2DA7A

Solution structure of the homeobox domain of zinc finger homeobox protein 1b (smad interacting protein 1)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
GSSGSSGSPINPYKDHMSVLKAYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQYSNSRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Zinc finger homeobox protein 1b
publication title Solution structure of the homeobox domain of Zinc finger homeobox protein 1b (Smad interacting protein 1)
rcsb
source organism Homo sapiens
total genus 13
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2da7A00
4A3MJ 2ELKA 5IYCJ 2IBDA 4X1EA 1QVTA 5IP6A 3Q0UA 1ETQA 1UG2A 1UHSA 1GV2A 2I10A 1ETOA 3Q3SA 1U8BA 1RESA 5FLVA 2EZKA 2XPUA 4QTRA 3OOUA 3LSPA 1JKOC 3BT9A 3FISA 4FE7A 2E19A 4D7NA 1WH5A 4S0HB 3O8HA 1FJLA 1MSEC 1SANA 3GTGJ 4A69C 2EZHA 2WB1N 3BR1A 5J1RA 3BTCA 5IYDJ 5EZHA 1FEXA 3A01A 4V2GA 1ETYA 1OCTC 4JX6A 5IYBJ 1MBEA 5FJ8J 5DTDA 5IPAA 2CJJA 1B72B 4A3IJ 2R7ZJ 2PMZN 5EGOB 4C3HJ 4XRMA 2FX0A 2LLKA 5F27A 4BKXA 3G1MA 2KDZA 1QVUA 2XGDA 3S1QJ 4DYRA 3LSGA 1TC3C 2EZLA 5F0CA 5IOZA 2CU7A 3MVPA 4UUTA 3D1NI 2LY9A 5EZGA 1NK2P 1MBKA 1FIAA 2ECBA 1VF9A 2CUFA 2ME6A 3RZDJ 3PO2J 5FKMA 2XPWA 5E3NA 3GTPJ 1JUPA 1YRNA 1RKWA 2E2HJ 1ZR4A 1HOMA 1JT0A 2NVTJ 2L7ZA 1VI0A 4M3GA 4W1UA 4LOCA 3HOXJ 3BQYA 3BR3A 5FLMJ 1Q1VA 2Y31A 4JX4A 4XK4A 2XGCA 2M2EA 2FQ4A 2ME0A 3SFIA 2E2JJ 2K9NA 2GM4A 1MH4A 3BR5A 1IRZA 3VPRA 1X2NA 1ENHA 1MSFC 3TW6A 3TEDA 3I4MJ 2QCOA 3B6CA 3B6AA 2E1OA 3E7LA 3S14J 2CUEA 4DYCA 4A3LJ 2X9DA 3OSFA 1AHDP 1S7EA 2FD5A 4A3EJ 1IUFA 1JUSA 1R9TJ 3GTOJ 4AUXA 1RETA 2MSYA 1IG7A 1WI3A 1FTTA 3M4OJ 2LTPA 2DJNA 5M5XJ 3S2DJ 4D5CA 2R0QC 4BY7J 9ANTA 3HOVJ 1ORKA 1Y1WJ 1HF0A 1B8IB 2DMUA 1JKPC 3HKZN 2HQ5A 3Q0VA 2NVXJ 2VPRA 1Z77A 3LSJA 4XRSG 5FKNA 2DA6A 4B4CA 4BBRJ 2XPVA 3JRFA 4AYBN 1GT0C 1U9OA 4IHVA 3SDGA 3IH3A 3JR9A 4CYCB 3WHCA 4UUSB 2JA6J 5M5WJ 2LVSA 5EG0A 2R5YB 1MH3A 1GV5A 2GBYA 2Y9YA 3HGGA 2YU9J 2COBA 5GPAA 3SJMA 2DA2A 1K61A 2R92J 5E3MA 2OPTA 2GLOA 3RQIA 3A02A 2MGQA 3JRBA 1CQTA 3UKGA 3G1LA 4A3FJ 3OIOA 3GBGA 2XGEA 1ZGWA 2E2IJ 3BG3A 5EGOA 1IV6A 3GTMJ 1A6IA 3S1RJ 2EQRA 2NVQJ 4BY1J 2R5ZB 3HEFA 3BG5A 2DTZA 4AC0A 1P7JA 1D5YA 4A3GJ 4DW6A 2DMNA 3IV5A 1P7IA 5M5YJ 1XS9A 3S17J 2AHQA 4BXXJ 5E3OA 4XICA 2JN6A 3ZQIA 1ZQ3P 4G12A 3C2BA 4M3FA 1GDTA 1EF4A 2NOGA 1JUMA 3FKIJ 2HOTA 2DA1A 4C2MJ 4IEJA 5M3MJ 3JRCA 2EH3A 2DN0A 3GTLJ 2FJ1A 5C4XJ 1W0TA 2CQQA 1RKTA 2DA4A 2XSDC 3OSGA 4J19A 3L1PA 1NK3P 2X48A 5GP9A 5JLXA 2DA5A 3LNQA 5BNGA 3S15J 2MW8A 4FE4A 3JRDA 3BQZA 3S2HJ 2H8RA 4DZJA 1PUFA 3WHBA 3O8GA 1IDYA 2LFBA 3BR2A 1MNMC 3IH4A 4RBOA 3A03A 3BR0A 4B1RA 3PO3J 1BW6A 3ZQHA 3DCFA 4MIMA 4I76A 1O4XA 2D5VA 3F0CA 3FK7A 3S1NJ 1APLC 4M3EA 3NAUA 5J1YA 2H1KA 2IAIA 3G1OA 4FTHA 3K2AA 4A3CJ 1LFBA 1B8IA 1H88C 3A01B 1XC5A 3W6VA 3LSRA 1HCRA 2AO9A 1TWAJ 5EEAA 1POGA 4A3KJ 2DMPA 2NS7A 3JRIA 3JRHA 2DA3A 3LOCA 3CMYA 1JKRC 2LKXA 1MBHA 2K9SA 3CQZJ 4IHXA 1G2HA 1JJ6C 4JYKA 2JJ7A 1IC8A 1U9NA 2ID3A 4CYCA 4UUSA 2HXOA 3HOWJ 3QPSA 2KT0A 3ZQFA 2R5YA 3IH2A 3HOYJ 1JKQC 2JA7J 1XG1A 4C3IJ 1ETWA 4FISA 2HI3A 2JWTA 2L7FP 4I6ZA 3CCYA 1LE8B 1ZTRA 2L7MP 3RKQA 2K9QA 4HNVA 3FIWA 2R5ZA 5C3EJ 3HDDA 4EEFG 2M34A 3JRGA 3ZOBA 1JGGA 2K40A 3BR6A 2O7OA 5EF6A 1I3QJ 1HDPA 2VUMJ 1ETVA 1UMQA 5K7FA 5F04A 1TWHJ 2O8KA 2O9LA 4JP0A 3JREA 1GUUA 4M6VA 2TCTA 2YS9A 1H89C 5IOYA 2XB0X 4M3DA 1ZKGA 1E3OC 3HM5A 1MBFA 2HXIA 1B72A 1AU7A 4X6AJ 1WH7A 2NS8A 5C4JJ 2JA5J 1AKHB 3HOUJ 2EBIA 1QRYA 3CDLA 4A3BJ 5EYRA 4XIDA 1Z0XA 2ECCA 1DU0A 3H3VK 1A5JA 2HDDA 2DA7A 4XRSA 3BTLA 2DMTA 2B63J 4IHYA 3GTJJ 2L0KA 5JLWA 2OF7A 5HODA 1X2MA 1X58A 2P81A 3M3YJ 5K7ZA 3MN2A 3HBLA 4V2FA 1LFUP 4B3AA 1WPKA 1OJLA 1TWCJ 4Y7NJ 2CQXA 1JJ8C 1WCMJ 1GVDA 2VKVA 1IJWC 5F0HA 2G0EA 3S16J 3GTKJ 1HDDC 1BL0A 5DS9A 4BBSJ 5F1JA 1SFOJ 2R93J 1Y1VJ 2VI6A 1MBJA 2X6OA 1NTCA 5F08A 1ZK8A 5J1UA 5EG0B 3DEWA 4D7MA 3BG9A 1VFCA 3K7AJ 4L5EA 3BTJA 5M3FJ 3ZQLA 5C44J 5FKKA 1H8AC 3HOZJ 1T56A 4MLOA 1OFCX 1TWGJ 4DZPA 3FK6A 3ZQCA 5E3LA 1RPWA 4JX5A 3JRAA 2DMQA 1JTYA 2YUSA 4W97A 4C3JJ 2M8GX 3TP0A 2N8GA 4IHWA 1FTZA 1U78A 4NDLA 2IEKA 1IDZA 4MO7A 2ID6A 2M0CA 2XB5A 1RR7A 4Y52J 2LK2A 2Y2ZA 5FKOA 1VNDA 1JT6A 4D5FA 1LE8A 4FCYA 1F43A 3I4NJ 5GPCA 2WAQN 5IP9J 4MFDA 3BTIA 4DYQA 1I6HJ 3QQAA 2L9RA 3TW7A 2W48A 2RAEA 2VKEA 5K7HA 3RZOJ 4QIWN 3Q0WA 1MBGA 3NARA 3H0GJ 4ABZA 2LD5A 1DU6A 2LR8A 1W0UA 1I50J 2ZB9A 1PUFB 2M9HA 5EDNA 4RDUA 2TRTA 3S1MJ 1YRNB 4A3JJ 1ETKA 4MFEA 1BJZA 2JA8J 1AKHA 1ZR2A 2HOAA 4A93J 1JTXA 2JMWA 1OCPA 4M3BA 3QPLA 2Y0SN 1BW5A 2Y30A 1ETXA 3GTQJ 1F36A 2JK3A 3ZQGA 2QF7A 1IGNA 2LP0A 4A3DJ 2EZIA 3HB9A 2HYJA 1K83J 1TWFJ 1WGXA 5FKLA 1BA5A 3HGYA 1T33A 2MG4A 3PM1A 2NVYJ 5J3LA 1HLVA 5IP7J 3TP3A 2Y9ZA 2HOSA 2WV1A 2XRLA 5F0FA 1QPIA 1ITYA 4GFBA 4QSHA 3MKLA 2CRGA 1FIPA
chains in the Genus database with same CATH superfamily
1X19A 5IYCJ 4RB1A 4X1EA 5HNFA 1VQNI 3Q0UA 1ETQA 3DF8A 1UG2A 4B48A 5A2QK 4C2UA 2I10A 3KZYA 1U8BA 2V4JC 2YX4A 2DCEA 2KKOA 2W82A 2EZKA 2XPUA 4M9XA 2ZKZA 2Z5UA 4QTRA 2UXXA 1IXSB 3PNTA 3V7RA 2WAEA 1RUOA 3ZQQA 3IL2A 5B1BH 3LAJA 1JKOC 2ZFUA 4CSWA 3PIPF 1PP7U 4FE7A 4HV5A 2E19A 2BY0A 1WH5A 1P4XA 2XSJC 1SAUA 1RIOH 1Y8QB 4HA8A 1V54H 1VQKI 4NBQA 1FJLA 3ZMUA 2PQ8A 3H3ZA 2EZHA 2QQ8A 1D0YA 1RC9A 2CUJA 3PSIA 4XOTA 3VSKA 3JTHA 2DFFA 3H36A 4IKFA 4HX7A 2DQRA 3ZPLA 1SC7A 3K69A 1F4KA 2CJJA 1B72B 2F5CA 3KE2A 2ZXJA 5E1ZB 3KP7A 4U0YA 5EGOB 1R7JA 5F27A 4BKXA 1IV8A 4LB6B 3BPVA 4KIBA 3U1KA 2XGDA 4ESJA 3OL4A 1WQ2A 1JHHA 5F0CA 2ZMEB 2AQFA 2Z3YA 5FROA 3FBIB 3OWTA 5HNHA 2CUFA 2LKSA 3PO2J 4HEA2 4RGXA 1YHQI 1OYWA 5E3NA 4PCQA 2FOWA 3K4JA 4TV7A 2MC3A 2Q8KA 1JUPA 2BW3A 2ZO4A 4UHTA 1ON1A 1Z21A 4XNFA 2E2HJ 4BS9A 2ESHA 2YSRA 3ZGKA 2OZ6A 4LG3A 5JVTA 3TBIA 1VI0A 4JQFA 4I2OA 3HG9A 3G2BA 1G3WA 1ZGJA 5FLMJ 2AQEA 3DU6A 2ZJQF 2M2EA 3J7YJ 2ELHA 2F4IA 2FQ4A 2ME0A 5KCMA 3SFIA 2XVCA 2R7UA 3G4SI 3VPRA 4XKWA 1YQAA 3X2QH 1MSFC 5D4SA 4KIFA 1LVAA 3TEDA 4HNTA 3CUQC 3WGIA 2R7TA 4IX7A 3B6AA 4X0GA 1UB9A 2RKHA 3S14J 3COAC 2CUEA 4DYCA 4A3LJ 1AHDP 2L7KA 2HVSA 4A3EJ 4AD9A 3L9FA 5LFAA 1R9TJ 5JHUA 3WODF 3GTOJ 1V5FA 2MSYA 4K2EA 3GLLA 1FYLA 1NG7A 3RTRA 1IN7A 4RAGA 1FP1D 1MDMA 1SD7A 4NNJA 2YPRA 3GCMA 2Z2SB 3I64A 2R0QC 1FMWA 2ISZA 3HOVJ 5D8LB 3CMEI 3HTUA 3LSKA 4WX9A 1VQPI 4BJ6C 3CUQA 3IKTA 4BDYA 2VPRA 1Z77A 2OQRA 3I55I 5FFZA 2UV1A 3OV8A 4NC8A 2R7DA 2NNYA 5TJJA 3JRFA 4CCJA 3CJTB 1R4MB 2HS5A 1KU7A 4XONA 3SDGA 1HKTA 2JUCA 3JR9A 3OYLA 5E8GA 3G3ZA 2F5EA 5L3CA 1ZYRF 3T8RA 5LHGA 3ISPA 5M5WJ 1D1BA 4N9HA 3HGGA 2YU9J 3DQVC 4MNUA 2NRAC 1K61A 1D8JA 4XKBA 2WTEA 2OPTA 2VQHA 2WV0A 3GEZA 2MGQA 4RB3C 2XGEA 1SFEA 4P55A 4CA0A 2VBZA 1IV6A 3WTVC 5FFXA 1O3RA 1USSA 1E2XA 5HVQC 1A6IA 2IS2A 1YX3A 3ABUA 1MMNA 2EQRA 2HZDA 2PX9A 3Q5FA 3LA2A 3BG5A 1P4AA 2EIMH 2LRDA 1UZCA 5HLTA 1HC8A 1IN8A 2EV5A 1BI1A 4CCOA 4ASNA 3RKWA 2DMNA 4EGZA 3IV5A 2CGPA 1FBSA 1HKSA 1XGSA 2IGOA 4M72A 1WVRA 4EM1A 5AIPA 5CVRA 2B0LA 1XS9A 2KL4A 3S17J 5J6XA 1HBXG 1BJAA 4BXXJ 2W24A 2JT1A 3I58A 3V8KA 2JN6A 3ZQIA 2VL8A 2O3FA 2M7BA 1YG2A 4RA2A 2WAQA 3TDZC 3U1DA 3BG7A 2DA1A 4C2MJ 5M3MJ 2HQRA 2Z1DA 5GAEJ 2K86A 2VQLA 2FJ1A 2Z99A 1TQMA 1W0TA 3H3UA 5CVJA 3WTSC 4RGRA 1JXSA 1YS6A 3BCAA 5BNGA 1MMDA 2MW8A 2V9VA 4EQQA 3P9IA 3O8GA 3BR2A 1MNMC 1YYVA 4RBOA 3A03A 4B1RA 4I98B 1XX5A 3AG3H 4JOMA 2Y0SA 2DBBA 4ZZLA 2O8XA 2Z16A 4D0PA 2GXAA 3RCOA 2HQAA 3ZRGA 3OS0A 3WU2C 4M3EA 4RB0A 4XR6A 1IZ1A 3FMRA 2DXIA 2MD5A 2H1KA 2KZVA 2X4HA 2COMA 2QZ8A 2VT2A 3K2AA 3HPHA 2ZSHB 1YJNI 3W6VA 3LSRA 1HCRA 4LK1F 5CQEA 4II3A 1W4MA 2A6EF 2CUZA 1WJDA 2DA3A 3LOCA 3QP6A 2LKXA 1TZLA 2K9SA 4HX4A 2Q1ZB 4Z6YA 5K1YA 3BZCA 4EJTA 2DOFA 3GUDA 1LFPA 2FA5A 4PUSA 3FXMA 4JYKA 1IN4A 1VQOI 1USTA 2X6WA 2QVOA 4CYCA 5D5XB 4UUSA 3HOWJ 2XAFA 2KT0A 5E17F 3L2WA 3DEEA 1YITI 3J7AY 2KMUA 3E6CC 1VTNC 4II2A 1HW5A 2JA7J 1UG0A 2X1CA 4HYEA 1XG1A 1IUYA 2ZC2A 1ZLJA 3J81K 4FISA 2HI3A 1FZPB 2F5DA 2KFDA 2BW3B 3CCYA 5GADJ 2FSWA 1LE8B 1T95A 2L7MP 3JCUC 2R5ZA 2CO5A 5C3EJ 1N77A 2DK8A 2NVUB 1JGGA 1OYIA 2G7UA 2HEOA 3LA7A 5EF6A 3U2RA 2X1EA 2K3PA 2CW0F 3GVAA 1HDPA 4HPQA 2Y75A 3W6KB 3QP5A 3FXUA 1D3YA 2ZNYA 5CJ9A 4OWRB 1BI2A 4JP0A 1W36D 1GUUA 2A5WA 4M6VA 2YS9A 3I4PA 2DO7A 3U9GA 3AL0C 2XB0X 2A68F 4E7ZA 1ZGAA 4HRIA 1D0XA 2KIMA 3NWTA 3SXYA 4X6AJ 2PMHA 5FGMA 5LD2C 3CP2A 3S3MA 2KHMA 2JA5J 3TQNA 1FY7A 1X3WB 4BE2A 3F8BA 5EYRA 4BQQA 3DTEA 4I0BA 4RLFA 2ECCA 2M45A 3H3VK 2DOAA 1A5JA 4M6YA 5IY5H 3NQOA 4XRSA 1QZYA 4OMYA 4IHYA 1TT5B 2L0KA 3JW4A 5LLQA 1SMYF 2OF7A 1MDMB 4BHBA 1SVLA 4GO1A 4XBFA 4XMYA 3N4MA 2P81A 5ICFA 1MMAA 2CS3A 3E6BA 3I3LA 5K7ZA 1PJRA 2CYYA 1Y39A 3HBLA 1WPKA 3CUQB 3HUGA 2V1UA 1JE8A 5GTIC 4Y7NJ 4WCGA 2UWMA 2V9PA 2MYSA 1XMXA 3IC7A 3CC2I 1EH8A 3DLAA 1FOYA 2G0EA 2V6EA 2FF4A 4B3XA 4DOZA 1XSDA 3MD2A 3ZMZA 4EJOA 3RKYA 