2XV4S

Structure of human rpc62 (partial)
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
532
structure length
399
Chain Sequence
MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETTMDYAEVSNTFVRLADTHFVQRCPSIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKGMYVINLHKALASLATATLESVVQERFGSRCARIFRLVLQRTFYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE III SUBUNIT RPC3
publication title Structure-Function Analysis of Hrpc62 Provides Insights Into RNA Polymerase III Transcription
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 150
structure length 399
sequence length 532
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF05645 RNA_pol_Rpc82 RNA polymerase III subunit RPC82
S PF08221 HTH_9 RNA polymerase III subunit RPC82 helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S03
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xv4S04
1WWXA 4MNUA 2D2WA 3HTSB 3TQNA 3WGIA 2A68F 4G9YA 3F8NA 4EM1A 3GWZA 3TO6A 3FX3A 1YG2A 1E2XA 1BBYA 4XBFA 1B9MA 1IN5A 1MKMA 1WQ2A 2MC3A 3KEQA 3OOPA 5LGTA 4UV8A 1XN7A 2AXLA 1EH6A 1IF1A 2XASA 1ONVA 1BN5A 3FXUA 4IHTA 1UCRA 1FPQA 3WGGA 2VXZA 2ZMEA 3NRVA 2QBYB 3E6CC 3FMSA 1SFUA 1L0OC 2V1XA 4BQAA 3QP5A 4HF2A 4N9IA 3HRTA 1LDKB 3GUDA 1QZYA 2FNAA 3I71A 1XSXA 3BY6A 1D8KA 1I27A 4U0YA 3M7GA 4G7ZF 2OAZA 4ENMA 2LDUA 3BWGA 4RB1A 1BI2A 2FMLA 4DNCA 1XDSA 1WSUA 3BJOA 1I1GA 1O3QA 4HF0A 1V3FA 2XIGA 4AIKA 3F8BA 4FHTA 3CO7C 1HKSA 5IT9Z 3M8FA 2IA1A 3EDPA 5ICEA 4HV5A 4CDGA 1TQPA 2PQ8A 3R60A 2ZNZA 2FBHA 4AWXB 2HEOA 5AIPA 2Q0OA 3KP6A 2V6CA 4HW0A 2E1NA 3D5LA 2H6CA 1HKQA 1QPMA 2L3DA 1EV7A 3R0JA 1WI9A 3ML6A 2CGPA 3KEOA 1PP8F 5HVQC 4IRIA 2O0YA 1PP7U 5L3DA 2DK5A 3I5UA 2FU4A 3F21A 5BPIA 4HX8A 4RAYA 3QU3A 1MDMA 1ZH5A 5K5RA 1J5YA 3V7RA 1XSDA 1YFHA 3HRSA 3RYPA 4U7DA 4ESJA 3C1DA 2LF8A 4WK8F 3I64A 4U7BA 5E17F 2EFQA 3G3ZA 3ROUA 3IRQA 4UXNA 3RKYA 3DQVC 4EJVA 1P6RA 3U2RA 2JPCA 1SD6A 3MWMA 2BYVE 2AS5F 1Y0UA 2GA1A 2P4WA 1U5TA 4I0AA 1G3SA 2BE5F 3WG9A 3H92A 4A0XA 3GX4X 2VC1A 4M72A 1Z7UA 2WV0A 5FFZA 2HYFA 1OYWA 3CDHA 5A2QK 1FSHA 2H27A 2K02A 2DBBA 4HDVA 4M6YA 4NHJA 4G7HF 3RDIA 4EGZA 5BMZA 3VFZA 1IUYA 1S8NA 3H3UA 4CHUA 3P9KA 4OMZA 2MLGA 2L4MA 3KETA 4FX0A 4HV6A 2NYXA 4RGSA 1XCVA 2RGVA 4BXUA 1LQ1A 3CUOA 3FXQA 2GA2A 1D3YA 5ILUA 3K9TA 1FWZA 3KE2A 1FX7A 5E1WA 5DCMA 1HW2A 1TLHB 2LNBA 1GHCA 1JHFA 1G6NA 5H20A 1YS6A 4PGGA 2DQLA 2VODA 2FSWA 4LLLA 1H9GA 2EV0A 2H94A 5CYVA 2DU9A 1QBJA 3LA2A 2IPQX 2XKOA 4I09A 3V7SA 1LJ9A 3W6KB 4CICA 4KFCA 4HZFA 1YS7A 2O03A 5E20A 3IL2A 4Y15A 2FBIA 2Z99A 4XSZF 3ZPLA 2K27A 1IW7F 4MEYF 4A6DA 1B59A 1ZLKA 1JGSA 1TQIA 4YFNF 2DPUA 2IA2A 4LLGF 1GXPA 1J7KA 5DYMA 5FD6A 3RTRA 1P92A 4GO1A 3WTXC 2OQRA 5E18F 1LDJA 2FF4A 4LGWA 4UVCA 3V7CA 4UVBA 5FLXK 3R0AA 1AOYA 1FT9A 1Z9CA 5FGMA 2EA2A 5L3BA 3V4GA 5F64A 1H9TA 3I59B 3CUQC 4L9VA 2HKXA 5HS7A 4HF1A 2ADUA 5DEQA 3FHZA 3V8JA 2W24A 1RIOH 3LA7A 4KIBA 3ZMVA 3MZHA 2HFHA 2ZMEB 5FB2A 1FBUA 5A2QZ 3I0TA 2ESHA 2EFWA 2BBYA 2P5KA 3KLNA 5DV5A 4BHPA 3M8EA 4XLPF 3LAPA 2ZXJA 2BV6A 4AIJA 4D0PA 3QU6A 4S05A 3R6SA 1FY7A 1Z05A 2UXXA 2HTSA 4GGGA 4KICA 2QVOA 1FYLA 1C0WA 2XAHA 4R8HA 4PZJA 1ZHFA 4OMYA 2XAQA 2NAZA 2RDPA 1SMYF 5F1RA 1B4AA 4UNOA 1Q1HA 2HQRA 1BOAA 2EK5A 2A6HF 2KIFA 1OPCA 4EM2A 4WWCA 4RGXA 3TDZC 3KP7A 3TOBA 1K78B 2EFPA 3HIFA 1A04A 1VTNC 4GXOA 3DFGA 1X3UA 3L9FA 3QAHA 5D5VB 3JAMK 3K1NA 3GYHX 5L3GA 2FOKA 3E5QA 4RGRA 1ZG3A 2FMYA 2ACJA 5E1XA 3OV8A 3T8RA 1K6OA 2CFXA 4I7HA 1T0FA 2G7HA 2HOEA 3GFJA 3L09A 4GYIA 1LB2A 3I58A 4XSXF 5FO5A 1K7AA 3DP7A 4GYGA 3U1DA 5K1YA 1KU3A 3WGHA 2JTVA 4QWQA 2Y75A 3P7NA 4BYYA 4HQMA 3WTSC 5FLXZ 1P4AA 2QQAA 3I54A 5BS6A 3JTGA 5DUIA 3CLOA 1KGSA 2RNJA 1FBQA 2V1UA 2FQ3A 3HRMA 4RAZA 5L3FA 2K4JA 3CTAA 3FF5A 5D4RA 1UHMA 2XGXA 4U0WA 3O6BB 4OU0A 4KN4X 1QZZA 1USTA 4LK0F 1ON2A 5D6FA 4G7OF 3QPHA 1T98A 1FC3A 2BEOA 5D5WB 2L54A 3EUHA 2NNYA 5JI6A 4IRHA 1IN7A 3F23A 2H6BA 3GO5A 3LFKA 3LQRA 2LKPA 3WTUC 3F72A 4HLYA 4YFXF 5JR3A 3ABUA 3ZMTA 5CVRA 5ILVA 3RPUA 4HA8A 2A3SA 2F2EA 4M71A 3FMQA 1KQ0A 4L9TA 1QQIA 3KCCA 1BM9A 3LA3A 1IRGA 2YPRA 3O3KA 4LJZF 1IN4A 4LB6B 3N4MA 2YSRA 1FSEA 4WXHA 3FM3A 2J5OA 5K5OA 1TW3A 5ILSA 1R22A 2STTA 2HDCA 2UZKA 5JHUA 1QO0D 1XGSA 2DK8A 1HW5A 1R1TA 3V8LA 3MFKA 5KVRA 3HHGA 4IF4A 2H09A 3DPTA 5ICGA 4N9HA 3DPLC 3JAMZ 2KKOA 2PG4A 1TBXA 3C7JA 3CUQB 1F4KA 2XUBA 4LG0A 5BQTA 3Q9SA 2R7FA 5EEGA 4H0EA 1SFXA 3H3ZA 2FXAA 2QQBA 2IA0A 4WCGA 5HLHA 4XRFA 2D1HA 2OZ6A 3WE3A 1KQ8A 1ZREA 1ODDA 3M9AA 4HLXA 5LEKA 2VT3A 3SFZA 4B8XA 2F5FA 1P4WA 3JW4A 2XAFA 3E5UA 3DF8A 1ZRCA 2Q8KA 1XGOA 3K1MA 4G6DA 2F5EA 2FRHA 3L00A 2A07F 1I5ZA 1JHHA 3C3WA 4I0BA 1HSJA 4MTDA 1MGTA 2YR2A 2L01A 4L0ZB 1F1ZA 3LQQA 4Q47A 2EB7A 1ZRFA 2VC0A 3JSPA 5DD4A 3T8TA 5DDGA 1UHWA 3MQ0A 1L3LA 4M6XA 1W7PB 1BC8C 2RVCA 3J80K 2QLZA 3QRFF 1GXQA 1IAWA 3HTUA 2PMUA 1AWCA 3SQNA 4ESBA 1K79A 2QENA 3CO6C 1BI0A 2GXGA 3JTHA 3VB2A 2PLYA 2EA4A 2JRTA 4UUVA 2CYYA 3BZ6A 1PDNC 2VE9A 1DDNA 2A5YB 2Z33A 4JK1X 5HDKA 1JXSA 2CSOA 2A61A 3HOSA 4U88A 3KP5A 4DQ2A 2EV5A 3HSRA 4RB0A 2OA4A 3F8FA 2HQNA 4IPAA 2IVMA 4AIHA 3RJPA 5ERIA 2R7DA 2QYOA 1H0MA 1O7LA 2MLKA 1HXDA 2MD5A 2V1DA 1J75A 3T5XA 2NS0A 3WTVC 1G3TA 4ASNA 3L7WA 1U3EM 3F8CA 1U8RA 2PI0A 4HAMA 4P9UA 3MZYA 2VBXA 1U5TC 4Q48A 1S7OA 2P7CB 2PMHA 4P9FA 2UWMA 3E5XA 3I4PA 2B0LA 2GAUA 1SD7A 3TGNA 1XMKA 1STZA 3BJAA 3D0SA 3BJ6A 4RB3C 4EV0A 4AVPA 2FE3A 2P5LC 4R79A 5D5XB 4A6EA 3HSFA 5ED4A 5LRSA 1KYZA 1B6AA 1YLFA 2CG4A 4M9XA 2JPBA 2E7XA 1U78A 3WE2A 4L9JA 5LGNA 3N97A 3T0YA 3O2PE 5IT3A 2QM3A 1BIAA 4P5OA 3DKWA 3J80Z 4YFKF 3GXOA 1W5TA 2V9VA 1F9NA 5H6QA 1R5GA 2YX4A 3L2CA 4BAYA 3S2WA 1RI7A 1YW8A 3I53A 4O6JA 4A2UA 3GFIA 1IXSB 3BP8A 3TKYA 3F6VA 4ZYEA 1LEAA 4NQWA 5EEHA 4OIPF 5CVUA 3TOAA 5D4SA 2X4HA 4K2EA 1RZ4A 1FNNA 1YIOA 4ENNA 3W6JB 3P9IA 5FFXA 5J6XA 3KP4A 3PQJA 3J81K 1U2WA 2PN6A 4WXDA 2WWYA 4OIQF 1TNTA 4Y13A 3DXJF 2EFOA 2X0LA 2XVCA 1R7JA 2F5CA 4EMSA 3ZMDA 1YTYA 1QNTA 1E17A 1J9IA 2ZJ2A 1CGPA 1Z6RA 2CWEA 1HKTA 2OZUA 1Z1DA 1USSA 1J59A 3ZMSA 5DD8A 1HSTA 1OYIA 2Z9OA 3QPTA 1JE8A 2XKPA 3GVAA 2GWRA 3IWZA 4MEXF 1BC7C 4EQQA 2PEXA 2W84A 4U0VA 3DV8A 3EYYA 1PUEE 1DPUA 3RI4A 2VE8A 3PQKA 1IXCA 4G94A 5TRDA 1ZRDA 2DPDA 1S29A 2QWWA 3GFMA 3HUGA 2UXNA 2ISZA 2VONA 4G6QA 4L9NA 3ABTA 4BNCA 3GLXA 2Y0MA 4MHGA 4OOIA 1P2FA 2ZBKA 2R3SA 4OIOF 1F5TA 3TO9A 1EH8A 3EETA 3F6OA 3KZYA 2O3FA 3HOTA 5HLGA 4QLCU 4ZYDA 3K2ZA 3WU0A 2ETHA 3ISPA 3ZP5A 1R00A 1IN8A 3CJNA 2DTRA 4GCVA 2PBIA 4G8XA 2P8TA 2VBYA 5E8GA 4B09A 4CYDA 1FZPB 3F22A 1ON1A 1SAXA 4LFUA 1P4XA 2A6EF 1T39A 1RUOA 3ZMZA 3K0LA 1LDDA 5LEJA 1XB4A 3GFLA 2P7VB 2MH2A 2YU3A 4HX4A 1KYWA 4ZYHA 1KA8A 1MDMB 4TV7A 1DP7P 4KIGA 1G3WA 1TNSA 2FNPA 3J81Z 1R1VA 2GZWA 3VEPA 4HBLA 2HZTA 5D8KB 2XV4S 1ZGAA 1ZGJA 1S6LA 1GVJA 2YX7A 3KFWX 1KU7A 3B02A 2KJCA 2NRAC 3E3VA 2RN7A 3BROA 3P9CA 4LD5A 1U5TB 1W4MA 1ZARA 3IHUA 3ZN1A 2VN2A 5D6EA 5LRRA 2DLLA 2OU2A 4IJAA 5BPDA 5HOOA 2MA3A 4XLNF 2PJPA 2KRFA 1QGPA 2FEZA 3BPVA 4KA4A 1YO5C 1TTYA 3LWFA 1DPRA 2NNNA 5TJJA 2O8XA 5J8CA 1O3SA 1U6GA 1RUNA 1TW2A 2PFBA 1TQMA 3ULQB 2LSOA 5DCMB 3VODA 3RPQA 3KP3A 2IJLA 1FP2A 2JSCA 4F7ZA 1IZ1A 3IRRA 3I59A 2XAJA 2HGCA 3E97A 2WC2A 4UVAA 5DUKA 2L4AA 1IRFA 1G3YA 5H6RA 3GZ5A 2VBWA 3SHFA 5L3EA 3ECOA 3FXRA 2QUFA 5E1ZB 2W25A 4KT5C 5HLIA 1CF7A 5DCFA 3WTWC 1XMAA 3GEZA 2GQQA 2P6TA 4ENJA 4JQFA 2M5WA 1R58A 1W5SA 2IRFG 2CO5A 4EJTA 4P55A 3COAC 3DEUA 3K69A 2BGCA 3HHHA 2ESNA 2KIUA 1BJAA 3R61A 4LK1F 2OBPA 2QQ9A 2DT5A 4M9SA 1FYKA 4RGUA 2HS5A 3LAJA 3EQLF 1R23A 4ZZDA 1YQAA 4UV9A 5CVVA 4KNYA 3WTYC 2VBZA 4I01A 4RS8A 1ZG1A 2VOPA 5K5QA 2C6YA 1R36A 3V8KA 4N0BA 3WTZA 1V4RA 1K78A 4ESFA 2V79A 2XAGA 3KP2A 4MQ9F 3M1EA 2RKHA 3KLOA 3U9GA 2D1VA 2GIVA 1O3RA 1ZLJA 5LBQA 1WKMA 4R1HA 3QP6A 2DQRA 4E70A 2RC4A 1OKRA 3GW2A 3BPXA 4EGYA 1SMTA 1W7PD 2EV6A 4ZH4F 3F8MA 4ENKA 2HWVA 2ZFWA 4HX7A 4IRGA 5FD5A 2ZNYA 3HYIA 4CO8A 2IW5A 1HQCA 3R4KA 3RKXA 4OIRF 1G4DA 4Y17A 4WXCA 3ECHA 4JBAA 1LVAA 3E6BA 3MCZA 1O3TA 5JFRA 3HSEA 1REPC 4RB2C 3EYIA 4Q5SF 4L5JA 2M30A 5HS9A 4A5MA 2L02A 3LSTA 1LEBA 2Z5UA 3MEXA 5CLSA 2K4BA 1FP1D 3E6DA 1BI3A 2XRNA 2ZCWA 2O6GE 1R1UA 4MTEA 2XHKA 4M73A 3BOQA 3MAJA 4A0YA 1EH7A 4IVNA 1XCBA 5J8FA 2STWA 4M74A 2IP2A 2ZKZA 4I2OA 4CGZA 2DAOA 5LHIA 4WF2A 3RYRA 3AAFA 1FOKA 2W85A 4HQEA 3IKTA 2VOOA 3REOA 1S3JA 1O7FA 4L18B 3ZQ7A 1FYMA 2EFNA 4KDPA 3FWEA 4O5VA 4AD9A 3HRUA 2IT0A 2W57A 4A12A 1MJBA 5D8LB 1J2XA 2RV8A 5D5UB 3IC7A 4KMUX 1ULYA 4Q4ZF 4M9ZA 3IKVA 1O57A 1J0RA 3SZPA 5L3CA 2OD5A 4Z2YA 3E6MA 3QOPA 4A5NA 2QBYA 2ELHA 2DW4A 1MJ9A 3GZ6A 5HDNA 2ZO4A 2J5PA 3GF2A 2M1BA 1ZYRF 4EVIA 2FBKA 2MH9A 2QZ8A 5F6FA 5LGUA 4O3MA 3CUQA 5ICCA 1KU9A 4NB5A 4BHBA 2JZYA 1SD5A 3Q9VA 5CVJA 1OYYA 1XGMA 1MZBA 3SZTA 3FMRA 4KIFA 4MGRA 2G9WA 2DI3A 3SXYA 2MBFA 1Z91A 1OMIA 1BI1A 4L5IA 3G73A 3WTTC 2LF7A 3VOEA 3RIRA 3C18A 5HS8A 2HR3A 3NQOA 4P96A 4LMYA 4PGHA 3K1PA 1HW1A 2HYGD 5LHGA 3BDDA 4IXAA 1D5VA 5LHHA 2K7LA 1B1BA 4PCQA 4ETSA 3TDUC 5KK1A 2D45A 4FX4A 4HYEA 1CF7B 3ELKA 1SFEA 1W7PA 3IWFA 2RQPA 4MQVA 2OQGA 1HBXG 2HKOA 4I02A 3T1BA 4LG0B 3ZN0A 1FLIA 5BOXA 2M45A 4EJWA 2M87A 4YIFA 1YW9A 1T2KA 4I98B 1IN6A 5LLQA 3F3XA 2HTJA 3FZVA 1SD4A 1IXRC 4BH9A 4CZZA 2VT2A 4IHSA 1UB9A 1I1SA 2EWNA 2WTEA 1T6SA 1I6XA 4ZYGA 2Q2EA 3WU1B 1FBSA 4HOBA 3NEUA 1Z6TA 5HDGA 4CXFA 2P6SA 4WX9A 4EM0B 4ZZLA 2FA5A 2O61A 4PDKA 4KUMA 1MJAA 2ISYA 1R5HA 4KN7X 5AIQA 1YW7A 4YIIA 1D8JA 1ZAOA 2G7UA 2KJBA 1UFMA 2KIMA 2EJRA 5CVIA 1XD7A 5JVTA 4FT8A 2CQKA 2A69F 1S7AA 1BIBA 4A0ZA 1MD0A 3FM5A 2K86A 1LNWA 1XDUA 1ZN2A 1B9NA 1YYVA 2Y48A 5CJ9A 2M8EA 3J7AO 3PFIA 2DO7A 4KYWA 2E7WA 1NHAA 5AONA 2CW0F 2TDXA 6PAXA 4BHCA 2F5DA 3ZMUA 3Q5FA 1DUXC 3RKWA 4UHTA 4OINF 2COMA 4HDUA 5IT9K 4S04A 3B73A 5ICFA 1WRJA 2E1CA 4KMFA 1T38A 3KZZA 3TO7A 1ZG5A 3JSOA 3ERED 1XSVA 2DFIA 5E8IA 4EJOA 4ON0A 4YG2F 4L0YB 2Z3YA 1OR7A 2GXBA 1XGNA 2JT1A 2XROA 4EJUA 2P5VA 1KU2A 4LLNA 4LB5A 3WODF 1KQ9A 1RNLA
chains in the Genus database with same CATH superfamily
4XN0A 2E36A 2K40A 1WWXA 3J7ZI 3A01B 3VYSB 4MNUA 4C2UA 2D2WA 3HTSB 3TQNA 4XRSA 3WGIA 2A68F 4G9YA 3F8NA 4EM1A 3GWZA 3TO6A 3K4BA 1LPQA 3FX3A 3QODA 1YG2A 4L5EA 1E2XA 1BBYA 1TT0A 1YIJI 4F52A 4XBFA 1B9MA 1IN5A 1MKMA 2ZXWH 3K4MA 1WQ2A 2MC3A 3KEQA 1VQ5I 3OOPA 4XLEA 5LGTA 4UV8A 1XN7A 1X1CA 2L7KA 2AXLA 1EH6A 1TL8A 1IF1A 3GTLJ 1TZLA 2XASA 1ONVA 1BN5A 1DQUA 2K9LA 3NARA 4XK4A 2M2EA 4XONA 3FXUA 5HODA 1UCRA 1FPQA 4IHTA 1SVLA 3G1MA 2WA0A 2X1DA 3WGGA 2PX9A 1GVDA 2W00A 3FKJA 3PFYA 2VXZA 3TBIA 1QA6A 1MBHA 2ZMEA 4E7HA 4UUTA 3NRVA 2QBYB 3E6CC 3FMSA 3UKGA 2ID3A 1SFUA 4E7SA 1L0OC 1MBGA 5KHDA 2V1XA 3ERMA 4BQAA 1OCPA 3QP5A 4HF2A 2FOWA 4N9IA 3HRTA 1LDKB 4AU7A 3BR6A 3GUDA 1QZYA 2FNAA 3I71A 1XSXA 3BY6A 1D8KA 3PJRA 3CF5F 1ETXA 3QPSA 3E7LA 1I27A 2IS4A 3ABMH 4U0YA 2LVSA 3M7GA 5CKTA 3BR2A 4G7ZF 2NOJB 2OAZA 4ENMA 3OYNA 4FCYA 4Y7NJ 2CV2A 2YU9J 1MH4A 2LDUA 3BWGA 4RB1A 2L5QA 1BI2A 2FMLA 4DNCA 3KPHA 1XDSA 4X0GA 4NQWB 1WSUA 3BQZA 1WJDA 3BJOA 3TW7A 1I1GA 1O3QA 4HF0A 2V1NA 3M07A 2DFFA 4KISA 4RM2A 3K70C 1V3FA 2XIGA 3J7YJ 3DU5A 4AIKA 3F8BA 4YELA 3QOEA 4FHTA 3DPUA 3ZQHA 3PIOF 3CO7C 1HKSA 4F93B 3GTJJ 5IT9Z 1S5LC 3G4SI 3UR3C 3M8FA 1RKTA 2B7EA 3LSIA 2IA1A 3OYEA 3EDPA 3LMMA 4X1EA 5ICEA 3HB9A 1APLC 4HV5A 4CDGA 1TQPA 2PQ8A 3R60A 1V54H 3SYTA 1RR7A 3C2HA 1QVTA 2I5UA 2ZNZA 2WAEA 2FBHA 3HPHA 4AWXB 2HEOA 3G2BA 5AIPA 2R7ZJ 2Q0OA 3A2KA 1T33A 3KP6A 1JUPA 3S14J 1ZELA 2V6CA 1DU6A 3A0BC 2KZGA 5J4YA 2IS6A 4HW0A 1VQ8I 4KITB 4XN3A 2E1NA 1HDPA 3VSKA 3D5LA 3ZR8X 2H6CA 1HKQA 1QPMA 2L3DA 1EV7A 3R0JA 1WI9A 4IHYA 1IG7A 3ML6A 2CGPA 3KEOA 1PP8F 2TRTA 5HVQC 4IRIA 4PJ0C 2O0YA 3ZQQA 2VQGA 3FK6A 2V4JC 5L3DA 1PP7U 2DK5A 3I5UA 3ASNH 2FU4A 3PL8A 5E79C 3F21A 5BPIA 3VSLA 3DBLB 4HX8A 4RAYA 4M3BA 3QU3A 1MDMA 1ZH5A 1OLTA 2DODA 1J5YA 1QHGA 5K5RA 3V7RA 1XSDA 3HUGB 