1Q1VA

Structure of the oncoprotein dek: a putative dna-binding domain related to the winged helix motif
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
70
structure length
70
Chain Sequence
DEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKELISLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DEK protein
publication title Solution NMR structure of the C-terminal domain of the human protein DEK
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 18
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2003-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08766 DEK_C DEK C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1q1vA00
3HB9A 1P7JA 3JRFA 4C3IJ 5F1JA 1BA5A 2W48A 3HOVJ 4FISA 4DYCA 3FK7A 5F04A 2DA4A 1RKTA 2R93J 1YRNA 4Y52J 4UUSA 2KDZA 1K61A 1FEXA 3CDLA 2DJNA 1ZQ3P 4S0HB 5IYBJ 4A3BJ 2M34A 1IG7A 4FE4A 4MO7A 1WH7A 2DA1A 5EZGA 1JJ6C 3FK6A 4C2MJ 2M9HA 3G1MA 5EGOB 2E1OA 1OFCX 1MBKA 5DS9A 2LVSA 5FKNA 4D7MA 3SFIA 3S1RJ 2NVXJ 1QVUA 4BY1J 1MBGA 2DA3A 4M3EA 2JA6J 2LKXA 3PO2J 2XGDA 1VFCA 4IHVA 2ECCA 2ID3A 3FIWA 4IHWA 3A03A 3K7AJ 1HDDC 1Y1VJ 2DA2A 1Z77A 1ZR2A 1GVDA 4B3AA 4CYCB 2ME0A 1MH3A 3BTIA 1JKQC 1S7EA 3TP0A 4A3DJ 1JTYA 3S2DJ 3ZQLA 3A01B 5EG0B 3HGYA 5F08A 3S1QJ 3TP3A 2KT0A 3MN2A 3OOUA 3BR5A 3Q0UA 4V2FA 4XRSA 1GT0C 1NK2P 5EYRA 2G0EA 5EZHA 3ZQCA 3S16J 2EQRA 3FKIJ 2L7ZA 5M5WJ 3S1MJ 3GTKJ 1VI0A 3GTPJ 2DMUA 1TWGJ 2VI6A 5J1UA 2H1KA 4A3CJ 3BTCA 5FJ8J 2JA8J 3TW6A 1LE8B 1WH5A 3HEFA 5EEAA 4M3DA 1IUFA 1ETVA 1NTCA 3JRDA 1P7IA 1AU7A 5HODA 4BY7J 2K9QA 2P81A 1H89C 3Q0VA 2DMPA 4W97A 1JKRC 1BW5A 1MBJA 4A3KJ 2WV1A 3WHCA 4IEJA 3ZQIA 3B6AA 5C3EJ 4RDUA 1VF9A 5IPAA 3JRAA 3HKZN 1RR7A 3O8GA 3ZQHA 2CRGA 3K2AA 9ANTA 1FJLA 1O4XA 5K7FA 1X58A 5IP7J 3Q3SA 3BR6A 4JX6A 3RQIA 2Y0SN 2FX0A 4I76A 3HM5A 1MH4A 4J19A 4BKXA 3LSRA 2LD5A 1TWHJ 2HOSA 1SFOJ 2M8GX 2Y9YA 1JGGA 4A3JJ 2QF7A 5IP9J 4X1EA 4CYCA 4DYRA 2EZHA 1CQTA 3C2BA 1OCTC 1B8IB 3GTJJ 5F0FA 1BJZA 4W1UA 1T56A 1IGNA 1HOMA 2ME6A 2CJJA 2L7FP 3A01A 2ECBA 3OSGA 2M0CA 5J1YA 5M5XJ 3F0CA 3CMYA 2L9RA 3NARA 4AUXA 5FKOA 3BTLA 5M3MJ 4UUTA 5C4XJ 4EEFG 1HCRA 1APLC 1I3QJ 3HOYJ 1RPWA 3D1NI 4A3GJ 2NS7A 4JX4A 3HBLA 4QSHA 4V2GA 1WGXA 2HQ5A 2FJ1A 2JWTA 5IYCJ 1X2MA 1BL0A 2EBIA 1H88C 4D7NA 2Y9ZA 2X6OA 5GPCA 2K40A 5EDNA 1UHSA 1VNDA 5BNGA 2JA7J 1GV5A 1WPKA 4DZJA 2TRTA 5FKMA 1EF4A 5M3FJ 2COBA 2ID6A 1JKOC 2CQXA 2HOTA 2JA5J 2I10A 2R5YB 2EH3A 1U78A 2AHQA 3GTOJ 3A02A 2HXIA 1PUFB 2IAIA 3RZDJ 3I4MJ 4XIDA 5E3NA 2FQ4A 5C4JJ 3H0GJ 1Z0XA 1W0UA 3FISA 2D5VA 2LR8A 3BR0A 3SJMA 1XC5A 4GFBA 2OPTA 2XB0X 1ZR4A 1ORKA 2YS9A 3BR3A 2HDDA 1LFBA 5J1RA 5M5YJ 2CUEA 1G2HA 1A5JA 1MSFC 2K9SA 3MKLA 2PMZN 1LFUP 2WB1N 2VPRA 2R0QC 3GTGJ 1QRYA 3G1OA 1IV6A 4JX5A 5DTDA 4Y7NJ 1AKHB 2MW8A 3HOZJ 2NOGA 2CU7A 1ZTRA 2LK2A 2NVYJ 4UUSB 4LOCA 2ZB9A 2EZLA 1F43A 2XSDC 3JRCA 5IP6A 3BR1A 3HDDA 3BQZA 1GV2A 2X48A 1IRZA 4AC0A 4RBOA 1R9TJ 3MVPA 4XRSG 2Y2ZA 3S14J 2DTZA 2Y30A 3GTMJ 3G1LA 3LNQA 1IJWC 3HOUJ 1ETKA 1HF0A 4IHYA 5EGOA 3DEWA 4BBRJ 2NVQJ 3M3YJ 3ZQGA 1MBEA 3JRBA 2GM4A 2XRLA 1WI3A 2DA7A 1W0TA 1X2NA 2FD5A 1POGA 3LOCA 4JYKA 1FIAA 3ZQFA 2E2JJ 2O9LA 1ETQA 2IBDA 2WAQN 3HGGA 4MLOA 1IDZA 1BW6A 3BQYA 2ELKA 5C44J 3W6VA 1DU6A 2GLOA 1RKWA 3PO3J 4BXXJ 4A3FJ 1HDPA 2LP0A 2NS8A 1RETA 2LFBA 1B72B 3IV5A 3OSFA 2O7OA 3WHBA 5EG0A 1JT6A 3QPLA 3B6CA 4X6AJ 5J3LA 3BT9A 1ITYA 3JRHA 5IYDJ 5FKLA 5F0HA 2JK3A 1T33A 1RESA 5JLXA 1IDYA 1Y1WJ 3RZOJ 1I6HJ 3S17J 1ZGWA 2R7ZJ 2XGCA 1E3OC 1AKHA 4JP0A 4A3EJ 3JRGA 4A3IJ 2DN0A 2L0KA 3SDGA 4IHXA 1LE8A 2HXOA 5GP9A 1ETXA 4M6VA 1JTXA 2XPVA 4HNVA 1MNMC 4AYBN 2EZIA 2R5ZB 3BR2A 1JJ8C 1ETOA 5F0CA 3RKQA 3GTLJ 3O8HA 3LSGA 4MFDA 4A3MJ 3Q0WA 1JUPA 2HYJA 2NVTJ 3E7LA 5FLMJ 2CUFA 5FKKA 2K9NA 5K7ZA 3CQZJ 4FCYA 1Q1VA 1UG2A 2JN6A 3BG3A 1MBFA 5K7HA 1FTZA 2MGQA 4DYQA 3BTJA 1QVTA 5IOZA 1HLVA 3GTQJ 5JLWA 3IH3A 4XRMA 1ETWA 4B1RA 2IEKA 1OJLA 1TWFJ 1U9NA 5EF6A 4FE7A 1ETYA 3QQAA 1JT0A 5E3OA 2XGEA 4I6ZA 1TC3C 2XPUA 2EZKA 3OIOA 3CCYA 3L1PA 2E2HJ 4A69C 3BG5A 1JUSA 3IH4A 1DU0A 3S1NJ 3JR9A 1B72A 2N8GA 1B8IA 1AHDP 1YRNB 4G12A 1D5YA 3TW7A 4NDLA 2DMQA 4D5CA 5E3LA 3LSJA 3NAUA 4M3GA 1GDTA 2E2IJ 4A3LJ 1QPIA 1ZK8A 5GPAA 3ZOBA 1TWCJ 2AO9A 4QTRA 1NK3P 3H3VK 3BG9A 2X9DA 2YUSA 2L7MP 3VPRA 1ENHA 4DW6A 1UMQA 1FIPA 1IC8A 3TEDA 4BBSJ 3JREA 2HI3A 3PM1A 4C3HJ 2R92J 3DCFA 1MBHA 1H8AC 4DZPA 1ZKGA 3S2HJ 4C3JJ 1FTTA 2YU9J 4XK4A 3JRIA 2DA6A 3UKGA 4B4CA 2LLKA 2Y31A 4D5FA 4L5EA 2MG4A 1F36A 2VKEA 1XG1A 4FTHA 2DMTA 2R5ZA 2DMNA 1GUUA 1I50J 2LTPA 4A93J 1MSEC 3GBGA 2QCOA 2O8KA 4M3FA 4XICA 2RAEA 3S15J 1XS9A 2VKVA 1OCPA 2B63J 1U8BA 2R5YA 2TCTA 3HOXJ 2CQQA 3LSPA 1PUFA 2MSYA 2XPWA 2XB5A 1K83J 4MFEA 4ABZA 3I4NJ 1JUMA 4M3BA 2GBYA 1WCMJ 3IH2A 1SANA 4QIWN 1TWAJ 3HOWJ 1A6IA 4MIMA 3M4OJ 2HOAA 5IOYA 3QPSA 1JKPC 2H8RA 2OF7A 2JMWA 5FLVA 2DA5A 2JJ7A 5F27A 2VUMJ 2E19A 1U9OA 2LY9A 2M2EA 5E3MA
chains in the Genus database with same CATH superfamily
4N9HA 3JRFA 5F1JA 3DPUA 3WG7H 1YTYA 2A5WA 2CFOA 1IXRC 2RN7A 2OZ6A 4M9SA 3OR1C 3QODA 5GAHJ 1KA8A 2JQ7A 4KA4A 1MMGA 4MQVA 4ANJA 1RKTA 1J0RA 3HJEA 4XLNF 4Y52J 3M8FA 4UUSA 2KDZA 4JQFA 2UV1A 2F5CA 3W2WA 3DKYA 1K6YA 4S0HB 2IS6A 4IZZA 1IG7A 4HQMA 1ZGJA 3EUHA 4MO7A 2DA1A 2V26A 3KIOA 1IN4A 2M9HA 1FOXA 2XF6A 4XM3A 5BPDA 3IWFA 2IRFG 2I5UA 3GXOA 3PQJA 5DS9A 3T8RA 4BE1A 2A6TA 3S32A 2VOPA 4D7MA 2Y0MA 4GO1A 2Q2EA 5DUKA 2X1EA 4BY1J 5TJJA 5HLTA 1MBGA 2EINH 3G6EI 3IHUA 2GOXB 2P4WA 2QVOA 2ECCA 4IHTA 3FIWA 3J81K 2DDBA 4HLXA 3S3NA 4Q47A 2JT1A 1V4RA 1Y1VJ 1E17A 5HLHA 2L2OA 4D0PA 4ESFA 1F5TA 4B3AA 3I59A 3FBNB 4KISA 2LF8A 2DU9A 1U5TB 2DCEA 3WTXC 4G9YA 3WU0A 1X19A 1S7EA 2DXIA 4KMUX 1K78A 2BZTA 1FOKA 3OS1A 2WAQA 1I5ZA 2KRHA 3EQLF 3LA7A 3ECHA 4UVAA 5F08A 4CA0A 1TTYA 3ROUA 5JI6A 3MN2A 3OOUA 4HLYA 3Q0UA 4DQ2A 2KQRA 4Q48A 1AOYA 2ZFWA 3CCJI 3GLLA 3FKIJ 2XIGA 4U0WA 4UB8C 2LBFA 4XQFA 1VI0A 3GTKJ 2DMUA 2QM3A 3PSIA 5J1UA 2G7HA 3M9AA 2L4AA 2L9SA 3GCMA 1H9GA 2CW0F 1OCTC 1LE8B 1PYVA 1KYZA 1QZZA 1IUFA 1YW8A 2ZFUA 2J5OA 3J81Z 4I7HA 2OZUA 4LLLA 3JRDA 1P7IA 2NYXA 2STWA 3CCEI 2VQGA 2HYGD 3Q0VA 2CUZA 3I54A 3N05A 4OIRF 3A0BC 5FFXA 4LK0F 2VJ4A 2V6CA 2LRDA 1MBJA 4LITA 5J8FA 3WHCA 4ZYEA 2R7SA 2NNNA 3B6AA 1VF9A 4NHJA 3O8GA 2D45A 5CQEA 1FJLA 5DCMB 2LY2A 5K7FA 4PGHA 3KEQA 1XSDA 1E2XA 5IY5H 3F8MA 2PBIA 3K4JA 4F91B 5EJCA 4LG3A 2FX0A 4IQ4A 2M7AA 2KDOA 1W36D 2HKOA 1MH4A 3IRQA 2KRFA 4L0YB 3LSRA 2W4SA 4X0GA 1TWHJ 3OYBA 4YRVA 2M8GX 4YFNF 1JGGA 3O6BB 4X1EA 2MA3A 4CYCA 4DYRA 1YO5C 2E60A 1HSTA 2F2EA 1Y8RB 2JTVA 1CQTA 1XCVA 4FT8A 1O57A 5LGTA 2E71A 2CUJA 3EPZA 3CZ6A 3RPQA 2V1XA 3RKXA 2OCEA 3A01A 1T6SA 2PG4A 2ECBA 1TP4A 3OSGA 3ZMDA 3KZYA 4MNUA 3MMYB 2MC3A 1R58A 3NARA 4BL0B 5M3MJ 5LD2C 4XOPA 5F64A 2UZKA 1QNTA 5JHUA 3IP4B 3BZCA 1VTNC 3HOYJ 2V7FA 1B4AA 1RPWA 1D8JA 4A5NA 2H6CA 4RGRA 2VLAA 3K4NA 2IS2A 3NEUA 2P6SA 5H20A 2E34A 5DM7F 2JWTA 3ABMH 4E6KG 5IYCJ 2EBIA 3CJNA 1BR2A 3R60A 2Y9ZA 3GW2A 4DOZA 2G9WA 4YIRX 3OOPA 2JA7J 1GV5A 3M8JA 3TDZC 5AIQA 2TRTA 1VQ6I 2WAFA 3DXJF 5M3FJ 2GQQA 2ETHA 2O8XA 2FU4A 3PUFA 1R22A 2I10A 5E79C 2GXAA 1VQ7I 2V9PA 3W2AA 2IAIA 3I4MJ 1B1BA 3H0GJ 4ZYDA 2K02A 3VYTB 2HOEA 3ABKH 4OAYA 3WTTC 1T8IA 4RAYA 4GFBA 2E5ZA 4IPAA 4RB3C 3KPHA 4Q4ZF 2HDDA 3D5SC 1V5FA 3REOA 4RB1A 2HYFA 1MSFC 4M9XA 1U2WA 2HU9A 3H9GA 3MKLA 4LFUA 2WB1N 2VPRA 5J8CA 2R0QC 3S8PA 1CF7B 1RZ4A 2IGKA 4B48A 1IV6A 4PZJA 2OA4A 2D1HA 3BDDA 2IW5A 1YHQI 2ZSHB 4OU0A 4B09A 4LJZF 2NVYJ 4BQNA 2R7WA 2W00A 1IN8A 3QPHA 4KIGA 4MTEA 3LAJA 3CCLI 3BQZA 2X48A 4HBLA 1IRZA 4RGXA 2BE5F 3E0JB 1N78A 4EMSA 1R9TJ 1YLFA 4G7OF 2IA1A 4EV0A 2Y2ZA 1OPCA 3S14J 3GTMJ 3FXRA 3OYLA 3RJPA 1O7LA 5LRSA 3M1CA 4L5IA 4PJNA 4CCLA 1QHGA 4IHYA 1EH7A 1RC9A 2ZXHA 1U5TC 3HRTA 4IOAF 4XKVA 3FMQA 3PNYA 2V1UA 2O03A 2NVQJ 3ZQGA 3FBIB 4NQWB 4EGYA 3JRBA 2GM4A 4AM3A 1BI2A 2H8WA 1WI3A 3CDIA 1W0TA 4KIFA 2FD5A 2BHZA 2EFNA 5LFAA 3S93A 3VFZA 1T0FA 3E97A 3FHNA 4I98B 3G71I 2YPRA 1EV7A 2HPMA 2EA2A 4HX4A 1LJ9A 3DTKA 2LP0A 2NS8A 2QSGX 1RETA 4L9VA 4EM2A 2AS5F 1ULYA 2VQCA 4BAYA 3ZCOA 1OYIA 2IGMA 2B0LA 4A6EA 2LKSA 3F9KA 5EG0A 2BBYA 2M7BA 3QPLA 1UHWA 5J47A 3B6CA 4EGZA 2D1VA 3K9TA 4CICA 1SEUA 1VQLI 1ITYA 1UAAA 3OYKA 1LKXA 1DDNA 2HTSA 2P5KA 5FKLA 1M1EB 4B3XA 3PIOF 1T33A 1BBYA 2CW8A 1MMSA 3FXJA 2HGCA 4OOIA 3S2WA 4BQQA 3ZPLA 1WJDA 1OR7C 1ERDA 2ZC2A 2A68F 4BQOA 1FBSA 2L01A 2W24A 2YSRA 1TL8A 2E5NA 2ELJA 3DPTA 3DQVC 4L9NA 4XKBA 3JRGA 2F4MB 3QU3A 3SDGA 5GP9A 2JZYA 4S04A 3IRRA 4FASD 2HQNA 2EV5A 3BR2A 1ETOA 5F0CA 2QEXI 4E4HA 1FT9A 2G7UA 3JCUC 2CMPA 3BROA 3E7LA 5FLMJ 1IN6A 5FB2A 5FKKA 2BVLA 3DTEA 3LFUA 3CQZJ 1ZRCA 2ZNZA 2FRHA 1OCCH 3L2WA 2JN6A 1MBFA 1V5GA 2JPBA 1FTZA 5LRRA 4DYQA 4XN3A 3I53A 4XSXF 1HA8A 4NC6A 3MKWB 2H1LA 2KKOA 4B1RA 2W57A 1QU3A 2MABA 1ZN2A 3EETA 2PQ8A 1JT0A 2VONA 