1Q1VA

Structure of the oncoprotein dek: a putative dna-binding domain related to the winged helix motif
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
70
structure length
70
Chain Sequence
DEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKELISLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DEK protein
publication title Solution NMR structure of the C-terminal domain of the human protein DEK
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 18
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2003-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08766 DEK_C DEK C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1q1vA00
5EZHA 1HCRA 5C44J 2DN0A 2XPWA 2NVQJ 4XRSA 4HNVA 2M9HA 4M3FA 4FISA 1IG7A 4MFDA 3HDDA 3IH4A 1BA5A 1U9OA 3BTIA 2R7ZJ 3QQAA 3RZDJ 2K40A 5M5XJ 2K9QA 3IV5A 2HOAA 4FE4A 2HI3A 3ZQLA 2IBDA 2TCTA 2FX0A 4X6AJ 1ZR2A 3VPRA 1SANA 4J19A 1U8BA 3OSGA 3FKIJ 2LKXA 4A3JJ 1MBJA 5M5YJ 1JKOC 4MO7A 5EDNA 3GTPJ 3M4OJ 2FJ1A 2LTPA 2Y9YA 3LSGA 5FJ8J 2COBA 3GTKJ 1MNMC 2DA1A 1RETA 1OCTC 4A3DJ 3A03A 4NDLA 3ZOBA 2HYJA 3A01B 2XB5A 2JWTA 2Y31A 2MSYA 5GPCA 3HB9A 1A6IA 1G2HA 3S15J 1IGNA 1HDPA 3MN2A 2L7MP 5FKNA 2DTZA 1FEXA 2DA2A 3TP0A 2DMUA 1QPIA 1TWCJ 3LOCA 1P7IA 1LE8A 3FK6A 2I10A 5EG0B 2VI6A 1TWFJ 5F04A 2Y30A 4D5FA 4DZPA 3JRIA 5HODA 3BTJA 5FKMA 5IPAA 1BJZA 5FKLA 1YRNA 5EYRA 3G1OA 3HOUJ 2HXOA 2VKVA 1ETQA 2R5YA 1E3OC 3HGYA 4A3FJ 2MG4A 3BR3A 2E2IJ 5JLWA 3L1PA 3O8HA 1VF9A 1RPWA 2JA8J 3BG9A 4BY7J 1AKHA 2DA7A 4QIWN 1PUFB 1ZKGA 2HXIA 3NARA 4JX6A 4XRMA 1H8AC 2VUMJ 4Y52J 3JRCA 3S1MJ 1WGXA 5FKKA 1A5JA 2EZLA 4FCYA 4MFEA 1OFCX 4A69C 1DU0A 2CU7A 2H1KA 2B63J 2LP0A 2H8RA 4DYCA 3LNQA 3FISA 3BQZA 2ID6A 4M3BA 4I76A 1NTCA 2DMPA 5IP7J 4A3MJ 2NVYJ 5J1UA 1Z77A 1BL0A 3HOZJ 2NVTJ 1ITYA 2Y0SN 2JK3A 4JX5A 2Y9ZA 1F36A 1QRYA 3RZOJ 4FTHA 5M3FJ 3IH2A 4M3GA 1JUMA 2DMQA 1W0UA 5IP9J 3S16J 3LSPA 5IOZA 3OIOA 3QPSA 4IHWA 2VPRA 4ABZA 1JT6A 5E3LA 3TP3A 5EF6A 2GLOA 2XGDA 1GT0C 2HQ5A 3K7AJ 5C4JJ 1NK2P 3HOVJ 2ID3A 5F0HA 5K7HA 1MSFC 2Y2ZA 2M8GX 1ENHA 5IYDJ 1B8IB 1FTZA 5E3MA 3HEFA 1MBGA 1IDZA 4RDUA 2E2JJ 2MGQA 4RBOA 2R93J 3LSJA 5IP6A 3F0CA 1FJLA 2JJ7A 1VFCA 2YS9A 2P81A 2L0KA 2R5YB 2AO9A 4S0HB 4BY1J 2CQQA 3BR2A 4A3CJ 4IHXA 3JRGA 2JA6J 1AKHB 1IDYA 2XGEA 2WV1A 2X6OA 3NAUA 3GTJJ 3S17J 3BG5A 4DYRA 1I50J 1JUSA 1ZTRA 3JRBA 1RESA 2DA5A 3CQZJ 3GTQJ 1OJLA 4IEJA 4CYCA 1MBHA 2JMWA 1HF0A 2X9DA 4A93J 1BW5A 1GV5A 2LVSA 2LLKA 1JJ6C 4W1UA 3WHCA 1HLVA 2DA6A 5F1JA 1RKWA 2EZKA 1ORKA 2R5ZA 2ME6A 5J1YA 1EF4A 4DW6A 2VKEA 4UUSA 2NS7A 1TC3C 1AU7A 1D5YA 3A02A 3ZQGA 2M34A 1K61A 3I4MJ 1S7EA 4AYBN 1CQTA 2JA5J 3ZQCA 1BW6A 1RKTA 3GBGA 2DA3A 2HOTA 1JJ8C 1WCMJ 4EEFG 5EGOB 4V2GA 5F08A 2OF7A 1GDTA 4A3LJ 3JRHA 2LK2A 2XGCA 1QVUA 4MIMA 1HOMA 4B4CA 2NOGA 3I4NJ 3B6AA 4JYKA 1ZK8A 3G1MA 1IJWC 1JUPA 3PO3J 2L7ZA 2L9RA 9ANTA 1Y1WJ 4I6ZA 2DMNA 1JKRC 5C4XJ 3H3VK 1JTYA 3S1NJ 1ETVA 4A3EJ 1WH7A 2EBIA 4MLOA 3JREA 4QTRA 3TEDA 4C2MJ 3OOUA 5K7ZA 2GBYA 4C3HJ 5IYCJ 4XICA 1JT0A 1B72A 3S1QJ 2R92J 2CRGA 3ZQIA 4DZJA 2XPUA 1F43A 2W48A 3BR1A 2RAEA 4BXXJ 3A01A 1ETWA 4W97A 4B3AA 2PMZN 4A3GJ 1DU6A 3Q0WA 5E3OA 3GTGJ 2LFBA 3SJMA 5FLVA 2QCOA 1AHDP 1MSEC 4GFBA 3Q0UA 1ZQ3P 1IRZA 3HKZN 2QF7A 1U9NA 4D7NA 2XB0X 3BR5A 1WI3A 5F0FA 3JRDA 1TWGJ 3JRAA 5BNGA 1JTXA 2O8KA 1T33A 3Q0VA 4A3BJ 1Y1VJ 2XRLA 4BBRJ 1H89C 2E1OA 3S14J 1POGA 5DS9A 5E3NA 5EG0A 1LE8B 1FIAA 1X2MA 1HDDC 2KDZA 1ZR4A 3C2BA 4M3EA 1MH4A 4UUTA 1UHSA 3S2DJ 2E19A 3O8GA 3RKQA 3FK7A 2NS8A 3W6VA 1MBFA 1X58A 2LR8A 3HOYJ 3Q3SA 1UG2A 2JN6A 2IEKA 3CMYA 1FTTA 1YRNB 1JKQC 4JP0A 3MVPA 4A3KJ 3UKGA 2HDDA 3PO2J 5DTDA 4M6VA 3PM1A 2LD5A 3ZQHA 1FIPA 2WAQN 1PUFA 3DEWA 4V2FA 3LSRA 1Q1VA 1H88C 3GTMJ 4D7MA 1Z0XA 4AUXA 3FIWA 2O7OA 2GM4A 3D1NI 2O9LA 1WPKA 4C3IJ 3MKLA 1MH3A 1IC8A 5FLMJ 3ZQFA 1R9TJ 2M0CA 3CCYA 2DJNA 3SDGA 5F0CA 2CQXA 5GP9A 3JRFA 1UMQA 2ECCA 4C3JJ 1B72B 5K7FA 1WH5A 1K83J 2ECBA 2ELKA 3WHBA 4XRSG 2OPTA 5C3EJ 2YUSA 3TW7A 2M2EA 2ZB9A 3E7LA 1TWHJ 1P7JA 2LY9A 2MW8A 2KT0A 4X1EA 2CJJA 1I6HJ 4A3IJ 2HOSA 2K9NA 2E2HJ 2D5VA 3HBLA 2YU9J 2IAIA 5F27A 3TW6A 4FE7A 1ETXA 3SFIA 3RQIA 3HM5A 3DCFA 3HOXJ 2FQ4A 2R0QC 1O4XA 3BR0A 1VI0A 2CUEA 2N8GA 1ZGWA 1GV2A 2FD5A 2X48A 3BR6A 4B1RA 2ME0A 1W0TA 1IV6A 1B8IA 1MBKA 2EZIA 4QSHA 4AC0A 4BBSJ 3OSFA 2EZHA 1XC5A 1T56A 2EQRA 5M3MJ 5EEAA 2CUFA 2DA4A 1VNDA 2EH3A 2DMTA 2L7FP 1XS9A 4BKXA 1TWAJ 1IUFA 3CDLA 1MBEA 4L5EA 3BQYA 4IHVA 3G1LA 3H0GJ 1SFOJ 2NVXJ 1ETYA 5J1RA 3BT9A 3HOWJ 1LFBA 1GVDA 3S2HJ 1JKPC 3JR9A 1JGGA 2XSDC 3S1RJ 3B6CA 4G12A 3BTCA 4M3DA 3GTLJ 1NK3P 1X2NA 5M5WJ 1RR7A 4CYCB 4Y7NJ 3HGGA 3K2AA 2XPVA 5IYBJ 5IOYA 2TRTA 1I3QJ 3BTLA 3IH3A 1ETKA 5FKOA 4D5CA 4XIDA 4XK4A 5JLXA 3BG3A 1ETOA 5J3LA 1U78A 5GPAA 4LOCA 2R5ZB 2G0EA 2JA7J 4UUSB 2AHQA 3GTOJ 5EZGA 1OCPA 1APLC 4DYQA 1GUUA 4IHYA 1QVTA 1LFUP 1XG1A 5EGOA 3QPLA 4JX4A 3M3YJ 2WB1N 2K9SA
chains in the Genus database with same CATH superfamily
4E7JA 2QLZA 2EA4A 4BH9A 4JBAA 3L09A 2BY2A 3NWSA 1S7AA 4MFDA 4DBRA 3JAMZ 1YQAA 2C6YA 1XSVA 4AD9A 3LSHA 5FD5A 4N4NB 1BA5A 5FD6A 3BTIA 2IT0A 2WAEA 4OWRB 3QQAA 3RZDJ 2K9QA 2HTSA 3IV5A 2HOAA 4KYWA 4GYIA 2TCTA 1H9GA 3SFZA 3PFIA 1SANA 2OAZA 4XONA 4J19A 1PUEE 3OSGA 4HOBA 1A04A 5J4VA 1FNNA 1R1UA 4EJVA 3PQJA 2QZ8A 4MO7A 4ZDLA 4E4HA 5EDNA 3F21A 3GTPJ 2Y9YA 1QZZA 4BQOA 3E0JB 2DA1A 3H1CA 1SVMA 2P0WA 1V5FA 3OY9A 2Y0MA 2ZJRF 2XB5A 5HDGA 4P5OA 2MSYA 5GPCA 2HR3A 1A6IA 2PX9A 1QGPA 2X0LA 1G2HA 4UHTA 1YITI 1HDPA 3MN2A 2DTZA 1KZHA 4CSWA 4AU7A 1SD5A 3H35A 4XKWA 4RMNA 2MC3A 1P7IA 2V6CA 3G4SI 2O0YA 3FK6A 3CO7C 3AL0C 3F3XA 4B48A 4WK8F 2I10A 4ZDPA 4G6QA 1WHUA 2P8TA 1R5HA 2KIFA 5K1YA 1EV7A 3E5QA 5F04A 2QYOA 1G3WA 2VN2A 4HRIA 3FWEA 1Y39A 2R4GA 1OKRA 2E1MC 1W7PD 3LAPA 5FKLA 1M1EB 4BDZA 3ZPLA 3PFYA 3CC4I 4GO1A 5FFXA 4HBLA 2VKVA 4HW0A 3HGYA 1USSA 2GA1A 3BDDA 5JLWA 4H0EA 3O8HA 4LK0F 3BG9A 1IN6A 3DEUA 2OV7A 3PNVA 3H0DA 2ZSHB 1WJDA 2RV8A 4ESFA 5HLTA 2L01A 1ZKGA 1T08B 4OOIA 5LEKA 4JX6A 4DQ2A 4IX7A 4Y52J 5E1WA 3S1MJ 1KQ9A 5FKKA 4WCGA 3J7AY 2OUMA 1W4MA 3HJEA 1OFCX 3W6KB 3L2UA 2H1KA 4DNCA 2JSCA 2LF8A 3HC7A 3EQLF 3PIOF 3B73A 3LNQA 2DMPA 4A3MJ 4YIRX 1Z67A 5J1UA 2LNBA 3BZCA 4J00A 3HOZJ 2VONA 2ZC2A 3A0HC 2JK3A 3ERMA 3J7AO 3BG6A 3MCZA 3E6CC 1F36A 4XLEA 2PG4A 3LSTA 1IRGA 3IH2A 4P55A 5IP9J 4XLNF 1N78A 5IOZA 3OIOA 2EK5A 2P7VB 2RNGA 1MMAA 4ESBA 4L9JA 3OIQA 5E3LA 3DEEA 5TGTA 2XVCA 4HDUA 1GT0C 3OWTA 3K7AJ 3WTSC 1FBUA 5CVVA 5C4JJ 2O5RA 2BZTA 1YYVA 2OA4A 1Y56A 5F0HA 3DBRB 4RB2C 2P6SA 5K7HA 2H09A 3TO6A 3FXRA 1ENHA 2HDCA 4RM3A 3TDZC 3F6OA 2CGPA 1IDZA 4ZYEA 4CXFA 3LSJA 3J80Z 2E1NA 3BPXA 3F0CA 3QU3A 4U0YA 4G7OF 1FLIA 2YS9A 2R5YB 5E8IA 2AO9A 4F93B 4AM3A 2QUFA 1WJAA 4YIFA 4PUSA 1YX3A 1X1BA 2W1OA 5JHFA 4U0WA 1ACIA 4ENNA 5D8KB 4Y13A 2BBYA 4RGXA 1TL8A 2EWNA 1QZYA 3U21A 3FBIB 1ONVA 5FLXK 1ZTRA 3IAM2 1LDDA 3CLOA 2KIUA 2YR2A 1OJLA 1HF0A 3C2HA 3GTQJ 4A93J 2DAOA 2W00A 5J6XA 2LLKA 3ASOH 3SEZA 1LJ9A 4W1UA 4XMYA 4XORA 1PP8F 3WHCA 2V1XA 5DV5A 2DA6A 3TL4X 3S3NA 1RKWA 4UB6C 3V8KA 3DV8A 3J81K 2ME6A 4L0YB 2RGVA 2BYVE 4DW6A 4XRFA 1J59A 3KP4A 4CO8A 3W2WA 4HDVA 4KN4X 1AU7A 5J47A 3A02A 3ZQGA 1WJFA 2Q1ZB 3EUAA 1K61A 1KQ0A 3ZQCA 4CZCA 1RKTA 1MJAA 2DOEA 1GLNA 3KE2A 3W2AA 3CCQI 2EV5A 1FSHA 5EGOB 4L5JA 4BS9A 2OF7A 3CO6C 2MFZA 4E7HA 4BHPA 1HOMA 3TBIA 1ZHFA 1K6YA 4B4CA 3Q5FA 3K0LA 1LFPA 2BVMA 2V1NA 2UXXA 3HOTA 2XAJA 4R8HA 3S93A 3VFZA 1ZK8A 3LFUA 1OCCH 1TLHB 4XLPF 1FMWA 1JUPA 1YLFA 2IGMA 1HW1A 2JUGA 4YIIA 3LAJA 3AKZA 3CUQC 9ANTA 3IWZA 1C0WA 5HLGA 4BQAA 5DUIA 2CSOA 3OV8A 2AS5F 1H0MA 2XF7A 4CUGA 3OYBA 4UVCA 2VJ5A 3FBNB 5F64A 4AIKA 1YW8A 2XSJC 2OCEA 4C2MJ 1U5TB 2IA2A 2M5WA 3DPLC 5DCMA 3OS1A 3T1BA 4LLNA 4IOAF 2DI3A 3HIFA 1K78A 2CRGA 3ZQIA 2E5NA 4MNUA 4P1WA 4CICA 2RAEA 3F72A 2P5LC 3Q9VA 2PMUA 4FETA 4B3AA 1UELB 2KIMA 1K7AA 3HRSA 2K02A 1S5LC 1DU6A 2KPMA 3GTGJ 2PN6A 2LFBA 1UAAA 2O3FA 2QCOA 4AIJA 4OIQF 1Z21A 2ZKZA 1ZQ3P 2LY1A 3H9GA 1U9NA 4D7NA 5D4RA 2XB0X 2JVGA 5LD2C 3JRDA 1TWGJ 2LKPA 2EJRA 1JTXA 2O8XA 4IHSA 2DT5A 3JSPA 3CCSI 2ELHA 3KP5A 2HS5A 3CP8A 3I4PA 4BBRJ 1H89C 3I55I 1Z05A 1R1VA 2DBBA 3ECOA 4EGYA 3AG4H 3A2KA 1S8NA 2VKDA 1UHSA 2Q0OA 5FLXZ 2J5PA 4L9NA 1XCBA 2NS8A 2WY8Q 3O6BB 4KNYA 4LG0B 2MD0A 1P2FA 3Q3SA 1QU3A 2AXTC 3H5RA 4AYBA 1WSUA 1R4MB 3CMYA 3PSIA 1YRNB 1KGSA 1ZARA 1P4XA 3DKXA 2HDDA 2VL8A 1G59A 3PM1A 2O6GE 2LD5A 2NNNA 5IT9K 1VQ4I 1Y8RB 1PJRA 2ESHA 2X1EA 3VYTB 4G94A 3LSRA 5B1AH 2R7VA 1TTYA 3MEXA 4M73A 2QWWA 2XAFA 1Z6RA 1MH3A 4PJJA 5F6FA 1WI9A 3HZJA 5FLMJ 2K9MA 1ON1A 2ZJ2A 3S32A 3ZQFA 4IO9F 1MNEA 1R9TJ 2HKOA 4F3QA 4C2UA 3CJTB 1E3HA 3L2CA 5DUKA 2ECCA 4Q48A 1B72B 1K83J 1NG6A 2FOWA 3R61A 5D8LB 2YUSA 1PP7U 4Q4ZF 1ULYA 4ENKA 1TWHJ 2Z3YA 2LY9A 4N0BA 1YJNI 3DKYA 2UUZA 2CJJA 4A3IJ 2HOSA 4PJMA 2K9NA 3N97A 