1Q1VA

Structure of the oncoprotein dek: a putative dna-binding domain related to the winged helix motif
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
70
structure length
70
Chain Sequence
DEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKELISLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution NMR structure of the C-terminal domain of the human protein DEK
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DEK protein
total genus 18
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2003-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08766 DEK_C DEK C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1q1vA00
4XRSG 1RKWA 2XGCA 4JX6A 4JYKA 2HI3A 4M6VA 4A3JJ 3CDLA 1OJLA 1HLVA 2M9HA 3LSJA 4C3HJ 5IP7J 1RETA 2AO9A 2I10A 1MNMC 1TWAJ 3HOZJ 3C2BA 4IHWA 3BG9A 1ZR2A 3S17J 1MBHA 2OF7A 2PMZN 4BBRJ 3A01B 4CYCA 3I4NJ 3IH4A 2E2IJ 2M34A 2X9DA 1UG2A 1OCTC 3I4MJ 5C4XJ 3FKIJ 4FE7A 1AHDP 4QIWN 1JGGA 3S2DJ 4FE4A 5DS9A 2HXOA 1IRZA 3ZQGA 5M3MJ 5JLWA 2JJ7A 1A6IA 4V2GA 1LE8B 1YRNB 4A3MJ 1U8BA 2NVQJ 4CYCB 1GUUA 4QSHA 3GTMJ 4XIDA 2LK2A 3BR0A 1B8IB 2CUEA 1TWCJ 3LSPA 3ZQFA 3JRGA 1WPKA 5F1JA 5EGOB 1MH4A 3S15J 2Y31A 3GTLJ 4B3AA 2HDDA 2L7ZA 3LSGA 1NK2P 3OOUA 1T56A 2ID3A 2VUMJ 5FKOA 2Y9ZA 5E3MA 1ETQA 2TCTA 1F43A 1MBKA 5EGOA 1JTYA 2JMWA 2DMTA 3S1NJ 1PUFA 1FIPA 1XG1A 1F36A 2G0EA 3HGYA 2ECCA 2DMQA 3MVPA 2WV1A 5EYRA 3D1NI 5FLMJ 2LR8A 4DYCA 4V2FA 2WAQN 4MFEA 1LE8A 3BTCA 1MSFC 1X58A 2DA7A 2DA6A 3ZOBA 4C3IJ 2LVSA 3BR3A 3S1MJ 3WHBA 3PM1A 2M2EA 4RBOA 1RKTA 3Q0UA 3G1MA 2R93J 2B63J 2EZKA 3VPRA 3JRDA 5FKNA 2GBYA 3HM5A 4S0HB 4DW6A 1POGA 5EG0A 3L1PA 3IV5A 5M5WJ 2HYJA 5EF6A 1JKOC 3HOWJ 4UUTA 3JRIA 5HODA 5IYCJ 3A03A 5IP6A 4XICA 2QF7A 3OSGA 2IAIA 1IDZA 1JJ6C 1K83J 3DEWA 3JREA 3LSRA 1GV5A 1ZQ3P 5K7ZA 4M3FA 2LKXA 3RKQA 4BY1J 2FD5A 3GTJJ 1ETOA 4GFBA 4Y52J 4D7MA 1ORKA 2CUFA 4G12A 1EF4A 2LLKA 2VKEA 3M4OJ 3FK7A 1XC5A 3BR1A 1NTCA 1APLC 2X6OA 4BXXJ 4IEJA 5J1RA 2W48A 5F0CA 1YRNA 1ZTRA 4A3IJ 2K40A 4X1EA 2DMNA 4X6AJ 1I3QJ 3SDGA 1W0TA 3MN2A 2VKVA 4W97A 4DZJA 4DYQA 9ANTA 2Y9YA 3HEFA 3ZQHA 4MO7A 2E19A 5GPAA 3SFIA 2NVTJ 1ETVA 2DA2A 2L9RA 2LY9A 2CQXA 1RPWA 1U78A 1R9TJ 3BQZA 2Y30A 1BW5A 2R5YA 2MGQA 3IH2A 2ME6A 2VI6A 3CMYA 1FIAA 4I76A 3BG3A 1HCRA 5EZGA 1ENHA 5IP9J 1WH7A 2CQQA 4D7NA 2M0CA 2O8KA 1I50J 2E2JJ 3S2HJ 2ZB9A 2EQRA 5M5YJ 3ZQLA 2YU9J 4ABZA 3FIWA 2CU7A 3BTJA 1VF9A 1VNDA 3W6VA 1GT0C 1U9NA 5F0FA 1AKHB 2TRTA 1X2MA 2Y2ZA 1JKPC 2JA8J 2JN6A 1WGXA 3S14J 2IEKA 2JA6J 1JUMA 3PO3J 2KT0A 1QVUA 1VI0A 1MBJA 2EBIA 3HGGA 2COBA 2ECBA 2E2HJ 1I6HJ 2FQ4A 3IH3A 3TP0A 1Y1WJ 2DA5A 3JRHA 4A3LJ 1S7EA 2L0KA 3H3VK 2E1OA 1ETKA 1JT0A 1IG7A 5F27A 5BNGA 4MFDA 1GVDA 2QCOA 3H0GJ 1TWGJ 2KDZA 4A3EJ 3BR2A 1TWFJ 5F04A 2WB1N 4I6ZA 3QPSA 3O8GA 4A3FJ 1OCPA 1QVTA 1O4XA 2R92J 1DU6A 5EZHA 2EZIA 3UKGA 3G1LA 3CCYA 5E3OA 1ETWA 2JWTA 5K7FA 3Q0WA 2XGDA 5E3NA 5IPAA 4BBSJ 4UUSA 1IUFA 2H8RA 1LFBA 4JP0A 4IHXA 2MW8A 3F0CA 4FTHA 2XPUA 1WH5A 5J1UA 5J1YA 1H8AC 1BA5A 2DA3A 2DJNA 1MBEA 5JLXA 2DA1A 5FLVA 4B4CA 4FISA 3BTLA 1IC8A 1H89C 1ZR4A 4MLOA 1FJLA 1ETXA 1GDTA 2DTZA 1JKQC 2P81A 1UMQA 5GP9A 4Y7NJ 3B6AA 3JRAA 3NARA 4MIMA 4A93J 1IV6A 5IOYA 4A3BJ 1TC3C 1T33A 2CJJA 4DYRA 4UUSB 3Q0VA 1Z77A 2LP0A 5IYDJ 2K9NA 4AC0A 3B6CA 1VFCA 2DMUA 5EG0B 4IHVA 3ZQIA 3GBGA 2XB0X 1D5YA 1ZKGA 2H1KA 4JX5A 1MH3A 3HOUJ 2ELKA 2RAEA 1IGNA 2D5VA 2EZLA 4XRMA 1W0UA 3GTQJ 1E3OC 3NAUA 4EEFG 1P7IA 5FKLA 3TW7A 2R0QC 2R5ZA 3O8HA 5F0HA 3A02A 5C4JJ 1HDDC 5F08A 3BR5A 1RR7A 3QQAA 2NS8A 2O7OA 1CQTA 2HOAA 2NVXJ 2NVYJ 3JRFA 3K2AA 1JKRC 3BT9A 2Y0SN 4HNVA 3HB9A 2XPVA 1IJWC 2K9SA 4A3KJ 2ID6A 1ZK8A 5J3LA 4J19A 3PO2J 2NOGA 1TWHJ 2HOSA 2M8GX 3G1OA 3JRBA 3HKZN 1U9OA 5FKMA 4C2MJ 1X2NA 4M3EA 4B1RA 4LOCA 3OSFA 4BY7J 4A69C 5C3EJ 3HOVJ 1FTTA 2EZHA 1MSEC 2AHQA 2FJ1A 3BQYA 4AYBN 1ETYA 2FX0A 1BW6A 2YUSA 2R7ZJ 4D5CA 4DZPA 4A3CJ 1B8IA 3BTIA 4A3DJ 1DU0A 5EEAA 3FK6A 1B72B 1JUSA 4JX4A 1SFOJ 3JR9A 1BJZA 1Q1VA 1HF0A 1SANA 4A3GJ 3LOCA 2R5YB 3TW6A 5EDNA 5M3FJ 2K9QA 2HQ5A 1JTXA 2VPRA 1JJ8C 1Y1VJ 3HOYJ 1FTZA 3TEDA 3K7AJ 4L5EA 2XGEA 1XS9A 3RZDJ 1LFUP 4AUXA 3S1RJ 2XPWA 1HDPA 5IYBJ 4M3DA 2JA7J 3A01A 3MKLA 3ZQCA 2L7FP 1P7JA 1PUFB 2JA5J 1FEXA 3GTOJ 1HOMA 1AKHA 1IDYA 2YS9A 5IOZA 1B72A 2DA4A 2R5ZB 2MG4A 1QPIA 4RDUA 2LD5A 2X48A 3FISA 2ME0A 2N8GA 1Z0XA 2EH3A 2NS7A 3LNQA 1NK3P 1ZGWA 2IBDA 3CQZJ 3Q3SA 4W1UA 1A5JA 4C3JJ 4XRSA 3HBLA 5K7HA 3GTGJ 2LTPA 2GLOA 3TP3A 1BL0A 2DN0A 1WI3A 3E7LA 5GPCA 5FJ8J 1H88C 2XRLA 2GM4A 1K61A 2OPTA 3DCFA 3S1QJ 3SJMA 2XB5A 5M5XJ 1OFCX 1QRYA 4XK4A 4FCYA 1MBFA 5C44J 3GTPJ 3BR6A 1GV2A 4D5FA 2LFBA 3HOXJ 3RQIA 2HXIA 4M3BA 3OIOA 3S16J 1AU7A 2L7MP 3QPLA 3HDDA 3BG5A 1MBGA 3M3YJ 1UHSA 3JRCA 4M3GA 4QTRA 2O9LA 2XSDC 4NDLA 2CRGA 2HOTA 2MSYA 1G2HA 5FKKA 4IHYA 1JT6A 1WCMJ 4BKXA 3RZOJ 2JK3A 2DMPA 5E3LA 1RESA 3GTKJ 3WHCA 1JUPA 5DTDA 1ITYA
chains in the Genus database with same CATH superfamily
4KN7X 4QWQA 2E35A 4EJOA 4HDUA 2FOKA 4GO1A 3DP7A 1HLVA 4C3HJ 2E1MB 1RETA 5IT9Z 4E6KG 2F5EA 1TWAJ 1BC8C 1ZR2A 1MIJA 3DEEA 2OF7A 3I53A 2Z9OA 3A01B 4CYCA 3ELKA 2E5ZA 2JT1A 3OIQA 2M34A 1G3TA 2XF5A 3LMMA 2QUFA 2IRFG 1S7AA 2HQAA 1OISA 1Y56A 1BI2A 4JK1X 5DM6F 4HX8A 5GTHC 2HQRA 2JPBA 2RVCA 4ZDOA 2GXAA 5FB2A 5JR3A 4D9JA 1IRZA 1YJWI 5HDKA 3SFZA 1NH3A 1TT0A 6PAXA 2B7EA 4A3MJ 2MFZA 4QSHA 3ZMTA 2X51A 2K86A 1SD6A 5HOOA 3BR0A 1ZRCA 4B09A 3ABLH 4B43A 2BGCA 4O5VA 2UWMA 3EYIA 5D4RA 4XORA 1TT5B 3GCMA 4A0XA 2HDDA 2L7ZA 3ZMVA 1OCCH 3BCAA 5FKOA 2Y9ZA 1HSTA 2DOEA 5CQEA 5EGOA 1JTYA 1U5TC 2CYYA 3HGYA 2G0EA 4LFUA 1QZZA 2ECCA 2RV8A 1FOYA 1QHHD 4ON0A 1XCBA 2LREA 3BC8A 4DYCA 4ITVA 1AOYA 1E0EA 2OCCH 2XC7A 1BN5A 3ZCOA 3CMAI 5LEKA 3ZOBA 4Q5SF 3S1MJ 4MTDA 2ZFUA 4A0ZA 4LG0B 1S5LC 1FOWA 2IGKA 1RKTA 4KIFA 4NUBA 4XLPF 2I8DA 3JRDA 1ON1A 2XVCA 3IV5A 3HM5A 1G59A 4DW6A 1U5TB 3IUOA 2K4JA 4E7KA 2CV2A 4ZTJA 2P6TA 1T95A 2EK5A 3OSGA 4C30A 4G8XA 1IDZA 4XSZF 1K83J 3ZR8X 3ECOA 5CVVA 2VE8A 3DBHB 4M6YA 3T8TA 1GV5A 3LSRA 1ZQ3P 3KP4A 4BUPA 2RNJA 4HNUA 4M3FA 2LKXA 2D2WA 2ZXJA 4BYYA 2Q0OA 2F5DA 3GTJJ 2TDXA 1IAWA 2XAUA 1YX5A 4PFOA 1SFEA 2WADA 1ORKA 4G12A 1QHGA 4ENJA 3D0SA 2F5CA 2HQNA 5DCFA 4F3QA 1XC5A 2IA1A 5CVIA 3VEPA 3GW2A 5J1RA 2PLYA 2Y75A 2CQNA 4FX0A 4X1EA 5L3DA 3HC7A 1VQ8I 1I3QJ 1YG2A 4BS9A 1W0TA 4RGRA 1RNLA 3LQQA 4EQQA 2W84A 2Y9YA 2W25A 5GPAA 3LFUA 4I02A 2CUZA 1XPXA 2E71A 1YLFA 1R9TJ 5ICFA 4AU7A 2WY7Q 2FMLA 2A3SA 2LF8A 3J81Z 2R5YA 3IH2A 1I1GA 1V5EA 3GF2A 3K70D 4KJZA 3SZGA 1FIAA 1P4AA 2R7WA 5IP9J 5HLIA 4D0PA 1WH7A 2OZUA 2HR3A 2P5VA 4IQ4A 1R23A 2BE5F 1SFXA 2JRTA 3TMOA 3F6VA 3OMYA 2E2JJ 3OYAA 1HBXG 3DTKA 2F6CA 3CZ6A 3E6CC 1Y0NA 4HF2A 3TKYA 1VF9A 5L3GA 2W57A 1OQYA 1R1TA 5KK1A 1OYIA 3BJAA 4Q47A 2VXDA 2CW0F 3JSOA 3E0JB 3ABTA 1W5TA 3QU3A 4L5IA 2JA8J 2JN6A 2ZJRF 1ZGJA 1ZG3A 3KLNA 4G6TB 3S14J 2GXGA 2DFFA 2FBHA 2IEKA 1Z6RA 1MMAA 2XHKA 4N4NB 3H0DA 3EYYA 1D0ZA 3RDIA 4B44A 1KGSA 1MBJA 1VI0A 3HGGA 5K5QA 3FXJA 5FGMA 1STZA 3OYKA 2H27A 3R0JA 2KPMA 4I09A 4A3LJ 4UUVA 4WF2A 2ZFWA 4A6EA 1LNWA 2BY1A 5F27A 3S93A 3J81K 1GVDA 1R71A 1R6RA 4A3EJ 3BR2A 3HRTA 1TWFJ 2VT3A 1WQ2A 3TO6A 3K2ZA 3SEQA 2R7FA 5LBQA 1UJ8A 5A2QZ 4BXUA 5GAHJ 5KNLA 1O4XA 2DW4A 5DEQA 2R92J 3H36A 5EZHA 3PL8A 3VSLA 4CGZA 1B1BA 3U9GA 1GXPA 1DQUA 5E3NA 3OYJA 1ULYA 2KZGA 4AIKA 1MNEA 1LFBA 1TZLA 3PQKA 3H5NA 2V9VA 3F0CA 1XSXA 2ZXHA 4FTHA 3CESA 5H6QA 2HDCA 4KICA 3X2QH 3GVAA 3LA7A 1MMDA 5F64A 4ZC3A 3WE3A 4B48A 2EPFA 1UB9A 3BTLA 2MD0A 4AIDA 1H89C 2X4HA 2DT5A 1ETXA 1R7JA 3MZ8A 4PJMA 3U1KA 1WZ2A 4N9IA 1I6XA 2MC3A 1UMQA 3E5XA 1WJDA 2JZYA 4O3MA 1S9HA 4CCJA 4PSWA 4OMYA 1VQNI 1I3AA 1U5TA 1YFHA 2CJJA 3C7JA 1LKXA 2KRFA 2Z5UA 5HNFA 1Z77A 2LP0A 3T8RA 3CF5F 3L2VA 4OIPF 2KISA 4AC0A 3B6CA 1W7PA 4P5OA 1Z91A 3EETA 3MZHA 1HQCA 1LDJA 1PYVA 3ZQQA 3ZQIA 3CCJI 2YPRA 2QZ8A 1MH3A 2ELKA 2FOWA 1Z3YA 2RAEA 2QQBA 5LGTA 5DUIA 2EV6A 2VBWA 3I5UA 3OR2C 4R1HA 1P7IA 5FKLA 1H9TA 1J75A 3SZPA 2AXTC 2V9PA 2GA1A 3A02A 5LRSA 3OY9A 2L7KA 5DCMB 2V6CA 3P9KA 4OIRF 2JUGA 3AG4H 2XSJC 2WAQA 1CQTA 2X85A 2HYGD 1KZHA 3K4JA 2HOAA 1DP7P 3HL2A 3DLLF 2OU2A 3JRFA 3GX4X 4LITA 2GIVA 3HHGA 4MQ9F 3KZZA 4B3XA 2UUZA 3CDHA 1S3JA 2DYRH 2L4MA 1G3YA 3PO2J 4LIUA 1E3PA 3A1YA 3U1DA 2ISZA 3EUHC 2FQ3A 2W4SA 2BEOA 1A31A 2DQLA 2Q2EA 1VQOI 4B1RA 3FXRA 4UB6C 1BR4A 2O8XA 1O7FA 3OSFA 1IRXA 2XRNA 4L5JA 2AHQA 5EEGA 1N78A 4KITB 3D5RC 4A5NA 3ESWB 1ZG1A 5ICGA 1EH8A 2EA2A 4BQQA 2E1MC 2HTSA 2XAQA 5EJCA 1X1PA 4OIQF 4DQ2A 3VSKA 5K1YA 1B72B 1SFOJ 1Q1VA 2H8WA 4YEJA 5BPDA 4Y15A 5M3FJ 4I0BA 1QO0D 1XCVA 3HSFA 3F9KA 3GFMA 4EM0B 1JTXA 2IA0A 2OUMA 3CJQB 1LUJB 2BZTA 4XQFA 3TEDA 1X4PA 2Q8KA 4UY8I 2XGEA 1LFUP 3A4CA 3KYLA 2K9LA 2HEOA 2R7XA 2JA7J 4F91B 1FX7A 3E3VA 2XAJA 3JW4A 4Q48A 3B73A 3GTOJ 2A61A 3QYEA 2JPCA 5FFZA 4IKFA 4U0VA 1R49A 