4AVZA 1Y1VJ 1SFOJ 2LC2A 1MBJA 2K9LA 3NRVA 3C7JA 3A0HC 2OV7A 4HAMA 4L5JA 1NTCA 1OMIA 3FXLA 1ZK8A 5F08A 5J1UA 1VFCA 3EETA 3BDDA 4M9ZA 3J80K 3S3OA 2WADA 3ZQLA 2VOOA 3L7WA 2LKPA 5C44J 3TOBA 1H8AC 3HOZJ 3E5XA 4L0YB 3HRTA 2HVRA 5DM7F 3FXRA 1IF1A 1R5GA 1RPWA 2CFXA 2DMQA 4EM2A 3OMYA 2M8GX 2QM3A 3PIOF 2N8GA 2KRCA 3F21A 1I1SA 2A6HF 4O6JA 2MLGA 4G7ZF 5KK1A 1U78A 2CH0A 4MO7A 5KVRA 2M0CA 1FT9A 4U87A 1RR7A 2VASA 4HF0A 1QHGA 1STZA 3B73A 2W00A 1XN7A 2A3SA 2D2WA 3HC7A 4DJAA 5B3SH 5J4YA 4XOPA 1JT6A 1GXPA 3PJRA 4D5FA 3E5UA 3BOQA 2RVCA 3O6BB 3LWFA 4BXUA 1K6YA 3M07A 3K1MA 3TO7A 1WFXA 3H9JA 2E5ZA 1FLIA 1JGSA 2E1CA 3TW7A 2RAEA 2VLAA 2IA0A 2Z33A 5LGTA 3A4CA 2CQKA 3Q0WA 1K78A 3F9KA 3NARA 3K4NA 5E1WA 2RC4A 2FEZA 2ZXHA 4DBQA 2X51A 4A3JJ 3KP2A 1AKHA 3CCLI 4L0ZB 2KZGA 3DP7A 4A93J 1BN5A 1KZHA 3Q9SA 1OCPA 4XLPF 1BW5A 5D5UB 1R1VA 3EYIA 5F1RA 4KMFA 2Y30A 3ROUA 1F36A 2WB1A 2M7AA 4RLQA 2BVLA 2FNPA 1BBYA 2QF7A 4PJJA 1X4PA 2GAUA 2GOXB 4A3DJ 4XORA 1K83J 1TWFJ 4LG0A 2LG4A 5LHHA 4CCKA 2M4KA 1BM9A 1MNDA 3KYDB 4Y33A 3FXQA 4WF2A 2ADUA 1I39A 2ELJA 3GZ5A 4D9JA 2XGXA 5KNLA 3O3KA 2LOOA 3WU0A 4ZZDA 4U0WA 1QPIA 3O2PE 1U0JA 4U7DA 3MKLA 5EDNA 3CCVI 5TGTA 4EV0A 2ELKA 1LNWA 1QVTA 1SVOA 1XCBA 2EWNA 5DEQA 5H2FC 3HL2A 4J00A 2H1LA 1UHSA 5HLGA 1GV2A 4L9VA 3WE3A 4PJLA 3ESWB 5FLVA 1EH6A 3WTXC 3LSIA 4BDZA 2R7OA 3OOUA 5DD8A 1X4OA 1RZ4A 2AS5F 2BOLA 3EUKL 5ILUA 3W2AA 2B7EA 3BT9A 3FISA 2IP2A 1FYKA 4IRHA 3F8FA 4G9YA 3GZNB 4LLLA 4S0HB 5ICEA 4UV9A 1P92A 4ANJA 5J8FA 3J7ZI 4HV6A 1D1AA 4RAFA 5CYVA 5J1RA 1S3JA 3BR1A 3RYRA 3HSRA 2CV1A 2P7CB 1YIJI 1I6XA 3GMEA 3ONQA 3A01A 3LSMA 2LMDA 2DJIA 4RGSA 1R1TA 4PK4A 4NC6A 1XDSA 2DI3A 4A12A 1K7AA 1QNTA 3DLLF 5DTDA 1MJAA 4XLAA 4Q47A 2WY8Q 4IVNA 1J59A 1TQIA 3G1MA 4M74A 3HSFA 1S6LA 1Y0NA 1QVUA 4UVBA 3SEQA 4DYRA 1XPXA 3SHFA 2VOPA 3D1NI 2JA2A 5EZGA 2LYCA 3MZHA 2IT0A 1FIAA 3I53A 1VF9A 2DTRA 3GLXA 4LLGF 2ETHA 5CVVA 1YRNA 1ZG3A 4P9FA 2XC7A 1HOMA 2TDXA 3LSTA 2L7ZA 3A0BC 1JT0A 2NVTJ 2PJPA 4M3GA 4LOCA 3K4BA 3WGGA 2LDUA 3EYYA 4RGUA 3HTSB 1Q1VA 4KA4A 3C3WA 2XGCA 2P4WA 3HPGA 2E2JJ 1J0RA 2OTLI 1MH4A 3OYBA 4DQ2A 2PMUA 1YW7A 1LQ1A 1R49A 2A5YB 2P5LC 1FBUA 5B66C 2PJRA 3W6JB 2J5PA 1LVKA 3I4MJ 3OS2A 1A6QA 2K4BA 4LGWA 1CGPA 3E7LA 3S2WA 3VFZA 1P4WA 2DOEA 4HX8A 4KN7X 2HZTA 3T1BA 2DFHA 3OYGA 2DYRH 2RNGA 4NHJA 2EFNA 2FMYA 2L01A 2QGUA 1S8NA 2EINH 1SEUA 1FTTA 1JHFA 2DJNA 3HHGA 2BY1A 3BJAA 5M5XJ 3S2DJ 3OIQA 3LA3A 5E18F 2H6BA 3MMYB 4D5CA 3ERMA 4M71A 4BY7J 4HLYA 2B9SA 3LL7A 2GQQA 4EVIA 4OAZA 2M8EA 2NAZA 2XHKA 1B8IB 1JKPC 1MD0A 4Z2YA 3L2RA 3QYEA 5JI6A 3R4KA 5DCMA 1HA8A 3LSJA 1LJ9A 5IT9Z 3MKWB 1YIOA 4IHTA 3IHUA 1KQ0A 2DA6A 5KHDA 5D6FA 1GT0C 1TQPA 1U9OA 5HDNA 3AKZA 4QPOA 4ZYAA 1XCVA 1A35A 4NUBA 3V8LA 3CCJI 4LMYA 1ZRCA 3WHCA 3PUFA 1YI2I 3SQNA 4ZTFA 5HS9A 3A2KA 1V55H 1MH3A 2GBYA 3JAMK 2F48A 4PSXA 2DA2A 3F6OA 4Y3OA 4XLFA 1S72I 1WJ5A 2VB6A 3SZTA 3RQIA 3A02A 2R4GA 1V5EA 4HDUA 4ETSA 1EV7A 3OIOA 2L3DA 1ZGWA 2E2IJ 4EMSA 2OD5A 4MTEA 3I59B 3S1RJ 4OIRF 4HLXA 2DAOA 2CMPA 3IAM2 4BY1J 4HDVA 3HEFA 5HLHA 3E1SA 1VZ0A 1HXDA 1P7JA 2Q2EA 2HFHA 1YFHA 1D5YA 4A3GJ 1G3TA 3QU6A 1J2XA 2JSCA 2KIFA 3LFUA 2ZJ2A 1Z7LA 2KIUA 2AHQA 4E7KA 5E3OA 3VOEA 3TOAA 4XICA 1QGPA 4LG0B 1ZQ3P 3WU1B 3I71A 3BROA 3I9V2 1ACIA 3QAHA 1JUMA 3GW2A 2FU4A 4DGWB 2DN0A 4BQNA 3K10A 4NB5A 2CQQA 1ZRDA 4GXOA 3TMOA 3DPTA 4PGGA 2ACJA 5GP9A 2DA5A 3LNQA 3S8PA 1GXQA 3I0TA 4ZH4F 3M1EA 4Y15A 1TW3A 3BQZA 2XRNA 5LGNA 3WHBA 1IDYA 5AIQA 2LFBA 2R7RA 1J09A 2EV0A 1G59A 3CO7C 2W84A 4E7JA 1R5HA 4CHUA 4NC7A 4YIRX 2HWVA 3FXKA 3DCFA 1EA3A 5H6RA 2MH2A 1O4XA 4NQWA 1QQIA 4BAYA 3R60A 3F0CA 3FK7A 2D5VA 3S1NJ 2KLOA 3NAUA 2O6GE 1R6RA 5BS6A 2V9KA 4CGZA 2HQNA 5DCFA 3H0DA 1N78A 2HYGD 1B6AA 3DKYA 2FRHA 3K4CA 1LFBA 3QRFF 1H88C 3A01B 3ML6A 1Z67A 2FOKA 3VSLA 5EEAA 2W4SA 4Y17A 3V8JA 3JRHA 3CMYA 4E7HA 4RAZA 2UZKA 3DPLC 4BJ5C 2XROA 4UY8I 2V1DA 3R61A 3ZMSA 2LF7A 1MZBA 2BBYA 2MD0A 4HF1A 3KPHA 2M3AA 2E1NA 1IC8A 2YU3A 3CO6C 3K1PA 3ZN1A 3HOSA 2R5YA 1G3YA 3F8CA 3H5NA 3IWFA 3R6SA 3HOYJ 2HNHA 3VDXA 3MKYB 2HOEA 4C3IJ 2DT6A 1ETWA 2QBYB 1ZAOA 3F72A 1R23A 2H6CA 2JWTA 4I6ZA 2L4MA 3CLQA 2EJRA 3OYMA 3KFWX 2MH9A 2PFBA 3RKQA 3BJ6A 1SD5A 5E8IA 2L54A 1OLTA 3HDDA 2E71A 2EIKH 3S32A 3M8FA 3ZOBA 1LDDA 2P5VA 3BR6A 2O7OA 1REPC 3IP4B 1I3QJ 3VYRB 4L5IA 1ETVA 2WBMA 5K7FA 3L2QA 2QSGX 1ZRFA 3JREA 2E7XA 3KEQA 5IOYA 2PJRB 3FM5A 3T8TA 1ZKGA 2X0LA 4HOBA 3WE2A 3HM5A 2HXIA 5CVIA 4B43A 1AU7A 1WH7A 2VN2A 4P96A 2NS8A 3MFKA 3CMAI 1CF7A 3EQLF 3HOUJ 2OU2A 2EBIA 1VQLI 1V5GA 4A3BJ 3ECHA 2DQLA 2E1MC 3HZJA 1DU0A 5DM6F 2MLKA 3T5XA 3RI4A 1MGTA 2DA7A 3I56I 3CCQI 3MZYA 1RNLA 2DMTA 4HSRA 3ZXSA 2OA4A 4MEYF 2QA4I 1W5SA 5HODA 1XMAA 2NS0A 1IRGA 3V4GA 2L9VA 3M3YJ 1R36A 3MN2A 1PP8F 4AU7A 4U88A 4KN4X 1LKXA 1KQ9A 3GFMA 1TWCJ 2K3FA 4H0EA 2GOMA 3E6MA 2VJJA 3RYPA 3M9AA 1I27A 4JBAA 1FMVA 1YOVB 3TKYA 4C9YA 4IZZA 1BL0A 3VEPA 4BBSJ 2ZFWA 2V26A 3K9TA 2AXTC 3OIPA 5J8CA 4YFKF 3DEWA 1DPRA 1YLFA 2HTJA 1BIBA 3DTIA 3F6VA 2QQBA 4UB8C 1F5TA 3RSNA 3DXJF 2F2EA 3HRUA 5K5RA 1RI7A 2DLLA 3FX3A 4HQMA 5FKKA 3AG4H 4HF2A 5ERIA 1T56A 3CD6I 1OFCX 1D0ZA 2NXNB 2QKLB 4DZPA 1Y0UA 3FK6A 5GAHJ 4MQVA 4HZFA 3SZGA 1K4SA 2DW4A 1JTYA 4BL0B 2I8DA 4IHWA 2Q2EB 1LDJA 3K70D 5FD5A 2IEKA 4F91B 1S9HA 2DK5A 2XB5A 1MNEA 1R22A 1WHUA 2UUZA 2R7QA 2E60A 3ABKH 4AWXB 5JVGF 2Y2ZA 2VPLA 4S05A 1VNDA 1T8IA 2KPMA 2IPQX 1F43A 1YW8A 4FETA 1J7KA 4P9UA 2FUG2 3IAS2 1BR2A 2K7LA 2V1NA 4ZJZA 3V7SA 1I5ZA 2RGVA 4MFDA 3QWLA 3F8MA 3FMSA 4ZYHA 2HYFA 4I09A 1X1DA 2QENA 5GAGJ 1X1PA 3GO5A 4LIUA 1XGMA 1IN5A 3VYTB 5J40A 5LHIA 4P1WA 1W7PD 1UELB 1OR7C 4F7ZA 3L2UA 4LLNA 2LR8A 1I50J 4I99C 1A04A 3OYJA 2E36A 4RDUA 2W85A 4IJAA 1ETKA 3PQKA 3IKVA 2JA8J 4FX4A 4OINF 4BEHA 3D5LA 1JTXA 3OYKA 2BXZA 3GFIA 4NQWB 4M3BA 3PL8A 3M7GA 3SDBA 4CZCA 2X6YA 3CF2A 3ABTA 3ZMVA 4G7OF 4B09A 3CC7I 3I5UA 1DP7P 3JSPA 1OR7A 4YG2F 2HYJA 2ZXIA 2DPUA 4R8HA 3HSEA 3HGYA 1T33A 1TNSA 1Z91A 2BHYA 2KDOA 3RPUD 1MJBA 1WJEA 2EFQA 4G6TB 4GYGA 4E6KG 2NVYJ 1YTYA 4L18B 2H94A 3KETA 1SFXA 5F64A 3WG7H 5IP7J 3SZPA 4YRVA 2K02A 2Q0OA 4EJWA 2HOSA 2W7NA 4ZYEA 3EUHC 3OR1C 1ITYA 3VYSB 3BJOA 1KA8A 4YIFA 4GFBA 4OIOF 4Y52J 1IGNA 3J7AO 1IAWA 2QYOA 4A3MJ 2QKMB 2IBDA 3MKZA 3OYFA 1Z1DA 1BIAA 4CCMA 1QHHD 1R1UA 5CQGA 3Q3SA 4BJTA 2MABA 3UR3C 3NEUA 1S7AA 2FMLA 2ZXWH 2STTA 2VBYA 4YFNF 5CVUA 3JSOA 2QQ9A 1SFKA 2VC0A 4Q5SF 3D0SA 3E6DA 3EUAA 3WTYC 4C2TA 3EUHA 4DIQA 3BLYA 2XKOA 4GCVA 1RR8C 1SANA 4A69C 2WB1N 1ZREA 4XSZF 5JR3A 1FEXA 1ETYA 1OCTC 3TO9A 4JX6A 5IYBJ 1MBEA 2P6SA 4FASD 3AG2H 5FJ8J 5IPAA 3CP8A 2R7ZJ 2PMZN 4C3HJ 4G8XA 3KP5A 5DV5A 1O57A 3S1QJ 1W5TA 1TC3C 2EZLA 5AONA 1G6NA 5IOZA 2LY9A 2W25A 1NK2P 4LIVA 1IW7F 1Y8RB 2ME6A 4A0YA 3RZDJ 1PUEE 1A36A 1LEBA 4UB6C 3ECOA 2XPWA 3LFKA 1K79A 3GTPJ 3PNVA 5ILSA 1RKWA 4MEXF 3HOXJ 4W1UA 3BQYA 3BR3A 5E1XA 2XF7A 4JX4A 4E7LA 2E1MB 1ZLKA 3E3VA 2KP6A 3D5SC 3L00A 2AXLA 2GM4A 4CCNA 5B1AH 3ULQB 3W3CA 1X2NA 4C30A 2HTSA 3ASOH 1F1ZA 3CCEI 1XSXA 2BEOA 1I1GA 3K4KA 4WK8F 2E1OA 4B44A 2JPCA 3VODA 2X9DA 3GFJA 1W7PA 1S7EA 1HW1A 3PNYA 1W36C 1WI3A 1EH7A 3M4OJ 1I3AA 2JZYA 5FLXZ 1O7LA 2K4JA 5BPDA 2OTJI 2VODA 3N97A 3SEZA 1Y6IA 2DMUA 3HKZN 4BU2A 3CCSI 3Q0VA 2A07F 4CUGA 3DKXA 1JI8A 2NVXJ 3CF5F 1GVJA 2WC2A 4XRSG 1RUNA 5FKNA 4B4CA 3CZ6A 3J81Z 4BBRJ 2XPVA 4XQFA 4GGGA 4AYBN 1FBQA 2J5OA 3LSHA 3IH3A 3OYIA 4KNYA 2GIVA 4CYCB 3BZ6A 3HRSA 4UUSB 3T0YA 2XASA 3ABLH 3V7CA 2JA6J 2VBXA 2E34A 5LRRA 2VXZA 1GV5A 2E7WA 2Y9YA 2COBA 1ZELA 4XLEA 5GPAA 2FBKA 3SJMA 2IGNA 2R92J 2GLOA 3JRBA 1YE9A 2ISYA 3E97A 4R1HA 3DFGA 3GWZA 5HS7A 3UKGA 2WA0A 1WJCA 4A3FJ 2XAHA 2E5NA 5LEJA 2VC1A 2D1VA 2BYVE 3RPQA 5EGOA 3GTMJ 2HKXA 1IRXA 4WXCA 1Z7UA 2ZBKA 2R5ZB 1T98A 1U6GA 3SYTA 1GHCA 1OCZH 1DQUA 2ZMEA 4DW6A 4CDGA 1P7IA 3V42A 1TP4A 2M1BA 4KJZA 2HKOA 3PFIA 2ZCWA 1BOBA 4U0VA 1SD6A 2BY2A 1T39A 4XN0A 3C2BA 1GDTA 1OCCH 1EF4A 1P2FA 2NOGA 3FKIJ 2HOTA 5H6QA 2VJ5A 1UJ8A 1YX5A 4IEJA 4KT5C 2X85A 4PZJA 3JRCA 1ZARA 4DBRA 3GTLJ 5C4XJ 1LUJB 3OOPA 3CC4I 1RKTA 2HVQA 4HG2A 1E0EA 3OSGA 3FXJA 4F55A 1NK3P 2X48A 5ICGA 2K9MA 2EFWA 3WG9A 3TDUC 4A2UA 4ZDPA 4FE4A 4XN3A 2H8RA 4I01A 3AL0B 3BR0A 3PO3J 3QOEA 3CJRB 3HUGB 1BW6A 3PUBA 3ZQHA 3K4LA 2EPFA 2JVGA 2KISA 4I76A 1F9NA 2F4MB 2XF5A 1YW9A 1S5LC 4PGHA 1PVEA 4P5OA 2FXAA 2RN7A 2IVMA 2IAIA 3G1OA 1U3EM 1S7OA 2M30A 1D1CA 4KICA 2V6CA 2H09A 5FO5A 1XC5A 4ENJA 1TWAJ 2RV8A 2DMPA 2NS7A 3JRIA 5LGUA 1JKRC 4G6QA 4FX0A 3CESA 2LREA 1W1WE 1VQ4I 2L02A 1NH3A 4ON0A 2F5FA 1DUXC 2JJ7A 1LDKB 1OCOH 3KEOA 2ID3A 2XUBA 3DKWA 4BQAA 3QPSA 2L4AA 2JUGA 3ZQFA 4IOAF 1IXCA 4F92B 4LB5A 3IH2A 2R7VA 1B4AA 1JKQC 4AIDA 4F3QA 2F5VA 1X3UA 4QWQA 1P6RA 3H9QA 3ABMH 2BVMA 3DEUA 4XL9A 2OZUA 2NOJB 1ZTRA 1NG6A 4HNVA 4BE1A 2P7VB 3FIWA 5L3GA 4EEFG 2XKPA 2M34A 1HSJA 2X1DA 5FD6A 