 4RM2A 3BY6A 5DEQA 1PP8F 1G3YA 5CLSA 3CC2I 4D5FA 2NVYJ 4XKBA 2ZFWA 3QOPA 1UZCA 5FKKA 4ASNA 3I55I 1X3WB 2ZKZA 2ME6A 3RSNA 3E97A 4ZJZA 4IO9F 2WAQN 3CO7C 1Y39A 1AKHA 2LSOA 2VKDA 3GCMA 1GXQA 1E0EA 3FX3A 4JBAA 4Q4ZF 4KNYA 3M8EA 4NDLA 1KQ8A 3JSPA 3FWEA 4JQFA 2GXGA 5DD4A 3FXRA 2GIVA 1HDPA 2L9VA 2X0LA 1SD6A 4XONA 3IH3A 5LFAA 2XGDA 1T6SA 3A03A 1ZELA 1J9IA 2BBYA 2X6YA 4BBRJ 4IRIA 2IGKA 2LKPA 1FJLA 1REPC 4EM0B 3L2UA 3LQQA 2YPRA 3T8RA 5BPDA 3A01B 2GA2A 2Z9OA 4L0ZB 2E19A 2XDVA 5J4YA 1IXCA 1XSXA 3FXOA 5EGOB 4ESJA 4XK4A 3BG9A 3QP5A 1R23A 2VONA 5DD8A 1VZ0A 3CP2A 2DO7A 3G71I 1VQ9I 1WVRA 4XORA 5JR3A 2FOKA 1LUJB 5HS9A 2MH9A 3MAJA 1ZREA 3CDLA 1FY7A 3UKGA 3U1DA 2EFNA 4R1HA 2X48A 3GUDA 2LNBA 2VE8A 1ETOA 1HKTA 1P2FA 2R3SA 1W7PB 2QENA 2RGVA 3CJRB 3E6MA 5D5VB 2IS1A 2LBFA 1Z6RA 3HOUJ 2CS3A 3K4LA 2DA2A 2HEOA 1A6QA 3KEYA 3DU5A 2VBWA 2FE3A 3OYFA 1ZG1A 2ICWG 1TNTA 1D8KA 3CQZJ 3QRFF 3HUGB 5FKNA 5F04A 3JRIA 1UELB 4G7HF 3VSLA 1MH4A 2IA2A 1IG7A 4ON0A 1HQCA 3G2BA 5HS8A 2E2JJ 1JKOC 1ZR4A 1BA5A 5B5EC 2COMA 4I02A 3JTGA 1PUFA 2PN6A 3JREA 4KIBA 2A61A 4A2UA 1GHCA 3FISA 3DP7A 1UAAA 3OYDA 2K5CA 3WHBA 2VT2A 1PDNC 1ETWA 1H8AC 2LYCA 1K7AA 2X1DA 3LSJA 3HOYJ 2A6TA 2H1KA 2UV1A 4XOTA 3J81K 1OCRH 1CGPA 2NS0A 1JKRC 4BH9A 4KMFA 4BNCA 3C18A 5EF6A 2R5ZA 1Y56A 2TDXA 1ZGAA 1RETA 2M0MA 1ZLKA 3U21A 4DYQA 1FT9A 3L2RA 1FIPA 2W48A 4XN0A 2E60A 2KQRA 3D5SC 3H9JA 3DEEA 3F3XA 2XAGA 5K5OA 1JJ8C 3ZQGA 3GFMA 4WCGA 3W2VA 2E36A 4A93J 2NVTJ 3QPLA 4JX6A 4HQEA 1MMGA 4II2A 1A36A 4QWQA 2GZWA 2V9KA 2DJNA 5FKMA 2G7UA 1XCVA 2K3PA 1XDSA 3G4SI 1R5ID 2OAZA 4YIFA 4QTRA 5BPIA 1J75A 3BT9A 4A0ZA 1T38A 2V79A 1RR7A 1I27A 2DTZA 2BYVE 2B7EA 1BI1A 5FLXZ 2DQRA 3FKIJ 2NVUB 1A04A 4G6TB 2LY2A 3R4KA 1FC3A 3RCOA 5J4VA 3RZOJ 2AQFA 4ZYDA 1BJAA 1MH3A 2IW5A 4CYCA 1XB4A 1ONVA 2ZB9A 5CJ9A 1H9GA 4KDPA 2QVOA 4HLXA 4XSXF 2Z1DA 4P96A 3S1NJ 3I4NJ 3DBHB 2QBYA 2VPRA 3QU3A 3J81Z 3DPUA 1I3QJ 4IL6C 3CLQA 5J40A 5K7FA 4C2UA 1ZRDA 2WA0A 1U9OA 4XLCA 4NC8A 1RPWA 3L9FA 1IN6A 2A3SA 2XASA 2HR3A 4IRGA 1UB9A 5ILUA 3WE2A 2LC2A 3HBLA 1YS6A 3ZGKA 4CA0A 1EJ9A 2G7HA 1U5TB 4XLFA 1LDDA 1OLTA 4ZDPA 4I09A 4HBLA 4Y3OA 3QU6A 4IX7A 2LVSA 2BVMA 2JWTA 3V42A 4DBQA 5ICEA 1E3HA 3DKXA 4EJWA 3TMOA 1ZGJA 4UUSB 4S04A 1T33A 2VUMJ 1WJAA 5HODA 2QA4I 3I71A 2YX4A 2D45A 3DTKA 1J09A 1ZG5A 5E1ZB 5EEHA 3IWFA 1FX7A 2KISA 1T2KA 1JGSA 4II3A 1JGGA 4MTDA 3A4CA 3GMEA 4RAGA 2JA6J 4FX0A 1OCOH 3RJPA 2JT1A 2LR8A 1ON1A 5CVRA 1E3OC 4MQVA 5H6RA 5D6EA 3K7AJ 3ISPA 3VODA 1H89C 2VQCA 2XPWA 3J80Z 4IHTA 3PNTA 5CVUA 5E20A 3W6JB 3S3NA 1D3YA 4HOBA 3AG4H 5FLMJ 2PQ8A 4MFDA 4ZTFA 3S3OA 3JW4A 4EM1A 2TRTA 5LEJA 4XBFA 1S3JA 1SVLA 4IEJA 3CESA 1T0FA 1VQKI 1TQIA 4EJVA 4A5MA 3L09A 2Z33A 1P9QC 3H5AA 4U0WA 3RKXA 1E3PA 2CQQA 4FASD 1EA3A 4FQGA 1HBXG 3PNYA 2E7XA 5IP9J 3X2QH 2GXAA 4ENJA 5E3OA 2DA1A 2DA6A 2M5WA 2VLAA 4KA4A 1LFBA 2R4GA 1WJEA 3ERED 1VQLI 3OL3A 4B09A 3CCVI 2F48A 4C30A 4Y17A 4RGUA 3OYAA 3DTEA 3IH4A 3H5RA 2H6BA 2OUMA 3OYNA 3QAHA 2ID3A 3MD2A 4MEYF 4A3LJ 1OR7A 3Q0VA 3V8LA 4KN7X 1DGRM 3ROUA 4XKVA 1VQ6I 4PJNA 1HXDA 1WZ2A 3GW2A 4ZZLA 5BMZA 3B6AA 4RS8A 2MLGA 3HOSA 2A5YB 4M74A 2FQ4A 3F8CA 1IZ1A 2K9LA 2V1DA 1ZH5A 2XPVA 2CW7A 4NHJA 2M34A 3TGNA 3DFGA 1MZBA 1WH5A 3RI4A 4HV6A 2VT3A 3PSFA 4AD9A 1DQUA 5J1UA 1G59A 3OYJA 3COAC 1MD0A 1MJ9A 1G8XA 2WBMA 3O6BB 2P6TA 3A0BC 2KP6A 2XC7A 1OQYA 4WK8F 1T0FC 4L9TA 1P7IA 2OZUA 1Z9CA 3CD6I 4G8XA 3HDDA 1JT6A 2QGUA 2E5NA 3CDHA 1DPUA 1AWCA 1PUFB 4OU0A 4PDKA 4RGRA 3WTXC 2QSHX 3CDIA 2K7LA 3OYKA 1NK3P 2QZ8A 2A05A 2OTLI 2L5QA 2AQEA 3PL8A 1CF7A 3G6EI 1ZAOA 1IV6A 5IP7J 5D8LB 2DFEA 3BR3A 3FK7A 4MNUA 4FISA 3VB2A 3ULQB 3H36A 1BBYA 3SYTA 2P7CB 2M4GA 4YG2F 4O3MA 2ZNYA 1MNEA 1T8IA 3W3CA 1Z67A 4AIJA 3CCYA 3BQYA 3LA7A 3KEQA 1Z77A 2FMYA 4V2FA 4UXNA 1R00A 4MIMA 1IGNA 3WTWC 2NNNA 4UV8A 1R5GA 1YQAA 2DPUA 2CMPA 2XAJA 2OCEA 1VNDA 2RREA 4EVIA 2R92J 1DU6A 3BOQA 1BW6A 4Y33A 1QZEA 3QPSA 3R0AA 2LLKA 5KHDA 3OYGA 2H94A 3GVAA 2ZBKA 3E6DA 4OOIA 2VJIA 3F8NA 1YJNI 2M7AA 2LG4A 2M30A 4DYCA 2CV2A 4BXFA 1B59A 5GAGJ 1J0RA 3DEWA 2Y31A 2ZNZA 5J1RA 1I3AA 1Y8QB 2A68F 3TW7A 2IEKA 1YS7A 4X1EA 4OIQF 4HF0A 3K2AA 1TTYA 4PSWA 4CYCB 3G73A 4HG2A 3WTYC 2L9SA 4FE4A 5E3LA 2EFWA 1LNWA 3SQNA 1Z21A 4EJUA 3WG7H 3P9CA 3M8FA 4O6JA 2K40A 2DPDA 3LFKA 1XSVA 3G1LA 3H1CA 5JVGF 4C2TA 4EMSA 2E1NA 3DF8A 5LRSA 4OIRF 5L3FA 2O8XA 3MKWB 3E1SA 2VB6A 3KETA 1N77A 1NK2P 3K1PA 4ZDOA 1H0MA 3TDZC 1EH8A 3ABLH 4M9ZA 2XGCA 3P7NA 1V3FA 3JSOA 1F4KA 1ZKGA 3F6VA 4LOCA 4HNVA 2M3AA 5HNFA 2F4OB 1OYYA 1SFEA 3TOBA 1MBEA 2BW3B 2QWWA 2JSCA 3RYRA 4U7BA 3WTVC 3EUHC 4LGWA 1TLHB 5A2QK 3R60A 2JA2A 2HS5A 2EFQA 3G1MA 2UXXA 5ICFA 2KLOA 4AU7A 3OS1A 3ZQFA 4N9IA 2G9WA 2IGOA 3CCRI 2EJRA 1HLVA 2DA7A 2MD0A 3W6KB 4A6DA 3HL2A 1TT5B 4A3FJ 3HM5A 4RMNA 2AXLA 3LSRA 1YOVB 2STTA 2DMPA 5IY5H 4AWXB 2RV8A 2EILH 3C7JA 1IAWA 1YW7A 2W7NA 1WI3A 5L3CA 1EH6A 1RZ4A 3IRQA 1U5TC 2DQLA 2M8GX 2QLZA 3ASNH 3MN2A 4M73A 3HKZN 4DNCA 2X6WA 4Z6YA 3LNQA 1JXSA 1KYWA 4ZH4F 2GM4A 5J6XA 2O8KA 1BJZA 3S14J 1OCTC 1D1BA 2VJJA 3HJEA 2R5ZB 2ID6A 4E7IA 2RQPA 2DT7B 3CJQB 3GO5A 1UHWA 5JFRA 1QVTA 4HEA2 3I9V2 1K78B 3P9KA 4HNTA 1U78A 2BY1A 1BR2A 2P5LC 2KRHA 1IXRC 1MBKA 4GYGA 5EGOA 4DZPA 4EATA 2R5YB 1JHFA 2VBXA 3S1RJ 4XMYA 2STWA 2I5UA 4ZC3A 3WODF 2MLKA 3ZQCA 1RUNA 4UVAA 1ZQ3P 3M9AA 1BI2A 1G2HA 3KYLA 2XAUA 2O3FA 2Z16A 2Y0MA 3HKZA 5H20A 1WFXA 3FHZA 3FXKA 3ZPLA 1X3ZB 3S17J 1D8JA 2DK5A 4LIUA 3ZMSA 4LFUA 2L4MA 2QQ9A 4F91B 4ENKA 9ANTA 2EZKA 3V7RA 1IW7F 1MBJA 5LGNA 3NQOA 3REOA 1OR7C 1W36C 2E35A 3WGGA 1X2MA 3W6VA 1D0XA 5F0HA 2L7ZA 1WJFA 2R7UA 1F5TA 2P81A 4M3DA 4B1RA 5AIQA 2WV1A 2QQ8A 2IRFG 4A3CJ 3M4OJ 2HXOA 1GDTA 2MBFA 2XB5A 4BJTA 4XN3A 4MLOA 3PO2J 1X4OA 3PFYA 1T08B 2FU4A 1MMAA 3FMSA 3Q0WA 1SANA 1XMXA 4F7ZA 4Z2YA 1D0YA 2HXIA 3K9TA 3OOUA 1YITI 3B6CA 5F08A 3LOCA 4ETSA 2CQNA 2CW8A 3ZQ7A 1XG1A 2JRMA 4BXXJ 2R7VA 3AFHA 2KJCA 4UHTA 1NG6A 2O0YA 2OTJI 1T56A 1P7JA 3L2CA 4A3JJ 1ZARA 1FYMA 1ITYA 5D4SA 2M1BA 2FRHA 3ECOA 1SFXA 4HW0A 3S16J 1KQ0A 1Y6IA 1TC3C 3KX2A 4XLPF 3I4PA 3S32A 5GAEJ 2VI6A 2X9DA 1FOKA 2E7WA 3ZN0A 2MD5A 3ZXSA 1W1WE 1XS9A 3JCUC 5D6FA 2PFBA 1YJ9I 1W5CC 1ETKA 2HZDA 1RESA 5F1JA 2HPMA 4LMYA 2EPFA 3BTCA 6PAXA 4ZTJA 1WI9A 3PQJA 3K69A 4IVNA 2KFDA 3BG3A 1LDKB 4IHWA 1FBUA 5IYCJ 1KA8A 1RUOA 3ELKA 3DBRB 4OWRB 3WTUC 1YIOA 2FD5A 1F36A 2M0CA 3E5XA 3GF2A 2M8EA 3HOVJ 1G3SA 5CVIA 3H92A 4B44A 2DW4A 2PJRA 4LK1F 1S8NA 4MTEA 3HSRA 4PGGA 4WXDA 2RDPA 3ABMH 3BPVA 4J19A 4HLYA 1YLFA 4U88A 1JT0A 2D1HA 2EH3A 3CJTB 5ILSA 3KZIC 4OMYA 1MMSA 2WWYA 3S8PA 3KZYA 4L5IA 1X19A 2K9MA 5DTDA 3R6SA 3F8FA 3D1NI 1FYKA 1TW3A 5CKTA 3CCLI 3L1PA 3SZGA 1N75A 3GTJJ 3E5UA 5LRRA 2IGNA 3HHHA 2WAEA 1V55H 3LSGA 2BOLA 2HTSA 3V4GA 4M3GA 4D9JA 5DM7F 3CCEI 4BJ5C 1TWFJ 1VI0A 3ABTA 3EPZA 3LSIA 5ICCA 3HTUA 2M4KA 2OPTA 4H0EA 2HQRA 1QPMA 1V54H 4W97A 2R7XA 3NWTA 2FNAA 1V5FA 1IRXA 1IJWC 3BJ6A 3CUQA 3CF2A 3JRAA 1SEUA 3K1NA 4JOMA 1TP4A 3E6BA 2XF7A 1R36A 1IRGA 3BJOA 2FOWA 3TDUC 5BNGA 5L3BA 1FP2A 2QSGX 2G0EA 1NG7A 3FXQA 1MSEC 2YS9A 4NUBA 2DMTA 3A1YA 4FETA 4LB6B 4HDUA 3VEPA 1VQ5I 1EH7A 4IHSA 1IN5A 3DPTA 1MBHA 1YIJI 4N9HA 4M71A 4A5NA 3BP8A 1QVUA 1I6HJ 1XTAA 4L9NA 5EEGA 2MABA 2O03A 2RC4A 2YU3A 3GLXA 1FNNA 3I64A 4NBQA 3HB9A 4RB0A 2HOEA 1J59A 3ASOH 3BJAA 3CJNA 3OYIA 4XKWA 1IO2A 4CICA 4KIGA 3TP0A 4GRIA 2ZC2A 3ECHA 1N25A 3KZZA 5F27A 2NNYA 1T39A 2B0LA 5KAFC 2E1CA 2EV5A 2ZXWH 1HKSA 3AG1H 3ZR8X 5GTHC 2F5DA 4BKXA 3MWMA 5D5WB 4E7LA 2OBPA 5F0FA 1WGXA 4CXFA 1BW5A 2AHQA 5FD6A 2XAHA 1B6AA 4ZYHA 4BY1J 1UCRA 3OL4A 3RTRA 2AS5F 2NS7A 1ODDA 2K02A 1Y0NA 4G9YA 3WTSC 2JPCA 3JRBA 4C3JJ 2R7FA 1XMKA 1H88C 4UY8I 2Y30A 3ZP5A 2H27A 4XRSG 1Y1WJ 5DYMA 4BL0B 2JA8J 3BR5A 1MGTA 5IYBJ 4A0XA 4HRIA 2BXYA 2FBIA 1ETXA 4AM3A 1TWCJ 3QQAA 3S2HJ 1SFUA 4XOPA 4P5OA 2HZTA 1DPRA 3GXOA 1KU7A 1GT0C 3PO3J 2V9PA 2BXZA 5EDNA 3CZ6A 3BTJA 1LEAA 1P4AA 3CMMA 3KE2A 1OJLA 4IOAF 2JQ7A 2V6EA 3H5NA 2RQQA 1GLNA 3OIOA 1GVDA 1HCRA 1P4WA 4E4HA 5L3DA 3K2ZA 3A02A 1XGOA 1T95A 4BDZA 4ENMA 1R71A 2Y75A 4PK4A 3ZMVA 1B8IB 1MMNA 4U87A 3GFIA 1UG2A 2GA1A 2X1CA 4I2OA 2Z5UA 2P0WA 3FM3A 2FMLA 4CCOA 2F5FA 1C0WA 3OY9A 3S3MA 5C4JJ 2K86A 2J5OA 3KPHA 2DDAA 3HSEA 1A31A 2AO9A 5E1WA 2M2EA 3E0JB 4BACA 1O3RA 4M6XA 2L9RA 3BZCA 2EV6A 3ZQHA 4IRHA 1J7KA 4PSXA 3D5LA 3TO9A
chains in the Genus database with same CATH topology