2XGEA 4R79A 1EH6A 1H0MA 2XAUA 3CUQC 3OIOA 3OYEA 2QBYB 1ZARA 4A69C 2OQGA 2A3SA 3S1NJ 5LHHA 3JR9A 4M6XA 1F9NA 1YRNB 1YQAA 2M45A 4NDLA 1DP3A 2QKLB 5E3LA 2EIKH 3NAUA 2K27A 3MQ0A 5GAGJ 1GDTA 2XKPA 1OMIA 1QPIA 4A3LJ 5DCFA 2BY0A 1SMYF 2IGOA 4I0BA 1PDNC 1NK3P 4CCKA 3L9FA 5LGNA 2KHMA 3F8NA 2A05A 1IC8A 1VQ8I 3Q9SA 1YX3A 2LSOA 2IXSA 1XN7A 2L9NA 2HI3A 4BYYA 1R1UA 1SVOA 2QKMB 5D4RA 2LC2A 2FBIA 2R92J 3GYHX 4OINF 4I02A 1ZKGA 3TDUC 4DZPA 4U0YA 3JSOA 4RM2A 4C3JJ 4N4OB 4IXAA 4XK4A 3JRIA 5FLXK 2LLKA 4XLCA 1JGSA 3DTIA 4KNYA 1E3PA 2DMTA 2R5ZA 2QENA 1GUUA 1I50J 4XSZF 1X4PA 2QLZA 2QQ9A 3HUGB 4P96A 1U8BA 3WU2C 1WZ2A 3G4SI 2R5YA 5CVVA 2VOOA 4UV8A 1B59A 2MSYA 3WGIA 2RGVA 3AKZA 2F4OB 2XB5A 3L09A 1O3SA 1ODDA 3MEXA 1RNLA 1G3SA 1JUMA 3I4NJ 2PJPA 1SANA 4KITB 2VASA 1TWAJ 1W4MA 2LREA 2RREA 3B02A 2GWRA 3M4OJ 5IOYA 4M71A 3AL0C 1FBUA 1R1TA 3FMRA 1JKPC 5FLVA 4Y17A 4U87A 3CCSI 1AWCA 5EEHA 2X1CA 3HB9A 1BA5A 1P9QC 2CG4A 4XMYA 4CH7A 3L00A 1E0EA 4F93B 2R7OA 4J00A 2CO5A 5E1ZB 5F04A 2OUMA 3KP5A 3ZXSA 4CCOA 2R93J 3SEQA 4L18B 1P92A 4QLCU 4KJZA 3H9QA 2GA2A 3GO5A 4G7ZF 1FEXA 4ZZDA 2RKHA 3KCCA 5IT9Z 4BDZA 2LYCA 1FOYA 5HNFA 1K7AA 4FE4A 5EZGA 1WH7A 3U1KA 3Q5FA 2WAEA 5EGOB 2BW3A 3ASNH 3AFHA 1RUOA 4F7ZA 2XVCA 2VJIA 2F5EA 2NS0A 3FMSA 2CSOA 3GZNB 1LUJB 2LMDA 1PVEA 4NB5A 3SFIA 2XKOA 1PUEE 1QVUA 4XR6A 3CO6C 3LAPA 3K4MA 3MZYA 4WXDA 3DEEA 3E5UA 4GXOA 1K79A 4ESJA 4IHVA 1MNEA 4IHWA 2L7KA 3K7AJ 1TLHB 4I2OA 3MZHA 4RLQA 4Y15A 3VODA 3QRFF 1YX5A 3C2HA 1ZR2A 2VL8A 3QYFA 1T2KA 3DU5A 5L3GA 3S3OA 4YFXF 2ME0A 5JVGF 2IA2A 1Z05A 1S5LC 1JHFA 5HVQC 1DQUA 1JTYA 1G8XA 4YFKF 3R0AA 4PJ0C 4KMFA 3S2DJ 2HFHA 2V1NA 1JXSA 3HGYA 2KIQA 3S1QJ 2WC2A 1A6QA 1ZGAA 1VQNI 1OLTA 4NC7A 1YJNI 2EILH 3BR5A 3F8FA 4EQQA 4YELA 1X3ZB 3S16J 5H6QA 1XDSA 3K0LA 1X1AA 2TDXA 3ELKA 4A0ZA 3NWTA 2P5LC 4LMYA 3RKYA 4LG0B 4ESBA 2H1KA 4A3CJ 3RKWA 3D5RC 2PN6A 5HS9A 2WTEA 1T98A 3KZIC 3LFKA 2JA8J 3C3WA 2VQHA 3HEFA 5EEAA 2KIFA 1IN7A 4M3DA 2X6XA 5E1WA 2E7WA 2HKXA 2BEOA 4RMNA 2DAOA 4G6TB 4H4KC 2K9QA 1S7AA 1ZG3A 1H89C 2P7CB 2IP2A 3GZ5A 5CVUA 3H92A 5LBQA 2DT5A 1W36C 2DQLA 2Z5UA 3PNTA 4W97A 4BS9A 3AG4H 1BW5A 1USTA 3LWFA 4PJLA 4CCMA 2M1BA 2Y69H 2WV1A 4A3KJ 3TO7A 1QA6A 1USSA 3KEOA 3JRAA 3HKZN 1RR7A 2CRGA 3K2AA 9ANTA 2PJRB 2MYSA 3PNVA 3I58A 4LLGF 1O4XA 1FMWA 1D8KA 3BR6A 1SMTA 3Q3SA 1AA7A 3RQIA 2Y0SN 3HIFA 5FROA 3DF8A 2CV0A 2OJED 2HEOA 3ZMVA 2RNJA 3HSFA 4BKXA 2KFDA 4E7LA 3L2UA 3F8CA 1HQCA 2LD5A 2QF7A 5IP9J 4WWCA 3ONQA 2ZBKA 3S3MA 4U0VA 1R4MB 4XLEA 3WGGA 5KHDA 3C2BA 1ZG5A 2M5WA 1B8IB 2V9VA 1IXCA 2F5VA 4L5JA 3TOBA 4YIFA 3GTJJ 1TW2A 5E18F 4UHTA 4EJTA 3CP8A 1MZBA 2L7FP 2ME6A 1MJ9A 2KJCA 1REPC 4JK1X 1O3RA 1FY7A 4WK8F 5M5XJ 5KAFC 1TNSA 3RTRA 4IJAA 5JHFA 2VJ5A 2L9RA 3ERED 3CD6I 4AUXA 3PUBA 3BTLA 1TW3A 5F6FA 4UVBA 2VE8A 4A2UA 4J01A 4A3GJ 5ED4A 1YOVB 3OYFA 4JX4A 3HBLA 5L3EA 1V3FA 2DODA 2J5PA 4XN0A 2VBYA 4BGDA 4IX7A 2HQ5A 1BL0A 2K9MA 1IO2A 1H88C 2YX7A 5EDNA 1VNDA 2JA2A 2ZMEB 2DI3A 2E7XA 3L2CA 2A61A 2EIMH 4LGWA 4A0XA 3NQOA 5GAEJ 1XGSA 5D4SA 1VQ4I 3AG1H 2FE3A 1QO0D 3HL2A 3FXKA 3IKTA 1BOAA 2EH3A 1OR7A 3VYRB 1U78A 3AG2H 3FWEA 2HXIA 1F1ZA 1R00A 5E3NA 1W0UA 2Z2SB 5K1YA 1Z0XA 5C4JJ 3FISA 3QPTA 1XGOA 5KAIC 3GFJA 4DIQA 2MD0A 1BIBA 3LL7A 4RAGA 4II2A 3CMMA 1KU3A 4M73A 4HW0A 3U1DA 4UXNA 2KLOA 4ZYGA 1ZR4A 2K5CA 3DWLE 4ZDPA 2V6EA 1H9TA 4IRHA 1ZELA 2MH2A 2JUCA 1W1WE 4IL6C 4QWQA 3WTZA 2VODA 4B44A 1KGSA 2WADA 2F4IA 3RYPA 4CZCA 2LY1A 2NAZA 4RB2C 3GTGJ 1QRYA 3IC7A 1GLNA 1AKHB 1TQMA 3HOZJ 3OMYA 1ZTRA 2LK2A 1X3UA 3OYHA 1TNTA 2NXNB 4UUSB 1ZYRF 2EZLA 4DJAA 3ZRGA 1QZYA 4CZZA 3BR1A 2K7LA 4BQAA 2E35A 1KQ9A 4AC0A 4RBOA 5CVRA 1MGTA 3CUQA 4NC8A 1SFEA 1Z7UA 2Y30A 3K2ZA 4RM3A 2VC1A 2BY1A 1OCOH 1MMNA 4CDGA 1YJ9I 1RRJA 4YG2F 1ON2A 4AU7A 2GXGA 2Q2EB 3DEWA 3KEYA 4BBRJ 1K4SA 2NOJB 1TBXA 3WU1B 5LHGA 1MBEA 2Z3YA 4HSRA 1LB2A 3F8BA 2XRLA 5ICGA 4AD9A 4IRIA 4E7HA 4PUSA 5J6XA 3LOCA 3H1CA 1FYKA 2FSWA 1FIAA 3RQ4A 5BOXA 1HSJA 1MMAA 1WKMA 1BIAA 1ETQA 1GVJA 3ABLH 2EFWA 5CVIA 3WTUC 1SFUA 2K4BA 2WAQN 3I59B 2DT6A 3TKYA 4MLOA 3F3XA 3WODF 2V9KA 2BVMA 4EJUA 1LNWA 1ZRDA 1WWXA 1RKWA 3FX3A 3G73A 1JE8A 4QPOA 1P4XA 4BXUA 1K78B 3BG7A 4PFPA 4N4NB 2P5VA 3RPUA 1J7KA 3Q9VA 1DPRA 1KQ8A 4HRIA 2O7OA 2CH0A 1MW7A 3WHBA 1ZLJA 1JT6A 5CLSA 4PCQA 1O3TA 3SYTA 4X6AJ 3BT9A 2JVHA 1FSEA 1IXSB 2DK5A 3JRHA 2L3DA 1LQ1A 4BDYA 3T0YA 2JK3A 4M74A 4ENNA 4KFCA 4RS8A 2LBFB 3CUOA 1SVMA 2XSJC 3FM5A 3OIPA 1X4OA 2VIXA 1RIOH 2R7ZJ 2XGCA 1DGRM 1LDDA 4RGSA 4A3IJ 4E7JA 1IV8A 2HXOA 1Y39A 1ETXA 4HNVA 2DYRH 3UNGC 3I55I 1MNMC 5ILUA 2AQFA 2EZIA 3CESA 1JJ8C 1YS6A 3O8HA 2PLYA 4MFDA 3Q0WA 3WE3A 1JUPA 2KZGA 3OYMA 1VQKI 2E1MC 3J7AY 2PMUA 2NVTJ 2CUFA 2K9NA 3CCVI 4BNCA 1IUYA 4L9JA 5B1BH 3ZQ7A 1UG2A 5K7HA 2P8TA 1TQIA 1QVTA 2HS5A 3BTJA 3GEZA 3PFIA 1HLVA 1KU7A 4HNTA 4XRMA 2EFPA 3OV8A 2IEKA 4XBFA 4IRGA 2XASA 1XX5A 4YEJA 1TWFJ 1U9NA 2ZO4A 1K4TA 2FF4A 2FA5A 2X6WA 4EM1A 4TV7A 2ZCWA 3QQAA 3BCAA 4I0AA 3OYNA 2WV0A 1TQPA 4I6ZA 1HW1A 4WX9A 3IL2A 5TISC 3F23A 5E8GA 2EZKA 2WY7Q 3BLYA 2CQNA 2BXZA 1VQPI 1Q1HA 2AXTC 2YR2A 1A04A 5B66C 1WJFA 1QHHD 3PQKA 3KETA 1NG6A 3IH4A 1DU0A 4RAZA 1UHMA 5FD5A 1L3LA 3HRSA 4G12A 3LMMA 2OC6A 3E6MA 3LSHA 2Q1ZB 2E2IJ 1ZHFA 4F55A 5BMZA 4YIIA 2Q8KA 1Z6TA 2ZMEC 5GPAA 3ZMTA 1TWCJ 1YI2I 3SDBA 2YUSA 2FMLA 1ENHA 4PSWA 4P9FA 1KQ0A 3C7JA 4CCJA 4DBRA 3CO7C 1MBHA 4S05A 1WJEA 1WJAA 3JAMZ 3RCOA 3DPLC 3L2QA 2FMYA 2EA4A 4CGZA 3UKGA 3GFLA 3DU6A 2BY2A 4D5FA 2A6HF 1F36A 3GX4X 1XG1A 4GDFA 2OU2A 2LTPA 5L3BA 3CCUI 4XICA 2RAEA 1R49A 3P5JA 4GCVA 1OCPA 3V7RA 2K3FA 3OYJA 2CGPA 3H35A 4UVCA 2R7FA 2CFXA 3BOQA 3K69A 2F5FA 2TCTA 3HOXJ 2CQQA 1SD7A 2VKDA 2Z99A 1PUFA 4Q5SF 4JBAA 4MFEA 2EV6A 1OYYA 2NNYA 1YFHA 1WCMJ 4F3QA 5ICCA 4KDPA 2JRMA 3K6GA 1A6IA 5KNLA 2HOAA 1O7FA 4WF2A 1UB9A 2JMWA 2IJLA 2VUMJ 5F27A 3A2KA 1I3AA 1U3EM 4G8XA 2E19A 2LY9A 3BPVA 4BEHA 3HHGA 4GGGA 2LOOA 2H94A 2W48A 3KP7A 4V19K 2F6CA 3HOVJ 4OMZA 3FK7A 1R4NB 4M72A 3TL4X 4PDKA 4LIVA 2CYYA 2EK5A 2PMZA 4BE0A 1YRNA 1A36A 1I1SA 2AQEA 1Y8QB 2IA0A 1K61A 4ZC3A 3CDLA 1SC7A 1T08B 3TGNA 2JRTA 3GFMA 4A3BJ 1LFPA 4BHBA 2M34A 2KJBA 2F5DA 2QGUA 3DBHB 4C2MJ 1G4DA 3G1MA 2X6YA 2FOWA 3FHZA 2E1OA 2ACJA 1OFCX 3WTSC 1JHHA 1V55H 2RQPA 5FKNA 3S1RJ 4P1WA 4MTDA 2K4JA 2BGCA 3H5AA 3T8TA 2JA6J 3PO2J 2Y48A 3TO9A 2XGDA 1X1CA 1GXPA 4RLFA 3K4BA 4I99C 1BR4A 1HDDC 1I1GA 3J7AO 4N0BA 1SAUA 2L9VA 3A0HC 3I5UA 4LB6B 1XMKA 1YYVA 2DOEA 4Y13A 2Y75A 1U0JA 1W5TA 1MJAA 4XONA 2HZTA 3MZ8A 1FP2A 2GA1A 1MH3A 5HS8A 3BTIA 2EIJH 1OKRA 2Z16A 3LQQA 1FMVA 2DK8A 2FOKA 1K6OA 1W7PD 1NH3A 5EG0B 1TZLA 4EVIA 1Z6RA 2DPDA 1EH8A 3ZMUA 2R4GA 1KZHA 3TP3A 4HZFA 1J9IA 3K1PA 4GYIA 1ZH5A 1X3WB 4V2FA 4XRSA 4ZTFA 1GT0C 3J7YJ 2LDUA 2G0EA 5EZHA 3ZQCA 2EQRA 3V8JA 2L7ZA 3HYIA 4LIUA 5M5WJ 3S1MJ 1TWGJ 4M9ZA 2VI6A 2OAZA 2PFBA 3TW6A 1WH5A 4MQ9F 2ZJQF 1XGNA 3RYRA 4IQJA 2VE9A 1NTCA 2XUBA 1J2XA 3T1BA 4A6DA 3WTYC 3HOSA 5ICEA 3GLXA 4L0ZB 1G59A 3IKVA 2DMPA 3F6OA 1HBXG 1JKRC 1D3YA 1YW9A 4DBQA 2R7TA 2ZKZA 3I0TA 4IEJA 5HDKA 5C3EJ 5IT9K 5IPAA 4K2EA 3OYGA 1SD4A 1T38A 3BCBA 4O6JA 5IP7J 2ICWG 1ZAOA 4JX6A 5D5XB 2O6GE 1P4AA 2V79A 4IKFA 4HSTA 4I76A 1MNDA 5HDNA 4IOCF 2IS1A 4O5VA 3FXOA 2CQKA 3QYBA 4EJVA 3EYYA 4J19A 5HDGA 2FBHA 4XKCA 3VEPA 4AVPA 1SFOJ 2HOSA 1UFMA 2Y9YA 4A3JJ 3H5NA 2X4HA 2A5YB 2LG4A 2CS3A 1WJ5A 3IAS2 2OV7A 3O3KA 3H3UA 3LSTA 5F0FA 1BJZA 1UJ8A 1T56A 3R6SA 5LEKA 3CJRB 4CYDA 2CJJA 2RQQA 2GOMA 2QYOA 4KN7X 5J1YA 2ZSIB 3WGHA 2VBZA 3AG3H 3GFIA 3LSKA 3CMYA 2OTLI 1WJBA 2I8DA 4XLHA 5JVTA 2XHKA 1FZPB 5DEQA 4XNFA 5C4XJ 5BQTA 1I3QJ 5EEGA 4NNJA 4KT5C 2W7NA 1XGMA 1GHCA 1YITI 3HC7A 1D1CA 2HWVA 1KONA 2MLKA 4V2GA 3A4CA 4QSHA 1WGXA 2FJ1A 3M8EA 2P0WA 1X2MA 3TQNA 5FD6A 1I27A 1MDMA 1OQYA 2X6OA 1ACIA 5GPCA 2K40A 1UHSA 1Y6IA 1WPKA 2QQBA 4DZJA 2EPFA 5FKMA 2DPUA 1EF4A 3LA2A 5L3FA 1W5SA 1BM9A 2COBA 2EFOA 2CQXA 1JKOC 2JA5J 3W6JB 2V4JC 3RSNA 2BYVE 3SXYA 2R5YB 2FUG2 4F52A 2VKHA 2XRNA 4CHUA 2FQ4A 1QZEA 2EJRA 2L4MA 2LR8A 2A07F 3SJMA 1XC5A 1MIJA 4ZH4F 5J4YA 2P7VB 2OQRA 3M7GA 4UY8I 1OCZH 5GTHC 4NBQA 4L9TA 2YS9A 3BR3A 4OIOF 1S29A 1D5VA 1FSHA 5AIPA 1R1VA 4ITVA 3L2RA 3CMEI 5J1RA 5M5YJ 5A2QZ 1C0WA 3OL4A 5DD4A 4AIDA 4BJ5C 1A5JA 5DYMA 2Y0SA 4LD5A 5D5VB 2DYSH 2K9SA 3C1DA 5DDGA 3SFZA 4C9YA 3P9CA 3G1OA 2PI0A 1XPXA 3MAJA 5DTDA 2STTA 3QP6A 1LVAA 2ISYA 4XOTA 3O2PE 2NRAC 3EUAA 5ILVA 4A5MA 3CC2I 3CTAA 3FXUA 1RUNA 4XLFA 3OR2C 3RIRA 2ZB9A 2ZJ2A 1F43A 2XSDC 5CQGA 3JRCA 3HTSB 4BHPA 1S8NA 3GWZA 1B6AA 2ZXJA 3JTHA 4OAZA 1G3TA 1S72I 4XRSG 3CLQA 1SAXA 3VWBA 3RI4A 3SZGA 2QSFX 4MHGA 3LNQA 3VYSB 2BW3B 1IJWC 3HOUJ 1P4WA 4Y3OA 2R7XA 3HRMA 3HZJA 4H0EA 2MBFA 3E5XA 3H5RA 2FBKA 2GIZA 2JSCA 1EJ9A 3M3YJ 3ZQQA 4UV9A 2M87A 5D6EA 3QOEA 4MEYF 3FF5A 1POGA 4XKWA 4JYKA 2RNGA 5ERIA 2E2JJ 3PSFA 4BHCA 5K5RA 2O9LA 1Z7LA 