2XV4S

Structure of human rpc62 (partial)
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
532
structure length
399
Chain Sequence
MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETTMDYAEVSNTFVRLADTHFVQRCPSIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKGMYVINLHKALASLATATLESVVQERFGSRCARIFRLVLQRTFYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE III SUBUNIT RPC3
publication title Structure-Function Analysis of Hrpc62 Provides Insights Into RNA Polymerase III Transcription
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 150
structure length 399
sequence length 532
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF05645 RNA_pol_Rpc82 RNA polymerase III subunit RPC82
S PF08221 HTH_9 RNA polymerase III subunit RPC82 helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S03
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S04
4L0ZB 2ZXJA 1ZYRF 1U8RA 2X4HA 5E18F 4I09A 2PLYA 1Z6TA 4KICA 4BHBA 3FM5A 5FLXK 4ZYDA 4KIGA 3PFIA 1MDMB 1HKSA 2OA4A 1IW7F 2FBIA 4B09A 2DPDA 2V1DA 3H3ZA 1YLFA 3KP4A 1G4DA 3E3VA 4Q5SF 1MDMA 2V1XA 3QU3A 4K2EA 2K4BA 2OZUA 2F5CA 3IL2A 1STZA 2ZBKA 5LRRA 3WTXC 2RNJA 2RQPA 4LLGF 2GZWA 3MZYA 3BJ6A 3QPTA 2PBIA 1OR7A 2LSOA 2OZ6A 4CO8A 2RV8A 5DD8A 5IT9Z 3I58A 4KYWA 4PZJA 1YW7A 4HQMA 5H20A 4EQQA 3KCCA 3WTUC 4OIQF 5ICFA 2KIMA 1HW1A 1ZN2A 3T8RA 5E8GA 1I5ZA 2GXGA 3COAC 5L3EA 4TV7A 3RTRA 4RGUA 1QBJA 4L9JA 2XUBA 3R6SA 1J7KA 3M7GA 1CF7B 2LDUA 4G8XA 3VFZA 2M8EA 2IP2A 4GYIA 2CYYA 1CF7A 2XRNA 3ABUA 2VBYA 2CWEA 4XRFA 3E6DA 2EFPA 3IWZA 2A07F 1AOYA 2QBYB 2ZNZA 4BYYA 2ZKZA 1USSA 1BI0A 1HW5A 3O6BB 2QBYA 4Q48A 2PN6A 5LHHA 2P6TA 3REOA 5BQTA 3P9KA 1XD7A 1I6XA 4UHTA 1USTA 1LEBA 2J5PA 2RGVA 3V8KA 3BZ6A 3IC7A 3FHZA 1FY7A 4O6JA 4OIPF 3HIFA 4L9VA 1MJBA 1ZRFA 2ADUA 1S6LA 3ULQB 1ZGJA 2OAZA 4BHCA 1I27A 3N97A 3HTUA 1XMAA 2EJRA 1IF1A 3F8NA 2UZKA 4OIOF 1BI1A 1HSTA 3GYHX 2M5WA 5A2QZ 4A0ZA 4XSZF 2UXNA 2FA5A 2LF7A 4QWQA 1Y0UA 3DFGA 2DK8A 3J80K 2LNBA 2O8XA 5HS8A 4GXOA 2G9WA 3FWEA 3ELKA 3MFKA 5ERIA 4PDKA 3ZMSA 2K02A 1XGOA 1S7AA 2YPRA 5JR3A 2P7VB 1IN7A 2FE3A 1REPC 4O3MA 1JHFA 4IHSA 1FLIA 1T2KA 2CG4A 4LB5A 3GXOA 1RZ4A 4CYDA 1OPCA 4Y13A 1S7OA 1FSEA 1K79A 4YFNF 3TGNA 2DU9A 2H94A 2B0LA 1B9MA 5JI6A 2EFWA 1ZH5A 4KN7X 2HFHA 3DPTA 2DFIA 3ABTA 3CLOA 1R1TA 3FXUA 2QM3A 3E5UA 2CGPA 1W7PB 5HDKA 1GXQA 1R5HA 3HTSB 3HYIA 3KP6A 5LLQA 1W7PA 5HLIA 3DPLC 2FEZA 2L4AA 2P5LC 1HKQA 4L5JA 2FOKA 1L3LA 5ILSA 4M72A 4HF2A 1XGMA 2D1VA 1U6GA 5F64A 2XAQA 2FQ3A 1RNLA 1PDNC 4KDPA 2YX7A 4RB2C 3RKXA 4LJZF 5DUKA 2VBXA 1O3SA 2QWWA 3F8CA 2D2WA 2EV0A 1MJAA 4OIRF 3KETA 4WF2A 2PEXA 4MTDA 2RDPA 1G3WA 2MLKA 2Q0OA 4KNYA 3C3WA 4N9IA 1ONVA 4U7DA 1LJ9A 3RI4A 3RJPA 2HGCA 3R0AA 1FBQA 4ZH4F 2HYFA 5D4SA 3GUDA 5L3GA 4L18B 2FRHA 5LRSA 3JAMZ 2MH9A 3KZYA 2VOOA 1IN5A 3DKWA 3FM3A 4NHJA 3KFWX 2QYOA 2E1CA 1EH6A 2K27A 5D5WB 3K1NA 3U1DA 3ERED 3BJOA 2JRTA 1BM9A 4L9NA 1QPMA 2XKPA 2L54A 3T8TA 4G7HF 5KVRA 3ROUA 4ETSA 4ZZLA 2OD5A 2VE8A 3ZMUA 4I02A 3WODF 3WE2A 2VC0A 4CDGA 2Z3YA 5BPIA 1FP1D 1FYKA 3LQRA 4PGHA 1QZYA 4YIIA 2YX4A 1OYYA 4N0BA 2IRFG 1R58A 3EYYA 2PMHA 4LMYA 4IJAA 4EJVA 2QVOA 4IXAA 3FMRA 1IN6A 2VXZA 3QOPA 3RYPA 4N9HA 4HDUA 4MTEA 2VE9A 1SD7A 3BPXA 1GHCA 5D8KB 1XCBA 1KYZA 2ISYA 1J75A 3GFIA 1SD6A 4WK8F 1ZRCA 5HVQC 4HA8A 4L0YB 1B59A 3GFMA 3R61A 1HBXG 3FMQA 5E1XA 2CO5A 2VBWA 3Q9VA 3GX4X 3EYIA 3Q5FA 3F6OA 4I0BA 1BI2A 1YQAA 1EV7A 2K7LA 3RPQA 1V4RA 3RDIA 4AVPA 1KU2A 5IT9K 3TOBA 1Z05A 2ELHA 1ODDA 3FMSA 2PG4A 2ZJ2A 2HS5A 5CVRA 3IRRA 3SZPA 2XKOA 4M9XA 2VOPA 1DDNA 2Z99A 2UWMA 4P55A 5BOXA 3VB2A 2KKOA 1TQPA 5DV5A 3W6JB 1T98A 3KLNA 5LEKA 4AIHA 1FYLA 4P96A 4A5MA 5K5QA 2HZTA 5D5UB 1XB4A 5BPDA 5F6FA 2OQGA 3IKVA 4RAYA 1QZZA 2ACJA 1J5YA 4A12A 1LEAA 3CJNA 1MJ9A 2OBPA 5IT3A 3J7AO 1G3SA 5K5OA 4MEXF 3BP8A 3HRMA 4A2UA 1G3TA 3T1BA 5HOOA 1FP2A 4M9SA 3QP6A 3KP2A 4BXUA 1TQIA 1IRGA 4ESFA 1QQIA 5H6RA 3HSFA 2F2EA 3MQ0A 3WTTC 4MNUA 4BHPA 1OYIA 1XN7A 1G6NA 3D5LA 3EDPA 5FFZA 5E1ZB 2HQRA 5A2QK 1KGSA 2G7HA 3CUQC 2M30A 2R7DA 1FX7A 3PQKA 1RIOH 4BQAA 4XLNF 5L3DA 4LK1F 2AXLA 1B6AA 4FHTA 2IW5A 1IXRC 3WTZA 4WWCA 2Q2EA 1IXCA 1BI3A 4IRHA 3TO9A 5TJJA 2HKOA 2FF4A 3LWFA 1QO0D 5FO5A 2Z5UA 1UHWA 4OOIA 4IRIA 3RKYA 2M1BA 5CVUA 1XGSA 1SD4A 5K1YA 1TBXA 3TDUC 1KU7A 1KQ9A 2QUFA 1TW3A 1ZRDA 1IZ1A 4MQVA 2K86A 4UV9A 4OMZA 3O3KA 1WQ2A 3F23A 2XROA 3JW4A 5DCMB 1J9IA 3HSRA 1YIOA 3K1PA 5DCMA 2NS0A 3J81Z 4IVNA 2GA1A 2FNPA 2NNYA 2CW0F 4ESBA 2DK5A 2JPBA 4M73A 5E20A 3F8FA 1ZHFA 2NNNA 3MCZA 5L3BA 1XDUA 3BY6A 2KIFA 1FBUA 1OMIA 4UVCA 1IN8A 3GZ5A 4U0VA 4LB6B 1SFXA 1FWZA 2JTVA 3R4KA 1BIAA 2XASA 4M74A 2A3SA 3QPHA 3EUHA 3N4MA 1GVJA 3GO5A 3KEOA 1L0OC 4ZYEA 4FT8A 4RGSA 2V79A 4AWXB 3HOSA 3JTHA 4FX4A 2QLZA 2KRFA 5HS7A 1C0WA 1TW2A 2E7WA 4KMFA 2P8TA 2XAGA 5KK1A 1DP7P 1XGNA 3F22A 3F3XA 3BWGA 2IA1A 1ZLJA 3B73A 2IVMA 2DQLA 1V3FA 4M71A 4HQEA 1J59A 4BNCA 4RAZA 1U5TC 3IKTA 1EH8A 4U7BA 3JAMK 5EEHA 3RPUA 4IHTA 1P6RA 3GLXA 4CHUA 1W4MA 3BJAA 4ON0A 4RB1A 2J5OA 3DV8A 2EFNA 3E97A 1YTYA 2BEOA 4HX8A 3I54A 2VONA 4LLLA 5J6XA 4HX4A 5FD6A 1EH7A 3LA7A 4QLCU 1UFMA 3L09A 4HLYA 1K7AA 2EB7A 5AONA 5J8CA 3WE3A 4WXDA 2P5VA 2GAUA 2DTRA 2XV4S 3E6MA 3WGHA 1FZPB 2O6GE 2VT3A 1H0MA 1BC8C 3F6VA 1JGSA 3DQVC 2L02A 2H6BA 5D6FA 3LFKA 4LGWA 1IRFA 4WCGA 3WU0A 2RKHA 1PP7U 2STTA 4U0YA 3TO6A 2W85A 3EQLF 1LB2A 4HV6A 2DI3A 3M1EA 3QAHA 1T38A 2LKPA 1G3YA 4Q47A 1IXSB 4I01A 4H0EA 4HF0A 2BYVE 1FSHA 3E6CC 3F8BA 1K78B 1LDJA 3RKWA 4HZFA 3HSEA 5JVTA 2XAFA 3F72A 3L9FA 2EV6A 5CJ9A 3ZN0A 3NRVA 1K78A 4UVAA 1D3YA 4NB5A 2ISZA 2Y75A 4XBFA 4NQWA 5BS6A 4LK0F 3DP7A 4WX9A 1A04A 4G6QA 3E5QA 2K4JA 3ZMZA 3NQOA 3HHGA 2NAZA 3CO7C 2MC3A 2IPQX 1XSDA 4MGRA 4HAMA 3ZQ7A 1OKRA 3K0LA 3KP5A 1RI7A 2KJCA 3C1DA 1WRJA 2A61A 1ZREA 3OV8A 4A6EA 4EM2A 1KQ8A 2FU4A 3QU6A 3P9IA 2V1UA 1LDDA 2JPCA 4I7HA 1U78A 2ZCWA 3WTSC 3T5XA 1ZLKA 3CUQB 1D8KA 2PI0A 3ECOA 4U0WA 4DNCA 2E7XA 4S04A 3V7CA 2XVCA 2MLGA 5JFRA 3GFJA 1SFUA 3KP7A 3G3ZA 2FMLA 2DQRA 1P4WA 1X3UA 2DT5A 2C6YA 3WTVC 2ESNA 5D5VB 2BGCA 2D45A 1D8JA 1DPRA 2G7UA 2WWYA 4G9YA 1B9NA 4JK1X 1B4AA 2ZNYA 4UNOA 1Z9CA 1XCVA 1S3JA 5J8FA 4EGZA 5ILVA 3BOQA 1SD5A 5D5XB 1TQMA 5ICCA 2L3DA 3V8LA 3K9TA 5E1WA 4PGGA 4ESJA 5HLHA 3WGIA 5LGTA 3I59B 1R23A 2HQNA 1R5GA 2L4MA 3SXYA 4XLPF 1KU9A 4FX0A 4RGRA 3KP3A 4GYGA 2A5YB 3M8EA 3I59A 1Z91A 5HLGA 3DEUA 1YW9A 2YSRA 4BH9A 4ENJA 2GIVA 2PJPA 1S29A 1S8NA 3I5UA 3I0TA 3ZMVA 1I1GA 2W25A 1UCRA 2FMYA 2FXAA 3QP5A 4MQ9F 2P6SA 5DUIA 4YIFA 3HRUA 5FFXA 3CDHA 3GZ6A 2FBHA 4U88A 3C7JA 1QGPA 3WTWC 2E1NA 4LD5A 3I71A 1KU3A 4AD9A 5DCFA 1BN5A 3V7RA 1RUNA 3CO6C 3ZPLA 4KN4X 2BE5F 2FNAA 3J81K 3FXRA 3D0SA 2RN7A 2Z9OA 5LEJA 1FBSA 1LVAA 1ZGAA 3JTGA 4LLNA 2NYXA 3B02A 1U5TB 2Q8KA 2DO7A 1IUYA 5DEQA 2A6HF 4A6DA 2EA4A 1U5TA 2HTSA 1RUOA 4P9FA 3SHFA 4Z2YA 3LAPA 2F5DA 1XSXA 3MEXA 3LQQA 2Y0MA 5CVIA 1KYWA 3FX3A 1W5SA 4EM0B 1T6SA 4S05A 2KIUA 2LF8A 3HOTA 4RB0A 1FPQA 3ZMDA 4HV5A 1T0FA 1O3TA 4EV0A 4HF1A 2XGXA 4BAYA 1PUEE 4Q4ZF 1R1VA 2IA0A 2JSCA 3GF2A 2WV0A 4L5IA 1LNWA 1F1ZA 4ZYGA 4B8XA 3K69A 1B1BA 3S2WA 3T0YA 3U2RA 3G73A 1YG2A 3H3UA 2DBBA 4UUVA 2BV6A 3U9GA 2F5EA 4L9TA 2QENA 1HQCA 5FGMA 6PAXA 1FOKA 2H09A 1OYWA 3P9CA 3RYRA 2A68F 1WSUA 1U3EM 5EEGA 2EFQA 2EA2A 2QQAA 4M6YA 3VODA 1W5TA 2HKXA 3FZVA 2DAOA 4KA4A 2V9VA 2XAHA 5HDNA 4HLXA 2O3FA 3K1MA 2IT0A 3HHHA 2EFOA 2FBKA 3E5XA 3I64A 4UXNA 5L3FA 2COMA 4MEYF 5D6EA 1F4KA 4E70A 1NHAA 1VTNC 5K5RA 5ILUA 3VOEA 4ENMA 2Y48A 4EGYA 4I2OA 2GXBA 2EWNA 4RS8A 1F9NA 2IA2A 3JSPA 3V8JA 4WXCA 3VEPA 4JBAA 1Z1DA 3MWMA 3P7NA 2ZFWA 1H9GA 1FT9A 3CTAA 4GO1A 1YW8A 4A0YA 4Y17A 1O3QA 2GQQA 4RGXA 1MGTA 2DW4A 4KIFA 3TDZC 2W24A 3SQNA 3FXQA 1SMTA 3V7SA 2XHKA 1P92A 1YO5C 3R60A 1UHMA 1GXPA 2HEOA 4EMSA 5LHIA 4F7ZA 3NEUA 2VODA 4R79A 3IRQA 2PFBA 4ENNA 1MD0A 4CZZA 5AIQA 2A69F 1ZARA 1BC7C 3M9AA 2JT1A 4IRGA 2KJBA 1ON1A 2GWRA 3GWZA 3L7WA 3E6BA 5HS9A 2F5FA 1Z7UA 1ZG3A 1IAWA 3HRSA 2IJLA 2QZ8A 3TQNA 2STWA 4CXFA 5FLXZ 3W6KB 3HRTA 2DLLA 1E2XA 1SAXA 2D1HA 2GA2A 4AIKA 2P4WA 1WWXA 3LSTA 2DPUA 1O57A 1SFEA 4EJOA 4JQFA 1H9TA 3I53A 2YR2A 3R0JA 2P5KA 2RVCA 2H6CA 3MZHA 3L00A 1U2WA 1YYVA 1ON2A 3MAJA 4PCQA 3O2PE 1W7PD 5LGNA 3WU1B 1O7FA 3RIRA 1TLHB 1BIBA 2CSOA 4D0PA 2ETHA 2W84A 4HBLA 1CGPA 2O0YA 5CVJA 3IHUA 4KMUX 4Y15A 4P5OA 4EJWA 1D5VA 2XIGA 4UV8A 2FSWA 4R1HA 4P9UA 3ISPA 2VN2A 1E17A 3AAFA 1HW2A 1IN4A 4DQ2A 4ZYHA 1JHHA 2V6CA 3C18A 4YFXF 3KE2A 1PP8F 4I0AA 1MKMA 2MBFA 4CICA 2UXXA 5JHUA 1J2XA 3I4PA 3ZP5A 3ECHA 1R22A 3DF8A 5DDGA 3OOPA 2A6EF 3Q9SA 5CYVA 2HOEA 4XSXF 1ZAOA 4IPAA 4A5NA 1TNSA 4G94A 4M6XA 4EJTA 2TDXA 3GEZA 1DPUA 5BMZA 2EV5A 2QQBA 4IF4A 4YFKF 1HKTA 4LG0B 5ED4A 1R00A 2BBYA 2MD5A 3M8FA 2EK5A 5E17F 3HUGA 3WG9A 4LG0A 3WGGA 5D8LB 4A0XA 1HSJA 5LGUA 3GVAA 5FD5A 2WTEA 2HTJA 1LQ1A 3J80Z 1HXDA 2O03A 1O7LA 2R3SA 1SMYF 3CUQA 4GCVA 2PQ8A 3QRFF 2XAJA 5ICEA 5LHGA 4HDVA 1ZG5A 3CUOA 3KLOA 3LA3A 4GGGA 4G6DA 5D4RA 1I1SA 2VBZA 1ULYA 2RC4A 2NRAC 3TOAA 1JXSA 3FF5A 5AIPA 1YFHA 1ZG1A 4M9ZA 2VT2A 4G7ZF 4ENKA 5TRDA 1FC3A 1FNNA 5E8IA 2HWVA 2R7FA 2ZO4A 2X0LA 5LBQA 4KFCA 2OQRA 3LA2A 3F21A 5F1RA 1TTYA 5FB2A 1P4AA 2O61A 4O5VA 1XMKA 1TNTA 3KEQA 3F8MA 4LFUA 1YS7A 2MH2A 1JE8A 1WKMA 4CGZA 4I98B 3EETA 1R36A 1KQ0A 4KIBA 3WTYC 2AS5F 1O3RA 3SZTA 3H92A 4MHGA 3BPVA 4OU0A 2H27A 2M45A 2HYGD 3DXJF 2W57A 5CVVA 4EVIA 4YG2F 3K2ZA 1K6OA 1AWCA 4ASNA 2P7CB 4OINF 1P2FA 1UB9A 3GFLA 1LDKB 3BROA 2PMUA 2VC1A 1R1UA 2Z33A 5CLSA 1FYMA 1BJAA 2HR3A 2QQ9A 1P4XA 4R8HA 2M87A 4UVBA 2WC2A 1KA8A 5H6QA 1J0RA 1XDSA 1XSVA 4G7OF 5DYMA 3TO7A 1MZBA 2L01A 1Q1HA 4HYEA 4ZZDA 1Z6RA 3PQJA 1T39A 2OU2A 3ML6A 3GW2A 3ZN1A 4KT5C 3BDDA 1BOAA 2MA3A 2ESHA 4KUMA 4HOBA 1WI9A 4HX7A 4EJUA 2ZMEB 3SFZA 5ICGA 3LAJA 3TKYA 2YU3A 4HW0A 5L3CA 1BBYA 3IWFA 2ZMEA 4EM1A 5HDGA 2CFXA 3V4GA 1F5TA 3KZZA 4OMYA 2HDCA 1QNTA 1YS6A 5DD4A 4AIJA 1DUXC 1R7JA 3ZMTA 3JSOA 2CQKA 4WXHA 4RB3C 2JZYA 3L2CA
chains in the Genus database with same CATH superfamily
3BG5A 4L0ZB 2ZXJA 3SJMA 4HSTA 4BJ6C 1ZYRF 1U8RA 3DBLB 2X4HA 3CC7I 4KITB 4XRMA 1D0ZA 5E18F 4I09A 2DCEA 3VPRA 2L7ZA 1Z6TA 2PLYA 4KICA 4BHBA 1WH5A 3FM5A 5FLXK 4E4HA 4ZYDA 4KIGA 3CC2I 3PFIA 4A69C 2HQ5A 2KQRA 1MDMB 1HKSA 2OA4A 1IW7F 2H8RA 4DYRA 2FBIA 4B09A 1O4XA 1AU7A 2DPDA 2V1DA 3H3ZA 1YLFA 3KP4A 2W4SA 1G4DA 3E3VA 4Q5SF 1XX5A 2V1XA 3QU3A 4K2EA 1MDMA 1TP4A 2QKMB 2K4BA 3PM1A 2OZUA 2ZXIA 3D5SC 2F5CA 2EZLA 3IL2A 1STZA 2ZBKA 5LRRA 3FHNA 3WTXC 2RNJA 2CUEA 2RQPA 4LLGF 2GZWA 1H8AC 4CCMA 1APLC 3MZYA 3LOCA 4HNTA 2P81A 3BJ6A 2PBIA 3QPTA 1OR7A 2LSOA 2OZ6A 2XGEA 4CO8A 1W0UA 1JKRC 3BTJA 3OYFA 2RV8A 4LOCA 2JUCA 3PUFA 1ETKA 5DD8A 5IT9Z 3EUAA 1OISA 3I58A 4KYWA 2EIKH 4PZJA 3AFHA 1MBJA 1YW7A 3HB9A 3P5JA 4HQMA 4CYCB 5H20A 4EQQA 3OOUA 3KCCA 2O8KA 4PSWA 2VQLA 3WTUC 4ZJZA 4OIQF 4F52A 2Y69H 1BW6A 5ICFA 4FE4A 2QCOA 2KIMA 1HW1A 1ZN2A 4NUBA 5E8GA 1I5ZA 2GXGA 3CP8A 3T8RA 4CYCA 2V6EA 3J7YJ 3COAC 5L3EA 4TV7A 4RAFA 3K4LA 3FISA 2RNGA 5IYDJ 3RTRA 4RGUA 3VWBA 3CJTB 4IHVA 2LG4A 1OCPA 4L9JA 1QBJA 2P0WA 2YU9J 2XUBA 2OJED 3R6SA 3H0DA 1J7KA 1S5LC 3M7GA 1CF7B 2KHMA 2LDUA 2PX9A 4G8XA 5M5YJ 9ANTA 2VJ4A 4A3JJ 3KPHA 3NWSA 3VFZA 3WHBA 2M8EA 2DT6A 2LP0A 2CV0A 2IS4A 1MMGA 2IP2A 4GYIA 2CYYA 1CF7A 4KISA 5J1UA 5LD2C 2XRNA 3ABUA 4V19K 2W48A 2VBYA 2CWEA 4C2UA 4XRFA 4BUPA 3K6GA 3E6DA 2EFPA 3IWZA 2A07F 4BY7J 2CUFA 1AOYA 2QBYB 2ZNZA 4BYYA 4C3IJ 2ZKZA 3JCUC 1USSA 1BI0A 4XLHA 1HW5A 3O6BB 4FQGA 1K4TA 4HPQA 3HDDA 3CD6I 1X1BA 1XG1A 2QBYA 4Q48A 2PN6A 1TT5B 5LHHA 2P6TA 3REOA 5BQTA 3P9KA 1YX5A 1XD7A 1I6XA 5M3FJ 4UHTA 1VQ4I 1USTA 5M5XJ 3JRAA 3E7LA 2X6YA 3RPUD 4E7IA 1LEBA 4YEJA 2M7AA 2J5PA 1YIJI 2RGVA 3V8KA 3BZ6A 4XONA 2KRHA 1EKEA 3DCFA 3IC7A 3FHZA 3PNVA 1FY7A 4O6JA 4OIPF 3H3VK 3HIFA 2NVYJ 1X4PA 1MH4A 4L9VA 1MJBA 2LKXA 2ADUA 4X1EA 1ZRFA 1S6LA 3F9KA 1R4NB 