4N4NB

Nitrosomonas europea hao
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
SLAPISAKDMLDYLACKDKKPTDVVKSHTEVENGKIVRVKCGDIVALVQKAREQSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxylamine oxidoreductase
publication title Structural Basis of Biological NO Generation by Octaheme Oxidoreductases.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 12
structure length 56
sequence length 56
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2013-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4n4nB00
4FASD 4N4NB 4N4OB
chains in the Genus database with same CATH superfamily
4I98B 4XLEA 2CQXA 3GTJJ 5IT9Z 1Z05A 5EDNA 3RKQA 2E7WA 1RIOH 1JHHA 1JKQC 4BY1J 3BWGA 5FKLA 1A04A 4PZJA 3WTZA 3C7JA 3GTPJ 2DQLA 2ZC2A 2VOPA 1MBEA 2KIFA 2LF8A 2M8GX 5E79C 4V19K 1SVMA 1B72B 2HQ5A 2W25A 2L4AA 1QHHD 2FMYA 1JGGA 3RIRA 1UZCA 3JREA 4KT5C 4FX0A 4MQVA 2GQQA 5JI6A 3MVPA 1D0XA 1P4AA 2W1OA 5K7HA 2VKEA 1JJ6C 2AO9A 1HDPA 2XKPA 3V8KA 2WADA 2V9VA 3F8MA 1G59A 2HTSA 1LVKA 4H0EA 4V2GA 3CC4I 3J80K 2K02A 1G8XA 2FMLA 2O03A 3MFKA 4XM3A 1OMIA 3COAC 5HLIA 3ZQQA 3C3WA 3F6VA 4ABZA 2DOEA 2QZ8A 1DUXC 3B6CA 1K61A 1IC8A 4XL9A 1U5TA 2L7ZA 3BC8A 1YRNA 1BI2A 3H92A 4YFXF 5L3GA 2NS0A 2L7FP 2LOOA 3H5AA 4OMYA 2WA0A 3GCMA 3OOPA 1YX3A 3ZOBA 3HHHA 2W84A 1TP4A 2A69F 1XGSA 1DQUA 1P4XA 4G94A 3BR1A 4U87A 3EUHA 1FIPA 4FHTA 3M4OJ 5CVJA 2GBYA 4PJ0C 4S05A 1T2KA 1XDSA 3X2QH 5EZGA 4W97A 4UXNA 4O3MA 3OS0A 3FXJA 3J7YJ 2DDAA 4KA4A 2Z1DA 4M3DA 1YW8A 3ZGKA 1EF4A 2KIMA 2IS2A 5DUIA 3TL4X 1MKMA 4S04A 4XORA 3TGNA 5KCMA 1BM9A 3MCZA 4PJLA 3S16J 2EZHA 2R7OA 3SJMA 1W4MA 4EJUA 5H6QA 3WTSC 1TNTA 2DQRA 2IVMA 3K1MA 5EF6A 1U5TB 2CSOA 3QOPA 3OSFA 1H8AC 1TC3C 1YRNB 5J8FA 2ZXJA 3C2GA 1Y39A 1T0FC 3IP4B 1W0TA 2Y0SA 4M71A 5FKMA 1ORKA 1B9NA 4II3A 4BDZA 1KGSA 2XROA 4PSWA 2XAUA 5M5WJ 1BR2A 3GZ6A 1GV2A 5E3LA 3ZR8X 4ETSA 4C9YA 2V26A 4ESBA 2QENA 1WI9A 4A69C 3ZQHA 3HGYA 1MNDA 2VPLA 1ZRDA 4HNTA 3GWZA 4UHTA 2L0KA 3EUKL 4BXXJ 4IEJA 4D1QA 3OYNA 1XSVA 4L5IA 3CCYA 3L2WA 2A68F 4XKCA 3DCFA 4M6VA 4UV8A 1GXQA 2DODA 4F92B 1PUEE 4DIQA 4FE7A 3LSRA 4MEXF 2BXZA 1R4NB 3S1MJ 3RZOJ 1R5GA 3HYIA 3F23A 3BROA 3WTVC 1S3JA 3K7AJ 4WXHA 4J19A 5LEKA 4DJAA 3OYGA 1O3TA 2MA3A 2ELHA 5GAGJ 3ZN0A 2LH9A 3E7LA 2DFFA 3RPQA 4BKXA 3CLQA 3P7NA 1OISA 2RQQA 5JLWA 2KPMA 4IHVA 1MBHA 4IPAA 1USTA 4II2A 4RGSA 2M5WA 1A6IA 4M6YA 1XMXA 1BR1A 1C0WA 1G3YA 2BOLA 4AIDA 1SANA 2G7HA 1B9MA 2O8XA 3HIFA 2IP2A 1O3SA 4LG3A 1FBQA 2JQ7A 2K27A 1SAUA 2K5CA 3DPUA 3ULQB 2HZTA 2LF7A 2E1MB 3AL0C 1MD0A 5EGOA 1OR7A 1ZGJA 2MC3A 2QUFA 3ZMUA 2R0QC 2L54A 1WGXA 2OUMA 2IS1A 3HB9A 2EZIA 3HXLA 3TW7A 4HSTA 5K1YA 3OYKA 4UUSA 1MH3A 1JTXA 3K4MA 2KIUA 3ZPLA 2VQGA 3L7WA 3OSGA 2EFWA 1Y8RB 4R79A 5FKNA 1LFUP 4G12A 4QLCU 5HNHA 4YFNF 3WODF 1PDNC 2ZBKA 4PJJA 3GX4X 4I02A 4X6AJ 1TL8A 1MIJA 3E6MA 4PFOA 3RQ4A 1ZGAA 3M1EA 2KP6A 1KU2A 1JUMA 5JHUA 2EFQA 3OR2C 1VTNC 4UY8I 1VQ4I 1ETOA 2NVYJ 2NS8A 4ITVA 1FTZA 2D2WA 3HC7A 1QO0D 4BS9A 2FE3A 5KHDA 1T39A 1BI3A 4IHSA 3Q9VA 5LBQA 2QQAA 5DUKA 1P7JA 1X2MA 2E2HJ 5HDNA 1FX7A 2PEXA 3SDGA 4ZYAA 3I64A 2QEXI 4GFBA 1PUFA 3ZRGA 4LK1F 3QAHA 1MMNA 3ABMH 2KLOA 3JRHA 2L02A 3W6KB 1IJWC 3JAMZ 2E2IJ 3BP8A 3V7RA 5EGOB 1O3RA 3H5NA 4EM1A 4N0BA 5EEHA 2DYRH 2LK2A 3CLOA 4RM2A 4HZFA 1R5ID 2K9QA 5B1AH 3S2WA 2FUG2 2PBIA 4XBFA 4BHPA 2ZB9A 1QZZA 3WTXC 3CESA 3CDHA 3OY9A 2B63J 3OMYA 4GRIA 1DPUA 3DKWA 2KISA 3OWTA 1HQCA 1ACIA 1IDZA 4J01A 4A3BJ 2DI3A 4ENMA 2IEKA 5M5XJ 2MLKA 3V7SA 1BC8C 4A0ZA 1V4RA 3K2AA 4B09A 2RREA 5IPAA 5EG0A 4A2UA 4BJTA 2QYOA 2LREA 5DD8A 4BH9A 3N05A 2CGPA 2EBIA 4DYQA 2Q1ZB 4JX5A 3RPUD 2UUZA 3QYBA 2O5RA 3VFZA 1U8RA 3HZJA 5E18F 4Q4ZF 3LAJA 1X3WB 1L0OC 4OOIA 3ZMZA 2W00A 1XD7A 2RC4A 4CSWA 4G7HF 2HOEA 3HSRA 2R4GA 4IF4A 4MFDA 1SFUA 3REOA 2E2JJ 1PUFB 4BHBA 2YSRA 1ZLJA 4WF2A 1XGOA 1YITI 3HPGA 2HXOA 2ACJA 3DEUA 1EKEA 1OCRH 4PUSA 1IV8A 1IAWA 4KDPA 3V8LA 4EGYA 4EV0A 2ESNA 1S9HA 2JA7J 3TW6A 3QQAA 1XX5A 2NS7A 3IL2A 2A07F 4AYBN 3CJTB 3ZMSA 3NAUA 2IW5A 1G3SA 1PJRA 4UVCA 2WAEA 2L9NA 1N75A 2GWRA 1HW2A 3LL7A 3HGGA 2HFHA 5AIPA 4JK1X 1TQIA 3GUDA 1R00A 1FYLA 2HU9A 2EPFA 3KYDB 2VJJA 3HL2A 1J59A 1HOMA 4AU7A 3ZQIA 5FKKA 1R1TA 4EJOA 2KKOA 5ERIA 4KNYA 2KDZA 3B6AA 2FOKA 1KQ0A 4I7HA 1W0UA 1IUFA 2GA1A 3R0JA 4JOMA 3WGHA 1KQ9A 4XQFA 4RB1A 4RM3A 1S6LA 3V8JA 4PK4A 3TP3A 4LITA 5HNFA 2P5LC 1JJ8C 4CYCA 2QSGX 4RAGA 3E1SA 1YJWI 3WE2A 2EV0A 4AIHA 2VXDA 2P81A 3HBLA 1KU3A 1A35A 3QRFF 3W6JB 1DDNA 5K7FA 1EH7A 3PUFA 4A12A 5LLQA 1FOYA 2IGNA 4RGRA 4OAZA 2M34A 5KK1A 5DYMA 3S1QJ 1RKTA 2V9PA 3HTSB 5F64A 2DA1A 1BL0A 5D5VB 2JA2A 3LWFA 2E7XA 3WU1B 4LK0F 2YUSA 2NVXJ 3LSJA 1NK2P 4HNVA 1CF7A 2XPVA 3QPTA 5FROA 4HF0A 3GVAA 6PAXA 2IGMA 4E7LA 2ZFWA 4IJAA 3VB2A 3FBIB 3S32A 4OIQF 4B44A 5GTIC 5JHFA 2EINH 3QODA 1FPQA 3L9FA 4Y17A 2OC6A 1T6SA 4GYIA 3MZHA 1QGPA 3BG5A 1ETQA 2LVSA 4XOTA 4HSRA 1SEUA 1DU6A 5HODA 3BDDA 2CQKA 4XLFA 4RB3C 2OCCH 4U0WA 4Y7NJ 2XGCA 1BW5A 1XCVA 5KNLA 2ISZA 2XDVA 3DEEA 1T95A 2VKHA 4CYCB 1MBGA 2ZCWA 1FZPB 1J0RA 1G3WA 2JJ7A 5FLXZ 4UB8C 2E34A 2E60A 1D0YA 4JP0A 4QPOA 4CDGA 4Y3OA 3P5JA 4KIFA 3JCUC 2J5PA 3HRMA 4MFEA 4QIWN 4MEYF 2FBHA 2KRHA 3TEDA 3H3VK 3C2BA 4LLGF 1S5LC 4G7ZF 3HKZA 1F36A 1FSEA 3MMYB 5H20A 3UNGC 2FJ1A 2Y31A 4XN3A 1V3FA 1BA5A 4A5MA 4UUVA 3SQNA 3PNTA 5IYDJ 2Q8KA 3CCMI 1D3YA 3HRUA 2R7FA 1CF7B 1I3QJ 1TZLA 3TO7A 5DS9A 3TBIA 1UG0A 3G3ZA 4A3CJ 4LB6B 2BY0A 1FC3A 4HF2A 2P0WA 4XLAA 5CPRB 1XN7A 2V1XA 4EMSA 3M07A 1UG2A 4WK8F 4KUMA 1FOXA 1HBXG 4JYKA 4U0YA 3G1LA 1QVTA 2I10A 2ZSIB 4XKVA 3HOVJ 3NWTA 4NDLA 3JRGA 1MZBA 2Q0OA 4JX6A 4P55A 5BPIA 1V55H 5LGNA 1TWCJ 2Y75A 1E3OC 3R4KA 5ILSA 2X0LA 1Z1DA 1I39A 2KQRA 3JR9A 2L9VA 2Z16A 2AXTC 1XGMA 3FMSA 3KEOA 1RZ4A 3J7AO 4RLFA 3TO9A 4CZZA 4IX7A 4C3JJ 4Q48A 3MZYA 3TQNA 2IRFG 2CFOA 2XGEA 3OV8A 5FD5A 3N4MA 4OIRF 1R49A 5J40A 2L4MA 1VQKI 5GPCA 5L3EA 2R7QA 5J1RA 2MD0A 4C30A 1VF9A 4RDUA 3ZQLA 4UB6C 3C1DA 3E6BA 3I54A 3EETA 4JQFA 2HZDA 3R61A 1IDYA 2DOAA 3IC7A 4Y33A 1EJ9A 4FISA 1K4TA 4CHUA 3LNQA 2CMPA 4PCQA 5E1XA 1WCMJ 1I1GA 3BR6A 1HXDA 2Y48A 3OYAA 1WQ2A 2V1UA 5IP6A 2VJIA 1ULYA 3E5XA 3FBNB 2BEOA 2EILH 3FXQA 4KICA 4XRFA 1K83J 2EFNA 3CCUI 1RI7A 4L5JA 3G71I 4ZYDA 4BNCA 1RPWA 4I2OA 1J5YA 1ZARA 4LFUA 4N9IA 3ZMDA 2O0YA 3I71A 3Q0UA 1MW7A 3SZGA 2CQQA 4AD9A 4IRGA 2L2OA 3S3NA 4XSXF 2XAJA 3U1KA 3RJPA 1NK3P 2NNYA 2NVTJ 3K4NA 1YG2A 2RAEA 1ZG5A 2E1CA 1BOBA 1S29A 2VIXA 4B8XA 3GFIA 3G1MA 1B72A 1VQNI 2ZO4A 5DV5A 4MHGA 2R5YB 2O8KA 1U6GA 2VL8A 3HM5A 3T0YA 3F8BA 3J81Z 2VOOA 4RA2A 4NQWA 3OIQA 2STTA 2YR2A 4WWCA 1DP3A 2I8DA 2JRTA 4M9SA 3L2UA 1OKRA 3ZQFA 2R92J 2OU2A 4JX4A 3HOSA 1KU7A 3A0BC 1SVLA 1S7EA 1ZN2A 2O61A 4LG0A 2ZMEA 4HLYA 3IRRA 1XTAA 4RGUA 4B48A 2C6YA 4A3IJ 1O7LA 4EATA 1YW9A 5TRDA 4LLNA 4F93B 2IAIA 3BJ6A 2L3DA 3NQOA 3RSNA 1SD5A 2XGDA 4N4NB 4GDFA 3BG3A 1SMYF 1LDJA 1TNSA 3I56I 1VI0A 4D7MA 2MD5A 3ECHA 1ZG1A 2QGUA 2X48A 3M8JA 2MABA 4KN4X 2D5VA 2FD5A 2HI3A 4PJMA 3UKGA 4DW6A 2P4WA 2W57A 1B8IA 3JSPA 5LEJA 1LDKB 2IS4A 2ETHA 3AKZA 2VPRA 4P9UA 3PO2J 1TWGJ 3CJQB 4B3AA 4L5EA 5DM7F 5D5XB 2CO5A 4HW0A 3QYEA 2KZGA 4FQGA 3KP7A 5IT9K 3VYUB 3IHUA 2M9HA 2DK8A 4NQWB 4KIGA 3L2QA 2EZKA 1F1ZA 4NUBA 1IRZA 2DBBA 1MH4A 1GXPA 2DPUA 4XSZF 3QPHA 3OIPA 2DK5A 1QNTA 2M87A 3R60A 4MIMA 2DA7A 2JA5J 3I4NJ 2EZLA 4BJ6C 4ANJA 1YIJI 3T8TA 2LFBA 4LG0B 2ZMEB 1JTYA 5IT3A 4HV5A 3MWMA 4B47A 5EEAA 2KFDA 3RZDJ 1JGSA 3BR5A 4YELA 2KZVA 2BW3A 2OA4A 3R6SA 2GLOA 4EJTA 3HRTA 2PMZN 3IH2A 1IV6A 1J2XA 3CQZJ 1D8KA 2JPCA 3CP2A 4XICA 3OYEA 