4ZC3A 5E79C 3H35A 3FM3A 2FBHA 2HR3A 3ZMTA 2VUMJ 1T0FA 4E70A 1BR1A 1QU3A 5J47A 2OCCH 5L3EA 1G3SA 1UFMA 2DODA 1H89C 1K78B 2E35A 3G6EI 2OUMA 2EA2A 4M3DA 1MBFA 2I5UA 2CFOA 2ZSIB 2R7FA 4E7SA 1E17A 4RB2C 1T6SA 1DP3A 3G71I 2VONA 1AKHB 5FRNA 3RKXA 4CXFA 4YIIA 4EGYA 2ZNZA 4XIDA 3K1NA 1Z0XA 5J4VA 3TO6A 3BTLA 3ZN0A 2B63J 1UAAA 3GTJJ 5JLWA 1FOXA 2DDBA 5BQTA 4A5MA 1O3SA 4BHCA 4KMUX 4RS8A 4V2FA 2LY1A 1OJLA 2JPBA 5HDGA 3IRRA 3H5RA 2M5WA 2OAZA 2QSFX 3LMMA 2CQXA 2K85A 1JJ8C 2VKVA 4QPQA 4ZYDA 2LBFA 3BZKA 2GZWA 3LQQA 2V79A 3S16J 2JRTA 3W2VA 3OYCA 4IXAA 4RAYA 5F1JA 2R93J 3GFLA 1VQ5I 1KONA 3AG1H 3QU3A 1UCRA 3GYHX 3CJNA 4AIKA 2M0MA 3K7AJ 4AIJA 3VWBA 1J5YA 4L5EA 3BTJA 1KQ8A 4CO8A 1KU9A 1KGSA 5M3FJ 1B9NA 1MKMA 3MEXA 3H92A 5HS8A 4OAYA 2EA4A 3DBHB 1SD4A 2QEXI 2BE5F 4WWCA 4IF4A 4A6EA 5ILVA 4JX5A 1ZN2A 4RM2A 3JRAA 3C2GA 2YUSA 3QODA 4C3JJ 4KISA 3CMMA 2HPIA 1FTZA 2L9SA 4BE0A 5L3FA 1QBJA 2A05A 2ID6A 4PJMA 1TW2A 2YX7A 4BGDA 4IQJA 2LK2A 5CPRB 2Y69H 5F6FA 2FQ3A 2OQGA 4OMZA 3FBNB 1LE8A 5BOXA 4OIQF 4I7HA 2PN6A 1R5ID 3I4NJ 5LBQA 1ODDA 1A31A 2WAQN 1I6HJ 3BTIA 4I0AA 3QQAA 2XAGA 1HW2A 2VJ4A 3ZR8X 1V4RA 1BC7C 2W48A 1T38A 2XAJA 2VKEA 3BCBA 2CG4A 4B8XA 3RZOJ 1Z05A 2PI0A 1MBGA 3H0GJ 3MCZA 1N25A 2LH9A 1Z3YA 4O3MA 2ZB9A 4HBLA 3Q9VA 2CV2A 1U5TC 2TRTA 1IRFA 3HHHA 2C6YA 3S1MJ 1YRNB 4MFEA 1BJZA 1BOAA 2QLZA 5DD4A 2QUFA 2FBIA 2JMWA 3H1CA 4UXNA 3REOA 3QPLA 2Y0SN 4CH7A 4V19K 5FRMA 1G8XA 1J9IA 1KYZA 3FKJA 1ETXA 3GTQJ 1B9MA 4AM3A 1KU3A 3RDIA 2FNAA 2JK3A 4LITA 2LY2A 4F52A 2CQNA 2WAFA 2EZIA 3FF5A 3HB9A 1SFUA 1O3QA 4G7HF 1LEAA 3N05A 2IS4A 1BA5A 1U5TA 3M1CA 5DUKA 2MFZA 2MG4A 3PM1A 1EKEA 2VIXA 4UV8A 3CDHA 3DBRB 3QYFA 3H9GA 3KLNA 2O61A 3TP3A 1Z3XA 5F0FA 2KIQA 2IRFG 2ZJPF 3GX4X 1KYWA 4UVAA 1MJ9A 4M9SA 4GDFA 2IA2A 4QSHA 3S3NA 1QA6A 2JRMA 1R58A 3C18A 3M8JA 5IP6A 4HNUA 4YEJA 1OPCA 2EFOA 1ETOA 1FC3A 2V1XA 4IHSA 1RESA 2M87A 4BQOA 5DCMB 3JAMZ 2IGKA 3TL4X 4DNCA 4Q4ZF 3LSPA 5K5QA 1KU2A 2A61A 1QZEA 4ENNA 2Z9OA 4BUPA 4A5NA 5A2QZ 1BC8C 2L5QA 1T08B 4JK1X 2LSOA 4D7NA 2R7XA 1NHAA 4FQGA 3O8HA 4N9IA 4KITB 2RQPA 1MSEC 3GTGJ 4IL6C 3BTCA 1K4TA 3GXOA 2IXSA 4OU0A 5IYDJ 3EDPA 1BI0A 5EZHA 4B47A 4CZZA 1T2KA 2OC6A 2ESNA 4V2GA 2XF6A 3QYBA 4KIGA 2H27A 2HGCA 3K0LA 4FHTA 5KAIC 4IO9F 4A3IJ 4RMNA 4F93B 1XDUA 1B1BA 4GYIA 4XRMA 2BHZA 2MBFA 2FX0A 2LLKA 3MWMA 1ERDA 2GIZA 4HSTA 2G7HA 2KDZA 3LSGA 4LK0F 2CU7A 2RREA 2O03A 3MVPA 4UUTA 1YJWI 2P0WA 1MBKA 2ECBA 4MTDA 2R7SA 4XRFA 3CJQB 5FKMA 1DGWY 1XGOA 3CCMI 4IOCF 2DT7B 3WTWC 5BPIA 3M8EA 4KDPA 2IW5A 4PJ0C 1FSHA 1VQMI 1ZR4A 1WI9A 1FX7A 4AVPA 4EATA 2LBFB 1O7FA 1QZZA 4ESBA 3WTZA 2Y31A 4UVCA 4XK4A 5IT3A 4BACA 4A0XA 2K9NA 4KFCA 3BR5A 4BXFA 2VKHA 1IRZA 3P5JA 4MQ9F 3HOTA 1ENHA 4MHGA 1Z9CA 1RRJA 4PFPA 2JTVA 3TW6A 1YO5C 4L9NA 4CICA 2Y0MA 3L2VA 2QCOA 3B6CA 5LRSA 3DBLB 2DFIA 3BPXA 3OYDA 3OSFA 2EILH 4Q48A 2FD5A 5FLXK 1IUFA 1FNNA 1JUSA 2EK5A 4PFOA 4AUXA 1RETA 1IG7A 2ICWG 3H5AA 2KQRA 1FPQA 1SMTA 2LTPA 3VYUB 1O3TA 1XSVA 3R0AA 3KP6A 1EJ9A 1D5VA 9ANTA 1ORKA 2DT5A 1Y1WJ 1FYMA 3OYAA 4IRIA 2VT3A 1HF0A 5D6EA 2BXYA 2HQ5A 3FZVA 3BWGA 2A69F 2OJED 1YS7A 1V3FA 4XLCA 1UHMA 2XV4S 3AFHA 1M1EB 3RIRA 3W2WA 2PLYA 3CCRI 1DPUA 2KJCA 1D8KA 4IHVA 1L0OC 4BNCA 3CDIA 1BI3A 1WKMA 5D5VB 1FOWA 2LVSA 5EG0A 2R5YB 4UUVA 1TTYA 3HXLA 4Y13A 3FHNA 5E3MA 3KX2A 2A6TA 1CQTA 1SAXA 2XAQA 3G1LA 3IRQA 3GBGA 1U8RA 2VQGA 3BG3A 2EB7A 5FB2A 2KJBA 4XLHA 2CW7A 3C2HA 4FT8A 2IGMA 4L9JA 2R7WA 2NVQJ 2STWA 5ICCA 2DTZA 4AC0A 2UXNA 3A1YA 3F22A 2HPMA 3CLOA 2G9WA 3OR2C 5M5YJ 3KYLA 1K6OA 2RQQA 4RM3A 2VE8A 3FMQA 2P8TA 1ZHFA 1ON2A 4G12A 2R3SA 5JFRA 4M3FA 3K70C 1U5TB 3PQJA 3I54A 2LF8A 2BGCA 4WXHA 1CF7B 3ZP5A 2EH3A 2GA2A 2XDVA 3NWSA 2JQ7A 1AOYA 2DFEA 2XAUA 2DA4A 2GXBA 5DUIA 2XSDC 3D5RC 1DGRM 4J19A 3L1PA 3KEYA 1S29A 5JLXA 3L2CA 2PG4A 5BMZA 4I02A 2BV6A 3S15J 3G73A 2KRFA 3JRDA 2VKDA 3S2HJ 1XD7A 4DZJA 3E0JB 4CCLA 1PUFA 1TL8A 2HU9A 2K5CA 2ZJRF 3IH4A 1YJ9I 3KIOA 1WZ2A 3SFZA 2LNBA 3R0JA 4MIMA 3DU5A 1XB4A 2NYXA 1LPQA 2QSHX 3ELKA 1HSTA 2HDCA 1APLC 3WGHA 4KYWA 2V7FA 5J1YA 4FTHA 4XKVA 4ZDLA 3CCUI 4M73A 4A3CJ 4HW0A 1B8IA 4EM0B 2AO9A 4A3KJ 1POGA 2H8WA 3IWZA 2EFPA 6PAXA 1MBHA 3U21A 1C0WA 1OQYA 3CQZJ 1WJFA 4IRGA 4IHXA 4R79A 1G2HA 2VXDA 2X6XA 1R00A 2CWEA 3KCCA 1JJ6C 3ERED 1ULYA 3ZCOA 2EV6A 1U9NA 2HXOA 1BR4A 5HLIA 1Z6TA 4ZDOA 3QOPA 4M6XA 3F8NA 2OCEA 1Z6RA 2CW8A 5IT9K 3LQRA 3EPZA 5KAFC 2L7FP 4KT6A 3CUOA 1MMSA 1IN6A 2MA3A 3K2ZA 2L2OA 1X1BA 4PSWA 3I59A 3FWEA 4G94A 2K9QA 2NNNA 3K4MA 1OCRH 3HIFA 5GTHC 5L3DA 2QWWA 2IJLA 1VQ6I 2MC4A 1TNTA 3JRGA 3PFYA 2D1HA 3BP8A 2K40A 3HJEA 3P9CA 3KYCB 2ZMEC 4IPAA 4A6DA 5EJCA 3S93A 3RPUA 1UMQA 2RNJA 5F04A 4HQEA 1ZG5A 1TWHJ 1ZG1A 2O8KA 2O9LA 1PDNC 2WY7Q 3KZIC 1WSUA 2TCTA 5D5WB 2IA1A 1PYVA 4XLNF 4BYYA 1E3OC 3MQ0A 1TLHB 1GLNA 1X1CA 2P5KA 3DWLE 2PMZA 1LB2A 1B72A 2VJIA 5TISC 3GF2A 4YELA 5C4JJ 1FWZA 3CDLA 1QRYA 4N4NB 4E7IA 4BEHB 4D1QA 4YFXF 2HDDA 3FDYA 2O0YA 4N0BA 2O5RA 1MMGA 2RDPA 4IQ4A 3QPHA 2DDAA 4G6DA 4ITVA 1B59A 1X2MA 1OYYA 1FP2A 1X58A 1UHWA 4ZTJA 2YR2A 3IUOA 3OS1A 1IXRC 3HRMA 3KLOA 1LFUP 4B3AA 1MW7A 2JSPA 2M4GA 4QLCU 1WCMJ 1GVDA 5JHFA 2K27A 1IJWC 5F0HA 2BY3A 3CTAA 5CKTA 5E20A 2IS6A 4KUMA 3GTKJ 1HDDC 4A0ZA 4XM3A 2EIJH 5DS9A 1OISA 1OKRA 2W1OA 3KP4A 3UNGC 3OYHA 4EJVA 1QO0D 1QPMA 2VI6A 2GWRA 4BHPA 1WJAA 2X6OA 5EG0B 2OBPA 1H9GA 3BG9A 5EEGA 3DTKA 4D7MA 4Y4RA 1HKQA 2VQCA 3ZMDA 3RJPA 4LFUA 3TGNA 3QPTA 4XKCA 2WWYA 2VE9A 4OIPF 2BZTA 5DDGA 5H20A 4MLOA 1E3PA 3FXOA 1E3HA 5HOOA 1TWGJ 3LAPA 4EJUA 3MAJA 1WRJA 3VB2A 2PEXA 4ESFA 1R71A 3ZQCA 5E3LA 3J80Z 2CQ7A 1H0MA 2W57A 1TBXA 4W97A 4GRIA 3WTUC 3TP0A 1AWCA 4ENKA 5HDKA 4NDLA 4AIHA 4OOIA 1IDZA 1L3LA 4O5VA 1W5CC 3HKZA 5ED4A 3OY9A 3AAFA 2QBYA 1X3ZB 5FKOA 4PJNA 3DV8A 3F3XA 1FSEA 4FCYA 4ZYGA 5D4RA 1H9TA 4LJZF 4AYBA 4E4HA 5GPCA 1TT0A 1Q1HA 3C1DA 5IP9J 2IS1A 4N4OB 4DYQA 3MZ8A 3P9KA 2CSOA 1MIJA 3L09A 5K5OA 1J75A 2L9RA 5DYMA 3F23A 2JVHA 2QQAA 4PDKA 3GZ6A 2F6CA 2HDWA 5K7HA 3K6GA 1T0FC 2GA1A 2Y48A 3B02A 4QIWN 1HQCA 4ABZA 2LD5A 3FHZA 4UNOA 1DU6A 3DPUA 1VQ9I 3PSFA 1SVMA 1W0UA 3ZQ7A 2DU9A 4S04A 2M9HA 1PUFB 1VQ8I 4U7BA 1XMKA 1VQ7I 1R4NB 3KP3A 1XGNA 1IO2A 1X1AA 1ZR2A 2HOAA 1AA7A 1Y56A 4WXDA 3BG6A 5CLSA 2F4OB 4BH9A 1WWXA 2DPDA 1G4DA 4H4KC 4LD5A 2PBIA 3BC8A 5D8KB 5L3BA 4CYDA 3ZQGA 4ENMA 2CV0A 2LP0A 1FOKA 1ONVA 2XIGA 5LEKA 2DYSH 1XTAA 1DDNA 1P9QC 1WGXA 3HYIA 4MGRA 5FKLA 1N75A 2L9NA 3KZZA 2FE3A 4J01A 4XSXF 3OYEA 3RQ4A 5J3LA 3BY6A 3JTGA 2KRHA 1W7PB 2P6TA 2GXGA 1HLVA 1ZH5A 5EEHA 5TRDA 3P7NA 2D45A 3ASNH 2Y9ZA 1WJBA 2VBWA 3OL3A 4L9TA 2WV1A 2XRLA 3E5QA 5B5EC 1U2WA 3WTTC 2CRGA 1FIPA 3OYNA
chains in the Genus database with same CATH topology
4A3MJ 2ELKA 5IYCJ 2IBDA 4X1EA 1QVTA 5IP6A 3Q0UA 1ETQA 1UG2A 1UHSA 1GV2A 2I10A 1ETOA 3Q3SA 1U8BA 1RESA 5FLVA 2EZKA 2XPUA 4QTRA 3OOUA 3LSPA 1JKOC 3BT9A 3FISA 4FE7A 2E19A 4D7NA 1WH5A 4S0HB 3O8HA 1FJLA 1MSEC 1SANA 3GTGJ 4A69C 2EZHA 2WB1N 3BR1A 5J1RA 3BTCA 5IYDJ 5EZHA 1FEXA 3A01A 4V2GA 1ETYA 1OCTC 4JX6A 5IYBJ 1MBEA 5FJ8J 5DTDA 5IPAA 2CJJA 1B72B 4A3IJ 2R7ZJ 2PMZN 5EGOB 4C3HJ 4XRMA 2FX0A 2LLKA 5F27A 4BKXA 3G1MA 2KDZA 1QVUA 2XGDA 3S1QJ 4DYRA 3LSGA 1TC3C 2EZLA 5F0CA 5IOZA 2CU7A 3MVPA 4UUTA 3D1NI 2LY9A 5EZGA 1NK2P 1MBKA 1FIAA 2ECBA 1VF9A 2CUFA 2ME6A 3RZDJ 3PO2J 5FKMA 2XPWA 5E3NA 3GTPJ 1JUPA 1YRNA 1RKWA 2E2HJ 1ZR4A 1HOMA 1JT0A 2NVTJ 2L7ZA 1VI0A 4M3GA 4W1UA 4LOCA 3HOXJ 3BQYA 3BR3A 5FLMJ 1Q1VA 2Y31A 4JX4A 4XK4A 2XGCA 2M2EA 2FQ4A 2ME0A 3SFIA 2E2JJ 2K9NA 2GM4A 1MH4A 3BR5A 1IRZA 3VPRA 1X2NA 1ENHA 1MSFC 3TW6A 3TEDA 3I4MJ 2QCOA 3B6CA 3B6AA 2E1OA 3E7LA 3S14J 2CUEA 4DYCA 4A3LJ 2X9DA 3OSFA 1AHDP 1S7EA 2FD5A 4A3EJ 1IUFA 1JUSA 1R9TJ 3GTOJ 4AUXA 1RETA 2MSYA 1IG7A 1WI3A 1FTTA 3M4OJ 2LTPA 2DJNA 5M5XJ 3S2DJ 4D5CA 2R0QC 4BY7J 9ANTA 3HOVJ 1ORKA 1Y1WJ 1HF0A 1B8IB 2DMUA 1JKPC 3HKZN 2HQ5A 3Q0VA 2NVXJ 2VPRA 1Z77A 3LSJA 4XRSG 5FKNA 2DA6A 4B4CA 4BBRJ 2XPVA 3JRFA 4AYBN 1GT0C 1U9OA 4IHVA 3SDGA 3IH3A 3JR9A 4CYCB 3WHCA 4UUSB 2JA6J 5M5WJ 2LVSA 5EG0A 2R5YB 1MH3A 1GV5A 2GBYA 2Y9YA 3HGGA 2YU9J 2COBA 5GPAA 3SJMA 2DA2A 1K61A 2R92J 5E3MA 2OPTA 2GLOA 3RQIA 3A02A 2MGQA 3JRBA 1CQTA 3UKGA 3G1LA 4A3FJ 3OIOA 3GBGA 2XGEA 1ZGWA 2E2IJ 3BG3A 5EGOA 1IV6A 3GTMJ 1A6IA 3S1RJ 2EQRA 2NVQJ 4BY1J 2R5ZB 3HEFA 3BG5A 2DTZA 4AC0A 1P7JA 1D5YA 4A3GJ 4DW6A 2DMNA 3IV5A 1P7IA 5M5YJ 1XS9A 3S17J 2AHQA 4BXXJ 5E3OA 4XICA 2JN6A 3ZQIA 1ZQ3P 4G12A 3C2BA 4M3FA 1GDTA 1EF4A 2NOGA 1JUMA 3FKIJ 2HOTA 2DA1A 4C2MJ 4IEJA 5M3MJ 3JRCA 2EH3A 2DN0A 3GTLJ 2FJ1A 5C4XJ 1W0TA 2CQQA 1RKTA 2DA4A 2XSDC 3OSGA 4J19A 3L1PA 1NK3P 2X48A 5GP9A 5JLXA 2DA5A 3LNQA 5BNGA 3S15J 2MW8A 4FE4A 3JRDA 3BQZA 3S2HJ 2H8RA 4DZJA 1PUFA 3WHBA 3O8GA 1IDYA 2LFBA 3BR2A 1MNMC 3IH4A 4RBOA 3A03A 3BR0A 4B1RA 3PO3J 1BW6A 3ZQHA 3DCFA 4MIMA 4I76A 1O4XA 