2DA7A

Solution structure of the homeobox domain of zinc finger homeobox protein 1b (smad interacting protein 1)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
GSSGSSGSPINPYKDHMSVLKAYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQYSNSRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger homeobox protein 1b
publication title Solution structure of the homeobox domain of Zinc finger homeobox protein 1b (Smad interacting protein 1)
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 13
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2da7A00
2R5ZB 2JN6A 2P81A 1D5YA 1JTYA 1FEXA 5GPCA 1T33A 3TP3A 4DYQA 4I76A 1CQTA 3ZQFA 1JKPC 2JA5J 2R7ZJ 3PO2J 3D1NI 4M3FA 1LE8B 3HGYA 3H3VK 2LK2A 3G1OA 3IH2A 3G1LA 4D5CA 2KDZA 1OFCX 5M3FJ 2FJ1A 5FLVA 1A5JA 4JP0A 1ETWA 2R93J 2LY9A 2X6OA 1IRZA 3DEWA 3HOUJ 1JUPA 3A02A 1DU6A 3ZQGA 1NK2P 1HOMA 3BQYA 1ENHA 4FCYA 1IV6A 2Y31A 4NDLA 4X6AJ 1MH3A 4V2FA 1NK3P 5IP7J 3CMYA 3IH4A 4I6ZA 1X2NA 3OSFA 4B3AA 5EZGA 1MH4A 2LVSA 3BG5A 3ZQIA 3BR0A 3BR5A 4M3DA 1MBJA 1WH5A 2GBYA 3CCYA 3GTOJ 1X2MA 3JRAA 3IV5A 3OOUA 5J1UA 2E19A 5E3NA 3GTQJ 3H0GJ 2CRGA 2WB1N 1Y1WJ 1TWHJ 4A3EJ 3S1RJ 3BTLA 3FK7A 2YU9J 4M6VA 5M5XJ 4UUTA 2DA7A 3TW6A 2O8KA 1ETKA 4M3EA 3JRGA 1JJ8C 1ZTRA 2AHQA 1Z77A 3LNQA 3HKZN 5M5YJ 2ECBA 5C3EJ 4C2MJ 3JRIA 1SANA 2ID6A 2R5YB 3HDDA 1RESA 3A03A 3LSJA 5F27A 3OSGA 2HXOA 1IDYA 2EQRA 2K9SA 2VPRA 2X9DA 1UG2A 4DZJA 1MBFA 1ZK8A 4MO7A 4V2GA 2XGDA 3JREA 4A69C 1ORKA 3QQAA 1ETVA 2L9RA 5DTDA 5EYRA 1P7JA 4MLOA 3Q3SA 2EZLA 1OCTC 2R5ZA 2ME0A 3GTPJ 1Y1VJ 3BR3A 4DYRA 1WH7A 2L7MP 5FLMJ 1FJLA 3RKQA 5EDNA 3QPSA 2M8GX 3JR9A 4C3IJ 1FIAA 2ID3A 1DU0A 2JA6J 2XPVA 1MSFC 1JKRC 2K9NA 2L7FP 5IYCJ 4XRMA 3W6VA 4FE4A 4A3BJ 1K61A 3S2DJ 1IJWC 3B6CA 2DTZA 3I4MJ 2Y30A 1ZR2A 2R92J 1W0UA 2M0CA 4B4CA 3BTJA 1H89C 3Q0WA 1IGNA 4XIDA 5GPAA 1ZKGA 4S0HB 1A6IA 4A3JJ 3S1QJ 4A3IJ 1T56A 5E3LA 4QSHA 2YUSA 2MW8A 4IHXA 3JRHA 3JRFA 1TWAJ 3DCFA 2NVXJ 1UHSA 5JLXA 1MSEC 3OIOA 1I6HJ 1TC3C 3VPRA 2IAIA 2NS7A 1H8AC 1ZR4A 2NVYJ 5F08A 4Y7NJ 1ZQ3P 5FKKA 2FQ4A 2LKXA 3HOVJ 4A3DJ 2LP0A 3O8HA 1K83J 1AHDP 2E2JJ 1MBGA 3ZOBA 4QIWN 1U9OA 2B63J 1APLC 3WHCA 3HGGA 3RZDJ 4A3LJ 4HNVA 4QTRA 3CDLA 3HBLA 2OF7A 2O7OA 3JRBA 4MIMA 5FKOA 2WAQN 5M3MJ 3BTIA 1GDTA 4FTHA 3G1MA 3Q0VA 1NTCA 2GM4A 1MBKA 3TP0A 3GTJJ 2DA6A 2O9LA 3MN2A 5J3LA 2IBDA 2R5YA 1LFUP 1OJLA 2XGCA 1VI0A 1Z0XA 2JJ7A 2JA8J 3FISA 2CJJA 5C4JJ 3LSGA 1B72A 1FTTA 5C4XJ 5EG0B 2XSDC 3TEDA 1EF4A 3HB9A 5IYBJ 1O4XA 4A3GJ 2CUEA 1H88C 1FTZA 5EEAA 2EZKA 2MG4A 2MSYA 1RR7A 2DMQA 3BR2A 3BR6A 5EGOB 2H8RA 1ZGWA 4B1RA 1S7EA 2HYJA 2D5VA 2XPUA 1YRNA 4M3GA 1OCPA 1RKTA 4IHVA 1R9TJ 4DZPA 1LFBA 5F1JA 2Y9YA 4XRSA 1QPIA 3NARA 1WPKA 4IEJA 4C3JJ 1WI3A 5K7ZA 5IP6A 3HEFA 3S1NJ 2VKEA 1B72B 4JX5A 2HI3A 2M34A 2Y9ZA 4J19A 2DA4A 3A01A 3LSPA 5JLWA 1U78A 1ITYA 1MNMC 2NOGA 5K7HA 2DA5A 4IHWA 1JUMA 2L0KA 3GTGJ 9ANTA 5FKLA 2HXIA 1ETOA 1QRYA 2EBIA 2K40A 1MBEA 1U9NA 2RAEA 2R0QC 4RBOA 1IC8A 1YRNB 4BXXJ 4BBSJ 2GLOA 5IYDJ 2JMWA 4M3BA 3HOZJ 3UKGA 2CQQA 3BG3A 4A3KJ 1HDPA 2CUFA 1JTXA 1POGA 3C2BA 1GT0C 1AU7A 1VNDA 1ETQA 2HQ5A 2DA1A 4A93J 3O8GA 2FX0A 1WGXA 2HOSA 1BW6A 2VUMJ 5GP9A 2VKVA 3ZQLA 3M3YJ 3K2AA 4AYBN 3K7AJ 1WCMJ 2XRLA 4UUSA 1BW5A 4IHYA 3GTMJ 4XK4A 1GV5A 1JT6A 1P7IA 2IEKA 2ME6A 5FJ8J 3A01B 1F43A 2XB5A 4EEFG 2EZIA 2DJNA 5EF6A 3IH3A 3S2HJ 4G12A 1IUFA 4W97A 2XGEA 2ECCA 4BY1J 4XRSG 2LR8A 1I3QJ 2Y2ZA 3BT9A 2M9HA 4AC0A 3S14J 5EG0A 5IP9J 3JRDA 3Q0UA 4D7MA 1JT0A 1JGGA 1BJZA 2JA7J 3BR1A 5BNGA 1JKQC 5EGOA 3S15J 3SDGA 3GBGA 2QCOA 2JWTA 2XPWA 3NAUA 2LLKA 1IG7A 4X1EA 4ABZA 3WHBA 4UUSB 2OPTA 1HDDC 4JX4A 5IOZA 1GVDA 1Q1VA 2K9QA 4XICA 3BTCA 4A3FJ 2W48A 2HOAA 3HOYJ 4D5FA 1RPWA 4C3HJ 2COBA 3S1MJ 2NS8A 3FK6A 2ZB9A 2E1OA 5IOYA 2PMZN 2DA3A 5F0HA 1W0TA 1RETA 1GV2A 2DMTA 1VFCA 2KT0A 3ZQHA 1AKHB 2XB0X 2DA2A 1SFOJ 2EZHA 3TW7A 3FIWA 2Y0SN 1B8IA 3LSRA 1PUFA 1HCRA 2DN0A 3MKLA 1RKWA 1FIPA 4D7NA 1U8BA 2CQXA 3SJMA 2E2HJ 4JX6A 4Y52J 2VI6A 1JKOC 4BY7J 2FD5A 5FKMA 2LD5A 1QVTA 4BBRJ 3LOCA 2CU7A 4JYKA 4A3CJ 2M2EA 4RDUA 5F04A 2X48A 1GUUA 2E2IJ 4CYCA 1G2HA 1VF9A 4FISA 2MGQA 3FKIJ 2L7ZA 2HOTA 3GTLJ 5F0CA 5M5WJ 2EH3A 5K7FA 2NVTJ 3PO3J 5IPAA 4GFBA 3PM1A 1MBHA 2LTPA 5HODA 1B8IB 1PUFB 2AO9A 1ETYA 2DMPA 5E3OA 3MVPA 5C44J 3CQZJ 1XG1A 3BQZA 4FE7A 3S17J 2H1KA 4AUXA 2DMNA 3L1PA 1X58A 1HF0A 2NVQJ 2TCTA 3B6AA 3JRCA 4L5EA 3SFIA 3HM5A 3RZOJ 1IDZA 1JJ6C 3HOWJ 4W1UA 4MFEA 4BKXA 1F36A 2YS9A 3S16J 5J1YA 4A3MJ 3I4NJ 4DW6A 3QPLA 3RQIA 4CYCB 1BA5A 5F0FA 1JUSA 1QVUA 1UMQA 1LE8A 1I50J 1XS9A 2QF7A 1TWFJ 2DMUA 3BG9A 1TWCJ 4DYCA 3M4OJ 1TWGJ 2HDDA 4MFDA 3HOXJ 1XC5A 4LOCA 2ELKA 3GTKJ 2G0EA 3ZQCA 2LFBA 5J1RA 2WV1A 2N8GA 5FKNA 1E3OC 2JK3A 1ETXA 5EZHA 1HLVA 5DS9A 3E7LA 1AKHA 2TRTA 2I10A 1BL0A 5E3MA 3F0CA
chains in the Genus database with same CATH superfamily
5E20A 4F7ZA 4A5MA 3Q9VA 4ESJA 1JTYA 2LC2A 2LF7A 1USTA 1D1CA 1FX7A 4C2UA 2EA4A 1IN8A 3GFMA 3ZQFA 2FNAA 5FFZA 4L18B 4UV8A 4UY8I 3B02A 4CUGA 3D1NI 3DBHB 2MYSA 4HF2A 2ZSIB 3OYMA 2KDZA 1E0EA 1OISA 5M3FJ 2CQNA 4XBFA 2HZDA 5FLVA 1T8IA 1I1GA 1ZRDA 4BS9A 3VSLA 4ZJZA 2LY9A 3AKZA 5B3SH 1J0RA 4UVCA 2WY8Q 2KRHA 3W3CA 1DU6A 3ZQGA 3DKYA 4B47A 1HOMA 2A69F 3COAC 1V5EA 5DUKA 1KQ8A 4A6EA 1IV6A 1FMVA 3S2WA 4FCYA 2ZKZA 5FD5A 4NDLA 4HA8A 3TQNA 4RGRA 4YFKF 2P6TA 4JBAA 1MH4A 3P9IA 3BG5A 3DLAA 4GDFA 2JT1A 2BHZA 2ETHA 3CCYA 3SEQA 4D1QA 3CO7C 4BE2A 1CF7A 3OV8A 1YLFA 3KP3A 3IV5A 2QWWA 1B59A 5E3NA 3H0GJ 3MFKA 2LG4A 2VQGA 3QRFF 1Y1WJ 3K1PA 4YFNF 1LQ1A 2XF6A 1REPC 3TBIA 3K4KA 2IGOA 5LFAA 2V26A 1QHHD 3S1RJ 5K5QA 2LREA 4ZYEA 1VQ7I 2YU9J 5M5XJ 4DJAA 4KUMA 3JRGA 5K1YA 4EM2A 1KGSA 2Q8KA 1JJ8C 2Y48A 4M73A 1YIOA 3RI4A 3HKZN 3KP2A 2W57A 2BBYA 3HDDA 3EUHA 2DK5A 2EILH 2ZNZA 3BWGA 2ZBKA 3OSGA 3L9FA 1CF7B 2HXOA 1IDYA 2VPRA 1H0MA 4ASNA 1ZK8A 3KIOA 2MD0A 3H5AA 4V2GA 4XONA 5IY5H 4HQEA 2ESHA 3VSKA 5FLXK 2QM3A 5JVTA 2QENA 1W7PA 2W24A 4BQOA 4K2EA 2L01A 1R5GA 1UHMA 1DP7P 5FROA 1FJLA 3FKJA 3GZ5A 2D2WA 5EDNA 5DDGA 4RB3C 1R5HA 2M8GX 3JR9A 3DPTA 4DQ2A 4FASD 2KP6A 2IVMA 1MMSA 1MSFC 2CWEA 3DPUA 3I55I 1JKRC 1ZG3A 2WTEA 1XDUA 1KZHA 4AM3A 3FM3A 1IJWC 1BC8C 2Q2EA 3ABTA 3ZN0A 2E5ZA 3OYGA 5HS7A 4AD9A 1S7OA 2HFHA 1MMNA 1XCBA 1Z91A 2Y0MA 1TNSA 3BTJA 5LBQA 1SFUA 3OL3A 2W84A 1T56A 4L5JA 4HQMA 4QSHA 3ZR8X 2MW8A 5LGNA 1W7PB 3JRHA 4LLNA 1IXRC 4XOTA 2RQQA 1KA8A 2E1MB 4XLFA 4HSTA 3BDDA 3C2GA 4RLFA 4FQGA 3KP7A 3HL2A 3ERMA 5ICFA 2LYCA 4Y33A 4XKCA 3KETA 1A31A 3RCOA 3GFLA 2NYXA 3GVAA 2HOEA 2FQ4A 3PQKA 1E3HA 2A05A 1WJCA 4XN0A 4BJ5C 3HOVJ 4A3DJ 1EA3A 3LFUA 1IN7A 1J7KA 1U9OA 2VQHA 4PJLA 4I0AA 5J4YA 3CDLA 3HBLA 2OF7A 3CZ6A 2WC2A 3J7YJ 2QSGX 2P4WA 3JRBA 4RM3A 3WTZA 1ZLJA 2WAQN 4N0BA 4FT8A 2GQQA 1MBKA 2DXIA 2BOLA 4AIKA 5CYVA 2ADUA 5AIPA 3HSEA 5J3LA 4B8XA 3C2HA 3LWFA 2R5YA 1Y0NA 1OJLA 1LFUP 2BVLA 4Q5SF 4DIQA 3IC7A 2JZYA 3FISA 2CJJA 4DGWB 3GF2A 1B72A 1O3RA 4IPAA 3WE2A 2FUG2 2RGVA 1J59A 2V9VA 3QP5A 1J5YA 2JTVA 4EJTA 3H9QA 1O4XA 3KEOA 1TT5B 3MZHA 2F5CA 5B1BH 2MSYA 3T5XA 4X0GA 1R58A 1RR7A 2KJCA 4ZDLA 4ZYHA 5K5OA 4F52A 1HSJA 2H8RA 3QPHA 2STWA 2IS2A 3NEUA 3EPZA 3JAMZ 5JI6A 4GCVA 4BEHB 4P55A 1BI3A 1TTYA 1QZZA 4IF4A 1YRNA 2L4AA 3HIFA 2ZXIA 5LHHA 1LDJA 1S3JA 2ZXJA 2Y9YA 1PVEA 5JVGF 1WPKA 2DFEA 4C3JJ 4KIGA 3K0LA 2XAQA 2R7QA 3W6KB 5CKTA 2XV4S 5IP6A 1NG6A 4CZZA 2F6CA 2QGUA 1B72B 2HI3A 2V79A 3CJNA 4UVAA 4CCJA 1SEUA 2DA4A 4FETA 5D4RA 3A01A 3FXQA 4CGZA 4MHGA 4L9NA 4II2A 5ICGA 4XKBA 5LGTA 1U78A 3TKYA 1ITYA 4M74A 5GTIC 3A4CA 1JUMA 2CW8A 2L0KA 2V9KA 4AIDA 1R71A 3K6GA 2UXXA 1QRYA 2EBIA 2K40A 2RAEA 2XF7A 3G3ZA 1YRNB 2ZMEC 4BXXJ 4BBSJ 3ZXSA 2CUZA 5IYDJ 2JMWA 2XAFA 2XIGA 4ZZDA 5J40A 3UKGA 2CQQA 5FLXZ 4U7DA 2QSFX 1G3YA 3BG3A 2RV8A 3OYJA 4ZDOA 3F3XA 2QKLB 1GT0C 4A0YA 1R4NB 4RAZA 3U1DA 2HVRA 2X1CA 3DWLE 4A93J 1JI8A 1PJRA 2HOSA 3VFZA 5B1AH 3I0TA 3K7AJ 2NS0A 2XRLA 2PN6A 4ANJA 4IHYA 2HS5A 4BHPA 2XDVA 1GV5A 2ME6A 2IEKA 3A01B 1F43A 3TO9A 2M1BA 3H3ZA 4EEFG 1WJEA 3OS2A 1SAXA 2QEXI 1TZLA 5EF6A 3IH3A 4BL0B 3J80Z 1IUFA 2CYYA 3DKWA 2VQCA 1R7JA 4LK0F 1AOYA 2Y2ZA 2ZFWA 4AC0A 2AQEA 5IP9J 3JRDA 5E8GA 2CGPA 1JGGA 3RKWA 2JA7J 3RDIA 2DFIA 2QSHX 2XKOA 3DEUA 1TP4A 3HXLA 2LLKA 1IG7A 4X1EA 4XSZF 4ABZA 2L9NA 4S05A 3C3WA 3HTUA 3FMRA 1KU2A 3JSPA 3CP2A 1XGMA 1K6YA 2IA0A 3HHGA 2VC0A 4KMUX 2OAZA 3BTCA 1XB4A 3MCZA 2BVMA 4P5OA 5TGTA 4A3FJ 1IAWA 3U21A 2DCEA 4HBLA 5BPDA 2X85A 3DF8A 1B9NA 2RDPA 2ZFUA 3FK6A 2G7UA 5IOYA 5J47A 1RETA 1R5ID 1GV2A 2YSRA 1U6GA 3DLLF 2H6BA 1T0FA 2XASA 3CCRI 2XB0X 3U1KA 2LF8A 3AG4H 3FIWA 1L0OC 1B8IA 2BXYA 3LSRA 1PUFA 3WG7H 3BPVA 3IAS2 5D6EA 2DJIA 1ZN2A 3I64A 3CUQC 1X1CA 2HYFA 1RKWA 3DU6A 3H5NA 4HX4A 1X4PA 3BZ6A 4EMSA 5GAGJ 3Q5FA 1U8BA 2C6YA 2CQXA 4JX6A 1WVRA 2HQAA 4Y52J 1VQ9I 2RC4A 2LD5A 2P6SA 1QVTA 3PSFA 