2IBDA 2R3SA 2RC4A 2JSPA 1IDZA 1BW6A 2XAJA 1R23A 5D8KB 2ELKA 1Y0NA 5C44J 1DU6A 2GLOA 3LSIA 4BXXJ 1P6RA 5E20A 4KT6A 4BXFA 5HS7A 1U5TA 4ENKA 1B72B 3IV5A 2W84A 4Y33A 3CF5F 1W7PB 3WG9A 1V5EA 2WBMA 4AIKA 4FX4A 3M07A 3W2VA 1UZCA 4HA8A 3FZVA 2K9LA 4PGGA 2WY8Q 3VDXA 5IYDJ 3ASOH 3BJAA 1RESA 2ZXWH 2EV0A 1R5HA 4II3A 2QWWA 3P7NA 1IDYA 3K70C 1XD7A 1N77A 3RZOJ 4ZDOA 1HW2A 5CYVA 4AWXB 1VZ0A 1ZGWA 4A12A 3ESWB 1ONVA 2XAHA 1AKHA 1R36A 2DFEA 4JP0A 2OD5A 4A3EJ 2L0KA 1LE8A 4BJ6C 4U7BA 4HEA2 1ON1A 4M6YA 4AYBN 1EA3A 3BPXA 3RKQA 4I01A 1Z1DA 1LPQA 1FPQA 4IVNA 3PFYA 3GTLJ 2RDPA 2CW7A 3FKJA 5B3SH 1CGPA 1FWZA 3FM3A 1XMXA 2X85A 3IWZA 2R7RA 4ASNA 3I64A 3IAM2 5K7ZA 2HVRA 4WXHA 1Q1VA 5DM6F 3E6DA 4O3MA 3ZN1A 4ZYAA 3KFWX 5K5QA 3CCRI 3GTQJ 5IOZA 5JLWA 3IH3A 5DCMA 1ETWA 5KK1A 5EF6A 3F6VA 4FE7A 4P55A 4CCNA 5HNHA 3WTWC 1SVLA 1VQMI 1TC3C 2L54A 1BI3A 2FNPA 4OWRB 4P9UA 2XPUA 3V8LA 2QQ8A 1FX7A 3K4LA 4G94A 2W1OA 3CCYA 3TMOA 4ETSA 3L1PA 2E2HJ 1LVKA 2XROA 4IF4A 5BPIA 3BG5A 3N97A 1JUSA 2X1DA 4ON0A 2UUZA 4ZJZA 5LLQA 2CV1A 1AHDP 4IHSA 1D5YA 1IW7F 4CXFA 3V8KA 3LSJA 2JPCA 2P6TA 2O61A 2C6YA 1LEAA 2LNBA 2IVMA 2AO9A 3SZPA 2ESHA 4QTRA 3ML6A 3H3VK 5D8LB 4CSWA 2X9DA 5D5UB 3W6KB 3VPRA 4DW6A 1R6RA 1UMQA 3SQNA 1BOBA 3LQRA 1G3WA 4BBSJ 3I3LA 1YIJI 3VSLA 3KZZA 2MLGA 3PM1A 3E6BA 4C30A 1BI0A 4C3HJ 2XDVA 2DOAA 4XLPF 3HHHA 4HF1A 3KYDB 3S2HJ 2YU3A 4HV5A 1MKMA 3T5XA 3QAHA 1HKQA 4B4CA 3RDIA 1E3HA 2KISA 2VKEA 1F4KA 1B9MA 1WQ2A 1MSEC 2QCOA 2BXYA 3S15J 2O5RA 2VKVA 3BY6A 2LF7A 2B63J 3V7CA 4E70A 5GADJ 1IAWA 3G3ZA 3LSPA 1ZLKA 3ABTA 4B8XA 1IRFA 2VPLA 3R4KA 1K83J 1FNNA 1UCRA 1R7JA 3I9V2 4G6DA 1D0XA 2GBYA 2KL4A 2ZJPF 4JOMA 3HOWJ 4MIMA 3BZKA 1U6GA 3KP4A 3QPSA 4LB5A 1YS7A 1QPMA 2M2EA 3PJRA 3ULQB 4E7SA 1J09A 4AIHA 1P7JA 3OL3A 4C3IJ 1BJAA 3KP6A 4BH9A 1X1BA 1S7OA 1Z3XA 3V7SA 2W25A 1JI8A 4Y4RA 3HOTA 4UNOA 1Z3YA 1CF7A 4FISA 4DYCA 1NG7A 2ESNA 2M0MA 3KE2A 2DA4A 1HXDA 1SFKA 2DT7B 1OYWA 3K4CA 3U21A 2QA4I 5ILSA 4C2TA 1PP7U 2WB1A 1B9NA 4RA2A 1ZG1A 2HNHA 3C18A 3KP2A 3L7WA 5IT3A 1XDUA 2VXDA 2DJNA 4ENMA 2UXXA 1ZQ3P 3CUQB 5IYBJ 4PK4A 1BC7C 2ELHA 1I39A 1SD6A 3J7ZI 1JJ6C 3K70D 3FK6A 1T95A 3E6CC 4MGRA 4AIJA 1FBQA 2A69F 3HTUA 1MBKA 2FXAA 4XRFA 3ECOA 5HLIA 2LVSA 5FGMA 2GIVA 1LEBA 3MKYB 3KLNA 1G3YA 5FFZA 2NVXJ 5GTIC 1YIOA 3QOPA 2DA3A 4M3EA 3H36A 2LKXA 4OIPF 3VB2A 4NQWA 3MCZA 2DTRA 1VFCA 2KZVA 2WWYA 2ID3A 3FDYA 3JAMK 3A03A 3ISPA 1XB4A 2Z33A 1A31A 2VBWA 2DA2A 1Z77A 2HPIA 2HR3A 3HPGA 1GVDA 3CCMI 1YJWI 4E7KA 2HQRA 3E1SA 4CYCB 2VBXA 2HVSA 4WXCA 2IPQX 2O3FA 3E3VA 2E36A 4EJWA 4G7HF 1JKQC 1N75A 3CJTB 3TP0A 4EM0B 4A3DJ 4R8HA 5CPRB 3ZQLA 3A01B 3I56I 3OS0A 2JVGA 4BACA 2KT0A 4HAMA 3EUKL 2QUFA 3U2RA 3OYCA 2OCCH 4PSXA 3DLAA 4Z6YA 1HKTA 2R7UA 3L2VA 5HOOA 1NK2P 5EYRA 3CDHA 3KYLA 1L0OC 1BR1A 3DKXA 2LKPA 2QQAA 5LGUA 3GTPJ 1GXQA 2NVUB 3FXMA 3BTCA 5FJ8J 3GZ6A 2V1DA 1XMAA 1XSXA 3BWGA 1HW5A 1UELB 2DW4A 1KYWA 5E17F 1FLIA 2QSHX 5JFRA 3QP5A 3BZ6A 4N9IA 3AL0B 2R7VA 1BN5A 3D0SA 1ETVA 3ZR8X 2IT0A 1AU7A 5HODA 2XAFA 1OISA 4BY7J 2P81A 2HVQA 3VYUB 1Z91A 4P5OA 4U7DA 3TBIA 4EJOA 6PAXA 5ICFA 4KUMA 2PEXA 4B47A 3ZQIA 3CMAI 4RDUA 3OS2A 2K85A 2GXBA 3ZQHA 3ZGKA 3R61A 5TRDA 5CJ9A 1X58A 4HF0A 1D0YA 2DQRA 3MKZA 1IN5A 1ZRFA 2L5QA 5TGTA 3HM5A 1WRJA 1WVRA 1TT0A 3ZMZA 5CVJA 4HF2A 2M4KA 2ZJRF 2R7DA 1I6XA 2DJIA 3EUHC 1QBJA 2QBYA 1XSVA 2X0LA 4WCGA 3COAC 2EZHA 1IF1A 4XL9A 3VSKA 4XLAA 4KIBA 2M4GA 2CV2A 2W85A 3OWTA 2FEZA 2BV6A 4W1UA 1IGNA 4BU2A 1Z9CA 2XF5A 1D1AA 2O0YA 1HOMA 2R7QA 3MD2A 4FQGA 2IS4A 1Z21A 2M0CA 3VOEA 1A35A 3B73A 3F0CA 3CC4I 4HPQA 1RR8C 5LEJA 2DFIA 2VT3A 5FKOA 4UUTA 2EWNA 1VQOI 4EEFG 1HCRA 2KP6A 1APLC 2JUGA 5K5OA 2VT2A 3D1NI 5J40A 4D1QA 2NS7A 3JTGA 2XC7A 2H27A 1S6LA 4HYEA 1WHUA 2VXZA 4UB6C 2VN2A 1KU9A 1J59A 5L3DA 4D7NA 1ZREA 3K1MA 3FXLA 3HG9A 5BNGA 3TO6A 3X2QH 3GUDA 1X1DA 2HTJA 2Q0OA 1J75A 3IUOA 1RI7A 2ID6A 4MEXF 5CKTA 2HOTA 1DUXC 3HPHA 1OCRH 3EYIA 3GTOJ 2AHQA 3A02A 1YG2A 3M1EA 1EKEA 2L02A 3HUGA 4DGWB 1PUFB 2ISZA 3RZDJ 4XIDA 3JSPA 2D5VA 4KICA 3BR0A 2KIUA 1WFXA 1Y0UA 2KPMA 1IZ1A 1S9HA 2W82A 3NRVA 3H3ZA 2OPTA 2XB0X 1ORKA 4E7IA 2OTJI 3BP8A 5FRMA 3ZMSA 3OYAA 1LFBA 1XCBA 2CUEA 4ZDLA 3C2GA 3V42A 4BEHB 1G2HA 4PFOA 2EB7A 3PL8A 5KCMA 4QPQA 4BJTA 1XTAA 4HX7A 4IO9F 5B1AH 2PMZN 1LFUP 1V54H 5D6FA 5D5WB 5E8IA 2VQLA 4JX5A 4Y7NJ 2MW8A 3DLLF 3FXQA 2PMHA 4ZYHA 2NOGA 2CU7A 4HOBA 4BUPA 3CF2A 2BY3A 5LHIA 4LOCA 4XORA 3H0DA 5IP6A 1HC8A 3HDDA 1GV2A 1PP8F 5FRNA 3DKWA 4HNUA 3BJ6A 4E7ZA 4Z2YA 2KMUA 3ZN0A 3MVPA 2LH9A 1O3QA 2AXLA 2CQ7A 2BOLA 2DTZA 3G1LA 5KVRA 3W3CA 2DLLA 2M3AA 2VJJA 2WA0A 3I4PA 1X1PA 1ETKA 1HF0A 3HXLA 5E1XA 4HV6A 5EGOA 1N25A 3ZP5A 2E1CA 3EDPA 3R0JA 3ABUA 1SD5A 1YW7A 2FNAA 3NWSA 5DUIA 1HKSA 2COMA 3N4MA 2XV4S 2GAUA 2DA7A 1X2NA 1IRXA 1IRGA 2K3PA 3KX2A 4KN4X 3ZQFA 2QZ8A 2DFHA 1NHAA 4ZTJA 3K4KA 3HGGA 3HSRA 3BQYA 3QU6A 1VQ9I 1DPUA 4R1HA 3W6VA 1WJCA 2M8EA 3PO3J 1FYLA 2MH9A 1HDPA 4A3FJ 4HQEA 2LFBA 2UXNA 3PIPF 3OIQA 3OSFA 5DD8A 1TT5B 2DOFA 2ADUA 3G2BA 4RAFA 1MMDA 2RVCA 1G6NA 2F48A 3F21A 4AVZA 3HSEA 1T39A 3CJQB 5J3LA 2DO7A 2HDWA 1YE9A 3WE2A 3KLOA 5F0HA 4OIQF 5JLXA 3DV8A 1Y1WJ 2HDCA 5A2QK 4BE2A 1STZA 1I6HJ 2HQAA 2KRCA 5FLXZ 3S17J 3WTVC 3LSMA 3SZTA 3F22A 1E3OC 4LG0A 3V4GA 4UUVA 5H6RA 1PJRA 3OYIA 2DN0A 1D0ZA 2VB6A 4IHXA 4HX8A 4M6VA 1JTXA 2XPVA 3CLOA 4HG2A 1R5ID 5AONA 5F1RA 1DGWY 2R5ZB 3GF2A 4PJMA 4EATA 3LSGA 4KYWA 4A3MJ 5FO5A 3F72A 4I09A 5JR3A 2HYJA 4LK1F 2HZDA 4CUGA 3DBRB 2ZXIA 4HDUA 3MFKA 3E5QA 4FCYA 1VQ5I 2DFFA 3BG3A 2UWMA 2ZNYA 3CP2A 3K10A 3TOAA 2MGQA 4NUBA 5HLGA 4HDVA 2Z1DA 3ERMA 2PJRA 4FX0A 3H9JA 2A6EF 1OJLA 3DFGA 3HKZA 3I71A 3QWLA 4D9JA 1ETYA 1S3JA 4GYGA 2H09A 5E3OA 4U88A 4ZZLA 1QQIA 1SFXA 3JW4A 2X51A 2DBBA 3J80K 4CO8A 2FQ3A 2OBPA 4FHTA 4C2UA 2KIMA 3A1YA 1R5GA 3BC8A 3SEZA 1B72A 4PJJA 2N8GA 1W7PA 2B7EA 1B8IA 3LA3A 2YX4A 3TW7A 1MJBA 2DMQA 3K1NA 1UG0A 4B43A 4D5CA 3DBLB 1MD0A 4M3GA 1ZK8A 3ZOBA 5DV5A 3BG6A 1BC8C 2PX9A 3OYDA 2B9SA 1LDKB 3BG9A 2L7MP 2XF7A 1FIPA 1T0FC 2XAQA 4DNCA 3TEDA 3HRUA 3JREA 3MWMA 3P9IA 3DP7A 1W5CC 4FETA 5H2FC 3DCFA 1H8AC 5BS6A 5L3CA 3D5LA 1MDMB 3QYEA 3GMEA 2YU9J 1FTTA 2BHYA 4GRIA 4ENJA 3DEUA 2DA6A 2DDAA 2XGXA 2Y31A 2Z9OA 4L5EA 2MG4A 3P9KA 4FTHA 3SHFA 1J5YA 2ZMEA 2DMNA 4A93J 3J80Z 3GBGA 2IGNA 2K86A 2O8KA 4M3FA 3UR3C 2D2WA 1LDJA 1XS9A 4RB0A 3KP3A 1D1BA 3OY9A 2MD5A 2CWEA 1WSUA 3U9GA 4AYBA 1WI9A 2XAGA 1FYMA 5B5EC 1U8RA 1QGPA 1Y56A 3CC7I 2XPWA 1R71A 4ABZA 2MFZA 4G6QA 2M30A 4M3BA 3RPUD 1DP7P 3IH2A 4QIWN 2EFQA 1FOWA 1BI1A 1FP1D 4OMYA 3CCQI 2E1NA 4A0YA 1Z67A 1KU2A 2H8RA 2MC4A 3BJOA 2E1MB 2OF7A 5J4VA 2DA5A 4F92B 1FC3A 2JJ7A 2RV8A 4RGUA 5E3MA 1U9OA 2GZWA 3AAFA 3GVAA 1P2FA 2H6BA 2VC0A 3KYCB 4LLNA
chains in the Genus database with same CATH topology
3HB9A 1P7JA 3JRFA 4C3IJ 5F1JA 1BA5A 2W48A 3HOVJ 4FISA 4DYCA 3FK7A 5F04A 2DA4A 1RKTA 2R93J 1YRNA 4Y52J 4UUSA 2KDZA 1K61A 1FEXA 3CDLA 2DJNA 1ZQ3P 4S0HB 5IYBJ 4A3BJ 2M34A 1IG7A 4FE4A 4MO7A 1WH7A 2DA1A 5EZGA 1JJ6C 3FK6A 4C2MJ 2M9HA 3G1MA 5EGOB 2E1OA 1OFCX 1MBKA 5DS9A 2LVSA 5FKNA 4D7MA 3SFIA 3S1RJ 2NVXJ 1QVUA 4BY1J 1MBGA 2DA3A 4M3EA 2JA6J 2LKXA 3PO2J 2XGDA 1VFCA 4IHVA 2ECCA 2ID3A 3FIWA 4IHWA 3A03A 3K7AJ 1HDDC 1Y1VJ 2DA2A 1Z77A 1ZR2A 1GVDA 4B3AA 4CYCB 2ME0A 1MH3A 3BTIA 1JKQC 1S7EA 3TP0A 4A3DJ 1JTYA 3S2DJ 3ZQLA 3A01B 5EG0B 3HGYA 5F08A 3S1QJ 3TP3A 2KT0A 3MN2A 3OOUA 3BR5A 3Q0UA 4V2FA 4XRSA 1GT0C 1NK2P 5EYRA 2G0EA 5EZHA 3ZQCA 3S16J 2EQRA 3FKIJ 2L7ZA 5M5WJ 3S1MJ 3GTKJ 1VI0A 3GTPJ 2DMUA 1TWGJ 2VI6A 5J1UA 2H1KA 4A3CJ 3BTCA 5FJ8J 2JA8J 3TW6A 1LE8B 1WH5A 3HEFA 5EEAA 4M3DA 1IUFA 1ETVA 1NTCA 3JRDA 1P7IA 1AU7A 5HODA 4BY7J 2K9QA 2P81A 1H89C 3Q0VA 2DMPA 4W97A 1JKRC 1BW5A 1MBJA 4A3KJ 2WV1A 3WHCA 4IEJA 3ZQIA 3B6AA 5C3EJ 4RDUA 1VF9A 5IPAA 3JRAA 3HKZN 1RR7A 3O8GA 3ZQHA 2CRGA 3K2AA 9ANTA 1FJLA 1O4XA 5K7FA 1X58A 5IP7J 3Q3SA 3BR6A 4JX6A 3RQIA 2Y0SN 2FX0A 4I76A 3HM5A 1MH4A 4J19A 4BKXA 3LSRA 2LD5A 1TWHJ 2HOSA 1SFOJ 2M8GX 2Y9YA 1JGGA 4A3JJ 2QF7A 5IP9J 4X1EA 4CYCA 4DYRA 2EZHA 1CQTA 3C2BA 1OCTC 1B8IB 3GTJJ 5F0FA 1BJZA 4W1UA 1T56A 1IGNA 1HOMA 2ME6A 2CJJA 2L7FP 3A01A 2ECBA 3OSGA 2M0CA 5J1YA 5M5XJ 3F0CA 3CMYA 2L9RA 3NARA 4AUXA 5FKOA 3BTLA 5M3MJ 4UUTA 5C4XJ 4EEFG 1HCRA 1APLC 1I3QJ 3HOYJ 1RPWA 3D1NI 4A3GJ 2NS7A 4JX4A 3HBLA 4QSHA 4V2GA 1WGXA 2HQ5A 2FJ1A 2JWTA 5IYCJ 1X2MA 1BL0A 2EBIA 1H88C 4D7NA 2Y9ZA 2X6OA 5GPCA 2K40A 5EDNA 1UHSA 1VNDA 5BNGA 2JA7J 1GV5A 1WPKA 4DZJA 2TRTA 5FKMA 1EF4A 5M3FJ 2COBA 2ID6A 1JKOC 2CQXA 2HOTA 2JA5J 2I10A 2R5YB 2EH3A 1U78A 2AHQA 3GTOJ 3A02A 2HXIA 1PUFB 2IAIA 3RZDJ 3I4MJ 4XIDA 5E3NA 2FQ4A 5C4JJ 3H0GJ 1Z0XA 1W0UA 3FISA 2D5VA 2LR8A 3BR0A 3SJMA 1XC5A 4GFBA 2OPTA 2XB0X 1ZR4A 1ORKA 2YS9A 3BR3A 2HDDA 1LFBA 5J1RA 5M5YJ 2CUEA 1G2HA 1A5JA 1MSFC 2K9SA 3MKLA 2PMZN 1LFUP 2WB1N 2VPRA 2R0QC 