2XV4S

Structure of human rpc62 (partial)
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
532
structure length
399
Chain Sequence
MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETTMDYAEVSNTFVRLADTHFVQRCPSIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKGMYVINLHKALASLATATLESVVQERFGSRCARIFRLVLQRTFYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analysis of Hrpc62 Provides Insights Into RNA Polymerase III Transcription
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE III SUBUNIT RPC3
total genus 150
structure length 399
sequence length 532
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF05645 RNA_pol_Rpc82 RNA polymerase III subunit RPC82
S PF08221 HTH_9 RNA polymerase III subunit RPC82 helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S03
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S04
3ULQB 4D0PA 4ENMA 2K7LA 3W6KB 1USSA 4RGUA 3KP7A 1Z6TA 4L5IA 2CYYA 2ISYA 1J75A 3F6OA 3FM5A 2QQBA 4G6DA 4L9VA 1TBXA 5L3FA 1OYIA 4BHCA 1XGSA 1ZAOA 5H20A 1GXQA 3KP5A 1BC7C 3WE2A 1F4KA 5HLGA 1JGSA 4I02A 1PP8F 4BQAA 1WKMA 1MKMA 4L5JA 2KJBA 5BMZA 5CJ9A 3J80Z 4GYIA 3F8CA 3K0LA 2O3FA 3RYRA 2JRTA 2OQRA 3SZPA 3R4KA 1SAXA 2XHKA 2P8TA 2D2WA 1S3JA 2QBYB 3HRSA 1ZG3A 3QU3A 3ZMVA 2IW5A 1BI3A 4PZJA 1VTNC 2JSCA 2O61A 1S8NA 1W5SA 2FEZA 2L3DA 3QPHA 3EQLF 4RAZA 3EYYA 2IJLA 4AIKA 2VC1A 1H9TA 3V4GA 1ON1A 2FF4A 1UHWA 4JBAA 2UWMA 3GFMA 3R0AA 1IAWA 5L3GA 4Q4ZF 5AIPA 1GHCA 3L00A 1ZHFA 2P5LC 1F9NA 3FXQA 2OU2A 2MBFA 1S7OA 2HKXA 3T8RA 1DPRA 4EGZA 4LD5A 2ZXJA 3V7SA 1U5TB 5EEGA 3WTVC 5D4SA 4OINF 2VOPA 5FGMA 4KN4X 1P6RA 4IRGA 3E97A 5CVRA 2Q0OA 4JQFA 3V7RA 1K78B 2FBIA 2XAJA 5E1ZB 1SMTA 2ZCWA 5DCMA 4KFCA 4MQ9F 1USTA 1QPMA 4A5NA 2QM3A 1I6XA 3M1EA 4R1HA 4BHBA 4IRHA 1Z05A 4G7OF 1BOAA 2H6BA 4B09A 3I58A 1YQAA 2ZJ2A 1BIBA 4A6EA 5H6QA 4O3MA 3WTYC 3L7WA 3AAFA 3SXYA 5HDKA 3M8FA 2A61A 1FNNA 1TTYA 1HXDA 3HRTA 5L3BA 4YFXF 3MCZA 1ZRDA 4L9TA 2VC0A 2UXNA 5JFRA 2HS5A 3MZYA 2FRHA 2M45A 4CHUA 3H92A 3ROUA 4HW0A 2NS0A 3V7CA 2EFWA 3P9IA 2GWRA 4G94A 2J5OA 4Q47A 5JR3A 3JAMZ 5LEJA 1P4XA 2EFNA 2Z5UA 3HTSB 2O8XA 2E7WA 2LNBA 1W4MA 2MH2A 3RYPA 3GF2A 1E17A 4CYDA 4RAYA 2V1DA 1ULYA 3GFJA 2HKOA 1R1VA 2ETHA 1SFUA 1WRJA 2YU3A 4ZYHA 2E1CA 2MA3A 3FMRA 3WGIA 3K9TA 1YFHA 4YIFA 4M9SA 5H6RA 4ENKA 1RUNA 3ERED 1G3SA 2OQGA 1K79A 1R5GA 4KDPA 2F5DA 3DV8A 1HKQA 2G7HA 2VOOA 3CUQA 1FYMA 2XIGA 3VOEA 3BJAA 2JZYA 3G3ZA 1LQ1A 2V79A 3TOAA 1U5TC 4I98B 3PFIA 4ENNA 1RI7A 2RC4A 2ZBKA 4OOIA 3O3KA 3Q9SA 3F8BA 3NEUA 1XMAA 2HTJA 2JPBA 5E1XA 2M5WA 4HF0A 4A6DA 3E6MA 2LKPA 4IVNA 5D4RA 1Z9CA 3KP4A 4M74A 1P4WA 1FYLA 2Z33A 3H3UA 1SD4A 4IXAA 2JT1A 4L0ZB 1IXCA 3RI4A 3M8EA 3U1DA 1XDSA 4DNCA 3T1BA 3DPTA 2KIUA 2GZWA 4WXDA 4EM0B 2PLYA 2GAUA 2DU9A 4WK8F 2MH9A 3FXRA 3BOQA 1RIOH 1W7PA 3RKWA 5ILSA 5HS8A 4HV6A 2BBYA 1DUXC 2Z9OA 4KICA 4IJAA 4KUMA 5E8GA 1MJ9A 3R60A 2R3SA 4RS8A 2NNYA 2L4MA 1FBSA 1FOKA 2ZNYA 4MGRA 1TW2A 2MD5A 1QBJA 1R58A 3ZN0A 5DEQA 3MEXA 4XRFA 1EH7A 4QWQA 3LQRA 5K5QA 1IN4A 4NQWA 1IRGA 3QRFF 1O7LA 1IN6A 4B8XA 3DPLC 4Q48A 4RGSA 2OZUA 4CICA 2GQQA 1Q1HA 2ESHA 4UUVA 2VT2A 3I5UA 4M73A 4XLPF 2G9WA 5L3CA 4LLGF 1FX7A 4AWXB 1KU9A 4UHTA 2BGCA 4N9HA 3FWEA 3ZN1A 4F7ZA 3IWZA 3LA7A 2HYGD 1QZYA 4EM1A 3KP3A 3ABTA 2ZMEB 2EV5A 3KLNA 5HLIA 3DQVC 3FX3A 5FLXZ 2VE8A 1YS7A 2P6SA 3TO6A 3FZVA 2ADUA 3LAJA 3L09A 5F6FA 4EGYA 3HOTA 4P96A 3K1PA 4EMSA 3LQQA 5ICCA 1R1UA 2H27A 3ZQ7A 2D1VA 3WTWC 3CO6C 2PFBA 5LRSA 3C3WA 2EV0A 2GA1A 3SHFA 2DBBA 4HOBA 4A0ZA 3IWFA 3P7NA 2VODA 4EJTA 3J7AO 2X0LA 3J80K 3P9CA 2EFOA 4Y15A 3BJ6A 2H6CA 2COMA 4HDVA 2K4JA 3TKYA 2WC2A 4KMFA 3QP6A 1FLIA 2NYXA 3KP2A 1SFEA 2F5FA 4LMYA 1AWCA 4LG0A 3I0TA 1I1SA 5K5OA 1OKRA 3BP8A 2IA1A 3HRUA 5A2QZ 4P55A 4RB2C 3REOA 4XSXF 3CLOA 2DT5A 4S05A 4I01A 3DKWA 1HKTA 2L02A 3HHHA 4IF4A 3KLOA 3GZ5A 3I64A 1TLHB 5LHIA 2XKPA 3GXOA 3NQOA 4GXOA 4AVPA 4M71A 3KE2A 2EA4A 5ERIA 2VBXA 4HAMA 4I2OA 2A3SA 1ONVA 3LWFA 5ICGA 3SQNA 1G3YA 1Y0UA 4LFUA 3SFZA 1ZREA 1IXSB 3VFZA 2HR3A 2RN7A 4LLLA 2Q2EA 1YW8A 1EH8A 1KA8A 2F2EA 1XN7A 1IZ1A 4BNCA 3C18A 5KK1A 1UFMA 2EA2A 2XAFA 4UV9A 4A2UA 3L9FA 3L2CA 2MLKA 4XLNF 2STTA 3QU6A 1K6OA 1FC3A 1ZRFA 2GIVA 5HDGA 1ZN2A 2TDXA 1D8KA 2HGCA 1IRFA 1H9GA 1R22A 5FFZA 3BZ6A 1F5TA 3FMQA 4CGZA 2IRFG 5FO5A 2QZ8A 2FSWA 2KRFA 4WF2A 1XGMA 4N9IA 2FNPA 4BAYA 5JI6A 1SD5A 3T8TA 3I59A 1J2XA 3P9KA 4I0AA 3RIRA 4A0XA 3DP7A 2LDUA 4O6JA 2O0YA 1SD6A 3O6BB 2PBIA 4MEXF 1OYYA 4GO1A 5LGNA 1T0FA 1UHMA 2PMUA 1XCVA 4M72A 4PDKA 3BPXA 2CGPA 1I27A 1Z7UA 2WV0A 4HX4A 1ZLKA 1TQPA 2DTRA 3KZZA 2J5PA 4HQMA 2EB7A 2NRAC 4ETSA 4RB1A 3LA2A 2JTVA 1B9MA 5J8FA 2M1BA 4MTEA 4ZZLA 5D5WB 3WU1B 2FBKA 4BYYA 4ZH4F 3KETA 4MTDA 2L01A 1W5TA 5DD4A 5L3DA 1KQ9A 2STWA 2XGXA 1CF7B 3V8JA 4WCGA 4M6XA 3C1DA 3K2ZA 1ODDA 3E6CC 2D45A 2VBYA 3HOSA 3J81Z 1ZH5A 1HSTA 4MQVA 5AONA 1RNLA 2PEXA 1NHAA 2DO7A 3KEOA 3CDHA 1FP1D 1OPCA 4P9FA 1ZGJA 1FY7A 5IT9Z 4L9NA 1QGPA 3ZMTA 5HDNA 1BIAA 1OYWA 2QUFA 4AIJA 1X3UA 2YX4A 1B6AA 1LDKB 1R23A 4MHGA 2QYOA 3K69A 1ZLJA 4Y17A 1FBQA 2OA4A 3G73A 4ESBA 4HLXA 3IC7A 5LEKA 3IL2A 5E8IA 2IP2A 5E1WA 1AOYA 3QP5A 4GGGA 4IHSA 2P5VA 1P92A 3FF5A 4G9YA 1XB4A 5CVJA 5D6FA 1KYWA 4LK1F 1TW3A 3QOPA 4KN7X 2FE3A 1W7PD 4KA4A 3GZ6A 1FBUA 1FWZA 1KQ0A 3GEZA 1IN7A 2EFPA 1WQ2A 2DPUA 5LHGA 4Q5SF 3RKXA 4FX4A 4G7HF 4OMYA 2ZKZA 2DFIA 1C0WA 2VT3A 1LEAA 1FYKA 3SZTA 3ZPLA 4FHTA 4JK1X 1KGSA 1R7JA 5D6EA 5L3EA 2HEOA 5DCMB 3IRQA 3I59B 4RB0A 4XSZF 4Z2YA 3JTGA 2FQ3A 1E2XA 4HA8A 5BPIA 2IPQX 4IPAA 3JSPA 2LF8A 3U9GA 3EUHA 2BE5F 1EH6A 4LG0B 3RKYA 4LB6B 3I4PA 5HLHA 2DK5A 4G7ZF 5E18F 4ZYDA 4KT5C 1SFXA 1W7PB 5JVTA 2UZKA 4HDUA 5TRDA 3F21A 1T38A 4EV0A 2R7DA 5LBQA 4KYWA 4HLYA 3R0JA 2HOEA 4U88A 5D5UB 3E5XA 1D3YA 1LEBA 5CVIA 2PG4A 2KIFA 4XBFA 3ZMUA 2OD5A 3BDDA 3LAPA 2XV4S 1FPQA 1V3FA 3HRMA 2ZMEA 3OV8A 2IA0A 1HQCA 1YW9A 2JPCA 4FT8A 2IVMA 1U5TA 3GO5A 5F64A 1XD7A 3LSTA 4G8XA 4IHTA 5J8CA 4NHJA 4ZYEA 1B1BA 2FU4A 4CXFA 1D8JA 1MD0A 1J9IA 3V8LA 1T39A 4M9ZA 3IHUA 5FD5A 4HV5A 4HBLA 1U3EM 2A5YB 2MC3A 2VONA 4PGGA 3ZMZA 1XSDA 3ECOA 2RKHA 2W24A 3CUOA 2IT0A 4HF2A 3WTXC 3F8FA 1R00A 4RB3C 4UVAA 2EFQA 2LF7A 3S2WA 4KIFA 3KFWX 2CO5A 4GYGA 1S6LA 5KVRA 4U0VA 3D5LA 1BM9A 2AXLA 1YS6A 2OBPA 4NB5A 2OZ6A 3JAMK 4KMUX 3HUGA 1XGNA 5CYVA 4M9XA 3FHZA 4ASNA 1FP2A 1JHFA 2Y0MA 4LGWA 4TV7A 1IN8A 1A04A 3F8NA 1YO5C 4PCQA 1JXSA 3DFGA 2P5KA 1HW2A 4PGHA 1UB9A 1ON2A 2VN2A 4ZYGA 4EVIA 1YLFA 5A2QK 3TGNA 5D8LB 3KZYA 5CVUA 1XSVA 1K7AA 5HVQC 1IF1A 2ZFWA 3HHGA 2LSOA 1R1TA 4EJWA 1T98A 2DI3A 4IRIA 2PJPA 3B73A 2WTEA 5D5VB 3CTAA 1DDNA 3R61A 2D1HA 2HQRA 4AD9A 3BY6A 2CW0F 1O3TA 3ML6A 1J7KA 3EETA 4FX0A 3E3VA 3HSRA 4AIHA 1PDNC 1KU7A 2HFHA 1OMIA 1XGOA 2F5CA 2ESNA 2WWYA 3GWZA 2PMHA 1D5VA 2DAOA 1R5HA 3HIFA 3Q9VA 4U0WA 4OIOF 2DQRA 4OIRF 3N97A 2P7VB 4EM2A 4HQEA 1QO0D 6PAXA 1S29A 2P4WA 2ELHA 4YG2F 2W57A 1ZRCA 3LA3A 2DQLA 2P7CB 3JW4A 3GW2A 5ICFA 1QZZA 1KU3A 2GXGA 3IKVA 2QENA 3E6DA 1WSUA 4HYEA 3GFLA 3WU0A 3RPQA 1WI9A 2HYFA 5LRRA 3WGHA 4P5OA 1YTYA 3DEUA 2BV6A 2A69F 2QQAA 2A07F 5BS6A 1TQMA 1YG2A 1MDMA 3BJOA 3FXUA 3BWGA 4U0YA 2VXZA 1HKSA 1GVJA 5LLQA 5BOXA 2NNNA 1QQIA 1YIOA 1SMYF 4OIPF 1B4AA 3CJNA 4L9JA 2Q8KA 3OOPA 1L0OC 1J5YA 1K78A 1IXRC 4P9UA 1V4RA 2PQ8A 1Z6RA 5FD6A 4OIQF 4CDGA 2FMYA 2FMLA 5AIQA 1RZ4A 3HYIA 1LDJA 2UXXA 4HX7A 5ILVA 2M87A 1P2FA 1BI2A 1WWXA 3I54A 3DF8A 2KJCA 2ACJA 4YFKF 1JE8A 4EJUA 2RV8A 1QNTA 5DD8A 1STZA 2ISZA 1G4DA 2HQNA 1BBYA 1G6NA 4ESJA 3EYIA 4BXUA 1R36A 2KIMA 4WX9A 2XRNA 3IRRA 1LDDA 1TNTA 1MGTA 1JHHA 4HZFA 3HTUA 2Z99A 4I7HA 1LB2A 2YPRA 3RPUA 4R79A 5TJJA 2R7FA 1O3RA 3GYHX 2AS5F 5K5RA 3ELKA 1BI1A 3HSEA 3TO9A 1KYZA 3O2PE 1EV7A 5LHHA 1YW7A 2EK5A 2GXBA 1REPC 2E7XA 3VB2A 5D5XB 3KEQA 5LGUA 2HZTA 1B59A 1MJBA 3PQJA 3T5XA 5HS7A 1BI0A 2XKOA 4EJVA 5JHUA 1G3TA 1PP7U 2P6TA 2XUBA 2W25A 2XAQA 1Z1DA 3GLXA 5IT9K 2XASA 3CO7C 1LVAA 3MZHA 1P4AA 4ON0A 4O5VA 1HW5A 5DDGA 3MQ0A 3LFKA 1HBXG 4EJOA 4MNUA 4M6YA 3GX4X 2HWVA 3ZMDA 1XSXA 1RUOA 5DV5A 3N4MA 1HSJA 3ISPA 4WWCA 1ZG1A 2EJRA 2K4BA 1J0RA 4UVCA 3I53A 5FB2A 4R8HA 3COAC 4S04A 4UXNA 1IUYA 2PI0A 2M8EA 3RJPA 1FSEA 2L54A 4I0BA 3TDUC 2A68F 2PN6A 3ECHA 2F5EA 3WODF 2K27A 3W6JB 4H0EA 2H94A 3DXJF 5FLXK 1B9NA 3MWMA 3E5QA 4N0BA 2CSOA 1KU2A 2VBWA 3F6VA 1FT9A 1I5ZA 3NRVA 2RDPA 1MJAA 1F1ZA 1G3WA 2V6CA 2GA2A 2BEOA 3MAJA 1FSHA 3HSFA 2YSRA 5K1YA 1UCRA 2B0LA 2EWNA 2IA2A 3VEPA 4G6QA 3GFIA 3JSOA 2G7UA 2QWWA 2RQPA 2QQ9A 2W84A 2RGVA 3EDPA 3CUQB 4BHPA 2XVCA 3GVAA 3F22A 1LJ9A 1O3QA 5F1RA 1CGPA 5DUKA 4MEYF 3KP6A 3GUDA 3F3XA 2QVOA 5EEHA 4L18B 1MDMB 4UV8A 4Y13A 2DK8A 2ZO4A 2EV6A 1DP7P 2A6HF 4U7BA 4HF1A 1H0MA 5D8KB 3ZP5A 3H3ZA 1HW1A 3WE3A 1TQIA 2K86A 4YIIA 3K1NA 2FA5A 5HOOA 3WTUC 5IT3A 1ZYRF 4YFNF 1BN5A 1XMKA 5J6XA 1KQ8A 3RDIA 3ABUA 2V1XA 1MZBA 3V8KA 5BQTA 1J59A 3I71A 1DPUA 4LK0F 1L3LA 2RNJA 3D0SA 3F72A 3T0YA 3VODA 2K02A 2C6YA 4WXCA 2VE9A 5E20A 5LGTA 3F8MA 2XAHA 4GCVA 5ICEA 3KCCA 3QAHA 3FMSA 4LJZF 4KIGA 1ZG5A 2YX7A 1U78A 2W85A 4CZZA 4KIBA 2O6GE 2XAGA 5CVVA 4OMZA 1U2WA 2CQKA 2H09A 3FM3A 1S7AA 2CFXA 1ZGAA 4U7DA 1BJAA 4OU0A 4EQQA 2X4HA 5ED4A 2ZNZA 3Q5FA 4ENJA 2KKOA 1LNWA 4CO8A 5DCFA 1SD7A 4KNYA 1CF7A 2QBYA 5FFXA 4ESFA 1FZPB 2BYVE 2QLZA 2FNAA 3B02A 1U8RA 4A0YA 3WTZA 1I1GA 2A6EF 3WTSC 4I09A 1GXPA 3MFKA 3F23A 3K1MA 3U2RA 3M9AA 2E1NA 4HX8A 4L0YB 2V1UA 3E6BA 4LLNA 5DUIA 2Y48A 2DW4A 4LB5A 2HTSA 4UNOA 4ZZDA 1T2KA 2FBHA 4A12A 2XROA 2M30A 1YYVA 2L4AA 2RVCA 4RGRA 3JTHA 1XCBA 5E17F 2NAZA 2DLLA 2YR2A 3PQKA 3WGGA 4A5MA 1O7FA 3E5UA 3ZMSA 3BPVA 4DQ2A 2DPDA 1ZARA 2MLGA 3TQNA 2VBZA 3CUQC 3IKTA 4WXHA 4RGXA 1BC8C 3M7GA 3RTRA 4UVBA 2CG4A 1OR7A 5CLSA 5DYMA 1U6GA 2OAZA 4K2EA 3C7JA 1O3SA 4QLCU 1IW7F 1IN5A 2O03A 2V9VA 1T6SA 3J81K 3WTTC 1O57A 1Z91A 5BPDA 4BH9A 3TDZC 2CWEA 5ILUA 3R6SA 1PUEE 5HS9A 3QPTA 4E70A 3WG9A 2FOKA 1TNSA 3TOBA 1XDUA 2FXAA 2Y75A 2HDCA 3BROA 3TO7A 2Z3YA
chains in the Genus database with same CATH superfamily
3ULQB 4D0PA 4ENMA 3LSMA 1Y1WJ 2K7LA 2HOTA 3W6KB 2ZB9A 2XGEA 5FKOA 5E3NA 1USSA 1QHGA 4RGUA 3KP7A 2AQEA 1WJAA 1Z6TA 2L9SA 4DOZA 4L5IA 2CYYA 2ISYA 1J75A 3F6OA 4PFOA 3FM5A 3HJEA 2QQBA 2A5WA 4G6DA 3H3VK 4L9VA 1TBXA 5L3FA 1OYIA 4BHCA 5EG0B 4CH7A 1XGSA 3HC7A 1ZAOA 5H20A 1BOBA 2CW8A 3AL0C 1GXQA 2WAQN 3KP5A 3V42A 3BR5A 3ERMA 1BC7C 3WE2A 1F4KA 5J1RA 4D7MA 5HLGA 1JGSA 4I02A 1PP8F 4BQAA 1WKMA 2W82A 4BDYA 1MKMA 3MN2A 1K6YA 4L5JA 2KJBA 5BMZA 4AVZA 1RPWA 3EUKL 5F08A 3H9JA 5CJ9A 2LVSA 1SVLA 4A3KJ 3QYEA 3J80Z 1WVRA 4GYIA 3F8CA 3K0LA 1V55H 2DYRH 1OCOH 2O3FA 4F3QA 1W36D 1X1PA 1WH5A 3W2WA 4G6TB 1YRNA 3RYRA 2JRTA 3K4CA 2OQRA 3SZPA 3R4KA 1SAXA 2XHKA 3HKZN 2P8TA 2D2WA 1IUFA 1S3JA 2QBYB 4QSHA 4IZZA 3CCSI 3HRSA 2DA5A 4NDLA 1ZG3A 3QU3A 2H8RA 3ZMVA 2IW5A 1BI3A 4PZJA 1VTNC 2JSCA 2O61A 1S8NA 1W5SA 2FEZA 2L3DA 4P1WA 1FIAA 3QPHA 3EQLF 1WPKA 2VL8A 3BT9A 4RAZA 2ZMEC 1GUUA 2BHYA 1D0XA 9ANTA 3Q0WA 3EYYA 2IJLA 4AIKA 1JGGA 1F43A 2VC1A 3W3CA 1H9TA 1MH4A 3V4GA 1ON1A 1FMWA 1ENHA 2FF4A 1UHWA 4JBAA 2UWMA 3GFMA 2RREA 3R0AA 1IAWA 5L3GA 4Q4ZF 5AIPA 3HOXJ 1GHCA 1MBFA 3L00A 1ZHFA 3VPRA 4BQQA 3PM1A 2P5LC 1F9NA 3FXQA 2OU2A 3S2DJ 1DGRM 2MBFA 1S7OA 4IQJA 1SEUA 5M3MJ 2HKXA 1I39A 4Y33A 3T8RA 1DPRA 4EGZA 4LD5A 2ZXJA 3V7SA 1U5TB 3FXJA 2E1MC 2IS1A 2KRHA 2Z2SB 5EDNA 5EEGA 3WTVC 4AC0A 5D4SA 4OINF 2VOPA 1UAAA 1T08B 5FGMA 2M4KA 2CV0A 1PUFA 4XRSA 4KN4X 1P6RA 4IRGA 2M4GA 4HSRA 3E97A 5IY5H 2K3PA 5CVRA 2KRCA 2Q0OA 4JQFA 3N05A 4JYKA 2PJRA 1RETA 3BLYA 3V7RA 1K78B 4F92B 2X51A 5KCMA 4RLFA 4XKWA 3G6EI 3U1KA 2FBIA 4GRIA 2XAJA 5E1ZB 5TISC 3OYNA 1SMTA 2ZCWA 5DCMA 4KFCA 4MQ9F 1USTA 3MVPA 4Z6YA 4ZTFA 1QPMA 4A5NA 3DEWA 2QM3A 1I6XA 1Q1VA 1YE9A 3M1EA 2DJNA 2DOFA 3CF5F 4R1HA 1RRJA 4BHBA 4IRHA 5KAIC 1Z05A 4XR6A 1B72B 4G7OF 1BOAA 2H6BA 3H9GA 4B09A 3I58A 3JCUC 1RKWA 1YQAA 2ZJ2A 2IS4A 3HPGA 