4G6TB 2PX9A 3KYLA 5F04A 1G2HA 2K86A 1ZREA 3LSHA 2WBMA 3FKIJ 2EH3A 5CPRB 5HVQC 2OUMA 3H3UA 2PJRA 2OV7A 2K3FA 3V8JA 4GFBA 1OMIA 2R4GA 1B8IB 1PUFB 1IRXA 1OCRH 5CQEA 4M72A 3S17J 3HHHA 1N75A 3T8RA 3C18A 2DMNA 1IW7F 5CLSA 1X58A 3CTAA 3I58A 3B6AA 1IXSB 3LSIA 2JUCA 3WU0A 1BI1A 3RZOJ 3HOWJ 1HSTA 4W1UA 1Z9CA 2YS9A 5DUIA 3BPXA 3RKXA 3I4NJ 4DW6A 2Z9OA 4CCMA 1Z7UA 2JA2A 4I02A 3CF5F 2ZJPF 1QPMA 2DYSH 3F8BA 2DQRA 3OR1C 4IOCF 2HTJA 5ILUA 2QF7A 1TWFJ 2CW0F 1S72I 1TWCJ 2PJRB 4F93B 5EJCA 4IQJA 2H8WA 1SFKA 2KKOA 2OQGA 1SAUA 1OPCA 2VXZA 4OAYA 4PGGA 1Y8RB 2EV5A 5D8KB 2EIJH 3G4SI 1QQIA 2H94A 2HYGD 2I8DA 1MIJA 3LMMA 3J81Z 1D8JA 2WV1A 3I3LA 2N8GA 3D0SA 2LH9A 4A6DA 1WRJA 1YQAA 5D6FA 2V6EA 5EZHA 2QQ9A 2K4BA 2TRTA 2I10A 1BL0A 5E3MA 2JN6A 2DO7A 1FEXA 2H1LA 2PQ8A 5GPCA 1KU7A 4N4NB 4G6DA 3TP3A 3WE3A 2XSJC 4RB1A 2LY2A 1B9MA 4LFUA 5F6FA 2JA5J 3PO2J 4RGUA 4M3FA 5FGMA 2A68F 4XLCA 1IZ1A 2LK2A 3G1OA 1YTYA 4Y4RA 3E3VA 1D8KA 4NC8A 5KAIC 1KU3A 4CZCA 2BEOA 4BE0A 4NC6A 3RPUD 3U9GA 4HYEA 4JP0A 1BI0A 1ETWA 2UUZA 2X6OA 5L3GA 2Z16A 2O8XA 3DEWA 4HDUA 1I39A 2MLGA 3HOUJ 3LAJA 4KT5C 3BQYA 3W2WA 1ZH5A 3GW2A 3F23A 1NK3P 3QU3A 3P9KA 3CMYA 1P4XA 1S29A 4I99C 4I6ZA 4KITB 1OCCH 3OYHA 1X2NA 4EGYA 3OSFA 4B3AA 1O57A 4XLHA 4ON0A 3ZQIA 1BBYA 4M3DA 2IT0A 2GBYA 2L5QA 2DQLA 5FRNA 1DP3A 4R79A 3GTOJ 1R49A 2E19A 3M07A 2R7DA 5JHFA 3VODA 2ICWG 3I9V2 1T38A 4KISA 2FA5A 3QYEA 2CS3A 2DFHA 1QBJA 3LSKA 4RAGA 2ZJRF 2FQ3A 3E6DA 2BYVE 3L7WA 1TWHJ 2Q1ZB 2K85A 3ROUA 1VQKI 3DQVC 2GIVA 4L0ZB 4QLCU 5GAEJ 4UUTA 3BCBA 2O8KA 1ETKA 4M3EA 3KEQA 1SD7A 2L2OA 1HKQA 2AHQA 1Z77A 4HLYA 4JK1X 3TGNA 3LNQA 5DD4A 3FXUA 5CVVA 5CVJA 1SANA 2PMUA 2ID6A 1N77A 2PBIA 1BOAA 4V19K 1ON1A 4I7HA 1K4SA 1MKMA 2EQRA 3CCVI 1BIAA 2A5WA 4UB6C 3ZQ7A 2GXAA 3ZMDA 4UUVA 4DZJA 4G6QA 2KMUA 1TW3A 3BY6A 2CW7A 3DBLB 4BQQA 3CC2I 5F64A 2M0MA 1LB2A 1BI2A 2KJBA 2EZLA 1OCTC 2ME0A 4IX7A 1Y1VJ 1SFXA 2BY3A 3BR3A 1P4WA 3JW4A 4DYRA 1ODDA 1KQ0A 3RKQA 1X4OA 1K4TA 3K70C 4BJ6C 3QAHA 2ID3A 1DU0A 3WGIA 1XPXA 2XPVA 3P9CA 2V1DA 1FOYA 3F6VA 4DOZA 2P8TA 1KYWA 2L7FP 1TQMA 1U5TA 2JVGA 2W82A 4FE4A 2OZ6A 4I98B 3NWSA 3QODA 1K61A 3V7RA 1HXDA 2COMA 2HVQA 3VYSB 2XROA 4IHTA 1D0ZA 2DTZA 3FBIB 3VWBA 2Y30A 4IRHA 1ZR2A 1FBSA 2R92J 2GZWA 4R8HA 1KU9A 3ML6A 4CO8A 1H89C 3FXLA 3TMOA 3CMMA 1ZKGA 1A6IA 4A3JJ 1RUOA 2QUFA 4A3IJ 4RGSA 2YUSA 1BIBA 1FP2A 2F4MB 3CUOA 3V7CA 3EUKL 3CCEI 3DCFA 2NVXJ 2D1VA 3PNTA 4IL6C 3OIOA 1QA6A 1B4AA 1TC3C 5LEJA 2E1CA 1I6HJ 1UZCA 3L2RA 4B43A 5BPIA 1H8AC 1W36C 3OYBA 4MEXF 3BCAA 4D9JA 2Z99A 2FU4A 2H09A 2IS6A 2HU9A 4BDYA 1DUXC 2ISZA 5HS9A 4E7ZA 2LP0A 2VJ5A 1U5TB 1IN6A 4MTEA 1I1SA 2GIZA 2LSOA 1MBGA 2M4GA 2QQ8A 4QIWN 1APLC 3OYDA 3WHCA 2DI3A 4HNVA 4QTRA 3RPUA 3MMYB 3ECOA 2R7RA 5BOXA 2GOXB 1G4DA 3OYAA 4OAZA 4NB5A 3BTIA 5CVIA 1Z3XA 2CQ7A 5M3MJ 4B48A 3G1MA 5HDNA 2QA4I 1TBXA 2MC3A 2CFXA 4NBQA 2LRDA 5H20A 1V5FA 3KEYA 2M5WA 3TP0A 4YIRX 3DBRB 1IN5A 1ZGJA 3S3OA 3TDZC 1K7AA 2PI0A 1D5VA 3K4MA 1Z0XA 4IZZA 2JA8J 3IP4B 2DLLA 3M8FA 3ZMUA 1R6RA 3LSGA 1FTTA 2QZ8A 2BZTA 4LLLA 5EG0B 1P4AA 3DTIA 2RNJA 3OYNA 3TEDA 5JFRA 5IYBJ 2DOAA 1OR7A 2FXAA 3CDHA 2CUEA 5GADJ 5E18F 1H88C 1FTZA 5EEAA 2EZKA 2WV0A 2ZXWH 4BXUA 1LPQA 1DDNA 2E71A 1XN7A 2HKXA 2DMQA 2RVCA 1FOKA 3BR2A 2XAHA 3BJ6A 4S04A 4OINF 5EGOB 4AIHA 1ZGWA 2GWRA 1EH6A 1MNEA 2MH9A 1IRFA 3IRRA 2EB7A 2H6CA 1G3SA 4IHVA 3KZIC 2KIMA 2OCEA 2L9SA 2KQRA 1X1DA 3NARA 1S5LC 3LL7A 1UB9A 3MQ0A 5K7ZA 4DNCA 4KA4A 3DTEA 5H6RA 4XM3A 2VOPA 3HEFA 1TT0A 2RNGA 4WCGA 5E1ZB 4JX5A 2GXGA 5DM6F 2M34A 2Y9ZA 5CVRA 2BY1A 4L9TA 2WB1A 3ECHA 1YS7A 4E7LA 3S3NA 1SC7A 3SFZA 1FOXA 2VXDA 1JHFA 1PP8F 4HV5A 4E7IA 3O3KA 2ZO4A 4OU0A 2W1OA 5FKLA 4A2UA 1LFPA 1ETOA 2R0QC 1BW5A 4YRVA 2MA3A 1U9NA 2VJIA 3K9TA 5K5RA 1ULYA 4RBOA 1IC8A 2BW3A 2P5KA 5ERIA 3MZYA 4CCLA 4XMYA 1WFXA 3HOZJ 1D1BA 1QU3A 1RNLA 1ACIA 3L2VA 1HDPA 4WK8F 3MKWB 1G6NA 1AU7A 1POGA 3C2BA 4ESFA 5D5UB 1ETQA 4GYIA 2EFQA 4RAYA 5DCMB 3N4MA 1STZA 2VKVA 5GP9A 4U0YA 3ZQLA 3K4LA 4EJUA 4RLQA 1WCMJ 2FMLA 4UUSA 1BC7C 1G59A 3F22A 2IS1A 3TOBA 1JT6A 3HRMA 2HZTA 4P96A 2EZIA 2EFOA 3A0HC 3FBNB 3E6MA 4OMZA 4G12A 4W97A 1LDKB 2XC7A 1FBQA 3BG6A 2ECCA 4BY1J 2K02A 4XRSG 3AAFA 1WJDA 2F48A 3BT9A 2BW3B 2LNBA 2M9HA 4E7JA 3Q0UA 4D7MA 2OBPA 3ZCOA 3RTRA 5HLIA 3UNGC 4HZFA 1IO2A 4BU2A 2BXZA 2KRFA 3HRTA 1I3AA 3KX2A 4HW0A 5BNGA 1JKQC 2DAOA 2O6GE 2ELJA 1YJWI 1LJ9A 3S15J 4MQVA 2DU9A 3GBGA 5GTHC 4G94A 4Y3OA 1X1PA 1I27A 4BEHA 3X2QH 1WI9A 4UUSB 2EFPA 2WA0A 1U3EM 3DPLC 1HDDC 4Q4ZF 2R7TA 2HGCA 4UV9A 3OS1A 4WXDA 1S9HA 4BGDA 1ZAOA 5ILVA 3OYCA 1LEAA 4HPQA 1GVJA 1RPWA 3NQOA 2F5EA 1T39A 4PDKA 4C3HJ 2HVSA 4L5IA 3CD6I 2COBA 1WQ2A 2NS8A 4A0ZA 2JQ7A 4YIFA 1GXPA 1OYWA 3K69A 4AU7A 1VQ5I 3S3MA 3A2KA 1N25A 1P9QC 1VFCA 3DXJF 1OKRA 2M8EA 4LJZF 4GXOA 1AKHB 2DK8A 5KAFC 2L4MA 3MWMA 4F91B 1RC9A 3GFIA 4KIFA 2FOKA 4E6KG 4ZYDA 3HRUA 3SXYA 1RIOH 2LOOA 4ENMA 1ZLKA 3K1MA 2KFDA 1LUJB 2M87A 3RJPA 2OTLI 4TV7A 2VKDA 3E0JB 4AVZA 2E2HJ 4FHTA 4RS8A 4L9JA 3FXRA 3V8LA 3KYCB 2K27A 4BY7J 1W1WE 3K4BA 1SD6A 3QP6A 2AXLA 3DP7A 2CU7A 4JYKA 2M2EA 3I59A 4A12A 1TLHB 2E35A 2X48A 1GUUA 5HS8A 1VF9A 2RREA 3O6BB 2L7ZA 2HOTA 1FNNA 2XUBA 3N97A 5F0CA 2YX7A 4UVBA 4Q48A 1EH7A 3PNVA 5HLTA 1A6QA 3M8EA 1EKEA 2NVTJ 1EJ9A 3KZYA 4XL9A 1SD5A 3W6JB 3GWZA 1FLIA 5HODA 3S32A 3OWTA 2DMPA 1GHCA 4C9YA 3M8JA 4XN3A 3CQZJ 3MAJA 1MW7A 2F4OB 1T98A 2H1KA 1HKSA 3E97A 3L1PA 4OOIA 2FEZA 3B73A 4EJOA 2NVQJ 2VJJA 1T95A 2X1DA 3JRCA 1UELB 1RUNA 1JHHA 1ERDA 4L5EA 3SFIA 2IJLA 4KT6A 1IDZA 3CMEI 1BR1A 1JJ6C 2VASA 4BKXA 1BR2A 4OIRF 3I59B 1JE8A 2LBFA 1BA5A 3RQIA 3ONQA 5F0FA 3V8KA 1P2FA 2FE3A 1DQUA 4HLXA 3BC8A 2E5NA 1FSEA 1LE8A 1LNWA 1XS9A 3BG9A 2DMUA 4MEYF 1YITI 2XVCA 4HEA2 3KPHA 1E17A 3ZMSA 4EM0B 4MFDA 1FMWA 2MLKA 1VQ8I 1XC5A 3CJQB 1VTNC 3GZNB 4MGRA 2DFFA 2Z2SB 2XAJA 2B0LA 1VZ0A 2QQBA 2JUGA 1ON2A 3KLOA 4YEJA 3ZMZA 1E3OC 4PFOA 2V6CA 2JK3A 4P1WA 1VQPI 3ABUA 4WF2A 1QO0D 5HNHA 3CC7I 2KIFA 3F0CA 2R5ZB 1D5YA 2WADA 4F55A 2LBFB 1JXSA 4B44A 3RSNA 4GYGA 4ZH4F 3RYPA 3H1CA 3ISPA 5BMZA 1JKPC 1C0WA 4CHUA 1LE8B 3HGYA 3H3VK 3HYIA 1XMAA 3IH2A 3FHNA 3G1LA 4D5CA 2FJ1A 4AIJA 1XSVA 3HUGB 1A5JA 4J01A 2V4JC 2M3AA 2R93J 2O5RA 1EV7A 4HF0A 3UR3C 1SMTA 1JUPA 3A02A 3D5SC 3FM5A 3FMSA 2M4KA 2Y31A 1PP7U 1GLNA 2GXBA 4X6AJ 1MH3A 3LAPA 4LIUA 3T8TA 4LB6B 2ESNA 3GUDA 5EZGA 3VYUB 1BM9A 3OS0A 4O6JA 3GLXA 1MBJA 1WH5A 2L54A 3KYDB 2VLAA 4M71A 2GA1A 5H2FC 1QNTA 1Y8QB 3OOUA 2VE8A 2YPRA 5JHUA 2PLYA 3GTQJ 2YU3A 4LITA 3IHUA 2NRAC 2ZNYA 3GZ6A 2WB1N 3AL0C 3WU1B 2E60A 1N78A 5LHGA 2E34A 2EV6A 3K2ZA 3SEZA 4CA0A 4A3EJ 2DPDA 4RA2A 1QHGA 4BQNA 4M6VA 2DA7A 3QU6A 2PMZA 3LFKA 2EFWA 3TO6A 1LEBA 2X6XA 2AS5F 1F5TA 2K9MA 1HW2A 3T1BA 3HZJA 2ECBA 3F21A 3EYYA 3JRIA 3QYFA 1RESA 1XX5A 3SZPA 2XAGA 1TL8A 3REOA 1F1ZA 2H27A 1J2XA 2X9DA 2W4SA 5DYMA 1MBFA 2BHYA 2XF5A 4EJWA 1ORKA 1PYVA 4I01A 3KFWX 3QQAA 4HX8A 1ETVA 1G3WA 2L9RA 4LMYA 1EH8A 3RPQA 4N9HA 3HRSA 1ZRCA 3BZCA 4G7ZF 3Q3SA 4EQQA 1UHWA 4OIOF 3GTPJ 2UZKA 4PFPA 1WH7A 2L7MP 5A2QK 2OTJI 2PJPA 1ZG5A 4RGXA 2OQRA 1WJBA 3HSFA 4XLNF 3EETA 2JA6J 3PL8A 3R6SA 4NHJA 2K9NA 4ZYGA 3BG7A 4UB8C 3OYLA 3S2DJ 1AA7A 3CF2A 3I4MJ 3M9AA 1SVOA 1YJ9I 5TRDA 1W0UA 2XRNA 4GRIA 1P6RA 3DEEA 2DW4A 3A0BC 3K4CA 4B4CA 1MMAA 2G9WA 1WJFA 2VB6A 1VQMI 1IGNA 6PAXA 2R7SA 5GPAA 2VQLA 2VIXA 1K78A 5ICEA 4S0HB 3S1QJ 3SYTA 5HDKA 2WAFA 1T6SA 4OIPF 3GXOA 3IWZA 4KJZA 5KHDA 3JRFA 1J9IA 1UHSA 4CCKA 5JLXA 4AVPA 3VPRA 2ZMEA 4U0WA 2NS7A 1CGPA 1V55H 3PIPF 2NVYJ 2HWVA 4KN4X 1FPQA 1ZQ3P 1Y56A 5F1RA 2K9LA 3ZGKA 1BOBA 1R00A 3I5UA 1OCZH 2LKXA 3HJEA 1YX5A 3D5RC 5BQTA 2P0WA 3O8HA 1K83J 3OIQA 2V9PA 1AHDP 2HDWA 2E2JJ 2K5CA 3HG9A 5L3BA 2RQPA 1BJAA 2EINH 2WWYA 1FYMA 2B63J 4NUBA 2F2EA 2P5VA 3AG1H 4A3LJ 2EV0A 1U2WA 5B66C 3L2QA 1HW5A 3N05A 3QWLA 3IKTA 4MIMA 5FKOA 3QPTA 1K78B 2NNNA 1GDTA 3P5JA 2IXSA 3Q0VA 2UWMA 1HW1A 2GM4A 4XLPF 1MJ9A 1XDSA 4M6YA 2X0LA 2DA6A 2IPQX 1H9TA 2HPMA 2O9LA 2KHMA 2FMYA 3OMYA 4O5VA 5FRMA 2ZMEB 3MD2A 2G7HA 3OYKA 1FZPB 3PSIA 2DDAA 1RR8C 4E7HA 4ZDPA 4M9ZA 3IUOA 3GEZA 1HBXG 2VONA 3KP6A 3QOEA 3EUHC 5C4XJ 1D0YA 2DOEA 1RRJA 2VBZA 4Y15A 3HB9A 2IGMA 4A3GJ 2MG4A 2XHKA 3PQJA 3LA7A 2L9VA 2M45A 5E79C 4MTDA 1RI7A 1MMDA 4CCOA 5BS6A 1Z6TA 1S7EA 3T0YA 4B1RA 1A36A 2D5VA 3OR2C 1WKMA 5J6XA 3CMAI 2E1MC 5E17F 3BLYA 4M3GA 3O2PE 2W7NA 3VDXA 1RKTA 2KIUA 4LLGF 4U88A 3ELKA 1QPIA 4IEJA 1O7LA 2VBXA 4LG3A 2A61A 4A5NA 5HNFA 1MD0A 2D1HA 4Y17A 4HX7A 1B6AA 1A35A 4BH9A 2P7VB 2VKEA 1BR4A 4E7KA 5D5VB 5L3CA 2P5LC 3WTSC 4J19A 3CJRB 1OLTA 4ENJA 2R7VA 5JR3A 4XSXF 3CUQA 5JLWA 3WTUC 1G8XA 1MNMC 1FYKA 4PJ0C 5K7HA 2QKMB 4IHWA 9ANTA 3ABKH 1ZRFA 2LY1A 2HXIA 3F8NA 2Z3YA 3WGGA 3JSOA 2PEXA 3I53A 2MC4A 2WAEA 2IGNA 4PK4A 3V7SA 1U8RA 2F5VA 2IA2A 1RZ4A 2K3PA 4G8XA 4PSXA 4A3KJ 1ZG1A 2CUFA 