3GTGJ 1QRYA 3G1OA 1IV6A 4JX5A 5DTDA 4Y7NJ 1AKHB 2MW8A 3HOZJ 2NOGA 2CU7A 1ZTRA 2LK2A 2NVYJ 4UUSB 4LOCA 2ZB9A 2EZLA 1F43A 2XSDC 3JRCA 5IP6A 3BR1A 3HDDA 3BQZA 1GV2A 2X48A 1IRZA 4AC0A 4RBOA 1R9TJ 3MVPA 4XRSG 2Y2ZA 3S14J 2DTZA 2Y30A 3GTMJ 3G1LA 3LNQA 1IJWC 3HOUJ 1ETKA 1HF0A 4IHYA 5EGOA 3DEWA 4BBRJ 2NVQJ 3M3YJ 3ZQGA 1MBEA 3JRBA 2GM4A 2XRLA 1WI3A 2DA7A 1W0TA 1X2NA 2FD5A 1POGA 3LOCA 4JYKA 1FIAA 3ZQFA 2E2JJ 2O9LA 1ETQA 2IBDA 2WAQN 3HGGA 4MLOA 1IDZA 1BW6A 3BQYA 2ELKA 5C44J 3W6VA 1DU6A 2GLOA 1RKWA 3PO3J 4BXXJ 4A3FJ 1HDPA 2LP0A 2NS8A 1RETA 2LFBA 1B72B 3IV5A 3OSFA 2O7OA 3WHBA 5EG0A 1JT6A 3QPLA 3B6CA 4X6AJ 5J3LA 3BT9A 1ITYA 3JRHA 5IYDJ 5FKLA 5F0HA 2JK3A 1T33A 1RESA 5JLXA 1IDYA 1Y1WJ 3RZOJ 1I6HJ 3S17J 1ZGWA 2R7ZJ 2XGCA 1E3OC 1AKHA 4JP0A 4A3EJ 3JRGA 4A3IJ 2DN0A 2L0KA 3SDGA 4IHXA 1LE8A 2HXOA 5GP9A 1ETXA 4M6VA 1JTXA 2XPVA 4HNVA 1MNMC 4AYBN 2EZIA 2R5ZB 3BR2A 1JJ8C 1ETOA 5F0CA 3RKQA 3GTLJ 3O8HA 3LSGA 4MFDA 4A3MJ 3Q0WA 1JUPA 2HYJA 2NVTJ 3E7LA 5FLMJ 2CUFA 5FKKA 2K9NA 5K7ZA 3CQZJ 4FCYA 1Q1VA 1UG2A 2JN6A 3BG3A 1MBFA 5K7HA 1FTZA 2MGQA 4DYQA 3BTJA 1QVTA 5IOZA 1HLVA 3GTQJ 5JLWA 3IH3A 4XRMA 1ETWA 4B1RA 2IEKA 1OJLA 1TWFJ 1U9NA 5EF6A 4FE7A 1ETYA 3QQAA 1JT0A 5E3OA 2XGEA 4I6ZA 1TC3C 2XPUA 2EZKA 3OIOA 3CCYA 3L1PA 2E2HJ 4A69C 3BG5A 1JUSA 3IH4A 1DU0A 3S1NJ 3JR9A 1B72A 2N8GA 1B8IA 1AHDP 1YRNB 4G12A 1D5YA 3TW7A 4NDLA 2DMQA 4D5CA 5E3LA 3LSJA 3NAUA 4M3GA 1GDTA 2E2IJ 4A3LJ 1QPIA 1ZK8A 5GPAA 3ZOBA 1TWCJ 2AO9A 4QTRA 1NK3P 3H3VK 3BG9A 2X9DA 2YUSA 2L7MP 3VPRA 1ENHA 4DW6A 1UMQA 1FIPA 1IC8A 3TEDA 4BBSJ 3JREA 2HI3A 3PM1A 4C3HJ 2R92J 3DCFA 1MBHA 1H8AC 4DZPA 1ZKGA 3S2HJ 4C3JJ 1FTTA 2YU9J 4XK4A 3JRIA 2DA6A 3UKGA 4B4CA 2LLKA 2Y31A 4D5FA 4L5EA 2MG4A 1F36A 2VKEA 1XG1A 4FTHA 2DMTA 2R5ZA 2DMNA 1GUUA 1I50J 2LTPA 4A93J 1MSEC 3GBGA 2QCOA 2O8KA 4M3FA 4XICA 2RAEA 3S15J 1XS9A 2VKVA 1OCPA 2B63J 1U8BA 2R5YA 2TCTA 3HOXJ 2CQQA 3LSPA 1PUFA 2MSYA 2XPWA 2XB5A 1K83J 4MFEA 4ABZA 3I4NJ 1JUMA 4M3BA 2GBYA 1WCMJ 3IH2A 1SANA 4QIWN 1TWAJ 3HOWJ 1A6IA 4MIMA 3M4OJ 2HOAA 5IOYA 3QPSA 1JKPC 2H8RA 2OF7A 2JMWA 5FLVA 2DA5A 2JJ7A 5F27A 2VUMJ 2E19A 1U9OA 2LY9A 2M2EA 5E3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HB9 A;  1P7J A;  3JRF A;  4C3I J;  5F1J A;  1BA5 A;  2W48 A;  3HOV J;  4FIS A;  4DYC A;  3FK7 A;  5F04 A;  2DA4 A;  1RKT A;  2R93 J;  1YRN A;  4Y52 J;  4UUS A;  2KDZ A;  1K61 A;  1FEX A;  3CDL A;  2DJN A;  1ZQ3 P;  4S0H B;  5IYB J;  4A3B J;  2M34 A;  1IG7 A;  4FE4 A;  4MO7 A;  1WH7 A;  2DA1 A;  5EZG A;  1JJ6 C;  3FK6 A;  4C2M J;  2M9H A;  3G1M A;  5EGO B;  2E1O A;  1OFC X;  1MBK A;  5DS9 A;  2LVS A;  5FKN A;  4D7M A;  3SFI A;  3S1R J;  2NVX J;  1QVU A;  4BY1 J;  1MBG A;  2DA3 A;  4M3E A;  2JA6 J;  2LKX A;  3PO2 J;  2XGD A;  1VFC A;  4IHV A;  2ECC A;  2ID3 A;  3FIW A;  4IHW A;  3A03 A;  3K7A J;  1HDD C;  1Y1V J;  2DA2 A;  1Z77 A;  1ZR2 A;  1GVD A;  4B3A A;  4CYC B;  2ME0 A;  1MH3 A;  3BTI A;  1JKQ C;  1S7E A;  3TP0 A;  4A3D J;  1JTY A;  3S2D J;  3ZQL A;  3A01 B;  5EG0 B;  3HGY A;  5F08 A;  3S1Q J;  3TP3 A;  2KT0 A;  3MN2 A;  3OOU A;  3BR5 A;  3Q0U A;  4V2F A;  4XRS A;  1GT0 C;  1NK2 P;  5EYR A;  2G0E A;  5EZH A;  3ZQC A;  3S16 J;  2EQR A;  3FKI J;  2L7Z A;  5M5W J;  3S1M J;  3GTK J;  1VI0 A;  3GTP J;  2DMU A;  1TWG J;  2VI6 A;  5J1U A;  2H1K A;  4A3C J;  3BTC A;  5FJ8 J;  2JA8 J;  3TW6 A;  1LE8 B;  1WH5 A;  3HEF A;  5EEA A;  4M3D A;  1IUF A;  1ETV A;  1NTC A;  3JRD A;  1P7I A;  1AU7 A;  5HOD A;  4BY7 J;  2K9Q A;  2P81 A;  1H89 C;  3Q0V A;  2DMP A;  4W97 A;  1JKR C;  1BW5 A;  1MBJ A;  4A3K J;  2WV1 A;  3WHC A;  4IEJ A;  3ZQI A;  3B6A A;  5C3E J;  4RDU A;  1VF9 A;  5IPA A;  3JRA A;  3HKZ N;  1RR7 A;  3O8G A;  3ZQH A;  2CRG A;  3K2A A;  9ANT A;  1FJL A;  1O4X A;  5K7F A;  1X58 A;  5IP7 J;  3Q3S A;  3BR6 A;  4JX6 A;  3RQI A;  2Y0S N;  2FX0 A;  4I76 A;  3HM5 A;  1MH4 A;  4J19 A;  4BKX A;  3LSR A;  2LD5 A;  1TWH J;  2HOS A;  1SFO J;  2M8G X;  2Y9Y A;  1JGG A;  4A3J J;  2QF7 A;  5IP9 J;  4X1E A;  4CYC A;  4DYR A;  2EZH A;  1CQT A;  3C2B A;  1OCT C;  1B8I B;  3GTJ J;  5F0F A;  1BJZ A;  4W1U A;  1T56 A;  1IGN A;  1HOM A;  2ME6 A;  2CJJ A;  2L7F P;  3A01 A;  2ECB A;  3OSG A;  2M0C A;  5J1Y A;  5M5X J;  3F0C A;  3CMY A;  2L9R A;  3NAR A;  4AUX A;  5FKO A;  3BTL A;  5M3M J;  4UUT A;  5C4X J;  4EEF G;  1HCR A;  1APL C;  1I3Q J;  3HOY J;  1RPW A;  3D1N I;  4A3G J;  2NS7 A;  4JX4 A;  3HBL A;  4QSH A;  4V2G A;  1WGX A;  2HQ5 A;  2FJ1 A;  2JWT A;  5IYC J;  1X2M A;  1BL0 A;  2EBI A;  1H88 C;  4D7N A;  2Y9Z A;  2X6O A;  5GPC A;  2K40 A;  5EDN A;  1UHS A;  1VND A;  5BNG A;  2JA7 J;  1GV5 A;  1WPK A;  4DZJ A;  2TRT A;  5FKM A;  1EF4 A;  5M3F J;  2COB A;  2ID6 A;  1JKO C;  2CQX A;  2HOT A;  2JA5 J;  2I10 A;  2R5Y B;  2EH3 A;  1U78 A;  2AHQ A;  3GTO J;  3A02 A;  2HXI A;  1PUF B;  2IAI A;  3RZD J;  3I4M J;  4XID A;  5E3N A;  2FQ4 A;  5C4J J;  3H0G J;  1Z0X A;  1W0U A;  3FIS A;  2D5V A;  2LR8 A;  3BR0 A;  3SJM A;  1XC5 A;  4GFB A;  2OPT A;  2XB0 X;  1ZR4 A;  1ORK A;  2YS9 A;  3BR3 A;  2HDD A;  1LFB A;  5J1R A;  5M5Y J;  2CUE A;  1G2H A;  1A5J A;  1MSF C;  2K9S A;  3MKL A;  2PMZ N;  1LFU P;  2WB1 N;  2VPR A;  2R0Q C;  3GTG J;  1QRY A;  3G1O A;  1IV6 A;  4JX5 A;  5DTD A;  4Y7N J;  1AKH B;  2MW8 A;  3HOZ J;  2NOG A;  2CU7 A;  1ZTR A;  2LK2 A;  2NVY J;  4UUS B;  4LOC A;  2ZB9 A;  2EZL A;  1F43 A;  2XSD C;  3JRC A;  5IP6 A;  3BR1 A;  3HDD A;  3BQZ A;  1GV2 A;  2X48 A;  1IRZ A;  4AC0 A;  4RBO A;  1R9T J;  3MVP A;  4XRS G;  2Y2Z A;  3S14 J;  2DTZ A;  2Y30 A;  3GTM J;  3G1L A;  3LNQ A;  1IJW C;  3HOU J;  1ETK A;  1HF0 A;  4IHY A;  5EGO A;  3DEW A;  4BBR J;  2NVQ J;  3M3Y J;  3ZQG A;  1MBE A;  3JRB A;  2GM4 A;  2XRL A;  1WI3 A;  2DA7 A;  1W0T A;  1X2N A;  2FD5 A;  1POG A;  3LOC A;  4JYK A;  1FIA A;  3ZQF A;  2E2J J;  2O9L A;  1ETQ A;  2IBD A;  2WAQ N;  3HGG A;  4MLO A;  1IDZ A;  1BW6 A;  3BQY A;  2ELK A;  5C44 J;  3W6V A;  1DU6 A;  2GLO A;  1RKW A;  3PO3 J;  4BXX J;  4A3F J;  1HDP A;  2LP0 A;  2NS8 A;  1RET A;  2LFB A;  1B72 B;  3IV5 A;  3OSF A;  2O7O A;  3WHB A;  5EG0 A;  1JT6 A;  3QPL A;  3B6C A;  4X6A J;  5J3L A;  3BT9 A;  1ITY A;  3JRH A;  5IYD J;  5FKL A;  5F0H A;  2JK3 A;  1T33 A;  1RES A;  5JLX A;  1IDY A;  1Y1W J;  3RZO J;  1I6H J;  3S17 J;  1ZGW A;  2R7Z J;  2XGC A;  1E3O C;  1AKH A;  4JP0 A;  4A3E J;  3JRG A;  4A3I J;  2DN0 A;  2L0K A;  3SDG A;  4IHX A;  1LE8 A;  2HXO A;  5GP9 A;  1ETX A;  4M6V A;  1JTX A;  2XPV A;  4HNV A;  1MNM C;  4AYB N;  2EZI A;  2R5Z B;  3BR2 A;  1JJ8 C;  1ETO A;  5F0C A;  3RKQ A;  3GTL J;  3O8H A;  3LSG A;  4MFD A;  4A3M J;  3Q0W A;  1JUP A;  2HYJ A;  2NVT J;  3E7L A;  5FLM J;  2CUF A;  5FKK A;  2K9N A;  5K7Z A;  3CQZ J;  4FCY A;  1Q1V A;  1UG2 A;  2JN6 A;  3BG3 A;  1MBF A;  5K7H A;  1FTZ A;  2MGQ A;  4DYQ A;  3BTJ A;  1QVT A;  5IOZ A;  1HLV A;  3GTQ J;  5JLW A;  3IH3 A;  4XRM A;  1ETW A;  4B1R A;  2IEK A;  1OJL A;  1TWF J;  1U9N A;  5EF6 A;  4FE7 A;  1ETY A;  3QQA A;  1JT0 A;  5E3O A;  2XGE A;  4I6Z A;  1TC3 C;  2XPU A;  2EZK A;  3OIO A;  3CCY A;  3L1P A;  2E2H J;  4A69 C;  3BG5 A;  1JUS A;  3IH4 A;  1DU0 A;  3S1N J;  3JR9 A;  1B72 A;  2N8G A;  1B8I A;  1AHD P;  1YRN B;  4G12 A;  1D5Y A;  3TW7 A;  4NDL A;  2DMQ A;  4D5C A;  5E3L A;  3LSJ A;  3NAU A;  4M3G A;  1GDT A;  2E2I J;  4A3L J;  1QPI A;  1ZK8 A;  5GPA A;  3ZOB A;  1TWC J;  2AO9 A;  4QTR A;  1NK3 P;  3H3V K;  3BG9 A;  2X9D A;  2YUS A;  2L7M P;  3VPR A;  1ENH A;  4DW6 A;  1UMQ A;  1FIP A;  1IC8 A;  3TED A;  4BBS J;  3JRE A;  2HI3 A;  3PM1 A;  4C3H J;  2R92 J;  3DCF A;  1MBH A;  1H8A C;  4DZP A;  1ZKG A;  3S2H J;  4C3J J;  1FTT A;  2YU9 J;  4XK4 A;  3JRI A;  2DA6 A;  3UKG A;  4B4C A;  2LLK A;  2Y31 A;  4D5F A;  4L5E A;  2MG4 A;  1F36 A;  2VKE A;  1XG1 A;  4FTH A;  2DMT A;  2R5Z A;  2DMN A;  1GUU A;  1I50 J;  2LTP A;  4A93 J;  1MSE C;  3GBG A;  2QCO A;  2O8K A;  4M3F A;  4XIC A;  2RAE A;  3S15 J;  1XS9 A;  2VKV A;  1OCP A;  2B63 J;  1U8B A;  2R5Y A;  2TCT A;  3HOX J;  2CQQ A;  3LSP A;  1PUF A;  2MSY A;  2XPW A;  2XB5 A;  1K83 J;  4MFE A;  4ABZ A;  3I4N J;  1JUM A;  4M3B A;  2GBY A;  1WCM J;  3IH2 A;  1SAN A;  4QIW N;  1TWA J;  3HOW J;  1A6I A;  4MIM A;  3M4O J;  2HOA A;  5IOY A;  3QPS A;  1JKP C;  2H8R A;  2OF7 A;  2JMW A;  5FLV A;  2DA5 A;  2JJ7 A;  5F27 A;  2VUM J;  2E19 A;  1U9O A;  2LY9 A;  2M2E A;  5E3M A; 
#chains in the Genus database with same CATH topology
