2XV4S

Structure of human rpc62 (partial)
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
532
structure length
399
Chain Sequence
MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETTMDYAEVSNTFVRLADTHFVQRCPSIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKGMYVINLHKALASLATATLESVVQERFGSRCARIFRLVLQRTFYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analysis of Hrpc62 Provides Insights Into RNA Polymerase III Transcription
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE III SUBUNIT RPC3
total genus 150
structure length 399
sequence length 532
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF05645 RNA_pol_Rpc82 RNA polymerase III subunit RPC82
S PF08221 HTH_9 RNA polymerase III subunit RPC82 helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S03
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S04
5TJJA 4HOBA 2MLKA 1E2XA 4M9ZA 1HQCA 5LHHA 4RB2C 4YFKF 2NNYA 2OAZA 4Q5SF 2O61A 3V8LA 1HKQA 1W7PA 2LF7A 2Y75A 1R36A 3K2ZA 2L3DA 4HLYA 4I2OA 3RPUA 2BEOA 1MJAA 1HSJA 5LRSA 2ZJ2A 1R1VA 4Y17A 5HVQC 5E18F 2G7UA 5FD5A 4ESBA 2ZKZA 2P7VB 2M87A 2PN6A 5CVRA 2EFWA 2HFHA 1D3YA 3SZPA 4MTEA 3OV8A 2XKPA 4Z2YA 4MHGA 1OPCA 3BJ6A 3JSOA 1XCVA 3HRUA 3RPQA 4CYDA 4BHCA 3CO6C 1K6OA 4P9UA 1P4AA 4FHTA 2UXXA 5LHGA 3WU1B 4IHSA 4HX7A 5JI6A 1OKRA 5L3BA 2F5FA 4JBAA 5D4SA 1J5YA 4HQMA 4GYIA 4E70A 1B6AA 2JRTA 2P8TA 1BJAA 1XMKA 1SD5A 2QUFA 3VB2A 2ESHA 4OOIA 1O3TA 3HIFA 3L09A 5KK1A 3CUQC 1BI1A 2H94A 2NS0A 5EEGA 4PGHA 4KYWA 3ZMTA 2GZWA 3F8FA 2ZMEB 3ULQB 3HSRA 1ULYA 1B4AA 5LGNA 1U78A 1IXRC 3MQ0A 3LSTA 2VBXA 1NHAA 3KP4A 2VOPA 2V1DA 4FX0A 4LK0F 1ZRFA 1DP7P 3EYYA 3JSPA 5H6QA 4WCGA 3TOBA 2MBFA 1G4DA 1KU7A 1UFMA 3D0SA 1ONVA 1JE8A 5HDGA 4HF2A 3BJOA 1D5VA 2QQ9A 4O3MA 2H09A 1P2FA 1LJ9A 2GQQA 4IVNA 1O57A 1AOYA 1R5HA 2RQPA 3R61A 3R4KA 2F5EA 2XV4S 1QO0D 5BOXA 2ISZA 1SMYF 2H6BA 4QWQA 3CDHA 4EV0A 2PEXA 2MH9A 1J75A 1MKMA 3I4PA 4WK8F 1S3JA 2FE3A 2MLGA 3C1DA 2XVCA 2NAZA 5JHUA 3GFMA 2CW0F 3BY6A 3ECHA 1LEBA 1YS6A 3F8MA 4KIGA 2EJRA 5K5QA 4K2EA 3HHHA 3F3XA 2XHKA 1TQMA 4RB3C 3HOTA 4LLGF 3KZYA 1BI0A 4MNUA 3K1MA 3GF2A 2CG4A 1FYKA 2ZNZA 4CO8A 5D5WB 3N4MA 3EUHA 4EJVA 1BI2A 3QPTA 2GA1A 2WV0A 4PGGA 4QLCU 1FP1D 1XGOA 4RAZA 4IPAA 4LFUA 1Z6TA 3RI4A 5CVJA 1QGPA 1IAWA 4LB5A 1FLIA 2Z99A 3GX4X 4U0WA 4XLNF 5DV5A 1H9TA 5LEKA 2DPUA 2QLZA 5E20A 1Z91A 5HDKA 2GXBA 3P9KA 1XD7A 1S6LA 3GLXA 1QQIA 2CWEA 1U5TB 1LVAA 3DXJF 5DD4A 3EQLF 4N9IA 5LBQA 4ZH4F 3KE2A 5F6FA 1PP7U 5CVIA 3V7SA 2L4MA 2EB7A 3TDZC 1F9NA 5HS8A 4EGYA 2PFBA 4BAYA 4OIPF 1DUXC 3ZPLA 2P6SA 1SFEA 3VOEA 1YIOA 4KMUX 3KETA 5HS9A 1IZ1A 5J8FA 5BQTA 2IA0A 3J80K 3WTXC 5ICFA 4KMFA 4ENJA 3BP8A 2FA5A 3FHZA 2PG4A 2IPQX 4BH9A 4R1HA 1MDMB 1FSEA 6PAXA 1L0OC 4CDGA 1LQ1A 5DYMA 4YFNF 1XB4A 2KJCA 1QBJA 5DUIA 3F8BA 1P92A 4PDKA 2HOEA 4ZYDA 4A2UA 2VBWA 1MZBA 3QU3A 3RYPA 2EK5A 4OMYA 1O3RA 2EV0A 2DO7A 1LDDA 3Q9VA 2NYXA 1K7AA 4BQAA 5H20A 4NB5A 3T8TA 4AIJA 4I0AA 2GXGA 4H0EA 1XGMA 3WGHA 2PLYA 2WWYA 5K5RA 1Y0UA 4KN4X 5D5UB 1KYZA 3HTUA 3TOAA 2JZYA 3DKWA 3QP5A 1IXSB 3QAHA 1EH7A 3NQOA 4OIQF 3O6BB 4AWXB 2JT1A 2WC2A 3RDIA 5E1XA 1J2XA 4UV8A 1P6RA 3LQRA 1Z9CA 3FM5A 4CHUA 2ZCWA 1FSHA 2HR3A 4AD9A 1TNSA 3LQQA 3JAMK 1Z1DA 4Y13A 5KVRA 1R00A 3DPLC 4ESFA 1O3SA 1R1UA 4KDPA 2DAOA 2DT5A 1T38A 4M72A 5E8IA 2IJLA 1USTA 1RIOH 3ZQ7A 4I0BA 1FY7A 1KU3A 3T1BA 1ZLKA 5IT9K 4EMSA 1ZGAA 1FBSA 3R0JA 3NEUA 1F5TA 1IN5A 1WQ2A 1P4WA 1V4RA 3F6VA 2GA2A 2STWA 3KLNA 2D1VA 2BV6A 3KCCA 3K1PA 3M8EA 2ZXJA 4HZFA 2L01A 4AIKA 2HQNA 2DU9A 1FNNA 2O03A 2HYGD 2VODA 2Z3YA 4WX9A 2A3SA 4HA8A 1HSTA 1I6XA 2J5PA 3E6CC 4ZZDA 2O6GE 5A2QZ 3EDPA 4MEYF 2RDPA 4DQ2A 1YYVA 2Z9OA 2LKPA 3K69A 2W57A 2FBKA 1GVJA 3B73A 2PI0A 2J5OA 5ERIA 4BHBA 3Q9SA 3JW4A 1S7AA 2RKHA 5DDGA 1RUNA 2R7FA 4OMZA 3F23A 2F5DA 4LB6B 1WWXA 3KEQA 2K86A 3KP3A 4ZYGA 1R5GA 3WTZA 1G3TA 3ZMSA 4L18B 4EJUA 2DK5A 5BMZA 3QP6A 4HX8A 2Z5UA 1KQ0A 4L9JA 1W5TA 2DLLA 1LNWA 5IT9Z 3I59A 3ZP5A 3HTSB 4ASNA 2ELHA 4MGRA 3DEUA 4M71A 2FMLA 3FXRA 5IT3A 1BBYA 3IWFA 1XGSA 2P5LC 3RJPA 3GWZA 2QWWA 4BNCA 5A2QK 3WTUC 3ECOA 1E17A 3KP5A 1REPC 4I02A 4I7HA 4CXFA 4RGRA 1CF7A 1O7LA 2GAUA 3DF8A 2Y48A 2X0LA 3HYIA 3I54A 3P9CA 2KRFA 2LSOA 2DQRA 5LEJA 1TNTA 3VEPA 4KUMA 3ML6A 2DW4A 3L9FA 2RC4A 4UVAA 4M9SA 3MZHA 2XUBA 3ZMDA 1R1TA 2PJPA 1I27A 1XCBA 2K7LA 1GHCA 2VBYA 1ZYRF 2FBIA 3GUDA 3F22A 3ZMZA 2LF8A 3I0TA 4M73A 4RB0A 2E1NA 5CVUA 3E6MA 1U5TC 4GYGA 1J7KA 3E5UA 2VONA 4S05A 4U7DA 3I58A 4RGUA 4BYYA 1LB2A 2V1UA 3E5XA 1IUYA 3W6KB 3MFKA 2QENA 3GZ5A 5K1YA 5L3FA 4RB1A 5ILUA 5D6FA 4RAYA 3V4GA 1RI7A 2KKOA 2L4AA 1P4XA 3V7RA 3HSEA 5HLGA 1MDMA 2YR2A 4L5IA 2UXNA 2O8XA 4NHJA 3H92A 1ZG5A 2STTA 1XSDA 4OINF 3T5XA 1SD4A 3CUOA 4JQFA 3TGNA 4HF1A 1U6GA 3RKWA 3ABUA 1TLHB 3KP6A 4KIFA 2FSWA 2VT2A 3M1EA 1MJBA 3TQNA 4U0YA 1MGTA 3CUQA 1UHMA 2EA4A 5BPDA 1SAXA 2TDXA 3Q5FA 4LLNA 1IN8A 4TV7A 3J7AO 3IL2A 2KIUA 5H6RA 1K78A 2D45A 3GFLA 1OMIA 5K5OA 1DDNA 2P4WA 3IRQA 2IA1A 4OIOF 4P9FA 2ESNA 4KFCA 1ZGJA 1ZHFA 5CJ9A 1SFUA 2K02A 4A6EA 4IF4A 1B9NA 3MAJA 5FLXZ 1XSXA 2A69F 3FM3A 2BYVE 5FO5A 1ODDA 2G7HA 2K4BA 5BPIA 1STZA 4G6QA 2C6YA 4GO1A 5ICCA 1QPMA 5CYVA 4D0PA 3DFGA 3J81Z 3V7CA 3WTYC 1UHWA 4ON0A 4G7HF 2EFNA 1JHHA 4KN7X 3VODA 3D5LA 3HSFA 4G8XA 1T2KA 3CO7C 4A0XA 5ILVA 3MCZA 2RV8A 3O3KA 4G9YA 2ZMEA 3RKXA 3CJNA 1JHFA 3FMSA 4UV9A 4L9TA 1B9MA 2JTVA 1OYWA 3CUQB 2IVMA 3GFIA 3WE2A 4IHTA 3LAJA 3ABTA 1FPQA 2FEZA 4EM1A 1WSUA 1TW3A 2HGCA 3F72A 3SHFA 2VBZA 1SFXA 2M45A 1Z7UA 1RNLA 4EQQA 1FC3A 1T98A 4IRGA 2PMHA 2IW5A 4U88A 3RKYA 2F2EA 3S2WA 2L54A 3FZVA 2KIFA 1BC7C 2K27A 2D1HA 3U1DA 1XMAA 3E97A 3SFZA 1BI3A 2PBIA 2A07F 2AS5F 2RVCA 1CGPA 3KEOA 4FT8A 4ZZLA 1YS7A 4U0VA 3I59B 4HBLA 4LK1F 2E7XA 1BM9A 1VTNC 4MQVA 1BIAA 3SZTA 3FXUA 2IT0A 1IN6A 2JPCA 4M6YA 1W4MA 3LWFA 2DK8A 4HF0A 2ZBKA 1CF7B 2VT3A 1Z6RA 3ROUA 4MEXF 1XDSA 1JXSA 2QBYB 1HKTA 2XAFA 2CO5A 3LAPA 4L5JA 4PZJA 3PFIA 3COAC 2MD5A 3W6JB 3J80Z 1TW2A 3N97A 2RN7A 5JFRA 1B59A 1J9IA 2Y0MA 1OR7A 1FWZA 4ENKA 2RNJA 2OZUA 4EJOA 5L3GA 3SXYA 5F64A 3G3ZA 2EV5A 1L3LA 2DTRA 4YFXF 4G6DA 1BN5A 5D8LB 3ERED 2HDCA 2OA4A 5ICGA 1J0RA 1LDJA 5CVVA 2F5CA 3JTGA 2XKOA 3V8JA 4L9VA 4Q4ZF 4UNOA 5L3CA 4XBFA 1YLFA 5F1RA 3E5QA 3FMQA 4HX4A 1WKMA 3KLOA 1TQIA 2A6EF 1BC8C 3WTTC 3KFWX 1HXDA 2O3FA 3C18A 2VC0A 3FX3A 1F1ZA 5HDNA 1YW8A 4U7BA 2DI3A 1KQ9A 2G9WA 5FB2A 4O6JA 4ENNA 3QPHA 5D8KB 5LHIA 5ICEA 1ZRDA 2OZ6A 4YIIA 3JAMZ 4L0ZB 3WGIA 1K78B 3FXQA 3H3ZA 2VXZA 2ZNYA 4JK1X 3DQVC 4I09A 2GWRA 2BBYA 3FMRA 4L0YB 2EFOA 1I5ZA 4A12A 5D6EA 1S29A 1B1BA 1ZG1A 4UXNA 3LA2A 1R58A 2ETHA 1FYLA 3RYRA 5HS7A 1UB9A 1HW1A 3HHGA 1ZREA 1ZN2A 4GCVA 4HV6A 2B0LA 3C7JA 4IRHA 1YW7A 3R6SA 2P7CB 4EJWA 4BHPA 4WXDA 4UVBA 2FNPA 2A6HF 3L7WA 4B8XA 3WTVC 2M30A 2Q0OA 5HOOA 2W84A 3RIRA 4G7OF 5LRRA 3VFZA 3WGGA 1RZ4A 1KU9A 2HS5A 1EH6A 1T0FA 1W7PD 4KT5C 3H3UA 4ZYEA 2XASA 2FNAA 4MTDA 2M8EA 1T39A 3JTHA 1U3EM 1U2WA 4BXUA 3TO6A 1TQPA 3WODF 1IW7F 4PCQA 3L2CA 1ZRCA 1GXQA 2XAJA 2FOKA 1D8JA 4G7ZF 3F8CA 3HRSA 4Q47A 1SMTA 4ETSA 1AWCA 5DEQA 3B02A 4ZYHA 4AVPA 1QZZA 3IKVA 1G3SA 2YU3A 4HAMA 3BWGA 4ESJA 4NQWA 2NNNA 2V1XA 2CSOA 3TO9A 3O2PE 3SQNA 4LD5A 3G73A 4GGGA 4CGZA 3K9TA 3KP2A 5FD6A 4YG2F 3LFKA 3QOPA 1YW9A 3LA3A 3E3VA 2ZO4A 4M9XA 3ZN1A 3ZMUA 3K1NA 3RTRA 5DCMA 1LEAA 2R7DA 3GYHX 3C3WA 1U8RA 5ILSA 2KIMA 5E1WA 1TBXA 5L3DA 3M9AA 3KZZA 2A61A 1TTYA 1KGSA 4LG0B 2HEOA 4A0YA 2LDUA 4P55A 4LGWA 2EA2A 1W7PB 1R22A 2ACJA 1FOKA 1YO5C 1ZLJA 3GVAA 1MJ9A 2CFXA 4UHTA 1YTYA 1Q1HA 3REOA 1Z05A 4G94A 2FMYA 1HW2A 2P5VA 3F21A 4LG0A 5FFZA 1QZYA 3FWEA 2H27A 2QVOA 4A5NA 3QU6A 4RGSA 2IA2A 4F7ZA 1D8KA 1SD7A 2PMUA 5E1ZB 2QYOA 4IXAA 1BIBA 1PP8F 2HKOA 2HKXA 2XAQA 4FX4A 5LGUA 3BPVA 2QQBA 2FXAA 1DPRA 2YX7A 2EFPA 3IC7A 5DUKA 4XLPF 2FRHA 2VOOA 1USSA 2E7WA 2LNBA 2OBPA 2HZTA 2W85A 2OU2A 3M8FA 5FLXK 3GW2A 4WWCA 2DQLA 3ZMVA 2EWNA 3BJAA 1I1SA 1A04A 2QZ8A 3ISPA 3I71A 1XSVA 2FBHA 2O0YA 1H0MA 4Q48A 1EV7A 5FGMA 2EV6A 1LDKB 4KA4A 3WE3A 1OYIA 2MC3A 3PQKA 2P5KA 1JGSA 4P96A 3TO7A 2OD5A 2FF4A 4R8HA 4UUVA 1GXPA 2XIGA 1QNTA 4XSXF 3J81K 3M7GA 3HRTA 2Q2EA 2RGVA 4LJZF 4KIBA 2XROA 3MEXA 1FBQA 1S8NA 5JR3A 3EETA 3WTWC 1IN7A 4EM2A 1KA8A 2BGCA 1R23A 2Q8KA 4B09A 5JVTA 5CLSA 2BE5F 1KYWA 1G3YA 3CTAA 5E8GA 4I01A 1T6SA 3DP7A 3PQJA 5DCFA 4HQEA 5EEHA 1FYMA 1XGNA 2DFIA 3NRVA 1X3UA 1PDNC 1I1GA 3L00A 2A68F 3MWMA 3GEZA 4A6DA 3F8NA 2IP2A 1ZARA 1OYYA 1W5SA 3TKYA 3HRMA 2PQ8A 2NRAC 3BZ6A 3IKTA 2UZKA 2FU4A 3P9IA 2ZFWA 3BROA 3GXOA 4WXHA 4KICA 4Y15A 4M74A 2OQGA 4L9NA 3V8KA 2GIVA 2DBBA 3TDUC 1ZH5A 1H9GA 3K0LA 1UCRA 4WF2A 2DPDA 5AONA 4DNCA 5LGTA 4GXOA 4R79A 5L3EA 4XSZF 3U9GA 4YIFA 4A5MA 3WU0A 3HOSA 4RGXA 5DCMB 4UVCA 2UWMA 2QQAA 3I5UA 3ELKA 3BOQA 1BOAA 4LMYA 1G3WA 4IRIA 5D4RA 5J8CA 4IJAA 1FX7A 2AXLA 2CQKA 5D5VB 4HV5A 1HKSA 3QRFF 1XDUA 1FBUA 2QBYA 3T8RA 3GFJA 4HYEA 2VN2A 4HW0A 2WTEA 3AAFA 3F6OA 2KJBA 3DV8A 1R7JA 1HW5A 2CGPA 2P6TA 5FFXA 3E6BA 4I98B 4MQ9F 1YQAA 4N0BA 2ADUA 1WRJA 3IWZA 3R0AA 5TRDA 2M1BA 1G6NA 2FQ3A 1K79A 2K4JA 4EGZA 2JPBA 2VC1A 1IRFA 3KP7A 2ISYA 3ZN0A 2YX4A 2HYFA 5E17F 5BS6A 2HTJA 1J59A 1ZAOA 3LA7A 3GZ6A 1FT9A 2YPRA 4HLXA 4S04A 1O7FA 2COMA 2R3SA 5D5XB 2EFQA 2A5YB 2MH2A 1WI9A 4EJTA 1KQ8A 1F4KA 1C0WA 2CYYA 5AIQA 2V9VA 1SD6A 3OOPA 5HLHA 3I53A 2XAHA 4OIRF 1HBXG 5DD8A 1ON1A 2W24A 4CICA 1S7OA 2V6CA 1ON2A 2V79A 2H6CA 3MZYA 4EVIA 1V3FA 3BDDA 3FF5A 4ENMA 3CLOA 3IHUA 1IXCA 4CZZA 5AIPA 3HUGA 4HDVA 2W25A 1KU2A 3WG9A 2JSCA 2E1CA 4OU0A 2HWVA 2VE9A 1FP2A 3GO5A 2HTSA 2HQRA 2QM3A 4XRFA 2YSRA 3U2RA 4WXCA 2M5WA 4AIHA 2XRNA 5LLQA 1FZPB 3I64A 1RUOA 2X4HA 4N9HA 1O3QA 3DPTA 1DPUA 1IN4A 3EYIA 5ED4A 1EH8A 1YG2A 3E6DA 2L02A 3IRRA 3P7NA 2OQRA 2XGXA 5J6XA 1MD0A 1PUEE 3BPXA 2MA3A 4KNYA 2Z33A 1IF1A 2VE8A 5HLIA 4RS8A 4LLLA 4A0ZA 2IRFG 4EM0B 4O5VA 4M6XA 4HDUA 1ZG3A 4P5OA 1YFHA 1U5TA 1IRGA 1XN7A 3T0YA 3R60A 2XAGA 3WTSC 2D2WA
chains in the Genus database with same CATH superfamily
5TJJA 4HOBA 1A36A 2MLKA 1E2XA 4M9ZA 4ZDPA 1HQCA 3NAUA 5LHHA 1RKWA 2DFEA 2BXYA 4YFKF 4RB2C 2NNYA 2OAZA 3HZJA 4QTRA 4Q5SF 2DMTA 2O61A 3V8LA 1HKQA 2ZB9A 2CQNA 1IUFA 1W7PA 3L2WA 4ITVA 5M5XJ 2LF7A 2Y75A 2TCTA 3TW6A 1R36A 3K2ZA 1TT0A 2L3DA 3NWSA 4HLYA 4I2OA 2QKMB 3RPUA 2BEOA 1D5YA 2R7SA 1VQ7I 1MJAA 1HSJA 4Y52J 1K83J 5LRSA 2ZJ2A 1R1VA 5B3SH 1X4OA 4IO9F 1CQTA 1FEXA 3KZIC 2IGKA 4DGWB 5LD2C 4Y17A 5HVQC 3MD2A 5E18F 2G7UA 3H0GJ 3MN2A 3B6CA 2KDOA 2X85A 2ID6A 3JRCA 5FD5A 1T8IA 2E5NA 2IXSA 4D7MA 4ESBA 2ZKZA 2DA7A 3LL7A 2P7VB 2M87A 2CS3A 2PN6A 2Z16A 5CVRA 3ZXSA 4BQQA 2V26A 2EFWA 2WAFA 4PFOA 2HFHA 1LFUP 3KEYA 2VQHA 5F1JA 1D3YA 3SZPA 3KYLA 3P5JA 5J1UA 4Y4RA 4MTEA 5M5YJ 1YITI 2DOFA 3OV8A 2XKPA 4Z2YA 2VASA 4E7SA 5HLTA 1Z7LA 4MHGA 2LLKA 1OPCA 2O8KA 3BJ6A 4DYQA 3JSOA 1XCVA 3CMYA 2M4KA 3HRUA 3FKJA 3RPQA 4CYDA 1Z3XA 3K4KA 1N78A 3CESA 4BHCA 3CO6C 5J4VA 4BACA 1K6OA 4P9UA 1P4AA 3RPUD 4OAZA 1TL8A 4FHTA 2UXXA 2CUEA 5LHGA 1XS9A 5HNFA 1VQ4I 3WU1B 4AIDA 3HOUJ 4IHSA 5JHFA 1ACIA 1EJ9A 4HX7A 5JI6A 1OKRA 3N05A 5L3BA 5E3NA 2F5FA 4JBAA 5D4SA 1J5YA 4HQMA 5IP9J 1JI8A 4GYIA 1A6QA 4BE2A 2R7VA 2KMUA 4E70A 1B6AA 4XOPA 2R5YA 3HB9A 1SC7A 2ZSHB 2JRTA 2P8TA 1BJAA 4Y7NJ 1E0EA 1XMKA 1SD5A 1TWGJ 2QUFA 3H9GA 3VB2A 4CH7A 3MKYB 2ESHA 4OOIA 2NS7A 1QA6A 1O3TA 5GPCA 3HIFA 3L09A 5KK1A 3CUQC 1LFPA 3GTLJ 4CSWA 1BI1A 5J1YA 3D5SC 2E36A 4A69C 2H94A 5F08A 1UHSA 1X1CA 2NS0A 5EEGA 2L2OA 4PGHA 1VQ8I 2EZLA 4KYWA 4BY1J 2W82A 3ZMTA 2GZWA 3F8FA 1QU3A 2ZMEB 3ULQB 3K2AA 3ZQIA 3HSRA 3SDBA 1ULYA 1B4AA 3UR3C 1WHUA 5LGNA 1U78A 2IBDA 4MFDA 1IXRC 5FKMA 4C3JJ 1JTYA 3H3VK 3MQ0A 3LSTA 1MBFA 4C2MJ 4PUSA 2VBXA 1NK3P 1ZR4A 2ZXWH 1NHAA 3KP4A 5EZGA 1YX3A 4L5EA 2VOPA 3BR1A 3W6VA 2RAEA 2CU7A 2V1DA 4FX0A 4LK0F 5GPAA 3I4NJ 1ZRFA 3UNGC 2E5ZA 3KPHA 3HOZJ 1DP7P 2DMQA 3EYYA 5H6QA 3JSPA 4WCGA 2FOWA 3TOBA 