5LBQA 1H9TA 2CGPA 4R79A 1W7PD 2RNJA 1G6NA 5FFXA 2OA4A 3I53A 1ZHFA 2WV0A 3MZHA 3KLNA 1XGNA 1YW9A 4GCVA 1R5HA 1P92A 1ON2A 4LB5A 2PMHA 3HHGA 1F9NA 1P4XA 3OV8A 4CGZA 2YX7A 3WG9A 5BQTA 5L3EA 1R7JA 2K4BA 2UZKA 4A6EA 3GYHX 4I0AA 2ZJ2A 1D5VA 2A69F 1BOAA 3T1BA 2JZYA 1Z91A 4A0YA 4I0BA 4M9XA 4IXAA 4D0PA 3CTAA 4MEXF 3DEUA 4XLNF 2L01A 1XGMA 1RNLA 1AOYA 4I7HA 1XCBA 2PBIA 5F6FA 1JE8A 1R22A 4I98B 4WXHA 2XKOA 4R8HA 4NQWA 2FNPA 2J5PA 1MKMA 2EB7A 1DDNA 5LHIA 2ZXJA 2VN2A 2C6YA 2YR2A 2DT5A 1KQ9A 4YFXF 1B9MA 3LA3A 4KN4X 1L3LA 1FYLA 4KIFA 5K5RA 3KLOA 2IJLA 3IL2A 4NB5A 5JI6A 2DAOA 3JTHA 1KGSA 3GFJA 3IC7A 1BIAA 4BAYA 5J8CA 1I1SA 3I54A 3F23A 4G6QA 3TQNA 3QPTA 5HDNA 1R58A 3FZVA 2CQKA 5HVQC 3P9IA 1L0OC 3BPXA 1KYZA 4CHUA 3F72A 1G3WA 1XSDA 2WTEA 4Q48A 3KEOA 3T5XA 1T98A 2HYFA 4HX8A 1IN8A 3HOTA 2D1VA 2CO5A 5F64A 5JHUA 1TBXA 4UV9A 2Y48A 3N4MA 2IT0A 1QZYA 5J8FA 2EK5A 2QBYB 2P8TA 1ZLJA 3ZN1A 1ULYA 1B9NA 4RB2C 3IKTA 4EGYA 1IN4A 3Q5FA 2VODA 2JPBA 1RI7A 3V7SA 3D0SA 1FZPB 4EQQA 5TJJA 3E3VA 5CVJA 1YFHA 2L4AA 2XAQA 2L3DA 4LG0B 3WTZA 5K5QA 2ISYA 4ZYGA 1OPCA 1Y0UA 3FXUA 2HWVA 2KKOA 4UNOA 3F6OA 3HRUA 2ISZA 4LLNA 3B73A 5FFZA 2XAFA 3IKVA 5AIPA 2CYYA 1Q1HA 4M6YA 5LLQA 4HYEA 4RAYA 1W4MA 3RIRA 1LB2A 2GAUA 2KJBA 5D8KB 1XMAA 1USTA 1IF1A 4G7ZF 4LD5A 1F1ZA 4G94A 5HLHA 2RKHA 3KP2A 1WWXA 2KIFA 1SD7A 2LF7A 1LEBA 3RPUA 3ZMUA 2H09A 4CDGA 4LLLA 4OINF 2Z3YA 5A2QZ 1TQPA 5E1XA 5IT9Z 1STZA 1WRJA 3WE3A 3PFIA 1QO0D 1BC7C 3NEUA 4AIHA 3L00A 5FB2A 5D5XB 3MZYA 3HRMA 2ETHA 1ZN2A 1SMTA 2FA5A 2HQNA 3I58A 3KFWX 4EJOA 2OQRA 4M72A 3CUOA 3KP5A 1HW2A 2Q8KA 2Q0OA 1SD4A 1O57A 2EFPA 3DQVC 1ZRCA 1YG2A 3GEZA 4PGHA 1BIBA 1U2WA 1JHHA 1E17A 3SZPA 3SXYA 2ZCWA 2XRNA 1O3TA 3F8BA 5E8GA 5ILVA 3MEXA 3HUGA 1YW8A 1FSHA 3TOAA 3CO6C 2F2EA 5CVVA 3MCZA 2GWRA 1X3UA 4WF2A 1HSTA 4AIKA 2DTRA 4L9JA 3DKWA 3PQKA 2F5EA 5HLGA 1Z7UA 5KK1A 3I59A 1MDMB 2QUFA 4RB1A 4OIPF 2X4HA 4LG0A 2V1UA 4DQ2A 1O3SA 5K1YA 4GO1A 2VOOA 3F21A 3J80K 3E5QA 4MQ9F 3HSFA 1XDUA 2QQBA 5BOXA 5D4RA 2A07F 3F8MA 4CZZA 3I0TA 2PEXA 1FPQA 1MJBA 1IRFA 5ERIA 3DXJF 2HGCA 4AVPA 4FT8A 1J2XA 2NAZA 5TRDA 4M9SA 2FBHA 4YFNF 2JRTA 1E2XA 2XVCA 2CG4A 4MHGA 2CWEA 4YFKF 4OMZA 4S05A 1WKMA 2OZ6A 1Z6TA 3C3WA 1GXPA 3IWZA 3U2RA 3EYIA 4E70A 2K4JA 4KICA 1K78A 3GZ6A 2LDUA 5FD5A 4FX4A 5AONA 2EA4A 3FMQA 3HRTA 3BROA 2UXNA 2W84A 3M1EA 4UVCA 3M7GA 1BC8C 5ED4A 4HA8A 4P9UA 4ZZDA 5JVTA 3FF5A 1XD7A 2ADUA 1XGSA 2VE9A 3KP7A 4PCQA 2XGXA 3ABUA 1G3TA 3EETA 3TKYA 4U0VA 1I1GA 2DBBA 5HDKA 1KU2A 2ESHA 3WU1B 3R61A 3CLOA 3HTSB 2W25A 3T0YA 5LHHA 1KU9A 2BGCA 5D5UB 5FLXK 3H3UA 3GWZA 4CYDA 4EGZA 2P7VB 4WX9A 4HX4A 4XRFA 2NRAC 3EYYA 4PZJA 5LHGA 2LF8A 2HKXA 4Q47A 2VBYA 3CUQC 1Z1DA 2Q2EA 5LGUA 3RDIA 4P55A 4LK0F 1PP7U 2DFIA 1FBQA 3DPLC 4BHPA 1O7LA 4Y13A 2P5VA 2XROA 4HV5A 1QBJA 5E18F 3CUQB 3C1DA 3KP6A 2D2WA 1LQ1A 3ZMTA 1KU3A 1R1VA 3WTTC 1UHMA 3LAPA 4I01A 2V9VA 2FSWA 2V1XA 4BHCA 2H6CA 3FM5A 5FO5A 2XIGA 2XUBA 1DP7P 2ACJA 2DI3A 3K0LA 5L3GA 5H6QA 2W85A 3HYIA 1LVAA 4IJAA 3T8TA 4KMUX 5DCFA 4RGSA 1BI0A 1G4DA 5BS6A 5DUIA 1W7PA 5IT9K 2CSOA 4OIOF 2OD5A 5HDGA 3R0JA 4HF2A 4EV0A 2GXBA 3RKYA 3DV8A 3Q9SA 2F5CA 2DLLA 4B8XA 4RAZA 2KRFA 3I5UA 1FWZA 2PG4A 2VXZA 1K79A 2XKPA 4ENNA 2HDCA 4HAMA 3U9GA 1IXSB 2P5KA 3TO6A 4BHBA 2QQAA 4P9FA 3SZTA 5DCMB 2O61A 5DCMA 4U7DA 1QZZA 4JK1X 2FBKA 3HIFA 3FMRA 4Q5SF 4ESFA 1QQIA 4GYIA 3IRRA 3EDPA 4HZFA 1J5YA 2FF4A 2IA1A 4L0YB 3NRVA 2XHKA 1I5ZA 2A6HF 3SHFA 2Z99A 1HW1A 2VOPA 5F1RA 2YSRA 2VBZA 5HOOA 4BXUA 1QNTA 5HS7A 1U3EM 3V8JA 2PJPA 2K27A 1I6XA 4WWCA 1R1UA 1LJ9A 2R7DA 1YTYA 5CYVA 4UUVA 1HW5A 2CFXA 3O3KA 2WC2A 4K2EA 1UFMA 1SD5A 3VFZA 2OQGA 1FLIA 2EFOA 4WXCA 3G3ZA 1WQ2A 2MH2A 3EUHA 3LSTA 1S29A 3TO7A 1BN5A 2EA2A 4GGGA 1FP1D 5DV5A 2HKOA 2PI0A 1USSA 1O7FA 3V7CA 3GX4X 2BV6A 1P6RA 2KIMA 3V8KA 2O6GE 3B02A 1ZYRF 1PUEE 1FBSA 1OYWA 2RVCA 3BWGA 2NYXA 4HF1A 1BI3A 1U8RA 1SAXA 3QP6A 2BE5F 4ESBA 3K1MA 4EM2A 4N0BA 1CF7B 2MA3A 3J7AO 3JAMZ 1HSJA 2M45A 2VC0A 1EV7A 2HTJA 2RN7A 5HLIA 1V4RA 4KFCA 2EV0A 1YO5C 2HFHA 2ZMEA 1OMIA 2ZMEB 3WGIA 3Q9VA 4G6DA 3ZMZA 1TW2A 3L7WA 4IPAA 1SMYF 1BM9A 2CW0F 4L18B 1U6GA 3RPQA 2OU2A 2QYOA 2EWNA 3S2WA 4XSZF 2HYGD 4O5VA 4U0YA 2PLYA 2MC3A 2BEOA 3QPHA 4YIIA 2W24A 3KCCA 2ZO4A 3LAJA 4KUMA 2VC1A 1VTNC 1XN7A 2ELHA 2XV4S 3AAFA 4QLCU 3GZ5A 4LJZF 1ZG3A 3LWFA 4RB3C 3WGHA 4HDVA 4HX7A 2DK8A 3MQ0A 4EJTA 3BDDA 4GXOA 3SFZA 1MJAA 3KP4A 5ICGA 1ZRFA 4L9VA 3O2PE 1IUYA 2IVMA 4RGXA 2QM3A 1GVJA 3ZMDA 4KYWA 3LQRA 3JAMK 3GFLA 1S7OA 3HRSA 3RKWA 2FQ3A 3VOEA 1YYVA 3IHUA 4A12A 1QGPA 4MGRA 3E6CC 2DU9A 1TQMA 3H3ZA 5IT3A 1B1BA 2A6EF 4ZYEA 3N97A 1B4AA 2FEZA 3ML6A 4G7OF 5E8IA 1R1TA 5DUKA 2W57A 2P6SA 5E17F 2IPQX 3I59B 1MDMA 1U5TA 2L02A 3LA2A 2L54A 3OOPA 2UWMA 4FHTA 4CO8A 3BZ6A 3WU0A 2IP2A 1S7AA 5DDGA 2PMUA 5LEKA 5KVRA 2ESNA 1NHAA 2M87A 3EQLF 4HQMA 1RIOH 2IA0A 1W5SA 1TNSA 3RYPA 3F22A 3MFKA 2V6CA 4BQAA 1OYIA 1W5TA 4LLGF 4L5JA 1O3QA 1IN7A 1LDJA 4TV7A 5FGMA 4BYYA 2P4WA 4UVBA 1HKQA 2KIUA 1WSUA 5LGTA 1DUXC 2FXAA 2JTVA 2GQQA 3KP3A 1FSEA 1Z05A 4KT5C 4Y15A 1K6OA 1OKRA 4IF4A 1S6LA 3BY6A 5DEQA 1PP8F 1G3YA 5CLSA 2ZFWA 3QOPA 4ASNA 2ZKZA 3E97A 3CO7C 2LSOA 1GXQA 3FX3A 4JBAA 4Q4ZF 4KNYA 3M8EA 1KQ8A 3JSPA 3FWEA 4JQFA 2GXGA 5DD4A 3FXRA 2GIVA 2X0LA 1SD6A 1T6SA 1J9IA 2BBYA 4IRIA 2LKPA 1REPC 4EM0B 3LQQA 2YPRA 3T8RA 5BPDA 2GA2A 2Z9OA 4L0ZB 1IXCA 1XSXA 4ESJA 3QP5A 1R23A 2VONA 5DD8A 2DO7A 5JR3A 2FOKA 5HS9A 2MH9A 3MAJA 1ZREA 1FY7A 3U1DA 2EFNA 4R1HA 3GUDA 2LNBA 2VE8A 1HKTA 1P2FA 2R3SA 1W7PB 2QENA 2RGVA 3E6MA 5D5VB 1Z6RA 2HEOA 2VBWA 2FE3A 1ZG1A 1TNTA 1D8KA 3QRFF 4G7HF 2IA2A 4ON0A 1HQCA 5HS8A 2COMA 4I02A 3JTGA 2PN6A 4KIBA 2A61A 4A2UA 1GHCA 3DP7A 2VT2A 1PDNC 1K7AA 3J81K 1CGPA 2NS0A 4BH9A 4KMFA 4BNCA 3C18A 2TDXA 1ZGAA 1ZLKA 1FT9A 3F3XA 2XAGA 5K5OA 3GFMA 4WCGA 4HQEA 4QWQA 2GZWA 2G7UA 1XCVA 1XDSA 5BPIA 2OAZA 4YIFA 1J75A 4A0ZA 1T38A 2V79A 1I27A 2BYVE 1BI1A 5FLXZ 2DQRA 1A04A 3R4KA 1FC3A 4ZYDA 1BJAA 2IW5A 1XB4A 1ONVA 5CJ9A 1H9GA 4KDPA 2QVOA 4HLXA 4XSXF 4P96A 2QBYA 3QU3A 3J81Z 1ZRDA 3L9FA 1IN6A 2A3SA 4IRGA 2HR3A 2XASA 1UB9A 5ILUA 3WE2A 1YS6A 2G7HA 1U5TB 1LDDA 4I09A 4HBLA 3QU6A 5ICEA 4EJWA 1ZGJA 4S04A 3I71A 2YX4A 2D45A 1ZG5A 5E1ZB 5EEHA 3IWFA 1FX7A 1T2KA 1JGSA 4MTDA 4FX0A 3RJPA 2JT1A 1ON1A 5CVRA 4MQVA 5H6RA 5D6EA 3VODA 3ISPA 3J80Z 4IHTA 5E20A 5CVUA 3W6JB 1D3YA 4HOBA 2PQ8A 3JW4A 4EM1A 5LEJA 4XBFA 1S3JA 1T0FA 1TQIA 4EJVA 4A5MA 3L09A 2Z33A 4U0WA 3RKXA 1HBXG 2E7XA 4ENJA 2M5WA 4KA4A 3ERED 4B09A 4Y17A 4RGUA 2H6BA 3QAHA 4MEYF 1OR7A 3V8LA 4KN7X 3ROUA 1HXDA 3GW2A 4ZZLA 5BMZA 4RS8A 3HOSA 2MLGA 2A5YB 4M74A 3F8CA 1IZ1A 1ZH5A 2V1DA 4NHJA 3TGNA 3DFGA 1MZBA 3RI4A 4HV6A 2VT3A 4AD9A 3COAC 1MD0A 1MJ9A 3O6BB 2P6TA 4WK8F 4L9TA 2OZUA 1Z9CA 4G8XA 3CDHA 1DPUA 1AWCA 4OU0A 4PDKA 4RGRA 3WTXC 2K7LA 2QZ8A 1CF7A 1ZAOA 5D8LB 4MNUA 3VB2A 3ULQB 2P7CB 1BBYA 4YG2F 4O3MA 2ZNYA 4AIJA 3LA7A 3KEQA 2FMYA 4UXNA 1R00A 3WTWC 2NNNA 4UV8A 1R5GA 1YQAA 2DPUA 2XAJA 4EVIA 3BOQA 3R0AA 2H94A 3GVAA 2ZBKA 3E6DA 4OOIA 3F8NA 2M30A 1B59A 1J0RA 2ZNZA 2A68F 1YS7A 4OIQF 4HF0A 1TTYA 3G73A 3WTYC 2EFWA 1LNWA 3SQNA 4EJUA 3P9CA 3M8FA 4O6JA 2DPDA 3LFKA 1XSVA 4EMSA 2E1NA 3DF8A 5LRSA 4OIRF 5L3FA 2O8XA 3KETA 3K1PA 1H0MA 3TDZC 1EH8A 4M9ZA 3P7NA 1V3FA 3JSOA 1F4KA 3F6VA 1OYYA 1SFEA 3TOBA 2QWWA 2JSCA 3RYRA 4U7BA 3WTVC 4LGWA 1TLHB 5A2QK 3R60A 2HS5A 2EFQA 2UXXA 5ICFA 4N9IA 2G9WA 2EJRA 3W6KB 4A6DA 2AXLA 2STTA 4AWXB 2RV8A 3C7JA 1IAWA 1YW7A 5L3CA 1EH6A 1RZ4A 3IRQA 1U5TC 2DQLA 2QLZA 4M73A 4DNCA 1JXSA 1KYWA 4ZH4F 5J6XA 2RQPA 3GO5A 1UHWA 5JFRA 1K78B 3P9KA 1U78A 2P5LC 1IXRC 4GYGA 1JHFA 2VBXA 2STWA 3WODF 2MLKA 1RUNA 4UVAA 3M9AA 1BI2A 2O3FA 5H20A 2Y0MA 3ZPLA 3FHZA 1D8JA 2DK5A 3ZMSA 4LFUA 2L4MA 2QQ9A 4ENKA 3V7RA 1IW7F 5LGNA 3NQOA 3REOA 3WGGA 1F5TA 5AIQA 2IRFG 2MBFA 2FU4A 3FMSA 4F7ZA 4Z2YA 3K9TA 4ETSA 3ZQ7A 2KJCA 4UHTA 2O0YA 3L2CA 1ZARA 1FYMA 5D4SA 2M1BA 2FRHA 3ECOA 1SFXA 4HW0A 1KQ0A 4XLPF 3I4PA 1FOKA 2E7WA 3ZN0A 2MD5A 5D6FA 2PFBA 4LMYA 6PAXA 1WI9A 3PQJA 3K69A 4IVNA 1LDKB 1FBUA 1KA8A 1RUOA 3ELKA 3WTUC 1YIOA 3E5XA 3GF2A 2M8EA 1G3SA 5CVIA 3H92A 2DW4A 4LK1F 1S8NA 4MTEA 3HSRA 4PGGA 4WXDA 2RDPA 3BPVA 4HLYA 1YLFA 4U88A 2D1HA 5ILSA 4OMYA 2WWYA 3KZYA 4L5IA 3R6SA 3F8FA 1FYKA 1TW3A 3E5UA 5LRRA 3HHHA 2HTSA 3V4GA 3ABTA 5ICCA 3HTUA 4H0EA 2HQRA 1QPMA 2FNAA 3BJ6A 3CUQA 3K1NA 3E6BA 1R36A 1IRGA 3BJOA 3TDUC 5L3BA 1FP2A 3FXQA 4LB6B 4HDUA 3VEPA 1EH7A 4IHSA 1IN5A 3DPTA 4N9HA 4M71A 4A5NA 3BP8A 4L9NA 5EEGA 2O03A 2RC4A 2YU3A 3GLXA 1FNNA 3I64A 4RB0A 2HOEA 1J59A 3BJAA 3CJNA 4CICA 4KIGA 3ECHA 3KZZA 2NNYA 1T39A 2B0LA 2E1CA 2EV5A 1HKSA 2F5DA 3MWMA 5D5WB 2OBPA 4CXFA 5FD6A 2XAHA 1B6AA 4ZYHA 1UCRA 3RTRA 2AS5F 1ODDA 2K02A 4G9YA 3WTSC 2JPCA 2R7FA 1XMKA 3ZP5A 2H27A 5DYMA 1MGTA 4A0XA 2FBIA 1SFUA 4P5OA 2HZTA 1DPRA 3GXOA 1KU7A 1LEAA 1P4AA 3KE2A 1P4WA 5L3DA 3K2ZA 1XGOA 4ENMA 2Y75A 3ZMVA 3GFIA 2GA1A 4I2OA 2Z5UA 2FMLA 3FM3A 1C0WA 2F5FA 2K86A 2J5OA 3HSEA 5E1WA 1O3RA 4M6XA 2EV6A 4IRHA 1J7KA 3D5LA 3TO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LBQ A;  1H9T A;  2CGP A;  4R79 A;  1W7P D;  2RNJ A;  1G6N A;  5FFX A;  2OA4 A;  3I53 A;  1ZHF A;  2WV0 A;  3MZH A;  3KLN A;  1XGN A;  1YW9 A;  4GCV A;  1R5H A;  1P92 A;  1ON2 A;  4LB5 A;  2PMH A;  3HHG A;  1F9N A;  1P4X A;  3OV8 A;  4CGZ A;  2YX7 A;  3WG9 A;  5BQT A;  5L3E A;  1R7J A;  2K4B A;  2UZK A;  4A6E A;  3GYH X;  4I0A A;  2ZJ2 A;  1D5V A;  2A69 F;  1BOA A;  3T1B A;  2JZY A;  1Z91 A;  4A0Y A;  4I0B A;  4M9X A;  4IXA A;  4D0P A;  3CTA A;  4MEX F;  3DEU A;  4XLN F;  2L01 A;  1XGM A;  1RNL A;  1AOY A;  4I7H A;  1XCB A;  2PBI A;  5F6F A;  1JE8 A;  1R22 A;  4I98 B;  4WXH A;  2XKO A;  4R8H A;  4NQW A;  2FNP A;  2J5P A;  1MKM A;  2EB7 A;  1DDN A;  5LHI A;  2ZXJ A;  2VN2 A;  2C6Y A;  2YR2 A;  2DT5 A;  1KQ9 A;  4YFX F;  1B9M A;  3LA3 A;  4KN4 X;  1L3L A;  1FYL A;  4KIF A;  5K5R A;  3KLO A;  2IJL A;  3IL2 A;  4NB5 A;  5JI6 A;  2DAO A;  3JTH A;  1KGS A;  3GFJ A;  3IC7 A;  1BIA A;  4BAY A;  5J8C A;  1I1S A;  3I54 