4N4NB

Nitrosomonas europea hao
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
SLAPISAKDMLDYLACKDKKPTDVVKSHTEVENGKIVRVKCGDIVALVQKAREQSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Biological NO Generation by Octaheme Oxidoreductases.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Hydroxylamine oxidoreductase
total genus 12
structure length 56
sequence length 56
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2013-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4n4nB00
4N4OB 4FASD 4N4NB
chains in the Genus database with same CATH superfamily
3PJRA 3IRRA 4BDZA 1TWCJ 3HHGA 4OIPF 5IOZA 1D0YA 1G4DA 5CQGA 1SFUA 5HDNA 3ULQB 1SFEA 2W57A 3P9CA 2WV1A 2KJBA 1LFBA 2JSCA 1K6OA 4HOBA 4NC8A 2X85A 1YIOA 5K5QA 3KYLA 4XQFA 1DPRA 3DQVC 5LBQA 4GYIA 1X1PA 2ZNZA 4RS8A 4M9SA 5FKKA 3BTJA 5CVJA 3JRFA 2KIMA 2TRTA 3MVPA 4MQ9F 1DPUA 2E7XA 2DN0A 4EM1A 2G7UA 3S3NA 3QU6A 5E20A 3JRHA 3EDPA 3TW6A 1UZCA 3K4JA 4ZYHA 3U1KA 4JX4A 3ECHA 1TWGJ 2EV5A 1K78A 4KT6A 3VWBA 5IT9Z 3I54A 4ZYAA 3L2VA 2Z9OA 1I50J 1HKQA 3EUHA 4ZYEA 3I58A 4JX6A 5KNLA 3B6AA 2VLAA 1X4PA 4Y17A 2C6YA 4BH9A 4L0YB 3HPHA 3P5JA 2M30A 5JFRA 3JSOA 1WPKA 2O6GE 5TRDA 3S1MJ 2ZFWA 4WK8F 3MAJA 3BR2A 1ETQA 5FLVA 4XICA 1O57A 4FASD 1IV6A 2ZO4A 4BXFA 4HRIA 2VASA 2VODA 3FXQA 1S5LC 5HS9A 1D3YA 2M4KA 2X6WA 3ZQGA 1RI7A 4BEHA 1JKPC 1KGSA 2O8XA 3P7NA 3DBRB 1PP7U 3JTHA 1UCRA 2HPIA 1YS6A 2ESNA 1BR1A 2KT0A 5CKTA 4EJUA 4AIDA 2B9SA 2HYGD 2HTSA 2M5WA 1V4RA 4U87A 3M9AA 1UMQA 1Y56A 3WTVC 4XKWA 1O7FA 3M1EA 3V7RA 3KEQA 2HKXA 3BG3A 1S7EA 1MGTA 4UV8A 3T0YA 2XSJC 1YRNB 3DKXA 2ISYA 3PNVA 3GTGJ 4CZCA 3JREA 2KZGA 1IV8A 2QQ9A 4AIHA 4RGSA 3ZN0A 2IS6A 2DPUA 2H1LA 3OMYA 2CU7A 1O3RA 3ZQFA 5E3LA 4G7OF 3KYCB 3G1LA 5D6EA 3TBIA 3ZMDA 4N9IA 1WGXA 3IAM2 1S6LA 1UG2A 3DPTA 4X0GA 2UZKA 4KN7X 2L9VA 4HF2A 4P96A 1E17A 3HOVJ 1ZR2A 3JRCA 1ZELA 1T98A 3BG7A 1BL0A 2VI6A 5ICFA 1FNNA 3N05A 1DP3A 2QKLB 2JRTA 3BOQA 5DTDA 2XIGA 3BY6A 6PAXA 1DGRM 3I4MJ 2LMDA 2F4MB 3A0BC 2FNPA 2VE8A 4JX5A 2W85A 4Y33A 2LDUA 4IL6C 4M6XA 2BOLA 4NB5A 3CCQI 4Y3OA 2LLKA 1DU0A 1U0JA 1ITYA 3S2HJ 1BI1A 3LSMA 2ZXWH 4OINF 2IEKA 2BGCA 1U8BA 1MNMC 3W2AA 1UJ8A 3S93A 1IRZA 1JT0A 2HWVA 1B8IB 1JUPA 2CUEA 1W4MA 3DTKA 1RPWA 5HLHA 3RYPA 4L0ZB 1D8JA 3N97A 1BA5A 4B09A 4A3GJ 2RAEA 2KIQA 1KYZA 2OBPA 1ZG3A 3K1MA 2COBA 1FBQA 1QVUA 4RA2A 5DV5A 3RKYA 1W0UA 1IG7A 3PUFA 4NHJA 4ZZDA 2L01A 4BHBA 1U6GA 3OV8A 3OYGA 2Y31A 1W7PD 3H5NA 3DEEA 3K6GA 2JK3A 3P9KA 3I9V2 3K2AA 5J1YA 1G6NA 2RKHA 2NS0A 3CQZJ 4QLCU 4HDVA 4AIKA 2E1OA 4EJVA 5J8CA 2KRCA 2BEOA 3BG6A 2WV0A 3ABKH 4CZZA 2ZMEC 2YU9J 3DKWA 2BW3B 2RDPA 5HLTA 3OOPA 4A0XA 2F4OB 1I1SA 3ZN1A 2FNAA 3E6MA 3JRBA 4HQMA 2JA5J 3W2WA 2W1OA 1DDNA 4RM3A 1Y1WJ 1BR2A 3FBIB 1OFCX 1USTA 4A0ZA 1YHQI 3GTPJ 1HQCA 2WB1N 5DM7F 1GT0C 1B4AA 1RNLA 1PUEE 1E3PA 1R4NB 2MC4A 3HL2A 1YJWI 4HZFA 1ZN2A 3K70C 5E1XA 3F3XA 1JTXA 2EFOA 2VT2A 1YJ9I 2AQFA 2NXNB 2K7LA 1P7IA 3P9IA 4UV9A 5ICGA 4EGYA 1QVTA 1KONA 2MSYA 3FZVA 4HNTA 1ZRCA 2JVGA 1VQ6I 2DLLA 5CVVA 2L2OA 2OU2A 1EA3A 1QZYA 3RPUA 1MDMA 2QQAA 3G6EI 4Y13A 2JUGA 2KRHA 2EIKH 1P4WA 4YG2F 3Q0WA 4H4KC 1JKOC 1XCBA 1XX5A 3RKXA 3A1YA 3SYTA 4U88A 3BTLA 3C1DA 3ZQ7A 3I56I 2R7ZJ 3ABLH 1JGGA 4RMNA 5GAHJ 1U2WA 2L7KA 1V5GA 1JTYA 4L5IA 5E3OA 4TV7A 1GLNA 2BZTA 4P9UA 4MIMA 2HTJA 4BY7J 1FYLA 4IOAF 1B9NA 1WWXA 3DPUA 4FTHA 2O03A 2ETHA 4IHSA 4BDYA 3OYHA 2FRHA 2DK8A 4KISA 4E7SA 5LD2C 3JW4A 4XKBA 4N9HA 3TOBA 1IUFA 3ONQA 2QBYA 4KICA 5K5OA 2XAGA 2IGOA 2VOOA 2QCOA 5JVGF 4D5CA 1BI3A 1S72I 1HOMA 2BE5F 3ZQHA 4HBLA 4W1UA 1U8RA 1IDZA 1WZ2A 1I27A 2K02A 3ZQQA 2CV1A 1OCPA 1SFXA 5J4VA 2K40A 4GO1A 4M9ZA 4XSZF 3K10A 2BY0A 2WAEA 2V6CA 5K7HA 5FKLA 3FXLA 2E36A 4Q47A 1LDDA 4FCYA 2VPRA 4IRGA 3TQNA 5A2QK 3HKZN 3ML6A 2E19A 2EFPA 3LSRA 3QPLA 5EEAA 2JMWA 1R1TA 3I59A 3VSKA 2DDBA 2EBIA 2IBDA 4OIRF 3MFKA 4DZJA 5H6RA 2BY3A 4EJWA 2W48A 4LK0F 2VE9A 3KIOA 2HNHA 2EPFA 5JHFA 1ETKA 3C3WA 2Y0SA 1FBSA 4LG3A 1ZR4A 2Y0MA 2DPDA 3I0TA 3CC2I 3CF2A 2WAQA 1FOYA 2I10A 2J5PA 3FX3A 4MO7A 1N78A 1Z3YA 3KE2A 2A68F 2NVXJ 3SDGA 5F27A 5LHGA 1MIJA 4LOCA 3DTEA 3IUOA 3GFJA 2E5NA 3PQJA 1ZYRF 1SAXA 1MW7A 2L9NA 2V1XA 3RKWA 1BM9A 2EK5A 4KN4X 4ZDLA 2MFZA 4RGUA 3MMYB 3SZTA 5EGOA 3PO2J 3V42A 5BNGA 5GPCA 3LOCA 2GXAA 4LK1F 1LEAA 1KU2A 3GYHX 1XC5A 5KHDA 3JCUC 3Q5FA 3CC7I 3L2RA 3BWGA 3WU2C 3GTKJ 4V19K 2GIZA 3IH3A 2VBZA 2DQRA 2GQQA 2KZVA 3ZGKA 2BVLA 1OCOH 4A12A 2P4WA 4YELA 1Y8QB 3UNGC 4PJ0C 4HLXA 3HTSB 3EPZA 1LE8B 3F8BA 2ID3A 2NYXA 2XB0X 2YPRA 4H0EA 1TWFJ 3QPHA 3EETA 2LY9A 1VQOI 2ACJA 5D5UB 3BPXA 1Z05A 2DMPA 3O2PE 2FMLA 2KDOA 1VQNI 2ELKA 3IWFA 3A4CA 2I8DA 2GAUA 2KPMA 1LEBA 3RKQA 2DT5A 3H9QA 4X6AJ 2XF5A 4XN0A 2MYSA 2W00A 5D8KB 2ZJPF 1JKRC 1FLIA 3VPRA 4F93B 1AU7A 3WG9A 1Z7UA 3T5XA 4FX4A 3E5UA 5D4SA 3BJAA 3FHNA 2EZIA 2VBWA 2OF7A 3BJ6A 4LG0B 1RZ4A 3G4SI 2CS3A 4LB6B 2Y75A 4M9XA 1UG0A 2DJNA 4A3CJ 2M3AA 3PSIA 1T95A 2XPUA 2VC1A 3IAS2 2XAQA 5FB2A 2KQRA 3RPUD 2PX9A 2G7HA 1UHMA 2HZDA 5HOOA 2NVTJ 3GLXA 2VIXA 2EWNA 4A3BJ 4E7JA 2OD5A 3BR6A 3ZR8X 1LDJA 1F9NA 2R7OA 1VQMI 1I3QJ 3GXOA 3LAJA 3CMYA 5BMZA 1WVRA 1ACIA 2V79A 3CDLA 1VTNC 2PJPA 4OMYA 2GA2A 2JJ7A 4RM2A 2QGUA 2STWA 1B59A 1P7JA 1XGNA 3G1OA 1X1DA 3ZMZA 1R23A 1ZRDA 4XLCA 4A3KJ 3OYIA 3G73A 3WG7H 4DQ2A 1R58A 2IS1A 4A3LJ 3DEWA 3CCLI 2XUBA 2V9KA 5CVIA 2R7DA 2WTEA 4G12A 4KIFA 2GBYA 5ILSA 3KETA 3G3ZA 1ETXA 2K9MA 1NK2P 2RREA 2H8RA 1MJ9A 3N4MA 3AFHA 1EJ9A 1P92A 4A93J 2YU3A 3CCJI 2NNYA 1ON1A 3VEPA 1DP7P 5CVUA 1N77A 4F91B 2GLOA 3OIOA 3VOEA 3QOPA 1A35A 1V55H 1EH7A 3H9JA 2VJ4A 1MBGA 3S2DJ 2WBMA 3SZPA 4MEXF 1IRFA 2K5CA 2CW8A 1BJZA 3M8EA 2HXIA 1ZREA 3OYEA 1QZEA 1T38A 3QODA 4NDLA 2DFEA 3I64A 4S04A 5L3GA 1G3TA 3H3ZA 2CQXA 4NC7A 1YX3A 2ZXHA 3SEQA 1DUXC 1HCRA 4KT5C 4CYCB 3TW7A 4IHXA 1QGPA 1T0FC 1FY7A 2UXXA 1F1ZA 4ANJA 2Y2ZA 3M8FA 3JR9A 4IQJA 2MD0A 3SFIA 3VSLA 1P6RA 3MCZA 4I6ZA 2ZMEB 3MN2A 2JWTA 5J1UA 4ZTFA 3F9KA 1J75A 2DMUA 2VBXA 1R7JA 4JOMA 4HPQA 3W6VA 4KA4A 1FEXA 2D45A 5B3SH 2YS9A 2R5ZA 4BGDA 2ICWG 2LRDA 4BXUA 2CQQA 3CUQB 3Q9VA 5D5XB 1RRJA 3LNQA 2M0MA 2ZKZA 4F52A 1XTAA 5M5YJ 2X6OA 1H9GA 3QWLA 2IS4A 5LHIA 3OYNA 4I01A 3FXMA 3V8KA 5DEQA 4EM0B 1Y6IA 4L9VA 4FHTA 3TMOA 3J7YJ 1T2KA 2A5YB 3ZMUA 1H89C 1ENHA 5J8FA 4XRMA 3JRGA 3BCBA 4IHVA 2JA2A 4P55A 3K4BA 1PYVA 3U9GA 1YE9A 1YW8A 4MFDA 3TOAA 4G7HF 5FLMJ 3H92A 3OSGA 4A5MA 4N4NB 2K86A 4PUSA 4I99C 5FKMA 5TJJA 2PI0A 5E18F 4D9JA 1U9OA 3S3MA 1T39A 3LA2A 2HVSA 3SZGA 2FUG2 1CF7B 1A5JA 1U9NA 3GFLA 3K9TA 4A69C 1BN5A 1OCTC 3DP7A 1ZGJA 2XGCA 5FFZA 2MBFA 3F8FA 3V8LA 2XB5A 4UB8C 5ICEA 1K7AA 2Q0OA 3S17J 2IVMA 2H1KA 2QSHX 1U5TC 1SEUA 3FXKA 1F43A 3CCVI 2JQ7A 2L7ZA 3O6BB 3MZYA 1Q1HA 5J3LA 5F0FA 4ASNA 1F5TA 1FJLA 1VF9A 2OTLI 1X4OA 4CCJA 1MBKA 4XORA 4O3MA 3WTTC 3ABUA 2DO7A 2GA1A 2PMUA 3NWTA 2PEXA 4XNFA 1XS9A 1HW1A 2XAUA 3SDBA 2DYRH 3KYDB 5AIPA 4FT8A 4PGGA 5BOXA 2FE3A 2P7CB 3OS2A 4Y7NJ 1MD0A 2VJJA 4PK4A 2OZ6A 2FJ1A 2RVCA 3OYCA 3I4PA 1XPXA 2IP2A 4XBFA 1JHFA 5GAGJ 1XGSA 4HYEA 2E35A 3IHUA 5J4YA 2GIVA 3PFIA 2Z2SB 2F4IA 2ISZA 3D5SC 4G6TB 5M3FJ 1LQ1A 2R7VA 1X3UA 3GW2A 4NBQA 5JHUA 1O4XA 3BR3A 2W25A 2QF7A 4CCMA 5FFXA 1XDUA 1GXPA 1HXDA 2BY1A 3KFWX 3KPHA 3I59B 4CCNA 2ZSIB 2STTA 2HDWA 4G6QA 5L3CA 3S1RJ 3HBLA 1WH7A 2OA4A 3VYRB 3IH2A 3CJRB 3TP0A 3M4OJ 2F5CA 1BC7C 1R1UA 1WJ5A 3V7SA 3HIFA 1N25A 5B66C 3OYBA 2CFXA 3VYSB 1LVKA 1PUFA 2HQRA 3I5UA 1LNWA 3FM5A 3X2QH 5LGUA 1V3FA 3LMMA 4LITA 3WTYC 3U2RA 5BS6A 1QNTA 3KCCA 2DTRA 1JHHA 2XF7A 4I0AA 4B47A 4E70A 2PN6A 