1BIBA 4A6EA 5H6QA 2Y2ZA 4O3MA 2DMNA 3TMOA 5FLVA 3WTYC 3LMMA 2NVUB 3L7WA 5M3FJ 1Y1VJ 3AAFA 3SXYA 4DZPA 5HDKA 2DOAA 3M8FA 2HI3A 2A61A 1FNNA 1TTYA 1HXDA 3HRTA 2ZJRF 1TT0A 5L3BA 4YFXF 3MCZA 4F52A 1ZRDA 4L9TA 1WHUA 2UXNA 2VC0A 4A3FJ 5JFRA 2HS5A 3MZYA 4S0HB 2FRHA 2EZIA 2UUZA 5CKTA 2M45A 3J7ZI 4CHUA 3BG3A 4BJTA 3OY9A 3H92A 3ROUA 4QTRA 4HW0A 2NS0A 3V7CA 2EFWA 1FTTA 3P9IA 2GWRA 2Y9YA 4G94A 2J5OA 3ZQQA 4Q47A 3GCMA 4IEJA 5JR3A 2XB0X 3JAMZ 5LEJA 1P4XA 3C2GA 3HDDA 2ME6A 2EFNA 2EINH 1VQ9I 1QVTA 3W2VA 2Z5UA 1X3WB 2M0CA 2PMZN 3HTSB 4PJLA 2ECBA 2O8XA 2E7WA 3DBRB 2LNBA 3ZOBA 1W4MA 2MH2A 3RYPA 3GF2A 1E17A 4CYDA 4RAYA 2V1DA 2X6OA 1AKHB 1QVUA 1ULYA 3GFJA 2HXIA 2HKOA 3A2KA 1R1VA 4MIMA 2ETHA 1SFUA 1WRJA 5FRMA 2YU3A 4ZYHA 4IOCF 2E1CA 2MA3A 3FMRA 1VQKI 3WGIA 1MMDA 3K9TA 2OC6A 3EUHC 1YFHA 3TW7A 4E7ZA 2RAEA 2ME0A 4M9SA 5H6RA 2X6YA 4YIFA 5HNHA 4ENKA 1YJ9I 1N77A 1RUNA 3ERED 4XN0A 2BHZA 1G3SA 2OQGA 1JJ8C 1K79A 1R5GA 4KDPA 1DP3A 1WJDA 3GMEA 1VI0A 2F5DA 3DV8A 2LP0A 4DZJA 1HKQA 1U9OA 2G7HA 2VOOA 4JX6A 2ZFUA 3CUQA 1FYMA 2XIGA 2DA2A 3VOEA 4C9YA 3OR2C 3NAUA 3Q0UA 3BJAA 2JZYA 3EPZA 3G2BA 3G3ZA 3L1PA 2DA3A 1LQ1A 2E1MB 2V79A 3TOAA 3VSKA 1U5TC 5CQEA 4I98B 1LKXA 3PFIA 4ENNA 4C2TA 5B5EC 1RI7A 4FTHA 1W36C 2RC4A 2K40A 1VFCA 2ZBKA 4OOIA 3DEEA 3BG6A 1JUPA 1Y0NA 4BY1J 3O3KA 3LOCA 3Q9SA 3F8BA 3NEUA 3CJTB 4EATA 1XX5A 1XMAA 2HTJA 1TC3C 4V2GA 1Z21A 1VQLI 2JPBA 5E1XA 5GADJ 1N25A 3AG1H 2M5WA 1S72I 2VUMJ 2NS7A 4HF0A 4A6DA 2I5UA 3E6MA 2LKPA 1MSFC 4IVNA 1U0JA 2BY0A 5D4RA 1Z9CA 3KP4A 4M74A 1P4WA 4FE4A 2DA7A 1FYLA 1Y8QB 2Z33A 3H3UA 2LREA 2QQ8A 1SD4A 4IXAA 2JT1A 5B66C 3HUGB 1QHHD 4L0ZB 2JUGA 3QPSA 1ZELA 1IXCA 3RI4A 2DN0A 3WU2C 2JA6J 3M8EA 3U1DA 3ZR8X 2D5VA 2R5YA 1XDSA 4H4KC 3H9QA 3MKZA 1W1WE 2CMPA 4XN3A 4DNCA 2GIZA 3T1BA 3OYDA 3DPTA 2KIUA 4RM2A 2GZWA 3HOZJ 2NXNB 4RDUA 4WXDA 4EM0B 2PLYA 2GAUA 4A93J 2VJ5A 2DU9A 4WK8F 2MH9A 3CMMA 2XSJC 2BW3B 4RM3A 2EIKH 3FXRA 4XRMA 3BOQA 1RIOH 2LLKA 2LC2A 3CMEI 2VQHA 4XKBA 1PYVA 1W7PA 3RKWA 1RC9A 5ILSA 1F36A 5HS8A 4HV6A 2ZJPF 2BBYA 4LITA 1DUXC 1UZCA 4E7KA 2Z9OA 2L7ZA 5IYCJ 2LKXA 1OCCH 2COBA 2XGDA 4KICA 5E3OA 4IJAA 4MO7A 1H8AC 4BDZA 4C3HJ 4KUMA 1JKRC 5E8GA 1MJ9A 4PJMA 4NC8A 3R60A 1K4TA 2R3SA 4Y52J 3OYMA 1D1AA 4RS8A 2NNYA 2L4MA 3AL0B 1FBSA 1MBJA 1FOKA 1WJBA 4HPQA 1LFUP 3OSFA 2YS9A 2ZNYA 3BZKA 4C3JJ 4MGRA 3M4OJ 3G1LA 2WB1A 1TW2A 2X1CA 2MD5A 3BQZA 1OISA 3D1NI 1QBJA 1R58A 5EF6A 3ZN0A 3G71I 4RAFA 5DEQA 2OF7A 3MEXA 4XRFA 1EH7A 2M9HA 3LNQA 2PX9A 4QWQA 3LQRA 5K5QA 3TP3A 1IN4A 1SVMA 2E5ZA 3DU5A 4QPOA 2L9RA 4NQWA 1IRGA 3OYAA 3QRFF 1O7LA 1IN6A 2DFEA 3PJRA 4B8XA 3DPLC 4Q48A 4RGSA 2OZUA 4CICA 4XOTA 2X48A 2DYSH 2GQQA 1Q1HA 2ESHA 4ZDOA 4UUVA 3ZQIA 3W2AA 4FETA 1OLTA 3IAM2 3JRFA 2DA6A 2VT2A 2W7NA 2PMZA 1I3AA 3I5UA 3SYTA 4M73A 4XLPF 2K9NA 2G9WA 5L3CA 1SFKA 4LLGF 1U8BA 3KPHA 1FX7A 1MW7A 1KU9A 4AWXB 4UHTA 4E7HA 2L0KA 1XTAA 2Q2EB 2DODA 2K9LA 5J3LA 2XF5A 2BGCA 5FKMA 3RSNA 1NG7A 4N9HA 2MFZA 3W6VA 2M3AA 5DTDA 3FWEA 2R7UA 3ZN1A 1APLC 4F7ZA 3IWZA 2LFBA 3LA7A 4ZDPA 2HYGD 5EGOA 1QZYA 1JT0A 4EM1A 3KP3A 3JRGA 3Q0VA 3ABTA 5E3MA 2QCOA 5IP7J 4NUBA 3ZQGA 2ZMEB 4BS9A 2R5ZB 2EV5A 3KLNA 5HLIA 3DQVC 3FX3A 4RMNA 2VE8A 5FLXZ 1JT6A 2XGCA 1YS7A 2R4GA 4I6ZA 2P6SA 3TO6A 3FZVA 2BY1A 2ADUA 2EILH 4ZDLA 1X58A 2VPRA 1AU7A 4D5CA 3LAJA 3L09A 5F6FA 5FKLA 4EGYA 5H2FC 3HOTA 4P96A 1ZQ3P 3K1PA 4EMSA 3LQQA 5ICCA 1R1UA 2H27A 3ZQ7A 2D1VA 3QODA 3WTWC 2HOSA 3CO6C 2PFBA 2LRDA 2KZGA 3C3WA 2EV0A 5LRSA 2GA1A 2Z1DA 3SHFA 1QA6A 1Z3YA 1P9QC 3NWTA 4NBQA 2DBBA 4HOBA 2IGKA 4A0ZA 3BCAA 3IWFA 3P7NA 4EJTA 2OTLI 2VODA 3HGYA 3J7AO 2X0LA 4A69C 3J80K 3P9CA 4IHYA 2EFOA 1MNEA 4B4CA 4X1EA 4Y15A 1A31A 3BJ6A 2H6CA 2COMA 4HDVA 2K4JA 2V9PA 2WC2A 3TKYA 1D5YA 3OSGA 2NOJB 2CRGA 4KMFA 3QP6A 2E60A 2ELKA 3LSRA 4BE2A 1VQPI 1FLIA 1Z67A 1MIJA 3UR3C 2NYXA 2ZC2A 1HLVA 4PSWA 3AG4H 3KP2A 1SFEA 2F5FA 3AG3H 4LMYA 2NVYJ 1AWCA 2E34A 5F04A 4XRSG 4LG0A 2VPLA 2FUG2 3G1OA 3SZGA 2E19A 3SEZA 3LFUA 3I0TA 2GLOA 1J09A 5J1YA 1I1SA 2XSDC 3QPLA 4M3EA 4BBSJ 1BW5A 5K5OA 1ZR4A 1OKRA 3BP8A 1HA8A 2IA1A 3HRUA 1ZK8A 4FCYA 3GTMJ 5A2QZ 4P55A 4RB2C 3REOA 2VI6A 3GTJJ 4XSXF 4A3JJ 3CLOA 1OCZH 2DT5A 4S05A 1R4MB 2WAEA 4I01A 1IRZA 3DKWA 1HKTA 2L02A 3HHHA 4BQNA 3RZOJ 4IF4A 3B6CA 3WG7H 3CC4I 3KLOA 3GZ5A 3I64A 3ZQHA 3JRCA 2DFHA 3J7YJ 4CCMA 1TLHB 5LHIA 2XKPA 3GXOA 3NQOA 4GXOA 4AVPA 1EF4A 3LSGA 4M71A 3QYBA 2HPIA 1I50J 3KE2A 2EA4A 3JRBA 4AUXA 1OCTC 3VYRB 2DT7B 1ETOA 5ERIA 2VBXA 4HNVA 2JA2A 4HNUA 4UUTA 4HAMA 2QKLB 4I2OA 3QOEA 5J47A 3ZQCA 4CZCA 1Y6IA 3DKXA 2A3SA 4BU2A 1ONVA 3LWFA 5ICGA 2V1NA 4LIVA 3SQNA 2F4OB 3QWLA 2R5ZA 1G3YA 1MBHA 1Y0UA 4BUPA 4LFUA 4A3MJ 3SFZA 1ZREA 3TP0A 1IXSB 2E35A 3VFZA 1SANA 2HR3A 3D5SC 2RN7A 4LLLA 1A35A 1W0UA 1QPIA 2Q2EA 1YW8A 2CUJA 4LOCA 3F9KA 1EH8A 1TT5B 3OWTA 1KA8A 2F2EA 4XL9A 5E3LA 1XN7A 2JRMA 1IZ1A 1K83J 4BNCA 3C18A 5KK1A 2R92J 4ANJA 3IAS2 1UFMA 1NH3A 1UELB 3AFHA 2EA2A 2XAFA 4UV9A 4A2UA 3L9FA 4B43A 4DW6A 5DM7F 2DT6A 3L2CA 4YEJA 2MLKA 1S9HA 4XLNF 2DA1A 2WB1N 2DA4A 2DTZA 3RKQA 1A5JA 2STTA 3QU6A 3JR9A 1K6OA 1FC3A 2VB6A 3I55I 3S2HJ 2CS3A 2GIVA 1ZRFA 2KHMA 1WI3A 4E7LA 4IL6C 5HDGA 1ZN2A 2TDXA 1D8KA 2HGCA 4XLHA 1IRFA 1OFCX 3M8JA 1H9GA 1R22A 1E0EA 3CLQA 5FFZA 4PJ0C 2A05A 3OS0A 3BZ6A 1F5TA 3FMQA 1OJLA 4CGZA 2IRFG 5FO5A 2QZ8A 3VYTB 2FSWA 2BVLA 2KRFA 2EZLA 1RR8C 1KZHA 2M0MA 1TWGJ 4FISA 4WF2A 1XGMA 4N9IA 2FNPA 4BAYA 5JI6A 1SD5A 3T8TA 3I59A 1J2XA 3P9KA 4I0AA 3RIRA 2CV2A 2AHQA 4A0XA 2JK3A 1TP4A 1PUFB 1BJZA 2WAQA 3DP7A 2LDUA 4O6JA 2O0YA 1SD6A 3I4NJ 3O6BB 2IS2A 2FQ4A 2PBIA 2R7ZJ 2XPUA 4MEXF 1OYYA 4GO1A 5LGNA 2Y31A 1X2NA 2L9VA 2LBFA 4ZTJA 1RKTA 1T0FA 1UHMA 2KT0A 2PMUA 1XCVA 4M72A 3K4BA 3K4KA 4PDKA 3BPXA 3FK7A 2NOGA 1FOXA 2BW3A 3PSFA 2V7FA 5JHFA 3PNTA 2CGPA 3PUBA 3CJRB 2HDDA 1FOYA 1I27A 4A3CJ 1Z7UA 2HQAA 2K9QA 2WV0A 4CYCB 3MZ8A 4HX4A 3RCOA 1TQPA 1ZLKA 3ABKH 2LH9A 5F0CA 1VNDA 2DTRA 3KZZA 2B9SA 1BR1A 2J5PA 2R7QA 2EB7A 4HQMA 2NRAC 4ZJZA 3TEDA 2QSFX 2RQQA 4ETSA 4AYBA 4RB1A 3OYCA 1WJEA 3LA2A 2JTVA 1B9MA 3K70C 3DBHB 1O4XA 5J8FA 1FMVA 2M1BA 4MTEA 1PVEA 4ZZLA 5D5WB 2BVMA 3WU1B 2XAUA 1ZGWA 2FBKA 4BYYA 4KJZA 4ZH4F 3KETA 4MTDA 2L01A 3JREA 1FJLA 2OJED 4GFBA 1DQUA 1W5TA 5DD4A 5L3DA 1WH7A 1KQ9A 1JUSA 2STWA 3I4MJ 2HPMA 2XGXA 1CF7B 3V8JA 2QA4I 4WCGA 3KYLA 4YELA 4M6XA 3C1DA 3K2ZA 1ODDA 4F93B 3E6CC 2D45A 1IV6A 1VQ7I 2VBYA 3HOSA 2QSHX 4AM3A 4XLFA 4XM3A 3J81Z 3K10A 1ZH5A 1HSTA 5IOYA 4DGWB 1SAUA 3GTLJ 2EQRA 4MQVA 5AONA 1RNLA 3C2HA 2PEXA 3K4JA 4XKVA 1NHAA 3LSPA 4U87A 2DO7A 2KISA 3KEOA 3JRHA 3CDHA 5C4JJ 1FP1D 3OYGA 1OPCA 4P9FA 2EIJH 1ZGJA 1XG1A 2LR8A 4BBRJ 1W5CC 2VQCA 3OYBA 1X1AA 3IUOA 1HOMA 1FY7A 5IT9Z 4L9NA 1QGPA 2LTPA 3CF2A 2QEXI 1MMNA 3A0BC 3ZMTA 2CQXA 5HDNA 2XRLA 1BIAA 1OYWA 2QUFA 5KHDA 4AIJA 1X3UA 2YX4A 1B6AA 4EEFG 1LDKB 1R23A 4MHGA 4BGDA 2QYOA 3K69A 3DU6A 1ZLJA 4Y17A 2LYCA 3HXLA 5DM6F 1FBQA 2LY9A 1WZ2A 1WCMJ 1S5LC 2OA4A 3G73A 4PK4A 4ESBA 4PSXA 4HLXA 3MKYB 3CESA 3IC7A 2NVTJ 1E3OC 5GTHC 5LEKA 3IL2A 1BR2A 5E8IA 2IP2A 1T8IA 5E1WA 1AOYA 4IHWA 2E1OA 3VSLA 4HNTA 3QP5A 4GGGA 3ZXSA 4IHSA 3DCFA 2P5VA 2XC7A 1P92A 3K6GA 3FF5A 2KMUA 3DBLB 4G9YA 1E3PA 1XB4A 5F1JA 5CVJA 3CCRI 1X2MA 5D6FA 1IGNA 1KYWA 4LK1F 1Y39A 1UG2A 1XPXA 1TW3A 2DMTA 1POGA 3QOPA 4DYCA 4KN7X 4XICA 1YI2I 1VF9A 2FE3A 2NVQJ 1W7PD 1AHDP 4KA4A 3CJQB 3GZ6A 1R6RA 1FBUA 1YIJI 1FWZA 5TGTA 1KQ0A 2BXZA 3GEZA 1IN7A 4E7IA 2EFPA 1WQ2A 2DPUA 1UJ8A 1Z7LA 2Q1ZB 5LHGA 1W0TA 4Q5SF 4HSTA 3RKXA 4FX4A 4G7HF 3S93A 4M3FA 2ZKZA 4OMYA 1KONA 4Y7NJ 5J40A 2DFIA 1C0WA 2VT3A 1LEAA 1LE8A 1FYKA 3SZTA 3ZPLA 4FHTA 4JK1X 1KGSA 1R7JA 5D6EA 2KDZA 3FXLA 2DCEA 1JI8A 5L3EA 3S32A 2HEOA 2V6EA 5DCMB 3IRQA 1IC8A 3BTCA 3S14J 1JJ6C 1OQYA 1UHSA 3HGGA 3I59B 4I76A 4RB0A 4DYQA 1R5ID 3RPUD 4XSZF 2GXAA 4Z2YA 3JTGA 2FQ3A 1E2XA 1X1CA 4XK4A 4HA8A 5BPIA 4JOMA 2IPQX 4IPAA 4ZYAA 3JSPA 2LF8A 3U9GA 3HOWJ 3EUHA 5BNGA 2ZSIB 2BE5F 4N4OB 2X1DA 1EH6A 2BY2A 1MBGA 2E71A 4LG0B 3BR3A 3RKYA 2GOXB 4LB6B 2CFOA 2F6CA 2HYJA 3I4PA 4NQWB 5HLHA 2DK5A 5CPRB 3KZIC 3A02A 3RQ4A 4RAGA 4CA0A 3A01B 4G7ZF 5E18F 4ZYDA 2QGUA 4KT5C 1SFXA 1W7PB 5JVTA 3CQZJ 2UZKA 3H36A 2R7OA 4HDUA 2JWTA 3ABLH 1TWCJ 5TRDA 3F21A 1T38A 4EV0A 2TRTA 2Y0SA 3I3LA 3DLAA 5J4YA 3HPHA 2R7DA 3B6AA 5LBQA 4KYWA 3OYFA 2XPWA 4HLYA 4IHXA 4CSWA 3DTKA 4XMYA 3R0JA 2HOEA 2L5QA 2GBYA 4U88A 5D5UB 3E5XA 1D3YA 1LEBA 2V4JC 5CVIA 2E2JJ 1ORKA 2PG4A 3O8GA 2KIFA 4XBFA 3ZMUA 3S8PA 2OD5A 3CMYA 3BDDA 2VKDA 2R7WA 3LAPA 3H0DA 3GBGA 1WJ5A 1A36A 1ACIA 4V2FA 1P7IA 2XV4S 1GT0C 1FPQA 4CCJA 4YRVA 1V3FA 2JQ7A 3HRMA 2E2HJ 5M5YJ 2ZMEA 2X6WA 3MKLA 3OV8A 2IA0A 1WGXA 2VLAA 4J00A 1HQCA 1YW9A 2JPCA 2XF7A 4FT8A 4XONA 2AO9A 4AYBN 3PO3J 2IVMA 1XC5A 1U5TA 2A6TA 4QIWN 2JVHA 2HNHA 2VKVA 3H1CA 2JUCA 3GO5A 5F64A 1XD7A 3LSTA 4G8XA 4IHTA 4X6AJ 5J8CA 4NHJA 4ZYEA 3GTGJ 1TWAJ 3L2VA 1B1BA 4XLAA 4IOAF 5JVGF 3PNVA 2FU4A 2Y9ZA 4XKCA 4JX5A 1T33A 2B63J 1HDPA 4CXFA 1D8JA 1MD0A 1J9IA 4A3IJ 3LSKA 3ZCOA 1IV8A 3V8LA 3CCEI 1T39A 4M9ZA 4HG2A 3IHUA 5GAHJ 5FD5A 3JRIA 4HV5A 4HBLA 1HC8A 2WAFA 3CCJI 1U3EM 3OIPA 1H88C 3QQAA 2A5YB 2MC3A 2VONA 4PGGA 2JMWA 2M2EA 3ZMZA 5C3EJ 1XSDA 3ECOA 2RKHA 2W24A 3CUOA 2IT0A 2KDOA 3BR1A 4HF2A 3WTXC 1MMAA 1R71A 3F8FA 4JX4A 1Z0XA 1TL8A 5M5XJ 1R00A 1R4NB 2HU9A 4RB3C 4DBQA 4UVAA 3S3OA 3PO2J 3OMYA 3BQYA 2EFQA 2MC4A 1IDYA 2LF7A 3S2WA 4KIFA 2KLOA 4CCKA 3KFWX 5J4VA 1JKPC 1DU0A 2CO5A 4GYGA 3FHNA 3CCYA 3KYDB 1S6LA 5KVRA 3NARA 3JRDA 4U0VA 4DYRA 3D5LA 1X3ZB 3VDXA 1BM9A 2AXLA 2N8GA 5GP9A 1YS6A 2OBPA 2R7SA 4NB5A 2OZ6A 3JAMK 2JVGA 4KMUX 5B3SH 3HUGA 2HVRA 1XGNA 5CYVA 2O5RA 2DDAA 2K9SA 4M9XA 1V5FA 2KPMA 2ID3A 1H89C 1E3HA 3FHZA 2LBFB 4ASNA 4BE0A 2MABA 3A1YA 1FP2A 2V26A 1JHFA 2IGMA 2Y0MA 1JTYA 4LGWA 4TV7A 3FIWA 3K4NA 5F27A 1IN8A 4KT6A 4OAYA 5IOZA 1A04A 3F8NA 2L2OA 2OV7A 3H5AA 1YO5C 4PCQA 2JA5J 1JXSA 3DFGA 1DU6A 2P5KA 2IGNA 4BY7J 1VQ6I 1HW2A 4PGHA 1JKQC 1UB9A 2I10A 1ON2A 2VN2A 5GTIC 4ZYGA 1WFXA 3VYUB 5FLMJ 4EVIA 1YLFA 5A2QK 3DKYA 3TGNA 4PFPA 5D8LB 4W1UA 3KZYA 5CVUA 1XSVA 3FBIB 4YIRX 1K7AA 1VQMI 5HVQC 4PUSA 2O7OA 5FRNA 4B3AA 1IF1A 2ZFWA 3HHGA 2LSOA 3BR0A 3ASOH 3WHCA 1R1TA 1Z77A 3CDLA 4EJWA 1T98A 1V54H 2DI3A 4IRIA 2PJPA 3B73A 3M1CA 1RESA 3OYHA 2WTEA 2WY7Q 5D5VB 3CTAA 3I9V2 1DDNA 3R61A 3OR1C 2D1HA 2HQRA 2KFDA 4AD9A 2Y69H 1MNMC 1OCRH 3JRAA 3HOYJ 2DXIA 4BKXA 3ESWB 5JLXA 2MGQA 3GTQJ 3BY6A 2CW0F 1O3TA 3ML6A 1J7KA 3EETA 4XLEA 2VQLA 3O8HA 4FX0A 1YJWI 3E3VA 2BOLA 4IQ4A 3HSRA 3PUFA 4AIHA 4F91B 1PDNC 3HG9A 1KU7A 4M3DA 1FEXA 2WA0A 2HFHA 1VQ8I 5KAFC 1OMIA 1R49A 4UY8I 2DOEA 1XGOA 4D7NA 2F5CA 3LSIA 4AIDA 1G59A 1K4SA 3IV5A 1LFBA 3PSIA 2ESNA 2WWYA 1X4PA 3GWZA 2PMHA 1D5VA 1BW6A 2DAOA 4IKFA 4HRIA 1R5HA 1I6HJ 2EBIA 3RZDJ 3HIFA 3ABMH 3Q9VA 5GAGJ 4U0WA 2BY3A 4OIOF 2DQRA 4OIRF 3RQIA 3N97A 2P7VB 1SVOA 4EM2A 4HQEA 1QO0D 4FQGA 6PAXA 1S29A 4M3BA 2P4WA 1GLNA 2ELHA 4YG2F 2W57A 2X1EA 1ZRCA 3H0GJ 4II2A 3LA3A 4RBOA 3HM5A 2DQLA 2LY2A 1GVDA 3HBLA 2P7CB 3JW4A 3S1MJ 3OYIA 4DJAA 3CP8A 2XPVA 2ZXHA 3OYEA 3GW2A 5ICFA 1ZR2A 4RA2A 1QZZA 1KU3A 1A6QA 5HODA 1ETWA 2K3FA 2GXGA 3IKVA 5IYBJ 2B7EA 2Y30A 1P7JA 1TWFJ 2QENA 3E6DA 1YOVB 2CUZA 2JSPA 1WSUA 3MKWB 4B48A 4HYEA 1FIPA 3GFLA 1TZLA 3WU0A 3RPQA 2YUSA 1WI9A 2HYFA 2K9MA 5LRRA 5CQGA 3WGHA 2O8KA 2Y0SN 4P5OA 4II3A 1YTYA 3DEUA 1LE8B 4GDFA 3BG5A 1NTCA 2BV6A 2A69F 2QQAA 2MD0A 4BXFA 2A07F 5BS6A 2JN6A 2ECCA 1TQMA 2WBMA 1IO2A 1YG2A 3BR2A 5FKNA 1MDMA 1ITYA 4Y4RA 3BJOA 3FXUA 3BWGA 3HOUJ 2Z16A 1N78A 1ETVA 4XNFA 1X1DA 2CQQA 2V9KA 4U0YA 2I8DA 3OYKA 2K85A 4E7SA 1D1CA 2VXZA 3CCVI 2LK2A 1HKSA 2FX0A 1GVJA 5LLQA 2R93J 5BOXA 2NNNA 1QQIA 1YIOA 1SMYF 4OIPF 1B4AA 5FROA 3CJNA 3OL3A 3GTKJ 4L9JA 2Q8KA 4XORA 1LFPA 3OOPA 3OIOA 1L0OC 1J5YA 1K78A 4ABZA 2CQ7A 1IXRC 1N75A 4P9UA 3U21A 1V4RA 4IHVA 1A6IA 1VQ5I 4XIDA 2PQ8A 4OAZA 3Q3SA 4BL0B 4IX7A 