1WH5A 3VPRA 3MD2A 5HS8A 2DFHA 4NB5A 1D1AA 3QP5A 1RR8C 1B8IB 3DWLE 1Z3XA 2ECCA 2QWWA 2XAHA 4YIFA 1ETXA 4IQJA 4KJZA 3LA7A 2ELKA 3TO6A 2R7ZJ 2MG4A 2IGOA 4HLXA 3GZ5A 3L1PA 3FHZA 2WC2A 3QPLA 3VODA 2XAQA 4DZJA 1RETA 3RQIA 2UXNA 1IG7A 1ZK8A 2A5YB 2VJ4A 1JT0A 2JZYA 1TBXA 2K40A 4S0HB 3S1RJ 1DP7P 4ON0A 5F1JA 3NWSA 5L3FA 3SEZA 4F3QA 1X3ZB 5CVIA 2Y0SN 1KONA 1YHQI 2W4SA 4PFPA 4BXFA 2XRLA 4XKBA 1Y6IA 4IKFA 3RI4A 4M73A 4AM3A 3G4SI 2PFBA 4NC7A 3D1NI 3E97A 2V6EA 2ME0A 3EYYA 4IL6C 4B4CA 1VQ5I 4Y15A 2KHMA 1IN4A 2DOFA 2PI0A 5J8CA 1VQ6I 2BW3B 1L3LA 3TDUC 3R0AA 3CCQI 3OS2A 2BHZA 2DT6A 1MNMC 1WZ2A 3LFUA 4I99C 1H88C 1X3UA 2VUMJ 5JLXA 4UVAA 4QPQA 3DEWA 2CJJA 1KYWA 3HRSA 1BR4A 2DT7B 3A02A 4UV9A 4O5VA 1HF0A 1SFEA 1FEXA 1KYZA 1Z91A 2NOGA 3S8PA 5FGMA 5DDGA 2DXIA 1SMTA 1XB4A 3BTIA 3KP5A 4XRSA 1MJ9A 3BG6A 1T0FA 5F0HA 2XVCA 2BGCA 2F6CA 2Q2EA 1Y8QB 3L00A 2VXZA 3SDBA 4BL0B 3N97A 4BBRJ 1XSDA 1OCCH 3A2KA 1HA8A 3GXOA 5A2QZ 5E3OA 3CCRI 1UB9A 2MGQA 4BAYA 2E19A 1V54H 2CQNA 4C2UA 2YU3A 3KEYA 2CQ7A 4MO7A 4KFCA 3I4PA 3HPHA 1LPQA 2FBKA 4UUTA 2FRHA 3ERMA 3H0GJ 3LA2A 1RNLA 2VJ5A 4E7HA 2P7CB 1YE9A 1VZ0A 2F4OB 2X9DA 3OYJA 2MW8A 3OOUA 4RB2C 1O57A 4WXCA 2GXBA 2GIVA 3HOUJ 1FY7A 2VE8A 3AG3H 1RR7A 2ZFUA 2V1NA 1YTYA 4A6DA 1ENHA 1T08B 2JMWA 2A6EF 2W24A 5GTHC 3F3XA 2BHYA 3K4KA 2DAOA 2NVUB 4BQNA 3CCJI 1WHUA 2FU4A 2GM4A 1GVJA 2HWVA 2Z3YA 5J6XA 2HS5A 2ME6A 4YIRX 3BJOA 3GLXA 4H4KC 2CV2A 2R7UA 4QWQA 3GTKJ 4EVIA 5LD2C 3BT9A 3GO5A 1R1UA 1W1WE 2IGKA 4HQMA 3CC2I 2CUEA 5JVTA 3HEFA 4BJ5C 4LMYA 4E6KG 1SD6A 2F5CA 4A3LJ 3SXYA 3DFGA 2Q2EB 3EQLF 2M30A 3TOAA 5D8KB 5HLHA 2DN0A 3M7GA 2DO7A 5CKTA 1WJCA 2ADUA 1JHFA 4M3GA 2ZJPF 3LAPA 2B0LA 2H1LA 4A3MJ 1APLC 5FJ8J 2MFZA 3PSIA 2A6TA 2CW0F 2ZXHA 3CCSI 3HOWJ 1W7PD 3KYCB 2V6CA 2DYSH 2ZNYA 2VE9A 2RNJA 1MNEA 2H6CA 4ZDPA 4HYEA 1CQTA 3MQ0A 1QHGA 1ETYA 3KP2A 1FBSA 2P6TA 3BJAA 3WGGA 4Y13A 2H27A 2K9SA 3I59A 4E70A 3K4CA 5LHIA 4DBRA 2BXYA 4G6QA 4N9HA 3F8CA 3ML6A 3QPSA 2XUBA 3FHNA 3HDDA 3DKXA 4PGGA 5CQGA 3IV5A 3PIPF 1O7FA 2QA4I 4CICA 1T38A 2IPQX 2OAZA 1G4DA 1VNDA 1E17A 3ABTA 2BY2A 2EH3A 1YS7A 4ZYEA 2LMDA 3VYTB 1VQOI 2HYFA 1MMDA 5JR3A 2WAQA 3U21A 1XMKA 3DU5A 4CA0A 1JXSA 1XGNA 2F2EA 3ECOA 2VQCA 3FKIJ 3L2VA 2H8WA 3CO6C 3DLLF 4ENJA 1ZREA 1FOWA 3FXMA 3PNVA 2V9KA 2X1CA 5F0FA 1R36A 3CF5F 3CMEI 1NTCA 1WJ5A 2PJRA 2WV0A 3LQQA 3G6EI 3CJNA 1DGWY 3BOQA 2R93J 2X51A 4XLPF 2AS5F 4D9JA 3VSLA 3I58A 5HLGA 3OYBA 2V79A 1R23A 3IWFA 3JAMK 2X4HA 3AL0B 1PP7U 3CF2A 3I3LA 1ZQ3P 2HPMA 1OCPA 4ASNA 4BE0A 2LKSA 3I59B 1W5TA 1VQMI 2R5ZA 1BC7C 1P4WA 1Y0NA 4J00A 1WSUA 3K2ZA 3K69A 2XASA 3ZQGA 4KIBA 3IUOA 4GGGA 1Y0UA 3GFJA 1JKRC 3Q5FA 5B66C 3D5SC 1MMSA 3ZCOA 1YI2I 3MAJA 4OAYA 3LQRA 1FNNA 3GFLA 4DGWB 2UWMA 4DYCA 3P9CA 4U7DA 1X2NA 1YO5C 2HDDA 2HKOA 3A0HC 5HS7A 2JN6A 2KJBA 4AUXA 5GAEJ 3Q0WA 5KVRA 1OCZH 2ZJ2A 3K0LA 1EH6A 3S93A 5J4YA 3CO7C 1IRGA 2EFOA 5LRSA 1OYYA 4BACA 4LLLA 3DBRB 2A3SA 1AU7A 1A6QA 4L9VA 1QZYA 1LE8A 1X19A 2V4JC 4BQOA 1M1EB 4RAYA 3F72A 5K5OA 4IO9F 3T1BA 5ILUA 3CUQC 1SD4A 1TT0A 3JRDA 2PJRB 1D8JA 3KIOA 1ZR2A 1I5ZA 3ERED 4G7OF 2VT2A 2EIMH 2XKOA 4BQQA 5AIQA 1AOYA 4CCJA 1MJAA 2XF7A 3HHGA 2OQRA 1UMQA 2B7EA 2ELJA 1K6OA 2UXXA 3F0CA 2K3FA 2VT3A 5BOXA 4QSHA 3RKXA 2R5ZB 1K7AA 2CV1A 2N8GA 3S2DJ 3PL8A 2ZKZA 2VASA 2DPDA 5M5YJ 3QU6A 4BE1A 1AKHA 2Z5UA 2CU7A 3GZNB 2M45A 1GVDA 4HOBA 3LSGA 4BY7J 4PSXA 4CO8A 1P6RA 2F48A 1FMVA 2DA3A 3ZQ7A 4B3XA 4HDVA 1MBKA 4F52A 2GXGA 4KT6A 3HOYJ 3DBLB 2R3SA 3WTYC 3F22A 3WTWC 2M3AA 3PQJA 1ZG3A 4ZC3A 2EIKH 4XK4A 5BPDA 4F55A 3OS1A 3KFWX 4RAFA 2H6BA 3D5LA 1TW3A 4I01A 4AYBA 4PGHA 3H9JA 1X58A 1LE8B 1IUYA 3HG9A 3QYFA 2V7FA 3ABLH 5FO5A 5M3MJ 4DQ2A 3MKYB 1ZGWA 1FWZA 3ZMTA 4KN7X 1J7KA 2XB5A 4EM0B 3VDXA 4G6TB 3MN2A 2XPUA 3WTTC 2LRDA 5J3LA 2XHKA 1ON1A 1A5JA 3ASOH 2P6SA 4IHWA 2W85A 3KLNA 4IHYA 2ID3A 1A31A 5LRRA 4IQ4A 3AFHA 4WCGA 3H35A 3G73A 4IOCF 4HV6A 3OL4A 2DFEA 3DXJF 4BGDA 2F4MB 2G9WA 3OIOA 2X1EA 2XF5A 2YX7A 2AQEA 2HDWA 1AKHB 3RDIA 4LGWA 1YJNI 1VQ7I 5FRNA 2Y69H 4UVBA 2QM3A 3DLAA 2VBXA 2HR3A 3CJRB 3QWLA 1TLHB 2KDOA 1LDDA 4IRHA 1H89C 1T98A 2HKXA 2DMUA 2IA1A 2JWTA 1U8BA 1G3TA 1NHAA 2LBFA 3JW4A 4E7ZA 5BMZA 3RPUA 4HDUA 4Y52J 1MJBA 2EK5A 3D0SA 4LD5A 2E1OA 2JPBA 2DTRA 3A03A 3B02A 5FFZA 2M7BA 3IH4A 2IJLA 1MSEC 2XSJC 2L7KA 3PUBA 3EPZA 1RKWA 4ZYHA 1XPXA 2MH9A 1ON2A 2CFXA 4YFKF 2M2EA 2H8RA 5FLXK 2OTLI 1H0MA 3FIWA 4KMFA 4OMZA 2IBDA 4RS8A 2EV5A 5D4SA 4M72A 4KMUX 3I53A 3OL3A 1B6AA 4F91B 3F9KA 5HLTA 5BS6A 2ISYA 5HDKA 3AAFA 1K78A 1IXSB 4X1EA 1T56A 1WI3A 5L3DA 1SVOA 2HDCA 1X1AA 1Z21A 1GUUA 2ZSHB 3OYHA 3ZN1A 4R8HA 4GXOA 1E3PA 3PNYA 2G0EA 1YJ9I 3KZZA 4C3IJ 2Y9ZA 1VQPI 4CZCA 3MEXA 4ZDOA 1FTTA 4I0BA 4XLHA 3HSFA 2LBFB 5CVUA 2FA5A 2DU9A 2RDPA 3HTUA 5DCFA 1ZKGA 4B43A 3WGIA 1AWCA 4P1WA 4HX7A 2K7LA 5GADJ 3S3MA 2STWA 3E0JB 3KP6A 1LUJB 4GO1A 2VI6A 1QQIA 4HPQA 2H1KA 4L0ZB 2HXIA 3SFIA 3M3YJ 2NOJB 1DGRM 2R5YA 4LIUA 3L2CA 3FISA 3S2HJ 4RMNA 3H9GA 1HSTA 1R6RA 3G2BA 2L9SA 5FRMA 2V1DA 4M9XA 2DA2A 2P5VA 3P9KA 1U2WA 4I6ZA 3DQVC 5ICGA 2WB1N 2WAFA 2Y30A 1K78B 2K3PA 3VYRB 1N25A 1Z7LA 1WPKA 2VN2A 3T5XA 3RKYA 3WHCA 3W2VA 3WTUC 1JKOC 1MBFA 2EA4A 1FOKA 4NBQA 2OD5A 5E1ZB 3IKTA 3DU6A 4EM2A 3RKWA 4D5FA 4C2MJ 4Q47A 3SYTA 4MTDA 3MKZA 5JVGF 4ZZDA 3IRQA 2F5VA 1XG1A 4XONA 5E3NA 5EEGA 3F8FA 1R1VA 2A05A 2NVQJ 3ZP5A 3WU2C 2DLLA 2PX9A 1ERDA 4M74A 5FFXA 3H9QA 2X6WA 2AQFA 1OPCA 5HVQC 2NXNB 1UELB 5K5RA 2XRNA 3ZXSA 4XRMA 4E7KA 2JT1A 1KQ8A 1D1BA 5LGUA 1JI8A 1F43A 2DJNA 3W2AA 1BOAA 2JTVA 3LSMA 3HOXJ 3MKWB 1WWXA 2QSFX 4EJVA 4K2EA 3ABKH 3PO3J 3JRAA 4HBLA 1J75A 5KAFC 1FBUA 3CZ6A 5F08A 2DCEA 5BNGA 3KZIC 3PM1A 3GFMA 1ZLKA 1MBJA 5IP7J 3DKYA 3MZ8A 4A0XA 1HKSA 1D1CA 4OIPF 2OZ6A 4CUGA 3HOTA 2HOTA 2CUZA 3KP4A 1J9IA 3F6OA 4CXFA 4NC8A 4MQ9F 4XR6A 3J81K 2XC7A 1ZHFA 1VFCA 1W36D 4FX4A 5IYBJ 2O6GE 2COMA 2EWNA 3TDZC 1OCTC 2VQHA 1LFPA 4HNUA 3H0DA 1JT6A 3SHFA 4NHJA 2OZUA 4C3HJ 1SAXA 4OU0A 2MH2A 1I6HJ 1POGA 1LFBA 3JRIA 2ZJQF 1OFCX 1RESA 4IOAF 3OR1C 5FB2A 4RLQA 1IGNA 4B1RA 1YOVB 1XCBA 3GTMJ 1TWFJ 5CVRA 1XSXA 1S7OA 3LSTA 1R7JA 3V7CA 2MBFA 1TT5B 2XSDC 1DU0A 4R1HA 1QBJA 2QSHX 3I4MJ 5HS9A 2K85A 3ZQCA 3JRFA 4UNOA 9ANTA 1Y1WJ 4L0YB 3OYFA 1PP8F 2X6YA 1ZH5A 1QZEA 1TWAJ 2JVHA 1WJDA 2R7WA 3E3VA 2ECBA 1D0ZA 2GOMA 1HDDC 4EEFG 3JTGA 1P9QC 3KP3A 3TP0A 1FYMA 5LHHA 4XN0A 1GLNA 3PFIA 1ZRFA 3J80Z 5CJ9A 2K9LA 2E5NA 1IO2A 2LTPA 4A3JJ 4RBOA 2FBIA 2LR8A 4RAZA 2HPIA 4XRSG 2D45A 4BBSJ 1N78A 1Y1VJ 3KZYA 4ZH4F 1NG6A 2L01A 4FETA 1E0EA 4PDKA 2ZXWH 4P5OA 4HRIA 1U5TC 5C4JJ 1BJAA 1Z7UA 1IN6A 4AIJA 5D6FA 2R7TA 1AHDP 1ZELA 3W3CA 1Q1HA 2UV1A 3LSKA 1G6NA 4U0VA 4ZZLA 1PVEA 2F5DA 1XMAA 1PYVA 1R22A 2OBPA 3H5RA 2W7NA 2WBMA 3EUHC 1ODDA 1R58A 1YFHA 4M3EA 2BY1A 2CUJA 1RUOA 1BJZA 1KU9A 1Z9CA 4AVZA 4BU2A 2ESHA 1UAAA 3WG9A 2WY8Q 2HVRA 4LIVA 1FLIA 5ICFA 1WJFA 4M3FA 4LOCA 1T8IA 3DF8A 1VQ9I 3CMYA 3W2WA 1N77A 2GAUA 3ISPA 3S1NJ 1TWHJ 2L5QA 1Q1VA 3I5UA 3I9V2 5FLMJ 1LB2A 1W36C 1X1BA 3CD6I 3S17J 3FX3A 1FJLA 4A3GJ 2VQLA 2PMZA 3PSFA 3O6BB 1MGTA 1RRJA 3FWEA 2M0CA 1TQPA 2GIZA 2I5UA 5GP9A 2K4BA 4IHTA 5B5EC 1QPMA 4BQAA 2QKMB 3KLOA 3FXUA 3FXOA 5LHGA 1WFXA 2MYSA 3K1PA 1WRJA 3FMRA 2D1VA 1IZ1A 3NARA 2H09A 3BQZA 5TGTA 4YIIA 1NH3A 2QQ9A 4E7JA 2IS6A 2MC4A 5LGTA 1B4AA 5CYVA 2PMUA 2PJPA 5F27A 2DDBA 3HUGA 2ICWG 2IA0A 3M9AA 3IH3A 2TCTA 2HYJA 3KYLA 1UFMA 1S72I 2O9LA 3HJEA 3LA3A 4G8XA 4XLNF 5B1BH 3BTLA 3TOBA 2OCEA 5DEQA 3DTEA 3SFZA 4A3KJ 1SD7A 3K9TA 3KETA 1UCRA 2E1MC 2VODA 4ZDLA 2F5FA 2JRMA 5TISC 1IW7F 1YW7A 