2XV4S

Structure of human rpc62 (partial)
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
532
structure length
399
Chain Sequence
MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETTMDYAEVSNTFVRLADTHFVQRCPSIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKGMYVINLHKALASLATATLESVVQERFGSRCARIFRLVLQRTFYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE III SUBUNIT RPC3
publication title Structure-Function Analysis of Hrpc62 Provides Insights Into RNA Polymerase III Transcription
pubmed doi rcsb
source organism Homo sapiens
total genus 150
structure length 399
sequence length 532
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF05645 RNA_pol_Rpc82 RNA polymerase III subunit RPC82
S PF08221 HTH_9 RNA polymerase III subunit RPC82 helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S03
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S04
4KN4X 1EH7A 3DP7A 3K9TA 2OQGA 2P6TA 2LSOA 3E97A 4IRGA 1TQIA 4AIJA 4ON0A 4KT5C 1B9NA 4P55A 3HRMA 2V1XA 1QBJA 2HYFA 4RB0A 3I58A 2IRFG 4G7ZF 3GW2A 3WODF 2D1VA 3RJPA 2Z99A 4ZYEA 4UV9A 2DI3A 4HW0A 1MGTA 3QPTA 5EEGA 2JPCA 1YW7A 4OIOF 4AD9A 1KA8A 4DQ2A 5JR3A 1T2KA 1S29A 2PMUA 2VBYA 3GZ6A 3GEZA 2ACJA 3ZP5A 3F21A 2H09A 5HS8A 4Q5SF 4I98B 2HKOA 3KFWX 4AVPA 1WI9A 3TQNA 3HRUA 2D2WA 1I27A 1W5TA 4RGRA 2VOOA 5CVVA 3HHGA 2Z5UA 1GXQA 4PGHA 4L9JA 3M1EA 2FSWA 2QQAA 3E5XA 5DD8A 2FBIA 4MQVA 2FMLA 1PUEE 1OYWA 1D8JA 1R7JA 4ENMA 4Y15A 1G4DA 1D5VA 2QENA 3EYYA 4EJWA 1ZG3A 1FZPB 3WTTC 3ZPLA 4LLLA 4NHJA 5DUKA 1KU3A 3F3XA 1FBSA 2ZFWA 1P2FA 2M1BA 3F8FA 1MZBA 3F8MA 3FM3A 1D3YA 4A2UA 4BNCA 2R3SA 1XDUA 1BOAA 1JHFA 5E1XA 2PN6A 3BOQA 3SXYA 3DFGA 2Q2EA 3P9IA 3WTVC 1BI0A 4HLXA 2YU3A 4GGGA 1MJAA 1IW7F 3LQQA 3K1NA 1PP7U 1B59A 4EJOA 4HX4A 3QRFF 3J7AO 4PGGA 3U2RA 5KVRA 4N0BA 5ICGA 2BV6A 1O57A 2MA3A 4EM1A 4WXHA 2PG4A 3GFMA 3BJOA 4MTEA 5BPDA 1R00A 4UHTA 5D5UB 2CG4A 3FMSA 1IF1A 2EFPA 5IT9Z 4KUMA 2K02A 1BI2A 2XV4S 3F22A 3HSRA 5FB2A 4XLPF 4YFXF 4P9FA 1EH6A 4JQFA 3GF2A 4KA4A 2GA1A 1USSA 1ON1A 2H6CA 4RGSA 2RC4A 3HHHA 5L3CA 5E8GA 2GXBA 2VN2A 3ABTA 3LAPA 4G8XA 2ELHA 3ML6A 1HKSA 4RS8A 5LGTA 1HW1A 2VT2A 4YG2F 2RV8A 4M9XA 4OMYA 5L3EA 3E6BA 1J0RA 2G7UA 1FBQA 1LJ9A 1W7PB 3GFLA 1T39A 1A04A 4B09A 1MDMB 1WRJA 3I54A 3HOTA 3L9FA 3T5XA 1KQ9A 3ZN0A 3IRQA 4F7ZA 4O3MA 1FX7A 3GWZA 2HQRA 4L18B 1KQ8A 1R1TA 1P6RA 2WC2A 1RUNA 2V1DA 3TOAA 5LHIA 2GQQA 1S7OA 4G94A 3DPLC 3CJNA 3VOEA 4G6DA 3BROA 1F4KA 2NRAC 1SD6A 5FO5A 2PQ8A 5DYMA 1O3TA 3HUGA 3KETA 2A6EF 3KP6A 2J5PA 2BEOA 2VOPA 1FOKA 1J9IA 3ZMZA 1RZ4A 4BHPA 3WU0A 4KIGA 4P96A 5ERIA 2BGCA 3QPHA 2MBFA 4K2EA 4HF0A 4EGZA 2RGVA 4KICA 4XRFA 4IRIA 4M6XA 4EGYA 3H92A 3WGGA 2DT5A 5F1RA 4XLNF 1H9TA 1LB2A 1BC7C 3E6CC 1KU2A 3WTYC 4ENKA 2VE9A 1STZA 1E17A 3OOPA 5DD4A 2PI0A 1H0MA 4UVAA 2DW4A 1XCVA 2P4WA 2LDUA 1OYIA 3GX4X 4ZYDA 3G3ZA 5H6RA 2HEOA 1FSEA 5IT9K 4ESFA 2FU4A 2YX7A 3MQ0A 3VFZA 3DF8A 1TQMA 4ESJA 1ZARA 4LB5A 1J2XA 2W85A 3JW4A 2L02A 3V7CA 1B6AA 4A6DA 2EB7A 2VBZA 1K78B 2GZWA 2CSOA 1C0WA 2Z9OA 4FT8A 2XROA 1FYLA 2HS5A 1FSHA 4BHCA 4Q4ZF 4G7OF 3JAMZ 2HTSA 1YG2A 2J5OA 2M30A 2Y0MA 3T0YA 2OD5A 2O0YA 2Q0OA 1REPC 2XAHA 5A2QZ 4CXFA 2F5FA 2QVOA 1TBXA 1JHHA 3GZ5A 4OOIA 2PEXA 2HGCA 4UVCA 2CGPA 2A6HF 3K69A 2RN7A 4JBAA 4KMFA 2LF8A 5HLHA 4RGXA 2K4BA 3WU1B 1SMYF 2M8EA 2AS5F 5DEQA 3QU6A 4HX8A 2UXNA 4Y17A 5BQTA 2XGXA 2OZ6A 5LEKA 1RUOA 2HDCA 3DKWA 4MNUA 2DU9A 1YFHA 1QZYA 1XMAA 3BZ6A 4XBFA 2XUBA 4GO1A 1KU9A 3E6MA 3IC7A 4I02A 5L3FA 4OIPF 3F23A 2FA5A 3V8JA 1U2WA 1ZH5A 2O03A 5FFXA 2IA1A 2DO7A 4M73A 3ZQ7A 4G7HF 1R58A 3LAJA 3I64A 1O3SA 3KZYA 1Z6RA 4FX4A 2KIUA 4EJTA 4UUVA 3R0AA 1P92A 5ICCA 1J59A 1XGMA 1CF7B 1ZLKA 5D4RA 4MEXF 2DPDA 1IUYA 3GVAA 4RB1A 2JZYA 3AAFA 4LLGF 3RKXA 4Q47A 2COMA 5D4SA 1QPMA 2FNAA 1TNTA 2KIFA 2E7WA 3F8NA 2VBXA 3ZMTA 2EFQA 2YX4A 4S04A 1ZGAA 5JI6A 1RIOH 4OIRF 2OAZA 1IXSB 3EDPA 3TKYA 2FBHA 2GAUA 2DPUA 2PLYA 3HSFA 1GXPA 2G7HA 4KNYA 2D1HA 2DK5A 5J8CA 2P7VB 2P5KA 1PDNC 1ZRDA 3E3VA 5LEJA 3HSEA 2PMHA 5L3GA 1SFUA 3EQLF 2Z3YA 3FXRA 5D5WB 3P9KA 4KMUX 2FOKA 4U0WA 1F1ZA 4EMSA 3M8EA 3MZHA 5DUIA 3JAMK 4R79A 2M87A 4O6JA 4R1HA 2DAOA 1DPUA 3K1PA 1IN8A 3D5LA 3PFIA 1LNWA 4UNOA 1IRGA 2G9WA 1BI1A 4A5NA 1QO0D 5A2QK 3J80Z 4CHUA 4LK0F 1TQPA 4MQ9F 3C18A 2DLLA 2JPBA 1UB9A 3CTAA 2VODA 1B4AA 4BAYA 2VC0A 1SAXA 2EWNA 4Z2YA 5D6EA 4E70A 3VODA 2DBBA 1YS6A 3BWGA 3KLOA 4LK1F 1IXRC 3Q5FA 3MZYA 1K79A 2M45A 2UXXA 2XHKA 1ZG5A 2A69F 1KYWA 2XAQA 2ISYA 1WWXA 3KP7A 4M6YA 1XGOA 5CJ9A 4L0YB 2Y75A 1R5GA 1BI3A 2V9VA 1ZRFA 2QM3A 4NQWA 1HW5A 3TOBA 2RNJA 3QOPA 4EM2A 3WTWC 3R61A 4N9HA 4M71A 1SD4A 2FEZA 4A6EA 1J5YA 5TRDA 1HXDA 1LVAA 3IRRA 1XSVA 3ZMSA 5FD6A 3ZN1A 1P4XA 4WWCA 2QLZA 4ASNA 5LGNA 1SMTA 1GHCA 5AIPA 1MD0A 2XIGA 3KEOA 1SD5A 3SFZA 1W7PA 3F8BA 2JTVA 4HV6A 2HYGD 4I2OA 5E17F 5F64A 1MDMA 2VT3A 5FGMA 3T8TA 5CLSA 3LA3A 2CWEA 3Q9VA 1FC3A 4R8HA 1CGPA 1GVJA 3V7RA 1R36A 3CUQC 4EV0A 4ENJA 3KP4A 5DCMB 2L54A 4N9IA 1K7AA 2XKOA 4ZH4F 4Y13A 1G6NA 1SFXA 5BS6A 5LHHA 1ZHFA 2E1NA 1U6GA 4IXAA 2HR3A 3REOA 3GFIA 1S7AA 4KDPA 3W6JB 1AWCA 1KGSA 2EV5A 5FLXZ 5ED4A 3SZTA 4UVBA 1Q1HA 2F5CA 2WV0A 2FMYA 4GCVA 4L9TA 1V3FA 2HWVA 4WXCA 5HDKA 1I1SA 2QBYB 5AIQA 4G6QA 4PDKA 1HW2A 1YS7A 3B73A 2L01A 1D8KA 1HBXG 4U88A 1BM9A 2STTA 1ZRCA 1G3TA 1SFEA 3TO9A 2VE8A 1XSDA 2VONA 2Y48A 3J81Z 3CO6C 1T0FA 2RDPA 2QQBA 2EK5A 3NQOA 4L5IA 2P8TA 3FX3A 1XGSA 3LA7A 3T1BA 2XAFA 2W24A 4IHTA 1U3EM 2XASA 2XRNA 2ISZA 3F72A 4ETSA 4RAYA 4FHTA 3U9GA 2FBKA 4WCGA 3WGIA 3BJAA 3COAC 5ICFA 1K78A 3FMRA 2R7DA 1W4MA 1UHMA 3JSOA 4HZFA 2IA2A 2A61A 4ENNA 5FFZA 2P6SA 4EVIA 3FWEA 1XB4A 3SHFA 1J75A 2CQKA 2VC1A 2ZNYA 3F6OA 4EM0B 4OU0A 4HAMA 3MAJA 3RPUA 3H3ZA 3QU3A 3ZMVA 4HQMA 3KE2A 4GYGA 1Z1DA 3EYIA 1JE8A 4I7HA 3F8CA 1I6XA 4YFKF 5DCFA 4NB5A 5BMZA 4IRHA 4HDUA 1O3QA 3PQKA 5D8LB 4BYYA 4KIFA 2QYOA 2ADUA 2XAJA 4MGRA 5DV5A 1B1BA 3RYPA 2GWRA 1IN7A 3GUDA 4WXDA 1Y0UA 1BN5A 3LA2A 3E6DA 3BPVA 1FLIA 2OZUA 2Z33A 5LLQA 3ISPA 1OMIA 4ZYHA 1Z7UA 3R6SA 5HLGA 3SQNA 5E20A 4ZZDA 4I09A 3LWFA 1P4WA 3VEPA 4HBLA 3M7GA 1KYZA 1RNLA 2PFBA 1CF7A 2BE5F 5D5VB 4H0EA 1IZ1A 2W84A 3L00A 4LJZF 2RKHA 1EV7A 1ZGJA 3WG9A 1U8RA 4CYDA 2HQNA 3HRTA 4MTDA 3EUHA 2O8XA 3HTSB 1DDNA 1LEAA 1HSJA 1FT9A 3J81K 4ZZLA 2YSRA 1IXCA 4XSXF 1UFMA 5JFRA 1TLHB 2F5EA 2XKPA 1QNTA 4I0BA 4IF4A 3E5UA 3MEXA 4M9ZA 5E1WA 3KCCA 3ELKA 5HS7A 1O3RA 4IJAA 4ZYGA 2HOEA 1H9GA 1T98A 2TDXA 3K2ZA 2E1CA 2MLGA 3V8KA 2L3DA 2ZCWA 3IL2A 1UCRA 4TV7A 2IPQX 1WSUA 2W25A 3MCZA 1XSXA 1BBYA 4OMZA 2X4HA 1HKTA 2K4JA 1Z9CA 1MJ9A 1S6LA 3P9CA 1ZAOA 1LQ1A 2ZNZA 1ZG1A 3NEUA 3ZMUA 1X3UA 1MJBA 1FP1D 4KN7X 4RGUA 5FD5A 3DXJF 2GA2A 3CDHA 4IPAA 2PJPA 5D6FA 1YYVA 3B02A 2HFHA 3M9AA 3LFKA 3TO6A 3ROUA 2O6GE 2QUFA 3DV8A 2KJBA 5LGUA 1TTYA 4A0ZA 4S05A 1Z05A 5K5RA 2K27A 2OU2A 1B9MA 3ULQB 1IN4A 3L2CA 3V4GA 2A5YB 3WGHA 2NNYA 5LHGA 2NS0A 1LDKB 3FXUA 1R1VA 1YO5C 1BIAA 2XAGA 1FP2A 3S2WA 4WF2A 1YTYA 2MC3A 2HTJA 3CO7C 5H6QA 3L09A 3BP8A 1OKRA 3TGNA 4EJUA 3KZZA 4AIKA 3CUQA 1PP8F 3ECOA 2RQPA 2C6YA 3E5QA 1EH8A 1TW3A 3IKTA 2L4MA 1I1GA 3WE2A 2MLKA 4BHBA 1VTNC 2STWA 5J8FA 1K6OA 2VXZA 4WK8F 2LNBA 1Z6TA 2OQRA 4CDGA 3U1DA 4Q48A 3RYRA 1ODDA 5HDNA 1FPQA 2E7XA 2ESHA 1BC8C 3O3KA 3GO5A 4IVNA 2BBYA 1U5TB 4LG0B 4KFCA 2ETHA 4WX9A 2M5WA 2CYYA 4QLCU 3QP5A 3LSTA 2F2EA 1RI7A 4HQEA 5HOOA 3RDIA 3DQVC 2FXAA 5DCMA 3W6KB 2QQ9A 5ILUA 1Z91A 3RIRA 1HQCA 1FYKA 1XMKA 3FM5A 2WTEA 1LDJA 1XGNA 1YLFA 3EETA 4RB3C 1L3LA 1V4RA 2KJCA 1IRFA 6PAXA 2FE3A 5CVRA 3CUQB 4HDVA 2H27A 3GXOA 1G3WA 4A5MA 5KK1A 3KP3A 1JXSA 2WWYA 2KRFA 1YQAA 5CVJA 5D5XB 2D45A 1R1UA 1U5TC 1I5ZA 5ICEA 2FQ3A 3RKYA 3I53A 2QBYA 2O3FA 3FMQA 5LRRA 3JTHA 4YIFA 5E1ZB 3GFJA 2HZTA 5K5OA 3JSPA 2JRTA 1DP7P 4RAZA 1SD7A 2H94A 5HDGA 1S3JA 1R22A 5HLIA 5BOXA 3H3UA 5IT3A 3WE3A 5ILSA 2ZJ2A 3BY6A 2IP2A 3FHZA 1F5TA 4ESBA 2IVMA 3R0JA 3P7NA 3C3WA 3WTUC 4GXOA 1KU7A 1QZZA 3JTGA 2V79A 2ESNA 4OINF 4M74A 4U0VA 1XDSA 1QQIA 5TJJA 3CUOA 2JT1A 1FY7A 1ONVA 1ZYRF 2YPRA 4BQAA 1P4AA 4U0YA 3R4KA 2H6BA 1FNNA 4U7BA 1OR7A 3FZVA 2BYVE 2B0LA 1YW8A 2V1UA 3ABUA 3LQRA 3I59A 1S8NA 2IJLA 3M8FA 3R60A 2EFWA 4EJVA 4B8XA 3KP2A 2MH2A 3O6BB 2GIVA 3RKWA 3HRSA 3J80K 1W5SA 2V6CA 2DFIA 4KIBA 4O5VA 2MD5A 3BJ6A 4HYEA 3TO7A 3ZMDA 1ULYA 4L5JA 5BPIA 5H20A 1BJAA 4LLNA 3L7WA 4M9SA 1J7KA 4XSZF 1O7FA 1XN7A 2X0LA 3I71A 1XD7A 3K1MA 3HOSA 3BPXA 4AWXB 2NNNA 4LFUA 2HKXA 3DPTA 3OV8A 5HS9A 3ERED 4HOBA 2ZO4A 3Q9SA 3TDUC 2Q8KA 4A12A 2CFXA 2GXGA 1OYYA 5CVUA 4HV5A 2FF4A 4U7DA 3GLXA 4UV8A 2P7CB 3I4PA 3WTSC 4BH9A 5EEHA 3NRVA 3ECHA 4LGWA 4I0AA 2IT0A 1F9NA 2NYXA 1G3SA 4FX0A 2FNPA 3HIFA 5K5QA 4I01A 1AOYA 3IWZA 3WTXC 1TW2A 4GYIA 4QWQA 3I59B 3V8LA 3I0TA 4D0PA 1T38A 5E8IA 3C1DA 2O61A 1IN6A 3MWMA 3G73A 3HYIA 4IHSA 2ZKZA 1T6SA 4PZJA 1QGPA 4L9VA 2OA4A 2QZ8A 3IWFA 4OIQF 4CGZA 3I5UA 4LMYA 2EV6A 2EFNA 2CW0F 2EJRA 1BIBA 4CICA 3K0LA 5K1YA 2IW5A 1YIOA 2XVCA 2ZMEA 5L3BA 4P5OA 4BXUA 1FWZA 1DUXC 2A3SA 3IHUA 5D8KB 2VBWA 3F6VA 4UXNA 3DEUA 5JHUA 2EA2A 2JSCA 4HLYA 1ON2A 5AONA 2YR2A 4LD5A 1R23A 3CLOA 1OPCA 1WQ2A 3T8RA 5LRSA 4YIIA 1ZN2A 4L0ZB 5FLXK 5DDGA 3D0SA 2F5DA 2DQRA 1R5HA 3SZPA 4A0XA 3O2PE 1ZREA 1IN5A 3N4MA 2AXLA 4RB2C 4M72A 1NHAA 2P5LC 3RI4A 1ZLJA 3RTRA 4DNCA 4CZZA 5CYVA 5J6XA 3RPQA 1E2XA 1W7PD 3KLNA 2A07F 1XCBA 2P5VA 2ZXJA 2ZBKA 1MKMA 1G3YA 2KIMA 4MEYF 2W57A 4EQQA 2UWMA 4HX7A 4L9NA 2OBPA 2A68F 1FBUA 1O7LA 4HF2A 2ZMEB 1UHWA 4CO8A 2KKOA 2LKPA 5ILVA 2K7LA 5JVTA 3BDDA 5LBQA 3HTUA 3WTZA 2DK8A 2NAZA 5E18F 3IKVA 3C7JA 2R7FA 3KEQA 3FF5A 5L3DA 2EV0A 2LF7A 5CVIA 3VB2A 3GYHX 4AIHA 1USTA 3KP5A 2MH9A 2RVCA 1DPRA 4A0YA 3QAHA 5F6FA 1KQ0A 3V7SA 2EFOA 3PQJA 4YFNF 2EA4A 1HSTA 2PBIA 1U78A 3MFKA 2K86A 2FRHA 4HA8A 1LDDA 1U5TA 4LG0A 4G9YA 2DQLA 3QP6A 4KYWA 4MHGA 1WKMA 5HVQC 1JGSA 4P9UA 2L4AA 4PCQA 3TDZC 2QWWA 1YW9A 1TNSA 1IAWA 1FYMA 3N97A 2UZKA 2IA0A 1HKQA 2CO5A 4JK1X 1LEBA 1L0OC 3FXQA 4LB6B 4HF1A 2DTRA
chains in the Genus database with same CATH superfamily
3QOEA 4KN4X 2K5CA 4BY1J 1VQNI 3CC7I 2CU7A 1EH7A 3DP7A 3K9TA 3S1NJ 2OQGA 3CMAI 2AQEA 1KONA 2P6TA 2LSOA 1POGA 3E97A 4IRGA 2R5ZB 4D1QA 1TQIA 2XB0X 4E7SA 2OTLI 1YHQI 3BC8A 4AIJA 4ON0A 2JMWA 2QEXI 3SDBA 4KT5C 1B9NA 4P55A 3ERMA 3HRMA 1H8AC 1ETQA 4RMNA 2V1XA 1QBJA 4CZCA 1H88C 2HYFA 1BJZA 3DKXA 4RB0A 4XLEA 2CW8A 1BW6A 3I58A 2IRFG 4A93J 1G59A 5EDNA 2K9LA 2JQ7A 3G4SI 4G7ZF 3GW2A 3WODF 2D1VA 1JJ6C 2QCOA 3RJPA 2Z99A 4ZYEA 1TWCJ 4XRMA 2LRDA 2F48A 4UV9A 5DTDA 2LP0A 3QODA 2DI3A 3S1RJ 4HW0A 1VQKI 1MGTA 1V55H 3QPTA 2JPCA 3QPSA 3HPHA 5EEGA 3HKZN 4RM2A 1YW7A 4AYBN 4OIOF 2VQLA 1ORKA 3OYFA 4AD9A 1KA8A 4DQ2A 5JR3A 1T2KA 4B3XA 2B7EA 1QRYA 3OIPA 1S29A 2PMUA 2VBYA 3DBLB 3HDDA 3I4NJ 2V6EA 3GZ6A 1K4TA 3GEZA 2ACJA 2W48A 2M7BA 2QSHX 5M3FJ 3ZP5A 3FXMA 3FDYA 1W5CC 3ABMH 2H09A 4XMYA 3F21A 3EPZA 5HS8A 4Q5SF 4I98B 1RESA 2IGNA 2HKOA 2BY0A 2ZB9A 3KFWX 3TW6A 4AVPA 1WI9A 3K4CA 3QPLA 2VKVA 4ZJZA 3J7ZI 1FTTA 3TQNA 3HRUA 3KYCB 3L2QA 1ETXA 2D2WA 1I27A 1W5TA 2X85A 4RGRA 2I10A 2VOOA 5FKKA 5CVVA 4YEJA 5KHDA 3HHGA 3DEWA 2R7VA 1FOYA 1MBEA 2Z5UA 2LOOA 2KZGA 1GXQA 3GTOJ 3K70C 4PGHA 3AKZA 4L9JA 4MFEA 3E7LA 2GXAA 1U9NA 1U9OA 3M1EA 3BR3A 2FSWA 4CCMA 2QQAA 3E5XA 5DD8A 1YITI 2IBDA 2FBIA 4MQVA 2FMLA 1PUEE 1OYWA 1D8JA 1R7JA 4ENMA 4Y15A 1G4DA 1D5VA 2QENA 2F6CA 4ZC3A 3EYYA 1WFXA 3ASOH 4EJWA 1ZG3A 1R9TJ 5J4VA 3MD2A 1FZPB 3WTTC 3ZPLA 4FETA 4LLLA 1Q1VA 3PUFA 4NHJA 2R7OA 4IOCF 2EBIA 2HQ5A 1OQYA 1E0EA 2BVMA 2ID3A 4D5FA 5DUKA 3WU2C 1KU3A 3F3XA 1FBSA 2ZFWA 1P2FA 2E2JJ 3ZOBA 2M1BA 3F8FA 1MZBA 3F8MA 3IAM2 3FM3A 1D3YA 2HXIA 4A3FJ 4A2UA 1JKQC 4BNCA 2R3SA 1T33A 1XDUA 2IS6A 2OJED 2D5VA 2NVTJ 2DMNA 2V7FA 1BOAA 1MIJA 2VQHA 1JHFA 3KYLA 5E1XA 2PN6A 4RLFA 3BOQA 3SXYA 3OL4A 4IEJA 3DFGA 2Q2EA 3P9IA 3H5AA 4JOMA 3I4MJ 2R7XA 3WTVC 3B6CA 5K7ZA 1BI0A 3K4NA 4HLXA 