2Q2EA 5EJCA 5L3FA 3ZOBA 3G71I 2P0WA 2VBYA 4PCQA 2VB6A 4M72A 4MQVA 4EJOA 4RB3C 1PDNC 1SD7A 2R5YA 1Z7LA 4CH7A 4GXOA 3ECOA 2DFFA 1D8KA 1AKHB 4L9NA 4LB5A 3GTMJ 3KLOA 2E2JJ 2W84A 1E3HA 4BE1A 3JRIA 4LIUA 3HSFA 5CYVA 3MKLA 3E6DA 5CLSA 2GOXB 5EEHA 5JLXA 3K70D 4XLNF 2IAIA 2HOAA 2F2EA 3S1QJ 2BXYA 2B63J 5LLQA 1QPMA 2P6SA 3CCMI 2XF6A 1G3SA 1P2FA 2BXZA 5M3MJ 3CCSI 3K7AJ 3GX4X 1R22A 3CTAA 4JYKA 2NOJB 4J19A 1Y8RB 1CQTA 2R7XA 4XM3A 1XD7A 5GAEJ 2YR2A 4XOPA 4QTRA 4A3EJ 3FXOA 3R6SA 1BR4A 1IF1A 1B6AA 4V2FA 1ZG1A 5FD5A 4BHPA 4S05A 4Y52J 3VODA 3LSPA 4G6DA 2NVQJ 2EQRA 1BOAA 5M5WJ 3GEZA 2LY2A 1R49A 5ED4A 2A07F 1JXSA 1W5CC 3TO7A 1KA8A 5E1ZB 1TT5B 2P5KA 2GM4A 4E7KA 2LC2A 3EUAA 1EH6A 2KIFA 4M3GA 1TBXA 4A3IJ 1W36C 5H6QA 4E6KG 1JJ8C 2YX4A 2Y9ZA 2R7TA 1Q1VA 3KZZA 2P5LC 2HVRA 2CV0A 4XRSA 1J0RA 3ABTA 4HSTA 4ENMA 2VQLA 3FKJA 3MZHA 1WQ2A 2EFQA 2M1BA 2A05A 2WWYA 4XSXF 4MEYF 1MNEA 2M4GA 2X1CA 2R4GA 4WCGA 1SANA 3OOUA 3GTLJ 3J80Z 3DTIA 3FKIJ 5DM6F 4DBRA 2MD5A 2PJRA 3TP3A 2CMPA 2XSDC 1X1AA 1LUJB 1T56A 3IWZA 2DJIA 2E7WA 2YUSA 2DA6A 2WADA 2P81A 1I5ZA 2WY8Q 2PMZN 4AM3A 2FQ4A 4PJLA 1SD4A 4PJJA 5GADJ 5BQTA 1X3WB 2ZXIA 4P9FA 2DBBA 2JA7J 1MMNA 3BQZA 1TTYA 2H8WA 2HQ5A 1IN4A 1FC3A 3DKYA 5HS8A 3AKZA 1K78B 1EH8A 1ZQ3P 1IDYA 3LWFA 3SFZA 1VI0A 2NNNA 4ZYDA 3JAMZ 3FBNB 4MNUA 3FK7A 1MSFC 3BCAA 1WJCA 1HKSA 5J6XA 5CQEA 2LP0A 5L3DA 1I39A 2VQHA 4YFXF 1ZGAA 1IO2A 2EZLA 1ON2A 2E1MB 2FBIA 1ULYA 2DMTA 3L1PA 4U7DA 4CO8A 1YOVB 4IPAA 2DA3A 2XRLA 2R7UA 2H6BA 2HEOA 5ERIA 2FOWA 4CXFA 2CV2A 5FKOA 2F5EA 2WY7Q 4JBAA 3Q3SA 2HDCA 1P4AA 1WFXA 4FE4A 2HYJA 2H6CA 5K1YA 4M71A 2E2HJ 5K7FA 4A3MJ 2RV8A 2ADUA 3I55I 1DGWY 3SHFA 3WODF 3M7GA 3PUBA 4CA0A 4Z6YA 1W5SA 2EIMH 3BTCA 4WWCA 2IGMA 3LSKA 1IN6A 3MQ0A 2DMQA 5F0CA 4P5OA 5D4RA 4HV5A 3S15J 2XKOA 1N75A 1ERDA 2XDVA 2XPVA 5E1WA 3CDHA 1A04A 3RZOJ 2KDZA 1YRNA 5EYRA 3S14J 5IYDJ 1UAAA 2IXSA 5F08A 5GP9A 2L7MP 2AXLA 2H94A 1U3EM 3KLNA 1Y1VJ 1JGSA 1F4KA 2EA4A 3FMQA 2QKMB 1MMGA 3DU6A 4FE7A 2VKVA 5GPAA 3DCFA 2XAFA 1F36A 4DZPA 2CSOA 3BT9A 4FQGA 3L2CA 4BE2A 2Y30A 4OU0A 2Z3YA 3HGGA 1ETWA 1NHAA 2VKHA 3S1NJ 1U5TB 1XB4A 2A61A 2PG4A 4UVAA 3FXUA 2R93J 1YW7A 3C2HA 3L00A 2V4JC 3KP3A 4YRVA 1QPIA 2R7QA 2JA8J 2GXBA 1BI2A 1NTCA 3LL7A 4ESJA 3LFUA 4ETSA 1POGA 2CQKA 4ZDPA 1TT0A 2JT1A 2YX7A 5E8IA 3CO6C 1FOWA 3FMSA 4B3AA 4LJZF 3GZNB 4Y15A 2ZJQF 1KQ9A 2FEZA 3G2BA 4LLNA 2EV6A 2QQ8A 4XOTA 3FHZA 4OAYA 1IJWC 2E5ZA 3K4KA 4YEJA 2LNBA 1IAWA 4HW0A 1USSA 5JI6A 2JTVA 1TP4A 2FD5A 2K9NA 2R7RA 2BBYA 4KITB 3HZJA 1U78A 2CW0F 3D5RC 2IGNA 4L9JA 2JUCA 1KU3A 3GZ5A 3LA3A 5AONA 5LHHA 3IKTA 1LDKB 1WH5A 1A6QA 1V5FA 5LRSA 1J59A 3FXJA 1VQ4I 1FOXA 1OISA 3OWTA 4MGRA 4CICA 1SVMA 3O8HA 5FJ8J 4BY1J 3BROA 2DOEA 3HOYJ 5JLWA 1XCVA 3HRSA 4ENJA 3S16J 1HSJA 2EJRA 3HKZA 4AU7A 3DXJF 1QA6A 3HM5A 2Y69H 1K6YA 2UWMA 4HNVA 2TCTA 3DV8A 2HKOA 1OCRH 3RYRA 2KRFA 3V4GA 5HODA 3K2ZA 2EINH 1V54H 3OYMA 4RAFA 5EG0B 3LSIA 4DYRA 5FRNA 3RCOA 1EKEA 3T8TA 4XLEA 2WAQN 2ZJRF 2XRNA 4HAMA 4Q4ZF 1UB9A 3IL2A 3J80K 3EYYA 2BW3A 1FSEA 4HQEA 2WC2A 1VNDA 3CZ6A 3FXRA 1NG7A 4HEA2 2QA4I 3BP8A 3JTGA 4JP0A 2F5DA 1ZTRA 1J2XA 2QM3A 4PGHA 2VONA 1D1BA 4NUBA 4A0YA 2OUMA 2V1DA 2VC0A 2HYFA 3CO7C 2E2IJ 4XLHA 3IRQA 3LSJA 2HQNA 4AUXA 3F21A 2LY1A 4HLYA 4LFUA 4IRHA 1W0TA 2QSFX 1QBJA 1JT6A 3OYFA 1FTZA 3RSNA 1MMDA 2OV7A 1OYYA 4M6VA 3TDUC 3ERMA 5CPRB 1JUSA 3IP4B 5E3NA 4G9YA 3HJEA 1BW6A 1C0WA 2X9DA 1B8IA 3Q0UA 3L7WA 5E8GA 2D2WA 3CF5F 4JK1X 4RB0A 3SXYA 1AA7A 3BG9A 4GYGA 1G59A 2I5UA 5KK1A 1YIJI 2LSOA 2RNJA 4WF2A 4UUVA 5H2FC 4PJNA 4DNCA 4O6JA 4UXNA 4IQ4A 2VL8A 4D1QA 3GUDA 3H35A 3OL3A 1Z1DA 3HUGB 5IYBJ 2ZMEA 2KMUA 2J5OA 4BS9A 4I0BA 1FT9A 4WX9A 3CLOA 1T6SA 1ETOA 1FP1D 3KEYA 4V2GA 2IA0A 2QBYB 1TL8A 4F55A 3OYKA 4UY8I 1ONVA 3I71A 1AHDP 3J81Z 3B02A 4R8HA 2M2EA 1HW5A 4MTDA 5IP6A 2B0LA 4D5FA 2E34A 2CW7A 3A0HC 2MABA 3DU5A 4IOCF 2ECBA 1ZKGA 2AO9A 2VPLA 1E3OC 4UB6C 2ME0A 3WE2A 4N0BA 2PQ8A 2KKOA 1O3SA 2OCEA 1YTYA 4AYBA 3EYIA 2ID6A 2YSRA 3HXLA 3OY9A 2L0KA 1M1EB 3CP8A 3HEFA 3ZMTA 1Y0NA 1MJAA 3C2BA 2JZYA 2CG4A 2DDAA 3C18A 4X1EA 1TWHJ 4KDPA 3REOA 4GGGA 1QQIA 2CQNA 2XGDA 3HGYA 1XMXA 3VYTB 1D5VA 1XN7A 4I76A 4XONA 3EUKL 4OMZA 3BZKA 1VQ5I 3SQNA 1VZ0A 2KJCA 1Z9CA 1OCZH 3H5RA 2QLZA 3KEOA 3UKGA 2LYCA 2DOAA 3A03A 4IHYA 2L5QA 1UHSA 3OYLA 3IKVA 4EMSA 2R5YB 1DU6A 2LREA 1K4SA 1OMIA 3BPVA 1S8NA 2NS7A 2R3SA 2VN2A 1JE8A 3AG4H 3EUHC 3E6CC 5GTIC 3H36A 5DD4A 4RB1A 2P6TA 2DODA 4IHTA 2UXNA 1KQ8A 2HI3A 1G3WA 1NK3P 4I7HA 4ITVA 2E1MC 4S0HB 4M6YA 1BW5A 2XV4S 2M8GX 2KFDA 4CGZA 3F8NA 3HRMA 1FBUA 2K9QA 4BYYA 1QHHD 2ZBKA 2KP6A 2CJJA 1OR7C 3H3UA 3MEXA 4Q48A 2G9WA 4Z2YA 4A3JJ 4HSRA 5KCMA 1RR7A 2QVOA 2ELHA 5TISC 1OQYA 4XRFA 2VUMJ 4EM2A 5HVQC 4PFOA 2OQGA 4E7LA 2HFHA 1WHUA 3BR5A 1KZHA 3VFZA 3TEDA 3TL4X 4OIOF 3QAHA 4ZC3A 3HOXJ 2VKDA 3COAC 3L9FA 1X1CA 3Q9SA 1R5ID 2FXAA 4IX7A 4U0YA 4RBOA 1RUOA 3E6BA 1G2HA 4U7BA 3SJMA 1HKTA 3OYJA 2CUZA 2VT3A 3CCUI 2HPMA 4WXDA 1MBHA 4QPQA 2WAFA 1ETYA 3OIPA 4UUTA 3ROUA 3RTRA 1ZGWA 4J00A 1ZK8A 3DBLB 3BQYA 1B9MA 2FBHA 1D1CA 3D5LA 1OPCA 2DT6A 3QP5A 2N8GA 3GBGA 4BQOA 5LEKA 3HOSA 1XGMA 2KLOA 2MW8A 4FX0A 5IYCJ 2W24A 3V8JA 2DW4A 2OQRA 1LFPA 2BHZA 2VXZA 3HB9A 4CCOA 2XC7A 5EGOB 1OJLA 3JRDA 1WCMJ 1K4TA 1OYWA 4UNOA 3R4KA 1H0MA 1S3JA 1FMWA 2X1DA 1FZPB 3HOTA 2BHYA 2ZB9A 3OIQA 5B1BH 3PNYA 2DU9A 3MKWB 4LIVA 3CDIA 1P4XA 3V7CA 4CDGA 3HTUA 2WA0A 2NAZA 2KHMA 3BG5A 3WU0A 3HSEA 1GVDA 3PFYA 5BPDA 1IW7F 2V6EA 1XMAA 2PMZA 1I1GA 2MH9A 2QYOA 1ZLJA 3ZQIA 3WGIA 5M5XJ 3OYAA 1QHGA 2NS8A 4RGRA 4NNJA 3F6VA 4IO9F 2DT7B 1YJNI 1VQKI 5DUKA 2UUZA 1T8IA 1KU7A 1PP8F 4ZTJA 2FSWA 4JQFA 1R1VA 1SC7A 3H3VK 2R7SA 2DCEA 3LSTA 5D6FA 3ZXSA 4XL9A 1IN7A 1HA8A 3QYBA 3KP5A 3E3VA 4QIWN 2R7WA 2O9LA 1FPQA 5DS9A 1Z3XA 4N4OB 5EEGA 1OYIA 4AVZA 5KAFC 1KQ0A 2FX0A 2GZWA 2K9SA 1VQ9I 3K4MA 1YQAA 1IGNA 1S29A 1X2MA 1MBEA 3M8JA 4BJ5C 3KP2A 3DWLE 5LRRA 1LKXA 1OR7A 1G3YA 3CUQC 1TLHB 1NH3A 2ELJA 4HF1A 3K4NA 4RAYA 3FM3A 1RETA 4CYCA 3QYFA 3NWSA 4NQWA 4BQAA 2V9PA 1KYWA 3FF5A 3K1PA 3H5AA 3E97A 3DPLC 4KIBA 5CJ9A 3ABMH 3E1SA 2HOSA 2A69F 3FIWA 4CSWA 2EFWA 2Y48A 5LGTA 5K5RA 2K3PA 3MWMA 1E2XA 4HNUA 2JSPA 4G94A 5F1JA 5J1RA 1BBYA 3HC7A 3W2VA 5KAIC 2RGVA 4I2OA 1MH4A 4PJMA 2QUFA 2CUFA 3VDXA 2M9HA 3AL0B 4ZJZA 1MDMB 4IZZA 2Z99A 3IH4A 4FISA 3HOWJ 2X1EA 4B43A 4UUSB 1FYKA 3CCYA 1FMVA 1X58A 4UVCA 4D0PA 1RIOH 1EV7A 2XKPA 2E1NA 2OZUA 4E7HA 4GFBA 3LQQA 5B5EC 4BJTA 3K0LA 4WXCA 2R0QC 3KZYA 3JRAA 2EFNA 4ESBA 4F92B 1YG2A 4II2A 3A01A 3RI4A 2AS5F 2A6HF 3H0DA 3HRTA 1RC9A 1MNDA 4BU2A 3WE3A 1MKMA 2IPQX 2QSGX 3RPQA 4AVPA 1W5TA 4BHCA 2TDXA 1XMKA 4M3BA 2MH2A 2MC3A 2D5VA 2JRMA 4CCLA 3WTSC 1LFUP 3O3KA 5A2QZ 2FA5A 1ETVA 4M3EA 1OCCH 4P1WA 1WJDA 5IOYA 3IV5A 1T08B 1T0FA 3K4CA 5FLXK 1CF7A 4QPOA 3GZ6A 4ZZLA 1DQUA 2Z1DA 2KIUA 3F8CA 3QU3A 2M7BA 1HF0A 5IT9K 2K4JA 2XROA 2NVUB 4BBSJ 3J7AY 1RKWA 4ZYGA 5E3MA 3CC4I 1R6RA 3KP6A 3ZCOA 1WI9A 4NC6A 3CJTB 3HOUJ 4I09A 3W6JB 3LSHA 3J7ZI 1WSUA 4AD9A 1MMAA 3OYDA 1YI2I 4AYBN 4C2UA 4C3JJ 3DFGA 3EQLF 1SMTA 2DA1A 1BC8C 2LK2A 1REPC 4KIGA 4BJ6C 2M7AA 2RNGA 4GCVA 1LVAA 3A02A 3H1CA 1JJ6C 2GWRA 3U1DA 1IN5A 2IGKA 3C7JA 3CLQA 1RR8C 4OWRB 3GTQJ 3DLAA 3GMEA 4WXHA 1R71A 1ODDA 1Z77A 3W3CA 3CUQA 3PNTA 2COMA 4DBQA 5EG0A 1SFOJ 1IXCA 4U0VA 3M3YJ 2CQ7A 2DQLA 2M34A 4UVBA 2CRGA 4HV6A 1WJEA 5B1AH 1I3AA 3U21A 4XR6A 2CH0A 2MA3A 1RUNA 1Z6TA 2LG4A 2LBFB 2XAHA 4IF4A 2E1CA 3HHHA 5F64A 4E7ZA 1FOKA 3NQOA 3I3LA 4LLLA 1I6XA 4LMYA 1TZLA 5K7ZA 3A01B 4W97A 4B1RA 3GTOJ 1O3QA 5FROA 