1S7AA 2BYVE 2LP0A 1MDMA 2FX0A 4KYWA 1REPC 1MSFC 2TRTA 4A3DJ 1KZHA 1IN8A 1TW2A 2KRFA 1J09A 2DJIA 2LNBA 5A2QK 3J7AY 2R7SA 2M8EA 1QVUA 2HTJA 2R7RA 2NRAC 2KT0A 2DT5A 5ICEA 2R7DA 4CCKA 2Y2ZA 2BE5F 4CCNA 3WHBA 2VBZA 1FMWA 3F8NA 3TMOA 3Q0VA 3S15J 1ZTRA 4YG2F 4XOPA 3PQKA 1JUSA 2VC1A 4V2FA 3CMMA 4ESFA 4A6EA 3IAS2 2QCOA 3DPLC 1R9TJ 3H36A 1BIAA 4L9TA 3HUGB 2YS9A 4CCLA 5IOZA 4W1UA 5E3MA 3JRBA 1Z3YA 1FSHA 1RC9A 4CH7A 2P8TA 1SC7A 3O8HA 3GW2A 3A4CA 3M1CA 2CS3A 5J1UA 3JSOA 2M7AA 3H3UA 2ZXIA 2RGVA 2WV1A 3FXKA 5F6FA 5IP9J 3BCAA 1ETKA 5JFRA 2RN7A 1FP2A 1OR7C 3ABUA 3DTKA 3KPHA 5D4RA 4CCOA 5DCMA 4Z6YA 5FLVA 2Z2SB 1ZAOA 4CYDA 3ELKA 1MDMB 2DMQA 1FYKA 3CDLA 1P2FA 5DTDA 3ONQA 3IKVA 2RNGA 4I0AA 4BXUA 3KE2A 3G1OA 2LY2A 3SEQA 3ASNH 3CCLI 2OQGA 3BR2A 2LC2A 2J5OA 3H3ZA 4LB5A 2HVQA 2Y9YA 2EA2A 3C2HA 3K1NA 5H2FC 2WAQN 1XC5A 1Z67A 2K9NA 1CGPA 3EYIA 5EJCA 5CQEA 2ZNZA 2BBYA 3M8FA 2D1HA 3ESWB 2HYGD 3GF2A 1I3AA 1YX5A 5E20A 1P92A 1WJBA 3B73A 4OIOF 5CVVA 4HF1A 1LJ9A 2BV6A 2VB6A 2WY7Q 2FSWA 2FEZA 4AVPA 1IN5A 1TQMA 3LSIA 2DA4A 3WU0A 2W82A 1OLTA 4XMYA 3GMEA 1UHWA 2VBWA 2XGXA 2QKLB 1VQ8I 1IRXA 3CCEI 3LSHA 5D6EA 4ZJZA 2CWEA 2M0MA 2DA6A 2DTZA 4DNCA 1LVAA 3MKLA 4DYRA 1WJAA 3NEUA 1U78A 5L3BA 3BTJA 5LFAA 1I1SA 4P96A 4L18B 2M4GA 5DCMB 5AONA 1X1DA 2QQ8A 3GTLJ 2MSYA 1Z6TA 5CLSA 1U9NA 3VSKA 1XDUA 2QVOA 2UZKA 1LNWA 3AG2H 3EUAA 4EJWA 3QP6A 2HVSA 2LG4A 1U3EM 5M3FJ 3BZ6A 4WXDA 3FDYA 3BPVA 5C3EJ 2HOAA 4ESJA 4G9YA 2XPWA 2DA5A 1I50J 2OPTA 2PQ8A 2W48A 2RVCA 4UUSB 3DTIA 1VQLI 2JVGA 4IZZA 1K79A 1MMAA 5KAIC 3F21A 2HQAA 4HX8A 1WH7A 1BBYA 2AHQA 1XS9A 1OQYA 1X1CA 4GYGA 1Z0XA 2JUCA 4DZPA 2HOSA 1HKQA 3K70D 1T33A 1V5EA 1HLVA 4Q5SF 4L9JA 3FF5A 1UHMA 3E6CC 3Q3SA 2A5WA 1QRYA 1Z77A 3S14J 4I09A 4IVNA 1QU3A 1K6YA 4M9ZA 3RTRA 3FMQA 4WX9A 4X0GA 2IA2A 2H94A 3CP8A 4XNFA 2AXLA 2NYXA 3GYHX 5B3SH 1IRFA 4M6XA 4OWRB 2E35A 1UJ8A 1W7PA 2RQPA 3A01A 2VKVA 3LMMA 4D7NA 3KCCA 4HX4A 5J1YA 2CH0A 2BVLA 3CUQA 5J47A 2OJED 2LD5A 3NRVA 1LQ1A 1ZYRF 3CDIA 3T8RA 1SFXA 3SZTA 4U7BA 3CUOA 2LYCA 3E5UA 4MLOA 1OJLA 1YIOA 2JA6J 1Y56A 4YEJA 1I6XA 1U9OA 4KISA 1SFOJ 3PJRA 2R7VA 5E8GA 2COBA 3WG7H 4GCVA 3LFKA 3UR3C 2FNPA 2JUGA 5TJJA 3O8GA 4XIDA 4KITB 5EG0B 3GTQJ 2QF7A 4BDYA 4A5NA 1E2XA 1V5GA 3AG1H 4MNUA 5HOOA 4QTRA 3CCVI 1BI0A 2X6OA 1R71A 1HKTA 3HOZJ 3OYLA 1YYVA 2Y0MA 3I0TA 4A3FJ 1A36A 4U88A 2X85A 1IN7A 2PN6A 3O2PE 3PIOF 1MMGA 2OV7A 1BIBA 2WWYA 1ONVA 2A61A 3WE3A 3DBHB 3QOEA 3IAM2 5C4XJ 4FASD 1NG7A 4PJNA 1ETWA 1BW6A 2RKHA 2LY9A 5ILVA 4CGZA 2XF6A 3CMAI 3V42A 4FT8A 3ZMVA 3U9GA 2FOWA 4AIKA 4RGXA 2LDUA 4BYYA 4C2TA 1W7PB 4IRIA 3A01B 4XKWA 2EB7A 3CUQB 1YS6A 2LSOA 3W6VA 2F5EA 1HW5A 2BVMA 2GZWA 4D5CA 2HGCA 3O3KA 4JBAA 4E4HA 5IOYA 2CW7A 3LSPA 4G6DA 2EFPA 3CC7I 2KIQA 2VC0A 3KX2A 3VEPA 3HKZN 2XAGA 2K4JA 2LKXA 4MGRA 2DMNA 2NNNA 2RV8A 3BZKA 3M8EA 4LJZF 3FZVA 5E1WA 5L3CA 2QLZA 5FD6A 1IXCA 2DMPA 3K70C 2K86A 3GEZA 5K5QA 1IF1A 1IXRC 3BLYA 2G7UA 3BCBA 3OYCA 4ZTJA 3A1YA 3OYDA 3VYSB 4MTEA 2GA2A 1Z6RA 2HQNA 1AA7A 2DW4A 3PFYA 2BZTA 3HSEA 3ROUA 4HQEA 5H6RA 2EIJH 1I27A 2EV6A 4NNJA 2HEOA 4YRVA 2L7MP 1F9NA 1D5VA 4XLCA 2LLKA 3LOCA 5DD4A 2DFIA 4P9FA 1QPIA 1FP1D 1ITYA 2BY3A 2QBYA 3BZCA 4F7ZA 2VBYA 1E3HA 1W5CC 5FKOA 2XAFA 1QA6A 2XIGA 3E5QA 2Z33A 4O6JA 1K4SA 1FT9A 1V5FA 1B59A 2E71A 2JK3A 3FXRA 5J4VA 2M1BA 1FIAA 5ED4A 4A3EJ 4AWXB 4Z2YA 2PG4A 1D5YA 1RUNA 1STZA 1S8NA 1LEAA 5BQTA 5E17F 1HSJA 1ZR4A 2M4KA 2OTJI 1LEBA 4E7SA 2FQ3A 3FM3A 3FKJA 3JRCA 3AG4H 1JUPA 1BN5A 1W5SA 3BR0A 2XB0X 3K4JA 2HNHA 3FM5A 5EYRA 2HQRA 3CTAA 1USSA 3BG9A 5GPAA 5F04A 4FE4A 1G2HA 1OYIA 1X4PA 1X1PA 2IT0A 3K10A 4IXAA 5ICCA 3VWBA 4EQQA 1U0JA 3GBGA 3BG7A 3K4LA 4NC6A 3TKYA 2OF7A 2CG4A 3QU3A 2GXAA 3E6DA 2QBYB 5F1RA 1GV5A 1SFKA 1OCOH 4HEA2 3J7ZI 1WVRA 3RCOA 1EA3A 2MLGA 2KMUA 2DMTA 2CW8A 3OYMA 4HAMA 2LKPA 4ENNA 2A6HF 4ENKA 2WTEA 4HG2A 3IWZA 4BUPA 1BI1A 4BHCA 3BTCA 2QQBA 1KA8A 3L09A 5C44J 1R5HA 1HW1A 2KJCA 3C18A 1B1BA 1ZRCA 2FXAA 2CYYA 4HA8A 1DPRA 2Z9OA 4Y4RA 4BEHA 3K4BA 2JA8J 2IXSA 1O3QA 1JE8A 2E1NA 3S3OA 1YLFA 4E7IA 1P7IA 3DPTA 4IHXA 1YQAA 3P9IA 1HC8A 4RB0A 3V4GA 4I76A 3RYRA 2FF4A 1UHSA 2KRCA 1GDTA 1WKMA 2TDXA 2R7XA 2ZJRF 5F0CA 5K7ZA 3BY6A 3GTOJ 3U2RA 2PMHA 2KL4A 3RYPA 3Q9SA 2ID6A 2Z99A 4L9NA 1EH8A 1WJEA 5IYCJ 2PLYA 4ZYGA 4BE2A 5E8IA 3I55I 2WB1A 2L9RA 2CRGA 3BQYA 4D0PA 3FK7A 1HCRA 2P5KA 1TTYA 3KEQA 3K6GA 2X6XA 4DBQA 2YU9J 5HDGA 4CCMA 4ZTFA 3U1DA 1JKPC 3EDPA 4M3BA 2F4IA 3DP7A 4FCYA 2VKDA 2XV4S 2GOXB 2NAZA 2O7OA 3BPXA 3JTHA 3GLLA 4A0YA 1GT0C 2ZMEC 5D8LB 3FXLA 3DV8A 4N4OB 1ETVA 5IY5H 4A93J 1LKXA 1GHCA 4FTHA 3BR3A 3FK6A 4BEHB 5DM6F 1EV7A 3OYIA 3GTGJ 2YX4A 2E5ZA 2EJRA 5D5WB 2CV0A 2JSCA 1F5TA 1H9TA 3D5RC 2B9SA 2LY1A 2O3FA 2P7VB 2FQ4A 4OINF 2VONA 5EZHA 1H9GA 1O4XA 4TV7A 1OYWA 4AC0A 1R4MB 3VOEA 2E36A 2VLAA 3SZPA 5D5UB 4EGZA 2YPRA 3H1CA 4DOZA 5GAHJ 1F4KA 2EQRA 2X1DA 2CUFA 2K9MA 3L2RA 2JSPA 2FNAA 1X4OA
chains in the Genus database with same CATH topology
4XLEA 3TBIA 3S93A 1UG0A 4CCNA 2P0WA 4XLAA 1FMWA 5CPRB 3TMOA 4BACA 4XOPA 4XKVA 1X19A 2V4JC 2ZSIB 4BQOA 3NWTA 3CMMA 1TT0A 2PJRB 3IAS2 3DPLC 1QHHD 2KQRA 2Z16A 4BQQA 3HUGB 4CCJA 2XF7A 4CCLA 1D0XA 2ELJA 2W1OA 1Z3YA 4CH7A 2WADA 4RLFA 3A4CA 3M1CA 2CS3A 4IX7A 1G59A 1LVKA 2M7AA 3PL8A 2CV1A 2CFOA 2ZXIA 1G8XA 2VASA 4BE1A 4XM3A 3BCAA 1OR7C 2R7QA 3DTKA 2MD0A 4C30A 3LSGA 3ZQQA 4CCOA 4PSXA 2Z2SB 1FMVA 4B3XA 3ONQA 2RNGA 4JQFA 4XL9A 2HZDA 2LY2A 4Y33A 2DOAA 4F52A 3BC8A 3SEQA 2LC2A 4KT6A 2HVQA 2CMPA 2M3AA 3C2HA 2LOOA 3H5AA 4ZC3A 2WA0A 1YX3A 4F55A 3OS1A 3OYAA 5CQEA 3D5LA 4AYBA 2VJIA 1DQUA 3H9JA 3FBNB 4U87A 3HG9A 3QYFA 1YX5A 2V7FA 1WJBA 3MKYB 3VDXA 2VB6A 2WY7Q 4G6TB 2LRDA 3LSIA 3OS0A 2W82A 1OLTA 4XMYA 2QKLB 1MW7A 3SZGA 2Z1DA 3ZGKA 2L2OA 4IQ4A 3AFHA 3S3NA 1IRXA 2IS2A 3LSHA 3H35A 3TL4X 4ZJZA 3OL4A 2M0MA 3K4NA 4XORA 5KCMA 4BGDA 4PJLA 1WJAA 2X1EA 2XF5A 2AQEA 2HDWA 2R7OA 5FRNA 1BOBA 5LFAA 2VIXA 3DLAA 2M4GA 3CJRB 1X1DA 2KDOA 2VL8A 3VSKA 3EUAA 2LBFA 3OIQA 4E7ZA 2HVSA 2LG4A 1DP3A 2I8DA 3L2UA 3C2GA 1T0FC 3FDYA 3IP4B 2Y0SA 3HOSA 2M7BA 4II3A 4BDZA 4PSWA 2XSJC 2L7KA 3PUBA 2XAUA 3EPZA 1BR2A 3DTIA 4B48A 2JVGA 4IZZA 3ZR8X 4EATA 4C9YA 2V26A 1MMAA 4F93B 3RSNA 4N4NB 2HQAA 3OL3A 1MNDA 4F91B 3F9KA 2VPLA 5HLTA 3M8JA 1X1CA 4HNTA 2MABA 3EUKL 4PJMA 3K70D 1LDKB 4D1QA 3OYNA 1V5EA 1X1AA 2IS4A 3AKZA 1Z21A 3L2WA 2ZSHB 3OYHA 4XKCA 2A5WA 3CJQB 4F92B 4DIQA 1QU3A 3PNYA 1K6YA 3RTRA 3QYEA 3VYUB 4X0GA 4CZCA 3CP8A 4ZDOA 4XLHA 4NQWB 4XNFA 2LBFB 3L2QA 4NUBA 4DJAA 3OYGA 4OWRB 4B43A 2LH9A 3LMMA 4P1WA 2CH0A 2BVLA 3OIPA 3S3MA 2RQQA 3E0JB 2KPMA 4HPQA 4ANJA 4II2A 4BJ6C 4U7BA 2LYCA 4MLOA 1BR1A 1Y56A 2NOJB 4B47A 1DGRM 4LIUA 4YEJA 2BOLA 4YELA 4RMNA 4KISA 3PJRA 2KZVA 3H9GA 3G2BA 1R6RA 2R7VA 2BW3A 2L9SA 5FRMA 4LG3A 3UR3C 1SAUA 2JUGA 2K5CA 3DPUA 3CP2A 3DQVC 3OYEA 4KITB 2E1MB 2WAFA 3AL0C 4BDYA 3MD2A 1V5GA 5HOOA 2K3PA 3VYRB 1D1AA 1Z7LA 2OUMA 3DWLE 2IS1A 3W2VA 3HXLA 3OYLA 1Z3XA 4HSTA 3OYKA 2X85A 4IQJA 4KJZA 3DU6A 2IGOA 1MMGA 2OV7A 3K4MA 2VQGA 3QOEA 3IAM2 4R79A 4FASD 1NG7A 4PJNA 5HNHA 3SYTA 2VJ4A 3MKZA 4PJJA 2XF6A 2F5VA 4PFOA 4XONA 3RQ4A 3V42A 2KP6A 3NWSA 3SEZA 4F3QA 4C2TA 1ERDA 3OR2C 3H9QA 2X6WA 1KONA 2AQFA 4XKWA 4ITVA 2W4SA 4PFPA 5HVQC 1UELB 3HC7A 4BXFA 2BVMA 4XKBA 1Y6IA 3ZXSA 4BS9A 4E4HA 5KHDA 4E7KA 4IKFA 2CW7A 1D1BA 4NC7A 1JI8A 2V6EA 3KX2A 3W2AA 4ZYAA 3LSMA 2KHMA 3MKWB 3ZRGA 2BW3B 1MMNA 2KLOA 3OS2A 3CZ6A 2DT6A 2DCEA 3LFUA 3K70C 3H5NA 4QPQA 3DKYA 1D1CA 3BLYA 4CUGA 4RM2A 3HOTA 1BR4A 2DT7B 3BCBA 2CUZA 3OYCA 