A;  3F23 A;  4G6Q A;  3TQN A;  3QPT A;  5HDN A;  1R58 A;  3FZV A;  2CQK A;  5HVQ C;  3P9I A;  1L0O C;  3BPX A;  1KYZ A;  4CHU A;  3F72 A;  1G3W A;  1XSD A;  2WTE A;  4Q48 A;  3KEO A;  3T5X A;  1T98 A;  2HYF A;  4HX8 A;  1IN8 A;  3HOT A;  2D1V A;  2CO5 A;  5F64 A;  5JHU A;  1TBX A;  4UV9 A;  2Y48 A;  3N4M A;  2IT0 A;  1QZY A;  5J8F A;  2EK5 A;  2QBY B;  2P8T A;  1ZLJ A;  3ZN1 A;  1ULY A;  1B9N A;  4RB2 C;  3IKT A;  4EGY A;  1IN4 A;  3Q5F A;  2VOD A;  2JPB A;  1RI7 A;  3V7S A;  3D0S A;  1FZP B;  4EQQ A;  5TJJ A;  3E3V A;  5CVJ A;  1YFH A;  2L4A A;  2XAQ A;  2L3D A;  4LG0 B;  3WTZ A;  5K5Q A;  2ISY A;  4ZYG A;  1OPC A;  1Y0U A;  3FXU A;  2HWV A;  2KKO A;  4UNO A;  3F6O A;  3HRU A;  2ISZ A;  4LLN A;  3B73 A;  5FFZ A;  2XAF A;  3IKV A;  5AIP A;  2CYY A;  1Q1H A;  4M6Y A;  5LLQ A;  4HYE A;  4RAY A;  1W4M A;  3RIR A;  1LB2 A;  2GAU A;  2KJB A;  5D8K B;  1XMA A;  1UST A;  1IF1 A;  4G7Z F;  4LD5 A;  1F1Z A;  4G94 A;  5HLH A;  2RKH A;  3KP2 A;  1WWX A;  2KIF A;  1SD7 A;  2LF7 A;  1LEB A;  3RPU A;  3ZMU A;  2H09 A;  4CDG A;  4LLL A;  4OIN F;  2Z3Y A;  5A2Q Z;  1TQP A;  5E1X A;  5IT9 Z;  1STZ A;  1WRJ A;  3WE3 A;  3PFI A;  1QO0 D;  1BC7 C;  3NEU A;  4AIH A;  3L00 A;  5FB2 A;  5D5X B;  3MZY A;  3HRM A;  2ETH A;  1ZN2 A;  1SMT A;  2FA5 A;  2HQN A;  3I58 A;  3KFW X;  4EJO A;  2OQR A;  4M72 A;  3CUO A;  3KP5 A;  1HW2 A;  2Q8K A;  2Q0O A;  1SD4 A;  1O57 A;  2EFP A;  3DQV C;  1ZRC A;  1YG2 A;  3GEZ A;  4PGH A;  1BIB A;  1U2W A;  1JHH A;  1E17 A;  3SZP A;  3SXY A;  2ZCW A;  2XRN A;  1O3T A;  3F8B A;  5E8G A;  5ILV A;  3MEX A;  3HUG A;  1YW8 A;  1FSH A;  3TOA A;  3CO6 C;  2F2E A;  5CVV A;  3MCZ A;  2GWR A;  1X3U A;  4WF2 A;  1HST A;  4AIK A;  2DTR A;  4L9J A;  3DKW A;  3PQK A;  2F5E A;  5HLG A;  1Z7U A;  5KK1 A;  3I59 A;  1MDM B;  2QUF A;  4RB1 A;  4OIP F;  2X4H A;  4LG0 A;  2V1U A;  4DQ2 A;  1O3S A;  5K1Y A;  4GO1 A;  2VOO A;  3F21 A;  3J80 K;  3E5Q A;  4MQ9 F;  3HSF A;  1XDU A;  2QQB A;  5BOX A;  5D4R A;  2A07 F;  3F8M A;  4CZZ A;  3I0T A;  2PEX A;  1FPQ A;  1MJB A;  1IRF A;  5ERI A;  3DXJ F;  2HGC A;  4AVP A;  4FT8 A;  1J2X A;  2NAZ A;  5TRD A;  4M9S A;  2FBH A;  4YFN F;  2JRT A;  1E2X A;  2XVC A;  2CG4 A;  4MHG A;  2CWE A;  4YFK F;  4OMZ A;  4S05 A;  1WKM A;  2OZ6 A;  1Z6T A;  3C3W A;  1GXP A;  3IWZ A;  3U2R A;  3EYI A;  4E70 A;  2K4J A;  4KIC A;  1K78 A;  3GZ6 A;  2LDU A;  5FD5 A;  4FX4 A;  5AON A;  2EA4 A;  3FMQ A;  3HRT A;  3BRO A;  2UXN A;  2W84 A;  3M1E A;  4UVC A;  3M7G A;  1BC8 C;  5ED4 A;  4HA8 A;  4P9U A;  4ZZD A;  5JVT A;  3FF5 A;  1XD7 A;  2ADU A;  1XGS A;  2VE9 A;  3KP7 A;  4PCQ A;  2XGX A;  3ABU A;  1G3T A;  3EET A;  3TKY A;  4U0V A;  1I1G A;  2DBB A;  5HDK A;  1KU2 A;  2ESH A;  3WU1 B;  3R61 A;  3CLO A;  3HTS B;  2W25 A;  3T0Y A;  5LHH A;  1KU9 A;  2BGC A;  5D5U B;  5FLX K;  3H3U A;  3GWZ A;  4CYD A;  4EGZ A;  2P7V B;  4WX9 A;  4HX4 A;  4XRF A;  2NRA C;  3EYY A;  4PZJ A;  5LHG A;  2LF8 A;  2HKX A;  4Q47 A;  2VBY A;  3CUQ C;  1Z1D A;  2Q2E A;  5LGU A;  3RDI A;  4P55 A;  4LK0 F;  1PP7 U;  2DFI A;  1FBQ A;  3DPL C;  4BHP A;  1O7L A;  4Y13 A;  2P5V A;  2XRO A;  4HV5 A;  1QBJ A;  5E18 F;  3CUQ B;  3C1D A;  3KP6 A;  2D2W A;  1LQ1 A;  3ZMT A;  1KU3 A;  1R1V A;  3WTT C;  1UHM A;  3LAP A;  4I01 A;  2V9V A;  2FSW A;  2V1X A;  4BHC A;  2H6C A;  3FM5 A;  5FO5 A;  2XIG A;  2XUB A;  1DP7 P;  2ACJ A;  2DI3 A;  3K0L A;  5L3G A;  5H6Q A;  2W85 A;  3HYI A;  1LVA A;  4IJA A;  3T8T A;  4KMU X;  5DCF A;  4RGS A;  1BI0 A;  1G4D A;  5BS6 A;  5DUI A;  1W7P A;  5IT9 K;  2CSO A;  4OIO F;  2OD5 A;  5HDG A;  3R0J A;  4HF2 A;  4EV0 A;  2GXB A;  3RKY A;  3DV8 A;  3Q9S A;  2F5C A;  2DLL A;  4B8X A;  4RAZ A;  2KRF A;  3I5U A;  1FWZ A;  2PG4 A;  2VXZ A;  1K79 A;  2XKP A;  4ENN A;  2HDC A;  4HAM A;  3U9G A;  1IXS B;  2P5K A;  3TO6 A;  4BHB A;  2QQA A;  4P9F A;  3SZT A;  5DCM B;  2O61 A;  5DCM A;  4U7D A;  1QZZ A;  4JK1 X;  2FBK A;  3HIF A;  3FMR A;  4Q5S F;  4ESF A;  1QQI A;  4GYI A;  3IRR A;  3EDP A;  4HZF A;  1J5Y A;  2FF4 A;  2IA1 A;  4L0Y B;  3NRV A;  2XHK A;  1I5Z A;  2A6H F;  3SHF A;  2Z99 A;  1HW1 A;  2VOP A;  5F1R A;  2YSR A;  2VBZ A;  5HOO A;  4BXU A;  1QNT A;  5HS7 A;  1U3E M;  3V8J A;  2PJP A;  2K27 A;  1I6X A;  4WWC A;  1R1U A;  1LJ9 A;  2R7D A;  1YTY A;  5CYV A;  4UUV A;  1HW5 A;  2CFX A;  3O3K A;  2WC2 A;  4K2E A;  1UFM A;  1SD5 A;  3VFZ A;  2OQG A;  1FLI A;  2EFO A;  4WXC A;  3G3Z A;  1WQ2 A;  2MH2 A;  3EUH A;  3LST A;  1S29 A;  3TO7 A;  1BN5 A;  2EA2 A;  4GGG A;  1FP1 D;  5DV5 A;  2HKO A;  2PI0 A;  1USS A;  1O7F A;  3V7C A;  3GX4 X;  2BV6 A;  1P6R A;  2KIM A;  3V8K A;  2O6G E;  3B02 A;  1ZYR F;  1PUE E;  1FBS A;  1OYW A;  2RVC A;  3BWG A;  2NYX A;  4HF1 A;  1BI3 A;  1U8R A;  1SAX A;  3QP6 A;  2BE5 F;  4ESB A;  3K1M A;  4EM2 A;  4N0B A;  1CF7 B;  2MA3 A;  3J7A O;  3JAM Z;  1HSJ A;  2M45 A;  2VC0 A;  1EV7 A;  2HTJ A;  2RN7 A;  5HLI A;  1V4R A;  4KFC A;  2EV0 A;  1YO5 C;  2HFH A;  2ZME A;  1OMI A;  2ZME B;  3WGI A;  3Q9V A;  4G6D A;  3ZMZ A;  1TW2 A;  3L7W A;  4IPA A;  1SMY F;  1BM9 A;  2CW0 F;  4L18 B;  1U6G A;  3RPQ A;  2OU2 A;  2QYO A;  2EWN A;  3S2W A;  4XSZ F;  2HYG D;  4O5V A;  4U0Y A;  2PLY A;  2MC3 A;  2BEO A;  3QPH A;  4YII A;  2W24 A;  3KCC A;  2ZO4 A;  3LAJ A;  4KUM A;  2VC1 A;  1VTN C;  1XN7 A;  2ELH A;  2XV4 S;  3AAF A;  4QLC U;  3GZ5 A;  4LJZ F;  1ZG3 A;  3LWF A;  4RB3 C;  3WGH A;  4HDV A;  4HX7 A;  2DK8 A;  3MQ0 A;  4EJT A;  3BDD A;  4GXO A;  3SFZ A;  1MJA A;  3KP4 A;  5ICG A;  1ZRF A;  4L9V A;  3O2P E;  1IUY A;  2IVM A;  4RGX A;  2QM3 A;  1GVJ A;  3ZMD A;  4KYW A;  3LQR A;  3JAM K;  3GFL A;  1S7O A;  3HRS A;  3RKW A;  2FQ3 A;  3VOE A;  1YYV A;  3IHU A;  4A12 A;  1QGP A;  4MGR A;  3E6C C;  2DU9 A;  1TQM A;  3H3Z A;  5IT3 A;  1B1B A;  2A6E F;  4ZYE A;  3N97 A;  1B4A A;  2FEZ A;  3ML6 A;  4G7O F;  5E8I A;  1R1T A;  5DUK A;  2W57 A;  2P6S A;  5E17 F;  2IPQ X;  3I59 B;  1MDM A;  1U5T A;  2L02 A;  3LA2 A;  2L54 A;  3OOP A;  2UWM A;  4FHT A;  4CO8 A;  3BZ6 A;  3WU0 A;  2IP2 A;  1S7A A;  5DDG A;  2PMU A;  5LEK A;  5KVR A;  2ESN A;  1NHA A;  2M87 A;  3EQL F;  4HQM A;  1RIO H;  2IA0 A;  1W5S A;  1TNS A;  3RYP A;  3F22 A;  3MFK A;  2V6C A;  4BQA A;  1OYI A;  1W5T A;  4LLG F;  4L5J A;  1O3Q A;  1IN7 A;  1LDJ A;  4TV7 A;  5FGM A;  4BYY A;  2P4W A;  4UVB A;  1HKQ A;  2KIU A;  1WSU A;  5LGT A;  1DUX C;  2FXA A;  2JTV A;  2GQQ A;  3KP3 A;  1FSE A;  1Z05 A;  4KT5 C;  4Y15 A;  1K6O A;  1OKR A;  4IF4 A;  1S6L A;  3BY6 A;  5DEQ A;  1PP8 F;  1G3Y A;  5CLS A;  2ZFW A;  3QOP A;  4ASN A;  2ZKZ A;  3E97 A;  3CO7 C;  2LSO A;  1GXQ A;  3FX3 A;  4JBA A;  4Q4Z F;  4KNY A;  3M8E A;  1KQ8 A;  3JSP A;  3FWE A;  4JQF A;  2GXG A;  5DD4 A;  3FXR A;  2GIV A;  2X0L A;  1SD6 A;  1T6S A;  1J9I A;  2BBY A;  4IRI A;  2LKP A;  1REP C;  4EM0 B;  3LQQ A;  2YPR A;  3T8R A;  5BPD A;  2GA2 A;  2Z9O A;  4L0Z B;  1IXC A;  1XSX A;  4ESJ A;  3QP5 A;  1R23 A;  2VON A;  5DD8 A;  2DO7 A;  5JR3 A;  2FOK A;  5HS9 A;  2MH9 A;  3MAJ A;  1ZRE A;  1FY7 A;  3U1D A;  2EFN A;  4R1H A;  3GUD A;  2LNB A;  2VE8 A;  1HKT A;  1P2F A;  2R3S A;  1W7P B;  2QEN A;  2RGV A;  3E6M A;  5D5V B;  1Z6R A;  2HEO A;  2VBW A;  2FE3 A;  1ZG1 A;  1TNT A;  1D8K A;  3QRF F;  4G7H F;  2IA2 A;  4ON0 A;  1HQC A;  5HS8 A;  2COM A;  4I02 A;  3JTG A;  2PN6 A;  4KIB A;  2A61 A;  4A2U A;  1GHC A;  3DP7 A;  2VT2 A;  1PDN C;  1K7A A;  3J81 K;  1CGP A;  2NS0 A;  4BH9 A;  4KMF A;  4BNC A;  3C18 A;  2TDX A;  1ZGA A;  1ZLK A;  1FT9 A;  3F3X A;  2XAG A;  5K5O A;  3GFM A;  4WCG A;  4HQE A;  4QWQ A;  2GZW A;  2G7U A;  1XCV A;  1XDS A;  5BPI A;  2OAZ A;  4YIF A;  1J75 A;  4A0Z A;  1T38 A;  2V79 A;  1I27 A;  2BYV E;  1BI1 A;  5FLX Z;  2DQR A;  1A04 A;  3R4K A;  1FC3 A;  4ZYD A;  1BJA A;  2IW5 A;  1XB4 A;  1ONV A;  5CJ9 A;  1H9G A;  4KDP A;  2QVO A;  4HLX A;  4XSX F;  4P96 A;  2QBY A;  3QU3 A;  3J81 Z;  1ZRD A;  3L9F A;  1IN6 A;  2A3S A;  4IRG A;  2HR3 A;  2XAS A;  1UB9 A;  5ILU A;  3WE2 A;  1YS6 A;  2G7H A;  1U5T B;  1LDD A;  4I09 A;  4HBL A;  3QU6 A;  5ICE A;  4EJW A;  1ZGJ A;  4S04 A;  3I71 A;  2YX4 A;  2D45 A;  1ZG5 A;  5E1Z B;  5EEH A;  3IWF A;  1FX7 A;  1T2K A;  1JGS A;  4MTD A;  4FX0 A;  3RJP A;  2JT1 A;  1ON1 A;  5CVR A;  4MQV A;  5H6R A;  5D6E A;  3VOD A;  3ISP A;  3J80 Z;  4IHT A;  5E20 A;  5CVU A;  3W6J B;  1D3Y A;  4HOB A;  2PQ8 A;  3JW4 A;  4EM1 A;  5LEJ A;  4XBF A;  1S3J A;  1T0F A;  1TQI A;  4EJV A;  4A5M A;  3L09 A;  2Z33 A;  4U0W A;  3RKX A;  1HBX G;  2E7X A;  4ENJ A;  2M5W A;  4KA4 A;  3ERE D;  4B09 A;  4Y17 A;  4RGU A;  2H6B A;  3QAH A;  4MEY F;  1OR7 A;  3V8L A;  4KN7 X;  3ROU A;  1HXD A;  3GW2 A;  4ZZL A;  5BMZ A;  4RS8 A;  3HOS A;  2MLG A;  2A5Y B;  4M74 A;  3F8C A;  1IZ1 A;  1ZH5 A;  2V1D A;  4NHJ A;  3TGN A;  3DFG A;  1MZB A;  3RI4 A;  4HV6 A;  2VT3 A;  4AD9 A;  3COA C;  1MD0 A;  1MJ9 A;  3O6B B;  2P6T A;  4WK8 F;  4L9T A;  2OZU A;  1Z9C A;  4G8X A;  3CDH A;  1DPU A;  1AWC A;  4OU0 A;  4PDK A;  4RGR A;  3WTX