3ULQB 1A35A 3A01B 1ZGJA 2DDBA 1BA5A 3QPSA 2OAZA 3OIQA 3SEQA 4BHCA 1I27A 3N97A 2A6TA 3KYCB 3HTUA 3TW7A 1QPIA 3S8PA 5E3LA 1XMAA 2VLAA 2EJRA 3H9GA 3A01A 1RR7A 2QKLB 3D1NI 1SVMA 1IF1A 1VZ0A 2EQRA 3F8NA 2UZKA 3FXMA 4OIOF 3ZQFA 4CCJA 1BI1A 1HSTA 3GYHX 2M5WA 1XC5A 5A2QZ 1ZK8A 4A0ZA 3RZOJ 4XSZF 5JHFA 2UXNA 2FA5A 2LF7A 4QWQA 1Y0UA 1TWHJ 3DFGA 3BR6A 1W36C 2DK8A 3J80K 4N4NB 5IOZA 2LNBA 2HXIA 3MKWB 3BG3A 2O8XA 3LSKA 1DU6A 5HS8A 2E35A 4FETA 4GXOA 4BBSJ 2G9WA 3K4KA 3FWEA 3ELKA 1WGXA 5J1YA 5FROA 3MFKA 5ERIA 4PDKA 3ZMSA 2K02A 3QYFA 1XGOA 1S7AA 4AVZA 5KAFC 1PUFA 2YPRA 4HEA2 2ELJA 2KPMA 3S93A 5JR3A 4XMYA 1SFOJ 2P7VB 3PSIA 1IN7A 2FE3A 1REPC 4A3IJ 4O3MA 3BC8A 1JHFA 4IHSA 1FLIA 3KYLA 1T2KA 1JT6A 2CG4A 4LB5A 3GXOA 1RZ4A 1T0FC 2DMUA 2DA4A 1VQNI 4CYDA 1OPCA 1K4SA 1D1AA 3MZ8A 4Y13A 1S7OA 1I3AA 5IPAA 1FSEA 1K79A 2LVSA 4YFNF 3TGNA 2DU9A 2H94A 3HXLA 3TP0A 2B0LA 1B9MA 5JI6A 2EFWA 3CCVI 1B8IB 1R6RA 1ZH5A 2LD5A 4KN7X 2HFHA 4IZZA 1MBHA 3DPTA 4OAYA 2IAIA 2DFIA 4C9YA 3ABTA 3AG3H 3CLOA 2HNHA 2PMZA 3ZR8X 1R1TA 1B8IA 5E3MA 3FXUA 4PJNA 2QM3A 3HOZJ 3E5UA 2CGPA 1W7PB 1RRJA 5HDKA 1GXQA 4IX7A 1R5HA 1GV2A 3HTSB 2JA8J 2LY2A 3HYIA 3L2UA 1JTXA 1UG2A 4RM2A 1VQOI 4BU2A 3KP6A 5LLQA 1W7PA 5HLIA 3DPLC 1YJNI 2FEZA 3BLYA 2L4AA 2P5LC 1HKQA 4XK4A 1ZR2A 1N77A 2BXYA 3S1RJ 1FTZA 4L5JA 2FOKA 2RREA 3FXJA 1MIJA 1L3LA 2VKDA 1FOWA 5ILSA 4M72A 4HF2A 2DFHA 1XGMA 4FE7A 2D1VA 1U6GA 2JN6A 2CJJA 5F64A 2MD0A 5C4JJ 3CCYA 1P7JA 2FQ3A 2XAQA 1RNLA 2E34A 3ABMH 1SFKA 3RSNA 3KEYA 1PDNC 4KDPA 2R7ZJ 2HOTA 2YX7A 4RB2C 3RKXA 3GZNB 4LITA 4J01A 1X19A 4LJZF 5DUKA 4ZTFA 2VBXA 1O3SA 3E1SA 3DLAA 4E7HA 2M4KA 1RR8C 2QWWA 3F8CA 1DP3A 2D2WA 2EV0A 1MJAA 3LSMA 4OIRF 2X1CA 5EJCA 4WF2A 3KETA 2XRLA 2PEXA 4MTDA 2RDPA 3VYTB 3BR1A 2VKHA 4QTRA 1G3WA 2KDZA 2MLKA 2Q0OA 5E79C 1JKQC 4KNYA 3C3WA 4N9IA 2XB5A 4CCKA 1ONVA 5K7ZA 3WG7H 4U7DA 1LJ9A 1QVUA 3RI4A 3RJPA 4ZTJA 1OCCH 1Y1WJ 2HGCA 3R0AA 3PNYA 1FBQA 1T08B 1Z77A 2WAFA 2XF7A 4ZH4F 1G8XA 4GRIA 1S7EA 2HYFA 2HOSA 5D4SA 2CH0A 3GUDA 3HOXJ 3LSGA 5TISC 5L3GA 4L18B 2FRHA 2R92J 1ETOA 4BQQA 5LRSA 3JAMZ 2BVLA 1IG7A 2MH9A 3KZYA 5FLMJ 2VOOA 1IN5A 1XPXA 2E1OA 1ETYA 2AXTC 2X48A 2DDAA 3DKWA 2ZFUA 2DOAA 4BY1J 2L7FP 3FM3A 4NHJA 1NG6A 2JRMA 1T33A 3CDIA 3KFWX 2QYOA 2E1CA 4NNJA 1EH6A 3U1KA 2K27A 5D5WB 4PJJA 2EILH 2WY8Q 4N4OB 1VQ9I 4NBQA 3K1NA 3U1DA 3ZQHA 3OYJA 3ERED 3BJOA 2JRTA 1BM9A 4L9NA 2ME6A 2QSGX 1QPMA 3S1MJ 2XKPA 2L54A 1WFXA 3T8TA 4G7HF 5KVRA 3ROUA 3H36A 1YRNB 1DGRM 4ETSA 1OCOH 1DQUA 3B6CA 3DU5A 4ZZLA 3S2DJ 2OD5A 2VE8A 2BHYA 4I02A 3QYEA 3WODF 3ZMUA 3OYIA 4BDYA 2XGDA 3AG1H 4XRSA 1R5ID 1ZTRA 2JK3A 3WE2A 3AL0C 4BJ5C 2VC0A 4CDGA 3LSRA 2Z3YA 5BPIA 1MBGA 1FP1D 2L7MP 1FYKA 3LQRA 1WJ5A 5J4VA 1IUFA 4PGHA 1QZYA 4YIIA 4ABZA 2YX4A 3CCJI 5J40A 4PJMA 1OYYA 4JX6A 5J4YA 4N0BA 2IRFG 1R58A 3EYYA 2PMHA 4LMYA 1YOVB 4IJAA 2OV7A 2M4GA 4EJVA 2QVOA 3BQYA 4IXAA 2L2OA 3FMRA 4D1QA 1IN6A 2VXZA 3QOPA 4XKCA 3S32A 3RYPA 2XDVA 4N9HA 4HDUA 4MTEA 2BZTA 2VE9A 1SD7A 4Y3OA 3BPXA 5GPCA 1VQ5I 2LY1A 1GHCA 3GTGJ 2I8DA 1YI2I 4M3FA 1E3OC 5D8KB 4M3BA 1XCBA 2M9HA 1KYZA 2ISYA 1K61A 3GFIA 1J75A 1SD6A 4XN3A 4WK8F 3OYCA 1ZRCA 3W2VA 1F36A 5HVQC 2LREA 4HA8A 1IRXA 2DMTA 3QWLA 2LLKA 4L0YB 3K4JA 1B59A 4ZDOA 2X6XA 4DYQA 3GFMA 4BEHB 1GUUA 1Z0XA 3R61A 2W7NA 1HBXG 3FMQA 1IDYA 5E1XA 3A03A 2MSYA 2CO5A 2VBWA 3Q9VA 5F0FA 3GX4X 3EYIA 2BW3B 3Q5FA 1KONA 3HPGA 3F6OA 4I0BA 5KAIC 4BEHA 1BI2A 3PIPF 1YQAA 2OCCH 4BJTA 2E36A 1EV7A 4DW6A 3JRBA 2K7LA 3RPQA 3UKGA 1V4RA 3RDIA 2BW3A 2DYRH 4LG3A 4AVPA 1KU2A 1POGA 2K3PA 3BCAA 1TZLA 1Z05A 2ELHA 3TOBA 3OSGA 5IT9K 4U87A 2VJJA 1ODDA 3FMSA 3LSHA 1VQMI 4M6VA 1A31A 2PG4A 2ZJ2A 2HS5A 3SZGA 5CVRA 1FEXA 3BR2A 3IRRA 3SZPA 2XKOA 5E3NA 3I56I 1ENHA 3HZJA 4M9XA 2L5QA 3HEFA 2VOPA 4DYCA 2HOAA 3DTEA 5KCMA 1OCZH 4CSWA 2NOJB 1TWAJ 1LVKA 1DDNA 4UY8I 2Z99A 2UWMA 2Y2ZA 2DFEA 2WV1A 4P55A 3H5AA 5BOXA 3VB2A 2KKOA 2BXZA 1TQPA 5DV5A 2EBIA 3W6JB 1T98A 2KRCA 3KLNA 1FJLA 1JKOC 1R9TJ 4QPQA 1I39A 2CU7A 2OUMA 3OYNA 4RBOA 3OIPA 5LEKA 1BR2A 4AIHA 2YS9A 1J09A 1FYLA 2JVGA 4P96A 2HYJA 4A5MA 5K5QA 2HZTA 5D5UB 2IS6A 1XB4A 1IV8A 5BPDA 5F6FA 3CF5F 3C2HA 2CRGA 5CQGA 2OQGA 3IKVA 4RAYA 4XKWA 1QZZA 2ACJA 1J5YA 2KIQA 2KP6A 1LEAA 1WJFA 4A12A 1HDDC 5B1BH 3CJNA 1MJ9A 2KT0A 2W1OA 4A93J 2OBPA 2K40A 3W2WA 3MVPA 5IT3A 3J7AO 3G71I 2LBFB 2DN0A 2M8GX 2UV1A 1G3SA 2R7XA 3BZCA 5K5OA 3HL2A 2A5WA 3V42A 3BP8A 3HRMA 4MEXF 4A2UA 1G3TA 3T1BA 3ASNH 5HOOA 1FP2A 4M9SA 2LBFA 3CCUI 3QP6A 2GOXB 3KP2A 4BXUA 2DJIA 5CPRB 1TQIA 1HCRA 1IRGA 4ESFA 1QQIA 5H6RA 1U9OA 3HSFA 2L9VA 2F2EA 3MQ0A 3U21A 3WTTC 1RESA 4MNUA 4BHPA 3DU6A 4B48A 3A0BC 5BNGA 1OYIA 1XN7A 1OJLA 1G6NA 3D5LA 4IO9F 3HOYJ 3GTJJ 4IQJA 3EDPA 3MN2A 1E3PA 2E5ZA 3G1OA 5FFZA 5E1ZB 2MYSA 2HQRA 3ESWB 5A2QK 2Q2EB 4F91B 1KGSA 2G7HA 3CUQC 2M30A 2R7DA 2ZXHA 1FX7A 4AIDA 3PQKA 1RIOH 4BQAA 4IHYA 4XLNF 5L3DA 4LK1F 2AXLA 1B6AA 4FHTA 2IW5A 1IXRC 3WTZA 3HOWJ 4WWCA 2Q2EA 1IXCA 1BI3A 4IRHA 5TGTA 1A6IA 3TO9A 5TJJA 2HKOA 2FF4A 4NDLA 3LWFA 3SDBA 1QO0D 5FO5A 5KNLA 3JRGA 2Z5UA 3IH4A 2L7KA 2MFZA 2N8GA 2X1EA 1UHWA 1PYVA 4OOIA 4IRIA 1CQTA 1PVEA 2QSFX 3RKYA 2K9MA 2M1BA 5CVUA 4II3A 1XGSA 1SD4A 5K1YA 2M2EA 1TBXA 1ERDA 2VASA 2E19A 1UJ8A 3TDUC 2HDDA 1Y6IA 1KU7A 1KQ9A 2QUFA 2NVXJ 1TW3A 3GTOJ 1ZRDA 3RCOA 5CKTA 4EEFG 1IZ1A 3N05A 4MQVA 2K86A 4UV9A 1TL8A 2RAEA 3S3NA 1LFPA 4OMZA 4C3HJ 3O3KA 4ZDLA 5DTDA 5GTIC 4YRVA 1SVOA 3OYMA 1WQ2A 1XS9A 3F23A 2JA5J 3O8GA 2XROA 1I6HJ 2DA2A 3JW4A 4A3LJ 2VIXA 5DCMB 1J9IA 3JRIA 3IAS2 3VDXA 4FTHA 3HSRA 1YIOA 4M3GA 4PK4A 2Q1ZB 2L9RA 2VXDA 2LFBA 5H2FC 3K1PA 5DCMA 2NS0A 4CCOA 5HNFA 3J81Z 2QSHX 4IVNA 4XN0A 1RKTA 1AHDP 2GA1A 1D1BA 2FNPA 2NNYA 3H1CA 2CW0F 4X6AJ 4E6KG 4ESBA 2KISA 1VQLI 2V26A 4F3QA 2DK5A 2JPBA 4M73A 5E20A 3BG7A 3F8FA 3M8JA 1R71A 3PO2J 1ZHFA 2NNNA 1WZ2A 2O7OA 1VQ6I 3MCZA 5L3BA 1XDUA 1MMNA 3S15J 3BY6A 2DA5A 2KIFA 3BQZA 1FBUA 1OMIA 3E0JB 2ZSHB 3Q0WA 4UVCA 3A4CA 3M4OJ 1IN8A 2R93J 2IBDA 3GZ5A 4U0VA 3NWTA 4LB6B 2F6CA 1SFXA 2IGKA 1ITYA 1X1CA 1FWZA 2JTVA 1U8BA 3R4KA 3CF2A 1BIAA 2VJ5A 5FKKA 3FBIB 5FJ8J 2XASA 4IEJA 4M74A 2ID3A 4A3KJ 2X6OA 2LY9A 2A3SA 3QPHA 3EUHA 3N4MA 2L0KA 5K7HA 3GLLA 1GVJA 3Q0UA 3GO5A 3KEOA 4D5CA 1L0OC 4ZYEA 1ETWA 3BTLA 2HPIA 4FT8A 2V79A 4RGSA 1GDTA 4AWXB 3HOSA 3A2KA 3JTHA 4FX4A 3OR2C 4AUXA 2QLZA 2KRFA 5HS7A 1C0WA 1TW2A 2E7WA 2VPRA 3OWTA 3ZQCA 4KMFA 1QRYA 2P8TA 2XAGA 3S1NJ 3AL0B 5KK1A 1DP7P 3CCLI 1D0YA 3AG4H 2VPLA 1XGNA 5IP6A 1VQ7I 3F22A 3F3XA 2R5YB 3QOEA 5FLVA 4RM3A 5HNHA 4MFEA 1OLTA 3BWGA 3TBIA 2V4JC 1G2HA 2IA1A 1ZLJA 3B73A 5IYCJ 2IVMA 5FKMA 3TW6A 2DQLA 1V3FA 4M71A 4XL9A 2R5YA 2LK2A 2R5ZB 4AU7A 4D9JA 2CQQA 4HQEA 1J59A 2E2JJ 4RAZA 1U5TC 4G6TB 4BNCA 3IKTA 1X3WB 1EH8A 1HLVA 3I4NJ 4U7BA 3JAMK 1SC7A 5EEHA 3RPUA 4IHTA 1P6RA 3BG6A 3GLXA 4CHUA 1W4MA 3BJAA 4ON0A 2ME0A 3SYTA 4RB1A 3S1QJ 2J5OA 3DV8A 4CCLA 3DWLE 1NH3A 4B47A 2W00A 2EFNA 3E97A 1JJ8C 3HOVJ 1YTYA 2BEOA 4HX8A 1IDZA 3I54A 2H1LA 5B1AH 2VONA 4XRSG 4LLLA 4S0HB 2CMPA 3VYRB 5J6XA 4OWRB 4HX4A 3CCSI 5FD6A 1EH7A 3DBHB 3K7AJ 4DBQA 3LA7A 4QLCU 1UFMA 3L09A 3LFUA 4HLYA 1K7AA 4YIRX 2EB7A 1K6YA 2KDOA 2V9KA 5AONA 3ZRGA 5J8CA 3WE3A 3ERMA 1JUMA 1Y39A 1Y8RB 1OCRH 4WXDA 5GAEJ 2P5VA 1YJ9I 2GAUA 2E71A 2DTRA 2XV4S 3E6MA 2IEKA 3WGHA 1FZPB 2ZSIB 2O6GE 4BE2A 2VT3A 1H0MA 1BC8C 3F6VA 3IH3A 1P7IA 1RETA 4AM3A 3GCMA 4XM3A 1JGSA 3DQVC 2L02A 2H6BA 5D6FA 3LFKA 4DZPA 2QGUA 3CDLA 1YJWI 4LGWA 3CMYA 1IRFA 2ELKA 4WCGA 2FUG2 1X4OA 2RKHA 3WU0A 2I5UA 1PP7U 3CMMA 2STTA 4U0YA 1LPQA 2DJNA 2AHQA 2JQ7A 3TO6A 5B3SH 2W85A 4AC0A 3PIOF 5FRNA 3EQLF 1LB2A 3CP2A 4Y33A 4XKBA 3GTKJ 4HV6A 3TP3A 3M1CA 2QEXI 2Z2SB 3PJRA 2DI3A 3M1EA 2E2IJ 4JX5A 2GLOA 2XSDC 5FKOA 5FKLA 3QAHA 3NARA 1T38A 2LKPA 1G3YA 3FDYA 5GAHJ 1UHSA 3ABKH 4Q47A 1IXSB 4I01A 4H0EA 4HF0A 2BYVE 4PFOA 4D7NA 2DT7B 4J00A 1FSHA 3LMMA 3EPZA 3E6CC 1ZGWA 3F8BA 1OR7C 2DXIA 1K78B 1LDJA 3RKWA 2V9PA 2GM4A 4HZFA 2DFFA 1ETXA 3HSEA 5JVTA 3RKQA 2R7UA 2PMZN 4B4CA 2XAFA 3F72A 4NQWB 1E3HA 2XC7A 3L9FA 3LSIA 2EV6A 3KZIC 5CJ9A 3ZN0A 3BTCA 3NRVA 1K78A 3H5NA 4RLFA 1D3YA 4UVAA 4UUSB 5F0HA 4NB5A 4E7JA 2ISZA 2Y75A 4C30A 1AKHB 4XBFA 3J7ZI 4NQWA 2OTLI 5BS6A 4LK0F 3DP7A 4WX9A 1A04A 2F4IA 2XPWA 4G6QA 2QA4I 2HVSA 3E5QA 3ZGKA 2K4JA 2QQ8A 3ZMZA 4UUSA 4IOCF 3I3LA 3NQOA 1AKHA 3HHGA 2NAZA 3HOUJ 1X1AA 1U0JA 2AQFA 2MC3A 3CO7C 3ZQIA 2IPQX 1XSDA 2M3AA 4MGRA 4HAMA 3ZQ7A 3BT9A 1OKRA 4HNUA 2IS2A 3K0LA 3OYLA 5LFAA 4Y4RA 3KP5A 1RI7A 1T56A 2Y9YA 1LUJB 2KJCA 3C1DA 1WRJA 2A61A 4PJ0C 2HVRA 1ZREA 4UUTA 4X0GA 1RKWA 3OIOA 2LRDA 3OV8A 3RQ4A 4A6EA 4BXXJ 4EM2A 1KQ8A 2CQNA 1MMAA 2FU4A 3QU6A 3JREA 3P9IA 2F5VA 3FBNB 1LDDA 2V1UA 2JPCA 4I7HA 2KMUA 1U78A 5CQEA 4XIDA 2ZCWA 3WTSC 3FKJA 3T5XA 3OY9A 1MNMC 1ZLKA 1BL0A 1QZEA 3CUQB 1D8KA 1EJ9A 2B9SA 3HJEA 3AG2H 2PI0A 3ECOA 4U0WA 4DNCA 2E7XA 5C44J 3V7CA 4S04A 2XVCA 2MLGA 3S3OA 1H89C 1BOBA 5JFRA 1X1PA 4BQOA 3GFJA 3OYDA 1S9HA 2X51A 1PJRA 1SFUA 3KP7A 3VYSB 3G3ZA 2FMLA 1YITI 2DQRA 4PUSA 1RPWA 4XOTA 1P4WA 4IOAF 3NAUA 2MGQA 4HG2A 1X3UA 2DT5A 2C6YA 4F92B 1WJEA 3WTVC 1YRNA 2ESNA 1I3QJ 5D5VB 2BGCA 1OQYA 2R7QA 3PFYA 3W6VA 2D45A 1IRZA 1D8JA 1DPRA 2G7UA 2R7OA 2WWYA 2DA6A 3A02A 4XKVA 4G9YA 5EZGA 1WJBA 1B9NA 4I6ZA 2K85A 4JK1X 1B4AA 4CUGA 2ZNYA 4UNOA 1Z9CA 2COBA 1IV6A 1XCVA 1S3JA 2DODA 5J8FA 3H0GJ 4E7ZA 4EGZA 4XORA 3HBLA 5ILVA 5B66C 1S72I 4HNVA 4B3AA 2NVQJ 3BOQA 4NC8A 1JUPA 1SD5A 4ZDPA 2NOGA 5D5XB 3FXOA 4IL6C 1TQMA 3FK6A 5ICCA 2ID6A 5IP7J 4FCYA 4E7SA 2L3DA 3MD2A 3V8LA 2B63J 3K9TA 5E1WA 3HPHA 3I55I 4PGGA 4ESJA 5HLHA 3SFIA 2WAQA 2LH9A 4IQ4A 3WGIA 5LGTA 2HQAA 2RQQA 5FKNA 1JJ6C 2K9LA 4BBRJ 1HOMA 3I59B 4XLCA 2R7WA 1R23A 2DOEA 2R4GA 3VSLA 2HQNA 1R5GA 2L4MA 3SXYA 4XLPF 1N75A 1KU9A 4FX0A 4RGRA 3KP3A 4GYGA 2A5YB 3M8EA 2BHZA 1Z91A 3I59A 2VKEA 5HLGA 3DEUA 1RC9A 1YW9A 3M3YJ 2YSRA 3OL3A 3M07A 4BH9A 2BY2A 4ENJA 2GIVA 2PJPA 3GTMJ 2DYSH 2XPUA 5DM6F 1S29A 1V55H 1S8NA 3MKLA 3I5UA 1EA3A 3I0TA 1MBKA 5EGOB 3LSPA 1WCMJ 3S2HJ 3A0HC 3ZMVA 1I1GA 2VUMJ 2W25A 3H9JA 1UCRA 1TT0A 4IHXA 2FMYA 2FXAA 3QP5A 4MQ9F 2P6SA 5DUIA 2I10A 5EGOA 4YIFA 3HRUA 5FFXA 3CDHA 3GZ6A 2FBHA 2IGNA 4U88A 4I76A 2WAQN 3C7JA 1QGPA 3WTWC 4BDZA 2E1NA 4LD5A 4F55A 3I71A 1KU3A 4PFPA 3OYGA 4AD9A 5DCFA 2KZGA 2H8WA 1ORKA 4B44A 3RQIA 1BN5A 3V7RA 1RUNA 1VQ8I 2VI6A 3CO6C 3ZPLA 4KN4X 4MIMA 1Z67A 2ZJQF 2BE5F 3K2AA 2FNAA 3J81K 3FXRA 3GMEA 3D0SA 3IH2A 2RN7A 2Z9OA 4JP0A 1MSEC 5LEJA 1FBSA 1MW7A 2K9QA 5M3MJ 2GBYA 1LVAA 3IUOA 1ZGAA 4BL0B 4OAZA 3JTGA 2R7SA 1VI0A 2NYXA 3B02A 4LLNA 1U5TB 4L5EA 2Q8KA 5GADJ 2DO7A 3S14J 1IUYA 2JWTA 4H4KC 2BY3A 2ZC2A 1EF4A 2LTPA 5DEQA 4CCNA 2A6HF 1T95A 5F0CA 4A6DA 2IS1A 3QPLA 2EA4A 1U5TA 2HTSA 1RUOA 4XOPA 4P9FA 3SHFA 4Z2YA 3LAPA 3QODA 5EDNA 2F5DA 4A3FJ 3ZQGA 1XSXA 2KL4A 3CQZJ 3MEXA 1MMDA 3LQQA 2AQEA 3Q0VA 2Y0MA 4QSHA 1HA8A 2CUZA 1IC8A 2MW8A 3B6AA 1TC3C 5CVIA 3G6EI 1KYWA 3FX3A 1UMQA 1W5SA 3CC4I 4EM0B 3BR3A 1T6SA 2CFOA 4D5FA 1I50J 4S05A 1QVTA 3K4CA 2E5NA 2KIUA 2LF8A 4GDFA 3ZQQA 3HOTA 2XB0X 4RB0A 1FPQA 3HGYA 4A3EJ 2HDWA 3ZMDA 1R49A 2F48A 4HV5A 1T0FA 1O3TA 4EV0A 4HF1A 2XGXA 4BAYA 3HKZA 1PUEE 1FIPA 3MKYB 4Q4ZF 1R1VA 2IA0A 2JSCA 2LKSA 2GXAA 1JTYA 3GF2A 2WV0A 4L5IA 5DM7F 1LNWA 2CQXA 3VYUB 1F1ZA 4ZYGA 2R7VA 4B8XA 2ECBA 3OYBA 3K69A 5HODA 1B1BA 3S2WA 2TCTA 2WAEA 3T0YA 1V54H 3U2RA 3G73A 1YG2A 3H3UA 2DBBA 3CCQI 2JMWA 4UUVA 2BV6A 2VQGA 2E2HJ 1KZHA 3U9GA 2F5EA 4L9TA 3OS0A 2QENA 1HQCA 3L2QA 2BOLA 2BY0A 1Z3YA 3H9QA 1TWCJ 1FMWA 3L1PA 1TWFJ 2IGMA 5FGMA 6PAXA 2CUJA 2H09A 3G2BA 1FOKA 3MMYB 1OYWA 2ICWG 3P9CA 3ZQLA 3RYRA 3JRDA 1R4MB 1JT0A 2A68F 2Y31A 1WSUA 1V5FA 4D7MA 5EEGA 1U3EM 2XF6A 2EFQA 2VL8A 2EA2A 5J3LA 2QQAA 4M6YA 4CH7A 5JLWA 3ONQA 3VODA 1W5TA 2HKXA 3FZVA 2DAOA 1YHQI 4DBRA 4KA4A 1Y56A 5IOYA 1OFCX 2V9VA 2XAHA 5HDNA 4HLXA 2O3FA 1WJCA 3K1MA 3HKZN 2IT0A 3HHHA 1B72B 2EFOA 