3I59A 1E3HA 3KCCA 1HW5A 1T98A 3MAJA 2ZMEC 1Z0XA 2NS7A 4IF4A 1X4OA 5KVRA 1P4WA 2VN2A 4LK1F 4C3JJ 4XRSA 2LTPA 2M1BA 3IHUA 1O3TA 1D8KA 3EUAA 1WI3A 3WGGA 2GZWA 2VL8A 4G7HF 3IAS2 1H88C 2GM4A 3H9QA 1B9NA 3I58A 2BYVE 1D0XA 2DOAA 3NRVA 3SJMA 5CKTA 3CCSI 2HVQA 3NWSA 2LOOA 4I2OA 3TO9A 1OCZH 3BR6A 5E8GA 1FSEA 3WG7H 3L09A 4IOCF 3KFWX 4GDFA 4YIIA 1B9MA 3EQLF 5J8FA 2XF6A 2A6EF 2DYSH 4M3BA 2VT2A 2R7DA 3WTTC 3QPLA 2E7XA 3OYFA 4XOPA 3QP5A 4IRHA 2LYCA 4QTRA 2VC1A 1JE8A 4NDLA 3MCZA 2QQ9A 3IC7A 5LHGA 1FYMA 4IHYA 1JT6A 4IZZA 2CW7A 3KE2A 2JVHA 4BKXA 2JK3A 2JUCA 5E3LA 1RESA 3N05A 3KP5A 1ZLJA 1IXRC 2KL4A 4IX7A 2VE9A 1BR2A 4BEHA 1IN4A 1WJBA 2XGCA 4DBRA 2BOLA 1EH7A 1SD5A 4EGYA 1MMSA 2VJ5A 5GAEJ 2M5WA 1V5GA 1ZHFA 2HI3A 2L3DA 4ESJA 1OJLA 2PJRB 2MC4A 2GOXB 2AO9A 2I10A 3SZTA 5ICCA 3I59B 3G4SI 1U2WA 1FYKA 1FP2A 1Z6TA 4BXFA 4LB5A 3ZXSA 2G7UA 1NG7A 4II2A 2X9DA 5L3BA 2PMZA 3I4MJ 4HZFA 4B47A 3F8CA 1YJNI 3KYCB 3FKIJ 3C18A 1AHDP 4FE4A 3ZQGA 2O0YA 2K85A 3HHHA 1VQ5I 1A6IA 3TL4X 4ANJA 1U8BA 1AWCA 1W4MA 5DD8A 5TGTA 3A0HC 2H09A 2P0WA 1B8IB 1ERDA 1TWCJ 4M72A 1IN6A 2IS4A 1WPKA 1MH4A 3LSHA 2O6GE 3HKZA 2QWWA 3GTLJ 3V7RA 1YX3A 3QRFF 2VUMJ 4HOBA 5GAGJ 1DPUA 1EJ9A 1WWXA 1ETQA 3MWMA 3G3ZA 4BAYA 1IO2A 2PG4A 2DMTA 1X1AA 2M4GA 1SVMA 1A04A 2VQHA 5HVQC 5EYRA 1KU3A 1HKQA 2DBBA 1R5ID 3WU0A 3D1NI 5FLMJ 2LR8A 4II3A 4V2FA 3WE2A 2WAQN 1FSHA 2X1DA 2E36A 3BTCA 4I98B 3EDPA 4PFPA 4ZDLA 1OMIA 1X58A 2DA7A 3BPVA 4LGWA 2LSOA 2VOPA 2LVSA 1IN5A 2HNHA 3PM1A 2HKOA 3ROUA 4RBOA 3FMRA 4EATA 3ZMZA 3KP3A 5HS9A 2B63J 2DODA 2GBYA 1POGA 2XASA 5M5WJ 5EF6A 2WAEA 4XLAA 1K79A 5JI6A 1BM9A 2DCEA 2BVLA 4I01A 2E1CA 5IP6A 1LEBA 2CG4A 1Z3XA 5BOXA 2RN7A 2W82A 1OR7A 3CC7I 5AIQA 2ETHA 3HZJA 1DGRM 4WK8F 5GTIC 3KP2A 2IS6A 3RTRA 4HV5A 1MJ9A 3S32A 2ZBKA 3HSRA 1P4XA 4I7HA 4BQAA 2YU3A 1ETOA 1Q1HA 2CUFA 4EJWA 4U87A 2V7FA 4P9UA 3HRSA 3FK7A 2M7AA 3BR1A 3IRQA 2X6OA 2EIKH 3TOBA 1F1ZA 1ZGAA 4E7IA 2W48A 2XF7A 5F0CA 4MEXF 1ZTRA 1X3ZB 1YRNA 2K40A 5GADJ 1W36D 2VPLA 1UZCA 2V26A 3BZCA 4X6AJ 1XDSA 4LJZF 1USSA 3PUBA 5DYMA 4I0AA 3MN2A 4Y4RA 1LEAA 1J7KA 4DZJA 2FNPA 3HEFA 3ZQHA 3ZRGA 4N0BA 2NVTJ 1FBQA 2KZVA 2LY9A 1U78A 4ESFA 3BQZA 2FU4A 3CCEI 4OIOF 4HLXA 1JHFA 4BDYA 3RKYA 5E20A 3SXYA 3S3MA 3CMYA 4RGUA 2WA0A 3BG3A 2NS0A 5EZGA 3HTUA 3CF2A 4MQVA 4MGRA 5CQGA 3ZP5A 4HQMA 1B59A 4D7NA 4LK0F 3ZN1A 2O8KA 1QZYA 1FWZA 3DKYA 1I50J 1VQPI 3ZMDA 1X1CA 3SHFA 4XLCA 1MJBA 2K4BA 1YYVA 3ZQLA 1S8NA 1XGOA 2A68F 2EJRA 2CU7A 1VNDA 2AQFA 4IXAA 2DO7A 3W6VA 1VTNC 2QQ8A 2BY0A 3MEXA 5F0FA 4EMSA 2MYSA 4OOIA 1BBYA 1SAUA 1KQ0A 1WRJA 2VQCA 1JKPC 3K1NA 3BPXA 3ZMSA 3ABUA 1FMVA 2KQRA 1WGXA 2K7LA 2Y0MA 4IPAA 4S04A 5J6XA 4OAYA 1Z67A 4BNCA 2A6TA 1JUMA 2D1HA 2KT0A 3J7ZI 2K02A 2QSGX 2X1CA 2COBA 2P4WA 3O3KA 3CD6I 1BJAA 3IH3A 1P92A 2L0KA 3I3LA 2C6YA 2EFNA 4F52A 2ZNYA 2W00A 4RAZA 3H3VK 4U0YA 4P55A 5ED4A 3K4KA 3CCVI 5AIPA 2E60A 1J9IA 3M9AA 5J47A 3GEZA 1KYWA 4QLCU 3AG2H 4IRGA 3F21A 1QGPA 2J5PA 3HJEA 1YIJI 4HYEA 3O8GA 4A3FJ 2GWRA 2GXBA 1W7PD 5D5XB 1DU6A 2EZIA 3UKGA 3G1LA 3CCYA 3H1CA 4XBFA 5B1BH 1OR7C 5K7FA 4RLQA 3L2RA 1S6LA 3BWGA 3W2WA 4HW0A 2XGDA 2CH0A 4FX4A 1YO5C 4BBSJ 4UUSA 2XIGA 3SQNA 2OJED 2IA2A 2MW8A 1IUYA 2HVRA 1WH5A 5J1UA 3OIPA 2O3FA 3R60A 1H8AC 1QBJA 1JGSA 5E79C 3KETA 1WJFA 1B4AA 1R00A 2DA1A 2YX7A 3AG1H 2VBYA 3AFHA 4M73A 1OCOH 5KCMA 1IC8A 5HS7A 4KT6A 1ZR4A 3I71A 2VBXA 1FJLA 3TOAA 2HVSA 4KMUX 2DTZA 1JKQC 4PGHA 3K4CA 1TNTA 4R79A 1FZPB 5GP9A 2EV0A 4UV9A 4Y7NJ 2HDWA 4MIMA 3BDDA 1L3LA 1TC3C 3QYBA 1T33A 2QKLB 4RS8A 4Q4ZF 4UUSB 4U7BA 4HF1A 3J7AY 1TL8A 1R1UA 2K9NA 2JTVA 3DWLE 3K70C 4RAGA 1XDUA 2DLLA 5KHDA 1VFCA 4IHVA 3GBGA 2NAZA 3CCLI 4HV6A 2H1KA 3QP6A 5D5WB 1IF1A 4MEYF 1MNDA 1IGNA 1W0UA 4PSXA 5K5OA 1IN7A 2P5LC 3TW7A 2EV5A 3N4MA 2WY8Q 2JRMA 1C0WA 2PJRA 4CDGA 5E8IA 3VDXA 5HLHA 2NRAC 3H3ZA 3OYGA 1LVKA 3BR5A 1RR7A 3D5SC 4IHSA 3E1SA 1XMAA 3AAFA 4WXDA 2NVYJ 1PP8F 3BT9A 2NNYA 2XKOA 4MTEA 2Y0SN 3P9IA 5HNHA 4G6DA 4KIBA 2B9SA 3HB9A 2R3SA 2LBFB 5L3EA 1IJWC 1XN7A 2A5YB 2ZMEA 3CP8A 2K9SA 2ID6A 2QSFX 1TBXA 1ZK8A 2H1LA 4J19A 4PJNA 4KDPA 2CO5A 1QZEA 3G1OA 2EINH 4IL6C 3OYCA 1U9OA 5FKMA 4C2MJ 4HNTA 1X2NA 2UXXA 4BY7J 2XAFA 3EUKL 1I27A 5C3EJ 3HOVJ 1MSEC 3BQYA 1GVJA 1KU9A 2VKHA 4E7LA 2VB6A 3IP4B 4H0EA 2XAHA 1BW6A 5ILVA 1BI0A 1MZBA 1ODDA 4MHGA 3P9CA 5FD6A 1RRJA 1DU0A 1VQ4I 5EEAA 1XD7A 3FK6A 3J7YJ 4M9XA 4XKBA 3DLAA 3GZNB 2R7UA 1R4NB 2XROA 4A3GJ 4UB8C 1G3WA 4BJ6C 4BL0B 3TW6A 4CZCA 1SD4A 4HX7A 4HLYA 3N97A 3DKXA 4DIQA 5EDNA 3FZVA 1ONVA 1TTYA 2DK5A 1Z05A 3U21A 4E7JA 2VPRA 1JJ8C 4Y13A 2IXSA 2H94A 3S8PA 1F9NA 1XS9A 3BJ6A 3C2GA 4AUXA 1DDNA 3LL7A 3S1RJ 1RUOA 1DGWY 4RM3A 3CUQB 1VQ7I 1HDPA 3TO7A 3A01A 3W6KB 2L7FP 3HRUA 1P7JA 2JA5J 3H5RA 4OINF 5DCMA 4WCGA 4FQGA 2K27A 3GFLA 1AKHA 2HPIA 1XGNA 5IOZA 1JHHA 5JVGF 5FRMA 5CVJA 1TW2A 2PMHA 3T1BA 1QPIA 4RDUA 3LA2A 3FF5A 1F5TA 4YIRX 2A69F 1IRGA 2ME0A 3GO5A 3HG9A 2DDBA 1HC8A 2IBDA 3GMEA 2ZJQF 3Q3SA 4W1UA 2OZ6A 4M74A 3VFZA 2OTJI 1XGSA 1A5JA 3K4LA 4IHTA 3GFIA 3WU2C 1BL0A 2DN0A 3KZYA 2M0MA 3OYNA 3KZIC 3KEOA 3MD2A 1P9QC 5FJ8J 2ESHA 4HSTA 1ZRFA 2Z16A 3S1QJ 2XB5A 1KQ9A 3F3XA 1FNNA 3JSPA 3L2UA 2ELJA 3K0LA 4FCYA 4JQFA 5B66C 5TISC 4C9YA 2LFBA 3HOXJ 1A6QA 5E1ZB 3RQIA 2CFXA 3KYDB 3Q9SA 3ZGKA 3BG5A 3J7AO 2CWEA 3QYFA 4CCNA 1MBGA 4IVNA 2ZCWA 1YOVB 4P9FA 2M3AA 3CDIA 2O9LA 2XSDC 3CCQI 5BQTA 2PJPA 1BI1A 1KU7A 3MKZA 2MSYA 3DPLC 3OYEA 1W36C 2CV1A 5HDGA 4Y3OA 5LHHA 1R1VA 4YIFA 2DMPA 4DJAA 1LVAA 4NC6A 3GTKJ 3K4NA 3WHCA 5TJJA 1JUPA 5DTDA 1RKWA 2ELHA 4M6XA 3REOA 4F55A 4M71A 4JX6A 4NBQA 3ASOH 4JYKA 2EFPA 3V8JA 3PFYA 2V79A 3LFKA 4A3JJ 1K6OA 2O5RA 3CDLA 3WODF 2M9HA 2F5VA 3LSJA 5HDNA 2R7VA 3HOZJ 2LC2A 3C2BA 1VQKI 3BG9A 3S17J 1PDNC 1MBHA 1YS6A 2PMZN 1S7OA 5B1AH 3I4NJ 3P7NA 1N77A 3IH4A 1XX5A 2LF7A 4IJAA 1HW2A 1UG2A 2PBIA 5H2FC 2OQGA 5C4XJ 1Y0UA 1WSUA 5FFXA 3Q9VA 2XV4S 2K3FA 2DFEA 2Y0SA 5F6FA 2GOMA 4QIWN 2QLZA 4BDZA 5BPIA 2BHZA 1Z21A 2VONA 1BC7C 4IQJA 5DM7F 1FPQA 4HPQA 1GUUA 4Z2YA 5L3FA 3GTMJ 3DU6A 4XIDA 1MGTA 1K4SA 5H20A 2CSOA 2W85A 3TQNA 5F1JA 1DP3A 2OAZA 2Y31A 4B3AA 3LSGA 4FETA 1T56A 2ID3A 2VIXA 5JHFA 3GLLA 3FWEA 5KAIC 1W1WE 3ABKH 2TCTA 2QA4I 1F43A 1YITI 3WTVC 1V55H 3S1NJ 1FIPA 1XG1A 3GYHX 1E17A 3MVPA 2DMQA 1YI2I 2B0LA 3PUFA 5LFAA 1J0RA 2HZDA 1VQ9I 2DOFA 4BHBA 2I5UA 2ZJ2A 3H3UA 1M1EB 3G6EI 1ZAOA 4MFEA 1LE8A 1ZN2A 1MSFC 2LG4A 2DA6A 1RC9A 3BR3A 4ZYGA 5BS6A 5LGUA 2M2EA 1F4KA 3RPUD 1G3SA 5ILUA 4D1QA 5E17F 2FBIA 3G1MA 3Q0UA 2QSHX 2R93J 3EUHA 3FMSA 2EZKA 3VPRA 1EKEA 2WAFA 5FKNA 2P7CB 4S0HB 2BXZA 3EPZA 3FMQA 3L1PA 1W7PB 2HYJA 3BG6A 4LMYA 2DI3A 4UUTA 5L3CA 3JRIA 4U0WA 5HODA 1V5FA 2ZNZA 2EWNA 3A03A 5LLQA 4XICA 5LEJA 2X0LA 2YX4A 3UR3C 2EIMH 2QF7A 2IAIA 2F4OB 4RAYA 1J09A 4F93B 1Z7LA 3DEWA 4ZDPA 3VYUB 1FOXA 2DPDA 3COAC 3JREA 2GA2A 4JBAA 3HOTA 5EEHA 5K7ZA 2PX9A 1BOAA 3V42A 2FD5A 4Y52J 1YE9A 2FA5A 4CHUA 3PNVA 2LLKA 3K4MA 2VKEA 3M4OJ 1NTCA 1APLC 3DFGA 2MH9A 3FXLA 2L5QA 4IEJA 2JSPA 4A3IJ 4NQWB 1MDMA 2L4AA 2VODA 2DMNA 2LRDA 2KIQA 3SDGA 5CJ9A 4BHCA 2QKMB 2FNAA 4IRIA 2V4JC 1PVEA 2MABA 4W97A 1DPRA 3VOEA 4DYQA 4GYIA 3OYHA 9ANTA 3OYLA 1MJAA 4E4HA 1ZH5A 4HDVA 3QPHA 2P7VB 2IGOA 4YFXF 2DA2A 1RPWA 1K7AA 2CW8A 3F22A 3PIPF 2DFIA 2MGQA 3WTSC 4ZTFA 2ME6A 1ON2A 3OOPA 4QPQA 1T8IA 1OPCA 1GHCA 1HCRA 3DBLB 4UVBA 2LKPA 1YTYA 4AM3A 2G9WA 2CS3A 3AKZA 2M0CA 5FLXZ 2HYFA 3S2HJ 2L9NA 2X6YA 2ZB9A 3DF8A 3KLOA 5DD4A 2BW3B 3FKJA 3PNTA 4LIVA 3FIWA 3BTJA 4Z6YA 3S2WA 3CO6C 1GT0C 4DGWB 3QPTA 2MA3A 1O3RA 4WXCA 4LG3A 1U9NA 4HQEA 1R36A 1SD7A 2PQ8A 1UELB 2FEZA 1X2MA 2TRTA 4BJTA 2Y2ZA 2Z2SB 3DTEA 2KIUA 1YJ9I 5IT3A 1WJ5A 1TW3A 4BJ5C 4ETSA 3DEUA 1QVUA 2EBIA 2F48A 1I6HJ 3TP0A 1GLNA 3F8MA 2DA5A 1IXSB 2V6EA 1S7EA 3MZYA 2O61A 3VYSB 2BHYA 3WTUC 3ZN0A 1JT0A 4E70A 3LSIA 4MFDA 4ZZDA 4CSWA 1HXDA 5JFRA 1TWGJ 1W5SA 2FBKA 4UNOA 2KDZA 1V3FA 2RQQA 1SEUA 1XMKA 5F04A 5D6EA 4A0YA 3QPSA 1IZ1A 4WXHA 1OCPA 1QVTA 5FLXK 1MW7A 4EV0A 5HLTA 1BR1A 3PSFA 1K78A 2R4GA 1ETWA 1YQAA 1V4RA 2JWTA 2OTLI 5D4SA 5IPAA 2VJJA 3M1CA 1D5VA 2ICWG 4NHJA 4JP0A 4IHXA 1I1SA 2FE3A 2XPUA 4ZYDA 3B02A 4U7DA 3DPUA 1LDDA 5J1YA 3CCMI 2RC4A 2ISYA 4XKCA 3CJNA 2OD5A 2IP2A 2IS2A 3GXOA 1BA5A 1T38A 1MBEA 5JLXA 3IKTA 4KN4X 3QU6A 3IWFA 4FISA 3RPUA 2AXLA 1ZREA 2M30A 4RAFA 2DFHA 3M8EA 1IXCA 1J5YA 4PJJA 2QQAA 1XB4A 2P81A 1TQPA 4CCMA 1TLHB 4G94A 2L02A 4XKVA 5D6FA 2D45A 5E1XA 3LAPA 3JRAA 2WV0A 4KA4A 1XSVA 3NARA 3DXJF 5BMZA 1IV6A 5IOYA 2ESNA 4A3BJ 3SYTA 3IRRA 2EFOA 4DYRA 1QQIA 2GIZA 3BJOA 3ASNH 3IAM2 3PNYA 5IYDJ 2ZKZA 2X1EA 3ECHA 5TRDA 3DBRB 3DU5A 4G7ZF 2DMUA 2PFBA 2EIJH 3FBIB 1NG6A 4HAMA 3IKVA 2XB0X 3RIRA 2VLAA 3GZ5A 4KMFA 4EM2A 3HOUJ 3FM5A 1O57A 5ERIA 4P96A 2D5VA 1ZYRF 3GTQJ 1L0OC 2LDUA 4EEFG 2L2OA 2QVOA 4XONA 4PJ0C 2V1DA 4PUSA 3O8HA 5F0HA 3OS0A 3MMYB 5F08A 