5GADJ 2D5VA 1S29A 1QQIA 3HBLA 5HVQC 3ERED 2VLAA 4PSXA 3TW6A 4FE7A 5IY5H 3HKZA 3SFIA 3T8TA 3DCFA 3WG9A 2DFEA 1BI1A 5K5RA 4U88A 5AONA 4IHTA 1YG2A 4L9TA 4QLCU 1O4XA 2Z33A 1R49A 4XLCA 5CVUA 4IL6C 2XF5A 1MGTA 2EPFA 1OYWA 3E6DA 4A0ZA 2X48A 1EA3A 2CFOA 3F8MA 3VYUB 1QA6A 2LKSA 4XKBA 1W0TA 2FOKA 4MEXF 1GHCA 3KEYA 1MBKA 2EZIA 1J9IA 1SFEA 2EZHA 4XN3A 3ROUA 5M3MJ 2DA4A 1AA7A 2VKHA 4FX0A 2QQBA 1VNDA 3BROA 2DMTA 3DU6A 1R4NB 3RPUD 2JVHA 1B9NA 2WB1A 4I0BA 3VDXA 1STZA 3RKXA 3GUDA 3CDLA 4DBQA 2A61A 3IP4B 2W25A 3OL4A 4BHCA 3CF5F 2LY2A 2M4KA 2KDOA 3ZXSA 2CV1A 2WAQA 2QA4I 3BT9A 3HOWJ 1R7JA 5JVTA 3QOPA 2DQRA 2V6EA 2FNPA 2OQGA 1B4AA 4C2TA 2BW3A 1PVEA 1TQIA 3CCLI 1CF7A 2TDXA 4KIBA 4RGUA 3E3VA 2M3AA 2DCEA 4Y7NJ 2HZTA 3D5RC 3K2AA 4RB1A 3WU1B 2W84A 2P5VA 4BE1A 1XDUA 2GAUA 4XL9A 2STWA 4D5CA 3MKZA 2OTLI 3CLQA 4O5VA 1UJ8A 2XHKA 3COAC 4L18B 4AIHA 2DK8A 5HDKA 3CJQB 5EZGA 2K4BA 3K4BA 4Q47A 5DM6F 2QKLB 2Z16A 4TV7A 2HVSA 2DDAA 3CCVI 2K9SA 1FPQA 3HOSA 5EZHA 2CO5A 2CS3A 3D5SC 2JPBA 2PMHA 4IVNA 4XKCA 5LLQA 2DTRA 2IJLA 2A07F 3P9KA 3IWFA 4F55A 3HUGB 4XRSA 4II3A 4HNVA 1Y0NA 4M3FA 1FMVA 3NQOA 4HZFA 2BEOA 5H20A 3OYJA 3L2QA 2ZJQF 3WTWC 3HDDA 3IUOA 2JQ7A 2K40A 1T6SA 1W5SA 5HS7A 4YRVA 1F1ZA 5KNLA 2HI3A 1ZH5A 3F8FA 4X6AJ 1ZR2A 2ZXWH 4NQWB 4BEHA 4IOCF 1WJ5A 3M07A 1X3WB 3FKIJ 1LEAA 3ECHA 1D5VA 3DQVC 1MBJA 1DGRM 4YEJA 4ZH4F 4C30A 1JKOC 1U0JA 3F23A 2FJ1A 1XGSA 2COBA 4M9SA 4RB0A 3GTKJ 1MNMC 2QQ8A 2Q2EA 2KJBA 3SYTA 3RPQA 2IA0A 4A3DJ 2L9SA 3A03A 1XPXA 1KQ8A 4IF4A 1GXQA 2HYJA 1T0FA 3A01B 2CQNA 2XAHA 3VSLA 4A6EA 5ICCA 3HB9A 1W36D 4OMYA 2MBFA 4E7SA 2BE5F 2CW7A 3QU6A 4OIOF 3ZMVA 1X1PA 2WADA 4HF2A 1D0ZA 1KU7A 1H9TA 4HLYA 1ZRDA 3TP0A 1JGSA 2DMUA 1TWCJ 2ZFUA 1WJBA 1LE8A 4FT8A 1E0EA 5EG0B 3RYPA 2FMLA 3EYYA 1TWFJ 3M7GA 4D5FA 1SD7A 2YSRA 1OCZH 3HL2A 2M8EA 2NYXA 1K6OA 4UV8A 3BTJA 5FKMA 2JRTA 5IPAA 3FM5A 3K4KA 5HLHA 2ICWG 1V3FA 4G6DA 3OYIA 3DP7A 4QWQA 2PJRB 2HXOA 3K4NA 1E3OC 2UV1A 4D1QA 2DU9A 1EH8A 2KJCA 3DBLB 3BR3A 2PEXA 3NRVA 3ZMTA 3A1YA 4I02A 3IKTA 3L1PA 1J7KA 1HKSA 1VF9A 1RPWA 1YI2I 4NC7A 2JA8J 3ABMH 4NUBA 1G8XA 1ZREA 4YFKF 1AOYA 1DP3A 1AKHA 5GTHC 2DA7A 5D5UB 1FBQA 2ZSIB 5J8FA 2ZCWA 1YFHA 3CMAI 4QIWN 1U8RA 1PUFB 2YX7A 1WRJA 3NARA 4E7KA 3H9QA 3JRCA 3LSIA 2ZXHA 2KP6A 2LF7A 5JVGF 1BC8C 2VOPA 2E1CA 4PSWA 5GAGJ 2D2WA 4N9HA 4HX7A 4JOMA 2B63J 1NHAA 2LP0A 1QNTA 1V5EA 2ZMEA 2H8RA 4RA2A 1P4AA 1JI8A 4ZYGA 4UV9A 3FISA 3P5JA 3BQZA 3ZRGA 2PFBA 4I76A 2ZMEC 2M87A 1FBSA 4BU2A 4PGGA 1MDMA 1P92A 1YW9A 3DFGA 1ITYA 5TISC 4LB5A 2QQ9A 4JX5A 3RPUA 2QENA 2JPCA 1XSXA 5M3FJ 1ZG5A 1XN7A 3PJRA 4IXAA 4BAYA 1JUMA 1W0UA 1HSJA 1J09A 2K5CA 2W85A 4LJZF 4L0ZB 2XV4S 3QPSA 1LDKB 2UZKA 1ODDA 4ABZA 4XOPA 5E18F 3DLLF 5JR3A 3PUBA 1I6XA 3WE3A 2HQ5A 4RM2A 4Y3OA 3MAJA 2ID3A 2G7UA 2L3DA 3BG7A 2V4JC 3FF5A 1ON2A 1MSFC 4CHUA 5KAIC 3M1EA 1L0OC 5HNHA 1NG7A 4CCMA 2M8GX 2BGCA 2BY1A 4UXNA 5IYDJ 1B8IB 2GWRA 3HEFA 5E3MA 4IKFA 1GVJA 2E2JJ 4RBOA 3H9JA 4RLQA 5IP6A 1A31A 2RDPA 1FJLA 5HLIA 2VXDA 1DQUA 3KP6A 4BJTA 1X1CA 3W2VA 2JTVA 1W5CC 2LG4A 2ESNA 5LRRA 2V1DA 1XD7A 3BR2A 3EUHC 3BZKA 5GAHJ 2XGEA 3WTUC 5DD8A 3HTSB 1S7OA 2IA1A 4KMFA 1DDNA 3S17J 4DYRA 1QZEA 5KK1A 1I50J 1SFKA 2KIQA 2G9WA 1RESA 2DA5A 2RQQA 1T2KA 4IJAA 3I59B 4A12A 2MH2A 1X1DA 4IEJA 4CYCA 1MBHA 2JMWA 2ELJA 3P7NA 1BW5A 1GV5A 2IVMA 4WX9A 1KYWA 2CMPA 1KYZA 2E71A 1D1CA 3PL8A 4XM3A 2Z5UA 1HLVA 1HQCA 2VJJA 2KRFA 4ZJZA 2QBYB 3H36A 2EZKA 4MTEA 4A5MA 3GFIA 3KP2A 1IW7F 2A6EF 2NS7A 1TC3C 4XQFA 1USTA 5JI6A 2IPQX 4PJ0C 3I4MJ 2RKHA 4AYBN 1CQTA 5CVJA 2YX4A 3GBGA 1MMNA 2DA3A 1WCMJ 4LMYA 4V2GA 1GDTA 3PIPF 3OIPA 3JRHA 4ZTFA 2HFHA 1RUOA 2LC2A 5JFRA 1BI0A 4JYKA 4LIUA 3SEQA 1W36C 2Y69H 3U1KA 2L9RA 2IS2A 1Y1WJ 1JKRC 2F5EA 2F5FA 1YJ9I 1T38A 2A6TA 3H3VK 2JSPA 2V26A 1V55H 3LQQA 2EBIA 4FQGA 3QRFF 4MLOA 4OAYA 2YU3A 3JREA 4ENMA 2V1UA 3AG2H 2A05A 2F5CA 4B43A 3QPHA 3VEPA 4BJ6C 2GBYA 4XICA 5H6RA 2RN7A 4NBQA 4PJNA 3CCUI 4M6XA 2XROA 1IRFA 1Y0UA 4DZJA 2XIGA 1MMSA 1LDJA 2M45A 2F4IA 3VB2A 4BXXJ 2CV0A 2IGNA 3Q0WA 3SJMA 3TOAA 1XSDA 1ZN2A 4AIDA 1HC8A 5E20A 2W24A 4NHJA 3Q0UA 1XB4A 2VBZA 1IRZA 3DU5A 3HKZN 2QF7A 4U87A 3BR5A 1WI3A 2H6CA 3KPHA 5F0FA 1KU9A 1ZLKA 3JRAA 2F48A 4X0GA 1ZGJA 2O8KA 2CYYA 4HSRA 4PGHA 4V19K 4A3BJ 1Y1VJ 1J2XA 1POGA 5ED4A 3OYDA 5E1XA 4ZYDA 5DDGA 1O3QA 1J75A 5ICFA 3HRUA 4OIRF 4RAGA 1YIJI 3SZPA 3C2BA 3TMOA 4M3EA 3DTIA 3S2DJ 2E19A 3O8GA 3RKQA 4RS8A 5J8CA 2DXIA 4UVBA 1E3PA 3I5UA 4EJOA 5ILVA 1RNLA 4HLXA 3FXJA 1D1AA 3H5NA 4BL0B 4GGGA 5L3GA 3HHHA 4JP0A 3MVPA 3QWLA 4MQVA 4AVZA 5HDNA 1A36A 3UKGA 3M9AA 4M6VA 1TP4A 1WZ2A 1FIPA 2CWEA 2WAQN 5ICGA 3DEWA 4A0XA 1NH3A 3KETA 4MGRA 4KN7X 4GDFA 2L7KA 1Z0XA 4AUXA 1BR4A 3FIWA 2E60A 3FHNA 1XGMA 3MKLA 4G6TB 4YFNF 4GRIA 3L2WA 1IC8A 1X19A 3T0YA 2V79A 3WGHA 3QODA 4ZC3A 2Z99A 4AWXB 3M1CA 2DJNA 5LBQA 1DPUA 2CQXA 3ZMUA 4WWCA 1I1GA 3QYFA 1KA8A 5CQEA 3KLOA 3LSMA 4WXCA 5GAEJ 1IAWA 1WWXA 3GYHX 3HSRA 3E6MA 4E7ZA 1K78B 2FBIA 1W7PB 2K4JA 2FMYA 1Y8QB 2CFXA 1REPC 2KT0A 4X1EA 1JXSA 1K79A 5FFZA 3RI4A 1I6HJ 1X1AA 3SZGA 1E2XA 2PBIA 3U2RA 3DKWA 4E70A 1SEUA 2E34A 2IAIA 2QVOA 2HYFA 3JW4A 2VT3A 3RQIA 2GXBA 2KMUA 1CGPA 3HOXJ 5CVIA 3G71I 2R0QC 4ENJA 4R1HA 3KP3A 3MZHA 4XSXF 2R7FA 5E17F 2CUEA 1HBXG 1XTAA 3LL7A 2A68F 2AXLA 3CUQA 1W5TA 1GV2A 2FD5A 3BR6A 4BNCA 5LFAA 3HG9A 1UHWA 2EILH 3OSFA 3JCUC 1IZ1A 2FEZA 4I2OA 1T56A 3HYIA 5EEAA 2CUFA 4HQEA 2MLKA 3CCJI 1T98A 2EH3A 1R1TA 2STTA 3DF8A 2VQGA 2L7FP 2XF6A 3PUFA 2HU9A 2XRNA 3R0JA 3T8RA 4BKXA 1TWAJ 5LRSA 2WA0A 2FQ3A 4HSTA 2L54A 1SFOJ 5J1RA 4KT5C 1SD4A 3KEOA 1GVDA 1ZAOA 3MKWB 4G8XA 4CGZA 3JR9A 1G3YA 3H92A 3S1RJ 4ZDOA 2WBMA 1D8KA 5DD4A 3V7RA 1WJCA 1Z7UA 2X1DA 3BTCA 3HRTA 4M3DA 4KISA 1UFMA 3GTLJ 5M5WJ 1RR7A 3O2PE 2KRHA 3HGGA 4L9VA 2WY7Q 2AQEA 1VQKI 4QPOA 2MYSA 4B8XA 5FKOA 2PJPA 1X3UA 2GXGA 3JTGA 4G9YA 1ETOA 1U78A 4DOZA 2R5ZB 2G0EA 4OMZA 2JA7J 4RAYA 3SHFA 2VQLA 3H3UA 2AHQA 4KJZA 3WE2A 4UUSB 3GTOJ 4DJAA 5FRMA 3T5XA 2VQCA 3U1DA 3L00A 3LFKA 4ZYHA 1UG0A 3RDIA 1R5ID 3QPLA 5DM7F 5EGOA 4PJLA 3M3YJ 3ASNH 1TT5B 3GFJA 1J5YA 4HQMA 4ON0A 2DN0A 1BM9A 1RI7A 1VQMI 1IG7A 2VE9A 3J81Z 2DDBA 3LSKA 3SQNA 2IW5A 3KZYA 3F22A 4AVPA 1XGNA 1PDNC 3F8BA 1U9OA 1FX7A 3B02A 4KIGA 3VODA 2R7XA 2R7ZJ 4RGRA 1G3SA 4XR6A 5M5XJ 2FNAA 4QPQA 4XSZF 3ZQLA 2IRFG 4OIPF 4E7IA 5FRNA 1I3AA 1IN8A 2VIXA 3GZ5A 1LVKA 1YS6A 3SXYA 1U5TA 4A3JJ 3GEZA 1Z3YA 3EUKL 1MJBA 1U5TC 1YIOA 1ZG3A 2LTPA 1LQ1A 1YW7A 2BHZA 3TDUC 2BVLA 5KAFC 1QO0D 4EGZA 4GCVA 3IRQA 3E5XA 4BE2A 1OCTC 5FO5A 1FP2A 2A3SA 3ZOBA 4K2EA 2COMA 3BWGA 2L02A 2L2OA 3I56I 2NXNB 2Y31A 4XLFA 3S15J 5FROA 1IGNA 5FKNA 4PK4A 1S72I 1QPIA 2QEXI 4NC8A 3TQNA 4EV0A 3LMMA 4MQ9F 3CDHA 5J4YA 5GTIC 1IV8A 4YELA 4HEA2 3C3WA 2FBKA 2EV6A 2P4WA 3WGGA 3RJPA 1ZRFA 2X6YA 3F6VA 2VI6A 1VQ8I 2NNYA 3U9GA 3BJOA 1IN4A 2Y30A 2DODA 2EIMH 1SMTA 4I01A 2VB6A 4LG0A 4XNFA 3V7SA 2E5ZA 4U0VA 1MIJA 5HODA 2LREA 1N75A 1IUYA 5F1RA 4IRHA 3KYLA 2IXSA 1YRNA 2W57A 4ANJA 3MFKA 1SVOA 3G1OA 1A35A 3HOUJ 1F4KA 4F52A 4A3FJ 3I0TA 5J40A 2HYGD 1IO2A 2I5UA 5CYVA 3OR1C 3FM3A 3J7ZI 2DOAA 3ABLH 1HW5A 4U7BA 2H27A 4BY7J 2VODA 4G7ZF 2WV0A 2VXZA 3FMRA 4M9XA 4B44A 2FSWA 3ZN1A 3KIOA 2QSGX 1BOBA 2VUMJ 4XRMA 3Q9SA 5CQGA 2EA2A 1H8AC 1WGXA 1A5JA 2EZLA 3C2GA 4FCYA 4MFEA 4A69C 4FASD 3KP7A 1BIAA 3ZQQA 3GXOA 4DYCA 4I7HA 3OL3A 1VQ6I 1D1BA 5IT9Z 4M3BA 5IP7J 1U3EM 2J5OA 3CP2A 3D5LA 3GFMA 2NVYJ 2HEOA 1RZ4A 1Z77A 1BL0A 4BXFA 1OCOH 1T8IA 2X6XA 2QM3A 1QRYA 2HQNA 4FTHA 2DYSH 2HVRA 1DUXC 2OTJI 2P5KA 4M3GA 2DMQA 4N9IA 3FXOA 4RAFA 2VJ4A 4A5NA 5B1BH 4IHWA 2VPRA 5LHGA 4ESJA 1VQOI 1JT6A 4PFPA 4RAZA 2GLOA 1OCRH 3V8LA 2FUG2 3P9CA 1MJ9A 1U6GA 2ZO4A 1YS7A 2ETHA 2F4OB 2FRHA 3VYRB 1FYLA 3HOVJ 3I58A 2BY3A 2LH9A 2Y2ZA 2HVQA 3LQRA 1RR8C 3BC8A 5BPDA 2EIKH 3IAS2 5CKTA 3I3LA 2JT1A 2LSOA 3M8JA 3SDBA 2MGQA 2Y75A 2R93J 3TGNA 3KCCA 4OU0A 3R0AA 4LB6B 1VFCA 2D1VA 2L0KA 2LMDA 4BY1J 2RNJA 3DPTA 1BN5A 2CQQA 1TBXA 3F8NA 1QHHD 2IGOA 2KZGA 2IS1A 3GW2A 3JRGA 2JA6J 2I8DA 5E1ZB 4MTDA 1AKHB 5CVRA 2IP2A 4EJUA 2X6OA 1TT0A 2D1HA 3GTJJ 1WFXA 3K10A 3BG5A 4KICA 4ASNA 4F92B 4Y17A 5IT3A 4P96A 1O3RA 1FC3A 1EJ9A 2X9DA 2DO7A 2LVSA 4LGWA 1J0RA 5F1JA 1VQPI 1ORKA 2B0LA 5ILSA 1EF4A 5J1YA 1AWCA 3K2ZA 4HF0A 2FBHA 2R7DA 1VQLI 2VKEA 1IXSB 3MWMA 2LBFB 4Z6YA 2DJIA 3A0BC 1D8JA 3FDYA 3MQ0A 2IGKA 2Y0SA 4B09A 1FOXA 2M34A 4CCOA 3CCRI 1R36A 2JA5J 1IXCA 4IPAA 2DFFA 2MD5A 2A69F 5EEGA 2HOTA 1JJ8C 2IS4A 3WTZA 4HG2A 4EEFG 1BOAA 3DTEA 3BPVA 3HUGA 2KLOA 4J01A 1QVUA 3D0SA 1D0XA 3GX4X 1X3ZB 3I9V2 2DW4A 2NOGA 1LPQA 4CCJA 3B6AA 3CTAA 4E6KG 1IJWC 1P4WA 3CUOA 3ZR8X 3PO3J 4Y33A 2V7FA 2CW8A 2DMNA 2OZ6A 5C4XJ 1Z7LA 3N05A 3E6BA 2PLYA 1JTYA 1MZBA 4M6YA 4NQWA 5D6FA 3RKYA 4BXUA 1TNSA 3V42A 2R7WA 1BBYA 1S9HA 1U2WA 4I09A 4QTRA 1MMDA 1Z3XA 3OOUA 2YPRA 1QPMA 2VQHA 