3RQIA 4AWXB 2L9SA 2BYVE 2ZCWA 1U5TA 4B44A 4OIQF 4QWQA 2LKPA 1YS7A 3HYIA 3BDDA 1YW9A 4ZDOA 4ENNA 1HDDC 2X51A 2V26A 4RAZA 5GTHC 4PZJA 3AG3H 1IRGA 2O3FA 2A6EF 5JR3A 3PM1A 4DW6A 2Y9YA 3BC8A 5E79C 5HLGA 1IC8A 1ZLKA 2EH3A 1GDTA 3AAFA 4HDUA 3G1MA 1TWAJ 1R00A 2V9VA 1B1BA 1IXRC 2DYSH 2LF8A 4YIIA 3GFIA 4C3IJ 3CMAI 1BJAA 1R5GA 2VQGA 4B4CA 3CCRI 5ILUA 4CUGA 2BY2A 4HG2A 2LH9A 2KL4A 3FK6A 1D1AA 4PSXA 1AOYA 2DA7A 2X6YA 3F72A 4NQWB 2L4MA 3L2QA 2Q1ZB 4I98B 4A2UA 2VOPA 2LKXA 2G0EA 1R4MB 5IY5H 1L3LA 5EF6A 3HUGA 1YITI 5LGNA 2A5WA 2L7FP 3BTIA 5FKNA 2DK5A 4GDFA 4F3QA 4BKXA 4E7IA 3ELKA 5D8LB 2V1UA 1QO0D 2DTZA 2VQCA 3HG9A 3BZCA 3AG1H 2MGQA 3PIOF 4XK4A 2R7FA 1QZZA 2PLYA 1NG6A 1W1WE 2HGCA 1QU3A 4Q5SF 1FP2A 4C3HJ 2ESHA 2Q8KA 3E0JB 4PFPA 4A6EA 1TQIA 2F6CA 1MMSA 1G8XA 3FISA 1CGPA 2R92J 3CESA 2AXTC 2JVHA 1ORKA 4YIRX 4AC0A 1W7PA 2ECCA 4IJAA 3BZ6A 5L3EA 1PVEA 5ILVA 4BQNA 1E0EA 3NEUA 5C4XJ 2EIJH 3DBHB 3RQ4A 1YX5A 3DLLF 2O5RA 3HOZJ 2RN7A 1FWZA 4L18B 5AIQA 3F0CA 1LPQA 5E17F 1Y0UA 3C2GA 4M74A 4IEJA 2DA4A 1HC8A 3WTUC 4KUMA 4BQQA 2HXOA 4U0WA 1R9TJ 5IP9J 1W36D 5DYMA 3CD6I 4MFEA 3W6KB 2JPBA 1VQ7I 4BUPA 4YIFA 1J5YA 1TQMA 2GXGA 4EJTA 3H0GJ 5J47A 3QRFF 2DMNA 2W4SA 3RDIA 2O0YA 1R5HA 3QP6A 4UHTA 1XSDA 1BI0A 3RIRA 1SAUA 2Z5UA 1GHCA 3WGGA 1UELB 2Z16A 2NVYJ 2ZJ2A 2LR8A 1S9HA 1X3ZB 3RJPA 3ZP5A 5FO5A 4F7ZA 1AKHA 1Z21A 4XKCA 4B8XA 5CVRA 4LG0A 1HDPA 2PBIA 1APLC 2XAJA 2MLGA 3OL4A 3I4NJ 2K27A 2LF7A 1GV5A 2OPTA 1X19A 3GWZA 4RDUA 3LQRA 1J7KA 5C44J 5F0HA 2KISA 4MLOA 4ENKA 3PSFA 2P7VB 1H8AC 1K61A 5F04A 3CCEI 2LTPA 1QRYA 3FWEA 5IP7J 3LA7A 4EQQA 2DA2A 1UHWA 2CWEA 1WKMA 1GVJA 2AQEA 5FD6A 2R5ZB 3D0SA 2HDDA 3K1NA 2DFHA 2E71A 2DOFA 1TNTA 4D7NA 3AG2H 1FTTA 5FRMA 2L54A 4KMFA 1Z6RA 2H09A 3CP2A 3Q0VA 3HPGA 5HS7A 3OS0A 4BACA 1MBFA 2IW5A 2Y0SN 4OAZA 2FBKA 9ANTA 2EZKA 1FX7A 1UFMA 3MZ8A 1MZBA 4BAYA 2F5VA 1GXQA 1SD6A 4KFCA 3ZQLA 1LJ9A 1KU9A 3KP7A 2IRFG 2FU4A 3CMMA 3ISPA 2K9LA 4ABZA 3RZDJ 2ZXJA 3AL0C 5HDGA 2K4BA 2MG4A 3D1NI 1B72B 2XGEA 2PMHA 4EV0A 2UV1A 1MJBA 3E5XA 2NOGA 2CUJA 4D7MA 5C3EJ 2X0LA 3WTWC 3GVAA 3OR1C 3TO9A 4Y4RA 1H9TA 5KVRA 2RQPA 5EZHA 4R79A 3OS1A 3E7LA 4G7ZF 2RC4A 1H88C 3A2KA 1V5EA 1A31A 2GOMA 2X6XA 3BR0A 4KNYA 2IJLA 3T8RA 3TO6A 5L3BA 2O61A 3L09A 3ASNH 3IC7A 2JA6J 5HDKA 5TGTA 4B48A 2HVQA 1K79A 2FOKA 2L4AA 4M3DA 4BE0A 3QYEA 2EA2A 3M07A 5F6FA 2PJRB 1YFHA 5HLIA 2O8KA 1SVLA 3WTXC 1RESA 4XLPF 1Z67A 3L2UA 4HX4A 2B7EA 4IHWA 4B3XA 3ZRGA 4AIJA 3NAUA 1RKTA 1XSVA 3LSGA 4BEHB 1BOBA 3K69A 3WHCA 4BXXJ 4HX7A 1S7AA 1ZARA 2FF4A 3GFMA 1LE8A 1EF4A 3SEZA 4GRIA 5D5WB 4L9TA 3R0AA 3TKYA 4MTEA 4DYQA 1WJBA 3R0JA 4RB2C 1YYVA 2DI3A 3O8GA 3F23A 5D5VB 1J9IA 2W82A 3L2WA 3KP4A 2P8TA 5JVTA 5H20A 4DYCA 2CGPA 4HX8A 1XDSA 4ON0A 2V1NA 2VJ5A 2XPWA 2FQ3A 2ZSHB 5FGMA 5HNFA 1ZAOA 4XN3A 1HBXG 3R60A 2L9RA 4YFNF 3LAPA 2JPCA 3TDZC 2JN6A 1IN8A 1GV2A 2VJIA 2PFBA 3CUOA 2E60A 1AWCA 1B72A 1XGOA 2HOEA 3S8PA 4C2TA 1FYMA 2H27A 2K85A 1IZ1A 4C2MJ 1JKQC 2HS5A 2IT0A 2IS2A 1HLVA 1A6IA 3NRVA 3S32A 3K4LA 4BL0B 1TW2A 4EGZA 1S7OA 4A5NA 1ZG5A 5LFAA 4DOZA 1TW3A 2M45A 4FETA 3J81K 4RLQA 1BIAA 3BR1A 2HOTA 5DDGA 1I6HJ 2F48A 1PJRA 2L02A 4E4HA 4UUSA 5IPAA 2M8EA 3DF8A 2EV0A 1OKRA 2BV6A 2Q2EB 4DJAA 2VKEA 3MD2A 1Z0XA 2FMYA 5BPIA 5DCFA 4YFKF 1MBJA 5HNHA 4CHUA 5F1RA 3HSRA 4XKVA 3HDDA 2W7NA 4A3FJ 1JUMA 2QWWA 2DAOA 2EB7A 3JSPA 3MKZA 1ZHFA 4L5JA 4IXAA 1TNSA 1FSHA 2HQAA 3H9GA 2OCCH 4MHGA 3ZPLA 3KX2A 4LGWA 3S3OA 4RAGA 2QEXI 1HSTA 5DCMA 2CO5A 3B73A 1X2NA 3HRUA 1Z91A 5EZGA 2DXIA 4ZH4F 2AHQA 2DFIA 4HF0A 3GTJJ 3CJQB 2D1VA 3QOEA 4C30A 1IUYA 3ASOH 3FMRA 2DA5A 3ZQCA 1T33A 4XLAA 4CYDA 2L3DA 5FLXZ 3PO3J 4RGXA 2V7FA 1ZH5A 2OJED 1WJAA 4EEFG 4IKFA 3VB2A 2K3FA 2LVSA 2QENA 2D1HA 2EZHA 2F5FA 2ZNYA 3QPTA 1D0ZA 1L0OC 4HA8A 3E5QA 3UR3C 2M0CA 1WI3A 4EVIA 2XVCA 2HR3A 4IRIA 5IT3A 1XSXA 3R61A 1BIBA 4LD5A 1O3TA 3J7AO 2M87A 1PUFB 2OC6A 2A3SA 2O7OA 2LFBA 1VQLI 3OSFA 1MH3A 2CFOA 2CYYA 5C4JJ 2P5VA 1VFCA 4A6DA 1D5YA 3NARA 5ICCA 4J01A 2X48A 1YO5C 3F6OA 2RQQA 4XRSG 5J40A 1IRXA 4II3A 2NRAC 3GLLA 4R1HA 2LBFA 4KYWA 3QQAA 4BNCA 4O5VA 2EILH 4DIQA 2HZTA 1P9QC 4XMYA 4XIDA 1GUUA 1SVOA 3DEUA 4PDKA 4RLFA 3GF2A 4L5EA 1W7PB 3WGHA 2MLKA 4XLFA 1WJFA 5EDNA 2BVMA 3FDYA 1VQPI 2A6TA 3S2WA 2HU9A 4PSWA 5LEJA 3F22A 3CMEI 1IXSB 2WB1A 2LKSA 3WHBA 1VQ8I 3ERED 2QQBA 4G8XA 3JAMK 2IA1A 3OR2C 3I53A 5DD8A 1X1BA 5DCMB 2ME6A 3VYUB 2X4HA 1J09A 4M3FA 3ZMSA 3PL8A 3QPSA 3F8MA 3BJOA 3WU1B 2XGXA 4EATA 3TGNA 4I02A 1TC3C 1D0XA 4OOIA 2IA2A 1SFKA 3T1BA 2OAZA 4K2EA 3MKYB 1MSEC 2XHKA 1SD5A 1STZA 1O7LA 3KZIC 1LB2A 3LFKA 4DGWB 4KJZA 3PIPF 4IVNA 4LLGF 1FIPA 4C9YA 4ESFA 1JI8A 2XASA 1XG1A 4QSHA 2QZ8A 1SMYF 3GO5A 1ZRFA 4CCKA 1Y39A 1YLFA 3WTZA 2ZFUA 4A3DJ 1OLTA 1R36A 2VXDA 4BBRJ 5DUIA 2LOOA 1A36A 2OTJI 3CJNA 2ZC2A 1TQPA 4KMUX 3ZMVA 2LD5A 1WRJA 3BLYA 3GCMA 3ESWB 3PQKA 1FIAA 3B6CA 4M73A 1HW2A 1K83J 2Z33A 3M1CA
chains in the Genus database with same CATH topology
2V26A 3PJRA 4BDZA 3H9JA 3OYMA 2VJ4A 3BC8A 1D0YA 2WBMA 5CQGA 3LSIA 2K5CA 2CW8A 5FRNA 3RCOA 4XLEA 3OYEA 4NC8A 2VQGA 2X85A 3QODA 3KYLA 4CUGA 4XQFA 4HG2A 2LH9A 2KL4A 2BW3A 1D1AA 4PSXA 3DQVC 4NC7A 1YX3A 2ZXHA 3CZ6A 3SEQA 1NG7A 4HEA2 1T0FC 2X6YA 4NQWB 4ANJA 3L2QA 2Q1ZB 3S3NA 4IQJA 2MD0A 3VSLA 3K4JA 1D1BA 2A5WA 4ZTFA 4NUBA 3F9KA 2OUMA 4JOMA 4F3QA 4HPQA 4E7IA 4KT6A 3VWBA 2VQCA 3HG9A 4ZYAA 3L2VA 4XLHA 4BGDA 2LRDA 2LY1A 1NG6A 2M0MA 5KNLA 4F52A 2VLAA 1X4PA 1QU3A 2IS4A 3E0JB 4PFPA 3HPHA 3OYFA 3RSNA 1MMDA 2F6CA 2OV7A 3OYNA 1G8XA 3CESA 5CPRB 1Y6IA 3IP4B 2JVHA 3TMOA 4FASD 4BXFA 4HRIA 2VASA 4BQNA 1E0EA 1AA7A 3BCBA 2JA2A 1G59A 3K4BA 1YX5A 3RQ4A 1PYVA 2M4KA 1YE9A 2O5RA 2X6WA 4BEHA 4PJNA 4N4NB 4PUSA 4IQ4A 2VL8A 4D1QA 3C2GA 3H35A 2HPIA 3OL3A 3HUGB 4BS9A 2KMUA 1BR1A 5CKTA 4BQQA 4D9JA 3S3MA 3KEYA 2HVSA 4U87A 3SZGA 1W36D 1Y56A 2FUG2 4XKWA 4F55A 4BUPA 3OYKA 2XSJC 2W4SA 3DKXA 3PNVA 4CZCA 1SAUA 2CW7A 2IS6A 1UELB 2MABA 2Z16A 3DU5A 2VPLA 3OMYA 1S9HA 1Z21A 4XKCA 4AYBA 3TBIA 3HXLA 1X4OA 3OL4A 3OY9A 3IAM2 3CP8A 4CCJA 3DPTA 4XORA 4X0GA 1X19A 3NWTA 4XNFA 2XAUA 3SDBA 1ZELA 3BG7A 3VYTB 3N05A 4MLOA 2QKLB 4XONA 1DP3A 3PSFA 3OS2A 3EUKL 2VJJA 1VZ0A 4PK4A 1DGRM 3OYCA 2AQEA 3H5RA 4Y33A 2LYCA 2DOAA 5FRMA 2BOLA 2L5QA 2Z2SB 2F4IA 3CP2A 3HPGA 4Y3OA 3OS0A 4BACA 3D5SC 1U0JA 4G6TB 4OAZA 3OYLA 3LSMA 2R7VA 2F5VA 2LREA 3W2AA 3S93A 4CCMA 3CMMA 2K9LA 3DTKA 4CCNA 2ZSIB 3EUHC 3AL0C 2HDWA 3VYRB 2UV1A 3CJRB 2CUJA 4ITVA 2E1MC 3OR1C 4Y4RA 1WJ5A 4R79A 3OS1A 3OYBA 3VYSB 1LVKA 3A2KA 1V5EA 1QHHD 2GOMA 2X6XA 3OYGA 2KP6A 1OR7C 3H5NA 3DEEA 3K6GA 3LMMA 4LITA 4HSRA 5KCMA 3I9V2 2XF7A 5HVQC 4PFOA 4B47A 4E7LA 5TGTA 4B48A 2HVQA 2KRCA 3BG6A 2P0WA 3TL4X 4ZC3A 2VKDA 2VB6A 4BE0A 3QYEA 2BW3B 5HLTA 2PJRB 1X1CA 1Z7LA 4CH7A 4IX7A 3L2UA 3W2WA 2W1OA 4RM3A 4U7BA 1BR2A 4BE1A 3FBIB 4B3XA 4LIUA 3ZRGA 3LSGA 3OYJA 2CUZA 4BEHB 1BOBA 2HPMA 2GOXB 2MC4A 4QPQA 3K70D 2WAFA 3HL2A 3OIPA 3K70C 3RTRA 3SEZA 2XF6A 4GRIA 4J00A 1WJBA 2AQFA 1D1CA 3D5LA 2DT6A 1KONA 4HNTA 3GBGA 2NOJB 2JVGA 4BQOA 3HOSA 2R7XA 2L2OA 4XM3A 2W82A 2KLOA 1EA3A 3L2WA 2JUGA 2KRHA 4XOPA 4H4KC 1LFPA 2VXZA 4CCOA 2XC7A 3SYTA 1BR4A 3A1YA 2V1NA 2VJ5A 1FMWA 2X1DA 2ZSHB 4RMNA 5HNFA 3HOTA 4XN3A 3OIQA 3PNYA 3MKWB 4LIVA 2L7KA 1V5GA 1GLNA 2VJIA 2WA0A 2E60A 2KHMA 3DPUA 2LY2A 4BDYA 3S8PA 3PFYA 3OYHA 2V6EA 4C2TA 4KISA 4E7SA 2PMZA 5LD2C 4E7KA 2LC2A 4XKBA 2IS2A 3OYAA 1QHGA 3EUAA 3ONQA 2IGOA 3S32A 4NNJA 3K4LA 2DT7B 1W36C 4BL0B 2UUZA 4E6KG 2R7TA 4ZTJA 4JQFA 2R7SA 2HVRA 2CV0A 2DCEA 5LFAA 4DOZA 4FETA 