1YFHA 4C2TA 5FRMA 3HRSA 3RYPA 4HNUA 4U7DA 4ESJA 3C1DA 2X1EA 2LF8A 4WK8F 3I64A 4BXFA 4U7BA 5E17F 3S15J 1LE8A 2EFQA 3G3ZA 3PO2J 4EEFG 3ROUA 3IRQA 4UXNA 2ZJQF 1A6QA 3RKYA 4IQJA 3DQVC 4EJVA 5B66C 1Y8RB 1YI2I 3ABKH 2IBDA 1P6RA 1J09A 2HVQA 3U2RA 2JPCA 1SD6A 3MWMA 2BYVE 3PSFA 2AS5F 1OCOH 3HOUJ 1R6RA 3OS1A 2R7VA 3IUOA 2NVYJ 4DIQA 1Y0UA 3WU2C 3JREA 2GA1A 3K4JA 5EG0A 2P4WA 3Q0VA 4XICA 4JX5A 3RQIA 1U5TA 1BR2A 4I0AA 1G3SA 2BE5F 3WG9A 3H92A 3MZ8A 4A0XA 3GX4X 2VC1A 4M72A 1Z7UA 5K7FA 4MO7A 2WV0A 5FFZA 2R7TA 2HYFA 1MMSA 2NVTJ 2UV1A 1UG2A 1OYWA 3B6AA 3S1QJ 3CDHA 1GT0C 3TL4X 2DA5A 5A2QK 2XPVA 1FSHA 2H27A 2K02A 2DBBA 1FOXA 1WH5A 4HDVA 4M6YA 4NHJA 4G7HF 2K9QA 3L2WA 4UY8I 2BXZA 3RDIA 2QSFX 1P7JA 4EGZA 3Q0WA 3VFZA 5BMZA 1IUYA 1S8NA 4XORA 5E3NA 2VI6A 2OPTA 3I4MJ 2OCEA 3H3UA 4CHUA 3P9KA 3GMEA 3BG6A 2E34A 4OMZA 1ENHA 1ETQA 4A3IJ 5F1JA 2MLGA 2L4MA 3KETA 4FX0A 2BY3A 3S1MJ 4UB8C 4HV6A 2NYXA 4RGSA 4BJ6C 1XCVA 2RGVA 4BXUA 2EZHA 1WJFA 2DOAA 1LQ1A 3CUOA 3FXQA 2CQNA 2GA2A 1D3YA 5ILUA 3K9TA 1NK2P 1FWZA 3KE2A 2HDWA 1FX7A 2NS8A 2QKMB 5E1WA 3S3OA 3IAM2 5DCMA 1HW2A 1LKXA 1TLHB 1IV6A 3CLQA 2LNBA 2KRCA 3FISA 1GHCA 1JHFA 3OYBA 2OUMA 3ZQGA 1PUFB 1G6NA 5H20A 1YS6A 4PGGA 1Z3YA 2IEKA 2DQLA 3BTIA 5J3LA 2VODA 2FSWA 4LLLA 1H9GA 3M8JA 2DJNA 3S1NJ 4XIDA 2CUFA 4P1WA 2EV0A 2H94A 5CYVA 5C4XJ 2DU9A 1QBJA 2HQ5A 3LA2A 1K6YA 3KYLA 2IPQX 2XKOA 4I09A 1SANA 2EH3A 3V7SA 1LJ9A 3W6KB 4CICA 4KFCA 4HZFA 3DTKA 2LBFA 1YS7A 2O03A 5E20A 3H5NA 2ZC2A 3M3YJ 3IL2A 3X2QH 1WCMJ 3RZDJ 1QU3A 4Y15A 4ANJA 2FBIA 2Z99A 4XSZF 3ZPLA 3FXOA 5E3LA 2YUSA 2K27A 1FMVA 1IW7F 4MEYF 4A6DA 4GRIA 1B59A 2R5ZB 1ZLKA 2AXTC 2QGUA 1JGSA 3S3MA 1TQIA 4YFNF 2DPUA 2IA2A 4LLGF 4RLQA 4A3JJ 2MYSA 1I6HJ 3KIOA 1GXPA 4ZDOA 2JK3A 1J7KA 5DYMA 5DM7F 5FD6A 3RTRA 1P92A 4GO1A 3WTXC 9ANTA 2OQRA 4Y3OA 5M3MJ 5E18F 1LDJA 5K7HA 1YE9A 2CUJA 3DLAA 4HSRA 1IDYA 2FF4A 3CP8A 4LGWA 1R49A 2WAQA 1SEUA 4UVCA 1TT5B 3LOCA 3V7CA 1WFXA 4UVBA 2KT0A 5FLXK 3R0AA 2GOXB 3RPUD 1B8IA 1AOYA 1FT9A 3OYLA 1I39A 1K4SA 2VUMJ 3D5RC 2GBYA 2KZVA 4XOPA 1Z9CA 3H0GJ 5FGMA 2EA2A 4CCLA 5E3OA 5L3BA 4IKFA 4JX6A 4HEA2 3V4GA 5F64A 1H9TA 2KDZA 3I59B 1NG7A 2VQHA 3CUQC 3MD2A 4L9VA 1XMXA 4C3JJ 2HKXA 3VPRA 5HS7A 3DTIA 4HNTA 4HF1A 2ADUA 3H3VK 5DEQA 3FHZA 3L2VA 3V8JA 2E1MC 2N8GA 2W24A 2VKHA 3VYUB 1RIOH 3LA7A 4KIBA 1Z67A 3ZMVA 2W7NA 3MZHA 2HVSA 5FLVA 1K61A 2HFHA 2ZMEB 2OC6A 5FB2A 3K70D 1FBUA 5A2QZ 3I0TA 2HU9A 3UNGC 1POGA 2ESHA 2LR8A 3HC7A 1ZTRA 4BKXA 2EFWA 3CQZJ 4IZZA 3SDBA 3IH2A 2M9HA 2BBYA 1W5CC 2P5KA 3KLNA 5DV5A 4CYCB 5CQGA 1WHUA 4BHPA 1VQ7I 3DBHB 3M8EA 5EF6A 4XLPF 2MD0A 3LAPA 2ZXJA 2VJ4A 1HF0A 2BV6A 4AIJA 4D0PA 3QU6A 4S05A 2FX0A 3R6SA 2L9RA 2X1CA 2E2JJ 1V5FA 1AA7A 3MKYB 4J01A 1FY7A 1Z05A 2UXXA 2HTSA 2JA6J 1E0EA 4GGGA 4A3KJ 4KICA 1D1BA 5M3FJ 2QVOA 1FYLA 1C0WA 2XAHA 4R8HA 4D1QA 3F0CA 1OISA 3LSHA 2LKXA 4DW6A 2BOLA 4PZJA 1ZHFA 2F6CA 4OMYA 2DDAA 2XAQA 2NS7A 2NAZA 2RDPA 1SMYF 1Y1WJ 5F1RA 1B4AA 4UNOA 3JRGA 1Q1HA 2HQRA 1U0JA 3H35A 3LSJA 1BOAA 2EK5A 2A6HF 1W36D 1EA3A 4W1UA 2KIFA 1JKRC 3PO3J 2M4GA 1OPCA 4EM2A 5K7ZA 4WWCA 4CH7A 2VJIA 3LFUA 4RGXA 3TDZC 3KP7A 3TOBA 3CC4I 3PM1A 4PFPA 3SJMA 4IO9F 3LSGA 3GZNB 4IHVA 1K78B 2EFPA 4DYQA 2GOMA 3HIFA 1VI0A 4HNVA 5EGOA 1IC8A 1A04A 2KQRA 1V55H 5J1UA 2EPFA 1VTNC 4GXOA 2VKVA 3DFGA 1X3UA 4F92B 3OYAA 2R7OA 4E7LA 3L9FA 4RBOA 3RKQA 1LFPA 4BY1J 3QAHA 2PJRA 4C2MJ 1IRZA 5D5VB 3JAMK 3K1NA 3GYHX 1SFKA 5L3GA 2FOKA 3E5QA 2R5YB 4RGRA 1A6IA 3CMYA 1ZG3A 2JSPA 4XLHA 2FMYA 1H89C 2ACJA 5E1XA 1RKWA 1QVUA 3OV8A 3T8RA 1K6OA 4CCKA 4XKCA 2CFXA 2WY7Q 4I7HA 1T0FA 3MVPA 2G7HA 1YRNA 2HOEA 3OS0A 3GFJA 3L09A 4GYIA 1LB2A 3I58A 4XSXF 5FO5A 1ETYA 1K7AA 3DP7A 4GYGA 1X1PA 3U1DA 5K1YA 1KU3A 2QKLB 3WGHA 2JTVA 4QWQA 2Y75A 3W2WA 3P7NA 4BYYA 4HQMA 3WTSC 5FLXZ 4ZTJA 1G2HA 1VQ6I 1P4AA 1SAUA 2QQAA 3I54A 5BS6A 1LE8B 4BJ5C 3JTGA 5DUIA 3CLOA 3MKZA 1KGSA 2DDBA 2RNJA 2K85A 3JRCA 2ZSHB 1FBQA 3OIPA 2V1UA 2FQ3A 3HRMA 4C9YA 4RAZA 5L3FA 1AHDP 2HOSA 2K4JA 4BQQA 1VNDA 3CTAA 2M3AA 5GTIC 2KLOA 1VQNI 3FF5A 5D4RA 1UHMA 2XGXA 2PMZN 3HPGA 4U0WA 2KRHA 2EZKA 4JX4A 1BW5A 5IP6A 4X6AJ 2HXIA 2L9VA 4KT6A 3O6BB 2DA7A 4OU0A 1HA8A 4KN4X 1QZZA 2WB1A 1USTA 3K4CA 3K4NA 3L2UA 4LK0F 1ON2A 5D6FA 4G7OF 3QPHA 2V26A 1JT6A 1T98A 1FC3A 2BEOA 5D5WB 2L54A 2KIQA 3EUHA 1YX5A 1X4PA 1TWAJ 3ZOBA 2NNYA 2WV1A 2I10A 3HKZA 5JI6A 4B4CA 4IRHA 1GV5A 1IN7A 1Y1VJ 2XF7A 2ZXHA 4C3HJ 1AKHA 5HLTA 5IPAA 3F23A 2H6BA 2A6TA 2LFBA 3GO5A 1S72I 3SDGA 1XC5A 3LFKA 2BHYA 3LQRA 3TMOA 2LKPA 2CU7A 3WTUC 4MLOA 4BL0B 3F72A 5IY5H 4HLYA 3DTEA 3LNQA 4PFOA 4YFXF 5JR3A 3ABUA 3ZMTA 1R4MB 4M6VA 5CVRA 1FJLA 2QSHX 5ILVA 3RPUA 4HA8A 4CCOA 4A3BJ 3OYMA 2A3SA 2F2EA 4M71A 3FMQA 1U9NA 2DA4A 1KQ0A 3H1CA 4L9TA 5FKOA 5LD2C 1QQIA 3KCCA 3OYGA 4BXXJ 2OV7A 3EPZA 1BM9A 3LA3A 1IRGA 2YPRA 3IH4A 3O3KA 3QYBA 4LJZF 1IN4A 2RQQA 4LB6B 3N4MA 2YSRA 1FSEA 4WXHA 3FM3A 5GPCA 2H1LA 2J5OA 1OR7C 2VLAA 5K5OA 1TW3A 2Z16A 1ZK8A 5ILSA 2VJJA 3J7AY 1R22A 1ZGWA 1HC8A 1V5GA 2STTA 2HDCA 2UZKA 3A1YA 5JHUA 1QO0D 1XGSA 2DK8A 3G6EI 1D0ZA 4J00A 1ZR2A 4BEHA 5JVGF 1HW5A 1ZKGA 1R1TA 2I8DA 4Y52J 3V8LA 4B3XA 3MFKA 5KVRA 1IJWC 3HHGA 2CQ7A 4IF4A 2H09A 4XLFA 3DPTA 2CW7A 4XNFA 5ICGA 5EDNA 3JRFA 4N9HA 5EZGA 3DPLC 3FIWA 5EJCA 3JAMZ 4A93J 4NBQA 5IYCJ 3BR3A 2XF6A 2KKOA 2DFEA 1A31A 2PG4A 1TBXA 3C7JA 3CUQB 1F4KA 2XUBA 4LG0A 5BQTA 3HXLA 3EUKL 2R7FA 3Q9SA 5EEGA 5FJ8J 2KDOA 2LG4A 4H0EA 1SFXA 1IDZA 2BW3B 3H3ZA 2FXAA 4C30A 2L9SA 2E1MB 2QQBA 1NTCA 3CZ6A 1MIJA 2IA0A 1U8BA 2LREA 2M7AA 2XB5A 4WCGA 3MMYB 5HLHA 4XRFA 2D1HA 2OZ6A 4E7JA 3WE3A 1KQ8A 1P7IA 1ZREA 1ODDA 3M9AA 2JWTA 2DOFA 1ETWA 4HLXA 3I55I 1A5JA 5LEKA 2VT3A 1WZ2A 2LYCA 1FTZA 3SFZA 4B8XA 2F5FA 2IGOA 3GTOJ 1P4WA 1W1WE 2X9DA 3JW4A 4Y33A 2XAFA 3E5UA 3DF8A 3FK7A 2ZMEC 1ZRCA 2Q8KA 1XGOA 3K1MA 4G6DA 2F5EA 3OL3A 4D9JA 3OWTA 4II2A 4BGDA 2FRHA 1ORKA 1EJ9A 3L00A 2A07F 1I5ZA 1RR8C 1B8IB 1JHHA 3ASOH 3PIPF 3C3WA 4I0BA 5IOZA 2E5ZA 1HSJA 1CQTA 5F0FA 4MTDA 1MGTA 3Q3SA 4PUSA 5B1BH 1Y0NA 4UUSB 2XC7A 2YR2A 2L01A 1IUFA 4L0ZB 4DGWB 1F1ZA 3DEEA 4A3GJ 3LQQA 4Q47A 4QIWN 3GBGA 4ZC3A 2FJ1A 2EB7A 1ZRFA 2VC0A 2GIZA 3JSPA 2VPLA 4DBQA 5DD4A 3T8TA 5DDGA 2HXOA 1UHWA 5KNLA 3MQ0A 2R0QC 1MH3A 2QQ8A 1L3LA 4NC6A 2EQRA 1W7PB 4M6XA 2A05A 1BC8C 1O4XA 3IV5A 3M1CA 2RVCA 3J80K 2QLZA 4RAFA 3BTLA 1TP4A 3QRFF 2E19A 2EZIA 1GXQA 5FRNA 1IAWA 3HTUA 5IYBJ 4W97A 2PMUA 1AWCA 3SQNA 4HRIA 1HOMA 4PK4A 4A69C 4ESBA 1K79A 3OYJA 4DJAA 2QENA 3HOZJ 2Y9YA 1LFUP 3CO6C 1D5YA 1BI0A 2GXGA 2LC2A 3TP0A 1RPWA 3JTHA 3VB2A 1VZ0A 2PLYA 2K9SA 2EA4A 3BG5A 1PVEA 2JRTA 2Q2EB 2W4SA 4UUVA 3FXLA 2CYYA 1GUUA 1HLVA 1ETOA 3BQYA 3BZ6A 4JOMA 3HM5A 1X3ZB 3N05A 3I56I 1PDNC 2ECCA 2VE9A 1DDNA 3GLLA 2A5YB 2MG4A 2IAIA 2Z33A 4JK1X 5HDKA 1B72A 1JXSA 2OF7A 2CSOA 1R4NB 2A61A 3OYCA 3HOSA 4U88A 3KP5A 4DQ2A 2MGQA 2EV5A 3HSRA 4CA0A 4RB0A 2OA4A 3F8FA 5EGOB 2HQNA 3G1OA 4IPAA 4D5CA 2IVMA 5J4VA 4AIHA 3H36A 4DYRA 3CC7I 2V6EA 1MNDA 3BCAA 3RJPA 3ZXSA 3FBNB 4LIVA 5ERIA 1PJRA 5F08A 3SEZA 2R7DA 2QYOA 2R7SA 1H0MA 1RETA 5F0CA 1O7LA 2MLKA 1HXDA 2MD5A 1WJAA 3BT9A 2V1DA 4NUBA 1J75A 2HNHA 4LG3A 2OTJI 3T5XA 2NS0A 2DYRH 5DM6F 2HYJA 4MFEA 1G3TA 2K9NA 3MN2A 3WTVC 4ASNA 3OS2A 1UJ8A 1Y8QB 3A01A 2HPMA 2E35A 3L7WA 1U3EM 2XPWA 3F8CA 2B9SA 5DS9A 1U8RA 2PI0A 2DN0A 4HAMA 1JTYA 4IEJA 1X58A 4P9UA 3MZYA 2W82A 2X85A 2RNGA 2P81A 2VBXA 1U5TC 4Q48A 2UUZA 1SVMA 1S7OA 2O7OA 3BG9A 3JRBA 2P7CB 2PMHA 3A4CA 4P9FA 2UWMA 3E5XA 1T08B 3I4PA 4B3AA 2IGKA 2B0LA 2GAUA 1SD7A 3FXJA 3TGNA 1XMKA 1JTXA 5KCMA 1STZA 3BJAA 3D0SA 3BJ6A 4RB3C 4EV0A 4AVPA 2FE3A 2P5LC 4PSXA 4R79A 5D5XB 4A6EA 3HSFA 3BLYA 5ED4A 5LRSA 1KYZA 1B6AA 2COBA 1YLFA 2CG4A 3ZRGA 4BACA 4M9XA 4BE0A 2H8WA 2BVLA 2EILH 2X6YA 3DKYA 1T56A 2JPBA 3OYFA 1N78A 2E7XA 1U78A 2JRMA 3WE2A 4L9JA 5LGNA 3N97A 1ZQ3P 1OCTC 2EIKH 2WAQN 1NG6A 3T0YA 4YEJA 3O2PE 4NNJA 5IT3A 2QM3A 3QWLA 2EINH 1BIAA 4M3FA 4P5OA 4RA2A 4RMNA 1BOBA 1MBKA 2CJJA 3AG4H 3DKWA 2DMQA 3BG7A 3J80Z 2NVQJ 3QPLA 3CJTB 4YFKF 3GXOA 1BJZA 1W5TA 2V9VA 1F9NA 5H6QA 1R5GA 2YX4A 5GAGJ 3L2CA 4C3IJ 4BAYA 3S2WA 1RI7A 1R9TJ 2IS2A 1BR1A 4XKWA 5E3MA 3DLLF 4IHWA 3VYTB 3ABLH 1YW8A 3S17J 2JQ7A 3I53A 4O6JA 4A2UA 3GFIA 1IXSB 3BP8A 4B47A 1JT0A 3TKYA 3F6VA 1IV8A 4ZYEA 1LEAA 4NQWA 5EEHA 2Y0SN 3TP3A 4OIPF 3CDLA 3AKZA 4E6KG 2OTLI 5CVUA 3TOAA 5D4SA 2X4HA 4ZDLA 4K2EA 1RZ4A 4A3CJ 2LKSA 1FNNA 3CDIA 1ETVA 1YIOA 4OAYA 4ENNA 3W6JB 3GTGJ 3P9IA 1WH7A 5C44J 1FOYA 5FFXA 1BA5A 5J6XA 5F0HA 3KP4A 5KAFC 2NVUB 3PQJA 1VQOI 3J81K 1U2WA 2PN6A 4WXDA 4I6ZA 2V9PA 2WWYA 4OIQF 1TNTA 4Y13A 1DGRM 3DXJF 4F3QA 2Y30A 2EFOA 2X0LA 2XVCA 1R7JA 3OMYA 4AC0A 4XRMA 1FEXA 2VASA 4V19K 2F5CA 4EMSA 3W6VA 3CCLI 2O9LA 2HOAA 2BHZA 3ZMDA 1WVRA 1YTYA 1QNTA 3PSIA 1E17A 1J9IA 2ZJ2A 3O8HA 1CGPA 2AHQA 1Z6RA 2CWEA 1IRXA 1HKTA 2OZUA 1Z1DA 2JUGA 2M8GX 1Z77A 4BS9A 2JA8J 1USSA 3RQ4A 1J59A 3LSKA 4YIRX 1AU7A 1ERDA 3ZMSA 5DD8A 1HSTA 1OYIA 2Z9OA 3QPTA 1JE8A 1IGNA 2XKPA 3GVAA 5EYRA 1FOWA 2DJIA 5M5WJ 2GWRA 4S0HB 3IWZA 3BR0A 4MEXF 1BC7C 4EQQA 2EBIA 2ZSIB 4J19A 1Z3XA 2PEXA 2W84A 2X6WA 3CP2A 4U0VA 3BTJA 4QSHA 3DV8A 3H0DA 3EYYA 3PNYA 1SFOJ 3CCSI 1PUEE 3KX2A 1MBJA 3IH3A 1GDTA 1WPKA 1DPUA 2GLOA 3RI4A 2VE8A 3PQKA 1IXCA 3PNTA 4G94A 5TRDA 2ECBA 1ZRDA 2DPDA 3CCYA 1S29A 2IGNA 2QWWA 3GFMA 3S8PA 3AL0B 3HUGA 2DMPA 2UXNA 2ISZA 4AUXA 2F4OB 2VONA 4G6QA 4CCMA 4L9NA 5IP7J 4JP0A 4RAGA 4AYBN 3ABTA 4RDUA 2K3FA 4BNCA 3GLXA 3OYDA 2Y0MA 4MHGA 1NH3A 4OOIA 3KZIC 3GTMJ 2CUZA 3H5RA 1P2FA 1N77A 1JKOC 2ZBKA 2R3SA 2X6XA 4OIOF 1F5TA 3TO9A 2RREA 2XGCA 2ICWG 1EH8A 3DEWA 3EETA 4ABZA 3F6OA 3AG1H 3KZYA 3O8GA 2O3FA 3HOTA 2BZTA 2DA2A 5HLGA 2ID6A 4QLCU 1UMQA 3E0JB 1JI8A 1D1CA 1XG1A 2NXNB 1T8IA 1E3HA 1X1AA 3LSRA 4BQNA 4ZYDA 3CCJI 1RESA 1MMNA 4RLFA 3CCRI 2VKDA 1LUJB 3K2ZA 3WU0A 2ETHA 1MNMC 3ISPA 4Y4RA 3A0HC 3ZP5A 1R00A 1IN8A 3CJNA 4IOAF 2DTRA 3NAUA 2LD5A 3HGYA 4GCVA 3ZQFA 2PBIA 4G8XA 1JUMA 2P8TA 2VBYA 5IOYA 4V2GA 5E8GA 4B09A 3HGGA 2F5VA 4OWRB 4CYDA 1FZPB 3F22A 1ON1A 2VKEA 3EUAA 1SAXA 4LFUA 1GV2A 1P4XA 1TWGJ 2A6EF 3U1KA 1T39A 1RUOA 2R4GA 3K0LA 1LDDA 3ZMZA 2Y69H 5LEJA 2NOGA 4ZYAA 1XB4A 2VL8A 3GFLA 3SEQA 2P7VB 2MH2A 4BUPA 2YU3A 2WY8Q 2HPIA 4HX4A 1KYWA 3NWTA 1RC9A 5B1AH 3ZQLA 3VWBA 1X1DA 4YRVA 4ZYHA 1FTTA 1KA8A 2DA1A 1MDMB 1MMGA 4TV7A 3MKLA 1DP7P 4KIGA 1G3WA 1TNSA 2WB1N 3L1PA 3GTQJ 2E5NA 3W2VA 1MBFA 2GM4A 3CD6I 2VJ5A 5FKNA 3ZQIA 4Z6YA 1UAAA 1TC3C 2FNPA 3DU6A 3J81Z 1R1VA 2GZWA 1VQ4I 2HI3A 1BW6A 3VEPA 4HBLA 4BU2A 3D1NI 2HZTA 2LLKA 5F04A 4PJJA 5D8KB 4MFDA 4M3EA 2XV4S 1PUFA 1ZGAA 3CJRB 4GFBA 1ZGJA 1S6LA 1GVJA 2YX7A 3KFWX 1KU7A 3B02A 1BR4A 4M3DA 2KJCA 5EG0B 2NRAC 3E3VA 2RN7A 1SVOA 3BROA 3P9CA 1U5TB 4LD5A 3QYEA 2ME0A 1LVKA 1W4MA 2Y31A 1ZARA 1QRYA 1KZHA 3G1LA 3GTKJ 3FXKA 1Q1VA 3IHUA 3ZN1A 2VN2A 2MFZA 2QEXI 2WADA 5D6EA 1S7EA 5LRRA 3DWLE 4XQFA 4IQ4A 1HDDC 1Z0XA 3U21A 3K10A 2DLLA 1T0FC 2K3PA 2OCCH 2OU2A 4IJAA 5BPDA 2ME6A 2R7UA 5HOOA 2MA3A 4ITVA 4XLNF 2PJPA 2KRFA 2WAFA 1QGPA 2R5ZA 1X2MA 2FEZA 2L0KA 2R7RA 3DKXA 1Y56A 3BPVA 4KA4A 1YO5C 1MMDA 3HBLA 1TTYA 2Y9ZA 1ZR4A 3LWFA 2LRDA 5C4JJ 2MC4A 1DPRA 1P9QC 2NNNA 2VPRA 3OY9A 1LFBA 5TJJA 3HG9A 2O8XA 4B43A 5J8CA 2XSDC 1O3SA 3BR1A 1K4TA 2XGDA 1X1BA 5KAIC 3HDDA 4PJMA 1U6GA 2VIXA 4XR6A 1TW2A 2PMZA 1RUNA 2PFBA 3ZQCA 1TQMA 3ULQB 2L7FP 2LSOA 2CQXA 5DCMB 3RPQA 3VODA 1W0UA 3KP3A 2IJLA 4B48A 1FP2A 2JSCA 4F7ZA 2ZJRF 3ZCOA 4ZTFA 1JKPC 1IZ1A 1PYVA 1Z7LA 3IRRA 3PNVA 2JVHA 4XLCA 3I59A 2XAJA 2HGCA 2D5VA 3E97A 2WC2A 4UVAA 5DUKA 4XKVA 3Q0UA 3QQAA 2L4AA 3EUHC 1IRFA 2R7QA 1G3YA 2JUCA 1D0YA 5H6RA 2Z1DA 3GZ5A 2VBWA 3SHFA 5L3EA 2HDDA 3ECOA 2GXAA 3FXRA 4PJLA 3OYKA 1R5ID 2QUFA 5E1ZB 5FROA 3S32A 2W25A 3CMAI 4KT5C 1VQMI 5HLIA 1YJ9I 1CF7A 1OJLA 4BDZA 2ELJA 5DCFA 3WTWC 1MSFC 3DBRB 4HPQA 5FKMA 2LBFB 4IX7A 4N4NB 1XMAA 3GEZA 3K7AJ 2GQQA 2P6TA 4BDYA 4NDLA 4ENJA 5B5EC 