5IYCJ 3S1QJ 3L7WA 2CQ7A 1XMKA 2Z2SB 5B5EC 2W7NA 4Z2YA 3FXKA 5L3DA 5ILUA 3WTTC 4XN0A 4B3XA 2FU4A 2QKMB 2R7RA 3A01A 3TO9A 2QSHX 1SVLA 2K7LA 4A3GJ 3CESA 3OOPA 5E3OA 4NB5A 1AHDP 1MSEC 4GFBA 3F9KA 2H8WA 4LD5A 5H6QA 3PSFA 3JSOA 1LKXA 2VT2A 4HX4A 1FWZA 1WVRA 5BNGA 3DWLE 5A2QK 3G3ZA 1DPRA 3Q0VA 3CJNA 3AL0B 2XRLA 1BR2A 2E1OA 3S14J 5E3NA 5EG0A 1UZCA 4ZZDA 2M7AA 1FIAA 1FOYA 1K4TA 3GMEA 1IN5A 2JZYA 4C9YA 4JQFA 4YG2F 1FOKA 3BCBA 1Q1HA 2G7HA 3C1DA 3KYDB 2E1MB 1MBFA 1X58A 2LR8A 2QQAA 3HOYJ 2K3PA 1O7LA 1UG2A 2PJRA 3OYFA 2K86A 1Y6IA 2DT6A 2VJIA 4HF1A 5DTDA 5DCFA 2XASA 3GWZA 3OYEA 5AIQA 5K5QA 3EUHA 2GOMA 2K85A 2HDWA 1PUFA 3KLNA 5CLSA 1Q1VA 4CDGA 1Z91A 1OISA 2GM4A 2HOEA 1KU2A 1WPKA 4XLHA 2EFNA 1SD6A 3RQ4A 3DXJF 3I54A 2ZJPF 4ITVA 3K1NA 1K4SA 2L4AA 3ULQB 3DLAA 2DQLA 2M0CA 1VTNC 3CCYA 4H4KC 3JRFA 1XMAA 5GP9A 2QGUA 4Y15A 2X1CA 1FOWA 5K7FA 1RUNA 2UXNA 1WKMA 4EM0B 2BOLA 4XRSG 1G6NA 2OPTA 5C3EJ 2M2EA 2ZB9A 3E7LA 2HZDA 4BQNA 2R7OA 3K70C 1G4DA 2EIJH 2MW8A 3MZYA 1V5GA 1N77A 4PDKA 1FSEA 1TNTA 1D3YA 2PMZA 1IRXA 1R58A 1IXRC 2DK5A 2W82A 1FYMA 4CH7A 2E2HJ 1OYIA 1YJWI 2Z9OA 1OQYA 1OR7A 2GXAA 4L5IA 1ETXA 1MNDA 3J80K 2A5YB 1X4OA 1OPCA 4M72A 1OR7C 3CZ6A 3N4MA 2N8GA 1ZGWA 1YX5A 2FA5A 3REOA 5ICEA 1P9QC 2EV0A 1B8IA 3CCMI 2XKPA 3W3CA 4BBSJ 3FX3A 1QBJA 2M4GA 3V4GA 3E5UA 1I5ZA 1YE9A 4R79A 1R23A 1HA8A 5LGNA 4MHGA 5A2QZ 2X6WA 3C7JA 2AQFA 3GLLA 1XS9A 3CD6I 5HS9A 2UWMA 3CJRB 4XOTA 1MBEA 1S6LA 5LHIA 4S04A 5ERIA 3BQYA 3KZZA 2CG4A 2VASA 4IHVA 3G1LA 3H0GJ 5BQTA 2WC2A 1OYYA 3M8EA 2VE8A 4LLLA 3PNYA 1LNWA 1LFBA 2KFDA 2O03A 1ZG1A 5HS8A 3IHUA 3TOBA 3I59A 2ZXIA 1W1WE 2MLGA 3LA3A 1XDSA 5FB2A 2ISZA 3I64A 3E97A 4G12A 3ZCOA 3KZIC 3R4KA 2ADUA 1B59A 1NK3P 2GZWA 4II2A 4KITB 2XPVA 2MABA 4U7DA 2F5VA 5IYBJ 2QBYA 2TRTA 2WAFA 1FYKA 3BTLA 4BYYA 1ZRCA 3IH3A 2DFIA 4BHBA 5JLXA 3ZN0A 5L3CA 3BG3A 1I39A 5J3LA 1T39A 3L2VA 1P6RA 1DGWY 2H94A 2RREA 1LVAA 4WF2A 2DOFA 4S05A 1OCPA 1APLC 4HPQA 1OLTA 1XG1A 4EJWA 3OYGA 1LFUP 4EQQA 1UCRA 3L2RA 2WB1N 4F7ZA 2BV6A 1HCRA 5C44J 1B1BA 2MC4A 3FMSA 2XPWA 3SZTA 2CUZA 4A2UA 2NVQJ 1DP7P 2M9HA 4FISA 2M0MA 1TQMA 4BDYA 3K4LA 3IH4A 3WTVC 3WU0A 1X4PA 2X51A 2V9VA 3CUQB 2RQPA 1KONA 1N25A 1YOVB 2HGCA 1SMYF 2KRCA 3LWFA 3KFWX 4FE4A 3FXQA 4WXHA 2IBDA 2FX0A 3VPRA 2MA3A 2XDVA 3S8PA 2EFWA 3NWTA 1U8BA 1S3JA 4KIFA 1YHQI 4EVIA 2LKXA 3C18A 2DLLA 2CV2A 5M5YJ 1XX5A 3VWBA 4D0PA 5D5VB 3M4OJ 1VQ7I 1V54H 3LSGA 3FXMA 5DCMB 5B66C 5FJ8J 2M30A 5H2FC 1ZYRF 4HAMA 1RETA 2DPUA 1BI2A 4NDLA 4CCKA 2E7XA 3M8FA 3R60A 4BQQA 1V4RA 4UNOA 4E7LA 2JWTA 1HKQA 2M7BA 2OC6A 3I53A 1HKTA 5KVRA 2L7MP 4KMUX 1FEXA 5LGUA 2DA2A 4M9ZA 4G7HF 3BY6A 3CMEI 3QPTA 3P9IA 3LOCA 3AAFA 2FE3A 2VBWA 3ELKA 5LGTA 3GZNB 3UNGC 1VQNI 4DZPA 3OYAA 1LUJB 3BJ6A 1BC7C 4I99C 2XAUA 3JRIA 3QYBA 5E79C 1R71A 1IN7A 1BJZA 3W6JB 2GOXB 4I0AA 5EYRA 4XKVA 4KUMA 3ISPA 3QP5A 5AIPA 1ETQA 2R5YA 3HHGA 3BP8A 2MG4A 2OBPA 2X85A 5BS6A 4IZZA 2E2IJ 2A5WA 2HQRA 3TKYA 1JHHA 6PAXA 4LITA 3S2WA 3J7YJ 1TW3A 2D45A 2O61A 1F9NA 4PFOA 4UB8C 4OINF 4PCQA 3K1MA 5K5OA 3OS2A 3BJAA 3GLXA 2CW0F 2HXIA 2K9LA 1FZPB 3H5AA 5LHHA 5BMZA 5L3BA 3FZVA 1TW2A 2XAQA 4ZZLA 2EFPA 2CU7A 1DU0A 2E35A 3CMMA 4NNJA 3ABKH 3CC2I 2ZBKA 2VC1A 2ID6A 2HTJA 5CPRB 1NTCA 3LA7A 3ZP5A 2RC4A 1FP1D 2NVTJ 1W7PA 2JRMA 4WXDA 2Y0SN 2LYCA 3CDIA 4P9UA 3OS0A 4Q5SF 2PI0A 2Y9ZA 1HXDA 4M71A 5TRDA 3RZOJ 3WG7H 3FMQA 1MW7A 2PQ8A 4IQ4A 1G3TA 1HSTA 3S16J 2NS0A 2QSFX 3LSPA 4RB3C 1XMXA 1ZLJA 2KHMA 4IQJA 1RIOH 3EDPA 3ZQ7A 5BPIA 3TP3A 5EF6A 4IRGA 1UHMA 3BCAA 2K3FA 2XGDA 2B7EA 1RC9A 1ERDA 2P6TA 3R6SA 1NK2P 3MD2A 3CF2A 4HV6A 3GCMA 3OR2C 1I1SA 1FTZA 3IC7A 1MBGA 3VYSB 4ETSA 4BGDA 4RDUA 2KISA 1R5GA 4PZJA 1MD0A 5EEHA 4EJTA 3H3ZA 2JJ7A 2P81A 4S0HB 1E17A 1R00A 3FXUA 1MMGA 2OU2A 3RKWA 4A6DA 1O7FA 2W4SA 1SAXA 3EYIA 4A3CJ 4IHXA 1IDYA 4HNTA 2WV1A 3NAUA 1SAUA 3VOEA 5L3FA 1VQ9I 2ACJA 1JUSA 3JRBA 1PYVA 1BJAA 4LG3A 1Z9CA 2NOJB 3CQZJ 3QP6A 2BW3B 4ZYAA 2HQAA 2OCCH 2M1BA 5D6EA 4HNUA 3G6EI 1CF7B 2V9KA 3HPHA 2R7TA 1JJ6C 2R7UA 2Q8KA 1MKMA 1I27A 2GQQA 3GFLA 3WODF 5FGMA 4BJ5C 1JE8A 3K69A 3CC7I 2GIZA 2R5ZA 2X4HA 2ISYA 2L9NA 3K6GA 1QHGA 3S3MA 4UUSA 3HSFA 2NRAC 1D5YA 2B9SA 2BXZA 1S7EA 5BOXA 1KU3A 1BW6A 3NEUA 3S3OA 4RGSA 1BI3A 3QOEA 2BHYA 4N4OB 4EM1A 2P7CB 2EB7A 2HPIA 5F08A 4A3LJ 2FXAA 2LK2A 2XGCA 4MIMA 2CUJA 3OYLA 2Z1DA 3DTKA 2A6HF 3I4NJ 3G1MA 1HW2A 2BY0A 2L7ZA 3GO5A 4JK1X 4I6ZA 2K27A 4F91B 1BIBA 4XBFA 2KQRA 3ESWB 3S1NJ 1SC7A 1ETVA 3OMYA 2GA2A 1WH7A 2VBYA 4A3EJ 3G73A 2GIVA 2XC7A 3OYCA 3GVAA 4BEHB 4FX4A 3TEDA 3RSNA 3ZMSA 1OMIA 1L3LA 2XUBA 4GXOA 5K7ZA 4C3HJ 1B72A 1JT0A 3K4JA 2R92J 2KKOA 1ZELA 4UY8I 2R7QA 5HNFA 1R22A 2XPUA 1F43A 2W48A 3BR1A 2Q2EB 4HX8A 3DPUA 1ETWA 4W97A 2KL4A 2PMZN 1O3SA 2FF4A 2HWVA 4NC6A 1D0YA 5FLVA 3ABUA 2OJED 3OYNA 4YFXF 2VBXA 3IKVA 2NVUB 4M74A 2WTEA 3AFHA 2F6CA 1T33A 2EFQA 1VQ5I 1LEBA 4Y4RA 3V8JA 3OYHA 1YO5C 2IS6A 5DS9A 2VC0A 1LE8B 3QAHA 2XKOA 2DPDA 1X2MA 1HDDC 3FHZA 2KDZA 1ZR4A 2HNHA 1MH4A 3L9FA 4UUTA 4B47A 2VOOA 5EJCA 3RCOA 2EFOA 4D9JA 3FK7A 3JTHA 3W6VA 1JHFA 4EMSA 3K70D 4IRIA 5KCMA 5TJJA 2V9PA 3BLYA 2JN6A 1O3TA 2IEKA 4EM2A 2LRDA 1FTTA 1JKQC 1A6QA 2L9VA 4UVAA 4A3KJ 3HRMA 3F8CA 3PO2J 4BUPA 3LA2A 5D5XB 3ZQHA 3CCEI 4EATA 2RVCA 4FHTA 4LLGF 1TQPA 4V2FA 3MMYB 1H88C 3QYEA 3GTMJ 5B3SH 1EH6A 4D7MA 5JHUA 4DGWB 1ZGAA 2O7OA 5KHDA 3D1NI 2O9LA 3EETA 3BOQA 4C3IJ 2MH9A 3MKYB 2CQKA 1XCVA 2EINH 3ZMDA 3K9TA 3MZ8A 1B6AA 3ABTA 4HA8A 2HKXA 1XGOA 3AG1H 3KYCB 4CZZA 2L4MA 2ZNZA 1Z1DA 1Z6TA 3KX2A 3GF2A 3SDGA 2ZMEB 4OAZA 5F0CA 1UMQA 3I71A 3UR3C 1SFUA 5D5WB 3WU2C 3RTRA 1TZLA 3VSKA 4C3JJ 2XGXA 1WH5A 2ECBA 4KDPA 2ELKA 1R6RA 3WHBA 4LIVA 3OYMA 1MDMB 3TW7A 4BE0A 2HPMA 3JAMK 1P7JA 3K1PA 1O57A 1WQ2A 4RLFA 2R7SA 2E36A 4CCLA 3DBHB 3PNTA 1T0FC 2DT7B 2ZXJA 1RRJA 2ZFWA 2YU9J 3X2QH 5E8GA 5F27A 4KA4A 2H6BA 2LDUA 3HM5A 1YTYA 3HTUA 4GYGA 2FQ4A 3KEQA 4O3MA 2JUCA 1B9MA 1VI0A 1FT9A 3BR0A 1VZ0A 2Y48A 3K4CA 1T95A 4HV5A 3FKJA 4KT6A 5DEQA 3V7CA 4B1RA 2L5QA 3OYKA 5DYMA 2ME0A 1IV6A 4LK1F 4QSHA 4AC0A 4HYEA 3G2BA 1XC5A 2EQRA 3RYRA 1UB9A 2F4MB 3E1SA 3ML6A 4I98B 1SFXA 1IUFA 5D4SA 3ONQA 4L5EA 1EH7A 4A0YA 2VPLA 5HOOA 2NVXJ 1ETYA 2OQRA 5L3EA 1GXPA 3WTXC 4LFUA 1IF1A 4UUVA 2LOOA 2CH0A 5LEJA 3TO7A 2H1LA 3S2HJ 3O3KA 1JKPC 1FY7A 1JGGA 2XSDC 3K4MA 2OD5A 4CYDA 3WGIA 3HXLA 3IL2A 3PQKA 3B6CA 3GZ6A 2DYRH 2R3SA 3HPGA 4CCNA 4KFCA 1X2NA 3BZ6A 4O6JA 4CYCB 2OZUA 3A4CA 2XAGA 2JA2A 3FXLA 5CJ9A 3WTYC 5IOYA 3AG3H 1I3QJ 2WWYA 4ZTJA 1ETKA 1EKEA 4BACA 4XIDA 4XK4A 2ZNYA 2DFHA 4DIQA 2LBFA 2BXYA 5GPAA 4LOCA 3ZMZA 3HSEA 4P9FA 3IRRA 1WJEA 2KZVA 1BR1A 4MEYF 3EPZA 4XLAA 3RIRA 4DYQA 1GUUA 2F2EA 3ZGKA 2NAZA 2F5DA 4CA0A 1LB2A 4IHYA 1QVTA 2E7WA 1F5TA 4JX4A
chains in the Genus database with same CATH topology
5EZHA 1HCRA 5C44J 2DN0A 2XPWA 2NVQJ 4XRSA 4HNVA 2M9HA 4M3FA 4FISA 1IG7A 4MFDA 3HDDA 3IH4A 1BA5A 1U9OA 3BTIA 2R7ZJ 3QQAA 3RZDJ 2K40A 5M5XJ 2K9QA 3IV5A 2HOAA 4FE4A 2HI3A 3ZQLA 2IBDA 2TCTA 2FX0A 4X6AJ 1ZR2A 3VPRA 1SANA 4J19A 1U8BA 3OSGA 3FKIJ 2LKXA 4A3JJ 1MBJA 5M5YJ 1JKOC 4MO7A 5EDNA 3GTPJ 3M4OJ 2FJ1A 2LTPA 2Y9YA 3LSGA 5FJ8J 2COBA 3GTKJ 1MNMC 2DA1A 1RETA 1OCTC 4A3DJ 3A03A 4NDLA 3ZOBA 2HYJA 3A01B 2XB5A 2JWTA 2Y31A 2MSYA 5GPCA 3HB9A 1A6IA 1G2HA 3S15J 1IGNA 1HDPA 3MN2A 2L7MP 5FKNA 2DTZA 1FEXA 2DA2A 3TP0A 2DMUA 1QPIA 1TWCJ 3LOCA 1P7IA 1LE8A 3FK6A 2I10A 5EG0B 2VI6A 1TWFJ 5F04A 2Y30A 4D5FA 4DZPA 3JRIA 5HODA 3BTJA 5FKMA 5IPAA 1BJZA 5FKLA 1YRNA 5EYRA 3G1OA 3HOUJ 2HXOA 2VKVA 1ETQA 2R5YA 1E3OC 3HGYA 4A3FJ 2MG4A 3BR3A 2E2IJ 5JLWA 3L1PA 3O8HA 1VF9A 1RPWA 2JA8J 3BG9A 4BY7J 1AKHA 2DA7A 4QIWN 1PUFB 1ZKGA 2HXIA 3NARA 4JX6A 4XRMA 1H8AC 2VUMJ 4Y52J 3JRCA 3S1MJ 1WGXA 5FKKA 1A5JA 2EZLA 4FCYA 4MFEA 1OFCX 4A69C 1DU0A 2CU7A 2H1KA 2B63J 2LP0A 2H8RA 4DYCA 3LNQA 3FISA 3BQZA 2ID6A 4M3BA 4I76A 1NTCA 2DMPA 5IP7J 4A3MJ 2NVYJ 5J1UA 1Z77A 1BL0A 3HOZJ 2NVTJ 1ITYA 2Y0SN 2JK3A 4JX5A 2Y9ZA 1F36A 1QRYA 3RZOJ 4FTHA 5M3FJ 3IH2A 4M3GA 1JUMA 2DMQA 1W0UA 5IP9J 3S16J 3LSPA 5IOZA 3OIOA 3QPSA 4IHWA 2VPRA 4ABZA 1JT6A 5E3LA 3TP3A 5EF6A 2GLOA 2XGDA 1GT0C 2HQ5A 3K7AJ 5C4JJ 1NK2P 3HOVJ 2ID3A 5F0HA 5K7HA 1MSFC 2Y2ZA 2M8GX 1ENHA 5IYDJ 1B8IB 1FTZA 5E3MA 3HEFA 1MBGA 1IDZA 4RDUA 2E2JJ 2MGQA 4RBOA 2R93J 3LSJA 5IP6A 3F0CA 1FJLA 2JJ7A 1VFCA 2YS9A 2P81A 2L0KA 2R5YB 2AO9A 4S0HB 4BY1J 2CQQA 3BR2A 4A3CJ 4IHXA 3JRGA 2JA6J 1AKHB 1IDYA 2XGEA 2WV1A 2X6OA 3NAUA 3GTJJ 3S17J 3BG5A 4DYRA 1I50J 1JUSA 1ZTRA 3JRBA 1RESA 2DA5A 3CQZJ 3GTQJ 1OJLA 4IEJA 4CYCA 1MBHA 2JMWA 1HF0A 2X9DA 4A93J 1BW5A 1GV5A 2LVSA 2LLKA 1JJ6C 4W1UA 3WHCA 1HLVA 2DA6A 5F1JA 1RKWA 2EZKA 1ORKA 2R5ZA 2ME6A 5J1YA 1EF4A 4DW6A 2VKEA 4UUSA 2NS7A 1TC3C 1AU7A 1D5YA 3A02A 3ZQGA 2M34A 1K61A 3I4MJ 1S7EA 4AYBN 1CQTA 2JA5J 3ZQCA 1BW6A 1RKTA 3GBGA 2DA3A 2HOTA 1JJ8C 1WCMJ 4EEFG 5EGOB 