1GV5A 2YU3A 4GGGA 1MJAA 4XLFA 4BBSJ 3Q0WA 3GTKJ 1IW7F 3LQQA 4EATA 4BGDA 2RNGA 3K1NA 1PP7U 1B59A 2EZLA 4EJOA 3HGYA 4HX4A 1N78A 3QRFF 3J7AO 4PGGA 3U2RA 3SDGA 5M3MJ 2HOSA 1B72B 3DTEA 2ELJA 3DCFA 2BW3A 1A5JA 3GCMA 5KVRA 4XIDA 4N0BA 5ICGA 4KISA 2BV6A 1O57A 1RRJA 2MA3A 4EM1A 4WXHA 2PG4A 3DWLE 1F43A 2V4JC 3HOYJ 3GFMA 3M3YJ 3BJOA 4MTEA 5KCMA 5BPDA 1R00A 4UHTA 4CCKA 2WBMA 5D5UB 3BLYA 2CG4A 2ME6A 3FMSA 3FKIJ 1RR7A 2BY2A 2Q1ZB 1IF1A 2EFPA 4XLCA 3KYDB 5IT9Z 4KUMA 2NOGA 1MMDA 2K02A 1JT6A 3S3NA 4XKBA 3TW7A 4X1EA 1BI2A 2XV4S 2KLOA 4CA0A 3AL0B 1W36D 3G71I 3QQAA 4BXFA 3F22A 3J7AY 3HSRA 5FB2A 3JR9A 4XLPF 2E35A 4YFXF 4P9FA 1EH6A 4BXXJ 4JQFA 3LNQA 3BG6A 2XDVA 2CW7A 4C30A 1FJLA 2CMPA 4NQWB 4BQNA 3GF2A 1K4SA 2JUGA 4KA4A 1YI2I 2GA1A 1GVDA 1USSA 3SEZA 2HOTA 2A05A 2IGMA 3FXOA 1ON1A 2H6CA 1TC3C 4RGSA 2RC4A 3HHHA 5L3CA 5E8GA 2EZKA 4PSWA 2GXBA 2VN2A 3ABTA 1R5ID 3LAPA 4G8XA 2ELHA 3ML6A 1HKSA 2Q2EB 3CZ6A 2KISA 3JRHA 1VQ8I 4RS8A 1MNEA 5LGTA 4QTRA 1HW1A 3H5NA 2VT2A 4YG2F 1QPIA 1XX5A 2HVQA 2RV8A 2NOJB 4M9XA 4OMYA 5L3EA 4W1UA 2KRHA 1NTCA 3E6BA 1J0RA 1YRNB 2G7UA 3MKLA 4M6VA 2E60A 4S0HB 1G2HA 3OSGA 1D0ZA 1FBQA 1LJ9A 4DZPA 1W7PB 1X1DA 3GFLA 1A04A 2BXZA 1T39A 2DTZA 3JRIA 3H0GJ 4B09A 1MDMB 1WRJA 4BQQA 2WY8Q 3I54A 3HOTA 3L9FA 3T5XA 1KQ9A 3ZN0A 4FISA 5CPRB 5FLVA 3IRQA 3AL0C 4F7ZA 4O3MA 4BL0B 1FX7A 3GWZA 3QYEA 1ETOA 2HQRA 4L18B 1KQ8A 1R1TA 3OIQA 3FXLA 1P6RA 2XF7A 2WC2A 1FOXA 4E7JA 1HCRA 1U0JA 1RUNA 2V1DA 1X3ZB 3OYNA 2TRTA 3TOAA 3OR1C 4F91B 2L7ZA 5LHIA 3H35A 2GQQA 2FD5A 4IL6C 1DU6A 5B3SH 1S7OA 2E2HJ 1VI0A 3RZDJ 1R49A 1Y8QB 2H8WA 2VXDA 2IS2A 5J47A 2OUMA 4G94A 4E4HA 3MVPA 3DPLC 4PK4A 3CJNA 3VOEA 1FEXA 4G6DA 3BROA 1F4KA 2N8GA 2NRAC 1SD6A 5FO5A 2PQ8A 5DYMA 2WADA 1O3TA 2IS4A 4KT6A 3HUGA 3G1LA 3KETA 2A6EF 3KP6A 2J5PA 2BEOA 2VOPA 1FOKA 3ESWB 4Y52J 5C4XJ 3W6VA 1J9IA 2E5NA 2L9VA 3ZMZA 2JA5J 1HA8A 1RZ4A 4BHPA 1Z21A 4H4KC 3WU0A 3LSPA 4KIGA 3AFHA 4P96A 1S7EA 4OWRB 2MSYA 1LPQA 1DQUA 5ERIA 2AHQA 2BGCA 4C3HJ 3QPHA 2MBFA 4K2EA 4HF0A 2VJIA 4BACA 4EGZA 2RGVA 3CQZJ 4BUPA 4KICA 4XRFA 4IRIA 3NWTA 2FUG2 2X6WA 4M6XA 4FE4A 3O8GA 1KZHA 4EGYA 1R4NB 1SVMA 3H92A 4LIVA 3WGGA 5J1RA 2DT5A 3H36A 5F1RA 4XLNF 2A6TA 1H9TA 1P7JA 3LSRA 4M3GA 1LB2A 3SFIA 1BC7C 2JK3A 3E6CC 1KU2A 3S17J 3WTYC 4ENKA 2AO9A 2DYSH 3E1SA 1AHDP 2VE9A 1STZA 1E17A 3OOPA 3HOXJ 1SVOA 5DD4A 3D1NI 3RQIA 2PI0A 4XR6A 1S5LC 1H0MA 4UVAA 1XCVA 2DW4A 2P4WA 2LDUA 4U87A 2CV2A 1OYIA 2O5RA 3AG2H 3GX4X 3G3ZA 4ZYDA 2CUZA 5H6RA 4HNVA 2HEOA 1FSEA 5FROA 5IT9K 4ESFA 2FU4A 4AM3A 3U21A 3CMEI 2YX7A 1OR7C 3MQ0A 3S1QJ 3LSHA 3VFZA 4PFPA 3IH4A 5B5EC 2LKXA 3DF8A 3TMOA 4E7LA 1TQMA 4ESJA 1ZARA 3UNGC 4NUBA 4LB5A 1J2XA 4QPQA 2W85A 3S2HJ 2R7QA 3JW4A 2VLAA 1LFUP 2L02A 3V7CA 5M5WJ 1B6AA 2P0WA 1BA5A 1HC8A 4A6DA 2EB7A 2VBZA 3M8JA 2KFDA 4UUTA 2V1NA 2X1CA 3HUGB 1D5YA 1K78B 2XF5A 2GZWA 2CSOA 1V5FA 2A5WA 4LIUA 1C0WA 2Z9OA 4FT8A 2PX9A 4GRIA 2XROA 2AXTC 4CYCA 1FYLA 4N4NB 2ME0A 2XPUA 3LL7A 3VYRB 2R4GA 2HS5A 2EIKH 1FSHA 4BHCA 1QHHD 4Q4ZF 4G7OF 3JAMZ 2CUJA 2HTSA 3I3LA 3DBHB 3A01A 2K9MA 4PSXA 1YG2A 2J5OA 2M30A 1LE8A 1IDZA 2X6XA 2Y0MA 3T0YA 2OD5A 2O0YA 2Q0OA 1REPC 1SANA 1X1BA 2XAHA 1T0FC 1SAUA 5A2QZ 4CXFA 3OYHA 2F5FA 2QVOA 1TBXA 1JHHA 2K9NA 3GZ5A 4OOIA 2PEXA 3MZ8A 1JUSA 2HGCA 4UVCA 4IZZA 2CGPA 4A3JJ 2A6HF 3K69A 2RN7A 2XSDC 4JBAA 1HDPA 1CQTA 2LF8A 4KMFA 5HLHA 4RGXA 2K4BA 3WU1B 3CCVI 2IAIA 1BW5A 1SMYF 4RLQA 1MBHA 3BR1A 1MH4A 1T8IA 2M8EA 5M5XJ 2AS5F 3HBLA 5DEQA 3QU6A 2VI6A 4HX8A 4F55A 2UXNA 4Y17A 2M4KA 5BQTA 2XGXA 4M3BA 4BKXA 4MFDA 2OZ6A 5LEKA 1JUMA 1RUOA 2HDCA 1X4OA 2Y0SA 1MSEC 3DKWA 4MNUA 3SYTA 1TT0A 2OC6A 2DU9A 1WI3A 1QZYA 1XMAA 4XM3A 3BZ6A 1YFHA 1VQMI 4XBFA 5IY5H 2XUBA 4GO1A 2FQ4A 1KU9A 3E6MA 4NNJA 3IC7A 2HQAA 2JN6A 4I02A 5L3FA 3PO2J 4LG3A 2RQQA 4OIPF 3F23A 2X1DA 1VF9A 2FA5A 3V8JA 1U2WA 1VQLI 2ZXIA 1ZH5A 3GTLJ 2R7TA 3JRBA 2O03A 5FFXA 4F52A 2IA1A 4B44A 2DO7A 4M73A 3ZQ7A 4G7HF 1R58A 3LAJA 5GAGJ 3I64A 1O3SA 3KZYA 1Z6RA 1BR1A 4FX4A 3TEDA 2KIUA 4EJTA 4UUVA 2JVHA 3FBIB 1F36A 1A35A 2DA4A 3R0AA 1P92A 3ZCOA 3K4KA 5ICCA 2ZJRF 1SC7A 1J59A 1XGMA 1RETA 1WVRA 2CQ7A 2L9SA 2EIJH 1CF7B 4CYCB 3I9V2 2LKSA 3BT9A 4DZJA 1ZLKA 5D4RA 3CMMA 2CJJA 3GTQJ 1ETVA 2KHMA 3A01B 4A3KJ 4MEXF 2DPDA 3GVAA 3IH3A 3I55I 1IUYA 3IUOA 1MMAA 4RB1A 2JZYA 2ECBA 1LE8B 4XQFA 3CD6I 3AAFA 1S72I 2CUFA 4LLGF 2O9LA 3MMYB 3RKXA 1QVUA 2WAQN 4Q47A 5H2FC 2COMA 5D4SA 4DW6A 1QPMA 2FNAA 2OF7A 1LFBA 1TNTA 2KIFA 4XORA 2E7WA 3F8NA 2VBXA 5JVGF 3ZMTA 4B1RA 2EFQA 2EQRA 3NARA 5CQGA 2YX4A 4S04A 3V42A 2JSPA 3N05A 1GUUA 1ZGAA 3ZGKA 5JI6A 1RIOH 2NS8A 4OIRF 3RQ4A 4HNTA 2OAZA 1IUFA 1IXSB 3EDPA 3TKYA 2JRMA 3IH2A 2FBHA 4HEA2 4XONA 3S15J 2GAUA 1DGRM 4DGWB 3GTGJ 1ZQ3P 1SFKA 2DPUA 1WH5A 4XRSG 2PLYA 1A6IA 3HSFA 2MD0A 5E79C 2MFZA 3PUBA 1GXPA 2G7HA 4KNYA 2D1HA 2DK5A 1W0UA 2DOAA 5J8CA 2P7VB 1ZKGA 4PJJA 2P5KA 1PDNC 2BZTA 1ZRDA 3E3VA 3OYKA 1MMNA 5LEJA 3HSEA 4I6ZA 2PMHA 3G1OA 5L3GA 2MGQA 3RPUD 4C3IJ 1SFUA 3ABKH 3EQLF 1E3HA 2Z3YA 3FXRA 5D5WB 3P9KA 4KMUX 1QHGA 2FOKA 4U0WA 1F1ZA 4EMSA 1JI8A 4XKVA 1GDTA 2CV1A 5GTIC 2QKMB 5IOZA 5F04A 3M8EA 1UG0A 3MZHA 5DUIA 3JAMK 4R79A 1WJCA 2CUEA 2M87A 4O6JA 4R1HA 2DAOA 3EUHC 2DA2A 5KAIC 1DPUA 3K1PA 1IN8A 3D5LA 3PFIA 1LNWA 4UNOA 1IRGA 2G9WA 1BI1A 2DYRH 1QO0D 1Z3YA 2OV7A 4A5NA 5A2QK 4PJ0C 3J80Z 4CHUA 2VKEA 4QPOA 3DPUA 4LK0F 3K6GA 1TQPA 4MQ9F 3C18A 3BZKA 1B72A 2DLLA 4RDUA 3IP4B 3CCRI 1EA3A 4L5EA 4M3FA 2Z16A 2JPBA 1UB9A 3NWSA 5F08A 3SEQA 2XPWA 3S16J 3CTAA 1WH7A 3BTIA 2B63J 2VODA 4BY7J 1B4AA 3PSIA 4BAYA 4ANJA 4RAGA 2VC0A 2Y0SN 3BQZA 1SAXA 4D7NA 2EWNA 1ETKA 2DFFA 5D6EA 4Z2YA 3VODA 1X4PA 3KZIC 4E70A 4A3CJ 2DBBA 4X6AJ 2COBA 3WHCA 2LG4A 1YS6A 3BWGA 3BTCA 4V19K 3G6EI 2E2IJ 3KLOA 3PIPF 4LK1F 5IP6A 4ZTJA 3RKQA 1IXRC 3Q5FA 3MZYA 1K79A 4HSRA 1RR8C 3GBGA 2M45A 2UXXA 2XHKA 1VQ5I 2GM4A 1ZG5A 2A69F 1KYWA 2XAQA 1X1CA 2ISYA 1WWXA 4LOCA 4A3EJ 3HJEA 4CCJA 3JRFA 2DMUA 1IO2A 3KP7A 4M6YA 1XGOA 1WJAA 4DYCA 2Y31A 3DTKA 5CJ9A 3CCYA 1GV2A 3AG3H 4L0YB 2E34A 1WJ5A 2Z1DA 2Y75A 1R5GA 1BI3A 2V9VA 3G1MA 4UB6C 4J19A 1W36C 3OYCA 3ZR8X 1ZRFA 2X48A 2QM3A 4NQWA 3DU5A 1HW5A 1K83J 4I76A 1XC5A 2IEKA 2VASA 2KDOA 3QYBA 2RNJA 3QOPA 3TOBA 4CCLA 1IG7A 4EM2A 5E3MA 3WTWC 3R61A 2LY2A 4RBOA 3PJRA 4N9HA 4M71A 2ECCA 1SD4A 2FEZA 4A6EA 1J5YA 2E1MB 1E3OC 5TRDA 1HXDA 3TBIA 5E3LA 1LVAA 4HPQA 3FXKA 1D0YA 2LREA 3IRRA 1XSVA 3ZMSA 1JKOC 5GP9A 2O8KA 1JKRC 1EKEA 3CCMI 3S8PA 5FD6A 4W97A 1LFPA 3ZN1A 1Y39A 1P4XA 3FKJA 4WWCA 2QLZA 3ZQGA 4ASNA 5LGNA 1SMTA 1BOBA 1ETWA 2CS3A 1YRNA 1GHCA 2JUCA 3ZQFA 5AIPA 5KNLA 4IO9F 2W4SA 1MD0A 2XIGA 3KEOA 1JTXA 5GTHC 2EZHA 1M1EB 1SD5A 3PM1A 3CP8A 3SFZA 3GTJJ 1W7PA 1X1AA 2AQFA 2JTVA 3F8BA 1UZCA 2HYGD 4HV6A 2IS1A 4I2OA 5E17F 3S2DJ 5F64A 1MDMA 2VT3A 5FGMA 3T8TA 1N25A 5CLSA 1HOMA 3LA3A 2VPLA 2O7OA 4GFBA 2Y69H 2CWEA 3Q9VA 4XLHA 2QQ8A 1P9QC 1FC3A 4R8HA 3S14J 2FJ1A 3CESA 2XGEA 2K3PA 1CGPA 1GVJA 3V7RA 2XRLA 3CCEI 1R36A 3CUQC 1GLNA 4EV0A 4ENJA 3KP4A 5DCMB 1E3PA 5J1YA 2L54A 2MC4A 4N9IA 1K7AA 2X51A 3FXJA 3RCOA 2XKOA 5F0CA 3BCBA 2DOFA 4ZH4F 3NAUA 4Y13A 3H9JA 2M34A 3OYBA 1G6NA 1SFXA 5BS6A 5LHHA 2TCTA 1ZHFA 5GADJ 2E1NA 4BE0A 1U6GA 2E1MC 5FRNA 4IXAA 2W7NA 5E3OA 1BL0A 2HR3A 2JJ7A 2KQRA 3DKYA 3REOA 3K4LA 1T08B 3GFIA 1S7AA 1UG2A 1UMQA 3ZQIA 1RC9A 1N75A 3RSNA 1PUFB 4KDPA 1MH3A 3UR3C 3W6JB 4J00A 5FRMA 2M2EA 3BG3A 1AWCA 1KGSA 2DMTA 2EV5A 2BHYA 5ED4A 5FLXZ 3SZTA 4UVBA 4J01A 4XKWA 1Q1HA 1ACIA 2F5CA 1OISA 2WV0A 1APLC 2FMYA 4GCVA 3FK7A 3S1MJ 2LY1A 4L9TA 1V3FA 2M7AA 2DDBA 3OYAA 2HWVA 4WXCA 5HDKA 2XC7A 4M3DA 1I1SA 1MMGA 2QBYB 2KIQA 1ZK8A 3GLLA 5AIQA 4G6QA 2G0EA 4PDKA 4M3EA 1HW2A 1EF4A 3OMYA 1YS7A 1I3AA 1UELB 3B73A 2R7SA 1FMVA 2L01A 1D8KA 1HBXG 3OOUA 1PYVA 3OS0A 2UV1A 4XL9A 2DA7A 4U88A 4NC6A 1BM9A 2STTA 3VWBA 1Y6IA 1MMSA 1ZRCA 1G3TA 1SFEA 3TO9A 2VE8A 2H1KA 1XSDA 2VONA 2Y48A 5JLXA 4HRIA 4BJTA 3J81Z 3CO6C 1T0FA 2RDPA 2QQBA 2R93J 2DA3A 2EK5A 3NQOA 1WPKA 5F0HA 4JX5A 2KZVA 4L5IA 5EF6A 1LKXA 4X0GA 2P8TA 1K6YA 3FX3A 1XGSA 3LA7A 1O4XA 3T1BA 2NS7A 2XAFA 2W24A 4A3IJ 4IHTA 1U3EM 1MNDA 2XASA 1HLVA 2BY1A 2XRNA 2QA4I 2E1OA 2FX0A 3U1KA 2ISZA 3OWTA 3F72A 4FCYA 3HOZJ 4ETSA 2OPTA 4RAYA 3LSKA 4FHTA 1ZGWA 1OCOH 3U9GA 3S3OA 4HG2A 2FBKA 4DYQA 5M5YJ 4WCGA 3WGIA 3HM5A 3BJAA 3COAC 3M1CA 4E7KA 1TWAJ 5ICFA 1K78A 3FMRA 4II2A 2K85A 4PJNA 2R7DA 1W4MA 1UHMA 2VB6A 3JSOA 2L9NA 3DLLF 4HZFA 3CCQI 1VQ4I 2IA2A 2L7FP 2A61A 4ENNA 5FFZA 1Z0XA 2P6SA 4CSWA 4EVIA 3QYFA 3FWEA 1XB4A 1Y1VJ 3SHFA 4ZDLA 1T56A 1D1CA 3CF2A 1J75A 2IGKA 2CQKA 2VC1A 2CQXA 2ZNYA 3F6OA 4EM0B 4OU0A 4HAMA 3HOVJ 3MAJA 3RPUA 3H3ZA 1X3WB 3QU3A 3ZMVA 1R71A 4HQMA 2DFEA 1VNDA 3HGGA 4OAYA 3KE2A 4GYGA 1I39A 4FASD 5IYBJ 1Z1DA 2ZFUA 4PFOA 4B4CA 3EYIA 4E7ZA 2B9SA 1JE8A 4I7HA 1WJFA 3F8CA 1Y1WJ 1I6XA 4YFKF 5DCFA 2YS9A 4NB5A 1H89C 5BMZA 2X9DA 4IRHA 4HDUA 2LYCA 4IHYA 1O3QA 4BJ6C 3PQKA 2QKLB 5IPAA 2ID6A 4BU2A 4G12A 5D8LB 3J7YJ 4BYYA 4KIFA 2QYOA 2ADUA 4D5CA 2XAJA 2R5YB 1GT0C 4MGRA 5DV5A 1B1BA 3RYPA 2GWRA 2VKHA 5CKTA 1IN7A 4YELA 3GUDA 3LSIA 4WXDA 2MABA 1Y0UA 4IHVA 2DA1A 1BN5A 3LA2A 3E6DA 3BPVA 3W2VA 1FLIA 4PJLA 2OZUA 3WHBA 2Z33A 4JX6A 4A3BJ 5LLQA 3ISPA 3S3MA 1XG1A 1OMIA 1ZTRA 2NVYJ 3BZCA 4ZYHA 2NVUB 1Z7UA 3R6SA 5HLGA 5F0FA 3SQNA 3JREA 2EIMH 3W2AA 5F27A 2ZSHB 3JRDA 4XICA 5E20A 2XAUA 4ZZDA 2Y2ZA 4I09A 2K3FA 3LWFA 1P4WA 4RA2A 3VEPA 1YJWI 1IRZA 1YX5A 4F93B 3OYLA 2YUSA 1YX3A 4HBLA 3BQYA 3JRCA 3M7GA 1KYZA 2L7MP 2KMUA 3FISA 2H8RA 1RNLA 2PFBA 1CF7A 1FOWA 2BE5F 5D5VB 1VQ6I 3KEYA 2LTPA 3OYGA 2VJJA 4H0EA 1IZ1A 4RAFA 3SZGA 1AKHB 2W84A 3L00A 4LJZF 2RKHA 1EV7A 4B3AA 3ONQA 3HOWJ 2XF6A 5B1BH 1ZGJA 2LBFA 3WG9A 3FHNA 1BR4A 1U8RA 4CYDA 1NG6A 2F5VA 1EJ9A 2LH9A 3HB9A 3PNTA 2HQNA 3HRTA 2GBYA 4Y33A 4MTDA 3EUHA 4MIMA 2O8XA 2R7WA 3HTSB 1DDNA 1LEAA 3H9QA 3LMMA 5EG0B 3H5RA 1HSJA 1FT9A 3J81K 5TGTA 2JA2A 3HKZA 4ZZLA 3SJMA 2YSRA 1IXCA 4XSXF 1UFMA 5JFRA 3GZNB 2NVXJ 1TLHB 2F5EA 2XKPA 1VQ7I 3HOUJ 1QNTA 2WB1A 4I0BA 4IF4A 3E5UA 3MEXA 4M9ZA 5E1WA 3KCCA 3L2UA 3ELKA 3E0JB 3FK6A 1JUPA 5HS7A 5EZHA 2ZJPF 1YJ9I 1O3RA 5LD2C 1OCTC 1VQOI 1ERDA 4DBRA 5J3LA 4IJAA 2JA6J 4ZYGA 2HOEA 2DJNA 4C2UA 4IHWA 2W00A 1H9GA 1T98A 4QSHA 2TDXA 4BDYA 2DA5A 3K2ZA 4F3QA 2E1CA 2MLGA 3Q0VA 4ZYAA 3V8KA 2L3DA 2ZCWA 4E7HA 2OTJI 3IL2A 1UCRA 1X1PA 3CC2I 5HNFA 2ZJQF 4TV7A 2IPQX 1ZELA 1WSUA 2W25A 3MCZA 1XSXA 3S93A 1BBYA 3F0CA 1MBGA 4OMZA 3TL4X 2X4HA 4B47A 5JLWA 1HKTA 1DP3A 5J4YA 2K4JA 2LR8A 1OCRH 1Z9CA 1MJ9A 1S6LA 3P9CA 1ZAOA 3VYSB 2EILH 4Y7NJ 1LQ1A 1TZLA 1OCZH 2ZNZA 1ZG1A 3NEUA 1QVTA 3ZMUA 1X3UA 1MJBA 1FP1D 4KN7X 2LK2A 2V9PA 4RGUA 5FD5A 3DXJF 2CV0A 2GA2A 4NC7A 3VSLA 2VPRA 3CF5F 4UY8I 1MNMC 3CDHA 3H9GA 4IPAA 4XK4A 3CCJI 2PJPA 4Y4RA 5D6FA 1YYVA 2WA0A 1OCCH 3C2GA 3B02A 2HFHA 1R4MB 2KL4A 3A4CA 3M9AA 3LFKA 3F9KA 3TO6A 1VQPI 3K4BA 2BOLA 3ROUA 2O6GE 2K40A 2QUFA 3M07A 3DV8A 1R6RA 2KJBA 5IP7J 1VZ0A 3CDLA 2LBFB 1I50J 5LGUA 1FMWA 1TTYA 1QZEA 2Y9YA 4A0ZA 4S05A 1Z05A 5K5RA 2JA7J 3ZRGA 3PSFA 2R0QC 1SFOJ 4JYKA 2K27A 2ZMEC 4IKFA 2OU2A 1B8IA 2X6YA 3ZQLA 1X58A 1B9MA 3DTIA 3ULQB 1AU7A 1IN4A 3L2CA 1K61A 3V4GA 5DS9A 2A5YB 3WGHA 4JP0A 2NNYA 5LHGA 5F1JA 3CCLI 2YU9J 2NS0A 1LDKB 1MBJA 3FXUA 1R1VA 2F4MB 3PFYA 3CMYA 1YO5C 1JKPC 4XLAA 1BIAA 3EUAA 2XAGA 4XNFA 1FP2A 2XSJC 3G2BA 4MLOA 1S9HA 2QGUA 3Q3SA 3S2WA 2K9QA 4WF2A 4B48A 1YJNI 1YTYA 2MC3A 3OYJA 2HTJA 3CO7C 5H6QA 3L09A 3ASNH 3BP8A 1OKRA 3TGNA 4EJUA 3GTMJ 1Z3XA 4ZTFA 3H3VK 4D9JA 4KJZA 3KZZA 4AIKA 3CUQA 1PP8F 3BTLA 4AC0A 2QF7A 1AA7A 2E36A 2L0KA 3ECOA 2RQPA 3MKYB 4BEHB 2C6YA 3E5QA 1EH8A 3O8HA 1TW3A 3IKTA 2L4MA 5C44J 1A36A 1I1GA 2E19A 3LSMA 3WE2A 2MLKA 4BHBA 5GPCA 3OR2C 1VTNC 2STWA 5J8FA 1K6OA 4AVZA 3VYTB 2VXZA 5GAHJ 4C9YA 2X6OA 4WK8F 2LNBA 1Z6TA 2OQRA 4CDGA 3U1DA 2BVLA 4Q48A 2MW8A 3RYRA 4F92B 1ODDA 5HDNA 1FPQA 1QU3A 2E7XA 2ESHA 1A6QA 1BC8C 