2FBKA 3E5XA 3I64A 1WPKA 1FMVA 4UXNA 2VQHA 2L9NA 3RZDJ 3H35A 1D0XA 5L3FA 1NK3P 4JX4A 2COMA 4MEYF 1B72A 5D6EA 1F4KA 4E70A 1ZKGA 2XAUA 4J19A 4A3BJ 1HF0A 4RLQA 1NHAA 4V2GA 5JVGF 4GFBA 1VTNC 3TMOA 5K5RA 5ILUA 1LFBA 3VOEA 4ENMA 3A1YA 1Z21A 3S16J 2Y48A 4EGYA 4I2OA 2GXBA 2EWNA 5GAGJ 3CZ6A 2GOMA 2EIJH 3UR3C 4RS8A 1FOYA 1F9NA 2IA2A 2MG4A 2EZHA 1IGNA 3ZCOA 3JRFA 3JSPA 1XMXA 3V8JA 4WXCA 3VEPA 2V7FA 4JBAA 2Z16A 1MBFA 3KX2A 1FOXA 2ECCA 3CMEI 1Z1DA 3I9V2 1GVDA 2IXSA 3ZOBA 1E0EA 3MWMA 3P7NA 2NVUB 2ZFWA 5GTHC 1H9GA 1FT9A 3CTAA 4GO1A 1YW8A 5KHDA 4A0YA 2FX0A 1Z3XA 4Y17A 2CS3A 2E1MC 3KIOA 1O3QA 2GQQA 4BXFA 3OS1A 5EF6A 3ASOH 4RGXA 1MGTA 1P9QC 2DW4A 4KIFA 3TDZC 1W5CC 1WJDA 3VSKA 2W24A 3SQNA 1D1CA 1LE8B 3PSFA 3FXQA 1SMTA 1U9NA 1X58A 2XHKA 3V7SA 1P92A 1YO5C 3R60A 1UHMA 2K9SA 1GXPA 2HEOA 4EMSA 2CW8A 4LIVA 5LHIA 2V1NA 1LE8A 4F7ZA 2CV2A 2JA6J 3NEUA 2VODA 4R79A 1IO2A 3IRQA 2PFBA 4ENNA 1MD0A 4CZZA 1ZQ3P 2JA2A 5AIQA 4Y7NJ 3IV5A 2A69F 1JGGA 2HVQA 1ZARA 1BC7C 2F4OB 2LC2A 3M9AA 2KLOA 2JT1A 4IRGA 2KJBA 2CV1A 1ON1A 2GWRA 2HPMA 2VKVA 4XLAA 2BY1A 4DOZA 1OCTC 3W3CA 3GWZA 3L7WA 2K9NA 4M3EA 3E6BA 5HS9A 2OF7A 2F5FA 1Z7LA 1Z7UA 1ZG3A 1IAWA 3BCBA 2IJLA 3HRSA 5B5EC 2QZ8A 3TQNA 1FTTA 2STWA 1SEUA 3I4MJ 3SDGA 2JUGA 1A6QA 4PSXA 4A3GJ 4CXFA 5FLXZ 5IY5H 2R5ZA 3W6KB 3HRTA 3JR9A 1UAAA 2XSJC 4A3MJ 5JLXA 4Y52J 2DLLA 2ZMEC 1E2XA 1ZR4A 2DA3A 4W1UA 1VFCA 1X1DA 1SAXA 1QA6A 2OTJI 1Y1VJ 4LIUA 2X6WA 2D1HA 2GA2A 2WBMA 3OS2A 4AIKA 1Y8QB 1WWXA 2P4WA 3OR1C 3OYAA 4DZJA 3LSTA 2FOWA 1PUFB 4XICA 2DPUA 1O57A 1SFEA 4EJOA 4JQFA 1H9TA 4ITVA 3I53A 1D5YA 2YR2A 4V2FA 3R0JA 2JVHA 2LMDA 2P5KA 2RVCA 2H6CA 4ZC3A 1VF9A 3L00A 3LSJA 3SEZA 3MZHA 1BR1A 4RMNA 1U2WA 1DU0A 1YYVA 1ON2A 2DMPA 3MAJA 3K4NA 1NK2P 1MH3A 2F4MB 4PCQA 1VQPI 1BW5A 3O2PE 1X2NA 1ZELA 1W7PD 5LGNA 1F43A 4XR6A 3WU1B 1O7FA 5M5WJ 2KZVA 3OMYA 3RIRA 1TLHB 1BIBA 2CSOA 4B43A 4D0PA 2ETHA 2W84A 4F93B 3CJRB 3DTKA 4HBLA 1CGPA 2O0YA 5CVJA 3IHUA 4KMUX 3G1MA 4Y15A 4P5OA 3GTPJ 2Y30A 4EJWA 1D5VA 2XIGA 4UV8A 2O5RA 3K70D 2YUSA 3H5RA 4DIQA 2FSWA 2M0MA 1UZCA 4R1HA 4P9UA 3DLLF 3ISPA 4MO7A 3LNQA 2ZJRF 2VN2A 2ZB9A 1E17A 1JUSA 3AAFA 1HW2A 3PNTA 1IN4A 4DQ2A 4ZYHA 4Z6YA 1JHHA 2V6CA 3C18A 4YELA 1N25A 2BVMA 4KT6A 4EATA 3KE2A 3FXLA 4YFXF 1PP8F 4I0AA 4FASD 5IP9J 1FIAA 1MKMA 2MBFA 4UB8C 4CICA 4PJLA 2UXXA 3K10A 5JHUA 1J2XA 4II2A 1ETQA 3I4PA 3ZP5A 2M7BA 2PJRB 3HC7A 3ECHA 5E3OA 1R22A 5C4XJ 2K5CA 3DF8A 5DDGA 1XTAA 2XF5A 3OOPA 2A6EF 3Q9SA 5CYVA 3X2QH 2PJRA 4DJAA 3MKZA 2HOEA 5J1RA 1Q1VA 4XSXF 4BS9A 2WADA 4NC6A 3BZKA 3IP4B 2DTZA 1ZAOA 2LYCA 4IPAA 4A5NA 1BR4A 2DOFA 3DKYA 1TNSA 4G94A 4M6XA 5F1JA 4EJTA 2G0EA 2UUZA 3S17J 2NS7A 1VQKI 1BJZA 2TDXA 2FQ4A 3GEZA 1HC8A 1DPUA 1WJAA 4BACA 2OC6A 4QIWN 5BMZA 2EV5A 2QQBA 3HGGA 4IF4A 4UB6C 2ZXWH 4YFKF 2EH3A 1HKTA 5EG0B 2X1DA 3J7AY 3LL7A 1V5EA 3HUGB 3QQAA 4LG0B 2VJIA 1MNEA 5ED4A 3AKZA 4HRIA 1R00A 2BBYA 2MD5A 3M8FA 2DA7A 2EK5A 2W82A 5EG0A 4BE0A 5E17F 3HUGA 3WG9A 4LG0A 3WGGA 2EZKA 3PO3J 2VQCA 5D8LB 5DS9A 2Y0SA 4A0XA 3JRCA 1HSJA 2A05A 2X9DA 5LGUA 3G4SI 3GVAA 4XLFA 5FD5A 1A5JA 2WTEA 2NXNB 2R7TA 3GTQJ 3ABLH 4E7LA 2HTJA 1YE9A 1LQ1A 2JJ7A 3J80Z 3G1LA 3CLQA 2CW7A 4XLEA 1HXDA 3DEWA 3PL8A 2HU9A 2O03A 4XNFA 4C2MJ 5EZHA 1O7LA 2R3SA 2MC4A 4BGDA 1W0TA 1SMYF 3CUQA 3L2RA 3W2AA 4GCVA 1Y0NA 1WI3A 2GIZA 2PQ8A 1G59A 3EUHC 3QRFF 2XAJA 5ICEA 5LHGA 1SAUA 4HDVA 2E60A 1ZG5A 2R0QC 3CUOA 1QU3A 2WY7Q 4A3DJ 3KLOA 3LA3A 4GGGA 3S3MA 2VB6A 2CQ7A 4G6DA 3WHCA 5D4RA 4ANJA 1I1SA 2VBZA 1ULYA 2Y0SN 2RC4A 1H88C 2NRAC 3GTLJ 3TOAA 1X2MA 4BQNA 3FF5A 4IHWA 1JXSA 5AIPA 1YFHA 1ZG1A 4M9ZA 2VT2A 4C3JJ 5GPAA 4G7ZF 4ENKA 1ETVA 1NTCA 1FC3A 2M0CA 5TRDA 1FNNA 5E8IA 2HWVA 2R7FA 2ZO4A 2X0LA 3BR5A 3FIWA 3BR0A 3CJQB 5LBQA 2HI3A 1SANA 2NVTJ 4KFCA 5EYRA 1UELB 4G12A 2OQRA 2EIMH 3HM5A 2H1KA 3LA2A 2LOOA 4B3XA 3F21A 4MFDA 5F1RA 1TTYA 4MLOA 3OYKA 2JA7J 4NC7A 1P4AA 3UNGC 5FB2A 2O61A 2L9SA 3F0CA 4O5VA 1HDPA 1XMKA 3EUKL 1TNTA 3KEQA 2DMQA 1GT0C 1N78A 1UG0A 3F8MA 4LFUA 1YS7A 2LR8A 2MH2A 1A36A 4HSRA 4IKFA 1JE8A 1WKMA 2DMNA 5K7FA 2ZJPF 3HG9A 4CGZA 3ZXSA 4I98B 3QYBA 1WH7A 3DTIA 4W97A 3EETA 1R36A 1KQ0A 2HZDA 4KIBA 5EEAA 4ZYAA 3C2GA 3FXKA 3WTYC 1M1EB 1W1WE 1IJWC 1MBEA 1V5GA 1YX3A 2AS5F 4BE1A 4BKXA 1O3RA 2QF7A 3SZTA 4M3DA 3H92A 4MHGA 3D5RC 2K3FA 4RAGA 1SVLA 1AA7A 2E1MB 3BPVA 4OU0A 2O9LA 2H27A 1DGWY 2M45A 3BG9A 2HYGD 3DXJF 2W57A 5CVVA 4I99C 3CCRI 4EVIA 3WU2C 4YG2F 5C3EJ 3K2ZA 1VNDA 3O8HA 4P1WA 1K6OA 2AO9A 5HLTA 1AWCA 3L2VA 2X85A 4ASNA 1K83J 2Z1DA 2XGCA 1GV5A 3CCMI 2P7CB 4OINF 1P2FA 1UB9A 3GFLA 3BTIA 3DKXA 1LDKB 3BROA 5GP9A 2PMUA 4E7KA 2WB1A 2VC1A 3IAM2 1X3ZB 1R1UA 2EINH 2Z33A 5CLSA 1FYMA 1BJAA 1LFUP 2HR3A 2QQ9A 1P4XA 2EPFA 2KFDA 4R8HA 3CCEI 3TL4X 2XPVA 3PUBA 4QPOA 3OL4A 2M87A 4UVBA 2WC2A 1KA8A 4JOMA 1W36D 3C2BA 5F27A 3DEEA 3FK7A 5H6QA 1J0RA 1XDSA 1XSVA 5F08A 4G7OF 4AYBA 2FJ1A 3K4BA 5DYMA 3TO7A 1MZBA 2M34A 2D5VA 2DA1A 2L01A 1Q1HA 2FD5A 4HYEA 4ZZDA 1Z6RA 3K70C 3PQJA 1T39A 2OU2A 3ML6A 3GW2A 3ZN1A 4KT5C 3OYEA 3BDDA 5FRMA 1MSFC 4RDUA 1BOAA 2MA3A 3CMAI 1NG7A 2ESHA 4KUMA 4CA0A 4HOBA 1JKPC 1ACIA 1QHGA 1WI9A 4HX7A 2WB1N 4EJUA 2ZMEB 3CESA 3SFZA 5ICGA 1MNDA 3LAJA 4RA2A 2MABA 3TKYA 1MMSA 2YU3A 1QHHD 4B1RA 4HW0A 4DGWB 5L3CA 3FKIJ 4JYKA 4CZCA 1BBYA 3IWFA 3DBRB 2ZMEA 4EM1A 3DPUA 2TRTA 5HDGA 1GLNA 2CFXA 3V4GA 5F04A 1F5TA 3KZZA 5IYBJ 4KJZA 4OMYA 3OSFA 2HDCA 1WVRA 1QNTA 2JSPA 5J47A 1YS6A 2EZIA 5DD4A 4XQFA 1T8IA 4AIJA 3L2WA 4AYBN 1DUXC 3JRHA 2IGOA 1R7JA 1LKXA 2NS8A 2R7RA 3ZMTA 2OCEA 3JSOA 2Y9ZA 2B7EA 2CQKA 4FISA 3TEDA 4WXHA 3OYHA 4A3CJ 3Q3SA 3GBGA 1JI8A 3KYDB 4RB3C 1TWGJ 4C2TA 2OPTA 3K4MA 2HXOA 1WHUA 2JZYA 2WA0A 3L2CA
chains in the Genus database with same CATH topology
4L0ZB 2ZXJA 1ZYRF 1U8RA 2X4HA 5E18F 4I09A 2PLYA 1Z6TA 4KICA 4BHBA 3FM5A 5FLXK 4ZYDA 4KIGA 3PFIA 1MDMB 1HKSA 2OA4A 1IW7F 2FBIA 4B09A 2DPDA 2V1DA 3H3ZA 1YLFA 3KP4A 1G4DA 3E3VA 4Q5SF 1MDMA 2V1XA 3QU3A 4K2EA 2K4BA 2OZUA 2F5CA 3IL2A 1STZA 2ZBKA 5LRRA 3WTXC 2RNJA 2RQPA 4LLGF 2GZWA 3MZYA 3BJ6A 3QPTA 2PBIA 1OR7A 2LSOA 2OZ6A 4CO8A 2RV8A 5DD8A 5IT9Z 3I58A 4KYWA 4PZJA 1YW7A 4HQMA 5H20A 4EQQA 3KCCA 3WTUC 4OIQF 5ICFA 2KIMA 1HW1A 1ZN2A 3T8RA 5E8GA 1I5ZA 2GXGA 3COAC 5L3EA 4TV7A 3RTRA 4RGUA 1QBJA 4L9JA 2XUBA 3R6SA 1J7KA 3M7GA 1CF7B 2LDUA 4G8XA 3VFZA 2M8EA 2IP2A 4GYIA 2CYYA 1CF7A 2XRNA 3ABUA 2VBYA 2CWEA 4XRFA 3E6DA 2EFPA 3IWZA 2A07F 1AOYA 2QBYB 2ZNZA 4BYYA 2ZKZA 1USSA 1BI0A 1HW5A 3O6BB 2QBYA 4Q48A 2PN6A 5LHHA 2P6TA 3REOA 5BQTA 3P9KA 1XD7A 1I6XA 4UHTA 1USTA 1LEBA 2J5PA 2RGVA 3V8KA 3BZ6A 3IC7A 3FHZA 1FY7A 4O6JA 4OIPF 3HIFA 4L9VA 1MJBA 1ZRFA 2ADUA 1S6LA 3ULQB 1ZGJA 2OAZA 4BHCA 1I27A 3N97A 3HTUA 1XMAA 2EJRA 1IF1A 3F8NA 2UZKA 4OIOF 1BI1A 1HSTA 3GYHX 2M5WA 5A2QZ 4A0ZA 4XSZF 2UXNA 2FA5A 2LF7A 4QWQA 1Y0UA 3DFGA 2DK8A 3J80K 2LNBA 2O8XA 5HS8A 4GXOA 2G9WA 3FWEA 3ELKA 3MFKA 5ERIA 4PDKA 3ZMSA 2K02A 1XGOA 1S7AA 2YPRA 5JR3A 2P7VB 1IN7A 2FE3A 1REPC 4O3MA 1JHFA 4IHSA 1FLIA 1T2KA 2CG4A 4LB5A 3GXOA 1RZ4A 4CYDA 1OPCA 4Y13A 1S7OA 1FSEA 1K79A 4YFNF 3TGNA 2DU9A 2H94A 2B0LA 1B9MA 5JI6A 2EFWA 1ZH5A 4KN7X 2HFHA 3DPTA 2DFIA 3ABTA 3CLOA 1R1TA 3FXUA 2QM3A 3E5UA 2CGPA 1W7PB 5HDKA 1GXQA 1R5HA 3HTSB 3HYIA 3KP6A 5LLQA 1W7PA 5HLIA 3DPLC 2FEZA 2L4AA 2P5LC 1HKQA 4L5JA 2FOKA 1L3LA 5ILSA 4M72A 4HF2A 1XGMA 2D1VA 1U6GA 5F64A 2XAQA 2FQ3A 1RNLA 1PDNC 4KDPA 2YX7A 4RB2C 3RKXA 4LJZF 5DUKA 2VBXA 1O3SA 2QWWA 3F8CA 2D2WA 2EV0A 1MJAA 4OIRF 3KETA 4WF2A 2PEXA 4MTDA 2RDPA 1G3WA 2MLKA 2Q0OA 4KNYA 3C3WA 4N9IA 1ONVA 4U7DA 1LJ9A 3RI4A 3RJPA 2HGCA 3R0AA 1FBQA 4ZH4F 2HYFA 5D4SA 3GUDA 5L3GA 4L18B 2FRHA 5LRSA 3JAMZ 2MH9A 3KZYA 2VOOA 1IN5A 3DKWA 3FM3A 4NHJA 3KFWX 2QYOA 2E1CA 1EH6A 2K27A 5D5WB 3K1NA 3U1DA 3ERED 3BJOA 2JRTA 1BM9A 4L9NA 1QPMA 2XKPA 2L54A 3T8TA 4G7HF 5KVRA 3ROUA 4ETSA 4ZZLA 2OD5A 2VE8A 3ZMUA 4I02A 3WODF 3WE2A 2VC0A 4CDGA 2Z3YA 5BPIA 1FP1D 1FYKA 3LQRA 4PGHA 1QZYA 4YIIA 2YX4A 1OYYA 4N0BA 2IRFG 1R58A 3EYYA 2PMHA 4LMYA 4IJAA 4EJVA 2QVOA 4IXAA 3FMRA 1IN6A 2VXZA 3QOPA 3RYPA 4N9HA 4HDUA 4MTEA 2VE9A 1SD7A 3BPXA 1GHCA 5D8KB 1XCBA 1KYZA 2ISYA 1J75A 3GFIA 1SD6A 4WK8F 1ZRCA 5HVQC 4HA8A 4L0YB 1B59A 3GFMA 3R61A 1HBXG 3FMQA 5E1XA 2CO5A 2VBWA 3Q9VA 3GX4X 3EYIA 3Q5FA 3F6OA 4I0BA 1BI2A 1YQAA 1EV7A 2K7LA 3RPQA 1V4RA 3RDIA 4AVPA 1KU2A 5IT9K 3TOBA 1Z05A 2ELHA 1ODDA 3FMSA 2PG4A 2ZJ2A 2HS5A 5CVRA 3IRRA 3SZPA 2XKOA 4M9XA 2VOPA 1DDNA 2Z99A 2UWMA 4P55A 5BOXA 3VB2A 2KKOA 1TQPA 5DV5A 3W6JB 1T98A 3KLNA 5LEKA 4AIHA 1FYLA 4P96A 4A5MA 5K5QA 2HZTA 5D5UB 1XB4A 5BPDA 5F6FA 2OQGA 3IKVA 4RAYA 1QZZA 2ACJA 1J5YA 4A12A 1LEAA 3CJNA 1MJ9A 2OBPA 5IT3A 3J7AO 1G3SA 5K5OA 4MEXF 3BP8A 3HRMA 4A2UA 1G3TA 3T1BA 5HOOA 1FP2A 4M9SA 3QP6A 3KP2A 4BXUA 1TQIA 1IRGA 4ESFA 1QQIA 5H6RA 3HSFA 2F2EA 3MQ0A 3WTTC 4MNUA 4BHPA 1OYIA 1XN7A 1G6NA 3D5LA 3EDPA 5FFZA 5E1ZB 2HQRA 5A2QK 1KGSA 2G7HA 3CUQC 2M30A 2R7DA 1FX7A 3PQKA 1RIOH 4BQAA 4XLNF 5L3DA 4LK1F 2AXLA 1B6AA 4FHTA 2IW5A 1IXRC 3WTZA 4WWCA 2Q2EA 1IXCA 1BI3A 4IRHA 3TO9A 5TJJA 2HKOA 2FF4A 3LWFA 1QO0D 5FO5A 2Z5UA 1UHWA 4OOIA 4IRIA 3RKYA 2M1BA 5CVUA 1XGSA 1SD4A 5K1YA 1TBXA 3TDUC 1KU7A 1KQ9A 2QUFA 1TW3A 1ZRDA 1IZ1A 4MQVA 2K86A 4UV9A 4OMZA 3O3KA 1WQ2A 3F23A 2XROA 3JW4A 5DCMB 1J9IA 3HSRA 1YIOA 3K1PA 5DCMA 2NS0A 3J81Z 4IVNA 2GA1A 2FNPA 2NNYA 2CW0F 4ESBA 2DK5A 2JPBA 4M73A 5E20A 3F8FA 1ZHFA 2NNNA 3MCZA 5L3BA 1XDUA 3BY6A 2KIFA 1FBUA 1OMIA 4UVCA 1IN8A 3GZ5A 4U0VA 4LB6B 1SFXA 1FWZA 2JTVA 3R4KA 1BIAA 2XASA 4M74A 2A3SA 3QPHA 3EUHA 3N4MA 1GVJA 3GO5A 3KEOA 1L0OC 4ZYEA 4FT8A 4RGSA 2V79A 4AWXB 3HOSA 3JTHA 4FX4A 2QLZA 2KRFA 5HS7A 1C0WA 1TW2A 2E7WA 4KMFA 2P8TA 2XAGA 5KK1A 1DP7P 1XGNA 3F22A 3F3XA 3BWGA 2IA1A 1ZLJA 3B73A 2IVMA 2DQLA 1V3FA 4M71A 4HQEA 1J59A 4BNCA 4RAZA 1U5TC 3IKTA 1EH8A 4U7BA 3JAMK 5EEHA 3RPUA 4IHTA 1P6RA 3GLXA 4CHUA 1W4MA 3BJAA 4ON0A 4RB1A 2J5OA 3DV8A 2EFNA 3E97A 1YTYA 2BEOA 4HX8A 3I54A 2VONA 4LLLA 5J6XA 4HX4A 5FD6A 1EH7A 3LA7A 4QLCU 1UFMA 3L09A 4HLYA 1K7AA 2EB7A 5AONA 5J8CA 3WE3A 4WXDA 2P5VA 2GAUA 2DTRA 2XV4S 3E6MA 3WGHA 1FZPB 2O6GE 2VT3A 1H0MA 1BC8C 3F6VA 1JGSA 3DQVC 2L02A 2H6BA 5D6FA 3LFKA 4LGWA 1IRFA 4WCGA 3WU0A 2RKHA 1PP7U 2STTA 4U0YA 3TO6A 2W85A 3EQLF 1LB2A 4HV6A 2DI3A 3M1EA 3QAHA 1T38A 2LKPA 1G3YA 4Q47A 1IXSB 4I01A 4H0EA 4HF0A 2BYVE 1FSHA 3E6CC 3F8BA 1K78B 1LDJA 3RKWA 4HZFA 3HSEA 5JVTA 2XAFA 3F72A 3L9FA 2EV6A 5CJ9A 3ZN0A 3NRVA 1K78A 4UVAA 1D3YA 4NB5A 2ISZA 2Y75A 4XBFA 4NQWA 5BS6A 4LK0F 3DP7A 4WX9A 1A04A 4G6QA 3E5QA 2K4JA 3ZMZA 3NQOA 3HHGA 2NAZA 3CO7C 2MC3A 2IPQX 1XSDA 4MGRA 4HAMA 3ZQ7A 1OKRA 3K0LA 3KP5A 1RI7A 2KJCA 3C1DA 1WRJA 2A61A 1ZREA 3OV8A 4A6EA 4EM2A 1KQ8A 2FU4A 3QU6A 3P9IA 2V1UA 1LDDA 2JPCA 4I7HA 1U78A 2ZCWA 3WTSC 3T5XA 1ZLKA 3CUQB 1D8KA 2PI0A 3ECOA 4U0WA 4DNCA 2E7XA 4S04A 3V7CA 2XVCA 2MLGA 5JFRA 3GFJA 1SFUA 3KP7A 3G3ZA 2FMLA 2DQRA 1P4WA 1X3UA 2DT5A 2C6YA 3WTVC 2ESNA 5D5VB 2BGCA 2D45A 1D8JA 1DPRA 2G7UA 2WWYA 4G9YA 1B9NA 4JK1X 1B4AA 2ZNYA 4UNOA 1Z9CA 1XCVA 1S3JA 5J8FA 4EGZA 5ILVA 3BOQA 1SD5A 5D5XB 1TQMA 5ICCA 2L3DA 3V8LA 3K9TA 5E1WA 4PGGA 4ESJA 5HLHA 3WGIA 5LGTA 3I59B 1R23A 2HQNA 1R5GA 2L4MA 3SXYA 4XLPF 1KU9A 4FX0A 4RGRA 3KP3A 4GYGA 2A5YB 3M8EA 3I59A 1Z91A 5HLGA 3DEUA 1YW9A 2YSRA 4BH9A 4ENJA 2GIVA 2PJPA 1S29A 1S8NA 3I5UA 3I0TA 3ZMVA 1I1GA 2W25A 1UCRA 2FMYA 2FXAA 3QP5A 4MQ9F 2P6SA 5DUIA 4YIFA 3HRUA 5FFXA 3CDHA 3GZ6A 2FBHA 4U88A 3C7JA 1QGPA 3WTWC 2E1NA 4LD5A 3I71A 1KU3A 4AD9A 5DCFA 1BN5A 3V7RA 1RUNA 3CO6C 3ZPLA 4KN4X 2BE5F 2FNAA 3J81K 3FXRA 3D0SA 2RN7A 2Z9OA 5LEJA 1FBSA 1LVAA 1ZGAA 3JTGA 4LLNA 2NYXA 3B02A 1U5TB 2Q8KA 2DO7A 1IUYA 5DEQA 2A6HF 4A6DA 2EA4A 1U5TA 2HTSA 1RUOA 4P9FA 3SHFA 4Z2YA 3LAPA 2F5DA 1XSXA 3MEXA 3LQQA 2Y0MA 5CVIA 1KYWA 3FX3A 1W5SA 4EM0B 1T6SA 4S05A 2KIUA 2LF8A 3HOTA 4RB0A 1FPQA 3ZMDA 4HV5A 1T0FA 1O3TA 4EV0A 4HF1A 2XGXA 4BAYA 1PUEE 