1JTXA 2HQ5A 1SVMA 2X4HA 3OYFA 2KZVA 3ERED 1ZARA 3GCMA 2J5PA 3PFYA 4ENKA 1JGSA 2VUMJ 2CG4A 2YR2A 5A2QZ 1Z6RA 3M3YJ 3K2AA 4E7SA 1LDDA 5B5EC 3LA3A 2CO5A 2W85A 4XK4A 4L9VA 5FJ8J 5DD8A 1YS6A 4Q47A 3CUQB 3E1SA 1J75A 1HC8A 3JTGA 2VJ4A 2DJNA 3CESA 2KPMA 5E1WA 1O3TA 4KICA 2HEOA 5D5XB 3R60A 1AWCA 3MEXA 4BDZA 2LR8A 2FNPA 4IRGA 1T2KA 5EG0A 2LKPA 2MD5A 1S7AA 1JT0A 2Z1DA 5D5WB 4UHTA 4M9SA 1BJZA 1YG2A 1R23A 3CO6C 2JSCA 2PFBA 2OJED 3K70D 3BR1A 2GAUA 4YFXF 2QQAA 1IV8A 5DEQA 5EGOA 2M7AA 4IXAA 2QCOA 2JWTA 1TNTA 2JVHA 4DBQA 2A6EF 1OCOH 3WHBA 2M30A 2OPTA 2EFNA 3WODF 3FXOA 1XCVA 2R7XA 1OYYA 1FBUA 2XKPA 3K4JA 4ITVA 3IKVA 1X3ZB 4ETSA 2HOAA 3HOYJ 3PNYA 1YHQI 1MGTA 2R7UA 1MDMB 3S1MJ 1A04A 4OIQF 2E1OA 3LQRA 5DCFA 3CDIA 3H35A 2DA3A 2DT5A 2PMZN 2WY7Q 5F0HA 1W0TA 2UV1A 1X3WB 3F6OA 5CQGA 4QPOA 1FWZA 1QZYA 4E70A 1YW9A 3I71A 1W36D 3EQLF 5AIQA 1SFOJ 2EZHA 3TW7A 3AG2H 4HDVA 1ONVA 2W25A 3VYRB 2J5OA 4KN7X 1X3UA 2Y69H 4WX9A 3JAMK 3FWEA 4P9FA 3MKLA 1FIPA 1W4MA 4D7NA 3CCSI 5KCMA 1R1UA 3F8MA 2TDXA 4GO1A 3ZPLA 3OL4A 1ZHFA 4LK1F 3DV8A 3IAM2 2DT7B 3SJMA 4XQFA 1UCRA 3D5LA 3F9KA 4ZC3A 4F3QA 2RKHA 3E6BA 1USSA 4IHSA 3IL2A 2FD5A 3C1DA 5FKMA 3FXKA 3OYEA 1NH3A 2DBBA 3LOCA 1Z7LA 3F8CA 4A3CJ 3ASOH 4CSWA 2V1UA 2IP2A 5DCMA 4Y13A 1MJBA 5LLQA 2D45A 2E2IJ 5CVUA 3BJAA 5LRSA 3GTLJ 1YOVB 5M5WJ 1SVLA 2CH0A 2PG4A 2VT3A 4M9XA 1SD4A 4HG2A 2HDCA 2ZSHB 5IPAA 3PO3J 2A6TA 4D0PA 1WSUA 4I0BA 2DODA 3QOPA 3I4PA 4BAYA 3ZP5A 1MJAA 1MBHA 4XLAA 2AO9A 1ETYA 2Q0OA 5E3OA 3MVPA 2JPCA 4BHCA 1XG1A 1V54H 4PSWA 1YFHA 1HF0A 2BV6A 2LKSA 3HOSA 1O3QA 4PUSA 2P7CB 2TCTA 5D8LB 2EPFA 3HM5A 4RB2C 4CDGA 3HSRA 2FSWA 1Z67A 1YI2I 3KLNA 4MFEA 3FHZA 3OOPA 5LGUA 4IQ4A 1DGWY 4PCQA 3I56I 2X51A 3OYIA 2HKOA 2JSPA 1R1VA 4Z6YA 1UMQA 1I50J 2A5YB 3M4OJ 5GAHJ 1FOWA 1TWGJ 3TL4X 2GOMA 2MBFA 3FZVA 1Y6IA 5ICCA 2DPUA 2HDDA 4IRIA 4LOCA 3FF5A 3J80K 2STTA 5KVRA 4JQFA 3GTKJ 3ABLH 1O7FA 4XKWA 2IS4A 2ZCWA 3WGHA 3AFHA 3ZQCA 2VE9A 5J1RA 1XSDA 1UG0A 3FXMA 2XAUA 2HTSA 1OQYA 1YX3A 5FKNA 3BZKA 3H9GA 2ZJ2A 5DS9A 3E7LA 1AKHA 4FX4A 4OMYA 1TW2A 1G3TA 2P81A 1J09A 4KIBA 1T0FC 2VT2A 1T33A 4DYQA 4I76A 1CQTA 1V3FA 2HNHA 4EV0A 1V5GA 2R7ZJ 1S6LA 3K4NA 5E1XA 3W2AA 4AYBA 1YJNI 2KL4A 4P9UA 1WZ2A 5J8CA 4HF1A 1LVKA 5HDGA 3LSMA 1UAAA 1OFCX 3CLOA 2B9SA 5L3FA 2X1EA 2Q2EB 3WTTC 5CJ9A 1IRZA 4G7HF 2VBWA 3JTHA 3HOTA 3EDPA 1NK2P 3BROA 1X19A 1KONA 3RYRA 1ENHA 2O3FA 1VQLI 1SMYF 2OU2A 4CICA 4V2FA 3E5UA 5IP7J 3CCLI 3IH4A 2HPIA 1S8NA 2NAZA 4BYYA 1XMXA 2K4JA 1PUEE 4XLEA 2LVSA 1YW8A 2CQKA 3J7ZI 3BR0A 2GA2A 3BR5A 1WJAA 3ZRGA 2VOOA 2V7FA 1X2MA 3JRAA 2QBYA 5J1UA 2RN7A 2CRGA 1E3PA 2JPBA 4BJTA 2CFOA 1ZELA 1FT9A 3G71I 1Z05A 2NNYA 2KZGA 4NNJA 1F4KA 3CLQA 4L0YB 3L00A 5EEHA 4KMFA 1XTAA 3DU5A 1YE9A 2IGKA 3VYTB 3BTLA 3FK7A 4XOPA 3PJRA 2QVOA 3H92A 3TW6A 1KYZA 3HC7A 3W2VA 4NQWA 2IW5A 2EWNA 2MFZA 1W5SA 1ZTRA 4U7BA 3GMEA 3GLLA 2VPLA 1PDNC 4LG0A 5M5YJ 3FDYA 5C3EJ 4C2MJ 1D0XA 4HRIA 3GX4X 2R5YB 2VN2A 3A03A 3LSJA 2Y0SA 3R4KA 5F27A 4RAFA 2LDUA 2CSOA 1FC3A 2K9SA 2QBYB 2VBYA 1UG2A 3JREA 3MKZA 4MO7A 2V1XA 4DBRA 1BN5A 2XGDA 4A69C 4LGWA 3K10A 1V4RA 5DTDA 5EYRA 4CYDA 1IF1A 1P7JA 2EIKH 2KISA 4MLOA 4IOAF 1LVAA 1FY7A 1Y0UA 2R5ZA 5KK1A 5FLMJ 4PJMA 3QPSA 4C3IJ 1XGNA 1FIAA 4NQWB 3E6CC 2KRCA 5IT3A 3CCJI 2K7LA 4CCNA 2F5FA 4LG0B 2L7KA 4YG2F 3DFGA 5IYCJ 4XRMA 1DGRM 2UXNA 3W6VA 4A3BJ 3HUGA 2EIMH 3LQQA 3FMQA 3B6CA 1VQNI 3KP4A 1LKXA 1D1AA 4G9YA 1VQ6I 1TQIA 2M0CA 3J81K 3Q0WA 2NOJB 4XIDA 3VB2A 4II3A 4B3XA 1HKTA 5E3LA 2W00A 4IHXA 4LD5A 1TWAJ 5J8FA 3HPHA 1MSEC 1NHAA 3P7NA 3S93A 1HA8A 2IAIA 1ZGAA 2OCCH 4U0VA 4KNYA 1IUYA 1ZR4A 2BE5F 1GXQA 5F08A 4CH7A 4Y7NJ 3KCCA 5FKKA 4HAMA 5L3EA 2HQRA 3WTYC 1R4MB 3WU2C 3ZOBA 5HOOA 3HGGA 3RZDJ 2JRMA 3PUFA 1Z3YA 2O7OA 3SHFA 3KP5A 4WWCA 4KDPA 2DYRH 3ULQB 4BQAA 4IO9F 4FTHA 1HQCA 1NTCA 4XORA 2NVUB 2ELHA 3FX3A 3MZ8A 2E1NA 2FF4A 3GTJJ 5TJJA 1X1BA 3QYBA 3MN2A 2IBDA 4LB5A 4BNCA 4BXFA 1FYLA 2FOWA 2A07F 2MH2A 2XGCA 2Z33A 3I54A 1VI0A 2JJ7A 4XR6A 3RIRA 3CCQI 1QZEA 5C4JJ 3H0DA 1Q1HA 2YX4A 4I2OA 2DT6A 4MNUA 2XSDC 1EF4A 5ED4A 2KDOA 4F92B 5LRRA 3ZN1A 1FP1D 4A0XA 1Y39A 3J7AY 1R22A 1WJ5A 4QWQA 4G7OF 3BR6A 1VQOI 2R7OA 2HYJA 4EM1A 1MMGA 2XPUA 3A1YA 4ZYAA 2EK5A 3C7JA 1OCPA 3DTKA 1R9TJ 2QYOA 3CP8A 4B09A 4DZPA 3IRQA 1UFMA 4PZJA 1LFBA 1VQ4I 2VKHA 5F1JA 4XRSA 3GO5A 4IJAA 2AQFA 1WI3A 2R7WA 4BE1A 1W5CC 2CV1A 2R3SA 1U5TC 3FXJA 3S1NJ 1YW7A 2QLZA 3V4GA 1XD7A 3WTXC 5DV5A 3G6EI 1MNDA 3R61A 2FRHA 2OD5A 3GFJA 3LSPA 4XNFA 5IT9K 1Z1DA 2PMHA 5LHIA 3BP8A 3EYIA 4I09A 2NOGA 3F72A 2B7EA 2DA5A 3RKYA 3U2RA 4N4OB 2CV2A 3GTGJ 4ZTJA 4MQ9F 4HNTA 1F9NA 1MBEA 2BY0A 2XGXA 3OIPA 4EATA 2GLOA 1R1TA 2F5DA 4M3BA 3CJTB 2KLOA 3HKZA 4C2TA 2CV0A 4RB0A 2FBHA 2VL8A 3G73A 3SDBA 1VNDA 4M6XA 1H9GA 2DA1A 3KE2A 3O8GA 2FX0A 4XKVA 1WGXA 2KIQA 5L3DA 1BW6A 4FX0A 2E7XA 4AYBN 5FD6A 2A6HF 3RQ4A 3GTMJ 1W5TA 4RM2A 3LA2A 2IRFG 1P7IA 5FO5A 2ZXHA 4EJVA 1K6OA 2XB5A 4KYWA 3MKYB 5LD2C 1B1BA 4BACA 2O03A 1DPRA 4ENNA 4E4HA 3PUBA 1KQ9A 3VEPA 5J4VA 3S2HJ 4IVNA 2XGEA 4Z2YA 4IKFA 4H0EA 1OYIA 4PJJA 1ZYRF 3L2CA 3H36A 1I3QJ 5DM7F 3S14J 3CCMI 1R36A 3G2BA 4EGZA 3PFIA 3S8PA 4HOBA 3DKXA 5HLGA 1I5ZA 3ZMVA 2CUJA 2X6WA 4HV6A 5HLHA 2O0YA 3SDGA 1OR7C 2BGCA 5ILSA 3TDUC 4N9IA 2XPWA 3NAUA 3TOAA 2ISYA 2JRTA 2DOFA 2L02A 1FSHA 4JX4A 5IOZA 1GVDA 1Q1VA 2K9QA 4XICA 2W48A 1P92A 4D5FA 2O61A 4ESBA 3J7AO 1IRGA 3L2UA 2ZB9A 3OY9A 1WHUA 5EEGA 2OA4A 3NWTA 5TISC 1XSXA 1E2XA 2DMTA 4J00A 2KT0A 1XGOA 4LIVA 3ZQHA 5AONA 1M1EB 2DA2A 4PGHA 3HPGA 2AXTC 3KZZA 2Y0SN 3K1NA 3H9JA 3R0AA 2EJRA 1HCRA 2DN0A 1U0JA 2I5UA 4UXNA 3ZMTA 1WWXA 2ZC2A 3NRVA 4PJNA 4WXCA 3JCUC 2F4IA 2WAQA 4YIIA 1YO5C 1DPUA 3ESWB 4AWXB 3SZGA 4C30A 5LEKA 1IN4A 3Q9SA 2VI6A 1JKOC 3HTSB 2Z5UA 4BBRJ 3BOQA 4BUPA 3EUAA 4RDUA 3ABMH 3H5RA 3SZTA 3L2WA 4UNOA 4CYCA 3M1CA 3E5QA 4FISA 2MGQA 3PIOF 1D3YA 2ZJQF 2IA1A 3M7GA 2CMPA 2BY2A 5K7FA 1I6XA 3WTVC 4HSRA 2A3SA 4O3MA 1SFEA 2FBIA 3PM1A 2MABA 3IWFA 3TO7A 4BHBA 4ZTFA 2LTPA 2OZUA 2OC6A 4YELA 3SQNA 3WG9A 1L3LA 3AG3H 5C44J 4QPQA 2ACJA 3BQZA 4NC7A 4FE7A 4JOMA 4AUXA 1UJ8A 1XGSA 3WTWC 4R1HA 2HQNA 3ASNH 1W7PD 2EA2A 3CCUI 4H4KC 4EVIA 4KFCA 3F8FA 1X1AA 5IT9Z 1MDMA 2R7FA 3BJOA 2NXNB 1F36A 3S16J 5J1YA 2E7WA 4CXFA 4A3MJ 2X6YA 4RMNA 1YIJI 3QPLA 4CYCB 1XMKA 4WXHA 2L3DA 2LMDA 2Y75A 5E8IA 1JUSA 1QVUA 3E5XA 2V1NA 4DYCA 1O3SA 1MZBA 3GYHX 3ZQQA 1NG7A 5FFXA 1TQPA 5D4SA 5FB2A 3HOXJ 3L09A 4ZZLA 2ELKA 1IXCA 2DDBA 2E36A 1YYVA 3AL0B 2G0EA 3VOEA 4XRFA 2FBKA 2LFBA 2VC1A 4GGGA 1K79A 1T08B 1QGPA 3M1EA 2DTRA 4HNUA 1Z21A 2M7BA 4OWRB 1ETXA 5H6QA 1HLVA 3V42A 2VODA 3CC4I 4U87A 3LSTA 5KNLA 2HR3A 3R0JA
chains in the Genus database with same CATH topology
2R5ZB 2JN6A 2P81A 1D5YA 1JTYA 1FEXA 5GPCA 1T33A 3TP3A 4DYQA 4I76A 1CQTA 3ZQFA 1JKPC 2JA5J 2R7ZJ 3PO2J 3D1NI 4M3FA 1LE8B 3HGYA 3H3VK 2LK2A 3G1OA 3IH2A 3G1LA 4D5CA 2KDZA 1OFCX 5M3FJ 2FJ1A 5FLVA 1A5JA 4JP0A 1ETWA 2R93J 2LY9A 2X6OA 1IRZA 3DEWA 3HOUJ 1JUPA 3A02A 1DU6A 3ZQGA 1NK2P 1HOMA 3BQYA 1ENHA 4FCYA 1IV6A 2Y31A 4NDLA 4X6AJ 1MH3A 4V2FA 1NK3P 5IP7J 3CMYA 3IH4A 4I6ZA 1X2NA 3OSFA 4B3AA 5EZGA 1MH4A 2LVSA 3BG5A 3ZQIA 3BR0A 3BR5A 4M3DA 1MBJA 1WH5A 2GBYA 3CCYA 3GTOJ 1X2MA 3JRAA 3IV5A 3OOUA 5J1UA 2E19A 5E3NA 3GTQJ 3H0GJ 2CRGA 2WB1N 1Y1WJ 1TWHJ 4A3EJ 3S1RJ 3BTLA 3FK7A 2YU9J 4M6VA 5M5XJ 4UUTA 2DA7A 3TW6A 2O8KA 1ETKA 4M3EA 3JRGA 1JJ8C 1ZTRA 2AHQA 1Z77A 3LNQA 3HKZN 5M5YJ 2ECBA 5C3EJ 4C2MJ 3JRIA 1SANA 2ID6A 2R5YB 3HDDA 1RESA 3A03A 3LSJA 5F27A 3OSGA 2HXOA 1IDYA 2EQRA 2K9SA 2VPRA 2X9DA 1UG2A 4DZJA 1MBFA 1ZK8A 4MO7A 4V2GA 2XGDA 3JREA 4A69C 1ORKA 3QQAA 1ETVA 2L9RA 5DTDA 5EYRA 1P7JA 4MLOA 3Q3SA 2EZLA 1OCTC 2R5ZA 2ME0A 3GTPJ 1Y1VJ 3BR3A 4DYRA 1WH7A 2L7MP 5FLMJ 1FJLA 3RKQA 5EDNA 3QPSA 2M8GX 3JR9A 4C3IJ 1FIAA 2ID3A 1DU0A 2JA6J 2XPVA 1MSFC 1JKRC 2K9NA 2L7FP 5IYCJ 4XRMA 3W6VA 4FE4A 4A3BJ 1K61A 3S2DJ 1IJWC 3B6CA 2DTZA 3I4MJ 2Y30A 1ZR2A 2R92J 1W0UA 2M0CA 4B4CA 3BTJA 1H89C 3Q0WA 1IGNA 4XIDA 5GPAA 1ZKGA 4S0HB 1A6IA 4A3JJ 3S1QJ 4A3IJ 1T56A 5E3LA 4QSHA 2YUSA 2MW8A 4IHXA 3JRHA 3JRFA 1TWAJ 3DCFA 2NVXJ 1UHSA 5JLXA 1MSEC 3OIOA 1I6HJ 1TC3C 3VPRA 2IAIA 2NS7A 1H8AC 1ZR4A 2NVYJ 5F08A 4Y7NJ 1ZQ3P 5FKKA 2FQ4A 2LKXA 3HOVJ 4A3DJ 2LP0A 3O8HA 1K83J 1AHDP 2E2JJ 1MBGA 3ZOBA 4QIWN 1U9OA 2B63J 1APLC 3WHCA 3HGGA 3RZDJ 4A3LJ 4HNVA 4QTRA 3CDLA 3HBLA 2OF7A 2O7OA 3JRBA 4MIMA 5FKOA 2WAQN 5M3MJ 3BTIA 1GDTA 4FTHA 3G1MA 3Q0VA 1NTCA 2GM4A 1MBKA 3TP0A 3GTJJ 2DA6A 2O9LA 3MN2A 5J3LA 2IBDA 2R5YA 1LFUP 1OJLA 2XGCA 1VI0A 1Z0XA 2JJ7A 2JA8J 3FISA 2CJJA 5C4JJ 3LSGA 1B72A 1FTTA 5C4XJ 5EG0B 2XSDC 3TEDA 1EF4A 3HB9A 5IYBJ 1O4XA 4A3GJ 2CUEA 1H88C 1FTZA 5EEAA 2EZKA 2MG4A 2MSYA 1RR7A 2DMQA 3BR2A 3BR6A 5EGOB 2H8RA 1ZGWA 4B1RA 1S7EA 2HYJA 2D5VA 2XPUA 1YRNA 4M3GA 1OCPA 1RKTA 4IHVA 1R9TJ 4DZPA 1LFBA 