C;  2K7L A;  2QZ8 A;  1CF7 A;  1ZAO A;  5D8L B;  4MNU A;  3VB2 A;  3ULQ B;  2P7C B;  1BBY A;  4YG2 F;  4O3M A;  2ZNY A;  4AIJ A;  3LA7 A;  3KEQ A;  2FMY A;  4UXN A;  1R00 A;  3WTW C;  2NNN A;  4UV8 A;  1R5G A;  1YQA A;  2DPU A;  2XAJ A;  4EVI A;  3BOQ A;  3R0A A;  2H94 A;  3GVA A;  2ZBK A;  3E6D A;  4OOI A;  3F8N A;  2M30 A;  1B59 A;  1J0R A;  2ZNZ A;  2A68 F;  1YS7 A;  4OIQ F;  4HF0 A;  1TTY A;  3G73 A;  3WTY C;  2EFW A;  1LNW A;  3SQN A;  4EJU A;  3P9C A;  3M8F A;  4O6J A;  2DPD A;  3LFK A;  1XSV A;  4EMS A;  2E1N A;  3DF8 A;  5LRS A;  4OIR F;  5L3F A;  2O8X A;  3KET A;  3K1P A;  1H0M A;  3TDZ C;  1EH8 A;  4M9Z A;  3P7N A;  1V3F A;  3JSO A;  1F4K A;  3F6V A;  1OYY A;  1SFE A;  3TOB A;  2QWW A;  2JSC A;  3RYR A;  4U7B A;  3WTV C;  4LGW A;  1TLH B;  5A2Q K;  3R60 A;  2HS5 A;  2EFQ A;  2UXX A;  5ICF A;  4N9I A;  2G9W A;  2EJR A;  3W6K B;  4A6D A;  2AXL A;  2STT A;  4AWX B;  2RV8 A;  3C7J A;  1IAW A;  1YW7 A;  5L3C A;  1EH6 A;  1RZ4 A;  3IRQ A;  1U5T C;  2DQL A;  2QLZ A;  4M73 A;  4DNC A;  1JXS A;  1KYW A;  4ZH4 F;  5J6X A;  2RQP A;  3GO5 A;  1UHW A;  5JFR A;  1K78 B;  3P9K A;  1U78 A;  2P5L C;  1IXR C;  4GYG A;  1JHF A;  2VBX A;  2STW A;  3WOD F;  2MLK A;  1RUN A;  4UVA A;  3M9A A;  1BI2 A;  2O3F A;  5H20 A;  2Y0M A;  3ZPL A;  3FHZ A;  1D8J A;  2DK5 A;  3ZMS A;  4LFU A;  2L4M A;  2QQ9 A;  4ENK A;  3V7R A;  1IW7 F;  5LGN A;  3NQO A;  3REO A;  3WGG A;  1F5T A;  5AIQ A;  2IRF G;  2MBF A;  2FU4 A;  3FMS A;  4F7Z A;  4Z2Y A;  3K9T A;  4ETS A;  3ZQ7 A;  2KJC A;  4UHT A;  2O0Y A;  3L2C A;  1ZAR A;  1FYM A;  5D4S A;  2M1B A;  2FRH A;  3ECO A;  1SFX A;  4HW0 A;  1KQ0 A;  4XLP F;  3I4P A;  1FOK A;  2E7W A;  3ZN0 A;  2MD5 A;  5D6F A;  2PFB A;  4LMY A;  6PAX A;  1WI9 A;  3PQJ A;  3K69 A;  4IVN A;  1LDK B;  1FBU A;  1KA8 A;  1RUO A;  3ELK A;  3WTU C;  1YIO A;  3E5X A;  3GF2 A;  2M8E A;  1G3S A;  5CVI A;  3H92 A;  2DW4 A;  4LK1 F;  1S8N A;  4MTE A;  3HSR A;  4PGG A;  4WXD A;  2RDP A;  3BPV A;  4HLY A;  1YLF A;  4U88 A;  2D1H A;  5ILS A;  4OMY A;  2WWY A;  3KZY A;  4L5I A;  3R6S A;  3F8F A;  1FYK A;  1TW3 A;  3E5U A;  5LRR A;  3HHH A;  2HTS A;  3V4G A;  3ABT A;  5ICC A;  3HTU A;  4H0E A;  2HQR A;  1QPM A;  2FNA A;  3BJ6 A;  3CUQ A;  3K1N A;  3E6B A;  1R36 A;  1IRG A;  3BJO A;  3TDU C;  5L3B A;  1FP2 A;  3FXQ A;  4LB6 B;  4HDU A;  3VEP A;  1EH7 A;  4IHS A;  1IN5 A;  3DPT A;  4N9H A;  4M71 A;  4A5N A;  3BP8 A;  4L9N A;  5EEG A;  2O03 A;  2RC4 A;  2YU3 A;  3GLX A;  1FNN A;  3I64 A;  4RB0 A;  2HOE A;  1J59 A;  3BJA A;  3CJN A;  4CIC A;  4KIG A;  3ECH A;  3KZZ A;  2NNY A;  1T39 A;  2B0L A;  2E1C A;  2EV5 A;  1HKS A;  2F5D A;  3MWM A;  5D5W B;  2OBP A;  4CXF A;  5FD6 A;  2XAH A;  1B6A A;  4ZYH A;  1UCR A;  3RTR A;  2AS5 F;  1ODD A;  2K02 A;  4G9Y A;  3WTS C;  2JPC A;  2R7F A;  1XMK A;  3ZP5 A;  2H27 A;  5DYM A;  1MGT A;  4A0X A;  2FBI A;  1SFU A;  4P5O A;  2HZT A;  1DPR A;  3GXO A;  1KU7 A;  1LEA A;  1P4A A;  3KE2 A;  1P4W A;  5L3D A;  3K2Z A;  1XGO A;  4ENM A;  2Y75 A;  3ZMV A;  3GFI A;  2GA1 A;  4I2O A;  2Z5U A;  2FML A;  3FM3 A;  1C0W A;  2F5F A;  2K86 A;  2J5O A;  3HSE A;  5E1W A;  1O3R A;  4M6X A;  2EV6 A;  4IRH A;  1J7K A;  3D5L A;  3TO9 A; 
#chains in the Genus database with same CATH topology
 2R5Y A;  5LBQ A;  2DDB A;  1H9T A;  2RAE A;  2CGP A;  2H8W A;  3KIO A;  4RAF A;  4R79 A;  1W7P D;  2RNJ A;  2OC6 A;  1G6N A;  5FFX A;  2OA4 A;  2HQ5 A;  3I53 A;  4BS9 A;  1FMW A;  1ZHF A;  4NC7 A;  2WV0 A;  4QPO A;  3MZH A;  3D5R C;  3KLN A;  4NNJ A;  5GAH J;  1XGN A;  5FRO A;  3K70 D;  1OFC X;  1YW9 A;  3AG2 H;  5EJC A;  4GCV A;  3OYC A;  1R5H A;  1P92 A;  1ON2 A;  4LB5 A;  2PMH A;  3FBN B;  3HHG A;  5HLT A;  1F9N A;  1S5L C;  1P4X A;  3OV8 A;  4CGZ A;  2YX7 A;  4PJ0 C;  3WG9 A;  5BQT A;  2Y2Z A;  2KZV A;  5L3E A;  1R7J A;  3SJM A;  2K4B A;  2DA3 A;  3N05 A;  2UZK A;  3K4J A;  4QIW N;  3S2D J;  2EIK H;  4A6E A;  1DU0 A;  3RPU D;  4LIV A;  3QOE A;  1JJ6 C;  3W2W A;  3SEQ A;  3GYH X;  4A3D J;  1V5E A;  3GTL J;  2MSY A;  4I0A A;  4EEF G;  1HC8 A;  2ZJ2 A;  1D5V A;  2VKV A;  3VPR A;  2A69 F;  1BOA A;  2NOG A;  3T1B A;  1IRZ A;  2FX0 A;  3TP3 A;  3OR2 C;  2L7M P;  2JZY A;  2F6C A;  1Z91 A;  3M07 A;  4A0Y A;  4I0B A;  5HNH A;  4M9X A;  2MG4 A;  2R7W A;  4IXA A;  2KDO A;  3NAU A;  4NC6 A;  3CTA A;  3ZQQ A;  4D0P A;  4MEX F;  4IKF A;  3DEU A;  2HVS A;  4XLN F;  3OS0 A;  2L01 A;  5J47 A;  2FJ1 A;  2OF7 A;  4AUX A;  1XGM A;  1RNL A;  1AOY A;  2HVR A;  4I7H A;  4MO7 A;  5IYD J;  2ECC A;  4KIS A;  1XCB A;  2PBI A;  1WJB A;  2W1O A;  3K10 A;  5KCM A;  5F6F A;  4RA2 A;  2HQA A;  2AXT C;  3K4M A;  1JE8 A;  1R22 A;  1OCZ H;  4I98 B;  5J1Y A;  4WXH A;  4A3E J;  2XKO A;  1ZGW A;  4R8H A;  3PUF A;  2K3F A;  1TWH J;  4NQW A;  2FNP A;  2MW8 A;  2J5P A;  1MKM A;  2WY7 Q;  1VQ7 I;  2EB7 A;  2VJ5 A;  1DDN A;  2E1O A;  4I99 C;  3IUO A;  1ETQ A;  2DJI A;  2ZXJ A;  5LHI A;  1Q1V A;  2L2O A;  1NTC A;  3I3L A;  2LH9 A;  3ZCO A;  2HOT A;  2VN2 A;  2C6Y A;  2YR2 A;  2BHY A;  3LSP A;  2DT5 A;  1KQ9 A;  4YFX F;  4N4N B;  1NH3 A;  3IP4 B;  1B9M A;  3LFU A;  3LA3 A;  4KN4 X;  3O8H A;  3OSF A;  2KHM A;  1L3L A;  4J01 A;  1FYL A;  4JX4 A;  2XF6 A;  5FJ8 J;  4KIF A;  5K5R A;  3KLO A;  4F92 B;  4B3X A;  1APL C;  2IJL A;  3BC8 A;  3DWL E;  2RNG A;  3IL2 A;  4NB5 A;  5JI6 A;  1R49 A;  1K4T A;  3GTG J;  2DYS H;  5B1B H;  2DAO A;  1TWG J;  3GZN B;  2ZXI A;  1FOW A;  3JTH A;  2D5V A;  2WAQ A;  1KGS A;  3GFJ A;  3IC7 A;  1BIA A;  4BAY A;  5J8C A;  3PNV A;  1I1S A;  3I54 A;  3F23 A;  1FOX A;  4G6Q A;  2Y0S N;  3TQN A;  2CH0 A;  2WAF A;  3QPT A;  3O8G A;  2K9Q A;  1MSF C;  5HDN A;  5M5X J;  3DLA A;  4XRM A;  2VL8 A;  1R58 A;  1D5Y A;  3FZV A;  1TL8 A;  3CC7 I;  1SAU A;  2HDD A;  4AYB A;  2CQK A;  2KZG A;  3OSG A;  2X6O A;  1A5J A;  3K4B A;  5HVQ C;  4ITV A;  2BY3 A;  3P9I A;  2EZH A;  3C2H A;  1L0O C;  3BPX A;  1KYZ A;  4CHU A;  2L9N A;  2HYJ A;  3HGY A;  4V19 K;  1WHU A;  3F72 A;  1ETY A;  1RC9 A;  1ZK8 A;  1VFC A;  1G3W A;  1XSD A;  2ZSI B;  4S0H B;  2WTE A;  4LG3 A;  4Q48 A;  2R0Q C;  1HF0 A;  3KEO A;  1JKQ C;  4G12 A;  3T5X A;  1T98 A;  3CMY A;  2HYF A;  2YU9 J;  4E7S A;  4HX8 A;  4RDU A;  1IN8 A;  4P1W A;  2LTP A;  3HOT A;  2D1V A;  2CO5 A;  5F64 A;  2WB1 N;  1JKP C;  2K85 A;  4B48 A;  2VPL A;  1BR4 A;  4YIR X;  3VYR B;  5JHU A;  1TBX A;  5KAI C;  4Y7N J;  1RKW A;  4UV9 A;  5E3N A;  1SFO J;  2Y48 A;  2ZSH B;  3N4M A;  2XSJ C;  2IT0 A;  4BJ6 C;  1QZY A;  5J8F A;  2DN0 A;  3ERM A;  2EK5 A;  2QBY B;  2DOD A;  1JUM A;  2P8T A;  1ZLJ A;  3ZN1 A;  1ULY A;  3RQ4 A;  1B9N A;  3ABK H;  3P5J A;  4RB2 C;  3IKT A;  4EGY A;  1IN4 A;  2XSD C;  3Q5F A;  2HOS A;  2DOF A;  5JLW A;  2VOD A;  2JPB A;  1RI7 A;  5K7Z A;  3V7S A;  3D0S A;  1FZP B;  4EQQ A;  3HPG A;  5TJJ A;  3E3V A;  5CVJ A;  1YFH A;  1FMV A;  2F5V A;  3DLL F;  2L4A A;  2XAQ A;  5EEA A;  1GV2 A;  2L3D A;  2IS4 A;  4LG0 B;  3WTZ A;  5K5Q A;  2ISY A;  5B1A H;  1X1P A;  3NAR A;  4ZYG A;  1OPC A;  1Y0U A;  2OJE D;  3FXU A;  3DCF A;  3JRH A;  2HWV A;  2KKO A;  3OWT A;  3VDX A;  1R4M B;  2QKL B;  2HOA A;  5M5W J;  4UNO A;  2DFF A;  3F6O A;  5EG0 A;  4E7H A;  3HRU A;  4DBR A;  2ISZ A;  2O9L A;  2W00 A;  2QKM B;  1X1C A;  4LLN A;  3B73 A;  3KYD B;  5FFZ A;  3M8J A;  4F52 A;  4BY7 J;  1AKH B;  2XAF A;  2ZJQ F;  1TWA J;  3IKV A;  4C9Y A;  5AIP A;  4KT6 A;  5TIS C;  1ZR2 A;  2E71 A;  5EZG A;  4I76 A;  2CYY A;  2CRG A;  1RRJ A;  1Q1H A;  4M6Y A;  4XIC A;  3FBI B;  5LLQ A;  4HYE A;  3SEZ A;  4RAY A;  1W4M A;  3BQZ A;  3RIR A;  3J7A Y;  1LB2 A;  2GAU A;  2KJB A;  3S15 J;  5D8K B;  1XMA A;  2WAD A;  3W2A A;  1UST A;  2QCO A;  3L2Q A;  2EIM H;  3MKY B;  1IF1 A;  2OCC H;  4G7Z F;  4AC0 A;  5FKL A;  2WY8 Q;  1N78 A;  1FIA A;  2VJ4 A;  4LD5 A;  1F1Z A;  2BZT A;  2VIX A;  4IQ4 A;  2V1N A;  4G94 A;  5HLH A;  2RKH A;  3KP2 A;  1WWX A;  2KIF A;  1SD7 A;  2LF7 A;  5FLV A;  1LEB A;  3RPU A;  3ZMU A;  3J7Y J;  3IH2 A;  2H09 A;  5JLX A;  4CDG A;  3HEF A;  4LLL A;  1QHH D;  3OR1 C;  3OS2 A;  3MZ8 A;  3FK6 A;  4OIN F;  2Z3Y A;  2Y0S A;  2CV1 A;  5A2Q Z;  2GIZ A;  1UMQ A;  3QYE A;  1TQP A;  5GPA A;  4XNF A;  2Q2E B;  5E1X A;  3BR1 A;  5IT9 Z;  2VQG A;  4RLF A;  1STZ A;  3OYM A;  1WRJ A;  3MKZ A;  1YRN A;  2Y9Z A;  2XF5 A;  2LKS A;  2Y69 H;  4HST A;  4C3I J;  2NVQ J;  3WE3 A;  4NQW B;  3PFI A;  1CQT A;  2JUG A;  1QO0 D;  1BC7 C;  3NEU A;  4AIH A;  1ZTR A;  3L00 A;  2M7B A;  4IZZ A;  5FB2 A;  2NOJ B;  3K4C A;  5D5X B;  2VAS A;  2R93 J;  3MZY A;  3HRM A;  2ETH A;  1ZN2 A;  4BDY A;  3MKL A;  4J00 A;  3H35 A;  1SMT A;  2FA5 A;  3TBI A;  4CCJ A;  3AG3 H;  3BR6 A;  3BZK A;  2ZXH A;  2HQN A;  2DMN A;  1LFU P;  3I58 A;  2LOO A;  5M3M J;  1Y8R B;  3KFW X;  4Y52 J;  3OMY A;  4EJO A;  2OQR A;  4M72 A;  1R4N B;  3CCM I;  3SFI A;  3CUO A;  3KP5 A;  1HW2 A;  3VWB A;  2Q8K A;  3ONQ A;  2Q0O A;  1AHD P;  1XX5 A;  3BG7 A;  5JHF A;  1SD4 A;  1O57 A;  4IQJ A;  1LFP A;  4ABZ A;  3DQV C;  