4Q4ZF 1R1VA 2IA0A 2JSCA 3GF2A 2WV0A 4L5IA 1LNWA 1F1ZA 4ZYGA 4B8XA 3K69A 1B1BA 3S2WA 3T0YA 3U2RA 3G73A 1YG2A 3H3UA 2DBBA 4UUVA 2BV6A 3U9GA 2F5EA 4L9TA 2QENA 1HQCA 5FGMA 6PAXA 1FOKA 2H09A 1OYWA 3P9CA 3RYRA 2A68F 1WSUA 1U3EM 5EEGA 2EFQA 2EA2A 2QQAA 4M6YA 3VODA 1W5TA 2HKXA 3FZVA 2DAOA 4KA4A 2V9VA 2XAHA 5HDNA 4HLXA 2O3FA 3K1MA 2IT0A 3HHHA 2EFOA 2FBKA 3E5XA 3I64A 4UXNA 5L3FA 2COMA 4MEYF 5D6EA 1F4KA 4E70A 1NHAA 1VTNC 5K5RA 5ILUA 3VOEA 4ENMA 2Y48A 4EGYA 4I2OA 2GXBA 2EWNA 4RS8A 1F9NA 2IA2A 3JSPA 3V8JA 4WXCA 3VEPA 4JBAA 1Z1DA 3MWMA 3P7NA 2ZFWA 1H9GA 1FT9A 3CTAA 4GO1A 1YW8A 4A0YA 4Y17A 1O3QA 2GQQA 4RGXA 1MGTA 2DW4A 4KIFA 3TDZC 2W24A 3SQNA 3FXQA 1SMTA 3V7SA 2XHKA 1P92A 1YO5C 3R60A 1UHMA 1GXPA 2HEOA 4EMSA 5LHIA 4F7ZA 3NEUA 2VODA 4R79A 3IRQA 2PFBA 4ENNA 1MD0A 4CZZA 5AIQA 2A69F 1ZARA 1BC7C 3M9AA 2JT1A 4IRGA 2KJBA 1ON1A 2GWRA 3GWZA 3L7WA 3E6BA 5HS9A 2F5FA 1Z7UA 1ZG3A 1IAWA 3HRSA 2IJLA 2QZ8A 3TQNA 2STWA 4CXFA 5FLXZ 3W6KB 3HRTA 2DLLA 1E2XA 1SAXA 2D1HA 2GA2A 4AIKA 2P4WA 1WWXA 3LSTA 2DPUA 1O57A 1SFEA 4EJOA 4JQFA 1H9TA 3I53A 2YR2A 3R0JA 2P5KA 2RVCA 2H6CA 3MZHA 3L00A 1U2WA 1YYVA 1ON2A 3MAJA 4PCQA 3O2PE 1W7PD 5LGNA 3WU1B 1O7FA 3RIRA 1TLHB 1BIBA 2CSOA 4D0PA 2ETHA 2W84A 4HBLA 1CGPA 2O0YA 5CVJA 3IHUA 4KMUX 4Y15A 4P5OA 4EJWA 1D5VA 2XIGA 4UV8A 2FSWA 4R1HA 4P9UA 3ISPA 2VN2A 1E17A 3AAFA 1HW2A 1IN4A 4DQ2A 4ZYHA 1JHHA 2V6CA 3C18A 4YFXF 3KE2A 1PP8F 4I0AA 1MKMA 2MBFA 4CICA 2UXXA 5JHUA 1J2XA 3I4PA 3ZP5A 3ECHA 1R22A 3DF8A 5DDGA 3OOPA 2A6EF 3Q9SA 5CYVA 2HOEA 4XSXF 1ZAOA 4IPAA 4A5NA 1TNSA 4G94A 4M6XA 4EJTA 2TDXA 3GEZA 1DPUA 5BMZA 2EV5A 2QQBA 4IF4A 4YFKF 1HKTA 4LG0B 5ED4A 1R00A 2BBYA 2MD5A 3M8FA 2EK5A 5E17F 3HUGA 3WG9A 4LG0A 3WGGA 5D8LB 4A0XA 1HSJA 5LGUA 3GVAA 5FD5A 2WTEA 2HTJA 1LQ1A 3J80Z 1HXDA 2O03A 1O7LA 2R3SA 1SMYF 3CUQA 4GCVA 2PQ8A 3QRFF 2XAJA 5ICEA 5LHGA 4HDVA 1ZG5A 3CUOA 3KLOA 3LA3A 4GGGA 4G6DA 5D4RA 1I1SA 2VBZA 1ULYA 2RC4A 2NRAC 3TOAA 1JXSA 3FF5A 5AIPA 1YFHA 1ZG1A 4M9ZA 2VT2A 4G7ZF 4ENKA 5TRDA 1FC3A 1FNNA 5E8IA 2HWVA 2R7FA 2ZO4A 2X0LA 5LBQA 4KFCA 2OQRA 3LA2A 3F21A 5F1RA 1TTYA 5FB2A 1P4AA 2O61A 4O5VA 1XMKA 1TNTA 3KEQA 3F8MA 4LFUA 1YS7A 2MH2A 1JE8A 1WKMA 4CGZA 4I98B 3EETA 1R36A 1KQ0A 4KIBA 3WTYC 2AS5F 1O3RA 3SZTA 3H92A 4MHGA 3BPVA 4OU0A 2H27A 2M45A 2HYGD 3DXJF 2W57A 5CVVA 4EVIA 4YG2F 3K2ZA 1K6OA 1AWCA 4ASNA 2P7CB 4OINF 1P2FA 1UB9A 3GFLA 1LDKB 3BROA 2PMUA 2VC1A 1R1UA 2Z33A 5CLSA 1FYMA 1BJAA 2HR3A 2QQ9A 1P4XA 4R8HA 2M87A 4UVBA 2WC2A 1KA8A 5H6QA 1J0RA 1XDSA 1XSVA 4G7OF 5DYMA 3TO7A 1MZBA 2L01A 1Q1HA 4HYEA 4ZZDA 1Z6RA 3PQJA 1T39A 2OU2A 3ML6A 3GW2A 3ZN1A 4KT5C 3BDDA 1BOAA 2MA3A 2ESHA 4KUMA 4HOBA 1WI9A 4HX7A 4EJUA 2ZMEB 3SFZA 5ICGA 3LAJA 3TKYA 2YU3A 4HW0A 5L3CA 1BBYA 3IWFA 2ZMEA 4EM1A 5HDGA 2CFXA 3V4GA 1F5TA 3KZZA 4OMYA 2HDCA 1QNTA 1YS6A 5DD4A 4AIJA 1DUXC 1R7JA 3ZMTA 3JSOA 2CQKA 4WXHA 4RB3C 2JZYA 3L2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L0Z B;  2ZXJ A;  1ZYR F;  1U8R A;  2X4H A;  5E18 F;  4I09 A;  2PLY A;  1Z6T A;  4KIC A;  4BHB A;  3FM5 A;  5FLX K;  4ZYD A;  4KIG A;  3PFI A;  1MDM B;  1HKS A;  2OA4 A;  1IW7 F;  2FBI A;  4B09 A;  2DPD A;  2V1D A;  3H3Z A;  1YLF A;  3KP4 A;  1G4D A;  3E3V A;  4Q5S F;  1MDM A;  2V1X A;  3QU3 A;  4K2E A;  2K4B A;  2OZU A;  2F5C A;  3IL2 A;  1STZ A;  2ZBK A;  5LRR A;  3WTX C;  2RNJ A;  2RQP A;  4LLG F;  2GZW A;  3MZY A;  3BJ6 A;  3QPT A;  2PBI A;  1OR7 A;  2LSO A;  2OZ6 A;  4CO8 A;  2RV8 A;  5DD8 A;  5IT9 Z;  3I58 A;  4KYW A;  4PZJ A;  1YW7 A;  4HQM A;  5H20 A;  4EQQ A;  3KCC A;  3WTU C;  4OIQ F;  5ICF A;  2KIM A;  1HW1 A;  1ZN2 A;  3T8R A;  5E8G A;  1I5Z A;  2GXG A;  3COA C;  5L3E A;  4TV7 A;  3RTR A;  4RGU A;  1QBJ A;  4L9J A;  2XUB A;  3R6S A;  1J7K A;  3M7G A;  1CF7 B;  2LDU A;  4G8X A;  3VFZ A;  2M8E A;  2IP2 A;  4GYI A;  2CYY A;  1CF7 A;  2XRN A;  3ABU A;  2VBY A;  2CWE A;  4XRF A;  3E6D A;  2EFP A;  3IWZ A;  2A07 F;  1AOY A;  2QBY B;  2ZNZ A;  4BYY A;  2ZKZ A;  1USS A;  1BI0 A;  1HW5 A;  3O6B B;  2QBY A;  4Q48 A;  2PN6 A;  5LHH A;  2P6T A;  3REO A;  5BQT A;  3P9K A;  1XD7 A;  1I6X A;  4UHT A;  1UST A;  1LEB A;  2J5P A;  2RGV A;  3V8K A;  3BZ6 A;  3IC7 A;  3FHZ A;  1FY7 A;  4O6J A;  4OIP F;  3HIF A;  4L9V A;  1MJB A;  1ZRF A;  2ADU A;  1S6L A;  3ULQ B;  1ZGJ A;  2OAZ A;  4BHC A;  1I27 A;  3N97 A;  3HTU A;  1XMA A;  2EJR A;  1IF1 A;  3F8N A;  2UZK A;  4OIO F;  1BI1 A;  1HST A;  3GYH X;  2M5W A;  5A2Q Z;  4A0Z A;  4XSZ F;  2UXN A;  2FA5 A;  2LF7 A;  4QWQ A;  1Y0U A;  3DFG A;  2DK8 A;  3J80 K;  2LNB A;  2O8X A;  5HS8 A;  4GXO A;  2G9W A;  3FWE A;  3ELK A;  3MFK A;  5ERI A;  4PDK A;  3ZMS A;  2K02 A;  1XGO A;  1S7A A;  2YPR A;  5JR3 A;  2P7V B;  1IN7 A;  2FE3 A;  1REP C;  4O3M A;  1JHF A;  4IHS A;  1FLI A;  1T2K A;  2CG4 A;  4LB5 A;  3GXO A;  1RZ4 A;  4CYD A;  1OPC A;  4Y13 A;  1S7O A;  1FSE A;  1K79 A;  4YFN F;  3TGN A;  2DU9 A;  2H94 A;  2B0L A;  1B9M A;  5JI6 A;  2EFW A;  1ZH5 A;  4KN7 X;  2HFH A;  3DPT A;  2DFI A;  3ABT A;  3CLO A;  1R1T A;  3FXU A;  2QM3 A;  3E5U A;  2CGP A;  1W7P B;  5HDK A;  1GXQ A;  1R5H A;  3HTS B;  3HYI A;  3KP6 A;  5LLQ A;  1W7P A;  5HLI A;  3DPL C;  2FEZ A;  2L4A A;  2P5L C;  1HKQ A;  4L5J A;  2FOK A;  1L3L A;  5ILS A;  4M72 A;  4HF2 A;  1XGM A;  2D1V A;  1U6G A;  5F64 A;  2XAQ A;  2FQ3 A;  1RNL A;  1PDN C;  4KDP A;  2YX7 A;  4RB2 C;  3RKX A;  4LJZ F;  5DUK A;  2VBX A;  1O3S A;  2QWW A;  3F8C A;  2D2W A;  2EV0 A;  1MJA A;  4OIR F;  3KET A;  4WF2 A;  2PEX A;  4MTD A;  2RDP A;  1G3W A;  2MLK A;  2Q0O A;  4KNY A;  3C3W A;  4N9I A;  1ONV A;  4U7D A;  1LJ9 A;  3RI4 A;  3RJP A;  2HGC A;  3R0A A;  1FBQ A;  4ZH4 F;  2HYF A;  5D4S A;  3GUD A;  5L3G A;  4L18 B;  2FRH A;  5LRS A;  3JAM Z;  2MH9 A;  3KZY A;  2VOO A;  1IN5 A;  3DKW A;  3FM3 A;  4NHJ A;  3KFW X;  2QYO A;  2E1C A;  1EH6 A;  2K27 A;  5D5W B;  3K1N A;  3U1D A;  3ERE D;  3BJO A;  2JRT A;  1BM9 A;  4L9N A;  1QPM A;  2XKP A;  2L54 A;  3T8T A;  4G7H F;  5KVR A;  3ROU A;  4ETS A;  4ZZL A;  2OD5 A;  2VE8 A;  3ZMU A;  4I02 A;  3WOD F;  3WE2 A;  2VC0 A;  4CDG A;  2Z3Y A;  5BPI A;  1FP1 D;  1FYK A;  3LQR A;  4PGH A;  1QZY A;  4YII A;  2YX4 A;  1OYY A;  4N0B A;  2IRF G;  1R58 A;  3EYY A;  2PMH A;  4LMY A;  4IJA A;  4EJV A;  2QVO A;  4IXA A;  3FMR A;  1IN6 A;  2VXZ A;  3QOP A;  3RYP A;  4N9H A;  4HDU A;  4MTE A;  2VE9 A;  1SD7 A;  3BPX A;  1GHC A;  5D8K B;  1XCB A;  1KYZ A;  2ISY A;  1J75 A;  3GFI A;  1SD6 A;  4WK8 F;  1ZRC A;  5HVQ C;  4HA8 A;  4L0Y B;  1B59 A;  3GFM A;  3R61 A;  1HBX G;  3FMQ A;  5E1X A;  2CO5 A;  2VBW A;  3Q9V A;  3GX4 X;  3EYI A;  3Q5F A;  3F6O A;  4I0B A;  1BI2 A;  1YQA A;  1EV7 A;  2K7L A;  3RPQ A;  1V4R A;  3RDI A;  4AVP A;  1KU2 A;  5IT9 K;  3TOB A;  1Z05 A;  2ELH A;  1ODD A;  3FMS A;  2PG4 A;  2ZJ2 A;  2HS5 A;  5CVR A;  3IRR A;  3SZP A;  2XKO A;  4M9X A;  2VOP A;  1DDN A;  2Z99 A;  2UWM A;  4P55 A;  5BOX A;  3VB2 A;  2KKO A;  1TQP A;  5DV5 A;  3W6J B;  1T98 A;  3KLN A;  5LEK A;  4AIH A;  1FYL A;  4P96 A;  4A5M A;  5K5Q A;  2HZT A;  5D5U B;  1XB4 A;  5BPD A;  5F6F A;  2OQG A;  3IKV A;  4RAY A;  1QZZ A;  2ACJ A;  1J5Y A;  4A12 A;  1LEA A;  3CJN A;  1MJ9 A;  2OBP A;  5IT3 A;  3J7A O;  1G3S A;  5K5O A;  4MEX F;  3BP8 A;  3HRM A;  4A2U A;  1G3T A;  3T1B A;  5HOO A;  1FP2 A;  4M9S A;  3QP6 A;  3KP2 A;  4BXU A;  1TQI A;  1IRG A;  4ESF A;  1QQI A;  5H6R A;  3HSF A;  2F2E A;  3MQ0 A;  3WTT C;  4MNU A;  4BHP A;  1OYI A;  1XN7 A;  1G6N A;  3D5L A;  3EDP A;  5FFZ A;  5E1Z B;  2HQR A;  5A2Q K;  1KGS A;  2G7H A;  3CUQ C;  2M30 A;  2R7D A;  1FX7 A;  3PQK A;  1RIO H;  4BQA A;  4XLN F;  5L3D A;  4LK1 F;  2AXL A;  1B6A A;  4FHT A;  2IW5 A;  1IXR C;  3WTZ A;  4WWC A;  2Q2E A;  1IXC A;  1BI3 A;  4IRH A;  3TO9 A;  5TJJ A;  2HKO A;  2FF4 A;  3LWF A;  1QO0 D;  5FO5 A;  2Z5U A;  1UHW A;  4OOI A;  4IRI A;  3RKY A;  2M1B A;  5CVU A;  1XGS A;  1SD4 A;  5K1Y A;  1TBX A;  3TDU C;  1KU7 A;  1KQ9 A;  2QUF A;  1TW3 A;  1ZRD A;  1IZ1 A;  4MQV A;  2K86 A;  4UV9 A;  4OMZ A;  3O3K A;  1WQ2 A;  3F23 A;  2XRO A;  3JW4 A;  5DCM B;  1J9I A;  3HSR A;  1YIO A;  3K1P A;  5DCM A;  2NS0 A;  3J81 Z;  4IVN A;  2GA1 A;  2FNP A;  2NNY A;  2CW0 F;  4ESB A;  2DK5 A;  2JPB A;  4M73 A;  5E20 A;  3F8F A;  1ZHF A;  2NNN A;  3MCZ A;  5L3B A;  1XDU A;  3BY6 A;  2KIF A;  1FBU A;  1OMI A;  4UVC A;  1IN8 A;  3GZ5 A;  4U0V A;  4LB6 B;  1SFX A;  1FWZ A;  2JTV A;  3R4K A;  1BIA A;  2XAS A;  4M74 A;  2A3S A;  3QPH A;  3EUH A;  3N4M A;  1GVJ A;  3GO5 A;  3KEO A;  1L0O C;  4ZYE A;  4FT8 A;  4RGS A;  2V79 A;  4AWX B;  3HOS A;  3JTH A;  4FX4 A;  2QLZ A;  2KRF A;  5HS7 A;  1C0W A;  1TW2 A;  2E7W A;  4KMF A;  2P8T A;  2XAG A;  5KK1 A;  1DP7 P;  1XGN A;  3F22 A;  3F3X A;  3BWG A;  2IA1 A;  1ZLJ A;  3B73 A;  2IVM A;  2DQL A;  1V3F A;  4M71 A;  4HQE A;  1J59 A;  4BNC A;  4RAZ A;  1U5T C;  3IKT A;  1EH8 A;  4U7B A;  3JAM K;  5EEH A;  3RPU A;  4IHT A;  1P6R A;  3GLX A;  4CHU A;  1W4M A;  3BJA A;  4ON0 A;  4RB1 A;  2J5O A;  3DV8 A;  2EFN A;  3E97 A;  1YTY A;  2BEO A;  4HX8 A;  3I54 A;  2VON A;  4LLL A;  5J6X A;  4HX4 A;  5FD6 A;  1EH7 A;  3LA7 A;  4QLC U;  1UFM A;  3L09 A;  4HLY A;  1K7A A;  2EB7 A;  5AON A;  5J8C A;  3WE3 A;  4WXD A;  2P5V A;  2GAU A;  2DTR A;  2XV4 S;  3E6M A;  3WGH A;  1FZP B;  2O6G E;  2VT3 A;  1H0M A;  1BC8 C;  3F6V A;  1JGS A;  3DQV C;  2L02 A;  2H6B A;  5D6F A;  3LFK A;  4LGW A;  1IRF A;  4WCG A;  3WU0 A;  2RKH A;  1PP7 U;  2STT A;  4U0Y A;  3TO6 A;  2W85 A;  3EQL F;  1LB2 A;  4HV6 A;  2DI3 A;  3M1E A;  3QAH A;  1T38 A;  2LKP A;  1G3Y A;  4Q47 A;  1IXS B;  4I01 A;  4H0E A;  4HF0 A;  2BYV E;  1FSH A;  3E6C C;  3F8B A;  1K78 B;  1LDJ A;  3RKW A;  4HZF A;  3HSE A;  5JVT A;  2XAF A;  3F72 A;  3L9F A;  2EV6 A;  5CJ9 A;  3ZN0 A;  3NRV A;  1K78 A;  4UVA A;  1D3Y A;  4NB5 A;  2ISZ A;  2Y75 A;  4XBF A;  4NQW A;  5BS6 A;  4LK0 F;  3DP7 A;  4WX9 A;  1A04 A;  4G6Q A;  3E5Q A;  2K4J A;  3ZMZ A;  3NQO A;  3HHG A;  2NAZ A;  3CO7 C;  2MC3 A;  2IPQ X;  1XSD A;  4MGR A;  4HAM A;  3ZQ7 A;  1OKR A;  3K0L A;  3KP5 A;  1RI7 A;  2KJC A;  3C1D A;  1WRJ A;  2A61 A;  1ZRE A;  3OV8 A;  4A6E A;  4EM2 A;  1KQ8 A;  2FU4 A;  3QU6 A;  3P9I A;  2V1U A;  1LDD A;  2JPC A;  4I7H A;  1U78 A;  2ZCW A;  3WTS C;  3T5X A;  1ZLK A;  3CUQ B;  1D8K A;  2PI0 A;  3ECO A;  4U0W A;  4DNC A;  2E7X A;  4S04 A;  3V7C A;  2XVC A;  2MLG A;  5JFR A;  3GFJ A;  1SFU A;  3KP7 A;  3G3Z A;  2FML A;  2DQR A;  1P4W A;  1X3U A;  2DT5 A;  2C6Y A;  3WTV C;  2ESN A;  5D5V B;  2BGC A;  2D45 A;  1D8J A;  1DPR A;  2G7U A;  2WWY A;  4G9Y A;  1B9N A;  4JK1 X;  1B4A A;  2ZNY A;  4UNO A;  1Z9C A;  1XCV A;  1S3J A;  5J8F A;  4EGZ A;  5ILV A;  3BOQ A;  1SD5 A;  5D5X B;  1TQM A;  5ICC A;  2L3D A;  3V8L A;  3K9T A;  5E1W A;  4PGG A;  4ESJ A;  5HLH A;  3WGI A;  5LGT A;  3I59 B;  1R23 A;  2HQN A;  1R5G A;  2L4M A;  3SXY A;  4XLP F;  1KU9 A;  4FX0 A;  4RGR A;  3KP3 A;  4GYG A;  2A5Y B;  3M8E A;  3I59 A;  1Z91 A;  5HLG A;  3DEU A;  1YW9 A;  2YSR A;  4BH9 A;  4ENJ A;  2GIV A;  2PJP A;  1S29 A;  1S8N A;  3I5U A;  3I0T A;  3ZMV A;  1I1G A;  2W25 A;  1UCR A;  2FMY A;  2FXA A;  3QP5 A;  4MQ9 F;  2P6S A;  5DUI A;  4YIF A;  3HRU A;  5FFX A;  3CDH A;  3GZ6 A;  2FBH A;  4U88 A;  3C7J A;  1QGP A;  3WTW C;  2E1N A;  4LD5 A;  3I71 A;  1KU3 A;  4AD9 A;  5DCF A;  1BN5 A;  3V7R A;  1RUN A;  3CO6 C;  3ZPL A;  4KN4 X;  2BE5 F;  2FNA A;  3J81 K;  3FXR A;  3D0S A;  2RN7 A;  2Z9O A;  5LEJ A;  1FBS A;  1LVA A;  1ZGA A;  3JTG A;  4LLN A;  2NYX A;  3B02 A;  1U5T B;  2Q8K A;  2DO7 A;  1IUY A;  5DEQ A;  2A6H F;  4A6D A;  2EA4 A;  1U5T A;  2HTS A;  1RUO A;  4P9F A;  3SHF A;  4Z2Y