3ZXSA 4RLQA 4XL9A 4HSTA 2VQLA 3FKJA 3ZQQA 1PJRA 4E4HA 1HA8A 2CV1A 3QYBA 2R7WA 1Z3XA 2Q2EB 3K10A 4N4OB 4DJAA 3MD2A 4AVZA 1MNEA 2M4GA 2WAEA 2X1CA 2R4GA 3K4MA 3OOUA 3DTIA 3M8JA 5HNHA 4BJ5C 4DBRA 2PJRA 4XKVA 2CMPA 3DWLE 3VSKA 2W7NA 1LKXA 1X1AA 2DJIA 2ELJA 2WADA 3K4NA 3MKZA 2HNHA 3QYFA 2WY8Q 5JHFA 3NWSA 2HQAA 3H9GA 4PJLA 2Y0SA 3KX2A 4LG3A 3S3OA 4PJJA 2ZXIA 3H5AA 3CF2A 2WAQA 1MMNA 3DPLC 3E1SA 4CSWA 2DXIA 1N78A 1Z3YA 2K3PA 3DKYA 3AKZA 4HNUA 3CJQB 2JSPA 3QOEA 4C30A 3DTEA 3HC7A 3W2VA 3FBNB 3IUOA 2E5NA 4PJMA 3BCAA 4XLAA 1WJCA 3VDXA 1MW7A 2L9NA 3AL0B 5CQEA 4ZJZA 4IZZA 2X1EA 2V7FA 2VQHA 4ZDLA 4B43A 1WJAA 2MFZA 1FMVA 3MMYB 4IKFA 2E1MB 3V42A 4E7HA 4BJTA 2R7UA 1D0ZA 5KHDA 3L2RA 2CV2A 3UR3C 2WY7Q 4F92B 4II2A 1WFXA 3H0DA 2KZVA 1MNDA 3ZGKA 2BVLA 4BU2A 4YELA 3UNGC 1DGWY 3EPZA 4CA0A 3PUBA 2OC6A 2IGMA 4CCLA 2CFOA 3LSKA 4P5OA 4J01A 4P1WA 1N75A 1WJDA 1ERDA 2XDVA 3K4CA 4QPOA 2KDOA 1DQUA 2RQQA 2Z1DA 2M7BA 3A4CA 1IRXA 2I8DA 4II3A 1UAAA 3J7AY 2KPMA 1R6RA 3H9QA 2IXSA 2XF5A 3ZCOA 2LBFA 4XN0A 2MYSA 2W00A 3LSHA 4DIQA 1P9QC 4XMYA 1MMAA 3OYDA 4F93B 4C2UA 4RLFA 2QKMB 1MMGA 3DU6A 4XLFA 1WJFA 3FHNA 2BVMA 3FDYA 2A6TA 4BE2A 2HU9A 2CS3A 4BJ6C 2VKHA 2M7AA 4PSWA 2RNGA 1UG0A 3C2HA 2WB1A 2V4JC 2M3AA 4YRVA 2R7QA 3PSIA 1T95A 3IAS2 2KQRA 3OR2C 3RPUD 2IGKA 3LL7A 1X1BA 3VYUB 2HZDA 1J09A 3LFUA 4OWRB 5HOOA 3DLAA 3PL8A 2VIXA 4ZDPA 1TT0A 4EATA 4E7JA 3ZR8X 3W3CA 2R7OA 3PNTA 1D0XA 4DBQA 1SFKA 3G2BA 3MKYB 4XOTA 4OAYA 2E5ZA 4RM2A 3K4KA 4YEJA 1WJEA 1X1DA 4DGWB 4XLCA 4KJZA 3U21A 4XR6A 3OYIA 2CH0A 4C9YA 2R7RA 2IS1A 1JI8A 2LBFB 2LG4A 2V9KA 4KITB 3D5RC 2IGNA 4E7ZA 1LDKB 1V5FA 2K9MA 4CCKA 2RREA 3I3LA 2ZFUA 1OLTA 1TZLA 2VXDA 2LOOA 3OWTA 3AFHA 5FROA 2L9SA 4B44A 1N77A 3BLYA 3HKZA 4F91B 4AU7A 4ZDOA 1K6YA 2X51A 2UWMA 3M1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4O B;  4FAS D;  4N4N B; 
#chains in the Genus database with same CATH topology
 3PJR A;  3IRR A;  4BDZ A;  1TWC J;  3HHG A;  4OIP F;  5IOZ A;  1D0Y A;  1G4D A;  5CQG A;  1SFU A;  5HDN A;  3ULQ B;  1SFE A;  2W57 A;  3P9C A;  2WV1 A;  2KJB A;  1LFB A;  2JSC A;  1K6O A;  4HOB A;  4NC8 A;  2X85 A;  1YIO A;  5K5Q A;  3KYL A;  4XQF A;  1DPR A;  3DQV C;  5LBQ A;  4GYI A;  1X1P A;  2ZNZ A;  4RS8 A;  4M9S A;  5FKK A;  3BTJ A;  5CVJ A;  3JRF A;  2KIM A;  2TRT A;  3MVP A;  4MQ9 F;  1DPU A;  2E7X A;  2DN0 A;  4EM1 A;  2G7U A;  3S3N A;  3QU6 A;  5E20 A;  3JRH A;  3EDP A;  3TW6 A;  1UZC A;  3K4J A;  4ZYH A;  3U1K A;  4JX4 A;  3ECH A;  1TWG J;  2EV5 A;  1K78 A;  4KT6 A;  3VWB A;  5IT9 Z;  3I54 A;  4ZYA A;  3L2V A;  2Z9O A;  1I50 J;  1HKQ A;  3EUH A;  4ZYE A;  3I58 A;  4JX6 A;  5KNL A;  3B6A A;  2VLA A;  1X4P A;  4Y17 A;  2C6Y A;  4BH9 A;  4L0Y B;  3HPH A;  3P5J A;  2M30 A;  5JFR A;  3JSO A;  1WPK A;  2O6G E;  5TRD A;  3S1M J;  2ZFW A;  4WK8 F;  3MAJ A;  3BR2 A;  1ETQ A;  5FLV A;  4XIC A;  1O57 A;  4FAS D;  1IV6 A;  2ZO4 A;  4BXF A;  4HRI A;  2VAS A;  2VOD A;  3FXQ A;  1S5L C;  5HS9 A;  1D3Y A;  2M4K A;  2X6W A;  3ZQG A;  1RI7 A;  4BEH A;  1JKP C;  1KGS A;  2O8X A;  3P7N A;  3DBR B;  1PP7 U;  3JTH A;  1UCR A;  2HPI A;  1YS6 A;  2ESN A;  1BR1 A;  2KT0 A;  5CKT A;  4EJU A;  4AID A;  2B9S A;  2HYG D;  2HTS A;  2M5W A;  1V4R A;  4U87 A;  3M9A A;  1UMQ A;  1Y56 A;  3WTV C;  4XKW A;  1O7F A;  3M1E A;  3V7R A;  3KEQ A;  2HKX A;  3BG3 A;  1S7E A;  1MGT A;  4UV8 A;  3T0Y A;  2XSJ C;  1YRN B;  3DKX A;  2ISY A;  3PNV A;  3GTG J;  4CZC A;  3JRE A;  2KZG A;  1IV8 A;  2QQ9 A;  4AIH A;  4RGS A;  3ZN0 A;  2IS6 A;  2DPU A;  2H1L A;  3OMY A;  2CU7 A;  1O3R A;  3ZQF A;  5E3L A;  4G7O F;  3KYC B;  3G1L A;  5D6E A;  3TBI A;  3ZMD A;  4N9I A;  1WGX A;  3IAM 2;  1S6L A;  1UG2 A;  3DPT A;  4X0G A;  2UZK A;  4KN7 X;  2L9V A;  4HF2 A;  4P96 A;  1E17 A;  3HOV J;  1ZR2 A;  3JRC A;  1ZEL A;  1T98 A;  3BG7 A;  1BL0 A;  2VI6 A;  5ICF A;  1FNN A;  3N05 A;  1DP3 A;  2QKL B;  2JRT A;  3BOQ A;  5DTD A;  2XIG A;  3BY6 A;  6PAX A;  1DGR M;  3I4M J;  2LMD A;  2F4M B;  3A0B C;  2FNP A;  2VE8 A;  4JX5 A;  2W85 A;  4Y33 A;  2LDU A;  4IL6 C;  4M6X A;  2BOL A;  4NB5 A;  3CCQ I;  4Y3O A;  2LLK A;  1DU0 A;  1U0J A;  1ITY A;  3S2H J;  1BI1 A;  3LSM A;  2ZXW H;  4OIN F;  2IEK A;  2BGC A;  1U8B A;  1MNM C;  3W2A A;  1UJ8 A;  3S93 A;  1IRZ A;  1JT0 A;  2HWV A;  1B8I B;  1JUP A;  2CUE A;  1W4M A;  3DTK A;  1RPW A;  5HLH A;  3RYP A;  4L0Z B;  1D8J A;  3N97 A;  1BA5 A;  4B09 A;  4A3G J;  2RAE A;  2KIQ A;  1KYZ A;  2OBP A;  1ZG3 A;  3K1M A;  2COB A;  1FBQ A;  1QVU A;  4RA2 A;  5DV5 A;  3RKY A;  1W0U A;  1IG7 A;  3PUF A;  4NHJ A;  4ZZD A;  2L01 A;  4BHB A;  1U6G A;  3OV8 A;  3OYG A;  2Y31 A;  1W7P D;  3H5N A;  3DEE A;  3K6G A;  2JK3 A;  3P9K A;  3I9V 2;  3K2A A;  5J1Y A;  1G6N A;  2RKH A;  2NS0 A;  3CQZ J;  4QLC U;  4HDV A;  4AIK A;  2E1O A;  4EJV A;  5J8C A;  2KRC A;  2BEO A;  3BG6 A;  2WV0 A;  3ABK H;  4CZZ A;  2ZME C;  2YU9 J;  3DKW A;  2BW3 B;  2RDP A;  5HLT A;  3OOP A;  4A0X A;  2F4O B;  1I1S A;  3ZN1 A;  2FNA A;  3E6M A;  3JRB A;  4HQM A;  2JA5 J;  3W2W A;  2W1O A;  1DDN A;  4RM3 A;  1Y1W J;  1BR2 A;  3FBI B;  1OFC X;  1UST A;  4A0Z A;  1YHQ I;  3GTP J;  1HQC A;  2WB1 N;  5DM7 F;  1GT0 C;  1B4A A;  1RNL A;  1PUE E;  1E3P A;  1R4N B;  2MC4 A;  3HL2 A;  1YJW I;  4HZF A;  1ZN2 A;  3K70 C;  5E1X A;  3F3X A;  1JTX A;  2EFO A;  2VT2 A;  1YJ9 I;  2AQF A;  2NXN B;  2K7L A;  1P7I A;  3P9I A;  4UV9 A;  5ICG A;  4EGY A;  1QVT A;  1KON A;  2MSY A;  3FZV A;  4HNT A;  1ZRC A;  2JVG A;  1VQ6 I;  2DLL A;  5CVV A;  2L2O A;  2OU2 A;  1EA3 A;  1QZY A;  3RPU A;  1MDM A;  2QQA A;  3G6E I;  4Y13 A;  2JUG A;  2KRH A;  2EIK H;  1P4W A;  4YG2 F;  3Q0W A;  4H4K C;  1JKO C;  1XCB A;  1XX5 A;  3RKX A;  3A1Y A;  3SYT A;  4U88 A;  3BTL A;  3C1D A;  3ZQ7 A;  3I56 I;  2R7Z J;  3ABL H;  1JGG A;  4RMN A;  5GAH J;  1U2W A;  2L7K A;  1V5G A;  1JTY A;  4L5I A;  5E3O A;  4TV7 A;  1GLN A;  2BZT A;  4P9U A;  4MIM A;  2HTJ A;  4BY7 J;  1FYL A;  4IOA F;  1B9N A;  1WWX A;  3DPU A;  4FTH A;  2O03 A;  2ETH A;  4IHS A;  4BDY A;  3OYH A;  2FRH A;  2DK8 A;  4KIS A;  4E7S A;  5LD2 C;  3JW4 A;  4XKB A;  4N9H A;  3TOB A;  1IUF A;  3ONQ A;  2QBY A;  4KIC A;  5K5O A;  2XAG A;  2IGO A;  2VOO A;  2QCO A;  5JVG F;  4D5C A;  1BI3 A;  1S72 I;  1HOM A;  2BE5 F;  3ZQH A;  4HBL A;  4W1U A;  1U8R A;  1IDZ A;  1WZ2 A;  1I27 A;  2K02 A;  3ZQQ A;  2CV1 A;  1OCP A;  1SFX A;  5J4V A;  2K40 A;  4GO1 A;  4M9Z A;  4XSZ F;  3K10 A;  2BY0 A;  2WAE A;  2V6C A;  5K7H A;  5FKL A;  3FXL A;  2E36 A;  4Q47 A;  1LDD A;  4FCY A;  2VPR A;  4IRG A;  3TQN A;  5A2Q K;  3HKZ N;  3ML6 A;  2E19 A;  2EFP A;  3LSR A;  3QPL A;  5EEA A;  2JMW A;  1R1T A;  3I59 A;  3VSK A;  2DDB A;  2EBI A;  2IBD A;  4OIR F;  3MFK A;  4DZJ A;  5H6R A;  2BY3 A;  4EJW A;  2W48 A;  4LK0 F;  2VE9 A;  3KIO A;  2HNH A;  2EPF A;  5JHF A;  1ETK A;  3C3W A;  2Y0S A;  1FBS A;  4LG3 A;  1ZR4 A;  2Y0M A;  2DPD A;  3I0T A;  3CC2 I;  3CF2 A;  2WAQ A;  1FOY A;  2I10 A;  2J5P A;  3FX3 A;  4MO7 A;  1N78 A;  1Z3Y A;  3KE2 A;  2A68 F;  2NVX J;  3SDG A;  5F27 A;  5LHG A;  1MIJ A;  4LOC A;  3DTE A;  3IUO A;  3GFJ A;  2E5N A;  3PQJ A;  1ZYR F;  1SAX A;  1MW7 A;  2L9N A;  2V1X A;  3RKW A;  1BM9 A;  2EK5 A;  4KN4 X;  4ZDL A;  2MFZ A;  4RGU A;  3MMY B;  3SZT A;  5EGO A;  3PO2 J;  3V42 A;  5BNG A;  5GPC A;  3LOC A;  2GXA A;  4LK1 F;  1LEA A;  1KU2 A;  3GYH X;  1XC5 A;  5KHD A;  3JCU