4V2GA 5F08A 2OF7A 1GDTA 4A3LJ 3JRHA 2LK2A 2XGCA 1QVUA 4MIMA 1HOMA 4B4CA 2NOGA 3I4NJ 3B6AA 4JYKA 1ZK8A 3G1MA 1IJWC 1JUPA 3PO3J 2L7ZA 2L9RA 9ANTA 1Y1WJ 4I6ZA 2DMNA 1JKRC 5C4XJ 3H3VK 1JTYA 3S1NJ 1ETVA 4A3EJ 1WH7A 2EBIA 4MLOA 3JREA 4QTRA 3TEDA 4C2MJ 3OOUA 5K7ZA 2GBYA 4C3HJ 5IYCJ 4XICA 1JT0A 1B72A 3S1QJ 2R92J 2CRGA 3ZQIA 4DZJA 2XPUA 1F43A 2W48A 3BR1A 2RAEA 4BXXJ 3A01A 1ETWA 4W97A 4B3AA 2PMZN 4A3GJ 1DU6A 3Q0WA 5E3OA 3GTGJ 2LFBA 3SJMA 5FLVA 2QCOA 1AHDP 1MSEC 4GFBA 3Q0UA 1ZQ3P 1IRZA 3HKZN 2QF7A 1U9NA 4D7NA 2XB0X 3BR5A 1WI3A 5F0FA 3JRDA 1TWGJ 3JRAA 5BNGA 1JTXA 2O8KA 1T33A 3Q0VA 4A3BJ 1Y1VJ 2XRLA 4BBRJ 1H89C 2E1OA 3S14J 1POGA 5DS9A 5E3NA 5EG0A 1LE8B 1FIAA 1X2MA 1HDDC 2KDZA 1ZR4A 3C2BA 4M3EA 1MH4A 4UUTA 1UHSA 3S2DJ 2E19A 3O8GA 3RKQA 3FK7A 2NS8A 3W6VA 1MBFA 1X58A 2LR8A 3HOYJ 3Q3SA 1UG2A 2JN6A 2IEKA 3CMYA 1FTTA 1YRNB 1JKQC 4JP0A 3MVPA 4A3KJ 3UKGA 2HDDA 3PO2J 5DTDA 4M6VA 3PM1A 2LD5A 3ZQHA 1FIPA 2WAQN 1PUFA 3DEWA 4V2FA 3LSRA 1Q1VA 1H88C 3GTMJ 4D7MA 1Z0XA 4AUXA 3FIWA 2O7OA 2GM4A 3D1NI 2O9LA 1WPKA 4C3IJ 3MKLA 1MH3A 1IC8A 5FLMJ 3ZQFA 1R9TJ 2M0CA 3CCYA 2DJNA 3SDGA 5F0CA 2CQXA 5GP9A 3JRFA 1UMQA 2ECCA 4C3JJ 1B72B 5K7FA 1WH5A 1K83J 2ECBA 2ELKA 3WHBA 4XRSG 2OPTA 5C3EJ 2YUSA 3TW7A 2M2EA 2ZB9A 3E7LA 1TWHJ 1P7JA 2LY9A 2MW8A 2KT0A 4X1EA 2CJJA 1I6HJ 4A3IJ 2HOSA 2K9NA 2E2HJ 2D5VA 3HBLA 2YU9J 2IAIA 5F27A 3TW6A 4FE7A 1ETXA 3SFIA 3RQIA 3HM5A 3DCFA 3HOXJ 2FQ4A 2R0QC 1O4XA 3BR0A 1VI0A 2CUEA 2N8GA 1ZGWA 1GV2A 2FD5A 2X48A 3BR6A 4B1RA 2ME0A 1W0TA 1IV6A 1B8IA 1MBKA 2EZIA 4QSHA 4AC0A 4BBSJ 3OSFA 2EZHA 1XC5A 1T56A 2EQRA 5M3MJ 5EEAA 2CUFA 2DA4A 1VNDA 2EH3A 2DMTA 2L7FP 1XS9A 4BKXA 1TWAJ 1IUFA 3CDLA 1MBEA 4L5EA 3BQYA 4IHVA 3G1LA 3H0GJ 1SFOJ 2NVXJ 1ETYA 5J1RA 3BT9A 3HOWJ 1LFBA 1GVDA 3S2HJ 1JKPC 3JR9A 1JGGA 2XSDC 3S1RJ 3B6CA 4G12A 3BTCA 4M3DA 3GTLJ 1NK3P 1X2NA 5M5WJ 1RR7A 4CYCB 4Y7NJ 3HGGA 3K2AA 2XPVA 5IYBJ 5IOYA 2TRTA 1I3QJ 3BTLA 3IH3A 1ETKA 5FKOA 4D5CA 4XIDA 4XK4A 5JLXA 3BG3A 1ETOA 5J3LA 1U78A 5GPAA 4LOCA 2R5ZB 2G0EA 2JA7J 4UUSB 2AHQA 3GTOJ 5EZGA 1OCPA 1APLC 4DYQA 1GUUA 4IHYA 1QVTA 1LFUP 1XG1A 5EGOA 3QPLA 4JX4A 3M3YJ 2WB1N 2K9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EZH A;  1HCR A;  5C44 J;  2DN0 A;  2XPW A;  2NVQ J;  4XRS A;  4HNV A;  2M9H A;  4M3F A;  4FIS A;  1IG7 A;  4MFD A;  3HDD A;  3IH4 A;  1BA5 A;  1U9O A;  3BTI A;  2R7Z J;  3QQA A;  3RZD J;  2K40 A;  5M5X J;  2K9Q A;  3IV5 A;  2HOA A;  4FE4 A;  2HI3 A;  3ZQL A;  2IBD A;  2TCT A;  2FX0 A;  4X6A J;  1ZR2 A;  3VPR A;  1SAN A;  4J19 A;  1U8B A;  3OSG A;  3FKI J;  2LKX A;  4A3J J;  1MBJ A;  5M5Y J;  1JKO C;  4MO7 A;  5EDN A;  3GTP J;  3M4O J;  2FJ1 A;  2LTP A;  2Y9Y A;  3LSG A;  5FJ8 J;  2COB A;  3GTK J;  1MNM C;  2DA1 A;  1RET A;  1OCT C;  4A3D J;  3A03 A;  4NDL A;  3ZOB A;  2HYJ A;  3A01 B;  2XB5 A;  2JWT A;  2Y31 A;  2MSY A;  5GPC A;  3HB9 A;  1A6I A;  1G2H A;  3S15 J;  1IGN A;  1HDP A;  3MN2 A;  2L7M P;  5FKN A;  2DTZ A;  1FEX A;  2DA2 A;  3TP0 A;  2DMU A;  1QPI A;  1TWC J;  3LOC A;  1P7I A;  1LE8 A;  3FK6 A;  2I10 A;  5EG0 B;  2VI6 A;  1TWF J;  5F04 A;  2Y30 A;  4D5F A;  4DZP A;  3JRI A;  5HOD A;  3BTJ A;  5FKM A;  5IPA A;  1BJZ A;  5FKL A;  1YRN A;  5EYR A;  3G1O A;  3HOU J;  2HXO A;  2VKV A;  1ETQ A;  2R5Y A;  1E3O C;  3HGY A;  4A3F J;  2MG4 A;  3BR3 A;  2E2I J;  5JLW A;  3L1P A;  3O8H A;  1VF9 A;  1RPW A;  2JA8 J;  3BG9 A;  4BY7 J;  1AKH A;  2DA7 A;  4QIW N;  1PUF B;  1ZKG A;  2HXI A;  3NAR A;  4JX6 A;  4XRM A;  1H8A C;  2VUM J;  4Y52 J;  3JRC A;  3S1M J;  1WGX A;  5FKK A;  1A5J A;  2EZL A;  4FCY A;  4MFE A;  1OFC X;  4A69 C;  1DU0 A;  2CU7 A;  2H1K A;  2B63 J;  2LP0 A;  2H8R A;  4DYC A;  3LNQ A;  3FIS A;  3BQZ A;  2ID6 A;  4M3B A;  4I76 A;  1NTC A;  2DMP A;  5IP7 J;  4A3M J;  2NVY J;  5J1U A;  1Z77 A;  1BL0 A;  3HOZ J;  2NVT J;  1ITY A;  2Y0S N;  2JK3 A;  4JX5 A;  2Y9Z A;  1F36 A;  1QRY A;  3RZO J;  4FTH A;  5M3F J;  3IH2 A;  4M3G A;  1JUM A;  2DMQ A;  1W0U A;  5IP9 J;  3S16 J;  3LSP A;  5IOZ A;  3OIO A;  3QPS A;  4IHW A;  2VPR A;  4ABZ A;  1JT6 A;  5E3L A;  3TP3 A;  5EF6 A;  2GLO A;  2XGD A;  1GT0 C;  2HQ5 A;  3K7A J;  5C4J J;  1NK2 P;  3HOV J;  2ID3 A;  5F0H A;  5K7H A;  1MSF C;  2Y2Z A;  2M8G X;  1ENH A;  5IYD J;  1B8I B;  1FTZ A;  5E3M A;  3HEF A;  1MBG A;  1IDZ A;  4RDU A;  2E2J J;  2MGQ A;  4RBO A;  2R93 J;  3LSJ A;  5IP6 A;  3F0C A;  1FJL A;  2JJ7 A;  1VFC A;  2YS9 A;  2P81 A;  2L0K A;  2R5Y B;  2AO9 A;  4S0H B;  4BY1 J;  2CQQ A;  3BR2 A;  4A3C J;  4IHX A;  3JRG A;  2JA6 J;  1AKH B;  1IDY A;  2XGE A;  2WV1 A;  2X6O A;  3NAU A;  3GTJ J;  3S17 J;  3BG5 A;  4DYR A;  1I50 J;  1JUS A;  1ZTR A;  3JRB A;  1RES A;  2DA5 A;  3CQZ J;  3GTQ J;  1OJL A;  4IEJ A;  4CYC A;  1MBH A;  2JMW A;  1HF0 A;  2X9D A;  4A93 J;  1BW5 A;  1GV5 A;  2LVS A;  2LLK A;  1JJ6 C;  4W1U A;  3WHC A;  1HLV A;  2DA6 A;  5F1J A;  1RKW A;  2EZK A;  1ORK A;  2R5Z A;  2ME6 A;  5J1Y A;  1EF4 A;  4DW6 A;  2VKE A;  4UUS A;  2NS7 A;  1TC3 C;  1AU7 A;  1D5Y A;  3A02 A;  3ZQG A;  2M34 A;  1K61 A;  3I4M J;  1S7E A;  4AYB N;  1CQT A;  2JA5 J;  3ZQC A;  1BW6 A;  1RKT A;  3GBG A;  2DA3 A;  2HOT A;  1JJ8 C;  1WCM J;  4EEF G;  5EGO B;  4V2G A;  5F08 A;  2OF7 A;  1GDT A;  4A3L J;  3JRH A;  2LK2 A;  2XGC A;  1QVU A;  4MIM A;  1HOM A;  4B4C A;  2NOG A;  3I4N J;  3B6A A;  4JYK A;  1ZK8 A;  3G1M A;  1IJW C;  1JUP A;  3PO3 J;  2L7Z A;  2L9R A;  9ANT A;  1Y1W J;  4I6Z A;  2DMN A;  1JKR C;  5C4X J;  3H3V K;  1JTY A;  3S1N J;  1ETV A;  4A3E J;  1WH7 A;  2EBI A;  4MLO A;  3JRE A;  4QTR A;  3TED A;  4C2M J;  3OOU A;  5K7Z A;  2GBY A;  4C3H J;  5IYC J;  4XIC A;  1JT0 A;  1B72 A;  3S1Q J;  2R92 J;  2CRG A;  3ZQI A;  4DZJ A;  2XPU A;  1F43 A;  2W48 A;  3BR1 A;  2RAE A;  4BXX J;  3A01 A;  1ETW A;  4W97 A;  4B3A A;  2PMZ N;  4A3G J;  1DU6 A;  3Q0W A;  5E3O A;  3GTG J;  2LFB A;  3SJM A;  5FLV A;  2QCO A;  1AHD P;  1MSE C;  4GFB A;  3Q0U A;  1ZQ3 P;  1IRZ A;  3HKZ N;  2QF7 A;  1U9N A;  4D7N A;  2XB0 X;  3BR5 A;  1WI3 A;  5F0F A;  3JRD A;  1TWG J;  3JRA A;  5BNG A;  1JTX A;  2O8K A;  1T33 A;  3Q0V A;  4A3B J;  1Y1V J;  2XRL A;  4BBR J;  1H89 C;  2E1O A;  3S14 J;  1POG A;  5DS9 A;  5E3N A;  5EG0 A;  1LE8 B;  1FIA A;  1X2M A;  1HDD C;  2KDZ A;  1ZR4 A;  3C2B A;  4M3E A;  1MH4 A;  4UUT A;  1UHS A;  3S2D J;  2E19 A;  3O8G A;  3RKQ A;  3FK7 A;  2NS8 A;  3W6V A;  1MBF A;  1X58 A;  2LR8 A;  3HOY J;  3Q3S A;  1UG2 A;  2JN6 A;  2IEK A;  3CMY A;  1FTT A;  1YRN B;  1JKQ C;  4JP0 A;  3MVP A;  4A3K J;  3UKG A;  2HDD A;  3PO2 J;  5DTD A;  4M6V A;  3PM1 A;  2LD5 A;  3ZQH A;  1FIP A;  2WAQ N;  1PUF A;  3DEW A;  4V2F A;  3LSR A;  1Q1V A;  1H88 C;  3GTM J;  4D7M A;  1Z0X A;  4AUX A;  3FIW A;  2O7O A;  2GM4 A;  3D1N I;  2O9L A;  1WPK A;  4C3I J;  3MKL A;  1MH3 A;  1IC8 A;  5FLM J;  3ZQF A;  1R9T J;  2M0C A;  3CCY A;  2DJN A;  3SDG A;  5F0C A;  2CQX A;  5GP9 A;  3JRF A;  1UMQ A;  2ECC A;  4C3J J;  1B72 B;  5K7F A;  1WH5 A;  1K83 J;  2ECB A;  2ELK A;  3WHB A;  4XRS G;  2OPT A;  5C3E J;  2YUS A;  3TW7 A;  2M2E A;  2ZB9 A;  3E7L A;  1TWH J;  1P7J A;  2LY9 A;  2MW8 A;  2KT0 A;  4X1E A;  2CJJ A;  1I6H J;  4A3I J;  2HOS A;  2K9N A;  2E2H J;  2D5V A;  3HBL A;  2YU9 J;  2IAI A;  5F27 A;  3TW6 A;  4FE7 A;  1ETX A;  3SFI A;  3RQI A;  3HM5 A;  3DCF A;  3HOX J;  2FQ4 A;  2R0Q C;  1O4X A;  3BR0 A;  1VI0 A;  2CUE A;  2N8G A;  1ZGW A;  1GV2 A;  2FD5 A;  2X48 A;  3BR6 A;  4B1R A;  2ME0 A;  1W0T A;  1IV6 A;  1B8I A;  1MBK A;  2EZI A;  4QSH A;  4AC0 A;  4BBS J;  3OSF A;  2EZH A;  1XC5 A;  1T56 A;  2EQR A;  5M3M J;  5EEA A;  2CUF A;  2DA4 A;  1VND A;  2EH3 A;  2DMT A;  2L7F P;  1XS9 A;  4BKX A;  1TWA J;  1IUF A;  3CDL A;  1MBE A;  4L5E A;  3BQY A;  4IHV A;  3G1L A;  3H0G J;  1SFO J;  2NVX J;  1ETY A;  5J1R A;  3BT9 A;  3HOW J;  1LFB A;  1GVD A;  3S2H J;  1JKP C;  3JR9 A;  1JGG A;  2XSD C;  3S1R J;  3B6C A;  4G12 A;  3BTC A;  4M3D A;  3GTL J;  1NK3 P;  1X2N A;  5M5W J;  1RR7 A;  4CYC B;  4Y7N J;  3HGG A;  3K2A A;  2XPV A;  5IYB J;  5IOY A;  2TRT A;  1I3Q J;  3BTL A;  3IH3 A;  1ETK A;  5FKO A;  4D5C A;  4XID A;  4XK4 A;  5JLX A;  3BG3 A;  1ETO A;  5J3L A;  1U78 A;  5GPA A;  4LOC A;  2R5Z B;  2G0E A;  2JA7 J;  4UUS B;  2AHQ A;  3GTO J;  5EZG A;  1OCP A;  1APL C;  4DYQ A;  1GUU A;  4IHY A;  1QVT A;  1LFU P;  1XG1 A;  5EGO A;  3QPL A;  4JX4 A;  3M3Y J;  2WB1 N;  2K9S A; 
#chains in the Genus database with same CATH topology