1JUPA 2MBFA 5CQGA 3ZR8X 1G4DA 1KU7A 1UFMA 3D0SA 3JRGA 4A3DJ 2XGEA 1JKQC 1ONVA 1JE8A 3DBLB 5HDGA 4HF2A 4LIUA 2EBIA 3BJOA 1TWFJ 4S0HB 4UUSA 2VJJA 1D5VA 3CDIA 1MH4A 2QQ9A 2DA4A 2MABA 4O3MA 1OJLA 4ZDLA 2H09A 1H8AC 1P2FA 1LJ9A 2GQQA 2P0WA 5FKOA 2DYSH 4IVNA 3C2HA 1D1AA 2Y0SA 1O57A 1AOYA 1R5HA 2RQPA 4GFBA 3R61A 3R4KA 1OCPA 2F5EA 2XV4S 1QO0D 3GBGA 3TP3A 5BOXA 2ISZA 1SMYF 3SYTA 5F0CA 2X6OA 2H6BA 3H0DA 4QWQA 3CDHA 3IUOA 2W1OA 4EV0A 2PEXA 2BZTA 2L5QA 2MH9A 1J75A 2JVHA 2R5ZB 1MKMA 4A3LJ 1X1AA 3I4PA 4II3A 4WK8F 3FBIB 1S3JA 2FE3A 2MLGA 3C1DA 2XVCA 2NAZA 3PIOF 5JHUA 3S3NA 4E6KG 3GFMA 3OIPA 1QRYA 5F0HA 5HODA 4C3HJ 4E7ZA 2CW0F 3BY6A 3ECHA 4HNUA 1ZTRA 5GP9A 1W0TA 4F55A 1LEBA 1YS6A 4YEJA 3F8MA 4KIGA 2CV1A 3RSNA 2EJRA 5K5QA 2XDVA 4K2EA 3HHHA 4IX7A 1APLC 3F3XA 1BW6A 4CUGA 2XF5A 3FXOA 1R71A 5IOZA 3FIWA 2XHKA 1TQMA 3HGGA 4RB3C 3HOTA 4LLGF 3FISA 3UKGA 3CLQA 4F92B 2NVUB 2ZXIA 3KZYA 1BI0A 2HPIA 3I9V2 4MNUA 3OY9A 3ZQLA 3K1MA 2DXIA 3GF2A 1AHDP 3SEQA 2CG4A 5D5WB 2ZNZA 4CO8A 1FYKA 2CRGA 3N4MA 2N8GA 1G8XA 3EUHA 4EJVA 1BI2A 2HOAA 2NOJB 3QPTA 4E4HA 2GA1A 2WV0A 3QPLA 4PGGA 3FHNA 4QLCU 1FP1D 4Y33A 2PX9A 2L7FP 1XGOA 3JRAA 1KZHA 4RAZA 4IPAA 5C44J 2CFOA 2DTZA 4LFUA 1Z6TA 3RI4A 1O4XA 4P1WA 2WAQA 3BT9A 5CVJA 1QGPA 3BR3A 1DP3A 1IAWA 4LB5A 1FLIA 4A3MJ 2R7OA 2X9DA 2Z99A 3DTEA 4U0WA 4XLNF 3GX4X 5DV5A 1H9TA 1AA7A 5LEKA 2M4GA 2DPUA 2QLZA 4A93J 2XF7A 1QHHD 4QPOA 4FASD 1V5EA 5E20A 2GLOA 5FRNA 5KAFC 2KP6A 1Z91A 2L7ZA 2R7WA 2BHYA 5HDKA 2GXBA 4F91B 3P9KA 3IAS2 2E71A 1XD7A 1S6LA 3CCQI 1WGXA 4C30A 3BLYA 3GLXA 3OL4A 1QQIA 2CWEA 2MG4A 5JLXA 2K9LA 5F27A 5E79C 3L2QA 1GLNA 1U5TB 3SEZA 1LVAA 1Y56A 3DXJF 5DD4A 3W2AA 3EQLF 3X2QH 4N9IA 5LBQA 5M3MJ 4RDUA 4ZH4F 3KE2A 5F6FA 1R4NB 2P81A 1PP7U 5CVIA 3V7SA 4BDZA 2L4MA 2EB7A 3TDZC 4MLOA 1DQUA 1F9NA 1SVMA 5HS8A 4EGYA 2PFBA 5B5EC 1ORKA 4XR6A 4BAYA 4OIPF 2B9SA 2E2JJ 1DUXC 4BE0A 3ZPLA 2P6SA 1WJDA 3MKWB 3RQ4A 1SFEA 3A02A 3H1CA 3VOEA 2X1EA 1YIOA 4KMUX 3KETA 3WHCA 5HS9A 1S9HA 4FTHA 4RAGA 1IZ1A 2M7BA 5J8FA 2OTJI 4LIVA 5BQTA 2IA0A 1MMNA 5CKTA 1YHQI 3J80K 3WTXC 1B8IB 4H4KC 2FX0A 4IQ4A 5ICFA 3HL2A 4KMFA 4LG3A 4ENJA 3BP8A 3OS0A 2FA5A 3FHZA 2ZJRF 3LSMA 2PG4A 2IPQX 3H9JA 4BH9A 5FKNA 2LVSA 1E3PA 4R1HA 3S3OA 1MDMB 1FSEA 3H5RA 6PAXA 3ZOBA 1A5JA 1L0OC 2OCCH 2K85A 5EJCA 3PSIA 3VYRB 4CDGA 1LQ1A 5DYMA 3CDLA 3BQYA 4YFNF 2JWTA 1FTZA 1XB4A 3W3CA 4AU7A 2KJCA 1QBJA 5DUIA 3F8BA 1A6IA 1P92A 4PDKA 4II2A 4LOCA 2OUMA 2HOEA 4ZYDA 4A2UA 2IGOA 3DLLF 1WH7A 2VBWA 1MZBA 3QU3A 3RYPA 4RLQA 2EK5A 3CQZJ 1VQOI 4OMYA 2EV0A 1O3RA 2DO7A 1LDDA 3HXLA 2NYXA 3Q9VA 1K7AA 4BQAA 2O5RA 3DEWA 5H20A 4XICA 2QEXI 4NB5A 4B3AA 4B47A 3T8TA 4AIJA 3Q0UA 1UJ8A 2QF7A 4W97A 3VDXA 4I0AA 2GXGA 4H0EA 1XGMA 2IS1A 2I10A 3WGHA 3OYGA 2PLYA 2JA7J 2WWYA 5K5RA 1D0YA 4QPQA 4UY8I 3DCFA 1Y0UA 4KN4X 5D5UB 3GZNB 1E3OC 1HDDC 3FXJA 1KYZA 4A3BJ 3HTUA 2ECBA 3TOAA 2A5WA 2JZYA 2BW3A 3DKWA 3QP5A 1IXSB 4M3DA 3QAHA 1EH7A 3NQOA 2F6CA 4NNJA 1DGRM 5IYCJ 3QODA 2W00A 4XONA 2GXAA 4OIQF 3O6BB 2RQQA 4AWXB 1R6RA 2JT1A 2JUCA 3PM1A 3J7ZI 2WC2A 3RDIA 2WB1A 1J2XA 5E1XA 4UV8A 2VQGA 3CCRI 1P6RA 3LQRA 1Z9CA 3DU5A 1IG7A 3FM5A 3OSGA 4CHUA 3QPSA 4RBOA 2ZCWA 1P9QC 1FSHA 5C4JJ 2HR3A 4AD9A 5KHDA 1TNSA 3I55I 2IS2A 1ENHA 3LQQA 3IV5A 2VUMJ 3JAMK 1Z1DA 1RPWA 2DA5A 4Y13A 1LUJB 5KVRA 2W48A 3BR2A 1R00A 3DPLC 4ESFA 1O3SA 1R1UA 4KDPA 2DAOA 2DT5A 1T38A 2LY2A 1I3AA 4M72A 3HG9A 5E8IA 3CCMI 2IJLA 1USTA 2HPMA 5M5WJ 4XKVA 1RIOH 3ZQ7A 2ICWG 4I0BA 2AQEA 3KIOA 2HXIA 3LSHA 3JRFA 1DU6A 2AHQA 4B43A 1FY7A 1KU3A 3T1BA 2W4SA 1ZLKA 5IT9K 1ETKA 4EMSA 1ZGAA 1FBSA 1VZ0A 3R0JA 3SZGA 3DTKA 1VFCA 3QWLA 3NEUA 4XLAA 2EZHA 1F5TA 2ZXHA 1IN5A 1WQ2A 1P4WA 1V4RA 5IP6A 3F6VA 1PYVA 3ZQHA 1POGA 2GA2A 2STWA 3KLNA 2D1VA 2BV6A 4NC8A 3KCCA 4C2UA 3K1PA 3L1PA 3M8EA 1T56A 3BG9A 1WH5A 2ZXJA 4HZFA 2LG4A 5TISC 2L01A 3OWTA 4AIKA 2ME0A 2HQNA 2DU9A 1FNNA 2O03A 2HYGD 2VODA 1Z0XA 2Z3YA 4CCMA 5H2FC 4WX9A 2A3SA 5K7FA 3BG5A 4HA8A 1HSTA 1NH3A 2X48A 1I6XA 3BTLA 3DKYA 1U8BA 2BVMA 2J5PA 3E6CC 4ZZDA 3HBLA 4V2GA 5B66C 2JA6J 2O6GE 2MSYA 5A2QZ 3EDPA 4MEYF 3PSFA 4XN3A 2RDPA 4DQ2A 4DZPA 1AKHA 2VXDA 3U1KA 1YYVA 2Z9OA 2LKPA 4F3QA 2WB1N 1A35A 3FXKA 3K69A 4JX5A 2OV7A 2W57A 2FBKA 1GVJA 3B73A 5GAEJ 2EPFA 2PI0A 2J5OA 5ERIA 1YRNA 4BHBA 2XPVA 3Q9SA 4XRMA 4UUSB 1OCCH 2DDAA 2LK2A 3JW4A 1S7AA 3G2BA 2RKHA 5DDGA 5KNLA 3OYMA 3ABKH 1RUNA 1IC8A 1Y1WJ 1Y0NA 2R7FA 4OMZA 3F23A 2R0QC 2F5DA 4LB6B 1WWXA 2VJIA 3KEQA 2K86A 3KP3A 3U21A 4ZYGA 2LRDA 1R5GA 4PJ0C 3RZDJ 3WTZA 1G3TA 3ZMSA 4DOZA 3PJRA 3CMAI 3W2WA 2DCEA 2F48A 1R5ID 4L18B 2LREA 4EJUA 4DIQA 2DK5A 3LSJA 2XSDC 5DTDA 2MFZA 4XM3A 5BMZA 2DJIA 3CMMA 2EH3A 3QP6A 4HX8A 2Z5UA 1KQ0A 3JRHA 2LD5A 4L9JA 1W5TA 4DW6A 3S14J 1N77A 1JKOC 2CW8A 2DLLA 3H36A 1LNWA 4MO7A 4BKXA 1AU7A 5IT9Z 3I59A 3FBNB 3ZP5A 3HTSB 1LPQA 2IS6A 4ASNA 1DU0A 2ELHA 4MGRA 2A6TA 3DEUA 4M71A 2R7XA 2FMLA 2DA1A 3FXRA 3GTKJ 1ETYA 3BR6A 5IT3A 1BBYA 1ETVA 3D5RC 3LSKA 3IWFA 1XGSA 2P5LC 1NG7A 1Z21A 3RJPA 3GWZA 3DLAA 2QWWA 2QA4I 3A2KA 1XPXA 4BNCA 4XK4A 5A2QK 1W36C 2KZVA 3WTUC 3ECOA 1E17A 2HXOA 3KP5A 1REPC 4I02A 4I7HA 2AQFA 4CXFA 4RGRA 1CF7A 1O7LA 4CCOA 2GAUA 3DF8A 2Y48A 2X0LA 1OFCX 3AL0B 1IGNA 4I76A 3HYIA 1IRZA 3I54A 3P9CA 2KRFA 2LSOA 4BXFA 2CQXA 1XTAA 1M1EB 2DQRA 1G59A 1ERDA 5LEJA 1TNTA 2CJJA 3AFHA 1ZR2A 3VEPA 4KUMA 4NQWB 3ML6A 2LKXA 3B6AA 2DW4A 4HSRA 3L9FA 2RC4A 2IGMA 2WV1A 4UVAA 2Y9YA 4M9SA 1VQNI 3CCLI 3MZHA 2XUBA 3ZMDA 3HPHA 1R1TA 2PJPA 3HOXJ 1I27A 1XCBA 2K7LA 1GHCA 1RETA 4PJLA 2VBYA 1TZLA 1ZYRF 2FBIA 3BC8A 3GUDA 1EF4A 3F22A 3ZMZA 1PVEA 2LF8A 3I0TA 3C2BA 4M73A 4RB0A 4UB6C 3S8PA 5E3OA 2E1NA 5CVUA 4XMYA 3ASOH 4XLCA 3E6MA 1U5TC 4GYGA 1X3WB 1J7KA 2M8GX 3E5UA 3LSIA 4S05A 2VONA 4U7DA 3I58A 4RGUA 4BYYA 4ZTFA 1LB2A 5GADJ 2V1UA 3E5XA 1VQ9I 1IUYA 3EUHC 2V4JC 3W6KB 2LKSA 4XIDA 3VPRA 3MFKA 1F43A 2QENA 3GZ5A 3E1SA 3BCAA 5K1YA 5L3FA 4RB1A 5ILUA 3OYCA 3CCEI 5D6FA 4RAYA 3DBHB 1YX5A 3V4GA 5IYDJ 2ZJPF 3AG2H 1RI7A 5B1BH 3MKZA 2D5VA 4D5CA 1FMVA 1KONA 2BVLA 2KKOA 2OF7A 3CC7I 2L4AA 2R7UA 1P4XA 3BTCA 4IOAF 2WAQN 3V7RA 1WJCA 2K9NA 3MZ8A 5C3EJ 4QIWN 3IP4B 3HSEA 1ZELA 2QKLB 3PL8A 3D1NI 5HLGA 3GTGJ 1GV2A 2BOLA 1MDMA 3F0CA 2YR2A 2YS9A 4L5IA 2UXNA 4DJAA 2K40A 1T95A 3K6GA 2O8XA 2WAEA 4NHJA 4JP0A 3H92A 1ZG5A 2E34A 1XSDA 2STTA 4OINF 3CC4I 1V54H 2OC6A 3T5XA 1UG2A 4J01A 4AUXA 1IRXA 1JT6A 2K5CA 1SD4A 4BJTA 3CUOA 4JQFA 1GV5A 3TGNA 2R4GA 3WHBA 4YELA 4HF1A 1U6GA 3RKWA 5EEAA 2GM4A 4HRIA 3ABUA 1JJ8C 1TLHB 3KP6A 4KIFA 1ZK8A 2FSWA 2VT2A 2KFDA 3M1EA 5FLVA 2NVTJ 4HNVA 1EA3A 1MJBA 1MBGA 2NOGA 3TQNA 4U0YA 5IYBJ 1MGTA 3CUQA 3FK7A 1UHMA 2EA4A 2F4OB 5BPDA 1SAXA 2TDXA 3Q5FA 4LLNA 1IN8A 3QQAA 3WG7H 5DM7F 1VQ6I 3K4NA 3I56I 2DDBA 3OOUA 2E1MB 4PJMA 3K4CA 3K4LA 4TV7A 3J7AO 2WY8Q 5FLMJ 3IL2A 2KIUA 1MMAA 5H6RA 1K78A 2D45A 3S3MA 1LVKA 3Q0VA 3GFLA 1OMIA 5K5OA 4ZDOA 1WJAA 1DDNA 4NUBA 3OS1A 2IAIA 2P4WA 2I5UA 3IRQA 1T08B 4BJ5C 2I8DA 2IA1A 3HC7A 4OIOF 2VJ4A 4MIMA 4P9FA 2ESNA 1R49A 2HDDA 4KFCA 1FTTA 2Y0SN 1ZGJA 1ZHFA 5CJ9A 1BL0A 1SFUA 2K02A 3S2HJ 2XB5A 4A6EA 4IF4A 2KPMA 1B9NA 4BEHA 3MAJA 1X19A 1UMQA 5FLXZ 3AG1H 3MMYB 1I39A 1TWHJ 2VQLA 1XSXA 2A69F 3FM3A 4ABZA 1QVUA 3LOCA 2R7QA 2BYVE 1N75A 1IDYA 5FO5A 1ODDA 2G7HA 4IEJA 2K4BA 4AVZA 5EZHA 5BPIA 1STZA 2KRHA 2Z1DA 1FOYA 4G6QA 1A31A 1MIJA 4GO1A 2C6YA 5ICCA 1QPMA 2VKDA 5CYVA 3HOVJ 4RM2A 4D0PA 1MBEA 1JKRC 3HGYA 3GLLA 3EUAA 3DFGA 2M0MA 1RR8C 3J81Z 2BXZA 4AC0A 3V7CA 3WTYC 3CJTB 4BGDA 1X1PA 1UHWA 4ON0A 1SVOA 4G7HF 1OCZH 2CUZA 2EFNA 5E3MA 1JHHA 4KN7X 3VODA 3HSFA 2DMPA 2DOEA 3D5LA 4G8XA 1T2KA 1FJLA 4E7JA 3CO7C 4A0XA 4DBQA 5ILVA 2NVQJ 1TC3C 3MCZA 2RV8A 3CCSI 3O3KA 2CV0A 1Y6IA 4G9YA 2ZMEA 3RKXA 1NTCA 3CJNA 1JHFA 3CCUI 3OIQA 3FMSA 4UV9A 3ZQCA 2DYRH 3OYFA 3OYLA 3HEFA 4L9TA 1B9MA 3ABLH 4XOTA 2JTVA 2KIQA 5IP7J 1OYWA 3CUQB 3VSKA 2E2HJ 3HUGB 4HSTA 2IVMA 3GFIA 3WE2A 4E7KA 4IHTA 3W2VA 3LAJA 3ABTA 1LE8B 1FPQA 2OCEA 4RM3A 2FEZA 3BCBA 2UV1A 2WY7Q 4EM1A 2ELJA 4CYCB 1WSUA 1HF0A 1TW3A 2HGCA 3F72A 1RC9A 3GCMA 3SHFA 3BTIA 3CD6I 2JRMA 2VBZA 4DYRA 3A0BC 1SFXA 2M45A 4ZYAA 1Z7UA 2DN0A 1IO2A 3DBRB 1TWCJ 3HKZN 2ZJQF 2F4IA 1X1BA 4HG2A 1RNLA 3OIOA 1X4PA 4EQQA 1FC3A 3H9QA 1T98A 2Y2ZA 5FKKA 3L2RA 1HLVA 1WJBA 4IRGA 2PMHA 4U87A 3QOEA 2IW5A 2GOMA 2Y69H 2WBMA 4U88A 1MMDA 3RKYA 2F2EA 4M3BA 3JRBA 3S2WA 5EDNA 2L54A 3FZVA 3CC2I 2DMUA 2KIFA 1BC7C 2K27A 2D1HA 3U1DA 2DT6A 2DA3A 1XMAA 2GOXB 3E97A 3DWLE 3S93A 3SFZA 2HDWA 2R5YB 1BI3A 2PBIA 1BR4A 1X1DA 4G6TB 1I6HJ 1IV8A 2A07F 2AS5F 2RVCA 1H88C 3PIPF 1CGPA 1SANA 3KEOA 5IOYA 2KDZA 2DJNA 4FT8A 4CA0A 4ZZLA 2CUJA 1YS7A 4JX6A 3CZ6A 4U0VA 1U9NA 5FKLA 3GTPJ 4CYCA 2RNGA 4A3GJ 3I59B 4HBLA 4LK1F 3I3LA 4GDFA 2E7XA 2EILH 1BM9A 2FUG2 3J7AY 1VTNC 1LFBA 2HVRA 2AO9A 4MQVA 1BIAA 3SZTA 3FXUA 2G0EA 2BHZA 2IT0A 1IN6A 2JPCA 4M6YA 1W4MA 1T0FC 3L2UA 3TP0A 1MSFC 1J09A 1NG6A 3OL3A 2LY1A 3LWFA 2DK8A 4HF0A 4J00A 2ID3A 2ZBKA 4ANJA 3CCYA 2ECCA 1MBHA 4PJJA 1CF7B 2K3PA 2VT3A 1Z6RA 3ROUA 4MEXF 2HOSA 1WZ2A 1XDSA 1JXSA 2QBYB 1HKTA 2XAFA 1K4TA 2CO5A 4CCJA 1YJ9I 3LAPA 4L5JA 1UG0A 4PZJA 3PFIA 3COAC 2MD5A 2H8WA 2BY0A 3W6JB 5IY5H 3BR0A 3OYKA 3J80Z 5HNHA 1TW2A 4JOMA 1JKPC 3N97A 1MMGA 2VB6A 3M4OJ 2RN7A 3K10A 5JFRA 1B59A 1J9IA 2Y0MA 1OR7A 1RR7A 1FWZA 4ENKA 2RNJA 5J4YA 2OZUA 4EJOA 2LOOA 5L3GA 3SXYA 3LFUA 3OR2C 3K4JA 5CQEA 5DM6F 5F64A 4C3IJ 4F93B 3G3ZA 2EV5A 4XRSG 1L3LA 2DTRA 2M7AA 4X1EA 5EG0B 1HC8A 4YFXF 4G6DA 3GTOJ 4YRVA 2FJ1A 1SFKA 1ZKGA 3O8HA 4Z6YA 4XRSA 4PSWA 1BN5A 3CP8A 5D8LB 3ERED 2HDCA 2HQ5A 1QVTA 2OA4A 5ICGA 3LNQA 1MSEC 1J0RA 1LDJA 2JMWA 5CVVA 2F5CA 4FQGA 2QGUA 3FDYA 3JTGA 2XKOA 3V8JA 4L9VA 2DA2A 4Q4ZF 4UNOA 5L3CA 2QSGX 4XBFA 2LH9A 2EINH 1YLFA 4DYCA 5F1RA 5M3FJ 5EF6A 3E5QA 2MC4A 4XN0A 1JTXA 3TBIA 4BE1A 3FMQA 4HX4A 3QYBA 1WKMA 3KLOA 1TQIA 1WVRA 3PNVA 2A6EF 1BC8C 3WTTC 3KFWX 1OCOH 1HXDA 2O3FA 2VKEA 2VC0A 3C18A 3EUKL 3FX3A 4DZJA 1Q1VA 2M0CA 1F1ZA 2VLAA 5HDNA 1MBKA 1XC5A 1YW8A 5J40A 4U7BA 1YIJI 4E7IA 2DI3A 4X6AJ 1KQ9A 4PSXA 2G9WA 5FB2A 4O6JA 4ENNA 2X1CA 1PJRA 2L7KA 3QPHA 5D8KB 5LHIA 2XSJC 5KAIC 1HDPA 1JUSA 1W1WE 4RA2A 5ICEA 1RESA 1ZRDA 2OZ6A 4A3CJ 9ANTA 4YIIA 3JAMZ 4L0ZB 1ZGWA 3WGIA 1K78B 2V9PA 2YU9J 3G1OA 2Z2SB 3LMMA 1ZQ3P 3FXQA 3H3ZA 4IL6C 2VXZA 2ZNYA 2JVGA 2CW7A 4JK1X 3DQVC 3BG3A 3CCJI 2JUGA 2V7FA 1EKEA 1YJWI 3PFYA 3OSFA 4D1QA 4I09A 2GWRA 2BBYA 3FMRA 3BR5A 2LMDA 1VI0A 4L0YB 1X58A 2EFOA 2JA2A 3TW7A 3BZKA 1I5ZA 1WJFA 4A12A 1BW5A 3QYFA 2XRLA 5D6EA 2LY9A 1S29A 2VKHA 1B1BA 4A3IJ 1ZG1A 4UXNA 3LA2A 1R58A 1Z3YA 2ETHA 1FYLA 2W7NA 2KZGA 5HS7A 1UB9A 3RYRA 1HW1A 3HHGA 4B1RA 1ZREA 4CCNA 1ZN2A 4GCVA 4HV6A 4N4OB 2B0LA 3C7JA 4IRHA 4M6VA 1YW7A 3R6SA 2P7CB 1VQLI 4EJWA 5LFAA 2JN6A 4BHPA 1FMWA 4WXDA 3PO2J 4UVBA 2FNPA 3ZGKA 1D1BA 2A6HF 3FK6A 4W1UA 3L7WA 4CCLA 3Q3SA 4B8XA 3WTVC 2X1DA 3V42A 2M30A 2CMPA 2Q0OA 5HOOA 2W84A 3RIRA 4G7OF 3DEEA 1S5LC 2FD5A 5LRRA 3HJEA 2M34A 3VFZA 3WGGA 1RZ4A 1R9TJ 1KU9A 3K7AJ 2HS5A 1EH6A 1T0FA 1W7PD 2R7TA 4KT5C 4MFEA 3H3UA 4ZYEA 4BBSJ 1B72A 3AG4H 3M1CA 2XASA 4AYBN 3HDDA 2QSHX 1GUUA 2V6EA 2FNAA 3A1YA 4MTDA 3DU6A 4A3EJ 1JJ6C 2M8EA 1T39A 3JTHA 1U3EM 1U2WA 1H89C 4BXUA 1BA5A 3TO6A 4I99C 5IPAA 1UZCA 2M3AA 3K4MA 3G1LA 1TQPA 2NS8A 1IW7F 3ABMH 3WODF 4PCQA 3CF5F 3L2CA 1Y39A 1GXQA 1RRJA 2XAJA 1ZRCA 2FOKA 4IHYA 1D8JA 3HOYJ 2L7MP 4F52A 3LSGA 4G7ZF 3F8CA 3HRSA 4Q47A 4RLFA 5GAHJ 1SMTA 4ETSA 1AWCA 5DEQA 3B02A 4ZYHA 3ERMA 1VQ5I 2V1NA 4AVPA 1QZZA 4QSHA 1U0JA 3ZRGA 3IKVA 4FCYA 1G3SA 5F0FA 2YU3A 2A05A 4HAMA 3BWGA 4BS9A 3JR9A 4ESJA 1WFXA 4NQWA 2NNNA 1K6YA 2V1XA 2CSOA 1FIPA 3TO9A 1LKXA 3O2PE 3SQNA 1XMXA 3ASNH 3M07A 4LD5A 3G73A 2ZMEC 2LFBA 4GGGA 2O7OA 4NC7A 4CGZA 3S1RJ 3K9TA 4BY7J 3JRDA 3TL4X 3KP2A 4B3XA 5FD6A 4YG2F 3LFKA 4E7LA 2M9HA 2XF6A 3QOPA 3SDGA 1ETQA 3JRIA 2NVYJ 4DBRA 1YW9A 3LA3A 3E3VA 2ZO4A 4M9XA 1JGGA 