5F1JA 2Y9YA 4XRSA 1QPIA 3NARA 1WPKA 4IEJA 4C3JJ 1WI3A 5K7ZA 5IP6A 3HEFA 3S1NJ 2VKEA 1B72B 4JX5A 2HI3A 2M34A 2Y9ZA 4J19A 2DA4A 3A01A 3LSPA 5JLWA 1U78A 1ITYA 1MNMC 2NOGA 5K7HA 2DA5A 4IHWA 1JUMA 2L0KA 3GTGJ 9ANTA 5FKLA 2HXIA 1ETOA 1QRYA 2EBIA 2K40A 1MBEA 1U9NA 2RAEA 2R0QC 4RBOA 1IC8A 1YRNB 4BXXJ 4BBSJ 2GLOA 5IYDJ 2JMWA 4M3BA 3HOZJ 3UKGA 2CQQA 3BG3A 4A3KJ 1HDPA 2CUFA 1JTXA 1POGA 3C2BA 1GT0C 1AU7A 1VNDA 1ETQA 2HQ5A 2DA1A 4A93J 3O8GA 2FX0A 1WGXA 2HOSA 1BW6A 2VUMJ 5GP9A 2VKVA 3ZQLA 3M3YJ 3K2AA 4AYBN 3K7AJ 1WCMJ 2XRLA 4UUSA 1BW5A 4IHYA 3GTMJ 4XK4A 1GV5A 1JT6A 1P7IA 2IEKA 2ME6A 5FJ8J 3A01B 1F43A 2XB5A 4EEFG 2EZIA 2DJNA 5EF6A 3IH3A 3S2HJ 4G12A 1IUFA 4W97A 2XGEA 2ECCA 4BY1J 4XRSG 2LR8A 1I3QJ 2Y2ZA 3BT9A 2M9HA 4AC0A 3S14J 5EG0A 5IP9J 3JRDA 3Q0UA 4D7MA 1JT0A 1JGGA 1BJZA 2JA7J 3BR1A 5BNGA 1JKQC 5EGOA 3S15J 3SDGA 3GBGA 2QCOA 2JWTA 2XPWA 3NAUA 2LLKA 1IG7A 4X1EA 4ABZA 3WHBA 4UUSB 2OPTA 1HDDC 4JX4A 5IOZA 1GVDA 1Q1VA 2K9QA 4XICA 3BTCA 4A3FJ 2W48A 2HOAA 3HOYJ 4D5FA 1RPWA 4C3HJ 2COBA 3S1MJ 2NS8A 3FK6A 2ZB9A 2E1OA 5IOYA 2PMZN 2DA3A 5F0HA 1W0TA 1RETA 1GV2A 2DMTA 1VFCA 2KT0A 3ZQHA 1AKHB 2XB0X 2DA2A 1SFOJ 2EZHA 3TW7A 3FIWA 2Y0SN 1B8IA 3LSRA 1PUFA 1HCRA 2DN0A 3MKLA 1RKWA 1FIPA 4D7NA 1U8BA 2CQXA 3SJMA 2E2HJ 4JX6A 4Y52J 2VI6A 1JKOC 4BY7J 2FD5A 5FKMA 2LD5A 1QVTA 4BBRJ 3LOCA 2CU7A 4JYKA 4A3CJ 2M2EA 4RDUA 5F04A 2X48A 1GUUA 2E2IJ 4CYCA 1G2HA 1VF9A 4FISA 2MGQA 3FKIJ 2L7ZA 2HOTA 3GTLJ 5F0CA 5M5WJ 2EH3A 5K7FA 2NVTJ 3PO3J 5IPAA 4GFBA 3PM1A 1MBHA 2LTPA 5HODA 1B8IB 1PUFB 2AO9A 1ETYA 2DMPA 5E3OA 3MVPA 5C44J 3CQZJ 1XG1A 3BQZA 4FE7A 3S17J 2H1KA 4AUXA 2DMNA 3L1PA 1X58A 1HF0A 2NVQJ 2TCTA 3B6AA 3JRCA 4L5EA 3SFIA 3HM5A 3RZOJ 1IDZA 1JJ6C 3HOWJ 4W1UA 4MFEA 4BKXA 1F36A 2YS9A 3S16J 5J1YA 4A3MJ 3I4NJ 4DW6A 3QPLA 3RQIA 4CYCB 1BA5A 5F0FA 1JUSA 1QVUA 1UMQA 1LE8A 1I50J 1XS9A 2QF7A 1TWFJ 2DMUA 3BG9A 1TWCJ 4DYCA 3M4OJ 1TWGJ 2HDDA 4MFDA 3HOXJ 1XC5A 4LOCA 2ELKA 3GTKJ 2G0EA 3ZQCA 2LFBA 5J1RA 2WV1A 2N8GA 5FKNA 1E3OC 2JK3A 1ETXA 5EZHA 1HLVA 5DS9A 3E7LA 1AKHA 2TRTA 2I10A 1BL0A 5E3MA 3F0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5Z B;  2JN6 A;  2P81 A;  1D5Y A;  1JTY A;  1FEX A;  5GPC A;  1T33 A;  3TP3 A;  4DYQ A;  4I76 A;  1CQT A;  3ZQF A;  1JKP C;  2JA5 J;  2R7Z J;  3PO2 J;  3D1N I;  4M3F A;  1LE8 B;  3HGY A;  3H3V K;  2LK2 A;  3G1O A;  3IH2 A;  3G1L A;  4D5C A;  2KDZ A;  1OFC X;  5M3F J;  2FJ1 A;  5FLV A;  1A5J A;  4JP0 A;  1ETW A;  2R93 J;  2LY9 A;  2X6O A;  1IRZ A;  3DEW A;  3HOU J;  1JUP A;  3A02 A;  1DU6 A;  3ZQG A;  1NK2 P;  1HOM A;  3BQY A;  1ENH A;  4FCY A;  1IV6 A;  2Y31 A;  4NDL A;  4X6A J;  1MH3 A;  4V2F A;  1NK3 P;  5IP7 J;  3CMY A;  3IH4 A;  4I6Z A;  1X2N A;  3OSF A;  4B3A A;  5EZG A;  1MH4 A;  2LVS A;  3BG5 A;  3ZQI A;  3BR0 A;  3BR5 A;  4M3D A;  1MBJ A;  1WH5 A;  2GBY A;  3CCY A;  3GTO J;  1X2M A;  3JRA A;  3IV5 A;  3OOU A;  5J1U A;  2E19 A;  5E3N A;  3GTQ J;  3H0G J;  2CRG A;  2WB1 N;  1Y1W J;  1TWH J;  4A3E J;  3S1R J;  3BTL A;  3FK7 A;  2YU9 J;  4M6V A;  5M5X J;  4UUT A;  2DA7 A;  3TW6 A;  2O8K A;  1ETK A;  4M3E A;  3JRG A;  1JJ8 C;  1ZTR A;  2AHQ A;  1Z77 A;  3LNQ A;  3HKZ N;  5M5Y J;  2ECB A;  5C3E J;  4C2M J;  3JRI A;  1SAN A;  2ID6 A;  2R5Y B;  3HDD A;  1RES A;  3A03 A;  3LSJ A;  5F27 A;  3OSG A;  2HXO A;  1IDY A;  2EQR A;  2K9S A;  2VPR A;  2X9D A;  1UG2 A;  4DZJ A;  1MBF A;  1ZK8 A;  4MO7 A;  4V2G A;  2XGD A;  3JRE A;  4A69 C;  1ORK A;  3QQA A;  1ETV A;  2L9R A;  5DTD A;  5EYR A;  1P7J A;  4MLO A;  3Q3S A;  2EZL A;  1OCT C;  2R5Z A;  2ME0 A;  3GTP J;  1Y1V J;  3BR3 A;  4DYR A;  1WH7 A;  2L7M P;  5FLM J;  1FJL A;  3RKQ A;  5EDN A;  3QPS A;  2M8G X;  3JR9 A;  4C3I J;  1FIA A;  2ID3 A;  1DU0 A;  2JA6 J;  2XPV A;  1MSF C;  1JKR C;  2K9N A;  2L7F P;  5IYC J;  4XRM A;  3W6V A;  4FE4 A;  4A3B J;  1K61 A;  3S2D J;  1IJW C;  3B6C A;  2DTZ A;  3I4M J;  2Y30 A;  1ZR2 A;  2R92 J;  1W0U A;  2M0C A;  4B4C A;  3BTJ A;  1H89 C;  3Q0W A;  1IGN A;  4XID A;  5GPA A;  1ZKG A;  4S0H B;  1A6I A;  4A3J J;  3S1Q J;  4A3I J;  1T56 A;  5E3L A;  4QSH A;  2YUS A;  2MW8 A;  4IHX A;  3JRH A;  3JRF A;  1TWA J;  3DCF A;  2NVX J;  1UHS A;  5JLX A;  1MSE C;  3OIO A;  1I6H J;  1TC3 C;  3VPR A;  2IAI A;  2NS7 A;  1H8A C;  1ZR4 A;  2NVY J;  5F08 A;  4Y7N J;  1ZQ3 P;  5FKK A;  2FQ4 A;  2LKX A;  3HOV J;  4A3D J;  2LP0 A;  3O8H A;  1K83 J;  1AHD P;  2E2J J;  1MBG A;  3ZOB A;  4QIW N;  1U9O A;  2B63 J;  1APL C;  3WHC A;  3HGG A;  3RZD J;  4A3L J;  4HNV A;  4QTR A;  3CDL A;  3HBL A;  2OF7 A;  2O7O A;  3JRB A;  4MIM A;  5FKO A;  2WAQ N;  5M3M J;  3BTI A;  1GDT A;  4FTH A;  3G1M A;  3Q0V A;  1NTC A;  2GM4 A;  1MBK A;  3TP0 A;  3GTJ J;  2DA6 A;  2O9L A;  3MN2 A;  5J3L A;  2IBD A;  2R5Y A;  1LFU P;  1OJL A;  2XGC A;  1VI0 A;  1Z0X A;  2JJ7 A;  2JA8 J;  3FIS A;  2CJJ A;  5C4J J;  3LSG A;  1B72 A;  1FTT A;  5C4X J;  5EG0 B;  2XSD C;  3TED A;  1EF4 A;  3HB9 A;  5IYB J;  1O4X A;  4A3G J;  2CUE A;  1H88 C;  1FTZ A;  5EEA A;  2EZK A;  2MG4 A;  2MSY A;  1RR7 A;  2DMQ A;  3BR2 A;  3BR6 A;  5EGO B;  2H8R A;  1ZGW A;  4B1R A;  1S7E A;  2HYJ A;  2D5V A;  2XPU A;  1YRN A;  4M3G A;  1OCP A;  1RKT A;  4IHV A;  1R9T J;  4DZP A;  1LFB A;  5F1J A;  2Y9Y A;  4XRS A;  1QPI A;  3NAR A;  1WPK A;  4IEJ A;  4C3J J;  1WI3 A;  5K7Z A;  5IP6 A;  3HEF A;  3S1N J;  2VKE A;  1B72 B;  4JX5 A;  2HI3 A;  2M34 A;  2Y9Z A;  4J19 A;  2DA4 A;  3A01 A;  3LSP A;  5JLW A;  1U78 A;  1ITY A;  1MNM C;  2NOG A;  5K7H A;  2DA5 A;  4IHW A;  1JUM A;  2L0K A;  3GTG J;  9ANT A;  5FKL A;  2HXI A;  1ETO A;  1QRY A;  2EBI A;  2K40 A;  1MBE A;  1U9N A;  2RAE A;  2R0Q C;  4RBO A;  1IC8 A;  1YRN B;  4BXX J;  4BBS J;  2GLO A;  5IYD J;  2JMW A;  4M3B A;  3HOZ J;  3UKG A;  2CQQ A;  3BG3 A;  4A3K J;  1HDP A;  2CUF A;  1JTX A;  1POG A;  3C2B A;  1GT0 C;  1AU7 A;  1VND A;  1ETQ A;  2HQ5 A;  2DA1 A;  4A93 J;  3O8G A;  2FX0 A;  1WGX A;  2HOS A;  1BW6 A;  2VUM J;  5GP9 A;  2VKV A;  3ZQL A;  3M3Y J;  3K2A A;  4AYB N;  3K7A J;  1WCM J;  2XRL A;  4UUS A;  1BW5 A;  4IHY A;  3GTM J;  4XK4 A;  1GV5 A;  1JT6 A;  1P7I A;  2IEK A;  2ME6 A;  5FJ8 J;  3A01 B;  1F43 A;  2XB5 A;  4EEF G;  2EZI A;  2DJN A;  5EF6 A;  3IH3 A;  3S2H J;  4G12 A;  1IUF A;  4W97 A;  2XGE A;  2ECC A;  4BY1 J;  4XRS G;  2LR8 A;  1I3Q J;  2Y2Z A;  3BT9 A;  2M9H A;  4AC0 A;  3S14 J;  5EG0 A;  5IP9 J;  3JRD A;  3Q0U A;  4D7M A;  1JT0 A;  1JGG A;  1BJZ A;  2JA7 J;  3BR1 A;  5BNG A;  1JKQ C;  5EGO A;  3S15 J;  3SDG A;  3GBG A;  2QCO A;  2JWT A;  2XPW A;  3NAU A;  2LLK A;  1IG7 A;  4X1E A;  4ABZ A;  3WHB A;  4UUS B;  2OPT A;  1HDD C;  4JX4 A;  5IOZ A;  1GVD A;  1Q1V A;  2K9Q A;  4XIC A;  3BTC A;  4A3F J;  2W48 A;  2HOA A;  3HOY J;  4D5F A;  1RPW A;  4C3H J;  2COB A;  3S1M J;  2NS8 A;  3FK6 A;  2ZB9 A;  2E1O A;  5IOY A;  2PMZ N;  2DA3 A;  5F0H A;  1W0T A;  1RET A;  1GV2 A;  2DMT A;  1VFC A;  2KT0 A;  3ZQH A;  1AKH B;  2XB0 X;  2DA2 A;  1SFO J;  2EZH A;  3TW7 A;  3FIW A;  2Y0S N;  1B8I A;  3LSR A;  1PUF A;  1HCR A;  2DN0 A;  3MKL A;  1RKW A;  1FIP A;  4D7N A;  1U8B A;  2CQX A;  3SJM A;  2E2H J;  4JX6 A;  4Y52 J;  2VI6 A;  1JKO C;  4BY7 J;  2FD5 A;  5FKM A;  2LD5 A;  1QVT A;  4BBR J;  3LOC A;  2CU7 A;  4JYK A;  4A3C J;  2M2E A;  4RDU A;  5F04 A;  2X48 A;  1GUU A;  2E2I J;  4CYC A;  1G2H A;  1VF9 A;  4FIS A;  2MGQ A;  3FKI J;  2L7Z A;  2HOT A;  3GTL J;  5F0C A;  5M5W J;  2EH3 A;  5K7F A;  2NVT J;  3PO3 J;  5IPA A;  4GFB A;  3PM1 A;  1MBH A;  2LTP A;  5HOD A;  1B8I B;  1PUF B;  2AO9 A;  1ETY A;  2DMP A;  5E3O A;  3MVP A;  5C44 J;  3CQZ J;  1XG1 A;  3BQZ A;  4FE7 A;  3S17 J;  2H1K A;  4AUX A;  2DMN A;  3L1P A;  1X58 A;  1HF0 A;  2NVQ J;  2TCT A;  3B6A A;  3JRC A;  4L5E A;  3SFI A;  3HM5 A;  3RZO J;  1IDZ A;  1JJ6 C;  3HOW J;  4W1U A;  4MFE A;  4BKX A;  1F36 A;  2YS9 A;  3S16 J;  5J1Y A;  4A3M J;  3I4N J;  4DW6 A;  3QPL A;  3RQI A;  4CYC B;  1BA5 A;  5F0F A;  1JUS A;  1QVU A;  1UMQ A;  1LE8 A;  1I50 J;  1XS9 A;  2QF7 A;  1TWF J;  2DMU A;  3BG9 A;  1TWC J;  4DYC A;  3M4O J;  1TWG J;  2HDD A;  4MFD A;  3HOX J;  1XC5 A;  4LOC A;  2ELK A;  3GTK J;  2G0E A;  3ZQC A;  2LFB A;  5J1R A;  2WV1 A;  2N8G A;  5FKN A;  1E3O C;  2JK3 A;  1ETX A;  5EZH A;  1HLV A;  5DS9 A;  3E7L A;  1AKH A;  2TRT A;  2I10 A;  1BL0 A;  5E3M A;  3F0C A; 
#chains in the Genus database with same CATH topology