1YJNI 2R7XA 5FLMJ 1I3QJ 4JQFA 2M5WA 5FKLA 1R58A 4E7ZA 1W5SA 2IRFG 1JJ8C 4CYCA 4F55A 2CO5A 2CH0A 4EJTA 1MSEC 2VXDA 3I3LA 4IL6C 4P55A 3SFIA 4BBSJ 3COAC 3DEUA 3K69A 1MNEA 2BGCA 2IGMA 2Z2SB 3IP4B 1I50J 3HHHA 2ESNA 1VQPI 2KIUA 1BJAA 3R61A 4LK1F 3CCVI 1WJEA 1YHQI 3BTCA 2OBPA 1KONA 2QQ9A 2DT5A 4M9SA 3A02A 1FYKA 4RGUA 2HS5A 3LAJA 3HEFA 1X19A 3EQLF 3OOUA 3OR1C 1R23A 4JYKA 4ZZDA 1YQAA 4UV9A 5CVVA 1FMWA 2VQLA 3CCMI 4E4HA 4FISA 4KNYA 3WTYC 2VBZA 4AM3A 4I01A 4RS8A 1Y39A 1ZG1A 2VOPA 5K5QA 2MSYA 3OL4A 1NK3P 4FQGA 2C6YA 1R36A 1F36A 3V8KA 4N0BA 3WTZA 1V4RA 1MMAA 3HJEA 5DTDA 1K78A 4ESFA 2V79A 2XAGA 2XSJC 3HZJA 3KP2A 4MQ9F 3M1EA 1HCRA 2RKHA 1OCRH 3WG7H 4CCJA 3A03A 3AL0C 3S93A 3PUFA 3TW6A 2XGEA 3KLOA 1TWHJ 4MIMA 3U9GA 1VQKI 2OJED 1F43A 2X48A 4FE4A 2D1VA 2GIVA 1O3RA 5GAHJ 1ZLJA 5LBQA 1WKMA 4R1HA 1X4OA 1Z21A 3QP6A 3CCQI 2DQRA 4QPOA 1WJ5A 4E70A 1WGXA 2RC4A 1OKRA 2R5YA 3GW2A 3BPXA 4EGYA 1SMTA 1SC7A 1W7PD 2EV6A 1W36C 1WJBA 3F8MA 4ZH4F 5JLWA 4ENKA 2HWVA 2KL4A 1JKQC 2ZFWA 4BY7J 4HX7A 4IOCF 2EIMH 2BY2A 4IRGA 5FD5A 1XPXA 2ZNYA 3BZKA 2M0CA 3HYIA 4CO8A 2IW5A 1HQCA 3R4KA 4XLAA 2QF7A 3RKXA 5GADJ 2H1KA 4OIRF 1G4DA 4Y17A 4D7NA 2LMDA 4XM3A 4WXCA 4DYCA 5F27A 3ECHA 2E2IJ 2L7ZA 4JBAA 4G6TB 1LVAA 3E6BA 3MCZA 4D7MA 2BVMA 4CSWA 1O3TA 5JFRA 3HSEA 4F91B 1S9HA 2BY1A 2CV0A 1REPC 4RB2C 3EYIA 4HSTA 4OAZA 3CCUI 5JHFA 2L7MP 4Q5SF 2EIJH 2K9MA 4L5JA 2M30A 2M0MA 5HS9A 4A5MA 2L02A 3LSTA 1LEBA 2Z5UA 3MEXA 5CLSA 3K6GA 1IO2A 1RRJA 2K4BA 3IAS2 1FP1D 3E6DA 2XRLA 2F4MB 5CQEA 1BI3A 2XRNA 2ZCWA 3DCFA 2O6GE 1R1UA 2DT6A 4MTEA 2ZJPF 3JR9A 3FHNA 3GTPJ 5J1YA 5IYDJ 2XHKA 4M73A 2DT7B 3KYCB 2QA4I 3BOQA 3MAJA 2JA5J 1UZCA 4A0YA 2HQAA 5TISC 1EH7A 2CW8A 4IVNA 1XCBA 1V5EA 1JGGA 4IHXA 5J8FA 2P0WA 2STWA 1XTAA 4M74A 2IP2A 5C3EJ 2DTZA 2ZKZA 4I2OA 4CGZA 3HL2A 2PJRB 3JCUC 4FTHA 2DAOA 2VB6A 5LHIA 4D5FA 3E1SA 4AIDA 4BBRJ 4WF2A 3RYRA 3AAFA 5M5YJ 1FOKA 2KPMA 4BQOA 4HG2A 2W85A 2CQQA 4HQEA 3IKTA 2VOOA 3REOA 3RSNA 4XKBA 3W3CA 3AFHA 1OCZH 1S3JA 1O7FA 2O5RA 2TCTA 3ZQ7A 4L18B 2KFDA 1FYMA 3OYHA 2EFNA 2K5CA 1YRNB 4KDPA 3HOWJ 2WBMA 3FWEA 3KYDB 2H8RA 4O5VA 2DXIA 4AD9A 3HRUA 1I3AA 4XL9A 2IT0A 2W57A 3M4OJ 4A12A 1MJBA 1QZEA 3CF2A 5TGTA 4PSWA 2E2HJ 5D8LB 1X2NA 1J2XA 4ZDPA 3L2QA 2LY1A 2RV8A 5D5UB 3H9GA 3AG3H 2NVXJ 4AVZA 3IC7A 4KMUX 5B3SH 1ULYA 3I9V2 4Q4ZF 2CFOA 3OIOA 4M9ZA 3IKVA 1O57A 1XS9A 1J0RA 3OIQA 3SZPA 5L3CA 2OD5A 2Y2ZA 4Z2YA 3FBIB 4A3EJ 1M1EB 3E6MA 3QOPA 4A5NA 3WHBA 2QBYA 2ELHA 2DW4A 1MJ9A 3GZ6A 5HDNA 2ZO4A 1FIAA 2J5PA 4DZPA 5EEAA 3CCEI 2DOEA 3GF2A 3CJQB 2M1BA 1ZYRF 4EVIA 2CMPA 2ZFUA 1BL0A 2FBKA 1DGWY 2MH9A 2QZ8A 2R7WA 4LIUA 4ZJZA 5F6FA 1N75A 3BC8A 2DFHA 5GPAA 5LGUA 4E7KA 3W2AA 4O3MA 3CUQA 5ICCA 2DMTA 4XMYA 3S2HJ 1KU9A 2XB0X 4NB5A 4PJNA 4BHBA 1AKHB 2LP0A 5HNHA 4I99C 2X51A 2BW3A 2JZYA 2G0EA 3ZGKA 4XOTA 5GP9A 1SD5A 2KP6A 3Q9VA 5CVJA 1OYYA 3NWSA 3FDYA 1XGMA 1MZBA 1D0XA 3KEYA 1X3WB 3SZTA 3FMRA 4KIFA 2QSGX 1QHHD 4MGRA 5GTHC 2G9WA 2DI3A 2E60A 2V7FA 4QPQA 3SXYA 5HNFA 3H9JA 2V9KA 2MBFA 1Z91A 4EATA 1OMIA 3AG2H 1BI1A 3H9QA 4L5IA 3G73A 1MBEA 4DOZA 4LITA 1MW7A 2ELKA 2LOOA 4GDFA 2DCEA 3FXMA 3WTTC 4NC7A 3CMEI 2LF7A 3VOEA 3OSGA 3BG3A 3RIRA 2XDVA 5J47A 1JJ6C 3C18A 4DZJA 5HS8A 2VQCA 2FUG2 2HR3A 3NQOA 4P96A 1VF9A 4LMYA 4PGHA 4FETA 3BR5A 2IS1A 3K1PA 1HW1A 3P5JA 2HYGD 1OCCH 3OR2C 5LHGA 2LH9A 3ONQA 3BDDA 4IXAA 3QYFA 3C2GA 1D5VA 3PUBA 5LHHA 2K7LA 5BNGA 1B1BA 4UUSA 2O8KA 3V42A 3BCBA 3CC2I 4PCQA 1G8XA 4UB6C 2FD5A 5JLXA 2XAUA 3JRIA 3VYRB 3TDUC 4ETSA 3G71I 4XRSG 1D1AA 3ESWB 4BEHB 2FQ4A 1XX5A 5KK1A 4QTRA 2D45A 2Y0SA 4A3FJ 4G12A 4FX4A 2HVRA 4HYEA 2RAEA 1CF7B 3ELKA 4II3A 1SFEA 1T95A 1W7PA 3IWFA 2RQPA 4V2FA 2CRGA 2CV1A 3OSFA 4MQVA 2OQGA 1HBXG 2HKOA 4I02A 3T1BA 2KHMA 4B1RA 4LG0B 1H88C 3ZN0A 3HOYJ 1FLIA 5BOXA 2M45A 4EJWA 2JA2A 2M87A 4YIFA 2DMUA 1YW9A 1UELB 2MW8A 2W48A 1T2KA 1UG0A 4I98B 1IN6A 2E71A 5LLQA 2JMWA 3F3XA 2QCOA 3HOVJ 2HTJA 2CS3A 3FZVA 1SD4A 1IXRC 1ETKA 2JJ7A 4BH9A 4CZZA 2VT2A 4IHSA 1UB9A 3K4KA 3LL7A 3BZCA 1I1SA 1DP3A 2EWNA 2WTEA 1T6SA 1I6XA 4E7IA 4ZYGA 1WI3A 2E1OA 1W0TA 2Q2EA 3WU1B 3I4NJ 2LTPA 4CUGA 1FBSA 4HOBA 3LSMA 3NEUA 3WHCA 1G59A 1QPIA 1TWCJ 1VQ9I 1Z6TA 2KISA 5HDGA 4CXFA 3GCMA 2P6SA 1EF4A 4WX9A 4EM0B 4ZZLA 2L2OA 3RZOJ 2XF5A 1E3PA 2FA5A 2AO9A 1GLNA 3K4LA 3D5SC 4CCNA 2O61A 3SZGA 2X6OA 3JRAA 1OFCX 2CUEA 5J1RA 4PDKA 1VQLI 2M34A 4KUMA 1MJAA 2ISYA 3S1RJ 1R5HA 5LFAA 2EZLA 4KN7X 5AIQA 1ACIA 4NC8A 1YW7A 2F4IA 1JUSA 1TWFJ 4YIIA 1D8JA 1ZAOA 2G7UA 3CMMA 2MABA 3LSPA 2KJBA 2DYSH 1EKEA 1R71A 3S16J 2M4KA 1WJCA 1A35A 1UFMA 2KIMA 2F48A 2EJRA 5J40A 5CVIA 1XD7A 3FKIJ 5JVTA 4FT8A 2CQKA 2A69F 1S7AA 4I76A 3F9KA 1ITYA 4AYBA 2JVGA 1BIBA 2LY9A 4A0ZA 2ZB9A 1MD0A 3RCOA 1FIPA 4A3DJ 4U87A 3MKWB 3FM5A 2M7BA 2K86A 1YJWI 2DA6A 1LNWA 1XDUA 1ZN2A 1N25A 3B6CA 2DA3A 1B9NA 5EZHA 3VDXA 1YYVA 2A5WA 2JA7J 2IXSA 2Y48A 3C2BA 5CJ9A 2M8EA 3K2AA 3J7AO 3HOXJ 3PFIA 2DO7A 4KYWA 3TEDA 2E7WA 2LK2A 4BJTA 1NHAA 2DMNA 1OQYA 2Q1ZB 1U9OA 1VFCA 5AONA 2AQEA 2CW0F 2TDXA 2BY0A 5GAEJ 6PAXA 4BHCA 2F5DA 3ZMUA 3JRHA 3Q5FA 1DUXC 1A36A 2KMUA 4BE1A 3HKZN 2ZXIA 4RM3A 2LY2A 3RKWA 5M5XJ 3S3NA 4DBRA 4B44A 4N4OB 1E3OC 4UHTA 4OINF 2COMA 2W1OA 2JN6A 2AQFA 5FKKA 4A3LJ 2BXYA 2L9NA 4HDUA 5IT9K 4S04A 3B73A 5ICFA 3S2DJ 2R92J 1YX3A 5CPRB 1WRJA 3OYIA 5H2FC 3JRDA 2E1CA 4KMFA 4CZCA 1T38A 3L2RA 2YS9A 4M3GA 4A3MJ 1YOVB 1DU0A 1B72B 2HOTA 3H5AA 3KZZA 2XPUA 3TO7A 1ZG5A 4H4KC 3CESA 4LOCA 3JSOA 4FASD 3ERED 1XSVA 2DFIA 4FE7A 5E8IA 4EJOA 1H8AC 4ON0A 4BE2A 5IP9J 1K83J 4YG2F 2R93J 1Y6IA 4L0YB 2Z3YA 1OR7A 2GXBA 1XGNA 2JT1A 2B63J 1YITI 2XROA 4EJUA 1UHSA 4KJZA 2P5VA 1KU2A 2HZDA 4LLNA 4LB5A 3WODF 1KQ9A 1RNLA
chains in the Genus database with same CATH topology
1WWXA 4MNUA 2D2WA 3HTSB 3TQNA 3WGIA 2A68F 4G9YA 3F8NA 4EM1A 3GWZA 3TO6A 3FX3A 1YG2A 1E2XA 1BBYA 4XBFA 1B9MA 1IN5A 1MKMA 1WQ2A 2MC3A 3KEQA 3OOPA 5LGTA 4UV8A 1XN7A 2AXLA 1EH6A 1IF1A 2XASA 1ONVA 1BN5A 3FXUA 4IHTA 1UCRA 1FPQA 3WGGA 2VXZA 2ZMEA 3NRVA 2QBYB 3E6CC 3FMSA 1SFUA 1L0OC 2V1XA 4BQAA 3QP5A 4HF2A 4N9IA 3HRTA 1LDKB 3GUDA 1QZYA 2FNAA 3I71A 1XSXA 3BY6A 1D8KA 1I27A 4U0YA 3M7GA 4G7ZF 2OAZA 4ENMA 2LDUA 3BWGA 4RB1A 1BI2A 2FMLA 4DNCA 1XDSA 1WSUA 3BJOA 1I1GA 1O3QA 4HF0A 1V3FA 2XIGA 4AIKA 3F8BA 4FHTA 3CO7C 1HKSA 5IT9Z 3M8FA 2IA1A 3EDPA 5ICEA 4HV5A 4CDGA 1TQPA 2PQ8A 3R60A 2ZNZA 2FBHA 4AWXB 2HEOA 5AIPA 2Q0OA 3KP6A 2V6CA 4HW0A 2E1NA 3D5LA 2H6CA 1HKQA 1QPMA 2L3DA 1EV7A 3R0JA 1WI9A 3ML6A 2CGPA 3KEOA 1PP8F 5HVQC 4IRIA 2O0YA 1PP7U 5L3DA 2DK5A 3I5UA 2FU4A 3F21A 5BPIA 4HX8A 4RAYA 3QU3A 1MDMA 1ZH5A 5K5RA 1J5YA 3V7RA 1XSDA 1YFHA 3HRSA 3RYPA 4U7DA 4ESJA 3C1DA 2LF8A 4WK8F 3I64A 4U7BA 5E17F 2EFQA 3G3ZA 3ROUA 3IRQA 4UXNA 3RKYA 3DQVC 4EJVA 1P6RA 3U2RA 2JPCA 1SD6A 3MWMA 2BYVE 2AS5F 1Y0UA 2GA1A 2P4WA 1U5TA 4I0AA 1G3SA 2BE5F 3WG9A 3H92A 4A0XA 3GX4X 2VC1A 4M72A 1Z7UA 2WV0A 5FFZA 2HYFA 1OYWA 3CDHA 5A2QK 1FSHA 2H27A 2K02A 2DBBA 4HDVA 4M6YA 4NHJA 4G7HF 3RDIA 4EGZA 5BMZA 3VFZA 1IUYA 1S8NA 3H3UA 4CHUA 3P9KA 4OMZA 2MLGA 2L4MA 3KETA 4FX0A 4HV6A 2NYXA 4RGSA 1XCVA 2RGVA 4BXUA 1LQ1A 3CUOA 3FXQA 2GA2A 1D3YA 5ILUA 3K9TA 1FWZA 3KE2A 1FX7A 5E1WA 5DCMA 1HW2A 1TLHB 2LNBA 1GHCA 1JHFA 1G6NA 5H20A 1YS6A 4PGGA 2DQLA 2VODA 2FSWA 4LLLA 1H9GA 2EV0A 2H94A 5CYVA 2DU9A 1QBJA 3LA2A 2IPQX 2XKOA 4I09A 3V7SA 1LJ9A 3W6KB 4CICA 4KFCA 4HZFA 1YS7A 2O03A 5E20A 3IL2A 4Y15A 2FBIA 2Z99A 4XSZF 3ZPLA 2K27A 1IW7F 4MEYF 4A6DA 1B59A 1ZLKA 1JGSA 1TQIA 4YFNF 2DPUA 2IA2A 4LLGF 1GXPA 1J7KA 5DYMA 5FD6A 3RTRA 1P92A 4GO1A 3WTXC 2OQRA 5E18F 1LDJA 2FF4A 4LGWA 4UVCA 3V7CA 4UVBA 5FLXK 3R0AA 1AOYA 1FT9A 1Z9CA 5FGMA 2EA2A 5L3BA 3V4GA 5F64A 1H9TA 3I59B 3CUQC 4L9VA 2HKXA 5HS7A 4HF1A 2ADUA 5DEQA 3FHZA 3V8JA 2W24A 1RIOH 3LA7A 4KIBA 3ZMVA 3MZHA 2HFHA 2ZMEB 5FB2A 1FBUA 5A2QZ 3I0TA 2ESHA 2EFWA 2BBYA 2P5KA 3KLNA 5DV5A 4BHPA 3M8EA 4XLPF 3LAPA 2ZXJA 2BV6A 4AIJA 4D0PA 3QU6A 4S05A 3R6SA 1FY7A 1Z05A 2UXXA 2HTSA 4GGGA 4KICA 2QVOA 1FYLA 1C0WA 2XAHA 4R8HA 4PZJA 1ZHFA 4OMYA 2XAQA 2NAZA 2RDPA 1SMYF 5F1RA 1B4AA 4UNOA 1Q1HA 2HQRA 1BOAA 2EK5A 2A6HF 2KIFA 1OPCA 4EM2A 4WWCA 4RGXA 3TDZC 3KP7A 3TOBA 1K78B 2EFPA 3HIFA 1A04A 1VTNC 4GXOA 3DFGA 1X3UA 3L9FA 3QAHA 5D5VB 3JAMK 3K1NA 3GYHX 5L3GA 2FOKA 3E5QA 4RGRA 1ZG3A 2FMYA 2ACJA 5E1XA 3OV8A 3T8RA 1K6OA 2CFXA 4I7HA 1T0FA 2G7HA 2HOEA 3GFJA 3L09A 4GYIA 1LB2A 3I58A 4XSXF 5FO5A 1K7AA 3DP7A 4GYGA 3U1DA 5K1YA 1KU3A 3WGHA 2JTVA 4QWQA 2Y75A 3P7NA 4BYYA 4HQMA 3WTSC 5FLXZ 1P4AA 2QQAA 3I54A 5BS6A 3JTGA 5DUIA 3CLOA 1KGSA 2RNJA 1FBQA 2V1UA 2FQ3A 3HRMA 4RAZA 5L3FA 2K4JA 3CTAA 3FF5A 5D4RA 1UHMA 2XGXA 4U0WA 3O6BB 4OU0A 4KN4X 1QZZA 1USTA 4LK0F 1ON2A 5D6FA 4G7OF 3QPHA 1T98A 1FC3A 2BEOA 5D5WB 2L54A 3EUHA 2NNYA 5JI6A 4IRHA 1IN7A 3F23A 2H6BA 3GO5A 3LFKA 3LQRA 2LKPA 3WTUC 3F72A 4HLYA 4YFXF 5JR3A 3ABUA 3ZMTA 5CVRA 5ILVA 3RPUA 4HA8A 2A3SA 2F2EA 4M71A 3FMQA 1KQ0A 4L9TA 1QQIA 3KCCA 1BM9A 3LA3A 1IRGA 2YPRA 3O3KA 4LJZF 1IN4A 4LB6B 3N4MA 2YSRA 1FSEA 4WXHA 3FM3A 2J5OA 5K5OA 1TW3A 5ILSA 1R22A 2STTA 2HDCA 2UZKA 5JHUA 1QO0D 1XGSA 2DK8A 1HW5A 1R1TA 3V8LA 3MFKA 5KVRA 3HHGA 4IF4A 2H09A 3DPTA 5ICGA 4N9HA 3DPLC 3JAMZ 2KKOA 2PG4A 1TBXA 3C7JA 3CUQB 1F4KA 2XUBA 4LG0A 5BQTA 3Q9SA 2R7FA 5EEGA 4H0EA 1SFXA 3H3ZA 2FXAA 2QQBA 2IA0A 4WCGA 5HLHA 4XRFA 2D1HA 2OZ6A 3WE3A 1KQ8A 1ZREA 1ODDA 3M9AA 4HLXA 5LEKA 2VT3A 3SFZA 4B8XA 2F5FA 1P4WA 3JW4A 2XAFA 3E5UA 3DF8A 1ZRCA 2Q8KA 1XGOA 3K1MA 4G6DA 2F5EA 2FRHA 3L00A 2A07F 1I5ZA 1JHHA 3C3WA 4I0BA 1HSJA 4MTDA 1MGTA 2YR2A 2L01A 4L0ZB 1F1ZA 3LQQA 4Q47A 2EB7A 1ZRFA 2VC0A 3JSPA 5DD4A 3T8TA 5DDGA 1UHWA 3MQ0A 1L3LA 4M6XA 1W7PB 1BC8C 2RVCA 3J80K 2QLZA 3QRFF 1GXQA 1IAWA 3HTUA 2PMUA 1AWCA 3SQNA 4ESBA 1K79A 2QENA 3CO6C 1BI0A 2GXGA 3JTHA 3VB2A 2PLYA 2EA4A 2JRTA 4UUVA 2CYYA 3BZ6A 1PDNC 2VE9A 1DDNA 2A5YB 2Z33A 4JK1X 5HDKA 1JXSA 2CSOA 2A61A 3HOSA 4U88A 3KP5A 4DQ2A 2EV5A 3HSRA 4RB0A 2OA4A 3F8FA 2HQNA 4IPAA 2IVMA 4AIHA 3RJPA 5ERIA 2R7DA 2QYOA 1H0MA 1O7LA 2MLKA 1HXDA 2MD5A 2V1DA 1J75A 3T5XA 2NS0A 3WTVC 1G3TA 4ASNA 3L7WA 1U3EM 3F8CA 1U8RA 2PI0A 4HAMA 4P9UA 3MZYA 2VBXA 1U5TC 4Q48A 1S7OA 2P7CB 2PMHA 4P9FA 2UWMA 3E5XA 3I4PA 2B0LA 2GAUA 1SD7A 3TGNA 1XMKA 1STZA 3BJAA 3D0SA 3BJ6A 4RB3C 4EV0A 4AVPA 2FE3A 2P5LC 4R79A 5D5XB 4A6EA 3HSFA 5ED4A 5LRSA 1KYZA 1B6AA 1YLFA 2CG4A 4M9XA 2JPBA 2E7XA 1U78A 3WE2A 4L9JA 5LGNA 3N97A 3T0YA 3O2PE 5IT3A 2QM3A 1BIAA 4P5OA 3DKWA 3J80Z 4YFKF 3GXOA 1W5TA 2V9VA 1F9NA 5H6QA 1R5GA 2YX4A 3L2CA 4BAYA 3S2WA 1RI7A 1YW8A 3I53A 4O6JA 4A2UA 3GFIA 1IXSB 3BP8A 3TKYA 3F6VA 4ZYEA 1LEAA 4NQWA 5EEHA 4OIPF 5CVUA 3TOAA 5D4SA 2X4HA 4K2EA 1RZ4A 1FNNA 1YIOA 4ENNA 3W6JB 3P9IA 5FFXA 5J6XA 3KP4A 3PQJA 3J81K 1U2WA 2PN6A 4WXDA 2WWYA 4OIQF 1TNTA 4Y13A 3DXJF 2EFOA 2X0LA 2XVCA 1R7JA 2F5CA 4EMSA 3ZMDA 1YTYA 1QNTA 1E17A 1J9IA 2ZJ2A 1CGPA 1Z6RA 2CWEA 1HKTA 2OZUA 1Z1DA 1USSA 1J59A 3ZMSA 5DD8A 1HSTA 1OYIA 2Z9OA 3QPTA 1JE8A 2XKPA 3GVAA 2GWRA 3IWZA 4MEXF 1BC7C 4EQQA 2PEXA 2W84A 4U0VA 3DV8A 3EYYA 1PUEE 1DPUA 3RI4A 2VE8A 3PQKA 1IXCA 4G94A 5TRDA 1ZRDA 2DPDA 1S29A 2QWWA 3GFMA 3HUGA 2UXNA 2ISZA 2VONA 4G6QA 4L9NA 3ABTA 4BNCA 3GLXA 2Y0MA 4MHGA 4OOIA 1P2FA 2ZBKA 2R3SA 4OIOF 1F5TA 3TO9A 1EH8A 3EETA 3F6OA 3KZYA 2O3FA 3HOTA 5HLGA 4QLCU 4ZYDA 3K2ZA 3WU0A 2ETHA 3ISPA 3ZP5A 1R00A 1IN8A 3CJNA 2DTRA 4GCVA 2PBIA 4G8XA 2P8TA 2VBYA 5E8GA 4B09A 4CYDA 1FZPB 3F22A 1ON1A 1SAXA 4LFUA 1P4XA 2A6EF 1T39A 1RUOA 3ZMZA 3K0LA 1LDDA 5LEJA 1XB4A 3GFLA 2P7VB 2MH2A 2YU3A 4HX4A 1KYWA 4ZYHA 1KA8A 1MDMB 4TV7A 1DP7P 4KIGA 1G3WA 1TNSA 2FNPA 3J81Z 1R1VA 2GZWA 3VEPA 4HBLA 2HZTA 5D8KB 2XV4S 1ZGAA 1ZGJA 1S6LA 1GVJA 2YX7A 3KFWX 1KU7A 3B02A 2KJCA 2NRAC 3E3VA 2RN7A 3BROA 3P9CA 4LD5A 1U5TB 1W4MA 1ZARA 3IHUA 3ZN1A 2VN2A 5D6EA 5LRRA 2DLLA 2OU2A 4IJAA 5BPDA 5HOOA 2MA3A 4XLNF 2PJPA 2KRFA 1QGPA 2FEZA 3BPVA 4KA4A 1YO5C 1TTYA 3LWFA 1DPRA 