3E7LA 3FKIJ 3ZMUA 3ZN1A 2JA5J 3K1NA 3ZCOA 3RTRA 5DCMA 4B4CA 2VPLA 1LEAA 2R7DA 3GYHX 1VNDA 3C3WA 5CPRB 1VQMI 1U8RA 5ILSA 2R93J 3HPGA 5K7HA 2KISA 4IHWA 2KIMA 4BU2A 1OR7C 4M3FA 2DA6A 5E1WA 2IEKA 4EATA 4D5FA 3OYDA 3LSPA 1TBXA 5L3DA 3M9AA 2X51A 1VQKI 2EIKH 3KZZA 2A61A 1TTYA 1Y8RB 1KGSA 2NXNB 2LTPA 1MNMC 2HEOA 4LG0B 4UB8C 1GVDA 2ELKA 2LDUA 4P55A 4A0YA 4LGWA 2EA2A 5GTIC 1W7PB 1R22A 2ACJA 1FOKA 1YO5C 1FOWA 1ZLJA 3GVAA 3MVPA 1MJ9A 2CFXA 3S16J 4UHTA 3NARA 1YTYA 2E60A 1SVLA 4AYBA 4V2FA 1Q1HA 3REOA 1Z05A 4G94A 1ETOA 2FMYA 1HA8A 1HW2A 2P5VA 5BNGA 3F21A 4LG0A 5FFZA 1QZYA 1P7JA 3FWEA 2H27A 3LSRA 2QVOA 4A5NA 3QU6A 2FQ4A 4AM3A 3JREA 3C2GA 4RGSA 2IA2A 4XNFA 3GTMJ 2EIJH 4F7ZA 1V5GA 2K9SA 4E7HA 1YRNB 1D8KA 1SD7A 2XAUA 2PMUA 5E1ZB 2QYOA 4IXAA 5TGTA 4X0GA 1DGWY 1BIBA 2F5VA 3ZQGA 1PP8F 4C2TA 2HKOA 5JLWA 2HKXA 4GRIA 1ETWA 3S17J 2E2IJ 2XAQA 4FX4A 5LGUA 3BPVA 2QQBA 2FXAA 1DPRA 4HNTA 2YX7A 5B1AH 3OYNA 2EFPA 3IC7A 1SAUA 1WJEA 5DUKA 2JJ7A 3A4CA 4XLPF 2FRHA 4FE7A 1USSA 2VOOA 2E7WA 2LNBA 2OBPA 3RCOA 1XX5A 2HZTA 2W85A 2OU2A 2VKVA 3M8FA 5FLXK 3GW2A 1VF9A 4XL9A 4WWCA 3I4MJ 2DQLA 3ZMVA 2EWNA 4ZTJA 2LBFA 3BJAA 1I1SA 2COBA 4BJ6C 4FETA 3BZCA 1TWAJ 1A04A 2QZ8A 3ISPA 3I71A 4NBQA 2Q2EB 1UAAA 2LYCA 5C4XJ 1YI2I 1K4SA 1XSVA 5K7ZA 3S15J 2FBHA 2O0YA 5J1RA 1H0MA 4Q48A 1EV7A 2HOTA 3OYEA 5FGMA 3Q0WA 2EV6A 1LDKB 2ZSIB 3CF2A 4KA4A 3WE3A 1OYIA 2BY2A 2MC3A 2R7ZJ 1X3ZB 3PQKA 2P5KA 1JGSA 2DFFA 4P96A 3TO7A 1K61A 4EEFG 2OD5A 2FF4A 2XB0X 4R8HA 4UUVA 1GXPA 2VI6A 2XIGA 1QNTA 2LR8A 4XSXF 3J81K 2VQCA 3M7GA 3SJMA 3HRTA 2Q2EA 2RGVA 4LJZF 4D7NA 4KIBA 1LE8A 2KT0A 2XROA 3MEXA 2MD0A 2BW3B 1XG1A 2L9VA 1FBQA 1BJZA 1S8NA 3G1MA 2E19A 1Z67A 5JR3A 3EETA 2GBYA 1OQYA 2AXTC 3KX2A 3CJQB 3WTWC 1IN7A 2HYJA 1S7EA 1ITYA 2IS4A 1MMSA 3G6EI 4EM2A 1KA8A 2JK3A 2BGCA 1W5CC 1R23A 2HNHA 2Q8KA 2KRCA 4OWRB 4B09A 5CLSA 2BE5F 5JVTA 2CUFA 1HOMA 1WPKA 3WU2C 5GTHC 1KYWA 1G3YA 4D9JA 2OTLI 3HM5A 2R5ZA 4RAFA 4PK4A 1E3HA 2X6YA 3CTAA 5E8GA 1W36D 5E3LA 4I01A 2X6XA 1T6SA 3DP7A 3PQJA 2BY1A 5DCFA 2XPWA 4HQEA 5EEHA 4IKFA 1FYMA 1XGNA 1HCRA 1YE9A 1MBJA 2DFIA 2LP0A 3NRVA 2O9LA 4NDLA 1X3UA 1PDNC 4BDYA 1OCTC 1I1GA 5GAGJ 3A01A 2CV2A 3K4BA 3L00A 2A68F 2OJED 3MWMA 3GEZA 4A6DA 3F8NA 2IP2A 1ZARA 1OYYA 2RREA 1W5SA 3IH2A 3HRMA 3TKYA 4C9YA 1SFOJ 1IDZA 2HVSA 3DPUA 3NWTA 2PQ8A 2NRAC 2Y9ZA 2EIMH 3BZ6A 2L9RA 3IKTA 2ZC2A 2UZKA 5JVGF 1PUFA 3AL0C 2FU4A 3BG6A 3P9IA 3VYTB 3ESWB 3PNTA 2ZFWA 3VYSB 3BROA 3GXOA 2Q1ZB 1YJNI 4IZZA 2L9NA 4WXHA 4KICA 4Y15A 3CMEI 1WI3A 3K70C 4M74A 2OQGA 3PUFA 4L9NA 3V8KA 2GIVA 3PUBA 1B8IA 3S1NJ 1BR1A 1JT0A 1TP4A 2DBBA 3TDUC 2MW8A 1ZH5A 1TT5B 4M3EA 1SEUA 1H9GA 3K0LA 1UCRA 2JSPA 4WF2A 1VQPI 3BTJA 2PJRA 4XORA 2DPDA 5AONA 3VSLA 5F04A 4DNCA 5LGTA 4GXOA 3TMOA 4XKWA 1QZEA 1I3QJ 2EZIA 4R79A 1MNDA 2H8RA 5J47A 4CZCA 2K9QA 4XSZF 5L3EA 3U9GA 4YIFA 3OYIA 4A5MA 3WU0A 2ME6A 1R4MB 2TRTA 3HOSA 2VL8A 2L0KA 2XPUA 2M2EA 3G4SI 4RGXA 5DCMB 4UVCA 3OYJA 2XC7A 2CQ7A 2QQAA 1RKTA 2UWMA 3I5UA 1P7IA 3ELKA 3IH3A 2E35A 3BOQA 3S32A 4PFPA 2HZDA 1BOAA 4LMYA 3VWBA 3SFIA 1G3WA 2CQQA 4IRIA 2DMNA 4B48A 3CP2A 2R92J 1F36A 5D4RA 2MYSA 5J8CA 4IJAA 3L2VA 1FX7A 4G12A 2LBFB 2VIXA 4I6ZA 4ZJZA 2AXLA 2CQKA 3GMEA 4PJNA 5D5VB 3TEDA 2H1LA 1N25A 2Y31A 4J19A 2NVXJ 4HV5A 1HKSA 3QRFF 3CCVI 1XDUA 1AKHB 4YIRX 1S72I 4NC6A 2XGCA 1FBUA 1Z77A 2LC2A 3A03A 2QBYA 3T8RA 3OR1C 3GFJA 2K9MA 3ZQFA 4HYEA 2VN2A 3IH4A 3J7YJ 5FRMA 2EQRA 1IV6A 2EZKA 3OYHA 3A01B 1YOVB 3JCUC 4HW0A 2WTEA 3AAFA 2WADA 3F6OA 4KITB 2PMZA 2V9KA 2KJBA 3DV8A 1I50J 1R7JA 3E0JB 4IQJA 1HW5A 5EG0A 2CGPA 2P6TA 2QSFX 1GT0C 5FFXA 1D0XA 3E6BA 4I98B 3G71I 4MQ9F 2DT7B 1YQAA 3RQIA 1QHGA 4N0BA 2ADUA 2HVQA 4N4NB 2Y30A 3PNYA 1WRJA 2HI3A 3IWZA 4B44A 2JA8J 3R0AA 5TRDA 2WA0A 2M1BA 1G6NA 2FQ3A 1K79A 2K4JA 4EGZA 3S2DJ 1D1CA 2JPBA 2VC1A 4BL0B 1IRFA 3KP7A 2K3FA 2ISYA 2IGNA 3ZN0A 1IJWC 2L9SA 2XGDA 4BUPA 2H1KA 3OYBA 2OPTA 2YX4A 3A0HC 2HYFA 3CJRB 3ONQA 1V55H 5E17F 5BS6A 2HTJA 1J59A 1ZAOA 3LA7A 3GZ6A 3FXLA 3IAM2 4KISA 1FT9A 1D0ZA 2X6WA 2YPRA 4HLXA 4S04A 1O7FA 1WCMJ 4HPQA 2COMA 4IHVA 3AG3H 2R3SA 5D5XB 2EFQA 2A5YB 4FISA 3VYUB 2MH2A 1WI9A 3OMYA 4M3GA 5FJ8J 4EJTA 1KQ8A 4BQOA 2VPRA 3OYAA 3RKQA 1F4KA 4KT6A 1C0WA 1PUFB 1OLTA 3BQZA 2CYYA 5AIQA 5FROA 2DOAA 1SD6A 2V9VA 4XQFA 3OOPA 1JUMA 5HLHA 3I53A 4BBRJ 1UELB 2PJRB 1NK2P 4UUTA 2XAHA 4OIRF 1HBXG 5DD8A 1ON1A 3KYDB 5EYRA 5EGOB 2W24A 5KCMA 1S7OA 4CICA 2V6CA 2KQRA 2R7RA 1ON2A 2V79A 3F9KA 3GTQJ 2H6CA 3MZYA 3FXMA 4EVIA 1V3FA 5EGOA 2MGQA 3BDDA 3DTIA 3FF5A 4ENMA 3CLOA 1FIAA 3IHUA 3DKXA 4XKCA 3M3YJ 4A3FJ 1W0UA 1IXCA 4CZZA 5DS9A 2KHMA 2UUZA 4IOCF 3O8GA 5AIPA 3HUGA 4HDVA 3HOWJ 2W25A 1KU2A 1OISA 3K70D 1ETXA 1B72B 3WG9A 2BY3A 2JSCA 3S1QJ 2E1CA 3OS2A 4V19K 2PMZN 1X2MA 4OU0A 2HWVA 2VE9A 1FP2A 4LITA 2E1OA 2F4MB 2ZFUA 3GO5A 2HTSA 2HQRA 4CCKA 2QM3A 4OAYA 1T33A 2VJ5A 3MKLA 3AKZA 4XRFA 2YSRA 2KLOA 4BXXJ 4WXCA 3U2RA 4XLEA 2M5WA 4AIHA 2XRNA 4XLFA 3RZOJ 4KJZA 1MW7A 5LLQA 1FZPB 3I64A 3PO3J 3EPZA 2QCOA 4XKBA 4BQNA 1RUOA 2X4HA 4N9HA 1O3QA 2HQAA 3DPTA 1DPUA 1IN4A 3EYIA 2DODA 4A3JJ 4RMNA 5ED4A 3S1MJ 1EH8A 3KYCB 4HEA2 1BR2A 1YG2A 3E6DA 4BEHB 2L02A 3IRRA 3P7NA 2OQRA 3GTJJ 3H5NA 2XGXA 5J6XA 1MD0A 2B63J 1PUEE 2QQ8A 4IHXA 3BPXA 2B7EA 1BOBA 2E1MC 2MA3A 2HU9A 4KNYA 2CH0A 2Z33A 1IF1A 3HKZA 2VE8A 5HLIA 4RS8A 5J3LA 4LLLA 4A0ZA 3M8JA 2KL4A 3H35A 4EM0B 2IRFG 1G2HA 3BG7A 1OCRH 1QPIA 4JYKA 2JQ7A 1Y8QB 1MH3A 4Y3OA 4O5VA 2GIZA 4A3KJ 4M6XA 4HDUA 1V5FA 1X2NA 1ZG3A 2YUSA 4P5OA 3QYEA 4FE4A 1U5TA 1YFHA 4JX4A 3ZQQA 1IRGA 1WJ5A 1XN7A 1Y1VJ 4ZC3A 1GDTA 4XLHA 3T0YA 3R60A 3H5AA 2XAGA 1FOXA 3WTSC 2DFHA 1U9OA 1MNEA 2D2WA
chains in the Genus database with same CATH topology
5TJJA 4HOBA 2MLKA 1E2XA 4M9ZA 1HQCA 5LHHA 4RB2C 4YFKF 2NNYA 2OAZA 4Q5SF 2O61A 3V8LA 1HKQA 1W7PA 2LF7A 2Y75A 1R36A 3K2ZA 2L3DA 4HLYA 4I2OA 3RPUA 2BEOA 1MJAA 1HSJA 5LRSA 2ZJ2A 1R1VA 4Y17A 5HVQC 5E18F 2G7UA 5FD5A 4ESBA 2ZKZA 2P7VB 2M87A 2PN6A 5CVRA 2EFWA 2HFHA 1D3YA 3SZPA 4MTEA 3OV8A 2XKPA 4Z2YA 4MHGA 1OPCA 3BJ6A 3JSOA 1XCVA 3HRUA 3RPQA 4CYDA 4BHCA 3CO6C 1K6OA 4P9UA 1P4AA 4FHTA 2UXXA 5LHGA 3WU1B 4IHSA 4HX7A 5JI6A 1OKRA 5L3BA 2F5FA 4JBAA 5D4SA 1J5YA 4HQMA 4GYIA 4E70A 1B6AA 2JRTA 2P8TA 1BJAA 1XMKA 1SD5A 2QUFA 3VB2A 2ESHA 4OOIA 1O3TA 3HIFA 3L09A 5KK1A 3CUQC 1BI1A 2H94A 2NS0A 5EEGA 4PGHA 4KYWA 3ZMTA 2GZWA 3F8FA 2ZMEB 3ULQB 3HSRA 1ULYA 1B4AA 5LGNA 1U78A 1IXRC 3MQ0A 3LSTA 2VBXA 1NHAA 3KP4A 2VOPA 2V1DA 4FX0A 4LK0F 1ZRFA 1DP7P 3EYYA 3JSPA 5H6QA 4WCGA 3TOBA 2MBFA 1G4DA 1KU7A 1UFMA 3D0SA 1ONVA 1JE8A 5HDGA 4HF2A 3BJOA 1D5VA 2QQ9A 4O3MA 2H09A 1P2FA 1LJ9A 2GQQA 4IVNA 1O57A 1AOYA 1R5HA 2RQPA 3R61A 3R4KA 2F5EA 2XV4S 1QO0D 5BOXA 2ISZA 1SMYF 2H6BA 4QWQA 3CDHA 4EV0A 2PEXA 2MH9A 1J75A 1MKMA 3I4PA 4WK8F 1S3JA 2FE3A 2MLGA 3C1DA 2XVCA 2NAZA 5JHUA 3GFMA 2CW0F 3BY6A 3ECHA 1LEBA 1YS6A 3F8MA 4KIGA 2EJRA 5K5QA 4K2EA 3HHHA 3F3XA 2XHKA 1TQMA 4RB3C 3HOTA 4LLGF 3KZYA 1BI0A 4MNUA 3K1MA 3GF2A 2CG4A 1FYKA 2ZNZA 4CO8A 5D5WB 3N4MA 3EUHA 4EJVA 1BI2A 3QPTA 2GA1A 2WV0A 4PGGA 4QLCU 1FP1D 1XGOA 4RAZA 4IPAA 4LFUA 1Z6TA 3RI4A 5CVJA 1QGPA 1IAWA 4LB5A 1FLIA 2Z99A 3GX4X 4U0WA 4XLNF 5DV5A 1H9TA 5LEKA 2DPUA 2QLZA 5E20A 1Z91A 5HDKA 2GXBA 3P9KA 1XD7A 1S6LA 3GLXA 1QQIA 2CWEA 1U5TB 1LVAA 3DXJF 5DD4A 3EQLF 4N9IA 5LBQA 4ZH4F 3KE2A 5F6FA 1PP7U 5CVIA 3V7SA 2L4MA 2EB7A 3TDZC 1F9NA 5HS8A 4EGYA 2PFBA 4BAYA 4OIPF 1DUXC 3ZPLA 2P6SA 1SFEA 3VOEA 1YIOA 4KMUX 3KETA 5HS9A 1IZ1A 5J8FA 5BQTA 2IA0A 3J80K 3WTXC 5ICFA 4KMFA 4ENJA 3BP8A 2FA5A 3FHZA 2PG4A 2IPQX 4BH9A 4R1HA 1MDMB 1FSEA 6PAXA 1L0OC 4CDGA 1LQ1A 5DYMA 4YFNF 1XB4A 2KJCA 1QBJA 5DUIA 3F8BA 1P92A 4PDKA 2HOEA 4ZYDA 4A2UA 2VBWA 1MZBA 3QU3A 3RYPA 2EK5A 4OMYA 1O3RA 2EV0A 2DO7A 1LDDA 3Q9VA 2NYXA 1K7AA 4BQAA 5H20A 4NB5A 3T8TA 4AIJA 4I0AA 2GXGA 4H0EA 1XGMA 3WGHA 2PLYA 2WWYA 5K5RA 1Y0UA 4KN4X 5D5UB 1KYZA 3HTUA 3TOAA 2JZYA 3DKWA 3QP5A 1IXSB 3QAHA 1EH7A 3NQOA 4OIQF 3O6BB 4AWXB 2JT1A 2WC2A 3RDIA 5E1XA 1J2XA 4UV8A 1P6RA 3LQRA 1Z9CA 3FM5A 4CHUA 2ZCWA 1FSHA 2HR3A 4AD9A 1TNSA 3LQQA 3JAMK 1Z1DA 4Y13A 5KVRA 1R00A 3DPLC 4ESFA 1O3SA 1R1UA 4KDPA 2DAOA 2DT5A 1T38A 4M72A 5E8IA 2IJLA 1USTA 1RIOH 3ZQ7A 4I0BA 1FY7A 1KU3A 3T1BA 1ZLKA 5IT9K 4EMSA 1ZGAA 1FBSA 3R0JA 3NEUA 1F5TA 1IN5A 1WQ2A 1P4WA 1V4RA 3F6VA 2GA2A 2STWA 3KLNA 2D1VA 2BV6A 3KCCA 3K1PA 3M8EA 2ZXJA 4HZFA 2L01A 4AIKA 2HQNA 2DU9A 1FNNA 2O03A 2HYGD 2VODA 2Z3YA 4WX9A 2A3SA 4HA8A 1HSTA 1I6XA 2J5PA 3E6CC 4ZZDA 2O6GE 5A2QZ 3EDPA 4MEYF 2RDPA 4DQ2A 1YYVA 2Z9OA 2LKPA 3K69A 2W57A 2FBKA 1GVJA 3B73A 2PI0A 2J5OA 5ERIA 4BHBA 3Q9SA 3JW4A 1S7AA 2RKHA 5DDGA 1RUNA 2R7FA 4OMZA 3F23A 2F5DA 4LB6B 1WWXA 3KEQA 2K86A 3KP3A 4ZYGA 1R5GA 3WTZA 1G3TA 3ZMSA 4L18B 4EJUA 2DK5A 5BMZA 3QP6A 4HX8A 2Z5UA 1KQ0A 4L9JA 1W5TA 2DLLA 1LNWA 5IT9Z 3I59A 3ZP5A 3HTSB 4ASNA 2ELHA 4MGRA 3DEUA 4M71A 2FMLA 3FXRA 5IT3A 1BBYA 3IWFA 1XGSA 2P5LC 3RJPA 3GWZA 2QWWA 4BNCA 5A2QK 3WTUC 3ECOA 1E17A 3KP5A 1REPC 4I02A 4I7HA 4CXFA 4RGRA 1CF7A 1O7LA 2GAUA 3DF8A 2Y48A 2X0LA 3HYIA 3I54A 3P9CA 2KRFA 2LSOA 2DQRA 5LEJA 1TNTA 3VEPA 4KUMA 3ML6A 2DW4A 3L9FA 2RC4A 4UVAA 4M9SA 3MZHA 2XUBA 3ZMDA 1R1TA 2PJPA 1I27A 1XCBA 2K7LA 1GHCA 2VBYA 1ZYRF 2FBIA 3GUDA 3F22A 3ZMZA 2LF8A 3I0TA 4M73A 4RB0A 2E1NA 5CVUA 3E6MA 1U5TC 4GYGA 1J7KA 3E5UA 2VONA 4S05A 4U7DA 3I58A 4RGUA 4BYYA 1LB2A 2V1UA 3E5XA 1IUYA 3W6KB 3MFKA 2QENA 3GZ5A 5K1YA 5L3FA 4RB1A 5ILUA 5D6FA 4RAYA 3V4GA 1RI7A 2KKOA 2L4AA 1P4XA 3V7RA 3HSEA 5HLGA 1MDMA 2YR2A 4L5IA 2UXNA 2O8XA 4NHJA 3H92A 1ZG5A 2STTA 1XSDA 4OINF 3T5XA 1SD4A 3CUOA 4JQFA 3TGNA 4HF1A 1U6GA 3RKWA 3ABUA 1TLHB 3KP6A 4KIFA 2FSWA 2VT2A 3M1EA 1MJBA 3TQNA 4U0YA 1MGTA 3CUQA 1UHMA 2EA4A 5BPDA 1SAXA 2TDXA 3Q5FA 4LLNA 1IN8A 4TV7A 3J7AO 3IL2A 2KIUA 5H6RA 1K78A 2D45A 3GFLA 1OMIA 5K5OA 1DDNA 2P4WA 3IRQA 2IA1A 4OIOF 4P9FA 2ESNA 4KFCA 1ZGJA 1ZHFA 5CJ9A 1SFUA 2K02A 4A6EA 4IF4A 1B9NA 3MAJA 5FLXZ 1XSXA 2A69F 3FM3A 2BYVE 5FO5A 1ODDA 2G7HA 2K4BA 5BPIA 1STZA 4G6QA 2C6YA 4GO1A 5ICCA 1QPMA 5CYVA 4D0PA 3DFGA 3J81Z 3V7CA 3WTYC 1UHWA 4ON0A 4G7HF 2EFNA 1JHHA 4KN7X 3VODA 3D5LA 3HSFA 4G8XA 1T2KA 3CO7C 4A0XA 5ILVA 3MCZA 2RV8A 3O3KA 4G9YA 2ZMEA 3RKXA 3CJNA 1JHFA 3FMSA 4UV9A 4L9TA 1B9MA 2JTVA 1OYWA 3CUQB 2IVMA 3GFIA 3WE2A 4IHTA 3LAJA 3ABTA 1FPQA 2FEZA 4EM1A 1WSUA 1TW3A 2HGCA 3F72A 3SHFA 2VBZA 1SFXA 2M45A 1Z7UA 1RNLA 4EQQA 1FC3A 1T98A 4IRGA 2PMHA 2IW5A 4U88A 3RKYA 2F2EA 3S2WA 2L54A 3FZVA 2KIFA 1BC7C 2K27A 2D1HA 3U1DA 1XMAA 3E97A 3SFZA 1BI3A 2PBIA 2A07F 2AS5F 2RVCA 1CGPA 3KEOA 4FT8A 4ZZLA 1YS7A 4U0VA 3I59B 4HBLA 4LK1F 2E7XA 1BM9A 1VTNC 4MQVA 1BIAA 3SZTA 3FXUA 2IT0A 1IN6A 2JPCA 4M6YA 1W4MA 3LWFA 2DK8A 4HF0A 2ZBKA 1CF7B 2VT3A 1Z6RA 3ROUA 4MEXF 1XDSA 1JXSA 2QBYB 1HKTA 2XAFA 2CO5A 3LAPA 4L5JA 4PZJA 3PFIA 3COAC 2MD5A 3W6JB 3J80Z 1TW2A 3N97A 2RN7A 5JFRA 1B59A 1J9IA 2Y0MA 1OR7A 1FWZA 4ENKA 2RNJA 2OZUA 4EJOA 5L3GA 3SXYA 5F64A 3G3ZA 2EV5A 1L3LA 2DTRA 4YFXF 4G6DA 1BN5A 5D8LB 3ERED 2HDCA 2OA4A 5ICGA 1J0RA 1LDJA 5CVVA 2F5CA 3JTGA 2XKOA 3V8JA 4L9VA 4Q4ZF 4UNOA 5L3CA 4XBFA 1YLFA 5F1RA 3E5QA 3FMQA 4HX4A 1WKMA 3KLOA 1TQIA 2A6EF 1BC8C 3WTTC 3KFWX 1HXDA 2O3FA 3C18A 2VC0A 3FX3A 1F1ZA 5HDNA 1YW8A 4U7BA 2DI3A 1KQ9A 2G9WA 5FB2A 4O6JA 4ENNA 3QPHA 5D8KB 5LHIA 5ICEA 1ZRDA 2OZ6A 4YIIA 3JAMZ 4L0ZB 3WGIA 1K78B 3FXQA 3H3ZA 2VXZA 2ZNYA 4JK1X 3DQVC 4I09A 2GWRA 2BBYA 3FMRA 4L0YB 2EFOA 1I5ZA 4A12A 5D6EA 1S29A 1B1BA 1ZG1A 4UXNA 3LA2A 1R58A 2ETHA 1FYLA 3RYRA 5HS7A 1UB9A 1HW1A 3HHGA 1ZREA 1ZN2A 4GCVA 4HV6A 2B0LA 3C7JA 4IRHA 1YW7A 3R6SA 2P7CB 4EJWA 4BHPA 4WXDA 4UVBA 2FNPA 2A6HF 3L7WA 4B8XA 3WTVC 2M30A 2Q0OA 5HOOA 2W84A 3RIRA 4G7OF 5LRRA 3VFZA 3WGGA 1RZ4A 1KU9A 2HS5A 1EH6A 1T0FA 1W7PD 4KT5C 3H3UA 4ZYEA 2XASA 2FNAA 4MTDA 2M8EA 1T39A 3JTHA 1U3EM 1U2WA 4BXUA 3TO6A 1TQPA 3WODF 1IW7F 4PCQA 3L2CA 1ZRCA 1GXQA 2XAJA 