2D5VA 3F0CA 3FK7A 3S1NJ 1APLC 4M3EA 3NAUA 5J1YA 2H1KA 2IAIA 3G1OA 4FTHA 3K2AA 4A3CJ 1LFBA 1B8IA 1H88C 3A01B 1XC5A 3W6VA 3LSRA 1HCRA 2AO9A 1TWAJ 5EEAA 1POGA 4A3KJ 2DMPA 2NS7A 3JRIA 3JRHA 2DA3A 3LOCA 3CMYA 1JKRC 2LKXA 1MBHA 2K9SA 3CQZJ 4IHXA 1G2HA 1JJ6C 4JYKA 2JJ7A 1IC8A 1U9NA 2ID3A 4CYCA 4UUSA 2HXOA 3HOWJ 3QPSA 2KT0A 3ZQFA 2R5YA 3IH2A 3HOYJ 1JKQC 2JA7J 1XG1A 4C3IJ 1ETWA 4FISA 2HI3A 2JWTA 2L7FP 4I6ZA 3CCYA 1LE8B 1ZTRA 2L7MP 3RKQA 2K9QA 4HNVA 3FIWA 2R5ZA 5C3EJ 3HDDA 4EEFG 2M34A 3JRGA 3ZOBA 1JGGA 2K40A 3BR6A 2O7OA 5EF6A 1I3QJ 1HDPA 2VUMJ 1ETVA 1UMQA 5K7FA 5F04A 1TWHJ 2O8KA 2O9LA 4JP0A 3JREA 1GUUA 4M6VA 2TCTA 2YS9A 1H89C 5IOYA 2XB0X 4M3DA 1ZKGA 1E3OC 3HM5A 1MBFA 2HXIA 1B72A 1AU7A 4X6AJ 1WH7A 2NS8A 5C4JJ 2JA5J 1AKHB 3HOUJ 2EBIA 1QRYA 3CDLA 4A3BJ 5EYRA 4XIDA 1Z0XA 2ECCA 1DU0A 3H3VK 1A5JA 2HDDA 2DA7A 4XRSA 3BTLA 2DMTA 2B63J 4IHYA 3GTJJ 2L0KA 5JLWA 2OF7A 5HODA 1X2MA 1X58A 2P81A 3M3YJ 5K7ZA 3MN2A 3HBLA 4V2FA 1LFUP 4B3AA 1WPKA 1OJLA 1TWCJ 4Y7NJ 2CQXA 1JJ8C 1WCMJ 1GVDA 2VKVA 1IJWC 5F0HA 2G0EA 3S16J 3GTKJ 1HDDC 1BL0A 5DS9A 4BBSJ 5F1JA 1SFOJ 2R93J 1Y1VJ 2VI6A 1MBJA 2X6OA 1NTCA 5F08A 1ZK8A 5J1UA 5EG0B 3DEWA 4D7MA 3BG9A 1VFCA 3K7AJ 4L5EA 3BTJA 5M3FJ 3ZQLA 5C44J 5FKKA 1H8AC 3HOZJ 1T56A 4MLOA 1OFCX 1TWGJ 4DZPA 3FK6A 3ZQCA 5E3LA 1RPWA 4JX5A 3JRAA 2DMQA 1JTYA 2YUSA 4W97A 4C3JJ 2M8GX 3TP0A 2N8GA 4IHWA 1FTZA 1U78A 4NDLA 2IEKA 1IDZA 4MO7A 2ID6A 2M0CA 2XB5A 1RR7A 4Y52J 2LK2A 2Y2ZA 5FKOA 1VNDA 1JT6A 4D5FA 1LE8A 4FCYA 1F43A 3I4NJ 5GPCA 2WAQN 5IP9J 4MFDA 3BTIA 4DYQA 1I6HJ 3QQAA 2L9RA 3TW7A 2W48A 2RAEA 2VKEA 5K7HA 3RZOJ 4QIWN 3Q0WA 1MBGA 3NARA 3H0GJ 4ABZA 2LD5A 1DU6A 2LR8A 1W0UA 1I50J 2ZB9A 1PUFB 2M9HA 5EDNA 4RDUA 2TRTA 3S1MJ 1YRNB 4A3JJ 1ETKA 4MFEA 1BJZA 2JA8J 1AKHA 1ZR2A 2HOAA 4A93J 1JTXA 2JMWA 1OCPA 4M3BA 3QPLA 2Y0SN 1BW5A 2Y30A 1ETXA 3GTQJ 1F36A 2JK3A 3ZQGA 2QF7A 1IGNA 2LP0A 4A3DJ 2EZIA 3HB9A 2HYJA 1K83J 1TWFJ 1WGXA 5FKLA 1BA5A 3HGYA 1T33A 2MG4A 3PM1A 2NVYJ 5J3LA 1HLVA 5IP7J 3TP3A 2Y9ZA 2HOSA 2WV1A 2XRLA 5F0FA 1QPIA 1ITYA 4GFBA 4QSHA 3MKLA 2CRGA 1FIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3M J;  2ELK A;  5IYC J;  2IBD A;  4X1E A;  1QVT A;  5IP6 A;  3Q0U A;  1ETQ A;  1UG2 A;  1UHS A;  1GV2 A;  2I10 A;  1ETO A;  3Q3S A;  1U8B A;  1RES A;  5FLV A;  2EZK A;  2XPU A;  4QTR A;  3OOU A;  3LSP A;  1JKO C;  3BT9 A;  3FIS A;  4FE7 A;  2E19 A;  4D7N A;  1WH5 A;  4S0H B;  3O8H A;  1FJL A;  1MSE C;  1SAN A;  3GTG J;  4A69 C;  2EZH A;  2WB1 N;  3BR1 A;  5J1R A;  3BTC A;  5IYD J;  5EZH A;  1FEX A;  3A01 A;  4V2G A;  1ETY A;  1OCT C;  4JX6 A;  5IYB J;  1MBE A;  5FJ8 J;  5DTD A;  5IPA A;  2CJJ A;  1B72 B;  4A3I J;  2R7Z J;  2PMZ N;  5EGO B;  4C3H J;  4XRM A;  2FX0 A;  2LLK A;  5F27 A;  4BKX A;  3G1M A;  2KDZ A;  1QVU A;  2XGD A;  3S1Q J;  4DYR A;  3LSG A;  1TC3 C;  2EZL A;  5F0C A;  5IOZ A;  2CU7 A;  3MVP A;  4UUT A;  3D1N I;  2LY9 A;  5EZG A;  1NK2 P;  1MBK A;  1FIA A;  2ECB A;  1VF9 A;  2CUF A;  2ME6 A;  3RZD J;  3PO2 J;  5FKM A;  2XPW A;  5E3N A;  3GTP J;  1JUP A;  1YRN A;  1RKW A;  2E2H J;  1ZR4 A;  1HOM A;  1JT0 A;  2NVT J;  2L7Z A;  1VI0 A;  4M3G A;  4W1U A;  4LOC A;  3HOX J;  3BQY A;  3BR3 A;  5FLM J;  1Q1V A;  2Y31 A;  4JX4 A;  4XK4 A;  2XGC A;  2M2E A;  2FQ4 A;  2ME0 A;  3SFI A;  2E2J J;  2K9N A;  2GM4 A;  1MH4 A;  3BR5 A;  1IRZ A;  3VPR A;  1X2N A;  1ENH A;  1MSF C;  3TW6 A;  3TED A;  3I4M J;  2QCO A;  3B6C A;  3B6A A;  2E1O A;  3E7L A;  3S14 J;  2CUE A;  4DYC A;  4A3L J;  2X9D A;  3OSF A;  1AHD P;  1S7E A;  2FD5 A;  4A3E J;  1IUF A;  1JUS A;  1R9T J;  3GTO J;  4AUX A;  1RET A;  2MSY A;  1IG7 A;  1WI3 A;  1FTT A;  3M4O J;  2LTP A;  2DJN A;  5M5X J;  3S2D J;  4D5C A;  2R0Q C;  4BY7 J;  9ANT A;  3HOV J;  1ORK A;  1Y1W J;  1HF0 A;  1B8I B;  2DMU A;  1JKP C;  3HKZ N;  2HQ5 A;  3Q0V A;  2NVX J;  2VPR A;  1Z77 A;  3LSJ A;  4XRS G;  5FKN A;  2DA6 A;  4B4C A;  4BBR J;  2XPV A;  3JRF A;  4AYB N;  1GT0 C;  1U9O A;  4IHV A;  3SDG A;  3IH3 A;  3JR9 A;  4CYC B;  3WHC A;  4UUS B;  2JA6 J;  5M5W J;  2LVS A;  5EG0 A;  2R5Y B;  1MH3 A;  1GV5 A;  2GBY A;  2Y9Y A;  3HGG A;  2YU9 J;  2COB A;  5GPA A;  3SJM A;  2DA2 A;  1K61 A;  2R92 J;  5E3M A;  2OPT A;  2GLO A;  3RQI A;  3A02 A;  2MGQ A;  3JRB A;  1CQT A;  3UKG A;  3G1L A;  4A3F J;  3OIO A;  3GBG A;  2XGE A;  1ZGW A;  2E2I J;  3BG3 A;  5EGO A;  1IV6 A;  3GTM J;  1A6I A;  3S1R J;  2EQR A;  2NVQ J;  4BY1 J;  2R5Z B;  3HEF A;  3BG5 A;  2DTZ A;  4AC0 A;  1P7J A;  1D5Y A;  4A3G J;  4DW6 A;  2DMN A;  3IV5 A;  1P7I A;  5M5Y J;  1XS9 A;  3S17 J;  2AHQ A;  4BXX J;  5E3O A;  4XIC A;  2JN6 A;  3ZQI A;  1ZQ3 P;  4G12 A;  3C2B A;  4M3F A;  1GDT A;  1EF4 A;  2NOG A;  1JUM A;  3FKI J;  2HOT A;  2DA1 A;  4C2M J;  4IEJ A;  5M3M J;  3JRC A;  2EH3 A;  2DN0 A;  3GTL J;  2FJ1 A;  5C4X J;  1W0T A;  2CQQ A;  1RKT A;  2DA4 A;  2XSD C;  3OSG A;  4J19 A;  3L1P A;  1NK3 P;  2X48 A;  5GP9 A;  5JLX A;  2DA5 A;  3LNQ A;  5BNG A;  3S15 J;  2MW8 A;  4FE4 A;  3JRD A;  3BQZ A;  3S2H J;  2H8R A;  4DZJ A;  1PUF A;  3WHB A;  3O8G A;  1IDY A;  2LFB A;  3BR2 A;  1MNM C;  3IH4 A;  4RBO A;  3A03 A;  3BR0 A;  4B1R A;  3PO3 J;  1BW6 A;  3ZQH A;  3DCF A;  4MIM A;  4I76 A;  1O4X A;  2D5V A;  3F0C A;  3FK7 A;  3S1N J;  1APL C;  4M3E A;  3NAU A;  5J1Y A;  2H1K A;  2IAI A;  3G1O A;  4FTH A;  3K2A A;  4A3C J;  1LFB A;  1B8I A;  1H88 C;  3A01 B;  1XC5 A;  3W6V A;  3LSR A;  1HCR A;  2AO9 A;  1TWA J;  5EEA A;  1POG A;  4A3K J;  2DMP A;  2NS7 A;  3JRI A;  3JRH A;  2DA3 A;  3LOC A;  3CMY A;  1JKR C;  2LKX A;  1MBH A;  2K9S A;  3CQZ J;  4IHX A;  1G2H A;  1JJ6 C;  4JYK A;  2JJ7 A;  1IC8 A;  1U9N A;  2ID3 A;  4CYC A;  4UUS A;  2HXO A;  3HOW J;  3QPS A;  2KT0 A;  3ZQF A;  2R5Y A;  3IH2 A;  3HOY J;  1JKQ C;  2JA7 J;  1XG1 A;  4C3I J;  1ETW A;  4FIS A;  2HI3 A;  2JWT A;  2L7F P;  4I6Z A;  3CCY A;  1LE8 B;  1ZTR A;  2L7M P;  3RKQ A;  2K9Q A;  4HNV A;  3FIW A;  2R5Z A;  5C3E J;  3HDD A;  4EEF G;  2M34 A;  3JRG A;  3ZOB A;  1JGG A;  2K40 A;  3BR6 A;  2O7O A;  5EF6 A;  1I3Q J;  1HDP A;  2VUM J;  1ETV A;  1UMQ A;  5K7F A;  5F04 A;  1TWH J;  2O8K A;  2O9L A;  4JP0 A;  3JRE A;  1GUU A;  4M6V A;  2TCT A;  2YS9 A;  1H89 C;  5IOY A;  2XB0 X;  4M3D A;  1ZKG A;  1E3O C;  3HM5 A;  1MBF A;  2HXI A;  1B72 A;  1AU7 A;  4X6A J;  1WH7 A;  2NS8 A;  5C4J J;  2JA5 J;  1AKH B;  3HOU J;  2EBI A;  1QRY A;  3CDL A;  4A3B J;  5EYR A;  4XID A;  1Z0X A;  2ECC A;  1DU0 A;  3H3V K;  1A5J A;  2HDD A;  2DA7 A;  4XRS A;  3BTL A;  2DMT A;  2B63 J;  4IHY A;  3GTJ J;  2L0K A;  5JLW A;  2OF7 A;  5HOD A;  1X2M A;  1X58 A;  2P81 A;  3M3Y J;  5K7Z A;  3MN2 A;  3HBL A;  4V2F A;  1LFU P;  4B3A A;  1WPK A;  1OJL A;  1TWC J;  4Y7N J;  2CQX A;  1JJ8 C;  1WCM J;  1GVD A;  2VKV A;  1IJW C;  5F0H A;  2G0E A;  3S16 J;  3GTK J;  1HDD C;  1BL0 A;  5DS9 A;  4BBS J;  5F1J A;  1SFO J;  2R93 J;  1Y1V J;  2VI6 A;  1MBJ A;  2X6O A;  1NTC A;  5F08 A;  1ZK8 A;  5J1U A;  5EG0 B;  3DEW A;  4D7M A;  3BG9 A;  1VFC A;  3K7A J;  4L5E A;  3BTJ A;  5M3F J;  3ZQL A;  5C44 J;  5FKK A;  1H8A C;  3HOZ J;  1T56 A;  4MLO A;  1OFC X;  1TWG J;  4DZP A;  3FK6 A;  3ZQC A;  5E3L A;  1RPW A;  4JX5 A;  3JRA A;  2DMQ A;  1JTY A;  2YUS A;  4W97 A;  4C3J J;  2M8G X;  3TP0 A;  2N8G A;  4IHW A;  1FTZ A;  1U78 A;  4NDL A;  2IEK A;  1IDZ A;  4MO7 A;  2ID6 A;  2M0C A;  2XB5 A;  1RR7 A;  4Y52 J;  2LK2 A;  2Y2Z A;  5FKO A;  1VND A;  1JT6 A;  4D5F A;  1LE8 A;  4FCY A;  1F43 A;  3I4N J;  5GPC A;  2WAQ N;  5IP9 J;  4MFD A;  3BTI A;  4DYQ A;  1I6H J;  3QQA A;  2L9R A;  3TW7 A;  2W48 A;  2RAE A;  2VKE A;  5K7H A;  3RZO J;  4QIW N;  3Q0W A;  1MBG A;  3NAR A;  3H0G J;  4ABZ A;  2LD5 A;  1DU6 A;  2LR8 A;  1W0U A;  1I50 J;  2ZB9 A;  1PUF B;  2M9H A;  5EDN A;  4RDU A;  2TRT A;  3S1M J;  1YRN B;  4A3J J;  1ETK A;  4MFE A;  1BJZ A;  2JA8 J;  1AKH A;  1ZR2 A;  2HOA A;  4A93 J;  1JTX A;  2JMW A;  1OCP A;  4M3B A;  3QPL A;  2Y0S N;  1BW5 A;  2Y30 A;  1ETX A;  3GTQ J;  1F36 A;  2JK3 A;  3ZQG A;  2QF7 A;  1IGN A;  2LP0 A;  4A3D J;  2EZI A;  3HB9 A;  2HYJ A;  1K83 J;  1TWF J;  1WGX A;  5FKL A;  1BA5 A;  3HGY A;  1T33 A;  2MG4 A;  3PM1 A;  2NVY J;  5J3L A;  1HLV A;  5IP7 J;  3TP3 A;  2Y9Z A;  2HOS A;  2WV1 A;  2XRL A;  5F0F A;  1QPI A;  1ITY A;  4GFB A;  4QSH A;  3MKL A;  2CRG A;  1FIP A; 
#chains in the Genus database with same CATH topology