2NNNA 5TJJA 2O8XA 5J8CA 1O3SA 1U6GA 1RUNA 1TW2A 2PFBA 1TQMA 3ULQB 2LSOA 5DCMB 3VODA 3RPQA 3KP3A 2IJLA 1FP2A 2JSCA 4F7ZA 1IZ1A 3IRRA 3I59A 2XAJA 2HGCA 3E97A 2WC2A 4UVAA 5DUKA 2L4AA 1IRFA 1G3YA 5H6RA 3GZ5A 2VBWA 3SHFA 5L3EA 3ECOA 3FXRA 2QUFA 5E1ZB 2W25A 4KT5C 5HLIA 1CF7A 5DCFA 3WTWC 1XMAA 3GEZA 2GQQA 2P6TA 4ENJA 4JQFA 2M5WA 1R58A 1W5SA 2IRFG 2CO5A 4EJTA 4P55A 3COAC 3DEUA 3K69A 2BGCA 3HHHA 2ESNA 2KIUA 1BJAA 3R61A 4LK1F 2OBPA 2QQ9A 2DT5A 4M9SA 1FYKA 4RGUA 2HS5A 3LAJA 3EQLF 1R23A 4ZZDA 1YQAA 4UV9A 5CVVA 4KNYA 3WTYC 2VBZA 4I01A 4RS8A 1ZG1A 2VOPA 5K5QA 2C6YA 1R36A 3V8KA 4N0BA 3WTZA 1V4RA 1K78A 4ESFA 2V79A 2XAGA 3KP2A 4MQ9F 3M1EA 2RKHA 3KLOA 3U9GA 2D1VA 2GIVA 1O3RA 1ZLJA 5LBQA 1WKMA 4R1HA 3QP6A 2DQRA 4E70A 2RC4A 1OKRA 3GW2A 3BPXA 4EGYA 1SMTA 1W7PD 2EV6A 4ZH4F 3F8MA 4ENKA 2HWVA 2ZFWA 4HX7A 4IRGA 5FD5A 2ZNYA 3HYIA 4CO8A 2IW5A 1HQCA 3R4KA 3RKXA 4OIRF 1G4DA 4Y17A 4WXCA 3ECHA 4JBAA 1LVAA 3E6BA 3MCZA 1O3TA 5JFRA 3HSEA 1REPC 4RB2C 3EYIA 4Q5SF 4L5JA 2M30A 5HS9A 4A5MA 2L02A 3LSTA 1LEBA 2Z5UA 3MEXA 5CLSA 2K4BA 1FP1D 3E6DA 1BI3A 2XRNA 2ZCWA 2O6GE 1R1UA 4MTEA 2XHKA 4M73A 3BOQA 3MAJA 4A0YA 1EH7A 4IVNA 1XCBA 5J8FA 2STWA 4M74A 2IP2A 2ZKZA 4I2OA 4CGZA 2DAOA 5LHIA 4WF2A 3RYRA 3AAFA 1FOKA 2W85A 4HQEA 3IKTA 2VOOA 3REOA 1S3JA 1O7FA 4L18B 3ZQ7A 1FYMA 2EFNA 4KDPA 3FWEA 4O5VA 4AD9A 3HRUA 2IT0A 2W57A 4A12A 1MJBA 5D8LB 1J2XA 2RV8A 5D5UB 3IC7A 4KMUX 1ULYA 4Q4ZF 4M9ZA 3IKVA 1O57A 1J0RA 3SZPA 5L3CA 2OD5A 4Z2YA 3E6MA 3QOPA 4A5NA 2QBYA 2ELHA 2DW4A 1MJ9A 3GZ6A 5HDNA 2ZO4A 2J5PA 3GF2A 2M1BA 1ZYRF 4EVIA 2FBKA 2MH9A 2QZ8A 5F6FA 5LGUA 4O3MA 3CUQA 5ICCA 1KU9A 4NB5A 4BHBA 2JZYA 1SD5A 3Q9VA 5CVJA 1OYYA 1XGMA 1MZBA 3SZTA 3FMRA 4KIFA 4MGRA 2G9WA 2DI3A 3SXYA 2MBFA 1Z91A 1OMIA 1BI1A 4L5IA 3G73A 3WTTC 2LF7A 3VOEA 3RIRA 3C18A 5HS8A 2HR3A 3NQOA 4P96A 4LMYA 4PGHA 3K1PA 1HW1A 2HYGD 5LHGA 3BDDA 4IXAA 1D5VA 5LHHA 2K7LA 1B1BA 4PCQA 4ETSA 3TDUC 5KK1A 2D45A 4FX4A 4HYEA 1CF7B 3ELKA 1SFEA 1W7PA 3IWFA 2RQPA 4MQVA 2OQGA 1HBXG 2HKOA 4I02A 3T1BA 4LG0B 3ZN0A 1FLIA 5BOXA 2M45A 4EJWA 2M87A 4YIFA 1YW9A 1T2KA 4I98B 1IN6A 5LLQA 3F3XA 2HTJA 3FZVA 1SD4A 1IXRC 4BH9A 4CZZA 2VT2A 4IHSA 1UB9A 1I1SA 2EWNA 2WTEA 1T6SA 1I6XA 4ZYGA 2Q2EA 3WU1B 1FBSA 4HOBA 3NEUA 1Z6TA 5HDGA 4CXFA 2P6SA 4WX9A 4EM0B 4ZZLA 2FA5A 2O61A 4PDKA 4KUMA 1MJAA 2ISYA 1R5HA 4KN7X 5AIQA 1YW7A 4YIIA 1D8JA 1ZAOA 2G7UA 2KJBA 1UFMA 2KIMA 2EJRA 5CVIA 1XD7A 5JVTA 4FT8A 2CQKA 2A69F 1S7AA 1BIBA 4A0ZA 1MD0A 3FM5A 2K86A 1LNWA 1XDUA 1ZN2A 1B9NA 1YYVA 2Y48A 5CJ9A 2M8EA 3J7AO 3PFIA 2DO7A 4KYWA 2E7WA 1NHAA 5AONA 2CW0F 2TDXA 6PAXA 4BHCA 2F5DA 3ZMUA 3Q5FA 1DUXC 3RKWA 4UHTA 4OINF 2COMA 4HDUA 5IT9K 4S04A 3B73A 5ICFA 1WRJA 2E1CA 4KMFA 1T38A 3KZZA 3TO7A 1ZG5A 3JSOA 3ERED 1XSVA 2DFIA 5E8IA 4EJOA 4ON0A 4YG2F 4L0YB 2Z3YA 1OR7A 2GXBA 1XGNA 2JT1A 2XROA 4EJUA 2P5VA 1KU2A 4LLNA 4LB5A 3WODF 1KQ9A 1RNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWX A;  4MNU A;  2D2W A;  3HTS B;  3TQN A;  3WGI A;  2A68 F;  4G9Y A;  3F8N A;  4EM1 A;  3GWZ A;  3TO6 A;  3FX3 A;  1YG2 A;  1E2X A;  1BBY A;  4XBF A;  1B9M A;  1IN5 A;  1MKM A;  1WQ2 A;  2MC3 A;  3KEQ A;  3OOP A;  5LGT A;  4UV8 A;  1XN7 A;  2AXL A;  1EH6 A;  1IF1 A;  2XAS A;  1ONV A;  1BN5 A;  3FXU A;  4IHT A;  1UCR A;  1FPQ A;  3WGG A;  2VXZ A;  2ZME A;  3NRV A;  2QBY B;  3E6C C;  3FMS A;  1SFU A;  1L0O C;  2V1X A;  4BQA A;  3QP5 A;  4HF2 A;  4N9I A;  3HRT A;  1LDK B;  3GUD A;  1QZY A;  2FNA A;  3I71 A;  1XSX A;  3BY6 A;  1D8K A;  1I27 A;  4U0Y A;  3M7G A;  4G7Z F;  2OAZ A;  4ENM A;  2LDU A;  3BWG A;  4RB1 A;  1BI2 A;  2FML A;  4DNC A;  1XDS A;  1WSU A;  3BJO A;  1I1G A;  1O3Q A;  4HF0 A;  1V3F A;  2XIG A;  4AIK A;  3F8B A;  4FHT A;  3CO7 C;  1HKS A;  5IT9 Z;  3M8F A;  2IA1 A;  3EDP A;  5ICE A;  4HV5 A;  4CDG A;  1TQP A;  2PQ8 A;  3R60 A;  2ZNZ A;  2FBH A;  4AWX B;  2HEO A;  5AIP A;  2Q0O A;  3KP6 A;  2V6C A;  4HW0 A;  2E1N A;  3D5L A;  2H6C A;  1HKQ A;  1QPM A;  2L3D A;  1EV7 A;  3R0J A;  1WI9 A;  3ML6 A;  2CGP A;  3KEO A;  1PP8 F;  5HVQ C;  4IRI A;  2O0Y A;  1PP7 U;  5L3D A;  2DK5 A;  3I5U A;  2FU4 A;  3F21 A;  5BPI A;  4HX8 A;  4RAY A;  3QU3 A;  1MDM A;  1ZH5 A;  5K5R A;  1J5Y A;  3V7R A;  1XSD A;  1YFH A;  3HRS A;  3RYP A;  4U7D A;  4ESJ A;  3C1D A;  2LF8 A;  4WK8 F;  3I64 A;  4U7B A;  5E17 F;  2EFQ A;  3G3Z A;  3ROU A;  3IRQ A;  4UXN A;  3RKY A;  3DQV C;  4EJV A;  1P6R A;  3U2R A;  2JPC A;  1SD6 A;  3MWM A;  2BYV E;  2AS5 F;  1Y0U A;  2GA1 A;  2P4W A;  1U5T A;  4I0A A;  1G3S A;  2BE5 F;  3WG9 A;  3H92 A;  4A0X A;  3GX4 X;  2VC1 A;  4M72 A;  1Z7U A;  2WV0 A;  5FFZ A;  2HYF A;  1OYW A;  3CDH A;  5A2Q K;  1FSH A;  2H27 A;  2K02 A;  2DBB A;  4HDV A;  4M6Y A;  4NHJ A;  4G7H F;  3RDI A;  4EGZ A;  5BMZ A;  3VFZ A;  1IUY A;  1S8N A;  3H3U A;  4CHU A;  3P9K A;  4OMZ A;  2MLG A;  2L4M A;  3KET A;  4FX0 A;  4HV6 A;  2NYX A;  4RGS A;  1XCV A;  2RGV A;  4BXU A;  1LQ1 A;  3CUO A;  3FXQ A;  2GA2 A;  1D3Y A;  5ILU A;  3K9T A;  1FWZ A;  3KE2 A;  1FX7 A;  5E1W A;  5DCM A;  1HW2 A;  1TLH B;  2LNB A;  1GHC A;  1JHF A;  1G6N A;  5H20 A;  1YS6 A;  4PGG A;  2DQL A;  2VOD A;  2FSW A;  4LLL A;  1H9G A;  2EV0 A;  2H94 A;  5CYV A;  2DU9 A;  1QBJ A;  3LA2 A;  2IPQ X;  2XKO A;  4I09 A;  3V7S A;  1LJ9 A;  3W6K B;  4CIC A;  4KFC A;  4HZF A;  1YS7 A;  2O03 A;  5E20 A;  3IL2 A;  4Y15 A;  2FBI A;  2Z99 A;  4XSZ F;  3ZPL A;  2K27 A;  1IW7 F;  4MEY F;  4A6D A;  1B59 A;  1ZLK A;  1JGS A;  1TQI A;  4YFN F;  2DPU A;  2IA2 A;  4LLG F;  1GXP A;  1J7K A;  5DYM A;  5FD6 A;  3RTR A;  1P92 A;  4GO1 A;  3WTX C;  2OQR A;  5E18 F;  1LDJ A;  2FF4 A;  4LGW A;  4UVC A;  3V7C A;  4UVB A;  5FLX K;  3R0A A;  1AOY A;  1FT9 A;  1Z9C A;  5FGM A;  2EA2 A;  5L3B A;  3V4G A;  5F64 A;  1H9T A;  3I59 B;  3CUQ C;  4L9V A;  2HKX A;  5HS7 A;  4HF1 A;  2ADU A;  5DEQ A;  3FHZ A;  3V8J A;  2W24 A;  1RIO H;  3LA7 A;  4KIB A;  3ZMV A;  3MZH A;  2HFH A;  2ZME B;  5FB2 A;  1FBU A;  5A2Q Z;  3I0T A;  2ESH A;  2EFW A;  2BBY A;  2P5K A;  3KLN A;  5DV5 A;  4BHP A;  3M8E A;  4XLP F;  3LAP A;  2ZXJ A;  2BV6 A;  4AIJ A;  4D0P A;  3QU6 A;  4S05 A;  3R6S A;  1FY7 A;  1Z05 A;  2UXX A;  2HTS A;  4GGG A;  4KIC A;  2QVO A;  1FYL A;  1C0W A;  2XAH A;  4R8H A;  4PZJ A;  1ZHF A;  4OMY A;  2XAQ A;  2NAZ A;  2RDP A;  1SMY F;  5F1R A;  1B4A A;  4UNO A;  1Q1H A;  2HQR A;  1BOA A;  2EK5 A;  2A6H F;  2KIF A;  1OPC A;  4EM2 A;  4WWC A;  4RGX A;  3TDZ C;  3KP7 A;  3TOB A;  1K78 B;  2EFP A;  3HIF A;  1A04 A;  1VTN C;  4GXO A;  3DFG A;  1X3U A;  3L9F A;  3QAH A;  5D5V B;  3JAM K;  3K1N A;  3GYH X;  5L3G A;  2FOK A;  3E5Q A;  4RGR A;  1ZG3 A;  2FMY A;  2ACJ A;  5E1X A;  3OV8 A;  3T8R A;  1K6O A;  2CFX A;  4I7H A;  1T0F A;  2G7H A;  2HOE A;  3GFJ A;  3L09 A;  4GYI A;  1LB2 A;  3I58 A;  4XSX F;  5FO5 A;  1K7A A;  3DP7 A;  4GYG A;  3U1D A;  5K1Y A;  1KU3 A;  3WGH A;  2JTV A;  4QWQ A;  2Y75 A;  3P7N A;  4BYY A;  4HQM A;  3WTS C;  5FLX Z;  1P4A A;  2QQA A;  3I54 A;  5BS6 A;  3JTG A;  5DUI A;  3CLO A;  1KGS A;  2RNJ A;  1FBQ A;  2V1U A;  2FQ3 A;  3HRM A;  4RAZ A;  5L3F A;  2K4J A;  3CTA A;  3FF5 A;  5D4R A;  1UHM A;  2XGX A;  4U0W A;  3O6B B;  4OU0 A;  4KN4 X;  1QZZ A;  1UST A;  4LK0 F;  1ON2 A;  5D6F A;  4G7O F;  3QPH A;  1T98 A;  1FC3 A;  2BEO A;  5D5W B;  2L54 A;  3EUH A;  2NNY A;  5JI6 A;  4IRH A;  1IN7 A;  3F23 A;  2H6B A;  3GO5 A;  3LFK A;  3LQR A;  2LKP A;  3WTU C;  3F72 A;  4HLY A;  4YFX F;  5JR3 A;  3ABU A;  3ZMT A;  5CVR A;  5ILV A;  3RPU A;  4HA8 A;  2A3S A;  2F2E A;  4M71 A;  3FMQ A;  1KQ0 A;  4L9T A;  1QQI A;  3KCC A;  1BM9 A;  3LA3 A;  1IRG A;  2YPR A;  3O3K A;  4LJZ F;  1IN4 A;  4LB6 B;  3N4M A;  2YSR A;  1FSE A;  4WXH A;  3FM3 A;  2J5O A;  5K5O A;  1TW3 A;  5ILS A;  1R22 A;  2STT A;  2HDC A;  2UZK A;  5JHU A;  1QO0 D;  1XGS A;  2DK8 A;  1HW5 A;  1R1T A;  3V8L A;  3MFK A;  5KVR A;  3HHG A;  4IF4 A;  2H09 A;  3DPT A;  5ICG A;  4N9H A;  3DPL C;  3JAM Z;  2KKO A;  2PG4 A;  1TBX A;  3C7J A;  3CUQ B;  1F4K A;  2XUB A;  4LG0 A;  5BQT A;  3Q9S A;  2R7F A;  5EEG A;  4H0E A;  1SFX A;  3H3Z A;  2FXA A;  2QQB A;  2IA0 A;  4WCG A;  5HLH A;  4XRF A;  2D1H A;  2OZ6 A;  3WE3 A;  1KQ8 A;  1ZRE A;  1ODD A;  3M9A A;  4HLX A;  5LEK A;  2VT3 A;  3SFZ A;  4B8X A;  2F5F A;  1P4W A;  3JW4 A;  2XAF A;  3E5U A;  3DF8 A;  1ZRC A;  2Q8K A;  1XGO A;  3K1M A;  4G6D A;  2F5E A;  2FRH A;  3L00 A;  2A07 F;  1I5Z A;  1JHH A;  3C3W A;  4I0B A;  1HSJ A;  4MTD A;  1MGT A;  2YR2 A;  2L01 A;  4L0Z B;  1F1Z A;  3LQQ A;  4Q47 A;  2EB7 A;  1ZRF A;  2VC0 A;  3JSP A;  5DD4 A;  3T8T A;  5DDG A;  1UHW A;  3MQ0 A;  1L3L A;  4M6X A;  1W7P B;  1BC8 C;  2RVC A;  3J80 K;  2QLZ A;  3QRF F;  1GXQ A;  1IAW A;  3HTU A;  2PMU A;  1AWC A;  3SQN A;  4ESB A;  1K79 A;  2QEN A;  3CO6 C;  1BI0 A;  2GXG A;  3JTH A;  3VB2 A;  2PLY A;  2EA4 A;  2JRT A;  4UUV A;  2CYY A;  3BZ6 A;  1PDN C;  2VE9 A;  1DDN A;  2A5Y B;  2Z33 A;  4JK1 X;  5HDK A;  1JXS A;  2CSO A;  2A61 A;  3HOS A;  4U88 A;  3KP5 A;  4DQ2 A;  2EV5 A;  3HSR A;  4RB0 A;  2OA4 A;  3F8F A;  2HQN A;  4IPA A;  2IVM A;  4AIH A;  3RJP A;  5ERI A;  2R7D A;  2QYO A;  1H0M A;  1O7L A;  2MLK A;  1HXD A;  2MD5 A;  2V1D A;  1J75 A;  3T5X A;  2NS0 A;  3WTV C;  1G3T A;  4ASN A;  3L7W A;  1U3E M;  3F8C A;  1U8R A;  2PI0 A;  4HAM A;  4P9U A;  3MZY A;  2VBX A;  1U5T C;  4Q48 A;  1S7O A;  2P7C B;  2PMH A;  4P9F A;  2UWM A;  3E5X A;  3I4P A;  2B0L A;  2GAU A;  1SD7 A;  3TGN A;  1XMK A;  1STZ A;  3BJA A;  3D0S A;  3BJ6 A;  4RB3 C;  4EV0 A;  4AVP A;  2FE3 A;  2P5L C;  4R79 A;  5D5X B;  4A6E A;  3HSF A;  5ED4 A;  5LRS A;  1KYZ A;  1B6A A;  1YLF A;  2CG4 A;  4M9X A;  2JPB A;  2E7X A;  1U78 A;  3WE2 A;  4L9J A;  5LGN A;  3N97 A;  3T0Y A;  3O2P E;  5IT3 A;  2QM3 A;  1BIA A;  4P5O A;  3DKW A;  3J80 Z;  4YFK F;  3GXO A;  1W5T A;  2V9V A;  1F9N A;  5H6Q A;  1R5G A;  2YX4 A;  3L2C A;  4BAY A;  3S2W A;  1RI7 A;  1YW8 A;  3I53 A;  4O6J A;  4A2U A;  3GFI A;  1IXS B;  3BP8 A;  3TKY A;  3F6V A;  4ZYE A;  1LEA A;  4NQW A;  5EEH A;  4OIP F;  5CVU A;  3TOA A;  5D4S A;  2X4H A;  4K2E A;  1RZ4 A;  1FNN A;  1YIO A;  4ENN A;  3W6J B;  3P9I A;  5FFX A;  5J6X A;  3KP4 A;  3PQJ A;  3J81 K;  1U2W A;  2PN6 A;  4WXD A;  2WWY A;  4OIQ F;  1TNT A;  4Y13 A;  3DXJ F;  2EFO A;  2X0L A;  2XVC A;  1R7J A;  2F5C A;  4EMS A;  3ZMD A;  1YTY A;  1QNT A;  1E17 A;  1J9I A;  2ZJ2 A;  1CGP A;  1Z6R A;  2CWE A;  1HKT A;  2OZU A;  1Z1D A;  1USS A;  1J59 A;  3ZMS A;  5DD8 A;  1HST A;  1OYI A;  2Z9O A;  3QPT A;  1JE8 A;  2XKP A;  3GVA A;  2GWR A;  3IWZ A;  4MEX F;  1BC7 C;  4EQQ A;  2PEX A;  2W84 A;  4U0V A;  3DV8 A;  3EYY A;  1PUE E;  1DPU A;  3RI4 A;  2VE8 A;  3PQK A;  1IXC A;  4G94 A;  5TRD A;  1ZRD A;  2DPD A;  1S29 A;  2QWW A;  3GFM A;  3HUG A;  2UXN A;  2ISZ A;  2VON A;  4G6Q A;  4L9N A;  3ABT A;  4BNC A;  3GLX A;  2Y0M A;  4MHG A;  4OOI A;  1P2F A;  2ZBK A;  2R3S A;  4OIO F;  1F5T A;  3TO9 A;  1EH8 A;  3EET A;  3F6O A;  3KZY A;  2O3F A;  3HOT A;  5HLG A;  4QLC U;  4ZYD A;  3K2Z A;  3WU0 A;  2ETH A;  3ISP A;  3ZP5 A;  1R00 A;  1IN8 A;  3CJN A;  2DTR A;  4GCV A;  2PBI A;  4G8X A;  2P8T A;  2VBY A;  5E8G A;  4B09 A;  4CYD A;  1FZP B;  3F22 A;  1ON1 A;  1SAX A;  4LFU A;  1P4X A;  2A6E F;  1T39 A;  1RUO A;  3ZMZ A;  3K0L A;  1LDD A;  5LEJ A;  1XB4 A;  3GFL A;  2P7V B;  2MH2 A;  2YU3 A;  4HX4 A;  1KYW A;  4ZYH A;  1KA8 A;  1MDM B;  4TV7 A;  1DP7 P;  4KIG A;  1G3W A;  1TNS A;  2FNP A;  3J81 Z;  1R1V A;  2GZW A;  3VEP A;  4HBL A;  2HZT A;  5D8K B;  2XV4 S;  1ZGA A;  1ZGJ A;  1S6L A;  1GVJ A;  2YX7 A;  3KFW X;  1KU7 A;  3B02 A;  2KJC A;  2NRA C;  3E3V A;  2RN7 A;  3BRO