2FOKA 1D8JA 4G7ZF 3F8CA 3HRSA 4Q47A 1SMTA 4ETSA 1AWCA 5DEQA 3B02A 4ZYHA 4AVPA 1QZZA 3IKVA 1G3SA 2YU3A 4HAMA 3BWGA 4ESJA 4NQWA 2NNNA 2V1XA 2CSOA 3TO9A 3O2PE 3SQNA 4LD5A 3G73A 4GGGA 4CGZA 3K9TA 3KP2A 5FD6A 4YG2F 3LFKA 3QOPA 1YW9A 3LA3A 3E3VA 2ZO4A 4M9XA 3ZN1A 3ZMUA 3K1NA 3RTRA 5DCMA 1LEAA 2R7DA 3GYHX 3C3WA 1U8RA 5ILSA 2KIMA 5E1WA 1TBXA 5L3DA 3M9AA 3KZZA 2A61A 1TTYA 1KGSA 4LG0B 2HEOA 4A0YA 2LDUA 4P55A 4LGWA 2EA2A 1W7PB 1R22A 2ACJA 1FOKA 1YO5C 1ZLJA 3GVAA 1MJ9A 2CFXA 4UHTA 1YTYA 1Q1HA 3REOA 1Z05A 4G94A 2FMYA 1HW2A 2P5VA 3F21A 4LG0A 5FFZA 1QZYA 3FWEA 2H27A 2QVOA 4A5NA 3QU6A 4RGSA 2IA2A 4F7ZA 1D8KA 1SD7A 2PMUA 5E1ZB 2QYOA 4IXAA 1BIBA 1PP8F 2HKOA 2HKXA 2XAQA 4FX4A 5LGUA 3BPVA 2QQBA 2FXAA 1DPRA 2YX7A 2EFPA 3IC7A 5DUKA 4XLPF 2FRHA 2VOOA 1USSA 2E7WA 2LNBA 2OBPA 2HZTA 2W85A 2OU2A 3M8FA 5FLXK 3GW2A 4WWCA 2DQLA 3ZMVA 2EWNA 3BJAA 1I1SA 1A04A 2QZ8A 3ISPA 3I71A 1XSVA 2FBHA 2O0YA 1H0MA 4Q48A 1EV7A 5FGMA 2EV6A 1LDKB 4KA4A 3WE3A 1OYIA 2MC3A 3PQKA 2P5KA 1JGSA 4P96A 3TO7A 2OD5A 2FF4A 4R8HA 4UUVA 1GXPA 2XIGA 1QNTA 4XSXF 3J81K 3M7GA 3HRTA 2Q2EA 2RGVA 4LJZF 4KIBA 2XROA 3MEXA 1FBQA 1S8NA 5JR3A 3EETA 3WTWC 1IN7A 4EM2A 1KA8A 2BGCA 1R23A 2Q8KA 4B09A 5JVTA 5CLSA 2BE5F 1KYWA 1G3YA 3CTAA 5E8GA 4I01A 1T6SA 3DP7A 3PQJA 5DCFA 4HQEA 5EEHA 1FYMA 1XGNA 2DFIA 3NRVA 1X3UA 1PDNC 1I1GA 3L00A 2A68F 3MWMA 3GEZA 4A6DA 3F8NA 2IP2A 1ZARA 1OYYA 1W5SA 3TKYA 3HRMA 2PQ8A 2NRAC 3BZ6A 3IKTA 2UZKA 2FU4A 3P9IA 2ZFWA 3BROA 3GXOA 4WXHA 4KICA 4Y15A 4M74A 2OQGA 4L9NA 3V8KA 2GIVA 2DBBA 3TDUC 1ZH5A 1H9GA 3K0LA 1UCRA 4WF2A 2DPDA 5AONA 4DNCA 5LGTA 4GXOA 4R79A 5L3EA 4XSZF 3U9GA 4YIFA 4A5MA 3WU0A 3HOSA 4RGXA 5DCMB 4UVCA 2UWMA 2QQAA 3I5UA 3ELKA 3BOQA 1BOAA 4LMYA 1G3WA 4IRIA 5D4RA 5J8CA 4IJAA 1FX7A 2AXLA 2CQKA 5D5VB 4HV5A 1HKSA 3QRFF 1XDUA 1FBUA 2QBYA 3T8RA 3GFJA 4HYEA 2VN2A 4HW0A 2WTEA 3AAFA 3F6OA 2KJBA 3DV8A 1R7JA 1HW5A 2CGPA 2P6TA 5FFXA 3E6BA 4I98B 4MQ9F 1YQAA 4N0BA 2ADUA 1WRJA 3IWZA 3R0AA 5TRDA 2M1BA 1G6NA 2FQ3A 1K79A 2K4JA 4EGZA 2JPBA 2VC1A 1IRFA 3KP7A 2ISYA 3ZN0A 2YX4A 2HYFA 5E17F 5BS6A 2HTJA 1J59A 1ZAOA 3LA7A 3GZ6A 1FT9A 2YPRA 4HLXA 4S04A 1O7FA 2COMA 2R3SA 5D5XB 2EFQA 2A5YB 2MH2A 1WI9A 4EJTA 1KQ8A 1F4KA 1C0WA 2CYYA 5AIQA 2V9VA 1SD6A 3OOPA 5HLHA 3I53A 2XAHA 4OIRF 1HBXG 5DD8A 1ON1A 2W24A 4CICA 1S7OA 2V6CA 1ON2A 2V79A 2H6CA 3MZYA 4EVIA 1V3FA 3BDDA 3FF5A 4ENMA 3CLOA 3IHUA 1IXCA 4CZZA 5AIPA 3HUGA 4HDVA 2W25A 1KU2A 3WG9A 2JSCA 2E1CA 4OU0A 2HWVA 2VE9A 1FP2A 3GO5A 2HTSA 2HQRA 2QM3A 4XRFA 2YSRA 3U2RA 4WXCA 2M5WA 4AIHA 2XRNA 5LLQA 1FZPB 3I64A 1RUOA 2X4HA 4N9HA 1O3QA 3DPTA 1DPUA 1IN4A 3EYIA 5ED4A 1EH8A 1YG2A 3E6DA 2L02A 3IRRA 3P7NA 2OQRA 2XGXA 5J6XA 1MD0A 1PUEE 3BPXA 2MA3A 4KNYA 2Z33A 1IF1A 2VE8A 5HLIA 4RS8A 4LLLA 4A0ZA 2IRFG 4EM0B 4O5VA 4M6XA 4HDUA 1ZG3A 4P5OA 1YFHA 1U5TA 1IRGA 1XN7A 3T0YA 3R60A 2XAGA 3WTSC 2D2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TJJ A;  4HOB A;  2MLK A;  1E2X A;  4M9Z A;  1HQC A;  5LHH A;  4RB2 C;  4YFK F;  2NNY A;  2OAZ A;  4Q5S F;  2O61 A;  3V8L A;  1HKQ A;  1W7P A;  2LF7 A;  2Y75 A;  1R36 A;  3K2Z A;  2L3D A;  4HLY A;  4I2O A;  3RPU A;  2BEO A;  1MJA A;  1HSJ A;  5LRS A;  2ZJ2 A;  1R1V A;  4Y17 A;  5HVQ C;  5E18 F;  2G7U A;  5FD5 A;  4ESB A;  2ZKZ A;  2P7V B;  2M87 A;  2PN6 A;  5CVR A;  2EFW A;  2HFH A;  1D3Y A;  3SZP A;  4MTE A;  3OV8 A;  2XKP A;  4Z2Y A;  4MHG A;  1OPC A;  3BJ6 A;  3JSO A;  1XCV A;  3HRU A;  3RPQ A;  4CYD A;  4BHC A;  3CO6 C;  1K6O A;  4P9U A;  1P4A A;  4FHT A;  2UXX A;  5LHG A;  3WU1 B;  4IHS A;  4HX7 A;  5JI6 A;  1OKR A;  5L3B A;  2F5F A;  4JBA A;  5D4S A;  1J5Y A;  4HQM A;  4GYI A;  4E70 A;  1B6A A;  2JRT A;  2P8T A;  1BJA A;  1XMK A;  1SD5 A;  2QUF A;  3VB2 A;  2ESH A;  4OOI A;  1O3T A;  3HIF A;  3L09 A;  5KK1 A;  3CUQ C;  1BI1 A;  2H94 A;  2NS0 A;  5EEG A;  4PGH A;  4KYW A;  3ZMT A;  2GZW A;  3F8F A;  2ZME B;  3ULQ B;  3HSR A;  1ULY A;  1B4A A;  5LGN A;  1U78 A;  1IXR C;  3MQ0 A;  3LST A;  2VBX A;  1NHA A;  3KP4 A;  2VOP A;  2V1D A;  4FX0 A;  4LK0 F;  1ZRF A;  1DP7 P;  3EYY A;  3JSP A;  5H6Q A;  4WCG A;  3TOB A;  2MBF A;  1G4D A;  1KU7 A;  1UFM A;  3D0S A;  1ONV A;  1JE8 A;  5HDG A;  4HF2 A;  3BJO A;  1D5V A;  2QQ9 A;  4O3M A;  2H09 A;  1P2F A;  1LJ9 A;  2GQQ A;  4IVN A;  1O57 A;  1AOY A;  1R5H A;  2RQP A;  3R61 A;  3R4K A;  2F5E A;  2XV4 S;  1QO0 D;  5BOX A;  2ISZ A;  1SMY F;  2H6B A;  4QWQ A;  3CDH A;  4EV0 A;  2PEX A;  2MH9 A;  1J75 A;  1MKM A;  3I4P A;  4WK8 F;  1S3J A;  2FE3 A;  2MLG A;  3C1D A;  2XVC A;  2NAZ A;  5JHU A;  3GFM A;  2CW0 F;  3BY6 A;  3ECH A;  1LEB A;  1YS6 A;  3F8M A;  4KIG A;  2EJR A;  5K5Q A;  4K2E A;  3HHH A;  3F3X A;  2XHK A;  1TQM A;  4RB3 C;  3HOT A;  4LLG F;  3KZY A;  1BI0 A;  4MNU A;  3K1M A;  3GF2 A;  2CG4 A;  1FYK A;  2ZNZ A;  4CO8 A;  5D5W B;  3N4M A;  3EUH A;  4EJV A;  1BI2 A;  3QPT A;  2GA1 A;  2WV0 A;  4PGG A;  4QLC U;  1FP1 D;  1XGO A;  4RAZ A;  4IPA A;  4LFU A;  1Z6T A;  3RI4 A;  5CVJ A;  1QGP A;  1IAW A;  4LB5 A;  1FLI A;  2Z99 A;  3GX4 X;  4U0W A;  4XLN F;  5DV5 A;  1H9T A;  5LEK A;  2DPU A;  2QLZ A;  5E20 A;  1Z91 A;  5HDK A;  2GXB A;  3P9K A;  1XD7 A;  1S6L A;  3GLX A;  1QQI A;  2CWE A;  1U5T B;  1LVA A;  3DXJ F;  5DD4 A;  3EQL F;  4N9I A;  5LBQ A;  4ZH4 F;  3KE2 A;  5F6F A;  1PP7 U;  5CVI A;  3V7S A;  2L4M A;  2EB7 A;  3TDZ C;  1F9N A;  5HS8 A;  4EGY A;  2PFB A;  4BAY A;  4OIP F;  1DUX C;  3ZPL A;  2P6S A;  1SFE A;  3VOE A;  1YIO A;  4KMU X;  3KET A;  5HS9 A;  1IZ1 A;  5J8F A;  5BQT A;  2IA0 A;  3J80 K;  3WTX C;  5ICF A;  4KMF A;  4ENJ A;  3BP8 A;  2FA5 A;  3FHZ A;  2PG4 A;  2IPQ X;  4BH9 A;  4R1H A;  1MDM B;  1FSE A;  6PAX A;  1L0O C;  4CDG A;  1LQ1 A;  5DYM A;  4YFN F;  1XB4 A;  2KJC A;  1QBJ A;  5DUI A;  3F8B A;  1P92 A;  4PDK A;  2HOE A;  4ZYD A;  4A2U A;  2VBW A;  1MZB A;  3QU3 A;  3RYP A;  2EK5 A;  4OMY A;  1O3R A;  2EV0 A;  2DO7 A;  1LDD A;  3Q9V A;  2NYX A;  1K7A A;  4BQA A;  5H20 A;  4NB5 A;  3T8T A;  4AIJ A;  4I0A A;  2GXG A;  4H0E A;  1XGM A;  3WGH A;  2PLY A;  2WWY A;  5K5R A;  1Y0U A;  4KN4 X;  5D5U B;  1KYZ A;  3HTU A;  3TOA A;  2JZY A;  3DKW A;  3QP5 A;  1IXS B;  3QAH A;  1EH7 A;  3NQO A;  4OIQ F;  3O6B B;  4AWX B;  2JT1 A;  2WC2 A;  3RDI A;  5E1X A;  1J2X A;  4UV8 A;  1P6R A;  3LQR A;  1Z9C A;  3FM5 A;  4CHU A;  2ZCW A;  1FSH A;  2HR3 A;  4AD9 A;  1TNS A;  3LQQ A;  3JAM K;  1Z1D A;  4Y13 A;  5KVR A;  1R00 A;  3DPL C;  4ESF A;  1O3S A;  1R1U A;  4KDP A;  2DAO A;  2DT5 A;  1T38 A;  4M72 A;  5E8I A;  2IJL A;  1UST A;  1RIO H;  3ZQ7 A;  4I0B A;  1FY7 A;  1KU3 A;  3T1B A;  1ZLK A;  5IT9 K;  4EMS A;  1ZGA A;  1FBS A;  3R0J A;  3NEU A;  1F5T A;  1IN5 A;  1WQ2 A;  1P4W A;  1V4R A;  3F6V A;  2GA2 A;  2STW A;  3KLN A;  2D1V A;  2BV6 A;  3KCC A;  3K1P A;  3M8E A;  2ZXJ A;  4HZF A;  2L01 A;  4AIK A;  2HQN A;  2DU9 A;  1FNN A;  2O03 A;  2HYG D;  2VOD A;  2Z3Y A;  4WX9 A;  2A3S A;  4HA8 A;  1HST A;  1I6X A;  2J5P A;  3E6C C;  4ZZD A;  2O6G E;  5A2Q Z;  3EDP A;  4MEY F;  2RDP A;  4DQ2 A;  1YYV A;  2Z9O A;  2LKP A;  3K69 A;  2W57 A;  2FBK A;  1GVJ A;  3B73 A;  2PI0 A;  2J5O A;  5ERI A;  4BHB A;  3Q9S A;  3JW4 A;  1S7A A;  2RKH A;  5DDG A;  1RUN A;  2R7F A;  4OMZ A;  3F23 A;  2F5D A;  4LB6 B;  1WWX A;  3KEQ A;  2K86 A;  3KP3 A;  4ZYG A;  1R5G A;  3WTZ A;  1G3T A;  3ZMS A;  4L18 B;  4EJU A;  2DK5 A;  5BMZ A;  3QP6 A;  4HX8 A;  2Z5U A;  1KQ0 A;  4L9J A;  1W5T A;  2DLL A;  1LNW A;  5IT9 Z;  3I59 A;  3ZP5 A;  3HTS B;  4ASN A;  2ELH A;  4MGR A;  3DEU A;  4M71 A;  2FML A;  3FXR A;  5IT3 A;  1BBY A;  3IWF A;  1XGS A;  2P5L C;  3RJP A;  3GWZ A;  2QWW A;  4BNC A;  5A2Q K;  3WTU C;  3ECO A;  1E17 A;  3KP5 A;  1REP C;  4I02 A;  4I7H A;  4CXF A;  4RGR A;  1CF7 A;  1O7L A;  2GAU A;  3DF8 A;  2Y48 A;  2X0L A;  3HYI A;  3I54 A;  3P9C A;  2KRF A;  2LSO A;  2DQR A;  5LEJ A;  1TNT A;  3VEP A;  4KUM A;  3ML6 A;  2DW4 A;  3L9F A;  2RC4 A;  4UVA A;  4M9S A;  3MZH A;  2XUB A;  3ZMD A;  1R1T A;  2PJP A;  1I27 A;  1XCB A;  2K7L A;  1GHC A;  2VBY A;  1ZYR F;  2FBI A;  3GUD A;  3F22 A;  3ZMZ A;  2LF8 A;  3I0T A;  4M73 A;  4RB0 A;  2E1N A;  5CVU A;  3E6M A;  1U5T C;  4GYG A;  1J7K A;  3E5U A;  2VON A;  4S05 A;  4U7D A;  3I58 A;  4RGU A;  4BYY A;  1LB2 A;  2V1U A;  3E5X A;  1IUY A;  3W6K B;  3MFK A;  2QEN A;  3GZ5 A;  5K1Y A;  5L3F A;  4RB1 A;  5ILU A;  5D6F A;  4RAY A;  3V4G A;  1RI7 A;  2KKO A;  2L4A A;  1P4X A;  3V7R A;  3HSE A;  5HLG A;  1MDM A;  2YR2 A;  4L5I A;  2UXN A;  2O8X A;  4NHJ A;  3H92 A;  1ZG5 A;  2STT A;  1XSD A;  4OIN F;  3T5X A;  1SD4 A;  3CUO A;  4JQF A;  3TGN A;  4HF1 A;  1U6G A;  3RKW A;  3ABU A;  1TLH B;  3KP6 A;  4KIF A;  2FSW A;  2VT2 A;  3M1E A;  1MJB A;  3TQN A;  4U0Y A;  1MGT A;  3CUQ A;  1UHM A;  2EA4 A;  5BPD A;  1SAX A;  2TDX A;  3Q5F A;  4LLN A;  1IN8 A;  4TV7 A;  3J7A O;  3IL2 A;  2KIU A;  5H6R A;  1K78 A;  2D45 A;  3GFL A;  1OMI A;  5K5O A;  1DDN A;  2P4W A;  3IRQ A;  2IA1 A;  4OIO F;  4P9F A;  2ESN A;  4KFC A;  1ZGJ A;  1ZHF A;  5CJ9 A;  1SFU A;  2K02 A;  4A6E A;  4IF4 A;  1B9N A;  3MAJ A;  5FLX Z;  1XSX A;  2A69 F;  3FM3 A;  2BYV E;  5FO5 A;  1ODD A;  2G7H A;  2K4B A;  5BPI A;  1STZ A;  4G6Q A;  2C6Y A;  4GO1 A;  5ICC A;  1QPM A;  5CYV A;  4D0P A;  3DFG A;  3J81 Z;  3V7C A;  3WTY C;  1UHW A;  4ON0 A;  4G7H F;  2EFN A;  1JHH A;  4KN7 X;  3VOD A;  3D5L A;  3HSF A;  4G8X A;  1T2K A;  3CO7 C;  4A0X A;  5ILV A;  3MCZ A;  2RV8 A;  3O3K A;  4G9Y A;  2ZME A;  3RKX A;  3CJN A;  1JHF A;  3FMS A;  4UV9 A;  4L9T A;  1B9M A;  2JTV A;  1OYW A;  3CUQ B;  2IVM A;  3GFI A;  3WE2 A;  4IHT A;  3LAJ A;  3ABT A;  1FPQ A;  2FEZ A;  4EM1 A;  1WSU A;  1TW3 A;  2HGC A;  3F72 A;  3SHF A;  2VBZ A;  1SFX A;  2M45 A;  1Z7U A;  1RNL A;  4EQQ A;  1FC3 A;  1T98 A;  4IRG A;  2PMH A;  2IW5 A;  4U88 A;  3RKY A;  2F2E A;  3S2W A;  2L54 A;  3FZV A;  2KIF A;  1BC7 C;  2K27 A;  2D1H A;  3U1D A;  1XMA A;  3E97 A;  3SFZ A;  1BI3 A;  2PBI A;  2A07 F;  2AS5 F;  2RVC A;  1CGP A;  3KEO A;  4FT8 A;  4ZZL A;  1YS7 A;  4U0V A;  3I59 B;  4HBL A;  4LK1 F;  2E7X A;  1BM9 A;  1VTN C;  4MQV A;  1BIA A;  3SZT A;  3FXU A;  2IT0 A;  1IN6 A;  2JPC A;  4M6Y A;  1W4M A;  3LWF A;  2DK8 A;  4HF0 A;  2ZBK A;  1CF7 B;  2VT3 A;  1Z6R A;  3ROU A;  4MEX F;  1XDS A;  1JXS A;  2QBY B;  1HKT A;  2XAF A;  2CO5 A;  3LAP A;  4L5J A;  4PZJ A;  3PFI A;  3COA C;  2MD5 A;  3W6J B;  3J80 Z;  1TW2 A;  3N97 A;  2RN7 A;  5JFR A;  1B59 A;  1J9I A;  2Y0M A;  1OR7 A;  1FWZ A;  4ENK A;  2RNJ A;  2OZU A;  4EJO A;  5L3G A;  3SXY A;  5F64 A;  3G3Z A;  2EV5 A;  1L3L A;  2DTR A;  4YFX F;  4G6D A;  1BN5 A;  5D8L B;  3ERE D;  2HDC A;  2OA4 A;  5ICG A;  1J0R A;  1LDJ A;  5CVV A;  2F5C A;  3JTG A;  2XKO A;  3V8J A;  4L9V A;  4Q4Z F;  4UNO A;  5L3C A;  4XBF A;  1YLF A;  5F1R A;  3E5Q A;  3FMQ A;  4HX4 A;  1WKM A;  3KLO A;  1TQI A;  2A6E F;  1BC8 C;  3WTT C;  3KFW X;  1HXD A;  2O3F A;  3C18 A;  2VC0 A;  3FX3 A;  1F1Z A;  5HDN A;  1YW8 A;  4U7B A;  2DI3 A;  1KQ9 A;  2G9W A;  5FB2 A;  4O6J A;  4ENN A;  3QPH A;  5D8K B;  5LHI A;  5ICE A;  1ZRD A;  2OZ6 A;  4YII A;  3JAM Z;  4L0Z B;  3WGI A;  1K78 B;  3FXQ A;  3H3Z A;  2VXZ A;  2ZNY A;  4JK1 X;  3DQV C;  4I09 A;  2GWR A;  2BBY A;  3FMR A;  4L0Y B;  2EFO A;  1I5Z A;  4A12 A;  5D6E A;  1S29 A;  1B1B A;  1ZG1 A;  4UXN A;  3LA2 A;  1R58 A;  2ETH A;  1FYL A;  3RYR A;  5HS7 A;  1UB9 A;  1HW1 A;  3HHG A;  1ZRE A;  1ZN2 A;  4GCV A;  4HV6 A;  2B0L A;  3C7J A;  4IRH A;  1YW7 A;  3R6S A;  2P7C B;  4EJW A;  4BHP A;  4WXD A;  4UVB A;  2FNP A;  2A6H F;  3L7W A;  4B8X A;  3WTV C;  2M30 A;  2Q0O A;  5HOO A;  2W84 A;  3RIR A;  4G7O F;  5LRR A;  