 5E20 A;  4F7Z A;  4A5M A;  3Q9V A;  4ESJ A;  1JTY A;  2LC2 A;  2LF7 A;  1UST A;  1D1C A;  1FX7 A;  4C2U A;  2EA4 A;  1IN8 A;  3GFM A;  3ZQF A;  2FNA A;  5FFZ A;  4L18 B;  4UV8 A;  4UY8 I;  3B02 A;  4CUG A;  3D1N I;  3DBH B;  2MYS A;  4HF2 A;  2ZSI B;  3OYM A;  2KDZ A;  1E0E A;  1OIS A;  5M3F J;  2CQN A;  4XBF A;  2HZD A;  5FLV A;  1T8I A;  1I1G A;  1ZRD A;  4BS9 A;  3VSL A;  4ZJZ A;  2LY9 A;  3AKZ A;  5B3S H;  1J0R A;  4UVC A;  2WY8 Q;  2KRH A;  3W3C A;  1DU6 A;  3ZQG A;  3DKY A;  4B47 A;  1HOM A;  2A69 F;  3COA C;  1V5E A;  5DUK A;  1KQ8 A;  4A6E A;  1IV6 A;  1FMV A;  3S2W A;  4FCY A;  2ZKZ A;  5FD5 A;  4NDL A;  4HA8 A;  3TQN A;  4RGR A;  4YFK F;  2P6T A;  4JBA A;  1MH4 A;  3P9I A;  3BG5 A;  3DLA A;  4GDF A;  2JT1 A;  2BHZ A;  2ETH A;  3CCY A;  3SEQ A;  4D1Q A;  3CO7 C;  4BE2 A;  1CF7 A;  3OV8 A;  1YLF A;  3KP3 A;  3IV5 A;  2QWW A;  1B59 A;  5E3N A;  3H0G J;  3MFK A;  2LG4 A;  2VQG A;  3QRF F;  1Y1W J;  3K1P A;  4YFN F;  1LQ1 A;  2XF6 A;  1REP C;  3TBI A;  3K4K A;  2IGO A;  5LFA A;  2V26 A;  1QHH D;  3S1R J;  5K5Q A;  2LRE A;  4ZYE A;  1VQ7 I;  2YU9 J;  5M5X J;  4DJA A;  4KUM A;  3JRG A;  5K1Y A;  4EM2 A;  1KGS A;  2Q8K A;  1JJ8 C;  2Y48 A;  4M73 A;  1YIO A;  3RI4 A;  3HKZ N;  3KP2 A;  2W57 A;  2BBY A;  3HDD A;  3EUH A;  2DK5 A;  2EIL H;  2ZNZ A;  3BWG A;  2ZBK A;  3OSG A;  3L9F A;  1CF7 B;  2HXO A;  1IDY A;  2VPR A;  1H0M A;  4ASN A;  1ZK8 A;  3KIO A;  2MD0 A;  3H5A A;  4V2G A;  4XON A;  5IY5 H;  4HQE A;  2ESH A;  3VSK A;  5FLX K;  2QM3 A;  5JVT A;  2QEN A;  1W7P A;  2W24 A;  4BQO A;  4K2E A;  2L01 A;  1R5G A;  1UHM A;  1DP7 P;  5FRO A;  1FJL A;  3FKJ A;  3GZ5 A;  2D2W A;  5EDN A;  5DDG A;  4RB3 C;  1R5H A;  2M8G X;  3JR9 A;  3DPT A;  4DQ2 A;  4FAS D;  2KP6 A;  2IVM A;  1MMS A;  1MSF C;  2CWE A;  3DPU A;  3I55 I;  1JKR C;  1ZG3 A;  2WTE A;  1XDU A;  1KZH A;  4AM3 A;  3FM3 A;  1IJW C;  1BC8 C;  2Q2E A;  3ABT A;  3ZN0 A;  2E5Z A;  3OYG A;  5HS7 A;  4AD9 A;  1S7O A;  2HFH A;  1MMN A;  1XCB A;  1Z91 A;  2Y0M A;  1TNS A;  3BTJ A;  5LBQ A;  1SFU A;  3OL3 A;  2W84 A;  1T56 A;  4L5J A;  4HQM A;  4QSH A;  3ZR8 X;  2MW8 A;  5LGN A;  1W7P B;  3JRH A;  4LLN A;  1IXR C;  4XOT A;  2RQQ A;  1KA8 A;  2E1M B;  4XLF A;  4HST A;  3BDD A;  3C2G A;  4RLF A;  4FQG A;  3KP7 A;  3HL2 A;  3ERM A;  5ICF A;  2LYC A;  4Y33 A;  4XKC A;  3KET A;  1A31 A;  3RCO A;  3GFL A;  2NYX A;  3GVA A;  2HOE A;  2FQ4 A;  3PQK A;  1E3H A;  2A05 A;  1WJC A;  4XN0 A;  4BJ5 C;  3HOV J;  4A3D J;  1EA3 A;  3LFU A;  1IN7 A;  1J7K A;  1U9O A;  2VQH A;  4PJL A;  4I0A A;  5J4Y A;  3CDL A;  3HBL A;  2OF7 A;  3CZ6 A;  2WC2 A;  3J7Y J;  2QSG X;  2P4W A;  3JRB A;  4RM3 A;  3WTZ A;  1ZLJ A;  2WAQ N;  4N0B A;  4FT8 A;  2GQQ A;  1MBK A;  2DXI A;  2BOL A;  4AIK A;  5CYV A;  2ADU A;  5AIP A;  3HSE A;  5J3L A;  4B8X A;  3C2H A;  3LWF A;  2R5Y A;  1Y0N A;  1OJL A;  1LFU P;  2BVL A;  4Q5S F;  4DIQ A;  3IC7 A;  2JZY A;  3FIS A;  2CJJ A;  4DGW B;  3GF2 A;  1B72 A;  1O3R A;  4IPA A;  3WE2 A;  2FUG 2;  2RGV A;  1J59 A;  2V9V A;  3QP5 A;  1J5Y A;  2JTV A;  4EJT A;  3H9Q A;  1O4X A;  3KEO A;  1TT5 B;  3MZH A;  2F5C A;  5B1B H;  2MSY A;  3T5X A;  4X0G A;  1R58 A;  1RR7 A;  2KJC A;  4ZDL A;  4ZYH A;  5K5O A;  4F52 A;  1HSJ A;  2H8R A;  3QPH A;  2STW A;  2IS2 A;  3NEU A;  3EPZ A;  3JAM Z;  5JI6 A;  4GCV A;  4BEH B;  4P55 A;  1BI3 A;  1TTY A;  1QZZ A;  4IF4 A;  1YRN A;  2L4A A;  3HIF A;  2ZXI A;  5LHH A;  1LDJ A;  1S3J A;  2ZXJ A;  2Y9Y A;  1PVE A;  5JVG F;  1WPK A;  2DFE A;  4C3J J;  4KIG A;  3K0L A;  2XAQ A;  2R7Q A;  3W6K B;  5CKT A;  2XV4 S;  5IP6 A;  1NG6 A;  4CZZ A;  2F6C A;  2QGU A;  1B72 B;  2HI3 A;  2V79 A;  3CJN A;  4UVA A;  4CCJ A;  1SEU A;  2DA4 A;  4FET A;  5D4R A;  3A01 A;  3FXQ A;  4CGZ A;  4MHG A;  4L9N A;  4II2 A;  5ICG A;  4XKB A;  5LGT A;  1U78 A;  3TKY A;  1ITY A;  4M74 A;  5GTI C;  3A4C A;  1JUM A;  2CW8 A;  2L0K A;  2V9K A;  4AID A;  1R71 A;  3K6G A;  2UXX A;  1QRY A;  2EBI A;  2K40 A;  2RAE A;  2XF7 A;  3G3Z A;  1YRN B;  2ZME C;  4BXX J;  4BBS J;  3ZXS A;  2CUZ A;  5IYD J;  2JMW A;  2XAF A;  2XIG A;  4ZZD A;  5J40 A;  3UKG A;  2CQQ A;  5FLX Z;  4U7D A;  2QSF X;  1G3Y A;  3BG3 A;  2RV8 A;  3OYJ A;  4ZDO A;  3F3X A;  2QKL B;  1GT0 C;  4A0Y A;  1R4N B;  4RAZ A;  3U1D A;  2HVR A;  2X1C A;  3DWL E;  4A93 J;  1JI8 A;  1PJR A;  2HOS A;  3VFZ A;  5B1A H;  3I0T A;  3K7A J;  2NS0 A;  2XRL A;  2PN6 A;  4ANJ A;  4IHY A;  2HS5 A;  4BHP A;  2XDV A;  1GV5 A;  2ME6 A;  2IEK A;  3A01 B;  1F43 A;  3TO9 A;  2M1B A;  3H3Z A;  4EEF G;  1WJE A;  3OS2 A;  1SAX A;  2QEX I;  1TZL A;  5EF6 A;  3IH3 A;  4BL0 B;  3J80 Z;  1IUF A;  2CYY A;  3DKW A;  2VQC A;  1R7J A;  4LK0 F;  1AOY A;  2Y2Z A;  2ZFW A;  4AC0 A;  2AQE A;  5IP9 J;  3JRD A;  5E8G A;  2CGP A;  1JGG A;  3RKW A;  2JA7 J;  3RDI A;  2DFI A;  2QSH X;  2XKO A;  3DEU A;  1TP4 A;  3HXL A;  2LLK A;  1IG7 A;  4X1E A;  4XSZ F;  4ABZ A;  2L9N A;  4S05 A;  3C3W A;  3HTU A;  3FMR A;  1KU2 A;  3JSP A;  3CP2 A;  1XGM A;  1K6Y A;  2IA0 A;  3HHG A;  2VC0 A;  4KMU X;  2OAZ A;  3BTC A;  1XB4 A;  3MCZ A;  2BVM A;  4P5O A;  5TGT A;  4A3F J;  1IAW A;  3U21 A;  2DCE A;  4HBL A;  5BPD A;  2X85 A;  3DF8 A;  1B9N A;  2RDP A;  2ZFU A;  3FK6 A;  2G7U A;  5IOY A;  5J47 A;  1RET A;  1R5I D;  1GV2 A;  2YSR A;  1U6G A;  3DLL F;  2H6B A;  1T0F A;  2XAS A;  3CCR I;  2XB0 X;  3U1K A;  2LF8 A;  3AG4 H;  3FIW A;  1L0O C;  1B8I A;  2BXY A;  3LSR A;  1PUF A;  3WG7 H;  3BPV A;  3IAS 2;  5D6E A;  2DJI A;  1ZN2 A;  3I64 A;  3CUQ C;  1X1C A;  2HYF A;  1RKW A;  3DU6 A;  3H5N A;  4HX4 A;  1X4P A;  3BZ6 A;  4EMS A;  5GAG J;  3Q5F A;  1U8B A;  2C6Y A;  2CQX A;  4JX6 A;  1WVR A;  2HQA A;  4Y52 J;  1VQ9 I;  2RC4 A;  2LD5 A;  2P6S A;  1QVT A;  3PSF A;  4G6T B;  2PX9 A;  3KYL A;  5F04 A;  1G2H A;  2K86 A;  1ZRE A;  3LSH A;  2WBM A;  3FKI J;  2EH3 A;  5CPR B;  5HVQ C;  2OUM A;  3H3U A;  2PJR A;  2OV7 A;  2K3F A;  3V8J A;  4GFB A;  1OMI A;  2R4G A;  1B8I B;  1PUF B;  1IRX A;  1OCR H;  5CQE A;  4M72 A;  3S17 J;  3HHH A;  1N75 A;  3T8R A;  3C18 A;  2DMN A;  1IW7 F;  5CLS A;  1X58 A;  3CTA A;  3I58 A;  3B6A A;  1IXS B;  3LSI A;  2JUC A;  3WU0 A;  1BI1 A;  3RZO J;  3HOW J;  1HST A;  4W1U A;  1Z9C A;  2YS9 A;  5DUI A;  3BPX A;  3RKX A;  3I4N J;  4DW6 A;  2Z9O A;  4CCM A;  1Z7U A;  2JA2 A;  4I02 A;  3CF5 F;  2ZJP F;  1QPM A;  2DYS H;  3F8B A;  2DQR A;  3OR1 C;  4IOC F;  2HTJ A;  5ILU A;  2QF7 A;  1TWF J;  2CW0 F;  1S72 I;  1TWC J;  2PJR B;  4F93 B;  5EJC A;  4IQJ A;  2H8W A;  1SFK A;  2KKO A;  2OQG A;  1SAU A;  1OPC A;  2VXZ A;  4OAY A;  4PGG A;  1Y8R B;  2EV5 A;  5D8K B;  2EIJ H;  3G4S I;  1QQI A;  2H94 A;  2HYG D;  2I8D A;  1MIJ A;  3LMM A;  3J81 Z;  1D8J A;  2WV1 A;  3I3L A;  2N8G A;  3D0S A;  2LH9 A;  4A6D A;  1WRJ A;  1YQA A;  5D6F A;  2V6E A;  5EZH A;  2QQ9 A;  2K4B A;  2TRT A;  2I10 A;  1BL0 A;  5E3M A;  2JN6 A;  2DO7 A;  1FEX A;  2H1L A;  2PQ8 A;  5GPC A;  1KU7 A;  4N4N B;  4G6D A;  3TP3 A;  3WE3 A;  2XSJ C;  4RB1 A;  2LY2 A;  1B9M A;  4LFU A;  5F6F A;  2JA5 J;  3PO2 J;  4RGU A;  4M3F A;  5FGM A;  2A68 F;  4XLC A;  1IZ1 A;  2LK2 A;  3G1O A;  1YTY A;  4Y4R A;  3E3V A;  1D8K A;  4NC8 A;  5KAI C;  1KU3 A;  4CZC A;  2BEO A;  4BE0 A;  4NC6 A;  3RPU D;  3U9G A;  4HYE A;  4JP0 A;  1BI0 A;  1ETW A;  2UUZ A;  2X6O A;  5L3G A;  2Z16 A;  2O8X A;  3DEW A;  4HDU A;  1I39 A;  2MLG A;  3HOU J;  3LAJ A;  4KT5 C;  3BQY A;  3W2W A;  1ZH5 A;  3GW2 A;  3F23 A;  1NK3 P;  3QU3 A;  3P9K A;  3CMY A;  1P4X A;  1S29 A;  4I99 C;  4I6Z A;  4KIT B;  1OCC H;  3OYH A;  1X2N A;  4EGY A;  3OSF A;  4B3A A;  1O57 A;  4XLH A;  4ON0 A;  3ZQI A;  1BBY A;  4M3D A;  2IT0 A;  2GBY A;  2L5Q A;  2DQL A;  5FRN A;  1DP3 A;  4R79 A;  3GTO J;  1R49 A;  2E19 A;  3M07 A;  2R7D A;  5JHF A;  3VOD A;  2ICW G;  3I9V 2;  1T38 A;  4KIS A;  2FA5 A;  3QYE A;  2CS3 A;  2DFH A;  1QBJ A;  3LSK A;  4RAG A;  2ZJR F;  2FQ3 A;  3E6D A;  2BYV E;  3L7W A;  1TWH J;  2Q1Z B;  2K85 A;  3ROU A;  1VQK I;  3DQV C;  2GIV A;  4L0Z B;  4QLC U;  5GAE J;  4UUT A;  3BCB A;  2O8K A;  1ETK A;  4M3E A;  3KEQ A;  1SD7 A;  2L2O A;  1HKQ A;  2AHQ A;  1Z77 A;  4HLY A;  4JK1 X;  3TGN A;  3LNQ A;  5DD4 A;  3FXU A;  5CVV A;  5CVJ A;  1SAN A;  2PMU A;  2ID6 A;  1N77 A;  2PBI A;  1BOA A;  4V19 K;  1ON1 A;  4I7H A;  1K4S A;  1MKM A;  2EQR A;  3CCV I;  1BIA A;  2A5W A;  4UB6 C;  3ZQ7 A;  2GXA A;  3ZMD A;  4UUV A;  4DZJ A;  4G6Q A;  2KMU A;  1TW3 A;  3BY6 A;  2CW7 A;  3DBL B;  4BQQ A;  3CC2 I;  5F64 A;  2M0M A;  1LB2 A;  1BI2 A;  2KJB A;  2EZL A;  1OCT C;  2ME0 A;  4IX7 A;  1Y1V J;  1SFX A;  2BY3 A;  3BR3 A;  1P4W A;  3JW4 A;  4DYR A;  1ODD A;  1KQ0 A;  3RKQ A;  1X4O A;  1K4T A;  3K70 C;  4BJ6 C;  3QAH A;  2ID3 A;  1DU0 A;  3WGI A;  1XPX A;  2XPV A;  3P9C A;  2V1D A;  1FOY A;  3F6V A;  4DOZ A;  2P8T A;  1KYW A;  2L7F P;  1TQM A;  1U5T A;  2JVG A;  2W82 A;  