C;  3Q5F A;  3CC7 I;  3L2R A;  3BWG A;  3WU2 C;  3GTK J;  4V19 K;  2GIZ A;  3IH3 A;  2VBZ A;  2DQR A;  2GQQ A;  2KZV A;  3ZGK A;  2BVL A;  1OCO H;  4A12 A;  2P4W A;  4YEL A;  1Y8Q B;  3UNG C;  4PJ0 C;  4HLX A;  3HTS B;  3EPZ A;  1LE8 B;  3F8B A;  2ID3 A;  2NYX A;  2XB0 X;  2YPR A;  4H0E A;  1TWF J;  3QPH A;  3EET A;  2LY9 A;  1VQO I;  2ACJ A;  5D5U B;  3BPX A;  1Z05 A;  2DMP A;  3O2P E;  2FML A;  2KDO A;  1VQN I;  2ELK A;  3IWF A;  3A4C A;  2I8D A;  2GAU A;  2KPM A;  1LEB A;  3RKQ A;  2DT5 A;  3H9Q A;  4X6A J;  2XF5 A;  4XN0 A;  2MYS A;  2W00 A;  5D8K B;  2ZJP F;  1JKR C;  1FLI A;  3VPR A;  4F93 B;  1AU7 A;  3WG9 A;  1Z7U A;  3T5X A;  4FX4 A;  3E5U A;  5D4S A;  3BJA A;  3FHN A;  2EZI A;  2VBW A;  2OF7 A;  3BJ6 A;  4LG0 B;  1RZ4 A;  3G4S I;  2CS3 A;  4LB6 B;  2Y75 A;  4M9X A;  1UG0 A;  2DJN A;  4A3C J;  2M3A A;  3PSI A;  1T95 A;  2XPU A;  2VC1 A;  3IAS 2;  2XAQ A;  5FB2 A;  2KQR A;  3RPU D;  2PX9 A;  2G7H A;  1UHM A;  2HZD A;  5HOO A;  2NVT J;  3GLX A;  2VIX A;  2EWN A;  4A3B J;  4E7J A;  2OD5 A;  3BR6 A;  3ZR8 X;  1LDJ A;  1F9N A;  2R7O A;  1VQM I;  1I3Q J;  3GXO A;  3LAJ A;  3CMY A;  5BMZ A;  1WVR A;  1ACI A;  2V79 A;  3CDL A;  1VTN C;  2PJP A;  4OMY A;  2GA2 A;  2JJ7 A;  4RM2 A;  2QGU A;  2STW A;  1B59 A;  1P7J A;  1XGN A;  3G1O A;  1X1D A;  3ZMZ A;  1R23 A;  1ZRD A;  4XLC A;  4A3K J;  3OYI A;  3G73 A;  3WG7 H;  4DQ2 A;  1R58 A;  2IS1 A;  4A3L J;  3DEW A;  3CCL I;  2XUB A;  2V9K A;  5CVI A;  2R7D A;  2WTE A;  4G12 A;  4KIF A;  2GBY A;  5ILS A;  3KET A;  3G3Z A;  1ETX A;  2K9M A;  1NK2 P;  2RRE A;  2H8R A;  1MJ9 A;  3N4M A;  3AFH A;  1EJ9 A;  1P92 A;  4A93 J;  2YU3 A;  3CCJ I;  2NNY A;  1ON1 A;  3VEP A;  1DP7 P;  5CVU A;  1N77 A;  4F91 B;  2GLO A;  3OIO A;  3VOE A;  3QOP A;  1A35 A;  1V55 H;  1EH7 A;  3H9J A;  2VJ4 A;  1MBG A;  3S2D J;  2WBM A;  3SZP A;  4MEX F;  1IRF A;  2K5C A;  2CW8 A;  1BJZ A;  3M8E A;  2HXI A;  1ZRE A;  3OYE A;  1QZE A;  1T38 A;  3QOD A;  4NDL A;  2DFE A;  3I64 A;  4S04 A;  5L3G A;  1G3T A;  3H3Z A;  2CQX A;  4NC7 A;  1YX3 A;  2ZXH A;  3SEQ A;  1DUX C;  1HCR A;  4KT5 C;  4CYC B;  3TW7 A;  4IHX A;  1QGP A;  1T0F C;  1FY7 A;  2UXX A;  1F1Z A;  4ANJ A;  2Y2Z A;  3M8F A;  3JR9 A;  4IQJ A;  2MD0 A;  3SFI A;  3VSL A;  1P6R A;  3MCZ A;  4I6Z A;  2ZME B;  3MN2 A;  2JWT A;  5J1U A;  4ZTF A;  3F9K A;  1J75 A;  2DMU A;  2VBX A;  1R7J A;  4JOM A;  4HPQ A;  3W6V A;  4KA4 A;  1FEX A;  2D45 A;  5B3S H;  2YS9 A;  2R5Z A;  4BGD A;  2ICW G;  2LRD A;  4BXU A;  2CQQ A;  3CUQ B;  3Q9V A;  5D5X B;  1RRJ A;  3LNQ A;  2M0M A;  2ZKZ A;  4F52 A;  1XTA A;  5M5Y J;  2X6O A;  1H9G A;  3QWL A;  2IS4 A;  5LHI A;  3OYN A;  4I01 A;  3FXM A;  3V8K A;  5DEQ A;  4EM0 B;  1Y6I A;  4L9V A;  4FHT A;  3TMO A;  3J7Y J;  1T2K A;  2A5Y B;  3ZMU A;  1H89 C;  1ENH A;  5J8F A;  4XRM A;  3JRG A;  3BCB A;  4IHV A;  2JA2 A;  4P55 A;  3K4B A;  1PYV A;  3U9G A;  1YE9 A;  1YW8 A;  4MFD A;  3TOA A;  4G7H F;  5FLM J;  3H92 A;  3OSG A;  4A5M A;  4N4N B;  2K86 A;  4PUS A;  4I99 C;  5FKM A;  5TJJ A;  2PI0 A;  5E18 F;  4D9J A;  1U9O A;  3S3M A;  1T39 A;  3LA2 A;  2HVS A;  3SZG A;  2FUG 2;  1CF7 B;  1A5J A;  1U9N A;  3GFL A;  3K9T A;  4A69 C;  1BN5 A;  1OCT C;  3DP7 A;  1ZGJ A;  2XGC A;  5FFZ A;  2MBF A;  3F8F A;  3V8L A;  2XB5 A;  4UB8 C;  5ICE A;  1K7A A;  2Q0O A;  3S17 J;  2IVM A;  2H1K A;  2QSH X;  1U5T C;  1SEU A;  3FXK A;  1F43 A;  3CCV I;  2JQ7 A;  2L7Z A;  3O6B B;  3MZY A;  1Q1H A;  5J3L A;  5F0F A;  4ASN A;  1F5T A;  1FJL A;  1VF9 A;  2OTL I;  1X4O A;  4CCJ A;  1MBK A;  4XOR A;  4O3M A;  3WTT C;  3ABU A;  2DO7 A;  2GA1 A;  2PMU A;  3NWT A;  2PEX A;  4XNF A;  1XS9 A;  1HW1 A;  2XAU A;  3SDB A;  2DYR H;  3KYD B;  5AIP A;  4FT8 A;  4PGG A;  5BOX A;  2FE3 A;  2P7C B;  3OS2 A;  4Y7N J;  1MD0 A;  2VJJ A;  4PK4 A;  2OZ6 A;  2FJ1 A;  2RVC A;  3OYC A;  3I4P A;  1XPX A;  2IP2 A;  4XBF A;  1JHF A;  5GAG J;  1XGS A;  4HYE A;  2E35 A;  3IHU A;  5J4Y A;  2GIV A;  3PFI A;  2Z2S B;  2F4I A;  2ISZ A;  3D5S C;  4G6T B;  5M3F J;  1LQ1 A;  2R7V A;  1X3U A;  3GW2 A;  4NBQ A;  5JHU A;  1O4X A;  3BR3 A;  2W25 A;  2QF7 A;  4CCM A;  5FFX A;  1XDU A;  1GXP A;  1HXD A;  2BY1 A;  3KFW X;  3KPH A;  3I59 B;  4CCN A;  2ZSI B;  2STT A;  2HDW A;  4G6Q A;  5L3C A;  3S1R J;  3HBL A;  1WH7 A;  2OA4 A;  3VYR B;  3IH2 A;  3CJR B;  3TP0 A;  3M4O J;  2F5C A;  1BC7 C;  1R1U A;  1WJ5 A;  3V7S A;  3HIF A;  1N25 A;  5B66 C;  3OYB A;  2CFX A;  3VYS B;  1LVK A;  1PUF A;  2HQR A;  3I5U A;  1LNW A;  3FM5 A;  3X2Q H;  5LGU A;  1V3F A;  3LMM A;  4LIT A;  3WTY C;  3U2R A;  5BS6 A;  1QNT A;  3KCC A;  2DTR A;  1JHH A;  2XF7 A;  4I0A A;  4B47 A;  4E70 A;  2PN6 A;  2Q2E A;  5EJC A;  5L3F A;  3ZOB A;  3G71 I;  2P0W A;  2VBY A;  4PCQ A;  2VB6 A;  4M72 A;  4MQV A;  4EJO A;  4RB3 C;  1PDN C;  1SD7 A;  2R5Y A;  1Z7L A;  4CH7 A;  4GXO A;  3ECO A;  2DFF A;  1D8K A;  1AKH B;  4L9N A;  4LB5 A;  3GTM J;  3KLO A;  2E2J J;  2W84 A;  1E3H A;  4BE1 A;  3JRI A;  4LIU A;  3HSF A;  5CYV A;  3MKL A;  3E6D A;  5CLS A;  2GOX B;  5EEH A;  5JLX A;  3K70 D;  4XLN F;  2IAI A;  2HOA A;  2F2E A;  3S1Q J;  2BXY A;  2B63 J;  5LLQ A;  1QPM A;  2P6S A;  3CCM I;  2XF6 A;  1G3S A;  1P2F A;  2BXZ A;  5M3M J;  3CCS I;  3K7A J;  3GX4 X;  1R22 A;  3CTA A;  4JYK A;  2NOJ B;  4J19 A;  1Y8R B;  1CQT A;  2R7X A;  4XM3 A;  1XD7 A;  5GAE J;  2YR2 A;  4XOP A;  4QTR A;  4A3E J;  3FXO A;  3R6S A;  1BR4 A;  1IF1 A;  1B6A A;  4V2F A;  1ZG1 A;  5FD5 A;  4BHP A;  4S05 A;  4Y52 J;  3VOD A;  3LSP A;  4G6D A;  2NVQ J;  2EQR A;  1BOA A;  5M5W J;  3GEZ A;  2LY2 A;  1R49 A;  5ED4 A;  2A07 F;  1JXS A;  1W5C C;  3TO7 A;  1KA8 A;  5E1Z B;  1TT5 B;  2P5K A;  2GM4 A;  4E7K A;  2LC2 A;  3EUA A;  1EH6 A;  2KIF A;  4M3G A;  1TBX A;  4A3I J;  1W36 C;  5H6Q A;  4E6K G;  1JJ8 C;  2YX4 A;  2Y9Z A;  2R7T A;  1Q1V A;  3KZZ A;  2P5L C;  2HVR A;  2CV0 A;  4XRS A;  1J0R A;  3ABT A;  4HST A;  4ENM A;  2VQL A;  3FKJ A;  3MZH A;  1WQ2 A;  2EFQ A;  2M1B A;  2A05 A;  2WWY A;  4XSX F;  4MEY F;  1MNE A;  2M4G A;  2X1C A;  2R4G A;  4WCG A;  1SAN A;  3OOU A;  3GTL J;  3J80 Z;  3DTI A;  3FKI J;  5DM6 F;  4DBR A;  2MD5 A;  2PJR A;  3TP3 A;  2CMP A;  2XSD C;  1X1A A;  1LUJ B;  1T56 A;  3IWZ A;  2DJI A;  2E7W A;  2YUS A;  2DA6 A;  2WAD A;  2P81 A;  1I5Z A;  2WY8 Q;  2PMZ N;  4AM3 A;  2FQ4 A;  4PJL A;  1SD4 A;  4PJJ A;  5GAD J;  5BQT A;  1X3W B;  2ZXI A;  4P9F A;  2DBB A;  2JA7 J;  1MMN A;  3BQZ A;  1TTY A;  2H8W A;  2HQ5 A;  1IN4 A;  1FC3 A;  3DKY A;  5HS8 A;  3AKZ A;  1K78 B;  1EH8 A;  1ZQ3 P;  1IDY A;  3LWF A;  3SFZ A;  1VI0 A;  2NNN A;  4ZYD A;  3JAM Z;  3FBN B;  4MNU A;  3FK7 A;  1MSF C;  3BCA A;  1WJC A;  1HKS A;  5J6X A;  5CQE A;  2LP0 A;  5L3D A;  1I39 A;  2VQH A;  4YFX F;  1ZGA A;  1IO2 A;  2EZL A;  1ON2 A;  2E1M B;  2FBI A;  1ULY A;  2DMT A;  3L1P A;  4U7D A;  4CO8 A;  1YOV B;  4IPA A;  2DA3 A;  2XRL A;  2R7U A;  2H6B A;  2HEO A;  5ERI A;  2FOW A;  4CXF A;  2CV2 A;  5FKO A;  2F5E A;  2WY7 Q;  4JBA A;  3Q3S A;  2HDC A;  1P4A A;  1WFX A;  4FE4 A;  2HYJ A;  2H6C A;  5K1Y A;  4M71 A;  2E2H J;  5K7F A;  4A3M J;  2RV8 A;  2ADU A;  3I55 I;  1DGW Y;  3SHF A;  3WOD F;  3M7G A;  3PUB A;  4CA0 A;  4Z6Y A;  1W5S A;  2EIM H;  3BTC A;  4WWC A;  2IGM A;  3LSK A;  1IN6 A;  3MQ0 A;  2DMQ A;  5F0C A;  4P5O A;  5D4R A;  4HV5 A;  3S15 J;  2XKO A;  1N75 A;  1ERD A;  