3VFZ A;  3WGG A;  1RZ4 A;  1KU9 A;  2HS5 A;  1EH6 A;  1T0F A;  1W7P D;  4KT5 C;  3H3U A;  4ZYE A;  2XAS A;  2FNA A;  4MTD A;  2M8E A;  1T39 A;  3JTH A;  1U3E M;  1U2W A;  4BXU A;  3TO6 A;  1TQP A;  3WOD F;  1IW7 F;  4PCQ A;  3L2C A;  1ZRC A;  1GXQ A;  2XAJ A;  2FOK A;  1D8J A;  4G7Z F;  3F8C A;  3HRS A;  4Q47 A;  1SMT A;  4ETS A;  1AWC A;  5DEQ A;  3B02 A;  4ZYH A;  4AVP A;  1QZZ A;  3IKV A;  1G3S A;  2YU3 A;  4HAM A;  3BWG A;  4ESJ A;  4NQW A;  2NNN A;  2V1X A;  2CSO A;  3TO9 A;  3O2P E;  3SQN A;  4LD5 A;  3G73 A;  4GGG A;  4CGZ A;  3K9T A;  3KP2 A;  5FD6 A;  4YG2 F;  3LFK A;  3QOP A;  1YW9 A;  3LA3 A;  3E3V A;  2ZO4 A;  4M9X A;  3ZN1 A;  3ZMU A;  3K1N A;  3RTR A;  5DCM A;  1LEA A;  2R7D A;  3GYH X;  3C3W A;  1U8R A;  5ILS A;  2KIM A;  5E1W A;  1TBX A;  5L3D A;  3M9A A;  3KZZ A;  2A61 A;  1TTY A;  1KGS A;  4LG0 B;  2HEO A;  4A0Y A;  2LDU A;  4P55 A;  4LGW A;  2EA2 A;  1W7P B;  1R22 A;  2ACJ A;  1FOK A;  1YO5 C;  1ZLJ A;  3GVA A;  1MJ9 A;  2CFX A;  4UHT A;  1YTY A;  1Q1H A;  3REO A;  1Z05 A;  4G94 A;  2FMY A;  1HW2 A;  2P5V A;  3F21 A;  4LG0 A;  5FFZ A;  1QZY A;  3FWE A;  2H27 A;  2QVO A;  4A5N A;  3QU6 A;  4RGS A;  2IA2 A;  4F7Z A;  1D8K A;  1SD7 A;  2PMU A;  5E1Z B;  2QYO A;  4IXA A;  1BIB A;  1PP8 F;  2HKO A;  2HKX A;  2XAQ A;  4FX4 A;  5LGU A;  3BPV A;  2QQB A;  2FXA A;  1DPR A;  2YX7 A;  2EFP A;  3IC7 A;  5DUK A;  4XLP F;  2FRH A;  2VOO A;  1USS A;  2E7W A;  2LNB A;  2OBP A;  2HZT A;  2W85 A;  2OU2 A;  3M8F A;  5FLX K;  3GW2 A;  4WWC A;  2DQL A;  3ZMV A;  2EWN A;  3BJA A;  1I1S A;  1A04 A;  2QZ8 A;  3ISP A;  3I71 A;  1XSV A;  2FBH A;  2O0Y A;  1H0M A;  4Q48 A;  1EV7 A;  5FGM A;  2EV6 A;  1LDK B;  4KA4 A;  3WE3 A;  1OYI A;  2MC3 A;  3PQK A;  2P5K A;  1JGS A;  4P96 A;  3TO7 A;  2OD5 A;  2FF4 A;  4R8H A;  4UUV A;  1GXP A;  2XIG A;  1QNT A;  4XSX F;  3J81 K;  3M7G A;  3HRT A;  2Q2E A;  2RGV A;  4LJZ F;  4KIB A;  2XRO A;  3MEX A;  1FBQ A;  1S8N A;  5JR3 A;  3EET A;  3WTW C;  1IN7 A;  4EM2 A;  1KA8 A;  2BGC A;  1R23 A;  2Q8K A;  4B09 A;  5JVT A;  5CLS A;  2BE5 F;  1KYW A;  1G3Y A;  3CTA A;  5E8G A;  4I01 A;  1T6S A;  3DP7 A;  3PQJ A;  5DCF A;  4HQE A;  5EEH A;  1FYM A;  1XGN A;  2DFI A;  3NRV A;  1X3U A;  1PDN C;  1I1G A;  3L00 A;  2A68 F;  3MWM A;  3GEZ A;  4A6D A;  3F8N A;  2IP2 A;  1ZAR A;  1OYY A;  1W5S A;  3TKY A;  3HRM A;  2PQ8 A;  2NRA C;  3BZ6 A;  3IKT A;  2UZK A;  2FU4 A;  3P9I A;  2ZFW A;  3BRO A;  3GXO A;  4WXH A;  4KIC A;  4Y15 A;  4M74 A;  2OQG A;  4L9N A;  3V8K A;  2GIV A;  2DBB A;  3TDU C;  1ZH5 A;  1H9G A;  3K0L A;  1UCR A;  4WF2 A;  2DPD A;  5AON A;  4DNC A;  5LGT A;  4GXO A;  4R79 A;  5L3E A;  4XSZ F;  3U9G A;  4YIF A;  4A5M A;  3WU0 A;  3HOS A;  4RGX A;  5DCM B;  4UVC A;  2UWM A;  2QQA A;  3I5U A;  3ELK A;  3BOQ A;  1BOA A;  4LMY A;  1G3W A;  4IRI A;  5D4R A;  5J8C A;  4IJA A;  1FX7 A;  2AXL A;  2CQK A;  5D5V B;  4HV5 A;  1HKS A;  3QRF F;  1XDU A;  1FBU A;  2QBY A;  3T8R A;  3GFJ A;  4HYE A;  2VN2 A;  4HW0 A;  2WTE A;  3AAF A;  3F6O A;  2KJB A;  3DV8 A;  1R7J A;  1HW5 A;  2CGP A;  2P6T A;  5FFX A;  3E6B A;  4I98 B;  4MQ9 F;  1YQA A;  4N0B A;  2ADU A;  1WRJ A;  3IWZ A;  3R0A A;  5TRD A;  2M1B A;  1G6N A;  2FQ3 A;  1K79 A;  2K4J A;  4EGZ A;  2JPB A;  2VC1 A;  1IRF A;  3KP7 A;  2ISY A;  3ZN0 A;  2YX4 A;  2HYF A;  5E17 F;  5BS6 A;  2HTJ A;  1J59 A;  1ZAO A;  3LA7 A;  3GZ6 A;  1FT9 A;  2YPR A;  4HLX A;  4S04 A;  1O7F A;  2COM A;  2R3S A;  5D5X B;  2EFQ A;  2A5Y B;  2MH2 A;  1WI9 A;  4EJT A;  1KQ8 A;  1F4K A;  1C0W A;  2CYY A;  5AIQ A;  2V9V A;  1SD6 A;  3OOP A;  5HLH A;  3I53 A;  2XAH A;  4OIR F;  1HBX G;  5DD8 A;  1ON1 A;  2W24 A;  4CIC A;  1S7O A;  2V6C A;  1ON2 A;  2V79 A;  2H6C A;  3MZY A;  4EVI A;  1V3F A;  3BDD A;  3FF5 A;  4ENM A;  3CLO A;  3IHU A;  1IXC A;  4CZZ A;  5AIP A;  3HUG A;  4HDV A;  2W25 A;  1KU2 A;  3WG9 A;  2JSC A;  2E1C A;  4OU0 A;  2HWV A;  2VE9 A;  1FP2 A;  3GO5 A;  2HTS A;  2HQR A;  2QM3 A;  4XRF A;  2YSR A;  3U2R A;  4WXC A;  2M5W A;  4AIH A;  2XRN A;  5LLQ A;  1FZP B;  3I64 A;  1RUO A;  2X4H A;  4N9H A;  1O3Q A;  3DPT A;  1DPU A;  1IN4 A;  3EYI A;  5ED4 A;  1EH8 A;  1YG2 A;  3E6D A;  2L02 A;  3IRR A;  3P7N A;  2OQR A;  2XGX A;  5J6X A;  1MD0 A;  1PUE E;  3BPX A;  2MA3 A;  4KNY A;  2Z33 A;  1IF1 A;  2VE8 A;  5HLI A;  4RS8 A;  4LLL A;  4A0Z A;  2IRF G;  4EM0 B;  4O5V A;  4M6X A;  4HDU A;  1ZG3 A;  4P5O A;  1YFH A;  1U5T A;  1IRG A;  1XN7 A;  3T0Y A;  3R60 A;  2XAG A;  3WTS C;  2D2W A; 
#chains in the Genus database with same CATH topology
 5TJJ A;  4HOB A;  1A36 A;  2MLK A;  1E2X A;  4M9Z A;  4ZDP A;  1HQC A;  3NAU A;  5LHH A;  1RKW A;  2DFE A;  2BXY A;  4YFK F;  4RB2 C;  2NNY A;  2OAZ A;  3HZJ A;  4QTR A;  4Q5S F;  2DMT A;  2O61 A;  3V8L A;  1HKQ A;  2ZB9 A;  2CQN A;  1IUF A;  1W7P A;  3L2W A;  4ITV A;  5M5X J;  2LF7 A;  2Y75 A;  2TCT A;  3TW6 A;  1R36 A;  3K2Z A;  1TT0 A;  2L3D A;  3NWS A;  4HLY A;  4I2O A;  2QKM B;  3RPU A;  2BEO A;  1D5Y A;  2R7S A;  1VQ7 I;  1MJA A;  1HSJ A;  4Y52 J;  1K83 J;  5LRS A;  2ZJ2 A;  1R1V A;  5B3S H;  1X4O A;  4IO9 F;  1CQT A;  1FEX A;  3KZI C;  2IGK A;  4DGW B;  5LD2 C;  4Y17 A;  5HVQ C;  3MD2 A;  5E18 F;  2G7U A;  3H0G J;  3MN2 A;  3B6C A;  2KDO A;  2X85 A;  2ID6 A;  3JRC A;  5FD5 A;  1T8I A;  2E5N A;  2IXS A;  4D7M A;  4ESB A;  2ZKZ A;  2DA7 A;  3LL7 A;  2P7V B;  2M87 A;  2CS3 A;  2PN6 A;  2Z16 A;  5CVR A;  3ZXS A;  4BQQ A;  2V26 A;  2EFW A;  2WAF A;  4PFO A;  2HFH A;  1LFU P;  3KEY A;  2VQH A;  5F1J A;  1D3Y A;  3SZP A;  3KYL A;  3P5J A;  5J1U A;  4Y4R A;  4MTE A;  5M5Y J;  1YIT I;  2DOF A;  3OV8 A;  2XKP A;  4Z2Y A;  2VAS A;  4E7S A;  5HLT A;  1Z7L A;  4MHG A;  2LLK A;  1OPC A;  2O8K A;  3BJ6 A;  4DYQ A;  3JSO A;  1XCV A;  3CMY A;  2M4K A;  3HRU A;  3FKJ A;  3RPQ A;  4CYD A;  1Z3X A;  3K4K A;  1N78 A;  3CES A;  4BHC A;  3CO6 C;  5J4V A;  4BAC A;  1K6O A;  4P9U A;  1P4A A;  3RPU D;  4OAZ A;  1TL8 A;  4FHT A;  2UXX A;  2CUE A;  5LHG A;  1XS9 A;  5HNF A;  1VQ4 I;  3WU1 B;  4AID A;  3HOU J;  4IHS A;  5JHF A;  1ACI A;  1EJ9 A;  4HX7 A;  5JI6 A;  1OKR A;  3N05 A;  5L3B A;  5E3N A;  2F5F A;  4JBA A;  5D4S A;  1J5Y A;  4HQM A;  5IP9 J;  1JI8 A;  4GYI A;  1A6Q A;  4BE2 A;  2R7V A;  2KMU A;  4E70 A;  1B6A A;  4XOP A;  2R5Y A;  3HB9 A;  1SC7 A;  2ZSH B;  2JRT A;  2P8T A;  1BJA A;  4Y7N J;  1E0E A;  1XMK A;  1SD5 A;  1TWG J;  2QUF A;  3H9G A;  3VB2 A;  4CH7 A;  3MKY B;  2ESH A;  4OOI A;  2NS7 A;  1QA6 A;  1O3T A;  5GPC A;  3HIF A;  3L09 A;  5KK1 A;  3CUQ C;  1LFP A;  3GTL J;  4CSW A;  1BI1 A;  5J1Y A;  3D5S C;  2E36 A;  4A69 C;  2H94 A;  5F08 A;  1UHS A;  1X1C A;  2NS0 A;  5EEG A;  2L2O A;  4PGH A;  1VQ8 I;  2EZL A;  4KYW A;  4BY1 J;  2W82 A;  3ZMT A;  2GZW A;  3F8F A;  1QU3 A;  2ZME B;  3ULQ B;  3K2A A;  3ZQI A;  3HSR A;  3SDB A;  1ULY A;  1B4A A;  3UR3 C;  1WHU A;  5LGN A;  1U78 A;  2IBD A;  4MFD A;  1IXR C;  5FKM A;  4C3J J;  1JTY A;  3H3V K;  3MQ0 A;  3LST A;  1MBF A;  4C2M J;  4PUS A;  2VBX A;  1NK3 P;  1ZR4 A;  2ZXW H;  1NHA A;  3KP4 A;  5EZG A;  1YX3 A;  4L5E A;  2VOP A;  3BR1 A;  3W6V A;  2RAE A;  2CU7 A;  2V1D A;  4FX0 A;  4LK0 F;  5GPA A;  3I4N J;  1ZRF A;  3UNG C;  2E5Z A;  3KPH A;  3HOZ J;  1DP7 P;  2DMQ A;  3EYY A;  5H6Q A;  3JSP A;  4WCG A;  2FOW A;  3TOB A;  1JUP A;  2MBF A;  5CQG A;  3ZR8 X;  1G4D A;  1KU7 A;  1UFM A;  3D0S A;  3JRG A;  4A3D J;  2XGE A;  1JKQ C;  1ONV A;  1JE8 A;  3DBL B;  5HDG A;  4HF2 A;  4LIU A;  2EBI A;  3BJO A;  1TWF J;  4S0H B;  4UUS A;  2VJJ A;  1D5V A;  3CDI A;  1MH4 A;  2QQ9 A;  2DA4 A;  2MAB A;  4O3M A;  1OJL A;  4ZDL A;  2H09 A;  1H8A C;  1P2F A;  1LJ9 A;  2GQQ A;  2P0W A;  5FKO A;  2DYS H;  4IVN A;  3C2H A;  1D1A A;  2Y0S A;  1O57 A;  1AOY A;  1R5H A;  2RQP A;  4GFB A;  3R61 A;  3R4K A;  1OCP A;  2F5E A;  2XV4 S;  1QO0 D;  3GBG A;  3TP3 A;  5BOX A;  2ISZ A;  1SMY F;  3SYT A;  5F0C A;  2X6O A;  2H6B A;  3H0D A;  4QWQ A;  3CDH A;  3IUO A;  2W1O A;  4EV0 A;  2PEX A;  2BZT A;  2L5Q A;  2MH9 A;  1J75 A;  2JVH A;  2R5Z B;  1MKM A;  4A3L J;  1X1A A;  3I4P A;  4II3 A;  4WK8 F;  3FBI B;  1S3J A;  2FE3 A;  2MLG A;  3C1D A;  2XVC A;  2NAZ A;  3PIO F;  5JHU A;  3S3N A;  4E6K G;  3GFM A;  3OIP A;  1QRY A;  5F0H A;  5HOD A;  4C3H J;  4E7Z A;  2CW0 F;  3BY6 A;  3ECH A;  4HNU A;  1ZTR A;  5GP9 A;  1W0T A;  4F55 A;  1LEB A;  1YS6 A;  4YEJ A;  3F8M A;  4KIG A;  2CV1 A;  3RSN A;  2EJR A;  5K5Q A;  2XDV A;  4K2E A;  3HHH A;  4IX7 A;  1APL C;  3F3X A;  1BW6 A;  4CUG A;  2XF5 A;  3FXO A;  1R71 A;  5IOZ A;  3FIW A;  2XHK A;  1TQM A;  3HGG A;  4RB3 C;  3HOT A;  4LLG F;  3FIS A;  3UKG A;  3CLQ A;  4F92 B;  2NVU B;  2ZXI A;  3KZY A;  1BI0 A;  2HPI A;  3I9V 2;  4MNU A;  3OY9 A;  3ZQL A;  3K1M A;  2DXI A;  3GF2 A;  1AHD P;  3SEQ A;  2CG4 A;  5D5W B;  2ZNZ A;  4CO8 A;  1FYK A;  2CRG A;  3N4M A;  2N8G A;  1G8X A;  3EUH A;  4EJV A;  1BI2 A;  2HOA A;  2NOJ B;  3QPT A;  4E4H A;  2GA1 A;  2WV0 A;  3QPL A;  4PGG A;  3FHN A;  4QLC U;  1FP1 D;  4Y33 A;  2PX9 A;  2L7F P;  1XGO A;  3JRA A;  1KZH A;  4RAZ A;  4IPA A;  5C44 J;  2CFO A;  2DTZ A;  4LFU A;  1Z6T A;  3RI4 A;  1O4X A;  4P1W A;  2WAQ A;  3BT9 A;  5CVJ A;  1QGP A;  3BR3 A;  1DP3 A;  1IAW A;  4LB5 A;  1FLI A;  4A3M J;  2R7O A;  2X9D A;  2Z99 A;  3DTE A;  4U0W A;  4XLN F;  3GX4 X;  5DV5 A;  1H9T A;  1AA7 A;  5LEK A;  2M4G A;  2DPU A;  2QLZ A;  4A93 J;  2XF7 A;  1QHH D;  4QPO A;  4FAS D;  1V5E A;  5E20 A;  2GLO A;  5FRN A;  5KAF C;  2KP6 A;  1Z91 A;  2L7Z A;  2R7W A;  2BHY A;  5HDK A;  2GXB A;  4F91 B;  3P9K A;  3IAS 2;  2E71 A;  1XD7 A;  1S6L A;  3CCQ I;  1WGX A;  4C30 A;  3BLY A;  3GLX A;  3OL4 A;  1QQI A;  2CWE A;  2MG4 A;  5JLX A;  2K9L A;  5F27 A;  5E79 C;  3L2Q A;  1GLN A;  1U5T B;  3SEZ A;  1LVA A;  1Y56 A;  3DXJ F;  5DD4 A;  3W2A A;  3EQL F;  3X2Q H;  4N9I A;  5LBQ A;  5M3M J;  4RDU A;  4ZH4 F;  3KE2 A;  5F6F A;  1R4N B;  2P81 A;  1PP7 U;  5CVI A;  3V7S A;  4BDZ A;  2L4M A;  2EB7 A;  3TDZ C;  4MLO A;  1DQU A;  1F9N A;  1SVM A;  5HS8 A;  4EGY A;  2PFB A;  5B5E C;  1ORK A;  4XR6 A;  4BAY A;  4OIP F;  2B9S A;  2E2J J;  1DUX C;  4BE0 A;  3ZPL A;  2P6S A;  1WJD A;  3MKW B;  3RQ4 A;  1SFE A;  3A02 A;  3H1C A;  3VOE A;  2X1E A;  1YIO A;  4KMU X;  3KET A;  3WHC A;  5HS9 A;  1S9H A;  4FTH A;  4RAG A;  1IZ1 A;  2M7B A;  5J8F A;  2OTJ I;  4LIV A;  5BQT A;  2IA0 A;  1MMN A;  5CKT A;  1YHQ I;  3J80 K;  3WTX C;  1B8I B;  4H4K C;  2FX0 A;  4IQ4 A;  5ICF A;  3HL2 A;  4KMF A;  4LG3 A;  4ENJ A;  3BP8 A;  3OS0 A;  2FA5 A;  3FHZ A;  2ZJR F;  3LSM A;  2PG4 A;  2IPQ X;  3H9J A;  4BH9 A;  5FKN A;  2LVS A;  1E3P A;  4R1H A;  3S3O A;  1MDM B;  1FSE A;  3H5R A;  6PAX A;  3ZOB A;  1A5J A;  1L0O C;  2OCC H;  2K85 A;  5EJC A;  3PSI A;  3VYR B;  4CDG A;  1LQ1 A;  5DYM A;  3CDL A;  3BQY A;  4YFN F;  2JWT A;  1FTZ A;  1XB4 A;  3W3C A;  4AU7 A;  2KJC A;  1QBJ A;  5DUI A;  3F8B A;  1A6I A;  1P92 A;  4PDK A;  4II2 A;  4LOC A;  2OUM A;  2HOE A;  4ZYD A;  4A2U A;  2IGO A;  3DLL F;  1WH7 A;  2VBW A;  1MZB A;  3QU3 A;  3RYP A;  4RLQ A;  2EK5 A;  3CQZ J;  1VQO I;  4OMY A;  2EV0 A;  1O3R A;  2DO7 A;  1LDD A;  3HXL A;  2NYX A;  3Q9V A;  1K7A A;  4BQA A;  2O5R A;  3DEW A;  5H20 A;  4XIC A;  2QEX I;  4NB5 A;  4B3A A;  4B47 A;  3T8T A;  4AIJ A;  3Q0U A;  1UJ8 A;  2QF7 A;  4W97 A;  3VDX A;  4I0A A;  2GXG A;  4H0E A;  1XGM A;  2IS1 A;  2I10 A;  3WGH A;  3OYG A;  2PLY A;  2JA7 J;  2WWY A;  5K5R A;  1D0Y A;  4QPQ A;  4UY8 I;  3DCF A;  1Y0U A;  4KN4 X;  5D5U B;  3GZN B;  1E3O C;  1HDD C;  3FXJ A;  1KYZ A;  4A3B J;  3HTU A;  2ECB A;  3TOA A;  