 4N9H A;  3JRF A;  5F1J A;  3DPU A;  3WG7 H;  1YTY A;  2A5W A;  2CFO A;  1IXR C;  2RN7 A;  2OZ6 A;  4M9S A;  3OR1 C;  3QOD A;  5GAH J;  1KA8 A;  2JQ7 A;  4KA4 A;  1MMG A;  4MQV A;  4ANJ A;  1RKT A;  1J0R A;  3HJE A;  4XLN F;  4Y52 J;  3M8F A;  4UUS A;  2KDZ A;  4JQF A;  2UV1 A;  2F5C A;  3W2W A;  3DKY A;  1K6Y A;  4S0H B;  2IS6 A;  4IZZ A;  1IG7 A;  4HQM A;  1ZGJ A;  3EUH A;  4MO7 A;  2DA1 A;  2V26 A;  3KIO A;  1IN4 A;  2M9H A;  1FOX A;  2XF6 A;  4XM3 A;  5BPD A;  3IWF A;  2IRF G;  2I5U A;  3GXO A;  3PQJ A;  5DS9 A;  3T8R A;  4BE1 A;  2A6T A;  3S32 A;  2VOP A;  4D7M A;  2Y0M A;  4GO1 A;  2Q2E A;  5DUK A;  2X1E A;  4BY1 J;  5TJJ A;  5HLT A;  1MBG A;  2EIN H;  3G6E I;  3IHU A;  2GOX B;  2P4W A;  2QVO A;  2ECC A;  4IHT A;  3FIW A;  3J81 K;  2DDB A;  4HLX A;  3S3N A;  4Q47 A;  2JT1 A;  1V4R A;  1Y1V J;  1E17 A;  5HLH A;  2L2O A;  4D0P A;  4ESF A;  1F5T A;  4B3A A;  3I59 A;  3FBN B;  4KIS A;  2LF8 A;  2DU9 A;  1U5T B;  2DCE A;  3WTX C;  4G9Y A;  3WU0 A;  1X19 A;  1S7E A;  2DXI A;  4KMU X;  1K78 A;  2BZT A;  1FOK A;  3OS1 A;  2WAQ A;  1I5Z A;  2KRH A;  3EQL F;  3LA7 A;  3ECH A;  4UVA A;  5F08 A;  4CA0 A;  1TTY A;  3ROU A;  5JI6 A;  3MN2 A;  3OOU A;  4HLY A;  3Q0U A;  4DQ2 A;  2KQR A;  4Q48 A;  1AOY A;  2ZFW A;  3CCJ I;  3GLL A;  3FKI J;  2XIG A;  4U0W A;  4UB8 C;  2LBF A;  4XQF A;  1VI0 A;  3GTK J;  2DMU A;  2QM3 A;  3PSI A;  5J1U A;  2G7H A;  3M9A A;  2L4A A;  2L9S A;  3GCM A;  1H9G A;  2CW0 F;  1OCT C;  1LE8 B;  1PYV A;  1KYZ A;  1QZZ A;  1IUF A;  1YW8 A;  2ZFU A;  2J5O A;  3J81 Z;  4I7H A;  2OZU A;  4LLL A;  3JRD A;  1P7I A;  2NYX A;  2STW A;  3CCE I;  2VQG A;  2HYG D;  3Q0V A;  2CUZ A;  3I54 A;  3N05 A;  4OIR F;  3A0B C;  5FFX A;  4LK0 F;  2VJ4 A;  2V6C A;  2LRD A;  1MBJ A;  4LIT A;  5J8F A;  3WHC A;  4ZYE A;  2R7S A;  2NNN A;  3B6A A;  1VF9 A;  4NHJ A;  3O8G A;  2D45 A;  5CQE A;  1FJL A;  5DCM B;  2LY2 A;  5K7F A;  4PGH A;  3KEQ A;  1XSD A;  1E2X A;  5IY5 H;  3F8M A;  2PBI A;  3K4J A;  4F91 B;  5EJC A;  4LG3 A;  2FX0 A;  4IQ4 A;  2M7A A;  2KDO A;  1W36 D;  2HKO A;  1MH4 A;  3IRQ A;  2KRF A;  4L0Y B;  3LSR A;  2W4S A;  4X0G A;  1TWH J;  3OYB A;  4YRV A;  2M8G X;  4YFN F;  1JGG A;  3O6B B;  4X1E A;  2MA3 A;  4CYC A;  4DYR A;  1YO5 C;  2E60 A;  1HST A;  2F2E A;  1Y8R B;  2JTV A;  1CQT A;  1XCV A;  4FT8 A;  1O57 A;  5LGT A;  2E71 A;  2CUJ A;  3EPZ A;  3CZ6 A;  3RPQ A;  2V1X A;  3RKX A;  2OCE A;  3A01 A;  1T6S A;  2PG4 A;  2ECB A;  1TP4 A;  3OSG A;  3ZMD A;  3KZY A;  4MNU A;  3MMY B;  2MC3 A;  1R58 A;  3NAR A;  4BL0 B;  5M3M J;  5LD2 C;  4XOP A;  5F64 A;  2UZK A;  1QNT A;  5JHU A;  3IP4 B;  3BZC A;  1VTN C;  3HOY J;  2V7F A;  1B4A A;  1RPW A;  1D8J A;  4A5N A;  2H6C A;  4RGR A;  2VLA A;  3K4N A;  2IS2 A;  3NEU A;  2P6S A;  5H20 A;  2E34 A;  5DM7 F;  2JWT A;  3ABM H;  4E6K G;  5IYC J;  2EBI A;  3CJN A;  1BR2 A;  3R60 A;  2Y9Z A;  3GW2 A;  4DOZ A;  2G9W A;  4YIR X;  3OOP A;  2JA7 J;  1GV5 A;  3M8J A;  3TDZ C;  5AIQ A;  2TRT A;  1VQ6 I;  2WAF A;  3DXJ F;  5M3F J;  2GQQ A;  2ETH A;  2O8X A;  2FU4 A;  3PUF A;  1R22 A;  2I10 A;  5E79 C;  2GXA A;  1VQ7 I;  2V9P A;  3W2A A;  2IAI A;  3I4M J;  1B1B A;  3H0G J;  4ZYD A;  2K02 A;  3VYT B;  2HOE A;  3ABK H;  4OAY A;  3WTT C;  1T8I A;  4RAY A;  4GFB A;  2E5Z A;  4IPA A;  4RB3 C;  3KPH A;  4Q4Z F;  2HDD A;  3D5S C;  1V5F A;  3REO A;  4RB1 A;  2HYF A;  1MSF C;  4M9X A;  1U2W A;  2HU9 A;  3H9G A;  3MKL A;  4LFU A;  2WB1 N;  2VPR A;  5J8C A;  2R0Q C;  3S8P A;  1CF7 B;  1RZ4 A;  2IGK A;  4B48 A;  1IV6 A;  4PZJ A;  2OA4 A;  2D1H A;  3BDD A;  2IW5 A;  1YHQ I;  2ZSH B;  4OU0 A;  4B09 A;  4LJZ F;  2NVY J;  4BQN A;  2R7W A;  2W00 A;  1IN8 A;  3QPH A;  4KIG A;  4MTE A;  3LAJ A;  3CCL I;  3BQZ A;  2X48 A;  4HBL A;  1IRZ A;  4RGX A;  2BE5 F;  3E0J B;  1N78 A;  4EMS A;  1R9T J;  1YLF A;  4G7O F;  2IA1 A;  4EV0 A;  2Y2Z A;  1OPC A;  3S14 J;  3GTM J;  3FXR A;  3OYL A;  3RJP A;  1O7L A;  5LRS A;  3M1C A;  4L5I A;  4PJN A;  4CCL A;  1QHG A;  4IHY A;  1EH7 A;  1RC9 A;  2ZXH A;  1U5T C;  3HRT A;  4IOA F;  4XKV A;  3FMQ A;  3PNY A;  2V1U A;  2O03 A;  2NVQ J;  3ZQG A;  3FBI B;  4NQW B;  4EGY A;  3JRB A;  2GM4 A;  4AM3 A;  1BI2 A;  2H8W A;  1WI3 A;  3CDI A;  1W0T A;  4KIF A;  2FD5 A;  2BHZ A;  2EFN A;  5LFA A;  3S93 A;  3VFZ A;  1T0F A;  3E97 A;  3FHN A;  4I98 B;  3G71 I;  2YPR A;  1EV7 A;  2HPM A;  2EA2 A;  4HX4 A;  1LJ9 A;  3DTK A;  2LP0 A;  2NS8 A;  2QSG X;  1RET A;  4L9V A;  4EM2 A;  2AS5 F;  1ULY A;  2VQC A;  4BAY A;  3ZCO A;  1OYI A;  2IGM A;  2B0L A;  4A6E A;  2LKS A;  3F9K A;  5EG0 A;  2BBY A;  2M7B A;  3QPL A;  1UHW A;  5J47 A;  3B6C A;  4EGZ A;  2D1V A;  3K9T A;  4CIC A;  1SEU A;  1VQL I;  1ITY A;  1UAA A;  3OYK A;  1LKX A;  1DDN A;  2HTS A;  2P5K A;  5FKL A;  1M1E B;  4B3X A;  3PIO F;  1T33 A;  1BBY A;  2CW8 A;  1MMS A;  3FXJ A;  2HGC A;  4OOI A;  3S2W A;  4BQQ A;  3ZPL A;  1WJD A;  1OR7 C;  1ERD A;  2ZC2 A;  2A68 F;  4BQO A;  1FBS A;  2L01 A;  2W24 A;  2YSR A;  1TL8 A;  2E5N A;  2ELJ A;  3DPT A;  3DQV C;  4L9N A;  4XKB A;  3JRG A;  2F4M B;  3QU3 A;  3SDG A;  5GP9 A;  2JZY A;  4S04 A;  3IRR A;  4FAS D;  2HQN A;  2EV5 A;  3BR2 A;  1ETO A;  5F0C A;  2QEX I;  4E4H A;  1FT9 A;  2G7U A;  3JCU C;  2CMP A;  3BRO A;  3E7L A;  5FLM J;  1IN6 A;  5FB2 A;  5FKK A;  2BVL A;  3DTE A;  3LFU A;  3CQZ J;  1ZRC A;  2ZNZ A;  2FRH A;  1OCC H;  3L2W A;  2JN6 A;  1MBF A;  1V5G A;  2JPB A;  1FTZ A;  5LRR A;  4DYQ A;  4XN3 A;  3I53 A;  4XSX F;  1HA8 A;  4NC6 A;  3MKW B;  2H1L A;  2KKO A;  4B1R A;  2W57 A;  1QU3 A;  2MAB A;  1ZN2 A;  3EET A;  2PQ8 A;  1JT0 A;  2VON A;  2XGE A;  4R79 A;  1EH6 A;  1H0M A;  2XAU A;  3CUQ C;  3OIO A;  3OYE A;  2QBY B;  1ZAR A;  4A69 C;  2OQG A;  2A3S A;  3S1N J;  5LHH A;  3JR9 A;  4M6X A;  1F9N A;  1YRN B;  1YQA A;  2M45 A;  4NDL A;  1DP3 A;  2QKL B;  5E3L A;  2EIK H;  3NAU A;  2K27 A;  3MQ0 A;  5GAG J;  1GDT A;  2XKP A;  1OMI A;  1QPI A;  4A3L J;  5DCF A;  2BY0 A;  1SMY F;  2IGO A;  4I0B A;  1PDN C;  1NK3 P;  4CCK A;  3L9F A;  5LGN A;  2KHM A;  3F8N A;  2A05 A;  1IC8 A;  1VQ8 I;  3Q9S A;  1YX3 A;  2LSO A;  2IXS A;  1XN7 A;  2L9N A;  2HI3 A;  4BYY A;  1R1U A;  1SVO A;  2QKM B;  5D4R A;  2LC2 A;  2FBI A;  2R92 J;  3GYH X;  4OIN F;  4I02 A;  1ZKG A;  3TDU C;  4DZP A;  4U0Y A;  3JSO A;  4RM2 A;  4C3J J;  4N4O B;  4IXA A;  4XK4 A;  3JRI A;  5FLX K;  2LLK A;  4XLC A;  1JGS A;  3DTI A;  4KNY A;  1E3P A;  2DMT A;  2R5Z A;  2QEN A;  1GUU A;  1I50 J;  4XSZ F;  1X4P A;  2QLZ A;  2QQ9 A;  3HUG B;  4P96 A;  1U8B A;  3WU2 C;  1WZ2 A;  3G4S I;  2R5Y A;  5CVV A;  2VOO A;  4UV8 A;  1B59 A;  2MSY A;  3WGI A;  2RGV A;  3AKZ A;  2F4O B;  2XB5 A;  3L09 A;  1O3S A;  1ODD A;  3MEX A;  1RNL A;  1G3S A;  1JUM A;  3I4N J;  2PJP A;  1SAN A;  4KIT B;  2VAS A;  1TWA J;  1W4M A;  2LRE A;  2RRE A;  3B02 A;  2GWR A;  3M4O J;  5IOY A;  4M71 A;  3AL0 C;  1FBU A;  1R1T A;  3FMR A;  1JKP C;  5FLV A;  4Y17 A;  4U87 A;  3CCS I;  1AWC A;  5EEH A;  2X1C A;  3HB9 A;  1BA5 A;  1P9Q C;  2CG4 A;  4XMY A;  4CH7 A;  3L00 A;  1E0E A;  4F93 B;  2R7O A;  4J00 A;  2CO5 A;  5E1Z B;  5F04 A;  2OUM A;  3KP5 A;  3ZXS A;  4CCO A;  2R93 J;  3SEQ A;  4L18 B;  1P92 A;  4QLC U;  4KJZ A;  3H9Q A;  2GA2 A;  3GO5 A;  4G7Z F;  1FEX A;  4ZZD A;  2RKH A;  3KCC A;  5IT9 Z;  4BDZ A;  2LYC A;  1FOY A;  5HNF A;  1K7A A;  4FE4 A;  5EZG A;  1WH7 A;  3U1K A;  3Q5F A;  2WAE A;  5EGO B;  2BW3 A;  3ASN H;  3AFH A;  1RUO A;  4F7Z A;  2XVC A;  2VJI A;  2F5E A;  2NS0 A;  3FMS A;  2CSO A;  3GZN B;  1LUJ B;  2LMD A;  1PVE A;  4NB5 A;  3SFI A;  2XKO A;  1PUE E;  1QVU A;  4XR6 A;  3CO6 C;  3LAP A;  3K4M A;  3MZY A;  4WXD A;  3DEE A;  3E5U A;  4GXO A;  1K79 A;  4ESJ A;  4IHV A;  1MNE A;  4IHW A;  2L7K A;  3K7A J;  1TLH B;  4I2O A;  3MZH A;  4RLQ A;  4Y15 A;  3VOD A;  3QRF F;  1YX5 A;  3C2H A;  1ZR2 A;  2VL8 A;  3QYF A;  1T2K A;  3DU5 A;  5L3G A;  3S3O A;  4YFX F;  2ME0 A;  5JVG F;  2IA2 A;  1Z05 A;  1S5L C;  1JHF A;  5HVQ C;  1DQU A;  1JTY A;  1G8X A;  4YFK F;  3R0A A;  4PJ0 C;  4KMF A;  3S2D J;  2HFH A;  2V1N A;  1JXS A;  3HGY A;  2KIQ A;  3S1Q J;  2WC2 A;  1A6Q A;  1ZGA A;  1VQN I;  1OLT A;  4NC7 A;  1YJN I;  2EIL H;  3BR5 A;  3F8F A;  4EQQ A;  4YEL A;  1X3Z B;  3S16 J;  5H6Q A;  1XDS A;  3K0L A;  1X1A A;  2TDX A;  3ELK A;  4A0Z A;  3NWT A;  2P5L C;  4LMY A;  3RKY A;  4LG0 B;  4ESB A;  2H1K A;  4A3C J;  3RKW A;  3D5R C;  2PN6 A;  5HS9 A;  2WTE A;  1T98 A;  3KZI C;  3LFK A;  2JA8 J;  3C3W A;  2VQH A;  3HEF A;  5EEA A;  2KIF A;  1IN7 A;  4M3D A;  2X6X A;  5E1W A;  2E7W A;  2HKX A;  2BEO A;  4RMN A;  2DAO A;  4G6T B;  4H4K C;  2K9Q A;  1S7A A;  1ZG3 A;  1H89 C;  2P7C B;  2IP2 A;  3GZ5 A;  5CVU A;  3H92 A;  5LBQ A;  2DT5 A;  1W36 C;  2DQL A;  2Z5U A;  3PNT A;  4W97 A;  4BS9 A;  3AG4 H;  1BW5 A;  1UST A;  3LWF A;  4PJL A;  