2XDV A;  2XPV A;  5E1W A;  3CDH A;  1A04 A;  3RZO J;  2KDZ A;  1YRN A;  5EYR A;  3S14 J;  5IYD J;  1UAA A;  2IXS A;  5F08 A;  5GP9 A;  2L7M P;  2AXL A;  2H94 A;  1U3E M;  3KLN A;  1Y1V J;  1JGS A;  1F4K A;  2EA4 A;  3FMQ A;  2QKM B;  1MMG A;  3DU6 A;  4FE7 A;  2VKV A;  5GPA A;  3DCF A;  2XAF A;  1F36 A;  4DZP A;  2CSO A;  3BT9 A;  4FQG A;  3L2C A;  4BE2 A;  2Y30 A;  4OU0 A;  2Z3Y A;  3HGG A;  1ETW A;  1NHA A;  2VKH A;  3S1N J;  1U5T B;  1XB4 A;  2A61 A;  2PG4 A;  4UVA A;  3FXU A;  2R93 J;  1YW7 A;  3C2H A;  3L00 A;  2V4J C;  3KP3 A;  4YRV A;  1QPI A;  2R7Q A;  2JA8 J;  2GXB A;  1BI2 A;  1NTC A;  3LL7 A;  4ESJ A;  3LFU A;  4ETS A;  1POG A;  2CQK A;  4ZDP A;  1TT0 A;  2JT1 A;  2YX7 A;  5E8I A;  3CO6 C;  1FOW A;  3FMS A;  4B3A A;  4LJZ F;  3GZN B;  4Y15 A;  2ZJQ F;  1KQ9 A;  2FEZ A;  3G2B A;  4LLN A;  2EV6 A;  2QQ8 A;  4XOT A;  3FHZ A;  4OAY A;  1IJW C;  2E5Z A;  3K4K A;  4YEJ A;  2LNB A;  1IAW A;  4HW0 A;  1USS A;  5JI6 A;  2JTV A;  1TP4 A;  2FD5 A;  2K9N A;  2R7R A;  2BBY A;  4KIT B;  3HZJ A;  1U78 A;  2CW0 F;  3D5R C;  2IGN A;  4L9J A;  2JUC A;  1KU3 A;  3GZ5 A;  3LA3 A;  5AON A;  5LHH A;  3IKT A;  1LDK B;  1WH5 A;  1A6Q A;  1V5F A;  5LRS A;  1J59 A;  3FXJ A;  1VQ4 I;  1FOX A;  1OIS A;  3OWT A;  4MGR A;  4CIC A;  1SVM A;  3O8H A;  5FJ8 J;  4BY1 J;  3BRO A;  2DOE A;  3HOY J;  5JLW A;  1XCV A;  3HRS A;  4ENJ A;  3S16 J;  1HSJ A;  2EJR A;  3HKZ A;  4AU7 A;  3DXJ F;  1QA6 A;  3HM5 A;  2Y69 H;  1K6Y A;  2UWM A;  4HNV A;  2TCT A;  3DV8 A;  2HKO A;  1OCR H;  3RYR A;  2KRF A;  3V4G A;  5HOD A;  3K2Z A;  2EIN H;  1V54 H;  3OYM A;  4RAF A;  5EG0 B;  3LSI A;  4DYR A;  5FRN A;  3RCO A;  1EKE A;  3T8T A;  4XLE A;  2WAQ N;  2ZJR F;  2XRN A;  4HAM A;  4Q4Z F;  1UB9 A;  3IL2 A;  3J80 K;  3EYY A;  2BW3 A;  1FSE A;  4HQE A;  2WC2 A;  1VND A;  3CZ6 A;  3FXR A;  1NG7 A;  4HEA 2;  2QA4 I;  3BP8 A;  3JTG A;  4JP0 A;  2F5D A;  1ZTR A;  1J2X A;  2QM3 A;  4PGH A;  2VON A;  1D1B A;  4NUB A;  4A0Y A;  2OUM A;  2V1D A;  2VC0 A;  2HYF A;  3CO7 C;  2E2I J;  4XLH A;  3IRQ A;  3LSJ A;  2HQN A;  4AUX A;  3F21 A;  2LY1 A;  4HLY A;  4LFU A;  4IRH A;  1W0T A;  2QSF X;  1QBJ A;  1JT6 A;  3OYF A;  1FTZ A;  3RSN A;  1MMD A;  2OV7 A;  1OYY A;  4M6V A;  3TDU C;  3ERM A;  5CPR B;  1JUS A;  3IP4 B;  5E3N A;  4G9Y A;  3HJE A;  1BW6 A;  1C0W A;  2X9D A;  1B8I A;  3Q0U A;  3L7W A;  5E8G A;  2D2W A;  3CF5 F;  4JK1 X;  4RB0 A;  3SXY A;  1AA7 A;  3BG9 A;  4GYG A;  1G59 A;  2I5U A;  5KK1 A;  1YIJ I;  2LSO A;  2RNJ A;  4WF2 A;  4UUV A;  5H2F C;  4PJN A;  4DNC A;  4O6J A;  4UXN A;  4IQ4 A;  2VL8 A;  4D1Q A;  3GUD A;  3H35 A;  3OL3 A;  1Z1D A;  3HUG B;  5IYB J;  2ZME A;  2KMU A;  2J5O A;  4BS9 A;  4I0B A;  1FT9 A;  4WX9 A;  3CLO A;  1T6S A;  1ETO A;  1FP1 D;  3KEY A;  4V2G A;  2IA0 A;  2QBY B;  1TL8 A;  4F55 A;  3OYK A;  4UY8 I;  1ONV A;  3I71 A;  1AHD P;  3J81 Z;  3B02 A;  4R8H A;  2M2E A;  1HW5 A;  4MTD A;  5IP6 A;  2B0L A;  4D5F A;  2E34 A;  2CW7 A;  3A0H C;  2MAB A;  3DU5 A;  4IOC F;  2ECB A;  1ZKG A;  2AO9 A;  2VPL A;  1E3O C;  4UB6 C;  2ME0 A;  3WE2 A;  4N0B A;  2PQ8 A;  2KKO A;  1O3S A;  2OCE A;  1YTY A;  4AYB A;  3EYI A;  2ID6 A;  2YSR A;  3HXL A;  3OY9 A;  2L0K A;  1M1E B;  3CP8 A;  3HEF A;  3ZMT A;  1Y0N A;  1MJA A;  3C2B A;  2JZY A;  2CG4 A;  2DDA A;  3C18 A;  4X1E A;  1TWH J;  4KDP A;  3REO A;  4GGG A;  1QQI A;  2CQN A;  2XGD A;  3HGY A;  1XMX A;  3VYT B;  1D5V A;  1XN7 A;  4I76 A;  4XON A;  3EUK L;  4OMZ A;  3BZK A;  1VQ5 I;  3SQN A;  1VZ0 A;  2KJC A;  1Z9C A;  1OCZ H;  3H5R A;  2QLZ A;  3KEO A;  3UKG A;  2LYC A;  2DOA A;  3A03 A;  4IHY A;  2L5Q A;  1UHS A;  3OYL A;  3IKV A;  4EMS A;  2R5Y B;  1DU6 A;  2LRE A;  1K4S A;  1OMI A;  3BPV A;  1S8N A;  2NS7 A;  2R3S A;  2VN2 A;  1JE8 A;  3AG4 H;  3EUH C;  3E6C C;  5GTI C;  3H36 A;  5DD4 A;  4RB1 A;  2P6T A;  2DOD A;  4IHT A;  2UXN A;  1KQ8 A;  2HI3 A;  1G3W A;  1NK3 P;  4I7H A;  4ITV A;  2E1M C;  4S0H B;  4M6Y A;  1BW5 A;  2XV4 S;  2M8G X;  2KFD A;  4CGZ A;  3F8N A;  3HRM A;  1FBU A;  2K9Q A;  4BYY A;  1QHH D;  2ZBK A;  2KP6 A;  2CJJ A;  1OR7 C;  3H3U A;  3MEX A;  4Q48 A;  2G9W A;  4Z2Y A;  4A3J J;  4HSR A;  5KCM A;  1RR7 A;  2QVO A;  2ELH A;  5TIS C;  1OQY A;  4XRF A;  2VUM J;  4EM2 A;  5HVQ C;  4PFO A;  2OQG A;  4E7L A;  2HFH A;  1WHU A;  3BR5 A;  1KZH A;  3VFZ A;  3TED A;  3TL4 X;  4OIO F;  3QAH A;  4ZC3 A;  3HOX J;  2VKD A;  3COA C;  3L9F A;  1X1C A;  3Q9S A;  1R5I D;  2FXA A;  4IX7 A;  4U0Y A;  4RBO A;  1RUO A;  3E6B A;  1G2H A;  4U7B A;  3SJM A;  1HKT A;  3OYJ A;  2CUZ A;  2VT3 A;  3CCU I;  2HPM A;  4WXD A;  1MBH A;  4QPQ A;  2WAF A;  1ETY A;  3OIP A;  4UUT A;  3ROU A;  3RTR A;  1ZGW A;  4J00 A;  1ZK8 A;  3DBL B;  3BQY A;  1B9M A;  2FBH A;  1D1C A;  3D5L A;  1OPC A;  2DT6 A;  3QP5 A;  2N8G A;  3GBG A;  4BQO A;  5LEK A;  3HOS A;  1XGM A;  2KLO A;  2MW8 A;  4FX0 A;  5IYC J;  2W24 A;  3V8J A;  2DW4 A;  2OQR A;  1LFP A;  2BHZ A;  2VXZ A;  3HB9 A;  4CCO A;  2XC7 A;  5EGO B;  1OJL A;  3JRD A;  1WCM J;  1K4T A;  1OYW A;  4UNO A;  3R4K A;  1H0M A;  1S3J A;  1FMW A;  2X1D A;  1FZP B;  3HOT A;  2BHY A;  2ZB9 A;  3OIQ A;  5B1B H;  3PNY A;  2DU9 A;  3MKW B;  4LIV A;  3CDI A;  1P4X A;  3V7C A;  4CDG A;  3HTU A;  2WA0 A;  2NAZ A;  2KHM A;  3BG5 A;  3WU0 A;  3HSE A;  1GVD A;  3PFY A;  5BPD A;  1IW7 F;  2V6E A;  1XMA A;  2PMZ A;  1I1G A;  2MH9 A;  2QYO A;  1ZLJ A;  3ZQI A;  3WGI A;  5M5X J;  3OYA A;  1QHG A;  2NS8 A;  4RGR A;  4NNJ A;  3F6V A;  4IO9 F;  2DT7 B;  1YJN I;  1VQK I;  5DUK A;  2UUZ A;  1T8I A;  1KU7 A;  1PP8 F;  4ZTJ A;  2FSW A;  4JQF A;  1R1V A;  1SC7 A;  3H3V K;  2R7S A;  2DCE A;  3LST A;  5D6F A;  3ZXS A;  4XL9 A;  1IN7 A;  1HA8 A;  3QYB A;  3KP5 A;  3E3V A;  4QIW N;  2R7W A;  2O9L A;  1FPQ A;  5DS9 A;  1Z3X A;  4N4O B;  5EEG A;  1OYI A;  4AVZ A;  5KAF C;  1KQ0 A;  2FX0 A;  2GZW A;  2K9S A;  1VQ9 I;  3K4M A;  1YQA A;  1IGN A;  1S29 A;  1X2M A;  1MBE A;  3M8J A;  4BJ5 C;  3KP2 A;  3DWL E;  5LRR A;  1LKX A;  1OR7 A;  1G3Y A;  3CUQ C;  1TLH B;  1NH3 A;  2ELJ A;  4HF1 A;  3K4N A;  4RAY A;  3FM3 A;  1RET A;  4CYC A;  3QYF A;  3NWS A;  4NQW A;  4BQA A;  2V9P A;  1KYW A;  3FF5 A;  3K1P A;  3H5A A;  3E97 A;  3DPL C;  4KIB A;  5CJ9 A;  3ABM H;  3E1S A;  2HOS A;  2A69 F;  3FIW A;  4CSW A;  2EFW A;  2Y48 A;  5LGT A;  5K5R A;  2K3P A;  3MWM A;  1E2X A;  4HNU A;  2JSP A;  4G94 A;  5F1J A;  5J1R A;  1BBY A;  3HC7 A;  3W2V A;  5KAI C;  2RGV A;  4I2O A;  1MH4 A;  4PJM A;  2QUF A;  2CUF A;  3VDX A;  2M9H A;  3AL0 B;  4ZJZ A;  1MDM B;  4IZZ A;  2Z99 A;  3IH4 A;  4FIS A;  3HOW J;  2X1E A;  4B43 A;  4UUS B;  1FYK A;  3CCY A;  1FMV A;  1X58 A;  4UVC A;  4D0P A;  1RIO H;  1EV7 A;  2XKP A;  2E1N A;  2OZU A;  4E7H A;  4GFB A;  3LQQ A;  5B5E C;  4BJT A;  3K0L A;  4WXC A;  2R0Q C;  3KZY A;  3JRA A;  2EFN A;  4ESB A;  4F92 B;  1YG2 A;  4II2 A;  3A01 A;  3RI4 A;  2AS5 F;  2A6H F;  3H0D A;  3HRT A;  1RC9 A;  1MND A;  4BU2 A;  3WE3 A;  1MKM A;  2IPQ X;  2QSG X;  3RPQ A;  4AVP A;  1W5T A;  4BHC A;  2TDX A;  1XMK A;  4M3B A;  2MH2 A;  2MC3 A;  2D5V A;  2JRM A;  4CCL A;  3WTS C;  1LFU P;  3O3K A;  5A2Q Z;  2FA5 A;  1ETV A;  4M3E A;  1OCC H;  4P1W A;  1WJD A;  5IOY A;  3IV5 A;  1T08 B;  1T0F A;  3K4C A;  5FLX K;  1CF7 A;  4QPO A;  3GZ6 A;  4ZZL A;  1DQU A;  2Z1D A;  2KIU A;  3F8C A;  3QU3 A;  2M7B A;  1HF0 A;  5IT9 