4N4NB

Nitrosomonas europea hao
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
SLAPISAKDMLDYLACKDKKPTDVVKSHTEVENGKIVRVKCGDIVALVQKAREQSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hydroxylamine oxidoreductase
publication title Structural Basis of Biological NO Generation by Octaheme Oxidoreductases.
pubmed doi rcsb
total genus 12
structure length 56
sequence length 56
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2013-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4n4nB00
4FASD 4N4OB 4N4NB
chains in the Genus database with same CATH superfamily
5H20A 4KIFA 3WGHA 1DP3A 4XKWA 2EIMH 2BHYA 1S72I 3E5UA 1KONA 5FKKA 4EVIA 4MEXF 1YW8A 1X1CA 2EFPA 3WU1B 2GXAA 4LK0F 1TWCJ 2LG4A 3LQRA 1K78B 4Q48A 1MZBA 4FX0A 4KN7X 2K40A 2V4JC 3TO9A 5JI6A 1ZGWA 1Y0NA 1U78A 5LEJA 3KCCA 1MBJA 3ONQA 1LEBA 2QSFX 1YLFA 1J2XA 2KT0A 1U2WA 4OINF 1ZGAA 4ASNA 2HR3A 2AQEA 2CSOA 4IXAA 4NHJA 4HLYA 2UZKA 1YI2I 1TT5B 1O3SA 2YU9J 2AO9A 4ZYHA 3K4BA 1MSFC 2CQ7A 1WHUA 4GGGA 1HC8A 4D7NA 2DA5A 3QYEA 2VBWA 2L54A 2IEKA 1ORKA 2LTPA 3F0CA 1S6LA 1B8IB 3M7GA 4CDGA 2ZJ2A 5F64A 1AOYA 4I6ZA 1F9NA 2EFOA 1I27A 2X1EA 3EETA 4U0YA 3ECHA 3ZXSA 4CCLA 2GOMA 1HLVA 1OR7C 2Y0SA 3WODF 2AS5F 2H6CA 2UUZA 4MGRA 4LOCA 4V2GA 5L3CA 3HKZA 2RQQA 2DLLA 5M5YJ 4ZYEA 2OCEA 4ESBA 2PMUA 3AKZA 2L3DA 2CQXA 2EH3A 4G7ZF 2CH0A 4X6AJ 3LFKA 3VB2A 3W2AA 4MQVA 2JUCA 4RMNA 1JGSA 4KFCA 3T8TA 1B72A 3I55I 3ECOA 3LSIA 4E7IA 1SMYF 1IXSB 4Z2YA 1APLC 4AYBA 2Z5UA 2RN7A 3QODA 4XORA 4UV9A 1K79A 4RM2A 3H9QA 4AU7A 2H6BA 3P9KA 4PCQA 2Z33A 2DU9A 3TW6A 4ANJA 2XB5A 2VBXA 2OJED 4KYWA 2NVQJ 1IAWA 2DK8A 4ENNA 3HRUA 4HSRA 1YJWI 2VPLA 3FMQA 1U0JA 5CQEA 2FOKA 2NS8A 2E1CA 3K10A 2A68F 3E0JB 2V9PA 3PSIA 4I76A 4CUGA 4E7JA 1RR7A 4XLAA 4GDFA 5D4RA 4PGHA 3U21A 3DWLE 1T8IA 3B6CA 1X2NA 1LKXA 3VYUB 1T56A 3F8NA 4FHTA 2DJNA 3BROA 4G7HF 4L0YB 5LEKA 2Y9YA 3RI4A 4HNTA 1BC8C 2QVOA 5HLTA 1BI1A 4LB6B 3TBIA 4XQFA 2ZXWH 2CV0A 3K6GA 3CTAA 1Y8QB 4QSHA 3MD2A 5CVJA 3UNGC 1I39A 2DO7A 1TBXA 4K2EA 4E7LA 3O6BB 2FEZA 2D45A 1MNDA 3L2RA 2LBFB 5J4YA 1OCTC 1B1BA 3ZN0A 3BTLA 4F55A 3CF5F 5K5QA 4HOBA 5H6QA 4ENKA 4YIIA 3ZP5A 2JQ7A 1CF7A 3J81Z 1U3EM 4KICA 4DOZA 4XN0A 1ETVA 1EF4A 3GEZA 5FROA 3K4KA 4F3QA 2JPCA 2XIGA 4RS8A 2Z1DA 1T95A 3I53A 2F4IA 1GV5A 1WCMJ 5KK1A 5C3EJ 1IRGA 3HOZJ 1JT6A 4F92B 1ZELA 3OYHA 3VYTB 4N9HA 2P5LC 2BY3A 2CFOA 3KEQA 1BBYA 2YX7A 1HW2A 2IA1A 4OIOF 2DYSH 1PVEA 2ID3A 4BQNA 2K02A 3BC8A 4OIRF 4A3CJ 3SHFA 2HI3A 2E2JJ 4A3BJ 2EZKA 1S7EA 1Y1VJ 3PNVA 2HTJA 4ZYGA 4BDYA 3CJTB 3ZPLA 4PK4A 5CLSA 4UY8I 1UHWA 2XSJC 3M8EA 2FNAA 1HKTA 2KJBA 1MJBA 2X1CA 3JAMK 3DLAA 3KP6A 5AIQA 3CUQB 2M4GA 4G12A 2DCEA 5IY5H 2M87A 2N8GA 4NQWB 1ZYRF 1QZZA 2L4AA 3A4CA 3S2DJ 1O3RA 2A05A 2D2WA 5KVRA 3OYAA 1MD0A 3T1BA 5D6EA 2K9QA 4I99C 5BNGA 2V1XA 1R4MB 3PNTA 4EJOA 1QGPA 1J59A 4DW6A 4IPAA 3VPRA 3IRRA 4HBLA 2JMWA 4P1WA 1J5YA 5EEHA 4WX9A 2M7AA 3QQAA 4B48A 2W24A 1BR2A 2ESHA 2IJLA 1U5TB 1XD7A 1YX5A 2QGUA 3OWTA 1ZR2A 3L2VA 3OYIA 4HF0A 1XCBA 3N4MA 4KIBA 5ICGA 1TT0A 1TQPA 2GA1A 3OS2A 1VQ6I 2HXIA 3S1NJ 2QQBA 1WJAA 2LREA 1IXRC 2Y75A 1BA5A 2X0LA 1FMVA 1A6IA 2XC7A 1ZK8A 3LA7A 4AIKA 3HG9A 2P5VA 5TISC 3D1NI 2IGNA 1G59A 2I10A 4XLFA 5DD4A 4EJWA 2LOOA 4C3HJ 2FA5A 1PDNC 4O5VA 4ZTFA 2LC2A 3E6DA 3ZGKA 2VOOA 2KKOA 2X6XA 2YUSA 3RPQA 5B1AH 4CSWA 3JSPA 2WB1N 4C2MJ 2K3PA 1ZGJA 3RDIA 4XONA 2VQCA 2MLGA 2KHMA 4IRGA 4BBSJ 3BR0A 3KX2A 2VKVA 3CMAI 3KETA 3HOXJ 1F43A 4UVBA 4A0ZA 2R7UA 3V7CA 2NS0A 3AL0C 3I4PA 3CMMA 1YO5C 3HRTA 2VJJA 3HB9A 1VQ8I 2DA3A 3E3VA 5IYCJ 2EA4A 2K7LA 3D5LA 2W4SA 3KP5A 3TDUC 4BXUA 3BTJA 5C4XJ 2K3FA 3HL2A 3K70D 2PI0A 1ENHA 3TW7A 2HNHA 3TO7A 3PSFA 1A04A 2OAZA 3Q0UA 5DCFA 3WG9A 4L9NA 3EUHA 4RAGA 5BMZA 2HOEA 1XGOA 2IXSA 3SFIA 3E1SA 3FX3A 2ME6A 3ERED 1B9NA 2GOXB 1ZREA 5LRRA 5CVIA 3RKXA 3TOBA 2HOSA 1SD4A 2JA2A 2P81A 1A36A 4MEYF 1H9TA 1JUMA 2LNBA 4MIMA 3EPZA 3FXOA 3RKWA 4BE2A 3CQZJ 4E70A 5E8GA 4XKBA 3AG1H 2OPTA 5F08A 4UNOA 2DFHA 2M0CA 2IA2A 2ICWG 2CUFA 5D6FA 5EGOB 3WHBA 5L3BA 2P7CB 3CCUI 3GFMA 3I56I 5HDGA 3PO2J 1G3SA 2LRDA 3K2ZA 2JA8J 4L0ZB 3GTLJ 1YJ9I 2CUEA 1WQ2A 1GHCA 2EJRA 5GTIC 1DP7P 2CW7A 3FBIB 1JT0A 4LIUA 2AHQA 4N0BA 1UELB 2EIKH 1LUJB 3PQJA 4RM3A 2XGDA 1XN7A 4BACA 3GYHX 4E6KG 4A3GJ 3CC2I 4XRFA 1U8RA 1TQIA 2EZIA 2PFBA 2NRAC 1UJ8A 4N4OB 2FU4A 4RAZA 4C30A 3WTSC 1JI8A 2EK5A 1TWHJ 1MMAA 3CCJI 3GF2A 2HVRA 1IDYA 2ZFWA 3A02A 