A;  3P9C A;  4LD5 A;  1U5T B;  1W4M A;  1ZAR A;  3IHU A;  3ZN1 A;  2VN2 A;  5D6E A;  5LRR A;  2DLL A;  2OU2 A;  4IJA A;  5BPD A;  5HOO A;  2MA3 A;  4XLN F;  2PJP A;  2KRF A;  1QGP A;  2FEZ A;  3BPV A;  4KA4 A;  1YO5 C;  1TTY A;  3LWF A;  1DPR A;  2NNN A;  5TJJ A;  2O8X A;  5J8C A;  1O3S A;  1U6G A;  1RUN A;  1TW2 A;  2PFB A;  1TQM A;  3ULQ B;  2LSO A;  5DCM B;  3VOD A;  3RPQ A;  3KP3 A;  2IJL A;  1FP2 A;  2JSC A;  4F7Z A;  1IZ1 A;  3IRR A;  3I59 A;  2XAJ A;  2HGC A;  3E97 A;  2WC2 A;  4UVA A;  5DUK A;  2L4A A;  1IRF A;  1G3Y A;  5H6R A;  3GZ5 A;  2VBW A;  3SHF A;  5L3E A;  3ECO A;  3FXR A;  2QUF A;  5E1Z B;  2W25 A;  4KT5 C;  5HLI A;  1CF7 A;  5DCF A;  3WTW C;  1XMA A;  3GEZ A;  2GQQ A;  2P6T A;  4ENJ A;  4JQF A;  2M5W A;  1R58 A;  1W5S A;  2IRF G;  2CO5 A;  4EJT A;  4P55 A;  3COA C;  3DEU A;  3K69 A;  2BGC A;  3HHH A;  2ESN A;  2KIU A;  1BJA A;  3R61 A;  4LK1 F;  2OBP A;  2QQ9 A;  2DT5 A;  4M9S A;  1FYK A;  4RGU A;  2HS5 A;  3LAJ A;  3EQL F;  1R23 A;  4ZZD A;  1YQA A;  4UV9 A;  5CVV A;  4KNY A;  3WTY C;  2VBZ A;  4I01 A;  4RS8 A;  1ZG1 A;  2VOP A;  5K5Q A;  2C6Y A;  1R36 A;  3V8K A;  4N0B A;  3WTZ A;  1V4R A;  1K78 A;  4ESF A;  2V79 A;  2XAG A;  3KP2 A;  4MQ9 F;  3M1E A;  2RKH A;  3KLO A;  3U9G A;  2D1V A;  2GIV A;  1O3R A;  1ZLJ A;  5LBQ A;  1WKM A;  4R1H A;  3QP6 A;  2DQR A;  4E70 A;  2RC4 A;  1OKR A;  3GW2 A;  3BPX A;  4EGY A;  1SMT A;  1W7P D;  2EV6 A;  4ZH4 F;  3F8M A;  4ENK A;  2HWV A;  2ZFW A;  4HX7 A;  4IRG A;  5FD5 A;  2ZNY A;  3HYI A;  4CO8 A;  2IW5 A;  1HQC A;  3R4K A;  3RKX A;  4OIR F;  1G4D A;  4Y17 A;  4WXC A;  3ECH A;  4JBA A;  1LVA A;  3E6B A;  3MCZ A;  1O3T A;  5JFR A;  3HSE A;  1REP C;  4RB2 C;  3EYI A;  4Q5S F;  4L5J A;  2M30 A;  5HS9 A;  4A5M A;  2L02 A;  3LST A;  1LEB A;  2Z5U A;  3MEX A;  5CLS A;  2K4B A;  1FP1 D;  3E6D A;  1BI3 A;  2XRN A;  2ZCW A;  2O6G E;  1R1U A;  4MTE A;  2XHK A;  4M73 A;  3BOQ A;  3MAJ A;  4A0Y A;  1EH7 A;  4IVN A;  1XCB A;  5J8F A;  2STW A;  4M74 A;  2IP2 A;  2ZKZ A;  4I2O A;  4CGZ A;  2DAO A;  5LHI A;  4WF2 A;  3RYR A;  3AAF A;  1FOK A;  2W85 A;  4HQE A;  3IKT A;  2VOO A;  3REO A;  1S3J A;  1O7F A;  4L18 B;  3ZQ7 A;  1FYM A;  2EFN A;  4KDP A;  3FWE A;  4O5V A;  4AD9 A;  3HRU A;  2IT0 A;  2W57 A;  4A12 A;  1MJB A;  5D8L B;  1J2X A;  2RV8 A;  5D5U B;  3IC7 A;  4KMU X;  1ULY A;  4Q4Z F;  4M9Z A;  3IKV A;  1O57 A;  1J0R A;  3SZP A;  5L3C A;  2OD5 A;  4Z2Y A;  3E6M A;  3QOP A;  4A5N A;  2QBY A;  2ELH A;  2DW4 A;  1MJ9 A;  3GZ6 A;  5HDN A;  2ZO4 A;  2J5P A;  3GF2 A;  2M1B A;  1ZYR F;  4EVI A;  2FBK A;  2MH9 A;  2QZ8 A;  5F6F A;  5LGU A;  4O3M A;  3CUQ A;  5ICC A;  1KU9 A;  4NB5 A;  4BHB A;  2JZY A;  1SD5 A;  3Q9V A;  5CVJ A;  1OYY A;  1XGM A;  1MZB A;  3SZT A;  3FMR A;  4KIF A;  4MGR A;  2G9W A;  2DI3 A;  3SXY A;  2MBF A;  1Z91 A;  1OMI A;  1BI1 A;  4L5I A;  3G73 A;  3WTT C;  2LF7 A;  3VOE A;  3RIR A;  3C18 A;  5HS8 A;  2HR3 A;  3NQO A;  4P96 A;  4LMY A;  4PGH A;  3K1P A;  1HW1 A;  2HYG D;  5LHG A;  3BDD A;  4IXA A;  1D5V A;  5LHH A;  2K7L A;  1B1B A;  4PCQ A;  4ETS A;  3TDU C;  5KK1 A;  2D45 A;  4FX4 A;  4HYE A;  1CF7 B;  3ELK A;  1SFE A;  1W7P A;  3IWF A;  2RQP A;  4MQV A;  2OQG A;  1HBX G;  2HKO A;  4I02 A;  3T1B A;  4LG0 B;  3ZN0 A;  1FLI A;  5BOX A;  2M45 A;  4EJW A;  2M87 A;  4YIF A;  1YW9 A;  1T2K A;  4I98 B;  1IN6 A;  5LLQ A;  3F3X A;  2HTJ A;  3FZV A;  1SD4 A;  1IXR C;  4BH9 A;  4CZZ A;  2VT2 A;  4IHS A;  1UB9 A;  1I1S A;  2EWN A;  2WTE A;  1T6S A;  1I6X A;  4ZYG A;  2Q2E A;  3WU1 B;  1FBS A;  4HOB A;  3NEU A;  1Z6T A;  5HDG A;  4CXF A;  2P6S A;  4WX9 A;  4EM0 B;  4ZZL A;  2FA5 A;  2O61 A;  4PDK A;  4KUM A;  1MJA A;  2ISY A;  1R5H A;  4KN7 X;  5AIQ A;  1YW7 A;  4YII A;  1D8J A;  1ZAO A;  2G7U A;  2KJB A;  1UFM A;  2KIM A;  2EJR A;  5CVI A;  1XD7 A;  5JVT A;  4FT8 A;  2CQK A;  2A69 F;  1S7A A;  1BIB A;  4A0Z A;  1MD0 A;  3FM5 A;  2K86 A;  1LNW A;  1XDU A;  1ZN2 A;  1B9N A;  1YYV A;  2Y48 A;  5CJ9 A;  2M8E A;  3J7A O;  3PFI A;  2DO7 A;  4KYW A;  2E7W A;  1NHA A;  5AON A;  2CW0 F;  2TDX A;  6PAX A;  4BHC A;  2F5D A;  3ZMU A;  3Q5F A;  1DUX C;  3RKW A;  4UHT A;  4OIN F;  2COM A;  4HDU A;  5IT9 K;  4S04 A;  3B73 A;  5ICF A;  1WRJ A;  2E1C A;  4KMF A;  1T38 A;  3KZZ A;  3TO7 A;  1ZG5 A;  3JSO A;  3ERE D;  1XSV A;  2DFI A;  5E8I A;  4EJO A;  4ON0 A;  4YG2 F;  4L0Y B;  2Z3Y A;  1OR7 A;  2GXB A;  1XGN A;  2JT1 A;  2XRO A;  4EJU A;  2P5V A;  1KU2 A;  4LLN A;  4LB5 A;  3WOD F;  1KQ9 A;  1RNL A; 
#chains in the Genus database with same CATH topology
 4XN0 A;  2E36 A;  2K40 A;  1WWX A;  3J7Z I;  3A01 B;  3VYS B;  4MNU A;  4C2U A;  2D2W A;  3HTS B;  3TQN A;  4XRS A;  3WGI A;  2A68 F;  4G9Y A;  3F8N A;  4EM1 A;  3GWZ A;  3TO6 A;  3K4B A;  1LPQ A;  3FX3 A;  3QOD A;  1YG2 A;  4L5E A;  1E2X A;  1BBY A;  1TT0 A;  1YIJ I;  4F52 A;  4XBF A;  1B9M A;  1IN5 A;  1MKM A;  2ZXW H;  3K4M A;  1WQ2 A;  2MC3 A;  3KEQ A;  1VQ5 I;  3OOP A;  4XLE A;  5LGT A;  4UV8 A;  1XN7 A;  1X1C A;  2L7K A;  2AXL A;  1EH6 A;  1TL8 A;  1IF1 A;  3GTL J;  1TZL A;  2XAS A;  1ONV A;  1BN5 A;  1DQU A;  2K9L A;  3NAR A;  4XK4 A;  2M2E A;  4XON A;  3FXU A;  5HOD A;  1UCR A;  1FPQ A;  4IHT A;  1SVL A;  3G1M A;  2WA0 A;  2X1D A;  3WGG A;  2PX9 A;  1GVD A;  2W00 A;  3FKJ A;  3PFY A;  2VXZ A;  3TBI A;  1QA6 A;  1MBH A;  2ZME A;  4E7H A;  4UUT A;  3NRV A;  2QBY B;  3E6C C;  3FMS A;  3UKG A;  2ID3 A;  1SFU A;  4E7S A;  1L0O C;  1MBG A;  5KHD A;  2V1X A;  3ERM A;  4BQA A;  1OCP A;  3QP5 A;  4HF2 A;  2FOW A;  4N9I A;  3HRT A;  1LDK B;  4AU7 A;  3BR6 A;  3GUD A;  1QZY A;  2FNA A;  3I71 A;  1XSX A;  3BY6 A;  1D8K A;  3PJR A;  3CF5 F;  1ETX A;  3QPS A;  3E7L A;  1I27 A;  2IS4 A;  3ABM H;  4U0Y A;  2LVS A;  3M7G A;  5CKT A;  3BR2 A;  4G7Z F;  2NOJ B;  2OAZ A;  4ENM A;  3OYN A;  4FCY A;  4Y7N J;  2CV2 A;  2YU9 J;  1MH4 A;  2LDU A;  3BWG A;  4RB1 A;  2L5Q A;  1BI2 A;  2FML A;  4DNC A;  3KPH A;  1XDS A;  4X0G A;  4NQW B;  1WSU A;  3BQZ A;  1WJD A;  3BJO A;  3TW7 A;  1I1G A;  1O3Q A;  4HF0 A;  2V1N A;  3M07 A;  2DFF A;  4KIS A;  4RM2 A;  3K70 C;  1V3F A;  2XIG A;  3J7Y J;  3DU5 A;  4AIK A;  3F8B A;  4YEL A;  3QOE A;  4FHT A;  3DPU A;  3ZQH A;  3PIO F;  3CO7 C;  1HKS A;  4F93 B;  3GTJ J;  5IT9 Z;  1S5L C;  3G4S I;  3UR3 C;  3M8F A;  1RKT A;  2B7E A;  3LSI A;  2IA1 A;  3OYE A;  3EDP A;  3LMM A;  4X1E A;  5ICE A;  3HB9 A;  1APL C;  4HV5 A;  4CDG A;  1TQP A;  2PQ8 A;  3R60 A;  1V54 H;  3SYT A;  1RR7 A;  3C2H A;  1QVT A;  2I5U A;  2ZNZ A;  2WAE A;  2FBH A;  3HPH A;  4AWX B;  2HEO A;  3G2B A;  5AIP A;  2R7Z J;  2Q0O A;  3A2K A;  1T33 A;  3KP6 A;  1JUP A;  3S14 J;  1ZEL A;  2V6C A;  1DU6 A;  3A0B C;  2KZG A;  5J4Y A;  2IS6 A;  4HW0 A;  1VQ8 I;  4KIT B;  4XN3 A;  2E1N A;  1HDP A;  3VSK A;  3D5L A;  3ZR8 X;  2H6C A;  1HKQ A;  1QPM A;  2L3D A;  1EV7 A;  3R0J A;  1WI9 A;  4IHY A;  1IG7 A;  3ML6 A;  2CGP A;  3KEO A;  1PP8 F;  2TRT A;  5HVQ C;  4IRI A;  4PJ0 C;  2O0Y A;  3ZQQ A;  2VQG A;  3FK6 A;  2V4J C;  5L3D A;  1PP7 U;  2DK5 A;  3I5U A;  3ASN H;  2FU4 A;  3PL8 A;  5E79 C;  3F21 A;  5BPI A;  3VSL A;  3DBL B;  4HX8 A;  4RAY A;  4M3B A;  3QU3 A;  1MDM A;  1ZH5 A;  1OLT A;  2DOD A;  1J5Y A;  1QHG A;  5K5R A;  3V7R A;  1XSD A;  3HUG B;  1YFH A;  4C2T A;  5FRM A;  3HRS A;  3RYP A;  4HNU A;  4U7D A;  4ESJ A;  3C1D A;  2X1E A;  2LF8 A;  4WK8 F;  3I64 A;  4BXF A;  4U7B A;  5E17 F;  3S15 J;  1LE8 A;  2EFQ A;  3G3Z A;  3PO2 J;  4EEF G;  3ROU A;  3IRQ A;  4UXN A;  2ZJQ F;  1A6Q A;  3RKY A;  4IQJ A;  3DQV C;  4EJV A;  5B66 C;  1Y8R B;  1YI2 I;  3ABK H;  2IBD A;  1P6R A;  1J09 A;  2HVQ A;  3U2R A;  2JPC A;  1SD6 A;  3MWM A;  2BYV E;  3PSF A;  2AS5 F;  1OCO H;  3HOU J;  1R6R A;  3OS1 A;  2R7V A;  3IUO A;  2NVY J;  4DIQ A;  1Y0U A;  3WU2 C;  3JRE A;  2GA1 A;  3K4J A;  5EG0 A;  2P4W A;  3Q0V A;  4XIC A;  4JX5 A;  3RQI A;  1U5T A;  1BR2 A;  4I0A A;  1G3S A;  2BE5 F;  3WG9 A;  3H92 A;  3MZ8 A;  4A0X A;  3GX4 X;  2VC1 A;  4M72 A;  1Z7U A;  5K7F A;  4MO7 A;  2WV0 A;  5FFZ A;  2R7T A;  2HYF A;  1MMS A;  2NVT J;  2UV1 A;  1UG2 A;  1OYW A;  3B6A A;  3S1Q J;  3CDH A;  1GT0 C;  3TL4 X;  2DA5 A;  5A2Q K;  2XPV A;  1FSH A;  2H27 A;  2K02 A;  2DBB A;  1FOX A;  1WH5 A;  4HDV A;  4M6Y A;  4NHJ A;  4G7H F;  2K9Q A;  3L2W A;  4UY8 I;  2BXZ A;  3RDI A;  2QSF X;  1P7J A;  4EGZ A;  3Q0W A;  3VFZ A;  5BMZ A;  1IUY A;  1S8N A;  4XOR A;  5E3N A;  2VI6 A;  2OPT A;  3I4M J;  2OCE A;  3H3U A;  4CHU A;  3P9K A;  3GME A;  3BG6 A;  2E34 A;  4OMZ A;  1ENH A;  1ETQ A;  4A3I J;  5F1J A;  2MLG A;  2L4M A;  3KET A;  4FX0 A;  2BY3 A;  3S1M J;  4UB8 C;  4HV6 A;  2NYX A;  4RGS A;  4BJ6 C;  1XCV A;  2RGV A;  4BXU A;  2EZH A;  1WJF A;  2DOA A;  1LQ1 A;  3CUO A;  3FXQ A;  2CQN A;  2GA2 A;  1D3Y A;  5ILU A;  3K9T A;  1NK2 P;  1FWZ A;  3KE2 A;  2HDW A;  1FX7 A;  2NS8 A;  2QKM B;  5E1W A;  3S3O A;  3IAM 2;  5DCM A;  1HW2 A;  1LKX A;  1TLH B;  1IV6 A;  3CLQ A;  2LNB A;  2KRC A;  3FIS A;  1GHC A;  1JHF A;  3OYB A;  2OUM A;  3ZQG A;  1PUF B;  1G6N A;  5H20 A;  1YS6 A;  4PGG A;  1Z3Y A;  2IEK A;  2DQL A;  3BTI A;  5J3L A;  2VOD A;  2FSW A;  4LLL A;  1H9G A;  3M8J A;  2DJN A;  3S1N J;  4XID A;  2CUF A;  4P1W A;  2EV0 A;  2H94 A;  5CYV A;  5C4X J;  2DU9 A;  1QBJ A;  2HQ5 A;  3LA2 A;  1K6Y A;  3KYL A;  2IPQ X;  2XKO A;  4I09 A;  1SAN A;  2EH3 A;  3V7S A;  1LJ9 A;  3W6K B;  4CIC A;  4KFC A;  4HZF A;  3DTK A;  2LBF A;  1YS7 A;  2O03 A;  5E20 A;  3H5N A;  2ZC2 A;  3M3Y J;  3IL2 A;  3X2Q H;  1WCM J;  3RZD J;  1QU3 A;  4Y15 A;  4ANJ A;  2FBI A;  2Z99 A;  4XSZ F;  3ZPL A;  3FXO A;  5E3L A;  2YUS A;  2K27 A;  1FMV A;  1IW7 F;  4MEY F;  4A6D A;  4GRI A;  1B59 A;  2R5Z B;  1ZLK A;  2AXT C;  2QGU A;  1JGS A;  3S3M A;  1TQI A;  4YFN F;  2DPU A;  2IA2 A;  4LLG F;  4RLQ A;  4A3J J;  2MYS A;  1I6H J;  3KIO A;  1GXP A;  4ZDO A;  2JK3 A;  1J7K A;  5DYM A;  5DM7 F;  5FD6 A;  3RTR A;  1P92 A;  4GO1 A;  3WTX C;  9ANT A;  2OQR A;  4Y3O A;  5M3M J;  5E18 F;  1LDJ A;  5K7H A;  1YE9 A;  2CUJ A;  3DLA A;  4HSR A;  1IDY A;  2FF4 A;  3CP8 A;  4LGW A;  1R49 A;  2WAQ A;  1SEU A;  4UVC A;  1TT5 B;  3LOC A;  3V7C A;  1WFX A;  4UVB A;  2KT0 A;  5FLX K;  3R0A A;  2GOX B;  3RPU D;  1B8I A;  1AOY A;  1FT9 A;  3OYL A;  1I39 A;  1K4S A;  2VUM J;  3D5R C;  2GBY A;  2KZV A;  4XOP A;  1Z9C A;  3H0G J;  5FGM A;  2EA2 A;  4CCL A;  5E3O A;  5L3B A;  4IKF A;  4JX6 A;  4HEA 2;  3V4G A;  5F64 A;  1H9T A;  2KDZ A;  3I59 B;  1NG7 A;  2VQH A;  3CUQ C;  3MD2 A;  4L9V A;  1XMX A;  4C3J J;  2HKX A;  3VPR A;  5HS7 A;  3DTI A;  4HNT A;  4HF1 A;  2ADU A;  3H3V K;  5DEQ A;  3FHZ A;  3L2V A;  3V8J A;  2E1M C;  2N8G A;  2W24 A;  2VKH A;  3VYU B;  1RIO H;  3LA7 A;  4KIB A;  1Z67 A;  3ZMV A;  2W7N A;  3MZH A;  2HVS A;  5FLV A;  1K61 A;  2HFH A;  2ZME B;  2OC6 A;  5FB2 A;  3K70 D;  1FBU A;  5A2Q Z;  3I0T A;  2HU9 A;  3UNG C;  1POG A;  2ESH A;  2LR8 A;  3HC7 A;  1ZTR A;  4BKX A;  2EFW A;  3CQZ J;  4IZZ A;  3SDB A;  3IH2 A;  2M9H A;  2BBY A;  1W5C C;  2P5K A;  3KLN A;  5DV5 A;  4CYC B;  5CQG A;  1WHU A;  4BHP A;  1VQ7 I;  3DBH B;  3M8E A;  5EF6 A;  4XLP F;  2MD0 A;  3LAP A;  2ZXJ A;  2VJ4 A;  1HF0 A;  2BV6 A;  4AIJ A;  4D0P A;  3QU6 A;  4S05 A;  2FX0 A;  3R6S A;  2L9R A;  2X1C A;  2E2J J;  1V5F A;  1AA7 A;  3MKY B;  4J01 A;  1FY7 A;  1Z05 A;  2UXX A;  2HTS A;  2JA6 J;  1E0E A;  4GGG A;  4A3K J;  4KIC A;  1D1B A;  5M3F J;  2QVO A;  1FYL A;  1C0W A;  2XAH A;  4R8H A;  4D1Q A;  3F0C A;  1OIS A;  3LSH A;  2LKX A;  4DW6 A;  2BOL A;  4PZJ A;  1ZHF A;  2F6C A;  4OMY A;  2DDA A;  2XAQ A;  2NS7 A;  2NAZ A;  2RDP A;  1SMY F;  1Y1W J;  5F1R A;  1B4A A;  4UNO A;  3JRG A;  1Q1H A;  2HQR A;  1U0J A;  3H35 A;  3LSJ A;  1BOA A;  2EK5 A;  2A6H F;  1W36 D;  1EA3 A;  4W1U A;  2KIF A;  1JKR C;  3PO3 J;  2M4G A;  1OPC A;  4EM2 A;  5K7Z A;  4WWC A;  4CH7 A;  2VJI A;  3LFU A;  4RGX A;  3TDZ C;  3KP7 A;  3TOB A;  3CC4 I;  3PM1 A;  4PFP A;  3SJM A;  4IO9 F;  3LSG A;  3GZN B;  4IHV A;  1K78 B;  2EFP A;  4DYQ A;  2GOM A;  3HIF A;  1VI0 A;  4HNV A;  5EGO A;  1IC8 A;  1A04 A;  2KQR A;  1V55 H;  5J1U A;  2EPF A;  1VTN C;  4GXO A;  2VKV A;  3DFG A;  1X3U A;  4F92 B;  3OYA A;  2R7O A;  4E7L A;  3L9F A;  4RBO A;  3RKQ A;  1LFP A;  4BY1 J;  3QAH A;  2PJR A;  4C2M J;  1IRZ A;  5D5V B;  3JAM K;  3K1N A;  3GYH X;  1SFK A;  5L3G A;  2FOK A;  3E5Q A;  2R5Y B;  4RGR A;  1A6I A;  3CMY A;  1ZG3 A;  2JSP A;  4XLH A;  2FMY A;  1H89 C;  2ACJ A;  5E1X A;  1RKW A;  1QVU A;  3OV8 A;  3T8R A;  1K6O A;  4CCK A;  4XKC A;  2CFX A;  2WY7 Q;  4I7H A;  1T0F A;  3MVP A;  2G7H A;  1YRN A;  2HOE A;  3OS0 A;  3GFJ A;  3L09 A;  4GYI A;  1LB2 A;  3I58 A;  4XSX F;  5FO5 A;  1ETY A;  1K7A A;  3DP7 A;  4GYG A;  1X1P A;  3U1D A;  5K1Y A;  1KU3 A;  2QKL B;  3WGH A;  2JTV A;  4QWQ A;  2Y75 A;  3W2W A;  3P7N A;  4BYY A;  4HQM A;  3WTS C;  5FLX Z;  4ZTJ A;  1G2H A;  1VQ6 I;  1P4A A;  1SAU A;  2QQA A;  3I54 A;  5BS6 A;  1LE8 B;  4BJ5 C;  3JTG A;  5DUI A;  3CLO A;  3MKZ A;  1KGS A;  2DDB A;  2RNJ A;  2K85 A;  3JRC A;  2ZSH B;  1FBQ A;  3OIP A;  2V1U A;  2FQ3 A;  3HRM A;  4C9Y A;  4RAZ A;  5L3F A;  1AHD P;  2HOS A;  2K4J A;  4BQQ A;  1VND A;  3CTA A;  2M3A A;  5GTI C;  2KLO A;  1VQN I;  3FF5 A;  5D4R A;  1UHM A;  2XGX A;  2PMZ N;  3HPG A;  4U0W A;  2KRH A;  2EZK A;  4JX4 A;  1BW5 A;  5IP6 A;  4X6A J;  2HXI A;  2L9V A;  4KT6 A;  3O6B B;  2DA7 A;  4OU0 A;  1HA8 A;  4KN4 X;  1QZZ A;  2WB1 A;  1UST A;  3K4C A;  3K4N A;  3L2U A;  4LK0 F;  1ON2 A;  5D6F A;  4G7O F;  3QPH A;  2V26 A;  1JT6 A;  1T98 A;  1FC3 A;  2BEO A;  5D5W B;  2L54 A;  2KIQ A;  3EUH A;  1YX5 A;  1X4P A;  1TWA J;  3ZOB A;  2NNY A;  2WV1 A;  2I10 A;  3HKZ A;  5JI6 A;  4B4C A;  4IRH A;  1GV5 A;  1IN7 A;  1Y1V J;  2XF7 A;  2ZXH A;  4C3H J;  1AKH A;  5HLT A;  5IPA A;  3F23 A;  2H6B A;  2A6T A;  2LFB A;  3GO5 A;  1S72 I;  3SDG A;  1XC5 A;  3LFK A;  2BHY A;  3LQR A;  3TMO A;  2LKP A;  2CU7 A;  3WTU C;  4MLO A;  4BL0 B;  3F72 A;  5IY5 H;  4HLY A;  3DTE A;  3LNQ A;  4PFO A;  4YFX F;  5JR3 A;  3ABU A;  3ZMT A;  1R4M B;  4M6V A;  5CVR A;  1FJL A;  2QSH X;  5ILV A;  3RPU A;  4HA8 A;  4CCO A;  4A3B J;  3OYM A;  2A3S A;  2F2E A;  4M71 A;  3FMQ A;  1U9N A;  2DA4 A;  1KQ0 A;  3H1C A;  4L9T A;  5FKO A;  5LD2 C;  1QQI A;  3KCC A;  3OYG A;  4BXX J;  2OV7 A;  3EPZ A;  1BM9 A;  3LA3 A;  1IRG A;  2YPR A;  3IH4 A;  3O3K A;  3QYB A;  4LJZ F;  1IN4 A;  2RQQ A;  4LB6 B;  3N4M A;  2YSR A;  1FSE A;  4WXH A;  3FM3 A;  5GPC A;  2H1L A;  2J5O A;  1OR7 C;  2VLA A;  5K5O A;  1TW3 A;  2Z16 A;  1ZK8 A;  5ILS A;  2VJJ A;  3J7A Y;  1R22 A;  1ZGW A;  1HC8 A;  1V5G A;  2STT A;  2HDC A;  2UZK A;  3A1Y A;  5JHU A;  1QO0 D;  1XGS A;  2DK8 A;  3G6E I;  1D0Z A;  4J00 A;  1ZR2 A;  4BEH A;  5JVG F;  1HW5 A;  1ZKG A;  1R1T A;  2I8D A;  4Y52 J;  3V8L A;  4B3X A;  3MFK A;  5KVR A;  1IJW C;  3HHG A;  2CQ7 A;  4IF4 A;  2H09 A;  4XLF A;  3DPT A;  2CW7 A;  4XNF A;  5ICG A;  5EDN A;  3JRF A;  4N9H A;  5EZG A;  3DPL C;  3FIW A;  5EJC A;  3JAM Z;  4A93 J;  4NBQ A;  5IYC J;  3BR3 A;  2XF6 A;  2KKO A;  2DFE A;  1A31 A;  2PG4 A;  1TBX A;  3C7J A;  3CUQ B;  1F4K A;  2XUB A;  4LG0 A;  5BQT A;  3HXL A;  3EUK L;  2R7F A;  3Q9S A;  5EEG A;  5FJ8 J;  2KDO A;  2LG4 A;  4H0E A;  1SFX A;  1IDZ A;  2BW3 B;  3H3Z A;  2FXA A;  4C30 A;  2L9S A;  2E1M B;  2QQB A;  1NTC A;  3CZ6 A;  1MIJ A;  2IA0 A;  1U8B A;  2LRE A;  2M7A A;  2XB5 A;  4WCG A;  3MMY B;  5HLH A;  4XRF A;  2D1H A;  2OZ6 A;  4E7J A;  3WE3 A;  1KQ8 A;  1P7I A;  1ZRE A;  1ODD A;  3M9A A;  2JWT A;  2DOF A;  1ETW A;  4HLX A;  3I55 I;  1A5J A;  5LEK A;  2VT3 A;  1WZ2 A;  2LYC A;  1FTZ A;  3SFZ A;  4B8X A;  2F5F A;  2IGO A;  3GTO J;  1P4W A;  1W1W E;  2X9D A;  3JW4 A;  4Y33 A;  2XAF A;  3E5U A;  3DF8 A;  3FK7 A;  2ZME C;  1ZRC A;  2Q8K A;  1XGO A;  3K1M A;  4G6D A;  2F5E A;  3OL3 A;  4D9J A;  3OWT A;  4II2 A;  4BGD A;  2FRH A;  1ORK A;  1EJ9 A;  3L00 A;  2A07 F;  1I5Z A;  1RR8 C;  1B8I B;  1JHH A;  3ASO H;  3PIP F;  3C3W A;  4I0B A;  5IOZ A;  2E5Z A;  1HSJ A;  1CQT A;  5F0F A;  4MTD A;  1MGT A;  3Q3S A;  4PUS A;  5B1B H;  1Y0N A;  4UUS B;  2XC7 A;  2YR2 A;  2L01 A;  1IUF A;  4L0Z B;  4DGW B;  1F1Z A;  3DEE A;  4A3G J;  3LQQ A;  4Q47 A;  4QIW N;  3GBG A;  4ZC3 A;  2FJ1 A;  2EB7 A;  1ZRF A;  2VC0 A;  2GIZ A;  3JSP A;  2VPL A;  4DBQ A;  5DD4 A;  3T8T A;  5DDG A;  2HXO A;  1UHW A;  5KNL A;  3MQ0 A;  2R0Q C;  1MH3 A;  2QQ8 A;  1L3L A;  4NC6 A;  2EQR A;  1W7P B;  4M6X A;  2A05 A;  1BC8 C;  1O4X A;  3IV5 A;  3M1C A;  2RVC A;  3J80 K;  2QLZ A;  4RAF A;  3BTL A;  1TP4 A;  3QRF F;  2E19 A;  2EZI A;  1GXQ A;  5FRN A;  1IAW A;  3HTU A;  5IYB J;  4W97 A;  2PMU A;  1AWC A;  3SQN A;  4HRI A;  1HOM A;  4PK4 A;  4A69 C;  4ESB A;  1K79 A;  3OYJ A;  4DJA A;  2QEN A;  3HOZ J;  2Y9Y A;  1LFU P;  3CO6 C;  1D5Y A;  1BI0 A;  2GXG A;  2LC2 A;  3TP0 A;  1RPW A;  3JTH A;  3VB2 A;  1VZ0 A;  2PLY A;  2K9S A;  2EA4 A;  3BG5 A;  1PVE A;  2JRT A;  2Q2E B;  2W4S A;  4UUV A;  3FXL A;  2CYY A;  1GUU A;  1HLV A;  1ETO A;  3BQY A;  3BZ6 A;  4JOM A;  3HM5 A;  1X3Z B;  3N05 A;  3I56 I;  1PDN C;  2ECC A;  2VE9 A;  1DDN A;  3GLL A;  2A5Y B;  2MG4 A;  2IAI A;  2Z33 A;  4JK1 X;  5HDK A;  1B72 A;  1JXS A;  2OF7 A;  2CSO A;  1R4N B;  2A61 A;  3OYC A;  3HOS A;  4U88 A;  3KP5 A;  4DQ2 A;  2MGQ A;  2EV5 A;  3HSR A;  4CA0 A;  4RB0 A;  2OA4 A;  3F8F A;  5EGO B;  2HQN A;  3G1O A;  4IPA A;  4D5C A;  2IVM A;  5J4V A;  4AIH A;  3H36 A;  4DYR A;  3CC7 I;  2V6E A;  1MND A;  3BCA A;  3RJP A;  3ZXS A;  3FBN B;  4LIV A;  5ERI A;  1PJR A;  5F08 A;  3SEZ A;  2R7D A;  2QYO A;  2R7S A;  1H0M A;  1RET A;  5F0C A;  1O7L A;  2MLK A;  1HXD A;  2MD5 A;  1WJA A;  3BT9 A;  2V1D A;  4NUB A;  1J75 A;  2HNH A;  4LG3 A;  2OTJ I;  3T5X A;  2NS0 A;  2DYR H;  5DM6 F;  2HYJ A;  4MFE A;  1G3T A;  2K9N A;  3MN2 A;  3WTV C;  4ASN A;  3OS2 A;  1UJ8 A;  1Y8Q B;  3A01 A;  2HPM A;  2E35 A;  3L7W A;  1U3E M;  2XPW A;  3F8C A;  2B9S A;  5DS9 A;  1U8R A;  2PI0 A;  2DN0 A;  4HAM A;  1JTY A;  4IEJ A;  1X58 A;  4P9U A;  3MZY A;  2W82 A;  2X85 A;  2RNG A;  2P81 A;  2VBX A;  1U5T C;  4Q48 A;  2UUZ A;  1SVM A;  1S7O A;  2O7O A;  3BG9 A;  3JRB A;  2P7C B;  2PMH A;  3A4C A;  4P9F A;  2UWM A;  3E5X A;  1T08 B;  3I4P A;  4B3A A;  2IGK A;  2B0L A;  2GAU A;  1SD7 A;  3FXJ A;  3TGN A;  1XMK A;  1JTX A;  5KCM A;  1STZ A;  3BJA A;  3D0S A;  3BJ6 A;  4RB3 C;  4EV0 A;  4AVP A;  2FE3 A;  2P5L C;  4PSX A;  4R79 A;  5D5X B;  4A6E A;  3HSF A;  3BLY A;  5ED4 A;  5LRS A;  1KYZ A;  1B6A A;  2COB A;  1YLF A;  2CG4 A;  3ZRG A;  4BAC A;  4M9X A;  4BE0 A;  2H8W A;  2BVL A;  2EIL H;  2X6Y A;  3DKY A;  1T56 A;  2JPB A;  3OYF A;  1N78 A;  2E7X A;  1U78 A;  2JRM A;  3WE2 A;  4L9J A;  5LGN A;  3N97 A;  1ZQ3 P;  1OCT C;  2EIK H;  2WAQ N;  1NG6 A;  3T0Y A;  4YEJ A;  3O2P E;  4NNJ A;  5IT3 A;  2QM3 A;  3QWL A;  2EIN H;  1BIA A;  4M3F A;  4P5O A;  4RA2 A;  4RMN A;  1BOB A;  1MBK A;  2CJJ A;  3AG4 H;  3DKW A;  2DMQ A;  3BG7 A;  3J80 Z;  2NVQ J;  3QPL A;  3CJT B;  4YFK F;  3GXO A;  1BJZ A;  1W5T A;  2V9V A;  1F9N A;  5H6Q A;  1R5G A;  2YX4 A;  5GAG J;  3L2C A;  4C3I J;  4BAY A;  3S2W A;  1RI7 A;  1R9T J;  2IS2 A;  1BR1 A;  4XKW A;  5E3M A;  3DLL F;  4IHW A;  3VYT B;  3ABL H;  1YW8 A;  3S17 J;  2JQ7 A;  3I53 A;  4O6J A;  4A2U A;  3GFI A;  1IXS B;  3BP8 A;  4B47 A;  1JT0 A;  3TKY A;  3F6V A;  1IV8 A;  4ZYE A;  1LEA A;  4NQW A;  5EEH A;  2Y0S N;  3TP3 A;  4OIP F;  3CDL A;  3AKZ A;  4E6K G;  2OTL I;  5CVU A;  3TOA A;  5D4S A;  2X4H A;  4ZDL A;  4K2E A;  1RZ4 A;  4A3C J;  2LKS A;  1FNN A;  3CDI A;  1ETV A;  1YIO A;  4OAY A;  4ENN A;  3W6J B;  3GTG J;  3P9I A;  1WH7 A;  5C44 J;  1FOY A;  5FFX A;  1BA5 A;  5J6X A;  5F0H A;  3KP4 A;  5KAF C;  2NVU B;  3PQJ A;  1VQO I;  3J81 K;  1U2W A;  2PN6 A;  4WXD A;  4I6Z A;  2V9P A;  2WWY A;  4OIQ F;  1TNT A;  4Y13 A;  1DGR M;  3DXJ F;  4F3Q A;  2Y30 A;  2EFO A;  2X0L A;  2XVC A;  1R7J A;  3OMY A;  4AC0 A;  4XRM A;  1FEX A;  2VAS A;  4V19 K;  2F5C A;  4EMS A;  3W6V A;  3CCL I;  2O9L A;  2HOA A;  2BHZ A;  3ZMD A;  1WVR A;  1YTY A;  1QNT A;  3PSI A;  1E17 A;  1J9I A;  2ZJ2 A;  3O8H A;  1CGP A;  2AHQ A;  1Z6R A;  2CWE A;  1IRX A;  1HKT A;  2OZU A;  1Z1D A;  2JUG A;  2M8G X;  1Z77 A;  4BS9 A;  2JA8 J;  1USS A;  3RQ4 A;  1J59 A;  3LSK A;  4YIR X;  1AU7 A;  1ERD A;  3ZMS A;  5DD8 A;  1HST A;  1OYI A;  2Z9O A;  3QPT A;  1JE8 A;  1IGN A;  2XKP A;  3GVA A;  5EYR A;  1FOW A;  2DJI A;  5M5W J;  2GWR A;  4S0H B;  3IWZ A;  3BR0 A;  4MEX F;  1BC7 C;  4EQQ A;  2EBI A;  2ZSI B;  4J19 A;  1Z3X A;  2PEX A;  2W84 A;  2X6W A;  3CP2 A;  4U0V A;  3BTJ A;  4QSH A;  3DV8 A;  3H0D A;  3EYY A;  3PNY A;  1SFO J;  3CCS I;  1PUE E;  3KX2 A;  1MBJ A;  3IH3 A;  1GDT A;  1WPK A;  1DPU A;  2GLO A;  3RI4 A;  2VE8 A;  3PQK A;  1IXC A;  3PNT A;  4G94 A;  5TRD A;  2ECB A;  1ZRD A;  2DPD A;  3CCY A;  1S29 A;  2IGN A;  2QWW A;  3GFM A;  3S8P A;  3AL0 B;  3HUG A;  2DMP A;  2UXN A;  2ISZ A;  4AUX A;  2F4O B;  2VON A;  4G6Q A;  4CCM A;  4L9N A;  5IP7 J;  4JP0 A;  4RAG A;  4AYB N;  3ABT A;  4RDU A;  2K3F A;  4BNC A;  3GLX A;  3OYD A;  2Y0M A;  4MHG A;  1NH3 A;  4OOI A;  3KZI C;  3GTM J;  2CUZ A;  3H5R A;  1P2F A;  1N77 A;  1JKO C;  2ZBK A;  2R3S A;  2X6X A;  4OIO F;  1F5T A;  3TO9 A;  2RRE A;  2XGC A;  2ICW G;  1EH8 A;  3DEW A;  3EET A;  4ABZ A;  3F6O A;  3AG1 H;  3KZY A;  3O8G A;  2O3F A;  3HOT A;  2BZT A;  2DA2 A;  5HLG A;  2ID6 A;  4QLC U;  1UMQ A;  3E0J B;  1JI8 A;  1D1C A;  1XG1 A;  2NXN B;  1T8I A;  1E3H A;  1X1A A;  3LSR A;  4BQN A;  4ZYD A;  3CCJ I;  1RES A;  1MMN A;  4RLF A;  3CCR I;  2VKD A;  1LUJ B;  3K2Z A;  3WU0 A;  2ETH A;  1MNM C;  3ISP A;  4Y4R A;  3A0H C;  3ZP5 A;  1R00 A;  1IN8 A;  3CJN A;  4IOA F;  2DTR A;  3NAU A;  2LD5 A;  3HGY A;  4GCV A;  3ZQF A;  2PBI A;  4G8X A;  1JUM A;  2P8T A;  2VBY A;  5IOY A;  4V2G A;  5E8G A;  4B09 A;  3HGG A;  2F5V A;  4OWR B;  4CYD A;  1FZP B;  3F22 A;  1ON1 A;  2VKE A;  3EUA A;  1SAX A;  4LFU A;  1GV2 A;  1P4X A;  1TWG J;  2A6E F;  3U1K A;  1T39 A;  1RUO A;  2R4G A;  3K0L A;  1LDD A;  3ZMZ A;  2Y69 H;  5LEJ A;  2NOG A;  4ZYA A;  1XB4 A;  2VL8 A;  3GFL A;  3SEQ A;  2P7V B;  2MH2 A;  4BUP A;  2YU3 A;  2WY8 Q;  2HPI A;  4HX4 A;  1KYW A;  3NWT A;  1RC9 A;  5B1A H;  3ZQL A;  3VWB A;  1X1D A;  4YRV A;  4ZYH A;  1FTT A;  1KA8 A;  2DA1 A;  1MDM B;  1MMG A;  4TV7 A;  3MKL A;  1DP7 P;  4KIG A;  1G3W A;  1TNS A;  2WB1 N;  3L1P A;  3GTQ J;  2E5N A;  3W2V A;  1MBF A;  2GM4 A;  3CD6 I;  2VJ5 A;  5FKN A;  3ZQI A;  4Z6Y A;  1UAA A;  1TC3 C;  2FNP A;  3DU6 A;  3J81 Z;  1R1V A;  2GZW A;  1VQ4 I;  2HI3 A;  1BW6 A;  3VEP A;  4HBL A;  4BU2 A;  3D1N I;  2HZT A;  2LLK A;  5F04 A;  4PJJ A;  5D8K B;  4MFD A;  4M3E A;  2XV4 S;  1PUF A;  1ZGA A;  3CJR B;  4GFB A;  1ZGJ A;  1S6L A;  1GVJ A;  2YX7 A;  3KFW X;  1KU7 A;  3B02 A;  1BR4 A;  4M3D A;  2KJC A;  5EG0 B;  2NRA C;  3E3V A;  2RN7 A;  1SVO A;  3BRO A;  3P9C A;  1U5T B;  4LD5 A;  3QYE A;  2ME0 A;  1LVK A;  1W4M A;  2Y31 A;  1ZAR A;  1QRY A;  1KZH A;  3G1L A;  3GTK J;  3FXK A;  1Q1V A;  3IHU A;  3ZN1 A;  2VN2 A;  2MFZ A;  2QEX I;  2WAD A;  5D6E A;  1S7E A;  5LRR A;  3DWL E;  4XQF A;  