1Z6RA 2H1KA 1X1BA 5FD6A 1ZTRA 2F5VA 4OIQF 4CDGA 2FMYA 2FMLA 5AIQA 1RZ4A 3HYIA 1LDJA 3SDBA 2BZTA 2UXXA 3WHBA 1B72A 1ETYA 4HX7A 3SFIA 1Z3XA 5ILVA 4E7JA 2M87A 1P2FA 1BI2A 3BG7A 1WWXA 3I54A 3KX2A 3DF8A 2KJCA 3CC7I 2NS8A 2ACJA 1R9TJ 4YFKF 1JE8A 4EJUA 2RV8A 1XMXA 2CJJA 3HKZA 3KEYA 4N4NB 1QNTA 5DD8A 4B47A 1YJNI 4KISA 3OS2A 1T56A 1VZ0A 3CDIA 1YX3A 1STZA 2ISZA 1G4DA 2HQNA 1BBYA 1G6NA 3CP2A 4BJ6C 2KIQA 4ESJA 1YX5A 5IP6A 2YU9J 4W97A 3EYIA 4F55A 1K61A 1MMGA 4BXUA 1R36A 2KIMA 4WX9A 2XRNA 3S16J 4DIQA 3OL4A 5C44J 3L2UA 3IRRA 1LDDA 1TNTA 3LSJA 1OR7C 1MGTA 2DJIA 1JHHA 5F0HA 3FISA 2IAIA 4HZFA 2WADA 3HTUA 2Z99A 2ID6A 4I7HA 2DMUA 1LB2A 2E5NA 3FDYA 2YPRA 3RPUA 1Y56A 4R79A 5TJJA 3PNYA 5E79C 3HEFA 2R7FA 1O3RA 3GYHX 2AS5F 4A3GJ 5K5RA 3ELKA 2OCEA 1BI1A 2H1LA 3HSEA 2ZXWH 3TO9A 3K70D 4C3IJ 3IH2A 1KYZA 3BR6A 3A4CA 2GOMA 1GV5A 1WJCA 1ETQA 3O2PE 1EV7A 5LHHA 1YW7A 2EK5A 2GXBA 4B44A 1X19A 1REPC 1CQTA 2NVXJ 2E7XA 2AQFA 3VB2A 3TBIA 5D5XB 3KEQA 1U9NA 1X4OA 3K4LA 2R7VA 5LGUA 4XQFA 2VJJA 3NWSA 1RR7A 1QZEA 2HZTA 3LL7A 1B59A 2AXTC 4BEHB 1MJBA 3PQJA 3T5XA 5HS7A 3D5RC 4CCOA 1BI0A 5GAEJ 2XKOA 3FKJA 1QU3A 1AA7A 3L2QA 4M6VA 3FXOA 4EJVA 4PJNA 1B8IB 1JKOC 5JHUA 1G3TA 1Y8RB 1PP7U 2P6TA 2XUBA 2W25A 5LD2C 2XAQA 2E2IJ 3H35A 1Z1DA 3GLXA 5IT9K 2XASA 3K4MA 2E36A 3S3NA 3CO7C 1LVAA 2HVSA 3MZHA 1P4AA 4ON0A 4O5VA 2CV1A 3UNGC 4I99C 3FKIJ 2ELJA 1YITI 1HW5A 5DDGA 3MQ0A 1IG7A 3LFKA 1IJWC 1HBXG 2L9NA 2X9DA 1TWHJ 3MD2A 1GV2A 4EJOA 5LFAA 4MNUA 4M6YA 2IXSA 2KQRA 2F4MB 3GX4X 3SEQA 2HWVA 3ZMDA 4CCLA 1XSXA 1RUOA 2M34A 2MYSA 5DV5A 3N4MA 1HSJA 5EYRA 3ISPA 2G0EA 3X2QH 1G8XA 3OYJA 3HL2A 5B1AH 4WWCA 3CD6I 3GTPJ 1ZG1A 3F0CA 3AKZA 2EJRA 2QKMB 2K4BA 1J0RA 2MG4A 4UVCA 3I53A 2VASA 1D1BA 3CCQI 5FB2A 4C30A 4MFDA 4R8HA 3L2RA 4UUSB 2EPFA 5M5WJ 3COAC 2LG4A 4S04A 2CW7A 4UXNA 1IUYA 3CCLI 2PI0A 2M8EA 2M8GX 3RJPA 3BTJA 1FSEA 2L54A 4XOPA 4I0BA 3TDUC 4A3LJ 2A68F 2PN6A 4A3DJ 3OIQA 1V5GA 3ECHA 2F5EA 2BXYA 2HQ5A 3WODF 2K27A 3W6JB 4H0EA 1BL0A 4D9JA 2H94A 3DXJF 2R7RA 5FLXK 1B9NA 5IPAA 2L7FP 3MWMA 3TW6A 4XLCA 3SJMA 1FOWA 2CQNA 3E5QA 3CCUI 4N0BA 2CSOA 2EH3A 4JP0A 3SDGA 2IEKA 1KU2A 3GZNB 2VBWA 4E4HA 4ITVA 2L7KA 2CUFA 3F6VA 1FT9A 3A03A 2K5CA 5B1BH 2EZHA 1EJ9A 2RNGA 1I5ZA 3NRVA 5JLWA 2RDPA 1MBEA 4C2UA 1MJAA 1F1ZA 1NK2P 1G3WA 2V6CA 1SFOJ 2GA2A 2BEOA 2W1OA 3MAJA 1FSHA 3HSFA 1MH3A 2YSRA 3ZQLA 2IGOA 3BC8A 3K2AA 2FOWA 3BTLA 3A01A 2W48A 4BEHA 5K1YA 1UCRA 2B0LA 2EWNA 2IA2A 4UB6C 3VEPA 4V19K 4G6QA 3GFIA 1ERDA 1NG6A 3JSOA 2G7UA 2QWWA 3DTEA 3OOUA 3KIOA 2RQPA 1AKHA 1B8IA 2QQ9A 1NK3P 4OWRB 2W84A 2KZVA 2RGVA 3EDPA 5K7HA 4A3EJ 3S17J 2LD5A 1JUMA 3CUQB 3PL8A 4LIUA 5FJ8J 4J19A 4BHPA 3PIOF 2XVCA 1IDZA 3GVAA 3VWBA 2M7AA 2FJ1A 4J01A 2W00A 3G1MA 2VIXA 3F22A 1LJ9A 3ONQA 1O3QA 4AU7A 5F1RA 2ZJQF 1CGPA 4LG3A 5DUKA 4PJJA 4MEYF 3KP6A 5KNLA 3GUDA 1ETXA 3F3XA 4D1QA 1VQ4I 3PFYA 2QVOA 2VXDA 5EEHA 2WV1A 2JA7J 4BXXJ 4L18B 3DPUA 1MDMB 4UV8A 4Y13A 2TCTA 2DK8A 2ZO4A 2F48A 2O9LA 2XF6A 1UG0A 2EV6A 4U7BA 2A6HF 1DP7P 4BE1A 4HF1A 1H0MA 5D8KB 3ZP5A 3H3ZA 1HW1A 5F0FA 3OS1A 3WE3A 1TQIA 2K86A 4YIIA 3K1NA 2FA5A 2ZSHB 3DWLE 5HOOA 3WTUC 5IT3A 2JJ7A 1ZYRF 4YFNF 1BN5A 1XMKA 5J6XA 1BR4A 4L5EA 1IRXA 1LUJB 1KQ8A 1YHQI 3A0HC 3RDIA 3ABUA 2V1XA 1MZBA 3V8KA 1DGWY 1LVKA 5BQTA 4DBRA 2LMDA 1G2HA 3HB9A 1J59A 3I71A 3TL4X 2UV1A 5GPAA 1DPUA 3CC2I 4LK0F 5K7ZA 3CMAI 1ZKGA 3PIPF 2XB5A 1L3LA 2RNJA 2X6XA 1V5EA 3D0SA 4FASD 3F72A 3T0YA 4BQOA 3VODA 2K02A 2VJ4A 2C6YA 1T95A 4WXCA 1MBKA 3UKGA 3E0JB 2VE9A 4KITB 5E20A 4QPQA 5LGTA 3F8MA 3E7LA 2HZDA 2XAHA 4GCVA 5ICEA 4RLQA 2OUMA 3KCCA 3QAHA 3FMSA 4LJZF 1VQNI 2OCCH 2LOOA 4KIGA 1ZG5A 1ETKA 2YX7A 1U78A 2IBDA 2LKSA 3GTOJ 5C4XJ 3P5JA 2VKHA 3L2WA 2W85A 2W4SA 4CZZA 4A3BJ 4KIBA 3I56I 2O6GE 1D0YA 1BA5A 1M1EB 2PJRB 4IO9F 2XAGA 5CVVA 4OMZA 1U2WA 2CQKA 2H09A 4CCNA 2KL4A 3FM3A 1WJFA 3K7AJ 4MLOA 2F4IA 1S7AA 2CFXA 1ZGAA 4U7DA 1BJAA 4OU0A 4EQQA 2X4HA 1MSEC 5ED4A 1QRYA 4NC6A 2ZNZA 5FKKA 5IP9J 3Q5FA 4ENJA 1LPQA 2KKOA 3AG2H 1LNWA 1UMQA 3G4SI 4CO8A 5DCFA 5EG0A 3H5RA 3J7AY 1SD7A 2CU7A 4D5FA 4KNYA 1CF7A 2QBYA 5FFXA 3S1NJ 5HNFA 4ESFA 4G12A 2BYVE 1FZPB 2QLZA 1HCRA 3BTIA 2FNAA 3B02A 3LSHA 3QYFA 4A0YA 3WTZA 1I1GA 1U8RA 2CUEA 2A6EF 3WTSC 3ASNH 4I09A 2HVQA 1GXPA 3MFKA 3F23A 3S1RJ 3FXKA 3C2BA 3K1MA 3IH4A 3U2RA 2MSYA 3M9AA 2E1NA 4HX8A 5EJCA 4L0YB 1XS9A 5K7FA 3M07A 4Y3OA 2V1UA 3E6BA 5J1UA 3HZJA 5GPCA 4LLNA 5DUIA 3FK6A 4BJ5C 3DLLF 2Y48A 3HOVJ 1MNDA 2DW4A 4LB5A 2HTSA 4UNOA 2OPTA 4ZZDA 1T2KA 3S1QJ 3BCBA 2HXOA 2FBHA 2IS6A 1GDTA 4A12A 4B1RA 2OTJI 2XROA 2M30A 3CCMI 4NNJA 1YYVA 2L4AA 3CZ6A 2RVCA 4E6KG 1OCPA 1D0ZA 4RGRA 3JTHA 3S3MA 1XCBA 2VJIA 5E17F 4CUGA 5EZGA 2NAZA 2DLLA 3VYSB 1EA3A 2YR2A 2P0WA 3PQKA 5HLTA 1SC7A 3WGGA 1HF0A 4A5MA 1O7FA 2DMQA 2P81A 3E5UA 3H5NA 3ZMSA 3BPVA 2VKEA 5EZHA 4DQ2A 3ZGKA 2DPDA 1ZARA 2MLGA 3TQNA 4ZC3A 3DTIA 5IYDJ 1YRNB 3BG9A 2VBZA 3CUQC 3IKTA 4FE7A 1JTXA 2DDBA 3BZCA 2R0QC 1PJRA 4WXHA 4RGXA 4UB8C 2HDWA 2JA8J 3S15J 4NC7A 2MW8A 5EGOB 2DFFA 2M7BA 1BC8C 3M7GA 2QF7A 3E1SA 2KP6A 3RTRA 3IH3A 4UVBA 2CG4A 1OR7A 2X85A 1EKEA 5CLSA 5DYMA 1U6GA 3EUAA 2OAZA 2R5YB 4K2EA 3IP4B 2WY8Q 3C7JA 1O3SA 2QSGX 2DMPA 3ZQFA 3FBNB 4QLCU 1IW7F 1IN5A 1MMSA 2O03A 4M3GA 2V9VA 2VQGA 4B3XA 4BACA 1HDDC 2CH0A 1T6SA 2LY1A 3J81K 2L7MP 3WTTC 1O57A 1Z91A 5BPDA 3M3YJ 2HOAA 4BH9A 3TDZC 2GM4A 2CWEA 5ILUA 4MFEA 1VQOI 3R6SA 1PUEE 5HS9A 3QPTA 5DS9A 4E70A 4X0GA 3MMYB 2ZXIA 3WG9A 2EZKA 2EIMH 2FOKA 1TNSA 3TOBA 3OYLA 1S7EA 2FD5A 4CYCA 2ICWG 4UUSA 1T0FC 1XDUA 3FXMA 4C2MJ 2FXAA 2Y75A 3KYCB 2HDCA 1I3QJ 3ZRGA 3BROA 2XDVA 3GLLA 1FTZA 4HEA2 2R7XA 3TO7A 2Z3YA 2H8WA 2R7TA 5EEAA
chains in the Genus database with same CATH topology
3ULQB 4D0PA 4ENMA 2K7LA 3W6KB 1USSA 4RGUA 3KP7A 1Z6TA 4L5IA 2CYYA 2ISYA 1J75A 3F6OA 3FM5A 2QQBA 4G6DA 4L9VA 1TBXA 5L3FA 1OYIA 4BHCA 1XGSA 1ZAOA 5H20A 1GXQA 3KP5A 1BC7C 3WE2A 1F4KA 5HLGA 1JGSA 4I02A 1PP8F 4BQAA 1WKMA 1MKMA 4L5JA 2KJBA 5BMZA 5CJ9A 3J80Z 4GYIA 3F8CA 3K0LA 2O3FA 3RYRA 2JRTA 2OQRA 3SZPA 3R4KA 1SAXA 2XHKA 2P8TA 2D2WA 1S3JA 2QBYB 3HRSA 1ZG3A 3QU3A 3ZMVA 2IW5A 1BI3A 4PZJA 1VTNC 2JSCA 2O61A 1S8NA 1W5SA 2FEZA 2L3DA 3QPHA 3EQLF 4RAZA 3EYYA 2IJLA 4AIKA 2VC1A 1H9TA 3V4GA 1ON1A 2FF4A 1UHWA 4JBAA 2UWMA 3GFMA 3R0AA 1IAWA 5L3GA 4Q4ZF 5AIPA 1GHCA 3L00A 1ZHFA 2P5LC 1F9NA 3FXQA 2OU2A 2MBFA 1S7OA 2HKXA 3T8RA 1DPRA 4EGZA 4LD5A 2ZXJA 3V7SA 1U5TB 5EEGA 3WTVC 5D4SA 4OINF 2VOPA 5FGMA 4KN4X 1P6RA 4IRGA 3E97A 5CVRA 2Q0OA 4JQFA 3V7RA 1K78B 2FBIA 2XAJA 5E1ZB 1SMTA 2ZCWA 5DCMA 4KFCA 4MQ9F 1USTA 1QPMA 4A5NA 2QM3A 1I6XA 3M1EA 4R1HA 4BHBA 4IRHA 1Z05A 4G7OF 1BOAA 2H6BA 4B09A 3I58A 1YQAA 2ZJ2A 1BIBA 4A6EA 5H6QA 4O3MA 3WTYC 3L7WA 3AAFA 3SXYA 5HDKA 3M8FA 2A61A 1FNNA 1TTYA 1HXDA 3HRTA 5L3BA 4YFXF 3MCZA 1ZRDA 4L9TA 2VC0A 2UXNA 5JFRA 2HS5A 3MZYA 2FRHA 2M45A 4CHUA 3H92A 3ROUA 4HW0A 2NS0A 3V7CA 2EFWA 3P9IA 2GWRA 4G94A 2J5OA 4Q47A 5JR3A 3JAMZ 5LEJA 1P4XA 2EFNA 2Z5UA 3HTSB 2O8XA 2E7WA 2LNBA 1W4MA 2MH2A 3RYPA 3GF2A 1E17A 4CYDA 4RAYA 2V1DA 1ULYA 3GFJA 2HKOA 1R1VA 2ETHA 1SFUA 1WRJA 2YU3A 4ZYHA 2E1CA 2MA3A 3FMRA 3WGIA 3K9TA 1YFHA 4YIFA 4M9SA 5H6RA 4ENKA 1RUNA 3ERED 1G3SA 2OQGA 1K79A 1R5GA 4KDPA 2F5DA 3DV8A 1HKQA 2G7HA 2VOOA 3CUQA 1FYMA 2XIGA 3VOEA 3BJAA 2JZYA 3G3ZA 1LQ1A 2V79A 3TOAA 1U5TC 4I98B 3PFIA 4ENNA 1RI7A 2RC4A 2ZBKA 4OOIA 3O3KA 3Q9SA 3F8BA 3NEUA 1XMAA 2HTJA 2JPBA 5E1XA 2M5WA 4HF0A 4A6DA 3E6MA 2LKPA 4IVNA 5D4RA 1Z9CA 3KP4A 4M74A 1P4WA 1FYLA 2Z33A 3H3UA 1SD4A 4IXAA 2JT1A 4L0ZB 1IXCA 3RI4A 3M8EA 3U1DA 1XDSA 4DNCA 3T1BA 3DPTA 2KIUA 2GZWA 4WXDA 4EM0B 2PLYA 2GAUA 2DU9A 4WK8F 2MH9A 3FXRA 3BOQA 1RIOH 1W7PA 3RKWA 5ILSA 5HS8A 4HV6A 2BBYA 1DUXC 2Z9OA 4KICA 4IJAA 4KUMA 5E8GA 1MJ9A 3R60A 2R3SA 4RS8A 2NNYA 2L4MA 1FBSA 1FOKA 2ZNYA 4MGRA 1TW2A 2MD5A 1QBJA 1R58A 3ZN0A 5DEQA 3MEXA 4XRFA 1EH7A 4QWQA 3LQRA 5K5QA 1IN4A 4NQWA 1IRGA 3QRFF 1O7LA 1IN6A 4B8XA 3DPLC 4Q48A 4RGSA 2OZUA 4CICA 2GQQA 1Q1HA 2ESHA 4UUVA 2VT2A 3I5UA 4M73A 4XLPF 2G9WA 5L3CA 4LLGF 1FX7A 4AWXB 1KU9A 4UHTA 2BGCA 4N9HA 3FWEA 3ZN1A 4F7ZA 3IWZA 3LA7A 2HYGD 1QZYA 4EM1A 3KP3A 3ABTA 2ZMEB 2EV5A 3KLNA 5HLIA 3DQVC 3FX3A 5FLXZ 2VE8A 1YS7A 2P6SA 3TO6A 3FZVA 2ADUA 3LAJA 3L09A 5F6FA 4EGYA 3HOTA 4P96A 3K1PA 4EMSA 3LQQA 5ICCA 1R1UA 2H27A 3ZQ7A 2D1VA 3WTWC 3CO6C 2PFBA 5LRSA 3C3WA 2EV0A 2GA1A 3SHFA 2DBBA 4HOBA 4A0ZA 3IWFA 3P7NA 2VODA 4EJTA 3J7AO 2X0LA 3J80K 3P9CA 2EFOA 4Y15A 3BJ6A 2H6CA 2COMA 4HDVA 2K4JA 3TKYA 2WC2A 4KMFA 3QP6A 1FLIA 2NYXA 3KP2A 1SFEA 2F5FA 4LMYA 1AWCA 4LG0A 3I0TA 1I1SA 5K5OA 1OKRA 3BP8A 2IA1A 3HRUA 5A2QZ 4P55A 4RB2C 3REOA 4XSXF 3CLOA 2DT5A 4S05A 4I01A 3DKWA 1HKTA 2L02A 3HHHA 4IF4A 3KLOA 3GZ5A 3I64A 1TLHB 5LHIA 2XKPA 3GXOA 3NQOA 4GXOA 4AVPA 4M71A 3KE2A 2EA4A 5ERIA 2VBXA 4HAMA 4I2OA 2A3SA 1ONVA 3LWFA 5ICGA 3SQNA 1G3YA 1Y0UA 4LFUA 3SFZA 1ZREA 1IXSB 3VFZA 2HR3A 2RN7A 4LLLA 2Q2EA 1YW8A 1EH8A 1KA8A 2F2EA 1XN7A 1IZ1A 4BNCA 3C18A 5KK1A 1UFMA 2EA2A 2XAFA 4UV9A 4A2UA 3L9FA 3L2CA 2MLKA 4XLNF 2STTA 3QU6A 1K6OA 1FC3A 1ZRFA 2GIVA 5HDGA 1ZN2A 2TDXA 1D8KA 2HGCA 1IRFA 1H9GA 1R22A 5FFZA 3BZ6A 1F5TA 3FMQA 4CGZA 2IRFG 5FO5A 2QZ8A 2FSWA 2KRFA 4WF2A 1XGMA 4N9IA 2FNPA 4BAYA 5JI6A 1SD5A 3T8TA 3I59A 1J2XA 3P9KA 4I0AA 3RIRA 4A0XA 3DP7A 2LDUA 4O6JA 2O0YA 1SD6A 3O6BB 2PBIA 4MEXF 1OYYA 4GO1A 5LGNA 1T0FA 1UHMA 2PMUA 1XCVA 4M72A 4PDKA 3BPXA 2CGPA 1I27A 1Z7UA 2WV0A 4HX4A 1ZLKA 1TQPA 2DTRA 3KZZA 2J5PA 4HQMA 2EB7A 2NRAC 4ETSA 4RB1A 3LA2A 2JTVA 1B9MA 5J8FA 2M1BA 4MTEA 4ZZLA 5D5WB 3WU1B 2FBKA 4BYYA 4ZH4F 3KETA 4MTDA 2L01A 1W5TA 5DD4A 5L3DA 1KQ9A 2STWA 2XGXA 1CF7B 3V8JA 4WCGA 4M6XA 3C1DA 3K2ZA 1ODDA 3E6CC 2D45A 2VBYA 3HOSA 3J81Z 1ZH5A 1HSTA 4MQVA 5AONA 1RNLA 2PEXA 1NHAA 2DO7A 3KEOA 3CDHA 1FP1D 1OPCA 4P9FA 1ZGJA 1FY7A 5IT9Z 4L9NA 1QGPA 3ZMTA 5HDNA 1BIAA 1OYWA 2QUFA 4AIJA 1X3UA 2YX4A 1B6AA 1LDKB 1R23A 4MHGA 2QYOA 3K69A 1ZLJA 4Y17A 1FBQA 2OA4A 3G73A 4ESBA 4HLXA 3IC7A 5LEKA 3IL2A 5E8IA 2IP2A 5E1WA 1AOYA 3QP5A 4GGGA 4IHSA 2P5VA 1P92A 3FF5A 4G9YA 1XB4A 5CVJA 5D6FA 1KYWA 4LK1F 1TW3A 3QOPA 4KN7X 2FE3A 1W7PD 4KA4A 3GZ6A 1FBUA 1FWZA 1KQ0A 3GEZA 1IN7A 2EFPA 1WQ2A 2DPUA 5LHGA 4Q5SF 3RKXA 4FX4A 4G7HF 4OMYA 2ZKZA 2DFIA 1C0WA 2VT3A 1LEAA 1FYKA 3SZTA 3ZPLA 4FHTA 4JK1X 1KGSA 1R7JA 5D6EA 5L3EA 2HEOA 5DCMB 3IRQA 3I59B 4RB0A 4XSZF 4Z2YA 3JTGA 2FQ3A 1E2XA 4HA8A 5BPIA 2IPQX 4IPAA 3JSPA 2LF8A 3U9GA 3EUHA 2BE5F 1EH6A 4LG0B 3RKYA 4LB6B 3I4PA 5HLHA 2DK5A 4G7ZF 5E18F 4ZYDA 4KT5C 1SFXA 1W7PB 5JVTA 2UZKA 4HDUA 5TRDA 3F21A 1T38A 4EV0A 2R7DA 5LBQA 4KYWA 4HLYA 3R0JA 2HOEA 4U88A 5D5UB 3E5XA 1D3YA 1LEBA 5CVIA 2PG4A 2KIFA 4XBFA 3ZMUA 2OD5A 3BDDA 3LAPA 2XV4S 1FPQA 1V3FA 3HRMA 2ZMEA 3OV8A 2IA0A 1HQCA 1YW9A 2JPCA 4FT8A 2IVMA 1U5TA 3GO5A 5F64A 1XD7A 3LSTA 4G8XA 4IHTA 5J8CA 4NHJA 4ZYEA 1B1BA 2FU4A 4CXFA 1D8JA 1MD0A 1J9IA 3V8LA 1T39A 4M9ZA 3IHUA 5FD5A 4HV5A 4HBLA 1U3EM 2A5YB 2MC3A 2VONA 4PGGA 3ZMZA 1XSDA 3ECOA 2RKHA 2W24A 3CUOA 2IT0A 4HF2A 3WTXC 3F8FA 1R00A 4RB3C 4UVAA 2EFQA 2LF7A 3S2WA 4KIFA 3KFWX 2CO5A 4GYGA 1S6LA 5KVRA 4U0VA 3D5LA 1BM9A 2AXLA 1YS6A 2OBPA 4NB5A 2OZ6A 3JAMK 4KMUX 3HUGA 1XGNA 5CYVA 4M9XA 3FHZA 4ASNA 1FP2A 1JHFA 2Y0MA 4LGWA 4TV7A 1IN8A 1A04A 3F8NA 1YO5C 4PCQA 1JXSA 3DFGA 2P5KA 1HW2A 4PGHA 1UB9A 1ON2A 2VN2A 4ZYGA 4EVIA 1YLFA 5A2QK 3TGNA 5D8LB 3KZYA 5CVUA 1XSVA 1K7AA 5HVQC 1IF1A 2ZFWA 3HHGA 2LSOA 1R1TA 4EJWA 1T98A 2DI3A 4IRIA 2PJPA 3B73A 2WTEA 5D5VB 3CTAA 1DDNA 3R61A 2D1HA 2HQRA 4AD9A 3BY6A 2CW0F 1O3TA 3ML6A 1J7KA 3EETA 4FX0A 3E3VA 3HSRA 4AIHA 1PDNC 1KU7A 2HFHA 1OMIA 1XGOA 2F5CA 2ESNA 2WWYA 3GWZA 2PMHA 1D5VA 2DAOA 1R5HA 3HIFA 3Q9VA 4U0WA 4OIOF 2DQRA 4OIRF 3N97A 2P7VB 4EM2A 4HQEA 1QO0D 6PAXA 1S29A 2P4WA 2ELHA 4YG2F 2W57A 1ZRCA 3LA3A 2DQLA 2P7CB 3JW4A 3GW2A 5ICFA 1QZZA 1KU3A 2GXGA 3IKVA 2QENA 3E6DA 1WSUA 4HYEA 3GFLA 3WU0A 3RPQA 1WI9A 2HYFA 5LRRA 3WGHA 4P5OA 1YTYA 3DEUA 2BV6A 2A69F 2QQAA 2A07F 5BS6A 1TQMA 1YG2A 1MDMA 3BJOA 3FXUA 3BWGA 4U0YA 2VXZA 1HKSA 1GVJA 5LLQA 5BOXA 2NNNA 1QQIA 1YIOA 1SMYF 4OIPF 1B4AA 3CJNA 4L9JA 2Q8KA 3OOPA 1L0OC 1J5YA 1K78A 1IXRC 4P9UA 1V4RA 2PQ8A 1Z6RA 5FD6A 4OIQF 4CDGA 2FMYA 2FMLA 5AIQA 1RZ4A 3HYIA 1LDJA 2UXXA 4HX7A 5ILVA 2M87A 1P2FA 1BI2A 1WWXA 3I54A 3DF8A 2KJCA 2ACJA 4YFKF 1JE8A 4EJUA 2RV8A 1QNTA 5DD8A 1STZA 2ISZA 1G4DA 2HQNA 1BBYA 1G6NA 4ESJA 3EYIA 4BXUA 1R36A 2KIMA 4WX9A 2XRNA 3IRRA 1LDDA 1TNTA 1MGTA 1JHHA 4HZFA 3HTUA 2Z99A 4I7HA 1LB2A 2YPRA 3RPUA 4R79A 5TJJA 2R7FA 1O3RA 3GYHX 2AS5F 5K5RA 3ELKA 1BI1A 3HSEA 3TO9A 1KYZA 3O2PE 1EV7A 5LHHA 1YW7A 2EK5A 2GXBA 1REPC 2E7XA 3VB2A 5D5XB 3KEQA 5LGUA 2HZTA 1B59A 1MJBA 3PQJA 3T5XA 5HS7A 1BI0A 2XKOA 4EJVA 5JHUA 1G3TA 1PP7U 2P6TA 2XUBA 2W25A 2XAQA 1Z1DA 3GLXA 5IT9K 2XASA 3CO7C 1LVAA 3MZHA 1P4AA 4ON0A 4O5VA 1HW5A 5DDGA 3MQ0A 3LFKA 1HBXG 4EJOA 4MNUA 4M6YA 3GX4X 2HWVA 3ZMDA 1XSXA 1RUOA 5DV5A 3N4MA 1HSJA 3ISPA 4WWCA 1ZG1A 2EJRA 2K4BA 1J0RA 4UVCA 3I53A 5FB2A 4R8HA 3COAC 4S04A 4UXNA 1IUYA 2PI0A 2M8EA 3RJPA 1FSEA 2L54A 4I0BA 3TDUC 2A68F 2PN6A 3ECHA 2F5EA 3WODF 2K27A 3W6JB 4H0EA 2H94A 3DXJF 5FLXK 1B9NA 3MWMA 3E5QA 4N0BA 2CSOA 1KU2A 2VBWA 3F6VA 1FT9A 1I5ZA 3NRVA 2RDPA 1MJAA 1F1ZA 1G3WA 2V6CA 2GA2A 2BEOA 3MAJA 1FSHA 3HSFA 2YSRA 5K1YA 1UCRA 2B0LA 2EWNA 2IA2A 3VEPA 4G6QA 3GFIA 3JSOA 2G7UA 2QWWA 2RQPA 2QQ9A 2W84A 2RGVA 3EDPA 3CUQB 4BHPA 2XVCA 3GVAA 3F22A 1LJ9A 1O3QA 5F1RA 1CGPA 5DUKA 4MEYF 3KP6A 3GUDA 3F3XA 2QVOA 5EEHA 4L18B 1MDMB 4UV8A 4Y13A 2DK8A 2ZO4A 2EV6A 1DP7P 2A6HF 4U7BA 4HF1A 1H0MA 5D8KB 3ZP5A 3H3ZA 1HW1A 3WE3A 1TQIA 2K86A 4YIIA 3K1NA 2FA5A 5HOOA 3WTUC 5IT3A 1ZYRF 4YFNF 1BN5A 1XMKA 5J6XA 1KQ8A 3RDIA 3ABUA 2V1XA 1MZBA 3V8KA 5BQTA 1J59A 3I71A 1DPUA 4LK0F 1L3LA 2RNJA 3D0SA 3F72A 3T0YA 3VODA 2K02A 2C6YA 4WXCA 2VE9A 5E20A 5LGTA 3F8MA 2XAHA 4GCVA 5ICEA 3KCCA 3QAHA 3FMSA 4LJZF 4KIGA 1ZG5A 2YX7A 1U78A 2W85A 4CZZA 4KIBA 2O6GE 2XAGA 5CVVA 4OMZA 1U2WA 2CQKA 2H09A 3FM3A 1S7AA 2CFXA 1ZGAA 4U7DA 1BJAA 4OU0A 4EQQA 2X4HA 5ED4A 2ZNZA 3Q5FA 4ENJA 2KKOA 1LNWA 4CO8A 5DCFA 1SD7A 4KNYA 1CF7A 2QBYA 5FFXA 4ESFA 1FZPB 2BYVE 2QLZA 2FNAA 3B02A 1U8RA 4A0YA 3WTZA 1I1GA 2A6EF 3WTSC 4I09A 1GXPA 3MFKA 3F23A 3K1MA 3U2RA 3M9AA 2E1NA 4HX8A 4L0YB 2V1UA 3E6BA 4LLNA 5DUIA 2Y48A 2DW4A 4LB5A 2HTSA 4UNOA 4ZZDA 1T2KA 2FBHA 4A12A 2XROA 2M30A 1YYVA 2L4AA 2RVCA 4RGRA 3JTHA 1XCBA 5E17F 2NAZA 2DLLA 2YR2A 3PQKA 3WGGA 4A5MA 1O7FA 3E5UA 3ZMSA 3BPVA 4DQ2A 2DPDA 1ZARA 2MLGA 3TQNA 2VBZA 3CUQC 3IKTA 4WXHA 4RGXA 1BC8C 3M7GA 3RTRA 4UVBA 2CG4A 1OR7A 5CLSA 5DYMA 1U6GA 2OAZA 4K2EA 3C7JA 1O3SA 4QLCU 1IW7F 1IN5A 2O03A 2V9VA 1T6SA 3J81K 3WTTC 1O57A 1Z91A 5BPDA 4BH9A 3TDZC 2CWEA 5ILUA 3R6SA 1PUEE 5HS9A 3QPTA 4E70A 3WG9A 2FOKA 1TNSA 3TOBA 1XDUA 2FXAA 2Y75A 2HDCA 3BROA 3TO7A 2Z3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULQ B;  4D0P A;  4ENM A;  2K7L A;  3W6K B;  1USS A;  4RGU A;  3KP7 A;  1Z6T A;  4L5I A;  2CYY A;  2ISY A;  1J75 A;  3F6O A;  3FM5 A;  2QQB A;  4G6D A;  4L9V A;  1TBX A;  5L3F A;  1OYI A;  4BHC A;  1XGS A;  1ZAO A;  5H20 A;  1GXQ A;  3KP5 A;  1BC7 C;  3WE2 A;  1F4K A;  5HLG A;  1JGS A;  4I02 A;  1PP8 F;  4BQA A;  1WKM A;  1MKM A;  4L5J A;  2KJB A;  5BMZ A;  5CJ9 A;  3J80 Z;  4GYI A;  3F8C A;  3K0L A;  2O3F A;  3RYR A;  2JRT A;  2OQR A;  3SZP A;  3R4K A;  1SAX A;  2XHK A;  2P8T A;  2D2W A;  1S3J A;  2QBY B;  3HRS A;  1ZG3 A;  3QU3 A;  3ZMV A;  2IW5 A;  1BI3 A;  4PZJ A;  1VTN C;  2JSC A;  2O61 A;  1S8N A;  1W5S A;  2FEZ A;  2L3D A;  3QPH A;  3EQL F;  4RAZ A;  3EYY A;  2IJL A;  4AIK A;  2VC1 A;  1H9T A;  3V4G A;  1ON1 A;  2FF4 A;  1UHW A;  4JBA A;  2UWM A;  3GFM A;  3R0A A;  1IAW A;  5L3G A;  4Q4Z F;  5AIP A;  1GHC A;  3L00 A;  1ZHF A;  2P5L C;  1F9N A;  3FXQ A;  2OU2 A;  2MBF A;  1S7O A;  2HKX A;  3T8R A;  1DPR A;  4EGZ A;  4LD5 A;  2ZXJ A;  3V7S A;  1U5T B;  5EEG A;  3WTV C;  5D4S A;  4OIN F;  2VOP A;  5FGM A;  4KN4 X;  1P6R A;  4IRG A;  3E97 A;  5CVR A;  2Q0O A;  4JQF A;  3V7R A;  1K78 B;  2FBI A;  2XAJ A;  5E1Z B;  1SMT A;  2ZCW A;  5DCM A;  4KFC A;  4MQ9 F;  1UST A;  1QPM A;  4A5N A;  2QM3 A;  1I6X A;  3M1E A;  4R1H A;  4BHB A;  4IRH A;  1Z05 A;  4G7O F;  1BOA A;  2H6B A;  4B09 A;  3I58 A;  1YQA A;  2ZJ2 A;  1BIB A;  4A6E A;  5H6Q A;  4O3M A;  3WTY C;  3L7W A;  3AAF A;  3SXY A;  5HDK A;  3M8F A;  2A61 A;  1FNN A;  1TTY A;  1HXD A;  3HRT A;  5L3B A;  4YFX F;  3MCZ A;  1ZRD A;  4L9T A;  2VC0 A;  2UXN A;  5JFR A;  2HS5 A;  3MZY A;  2FRH A;  2M45 A;  4CHU A;  3H92 A;  3ROU A;  4HW0 A;  2NS0 A;  3V7C A;  2EFW A;  3P9I A;  2GWR A;  4G94 A;  2J5O A;  4Q47 A;  5JR3 A;  3JAM Z;  5LEJ A;  1P4X A;  2EFN A;  2Z5U A;  3HTS B;  2O8X A;  2E7W A;  2LNB A;  1W4M A;  2MH2 A;  3RYP A;  3GF2 A;  1E17 A;  4CYD A;  4RAY A;  2V1D A;  1ULY A;  3GFJ A;  2HKO A;  1R1V A;  2ETH A;  1SFU A;  1WRJ A;  2YU3 A;  4ZYH A;  2E1C A;  2MA3 A;  3FMR A;  3WGI A;  3K9T A;  1YFH A;  4YIF A;  4M9S A;  5H6R A;  4ENK A;  1RUN A;  3ERE D;  1G3S A;  2OQG A;  1K79 A;  1R5G A;  4KDP A;  2F5D A;  3DV8 A;  1HKQ A;  2G7H A;  2VOO A;  3CUQ A;  1FYM A;  2XIG A;  3VOE A;  3BJA A;  2JZY A;  3G3Z A;  1LQ1 A;  2V79 A;  3TOA A;  1U5T C;  4I98 B;  3PFI A;  4ENN A;  1RI7 A;  2RC4 A;  2ZBK A;  4OOI A;  3O3K A;  3Q9S A;  3F8B A;  3NEU A;  1XMA A;  2HTJ A;  2JPB A;  5E1X A;  2M5W A;  4HF0 A;  4A6D A;  3E6M A;  2LKP A;  4IVN A;  5D4R A;  1Z9C A;  3KP4 A;  4M74 A;  1P4W A;  1FYL A;  2Z33 A;  3H3U A;  1SD4 A;  4IXA A;  2JT1 A;  4L0Z B;  1IXC A;  3RI4 A;  3M8E A;  3U1D A;  1XDS A;  4DNC A;  3T1B A;  3DPT A;  2KIU A;  2GZW A;  4WXD A;  4EM0 B;  2PLY A;  2GAU A;  2DU9 A;  4WK8 F;  2MH9 A;  3FXR A;  3BOQ A;  1RIO H;  1W7P A;  3RKW A;  5ILS A;  5HS8 A;  4HV6 A;  2BBY A;  1DUX C;  2Z9O A;  4KIC A;  4IJA A;  4KUM A;  5E8G A;  1MJ9 A;  3R60 A;  2R3S A;  4RS8 A;  2NNY A;  2L4M A;  1FBS A;  1FOK A;  2ZNY A;  4MGR A;  1TW2 A;  2MD5 A;  1QBJ A;  1R58 A;  3ZN0 A;  5DEQ A;  3MEX A;  4XRF A;  1EH7 A;  4QWQ A;  3LQR A;  5K5Q A;  1IN4 A;  4NQW A;  1IRG A;  3QRF F;  1O7L A;  1IN6 A;  4B8X A;  3DPL C;  4Q48 A;  4RGS A;  2OZU A;  4CIC A;  2GQQ A;  1Q1H A;  2ESH A;  4UUV A;  2VT2 A;  3I5U A;  4M73 A;  4XLP F;  2G9W A;  5L3C A;  4LLG F;  1FX7 A;  4AWX B;  1KU9 A;  4UHT A;  2BGC A;  4N9H A;  3FWE A;  3ZN1 A;  4F7Z A;  3IWZ A;  3LA7 A;  2HYG D;  1QZY A;  4EM1 A;  3KP3 A;  3ABT A;  2ZME B;  2EV5 A;  3KLN A;  5HLI A;  3DQV C;  3FX3 A;  5FLX Z;  2VE8 A;  1YS7 A;  2P6S A;  3TO6 A;  3FZV A;  2ADU A;  3LAJ A;  3L09 A;  5F6F A;  4EGY A;  3HOT A;  4P96 A;  3K1P A;  4EMS A;  3LQQ A;  5ICC A;  1R1U A;  2H27 A;  3ZQ7 A;  2D1V A;  3WTW C;  3CO6 C;  2PFB A;  5LRS A;  3C3W A;  2EV0 A;  2GA1 A;  3SHF A;  2DBB A;  4HOB A;  4A0Z A;  3IWF A;  3P7N A;  2VOD A;  4EJT A;  3J7A O;  2X0L A;  3J80 K;  3P9C A;  2EFO A;  4Y15 A;  3BJ6 A;  2H6C A;  2COM A;  4HDV A;  2K4J A;  3TKY A;  2WC2 A;  4KMF A;  3QP6 A;  1FLI A;  2NYX A;  3KP2 A;  1SFE A;  2F5F A;  4LMY A;  1AWC A;  4LG0 A;  3I0T A;  1I1S A;  5K5O A;  1OKR A;  3BP8 A;  2IA1 A;  3HRU A;  5A2Q Z;  4P55 A;  4RB2 C;  3REO A;  4XSX F;  3CLO A;  2DT5 A;  4S05 A;  4I01 A;  3DKW A;  1HKT A;  2L02 A;  3HHH A;  4IF4 A;  3KLO A;  3GZ5 A;  3I64 A;  1TLH B;  5LHI A;  2XKP A;  3GXO A;  3NQO A;  4GXO A;  4AVP A;  4M71 A;  3KE2 A;  2EA4 A;  5ERI A;  2VBX A;  4HAM A;  4I2O A;  2A3S A;  1ONV A;  3LWF A;  5ICG A;  3SQN A;  1G3Y A;  1Y0U A;  4LFU A;  3SFZ A;  1ZRE A;  1IXS B;  3VFZ A;  2HR3 A;  2RN7 A;  4LLL A;  2Q2E A;  1YW8 A;  1EH8 A;  1KA8 A;  2F2E A;  1XN7 A;  1IZ1 A;  4BNC A;  3C18 A;  5KK1 A;  1UFM A;  2EA2 A;  2XAF A;  4UV9 A;  4A2U A;  3L9F A;  3L2C A;  2MLK A;  4XLN F;  2STT A;  3QU6 A;  1K6O A;  1FC3 A;  1ZRF A;  2GIV A;  5HDG A;  1ZN2 A;  2TDX A;  1D8K A;  2HGC A;  1IRF A;  1H9G A;  1R22 A;  5FFZ A;  3BZ6 A;  1F5T A;  3FMQ A;  4CGZ A;  2IRF G;  5FO5 A;  2QZ8 A;  2FSW A;  2KRF A;  4WF2 A;  1XGM A;  4N9I A;  2FNP A;  4BAY A;  5JI6 A;  1SD5 A;  3T8T A;  3I59 A;  1J2X A;  3P9K A;  4I0A A;  3RIR A;  4A0X A;  3DP7 A;  2LDU A;  4O6J A;  2O0Y A;  1SD6 A;  3O6B B;  2PBI A;  4MEX F;  1OYY A;  4GO1 A;  5LGN A;  1T0F A;  1UHM A;  2PMU A;  1XCV A;  4M72 A;  4PDK A;  3BPX A;  2CGP A;  1I27 A;  1Z7U A;  2WV0 A;  4HX4 A;  1ZLK A;  1TQP A;  2DTR A;  3KZZ A;  2J5P A;  4HQM A;  2EB7 A;  2NRA C;  4ETS A;  4RB1 A;  3LA2 A;  2JTV A;  1B9M A;  5J8F A;  2M1B A;  4MTE A;  4ZZL A;  5D5W B;  3WU1 B;  2FBK A;  4BYY A;  4ZH4 F;  3KET A;  4MTD A;  2L01 A;  1W5T A;  5DD4 A;  5L3D A;  1KQ9 A;  2STW A;  2XGX A;  1CF7 B;  3V8J A;  4WCG A;  4M6X A;  3C1D A;  3K2Z A;  1ODD A;  3E6C C;  2D45 A;  2VBY A;  3HOS A;  3J81 Z;  1ZH5 A;  1HST A;  4MQV A;  5AON A;  1RNL A;  2PEX A;  1NHA A;  2DO7 A;  3KEO A;  3CDH A;  1FP1 D;  1OPC A;  4P9F A;  1ZGJ A;  1FY7 A;  5IT9 Z;  4L9N A;  1QGP A;  3ZMT A;  5HDN A;  1BIA A;  1OYW A;  2QUF A;  4AIJ A;  1X3U A;  2YX4 A;  1B6A A;  1LDK B;  1R23 A;  4MHG A;  2QYO A;  3K69 A;  1ZLJ A;  4Y17 A;  1FBQ A;  2OA4 A;  3G73 A;  4ESB A;  4HLX A;  3IC7 A;  5LEK A;  3IL2 A;  5E8I A;  2IP2 A;  5E1W A;  1AOY A;  3QP5 A;  4GGG A;  4IHS A;  2P5V A;  1P92 A;  3FF5 A;  4G9Y A;  1XB4 A;  5CVJ A;  5D6F A;  1KYW A;  4LK1 F;  1TW3 A;  3QOP A;  4KN7 X;  2FE3 A;  1W7P D;  4KA4 A;  3GZ6 A;  1FBU A;  1FWZ A;  1KQ0 A;  3GEZ A;  1IN7 A;  2EFP A;  1WQ2 A;  2DPU A;  5LHG A;  4Q5S F;  3RKX A;  4FX4 A;  4G7H F;  4OMY A;  2ZKZ A;  2DFI A;  1C0W A;  2VT3 A;  1LEA A;  1FYK A;  3SZT A;  3ZPL A;  4FHT A;  4JK1 X;  1KGS A;  1R7J A;  5D6E A;  5L3E A;  2HEO A;  5DCM B;  3IRQ A;  3I59 B;  4RB0 A;  4XSZ F;  4Z2Y A;  3JTG A;  2FQ3 A;  1E2X A;  4HA8 A;  5BPI A;  2IPQ X;  4IPA A;  3JSP A;  2LF8 A;  3U9G A;  3EUH A;  2BE5 F;  1EH6 A;  4LG0 B;  3RKY A;  4LB6 B;  3I4P A;  5HLH A;  2DK5 A;  4G7Z F;  5E18 F;  4ZYD A;  4KT5 C;  1SFX A;  1W7P B;  5JVT A;  2UZK A;  4HDU A;  5TRD A;  3F21 A;  1T38 A;  4EV0 A;  2R7D A;  5LBQ A;  4KYW A;  4HLY A;  3R0J A;  2HOE A;  4U88 A;  5D5U B;  3E5X A;  1D3Y A;  1LEB A;  5CVI A;  2PG4 A;  2KIF A;  4XBF A;  3ZMU A;  2OD5 A;  3BDD A;  3LAP A;  2XV4 S;  1FPQ A;  1V3F A;  3HRM A;  2ZME A;  3OV8 A;  2IA0 A;  1HQC A;  1YW9 A;  2JPC A;  4FT8 A;  2IVM A;  1U5T A;  3GO5 A;  5F64 A;  1XD7 A;  3LST A;  4G8X A;  4IHT A;  5J8C A;  4NHJ A;  4ZYE A;  1B1B A;  2FU4 A;  4CXF A;  1D8J A;  1MD0 A;  1J9I A;  3V8L A;  1T39 A;  4M9Z A;  3IHU A;  5FD5 A;  4HV5 A;  4HBL A;  1U3E M;  2A5Y B;  2MC3 A;  2VON A;  4PGG A;  3ZMZ A;  1XSD A;  3ECO A;  2RKH A;  2W24 A;  3CUO A;  2IT0 A;  4HF2 A;  3WTX C;  3F8F A;  1R00 A;  4RB3 C;  4UVA A;  2EFQ A;  2LF7 A;  3S2W A;  4KIF A;  3KFW X;  2CO5 A;  4GYG A;  1S6L A;  5KVR A;  4U0V A;  3D5L A;  1BM9 A;  2AXL A;  1YS6 A;  2OBP A;  4NB5 A;  2OZ6 A;  3JAM K;  4KMU X;  3HUG A;  1XGN A;  5CYV A;  4M9X A;  3FHZ A;  4ASN A;  1FP2 A;  1JHF A;  2Y0M A;  4LGW A;  4TV7 A;  1IN8 A;  1A04 A;  3F8N A;  1YO5 C;  4PCQ A;  1JXS A;  3DFG A;  2P5K A;  1HW2 A;  4PGH A;  1UB9 A;  1ON2 A;  2VN2 A;  4ZYG A;  4EVI A;  1YLF A;  5A2Q K;  3TGN A;  5D8L B;  3KZY A;  5CVU A;  1XSV A;  1K7A A;  5HVQ C;  1IF1 A;  2ZFW A;  3HHG A;  2LSO A;  1R1T A;  4EJW A;  1T98 A;  2DI3 A;  4IRI A;  2PJP A;  3B73 A;  2WTE A;  5D5V B;  3CTA A;  1DDN A;  3R61 A;  2D1H A;  2HQR A;  4AD9 A;  3BY6 A;  2CW0 F;  1O3T A;  3ML6 A;  1J7K A;  3EET A;  4FX0 A;  3E3V A;  3HSR A;  4AIH A;  1PDN C;  1KU7 A;  2HFH A;  1OMI A;  1XGO A;  2F5C A;  2ESN A;  2WWY A;  3GWZ A;  2PMH A;  1D5V A;  2DAO A;  1R5H A;  3HIF A;  3Q9V A;  4U0W A;  4OIO F;  2DQR A;  4OIR F;  3N97 A;  