5B3SH 3QPSA 2M0MA 4KMUX 5FGMA 1OKRA 2Y48A 3HDDA 3G4SI 4A12A 4QWQA 1VF9A 5E18F 1ZARA 5E1WA 3PFIA 4KN4X 1IUFA 2HXOA 2EIJH 1YFHA 1FC3A 2RGVA 5DUKA 2FQ4A 2QQ8A 2GQQA 1KZHA 4J01A 3HTUA 4HPQA 5L3FA 3ABLH 2JPBA 1SVLA 2GLOA 2ETHA 1TTYA 3Q0WA 5E20A 4DYQA 3SJMA 2HQ5A 1HOMA 1QZYA 5JR3A 1L0OC 2K9SA 2XGEA 5K7HA 3MVPA 1O4XA 2OC6A 3S2HJ 1MMNA 2M5WA 1QU3A 1E17A 2E71A 3A0BC 3SEQA 3KE2A 1LVKA 1WSUA 1ZHFA 5ICEA 4HAMA 4L9JA 3HIFA 4AYBN 2VB6A 1LB2A 3GTQJ 1U9NA 2ISZA 2BGCA 1YX3A 1YOVB 3BQYA 2TCTA 3BP8A 1FP2A 4MO7A 2XF6A 3KP3A 5TGTA 3IHUA 4XSZF 1FLIA 2DT5A 4DNCA 2VJIA 3KPHA 5E3OA 5A2QZ 3AG3H 2F48A 3E6BA 3ZQHA 1D3YA 2CRGA 1K7AA 1LDJA 5DCMA 4B4CA 1FZPB 3A2KA 3MFKA 2GZWA 4BKXA 3JRHA 1H88C 3WG7H 2Z16A 1IRFA 1OCCH 4L5JA 2K9LA 2HWVA 2DQLA 1RRJA 3CP2A 3FMRA 1AWCA 4HQMA 1GXQA 2GXGA 4HDVA 2XB0X 2HKOA 2H1LA 4G8XA 2P8TA 1HDPA 3A1YA 4FQGA 4EGZA 1F1ZA 3KP4A 1VQ4I 5LHIA 3BDDA 2DT7B 4EGYA 1ETQA 3HHGA 5L3GA 2QLZA 4Y3OA 3F8CA 4C2TA 3GWZA 5CPRB 2GBYA 3H35A 3FXMA 5ILVA 3PO3J 2W25A 2FRHA 4JYKA 4JQFA 2Y2ZA 1ULYA 1LVAA 3K7AJ 5FFXA 2IS6A 2DODA 4HX8A 1XC5A 2IS1A 1Z91A 5J6XA 3GZ5A 1XMXA 4GXOA 2OA4A 3OR1C 4PDKA 3JRDA 3RZOJ 3DEWA 4TV7A 4G7OF 3C1DA 2E1OA 4LK1F 2A6TA 1ZLKA 4HF1A 3DQVC 3WTYC 1MBKA 2QENA 2K9MA 4M71A 3HUGB 3H9GA 2RAEA 4IRIA 4XKVA 1GV2A 4ON0A 2V26A 2FSWA 3FXQA 1BOBA 1YQAA 4XM3A 3GTOJ 2CQQA 1S7OA 3CO7C 1P92A 2LKSA 3TO6A 1LE8A 2FUG2 2COMA 2DFIA 4X0GA 4BL0B 2VUMJ 3L00A 3ZR8X 2CUJA 1OYYA 5FLVA 2JWTA 4Z6YA 4J19A 4B3AA 2A69F 4L5EA 2DW4A 3H3ZA 5M5WJ 2CUZA 3EUHC 4DIQA 2QEXI 4XK4A 1FIPA 2MBFA 5IT9Z 2EFNA 2LF8A 4E7ZA 1I1SA 2JRTA 1AKHB 4I01A 1IN8A 2YU3A 1KU9A 1XCVA 2JVGA 2EV0A 1QO0D 2QWWA 1BOAA 1XDUA 5FRNA 1HCRA 3S1MJ 5JVGF 1B9MA 3AG4H 1G3TA 1POGA 3OYBA 3T8RA 3UR3C 1ETOA 4A69C 1P4AA 3JTGA 1R00A 2ZXHA 3F8BA 1K78A 2PJRA 2IAIA 3HC7A 1Y0UA 3TP0A 3PFYA 3U2RA 1IGNA 5M3FJ 5LGNA 2VXDA 3BT9A 1Q1HA 1MMSA 1YIJI 3JRIA 1H9GA 2MH9A 1RUOA 2UV1A 4G6TB 3M1EA 1PUFA 4MQ9F 1DU6A 2R4GA 2LKXA 2DDBA 3I59B 2VT2A 2X9DA 5AONA 2F5FA 2DJIA 3DFGA 1W0UA 2ZC2A 3DU5A 1R1UA 4G6QA 1CGPA 3LSRA 2IP2A 1LNWA 2HU9A 2XAHA 2ZO4A 3O8GA 3T5XA 1LFBA 3E7LA 4H4KC 4AM3A 1X3UA 4JP0A 3F8MA 3RKYA 1ZTRA 1MIJA 2MABA 4BYYA 4OMZA 4BJ5C 2WAFA 2L9VA 4XN3A 1MNMC 4FX4A 3OMYA 4DGWB 3LOCA 4ZC3A 2QBYB 5CVRA 2O8KA 3CCMI 1Q1VA 2L9NA 1OYWA 4UUSB 2BY1A 3JTHA 3JRGA 1OQYA 4IKFA 4M3FA 2V79A 2BHZA 2LLKA 2PG4A 5IP6A 1SAXA 1J75A 1KQ8A 3HEFA 3KEOA 1E3OC 4HQEA 1JKPC 2QSGX 1K6YA 2KRCA 5KCMA 3FM5A 2B0LA 1OCRH 3X2QH 3SEZA 3J7ZI 3WTWC 3HOWJ 5BQTA 2DMQA 3ZQLA 4H0EA 2CJJA 2HQNA 4HA8A 4HF2A 2O61A 4XSXF 2R7QA 2NOGA 2Q8KA 2M34A 4IOAF 5FLXK 4GCVA 4B3XA 5K5RA 4G9YA 2F5VA 3I71A 3HOSA 2L2OA 1BR1A 2LH9A 1X1AA 3PL8A 4PGGA 1ZAOA 2KP6A 3LNQA 4U0VA 2TRTA 3LSKA 4IHYA 3OS0A 3V42A 2V1UA 4J00A 1QVUA 1X3ZB 1UHMA 4CZZA 3H3VK 2X1DA 2XAUA 2KL4A 3A01B 3B6AA 2VE8A 5EG0B 1DPUA 2ESNA 1FEXA 4Q47A 2DMNA 1MH4A 1G4DA 1Z6RA 3L2WA 3LA2A 3R6SA 4N9IA 2LBFA 4HRIA 1J7KA 2E60A 1TWFJ 1NTCA 1BI3A 2ZXIA 3N05A 5TJJA 5EDNA 5FFZA 3S1QJ 4FCYA 2JSCA 3CLQA 3CJRB 2PBIA 3Q0VA 4MFEA 3I3LA 4IHSA 2LY1A 3Q3SA 2OUMA 2BE5F 2WAQA 3PUBA 4YG2F 3GLLA 1E2XA 2RQPA 3OIPA 2VN2A 4CCNA 1YW7A 3Q9SA 3JRAA 1V54H 2DQRA 3M8JA 4EM1A 3L1PA 4LJZF 2O3FA 1O7LA 1EJ9A 4I02A 2W84A 1E0EA 1VI0A 2Y31A 2I8DA 1I6HJ 2FX0A 4DZPA 1JKQC 3BQZA 4EJTA 3CCQI 2VPRA 5J1YA 3DP7A 3BG7A 2TDXA 3JCUC 2FXAA 3VEPA 1WGXA 3U9GA 1ZG1A 2VJ5A 1ITYA 4HNUA 2FQ3A 1NHAA 4BJTA 4HX4A 1MBGA 1JHHA 3BJAA 3NRVA 3BJ6A 1SEUA 2H94A 3I4MJ 1HKSA 2X6OA 1AHDP 1GDTA 2KIMA 2LYCA 4XRMA 1YIOA 4FE4A 3GTGJ 2NS7A 2DTZA 2K27A 2HDCA 1WI9A 4OIQF 3CUQA 1V5EA 4Y33A 4HNVA 3OS1A 1KGSA 2M8GX 3HXLA 3OL3A 3RJPA 1I3QJ 1YYVA 2BXYA 3GFLA 2HGCA 2ZBKA 4M3DA 4E4HA 3IH2A 1IRZA 2COBA 3CJQB 3LAJA 1IUYA 3MCZA 3RCOA 4Y52J 3W6JB 3HJEA 1R36A 2NXNB 1Z7UA 3KZYA 3WU2C 4ZH4F 1L3LA 1U5TA 1X2MA 3RSNA 3U1KA 4NDLA 2DMTA 1W4MA 2R5YB 3MKWB 4P96A 2JA6J 4DJAA 3B73A 3H3UA 2HYJA 1FOXA 3FKJA 2BZTA 3HGYA 1RZ4A 2MD0A 5IT3A 3NEUA 3BR2A 2JN6A 1MJ9A 1SD7A 4FT8A 2D1VA 1D1BA 3OYGA 2VQLA 2PX9A 5JFRA 2XF7A 2G7UA 5DYMA 5F0FA 4AD9A 4BXFA 1T39A 3VYRB 4XMYA 3G6EI 2E1MC 3LL7A 2XGXA 4EM0B 2W82A 1FTTA 3DPUA 1CQTA 2KIFA 4I0BA 3BOQA 4A3KJ 5EEGA 1W36C 1QHGA 2EZHA 4A6EA 2Y0MA 3BTCA 1NH3A 2OV7A 1IO2A 3P7NA 1DU0A 1LPQA 3FM3A 2L02A 1Z0XA 4HV6A 3ULQB 2W00A 3BG6A 3MAJA 3OL4A 3M1CA 3TKYA 4M73A 3AFHA 3RZDJ 4ITVA 3J7YJ 2FOWA 3DEUA 1JHFA 2DA2A 1IV6A 4HEA2 1VQKI 3CCEI 5E1XA 4U88A 