2A5W A;  2JZY A;  2BW3 A;  3DKW A;  3QP5 A;  1IXS B;  4M3D A;  3QAH A;  1EH7 A;  3NQO A;  2F6C A;  4NNJ A;  1DGR M;  5IYC J;  3QOD A;  2W00 A;  4XON A;  2GXA A;  4OIQ F;  3O6B B;  2RQQ A;  4AWX B;  1R6R A;  2JT1 A;  2JUC A;  3PM1 A;  3J7Z I;  2WC2 A;  3RDI A;  2WB1 A;  1J2X A;  5E1X A;  4UV8 A;  2VQG A;  3CCR I;  1P6R A;  3LQR A;  1Z9C A;  3DU5 A;  1IG7 A;  3FM5 A;  3OSG A;  4CHU A;  3QPS A;  4RBO A;  2ZCW A;  1P9Q C;  1FSH A;  5C4J J;  2HR3 A;  4AD9 A;  5KHD A;  1TNS A;  3I55 I;  2IS2 A;  1ENH A;  3LQQ A;  3IV5 A;  2VUM J;  3JAM K;  1Z1D A;  1RPW A;  2DA5 A;  4Y13 A;  1LUJ B;  5KVR A;  2W48 A;  3BR2 A;  1R00 A;  3DPL C;  4ESF A;  1O3S A;  1R1U A;  4KDP A;  2DAO A;  2DT5 A;  1T38 A;  2LY2 A;  1I3A A;  4M72 A;  3HG9 A;  5E8I A;  3CCM I;  2IJL A;  1UST A;  2HPM A;  5M5W J;  4XKV A;  1RIO H;  3ZQ7 A;  2ICW G;  4I0B A;  2AQE A;  3KIO A;  2HXI A;  3LSH A;  3JRF A;  1DU6 A;  2AHQ A;  4B43 A;  1FY7 A;  1KU3 A;  3T1B A;  2W4S A;  1ZLK A;  5IT9 K;  1ETK A;  4EMS A;  1ZGA A;  1FBS A;  1VZ0 A;  3R0J A;  3SZG A;  3DTK A;  1VFC A;  3QWL A;  3NEU A;  4XLA A;  2EZH A;  1F5T A;  2ZXH A;  1IN5 A;  1WQ2 A;  1P4W A;  1V4R A;  5IP6 A;  3F6V A;  1PYV A;  3ZQH A;  1POG A;  2GA2 A;  2STW A;  3KLN A;  2D1V A;  2BV6 A;  4NC8 A;  3KCC A;  4C2U A;  3K1P A;  3L1P A;  3M8E A;  1T56 A;  3BG9 A;  1WH5 A;  2ZXJ A;  4HZF A;  2LG4 A;  5TIS C;  2L01 A;  3OWT A;  4AIK A;  2ME0 A;  2HQN A;  2DU9 A;  1FNN A;  2O03 A;  2HYG D;  2VOD A;  1Z0X A;  2Z3Y A;  4CCM A;  5H2F C;  4WX9 A;  2A3S A;  5K7F A;  3BG5 A;  4HA8 A;  1HST A;  1NH3 A;  2X48 A;  1I6X A;  3BTL A;  3DKY A;  1U8B A;  2BVM A;  2J5P A;  3E6C C;  4ZZD A;  3HBL A;  4V2G A;  5B66 C;  2JA6 J;  2O6G E;  2MSY A;  5A2Q Z;  3EDP A;  4MEY F;  3PSF A;  4XN3 A;  2RDP A;  4DQ2 A;  4DZP A;  1AKH A;  2VXD A;  3U1K A;  1YYV A;  2Z9O A;  2LKP A;  4F3Q A;  2WB1 N;  1A35 A;  3FXK A;  3K69 A;  4JX5 A;  2OV7 A;  2W57 A;  2FBK A;  1GVJ A;  3B73 A;  5GAE J;  2EPF A;  2PI0 A;  2J5O A;  5ERI A;  1YRN A;  4BHB A;  2XPV A;  3Q9S A;  4XRM A;  4UUS B;  1OCC H;  2DDA A;  2LK2 A;  3JW4 A;  1S7A A;  3G2B A;  2RKH A;  5DDG A;  5KNL A;  3OYM A;  3ABK H;  1RUN A;  1IC8 A;  1Y1W J;  1Y0N A;  2R7F A;  4OMZ A;  3F23 A;  2R0Q C;  2F5D A;  4LB6 B;  1WWX A;  2VJI A;  3KEQ A;  2K86 A;  3KP3 A;  3U21 A;  4ZYG A;  2LRD A;  1R5G A;  4PJ0 C;  3RZD J;  3WTZ A;  1G3T A;  3ZMS A;  4DOZ A;  3PJR A;  3CMA I;  3W2W A;  2DCE A;  2F48 A;  1R5I D;  4L18 B;  2LRE A;  4EJU A;  4DIQ A;  2DK5 A;  3LSJ A;  2XSD C;  5DTD A;  2MFZ A;  4XM3 A;  5BMZ A;  2DJI A;  3CMM A;  2EH3 A;  3QP6 A;  4HX8 A;  2Z5U A;  1KQ0 A;  3JRH A;  2LD5 A;  4L9J A;  1W5T A;  4DW6 A;  3S14 J;  1N77 A;  1JKO C;  2CW8 A;  2DLL A;  3H36 A;  1LNW A;  4MO7 A;  4BKX A;  1AU7 A;  5IT9 Z;  3I59 A;  3FBN B;  3ZP5 A;  3HTS B;  1LPQ A;  2IS6 A;  4ASN A;  1DU0 A;  2ELH A;  4MGR A;  2A6T A;  3DEU A;  4M71 A;  2R7X A;  2FML A;  2DA1 A;  3FXR A;  3GTK J;  1ETY A;  3BR6 A;  5IT3 A;  1BBY A;  1ETV A;  3D5R C;  3LSK A;  3IWF A;  1XGS A;  2P5L C;  1NG7 A;  1Z21 A;  3RJP A;  3GWZ A;  3DLA A;  2QWW A;  2QA4 I;  3A2K A;  1XPX A;  4BNC A;  4XK4 A;  5A2Q K;  1W36 C;  2KZV A;  3WTU C;  3ECO A;  1E17 A;  2HXO A;  3KP5 A;  1REP C;  4I02 A;  4I7H A;  2AQF A;  4CXF A;  4RGR A;  1CF7 A;  1O7L A;  4CCO A;  2GAU A;  3DF8 A;  2Y48 A;  2X0L A;  1OFC X;  3AL0 B;  1IGN A;  4I76 A;  3HYI A;  1IRZ A;  3I54 A;  3P9C A;  2KRF A;  2LSO A;  4BXF A;  2CQX A;  1XTA A;  1M1E B;  2DQR A;  1G59 A;  1ERD A;  5LEJ A;  1TNT A;  2CJJ A;  3AFH A;  1ZR2 A;  3VEP A;  4KUM A;  4NQW B;  3ML6 A;  2LKX A;  3B6A A;  2DW4 A;  4HSR A;  3L9F A;  2RC4 A;  2IGM A;  2WV1 A;  4UVA A;  2Y9Y A;  4M9S A;  1VQN I;  3CCL I;  3MZH A;  2XUB A;  3ZMD A;  3HPH A;  1R1T A;  2PJP A;  3HOX J;  1I27 A;  1XCB A;  2K7L A;  1GHC A;  1RET A;  4PJL A;  2VBY A;  1TZL A;  1ZYR F;  2FBI A;  3BC8 A;  3GUD A;  1EF4 A;  3F22 A;  3ZMZ A;  1PVE A;  2LF8 A;  3I0T A;  3C2B A;  4M73 A;  4RB0 A;  4UB6 C;  3S8P A;  5E3O A;  2E1N A;  5CVU A;  4XMY A;  3ASO H;  4XLC A;  3E6M A;  1U5T C;  4GYG A;  1X3W B;  1J7K A;  2M8G X;  3E5U A;  3LSI A;  4S05 A;  2VON A;  4U7D A;  3I58 A;  4RGU A;  4BYY A;  4ZTF A;  1LB2 A;  5GAD J;  2V1U A;  3E5X A;  1VQ9 I;  1IUY A;  3EUH C;  2V4J C;  3W6K B;  2LKS A;  4XID A;  3VPR A;  3MFK A;  1F43 A;  2QEN A;  3GZ5 A;  3E1S A;  3BCA A;  5K1Y A;  5L3F A;  4RB1 A;  5ILU A;  3OYC A;  3CCE I;  5D6F A;  4RAY A;  3DBH B;  1YX5 A;  3V4G A;  5IYD J;  2ZJP F;  3AG2 H;  1RI7 A;  5B1B H;  3MKZ A;  2D5V A;  4D5C A;  1FMV A;  1KON A;  2BVL A;  2KKO A;  2OF7 A;  3CC7 I;  2L4A A;  2R7U A;  1P4X A;  3BTC A;  4IOA F;  2WAQ N;  3V7R A;  1WJC A;  2K9N A;  3MZ8 A;  5C3E J;  4QIW N;  3IP4 B;  3HSE A;  1ZEL A;  2QKL B;  3PL8 A;  3D1N I;  5HLG A;  3GTG J;  1GV2 A;  2BOL A;  1MDM A;  3F0C A;  2YR2 A;  2YS9 A;  4L5I A;  2UXN A;  4DJA A;  2K40 A;  1T95 A;  3K6G A;  2O8X A;  2WAE A;  4NHJ A;  4JP0 A;  3H92 A;  1ZG5 A;  2E34 A;  1XSD A;  2STT A;  4OIN F;  3CC4 I;  1V54 H;  2OC6 A;  3T5X A;  1UG2 A;  4J01 A;  4AUX A;  1IRX A;  1JT6 A;  2K5C A;  1SD4 A;  4BJT A;  3CUO A;  4JQF A;  1GV5 A;  3TGN A;  2R4G A;  3WHB A;  4YEL A;  4HF1 A;  1U6G A;  3RKW A;  5EEA A;  2GM4 A;  4HRI A;  3ABU A;  1JJ8 C;  1TLH B;  3KP6 A;  4KIF A;  1ZK8 A;  2FSW A;  2VT2 A;  2KFD A;  3M1E A;  5FLV A;  2NVT J;  4HNV A;  1EA3 A;  1MJB A;  1MBG A;  2NOG A;  3TQN A;  4U0Y A;  5IYB J;  1MGT A;  3CUQ A;  3FK7 A;  1UHM A;  2EA4 A;  2F4O B;  5BPD A;  1SAX A;  2TDX A;  3Q5F A;  4LLN A;  1IN8 A;  3QQA A;  3WG7 H;  5DM7 F;  1VQ6 I;  3K4N A;  3I56 I;  2DDB A;  3OOU A;  2E1M B;  4PJM A;  3K4C A;  3K4L A;  4TV7 A;  3J7A O;  2WY8 Q;  5FLM J;  3IL2 A;  2KIU A;  1MMA A;  5H6R A;  1K78 A;  2D45 A;  3S3M A;  1LVK A;  3Q0V A;  3GFL A;  1OMI A;  5K5O A;  4ZDO A;  1WJA A;  1DDN A;  4NUB A;  3OS1 A;  2IAI A;  2P4W A;  2I5U A;  3IRQ A;  1T08 B;  4BJ5 C;  2I8D A;  2IA1 A;  3HC7 A;  4OIO F;  2VJ4 A;  4MIM A;  4P9F A;  2ESN A;  1R49 A;  2HDD A;  4KFC A;  1FTT A;  2Y0S N;  1ZGJ A;  1ZHF A;  5CJ9 A;  1BL0 A;  1SFU A;  2K02 A;  3S2H J;  2XB5 A;  4A6E A;  4IF4 A;  2KPM A;  1B9N A;  4BEH A;  3MAJ A;  1X19 A;  1UMQ A;  5FLX Z;  3AG1 H;  3MMY B;  1I39 A;  1TWH J;  2VQL A;  1XSX A;  2A69 F;  3FM3 A;  4ABZ A;  1QVU A;  3LOC A;  2R7Q A;  2BYV E;  1N75 A;  1IDY A;  5FO5 A;  1ODD A;  2G7H A;  4IEJ A;  2K4B A;  4AVZ A;  5EZH A;  5BPI A;  1STZ A;  2KRH A;  2Z1D A;  1FOY A;  4G6Q A;  1A31 A;  1MIJ A;  4GO1 A;  2C6Y A;  5ICC A;  1QPM A;  2VKD A;  5CYV A;  3HOV J;  4RM2 A;  4D0P A;  1MBE A;  1JKR C;  3HGY A;  3GLL A;  3EUA A;  3DFG A;  2M0M A;  1RR8 C;  3J81 Z;  2BXZ A;  4AC0 A;  3V7C A;  3WTY C;  3CJT B;  4BGD A;  1X1P A;  1UHW A;  4ON0 A;  1SVO A;  4G7H F;  1OCZ H;  2CUZ A;  2EFN A;  5E3M A;  1JHH A;  4KN7 X;  3VOD A;  3HSF A;  2DMP A;  2DOE A;  3D5L A;  4G8X A;  1T2K A;  1FJL A;  4E7J A;  3CO7 C;  4A0X A;  4DBQ A;  5ILV A;  2NVQ J;  1TC3 C;  3MCZ A;  2RV8 A;  3CCS I;  3O3K A;  2CV0 A;  1Y6I A;  4G9Y A;  2ZME A;  3RKX A;  1NTC A;  3CJN A;  1JHF A;  3CCU I;  3OIQ A;  3FMS A;  4UV9 A;  3ZQC A;  2DYR H;  3OYF A;  3OYL A;  3HEF A;  4L9T A;  1B9M A;  3ABL H;  4XOT A;  2JTV A;  2KIQ A;  5IP7 J;  1OYW A;  3CUQ B;  3VSK A;  2E2H J;  3HUG B;  4HST A;  2IVM A;  3GFI A;  3WE2 A;  4E7K A;  4IHT A;  3W2V A;  3LAJ A;  3ABT A;  1LE8 B;  1FPQ A;  2OCE A;  4RM3 A;  2FEZ A;  3BCB A;  2UV1 A;  2WY7 Q;  4EM1 A;  2ELJ A;  4CYC B;  1WSU A;  1HF0 A;  1TW3 A;  2HGC A;  3F72 A;  1RC9 A;  3GCM A;  3SHF A;  3BTI A;  3CD6 I;  2JRM A;  2VBZ A;  4DYR A;  3A0B C;  1SFX A;  2M45 A;  4ZYA A;  1Z7U A;  2DN0 A;  1IO2 A;  3DBR B;  1TWC J;  3HKZ N;  2ZJQ F;  2F4I A;  1X1B A;  4HG2 A;  1RNL A;  3OIO A;  1X4P A;  4EQQ A;  1FC3 A;  3H9Q A;  1T98 A;  2Y2Z A;  5FKK A;  3L2R A;  1HLV A;  1WJB A;  4IRG A;  2PMH A;  4U87 A;  3QOE A;  2IW5 A;  2GOM A;  2Y69 H;  2WBM A;  4U88 A;  1MMD A;  3RKY A;  2F2E A;  4M3B A;  3JRB A;  3S2W A;  5EDN A;  2L54 A;  3FZV A;  3CC2 I;  2DMU A;  2KIF A;  1BC7 C;  2K27 A;  2D1H A;  3U1D A;  2DT6 A;  2DA3 A;  1XMA A;  2GOX B;  3E97 A;  3DWL E;  3S93 A;  3SFZ A;  2HDW A;  2R5Y B;  1BI3 A;  2PBI A;  1BR4 A;  1X1D A;  4G6T B;  1I6H J;  1IV8 A;  2A07 F;  2AS5 F;  2RVC A;  1H88 C;  3PIP F;  1CGP A;  1SAN A;  3KEO A;  5IOY A;  2KDZ A;  2DJN A;  4FT8 A;  4CA0 A;  4ZZL A;  2CUJ A;  1YS7 A;  4JX6 A;  3CZ6 A;  4U0V A;  1U9N A;  5FKL A;  3GTP J;  4CYC A;  2RNG A;  4A3G J;  3I59 B;  4HBL A;  4LK1 F;  3I3L A;  4GDF A;  2E7X A;  2EIL H;  1BM9 A;  2FUG 2;  3J7A Y;  1VTN C;  1LFB A;  2HVR A;  2AO9 A;  4MQV A;  1BIA A;  3SZT A;  3FXU A;  2G0E A;  2BHZ A;  2IT0 A;  1IN6 A;  2JPC A;  4M6Y A;  1W4M A;  1T0F C;  3L2U A;  3TP0 A;  1MSF C;  1J09 A;  1NG6 A;  3OL3 A;  2LY1 A;  3LWF A;  2DK8 A;  4HF0 A;  4J00 A;  2ID3 A;  2ZBK A;  4ANJ A;  3CCY A;  2ECC A;  1MBH A;  4PJJ A;  1CF7 B;  2K3P A;  2VT3 A;  1Z6R A;  3ROU A;  4MEX F;  2HOS A;  1WZ2 A;  1XDS A;  1JXS A;  2QBY B;  1HKT A;  2XAF A;  1K4T A;  2CO5 A;  4CCJ A;  1YJ9 I;  3LAP A;  4L5J A;  1UG0 A;  4PZJ A;  3PFI A;  3COA C;  2MD5 A;  2H8W A;  2BY0 A;  3W6J B;  5IY5 H;  3BR0 A;  3OYK A;  3J80 Z;  5HNH A;  1TW2 A;  4JOM A;  1JKP C;  3N97 A;  1MMG A;  2VB6 A;  3M4O J;  2RN7 A;  3K10 A;  5JFR A;  1B59 A;  1J9I A;  2Y0M A;  1OR7 A;  1RR7 A;  1FWZ A;  4ENK A;  2RNJ A;  5J4Y A;  2OZU A;  4EJO A;  2LOO A;  5L3G A;  3SXY A;  3LFU A;  3OR2 C;  3K4J A;  5CQE A;  5DM6 F;  5F64 A;  4C3I J;  4F93 B;  3G3Z A;  2EV5 A;  4XRS G;  1L3L A;  2DTR A;  2M7A A;  4X1E A;  5EG0 B;  1HC8 A;  4YFX F;  4G6D A;  3GTO J;  4YRV A;  2FJ1 A;  1SFK A;  1ZKG A;  3O8H A;  4Z6Y A;  4XRS A;  4PSW A;  1BN5 A;  3CP8 A;  5D8L B;  3ERE D;  2HDC A;  2HQ5 A;  1QVT A;  2OA4 A;  5ICG A;  3LNQ A;  1MSE C;  1J0R A;  1LDJ A;  2JMW A;  5CVV A;  2F5C A;  4FQG A;  2QGU A;  3FDY A;  3JTG A;  2XKO A;  3V8J A;  4L9V A;  2DA2 A;  4Q4Z F;  4UNO A;  5L3C A;  2QSG X;  4XBF A;  2LH9 A;  2EIN H;  1YLF A;  4DYC A;  5F1R A;  5M3F J;  5EF6 A;  3E5Q A;  2MC4 A;  4XN0 A;  1JTX A;  3TBI A;  4BE1 A;  3FMQ A;  4HX4 A;  3QYB A;  1WKM A;  3KLO A;  1TQI A;  1WVR A;  3PNV A;  2A6E F;  1BC8 C;  3WTT C;  3KFW X;  1OCO H;  1HXD A;  2O3F A;  2VKE A;  2VC0 A;  3C18 A;  3EUK L;  3FX3 A;  4DZJ A;  1Q1V A;  2M0C A;  1F1Z A;  2VLA A;  5HDN A;  1MBK A;  1XC5 A;  1YW8 A;  5J40 A;  4U7B A;  1YIJ I;  4E7I A;  2DI3 A;  4X6A J;  1KQ9 A;  4PSX A;  2G9W A;  5FB2 A;  4O6J A;  4ENN A;  2X1C A;  1PJR A;  2L7K A;  3QPH A;  5D8K B;  5LHI A;  2XSJ C;  5KAI C;  1HDP A;  1JUS A;  1W1W E;  4RA2 A;  5ICE A;  1RES A;  1ZRD A;  2OZ6 A;  4A3C J;  9ANT A;  4YII A;  3JAM Z;  4L0Z B;  1ZGW A;  3WGI A;  1K78 B;  2V9P A;  2YU9 J;  3G1O A;  2Z2S B;  3LMM A;  1ZQ3 P;  3FXQ A;  3H3Z A;  4IL6 C;  2VXZ A;  2ZNY A;  2JVG A;  2CW7 A;  4JK1 X;  3DQV C;  3BG3 A;  3CCJ I;  2JUG A;  2V7F A;  1EKE A;  1YJW I;  3PFY A;  3OSF A;  4D1Q A;  4I09 A;  2GWR A;  2BBY A;  3FMR A;  3BR5 A;  2LMD A;  1VI0 A;  4L0Y B;  1X58 A;  2EFO A;  2JA2 A;  3TW7 A;  3BZK A;  1I5Z A;  1WJF A;  4A12 A;  1BW5 A;  3QYF A;  2XRL A;  5D6E A;  2LY9 A;  1S29 A;  2VKH A;  1B1B A;  4A3I J;  1ZG1 A;  4UXN A;  3LA2 A;  1R58 A;  1Z3Y A;  2ETH A;  1FYL A;  2W7N A;  2KZG A;  5HS7 A;  1UB9 A;  3RYR A;  1HW1 A;  3HHG A;  4B1R A;  1ZRE A;  4CCN A;  1ZN2 A;  4GCV A;  4HV6 A;  4N4O B;  2B0L A;  3C7J A;  4IRH A;  4M6V A;  1YW7 A;  3R6S A;  2P7C B;  1VQL I;  4EJW A;  5LFA A;  2JN6 A;  4BHP A;  1FMW A;  4WXD A;  3PO2 J;  4UVB A;  2FNP A;  3ZGK A;  1D1B A;  2A6H F;  3FK6 A;  4W1U A;  3L7W A;  4CCL A;  3Q3S