4CCM A;  2M1B A;  2Y69 H;  2WV1 A;  4A3K J;  3TO7 A;  1QA6 A;  1USS A;  3KEO A;  3JRA A;  3HKZ N;  1RR7 A;  2CRG A;  3K2A A;  9ANT A;  2PJR B;  2MYS A;  3PNV A;  3I58 A;  4LLG F;  1O4X A;  1FMW A;  1D8K A;  3BR6 A;  1SMT A;  3Q3S A;  1AA7 A;  3RQI A;  2Y0S N;  3HIF A;  5FRO A;  3DF8 A;  2CV0 A;  2OJE D;  2HEO A;  3ZMV A;  2RNJ A;  3HSF A;  4BKX A;  2KFD A;  4E7L A;  3L2U A;  3F8C A;  1HQC A;  2LD5 A;  2QF7 A;  5IP9 J;  4WWC A;  3ONQ A;  2ZBK A;  3S3M A;  4U0V A;  1R4M B;  4XLE A;  3WGG A;  5KHD A;  3C2B A;  1ZG5 A;  2M5W A;  1B8I B;  2V9V A;  1IXC A;  2F5V A;  4L5J A;  3TOB A;  4YIF A;  3GTJ J;  1TW2 A;  5E18 F;  4UHT A;  4EJT A;  3CP8 A;  1MZB A;  2L7F P;  2ME6 A;  1MJ9 A;  2KJC A;  1REP C;  4JK1 X;  1O3R A;  1FY7 A;  4WK8 F;  5M5X J;  5KAF C;  1TNS A;  3RTR A;  4IJA A;  5JHF A;  2VJ5 A;  2L9R A;  3ERE D;  3CD6 I;  4AUX A;  3PUB A;  3BTL A;  1TW3 A;  5F6F A;  4UVB A;  2VE8 A;  4A2U A;  4J01 A;  4A3G J;  5ED4 A;  1YOV B;  3OYF A;  4JX4 A;  3HBL A;  5L3E A;  1V3F A;  2DOD A;  2J5P A;  4XN0 A;  2VBY A;  4BGD A;  4IX7 A;  2HQ5 A;  1BL0 A;  2K9M A;  1IO2 A;  1H88 C;  2YX7 A;  5EDN A;  1VND A;  2JA2 A;  2ZME B;  2DI3 A;  2E7X A;  3L2C A;  2A61 A;  2EIM H;  4LGW A;  4A0X A;  3NQO A;  5GAE J;  1XGS A;  5D4S A;  1VQ4 I;  3AG1 H;  2FE3 A;  1QO0 D;  3HL2 A;  3FXK A;  3IKT A;  1BOA A;  2EH3 A;  1OR7 A;  3VYR B;  1U78 A;  3AG2 H;  3FWE A;  2HXI A;  1F1Z A;  1R00 A;  5E3N A;  1W0U A;  2Z2S B;  5K1Y A;  1Z0X A;  5C4J J;  3FIS A;  3QPT A;  1XGO A;  5KAI C;  3GFJ A;  4DIQ A;  2MD0 A;  1BIB A;  3LL7 A;  4RAG A;  4II2 A;  3CMM A;  1KU3 A;  4M73 A;  4HW0 A;  3U1D A;  4UXN A;  2KLO A;  4ZYG A;  1ZR4 A;  2K5C A;  3DWL E;  4ZDP A;  2V6E A;  1H9T A;  4IRH A;  1ZEL A;  2MH2 A;  2JUC A;  1W1W E;  4IL6 C;  4QWQ A;  3WTZ A;  2VOD A;  4B44 A;  1KGS A;  2WAD A;  2F4I A;  3RYP A;  4CZC A;  2LY1 A;  2NAZ A;  4RB2 C;  3GTG J;  1QRY A;  3IC7 A;  1GLN A;  1AKH B;  1TQM A;  3HOZ J;  3OMY A;  1ZTR A;  2LK2 A;  1X3U A;  3OYH A;  1TNT A;  2NXN B;  4UUS B;  1ZYR F;  2EZL A;  4DJA A;  3ZRG A;  1QZY A;  4CZZ A;  3BR1 A;  2K7L A;  4BQA A;  2E35 A;  1KQ9 A;  4AC0 A;  4RBO A;  5CVR A;  1MGT A;  3CUQ A;  4NC8 A;  1SFE A;  1Z7U A;  2Y30 A;  3K2Z A;  4RM3 A;  2VC1 A;  2BY1 A;  1OCO H;  1MMN A;  4CDG A;  1YJ9 I;  1RRJ A;  4YG2 F;  1ON2 A;  4AU7 A;  2GXG A;  2Q2E B;  3DEW A;  3KEY A;  4BBR J;  1K4S A;  2NOJ B;  1TBX A;  3WU1 B;  5LHG A;  1MBE A;  2Z3Y A;  4HSR A;  1LB2 A;  3F8B A;  2XRL A;  5ICG A;  4AD9 A;  4IRI A;  4E7H A;  4PUS A;  5J6X A;  3LOC A;  3H1C A;  1FYK A;  2FSW A;  1FIA A;  3RQ4 A;  5BOX A;  1HSJ A;  1MMA A;  1WKM A;  1BIA A;  1ETQ A;  1GVJ A;  3ABL H;  2EFW A;  5CVI A;  3WTU C;  1SFU A;  2K4B A;  2WAQ N;  3I59 B;  2DT6 A;  3TKY A;  4MLO A;  3F3X A;  3WOD F;  2V9K A;  2BVM A;  4EJU A;  1LNW A;  1ZRD A;  1WWX A;  1RKW A;  3FX3 A;  3G73 A;  1JE8 A;  4QPO A;  1P4X A;  4BXU A;  1K78 B;  3BG7 A;  4PFP A;  4N4N B;  2P5V A;  3RPU A;  1J7K A;  3Q9V A;  1DPR A;  1KQ8 A;  4HRI A;  2O7O A;  2CH0 A;  1MW7 A;  3WHB A;  1ZLJ A;  1JT6 A;  5CLS A;  4PCQ A;  1O3T A;  3SYT A;  4X6A J;  3BT9 A;  2JVH A;  1FSE A;  1IXS B;  2DK5 A;  3JRH A;  2L3D A;  1LQ1 A;  4BDY A;  3T0Y A;  2JK3 A;  4M74 A;  4ENN A;  4KFC A;  4RS8 A;  2LBF B;  3CUO A;  1SVM A;  2XSJ C;  3FM5 A;  3OIP A;  1X4O A;  2VIX A;  1RIO H;  2R7Z J;  2XGC A;  1DGR M;  1LDD A;  4RGS A;  4A3I J;  4E7J A;  1IV8 A;  2HXO A;  1Y39 A;  1ETX A;  4HNV A;  2DYR H;  3UNG C;  3I55 I;  1MNM C;  5ILU A;  2AQF A;  2EZI A;  3CES A;  1JJ8 C;  1YS6 A;  3O8H A;  2PLY A;  4MFD A;  3Q0W A;  3WE3 A;  1JUP A;  2KZG A;  3OYM A;  1VQK I;  2E1M C;  3J7A Y;  2PMU A;  2NVT J;  2CUF A;  2K9N A;  3CCV I;  4BNC A;  1IUY A;  4L9J A;  5B1B H;  3ZQ7 A;  1UG2 A;  5K7H A;  2P8T A;  1TQI A;  1QVT A;  2HS5 A;  3BTJ A;  3GEZ A;  3PFI A;  1HLV A;  1KU7 A;  4HNT A;  4XRM A;  2EFP A;  3OV8 A;  2IEK A;  4XBF A;  4IRG A;  2XAS A;  1XX5 A;  4YEJ A;  1TWF J;  1U9N A;  2ZO4 A;  1K4T A;  2FF4 A;  2FA5 A;  2X6W A;  4EM1 A;  4TV7 A;  2ZCW A;  3QQA A;  3BCA A;  4I0A A;  3OYN A;  2WV0 A;  1TQP A;  4I6Z A;  1HW1 A;  4WX9 A;  3IL2 A;  5TIS C;  3F23 A;  5E8G A;  2EZK A;  2WY7 Q;  3BLY A;  2CQN A;  2BXZ A;  1VQP I;  1Q1H A;  2AXT C;  2YR2 A;  1A04 A;  5B66 C;  1WJF A;  1QHH D;  3PQK A;  3KET A;  1NG6 A;  3IH4 A;  1DU0 A;  4RAZ A;  1UHM A;  5FD5 A;  1L3L A;  3HRS A;  4G12 A;  3LMM A;  2OC6 A;  3E6M A;  3LSH A;  2Q1Z B;  2E2I J;  1ZHF A;  4F55 A;  5BMZ A;  4YII A;  2Q8K A;  1Z6T A;  2ZME C;  5GPA A;  3ZMT A;  1TWC J;  1YI2 I;  3SDB A;  2YUS A;  2FML A;  1ENH A;  4PSW A;  4P9F A;  1KQ0 A;  3C7J A;  4CCJ A;  4DBR A;  3CO7 C;  1MBH A;  4S05 A;  1WJE A;  1WJA A;  3JAM Z;  3RCO A;  3DPL C;  3L2Q A;  2FMY A;  2EA4 A;  4CGZ A;  3UKG A;  3GFL A;  3DU6 A;  2BY2 A;  4D5F A;  2A6H F;  1F36 A;  3GX4 X;  1XG1 A;  4GDF A;  2OU2 A;  2LTP A;  5L3B A;  3CCU I;  4XIC A;  2RAE A;  1R49 A;  3P5J A;  4GCV A;  1OCP A;  3V7R A;  2K3F A;  3OYJ A;  2CGP A;  3H35 A;  4UVC A;  2R7F A;  2CFX A;  3BOQ A;  3K69 A;  2F5F A;  2TCT A;  3HOX J;  2CQQ A;  1SD7 A;  2VKD A;  2Z99 A;  1PUF A;  4Q5S F;  4JBA A;  4MFE A;  2EV6 A;  1OYY A;  2NNY A;  1YFH A;  1WCM J;  4F3Q A;  5ICC A;  4KDP A;  2JRM A;  3K6G A;  1A6I A;  5KNL A;  2HOA A;  1O7F A;  4WF2 A;  1UB9 A;  2JMW A;  2IJL A;  2VUM J;  5F27 A;  3A2K A;  1I3A A;  1U3E M;  4G8X A;  2E19 A;  2LY9 A;  3BPV A;  4BEH A;  3HHG A;  4GGG A;  2LOO A;  2H94 A;  2W48 A;  3KP7 A;  4V19 K;  2F6C A;  3HOV J;  4OMZ A;  3FK7 A;  1R4N B;  4M72 A;  3TL4 X;  4PDK A;  4LIV A;  2CYY A;  2EK5 A;  2PMZ A;  4BE0 A;  1YRN A;  1A36 A;  1I1S A;  2AQE A;  1Y8Q B;  2IA0 A;  1K61 A;  4ZC3 A;  3CDL A;  1SC7 A;  1T08 B;  3TGN A;  2JRT A;  3GFM A;  4A3B J;  1LFP A;  4BHB A;  2M34 A;  2KJB A;  2F5D A;  2QGU A;  3DBH B;  4C2M J;  1G4D A;  3G1M A;  2X6Y A;  2FOW A;  3FHZ A;  2E1O A;  2ACJ A;  1OFC X;  3WTS C;  1JHH A;  1V55 H;  2RQP A;  5FKN A;  3S1R J;  4P1W A;  4MTD A;  2K4J A;  2BGC A;  3H5A A;  3T8T A;  2JA6 J;  3PO2 J;  2Y48 A;  3TO9 A;  2XGD A;  1X1C A;  1GXP A;  4RLF A;  3K4B A;  4I99 C;  1BR4 A;  1HDD C;  1I1G A;  3J7A O;  4N0B A;  1SAU A;  2L9V A;  3A0H C;  3I5U A;  4LB6 B;  1XMK A;  1YYV A;  2DOE A;  4Y13 A;  2Y75 A;  1U0J A;  1W5T A;  1MJA A;  4XON A;  2HZT A;  3MZ8 A;  1FP2 A;  2GA1 A;  1MH3 A;  5HS8 A;  3BTI A;  2EIJ H;  1OKR A;  2Z16 A;  3LQQ A;  1FMV A;  2DK8 A;  2FOK A;  1K6O A;  1W7P D;  1NH3 A;  5EG0 B;  1TZL A;  4EVI A;  1Z6R A;  2DPD A;  1EH8 A;  3ZMU A;  2R4G A;  1KZH A;  3TP3 A;  4HZF A;  1J9I A;  3K1P A;  4GYI A;  1ZH5 A;  1X3W B;  4V2F A;  4XRS A;  4ZTF A;  1GT0 C;  3J7Y J;  2LDU A;  2G0E A;  5EZH A;  3ZQC A;  2EQR A;  3V8J A;  2L7Z A;  3HYI A;  4LIU A;  5M5W J;  3S1M J;  1TWG J;  4M9Z A;  2VI6 A;  2OAZ A;  2PFB A;  3TW6 A;  1WH5 A;  4MQ9 F;  2ZJQ F;  1XGN A;  3RYR A;  4IQJ A;  2VE9 A;  1NTC A;  2XUB A;  1J2X A;  3T1B A;  4A6D A;  3WTY C;  3HOS A;  5ICE A;  3GLX A;  4L0Z B;  1G59 A;  3IKV A;  2DMP A;  3F6O A;  1HBX G;  1JKR C;  1D3Y A;  1YW9 A;  4DBQ A;  2R7T A;  2ZKZ A;  3I0T A;  4IEJ A;  5HDK A;  5C3E J;  5IT9 K;  5IPA A;  4K2E A;  3OYG A;  1SD4 A;  1T38 A;  3BCB A;  4O6J A;  5IP7 J;  2ICW G;  1ZAO A;  4JX6 A;  5D5X B;  2O6G E;  1P4A A;  2V79 A;  4IKF A;  4HST A;  4I76 A;  1MND A;  5HDN A;  4IOC F;  2IS1 A;  4O5V A;  3FXO A;  2CQK A;  3QYB A;  4EJV A;  3EYY A;  4J19 A;  5HDG A;  2FBH A;  4XKC A;  3VEP A;  4AVP A;  1SFO J;  2HOS A;  1UFM A;  2Y9Y A;  4A3J J;  3H5N A;  2X4H A;  2A5Y B;  2LG4 A;  2CS3 A;  1WJ5 A;  3IAS 2;  2OV7 A;  3O3K A;  3H3U A;  3LST A;  5F0F A;  1BJZ A;  1UJ8 A;  1T56 A;  3R6S A;  5LEK A;  3CJR B;  4CYD A;  2CJJ A;  2RQQ A;  2GOM A;  2QYO A;  4KN7 X;  5J1Y A;  2ZSI B;  3WGH A;  2VBZ A;  3AG3 H;  3GFI A;  3LSK A;  3CMY A;  2OTL I;  1WJB A;  2I8D A;  4XLH A;  5JVT A;  2XHK A;  1FZP B;  5DEQ A;  4XNF A;  5C4X J;  5BQT A;  1I3Q J;  5EEG A;  4NNJ A;  4KT5 C;  2W7N A;  1XGM A;  1GHC A;  1YIT I;  3HC7 A;  1D1C A;  2HWV A;  1KON A;  2MLK A;  4V2G A;  3A4C A;  4QSH A;  1WGX A;  2FJ1 A;  3M8E A;  2P0W A;  1X2M A;  3TQN A;  5FD6 A;  1I27 A;  1MDM A;  1OQY A;  2X6O A;  1ACI A;  5GPC A;  2K40 A;  1UHS A;  1Y6I A;  1WPK A;  2QQB A;  4DZJ A;  2EPF A;  5FKM A;  2DPU A;  1EF4 A;  3LA2 A;  5L3F A;  1W5S A;  1BM9 A;  2COB A;  2EFO A;  2CQX A;  1JKO C;  2JA5 J;  3W6J B;  2V4J C;  3RSN A;  2BYV E;  3SXY A;  2R5Y B;  2FUG 2;  4F52 A;  2VKH A;  2XRN A;  4CHU A;  2FQ4 A;  1QZE A;  2EJR A;  2L4M A;  2LR8 A;  2A07 F;  3SJM A;  1XC5 A;  1MIJ A;  4ZH4 F;  5J4Y A;  2P7V B;  2OQR A;  3M7G A;  4UY8 I;  1OCZ H;  5GTH