2EFP A;  2VKE A;  1IUF A;  3QYB A;  1ZRC A;  3E7L A;  3OYB A;  1YG2 A;  2Q1Z B;  2EZI A;  2E1M C;  3BR0 A;  3GEZ A;  1TZL A;  3K4N A;  4PGH A;  1BIB A;  1X1D A;  1U2W A;  3QYF A;  1JHH A;  2W4S A;  1E17 A;  3GTQ J;  3SZP A;  1Z3Y A;  4C2M J;  3SXY A;  4A3B J;  5EYR A;  2ZCW A;  1MNM C;  2XRN A;  1O3T A;  2ME0 A;  3F8B A;  1WCM J;  1RR8 C;  2XB0 X;  5E8G A;  5ILV A;  3MEX A;  3HUG A;  4A3K J;  4LIT A;  4PUS A;  1YW8 A;  3ESW B;  1FSH A;  3TW6 A;  3BG5 A;  3TOA A;  3CO6 C;  1UHS A;  2GLO A;  2F2E A;  4CZC A;  5CVV A;  3CP8 A;  2EQR A;  1UG0 A;  3MCZ A;  2GWR A;  4B3A A;  3HOW J;  1X3U A;  4WF2 A;  3LMM A;  1HST A;  4AIK A;  2DTR A;  4L9J A;  4XRS A;  4E7Z A;  3LSM A;  1R9T J;  3DKW A;  3PQK A;  2F5E A;  2KT0 A;  2MGQ A;  1SVM A;  5HLG A;  2R7R A;  2V4J C;  1Z7U A;  5KK1 A;  2XPU A;  3I59 A;  1MDM B;  4MFE A;  2DMQ A;  3H0D A;  2BW3 A;  4JX5 A;  2QUF A;  1AU7 A;  4RB1 A;  4OIP F;  2X4H A;  4LG0 A;  2V1U A;  4DQ2 A;  3HOX J;  1O3S A;  5K1Y A;  4GO1 A;  2VOO A;  2E5Z A;  2LD5 A;  3F21 A;  3J80 K;  2ZJP F;  3GTK J;  3E5Q A;  4MQ9 F;  3HSF A;  1JI8 A;  1XDU A;  2GOM A;  2QQB A;  4YEL A;  1K4S A;  1XPX A;  2M9H A;  2KPM A;  5BOX A;  1QA6 A;  5D4R A;  2A07 F;  3F8M A;  3RQI A;  4CZZ A;  3I0T A;  4ZYA A;  2PEX A;  1YHQ I;  1FPQ A;  1MJB A;  1YX3 A;  3JRG A;  2CUJ A;  1ETV A;  4A69 C;  1IRF A;  3FXJ A;  5ERI A;  1FTZ A;  4PFO A;  3DXJ F;  2HGC A;  4AVP A;  4FT8 A;  1J2X A;  3FHN A;  2NAZ A;  5TRD A;  4M9S A;  2FBH A;  1U0J A;  2E1M B;  4CCL A;  4YFN F;  2JRT A;  1HDD C;  1E2X A;  2XVC A;  2CG4 A;  2CWE A;  4MHG A;  4YFK F;  3GLL A;  4OMZ A;  1IDY A;  2NVX J;  3I4M J;  2HNH A;  4S05 A;  1WKM A;  2OZ6 A;  1Z6T A;  3C3W A;  1GXP A;  3IWZ A;  3U2R A;  1B8I A;  2JK3 A;  3EYI A;  4E70 A;  4DW6 A;  2K4J A;  4KIC A;  1K78 A;  1UJ8 A;  3JRD A;  3BG6 A;  2R7S A;  3GZ6 A;  4GDF A;  2LDU A;  5FD5 A;  4FX4 A;  5AON A;  2EA4 A;  3FMQ A;  3HRT A;  3BRO A;  1DP3 A;  2LY1 A;  2UXN A;  1WH7 A;  1KZH A;  4CCK A;  2W84 A;  4XLH A;  3M1E A;  4UVC A;  2BY0 A;  2ZFU A;  2LRD A;  2CJJ A;  2PMZ N;  3M7G A;  1VQP I;  1BC8 C;  2VXD A;  5ED4 A;  4HA8 A;  2KDZ A;  4P9U A;  4ZZD A;  5JVT A;  2BVL A;  2W82 A;  2V7F A;  2JA7 J;  3FF5 A;  1XD7 A;  4KJZ A;  2ADU A;  3HG9 A;  1XGS A;  2VE9 A;  3KP7 A;  1LE8 B;  4PCQ A;  2XGX A;  1LE8 A;  4E7K A;  5E79 C;  3ABU A;  1G3T A;  3EET A;  1Z3X A;  3ZRG A;  3TKY A;  2R7T A;  4X6A J;  2YUS A;  4U0V A;  1I1G A;  1YJW I;  2DBB A;  5HDK A;  4AID A;  4QSH A;  3OYH A;  1KU2 A;  2QF7 A;  2ESH A;  3KYC B;  4BQQ A;  3WU1 B;  3R61 A;  3CLO A;  3HTS B;  2R7Z J;  2DT6 A;  2N8G A;  3DU6 A;  4YRV A;  2R7O A;  1PYV A;  2W25 A;  5DS9 A;  3A01 A;  3T0Y A;  5LHH A;  1KU9 A;  3PIO F;  2BGC A;  2OV7 A;  1LPQ A;  3CCS I;  3SDB A;  5D5U B;  5FLX K;  2TCT A;  4DZJ A;  3H3U A;  3GWZ A;  3OIQ A;  4CYD A;  2P7V B;  4EGZ A;  4WX9 A;  4HX4 A;  4XRF A;  4Y4R A;  4IHY A;  4E6K G;  5E3M A;  1S9H A;  2DA5 A;  3TED A;  2NRA C;  3EYY A;  4QPQ A;  1IV8 A;  5EG0 B;  1LVK A;  4PZJ A;  5LHG A;  2LF8 A;  5CQG A;  2HKX A;  4Q47 A;  2VBY A;  3OYL A;  1MBG A;  2CFO A;  3PSI A;  3CUQ C;  4PJL A;  1Z1D A;  5IP6 A;  2Q2E A;  5LGU A;  3CCJ I;  3RDI A;  4P55 A;  4LK0 F;  4CCM A;  2B9S A;  1PP7 U;  2DFI A;  1FBQ A;  3PUB A;  3DPL C;  4BHP A;  1O7L A;  2PX9 A;  4Y13 A;  1PJR A;  2P5V A;  2VQL A;  2XRO A;  5C3E J;  4HV5 A;  2DYR H;  3RKQ A;  3BCB A;  3UR3 C;  1QBJ A;  4FTH A;  1LKX A;  5E18 F;  3CUQ B;  3C1D A;  3KP6 A;  3ZOB A;  1VQM I;  2JVG A;  4OAY A;  2D2W A;  1LQ1 A;  4XQF A;  2JJ7 A;  1KU3 A;  3ZMT A;  4DIQ A;  1R1V A;  3WTT C;  1UHM A;  2HVQ A;  3EUA A;  3LAP A;  4I01 A;  2V9V A;  2DCE A;  2FSW A;  2V1X A;  4BHC A;  2H6C A;  3HOZ J;  3FM5 A;  2K9N A;  2V26 A;  4IHX A;  5FO5 A;  5GP9 A;  2XIG A;  2XUB A;  5IPA A;  2BHZ A;  1DP7 P;  2ECB A;  2ACJ A;  3RZD J;  3F9K A;  2DI3 A;  3K0L A;  3PIP F;  1TT0 A;  3H9Q A;  5L3G A;  5H6Q A;  2W85 A;  3HYI A;  1LVA A;  1JTX A;  3OYE A;  4IJA A;  3T8T A;  4KMU X;  1EKE A;  3H9G A;  4XM3 A;  3ZQI A;  5DM6 F;  4PFP A;  1ACI A;  1VQN I;  2HPI A;  3DTI A;  4RGS A;  5DCF A;  1D0Z A;  4HNU A;  2DMU A;  2JUC A;  1BI0 A;  1G4D A;  3HXL A;  4HSR A;  2KRC A;  5GAD J;  5BS6 A;  4KIT B;  5DUI A;  1W7P A;  1QHG A;  3MVP A;  2IS6 A;  4A3I J;  5IT9 K;  2VQH A;  3CME I;  2XGE A;  4W1U A;  2CSO A;  4OIO F;  2DOA A;  1D1C A;  3K70 C;  2OD5 A;  5HDG A;  4B47 A;  3R0J A;  4HF2 A;  4EV0 A;  2GXB A;  3RKY A;  3DV8 A;  3Q9S A;  4M3F A;  2EBI A;  2F5C A;  4IHV A;  4JYK A;  1GV5 A;  3Q3S A;  2BY2 A;  2DLL A;  3HPH A;  4B8X A;  4RAZ A;  4OAZ A;  2KRF A;  3I5U A;  1FWZ A;  2PG4 A;  2VXZ A;  1K79 A;  2XKP A;  4M6V A;  4ENN A;  4CH7 A;  4A3G J;  2HDC A;  4HAM A;  1WJC A;  3U9G A;  2PMZ A;  3WHC A;  1IXS B;  2P5K A;  3TO6 A;  4BHB A;  4DYR A;  2QQA A;  3CCQ I;  2JVH A;  3M3Y J;  4P9F A;  3SZT A;  5DCM B;  2O61 A;  5DCM A;  4U7D A;  2ELJ A;  1QZZ A;  4JK1 X;  1X1A A;  2FBK A;  1WJD A;  3HIF A;  3FMR A;  3BR2 A;  3HGG A;  3VYS B;  4M3E A;  2KMU A;  2I10 A;  4Q5S F;  2X6X A;  4YEJ A;  4ESF A;  2JSP A;  3F0C A;  1QQI A;  3GBG A;  3S1M J;  4GYI A;  1S7E A;  3IRR A;  3EDP A;  4HZF A;  2EIN H;  1X2N A;  1J5Y A;  3BCA A;  3BTI A;  2FF4 A;  4DJA A;  1EF4 A;  4B43 A;  1MIJ A;  2IA1 A;  1BL0 A;  4L0Y B;  3NRV A;  2XHK A;  2KL4 A;  3JRF A;  4XLA A;  3EUK L;  1I39 A;  4RBO A;  1I5Z A;  1K83 J;  2A6H F;  3SDG A;  1Z7L A;  1HW1 A;  2Z99 A;  3SHF A;  1U8B A;  2VOP A;  1YRN B;  4CSW A;  5F1R A;  2YSR A;  2VBZ A;  2DFH A;  1QU3 A;  5HOO A;  3JRC A;  4BXU A;  5H2F C;  1BR1 A;  1QNT A;  2X51 A;  5HS7 A;  1U3E M;  2GOX B;  4IOC F;  4CUG A;  1JUS A;  3V8J A;  4D1Q A;  2PJP A;  4D7N A;  2K27 A;  1I6X A;  1D1A A;  4WWC A;  2HU9 A;  1R1U A;  1LJ9 A;  3IAM 2;  2R7D A;  1BOB A;  1YTY A;  5CYV A;  2A5W A;  2LY9 A;  3CC4 I;  4UUV A;  2IGM A;  1HW5 A;  1Y1V J;  2CFX A;  3O3K A;  4L5E A;  4DGW B;  3HC7 A;  2WC2 A;  4K2E A;  1UFM A;  2LFB A;  3GTM J;  1SD5 A;  3K6G A;  5J3L A;  3CF5 F;  1XC5 A;  5GPC A;  3A0H C;  3VFZ A;  2OQG A;  1AA7 A;  1JUP A;  1FLI A;  4UUS A;  2HDW A;  4CCN A;  2EFO A;  3DKY A;  4WXC A;  4JP0 A;  3G3Z A;  1YX5 A;  1WQ2 A;  2MH2 A;  3EUH A;  3LST A;  3QOD A;  1S29 A;  1U9N A;  4H4K C;  3TO7 A;  2Y9Y A;  2R7Q A;  1BN5 A;  2EA2 A;  4GGG A;  1FP1 D;  5DV5 A;  1SVO A;  3S93 A;  2HKO A;  5CQE A;  2PI0 A;  1USS A;  1O7F A;  2ELK A;  3V7C A;  1MW7 A;  3GX4 X;  2BV6 A;  1P6R A;  2KIM A;  3MMY B;  5IOZ A;  3PM1 A;  3FKJ A;  3V8K A;  1Z0X A;  1YE9 A;  2O6G E;  3B02 A;  3FDY A;  1ZYR F;  2F4M B;  4RLQ A;  2ZJR F;  1FBS A;  1OYW A;  1PUE E;  2RVC A;  3BWG A;  1SC7 A;  2NYX A;  4HF1 A;  1BI3 A;  1U8R A;  1VF9 A;  3FXL A;  1SAX A;  4BEH A;  2E2H J;  3HZJ A;  3QP6 A;  4HPQ A;  2BE5 F;  4ESB A;  3K1M A;  1FTT A;  4UB6 C;  4EM2 A;  2LKX A;  2KIQ A;  1W0T A;  2JMW A;  5IOY A;  2LK2 A;  2UUZ A;  4N0B A;  1CF7 B;  2K9S A;  2MA3 A;  3J7A O;  3JAM Z;  1HSJ A;  4X0G A;  4F93 B;  2M45 A;  1I50 J;  1EV7 A;  2HTJ A;  2RN7 A;  2VC0 A;  1V4R A;  5HLI A;  3I56 I;  2IBD A;  2IXS A;  4KFC A;  2CUF A;  2EV0 A;  2CV0 A;  1YO5 C;  1MMD A;  2VKH A;  1M1E B;  2CUZ A;  1X4P A;  2HFH A;  1K61 A;  2ZME A;  1B72 A;  1OMI A;  4BBS J;  5FRM A;  2ZME B;  1B72 B;  3WGI A;  3Q9V A;  4G6D A;  4XLE A;  3BTL A;  4M3B A;  3ZMZ A;  1QRY A;  4BQN A;  4I6Z A;  1TW2 A;  3L7W A;  2NXN B;  4IPA A;  1SMY F;  1BM9 A;  2CW0 F;  4PJJ A;  4L18 B;  3LSH A;  1VQ4 I;  1U6G A;  1OCP A;  1RKT A;  3RPQ A;  5C44 J;  2OU2 A;  3AKZ A;  2H1L A;  1JTY A;  3S1Q J;  2O7O A;  1R6R A;  2QYO A;  2EWN A;  4UB8 C;  2ZME C;  3S2W A;  4XSZ F;  2IS2 A;  3VYT B;  2DOE A;  2F4I A;  2HYG D;  4O5V A;  2EIJ H;  4U0Y A;  2PLY A;  2MC3 A;  2E2I J;  5C4X J;  1WJ5 A;  3H3V K;  2BEO A;  3QPH A;  3OIP A;  2E34 A;  4ZDL A;  4YII A;  4B4C A;  3LSK A;  2W24 A;  3KCC A;  1POG A;  2ZO4 A;  4KUM A;  3LAJ A;  2VC1 A;  4XID A;  1VTN C;  1XN7 A;  2ELH A;  2XV4 S;  3AAF A;  3JR9 A;  3FIW A;  2O5R A;  3BLY A;  4QLC U;  1IC8 A;  4RM3 A;  2LRE A;  3ZQL A;  3GZ5 A;  1MBF A;  2CU7 A;  2CUE A;  1ZG3 A;  4LJZ F;  3L2W A;  3LWF A;  1QPI A;  1MND A;  1HA8 A;  4FE7 A;  4BE2 A;  4RB3 C;  2DXI A;  3WGH A;  3PJR A;  4DOZ A;  4HDV A;  4HX7 A;  2DK8 A;  3MQ0 A;  1KON A;  4F3Q A;  4EJT A;  3BDD A;  2LBF B;  2L7F P;  4GXO A;  3Q0U A;  3SFZ A;  1MJA A;  4ANJ A;  2QEX I;  2H8R A;  3GTO J;  3KP4 A;  1IDZ A;  5ICG A;  4A3M J;  1ZRF A;  1A35 A;  2L7K A;  4L9V A;  3O2P E;  5FRN A;  2LMD A;  4BE0 A;  1IUY A;  2IVM A;  2MYS A;  1ERD A;  4RGX A;  2QM3 A;  3VSK A;  2X85 A;  3C2B A;  2L0K A;  1W36 D;  1GVJ A;  3ZMD A;  4KYW A;  1YI2 I;  3LQR A;  5LD2 C;  3TL4 X;  3JAM K;  3GTP J;  3GFL A;  3L2V A;  1S7O A;  4D5C A;  3UNG C;  3HRS A;  2IAI A;  3RKW A;  2FQ3 A;  3VOE A;  4BE1 A;  1YYV A;  5F0C A;  1S72 I;  3IHU A;  4A12 A;  1QGP A;  4MGR A;  3E6C C;  2DU9 A;  1GUU A;  4C3H J;  1TQM A;  3H3Z A;  3NWS A;  5IT3 A;  3FXM A;  4BGD A;  2QSF X;  3AL0 B;  2FUG 2;  1B1B A;  2CQX A;  2A6E F;  3LL7 A;  4D7M