2P7V B;  4EM2 A;  4HQE A;  1QO0 D;  6PAX A;  1S29 A;  2P4W A;  2ELH A;  4YG2 F;  2W57 A;  1ZRC A;  3LA3 A;  2DQL A;  2P7C B;  3JW4 A;  3GW2 A;  5ICF A;  1QZZ A;  1KU3 A;  2GXG A;  3IKV A;  2QEN A;  3E6D A;  1WSU A;  4HYE A;  3GFL A;  3WU0 A;  3RPQ A;  1WI9 A;  2HYF A;  5LRR A;  3WGH A;  4P5O A;  1YTY A;  3DEU A;  2BV6 A;  2A69 F;  2QQA A;  2A07 F;  5BS6 A;  1TQM A;  1YG2 A;  1MDM A;  3BJO A;  3FXU A;  3BWG A;  4U0Y A;  2VXZ A;  1HKS A;  1GVJ A;  5LLQ A;  5BOX A;  2NNN A;  1QQI A;  1YIO A;  1SMY F;  4OIP F;  1B4A A;  3CJN A;  4L9J A;  2Q8K A;  3OOP A;  1L0O C;  1J5Y A;  1K78 A;  1IXR C;  4P9U A;  1V4R A;  2PQ8 A;  1Z6R A;  5FD6 A;  4OIQ F;  4CDG A;  2FMY A;  2FML A;  5AIQ A;  1RZ4 A;  3HYI A;  1LDJ A;  2UXX A;  4HX7 A;  5ILV A;  2M87 A;  1P2F A;  1BI2 A;  1WWX A;  3I54 A;  3DF8 A;  2KJC A;  2ACJ A;  4YFK F;  1JE8 A;  4EJU A;  2RV8 A;  1QNT A;  5DD8 A;  1STZ A;  2ISZ A;  1G4D A;  2HQN A;  1BBY A;  1G6N A;  4ESJ A;  3EYI A;  4BXU A;  1R36 A;  2KIM A;  4WX9 A;  2XRN A;  3IRR A;  1LDD A;  1TNT A;  1MGT A;  1JHH A;  4HZF A;  3HTU A;  2Z99 A;  4I7H A;  1LB2 A;  2YPR A;  3RPU A;  4R79 A;  5TJJ A;  2R7F A;  1O3R A;  3GYH X;  2AS5 F;  5K5R A;  3ELK A;  1BI1 A;  3HSE A;  3TO9 A;  1KYZ A;  3O2P E;  1EV7 A;  5LHH A;  1YW7 A;  2EK5 A;  2GXB A;  1REP C;  2E7X A;  3VB2 A;  5D5X B;  3KEQ A;  5LGU A;  2HZT A;  1B59 A;  1MJB A;  3PQJ A;  3T5X A;  5HS7 A;  1BI0 A;  2XKO A;  4EJV A;  5JHU A;  1G3T A;  1PP7 U;  2P6T A;  2XUB A;  2W25 A;  2XAQ A;  1Z1D A;  3GLX A;  5IT9 K;  2XAS A;  3CO7 C;  1LVA A;  3MZH A;  1P4A A;  4ON0 A;  4O5V A;  1HW5 A;  5DDG A;  3MQ0 A;  3LFK A;  1HBX G;  4EJO A;  4MNU A;  4M6Y A;  3GX4 X;  2HWV A;  3ZMD A;  1XSX A;  1RUO A;  5DV5 A;  3N4M A;  1HSJ A;  3ISP A;  4WWC A;  1ZG1 A;  2EJR A;  2K4B A;  1J0R A;  4UVC A;  3I53 A;  5FB2 A;  4R8H A;  3COA C;  4S04 A;  4UXN A;  1IUY A;  2PI0 A;  2M8E A;  3RJP A;  1FSE A;  2L54 A;  4I0B A;  3TDU C;  2A68 F;  2PN6 A;  3ECH A;  2F5E A;  3WOD F;  2K27 A;  3W6J B;  4H0E A;  2H94 A;  3DXJ F;  5FLX K;  1B9N A;  3MWM A;  3E5Q A;  4N0B A;  2CSO A;  1KU2 A;  2VBW A;  3F6V A;  1FT9 A;  1I5Z A;  3NRV A;  2RDP A;  1MJA A;  1F1Z A;  1G3W A;  2V6C A;  2GA2 A;  2BEO A;  3MAJ A;  1FSH A;  3HSF A;  2YSR A;  5K1Y A;  1UCR A;  2B0L A;  2EWN A;  2IA2 A;  3VEP A;  4G6Q A;  3GFI A;  3JSO A;  2G7U A;  2QWW A;  2RQP A;  2QQ9 A;  2W84 A;  2RGV A;  3EDP A;  3CUQ B;  4BHP A;  2XVC A;  3GVA A;  3F22 A;  1LJ9 A;  1O3Q A;  5F1R A;  1CGP A;  5DUK A;  4MEY F;  3KP6 A;  3GUD A;  3F3X A;  2QVO A;  5EEH A;  4L18 B;  1MDM B;  4UV8 A;  4Y13 A;  2DK8 A;  2ZO4 A;  2EV6 A;  1DP7 P;  2A6H F;  4U7B A;  4HF1 A;  1H0M A;  5D8K B;  3ZP5 A;  3H3Z A;  1HW1 A;  3WE3 A;  1TQI A;  2K86 A;  4YII A;  3K1N A;  2FA5 A;  5HOO A;  3WTU C;  5IT3 A;  1ZYR F;  4YFN F;  1BN5 A;  1XMK A;  5J6X A;  1KQ8 A;  3RDI A;  3ABU A;  2V1X A;  1MZB A;  3V8K A;  5BQT A;  1J59 A;  3I71 A;  1DPU A;  4LK0 F;  1L3L A;  2RNJ A;  3D0S A;  3F72 A;  3T0Y A;  3VOD A;  2K02 A;  2C6Y A;  4WXC A;  2VE9 A;  5E20 A;  5LGT A;  3F8M A;  2XAH A;  4GCV A;  5ICE A;  3KCC A;  3QAH A;  3FMS A;  4LJZ F;  4KIG A;  1ZG5 A;  2YX7 A;  1U78 A;  2W85 A;  4CZZ A;  4KIB A;  2O6G E;  2XAG A;  5CVV A;  4OMZ A;  1U2W A;  2CQK A;  2H09 A;  3FM3 A;  1S7A A;  2CFX A;  1ZGA A;  4U7D A;  1BJA A;  4OU0 A;  4EQQ A;  2X4H A;  5ED4 A;  2ZNZ A;  3Q5F A;  4ENJ A;  2KKO A;  1LNW A;  4CO8 A;  5DCF A;  1SD7 A;  4KNY A;  1CF7 A;  2QBY A;  5FFX A;  4ESF A;  1FZP B;  2BYV E;  2QLZ A;  2FNA A;  3B02 A;  1U8R A;  4A0Y A;  3WTZ A;  1I1G A;  2A6E F;  3WTS C;  4I09 A;  1GXP A;  3MFK A;  3F23 A;  3K1M A;  3U2R A;  3M9A A;  2E1N A;  4HX8 A;  4L0Y B;  2V1U A;  3E6B A;  4LLN A;  5DUI A;  2Y48 A;  2DW4 A;  4LB5 A;  2HTS A;  4UNO A;  4ZZD A;  1T2K A;  2FBH A;  4A12 A;  2XRO A;  2M30 A;  1YYV A;  2L4A A;  2RVC A;  4RGR A;  3JTH A;  1XCB A;  5E17 F;  2NAZ A;  2DLL A;  2YR2 A;  3PQK A;  3WGG A;  4A5M A;  1O7F A;  3E5U A;  3ZMS A;  3BPV A;  4DQ2 A;  2DPD A;  1ZAR A;  2MLG A;  3TQN A;  2VBZ A;  3CUQ C;  3IKT A;  4WXH A;  4RGX A;  1BC8 C;  3M7G A;  3RTR A;  4UVB A;  2CG4 A;  1OR7 A;  5CLS A;  5DYM A;  1U6G A;  2OAZ A;  4K2E A;  3C7J A;  1O3S A;  4QLC U;  1IW7 F;  1IN5 A;  2O03 A;  2V9V A;  1T6S A;  3J81 K;  3WTT C;  1O57 A;  1Z91 A;  5BPD A;  4BH9 A;  3TDZ C;  2CWE A;  5ILU A;  3R6S A;  1PUE E;  5HS9 A;  3QPT A;  4E70 A;  3WG9 A;  2FOK A;  1TNS A;  3TOB A;  1XDU A;  2FXA A;  2Y75 A;  2HDC A;  3BRO A;  3TO7 A;  2Z3Y A; 
#chains in the Genus database with same CATH topology
 3ULQ B;  4D0P A;  4ENM A;  3LSM A;  1Y1W J;  2K7L A;  2HOT A;  3W6K B;  2ZB9 A;  2XGE A;  5FKO A;  5E3N A;  1USS A;  1QHG A;  4RGU A;  3KP7 A;  2AQE A;  1WJA A;  1Z6T A;  2L9S A;  4DOZ A;  4L5I A;  2CYY A;  2ISY A;  1J75 A;  3F6O A;  4PFO A;  3FM5 A;  3HJE A;  2QQB A;  2A5W A;  4G6D A;  3H3V K;  4L9V A;  1TBX A;  5L3F A;  1OYI A;  4BHC A;  5EG0 B;  4CH7 A;  1XGS A;  3HC7 A;  1ZAO A;  5H20 A;  1BOB A;  2CW8 A;  3AL0 C;  1GXQ A;  2WAQ N;  3KP5 A;  3V42 A;  3BR5 A;  3ERM A;  1BC7 C;  3WE2 A;  1F4K A;  5J1R A;  4D7M A;  5HLG A;  1JGS A;  4I02 A;  1PP8 F;  4BQA A;  1WKM A;  2W82 A;  4BDY A;  1MKM A;  3MN2 A;  1K6Y A;  4L5J A;  2KJB A;  5BMZ A;  4AVZ A;  1RPW A;  3EUK L;  5F08 A;  3H9J A;  5CJ9 A;  2LVS A;  1SVL A;  4A3K J;  3QYE A;  3J80 Z;  1WVR A;  4GYI A;  3F8C A;  3K0L A;  1V55 H;  2DYR H;  1OCO H;  2O3F A;  4F3Q A;  1W36 D;  1X1P A;  1WH5 A;  3W2W A;  4G6T B;  1YRN A;  3RYR A;  2JRT A;  3K4C A;  2OQR A;  3SZP A;  3R4K A;  1SAX A;  2XHK A;  3HKZ N;  2P8T A;  2D2W A;  1IUF A;  1S3J A;  2QBY B;  4QSH A;  4IZZ A;  3CCS I;  3HRS A;  2DA5 A;  4NDL A;  1ZG3 A;  3QU3 A;  2H8R A;  3ZMV A;  2IW5 A;  1BI3 A;  4PZJ A;  1VTN C;  2JSC A;  2O61 A;  1S8N A;  1W5S A;  2FEZ A;  2L3D A;  4P1W A;  1FIA A;  3QPH A;  3EQL F;  1WPK A;  2VL8 A;  3BT9 A;  4RAZ A;  2ZME C;  1GUU A;  2BHY A;  1D0X A;  9ANT A;  3Q0W A;  3EYY A;  2IJL A;  4AIK A;  1JGG A;  1F43 A;  2VC1 A;  3W3C A;  1H9T A;  1MH4 A;  3V4G A;  1ON1 A;  1FMW A;  1ENH A;  2FF4 A;  1UHW A;  4JBA A;  2UWM A;  3GFM A;  2RRE A;  3R0A A;  1IAW A;  5L3G A;  4Q4Z F;  5AIP A;  3HOX J;  1GHC A;  1MBF A;  3L00 A;  1ZHF A;  3VPR A;  4BQQ A;  3PM1 A;  2P5L C;  1F9N A;  3FXQ A;  2OU2 A;  3S2D J;  1DGR M;  2MBF A;  1S7O A;  4IQJ A;  1SEU A;  5M3M J;  2HKX A;  1I39 A;  4Y33 A;  3T8R A;  1DPR A;  4EGZ A;  4LD5 A;  2ZXJ A;  3V7S A;  1U5T B;  3FXJ A;  2E1M C;  2IS1 A;  2KRH A;  2Z2S B;  5EDN A;  5EEG A;  3WTV C;  4AC0 A;  5D4S A;  4OIN F;  2VOP A;  1UAA A;  1T08 B;  5FGM A;  2M4K A;  2CV0 A;  1PUF A;  4XRS A;  4KN4 X;  1P6R A;  4IRG A;  2M4G A;  4HSR A;  3E97 A;  5IY5 H;  2K3P A;  5CVR A;  2KRC A;  2Q0O A;  4JQF A;  3N05 A;  4JYK A;  2PJR A;  1RET A;  3BLY A;  3V7R A;  1K78 B;  4F92 B;  2X51 A;  5KCM A;  4RLF A;  4XKW A;  3G6E I;  3U1K A;  2FBI A;  4GRI A;  2XAJ A;  5E1Z B;  5TIS C;  3OYN A;  1SMT A;  2ZCW A;  5DCM A;  4KFC A;  4MQ9 F;  1UST A;  3MVP A;  4Z6Y A;  4ZTF A;  1QPM A;  4A5N A;  3DEW A;  2QM3 A;  1I6X A;  1Q1V A;  1YE9 A;  3M1E A;  2DJN A;  2DOF A;  3CF5 F;  4R1H A;  1RRJ A;  4BHB A;  4IRH A;  5KAI C;  1Z05 A;  4XR6 A;  1B72 B;  4G7O F;  1BOA A;  2H6B A;  3H9G A;  4B09 A;  3I58 A;  3JCU C;  1RKW A;  1YQA A;  2ZJ2 A;  2IS4 A;  3HPG A;  1BIB A;  4A6E A;  5H6Q A;  2Y2Z A;  4O3M A;  2DMN A;  3TMO A;  5FLV A;  3WTY C;  3LMM A;  2NVU B;  3L7W A;  5M3F J;  1Y1V J;  3AAF A;  3SXY A;  4DZP A;  5HDK A;  2DOA A;  3M8F A;  2HI3 A;  2A61 A;  1FNN A;  1TTY A;  1HXD A;  3HRT A;  2ZJR F;  1TT0 A;  5L3B A;  4YFX F;  3MCZ A;  4F52 A;  1ZRD A;  4L9T A;  1WHU A;  2UXN A;  2VC0 A;  4A3F J;  5JFR A;  2HS5 A;  3MZY A;  4S0H B;  2FRH A;  2EZI A;  2UUZ A;  5CKT A;  2M45 A;  3J7Z I;  4CHU A;  3BG3 A;  4BJT A;  3OY9 A;  3H92 A;  3ROU A;  4QTR A;  4HW0 A;  2NS0 A;  3V7C A;  2EFW A;  1FTT A;  3P9I A;  2GWR A;  2Y9Y A;  4G94 A;  2J5O A;  3ZQQ A;  4Q47 A;  3GCM A;  4IEJ A;  5JR3 A;  2XB0 X;  3JAM Z;  5LEJ A;  1P4X A;  3C2G A;  3HDD A;  2ME6 A;  2EFN A;  2EIN H;  1VQ9 I;  1QVT A;  3W2V A;  2Z5U A;  1X3W B;  2M0C A;  2PMZ N;  3HTS B;  4PJL A;  2ECB A;  2O8X A;  2E7W A;  3DBR B;  2LNB A;  3ZOB A;  1W4M A;  2MH2 A;  3RYP A;  3GF2 A;  1E17 A;  4CYD A;  4RAY A;  2V1D A;  2X6O A;  1AKH B;  1QVU A;  1ULY A;  3GFJ A;  2HXI A;  2HKO A;  3A2K A;  1R1V A;  4MIM A;  2ETH A;  1SFU A;  1WRJ A;  5FRM A;  2YU3 A;  4ZYH A;  4IOC F;  2E1C A;  2MA3 A;  3FMR A;  1VQK I;  3WGI A;  1MMD A;  3K9T A;  2OC6 A;  3EUH C;  1YFH A;  3TW7 A;  4E7Z A;  2RAE A;  2ME0 A;  4M9S A;  5H6R A;  2X6Y A;  4YIF A;  5HNH A;  4ENK A;  1YJ9 I;  1N77 A;  1RUN A;  3ERE D;  4XN0 A;  2BHZ A;  1G3S A;  2OQG A;  1JJ8 C;  1K79 A;  1R5G A;  4KDP A;  1DP3 A;  1WJD A;  3GME A;  1VI0 A;  2F5D A;  3DV8 A;  2LP0 A;  4DZJ A;  1HKQ A;  1U9O A;  2G7H A;  2VOO A;  4JX6 A;  2ZFU A;  3CUQ A;  1FYM A;  2XIG A;  2DA2 A;  3VOE A;  4C9Y A;  3OR2 C;  3NAU A;  3Q0U A;  3BJA A;  2JZY A;  3EPZ A;  3G2B A;  3G3Z A;  3L1P A;  2DA3 A;  1LQ1 A;  2E1M B;  2V79 A;  3TOA A;  3VSK A;  1U5T C;  5CQE A;  4I98 B;  1LKX A;  3PFI A;  4ENN A;  4C2T A;  5B5E C;  1RI7 A;  4FTH A;  1W36 C;  2RC4 A;  2K40 A;  1VFC A;  2ZBK A;  4OOI A;  3DEE A;  3BG6 A;  1JUP A;  1Y0N A;  4BY1 J;  3O3K A;  3LOC A;  3Q9S A;  3F8B A;  3NEU A;  3CJT B;  4EAT A;  1XX5 A;  1XMA A;  2HTJ A;  1TC3 C;  4V2G A;  1Z21 A;  1VQL I;  2JPB A;  5E1X A;  5GAD J;  1N25 A;  3AG1 H;  2M5W A;  1S72 I;  2VUM J;  2NS7 A;  4HF0 A;  4A6D A;  2I5U A;  3E6M A;  2LKP A;  1MSF C;  4IVN A;  1U0J A;  2BY0 A;  5D4R A;  1Z9C A;  3KP4 A;  4M74 A;  1P4W A;  4FE4 A;  2DA7 A;  1FYL A;  1Y8Q B;  2Z33 A;  3H3U A;  2LRE A;  2QQ8 A;  1SD4 A;  4IXA A;  2JT1 A;  5B66 C;  3HUG B;  1QHH D;  4L0Z B;  2JUG A;  3QPS A;  1ZEL A;  1IXC A;  3RI4 A;  2DN0 A;  3WU2 C;  2JA6 J;  3M8E A;  3U1D A;  3ZR8 X;  2D5V A;  2R5Y A;  1XDS A;  4H4K C;  3H9Q A;  3MKZ A;  1W1W E;  2CMP A;  4XN3 A;  4DNC A;  2GIZ A;  3T1B A;  3OYD A;  3DPT A;  2KIU A;  4RM2 A;  2GZW A;  3HOZ J;  2NXN B;  4RDU A;  4WXD A;  4EM0 B;  2PLY A;  2GAU A;  4A93 J;  2VJ5 A;  2DU9 A;  4WK8 F;  2MH9 A;  3CMM A;  2XSJ C;  2BW3 B;  4RM3 A;  2EIK H;  3FXR A;  4XRM A;  3BOQ A;  1RIO H;  2LLK A;  2LC2 A;  3CME I;  2VQH A;  4XKB A;  1PYV A;  1W7P A;  3RKW A;  1RC9 A;  5ILS A;  1F36 A;  5HS8 A;  4HV6 A;  2ZJP F;  2BBY A;  4LIT A;  1DUX C;  1UZC A;  4E7K A;  2Z9O A;  2L7Z A;  5IYC J;  2LKX A;  1OCC H;  2COB A;  2XGD A;  4KIC A;  5E3O A;  4IJA A;  4MO7 A;  1H8A C;  4BDZ A;  4C3H J;  4KUM A;  1JKR C;  5E8G A;  1MJ9 A;  4PJM A;  4NC8 A;  3R60 A;  1K4T A;  2R3S A;  4Y52 J;  3OYM A;  1D1A A;  4RS8 A;  2NNY A;  2L4M A;  3AL0 B;  1FBS A;  1MBJ A;  1FOK A;  1WJB A;  4HPQ A;  1LFU P;  3OSF A;  2YS9 A;  2ZNY A;  3BZK A;  4C3J J;  4MGR A;  3M4O J;  3G1L A;  2WB1 A;  1TW2 A;  2X1C A;  2MD5 A;  3BQZ A;  1OIS A;  3D1N I;  1QBJ A;  1R58 A;  5EF6 A;  3ZN0 A;  3G71 I;  4RAF A;  5DEQ A;  2OF7 A;  3MEX A;  4XRF A;  1EH7 A;  2M9H A;  3LNQ A;  2PX9 A;  4QWQ A;  3LQR A;  5K5Q A;  3TP3 A;  1IN4 A;  1SVM A;  2E5Z A;  3DU5 A;  4QPO A;  2L9R A;  4NQW A;  1IRG A;  3OYA A;  3QRF F;  1O7L A;  1IN6 A;  2DFE A;  3PJR A;  4B8X A;  3DPL C;  4Q48 A;  4RGS A;  2OZU A;  4CIC A;  4XOT A;  2X48 A;  2DYS H;  2GQQ A;  1Q1H A;  2ESH A;  4ZDO A;  4UUV A;  3ZQI A;  3W2A A;  4FET A;  1OLT A;  3IAM 2;  3JRF A;  2DA6 A;  2VT2 A;  2W7N A;  2PMZ A;  1I3A A;  3I5U A;  3SYT A;  4M73 A;  4XLP F;  2K9N A;  2G9W A;  5L3C A;  1SFK A;  4LLG F;  1U8B A;  3KPH A;  1FX7 A;  1MW7 A;  1KU9 A;  4AWX B;  4UHT A;  4E7H A;  