1REPC 4YRVA 3JTHA 1FYLA 2NS8A 5J40A 3CUQA 1SVOA 2JQ7A 3FM3A 2EILH 4BE1A 2ACJA 3VYRB 2NYXA 3FHZA 4BE0A 2UZKA 1BI3A 4HNVA 4TV7A 2JVGA 2W24A 3Q5FA 1MKMA 5K5RA 4ZYAA 5D8KB 1TWHJ 1TQIA 3ZMUA 4GCVA 1VQ6I 3HKZN 3TGNA 3BCBA 2LMDA 2CQ7A 2DT7B 4M3EA 3WTWC 4ENKA 1RR8C 2BXYA 2IT0A 3F8NA 1BIAA 2P6SA 2EZHA 5B5EC 3CO7C 2KKOA 2A07F 2FJ1A 2HGCA 1XMXA 4C2TA 2AQEA 4AYBN 5FD5A 1ETYA 1CF7A 3KP6A 4RMNA 4HX4A 2YUSA 2R7ZJ 4D5CA 1I5ZA 2A6HF 2JSCA 4DZPA 4L9VA 4A3CJ 1B8IA 3E6DA 3BTIA 4FT8A 4F92B 4A3DJ 1IW7F 1RIOH 3QOPA 3VB2A 2ZXIA 4AVZA 1A35A 3JR9A 1HF0A 5FRNA 5E18F 2R5YB 4JOMA 2CUJA 2VKDA 3NEUA 4UHTA 4N4OB 1WI9A 3SEZA 5E1WA 3HOYJ 2E7WA 1KYZA 2Z99A 4G7OF 3K7AJ 4S05A 3C3WA 1QA6A 4XOTA 5LRRA 3AL0C 2EFWA 4XRFA 5IYBJ 4M3DA 4AVPA 1FC3A 2QENA 1D1AA 4LLLA 3MKLA 3A2KA 4NQWA 3QOEA 2NNNA 3M8FA 3H9GA 3ONQA 3T0YA 1HSJA 3DV8A 1QNTA 4L18B 2YS9A 4HBLA 3OS2A 4XMYA 2R5ZB 1LB2A 1E2XA 1ZG5A 2PEXA 2MG4A 3FISA 2F4MB 1WHUA 2J5OA 1HKSA 4A2UA 2STWA 1MD0A 5B3SH 2N8GA 2QGUA 4LLNA 1ZGWA 1OLTA 3F72A 4R8HA 2STTA 4AWXB 3HBLA 5K7HA 3GTGJ 2RGVA 2FF4A 4XLEA 1IN8A 3TP3A 4E7ZA 2GLOA 3BZ6A 3RKWA 2OBPA 5LGNA 3E7LA 5GPCA 4CA0A 5J4VA 2G7HA 3HYIA 2XRLA 3BLYA 4WWCA 1O3SA 3W2VA 1UFMA 4CCOA 1VQMI 1K61A 3DCFA 2R7OA 3BROA 2ZSHB 2FRHA 5M5XJ 1T2KA 3I64A 2IW5A 1VQLI 2KIMA 1P6RA 1XGMA 1OFCX 4XK4A 2CGPA 3ZPLA 3FXOA 1MBFA 2KHMA 2D1VA 1R5GA 5C44J 4RLFA 1GV2A 1SFKA 4CXFA 3RKXA 4D5FA 5FO5A 3E5UA 3K10A 4KYWA 2VC0A 4EGZA 1KU2A 2L9SA 2P5KA 4KNYA 2GQQA 2HZTA 2ADUA 1AU7A 3S16J 3HDDA 4LG0A 1TNSA 3KX2A 4A6DA 3M3YJ 2LY1A 4Y17A 5CVRA 2V9KA 1P2FA 3GUDA 2DK8A 3CCRI 1U6GA 2HOTA 5FKKA 1X3UA 1WCMJ 4KT5C 4XNFA 1WKMA 5JHUA 3KEYA 5LD2C 2V1UA 5CLSA 3V7SA 1ITYA 4XRSG 3PFIA 3M8JA 3PJRA 1EH6A 1HA8A 1T08B 1WVRA 4RM2A 3E5QA 4M6VA 5IP7J 1D1CA 1MNMC 3HSEA 2UXNA 4CZZA 4IHWA 3RQ4A 1CGPA 4U88A 3QODA 1X1BA 4BBRJ 1FY7A 3DQVC 3JTGA 2W7NA 1LDKB 3F8BA 2E2IJ 3WU1B 1OCTC 2Y69H 5DUKA 2BW3A 4RGXA 4DOZA 5F1RA 3MFKA 3ML6A 4FE7A 4CCLA 2EB7A 2M7BA 2VQGA 1JGGA 2MLGA 3S2DJ 3BP8A 3G71I 5DS9A 2HXOA 4BEHB 2IGMA 3CP2A 5M3MJ 5JLWA 3RYRA 1R22A 3F23A 4J00A 4GYGA 2JJ7A 2K5CA 4V2GA 4XKWA 4B8XA 3OS1A 1LE8B 3FDYA 1YRNB 1VZ0A 2NVQJ 2HOEA 1XTAA 4CYCB 1AA7A 3I54A 2QEXI 2LK2A 2M87A 2CUEA 3LSPA 3ZQFA 3HOSA 3JRGA 2ZMEB 3JAMZ 2FMYA 5IY5H 5EGOB 3S15J 1UCRA 1NK2P 3OOUA 4MNUA 3KP7A 5E3MA 2MLKA 1MBKA 2EFQA 1UHMA 3G73A 1HW1A 2IVMA 4F7ZA 3J80K 1UG0A 2JMWA 4LB6B 1PUFA 2E1NA 1F36A 1YS7A 1MDMB 2BVMA 2WV1A 3FBNB 2DT6A 3BZKA 3HPGA 2QBYB 1OYWA 5D8LB 3KEQA 3PQJA 1IV8A 4E7HA 1WJAA 2VBZA 1UHWA 2HFHA 2COMA 4C3IJ 4IO9F 4V19K 1WJCA 4XLFA 3WHBA 1G6NA 3MKYB 4ZH4F 1G4DA 4PZJA 2M4KA 2F5FA 4CO8A 2XDVA 1FBSA 4EJUA 1K6YA 2NOJB 2YR2A 3H35A 2L54A 1Y8RB 1EA3A 5EG0A 1JKOC 3HOWJ 3CUOA 3RPQA 3ERMA 4LD5A 3C1DA 5IYCJ 3CLOA 5A2QK 4XLNF 1ZRDA 1D8JA 4CH7A 2BY3A 3I4PA 3U2RA 4NNJA 3FXKA 1JJ6C 1S29A 2VJIA 2KRCA 1YW8A 3IWZA 3KIOA 2DTRA 2ZSIB 3PSIA 2XKPA 3JAMK 3L2QA 2R7RA 3HXLA 1Z9CA 3AG3H 2KP6A 4H4KC 2V1XA 4QPOA 4ASNA 3RKQA 1O7LA 4BY1J 1R58A 1YW9A 4GFBA 4D7MA 3FXQA 3ZQ7A 3CC4I 2O03A 1EF4A 3TDUC 1U8RA 3HUGA 1KONA 3SDBA 4O6JA 2VJ4A 4E7SA 3V8KA 4BXXJ 2OC6A 4XLHA 4OMZA 4XR6A 4G9YA 2Z3YA 4K2EA 2OA4A 2PN6A 1OYYA 3HIFA 4YFNF 3E6BA 4BH9A 3OYBA 3K4BA 3VWBA 1Y39A 3ABMH 4XN0A 2HPMA 3OWTA 2VKVA 1QU3A 1G8XA 4PDKA 3RYPA 4MO7A 2E19A 3SFIA 1Y6IA 2XUBA 3WTYC 2AS5F 2OV7A 1ETVA 4EM1A 2L9RA 2CQXA 1FBUA 1V54H 2FXAA 2Y30A 3F6OA 3H92A 1BW5A 1MMNA 2X6WA 3CLQA 2Y48A 3HRMA 4NB5A 1OKRA 3GFJA 5AONA 2VI6A 3CJRB 4I76A 3OYDA 1PUEE 3RI4A 2ZC2A 2Z33A 1ENHA 2IPQX 3OYMA 2QBYA 2KLOA 2H6CA 4UV8A 2VXZA 1T0FA 1T0FC 3K6GA 2CQQA 2DJIA 4AIJA 3OR1C 4WX9A 2NXNB 2EQRA 5M5YJ 3WGIA 2DAOA 3L9FA 3P5JA 2YU9J 4ABZA 4PJLA 1Z1DA 4IOAF 5DV5A 3PIOF 3CUQC 4GRIA 1HKTA 5IT9K 1AKHB 4CYDA 4BU2A 1IRFA 4RGSA 4GGGA 4RA2A 4ENNA 3H5AA 3TBIA 3RCOA 2LBFA 2JA6J 2NVUB 1O3QA 3CCUI 3PO3J 3FXMA 3M7GA 1BIBA 2ECBA 2E2HJ 2FQ4A 1Y1WJ 2Q2EB 2P8TA 3JRHA 4L9JA 3H9JA 3WTXC 3LWFA 1A36A 2E1OA 2LH9A 2CQKA 1ETKA 1IG7A 4HSRA 5BNGA 3NQOA 4AYBA 2VQLA 3E6MA 2Q1ZB 2QCOA 4M9SA 5FROA 3H0GJ 3I55I 4HG2A 3K1MA 2KJBA 2XGXA 2WB1N 4I6ZA 2GAUA 4BHPA 1X19A 1OCRH 4N9HA 5HLGA 3FHNA 3DKWA 3OL3A 1NHAA 4M9ZA 3RSNA 2QM3A 4L0ZB 3FXUA 4KISA 3L2CA 3WTZA 1SVLA 3LA3A 5E3OA 2YSRA 3K69A 2H6BA 4DNCA 1RZ4A 3Q0WA 3KPHA 4A5MA 2CFOA 3CTAA 1I39A 1TQMA 1IUFA 3BY6A 2H8RA 4HRIA 1JI8A 4RB0A 2OCEA 1SC7A 1ACIA 2RQPA 5CYVA 4UVAA 3DTIA 3ERED 1S72I 2DU9A 1TP4A 3W6JB 1FT9A 1LFPA 3CJTB 3W2AA 3JCUC 4HA8A 4C2UA 2VOOA 2OQRA 2DA3A 2DJNA 2V1NA 4X0GA 2BBYA 1T39A 4ENMA 5FLVA 3LQRA 3G2BA 4B4CA 4P1WA 1CF7B 4MLOA 3NWTA 5CPRB 3W3CA 4J01A 3CC2I 3O2PE 4A12A 1Y8QB 2M8EA 2QYOA 1GDTA 3RJPA 2LNBA 3WG9A 4PGGA 4YG2F 3B6AA 1FOKA 1T6SA 4A93J 4AD9A 3K1PA 2IGNA 3I0TA 2F4IA 1XSDA 1W5CC 3HTSB 2F2EA 4I99C 2KDOA 3Q0VA 4XM3A 4XSXF 4AIHA 1J2XA 5LHIA 3OV8A 3GZ6A 5D5VB 1PJRA 4RB2C 4L0YB 1R5HA 4CCKA 5J4YA 5EG0B 2DXIA 4L9TA 4BACA 2RNGA 1ZKGA 1D5YA 3DPTA 4JX5A 4ZYEA 3WGHA 2K3PA 2ZO4A 4OWRB 2WBMA 1YW7A 4EJTA 2EZLA 4XRMA 1UAAA 1E3OC 3CMEI 3NAUA 5DDGA 4OU0A 1U3EM 2JA2A 5D5UB 2R0QC 2RKHA 2R5ZA 3R61A 4Y33A 5C4JJ 4ESBA 1HDDC 2IJLA 3T5XA 2L01A 5CVUA 1U0JA 2PMUA 1ZARA 4BE2A 4YFKF 3QQAA 1K78B 1J59A 2O7OA 2HKXA 3LSMA 1FP1D 3S3NA 3ULQB 2NVXJ 1GXQA 2R7QA 2R7TA 1N75A 2KRHA 3K2AA 1JKRC 3MQ0A 4FHTA 1KA8A 2FSWA 2MD5A 2XAGA 3LSTA 3GLXA 2XPVA 1ZLKA 2HWVA 2KMUA 4A3KJ 5H6RA 4PK4A 2BY2A 3BOQA 5J3LA 2NOGA 2HOSA 1X1DA 2A05A 2A5WA 2M8GX 4XL9A 4ZJZA 1R4MB 3JRBA 3S3OA 1QPMA 3GWZA 5JVTA 2ZXWH 4RB1A 2FUG2 2WWYA 1YIOA 1D1BA 4LOCA 4KUMA 2LKSA 4A69C 4NC8A 4RB3C 3OYIA 1FTTA 4KFCA 2WB1A 4UVCA 1YHQI 3C2HA 3F8FA 2PI0A 3R6SA 3J80Z 1H9GA 2FX0A 3L2WA 4YELA 2RREA 2X6XA 2VASA 2R7SA 3I9V2 3VYTB 5ICEA 1ZELA 3V8LA 4LLGF 3QWLA 1X3WB 2HU9A 1JUSA 3D5LA 4JX4A 3V4GA 2K9MA 4UXNA 3VODA 1BJZA 3A0BC 1SANA 3LOCA 4G6QA 4KIGA 3ISPA 1RUNA 4FASD 2K9QA 2IS1A 1LPQA 1RI7A 1H0MA 2HQ5A 4GXOA 1PP7U 1Y1VJ 2RDPA 1FTZA 2EA4A 1B6AA 2E5NA 2W1OA 1EV7A 4L5EA 4BGDA 4CICA 3RZDJ 1FMWA 1D3YA 1WJEA 2XPWA 2CV0A 3QAHA 2CMPA 3ZQCA 5KAFC 5ILSA 1PUFB 1FEXA 3L00A 3O6BB 3OL4A 2BV6A 1HOMA 1MMGA 1IDYA 1B72A 4L9NA 1SMYF 1WFXA 2DA4A 2LD5A 2X48A 4XN3A 2EH3A 3LNQA 1NK3P 2LY2A 4BQNA 4CUGA 3CQZJ 2KJCA 3R0AA 4DBQA 1D0YA 3FX3A 3HPHA 1BOBA 4ZYHA 1N25A 2KIFA 2DDAA 4HEA2 3LSKA 1FLIA 3V7CA 2KFDA 2OPTA 3TDZC 1DUXC 1USTA 3CMMA 1QRYA 3AL0B 3GTPJ 2HS5A 5HS8A 2MH2A 1LJ9A 1LQ1A 3LAJA 2WC2A 4BQOA 3BG7A 4EVIA 1SFUA 2HXIA 2M45A 1JXSA 4OAZA 3OIOA 3MKWB 2L7MP 2DQRA 3K9TA 1K4TA 2MBFA 2E34A 1KQ8A 3R4KA 1UHSA 3JRCA 3M07A 1Z7UA 2UV1A 1SMTA 4M3GA 2L9VA 3UNGC 4ZZLA 4EJVA 5J8CA 3I56I 2WTEA 3L7WA 2CRGA 3E97A 1G2HA 4HF0A 4PCQA 3HUGB 2DPUA 2ZJPF 3RZOJ 2Z1DA 1SAXA 2HTJA 3M1EA 4NC7A 3IL2A
chains in the Genus database with same CATH topology
4XRSG 1RKWA 2XGCA 4JX6A 4JYKA 2HI3A 4M6VA 4A3JJ 3CDLA 1OJLA 1HLVA 2M9HA 3LSJA 4C3HJ 5IP7J 1RETA 2AO9A 2I10A 1MNMC 1TWAJ 3HOZJ 3C2BA 4IHWA 3BG9A 1ZR2A 3S17J 1MBHA 2OF7A 2PMZN 4BBRJ 3A01B 4CYCA 3I4NJ 3IH4A 2E2IJ 2M34A 2X9DA 1UG2A 1OCTC 3I4MJ 5C4XJ 3FKIJ 4FE7A 1AHDP 4QIWN 1JGGA 3S2DJ 4FE4A 5DS9A 2HXOA 1IRZA 3ZQGA 5M3MJ 5JLWA 2JJ7A 1A6IA 4V2GA 1LE8B 1YRNB 4A3MJ 1U8BA 2NVQJ 4CYCB 1GUUA 4QSHA 3GTMJ 4XIDA 2LK2A 3BR0A 1B8IB 2CUEA 1TWCJ 3LSPA 3ZQFA 3JRGA 1WPKA 5F1JA 5EGOB 1MH4A 3S15J 2Y31A 3GTLJ 4B3AA 2HDDA 2L7ZA 3LSGA 1NK2P 3OOUA 1T56A 2ID3A 2VUMJ 5FKOA 2Y9ZA 5E3MA 1ETQA 2TCTA 1F43A 1MBKA 5EGOA 1JTYA 2JMWA 2DMTA 3S1NJ 1PUFA 1FIPA 1XG1A 1F36A 2G0EA 3HGYA 2ECCA 2DMQA 3MVPA 2WV1A 5EYRA 3D1NI 5FLMJ 2LR8A 4DYCA 4V2FA 2WAQN 4MFEA 1LE8A 3BTCA 1MSFC 1X58A 2DA7A 2DA6A 3ZOBA 4C3IJ 2LVSA 3BR3A 3S1MJ 3WHBA 3PM1A 2M2EA 4RBOA 1RKTA 3Q0UA 3G1MA 2R93J 2B63J 2EZKA 3VPRA 3JRDA 5FKNA 2GBYA 3HM5A 4S0HB 4DW6A 1POGA 5EG0A 3L1PA 3IV5A 5M5WJ 2HYJA 5EF6A 1JKOC 3HOWJ 4UUTA 3JRIA 5HODA 5IYCJ 3A03A 5IP6A 4XICA 2QF7A 3OSGA 2IAIA 1IDZA 1JJ6C 1K83J 3DEWA 3JREA 3LSRA 1GV5A 1ZQ3P 5K7ZA 4M3FA 2LKXA 3RKQA 4BY1J 2FD5A 3GTJJ 1ETOA 4GFBA 4Y52J 4D7MA 1ORKA 2CUFA 4G12A 1EF4A 2LLKA 2VKEA 3M4OJ 3FK7A 1XC5A 3BR1A 1NTCA 1APLC 2X6OA 4BXXJ 4IEJA 5J1RA 2W48A 5F0CA 1YRNA 1ZTRA 4A3IJ 2K40A 4X1EA 2DMNA 4X6AJ 1I3QJ 3SDGA 1W0TA 3MN2A 2VKVA 4W97A 4DZJA 4DYQA 9ANTA 2Y9YA 3HEFA 3ZQHA 4MO7A 2E19A 5GPAA 3SFIA 2NVTJ 1ETVA 2DA2A 2L9RA 2LY9A 2CQXA 1RPWA 1U78A 1R9TJ 3BQZA 2Y30A 1BW5A 2R5YA 2MGQA 3IH2A 2ME6A 2VI6A 3CMYA 1FIAA 4I76A 3BG3A 1HCRA 5EZGA 1ENHA 5IP9J 1WH7A 2CQQA 4D7NA 2M0CA 2O8KA 1I50J 2E2JJ 3S2HJ 2ZB9A 2EQRA 5M5YJ 3ZQLA 2YU9J 4ABZA 3FIWA 2CU7A 3BTJA 1VF9A 1VNDA 3W6VA 1GT0C 1U9NA 5F0FA 1AKHB 2TRTA 1X2MA 2Y2ZA 1JKPC 2JA8J 2JN6A 1WGXA 3S14J 2IEKA 2JA6J 1JUMA 3PO3J 2KT0A 1QVUA 1VI0A 1MBJA 2EBIA 3HGGA 2COBA 2ECBA 2E2HJ 1I6HJ 2FQ4A 3IH3A 3TP0A 1Y1WJ 2DA5A 3JRHA 4A3LJ 1S7EA 2L0KA 3H3VK 2E1OA 1ETKA 1JT0A 1IG7A 5F27A 5BNGA 4MFDA 1GVDA 