4IQ4 A;  1HDD C;  1Z0X A;  3U21 A;  3K10 A;  2DLL A;  1T0F C;  2K3P A;  2OCC H;  2OU2 A;  4IJA A;  5BPD A;  2ME6 A;  2R7U A;  5HOO A;  2MA3 A;  4ITV A;  4XLN F;  2PJP A;  2KRF A;  2WAF A;  1QGP A;  2R5Z A;  1X2M A;  2FEZ A;  2L0K A;  2R7R A;  3DKX A;  1Y56 A;  3BPV A;  4KA4 A;  1YO5 C;  1MMD A;  3HBL A;  1TTY A;  2Y9Z A;  1ZR4 A;  3LWF A;  2LRD A;  5C4J J;  2MC4 A;  1DPR A;  1P9Q C;  2NNN A;  2VPR A;  3OY9 A;  1LFB A;  5TJJ A;  3HG9 A;  2O8X A;  4B43 A;  5J8C A;  2XSD C;  1O3S A;  3BR1 A;  1K4T A;  2XGD A;  1X1B A;  5KAI C;  3HDD A;  4PJM A;  1U6G A;  2VIX A;  4XR6 A;  1TW2 A;  2PMZ A;  1RUN A;  2PFB A;  3ZQC A;  1TQM A;  3ULQ B;  2L7F P;  2LSO A;  2CQX A;  5DCM B;  3RPQ A;  3VOD A;  1W0U A;  3KP3 A;  2IJL A;  4B48 A;  1FP2 A;  2JSC A;  4F7Z A;  2ZJR F;  3ZCO A;  4ZTF A;  1JKP C;  1IZ1 A;  1PYV A;  1Z7L A;  3IRR A;  3PNV A;  2JVH A;  4XLC A;  3I59 A;  2XAJ A;  2HGC A;  2D5V A;  3E97 A;  2WC2 A;  4UVA A;  5DUK A;  4XKV A;  3Q0U A;  3QQA A;  2L4A A;  3EUH C;  1IRF A;  2R7Q A;  1G3Y A;  2JUC A;  1D0Y A;  5H6R A;  2Z1D A;  3GZ5 A;  2VBW A;  3SHF A;  5L3E A;  2HDD A;  3ECO A;  2GXA A;  3FXR A;  4PJL A;  3OYK A;  1R5I D;  2QUF A;  5E1Z B;  5FRO A;  3S32 A;  2W25 A;  3CMA I;  4KT5 C;  1VQM I;  5HLI A;  1YJ9 I;  1CF7 A;  1OJL A;  4BDZ A;  2ELJ A;  5DCF A;  3WTW C;  1MSF C;  3DBR B;  4HPQ A;  5FKM A;  2LBF B;  4IX7 A;  4N4N B;  1XMA A;  3GEZ A;  3K7A J;  2GQQ A;  2P6T A;  4BDY A;  4NDL A;  4ENJ A;  5B5E C;  1YJN I;  2R7X A;  5FLM J;  1I3Q J;  4JQF A;  2M5W A;  5FKL A;  1R58 A;  4E7Z A;  1W5S A;  2IRF G;  1JJ8 C;  4CYC A;  4F55 A;  2CO5 A;  2CH0 A;  4EJT A;  1MSE C;  2VXD A;  3I3L A;  4IL6 C;  4P55 A;  3SFI A;  4BBS J;  3COA C;  3DEU A;  3K69 A;  1MNE A;  2BGC A;  2IGM A;  2Z2S B;  3IP4 B;  1I50 J;  3HHH A;  2ESN A;  1VQP I;  2KIU A;  1BJA A;  3R61 A;  4LK1 F;  3CCV I;  1WJE A;  1YHQ I;  3BTC A;  2OBP A;  1KON A;  2QQ9 A;  2DT5 A;  4M9S A;  3A02 A;  1FYK A;  4RGU A;  2HS5 A;  3LAJ A;  3HEF A;  1X19 A;  3EQL F;  3OOU A;  3OR1 C;  1R23 A;  4JYK A;  4ZZD A;  1YQA A;  4UV9 A;  5CVV A;  1FMW A;  2VQL A;  3CCM I;  4E4H A;  4FIS A;  4KNY A;  3WTY C;  2VBZ A;  4AM3 A;  4I01 A;  4RS8 A;  1Y39 A;  1ZG1 A;  2VOP A;  5K5Q A;  2MSY A;  3OL4 A;  1NK3 P;  4FQG A;  2C6Y A;  1R36 A;  1F36 A;  3V8K A;  4N0B A;  3WTZ A;  1V4R A;  1MMA A;  3HJE A;  5DTD A;  1K78 A;  4ESF A;  2V79 A;  2XAG A;  2XSJ C;  3HZJ A;  3KP2 A;  4MQ9 F;  3M1E A;  1HCR A;  2RKH A;  1OCR H;  3WG7 H;  4CCJ A;  3A03 A;  3AL0 C;  3S93 A;  3PUF A;  3TW6 A;  2XGE A;  3KLO A;  1TWH J;  4MIM A;  3U9G A;  1VQK I;  2OJE D;  1F43 A;  2X48 A;  4FE4 A;  2D1V A;  2GIV A;  1O3R A;  5GAH J;  1ZLJ A;  5LBQ A;  1WKM A;  4R1H A;  1X4O A;  1Z21 A;  3QP6 A;  3CCQ I;  2DQR A;  4QPO A;  1WJ5 A;  4E70 A;  1WGX A;  2RC4 A;  1OKR A;  2R5Y A;  3GW2 A;  3BPX A;  4EGY A;  1SMT A;  1SC7 A;  1W7P D;  2EV6 A;  1W36 C;  1WJB A;  3F8M A;  4ZH4 F;  5JLW A;  4ENK A;  2HWV A;  2KL4 A;  1JKQ C;  2ZFW A;  4BY7 J;  4HX7 A;  4IOC F;  2EIM H;  2BY2 A;  4IRG A;  5FD5 A;  1XPX A;  2ZNY A;  3BZK A;  2M0C A;  3HYI A;  4CO8 A;  2IW5 A;  1HQC A;  3R4K A;  4XLA A;  2QF7 A;  3RKX A;  5GAD J;  2H1K A;  4OIR F;  1G4D A;  4Y17 A;  4D7N A;  2LMD A;  4XM3 A;  4WXC A;  4DYC A;  5F27 A;  3ECH A;  2E2I J;  2L7Z A;  4JBA A;  4G6T B;  1LVA A;  3E6B A;  3MCZ A;  4D7M A;  2BVM A;  4CSW A;  1O3T A;  5JFR A;  3HSE A;  4F91 B;  1S9H A;  2BY1 A;  2CV0 A;  1REP C;  4RB2 C;  3EYI A;  4HST A;  4OAZ A;  3CCU I;  5JHF A;  2L7M P;  4Q5S F;  2EIJ H;  2K9M A;  4L5J A;  2M30 A;  2M0M A;  5HS9 A;  4A5M A;  2L02 A;  3LST A;  1LEB A;  2Z5U A;  3MEX A;  5CLS A;  3K6G A;  1IO2 A;  1RRJ A;  2K4B A;  3IAS 2;  1FP1 D;  3E6D A;  2XRL A;  2F4M B;  5CQE A;  1BI3 A;  2XRN A;  2ZCW A;  3DCF A;  2O6G E;  1R1U A;  2DT6 A;  4MTE A;  2ZJP F;  3JR9 A;  3FHN A;  3GTP J;  5J1Y A;  5IYD J;  2XHK A;  4M73 A;  2DT7 B;  3KYC B;  2QA4 I;  3BOQ A;  3MAJ A;  2JA5 J;  1UZC A;  4A0Y A;  2HQA A;  5TIS C;  1EH7 A;  2CW8 A;  4IVN A;  1XCB A;  1V5E A;  1JGG A;  4IHX A;  5J8F A;  2P0W A;  2STW A;  1XTA A;  4M74 A;  2IP2 A;  5C3E J;  2DTZ A;  2ZKZ A;  4I2O A;  4CGZ A;  3HL2 A;  2PJR B;  3JCU C;  4FTH A;  2DAO A;  2VB6 A;  5LHI A;  4D5F A;  3E1S A;  4AID A;  4BBR J;  4WF2 A;  3RYR A;  3AAF A;  5M5Y J;  1FOK A;  2KPM A;  4BQO A;  4HG2 A;  2W85 A;  2CQQ A;  4HQE A;  3IKT A;  2VOO A;  3REO A;  3RSN A;  4XKB A;  3W3C A;  3AFH A;  1OCZ H;  1S3J A;  1O7F A;  2O5R A;  2TCT A;  3ZQ7 A;  4L18 B;  2KFD A;  1FYM A;  3OYH A;  2EFN A;  2K5C A;  1YRN B;  4KDP A;  3HOW J;  2WBM A;  3FWE A;  3KYD B;  2H8R A;  4O5V A;  2DXI A;  4AD9 A;  3HRU A;  1I3A A;  4XL9 A;  2IT0 A;  2W57 A;  3M4O J;  4A12 A;  1MJB A;  1QZE A;  3CF2 A;  5TGT A;  4PSW A;  2E2H J;  5D8L B;  1X2N A;  1J2X A;  4ZDP A;  3L2Q A;  2LY1 A;  2RV8 A;  5D5U B;  3H9G A;  3AG3 H;  2NVX J;  4AVZ A;  3IC7 A;  4KMU X;  5B3S H;  1ULY A;  3I9V 2;  4Q4Z F;  2CFO A;  3OIO A;  4M9Z A;  3IKV A;  1O57 A;  1XS9 A;  1J0R A;  3OIQ A;  3SZP A;  5L3C A;  2OD5 A;  2Y2Z A;  4Z2Y A;  3FBI B;  4A3E J;  1M1E B;  3E6M A;  3QOP A;  4A5N A;  3WHB A;  2QBY A;  2ELH A;  2DW4 A;  1MJ9 A;  3GZ6 A;  5HDN A;  2ZO4 A;  1FIA A;  2J5P A;  4DZP A;  5EEA A;  3CCE I;  2DOE A;  3GF2 A;  3CJQ B;  2M1B A;  1ZYR F;  4EVI A;  2CMP A;  2ZFU A;  1BL0 A;  2FBK A;  1DGW Y;  2MH9 A;  2QZ8 A;  2R7W A;  4LIU A;  4ZJZ A;  5F6F A;  1N75 A;  3BC8 A;  2DFH A;  5GPA A;  5LGU A;  4E7K A;  3W2A A;  4O3M A;  3CUQ A;  5ICC A;  2DMT A;  4XMY A;  3S2H J;  1KU9 A;  2XB0 X;  4NB5 A;  4PJN A;  4BHB A;  1AKH B;  2LP0 A;  5HNH A;  4I99 C;  2X51 A;  2BW3 A;  2JZY A;  2G0E A;  3ZGK A;  4XOT A;  5GP9 A;  1SD5 A;  2KP6 A;  3Q9V A;  5CVJ A;  1OYY A;  3NWS A;  3FDY A;  1XGM A;  1MZB A;  1D0X A;  3KEY A;  1X3W B;  3SZT A;  3FMR A;  4KIF A;  2QSG X;  1QHH D;  4MGR A;  5GTH C;  2G9W A;  2DI3 A;  2E60 A;  2V7F A;  4QPQ A;  3SXY A;  5HNF A;  3H9J A;  2V9K A;  2MBF A;  1Z91 A;  4EAT A;  1OMI A;  3AG2 H;  1BI1 A;  3H9Q A;  4L5I A;  3G73 A;  1MBE A;  4DOZ A;  4LIT A;  1MW7 A;  2ELK A;  2LOO A;  4GDF A;  2DCE A;  3FXM A;  3WTT C;  4NC7 A;  3CME I;  2LF7 A;  3VOE A;  3OSG A;  3BG3 A;  3RIR A;  2XDV A;  5J47 A;  1JJ6 C;  3C18 A;  4DZJ A;  5HS8 A;  2VQC A;  2FUG 2;  2HR3 A;  3NQO A;  4P96 A;  1VF9 A;  4LMY A;  4PGH A;  4FET A;  3BR5 A;  2IS1 A;  3K1P A;  1HW1 A;  3P5J A;  2HYG D;  1OCC H;  3OR2 C;  5LHG A;  2LH9 A;  3ONQ A;  3BDD A;  4IXA A;  3QYF A;  3C2G A;  1D5V A;  3PUB A;  5LHH A;  2K7L A;  5BNG A;  1B1B A;  4UUS A;  2O8K A;  3V42 A;  3BCB A;  3CC2 I;  4PCQ A;  1G8X A;  4UB6 C;  2FD5 A;  5JLX A;  2XAU A;  3JRI A;  3VYR B;  3TDU C;  4ETS A;  3G71 I;  4XRS G;  1D1A A;  3ESW B;  4BEH B;  2FQ4 A;  1XX5 A;  5KK1 A;  4QTR A;  2D45 A;  2Y0S A;  4A3F J;  4G12 A;  4FX4 A;  2HVR A;  4HYE A;  2RAE A;  1CF7 B;  3ELK A;  4II3 A;  1SFE A;  1T95 A;  1W7P A;  3IWF A;  2RQP A;  4V2F A;  2CRG A;  2CV1 A;  3OSF A;  4MQV A;  2OQG A;  1HBX G;  2HKO A;  4I02 A;  3T1B A;  2KHM A;  4B1R A;  4LG0 B;  1H88 C;  3ZN0 A;  3HOY J;  1FLI A;  5BOX A;  2M45 A;  4EJW A;  2JA2 A;  2M87 A;  4YIF A;  2DMU A;  1YW9 A;  1UEL B;  2MW8 A;  2W48 A;  1T2K A;  1UG0 A;  4I98 B;  1IN6 A;  2E71 A;  5LLQ A;  2JMW A;  3F3X A;  2QCO A;  3HOV J;  2HTJ A;  2CS3 A;  3FZV A;  1SD4 A;  1IXR C;  1ETK A;  2JJ7 A;  4BH9 A;  4CZZ A;  2VT2 A;  4IHS A;  1UB9 A;  3K4K A;  3LL7 A;  3BZC A;  1I1S A;  1DP3 A;  2EWN A;  2WTE A;  1T6S A;  1I6X A;  4E7I A;  4ZYG A;  1WI3 A;  2E1O A;  1W0T A;  2Q2E A;  3WU1 B;  3I4N J;  2LTP A;  4CUG A;  1FBS A;  4HOB A;  3LSM A;  3NEU A;  3WHC A;  1G59 A;  1QPI A;  1TWC J;  1VQ9 I;  1Z6T A;  2KIS A;  5HDG A;  4CXF A;  3GCM A;  2P6S A;  1EF4 A;  4WX9 A;  4EM0 B;  4ZZL A;  2L2O A;  3RZO J;  2XF5 A;  1E3P A;  2FA5 A;  2AO9 A;  1GLN A;  3K4L A;  3D5S C;  4CCN A;  2O61 A;  3SZG A;  2X6O A;  3JRA A;  1OFC X;  2CUE A;  5J1R A;  4PDK A;  1VQL I;  2M34 A;  4KUM A;  1MJA A;  2ISY A;  3S1R J;  1R5H A;  5LFA A;  2EZL A;  4KN7 X;  5AIQ A;  1ACI A;  4NC8 A;  1YW7 A;  2F4I A;  1JUS A;  1TWF J;  4YII A;  1D8J A;  1ZAO A;  2G7U A;  3CMM A;  2MAB A;  3LSP A;  2KJB A;  2DYS H;  1EKE A;  1R71 A;  3S16 J;  2M4K A;  1WJC A;  1A35 A;  1UFM A;  2KIM A;  2F48 A;  2EJR A;  5J40 A;  5CVI A;  1XD7 A;  3FKI J;  5JVT A;  4FT8 A;  2CQK A;  2A69 F;  1S7A A;  4I76 A;  3F9K A;  1ITY A;  4AYB A;  2JVG A;  1BIB A;  2LY9 A;  4A0Z A;  2ZB9 A;  1MD0 A;  3RCO A;  1FIP A;  4A3D J;  4U87 A;  3MKW B;  3FM5 A;  2M7B A;  2K86 A;  1YJW I;  2DA6 A;  1LNW A;  1XDU A;  1ZN2 A;  1N25 A;  3B6C A;  2DA3 A;  1B9N A;  5EZH A;  3VDX A;  1YYV A;  2A5W A;  2JA7 J;  2IXS A;  2Y48 A;  3C2B A;  5CJ9 A;  2M8E A;  3K2A A;  3J7A O;  3HOX J;  3PFI A;  2DO7 A;  4KYW A;  3TED A;  2E7W A;  2LK2 A;  4BJT A;  1NHA A;  2DMN A;  1OQY A;  2Q1Z B;  1U9O A;  1VFC A;  5AON A;  2AQE A;  2CW0 F;  2TDX A;  2BY0 A;  5GAE J;  6PAX A;  4BHC A;  2F5D A;  3ZMU A;  3JRH A;  3Q5F A;  1DUX C;  1A36 A;  2KMU A;  4BE1 A;  3HKZ N;  2ZXI A;  4RM3 A;  2LY2 A;  3RKW A;  5M5X J;  3S3N A;  4DBR A;  4B44 A;  4N4O B;  1E3O C;  4UHT A;  4OIN F;  2COM A;  2W1O A;  2JN6 A;  2AQF A;  5FKK A;  4A3L J;  2BXY A;  2L9N A;  4HDU A;  5IT9 K;  4S04 A;  3B73 A;  5ICF A;  3S2D J;  2R92 J;  1YX3 A;  5CPR B;  1WRJ A;  3OYI A;  5H2F C;  3JRD A;  2E1C A;  4KMF A;  4CZC A;  1T38 A;  3L2R A;  2YS9 A;  4M3G A;  4A3M J;  1YOV B;  1DU0 A;  1B72 B;  2HOT A;  3H5A A;  3KZZ A;  2XPU A;  3TO7 A;  1ZG5 A;  4H4K C;  3CES A;  4LOC A;  3JSO A;  4FAS D;  3ERE D;  1XSV A;  2DFI A;  4FE7 A;  5E8I A;  4EJO A;  1H8A C;  4ON0 A;  4BE2 A;  5IP9 J;  1K83 J;  4YG2 F;  2R93 J;  1Y6I A;  4L0Y B;  2Z3Y A;  1OR7 A;  2GXB A;  1XGN A;  2JT1 A;  2B63 J;  1YIT I;  2XRO A;  4EJU A;  1UHS A;  4KJZ A;  2P5V A;  1KU2 A;  2HZD A;  4LLN A;  4LB5 A;  3WOD F;  1KQ9 A;  1RNL A; 
#chains in the Genus database with same CATH homology