3A1YA 2FUG2 4ZTJA 3OYDA 4NC8A 4XR6A 3VYSB 1W36D 2XC7A 3S8PA 3CESA 3OY9A 2DXIA 1AA7A 3OMYA 3PFYA 4GRIA 3BG6A 4NNJA 2VQHA 1LFPA 3OWTA 4HNUA 3H0DA 2F6CA 4YRVA 2VXZA 4XLCA 3SDBA 4BL0B 4J01A 3A2KA 1HA8A 2RREA 4BJTA 2LREA 3N05A 4C2UA 3KEYA 2Q1ZB 3RPUD 2UUZA 3QYBA 2O5RA 1V5FA 3OR1C 4RLQA 3HPHA 2W00A 4CSWA 2VJ5A 4E7HA 1YE9A 1VZ0A 3OYJA 3OOUA 2R4GA 2ZFUA 2V1NA 3OYFA 3HPGA 2X6YA 2M4KA 4E7SA 2JVHA 3K4KA 3FKJA 1WJDA 4BQNA 2R7WA 4PUSA 3K4JA 1D0ZA 2GOMA 2HNHA 1P9QC 1S9HA 4H4KC 4XN0A 1GLNA 2CV2A 2R7UA 5LD2C 2K9LA 1X4PA 2E5NA 2IGKA 3K10A 3VWBA 1U0JA 3GBGA 3BG7A 1PJRA 2WAEA 3K4LA 4BJ5C 2L9NA 2HPIA 1N75A 4E6KG 1N78A 3LL7A 1NG6A 2Q2EB 4FETA 1E0EA 2HU9A 4P5OA 4HRIA 5CKTA 1WJCA 2VJJA 3HL2A 1SFKA 4AU7A 4HEA2 2R7TA 3RCOA 1EA3A 2MFZA 3PSIA 2KMUA 1ZELA 2CW8A 2A6TA 3W3CA 2ZXHA 3OYMA 2UV1A 3LSKA 4HG2A 1PYVA 4JOMA 1MNEA 4BUPA 4XQFA 3H5RA 4RM3A 4ZDPA 2WBMA 2W7NA 1QHGA 3EUHC 4PK4A 4LITA 5HNFA 3E1SA 4Y4RA 2CUJA 3K4BA 4BEHA 3K4CA 2VXDA 4DBRA 2IXSA 4AVZA 4BU2A 1UAAA 3S3OA 4E7IA 2WY8Q 3DPTA 2HVRA 4LIVA 1WJFA 3FHNA 3W2WA 3DKXA 1N77A 5CQGA 2IGNA 4OAZA 2KRCA 2L5QA 3I9V2 1W36C 2R7XA 1X1BA 2JA2A 2KL4A 2PMZA 2VQLA 3PSFA 1WJEA 4BE2A 3VYTB 2WB1A 1MMDA 5FROA 2IGMA 4E7LA 2WAQA 3U21A 2QKMB 3DU5A 3K6GA 2X6XA 4DBQA 3FBIB 3S32A 4CA0A 4CCMA 4B44A 3L2VA 4ZTFA 1WFXA 2VQCA 5JHFA 3QODA 2MYSA 3PNVA 2OC6A 2V9KA 2X1CA 5TGTA 2F4IA 1WJ5A 4XOTA 4HSRA 2PJRA 2VKDA 2GOXB 4E7JA 2IS6A 1DGWY 2MC4A 4XLFA 2X51A 4D9JA 3VSLA 3OYBA 4N4OB 5KNLA 2XDVA 3DEEA 3AL0B 1LKXA 1T95A 2VKHA 3CF2A 3I3LA 2HPMA 4BE0A 4BEHB 3KYLA 2E60A 1D0YA 4QPOA 3OYIA 4Y3OA 2E5ZA 4J00A 2CV0A 3DTEA 3IUOA 3D5RC 2LY1A 2E1MC 2KRHA 3D5SC 3ZCOA 4OAYA 4ZDLA 3HKZA 4DGWB 2UWMA 3UNGC 3MMYB 2VLAA 4XN3A 4DOZA 3PNTA 2X1DA 3J7AY 1J09A 2DJIA 2R7SA 2R7RA 2K9MA 1TZLA 3L2RA 2JSPA 4CCKA 1X4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAS D;  4N4N B;  4N4O B; 
#chains in the Genus database with same CATH topology
 4I98 B;  4XLE A;  2CQX A;  3GTJ J;  5IT9 Z;  1Z05 A;  5EDN A;  3RKQ A;  2E7W A;  1RIO H;  1JHH A;  1JKQ C;  4BY1 J;  3BWG A;  5FKL A;  1A04 A;  4PZJ A;  3WTZ A;  3C7J A;  3GTP J;  2DQL A;  2ZC2 A;  2VOP A;  1MBE A;  2KIF A;  2LF8 A;  2M8G X;  5E79 C;  4V19 K;  1SVM A;  1B72 B;  2HQ5 A;  2W25 A;  2L4A A;  1QHH D;  2FMY A;  1JGG A;  3RIR A;  1UZC A;  3JRE A;  4KT5 C;  4FX0 A;  4MQV A;  2GQQ A;  5JI6 A;  3MVP A;  1D0X A;  1P4A A;  2W1O A;  5K7H A;  2VKE A;  1JJ6 C;  2AO9 A;  1HDP A;  2XKP A;  3V8K A;  2WAD A;  2V9V A;  3F8M A;  1G59 A;  2HTS A;  1LVK A;  4H0E A;  4V2G A;  3CC4 I;  3J80 K;  2K02 A;  1G8X A;  2FML A;  2O03 A;  3MFK A;  4XM3 A;  1OMI A;  3COA C;  5HLI A;  3ZQQ A;  3C3W A;  3F6V A;  4ABZ A;  2DOE A;  2QZ8 A;  1DUX C;  3B6C A;  1K61 A;  1IC8 A;  4XL9 A;  1U5T A;  2L7Z A;  3BC8 A;  1YRN A;  1BI2 A;  3H92 A;  4YFX F;  5L3G A;  2NS0 A;  2L7F P;  2LOO A;  3H5A A;  4OMY A;  2WA0 A;  3GCM A;  3OOP A;  1YX3 A;  3ZOB A;  3HHH A;  2W84 A;  1TP4 A;  2A69 F;  1XGS A;  1DQU A;  1P4X A;  4G94 A;  3BR1 A;  4U87 A;  3EUH A;  1FIP A;  4FHT A;  3M4O J;  5CVJ A;  2GBY A;  4PJ0 C;  4S05 A;  1T2K A;  1XDS A;  3X2Q H;  5EZG A;  4W97 A;  4UXN A;  4O3M A;  3OS0 A;  3FXJ A;  3J7Y J;  2DDA A;  4KA4 A;  2Z1D A;  4M3D A;  1YW8 A;  3ZGK A;  1EF4 A;  2KIM A;  2IS2 A;  5DUI A;  3TL4 X;  1MKM A;  4S04 A;  4XOR A;  3TGN A;  5KCM A;  1BM9 A;  3MCZ A;  4PJL A;  3S16 J;  2EZH A;  2R7O A;  3SJM A;  1W4M A;  4EJU A;  5H6Q A;  3WTS C;  1TNT A;  2DQR A;  2IVM A;  3K1M A;  5EF6 A;  1U5T B;  2CSO A;  3QOP A;  3OSF A;  1H8A C;  1TC3 C;  1YRN B;  5J8F A;  2ZXJ A;  3C2G A;  1Y39 A;  1T0F C;  3IP4 B;  1W0T A;  2Y0S A;  4M71 A;  5FKM A;  1ORK A;  1B9N A;  4II3 A;  4BDZ A;  1KGS A;  2XRO A;  4PSW A;  2XAU A;  5M5W J;  1BR2 A;  3GZ6 A;  1GV2 A;  5E3L A;  3ZR8 X;  4ETS A;  4C9Y A;  2V26 A;  4ESB A;  2QEN A;  1WI9 A;  4A69 C;  3ZQH A;  3HGY A;  1MND A;  2VPL A;  1ZRD A;  4HNT A;  3GWZ A;  4UHT A;  2L0K A;  3EUK L;  4BXX J;  4IEJ A;  4D1Q A;  3OYN A;  1XSV A;  4L5I A;  3CCY A;  3L2W A;  2A68 F;  4XKC A;  3DCF A;  4M6V A;  4UV8 A;  1GXQ A;  2DOD A;  4F92 B;  1PUE E;  4DIQ A;  4FE7 A;  3LSR A;  4MEX F;  2BXZ A;  1R4N B;  3S1M J;  3RZO J;  1R5G A;  3HYI A;  3F23 A;  3BRO A;  3WTV C;  1S3J A;  3K7A J;  4WXH A;  4J19 A;  5LEK A;  4DJA A;  3OYG A;  1O3T A;  2MA3 A;  2ELH A;  5GAG J;  3ZN0 A;  2LH9 A;  3E7L A;  2DFF A;  3RPQ A;  4BKX A;  3CLQ A;  3P7N A;  1OIS A;  2RQQ A;  5JLW A;  2KPM A;  4IHV A;  1MBH A;  4IPA A;  1UST A;  4II2 A;  4RGS A;  2M5W A;  1A6I A;  4M6Y A;  1XMX A;  1BR1 A;  1C0W A;  1G3Y A;  2BOL A;  4AID A;  1SAN A;  2G7H A;  1B9M A;  2O8X A;  3HIF A;  2IP2 A;  1O3S A;  4LG3 A;  1FBQ A;  2JQ7 A;  2K27 A;  1SAU A;  2K5C A;  3DPU A;  3ULQ B;  2HZT A;  2LF7 A;  2E1M B;  3AL0 C;  1MD0 A;  5EGO A;  1OR7 A;  1ZGJ A;  2MC3 A;  2QUF A;  3ZMU A;  2R0Q C;  2L54 A;  1WGX A;  2OUM A;  2IS1 A;  3HB9 A;  2EZI A;  3HXL A;  3TW7 A;  4HST A;  5K1Y A;  3OYK A;  4UUS A;  1MH3 A;  1JTX A;  3K4M A;  2KIU A;  3ZPL A;  2VQG A;  3L7W A;  3OSG A;  2EFW A;  1Y8R B;  4R79 A;  5FKN A;  1LFU P;  4G12 A;  4QLC U;  5HNH A;  4YFN F;  3WOD F;  1PDN C;  2ZBK A;  4PJJ A;  3GX4 X;  4I02 A;  4X6A J;  1TL8 A;  1MIJ A;  3E6M A;  4PFO A;  3RQ4 A;  1ZGA A;  3M1E A;  2KP6 A;  1KU2 A;  1JUM A;  5JHU A;  2EFQ A;  3OR2 C;  1VTN C;  4UY8 I;  1VQ4 I;  1ETO A;  2NVY J;  2NS8 A;  4ITV A;  1FTZ A;  2D2W A;  3HC7 A;  1QO0 D;  4BS9 A;  2FE3 A;  5KHD A;  1T39 A;  1BI3 A;  4IHS A;  3Q9V A;  5LBQ A;  2QQA A;  5DUK A;  1P7J A;  1X2M A;  2E2H J;  5HDN A;  1FX7 A;  2PEX A;  3SDG A;  4ZYA A;  3I64 A;  2QEX I;  4GFB A;  1PUF A;  3ZRG A;  4LK1 F;  3QAH A;  1MMN A;  3ABM H;  2KLO A;  3JRH A;  2L02 A;  3W6K B;  1IJW C;  3JAM Z;  2E2I J;  3BP8 A;  3V7R A;  5EGO B;  1O3R A;  3H5N A;  4EM1 A;  4N0B A;  5EEH A;  2DYR H;  2LK2 A;  3CLO A;  4RM2 A;  4HZF A;  1R5I D;  2K9Q A;  5B1A H;  3S2W A;  2FUG 2;  2PBI A;  4XBF A;  4BHP A;  2ZB9 A;  1QZZ A;  3WTX C;  3CES A;  3CDH A;  3OY9 A;  2B63 J;  3OMY A;  4GRI A;  1DPU A;  3DKW A;  2KIS A;  3OWT A;  1HQC A;  1ACI A;  1IDZ A;  4J01 A;  4A3B J;  2DI3 A;  4ENM A;  2IEK A;  5M5X J;  2MLK A;  3V7S A;  1BC8 C;  4A0Z A;  1V4R A;  3K2A A;  4B09 A;  2RRE A;  5IPA A;  5EG0 A;  4A2U A;  4BJT A;  2QYO A;  2LRE A;  5DD8 A;  4BH9 A;  3N05 A;  2CGP A;  2EBI A;  4DYQ A;  2Q1Z B;  4JX5 A;  3RPU D;  2UUZ A;  3QYB A;  2O5R A;  3VFZ A;  1U8R A;  3HZJ A;  5E18 F;  4Q4Z F;  3LAJ A;  1X3W B;  1L0O C;  4OOI A;  3ZMZ A;  2W00 A;  1XD7 A;  2RC4 A;  4CSW A;  4G7H F;  2HOE A;  3HSR A;  2R4G A;  4IF4 A;  4MFD A;  1SFU A;  3REO A;  2E2J J;  1PUF B;  4BHB A;  2YSR A;  1ZLJ A;  4WF2 A;  1XGO A;  1YIT I;  3HPG A;  2HXO A;  2ACJ A;  3DEU A;  1EKE A;  1OCR H;  4PUS A;  1IV8 A;  1IAW A;  4KDP A;  3V8L A;  4EGY A;  4EV0 A;  2ESN A;  1S9H A;  2JA7 J;  3TW6 A;  3QQA A;  1XX5 A;  2NS7 A;  3IL2 A;  2A07 F;  4AYB N;  3CJT B;  3ZMS A;  3NAU A;  2IW5 A;  1G3S A;  1PJR A;  4UVC A;  2WAE A;  2L9N A;  1N75 A;  2GWR A;  1HW2 A;  3LL7 A;  3HGG A;  2HFH A;  5AIP A;  4JK1 X;  1TQI A;  3GUD A;  1R00 A;  1FYL A;  2HU9 A;  2EPF A;  3KYD B;  2VJJ A;  3HL2 A;  1J59 A;  1HOM A;  4AU7 A;  3ZQI A;  5FKK A;  1R1T A;  4EJO A;  2KKO A;  5ERI A;  4KNY A;  2KDZ A;  3B6A A;  2FOK A;  1KQ0 A;  4I7H A;  1W0U A;  1IUF A;  2GA1 A;  3R0J A;  4JOM A;  3WGH A;  1KQ9 A;  4XQF A;  4RB1 A;  4RM3 A;  1S6L A;  3V8J A;  4PK4 A;  