2QCOA 3H0GJ 1TWGJ 2KDZA 4A3EJ 3BR2A 1TWFJ 5F04A 2WB1N 4I6ZA 3QPSA 3O8GA 4A3FJ 1OCPA 1QVTA 1O4XA 2R92J 1DU6A 5EZHA 2EZIA 3UKGA 3G1LA 3CCYA 5E3OA 1ETWA 2JWTA 5K7FA 3Q0WA 2XGDA 5E3NA 5IPAA 4BBSJ 4UUSA 1IUFA 2H8RA 1LFBA 4JP0A 4IHXA 2MW8A 3F0CA 4FTHA 2XPUA 1WH5A 5J1UA 5J1YA 1H8AC 1BA5A 2DA3A 2DJNA 1MBEA 5JLXA 2DA1A 5FLVA 4B4CA 4FISA 3BTLA 1IC8A 1H89C 1ZR4A 4MLOA 1FJLA 1ETXA 1GDTA 2DTZA 1JKQC 2P81A 1UMQA 5GP9A 4Y7NJ 3B6AA 3JRAA 3NARA 4MIMA 4A93J 1IV6A 5IOYA 4A3BJ 1TC3C 1T33A 2CJJA 4DYRA 4UUSB 3Q0VA 1Z77A 2LP0A 5IYDJ 2K9NA 4AC0A 3B6CA 1VFCA 2DMUA 5EG0B 4IHVA 3ZQIA 3GBGA 2XB0X 1D5YA 1ZKGA 2H1KA 4JX5A 1MH3A 3HOUJ 2ELKA 2RAEA 1IGNA 2D5VA 2EZLA 4XRMA 1W0UA 3GTQJ 1E3OC 3NAUA 4EEFG 1P7IA 5FKLA 3TW7A 2R0QC 2R5ZA 3O8HA 5F0HA 3A02A 5C4JJ 1HDDC 5F08A 3BR5A 1RR7A 3QQAA 2NS8A 2O7OA 1CQTA 2HOAA 2NVXJ 2NVYJ 3JRFA 3K2AA 1JKRC 3BT9A 2Y0SN 4HNVA 3HB9A 2XPVA 1IJWC 2K9SA 4A3KJ 2ID6A 1ZK8A 5J3LA 4J19A 3PO2J 2NOGA 1TWHJ 2HOSA 2M8GX 3G1OA 3JRBA 3HKZN 1U9OA 5FKMA 4C2MJ 1X2NA 4M3EA 4B1RA 4LOCA 3OSFA 4BY7J 4A69C 5C3EJ 3HOVJ 1FTTA 2EZHA 1MSEC 2AHQA 2FJ1A 3BQYA 4AYBN 1ETYA 2FX0A 1BW6A 2YUSA 2R7ZJ 4D5CA 4DZPA 4A3CJ 1B8IA 3BTIA 4A3DJ 1DU0A 5EEAA 3FK6A 1B72B 1JUSA 4JX4A 1SFOJ 3JR9A 1BJZA 1Q1VA 1HF0A 1SANA 4A3GJ 3LOCA 2R5YB 3TW6A 5EDNA 5M3FJ 2K9QA 2HQ5A 1JTXA 2VPRA 1JJ8C 1Y1VJ 3HOYJ 1FTZA 3TEDA 3K7AJ 4L5EA 2XGEA 1XS9A 3RZDJ 1LFUP 4AUXA 3S1RJ 2XPWA 1HDPA 5IYBJ 4M3DA 2JA7J 3A01A 3MKLA 3ZQCA 2L7FP 1P7JA 1PUFB 2JA5J 1FEXA 3GTOJ 1HOMA 1AKHA 1IDYA 2YS9A 5IOZA 1B72A 2DA4A 2R5ZB 2MG4A 1QPIA 4RDUA 2LD5A 2X48A 3FISA 2ME0A 2N8GA 1Z0XA 2EH3A 2NS7A 3LNQA 1NK3P 1ZGWA 2IBDA 3CQZJ 3Q3SA 4W1UA 1A5JA 4C3JJ 4XRSA 3HBLA 5K7HA 3GTGJ 2LTPA 2GLOA 3TP3A 1BL0A 2DN0A 1WI3A 3E7LA 5GPCA 5FJ8J 1H88C 2XRLA 2GM4A 1K61A 2OPTA 3DCFA 3S1QJ 3SJMA 2XB5A 5M5XJ 1OFCX 1QRYA 4XK4A 4FCYA 1MBFA 5C44J 3GTPJ 3BR6A 1GV2A 4D5FA 2LFBA 3HOXJ 3RQIA 2HXIA 4M3BA 3OIOA 3S16J 1AU7A 2L7MP 3QPLA 3HDDA 3BG5A 1MBGA 3M3YJ 1UHSA 3JRCA 4M3GA 4QTRA 2O9LA 2XSDC 4NDLA 2CRGA 2HOTA 2MSYA 1G2HA 5FKKA 4IHYA 1JT6A 1WCMJ 4BKXA 3RZOJ 2JK3A 2DMPA 5E3LA 1RESA 3GTKJ 3WHCA 1JUPA 5DTDA 1ITYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRS G;  1RKW A;  2XGC A;  4JX6 A;  4JYK A;  2HI3 A;  4M6V A;  4A3J J;  3CDL A;  1OJL A;  1HLV A;  2M9H A;  3LSJ A;  4C3H J;  5IP7 J;  1RET A;  2AO9 A;  2I10 A;  1MNM C;  1TWA J;  3HOZ J;  3C2B A;  4IHW A;  3BG9 A;  1ZR2 A;  3S17 J;  1MBH A;  2OF7 A;  2PMZ N;  4BBR J;  3A01 B;  4CYC A;  3I4N J;  3IH4 A;  2E2I J;  2M34 A;  2X9D A;  1UG2 A;  1OCT C;  3I4M J;  5C4X J;  3FKI J;  4FE7 A;  1AHD P;  4QIW N;  1JGG A;  3S2D J;  4FE4 A;  5DS9 A;  2HXO A;  1IRZ A;  3ZQG A;  5M3M J;  5JLW A;  2JJ7 A;  1A6I A;  4V2G A;  1LE8 B;  1YRN B;  4A3M J;  1U8B A;  2NVQ J;  4CYC B;  1GUU A;  4QSH A;  3GTM J;  4XID A;  2LK2 A;  3BR0 A;  1B8I B;  2CUE A;  1TWC J;  3LSP A;  3ZQF A;  3JRG A;  1WPK A;  5F1J A;  5EGO B;  1MH4 A;  3S15 J;  2Y31 A;  3GTL J;  4B3A A;  2HDD A;  2L7Z A;  3LSG A;  1NK2 P;  3OOU A;  1T56 A;  2ID3 A;  2VUM J;  5FKO A;  2Y9Z A;  5E3M A;  1ETQ A;  2TCT A;  1F43 A;  1MBK A;  5EGO A;  1JTY A;  2JMW A;  2DMT A;  3S1N J;  1PUF A;  1FIP A;  1XG1 A;  1F36 A;  2G0E A;  3HGY A;  2ECC A;  2DMQ A;  3MVP A;  2WV1 A;  5EYR A;  3D1N I;  5FLM J;  2LR8 A;  4DYC A;  4V2F A;  2WAQ N;  4MFE A;  1LE8 A;  3BTC A;  1MSF C;  1X58 A;  2DA7 A;  2DA6 A;  3ZOB A;  4C3I J;  2LVS A;  3BR3 A;  3S1M J;  3WHB A;  3PM1 A;  2M2E A;  4RBO A;  1RKT A;  3Q0U A;  3G1M A;  2R93 J;  2B63 J;  2EZK A;  3VPR A;  3JRD A;  5FKN A;  2GBY A;  3HM5 A;  4S0H B;  4DW6 A;  1POG A;  5EG0 A;  3L1P A;  3IV5 A;  5M5W J;  2HYJ A;  5EF6 A;  1JKO C;  3HOW J;  4UUT A;  3JRI A;  5HOD A;  5IYC J;  3A03 A;  5IP6 A;  4XIC A;  2QF7 A;  3OSG A;  2IAI A;  1IDZ A;  1JJ6 C;  1K83 J;  3DEW A;  3JRE A;  3LSR A;  1GV5 A;  1ZQ3 P;  5K7Z A;  4M3F A;  2LKX A;  3RKQ A;  4BY1 J;  2FD5 A;  3GTJ J;  1ETO A;  4GFB A;  4Y52 J;  4D7M A;  1ORK A;  2CUF A;  4G12 A;  1EF4 A;  2LLK A;  2VKE A;  3M4O J;  3FK7 A;  1XC5 A;  3BR1 A;  1NTC A;  1APL C;  2X6O A;  4BXX J;  4IEJ A;  5J1R A;  2W48 A;  5F0C A;  1YRN A;  1ZTR A;  4A3I J;  2K40 A;  4X1E A;  2DMN A;  4X6A J;  1I3Q J;  3SDG A;  1W0T A;  3MN2 A;  2VKV A;  4W97 A;  4DZJ A;  4DYQ A;  9ANT A;  2Y9Y A;  3HEF A;  3ZQH A;  4MO7 A;  2E19 A;  5GPA A;  3SFI A;  2NVT J;  1ETV A;  2DA2 A;  2L9R A;  2LY9 A;  2CQX A;  1RPW A;  1U78 A;  1R9T J;  3BQZ A;  2Y30 A;  1BW5 A;  2R5Y A;  2MGQ A;  3IH2 A;  2ME6 A;  2VI6 A;  3CMY A;  1FIA A;  4I76 A;  3BG3 A;  1HCR A;  5EZG A;  1ENH A;  5IP9 J;  1WH7 A;  2CQQ A;  4D7N A;  2M0C A;  2O8K A;  1I50 J;  2E2J J;  3S2H J;  2ZB9 A;  2EQR A;  5M5Y J;  3ZQL A;  2YU9 J;  4ABZ A;  3FIW A;  2CU7 A;  3BTJ A;  1VF9 A;  1VND A;  3W6V A;  1GT0 C;  1U9N A;  5F0F A;  1AKH B;  2TRT A;  1X2M A;  2Y2Z A;  1JKP C;  2JA8 J;  2JN6 A;  1WGX A;  3S14 J;  2IEK A;  2JA6 J;  1JUM A;  3PO3 J;  2KT0 A;  1QVU A;  1VI0 A;  1MBJ A;  2EBI A;  3HGG A;  2COB A;  2ECB A;  2E2H J;  1I6H J;  2FQ4 A;  3IH3 A;  3TP0 A;  1Y1W J;  2DA5 A;  3JRH A;  4A3L J;  1S7E A;  2L0K A;  3H3V K;  2E1O A;  1ETK A;  1JT0 A;  1IG7 A;  5F27 A;  5BNG A;  4MFD A;  1GVD A;  2QCO A;  3H0G J;  1TWG J;  2KDZ A;  4A3E J;  3BR2 A;  1TWF J;  5F04 A;  2WB1 N;  4I6Z A;  3QPS A;  3O8G A;  4A3F J;  1OCP A;  1QVT A;  1O4X A;  2R92 J;  1DU6 A;  5EZH A;  2EZI A;  3UKG A;  3G1L A;  3CCY A;  5E3O A;  1ETW A;  2JWT A;  5K7F A;  3Q0W A;  2XGD A;  5E3N A;  5IPA A;  4BBS J;  4UUS A;  1IUF A;  2H8R A;  1LFB A;  4JP0 A;  4IHX A;  2MW8 A;  3F0C A;  4FTH A;  2XPU A;  1WH5 A;  5J1U A;  5J1Y A;  1H8A C;  1BA5 A;  2DA3 A;  2DJN A;  1MBE A;  5JLX A;  2DA1 A;  5FLV A;  4B4C A;  4FIS A;  3BTL A;  1IC8 A;  1H89 C;  1ZR4 A;  4MLO A;  1FJL A;  1ETX A;  1GDT A;  2DTZ A;  1JKQ C;  2P81 A;  1UMQ A;  5GP9 A;  4Y7N J;  3B6A A;  3JRA A;  3NAR A;  4MIM A;  4A93 J;  1IV6 A;  5IOY A;  4A3B J;  1TC3 C;  1T33 A;  2CJJ A;  4DYR A;  4UUS B;  3Q0V A;  1Z77 A;  2LP0 A;  5IYD J;  2K9N A;  4AC0 A;  3B6C A;  1VFC A;  2DMU A;  5EG0 B;  4IHV A;  3ZQI A;  3GBG A;  2XB0 X;  1D5Y A;  1ZKG A;  2H1K A;  4JX5 A;  1MH3 A;  3HOU J;  2ELK A;  2RAE A;  1IGN A;  2D5V A;  2EZL A;  4XRM A;  1W0U A;  3GTQ J;  1E3O C;  3NAU A;  4EEF G;  1P7I A;  5FKL A;  3TW7 A;  2R0Q C;  2R5Z A;  3O8H A;  5F0H A;  3A02 A;  5C4J J;  1HDD C;  5F08 A;  3BR5 A;  1RR7 A;  3QQA A;  2NS8 A;  2O7O A;  1CQT A;  2HOA A;  2NVX J;  2NVY J;  3JRF A;  3K2A A;  1JKR C;  3BT9 A;  2Y0S N;  4HNV A;  3HB9 A;  2XPV A;  1IJW C;  2K9S A;  4A3K J;  2ID6 A;  1ZK8 A;  5J3L A;  4J19 A;  3PO2 J;  2NOG A;  1TWH J;  2HOS A;  2M8G X;  3G1O A;  3JRB A;  3HKZ N;  1U9O A;  5FKM A;  4C2M J;  1X2N A;  4M3E A;  4B1R A;  4LOC A;  3OSF A;  4BY7 J;  4A69 C;  5C3E J;  3HOV J;  1FTT A;  2EZH A;  1MSE C;  2AHQ A;  2FJ1 A;  3BQY A;  4AYB N;  1ETY A;  2FX0 A;  1BW6 A;  2YUS A;  2R7Z J;  4D5C A;  4DZP A;  4A3C J;  1B8I A;  3BTI A;  4A3D J;  1DU0 A;  5EEA A;  3FK6 A;  1B72 B;  1JUS A;  4JX4 A;  1SFO J;  3JR9 A;  1BJZ A;  1Q1V A;  1HF0 A;  1SAN A;  4A3G J;  3LOC A;  2R5Y B;  3TW6 A;  5EDN A;  5M3F J;  2K9Q A;  2HQ5 A;  1JTX A;  2VPR A;  1JJ8 C;  1Y1V J;  3HOY J;  1FTZ A;  3TED A;  3K7A J;  4L5E A;  2XGE A;  1XS9 A;  3RZD J;  1LFU P;  4AUX A;  3S1R J;  2XPW A;  1HDP A;  5IYB J;  4M3D A;  2JA7 J;  3A01 A;  3MKL A;  3ZQC A;  2L7F P;  1P7J A;  1PUF B;  2JA5 J;  1FEX A;  3GTO J;  1HOM A;  1AKH A;  1IDY A;  2YS9 A;  5IOZ A;  1B72 A;  2DA4 A;  2R5Z B;  2MG4 A;  1QPI A;  4RDU A;  2LD5 A;  2X48 A;  3FIS A;  2ME0 A;  2N8G A;  1Z0X A;  2EH3 A;  2NS7 A;  3LNQ A;  1NK3 P;  1ZGW A;  2IBD A;  3CQZ J;  3Q3S A;  4W1U A;  1A5J A;  4C3J J;  4XRS A;  3HBL A;  5K7H A;  3GTG J;  2LTP A;  2GLO A;  3TP3 A;  1BL0 A;  2DN0 A;  1WI3 A;  3E7L A;  5GPC A;  5FJ8 J;  1H88 C;  2XRL A;  2GM4 A;  1K61 A;  2OPT A;  3DCF A;  3S1Q J;  3SJM A;  2XB5 A;  5M5X J;  1OFC X;  1QRY A;  4XK4 A;  4FCY A;  1MBF A;  5C44 J;  3GTP J;  3BR6 A;  1GV2 A;  4D5F A;  2LFB A;  3HOX J;  3RQI A;  2HXI A;  4M3B A;  3OIO A;  3S16 J;  1AU7 A;  2L7M P;  3QPL A;  3HDD A;  3BG5 A;  1MBG A;  3M3Y J;  1UHS A;  3JRC A;  4M3G A;  4QTR A;  2O9L A;  2XSD C;  4NDL A;  2CRG A;  2HOT A;  2MSY A;  1G2H A;  5FKK A;  4IHY A;  1JT6 A;  1WCM J;  4BKX A;  3RZO J;  2JK3 A;  2DMP A;  5E3L A;  1RES A;  3GTK J;  3WHC A;  1JUP A;  5DTD A;  1ITY A; 
#chains in the Genus database with same CATH topology