 1X19 A;  5IYC J;  4RB1 A;  4X1E A;  5HNF A;  1VQN I;  3Q0U A;  1ETQ A;  3DF8 A;  1UG2 A;  4B48 A;  5A2Q K;  4C2U A;  2I10 A;  3KZY A;  1U8B A;  2V4J C;  2YX4 A;  2DCE A;  2KKO A;  2W82 A;  2EZK A;  2XPU A;  4M9X A;  2ZKZ A;  2Z5U A;  4QTR A;  2UXX A;  1IXS B;  3PNT A;  3V7R A;  2WAE A;  1RUO A;  3ZQQ A;  3IL2 A;  5B1B H;  3LAJ A;  1JKO C;  2ZFU A;  4CSW A;  3PIP F;  1PP7 U;  4FE7 A;  4HV5 A;  2E19 A;  2BY0 A;  1WH5 A;  1P4X A;  2XSJ C;  1SAU A;  1RIO H;  1Y8Q B;  4HA8 A;  1V54 H;  1VQK I;  4NBQ A;  1FJL A;  3ZMU A;  2PQ8 A;  3H3Z A;  2EZH A;  2QQ8 A;  1D0Y A;  1RC9 A;  2CUJ A;  3PSI A;  4XOT A;  3VSK A;  3JTH A;  2DFF A;  3H36 A;  4IKF A;  4HX7 A;  2DQR A;  3ZPL A;  1SC7 A;  3K69 A;  1F4K A;  2CJJ A;  1B72 B;  2F5C A;  3KE2 A;  2ZXJ A;  5E1Z B;  3KP7 A;  4U0Y A;  5EGO B;  1R7J A;  5F27 A;  4BKX A;  1IV8 A;  4LB6 B;  3BPV A;  4KIB A;  3U1K A;  2XGD A;  4ESJ A;  3OL4 A;  1WQ2 A;  1JHH A;  5F0C A;  2ZME B;  2AQF A;  2Z3Y A;  5FRO A;  3FBI B;  3OWT A;  5HNH A;  2CUF A;  2LKS A;  3PO2 J;  4HEA 2;  4RGX A;  1YHQ I;  1OYW A;  5E3N A;  4PCQ A;  2FOW A;  3K4J A;  4TV7 A;  2MC3 A;  2Q8K A;  1JUP A;  2BW3 A;  2ZO4 A;  4UHT A;  1ON1 A;  1Z21 A;  4XNF A;  2E2H J;  4BS9 A;  2ESH A;  2YSR A;  3ZGK A;  2OZ6 A;  4LG3 A;  5JVT A;  3TBI A;  1VI0 A;  4JQF A;  4I2O A;  3HG9 A;  3G2B A;  1G3W A;  1ZGJ A;  5FLM J;  2AQE A;  3DU6 A;  2ZJQ F;  2M2E A;  3J7Y J;  2ELH A;  2F4I A;  2FQ4 A;  2ME0 A;  5KCM A;  3SFI A;  2XVC A;  2R7U A;  3G4S I;  3VPR A;  4XKW A;  1YQA A;  3X2Q H;  1MSF C;  5D4S A;  4KIF A;  1LVA A;  3TED A;  4HNT A;  3CUQ C;  3WGI A;  2R7T A;  4IX7 A;  3B6A A;  4X0G A;  1UB9 A;  2RKH A;  3S14 J;  3COA C;  2CUE A;  4DYC A;  4A3L J;  1AHD P;  2L7K A;  2HVS A;  4A3E J;  4AD9 A;  3L9F A;  5LFA A;  1R9T J;  5JHU A;  3WOD F;  3GTO J;  1V5F A;  2MSY A;  4K2E A;  3GLL A;  1FYL A;  1NG7 A;  3RTR A;  1IN7 A;  4RAG A;  1FP1 D;  1MDM A;  1SD7 A;  4NNJ A;  2YPR A;  3GCM A;  2Z2S B;  3I64 A;  2R0Q C;  1FMW A;  2ISZ A;  3HOV J;  5D8L B;  3CME I;  3HTU A;  3LSK A;  4WX9 A;  1VQP I;  4BJ6 C;  3CUQ A;  3IKT A;  4BDY A;  2VPR A;  1Z77 A;  2OQR A;  3I55 I;  5FFZ A;  2UV1 A;  3OV8 A;  4NC8 A;  2R7D A;  2NNY A;  5TJJ A;  3JRF A;  4CCJ A;  3CJT B;  1R4M B;  2HS5 A;  1KU7 A;  4XON A;  3SDG A;  1HKT A;  2JUC A;  3JR9 A;  3OYL A;  5E8G A;  3G3Z A;  2F5E A;  5L3C A;  1ZYR F;  3T8R A;  5LHG A;  3ISP A;  5M5W J;  1D1B A;  4N9H A;  3HGG A;  2YU9 J;  3DQV C;  4MNU A;  2NRA C;  1K61 A;  1D8J A;  4XKB A;  2WTE A;  2OPT A;  2VQH A;  2WV0 A;  3GEZ A;  2MGQ A;  4RB3 C;  2XGE A;  1SFE A;  4P55 A;  4CA0 A;  2VBZ A;  1IV6 A;  3WTV C;  5FFX A;  1O3R A;  1USS A;  1E2X A;  5HVQ C;  1A6I A;  2IS2 A;  1YX3 A;  3ABU A;  1MMN A;  2EQR A;  2HZD A;  2PX9 A;  3Q5F A;  3LA2 A;  3BG5 A;  1P4A A;  2EIM H;  2LRD A;  1UZC A;  5HLT A;  1HC8 A;  1IN8 A;  2EV5 A;  1BI1 A;  4CCO A;  4ASN A;  3RKW A;  2DMN A;  4EGZ A;  3IV5 A;  2CGP A;  1FBS A;  1HKS A;  1XGS A;  2IGO A;  4M72 A;  1WVR A;  4EM1 A;  5AIP A;  5CVR A;  2B0L A;  1XS9 A;  2KL4 A;  3S17 J;  5J6X A;  1HBX G;  1BJA A;  4BXX J;  2W24 A;  2JT1 A;  3I58 A;  3V8K A;  2JN6 A;  3ZQI A;  2VL8 A;  2O3F A;  2M7B A;  1YG2 A;  4RA2 A;  2WAQ A;  3TDZ C;  3U1D A;  3BG7 A;  2DA1 A;  4C2M J;  5M3M J;  2HQR A;  2Z1D A;  5GAE J;  2K86 A;  2VQL A;  2FJ1 A;  2Z99 A;  1TQM A;  1W0T A;  3H3U A;  5CVJ A;  3WTS C;  4RGR A;  1JXS A;  1YS6 A;  3BCA A;  5BNG A;  1MMD A;  2MW8 A;  2V9V A;  4EQQ A;  3P9I A;  3O8G A;  3BR2 A;  1MNM C;  1YYV A;  4RBO A;  3A03 A;  4B1R A;  4I98 B;  1XX5 A;  3AG3 H;  4JOM A;  2Y0S A;  2DBB A;  4ZZL A;  2O8X A;  2Z16 A;  4D0P A;  2GXA A;  3RCO A;  2HQA A;  3ZRG A;  3OS0 A;  3WU2 C;  4M3E A;  4RB0 A;  4XR6 A;  1IZ1 A;  3FMR A;  2DXI A;  2MD5 A;  2H1K A;  2KZV A;  2X4H A;  2COM A;  2QZ8 A;  2VT2 A;  3K2A A;  3HPH A;  2ZSH B;  1YJN I;  3W6V A;  3LSR A;  1HCR A;  4LK1 F;  5CQE A;  4II3 A;  1W4M A;  2A6E F;  2CUZ A;  1WJD A;  2DA3 A;  3LOC A;  3QP6 A;  2LKX A;  1TZL A;  2K9S A;  4HX4 A;  2Q1Z B;  4Z6Y A;  5K1Y A;  3BZC A;  4EJT A;  2DOF A;  3GUD A;  1LFP A;  2FA5 A;  4PUS A;  3FXM A;  4JYK A;  1IN4 A;  1VQO I;  1UST A;  2X6W A;  2QVO A;  4CYC A;  5D5X B;  4UUS A;  3HOW J;  2XAF A;  2KT0 A;  5E17 F;  3L2W A;  3DEE A;  1YIT I;  3J7A Y;  2KMU A;  3E6C C;  1VTN C;  4II2 A;  1HW5 A;  2JA7 J;  1UG0 A;  2X1C A;  4HYE A;  1XG1 A;  1IUY A;  2ZC2 A;  1ZLJ A;  3J81 K;  4FIS A;  2HI3 A;  1FZP B;  2F5D A;  2KFD A;  2BW3 B;  3CCY A;  5GAD J;  2FSW A;  1LE8 B;  1T95 A;  2L7M P;  3JCU C;  2R5Z A;  2CO5 A;  5C3E J;  1N77 A;  2DK8 A;  2NVU B;  1JGG A;  1OYI A;  2G7U A;  2HEO A;  3LA7 A;  5EF6 A;  3U2R A;  2X1E A;  2K3P A;  2CW0 F;  3GVA A;  1HDP A;  4HPQ A;  2Y75 A;  3W6K B;  3QP5 A;  3FXU A;  1D3Y A;  2ZNY A;  5CJ9 A;  4OWR B;  1BI2 A;  4JP0 A;  1W36 D;  1GUU A;  2A5W A;  4M6V A;  2YS9 A;  3I4P A;  2DO7 A;  3U9G A;  3AL0 C;  2XB0 X;  2A68 F;  4E7Z A;  1ZGA A;  4HRI A;  1D0X A;  2KIM A;  3NWT A;  3SXY A;  4X6A J;  2PMH A;  5FGM A;  5LD2 C;  3CP2 A;  3S3M A;  2KHM A;  2JA5 J;  3TQN A;  1FY7 A;  1X3W B;  4BE2 A;  3F8B A;  5EYR A;  4BQQ A;  3DTE A;  4I0B A;  4RLF A;  2ECC A;  2M45 A;  3H3V K;  2DOA A;  1A5J A;  4M6Y A;  5IY5 H;  3NQO A;  4XRS A;  1QZY A;  4OMY A;  4IHY A;  1TT5 B;  2L0K A;  3JW4 A;  5LLQ A;  1SMY F;  2OF7 A;  1MDM B;  4BHB A;  1SVL A;  4GO1 A;  4XBF A;  4XMY A;  3N4M A;  2P81 A;  5ICF A;  1MMA A;  2CS3 A;  3E6B A;  3I3L A;  5K7Z A;  1PJR A;  2CYY A;  1Y39 A;  3HBL A;  1WPK A;  3CUQ B;  3HUG A;  2V1U A;  1JE8 A;  5GTI C;  4Y7N J;  4WCG A;  2UWM A;  2V9P A;  2MYS A;  1XMX A;  3IC7 A;  3CC2 I;  1EH8 A;  3DLA A;  1FOY A;  2G0E A;  2V6E A;  2FF4 A;  4B3X A;  4DOZ A;  1XSD A;  3MD2 A;  3ZMZ A;  4EJO A;  3RKY A;  4AVZ A;  1Y1V J;  1SFO J;  2LC2 A;  1MBJ A;  2K9L A;  3NRV A;  3C7J A;  3A0H C;  2OV7 A;  4HAM A;  4L5J A;  1NTC A;  1OMI A;  3FXL A;  1ZK8 A;  5F08 A;  5J1U A;  1VFC A;  3EET A;  3BDD A;  4M9Z A;  3J80 K;  3S3O A;  2WAD A;  3ZQL A;  2VOO A;  3L7W A;  2LKP A;  5C44 J;  3TOB A;  1H8A C;  3HOZ J;  3E5X A;  4L0Y B;  3HRT A;  2HVR A;  5DM7 F;  3FXR A;  1IF1 A;  1R5G A;  1RPW A;  2CFX A;  2DMQ A;  4EM2 A;  3OMY A;  2M8G X;  2QM3 A;  3PIO F;  2N8G A;  2KRC A;  3F21 A;  1I1S A;  2A6H F;  4O6J A;  2MLG A;  4G7Z F;  5KK1 A;  1U78 A;  2CH0 A;  4MO7 A;  5KVR A;  2M0C A;  1FT9 A;  4U87 A;  1RR7 A;  2VAS A;  4HF0 A;  1QHG A;  1STZ A;  3B73 A;  2W00 A;  1XN7 A;  2A3S A;  2D2W A;  3HC7 A;  4DJA A;  5B3S H;  5J4Y A;  4XOP A;  1JT6 A;  1GXP A;  3PJR A;  4D5F A;  3E5U A;  3BOQ A;  2RVC A;  3O6B B;  3LWF A;  4BXU A;  1K6Y A;  3M07 A;  3K1M A;  3TO7 A;  1WFX A;  3H9J A;  2E5Z A;  1FLI A;  1JGS A;  2E1C A;  3TW7 A;  2RAE A;  2VLA A;  2IA0 A;  2Z33 A;  5LGT A;  3A4C A;  2CQK A;  3Q0W A;  1K78 A;  3F9K A;  3NAR A;  3K4N A;  5E1W A;  2RC4 A;  2FEZ A;  2ZXH A;  4DBQ A;  2X51 A;  4A3J J;  3KP2 A;  1AKH A;  3CCL I;  4L0Z B;  2KZG A;  3DP7 A;  4A93 J;  1BN5 A;  1KZH A;  3Q9S A;  1OCP A;  4XLP F;  1BW5 A;  5D5U B;  1R1V A;  3EYI A;  5F1R A;  4KMF A;  2Y30 A;  3ROU A;  1F36 A;  2WB1 A;  2M7A A;  4RLQ A;  2BVL A;  2FNP A;  1BBY A;  2QF7 A;  4PJJ A;  1X4P A;  2GAU A;  2GOX B;  4A3D J;  4XOR A;  1K83 J;  1TWF J;  4LG0 A;  2LG4 A;  5LHH A;  4CCK A;  2M4K A;  1BM9 A;  1MND A;  3KYD B;  4Y33 A;  3FXQ A;  4WF2 A;  2ADU A;  1I39 A;  2ELJ A;  3GZ5 A;  4D9J A;  2XGX A;  5KNL A;  3O3K A;  2LOO A;  3WU0 A;  4ZZD A;  4U0W A;  1QPI A;  3O2P E;  1U0J A;  4U7D A;  3MKL A;  5EDN A;  3CCV I;  5TGT A;  4EV0 A;  2ELK A;  1LNW A;  1QVT A;  1SVO A;  1XCB A;  2EWN A;  5DEQ A;  5H2F C;  3HL2 A;  4J00 A;  2H1L A;  1UHS A;  5HLG A;  1GV2 A;  4L9V A;  3WE3 A;  4PJL A;  3ESW B;  5FLV A;  1EH6 A;  3WTX C;  3LSI A;  4BDZ A;  2R7O A;  3OOU A;  5DD8 A;  1X4O A;  1RZ4 A;  2AS5 F;  2BOL A;  3EUK L;  5ILU A;  3W2A A;  2B7E A;  3BT9 A;  3FIS A;  2IP2 A;  1FYK A;  4IRH A;  3F8F A;  4G9Y A;  3GZN B;  4LLL A;  4S0H B;  5ICE A;  4UV9 A;  1P92 A;  4ANJ A;  5J8F A;  3J7Z I;  4HV6 A;  1D1A A;  4RAF A;  5CYV A;  5J1R A;  1S3J A;  3BR1 A;  3RYR A;  3HSR A;  2CV1 A;  2P7C B;  1YIJ I;  1I6X A;  3GME A;  3ONQ A;  3A01 A;  3LSM A;  2LMD A;  2DJI A;  4RGS A;  1R1T A;  4PK4 A;  4NC6 A;  1XDS A;  2DI3 A;  4A12 A;  1K7A A;  1QNT A;  3DLL F;  5DTD A;  1MJA A;  4XLA A;  4Q47 A;  2WY8 Q;  4IVN A;  1J59 A;  1TQI A;  3G1M A;  4M74 A;  3HSF A;  1S6L A;  1Y0N A;  1QVU A;  4UVB A;  3SEQ A;  4DYR A;  1XPX A;  3SHF A;  2VOP A;  3D1N I;  2JA2 A;  5EZG A;  2LYC A;  3MZH A;  2IT0 A;  1FIA A;  3I53 A;  1VF9 A;  2DTR A;  3GLX A;  4LLG F;  2ETH A;  5CVV A;  1YRN A;  1ZG3 A;  4P9F A;  2XC7 A;  1HOM A;  2TDX A;  3LST A;  2L7Z A;  3A0B C;  1JT0 A;  2NVT J;  2PJP A;  4M3G A;  4LOC A;  3K4B A;  3WGG A;  2LDU A;  3EYY A;  4RGU A;  3HTS B;  1Q1V A;  4KA4 A;  3C3W A;  2XGC A;  2P4W A;  3HPG A;  2E2J J;  1J0R A;  2OTL I;  