 4E7J A;  2QLZ A;  2EA4 A;  4BH9 A;  4JBA A;  3L09 A;  2BY2 A;  3NWS A;  1S7A A;  4MFD A;  4DBR A;  3JAM Z;  1YQA A;  2C6Y A;  1XSV A;  4AD9 A;  3LSH A;  5FD5 A;  4N4N B;  1BA5 A;  5FD6 A;  3BTI A;  2IT0 A;  2WAE A;  4OWR B;  3QQA A;  3RZD J;  2K9Q A;  2HTS A;  3IV5 A;  2HOA A;  4KYW A;  4GYI A;  2TCT A;  1H9G A;  3SFZ A;  3PFI A;  1SAN A;  2OAZ A;  4XON A;  4J19 A;  1PUE E;  3OSG A;  4HOB A;  1A04 A;  5J4V A;  1FNN A;  1R1U A;  4EJV A;  3PQJ A;  2QZ8 A;  4MO7 A;  4ZDL A;  4E4H A;  5EDN A;  3F21 A;  3GTP J;  2Y9Y A;  1QZZ A;  4BQO A;  3E0J B;  2DA1 A;  3H1C A;  1SVM A;  2P0W A;  1V5F A;  3OY9 A;  2Y0M A;  2ZJR F;  2XB5 A;  5HDG A;  4P5O A;  2MSY A;  5GPC A;  2HR3 A;  1A6I A;  2PX9 A;  1QGP A;  2X0L A;  1G2H A;  4UHT A;  1YIT I;  1HDP A;  3MN2 A;  2DTZ A;  1KZH A;  4CSW A;  4AU7 A;  1SD5 A;  3H35 A;  4XKW A;  4RMN A;  2MC3 A;  1P7I A;  2V6C A;  3G4S I;  2O0Y A;  3FK6 A;  3CO7 C;  3AL0 C;  3F3X A;  4B48 A;  4WK8 F;  2I10 A;  4ZDP A;  4G6Q A;  1WHU A;  2P8T A;  1R5H A;  2KIF A;  5K1Y A;  1EV7 A;  3E5Q A;  5F04 A;  2QYO A;  1G3W A;  2VN2 A;  4HRI A;  3FWE A;  1Y39 A;  2R4G A;  1OKR A;  2E1M C;  1W7P D;  3LAP A;  5FKL A;  1M1E B;  4BDZ A;  3ZPL A;  3PFY A;  3CC4 I;  4GO1 A;  5FFX A;  4HBL A;  2VKV A;  4HW0 A;  3HGY A;  1USS A;  2GA1 A;  3BDD A;  5JLW A;  4H0E A;  3O8H A;  4LK0 F;  3BG9 A;  1IN6 A;  3DEU A;  2OV7 A;  3PNV A;  3H0D A;  2ZSH B;  1WJD A;  2RV8 A;  4ESF A;  5HLT A;  2L01 A;  1ZKG A;  1T08 B;  4OOI A;  5LEK A;  4JX6 A;  4DQ2 A;  4IX7 A;  4Y52 J;  5E1W A;  3S1M J;  1KQ9 A;  5FKK A;  4WCG A;  3J7A Y;  2OUM A;  1W4M A;  3HJE A;  1OFC X;  3W6K B;  3L2U A;  2H1K A;  4DNC A;  2JSC A;  2LF8 A;  3HC7 A;  3EQL F;  3PIO F;  3B73 A;  3LNQ A;  2DMP A;  4A3M J;  4YIR X;  1Z67 A;  5J1U A;  2LNB A;  3BZC A;  4J00 A;  3HOZ J;  2VON A;  2ZC2 A;  3A0H C;  2JK3 A;  3ERM A;  3J7A O;  3BG6 A;  3MCZ A;  3E6C C;  1F36 A;  4XLE A;  2PG4 A;  3LST A;  1IRG A;  3IH2 A;  4P55 A;  5IP9 J;  4XLN F;  1N78 A;  5IOZ A;  3OIO A;  2EK5 A;  2P7V B;  2RNG A;  1MMA A;  4ESB A;  4L9J A;  3OIQ A;  5E3L A;  3DEE A;  5TGT A;  2XVC A;  4HDU A;  1GT0 C;  3OWT A;  3K7A J;  3WTS C;  1FBU A;  5CVV A;  5C4J J;  2O5R A;  2BZT A;  1YYV A;  2OA4 A;  1Y56 A;  5F0H A;  3DBR B;  4RB2 C;  2P6S A;  5K7H A;  2H09 A;  3TO6 A;  3FXR A;  1ENH A;  2HDC A;  4RM3 A;  3TDZ C;  3F6O A;  2CGP A;  1IDZ A;  4ZYE A;  4CXF A;  3LSJ A;  3J80 Z;  2E1N A;  3BPX A;  3F0C A;  3QU3 A;  4U0Y A;  4G7O F;  1FLI A;  2YS9 A;  2R5Y B;  5E8I A;  2AO9 A;  4F93 B;  4AM3 A;  2QUF A;  1WJA A;  4YIF A;  4PUS A;  1YX3 A;  1X1B A;  2W1O A;  5JHF A;  4U0W A;  1ACI A;  4ENN A;  5D8K B;  4Y13 A;  2BBY A;  4RGX A;  1TL8 A;  2EWN A;  1QZY A;  3U21 A;  3FBI B;  1ONV A;  5FLX K;  1ZTR A;  3IAM 2;  1LDD A;  3CLO A;  2KIU A;  2YR2 A;  1OJL A;  1HF0 A;  3C2H A;  3GTQ J;  4A93 J;  2DAO A;  2W00 A;  5J6X A;  2LLK A;  3ASO H;  3SEZ A;  1LJ9 A;  4W1U A;  4XMY A;  4XOR A;  1PP8 F;  3WHC A;  2V1X A;  5DV5 A;  2DA6 A;  3TL4 X;  3S3N A;  1RKW A;  4UB6 C;  3V8K A;  3DV8 A;  3J81 K;  2ME6 A;  4L0Y B;  2RGV A;  2BYV E;  4DW6 A;  4XRF A;  1J59 A;  3KP4 A;  4CO8 A;  3W2W A;  4HDV A;  4KN4 X;  1AU7 A;  5J47 A;  3A02 A;  3ZQG A;  1WJF A;  2Q1Z B;  3EUA A;  1K61 A;  1KQ0 A;  3ZQC A;  4CZC A;  1RKT A;  1MJA A;  2DOE A;  1GLN A;  3KE2 A;  3W2A A;  3CCQ I;  2EV5 A;  1FSH A;  5EGO B;  4L5J A;  4BS9 A;  2OF7 A;  3CO6 C;  2MFZ A;  4E7H A;  4BHP A;  1HOM A;  3TBI A;  1ZHF A;  1K6Y A;  4B4C A;  3Q5F A;  3K0L A;  1LFP A;  2BVM A;  2V1N A;  2UXX A;  3HOT A;  2XAJ A;  4R8H A;  3S93 A;  3VFZ A;  1ZK8 A;  3LFU A;  1OCC H;  1TLH B;  4XLP F;  1FMW A;  1JUP A;  1YLF A;  2IGM A;  1HW1 A;  2JUG A;  4YII A;  3LAJ A;  3AKZ A;  3CUQ C;  9ANT A;  3IWZ A;  1C0W A;  5HLG A;  4BQA A;  5DUI A;  2CSO A;  3OV8 A;  2AS5 F;  1H0M A;  2XF7 A;  4CUG A;  3OYB A;  4UVC A;  2VJ5 A;  3FBN B;  5F64 A;  4AIK A;  1YW8 A;  2XSJ C;  2OCE A;  4C2M J;  1U5T B;  2IA2 A;  2M5W A;  3DPL C;  5DCM A;  3OS1 A;  3T1B A;  4LLN A;  4IOA F;  2DI3 A;  3HIF A;  1K78 A;  2CRG A;  3ZQI A;  2E5N A;  4MNU A;  4P1W A;  4CIC A;  2RAE A;  3F72 A;  2P5L C;  3Q9V A;  2PMU A;  4FET A;  4B3A A;  1UEL B;  2KIM A;  1K7A A;  3HRS A;  2K02 A;  1S5L C;  1DU6 A;  2KPM A;  3GTG J;  2PN6 A;  2LFB A;  1UAA A;  2O3F A;  2QCO A;  4AIJ A;  4OIQ F;  1Z21 A;  2ZKZ A;  1ZQ3 P;  2LY1 A;  3H9G A;  1U9N A;  4D7N A;  5D4R A;  2XB0 X;  2JVG A;  5LD2 C;  3JRD A;  1TWG J;  2LKP A;  2EJR A;  1JTX A;  2O8X A;  4IHS A;  2DT5 A;  3JSP A;  3CCS I;  2ELH A;  3KP5 A;  2HS5 A;  3CP8 A;  3I4P A;  4BBR J;  1H89 C;  3I55 I;  1Z05 A;  1R1V A;  2DBB A;  3ECO A;  4EGY A;  3AG4 H;  3A2K A;  1S8N A;  2VKD A;  1UHS A;  2Q0O A;  5FLX Z;  2J5P A;  4L9N A;  1XCB A;  2NS8 A;  2WY8 Q;  3O6B B;  4KNY A;  4LG0 B;  2MD0 A;  1P2F A;  3Q3S A;  1QU3 A;  2AXT C;  3H5R A;  4AYB A;  1WSU A;  1R4M B;  3CMY A;  3PSI A;  1YRN B;  1KGS A;  1ZAR A;  1P4X A;  3DKX A;  2HDD A;  2VL8 A;  1G59 A;  3PM1 A;  2O6G E;  2LD5 A;  2NNN A;  5IT9 K;  1VQ4 I;  1Y8R B;  1PJR A;  2ESH A;  2X1E A;  3VYT B;  4G94 A;  3LSR A;  5B1A H;  2R7V A;  1TTY A;  3MEX A;  4M73 A;  2QWW A;  2XAF A;  1Z6R A;  1MH3 A;  4PJJ A;  5F6F A;  1WI9 A;  3HZJ A;  5FLM J;  2K9M A;  1ON1 A;  2ZJ2 A;  3S32 A;  3ZQF A;  4IO9 F;  1MNE A;  1R9T J;  2HKO A;  4F3Q A;  4C2U A;  3CJT B;  1E3H A;  3L2C A;  5DUK A;  2ECC A;  4Q48 A;  1B72 B;  1K83 J;  1NG6 A;  2FOW A;  3R61 A;  5D8L B;  2YUS A;  1PP7 U;  4Q4Z F;  1ULY A;  4ENK A;  1TWH J;  2Z3Y A;  2LY9 A;  4N0B A;  1YJN I;  3DKY A;  2UUZ A;  2CJJ A;  4A3I J;  2HOS A;  4PJM A;  2K9N A;  3N97 A;  5GAD J;  2D5V A;  1S29 A;  1QQI A;  3HBL A;  5HVQ C;  3ERE D;  2VLA A;  4PSX A;  3TW6 A;  4FE7 A;  5IY5 H;  3HKZ A;  3SFI A;  3T8T A;  3DCF A;  3WG9 A;  2DFE A;  1BI1 A;  5K5R A;  4U88 A;  5AON A;  4IHT A;  1YG2 A;  4L9T A;  4QLC U;  1O4X A;  2Z33 A;  1R49 A;  4XLC A;  5CVU A;  4IL6 C;  2XF5 A;  1MGT A;  2EPF A;  1OYW A;  3E6D A;  4A0Z A;  2X48 A;  1EA3 A;  2CFO A;  3F8M A;  3VYU B;  1QA6 A;  2LKS A;  4XKB A;  1W0T A;  2FOK A;  4MEX F;  1GHC A;  3KEY A;  1MBK A;  2EZI A;  1J9I A;  1SFE A;  2EZH A;  4XN3 A;  3ROU A;  5M3M J;  2DA4 A;  1AA7 A;  2VKH A;  4FX0 A;  2QQB A;  1VND A;  3BRO A;  2DMT A;  3DU6 A;  1R4N B;  3RPU D;  2JVH A;  1B9N A;  2WB1 A;  4I0B A;  3VDX A;  1STZ A;  3RKX A;  3GUD A;  3CDL A;  4DBQ A;  2A61 A;  3IP4 B;  2W25 A;  3OL4 A;  4BHC A;  3CF5 F;  2LY2 A;  2M4K A;  2KDO A;  3ZXS A;  2CV1 A;  2WAQ A;  2QA4 I;  3BT9 A;  3HOW J;  1R7J A;  5JVT A;  3QOP A;  2DQR A;  2V6E A;  2FNP A;  2OQG A;  1B4A A;  4C2T A;  2BW3 A;  1PVE A;  1TQI A;  3CCL I;  1CF7 A;  2TDX A;  4KIB A;  4RGU A;  3E3V A;  2M3A A;  2DCE A;  4Y7N J;  2HZT A;  3D5R C;  3K2A A;  4RB1 A;  3WU1 B;  2W84 A;  2P5V A;  4BE1 A;  1XDU A;  2GAU A;  4XL9 A;  2STW A;  4D5C A;  3MKZ A;  2OTL I;  3CLQ A;  4O5V A;  1UJ8 A;  2XHK A;  3COA C;  4L18 B;  4AIH A;  2DK8 A;  5HDK A;  3CJQ B;  5EZG A;  2K4B A;  3K4B A;  4Q47 A;  5DM6 F;  2QKL B;  2Z16 A;  4TV7 A;  2HVS A;  2DDA A;  3CCV I;  2K9S A;  1FPQ A;  3HOS A;  5EZH A;  2CO5 A;  2CS3 A;  3D5S C;  2JPB A;  2PMH A;  4IVN A;  4XKC A;  5LLQ A;  2DTR A;  2IJL A;  2A07 F;  3P9K A;  3IWF A;  4F55 A;  3HUG B;  4XRS A;  4II3 A;  4HNV A;  1Y0N A;  4M3F A;  1FMV A;  3NQO A;  4HZF A;  2BEO A;  5H20 A;  3OYJ A;  3L2Q A;  2ZJQ F;  3WTW C;  3HDD A;  3IUO A;  2JQ7 A;  2K40 A;  1T6S A;  1W5S A;  5HS7 A;  4YRV A;  1F1Z A;  5KNL A;  2HI3 A;  1ZH5 A;  3F8F A;  4X6A J;  1ZR2 A;  2ZXW H;  4NQW B;  4BEH A;  4IOC F;  1WJ5 A;  3M07 A;  1X3W B;  3FKI J;  1LEA A;  3ECH A;  1D5V A;  3DQV C;  1MBJ A;  1DGR M;  4YEJ A;  4ZH4 F;  4C30 A;  1JKO C;  1U0J A;  3F23 A;  2FJ1 A;  1XGS A;  2COB A;  4M9S A;  4RB0 A;  3GTK J;  1MNM C;  2QQ8 A;  2Q2E A;  2KJB A;  3SYT A;  3RPQ A;  2IA0 A;  4A3D J;  2L9S A;  3A03 A;  1XPX A;  1KQ8 A;  4IF4 A;  1GXQ A;  2HYJ A;  1T0F A;  3A01 B;  2CQN A;  2XAH A;  3VSL A;  4A6E A;  5ICC A;  3HB9 A;  1W36 D;  4OMY A;  2MBF A;  4E7S A;  2BE5 F;  2CW7 A;  3QU6 A;  4OIO F;  3ZMV A;  1X1P A;  2WAD A;  4HF2 A;  1D0Z A;  1KU7 A;  1H9T A;  4HLY A;  1ZRD A;  3TP0 A;  1JGS A;  2DMU A;  1TWC J;  2ZFU A;  1WJB A;  1LE8 A;  4FT8 A;  1E0E A;  5EG0 B;  3RYP A;  2FML A;  3EYY A;  1TWF J;  3M7G A;  4D5F A;  1SD7 A;  2YSR A;  1OCZ H;  3HL2 A;  2M8E A;  2NYX A;  1K6O A;  4UV8 A;  3BTJ A;  5FKM A;  2JRT A;  5IPA A;  3FM5 A;  3K4K A;  5HLH A;  2ICW G;  1V3F A;  4G6D A;  3OYI A;  3DP7 A;  4QWQ A;  2PJR B;  2HXO A;  3K4N A;  1E3O C;  2UV1 A;  4D1Q A;  2DU9 A;  1EH8 A;  2KJC A;  3DBL B;  3BR3 A;  2PEX A;  3NRV A;  3ZMT A;  3A1Y A;  4I02 A;  3IKT A;  3L1P A;  1J7K A;  1HKS A;  1VF9 A;  1RPW A;  1YI2 I;  4NC7 A;  2JA8 J;  3ABM H;  4NUB A;  1G8X A;  1ZRE A;  4YFK F;  1AOY A;  1DP3 A;  1AKH A;  5GTH C;  2DA7 A;  5D5U B;  1FBQ A;  