 4KN7 X;  4QWQ A;  2E35 A;  4EJO A;  4HDU A;  2FOK A;  4GO1 A;  3DP7 A;  1HLV A;  4C3H J;  2E1M B;  1RET A;  5IT9 Z;  4E6K G;  2F5E A;  1TWA J;  1BC8 C;  1ZR2 A;  1MIJ A;  3DEE A;  2OF7 A;  3I53 A;  2Z9O A;  3A01 B;  4CYC A;  3ELK A;  2E5Z A;  2JT1 A;  3OIQ A;  2M34 A;  1G3T A;  2XF5 A;  3LMM A;  2QUF A;  2IRF G;  1S7A A;  2HQA A;  1OIS A;  1Y56 A;  1BI2 A;  4JK1 X;  5DM6 F;  4HX8 A;  5GTH C;  2HQR A;  2JPB A;  2RVC A;  4ZDO A;  2GXA A;  5FB2 A;  5JR3 A;  4D9J A;  1IRZ A;  1YJW I;  5HDK A;  3SFZ A;  1NH3 A;  1TT0 A;  6PAX A;  2B7E A;  4A3M J;  2MFZ A;  4QSH A;  3ZMT A;  2X51 A;  2K86 A;  1SD6 A;  5HOO A;  3BR0 A;  1ZRC A;  4B09 A;  3ABL H;  4B43 A;  2BGC A;  4O5V A;  2UWM A;  3EYI A;  5D4R A;  4XOR A;  1TT5 B;  3GCM A;  4A0X A;  2HDD A;  2L7Z A;  3ZMV A;  1OCC H;  3BCA A;  5FKO A;  2Y9Z A;  1HST A;  2DOE A;  5CQE A;  5EGO A;  1JTY A;  1U5T C;  2CYY A;  3HGY A;  2G0E A;  4LFU A;  1QZZ A;  2ECC A;  2RV8 A;  1FOY A;  1QHH D;  4ON0 A;  1XCB A;  2LRE A;  3BC8 A;  4DYC A;  4ITV A;  1AOY A;  1E0E A;  2OCC H;  2XC7 A;  1BN5 A;  3ZCO A;  3CMA I;  5LEK A;  3ZOB A;  4Q5S F;  3S1M J;  4MTD A;  2ZFU A;  4A0Z A;  4LG0 B;  1S5L C;  1FOW A;  2IGK A;  1RKT A;  4KIF A;  4NUB A;  4XLP F;  2I8D A;  3JRD A;  1ON1 A;  2XVC A;  3IV5 A;  3HM5 A;  1G59 A;  4DW6 A;  1U5T B;  3IUO A;  2K4J A;  4E7K A;  2CV2 A;  4ZTJ A;  2P6T A;  1T95 A;  2EK5 A;  3OSG A;  4C30 A;  4G8X A;  1IDZ A;  4XSZ F;  1K83 J;  3ZR8 X;  3ECO A;  5CVV A;  2VE8 A;  3DBH B;  4M6Y A;  3T8T A;  1GV5 A;  3LSR A;  1ZQ3 P;  3KP4 A;  4BUP A;  2RNJ A;  4HNU A;  4M3F A;  2LKX A;  2D2W A;  2ZXJ A;  4BYY A;  2Q0O A;  2F5D A;  3GTJ J;  2TDX A;  1IAW A;  2XAU A;  1YX5 A;  4PFO A;  1SFE A;  2WAD A;  1ORK A;  4G12 A;  1QHG A;  4ENJ A;  3D0S A;  2F5C A;  2HQN A;  5DCF A;  4F3Q A;  1XC5 A;  2IA1 A;  5CVI A;  3VEP A;  3GW2 A;  5J1R A;  2PLY A;  2Y75 A;  2CQN A;  4FX0 A;  4X1E A;  5L3D A;  3HC7 A;  1VQ8 I;  1I3Q J;  1YG2 A;  4BS9 A;  1W0T A;  4RGR A;  1RNL A;  3LQQ A;  4EQQ A;  2W84 A;  2Y9Y A;  2W25 A;  5GPA A;  3LFU A;  4I02 A;  2CUZ A;  1XPX A;  2E71 A;  1YLF A;  1R9T J;  5ICF A;  4AU7 A;  2WY7 Q;  2FML A;  2A3S A;  2LF8 A;  3J81 Z;  2R5Y A;  3IH2 A;  1I1G A;  1V5E A;  3GF2 A;  3K70 D;  4KJZ A;  3SZG A;  1FIA A;  1P4A A;  2R7W A;  5IP9 J;  5HLI A;  4D0P A;  1WH7 A;  2OZU A;  2HR3 A;  2P5V A;  4IQ4 A;  1R23 A;  2BE5 F;  1SFX A;  2JRT A;  3TMO A;  3F6V A;  3OMY A;  2E2J J;  3OYA A;  1HBX G;  3DTK A;  2F6C A;  3CZ6 A;  3E6C C;  1Y0N A;  4HF2 A;  3TKY A;  1VF9 A;  5L3G A;  2W57 A;  1OQY A;  1R1T A;  5KK1 A;  1OYI A;  3BJA A;  4Q47 A;  2VXD A;  2CW0 F;  3JSO A;  3E0J B;  3ABT A;  1W5T A;  3QU3 A;  4L5I A;  2JA8 J;  2JN6 A;  2ZJR F;  1ZGJ A;  1ZG3 A;  3KLN A;  4G6T B;  3S14 J;  2GXG A;  2DFF A;  2FBH A;  2IEK A;  1Z6R A;  1MMA A;  2XHK A;  4N4N B;  3H0D A;  3EYY A;  1D0Z A;  3RDI A;  4B44 A;  1KGS A;  1MBJ A;  1VI0 A;  3HGG A;  5K5Q A;  3FXJ A;  5FGM A;  1STZ A;  3OYK A;  2H27 A;  3R0J A;  2KPM A;  4I09 A;  4A3L J;  4UUV A;  4WF2 A;  2ZFW A;  4A6E A;  1LNW A;  2BY1 A;  5F27 A;  3S93 A;  3J81 K;  1GVD A;  1R71 A;  1R6R A;  4A3E J;  3BR2 A;  3HRT A;  1TWF J;  2VT3 A;  1WQ2 A;  3TO6 A;  3K2Z A;  3SEQ A;  2R7F A;  5LBQ A;  1UJ8 A;  5A2Q Z;  4BXU A;  5GAH J;  5KNL A;  1O4X A;  2DW4 A;  5DEQ A;  2R92 J;  3H36 A;  5EZH A;  3PL8 A;  3VSL A;  4CGZ A;  1B1B A;  3U9G A;  1GXP A;  1DQU A;  5E3N A;  3OYJ A;  1ULY A;  2KZG A;  4AIK A;  1MNE A;  1LFB A;  1TZL A;  3PQK A;  3H5N A;  2V9V A;  3F0C A;  1XSX A;  2ZXH A;  4FTH A;  3CES A;  5H6Q A;  2HDC A;  4KIC A;  3X2Q H;  3GVA A;  3LA7 A;  1MMD A;  5F64 A;  4ZC3 A;  3WE3 A;  4B48 A;  2EPF A;  1UB9 A;  3BTL A;  2MD0 A;  4AID A;  1H89 C;  2X4H A;  2DT5 A;  1ETX A;  1R7J A;  3MZ8 A;  4PJM A;  3U1K A;  1WZ2 A;  4N9I A;  1I6X A;  2MC3 A;  1UMQ A;  3E5X A;  1WJD A;  2JZY A;  4O3M A;  1S9H A;  4CCJ A;  4PSW A;  4OMY A;  1VQN I;  1I3A A;  1U5T A;  1YFH A;  2CJJ A;  3C7J A;  1LKX A;  2KRF A;  2Z5U A;  5HNF A;  1Z77 A;  2LP0 A;  3T8R A;  3CF5 F;  3L2V A;  4OIP F;  2KIS A;  4AC0 A;  3B6C A;  1W7P A;  4P5O A;  1Z91 A;  3EET A;  3MZH A;  1HQC A;  1LDJ A;  1PYV A;  3ZQQ A;  3ZQI A;  3CCJ I;  2YPR A;  2QZ8 A;  1MH3 A;  2ELK A;  2FOW A;  1Z3Y A;  2RAE A;  2QQB A;  5LGT A;  5DUI A;  2EV6 A;  2VBW A;  3I5U A;  3OR2 C;  4R1H A;  1P7I A;  5FKL A;  1H9T A;  1J75 A;  3SZP A;  2AXT C;  2V9P A;  2GA1 A;  3A02 A;  5LRS A;  3OY9 A;  2L7K A;  5DCM B;  2V6C A;  3P9K A;  4OIR F;  2JUG A;  3AG4 H;  2XSJ C;  2WAQ A;  1CQT A;  2X85 A;  2HYG D;  1KZH A;  3K4J A;  2HOA A;  1DP7 P;  3HL2 A;  3DLL F;  2OU2 A;  3JRF A;  3GX4 X;  4LIT A;  2GIV A;  3HHG A;  4MQ9 F;  3KZZ A;  4B3X A;  2UUZ A;  3CDH A;  1S3J A;  2DYR H;  2L4M A;  1G3Y A;  3PO2 J;  4LIU A;  1E3P A;  3A1Y A;  3U1D A;  2ISZ A;  3EUH C;  2FQ3 A;  2W4S A;  2BEO A;  1A31 A;  2DQL A;  2Q2E A;  1VQO I;  4B1R A;  3FXR A;  4UB6 C;  1BR4 A;  2O8X A;  1O7F A;  3OSF A;  1IRX A;  2XRN A;  4L5J A;  2AHQ A;  5EEG A;  1N78 A;  4KIT B;  3D5R C;  4A5N A;  3ESW B;  1ZG1 A;  5ICG A;  1EH8 A;  2EA2 A;  4BQQ A;  2E1M C;  2HTS A;  2XAQ A;  5EJC A;  1X1P A;  4OIQ F;  4DQ2 A;  3VSK A;  5K1Y A;  1B72 B;  1SFO J;  1Q1V A;  2H8W A;  4YEJ A;  5BPD A;  4Y15 A;  5M3F J;  4I0B A;  1QO0 D;  1XCV A;  3HSF A;  3F9K A;  3GFM A;  4EM0 B;  1JTX A;  2IA0 A;  2OUM A;  3CJQ B;  1LUJ B;  2BZT A;  4XQF A;  3TED A;  1X4P A;  2Q8K A;  4UY8 I;  2XGE A;  1LFU P;  3A4C A;  3KYL A;  2K9L A;  2HEO A;  2R7X A;  2JA7 J;  4F91 B;  1FX7 A;  3E3V A;  2XAJ A;  3JW4 A;  4Q48 A;  3B73 A;  3GTO J;  2A61 A;  3QYE A;  2JPC A;  5FFZ A;  4IKF A;  4U0V A;  1R49 A;  3I59 A;  1E3H A;  3KCC A;  1HW5 A;  1T98 A;  3MAJ A;  2ZME C;  1Z0X A;  2NS7 A;  4IF4 A;  1X4O A;  5KVR A;  1P4W A;  2VN2 A;  4LK1 F;  4C3J J;  4XRS A;  2LTP A;  2M1B A;  3IHU A;  1O3T A;  1D8K A;  3EUA A;  1WI3 A;  3WGG A;  2GZW A;  2VL8 A;  4G7H F;  3IAS 2;  1H88 C;  2GM4 A;  3H9Q A;  1B9N A;  3I58 A;  2BYV E;  1D0X A;  2DOA A;  3NRV A;  3SJM A;  5CKT A;  3CCS I;  2HVQ A;  3NWS A;  2LOO A;  4I2O A;  3TO9 A;  1OCZ H;  3BR6 A;  5E8G A;  1FSE A;  3WG7 H;  3L09 A;  4IOC F;  3KFW X;  4GDF A;  4YII A;  1B9M A;  3EQL F;  5J8F A;  2XF6 A;  2A6E F;  2DYS H;  4M3B A;  2VT2 A;  2R7D A;  3WTT C;  3QPL A;  2E7X A;  3OYF A;  4XOP A;  3QP5 A;  4IRH A;  2LYC A;  4QTR A;  2VC1 A;  1JE8 A;  4NDL A;  3MCZ A;  2QQ9 A;  3IC7 A;  5LHG A;  1FYM A;  4IHY A;  1JT6 A;  4IZZ A;  2CW7 A;  3KE2 A;  2JVH A;  4BKX A;  2JK3 A;  2JUC A;  5E3L A;  1RES A;  3N05 A;  3KP5 A;  1ZLJ A;  1IXR C;  2KL4 A;  4IX7 A;  2VE9 A;  1BR2 A;  4BEH A;  1IN4 A;  1WJB A;  2XGC A;  4DBR A;  2BOL A;  1EH7 A;  1SD5 A;  4EGY A;  1MMS A;  2VJ5 A;  5GAE J;  2M5W A;  1V5G A;  1ZHF A;  2HI3 A;  2L3D A;  4ESJ A;  1OJL A;  2PJR B;  2MC4 A;  2GOX B;  2AO9 A;  2I10 A;  3SZT A;  5ICC A;  3I59 B;  3G4S I;  1U2W A;  1FYK A;  1FP2 A;  1Z6T A;  4BXF A;  4LB5 A;  3ZXS A;  2G7U A;  1NG7 A;  4II2 A;  2X9D A;  5L3B A;  2PMZ A;  3I4M J;  4HZF A;  4B47 A;  3F8C A;  1YJN I;  3KYC B;  3FKI J;  3C18 A;  1AHD P;  4FE4 A;  3ZQG A;  2O0Y A;  2K85 A;  3HHH A;  1VQ5 I;  1A6I A;  3TL4 X;  4ANJ A;  1U8B A;  1AWC A;  1W4M A;  5DD8 A;  5TGT A;  3A0H C;  2H09 A;  2P0W A;  1B8I B;  1ERD A;  1TWC J;  4M72 A;  1IN6 A;  2IS4 A;  1WPK A;  1MH4 A;  3LSH A;  2O6G E;  3HKZ A;  2QWW A;  3GTL J;  3V7R A;  1YX3 A;  3QRF F;  2VUM J;  4HOB A;  5GAG J;  1DPU A;  1EJ9 A;  1WWX A;  1ETQ A;  3MWM A;  3G3Z A;  4BAY A;  1IO2 A;  2PG4 A;  2DMT A;  1X1A A;  2M4G A;  1SVM A;  1A04 A;  2VQH A;  5HVQ C;  5EYR A;  1KU3 A;  1HKQ A;  2DBB A;  1R5I D;  3WU0 A;  3D1N I;  5FLM J;  2LR8 A;  4II3 A;  4V2F A;  3WE2 A;  2WAQ N;  1FSH A;  2X1D A;  2E36 A;  3BTC A;  4I98 B;  3EDP A;  4PFP A;  4ZDL A;  1OMI A;  1X58 A;  2DA7 A;  3BPV A;  4LGW A;  2LSO A;  2VOP A;  2LVS A;  1IN5 A;  2HNH A;  3PM1 A;  2HKO A;  3ROU A;  4RBO A;  3FMR A;  4EAT A;  3ZMZ A;  3KP3 A;  5HS9 A;  2B63 J;  2DOD A;  2GBY A;  1POG A;  2XAS A;  5M5W J;  5EF6 A;  2WAE A;  4XLA A;  1K79 A;  5JI6 A;  1BM9 A;  2DCE A;  2BVL A;  4I01 A;  2E1C A;  5IP6 A;  1LEB A;  2CG4 A;  1Z3X A;  5BOX A;  2RN7 A;  2W82 A;  1OR7 A;  3CC7 I;  5AIQ A;  2ETH A;  3HZJ A;  1DGR M;  4WK8 F;  5GTI C;  3KP2 A;  2IS6 A;  3RTR A;  4HV5 A;  1MJ9 A;  3S32 A;  2ZBK A;  3HSR A;  1P4X A;  4I7H A;  4BQA A;  2YU3 A;  1ETO A;  1Q1H A;  2CUF A;  4EJW A;  4U87 A;  2V7F A;  4P9U A;  3HRS A;  3FK7 A;  2M7A A;  3BR1 A;  3IRQ A;  2X6O A;  2EIK H;  3TOB A;  1F1Z A;  1ZGA A;  4E7I A;  2W48 A;  2XF7 A;  5F0C A;  4MEX F;  1ZTR A;  1X3Z B;  1YRN A;  2K40 A;  5GAD J;  1W36 D;  2VPL A;  1UZC A;  2V26 A;  3BZC A;  4X6A J;  1XDS A;  4LJZ F;  1USS A;  3PUB A;  5DYM A;  4I0A A;  3MN2 A;  4Y4R A;  1LEA A;  1J7K A;  4DZJ A;  2FNP A;  3HEF A;  3ZQH A;  3ZRG A;  4N0B A;  2NVT J;  1FBQ A;  2KZV A;  2LY9 