2IS2A 3M9AA 1IZ1A 1D8KA 2VKEA 4BQOA 3DTKA 2DFEA 1BM9A 2EILH 3HRSA 4ETSA 4BQAA 4UUTA 1Z7LA 5HS9A 1Z6TA 2BW3A 2R7DA 1HXDA 3PJRA 3K2AA 2ECCA 3G1MA 4OAYA 3DKYA 3LSJA 1FSHA 4XLPF 2ZCWA 1B72B 1FX7A 1PP7U 4BNCA 4XOTA 1WZ2A 4RB3C 3BCAA 3JRCA 3ESWB 3S8PA 1W7PD 2HYGD 1R5HA 1VNDA 2KDOA 2WA0A 1N25A 3K70C 4ZJZA 3H92A 2OCCH 4F7ZA 3IKVA 5FD5A 3IWZA 5JHFA 4CO8A 4EATA 3L2CA 3CCYA 1P7IA 2VT3A 4XNFA 4L5IA 1FYMA 4EMSA 1HSTA 4BHBA 1NK3P 1E3HA 5F6FA 1S5LC 1OMIA 5DM6F 1XMKA 5FD6A 1MSEC 3DBLB 3CCLI 3L09A 4GO1A 4V2FA 2E2HJ 4HX7A 3BR1A 2FBHA 2VQHA 2HKXA 4HZFA 4BXXJ 5B1BH 1BR4A 3ABTA 2DMPA 2EBIA 4BU2A 3DU6A 1T0FA 1WI3A 1HDDC 2OZUA 1D5YA 3E97A 3ML6A 2CV1A 1RNLA 3GMEA 2V6CA 4IHWA 4PSXA 2JT1A 1V55H 4LLGF 3OYNA 5CQGA 4AVZA 3FMSA 3M4OJ 1FTZA 2VKDA 3C2HA 3RQIA 3DLLF 2R7WA 4BE0A 3BG9A 1NK2P 4RGRA 4WCGA 2R7ZJ 3O3KA 3QYBA 3TGNA 2BVMA 5GTHC 4RDUA 4KMFA 3R61A 2KISA 1FY7A 2PLYA 4ZYAA 4RGUA 1XTAA 3IH3A 3CMYA 3HOUJ 4YEJA 4DBQA 4C9YA 3GX4X 1K83J 2MD5A 2QZ8A 3COAC 2GM4A 5M3MJ 1G3WA 2CYYA 2QCOA 1I1GA 5ERIA 3PIOF 4HYEA 4A6DA 1R7JA 3ZQ7A 1GVDA 1G8XA 2F5EA 3QOPA 3HM5A 2P7VB 2IBDA 5JVTA 2VASA 4M6YA 4I2OA 5D5VB 2BOLA 1N78A 3SZPA 1O7FA 1RESA 4RA2A 5IPAA 2VQGA 3NARA 1JTYA 2LK2A 2LR8A 3DBHB 1JKRC 3JREA 4QTRA 2KJCA 3LSHA 4JX4A 2ZMEB 2EA2A 3IKTA 2RVCA 1MMDA 4CGZA 5J3LA 3QU6A 3HHHA 4AIDA 4CH7A 2A5YB 3RQ4A 3GTJJ 2E2IJ 4A3JJ 2JRMA 2CFXA 2MC3A 3J81K 2P6TA 3I9V2 3GCMA 4LG0B 3E6MA 1U5TC 2VI6A 4M9SA 2Y9ZA 3FDYA 1X19A 2G7HA 3W2WA 3BWGA 1P4WA 1X4OA 1QPIA 1VQPI 1WJEA 4DYCA 2M9HA 3RTRA 3TP3A 5ILUA 2AXTC 2M8EA 3E5XA 4UB6C 1JGGA 2HDWA 4IHVA 4PFPA 3E5QA 2E1NA 1MH3A 4NC6A 1FBSA 1HSJA 1XDSA 2DBBA 4LD5A 5LFAA 4A3IJ 1PP8F 3ABKH 3G3ZA 1K4TA 2R7TA 1A5JA 3MZYA 2CG4A 5D5UB 2XKPA 2XVCA 4M9XA 5AIPA 5JHUA 2X6YA 2M3AA 2H8RA 2WAQN 2HPMA 1SFXA 5E3LA 1FWZA 2QSHX 4KNYA 3EDPA 3MKLA 5K7FA 2KZGA 1Z05A 2BY2A 5LGUA 5IYBJ 5HDKA 4YFKF 4P9FA 2O8XA 4RGSA 4U7DA 2FNPA 3OYFA 1ACIA 2Y0SN 2J5OA 2B9SA 3OYKA 2BVLA 3TEDA 4CCKA 3HKZN 2O03A 5FKMA 2MLKA 3HUGA 3G1LA 4WXCA 1R71A 4M6VA 4ZYDA 3R0JA 3IWFA 2W7NA 3W6VA 4WWCA 3ABUA 5CVVA 3JSOA 2M7BA 4IQ4A 1VQ9I 3DV8A 3GZNB 5GPCA 4CCOA 2WY7Q 1XSXA 1BJZA 3H5AA 5J1RA 2CU7A 1N77A 2X51A 4E7HA 1F5TA 4II2A 5CVUA 2QQ9A 3J80Z 3HGGA 2EINH 1DGRM 3HBLA 1WRJA 3K0LA 4R79A 2R93J 3BPXA 2FJ1A 2Q1ZB 4HW0A 5F1JA 1Y56A 5DUIA 4XIDA 4U0WA 1ETXA 4DZJA 4CYDA 3ZMTA 5HNFA 3L9FA 4B44A 3WGIA 1RPWA 1K4SA 1Y8RB 4UB8C 2P5KA 1FOKA 4UXNA 4A5MA 2MA3A 3HPHA 4C2UA 2KFDA 1MBEA 1P4XA 2HVQA 2ZKZA 3WHCA 3S3MA 1HF0A 1SD5A 3A03A 4D1QA 3CMEI 4BQQA 5F04A 4D9JA 3DCFA 4ZZLA 2MC4A 5E1ZB 1F4KA 1Z21A 3BTIA 4AWXB 2K4BA 4A0XA 3I4NJ 3M8FA 3C3WA 3D5RC 2CV2A 1K61A 4BEHA 4L9VA 2K85A 5HS7A 5TRDA 5DEQA 2O5RA 3I59A 2VC0A 1MBFA 3IP4B 2BXZA 2IPQX 1Z3XA 9ANTA 1T0FC 2HEOA 2ID6A 3FKIJ 4BS9A 1OLTA 3QU3A 1XSDA 3JRFA 2RDPA 4KJZA 1DUXC 4A5NA 1U6GA 4OAZA 3V7SA 4UUVA 4IQJA 2CQNA 2X6WA 4AIHA 1U9OA 1Z67A 1WWXA 5B5EC 1VZ0A 1FYLA 2BYVE 2GWRA 2R7RA 3C18A 3PUFA 3TQNA 3TMOA 1EV7A 2ME0A 2VLAA 1OJLA 3S32A 2DI3A 2Q2EA 2QBYA 4DBRA 3S17J 2NAZA 2XV4S 2MFZA 1IV8A 4BH9A 1D0ZA 4ENJA 2EV5A 4A3FJ 2LY2A 1JUPA 3KYLA 1D0XA 1ERDA 5HLHA 4HV5A 1VQLI 3RIRA 3H9JA 2PMHA 1RKWA 4KIGA 1UAAA 2PN6A 4M9ZA 2FD5A 2E36A 4MFDA 4B1RA 1A6QA 3HSRA 4ZDOA 2AQFA 2O7OA 1VQ7I 5C44J 5EZHA 2CW0F 3D0SA 4EJUA 2F4OB 3B02A 1MDMA 3NWTA 3A0HC 1WH5A 2WV1A 1MGTA 5LHHA 1B59A 5HVQC 5KNLA 3HOTA 5J1UA 3NQOA 3HOYJ 3LSPA 1YW9A 5CYVA 2VL8A 3LFUA 4ZDLA 4KDPA 2V6EA 3ZMVA 2A61A 4XOPA 4IF4A 1J0RA 4XLHA 1FT9A 5L3EA 1P6RA 1D1CA 2F6CA 1FP1D 3DTEA 2DT6A 2EV6A 2CMPA 3M07A 3MWMA 2JA7J 3CD6I 1B6AA 1T08B 1JUSA 2EWNA 2O0YA 3A01A 5BS6A 1SC7A 1UCRA 4OIPF 3H0GJ 3Q9VA 5EG0A 1SVMA 2IS4A 2EPFA 2EQRA 2R7FA 5DS9A 3GFIA 3GUDA 3GVAA 1QHHD 1LQ1A 3WTUC 1SFUA 4RAYA 1Z1DA 3H5NA 4RB2C 5DCMB 1S7AA 2E35A 3ZQGA 2DA6A 3GO5A 3QPHA 3MN2A 1TQMA 2W85A 2OF7A 2E5NA 3HOVJ 2ECBA 1WJ5A 1OCOH 3O2PE 4E7SA 3KLNA 3KP2A 5D5WB 1NG7A 1B8IA 1XS9A 1V4RA 4B43A 5LRSA 1F36A 2DMUA 2DOAA 2XAFA 5K1YA 5F27A 5FKNA 3MQ0A 1X3WB 2P0WA 2HFHA 3BG3A 4CYCB 3FHNA 3PNYA 3MKZA 3LSTA 1HW5A 1ETYA 2L5QA 2LF7A 2P4WA 4KT5C 1FIAA 1A35A 1P7JA 1P9QC 2EZLA 3FK7A 4LMYA 3J80K 4R8HA 4MTEA 1HBXG 5DDGA 2XSDC 2NVTJ 3C7JA 4FISA 4UHTA 1OFCX 3I54A 3V8KA 2KIQA 5B66C 1YHQI 3CDHA 5HNHA 5A2QK 4OU0A 4OWRB 4IRHA 2BBYA 2ELHA 4EQQA 5DTDA 2MSYA 4CZCA 4D0PA 3P9CA 4I7HA 4EJVA 5EEAA 1MKMA 1RUNA 1MBHA 1S3JA 3FF5A 5IP7J 3J7AY 4JBAA 1JTXA 3J7AO 3FXJA 