4FE4 A;  2OZ6 A;  4I98 B;  3NWS A;  3QOD A;  1K61 A;  3V7R A;  1HXD A;  2COM A;  2HVQ A;  3VYS B;  2XRO A;  4IHT A;  1D0Z A;  2DTZ A;  3FBI B;  3VWB A;  2Y30 A;  4IRH A;  1ZR2 A;  1FBS A;  2R92 J;  2GZW A;  4R8H A;  1KU9 A;  3ML6 A;  4CO8 A;  1H89 C;  3FXL A;  3TMO A;  3CMM A;  1ZKG A;  1A6I A;  4A3J J;  1RUO A;  2QUF A;  4A3I J;  4RGS A;  2YUS A;  1BIB A;  1FP2 A;  2F4M B;  3CUO A;  3V7C A;  3EUK L;  3CCE I;  3DCF A;  2NVX J;  2D1V A;  3PNT A;  4IL6 C;  3OIO A;  1QA6 A;  1B4A A;  1TC3 C;  5LEJ A;  2E1C A;  1I6H J;  1UZC A;  3L2R A;  4B43 A;  5BPI A;  1H8A C;  1W36 C;  3OYB A;  4MEX F;  3BCA A;  4D9J A;  2Z99 A;  2FU4 A;  2H09 A;  2IS6 A;  2HU9 A;  4BDY A;  1DUX C;  2ISZ A;  5HS9 A;  4E7Z A;  2LP0 A;  2VJ5 A;  1U5T B;  1IN6 A;  4MTE A;  1I1S A;  2GIZ A;  2LSO A;  1MBG A;  2M4G A;  2QQ8 A;  4QIW N;  1APL C;  3OYD A;  3WHC A;  2DI3 A;  4HNV A;  4QTR A;  3RPU A;  3MMY B;  3ECO A;  2R7R A;  5BOX A;  2GOX B;  1G4D A;  3OYA A;  4OAZ A;  4NB5 A;  3BTI A;  5CVI A;  1Z3X A;  2CQ7 A;  5M3M J;  4B48 A;  3G1M A;  5HDN A;  2QA4 I;  1TBX A;  2MC3 A;  2CFX A;  4NBQ A;  2LRD A;  5H20 A;  1V5F A;  3KEY A;  2M5W A;  3TP0 A;  4YIR X;  3DBR B;  1IN5 A;  1ZGJ A;  3S3O A;  3TDZ C;  1K7A A;  2PI0 A;  1D5V A;  3K4M A;  1Z0X A;  4IZZ A;  2JA8 J;  3IP4 B;  2DLL A;  3M8F A;  3ZMU A;  1R6R A;  3LSG A;  1FTT A;  2QZ8 A;  2BZT A;  4LLL A;  5EG0 B;  1P4A A;  3DTI A;  2RNJ A;  3OYN A;  3TED A;  5JFR A;  5IYB J;  2DOA A;  1OR7 A;  2FXA A;  3CDH A;  2CUE A;  5GAD J;  5E18 F;  1H88 C;  1FTZ A;  5EEA A;  2EZK A;  2WV0 A;  2ZXW H;  4BXU A;  1LPQ A;  1DDN A;  2E71 A;  1XN7 A;  2HKX A;  2DMQ A;  2RVC A;  1FOK A;  3BR2 A;  2XAH A;  3BJ6 A;  4S04 A;  4OIN F;  5EGO B;  4AIH A;  1ZGW A;  2GWR A;  1EH6 A;  1MNE A;  2MH9 A;  1IRF A;  3IRR A;  2EB7 A;  2H6C A;  1G3S A;  4IHV A;  3KZI C;  2KIM A;  2OCE A;  2L9S A;  2KQR A;  1X1D A;  3NAR A;  1S5L C;  3LL7 A;  1UB9 A;  3MQ0 A;  5K7Z A;  4DNC A;  4KA4 A;  3DTE A;  5H6R A;  4XM3 A;  2VOP A;  3HEF A;  1TT0 A;  2RNG A;  4WCG A;  5E1Z B;  4JX5 A;  2GXG A;  5DM6 F;  2M34 A;  2Y9Z A;  5CVR A;  2BY1 A;  4L9T A;  2WB1 A;  3ECH A;  1YS7 A;  4E7L A;  3S3N A;  1SC7 A;  3SFZ A;  1FOX A;  2VXD A;  1JHF A;  1PP8 F;  4HV5 A;  4E7I A;  3O3K A;  2ZO4 A;  4OU0 A;  2W1O A;  5FKL A;  4A2U A;  1LFP A;  1ETO A;  2R0Q C;  1BW5 A;  4YRV A;  2MA3 A;  1U9N A;  2VJI A;  3K9T A;  5K5R A;  1ULY A;  4RBO A;  1IC8 A;  2BW3 A;  2P5K A;  5ERI A;  3MZY A;  4CCL A;  4XMY A;  1WFX A;  3HOZ J;  1D1B A;  1QU3 A;  1RNL A;  1ACI A;  3L2V A;  1HDP A;  4WK8 F;  3MKW B;  1G6N A;  1AU7 A;  1POG A;  3C2B A;  4ESF A;  5D5U B;  1ETQ A;  4GYI A;  2EFQ A;  4RAY A;  5DCM B;  3N4M A;  1STZ A;  2VKV A;  5GP9 A;  4U0Y A;  3ZQL A;  3K4L A;  4EJU A;  4RLQ A;  1WCM J;  2FML A;  4UUS A;  1BC7 C;  1G59 A;  3F22 A;  2IS1 A;  3TOB A;  1JT6 A;  3HRM A;  2HZT A;  4P96 A;  2EZI A;  2EFO A;  3A0H C;  3FBN B;  3E6M A;  4OMZ A;  4G12 A;  4W97 A;  1LDK B;  2XC7 A;  1FBQ A;  3BG6 A;  2ECC A;  4BY1 J;  2K02 A;  4XRS G;  3AAF A;  1WJD A;  2F48 A;  3BT9 A;  2BW3 B;  2LNB A;  2M9H A;  4E7J A;  3Q0U A;  4D7M A;  2OBP A;  3ZCO A;  3RTR A;  5HLI A;  3UNG C;  4HZF A;  1IO2 A;  4BU2 A;  2BXZ A;  2KRF A;  3HRT A;  1I3A A;  3KX2 A;  4HW0 A;  5BNG A;  1JKQ C;  2DAO A;  2O6G E;  2ELJ A;  1YJW I;  1LJ9 A;  3S15 J;  4MQV A;  2DU9 A;  3GBG A;  5GTH C;  4G94 A;  4Y3O A;  1X1P A;  1I27 A;  4BEH A;  3X2Q H;  1WI9 A;  4UUS B;  2EFP A;  2WA0 A;  1U3E M;  3DPL C;  1HDD C;  4Q4Z F;  2R7T A;  2HGC A;  4UV9 A;  3OS1 A;  4WXD A;  1S9H A;  4BGD A;  1ZAO A;  5ILV A;  3OYC A;  1LEA A;  4HPQ A;  1GVJ A;  1RPW A;  3NQO A;  2F5E A;  1T39 A;  4PDK A;  4C3H J;  2HVS A;  4L5I A;  3CD6 I;  2COB A;  1WQ2 A;  2NS8 A;  4A0Z A;  2JQ7 A;  4YIF A;  1GXP A;  1OYW A;  3K69 A;  4AU7 A;  1VQ5 I;  3S3M A;  3A2K A;  1N25 A;  1P9Q C;  1VFC A;  3DXJ F;  1OKR A;  2M8E A;  4LJZ F;  4GXO A;  1AKH B;  2DK8 A;  5KAF C;  2L4M A;  3MWM A;  4F91 B;  1RC9 A;  3GFI A;  4KIF A;  2FOK A;  4E6K G;  4ZYD A;  3HRU A;  3SXY A;  1RIO H;  2LOO A;  4ENM A;  1ZLK A;  3K1M A;  2KFD A;  1LUJ B;  2M87 A;  3RJP A;  2OTL I;  4TV7 A;  2VKD A;  3E0J B;  4AVZ A;  2E2H J;  4FHT A;  4RS8 A;  4L9J A;  3FXR A;  3V8L A;  3KYC B;  2K27 A;  4BY7 J;  1W1W E;  3K4B A;  1SD6 A;  3QP6 A;  2AXL A;  3DP7 A;  2CU7 A;  4JYK A;  2M2E A;  3I59 A;  4A12 A;  1TLH B;  2E35 A;  2X48 A;  1GUU A;  5HS8 A;  1VF9 A;  2RRE A;  3O6B B;  2L7Z A;  2HOT A;  1FNN A;  2XUB A;  3N97 A;  5F0C A;  2YX7 A;  4UVB A;  4Q48 A;  1EH7 A;  3PNV A;  5HLT A;  1A6Q A;  3M8E A;  1EKE A;  2NVT J;  1EJ9 A;  3KZY A;  4XL9 A;  1SD5 A;  3W6J B;  3GWZ A;  1FLI A;  5HOD A;  3S32 A;  3OWT A;  2DMP A;  1GHC A;  4C9Y A;  3M8J A;  4XN3 A;  3CQZ J;  3MAJ A;  1MW7 A;  2F4O B;  1T98 A;  2H1K A;  1HKS A;  3E97 A;  3L1P A;  4OOI A;  2FEZ A;  3B73 A;  4EJO A;  2NVQ J;  2VJJ A;  1T95 A;  2X1D A;  3JRC A;  1UEL B;  1RUN A;  1JHH A;  1ERD A;  4L5E A;  3SFI A;  2IJL A;  4KT6 A;  1IDZ A;  3CME I;  1BR1 A;  1JJ6 C;  2VAS A;  4BKX A;  1BR2 A;  4OIR F;  3I59 B;  1JE8 A;  2LBF A;  1BA5 A;  3RQI A;  3ONQ A;  5F0F A;  3V8K A;  1P2F A;  2FE3 A;  1DQU A;  4HLX A;  3BC8 A;  2E5N A;  1FSE A;  1LE8 A;  1LNW A;  1XS9 A;  3BG9 A;  2DMU A;  4MEY F;  1YIT I;  2XVC A;  4HEA 2;  3KPH A;  1E17 A;  3ZMS A;  4EM0 B;  4MFD A;  1FMW A;  2MLK A;  1VQ8 I;  1XC5 A;  3CJQ B;  1VTN C;  3GZN B;  4MGR A;  2DFF A;  2Z2S B;  2XAJ A;  2B0L A;  1VZ0 A;  2QQB A;  2JUG A;  1ON2 A;  3KLO A;  4YEJ A;  3ZMZ A;  1E3O C;  4PFO A;  2V6C A;  2JK3 A;  4P1W A;  1VQP I;  3ABU A;  4WF2 A;  1QO0 D;  5HNH A;  3CC7 I;  2KIF A;  3F0C A;  2R5Z B;  1D5Y A;  2WAD A;  4F55 A;  2LBF B;  1JXS A;  4B44 A;  3RSN A;  4GYG A;  4ZH4 F;  3RYP A;  3H1C A;  3ISP A;  5BMZ A;  1JKP C;  1C0W A;  4CHU A;  1LE8 B;  3HGY A;  3H3V K;  3HYI A;  1XMA A;  3IH2 A;  3FHN A;  3G1L A;  4D5C A;  2FJ1 A;  4AIJ A;  1XSV A;  3HUG B;  1A5J A;  4J01 A;  2V4J C;  2M3A A;  2R93 J;  2O5R A;  1EV7 A;  4HF0 A;  3UR3 C;  1SMT A;  1JUP A;  3A02 A;  3D5S C;  3FM5 A;  3FMS A;  2M4K A;  2Y31 A;  1PP7 U;  1GLN A;  2GXB A;  4X6A J;  1MH3 A;  3LAP A;  4LIU A;  3T8T A;  4LB6 B;  2ESN A;  3GUD A;  5EZG A;  3VYU B;  1BM9 A;  3OS0 A;  4O6J A;  3GLX A;  1MBJ A;  1WH5 A;  2L54 A;  3KYD B;  2VLA A;  4M71 A;  2GA1 A;  5H2F C;  1QNT A;  1Y8Q B;  3OOU A;  2VE8 A;  2YPR A;  5JHU A;  2PLY A;  3GTQ J;  2YU3 A;  4LIT A;  3IHU A;  2NRA C;  2ZNY A;  3GZ6 A;  2WB1 N;  3AL0 C;  3WU1 B;  2E60 A;  1N78 A;  5LHG A;  2E34 A;  2EV6 A;  3K2Z A;  3SEZ A;  4CA0 A;  4A3E J;  2DPD A;  4RA2 A;  1QHG A;  4BQN A;  4M6V A;  2DA7 A;  3QU6 A;  2PMZ A;  3LFK A;  2EFW A;  3TO6 A;  1LEB A;  2X6X A;  2AS5 F;  1F5T A;  2K9M A;  1HW2 A;  3T1B A;  3HZJ A;  2ECB A;  3F21 A;  3EYY A;  3JRI A;  3QYF A;  1RES A;  1XX5 A;  3SZP A;  2XAG A;  1TL8 A;  3REO A;  1F1Z A;  2H27 A;  1J2X A;  2X9D A;  2W4S A;  5DYM A;  1MBF A;  2BHY A;  2XF5 A;  4EJW A;  1ORK A;  1PYV A;  4I01 A;  3KFW X;  3QQA A;  4HX8 A;  1ETV A;  1G3W A;  2L9R A;  4LMY A;  1EH8 A;  3RPQ A;  4N9H A;  3HRS A;  1ZRC A;  3BZC A;  4G7Z F;  3Q3S A;  4EQQ A;  1UHW A;  4OIO F;  3GTP J;  2UZK A;  4PFP A;  1WH7 A;  2L7M P;  5A2Q K;  2OTJ I;  2PJP A;  1ZG5 A;  4RGX A;  2OQR A;  1WJB A;  3HSF A;  4XLN F;  3EET A;  2JA6 J;  3PL8 A;  3R6S A;  4NHJ A;  2K9N A;  4ZYG A;  3BG7 A;  4UB8 C;  3OYL A;  3S2D J;  1AA7 A;  3CF2 A;  3I4M J;  3M9A A;  1SVO A;  1YJ9 I;  5TRD A;  1W0U A;  2XRN A;  4GRI A;  1P6R A;  3DEE A;  2DW4 A;  3A0B C;  3K4C A;  4B4C A;  1MMA A;  2G9W A;  1WJF A;  2VB6 A;  1VQM I;  1IGN A;  6PAX A;  2R7S A;  5GPA A;  2VQL A;  2VIX A;  1K78 A;  5ICE A;  4S0H B;  3S1Q J;  3SYT A;  5HDK A;  2WAF A;  1T6S A;  4OIP F;  3GXO A;  3IWZ A;  4KJZ A;  5KHD A;  3JRF A;  1J9I A;  1UHS A;  4CCK A;  5JLX A;  4AVP A;  3VPR A;  2ZME A;  4U0W A;  2NS7 A;  1CGP A;  1V55 H;  3PIP F;  2NVY J;  2HWV A;  4KN4 X;  1FPQ A;  1ZQ3 P;  1Y56 A;  5F1R A;  2K9L A;  3ZGK A;  1BOB A;  1R00 A;  3I5U A;  1OCZ H;  2LKX A;  3HJE A;  1YX5 A;  3D5R C;  5BQT A;  2P0W A;  3O8H A;  1K83 J;  3OIQ A;  2V9P A;  1AHD P;  2HDW A;  2E2J J;  2K5C A;  3HG9 A;  5L3B A;  2RQP A;  1BJA A;  2EIN H;  2WWY A;  1FYM A;  2B63 J;  4NUB A;  2F2E A;  2P5V A;  3AG1 H;  4A3L J;  2EV0 A;  1U2W A;  5B66 C;  3L2Q A;  1HW5 A;  3N05 A;  3QWL A;  3IKT A;  4MIM A;  5FKO A;  3QPT A;  1K78 B;  2NNN A;  1GDT A;  3P5J A;  2IXS A;  3Q0V A;  2UWM A;  1HW1 A;  2GM4 A;  4XLP F;  1MJ9 A;  1XDS A;  4M6Y A;  2X0L A;  2DA6 A;  2IPQ X;  1H9T A;  2HPM A;  2O9L A;  2KHM A;  2FMY A;  3OMY A;  4O5V A;  5FRM A;  2ZME B;  