2L0K A;  1XTA A;  2Q2E B;  2DOD A;  2K9L A;  5J3L A;  2XF5 A;  2BGC A;  5FKM A;  3RSN A;  1NG7 A;  4N9H A;  2MFZ A;  3W6V A;  2M3A A;  5DTD A;  3FWE A;  2R7U A;  3ZN1 A;  1APL C;  4F7Z A;  3IWZ A;  2LFB A;  3LA7 A;  4ZDP A;  2HYG D;  5EGO A;  1QZY A;  1JT0 A;  4EM1 A;  3KP3 A;  3JRG A;  3Q0V A;  3ABT A;  5E3M A;  2QCO A;  5IP7 J;  4NUB A;  3ZQG A;  2ZME B;  4BS9 A;  2R5Z B;  2EV5 A;  3KLN A;  5HLI A;  3DQV C;  3FX3 A;  4RMN A;  2VE8 A;  5FLX Z;  1JT6 A;  2XGC A;  1YS7 A;  2R4G A;  4I6Z A;  2P6S A;  3TO6 A;  3FZV A;  2BY1 A;  2ADU A;  2EIL H;  4ZDL A;  1X58 A;  2VPR A;  1AU7 A;  4D5C A;  3LAJ A;  3L09 A;  5F6F A;  5FKL A;  4EGY A;  5H2F C;  3HOT A;  4P96 A;  1ZQ3 P;  3K1P A;  4EMS A;  3LQQ A;  5ICC A;  1R1U A;  2H27 A;  3ZQ7 A;  2D1V A;  3QOD A;  3WTW C;  2HOS A;  3CO6 C;  2PFB A;  2LRD A;  2KZG A;  3C3W A;  2EV0 A;  5LRS A;  2GA1 A;  2Z1D A;  3SHF A;  1QA6 A;  1Z3Y A;  1P9Q C;  3NWT A;  4NBQ A;  2DBB A;  4HOB A;  2IGK A;  4A0Z A;  3BCA A;  3IWF A;  3P7N A;  4EJT A;  2OTL I;  2VOD A;  3HGY A;  3J7A O;  2X0L A;  4A69 C;  3J80 K;  3P9C A;  4IHY A;  2EFO A;  1MNE A;  4B4C A;  4X1E A;  4Y15 A;  1A31 A;  3BJ6 A;  2H6C A;  2COM A;  4HDV A;  2K4J A;  2V9P A;  2WC2 A;  3TKY A;  1D5Y A;  3OSG A;  2NOJ B;  2CRG A;  4KMF A;  3QP6 A;  2E60 A;  2ELK A;  3LSR A;  4BE2 A;  1VQP I;  1FLI A;  1Z67 A;  1MIJ A;  3UR3 C;  2NYX A;  2ZC2 A;  1HLV A;  4PSW A;  3AG4 H;  3KP2 A;  1SFE A;  2F5F A;  3AG3 H;  4LMY A;  2NVY J;  1AWC A;  2E34 A;  5F04 A;  4XRS G;  4LG0 A;  2VPL A;  2FUG 2;  3G1O A;  3SZG A;  2E19 A;  3SEZ A;  3LFU A;  3I0T A;  2GLO A;  1J09 A;  5J1Y A;  1I1S A;  2XSD C;  3QPL A;  4M3E A;  4BBS J;  1BW5 A;  5K5O A;  1ZR4 A;  1OKR A;  3BP8 A;  1HA8 A;  2IA1 A;  3HRU A;  1ZK8 A;  4FCY A;  3GTM J;  5A2Q Z;  4P55 A;  4RB2 C;  3REO A;  2VI6 A;  3GTJ J;  4XSX F;  4A3J J;  3CLO A;  1OCZ H;  2DT5 A;  4S05 A;  1R4M B;  2WAE A;  4I01 A;  1IRZ A;  3DKW A;  1HKT A;  2L02 A;  3HHH A;  4BQN A;  3RZO J;  4IF4 A;  3B6C A;  3WG7 H;  3CC4 I;  3KLO A;  3GZ5 A;  3I64 A;  3ZQH A;  3JRC A;  2DFH A;  3J7Y J;  4CCM A;  1TLH B;  5LHI A;  2XKP A;  3GXO A;  3NQO A;  4GXO A;  4AVP A;  1EF4 A;  3LSG A;  4M71 A;  3QYB A;  2HPI A;  1I50 J;  3KE2 A;  2EA4 A;  3JRB A;  4AUX A;  1OCT C;  3VYR B;  2DT7 B;  1ETO A;  5ERI A;  2VBX A;  4HNV A;  2JA2 A;  4HNU A;  4UUT A;  4HAM A;  2QKL B;  4I2O A;  3QOE A;  5J47 A;  3ZQC A;  4CZC A;  1Y6I A;  3DKX A;  2A3S A;  4BU2 A;  1ONV A;  3LWF A;  5ICG A;  2V1N A;  4LIV A;  3SQN A;  2F4O B;  3QWL A;  2R5Z A;  1G3Y A;  1MBH A;  1Y0U A;  4BUP A;  4LFU A;  4A3M J;  3SFZ A;  1ZRE A;  3TP0 A;  1IXS B;  2E35 A;  3VFZ A;  1SAN A;  2HR3 A;  3D5S C;  2RN7 A;  4LLL A;  1A35 A;  1W0U A;  1QPI A;  2Q2E A;  1YW8 A;  2CUJ A;  4LOC A;  3F9K A;  1EH8 A;  1TT5 B;  3OWT A;  1KA8 A;  2F2E A;  4XL9 A;  5E3L A;  1XN7 A;  2JRM A;  1IZ1 A;  1K83 J;  4BNC A;  3C18 A;  5KK1 A;  2R92 J;  4ANJ A;  3IAS 2;  1UFM A;  1NH3 A;  1UEL B;  3AFH A;  2EA2 A;  2XAF A;  4UV9 A;  4A2U A;  3L9F A;  4B43 A;  4DW6 A;  5DM7 F;  2DT6 A;  3L2C A;  4YEJ A;  2MLK A;  1S9H A;  4XLN F;  2DA1 A;  2WB1 N;  2DA4 A;  2DTZ A;  3RKQ A;  1A5J A;  2STT A;  3QU6 A;  3JR9 A;  1K6O A;  1FC3 A;  2VB6 A;  3I55 I;  3S2H J;  2CS3 A;  2GIV A;  1ZRF A;  2KHM A;  1WI3 A;  4E7L A;  4IL6 C;  5HDG A;  1ZN2 A;  2TDX A;  1D8K A;  2HGC A;  4XLH A;  1IRF A;  1OFC X;  3M8J A;  1H9G A;  1R22 A;  1E0E A;  3CLQ A;  5FFZ A;  4PJ0 C;  2A05 A;  3OS0 A;  3BZ6 A;  1F5T A;  3FMQ A;  1OJL A;  4CGZ A;  2IRF G;  5FO5 A;  2QZ8 A;  3VYT B;  2FSW A;  2BVL A;  2KRF A;  2EZL A;  1RR8 C;  1KZH A;  2M0M A;  1TWG J;  4FIS A;  4WF2 A;  1XGM A;  4N9I A;  2FNP A;  4BAY A;  5JI6 A;  1SD5 A;  3T8T A;  3I59 A;  1J2X A;  3P9K A;  4I0A A;  3RIR A;  2CV2 A;  2AHQ A;  4A0X A;  2JK3 A;  1TP4 A;  1PUF B;  1BJZ A;  2WAQ A;  3DP7 A;  2LDU A;  4O6J A;  2O0Y A;  1SD6 A;  3I4N J;  3O6B B;  2IS2 A;  2FQ4 A;  2PBI A;  2R7Z J;  2XPU A;  4MEX F;  1OYY A;  4GO1 A;  5LGN A;  2Y31 A;  1X2N A;  2L9V A;  2LBF A;  4ZTJ A;  1RKT A;  1T0F A;  1UHM A;  2KT0 A;  2PMU A;  1XCV A;  4M72 A;  3K4B A;  3K4K A;  4PDK A;  3BPX A;  3FK7 A;  2NOG A;  1FOX A;  2BW3 A;  3PSF A;  2V7F A;  5JHF A;  3PNT A;  2CGP A;  3PUB A;  3CJR B;  2HDD A;  1FOY A;  1I27 A;  4A3C J;  1Z7U A;  2HQA A;  2K9Q A;  2WV0 A;  4CYC B;  3MZ8 A;  4HX4 A;  3RCO A;  1TQP A;  1ZLK A;  3ABK H;  2LH9 A;  5F0C A;  1VND A;  2DTR A;  3KZZ A;  2B9S A;  1BR1 A;  2J5P A;  2R7Q A;  2EB7 A;  4HQM A;  2NRA C;  4ZJZ A;  3TED A;  2QSF X;  2RQQ A;  4ETS A;  4AYB A;  4RB1 A;  3OYC A;  1WJE A;  3LA2 A;  2JTV A;  1B9M A;  3K70 C;  3DBH B;  1O4X A;  5J8F A;  1FMV A;  2M1B A;  4MTE A;  1PVE A;  4ZZL A;  5D5W B;  2BVM A;  3WU1 B;  2XAU A;  1ZGW A;  2FBK A;  4BYY A;  4KJZ A;  4ZH4 F;  3KET A;  4MTD A;  2L01 A;  3JRE A;  1FJL A;  2OJE D;  4GFB A;  1DQU A;  1W5T A;  5DD4 A;  5L3D A;  1WH7 A;  1KQ9 A;  1JUS A;  2STW A;  3I4M J;  2HPM A;  2XGX A;  1CF7 B;  3V8J A;  2QA4 I;  4WCG A;  3KYL A;  4YEL A;  4M6X A;  3C1D A;  3K2Z A;  1ODD A;  4F93 B;  3E6C C;  2D45 A;  1IV6 A;  1VQ7 I;  2VBY A;  3HOS A;  2QSH X;  4AM3 A;  4XLF A;  4XM3 A;  3J81 Z;  3K10 A;  1ZH5 A;  1HST A;  5IOY A;  4DGW B;  1SAU A;  3GTL J;  2EQR A;  4MQV A;  5AON A;  1RNL A;  3C2H A;  2PEX A;  3K4J A;  4XKV A;  1NHA A;  3LSP A;  4U87 A;  2DO7 A;  2KIS A;  3KEO A;  3JRH A;  3CDH A;  5C4J J;  1FP1 D;  3OYG A;  1OPC A;  4P9F A;  2EIJ H;  1ZGJ A;  1XG1 A;  2LR8 A;  4BBR J;  1W5C C;  2VQC A;  3OYB A;  1X1A A;  3IUO A;  1HOM A;  1FY7 A;  5IT9 Z;  4L9N A;  1QGP A;  2LTP A;  3CF2 A;  2QEX I;  1MMN A;  3A0B C;  3ZMT A;  2CQX A;  5HDN A;  2XRL A;  1BIA A;  1OYW A;  2QUF A;  5KHD A;  4AIJ A;  1X3U A;  2YX4 A;  1B6A A;  4EEF G;  1LDK B;  1R23 A;  4MHG A;  4BGD A;  2QYO A;  3K69 A;  3DU6 A;  1ZLJ A;  4Y17 A;  2LYC A;  3HXL A;  5DM6 F;  1FBQ A;  2LY9 A;  1WZ2 A;  1WCM J;  1S5L C;  2OA4 A;  3G73 A;  4PK4 A;  4ESB A;  4PSX A;  4HLX A;  3MKY B;  3CES A;  3IC7 A;  2NVT J;  1E3O C;  5GTH C;  5LEK A;  3IL2 A;  1BR2 A;  5E8I A;  2IP2 A;  1T8I A;  5E1W A;  1AOY A;  4IHW A;  2E1O A;  3VSL A;  4HNT A;  3QP5 A;  4GGG A;  3ZXS A;  4IHS A;  3DCF A;  2P5V A;  2XC7 A;  1P92 A;  3K6G A;  3FF5 A;  2KMU A;  3DBL B;  4G9Y A;  1E3P A;  1XB4 A;  5F1J A;  5CVJ A;  3CCR I;  1X2M A;  5D6F A;  1IGN A;  1KYW A;  4LK1 F;  1Y39 A;  1UG2 A;  1XPX A;  1TW3 A;  2DMT A;  1POG A;  3QOP A;  4DYC A;  4KN7 X;  4XIC A;  1YI2 I;  1VF9 A;  2FE3 A;  2NVQ J;  1W7P D;  1AHD P;  4KA4 A;  3CJQ B;  3GZ6 A;  1R6R A;  1FBU A;  1YIJ I;  1FWZ A;  5TGT A;  1KQ0 A;  2BXZ A;  3GEZ A;  1IN7 A;  4E7I A;  2EFP A;  1WQ2 A;  2DPU A;  1UJ8 A;  1Z7L A;  2Q1Z B;  5LHG A;  1W0T A;  4Q5S F;  4HST A;  3RKX A;  4FX4 A;  4G7H F;  3S93 A;  4M3F A;  2ZKZ A;  4OMY A;  1KON A;  4Y7N J;  5J40 A;  2DFI A;  1C0W A;  2VT3 A;  1LEA A;  1LE8 A;  1FYK A;  3SZT A;  3ZPL A;  4FHT A;  4JK1 X;  1KGS A;  1R7J A;  5D6E A;  2KDZ A;  3FXL A;  2DCE A;  1JI8 A;  5L3E A;  3S32 A;  2HEO A;  2V6E A;  5DCM B;  3IRQ A;  1IC8 A;  3BTC A;  3S14 J;  1JJ6 C;  1OQY A;  1UHS A;  3HGG A;  3I59 B;  4I76 A;  4RB0 A;  4DYQ A;  1R5I D;  3RPU D;  4XSZ F;  2GXA A;  4Z2Y A;  3JTG A;  2FQ3 A;  1E2X A;  1X1C A;  4XK4 A;  4HA8 A;  5BPI A;  4JOM A;  2IPQ X;  4IPA A;  4ZYA A;  3JSP A;  2LF8 A;  3U9G A;  3HOW J;  3EUH A;  5BNG A;  2ZSI B;  2BE5 F;  4N4O B;  2X1D A;  1EH6 A;  2BY2 A;  1MBG A;  2E71 A;  4LG0 B;  3BR3 A;  3RKY A;  2GOX B;  4LB6 B;  2CFO A;  2F6C A;  2HYJ A;  3I4P A;  4NQW B;  5HLH A;  2DK5 A;  5CPR B;  3KZI C;  3A02 A;  3RQ4 A;  4RAG A;  4CA0 A;  3A01 B;  4G7Z F;  5E18 F;  4ZYD A;  2QGU A;  4KT5 C;  1SFX A;  1W7P B;  5JVT A;  3CQZ J;  2UZK A;  3H36 A;  2R7O A;  4HDU A;  2JWT A;  3ABL H;  1TWC J;  5TRD A;  3F21 A;  1T38 A;  4EV0 A;  2TRT A;  2Y0S A;  3I3L A;  3DLA A;  5J4Y A;  3HPH A;  2R7D A;  3B6A A;  5LBQ A;  4KYW A;  3OYF A;  2XPW A;  4HLY A;  4IHX A;  4CSW A;  3DTK A;  4XMY A;  3R0J A;  2HOE A;  2L5Q A;  2GBY A;  4U88 A;  5D5U B;  3E5X A;  1D3Y A;  1LEB A;  2V4J C;  5CVI A;  2E2J J;  1ORK A;  2PG4 A;  3O8G A;  2KIF A;  4XBF A;  3ZMU A;  3S8P A;  2OD5 A;  3CMY A;  3BDD A;  2VKD A;  2R7W A;  3LAP A;  3H0D A;  3GBG A;  1WJ5 A;  1A36 A;  1ACI A;  4V2F A;  1P7I A;  2XV4 S;  1GT0 C;  1FPQ A;  4CCJ A;  4YRV A;  1V3F A;  2JQ7 A;  3HRM A;  2E2H J;  5M5Y J;  2ZME A;  2X6W A;  3MKL A;  3OV8 A;  2IA0 A;  1WGX A;  2VLA A;  4J00 A;  1HQC A;  1YW9 A;  2JPC A;  2XF7 A;  4FT8 A;  4XON A;  2AO9 A;  4AYB N;  3PO3 J;  2IVM A;  1XC5 A;  1U5T A;  2A6T A;  4QIW N;  2JVH A;  2HNH A;  2VKV A;  3H1C A;  2JUC A;  3GO5 A;  5F64 A;  1XD7 A;  3LST A;  4G8X A;  4IHT A;  4X6A J;  5J8C A;  4NHJ A;  4ZYE A;  3GTG J;  1TWA J;  3L2V A;  1B1B A;  4XLA A;  4IOA F;  5JVG F;  3PNV A;  2FU4 A;  2Y9Z A;  4XKC A;  4JX5 A;  1T33 A;  2B63 J;  1HDP A;  4CXF A;  1D8J A;  1MD0 A;  1J9I A;  4A3I J;  3LSK A;  3ZCO A;  1IV8 A;  3V8L A;  3CCE I;  1T39 A;  4M9Z A;  4HG2 A;  3IHU A;  5GAH J;  5FD5 A;  3JRI A;  4HV5 A;  4HBL A;  1HC8 A;  2WAF A;  3CCJ I;  1U3E M;  3OIP A;  1H88 C;  3QQA A;  2A5Y B;  2MC3 A;  2VON A;  4PGG A;  2JMW A;  2M2E A;  3ZMZ A;  5C3E J;  1XSD A;  3ECO A;  2RKH A;  2W24 A;  3CUO A;  2IT0 A;  2KDO A;  3BR1 A;  4HF2 A;  3WTX C;  1MMA A;  1R71 A;  3F8F A;  4JX4 A;  1Z0X A;  1TL8 A;  5M5X J;  1R00 A;  1R4N B;  2HU9 A;  4RB3 C;  4DBQ A;  4UVA A;  3S3O A;  3PO2 J;  3OMY A;  3BQY A;  2EFQ A;  2MC4 A;  1IDY A;  2LF7 A;  3S2W A;  4KIF A;  2KLO A;  4CCK A;  3KFW X;  5J4V A;  1JKP C;  1DU0 A;  2CO5 A;  4GYG A;  3FHN A;  3CCY A;  3KYD B;  1S6L A;  5KVR A;  3NAR A;  3JRD A;  4U0V A;  4DYR A;  3D5L A;  1X3Z B;  3VDX A;  1BM9 A;  2AXL A;  2N8G A;  5GP9 A;  1YS6 A;  2OBP A;  2R7S A;  4NB5 A;  2OZ6 A;  3JAM K;  2JVG A;  4KMU X;  5B3S H;  3HUG A;  2HVR A;  1XGN A;  5CYV A;  2O5R A;  2DDA A;  2K9S A;  4M9X A;  1V5F A;  2KPM A;  2ID3 A;  1H89 C;  1E3H A;  3FHZ A;  2LBF B;  4ASN A;  4BE0 A;  2MAB A;  3A1Y A;  1FP2 A;  2V26 A;  1JHF A;  2IGM A;  2Y0M A;  1JTY A;  4LGW A;  4TV7 A;  3FIW A;  3K4N A;  5F27 A;  1IN8 A;  4KT6 A;  4OAY A;  5IOZ A;  1A04 A;  3F8N A;  2L2O A;  2OV7 A;  3H5A A;  1YO5 C;  4PCQ A;  2JA5 J;  1JXS A;  3DFG A;  1DU6 A;  2P5K A;  2IGN A;  4BY7 J;  1VQ6 I;  1HW2 A;  4PGH A;  1JKQ C;  1UB9 A;  2I10 A;  1ON2 A;  2VN2 A;  5GTI C;  4ZYG A;  1WFX A;  3VYU B;  5FLM J;  4EVI A;  1YLF A;  5A2Q K;  3DKY A;  3TGN A;  4PFP A;  5D8L B;  4W1U A;  3KZY A;  5CVU A;  1XSV A;  3FBI B;  4YIR X;  1K7A A;  1VQM I;  5HVQ C;  4PUS A;  2O7O A;  5FRN A;  4B3A A;  1IF1 A;  2ZFW A;  3HHG A;  2LSO A;  3BR0 A;  3ASO H;  3WHC A;  1R1T A;  1Z77 A;  3CDL A;  4EJW A;  1T98 A;  1V54 H;  2DI3 A;  4IRI A;  2PJP A;  3B73 A;  3M1C A;  1RES A;  3OYH A;  2WTE A;  2WY7 Q;  5D5V B;  3CTA A;  3I9V 2;  1DDN A;  3R61 A;  3OR1 C;  2D1H A;  2HQR A;  2KFD A;  4AD9 A;  2Y69 H;  1MNM C;  1OCR H;  3JRA A;  3HOY J;  2DXI A;  4BKX A;  3ESW B;  5JLX A;  2MGQ A;  3GTQ J;  3BY6 A;  2CW0 F;  1O3T A;  3ML6 A;  1J7K A;  3EET A;  4XLE A;  2VQL A;  3O8H A;  4FX0 A;  1YJW I;  3E3V A;  2BOL A;  4IQ4 A;  3HSR A;  3PUF A;  4AIH A;  4F91 B;  1PDN C;  3HG9 A;  1KU7 A;  4M3D A;  1FEX A;  2WA0 A;  2HFH A;  1VQ8 I;  5KAF C;  1OMI A;  1R49 A;  4UY8 I;  2DOE A;  1XGO A;  4D7N A;  2F5C A;  3LSI A;  4AID A;  1G59 A;  1K4S A;  3IV5 A;  1LFB A;  3PSI A;  2ESN A;  2WWY A;  1X4P A;  3GWZ A;  2PMH A;  1D5V A;  1BW6 A;  2DAO A;  4IKF A;  4HRI A;  1R5H A;  1I6H J;  2EBI A;  3RZD J;  3HIF A;  3ABM H;  3Q9V A;  5GAG J;  4U0W A;  2BY3 A;  4OIO F;  2DQR A;  4OIR F;  3RQI A;  3N97 