1V5GA 3WE3A 2DN0A 4G6DA 3RYPA 1BI0A 3GBGA 1X58A 1LE8B 2XROA 2DOFA 3ABMH 4Y7NJ 1IN7A 1OCZH 2W57A 1VQ5I 1VTNC 1Z3YA 1H89C 3OOPA 4LITA 3ZQCA 3F8FA 2QA4I 2EFQA 4BDZA 1Z9CA 1LFPA 2R7XA 2EFWA 4GYIA 3V4GA 1RR8C 3VFZA 5F1RA 1IF1A 3GW2A 1J09A 1E3PA 3DKWA 1GVJA 1HA8A 4U87A 1UG0A 3SFZA 2VONA 3IH4A 3ELKA 1FBUA 1JJ8C 2OZ6A 2R5YA 5JLXA 4W97A 3G73A 5KAIC 2QQAA 3CLOA 1FYKA 3LWFA 2HZTA 4B47A 3ZQFA 2WADA 5J40A 3DTIA 3WTTC 4I98B 3G71I 4OMYA 2MGQA 4ENMA 3KYDB 1W7PB 2PJRB 2LMDA 3VOEA 1IN4A 3JAMZ 3L2UA 2WWYA 1QNTA 4HLXA 5FJ8J 4JX6A 4IO9F 4A3DJ 1DDNA 2NNYA 1KYWA 1KU7A 1X4PA 3CC7I 3V7RA 4A93J 2XPWA 2HPIA 4BUPA 1AA7A 2VXZA 2KMUA 5LHGA 3SZGA 1PUFB 2W1OA 3ISPA 3R0AA 2VIXA 2CGPA 2FMLA 4E7KA 1IC8A 2HVSA 2ZJPF 5HDNA 2ZNYA 2LKPA 2V1DA 2OU2A 2HQRA 1WFXA 4JOMA 5IT9K 3WTZA 2CO5A 2E1MB 2VE9A 5CKTA 4PZJA 3WU0A 1BC7C 2R5ZB 1TZLA 4U7BA 3BZ6A 2XASA 1ETKA 2DA4A 1FNNA 6PAXA 1TL8A 4MLOA 1QA6A 1SD6A 2UXXA 2YX4A 5J8CA 3F3XA 4A2UA 1V3FA 3OIOA 1BW6A 3OYLA 3EUKL 2ISYA 3K9TA 2ADUA 2QYOA 2L9SA 1QBJA 2K9NA 4M3BA 1AU7A 1R9TJ 4LGWA 2ZFUA 2XPVA 2W48A 3KFWX 4B8XA 2BEOA 3Q5FA 1T98A 2HDDA 2MYSA 4NQWA 2B63J 2HOAA 1IN6A 4ESFA 1SFOJ 2DPUA 1G6NA 3K1NA 1G3YA 2DA1A 2X85A 3CJNA 4BAYA 2NNNA 2PEXA 2DXIA 3AG2H 3IC7A 2IVMA 3TDZC 3VDXA 1ZKGA 4WK8F 1BIAA 3M3YJ 3DPLC 1YRNB 1WPKA 2OQGA 1NG6A 5FO5A 1ZG3A 2EB7A 2XDVA 2KQRA 2Z9OA 2NYXA 3C2GA 4YIRX 2XAGA 4CICA 4FETA 2XGCA 1VQOI 3F72A 4CCMA 5LD2C 1IG7A 4BHPA 1I6XA 5LGTA 1IJWC 1EKEA 1HW1A 3K4JA 4D5FA 3LA3A 3LSGA 3V8JA 3DBRB 4KUMA 4XLEA 1TW2A 3OSGA 4PJJA 2HTSA 4JK1X 4A0YA 2QM3A 1ETWA 1V5FA 2K4JA 2KZVA 1X1BA 3DF8A 5E8IA 2LP0A 2UWMA 2JJ7A 3HYIA 3K1PA 3W6KB 4QIWN 2QUFA 3S14J 5E3MA 2Z99A 1XGSA 4XR6A 3EYIA 1R6RA 1T33A 3SXYA 3KZZA 2XAQA 4KA4A 2STTA 1ON2A 4PJNA 1K6OA 1D5VA 3BR3A 3FHZA 2R92J 2MH2A 3O8HA 2WC2A 1SMTA 1SFEA 2HZDA 2MG4A 3HSFA 3S16J 5HS8A 2E7WA 3CCVI 3MZHA 4LB5A 4CA0A 5FKLA 3OYDA 4BHCA 4F52A 2DA7A 1PUEE 2OTLI 3BG5A 4IZZA 3QOEA 4AC0A 2HQAA 5DM7F 1QPMA 2DYRH 4AUXA 1SFKA 3WGGA 1ZLJA 3F21A 2DOEA 2L01A 3BZKA 1TNTA 2JUGA 4P5OA 4XL9A 1USTA 4XRSG 3AL0B 2E19A 5K5OA 2KPMA 3DKXA 1X1PA 3G2BA 4OOIA 3W2VA 2JK3A 2RKHA 4IJAA 3FISA 2L7KA 3CF2A 4QLCU 2L0KA 2RC4A 2ZMEA 2XAJA 5E79C 4DYRA 1C0WA 3VYSB 3RYRA 1RIOH 2KRFA 1LJ9A 2XUBA 1XSVA 1XX5A 3BR6A 2A07F 2HOTA 2PMZA 3S93A 1RETA 5EGOA 5ICFA 1WJBA 2Z2SB 5GAGJ 4LG0A 1WKMA 5D5XB 2VJ4A 4LLNA 3OYCA 2V1NA 4XLCA 3W3CA 3P5JA 2M1BA 3F22A 3GLXA 3ZQIA 2F2EA 1XPXA 1EH7A 1FOYA 1MJAA 1MW7A 1OCPA 1QQIA 1XG1A 3F6VA 4WXHA 5EYRA 2STWA 3I0TA 2E7XA 1HQCA 5IOYA 2X48A 2RREA 1QRYA 1O3TA 4IX7A 3NWSA 1STZA 2A5WA 2UXNA 1ZRFA 5J8FA 1W5SA 4UVCA 3I64A 1T2KA 1FSEA 3ROUA 5LLQA 3R4KA 1USSA 1Y39A 3F6OA 3EYYA 1W36D 1S8NA 3EQLF 5FRMA 4NC7A 4YELA 1VFCA 2YSRA 3WE2A 3S3NA 2GA2A 3FK6A 5H2FC 2KRHA 3CP8A 3K4MA 2OTJI 1ON1A 4PJMA 1CF7B 1G2HA 3I5UA 5C4JJ 3F23A 3OY9A 1JKOC 3MEXA 1R4NB 1Y6IA 4IEJA 1SANA 5E17F 1B4AA 4HG2A 1Z77A 1A31A 1ZH5A 3S15J 1R1VA 2NVYJ 2QF7A 1XB4A 3SYTA 2IGOA 2JVHA 3TOAA 2R0QC 4EV0A 1HKQA 1I5ZA 3GZ6A 1TW3A 5D4SA 3CO6C 5FLMJ 3K1MA 4PUSA 3S1RJ 1LEAA 1S29A 5HOOA 2JTVA 2GIZA 3CUQC 3VSKA 4NNJA 1R5ID 2M2EA 1XGMA 1D8JA 2IRFG 5JLWA 3NAUA 2JZYA 1P2FA 4M3GA 4PSWA 2I5UA 1RI7A 2DFFA 4P9UA 2ZJRF 1GXPA 2R3SA 2XHKA 3RPUA 1KQ9A 1UMQA 2Y69H 2BV6A 3H5RA 4BJ6C 4RB1A 2KDZA 1SAUA 3BY6A 3CCRI 3ZRGA 4XKCA 3FWEA 4DQ2A 3MKYB 1T6SA 2BW3B 4GFBA 2WAEA 4IHXA 3C2BA 3IL2A 2O6GE 3PM1A 2FE3A 3HSEA 2A3SA 2XRLA 1LDKB 4XLNF 2D1HA 1BI2A 2OQRA 3N97A 5ED4A 4UV8A 3LAPA 4B09A 4D7MA 3OSFA 1U8BA 5EF6A 1I3AA 3BCBA 3D5SC 2ELKA 2FF4A 3K69A 3LMMA 2L7FP 4BGDA 5ICCA 2L9RA 1YJNI 1JJ6C 3KIOA 2H8WA 1XGNA 4HSTA 3KP7A 1D0YA 2OBPA 3R60A 3AAFA 4S04A 3QP6A 1YE9A 4LFUA 4PJLA 2E5ZA 2VBYA 3MZ8A 5GP9A 1GUUA 3HRMA 4RAFA 4IL6C 1JXSA 1S9HA 1BN5A 1R23A 3ZOBA 3UKGA 1X1DA 3U1DA 3PQKA 4AVPA 1M1EB 1W0TA 1MNEA 4FTHA 5J4VA 3DPTA 4Y4RA 1TNSA 2F4MB 3KZIC 4NC8A 2P6SA 2WY8Q 3QYFA 1RKTA 3JRBA 2IT0A 1ZRCA 4BE1A 2G0EA 4RBOA 2HYFA 4V19K 5GPAA 2BY0A 3HPGA 5M5XJ 1PYVA 1ZN2A 3K4LA 2H09A 2C6YA 4FASD 2V7FA 2M45A 1YS6A 1W5TA 1YS7A 4F91B 4W1UA 3K4CA 3E6CC 1AKHA 1BJAA 4A3EJ 1OISA 2HS5A 1FOWA 3QAHA 1OPCA 2XKOA 2ZMEC 3VSLA 3IRQA 5BPDA 4M3EA 1D1AA 3GFJA 2RNJA 3TL4X 3SQNA 2Q0OA 1N75A 2JSPA 1UB9A 1DGWY 3CZ6A 4KITB 2GXBA 4QPQA 1EH6A 3QWLA 3ZMSA 3P9IA 2RV8A 4C3JJ 3JR9A 2Z3YA 2LD5A 2M4KA 2WBMA 2IW5A 1YTYA 3ZMDA 3RKQA 2A6HF 3CUOA 3ZMUA 2VC1A 1VQMI 2NVXJ 3GTKJ 4ZDPA 2OD5A 2DAOA 4CHUA 3FXRA 2ZNZA 4IOCF 2O9LA 4XICA 2KLOA 5IYDJ 2M30A 1R5GA 1ZRDA 4IVNA 2CS3A 4BBRJ 4L9TA 3CC4I 3G1OA 2IGMA 3OOUA 5KHDA 5KAFC 4O3MA 4GYGA 2R7OA 2DPDA 5GADJ 2NVUB 1TC3C 1QZEA 3REOA 1H0MA 4WF2A 1O3QA 2K5CA 2K86A 2VKHA 1TLHB 3F9KA 5BPIA 5L3DA 5FLXZ 2LVSA 1FPQA 3IAM2 2CWEA 5DV5A 5GAEJ 1R49A 3BR5A 4CYCA 3KYCB 1WJDA 2XRNA 1GT0C 1LDDA 2ZB9A 4BY1J 3GTMJ 2FBIA 4YFNF 2PJPA 2VODA 4RLFA 3FXUA 1KU2A 4R1HA 3QRFF 5IP9J 2XF5A 3H0DA 1FJLA 2LFBA 1WJFA 4M6XA 5HODA 3VODA 4UUSA 2G9WA 4II3A 5K7ZA 3L2QA 5D8LB 4Q5SF 4D5CA 2XPUA 3L7WA 3V8LA 3KLOA 1ZG5A 1OR7A 3S2WA 3MMYB 1IRXA 4NBQA 4UVAA 1YG2A 1REPC 5IOZA 5LBQA 4RLQA 1JE8A 5ILSA 4G94A 4QPOA 1TP4A 4AIJA 3IUOA 4XBFA 4L18B 2L7MP 1R22A 2PQ8A 1DQUA 5FKOA 1IXCA 1ONVA 3QPTA 2CW8A 1KA8A 2IGKA 3DXJF 1DPRA 1Y1WJ 1I50J 3SDBA 2LDUA 1IW7F 1FBQA 1ODDA 4YFXF 1KQ0A 4ABZA 2GIVA 2R7VA 2RNGA 4JX5A 3H1CA 1IDZA 1J9IA 2ZSIB 4LIVA 2L4MA 3ZN1A 3FXKA 3ASNH 3OYMA 4ZTJA 2X4HA 4GRIA 2DTRA 4M74A 5F0CA 3CDLA 4I0AA 2CQKA 3FZVA 1XMAA 2PMZN 3VWBA 2DDAA 3LQQA 3ZQQA 2R7SA 4A3LJ 3OV8A 4RB0A 2A6EF 4YRVA 1BW5A 4WXDA 1T38A 2YPRA 3WTXC 2JA5J 1WVRA 1SVOA 3FBNB 4P55A 3OIQA 4YIFA 5CJ9A 4F93B 1FMWA 2H27A 3GXOA 3CDIA 4LLLA 5F0HA 4ESJA 1W7PA 3OR2C 2GAUA 1IN5A 4LG3A 1TWAJ 3K4NA 2IA0A 2V9KA 5GAHJ 3CCSI 4A3MJ 1R58A 1KYZA 1H8AC 3BZCA 4NUBA 1GLNA 2ELJA 4MHGA 1ZQ3P 2LY9A 4Y17A 1W5CC 1YITI 4N4NB 2H1KA 3HZJA 3KEYA 2VOPA 4C3IJ 2MW8A 1RC9A 3I58A 4BEHB 1EA3A 4MTDA 2LSOA 4FE7A 3WTVC 4IHTA 3ASOH 3OYJA 2ACJA 4NB5A 4Y13A 4XRSA 4ZZDA 5BOXA 3HTSB 1ZR4A 2WV0A 5HLIA 2QKLB 3FIWA 3ZMZA 2FMYA 2NOJB 2AXLA 3CESA 2F5CA 3SDGA 4Q4ZF 3PIPF 2R5ZA 3LSMA 3ERMA 1LFUP 2WB1A 2ZJQF 2QKMB 2KIUA 4S05A 1UFMA 2YR2A 1EH8A 4I09A 1BIBA 1R1TA 5E3NA 1BL0A 3BLYA 3T0YA 2ZSHB 3GTPJ 5D8KB 2Q2EB 1QVTA 2FBKA 5HLGA 4KISA 3IV5A 4CXFA 5H6RA 2B7EA 1UHSA 4RGXA 2F5DA 2VBZA 3DEEA 4BY7J 5EJCA 1O57A 4Y15A 2L7ZA 4EEFG 3ZCOA 1UZCA 3BJOA 1WJCA 4HDUA 5FB2A 2E34A 1WH7A 4MNUA 3FXLA 3RPUD 2V9VA 4KT6A 5DD8A 5EZGA 4PJ0C 4PFOA 4EM2A 4CCJA 1PJRA 3OYEA 1UG2A 2DK5A 3S3OA 2ZXJA 2J5PA 2YS9A 4O6JA 3QPLA 2D5VA 3QP5A 4M72A 5J47A 4X1EA 1W1WE 1MDMB 1YRNA 1MMGA 1OYIA 3IAS2 3H36A 3SZTA 3EUAA 4S0HB 2WTEA 2Y30A 1KU3A 1VQNI 3BPVA 1TWGJ 3JW4A
chains in the Genus database with same CATH topology
3I9V2 1DP3A 4CA0A 2A6TA 4XKWA 3DQVC 3OYDA 1KONA 4F52A 3FDYA 1X19A 2K9MA 3W2WA 3HUGB 4IZZA 1X4OA 1X1CA 3H9GA 1WJEA 3QOEA 4XKVA 2HQAA 2LG4A 2V26A 3RTRA 1SFKA 1BOBA 2V4JC 4XM3A 4P5OA 4XL9A 2JUGA 2HDWA 2FUG2 4PFPA 3AL0B 4X0GA 4BL0B 2KPMA 3ONQA 3ZR8X 2CUJA 2R7TA 3DKXA 5LFAA 3G2BA 3W2VA 2AQEA 2L7KA 2CUZA 3EUHC 2X6YA 2M3AA 3CF2A 4DIQA 2HPMA 3K4BA 3VYSB 4E7ZA 3QYEA 2JVGA 2PMZA 3S93A 1WJBA 3OYFA 2Z2SB 5FRNA 2X1EA 3OYKA 2BVLA 2VJ4A 4CCKA 3ZXSA 4CCLA 2GOMA 3OYBA 3OYCA 2V1NA 3UR3C 4XLCA 3W3CA 1OR7C 2Y0SA 2UUZA 2ZXHA 2W7NA 2PJRA 1MW7A 3HC7A 3HKZA 2M7BA 3PFYA 2RQQA 4IQ4A 2RREA 4CCOA 2WY7Q 2VXDA 4IX7A 3NWSA 3AKZA 2A5WA 3H5AA 1N77A 2CH0A 2UV1A 2X51A 4E7HA 3W2AA 4G6TB 4RMNA 4II2A 2R4GA 4E7IA 3LSIA 1W36D 1DGRM 4R79A 2Q1ZB 4XORA 4AYBA 3QODA 1Y56A 5FRMA 4RM2A 4NC7A 3H9QA 4YELA 2DJIA 4AU7A 3S3NA 3DU5A 4ANJA 5HNFA 2HU9A 2KRHA 3CP8A 3K4MA 4B44A 4H4KC 4HSRA 4PJMA 2VPLA 1U0JA 5CQEA 2MABA 3K10A 3E0JB 3PSIA 4BJ5C 2WAFA 3HPHA 4XN3A 4C2UA 4CUGA 3OMYA 2HVQA 4XLAA 4DGWB 3OY9A 4E7JA 3U21A 3DWLE 3S3MA 1Y6IA 4ZC3A 1LKXA 3VYUB 2L9NA 4HG2A 4D1QA 4BQQA 4D9JA 3SYTA 2MC4A 2IGOA 2JVHA 1Z21A 4HNTA 5HLTA 2CV0A 3TBIA 4XQFA 4IKFA 2CV2A 3D5RC 3K6GA 4BEHA 3MD2A 3UNGC 4E7LA 2O5RA 4PUSA 5HOOA 3IP4B 1K6YA 1MNDA 4NNJA 3VSKA 2KRCA 3L2RA 1Z3XA 2LBFB 1T0FC 5KCMA 4BS9A 4PSWA 1OLTA 3SEZA 4F55A 4KJZA 3K70D 3H5RA 4BJ6C 4OAZA 1SAUA 2R7QA 4IQJA 4DOZA 2X6WA 4XN0A 3ZRGA 1VZ0A 4XKCA 5FROA 3K4KA 4B3XA 4F3QA 2R7RA 2Z1DA 1T95A 2F5VA 3MKYB 3TMOA 3HOSA 2L2OA 1BR1A 2BW3B 2LH9A 2F4IA 2VLAA 1X1AA 2WAEA 3PL8A 3S32A 2KP6A 4DBRA 1LDKB 4F92B 2MFZA 3LSKA 3OS0A 1ZELA 3V42A 3OYHA 3VYTB 1D0ZA 2CFOA 4J00A 2LY2A 3KYLA 2X1DA 2XAUA 2KL4A 1D0XA 1ERDA 3BCBA 4BQNA 3BC8A 3D5SC 3H9JA 3LMMA 3L2WA 1UAAA 4BGDA 4ZDOA 2LBFA 2AQFA 2E60A 4HRIA 3PNVA 2ZXIA 3N05A 4HSTA 4BDYA 4PK4A 1D0YA 3CJRB 3NWTA 2XSJC 1YE9A 3I3LA 2LY1A 5HVQC 5KNLA 3HOTA 2OUMA 2WAQA 3PUBA 4PJLA 2E5ZA 2X1CA 3DLAA 3OIPA 4CCNA 2M4GA 2VL8A 3LFUA 4ZDLA 2DCEA 3M8JA 4NQWB 2V6EA 3A4CA 4XOPA 1S9HA 4XLHA 1X1DA 1E0EA 1D1CA 2F6CA 3DTEA 2I8DA 2DT6A 3OYAA 2CMPA 1MNEA 3DPTA 4Y4RA 3PNTA 4P1WA 4NC8A 3BG7A 2M7AA 