3O3KA 3GO5A 4IVNA 2BBYA 5CQEA 1U5TB 2VJ4A 2WB1N 4LG0B 2PJRB 3HC7A 4KFCA 2ETHA 4WX9A 2M5WA 1DU0A 3CP2A 2CYYA 4QLCU 3QP5A 2R7UA 3JCUC 3LSTA 2F2EA 1RI7A 2CH0A 4HQEA 1B8IB 1Y8RB 5HOOA 3RDIA 3BR6A 1YIJI 1WZ2A 2L2OA 3DQVC 5KAFC 1W1WE 2M8GX 5BNGA 2FXAA 5DCMA 1Z77A 3K2AA 3W6KB 5FLMJ 3CJRB 2QQ9A 5ILUA 1Z91A 2LY9A 3RIRA 1HQCA 5DM6F 3DBRB 1FYKA 1XMKA 3FM5A 2WTEA 4UUSB 1LDJA 1XGNA 1FIPA 1YLFA 1TP4A 3EETA 9ANTA 4RB3C 1L3LA 1LVKA 4CCNA 1V4RA 1I3QJ 2MYSA 2KJCA 3I56I 1ENHA 1IRFA 2KPMA 2I5UA 6PAXA 2FE3A 4XKCA 1IGNA 3C2HA 5EGOA 5CVRA 5DM7F 2M4GA 1NK3P 2OCEA 5IOYA 4E7IA 3CUQB 1PUFA 4HDVA 2H27A 3MN2A 3GXOA 1G3WA 2ZC2A 4A5MA 1NH3A 2I8DA 4IQ4A 2PMZA 5KK1A 3KP3A 3HG9A 1P7IA 3AG4H 1JXSA 3ZQCA 5E3NA 5FKNA 1WJDA 4BE2A 3GMEA 4A69C 2KRFA 4E6KG 2WWYA 1YQAA 3K4MA 5CVJA 5D5XB 1R1UA 1WJEA 3HZJA 2D45A 1U5TC 1I5ZA 5ICEA 3CLQA 2FQ3A 3RKYA 3BG5A 3H1CA 3I53A 3L2WA 2QBYA 2O3FA 3FMQA 5LRRA 3PIOF 3JTHA 2EPFA 4DJAA 4AUXA 4YIFA 3LSJA 5E1ZB 1Y56A 3GFJA 1TT5B 2XGDA 4HSTA 2HZTA 1JT0A 5K5OA 3JSPA 2JRTA 3BG9A 1DP7P 4RAZA 1SD7A 2H94A 5HDGA 1S3JA 1MBFA 1R22A 5HLIA 5BOXA 3W2WA 3H3UA 5IT3A 3WE3A 4A3DJ 5ILSA 3OYDA 2ZJ2A 3BY6A 2IP2A 3Q0UA 1W0TA 2F4IA 3FHZA 1F5TA 4ESBA 4IHXA 2IVMA 3K4JA 3R0JA 3P7NA 3A0BC 3C3WA 3WTUC 4XN3A 4GXOA 2HYJA 1KU7A 3L2RA 1QZZA 3JTGA 2V79A 1YOVB 3VYUB 2ESNA 3BR2A 4OINF 2X1EA 4M74A 4YIRX 4U0VA 1XDSA 1QQIA 3KPHA 5TJJA 5K7FA 2LD5A 3CUOA 2JT1A 2M9HA 2KRCA 2HPIA 1XPXA 1FY7A 1X2MA 3K70D 1ONVA 4QIWN 5LFAA 4OAZA 3K10A 1IC8A 1ZYRF 1UJ8A 1OJLA 2YPRA 4BQAA 1P4AA 1TWFJ 4U0YA 3R4KA 2H6BA 1FNNA 2DDAA 1MSFC 4U7BA 3DEEA 5EGOB 2LMDA 1OR7A 3FZVA 2BYVE 1VFCA 2B0LA 3VSKA 1U8BA 1YW8A 2V1UA 4A3LJ 3A03A 3ABUA 1Z67A 4NBQA 3VDXA 3PNYA 3LQRA 4V2GA 3TP3A 2VJ5A 3I59A 1S8NA 3MKWB 5IYDJ 4PJMA 3DU6A 2IJLA 3M8FA 3R60A 2EFWA 4EJVA 1XS9A 4B8XA 4BQOA 4A3MJ 3KP2A 2MH2A 3O6BB 1J09A 2DCEA 2DFHA 2GIVA 3RKWA 1IV8A 3HRSA 3J80K 1D1BA 1W5SA 2M3AA 5EEAA 2V6CA 2DFIA 4KIBA 4O5VA 2MD5A 2F4OB 5FJ8J 3BJ6A 5IP9J 4HYEA 3CJQB 3TO7A 3ZMDA 1NG7A 1ULYA 4HNUA 4L5JA 1JJ8C 1X2NA 2Z2SB 5BPIA 5H20A 4IX7A 5J40A 1BJAA 3P5JA 4BBRJ 4LLNA 2DMPA 2P81A 4G6TB 1HDDC 2V26A 3L7WA 4M9SA 1J7KA 3QWLA 4XSZF 4XN0A 1O7FA 1IDYA 1DGWY 2DN0A 1XN7A 2X0LA 1OLTA 3I71A 2R5YA 4DIQA 1XD7A 3K1MA 5TISC 4DOZA 3BPXA 4I99C 4AWXB 3HOSA 2NNNA 4LFUA 2HKXA 3DPTA 1IV6A 3OV8A 5HS9A 2QSFX 3ERED 2WAEA 4HOBA 1MW7A 2LVSA 2ZXWH 4FTHA 2ZO4A 2H1LA 3Q9SA 3TDUC 2Q8KA 3HPGA 4A12A 2CFXA 2GXGA 1OYYA 3MKZA 5CVUA 4HV5A 1I6HJ 2FF4A 4U7DA 2LC2A 4II3A 2BW3B 3GLXA 2ZXHA 4UV8A 2P7CB 2HXOA 2PMZN 3A2KA 3I4PA 2BY3A 2IGOA 1RKTA 3CDIA 3KIOA 2HDWA 4BJ5C 3WTSC 2HVSA 5C4JJ 4BH9A 5EEHA 3NRVA 2RAEA 3K7AJ 2HDDA 3ECHA 2KT0A 4BS9A 3BCAA 2DMQA 4LGWA 4I0AA 4Z6YA 2IT0A 2DA6A 1F9NA 2NYXA 5J1UA 1G3SA 2V9KA 4FX0A 4C3JJ 2FNPA 3HIFA 5K5QA 4B43A 4EEFG 4I01A 1AOYA 3IWZA 3WTXC 1TW2A 4GYIA 1RKWA 4QWQA 3I59B 2XGCA 3EUKL 3V8LA 3I0TA 4D0PA 1PJRA 1JTYA 1AKHA 4YRVA 1T38A 2IXSA 5E8IA 3C1DA 3OS1A 5IYCJ 2O61A 1WHUA 2WAFA 5FKOA 1IN6A 2R92J 2XB5A 4ZDOA 3MWMA 3S32A 3G73A 1VQ9I 3HYIA 2GOXB 4IHSA 2ZKZA 1T6SA 1T95A 4PZJA 1QGPA 5EG0A 3PO3J 4L9VA 3A1YA 2OA4A 2VUMJ 2QZ8A 2HPMA 3IWFA 1WCMJ 4OIQF 4CGZA 3I5UA 1BR2A 4NC8A 4LMYA 2UUZA 2EV6A 5EZGA 2CRGA 2XPVA 2EFNA 2CW0F 2OCCH 3L2VA 5HODA 2EJRA 1BIBA 1V54H 4XOPA 4CICA 5GPAA 2W1OA 2VQGA 3K0LA 5K1YA 1HF0A 1ZR2A 2IW5A 1XMXA 4N4OB 2EZIA 1MBKA 1YIOA 2XVCA 2ZMEA 5L3BA 1TWGJ 1IRXA 1D1AA 4P5OA 3RZOJ 2HI3A 4BXUA 2BXYA 1FWZA 2HZDA 1DUXC 2ICWG 4MO7A 5FKLA 3FIWA 2RREA 2A3SA 3IHUA 5D8KB 1QA6A 2VBWA 3F6VA 3ZXSA 4UXNA 2VL8A 3DEUA 3CC4I 2K9SA 5JHUA 2EA2A 1Y0NA 2JSCA 4HLYA 1JGGA 1ON2A 5AONA 2WAQA 2YR2A 3JRAA 4LD5A 1TWHJ 3X2QH 1R23A 3CLOA 1OPCA 3CCSI 4JX4A 4ITVA 1WQ2A 3T8RA 4YIIA 5LRSA 3OSFA 3D5RC 1ZN2A 3A0HC 4CUGA 3TP0A 2HVRA 4L0ZB 2JWTA 5FLXK 3W3CA 5DDGA 3D0SA 3HL2A 2DT7B 3A02A 3KX2A 2F5DA 4Y3OA 2DQRA 4IQJA 2CFOA 3OL3A 5B66C 1R5HA 2GIZA 3SZPA 4A0XA 3O2PE 1ZREA 2GOMA 1IN5A 3PL8A 3AG1H 4XOTA 2DT6A 2E71A 4DYRA 3N4MA 2AXLA 4RB2C 2EINH 3LFUA 1X19A 4M72A 1NHAA 2JVGA 2P5LC 3RI4A 1N77A 1ZLJA 3PNVA 3RTRA 4DNCA 3WG7H 4CZZA 5CYVA 2DJIA 5J6XA 1SVLA 4D7MA 3RPQA 2DOEA 1TL8A 3VPRA 3OYMA 1E2XA 4NDLA 2JA8J 1W7PD 3KLNA 2A07F 2DXIA 1XCBA 3FBNB 4CCOA 2P5VA 2KDZA 3B6AA 3ZQHA 2HNHA 2ZXJA 2ZBKA 5GAEJ 3L1PA 4FE7A 2MG4A 1UAAA 4AYBA 1MKMA 4XRSA 1G3YA 1UHSA 2KIMA 4MEYF 5C3EJ 4RM3A 2W57A 5HLTA 4EQQA 4KITB 3BR5A 5B1AH 3OYIA 4AU7A 2UWMA 1WJBA 1FIAA 4HX7A 4L9NA 2OBPA 3CCUI 5FKMA 2QSGX 2A68F 3M4OJ 1FBUA 1YE9A 1O7LA 4DBQA 4HF2A 2W82A 2ZMEB 1IJWC 1UHWA 2EH3A 4CO8A 2KKOA 2HU9A 3UKGA 4UB8C 2LKPA 3ZQQA 5ILVA 3C2BA 2K7LA 3BDDA 1PVEA 5LBQA 5JVTA 1ZR4A 2VQCA 3HTUA 3WTZA 2HOAA 2DK8A 3LOCA 1V5GA 4CH7A 1Z7LA 2NAZA 4BEHA 5E18F 4GDFA 4ABZA 2VIXA 3D5SC 3IKVA 3C7JA 3HXLA 2R7FA 3KEQA 2R5ZA 3FF5A 5L3DA 2EV0A 5K7HA 4BDZA 1OFCX 2LF7A 5CVIA 2ZSIB 3VB2A 1OCPA 3GYHX 4AIHA 1USTA 2FOWA 1G8XA 3KP5A 2M0CA 1WGXA 2MH9A 2RVCA 1DPRA 4A0YA 3BR0A 1NK2P 3QAHA 5F6FA 2DODA 3GTPJ 1KQ0A 3V7SA 2EFOA 2CQNA 3PQJA 4YFNF 2R7ZJ 2EA4A 2NXNB 3IAS2 4AIDA 1HSTA 1D0XA 5EJCA 1RPWA 2PBIA 1U78A 2Y9ZA 2LLKA 1FTZA 3MFKA 4C2TA 2K86A 2FRHA 4HA8A 3LSGA 1LDDA 2KP6A 1U5TA 4LG0A 5EYRA 4G9YA 2E5ZA 2BHZA 2LFBA 2R7RA 1A31A 2DQLA 2PJRA 3QP6A 4C2MJ 5JHFA 4P1WA 4KYWA 4IOAF 3ABLH 4MHGA 2NVQJ 2Y30A 1WKMA 3BG7A 5HVQC 2WY7Q 1JGSA 4P9UA 2CQQA 2L7KA 2L4AA 3DLAA 1SEUA 2L9RA 4PCQA 3H0DA 3TDZC 2ELKA 2QWWA 4A3GJ 1ITYA 3JRGA 2M0MA 1YW9A 1TNSA 1IAWA 1XTAA 5HNHA 1LUJB 1FYMA 4UUSA 4FQGA 3IV5A 3N97A 2VKDA 3OY9A 4PUSA 3OYEA 3OIOA 4ZDPA 4BE1A 2UZKA 1V5EA 2IA0A 3HEFA 4V2FA 1HKQA 2WV1A 2CO5A 1ETYA 4JK1X 4LITA 2GLOA 1LEBA 3CJTB 1L0OC 3FXQA 4LB6B 2L5QA 3OS2A 4HF1A 3BTJA 2DTRA
chains in the Genus database with same CATH topology
4KN4X 1EH7A 3DP7A 3K9TA 2OQGA 2P6TA 2LSOA 3E97A 4IRGA 1TQIA 4AIJA 4ON0A 4KT5C 1B9NA 4P55A 3HRMA 2V1XA 1QBJA 2HYFA 4RB0A 3I58A 2IRFG 4G7ZF 3GW2A 3WODF 2D1VA 3RJPA 2Z99A 4ZYEA 4UV9A 2DI3A 4HW0A 1MGTA 3QPTA 5EEGA 2JPCA 1YW7A 4OIOF 4AD9A 1KA8A 4DQ2A 5JR3A 1T2KA 1S29A 2PMUA 2VBYA 3GZ6A 3GEZA 2ACJA 3ZP5A 3F21A 2H09A 5HS8A 4Q5SF 4I98B 2HKOA 3KFWX 4AVPA 1WI9A 3TQNA 3HRUA 2D2WA 1I27A 1W5TA 4RGRA 2VOOA 5CVVA 3HHGA 2Z5UA 1GXQA 4PGHA 4L9JA 3M1EA 2FSWA 2QQAA 3E5XA 5DD8A 2FBIA 4MQVA 2FMLA 1PUEE 1OYWA 1D8JA 1R7JA 4ENMA 4Y15A 1G4DA 1D5VA 2QENA 3EYYA 4EJWA 1ZG3A 1FZPB 3WTTC 3ZPLA 4LLLA 4NHJA 5DUKA 1KU3A 3F3XA 1FBSA 2ZFWA 1P2FA 2M1BA 3F8FA 1MZBA 3F8MA 3FM3A 1D3YA 4A2UA 4BNCA 2R3SA 1XDUA 1BOAA 1JHFA 5E1XA 2PN6A 3BOQA 3SXYA 3DFGA 2Q2EA 3P9IA 3WTVC 1BI0A 4HLXA 2YU3A 4GGGA 1MJAA 1IW7F 3LQQA 3K1NA 1PP7U 1B59A 4EJOA 4HX4A 3QRFF 3J7AO 4PGGA 3U2RA 5KVRA 4N0BA 5ICGA 2BV6A 1O57A 2MA3A 4EM1A 4WXHA 2PG4A 3GFMA 3BJOA 4MTEA 5BPDA 1R00A 4UHTA 5D5UB 2CG4A 3FMSA 1IF1A 2EFPA 5IT9Z 4KUMA 2K02A 1BI2A 2XV4S 3F22A 3HSRA 5FB2A 4XLPF 4YFXF 4P9FA 1EH6A 4JQFA 3GF2A 4KA4A 2GA1A 1USSA 1ON1A 2H6CA 4RGSA 2RC4A 3HHHA 5L3CA 5E8GA 2GXBA 2VN2A 3ABTA 3LAPA 4G8XA 2ELHA 3ML6A 1HKSA 4RS8A 5LGTA 1HW1A 2VT2A 4YG2F 2RV8A 4M9XA 4OMYA 5L3EA 3E6BA 1J0RA 2G7UA 1FBQA 1LJ9A 1W7PB 3GFLA 1T39A 1A04A 4B09A 1MDMB 1WRJA 3I54A 3HOTA 3L9FA 3T5XA 1KQ9A 3ZN0A 3IRQA 4F7ZA 4O3MA 1FX7A 3GWZA 2HQRA 4L18B 1KQ8A 1R1TA 1P6RA 2WC2A 1RUNA 2V1DA 3TOAA 5LHIA 2GQQA 1S7OA 4G94A 3DPLC 3CJNA 3VOEA 4G6DA 3BROA 1F4KA 2NRAC 1SD6A 5FO5A 2PQ8A 5DYMA 1O3TA 3HUGA 3KETA 2A6EF 3KP6A 2J5PA 2BEOA 2VOPA 1FOKA 1J9IA 3ZMZA 1RZ4A 4BHPA 3WU0A 4KIGA 4P96A 5ERIA 2BGCA 3QPHA 2MBFA 4K2EA 4HF0A 4EGZA 2RGVA 4KICA 4XRFA 4IRIA 4M6XA 4EGYA 3H92A 3WGGA 2DT5A 5F1RA 4XLNF 1H9TA 1LB2A 1BC7C 3E6CC 1KU2A 3WTYC 4ENKA 2VE9A 1STZA 1E17A 3OOPA 5DD4A 2PI0A 1H0MA 4UVAA 2DW4A 1XCVA 2P4WA 2LDUA 1OYIA 3GX4X 4ZYDA 3G3ZA 5H6RA 2HEOA 1FSEA 5IT9K 4ESFA 2FU4A 2YX7A 3MQ0A 3VFZA 3DF8A 1TQMA 4ESJA 1ZARA 4LB5A 1J2XA 2W85A 3JW4A 2L02A 3V7CA 1B6AA 4A6DA 2EB7A 2VBZA 1K78B 2GZWA 2CSOA 1C0WA 2Z9OA 4FT8A 2XROA 1FYLA 2HS5A 1FSHA 4BHCA 4Q4ZF 4G7OF 3JAMZ 2HTSA 1YG2A 2J5OA 2M30A 2Y0MA 3T0YA 2OD5A 2O0YA 2Q0OA 1REPC 2XAHA 5A2QZ 4CXFA 2F5FA 2QVOA 1TBXA 1JHHA 3GZ5A 4OOIA 2PEXA 2HGCA 4UVCA 2CGPA 2A6HF 3K69A 2RN7A 4JBAA 4KMFA 2LF8A 5HLHA 4RGXA 2K4BA 3WU1B 1SMYF 2M8EA 2AS5F 5DEQA 3QU6A 4HX8A 2UXNA 4Y17A 5BQTA 2XGXA 2OZ6A 5LEKA 1RUOA 2HDCA 3DKWA 4MNUA 2DU9A 1YFHA 1QZYA 1XMAA 3BZ6A 4XBFA 2XUBA 4GO1A 1KU9A 3E6MA 3IC7A 4I02A 5L3FA 4OIPF 3F23A 2FA5A 3V8JA 1U2WA 1ZH5A 2O03A 5FFXA 2IA1A 2DO7A 4M73A 3ZQ7A 4G7HF 1R58A 3LAJA 3I64A 1O3SA 3KZYA 1Z6RA 4FX4A 2KIUA 4EJTA 4UUVA 3R0AA 1P92A 5ICCA 1J59A 1XGMA 1CF7B 1ZLKA 5D4RA 4MEXF 2DPDA 1IUYA 3GVAA 4RB1A 2JZYA 3AAFA 4LLGF 3RKXA 4Q47A 2COMA 5D4SA 1QPMA 2FNAA 1TNTA 2KIFA 2E7WA 3F8NA 2VBXA 3ZMTA 2EFQA 2YX4A 4S04A 1ZGAA 5JI6A 1RIOH 4OIRF 2OAZA 1IXSB 3EDPA 3TKYA 2FBHA 2GAUA 2DPUA 2PLYA 3HSFA 1GXPA 2G7HA 4KNYA 2D1HA 2DK5A 5J8CA 2P7VB 2P5KA 1PDNC 1ZRDA 3E3VA 5LEJA 3HSEA 2PMHA 5L3GA 1SFUA 3EQLF 2Z3YA 3FXRA 5D5WB 3P9KA 4KMUX 2FOKA 4U0WA 1F1ZA 4EMSA 3M8EA 3MZHA 5DUIA 3JAMK 4R79A 2M87A 4O6JA 4R1HA 2DAOA 1DPUA 3K1PA 1IN8A 3D5LA 3PFIA 1LNWA 4UNOA 1IRGA 2G9WA 1BI1A 4A5NA 1QO0D 5A2QK 3J80Z 4CHUA 4LK0F 1TQPA 4MQ9F 3C18A 2DLLA 2JPBA 1UB9A 3CTAA 2VODA 1B4AA 4BAYA 2VC0A 1SAXA 2EWNA 4Z2YA 5D6EA 4E70A 3VODA 2DBBA 1YS6A 3BWGA 3KLOA 4LK1F 1IXRC 3Q5FA 3MZYA 1K79A 2M45A 2UXXA 2XHKA 1ZG5A 2A69F 1KYWA 2XAQA 2ISYA 1WWXA 3KP7A 4M6YA 1XGOA 5CJ9A 4L0YB 2Y75A 1R5GA 1BI3A 2V9VA 1ZRFA 2QM3A 4NQWA 1HW5A 3TOBA 2RNJA 3QOPA 4EM2A 3WTWC 3R61A 4N9HA 4M71A 1SD4A 2FEZA 4A6EA 1J5YA 5TRDA 1HXDA 1LVAA 3IRRA 1XSVA 3ZMSA 5FD6A 3ZN1A 1P4XA 4WWCA 2QLZA 4ASNA 5LGNA 1SMTA 1GHCA 5AIPA 1MD0A 2XIGA 3KEOA 1SD5A 3SFZA 1W7PA 3F8BA 2JTVA 4HV6A 2HYGD 4I2OA 5E17F 5F64A 1MDMA 2VT3A 5FGMA 3T8TA 5CLSA 3LA3A 2CWEA 3Q9VA 1FC3A 4R8HA 1CGPA 1GVJA 3V7RA 1R36A 3CUQC 4EV0A 4ENJA 3KP4A 5DCMB 2L54A 4N9IA 1K7AA 2XKOA 4ZH4F 4Y13A 1G6NA 1SFXA 5BS6A 5LHHA 1ZHFA 2E1NA 1U6GA 4IXAA 2HR3A 3REOA 3GFIA 1S7AA 4KDPA 3W6JB 1AWCA 1KGSA 2EV5A 5FLXZ 5ED4A 3SZTA 4UVBA 1Q1HA 2F5CA 2WV0A 2FMYA 4GCVA 4L9TA 1V3FA 2HWVA 4WXCA 5HDKA 1I1SA 2QBYB 5AIQA 4G6QA 4PDKA 1HW2A 1YS7A 3B73A 2L01A 1D8KA 1HBXG 4U88A 1BM9A 2STTA 1ZRCA 1G3TA 1SFEA 3TO9A 2VE8A 1XSDA 2VONA 2Y48A 3J81Z 3CO6C 1T0FA 2RDPA 2QQBA 2EK5A 3NQOA 4L5IA 2P8TA 3FX3A 1XGSA 3LA7A 3T1BA 2XAFA 2W24A 4IHTA 1U3EM 2XASA 2XRNA 2ISZA 3F72A 4ETSA 4RAYA 4FHTA 3U9GA 2FBKA 4WCGA 3WGIA 3BJAA 3COAC 5ICFA 1K78A 3FMRA 2R7DA 1W4MA 1UHMA 3JSOA 4HZFA 2IA2A 2A61A 4ENNA 5FFZA 2P6SA 4EVIA 3FWEA 1XB4A 3SHFA 1J75A 2CQKA 2VC1A 2ZNYA 3F6OA 4EM0B 4OU0A 4HAMA 3MAJA 3RPUA 3H3ZA 3QU3A 3ZMVA 4HQMA 3KE2A 4GYGA 1Z1DA 3EYIA 1JE8A 4I7HA 3F8CA 1I6XA 4YFKF 5DCFA 4NB5A 5BMZA 4IRHA 4HDUA 1O3QA 3PQKA 5D8LB 4BYYA 4KIFA 2QYOA 2ADUA 2XAJA 4MGRA 5DV5A 1B1BA 3RYPA 2GWRA 1IN7A 3GUDA 4WXDA 1Y0UA 1BN5A 3LA2A 3E6DA 3BPVA 1FLIA 2OZUA 2Z33A 5LLQA 3ISPA 1OMIA 4ZYHA 1Z7UA 3R6SA 5HLGA 3SQNA 5E20A 4ZZDA 4I09A 3LWFA 1P4WA 3VEPA 4HBLA 3M7GA 1KYZA 1RNLA 2PFBA 1CF7A 2BE5F 5D5VB 4H0EA 1IZ1A 2W84A 3L00A 4LJZF 2RKHA 1EV7A 1ZGJA 3WG9A 1U8RA 4CYDA 2HQNA 3HRTA 4MTDA 3EUHA 2O8XA 3HTSB 1DDNA 1LEAA 1HSJA 1FT9A 3J81K 4ZZLA 2YSRA 1IXCA 4XSXF 1UFMA 5JFRA 1TLHB 2F5EA 2XKPA 1QNTA 4I0BA 4IF4A 3E5UA 3MEXA 4M9ZA 5E1WA 3KCCA 3ELKA 5HS7A 1O3RA 4IJAA 4ZYGA 2HOEA 1H9GA 1T98A 2TDXA 3K2ZA 2E1CA 2MLGA 3V8KA 2L3DA 2ZCWA 3IL2A 1UCRA 4TV7A 2IPQX 1WSUA 2W25A 3MCZA 1XSXA 1BBYA 4OMZA 2X4HA 1HKTA 2K4JA 1Z9CA 1MJ9A 1S6LA 3P9CA 1ZAOA 1LQ1A 2ZNZA 1ZG1A 3NEUA 3ZMUA 1X3UA 1MJBA 1FP1D 4KN7X 4RGUA 5FD5A 3DXJF 2GA2A 3CDHA 4IPAA 2PJPA 5D6FA 1YYVA 3B02A 2HFHA 3M9AA 3LFKA 3TO6A 3ROUA 2O6GE 2QUFA 3DV8A 2KJBA 5LGUA 1TTYA 4A0ZA 4S05A 1Z05A 5K5RA 2K27A 2OU2A 1B9MA 3ULQB 1IN4A 3L2CA 3V4GA 2A5YB 3WGHA 2NNYA 5LHGA 2NS0A 1LDKB 3FXUA 1R1VA 1YO5C 1BIAA 2XAGA 1FP2A 3S2WA 4WF2A 1YTYA 2MC3A 2HTJA 3CO7C 5H6QA 3L09A 3BP8A 1OKRA 3TGNA 4EJUA 3KZZA 