A;  2P7V B;  1SVO A;  4EM2 A;  4HQE A;  1QO0 D;  4FQG A;  6PAX A;  1S29 A;  4M3B A;  2P4W A;  1GLN A;  2ELH A;  4YG2 F;  2W57 A;  2X1E A;  1ZRC A;  3H0G J;  4II2 A;  3LA3 A;  4RBO A;  3HM5 A;  2DQL A;  2LY2 A;  1GVD A;  3HBL A;  2P7C B;  3JW4 A;  3S1M J;  3OYI A;  4DJA A;  3CP8 A;  2XPV A;  2ZXH A;  3OYE A;  3GW2 A;  5ICF A;  1ZR2 A;  4RA2 A;  1QZZ A;  1KU3 A;  1A6Q A;  5HOD A;  1ETW A;  2K3F A;  2GXG A;  3IKV A;  5IYB J;  2B7E A;  2Y30 A;  1P7J A;  1TWF J;  2QEN A;  3E6D A;  1YOV B;  2CUZ A;  2JSP A;  1WSU A;  3MKW B;  4B48 A;  4HYE A;  1FIP A;  3GFL A;  1TZL A;  3WU0 A;  3RPQ A;  2YUS A;  1WI9 A;  2HYF A;  2K9M A;  5LRR A;  5CQG A;  3WGH A;  2O8K A;  2Y0S N;  4P5O A;  4II3 A;  1YTY A;  3DEU A;  1LE8 B;  4GDF A;  3BG5 A;  1NTC A;  2BV6 A;  2A69 F;  2QQA A;  2MD0 A;  4BXF A;  2A07 F;  5BS6 A;  2JN6 A;  2ECC A;  1TQM A;  2WBM A;  1IO2 A;  1YG2 A;  3BR2 A;  5FKN A;  1MDM A;  1ITY A;  4Y4R A;  3BJO A;  3FXU A;  3BWG A;  3HOU J;  2Z16 A;  1N78 A;  1ETV A;  4XNF A;  1X1D A;  2CQQ A;  2V9K A;  4U0Y A;  2I8D A;  3OYK A;  2K85 A;  4E7S A;  1D1C A;  2VXZ A;  3CCV I;  2LK2 A;  1HKS A;  2FX0 A;  1GVJ A;  5LLQ A;  2R93 J;  5BOX A;  2NNN A;  1QQI A;  1YIO A;  1SMY F;  4OIP F;  1B4A A;  5FRO A;  3CJN A;  3OL3 A;  3GTK J;  4L9J A;  2Q8K A;  4XOR A;  1LFP A;  3OOP A;  3OIO A;  1L0O C;  1J5Y A;  1K78 A;  4ABZ A;  2CQ7 A;  1IXR C;  1N75 A;  4P9U A;  3U21 A;  1V4R A;  4IHV A;  1A6I A;  1VQ5 I;  4XID A;  2PQ8 A;  4OAZ A;  3Q3S A;  4BL0 B;  4IX7 A;  1Z6R A;  2H1K A;  1X1B A;  5FD6 A;  1ZTR A;  2F5V A;  4OIQ F;  4CDG A;  2FMY A;  2FML A;  5AIQ A;  1RZ4 A;  3HYI A;  1LDJ A;  3SDB A;  2BZT A;  2UXX A;  3WHB A;  1B72 A;  1ETY A;  4HX7 A;  3SFI A;  1Z3X A;  5ILV A;  4E7J A;  2M87 A;  1P2F A;  1BI2 A;  3BG7 A;  1WWX A;  3I54 A;  3KX2 A;  3DF8 A;  2KJC A;  3CC7 I;  2NS8 A;  2ACJ A;  1R9T J;  4YFK F;  1JE8 A;  4EJU A;  2RV8 A;  1XMX A;  2CJJ A;  3HKZ A;  3KEY A;  4N4N B;  1QNT A;  5DD8 A;  4B47 A;  1YJN I;  4KIS A;  3OS2 A;  1T56 A;  1VZ0 A;  3CDI A;  1YX3 A;  1STZ A;  2ISZ A;  1G4D A;  2HQN A;  1BBY A;  1G6N A;  3CP2 A;  4BJ6 C;  2KIQ A;  4ESJ A;  1YX5 A;  5IP6 A;  2YU9 J;  4W97 A;  3EYI A;  4F55 A;  1K61 A;  1MMG A;  4BXU A;  1R36 A;  2KIM A;  4WX9 A;  2XRN A;  3S16 J;  4DIQ A;  3OL4 A;  5C44 J;  3L2U A;  3IRR A;  1LDD A;  1TNT A;  3LSJ A;  1OR7 C;  1MGT A;  2DJI A;  1JHH A;  5F0H A;  3FIS A;  2IAI A;  4HZF A;  2WAD A;  3HTU A;  2Z99 A;  2ID6 A;  4I7H A;  2DMU A;  1LB2 A;  2E5N A;  3FDY A;  2YPR A;  3RPU A;  1Y56 A;  4R79 A;  5TJJ A;  3PNY A;  5E79 C;  3HEF A;  2R7F A;  1O3R A;  3GYH X;  2AS5 F;  4A3G J;  5K5R A;  3ELK A;  2OCE A;  1BI1 A;  2H1L A;  3HSE A;  2ZXW H;  3TO9 A;  3K70 D;  4C3I J;  3IH2 A;  1KYZ A;  3BR6 A;  3A4C A;  2GOM A;  1GV5 A;  1WJC A;  1ETQ A;  3O2P E;  1EV7 A;  5LHH A;  1YW7 A;  2EK5 A;  2GXB A;  4B44 A;  1X19 A;  1REP C;  1CQT A;  2NVX J;  2E7X A;  2AQF A;  3VB2 A;  3TBI A;  5D5X B;  3KEQ A;  1U9N A;  1X4O A;  3K4L A;  2R7V A;  5LGU A;  4XQF A;  2VJJ A;  3NWS A;  1RR7 A;  1QZE A;  2HZT A;  3LL7 A;  1B59 A;  2AXT C;  4BEH B;  1MJB A;  3PQJ A;  3T5X A;  5HS7 A;  3D5R C;  4CCO A;  1BI0 A;  5GAE J;  2XKO A;  3FKJ A;  1QU3 A;  1AA7 A;  3L2Q A;  4M6V A;  3FXO A;  4EJV A;  4PJN A;  1B8I B;  1JKO C;  5JHU A;  1G3T A;  1Y8R B;  1PP7 U;  2P6T A;  2XUB A;  2W25 A;  5LD2 C;  2XAQ A;  2E2I J;  3H35 A;  1Z1D A;  3GLX A;  5IT9 K;  2XAS A;  3K4M A;  2E36 A;  3S3N A;  3CO7 C;  1LVA A;  2HVS A;  3MZH A;  1P4A A;  4ON0 A;  4O5V A;  2CV1 A;  3UNG C;  4I99 C;  3FKI J;  2ELJ A;  1YIT I;  1HW5 A;  5DDG A;  3MQ0 A;  1IG7 A;  3LFK A;  1IJW C;  1HBX G;  2L9N A;  2X9D A;  1TWH J;  3MD2 A;  1GV2 A;  4EJO A;  5LFA A;  4MNU A;  4M6Y A;  2IXS A;  2KQR A;  2F4M B;  3GX4 X;  3SEQ A;  2HWV A;  3ZMD A;  4CCL A;  1XSX A;  1RUO A;  2M34 A;  2MYS A;  5DV5 A;  3N4M A;  1HSJ A;  5EYR A;  3ISP A;  2G0E A;  3X2Q H;  1G8X A;  3OYJ A;  3HL2 A;  5B1A H;  4WWC A;  3CD6 I;  3GTP J;  1ZG1 A;  3F0C A;  3AKZ A;  2EJR A;  2QKM B;  2K4B A;  1J0R A;  2MG4 A;  4UVC A;  3I53 A;  2VAS A;  1D1B A;  3CCQ I;  5FB2 A;  4C30 A;  4MFD A;  4R8H A;  3L2R A;  4UUS B;  2EPF A;  5M5W J;  3COA C;  2LG4 A;  4S04 A;  2CW7 A;  4UXN A;  1IUY A;  3CCL I;  2PI0 A;  2M8E A;  2M8G X;  3RJP A;  3BTJ A;  1FSE A;  2L54 A;  4XOP A;  4I0B A;  3TDU C;  4A3L J;  2A68 F;  2PN6 A;  4A3D J;  3OIQ A;  1V5G A;  3ECH A;  2F5E A;  2BXY A;  2HQ5 A;  3WOD F;  2K27 A;  3W6J B;  4H0E A;  1BL0 A;  4D9J A;  2H94 A;  3DXJ F;  2R7R A;  5FLX K;  1B9N A;  5IPA A;  2L7F P;  3MWM A;  3TW6 A;  4XLC A;  3SJM A;  1FOW A;  2CQN A;  3E5Q A;  3CCU I;  4N0B A;  2CSO A;  2EH3 A;  4JP0 A;  3SDG A;  2IEK A;  1KU2 A;  3GZN B;  2VBW A;  4E4H A;  4ITV A;  2L7K A;  2CUF A;  3F6V A;  1FT9 A;  3A03 A;  2K5C A;  5B1B H;  2EZH A;  1EJ9 A;  2RNG A;  1I5Z A;  3NRV A;  5JLW A;  2RDP A;  1MBE A;  4C2U A;  1MJA A;  1F1Z A;  1NK2 P;  1G3W A;  2V6C A;  1SFO J;  2GA2 A;  2BEO A;  2W1O A;  3MAJ A;  1FSH A;  3HSF A;  1MH3 A;  2YSR A;  3ZQL A;  2IGO A;  3BC8 A;  3K2A A;  2FOW A;  3BTL A;  3A01 A;  2W48 A;  4BEH A;  5K1Y A;  1UCR A;  2B0L A;  2EWN A;  2IA2 A;  4UB6 C;  3VEP A;  4V19 K;  4G6Q A;  3GFI A;  1ERD A;  1NG6 A;  3JSO A;  2G7U A;  2QWW A;  3DTE A;  3OOU A;  3KIO A;  2RQP A;  1AKH A;  1B8I A;  2QQ9 A;  1NK3 P;  4OWR B;  2W84 A;  2KZV A;  2RGV A;  3EDP A;  5K7H A;  4A3E J;  3S17 J;  2LD5 A;  1JUM A;  3CUQ B;  3PL8 A;  4LIU A;  5FJ8 J;  4J19 A;  4BHP A;  3PIO F;  2XVC A;  1IDZ A;  3GVA A;  3VWB A;  2M7A A;  2FJ1 A;  4J01 A;  2W00 A;  3G1M A;  2VIX A;  3F22 A;  1LJ9 A;  3ONQ A;  1O3Q A;  4AU7 A;  5F1R A;  2ZJQ F;  1CGP A;  4LG3 A;  5DUK A;  4PJJ A;  4MEY F;  3KP6 A;  5KNL A;  3GUD A;  1ETX A;  3F3X A;  4D1Q A;  1VQ4 I;  3PFY A;  2QVO A;  2VXD A;  5EEH A;  2WV1 A;  2JA7 J;  4BXX J;  4L18 B;  3DPU A;  1MDM B;  4UV8 A;  4Y13 A;  2TCT A;  2DK8 A;  2ZO4 A;  2F48 A;  2O9L A;  2XF6 A;  1UG0 A;  2EV6 A;  4U7B A;  2A6H F;  1DP7 P;  4BE1 A;  4HF1 A;  1H0M A;  5D8K B;  3ZP5 A;  3H3Z A;  1HW1 A;  5F0F A;  3OS1 A;  3WE3 A;  1TQI A;  2K86 A;  4YII A;  3K1N A;  2FA5 A;  2ZSH B;  3DWL E;  5HOO A;  3WTU C;  5IT3 A;  2JJ7 A;  1ZYR F;  4YFN F;  1BN5 A;  1XMK A;  5J6X A;  1BR4 A;  4L5E A;  1IRX A;  1LUJ B;  1KQ8 A;  1YHQ I;  3A0H C;  3RDI A;  3ABU A;  2V1X A;  1MZB A;  3V8K A;  1DGW Y;  1LVK A;  5BQT A;  4DBR A;  2LMD A;  1G2H A;  3HB9 A;  1J59 A;  3I71 A;  3TL4 X;  2UV1 A;  5GPA A;  1DPU A;  3CC2 I;  4LK0 F;  5K7Z A;  3CMA I;  1ZKG A;  3PIP F;  2XB5 A;  1L3L A;  2RNJ A;  2X6X A;  1V5E A;  3D0S A;  4FAS D;  3F72 A;  3T0Y A;  4BQO A;  3VOD A;  2K02 A;  2VJ4 A;  2C6Y A;  1T95 A;  4WXC A;  1MBK A;  3UKG A;  3E0J B;  2VE9 A;  4KIT B;  5E20 A;  4QPQ A;  5LGT A;  3F8M A;  3E7L A;  2HZD A;  2XAH A;  4GCV A;  5ICE A;  4RLQ A;  2OUM A;  3KCC A;  3QAH A;  3FMS A;  4LJZ F;  1VQN I;  2OCC H;  2LOO A;  4KIG A;  1ZG5 A;  1ETK A;  2YX7 A;  1U78 A;  2IBD A;  2LKS A;  3GTO J;  5C4X J;  3P5J A;  2VKH A;  3L2W A;  2W85 A;  2W4S A;  4CZZ A;  4A3B J;  4KIB A;  3I56 I;  2O6G E;  1D0Y A;  1BA5 A;  1M1E B;  2PJR B;  4IO9 F;  2XAG A;  5CVV A;  4OMZ A;  1U2W A;  2CQK A;  2H09 A;  4CCN A;  2KL4 A;  3FM3 A;  1WJF A;  3K7A J;  4MLO A;  2F4I A;  1S7A A;  2CFX A;  1ZGA A;  4U7D A;  1BJA A;  4OU0 A;  4EQQ A;  2X4H A;  1MSE C;  5ED4 A;  1QRY A;  4NC6 A;  2ZNZ A;  5FKK A;  5IP9 J;  3Q5F A;  4ENJ A;  1LPQ A;  2KKO A;  3AG2 H;  1LNW A;  1UMQ A;  3G4S I;  4CO8 A;  5DCF A;  5EG0 A;  3H5R A;  3J7A Y;  1SD7 A;  2CU7 A;  4D5F A;  4KNY A;  1CF7 A;  2QBY A;  5FFX A;  3S1N J;  5HNF A;  4ESF A;  4G12 A;  2BYV E;  1FZP B;  2QLZ A;  1HCR A;  3BTI A;  2FNA A;  3B02 A;  3LSH A;  3QYF A;  4A0Y A;  3WTZ A;  1I1G A;  1U8R A;  2CUE A;  2A6E F;  3WTS C;  3ASN H;  4I09 A;  2HVQ A;  1GXP A;  3MFK A;  3F23 A;  3S1R J;  3FXK A;  3C2B A;  3K1M A;  3IH4 A;  3U2R A;  2MSY A;  3M9A A;  2E1N A;  4HX8 A;  5EJC A;  4L0Y B;  1XS9 A;  5K7F A;  3M07 A;  4Y3O A;  2V1U A;  3E6B A;  5J1U A;  3HZJ A;  5GPC A;  4LLN A;  5DUI A;  3FK6 A;  4BJ5 C;  3DLL F;  2Y48 A;  3HOV J;  1MND A;  2DW4 A;  4LB5 A;  2HTS A;  4UNO A;  2OPT A;  4ZZD A;  1T2K A;  3S1Q J;  3BCB A;  2HXO A;  2FBH A;  2IS6 A;  1GDT A;  4A12 A;  4B1R A;  2OTJ I;  2XRO A;  2M30 A;  3CCM I;  4NNJ A;  1YYV A;  2L4A A;  3CZ6 A;  2RVC A;  4E6K G;  1OCP A;  1D0Z A;  4RGR A;  3JTH A;  3S3M A;  1XCB A;  2VJI A;  5E17 F;  4CUG A;  5EZG A;  2NAZ A;  2DLL A;  3VYS B;  1EA3 A;  2YR2 A;  2P0W A;  3PQK A;  5HLT A;  1SC7 A;  3WGG A;  1HF0 A;  4A5M A;  1O7F A;  2DMQ A;  2P81 A;  3E5U A;  3H5N A;  3ZMS A;  3BPV A;  2VKE A;  5EZH A;  4DQ2 A;  3ZGK A;  2DPD A;  1ZAR A;  2MLG A;  3TQN A;  4ZC3 A;  3DTI A;  5IYD J;  1YRN B;  3BG9 A;  2VBZ A;  3CUQ C;  3IKT A;  4FE7 A;  1JTX A;  2DDB A;  3BZC A;  2R0Q C;  1PJR A;  4WXH A;  4RGX A;  4UB8 C;  2HDW A;  2JA8 J;  3S15 J;  4NC7 A;  2MW8 A;  5EGO B;  2DFF A;  2M7B A;  1BC8 C;  3M7G A;  2QF7 A;  3E1S A;  2KP6 A;  3RTR A;  3IH3 A;  4UVB A;  2CG4 A;  1OR7 A;  2X85 A;  1EKE A;  5CLS A;  5DYM A;  1U6G A;  3EUA A;  2OAZ A;  2R5Y B;  4K2E A;  3IP4 B;  2WY8 Q;  3C7J A;  1O3S A;  2QSG X;  2DMP A;  3ZQF A;  3FBN B;  4QLC U;  1IW7 F;  1IN5 A;  1MMS A;  2O03 A;  4M3G A;  2V9V A;  2VQG A;  4B3X A;  4BAC A;  1HDD C;  2CH0 A;  1T6S A;  2LY1 A;  3J81 K;  2L7M P;  3WTT C;  1O57 A;  1Z91 A;  5BPD A;  3M3Y J;  2HOA A;  4BH9 A;  3TDZ C;  2GM4 A;  2CWE A;  5ILU A;  4MFE A;  1VQO I;  3R6S A;  1PUE E;  5HS9 A;  3QPT A;  5DS9 A;  4E70 A;  4X0G A;  3MMY B;  2ZXI A;  3WG9 A;  2EZK A;  2EIM H;  2FOK A;  1TNS A;  3TOB A;  3OYL A;  1S7E A;  2FD5 A;  4CYC A;  2ICW G;  4UUS A;  1T0F C;  1XDU A;  3FXM A;  4C2M J;  2FXA A;  2Y75 A;  3KYC B;  2HDC A;  1I3Q J;  3ZRG A;  3BRO A;  2XDV A;  3GLL A;  1FTZ A;  4HEA 2;  2R7X A;  3TO7 A;  2Z3Y A;  2H8W A;  2R7T A;  5EEA A; 
#chains in the Genus database with same CATH homology