 1WWX A;  4MNU A;  2D2W A;  3HTS B;  3TQN A;  3WGI A;  2A68 F;  4G9Y A;  3F8N A;  4EM1 A;  3GWZ A;  3TO6 A;  3FX3 A;  1YG2 A;  1E2X A;  1BBY A;  4XBF A;  1B9M A;  1IN5 A;  1MKM A;  1WQ2 A;  2MC3 A;  3KEQ A;  3OOP A;  5LGT A;  4UV8 A;  1XN7 A;  2AXL A;  1EH6 A;  1IF1 A;  2XAS A;  1ONV A;  1BN5 A;  3FXU A;  4IHT A;  1UCR A;  1FPQ A;  3WGG A;  2VXZ A;  2ZME A;  3NRV A;  2QBY B;  3E6C C;  3FMS A;  1SFU A;  1L0O C;  2V1X A;  4BQA A;  3QP5 A;  4HF2 A;  4N9I A;  3HRT A;  1LDK B;  3GUD A;  1QZY A;  2FNA A;  3I71 A;  1XSX A;  3BY6 A;  1D8K A;  1I27 A;  4U0Y A;  3M7G A;  4G7Z F;  2OAZ A;  4ENM A;  2LDU A;  3BWG A;  4RB1 A;  1BI2 A;  2FML A;  4DNC A;  1XDS A;  1WSU A;  3BJO A;  1I1G A;  1O3Q A;  4HF0 A;  1V3F A;  2XIG A;  4AIK A;  3F8B A;  4FHT A;  3CO7 C;  1HKS A;  5IT9 Z;  3M8F A;  2IA1 A;  3EDP A;  5ICE A;  4HV5 A;  4CDG A;  1TQP A;  2PQ8 A;  3R60 A;  2ZNZ A;  2FBH A;  4AWX B;  2HEO A;  5AIP A;  2Q0O A;  3KP6 A;  2V6C A;  4HW0 A;  2E1N A;  3D5L A;  2H6C A;  1HKQ A;  1QPM A;  2L3D A;  1EV7 A;  3R0J A;  1WI9 A;  3ML6 A;  2CGP A;  3KEO A;  1PP8 F;  5HVQ C;  4IRI A;  2O0Y A;  1PP7 U;  5L3D A;  2DK5 A;  3I5U A;  2FU4 A;  3F21 A;  5BPI A;  4HX8 A;  4RAY A;  3QU3 A;  1MDM A;  1ZH5 A;  5K5R A;  1J5Y A;  3V7R A;  1XSD A;  1YFH A;  3HRS A;  3RYP A;  4U7D A;  4ESJ A;  3C1D A;  2LF8 A;  4WK8 F;  3I64 A;  4U7B A;  5E17 F;  2EFQ A;  3G3Z A;  3ROU A;  3IRQ A;  4UXN A;  3RKY A;  3DQV C;  4EJV A;  1P6R A;  3U2R A;  2JPC A;  1SD6 A;  3MWM A;  2BYV E;  2AS5 F;  1Y0U A;  2GA1 A;  2P4W A;  1U5T A;  4I0A A;  1G3S A;  2BE5 F;  3WG9 A;  3H92 A;  4A0X A;  3GX4 X;  2VC1 A;  4M72 A;  1Z7U A;  2WV0 A;  5FFZ A;  2HYF A;  1OYW A;  3CDH A;  5A2Q K;  1FSH A;  2H27 A;  2K02 A;  2DBB A;  4HDV A;  4M6Y A;  4NHJ A;  4G7H F;  3RDI A;  4EGZ A;  5BMZ A;  3VFZ A;  1IUY A;  1S8N A;  3H3U A;  4CHU A;  3P9K A;  4OMZ A;  2MLG A;  2L4M A;  3KET A;  4FX0 A;  4HV6 A;  2NYX A;  4RGS A;  1XCV A;  2RGV A;  4BXU A;  1LQ1 A;  3CUO A;  3FXQ A;  2GA2 A;  1D3Y A;  5ILU A;  3K9T A;  1FWZ A;  3KE2 A;  1FX7 A;  5E1W A;  5DCM A;  1HW2 A;  1TLH B;  2LNB A;  1GHC A;  1JHF A;  1G6N A;  5H20 A;  1YS6 A;  4PGG A;  2DQL A;  2VOD A;  2FSW A;  4LLL A;  1H9G A;  2EV0 A;  2H94 A;  5CYV A;  2DU9 A;  1QBJ A;  3LA2 A;  2IPQ X;  2XKO A;  4I09 A;  3V7S A;  1LJ9 A;  3W6K B;  4CIC A;  4KFC A;  4HZF A;  1YS7 A;  2O03 A;  5E20 A;  3IL2 A;  4Y15 A;  2FBI A;  2Z99 A;  4XSZ F;  3ZPL A;  2K27 A;  1IW7 F;  4MEY F;  4A6D A;  1B59 A;  1ZLK A;  1JGS A;  1TQI A;  4YFN F;  2DPU A;  2IA2 A;  4LLG F;  1GXP A;  1J7K A;  5DYM A;  5FD6 A;  3RTR A;  1P92 A;  4GO1 A;  3WTX C;  2OQR A;  5E18 F;  1LDJ A;  2FF4 A;  4LGW A;  4UVC A;  3V7C A;  4UVB A;  5FLX K;  3R0A A;  1AOY A;  1FT9 A;  1Z9C A;  5FGM A;  2EA2 A;  5L3B A;  3V4G A;  5F64 A;  1H9T A;  3I59 B;  3CUQ C;  4L9V A;  2HKX A;  5HS7 A;  4HF1 A;  2ADU A;  5DEQ A;  3FHZ A;  3V8J A;  2W24 A;  1RIO H;  3LA7 A;  4KIB A;  3ZMV A;  3MZH A;  2HFH A;  2ZME B;  5FB2 A;  1FBU A;  5A2Q Z;  3I0T A;  2ESH A;  2EFW A;  2BBY A;  2P5K A;  3KLN A;  5DV5 A;  4BHP A;  3M8E A;  4XLP F;  3LAP A;  2ZXJ A;  2BV6 A;  4AIJ A;  4D0P A;  3QU6 A;  4S05 A;  3R6S A;  1FY7 A;  1Z05 A;  2UXX A;  2HTS A;  4GGG A;  4KIC A;  2QVO A;  1FYL A;  1C0W A;  2XAH A;  4R8H A;  4PZJ A;  1ZHF A;  4OMY A;  2XAQ A;  2NAZ A;  2RDP A;  1SMY F;  5F1R A;  1B4A A;  4UNO A;  1Q1H A;  2HQR A;  1BOA A;  2EK5 A;  2A6H F;  2KIF A;  1OPC A;  4EM2 A;  4WWC A;  4RGX A;  3TDZ C;  3KP7 A;  3TOB A;  1K78 B;  2EFP A;  3HIF A;  1A04 A;  1VTN C;  4GXO A;  3DFG A;  1X3U A;  3L9F A;  3QAH A;  5D5V B;  3JAM K;  3K1N A;  3GYH X;  5L3G A;  2FOK A;  3E5Q A;  4RGR A;  1ZG3 A;  2FMY A;  2ACJ A;  5E1X A;  3OV8 A;  3T8R A;  1K6O A;  2CFX A;  4I7H A;  1T0F A;  2G7H A;  2HOE A;  3GFJ A;  3L09 A;  4GYI A;  1LB2 A;  3I58 A;  4XSX F;  5FO5 A;  1K7A A;  3DP7 A;  4GYG A;  3U1D A;  5K1Y A;  1KU3 A;  3WGH A;  2JTV A;  4QWQ A;  2Y75 A;  3P7N A;  4BYY A;  4HQM A;  3WTS C;  5FLX Z;  1P4A A;  2QQA A;  3I54 A;  5BS6 A;  3JTG A;  5DUI A;  3CLO A;  1KGS A;  2RNJ A;  1FBQ A;  2V1U A;  2FQ3 A;  3HRM A;  4RAZ A;  5L3F A;  2K4J A;  3CTA A;  3FF5 A;  5D4R A;  1UHM A;  2XGX A;  4U0W A;  3O6B B;  4OU0 A;  4KN4 X;  1QZZ A;  1UST A;  4LK0 F;  1ON2 A;  5D6F A;  4G7O F;  3QPH A;  1T98 A;  1FC3 A;  2BEO A;  5D5W B;  2L54 A;  3EUH A;  2NNY A;  5JI6 A;  4IRH A;  1IN7 A;  3F23 A;  2H6B A;  3GO5 A;  3LFK A;  3LQR A;  2LKP A;  3WTU C;  3F72 A;  4HLY A;  4YFX F;  5JR3 A;  3ABU A;  3ZMT A;  5CVR A;  5ILV A;  3RPU A;  4HA8 A;  2A3S A;  2F2E A;  4M71 A;  3FMQ A;  1KQ0 A;  4L9T A;  1QQI A;  3KCC A;  1BM9 A;  3LA3 A;  1IRG A;  2YPR A;  3O3K A;  4LJZ F;  1IN4 A;  4LB6 B;  3N4M A;  2YSR A;  1FSE A;  4WXH A;  3FM3 A;  2J5O A;  5K5O A;  1TW3 A;  5ILS A;  1R22 A;  2STT A;  2HDC A;  2UZK A;  5JHU A;  1QO0 D;  1XGS A;  2DK8 A;  1HW5 A;  1R1T A;  3V8L A;  3MFK A;  5KVR A;  3HHG A;  4IF4 A;  2H09 A;  3DPT A;  5ICG A;  4N9H A;  3DPL C;  3JAM Z;  2KKO A;  2PG4 A;  1TBX A;  3C7J A;  3CUQ B;  1F4K A;  2XUB A;  4LG0 A;  5BQT A;  3Q9S A;  2R7F A;  5EEG A;  4H0E A;  1SFX A;  3H3Z A;  2FXA A;  2QQB A;  2IA0 A;  4WCG A;  5HLH A;  4XRF A;  2D1H A;  2OZ6 A;  3WE3 A;  1KQ8 A;  1ZRE A;  1ODD A;  3M9A A;  4HLX A;  5LEK A;  2VT3 A;  3SFZ A;  4B8X A;  2F5F A;  1P4W A;  3JW4 A;  2XAF A;  3E5U A;  3DF8 A;  1ZRC A;  2Q8K A;  1XGO A;  3K1M A;  4G6D A;  2F5E A;  2FRH A;  3L00 A;  2A07 F;  1I5Z A;  1JHH A;  3C3W A;  4I0B A;  1HSJ A;  4MTD A;  1MGT A;  2YR2 A;  2L01 A;  4L0Z B;  1F1Z A;  3LQQ A;  4Q47 A;  2EB7 A;  1ZRF A;  2VC0 A;  3JSP A;  5DD4 A;  3T8T A;  5DDG A;  1UHW A;  3MQ0 A;  1L3L A;  4M6X A;  1W7P B;  1BC8 C;  2RVC A;  3J80 K;  2QLZ A;  3QRF F;  1GXQ A;  1IAW A;  3HTU A;  2PMU A;  1AWC A;  3SQN A;  4ESB A;  1K79 A;  2QEN A;  3CO6 C;  1BI0 A;  2GXG A;  3JTH A;  3VB2 A;  2PLY A;  2EA4 A;  2JRT A;  4UUV A;  2CYY A;  3BZ6 A;  1PDN C;  2VE9 A;  1DDN A;  2A5Y B;  2Z33 A;  4JK1 X;  5HDK A;  1JXS A;  2CSO A;  2A61 A;  3HOS A;  4U88 A;  3KP5 A;  4DQ2 A;  2EV5 A;  3HSR A;  4RB0 A;  2OA4 A;  3F8F A;  2HQN A;  4IPA A;  2IVM A;  4AIH A;  3RJP A;  5ERI A;  2R7D A;  2QYO A;  1H0M A;  1O7L A;  2MLK A;  1HXD A;  2MD5 A;  2V1D A;  1J75 A;  3T5X A;  2NS0 A;  3WTV C;  1G3T A;  4ASN A;  3L7W A;  1U3E M;  3F8C A;  1U8R A;  2PI0 A;  4HAM A;  4P9U A;  3MZY A;  2VBX A;  1U5T C;  4Q48 A;  1S7O A;  2P7C B;  2PMH A;  4P9F A;  2UWM A;  3E5X A;  3I4P A;  2B0L A;  2GAU A;  1SD7 A;  3TGN A;  1XMK A;  1STZ A;  3BJA A;  3D0S A;  3BJ6 A;  4RB3 C;  4EV0 A;  4AVP A;  2FE3 A;  2P5L C;  4R79 A;  5D5X B;  4A6E A;  3HSF A;  5ED4 A;  5LRS A;  1KYZ A;  1B6A A;  1YLF A;  2CG4 A;  4M9X A;  2JPB A;  2E7X A;  1U78 A;  3WE2 A;  4L9J A;  5LGN A;  3N97 A;  3T0Y A;  3O2P E;  5IT3 A;  2QM3 A;  1BIA A;  4P5O A;  3DKW A;  3J80 Z;  4YFK F;  3GXO A;  1W5T A;  2V9V A;  1F9N A;  5H6Q A;  1R5G A;  2YX4 A;  3L2C A;  4BAY A;  3S2W A;  1RI7 A;  1YW8 A;  3I53 A;  4O6J A;  4A2U A;  3GFI A;  1IXS B;  3BP8 A;  3TKY A;  3F6V A;  4ZYE A;  1LEA A;  4NQW A;  5EEH A;  4OIP F;  5CVU A;  3TOA A;  5D4S A;  2X4H A;  4K2E A;  1RZ4 A;  1FNN A;  1YIO A;  4ENN A;  3W6J B;  3P9I A;  5FFX A;  5J6X A;  3KP4 A;  3PQJ A;  3J81 K;  1U2W A;  2PN6 A;  4WXD A;  2WWY A;  4OIQ F;  1TNT A;  4Y13 A;  3DXJ F;  2EFO A;  2X0L A;  2XVC A;  1R7J A;  2F5C A;  4EMS A;  3ZMD A;  1YTY A;  1QNT A;  1E17 A;  1J9I A;  2ZJ2 A;  1CGP A;  1Z6R A;  2CWE A;  1HKT A;  2OZU A;  1Z1D A;  1USS A;  1J59 A;  3ZMS A;  5DD8 A;  1HST A;  1OYI A;  2Z9O A;  3QPT A;  1JE8 A;  2XKP A;  3GVA A;  2GWR A;  3IWZ A;  4MEX F;  1BC7 C;  4EQQ A;  2PEX A;  2W84 A;  4U0V A;  3DV8 A;  3EYY A;  1PUE E;  1DPU A;  3RI4 A;  2VE8 A;  3PQK A;  1IXC A;  4G94 A;  5TRD A;  1ZRD A;  2DPD A;  1S29 A;  2QWW A;  3GFM A;  3HUG A;  2UXN A;  2ISZ A;  2VON A;  4G6Q A;  4L9N A;  3ABT A;  4BNC A;  3GLX A;  2Y0M A;  4MHG A;  4OOI A;  1P2F A;  2ZBK A;  2R3S A;  4OIO F;  1F5T A;  3TO9 A;  1EH8 A;  3EET A;  3F6O A;  3KZY A;  2O3F A;  3HOT A;  5HLG A;  4QLC U;  4ZYD A;  3K2Z A;  3WU0 A;  2ETH A;  3ISP A;  3ZP5 A;  1R00 A;  1IN8 A;  3CJN A;  2DTR A;  4GCV A;  2PBI A;  4G8X A;  2P8T A;  2VBY A;  5E8G A;  4B09 A;  4CYD A;  1FZP B;  3F22 A;  1ON1 A;  1SAX A;  4LFU A;  1P4X A;  2A6E F;  1T39 A;  1RUO A;  3ZMZ A;  3K0L A;  1LDD A;  5LEJ A;  1XB4 A;  3GFL A;  2P7V B;  2MH2 A;  2YU3 A;  4HX4 A;  1KYW A;  4ZYH A;  1KA8 A;  1MDM B;  4TV7 A;  1DP7 P;  4KIG A;  1G3W A;  1TNS A;  2FNP A;  3J81 Z;  1R1V A;  2GZW A;  3VEP A;  4HBL A;  2HZT A;  5D8K B;  2XV4 S;  1ZGA A;  1ZGJ A;  1S6L A;  1GVJ A;  2YX7 A;  3KFW X;  1KU7 A;  3B02 A;  2KJC A;  2NRA C;  3E3V A;  2RN7 A;  3BRO A;  3P9C A;  4LD5 A;  1U5T B;  1W4M A;  1ZAR A;  3IHU A;  3ZN1 A;  2VN2 A;  5D6E A;  5LRR A;  2DLL A;  2OU2 A;  4IJA A;  5BPD A;  5HOO A;  2MA3 A;  4XLN F;  2PJP A;  2KRF A;  1QGP A;  2FEZ A;  3BPV A;  4KA4 A;  1YO5 C;  1TTY A;  3LWF A;  1DPR A;  2NNN A;  5TJJ A;  2O8X A;  5J8C A;  1O3S A;  1U6G A;  1RUN A;  1TW2 A;  2PFB A;  1TQM A;  3ULQ B;  2LSO A;  5DCM B;  3VOD A;  3RPQ A;  3KP3 A;  2IJL A;  1FP2 A;  2JSC A;  4F7Z A;  1IZ1 A;  3IRR A;  3I59 A;  2XAJ A;  2HGC A;  3E97 A;  2WC2 A;  4UVA A;  5DUK A;  2L4A A;  1IRF A;  1G3Y A;  5H6R A;  3GZ5 A;  2VBW A;  3SHF A;  5L3E A;  3ECO A;  3FXR A;  2QUF A;  5E1Z B;  2W25 A;  4KT5 C;  5HLI A;  1CF7 A;  5DCF A;  3WTW C;  1XMA A;  3GEZ A;  2GQQ A;  2P6T A;  4ENJ A;  4JQF A;  2M5W A;  1R58 A;  1W5S A;  2IRF G;  2CO5 A;  4EJT A;  4P55 A;  3COA C;  3DEU A;  3K69 A;  2BGC A;  3HHH A;  2ESN A;  2KIU A;  1BJA A;  3R61 A;  4LK1 F;  2OBP A;  2QQ9 A;  2DT5 A;  4M9S A;  1FYK A;  4RGU A;  2HS5 A;  3LAJ A;  3EQL F;  1R23 A;  4ZZD A;  1YQA A;  4UV9 A;  5CVV A;  4KNY A;  3WTY C;  2VBZ A;  4I01 A;  4RS8 A;  1ZG1 A;  2VOP A;  5K5Q A;  2C6Y A;  1R36 A;  3V8K A;  4N0B A;  3WTZ A;  1V4R A;  1K78 A;  4ESF A;  2V79 A;  2XAG A;  3KP2 A;  4MQ9 F;  3M1E A;  2RKH A;  3KLO A;  3U9G A;  2D1V A;  2GIV A;  1O3R A;  1ZLJ A;  5LBQ A;  1WKM A;  4R1H A;  3QP6 A;  2DQR A;  4E70 A;  2RC4 A;  1OKR A;  3GW2 A;  3BPX A;  4EGY A;  1SMT A;  1W7P D;  2EV6 A;  4ZH4 F;  3F8M A;  4ENK A;  2HWV A;  2ZFW A;  4HX7 A;  4IRG A;  5FD5 A;  2ZNY A;  3HYI A;  4CO8 A;  2IW5 A;  1HQC A;  3R4K A;  3RKX A;  4OIR F;  1G4D A;  4Y17 A;  4WXC A;  3ECH A;  4JBA A;  1LVA A;  3E6B A;  3MCZ A;  1O3T A;  5JFR A;  3HSE A;  1REP C;  4RB2 C;  3EYI A;  4Q5S F;  4L5J A;  2M30 A;  5HS9 A;  4A5M A;  2L02 A;  3LST A;  1LEB A;  2Z5U A;  3MEX A;  5CLS A;  2K4B A;  1FP1 D;  3E6D A;  1BI3 A;  2XRN A;  2ZCW A;  2O6G E;  1R1U A;  4MTE A;  2XHK A;  4M73 A;  3BOQ A;  3MAJ A;  4A0Y A;  1EH7 A;  4IVN A;  1XCB A;  5J8F A;  2STW A;  4M74 A;  2IP2 A;  2ZKZ A;  4I2O A;  4CGZ A;  2DAO A;  5LHI A;  4WF2 A;  3RYR A;  3AAF A;  1FOK A;  2W85 A;  4HQE A;  3IKT A;  2VOO A;  3REO A;  1S3J A;  1O7F A;  4L18 B;  3ZQ7 A;  1FYM A;  2EFN A;  4KDP A;  3FWE A;  4O5V A;  4AD9 A;  3HRU A;  2IT0 A;  2W57 A;  4A12 A;  1MJB A;  5D8L B;  1J2X A;  2RV8 A;  5D5U B;  3IC7 A;  4KMU X;  1ULY A;  4Q4Z F;  4M9Z A;  3IKV A;  1O57 A;  1J0R A;  3SZP A;  5L3C A;  2OD5 A;  4Z2Y A;  3E6M A;  3QOP A;  4A5N A;  2QBY A;  2ELH A;  2DW4 A;  1MJ9 A;  3GZ6 A;  5HDN A;  2ZO4 A;  2J5P A;  3GF2 A;  2M1B A;  1ZYR F;  4EVI A;  2FBK A;  2MH9 A;  2QZ8 A;  5F6F A;  5LGU A;  4O3M A;  3CUQ A;  5ICC A;  1KU9 A;  4NB5 A;  4BHB A;  2JZY A;  1SD5 A;  3Q9V A;  5CVJ A;  1OYY A;  1XGM A;  1MZB A;  3SZT A;  3FMR A;  4KIF A;  4MGR A;  2G9W A;  2DI3 A;  3SXY A;  2MBF A;  1Z91 A;  1OMI A;  1BI1 A;  4L5I A;  3G73 A;  3WTT C;  2LF7 A;  3VOE A;  3RIR A;  3C18 A;  5HS8 A;  2HR3 A;  3NQO A;  4P96 A;  4LMY A;  4PGH A;  3K1P A;  1HW1 A;  2HYG D;  5LHG A;  3BDD A;  4IXA A;  1D5V A;  5LHH A;  2K7L A;  1B1B A;  4PCQ A;  4ETS A;  3TDU C;  5KK1 A;  2D45 A;  4FX4 A;  4HYE A;  1CF7 B;  3ELK A;  1SFE A;  1W7P A;  3IWF A;  2RQP A;  4MQV A;  2OQG A;  1HBX G;  2HKO A;  4I02 A;  3T1B A;  4LG0 B;  3ZN0 A;  1FLI A;  5BOX A;  2M45 A;  4EJW A;  2M87 A;  4YIF A;  1YW9 A;  1T2K A;  4I98 B;  1IN6 A;  5LLQ A;  3F3X A;  2HTJ A;  3FZV A;  1SD4 A;  1IXR C;  4BH9 A;  4CZZ A;  2VT2 A;  4IHS A;  1UB9 A;  1I1S A;  2EWN A;  2WTE A;  1T6S A;  1I6X A;  4ZYG A;  2Q2E A;  3WU1 B;  1FBS A;  4HOB A;  3NEU A;  1Z6T A;  5HDG A;  4CXF A;  2P6S A;  4WX9 A;  4EM0 B;  4ZZL A;  2FA5 A;  2O61 A;  4PDK A;  4KUM A;  1MJA A;  2ISY A;  1R5H A;  4KN7 X;  5AIQ A;  1YW7 A;  4YII A;  1D8J A;  1ZAO A;  2G7U A;  2KJB A;  1UFM A;  2KIM A;  2EJR A;  5CVI A;  1XD7 A;  5JVT A;  4FT8 A;  2CQK A;  2A69 F;  1S7A A;  1BIB A;  4A0Z A;  1MD0 A;  3FM5 A;  2K86 A;  1LNW A;  1XDU A;  1ZN2 A;  1B9N A;  1YYV A;  2Y48 A;  5CJ9 A;  2M8E A;  3J7A O;  3PFI A;  2DO7 A;  4KYW A;  2E7W A;  1NHA A;  5AON A;  2CW0 F;  2TDX A;  6PAX A;  4BHC A;  2F5D A;  3ZMU A;  3Q5F A;  1DUX C;  3RKW A;  4UHT A;  4OIN F;  2COM A;  4HDU A;  5IT9 K;  4S04 A;  3B73 A;  5ICF A;  1WRJ A;  2E1C A;  4KMF A;  1T38 A;  3KZZ A;  3TO7 A;  1ZG5 A;  3JSO A;  3ERE D;  1XSV A;  2DFI A;  5E8I A;  4EJO A;  4ON0 A;  4YG2 F;  4L0Y B;  2Z3Y A;  1OR7 A;  2GXB A;  1XGN A;  2JT1 A;  2XRO A;  4EJU A;  2P5V A;  1KU2 A;  4LLN A;  4LB5 A;  3WOD F;  1KQ9 A;  1RNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...