2ZSI B;  5J8F A;  2ZCW A;  1YFH A;  3CMA I;  4QIW N;  1U8R A;  1PUF B;  2YX7 A;  1WRJ A;  3NAR A;  4E7K A;  3H9Q A;  3JRC A;  3LSI A;  2ZXH A;  2KP6 A;  2LF7 A;  5JVG F;  1BC8 C;  2VOP A;  2E1C A;  4PSW A;  5GAG J;  2D2W A;  4N9H A;  4HX7 A;  4JOM A;  2B63 J;  1NHA A;  2LP0 A;  1QNT A;  1V5E A;  2ZME A;  2H8R A;  4RA2 A;  1P4A A;  1JI8 A;  4ZYG A;  4UV9 A;  3FIS A;  3P5J A;  3BQZ A;  3ZRG A;  2PFB A;  4I76 A;  2ZME C;  2M87 A;  1FBS A;  4BU2 A;  4PGG A;  1MDM A;  1P92 A;  1YW9 A;  3DFG A;  1ITY A;  5TIS C;  4LB5 A;  2QQ9 A;  4JX5 A;  3RPU A;  2QEN A;  2JPC A;  1XSX A;  5M3F J;  1ZG5 A;  1XN7 A;  3PJR A;  4IXA A;  4BAY A;  1JUM A;  1W0U A;  1HSJ A;  1J09 A;  2K5C A;  2W85 A;  4LJZ F;  4L0Z B;  2XV4 S;  3QPS A;  1LDK B;  2UZK A;  1ODD A;  4ABZ A;  4XOP A;  5E18 F;  3DLL F;  5JR3 A;  3PUB A;  1I6X A;  3WE3 A;  2HQ5 A;  4RM2 A;  4Y3O A;  3MAJ A;  2ID3 A;  2G7U A;  2L3D A;  3BG7 A;  2V4J C;  3FF5 A;  1ON2 A;  1MSF C;  4CHU A;  5KAI C;  3M1E A;  1L0O C;  5HNH A;  1NG7 A;  4CCM A;  2M8G X;  2BGC A;  2BY1 A;  4UXN A;  5IYD J;  1B8I B;  2GWR A;  3HEF A;  5E3M A;  4IKF A;  1GVJ A;  2E2J J;  4RBO A;  3H9J A;  4RLQ A;  5IP6 A;  1A31 A;  2RDP A;  1FJL A;  5HLI A;  2VXD A;  1DQU A;  3KP6 A;  4BJT A;  1X1C A;  3W2V A;  2JTV A;  1W5C C;  2LG4 A;  2ESN A;  5LRR A;  2V1D A;  1XD7 A;  3BR2 A;  3EUH C;  3BZK A;  5GAH J;  2XGE A;  3WTU C;  5DD8 A;  3HTS B;  1S7O A;  2IA1 A;  4KMF A;  1DDN A;  3S17 J;  4DYR A;  1QZE A;  5KK1 A;  1I50 J;  1SFK A;  2KIQ A;  2G9W A;  1RES A;  2DA5 A;  2RQQ A;  1T2K A;  4IJA A;  3I59 B;  4A12 A;  2MH2 A;  1X1D A;  4IEJ A;  4CYC A;  1MBH A;  2JMW A;  2ELJ A;  3P7N A;  1BW5 A;  1GV5 A;  2IVM A;  4WX9 A;  1KYW A;  2CMP A;  1KYZ A;  2E71 A;  1D1C A;  3PL8 A;  4XM3 A;  2Z5U A;  1HLV A;  1HQC A;  2VJJ A;  2KRF A;  4ZJZ A;  2QBY B;  3H36 A;  2EZK A;  4MTE A;  4A5M A;  3GFI A;  3KP2 A;  1IW7 F;  2A6E F;  2NS7 A;  1TC3 C;  4XQF A;  1UST A;  5JI6 A;  2IPQ X;  4PJ0 C;  3I4M J;  2RKH A;  4AYB N;  1CQT A;  5CVJ A;  2YX4 A;  3GBG A;  1MMN A;  2DA3 A;  1WCM J;  4LMY A;  4V2G A;  1GDT A;  3PIP F;  3OIP A;  3JRH A;  4ZTF A;  2HFH A;  1RUO A;  2LC2 A;  5JFR A;  1BI0 A;  4JYK A;  4LIU A;  3SEQ A;  1W36 C;  2Y69 H;  3U1K A;  2L9R A;  2IS2 A;  1Y1W J;  1JKR C;  2F5E A;  2F5F A;  1YJ9 I;  1T38 A;  2A6T A;  3H3V K;  2JSP A;  2V26 A;  1V55 H;  3LQQ A;  2EBI A;  4FQG A;  3QRF F;  4MLO A;  4OAY A;  2YU3 A;  3JRE A;  4ENM A;  2V1U A;  3AG2 H;  2A05 A;  2F5C A;  4B43 A;  3QPH A;  3VEP A;  4BJ6 C;  2GBY A;  4XIC A;  5H6R A;  2RN7 A;  4NBQ A;  4PJN A;  3CCU I;  4M6X A;  2XRO A;  1IRF A;  1Y0U A;  4DZJ A;  2XIG A;  1MMS A;  1LDJ A;  2M45 A;  2F4I A;  3VB2 A;  4BXX J;  2CV0 A;  2IGN A;  3Q0W A;  3SJM A;  3TOA A;  1XSD A;  1ZN2 A;  4AID A;  1HC8 A;  5E20 A;  2W24 A;  4NHJ A;  3Q0U A;  1XB4 A;  2VBZ A;  1IRZ A;  3DU5 A;  3HKZ N;  2QF7 A;  4U87 A;  3BR5 A;  1WI3 A;  2H6C A;  3KPH A;  5F0F A;  1KU9 A;  1ZLK A;  3JRA A;  2F48 A;  4X0G A;  1ZGJ A;  2O8K A;  2CYY A;  4HSR A;  4PGH A;  4V19 K;  4A3B J;  1Y1V J;  1J2X A;  1POG A;  5ED4 A;  3OYD A;  5E1X A;  4ZYD A;  5DDG A;  1O3Q A;  1J75 A;  5ICF A;  3HRU A;  4OIR F;  4RAG A;  1YIJ I;  3SZP A;  3C2B A;  3TMO A;  4M3E A;  3DTI A;  3S2D J;  2E19 A;  3O8G A;  3RKQ A;  4RS8 A;  5J8C A;  2DXI A;  4UVB A;  1E3P A;  3I5U A;  4EJO A;  5ILV A;  1RNL A;  4HLX A;  3FXJ A;  1D1A A;  3H5N A;  4BL0 B;  4GGG A;  5L3G A;  3HHH A;  4JP0 A;  3MVP A;  3QWL A;  4MQV A;  4AVZ A;  5HDN A;  1A36 A;  3UKG A;  3M9A A;  4M6V A;  1TP4 A;  1WZ2 A;  1FIP A;  2CWE A;  2WAQ N;  5ICG A;  3DEW A;  4A0X A;  1NH3 A;  3KET A;  4MGR A;  4KN7 X;  4GDF A;  2L7K A;  1Z0X A;  4AUX A;  1BR4 A;  3FIW A;  2E60 A;  3FHN A;  1XGM A;  3MKL A;  4G6T B;  4YFN F;  4GRI A;  3L2W A;  1IC8 A;  1X19 A;  3T0Y A;  2V79 A;  3WGH A;  3QOD A;  4ZC3 A;  2Z99 A;  4AWX B;  3M1C A;  2DJN A;  5LBQ A;  1DPU A;  2CQX A;  3ZMU A;  4WWC A;  1I1G A;  3QYF A;  1KA8 A;  5CQE A;  3KLO A;  3LSM A;  4WXC A;  5GAE J;  1IAW A;  1WWX A;  3GYH X;  3HSR A;  3E6M A;  4E7Z A;  1K78 B;  2FBI A;  1W7P B;  2K4J A;  2FMY A;  1Y8Q B;  2CFX A;  1REP C;  2KT0 A;  4X1E A;  1JXS A;  1K79 A;  5FFZ A;  3RI4 A;  1I6H J;  1X1A A;  3SZG A;  1E2X A;  2PBI A;  3U2R A;  3DKW A;  4E70 A;  1SEU A;  2E34 A;  2IAI A;  2QVO A;  2HYF A;  3JW4 A;  2VT3 A;  3RQI A;  2GXB A;  2KMU A;  1CGP A;  3HOX J;  5CVI A;  3G71 I;  2R0Q C;  4ENJ A;  4R1H A;  3KP3 A;  3MZH A;  4XSX F;  2R7F A;  5E17 F;  2CUE A;  1HBX G;  1XTA A;  3LL7 A;  2A68 F;  2AXL A;  3CUQ A;  1W5T A;  1GV2 A;  2FD5 A;  3BR6 A;  4BNC A;  5LFA A;  3HG9 A;  1UHW A;  2EIL H;  3OSF A;  3JCU C;  1IZ1 A;  2FEZ A;  4I2O A;  1T56 A;  3HYI A;  5EEA A;  2CUF A;  4HQE A;  2MLK A;  3CCJ I;  1T98 A;  2EH3 A;  1R1T A;  2STT A;  3DF8 A;  2VQG A;  2L7F P;  2XF6 A;  3PUF A;  2HU9 A;  2XRN A;  3R0J A;  3T8R A;  4BKX A;  1TWA J;  5LRS A;  2WA0 A;  2FQ3 A;  4HST A;  2L54 A;  1SFO J;  5J1R A;  4KT5 C;  1SD4 A;  3KEO A;  1GVD A;  1ZAO A;  3MKW B;  4G8X A;  4CGZ A;  3JR9 A;  1G3Y A;  3H92 A;  3S1R J;  4ZDO A;  2WBM A;  1D8K A;  5DD4 A;  3V7R A;  1WJC A;  1Z7U A;  2X1D A;  3BTC A;  3HRT A;  4M3D A;  4KIS A;  1UFM A;  3GTL J;  5M5W J;  1RR7 A;  3O2P E;  2KRH A;  3HGG A;  4L9V A;  2WY7 Q;  2AQE A;  1VQK I;  4QPO A;  2MYS A;  4B8X A;  5FKO A;  2PJP A;  1X3U A;  2GXG A;  3JTG A;  4G9Y A;  1ETO A;  1U78 A;  4DOZ A;  2R5Z B;  2G0E A;  4OMZ A;  2JA7 J;  4RAY A;  3SHF A;  2VQL A;  3H3U A;  2AHQ A;  4KJZ A;  3WE2 A;  4UUS B;  3GTO J;  4DJA A;  5FRM A;  3T5X A;  2VQC A;  3U1D A;  3L00 A;  3LFK A;  4ZYH A;  1UG0 A;  3RDI A;  1R5I D;  3QPL A;  5DM7 F;  5EGO A;  4PJL A;  3M3Y J;  3ASN H;  1TT5 B;  3GFJ A;  1J5Y A;  4HQM A;  4ON0 A;  2DN0 A;  1BM9 A;  1RI7 A;  1VQM I;  1IG7 A;  2VE9 A;  3J81 Z;  2DDB A;  3LSK A;  3SQN A;  2IW5 A;  3KZY A;  3F22 A;  4AVP A;  1XGN A;  1PDN C;  3F8B A;  1U9O A;  1FX7 A;  3B02 A;  4KIG A;  3VOD A;  2R7X A;  2R7Z J;  4RGR A;  1G3S A;  4XR6 A;  5M5X J;  2FNA A;  4QPQ A;  4XSZ F;  3ZQL A;  2IRF G;  4OIP F;  4E7I A;  5FRN A;  1I3A A;  1IN8 A;  2VIX A;  3GZ5 A;  1LVK A;  1YS6 A;  3SXY A;  1U5T A;  4A3J J;  3GEZ A;  1Z3Y A;  3EUK L;  1MJB A;  1U5T C;  1YIO A;  1ZG3 A;  2LTP A;  1LQ1 A;  1YW7 A;  2BHZ A;  3TDU C;  2BVL A;  5KAF C;  1QO0 D;  4EGZ A;  4GCV A;  3IRQ A;  3E5X A;  4BE2 A;  1OCT C;  5FO5 A;  1FP2 A;  2A3S A;  3ZOB A;  4K2E A;  2COM A;  3BWG A;  2L02 A;  2L2O A;  3I56 I;  2NXN B;  2Y31 A;  4XLF A;  3S15 J;  5FRO A;  1IGN A;  5FKN A;  4PK4 A;  1S72 I;  1QPI A;  2QEX I;  4NC8 A;  3TQN A;  4EV0 A;  3LMM A;  4MQ9 F;  3CDH A;  5J4Y A;  5GTI C;  1IV8 A;  4YEL A;  4HEA 2;  3C3W A;  2FBK A;  2EV6 A;  2P4W A;  3WGG A;  3RJP A;  1ZRF A;  2X6Y A;  3F6V A;  2VI6 A;  1VQ8 I;  2NNY A;  3U9G A;  3BJO A;  1IN4 A;  2Y30 A;  2DOD A;  2EIM H;  1SMT A;  4I01 A;  2VB6 A;  4LG0 A;  4XNF A;  3V7S A;  2E5Z A;  4U0V A;  1MIJ A;  5HOD A;  2LRE A;  1N75 A;  1IUY A;  5F1R A;  4IRH A;  3KYL A;  2IXS A;  1YRN A;  2W57 A;  4ANJ A;  3MFK A;  1SVO A;  3G1O A;  1A35 A;  3HOU J;  1F4K A;  4F52 A;  4A3F J;  3I0T A;  5J40 A;  2HYG D;  1IO2 A;  2I5U A;  5CYV A;  3OR1 C;  3FM3 A;  3J7Z I;  2DOA A;  3ABL H;  1HW5 A;  4U7B A;  2H27 A;  4BY7 J;  2VOD A;  4G7Z F;  2WV0 A;  2VXZ A;  3FMR A;  4M9X A;  4B44 A;  2FSW A;  3ZN1 A;  3KIO A;  2QSG X;  1BOB A;  2VUM J;  4XRM A;  3Q9S A;  5CQG A;  2EA2 A;  1H8A C;  1WGX A;  1A5J A;  2EZL A;  3C2G A;  4FCY A;  4MFE A;  4A69 C;  4FAS D;  3KP7 A;  1BIA A;  3ZQQ A;  3GXO A;  4DYC A;  4I7H A;  3OL3 A;  1VQ6 I;  1D1B A;  5IT9 Z;  4M3B A;  5IP7 J;  1U3E M;  2J5O A;  3CP2 A;  3D5L A;  3GFM A;  2NVY J;  2HEO A;  1RZ4 A;  1Z77 A;  1BL0 A;  4BXF A;  1OCO H;  1T8I A;  2X6X A;  2QM3 A;  1QRY A;  2HQN A;  4FTH A;  2DYS H;  2HVR A;  1DUX C;  2OTJ I;  2P5K A;  4M3G A;  2DMQ A;  4N9I A;  3FXO A;  4RAF A;  2VJ4 A;  4A5N A;  5B1B H;  4IHW A;  2VPR A;  5LHG A;  4ESJ A;  1VQO I;  1JT6 A;  4PFP A;  4RAZ A;  2GLO A;  1OCR H;  3V8L A;  2FUG 2;  3P9C A;  1MJ9 A;  1U6G A;  2ZO4 A;  1YS7 A;  2ETH A;  2F4O B;  2FRH A;  3VYR B;  1FYL A;  3HOV J;  3I58 A;  2BY3 A;  2LH9 A;  2Y2Z A;  2HVQ A;  3LQR A;  1RR8 C;  3BC8 A;  5BPD A;  2EIK H;  3IAS 2;  5CKT A;  3I3L A;  2JT1 A;  2LSO A;  3M8J A;  3SDB A;  2MGQ A;  2Y75 A;  2R93 J;  3TGN A;  3KCC A;  4OU0 A;  3R0A A;  4LB6 B;  1VFC A;  2D1V A;  2L0K A;  2LMD A;  4BY1 J;  2RNJ A;  3DPT A;  1BN5 A;  2CQQ A;  1TBX A;  3F8N A;  1QHH D;  2IGO A;  2KZG A;  2IS1 A;  3GW2 A;  3JRG A;  2JA6 J;  2I8D A;  5E1Z B;  4MTD A;  1AKH B;  5CVR A;  2IP2 A;  4EJU A;  2X6O A;  1TT0 A;  2D1H A;  3GTJ J;  1WFX A;  3K10 A;  3BG5 A;  4KIC A;  4ASN A;  4F92 B;  4Y17 A;  5IT3 A;  4P96 A;  1O3R A;  1FC3 A;  1EJ9 A;  2X9D A;  2DO7 A;  2LVS A;  4LGW A;  1J0R A;  5F1J A;  1VQP I;  1ORK A;  2B0L A;  5ILS A;  1EF4 A;  5J1Y A;  1AWC A;  3K2Z A;  4HF0 A;  2FBH A;  2R7D A;  1VQL I;  2VKE A;  1IXS B;  3MWM A;  2LBF B;  4Z6Y A;  2DJI A;  3A0B C;  1D8J A;  3FDY A;  3MQ0 A;  2IGK A;  2Y0S A;  4B09 A;  1FOX A;  2M34 A;  4CCO A;  3CCR I;  1R36 A;  2JA5 J;  1IXC A;  4IPA A;  2DFF A;  2MD5 A;  2A69 F;  5EEG A;  2HOT A;  1JJ8 C;  2IS4 A;  3WTZ A;  4HG2 A;  4EEF G;  1BOA A;  3DTE A;  3BPV A;  3HUG A;  2KLO A;  4J01 A;  1QVU A;  3D0S A;  1D0X A;  3GX4 X;  1X3Z B;  3I9V 2;  2DW4 A;  2NOG A;  1LPQ A;  4CCJ A;  3B6A A;  3CTA A;  4E6K G;  1IJW C;  1P4W A;  3CUO A;  3ZR8 X;  3PO3 J;  4Y33 A;  2V7F A;  2CW8 A;  2DMN A;  2OZ6 A;  5C4X J;  1Z7L A;  3N05 A;  3E6B A;  2PLY A;  1JTY A;  1MZB A;  4M6Y A;  4NQW A;  5D6F A;  3RKY A;  4BXU A;  1TNS A;  3V42 A;  2R7W A;  1BBY A;  1S9H A;  1U2W A;  4I09 A;  4QTR A;  1MMD A;  1Z3X A;  3OOU A;  2YPR A;  1QPM A;  2VQH A;  5IYC J;  3S1Q J;  3L7W A;  2CQ7 A;  1XMK A;  2Z2S B;  5B5E C;  2W7N A;  4Z2Y A;  3FXK A;  5L3D A;  5ILU A;  3WTT C;  4XN0 A;  4B3X A;  2FU4 A;  2QKM B;  2R7R A;  3A01 A;  3TO9 A;  2QSH X;  1SVL A;  2K7L A;  4A3G J;  3CES A;  3OOP A;  5E3O A;  4NB5 A;  1AHD P;  1MSE C;  4GFB A;  3F9K A;  2H8W A;  4LD5 A;  5H6Q A;  3PSF A;  3JSO A;  1LKX A;  2VT2 A;  4HX4 A;  1FWZ A;  1WVR A;  5BNG A;  3DWL E;  5A2Q K;  3G3Z A;  1DPR A;  3Q0V A;  3CJN A;  3AL0 B;  2XRL A;  1BR2 A;  2E1O A;  3S14 J;  5E3N A;  5EG0 A;  1UZC A;  4ZZD A;  2M7A A;  1FIA A;  1FOY A;  1K4T A;  3GME A;  1IN5 A;  2JZY A;  4C9Y A;  4JQF A;  4YG2 F;  1FOK A;  3BCB A;  1Q1H A;  2G7H A;  3C1D A;  3KYD B;  2E1M B;  1MBF A;  1X58 A;  2LR8 A;  2QQA A;  3HOY J;  2K3P A;  1O7L A;  1UG2 A;  2PJR A;  3OYF A;  2K86 A;  1Y6I A;  2DT6 A;  2VJI A;  4HF1 A;  5DTD A;  5DCF A;  2XAS A;  3GWZ A;  3OYE A;  5AIQ A;  5K5Q A;  3EUH A;  2GOM A;  2K85 A;  2HDW A;  1PUF A;  3KLN A;  5CLS A;  1Q1V A;  4CDG A;  1Z91 A;  1OIS A;  2GM4 A;  2HOE A;  1KU2 A;  1WPK A;  4XLH A;  2EFN A;  1SD6 A;  3RQ4 A;  3DXJ F;  3I54 A;  2ZJP F;  4ITV A;  3K1N A;  1K4S A;  2L4A A;  3ULQ B;  3DLA A;  2DQL A;  2M0C A;  1VTN C;  3CCY A;  4H4K C;  3JRF A;  1XMA A;  5GP9 A;  2QGU A;  4Y15 A;  2X1C A;  1FOW A;  5K7F A;  1RUN A;  2UXN A;  1WKM A;  4EM0 B;  2BOL A;  4XRS G;  1G6N A;  2OPT A;  5C3E J;  2M2E A;  2ZB9 A;  3E7L A;  2HZD A;  4BQN A;  2R7O A;  3K70 C;  1G4D A;  2EIJ H;  2MW8 A;  3MZY A;  1V5G A;  1N77 A;  4PDK A;  1FSE A;  1TNT A;  1D3Y A;  2PMZ A;  1IRX A;  1R58 A;  1IXR C;  2DK5 A;  2W82 A;  1FYM A;  4CH7 A;  2E2H J;  1OYI A;  1YJW I;  2Z9O A;  1OQY A;  1OR7 A;  2GXA A;  4L5I A;  1ETX A;  1MND A;  3J80 K;  2A5Y B;  1X4O A;  1OPC A;  4M72 A;  1OR7 C;  3CZ6 A;  3N4M A;  2N8G A;  1ZGW A;  1YX5 A;  2FA5 A;  3REO A;  5ICE A;  1P9Q C;  2EV0 A;  1B8I A;  3CCM I;  2XKP A;  3W3C A;  4BBS J;  3FX3 A;  1QBJ A;  2M4G A;  3V4G A;  3E5U A;  1I5Z A;  1YE9 A;  4R79 A;  1R23 A;  1HA8 A;  5LGN A;  4MHG A;  5A2Q Z;  2X6W A;  3C7J A;  2AQF A;  3GLL A;  1XS9 A;  3CD6 I;  5HS9 A;  2UWM A;  3CJR B;  4XOT A;  1MBE A;  1S6L A;  5LHI A;  4S04 A;  5ERI A;  3BQY A;  3KZZ A;  2CG4 A;  2VAS A;  4IHV A;  3G1L A;  3H0G J;  5BQT A;  2WC2 A;  1OYY A;  3M8E A;  2VE8 A;  4LLL A;  3PNY A;  1LNW A;  1LFB A;  2KFD A;  2O03 A;  1ZG1 A;  5HS8 A;  3IHU A;  3TOB A;  3I59 A;  2ZXI A;  1W1W E;  2MLG A;  3LA3 A;  1XDS A;  5FB2 A;  2ISZ A;  3I64 A;  3E97 A;  4G12 A;  3ZCO A;  3KZI C;  3R4K A;  2ADU A;  1B59 A;  1NK3 P;  2GZW A;  4II2 A;  4KIT B;  2XPV A;  2MAB A;  4U7D A;  2F5V A;  5IYB J;  2QBY A;  2TRT A;  2WAF A;  1FYK A;  3BTL A;  4BYY A;  1ZRC A;  3IH3 A;  2DFI A;  4BHB A;  5JLX A;  3ZN0 A;  5L3C A;  3BG3 A;  1I39 A;  5J3L A;  1T39 A;  3L2V A;  1P6R A;  1DGW Y;  2H94 A;  2RRE A;  1LVA A;  4WF2 A;  2DOF A;  4S05 A;  1OCP A;  1APL C;  4HPQ A;  1OLT A;  1XG1 A;  4EJW A;  3OYG A;  1LFU P;  4EQQ A;  1UCR A;  3L2R A;  2WB1 N;  4F7Z A;  2BV6 A;  1HCR A;  5C44 J;  1B1B A;  2MC4 A;  3FMS A;  2XPW A;  3SZT A;  2CUZ A;  4A2U A;  2NVQ J;  1DP7 P;  2M9H A;  4FIS A;  2M0M A;  1TQM A;  4BDY A;  3K4L A;  3IH4 A;  3WTV C;  3WU0 A;  1X4P A;  2X51 A;  2V9V A;  3CUQ B;  2RQP A;  1KON A;  1N25 A;  1YOV B;  2HGC A;  1SMY F;  2KRC A;  3LWF A;  3KFW X;  4FE4 A;  3FXQ A;  4WXH A;  2IBD A;  2FX0 A;  3VPR A;  2MA3 A;  2XDV A;  3S8P A;  2EFW A;  3NWT A;  1U8B A;  1S3J A;  4KIF A;  1YHQ I;  4EVI A;  2LKX A;  3C18 A;  2DLL A;  2CV2 A;  5M5Y J;  1XX5 A;  3VWB A;  4D0P A;  5D5V B;  3M4O J;  1VQ7 I;  1V54 H;  3LSG A;  3FXM A;  5DCM B;  5B66 C;  5FJ8 J;  2M30 A;  5H2F C;  1ZYR F;  4HAM A;  1RET A;  2DPU A;  1BI2 A;  4NDL A;  4CCK A;  2E7X A;  3M8F A;  3R60 A;  4BQQ A;  1V4R A;  4UNO A;  4E7L A;  2JWT A;  1HKQ A;  2M7B A;  2OC6 A;  3I53 A;  1HKT A;  5KVR A;  2L7M P;  4KMU X;  1FEX A;  5LGU A;  2DA2 A;  4M9Z A;  4G7H F;  3BY6 A;  3CME I;  3QPT A;  3P9I A;  3LOC A;  3AAF A;  2FE3 A;  2VBW A;  3ELK A;  5LGT A;  3GZN B;  3UNG C;  1VQN I;  4DZP A;  3OYA A;  1LUJ B;  3BJ6 A;  1BC7 C;  4I99 C;  2XAU A;  3JRI A;  3QYB A;  5E79 C;  1R71 A;  1IN7 A;  1BJZ A;  3W6J B;  2GOX B;  4I0A A;  5EYR A;  4XKV A;  4KUM A;  3ISP A;  3QP5 A;  5AIP A;  1ETQ A;  2R5Y A;  3HHG A;  3BP8 A;  2MG4 A;  2OBP A;  2X85 A;  5BS6 A;  4IZZ A;  2E2I J;  2A5W A;  2HQR A;  3TKY A;  1JHH A;  6PAX A;  4LIT A;  3S2W A;  3J7Y J;  1TW3 A;  2D45 A;  2O61 A;  1F9N A;  4PFO A;  4UB8 C;  4OIN F;  4PCQ A;  3K1M A;  5K5O A;  3OS2 A;  3BJA A;  3GLX A;  2CW0 F;  2HXI A;  2K9L A;  1FZP B;  3H5A A;  5LHH A;  5BMZ A;  5L3B A;  3FZV A;  1TW2 A;  2XAQ A;  4ZZL A;  2EFP A;  2CU7 A;  1DU0 A;  2E35 A;  3CMM A;  4NNJ A;  3ABK H;  3CC2 I;  2ZBK A;  2VC1 A;  2ID6 A;  2HTJ A;  5CPR B;  1NTC A;  3LA7 A;  3ZP5 A;  2RC4 A;  1FP1 D;  2NVT J;  1W7P A;  2JRM A;  4WXD A;  2Y0S N;  2LYC A;  3CDI A;  4P9U A;  3OS0 A;  4Q5S F;  2PI0 A;  2Y9Z A;  1HXD A;  4M71 A;  5TRD A;  3RZO J;  3WG7 H;  3FMQ A;  1MW7 A;  2PQ8 A;  4IQ4 A;  1G3T A;  1HST A;  3S16 J;  2NS0 A;  2QSF X;  3LSP A;  4RB3 C;  1XMX A;  1ZLJ A;  2KHM A;  4IQJ A;  1RIO H;  3EDP A;  3ZQ7 A;  5BPI A;  3TP3 A;  5EF6 A;  4IRG A;  1UHM A;  3BCA A;  2K3F A;  2XGD A;  2B7E A;  1RC9 A;  1ERD A;  2P6T A;  3R6S A;  1NK2 P;  3MD2 A;  3CF2 A;  4HV6 A;  3GCM A;  3OR2 C;  1I1S A;  1FTZ A;  3IC7 A;  1MBG A;  3VYS B;  4ETS A;  4BGD A;  4RDU A;  2KIS A;  1R5G A;  4PZJ A;  1MD0 A;  5EEH A;  4EJT A;  3H3Z A;  2JJ7 A;  2P81 A;  4S0H B;  1E17 A;  1R00 A;  3FXU A;  1MMG A;  2OU2 A;  3RKW A;  4A6D A;  1O7F A;  2W4S A;  1SAX A;  3EYI A;  4A3C J;  4IHX A;  1IDY A;  4HNT A;  2WV1 A;  3NAU A;  1SAU A;  3VOE A;  5L3F A;  1VQ9 I;  2ACJ A;  1JUS A;  3JRB A;  1PYV A;  1BJA A;  4LG3 A;  1Z9C A;  2NOJ B;  3CQZ J;  3QP6 A;  2BW3 B;  4ZYA A;  2HQA A;  2OCC H;  2M1B A;  5D6E A;  4HNU A;  3G6E I;  1CF7 B;  2V9K A;  3HPH A;  2R7T A;  1JJ6 C;  2R7U A;  2Q8K A;  1MKM A;  1I27 A;  2GQQ A;  3GFL A;  3WOD F;  5FGM A;  4BJ5 C;  1JE8 A;  3K69 A;  3CC7 I;  2GIZ A;  2R5Z A;  2X4H A;  2ISY A;  2L9N A;  3K6G A;  1QHG A;  3S3M A;  4UUS A;  3HSF A;  2NRA C;  1D5Y A;  2B9S A;  2BXZ A;  1S7E A;  5BOX A;  1KU3 A;  1BW6 A;  3NEU A;  3S3O A;  4RGS A;  1BI3 A;  3QOE A;  2BHY A;  4N4O B;  4EM1 A;  2P7C B;  2EB7 A;  2HPI A;  5F08 A;  4A3L J;  2FXA A;  2LK2 A;  2XGC A;  4MIM A;  2CUJ A;  3OYL A;  2Z1D A;  3DTK A;  2A6H F;  3I4N J;  3G1M A;  1HW2 A;  2BY0 A;  2L7Z A;  3GO5 A;  4JK1 X;  4I6Z A;  2K27 A;  4F91 B;  1BIB A;  4XBF A;  2KQR A;  3ESW B;  3S1N J;  1SC7 A;  1ETV A;  3OMY A;  2GA2 A;  1WH7 A;  2VBY A;  4A3E J;  3G73 A;  2GIV A;  2XC7 A;  3OYC A;  3GVA A;  4BEH B;  4FX4 A;  3TED A;  3RSN A;  3ZMS A;  1OMI A;  1L3L A;  2XUB A;  4GXO A;  5K7Z A;  4C3H J;  1B72 A;  1JT0 A;  3K4J A;  2R92 J;  2KKO A;  1ZEL A;  4UY8 I;  2R7Q A;  5HNF A;  1R22 A;  2XPU A;  1F43 A;  2W48 A;  3BR1 A;  2Q2E B;  4HX8 A;  3DPU A;  1ETW A;  4W97 A;  2KL4 A;  2PMZ N;  1O3S A;  2FF4 A;  2HWV A;  4NC6 A;  1D0Y A;  5FLV A;  3ABU A;  2OJE D;  3OYN A;  4YFX F;  2VBX A;  3IKV A;  2NVU B;  4M74 A;  2WTE A;  3AFH A;  2F6C A;  1T33 A;  2EFQ A;  1VQ5 I;  1LEB A;  4Y4R A;  3V8J A;  3OYH A;  1YO5 C;  2IS6 A;  5DS9 A;  2VC0 A;  1LE8 B;  3QAH A;  2XKO A;  2DPD A;  1X2M A;  1HDD C;  3FHZ A;  2KDZ A;  1ZR4 A;  2HNH A;  1MH4 A;  3L9F A;  4UUT A;  4B47 A;  2VOO A;  5EJC A;  3RCO A;  2EFO A;  4D9J A;  3FK7 A;  3JTH A;  3W6V A;  1JHF A;  4EMS A;  3K70 D;  4IRI A;  5KCM A;  5TJJ A;  2V9P A;  3BLY A;  2JN6 A;  