4AIKA 3CUQA 1PP8F 3ECOA 2RQPA 2C6YA 3E5QA 1EH8A 1TW3A 3IKTA 2L4MA 1I1GA 3WE2A 2MLKA 4BHBA 1VTNC 2STWA 5J8FA 1K6OA 2VXZA 4WK8F 2LNBA 1Z6TA 2OQRA 4CDGA 3U1DA 4Q48A 3RYRA 1ODDA 5HDNA 1FPQA 2E7XA 2ESHA 1BC8C 3O3KA 3GO5A 4IVNA 2BBYA 1U5TB 4LG0B 4KFCA 2ETHA 4WX9A 2M5WA 2CYYA 4QLCU 3QP5A 3LSTA 2F2EA 1RI7A 4HQEA 5HOOA 3RDIA 3DQVC 2FXAA 5DCMA 3W6KB 2QQ9A 5ILUA 1Z91A 3RIRA 1HQCA 1FYKA 1XMKA 3FM5A 2WTEA 1LDJA 1XGNA 1YLFA 3EETA 4RB3C 1L3LA 1V4RA 2KJCA 1IRFA 6PAXA 2FE3A 5CVRA 3CUQB 4HDVA 2H27A 3GXOA 1G3WA 4A5MA 5KK1A 3KP3A 1JXSA 2WWYA 2KRFA 1YQAA 5CVJA 5D5XB 2D45A 1R1UA 1U5TC 1I5ZA 5ICEA 2FQ3A 3RKYA 3I53A 2QBYA 2O3FA 3FMQA 5LRRA 3JTHA 4YIFA 5E1ZB 3GFJA 2HZTA 5K5OA 3JSPA 2JRTA 1DP7P 4RAZA 1SD7A 2H94A 5HDGA 1S3JA 1R22A 5HLIA 5BOXA 3H3UA 5IT3A 3WE3A 5ILSA 2ZJ2A 3BY6A 2IP2A 3FHZA 1F5TA 4ESBA 2IVMA 3R0JA 3P7NA 3C3WA 3WTUC 4GXOA 1KU7A 1QZZA 3JTGA 2V79A 2ESNA 4OINF 4M74A 4U0VA 1XDSA 1QQIA 5TJJA 3CUOA 2JT1A 1FY7A 1ONVA 1ZYRF 2YPRA 4BQAA 1P4AA 4U0YA 3R4KA 2H6BA 1FNNA 4U7BA 1OR7A 3FZVA 2BYVE 2B0LA 1YW8A 2V1UA 3ABUA 3LQRA 3I59A 1S8NA 2IJLA 3M8FA 3R60A 2EFWA 4EJVA 4B8XA 3KP2A 2MH2A 3O6BB 2GIVA 3RKWA 3HRSA 3J80K 1W5SA 2V6CA 2DFIA 4KIBA 4O5VA 2MD5A 3BJ6A 4HYEA 3TO7A 3ZMDA 1ULYA 4L5JA 5BPIA 5H20A 1BJAA 4LLNA 3L7WA 4M9SA 1J7KA 4XSZF 1O7FA 1XN7A 2X0LA 3I71A 1XD7A 3K1MA 3HOSA 3BPXA 4AWXB 2NNNA 4LFUA 2HKXA 3DPTA 3OV8A 5HS9A 3ERED 4HOBA 2ZO4A 3Q9SA 3TDUC 2Q8KA 4A12A 2CFXA 2GXGA 1OYYA 5CVUA 4HV5A 2FF4A 4U7DA 3GLXA 4UV8A 2P7CB 3I4PA 3WTSC 4BH9A 5EEHA 3NRVA 3ECHA 4LGWA 4I0AA 2IT0A 1F9NA 2NYXA 1G3SA 4FX0A 2FNPA 3HIFA 5K5QA 4I01A 1AOYA 3IWZA 3WTXC 1TW2A 4GYIA 4QWQA 3I59B 3V8LA 3I0TA 4D0PA 1T38A 5E8IA 3C1DA 2O61A 1IN6A 3MWMA 3G73A 3HYIA 4IHSA 2ZKZA 1T6SA 4PZJA 1QGPA 4L9VA 2OA4A 2QZ8A 3IWFA 4OIQF 4CGZA 3I5UA 4LMYA 2EV6A 2EFNA 2CW0F 2EJRA 1BIBA 4CICA 3K0LA 5K1YA 2IW5A 1YIOA 2XVCA 2ZMEA 5L3BA 4P5OA 4BXUA 1FWZA 1DUXC 2A3SA 3IHUA 5D8KB 2VBWA 3F6VA 4UXNA 3DEUA 5JHUA 2EA2A 2JSCA 4HLYA 1ON2A 5AONA 2YR2A 4LD5A 1R23A 3CLOA 1OPCA 1WQ2A 3T8RA 5LRSA 4YIIA 1ZN2A 4L0ZB 5FLXK 5DDGA 3D0SA 2F5DA 2DQRA 1R5HA 3SZPA 4A0XA 3O2PE 1ZREA 1IN5A 3N4MA 2AXLA 4RB2C 4M72A 1NHAA 2P5LC 3RI4A 1ZLJA 3RTRA 4DNCA 4CZZA 5CYVA 5J6XA 3RPQA 1E2XA 1W7PD 3KLNA 2A07F 1XCBA 2P5VA 2ZXJA 2ZBKA 1MKMA 1G3YA 2KIMA 4MEYF 2W57A 4EQQA 2UWMA 4HX7A 4L9NA 2OBPA 2A68F 1FBUA 1O7LA 4HF2A 2ZMEB 1UHWA 4CO8A 2KKOA 2LKPA 5ILVA 2K7LA 5JVTA 3BDDA 5LBQA 3HTUA 3WTZA 2DK8A 2NAZA 5E18F 3IKVA 3C7JA 2R7FA 3KEQA 3FF5A 5L3DA 2EV0A 2LF7A 5CVIA 3VB2A 3GYHX 4AIHA 1USTA 3KP5A 2MH9A 2RVCA 1DPRA 4A0YA 3QAHA 5F6FA 1KQ0A 3V7SA 2EFOA 3PQJA 4YFNF 2EA4A 1HSTA 2PBIA 1U78A 3MFKA 2K86A 2FRHA 4HA8A 1LDDA 1U5TA 4LG0A 4G9YA 2DQLA 3QP6A 4KYWA 4MHGA 1WKMA 5HVQC 1JGSA 4P9UA 2L4AA 4PCQA 3TDZC 2QWWA 1YW9A 1TNSA 1IAWA 1FYMA 3N97A 2UZKA 2IA0A 1HKQA 2CO5A 4JK1X 1LEBA 1L0OC 3FXQA 4LB6B 4HF1A 2DTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KN4 X;  1EH7 A;  3DP7 A;  3K9T A;  2OQG A;  2P6T A;  2LSO A;  3E97 A;  4IRG A;  1TQI A;  4AIJ A;  4ON0 A;  4KT5 C;  1B9N A;  4P55 A;  3HRM A;  2V1X A;  1QBJ A;  2HYF A;  4RB0 A;  3I58 A;  2IRF G;  4G7Z F;  3GW2 A;  3WOD F;  2D1V A;  3RJP A;  2Z99 A;  4ZYE A;  4UV9 A;  2DI3 A;  4HW0 A;  1MGT A;  3QPT A;  5EEG A;  2JPC A;  1YW7 A;  4OIO F;  4AD9 A;  1KA8 A;  4DQ2 A;  5JR3 A;  1T2K A;  1S29 A;  2PMU A;  2VBY A;  3GZ6 A;  3GEZ A;  2ACJ A;  3ZP5 A;  3F21 A;  2H09 A;  5HS8 A;  4Q5S F;  4I98 B;  2HKO A;  3KFW X;  4AVP A;  1WI9 A;  3TQN A;  3HRU A;  2D2W A;  1I27 A;  1W5T A;  4RGR A;  2VOO A;  5CVV A;  3HHG A;  2Z5U A;  1GXQ A;  4PGH A;  4L9J A;  3M1E A;  2FSW A;  2QQA A;  3E5X A;  5DD8 A;  2FBI A;  4MQV A;  2FML A;  1PUE E;  1OYW A;  1D8J A;  1R7J A;  4ENM A;  4Y15 A;  1G4D A;  1D5V A;  2QEN A;  3EYY A;  4EJW A;  1ZG3 A;  1FZP B;  3WTT C;  3ZPL A;  4LLL A;  4NHJ A;  5DUK A;  1KU3 A;  3F3X A;  1FBS A;  2ZFW A;  1P2F A;  2M1B A;  3F8F A;  1MZB A;  3F8M A;  3FM3 A;  1D3Y A;  4A2U A;  4BNC A;  2R3S A;  1XDU A;  1BOA A;  1JHF A;  5E1X A;  2PN6 A;  3BOQ A;  3SXY A;  3DFG A;  2Q2E A;  3P9I A;  3WTV C;  1BI0 A;  4HLX A;  2YU3 A;  4GGG A;  1MJA A;  1IW7 F;  3LQQ A;  3K1N A;  1PP7 U;  1B59 A;  4EJO A;  4HX4 A;  3QRF F;  3J7A O;  4PGG A;  3U2R A;  5KVR A;  4N0B A;  5ICG A;  2BV6 A;  1O57 A;  2MA3 A;  4EM1 A;  4WXH A;  2PG4 A;  3GFM A;  3BJO A;  4MTE A;  5BPD A;  1R00 A;  4UHT A;  5D5U B;  2CG4 A;  3FMS A;  1IF1 A;  2EFP A;  5IT9 Z;  4KUM A;  2K02 A;  1BI2 A;  2XV4 S;  3F22 A;  3HSR A;  5FB2 A;  4XLP F;  4YFX F;  4P9F A;  1EH6 A;  4JQF A;  3GF2 A;  4KA4 A;  2GA1 A;  1USS A;  1ON1 A;  2H6C A;  4RGS A;  2RC4 A;  3HHH A;  5L3C A;  5E8G A;  2GXB A;  2VN2 A;  3ABT A;  3LAP A;  4G8X A;  2ELH A;  3ML6 A;  1HKS A;  4RS8 A;  5LGT A;  1HW1 A;  2VT2 A;  4YG2 F;  2RV8 A;  4M9X A;  4OMY A;  5L3E A;  3E6B A;  1J0R A;  2G7U A;  1FBQ A;  1LJ9 A;  1W7P B;  3GFL A;  1T39 A;  1A04 A;  4B09 A;  1MDM B;  1WRJ A;  3I54 A;  3HOT A;  3L9F A;  3T5X A;  1KQ9 A;  3ZN0 A;  3IRQ A;  4F7Z A;  4O3M A;  1FX7 A;  3GWZ A;  2HQR A;  4L18 B;  1KQ8 A;  1R1T A;  1P6R A;  2WC2 A;  1RUN A;  2V1D A;  3TOA A;  5LHI A;  2GQQ A;  1S7O A;  4G94 A;  3DPL C;  3CJN A;  3VOE A;  4G6D A;  3BRO A;  1F4K A;  2NRA C;  1SD6 A;  5FO5 A;  2PQ8 A;  5DYM A;  1O3T A;  3HUG A;  3KET A;  2A6E F;  3KP6 A;  2J5P A;  2BEO A;  2VOP A;  1FOK A;  1J9I A;  3ZMZ A;  1RZ4 A;  4BHP A;  3WU0 A;  4KIG A;  4P96 A;  5ERI A;  2BGC A;  3QPH A;  2MBF A;  4K2E A;  4HF0 A;  4EGZ A;  2RGV A;  4KIC A;  4XRF A;  4IRI A;  4M6X A;  4EGY A;  3H92 A;  3WGG A;  2DT5 A;  5F1R A;  4XLN F;  1H9T A;  1LB2 A;  1BC7 C;  3E6C C;  1KU2 A;  3WTY C;  4ENK A;  2VE9 A;  1STZ A;  1E17 A;  3OOP A;  5DD4 A;  2PI0 A;  1H0M A;  4UVA A;  2DW4 A;  1XCV A;  2P4W A;  2LDU A;  1OYI A;  3GX4 X;  4ZYD A;  3G3Z A;  5H6R A;  2HEO A;  1FSE A;  5IT9 K;  4ESF A;  2FU4 A;  2YX7 A;  3MQ0 A;  3VFZ A;  3DF8 A;  1TQM A;  4ESJ A;  1ZAR A;  4LB5 A;  1J2X A;  2W85 A;  3JW4 A;  2L02 A;  3V7C A;  1B6A A;  4A6D A;  2EB7 A;  2VBZ A;  1K78 B;  2GZW A;  2CSO A;  1C0W A;  2Z9O A;  4FT8 A;  2XRO A;  1FYL A;  2HS5 A;  1FSH A;  4BHC A;  4Q4Z F;  4G7O F;  3JAM Z;  2HTS A;  1YG2 A;  2J5O A;  2M30 A;  2Y0M A;  3T0Y A;  2OD5 A;  2O0Y A;  2Q0O A;  1REP C;  2XAH A;  5A2Q Z;  4CXF A;  2F5F A;  2QVO A;  1TBX A;  1JHH A;  3GZ5 A;  4OOI A;  2PEX A;  2HGC A;  4UVC A;  2CGP A;  2A6H F;  3K69 A;  2RN7 A;  4JBA A;  4KMF A;  2LF8 A;  5HLH A;  4RGX A;  2K4B A;  3WU1 B;  1SMY F;  2M8E A;  2AS5 F;  5DEQ A;  3QU6 A;  4HX8 A;  2UXN A;  4Y17 A;  5BQT A;  2XGX A;  2OZ6 A;  5LEK A;  1RUO A;  2HDC A;  3DKW A;  4MNU A;  2DU9 A;  1YFH A;  1QZY A;  1XMA A;  3BZ6 A;  4XBF A;  2XUB A;  4GO1 A;  1KU9 A;  3E6M A;  3IC7 A;  4I02 A;  5L3F A;  4OIP F;  3F23 A;  2FA5 A;  3V8J A;  1U2W A;  1ZH5 A;  2O03 A;  5FFX A;  2IA1 A;  2DO7 A;  4M73 A;  3ZQ7 A;  4G7H F;  1R58 A;  3LAJ A;  3I64 A;  1O3S A;  3KZY A;  1Z6R A;  4FX4 A;  2KIU A;  4EJT A;  4UUV A;  3R0A A;  1P92 A;  5ICC A;  1J59 A;  1XGM A;  1CF7 B;  1ZLK A;  5D4R A;  4MEX F;  2DPD A;  1IUY A;  3GVA A;  4RB1 A;  2JZY A;  3AAF A;  4LLG F;  3RKX A;  4Q47 A;  2COM A;  5D4S A;  1QPM A;  2FNA A;  1TNT A;  2KIF A;  2E7W A;  3F8N A;  2VBX A;  3ZMT A;  2EFQ A;  2YX4 A;  4S04 A;  1ZGA A;  5JI6 A;  1RIO H;  4OIR F;  2OAZ A;  1IXS B;  3EDP A;  3TKY A;  2FBH A;  2GAU A;  2DPU A;  2PLY A;  3HSF A;  1GXP A;  2G7H A;  4KNY A;  2D1H A;  2DK5 A;  5J8C A;  2P7V B;  2P5K A;  1PDN C;  1ZRD A;  3E3V A;  5LEJ A;  3HSE A;  2PMH A;  5L3G A;  1SFU A;  3EQL F;  2Z3Y A;  3FXR A;  5D5W B;  3P9K A;  4KMU X;  2FOK A;  4U0W A;  1F1Z A;  4EMS A;  3M8E A;  3MZH A;  5DUI A;  3JAM K;  4R79 A;  2M87 A;  4O6J A;  4R1H A;  2DAO A;  1DPU A;  3K1P A;  1IN8 A;  3D5L A;  3PFI A;  1LNW A;  4UNO A;  1IRG A;  2G9W A;  1BI1 A;  4A5N A;  1QO0 D;  5A2Q K;  3J80 Z;  4CHU A;  4LK0 F;  1TQP A;  4MQ9 F;  3C18 A;  2DLL A;  2JPB A;  1UB9 A;  3CTA A;  2VOD A;  1B4A A;  4BAY A;  2VC0 A;  1SAX A;  2EWN A;  4Z2Y A;  5D6E A;  4E70 A;  3VOD A;  2DBB A;  1YS6 A;  3BWG A;  3KLO A;  4LK1 F;  1IXR C;  3Q5F A;  3MZY A;  1K79 A;  2M45 A;  2UXX A;  2XHK A;  1ZG5 A;  2A69 F;  1KYW A;  2XAQ A;  2ISY A;  1WWX A;  3KP7 A;  4M6Y A;  1XGO A;  5CJ9 A;  4L0Y B;  2Y75 A;  1R5G A;  1BI3 A;  2V9V A;  1ZRF A;  2QM3 A;  4NQW A;  1HW5 A;  3TOB A;  2RNJ A;  3QOP A;  4EM2 A;  3WTW C;  3R61 A;  4N9H A;  4M71 A;  1SD4 A;  2FEZ A;  4A6E A;  1J5Y A;  5TRD A;  1HXD A;  1LVA A;  3IRR A;  1XSV A;  3ZMS A;  5FD6 A;  3ZN1 A;  1P4X A;  4WWC A;  2QLZ A;  4ASN A;  5LGN A;  1SMT A;  1GHC A;  5AIP A;  1MD0 A;  2XIG A;  3KEO A;  1SD5 A;  3SFZ A;  1W7P A;  3F8B A;  2JTV A;  4HV6 A;  2HYG D;  4I2O A;  5E17 F;  5F64 A;  1MDM A;  2VT3 A;  5FGM A;  3T8T A;  5CLS A;  3LA3 A;  2CWE A;  3Q9V A;  1FC3 A;  4R8H A;  1CGP A;  1GVJ A;  3V7R A;  1R36 A;  3CUQ C;  4EV0 A;  4ENJ A;  3KP4 A;  5DCM B;  2L54 A;  4N9I A;  1K7A A;  2XKO A;  4ZH4 F;  4Y13 A;  1G6N A;  1SFX A;  5BS6 A;  5LHH A;  1ZHF A;  2E1N A;  1U6G A;  4IXA A;  2HR3 A;  3REO A;  3GFI A;  1S7A A;  4KDP A;  3W6J B;  1AWC A;  1KGS A;  2EV5 A;  5FLX Z;  5ED4 A;  3SZT A;  4UVB A;  1Q1H A;  2F5C A;  2WV0 A;  2FMY A;  4GCV A;  4L9T A;  1V3F A;  2HWV A;  4WXC A;  5HDK A;  1I1S A;  2QBY B;  5AIQ A;  4G6Q A;  4PDK A;  1HW2 A;  1YS7 A;  3B73 A;  2L01 A;  1D8K A;  1HBX G;  4U88 A;  1BM9 A;  2STT A;  1ZRC A;  1G3T A;  1SFE A;  3TO9 A;  2VE8 A;  1XSD A;  2VON A;  2Y48 A;  3J81 Z;  3CO6 C;  1T0F A;  2RDP A;  2QQB A;  2EK5 A;  3NQO A;  4L5I A;  2P8T A;  3FX3 A;  1XGS A;  3LA7 A;  3T1B A;  2XAF A;  2W24 A;  4IHT A;  1U3E M;  2XAS A;  2XRN A;  2ISZ A;  3F72 A;  4ETS A;  4RAY A;  4FHT A;  3U9G A;  2FBK A;  4WCG A;  3WGI A;  3BJA A;  3COA C;  5ICF A;  1K78 A;  3FMR A;  2R7D A;  1W4M A;  1UHM A;  3JSO A;  4HZF A;  2IA2 A;  2A61 A;  4ENN A;  5FFZ A;  2P6S A;  4EVI A;  3FWE A;  1XB4 A;  3SHF A;  1J75 A;  2CQK A;  2VC1 A;  2ZNY A;  3F6O A;  4EM0 B;  4OU0 A;  4HAM A;  3MAJ A;  3RPU A;  3H3Z A;  3QU3 A;  3ZMV A;  4HQM A;  3KE2 A;  4GYG A;  1Z1D A;  3EYI A;  1JE8 A;  4I7H A;  3F8C A;  1I6X A;  4YFK F;  5DCF A;  4NB5 A;  5BMZ A;  4IRH A;  4HDU A;  1O3Q A;  3PQK A;  5D8L B;  4BYY A;  4KIF A;  2QYO A;  2ADU A;  2XAJ A;  4MGR A;  5DV5 A;  1B1B A;  3RYP A;  2GWR A;  1IN7 A;  3GUD A;  4WXD A;  1Y0U A;  1BN5 A;  3LA2 A;  3E6D A;  3BPV A;  1FLI A;  2OZU A;  2Z33 A;  5LLQ A;  3ISP A;  1OMI A;  4ZYH A;  1Z7U A;  3R6S A;  5HLG A;  3SQN A;  5E20 A;  4ZZD A;  4I09 A;  3LWF A;  1P4W A;  3VEP A;  4HBL A;  3M7G A;  1KYZ A;  1RNL A;  2PFB A;  1CF7 A;  2BE5 F;  5D5V B;  4H0E A;  1IZ1 A;  2W84 A;  3L00 A;  4LJZ F;  2RKH A;  1EV7 A;  1ZGJ A;  3WG9 A;  1U8R A;  4CYD A;  2HQN A;  3HRT A;  4MTD A;  3EUH A;  2O8X A;  3HTS B;  1DDN A;  1LEA A;  1HSJ A;  1FT9 A;  3J81 K;  4ZZL A;  2YSR A;  1IXC A;  4XSX F;  1UFM A;  5JFR A;  1TLH B;  2F5E A;  2XKP A;  1QNT A;  4I0B A;  4IF4 A;  3E5U A;  3MEX A;  4M9Z A;  5E1W A;  3KCC A;  3ELK A;  5HS7 A;  1O3R A;  4IJA A;  4ZYG A;  2HOE A;  1H9G A;  1T98 A;  2TDX A;  3K2Z A;  2E1C A;  2MLG A;  3V8K A;  2L3D A;  2ZCW A;  3IL2 A;  1UCR A;  4TV7 A;  2IPQ X;  1WSU A;  2W25 A;  3MCZ A;  1XSX A;  1BBY A;  4OMZ A;  2X4H A;  1HKT A;  2K4J A;  1Z9C A;  1MJ9 A;  1S6L A;  3P9C A;  1ZAO A;  1LQ1 A;  2ZNZ A;  1ZG1 A;  3NEU A;  3ZMU A;  1X3U A;  1MJB A;  1FP1 D;  4KN7 X;  4RGU A;  5FD5 A;  3DXJ F;  2GA2 A;  3CDH A;  4IPA A;  2PJP A;  5D6F A;  1YYV A;  3B02 A;  2HFH A;  3M9A A;  3LFK A;  3TO6 A;  3ROU A;  2O6G E;  2QUF A;  3DV8 A;  2KJB A;  5LGU A;  1TTY A;  4A0Z A;  4S05 A;  1Z05 A;  5K5R A;  2K27 A;  2OU2 A;  1B9M A;  3ULQ B;  1IN4 