A;  3LAP A;  2F5D A;  1XSX A;  3MEX A;  3LQQ A;  2Y0M A;  5CVI A;  1KYW A;  3FX3 A;  1W5S A;  4EM0 B;  1T6S A;  4S05 A;  2KIU A;  2LF8 A;  3HOT A;  4RB0 A;  1FPQ A;  3ZMD A;  4HV5 A;  1T0F A;  1O3T A;  4EV0 A;  4HF1 A;  2XGX A;  4BAY A;  1PUE E;  4Q4Z F;  1R1V A;  2IA0 A;  2JSC A;  3GF2 A;  2WV0 A;  4L5I A;  1LNW A;  1F1Z A;  4ZYG A;  4B8X A;  3K69 A;  1B1B A;  3S2W A;  3T0Y A;  3U2R A;  3G73 A;  1YG2 A;  3H3U A;  2DBB A;  4UUV A;  2BV6 A;  3U9G A;  2F5E A;  4L9T A;  2QEN A;  1HQC A;  5FGM A;  6PAX A;  1FOK A;  2H09 A;  1OYW A;  3P9C A;  3RYR A;  2A68 F;  1WSU A;  1U3E M;  5EEG A;  2EFQ A;  2EA2 A;  2QQA A;  4M6Y A;  3VOD A;  1W5T A;  2HKX A;  3FZV A;  2DAO A;  4KA4 A;  2V9V A;  2XAH A;  5HDN A;  4HLX A;  2O3F A;  3K1M A;  2IT0 A;  3HHH A;  2EFO A;  2FBK A;  3E5X A;  3I64 A;  4UXN A;  5L3F A;  2COM A;  4MEY F;  5D6E A;  1F4K A;  4E70 A;  1NHA A;  1VTN C;  5K5R A;  5ILU A;  3VOE A;  4ENM A;  2Y48 A;  4EGY A;  4I2O A;  2GXB A;  2EWN A;  4RS8 A;  1F9N A;  2IA2 A;  3JSP A;  3V8J A;  4WXC A;  3VEP A;  4JBA A;  1Z1D A;  3MWM A;  3P7N A;  2ZFW A;  1H9G A;  1FT9 A;  3CTA A;  4GO1 A;  1YW8 A;  4A0Y A;  4Y17 A;  1O3Q A;  2GQQ A;  4RGX A;  1MGT A;  2DW4 A;  4KIF A;  3TDZ C;  2W24 A;  3SQN A;  3FXQ A;  1SMT A;  3V7S A;  2XHK A;  1P92 A;  1YO5 C;  3R60 A;  1UHM A;  1GXP A;  2HEO A;  4EMS A;  5LHI A;  4F7Z A;  3NEU A;  2VOD A;  4R79 A;  3IRQ A;  2PFB A;  4ENN A;  1MD0 A;  4CZZ A;  5AIQ A;  2A69 F;  1ZAR A;  1BC7 C;  3M9A A;  2JT1 A;  4IRG A;  2KJB A;  1ON1 A;  2GWR A;  3GWZ A;  3L7W A;  3E6B A;  5HS9 A;  2F5F A;  1Z7U A;  1ZG3 A;  1IAW A;  3HRS A;  2IJL A;  2QZ8 A;  3TQN A;  2STW A;  4CXF A;  5FLX Z;  3W6K B;  3HRT A;  2DLL A;  1E2X A;  1SAX A;  2D1H A;  2GA2 A;  4AIK A;  2P4W A;  1WWX A;  3LST A;  2DPU A;  1O57 A;  1SFE A;  4EJO A;  4JQF A;  1H9T A;  3I53 A;  2YR2 A;  3R0J A;  2P5K A;  2RVC A;  2H6C A;  3MZH A;  3L00 A;  1U2W A;  1YYV A;  1ON2 A;  3MAJ A;  4PCQ A;  3O2P E;  1W7P D;  5LGN A;  3WU1 B;  1O7F A;  3RIR A;  1TLH B;  1BIB A;  2CSO A;  4D0P A;  2ETH A;  2W84 A;  4HBL A;  1CGP A;  2O0Y A;  5CVJ A;  3IHU A;  4KMU X;  4Y15 A;  4P5O A;  4EJW A;  1D5V A;  2XIG A;  4UV8 A;  2FSW A;  4R1H A;  4P9U A;  3ISP A;  2VN2 A;  1E17 A;  3AAF A;  1HW2 A;  1IN4 A;  4DQ2 A;  4ZYH A;  1JHH A;  2V6C A;  3C18 A;  4YFX F;  3KE2 A;  1PP8 F;  4I0A A;  1MKM A;  2MBF A;  4CIC A;  2UXX A;  5JHU A;  1J2X A;  3I4P A;  3ZP5 A;  3ECH A;  1R22 A;  3DF8 A;  5DDG A;  3OOP A;  2A6E F;  3Q9S A;  5CYV A;  2HOE A;  4XSX F;  1ZAO A;  4IPA A;  4A5N A;  1TNS A;  4G94 A;  4M6X A;  4EJT A;  2TDX A;  3GEZ A;  1DPU A;  5BMZ A;  2EV5 A;  2QQB A;  4IF4 A;  4YFK F;  1HKT A;  4LG0 B;  5ED4 A;  1R00 A;  2BBY A;  2MD5 A;  3M8F A;  2EK5 A;  5E17 F;  3HUG A;  3WG9 A;  4LG0 A;  3WGG A;  5D8L B;  4A0X A;  1HSJ A;  5LGU A;  3GVA A;  5FD5 A;  2WTE A;  2HTJ A;  1LQ1 A;  3J80 Z;  1HXD A;  2O03 A;  1O7L A;  2R3S A;  1SMY F;  3CUQ A;  4GCV A;  2PQ8 A;  3QRF F;  2XAJ A;  5ICE A;  5LHG A;  4HDV A;  1ZG5 A;  3CUO A;  3KLO A;  3LA3 A;  4GGG A;  4G6D A;  5D4R A;  1I1S A;  2VBZ A;  1ULY A;  2RC4 A;  2NRA C;  3TOA A;  1JXS A;  3FF5 A;  5AIP A;  1YFH A;  1ZG1 A;  4M9Z A;  2VT2 A;  4G7Z F;  4ENK A;  5TRD A;  1FC3 A;  1FNN A;  5E8I A;  2HWV A;  2R7F A;  2ZO4 A;  2X0L A;  5LBQ A;  4KFC A;  2OQR A;  3LA2 A;  3F21 A;  5F1R A;  1TTY A;  5FB2 A;  1P4A A;  2O61 A;  4O5V A;  1XMK A;  1TNT A;  3KEQ A;  3F8M A;  4LFU A;  1YS7 A;  2MH2 A;  1JE8 A;  1WKM A;  4CGZ A;  4I98 B;  3EET A;  1R36 A;  1KQ0 A;  4KIB A;  3WTY C;  2AS5 F;  1O3R A;  3SZT A;  3H92 A;  4MHG A;  3BPV A;  4OU0 A;  2H27 A;  2M45 A;  2HYG D;  3DXJ F;  2W57 A;  5CVV A;  4EVI A;  4YG2 F;  3K2Z A;  1K6O A;  1AWC A;  4ASN A;  2P7C B;  4OIN F;  1P2F A;  1UB9 A;  3GFL A;  1LDK B;  3BRO A;  2PMU A;  2VC1 A;  1R1U A;  2Z33 A;  5CLS A;  1FYM A;  1BJA A;  2HR3 A;  2QQ9 A;  1P4X A;  4R8H A;  2M87 A;  4UVB A;  2WC2 A;  1KA8 A;  5H6Q A;  1J0R A;  1XDS A;  1XSV A;  4G7O F;  5DYM A;  3TO7 A;  1MZB A;  2L01 A;  1Q1H A;  4HYE A;  4ZZD A;  1Z6R A;  3PQJ A;  1T39 A;  2OU2 A;  3ML6 A;  3GW2 A;  3ZN1 A;  4KT5 C;  3BDD A;  1BOA A;  2MA3 A;  2ESH A;  4KUM A;  4HOB A;  1WI9 A;  4HX7 A;  4EJU A;  2ZME B;  3SFZ A;  5ICG A;  3LAJ A;  3TKY A;  2YU3 A;  4HW0 A;  5L3C A;  1BBY A;  3IWF A;  2ZME A;  4EM1 A;  5HDG A;  2CFX A;  3V4G A;  1F5T A;  3KZZ A;  4OMY A;  2HDC A;  1QNT A;  1YS6 A;  5DD4 A;  4AIJ A;  1DUX C;  1R7J A;  3ZMT A;  3JSO A;  2CQK A;  4WXH A;  4RB3 C;  2JZY A;  3L2C A; 
#chains in the Genus database with same CATH topology
 3BG5 A;  4L0Z B;  2ZXJ A;  3SJM A;  4HST A;  4BJ6 C;  1ZYR F;  1U8R A;  3DBL B;  2X4H A;  3CC7 I;  4KIT B;  4XRM A;  1D0Z A;  5E18 F;  4I09 A;  2DCE A;  3VPR A;  2L7Z A;  1Z6T A;  2PLY A;  4KIC A;  4BHB A;  1WH5 A;  3FM5 A;  5FLX K;  4E4H A;  4ZYD A;  4KIG A;  3CC2 I;  3PFI A;  4A69 C;  2HQ5 A;  2KQR A;  1MDM B;  1HKS A;  2OA4 A;  1IW7 F;  2H8R A;  4DYR A;  2FBI A;  4B09 A;  1O4X A;  1AU7 A;  2DPD A;  2V1D A;  3H3Z A;  1YLF A;  3KP4 A;  2W4S A;  1G4D A;  3E3V A;  4Q5S F;  1XX5 A;  2V1X A;  3QU3 A;  4K2E A;  1MDM A;  1TP4 A;  2QKM B;  2K4B A;  3PM1 A;  2OZU A;  2ZXI A;  3D5S C;  2F5C A;  2EZL A;  3IL2 A;  1STZ A;  2ZBK A;  5LRR A;  3FHN A;  3WTX C;  2RNJ A;  2CUE A;  2RQP A;  4LLG F;  2GZW A;  1H8A C;  4CCM A;  1APL C;  3MZY A;  3LOC A;  4HNT A;  2P81 A;  3BJ6 A;  2PBI A;  3QPT A;  1OR7 A;  2LSO A;  2OZ6 A;  2XGE A;  4CO8 A;  1W0U A;  1JKR C;  3BTJ A;  3OYF A;  2RV8 A;  4LOC A;  2JUC A;  3PUF A;  1ETK A;  5DD8 A;  5IT9 Z;  3EUA A;  1OIS A;  3I58 A;  4KYW A;  2EIK H;  4PZJ A;  3AFH A;  1MBJ A;  1YW7 A;  3HB9 A;  3P5J A;  4HQM A;  4CYC B;  5H20 A;  4EQQ A;  3OOU A;  3KCC A;  2O8K A;  4PSW A;  2VQL A;  3WTU C;  4ZJZ A;  4OIQ F;  4F52 A;  2Y69 H;  1BW6 A;  5ICF A;  4FE4 A;  2QCO A;  2KIM A;  1HW1 A;  1ZN2 A;  4NUB A;  5E8G A;  1I5Z A;  2GXG A;  3CP8 A;  3T8R A;  4CYC A;  2V6E A;  3J7Y J;  3COA C;  5L3E A;  4TV7 A;  4RAF A;  3K4L A;  3FIS A;  2RNG A;  5IYD J;  3RTR A;  4RGU A;  3VWB A;  3CJT B;  4IHV A;  2LG4 A;  1OCP A;  4L9J A;  1QBJ A;  2P0W A;  2YU9 J;  2XUB A;  2OJE D;  3R6S A;  3H0D A;  1J7K A;  1S5L C;  3M7G A;  1CF7 B;  2KHM A;  2LDU A;  2PX9 A;  4G8X A;  5M5Y J;  9ANT A;  2VJ4 A;  4A3J J;  3KPH A;  3NWS A;  3VFZ A;  3WHB A;  2M8E A;  2DT6 A;  2LP0 A;  2CV0 A;  2IS4 A;  1MMG A;  2IP2 A;  4GYI A;  2CYY A;  1CF7 A;  4KIS A;  5J1U A;  5LD2 C;  2XRN A;  3ABU A;  4V19 K;  2W48 A;  2VBY A;  2CWE A;  4C2U A;  4XRF A;  4BUP A;  3K6G A;  3E6D A;  2EFP A;  3IWZ A;  2A07 F;  4BY7 J;  2CUF A;  1AOY A;  2QBY B;  2ZNZ A;  4BYY A;  4C3I J;  2ZKZ A;  3JCU C;  1USS A;  1BI0 A;  4XLH A;  1HW5 A;  3O6B B;  4FQG A;  1K4T A;  4HPQ A;  3HDD A;  3CD6 I;  1X1B A;  1XG1 A;  2QBY A;  4Q48 A;  2PN6 A;  1TT5 B;  5LHH A;  2P6T A;  3REO A;  5BQT A;  3P9K A;  1YX5 A;  1XD7 A;  1I6X A;  5M3F J;  4UHT A;  1VQ4 I;  1UST A;  5M5X J;  3JRA A;  3E7L A;  2X6Y A;  3RPU D;  4E7I A;  1LEB A;  4YEJ A;  2M7A A;  2J5P A;  1YIJ I;  2RGV A;  3V8K A;  3BZ6 A;  4XON A;  2KRH A;  1EKE A;  3DCF A;  3IC7 A;  3FHZ A;  3PNV A;  1FY7 A;  4O6J A;  4OIP F;  3H3V K;  3HIF A;  2NVY J;  1X4P A;  1MH4 A;  4L9V A;  1MJB A;  2LKX A;  2ADU A;  4X1E A;  1ZRF A;  1S6L A;  3F9K A;  1R4N B;  3ULQ B;  1A35 A;  3A01 B;  1ZGJ A;  2DDB A;  1BA5 A;  3QPS A;  2OAZ A;  3OIQ A;  3SEQ A;  4BHC A;  1I27 A;  3N97 A;  2A6T A;  3KYC B;  3HTU A;  3TW7 A;  1QPI A;  3S8P A;  5E3L A;  1XMA A;  2VLA A;  2EJR A;  3H9G A;  3A01 A;  1RR7 A;  2QKL B;  3D1N I;  1SVM A;  1IF1 A;  1VZ0 A;  2EQR A;  3F8N A;  2UZK A;  3FXM A;  4OIO F;  3ZQF A;  4CCJ A;  1BI1 A;  1HST A;  3GYH X;  2M5W A;  1XC5 A;  5A2Q Z;  1ZK8 A;  4A0Z A;  3RZO J;  4XSZ F;  5JHF A;  2UXN A;  2FA5 A;  2LF7 A;  4QWQ A;  1Y0U A;  1TWH J;  3DFG A;  3BR6 A;  1W36 C;  2DK8 A;  3J80 K;  4N4N B;  5IOZ A;  2LNB A;  2HXI A;  3MKW B;  3BG3 A;  2O8X A;  3LSK A;  1DU6 A;  5HS8 A;  2E35 A;  4FET A;  4GXO A;  4BBS J;  2G9W A;  3K4K A;  3FWE A;  3ELK A;  1WGX A;  5J1Y A;  5FRO A;  3MFK A;  5ERI A;  4PDK A;  3ZMS A;  2K02 A;  3QYF A;  1XGO A;  1S7A A;  4AVZ A;  5KAF C;  1PUF A;  2YPR A;  4HEA 2;  2ELJ A;  2KPM A;  3S93 A;  5JR3 A;  4XMY A;  1SFO J;  2P7V B;  3PSI A;  1IN7 A;  2FE3 A;  1REP C;  4A3I J;  4O3M A;  3BC8 A;  1JHF A;  4IHS A;  1FLI A;  3KYL A;  1T2K A;  1JT6 A;  2CG4 A;  4LB5 A;  3GXO A;  1RZ4 A;  1T0F C;  2DMU A;  2DA4 A;  1VQN I;  4CYD A;  1OPC A;  1K4S A;  1D1A A;  3MZ8 A;  4Y13 A;  1S7O A;  1I3A A;  5IPA A;  1FSE A;  1K79 A;  2LVS A;  4YFN F;  3TGN A;  2DU9 A;  2H94 A;  3HXL A;  3TP0 A;  2B0L A;  1B9M A;  5JI6 A;  2EFW A;  3CCV I;  1B8I B;  1R6R A;  1ZH5 A;  2LD5 A;  4KN7 X;  2HFH A;  4IZZ A;  1MBH A;  3DPT A;  4OAY A;  2IAI A;  2DFI A;  4C9Y A;  3ABT A;  3AG3 H;  3CLO A;  2HNH A;  2PMZ A;  3ZR8 X;  1R1T A;  1B8I A;  5E3M A;  3FXU A;  4PJN A;  2QM3 A;  3HOZ J;  3E5U A;  2CGP A;  1W7P B;  1RRJ A;  5HDK A;  1GXQ A;  4IX7 A;  1R5H A;  1GV2 A;  3HTS B;  2JA8 J;  2LY2 A;  3HYI A;  3L2U A;  1JTX A;  1UG2 A;  4RM2 A;  1VQO I;  4BU2 A;  3KP6 A;  5LLQ A;  1W7P A;  5HLI A;  3DPL C;  1YJN I;  2FEZ A;  3BLY A;  2L4A A;  2P5L C;  1HKQ A;  4XK4 A;  1ZR2 A;  1N77 A;  2BXY A;  3S1R J;  1FTZ A;  4L5J A;  2FOK A;  2RRE A;  3FXJ A;  1MIJ A;  1L3L A;  2VKD A;  1FOW A;  5ILS A;  4M72 A;  4HF2 A;  2DFH A;  1XGM A;  4FE7 A;  2D1V A;  1U6G A;  2JN6 A;  2CJJ A;  5F64 A;  2MD0 A;  5C4J J;  3CCY A;  1P7J A;  2FQ3 A;  2XAQ A;  1RNL A;  2E34 A;  3ABM H;  1SFK A;  3RSN A;  3KEY A;  1PDN C;  4KDP A;  2R7Z J;  2HOT A;  2YX7 A;  4RB2 C;  3RKX A;  3GZN B;  4LIT A;  4J01 A;  1X19 A;  4LJZ F;  5DUK A;  4ZTF A;  2VBX A;  1O3S A;  3E1S A;  3DLA A;  4E7H A;  2M4K A;  1RR8 C;  2QWW A;  3F8C A;  1DP3 A;  2D2W A;  2EV0 A;  1MJA A;  3LSM A;  4OIR F;  2X1C A;  5EJC A;  4WF2 A;  3KET A;  2XRL A;  2PEX A;  4MTD A;  2RDP A;  3VYT B;  3BR1 A;  2VKH A;  4QTR A;  1G3W A;  2KDZ A;  2MLK A;  2Q0O A;  5E79 C;  1JKQ C;  4KNY A;  3C3W A;  4N9I A;  2XB5 A;  4CCK A;  1ONV A;  5K7Z A;  3WG7 H;  4U7D A;  1LJ9 A;  1QVU A;  3RI4 A;  3RJP A;  4ZTJ A;  1OCC H;  1Y1W J;  2HGC A;  3R0A A;  3PNY A;  1FBQ A;  1T08 B;  1Z77 A;  2WAF A;  2XF7 A;  4ZH4 F;  1G8X A;  4GRI A;  1S7E A;  2HYF A;  2HOS A;  5D4S A;  2CH0 A;  3GUD A;  3HOX J;  3LSG A;  5TIS C;  5L3G A;  4L18 B;  2FRH A;  2R92 J;  1ETO A;  4BQQ A;  5LRS A;  3JAM Z;  2BVL A;  1IG7 A;  2MH9 A;  3KZY A;  5FLM J;  2VOO A;  1IN5 A;  1XPX A;  2E1O A;  1ETY A;  2AXT C;  2X48 A;  2DDA A;  3DKW A;  2ZFU A;  2DOA A;  4BY1 J;  2L7F P;  3FM3 A;  4NHJ A;  1NG6 A;  2JRM A;  1T33 A;  3CDI A;  3KFW X;  2QYO A;  2E1C A;  4NNJ A;  1EH6 A;  3U1K A;  2K27 A;  5D5W B;  4PJJ A;  2EIL H;  2WY8 Q;  4N4O B;  1VQ9 I;  4NBQ A;  3K1N A;  3U1D A;  3ZQH A;  3OYJ A;  3ERE D;  3BJO A;  2JRT A;  1BM9 A;  4L9N A;  2ME6 A;  2QSG X;  1QPM A;  3S1M J;  2XKP A;  2L54 A;  1WFX A;  3T8T A;  4G7H F;  5KVR A;  3ROU A;  3H36 A;  1YRN B;  1DGR M;  4ETS A;  1OCO H;  1DQU A;  3B6C A;  3DU5 A;  4ZZL A;  3S2D J;  2OD5 A;  2VE8 A;  2BHY A;  4I02 A;  3QYE A;  3WOD F;  3ZMU A;  3OYI A;  4BDY A;  2XGD A;  3AG1 H;  4XRS A;  1R5I D;  1ZTR A;  2JK3 A;  3WE2 A;  3AL0 C;  4BJ5 C;  2VC0 A;  4CDG A;  3LSR A;  2Z3Y A;  5BPI A;  1MBG A;  1FP1 D;  2L7M P;  1FYK A;  3LQR A;  1WJ5 A;  5J4V A;  1IUF A;  4PGH A;  1QZY A;  4YII A;  4ABZ A;  2YX4 A;  3CCJ I;  5J40 A;  4PJM A;  1OYY A;  4JX6 A;  5J4Y A;  4N0B A;  2IRF G;  1R58 A;  3EYY A;  2PMH A;  4LMY A;  1YOV B;  4IJA A;  2OV7 A;  2M4G A;  4EJV A;  2QVO A;  3BQY A;  4IXA A;  2L2O A;  3FMR