A;  4B8X A;  3WTV C;  2X1D A;  3V42 A;  2M30 A;  2CMP A;  2Q0O A;  5HOO A;  2W84 A;  3RIR A;  4G7O F;  3DEE A;  1S5L C;  2FD5 A;  5LRR A;  3HJE A;  2M34 A;  3VFZ A;  3WGG A;  1RZ4 A;  1R9T J;  1KU9 A;  3K7A J;  2HS5 A;  1EH6 A;  1T0F A;  1W7P D;  2R7T A;  4KT5 C;  4MFE A;  3H3U A;  4ZYE A;  4BBS J;  1B72 A;  3AG4 H;  3M1C A;  2XAS A;  4AYB N;  3HDD A;  2QSH X;  1GUU A;  2V6E A;  2FNA A;  3A1Y A;  4MTD A;  3DU6 A;  4A3E J;  1JJ6 C;  2M8E A;  1T39 A;  3JTH A;  1U3E M;  1U2W A;  1H89 C;  4BXU A;  1BA5 A;  3TO6 A;  4I99 C;  5IPA A;  1UZC A;  2M3A A;  3K4M A;  3G1L A;  1TQP A;  2NS8 A;  1IW7 F;  3ABM H;  3WOD F;  4PCQ A;  3CF5 F;  3L2C A;  1Y39 A;  1GXQ A;  1RRJ A;  2XAJ A;  1ZRC A;  2FOK A;  4IHY A;  1D8J A;  3HOY J;  2L7M P;  4F52 A;  3LSG A;  4G7Z F;  3F8C A;  3HRS A;  4Q47 A;  4RLF A;  5GAH J;  1SMT A;  4ETS A;  1AWC A;  5DEQ A;  3B02 A;  4ZYH A;  3ERM A;  1VQ5 I;  2V1N A;  4AVP A;  1QZZ A;  4QSH A;  1U0J A;  3ZRG A;  3IKV A;  4FCY A;  1G3S A;  5F0F A;  2YU3 A;  2A05 A;  4HAM A;  3BWG A;  4BS9 A;  3JR9 A;  4ESJ A;  1WFX A;  4NQW A;  2NNN A;  1K6Y A;  2V1X A;  2CSO A;  1FIP A;  3TO9 A;  1LKX A;  3O2P E;  3SQN A;  1XMX A;  3ASN H;  3M07 A;  4LD5 A;  3G73 A;  2ZME C;  2LFB A;  4GGG A;  2O7O A;  4NC7 A;  4CGZ A;  3S1R J;  3K9T A;  4BY7 J;  3JRD A;  3TL4 X;  3KP2 A;  4B3X A;  5FD6 A;  4YG2 F;  3LFK A;  4E7L A;  2M9H A;  2XF6 A;  3QOP A;  3SDG A;  1ETQ A;  3JRI A;  2NVY J;  4DBR A;  1YW9 A;  3LA3 A;  3E3V A;  2ZO4 A;  4M9X A;  1JGG A;  3E7L A;  3FKI J;  3ZMU A;  3ZN1 A;  2JA5 J;  3K1N A;  3ZCO A;  3RTR A;  5DCM A;  4B4C A;  2VPL A;  1LEA A;  2R7D A;  3GYH X;  1VND A;  3C3W A;  5CPR B;  1VQM I;  1U8R A;  5ILS A;  2R93 J;  3HPG A;  5K7H A;  2KIS A;  4IHW A;  2KIM A;  4BU2 A;  1OR7 C;  4M3F A;  2DA6 A;  5E1W A;  2IEK A;  4EAT A;  4D5F A;  3OYD A;  3LSP A;  1TBX A;  5L3D A;  3M9A A;  2X51 A;  1VQK I;  2EIK H;  3KZZ A;  2A61 A;  1TTY A;  1Y8R B;  1KGS A;  2NXN B;  2LTP A;  1MNM C;  2HEO A;  4LG0 B;  4UB8 C;  1GVD A;  2ELK A;  2LDU A;  4P55 A;  4A0Y A;  4LGW A;  2EA2 A;  5GTI C;  1W7P B;  1R22 A;  2ACJ A;  1FOK A;  1YO5 C;  1FOW A;  1ZLJ A;  3GVA A;  3MVP A;  1MJ9 A;  2CFX A;  3S16 J;  4UHT A;  3NAR A;  1YTY A;  2E60 A;  1SVL A;  4AYB A;  4V2F A;  1Q1H A;  3REO A;  1Z05 A;  4G94 A;  1ETO A;  2FMY A;  1HA8 A;  1HW2 A;  2P5V A;  5BNG A;  3F21 A;  4LG0 A;  5FFZ A;  1QZY A;  1P7J A;  3FWE A;  2H27 A;  3LSR A;  2QVO A;  4A5N A;  3QU6 A;  2FQ4 A;  4AM3 A;  3JRE A;  3C2G A;  4RGS A;  2IA2 A;  4XNF A;  3GTM J;  2EIJ H;  4F7Z A;  1V5G A;  2K9S A;  4E7H A;  1YRN B;  1D8K A;  1SD7 A;  2XAU A;  2PMU A;  5E1Z B;  2QYO A;  4IXA A;  5TGT A;  4X0G A;  1DGW Y;  1BIB A;  2F5V A;  3ZQG A;  1PP8 F;  4C2T A;  2HKO A;  5JLW A;  2HKX A;  4GRI A;  1ETW A;  3S17 J;  2E2I J;  2XAQ A;  4FX4 A;  5LGU A;  3BPV A;  2QQB A;  2FXA A;  1DPR A;  4HNT A;  2YX7 A;  5B1A H;  3OYN A;  2EFP A;  3IC7 A;  1SAU A;  1WJE A;  5DUK A;  2JJ7 A;  3A4C A;  4XLP F;  2FRH A;  4FE7 A;  1USS A;  2VOO A;  2E7W A;  2LNB A;  2OBP A;  3RCO A;  1XX5 A;  2HZT A;  2W85 A;  2OU2 A;  2VKV A;  3M8F A;  5FLX K;  3GW2 A;  1VF9 A;  4XL9 A;  4WWC A;  3I4M J;  2DQL A;  3ZMV A;  2EWN A;  4ZTJ A;  2LBF A;  3BJA A;  1I1S A;  2COB A;  4BJ6 C;  4FET A;  3BZC A;  1TWA J;  1A04 A;  2QZ8 A;  3ISP A;  3I71 A;  4NBQ A;  2Q2E B;  1UAA A;  2LYC A;  5C4X J;  1YI2 I;  1K4S A;  1XSV A;  5K7Z A;  3S15 J;  2FBH A;  2O0Y A;  5J1R A;  1H0M A;  4Q48 A;  1EV7 A;  2HOT A;  3OYE A;  5FGM A;  3Q0W A;  2EV6 A;  1LDK B;  2ZSI B;  3CF2 A;  4KA4 A;  3WE3 A;  1OYI A;  2BY2 A;  2MC3 A;  2R7Z J;  1X3Z B;  3PQK A;  2P5K A;  1JGS A;  2DFF A;  4P96 A;  3TO7 A;  1K61 A;  4EEF G;  2OD5 A;  2FF4 A;  2XB0 X;  4R8H A;  4UUV A;  1GXP A;  2VI6 A;  2XIG A;  1QNT A;  2LR8 A;  4XSX F;  3J81 K;  2VQC A;  3M7G A;  3SJM A;  3HRT A;  2Q2E A;  2RGV A;  4LJZ F;  4D7N A;  4KIB A;  1LE8 A;  2KT0 A;  2XRO A;  3MEX A;  2MD0 A;  2BW3 B;  1XG1 A;  2L9V A;  1FBQ A;  1BJZ A;  1S8N A;  3G1M A;  2E19 A;  1Z67 A;  5JR3 A;  3EET A;  2GBY A;  1OQY A;  2AXT C;  3KX2 A;  3CJQ B;  3WTW C;  1IN7 A;  2HYJ A;  1S7E A;  1ITY A;  2IS4 A;  1MMS A;  3G6E I;  4EM2 A;  1KA8 A;  2JK3 A;  2BGC A;  1W5C C;  1R23 A;  2HNH A;  2Q8K A;  2KRC A;  4OWR B;  4B09 A;  5CLS A;  2BE5 F;  5JVT A;  2CUF A;  1HOM A;  1WPK A;  3WU2 C;  5GTH C;  1KYW A;  1G3Y A;  4D9J A;  2OTL I;  3HM5 A;  2R5Z A;  4RAF A;  4PK4 A;  1E3H A;  2X6Y A;  3CTA A;  5E8G A;  1W36 D;  5E3L A;  4I01 A;  2X6X A;  1T6S A;  3DP7 A;  3PQJ A;  2BY1 A;  5DCF A;  2XPW A;  4HQE A;  5EEH A;  4IKF A;  1FYM A;  1XGN A;  1HCR A;  1YE9 A;  1MBJ A;  2DFI A;  2LP0 A;  3NRV A;  2O9L A;  4NDL A;  1X3U A;  1PDN C;  4BDY A;  1OCT C;  1I1G A;  5GAG J;  3A01 A;  2CV2 A;  3K4B A;  3L00 A;  2A68 F;  2OJE D;  3MWM A;  3GEZ A;  4A6D A;  3F8N A;  2IP2 A;  1ZAR A;  1OYY A;  2RRE A;  1W5S A;  3IH2 A;  3HRM A;  3TKY A;  4C9Y A;  1SFO J;  1IDZ A;  2HVS A;  3DPU A;  3NWT A;  2PQ8 A;  2NRA C;  2Y9Z A;  2EIM H;  3BZ6 A;  2L9R A;  3IKT A;  2ZC2 A;  2UZK A;  5JVG F;  1PUF A;  3AL0 C;  2FU4 A;  3BG6 A;  3P9I A;  3VYT B;  3ESW B;  3PNT A;  2ZFW A;  3VYS B;  3BRO A;  3GXO A;  2Q1Z B;  1YJN I;  4IZZ A;  2L9N A;  4WXH A;  4KIC A;  4Y15 A;  3CME I;  1WI3 A;  3K70 C;  4M74 A;  2OQG A;  3PUF A;  4L9N A;  3V8K A;  2GIV A;  3PUB A;  1B8I A;  3S1N J;  1BR1 A;  1JT0 A;  1TP4 A;  2DBB A;  3TDU C;  2MW8 A;  1ZH5 A;  1TT5 B;  4M3E A;  1SEU A;  1H9G A;  3K0L A;  1UCR A;  2JSP A;  4WF2 A;  1VQP I;  3BTJ A;  2PJR A;  4XOR A;  2DPD A;  5AON A;  3VSL A;  5F04 A;  4DNC A;  5LGT A;  4GXO A;  3TMO A;  4XKW A;  1QZE A;  1I3Q J;  2EZI A;  4R79 A;  1MND A;  2H8R A;  5J47 A;  4CZC A;  2K9Q A;  4XSZ F;  5L3E A;  3U9G A;  4YIF A;  3OYI A;  4A5M A;  3WU0 A;  2ME6 A;  1R4M B;  2TRT A;  3HOS A;  2VL8 A;  2L0K A;  2XPU A;  2M2E A;  3G4S I;  4RGX A;  5DCM B;  4UVC A;  3OYJ A;  2XC7 A;  2CQ7 A;  2QQA A;  1RKT A;  2UWM A;  3I5U A;  1P7I A;  3ELK A;  3IH3 A;  2E35 A;  3BOQ A;  3S32 A;  4PFP A;  2HZD A;  1BOA A;  4LMY A;  3VWB A;  3SFI A;  1G3W A;  2CQQ A;  4IRI A;  2DMN A;  4B48 A;  3CP2 A;  2R92 J;  1F36 A;  5D4R A;  2MYS A;  5J8C A;  4IJA A;  3L2V A;  1FX7 A;  4G12 A;  2LBF B;  2VIX A;  4I6Z A;  4ZJZ A;  2AXL A;  2CQK A;  3GME A;  4PJN A;  5D5V B;  3TED A;  2H1L A;  1N25 A;  2Y31 A;  4J19 A;  2NVX J;  4HV5 A;  1HKS A;  3QRF F;  3CCV I;  1XDU A;  1AKH B;  4YIR X;  1S72 I;  4NC6 A;  2XGC A;  1FBU A;  1Z77 A;  2LC2 A;  3A03 A;  2QBY A;  3T8R A;  3OR1 C;  3GFJ A;  2K9M A;  3ZQF A;  4HYE A;  2VN2 A;  3IH4 A;  3J7Y J;  5FRM A;  2EQR A;  1IV6 A;  2EZK A;  3OYH A;  3A01 B;  1YOV B;  3JCU C;  4HW0 A;  2WTE A;  3AAF A;  2WAD A;  3F6O A;  4KIT B;  2PMZ A;  2V9K A;  2KJB A;  3DV8 A;  1I50 J;  1R7J A;  3E0J B;  4IQJ A;  1HW5 A;  5EG0 A;  2CGP A;  2P6T A;  2QSF X;  1GT0 C;  5FFX A;  1D0X A;  3E6B A;  4I98 B;  3G71 I;  4MQ9 F;  2DT7 B;  1YQA A;  3RQI A;  1QHG A;  4N0B A;  2ADU A;  2HVQ A;  4N4N B;  2Y30 A;  3PNY A;  1WRJ A;  2HI3 A;  3IWZ A;  4B44 A;  2JA8 J;  3R0A A;  5TRD A;  2WA0 A;  2M1B A;  1G6N A;  2FQ3 A;  1K79 A;  2K4J A;  4EGZ A;  3S2D J;  1D1C A;  2JPB A;  2VC1 A;  4BL0 B;  1IRF A;  3KP7 A;  2K3F A;  2ISY A;  2IGN A;  3ZN0 A;  1IJW C;  2L9S A;  2XGD A;  4BUP A;  2H1K A;  3OYB A;  2OPT A;  2YX4 A;  3A0H C;  2HYF A;  3CJR B;  3ONQ A;  1V55 H;  5E17 F;  5BS6 A;  2HTJ A;  1J59 A;  1ZAO A;  3LA7 A;  3GZ6 A;  3FXL A;  3IAM 2;  4KIS A;  1FT9 A;  1D0Z A;  2X6W A;  2YPR A;  4HLX A;  4S04 A;  1O7F A;  1WCM J;  4HPQ A;  2COM A;  4IHV A;  3AG3 H;  2R3S A;  5D5X B;  2EFQ A;  2A5Y B;  4FIS A;  3VYU B;  2MH2 A;  1WI9 A;  3OMY A;  4M3G A;  5FJ8 J;  4EJT A;  1KQ8 A;  4BQO A;  2VPR A;  3OYA A;  3RKQ A;  1F4K A;  4KT6 A;  1C0W A;  1PUF B;  1OLT A;  3BQZ A;  2CYY A;  5AIQ A;  5FRO A;  2DOA A;  1SD6 A;  2V9V A;  4XQF A;  3OOP A;  1JUM A;  5HLH A;  3I53 A;  4BBR J;  1UEL B;  2PJR B;  1NK2 P;  4UUT A;  2XAH A;  4OIR F;  1HBX G;  5DD8 A;  1ON1 A;  3KYD B;  5EYR A;  5EGO B;  2W24 A;  5KCM A;  1S7O A;  4CIC A;  2V6C A;  2KQR A;  2R7R A;  1ON2 A;  2V79 A;  3F9K A;  3GTQ J;  2H6C A;  3MZY A;  3FXM A;  4EVI A;  1V3F A;  5EGO A;  2MGQ A;  3BDD A;  3DTI A;  3FF5 A;  4ENM A;  3CLO A;  1FIA A;  3IHU A;  3DKX A;  4XKC A;  3M3Y J;  4A3F J;  1W0U A;  1IXC A;  4CZZ A;  5DS9 A;  2KHM A;  2UUZ A;  4IOC F;  3O8G A;  5AIP A;  3HUG A;  4HDV A;  3HOW J;  2W25 A;  1KU2 A;  1OIS A;  3K70 D;  1ETX A;  1B72 B;  3WG9 A;  2BY3 A;  2JSC A;  3S1Q J;  2E1C A;  3OS2 A;  4V19 K;  2PMZ N;  1X2M A;  4OU0 A;  2HWV A;  2VE9 A;  1FP2 A;  4LIT A;  2E1O A;  2F4M B;  2ZFU A;  3GO5 A;  2HTS A;  2HQR A;  4CCK A;  2QM3 A;  4OAY A;  1T33 A;  2VJ5 A;  3MKL A;  3AKZ A;  4XRF A;  2YSR A;  2KLO A;  4BXX J;  4WXC A;  3U2R A;  4XLE A;  2M5W A;  4AIH A;  2XRN A;  4XLF A;  3RZO J;  4KJZ A;  1MW7 A;  5LLQ A;  1FZP B;  3I64 A;  3PO3 J;  3EPZ A;  2QCO A;  4XKB A;  4BQN A;  1RUO A;  2X4H A;  4N9H A;  1O3Q A;  2HQA A;  3DPT A;  1DPU A;  1IN4 A;  3EYI A;  2DOD A;  4A3J J;  4RMN A;  5ED4 A;  3S1M J;  1EH8 A;  3KYC B;  4HEA 2;  1BR2 A;  1YG2 A;  3E6D A;  4BEH B;  2L02 A;  3IRR A;  3P7N A;  2OQR A;  3GTJ J;  3H5N A;  2XGX A;  5J6X A;  1MD0 A;  2B63 J;  1PUE E;  2QQ8 A;  4IHX A;  3BPX A;  2B7E A;  1BOB A;  2E1M C;  2MA3 A;  2HU9 A;  4KNY A;  2CH0 A;  2Z33 A;  1IF1 A;  3HKZ A;  2VE8 A;  5HLI A;  4RS8 A;  5J3L A;  4LLL A;  4A0Z A;  3M8J A;  2KL4 A;  3H35 A;  4EM0 B;  2IRF G;  1G2H A;  3BG7 A;  1OCR H;  1QPI A;  4JYK A;  2JQ7 A;  1Y8Q B;  1MH3 A;  4Y3O A;  4O5V A;  2GIZ A;  4A3K J;  4M6X A;  4HDU A;  1V5F A;  1X2N A;  1ZG3 A;  2YUS A;  4P5O A;  3QYE A;  4FE4 A;  1U5T A;  1YFH A;  4JX4 A;  3ZQQ A;  1IRG A;  1WJ5 A;  1XN7 A;  1Y1V J;  4ZC3 A;  1GDT A;  4XLH A;  3T0Y A;  3R60 A;  3H5A A;  2XAG A;  1FOX A;  3WTS C;  2DFH A;  1U9O A;  1MNE A;  2D2W A; 
#chains in the Genus database with same CATH homology