A;  3L2C A;  3V4G A;  2A5Y B;  3WGH A;  2NNY A;  5LHG A;  2NS0 A;  1LDK B;  3FXU A;  1R1V A;  1YO5 C;  1BIA A;  2XAG A;  1FP2 A;  3S2W A;  4WF2 A;  1YTY A;  2MC3 A;  2HTJ A;  3CO7 C;  5H6Q A;  3L09 A;  3BP8 A;  1OKR A;  3TGN A;  4EJU A;  3KZZ A;  4AIK A;  3CUQ A;  1PP8 F;  3ECO A;  2RQP A;  2C6Y A;  3E5Q A;  1EH8 A;  1TW3 A;  3IKT A;  2L4M A;  1I1G A;  3WE2 A;  2MLK A;  4BHB A;  1VTN C;  2STW A;  5J8F A;  1K6O A;  2VXZ A;  4WK8 F;  2LNB A;  1Z6T A;  2OQR A;  4CDG A;  3U1D A;  4Q48 A;  3RYR A;  1ODD A;  5HDN A;  1FPQ A;  2E7X A;  2ESH A;  1BC8 C;  3O3K A;  3GO5 A;  4IVN A;  2BBY A;  1U5T B;  4LG0 B;  4KFC A;  2ETH A;  4WX9 A;  2M5W A;  2CYY A;  4QLC U;  3QP5 A;  3LST A;  2F2E A;  1RI7 A;  4HQE A;  5HOO A;  3RDI A;  3DQV C;  2FXA A;  5DCM A;  3W6K B;  2QQ9 A;  5ILU A;  1Z91 A;  3RIR A;  1HQC A;  1FYK A;  1XMK A;  3FM5 A;  2WTE A;  1LDJ A;  1XGN A;  1YLF A;  3EET A;  4RB3 C;  1L3L A;  1V4R A;  2KJC A;  1IRF A;  6PAX A;  2FE3 A;  5CVR A;  3CUQ B;  4HDV A;  2H27 A;  3GXO A;  1G3W A;  4A5M A;  5KK1 A;  3KP3 A;  1JXS A;  2WWY A;  2KRF A;  1YQA A;  5CVJ A;  5D5X B;  2D45 A;  1R1U A;  1U5T C;  1I5Z A;  5ICE A;  2FQ3 A;  3RKY A;  3I53 A;  2QBY A;  2O3F A;  3FMQ A;  5LRR A;  3JTH A;  4YIF A;  5E1Z B;  3GFJ A;  2HZT A;  5K5O A;  3JSP A;  2JRT A;  1DP7 P;  4RAZ A;  1SD7 A;  2H94 A;  5HDG A;  1S3J A;  1R22 A;  5HLI A;  5BOX A;  3H3U A;  5IT3 A;  3WE3 A;  5ILS A;  2ZJ2 A;  3BY6 A;  2IP2 A;  3FHZ A;  1F5T A;  4ESB A;  2IVM A;  3R0J A;  3P7N A;  3C3W A;  3WTU C;  4GXO A;  1KU7 A;  1QZZ A;  3JTG A;  2V79 A;  2ESN A;  4OIN F;  4M74 A;  4U0V A;  1XDS A;  1QQI A;  5TJJ A;  3CUO A;  2JT1 A;  1FY7 A;  1ONV A;  1ZYR F;  2YPR A;  4BQA A;  1P4A A;  4U0Y A;  3R4K A;  2H6B A;  1FNN A;  4U7B A;  1OR7 A;  3FZV A;  2BYV E;  2B0L A;  1YW8 A;  2V1U A;  3ABU A;  3LQR A;  3I59 A;  1S8N A;  2IJL A;  3M8F A;  3R60 A;  2EFW A;  4EJV A;  4B8X A;  3KP2 A;  2MH2 A;  3O6B B;  2GIV A;  3RKW A;  3HRS A;  3J80 K;  1W5S A;  2V6C A;  2DFI A;  4KIB A;  4O5V A;  2MD5 A;  3BJ6 A;  4HYE A;  3TO7 A;  3ZMD A;  1ULY A;  4L5J A;  5BPI A;  5H20 A;  1BJA A;  4LLN A;  3L7W A;  4M9S A;  1J7K A;  4XSZ F;  1O7F A;  1XN7 A;  2X0L A;  3I71 A;  1XD7 A;  3K1M A;  3HOS A;  3BPX A;  4AWX B;  2NNN A;  4LFU A;  2HKX A;  3DPT A;  3OV8 A;  5HS9 A;  3ERE D;  4HOB A;  2ZO4 A;  3Q9S A;  3TDU C;  2Q8K A;  4A12 A;  2CFX A;  2GXG A;  1OYY A;  5CVU A;  4HV5 A;  2FF4 A;  4U7D A;  3GLX A;  4UV8 A;  2P7C B;  3I4P A;  3WTS C;  4BH9 A;  5EEH A;  3NRV A;  3ECH A;  4LGW A;  4I0A A;  2IT0 A;  1F9N A;  2NYX A;  1G3S A;  4FX0 A;  2FNP A;  3HIF A;  5K5Q A;  4I01 A;  1AOY A;  3IWZ A;  3WTX C;  1TW2 A;  4GYI A;  4QWQ A;  3I59 B;  3V8L A;  3I0T A;  4D0P A;  1T38 A;  5E8I A;  3C1D A;  2O61 A;  1IN6 A;  3MWM A;  3G73 A;  3HYI A;  4IHS A;  2ZKZ A;  1T6S A;  4PZJ A;  1QGP A;  4L9V A;  2OA4 A;  2QZ8 A;  3IWF A;  4OIQ F;  4CGZ A;  3I5U A;  4LMY A;  2EV6 A;  2EFN A;  2CW0 F;  2EJR A;  1BIB A;  4CIC A;  3K0L A;  5K1Y A;  2IW5 A;  1YIO A;  2XVC A;  2ZME A;  5L3B A;  4P5O A;  4BXU A;  1FWZ A;  1DUX C;  2A3S A;  3IHU A;  5D8K B;  2VBW A;  3F6V A;  4UXN A;  3DEU A;  5JHU A;  2EA2 A;  2JSC A;  4HLY A;  1ON2 A;  5AON A;  2YR2 A;  4LD5 A;  1R23 A;  3CLO A;  1OPC A;  1WQ2 A;  3T8R A;  5LRS A;  4YII A;  1ZN2 A;  4L0Z B;  5FLX K;  5DDG A;  3D0S A;  2F5D A;  2DQR A;  1R5H A;  3SZP A;  4A0X A;  3O2P E;  1ZRE A;  1IN5 A;  3N4M A;  2AXL A;  4RB2 C;  4M72 A;  1NHA A;  2P5L C;  3RI4 A;  1ZLJ A;  3RTR A;  4DNC A;  4CZZ A;  5CYV A;  5J6X A;  3RPQ A;  1E2X A;  1W7P D;  3KLN A;  2A07 F;  1XCB A;  2P5V A;  2ZXJ A;  2ZBK A;  1MKM A;  1G3Y A;  2KIM A;  4MEY F;  2W57 A;  4EQQ A;  2UWM A;  4HX7 A;  4L9N A;  2OBP A;  2A68 F;  1FBU A;  1O7L A;  4HF2 A;  2ZME B;  1UHW A;  4CO8 A;  2KKO A;  2LKP A;  5ILV A;  2K7L A;  5JVT A;  3BDD A;  5LBQ A;  3HTU A;  3WTZ A;  2DK8 A;  2NAZ A;  5E18 F;  3IKV A;  3C7J A;  2R7F A;  3KEQ A;  3FF5 A;  5L3D A;  2EV0 A;  2LF7 A;  5CVI A;  3VB2 A;  3GYH X;  4AIH A;  1UST A;  3KP5 A;  2MH9 A;  2RVC A;  1DPR A;  4A0Y A;  3QAH A;  5F6F A;  1KQ0 A;  3V7S A;  2EFO A;  3PQJ A;  4YFN F;  2EA4 A;  1HST A;  2PBI A;  1U78 A;  3MFK A;  2K86 A;  2FRH A;  4HA8 A;  1LDD A;  1U5T A;  4LG0 A;  4G9Y A;  2DQL A;  3QP6 A;  4KYW A;  4MHG A;  1WKM A;  5HVQ C;  1JGS A;  4P9U A;  2L4A A;  4PCQ A;  3TDZ C;  2QWW A;  1YW9 A;  1TNS A;  1IAW A;  1FYM A;  3N97 A;  2UZK A;  2IA0 A;  1HKQ A;  2CO5 A;  4JK1 X;  1LEB A;  1L0O C;  3FXQ A;  4LB6 B;  4HF1 A;  2DTR A; 
#chains in the Genus database with same CATH topology
 3QOE A;  4KN4 X;  2K5C A;  4BY1 J;  1VQN I;  3CC7 I;  2CU7 A;  1EH7 A;  3DP7 A;  3K9T A;  3S1N J;  2OQG A;  3CMA I;  2AQE A;  1KON A;  2P6T A;  2LSO A;  1POG A;  3E97 A;  4IRG A;  2R5Z B;  4D1Q A;  1TQI A;  2XB0 X;  4E7S A;  2OTL I;  1YHQ I;  3BC8 A;  4AIJ A;  4ON0 A;  2JMW A;  2QEX I;  3SDB A;  4KT5 C;  1B9N A;  4P55 A;  3ERM A;  3HRM A;  1H8A C;  1ETQ A;  4RMN A;  2V1X A;  1QBJ A;  4CZC A;  1H88 C;  2HYF A;  1BJZ A;  3DKX A;  4RB0 A;  4XLE A;  2CW8 A;  1BW6 A;  3I58 A;  2IRF G;  4A93 J;  1G59 A;  5EDN A;  2K9L A;  2JQ7 A;  3G4S I;  4G7Z F;  3GW2 A;  3WOD F;  2D1V A;  1JJ6 C;  2QCO A;  3RJP A;  2Z99 A;  4ZYE A;  1TWC J;  4XRM A;  2LRD A;  2F48 A;  4UV9 A;  5DTD A;  2LP0 A;  3QOD A;  2DI3 A;  3S1R J;  4HW0 A;  1VQK I;  1MGT A;  1V55 H;  3QPT A;  2JPC A;  3QPS A;  3HPH A;  5EEG A;  3HKZ N;  4RM2 A;  1YW7 A;  4AYB N;  4OIO F;  2VQL A;  1ORK A;  3OYF A;  4AD9 A;  1KA8 A;  4DQ2 A;  5JR3 A;  1T2K A;  4B3X A;  2B7E A;  1QRY A;  3OIP A;  1S29 A;  2PMU A;  2VBY A;  3DBL B;  3HDD A;  3I4N J;  2V6E A;  3GZ6 A;  1K4T A;  3GEZ A;  2ACJ A;  2W48 A;  2M7B A;  2QSH X;  5M3F J;  3ZP5 A;  3FXM A;  3FDY A;  1W5C C;  3ABM H;  2H09 A;  4XMY A;  3F21 A;  3EPZ A;  5HS8 A;  4Q5S F;  4I98 B;  1RES A;  2IGN A;  2HKO A;  2BY0 A;  2ZB9 A;  3KFW X;  3TW6 A;  4AVP A;  1WI9 A;  3K4C A;  3QPL A;  2VKV A;  4ZJZ A;  3J7Z I;  1FTT A;  3TQN A;  3HRU A;  3KYC B;  3L2Q A;  1ETX A;  2D2W A;  1I27 A;  1W5T A;  2X85 A;  4RGR A;  2I10 A;  2VOO A;  5FKK A;  5CVV A;  4YEJ A;  5KHD A;  3HHG A;  3DEW A;  2R7V A;  1FOY A;  1MBE A;  2Z5U A;  2LOO A;  2KZG A;  1GXQ A;  3GTO J;  3K70 C;  4PGH A;  3AKZ A;  4L9J A;  4MFE A;  3E7L A;  2GXA A;  1U9N A;  1U9O A;  3M1E A;  3BR3 A;  2FSW A;  4CCM A;  2QQA A;  3E5X A;  5DD8 A;  1YIT I;  2IBD A;  2FBI A;  4MQV A;  2FML A;  1PUE E;  1OYW A;  1D8J A;  1R7J A;  4ENM A;  4Y15 A;  1G4D A;  1D5V A;  2QEN A;  2F6C A;  4ZC3 A;  3EYY A;  1WFX A;  3ASO H;  4EJW A;  1ZG3 A;  1R9T J;  5J4V A;  3MD2 A;  1FZP B;  3WTT C;  3ZPL A;  4FET A;  4LLL A;  1Q1V A;  3PUF A;  4NHJ A;  2R7O A;  4IOC F;  2EBI A;  2HQ5 A;  1OQY A;  1E0E A;  2BVM A;  2ID3 A;  4D5F A;  5DUK A;  3WU2 C;  1KU3 A;  3F3X A;  1FBS A;  2ZFW A;  1P2F A;  2E2J J;  3ZOB A;  2M1B A;  3F8F A;  1MZB A;  3F8M A;  3IAM 2;  3FM3 A;  1D3Y A;  2HXI A;  4A3F J;  4A2U A;  1JKQ C;  4BNC A;  2R3S A;  1T33 A;  1XDU A;  2IS6 A;  2OJE D;  2D5V A;  2NVT J;  2DMN A;  2V7F A;  1BOA A;  1MIJ A;  2VQH A;  1JHF A;  3KYL A;  5E1X A;  2PN6 A;  4RLF A;  3BOQ A;  3SXY A;  3OL4 A;  4IEJ A;  3DFG A;  2Q2E A;  3P9I A;  3H5A A;  4JOM A;  3I4M J;  2R7X A;  3WTV C;  3B6C A;  5K7Z A;  1BI0 A;  3K4N A;  4HLX A;  1GV5 A;  2YU3 A;  4GGG A;  1MJA A;  4XLF A;  4BBS J;  3Q0W A;  3GTK J;  1IW7 F;  3LQQ A;  4EAT A;  4BGD A;  2RNG A;  3K1N A;  1PP7 U;  1B59 A;  2EZL A;  4EJO A;  3HGY A;  4HX4 A;  1N78 A;  3QRF F;  3J7A O;  4PGG A;  3U2R A;  3SDG A;  5M3M J;  2HOS A;  1B72 B;  3DTE A;  2ELJ A;  3DCF A;  2BW3 A;  1A5J A;  3GCM A;  5KVR A;  4XID A;  4N0B A;  5ICG A;  4KIS A;  2BV6 A;  1O57 A;  1RRJ A;  2MA3 A;  4EM1 A;  4WXH A;  2PG4 A;  3DWL E;  1F43 A;  2V4J C;  3HOY J;  3GFM A;  3M3Y J;  3BJO A;  4MTE A;  5KCM A;  5BPD A;  1R00 A;  4UHT A;  4CCK A;  2WBM A;  5D5U B;  3BLY A;  2CG4 A;  2ME6 A;  3FMS A;  3FKI J;  1RR7 A;  2BY2 A;  2Q1Z B;  1IF1 A;  2EFP A;  4XLC A;  3KYD B;  5IT9 Z;  4KUM A;  2NOG A;  1MMD A;  2K02 A;  1JT6 A;  3S3N A;  4XKB A;  3TW7 A;  4X1E A;  1BI2 A;  2XV4 S;  2KLO A;  4CA0 A;  3AL0 B;  1W36 D;  3G71 I;  3QQA A;  4BXF A;  3F22 A;  3J7A Y;  3HSR A;  5FB2 A;  3JR9 A;  4XLP F;  2E35 A;  4YFX F;  4P9F A;  1EH6 A;  4BXX J;  4JQF A;  3LNQ A;  3BG6 A;  2XDV A;  2CW7 A;  4C30 A;  1FJL A;  2CMP A;  4NQW B;  4BQN A;  3GF2 A;  1K4S A;  2JUG A;  4KA4 A;  1YI2 I;  2GA1 A;  1GVD A;  1USS A;  3SEZ A;  2HOT A;  2A05 A;  2IGM A;  3FXO A;  1ON1 A;  2H6C A;  1TC3 C;  4RGS A;  2RC4 A;  3HHH A;  5L3C A;  5E8G A;  2EZK A;  4PSW A;  2GXB A;  2VN2 A;  3ABT A;  1R5I D;  3LAP A;  4G8X A;  2ELH A;  3ML6 A;  1HKS A;  2Q2E B;  3CZ6 A;  2KIS A;  3JRH A;  1VQ8 I;  4RS8 A;  1MNE A;  5LGT A;  4QTR A;  1HW1 A;  3H5N A;  2VT2 A;  4YG2 F;  1QPI A;  1XX5 A;  2HVQ A;  2RV8 A;  2NOJ B;  4M9X A;  4OMY A;  5L3E A;  4W1U A;  2KRH A;  1NTC A;  3E6B A;  1J0R A;  1YRN B;  2G7U A;  3MKL A;  4M6V A;  2E60 A;  4S0H B;  1G2H A;  3OSG A;  1D0Z A;  1FBQ A;  1LJ9 A;  4DZP A;  1W7P B;  1X1D A;  3GFL A;  1A04 A;  2BXZ A;  1T39 A;  2DTZ A;  3JRI A;  3H0G J;  4B09 A;  1MDM B;  1WRJ A;  4BQQ A;  2WY8 Q;  3I54 A;  3HOT A;  3L9F A;  3T5X A;  1KQ9 A;  3ZN0 A;  4FIS A;  5CPR B;  5FLV A;  3IRQ A;  3AL0 C;  4F7Z A;  4O3M A;  4BL0 B;  1FX7 A;  3GWZ A;  3QYE A;  1ETO A;  2HQR A;  4L18 B;  1KQ8 A;  1R1T A;  3OIQ A;  3FXL A;  1P6R A;  2XF7 A;  2WC2 A;  1FOX A;  4E7J A;  1HCR A;  1U0J A;  1RUN A;  2V1D A;  1X3Z B;  3OYN A;  2TRT A;  3TOA A;  3OR1 C;  4F91 B;  2L7Z A;  5LHI A;  3H35 A;  2GQQ A;  2FD5 A;  4IL6 C;  1DU6 A;  5B3S H;  1S7O A;  2E2H J;  1VI0 A;  3RZD J;  1R49 A;  1Y8Q B;  2H8W A;  2VXD A;  2IS2 A;  5J47 A;  2OUM A;  4G94 A;  4E4H A;  3MVP A;  3DPL C;  4PK4 A;  3CJN A;  3VOE A;  1FEX A;  4G6D A;  3BRO A;  1F4K A;  2N8G A;  2NRA C;  1SD6 A;  5FO5 A;  2PQ8 A;  5DYM A;  2WAD A;  1O3T A;  2IS4 A;  4KT6 A;  3HUG A;  3G1L A;  3KET A;  2A6E F;  3KP6 A;  2J5P A;  2BEO A;  2VOP A;  1FOK A;  3ESW B;  4Y52 J;  5C4X J;  3W6V A;  1J9I A;  2E5N A;  2L9V A;  3ZMZ A;  2JA5 J;  1HA8 A;  1RZ4 A;  4BHP A;  1Z21 A;  4H4K C;  3WU0 A;  3LSP A;  4KIG A;  3AFH A;  4P96 A;  1S7E A;  4OWR B;  2MSY A;  1LPQ A;  1DQU A;  5ERI A;  2AHQ A;  2BGC A;  4C3H J;  3QPH A;  2MBF A;  4K2E A;  4HF0 A;  2VJI A;  4BAC A;  4EGZ A;  2RGV A;  3CQZ J;  4BUP A;  4KIC A;  4XRF A;  4IRI A;  3NWT A;  2FUG 2;  2X6W A;  4M6X A;  4FE4 A;  3O8G A;  1KZH A;  4EGY A;  1R4N B;  1SVM A;  3H92 A;  4LIV A;  3WGG A;  5J1R A;  2DT5 A;  3H36 A;  5F1R A;  4XLN F;  2A6T A;  1H9T A;  1P7J A;  3LSR A;  4M3G A;  1LB2 A;  3SFI A;  1BC7 C;  2JK3 A;  3E6C C;  1KU2 A;  3S17 J;  3WTY C;  4ENK A;  2AO9 A;  2DYS H;  3E1S A;  1AHD P;  2VE9 A;  1STZ A;  1E17 A;  3OOP A;  3HOX J;  1SVO A;  5DD4 A;  3D1N I;  3RQI A;  2PI0 A;  4XR6 A;  1S5L C;  1H0M A;  4UVA A;  1XCV A;  2DW4 A;  2P4W A;  2LDU A;  4U87 A;  2CV2 A;  1OYI A;  2O5R A;  3AG2 H;  3GX4 X;  3G3Z A;  4ZYD A;  2CUZ A;  5H6R A;  4HNV A;  2HEO A;  1FSE A;  5FRO A;  5IT9 K;  4ESF A;  2FU4 A;  4AM3 A;  3U21 A;  3CME I;  2YX7 A;  1OR7 C;  3MQ0 A;  3S1Q J;  3LSH A;  3VFZ A;  4PFP A;  3IH4 A;  5B5E C;  2LKX A;  3DF8 A;  3TMO A;  4E7L A;  1TQM A;  4ESJ A;  1ZAR A;  3UNG C;  4NUB A;  4LB5 A;  1J2X A;  4QPQ A;  2W85 A;  3S2H J;  2R7Q A;  3JW4 A;  2VLA A;  1LFU P;  2L02 A;  3V7C A;  5M5W J;  1B6A A;  2P0W A;  1BA5 A;  1HC8 A;  4A6D A;  2EB7 A;  2VBZ A;  3M8J A;  2KFD A;  4UUT A;  2V1N A;  2X1C A;  3HUG B;  1D5Y A;  1K78 B;  2XF5 A;  2GZW A;  2CSO A;  1V5F A;  2A5W A;  4LIU A;  1C0W A;  2Z9O A;  4FT8 A;  2PX9 