A;  4D1Q A;  1IN6 A;  2VXZ A;  3QOP A;  4XKC A;  3S32 A;  3RYP A;  2XDV A;  4N9H A;  4HDU A;  4MTE A;  2BZT A;  2VE9 A;  1SD7 A;  4Y3O A;  3BPX A;  5GPC A;  1VQ5 I;  2LY1 A;  1GHC A;  3GTG J;  2I8D A;  1YI2 I;  4M3F A;  1E3O C;  5D8K B;  4M3B A;  1XCB A;  2M9H A;  1KYZ A;  2ISY A;  1K61 A;  3GFI A;  1J75 A;  1SD6 A;  4XN3 A;  4WK8 F;  3OYC A;  1ZRC A;  3W2V A;  1F36 A;  5HVQ C;  2LRE A;  4HA8 A;  1IRX A;  2DMT A;  3QWL A;  2LLK A;  4L0Y B;  3K4J A;  1B59 A;  4ZDO A;  2X6X A;  4DYQ A;  3GFM A;  4BEH B;  1GUU A;  1Z0X A;  3R61 A;  2W7N A;  1HBX G;  3FMQ A;  1IDY A;  5E1X A;  3A03 A;  2MSY A;  2CO5 A;  2VBW A;  3Q9V A;  5F0F A;  3GX4 X;  3EYI A;  2BW3 B;  3Q5F A;  1KON A;  3HPG A;  3F6O A;  4I0B A;  5KAI C;  4BEH A;  1BI2 A;  3PIP F;  1YQA A;  2OCC H;  4BJT A;  2E36 A;  1EV7 A;  4DW6 A;  3JRB A;  2K7L A;  3RPQ A;  3UKG A;  1V4R A;  3RDI A;  2BW3 A;  2DYR H;  4LG3 A;  4AVP A;  1KU2 A;  1POG A;  2K3P A;  3BCA A;  1TZL A;  1Z05 A;  2ELH A;  3TOB A;  3OSG A;  5IT9 K;  4U87 A;  2VJJ A;  1ODD A;  3FMS A;  3LSH A;  1VQM I;  4M6V A;  1A31 A;  2PG4 A;  2ZJ2 A;  2HS5 A;  3SZG A;  5CVR A;  1FEX A;  3BR2 A;  3IRR A;  3SZP A;  2XKO A;  5E3N A;  3I56 I;  1ENH A;  3HZJ A;  4M9X A;  2L5Q A;  3HEF A;  2VOP A;  4DYC A;  2HOA A;  3DTE A;  5KCM A;  1OCZ H;  4CSW A;  2NOJ B;  1TWA J;  1LVK A;  1DDN A;  4UY8 I;  2Z99 A;  2UWM A;  2Y2Z A;  2DFE A;  2WV1 A;  4P55 A;  3H5A A;  5BOX A;  3VB2 A;  2KKO A;  2BXZ A;  1TQP A;  5DV5 A;  2EBI A;  3W6J B;  1T98 A;  2KRC A;  3KLN A;  1FJL A;  1JKO C;  1R9T J;  4QPQ A;  1I39 A;  2CU7 A;  2OUM A;  3OYN A;  4RBO A;  3OIP A;  5LEK A;  1BR2 A;  4AIH A;  2YS9 A;  1J09 A;  1FYL A;  2JVG A;  4P96 A;  2HYJ A;  4A5M A;  5K5Q A;  2HZT A;  5D5U B;  2IS6 A;  1XB4 A;  1IV8 A;  5BPD A;  5F6F A;  3CF5 F;  3C2H A;  2CRG A;  5CQG A;  2OQG A;  3IKV A;  4RAY A;  4XKW A;  1QZZ A;  2ACJ A;  1J5Y A;  2KIQ A;  2KP6 A;  1LEA A;  1WJF A;  4A12 A;  1HDD C;  5B1B H;  3CJN A;  1MJ9 A;  2KT0 A;  2W1O A;  4A93 J;  2OBP A;  2K40 A;  3W2W A;  3MVP A;  5IT3 A;  3J7A O;  3G71 I;  2LBF B;  2DN0 A;  2M8G X;  2UV1 A;  1G3S A;  2R7X A;  3BZC A;  5K5O A;  3HL2 A;  2A5W A;  3V42 A;  3BP8 A;  3HRM A;  4MEX F;  4A2U A;  1G3T A;  3T1B A;  3ASN H;  5HOO A;  1FP2 A;  4M9S A;  2LBF A;  3CCU I;  3QP6 A;  2GOX B;  3KP2 A;  4BXU A;  2DJI A;  5CPR B;  1TQI A;  1HCR A;  1IRG A;  4ESF A;  1QQI A;  5H6R A;  1U9O A;  3HSF A;  2L9V A;  2F2E A;  3MQ0 A;  3U21 A;  3WTT C;  1RES A;  4MNU A;  4BHP A;  3DU6 A;  4B48 A;  3A0B C;  5BNG A;  1OYI A;  1XN7 A;  1OJL A;  1G6N A;  3D5L A;  4IO9 F;  3HOY J;  3GTJ J;  4IQJ A;  3EDP A;  3MN2 A;  1E3P A;  2E5Z A;  3G1O A;  5FFZ A;  5E1Z B;  2MYS A;  2HQR A;  3ESW B;  5A2Q K;  2Q2E B;  4F91 B;  1KGS A;  2G7H A;  3CUQ C;  2M30 A;  2R7D A;  2ZXH A;  1FX7 A;  4AID A;  3PQK A;  1RIO H;  4BQA A;  4IHY A;  4XLN F;  5L3D A;  4LK1 F;  2AXL A;  1B6A A;  4FHT A;  2IW5 A;  1IXR C;  3WTZ A;  3HOW J;  4WWC A;  2Q2E A;  1IXC A;  1BI3 A;  4IRH A;  5TGT A;  1A6I A;  3TO9 A;  5TJJ A;  2HKO A;  2FF4 A;  4NDL A;  3LWF A;  3SDB A;  1QO0 D;  5FO5 A;  5KNL A;  3JRG A;  2Z5U A;  3IH4 A;  2L7K A;  2MFZ A;  2N8G A;  2X1E A;  1UHW A;  1PYV A;  4OOI A;  4IRI A;  1CQT A;  1PVE A;  2QSF X;  3RKY A;  2K9M A;  2M1B A;  5CVU A;  4II3 A;  1XGS A;  1SD4 A;  5K1Y A;  2M2E A;  1TBX A;  1ERD A;  2VAS A;  2E19 A;  1UJ8 A;  3TDU C;  2HDD A;  1Y6I A;  1KU7 A;  1KQ9 A;  2QUF A;  2NVX J;  1TW3 A;  3GTO J;  1ZRD A;  3RCO A;  5CKT A;  4EEF G;  1IZ1 A;  3N05 A;  4MQV A;  2K86 A;  4UV9 A;  1TL8 A;  2RAE A;  3S3N A;  1LFP A;  4OMZ A;  4C3H J;  3O3K A;  4ZDL A;  5DTD A;  5GTI C;  4YRV A;  1SVO A;  3OYM A;  1WQ2 A;  1XS9 A;  3F23 A;  2JA5 J;  3O8G A;  2XRO A;  1I6H J;  2DA2 A;  3JW4 A;  4A3L J;  2VIX A;  5DCM B;  1J9I A;  3JRI A;  3IAS 2;  3VDX A;  4FTH A;  3HSR A;  1YIO A;  4M3G A;  4PK4 A;  2Q1Z B;  2L9R A;  2VXD A;  2LFB A;  5H2F C;  3K1P A;  5DCM A;  2NS0 A;  4CCO A;  5HNF A;  3J81 Z;  2QSH X;  4IVN A;  4XN0 A;  1RKT A;  1AHD P;  2GA1 A;  1D1B A;  2FNP A;  2NNY A;  3H1C A;  2CW0 F;  4X6A J;  4E6K G;  4ESB A;  2KIS A;  1VQL I;  2V26 A;  4F3Q A;  2DK5 A;  2JPB A;  4M73 A;  5E20 A;  3BG7 A;  3F8F A;  3M8J A;  1R71 A;  3PO2 J;  1ZHF A;  2NNN A;  1WZ2 A;  2O7O A;  1VQ6 I;  3MCZ A;  5L3B A;  1XDU A;  1MMN A;  3S15 J;  3BY6 A;  2DA5 A;  2KIF A;  3BQZ A;  1FBU A;  1OMI A;  3E0J B;  2ZSH B;  3Q0W A;  4UVC A;  3A4C A;  3M4O J;  1IN8 A;  2R93 J;  2IBD A;  3GZ5 A;  4U0V A;  3NWT A;  4LB6 B;  2F6C A;  1SFX A;  2IGK A;  1ITY A;  1X1C A;  1FWZ A;  2JTV A;  1U8B A;  3R4K A;  3CF2 A;  1BIA A;  2VJ5 A;  5FKK A;  3FBI B;  5FJ8 J;  2XAS A;  4IEJ A;  4M74 A;  2ID3 A;  4A3K J;  2X6O A;  2LY9 A;  2A3S A;  3QPH A;  3EUH A;  3N4M A;  2L0K A;  5K7H A;  3GLL A;  1GVJ A;  3Q0U A;  3GO5 A;  3KEO A;  4D5C A;  1L0O C;  4ZYE A;  1ETW A;  3BTL A;  2HPI A;  4FT8 A;  2V79 A;  4RGS A;  1GDT A;  4AWX B;  3HOS A;  3A2K A;  3JTH A;  4FX4 A;  3OR2 C;  4AUX A;  2QLZ A;  2KRF A;  5HS7 A;  1C0W A;  1TW2 A;  2E7W A;  2VPR A;  3OWT A;  3ZQC A;  4KMF A;  1QRY A;  2P8T A;  2XAG A;  3S1N J;  3AL0 B;  5KK1 A;  1DP7 P;  3CCL I;  1D0Y A;  3AG4 H;  2VPL A;  1XGN A;  5IP6 A;  1VQ7 I;  3F22 A;  3F3X A;  2R5Y B;  3QOE A;  5FLV A;  4RM3 A;  5HNH A;  4MFE A;  1OLT A;  3BWG A;  3TBI A;  2V4J C;  1G2H A;  2IA1 A;  1ZLJ A;  3B73 A;  5IYC J;  2IVM A;  5FKM A;  3TW6 A;  2DQL A;  1V3F A;  4M71 A;  4XL9 A;  2R5Y A;  2LK2 A;  2R5Z B;  4AU7 A;  4D9J A;  2CQQ A;  4HQE A;  1J59 A;  2E2J J;  4RAZ A;  1U5T C;  4G6T B;  4BNC A;  3IKT A;  1X3W B;  1EH8 A;  1HLV A;  3I4N J;  4U7B A;  3JAM K;  1SC7 A;  5EEH A;  3RPU A;  4IHT A;  1P6R A;  3BG6 A;  3GLX A;  4CHU A;  1W4M A;  3BJA A;  4ON0 A;  2ME0 A;  3SYT A;  4RB1 A;  3S1Q J;  2J5O A;  3DV8 A;  4CCL A;  3DWL E;  1NH3 A;  4B47 A;  2W00 A;  2EFN A;  3E97 A;  1JJ8 C;  3HOV J;  1YTY A;  2BEO A;  4HX8 A;  1IDZ A;  3I54 A;  2H1L A;  5B1A H;  2VON A;  4XRS G;  4LLL A;  4S0H B;  2CMP A;  3VYR B;  5J6X A;  4OWR B;  4HX4 A;  3CCS I;  5FD6 A;  1EH7 A;  3DBH B;  3K7A J;  4DBQ A;  3LA7 A;  4QLC U;  1UFM A;  3L09 A;  3LFU A;  4HLY A;  1K7A A;  4YIR X;  2EB7 A;  1K6Y A;  2KDO A;  2V9K A;  5AON A;  3ZRG A;  5J8C A;  3WE3 A;  3ERM A;  1JUM A;  1Y39 A;  1Y8R B;  1OCR H;  4WXD A;  5GAE J;  2P5V A;  1YJ9 I;  2GAU A;  2E71 A;  2DTR A;  2XV4 S;  3E6M A;  2IEK A;  3WGH A;  1FZP B;  2ZSI B;  2O6G E;  4BE2 A;  2VT3 A;  1H0M A;  1BC8 C;  3F6V A;  3IH3 A;  1P7I A;  1RET A;  4AM3 A;  3GCM A;  4XM3 A;  1JGS A;  3DQV C;  2L02 A;  2H6B A;  5D6F A;  3LFK A;  4DZP A;  2QGU A;  3CDL A;  1YJW I;  4LGW A;  3CMY A;  1IRF A;  2ELK A;  4WCG A;  2FUG 2;  1X4O A;  2RKH A;  3WU0 A;  2I5U A;  1PP7 U;  3CMM A;  2STT A;  4U0Y A;  1LPQ A;  2DJN A;  2AHQ A;  2JQ7 A;  3TO6 A;  5B3S H;  2W85 A;  4AC0 A;  3PIO F;  5FRN A;  3EQL F;  1LB2 A;  3CP2 A;  4Y33 A;  4XKB A;  3GTK J;  4HV6 A;  3TP3 A;  3M1C A;  2QEX I;  2Z2S B;  3PJR A;  2DI3 A;  3M1E A;  2E2I J;  4JX5 A;  2GLO A;  2XSD C;  5FKO A;  5FKL A;  3QAH A;  3NAR A;  1T38 A;  2LKP A;  1G3Y A;  3FDY A;  5GAH J;  1UHS A;  3ABK H;  4Q47 A;  1IXS B;  4I01 A;  4H0E A;  4HF0 A;  2BYV E;  4PFO A;  4D7N A;  2DT7 B;  4J00 A;  1FSH A;  3LMM A;  3EPZ A;  3E6C C;  1ZGW A;  3F8B A;  1OR7 C;  2DXI A;  1K78 B;  1LDJ A;  3RKW A;  2V9P A;  2GM4 A;  4HZF A;  2DFF A;  1ETX A;  3HSE A;  5JVT A;  3RKQ A;  2R7U A;  2PMZ N;  4B4C A;  2XAF A;  3F72 A;  4NQW B;  1E3H A;  2XC7 A;  3L9F A;  3LSI A;  2EV6 A;  3KZI C;  5CJ9 A;  3ZN0 A;  3BTC A;  3NRV A;  1K78 A;  3H5N A;  4RLF A;  1D3Y A;  4UVA A;  4UUS B;  5F0H A;  4NB5 A;  4E7J A;  2ISZ A;  2Y75 A;  4C30 A;  1AKH B;  4XBF A;  3J7Z I;  4NQW A;  2OTL I;  5BS6 A;  4LK0 F;  3DP7 A;  4WX9 A;  1A04 A;  2F4I A;  2XPW A;  4G6Q A;  2QA4 I;  2HVS A;  3E5Q A;  3ZGK A;  2K4J A;  2QQ8 A;  3ZMZ A;  4UUS A;  4IOC F;  3I3L A;  3NQO A;  1AKH A;  3HHG A;  2NAZ A;  3HOU J;  1X1A A;  1U0J A;  2AQF A;  2MC3 A;  3CO7 C;  3ZQI A;  2IPQ X;  1XSD A;  2M3A A;  4MGR A;  4HAM A;  3ZQ7 A;  3BT9 A;  1OKR A;  4HNU A;  2IS2 A;  3K0L A;  3OYL A;  5LFA A;  4Y4R A;  3KP5 A;  1RI7 A;  1T56 A;  2Y9Y A;  1LUJ B;  2KJC A;  3C1D A;  1WRJ A;  2A61 A;  4PJ0 C;  2HVR A;  1ZRE A;  4UUT A;  4X0G A;  1RKW A;  3OIO A;  2LRD A;  3OV8 A;  3RQ4 A;  4A6E A;  4BXX J;  4EM2 A;  1KQ8 A;  2CQN A;  1MMA A;  2FU4 A;  3QU6 A;  3JRE A;  3P9I A;  2F5V A;  3FBN B;  1LDD A;  2V1U A;  2JPC A;  4I7H A;  2KMU A;  1U78 A;  5CQE A;  4XID A;  2ZCW A;  3WTS C;  3FKJ A;  3T5X A;  3OY9 A;  1MNM C;  1ZLK A;  1BL0 A;  1QZE A;  3CUQ B;  1D8K A;  1EJ9 A;  2B9S A;  3HJE A;  3AG2 H;  2PI0 A;  3ECO A;  4U0W A;  4DNC A;  2E7X A;  5C44 J;  3V7C A;  4S04 A;  2XVC A;  2MLG A;  3S3O A;  1H89 C;  1BOB A;  5JFR A;  1X1P A;  4BQO A;  3GFJ A;  3OYD A;  1S9H A;  2X51 A;  1PJR A;  1SFU A;  3KP7 A;  3VYS B;  3G3Z A;  2FML A;  1YIT I;  2DQR A;  4PUS A;  1RPW A;  4XOT A;  1P4W A;  4IOA F;  3NAU A;  2MGQ A;  4HG2 A;  1X3U A;  2DT5 A;  2C6Y A;  4F92 B;  1WJE A;  3WTV C;  1YRN A;  2ESN A;  1I3Q J;  5D5V B;  2BGC A;  1OQY A;  2R7Q A;  3PFY A;  3W6V A;  2D45 A;  1IRZ A;  1D8J A;  1DPR A;  2G7U A;  2R7O A;  2WWY A;  2DA6 A;  3A02 A;  4XKV A;  4G9Y A;  5EZG A;  1WJB A;  1B9N A;  4I6Z A;  2K85 A;  4JK1 X;  1B4A A;  4CUG A;  2ZNY A;  4UNO A;  1Z9C A;  2COB A;  1IV6 A;  1XCV A;  1S3J A;  2DOD A;  5J8F A;  3H0G J;  4E7Z A;  4EGZ A;  4XOR A;  3HBL A;  5ILV A;  5B66 C;  1S72 I;  4HNV A;  4B3A A;  2NVQ J;  3BOQ A;  4NC8 A;  1JUP A;  1SD5 A;  4ZDP A;  2NOG A;  5D5X B;  3FXO A;  4IL6 C;  1TQM A;  3FK6 A;  5ICC A;  2ID6 A;  5IP7 J;  4FCY A;  4E7S A;  2L3D A;  3MD2 A;  3V8L A;  2B63 J;  3K9T A;  5E1W A;  3HPH A;  3I55 I;  4PGG A;  4ESJ A;  5HLH A;  3SFI A;  2WAQ A;  2LH9 A;  4IQ4 A;  3WGI A;  5LGT A;  2HQA A;  2RQQ A;  5FKN A;  1JJ6 C;  2K9L A;  4BBR J;  1HOM A;  3I59 B;  4XLC A;  2R7W A;  1R23 A;  2DOE A;  2R4G A;  3VSL A;  2HQN A;  1R5G A;  2L4M A;  3SXY A;  4XLP F;  1N75 A;  1KU9 A;  4FX0 A;  4RGR A;  3KP3 A;  4GYG A;  2A5Y B;  3M8E A;  2BHZ A;  1Z91 A;  3I59 A;  2VKE A;  5HLG A;  3DEU A;  1RC9 A;  1YW9 A;  3M3Y J;  2YSR A;  3OL3 A;  3M07 A;  4BH9 A;  2BY2 A;  4ENJ A;  2GIV A;  2PJP A;  3GTM J;  2DYS H;  2XPU A;  5DM6 F;  1S29 A;  1V55 H;  1S8N A;  3MKL A;  3I5U A;  1EA3 A;  3I0T A;  1MBK A;  5EGO B;  3LSP A;  1WCM J;  3S2H J;  3A0H C;  3ZMV A;  1I1G A;  2VUM J;  2W25 A;  3H9J A;  1UCR A;  1TT0 A;  4IHX A;  2FMY A;  2FXA A;  3QP5 A;  4MQ9 F;  2P6S A;  5DUI A;  2I10 A;  5EGO A;  4YIF A;  3HRU A;  5FFX A;  3CDH A;  3GZ6 A;  2FBH A;  2IGN A;  4U88 A;  4I76 A;  2WAQ N;  3C7J A;  1QGP A;  3WTW C;  4BDZ A;  2E1N A;  4LD5 A;  4F55 A;  3I71 A;  1KU3 A;  4PFP A;  3OYG A;  4AD9 A;  5DCF A;  2KZG A;  2H8W A;  1ORK A;  4B44 A;  3RQI A;  1BN5 A;  3V7R A;  1RUN A;  1VQ8 I;  2VI6 A;  3CO6 C;  3ZPL A;  4KN4 X;  4MIM A;  1Z67 A;  2ZJQ F;  2BE5 F;  3K2A A;  2FNA A;  3J81 K;  3FXR A;  3GME A;  3D0S A;  3IH2 A;  2RN7 A;  2Z9O A;  4JP0 A;  1MSE C;  5LEJ A;  1FBS A;  1MW7 A;  2K9Q A;  5M3M J;  2GBY A;  1LVA A;  3IUO A;  1ZGA A;  4BL0 B;  4OAZ A;  3JTG A;  2R7S A;  1VI0 A;  2NYX A;  3B02 A;  4LLN A;  1U5T B;  4L5E A;  2Q8K A;  5GAD J;  2DO7 A;  3S14 J;  1IUY A;  2JWT A;  4H4K C;  2BY3 A;  2ZC2 A;  1EF4 A;  2LTP A;  5DEQ A;  4CCN A;  2A6H F;  1T95 A;  5F0C A;  4A6D A;  2IS1 A;  3QPL A;  2EA4 A;  1U5T A;  2HTS A;  1RUO A;  4XOP A;  4P9F A;  3SHF A;  4Z2Y A;  3LAP A;  3QOD A;  5EDN A;  2F5D A;  4A3F J;  3ZQG A;  1XSX A;  2KL4 A;  3CQZ J;  3MEX A;  1MMD A;  3LQQ A;  2AQE A;  3Q0V A;  2Y0M A;  4QSH A;  1HA8 A;  