 3ULQ B;  4D0P A;  4ENM A;  2K7L A;  3W6K B;  1USS A;  4RGU A;  3KP7 A;  1Z6T A;  4L5I A;  2CYY A;  2ISY A;  1J75 A;  3F6O A;  3FM5 A;  2QQB A;  4G6D A;  4L9V A;  1TBX A;  5L3F A;  1OYI A;  4BHC A;  1XGS A;  1ZAO A;  5H20 A;  1GXQ A;  3KP5 A;  1BC7 C;  3WE2 A;  1F4K A;  5HLG A;  1JGS A;  4I02 A;  1PP8 F;  4BQA A;  1WKM A;  1MKM A;  4L5J A;  2KJB A;  5BMZ A;  5CJ9 A;  3J80 Z;  4GYI A;  3F8C A;  3K0L A;  2O3F A;  3RYR A;  2JRT A;  2OQR A;  3SZP A;  3R4K A;  1SAX A;  2XHK A;  2P8T A;  2D2W A;  1S3J A;  2QBY B;  3HRS A;  1ZG3 A;  3QU3 A;  3ZMV A;  2IW5 A;  1BI3 A;  4PZJ A;  1VTN C;  2JSC A;  2O61 A;  1S8N A;  1W5S A;  2FEZ A;  2L3D A;  3QPH A;  3EQL F;  4RAZ A;  3EYY A;  2IJL A;  4AIK A;  2VC1 A;  1H9T A;  3V4G A;  1ON1 A;  2FF4 A;  1UHW A;  4JBA A;  2UWM A;  3GFM A;  3R0A A;  1IAW A;  5L3G A;  4Q4Z F;  5AIP A;  1GHC A;  3L00 A;  1ZHF A;  2P5L C;  1F9N A;  3FXQ A;  2OU2 A;  2MBF A;  1S7O A;  2HKX A;  3T8R A;  1DPR A;  4EGZ A;  4LD5 A;  2ZXJ A;  3V7S A;  1U5T B;  5EEG A;  3WTV C;  5D4S A;  4OIN F;  2VOP A;  5FGM A;  4KN4 X;  1P6R A;  4IRG A;  3E97 A;  5CVR A;  2Q0O A;  4JQF A;  3V7R A;  1K78 B;  2FBI A;  2XAJ A;  5E1Z B;  1SMT A;  2ZCW A;  5DCM A;  4KFC A;  4MQ9 F;  1UST A;  1QPM A;  4A5N A;  2QM3 A;  1I6X A;  3M1E A;  4R1H A;  4BHB A;  4IRH A;  1Z05 A;  4G7O F;  1BOA A;  2H6B A;  4B09 A;  3I58 A;  1YQA A;  2ZJ2 A;  1BIB A;  4A6E A;  5H6Q A;  4O3M A;  3WTY C;  3L7W A;  3AAF A;  3SXY A;  5HDK A;  3M8F A;  2A61 A;  1FNN A;  1TTY A;  1HXD A;  3HRT A;  5L3B A;  4YFX F;  3MCZ A;  1ZRD A;  4L9T A;  2VC0 A;  2UXN A;  5JFR A;  2HS5 A;  3MZY A;  2FRH A;  2M45 A;  4CHU A;  3H92 A;  3ROU A;  4HW0 A;  2NS0 A;  3V7C A;  2EFW A;  3P9I A;  2GWR A;  4G94 A;  2J5O A;  4Q47 A;  5JR3 A;  3JAM Z;  5LEJ A;  1P4X A;  2EFN A;  2Z5U A;  3HTS B;  2O8X A;  2E7W A;  2LNB A;  1W4M A;  2MH2 A;  3RYP A;  3GF2 A;  1E17 A;  4CYD A;  4RAY A;  2V1D A;  1ULY A;  3GFJ A;  2HKO A;  1R1V A;  2ETH A;  1SFU A;  1WRJ A;  2YU3 A;  4ZYH A;  2E1C A;  2MA3 A;  3FMR A;  3WGI A;  3K9T A;  1YFH A;  4YIF A;  4M9S A;  5H6R A;  4ENK A;  1RUN A;  3ERE D;  1G3S A;  2OQG A;  1K79 A;  1R5G A;  4KDP A;  2F5D A;  3DV8 A;  1HKQ A;  2G7H A;  2VOO A;  3CUQ A;  1FYM A;  2XIG A;  3VOE A;  3BJA A;  2JZY A;  3G3Z A;  1LQ1 A;  2V79 A;  3TOA A;  1U5T C;  4I98 B;  3PFI A;  4ENN A;  1RI7 A;  2RC4 A;  2ZBK A;  4OOI A;  3O3K A;  3Q9S A;  3F8B A;  3NEU A;  1XMA A;  2HTJ A;  2JPB A;  5E1X A;  2M5W A;  4HF0 A;  4A6D A;  3E6M A;  2LKP A;  4IVN A;  5D4R A;  1Z9C A;  3KP4 A;  4M74 A;  1P4W A;  1FYL A;  2Z33 A;  3H3U A;  1SD4 A;  4IXA A;  2JT1 A;  4L0Z B;  1IXC A;  3RI4 A;  3M8E A;  3U1D A;  1XDS A;  4DNC A;  3T1B A;  3DPT A;  2KIU A;  2GZW A;  4WXD A;  4EM0 B;  2PLY A;  2GAU A;  2DU9 A;  4WK8 F;  2MH9 A;  3FXR A;  3BOQ A;  1RIO H;  1W7P A;  3RKW A;  5ILS A;  5HS8 A;  4HV6 A;  2BBY A;  1DUX C;  2Z9O A;  4KIC A;  4IJA A;  4KUM A;  5E8G A;  1MJ9 A;  3R60 A;  2R3S A;  4RS8 A;  2NNY A;  2L4M A;  1FBS A;  1FOK A;  2ZNY A;  4MGR A;  1TW2 A;  2MD5 A;  1QBJ A;  1R58 A;  3ZN0 A;  5DEQ A;  3MEX A;  4XRF A;  1EH7 A;  4QWQ A;  3LQR A;  5K5Q A;  1IN4 A;  4NQW A;  1IRG A;  3QRF F;  1O7L A;  1IN6 A;  4B8X A;  3DPL C;  4Q48 A;  4RGS A;  2OZU A;  4CIC A;  2GQQ A;  1Q1H A;  2ESH A;  4UUV A;  2VT2 A;  3I5U A;  4M73 A;  4XLP F;  2G9W A;  5L3C A;  4LLG F;  1FX7 A;  4AWX B;  1KU9 A;  4UHT A;  2BGC A;  4N9H A;  3FWE A;  3ZN1 A;  4F7Z A;  3IWZ A;  3LA7 A;  2HYG D;  1QZY A;  4EM1 A;  3KP3 A;  3ABT A;  2ZME B;  2EV5 A;  3KLN A;  5HLI A;  3DQV C;  3FX3 A;  5FLX Z;  2VE8 A;  1YS7 A;  2P6S A;  3TO6 A;  3FZV A;  2ADU A;  3LAJ A;  3L09 A;  5F6F A;  4EGY A;  3HOT A;  4P96 A;  3K1P A;  4EMS A;  3LQQ A;  5ICC A;  1R1U A;  2H27 A;  3ZQ7 A;  2D1V A;  3WTW C;  3CO6 C;  2PFB A;  5LRS A;  3C3W A;  2EV0 A;  2GA1 A;  3SHF A;  2DBB A;  4HOB A;  4A0Z A;  3IWF A;  3P7N A;  2VOD A;  4EJT A;  3J7A O;  2X0L A;  3J80 K;  3P9C A;  2EFO A;  4Y15 A;  3BJ6 A;  2H6C A;  2COM A;  4HDV A;  2K4J A;  3TKY A;  2WC2 A;  4KMF A;  3QP6 A;  1FLI A;  2NYX A;  3KP2 A;  1SFE A;  2F5F A;  4LMY A;  1AWC A;  4LG0 A;  3I0T A;  1I1S A;  5K5O A;  1OKR A;  3BP8 A;  2IA1 A;  3HRU A;  5A2Q Z;  4P55 A;  4RB2 C;  3REO A;  4XSX F;  3CLO A;  2DT5 A;  4S05 A;  4I01 A;  3DKW A;  1HKT A;  2L02 A;  3HHH A;  4IF4 A;  3KLO A;  3GZ5 A;  3I64 A;  1TLH B;  5LHI A;  2XKP A;  3GXO A;  3NQO A;  4GXO A;  4AVP A;  4M71 A;  3KE2 A;  2EA4 A;  5ERI A;  2VBX A;  4HAM A;  4I2O A;  2A3S A;  1ONV A;  3LWF A;  5ICG A;  3SQN A;  1G3Y A;  1Y0U A;  4LFU A;  3SFZ A;  1ZRE A;  1IXS B;  3VFZ A;  2HR3 A;  2RN7 A;  4LLL A;  2Q2E A;  1YW8 A;  1EH8 A;  1KA8 A;  2F2E A;  1XN7 A;  1IZ1 A;  4BNC A;  3C18 A;  5KK1 A;  1UFM A;  2EA2 A;  2XAF A;  4UV9 A;  4A2U A;  3L9F A;  3L2C A;  2MLK A;  4XLN F;  2STT A;  3QU6 A;  1K6O A;  1FC3 A;  1ZRF A;  2GIV A;  5HDG A;  1ZN2 A;  2TDX A;  1D8K A;  2HGC A;  1IRF A;  1H9G A;  1R22 A;  5FFZ A;  3BZ6 A;  1F5T A;  3FMQ A;  4CGZ A;  2IRF G;  5FO5 A;  2QZ8 A;  2FSW A;  2KRF A;  4WF2 A;  1XGM A;  4N9I A;  2FNP A;  4BAY A;  5JI6 A;  1SD5 A;  3T8T A;  3I59 A;  1J2X A;  3P9K A;  4I0A A;  3RIR A;  4A0X A;  3DP7 A;  2LDU A;  4O6J A;  2O0Y A;  1SD6 A;  3O6B B;  2PBI A;  4MEX F;  1OYY A;  4GO1 A;  5LGN A;  1T0F A;  1UHM A;  2PMU A;  1XCV A;  4M72 A;  4PDK A;  3BPX A;  2CGP A;  1I27 A;  1Z7U A;  2WV0 A;  4HX4 A;  1ZLK A;  1TQP A;  2DTR A;  3KZZ A;  2J5P A;  4HQM A;  2EB7 A;  2NRA C;  4ETS A;  4RB1 A;  3LA2 A;  2JTV A;  1B9M A;  5J8F A;  2M1B A;  4MTE A;  4ZZL A;  5D5W B;  3WU1 B;  2FBK A;  4BYY A;  4ZH4 F;  3KET A;  4MTD A;  2L01 A;  1W5T A;  5DD4 A;  5L3D A;  1KQ9 A;  2STW A;  2XGX A;  1CF7 B;  3V8J A;  4WCG A;  4M6X A;  3C1D A;  3K2Z A;  1ODD A;  3E6C C;  2D45 A;  2VBY A;  3HOS A;  3J81 Z;  1ZH5 A;  1HST A;  4MQV A;  5AON A;  1RNL A;  2PEX A;  1NHA A;  2DO7 A;  3KEO A;  3CDH A;  1FP1 D;  1OPC A;  4P9F A;  1ZGJ A;  1FY7 A;  5IT9 Z;  4L9N A;  1QGP A;  3ZMT A;  5HDN A;  1BIA A;  1OYW A;  2QUF A;  4AIJ A;  1X3U A;  2YX4 A;  1B6A A;  1LDK B;  1R23 A;  4MHG A;  2QYO A;  3K69 A;  1ZLJ A;  4Y17 A;  1FBQ A;  2OA4 A;  3G73 A;  4ESB A;  4HLX A;  3IC7 A;  5LEK A;  3IL2 A;  5E8I A;  2IP2 A;  5E1W A;  1AOY A;  3QP5 A;  4GGG A;  4IHS A;  2P5V A;  1P92 A;  3FF5 A;  4G9Y A;  1XB4 A;  5CVJ A;  5D6F A;  1KYW A;  4LK1 F;  1TW3 A;  3QOP A;  4KN7 X;  2FE3 A;  1W7P D;  4KA4 A;  3GZ6 A;  1FBU A;  1FWZ A;  1KQ0 A;  3GEZ A;  1IN7 A;  2EFP A;  1WQ2 A;  2DPU A;  5LHG A;  4Q5S F;  3RKX A;  4FX4 A;  4G7H F;  4OMY A;  2ZKZ A;  2DFI A;  1C0W A;  2VT3 A;  1LEA A;  1FYK A;  3SZT A;  3ZPL A;  4FHT A;  4JK1 X;  1KGS A;  1R7J A;  5D6E A;  5L3E A;  2HEO A;  5DCM B;  3IRQ A;  3I59 B;  4RB0 A;  4XSZ F;  4Z2Y A;  3JTG A;  2FQ3 A;  1E2X A;  4HA8 A;  5BPI A;  2IPQ X;  4IPA A;  3JSP A;  2LF8 A;  3U9G A;  3EUH A;  2BE5 F;  1EH6 A;  4LG0 B;  3RKY A;  4LB6 B;  3I4P A;  5HLH A;  2DK5 A;  4G7Z F;  5E18 F;  4ZYD A;  4KT5 C;  1SFX A;  1W7P B;  5JVT A;  2UZK A;  4HDU A;  5TRD A;  3F21 A;  1T38 A;  4EV0 A;  2R7D A;  5LBQ A;  4KYW A;  4HLY A;  3R0J A;  2HOE A;  4U88 A;  5D5U B;  3E5X A;  1D3Y A;  1LEB A;  5CVI A;  2PG4 A;  2KIF A;  4XBF A;  3ZMU A;  2OD5 A;  3BDD A;  3LAP A;  2XV4 S;  1FPQ A;  1V3F A;  3HRM A;  2ZME A;  3OV8 A;  2IA0 A;  1HQC A;  1YW9 A;  2JPC A;  4FT8 A;  2IVM A;  1U5T A;  3GO5 A;  5F64 A;  1XD7 A;  3LST A;  4G8X A;  4IHT A;  5J8C A;  4NHJ A;  4ZYE A;  1B1B A;  2FU4 A;  4CXF A;  1D8J A;  1MD0 A;  1J9I A;  3V8L A;  1T39 A;  4M9Z A;  3IHU A;  5FD5 A;  4HV5 A;  4HBL A;  1U3E M;  2A5Y B;  2MC3 A;  2VON A;  4PGG A;  3ZMZ A;  1XSD A;  3ECO A;  2RKH A;  2W24 A;  3CUO A;  2IT0 A;  4HF2 A;  3WTX C;  3F8F A;  1R00 A;  4RB3 C;  4UVA A;  2EFQ A;  2LF7 A;  3S2W A;  4KIF A;  3KFW X;  2CO5 A;  4GYG A;  1S6L A;  5KVR A;  4U0V A;  3D5L A;  1BM9 A;  2AXL A;  1YS6 A;  2OBP A;  4NB5 A;  2OZ6 A;  3JAM K;  4KMU X;  3HUG A;  1XGN A;  5CYV A;  4M9X A;  3FHZ A;  4ASN A;  1FP2 A;  1JHF A;  2Y0M A;  4LGW A;  4TV7 A;  1IN8 A;  1A04 A;  3F8N A;  1YO5 C;  4PCQ A;  1JXS A;  3DFG A;  2P5K A;  1HW2 A;  4PGH A;  1UB9 A;  1ON2 A;  2VN2 A;  4ZYG A;  4EVI A;  1YLF A;  5A2Q K;  3TGN A;  5D8L B;  3KZY A;  5CVU A;  1XSV A;  1K7A A;  5HVQ C;  1IF1 A;  2ZFW A;  3HHG A;  2LSO A;  1R1T A;  4EJW A;  1T98 A;  2DI3 A;  4IRI A;  2PJP A;  3B73 A;  2WTE A;  5D5V B;  3CTA A;  1DDN A;  3R61 A;  2D1H A;  2HQR A;  4AD9 A;  3BY6 A;  2CW0 F;  1O3T A;  3ML6 A;  1J7K A;  3EET A;  4FX0 A;  3E3V A;  3HSR A;  4AIH A;  1PDN C;  1KU7 A;  2HFH A;  1OMI A;  1XGO A;  2F5C A;  2ESN A;  2WWY A;  3GWZ A;  2PMH A;  1D5V A;  2DAO A;  1R5H A;  3HIF A;  3Q9V A;  4U0W A;  4OIO F;  2DQR A;  4OIR F;  3N97 A;  2P7V B;  4EM2 A;  4HQE A;  1QO0 D;  6PAX A;  1S29 A;  2P4W A;  2ELH A;  4YG2 F;  2W57 A;  1ZRC A;  3LA3 A;  2DQL A;  2P7C B;  3JW4 A;  3GW2 A;  5ICF A;  1QZZ A;  1KU3 A;  2GXG A;  3IKV A;  2QEN A;  3E6D A;  1WSU A;  4HYE A;  3GFL A;  3WU0 A;  3RPQ A;  1WI9 A;  2HYF A;  5LRR A;  3WGH A;  4P5O A;  1YTY A;  3DEU A;  2BV6 A;  2A69 F;  2QQA A;  2A07 F;  5BS6 A;  1TQM A;  1YG2 A;  1MDM A;  3BJO A;  3FXU A;  3BWG A;  4U0Y A;  2VXZ A;  1HKS A;  1GVJ A;  5LLQ A;  5BOX A;  2NNN A;  1QQI A;  1YIO A;  1SMY F;  4OIP F;  1B4A A;  3CJN A;  4L9J A;  2Q8K A;  3OOP A;  1L0O C;  1J5Y A;  1K78 A;  1IXR C;  4P9U A;  1V4R A;  2PQ8 A;  1Z6R A;  5FD6 A;  4OIQ F;  4CDG A;  2FMY A;  2FML A;  5AIQ A;  1RZ4 A;  3HYI A;  1LDJ A;  2UXX A;  4HX7 A;  5ILV A;  2M87 A;  1P2F A;  1BI2 A;  1WWX A;  3I54 A;  3DF8 A;  2KJC A;  2ACJ A;  4YFK F;  1JE8 A;  4EJU A;  2RV8 A;  1QNT A;  5DD8 A;  1STZ A;  2ISZ A;  1G4D A;  2HQN A;  1BBY A;  1G6N A;  4ESJ A;  3EYI A;  4BXU A;  1R36 A;  2KIM A;  4WX9 A;  2XRN A;  3IRR A;  1LDD A;  1TNT A;  1MGT A;  1JHH A;  4HZF A;  3HTU A;  2Z99 A;  4I7H A;  1LB2 A;  2YPR A;  3RPU A;  4R79 A;  5TJJ A;  2R7F A;  1O3R A;  3GYH X;  2AS5 F;  5K5R A;  3ELK A;  1BI1 A;  3HSE A;  3TO9 A;  1KYZ A;  3O2P E;  1EV7 A;  5LHH A;  1YW7 A;  2EK5 A;  2GXB A;  1REP C;  2E7X A;  3VB2 A;  5D5X B;  3KEQ A;  5LGU A;  2HZT A;  1B59 A;  1MJB A;  3PQJ A;  3T5X A;  5HS7 A;  1BI0 A;  2XKO A;  4EJV A;  5JHU A;  1G3T A;  1PP7 U;  2P6T A;  2XUB A;  2W25 A;  2XAQ A;  1Z1D A;  3GLX A;  5IT9 K;  2XAS A;  3CO7 C;  1LVA A;  3MZH A;  1P4A A;  4ON0 A;  4O5V A;  1HW5 A;  5DDG A;  3MQ0 A;  3LFK A;  1HBX G;  4EJO A;  4MNU A;  4M6Y A;  3GX4 X;  2HWV A;  3ZMD A;  1XSX A;  1RUO A;  5DV5 A;  3N4M A;  1HSJ A;  3ISP A;  4WWC A;  1ZG1 A;  2EJR A;  2K4B A;  1J0R A;  4UVC A;  3I53 A;  5FB2 A;  4R8H A;  3COA C;  4S04 A;  4UXN A;  1IUY A;  2PI0 A;  2M8E A;  3RJP A;  1FSE A;  2L54 A;  4I0B A;  3TDU C;  2A68 F;  2PN6 A;  3ECH A;  2F5E A;  3WOD F;  2K27 A;  3W6J B;  4H0E A;  2H94 A;  3DXJ F;  5FLX K;  1B9N A;  3MWM A;  3E5Q A;  4N0B A;  2CSO A;  1KU2 A;  2VBW A;  3F6V A;  1FT9 A;  1I5Z A;  3NRV A;  2RDP A;  1MJA A;  1F1Z A;  1G3W A;  2V6C A;  2GA2 A;  2BEO A;  3MAJ A;  1FSH A;  3HSF A;  2YSR A;  5K1Y A;  1UCR A;  2B0L A;  2EWN A;  2IA2 A;  3VEP A;  4G6Q A;  3GFI A;  3JSO A;  2G7U A;  2QWW A;  2RQP A;  2QQ9 A;  2W84 A;  2RGV A;  3EDP A;  3CUQ B;  4BHP A;  2XVC A;  3GVA A;  3F22 A;  1LJ9 A;  1O3Q A;  5F1R A;  1CGP A;  5DUK A;  4MEY F;  3KP6 A;  3GUD A;  3F3X A;  2QVO A;  5EEH A;  4L18 B;  1MDM B;  4UV8 A;  4Y13 A;  2DK8 A;  2ZO4 A;  2EV6 A;  1DP7 P;  2A6H F;  4U7B A;  4HF1 A;  1H0M A;  5D8K B;  3ZP5 A;  3H3Z A;  1HW1 A;  3WE3 A;  1TQI A;  2K86 A;  4YII A;  3K1N A;  2FA5 A;  5HOO A;  3WTU C;  5IT3 A;  1ZYR F;  4YFN F;  1BN5 A;  1XMK A;  5J6X A;  1KQ8 A;  3RDI A;  3ABU A;  2V1X A;  1MZB A;  3V8K A;  5BQT A;  1J59 A;  3I71 A;  1DPU A;  4LK0 F;  1L3L A;  2RNJ A;  3D0S A;  3F72 A;  3T0Y A;  3VOD A;  2K02 A;  2C6Y A;  4WXC A;  2VE9 A;  5E20 A;  5LGT A;  3F8M A;  2XAH A;  4GCV A;  5ICE A;  3KCC A;  3QAH A;  3FMS A;  4LJZ F;  4KIG A;  1ZG5 A;  2YX7 A;  1U78 A;  2W85 A;  4CZZ A;  4KIB A;  2O6G E;  2XAG A;  5CVV A;  4OMZ A;  1U2W A;  2CQK A;  2H09 A;  3FM3 A;  1S7A A;  2CFX A;  1ZGA A;  4U7D A;  1BJA A;  4OU0 A;  4EQQ A;  2X4H A;  5ED4 A;  2ZNZ A;  3Q5F A;  4ENJ A;  2KKO A;  1LNW A;  4CO8 A;  5DCF A;  1SD7 A;  4KNY A;  1CF7 A;  2QBY A;  5FFX A;  4ESF A;  1FZP B;  2BYV E;  2QLZ A;  2FNA A;  3B02 A;  1U8R A;  4A0Y A;  3WTZ A;  1I1G A;  2A6E F;  3WTS C;  4I09 A;  1GXP A;  3MFK A;  3F23 A;  3K1M A;  3U2R A;  3M9A A;  2E1N A;  4HX8 A;  4L0Y B;  2V1U A;  3E6B A;  4LLN A;  5DUI A;  2Y48 A;  2DW4 A;  4LB5 A;  2HTS A;  4UNO A;  4ZZD A;  1T2K A;  2FBH A;  4A12 A;  2XRO A;  2M30 A;  1YYV A;  2L4A A;  2RVC A;  4RGR A;  3JTH A;  1XCB A;  5E17 F;  2NAZ A;  2DLL A;  2YR2 A;  3PQK A;  3WGG A;  4A5M A;  1O7F A;  3E5U A;  3ZMS A;  3BPV A;  4DQ2 A;  2DPD A;  1ZAR A;  2MLG A;  3TQN A;  2VBZ A;  3CUQ C;  3IKT A;  4WXH A;  4RGX A;  1BC8 C;  3M7G A;  3RTR A;  4UVB A;  2CG4 A;  1OR7 A;  5CLS A;  5DYM A;  1U6G A;  2OAZ A;  4K2E A;  3C7J A;  1O3S A;  4QLC U;  1IW7 F;  1IN5 A;  2O03 A;  2V9V A;  1T6S A;  3J81 K;  3WTT C;  1O57 A;  1Z91 A;  5BPD A;  4BH9 A;  3TDZ C;  2CWE A;  5ILU A;  3R6S A;  1PUE E;  5HS9 A;  3QPT A;  4E70 A;  3WG9 A;  2FOK A;  1TNS A;  3TOB A;  1XDU A;  2FXA A;  2Y75 A;  2HDC A;  3BRO A;  3TO7 A;  2Z3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...