A;  4GRI A;  2XRO A;  2AXT C;  4CYC A;  1FYL A;  4N4N B;  2ME0 A;  2XPU A;  3LL7 A;  3VYR B;  2R4G A;  2HS5 A;  2EIK H;  1FSH A;  4BHC A;  1QHH D;  4Q4Z F;  4G7O F;  3JAM Z;  2CUJ A;  2HTS A;  3I3L A;  3DBH B;  3A01 A;  2K9M A;  4PSX A;  1YG2 A;  2J5O A;  2M30 A;  1LE8 A;  1IDZ A;  2X6X A;  2Y0M A;  3T0Y A;  2OD5 A;  2O0Y A;  2Q0O A;  1REP C;  1SAN A;  1X1B A;  2XAH A;  1T0F C;  1SAU A;  5A2Q Z;  4CXF A;  3OYH A;  2F5F A;  2QVO A;  1TBX A;  1JHH A;  2K9N A;  3GZ5 A;  4OOI A;  2PEX A;  3MZ8 A;  1JUS A;  2HGC A;  4UVC A;  4IZZ A;  2CGP A;  4A3J J;  2A6H F;  3K69 A;  2RN7 A;  2XSD C;  4JBA A;  1HDP A;  1CQT A;  2LF8 A;  4KMF A;  5HLH A;  4RGX A;  2K4B A;  3WU1 B;  3CCV I;  2IAI A;  1BW5 A;  1SMY F;  4RLQ A;  1MBH A;  3BR1 A;  1MH4 A;  1T8I A;  2M8E A;  5M5X J;  2AS5 F;  3HBL A;  5DEQ A;  3QU6 A;  2VI6 A;  4HX8 A;  4F55 A;  2UXN A;  4Y17 A;  2M4K A;  5BQT A;  2XGX A;  4M3B A;  4BKX A;  4MFD A;  2OZ6 A;  5LEK A;  1JUM A;  1RUO A;  2HDC A;  1X4O A;  2Y0S A;  1MSE C;  3DKW A;  4MNU A;  3SYT A;  1TT0 A;  2OC6 A;  2DU9 A;  1WI3 A;  1QZY A;  1XMA A;  4XM3 A;  3BZ6 A;  1YFH A;  1VQM I;  4XBF A;  5IY5 H;  2XUB A;  4GO1 A;  2FQ4 A;  1KU9 A;  3E6M A;  4NNJ A;  3IC7 A;  2HQA A;  2JN6 A;  4I02 A;  5L3F A;  3PO2 J;  4LG3 A;  2RQQ A;  4OIP F;  3F23 A;  2X1D A;  1VF9 A;  2FA5 A;  3V8J A;  1U2W A;  1VQL I;  2ZXI A;  1ZH5 A;  3GTL J;  2R7T A;  3JRB A;  2O03 A;  5FFX A;  4F52 A;  2IA1 A;  4B44 A;  2DO7 A;  4M73 A;  3ZQ7 A;  4G7H F;  1R58 A;  3LAJ A;  5GAG J;  3I64 A;  1O3S A;  3KZY A;  1Z6R A;  1BR1 A;  4FX4 A;  3TED A;  2KIU A;  4EJT A;  4UUV A;  2JVH A;  3FBI B;  1F36 A;  1A35 A;  2DA4 A;  3R0A A;  1P92 A;  3ZCO A;  3K4K A;  5ICC A;  2ZJR F;  1SC7 A;  1J59 A;  1XGM A;  1RET A;  1WVR A;  2CQ7 A;  2L9S A;  2EIJ H;  1CF7 B;  4CYC B;  3I9V 2;  2LKS A;  3BT9 A;  4DZJ A;  1ZLK A;  5D4R A;  3CMM A;  2CJJ A;  3GTQ J;  1ETV A;  2KHM A;  3A01 B;  4A3K J;  4MEX F;  2DPD A;  3GVA A;  3IH3 A;  3I55 I;  1IUY A;  3IUO A;  1MMA A;  4RB1 A;  2JZY A;  2ECB A;  1LE8 B;  4XQF A;  3CD6 I;  3AAF A;  1S72 I;  2CUF A;  4LLG F;  2O9L A;  3MMY B;  3RKX A;  1QVU A;  2WAQ N;  4Q47 A;  5H2F C;  2COM A;  5D4S A;  4DW6 A;  1QPM A;  2FNA A;  2OF7 A;  1LFB A;  1TNT A;  2KIF A;  4XOR A;  2E7W A;  3F8N A;  2VBX A;  5JVG F;  3ZMT A;  4B1R A;  2EFQ A;  2EQR A;  3NAR A;  5CQG A;  2YX4 A;  4S04 A;  3V42 A;  2JSP A;  3N05 A;  1GUU A;  1ZGA A;  3ZGK A;  5JI6 A;  1RIO H;  2NS8 A;  4OIR F;  3RQ4 A;  4HNT A;  2OAZ A;  1IUF A;  1IXS B;  3EDP A;  3TKY A;  2JRM A;  3IH2 A;  2FBH A;  4HEA 2;  4XON A;  3S15 J;  2GAU A;  1DGR M;  4DGW B;  3GTG J;  1ZQ3 P;  1SFK A;  2DPU A;  1WH5 A;  4XRS G;  2PLY A;  1A6I A;  3HSF A;  2MD0 A;  5E79 C;  2MFZ A;  3PUB A;  1GXP A;  2G7H A;  4KNY A;  2D1H A;  2DK5 A;  1W0U A;  2DOA A;  5J8C A;  2P7V B;  1ZKG A;  4PJJ A;  2P5K A;  1PDN C;  2BZT A;  1ZRD A;  3E3V A;  3OYK A;  1MMN A;  5LEJ A;  3HSE A;  4I6Z A;  2PMH A;  3G1O A;  5L3G A;  2MGQ A;  3RPU D;  4C3I J;  1SFU A;  3ABK H;  3EQL F;  1E3H A;  2Z3Y A;  3FXR A;  5D5W B;  3P9K A;  4KMU X;  1QHG A;  2FOK A;  4U0W A;  1F1Z A;  4EMS A;  1JI8 A;  4XKV A;  1GDT A;  2CV1 A;  5GTI C;  2QKM B;  5IOZ A;  5F04 A;  3M8E A;  1UG0 A;  3MZH A;  5DUI A;  3JAM K;  4R79 A;  1WJC A;  2CUE A;  2M87 A;  4O6J A;  4R1H A;  2DAO A;  3EUH C;  2DA2 A;  5KAI C;  1DPU A;  3K1P A;  1IN8 A;  3D5L A;  3PFI A;  1LNW A;  4UNO A;  1IRG A;  2G9W A;  1BI1 A;  2DYR H;  1QO0 D;  1Z3Y A;  2OV7 A;  4A5N A;  5A2Q K;  4PJ0 C;  3J80 Z;  4CHU A;  2VKE A;  4QPO A;  3DPU A;  4LK0 F;  3K6G A;  1TQP A;  4MQ9 F;  3C18 A;  3BZK A;  1B72 A;  2DLL A;  4RDU A;  3IP4 B;  3CCR I;  1EA3 A;  4L5E A;  4M3F A;  2Z16 A;  2JPB A;  1UB9 A;  3NWS A;  5F08 A;  3SEQ A;  2XPW A;  3S16 J;  3CTA A;  1WH7 A;  3BTI A;  2B63 J;  2VOD A;  4BY7 J;  1B4A A;  3PSI A;  4BAY A;  4ANJ A;  4RAG A;  2VC0 A;  2Y0S N;  3BQZ A;  1SAX A;  4D7N A;  2EWN A;  1ETK A;  2DFF A;  5D6E A;  4Z2Y A;  3VOD A;  1X4P A;  3KZI C;  4E70 A;  4A3C J;  2DBB A;  4X6A J;  2COB A;  3WHC A;  2LG4 A;  1YS6 A;  3BWG A;  3BTC A;  4V19 K;  3G6E I;  2E2I J;  3KLO A;  3PIP F;  4LK1 F;  5IP6 A;  4ZTJ A;  3RKQ A;  1IXR C;  3Q5F A;  3MZY A;  1K79 A;  4HSR A;  1RR8 C;  3GBG A;  2M45 A;  2UXX A;  2XHK A;  1VQ5 I;  2GM4 A;  1ZG5 A;  2A69 F;  1KYW A;  2XAQ A;  1X1C A;  2ISY A;  1WWX A;  4LOC A;  4A3E J;  3HJE A;  4CCJ A;  3JRF A;  2DMU A;  1IO2 A;  3KP7 A;  4M6Y A;  1XGO A;  1WJA A;  4DYC A;  2Y31 A;  3DTK A;  5CJ9 A;  3CCY A;  1GV2 A;  3AG3 H;  4L0Y B;  2E34 A;  1WJ5 A;  2Z1D A;  2Y75 A;  1R5G A;  1BI3 A;  2V9V A;  3G1M A;  4UB6 C;  4J19 A;  1W36 C;  3OYC A;  3ZR8 X;  1ZRF A;  2X48 A;  2QM3 A;  4NQW A;  3DU5 A;  1HW5 A;  1K83 J;  4I76 A;  1XC5 A;  2IEK A;  2VAS A;  2KDO A;  3QYB A;  2RNJ A;  3QOP A;  3TOB A;  4CCL A;  1IG7 A;  4EM2 A;  5E3M A;  3WTW C;  3R61 A;  2LY2 A;  4RBO A;  3PJR A;  4N9H A;  4M71 A;  2ECC A;  1SD4 A;  2FEZ A;  4A6E A;  1J5Y A;  2E1M B;  1E3O C;  5TRD A;  1HXD A;  3TBI A;  5E3L A;  1LVA A;  4HPQ A;  3FXK A;  1D0Y A;  2LRE A;  3IRR A;  1XSV A;  3ZMS A;  1JKO C;  5GP9 A;  2O8K A;  1JKR C;  1EKE A;  3CCM I;  3S8P A;  5FD6 A;  4W97 A;  1LFP A;  3ZN1 A;  1Y39 A;  1P4X A;  3FKJ A;  4WWC A;  2QLZ A;  3ZQG A;  4ASN A;  5LGN A;  1SMT A;  1BOB A;  1ETW A;  2CS3 A;  1YRN A;  1GHC A;  2JUC A;  3ZQF A;  5AIP A;  5KNL A;  4IO9 F;  2W4S A;  1MD0 A;  2XIG A;  3KEO A;  1JTX A;  5GTH C;  2EZH A;  1M1E B;  1SD5 A;  3PM1 A;  3CP8 A;  3SFZ A;  3GTJ J;  1W7P A;  1X1A A;  2AQF A;  2JTV A;  3F8B A;  1UZC A;  2HYG D;  4HV6 A;  2IS1 A;  4I2O A;  5E17 F;  3S2D J;  5F64 A;  1MDM A;  2VT3 A;  5FGM A;  3T8T A;  1N25 A;  5CLS A;  1HOM A;  3LA3 A;  2VPL A;  2O7O A;  4GFB A;  2Y69 H;  2CWE A;  3Q9V A;  4XLH A;  2QQ8 A;  1P9Q C;  1FC3 A;  4R8H A;  3S14 J;  2FJ1 A;  3CES A;  2XGE A;  2K3P A;  1CGP A;  1GVJ A;  3V7R A;  2XRL A;  3CCE I;  1R36 A;  3CUQ C;  1GLN A;  4EV0 A;  4ENJ A;  3KP4 A;  5DCM B;  1E3P A;  5J1Y A;  2L54 A;  2MC4 A;  4N9I A;  1K7A A;  2X51 A;  3FXJ A;  3RCO A;  2XKO A;  5F0C A;  3BCB A;  2DOF A;  4ZH4 F;  3NAU A;  4Y13 A;  3H9J A;  2M34 A;  3OYB A;  1G6N A;  1SFX A;  5BS6 A;  5LHH A;  2TCT A;  1ZHF A;  5GAD J;  2E1N A;  4BE0 A;  1U6G A;  2E1M C;  5FRN A;  4IXA A;  2W7N A;  5E3O A;  1BL0 A;  2HR3 A;  2JJ7 A;  2KQR A;  3DKY A;  3REO A;  3K4L A;  1T08 B;  3GFI A;  1S7A A;  1UG2 A;  1UMQ A;  3ZQI A;  1RC9 A;  1N75 A;  3RSN A;  1PUF B;  4KDP A;  1MH3 A;  3UR3 C;  3W6J B;  4J00 A;  5FRM A;  2M2E A;  3BG3 A;  1AWC A;  1KGS A;  2DMT A;  2EV5 A;  2BHY A;  5ED4 A;  5FLX Z;  3SZT A;  4UVB A;  4J01 A;  4XKW A;  1Q1H A;  1ACI A;  2F5C A;  1OIS A;  2WV0 A;  1APL C;  2FMY A;  4GCV A;  3FK7 A;  3S1M J;  2LY1 A;  4L9T A;  1V3F A;  2M7A A;  2DDB A;  3OYA A;  2HWV A;  4WXC A;  5HDK A;  2XC7 A;  4M3D A;  1I1S A;  1MMG A;  2QBY B;  2KIQ A;  1ZK8 A;  3GLL A;  5AIQ A;  4G6Q A;  2G0E A;  4PDK A;  4M3E A;  1HW2 A;  1EF4 A;  3OMY A;  1YS7 A;  1I3A A;  1UEL B;  3B73 A;  2R7S A;  1FMV A;  2L01 A;  1D8K A;  1HBX G;  3OOU A;  1PYV A;  3OS0 A;  2UV1 A;  4XL9 A;  2DA7 A;  4U88 A;  4NC6 A;  1BM9 A;  2STT A;  3VWB A;  1Y6I A;  1MMS A;  1ZRC A;  1G3T A;  1SFE A;  3TO9 A;  2VE8 A;  2H1K A;  1XSD A;  2VON A;  2Y48 A;  5JLX A;  4HRI A;  4BJT A;  3J81 Z;  3CO6 C;  1T0F A;  2RDP A;  2QQB A;  2R93 J;  2DA3 A;  2EK5 A;  3NQO A;  1WPK A;  5F0H A;  4JX5 A;  2KZV A;  4L5I A;  5EF6 A;  1LKX A;  4X0G A;  2P8T A;  1K6Y A;  3FX3 A;  1XGS A;  3LA7 A;  1O4X A;  3T1B A;  2NS7 A;  2XAF A;  2W24 A;  4A3I J;  4IHT A;  1U3E M;  1MND A;  2XAS A;  1HLV A;  2BY1 A;  2XRN A;  2QA4 I;  2E1O A;  2FX0 A;  3U1K A;  2ISZ A;  3OWT A;  3F72 A;  4FCY A;  3HOZ J;  4ETS A;  2OPT A;  4RAY A;  3LSK A;  4FHT A;  1ZGW A;  1OCO H;  3U9G A;  3S3O A;  4HG2 A;  2FBK A;  4DYQ A;  5M5Y J;  4WCG A;  3WGI A;  3HM5 A;  3BJA A;  3COA C;  3M1C A;  4E7K A;  1TWA J;  5ICF A;  1K78 A;  3FMR A;  4II2 A;  2K85 A;  4PJN A;  2R7D A;  1W4M A;  1UHM A;  2VB6 A;  3JSO A;  2L9N A;  3DLL F;  4HZF A;  3CCQ I;  1VQ4 I;  2IA2 A;  2L7F P;  2A61 A;  4ENN A;  5FFZ A;  1Z0X A;  2P6S A;  4CSW A;  4EVI A;  3QYF A;  3FWE A;  1XB4 A;  1Y1V J;  3SHF A;  4ZDL A;  1T56 A;  1D1C A;  3CF2 A;  1J75 A;  2IGK A;  2CQK A;  2VC1 A;  2CQX A;  2ZNY A;  3F6O A;  4EM0 B;  4OU0 A;  4HAM A;  3HOV J;  3MAJ A;  3RPU A;  3H3Z A;  1X3W B;  3QU3 A;  3ZMV A;  1R71 A;  4HQM A;  2DFE A;  1VND A;  3HGG A;  4OAY A;  3KE2 A;  4GYG A;  1I39 A;  4FAS D;  5IYB J;  1Z1D A;  2ZFU A;  4PFO A;  4B4C A;  3EYI A;  4E7Z A;  2B9S A;  1JE8 A;  4I7H A;  1WJF A;  3F8C A;  1Y1W J;  1I6X A;  4YFK F;  5DCF A;  2YS9 A;  4NB5 A;  1H89 C;  5BMZ A;  2X9D A;  4IRH A;  4HDU A;  2LYC A;  4IHY A;  1O3Q A;  4BJ6 C;  3PQK A;  2QKL B;  5IPA A;  2ID6 A;  4BU2 A;  4G12 A;  5D8L B;  3J7Y J;  4BYY A;  4KIF A;  2QYO A;  2ADU A;  4D5C A;  2XAJ A;  2R5Y B;  1GT0 C;  4MGR A;  5DV5 A;  1B1B A;  3RYP A;  2GWR A;  2VKH A;  5CKT A;  1IN7 A;  4YEL A;  3GUD A;  3LSI A;  4WXD A;  2MAB A;  1Y0U A;  4IHV A;  2DA1 A;  1BN5 A;  3LA2 A;  3E6D A;  3BPV A;  3W2V A;  1FLI A;  4PJL A;  2OZU A;  3WHB A;  2Z33 A;  4JX6 A;  4A3B J;  5LLQ A;  3ISP A;  3S3M A;  1XG1 A;  1OMI A;  1ZTR A;  2NVY J;  3BZC A;  4ZYH A;  2NVU B;  1Z7U A;  3R6S A;  5HLG A;  5F0F A;  3SQN A;  3JRE A;  2EIM H;  3W2A A;  5F27 A;  2ZSH B;  3JRD A;  4XIC A;  5E20 A;  2XAU A;  4ZZD A;  2Y2Z A;  4I09 A;  2K3F A;  3LWF A;  1P4W A;  4RA2 A;  3VEP A;  1YJW I;  1IRZ A;  1YX5 A;  4F93 B;  3OYL A;  2YUS A;  1YX3 A;  4HBL A;  3BQY A;  3JRC A;  3M7G A;  1KYZ A;  2L7M P;  2KMU A;  3FIS A;  2H8R A;  1RNL A;  2PFB A;  1CF7 A;  1FOW A;  2BE5 F;  5D5V B;  1VQ6 I;  3KEY A;  2LTP A;  3OYG A;  2VJJ A;  4H0E A;  1IZ1 A;  4RAF A;  3SZG A;  1AKH B;  2W84 A;  3L00 A;  4LJZ F;  2RKH A;  1EV7 A;  4B3A A;  3ONQ A;  3HOW J;  2XF6 A;  5B1B H;  1ZGJ A;  2LBF A;  3WG9 A;  3FHN A;  1BR4 A;  1U8R A;  4CYD A;  1NG6 A;  2F5V A;  1EJ9 A;  2LH9 A;  3HB9 A;  3PNT A;  2HQN A;  3HRT A;  2GBY A;  4Y33 A;  4MTD A;  3EUH A;  4MIM A;  2O8X A;  2R7W A;  3HTS B;  1DDN A;  1LEA A;  3H9Q A;  3LMM A;  5EG0 B;  3H5R A;  1HSJ A;  1FT9 A;  3J81 K;  5TGT A;  2JA2 A;  3HKZ A;  4ZZL A;  3SJM A;  2YSR A;  1IXC A;  4XSX F;  1UFM A;  5JFR A;  3GZN B;  2NVX J;  1TLH B;  2F5E A;  2XKP A;  1VQ7 I;  3HOU J;  1QNT A;  2WB1 A;  4I0B A;  4IF4 A;  3E5U A;  3MEX A;  4M9Z A;  5E1W A;  3KCC A;  3L2U A;  3ELK A;  3E0J B;  3FK6 A;  1JUP A;  5HS7 A;  5EZH A;  2ZJP F;  1YJ9 I;  1O3R A;  5LD2 C;  1OCT C;  1VQO I;  1ERD A;  4DBR A;  5J3L A;  4IJA A;  2JA6 J;  4ZYG A;  2HOE A;  2DJN A;  4C2U A;  4IHW A;  2W00 A;  1H9G A;  1T98 A;  4QSH A;  2TDX A;  4BDY A;  2DA5 A;  3K2Z A;  4F3Q A;  2E1C A;  2MLG A;  3Q0V A;  4ZYA A;  3V8K A;  2L3D A;  2ZCW A;  4E7H A;  2OTJ I;  3IL2 A;  1UCR A;  1X1P A;  3CC2 I;  5HNF A;  2ZJQ F;  4TV7 A;  2IPQ X;  1ZEL A;  1WSU A;  2W25 A;  3MCZ A;  1XSX A;  3S93 A;  1BBY A;  3F0C A;  1MBG A;  4OMZ A;  3TL4 X;  2X4H A;  4B47 A;  5JLW A;  1HKT A;  1DP3 A;  5J4Y A;  2K4J A;  2LR8 A;  1OCR H;  1Z9C A;  1MJ9 A;  1S6L A;  3P9C A;  1ZAO A;  3VYS B;  2EIL H;  4Y7N J;  1LQ1 A;  1TZL A;  1OCZ H;  2ZNZ A;  1ZG1 A;  3NEU A;  1QVT A;  3ZMU A;  1X3U A;  1MJB A;  1FP1 D;  4KN7 X;  2LK2 A;  2V9P A;  4RGU A;  5FD5 A;  3DXJ F;  2CV0 A;  2GA2 A;  4NC7 A;  3VSL A;  2VPR A;  3CF5 F;  4UY8 I;  1MNM C;  3CDH A;  3H9G A;  4IPA A;  4XK4 A;  3CCJ I;  2PJP A;  4Y4R A;  5D6F A;  1YYV A;  2WA0 A;  1OCC H;  3C2G A;  3B02 A;  2HFH A;  1R4M B;  2KL4 A;  3A4C A;  3M9A A;  3LFK A;  3F9K A;  3TO6 A;  1VQP I;  3K4B A;  2BOL A;  