1MH4 A;  3OYB A;  4DQ2 A;  2PMU A;  1YW7 A;  1LQ1 A;  1R49 A;  2A5Y B;  2P5L C;  1FBU A;  5B66 C;  2PJR A;  3W6J B;  2J5P A;  1LVK A;  3I4M J;  3OS2 A;  1A6Q A;  2K4B A;  4LGW A;  1CGP A;  3E7L A;  3S2W A;  3VFZ A;  1P4W A;  2DOE A;  4HX8 A;  4KN7 X;  2HZT A;  3T1B A;  2DFH A;  3OYG A;  2DYR H;  2RNG A;  4NHJ A;  2EFN A;  2FMY A;  2L01 A;  2QGU A;  1S8N A;  2EIN H;  1SEU A;  1FTT A;  1JHF A;  2DJN A;  3HHG A;  2BY1 A;  3BJA A;  5M5X J;  3S2D J;  3OIQ A;  3LA3 A;  5E18 F;  2H6B A;  3MMY B;  4D5C A;  3ERM A;  4M71 A;  4BY7 J;  4HLY A;  2B9S A;  3LL7 A;  2GQQ A;  4EVI A;  4OAZ A;  2M8E A;  2NAZ A;  2XHK A;  1B8I B;  1JKP C;  1MD0 A;  4Z2Y A;  3L2R A;  3QYE A;  5JI6 A;  3R4K A;  5DCM A;  1HA8 A;  3LSJ A;  1LJ9 A;  5IT9 Z;  3MKW B;  1YIO A;  4IHT A;  3IHU A;  1KQ0 A;  2DA6 A;  5KHD A;  5D6F A;  1GT0 C;  1TQP A;  1U9O A;  5HDN A;  3AKZ A;  4QPO A;  4ZYA A;  1XCV A;  1A35 A;  4NUB A;  3V8L A;  3CCJ I;  4LMY A;  1ZRC A;  3WHC A;  3PUF A;  1YI2 I;  3SQN A;  4ZTF A;  5HS9 A;  3A2K A;  1V55 H;  1MH3 A;  2GBY A;  3JAM K;  2F48 A;  4PSX A;  2DA2 A;  3F6O A;  4Y3O A;  4XLF A;  1S72 I;  1WJ5 A;  2VB6 A;  3SZT A;  3RQI A;  3A02 A;  2R4G A;  1V5E A;  4HDU A;  4ETS A;  1EV7 A;  3OIO A;  2L3D A;  1ZGW A;  2E2I J;  4EMS A;  2OD5 A;  4MTE A;  3I59 B;  3S1R J;  4OIR F;  4HLX A;  2DAO A;  2CMP A;  3IAM 2;  4BY1 J;  4HDV A;  3HEF A;  5HLH A;  3E1S A;  1VZ0 A;  1HXD A;  1P7J A;  2Q2E A;  2HFH A;  1YFH A;  1D5Y A;  4A3G J;  1G3T A;  3QU6 A;  1J2X A;  2JSC A;  2KIF A;  3LFU A;  2ZJ2 A;  1Z7L A;  2KIU A;  2AHQ A;  4E7K A;  5E3O A;  3VOE A;  3TOA A;  4XIC A;  1QGP A;  4LG0 B;  1ZQ3 P;  3WU1 B;  3I71 A;  3BRO A;  3I9V 2;  1ACI A;  3QAH A;  1JUM A;  3GW2 A;  2FU4 A;  4DGW B;  2DN0 A;  4BQN A;  3K10 A;  4NB5 A;  2CQQ A;  1ZRD A;  4GXO A;  3TMO A;  3DPT A;  4PGG A;  2ACJ A;  5GP9 A;  2DA5 A;  3LNQ A;  3S8P A;  1GXQ A;  3I0T A;  4ZH4 F;  3M1E A;  4Y15 A;  1TW3 A;  3BQZ A;  2XRN A;  5LGN A;  3WHB A;  1IDY A;  5AIQ A;  2LFB A;  2R7R A;  1J09 A;  2EV0 A;  1G59 A;  3CO7 C;  2W84 A;  4E7J A;  1R5H A;  4CHU A;  4NC7 A;  4YIR X;  2HWV A;  3FXK A;  3DCF A;  1EA3 A;  5H6R A;  2MH2 A;  1O4X A;  4NQW A;  1QQI A;  4BAY A;  3R60 A;  3F0C A;  3FK7 A;  2D5V A;  3S1N J;  2KLO A;  3NAU A;  2O6G E;  1R6R A;  5BS6 A;  2V9K A;  4CGZ A;  2HQN A;  5DCF A;  3H0D A;  1N78 A;  2HYG D;  1B6A A;  3DKY A;  2FRH A;  3K4C A;  1LFB A;  3QRF F;  1H88 C;  3A01 B;  3ML6 A;  1Z67 A;  2FOK A;  3VSL A;  5EEA A;  2W4S A;  4Y17 A;  3V8J A;  3JRH A;  3CMY A;  4E7H A;  4RAZ A;  2UZK A;  3DPL C;  4BJ5 C;  2XRO A;  4UY8 I;  2V1D A;  3R61 A;  3ZMS A;  2LF7 A;  1MZB A;  2BBY A;  2MD0 A;  4HF1 A;  3KPH A;  2M3A A;  2E1N A;  1IC8 A;  2YU3 A;  3CO6 C;  3K1P A;  3ZN1 A;  3HOS A;  2R5Y A;  1G3Y A;  3F8C A;  3H5N A;  3IWF A;  3R6S A;  3HOY J;  2HNH A;  3VDX A;  3MKY B;  2HOE A;  4C3I J;  2DT6 A;  1ETW A;  2QBY B;  1ZAO A;  3F72 A;  1R23 A;  2H6C A;  2JWT A;  4I6Z A;  2L4M A;  3CLQ A;  2EJR A;  3OYM A;  3KFW X;  2MH9 A;  2PFB A;  3RKQ A;  3BJ6 A;  1SD5 A;  5E8I A;  2L54 A;  1OLT A;  3HDD A;  2E71 A;  2EIK H;  3S32 A;  3M8F A;  3ZOB A;  1LDD A;  2P5V A;  3BR6 A;  2O7O A;  1REP C;  3IP4 B;  1I3Q J;  3VYR B;  4L5I A;  1ETV A;  2WBM A;  5K7F A;  3L2Q A;  2QSG X;  1ZRF A;  3JRE A;  2E7X A;  3KEQ A;  5IOY A;  2PJR B;  3FM5 A;  3T8T A;  1ZKG A;  2X0L A;  4HOB A;  3WE2 A;  3HM5 A;  2HXI A;  5CVI A;  4B43 A;  1AU7 A;  1WH7 A;  2VN2 A;  4P96 A;  2NS8 A;  3MFK A;  3CMA I;  1CF7 A;  3EQL F;  3HOU J;  2OU2 A;  2EBI A;  1VQL I;  1V5G A;  4A3B J;  3ECH A;  2DQL A;  2E1M C;  3HZJ A;  1DU0 A;  5DM6 F;  2MLK A;  3T5X A;  3RI4 A;  1MGT A;  2DA7 A;  3I56 I;  3CCQ I;  3MZY A;  1RNL A;  2DMT A;  4HSR A;  3ZXS A;  2OA4 A;  4MEY F;  2QA4 I;  1W5S A;  5HOD A;  1XMA A;  2NS0 A;  1IRG A;  3V4G A;  2L9V A;  3M3Y J;  1R36 A;  3MN2 A;  1PP8 F;  4AU7 A;  4U88 A;  4KN4 X;  1LKX A;  1KQ9 A;  3GFM A;  1TWC J;  2K3F A;  4H0E A;  2GOM A;  3E6M A;  2VJJ A;  3RYP A;  3M9A A;  1I27 A;  4JBA A;  1FMV A;  1YOV B;  3TKY A;  4C9Y A;  4IZZ A;  1BL0 A;  3VEP A;  4BBS J;  2ZFW A;  2V26 A;  3K9T A;  2AXT C;  3OIP A;  5J8C A;  4YFK F;  3DEW A;  1DPR A;  1YLF A;  2HTJ A;  1BIB A;  3DTI A;  3F6V A;  2QQB A;  4UB8 C;  1F5T A;  3RSN A;  3DXJ F;  2F2E A;  3HRU A;  5K5R A;  1RI7 A;  2DLL A;  3FX3 A;  4HQM A;  5FKK A;  3AG4 H;  4HF2 A;  5ERI A;  1T56 A;  3CD6 I;  1OFC X;  1D0Z A;  2NXN B;  2QKL B;  4DZP A;  1Y0U A;  3FK6 A;  5GAH J;  4MQV A;  4HZF A;  3SZG A;  1K4S A;  2DW4 A;  1JTY A;  4BL0 B;  2I8D A;  4IHW A;  2Q2E B;  1LDJ A;  3K70 D;  5FD5 A;  2IEK A;  4F91 B;  1S9H A;  2DK5 A;  2XB5 A;  1MNE A;  1R22 A;  1WHU A;  2UUZ A;  2R7Q A;  2E60 A;  3ABK H;  4AWX B;  5JVG F;  2Y2Z A;  2VPL A;  4S05 A;  1VND A;  1T8I A;  2KPM A;  2IPQ X;  1F43 A;  1YW8 A;  4FET A;  1J7K A;  4P9U A;  2FUG 2;  3IAS 2;  1BR2 A;  2K7L A;  2V1N A;  4ZJZ A;  3V7S A;  1I5Z A;  2RGV A;  4MFD A;  3QWL A;  3F8M A;  3FMS A;  4ZYH A;  2HYF A;  4I09 A;  1X1D A;  2QEN A;  5GAG J;  1X1P A;  3GO5 A;  4LIU A;  1XGM A;  1IN5 A;  3VYT B;  5J40 A;  5LHI A;  4P1W A;  1W7P D;  1UEL B;  1OR7 C;  4F7Z A;  3L2U A;  4LLN A;  2LR8 A;  1I50 J;  4I99 C;  1A04 A;  3OYJ A;  2E36 A;  4RDU A;  2W85 A;  4IJA A;  1ETK A;  3PQK A;  3IKV A;  2JA8 J;  4FX4 A;  4OIN F;  4BEH A;  3D5L A;  1JTX A;  3OYK A;  2BXZ A;  3GFI A;  4NQW B;  4M3B A;  3PL8 A;  3M7G A;  3SDB A;  4CZC A;  2X6Y A;  3CF2 A;  3ABT A;  3ZMV A;  4G7O F;  4B09 A;  3CC7 I;  3I5U A;  1DP7 P;  3JSP A;  1OR7 A;  4YG2 F;  2HYJ A;  2ZXI A;  2DPU A;  4R8H A;  3HSE A;  3HGY A;  1T33 A;  1TNS A;  1Z91 A;  2BHY A;  2KDO A;  3RPU D;  1MJB A;  1WJE A;  2EFQ A;  4G6T B;  4GYG A;  4E6K G;  2NVY J;  1YTY A;  4L18 B;  2H94 A;  3KET A;  1SFX A;  5F64 A;  3WG7 H;  5IP7 J;  3SZP A;  4YRV A;  2K02 A;  2Q0O A;  4EJW A;  2HOS A;  2W7N A;  4ZYE A;  3EUH C;  3OR1 C;  1ITY A;  3VYS B;  3BJO A;  1KA8 A;  4YIF A;  4GFB A;  4OIO F;  4Y52 J;  1IGN A;  3J7A O;  1IAW A;  2QYO A;  4A3M J;  2QKM B;  2IBD A;  3MKZ A;  3OYF A;  1Z1D A;  1BIA A;  4CCM A;  1QHH D;  1R1U A;  5CQG A;  3Q3S A;  4BJT A;  2MAB A;  3UR3 C;  3NEU A;  1S7A A;  2FML A;  2ZXW H;  2STT A;  2VBY A;  4YFN F;  5CVU A;  3JSO A;  2QQ9 A;  1SFK A;  2VC0 A;  4Q5S F;  3D0S A;  3E6D A;  3EUA A;  3WTY C;  4C2T A;  3EUH A;  4DIQ A;  3BLY A;  2XKO A;  4GCV A;  1RR8 C;  1SAN A;  4A69 C;  2WB1 N;  1ZRE A;  4XSZ F;  5JR3 A;  1FEX A;  1ETY A;  1OCT C;  3TO9 A;  4JX6 A;  5IYB J;  1MBE A;  2P6S A;  4FAS D;  3AG2 H;  5FJ8 J;  5IPA A;  3CP8 A;  2R7Z J;  2PMZ N;  4C3H J;  4G8X A;  3KP5 A;  5DV5 A;  1O57 A;  3S1Q J;  1W5T A;  1TC3 C;  2EZL A;  5AON A;  1G6N A;  5IOZ A;  2LY9 A;  2W25 A;  1NK2 P;  4LIV A;  1IW7 F;  1Y8R B;  2ME6 A;  4A0Y A;  3RZD J;  1PUE E;  1A36 A;  1LEB A;  4UB6 C;  3ECO A;  2XPW A;  3LFK A;  1K79 A;  3GTP J;  3PNV A;  5ILS A;  1RKW A;  4MEX F;  3HOX J;  4W1U A;  3BQY A;  3BR3 A;  5E1X A;  2XF7 A;  4JX4 A;  4E7L A;  2E1M B;  1ZLK A;  3E3V A;  2KP6 A;  3D5S C;  3L00 A;  2AXL A;  2GM4 A;  4CCN A;  5B1A H;  3ULQ B;  3W3C A;  1X2N A;  4C30 A;  2HTS A;  3ASO H;  1F1Z A;  3CCE I;  1XSX A;  2BEO A;  1I1G A;  3K4K A;  4WK8 F;  2E1O A;  4B44 A;  2JPC A;  3VOD A;  2X9D A;  3GFJ A;  1W7P A;  1S7E A;  1HW1 A;  3PNY A;  1W36 C;  1WI3 A;  1EH7 A;  3M4O J;  1I3A A;  2JZY A;  5FLX Z;  1O7L A;  2K4J A;  5BPD A;  2OTJ I;  2VOD A;  3N97 A;  3SEZ A;  1Y6I A;  2DMU A;  3HKZ N;  4BU2 A;  3CCS I;  3Q0V A;  2A07 F;  4CUG A;  3DKX A;  1JI8 A;  2NVX J;  3CF5 F;  1GVJ A;  2WC2 A;  4XRS G;  1RUN A;  5FKN A;  4B4C A;  3CZ6 A;  3J81 Z;  4BBR J;  2XPV A;  4XQF A;  4GGG A;  4AYB N;  1FBQ A;  2J5O A;  3LSH A;  3IH3 A;  3OYI A;  4KNY A;  2GIV A;  4CYC B;  3BZ6 A;  3HRS A;  4UUS B;  3T0Y A;  2XAS A;  3ABL H;  3V7C A;  2JA6 J;  2VBX A;  2E34 A;  5LRR A;  2VXZ A;  1GV5 A;  2E7W A;  2Y9Y A;  2COB A;  1ZEL A;  4XLE A;  5GPA A;  2FBK A;  3SJM A;  2IGN A;  2R92 J;  2GLO A;  3JRB A;  1YE9 A;  2ISY A;  3E97 A;  4R1H A;  3DFG A;  3GWZ A;  5HS7 A;  3UKG A;  2WA0 A;  1WJC A;  4A3F J;  2XAH A;  2E5N A;  5LEJ A;  2VC1 A;  2D1V A;  2BYV E;  3RPQ A;  5EGO A;  3GTM J;  2HKX A;  1IRX A;  4WXC A;  1Z7U A;  2ZBK A;  2R5Z B;  1T98 A;  1U6G A;  3SYT A;  1GHC A;  1OCZ H;  1DQU A;  2ZME A;  4DW6 A;  4CDG A;  1P7I A;  3V42 A;  1TP4 A;  2M1B A;  4KJZ A;  2HKO A;  3PFI A;  2ZCW A;  1BOB A;  4U0V A;  1SD6 A;  2BY2 A;  1T39 A;  4XN0 A;  3C2B A;  1GDT A;  1OCC H;  1EF4 A;  1P2F A;  2NOG A;  3FKI J;  2HOT A;  5H6Q A;  2VJ5 A;  1UJ8 A;  1YX5 A;  4IEJ A;  4KT5 C;  2X85 A;  4PZJ A;  3JRC A;  1ZAR A;  4DBR A;  