A;  1U78 A;  4ESF A;  3BQZ A;  2FU4 A;  3CCE I;  4OIO F;  4HLX A;  1JHF A;  4BDY A;  3RKY A;  5E20 A;  3SXY A;  3S3M A;  3CMY A;  4RGU A;  2WA0 A;  3BG3 A;  2NS0 A;  5EZG A;  3HTU A;  3CF2 A;  4MQV A;  4MGR A;  5CQG A;  3ZP5 A;  4HQM A;  1B59 A;  4D7N A;  4LK0 F;  3ZN1 A;  2O8K A;  1QZY A;  1FWZ A;  3DKY A;  1I50 J;  1VQP I;  3ZMD A;  1X1C A;  3SHF A;  4XLC A;  1MJB A;  2K4B A;  1YYV A;  3ZQL A;  1S8N A;  1XGO A;  2A68 F;  2EJR A;  2CU7 A;  1VND A;  2AQF A;  4IXA A;  2DO7 A;  3W6V A;  1VTN C;  2QQ8 A;  2BY0 A;  3MEX A;  5F0F A;  4EMS A;  2MYS A;  4OOI A;  1BBY A;  1SAU A;  1KQ0 A;  1WRJ A;  2VQC A;  1JKP C;  3K1N A;  3BPX A;  3ZMS A;  3ABU A;  1FMV A;  2KQR A;  1WGX A;  2K7L A;  2Y0M A;  4IPA A;  4S04 A;  5J6X A;  4OAY A;  1Z67 A;  4BNC A;  2A6T A;  1JUM A;  2D1H A;  2KT0 A;  3J7Z I;  2K02 A;  2QSG X;  2X1C A;  2COB A;  2P4W A;  3O3K A;  3CD6 I;  1BJA A;  3IH3 A;  1P92 A;  2L0K A;  3I3L A;  2C6Y A;  2EFN A;  4F52 A;  2ZNY A;  2W00 A;  4RAZ A;  3H3V K;  4U0Y A;  4P55 A;  5ED4 A;  3K4K A;  3CCV I;  5AIP A;  2E60 A;  1J9I A;  3M9A A;  5J47 A;  3GEZ A;  1KYW A;  4QLC U;  3AG2 H;  4IRG A;  3F21 A;  1QGP A;  2J5P A;  3HJE A;  1YIJ I;  4HYE A;  3O8G A;  4A3F J;  2GWR A;  2GXB A;  1W7P D;  5D5X B;  1DU6 A;  2EZI A;  3UKG A;  3G1L A;  3CCY A;  3H1C A;  4XBF A;  5B1B H;  1OR7 C;  5K7F A;  4RLQ A;  3L2R A;  1S6L A;  3BWG A;  3W2W A;  4HW0 A;  2XGD A;  2CH0 A;  4FX4 A;  1YO5 C;  4BBS J;  4UUS A;  2XIG A;  3SQN A;  2OJE D;  2IA2 A;  2MW8 A;  1IUY A;  2HVR A;  1WH5 A;  5J1U A;  3OIP A;  2O3F A;  3R60 A;  1H8A C;  1QBJ A;  1JGS A;  5E79 C;  3KET A;  1WJF A;  1B4A A;  1R00 A;  2DA1 A;  2YX7 A;  3AG1 H;  2VBY A;  3AFH A;  4M73 A;  1OCO H;  5KCM A;  1IC8 A;  5HS7 A;  4KT6 A;  1ZR4 A;  3I71 A;  2VBX A;  1FJL A;  3TOA A;  2HVS A;  4KMU X;  2DTZ A;  1JKQ C;  4PGH A;  3K4C A;  1TNT A;  4R79 A;  1FZP B;  5GP9 A;  2EV0 A;  4UV9 A;  4Y7N J;  2HDW A;  4MIM A;  3BDD A;  1L3L A;  1TC3 C;  3QYB A;  1T33 A;  2QKL B;  4RS8 A;  4Q4Z F;  4UUS B;  4U7B A;  4HF1 A;  3J7A Y;  1TL8 A;  1R1U A;  2K9N A;  2JTV A;  3DWL E;  3K70 C;  4RAG A;  1XDU A;  2DLL A;  5KHD A;  1VFC A;  4IHV A;  3GBG A;  2NAZ A;  3CCL I;  4HV6 A;  2H1K A;  3QP6 A;  5D5W B;  1IF1 A;  4MEY F;  1MND A;  1IGN A;  1W0U A;  4PSX A;  5K5O A;  1IN7 A;  2P5L C;  3TW7 A;  2EV5 A;  3N4M A;  2WY8 Q;  2JRM A;  1C0W A;  2PJR A;  4CDG A;  5E8I A;  3VDX A;  5HLH A;  2NRA C;  3H3Z A;  3OYG A;  1LVK A;  3BR5 A;  1RR7 A;  3D5S C;  4IHS A;  3E1S A;  1XMA A;  3AAF A;  4WXD A;  2NVY J;  1PP8 F;  3BT9 A;  2NNY A;  2XKO A;  4MTE A;  2Y0S N;  3P9I A;  5HNH A;  4G6D A;  4KIB A;  2B9S A;  3HB9 A;  2R3S A;  2LBF B;  5L3E A;  1IJW C;  1XN7 A;  2A5Y B;  2ZME A;  3CP8 A;  2K9S A;  2ID6 A;  2QSF X;  1TBX A;  1ZK8 A;  2H1L A;  4J19 A;  4PJN A;  4KDP A;  2CO5 A;  1QZE A;  3G1O A;  2EIN H;  4IL6 C;  3OYC A;  1U9O A;  5FKM A;  4C2M J;  4HNT A;  1X2N A;  2UXX A;  4BY7 J;  2XAF A;  3EUK L;  1I27 A;  5C3E J;  3HOV J;  1MSE C;  3BQY A;  1GVJ A;  1KU9 A;  2VKH A;  4E7L A;  2VB6 A;  3IP4 B;  4H0E A;  2XAH A;  1BW6 A;  5ILV A;  1BI0 A;  1MZB A;  1ODD A;  4MHG A;  3P9C A;  5FD6 A;  1RRJ A;  1DU0 A;  1VQ4 I;  5EEA A;  1XD7 A;  3FK6 A;  3J7Y J;  4M9X A;  4XKB A;  3DLA A;  3GZN B;  2R7U A;  1R4N B;  2XRO A;  4A3G J;  4UB8 C;  1G3W A;  4BJ6 C;  4BL0 B;  3TW6 A;  4CZC A;  1SD4 A;  4HX7 A;  4HLY A;  3N97 A;  3DKX A;  4DIQ A;  5EDN A;  3FZV A;  1ONV A;  1TTY A;  2DK5 A;  1Z05 A;  3U21 A;  4E7J A;  2VPR A;  1JJ8 C;  4Y13 A;  2IXS A;  2H94 A;  3S8P A;  1F9N A;  1XS9 A;  3BJ6 A;  3C2G A;  4AUX A;  1DDN A;  3LL7 A;  3S1R J;  1RUO A;  1DGW Y;  4RM3 A;  3CUQ B;  1VQ7 I;  1HDP A;  3TO7 A;  3A01 A;  3W6K B;  2L7F P;  3HRU A;  1P7J A;  2JA5 J;  3H5R A;  4OIN F;  5DCM A;  4WCG A;  4FQG A;  2K27 A;  3GFL A;  1AKH A;  2HPI A;  1XGN A;  5IOZ A;  1JHH A;  5JVG F;  5FRM A;  5CVJ A;  1TW2 A;  2PMH A;  3T1B A;  1QPI A;  4RDU A;  3LA2 A;  3FF5 A;  1F5T A;  4YIR X;  2A69 F;  1IRG A;  2ME0 A;  3GO5 A;  3HG9 A;  2DDB A;  1HC8 A;  2IBD A;  3GME A;  2ZJQ F;  3Q3S A;  4W1U A;  2OZ6 A;  4M74 A;  3VFZ A;  2OTJ I;  1XGS A;  1A5J A;  3K4L A;  4IHT A;  3GFI A;  3WU2 C;  1BL0 A;  2DN0 A;  3KZY A;  2M0M A;  3OYN A;  3KZI C;  3KEO A;  3MD2 A;  1P9Q C;  5FJ8 J;  2ESH A;  4HST A;  1ZRF A;  2Z16 A;  3S1Q J;  2XB5 A;  1KQ9 A;  3F3X A;  1FNN A;  3JSP A;  3L2U A;  2ELJ A;  3K0L A;  4FCY A;  4JQF A;  5B66 C;  5TIS C;  4C9Y A;  2LFB A;  3HOX J;  1A6Q A;  5E1Z B;  3RQI A;  2CFX A;  3KYD B;  3Q9S A;  3ZGK A;  3BG5 A;  3J7A O;  2CWE A;  3QYF A;  4CCN A;  1MBG A;  4IVN A;  2ZCW A;  1YOV B;  4P9F A;  2M3A A;  3CDI A;  2O9L A;  2XSD C;  3CCQ I;  5BQT A;  2PJP A;  1BI1 A;  1KU7 A;  3MKZ A;  2MSY A;  3DPL C;  3OYE A;  1W36 C;  2CV1 A;  5HDG A;  4Y3O A;  5LHH A;  1R1V A;  4YIF A;  2DMP A;  4DJA A;  1LVA A;  4NC6 A;  3GTK J;  3K4N A;  3WHC A;  5TJJ A;  1JUP A;  5DTD A;  1RKW A;  2ELH A;  4M6X A;  3REO A;  4F55 A;  4M71 A;  4JX6 A;  4NBQ A;  3ASO H;  4JYK A;  2EFP A;  3V8J A;  3PFY A;  2V79 A;  3LFK A;  4A3J J;  1K6O A;  2O5R A;  3CDL A;  3WOD F;  2M9H A;  2F5V A;  3LSJ A;  5HDN A;  2R7V A;  3HOZ J;  2LC2 A;  3C2B A;  1VQK I;  3BG9 A;  3S17 J;  1PDN C;  1MBH A;  1YS6 A;  2PMZ N;  1S7O A;  5B1A H;  3I4N J;  3P7N A;  1N77 A;  3IH4 A;  1XX5 A;  2LF7 A;  4IJA A;  1HW2 A;  1UG2 A;  2PBI A;  5H2F C;  2OQG A;  5C4X J;  1Y0U A;  1WSU A;  5FFX A;  3Q9V A;  2XV4 S;  2K3F A;  2DFE A;  2Y0S A;  5F6F A;  2GOM A;  4QIW N;  2QLZ A;  4BDZ A;  5BPI A;  2BHZ A;  1Z21 A;  2VON A;  1BC7 C;  4IQJ A;  5DM7 F;  1FPQ A;  4HPQ A;  1GUU A;  4Z2Y A;  5L3F A;  3GTM J;  3DU6 A;  4XID A;  1MGT A;  1K4S A;  5H20 A;  2CSO A;  2W85 A;  3TQN A;  5F1J A;  1DP3 A;  2OAZ A;  2Y31 A;  4B3A A;  3LSG A;  4FET A;  1T56 A;  2ID3 A;  2VIX A;  5JHF A;  3GLL A;  3FWE A;  5KAI C;  1W1W E;  3ABK H;  2TCT A;  2QA4 I;  1F43 A;  1YIT I;  3WTV C;  1V55 H;  3S1N J;  1FIP A;  1XG1 A;  3GYH X;  1E17 A;  3MVP A;  2DMQ A;  1YI2 I;  2B0L A;  3PUF A;  5LFA A;  1J0R A;  2HZD A;  1VQ9 I;  2DOF A;  4BHB A;  2I5U A;  2ZJ2 A;  3H3U A;  1M1E B;  3G6E I;  1ZAO A;  4MFE A;  1LE8 A;  1ZN2 A;  1MSF C;  2LG4 A;  2DA6 A;  1RC9 A;  3BR3 A;  4ZYG A;  5BS6 A;  5LGU A;  2M2E A;  1F4K A;  3RPU D;  1G3S A;  5ILU A;  4D1Q A;  5E17 F;  2FBI A;  3G1M A;  3Q0U A;  2QSH X;  2R93 J;  3EUH A;  3FMS A;  2EZK A;  3VPR A;  1EKE A;  2WAF A;  5FKN A;  2P7C B;  4S0H B;  2BXZ A;  3EPZ A;  3FMQ A;  3L1P A;  1W7P B;  2HYJ A;  3BG6 A;  4LMY A;  2DI3 A;  4UUT A;  5L3C A;  3JRI A;  4U0W A;  5HOD A;  1V5F A;  2ZNZ A;  2EWN A;  3A03 A;  5LLQ A;  4XIC A;  5LEJ A;  2X0L A;  2YX4 A;  3UR3 C;  2EIM H;  2QF7 A;  2IAI A;  2F4O B;  4RAY A;  1J09 A;  4F93 B;  1Z7L A;  3DEW A;  4ZDP A;  3VYU B;  1FOX A;  2DPD A;  3COA C;  3JRE A;  2GA2 A;  4JBA A;  3HOT A;  5EEH A;  5K7Z A;  2PX9 A;  1BOA A;  3V42 A;  2FD5 A;  4Y52 J;  1YE9 A;  2FA5 A;  4CHU A;  3PNV A;  2LLK A;  3K4M A;  2VKE A;  3M4O J;  1NTC A;  1APL C;  3DFG A;  2MH9 A;  3FXL A;  2L5Q A;  4IEJ A;  2JSP A;  4A3I J;  4NQW B;  1MDM A;  2L4A A;  2VOD A;  2DMN A;  2LRD A;  2KIQ A;  3SDG A;  5CJ9 A;  4BHC A;  2QKM B;  2FNA A;  4IRI A;  2V4J C;  1PVE A;  2MAB A;  4W97 A;  1DPR A;  3VOE A;  4DYQ A;  4GYI A;  3OYH A;  9ANT A;  3OYL A;  1MJA A;  4E4H A;  1ZH5 A;  4HDV A;  3QPH A;  2P7V B;  2IGO A;  4YFX F;  2DA2 A;  1RPW A;  1K7A A;  2CW8 A;  3F22 A;  3PIP F;  2DFI A;  2MGQ A;  3WTS C;  4ZTF A;  2ME6 A;  1ON2 A;  3OOP A;  4QPQ A;  1T8I A;  1OPC A;  1GHC A;  1HCR A;  3DBL B;  4UVB A;  2LKP A;  1YTY A;  4AM3 A;  2G9W A;  2CS3 A;  3AKZ A;  2M0C A;  5FLX Z;  2HYF A;  3S2H J;  2L9N A;  2X6Y A;  2ZB9 A;  3DF8 A;  3KLO A;  5DD4 A;  2BW3 B;  3FKJ A;  3PNT A;  4LIV A;  3FIW A;  3BTJ A;  4Z6Y A;  3S2W A;  3CO6 C;  1GT0 C;  4DGW B;  3QPT A;  2MA3 A;  1O3R A;  4WXC A;  4LG3 A;  1U9N A;  4HQE A;  1R36 A;  1SD7 A;  2PQ8 A;  1UEL B;  2FEZ A;  1X2M A;  2TRT A;  4BJT A;  2Y2Z A;  2Z2S B;  3DTE A;  2KIU A;  1YJ9 I;  5IT3 A;  1WJ5 A;  1TW3 A;  4BJ5 C;  4ETS A;  3DEU A;  1QVU A;  2EBI A;  2F48 A;  1I6H J;  3TP0 A;  1GLN A;  3F8M A;  2DA5 A;  1IXS B;  2V6E A;  1S7E A;  3MZY A;  2O61 A;  3VYS B;  2BHY A;  3WTU C;  3ZN0 A;  1JT0 A;  4E70 A;  3LSI A;  4MFD A;  4ZZD A;  4CSW A;  1HXD A;  5JFR A;  1TWG J;  1W5S A;  2FBK A;  4UNO A;  2KDZ A;  1V3F A;  2RQQ A;  1SEU A;  1XMK A;  5F04 A;  5D6E A;  4A0Y A;  3QPS A;  1IZ1 A;  4WXH A;  1OCP A;  1QVT A;  5FLX K;  1MW7 A;  4EV0 A;  5HLT A;  1BR1 A;  3PSF A;  1K78 A;  2R4G A;  1ETW A;  1YQA A;  1V4R A;  2JWT A;  2OTL I;  5D4S A;  5IPA A;  2VJJ A;  3M1C A;  1D5V A;  