C;  4NBQ A;  4L9T A;  2YS9 A;  3BR3 A;  4OIO F;  1S29 A;  1D5V A;  1FSH A;  5AIP A;  1R1V A;  4ITV A;  3L2R A;  3CME I;  5J1R A;  5M5Y J;  5A2Q Z;  1C0W A;  3OL4 A;  5DD4 A;  4AID A;  4BJ5 C;  1A5J A;  5DYM A;  2Y0S A;  4LD5 A;  5D5V B;  2DYS H;  2K9S A;  3C1D A;  5DDG A;  3SFZ A;  4C9Y A;  3P9C A;  3G1O A;  2PI0 A;  1XPX A;  3MAJ A;  5DTD A;  2STT A;  3QP6 A;  1LVA A;  2ISY A;  4XOT A;  3O2P E;  2NRA C;  3EUA A;  5ILV A;  4A5M A;  3CC2 I;  3CTA A;  3FXU A;  1RUN A;  4XLF A;  3OR2 C;  3RIR A;  2ZB9 A;  2ZJ2 A;  1F43 A;  2XSD C;  5CQG A;  3JRC A;  3HTS B;  4BHP A;  1S8N A;  3GWZ A;  1B6A A;  2ZXJ A;  3JTH A;  4OAZ A;  1G3T A;  1S72 I;  4XRS G;  3CLQ A;  1SAX A;  3VWB A;  3RI4 A;  3SZG A;  2QSF X;  4MHG A;  3LNQ A;  3VYS B;  2BW3 B;  1IJW C;  3HOU J;  1P4W A;  4Y3O A;  2R7X A;  3HRM A;  3HZJ A;  4H0E A;  2MBF A;  3E5X A;  3H5R A;  2FBK A;  2GIZ A;  2JSC A;  1EJ9 A;  3M3Y J;  3ZQQ A;  4UV9 A;  2M87 A;  5D6E A;  3QOE A;  4MEY F;  3FF5 A;  1POG A;  4XKW A;  4JYK A;  2RNG A;  5ERI A;  2E2J J;  3PSF A;  4BHC A;  5K5R A;  2O9L A;  1Z7L A;  2IBD A;  2R3S A;  2RC4 A;  2JSP A;  1IDZ A;  1BW6 A;  2XAJ A;  1R23 A;  5D8K B;  2ELK A;  1Y0N A;  5C44 J;  1DU6 A;  2GLO A;  3LSI A;  4BXX J;  1P6R A;  5E20 A;  4KT6 A;  4BXF A;  5HS7 A;  1U5T A;  4ENK A;  1B72 B;  3IV5 A;  2W84 A;  4Y33 A;  3CF5 F;  1W7P B;  3WG9 A;  1V5E A;  2WBM A;  4AIK A;  4FX4 A;  3M07 A;  3W2V A;  1UZC A;  4HA8 A;  3FZV A;  2K9L A;  4PGG A;  2WY8 Q;  3VDX A;  5IYD J;  3ASO H;  3BJA A;  1RES A;  2ZXW H;  2EV0 A;  1R5H A;  4II3 A;  2QWW A;  3P7N A;  1IDY A;  3K70 C;  1XD7 A;  1N77 A;  3RZO J;  4ZDO A;  1HW2 A;  5CYV A;  4AWX B;  1VZ0 A;  1ZGW A;  4A12 A;  3ESW B;  1ONV A;  2XAH A;  1AKH A;  1R36 A;  2DFE A;  4JP0 A;  2OD5 A;  4A3E J;  2L0K A;  1LE8 A;  4BJ6 C;  4U7B A;  4HEA 2;  1ON1 A;  4M6Y A;  4AYB N;  1EA3 A;  3BPX A;  3RKQ A;  4I01 A;  1Z1D A;  1LPQ A;  1FPQ A;  4IVN A;  3PFY A;  3GTL J;  2RDP A;  2CW7 A;  3FKJ A;  5B3S H;  1CGP A;  1FWZ A;  3FM3 A;  1XMX A;  2X85 A;  3IWZ A;  2R7R A;  4ASN A;  3I64 A;  3IAM 2;  5K7Z A;  2HVR A;  4WXH A;  1Q1V A;  5DM6 F;  3E6D A;  4O3M A;  3ZN1 A;  4ZYA A;  3KFW X;  5K5Q A;  3CCR I;  3GTQ J;  5IOZ A;  5JLW A;  3IH3 A;  5DCM A;  1ETW A;  5KK1 A;  5EF6 A;  3F6V A;  4FE7 A;  4P55 A;  4CCN A;  5HNH A;  3WTW C;  1SVL A;  1VQM I;  1TC3 C;  2L54 A;  1BI3 A;  2FNP A;  4OWR B;  4P9U A;  2XPU A;  3V8L A;  2QQ8 A;  1FX7 A;  3K4L A;  4G94 A;  2W1O A;  3CCY A;  3TMO A;  4ETS A;  3L1P A;  2E2H J;  1LVK A;  2XRO A;  4IF4 A;  5BPI A;  3BG5 A;  3N97 A;  1JUS A;  2X1D A;  4ON0 A;  2UUZ A;  4ZJZ A;  5LLQ A;  2CV1 A;  1AHD P;  4IHS A;  1D5Y A;  1IW7 F;  4CXF A;  3V8K A;  3LSJ A;  2JPC A;  2P6T A;  2O61 A;  2C6Y A;  1LEA A;  2LNB A;  2IVM A;  2AO9 A;  3SZP A;  2ESH A;  4QTR A;  3ML6 A;  3H3V K;  5D8L B;  4CSW A;  2X9D A;  5D5U B;  3W6K B;  3VPR A;  4DW6 A;  1R6R A;  1UMQ A;  3SQN A;  1BOB A;  3LQR A;  1G3W A;  4BBS J;  3I3L A;  1YIJ I;  3VSL A;  3KZZ A;  2MLG A;  3PM1 A;  3E6B A;  4C30 A;  1BI0 A;  4C3H J;  2XDV A;  2DOA A;  4XLP F;  3HHH A;  4HF1 A;  3KYD B;  3S2H J;  2YU3 A;  4HV5 A;  1MKM A;  3T5X A;  3QAH A;  1HKQ A;  4B4C A;  3RDI A;  1E3H A;  2KIS A;  2VKE A;  1F4K A;  1B9M A;  1WQ2 A;  1MSE C;  2QCO A;  2BXY A;  3S15 J;  2O5R A;  2VKV A;  3BY6 A;  2LF7 A;  2B63 J;  3V7C A;  4E70 A;  5GAD J;  1IAW A;  3G3Z A;  3LSP A;  1ZLK A;  3ABT A;  4B8X A;  1IRF A;  2VPL A;  3R4K A;  1K83 J;  1FNN A;  1UCR A;  1R7J A;  3I9V 2;  4G6D A;  1D0X A;  2GBY A;  2KL4 A;  2ZJP F;  4JOM A;  3HOW J;  4MIM A;  3BZK A;  1U6G A;  3KP4 A;  3QPS A;  4LB5 A;  1YS7 A;  1QPM A;  2M2E A;  3PJR A;  3ULQ B;  4E7S A;  1J09 A;  4AIH A;  1P7J A;  3OL3 A;  4C3I J;  1BJA A;  3KP6 A;  4BH9 A;  1X1B A;  1S7O A;  1Z3X A;  3V7S A;  2W25 A;  1JI8 A;  4Y4R A;  3HOT A;  4UNO A;  1Z3Y A;  1CF7 A;  4FIS A;  4DYC A;  1NG7 A;  2ESN A;  2M0M A;  3KE2 A;  2DA4 A;  1HXD A;  1SFK A;  2DT7 B;  1OYW A;  3K4C A;  3U21 A;  2QA4 I;  5ILS A;  4C2T A;  1PP7 U;  2WB1 A;  1B9N A;  4RA2 A;  1ZG1 A;  2HNH A;  3C18 A;  3KP2 A;  3L7W A;  5IT3 A;  1XDU A;  2VXD A;  2DJN A;  4ENM A;  2UXX A;  1ZQ3 P;  3CUQ B;  5IYB J;  4PK4 A;  1BC7 C;  2ELH A;  1I39 A;  1SD6 A;  3J7Z I;  1JJ6 C;  3K70 D;  3FK6 A;  1T95 A;  3E6C C;  4MGR A;  4AIJ A;  1FBQ A;  2A69 F;  3HTU A;  1MBK A;  2FXA A;  4XRF A;  3ECO A;  5HLI A;  2LVS A;  5FGM A;  2GIV A;  1LEB A;  3MKY B;  3KLN A;  1G3Y A;  5FFZ A;  2NVX J;  5GTI C;  1YIO A;  3QOP A;  2DA3 A;  4M3E A;  3H36 A;  2LKX A;  4OIP F;  3VB2 A;  4NQW A;  3MCZ A;  2DTR A;  1VFC A;  2KZV A;  2WWY A;  2ID3 A;  3FDY A;  3JAM K;  3A03 A;  3ISP A;  1XB4 A;  2Z33 A;  1A31 A;  2VBW A;  2DA2 A;  1Z77 A;  2HPI A;  2HR3 A;  3HPG A;  1GVD A;  3CCM I;  1YJW I;  4E7K A;  2HQR A;  3E1S A;  4CYC B;  2VBX A;  2HVS A;  4WXC A;  2IPQ X;  2O3F A;  3E3V A;  2E36 A;  4EJW A;  4G7H F;  1JKQ C;  1N75 A;  3CJT B;  3TP0 A;  4EM0 B;  4A3D J;  4R8H A;  5CPR B;  3ZQL A;  3A01 B;  3I56 I;  3OS0 A;  2JVG A;  4BAC A;  2KT0 A;  4HAM A;  3EUK L;  2QUF A;  3U2R A;  3OYC A;  2OCC H;  4PSX A;  3DLA A;  4Z6Y A;  1HKT A;  2R7U A;  3L2V A;  5HOO A;  1NK2 P;  5EYR A;  3CDH A;  3KYL A;  1L0O C;  1BR1 A;  3DKX A;  2LKP A;  2QQA A;  5LGU A;  3GTP J;  1GXQ A;  2NVU B;  3FXM A;  3BTC A;  5FJ8 J;  3GZ6 A;  2V1D A;  1XMA A;  1XSX A;  3BWG A;  1HW5 A;  1UEL B;  2DW4 A;  1KYW A;  5E17 F;  1FLI A;  2QSH X;  5JFR A;  3QP5 A;  3BZ6 A;  4N9I A;  3AL0 B;  2R7V A;  1BN5 A;  3D0S A;  1ETV A;  3ZR8 X;  2IT0 A;  1AU7 A;  5HOD A;  2XAF A;  1OIS A;  4BY7 J;  2P81 A;  2HVQ A;  3VYU B;  1Z91 A;  4P5O A;  4U7D A;  3TBI A;  4EJO A;  6PAX A;  5ICF A;  4KUM A;  2PEX A;  4B47 A;  3ZQI A;  3CMA I;  4RDU A;  3OS2 A;  2K85 A;  2GXB A;  3ZQH A;  3ZGK A;  3R61 A;  5TRD A;  5CJ9 A;  1X58 A;  4HF0 A;  1D0Y A;  2DQR A;  3MKZ A;  1IN5 A;  1ZRF A;  2L5Q A;  5TGT A;  3HM5 A;  1WRJ A;  1WVR A;  1TT0 A;  3ZMZ A;  5CVJ A;  4HF2 A;  2M4K A;  2ZJR F;  2R7D A;  1I6X A;  2DJI A;  3EUH C;  1QBJ A;  2QBY A;  1XSV A;  2X0L A;  4WCG A;  3COA C;  2EZH A;  1IF1 A;  4XL9 A;  3VSK A;  4XLA A;  4KIB A;  2M4G A;  2CV2 A;  2W85 A;  3OWT A;  2FEZ A;  2BV6 A;  4W1U A;  1IGN A;  4BU2 A;  1Z9C A;  2XF5 A;  1D1A A;  2O0Y A;  1HOM A;  2R7Q A;  3MD2 A;  4FQG A;  2IS4 A;  1Z21 A;  2M0C A;  3VOE A;  1A35 A;  3B73 A;  3F0C A;  3CC4 I;  4HPQ A;  1RR8 C;  5LEJ A;  2DFI A;  2VT3 A;  5FKO A;  4UUT A;  2EWN A;  1VQO I;  4EEF G;  1HCR A;  2KP6 A;  1APL C;  2JUG A;  5K5O A;  2VT2 A;  3D1N I;  5J40 A;  4D1Q A;  2NS7 A;  3JTG A;  2XC7 A;  2H27 A;  1S6L A;  4HYE A;  1WHU A;  2VXZ A;  4UB6 C;  2VN2 A;  1KU9 A;  1J59 A;  5L3D A;  4D7N A;  1ZRE A;  3K1M A;  3FXL A;  3HG9 A;  5BNG A;  3TO6 A;  3X2Q H;  3GUD A;  1X1D A;  2HTJ A;  2Q0O A;  1J75 A;  3IUO A;  1RI7 A;  2ID6 A;  4MEX F;  5CKT A;  2HOT A;  1DUX C;  3HPH A;  1OCR H;  3EYI A;  3GTO J;  2AHQ A;  3A02 A;  1YG2 A;  3M1E A;  1EKE A;  2L02 A;  3HUG A;  4DGW B;  1PUF B;  2ISZ A;  3RZD J;  4XID A;  3JSP A;  2D5V A;  4KIC A;  3BR0 A;  2KIU A;  1WFX A;  1Y0U A;  2KPM A;  1IZ1 A;  1S9H A;  2W82 A;  3NRV A;  3H3Z A;  2OPT A;  2XB0 X;  1ORK A;  4E7I A;  2OTJ I;  3BP8 A;  5FRM A;  3ZMS A;  3OYA A;  1LFB A;  1XCB A;  2CUE A;  4ZDL A;  3C2G A;  3V42 A;  4BEH B;  1G2H A;  4PFO A;  2EB7 A;  3PL8 A;  5KCM A;  4QPQ A;  4BJT A;  1XTA A;  4HX7 A;  4IO9 F;  5B1A H;  2PMZ N;  1LFU P;  1V54 H;  5D6F A;  5D5W B;  5E8I A;  2VQL A;  4JX5 A;  4Y7N J;  2MW8 A;  3DLL F;  3FXQ A;  2PMH A;  4ZYH A;  2NOG A;  2CU7 A;  4HOB A;  4BUP A;  3CF2 A;  2BY3 A;  5LHI A;  4LOC A;  4XOR A;  3H0D A;  5IP6 A;  1HC8 A;  3HDD A;  1GV2 A;  1PP8 F;  5FRN A;  3DKW A;  4HNU A;  3BJ6 A;  4E7Z A;  4Z2Y A;  2KMU A;  3ZN0 A;  3MVP A;  2LH9 A;  1O3Q A;  2AXL A;  2CQ7 A;  2BOL A;  2DTZ A;  3G1L A;  5KVR A;  3W3C A;  2DLL A;  2M3A A;  2VJJ A;  2WA0 A;  3I4P A;  1X1P A;  1ETK A;  1HF0 A;  3HXL A;  5E1X A;  4HV6 A;  5EGO A;  1N25 A;  3ZP5 A;  2E1C A;  3EDP A;  3R0J A;  3ABU A;  1SD5 A;  1YW7 A;  2FNA A;  3NWS A;  5DUI A;  1HKS A;  2COM A;  3N4M A;  2XV4 S;  2GAU A;  2DA7 A;  1X2N A;  1IRX A;  1IRG A;  2K3P A;  3KX2 A;  4KN4 X;  3ZQF A;  2QZ8 A;  2DFH A;  1NHA A;  4ZTJ A;  3K4K A;  3HGG A;  3HSR A;  3BQY A;  3QU6 A;  1VQ9 I;  1DPU A;  4R1H A;  3W6V A;  1WJC A;  2M8E A;  3PO3 J;  1FYL A;  2MH9 A;  1HDP A;  4A3F J;  4HQE A;  2LFB A;  2UXN A;  3PIP F;  3OIQ A;  3OSF A;  5DD8 A;  1TT5 B;  2DOF A;  2ADU A;  3G2B A;  4RAF A;  1MMD A;  2RVC A;  1G6N A;  2F48 A;  3F21 A;  4AVZ A;  3HSE A;  1T39 A;  3CJQ B;  5J3L A;  2DO7 A;  2HDW A;  1YE9 A;  3WE2 A;  3KLO A;  