K;  2K4J A;  2XRO A;  2NVU B;  4BBS J;  3J7A Y;  1RKW A;  4ZYG A;  5E3M A;  3CC4 I;  1R6R A;  3KP6 A;  3ZCO A;  1WI9 A;  4NC6 A;  3CJT B;  3HOU J;  4I09 A;  3W6J B;  3LSH A;  3J7Z I;  1WSU A;  4AD9 A;  1MMA A;  3OYD A;  1YI2 I;  4AYB N;  4C2U A;  4C3J J;  3DFG A;  3EQL F;  1SMT A;  2DA1 A;  1BC8 C;  2LK2 A;  1REP C;  4KIG A;  4BJ6 C;  2M7A A;  2RNG A;  4GCV A;  1LVA A;  3A02 A;  3H1C A;  1JJ6 C;  2GWR A;  3U1D A;  1IN5 A;  2IGK A;  3C7J A;  3CLQ A;  1RR8 C;  4OWR B;  3GTQ J;  3DLA A;  3GME A;  4WXH A;  1R71 A;  1ODD A;  1Z77 A;  3W3C A;  3CUQ A;  3PNT A;  2COM A;  4DBQ A;  5EG0 A;  1SFO J;  1IXC A;  4U0V A;  3M3Y J;  2CQ7 A;  2DQL A;  2M34 A;  4UVB A;  2CRG A;  4HV6 A;  1WJE A;  5B1A H;  1I3A A;  3U21 A;  4XR6 A;  2CH0 A;  2MA3 A;  1RUN A;  1Z6T A;  2LG4 A;  2LBF B;  2XAH A;  4IF4 A;  2E1C A;  3HHH A;  5F64 A;  4E7Z A;  1FOK A;  3NQO A;  3I3L A;  4LLL A;  1I6X A;  4LMY A;  1TZL A;  5K7Z A;  3A01 B;  4W97 A;  4B1R A;  3GTO J;  1O3Q A;  5FRO A;  3RQI A;  4AWX B;  2L9S A;  2BYV E;  2ZCW A;  1U5T A;  4B44 A;  4OIQ F;  4QWQ A;  2LKP A;  1YS7 A;  3HYI A;  3BDD A;  1YW9 A;  4ZDO A;  4ENN A;  1HDD C;  2X51 A;  2V26 A;  4RAZ A;  5GTH C;  4PZJ A;  3AG3 H;  1IRG A;  2O3F A;  2A6E F;  5JR3 A;  3PM1 A;  4DW6 A;  2Y9Y A;  3BC8 A;  5E79 C;  5HLG A;  1IC8 A;  1ZLK A;  2EH3 A;  1GDT A;  3AAF A;  4HDU A;  3G1M A;  1TWA J;  1R00 A;  2V9V A;  1B1B A;  1IXR C;  2DYS H;  2LF8 A;  4YII A;  3GFI A;  4C3I J;  3CMA I;  1BJA A;  1R5G A;  2VQG A;  4B4C A;  3CCR I;  5ILU A;  4CUG A;  2BY2 A;  4HG2 A;  2LH9 A;  2KL4 A;  3FK6 A;  1D1A A;  4PSX A;  1AOY A;  2DA7 A;  2X6Y A;  3F72 A;  4NQW B;  2L4M A;  3L2Q A;  2Q1Z B;  4I98 B;  4A2U A;  2VOP A;  2LKX A;  2G0E A;  1R4M B;  5IY5 H;  1L3L A;  5EF6 A;  3HUG A;  1YIT I;  5LGN A;  2A5W A;  2L7F P;  3BTI A;  5FKN A;  2DK5 A;  4GDF A;  4F3Q A;  4BKX A;  4E7I A;  3ELK A;  5D8L B;  2V1U A;  1QO0 D;  2DTZ A;  2VQC A;  3HG9 A;  3BZC A;  3AG1 H;  2MGQ A;  3PIO F;  4XK4 A;  2R7F A;  1QZZ A;  2PLY A;  1NG6 A;  1W1W E;  2HGC A;  1QU3 A;  4Q5S F;  1FP2 A;  4C3H J;  2ESH A;  2Q8K A;  3E0J B;  4PFP A;  4A6E A;  1TQI A;  2F6C A;  1MMS A;  1G8X A;  3FIS A;  1CGP A;  2R92 J;  3CES A;  2AXT C;  2JVH A;  1ORK A;  4YIR X;  4AC0 A;  1W7P A;  2ECC A;  4IJA A;  3BZ6 A;  5L3E A;  1PVE A;  5ILV A;  4BQN A;  1E0E A;  3NEU A;  5C4X J;  2EIJ H;  3DBH B;  3RQ4 A;  1YX5 A;  3DLL F;  2O5R A;  3HOZ J;  2RN7 A;  1FWZ A;  4L18 B;  5AIQ A;  3F0C A;  1LPQ A;  5E17 F;  1Y0U A;  3C2G A;  4M74 A;  4IEJ A;  2DA4 A;  1HC8 A;  3WTU C;  4KUM A;  4BQQ A;  2HXO A;  4U0W A;  1R9T J;  5IP9 J;  1W36 D;  5DYM A;  3CD6 I;  4MFE A;  3W6K B;  2JPB A;  1VQ7 I;  4BUP A;  4YIF A;  1J5Y A;  1TQM A;  2GXG A;  4EJT A;  3H0G J;  5J47 A;  3QRF F;  2DMN A;  2W4S A;  3RDI A;  2O0Y A;  1R5H A;  3QP6 A;  4UHT A;  1XSD A;  1BI0 A;  3RIR A;  1SAU A;  2Z5U A;  1GHC A;  3WGG A;  1UEL B;  2Z16 A;  2NVY J;  2ZJ2 A;  2LR8 A;  1S9H A;  1X3Z B;  3RJP A;  3ZP5 A;  5FO5 A;  4F7Z A;  1AKH A;  1Z21 A;  4XKC A;  4B8X A;  5CVR A;  4LG0 A;  1HDP A;  2PBI A;  1APL C;  2XAJ A;  2MLG A;  3OL4 A;  3I4N J;  2K27 A;  2LF7 A;  1GV5 A;  2OPT A;  1X19 A;  3GWZ A;  4RDU A;  3LQR A;  1J7K A;  5C44 J;  5F0H A;  2KIS A;  4MLO A;  4ENK A;  3PSF A;  2P7V B;  1H8A C;  1K61 A;  5F04 A;  3CCE I;  2LTP A;  1QRY A;  3FWE A;  5IP7 J;  3LA7 A;  4EQQ A;  2DA2 A;  1UHW A;  2CWE A;  1WKM A;  1GVJ A;  2AQE A;  5FD6 A;  2R5Z B;  3D0S A;  2HDD A;  3K1N A;  2DFH A;  2E71 A;  2DOF A;  1TNT A;  4D7N A;  3AG2 H;  1FTT A;  5FRM A;  2L54 A;  4KMF A;  1Z6R A;  2H09 A;  3CP2 A;  3Q0V A;  3HPG A;  5HS7 A;  3OS0 A;  4BAC A;  1MBF A;  2IW5 A;  2Y0S N;  4OAZ A;  2FBK A;  9ANT A;  2EZK A;  1FX7 A;  1UFM A;  3MZ8 A;  1MZB A;  4BAY A;  2F5V A;  1GXQ A;  1SD6 A;  4KFC A;  3ZQL A;  1LJ9 A;  1KU9 A;  3KP7 A;  2IRF G;  2FU4 A;  3CMM A;  3ISP A;  2K9L A;  4ABZ A;  3RZD J;  2ZXJ A;  3AL0 C;  5HDG A;  2K4B A;  2MG4 A;  3D1N I;  1B72 B;  2XGE A;  2PMH A;  4EV0 A;  2UV1 A;  1MJB A;  3E5X A;  2NOG A;  2CUJ A;  4D7M A;  5C3E J;  2X0L A;  3WTW C;  3GVA A;  3OR1 C;  3TO9 A;  4Y4R A;  1H9T A;  5KVR A;  2RQP A;  5EZH A;  4R79 A;  3OS1 A;  3E7L A;  4G7Z F;  2RC4 A;  1H88 C;  3A2K A;  1V5E A;  1A31 A;  2GOM A;  2X6X A;  3BR0 A;  4KNY A;  2IJL A;  3T8R A;  3TO6 A;  5L3B A;  2O61 A;  3L09 A;  3ASN H;  3IC7 A;  2JA6 J;  5HDK A;  5TGT A;  4B48 A;  2HVQ A;  1K79 A;  2FOK A;  2L4A A;  4M3D A;  4BE0 A;  3QYE A;  2EA2 A;  3M07 A;  5F6F A;  2PJR B;  1YFH A;  5HLI A;  2O8K A;  1SVL A;  3WTX C;  1RES A;  4XLP F;  1Z67 A;  3L2U A;  4HX4 A;  2B7E A;  4IHW A;  4B3X A;  3ZRG A;  4AIJ A;  3NAU A;  1RKT A;  1XSV A;  3LSG A;  4BEH B;  1BOB A;  3K69 A;  3WHC A;  4BXX J;  4HX7 A;  1S7A A;  1ZAR A;  2FF4 A;  3GFM A;  1LE8 A;  1EF4 A;  3SEZ A;  4GRI A;  5D5W B;  4L9T A;  3R0A A;  3TKY A;  4MTE A;  4DYQ A;  1WJB A;  3R0J A;  4RB2 C;  1YYV A;  2DI3 A;  3O8G A;  3F23 A;  5D5V B;  1J9I A;  2W82 A;  3L2W A;  3KP4 A;  2P8T A;  5JVT A;  5H20 A;  4DYC A;  2CGP A;  4HX8 A;  1XDS A;  4ON0 A;  2V1N A;  2VJ5 A;  2XPW A;  2FQ3 A;  2ZSH B;  5FGM A;  5HNF A;  1ZAO A;  4XN3 A;  1HBX G;  3R60 A;  2L9R A;  4YFN F;  3LAP A;  2JPC A;  3TDZ C;  2JN6 A;  1IN8 A;  1GV2 A;  2VJI A;  2PFB A;  3CUO A;  2E60 A;  1AWC A;  1B72 A;  1XGO A;  2HOE A;  3S8P A;  4C2T A;  1FYM A;  2H27 A;  2K85 A;  1IZ1 A;  4C2M J;  1JKQ C;  2HS5 A;  2IT0 A;  2IS2 A;  1HLV A;  1A6I A;  3NRV A;  3S32 A;  3K4L A;  4BL0 B;  1TW2 A;  4EGZ A;  1S7O A;  4A5N A;  1ZG5 A;  5LFA A;  4DOZ A;  1TW3 A;  2M45 A;  4FET A;  3J81 K;  4RLQ A;  1BIA A;  3BR1 A;  2HOT A;  5DDG A;  1I6H J;  2F48 A;  1PJR A;  2L02 A;  4E4H A;  4UUS A;  5IPA A;  2M8E A;  3DF8 A;  2EV0 A;  1OKR A;  2BV6 A;  2Q2E B;  4DJA A;  2VKE A;  3MD2 A;  1Z0X A;  2FMY A;  5BPI A;  5DCF A;  4YFK F;  1MBJ A;  5HNH A;  4CHU A;  5F1R A;  3HSR A;  4XKV A;  3HDD A;  2W7N A;  4A3F J;  1JUM A;  2QWW A;  2DAO A;  2EB7 A;  3JSP A;  3MKZ A;  1ZHF A;  4L5J A;  4IXA A;  1TNS A;  1FSH A;  2HQA A;  3H9G A;  2OCC H;  4MHG A;  3ZPL A;  3KX2 A;  4LGW A;  3S3O A;  4RAG A;  2QEX I;  1HST A;  5DCM A;  2CO5 A;  3B73 A;  1X2N A;  3HRU A;  1Z91 A;  5EZG A;  2DXI A;  4ZH4 F;  2AHQ A;  2DFI A;  4HF0 A;  3GTJ J;  3CJQ B;  2D1V A;  3QOE A;  4C30 A;  1IUY A;  3ASO H;  3FMR A;  2DA5 A;  3ZQC A;  1T33 A;  4XLA A;  4CYD A;  2L3D A;  5FLX Z;  3PO3 J;  4RGX A;  2V7F A;  1ZH5 A;  2OJE D;  1WJA A;  4EEF G;  4IKF A;  3VB2 A;  2K3F A;  2LVS A;  2QEN A;  2D1H A;  2EZH A;  2F5F A;  2ZNY A;  3QPT A;  1D0Z A;  1L0O C;  4HA8 A;  3E5Q A;  3UR3 C;  2M0C A;  1WI3 A;  4EVI A;  2XVC A;  2HR3 A;  4IRI A;  5IT3 A;  1XSX A;  3R61 A;  1BIB A;  4LD5 A;  1O3T A;  3J7A O;  2M87 A;  1PUF B;  2OC6 A;  2A3S A;  2O7O A;  2LFB A;  1VQL I;  3OSF A;  1MH3 A;  2CFO A;  2CYY A;  5C4J J;  2P5V A;  1VFC A;  4A6D A;  1D5Y A;  3NAR A;  5ICC A;  4J01 A;  2X48 A;  1YO5 C;  3F6O A;  2RQQ A;  4XRS G;  5J40 A;  1IRX A;  4II3 A;  2NRA C;  3GLL A;  4R1H A;  2LBF A;  4KYW A;  3QQA A;  4BNC A;  4O5V A;  2EIL H;  4DIQ A;  2HZT A;  1P9Q C;  4XMY A;  4XID A;  1GUU A;  1SVO A;  3DEU A;  4PDK A;  4RLF A;  3GF2 A;  4L5E A;  1W7P B;  3WGH A;  2MLK A;  4XLF A;  1WJF A;  5EDN A;  2BVM A;  3FDY A;  1VQP I;  2A6T A;  3S2W A;  2HU9 A;  4PSW A;  5LEJ A;  3F22 A;  3CME I;  1IXS B;  2WB1 A;  2LKS A;  3WHB A;  1VQ8 I;  3ERE D;  2QQB A;  4G8X A;  3JAM K;  2IA1 A;  3OR2 C;  3I53 A;  5DD8 A;  1X1B A;  5DCM B;  2ME6 A;  3VYU B;  2X4H A;  1J09 A;  4M3F A;  3ZMS A;  3PL8 A;  3QPS A;  3F8M A;  3BJO A;  3WU1 B;  2XGX A;  4EAT A;  3TGN A;  4I02 A;  1TC3 C;  1D0X A;  4OOI A;  2IA2 A;  1SFK A;  3T1B A;  2OAZ A;  4K2E A;  3MKY B;  1MSE C;  2XHK A;  1SD5 A;  1STZ A;  1O7L A;  3KZI C;  1LB2 A;  3LFK A;  4DGW B;  4KJZ A;  3PIP F;  4IVN A;  4LLG F;  1FIP A;  4C9Y A;  4ESF A;  1JI8 A;  2XAS A;  1XG1 A;  4QSH A;  2QZ8 A;  1SMY F;  3GO5 A;  1ZRF A;  4CCK A;  1Y39 A;  1YLF A;  3WTZ A;  2ZFU A;  4A3D J;  1OLT A;  1R36 A;  2VXD A;  4BBR J;  5DUI A;  2LOO A;  1A36 A;  2OTJ I;  3CJN A;  2ZC2 A;  1TQP A;  4KMU X;  3ZMV A;  2LD5 A;  1WRJ A;  3BLY A;  3GCM A;  3ESW B;  3PQK A;  1FIA A;  3B6C A;  4M73 A;  1HW2 A;  1K83 J;  2Z33 A;  3M1C A; 