3ROU A;  2O6G E;  2K40 A;  2QUF A;  3M07 A;  3DV8 A;  1R6R A;  2KJB A;  5IP7 J;  1VZ0 A;  3CDL A;  2LBF B;  1I50 J;  5LGU A;  1FMW A;  1TTY A;  1QZE A;  2Y9Y A;  4A0Z A;  4S05 A;  1Z05 A;  5K5R A;  2JA7 J;  3ZRG A;  3PSF A;  2R0Q C;  1SFO J;  4JYK A;  2K27 A;  2ZME C;  4IKF A;  2OU2 A;  1B8I A;  2X6Y A;  3ZQL A;  1X58 A;  1B9M A;  3DTI A;  3ULQ B;  1AU7 A;  1IN4 A;  3L2C A;  1K61 A;  3V4G A;  5DS9 A;  2A5Y B;  3WGH A;  4JP0 A;  2NNY A;  5LHG A;  5F1J A;  3CCL I;  2YU9 J;  2NS0 A;  1LDK B;  1MBJ A;  3FXU A;  1R1V A;  2F4M B;  3PFY A;  3CMY A;  1YO5 C;  1JKP C;  4XLA A;  1BIA A;  3EUA A;  2XAG A;  4XNF A;  1FP2 A;  2XSJ C;  3G2B A;  4MLO A;  1S9H A;  2QGU A;  3Q3S A;  3S2W A;  2K9Q A;  4WF2 A;  4B48 A;  1YJN I;  1YTY A;  2MC3 A;  3OYJ A;  2HTJ A;  3CO7 C;  5H6Q A;  3L09 A;  3ASN H;  3BP8 A;  1OKR A;  3TGN A;  4EJU A;  3GTM J;  1Z3X A;  4ZTF A;  3H3V K;  4D9J A;  4KJZ A;  3KZZ A;  4AIK A;  3CUQ A;  1PP8 F;  3BTL A;  4AC0 A;  2QF7 A;  1AA7 A;  2E36 A;  2L0K A;  3ECO A;  2RQP A;  3MKY B;  4BEH B;  2C6Y A;  3E5Q A;  1EH8 A;  3O8H A;  1TW3 A;  3IKT A;  2L4M A;  5C44 J;  1A36 A;  1I1G A;  2E19 A;  3LSM A;  3WE2 A;  2MLK A;  4BHB A;  5GPC A;  3OR2 C;  1VTN C;  2STW A;  5J8F A;  1K6O A;  4AVZ A;  3VYT B;  2VXZ A;  5GAH J;  4C9Y A;  2X6O A;  4WK8 F;  2LNB A;  1Z6T A;  2OQR A;  4CDG A;  3U1D A;  2BVL A;  4Q48 A;  2MW8 A;  3RYR A;  4F92 B;  1ODD A;  5HDN A;  1FPQ A;  1QU3 A;  2E7X A;  2ESH A;  1A6Q A;  1BC8 C;  3O3K A;  3GO5 A;  4IVN A;  2BBY A;  5CQE A;  1U5T B;  2VJ4 A;  2WB1 N;  4LG0 B;  2PJR B;  3HC7 A;  4KFC A;  2ETH A;  4WX9 A;  2M5W A;  1DU0 A;  3CP2 A;  2CYY A;  4QLC U;  3QP5 A;  2R7U A;  3JCU C;  3LST A;  2F2E A;  1RI7 A;  2CH0 A;  4HQE A;  1B8I B;  1Y8R B;  5HOO A;  3RDI A;  3BR6 A;  1YIJ I;  1WZ2 A;  2L2O A;  3DQV C;  5KAF C;  1W1W E;  2M8G X;  5BNG A;  2FXA A;  5DCM A;  1Z77 A;  3K2A A;  3W6K B;  5FLM J;  3CJR B;  2QQ9 A;  5ILU A;  1Z91 A;  2LY9 A;  3RIR A;  1HQC A;  5DM6 F;  3DBR B;  1FYK A;  1XMK A;  3FM5 A;  2WTE A;  4UUS B;  1LDJ A;  1XGN A;  1FIP A;  1YLF A;  1TP4 A;  3EET A;  9ANT A;  4RB3 C;  1L3L A;  1LVK A;  4CCN A;  1V4R A;  1I3Q J;  2MYS A;  2KJC A;  3I56 I;  1ENH A;  1IRF A;  2KPM A;  2I5U A;  6PAX A;  2FE3 A;  4XKC A;  1IGN A;  3C2H A;  5EGO A;  5CVR A;  5DM7 F;  2M4G A;  1NK3 P;  2OCE A;  5IOY A;  4E7I A;  3CUQ B;  1PUF A;  4HDV A;  2H27 A;  3MN2 A;  3GXO A;  1G3W A;  2ZC2 A;  4A5M A;  1NH3 A;  2I8D A;  4IQ4 A;  2PMZ A;  5KK1 A;  3KP3 A;  3HG9 A;  1P7I A;  3AG4 H;  1JXS A;  3ZQC A;  5E3N A;  5FKN A;  1WJD A;  4BE2 A;  3GME A;  4A69 C;  2KRF A;  4E6K G;  2WWY A;  1YQA A;  3K4M A;  5CVJ A;  5D5X B;  1R1U A;  1WJE A;  3HZJ A;  2D45 A;  1U5T C;  1I5Z A;  5ICE A;  3CLQ A;  2FQ3 A;  3RKY A;  3BG5 A;  3H1C A;  3I53 A;  3L2W A;  2QBY A;  2O3F A;  3FMQ A;  5LRR A;  3PIO F;  3JTH A;  2EPF A;  4DJA A;  4AUX A;  4YIF A;  3LSJ A;  5E1Z B;  1Y56 A;  3GFJ A;  1TT5 B;  2XGD A;  4HST A;  2HZT A;  1JT0 A;  5K5O A;  3JSP A;  2JRT A;  3BG9 A;  1DP7 P;  4RAZ A;  1SD7 A;  2H94 A;  5HDG A;  1S3J A;  1MBF A;  1R22 A;  5HLI A;  5BOX A;  3W2W A;  3H3U A;  5IT3 A;  3WE3 A;  4A3D J;  5ILS A;  3OYD A;  2ZJ2 A;  3BY6 A;  2IP2 A;  3Q0U A;  1W0T A;  2F4I A;  3FHZ A;  1F5T A;  4ESB A;  4IHX A;  2IVM A;  3K4J A;  3R0J A;  3P7N A;  3A0B C;  3C3W A;  3WTU C;  4XN3 A;  4GXO A;  2HYJ A;  1KU7 A;  3L2R A;  1QZZ A;  3JTG A;  2V79 A;  1YOV B;  3VYU B;  2ESN A;  3BR2 A;  4OIN F;  2X1E A;  4M74 A;  4YIR X;  4U0V A;  1XDS A;  1QQI A;  3KPH A;  5TJJ A;  5K7F A;  2LD5 A;  3CUO A;  2JT1 A;  2M9H A;  2KRC A;  2HPI A;  1XPX A;  1FY7 A;  1X2M A;  3K70 D;  1ONV A;  4QIW N;  5LFA A;  4OAZ A;  3K10 A;  1IC8 A;  1ZYR F;  1UJ8 A;  1OJL A;  2YPR A;  4BQA A;  1P4A A;  1TWF J;  4U0Y A;  3R4K A;  2H6B A;  1FNN A;  2DDA A;  1MSF C;  4U7B A;  3DEE A;  5EGO B;  2LMD A;  1OR7 A;  3FZV A;  2BYV E;  1VFC A;  2B0L A;  3VSK A;  1U8B A;  1YW8 A;  2V1U A;  4A3L J;  3A03 A;  3ABU A;  1Z67 A;  4NBQ A;  3VDX A;  3PNY A;  3LQR A;  4V2G A;  3TP3 A;  2VJ5 A;  3I59 A;  1S8N A;  3MKW B;  5IYD J;  4PJM A;  3DU6 A;  2IJL A;  3M8F A;  3R60 A;  2EFW A;  4EJV A;  1XS9 A;  4B8X A;  4BQO A;  4A3M J;  3KP2 A;  2MH2 A;  3O6B B;  1J09 A;  2DCE A;  2DFH A;  2GIV A;  3RKW A;  1IV8 A;  3HRS A;  3J80 K;  1D1B A;  1W5S A;  2M3A A;  5EEA A;  2V6C A;  2DFI A;  4KIB A;  4O5V A;  2MD5 A;  2F4O B;  5FJ8 J;  3BJ6 A;  5IP9 J;  4HYE A;  3CJQ B;  3TO7 A;  3ZMD A;  1NG7 A;  1ULY A;  4HNU A;  4L5J A;  1JJ8 C;  1X2N A;  2Z2S B;  5BPI A;  5H20 A;  4IX7 A;  5J40 A;  1BJA A;  3P5J A;  4BBR J;  4LLN A;  2DMP A;  2P81 A;  4G6T B;  1HDD C;  2V26 A;  3L7W A;  4M9S A;  1J7K A;  3QWL A;  4XSZ F;  4XN0 A;  1O7F A;  1IDY A;  1DGW Y;  2DN0 A;  1XN7 A;  2X0L A;  1OLT A;  3I71 A;  2R5Y A;  4DIQ A;  1XD7 A;  3K1M A;  5TIS C;  4DOZ A;  3BPX A;  4I99 C;  4AWX B;  3HOS A;  2NNN A;  4LFU A;  2HKX A;  3DPT A;  1IV6 A;  3OV8 A;  5HS9 A;  2QSF X;  3ERE D;  2WAE A;  4HOB A;  1MW7 A;  2LVS A;  2ZXW H;  4FTH A;  2ZO4 A;  2H1L A;  3Q9S A;  3TDU C;  2Q8K A;  3HPG A;  4A12 A;  2CFX A;  2GXG A;  1OYY A;  3MKZ A;  5CVU A;  4HV5 A;  1I6H J;  2FF4 A;  4U7D A;  2LC2 A;  4II3 A;  2BW3 B;  3GLX A;  2ZXH A;  4UV8 A;  2P7C B;  2HXO A;  2PMZ N;  3A2K A;  3I4P A;  2BY3 A;  2IGO A;  1RKT A;  3CDI A;  3KIO A;  2HDW A;  4BJ5 C;  3WTS C;  2HVS A;  5C4J J;  4BH9 A;  5EEH A;  3NRV A;  2RAE A;  3K7A J;  2HDD A;  3ECH A;  2KT0 A;  4BS9 A;  3BCA A;  2DMQ A;  4LGW A;  4I0A A;  4Z6Y A;  2IT0 A;  2DA6 A;  1F9N A;  2NYX A;  5J1U A;  1G3S A;  2V9K A;  4FX0 A;  4C3J J;  2FNP A;  3HIF A;  5K5Q A;  4B43 A;  4EEF G;  4I01 A;  1AOY A;  3IWZ A;  3WTX C;  1TW2 A;  4GYI A;  1RKW A;  4QWQ A;  3I59 B;  2XGC A;  3EUK L;  3V8L A;  3I0T A;  4D0P A;  1PJR A;  1JTY A;  1AKH A;  4YRV A;  1T38 A;  2IXS A;  5E8I A;  3C1D A;  3OS1 A;  5IYC J;  2O61 A;  1WHU A;  2WAF A;  5FKO A;  1IN6 A;  2R92 J;  2XB5 A;  4ZDO A;  3MWM A;  3S32 A;  3G73 A;  1VQ9 I;  3HYI A;  2GOX B;  4IHS A;  2ZKZ A;  1T6S A;  1T95 A;  4PZJ A;  1QGP A;  5EG0 A;  3PO3 J;  4L9V A;  3A1Y A;  2OA4 A;  2VUM J;  2QZ8 A;  2HPM A;  3IWF A;  1WCM J;  4OIQ F;  4CGZ A;  3I5U A;  1BR2 A;  4NC8 A;  4LMY A;  2UUZ A;  2EV6 A;  5EZG A;  2CRG A;  2XPV A;  2EFN A;  2CW0 F;  2OCC H;  3L2V A;  5HOD A;  2EJR A;  1BIB A;  1V54 H;  4XOP A;  4CIC A;  5GPA A;  2W1O A;  2VQG A;  3K0L A;  5K1Y A;  1HF0 A;  1ZR2 A;  2IW5 A;  1XMX A;  4N4O B;  2EZI A;  1MBK A;  1YIO A;  2XVC A;  2ZME A;  5L3B A;  1TWG J;  1IRX A;  1D1A A;  4P5O A;  3RZO J;  2HI3 A;  4BXU A;  2BXY A;  1FWZ A;  2HZD A;  1DUX C;  2ICW G;  4MO7 A;  5FKL A;  3FIW A;  2RRE A;  2A3S A;  3IHU A;  5D8K B;  1QA6 A;  2VBW A;  3F6V A;  3ZXS A;  4UXN A;  2VL8 A;  3DEU A;  3CC4 I;  2K9S A;  5JHU A;  2EA2 A;  1Y0N A;  2JSC A;  4HLY A;  1JGG A;  1ON2 A;  5AON A;  2WAQ A;  2YR2 A;  3JRA A;  4LD5 A;  1TWH J;  3X2Q H;  1R23 A;  3CLO A;  1OPC A;  3CCS I;  4JX4 A;  4ITV A;  1WQ2 A;  3T8R A;  4YII A;  5LRS A;  3OSF A;  3D5R C;  1ZN2 A;  3A0H C;  4CUG A;  3TP0 A;  2HVR A;  4L0Z B;  2JWT A;  5FLX K;  3W3C A;  5DDG A;  3D0S A;  3HL2 A;  2DT7 B;  3A02 A;  3KX2 A;  2F5D A;  4Y3O A;  2DQR A;  4IQJ A;  2CFO A;  3OL3 A;  5B66 C;  1R5H A;  2GIZ A;  3SZP A;  4A0X A;  3O2P E;  1ZRE A;  2GOM A;  1IN5 A;  3PL8 A;  3AG1 H;  4XOT A;  2DT6 A;  2E71 A;  4DYR A;  3N4M A;  2AXL A;  4RB2 C;  2EIN H;  3LFU A;  1X19 A;  4M72 A;  1NHA A;  2JVG A;  2P5L C;  3RI4 A;  1N77 A;  1ZLJ A;  3PNV A;  3RTR A;  4DNC A;  3WG7 H;  4CZZ A;  5CYV A;  2DJI A;  5J6X A;  1SVL A;  4D7M A;  3RPQ A;  2DOE A;  1TL8 A;  3VPR A;  3OYM A;  1E2X A;  4NDL A;  2JA8 J;  1W7P D;  3KLN A;  2A07 F;  2DXI A;  1XCB A;  3FBN B;  4CCO A;  2P5V A;  2KDZ A;  3B6A A;  3ZQH A;  2HNH A;  2ZXJ A;  2ZBK A;  5GAE J;  3L1P A;  4FE7 A;  2MG4 A;  1UAA A;  4AYB A;  1MKM A;  4XRS A;  1G3Y A;  1UHS A;  2KIM A;  4MEY F;  5C3E J;  4RM3 A;  2W57 A;  5HLT A;  4EQQ A;  4KIT B;  3BR5 A;  5B1A H;  3OYI A;  4AU7 A;  2UWM A;  1WJB A;  1FIA A;  4HX7 A;  4L9N A;  2OBP A;  3CCU I;  5FKM A;  2QSG X;  2A68 F;  3M4O J;  1FBU A;  1YE9 A;  1O7L A;  4DBQ A;  4HF2 A;  2W82 A;  2ZME B;  1IJW C;  1UHW A;  2EH3 A;  4CO8 A;  2KKO A;  2HU9 A;  3UKG A;  4UB8 C;  2LKP A;  3ZQQ A;  5ILV A;  3C2B A;  2K7L A;  3BDD A;  1PVE A;  5LBQ A;  5JVT A;  1ZR4 A;  2VQC A;  3HTU A;  3WTZ A;  2HOA A;  2DK8 A;  3LOC A;  1V5G A;  4CH7 A;  1Z7L A;  2NAZ A;  4BEH A;  5E18 F;  4GDF A;  4ABZ A;  2VIX A;  3D5S C;  3IKV A;  3C7J A;  3HXL A;  2R7F A;  3KEQ A;  2R5Z A;  3FF5 A;  5L3D A;  2EV0 A;  5K7H A;  4BDZ A;  1OFC X;  2LF7 A;  5CVI A;  2ZSI B;  3VB2 A;  1OCP A;  3GYH X;  4AIH A;  1UST A;  2FOW A;  1G8X A;  3KP5 A;  2M0C A;  1WGX A;  2MH9 A;  2RVC A;  1DPR A;  4A0Y A;  3BR0 A;  1NK2 P;  3QAH A;  5F6F A;  2DOD A;  3GTP J;  1KQ0 A;  3V7S A;  2EFO A;  2CQN A;  3PQJ A;  4YFN F;  2R7Z J;  2EA4 A;  2NXN B;  3IAS 2;  4AID A;  1HST A;  1D0X A;  5EJC A;  1RPW A;  2PBI A;  1U78 A;  2Y9Z A;  2LLK A;  1FTZ A;  3MFK A;  4C2T A;  2K86 A;  2FRH A;  4HA8 A;  3LSG A;  1LDD A;  2KP6 A;  1U5T A;  4LG0 A;  5EYR A;  4G9Y A;  2E5Z A;  2BHZ A;  2LFB A;  2R7R A;  1A31 A;  2DQL A;  2PJR A;  3QP6 A;  4C2M J;  5JHF A;  4P1W A;  4KYW A;  4IOA F;  3ABL H;  4MHG A;  2NVQ J;  2Y30 A;  1WKM A;  3BG7 A;  5HVQ C;  2WY7 Q;  1JGS A;  4P9U A;  2CQQ A;  2L7K A;  2L4A A;  3DLA A;  1SEU A;  2L9R A;  4PCQ A;  3H0D A;  3TDZ C;  2ELK A;  2QWW A;  4A3G J;  1ITY A;  3JRG A;  2M0M A;  1YW9 A;  1TNS A;  1IAW A;  1XTA A;  5HNH A;  1LUJ B;  1FYM A;  4UUS A;  4FQG A;  3IV5 A;  3N97 A;  2VKD A;  3OY9 A;  4PUS A;  3OYE A;  3OIO A;  4ZDP A;  4BE1 A;  2UZK A;  1V5E A;  2IA0 A;  3HEF A;  4V2F A;  1HKQ A;  2WV1 A;  2CO5 A;  1ETY A;  4JK1 X;  4LIT A;  2GLO A;  1LEB A;  3CJT B;  1L0O C;  3FXQ A;  4LB6 B;  2L5Q A;  3OS2 A;  4HF1 A;  3BTJ A;  2DTR A; 
#chains in the Genus database with same CATH homology