2IS4A 2WY8Q 3QYFA 4B48A 1BR2A 1YX5A 2VJ5A 1QHHD 4BE1A 3OWTA 4HNUA 3L2VA 3OYIA 3HPGA 1PYVA 3K4LA 4BJTA 3H5NA 1TT0A 3OS2A 4FASD 2V7FA 1WJAA 2LREA 4F91B 2E5NA 3K4CA 1FMVA 1WJ5A 4E7SA 2LYCA 2XC7A 1NG7A 3HG9A 4B43A 3VSLA 2IGNA 1G59A 1D1AA 1V5EA 2DOAA 4Y33A 4XLFA 3TL4X 3OS1A 2P0WA 3HXLA 1N75A 2LOOA 2JSPA 3OL3A 4E4HA 1DGWY 3FHNA 3PNYA 3MKZA 3CZ6A 4KITB 4ZTFA 2LC2A 4QPQA 2L5QA 3CJQB 3ZGKA 2X6XA 1P9QC 4CSWA 3RCOA 2M4KA 2WBMA 2K3PA 4XONA 2VQCA 2KHMA 4ZDPA 3KX2A 3RSNA 2R7UA 5HNHA 3AL0C 3MKWB 4OWRB 2KLOA 3CMMA 4DJAA 2VJJA 2CS3A 4CZCA 2IGMA 3FKJA 3OOUA 3D5LA 5KHDA 2W4SA 3J7AY 2MD0A 2R7OA 1V5GA 3HL2A 1D1BA 2K5CA 3OYGA 2VKHA 2VQLA 3F9KA 2HNHA 3GBGA 3PSFA 2XF7A 3IAM2 4BXFA 3VYRB 4XMYA 1WJDA 2E1MC 1Z3YA 2IXSA 3LL7A 2W82A 3E1SA 4LITA 3DPUA 2GOXB 4BDZA 1LFPA 2R7XA 4RLFA 2JA2A 2XF5A 3H0DA 1W36C 1QHGA 1J09A 1WJFA 3EPZA 1HA8A 4U87A 1UG0A 4II3A 3L2QA 4BE2A 2OV7A 4XKBA 3MMYB 1IRXA 2W00A 3BG6A 4RLQA 3OL4A 4B47A 3M1CA 2WADA 4QPOA 3DTIA 3IUOA 2LRDA 3AFHA 4ITVA 1DQUA 4HEA2 2CW8A 2PJRB 2CW7A 3FBIB 3L2UA 2IGKA 4LIUA 2IS2A 1UELB 4BQOA 3DTKA 4RM3A 4BACA 3SDBA 1X4PA 4E6KG 1Z7LA 2HPIA 4BUPA 1AA7A 2R7VA 2RNGA 2BW3A 2VXZA 2KMUA 4N4OB 3PJRA 2ZSIB 4LIVA 4C30A 3SZGA 2W1OA 1JI8A 2VIXA 3OYMA 4OAYA 4ZTJA 3DKYA 4GRIA 1MMAA 4E7KA 2HVRA 2HVSA 2M0MA 3VWBA 4XOTA 3ZQQA 2R7SA 3BCAA 4YRVA 3S8PA 4JOMA 1WFXA 2KDOA 2E1MB 2WA0A 3K70C 5CKTA 4ZJZA 1TZLA 4U7BA 3FBNB 3OIQA 4F93B 4J01A 5JHFA 1FMWA 4EATA 4HPQA 4MLOA 4XNFA 3OYLA 3OR2C 3EUKL 4LG3A 2L9SA 3K4NA 2V9KA 2OC6A 1MMNA 1QU3A 2VQHA 2ZFUA 4NUBA 3SEQA 1GLNA 2ELJA 1BR4A 1LVKA 4N4NB 2MYSA 4BU2A 3KEYA 3DU6A 2VB6A 4BEHB 1EA3A 3OYJA 2X85A 2CV1A 1YX3A 4PSXA 2DXIA 2QKLB 3OYNA 5CQGA 4AVZA 2VKDA 3C2HA 2R7WA 2XF6A 5TGTA 3VDXA 4BE0A 2NOJB 2VJIA 3QYBA 3DPLC 2BVMA 3CESA 3LSMA 2WB1A 1NG6A 2QKMB 2XDVA 4ZYAA 2KQRA 3C2GA 4YEJA 3BLYA 4C9YA 4DBQA 3A2KA 2ZSHB 4FETA 4CCMA 5LD2C 2Z16A 2K9LA 2Q2EB 4KISA 3K4JA 3LSGA 3CP2A 4XLEA 1G8XA 4PJJA 3DEEA 3ZCOA 2VASA 1WJCA 1V5FA 3A1YA 2KZVA 1X1BA 2BOLA 1N78A 3RPUD 2UWMA 4KT6A 2VQGA 2DT7B 4PFOA 4XR6A 4CCJA 4Y3OA 1PJRA 1R6RA 3OYEA 4C2TA 5CPRB 3S3OA 3H35A 3LSHA 4PJNA 4JQFA 2IS6A 1MMGA 1MMDA 3IAS2 2IS1A 3EUAA 4CH7A 2HZDA 3RQ4A 3OR1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAS D;  4N4O B;  4N4N B; 
#chains in the Genus database with same CATH topology
 5H20 A;  4KIF A;  3WGH A;  1DP3 A;  4XKW A;  2EIM H;  2BHY A;  1S72 I;  3E5U A;  1KON A;  5FKK A;  4EVI A;  4MEX F;  1YW8 A;  1X1C A;  2EFP A;  3WU1 B;  2GXA A;  4LK0 F;  1TWC J;  2LG4 A;  3LQR A;  1K78 B;  4Q48 A;  1MZB A;  4FX0 A;  4KN7 X;  2K40 A;  2V4J C;  3TO9 A;  5JI6 A;  1ZGW A;  1Y0N A;  1U78 A;  5LEJ A;  3KCC A;  1MBJ A;  3ONQ A;  1LEB A;  2QSF X;  1YLF A;  1J2X A;  2KT0 A;  1U2W A;  4OIN F;  1ZGA A;  4ASN A;  2HR3 A;  2AQE A;  2CSO A;  4IXA A;  4NHJ A;  4HLY A;  2UZK A;  1YI2 I;  1TT5 B;  1O3S A;  2YU9 J;  2AO9 A;  4ZYH A;  3K4B A;  1MSF C;  2CQ7 A;  1WHU A;  4GGG A;  1HC8 A;  4D7N A;  2DA5 A;  3QYE A;  2VBW A;  2L54 A;  2IEK A;  1ORK A;  2LTP A;  3F0C A;  1S6L A;  1B8I B;  3M7G A;  4CDG A;  2ZJ2 A;  5F64 A;  1AOY A;  4I6Z A;  1F9N A;  2EFO A;  1I27 A;  2X1E A;  3EET A;  4U0Y A;  3ECH A;  3ZXS A;  4CCL A;  2GOM A;  1HLV A;  1OR7 C;  2Y0S A;  3WOD F;  2AS5 F;  2H6C A;  2UUZ A;  4MGR A;  4LOC A;  4V2G A;  5L3C A;  3HKZ A;  2RQQ A;  2DLL A;  5M5Y J;  4ZYE A;  2OCE A;  4ESB A;  2PMU A;  3AKZ A;  2L3D A;  2CQX A;  2EH3 A;  4G7Z F;  2CH0 A;  4X6A J;  3LFK A;  3VB2 A;  3W2A A;  4MQV A;  2JUC A;  4RMN A;  1JGS A;  4KFC A;  3T8T A;  1B72 A;  3I55 I;  3ECO A;  3LSI A;  4E7I A;  1SMY F;  1IXS B;  4Z2Y A;  1APL C;  4AYB A;  2Z5U A;  2RN7 A;  3QOD A;  4XOR A;  4UV9 A;  1K79 A;  4RM2 A;  3H9Q A;  4AU7 A;  2H6B A;  3P9K A;  4PCQ A;  2Z33 A;  2DU9 A;  3TW6 A;  4ANJ A;  2XB5 A;  2VBX A;  2OJE D;  4KYW A;  2NVQ J;  1IAW A;  2DK8 A;  4ENN A;  3HRU A;  4HSR A;  1YJW I;  2VPL A;  3FMQ A;  1U0J A;  5CQE A;  2FOK A;  2NS8 A;  2E1C A;  3K10 A;  2A68 F;  3E0J B;  2V9P A;  3PSI A;  4I76 A;  4CUG A;  4E7J A;  1RR7 A;  4XLA A;  4GDF A;  5D4R A;  4PGH A;  3U21 A;  3DWL E;  1T8I A;  3B6C A;  1X2N A;  1LKX A;  3VYU B;  1T56 A;  3F8N A;  4FHT A;  2DJN A;  3BRO A;  4G7H F;  4L0Y B;  5LEK A;  2Y9Y A;  3RI4 A;  4HNT A;  1BC8 C;  2QVO A;  5HLT A;  1BI1 A;  4LB6 B;  3TBI A;  4XQF A;  2ZXW H;  2CV0 A;  3K6G A;  3CTA A;  1Y8Q