3TP3 A;  4LIT A;  5HNF A;  2P5L C;  1JJ8 C;  4CYC A;  2QSG X;  4RAG A;  3E1S A;  1YJW I;  3WE2 A;  2EV0 A;  4AIH A;  2VXD A;  2P81 A;  3HBL A;  1KU3 A;  1A35 A;  3QRF F;  3W6J B;  1DDN A;  5K7F A;  1EH7 A;  3PUF A;  4A12 A;  5LLQ A;  1FOY A;  2IGN A;  4RGR A;  4OAZ A;  2M34 A;  5KK1 A;  5DYM A;  3S1Q J;  1RKT A;  2V9P A;  3HTS B;  5F64 A;  2DA1 A;  1BL0 A;  5D5V B;  2JA2 A;  3LWF A;  2E7X A;  3WU1 B;  4LK0 F;  2YUS A;  2NVX J;  3LSJ A;  1NK2 P;  4HNV A;  1CF7 A;  2XPV A;  3QPT A;  5FRO A;  4HF0 A;  3GVA A;  6PAX A;  2IGM A;  4E7L A;  2ZFW A;  4IJA A;  3VB2 A;  3FBI B;  3S32 A;  4OIQ F;  4B44 A;  5GTI C;  5JHF A;  2EIN H;  3QOD A;  1FPQ A;  3L9F A;  4Y17 A;  2OC6 A;  1T6S A;  4GYI A;  3MZH A;  1QGP A;  3BG5 A;  1ETQ A;  2LVS A;  4XOT A;  4HSR A;  1SEU A;  1DU6 A;  5HOD A;  3BDD A;  2CQK A;  4XLF A;  4RB3 C;  2OCC H;  4U0W A;  4Y7N J;  2XGC A;  1BW5 A;  1XCV A;  5KNL A;  2ISZ A;  2XDV A;  3DEE A;  1T95 A;  2VKH A;  4CYC B;  1MBG A;  2ZCW A;  1FZP B;  1J0R A;  1G3W A;  2JJ7 A;  5FLX Z;  4UB8 C;  2E34 A;  2E60 A;  1D0Y A;  4JP0 A;  4QPO A;  4CDG A;  4Y3O A;  3P5J A;  4KIF A;  3JCU C;  2J5P A;  3HRM A;  4MFE A;  4QIW N;  4MEY F;  2FBH A;  2KRH A;  3TED A;  3H3V K;  3C2B A;  4LLG F;  1S5L C;  4G7Z F;  3HKZ A;  1F36 A;  1FSE A;  3MMY B;  5H20 A;  3UNG C;  2FJ1 A;  2Y31 A;  4XN3 A;  1V3F A;  1BA5 A;  4A5M A;  4UUV A;  3SQN A;  3PNT A;  5IYD J;  2Q8K A;  3CCM I;  1D3Y A;  3HRU A;  2R7F A;  1CF7 B;  1I3Q J;  1TZL A;  3TO7 A;  5DS9 A;  3TBI A;  1UG0 A;  3G3Z A;  4A3C J;  4LB6 B;  2BY0 A;  1FC3 A;  4HF2 A;  2P0W A;  4XLA A;  5CPR B;  1XN7 A;  2V1X A;  4EMS A;  3M07 A;  1UG2 A;  4WK8 F;  4KUM A;  1FOX A;  1HBX G;  4JYK A;  4U0Y A;  3G1L A;  1QVT A;  2I10 A;  2ZSI B;  4XKV A;  3HOV J;  3NWT A;  4NDL A;  3JRG A;  1MZB A;  2Q0O A;  4JX6 A;  4P55 A;  5BPI A;  1V55 H;  5LGN A;  1TWC J;  2Y75 A;  1E3O C;  3R4K A;  5ILS A;  2X0L A;  1Z1D A;  1I39 A;  2KQR A;  3JR9 A;  2L9V A;  2Z16 A;  2AXT C;  1XGM A;  3FMS A;  3KEO A;  1RZ4 A;  3J7A O;  4RLF A;  3TO9 A;  4CZZ A;  4IX7 A;  4C3J J;  4Q48 A;  3MZY A;  3TQN A;  2IRF G;  2CFO A;  2XGE A;  3OV8 A;  5FD5 A;  3N4M A;  4OIR F;  1R49 A;  5J40 A;  2L4M A;  1VQK I;  5GPC A;  5L3E A;  2R7Q A;  5J1R A;  2MD0 A;  4C30 A;  1VF9 A;  4RDU A;  3ZQL A;  4UB6 C;  3C1D A;  3E6B A;  3I54 A;  3EET A;  4JQF A;  2HZD A;  3R61 A;  1IDY A;  2DOA A;  3IC7 A;  4Y33 A;  1EJ9 A;  4FIS A;  1K4T A;  4CHU A;  3LNQ A;  2CMP A;  4PCQ A;  5E1X A;  1WCM J;  1I1G A;  3BR6 A;  1HXD A;  2Y48 A;  3OYA A;  1WQ2 A;  2V1U A;  5IP6 A;  2VJI A;  1ULY A;  3E5X A;  3FBN B;  2BEO A;  2EIL H;  3FXQ A;  4KIC A;  4XRF A;  1K83 J;  2EFN A;  3CCU I;  1RI7 A;  4L5J A;  3G71 I;  4ZYD A;  4BNC A;  1RPW A;  4I2O A;  1J5Y A;  1ZAR A;  4LFU A;  4N9I A;  3ZMD A;  2O0Y A;  3I71 A;  3Q0U A;  1MW7 A;  3SZG A;  2CQQ A;  4AD9 A;  4IRG A;  2L2O A;  3S3N A;  4XSX F;  2XAJ A;  3U1K A;  3RJP A;  1NK3 P;  2NNY A;  2NVT J;  3K4N A;  1YG2 A;  2RAE A;  1ZG5 A;  2E1C A;  1BOB A;  1S29 A;  2VIX A;  4B8X A;  3GFI A;  3G1M A;  1B72 A;  1VQN I;  2ZO4 A;  5DV5 A;  4MHG A;  2R5Y B;  2O8K A;  1U6G A;  2VL8 A;  3HM5 A;  3T0Y A;  3F8B A;  3J81 Z;  2VOO A;  4RA2 A;  4NQW A;  3OIQ A;  2STT A;  2YR2 A;  4WWC A;  1DP3 A;  2I8D A;  2JRT A;  4M9S A;  3L2U A;  1OKR A;  3ZQF A;  2R92 J;  2OU2 A;  4JX4 A;  3HOS A;  1KU7 A;  3A0B C;  1SVL A;  1S7E A;  1ZN2 A;  2O61 A;  4LG0 A;  2ZME A;  4HLY A;  3IRR A;  1XTA A;  4RGU A;  4B48 A;  2C6Y A;  4A3I J;  1O7L A;  4EAT A;  1YW9 A;  5TRD A;  4LLN A;  4F93 B;  2IAI A;  3BJ6 A;  2L3D A;  3NQO A;  3RSN A;  1SD5 A;  2XGD A;  4N4N B;  4GDF A;  3BG3 A;  1SMY F;  1LDJ A;  1TNS A;  3I56 I;  1VI0 A;  4D7M A;  2MD5 A;  3ECH A;  1ZG1 A;  2QGU A;  2X48 A;  3M8J A;  2MAB A;  4KN4 X;  2D5V A;  2FD5 A;  2HI3 A;  4PJM A;  3UKG A;  4DW6 A;  2P4W A;  2W57 A;  1B8I A;  3JSP A;  5LEJ A;  1LDK B;  2IS4 A;  2ETH A;  3AKZ A;  2VPR A;  4P9U A;  3PO2 J;  1TWG J;  3CJQ B;  4B3A A;  4L5E A;  5DM7 F;  5D5X B;  2CO5 A;  4HW0 A;  3QYE A;  2KZG A;  4FQG A;  3KP7 A;  5IT9 K;  3VYU B;  3IHU A;  2M9H A;  2DK8 A;  4NQW B;  4KIG A;  3L2Q A;  2EZK A;  1F1Z A;  4NUB A;  1IRZ A;  2DBB A;  1MH4 A;  1GXP A;  2DPU A;  4XSZ F;  3QPH A;  3OIP A;  2DK5 A;  1QNT A;  2M87 A;  3R60 A;  4MIM A;  2DA7 A;  2JA5 J;  3I4N J;  2EZL A;  4BJ6 C;  4ANJ A;  1YIJ I;  3T8T A;  2LFB A;  4LG0 B;  2ZME B;  1JTY A;  5IT3 A;  4HV5 A;  3MWM A;  4B47 A;  5EEA A;  2KFD A;  3RZD J;  1JGS A;  3BR5 A;  4YEL A;  2KZV A;  2BW3 A;  2OA4 A;  3R6S A;  2GLO A;  4EJT A;  3HRT A;  2PMZ N;  3IH2 A;  1IV6 A;  1J2X A;  3CQZ J;  1D8K A;  2JPC A;  3CP2 A;  4XIC A;  3OYE A;  1WH5 A;  3VPR A;  3MD2 A;  5HS8 A;  2DFH A;  4NB5 A;  1D1A A;  3QP5 A;  1RR8 C;  1B8I B;  3DWL E;  1Z3X A;  2ECC A;  2QWW A;  2XAH A;  4YIF A;  1ETX A;  4IQJ A;  4KJZ A;  3LA7 A;  2ELK A;  3TO6 A;  2R7Z J;  2MG4 A;  2IGO A;  4HLX A;  3GZ5 A;  3L1P A;  3FHZ A;  2WC2 A;  3QPL A;  3VOD A;  2XAQ A;  4DZJ A;  1RET A;  3RQI A;  2UXN A;  1IG7 A;  1ZK8 A;  2A5Y B;  2VJ4 A;  1JT0 A;  2JZY A;  1TBX A;  2K40 A;  4S0H B;  3S1R J;  1DP7 P;  4ON0 A;  5F1J A;  3NWS A;  5L3F A;  3SEZ A;  4F3Q A;  1X3Z B;  5CVI A;  2Y0S N;  1KON A;  1YHQ I;  2W4S A;  4PFP A;  4BXF A;  2XRL A;  4XKB A;  1Y6I A;  4IKF A;  3RI4 A;  4M73 A;  4AM3 A;  3G4S I;  2PFB A;  4NC7 A;  3D1N I;  3E97 A;  2V6E A;  2ME0 A;  3EYY A;  4IL6 C;  4B4C A;  1VQ5 I;  4Y15 A;  2KHM A;  1IN4 A;  2DOF A;  2PI0 A;  5J8C A;  1VQ6 I;  2BW3 B;  1L3L A;  3TDU C;  3R0A A;  3CCQ I;  3OS2 A;  2BHZ A;  2DT6 A;  1MNM C;  1WZ2 A;  3LFU A;  4I99 C;  1H88 C;  1X3U A;  2VUM J;  5JLX A;  4UVA A;  4QPQ A;  3DEW A;  2CJJ A;  1KYW A;  3HRS A;  1BR4 A;  2DT7 B;  3A02 A;  4UV9 A;  4O5V A;  1HF0 A;  1SFE A;  1FEX A;  1KYZ A;  1Z91 A;  2NOG A;  3S8P A;  5FGM A;  5DDG A;  2DXI A;  1SMT A;  1XB4 A;  3BTI A;  3KP5 A;  4XRS A;  1MJ9 A;  3BG6 A;  1T0F A;  5F0H A;  2XVC A;  2BGC A;  2F6C A;  2Q2E A;  1Y8Q B;  3L00 A;  2VXZ A;  3SDB A;  4BL0 B;  3N97 A;  4BBR J;  1XSD A;  1OCC H;  3A2K A;  1HA8 A;  3GXO A;  5A2Q Z;  5E3O A;  3CCR I;  1UB9 A;  2MGQ A;  4BAY A;  2E19 A;  1V54 H;  2CQN A;  4C2U A;  2YU3 A;  3KEY A;  2CQ7 A;  4MO7 A;  4KFC A;  3I4P A;  3HPH A;  1LPQ A;  2FBK A;  4UUT A;  2FRH A;  3ERM A;  3H0G J;  3LA2 A;  1RNL A;  2VJ5 A;  4E7H A;  2P7C B;  1YE9 A;  1VZ0 A;  2F4O B;  2X9D A;  3OYJ A;  2MW8 A;  3OOU A;  4RB2 C;  1O57 A;  4WXC A;  2GXB A;  2GIV A;  3HOU J;  1FY7 A;  2VE8 A;  3AG3 H;  1RR7 A;  2ZFU A;  2V1N A;  1YTY A;  4A6D A;  1ENH A;  1T08 B;  2JMW A;  2A6E F;  2W24 A;  5GTH C;  3F3X A;  2BHY A;  3K4K A;  2DAO A;  2NVU B;  4BQN A;  3CCJ I;  1WHU A;  2FU4 A;  2GM4 A;  1GVJ A;  2HWV A;  2Z3Y A;  5J6X A;  2HS5 A;  2ME6 A;  4YIR X;  3BJO A;  3GLX A;  4H4K C;  2CV2 A;  2R7U A;  4QWQ A;  3GTK J;  4EVI A;  5LD2 C;  3BT9 A;  3GO5 A;  1R1U A;  1W1W E;  2IGK A;  4HQM A;  3CC2 I;  2CUE A;  5JVT A;  3HEF A;  4BJ5 C;  4LMY A;  4E6K G;  1SD6 A;  2F5C A;  4A3L J;  3SXY A;  3DFG A;  2Q2E B;  3EQL F;  2M30 A;  3TOA A;  5D8K B;  5HLH A;  2DN0 A;  3M7G A;  2DO7 A;  5CKT A;  1WJC A;  2ADU A;  1JHF A;  4M3G A;  2ZJP F;  3LAP A;  2B0L A;  2H1L A;  4A3M J;  1APL C;  5FJ8 J;  2MFZ A;  3PSI A;  2A6T A;  2CW0 F;  2ZXH A;  3CCS I;  3HOW J;  1W7P D;  3KYC B;  2V6C A;  2DYS H;  2ZNY A;  2VE9 A;  2RNJ A;  1MNE A;  2H6C A;  4ZDP A;  