 4KN4 X;  1EH7 A;  3DP7 A;  3K9T A;  2OQG A;  2P6T A;  2LSO A;  3E97 A;  4IRG A;  1TQI A;  4AIJ A;  4ON0 A;  4KT5 C;  1B9N A;  4P55 A;  3HRM A;  2V1X A;  1QBJ A;  2HYF A;  4RB0 A;  3I58 A;  2IRF G;  4G7Z F;  3GW2 A;  3WOD F;  2D1V A;  3RJP A;  2Z99 A;  4ZYE A;  4UV9 A;  2DI3 A;  4HW0 A;  1MGT A;  3QPT A;  5EEG A;  2JPC A;  1YW7 A;  4OIO F;  4AD9 A;  1KA8 A;  4DQ2 A;  5JR3 A;  1T2K A;  1S29 A;  2PMU A;  2VBY A;  3GZ6 A;  3GEZ A;  2ACJ A;  3ZP5 A;  3F21 A;  2H09 A;  5HS8 A;  4Q5S F;  4I98 B;  2HKO A;  3KFW X;  4AVP A;  1WI9 A;  3TQN A;  3HRU A;  2D2W A;  1I27 A;  1W5T A;  4RGR A;  2VOO A;  5CVV A;  3HHG A;  2Z5U A;  1GXQ A;  4PGH A;  4L9J A;  3M1E A;  2FSW A;  2QQA A;  3E5X A;  5DD8 A;  2FBI A;  4MQV A;  2FML A;  1PUE E;  1OYW A;  1D8J A;  1R7J A;  4ENM A;  4Y15 A;  1G4D A;  1D5V A;  2QEN A;  3EYY A;  4EJW A;  1ZG3 A;  1FZP B;  3WTT C;  3ZPL A;  4LLL A;  4NHJ A;  5DUK A;  1KU3 A;  3F3X A;  1FBS A;  2ZFW A;  1P2F A;  2M1B A;  3F8F A;  1MZB A;  3F8M A;  3FM3 A;  1D3Y A;  4A2U A;  4BNC A;  2R3S A;  1XDU A;  1BOA A;  1JHF A;  5E1X A;  2PN6 A;  3BOQ A;  3SXY A;  3DFG A;  2Q2E A;  3P9I A;  3WTV C;  1BI0 A;  4HLX A;  2YU3 A;  4GGG A;  1MJA A;  1IW7 F;  3LQQ A;  3K1N A;  1PP7 U;  1B59 A;  4EJO A;  4HX4 A;  3QRF F;  3J7A O;  4PGG A;  3U2R A;  5KVR A;  4N0B A;  5ICG A;  2BV6 A;  1O57 A;  2MA3 A;  4EM1 A;  4WXH A;  2PG4 A;  3GFM A;  3BJO A;  4MTE A;  5BPD A;  1R00 A;  4UHT A;  5D5U B;  2CG4 A;  3FMS A;  1IF1 A;  2EFP A;  5IT9 Z;  4KUM A;  2K02 A;  1BI2 A;  2XV4 S;  3F22 A;  3HSR A;  5FB2 A;  4XLP F;  4YFX F;  4P9F A;  1EH6 A;  4JQF A;  3GF2 A;  4KA4 A;  2GA1 A;  1USS A;  1ON1 A;  2H6C A;  4RGS A;  2RC4 A;  3HHH A;  5L3C A;  5E8G A;  2GXB A;  2VN2 A;  3ABT A;  3LAP A;  4G8X A;  2ELH A;  3ML6 A;  1HKS A;  4RS8 A;  5LGT A;  1HW1 A;  2VT2 A;  4YG2 F;  2RV8 A;  4M9X A;  4OMY A;  5L3E A;  3E6B A;  1J0R A;  2G7U A;  1FBQ A;  1LJ9 A;  1W7P B;  3GFL A;  1T39 A;  1A04 A;  4B09 A;  1MDM B;  1WRJ A;  3I54 A;  3HOT A;  3L9F A;  3T5X A;  1KQ9 A;  3ZN0 A;  3IRQ A;  4F7Z A;  4O3M A;  1FX7 A;  3GWZ A;  2HQR A;  4L18 B;  1KQ8 A;  1R1T A;  1P6R A;  2WC2 A;  1RUN A;  2V1D A;  3TOA A;  5LHI A;  2GQQ A;  1S7O A;  4G94 A;  3DPL C;  3CJN A;  3VOE A;  4G6D A;  3BRO A;  1F4K A;  2NRA C;  1SD6 A;  5FO5 A;  2PQ8 A;  5DYM A;  1O3T A;  3HUG A;  3KET A;  2A6E F;  3KP6 A;  2J5P A;  2BEO A;  2VOP A;  1FOK A;  1J9I A;  3ZMZ A;  1RZ4 A;  4BHP A;  3WU0 A;  4KIG A;  4P96 A;  5ERI A;  2BGC A;  3QPH A;  2MBF A;  4K2E A;  4HF0 A;  4EGZ A;  2RGV A;  4KIC A;  4XRF A;  4IRI A;  4M6X A;  4EGY A;  3H92 A;  3WGG A;  2DT5 A;  5F1R A;  4XLN F;  1H9T A;  1LB2 A;  1BC7 C;  3E6C C;  1KU2 A;  3WTY C;  4ENK A;  2VE9 A;  1STZ A;  1E17 A;  3OOP A;  5DD4 A;  2PI0 A;  1H0M A;  4UVA A;  2DW4 A;  1XCV A;  2P4W A;  2LDU A;  1OYI A;  3GX4 X;  4ZYD A;  3G3Z A;  5H6R A;  2HEO A;  1FSE A;  5IT9 K;  4ESF A;  2FU4 A;  2YX7 A;  3MQ0 A;  3VFZ A;  3DF8 A;  1TQM A;  4ESJ A;  1ZAR A;  4LB5 A;  1J2X A;  2W85 A;  3JW4 A;  2L02 A;  3V7C A;  1B6A A;  4A6D A;  2EB7 A;  2VBZ A;  1K78 B;  2GZW A;  2CSO A;  1C0W A;  2Z9O A;  4FT8 A;  2XRO A;  1FYL A;  2HS5 A;  1FSH A;  4BHC A;  4Q4Z F;  4G7O F;  3JAM Z;  2HTS A;  1YG2 A;  2J5O A;  2M30 A;  2Y0M A;  3T0Y A;  2OD5 A;  2O0Y A;  2Q0O A;  1REP C;  2XAH A;  5A2Q Z;  4CXF A;  2F5F A;  2QVO A;  1TBX A;  1JHH A;  3GZ5 A;  4OOI A;  2PEX A;  2HGC A;  4UVC A;  2CGP A;  2A6H F;  3K69 A;  2RN7 A;  4JBA A;  4KMF A;  2LF8 A;  5HLH A;  4RGX A;  2K4B A;  3WU1 B;  1SMY F;  2M8E A;  2AS5 F;  5DEQ A;  3QU6 A;  4HX8 A;  2UXN A;  4Y17 A;  5BQT A;  2XGX A;  2OZ6 A;  5LEK A;  1RUO A;  2HDC A;  3DKW A;  4MNU A;  2DU9 A;  1YFH A;  1QZY A;  1XMA A;  3BZ6 A;  4XBF A;  2XUB A;  4GO1 A;  1KU9 A;  3E6M A;  3IC7 A;  4I02 A;  5L3F A;  4OIP F;  3F23 A;  2FA5 A;  3V8J A;  1U2W A;  1ZH5 A;  2O03 A;  5FFX A;  2IA1 A;  2DO7 A;  4M73 A;  3ZQ7 A;  4G7H F;  1R58 A;  3LAJ A;  3I64 A;  1O3S A;  3KZY A;  1Z6R A;  4FX4 A;  2KIU A;  4EJT A;  4UUV A;  3R0A A;  1P92 A;  5ICC A;  1J59 A;  1XGM A;  1CF7 B;  1ZLK A;  5D4R A;  4MEX F;  2DPD A;  1IUY A;  3GVA A;  4RB1 A;  2JZY A;  3AAF A;  4LLG F;  3RKX A;  4Q47 A;  2COM A;  5D4S A;  1QPM A;  2FNA A;  1TNT A;  2KIF A;  2E7W A;  3F8N A;  2VBX A;  3ZMT A;  2EFQ A;  2YX4 A;  4S04 A;  1ZGA A;  5JI6 A;  1RIO H;  4OIR F;  2OAZ A;  1IXS B;  3EDP A;  3TKY A;  2FBH A;  2GAU A;  2DPU A;  2PLY A;  3HSF A;  1GXP A;  2G7H A;  4KNY A;  2D1H A;  2DK5 A;  5J8C A;  2P7V B;  2P5K A;  1PDN C;  1ZRD A;  3E3V A;  5LEJ A;  3HSE A;  2PMH A;  5L3G A;  1SFU A;  3EQL F;  2Z3Y A;  3FXR A;  5D5W B;  3P9K A;  4KMU X;  2FOK A;  4U0W A;  1F1Z A;  4EMS A;  3M8E A;  3MZH A;  5DUI A;  3JAM K;  4R79 A;  2M87 A;  4O6J A;  4R1H A;  2DAO A;  1DPU A;  3K1P A;  1IN8 A;  3D5L A;  3PFI A;  1LNW A;  4UNO A;  1IRG A;  2G9W A;  1BI1 A;  4A5N A;  1QO0 D;  5A2Q K;  3J80 Z;  4CHU A;  4LK0 F;  1TQP A;  4MQ9 F;  3C18 A;  2DLL A;  2JPB A;  1UB9 A;  3CTA A;  2VOD A;  1B4A A;  4BAY A;  2VC0 A;  1SAX A;  2EWN A;  4Z2Y A;  5D6E A;  4E70 A;  3VOD A;  2DBB A;  1YS6 A;  3BWG A;  3KLO A;  4LK1 F;  1IXR C;  3Q5F A;  3MZY A;  1K79 A;  2M45 A;  2UXX A;  2XHK A;  1ZG5 A;  2A69 F;  1KYW A;  2XAQ A;  2ISY A;  1WWX A;  3KP7 A;  4M6Y A;  1XGO A;  5CJ9 A;  4L0Y B;  2Y75 A;  1R5G A;  1BI3 A;  2V9V A;  1ZRF A;  2QM3 A;  4NQW A;  1HW5 A;  3TOB A;  2RNJ A;  3QOP A;  4EM2 A;  3WTW C;  3R61 A;  4N9H A;  4M71 A;  1SD4 A;  2FEZ A;  4A6E A;  1J5Y A;  5TRD A;  1HXD A;  1LVA A;  3IRR A;  1XSV A;  3ZMS A;  5FD6 A;  3ZN1 A;  1P4X A;  4WWC A;  2QLZ A;  4ASN A;  5LGN A;  1SMT A;  1GHC A;  5AIP A;  1MD0 A;  2XIG A;  3KEO A;  1SD5 A;  3SFZ A;  1W7P A;  3F8B A;  2JTV A;  4HV6 A;  2HYG D;  4I2O A;  5E17 F;  5F64 A;  1MDM A;  2VT3 A;  5FGM A;  3T8T A;  5CLS A;  3LA3 A;  2CWE A;  3Q9V A;  1FC3 A;  4R8H A;  1CGP A;  1GVJ A;  3V7R A;  1R36 A;  3CUQ C;  4EV0 A;  4ENJ A;  3KP4 A;  5DCM B;  2L54 A;  4N9I A;  1K7A A;  2XKO A;  4ZH4 F;  4Y13 A;  1G6N A;  1SFX A;  5BS6 A;  5LHH A;  1ZHF A;  2E1N A;  1U6G A;  4IXA A;  2HR3 A;  3REO A;  3GFI A;  1S7A A;  4KDP A;  3W6J B;  1AWC A;  1KGS A;  2EV5 A;  5FLX Z;  5ED4 A;  3SZT A;  4UVB A;  1Q1H A;  2F5C A;  2WV0 A;  2FMY A;  4GCV A;  4L9T A;  1V3F A;  2HWV A;  4WXC A;  5HDK A;  1I1S A;  2QBY B;  5AIQ A;  4G6Q A;  4PDK A;  1HW2 A;  1YS7 A;  3B73 A;  2L01 A;  1D8K A;  1HBX G;  4U88 A;  1BM9 A;  2STT A;  1ZRC A;  1G3T A;  1SFE A;  3TO9 A;  2VE8 A;  1XSD A;  2VON A;  2Y48 A;  3J81 Z;  3CO6 C;  1T0F A;  2RDP A;  2QQB A;  2EK5 A;  3NQO A;  4L5I A;  2P8T A;  3FX3 A;  1XGS A;  3LA7 A;  3T1B A;  2XAF A;  2W24 A;  4IHT A;  1U3E M;  2XAS A;  2XRN A;  2ISZ A;  3F72 A;  4ETS A;  4RAY A;  4FHT A;  3U9G A;  2FBK A;  4WCG A;  3WGI A;  3BJA A;  3COA C;  5ICF A;  1K78 A;  3FMR A;  2R7D A;  1W4M A;  1UHM A;  3JSO A;  4HZF A;  2IA2 A;  2A61 A;  4ENN A;  5FFZ A;  2P6S A;  4EVI A;  3FWE A;  1XB4 A;  3SHF A;  1J75 A;  2CQK A;  2VC1 A;  2ZNY A;  3F6O A;  4EM0 B;  4OU0 A;  4HAM A;  3MAJ A;  3RPU A;  3H3Z A;  3QU3 A;  3ZMV A;  4HQM A;  3KE2 A;  4GYG A;  1Z1D A;  3EYI A;  1JE8 A;  4I7H A;  3F8C A;  1I6X A;  4YFK F;  5DCF A;  4NB5 A;  5BMZ A;  4IRH A;  4HDU A;  1O3Q A;  3PQK A;  5D8L B;  4BYY A;  4KIF A;  2QYO A;  2ADU A;  2XAJ A;  4MGR A;  5DV5 A;  1B1B A;  3RYP A;  2GWR A;  1IN7 A;  3GUD A;  4WXD A;  1Y0U A;  1BN5 A;  3LA2 A;  3E6D A;  3BPV A;  1FLI A;  2OZU A;  2Z33 A;  5LLQ A;  3ISP A;  1OMI A;  4ZYH A;  1Z7U A;  3R6S A;  5HLG A;  3SQN A;  5E20 A;  4ZZD A;  4I09 A;  3LWF A;  1P4W A;  3VEP A;  4HBL A;  3M7G A;  1KYZ A;  1RNL A;  2PFB A;  1CF7 A;  2BE5 F;  5D5V B;  4H0E A;  1IZ1 A;  2W84 A;  3L00 A;  4LJZ F;  2RKH A;  1EV7 A;  1ZGJ A;  3WG9 A;  1U8R A;  4CYD A;  2HQN A;  3HRT A;  4MTD A;  3EUH A;  2O8X A;  3HTS B;  1DDN A;  1LEA A;  1HSJ A;  1FT9 A;  3J81 K;  4ZZL A;  2YSR A;  1IXC A;  4XSX F;  1UFM A;  5JFR A;  1TLH B;  2F5E A;  2XKP A;  1QNT A;  4I0B A;  4IF4 A;  3E5U A;  3MEX A;  4M9Z A;  5E1W A;  3KCC A;  3ELK A;  5HS7 A;  1O3R A;  4IJA A;  4ZYG A;  2HOE A;  1H9G A;  1T98 A;  2TDX A;  3K2Z A;  2E1C A;  2MLG A;  3V8K A;  2L3D A;  2ZCW A;  3IL2 A;  1UCR A;  4TV7 A;  2IPQ X;  1WSU A;  2W25 A;  3MCZ A;  1XSX A;  1BBY A;  4OMZ A;  2X4H A;  1HKT A;  2K4J A;  1Z9C A;  1MJ9 A;  1S6L A;  3P9C A;  1ZAO A;  1LQ1 A;  2ZNZ A;  1ZG1 A;  3NEU A;  3ZMU A;  1X3U A;  1MJB A;  1FP1 D;  4KN7 X;  4RGU A;  5FD5 A;  3DXJ F;  2GA2 A;  3CDH A;  4IPA A;  2PJP A;  5D6F A;  1YYV A;  3B02 A;  2HFH A;  3M9A A;  3LFK A;  3TO6 A;  3ROU A;  2O6G E;  2QUF A;  3DV8 A;  2KJB A;  5LGU A;  1TTY A;  4A0Z A;  4S05 A;  1Z05 A;  5K5R A;  2K27 A;  2OU2 A;  1B9M A;  3ULQ B;  1IN4 A;  3L2C A;  3V4G A;  2A5Y B;  3WGH A;  2NNY A;  5LHG A;  2NS0 A;  1LDK B;  3FXU A;  1R1V A;  1YO5 C;  1BIA A;  2XAG A;  1FP2 A;  3S2W A;  4WF2 A;  1YTY A;  2MC3 A;  2HTJ A;  3CO7 C;  5H6Q A;  3L09 A;  3BP8 A;  1OKR A;  3TGN A;  4EJU A;  3KZZ A;  4AIK A;  3CUQ A;  1PP8 F;  3ECO A;  2RQP A;  2C6Y A;  3E5Q A;  1EH8 A;  1TW3 A;  3IKT A;  2L4M A;  1I1G A;  3WE2 A;  2MLK A;  4BHB A;  1VTN C;  2STW A;  5J8F A;  1K6O A;  2VXZ A;  4WK8 F;  2LNB A;  1Z6T A;  2OQR A;  4CDG A;  3U1D A;  4Q48 A;  3RYR A;  1ODD A;  5HDN A;  1FPQ A;  2E7X A;  2ESH A;  1BC8 C;  3O3K A;  3GO5 A;  4IVN A;  2BBY A;  1U5T B;  4LG0 B;  4KFC A;  2ETH A;  4WX9 A;  2M5W A;  2CYY A;  4QLC U;  3QP5 A;  3LST A;  2F2E A;  1RI7 A;  4HQE A;  5HOO A;  3RDI A;  3DQV C;  2FXA A;  5DCM A;  3W6K B;  2QQ9 A;  5ILU A;  1Z91 A;  3RIR A;  1HQC A;  1FYK A;  1XMK A;  3FM5 A;  2WTE A;  1LDJ A;  1XGN A;  1YLF A;  3EET A;  4RB3 C;  1L3L A;  1V4R A;  2KJC A;  1IRF A;  6PAX A;  2FE3 A;  5CVR A;  3CUQ B;  4HDV A;  2H27 A;  3GXO A;  1G3W A;  4A5M A;  5KK1 A;  3KP3 A;  1JXS A;  2WWY A;  2KRF A;  1YQA A;  5CVJ A;  5D5X B;  2D45 A;  1R1U A;  1U5T C;  1I5Z A;  5ICE A;  2FQ3 A;  3RKY A;  3I53 A;  2QBY A;  2O3F A;  3FMQ A;  5LRR A;  3JTH A;  4YIF A;  5E1Z B;  3GFJ A;  2HZT A;  5K5O A;  3JSP A;  2JRT A;  1DP7 P;  4RAZ A;  1SD7 A;  2H94 A;  5HDG A;  1S3J A;  1R22 A;  5HLI A;  5BOX A;  3H3U A;  5IT3 A;  3WE3 A;  5ILS A;  2ZJ2 A;  3BY6 A;  2IP2 A;  3FHZ A;  1F5T A;  4ESB A;  2IVM A;  3R0J A;  3P7N A;  3C3W A;  3WTU C;  4GXO A;  1KU7 A;  1QZZ A;  3JTG A;  2V79 A;  2ESN A;  4OIN F;  4M74 A;  4U0V A;  1XDS A;  1QQI A;  5TJJ A;  3CUO A;  2JT1 A;  1FY7 A;  1ONV A;  1ZYR F;  2YPR A;  4BQA A;  1P4A A;  4U0Y A;  3R4K A;  2H6B A;  1FNN A;  4U7B A;  1OR7 A;  3FZV A;  2BYV E;  2B0L A;  1YW8 A;  2V1U A;  3ABU A;  3LQR A;  3I59 A;  1S8N A;  2IJL A;  3M8F A;  3R60 A;  2EFW A;  4EJV A;  4B8X A;  3KP2 A;  2MH2 A;  3O6B B;  2GIV A;  3RKW A;  3HRS A;  3J80 K;  1W5S A;  2V6C A;  2DFI A;  4KIB A;  4O5V A;  2MD5 A;  3BJ6 A;  4HYE A;  3TO7 A;  3ZMD A;  1ULY A;  4L5J A;  5BPI A;  5H20 A;  1BJA A;  4LLN A;  3L7W A;  4M9S A;  1J7K A;  4XSZ F;  1O7F A;  1XN7 A;  2X0L A;  3I71 A;  1XD7 A;  3K1M A;  3HOS A;  3BPX A;  4AWX B;  2NNN A;  4LFU A;  2HKX A;  3DPT A;  3OV8 A;  5HS9 A;  3ERE D;  4HOB A;  2ZO4 A;  3Q9S A;  3TDU C;  2Q8K A;  4A12 A;  2CFX A;  2GXG A;  1OYY A;  5CVU A;  4HV5 A;  2FF4 A;  4U7D A;  3GLX A;  4UV8 A;  2P7C B;  3I4P A;  3WTS C;  4BH9 A;  5EEH A;  3NRV A;  3ECH A;  4LGW A;  4I0A A;  2IT0 A;  1F9N A;  2NYX A;  1G3S A;  4FX0 A;  2FNP A;  3HIF A;  5K5Q A;  4I01 A;  1AOY A;  3IWZ A;  3WTX C;  1TW2 A;  4GYI A;  4QWQ A;  3I59 B;  3V8L A;  3I0T A;  4D0P A;  1T38 A;  5E8I A;  3C1D A;  2O61 A;  1IN6 A;  3MWM A;  3G73 A;  3HYI A;  4IHS A;  2ZKZ A;  1T6S A;  4PZJ A;  1QGP A;  4L9V A;  2OA4 A;  2QZ8 A;  3IWF A;  4OIQ F;  4CGZ A;  3I5U A;  4LMY A;  2EV6 A;  2EFN A;  2CW0 F;  2EJR A;  1BIB A;  4CIC A;  3K0L A;  5K1Y A;  2IW5 A;  1YIO A;  2XVC A;  2ZME A;  5L3B A;  4P5O A;  4BXU A;  1FWZ A;  1DUX C;  2A3S A;  3IHU A;  5D8K B;  2VBW A;  3F6V A;  4UXN A;  3DEU A;  5JHU A;  2EA2 A;  2JSC A;  4HLY A;  1ON2 A;  5AON A;  2YR2 A;  4LD5 A;  1R23 A;  3CLO A;  1OPC A;  1WQ2 A;  3T8R A;  5LRS A;  4YII A;  1ZN2 A;  4L0Z B;  5FLX K;  5DDG A;  3D0S A;  2F5D A;  2DQR A;  1R5H A;  3SZP A;  4A0X A;  3O2P E;  1ZRE A;  1IN5 A;  3N4M A;  2AXL A;  4RB2 C;  4M72 A;  1NHA A;  2P5L C;  3RI4 A;  1ZLJ A;  3RTR A;  4DNC A;  4CZZ A;  5CYV A;  5J6X A;  3RPQ A;  1E2X A;  1W7P D;  3KLN A;  2A07 F;  1XCB A;  2P5V A;  2ZXJ A;  2ZBK A;  1MKM A;  1G3Y A;  2KIM A;  4MEY F;  2W57 A;  4EQQ A;  2UWM A;  4HX7 A;  4L9N A;  2OBP A;  2A68 F;  1FBU A;  1O7L A;  4HF2 A;  2ZME B;  1UHW A;  4CO8 A;  2KKO A;  2LKP A;  5ILV A;  2K7L A;  5JVT A;  3BDD A;  5LBQ A;  3HTU A;  3WTZ A;  2DK8 A;  2NAZ A;  5E18 F;  3IKV A;  3C7J A;  2R7F A;  3KEQ A;  3FF5 A;  5L3D A;  2EV0 A;  2LF7 A;  5CVI A;  3VB2 A;  3GYH X;  4AIH A;  1UST A;  3KP5 A;  2MH9 A;  2RVC A;  1DPR A;  4A0Y A;  3QAH A;  5F6F A;  1KQ0 A;  3V7S A;  2EFO A;  3PQJ A;  4YFN F;  2EA4 A;  1HST A;  2PBI A;  1U78 A;  3MFK A;  2K86 A;  2FRH A;  4HA8 A;  1LDD A;  1U5T A;  4LG0 A;  4G9Y A;  2DQL A;  3QP6 A;  4KYW A;  4MHG A;  1WKM A;  5HVQ C;  1JGS A;  4P9U A;  2L4A A;  4PCQ A;  3TDZ C;  2QWW A;  1YW9 A;  1TNS A;  1IAW A;  1FYM A;  3N97 A;  2UZK A;  2IA0 A;  1HKQ A;  2CO5 A;  4JK1 X;  1LEB A;  1L0O C;  3FXQ A;  4LB6 B;  4HF1 A;  2DTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...