1O3T A;  2IEK A;  4EM2 A;  2LRD A;  1FTT A;  1JKQ C;  1A6Q A;  2L9V A;  4UVA A;  4A3K J;  3HRM A;  3F8C A;  3PO2 J;  4BUP A;  3LA2 A;  5D5X B;  3ZQH A;  3CCE I;  4EAT A;  2RVC A;  4FHT A;  4LLG F;  1TQP A;  4V2F A;  3MMY B;  1H88 C;  3QYE A;  3GTM J;  5B3S H;  1EH6 A;  4D7M A;  5JHU A;  4DGW B;  1ZGA A;  2O7O A;  5KHD A;  3D1N I;  2O9L A;  3EET A;  3BOQ A;  4C3I J;  2MH9 A;  3MKY B;  2CQK A;  1XCV A;  2EIN H;  3ZMD A;  3K9T A;  3MZ8 A;  1B6A A;  3ABT A;  4HA8 A;  2HKX A;  1XGO A;  3AG1 H;  3KYC B;  4CZZ A;  2L4M A;  2ZNZ A;  1Z1D A;  1Z6T A;  3KX2 A;  3GF2 A;  3SDG A;  2ZME B;  4OAZ A;  5F0C A;  1UMQ A;  3I71 A;  3UR3 C;  1SFU A;  5D5W B;  3WU2 C;  3RTR A;  1TZL A;  3VSK A;  4C3J J;  2XGX A;  1WH5 A;  2ECB A;  4KDP A;  2ELK A;  1R6R A;  3WHB A;  4LIV A;  3OYM A;  1MDM B;  3TW7 A;  4BE0 A;  2HPM A;  3JAM K;  1P7J A;  3K1P A;  1O57 A;  1WQ2 A;  4RLF A;  2R7S A;  2E36 A;  4CCL A;  3DBH B;  3PNT A;  1T0F C;  2DT7 B;  2ZXJ A;  1RRJ A;  2ZFW A;  2YU9 J;  3X2Q H;  5E8G A;  5F27 A;  4KA4 A;  2H6B A;  2LDU A;  3HM5 A;  1YTY A;  3HTU A;  4GYG A;  2FQ4 A;  3KEQ A;  4O3M A;  2JUC A;  1B9M A;  1VI0 A;  1FT9 A;  3BR0 A;  1VZ0 A;  2Y48 A;  3K4C A;  1T95 A;  4HV5 A;  3FKJ A;  4KT6 A;  5DEQ A;  3V7C A;  4B1R A;  2L5Q A;  3OYK A;  5DYM A;  2ME0 A;  1IV6 A;  4LK1 F;  4QSH A;  4AC0 A;  4HYE A;  3G2B A;  1XC5 A;  2EQR A;  3RYR A;  1UB9 A;  2F4M B;  3E1S A;  3ML6 A;  4I98 B;  1SFX A;  1IUF A;  5D4S A;  3ONQ A;  4L5E A;  1EH7 A;  4A0Y A;  2VPL A;  5HOO A;  2NVX J;  1ETY A;  2OQR A;  5L3E A;  1GXP A;  3WTX C;  4LFU A;  1IF1 A;  4UUV A;  2LOO A;  2CH0 A;  5LEJ A;  3TO7 A;  2H1L A;  3S2H J;  3O3K A;  1JKP C;  1FY7 A;  1JGG A;  2XSD C;  3K4M A;  2OD5 A;  4CYD A;  3WGI A;  3HXL A;  3IL2 A;  3PQK A;  3B6C A;  3GZ6 A;  2DYR H;  2R3S A;  3HPG A;  4CCN A;  4KFC A;  1X2N A;  3BZ6 A;  4O6J A;  4CYC B;  2OZU A;  3A4C A;  2XAG A;  2JA2 A;  3FXL A;  5CJ9 A;  3WTY C;  5IOY A;  3AG3 H;  1I3Q J;  2WWY A;  4ZTJ A;  1ETK A;  1EKE A;  4BAC A;  4XID A;  4XK4 A;  2ZNY A;  2DFH A;  4DIQ A;  2LBF A;  2BXY A;  5GPA A;  4LOC A;  3ZMZ A;  3HSE A;  4P9F A;  3IRR A;  1WJE A;  2KZV A;  1BR1 A;  4MEY F;  3EPZ A;  4XLA A;  3RIR A;  4DYQ A;  1GUU A;  2F2E A;  3ZGK A;  2NAZ A;  2F5D A;  4CA0 A;  1LB2 A;  4IHY A;  1QVT A;  2E7W A;  1F5T A;  4JX4 A; 
#chains in the Genus database with same CATH homology
 5EZH A;  1HCR A;  5C44 J;  2DN0 A;  2XPW A;  2NVQ J;  4XRS A;  4HNV A;  2M9H A;  4M3F A;  4FIS A;  1IG7 A;  4MFD A;  3HDD A;  3IH4 A;  1BA5 A;  1U9O A;  3BTI A;  2R7Z J;  3QQA A;  3RZD J;  2K40 A;  5M5X J;  2K9Q A;  3IV5 A;  2HOA A;  4FE4 A;  2HI3 A;  3ZQL A;  2IBD A;  2TCT A;  2FX0 A;  4X6A J;  1ZR2 A;  3VPR A;  1SAN A;  4J19 A;  1U8B A;  3OSG A;  3FKI J;  2LKX A;  4A3J J;  1MBJ A;  5M5Y J;  1JKO C;  4MO7 A;  5EDN A;  3GTP J;  3M4O J;  2FJ1 A;  2LTP A;  2Y9Y A;  3LSG A;  5FJ8 J;  2COB A;  3GTK J;  1MNM C;  2DA1 A;  1RET A;  1OCT C;  4A3D J;  3A03 A;  4NDL A;  3ZOB A;  2HYJ A;  3A01 B;  2XB5 A;  2JWT A;  2Y31 A;  2MSY A;  5GPC A;  3HB9 A;  1A6I A;  1G2H A;  3S15 J;  1IGN A;  1HDP A;  3MN2 A;  2L7M P;  5FKN A;  2DTZ A;  1FEX A;  2DA2 A;  3TP0 A;  2DMU A;  1QPI A;  1TWC J;  3LOC A;  1P7I A;  1LE8 A;  3FK6 A;  2I10 A;  5EG0 B;  2VI6 A;  1TWF J;  5F04 A;  2Y30 A;  4D5F A;  4DZP A;  3JRI A;  5HOD A;  3BTJ A;  5FKM A;  5IPA A;  1BJZ A;  5FKL A;  1YRN A;  5EYR A;  3G1O A;  3HOU J;  2HXO A;  2VKV A;  1ETQ A;  2R5Y A;  1E3O C;  3HGY A;  4A3F J;  2MG4 A;  3BR3 A;  2E2I J;  5JLW A;  3L1P A;  3O8H A;  1VF9 A;  1RPW A;  2JA8 J;  3BG9 A;  4BY7 J;  1AKH A;  2DA7 A;  4QIW N;  1PUF B;  1ZKG A;  2HXI A;  3NAR A;  4JX6 A;  4XRM A;  1H8A C;  2VUM J;  4Y52 J;  3JRC A;  3S1M J;  1WGX A;  5FKK A;  1A5J A;  2EZL A;  4FCY A;  4MFE A;  1OFC X;  4A69 C;  1DU0 A;  2CU7 A;  2H1K A;  2B63 J;  2LP0 A;  2H8R A;  4DYC A;  3LNQ A;  3FIS A;  3BQZ A;  2ID6 A;  4M3B A;  4I76 A;  1NTC A;  2DMP A;  5IP7 J;  4A3M J;  2NVY J;  5J1U A;  1Z77 A;  1BL0 A;  3HOZ J;  2NVT J;  1ITY A;  2Y0S N;  2JK3 A;  4JX5 A;  2Y9Z A;  1F36 A;  1QRY A;  3RZO J;  4FTH A;  5M3F J;  3IH2 A;  4M3G A;  1JUM A;  2DMQ A;  1W0U A;  5IP9 J;  3S16 J;  3LSP A;  5IOZ A;  3OIO A;  3QPS A;  4IHW A;  2VPR A;  4ABZ A;  1JT6 A;  5E3L A;  3TP3 A;  5EF6 A;  2GLO A;  2XGD A;  1GT0 C;  2HQ5 A;  3K7A J;  5C4J J;  1NK2 P;  3HOV J;  2ID3 A;  5F0H A;  5K7H A;  1MSF C;  2Y2Z A;  2M8G X;  1ENH A;  5IYD J;  1B8I B;  1FTZ A;  5E3M A;  3HEF A;  1MBG A;  1IDZ A;  4RDU A;  2E2J J;  2MGQ A;  4RBO A;  2R93 J;  3LSJ A;  5IP6 A;  3F0C A;  1FJL A;  2JJ7 A;  1VFC A;  2YS9 A;  2P81 A;  2L0K A;  2R5Y B;  2AO9 A;  4S0H B;  4BY1 J;  2CQQ A;  3BR2 A;  4A3C J;  4IHX A;  3JRG A;  2JA6 J;  1AKH B;  1IDY A;  2XGE A;  2WV1 A;  2X6O A;  3NAU A;  3GTJ J;  3S17 J;  3BG5 A;  4DYR A;  1I50 J;  1JUS A;  1ZTR A;  3JRB A;  1RES A;  2DA5 A;  3CQZ J;  3GTQ J;  1OJL A;  4IEJ A;  4CYC A;  1MBH A;  2JMW A;  1HF0 A;  2X9D A;  4A93 J;  1BW5 A;  1GV5 A;  2LVS A;  2LLK A;  1JJ6 C;  4W1U A;  3WHC A;  1HLV A;  2DA6 A;  5F1J A;  1RKW A;  2EZK A;  1ORK A;  2R5Z A;  2ME6 A;  5J1Y A;  1EF4 A;  4DW6 A;  2VKE A;  4UUS A;  2NS7 A;  1TC3 C;  1AU7 A;  1D5Y A;  3A02 A;  3ZQG A;  2M34 A;  1K61 A;  3I4M J;  1S7E A;  4AYB N;  1CQT A;  2JA5 J;  3ZQC A;  1BW6 A;  1RKT A;  3GBG A;  2DA3 A;  2HOT A;  1JJ8 C;  1WCM J;  4EEF G;  5EGO B;  4V2G A;  5F08 A;  2OF7 A;  1GDT A;  4A3L J;  3JRH A;  2LK2 A;  2XGC A;  1QVU A;  4MIM A;  1HOM A;  4B4C A;  2NOG A;  3I4N J;  3B6A A;  4JYK A;  1ZK8 A;  3G1M A;  1IJW C;  1JUP A;  3PO3 J;  2L7Z A;  2L9R A;  9ANT A;  1Y1W J;  4I6Z A;  2DMN A;  1JKR C;  5C4X J;  3H3V K;  1JTY A;  3S1N J;  1ETV A;  4A3E J;  1WH7 A;  2EBI A;  4MLO A;  3JRE A;  4QTR A;  3TED A;  4C2M J;  3OOU A;  5K7Z A;  2GBY A;  4C3H J;  5IYC J;  4XIC A;  1JT0 A;  1B72 A;  3S1Q J;  2R92 J;  2CRG A;  3ZQI A;  4DZJ A;  2XPU A;  1F43 A;  2W48 A;  3BR1 A;  2RAE A;  4BXX J;  3A01 A;  1ETW A;  4W97 A;  4B3A A;  2PMZ N;  4A3G J;  1DU6 A;  3Q0W A;  5E3O A;  3GTG J;  2LFB A;  3SJM A;  5FLV A;  2QCO A;  1AHD P;  1MSE C;  4GFB A;  3Q0U A;  1ZQ3 P;  1IRZ A;  3HKZ N;  2QF7 A;  1U9N A;  4D7N A;  2XB0 X;  3BR5 A;  1WI3 A;  5F0F A;  3JRD A;  1TWG J;  3JRA A;  5BNG A;  1JTX A;  2O8K A;  1T33 A;  3Q0V A;  4A3B J;  1Y1V J;  2XRL A;  4BBR J;  1H89 C;  2E1O A;  3S14 J;  1POG A;  5DS9 A;  5E3N A;  5EG0 A;  1LE8 B;  1FIA A;  1X2M A;  1HDD C;  2KDZ A;  1ZR4 A;  3C2B A;  4M3E A;  1MH4 A;  4UUT A;  1UHS A;  3S2D J;  2E19 A;  3O8G A;  3RKQ A;  3FK7 A;  2NS8 A;  3W6V A;  1MBF A;  1X58 A;  2LR8 A;  3HOY J;  3Q3S A;  1UG2 A;  2JN6 A;  2IEK A;  3CMY A;  1FTT A;  1YRN B;  1JKQ C;  4JP0 A;  3MVP A;  4A3K J;  3UKG A;  2HDD A;  3PO2 J;  5DTD A;  4M6V A;  3PM1 A;  2LD5 A;  3ZQH A;  1FIP A;  2WAQ N;  1PUF A;  3DEW A;  4V2F A;  3LSR A;  1Q1V A;  1H88 C;  3GTM J;  4D7M A;  1Z0X A;  4AUX A;  3FIW A;  2O7O A;  2GM4 A;  3D1N I;  2O9L A;  1WPK A;  4C3I J;  3MKL A;  1MH3 A;  1IC8 A;  5FLM J;  3ZQF A;  1R9T J;  2M0C A;  3CCY A;  2DJN A;  3SDG A;  5F0C A;  2CQX A;  5GP9 A;  3JRF A;  1UMQ A;  2ECC A;  4C3J J;  1B72 B;  5K7F A;  1WH5 A;  1K83 J;  2ECB A;  2ELK A;  3WHB A;  4XRS G;  2OPT A;  5C3E J;  2YUS A;  3TW7 A;  2M2E A;  2ZB9 A;  3E7L A;  1TWH J;  1P7J A;  2LY9 A;  2MW8 A;  2KT0 A;  4X1E A;  2CJJ A;  1I6H J;  4A3I J;  2HOS A;  2K9N A;  2E2H J;  2D5V A;  3HBL A;  2YU9 J;  2IAI A;  5F27 A;  3TW6 A;  4FE7 A;  1ETX A;  3SFI A;  3RQI A;  3HM5 A;  3DCF A;  3HOX J;  2FQ4 A;  2R0Q C;  1O4X A;  3BR0 A;  1VI0 A;  2CUE A;  2N8G A;  1ZGW A;  1GV2 A;  2FD5 A;  2X48 A;  3BR6 A;  4B1R A;  2ME0 A;  1W0T A;  1IV6 A;  1B8I A;  1MBK A;  2EZI A;  4QSH A;  4AC0 A;  4BBS J;  3OSF A;  2EZH A;  1XC5 A;  1T56 A;  2EQR A;  5M3M J;  5EEA A;  2CUF A;  2DA4 A;  1VND A;  2EH3 A;  2DMT A;  2L7F P;  1XS9 A;  4BKX A;  1TWA J;  1IUF A;  3CDL A;  1MBE A;  4L5E A;  3BQY A;  4IHV A;  3G1L A;  3H0G J;  1SFO J;  2NVX J;  1ETY A;  5J1R A;  3BT9 A;  3HOW J;  1LFB A;  1GVD A;  3S2H J;  1JKP C;  3JR9 A;  1JGG A;  2XSD C;  3S1R J;  3B6C A;  4G12 A;  3BTC A;  4M3D A;  3GTL J;  1NK3 P;  1X2N A;  5M5W J;  1RR7 A;  4CYC B;  4Y7N J;  3HGG A;  3K2A A;  2XPV A;  5IYB J;  5IOY A;  2TRT A;  1I3Q J;  3BTL A;  3IH3 A;  1ETK A;  5FKO A;  4D5C A;  4XID A;  4XK4 A;  5JLX A;  3BG3 A;  1ETO A;  5J3L A;  1U78 A;  5GPA A;  4LOC A;  2R5Z B;  2G0E A;  2JA7 J;  4UUS B;  2AHQ A;  3GTO J;  5EZG A;  1OCP A;  1APL C;  4DYQ A;  1GUU A;  4IHY A;  1QVT A;  1LFU P;  1XG1 A;  5EGO A;  3QPL A;  4JX4 A;  3M3Y J;  2WB1 N;  2K9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...