2ICW G;  4NHJ A;  4JP0 A;  4IHX A;  1I1S A;  2FE3 A;  2XPU A;  4ZYD A;  3B02 A;  4U7D A;  3DPU A;  1LDD A;  5J1Y A;  3CCM I;  2RC4 A;  2ISY A;  4XKC A;  3CJN A;  2OD5 A;  2IP2 A;  2IS2 A;  3GXO A;  1BA5 A;  1T38 A;  1MBE A;  5JLX A;  3IKT A;  4KN4 X;  3QU6 A;  3IWF A;  4FIS A;  3RPU A;  2AXL A;  1ZRE A;  2M30 A;  4RAF A;  2DFH A;  3M8E A;  1IXC A;  1J5Y A;  4PJJ A;  2QQA A;  1XB4 A;  2P81 A;  1TQP A;  4CCM A;  1TLH B;  4G94 A;  2L02 A;  4XKV A;  5D6F A;  2D45 A;  5E1X A;  3LAP A;  3JRA A;  2WV0 A;  4KA4 A;  1XSV A;  3NAR A;  3DXJ F;  5BMZ A;  1IV6 A;  5IOY A;  2ESN A;  4A3B J;  3SYT A;  3IRR A;  2EFO A;  4DYR A;  1QQI A;  2GIZ A;  3BJO A;  3ASN H;  3IAM 2;  3PNY A;  5IYD J;  2ZKZ A;  2X1E A;  3ECH A;  5TRD A;  3DBR B;  3DU5 A;  4G7Z F;  2DMU A;  2PFB A;  2EIJ H;  3FBI B;  1NG6 A;  4HAM A;  3IKV A;  2XB0 X;  3RIR A;  2VLA A;  3GZ5 A;  4KMF A;  4EM2 A;  3HOU J;  3FM5 A;  1O57 A;  5ERI A;  4P96 A;  2D5V A;  1ZYR F;  3GTQ J;  1L0O C;  2LDU A;  4EEF G;  2L2O A;  2QVO A;  4XON A;  4PJ0 C;  2V1D A;  4PUS A;  3O8H A;  5F0H A;  3OS0 A;  3MMY B;  5F08 A;  1REP C;  4YRV A;  3JTH A;  1FYL A;  2NS8 A;  5J40 A;  3CUQ A;  1SVO A;  2JQ7 A;  3FM3 A;  2EIL H;  4BE1 A;  2ACJ A;  3VYR B;  2NYX A;  3FHZ A;  4BE0 A;  2UZK A;  1BI3 A;  4HNV A;  4TV7 A;  2JVG A;  2W24 A;  3Q5F A;  1MKM A;  5K5R A;  4ZYA A;  5D8K B;  1TWH J;  1TQI A;  3ZMU A;  4GCV A;  1VQ6 I;  3HKZ N;  3TGN A;  3BCB A;  2LMD A;  2CQ7 A;  2DT7 B;  4M3E A;  3WTW C;  4ENK A;  1RR8 C;  2BXY A;  2IT0 A;  3F8N A;  1BIA A;  2P6S A;  2EZH A;  5B5E C;  3CO7 C;  2KKO A;  2A07 F;  2FJ1 A;  2HGC A;  1XMX A;  4C2T A;  2AQE A;  4AYB N;  5FD5 A;  1ETY A;  1CF7 A;  3KP6 A;  4RMN A;  4HX4 A;  2YUS A;  2R7Z J;  4D5C A;  1I5Z A;  2A6H F;  2JSC A;  4DZP A;  4L9V A;  4A3C J;  1B8I A;  3E6D A;  3BTI A;  4FT8 A;  4F92 B;  4A3D J;  1IW7 F;  1RIO H;  3QOP A;  3VB2 A;  2ZXI A;  4AVZ A;  1A35 A;  3JR9 A;  1HF0 A;  5FRN A;  5E18 F;  2R5Y B;  4JOM A;  2CUJ A;  2VKD A;  3NEU A;  4UHT A;  4N4O B;  1WI9 A;  3SEZ A;  5E1W A;  3HOY J;  2E7W A;  1KYZ A;  2Z99 A;  4G7O F;  3K7A J;  4S05 A;  3C3W A;  1QA6 A;  4XOT A;  5LRR A;  3AL0 C;  2EFW A;  4XRF A;  5IYB J;  4M3D A;  4AVP A;  1FC3 A;  2QEN A;  1D1A A;  4LLL A;  3MKL A;  3A2K A;  4NQW A;  3QOE A;  2NNN A;  3M8F A;  3H9G A;  3ONQ A;  3T0Y A;  1HSJ A;  3DV8 A;  1QNT A;  4L18 B;  2YS9 A;  4HBL A;  3OS2 A;  4XMY A;  2R5Z B;  1LB2 A;  1E2X A;  1ZG5 A;  2PEX A;  2MG4 A;  3FIS A;  2F4M B;  1WHU A;  2J5O A;  1HKS A;  4A2U A;  2STW A;  1MD0 A;  5B3S H;  2N8G A;  2QGU A;  4LLN A;  1ZGW A;  1OLT A;  3F72 A;  4R8H A;  2STT A;  4AWX B;  3HBL A;  5K7H A;  3GTG J;  2RGV A;  2FF4 A;  4XLE A;  1IN8 A;  3TP3 A;  4E7Z A;  2GLO A;  3BZ6 A;  3RKW A;  2OBP A;  5LGN A;  3E7L A;  5GPC A;  4CA0 A;  5J4V A;  2G7H A;  3HYI A;  2XRL A;  3BLY A;  4WWC A;  1O3S A;  3W2V A;  1UFM A;  4CCO A;  1VQM I;  1K61 A;  3DCF A;  2R7O A;  3BRO A;  2ZSH B;  2FRH A;  5M5X J;  1T2K A;  3I64 A;  2IW5 A;  1VQL I;  2KIM A;  1P6R A;  1XGM A;  1OFC X;  4XK4 A;  2CGP A;  3ZPL A;  3FXO A;  1MBF A;  2KHM A;  2D1V A;  1R5G A;  5C44 J;  4RLF A;  1GV2 A;  1SFK A;  4CXF A;  3RKX A;  4D5F A;  5FO5 A;  3E5U A;  3K10 A;  4KYW A;  2VC0 A;  4EGZ A;  1KU2 A;  2L9S A;  2P5K A;  4KNY A;  2GQQ A;  2HZT A;  2ADU A;  1AU7 A;  3S16 J;  3HDD A;  4LG0 A;  1TNS A;  3KX2 A;  4A6D A;  3M3Y J;  2LY1 A;  4Y17 A;  5CVR A;  2V9K A;  1P2F A;  3GUD A;  2DK8 A;  3CCR I;  1U6G A;  2HOT A;  5FKK A;  1X3U A;  1WCM J;  4KT5 C;  4XNF A;  1WKM A;  5JHU A;  3KEY A;  5LD2 C;  2V1U A;  5CLS A;  3V7S A;  1ITY A;  4XRS G;  3PFI A;  3M8J A;  3PJR A;  1EH6 A;  1HA8 A;  1T08 B;  1WVR A;  4RM2 A;  3E5Q A;  4M6V A;  5IP7 J;  1D1C A;  1MNM C;  3HSE A;  2UXN A;  4CZZ A;  4IHW A;  3RQ4 A;  1CGP A;  4U88 A;  3QOD A;  1X1B A;  4BBR J;  1FY7 A;  3DQV C;  3JTG A;  2W7N A;  1LDK B;  3F8B A;  2E2I J;  3WU1 B;  1OCT C;  2Y69 H;  5DUK A;  2BW3 A;  4RGX A;  4DOZ A;  5F1R A;  3MFK A;  3ML6 A;  4FE7 A;  4CCL A;  2EB7 A;  2M7B A;  2VQG A;  1JGG A;  2MLG A;  3S2D J;  3BP8 A;  3G71 I;  5DS9 A;  2HXO A;  4BEH B;  2IGM A;  3CP2 A;  5M3M J;  5JLW A;  3RYR A;  1R22 A;  3F23 A;  4J00 A;  4GYG A;  2JJ7 A;  2K5C A;  4V2G A;  4XKW A;  4B8X A;  3OS1 A;  1LE8 B;  3FDY A;  1YRN B;  1VZ0 A;  2NVQ J;  2HOE A;  1XTA A;  4CYC B;  1AA7 A;  3I54 A;  2QEX I;  2LK2 A;  2M87 A;  2CUE A;  3LSP A;  3ZQF A;  3HOS A;  3JRG A;  2ZME B;  3JAM Z;  2FMY A;  5IY5 H;  5EGO B;  3S15 J;  1UCR A;  1NK2 P;  3OOU A;  4MNU A;  3KP7 A;  5E3M A;  2MLK A;  1MBK A;  2EFQ A;  1UHM A;  3G73 A;  1HW1 A;  2IVM A;  4F7Z A;  3J80 K;  1UG0 A;  2JMW A;  4LB6 B;  1PUF A;  2E1N A;  1F36 A;  1YS7 A;  1MDM B;  2BVM A;  2WV1 A;  3FBN B;  2DT6 A;  3BZK A;  3HPG A;  2QBY B;  1OYW A;  5D8L B;  3KEQ A;  3PQJ A;  1IV8 A;  4E7H A;  1WJA A;  2VBZ A;  1UHW A;  2HFH A;  2COM A;  4C3I J;  4IO9 F;  4V19 K;  1WJC A;  4XLF A;  3WHB A;  1G6N A;  3MKY B;  4ZH4 F;  1G4D A;  4PZJ A;  2M4K A;  2F5F A;  4CO8 A;  2XDV A;  1FBS A;  4EJU A;  1K6Y A;  2NOJ B;  2YR2 A;  3H35 A;  2L54 A;  1Y8R B;  1EA3 A;  5EG0 A;  1JKO C;  3HOW J;  3CUO A;  3RPQ A;  3ERM A;  4LD5 A;  3C1D A;  5IYC J;  3CLO A;  5A2Q K;  4XLN F;  1ZRD A;  1D8J A;  4CH7 A;  2BY3 A;  3I4P A;  3U2R A;  4NNJ A;  3FXK A;  1JJ6 C;  1S29 A;  2VJI A;  2KRC A;  1YW8 A;  3IWZ A;  3KIO A;  2DTR A;  2ZSI B;  3PSI A;  2XKP A;  3JAM K;  3L2Q A;  2R7R A;  3HXL A;  1Z9C A;  3AG3 H;  2KP6 A;  4H4K C;  2V1X A;  4QPO A;  4ASN A;  3RKQ A;  1O7L A;  4BY1 J;  1R58 A;  1YW9 A;  4GFB A;  4D7M A;  3FXQ A;  3ZQ7 A;  3CC4 I;  2O03 A;  1EF4 A;  3TDU C;  1U8R A;  3HUG A;  1KON A;  3SDB A;  4O6J A;  2VJ4 A;  4E7S A;  3V8K A;  4BXX J;  2OC6 A;  4XLH A;  4OMZ A;  4XR6 A;  4G9Y A;  2Z3Y A;  4K2E A;  2OA4 A;  2PN6 A;  1OYY A;  3HIF A;  4YFN F;  3E6B A;  4BH9 A;  3OYB A;  3K4B A;  3VWB A;  1Y39 A;  3ABM H;  4XN0 A;  2HPM A;  3OWT A;  2VKV A;  1QU3 A;  1G8X A;  4PDK A;  3RYP A;  4MO7 A;  2E19 A;  3SFI A;  1Y6I A;  2XUB A;  3WTY C;  2AS5 F;  2OV7 A;  1ETV A;  4EM1 A;  2L9R A;  2CQX A;  1FBU A;  1V54 H;  2FXA A;  2Y30 A;  3F6O A;  3H92 A;  1BW5 A;  1MMN A;  2X6W A;  3CLQ A;  2Y48 A;  3HRM A;  4NB5 A;  1OKR A;  3GFJ A;  5AON A;  2VI6 A;  3CJR B;  4I76 A;  3OYD A;  1PUE E;  3RI4 A;  2ZC2 A;  2Z33 A;  1ENH A;  2IPQ X;  3OYM A;  2QBY A;  2KLO A;  2H6C A;  4UV8 A;  2VXZ A;  1T0F A;  1T0F C;  3K6G A;  2CQQ A;  2DJI A;  4AIJ A;  3OR1 C;  4WX9 A;  2NXN B;  2EQR A;  5M5Y J;  3WGI A;  2DAO A;  3L9F A;  3P5J A;  2YU9 J;  4ABZ A;  4PJL A;  1Z1D A;  4IOA F;  5DV5 A;  3PIO F;  3CUQ C;  4GRI A;  1HKT A;  5IT9 K;  1AKH B;  4CYD A;  4BU2 A;  1IRF A;  4RGS A;  4GGG A;  4RA2 A;  4ENN A;  3H5A A;  3TBI A;  3RCO A;  2LBF A;  2JA6 J;  2NVU B;  1O3Q A;  3CCU I;  3PO3 J;  3FXM A;  3M7G A;  1BIB A;  2ECB A;  2E2H J;  2FQ4 A;  1Y1W J;  2Q2E B;  2P8T A;  3JRH A;  4L9J A;  3H9J A;  3WTX C;  3LWF A;  1A36 A;  2E1O A;  2LH9 A;  2CQK A;  1ETK A;  1IG7 A;  4HSR A;  5BNG A;  3NQO A;  4AYB A;  2VQL A;  3E6M A;  2Q1Z B;  2QCO A;  4M9S A;  5FRO A;  3H0G J;  3I55 I;  4HG2 A;  3K1M A;  2KJB A;  2XGX A;  2WB1 N;  4I6Z A;  2GAU A;  4BHP A;  1X19 A;  1OCR H;  4N9H A;  5HLG A;  3FHN A;  3DKW A;  3OL3 A;  1NHA A;  4M9Z A;  3RSN A;  2QM3 A;  4L0Z B;  3FXU A;  4KIS A;  3L2C A;  3WTZ A;  1SVL A;  3LA3 A;  5E3O A;  2YSR A;  3K69 A;  2H6B A;  4DNC A;  1RZ4 A;  3Q0W A;  3KPH A;  4A5M A;  2CFO A;  3CTA A;  1I39 A;  1TQM A;  1IUF A;  3BY6 A;  2H8R A;  4HRI A;  1JI8 A;  4RB0 A;  2OCE A;  1SC7 A;  1ACI A;  2RQP A;  5CYV A;  4UVA A;  3DTI A;  3ERE D;  1S72 I;  2DU9 A;  1TP4 A;  3W6J B;  1FT9 A;  1LFP A;  3CJT B;  3W2A A;  3JCU C;  4HA8 A;  4C2U A;  2VOO A;  2OQR A;  2DA3 A;  2DJN A;  2V1N A;  4X0G A;  2BBY A;  1T39 A;  4ENM A;  5FLV A;  3LQR A;  3G2B A;  4B4C A;  4P1W A;  1CF7 B;  4MLO A;  3NWT A;  5CPR B;  3W3C A;  4J01 A;  3CC2 I;  3O2P E;  4A12 A;  1Y8Q B;  2M8E A;  2QYO A;  1GDT A;  3RJP A;  2LNB A;  3WG9 A;  4PGG A;  4YG2 F;  3B6A A;  1FOK A;  1T6S A;  4A93 J;  4AD9 A;  3K1P A;  2IGN A;  3I0T A;  2F4I A;  1XSD A;  1W5C C;  3HTS B;  2F2E A;  4I99 C;  2KDO A;  3Q0V A;  4XM3 A;  4XSX F;  4AIH A;  1J2X A;  5LHI A;  3OV8 A;  3GZ6 A;  5D5V B;  1PJR A;  4RB2 C;  4L0Y B;  1R5H A;  4CCK A;  5J4Y A;  5EG0 B;  2DXI A;  4L9T A;  4BAC A;  2RNG A;  1ZKG A;  1D5Y A;  3DPT A;  4JX5 A;  4ZYE A;  3WGH A;  2K3P A;  2ZO4 A;  4OWR B;  2WBM A;  1YW7 A;  4EJT A;  2EZL A;  4XRM A;  1UAA A;  1E3O C;  3CME I;  3NAU A;  5DDG A;  4OU0 A;  1U3E M;  2JA2 A;  5D5U B;  2R0Q C;  2RKH A;  2R5Z A;  3R61 A;  4Y33 A;  5C4J J;  4ESB A;  1HDD