3MD2 A;  2G7H A;  3OYK A;  1FZP B;  3PSI A;  2DDA A;  1RR8 C;  4E7H A;  4ZDP A;  4M9Z A;  3IUO A;  3GEZ A;  1HBX G;  2VON A;  3KP6 A;  3QOE A;  3EUH C;  5C4X J;  1D0Y A;  2DOE A;  1RRJ A;  2VBZ A;  4Y15 A;  3HB9 A;  2IGM A;  4A3G J;  2MG4 A;  2XHK A;  3PQJ A;  3LA7 A;  2L9V A;  2M45 A;  5E79 C;  4MTD A;  1RI7 A;  1MMD A;  4CCO A;  5BS6 A;  1Z6T A;  1S7E A;  3T0Y A;  4B1R A;  1A36 A;  2D5V A;  3OR2 C;  1WKM A;  5J6X A;  3CMA I;  2E1M C;  5E17 F;  3BLY A;  4M3G A;  3O2P E;  2W7N A;  3VDX A;  1RKT A;  2KIU A;  4LLG F;  4U88 A;  3ELK A;  1QPI A;  4IEJ A;  1O7L A;  2VBX A;  4LG3 A;  2A61 A;  4A5N A;  5HNF A;  1MD0 A;  2D1H A;  4Y17 A;  4HX7 A;  1B6A A;  1A35 A;  4BH9 A;  2P7V B;  2VKE A;  1BR4 A;  4E7K A;  5D5V B;  5L3C A;  2P5L C;  3WTS C;  4J19 A;  3CJR B;  1OLT A;  4ENJ A;  2R7V A;  5JR3 A;  4XSX F;  3CUQ A;  5JLW A;  3WTU C;  1G8X A;  1MNM C;  1FYK A;  4PJ0 C;  5K7H A;  2QKM B;  4IHW A;  9ANT A;  3ABK H;  1ZRF A;  2LY1 A;  2HXI A;  3F8N A;  2Z3Y A;  3WGG A;  3JSO A;  2PEX A;  3I53 A;  2MC4 A;  2WAE A;  2IGN A;  4PK4 A;  3V7S A;  1U8R A;  2F5V A;  2IA2 A;  1RZ4 A;  2K3P A;  4G8X A;  4PSX A;  4A3K J;  1ZG1 A;  2CUF A;  1JTX A;  2HQ5 A;  1SVM A;  2X4H A;  3OYF A;  2KZV A;  3ERE D;  1ZAR A;  3GCM A;  2J5P A;  3PFY A;  4ENK A;  1JGS A;  2VUM J;  2CG4 A;  2YR2 A;  5A2Q Z;  1Z6R A;  3M3Y J;  3K2A A;  4E7S A;  1LDD A;  5B5E C;  3LA3 A;  2CO5 A;  2W85 A;  4XK4 A;  4L9V A;  5FJ8 J;  5DD8 A;  1YS6 A;  4Q47 A;  3CUQ B;  3E1S A;  1J75 A;  1HC8 A;  3JTG A;  2VJ4 A;  2DJN A;  3CES A;  2KPM A;  5E1W A;  1O3T A;  4KIC A;  2HEO A;  5D5X B;  3R60 A;  1AWC A;  3MEX A;  4BDZ A;  2LR8 A;  2FNP A;  4IRG A;  1T2K A;  5EG0 A;  2LKP A;  2MD5 A;  1S7A A;  1JT0 A;  2Z1D A;  5D5W B;  4UHT A;  4M9S A;  1BJZ A;  1YG2 A;  1R23 A;  3CO6 C;  2JSC A;  2PFB A;  2OJE D;  3K70 D;  3BR1 A;  2GAU A;  4YFX F;  2QQA A;  1IV8 A;  5DEQ A;  5EGO A;  2M7A A;  4IXA A;  2QCO A;  2JWT A;  1TNT A;  2JVH A;  4DBQ A;  2A6E F;  1OCO H;  3WHB A;  2M30 A;  2OPT A;  2EFN A;  3WOD F;  3FXO A;  1XCV A;  2R7X A;  1OYY A;  1FBU A;  2XKP A;  3K4J A;  4ITV A;  3IKV A;  1X3Z B;  4ETS A;  2HOA A;  3HOY J;  3PNY A;  1YHQ I;  1MGT A;  2R7U A;  1MDM B;  3S1M J;  1A04 A;  4OIQ F;  2E1O A;  3LQR A;  5DCF A;  3CDI A;  3H35 A;  2DA3 A;  2DT5 A;  2PMZ N;  2WY7 Q;  5F0H A;  1W0T A;  2UV1 A;  1X3W B;  3F6O A;  5CQG A;  4QPO A;  1FWZ A;  1QZY A;  4E70 A;  1YW9 A;  3I71 A;  1W36 D;  3EQL F;  5AIQ A;  1SFO J;  2EZH A;  3TW7 A;  3AG2 H;  4HDV A;  1ONV A;  2W25 A;  3VYR B;  2J5O A;  4KN7 X;  1X3U A;  2Y69 H;  4WX9 A;  3JAM K;  3FWE A;  4P9F A;  3MKL A;  1FIP A;  1W4M A;  4D7N A;  3CCS I;  5KCM A;  1R1U A;  3F8M A;  2TDX A;  4GO1 A;  3ZPL A;  3OL4 A;  1ZHF A;  4LK1 F;  3DV8 A;  3IAM 2;  2DT7 B;  3SJM A;  4XQF A;  1UCR A;  3D5L A;  3F9K A;  4ZC3 A;  4F3Q A;  2RKH A;  3E6B A;  1USS A;  4IHS A;  3IL2 A;  2FD5 A;  3C1D A;  5FKM A;  3FXK A;  3OYE A;  1NH3 A;  2DBB A;  3LOC A;  1Z7L A;  3F8C A;  4A3C J;  3ASO H;  4CSW A;  2V1U A;  2IP2 A;  5DCM A;  4Y13 A;  1MJB A;  5LLQ A;  2D45 A;  2E2I J;  5CVU A;  3BJA A;  5LRS A;  3GTL J;  1YOV B;  5M5W J;  1SVL A;  2CH0 A;  2PG4 A;  2VT3 A;  4M9X A;  1SD4 A;  4HG2 A;  2HDC A;  2ZSH B;  5IPA A;  3PO3 J;  2A6T A;  4D0P A;  1WSU A;  4I0B A;  2DOD A;  3QOP A;  3I4P A;  4BAY A;  3ZP5 A;  1MJA A;  1MBH A;  4XLA A;  2AO9 A;  1ETY A;  2Q0O A;  5E3O A;  3MVP A;  2JPC A;  4BHC A;  1XG1 A;  1V54 H;  4PSW A;  1YFH A;  1HF0 A;  2BV6 A;  2LKS A;  3HOS A;  1O3Q A;  4PUS A;  2P7C B;  2TCT A;  5D8L B;  2EPF A;  3HM5 A;  4RB2 C;  4CDG A;  3HSR A;  2FSW A;  1Z67 A;  1YI2 I;  3KLN A;  4MFE A;  3FHZ A;  3OOP A;  5LGU A;  4IQ4 A;  1DGW Y;  4PCQ A;  3I56 I;  2X51 A;  3OYI A;  2HKO A;  2JSP A;  1R1V A;  4Z6Y A;  1UMQ A;  1I50 J;  2A5Y B;  3M4O J;  5GAH J;  1FOW A;  1TWG J;  3TL4 X;  2GOM A;  2MBF A;  3FZV A;  1Y6I A;  5ICC A;  2DPU A;  2HDD A;  4IRI A;  4LOC A;  3FF5 A;  3J80 K;  2STT A;  5KVR A;  4JQF A;  3GTK J;  3ABL H;  1O7F A;  4XKW A;  2IS4 A;  2ZCW A;  3WGH A;  3AFH A;  3ZQC A;  2VE9 A;  5J1R A;  1XSD A;  1UG0 A;  3FXM A;  2XAU A;  2HTS A;  1OQY A;  1YX3 A;  5FKN A;  3BZK A;  3H9G A;  2ZJ2 A;  5DS9 A;  3E7L A;  1AKH A;  4FX4 A;  4OMY A;  1TW2 A;  1G3T A;  2P81 A;  1J09 A;  4KIB A;  1T0F C;  2VT2 A;  1T33 A;  4DYQ A;  4I76 A;  1CQT A;  1V3F A;  2HNH A;  4EV0 A;  1V5G A;  2R7Z J;  1S6L A;  3K4N A;  5E1X A;  3W2A A;  4AYB A;  1YJN I;  2KL4 A;  4P9U A;  1WZ2 A;  5J8C A;  4HF1 A;  1LVK A;  5HDG A;  3LSM A;  1UAA A;  1OFC X;  3CLO A;  2B9S A;  5L3F A;  2X1E A;  2Q2E B;  3WTT C;  5CJ9 A;  1IRZ A;  4G7H F;  2VBW A;  3JTH A;  3HOT A;  3EDP A;  1NK2 P;  3BRO A;  1X19 A;  1KON A;  3RYR A;  1ENH A;  2O3F A;  1VQL I;  1SMY F;  2OU2 A;  4CIC A;  4V2F A;  3E5U A;  5IP7 J;  3CCL I;  3IH4 A;  2HPI A;  1S8N A;  2NAZ A;  4BYY A;  1XMX A;  2K4J A;  1PUE E;  4XLE A;  2LVS A;  1YW8 A;  2CQK A;  3J7Z I;  3BR0 A;  2GA2 A;  3BR5 A;  1WJA A;  3ZRG A;  2VOO A;  2V7F A;  1X2M A;  3JRA A;  2QBY A;  5J1U A;  2RN7 A;  2CRG A;  1E3P A;  2JPB A;  4BJT A;  2CFO A;  1ZEL A;  1FT9 A;  3G71 I;  1Z05 A;  2NNY A;  2KZG A;  4NNJ A;  1F4K A;  3CLQ A;  4L0Y B;  3L00 A;  5EEH A;  4KMF A;  1XTA A;  3DU5 A;  1YE9 A;  2IGK A;  3VYT B;  3BTL A;  3FK7 A;  4XOP A;  3PJR A;  2QVO A;  3H92 A;  3TW6 A;  1KYZ A;  3HC7 A;  3W2V A;  4NQW A;  2IW5 A;  2EWN A;  2MFZ A;  1W5S A;  1ZTR A;  4U7B A;  3GME A;  3GLL A;  2VPL A;  1PDN C;  4LG0 A;  5M5Y J;  3FDY A;  5C3E J;  4C2M J;  1D0X A;  4HRI A;  3GX4 X;  2R5Y B;  2VN2 A;  3A03 A;  3LSJ A;  2Y0S A;  3R4K A;  5F27 A;  4RAF A;  2LDU A;  2CSO A;  1FC3 A;  2K9S A;  2QBY B;  2VBY A;  1UG2 A;  3JRE A;  3MKZ A;  4MO7 A;  2V1X A;  4DBR A;  1BN5 A;  2XGD A;  4A69 C;  4LGW A;  3K10 A;  1V4R A;  5DTD A;  5EYR A;  4CYD A;  1IF1 A;  1P7J A;  2EIK H;  2KIS A;  4MLO A;  4IOA F;  1LVA A;  1FY7 A;  1Y0U A;  2R5Z A;  5KK1 A;  5FLM J;  4PJM A;  3QPS A;  4C3I J;  1XGN A;  1FIA A;  4NQW B;  3E6C C;  2KRC A;  5IT3 A;  3CCJ I;  2K7L A;  4CCN A;  2F5F A;  4LG0 B;  2L7K A;  4YG2 F;  3DFG A;  5IYC J;  4XRM A;  1DGR M;  2UXN A;  3W6V A;  4A3B J;  3HUG A;  2EIM H;  3LQQ A;  3FMQ A;  3B6C A;  1VQN I;  3KP4 A;  1LKX A;  1D1A A;  4G9Y A;  1VQ6 I;  1TQI A;  2M0C A;  3J81 K;  3Q0W A;  2NOJ B;  4XID A;  3VB2 A;  4II3 A;  4B3X A;  1HKT A;  5E3L A;  2W00 A;  4IHX A;  4LD5 A;  1TWA J;  5J8F A;  3HPH A;  1MSE C;  1NHA A;  3P7N A;  3S93 A;  1HA8 A;  2IAI A;  1ZGA A;  2OCC H;  4U0V A;  4KNY A;  1IUY A;  1ZR4 A;  2BE5 F;  1GXQ A;  5F08 A;  4CH7 A;  4Y7N J;  3KCC A;  5FKK A;  4HAM A;  5L3E A;  2HQR A;  3WTY C;  1R4M B;  3WU2 C;  3ZOB A;  5HOO A;  3HGG A;  3RZD J;  2JRM A;  3PUF A;  1Z3Y A;  2O7O A;  3SHF A;  3KP5 A;  4WWC A;  4KDP A;  2DYR H;  3ULQ B;  4BQA A;  4IO9 F;  4FTH A;  1HQC A;  1NTC A;  4XOR A;  2NVU B;  2ELH A;  3FX3 A;  3MZ8 A;  2E1N A;  2FF4 A;  3GTJ J;  5TJJ A;  1X1B A;  3QYB A;  3MN2 A;  2IBD A;  4LB5 A;  4BNC A;  4BXF A;  1FYL A;  2FOW A;  2A07 F;  2MH2 A;  2XGC A;  2Z33 A;  3I54 A;  1VI0 A;  2JJ7 A;  4XR6 A;  3RIR A;  3CCQ I;  1QZE A;  5C4J J;  3H0D A;  1Q1H A;  2YX4 A;  4I2O A;  2DT6 A;  4MNU A;  2XSD C;  1EF4 A;  5ED4 A;  2KDO A;  4F92 B;  5LRR A;  3ZN1 A;  1FP1 D;  4A0X A;  1Y39 A;  3J7A Y;  1R22 A;  1WJ5 A;  4QWQ A;  4G7O F;  3BR6 A;  1VQO I;  2R7O A;  2HYJ A;  4EM1 A;  1MMG A;  2XPU A;  3A1Y A;  4ZYA A;  2EK5 A;  3C7J A;  1OCP A;  3DTK A;  1R9T J;  2QYO A;  3CP8 A;  4B09 A;  4DZP A;  3IRQ A;  1UFM A;  4PZJ A;  1LFB A;  1VQ4 I;  2VKH A;  5F1J A;  4XRS A;  3GO5 A;  4IJA A;  2AQF A;  1WI3 A;  2R7W A;  4BE1 A;  1W5C C;  2CV1 A;  2R3S A;  1U5T C;  3FXJ A;  3S1N J;  1YW7 A;  2QLZ A;  3V4G A;  1XD7 A;  3WTX C;  5DV5 A;  3G6E I;  1MND A;  3R61 A;  2FRH A;  2OD5 A;  3GFJ A;  3LSP A;  4XNF A;  5IT9 K;  1Z1D A;  2PMH A;  5LHI A;  3BP8 A;  3EYI A;  4I09 A;  2NOG A;  3F72 A;  2B7E A;  2DA5 A;  3RKY A;  3U2R A;  4N4O B;  2CV2 A;  3GTG J;  4ZTJ A;  4MQ9 F;  4HNT A;  1F9N A;  1MBE A;  2BY0 A;  2XGX A;  3OIP A;  4EAT A;  2GLO A;  1R1T A;  2F5D A;  4M3B A;  3CJT B;  2KLO A;  3HKZ A;  4C2T A;  2CV0 A;  4RB0 A;  2FBH A;  2VL8 A;  3G73 A;  3SDB A;  1VND A;  4M6X A;  1H9G A;  2DA1 A;  3KE2 A;  3O8G A;  2FX0 A;  4XKV A;  1WGX A;  2KIQ A;  5L3D A;  1BW6 A;  4FX0 A;  2E7X A;  4AYB N;  5FD6 A;  2A6H F;  3RQ4 A;  3GTM J;  1W5T A;  4RM2 A;  3LA2 A;  2IRF G;  1P7I A;  5FO5 A;  2ZXH A;  4EJV A;  1K6O A;  2XB5 A;  4KYW A;  3MKY B;  5LD2 C;  1B1B A;  4BAC A;  2O03 A;  1DPR A;  4ENN A;  4E4H A;  3PUB A;  1KQ9 A;  3VEP A;  5J4V A;  3S2H J;  4IVN A;  2XGE A;  4Z2Y A;  4IKF