A;  4ZYE A;  3N97 A;  1B4A A;  2CQ7 A;  4UUT A;  3IV5 A;  2FEZ A;  3ML6 A;  4G7O F;  5E8I A;  4XL9 A;  3U1K A;  5M5Y J;  1R1T A;  4XKC A;  4F55 A;  5DUK A;  3QWL A;  1FOY A;  3VYU B;  2W57 A;  2P6S A;  2JA5 J;  5E17 F;  2IPQ X;  3I59 B;  1MDM A;  1U5T A;  2B63 J;  1HOM A;  2L02 A;  4V2G A;  3IAS 2;  1ENH A;  1PVE A;  4GFB A;  3LA2 A;  2Z2S B;  3AL0 C;  2L54 A;  2MFZ A;  3OOP A;  2XRL A;  2UWM A;  4FHT A;  4CO8 A;  1W0U A;  3BZ6 A;  2I8D A;  3WU0 A;  3A2K A;  1FEX A;  3K4K A;  1K6Y A;  3G1O A;  4N4O B;  1DGW Y;  2GBY A;  1ORK A;  2IP2 A;  1S7A A;  1A6I A;  5GTI C;  5DDG A;  3C2G A;  4PJM A;  2PMU A;  5LEK A;  5KVR A;  5KNL A;  1O4X A;  1X1B A;  2ESN A;  1NHA A;  2M87 A;  3EQL F;  4HQM A;  1RIO H;  2IA0 A;  1W5S A;  5B66 C;  1TNS A;  3RYP A;  3M1C A;  2DA4 A;  3F22 A;  3MFK A;  5FKO A;  2V6C A;  4BQA A;  1OYI A;  1OIS A;  1W5T A;  2WB1 A;  4LLG F;  4L5J A;  1O3Q A;  5M3F J;  1IN7 A;  3DBL B;  1LDJ A;  1VQO I;  4TV7 A;  4AVZ A;  5FGM A;  3J7Z I;  1V5G A;  5B3S H;  4BYY A;  1F43 A;  4FCY A;  4BEH B;  3H0G J;  2P4W A;  2X1E A;  4UVB A;  5TGT A;  1HKQ A;  2KIU A;  2JN6 A;  3CMA I;  2NS8 A;  1X58 A;  2HI3 A;  4XR6 A;  2PJR B;  2LP0 A;  1WSU A;  5LGT A;  2MC4 A;  1DUX C;  2COB A;  4E7J A;  4BUP A;  2FXA A;  2EZL A;  2JTV A;  2GQQ A;  3KP3 A;  1FSE A;  1Z05 A;  1VQ8 I;  5K7H A;  4KT5 C;  4Y15 A;  1OCC H;  1K6O A;  4AYB N;  1OKR A;  4BU2 A;  5EZH A;  4IF4 A;  1SFK A;  4BQO A;  1WPK A;  5CPR B;  1S6L A;  3WU2 C;  3CCU I;  4RM2 A;  3BY6 A;  5DEQ A;  1PP8 F;  1G3Y A;  5CLS A;  3CC2 I;  4D5F A;  2NVY J;  4XKB A;  2ZFW A;  3QOP A;  1UZC A;  5FKK A;  4ASN A;  3I55 I;  1X3W B;  2ZKZ A;  2ME6 A;  3RSN A;  3E97 A;  4ZJZ A;  4IO9 F;  2WAQ N;  3CO7 C;  1Y39 A;  1AKH A;  2LSO A;  2VKD A;  3GCM A;  1GXQ A;  1E0E A;  3FX3 A;  4JBA A;  4Q4Z F;  4KNY A;  3M8E A;  4NDL A;  1KQ8 A;  3JSP A;  3FWE A;  4JQF A;  2GXG A;  5DD4 A;  3FXR A;  2GIV A;  1HDP A;  2L9V A;  2X0L A;  1SD6 A;  4XON A;  3IH3 A;  5LFA A;  2XGD A;  1T6S A;  3A03 A;  1ZEL A;  1J9I A;  2BBY A;  2X6Y A;  4BBR J;  4IRI A;  2IGK A;  2LKP A;  1FJL A;  1REP C;  4EM0 B;  3L2U A;  3LQQ A;  2YPR A;  3T8R A;  5BPD A;  3A01 B;  2GA2 A;  2Z9O A;  4L0Z B;  2E19 A;  2XDV A;  5J4Y A;  1IXC A;  1XSX A;  3FXO A;  5EGO B;  4ESJ A;  4XK4 A;  3BG9 A;  3QP5 A;  1R23 A;  2VON A;  5DD8 A;  1VZ0 A;  3CP2 A;  2DO7 A;  3G71 I;  1VQ9 I;  1WVR A;  4XOR A;  5JR3 A;  2FOK A;  1LUJ B;  5HS9 A;  2MH9 A;  3MAJ A;  1ZRE A;  3CDL A;  1FY7 A;  3UKG A;  3U1D A;  2EFN A;  4R1H A;  2X48 A;  3GUD A;  2LNB A;  2VE8 A;  1ETO A;  1HKT A;  1P2F A;  2R3S A;  1W7P B;  2QEN A;  2RGV A;  3CJR B;  3E6M A;  5D5V B;  2IS1 A;  2LBF A;  1Z6R A;  3HOU J;  2CS3 A;  3K4L A;  2DA2 A;  2HEO A;  1A6Q A;  3KEY A;  3DU5 A;  2VBW A;  2FE3 A;  3OYF A;  1ZG1 A;  2ICW G;  1TNT A;  1D8K A;  3CQZ J;  3QRF F;  3HUG B;  5FKN A;  5F04 A;  3JRI A;  1UEL B;  4G7H F;  3VSL A;  1MH4 A;  2IA2 A;  1IG7 A;  4ON0 A;  1HQC A;  3G2B A;  5HS8 A;  2E2J J;  1JKO C;  1ZR4 A;  1BA5 A;  5B5E C;  2COM A;  4I02 A;  3JTG A;  1PUF A;  2PN6 A;  3JRE A;  4KIB A;  2A61 A;  4A2U A;  1GHC A;  3FIS A;  3DP7 A;  1UAA A;  3OYD A;  2K5C A;  3WHB A;  2VT2 A;  1PDN C;  1ETW A;  1H8A C;  2LYC A;  1K7A A;  2X1D A;  3LSJ A;  3HOY J;  2A6T A;  2H1K A;  2UV1 A;  4XOT A;  3J81 K;  1OCR H;  1CGP A;  2NS0 A;  1JKR C;  4BH9 A;  4KMF A;  4BNC A;  3C18 A;  5EF6 A;  2R5Z A;  1Y56 A;  2TDX A;  1ZGA A;  1RET A;  2M0M A;  1ZLK A;  3U21 A;  4DYQ A;  1FT9 A;  3L2R A;  1FIP A;  2W48 A;  4XN0 A;  2E60 A;  2KQR A;  3D5S C;  3H9J A;  3DEE A;  3F3X A;  2XAG A;  5K5O A;  1JJ8 C;  3ZQG A;  3GFM A;  4WCG A;  3W2V A;  2E36 A;  4A93 J;  2NVT J;  3QPL A;  4JX6 A;  4HQE A;  1MMG A;  4II2 A;  1A36 A;  4QWQ A;  2GZW A;  2V9K A;  2DJN A;  5FKM A;  2G7U A;  1XCV A;  2K3P A;  1XDS A;  3G4S I;  1R5I D;  2OAZ A;  4YIF A;  4QTR A;  5BPI A;  1J75 A;  3BT9 A;  4A0Z A;  1T38 A;  2V79 A;  1RR7 A;  1I27 A;  2DTZ A;  2BYV E;  2B7E A;  1BI1 A;  5FLX Z;  2DQR A;  3FKI J;  2NVU B;  1A04 A;  4G6T B;  2LY2 A;  3R4K A;  1FC3 A;  3RCO A;  5J4V A;  3RZO J;  2AQF A;  4ZYD A;  1BJA A;  1MH3 A;  2IW5 A;  4CYC A;  1XB4 A;  1ONV A;  2ZB9 A;  5CJ9 A;  1H9G A;  4KDP A;  2QVO A;  4HLX A;  4XSX F;  2Z1D A;  4P96 A;  3S1N J;  3I4N J;  3DBH B;  2QBY A;  2VPR A;  3QU3 A;  3J81 Z;  3DPU A;  1I3Q J;  4IL6 C;  3CLQ A;  5J40 A;  5K7F A;  4C2U A;  1ZRD A;  2WA0 A;  1U9O A;  4XLC A;  4NC8 A;  1RPW A;  3L9F A;  1IN6 A;  2A3S A;  2XAS A;  2HR3 A;  4IRG A;  1UB9 A;  5ILU A;  3WE2 A;  2LC2 A;  3HBL A;  1YS6 A;  3ZGK A;  4CA0 A;  1EJ9 A;  2G7H A;  1U5T B;  4XLF A;  1LDD A;  1OLT A;  4ZDP A;  4I09 A;  4HBL A;  4Y3O A;  3QU6 A;  4IX7 A;  2LVS A;  2BVM A;  2JWT A;  3V42 A;  4DBQ A;  5ICE A;  1E3H A;  3DKX A;  4EJW A;  3TMO A;  1ZGJ A;  4UUS B;  4S04 A;  1T33 A;  2VUM J;  1WJA A;  5HOD A;  2QA4 I;  3I71 A;  2YX4 A;  2D45 A;  3DTK A;  1J09 A;  1ZG5 A;  5E1Z B;  5EEH A;  3IWF A;  1FX7 A;  2KIS A;  1T2K A;  1JGS A;  4II3 A;  1JGG A;  4MTD A;  3A4C A;  3GME A;  4RAG A;  2JA6 J;  4FX0 A;  1OCO H;  3RJP A;  2JT1 A;  2LR8 A;  1ON1 A;  5CVR A;  1E3O C;  4MQV A;  5H6R A;  5D6E A;  3K7A J;  3ISP A;  3VOD A;  1H89 C;  2VQC A;  2XPW A;  3J80 Z;  4IHT A;  3PNT A;  5CVU A;  5E20 A;  3W6J B;  3S3N A;  1D3Y A;  4HOB A;  3AG4 H;  5FLM J;  2PQ8 A;  4MFD A;  4ZTF A;  3S3O A;  3JW4 A;  4EM1 A;  2TRT A;  5LEJ A;  4XBF A;  1S3J A;  1SVL A;  4IEJ A;  3CES A;  1T0F A;  1VQK I;  1TQI A;  4EJV A;  4A5M A;  3L09 A;  2Z33 A;  1P9Q C;  3H5A A;  4U0W A;  3RKX A;  1E3P A;  2CQQ A;  4FAS D;  1EA3 A;  4FQG A;  1HBX G;  3PNY A;  2E7X A;  5IP9 J;  3X2Q H;  2GXA A;  4ENJ A;  5E3O A;  2DA1 A;  2DA6 A;  2M5W A;  2VLA A;  4KA4 A;  1LFB A;  2R4G A;  1WJE A;  3ERE D;  1VQL I;  3OL3 A;  4B09 A;  3CCV I;  2F48 A;  4C30 A;  4Y17 A;  4RGU A;  3OYA A;  3DTE A;  3IH4 A;  3H5R A;  2H6B A;  2OUM A;  3OYN A;  3QAH A;  2ID3 A;  3MD2 A;  4MEY F;  4A3L J;  1OR7 A;  3Q0V A;  3V8L A;  4KN7 X;  1DGR M;  3ROU A;  4XKV A;  1VQ6 I;  4PJN A;  1HXD A;  1WZ2 A;  3GW2 A;  4ZZL A;  5BMZ A;  3B6A A;  4RS8 A;  2MLG A;  3HOS A;  2A5Y B;  4M74 A;  2FQ4 A;  3F8C A;  1IZ1 A;  2K9L A;  2V1D A;  1ZH5 A;  2XPV A;  2CW7 A;  4NHJ A;  2M34 A;  3TGN A;  3DFG A;  1MZB A;  1WH5 A;  3RI4 A;  4HV6 A;  2VT3 A;  3PSF A;  4AD9 A;  1DQU A;  5J1U A;  1G59 A;  3OYJ A;  3COA C;  1MD0 A;  1MJ9 A;  1G8X A;  2WBM A;  3O6B B;  2P6T A;  3A0B C;  2KP6 A;  2XC7 A;  1OQY A;  4WK8 F;  1T0F C;  4L9T A;  1P7I A;  2OZU A;  1Z9C A;  3CD6 I;  4G8X A;  3HDD A;  1JT6 A;  2QGU A;  2E5N A;  3CDH A;  1DPU A;  1AWC A;  1PUF B;  4OU0 A;  4PDK A;  4RGR A;  3WTX C;  2QSH X;  3CDI A;  2K7L A;  3OYK A;  1NK3 P;  2QZ8 A;  2A05 A;  2OTL I;  2L5Q A;  2AQE A;  3PL8 A;  1CF7 A;  3G6E I;  1ZAO A;  1IV6 A;  5IP7 J;  5D8L B;  2DFE A;  3BR3 A;  3FK7 A;  4MNU A;  4FIS A;  3VB2 A;  3ULQ B;  3H36 A;  1BBY A;  3SYT A;  2P7C B;  2M4G A;  4YG2 F;  4O3M A;  2ZNY A;  1MNE A;  1T8I A;  3W3C A;  1Z67 A;  4AIJ A;  3CCY A;  3BQY A;  3LA7 A;  3KEQ A;  1Z77 A;  2FMY A;  4V2F A;  4UXN A;  1R00 A;  4MIM A;  1IGN A;  3WTW C;  2NNN A;  4UV8 A;  1R5G A;  1YQA A;  2DPU A;  2CMP A;  2XAJ A;  2OCE A;  1VND A;  2RRE A;  4EVI A;  2R92 J;  1DU6 A;  3BOQ A;  1BW6 A;  4Y33 A;  1QZE A;  3QPS A;  3R0A A;  2LLK A;  5KHD A;  3OYG A;  2H94 A;  3GVA A;  2ZBK A;  3E6D A;  4OOI A;  2VJI A;  3F8N A;  1YJN I;  2M7A A;  2LG4 A;  2M30 A;  4DYC A;  2CV2 A;  4BXF A;  1B59 A;  5GAG J;  1J0R A;  3DEW A;  2Y31 A;  2ZNZ A;  5J1R A;  1I3A A;  1Y8Q B;  2A68 F;  3TW7 A;  2IEK A;  1YS7 A;  4X1E A;  4OIQ F;  4HF0 A;  3K2A A;  1TTY A;  4PSW A;  4CYC B;  3G73 A;  4HG2 A;  3WTY C;  2L9S A;  4FE4 A;  5E3L A;  2EFW A;  1LNW A;  3SQN A;  1Z21 A;  4EJU A;  3WG7 H;  3P9C A;  3M8F A;  4O6J A;  2K40 A;  2DPD A;  3LFK A;  1XSV A;  3G1L A;  3H1C A;  5JVG F;  4C2T A;  4EMS A;  2E1N A;  3DF8 A;  5LRS A;  4OIR F;  5L3F A;  2O8X A;  3MKW B;  3E1S A;  2VB6 A;  3KET A;  1N77 A;  1NK2 P;  3K1P A;  4ZDO A;  1H0M A;  3TDZ C;  1EH8 A;  3ABL H;  4M9Z A;  2XGC A;  3P7N A;  1V3F A;  3JSO A;  1F4K A;  1ZKG A;  3F6V A;  4LOC A;  4HNV A;  2M3A A;  5HNF A;  2F4O B;  1OYY A;  1SFE A;  3TOB A;  1MBE A;  2BW3 B;  2QWW A;  2JSC A;  3RYR A;  4U7B A;  3WTV C;  3EUH C;  4LGW A;  1TLH B;  5A2Q K;  3R60 A;  2JA2 A;  2HS5 A;  2EFQ A;  3G1M A;  2UXX A;  5ICF A;  2KLO A;  4AU7 A;  3OS1 A;  3ZQF A;  4N9I A;  2G9W A;  2IGO A;  3CCR I;  2EJR A;  1HLV A;  2DA7 A;  2MD0 A;  3W6K B;  4A6D A;  3HL2 A;  1TT5 B;  4A3F J;  3HM5 A;  4RMN A;  2AXL A;  3LSR A;  1YOV B;  2STT A;  2DMP A;  5IY5 H;  4AWX B;  2RV8 A;  2EIL H;  3C7J A;  1IAW A;  1YW7 A;  2W7N A;  1WI3 A;  5L3C A;  1EH6 A;  1RZ4 A;  3IRQ A;  1U5T C;  2DQL A;  2M8G X;  2QLZ A;  3ASN H;  3MN2 A;  4M73 A;  3HKZ N;  4DNC A;  2X6W A;  4Z6Y A;  3LNQ A;  1JXS A;  1KYW A;  4ZH4 F;  2GM4 A;  5J6X A;  2O8K A;  1BJZ A;  3S14 J;  1OCT C;  1D1B A;  2VJJ A;  3HJE A;  2R5Z B;  2ID6 A;  4E7I A;  2RQP A;  2DT7 B;  3CJQ B;  3GO5 A;  