B;  4QSH A;  3MD2 A;  5CVJ A;  3UNG C;  1I39 A;  2DO7 A;  1TBX A;  4K2E A;  4E7L A;  3O6B B;  2FEZ A;  2D45 A;  1MND A;  3L2R A;  2LBF B;  5J4Y A;  1OCT C;  1B1B A;  3ZN0 A;  3BTL A;  4F55 A;  3CF5 F;  5K5Q A;  4HOB A;  5H6Q A;  4ENK A;  4YII A;  3ZP5 A;  2JQ7 A;  1CF7 A;  3J81 Z;  1U3E M;  4KIC A;  4DOZ A;  4XN0 A;  1ETV A;  1EF4 A;  3GEZ A;  5FRO A;  3K4K A;  4F3Q A;  2JPC A;  2XIG A;  4RS8 A;  2Z1D A;  1T95 A;  3I53 A;  2F4I A;  1GV5 A;  1WCM J;  5KK1 A;  5C3E J;  1IRG A;  3HOZ J;  1JT6 A;  4F92 B;  1ZEL A;  3OYH A;  3VYT B;  4N9H A;  2P5L C;  2BY3 A;  2CFO A;  3KEQ A;  1BBY A;  2YX7 A;  1HW2 A;  2IA1 A;  4OIO F;  2DYS H;  1PVE A;  2ID3 A;  4BQN A;  2K02 A;  3BC8 A;  4OIR F;  4A3C J;  3SHF A;  2HI3 A;  2E2J J;  4A3B J;  2EZK A;  1S7E A;  1Y1V J;  3PNV A;  2HTJ A;  4ZYG A;  4BDY A;  3CJT B;  3ZPL A;  4PK4 A;  5CLS A;  4UY8 I;  1UHW A;  2XSJ C;  3M8E A;  2FNA A;  1HKT A;  2KJB A;  1MJB A;  2X1C A;  3JAM K;  3DLA A;  3KP6 A;  5AIQ A;  3CUQ B;  2M4G A;  4G12 A;  2DCE A;  5IY5 H;  2M87 A;  2N8G A;  4NQW B;  1ZYR F;  1QZZ A;  2L4A A;  3A4C A;  3S2D J;  1O3R A;  2A05 A;  2D2W A;  5KVR A;  3OYA A;  1MD0 A;  3T1B A;  5D6E A;  2K9Q A;  4I99 C;  5BNG A;  2V1X A;  1R4M B;  3PNT A;  4EJO A;  1QGP A;  1J59 A;  4DW6 A;  4IPA A;  3VPR A;  3IRR A;  4HBL A;  2JMW A;  4P1W A;  1J5Y A;  5EEH A;  4WX9 A;  2M7A A;  3QQA A;  4B48 A;  2W24 A;  1BR2 A;  2ESH A;  2IJL A;  1U5T B;  1XD7 A;  1YX5 A;  2QGU A;  3OWT A;  1ZR2 A;  3L2V A;  3OYI A;  4HF0 A;  1XCB A;  3N4M A;  4KIB A;  5ICG A;  1TT0 A;  1TQP A;  2GA1 A;  3OS2 A;  1VQ6 I;  2HXI A;  3S1N J;  2QQB A;  1WJA A;  2LRE A;  1IXR C;  2Y75 A;  1BA5 A;  2X0L A;  1FMV A;  1A6I A;  2XC7 A;  1ZK8 A;  3LA7 A;  4AIK A;  3HG9 A;  2P5V A;  5TIS C;  3D1N I;  2IGN A;  1G59 A;  2I10 A;  4XLF A;  5DD4 A;  4EJW A;  2LOO A;  4C3H J;  2FA5 A;  1PDN C;  4O5V A;  4ZTF A;  2LC2 A;  3E6D A;  3ZGK A;  2VOO A;  2KKO A;  2X6X A;  2YUS A;  3RPQ A;  5B1A H;  4CSW A;  3JSP A;  2WB1 N;  4C2M J;  2K3P A;  1ZGJ A;  3RDI A;  4XON A;  2VQC A;  2MLG A;  2KHM A;  4IRG A;  4BBS J;  3BR0 A;  3KX2 A;  2VKV A;  3CMA I;  3KET A;  3HOX J;  1F43 A;  4UVB A;  4A0Z A;  2R7U A;  3V7C A;  2NS0 A;  3AL0 C;  3I4P A;  3CMM A;  1YO5 C;  3HRT A;  2VJJ A;  3HB9 A;  1VQ8 I;  2DA3 A;  3E3V A;  5IYC J;  2EA4 A;  2K7L A;  3D5L A;  2W4S A;  3KP5 A;  3TDU C;  4BXU A;  3BTJ A;  5C4X J;  2K3F A;  3HL2 A;  3K70 D;  2PI0 A;  1ENH A;  3TW7 A;  2HNH A;  3TO7 A;  3PSF A;  1A04 A;  2OAZ A;  3Q0U A;  5DCF A;  3WG9 A;  4L9N A;  3EUH A;  4RAG A;  5BMZ A;  2HOE A;  1XGO A;  2IXS A;  3SFI A;  3E1S A;  3FX3 A;  2ME6 A;  3ERE D;  1B9N A;  2GOX B;  1ZRE A;  5LRR A;  5CVI A;  3RKX A;  3TOB A;  2HOS A;  1SD4 A;  2JA2 A;  2P81 A;  1A36 A;  4MEY F;  1H9T A;  1JUM A;  2LNB A;  4MIM A;  3EPZ A;  3FXO A;  3RKW A;  4BE2 A;  3CQZ J;  4E70 A;  5E8G A;  4XKB A;  3AG1 H;  2OPT A;  5F08 A;  4UNO A;  2DFH A;  2M0C A;  2IA2 A;  2ICW G;  2CUF A;  5D6F A;  5EGO B;  3WHB A;  5L3B A;  2P7C B;  3CCU I;  3GFM A;  3I56 I;  5HDG A;  3PO2 J;  1G3S A;  2LRD A;  3K2Z A;  2JA8 J;  4L0Z B;  3GTL J;  1YJ9 I;  2CUE A;  1WQ2 A;  1GHC A;  2EJR A;  5GTI C;  1DP7 P;  2CW7 A;  3FBI B;  1JT0 A;  4LIU A;  2AHQ A;  4N0B A;  1UEL B;  2EIK H;  1LUJ B;  3PQJ A;  4RM3 A;  2XGD A;  1XN7 A;  4BAC A;  3GYH X;  4E6K G;  4A3G J;  3CC2 I;  4XRF A;  1U8R A;  1TQI A;  2EZI A;  2PFB A;  2NRA C;  1UJ8 A;  4N4O B;  2FU4 A;  4RAZ A;  4C30 A;  3WTS C;  1JI8 A;  2EK5 A;  1TWH J;  1MMA A;  3CCJ I;  3GF2 A;  2HVR A;  1IDY A;  2ZFW A;  3A02 A;  5B3S H;  3QPS A;  2M0M A;  4KMU X;  5FGM A;  1OKR A;  2Y48 A;  3HDD A;  3G4S I;  4A12 A;  4QWQ A;  1VF9 A;  5E18 F;  1ZAR A;  5E1W A;  3PFI A;  4KN4 X;  1IUF A;  2HXO A;  2EIJ H;  1YFH A;  1FC3 A;  2RGV A;  5DUK A;  2FQ4 A;  2QQ8 A;  2GQQ A;  1KZH A;  4J01 A;  3HTU A;  4HPQ A;  5L3F A;  3ABL H;  2JPB A;  1SVL A;  2GLO A;  2ETH A;  1TTY A;  3Q0W A;  5E20 A;  4DYQ A;  3SJM A;  2HQ5 A;  1HOM A;  1QZY A;  5JR3 A;  1L0O C;  2K9S A;  2XGE A;  5K7H A;  3MVP A;  1O4X A;  2OC6 A;  3S2H J;  1MMN A;  2M5W A;  1QU3 A;  1E17 A;  2E71 A;  3A0B C;  3SEQ A;  3KE2 A;  1LVK A;  1WSU A;  1ZHF A;  5ICE A;  4HAM A;  4L9J A;  3HIF A;  4AYB N;  2VB6 A;  1LB2 A;  3GTQ J;  1U9N A;  2ISZ A;  2BGC A;  1YX3 A;  1YOV B;  3BQY A;  2TCT A;  3BP8 A;  1FP2 