#chains in the Genus database with same CATH homology
 2V26 A;  3PJR A;  4BDZ A;  3H9J A;  3OYM A;  2VJ4 A;  3BC8 A;  1D0Y A;  2WBM A;  5CQG A;  3LSI A;  2K5C A;  2CW8 A;  5FRN A;  3RCO A;  4XLE A;  3OYE A;  4NC8 A;  2VQG A;  2X85 A;  3QOD A;  3KYL A;  4CUG A;  4XQF A;  4HG2 A;  2LH9 A;  2KL4 A;  2BW3 A;  1D1A A;  4PSX A;  3DQV C;  4NC7 A;  1YX3 A;  2ZXH A;  3CZ6 A;  3SEQ A;  1NG7 A;  4HEA 2;  1T0F C;  2X6Y A;  4NQW B;  4ANJ A;  3L2Q A;  2Q1Z B;  3S3N A;  4IQJ A;  2MD0 A;  3VSL A;  3K4J A;  1D1B A;  2A5W A;  4ZTF A;  4NUB A;  3F9K A;  2OUM A;  4JOM A;  4F3Q A;  4HPQ A;  4E7I A;  4KT6 A;  3VWB A;  2VQC A;  3HG9 A;  4ZYA A;  3L2V A;  4XLH A;  4BGD A;  2LRD A;  2LY1 A;  1NG6 A;  2M0M A;  5KNL A;  4F52 A;  2VLA A;  1X4P A;  1QU3 A;  2IS4 A;  3E0J B;  4PFP A;  3HPH A;  3OYF A;  3RSN A;  1MMD A;  2F6C A;  2OV7 A;  3OYN A;  1G8X A;  3CES A;  5CPR B;  1Y6I A;  3IP4 B;  2JVH A;  3TMO A;  4FAS D;  4BXF A;  4HRI A;  2VAS A;  4BQN A;  1E0E A;  1AA7 A;  3BCB A;  2JA2 A;  1G59 A;  3K4B A;  1YX5 A;  3RQ4 A;  1PYV A;  2M4K A;  1YE9 A;  2O5R A;  2X6W A;  4BEH A;  4PJN A;  4N4N B;  4PUS A;  4IQ4 A;  2VL8 A;  4D1Q A;  3C2G A;  3H35 A;  2HPI A;  3OL3 A;  3HUG B;  4BS9 A;  2KMU A;  1BR1 A;  5CKT A;  4BQQ A;  4D9J A;  3S3M A;  3KEY A;  2HVS A;  4U87 A;  3SZG A;  1W36 D;  1Y56 A;  2FUG 2;  4XKW A;  4F55 A;  4BUP A;  3OYK A;  2XSJ C;  2W4S A;  3DKX A;  3PNV A;  4CZC A;  1SAU A;  2CW7 A;  2IS6 A;  1UEL B;  2MAB A;  2Z16 A;  3DU5 A;  2VPL A;  3OMY A;  1S9H A;  1Z21 A;  4XKC A;  4AYB A;  3TBI A;  3HXL A;  1X4O A;  3OL4 A;  3OY9 A;  3IAM 2;  3CP8 A;  4CCJ A;  3DPT A;  4XOR A;  4X0G A;  1X19 A;  3NWT A;  4XNF A;  2XAU A;  3SDB A;  1ZEL A;  3BG7 A;  3VYT B;  3N05 A;  4MLO A;  2QKL B;  4XON A;  1DP3 A;  3PSF A;  3OS2 A;  3EUK L;  2VJJ A;  1VZ0 A;  4PK4 A;  1DGR M;  3OYC A;  2AQE A;  3H5R A;  4Y33 A;  2LYC A;  2DOA A;  5FRM A;  2BOL A;  2L5Q A;  2Z2S B;  2F4I A;  3CP2 A;  3HPG A;  4Y3O A;  3OS0 A;  4BAC A;  3D5S C;  1U0J A;  4G6T B;  4OAZ A;  3OYL A;  3LSM A;  2R7V A;  2F5V A;  2LRE A;  3W2A A;  3S93 A;  4CCM A;  3CMM A;  2K9L A;  3DTK A;  4CCN A;  2ZSI B;  3EUH C;  3AL0 C;  2HDW A;  3VYR B;  2UV1 A;  3CJR B;  2CUJ A;  4ITV A;  2E1M C;  3OR1 C;  4Y4R A;  1WJ5 A;  4R79 A;  3OS1 A;  3OYB A;  3VYS B;  1LVK A;  3A2K A;  1V5E A;  1QHH D;  2GOM A;  2X6X A;  3OYG A;  2KP6 A;  1OR7 C;  3H5N A;  3DEE A;  3K6G A;  3LMM A;  4LIT A;  4HSR A;  5KCM A;  3I9V 2;  2XF7 A;  5HVQ C;  4PFO A;  4B47 A;  4E7L A;  5TGT A;  4B48 A;  2HVQ A;  2KRC A;  3BG6 A;  2P0W A;  3TL4 X;  4ZC3 A;  2VKD A;  2VB6 A;  4BE0 A;  3QYE A;  2BW3 B;  5HLT A;  2PJR B;  1X1C A;  1Z7L A;  4CH7 A;  4IX7 A;  3L2U A;  3W2W A;  2W1O A;  4RM3 A;  4U7B A;  1BR2 A;  4BE1 A;  3FBI B;  4B3X A;  4LIU A;  3ZRG A;  3LSG A;  3OYJ A;  2CUZ A;  4BEH B;  1BOB A;  2HPM A;  2GOX B;  2MC4 A;  4QPQ A;  3K70 D;  2WAF A;  3HL2 A;  3OIP A;  3K70 C;  3RTR A;  3SEZ A;  2XF6 A;  4GRI A;  4J00 A;  1WJB A;  2AQF A;  1D1C A;  3D5L A;  2DT6 A;  1KON A;  4HNT A;  3GBG A;  2NOJ B;  2JVG A;  4BQO A;  3HOS A;  2R7X A;  2L2O A;  4XM3 A;  2W82 A;  2KLO A;  1EA3 A;  3L2W A;  2JUG A;  2KRH A;  4XOP A;  4H4K C;  1LFP A;  2VXZ A;  4CCO A;  2XC7 A;  3SYT A;  1BR4 A;  3A1Y A;  2V1N A;  2VJ5 A;  1FMW A;  2X1D A;  2ZSH B;  4RMN A;  5HNF A;  3HOT A;  4XN3 A;  3OIQ A;  3PNY A;  3MKW B;  4LIV A;  2L7K A;  1V5G A;  1GLN A;  2VJI A;  2WA0 A;  2E60 A;  2KHM A;  3DPU A;  2LY2 A;  4BDY A;  3S8P A;  3PFY A;  3OYH A;  2V6E A;  4C2T A;  4KIS A;  4E7S A;  2PMZ A;  5LD2 C;  4E7K A;  2LC2 A;  4XKB A;  2IS2 A;  3OYA A;  1QHG A;  3EUA A;  3ONQ A;  2IGO A;  3S32 A;  4NNJ A;  3K4L A;  2DT7 B;  1W36 C;  4BL0 B;  2UUZ A;  4E6K G;  2R7T A;  4ZTJ A;  4JQF A;  2R7S A;  2HVR A;  2CV0 A;  2DCE A;  5LFA A;  4DOZ A;  4FET A;  3ZXS A;  4RLQ A;  4XL9 A;  4HST A;  2VQL A;  3FKJ A;  3ZQQ A;  1PJR A;  4E4H A;  1HA8 A;  2CV1 A;  3QYB A;  2R7W A;  1Z3X A;  2Q2E B;  3K10 A;  4N4O B;  4DJA A;  3MD2 A;  4AVZ A;  1MNE A;  2M4G A;  2WAE A;  2X1C A;  2R4G A;  3K4M A;  3OOU A;  3DTI A;  3M8J A;  5HNH A;  4BJ5 C;  4DBR A;  2PJR A;  4XKV A;  2CMP A;  3DWL E;  3VSK A;  2W7N A;  1LKX A;  1X1A A;  2DJI A;  2ELJ A;  2WAD A;  3K4N A;  3MKZ A;  2HNH A;  3QYF A;  2WY8 Q;  5JHF A;  3NWS A;  2HQA A;  3H9G A;  4PJL A;  2Y0S A;  3KX2 A;  4LG3 A;  3S3O A;  4PJJ A;  2ZXI A;  3H5A A;  3CF2 A;  2WAQ A;  1MMN A;  3DPL C;  3E1S A;  4CSW A;  2DXI A;  1N78 A;  1Z3Y A;  2K3P A;  3DKY A;  3AKZ A;  4HNU A;  3CJQ B;  2JSP A;  3QOE A;  4C30 A;  3DTE A;  3HC7 A;  3W2V A;  3FBN B;  3IUO A;  2E5N A;  4PJM A;  3BCA A;  4XLA A;  1WJC A;  3VDX A;  1MW7 A;  2L9N A;  3AL0 B;  5CQE A;  4ZJZ A;  4IZZ A;  2X1E A;  2V7F A;  2VQH A;  4ZDL A;  4B43 A;  1WJA A;  2MFZ A;  1FMV A;  3MMY B;  4IKF A;  2E1M B;  3V42 A;  4E7H A;  4BJT A;  2R7U A;  1D0Z A;  5KHD A;  3L2R A;  2CV2 A;  3UR3 C;  2WY7 Q;  4F92 B;  4II2 A;  1WFX A;  3H0D A;  2KZV A;  1MND A;  3ZGK A;  2BVL A;  4BU2 A;  4YEL A;  3UNG C;  1DGW Y;  3EPZ A;  4CA0 A;  3PUB A;  2OC6 A;  2IGM A;  4CCL A;  2CFO A;  3LSK A;  4P5O A;  4J01 A;  4P1W A;  1N75 A;  1WJD A;  1ERD A;  2XDV A;  3K4C A;  4QPO A;  2KDO A;  1DQU A;  2RQQ A;  2Z1D A;  2M7B A;  3A4C A;  1IRX A;  2I8D A;  4II3 A;  1UAA A;  3J7A Y;  2KPM A;  1R6R A;  3H9Q A;  2IXS A;  2XF5 A;  3ZCO A;  2LBF A;  4XN0 A;  2MYS A;  2W00 A;  3LSH A;  4DIQ A;  1P9Q C;  4XMY A;  1MMA A;  3OYD A;  4F93 B;  4C2U A;  4RLF A;  2QKM B;  1MMG A;  3DU6 A;  4XLF A;  1WJF A;  3FHN A;  2BVM A;  3FDY A;  2A6T A;  4BE2 A;  2HU9 A;  2CS3 A;  4BJ6 C;  2VKH A;  2M7A A;  4PSW A;  2RNG A;  1UG0 A;  3C2H A;  2WB1 A;  2V4J C;  2M3A A;  4YRV A;  2R7Q A;  3PSI A;  1T95 A;  3IAS 2;  2KQR A;  3OR2 C;  3RPU D;  2IGK A;  3LL7 A;  1X1B A;  3VYU B;  2HZD A;  1J09 A;  3LFU A;  4OWR B;  5HOO A;  3DLA A;  3PL8 A;  2VIX A;  4ZDP A;  1TT0 A;  4EAT A;  4E7J A;  3ZR8 X;  3W3C A;  2R7O A;  3PNT A;  1D0X A;  4DBQ A;  1SFK A;  3G2B A;  3MKY B;  4XOT A;  4OAY A;  2E5Z A;  4RM2 A;  3K4K A;  4YEJ A;  1WJE A;  1X1D A;  4DGW B;  4XLC A;  4KJZ A;  3U21 A;  4XR6 A;  3OYI A;  2CH0 A;  4C9Y A;  2R7R A;  2IS1 A;  1JI8 A;  2LBF B;  2LG4 A;  2V9K A;  4KIT B;  3D5R C;  2IGN A;  4E7Z A;  1LDK B;  1V5F A;  2K9M A;  4CCK A;  2RRE A;  3I3L A;  2ZFU A;  1OLT A;  1TZL A;  2VXD A;  2LOO A;  3OWT A;  3AFH A;  5FRO A;  2L9S A;  4B44 A;  1N77 A;  3BLY A;  3HKZ A;  4F91 B;  4AU7 A;  4ZDO A;  1K6Y A;  2X51 A;  2UWM A;  3M1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...