 5TJJ A;  4HOB A;  2MLK A;  1E2X A;  4M9Z A;  1HQC A;  5LHH A;  4RB2 C;  4YFK F;  2NNY A;  2OAZ A;  4Q5S F;  2O61 A;  3V8L A;  1HKQ A;  1W7P A;  2LF7 A;  2Y75 A;  1R36 A;  3K2Z A;  2L3D A;  4HLY A;  4I2O A;  3RPU A;  2BEO A;  1MJA A;  1HSJ A;  5LRS A;  2ZJ2 A;  1R1V A;  4Y17 A;  5HVQ C;  5E18 F;  2G7U A;  5FD5 A;  4ESB A;  2ZKZ A;  2P7V B;  2M87 A;  2PN6 A;  5CVR A;  2EFW A;  2HFH A;  1D3Y A;  3SZP A;  4MTE A;  3OV8 A;  2XKP A;  4Z2Y A;  4MHG A;  1OPC A;  3BJ6 A;  3JSO A;  1XCV A;  3HRU A;  3RPQ A;  4CYD A;  4BHC A;  3CO6 C;  1K6O A;  4P9U A;  1P4A A;  4FHT A;  2UXX A;  5LHG A;  3WU1 B;  4IHS A;  4HX7 A;  5JI6 A;  1OKR A;  5L3B A;  2F5F A;  4JBA A;  5D4S A;  1J5Y A;  4HQM A;  4GYI A;  4E70 A;  1B6A A;  2JRT A;  2P8T A;  1BJA A;  1XMK A;  1SD5 A;  2QUF A;  3VB2 A;  2ESH A;  4OOI A;  1O3T A;  3HIF A;  3L09 A;  5KK1 A;  3CUQ C;  1BI1 A;  2H94 A;  2NS0 A;  5EEG A;  4PGH A;  4KYW A;  3ZMT A;  2GZW A;  3F8F A;  2ZME B;  3ULQ B;  3HSR A;  1ULY A;  1B4A A;  5LGN A;  1U78 A;  1IXR C;  3MQ0 A;  3LST A;  2VBX A;  1NHA A;  3KP4 A;  2VOP A;  2V1D A;  4FX0 A;  4LK0 F;  1ZRF A;  1DP7 P;  3EYY A;  3JSP A;  5H6Q A;  4WCG A;  3TOB A;  2MBF A;  1G4D A;  1KU7 A;  1UFM A;  3D0S A;  1ONV A;  1JE8 A;  5HDG A;  4HF2 A;  3BJO A;  1D5V A;  2QQ9 A;  4O3M A;  2H09 A;  1P2F A;  1LJ9 A;  2GQQ A;  4IVN A;  1O57 A;  1AOY A;  1R5H A;  2RQP A;  3R61 A;  3R4K A;  2F5E A;  2XV4 S;  1QO0 D;  5BOX A;  2ISZ A;  1SMY F;  2H6B A;  4QWQ A;  3CDH A;  4EV0 A;  2PEX A;  2MH9 A;  1J75 A;  1MKM A;  3I4P A;  4WK8 F;  1S3J A;  2FE3 A;  2MLG A;  3C1D A;  2XVC A;  2NAZ A;  5JHU A;  3GFM A;  2CW0 F;  3BY6 A;  3ECH A;  1LEB A;  1YS6 A;  3F8M A;  4KIG A;  2EJR A;  5K5Q A;  4K2E A;  3HHH A;  3F3X A;  2XHK A;  1TQM A;  4RB3 C;  3HOT A;  4LLG F;  3KZY A;  1BI0 A;  4MNU A;  3K1M A;  3GF2 A;  2CG4 A;  1FYK A;  2ZNZ A;  4CO8 A;  5D5W B;  3N4M A;  3EUH A;  4EJV A;  1BI2 A;  3QPT A;  2GA1 A;  2WV0 A;  4PGG A;  4QLC U;  1FP1 D;  1XGO A;  4RAZ A;  4IPA A;  4LFU A;  1Z6T A;  3RI4 A;  5CVJ A;  1QGP A;  1IAW A;  4LB5 A;  1FLI A;  2Z99 A;  3GX4 X;  4U0W A;  4XLN F;  5DV5 A;  1H9T A;  5LEK A;  2DPU A;  2QLZ A;  5E20 A;  1Z91 A;  5HDK A;  2GXB A;  3P9K A;  1XD7 A;  1S6L A;  3GLX A;  1QQI A;  2CWE A;  1U5T B;  1LVA A;  3DXJ F;  5DD4 A;  3EQL F;  4N9I A;  5LBQ A;  4ZH4 F;  3KE2 A;  5F6F A;  1PP7 U;  5CVI A;  3V7S A;  2L4M A;  2EB7 A;  3TDZ C;  1F9N A;  5HS8 A;  4EGY A;  2PFB A;  4BAY A;  4OIP F;  1DUX C;  3ZPL A;  2P6S A;  1SFE A;  3VOE A;  1YIO A;  4KMU X;  3KET A;  5HS9 A;  1IZ1 A;  5J8F A;  5BQT A;  2IA0 A;  3J80 K;  3WTX C;  5ICF A;  4KMF A;  4ENJ A;  3BP8 A;  2FA5 A;  3FHZ A;  2PG4 A;  2IPQ X;  4BH9 A;  4R1H A;  1MDM B;  1FSE A;  6PAX A;  1L0O C;  4CDG A;  1LQ1 A;  5DYM A;  4YFN F;  1XB4 A;  2KJC A;  1QBJ A;  5DUI A;  3F8B A;  1P92 A;  4PDK A;  2HOE A;  4ZYD A;  4A2U A;  2VBW A;  1MZB A;  3QU3 A;  3RYP A;  2EK5 A;  4OMY A;  1O3R A;  2EV0 A;  2DO7 A;  1LDD A;  3Q9V A;  2NYX A;  1K7A A;  4BQA A;  5H20 A;  4NB5 A;  3T8T A;  4AIJ A;  4I0A A;  2GXG A;  4H0E A;  1XGM A;  3WGH A;  2PLY A;  2WWY A;  5K5R A;  1Y0U A;  4KN4 X;  5D5U B;  1KYZ A;  3HTU A;  3TOA A;  2JZY A;  3DKW A;  3QP5 A;  1IXS B;  3QAH A;  1EH7 A;  3NQO A;  4OIQ F;  3O6B B;  4AWX B;  2JT1 A;  2WC2 A;  3RDI A;  5E1X A;  1J2X A;  4UV8 A;  1P6R A;  3LQR A;  1Z9C A;  3FM5 A;  4CHU A;  2ZCW A;  1FSH A;  2HR3 A;  4AD9 A;  1TNS A;  3LQQ A;  3JAM K;  1Z1D A;  4Y13 A;  5KVR A;  1R00 A;  3DPL C;  4ESF A;  1O3S A;  1R1U A;  4KDP A;  2DAO A;  2DT5 A;  1T38 A;  4M72 A;  5E8I A;  2IJL A;  1UST A;  1RIO H;  3ZQ7 A;  4I0B A;  1FY7 A;  1KU3 A;  3T1B A;  1ZLK A;  5IT9 K;  4EMS A;  1ZGA A;  1FBS A;  3R0J A;  3NEU A;  1F5T A;  1IN5 A;  1WQ2 A;  1P4W A;  1V4R A;  3F6V A;  2GA2 A;  2STW A;  3KLN A;  2D1V A;  2BV6 A;  3KCC A;  3K1P A;  3M8E A;  2ZXJ A;  4HZF A;  2L01 A;  4AIK A;  2HQN A;  2DU9 A;  1FNN A;  2O03 A;  2HYG D;  2VOD A;  2Z3Y A;  4WX9 A;  2A3S A;  4HA8 A;  1HST A;  1I6X A;  2J5P A;  3E6C C;  4ZZD A;  2O6G E;  5A2Q Z;  3EDP A;  4MEY F;  2RDP A;  4DQ2 A;  1YYV A;  2Z9O A;  2LKP A;  3K69 A;  2W57 A;  2FBK A;  1GVJ A;  3B73 A;  2PI0 A;  2J5O A;  5ERI A;  4BHB A;  3Q9S A;  3JW4 A;  1S7A A;  2RKH A;  5DDG A;  1RUN A;  2R7F A;  4OMZ A;  3F23 A;  2F5D A;  4LB6 B;  1WWX A;  3KEQ A;  2K86 A;  3KP3 A;  4ZYG A;  1R5G A;  3WTZ A;  1G3T A;  3ZMS A;  4L18 B;  4EJU A;  2DK5 A;  5BMZ A;  3QP6 A;  4HX8 A;  2Z5U A;  1KQ0 A;  4L9J A;  1W5T A;  2DLL A;  1LNW A;  5IT9 Z;  3I59 A;  3ZP5 A;  3HTS B;  4ASN A;  2ELH A;  4MGR A;  3DEU A;  4M71 A;  2FML A;  3FXR A;  5IT3 A;  1BBY A;  3IWF A;  1XGS A;  2P5L C;  3RJP A;  3GWZ A;  2QWW A;  4BNC A;  5A2Q K;  3WTU C;  3ECO A;  1E17 A;  3KP5 A;  1REP C;  4I02 A;  4I7H A;  4CXF A;  4RGR A;  1CF7 A;  1O7L A;  2GAU A;  3DF8 A;  2Y48 A;  2X0L A;  3HYI A;  3I54 A;  3P9C A;  2KRF A;  2LSO A;  2DQR A;  5LEJ A;  1TNT A;  3VEP A;  4KUM A;  3ML6 A;  2DW4 A;  3L9F A;  2RC4 A;  4UVA A;  4M9S A;  3MZH A;  2XUB A;  3ZMD A;  1R1T A;  2PJP A;  1I27 A;  1XCB A;  2K7L A;  1GHC A;  2VBY A;  1ZYR F;  2FBI A;  3GUD A;  3F22 A;  3ZMZ A;  2LF8 A;  3I0T A;  4M73 A;  4RB0 A;  2E1N A;  5CVU A;  3E6M A;  1U5T C;  4GYG A;  1J7K A;  3E5U A;  2VON A;  4S05 A;  4U7D A;  3I58 A;  4RGU A;  4BYY A;  1LB2 A;  2V1U A;  3E5X A;  1IUY A;  3W6K B;  3MFK A;  2QEN A;  3GZ5 A;  5K1Y A;  5L3F A;  4RB1 A;  5ILU A;  5D6F A;  4RAY A;  3V4G A;  1RI7 A;  2KKO A;  2L4A A;  1P4X A;  3V7R A;  3HSE A;  5HLG A;  1MDM A;  2YR2 A;  4L5I A;  2UXN A;  2O8X A;  4NHJ A;  3H92 A;  1ZG5 A;  2STT A;  1XSD A;  4OIN F;  3T5X A;  1SD4 A;  3CUO A;  4JQF A;  3TGN A;  4HF1 A;  1U6G A;  3RKW A;  3ABU A;  1TLH B;  3KP6 A;  4KIF A;  2FSW A;  2VT2 A;  3M1E A;  1MJB A;  3TQN A;  4U0Y A;  1MGT A;  3CUQ A;  1UHM A;  2EA4 A;  5BPD A;  1SAX A;  2TDX A;  3Q5F A;  4LLN A;  1IN8 A;  4TV7 A;  3J7A O;  3IL2 A;  2KIU A;  5H6R A;  1K78 A;  2D45 A;  3GFL A;  1OMI A;  5K5O A;  1DDN A;  2P4W A;  3IRQ A;  2IA1 A;  4OIO F;  4P9F A;  2ESN A;  4KFC A;  1ZGJ A;  1ZHF A;  5CJ9 A;  1SFU A;  2K02 A;  4A6E A;  4IF4 A;  1B9N A;  3MAJ A;  5FLX Z;  1XSX A;  2A69 F;  3FM3 A;  2BYV E;  5FO5 A;  1ODD A;  2G7H A;  2K4B A;  5BPI A;  1STZ A;  4G6Q A;  2C6Y A;  4GO1 A;  5ICC A;  1QPM A;  5CYV A;  4D0P A;  3DFG A;  3J81 Z;  3V7C A;  3WTY C;  1UHW A;  4ON0 A;  4G7H F;  2EFN A;  1JHH A;  4KN7 X;  3VOD A;  3D5L A;  3HSF A;  4G8X A;  1T2K A;  3CO7 C;  4A0X A;  5ILV A;  3MCZ A;  2RV8 A;  3O3K A;  4G9Y A;  2ZME A;  3RKX A;  3CJN A;  1JHF A;  3FMS A;  4UV9 A;  4L9T A;  1B9M A;  2JTV A;  1OYW A;  3CUQ B;  2IVM A;  3GFI A;  3WE2 A;  4IHT A;  3LAJ A;  3ABT A;  1FPQ A;  2FEZ A;  4EM1 A;  1WSU A;  1TW3 A;  2HGC A;  3F72 A;  3SHF A;  2VBZ A;  1SFX A;  2M45 A;  1Z7U A;  1RNL A;  4EQQ A;  1FC3 A;  1T98 A;  4IRG A;  2PMH A;  2IW5 A;  4U88 A;  3RKY A;  2F2E A;  3S2W A;  2L54 A;  3FZV A;  2KIF A;  1BC7 C;  2K27 A;  2D1H A;  3U1D A;  1XMA A;  3E97 A;  3SFZ A;  1BI3 A;  2PBI A;  2A07 F;  2AS5 F;  2RVC A;  1CGP A;  3KEO A;  4FT8 A;  4ZZL A;  1YS7 A;  4U0V A;  3I59 B;  4HBL A;  4LK1 F;  2E7X A;  1BM9 A;  1VTN C;  4MQV A;  1BIA A;  3SZT A;  3FXU A;  2IT0 A;  1IN6 A;  2JPC A;  4M6Y A;  1W4M A;  3LWF A;  2DK8 A;  4HF0 A;  2ZBK A;  1CF7 B;  2VT3 A;  1Z6R A;  3ROU A;  4MEX F;  1XDS A;  1JXS A;  2QBY B;  1HKT A;  2XAF A;  2CO5 A;  3LAP A;  4L5J A;  4PZJ A;  3PFI A;  3COA C;  2MD5 A;  3W6J B;  3J80 Z;  1TW2 A;  3N97 A;  2RN7 A;  5JFR A;  1B59 A;  1J9I A;  2Y0M A;  1OR7 A;  1FWZ A;  4ENK A;  2RNJ A;  2OZU A;  4EJO A;  5L3G A;  3SXY A;  5F64 A;  3G3Z A;  2EV5 A;  1L3L A;  2DTR A;  4YFX F;  4G6D A;  1BN5 A;  5D8L B;  3ERE D;  2HDC A;  2OA4 A;  5ICG A;  1J0R A;  1LDJ A;  5CVV A;  2F5C A;  3JTG A;  2XKO A;  3V8J A;  4L9V A;  4Q4Z F;  4UNO A;  5L3C A;  4XBF A;  1YLF A;  5F1R A;  3E5Q A;  3FMQ A;  4HX4 A;  1WKM A;  3KLO A;  1TQI A;  2A6E F;  1BC8 C;  3WTT C;  3KFW X;  1HXD A;  2O3F A;  3C18 A;  2VC0 A;  3FX3 A;  1F1Z A;  5HDN A;  1YW8 A;  4U7B A;  2DI3 A;  1KQ9 A;  2G9W A;  5FB2 A;  4O6J A;  4ENN A;  3QPH A;  5D8K B;  5LHI A;  5ICE A;  1ZRD A;  2OZ6 A;  4YII A;  3JAM Z;  4L0Z B;  3WGI A;  1K78 B;  3FXQ A;  3H3Z A;  2VXZ A;  2ZNY A;  4JK1 X;  3DQV C;  4I09 A;  2GWR A;  2BBY A;  3FMR A;  4L0Y B;  2EFO A;  1I5Z A;  4A12 A;  5D6E A;  1S29 A;  1B1B A;  1ZG1 A;  4UXN A;  3LA2 A;  1R58 A;  2ETH A;  1FYL A;  3RYR A;  5HS7 A;  1UB9 A;  1HW1 A;  3HHG A;  1ZRE A;  1ZN2 A;  4GCV A;  4HV6 A;  2B0L A;  3C7J A;  4IRH A;  1YW7 A;  3R6S A;  2P7C B;  4EJW A;  4BHP A;  4WXD A;  4UVB A;  2FNP A;  2A6H F;  3L7W A;  4B8X A;  3WTV C;  2M30 A;  2Q0O A;  5HOO A;  2W84 A;  3RIR A;  4G7O F;  5LRR A;  3VFZ A;  3WGG A;  1RZ4 A;  1KU9 A;  2HS5 A;  1EH6 A;  1T0F A;  1W7P D;  4KT5 C;  3H3U A;  4ZYE A;  2XAS A;  2FNA A;  4MTD A;  2M8E A;  1T39 A;  3JTH A;  1U3E M;  1U2W A;  4BXU A;  3TO6 A;  1TQP A;  3WOD F;  1IW7 F;  4PCQ A;  3L2C A;  1ZRC A;  1GXQ A;  2XAJ A;  2FOK A;  1D8J A;  4G7Z F;  3F8C A;  3HRS A;  4Q47 A;  1SMT A;  4ETS A;  1AWC A;  5DEQ A;  3B02 A;  4ZYH A;  4AVP A;  1QZZ A;  3IKV A;  1G3S A;  2YU3 A;  4HAM A;  3BWG A;  4ESJ A;  4NQW A;  2NNN A;  2V1X A;  2CSO A;  3TO9 A;  3O2P E;  3SQN A;  4LD5 A;  3G73 A;  4GGG A;  4CGZ A;  3K9T A;  3KP2 A;  5FD6 A;  4YG2 F;  3LFK A;  3QOP A;  1YW9 A;  3LA3 A;  3E3V A;  2ZO4 A;  4M9X A;  3ZN1 A;  3ZMU A;  3K1N A;  3RTR A;  5DCM A;  1LEA A;  2R7D A;  3GYH X;  3C3W A;  1U8R A;  5ILS A;  2KIM A;  5E1W A;  1TBX A;  5L3D A;  3M9A A;  3KZZ A;  2A61 A;  1TTY A;  1KGS A;  4LG0 B;  2HEO A;  4A0Y A;  2LDU A;  4P55 A;  4LGW A;  2EA2 A;  1W7P B;  1R22 A;  2ACJ A;  1FOK A;  1YO5 C;  1ZLJ A;  3GVA A;  1MJ9 A;  2CFX A;  4UHT A;  1YTY A;  1Q1H A;  3REO A;  1Z05 A;  4G94 A;  2FMY A;  1HW2 A;  2P5V A;  3F21 A;  4LG0 A;  5FFZ A;  1QZY A;  3FWE A;  2H27 A;  2QVO A;  4A5N A;  3QU6 A;  4RGS A;  2IA2 A;  4F7Z A;  1D8K A;  1SD7 A;  2PMU A;  5E1Z B;  2QYO A;  4IXA A;  1BIB A;  1PP8 F;  2HKO A;  2HKX A;  2XAQ A;  4FX4 A;  5LGU A;  3BPV A;  2QQB A;  2FXA A;  1DPR A;  2YX7 A;  2EFP A;  3IC7 A;  5DUK A;  4XLP F;  2FRH A;  2VOO A;  1USS A;  2E7W A;  2LNB A;  2OBP A;  2HZT A;  2W85 A;  2OU2 A;  3M8F A;  5FLX K;  3GW2 A;  4WWC A;  2DQL A;  3ZMV A;  2EWN A;  3BJA A;  1I1S A;  1A04 A;  2QZ8 A;  3ISP A;  3I71 A;  1XSV A;  2FBH A;  2O0Y A;  1H0M A;  4Q48 A;  1EV7 A;  5FGM A;  2EV6 A;  1LDK B;  4KA4 A;  3WE3 A;  1OYI A;  2MC3 A;  3PQK A;  2P5K A;  1JGS A;  4P96 A;  3TO7 A;  2OD5 A;  2FF4 A;  4R8H A;  4UUV A;  1GXP A;  2XIG A;  1QNT A;  4XSX F;  3J81 K;  3M7G A;  3HRT A;  2Q2E A;  2RGV A;  4LJZ F;  4KIB A;  2XRO A;  3MEX A;  1FBQ A;  1S8N A;  5JR3 A;  3EET A;  3WTW C;  1IN7 A;  4EM2 A;  1KA8 A;  2BGC A;  1R23 A;  2Q8K A;  4B09 A;  5JVT A;  5CLS A;  2BE5 F;  1KYW A;  1G3Y A;  3CTA A;  5E8G A;  4I01 A;  1T6S A;  3DP7 A;  3PQJ A;  5DCF A;  4HQE A;  5EEH A;  1FYM A;  1XGN A;  2DFI A;  3NRV A;  1X3U A;  1PDN C;  1I1G A;  3L00 A;  2A68 F;  3MWM A;  3GEZ A;  4A6D A;  3F8N A;  2IP2 A;  1ZAR A;  1OYY A;  1W5S A;  3TKY A;  3HRM A;  2PQ8 A;  2NRA C;  3BZ6 A;  3IKT A;  2UZK A;  2FU4 A;  3P9I A;  2ZFW A;  3BRO A;  3GXO A;  4WXH A;  4KIC A;  4Y15 A;  4M74 A;  2OQG A;  4L9N A;  3V8K A;  2GIV A;  2DBB A;  3TDU C;  1ZH5 A;  1H9G A;  3K0L A;  1UCR A;  4WF2 A;  2DPD A;  5AON A;  4DNC A;  5LGT A;  4GXO A;  4R79 A;  5L3E A;  4XSZ F;  3U9G A;  4YIF A;  4A5M A;  3WU0 A;  3HOS A;  4RGX A;  5DCM B;  4UVC A;  2UWM A;  2QQA A;  3I5U A;  3ELK A;  3BOQ A;  1BOA A;  4LMY A;  1G3W A;  4IRI A;  5D4R A;  5J8C A;  4IJA A;  1FX7 A;  2AXL A;  2CQK A;  5D5V B;  4HV5 A;  1HKS A;  3QRF F;  1XDU A;  1FBU A;  2QBY A;  3T8R A;  3GFJ A;  4HYE A;  2VN2 A;  4HW0 A;  2WTE A;  3AAF A;  3F6O A;  2KJB A;  3DV8 A;  1R7J A;  1HW5 A;  2CGP A;  2P6T A;  5FFX A;  3E6B A;  4I98 B;  4MQ9 F;  1YQA A;  4N0B A;  2ADU A;  1WRJ A;  3IWZ A;  3R0A A;  5TRD A;  2M1B A;  1G6N A;  2FQ3 A;  1K79 A;  2K4J A;  4EGZ A;  2JPB A;  2VC1 A;  1IRF A;  3KP7 A;  2ISY A;  3ZN0 A;  2YX4 A;  2HYF A;  5E17 F;  5BS6 A;  2HTJ A;  1J59 A;  1ZAO A;  3LA7 A;  3GZ6 A;  1FT9 A;  2YPR A;  4HLX A;  4S04 A;  1O7F A;  2COM A;  2R3S A;  5D5X B;  2EFQ A;  2A5Y B;  2MH2 A;  1WI9 A;  4EJT A;  1KQ8 A;  1F4K A;  1C0W A;  2CYY A;  5AIQ A;  2V9V A;  1SD6 A;  3OOP A;  5HLH A;  3I53 A;  2XAH A;  4OIR F;  1HBX G;  5DD8 A;  1ON1 A;  2W24 A;  4CIC A;  1S7O A;  2V6C A;  1ON2 A;  2V79 A;  2H6C A;  3MZY A;  4EVI A;  1V3F A;  3BDD A;  3FF5 A;  4ENM A;  3CLO A;  3IHU A;  1IXC A;  4CZZ A;  5AIP A;  3HUG A;  4HDV A;  2W25 A;  1KU2 A;  3WG9 A;  2JSC A;  2E1C A;  4OU0 A;  2HWV A;  2VE9 A;  1FP2 A;  3GO5 A;  2HTS A;  2HQR A;  2QM3 A;  4XRF A;  2YSR A;  3U2R A;  4WXC A;  2M5W A;  4AIH A;  2XRN A;  5LLQ A;  1FZP B;  3I64 A;  1RUO A;  2X4H A;  4N9H A;  1O3Q A;  3DPT A;  1DPU A;  1IN4 A;  3EYI A;  5ED4 A;  1EH8 A;  1YG2 A;  3E6D A;  2L02 A;  3IRR A;  3P7N A;  2OQR A;  2XGX A;  5J6X A;  1MD0 A;  1PUE E;  3BPX A;  2MA3 A;  4KNY A;  2Z33 A;  1IF1 A;  2VE8 A;  5HLI A;  4RS8 A;  4LLL A;  4A0Z A;  2IRF G;  4EM0 B;  4O5V A;  4M6X A;  4HDU A;  1ZG3 A;  4P5O A;  1YFH A;  1U5T A;  1IRG A;  1XN7 A;  3T0Y A;  3R60 A;  2XAG A;  3WTS C;  2D2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...