3GTL J;  5C4X J;  1LUJ B;  3OOP A;  3CC4 I;  1RKT A;  2HVQ A;  4HG2 A;  1E0E A;  3OSG A;  3FXJ A;  4F55 A;  1NK3 P;  2X48 A;  5ICG A;  2K9M A;  2EFW A;  3WG9 A;  3TDU C;  4A2U A;  4ZDP A;  4FE4 A;  4XN3 A;  2H8R A;  4I01 A;  3AL0 B;  3BR0 A;  3PO3 J;  3QOE A;  3CJR B;  3HUG B;  1BW6 A;  3PUB A;  3ZQH A;  3K4L A;  2EPF A;  2JVG A;  2KIS A;  4I76 A;  1F9N A;  2F4M B;  2XF5 A;  1YW9 A;  1S5L C;  4PGH A;  1PVE A;  4P5O A;  2FXA A;  2RN7 A;  2IVM A;  2IAI A;  3G1O A;  1U3E M;  1S7O A;  2M30 A;  1D1C A;  4KIC A;  2V6C A;  2H09 A;  5FO5 A;  1XC5 A;  4ENJ A;  1TWA J;  2RV8 A;  2DMP A;  2NS7 A;  3JRI A;  5LGU A;  1JKR C;  4G6Q A;  4FX0 A;  3CES A;  2LRE A;  1W1W E;  1VQ4 I;  2L02 A;  1NH3 A;  4ON0 A;  2F5F A;  1DUX C;  2JJ7 A;  1LDK B;  1OCO H;  3KEO A;  2ID3 A;  2XUB A;  3DKW A;  4BQA A;  3QPS A;  2L4A A;  2JUG A;  3ZQF A;  4IOA F;  1IXC A;  4F92 B;  4LB5 A;  3IH2 A;  2R7V A;  1B4A A;  1JKQ C;  4AID A;  4F3Q A;  2F5V A;  1X3U A;  4QWQ A;  1P6R A;  3H9Q A;  3ABM H;  2BVM A;  3DEU A;  4XL9 A;  2OZU A;  2NOJ B;  1ZTR A;  1NG6 A;  4HNV A;  4BE1 A;  2P7V B;  3FIW A;  5L3G A;  4EEF G;  2XKP A;  2M34 A;  1HSJ A;  2X1D A;  5FD6 A;  4ZC3 A;  5E79 C;  3H35 A;  3FM3 A;  2FBH A;  2HR3 A;  3ZMT A;  2VUM J;  1T0F A;  4E70 A;  1BR1 A;  1QU3 A;  5J47 A;  2OCC H;  5L3E A;  1G3S A;  1UFM A;  2DOD A;  1H89 C;  1K78 B;  2E35 A;  3G6E I;  2OUM A;  2EA2 A;  4M3D A;  1MBF A;  2I5U A;  2CFO A;  2ZSI B;  2R7F A;  4E7S A;  1E17 A;  4RB2 C;  1T6S A;  1DP3 A;  3G71 I;  2VON A;  1AKH B;  5FRN A;  3RKX A;  4CXF A;  4YII A;  4EGY A;  2ZNZ A;  4XID A;  3K1N A;  1Z0X A;  5J4V A;  3TO6 A;  3BTL A;  3ZN0 A;  2B63 J;  1UAA A;  3GTJ J;  5JLW A;  1FOX A;  2DDB A;  5BQT A;  4A5M A;  1O3S A;  4BHC A;  4KMU X;  4RS8 A;  4V2F A;  2LY1 A;  1OJL A;  2JPB A;  5HDG A;  3IRR A;  3H5R A;  2M5W A;  2OAZ A;  2QSF X;  3LMM A;  2CQX A;  2K85 A;  1JJ8 C;  2VKV A;  4QPQ A;  4ZYD A;  2LBF A;  3BZK A;  2GZW A;  3LQQ A;  2V79 A;  3S16 J;  2JRT A;  3W2V A;  3OYC A;  4IXA A;  4RAY A;  5F1J A;  2R93 J;  3GFL A;  1VQ5 I;  1KON A;  3AG1 H;  3QU3 A;  1UCR A;  3GYH X;  3CJN A;  4AIK A;  2M0M A;  3K7A J;  4AIJ A;  3VWB A;  1J5Y A;  4L5E A;  3BTJ A;  1KQ8 A;  4CO8 A;  1KU9 A;  1KGS A;  5M3F J;  1B9N A;  1MKM A;  3MEX A;  3H92 A;  5HS8 A;  4OAY A;  2EA4 A;  3DBH B;  1SD4 A;  2QEX I;  2BE5 F;  4WWC A;  4IF4 A;  4A6E A;  5ILV A;  4JX5 A;  1ZN2 A;  4RM2 A;  3JRA A;  3C2G A;  2YUS A;  3QOD A;  4C3J J;  4KIS A;  3CMM A;  2HPI A;  1FTZ A;  2L9S A;  4BE0 A;  5L3F A;  1QBJ A;  2A05 A;  2ID6 A;  4PJM A;  1TW2 A;  2YX7 A;  4BGD A;  4IQJ A;  2LK2 A;  5CPR B;  2Y69 H;  5F6F A;  2FQ3 A;  2OQG A;  4OMZ A;  3FBN B;  1LE8 A;  5BOX A;  4OIQ F;  4I7H A;  2PN6 A;  1R5I D;  3I4N J;  5LBQ A;  1ODD A;  1A31 A;  2WAQ N;  1I6H J;  3BTI A;  4I0A A;  3QQA A;  2XAG A;  1HW2 A;  2VJ4 A;  3ZR8 X;  1V4R A;  1BC7 C;  2W48 A;  1T38 A;  2XAJ A;  2VKE A;  3BCB A;  2CG4 A;  4B8X A;  3RZO J;  1Z05 A;  2PI0 A;  1MBG A;  3H0G J;  3MCZ A;  1N25 A;  2LH9 A;  1Z3Y A;  4O3M A;  2ZB9 A;  4HBL A;  3Q9V A;  2CV2 A;  1U5T C;  2TRT A;  1IRF A;  3HHH A;  2C6Y A;  3S1M J;  1YRN B;  4MFE A;  1BJZ A;  1BOA A;  2QLZ A;  5DD4 A;  2QUF A;  2FBI A;  2JMW A;  3H1C A;  4UXN A;  3REO A;  3QPL A;  2Y0S N;  4CH7 A;  4V19 K;  5FRM A;  1G8X A;  1J9I A;  1KYZ A;  3FKJ A;  1ETX A;  3GTQ J;  1B9M A;  4AM3 A;  1KU3 A;  3RDI A;  2FNA A;  2JK3 A;  4LIT A;  2LY2 A;  4F52 A;  2CQN A;  2WAF A;  2EZI A;  3FF5 A;  3HB9 A;  1SFU A;  1O3Q A;  4G7H F;  1LEA A;  3N05 A;  2IS4 A;  1BA5 A;  1U5T A;  3M1C A;  5DUK A;  2MFZ A;  2MG4 A;  3PM1 A;  1EKE A;  2VIX A;  4UV8 A;  3CDH A;  3DBR B;  3QYF A;  3H9G A;  3KLN A;  2O61 A;  3TP3 A;  1Z3X A;  5F0F A;  2KIQ A;  2IRF G;  2ZJP F;  3GX4 X;  1KYW A;  4UVA A;  1MJ9 A;  4M9S A;  4GDF A;  2IA2 A;  4QSH A;  3S3N A;  1QA6 A;  2JRM A;  1R58 A;  3C18 A;  3M8J A;  5IP6 A;  4HNU A;  4YEJ A;  1OPC A;  2EFO A;  1ETO A;  1FC3 A;  2V1X A;  4IHS A;  1RES A;  2M87 A;  4BQO A;  5DCM B;  3JAM Z;  2IGK A;  3TL4 X;  4DNC A;  4Q4Z F;  3LSP A;  5K5Q A;  1KU2 A;  2A61 A;  1QZE A;  4ENN A;  2Z9O A;  4BUP A;  4A5N A;  5A2Q Z;  1BC8 C;  2L5Q A;  1T08 B;  4JK1 X;  2LSO A;  4D7N A;  2R7X A;  1NHA A;  4FQG A;  3O8H A;  4N9I A;  4KIT B;  2RQP A;  1MSE C;  3GTG J;  4IL6 C;  3BTC A;  1K4T A;  3GXO A;  2IXS A;  4OU0 A;  5IYD J;  3EDP A;  1BI0 A;  5EZH A;  4B47 A;  4CZZ A;  1T2K A;  2OC6 A;  2ESN A;  4V2G A;  2XF6 A;  3QYB A;  4KIG A;  2H27 A;  2HGC A;  3K0L A;  4FHT A;  5KAI C;  4IO9 F;  4A3I J;  4RMN A;  4F93 B;  1XDU A;  1B1B A;  4GYI A;  4XRM A;  2BHZ A;  2MBF A;  2FX0 A;  2LLK A;  3MWM A;  1ERD A;  2GIZ A;  4HST A;  2G7H A;  2KDZ A;  3LSG A;  4LK0 F;  2CU7 A;  2RRE A;  2O03 A;  3MVP A;  4UUT A;  1YJW I;  2P0W A;  1MBK A;  2ECB A;  4MTD A;  2R7S A;  4XRF A;  3CJQ B;  5FKM A;  1DGW Y;  1XGO A;  3CCM I;  4IOC F;  2DT7 B;  3WTW C;  5BPI A;  3M8E A;  4KDP A;  2IW5 A;  4PJ0 C;  1FSH A;  1VQM I;  1ZR4 A;  1WI9 A;  1FX7 A;  4AVP A;  4EAT A;  2LBF B;  1O7F A;  1QZZ A;  4ESB A;  3WTZ A;  2Y31 A;  4UVC A;  4XK4 A;  5IT3 A;  4BAC A;  4A0X A;  2K9N A;  4KFC A;  3BR5 A;  4BXF A;  2VKH A;  1IRZ A;  3P5J A;  4MQ9 F;  3HOT A;  1ENH A;  4MHG A;  1Z9C A;  1RRJ A;  4PFP A;  2JTV A;  3TW6 A;  1YO5 C;  4L9N A;  4CIC A;  2Y0M A;  3L2V A;  2QCO A;  3B6C A;  5LRS A;  3DBL B;  2DFI A;  3BPX A;  3OYD A;  3OSF A;  2EIL H;  4Q48 A;  2FD5 A;  5FLX K;  1IUF A;  1FNN A;  1JUS A;  2EK5 A;  4PFO A;  4AUX A;  1RET A;  1IG7 A;  2ICW G;  3H5A A;  2KQR A;  1FPQ A;  1SMT A;  2LTP A;  3VYU B;  1O3T A;  1XSV A;  3R0A A;  3KP6 A;  1EJ9 A;  1D5V A;  9ANT A;  1ORK A;  2DT5 A;  1Y1W J;  1FYM A;  3OYA A;  4IRI A;  2VT3 A;  1HF0 A;  5D6E A;  2BXY A;  2HQ5 A;  3FZV A;  3BWG A;  2A69 F;  2OJE D;  1YS7 A;  1V3F A;  4XLC A;  1UHM A;  2XV4 S;  3AFH A;  1M1E B;  3RIR A;  3W2W A;  2PLY A;  3CCR I;  1DPU A;  2KJC A;  1D8K A;  4IHV A;  1L0O C;  4BNC A;  3CDI A;  1BI3 A;  1WKM A;  5D5V B;  1FOW A;  2LVS A;  5EG0 A;  2R5Y B;  4UUV A;  1TTY A;  3HXL A;  4Y13 A;  3FHN A;  5E3M A;  3KX2 A;  2A6T A;  1CQT A;  1SAX A;  2XAQ A;  3G1L A;  3IRQ A;  3GBG A;  1U8R A;  2VQG A;  3BG3 A;  2EB7 A;  5FB2 A;  2KJB A;  4XLH A;  2CW7 A;  3C2H A;  4FT8 A;  2IGM A;  4L9J A;  2R7W A;  2NVQ J;  2STW A;  5ICC A;  2DTZ A;  4AC0 A;  2UXN A;  3A1Y A;  3F22 A;  2HPM A;  3CLO A;  2G9W A;  3OR2 C;  5M5Y J;  3KYL A;  1K6O A;  2RQQ A;  4RM3 A;  2VE8 A;  3FMQ A;  2P8T A;  1ZHF A;  1ON2 A;  4G12 A;  2R3S A;  5JFR A;  4M3F A;  3K70 C;  1U5T B;  3PQJ A;  3I54 A;  2LF8 A;  2BGC A;  4WXH A;  1CF7 B;  3ZP5 A;  2EH3 A;  2GA2 A;  2XDV A;  3NWS A;  2JQ7 A;  1AOY A;  2DFE A;  2XAU A;  2DA4 A;  2GXB A;  5DUI A;  2XSD C;  3D5R C;  1DGR M;  4J19 A;  3L1P A;  3KEY A;  1S29 A;  5JLX A;  3L2C A;  2PG4 A;  5BMZ A;  4I02 A;  2BV6 A;  3S15 J;  3G73 A;  2KRF A;  3JRD A;  2VKD A;  3S2H J;  1XD7 A;  4DZJ A;  3E0J B;  4CCL A;  1PUF A;  1TL8 A;  2HU9 A;  2K5C A;  2ZJR F;  3IH4 A;  1YJ9 I;  3KIO A;  1WZ2 A;  3SFZ A;  2LNB A;  3R0J A;  4MIM A;  3DU5 A;  1XB4 A;  2NYX A;  1LPQ A;  2QSH X;  3ELK A;  1HST A;  2HDC A;  1APL C;  3WGH A;  4KYW A;  2V7F A;  5J1Y A;  4FTH A;  4XKV A;  4ZDL A;  3CCU I;  4M73 A;  4A3C J;  4HW0 A;  1B8I A;  4EM0 B;  2AO9 A;  4A3K J;  1POG A;  2H8W A;  3IWZ A;  2EFP A;  6PAX A;  1MBH A;  3U21 A;  1C0W A;  1OQY A;  3CQZ J;  1WJF A;  4IRG A;  4IHX A;  4R79 A;  1G2H A;  2VXD A;  2X6X A;  1R00 A;  2CWE A;  3KCC A;  1JJ6 C;  3ERE D;  1ULY A;  3ZCO A;  2EV6 A;  1U9N A;  2HXO A;  1BR4 A;  5HLI A;  1Z6T A;  4ZDO A;  3QOP A;  4M6X A;  3F8N A;  2OCE A;  1Z6R A;  2CW8 A;  5IT9 K;  3LQR A;  3EPZ A;  5KAF C;  2L7F P;  4KT6 A;  3CUO A;  1MMS A;  1IN6 A;  2MA3 A;  3K2Z A;  2L2O A;  1X1B A;  4PSW A;  3I59 A;  3FWE A;  4G94 A;  2K9Q A;  2NNN A;  3K4M A;  1OCR H;  3HIF A;  5GTH C;  5L3D A;  2QWW A;  2IJL A;  1VQ6 I;  2MC4 A;  1TNT A;  3JRG A;  3PFY A;  2D1H A;  3BP8 A;  2K40 A;  3HJE A;  3P9C A;  3KYC B;  2ZME C;  4IPA A;  4A6D A;  5EJC A;  3S93 A;  3RPU A;  1UMQ A;  2RNJ A;  5F04 A;  4HQE A;  1ZG5 A;  1TWH J;  1ZG1 A;  2O8K A;  2O9L A;  1PDN C;  2WY7 Q;  3KZI C;  1WSU A;  2TCT A;  5D5W B;  2IA1 A;  1PYV A;  4XLN F;  4BYY A;  1E3O C;  3MQ0 A;  1TLH B;  1GLN A;  1X1C A;  2P5K A;  3DWL E;  2PMZ A;  1LB2 A;  1B72 A;  2VJI A;  5TIS C;  3GF2 A;  4YEL A;  5C4J J;  1FWZ A;  3CDL A;  1QRY A;  4N4N B;  4E7I A;  4BEH B;  4D1Q A;  4YFX F;  2HDD A;  3FDY A;  2O0Y A;  4N0B A;  2O5R A;  1MMG A;  2RDP A;  4IQ4 A;  3QPH A;  2DDA A;  4G6D A;  4ITV A;  1B59 A;  1X2M A;  1OYY A;  1FP2 A;  1X58 A;  1UHW A;  4ZTJ A;  2YR2 A;  3IUO A;  3OS1 A;  1IXR C;  3HRM A;  3KLO A;  1LFU P;  4B3A A;  1MW7 A;  2JSP A;  2M4G A;  4QLC U;  1WCM J;  1GVD A;  5JHF A;  2K27 A;  1IJW C;  5F0H A;  2BY3 A;  3CTA A;  5CKT A;  5E20 A;  2IS6 A;  4KUM A;  3GTK J;  1HDD C;  4A0Z A;  4XM3 A;  2EIJ H;  5DS9 A;  1OIS A;  1OKR A;  2W1O A;  3KP4 A;  3UNG C;  3OYH A;  4EJV A;  1QO0 D;  1QPM A;  2VI6 A;  2GWR A;  4BHP A;  1WJA A;  2X6O A;  5EG0 B;  2OBP A;  1H9G A;  3BG9 A;  5EEG A;  3DTK A;  4D7M A;  4Y4R A;  1HKQ A;  2VQC A;  3ZMD A;  3RJP A;  4LFU A;  3TGN A;  3QPT A;  4XKC A;  2WWY A;  2VE9 A;  4OIP F;  2BZT A;  5DDG A;  5H20 A;  4MLO A;  1E3P A;  3FXO A;  1E3H A;  5HOO A;  1TWG J;  3LAP A;  4EJU A;  3MAJ A;  1WRJ A;  3VB2 A;  2PEX A;  4ESF A;  1R71 A;  3ZQC A;  5E3L A;  3J80 Z;  2CQ7 A;  1H0M A;  2W57 A;  1TBX A;  4W97 A;  4GRI A;  3WTU C;  3TP0 A;  1AWC A;  4ENK A;  5HDK A;  4NDL A;  4AIH A;  4OOI A;  1IDZ A;  1L3L A;  4O5V A;  1W5C C;  3HKZ A;  5ED4 A;  3OY9 A;  3AAF A;  2QBY A;  1X3Z B;  5FKO A;  4PJN A;  3DV8 A;  3F3X A;  1FSE A;  4FCY A;  4ZYG A;  5D4R A;  1H9T A;  4LJZ F;  4AYB A;  4E4H A;  5GPC A;  1TT0 A;  1Q1H A;  3C1D A;  5IP9 J;  2IS1 A;  4N4O B;  4DYQ A;  3MZ8 A;  3P9K A;  2CSO A;  1MIJ A;  3L09 A;  5K5O A;  1J75 A;  2L9R A;  5DYM A;  3F23 A;  2JVH A;  2QQA A;  4PDK A;  3GZ6 A;  2F6C A;  2HDW A;  5K7H A;  3K6G A;  1T0F C;  2GA1 A;  2Y48 A;  3B02 A;  4QIW N;  1HQC A;  4ABZ A;  2LD5 A;  3FHZ A;  4UNO A;  1DU6 A;  3DPU A;  1VQ9 I;  3PSF A;  1SVM A;  1W0U A;  3ZQ7 A;  2DU9 A;  4S04 A;  2M9H A;  1PUF B;  1VQ8 I;  4U7B A;  1XMK A;  1VQ7 I;  1R4N B;  3KP3 A;  1XGN A;  1IO2 A;  1X1A A;  1ZR2 A;  2HOA A;  1AA7 A;  1Y56 A;  4WXD A;  3BG6 A;  5CLS A;  2F4O B;  4BH9 A;  1WWX A;  2DPD A;  1G4D A;  4H4K C;  4LD5 A;  2PBI A;  3BC8 A;  5D8K B;  5L3B A;  4CYD A;  3ZQG A;  4ENM A;  2CV0 A;  2LP0 A;  1FOK A;  1ONV A;  2XIG A;  5LEK A;  2DYS H;  1XTA A;  1DDN A;  1P9Q C;  1WGX A;  3HYI A;  4MGR A;  5FKL A;  1N75 A;  2L9N A;  3KZZ A;  2FE3 A;  4J01 A;  4XSX F;  3OYE A;  3RQ4 A;  5J3L A;  3BY6 A;  3JTG A;  2KRH A;  1W7P B;  2P6T A;  2GXG A;  1HLV A;  1ZH5 A;  5EEH A;  5TRD A;  3P7N A;  2D45 A;  3ASN H;  2Y9Z A;  1WJB A;  2VBW A;  3OL3 A;  4L9T A;  2WV1 A;  2XRL A;  3E5Q A;  5B5E C;  1U2W A;  3WTT C;  2CRG A;  1FIP A;  3OYN A; 
#chains in the Genus database with same CATH homology
 4A3M J;  2ELK A;  5IYC J;  2IBD A;  4X1E A;  1QVT A;  5IP6 A;  3Q0U A;  1ETQ A;  1UG2 A;  1UHS A;  1GV2 A;  2I10 A;  1ETO A;  3Q3S A;  1U8B A;  1RES A;  5FLV A;  2EZK A;  2XPU A;  4QTR A;  3OOU A;  3LSP A;  1JKO C;  3BT9 A;  3FIS A;  4FE7 A;  2E19 A;  4D7N A;  1WH5 A;  4S0H B;  3O8H A;  1FJL A;  1MSE C;  1SAN A;  3GTG J;  4A69 C;  2EZH A;  2WB1 N;  3BR1 A;  5J1R A;  3BTC A;  5IYD J;  5EZH A;  1FEX A;  3A01 A;  4V2G A;  1ETY A;  1OCT C;  4JX6 A;  5IYB J;  1MBE A;  5FJ8 J;  5DTD A;  5IPA A;  2CJJ A;  1B72 B;  4A3I J;  2R7Z J;  2PMZ N;  5EGO B;  4C3H J;  4XRM A;  2FX0 A;  2LLK A;  5F27 A;  4BKX A;  3G1M A;  2KDZ A;  1QVU A;  2XGD A;  3S1Q J;  4DYR A;  3LSG A;  1TC3 C;  2EZL A;  5F0C A;  5IOZ A;  2CU7 A;  3MVP A;  4UUT A;  3D1N I;  2LY9 A;  5EZG A;  1NK2 P;  1MBK A;  1FIA A;  2ECB A;  1VF9 A;  2CUF A;  2ME6 A;  3RZD J;  3PO2 J;  5FKM A;  2XPW A;  5E3N A;  3GTP J;  1JUP A;  1YRN A;  1RKW A;  2E2H J;  1ZR4 A;  1HOM A;  1JT0 A;  2NVT J;  2L7Z A;  1VI0 A;  4M3G A;  4W1U A;  4LOC A;  3HOX J;  3BQY A;  3BR3 A;  5FLM J;  1Q1V A;  2Y31 A;  4JX4 A;  4XK4 A;  2XGC A;  2M2E A;  2FQ4 A;  2ME0 A;  3SFI A;  2E2J J;  2K9N A;  2GM4 A;  1MH4 A;  3BR5 A;  1IRZ A;  3VPR A;  1X2N A;  1ENH A;  1MSF C;  3TW6 A;  3TED A;  3I4M J;  2QCO A;  3B6C A;  3B6A A;  2E1O A;  3E7L A;  3S14 J;  2CUE A;  4DYC A;  4A3L J;  2X9D A;  3OSF A;  1AHD P;  1S7E A;  2FD5 A;  4A3E J;  1IUF A;  1JUS A;  1R9T J;  3GTO J;  4AUX A;  1RET A;  2MSY A;  1IG7 A;  1WI3 A;  1FTT A;  3M4O J;  2LTP A;  2DJN A;  5M5X J;  3S2D J;  4D5C A;  2R0Q C;  4BY7 J;  9ANT A;  3HOV J;  1ORK A;  1Y1W J;  1HF0 A;  1B8I B;  2DMU A;  1JKP C;  3HKZ N;  2HQ5 A;  3Q0V A;  2NVX J;  2VPR A;  1Z77 A;  3LSJ A;  4XRS G;  5FKN A;  2DA6 A;  4B4C A;  4BBR J;  2XPV A;  3JRF A;  4AYB N;  1GT0 C;  1U9O A;  4IHV A;  3SDG A;  3IH3 A;  3JR9 A;  4CYC B;  3WHC A;  4UUS B;  2JA6 J;  5M5W J;  2LVS A;  5EG0 A;  2R5Y B;  1MH3 A;  1GV5 A;  2GBY A;  2Y9Y A;  3HGG A;  2YU9 J;  2COB A;  5GPA A;  3SJM A;  2DA2 A;  1K61 A;  2R92 J;  5E3M A;  2OPT A;  2GLO A;  3RQI A;  3A02 A;  2MGQ A;  3JRB A;  1CQT A;  3UKG A;  3G1L A;  4A3F J;  3OIO A;  3GBG A;  2XGE A;  1ZGW A;  2E2I J;  3BG3 A;  5EGO A;  1IV6 A;  3GTM J;  1A6I A;  3S1R J;  2EQR A;  2NVQ J;  4BY1 J;  2R5Z B;  3HEF A;  3BG5 A;  2DTZ A;  4AC0 A;  1P7J A;  1D5Y A;  4A3G J;  4DW6 A;  2DMN A;  3IV5 A;  1P7I A;  5M5Y J;  1XS9 A;  3S17 J;  2AHQ A;  4BXX J;  5E3O A;  4XIC A;  2JN6 A;  3ZQI A;  1ZQ3 P;  4G12 A;  3C2B A;  4M3F A;  1GDT A;  1EF4 A;  2NOG A;  1JUM A;  3FKI J;  2HOT A;  2DA1 A;  4C2M J;  4IEJ A;  5M3M J;  3JRC A;  2EH3 A;  2DN0 A;  3GTL J;  2FJ1 A;  5C4X J;  1W0T A;  2CQQ A;  1RKT A;  2DA4 A;  2XSD C;  3OSG A;  4J19 A;  3L1P A;  1NK3 P;  2X48 A;  5GP9 A;  5JLX A;  2DA5 A;  3LNQ A;  5BNG A;  3S15 J;  2MW8 A;  4FE4 A;  3JRD A;  3BQZ A;  3S2H J;  2H8R A;  4DZJ A;  1PUF A;  3WHB A;  3O8G A;  1IDY A;  2LFB A;  3BR2 A;  1MNM C;  3IH4 A;  4RBO A;  3A03 A;  3BR0 A;  4B1R A;  3PO3 J;  1BW6 A;  3ZQH A;  3DCF A;  4MIM A;  4I76 A;  1O4X A;  2D5V A;  3F0C A;  3FK7 A;  3S1N J;  1APL C;  4M3E A;  3NAU A;  5J1Y A;  2H1K A;  2IAI A;  3G1O A;  4FTH A;  3K2A A;  4A3C J;  1LFB A;  1B8I A;  1H88 C;  3A01 B;  1XC5 A;  3W6V A;  3LSR A;  1HCR A;  2AO9 A;  1TWA J;  5EEA A;  1POG A;  4A3K J;  2DMP A;  2NS7 A;  3JRI A;  3JRH A;  2DA3 A;  3LOC A;  3CMY A;  1JKR C;  2LKX A;  1MBH A;  2K9S A;  3CQZ J;  4IHX A;  1G2H A;  1JJ6 C;  4JYK A;  2JJ7 A;  1IC8 A;  1U9N A;  2ID3 A;  4CYC A;  4UUS A;  2HXO A;  3HOW J;  3QPS A;  2KT0 A;  3ZQF A;  2R5Y A;  3IH2 A;  3HOY J;  1JKQ C;  2JA7 J;  1XG1 A;  4C3I J;  1ETW A;  4FIS A;  2HI3 A;  2JWT A;  2L7F P;  4I6Z A;  3CCY A;  1LE8 B;  1ZTR A;  2L7M P;  3RKQ A;  2K9Q A;  4HNV A;  3FIW A;  2R5Z A;  5C3E J;  3HDD A;  4EEF G;  2M34 A;  3JRG A;  3ZOB A;  1JGG A;  2K40 A;  3BR6 A;  2O7O A;  5EF6 A;  1I3Q J;  1HDP A;  2VUM J;  1ETV A;  1UMQ A;  5K7F A;  5F04 A;  1TWH J;  2O8K A;  2O9L A;  4JP0 A;  3JRE A;  1GUU A;  4M6V A;  2TCT A;  2YS9 A;  1H89 C;  5IOY A;  2XB0 X;  4M3D A;  1ZKG A;  1E3O C;  3HM5 A;  1MBF A;  2HXI A;  1B72 A;  1AU7 A;  4X6A J;  1WH7 A;  2NS8 A;  5C4J J;  2JA5 J;  1AKH B;  3HOU J;  2EBI A;  1QRY A;  3CDL A;  4A3B J;  5EYR A;  4XID A;  1Z0X A;  2ECC A;  1DU0 A;  3H3V K;  1A5J A;  2HDD A;  2DA7 A;  4XRS A;  3BTL A;  2DMT A;  2B63 J;  4IHY A;  3GTJ J;  2L0K A;  5JLW A;  2OF7 A;  5HOD A;  1X2M A;  1X58 A;  2P81 A;  3M3Y J;  5K7Z A;  3MN2 A;  3HBL A;  4V2F A;  1LFU P;  4B3A A;  1WPK A;  1OJL A;  1TWC J;  4Y7N J;  2CQX A;  1JJ8 C;  1WCM J;  1GVD A;  2VKV A;  1IJW C;  5F0H A;  2G0E A;  3S16 J;  3GTK J;  1HDD C;  1BL0 A;  5DS9 A;  4BBS J;  5F1J A;  1SFO J;  2R93 J;  1Y1V J;  2VI6 A;  1MBJ A;  2X6O A;  1NTC A;  5F08 A;  1ZK8 A;  5J1U A;  5EG0 B;  3DEW A;  4D7M A;  3BG9 A;  1VFC A;  3K7A J;  4L5E A;  3BTJ A;  5M3F J;  3ZQL A;  5C44 J;  5FKK A;  1H8A C;  3HOZ J;  1T56 A;  4MLO A;  1OFC X;  1TWG J;  4DZP A;  3FK6 A;  3ZQC A;  5E3L A;  1RPW A;  4JX5 A;  3JRA A;  2DMQ A;  1JTY A;  2YUS A;  4W97 A;  4C3J J;  2M8G X;  3TP0 A;  2N8G A;  4IHW A;  1FTZ A;  1U78 A;  4NDL A;  2IEK A;  1IDZ A;  4MO7 A;  2ID6 A;  2M0C A;  2XB5 A;  1RR7 A;  4Y52 J;  2LK2 A;  2Y2Z A;  5FKO A;  1VND A;  1JT6 A;  4D5F A;  1LE8 A;  4FCY A;  1F43 A;  3I4N J;  5GPC A;  2WAQ N;  5IP9 J;  4MFD A;  3BTI A;  4DYQ A;  1I6H J;  3QQA A;  2L9R A;  3TW7 A;  2W48 A;  2RAE A;  2VKE A;  5K7H A;  3RZO J;  4QIW N;  3Q0W A;  1MBG A;  3NAR A;  3H0G J;  4ABZ A;  2LD5 A;  1DU6 A;  2LR8 A;  1W0U A;  1I50 J;  2ZB9 A;  1PUF B;  2M9H A;  5EDN A;  4RDU A;  2TRT A;  3S1M J;  1YRN B;  4A3J J;  1ETK A;  4MFE A;  1BJZ A;  2JA8 J;  1AKH A;  1ZR2 A;  2HOA A;  4A93 J;  1JTX A;  2JMW A;  1OCP A;  4M3B A;  3QPL A;  2Y0S N;  1BW5 A;  2Y30 A;  1ETX A;  3GTQ J;  1F36 A;  2JK3 A;  3ZQG A;  2QF7 A;  1IGN A;  2LP0 A;  4A3D J;  2EZI A;  3HB9 A;  2HYJ A;  1K83 J;  1TWF J;  1WGX A;  5FKL A;  1BA5 A;  3HGY A;  1T33 A;  2MG4 A;  3PM1 A;  2NVY J;  5J3L A;  1HLV A;  5IP7 J;  3TP3 A;  2Y9Z A;  2HOS A;  2WV1 A;  2XRL A;  5F0F A;  1QPI A;  1ITY A;  4GFB A;  4QSH A;  3MKL A;  2CRG A;  1FIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...