1UHW A;  5JFR A;  1QVT A;  4HEA 2;  3I9V 2;  1K78 B;  3P9K A;  4HNT A;  1U78 A;  2BY1 A;  1BR2 A;  2P5L C;  2KRH A;  1IXR C;  1MBK A;  4GYG A;  5EGO A;  4DZP A;  4EAT A;  2R5Y B;  1JHF A;  2VBX A;  3S1R J;  4XMY A;  2STW A;  2I5U A;  4ZC3 A;  3WOD F;  2MLK A;  3ZQC A;  1RUN A;  4UVA A;  1ZQ3 P;  3M9A A;  1BI2 A;  1G2H A;  3KYL A;  2XAU A;  2O3F A;  2Z16 A;  2Y0M A;  3HKZ A;  5H20 A;  1WFX A;  3FHZ A;  3FXK A;  3ZPL A;  1X3Z B;  3S17 J;  1D8J A;  2DK5 A;  4LIU A;  3ZMS A;  4LFU A;  2L4M A;  2QQ9 A;  4F91 B;  4ENK A;  9ANT A;  2EZK A;  3V7R A;  1IW7 F;  1MBJ A;  5LGN A;  3NQO A;  3REO A;  1OR7 C;  1W36 C;  2E35 A;  3WGG A;  1X2M A;  3W6V A;  1D0X A;  5F0H A;  2L7Z A;  1WJF A;  2R7U A;  1F5T A;  2P81 A;  4M3D A;  4B1R A;  5AIQ A;  2WV1 A;  2QQ8 A;  2IRF G;  4A3C J;  3M4O J;  2HXO A;  1GDT A;  2MBF A;  2XB5 A;  4BJT A;  4XN3 A;  4MLO A;  3PO2 J;  1X4O A;  3PFY A;  1T08 B;  2FU4 A;  1MMA A;  3FMS A;  3Q0W A;  1SAN A;  1XMX A;  4F7Z A;  4Z2Y A;  1D0Y A;  2HXI A;  3K9T A;  3OOU A;  1YIT I;  3B6C A;  5F08 A;  3LOC A;  4ETS A;  2CQN A;  2CW8 A;  3ZQ7 A;  1XG1 A;  2JRM A;  4BXX J;  2R7V A;  3AFH A;  2KJC A;  4UHT A;  1NG6 A;  2O0Y A;  2OTJ I;  1T56 A;  1P7J A;  3L2C A;  4A3J J;  1ZAR A;  1FYM A;  1ITY A;  5D4S A;  2M1B A;  2FRH A;  3ECO A;  1SFX A;  4HW0 A;  3S16 J;  1KQ0 A;  1Y6I A;  1TC3 C;  3KX2 A;  4XLP F;  3I4P A;  3S32 A;  5GAE J;  2VI6 A;  2X9D A;  1FOK A;  2E7W A;  3ZN0 A;  2MD5 A;  3ZXS A;  1W1W E;  1XS9 A;  3JCU C;  5D6F A;  2PFB A;  1YJ9 I;  1W5C C;  1ETK A;  2HZD A;  1RES A;  5F1J A;  2HPM A;  4LMY A;  2EPF A;  3BTC A;  6PAX A;  4ZTJ A;  1WI9 A;  3PQJ A;  3K69 A;  4IVN A;  2KFD A;  3BG3 A;  1LDK B;  4IHW A;  1FBU A;  5IYC J;  1KA8 A;  1RUO A;  3ELK A;  3DBR B;  4OWR B;  3WTU C;  1YIO A;  2FD5 A;  1F36 A;  2M0C A;  3E5X A;  3GF2 A;  2M8E A;  3HOV J;  1G3S A;  5CVI A;  3H92 A;  4B44 A;  2DW4 A;  2PJR A;  4LK1 F;  1S8N A;  4MTE A;  3HSR A;  4PGG A;  4WXD A;  2RDP A;  3ABM H;  3BPV A;  4J19 A;  4HLY A;  1YLF A;  4U88 A;  1JT0 A;  2D1H A;  2EH3 A;  3CJT B;  5ILS A;  3KZI C;  4OMY A;  1MMS A;  2WWY A;  3S8P A;  3KZY A;  4L5I A;  1X19 A;  2K9M A;  5DTD A;  3R6S A;  3F8F A;  3D1N I;  1FYK A;  1TW3 A;  5CKT A;  3CCL I;  3L1P A;  3SZG A;  1N75 A;  3GTJ J;  3E5U A;  5LRR A;  2IGN A;  3HHH A;  2WAE A;  1V55 H;  3LSG A;  2BOL A;  2HTS A;  3V4G A;  4M3G A;  4D9J A;  5DM7 F;  3CCE I;  4BJ5 C;  1TWF J;  1VI0 A;  3ABT A;  3EPZ A;  3LSI A;  5ICC A;  3HTU A;  2M4K A;  2OPT A;  4H0E A;  2HQR A;  1QPM A;  1V54 H;  4W97 A;  2R7X A;  3NWT A;  2FNA A;  1V5F A;  1IRX A;  1IJW C;  3BJ6 A;  3CUQ A;  3CF2 A;  3JRA A;  1SEU A;  3K1N A;  4JOM A;  1TP4 A;  3E6B A;  2XF7 A;  1R36 A;  1IRG A;  3BJO A;  2FOW A;  3TDU C;  5BNG A;  5L3B A;  1FP2 A;  2QSG X;  2G0E A;  1NG7 A;  3FXQ A;  1MSE C;  2YS9 A;  4NUB A;  2DMT A;  3A1Y A;  4FET A;  4LB6 B;  4HDU A;  3VEP A;  1VQ5 I;  1EH7 A;  4IHS A;  1IN5 A;  3DPT A;  1MBH A;  1YIJ I;  4N9H A;  4M71 A;  4A5N A;  3BP8 A;  1QVU A;  1I6H J;  1XTA A;  4L9N A;  5EEG A;  2MAB A;  2O03 A;  2RC4 A;  2YU3 A;  3GLX A;  1FNN A;  3I64 A;  4NBQ A;  3HB9 A;  4RB0 A;  2HOE A;  1J59 A;  3ASO H;  3BJA A;  3CJN A;  3OYI A;  4XKW A;  1IO2 A;  4CIC A;  4KIG A;  3TP0 A;  4GRI A;  2ZC2 A;  3ECH A;  1N25 A;  3KZZ A;  5F27 A;  2NNY A;  1T39 A;  2B0L A;  5KAF C;  2E1C A;  2EV5 A;  2ZXW H;  1HKS A;  3AG1 H;  3ZR8 X;  5GTH C;  2F5D A;  4BKX A;  3MWM A;  5D5W B;  4E7L A;  2OBP A;  5F0F A;  1WGX A;  4CXF A;  1BW5 A;  2AHQ A;  5FD6 A;  2XAH A;  1B6A A;  4ZYH A;  4BY1 J;  1UCR A;  3OL4 A;  3RTR A;  2AS5 F;  2NS7 A;  1ODD A;  2K02 A;  1Y0N A;  4G9Y A;  3WTS C;  2JPC A;  3JRB A;  4C3J J;  2R7F A;  1XMK A;  1H88 C;  4UY8 I;  2Y30 A;  3ZP5 A;  2H27 A;  4XRS G;  1Y1W J;  5DYM A;  4BL0 B;  2JA8 J;  3BR5 A;  1MGT A;  5IYB J;  4A0X A;  4HRI A;  2BXY A;  2FBI A;  1ETX A;  4AM3 A;  1TWC J;  3QQA A;  3S2H J;  1SFU A;  4XOP A;  4P5O A;  2HZT A;  1DPR A;  3GXO A;  1KU7 A;  1GT0 C;  3PO3 J;  2V9P A;  2BXZ A;  5EDN A;  3CZ6 A;  3BTJ A;  1LEA A;  1P4A A;  3CMM A;  3KE2 A;  1OJL A;  4IOA F;  2JQ7 A;  2V6E A;  3H5N A;  2RQQ A;  1GLN A;  3OIO A;  1GVD A;  1HCR A;  1P4W A;  4E4H A;  5L3D A;  3K2Z A;  3A02 A;  1XGO A;  1T95 A;  4BDZ A;  4ENM A;  1R71 A;  2Y75 A;  4PK4 A;  3ZMV A;  1B8I B;  1MMN A;  4U87 A;  3GFI A;  1UG2 A;  2GA1 A;  2X1C A;  4I2O A;  2Z5U A;  2P0W A;  3FM3 A;  2FML A;  4CCO A;  2F5F A;  1C0W A;  3OY9 A;  3S3M A;  5C4J J;  2K86 A;  2J5O A;  3KPH A;  2DDA A;  3HSE A;  1A31 A;  2AO9 A;  5E1W A;  2M2E A;  3E0J B;  4BAC A;  1O3R A;  4M6X A;  2L9R A;  3BZC A;  2EV6 A;  3ZQH A;  4IRH A;  1J7K A;  4PSX A;  3D5L A;  3TO9 A; 
#chains in the Genus database with same CATH homology
 5LBQ A;  1H9T A;  2CGP A;  4R79 A;  1W7P D;  2RNJ A;  1G6N A;  5FFX A;  2OA4 A;  3I53 A;  1ZHF A;  2WV0 A;  3MZH A;  3KLN A;  1XGN A;  1YW9 A;  4GCV A;  1R5H A;  1P92 A;  1ON2 A;  4LB5 A;  2PMH A;  3HHG A;  1F9N A;  1P4X A;  3OV8 A;  4CGZ A;  2YX7 A;  3WG9 A;  5BQT A;  5L3E A;  1R7J A;  2K4B A;  2UZK A;  4A6E A;  3GYH X;  4I0A A;  2ZJ2 A;  1D5V A;  2A69 F;  1BOA A;  3T1B A;  2JZY A;  1Z91 A;  4A0Y A;  4I0B A;  4M9X A;  4IXA A;  4D0P A;  3CTA A;  4MEX F;  3DEU A;  4XLN F;  2L01 A;  1XGM A;  1RNL A;  1AOY A;  4I7H A;  1XCB A;  2PBI A;  5F6F A;  1JE8 A;  1R22 A;  4I98 B;  4WXH A;  2XKO A;  4R8H A;  4NQW A;  2FNP A;  2J5P A;  1MKM A;  2EB7 A;  1DDN A;  5LHI A;  2ZXJ A;  2VN2 A;  2C6Y A;  2YR2 A;  2DT5 A;  1KQ9 A;  4YFX F;  1B9M A;  3LA3 A;  4KN4 X;  1L3L A;  1FYL A;  4KIF A;  5K5R A;  3KLO A;  2IJL A;  3IL2 A;  4NB5 A;  5JI6 A;  2DAO A;  3JTH A;  1KGS A;  3GFJ A;  3IC7 A;  1BIA A;  4BAY A;  5J8C A;  1I1S A;  3I54 A;  3F23 A;  4G6Q A;  3TQN A;  3QPT A;  5HDN A;  1R58 A;  3FZV A;  2CQK A;  5HVQ C;  3P9I A;  1L0O C;  3BPX A;  1KYZ A;  4CHU A;  3F72 A;  1G3W A;  1XSD A;  2WTE A;  4Q48 A;  3KEO A;  3T5X A;  1T98 A;  2HYF A;  4HX8 A;  1IN8 A;  3HOT A;  2D1V A;  2CO5 A;  5F64 A;  5JHU A;  1TBX A;  4UV9 A;  2Y48 A;  3N4M A;  2IT0 A;  1QZY A;  5J8F A;  2EK5 A;  2QBY B;  2P8T A;  1ZLJ A;  3ZN1 A;  1ULY A;  1B9N A;  4RB2 C;  3IKT A;  4EGY A;  1IN4 A;  3Q5F A;  2VOD A;  2JPB A;  1RI7 A;  3V7S A;  3D0S A;  1FZP B;  4EQQ A;  5TJJ A;  3E3V A;  5CVJ A;  1YFH A;  2L4A A;  2XAQ A;  2L3D A;  4LG0 B;  3WTZ A;  5K5Q A;  2ISY A;  4ZYG A;  1OPC A;  1Y0U A;  3FXU A;  2HWV A;  2KKO A;  4UNO A;  3F6O A;  3HRU A;  2ISZ A;  4LLN A;  3B73 A;  5FFZ A;  2XAF A;  3IKV A;  5AIP A;  2CYY A;  1Q1H A;  4M6Y A;  5LLQ A;  4HYE A;  4RAY A;  1W4M A;  3RIR A;  1LB2 A;  2GAU A;  2KJB A;  5D8K B;  1XMA A;  1UST A;  1IF1 A;  4G7Z F;  4LD5 A;  1F1Z A;  4G94 A;  5HLH A;  2RKH A;  3KP2 A;  1WWX A;  2KIF A;  1SD7 A;  2LF7 A;  1LEB A;  3RPU A;  3ZMU A;  2H09 A;  4CDG A;  4LLL A;  4OIN F;  2Z3Y A;  5A2Q Z;  1TQP A;  5E1X A;  5IT9 Z;  1STZ A;  1WRJ A;  3WE3 A;  3PFI A;  1QO0 D;  1BC7 C;  3NEU A;  4AIH A;  3L00 A;  5FB2 A;  5D5X B;  3MZY A;  3HRM A;  2ETH A;  1ZN2 A;  1SMT A;  2FA5 A;  2HQN A;  3I58 A;  3KFW X;  4EJO A;  2OQR A;  4M72 A;  3CUO A;  3KP5 A;  1HW2 A;  2Q8K A;  2Q0O A;  1SD4 A;  1O57 A;  2EFP A;  3DQV C;  1ZRC A;  1YG2 A;  3GEZ A;  4PGH A;  1BIB A;  1U2W A;  1JHH A;  1E17 A;  3SZP A;  3SXY A;  2ZCW A;  2XRN A;  1O3T A;  3F8B A;  5E8G A;  5ILV A;  3MEX A;  3HUG A;  1YW8 A;  1FSH A;  3TOA A;  3CO6 C;  2F2E A;  5CVV A;  3MCZ A;  2GWR A;  1X3U A;  4WF2 A;  1HST A;  4AIK A;  2DTR A;  4L9J A;  3DKW A;  3PQK A;  2F5E A;  5HLG A;  1Z7U A;  5KK1 A;  3I59 A;  1MDM B;  2QUF A;  4RB1 A;  4OIP F;  2X4H A;  4LG0 A;  2V1U A;  4DQ2 A;  1O3S A;  5K1Y A;  4GO1 A;  2VOO A;  3F21 A;  3J80 K;  3E5Q A;  4MQ9 F;  3HSF A;  1XDU A;  2QQB A;  5BOX A;  5D4R A;  2A07 F;  3F8M A;  4CZZ A;  3I0T A;  2PEX A;  1FPQ A;  1MJB A;  1IRF A;  5ERI A;  3DXJ F;  2HGC A;  4AVP A;  4FT8 A;  1J2X A;  2NAZ A;  5TRD A;  4M9S A;  2FBH A;  4YFN F;  2JRT A;  1E2X A;  2XVC A;  2CG4 A;  4MHG A;  2CWE A;  4YFK F;  4OMZ A;  4S05 A;  1WKM A;  2OZ6 A;  1Z6T A;  3C3W A;  1GXP A;  3IWZ A;  3U2R A;  3EYI A;  4E70 A;  2K4J A;  4KIC A;  1K78 A;  3GZ6 A;  2LDU A;  5FD5 A;  4FX4 A;  5AON A;  2EA4 A;  3FMQ A;  3HRT A;  3BRO A;  2UXN A;  2W84 A;  3M1E A;  4UVC A;  3M7G A;  1BC8 C;  5ED4 A;  4HA8 A;  4P9U A;  4ZZD A;  5JVT A;  3FF5 A;  1XD7 A;  2ADU A;  1XGS A;  2VE9 A;  3KP7 A;  4PCQ A;  2XGX A;  3ABU A;  1G3T A;  3EET A;  3TKY A;  4U0V A;  1I1G A;  2DBB A;  5HDK A;  1KU2 A;  2ESH A;  3WU1 B;  3R61 A;  3CLO A;  3HTS B;  2W25 A;  3T0Y A;  5LHH A;  1KU9 A;  2BGC A;  5D5U B;  5FLX K;  3H3U A;  3GWZ A;  4CYD A;  4EGZ A;  2P7V B;  4WX9 A;  4HX4 A;  4XRF A;  2NRA C;  3EYY A;  4PZJ A;  5LHG A;  2LF8 A;  2HKX A;  4Q47 A;  2VBY A;  3CUQ C;  1Z1D A;  2Q2E A;  5LGU A;  3RDI A;  4P55 A;  4LK0 F;  1PP7 U;  2DFI A;  1FBQ A;  3DPL C;  4BHP A;  1O7L A;  4Y13 A;  2P5V A;  2XRO A;  4HV5 A;  1QBJ A;  5E18 F;  3CUQ B;  3C1D A;  3KP6 A;  2D2W A;  1LQ1 A;  3ZMT A;  1KU3 A;  1R1V A;  3WTT C;  1UHM A;  3LAP A;  