4HYE A;  1CQT A;  3MQ0 A;  1QHG A;  1ETY A;  3KP2 A;  1FBS A;  2P6T A;  3BJA A;  3WGG A;  4Y13 A;  2H27 A;  2K9S A;  3I59 A;  4E70 A;  3K4C A;  5LHI A;  4DBR A;  2BXY A;  4G6Q A;  4N9H A;  3F8C A;  3ML6 A;  3QPS A;  2XUB A;  3FHN A;  3HDD A;  3DKX A;  4PGG A;  5CQG A;  3IV5 A;  3PIP F;  1O7F A;  2QA4 I;  4CIC A;  1T38 A;  2IPQ X;  2OAZ A;  1G4D A;  1VND A;  1E17 A;  3ABT A;  2BY2 A;  2EH3 A;  1YS7 A;  4ZYE A;  2LMD A;  3VYT B;  1VQO I;  2HYF A;  1MMD A;  5JR3 A;  2WAQ A;  3U21 A;  1XMK A;  3DU5 A;  4CA0 A;  1JXS A;  1XGN A;  2F2E A;  3ECO A;  2VQC A;  3FKI J;  3L2V A;  2H8W A;  3CO6 C;  3DLL F;  4ENJ A;  1ZRE A;  1FOW A;  3FXM A;  3PNV A;  2V9K A;  2X1C A;  5F0F A;  1R36 A;  3CF5 F;  3CME I;  1NTC A;  1WJ5 A;  2PJR A;  2WV0 A;  3LQQ A;  3G6E I;  3CJN A;  1DGW Y;  3BOQ A;  2R93 J;  2X51 A;  4XLP F;  2AS5 F;  4D9J A;  3VSL A;  3I58 A;  5HLG A;  3OYB A;  2V79 A;  1R23 A;  3IWF A;  3JAM K;  2X4H A;  3AL0 B;  1PP7 U;  3CF2 A;  3I3L A;  1ZQ3 P;  2HPM A;  1OCP A;  4ASN A;  4BE0 A;  2LKS A;  3I59 B;  1W5T A;  1VQM I;  2R5Z A;  1BC7 C;  1P4W A;  1Y0N A;  4J00 A;  1WSU A;  3K2Z A;  3K69 A;  2XAS A;  3ZQG A;  4KIB A;  3IUO A;  4GGG A;  1Y0U A;  3GFJ A;  1JKR C;  3Q5F A;  5B66 C;  3D5S C;  1MMS A;  3ZCO A;  1YI2 I;  3MAJ A;  4OAY A;  3LQR A;  1FNN A;  3GFL A;  4DGW B;  2UWM A;  4DYC A;  3P9C A;  4U7D A;  1X2N A;  1YO5 C;  2HDD A;  2HKO A;  3A0H C;  5HS7 A;  2JN6 A;  2KJB A;  4AUX A;  5GAE J;  3Q0W A;  5KVR A;  1OCZ H;  2ZJ2 A;  3K0L A;  1EH6 A;  3S93 A;  5J4Y A;  3CO7 C;  1IRG A;  2EFO A;  5LRS A;  1OYY A;  4BAC A;  4LLL A;  3DBR B;  2A3S A;  1AU7 A;  1A6Q A;  4L9V A;  1QZY A;  1LE8 A;  1X19 A;  2V4J C;  4BQO A;  1M1E B;  4RAY A;  3F72 A;  5K5O A;  4IO9 F;  3T1B A;  5ILU A;  3CUQ C;  1SD4 A;  1TT0 A;  3JRD A;  2PJR B;  1D8J A;  3KIO A;  1ZR2 A;  1I5Z A;  3ERE D;  4G7O F;  2VT2 A;  2EIM H;  2XKO A;  4BQQ A;  5AIQ A;  1AOY A;  4CCJ A;  1MJA A;  2XF7 A;  3HHG A;  2OQR A;  1UMQ A;  2B7E A;  2ELJ A;  1K6O A;  2UXX A;  3F0C A;  2K3F A;  2VT3 A;  5BOX A;  4QSH A;  3RKX A;  2R5Z B;  1K7A A;  2CV1 A;  2N8G A;  3S2D J;  3PL8 A;  2ZKZ A;  2VAS A;  2DPD A;  5M5Y J;  3QU6 A;  4BE1 A;  1AKH A;  2Z5U A;  2CU7 A;  3GZN B;  2M45 A;  1GVD A;  4HOB A;  3LSG A;  4BY7 J;  4PSX A;  4CO8 A;  1P6R A;  2F48 A;  1FMV A;  2DA3 A;  3ZQ7 A;  4B3X A;  4HDV A;  1MBK A;  4F52 A;  2GXG A;  4KT6 A;  3HOY J;  3DBL B;  2R3S A;  3WTY C;  3F22 A;  3WTW C;  2M3A A;  3PQJ A;  1ZG3 A;  4ZC3 A;  2EIK H;  4XK4 A;  5BPD A;  4F55 A;  3OS1 A;  3KFW X;  4RAF A;  2H6B A;  3D5L A;  1TW3 A;  4I01 A;  4AYB A;  4PGH A;  3H9J A;  1X58 A;  1LE8 B;  1IUY A;  3HG9 A;  3QYF A;  2V7F A;  3ABL H;  5FO5 A;  5M3M J;  4DQ2 A;  3MKY B;  1ZGW A;  1FWZ A;  3ZMT A;  4KN7 X;  1J7K A;  2XB5 A;  4EM0 B;  3VDX A;  4G6T B;  3MN2 A;  2XPU A;  3WTT C;  2LRD A;  5J3L A;  2XHK A;  1ON1 A;  1A5J A;  3ASO H;  2P6S A;  4IHW A;  2W85 A;  3KLN A;  4IHY A;  2ID3 A;  1A31 A;  5LRR A;  4IQ4 A;  3AFH A;  4WCG A;  3H35 A;  3G73 A;  4IOC F;  4HV6 A;  3OL4 A;  2DFE A;  3DXJ F;  4BGD A;  2F4M B;  2G9W A;  3OIO A;  2X1E A;  2XF5 A;  2YX7 A;  2AQE A;  2HDW A;  1AKH B;  3RDI A;  4LGW A;  1YJN I;  1VQ7 I;  5FRN A;  2Y69 H;  4UVB A;  2QM3 A;  3DLA A;  2VBX A;  2HR3 A;  3CJR B;  3QWL A;  1TLH B;  2KDO A;  1LDD A;  4IRH A;  1H89 C;  1T98 A;  2HKX A;  2DMU A;  2IA1 A;  2JWT A;  1U8B A;  1G3T A;  1NHA A;  2LBF A;  3JW4 A;  4E7Z A;  5BMZ A;  3RPU A;  4HDU A;  4Y52 J;  1MJB A;  2EK5 A;  3D0S A;  4LD5 A;  2E1O A;  2JPB A;  2DTR A;  3A03 A;  3B02 A;  5FFZ A;  2M7B A;  3IH4 A;  2IJL A;  1MSE C;  2XSJ C;  2L7K A;  3PUB A;  3EPZ A;  1RKW A;  4ZYH A;  1XPX A;  2MH9 A;  1ON2 A;  2CFX A;  4YFK F;  2M2E A;  2H8R A;  5FLX K;  2OTL I;  1H0M A;  3FIW A;  4KMF A;  4OMZ A;  2IBD A;  4RS8 A;  2EV5 A;  5D4S A;  4M72 A;  4KMU X;  3I53 A;  3OL3 A;  1B6A A;  4F91 B;  3F9K A;  5HLT A;  5BS6 A;  2ISY A;  5HDK A;  3AAF A;  1K78 A;  1IXS B;  4X1E A;  1T56 A;  1WI3 A;  5L3D A;  1SVO A;  2HDC A;  1X1A A;  1Z21 A;  1GUU A;  2ZSH B;  3OYH A;  3ZN1 A;  4R8H A;  4GXO A;  1E3P A;  3PNY A;  2G0E A;  1YJ9 I;  3KZZ A;  4C3I J;  2Y9Z A;  1VQP I;  4CZC A;  3MEX A;  4ZDO A;  1FTT A;  4I0B A;  4XLH A;  3HSF A;  2LBF B;  5CVU A;  2FA5 A;  2DU9 A;  2RDP A;  3HTU A;  5DCF A;  1ZKG A;  4B43 A;  3WGI A;  1AWC A;  4P1W A;  4HX7 A;  2K7L A;  5GAD J;  3S3M A;  2STW A;  3E0J B;  3KP6 A;  1LUJ B;  4GO1 A;  2VI6 A;  1QQI A;  4HPQ A;  2H1K A;  4L0Z B;  2HXI A;  3SFI A;  3M3Y J;  2NOJ B;  1DGR M;  2R5Y A;  4LIU A;  3L2C A;  3FIS A;  3S2H J;  4RMN A;  3H9G A;  1HST A;  1R6R A;  3G2B A;  2L9S A;  5FRM A;  2V1D A;  4M9X A;  2DA2 A;  2P5V A;  3P9K A;  1U2W A;  4I6Z A;  3DQV C;  5ICG A;  2WB1 N;  2WAF A;  2Y30 A;  1K78 B;  2K3P A;  3VYR B;  1N25 A;  1Z7L A;  1WPK A;  2VN2 A;  3T5X A;  3RKY A;  3WHC A;  3W2V A;  3WTU C;  1JKO C;  1MBF A;  2EA4 A;  1FOK A;  4NBQ A;  2OD5 A;  5E1Z B;  3IKT A;  3DU6 A;  4EM2 A;  3RKW A;  4D5F A;  4C2M J;  4Q47 A;  3SYT A;  4MTD A;  3MKZ A;  5JVG F;  4ZZD A;  3IRQ A;  2F5V A;  1XG1 A;  4XON A;  5E3N A;  5EEG A;  3F8F A;  1R1V A;  2A05 A;  2NVQ J;  3ZP5 A;  3WU2 C;  2DLL A;  2PX9 A;  1ERD A;  4M74 A;  5FFX A;  3H9Q A;  2X6W A;  2AQF A;  1OPC A;  5HVQ C;  2NXN B;  1UEL B;  5K5R A;  2XRN A;  3ZXS A;  4XRM A;  4E7K A;  2JT1 A;  1KQ8 A;  1D1B A;  5LGU A;  1JI8 A;  1F43 A;  2DJN A;  3W2A A;  1BOA A;  2JTV A;  3LSM A;  3HOX J;  3MKW B;  1WWX A;  2QSF X;  4EJV A;  4K2E A;  3ABK H;  3PO3 J;  3JRA A;  4HBL A;  1J75 A;  5KAF C;  1FBU A;  3CZ6 A;  5F08 A;  2DCE A;  5BNG A;  3KZI C;  3PM1 A;  3GFM A;  1ZLK A;  1MBJ A;  5IP7 J;  3DKY A;  3MZ8 A;  4A0X A;  1HKS A;  1D1C A;  4OIP F;  2OZ6 A;  4CUG A;  3HOT A;  2HOT A;  2CUZ A;  3KP4 A;  1J9I A;  3F6O A;  4CXF A;  4NC8 A;  4MQ9 F;  4XR6 A;  3J81 K;  2XC7 A;  1ZHF A;  1VFC A;  1W36 D;  4FX4 A;  5IYB J;  2O6G E;  2COM A;  2EWN A;  3TDZ C;  1OCT C;  2VQH A;  1LFP A;  4HNU A;  3H0D A;  1JT6 A;  3SHF A;  4NHJ A;  2OZU A;  4C3H J;  1SAX A;  4OU0 A;  2MH2 A;  1I6H J;  1POG A;  1LFB A;  3JRI A;  2ZJQ F;  1OFC X;  1RES A;  4IOA F;  3OR1 C;  5FB2 A;  4RLQ A;  1IGN A;  4B1R A;  1YOV B;  1XCB A;  3GTM J;  1TWF J;  5CVR A;  1XSX A;  1S7O A;  3LST A;  1R7J A;  3V7C A;  2MBF A;  1TT5 B;  2XSD C;  1DU0 A;  4R1H A;  1QBJ A;  2QSH X;  3I4M J;  5HS9 A;  2K85 A;  3ZQC A;  3JRF A;  4UNO A;  9ANT A;  1Y1W J;  4L0Y B;  3OYF A;  1PP8 F;  2X6Y A;  1ZH5 A;  1QZE A;  1TWA J;  2JVH A;  1WJD A;  2R7W A;  3E3V A;  2ECB A;  1D0Z A;  2GOM A;  1HDD C;  4EEF G;  3JTG A;  1P9Q C;  3KP3 A;  3TP0 A;  1FYM A;  5LHH A;  4XN0 A;  1GLN A;  3PFI A;  1ZRF A;  3J80 Z;  5CJ9 A;  2K9L A;  2E5N A;  1IO2 A;  2LTP A;  4A3J J;  4RBO A;  2FBI A;  2LR8 A;  4RAZ A;  2HPI A;  4XRS G;  2D45 A;  4BBS J;  1N78 A;  1Y1V J;  3KZY A;  4ZH4 F;  1NG6 A;  2L01 A;  4FET A;  1E0E A;  4PDK A;  2ZXW H;  4P5O A;  4HRI A;  1U5T C;  5C4J J;  1BJA A;  1Z7U A;  1IN6 A;  4AIJ A;  5D6F A;  2R7T A;  1AHD P;  1ZEL A;  3W3C A;  1Q1H A;  2UV1 A;  3LSK A;  1G6N A;  4U0V A;  4ZZL A;  1PVE A;  2F5D A;  1XMA A;  1PYV A;  1R22 A;  2OBP A;  3H5R A;  2W7N A;  2WBM A;  3EUH C;  1ODD A;  1R58 A;  1YFH A;  4M3E A;  2BY1 A;  2CUJ A;  1RUO A;  1BJZ A;  1KU9 A;  1Z9C A;  4AVZ A;  4BU2 A;  2ESH A;  1UAA A;  3WG9 A;  2WY8 Q;  2HVR A;  4LIV A;  1FLI A;  5ICF A;  1WJF A;  4M3F A;  4LOC A;  