2CUZ A;  1IC8 A;  2MW8 A;  3B6A A;  1TC3 C;  5CVI A;  3G6E I;  1KYW A;  3FX3 A;  1UMQ A;  1W5S A;  3CC4 I;  4EM0 B;  3BR3 A;  1T6S A;  2CFO A;  4D5F A;  1I50 J;  4S05 A;  1QVT A;  3K4C A;  2E5N A;  2KIU A;  2LF8 A;  4GDF A;  3ZQQ A;  3HOT A;  2XB0 X;  4RB0 A;  1FPQ A;  3HGY A;  4A3E J;  2HDW A;  3ZMD A;  1R49 A;  2F48 A;  4HV5 A;  1T0F A;  1O3T A;  4EV0 A;  4HF1 A;  2XGX A;  4BAY A;  3HKZ A;  1PUE E;  1FIP A;  3MKY B;  4Q4Z F;  1R1V A;  2IA0 A;  2JSC A;  2LKS A;  2GXA A;  1JTY A;  3GF2 A;  2WV0 A;  4L5I A;  5DM7 F;  1LNW A;  2CQX A;  3VYU B;  1F1Z A;  4ZYG A;  2R7V A;  4B8X A;  2ECB A;  3OYB A;  3K69 A;  5HOD A;  1B1B A;  3S2W A;  2TCT A;  2WAE A;  3T0Y A;  1V54 H;  3U2R A;  3G73 A;  1YG2 A;  3H3U A;  2DBB A;  3CCQ I;  2JMW A;  4UUV A;  2BV6 A;  2VQG A;  2E2H J;  1KZH A;  3U9G A;  2F5E A;  4L9T A;  3OS0 A;  2QEN A;  1HQC A;  3L2Q A;  2BOL A;  2BY0 A;  1Z3Y A;  3H9Q A;  1TWC J;  1FMW A;  3L1P A;  1TWF J;  2IGM A;  5FGM A;  6PAX A;  2CUJ A;  2H09 A;  3G2B A;  1FOK A;  3MMY B;  1OYW A;  2ICW G;  3P9C A;  3ZQL A;  3RYR A;  3JRD A;  1R4M B;  1JT0 A;  2A68 F;  2Y31 A;  1WSU A;  1V5F A;  4D7M A;  5EEG A;  1U3E M;  2XF6 A;  2EFQ A;  2VL8 A;  2EA2 A;  5J3L A;  2QQA A;  4M6Y A;  4CH7 A;  5JLW A;  3ONQ A;  3VOD A;  1W5T A;  2HKX A;  3FZV A;  2DAO A;  1YHQ I;  4DBR A;  4KA4 A;  1Y56 A;  5IOY A;  1OFC X;  2V9V A;  2XAH A;  5HDN A;  4HLX A;  2O3F A;  1WJC A;  3K1M A;  3HKZ N;  2IT0 A;  3HHH A;  1B72 B;  2EFO A;  2FBK A;  3E5X A;  3I64 A;  1WPK A;  1FMV A;  4UXN A;  2VQH A;  2L9N A;  3RZD J;  3H35 A;  1D0X A;  5L3F A;  1NK3 P;  4JX4 A;  2COM A;  4MEY F;  1B72 A;  5D6E A;  1F4K A;  4E70 A;  1ZKG A;  2XAU A;  4J19 A;  4A3B J;  1HF0 A;  4RLQ A;  1NHA A;  4V2G A;  5JVG F;  4GFB A;  1VTN C;  3TMO A;  5K5R A;  5ILU A;  1LFB A;  3VOE A;  4ENM A;  3A1Y A;  1Z21 A;  3S16 J;  2Y48 A;  4EGY A;  4I2O A;  2GXB A;  2EWN A;  5GAG J;  3CZ6 A;  2GOM A;  2EIJ H;  3UR3 C;  4RS8 A;  1FOY A;  1F9N A;  2IA2 A;  2MG4 A;  2EZH A;  1IGN A;  3ZCO A;  3JRF A;  3JSP A;  1XMX A;  3V8J A;  4WXC A;  3VEP A;  2V7F A;  4JBA A;  2Z16 A;  1MBF A;  3KX2 A;  1FOX A;  2ECC A;  3CME I;  1Z1D A;  3I9V 2;  1GVD A;  2IXS A;  3ZOB A;  1E0E A;  3MWM A;  3P7N A;  2NVU B;  2ZFW A;  5GTH C;  1H9G A;  1FT9 A;  3CTA A;  4GO1 A;  1YW8 A;  5KHD A;  4A0Y A;  2FX0 A;  1Z3X A;  4Y17 A;  2CS3 A;  2E1M C;  3KIO A;  1O3Q A;  2GQQ A;  4BXF A;  3OS1 A;  5EF6 A;  3ASO H;  4RGX A;  1MGT A;  1P9Q C;  2DW4 A;  4KIF A;  3TDZ C;  1W5C C;  1WJD A;  3VSK A;  2W24 A;  3SQN A;  1D1C A;  1LE8 B;  3PSF A;  3FXQ A;  1SMT A;  1U9N A;  1X58 A;  2XHK A;  3V7S A;  1P92 A;  1YO5 C;  3R60 A;  1UHM A;  2K9S A;  1GXP A;  2HEO A;  4EMS A;  2CW8 A;  4LIV A;  5LHI A;  2V1N A;  1LE8 A;  4F7Z A;  2CV2 A;  2JA6 J;  3NEU A;  2VOD A;  4R79 A;  1IO2 A;  3IRQ A;  2PFB A;  4ENN A;  1MD0 A;  4CZZ A;  1ZQ3 P;  2JA2 A;  5AIQ A;  4Y7N J;  3IV5 A;  2A69 F;  1JGG A;  2HVQ A;  1ZAR A;  1BC7 C;  2F4O B;  2LC2 A;  3M9A A;  2KLO A;  2JT1 A;  4IRG A;  2KJB A;  2CV1 A;  1ON1 A;  2GWR A;  2HPM A;  2VKV A;  4XLA A;  2BY1 A;  4DOZ A;  1OCT C;  3W3C A;  3GWZ A;  3L7W A;  2K9N A;  4M3E A;  3E6B A;  5HS9 A;  2OF7 A;  2F5F A;  1Z7L A;  1Z7U A;  1ZG3 A;  1IAW A;  3BCB A;  2IJL A;  3HRS A;  5B5E C;  2QZ8 A;  3TQN A;  1FTT A;  2STW A;  1SEU A;  3I4M J;  3SDG A;  2JUG A;  1A6Q A;  4PSX A;  4A3G J;  4CXF A;  5FLX Z;  5IY5 H;  2R5Z A;  3W6K B;  3HRT A;  3JR9 A;  1UAA A;  2XSJ C;  4A3M J;  5JLX A;  4Y52 J;  2DLL A;  2ZME C;  1E2X A;  1ZR4 A;  2DA3 A;  4W1U A;  1VFC A;  1X1D A;  1SAX A;  1QA6 A;  2OTJ I;  1Y1V J;  4LIU A;  2X6W A;  2D1H A;  2GA2 A;  2WBM A;  3OS2 A;  4AIK A;  1Y8Q B;  1WWX A;  2P4W A;  3OR1 C;  3OYA A;  4DZJ A;  3LST A;  2FOW A;  1PUF B;  4XIC A;  2DPU A;  1O57 A;  1SFE A;  4EJO A;  4JQF A;  1H9T A;  4ITV A;  3I53 A;  1D5Y A;  2YR2 A;  4V2F A;  3R0J A;  2JVH A;  2LMD A;  2P5K A;  2RVC A;  2H6C A;  4ZC3 A;  1VF9 A;  3L00 A;  3LSJ A;  3SEZ A;  3MZH A;  1BR1 A;  4RMN A;  1U2W A;  1DU0 A;  1YYV A;  1ON2 A;  2DMP A;  3MAJ A;  3K4N A;  1NK2 P;  1MH3 A;  2F4M B;  4PCQ A;  1VQP I;  1BW5 A;  3O2P E;  1X2N A;  1ZEL A;  1W7P D;  5LGN A;  1F43 A;  4XR6 A;  3WU1 B;  1O7F A;  5M5W J;  2KZV A;  3OMY A;  3RIR A;  1TLH B;  1BIB A;  2CSO A;  4B43 A;  4D0P A;  2ETH A;  2W84 A;  4F93 B;  3CJR B;  3DTK A;  4HBL A;  1CGP A;  2O0Y A;  5CVJ A;  3IHU A;  4KMU X;  3G1M A;  4Y15 A;  4P5O A;  3GTP J;  2Y30 A;  4EJW A;  1D5V A;  2XIG A;  4UV8 A;  2O5R A;  3K70 D;  2YUS A;  3H5R A;  4DIQ A;  2FSW A;  2M0M A;  1UZC A;  4R1H A;  4P9U A;  3DLL F;  3ISP A;  4MO7 A;  3LNQ A;  2ZJR F;  2VN2 A;  2ZB9 A;  1E17 A;  1JUS A;  3AAF A;  1HW2 A;  3PNT A;  1IN4 A;  4DQ2 A;  4ZYH A;  4Z6Y A;  1JHH A;  2V6C A;  3C18 A;  4YEL A;  1N25 A;  2BVM A;  4KT6 A;  4EAT A;  3KE2 A;  3FXL A;  4YFX F;  1PP8 F;  4I0A A;  4FAS D;  5IP9 J;  1FIA A;  1MKM A;  2MBF A;  4UB8 C;  4CIC A;  4PJL A;  2UXX A;  3K10 A;  5JHU A;  1J2X A;  4II2 A;  1ETQ A;  3I4P A;  3ZP5 A;  2M7B A;  2PJR B;  3HC7 A;  3ECH A;  5E3O A;  1R22 A;  5C4X J;  2K5C A;  3DF8 A;  5DDG A;  1XTA A;  2XF5 A;  3OOP A;  2A6E F;  3Q9S A;  5CYV A;  3X2Q H;  2PJR A;  4DJA A;  3MKZ A;  2HOE A;  5J1R A;  1Q1V A;  4XSX F;  4BS9 A;  2WAD A;  4NC6 A;  3BZK A;  3IP4 B;  2DTZ A;  1ZAO A;  2LYC A;  4IPA A;  4A5N A;  1BR4 A;  2DOF A;  3DKY A;  1TNS A;  4G94 A;  4M6X A;  5F1J A;  4EJT A;  2G0E A;  2UUZ A;  3S17 J;  2NS7 A;  1VQK I;  1BJZ A;  2TDX A;  2FQ4 A;  3GEZ A;  1HC8 A;  1DPU A;  1WJA A;  4BAC A;  2OC6 A;  4QIW N;  5BMZ A;  2EV5 A;  2QQB A;  3HGG A;  4IF4 A;  4UB6 C;  2ZXW H;  4YFK F;  2EH3 A;  1HKT A;  5EG0 B;  2X1D A;  3J7A Y;  3LL7 A;  1V5E A;  3HUG B;  3QQA A;  4LG0 B;  2VJI A;  1MNE A;  5ED4 A;  3AKZ A;  4HRI A;  1R00 A;  2BBY A;  2MD5 A;  3M8F A;  2DA7 A;  2EK5 A;  2W82 A;  5EG0 A;  4BE0 A;  5E17 F;  3HUG A;  3WG9 A;  4LG0 A;  3WGG A;  2EZK A;  3PO3 J;  2VQC A;  5D8L B;  5DS9 A;  2Y0S A;  4A0X A;  3JRC A;  1HSJ A;  2A05 A;  2X9D A;  5LGU A;  3G4S I;  3GVA A;  4XLF A;  5FD5 A;  1A5J A;  2WTE A;  2NXN B;  2R7T A;  3GTQ J;  3ABL H;  4E7L A;  2HTJ A;  1YE9 A;  1LQ1 A;  2JJ7 A;  3J80 Z;  3G1L A;  3CLQ A;  2CW7 A;  4XLE A;  1HXD A;  3DEW A;  3PL8 A;  2HU9 A;  2O03 A;  4XNF A;  4C2M J;  5EZH A;  1O7L A;  2R3S A;  2MC4 A;  4BGD A;  1W0T A;  1SMY F;  3CUQ A;  3L2R A;  3W2A A;  4GCV A;  1Y0N A;  1WI3 A;  2GIZ A;  2PQ8 A;  1G59 A;  3EUH C;  3QRF F;  2XAJ A;  5ICE A;  5LHG A;  1SAU A;  4HDV A;  2E60 A;  1ZG5 A;  2R0Q C;  3CUO A;  1QU3 A;  2WY7 Q;  4A3D J;  3KLO A;  3LA3 A;  4GGG A;  3S3M A;  2VB6 A;  2CQ7 A;  4G6D A;  3WHC A;  5D4R A;  4ANJ A;  1I1S A;  2VBZ A;  1ULY A;  2Y0S N;  2RC4 A;  1H88 C;  2NRA C;  3GTL J;  3TOA A;  1X2M A;  4BQN A;  3FF5 A;  4IHW A;  1JXS A;  5AIP A;  1YFH A;  1ZG1 A;  4M9Z A;  2VT2 A;  4C3J J;  5GPA A;  4G7Z F;  4ENK A;  1ETV A;  1NTC A;  1FC3 A;  2M0C A;  5TRD A;  1FNN A;  5E8I A;  2HWV A;  2R7F A;  2ZO4 A;  2X0L A;  3BR5 A;  3FIW A;  3BR0 A;  3CJQ B;  5LBQ A;  2HI3 A;  1SAN A;  2NVT J;  4KFC A;  5EYR A;  1UEL B;  4G12 A;  2OQR A;  2EIM H;  3HM5 A;  2H1K A;  3LA2 A;  2LOO A;  4B3X A;  3F21 A;  4MFD A;  5F1R A;  1TTY A;  4MLO A;  3OYK A;  2JA7 J;  4NC7 A;  1P4A A;  3UNG C;  5FB2 A;  2O61 A;  2L9S A;  3F0C A;  4O5V A;  1HDP A;  1XMK A;  3EUK L;  1TNT A;  3KEQ A;  2DMQ A;  1GT0 C;  1N78 A;  1UG0 A;  3F8M A;  4LFU A;  1YS7 A;  2LR8 A;  2MH2 A;  1A36 A;  4HSR A;  4IKF A;  1JE8 A;  1WKM A;  2DMN A;  5K7F A;  2ZJP F;  3HG9 A;  4CGZ A;  3ZXS A;  4I98 B;  3QYB A;  1WH7 A;  3DTI A;  4W97 A;  3EET A;  1R36 A;  1KQ0 A;  2HZD A;  4KIB A;  5EEA A;  4ZYA A;  3C2G A;  3FXK A;  3WTY C;  1M1E B;  1W1W E;  1IJW C;  1MBE A;  1V5G A;  1YX3 A;  2AS5 F;  4BE1 A;  4BKX A;  1O3R A;  2QF7 A;  3SZT A;  4M3D A;  3H92 A;  4MHG A;  3D5R C;  2K3F A;  4RAG A;  1SVL A;  1AA7 A;  2E1M B;  3BPV A;  4OU0 A;  2O9L A;  2H27 A;  1DGW Y;  2M45 A;  3BG9 A;  2HYG D;  3DXJ F;  2W57 A;  5CVV A;  4I99 C;  3CCR I;  4EVI A;  3WU2 C;  4YG2 F;  5C3E J;  3K2Z A;  1VND A;  3O8H A;  4P1W A;  1K6O A;  2AO9 A;  5HLT A;  1AWC A;  3L2V A;  2X85 A;  4ASN A;  1K83 J;  2Z1D A;  2XGC A;  1GV5 A;  3CCM I;  2P7C B;  4OIN F;  1P2F A;  1UB9 A;  3GFL A;  3BTI A;  3DKX A;  1LDK B;  3BRO A;  5GP9 A;  2PMU A;  4E7K A;  2WB1 A;  2VC1 A;  3IAM 2;  1X3Z B;  1R1U A;  2EIN H;  2Z33 A;  5CLS A;  1FYM A;  1BJA A;  1LFU P;  2HR3 A;  2QQ9 A;  1P4X A;  2EPF A;  2KFD A;  4R8H A;  3CCE I;  3TL4 X;  2XPV A;  3PUB A;  4QPO A;  3OL4 A;  2M87 A;  4UVB A;  2WC2 A;  1KA8 A;  4JOM A;  1W36 D;  3C2B A;  5F27 A;  3DEE A;  3FK7 A;  5H6Q A;  1J0R A;  1XDS A;  1XSV A;  5F08 A;  4G7O F;  4AYB A;  2FJ1 A;  3K4B A;  5DYM A;  3TO7 A;  1MZB A;  2M34 A;  2D5V A;  2DA1 A;  2L01 A;  1Q1H A;  2FD5 A;  4HYE A;  4ZZD A;  1Z6R A;  3K70 C;  3PQJ A;  1T39 A;  2OU2 A;  3ML6 A;  3GW2 A;  3ZN1 A;  4KT5 C;  3OYE A;  3BDD A;  5FRM A;  1MSF C;  4RDU A;  1BOA A;  2MA3 A;  3CMA I;  1NG7 A;  2ESH A;  4KUM A;  4CA0 A;  4HOB A;  1JKP C;  1ACI A;  1QHG A;  1WI9 A;  4HX7 A;  2WB1 N;  4EJU A;  2ZME B;  3CES A;  3SFZ A;  5ICG A;  1MND A;  3LAJ A;  4RA2 A;  2MAB A;  3TKY A;  1MMS A;  2YU3 A;  1QHH D;  4B1R A;  4HW0 A;  4DGW B;  5L3C A;  3FKI J;  4JYK A;  4CZC A;  1BBY A;  3IWF A;  3DBR B;  2ZME A;  4EM1 A;  3DPU A;  2TRT A;  5HDG A;  1GLN A;  2CFX A;  3V4G A;  5F04 A;  1F5T A;  3KZZ A;  5IYB J;  4KJZ A;  4OMY A;  3OSF A;  2HDC A;  1WVR A;  1QNT A;  2JSP A;  5J47 A;  1YS6 A;  2EZI A;  5DD4 A;  4XQF A;  1T8I A;  4AIJ A;  3L2W A;  4AYB N;  1DUX C;  3JRH A;  2IGO A;  1R7J A;  1LKX A;  2NS8 A;  2R7R A;  3ZMT A;  2OCE A;  3JSO A;  2Y9Z A;  2B7E A;  2CQK A;  4FIS A;  3TED A;  4WXH A;  3OYH A;  4A3C J;  3Q3S A;  3GBG A;  1JI8 A;  3KYD B;  4RB3 C;  1TWG J;  4C2T A;  2OPT A;  3K4M A;  2HXO A;  1WHU A;  2JZY A;  2WA0 A;  3L2C A; 
#chains in the Genus database with same CATH homology
 4L0Z B;  2ZXJ A;  1ZYR F;  1U8R A;  2X4H A;  5E18 F;  4I09 A;  2PLY A;  1Z6T A;  4KIC A;  4BHB A;  3FM5 A;  5FLX K;  4ZYD A;  4KIG A;  3PFI A;  1MDM B;  1HKS A;  2OA4 A;  1IW7 F;  2FBI A;  4B09 A;  2DPD A;  2V1D A;  3H3Z A;  1YLF A;  3KP4 A;  1G4D A;  3E3V A;  4Q5S F;  1MDM A;  2V1X A;  3QU3 A;  4K2E A;  2K4B A;  2OZU A;  2F5C A;  3IL2 A;  1STZ A;  2ZBK A;  5LRR A;  3WTX C;  2RNJ A;  2RQP A;  4LLG F;  2GZW A;  3MZY A;  3BJ6 A;  3QPT A;  2PBI A;  1OR7 A;  2LSO A;  2OZ6 A;  4CO8 A;  2RV8 A;  5DD8 A;  5IT9 Z;  3I58 A;  4KYW A;  4PZJ A;  1YW7 A;  4HQM A;  5H20 A;  4EQQ A;  3KCC A;  3WTU C;  4OIQ F;  5ICF A;  2KIM A;  1HW1 A;  1ZN2 A;  3T8R A;  5E8G A;  1I5Z A;  2GXG A;  3COA C;  5L3E A;  4TV7 A;  3RTR A;  4RGU A;  1QBJ A;  4L9J A;  2XUB A;  3R6S A;  1J7K A;  3M7G A;  1CF7 B;  2LDU A;  4G8X A;  3VFZ A;  2M8E A;  2IP2 A;  4GYI A;  2CYY A;  1CF7 A;  2XRN A;  3ABU A;  2VBY A;  2CWE A;  4XRF A;  3E6D A;  2EFP A;  3IWZ A;  2A07 F;  1AOY A;  2QBY B;  2ZNZ A;  4BYY A;  2ZKZ A;  1USS A;  1BI0 A;  1HW5 A;  3O6B B;  2QBY A;  4Q48 A;  2PN6 A;  5LHH A;  2P6T A;  3REO A;  5BQT A;  3P9K A;  1XD7 A;  1I6X A;  4UHT A;  1UST A;  1LEB A;  2J5P A;  2RGV A;  3V8K A;  3BZ6 A;  3IC7 A;  3FHZ A;  1FY7 A;  4O6J A;  4OIP F;  3HIF A;  4L9V A;  1MJB A;  1ZRF A;  2ADU A;  1S6L A;  3ULQ B;  1ZGJ A;  2OAZ A;  4BHC A;  1I27 A;  3N97 A;  3HTU A;  1XMA A;  2EJR A;  1IF1 A;  3F8N A;  2UZK A;  4OIO F;  1BI1 A;  1HST A;  3GYH X;  2M5W A;  5A2Q Z;  4A0Z A;  4XSZ F;  2UXN A;  2FA5 A;  2LF7 A;  4QWQ A;  1Y0U A;  3DFG A;  2DK8 A;  3J80 K;  2LNB A;  2O8X A;  5HS8 A;  4GXO A;  2G9W A;  3FWE A;  3ELK A;  3MFK A;  5ERI A;  4PDK A;  3ZMS A;  2K02 A;  1XGO A;  1S7A A;  2YPR A;  5JR3 A;  2P7V B;  1IN7 A;  2FE3 A;  1REP C;  4O3M A;  1JHF A;  4IHS A;  1FLI A;  1T2K A;  2CG4 A;  4LB5 A;  3GXO A;  1RZ4 A;  4CYD A;  1OPC A;  4Y13 A;  1S7O A;  1FSE A;  1K79 A;  4YFN F;  3TGN A;  2DU9 A;  2H94 A;  2B0L A;  1B9M A;  5JI6 A;  2EFW A;  1ZH5 A;  4KN7 X;  2HFH A;  3DPT A;  2DFI A;  3ABT A;  3CLO A;  1R1T A;  3FXU A;  2QM3 A;  3E5U A;  2CGP A;  1W7P B;  5HDK A;  1GXQ A;  1R5H A;  3HTS B;  3HYI A;  3KP6 A;  5LLQ A;  1W7P A;  5HLI A;  3DPL C;  2FEZ A;  2L4A A;  2P5L C;  1HKQ A;  4L5J A;  2FOK A;  1L3L A;  5ILS A;  4M72 A;  4HF2 A;  1XGM A;  2D1V A;  1U6G A;  5F64 A;  2XAQ A;  2FQ3 A;  1RNL A;  1PDN C;  4KDP A;  2YX7 A;  4RB2 C;  3RKX A;  4LJZ F;  5DUK A;  2VBX A;  1O3S A;  2QWW A;  3F8C A;  2D2W A;  2EV0 A;  1MJA A;  4OIR F;  3KET A;  4WF2 A;  2PEX A;  4MTD A;  2RDP A;  1G3W A;  2MLK A;  2Q0O A;  4KNY A;  3C3W A;  4N9I A;  1ONV A;  4U7D A;  1LJ9 A;  3RI4 A;  3RJP A;  2HGC A;  3R0A A;  1FBQ A;  4ZH4 F;  2HYF A;  5D4S A;  3GUD A;  5L3G A;  4L18 B;  2FRH A;  5LRS A;  3JAM Z;  2MH9 A;  3KZY A;  2VOO A;  1IN5 A;  3DKW A;  3FM3 A;  4NHJ A;  3KFW X;  2QYO A;  2E1C A;  1EH6 A;  2K27 A;  5D5W B;  3K1N A;  3U1D A;  3ERE D;  3BJO A;  2JRT A;  1BM9 A;  4L9N A;  1QPM A;  2XKP A;  2L54 A;  3T8T A;  4G7H F;  5KVR A;  3ROU A;  4ETS A;  4ZZL A;  2OD5 A;  2VE8 A;  3ZMU A;  4I02 A;  3WOD F;  3WE2 A;  2VC0 A;  4CDG A;  2Z3Y A;  5BPI A;  1FP1 D;  1FYK A;  3LQR A;  4PGH A;  1QZY A;  4YII A;  2YX4 A;  1OYY A;  4N0B A;  2IRF G;  1R58 A;  3EYY A;  2PMH A;  4LMY A;  4IJA A;  4EJV A;  2QVO A;  4IXA A;  3FMR A;  1IN6 A;  2VXZ A;  3QOP A;  3RYP A;  4N9H A;  4HDU A;  4MTE A;  2VE9 A;  1SD7 A;  3BPX A;  1GHC A;  5D8K B;  1XCB A;  1KYZ A;  2ISY A;  1J75 A;  3GFI A;  1SD6 A;  4WK8 F;  1ZRC A;  5HVQ C;  4HA8 A;  4L0Y B;  1B59 A;  3GFM A;  3R61 A;  1HBX G;  3FMQ A;  5E1X A;  2CO5 A;  2VBW A;  3Q9V A;  3GX4 X;  3EYI A;  3Q5F A;  3F6O A;  4I0B A;  1BI2 A;  1YQA A;  1EV7 A;  2K7L A;  3RPQ A;  1V4R A;  3RDI A;  4AVP A;  1KU2 A;  5IT9 K;  3TOB A;  1Z05 A;  2ELH A;  1ODD A;  3FMS A;  2PG4 A;  2ZJ2 A;  2HS5 A;  5CVR A;  3IRR A;  3SZP A;  2XKO A;  4M9X A;  2VOP A;  1DDN A;  2Z99 A;  2UWM A;  4P55 A;  5BOX A;  3VB2 A;  2KKO A;  1TQP A;  5DV5 A;  3W6J B;  1T98 A;  3KLN A;  5LEK A;  4AIH A;  1FYL A;  4P96 A;  4A5M A;  5K5Q A;  2HZT A;  5D5U B;  1XB4 A;  5BPD A;  5F6F A;  2OQG A;  3IKV A;  4RAY A;  1QZZ A;  2ACJ A;  1J5Y A;  4A12 A;  1LEA A;  3CJN A;  1MJ9 A;  2OBP A;  5IT3 A;  3J7A O;  1G3S A;  5K5O A;  4MEX F;  3BP8 A;  3HRM A;  4A2U A;  1G3T A;  3T1B A;  5HOO A;  1FP2 A;  4M9S A;  3QP6 A;  3KP2 A;  4BXU A;  1TQI A;  1IRG A;  4ESF A;  1QQI A;  5H6R A;  3HSF A;  2F2E A;  3MQ0 A;  3WTT C;  4MNU A;  4BHP A;  1OYI A;  1XN7 A;  1G6N A;  3D5L A;  3EDP A;  5FFZ A;  5E1Z B;  2HQR A;  5A2Q K;  1KGS A;  2G7H A;  3CUQ C;  2M30 A;  2R7D A;  1FX7 A;  3PQK A;  1RIO H;  4BQA A;  4XLN F;  5L3D A;  4LK1 F;  2AXL A;  1B6A A;  4FHT A;  2IW5 A;  1IXR C;  3WTZ A;  4WWC A;  2Q2E A;  1IXC A;  1BI3 A;  4IRH A;  3TO9 A;  5TJJ A;  2HKO A;  2FF4 A;  3LWF A;  1QO0 D;  5FO5 A;  2Z5U A;  1UHW A;  4OOI A;  4IRI A;  3RKY A;  2M1B A;  5CVU A;  1XGS A;  1SD4 A;  5K1Y A;  1TBX A;  3TDU C;  1KU7 A;  1KQ9 A;  2QUF A;  1TW3 A;  1ZRD A;  1IZ1 A;  4MQV A;  2K86 A;  4UV9 A;  4OMZ A;  3O3K A;  1WQ2 A;  3F23 A;  2XRO A;  3JW4 A;  5DCM B;  1J9I A;  3HSR A;  1YIO A;  3K1P A;  5DCM A;  2NS0 A;  3J81 Z;  4IVN A;  2GA1 A;  2FNP A;  2NNY A;  2CW0 F;  4ESB A;  2DK5 A;  2JPB A;  4M73 A;  5E20 A;  3F8F A;  1ZHF A;  2NNN A;  3MCZ A;  5L3B A;  1XDU A;  3BY6 A;  2KIF A;  1FBU A;  1OMI A;  4UVC A;  1IN8 A;  3GZ5 A;  4U0V A;  4LB6 B;  1SFX A;  1FWZ A;  2JTV A;  3R4K A;  1BIA A;  2XAS A;  4M74 A;  2A3S A;  3QPH A;  3EUH A;  3N4M A;  1GVJ A;  3GO5 A;  3KEO A;  1L0O C;  4ZYE A;  4FT8 A;  4RGS A;  2V79 A;  4AWX B;  3HOS A;  3JTH A;  4FX4 A;  2QLZ A;  2KRF A;  5HS7 A;  1C0W A;  1TW2 A;  2E7W A;  4KMF A;  2P8T A;  2XAG A;  5KK1 A;  1DP7 P;  1XGN A;  3F22 A;  3F3X A;  3BWG A;  2IA1 A;  1ZLJ A;  3B73 A;  2IVM A;  2DQL A;  1V3F A;  4M71 A;  4HQE A;  1J59 A;  4BNC A;  4RAZ A;  1U5T C;  3IKT A;  1EH8 A;  4U7B A;  3JAM K;  5EEH A;  3RPU A;  4IHT A;  1P6R A;  3GLX A;  4CHU A;  1W4M A;  3BJA A;  4ON0 A;  4RB1 A;  2J5O A;  3DV8 A;  2EFN A;  3E97 A;  1YTY A;  2BEO A;  4HX8 A;  3I54 A;  2VON A;  4LLL A;  5J6X A;  4HX4 A;  5FD6 A;  1EH7 A;  3LA7 A;  4QLC U;  1UFM A;  3L09 A;  4HLY A;  1K7A A;  2EB7 A;  5AON A;  5J8C A;  3WE3 A;  4WXD A;  2P5V A;  2GAU A;  2DTR A;  2XV4 S;  3E6M A;  3WGH A;  1FZP B;  2O6G E;  2VT3 A;  1H0M A;  1BC8 C;  3F6V A;  1JGS A;  3DQV C;  2L02 A;  2H6B A;  5D6F A;  3LFK A;  4LGW A;  1IRF A;  4WCG A;  3WU0 A;  2RKH A;  1PP7 U;  2STT A;  4U0Y A;  3TO6 A;  2W85 A;  3EQL F;  1LB2 A;  4HV6 A;  2DI3 A;  3M1E A;  3QAH A;  1T38 A;  2LKP A;  1G3Y A;  4Q47 A;  1IXS B;  4I01 A;  4H0E A;  4HF0 A;  2BYV E;  1FSH A;  3E6C C;  3F8B A;  1K78 B;  1LDJ A;  3RKW A;  4HZF A;  3HSE A;  5JVT A;  2XAF A;  3F72 A;  3L9F A;  2EV6 A;  5CJ9 A;  3ZN0 A;  3NRV A;  1K78 A;  4UVA A;  1D3Y A;  4NB5 A;  2ISZ A;  2Y75 A;  4XBF A;  4NQW A;  5BS6 A;  4LK0 F;  3DP7 A;  4WX9 A;  1A04 A;  4G6Q A;  3E5Q A;  2K4J A;  3ZMZ A;  3NQO A;  3HHG A;  2NAZ A;  3CO7 C;  2MC3 A;  2IPQ X;  1XSD A;  4MGR A;  4HAM A;  3ZQ7 A;  1OKR A;  3K0L A;  3KP5 A;  1RI7 A;  2KJC A;  3C1D A;  1WRJ A;  2A61 A;  1ZRE A;  3OV8 A;  4A6E A;  4EM2 A;  1KQ8 A;  2FU4 A;  3QU6 A;  3P9I A;  2V1U A;  1LDD A;  2JPC A;  4I7H A;  1U78 A;  2ZCW A;  3WTS C;  3T5X A;  1ZLK A;  3CUQ B;  1D8K A;  2PI0 A;  3ECO A;  4U0W A;  4DNC A;  2E7X A;  4S04 A;  3V7C A;  2XVC A;  2MLG A;  5JFR A;  3GFJ A;  1SFU A;  3KP7 A;  3G3Z A;  2FML A;  2DQR A;  1P4W A;  1X3U A;  2DT5 A;  2C6Y A;  3WTV C;  2ESN A;  5D5V B;  2BGC A;  2D45 A;  1D8J A;  1DPR A;  2G7U A;  2WWY A;  4G9Y A;  1B9N A;  4JK1 X;  1B4A A;  2ZNY A;  4UNO A;  1Z9C A;  1XCV A;  1S3J A;  5J8F A;  4EGZ A;  5ILV A;  3BOQ A;  1SD5 A;  5D5X B;  1TQM A;  5ICC A;  2L3D A;  3V8L A;  3K9T A;  5E1W A;  4PGG A;  4ESJ A;  5HLH A;  3WGI A;  5LGT A;  3I59 B;  1R23 A;  2HQN A;  1R5G A;  2L4M A;  3SXY A;  4XLP F;  1KU9 A;  4FX0 A;  4RGR A;  3KP3 A;  4GYG A;  2A5Y B;  3M8E A;  3I59 A;  1Z91 A;  5HLG A;  3DEU A;  1YW9 A;  2YSR A;  4BH9 A;  4ENJ A;  2GIV A;  2PJP A;  1S29 A;  1S8N A;  3I5U A;  3I0T A;  3ZMV A;  1I1G A;  2W25 A;  1UCR A;  2FMY A;  2FXA A;  3QP5 A;  4MQ9 F;  2P6S A;  5DUI A;  4YIF A;  3HRU A;  5FFX A;  3CDH A;  3GZ6 A;  2FBH A;  4U88 A;  3C7J A;  1QGP A;  3WTW C;  2E1N A;  4LD5 A;  3I71 A;  1KU3 A;  4AD9 A;  5DCF A;  1BN5 A;  3V7R A;  1RUN A;  3CO6 C;  3ZPL A;  4KN4 X;  2BE5 F;  2FNA A;  3J81 K;  3FXR A;  3D0S A;  2RN7 A;  2Z9O A;  5LEJ A;  1FBS A;  1LVA A;  1ZGA A;  3JTG A;  4LLN A;  2NYX A;  3B02 A;  1U5T B;  2Q8K A;  2DO7 A;  1IUY A;  5DEQ A;  2A6H F;  4A6D A;  2EA4 A;  1U5T A;  2HTS A;  1RUO A;  4P9F A;  3SHF A;  4Z2Y A;  3LAP A;  2F5D A;  1XSX A;  3MEX A;  3LQQ A;  2Y0M A;  5CVI A;  1KYW A;  3FX3 A;  1W5S A;  4EM0 B;  1T6S A;  4S05 A;  2KIU A;  2LF8 A;  3HOT A;  4RB0 A;  1FPQ A;  3ZMD A;  4HV5 A;  1T0F A;  1O3T A;  4EV0 A;  4HF1 A;  2XGX A;  4BAY A;  1PUE E;  4Q4Z F;  1R1V A;  2IA0 A;  2JSC A;  3GF2 A;  2WV0 A;  4L5I A;  1LNW A;  1F1Z A;  4ZYG A;  4B8X A;  3K69 A;  1B1B A;  3S2W A;  3T0Y A;  3U2R A;  3G73 A;  1YG2 A;  3H3U A;  2DBB A;  4UUV A;  2BV6 A;  3U9G A;  2F5E A;  4L9T A;  2QEN A;  1HQC A;  5FGM A;  6PAX A;  1FOK A;  2H09 A;  1OYW A;  3P9C A;  3RYR A;  2A68 F;  1WSU A;  1U3E M;  5EEG A;  2EFQ A;  2EA2 A;  2QQA A;  4M6Y A;  3VOD A;  1W5T A;  2HKX A;  3FZV A;  2DAO A;  4KA4 A;  2V9V A;  2XAH A;  5HDN A;  4HLX A;  2O3F A;  3K1M A;  2IT0 A;  3HHH A;  2EFO A;  2FBK A;  3E5X A;  3I64 A;  4UXN A;  5L3F A;  2COM A;  4MEY F;  5D6E A;  1F4K A;  4E70 A;  1NHA A;  1VTN C;  5K5R A;  5ILU A;  3VOE A;  4ENM A;  2Y48 A;  4EGY A;  4I2O A;  2GXB A;  2EWN A;  4RS8 A;  1F9N A;  2IA2 A;  3JSP A;  3V8J A;  4WXC A;  3VEP A;  4JBA A;  1Z1D A;  3MWM A;  3P7N A;  2ZFW A;  1H9G A;  1FT9 A;  3CTA A;  4GO1 A;  1YW8 A;  4A0Y A;  4Y17 A;  1O3Q A;  2GQQ A;  4RGX A;  1MGT A;  2DW4 A;  4KIF A;  3TDZ C;  2W24 A;  3SQN A;  3FXQ A;  1SMT A;  3V7S A;  2XHK A;  1P92 A;  1YO5 C;  3R60 A;  1UHM A;  1GXP A;  2HEO A;  4EMS A;  5LHI A;  4F7Z A;  3NEU A;  2VOD A;  4R79 A;  3IRQ A;  2PFB A;  4ENN A;  1MD0 A;  4CZZ A;  5AIQ A;  2A69 F;  1ZAR A;  1BC7 C;  3M9A A;  2JT1 A;  4IRG A;  2KJB A;  1ON1 A;  2GWR A;  3GWZ A;  3L7W A;  3E6B A;  5HS9 A;  2F5F A;  1Z7U A;  1ZG3 A;  1IAW A;  3HRS A;  2IJL A;  2QZ8 A;  3TQN A;  2STW A;  4CXF A;  5FLX Z;  3W6K B;  3HRT A;  2DLL A;  1E2X A;  1SAX A;  2D1H A;  2GA2 A;  4AIK A;  2P4W A;  1WWX A;  3LST A;  2DPU A;  1O57 A;  1SFE A;  4EJO A;  4JQF A;  1H9T A;  3I53 A;  2YR2 A;  3R0J A;  2P5K A;  2RVC A;  2H6C A;  3MZH A;  3L00 A;  1U2W A;  1YYV A;  1ON2 A;  3MAJ A;  4PCQ A;  3O2P E;  1W7P D;  5LGN A;  3WU1 B;  1O7F A;  3RIR A;  1TLH B;  1BIB A;  2CSO A;  4D0P A;  2ETH A;  2W84 A;  4HBL A;  1CGP A;  2O0Y A;  5CVJ A;  3IHU A;  4KMU X;  4Y15 A;  4P5O A;  4EJW A;  1D5V A;  2XIG A;  4UV8 A;  2FSW A;  4R1H A;  4P9U A;  3ISP A;  2VN2 A;  1E17 A;  3AAF A;  1HW2 A;  1IN4 A;  4DQ2 A;  4ZYH A;  1JHH A;  2V6C A;  3C18 A;  4YFX F;  3KE2 A;  1PP8 F;  4I0A A;  1MKM A;  2MBF A;  4CIC A;  2UXX A;  5JHU A;  1J2X A;  3I4P A;  3ZP5 A;  3ECH A;  1R22 A;  3DF8 A;  5DDG A;  3OOP A;  2A6E F;  3Q9S A;  5CYV A;  2HOE A;  4XSX F;  1ZAO A;  4IPA A;  4A5N A;  1TNS A;  4G94 A;  4M6X A;  4EJT A;  2TDX A;  3GEZ A;  1DPU A;  5BMZ A;  2EV5 A;  2QQB A;  4IF4 A;  4YFK F;  1HKT A;  4LG0 B;  5ED4 A;  1R00 A;  2BBY A;  2MD5 A;  3M8F A;  2EK5 A;  5E17 F;  3HUG A;  3WG9 A;  4LG0 A;  3WGG A;  5D8L B;  4A0X A;  1HSJ A;  5LGU A;  3GVA A;  5FD5 A;  2WTE A;  2HTJ A;  1LQ1 A;  3J80 Z;  1HXD A;  2O03 A;  1O7L A;  2R3S A;  1SMY F;  3CUQ A;  4GCV A;  2PQ8 A;  3QRF F;  2XAJ A;  5ICE A;  5LHG A;  4HDV A;  1ZG5 A;  3CUO A;  3KLO A;  3LA3 A;  4GGG A;  4G6D A;  5D4R A;  1I1S A;  2VBZ A;  1ULY A;  2RC4 A;  2NRA C;  3TOA A;  1JXS A;  3FF5 A;  5AIP A;  1YFH A;  1ZG1 A;  4M9Z A;  2VT2 A;  4G7Z F;  4ENK A;  5TRD A;  1FC3 A;  1FNN A;  5E8I A;  2HWV A;  2R7F A;  2ZO4 A;  2X0L A;  5LBQ A;  4KFC A;  2OQR A;  3LA2 A;  3F21 A;  5F1R A;  1TTY A;  5FB2 A;  1P4A A;  2O61 A;  4O5V A;  1XMK A;  1TNT A;  3KEQ A;  3F8M A;  4LFU A;  1YS7 A;  2MH2 A;  1JE8 A;  1WKM A;  4CGZ A;  4I98 B;  3EET A;  1R36 A;  1KQ0 A;  4KIB A;  3WTY C;  2AS5 F;  1O3R A;  3SZT A;  3H92 A;  4MHG A;  3BPV A;  4OU0 A;  2H27 A;  2M45 A;  2HYG D;  3DXJ F;  2W57 A;  5CVV A;  4EVI A;  4YG2 F;  3K2Z A;  1K6O A;  1AWC A;  4ASN A;  2P7C B;  4OIN F;  1P2F A;  1UB9 A;  3GFL A;  1LDK B;  3BRO A;  2PMU A;  2VC1 A;  1R1U A;  2Z33 A;  5CLS A;  1FYM A;  1BJA A;  2HR3 A;  2QQ9 A;  1P4X A;  4R8H A;  2M87 A;  4UVB A;  2WC2 A;  1KA8 A;  5H6Q A;  1J0R A;  1XDS A;  1XSV A;  4G7O F;  5DYM A;  3TO7 A;  1MZB A;  2L01 A;  1Q1H A;  4HYE A;  4ZZD A;  1Z6R A;  3PQJ A;  1T39 A;  2OU2 A;  3ML6 A;  3GW2 A;  3ZN1 A;  4KT5 C;  3BDD A;  1BOA A;  2MA3 A;  2ESH A;  4KUM A;  4HOB A;  1WI9 A;  4HX7 A;  4EJU A;  2ZME B;  3SFZ A;  5ICG A;  3LAJ A;  3TKY A;  2YU3 A;  4HW0 A;  5L3C A;  1BBY A;  3IWF A;  2ZME A;  4EM1 A;  5HDG A;  2CFX A;  3V4G A;  1F5T A;  3KZZ A;  4OMY A;  2HDC A;  1QNT A;  1YS6 A;  5DD4 A;  4AIJ A;  1DUX C;  1R7J A;  3ZMT A;  3JSO A;  2CQK A;  4WXH A;  4RB3 C;  2JZY A;  3L2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...