C;  2IJL A;  3T5X A;  2L01 A;  5CVU A;  1U0J A;  2PMU A;  1ZAR A;  4BE2 A;  4YFK F;  3QQA A;  1K78 B;  1J59 A;  2O7O A;  2HKX A;  3LSM A;  1FP1 D;  3S3N A;  3ULQ B;  2NVX J;  1GXQ A;  2R7Q A;  2R7T A;  1N75 A;  2KRH A;  3K2A A;  1JKR C;  3MQ0 A;  4FHT A;  1KA8 A;  2FSW A;  2MD5 A;  2XAG A;  3LST A;  3GLX A;  2XPV A;  1ZLK A;  2HWV A;  2KMU A;  4A3K J;  5H6R A;  4PK4 A;  2BY2 A;  3BOQ A;  5J3L A;  2NOG A;  2HOS A;  1X1D A;  2A05 A;  2A5W A;  2M8G X;  4XL9 A;  4ZJZ A;  1R4M B;  3JRB A;  3S3O A;  1QPM A;  3GWZ A;  5JVT A;  2ZXW H;  4RB1 A;  2FUG 2;  2WWY A;  1YIO A;  1D1B A;  4LOC A;  4KUM A;  2LKS A;  4A69 C;  4NC8 A;  4RB3 C;  3OYI A;  1FTT A;  4KFC A;  2WB1 A;  4UVC A;  1YHQ I;  3C2H A;  3F8F A;  2PI0 A;  3R6S A;  3J80 Z;  1H9G A;  2FX0 A;  3L2W A;  4YEL A;  2RRE A;  2X6X A;  2VAS A;  2R7S A;  3I9V 2;  3VYT B;  5ICE A;  1ZEL A;  3V8L A;  4LLG F;  3QWL A;  1X3W B;  2HU9 A;  1JUS A;  3D5L A;  4JX4 A;  3V4G A;  2K9M A;  4UXN A;  3VOD A;  1BJZ A;  3A0B C;  1SAN A;  3LOC A;  4G6Q A;  4KIG A;  3ISP A;  1RUN A;  4FAS D;  2K9Q A;  2IS1 A;  1LPQ A;  1RI7 A;  1H0M A;  2HQ5 A;  4GXO A;  1PP7 U;  1Y1V J;  2RDP A;  1FTZ A;  2EA4 A;  1B6A A;  2E5N A;  2W1O A;  1EV7 A;  4L5E A;  4BGD A;  4CIC A;  3RZD J;  1FMW A;  1D3Y A;  1WJE A;  2XPW A;  2CV0 A;  3QAH A;  2CMP A;  3ZQC A;  5KAF C;  5ILS A;  1PUF B;  1FEX A;  3L00 A;  3O6B B;  3OL4 A;  2BV6 A;  1HOM A;  1MMG A;  1IDY A;  1B72 A;  4L9N A;  1SMY F;  1WFX A;  2DA4 A;  2LD5 A;  2X48 A;  4XN3 A;  2EH3 A;  3LNQ A;  1NK3 P;  2LY2 A;  4BQN A;  4CUG A;  3CQZ J;  2KJC A;  3R0A A;  4DBQ A;  1D0Y A;  3FX3 A;  3HPH A;  1BOB A;  4ZYH A;  1N25 A;  2KIF A;  2DDA A;  4HEA 2;  3LSK A;  1FLI A;  3V7C A;  2KFD A;  2OPT A;  3TDZ C;  1DUX C;  1UST A;  3CMM A;  1QRY A;  3AL0 B;  3GTP J;  2HS5 A;  5HS8 A;  2MH2 A;  1LJ9 A;  1LQ1 A;  3LAJ A;  2WC2 A;  4BQO A;  3BG7 A;  4EVI A;  1SFU A;  2HXI A;  2M45 A;  1JXS A;  4OAZ A;  3OIO A;  3MKW B;  2L7M P;  2DQR A;  3K9T A;  1K4T A;  2MBF A;  2E34 A;  1KQ8 A;  3R4K A;  1UHS A;  3JRC A;  3M07 A;  1Z7U A;  2UV1 A;  1SMT A;  4M3G A;  2L9V A;  3UNG C;  4ZZL A;  4EJV A;  5J8C A;  3I56 I;  2WTE A;  3L7W A;  2CRG A;  3E97 A;  1G2H A;  4HF0 A;  4PCQ A;  3HUG B;  2DPU A;  2ZJP F;  3RZO J;  2Z1D A;  1SAX A;  2HTJ A;  3M1E A;  4NC7 A;  3IL2 A; 
#chains in the Genus database with same CATH homology
 4XRS G;  1RKW A;  2XGC A;  4JX6 A;  4JYK A;  2HI3 A;  4M6V A;  4A3J J;  3CDL A;  1OJL A;  1HLV A;  2M9H A;  3LSJ A;  4C3H J;  5IP7 J;  1RET A;  2AO9 A;  2I10 A;  1MNM C;  1TWA J;  3HOZ J;  3C2B A;  4IHW A;  3BG9 A;  1ZR2 A;  3S17 J;  1MBH A;  2OF7 A;  2PMZ N;  4BBR J;  3A01 B;  4CYC A;  3I4N J;  3IH4 A;  2E2I J;  2M34 A;  2X9D A;  1UG2 A;  1OCT C;  3I4M J;  5C4X J;  3FKI J;  4FE7 A;  1AHD P;  4QIW N;  1JGG A;  3S2D J;  4FE4 A;  5DS9 A;  2HXO A;  1IRZ A;  3ZQG A;  5M3M J;  5JLW A;  2JJ7 A;  1A6I A;  4V2G A;  1LE8 B;  1YRN B;  4A3M J;  1U8B A;  2NVQ J;  4CYC B;  1GUU A;  4QSH A;  3GTM J;  4XID A;  2LK2 A;  3BR0 A;  1B8I B;  2CUE A;  1TWC J;  3LSP A;  3ZQF A;  3JRG A;  1WPK A;  5F1J A;  5EGO B;  1MH4 A;  3S15 J;  2Y31 A;  3GTL J;  4B3A A;  2HDD A;  2L7Z A;  3LSG A;  1NK2 P;  3OOU A;  1T56 A;  2ID3 A;  2VUM J;  5FKO A;  2Y9Z A;  5E3M A;  1ETQ A;  2TCT A;  1F43 A;  1MBK A;  5EGO A;  1JTY A;  2JMW A;  2DMT A;  3S1N J;  1PUF A;  1FIP A;  1XG1 A;  1F36 A;  2G0E A;  3HGY A;  2ECC A;  2DMQ A;  3MVP A;  2WV1 A;  5EYR A;  3D1N I;  5FLM J;  2LR8 A;  4DYC A;  4V2F A;  2WAQ N;  4MFE A;  1LE8 A;  3BTC A;  1MSF C;  1X58 A;  2DA7 A;  2DA6 A;  3ZOB A;  4C3I J;  2LVS A;  3BR3 A;  3S1M J;  3WHB A;  3PM1 A;  2M2E A;  4RBO A;  1RKT A;  3Q0U A;  3G1M A;  2R93 J;  2B63 J;  2EZK A;  3VPR A;  3JRD A;  5FKN A;  2GBY A;  3HM5 A;  4S0H B;  4DW6 A;  1POG A;  5EG0 A;  3L1P A;  3IV5 A;  5M5W J;  2HYJ A;  5EF6 A;  1JKO C;  3HOW J;  4UUT A;  3JRI A;  5HOD A;  5IYC J;  3A03 A;  5IP6 A;  4XIC A;  2QF7 A;  3OSG A;  2IAI A;  1IDZ A;  1JJ6 C;  1K83 J;  3DEW A;  3JRE A;  3LSR A;  1GV5 A;  1ZQ3 P;  5K7Z A;  4M3F A;  2LKX A;  3RKQ A;  4BY1 J;  2FD5 A;  3GTJ J;  1ETO A;  4GFB A;  4Y52 J;  4D7M A;  1ORK A;  2CUF A;  4G12 A;  1EF4 A;  2LLK A;  2VKE A;  3M4O J;  3FK7 A;  1XC5 A;  3BR1 A;  1NTC A;  1APL C;  2X6O A;  4BXX J;  4IEJ A;  5J1R A;  2W48 A;  5F0C A;  1YRN A;  1ZTR A;  4A3I J;  2K40 A;  4X1E A;  2DMN A;  4X6A J;  1I3Q J;  3SDG A;  1W0T A;  3MN2 A;  2VKV A;  4W97 A;  4DZJ A;  4DYQ A;  9ANT A;  2Y9Y A;  3HEF A;  3ZQH A;  4MO7 A;  2E19 A;  5GPA A;  3SFI A;  2NVT J;  1ETV A;  2DA2 A;  2L9R A;  2LY9 A;  2CQX A;  1RPW A;  1U78 A;  1R9T J;  3BQZ A;  2Y30 A;  1BW5 A;  2R5Y A;  2MGQ A;  3IH2 A;  2ME6 A;  2VI6 A;  3CMY A;  1FIA A;  4I76 A;  3BG3 A;  1HCR A;  5EZG A;  1ENH A;  5IP9 J;  1WH7 A;  2CQQ A;  4D7N A;  2M0C A;  2O8K A;  1I50 J;  2E2J J;  3S2H J;  2ZB9 A;  2EQR A;  5M5Y J;  3ZQL A;  2YU9 J;  4ABZ A;  3FIW A;  2CU7 A;  3BTJ A;  1VF9 A;  1VND A;  3W6V A;  1GT0 C;  1U9N A;  5F0F A;  1AKH B;  2TRT A;  1X2M A;  2Y2Z A;  1JKP C;  2JA8 J;  2JN6 A;  1WGX A;  3S14 J;  2IEK A;  2JA6 J;  1JUM A;  3PO3 J;  2KT0 A;  1QVU A;  1VI0 A;  1MBJ A;  2EBI A;  3HGG A;  2COB A;  2ECB A;  2E2H J;  1I6H J;  2FQ4 A;  3IH3 A;  3TP0 A;  1Y1W J;  2DA5 A;  3JRH A;  4A3L J;  1S7E A;  2L0K A;  3H3V K;  2E1O A;  1ETK A;  1JT0 A;  1IG7 A;  5F27 A;  5BNG A;  4MFD A;  1GVD A;  2QCO A;  3H0G J;  1TWG J;  2KDZ A;  4A3E J;  3BR2 A;  1TWF J;  5F04 A;  2WB1 N;  4I6Z A;  3QPS A;  3O8G A;  4A3F J;  1OCP A;  1QVT A;  1O4X A;  2R92 J;  1DU6 A;  5EZH A;  2EZI A;  3UKG A;  3G1L A;  3CCY A;  5E3O A;  1ETW A;  2JWT A;  5K7F A;  3Q0W A;  2XGD A;  5E3N A;  5IPA A;  4BBS J;  4UUS A;  1IUF A;  2H8R A;  1LFB A;  4JP0 A;  4IHX A;  2MW8 A;  3F0C A;  4FTH A;  2XPU A;  1WH5 A;  5J1U A;  5J1Y A;  1H8A C;  1BA5 A;  2DA3 A;  2DJN A;  1MBE A;  5JLX A;  2DA1 A;  5FLV A;  4B4C A;  4FIS A;  3BTL A;  1IC8 A;  1H89 C;  1ZR4 A;  4MLO A;  1FJL A;  1ETX A;  1GDT A;  2DTZ A;  1JKQ C;  2P81 A;  1UMQ A;  5GP9 A;  4Y7N J;  3B6A A;  3JRA A;  3NAR A;  4MIM A;  4A93 J;  1IV6 A;  5IOY A;  4A3B J;  1TC3 C;  1T33 A;  2CJJ A;  4DYR A;  4UUS B;  3Q0V A;  1Z77 A;  2LP0 A;  5IYD J;  2K9N A;  4AC0 A;  3B6C A;  1VFC A;  2DMU A;  5EG0 B;  4IHV A;  3ZQI A;  3GBG A;  2XB0 X;  1D5Y A;  1ZKG A;  2H1K A;  4JX5 A;  1MH3 A;  3HOU J;  2ELK A;  2RAE A;  1IGN A;  2D5V A;  2EZL A;  4XRM A;  1W0U A;  3GTQ J;  1E3O C;  3NAU A;  4EEF G;  1P7I A;  5FKL A;  3TW7 A;  2R0Q C;  2R5Z A;  3O8H A;  5F0H A;  3A02 A;  5C4J J;  1HDD C;  5F08 A;  3BR5 A;  1RR7 A;  3QQA A;  2NS8 A;  2O7O A;  1CQT A;  2HOA A;  2NVX J;  2NVY J;  3JRF A;  3K2A A;  1JKR C;  3BT9 A;  2Y0S N;  4HNV A;  3HB9 A;  2XPV A;  1IJW C;  2K9S A;  4A3K J;  2ID6 A;  1ZK8 A;  5J3L A;  4J19 A;  3PO2 J;  2NOG A;  1TWH J;  2HOS A;  2M8G X;  3G1O A;  3JRB A;  3HKZ N;  1U9O A;  5FKM A;  4C2M J;  1X2N A;  4M3E A;  4B1R A;  4LOC A;  3OSF A;  4BY7 J;  4A69 C;  5C3E J;  3HOV J;  1FTT A;  2EZH A;  1MSE C;  2AHQ A;  2FJ1 A;  3BQY A;  4AYB N;  1ETY A;  2FX0 A;  1BW6 A;  2YUS A;  2R7Z J;  4D5C A;  4DZP A;  4A3C J;  1B8I A;  3BTI A;  4A3D J;  1DU0 A;  5EEA A;  3FK6 A;  1B72 B;  1JUS A;  4JX4 A;  1SFO J;  3JR9 A;  1BJZ A;  1Q1V A;  1HF0 A;  1SAN A;  4A3G J;  3LOC A;  2R5Y B;  3TW6 A;  5EDN A;  5M3F J;  2K9Q A;  2HQ5 A;  1JTX A;  2VPR A;  1JJ8 C;  1Y1V J;  3HOY J;  1FTZ A;  3TED A;  3K7A J;  4L5E A;  2XGE A;  1XS9 A;  3RZD J;  1LFU P;  4AUX A;  3S1R J;  2XPW A;  1HDP A;  5IYB J;  4M3D A;  2JA7 J;  3A01 A;  3MKL A;  3ZQC A;  2L7F P;  1P7J A;  1PUF B;  2JA5 J;  1FEX A;  3GTO J;  1HOM A;  1AKH A;  1IDY A;  2YS9 A;  5IOZ A;  1B72 A;  2DA4 A;  2R5Z B;  2MG4 A;  1QPI A;  4RDU A;  2LD5 A;  2X48 A;  3FIS A;  2ME0 A;  2N8G A;  1Z0X A;  2EH3 A;  2NS7 A;  3LNQ A;  1NK3 P;  1ZGW A;  2IBD A;  3CQZ J;  3Q3S A;  4W1U A;  1A5J A;  4C3J J;  4XRS A;  3HBL A;  5K7H A;  3GTG J;  2LTP A;  2GLO A;  3TP3 A;  1BL0 A;  2DN0 A;  1WI3 A;  3E7L A;  5GPC A;  5FJ8 J;  1H88 C;  2XRL A;  2GM4 A;  1K61 A;  2OPT A;  3DCF A;  3S1Q J;  3SJM A;  2XB5 A;  5M5X J;  1OFC X;  1QRY A;  4XK4 A;  4FCY A;  1MBF A;  5C44 J;  3GTP J;  3BR6 A;  1GV2 A;  4D5F A;  2LFB A;  3HOX J;  3RQI A;  2HXI A;  4M3B A;  3OIO A;  3S16 J;  1AU7 A;  2L7M P;  3QPL A;  3HDD A;  3BG5 A;  1MBG A;  3M3Y J;  1UHS A;  3JRC A;  4M3G A;  4QTR A;  2O9L A;  2XSD C;  4NDL A;  2CRG A;  2HOT A;  2MSY A;  1G2H A;  5FKK A;  4IHY A;  1JT6 A;  1WCM J;  4BKX A;  3RZO J;  2JK3 A;  2DMP A;  5E3L A;  1RES A;  3GTK J;  3WHC A;  1JUP A;  5DTD A;  1ITY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...