A;  4H0E A;  1OYI A;  4PJJ A;  1ZYR F;  3L2C A;  3H36 A;  1I3Q J;  5DM7 F;  3S14 J;  3CCM I;  1R36 A;  3G2B A;  4EGZ A;  3PFI A;  3S8P A;  4HOB A;  3DKX A;  5HLG A;  1I5Z A;  3ZMV A;  2CUJ A;  2X6W A;  4HV6 A;  5HLH A;  2O0Y A;  3SDG A;  1OR7 C;  2BGC A;  5ILS A;  3TDU C;  4N9I A;  2XPW A;  3NAU A;  3TOA A;  2ISY A;  2JRT A;  2DOF A;  2L02 A;  1FSH A;  4JX4 A;  5IOZ A;  1GVD A;  1Q1V A;  2K9Q A;  4XIC A;  2W48 A;  1P92 A;  4D5F A;  2O61 A;  4ESB A;  3J7A O;  1IRG A;  3L2U A;  2ZB9 A;  3OY9 A;  1WHU A;  5EEG A;  2OA4 A;  3NWT A;  5TIS C;  1XSX A;  1E2X A;  2DMT A;  4J00 A;  2KT0 A;  1XGO A;  4LIV A;  3ZQH A;  5AON A;  1M1E B;  2DA2 A;  4PGH A;  3HPG A;  2AXT C;  3KZZ A;  2Y0S N;  3K1N A;  3H9J A;  3R0A A;  2EJR A;  1HCR A;  2DN0 A;  1U0J A;  2I5U A;  4UXN A;  3ZMT A;  1WWX A;  2ZC2 A;  3NRV A;  4PJN A;  4WXC A;  3JCU C;  2F4I A;  2WAQ A;  4YII A;  1YO5 C;  1DPU A;  3ESW B;  4AWX B;  3SZG A;  4C30 A;  5LEK A;  1IN4 A;  3Q9S A;  2VI6 A;  1JKO C;  3HTS B;  2Z5U A;  4BBR J;  3BOQ A;  4BUP A;  3EUA A;  4RDU A;  3ABM H;  3H5R A;  3SZT A;  3L2W A;  4UNO A;  4CYC A;  3M1C A;  3E5Q A;  4FIS A;  2MGQ A;  3PIO F;  1D3Y A;  2ZJQ F;  2IA1 A;  3M7G A;  2CMP A;  2BY2 A;  5K7F A;  1I6X A;  3WTV C;  4HSR A;  2A3S A;  4O3M A;  1SFE A;  2FBI A;  3PM1 A;  2MAB A;  3IWF A;  3TO7 A;  4BHB A;  4ZTF A;  2LTP A;  2OZU A;  2OC6 A;  4YEL A;  3SQN A;  3WG9 A;  1L3L A;  3AG3 H;  5C44 J;  4QPQ A;  2ACJ A;  3BQZ A;  4NC7 A;  4FE7 A;  4JOM A;  4AUX A;  1UJ8 A;  1XGS A;  3WTW C;  4R1H A;  2HQN A;  3ASN H;  1W7P D;  2EA2 A;  3CCU I;  4H4K C;  4EVI A;  4KFC A;  3F8F A;  1X1A A;  5IT9 Z;  1MDM A;  2R7F A;  3BJO A;  2NXN B;  1F36 A;  3S16 J;  5J1Y A;  2E7W A;  4CXF A;  4A3M J;  2X6Y A;  4RMN A;  1YIJ I;  3QPL A;  4CYC B;  1XMK A;  4WXH A;  2L3D A;  2LMD A;  2Y75 A;  5E8I A;  1JUS A;  1QVU A;  3E5X A;  2V1N A;  4DYC A;  1O3S A;  1MZB A;  3GYH X;  3ZQQ A;  1NG7 A;  5FFX A;  1TQP A;  5D4S A;  5FB2 A;  3HOX J;  3L09 A;  4ZZL A;  2ELK A;  1IXC A;  2DDB A;  2E36 A;  1YYV A;  3AL0 B;  2G0E A;  3VOE A;  4XRF A;  2FBK A;  2LFB A;  2VC1 A;  4GGG A;  1K79 A;  1T08 B;  1QGP A;  3M1E A;  2DTR A;  4HNU A;  1Z21 A;  2M7B A;  4OWR B;  1ETX A;  5H6Q A;  1HLV A;  3V42 A;  2VOD A;  3CC4 I;  4U87 A;  3LST A;  5KNL A;  2HR3 A;  3R0J A; 
#chains in the Genus database with same CATH homology
 2R5Z B;  2JN6 A;  2P81 A;  1D5Y A;  1JTY A;  1FEX A;  5GPC A;  1T33 A;  3TP3 A;  4DYQ A;  4I76 A;  1CQT A;  3ZQF A;  1JKP C;  2JA5 J;  2R7Z J;  3PO2 J;  3D1N I;  4M3F A;  1LE8 B;  3HGY A;  3H3V K;  2LK2 A;  3G1O A;  3IH2 A;  3G1L A;  4D5C A;  2KDZ A;  1OFC X;  5M3F J;  2FJ1 A;  5FLV A;  1A5J A;  4JP0 A;  1ETW A;  2R93 J;  2LY9 A;  2X6O A;  1IRZ A;  3DEW A;  3HOU J;  1JUP A;  3A02 A;  1DU6 A;  3ZQG A;  1NK2 P;  1HOM A;  3BQY A;  1ENH A;  4FCY A;  1IV6 A;  2Y31 A;  4NDL A;  4X6A J;  1MH3 A;  4V2F A;  1NK3 P;  5IP7 J;  3CMY A;  3IH4 A;  4I6Z A;  1X2N A;  3OSF A;  4B3A A;  5EZG A;  1MH4 A;  2LVS A;  3BG5 A;  3ZQI A;  3BR0 A;  3BR5 A;  4M3D A;  1MBJ A;  1WH5 A;  2GBY A;  3CCY A;  3GTO J;  1X2M A;  3JRA A;  3IV5 A;  3OOU A;  5J1U A;  2E19 A;  5E3N A;  3GTQ J;  3H0G J;  2CRG A;  2WB1 N;  1Y1W J;  1TWH J;  4A3E J;  3S1R J;  3BTL A;  3FK7 A;  2YU9 J;  4M6V A;  5M5X J;  4UUT A;  2DA7 A;  3TW6 A;  2O8K A;  1ETK A;  4M3E A;  3JRG A;  1JJ8 C;  1ZTR A;  2AHQ A;  1Z77 A;  3LNQ A;  3HKZ N;  5M5Y J;  2ECB A;  5C3E J;  4C2M J;  3JRI A;  1SAN A;  2ID6 A;  2R5Y B;  3HDD A;  1RES A;  3A03 A;  3LSJ A;  5F27 A;  3OSG A;  2HXO A;  1IDY A;  2EQR A;  2K9S A;  2VPR A;  2X9D A;  1UG2 A;  4DZJ A;  1MBF A;  1ZK8 A;  4MO7 A;  4V2G A;  2XGD A;  3JRE A;  4A69 C;  1ORK A;  3QQA A;  1ETV A;  2L9R A;  5DTD A;  5EYR A;  1P7J A;  4MLO A;  3Q3S A;  2EZL A;  1OCT C;  2R5Z A;  2ME0 A;  3GTP J;  1Y1V J;  3BR3 A;  4DYR A;  1WH7 A;  2L7M P;  5FLM J;  1FJL A;  3RKQ A;  5EDN A;  3QPS A;  2M8G X;  3JR9 A;  4C3I J;  1FIA A;  2ID3 A;  1DU0 A;  2JA6 J;  2XPV A;  1MSF C;  1JKR C;  2K9N A;  2L7F P;  5IYC J;  4XRM A;  3W6V A;  4FE4 A;  4A3B J;  1K61 A;  3S2D J;  1IJW C;  3B6C A;  2DTZ A;  3I4M J;  2Y30 A;  1ZR2 A;  2R92 J;  1W0U A;  2M0C A;  4B4C A;  3BTJ A;  1H89 C;  3Q0W A;  1IGN A;  4XID A;  5GPA A;  1ZKG A;  4S0H B;  1A6I A;  4A3J J;  3S1Q J;  4A3I J;  1T56 A;  5E3L A;  4QSH A;  2YUS A;  2MW8 A;  4IHX A;  3JRH A;  3JRF A;  1TWA J;  3DCF A;  2NVX J;  1UHS A;  5JLX A;  1MSE C;  3OIO A;  1I6H J;  1TC3 C;  3VPR A;  2IAI A;  2NS7 A;  1H8A C;  1ZR4 A;  2NVY J;  5F08 A;  4Y7N J;  1ZQ3 P;  5FKK A;  2FQ4 A;  2LKX A;  3HOV J;  4A3D J;  2LP0 A;  3O8H A;  1K83 J;  1AHD P;  2E2J J;  1MBG A;  3ZOB A;  4QIW N;  1U9O A;  2B63 J;  1APL C;  3WHC A;  3HGG A;  3RZD J;  4A3L J;  4HNV A;  4QTR A;  3CDL A;  3HBL A;  2OF7 A;  2O7O A;  3JRB A;  4MIM A;  5FKO A;  2WAQ N;  5M3M J;  3BTI A;  1GDT A;  4FTH A;  3G1M A;  3Q0V A;  1NTC A;  2GM4 A;  1MBK A;  3TP0 A;  3GTJ J;  2DA6 A;  2O9L A;  3MN2 A;  5J3L A;  2IBD A;  2R5Y A;  1LFU P;  1OJL A;  2XGC A;  1VI0 A;  1Z0X A;  2JJ7 A;  2JA8 J;  3FIS A;  2CJJ A;  5C4J J;  3LSG A;  1B72 A;  1FTT A;  5C4X J;  5EG0 B;  2XSD C;  3TED A;  1EF4 A;  3HB9 A;  5IYB J;  1O4X A;  4A3G J;  2CUE A;  1H88 C;  1FTZ A;  5EEA A;  2EZK A;  2MG4 A;  2MSY A;  1RR7 A;  2DMQ A;  3BR2 A;  3BR6 A;  5EGO B;  2H8R A;  1ZGW A;  4B1R A;  1S7E A;  2HYJ A;  2D5V A;  2XPU A;  1YRN A;  4M3G A;  1OCP A;  1RKT A;  4IHV A;  1R9T J;  4DZP A;  1LFB A;  5F1J A;  2Y9Y A;  4XRS A;  1QPI A;  3NAR A;  1WPK A;  4IEJ A;  4C3J J;  1WI3 A;  5K7Z A;  5IP6 A;  3HEF A;  3S1N J;  2VKE A;  1B72 B;  4JX5 A;  2HI3 A;  2M34 A;  2Y9Z A;  4J19 A;  2DA4 A;  3A01 A;  3LSP A;  5JLW A;  1U78 A;  1ITY A;  1MNM C;  2NOG A;  5K7H A;  2DA5 A;  4IHW A;  1JUM A;  2L0K A;  3GTG J;  9ANT A;  5FKL A;  2HXI A;  1ETO A;  1QRY A;  2EBI A;  2K40 A;  1MBE A;  1U9N A;  2RAE A;  2R0Q C;  4RBO A;  1IC8 A;  1YRN B;  4BXX J;  4BBS J;  2GLO A;  5IYD J;  2JMW A;  4M3B A;  3HOZ J;  3UKG A;  2CQQ A;  3BG3 A;  4A3K J;  1HDP A;  2CUF A;  1JTX A;  1POG A;  3C2B A;  1GT0 C;  1AU7 A;  1VND A;  1ETQ A;  2HQ5 A;  2DA1 A;  4A93 J;  3O8G A;  2FX0 A;  1WGX A;  2HOS A;  1BW6 A;  2VUM J;  5GP9 A;  2VKV A;  3ZQL A;  3M3Y J;  3K2A A;  4AYB N;  3K7A J;  1WCM J;  2XRL A;  4UUS A;  1BW5 A;  4IHY A;  3GTM J;  4XK4 A;  1GV5 A;  1JT6 A;  1P7I A;  2IEK A;  2ME6 A;  5FJ8 J;  3A01 B;  1F43 A;  2XB5 A;  4EEF G;  2EZI A;  2DJN A;  5EF6 A;  3IH3 A;  3S2H J;  4G12 A;  1IUF A;  4W97 A;  2XGE A;  2ECC A;  4BY1 J;  4XRS G;  2LR8 A;  1I3Q J;  2Y2Z A;  3BT9 A;  2M9H A;  4AC0 A;  3S14 J;  5EG0 A;  5IP9 J;  3JRD A;  3Q0U A;  4D7M A;  1JT0 A;  1JGG A;  1BJZ A;  2JA7 J;  3BR1 A;  5BNG A;  1JKQ C;  5EGO A;  3S15 J;  3SDG A;  3GBG A;  2QCO A;  2JWT A;  2XPW A;  3NAU A;  2LLK A;  1IG7 A;  4X1E A;  4ABZ A;  3WHB A;  4UUS B;  2OPT A;  1HDD C;  4JX4 A;  5IOZ A;  1GVD A;  1Q1V A;  2K9Q A;  4XIC A;  3BTC A;  4A3F J;  2W48 A;  2HOA A;  3HOY J;  4D5F A;  1RPW A;  4C3H J;  2COB A;  3S1M J;  2NS8 A;  3FK6 A;  2ZB9 A;  2E1O A;  5IOY A;  2PMZ N;  2DA3 A;  5F0H A;  1W0T A;  1RET A;  1GV2 A;  2DMT A;  1VFC A;  2KT0 A;  3ZQH A;  1AKH B;  2XB0 X;  2DA2 A;  1SFO J;  2EZH A;  3TW7 A;  3FIW A;  2Y0S N;  1B8I A;  3LSR A;  1PUF A;  1HCR A;  2DN0 A;  3MKL A;  1RKW A;  1FIP A;  4D7N A;  1U8B A;  2CQX A;  3SJM A;  2E2H J;  4JX6 A;  4Y52 J;  2VI6 A;  1JKO C;  4BY7 J;  2FD5 A;  5FKM A;  2LD5 A;  1QVT A;  4BBR J;  3LOC A;  2CU7 A;  4JYK A;  4A3C J;  2M2E A;  4RDU A;  5F04 A;  2X48 A;  1GUU A;  2E2I J;  4CYC A;  1G2H A;  1VF9 A;  4FIS A;  2MGQ A;  3FKI J;  2L7Z A;  2HOT A;  3GTL J;  5F0C A;  5M5W J;  2EH3 A;  5K7F A;  2NVT J;  3PO3 J;  5IPA A;  4GFB A;  3PM1 A;  1MBH A;  2LTP A;  5HOD A;  1B8I B;  1PUF B;  2AO9 A;  1ETY A;  2DMP A;  5E3O A;  3MVP A;  5C44 J;  3CQZ J;  1XG1 A;  3BQZ A;  4FE7 A;  3S17 J;  2H1K A;  4AUX A;  2DMN A;  3L1P A;  1X58 A;  1HF0 A;  2NVQ J;  2TCT A;  3B6A A;  3JRC A;  4L5E A;  3SFI A;  3HM5 A;  3RZO J;  1IDZ A;  1JJ6 C;  3HOW J;  4W1U A;  4MFE A;  4BKX A;  1F36 A;  2YS9 A;  3S16 J;  5J1Y A;  4A3M J;  3I4N J;  4DW6 A;  3QPL A;  3RQI A;  4CYC B;  1BA5 A;  5F0F A;  1JUS A;  1QVU A;  1UMQ A;  1LE8 A;  1I50 J;  1XS9 A;  2QF7 A;  1TWF J;  2DMU A;  3BG9 A;  1TWC J;  4DYC A;  3M4O J;  1TWG J;  2HDD A;  4MFD A;  3HOX J;  1XC5 A;  4LOC A;  2ELK A;  3GTK J;  2G0E A;  3ZQC A;  2LFB A;  5J1R A;  2WV1 A;  2N8G A;  5FKN A;  1E3O C;  2JK3 A;  1ETX A;  5EZH A;  1HLV A;  5DS9 A;  3E7L A;  1AKH A;  2TRT A;  2I10 A;  1BL0 A;  5E3M A;  3F0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...