5F0H A;  4OIQ F;  5JLX A;  3DV8 A;  1Y1W J;  2HDC A;  5A2Q K;  4BE2 A;  1STZ A;  1I6H J;  2HQA A;  2KRC A;  5FLX Z;  3S17 J;  3WTV C;  3LSM A;  3SZT A;  3F22 A;  1E3O C;  4LG0 A;  3V4G A;  4UUV A;  5H6R A;  1PJR A;  3OYI A;  2DN0 A;  1D0Z A;  2VB6 A;  4IHX A;  4HX8 A;  4M6V A;  1JTX A;  2XPV A;  3CLO A;  4HG2 A;  1R5I D;  5AON A;  5F1R A;  1DGW Y;  2R5Z B;  3GF2 A;  4PJM A;  4EAT A;  3LSG A;  4KYW A;  4A3M J;  5FO5 A;  3F72 A;  4I09 A;  5JR3 A;  2HYJ A;  4LK1 F;  2HZD A;  4CUG A;  3DBR B;  2ZXI A;  4HDU A;  3MFK A;  3E5Q A;  4FCY A;  1VQ5 I;  2DFF A;  3BG3 A;  2UWM A;  2ZNY A;  3CP2 A;  3K10 A;  3TOA A;  2MGQ A;  4NUB A;  5HLG A;  4HDV A;  2Z1D A;  3ERM A;  2PJR A;  4FX0 A;  3H9J A;  2A6E F;  1OJL A;  3DFG A;  3HKZ A;  3I71 A;  3QWL A;  4D9J A;  1ETY A;  1S3J A;  4GYG A;  2H09 A;  5E3O A;  4U88 A;  4ZZL A;  1QQI A;  1SFX A;  3JW4 A;  2X51 A;  2DBB A;  3J80 K;  4CO8 A;  2FQ3 A;  2OBP A;  4FHT A;  4C2U A;  2KIM A;  3A1Y A;  1R5G A;  3BC8 A;  3SEZ A;  1B72 A;  4PJJ A;  2N8G A;  1W7P A;  2B7E A;  1B8I A;  3LA3 A;  2YX4 A;  3TW7 A;  1MJB A;  2DMQ A;  3K1N A;  1UG0 A;  4B43 A;  4D5C A;  3DBL B;  1MD0 A;  4M3G A;  1ZK8 A;  3ZOB A;  5DV5 A;  3BG6 A;  1BC8 C;  2PX9 A;  3OYD A;  2B9S A;  1LDK B;  3BG9 A;  2L7M P;  2XF7 A;  1FIP A;  1T0F C;  2XAQ A;  4DNC A;  3TED A;  3HRU A;  3JRE A;  3MWM A;  3P9I A;  3DP7 A;  1W5C C;  4FET A;  5H2F C;  3DCF A;  1H8A C;  5BS6 A;  5L3C A;  3D5L A;  1MDM B;  3QYE A;  3GME A;  2YU9 J;  1FTT A;  2BHY A;  4GRI A;  4ENJ A;  3DEU A;  2DA6 A;  2DDA A;  2XGX A;  2Y31 A;  2Z9O A;  4L5E A;  2MG4 A;  3P9K A;  4FTH A;  3SHF A;  1J5Y A;  2ZME A;  2DMN A;  4A93 J;  3J80 Z;  3GBG A;  2IGN A;  2K86 A;  2O8K A;  4M3F A;  3UR3 C;  2D2W A;  1LDJ A;  1XS9 A;  4RB0 A;  3KP3 A;  1D1B A;  3OY9 A;  2MD5 A;  2CWE A;  1WSU A;  3U9G A;  4AYB A;  1WI9 A;  2XAG A;  1FYM A;  5B5E C;  1U8R A;  1QGP A;  1Y56 A;  3CC7 I;  2XPW A;  1R71 A;  4ABZ A;  2MFZ A;  4G6Q A;  2M30 A;  4M3B A;  3RPU D;  1DP7 P;  3IH2 A;  4QIW N;  2EFQ A;  1FOW A;  1BI1 A;  1FP1 D;  4OMY A;  3CCQ I;  2E1N A;  4A0Y A;  1Z67 A;  1KU2 A;  2H8R A;  2MC4 A;  3BJO A;  2E1M B;  2OF7 A;  5J4V A;  2DA5 A;  4F92 B;  1FC3 A;  2JJ7 A;  2RV8 A;  4RGU A;  5E3M A;  1U9O A;  2GZW A;  3AAF A;  3GVA A;  1P2F A;  2H6B A;  2VC0 A;  3KYC B;  4LLN A; 
#chains in the Genus database with same CATH homology
 3HB9 A;  1P7J A;  3JRF A;  4C3I J;  5F1J A;  1BA5 A;  2W48 A;  3HOV J;  4FIS A;  4DYC A;  3FK7 A;  5F04 A;  2DA4 A;  1RKT A;  2R93 J;  1YRN A;  4Y52 J;  4UUS A;  2KDZ A;  1K61 A;  1FEX A;  3CDL A;  2DJN A;  1ZQ3 P;  4S0H B;  5IYB J;  4A3B J;  2M34 A;  1IG7 A;  4FE4 A;  4MO7 A;  1WH7 A;  2DA1 A;  5EZG A;  1JJ6 C;  3FK6 A;  4C2M J;  2M9H A;  3G1M A;  5EGO B;  2E1O A;  1OFC X;  1MBK A;  5DS9 A;  2LVS A;  5FKN A;  4D7M A;  3SFI A;  3S1R J;  2NVX J;  1QVU A;  4BY1 J;  1MBG A;  2DA3 A;  4M3E A;  2JA6 J;  2LKX A;  3PO2 J;  2XGD A;  1VFC A;  4IHV A;  2ECC A;  2ID3 A;  3FIW A;  4IHW A;  3A03 A;  3K7A J;  1HDD C;  1Y1V J;  2DA2 A;  1Z77 A;  1ZR2 A;  1GVD A;  4B3A A;  4CYC B;  2ME0 A;  1MH3 A;  3BTI A;  1JKQ C;  1S7E A;  3TP0 A;  4A3D J;  1JTY A;  3S2D J;  3ZQL A;  3A01 B;  5EG0 B;  3HGY A;  5F08 A;  3S1Q J;  3TP3 A;  2KT0 A;  3MN2 A;  3OOU A;  3BR5 A;  3Q0U A;  4V2F A;  4XRS A;  1GT0 C;  1NK2 P;  5EYR A;  2G0E A;  5EZH A;  3ZQC A;  3S16 J;  2EQR A;  3FKI J;  2L7Z A;  5M5W J;  3S1M J;  3GTK J;  1VI0 A;  3GTP J;  2DMU A;  1TWG J;  2VI6 A;  5J1U A;  2H1K A;  4A3C J;  3BTC A;  5FJ8 J;  2JA8 J;  3TW6 A;  1LE8 B;  1WH5 A;  3HEF A;  5EEA A;  4M3D A;  1IUF A;  1ETV A;  1NTC A;  3JRD A;  1P7I A;  1AU7 A;  5HOD A;  4BY7 J;  2K9Q A;  2P81 A;  1H89 C;  3Q0V A;  2DMP A;  4W97 A;  1JKR C;  1BW5 A;  1MBJ A;  4A3K J;  2WV1 A;  3WHC A;  4IEJ A;  3ZQI A;  3B6A A;  5C3E J;  4RDU A;  1VF9 A;  5IPA A;  3JRA A;  3HKZ N;  1RR7 A;  3O8G A;  3ZQH A;  2CRG A;  3K2A A;  9ANT A;  1FJL A;  1O4X A;  5K7F A;  1X58 A;  5IP7 J;  3Q3S A;  3BR6 A;  4JX6 A;  3RQI A;  2Y0S N;  2FX0 A;  4I76 A;  3HM5 A;  1MH4 A;  4J19 A;  4BKX A;  3LSR A;  2LD5 A;  1TWH J;  2HOS A;  1SFO J;  2M8G X;  2Y9Y A;  1JGG A;  4A3J J;  2QF7 A;  5IP9 J;  4X1E A;  4CYC A;  4DYR A;  2EZH A;  1CQT A;  3C2B A;  1OCT C;  1B8I B;  3GTJ J;  5F0F A;  1BJZ A;  4W1U A;  1T56 A;  1IGN A;  1HOM A;  2ME6 A;  2CJJ A;  2L7F P;  3A01 A;  2ECB A;  3OSG A;  2M0C A;  5J1Y A;  5M5X J;  3F0C A;  3CMY A;  2L9R A;  3NAR A;  4AUX A;  5FKO A;  3BTL A;  5M3M J;  4UUT A;  5C4X J;  4EEF G;  1HCR A;  1APL C;  1I3Q J;  3HOY J;  1RPW A;  3D1N I;  4A3G J;  2NS7 A;  4JX4 A;  3HBL A;  4QSH A;  4V2G A;  1WGX A;  2HQ5 A;  2FJ1 A;  2JWT A;  5IYC J;  1X2M A;  1BL0 A;  2EBI A;  1H88 C;  4D7N A;  2Y9Z A;  2X6O A;  5GPC A;  2K40 A;  5EDN A;  1UHS A;  1VND A;  5BNG A;  2JA7 J;  1GV5 A;  1WPK A;  4DZJ A;  2TRT A;  5FKM A;  1EF4 A;  5M3F J;  2COB A;  2ID6 A;  1JKO C;  2CQX A;  2HOT A;  2JA5 J;  2I10 A;  2R5Y B;  2EH3 A;  1U78 A;  2AHQ A;  3GTO J;  3A02 A;  2HXI A;  1PUF B;  2IAI A;  3RZD J;  3I4M J;  4XID A;  5E3N A;  2FQ4 A;  5C4J J;  3H0G J;  1Z0X A;  1W0U A;  3FIS A;  2D5V A;  2LR8 A;  3BR0 A;  3SJM A;  1XC5 A;  4GFB A;  2OPT A;  2XB0 X;  1ZR4 A;  1ORK A;  2YS9 A;  3BR3 A;  2HDD A;  1LFB A;  5J1R A;  5M5Y J;  2CUE A;  1G2H A;  1A5J A;  1MSF C;  2K9S A;  3MKL A;  2PMZ N;  1LFU P;  2WB1 N;  2VPR A;  2R0Q C;  3GTG J;  1QRY A;  3G1O A;  1IV6 A;  4JX5 A;  5DTD A;  4Y7N J;  1AKH B;  2MW8 A;  3HOZ J;  2NOG A;  2CU7 A;  1ZTR A;  2LK2 A;  2NVY J;  4UUS B;  4LOC A;  2ZB9 A;  2EZL A;  1F43 A;  2XSD C;  3JRC A;  5IP6 A;  3BR1 A;  3HDD A;  3BQZ A;  1GV2 A;  2X48 A;  1IRZ A;  4AC0 A;  4RBO A;  1R9T J;  3MVP A;  4XRS G;  2Y2Z A;  3S14 J;  2DTZ A;  2Y30 A;  3GTM J;  3G1L A;  3LNQ A;  1IJW C;  3HOU J;  1ETK A;  1HF0 A;  4IHY A;  5EGO A;  3DEW A;  4BBR J;  2NVQ J;  3M3Y J;  3ZQG A;  1MBE A;  3JRB A;  2GM4 A;  2XRL A;  1WI3 A;  2DA7 A;  1W0T A;  1X2N A;  2FD5 A;  1POG A;  3LOC A;  4JYK A;  1FIA A;  3ZQF A;  2E2J J;  2O9L A;  1ETQ A;  2IBD A;  2WAQ N;  3HGG A;  4MLO A;  1IDZ A;  1BW6 A;  3BQY A;  2ELK A;  5C44 J;  3W6V A;  1DU6 A;  2GLO A;  1RKW A;  3PO3 J;  4BXX J;  4A3F J;  1HDP A;  2LP0 A;  2NS8 A;  1RET A;  2LFB A;  1B72 B;  3IV5 A;  3OSF A;  2O7O A;  3WHB A;  5EG0 A;  1JT6 A;  3QPL A;  3B6C A;  4X6A J;  5J3L A;  3BT9 A;  1ITY A;  3JRH A;  5IYD J;  5FKL A;  5F0H A;  2JK3 A;  1T33 A;  1RES A;  5JLX A;  1IDY A;  1Y1W J;  3RZO J;  1I6H J;  3S17 J;  1ZGW A;  2R7Z J;  2XGC A;  1E3O C;  1AKH A;  4JP0 A;  4A3E J;  3JRG A;  4A3I J;  2DN0 A;  2L0K A;  3SDG A;  4IHX A;  1LE8 A;  2HXO A;  5GP9 A;  1ETX A;  4M6V A;  1JTX A;  2XPV A;  4HNV A;  1MNM C;  4AYB N;  2EZI A;  2R5Z B;  3BR2 A;  1JJ8 C;  1ETO A;  5F0C A;  3RKQ A;  3GTL J;  3O8H A;  3LSG A;  4MFD A;  4A3M J;  3Q0W A;  1JUP A;  2HYJ A;  2NVT J;  3E7L A;  5FLM J;  2CUF A;  5FKK A;  2K9N A;  5K7Z A;  3CQZ J;  4FCY A;  1Q1V A;  1UG2 A;  2JN6 A;  3BG3 A;  1MBF A;  5K7H A;  1FTZ A;  2MGQ A;  4DYQ A;  3BTJ A;  1QVT A;  5IOZ A;  1HLV A;  3GTQ J;  5JLW A;  3IH3 A;  4XRM A;  1ETW A;  4B1R A;  2IEK A;  1OJL A;  1TWF J;  1U9N A;  5EF6 A;  4FE7 A;  1ETY A;  3QQA A;  1JT0 A;  5E3O A;  2XGE A;  4I6Z A;  1TC3 C;  2XPU A;  2EZK A;  3OIO A;  3CCY A;  3L1P A;  2E2H J;  4A69 C;  3BG5 A;  1JUS A;  3IH4 A;  1DU0 A;  3S1N J;  3JR9 A;  1B72 A;  2N8G A;  1B8I A;  1AHD P;  1YRN B;  4G12 A;  1D5Y A;  3TW7 A;  4NDL A;  2DMQ A;  4D5C A;  5E3L A;  3LSJ A;  3NAU A;  4M3G A;  1GDT A;  2E2I J;  4A3L J;  1QPI A;  1ZK8 A;  5GPA A;  3ZOB A;  1TWC J;  2AO9 A;  4QTR A;  1NK3 P;  3H3V K;  3BG9 A;  2X9D A;  2YUS A;  2L7M P;  3VPR A;  1ENH A;  4DW6 A;  1UMQ A;  1FIP A;  1IC8 A;  3TED A;  4BBS J;  3JRE A;  2HI3 A;  3PM1 A;  4C3H J;  2R92 J;  3DCF A;  1MBH A;  1H8A C;  4DZP A;  1ZKG A;  3S2H J;  4C3J J;  1FTT A;  2YU9 J;  4XK4 A;  3JRI A;  2DA6 A;  3UKG A;  4B4C A;  2LLK A;  2Y31 A;  4D5F A;  4L5E A;  2MG4 A;  1F36 A;  2VKE A;  1XG1 A;  4FTH A;  2DMT A;  2R5Z A;  2DMN A;  1GUU A;  1I50 J;  2LTP A;  4A93 J;  1MSE C;  3GBG A;  2QCO A;  2O8K A;  4M3F A;  4XIC A;  2RAE A;  3S15 J;  1XS9 A;  2VKV A;  1OCP A;  2B63 J;  1U8B A;  2R5Y A;  2TCT A;  3HOX J;  2CQQ A;  3LSP A;  1PUF A;  2MSY A;  2XPW A;  2XB5 A;  1K83 J;  4MFE A;  4ABZ A;  3I4N J;  1JUM A;  4M3B A;  2GBY A;  1WCM J;  3IH2 A;  1SAN A;  4QIW N;  1TWA J;  3HOW J;  1A6I A;  4MIM A;  3M4O J;  2HOA A;  5IOY A;  3QPS A;  1JKP C;  2H8R A;  2OF7 A;  2JMW A;  5FLV A;  2DA5 A;  2JJ7 A;  5F27 A;  2VUM J;  2E19 A;  1U9O A;  2LY9 A;  2M2E A;  5E3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...