1T8I A;  3DF8 A;  1VQ9 I;  3CMY A;  3W2W A;  1N77 A;  2GAU A;  3ISP A;  3S1N J;  1TWH J;  2L5Q A;  1Q1V A;  3I5U A;  3I9V 2;  5FLM J;  1LB2 A;  1W36 C;  1X1B A;  3CD6 I;  3S17 J;  3FX3 A;  1FJL A;  4A3G J;  2VQL A;  2PMZ A;  3PSF A;  3O6B B;  1MGT A;  1RRJ A;  3FWE A;  2M0C A;  1TQP A;  2GIZ A;  2I5U A;  5GP9 A;  2K4B A;  4IHT A;  5B5E C;  1QPM A;  4BQA A;  2QKM B;  3KLO A;  3FXU A;  3FXO A;  5LHG A;  1WFX A;  2MYS A;  3K1P A;  1WRJ A;  3FMR A;  2D1V A;  1IZ1 A;  3NAR A;  2H09 A;  3BQZ A;  5TGT A;  4YII A;  1NH3 A;  2QQ9 A;  4E7J A;  2IS6 A;  2MC4 A;  5LGT A;  1B4A A;  5CYV A;  2PMU A;  2PJP A;  5F27 A;  2DDB A;  3HUG A;  2ICW G;  2IA0 A;  3M9A A;  3IH3 A;  2TCT A;  2HYJ A;  3KYL A;  1UFM A;  1S72 I;  2O9L A;  3HJE A;  3LA3 A;  4G8X A;  4XLN F;  5B1B H;  3BTL A;  3TOB A;  2OCE A;  5DEQ A;  3DTE A;  3SFZ A;  4A3K J;  1SD7 A;  3K9T A;  3KET A;  1UCR A;  2E1M C;  2VOD A;  4ZDL A;  2F5F A;  2JRM A;  5TIS C;  1IW7 F;  1YW7 A;  1S7A A;  2BYV E;  2LP0 A;  1MDM A;  2FX0 A;  4KYW A;  1REP C;  1MSF C;  2TRT A;  4A3D J;  1KZH A;  1IN8 A;  1TW2 A;  2KRF A;  1J09 A;  2DJI A;  2LNB A;  5A2Q K;  3J7A Y;  2R7S A;  2M8E A;  1QVU A;  2HTJ A;  2R7R A;  2NRA C;  2KT0 A;  2DT5 A;  5ICE A;  2R7D A;  4CCK A;  2Y2Z A;  2BE5 F;  4CCN A;  3WHB A;  2VBZ A;  1FMW A;  3F8N A;  3TMO A;  3Q0V A;  3S15 J;  1ZTR A;  4YG2 F;  4XOP A;  3PQK A;  1JUS A;  2VC1 A;  4V2F A;  3CMM A;  4ESF A;  4A6E A;  3IAS 2;  2QCO A;  3DPL C;  1R9T J;  3H36 A;  1BIA A;  4L9T A;  3HUG B;  2YS9 A;  4CCL A;  5IOZ A;  4W1U A;  5E3M A;  3JRB A;  1Z3Y A;  1FSH A;  1RC9 A;  4CH7 A;  2P8T A;  1SC7 A;  3O8H A;  3GW2 A;  3A4C A;  3M1C A;  2CS3 A;  5J1U A;  3JSO A;  2M7A A;  3H3U A;  2ZXI A;  2RGV A;  2WV1 A;  3FXK A;  5F6F A;  5IP9 J;  3BCA A;  1ETK A;  5JFR A;  2RN7 A;  1FP2 A;  1OR7 C;  3ABU A;  3DTK A;  3KPH A;  5D4R A;  4CCO A;  5DCM A;  4Z6Y A;  5FLV A;  2Z2S B;  1ZAO A;  4CYD A;  3ELK A;  1MDM B;  2DMQ A;  1FYK A;  3CDL A;  1P2F A;  5DTD A;  3ONQ A;  3IKV A;  2RNG A;  4I0A A;  4BXU A;  3KE2 A;  3G1O A;  2LY2 A;  3SEQ A;  3ASN H;  3CCL I;  2OQG A;  3BR2 A;  2LC2 A;  2J5O A;  3H3Z A;  4LB5 A;  2HVQ A;  2Y9Y A;  2EA2 A;  3C2H A;  3K1N A;  5H2F C;  2WAQ N;  1XC5 A;  1Z67 A;  2K9N A;  1CGP A;  3EYI A;  5EJC A;  5CQE A;  2ZNZ A;  2BBY A;  3M8F A;  2D1H A;  3ESW B;  2HYG D;  3GF2 A;  1I3A A;  1YX5 A;  5E20 A;  1P92 A;  1WJB A;  3B73 A;  4OIO F;  5CVV A;  4HF1 A;  1LJ9 A;  2BV6 A;  2VB6 A;  2WY7 Q;  2FSW A;  2FEZ A;  4AVP A;  1IN5 A;  1TQM A;  3LSI A;  2DA4 A;  3WU0 A;  2W82 A;  1OLT A;  4XMY A;  3GME A;  1UHW A;  2VBW A;  2XGX A;  2QKL B;  1VQ8 I;  1IRX A;  3CCE I;  3LSH A;  5D6E A;  4ZJZ A;  2CWE A;  2M0M A;  2DA6 A;  2DTZ A;  4DNC A;  1LVA A;  3MKL A;  4DYR A;  1WJA A;  3NEU A;  1U78 A;  5L3B A;  3BTJ A;  5LFA A;  1I1S A;  4P96 A;  4L18 B;  2M4G A;  5DCM B;  5AON A;  1X1D A;  2QQ8 A;  3GTL J;  2MSY A;  1Z6T A;  5CLS A;  1U9N A;  3VSK A;  1XDU A;  2QVO A;  2UZK A;  1LNW A;  3AG2 H;  3EUA A;  4EJW A;  3QP6 A;  2HVS A;  2LG4 A;  1U3E M;  5M3F J;  3BZ6 A;  4WXD A;  3FDY A;  3BPV A;  5C3E J;  2HOA A;  4ESJ A;  4G9Y A;  2XPW A;  2DA5 A;  1I50 J;  2OPT A;  2PQ8 A;  2W48 A;  2RVC A;  4UUS B;  3DTI A;  1VQL I;  2JVG A;  4IZZ A;  1K79 A;  1MMA A;  5KAI C;  3F21 A;  2HQA A;  4HX8 A;  1WH7 A;  1BBY A;  2AHQ A;  1XS9 A;  1OQY A;  1X1C A;  4GYG A;  1Z0X A;  2JUC A;  4DZP A;  2HOS A;  1HKQ A;  3K70 D;  1T33 A;  1V5E A;  1HLV A;  4Q5S F;  4L9J A;  3FF5 A;  1UHM A;  3E6C C;  3Q3S A;  2A5W A;  1QRY A;  1Z77 A;  3S14 J;  4I09 A;  4IVN A;  1QU3 A;  1K6Y A;  4M9Z A;  3RTR A;  3FMQ A;  4WX9 A;  4X0G A;  2IA2 A;  2H94 A;  3CP8 A;  4XNF A;  2AXL A;  2NYX A;  3GYH X;  5B3S H;  1IRF A;  4M6X A;  4OWR B;  2E35 A;  1UJ8 A;  1W7P A;  2RQP A;  3A01 A;  2VKV A;  3LMM A;  4D7N A;  3KCC A;  4HX4 A;  5J1Y A;  2CH0 A;  2BVL A;  3CUQ A;  5J47 A;  2OJE D;  2LD5 A;  3NRV A;  1LQ1 A;  1ZYR F;  3CDI A;  3T8R A;  1SFX A;  3SZT A;  4U7B A;  3CUO A;  2LYC A;  3E5U A;  4MLO A;  1OJL A;  1YIO A;  2JA6 J;  1Y56 A;  4YEJ A;  1I6X A;  1U9O A;  4KIS A;  1SFO J;  3PJR A;  2R7V A;  5E8G A;  2COB A;  3WG7 H;  4GCV A;  3LFK A;  3UR3 C;  2FNP A;  2JUG A;  5TJJ A;  3O8G A;  4XID A;  4KIT B;  5EG0 B;  3GTQ J;  2QF7 A;  4BDY A;  4A5N A;  1E2X A;  1V5G A;  3AG1 H;  4MNU A;  5HOO A;  4QTR A;  3CCV I;  1BI0 A;  2X6O A;  1R71 A;  1HKT A;  3HOZ J;  3OYL A;  1YYV A;  2Y0M A;  3I0T A;  4A3F J;  1A36 A;  4U88 A;  2X85 A;  1IN7 A;  2PN6 A;  3O2P E;  3PIO F;  1MMG A;  2OV7 A;  1BIB A;  2WWY A;  1ONV A;  2A61 A;  3WE3 A;  3DBH B;  3QOE A;  3IAM 2;  5C4X J;  4FAS D;  1NG7 A;  4PJN A;  1ETW A;  1BW6 A;  2RKH A;  2LY9 A;  5ILV A;  4CGZ A;  2XF6 A;  3CMA I;  3V42 A;  4FT8 A;  3ZMV A;  3U9G A;  2FOW A;  4AIK A;  4RGX A;  2LDU A;  4BYY A;  4C2T A;  1W7P B;  4IRI A;  3A01 B;  4XKW A;  2EB7 A;  3CUQ B;  1YS6 A;  2LSO A;  3W6V A;  2F5E A;  1HW5 A;  2BVM A;  2GZW A;  4D5C A;  2HGC A;  3O3K A;  4JBA A;  4E4H A;  5IOY A;  2CW7 A;  3LSP A;  4G6D A;  2EFP A;  3CC7 I;  2KIQ A;  2VC0 A;  3KX2 A;  3VEP A;  3HKZ N;  2XAG A;  2K4J A;  2LKX A;  4MGR A;  2DMN A;  2NNN A;  2RV8 A;  3BZK A;  3M8E A;  4LJZ F;  3FZV A;  5E1W A;  5L3C A;  2QLZ A;  5FD6 A;  1IXC A;  2DMP A;  3K70 C;  2K86 A;  3GEZ A;  5K5Q A;  1IF1 A;  1IXR C;  3BLY A;  2G7U A;  3BCB A;  3OYC A;  4ZTJ A;  3A1Y A;  3OYD A;  3VYS B;  4MTE A;  2GA2 A;  1Z6R A;  2HQN A;  1AA7 A;  2DW4 A;  3PFY A;  2BZT A;  3HSE A;  3ROU A;  4HQE A;  5H6R A;  2EIJ H;  1I27 A;  2EV6 A;  4NNJ A;  2HEO A;  4YRV A;  2L7M P;  1F9N A;  1D5V A;  4XLC A;  2LLK A;  3LOC A;  5DD4 A;  2DFI A;  4P9F A;  1QPI A;  1FP1 D;  1ITY A;  2BY3 A;  2QBY A;  3BZC A;  4F7Z A;  2VBY A;  1E3H A;  1W5C C;  5FKO A;  2XAF A;  1QA6 A;  2XIG A;  3E5Q A;  2Z33 A;  4O6J A;  1K4S A;  1FT9 A;  1V5F A;  1B59 A;  2E71 A;  2JK3 A;  3FXR A;  5J4V A;  2M1B A;  1FIA A;  5ED4 A;  4A3E J;  4AWX B;  4Z2Y A;  2PG4 A;  1D5Y A;  1RUN A;  1STZ A;  1S8N A;  1LEA A;  5BQT A;  5E17 F;  1HSJ A;  1ZR4 A;  2M4K A;  2OTJ I;  1LEB A;  4E7S A;  2FQ3 A;  3FM3 A;  3FKJ A;  3JRC A;  3AG4 H;  1JUP A;  1BN5 A;  1W5S A;  3BR0 A;  2XB0 X;  3K4J A;  2HNH A;  3FM5 A;  5EYR A;  2HQR A;  3CTA A;  1USS A;  3BG9 A;  5GPA A;  5F04 A;  4FE4 A;  1G2H A;  1OYI A;  1X4P A;  1X1P A;  2IT0 A;  3K10 A;  4IXA A;  5ICC A;  3VWB A;  4EQQ A;  1U0J A;  3GBG A;  3BG7 A;  3K4L A;  4NC6 A;  3TKY A;  2OF7 A;  2CG4 A;  3QU3 A;  2GXA A;  3E6D A;  2QBY B;  5F1R A;  1GV5 A;  1SFK A;  1OCO H;  4HEA 2;  3J7Z I;  1WVR A;  3RCO A;  1EA3 A;  2MLG A;  2KMU A;  2DMT A;  2CW8 A;  3OYM A;  4HAM A;  2LKP A;  4ENN A;  2A6H F;  4ENK A;  2WTE A;  4HG2 A;  3IWZ A;  4BUP A;  1BI1 A;  4BHC A;  3BTC A;  2QQB A;  1KA8 A;  3L09 A;  5C44 J;  1R5H A;  1HW1 A;  2KJC A;  3C18 A;  1B1B A;  1ZRC A;  2FXA A;  2CYY A;  4HA8 A;  1DPR A;  2Z9O A;  4Y4R A;  4BEH A;  3K4B A;  2JA8 J;  2IXS A;  1O3Q A;  1JE8 A;  2E1N A;  3S3O A;  1YLF A;  4E7I A;  1P7I A;  3DPT A;  4IHX A;  1YQA A;  3P9I A;  1HC8 A;  4RB0 A;  3V4G A;  4I76 A;  3RYR A;  2FF4 A;  1UHS A;  2KRC A;  1GDT A;  1WKM A;  2TDX A;  2R7X A;  2ZJR F;  5F0C A;  5K7Z A;  3BY6 A;  3GTO J;  3U2R A;  2PMH A;  2KL4 A;  3RYP A;  3Q9S A;  2ID6 A;  2Z99 A;  4L9N A;  1EH8 A;  1WJE A;  5IYC J;  2PLY A;  4ZYG A;  4BE2 A;  5E8I A;  3I55 I;  2WB1 A;  2L9R A;  2CRG A;  3BQY A;  4D0P A;  3FK7 A;  1HCR A;  2P5K A;  1TTY A;  3KEQ A;  3K6G A;  2X6X A;  4DBQ A;  2YU9 J;  5HDG A;  4CCM A;  4ZTF A;  3U1D A;  1JKP C;  3EDP A;  4M3B A;  2F4I A;  3DP7 A;  4FCY A;  2VKD A;  2XV4 S;  2GOX B;  2NAZ A;  2O7O A;  3BPX A;  3JTH A;  3GLL A;  4A0Y A;  1GT0 C;  2ZME C;  5D8L B;  3FXL A;  3DV8 A;  4N4O B;  1ETV A;  5IY5 H;  4A93 J;  1LKX A;  1GHC A;  4FTH A;  3BR3 A;  3FK6 A;  4BEH B;  5DM6 F;  1EV7 A;  3OYI A;  3GTG J;  2YX4 A;  2E5Z A;  2EJR A;  5D5W B;  2CV0 A;  2JSC A;  1F5T A;  1H9T A;  3D5R C;  2B9S A;  2LY1 A;  2O3F A;  2P7V B;  2FQ4 A;  4OIN F;  2VON A;  5EZH A;  1H9G A;  1O4X A;  4TV7 A;  1OYW A;  4AC0 A;  1R4M B;  3VOE A;  2E36 A;  2VLA A;  3SZP A;  5D5U B;  4EGZ A;  2YPR A;  3H1C A;  4DOZ A;  5GAH J;  1F4K A;  2EQR A;  2X1D A;  2CUF A;  2K9M A;  3L2R A;  2JSP A;  2FNA A;  1X4O A; 