4I01 A;  2V9V A;  2FSW A;  2V1X A;  4BHC A;  2H6C A;  3FM5 A;  5FO5 A;  2XIG A;  2XUB A;  1DP7 P;  2ACJ A;  2DI3 A;  3K0L A;  5L3G A;  5H6Q A;  2W85 A;  3HYI A;  1LVA A;  4IJA A;  3T8T A;  4KMU X;  5DCF A;  4RGS A;  1BI0 A;  1G4D A;  5BS6 A;  5DUI A;  1W7P A;  5IT9 K;  2CSO A;  4OIO F;  2OD5 A;  5HDG A;  3R0J A;  4HF2 A;  4EV0 A;  2GXB A;  3RKY A;  3DV8 A;  3Q9S A;  2F5C A;  2DLL A;  4B8X A;  4RAZ A;  2KRF A;  3I5U A;  1FWZ A;  2PG4 A;  2VXZ A;  1K79 A;  2XKP A;  4ENN A;  2HDC A;  4HAM A;  3U9G A;  1IXS B;  2P5K A;  3TO6 A;  4BHB A;  2QQA A;  4P9F A;  3SZT A;  5DCM B;  2O61 A;  5DCM A;  4U7D A;  1QZZ A;  4JK1 X;  2FBK A;  3HIF A;  3FMR A;  4Q5S F;  4ESF A;  1QQI A;  4GYI A;  3IRR A;  3EDP A;  4HZF A;  1J5Y A;  2FF4 A;  2IA1 A;  4L0Y B;  3NRV A;  2XHK A;  1I5Z A;  2A6H F;  3SHF A;  2Z99 A;  1HW1 A;  2VOP A;  5F1R A;  2YSR A;  2VBZ A;  5HOO A;  4BXU A;  1QNT A;  5HS7 A;  1U3E M;  3V8J A;  2PJP A;  2K27 A;  1I6X A;  4WWC A;  1R1U A;  1LJ9 A;  2R7D A;  1YTY A;  5CYV A;  4UUV A;  1HW5 A;  2CFX A;  3O3K A;  2WC2 A;  4K2E A;  1UFM A;  1SD5 A;  3VFZ A;  2OQG A;  1FLI A;  2EFO A;  4WXC A;  3G3Z A;  1WQ2 A;  2MH2 A;  3EUH A;  3LST A;  1S29 A;  3TO7 A;  1BN5 A;  2EA2 A;  4GGG A;  1FP1 D;  5DV5 A;  2HKO A;  2PI0 A;  1USS A;  1O7F A;  3V7C A;  3GX4 X;  2BV6 A;  1P6R A;  2KIM A;  3V8K A;  2O6G E;  3B02 A;  1ZYR F;  1PUE E;  1FBS A;  1OYW A;  2RVC A;  3BWG A;  2NYX A;  4HF1 A;  1BI3 A;  1U8R A;  1SAX A;  3QP6 A;  2BE5 F;  4ESB A;  3K1M A;  4EM2 A;  4N0B A;  1CF7 B;  2MA3 A;  3J7A O;  3JAM Z;  1HSJ A;  2M45 A;  2VC0 A;  1EV7 A;  2HTJ A;  2RN7 A;  5HLI A;  1V4R A;  4KFC A;  2EV0 A;  1YO5 C;  2HFH A;  2ZME A;  1OMI A;  2ZME B;  3WGI A;  3Q9V A;  4G6D A;  3ZMZ A;  1TW2 A;  3L7W A;  4IPA A;  1SMY F;  1BM9 A;  2CW0 F;  4L18 B;  1U6G A;  3RPQ A;  2OU2 A;  2QYO A;  2EWN A;  3S2W A;  4XSZ F;  2HYG D;  4O5V A;  4U0Y A;  2PLY A;  2MC3 A;  2BEO A;  3QPH A;  4YII A;  2W24 A;  3KCC A;  2ZO4 A;  3LAJ A;  4KUM A;  2VC1 A;  1VTN C;  1XN7 A;  2ELH A;  2XV4 S;  3AAF A;  4QLC U;  3GZ5 A;  4LJZ F;  1ZG3 A;  3LWF A;  4RB3 C;  3WGH A;  4HDV A;  4HX7 A;  2DK8 A;  3MQ0 A;  4EJT A;  3BDD A;  4GXO A;  3SFZ A;  1MJA A;  3KP4 A;  5ICG A;  1ZRF A;  4L9V A;  3O2P E;  1IUY A;  2IVM A;  4RGX A;  2QM3 A;  1GVJ A;  3ZMD A;  4KYW A;  3LQR A;  3JAM K;  3GFL A;  1S7O A;  3HRS A;  3RKW A;  2FQ3 A;  3VOE A;  1YYV A;  3IHU A;  4A12 A;  1QGP A;  4MGR A;  3E6C C;  2DU9 A;  1TQM A;  3H3Z A;  5IT3 A;  1B1B A;  2A6E F;  4ZYE A;  3N97 A;  1B4A A;  2FEZ A;  3ML6 A;  4G7O F;  5E8I A;  1R1T A;  5DUK A;  2W57 A;  2P6S A;  5E17 F;  2IPQ X;  3I59 B;  1MDM A;  1U5T A;  2L02 A;  3LA2 A;  2L54 A;  3OOP A;  2UWM A;  4FHT A;  4CO8 A;  3BZ6 A;  3WU0 A;  2IP2 A;  1S7A A;  5DDG A;  2PMU A;  5LEK A;  5KVR A;  2ESN A;  1NHA A;  2M87 A;  3EQL F;  4HQM A;  1RIO H;  2IA0 A;  1W5S A;  1TNS A;  3RYP A;  3F22 A;  3MFK A;  2V6C A;  4BQA A;  1OYI A;  1W5T A;  4LLG F;  4L5J A;  1O3Q A;  1IN7 A;  1LDJ A;  4TV7 A;  5FGM A;  4BYY A;  2P4W A;  4UVB A;  1HKQ A;  2KIU A;  1WSU A;  5LGT A;  1DUX C;  2FXA A;  2JTV A;  2GQQ A;  3KP3 A;  1FSE A;  1Z05 A;  4KT5 C;  4Y15 A;  1K6O A;  1OKR A;  4IF4 A;  1S6L A;  3BY6 A;  5DEQ A;  1PP8 F;  1G3Y A;  5CLS A;  2ZFW A;  3QOP A;  4ASN A;  2ZKZ A;  3E97 A;  3CO7 C;  2LSO A;  1GXQ A;  3FX3 A;  4JBA A;  4Q4Z F;  4KNY A;  3M8E A;  1KQ8 A;  3JSP A;  3FWE A;  4JQF A;  2GXG A;  5DD4 A;  3FXR A;  2GIV A;  2X0L A;  1SD6 A;  1T6S A;  1J9I A;  2BBY A;  4IRI A;  2LKP A;  1REP C;  4EM0 B;  3LQQ A;  2YPR A;  3T8R A;  5BPD A;  2GA2 A;  2Z9O A;  4L0Z B;  1IXC A;  1XSX A;  4ESJ A;  3QP5 A;  1R23 A;  2VON A;  5DD8 A;  2DO7 A;  5JR3 A;  2FOK A;  5HS9 A;  2MH9 A;  3MAJ A;  1ZRE A;  1FY7 A;  3U1D A;  2EFN A;  4R1H A;  3GUD A;  2LNB A;  2VE8 A;  1HKT A;  1P2F A;  2R3S A;  1W7P B;  2QEN A;  2RGV A;  3E6M A;  5D5V B;  1Z6R A;  2HEO A;  2VBW A;  2FE3 A;  1ZG1 A;  1TNT A;  1D8K A;  3QRF F;  4G7H F;  2IA2 A;  4ON0 A;  1HQC A;  5HS8 A;  2COM A;  4I02 A;  3JTG A;  2PN6 A;  4KIB A;  2A61 A;  4A2U A;  1GHC A;  3DP7 A;  2VT2 A;  1PDN C;  1K7A A;  3J81 K;  1CGP A;  2NS0 A;  4BH9 A;  4KMF A;  4BNC A;  3C18 A;  2TDX A;  1ZGA A;  1ZLK A;  1FT9 A;  3F3X A;  2XAG A;  5K5O A;  3GFM A;  4WCG A;  4HQE A;  4QWQ A;  2GZW A;  2G7U A;  1XCV A;  1XDS A;  5BPI A;  2OAZ A;  4YIF A;  1J75 A;  4A0Z A;  1T38 A;  2V79 A;  1I27 A;  2BYV E;  1BI1 A;  5FLX Z;  2DQR A;  1A04 A;  3R4K A;  1FC3 A;  4ZYD A;  1BJA A;  2IW5 A;  1XB4 A;  1ONV A;  5CJ9 A;  1H9G A;  4KDP A;  2QVO A;  4HLX A;  4XSX F;  4P96 A;  2QBY A;  3QU3 A;  3J81 Z;  1ZRD A;  3L9F A;  1IN6 A;  2A3S A;  4IRG A;  2HR3 A;  2XAS A;  1UB9 A;  5ILU A;  3WE2 A;  1YS6 A;  2G7H A;  1U5T B;  1LDD A;  4I09 A;  4HBL A;  3QU6 A;  5ICE A;  4EJW A;  1ZGJ A;  4S04 A;  3I71 A;  2YX4 A;  2D45 A;  1ZG5 A;  5E1Z B;  5EEH A;  3IWF A;  1FX7 A;  1T2K A;  1JGS A;  4MTD A;  4FX0 A;  3RJP A;  2JT1 A;  1ON1 A;  5CVR A;  4MQV A;  5H6R A;  5D6E A;  3VOD A;  3ISP A;  3J80 Z;  4IHT A;  5E20 A;  5CVU A;  3W6J B;  1D3Y A;  4HOB A;  2PQ8 A;  3JW4 A;  4EM1 A;  5LEJ A;  4XBF A;  1S3J A;  1T0F A;  1TQI A;  4EJV A;  4A5M A;  3L09 A;  2Z33 A;  4U0W A;  3RKX A;  1HBX G;  2E7X A;  4ENJ A;  2M5W A;  4KA4 A;  3ERE D;  4B09 A;  4Y17 A;  4RGU A;  2H6B A;  3QAH A;  4MEY F;  1OR7 A;  3V8L A;  4KN7 X;  3ROU A;  1HXD A;  3GW2 A;  4ZZL A;  5BMZ A;  4RS8 A;  3HOS A;  2MLG A;  2A5Y B;  4M74 A;  3F8C A;  1IZ1 A;  1ZH5 A;  2V1D A;  4NHJ A;  3TGN A;  3DFG A;  1MZB A;  3RI4 A;  4HV6 A;  2VT3 A;  4AD9 A;  3COA C;  1MD0 A;  1MJ9 A;  3O6B B;  2P6T A;  4WK8 F;  4L9T A;  2OZU A;  1Z9C A;  4G8X A;  3CDH A;  1DPU A;  1AWC A;  4OU0 A;  4PDK A;  4RGR A;  3WTX C;  2K7L A;  2QZ8 A;  1CF7 A;  1ZAO A;  5D8L B;  4MNU A;  3VB2 A;  3ULQ B;  2P7C B;  1BBY A;  4YG2 F;  4O3M A;  2ZNY A;  4AIJ A;  3LA7 A;  3KEQ A;  2FMY A;  4UXN A;  1R00 A;  3WTW C;  2NNN A;  4UV8 A;  1R5G A;  1YQA A;  2DPU A;  2XAJ A;  4EVI A;  3BOQ A;  3R0A A;  2H94 A;  3GVA A;  2ZBK A;  3E6D A;  4OOI A;  3F8N A;  2M30 A;  1B59 A;  1J0R A;  2ZNZ A;  2A68 F;  1YS7 A;  4OIQ F;  4HF0 A;  1TTY A;  3G73 A;  3WTY C;  2EFW A;  1LNW A;  3SQN A;  4EJU A;  3P9C A;  3M8F A;  4O6J A;  2DPD A;  3LFK A;  1XSV A;  4EMS A;  2E1N A;  3DF8 A;  5LRS A;  4OIR F;  5L3F A;  2O8X A;  3KET A;  3K1P A;  1H0M A;  3TDZ C;  1EH8 A;  4M9Z A;  3P7N A;  1V3F A;  3JSO A;  1F4K A;  3F6V A;  1OYY A;  1SFE A;  3TOB A;  2QWW A;  2JSC A;  3RYR A;  4U7B A;  3WTV C;  4LGW A;  1TLH B;  5A2Q K;  3R60 A;  2HS5 A;  2EFQ A;  2UXX A;  5ICF A;  4N9I A;  2G9W A;  2EJR A;  3W6K B;  4A6D A;  2AXL A;  2STT A;  4AWX B;  2RV8 A;  3C7J A;  1IAW A;  1YW7 A;  5L3C A;  1EH6 A;  1RZ4 A;  3IRQ A;  1U5T C;  2DQL A;  2QLZ A;  4M73 A;  4DNC A;  1JXS A;  1KYW A;  4ZH4 F;  5J6X A;  2RQP A;  3GO5 A;  1UHW A;  5JFR A;  1K78 B;  3P9K A;  1U78 A;  2P5L C;  1IXR C;  4GYG A;  1JHF A;  2VBX A;  2STW A;  3WOD F;  2MLK A;  1RUN A;  4UVA A;  3M9A A;  1BI2 A;  2O3F A;  5H20 A;  2Y0M A;  3ZPL A;  3FHZ A;  1D8J A;  2DK5 A;  3ZMS A;  4LFU A;  2L4M A;  2QQ9 A;  4ENK A;  3V7R A;  1IW7 F;  5LGN A;  3NQO A;  3REO A;  3WGG A;  1F5T A;  5AIQ A;  2IRF G;  2MBF A;  2FU4 A;  3FMS A;  4F7Z A;  4Z2Y A;  3K9T A;  4ETS A;  3ZQ7 A;  2KJC A;  4UHT A;  2O0Y A;  3L2C A;  1ZAR A;  1FYM A;  5D4S A;  2M1B A;  2FRH A;  3ECO A;  1SFX A;  4HW0 A;  1KQ0 A;  4XLP F;  3I4P A;  1FOK A;  2E7W A;  3ZN0 A;  2MD5 A;  5D6F A;  2PFB A;  4LMY A;  6PAX A;  1WI9 A;  3PQJ A;  3K69 A;  4IVN A;  1LDK B;  1FBU A;  1KA8 A;  1RUO A;  3ELK A;  3WTU C;  1YIO A;  3E5X A;  3GF2 A;  2M8E A;  1G3S A;  5CVI A;  3H92 A;  2DW4 A;  4LK1 F;  1S8N A;  4MTE A;  3HSR A;  4PGG A;  4WXD A;  2RDP A;  3BPV A;  4HLY A;  1YLF A;  4U88 A;  2D1H A;  5ILS A;  4OMY A;  2WWY A;  3KZY A;  4L5I A;  3R6S A;  3F8F A;  1FYK A;  1TW3 A;  3E5U A;  5LRR A;  3HHH A;  2HTS A;  3V4G A;  3ABT A;  5ICC A;  3HTU A;  4H0E A;  2HQR A;  1QPM A;  2FNA A;  3BJ6 A;  3CUQ A;  3K1N A;  3E6B A;  1R36 A;  1IRG A;  3BJO A;  3TDU C;  5L3B A;  1FP2 A;  3FXQ A;  4LB6 B;  4HDU A;  3VEP A;  1EH7 A;  4IHS A;  1IN5 A;  3DPT A;  4N9H A;  4M71 A;  4A5N A;  3BP8 A;  4L9N A;  5EEG A;  2O03 A;  2RC4 A;  2YU3 A;  3GLX A;  1FNN A;  3I64 A;  4RB0 A;  2HOE A;  1J59 A;  3BJA A;  3CJN A;  4CIC A;  4KIG A;  3ECH A;  3KZZ A;  2NNY A;  1T39 A;  2B0L A;  2E1C A;  2EV5 A;  1HKS A;  2F5D A;  3MWM A;  5D5W B;  2OBP A;  4CXF A;  5FD6 A;  2XAH A;  1B6A A;  4ZYH A;  1UCR A;  3RTR A;  2AS5 F;  1ODD A;  2K02 A;  4G9Y A;  3WTS C;  2JPC A;  2R7F A;  1XMK A;  3ZP5 A;  2H27 A;  5DYM A;  1MGT A;  4A0X A;  2FBI A;  1SFU A;  4P5O A;  2HZT A;  1DPR A;  3GXO A;  1KU7 A;  1LEA A;  1P4A A;  3KE2 A;  1P4W A;  5L3D A;  3K2Z A;  1XGO A;  4ENM A;  2Y75 A;  3ZMV A;  3GFI A;  2GA1 A;  4I2O A;  2Z5U A;  2FML A;  3FM3 A;  1C0W A;  2F5F A;  2K86 A;  2J5O A;  3HSE A;  5E1W A;  1O3R A;  4M6X A;  2EV6 A;  4IRH A;  1J7K A;  3D5L A;  3TO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...