#chains in the Genus database with same CATH homology
 4XLE A;  3TBI A;  3S93 A;  1UG0 A;  4CCN A;  2P0W A;  4XLA A;  1FMW A;  5CPR B;  3TMO A;  4BAC A;  4XOP A;  4XKV A;  1X19 A;  2V4J C;  2ZSI B;  4BQO A;  3NWT A;  3CMM A;  1TT0 A;  2PJR B;  3IAS 2;  3DPL C;  1QHH D;  2KQR A;  2Z16 A;  4BQQ A;  3HUG B;  4CCJ A;  2XF7 A;  4CCL A;  1D0X A;  2ELJ A;  2W1O A;  1Z3Y A;  4CH7 A;  2WAD A;  4RLF A;  3A4C A;  3M1C A;  2CS3 A;  4IX7 A;  1G59 A;  1LVK A;  2M7A A;  3PL8 A;  2CV1 A;  2CFO A;  2ZXI A;  1G8X A;  2VAS A;  4BE1 A;  4XM3 A;  3BCA A;  1OR7 C;  2R7Q A;  3DTK A;  2MD0 A;  4C30 A;  3LSG A;  3ZQQ A;  4CCO A;  4PSX A;  2Z2S B;  1FMV A;  4B3X A;  3ONQ A;  2RNG A;  4JQF A;  4XL9 A;  2HZD A;  2LY2 A;  4Y33 A;  2DOA A;  4F52 A;  3BC8 A;  3SEQ A;  2LC2 A;  4KT6 A;  2HVQ A;  2CMP A;  2M3A A;  3C2H A;  2LOO A;  3H5A A;  4ZC3 A;  2WA0 A;  1YX3 A;  4F55 A;  3OS1 A;  3OYA A;  5CQE A;  3D5L A;  4AYB A;  2VJI A;  1DQU A;  3H9J A;  3FBN B;  4U87 A;  3HG9 A;  3QYF A;  1YX5 A;  2V7F A;  1WJB A;  3MKY B;  3VDX A;  2VB6 A;  2WY7 Q;  4G6T B;  2LRD A;  3LSI A;  3OS0 A;  2W82 A;  1OLT A;  4XMY A;  2QKL B;  1MW7 A;  3SZG A;  2Z1D A;  3ZGK A;  2L2O A;  4IQ4 A;  3AFH A;  3S3N A;  1IRX A;  2IS2 A;  3LSH A;  3H35 A;  3TL4 X;  4ZJZ A;  3OL4 A;  2M0M A;  3K4N A;  4XOR A;  5KCM A;  4BGD A;  4PJL A;  1WJA A;  2X1E A;  2XF5 A;  2AQE A;  2HDW A;  2R7O A;  5FRN A;  1BOB A;  5LFA A;  2VIX A;  3DLA A;  2M4G A;  3CJR B;  1X1D A;  2KDO A;  2VL8 A;  3VSK A;  3EUA A;  2LBF A;  3OIQ A;  4E7Z A;  2HVS A;  2LG4 A;  1DP3 A;  2I8D A;  3L2U A;  3C2G A;  1T0F C;  3FDY A;  3IP4 B;  2Y0S A;  3HOS A;  2M7B A;  4II3 A;  4BDZ A;  4PSW A;  2XSJ C;  2L7K A;  3PUB A;  2XAU A;  3EPZ A;  1BR2 A;  3DTI A;  4B48 A;  2JVG A;  4IZZ A;  3ZR8 X;  4EAT A;  4C9Y A;  2V26 A;  1MMA A;  4F93 B;  3RSN A;  4N4N B;  2HQA A;  3OL3 A;  1MND A;  4F91 B;  3F9K A;  2VPL A;  5HLT A;  3M8J A;  1X1C A;  4HNT A;  2MAB A;  3EUK L;  4PJM A;  3K70 D;  1LDK B;  4D1Q A;  3OYN A;  1V5E A;  1X1A A;  2IS4 A;  3AKZ A;  1Z21 A;  3L2W A;  2ZSH B;  3OYH A;  4XKC A;  2A5W A;  3CJQ B;  4F92 B;  4DIQ A;  1QU3 A;  3PNY A;  1K6Y A;  3RTR A;  3QYE A;  3VYU B;  4X0G A;  4CZC A;  3CP8 A;  4ZDO A;  4XLH A;  4NQW B;  4XNF A;  2LBF B;  3L2Q A;  4NUB A;  4DJA A;  3OYG A;  4OWR B;  4B43 A;  2LH9 A;  3LMM A;  4P1W A;  2CH0 A;  2BVL A;  3OIP A;  3S3M A;  2RQQ A;  3E0J B;  2KPM A;  4HPQ A;  4ANJ A;  4II2 A;  4BJ6 C;  4U7B A;  2LYC A;  4MLO A;  1BR1 A;  1Y56 A;  2NOJ B;  4B47 A;  1DGR M;  4LIU A;  4YEJ A;  2BOL A;  4YEL A;  4RMN A;  4KIS A;  3PJR A;  2KZV A;  3H9G A;  3G2B A;  1R6R A;  2R7V A;  2BW3 A;  2L9S A;  5FRM A;  4LG3 A;  3UR3 C;  1SAU A;  2JUG A;  2K5C A;  3DPU A;  3CP2 A;  3DQV C;  3OYE A;  4KIT B;  2E1M B;  2WAF A;  3AL0 C;  4BDY A;  3MD2 A;  1V5G A;  5HOO A;  2K3P A;  3VYR B;  1D1A A;  1Z7L A;  2OUM A;  3DWL E;  2IS1 A;  3W2V A;  3HXL A;  3OYL A;  1Z3X A;  4HST A;  3OYK A;  2X85 A;  4IQJ A;  4KJZ A;  3DU6 A;  2IGO A;  1MMG A;  2OV7 A;  3K4M A;  2VQG A;  3QOE A;  3IAM 2;  4R79 A;  4FAS D;  1NG7 A;  4PJN A;  5HNH A;  3SYT A;  2VJ4 A;  3MKZ A;  4PJJ A;  2XF6 A;  2F5V A;  4PFO A;  4XON A;  3RQ4 A;  3V42 A;  2KP6 A;  3NWS A;  3SEZ A;  4F3Q A;  4C2T A;  1ERD A;  3OR2 C;  3H9Q A;  2X6W A;  1KON A;  2AQF A;  4XKW A;  4ITV A;  2W4S A;  4PFP A;  5HVQ C;  1UEL B;  3HC7 A;  4BXF A;  2BVM A;  4XKB A;  1Y6I A;  3ZXS A;  4BS9 A;  4E4H A;  5KHD A;  4E7K A;  4IKF A;  2CW7 A;  1D1B A;  4NC7 A;  1JI8 A;  2V6E A;  3KX2 A;  3W2A A;  4ZYA A;  3LSM A;  2KHM A;  3MKW B;  3ZRG A;  2BW3 B;  1MMN A;  2KLO A;  3OS2 A;  3CZ6 A;  2DT6 A;  2DCE A;  3LFU A;  3K70 C;  3H5N A;  4QPQ A;  3DKY A;  1D1C A;  3BLY A;  4CUG A;  4RM2 A;  3HOT A;  1BR4 A;  2DT7 B;  3BCB A;  2CUZ A;  3OYC A;  3A1Y A;  2FUG 2;  4ZTJ A;  3OYD A;  4NC8 A;  4XR6 A;  3VYS B;  1W36 D;  2XC7 A;  3S8P A;  3CES A;  3OY9 A;  2DXI A;  1AA7 A;  3OMY A;  3PFY A;  4GRI A;  3BG6 A;  4NNJ A;  2VQH A;  1LFP A;  3OWT A;  4HNU A;  3H0D A;  2F6C A;  4YRV A;  2VXZ A;  4XLC A;  3SDB A;  4BL0 B;  4J01 A;  3A2K A;  1HA8 A;  2RRE A;  4BJT A;  2LRE A;  3N05 A;  4C2U A;  3KEY A;  2Q1Z B;  3RPU D;  2UUZ A;  3QYB A;  2O5R A;  1V5F A;  3OR1 C;  4RLQ A;  3HPH A;  2W00 A;  4CSW A;  2VJ5 A;  4E7H A;  1YE9 A;  1VZ0 A;  3OYJ A;  3OOU A;  2R4G A;  2ZFU A;  2V1N A;  3OYF A;  3HPG A;  2X6Y A;  2M4K A;  4E7S A;  2JVH A;  3K4K A;  3FKJ A;  1WJD A;  4BQN A;  2R7W A;  4PUS A;  3K4J A;  1D0Z A;  2GOM A;  2HNH A;  1P9Q C;  1S9H A;  4H4K C;  4XN0 A;  1GLN A;  2CV2 A;  2R7U A;  5LD2 C;  2K9L A;  1X4P A;  2E5N A;  2IGK A;  3K10 A;  3VWB A;  1U0J A;  3GBG A;  3BG7 A;  1PJR A;  2WAE A;  3K4L A;  4BJ5 C;  2L9N A;  2HPI A;  1N75 A;  4E6K G;  1N78 A;  3LL7 A;  1NG6 A;  2Q2E B;  4FET A;  1E0E A;  2HU9 A;  4P5O A;  4HRI A;  5CKT A;  1WJC A;  2VJJ A;  3HL2 A;  1SFK A;  4AU7 A;  4HEA 2;  2R7T A;  3RCO A;  1EA3 A;  2MFZ A;  3PSI A;  2KMU A;  1ZEL A;  2CW8 A;  2A6T A;  3W3C A;  2ZXH A;  3OYM A;  2UV1 A;  3LSK A;  4HG2 A;  1PYV A;  4JOM A;  1MNE A;  4BUP A;  4XQF A;  3H5R A;  4RM3 A;  4ZDP A;  2WBM A;  2W7N A;  1QHG A;  3EUH C;  4PK4 A;  4LIT A;  5HNF A;  3E1S A;  4Y4R A;  2CUJ A;  3K4B A;  4BEH A;  3K4C A;  2VXD A;  4DBR A;  2IXS A;  4AVZ A;  4BU2 A;  1UAA A;  3S3O A;  4E7I A;  2WY8 Q;  3DPT A;  2HVR A;  4LIV A;  1WJF A;  3FHN A;  3W2W A;  3DKX A;  1N77 A;  5CQG A;  2IGN A;  4OAZ A;  2KRC A;  2L5Q A;  3I9V 2;  1W36 C;  2R7X A;  1X1B A;  2JA2 A;  2KL4 A;  2PMZ A;  2VQL A;  3PSF A;  1WJE A;  4BE2 A;  3VYT B;  2WB1 A;  1MMD A;  5FRO A;  2IGM A;  4E7L A;  2WAQ A;  3U21 A;  2QKM B;  3DU5 A;  3K6G A;  2X6X A;  4DBQ A;  3FBI B;  3S32 A;  4CA0 A;  4CCM A;  4B44 A;  3L2V A;  4ZTF A;  1WFX A;  2VQC A;  5JHF A;  3QOD A;  2MYS A;  3PNV A;  2OC6 A;  2V9K A;  2X1C A;  5TGT A;  2F4I A;  1WJ5 A;  4XOT A;  4HSR A;  2PJR A;  2VKD A;  2GOX B;  4E7J A;  2IS6 A;  1DGW Y;  2MC4 A;  4XLF A;  2X51 A;  4D9J A;  3VSL A;  3OYB A;  4N4O B;  5KNL A;  2XDV A;  3DEE A;  3AL0 B;  1LKX A;  1T95 A;  2VKH A;  3CF2 A;  3I3L A;  2HPM A;  4BE0 A;  4BEH B;  3KYL A;  2E60 A;  1D0Y A;  4QPO A;  3OYI A;  4Y3O A;  2E5Z A;  4J00 A;  2CV0 A;  3DTE A;  3IUO A;  3D5R C;  2LY1 A;  2E1M C;  2KRH A;  3D5S C;  3ZCO A;  4OAY A;  4ZDL A;  3HKZ A;  4DGW B;  2UWM A;  3UNG C;  3MMY B;  2VLA A;  4XN3 A;  4DOZ A;  3PNT A;  2X1D A;  3J7A Y;  1J09 A;  2DJI A;  2R7S A;  2R7R A;  2K9M A;  1TZL A;  3L2R A;  2JSP A;  4CCK A;  1X4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...