A;  4MO7 A;  2XF6 A;  3KP3 A;  5TGT A;  3IHU A;  4XSZ F;  1FLI A;  2DT5 A;  4DNC A;  2VJI A;  3KPH A;  5E3O A;  5A2Q Z;  3AG3 H;  2F48 A;  3E6B A;  3ZQH A;  1D3Y A;  2CRG A;  1K7A A;  1LDJ A;  5DCM A;  4B4C A;  1FZP B;  3A2K A;  3MFK A;  2GZW A;  4BKX A;  3JRH A;  1H88 C;  3WG7 H;  2Z16 A;  1IRF A;  1OCC H;  4L5J A;  2K9L A;  2HWV A;  2DQL A;  1RRJ A;  3CP2 A;  3FMR A;  1AWC A;  4HQM A;  1GXQ A;  2GXG A;  4HDV A;  2XB0 X;  2HKO A;  2H1L A;  4G8X A;  2P8T A;  1HDP A;  3A1Y A;  4FQG A;  4EGZ A;  1F1Z A;  3KP4 A;  1VQ4 I;  5LHI A;  3BDD A;  2DT7 B;  4EGY A;  1ETQ A;  3HHG A;  5L3G A;  2QLZ A;  4Y3O A;  3F8C A;  4C2T A;  3GWZ A;  5CPR B;  2GBY A;  3H35 A;  3FXM A;  5ILV A;  3PO3 J;  2W25 A;  2FRH A;  4JYK A;  4JQF A;  2Y2Z A;  1ULY A;  1LVA A;  3K7A J;  5FFX A;  2IS6 A;  2DOD A;  4HX8 A;  1XC5 A;  2IS1 A;  1Z91 A;  5J6X A;  3GZ5 A;  1XMX A;  4GXO A;  2OA4 A;  3OR1 C;  4PDK A;  3JRD A;  3RZO J;  3DEW A;  4TV7 A;  4G7O F;  3C1D A;  2E1O A;  4LK1 F;  2A6T A;  1ZLK A;  4HF1 A;  3DQV C;  3WTY C;  1MBK A;  2QEN A;  2K9M A;  4M71 A;  3HUG B;  3H9G A;  2RAE A;  4IRI A;  4XKV A;  1GV2 A;  4ON0 A;  2V26 A;  2FSW A;  3FXQ A;  1BOB A;  1YQA A;  4XM3 A;  3GTO J;  2CQQ A;  1S7O A;  3CO7 C;  1P92 A;  2LKS A;  3TO6 A;  1LE8 A;  2FUG 2;  2COM A;  2DFI A;  4X0G A;  4BL0 B;  2VUM J;  3L00 A;  3ZR8 X;  2CUJ A;  1OYY A;  5FLV A;  2JWT A;  4Z6Y A;  4J19 A;  4B3A A;  2A69 F;  4L5E A;  2DW4 A;  3H3Z A;  5M5W J;  2CUZ A;  3EUH C;  4DIQ A;  2QEX I;  4XK4 A;  1FIP A;  2MBF A;  5IT9 Z;  2EFN A;  2LF8 A;  4E7Z A;  1I1S A;  2JRT A;  1AKH B;  4I01 A;  1IN8 A;  2YU3 A;  1KU9 A;  1XCV A;  2JVG A;  2EV0 A;  1QO0 D;  2QWW A;  1BOA A;  1XDU A;  5FRN A;  1HCR A;  3S1M J;  5JVG F;  1B9M A;  3AG4 H;  1G3T A;  1POG A;  3OYB A;  3T8R A;  3UR3 C;  1ETO A;  4A69 C;  1P4A A;  3JTG A;  1R00 A;  2ZXH A;  3F8B A;  1K78 A;  2PJR A;  2IAI A;  3HC7 A;  1Y0U A;  3TP0 A;  3PFY A;  3U2R A;  1IGN A;  5M3F J;  5LGN A;  2VXD A;  3BT9 A;  1Q1H A;  1MMS A;  1YIJ I;  3JRI A;  1H9G A;  2MH9 A;  1RUO A;  2UV1 A;  4G6T B;  3M1E A;  1PUF A;  4MQ9 F;  1DU6 A;  2R4G A;  2LKX A;  2DDB A;  3I59 B;  2VT2 A;  2X9D A;  5AON A;  2F5F A;  2DJI A;  3DFG A;  1W0U A;  2ZC2 A;  3DU5 A;  1R1U A;  4G6Q A;  1CGP A;  3LSR A;  2IP2 A;  1LNW A;  2HU9 A;  2XAH A;  2ZO4 A;  3O8G A;  3T5X A;  1LFB A;  3E7L A;  4H4K C;  4AM3 A;  1X3U A;  4JP0 A;  3F8M A;  3RKY A;  1ZTR A;  1MIJ A;  2MAB A;  4BYY A;  4OMZ A;  4BJ5 C;  2WAF A;  2L9V A;  4XN3 A;  1MNM C;  4FX4 A;  3OMY A;  4DGW B;  3LOC A;  4ZC3 A;  2QBY B;  5CVR A;  2O8K A;  3CCM I;  1Q1V A;  2L9N A;  1OYW A;  4UUS B;  2BY1 A;  3JTH A;  3JRG A;  1OQY A;  4IKF A;  4M3F A;  2V79 A;  2BHZ A;  2LLK A;  2PG4 A;  5IP6 A;  1SAX A;  1J75 A;  1KQ8 A;  3HEF A;  3KEO A;  1E3O C;  4HQE A;  1JKP C;  2QSG X;  1K6Y A;  2KRC A;  5KCM A;  3FM5 A;  2B0L A;  1OCR H;  3X2Q H;  3SEZ A;  3J7Z I;  3WTW C;  3HOW J;  5BQT A;  2DMQ A;  3ZQL A;  4H0E A;  2CJJ A;  2HQN A;  4HA8 A;  4HF2 A;  2O61 A;  4XSX F;  2R7Q A;  2NOG A;  2Q8K A;  2M34 A;  4IOA F;  5FLX K;  4GCV A;  4B3X A;  5K5R A;  4G9Y A;  2F5V A;  3I71 A;  3HOS A;  2L2O A;  1BR1 A;  2LH9 A;  1X1A A;  3PL8 A;  4PGG A;  1ZAO A;  2KP6 A;  3LNQ A;  4U0V A;  2TRT A;  3LSK A;  4IHY A;  3OS0 A;  3V42 A;  2V1U A;  4J00 A;  1QVU A;  1X3Z B;  1UHM A;  4CZZ A;  3H3V K;  2X1D A;  2XAU A;  2KL4 A;  3A01 B;  3B6A A;  2VE8 A;  5EG0 B;  1DPU A;  2ESN A;  1FEX A;  4Q47 A;  2DMN A;  1MH4 A;  1G4D A;  1Z6R A;  3L2W A;  3LA2 A;  3R6S A;  4N9I A;  2LBF A;  4HRI A;  1J7K A;  2E60 A;  1TWF J;  1NTC A;  1BI3 A;  2ZXI A;  3N05 A;  5TJJ A;  5EDN A;  5FFZ A;  3S1Q J;  4FCY A;  2JSC A;  3CLQ A;  3CJR B;  2PBI A;  3Q0V A;  4MFE A;  3I3L A;  4IHS A;  2LY1 A;  3Q3S A;  2OUM A;  2BE5 F;  2WAQ A;  3PUB A;  4YG2 F;  3GLL A;  1E2X A;  2RQP A;  3OIP A;  2VN2 A;  4CCN A;  1YW7 A;  3Q9S A;  3JRA A;  1V54 H;  2DQR A;  3M8J A;  4EM1 A;  3L1P A;  4LJZ F;  2O3F A;  1O7L A;  1EJ9 A;  4I02 A;  2W84 A;  1E0E A;  1VI0 A;  2Y31 A;  2I8D A;  1I6H J;  2FX0 A;  4DZP A;  1JKQ C;  3BQZ A;  4EJT A;  3CCQ I;  2VPR A;  5J1Y A;  3DP7 A;  3BG7 A;  2TDX A;  3JCU C;  2FXA A;  3VEP A;  1WGX A;  3U9G A;  1ZG1 A;  2VJ5 A;  1ITY A;  4HNU A;  2FQ3 A;  1NHA A;  4BJT A;  4HX4 A;  1MBG A;  1JHH A;  3BJA A;  3NRV A;  3BJ6 A;  1SEU A;  2H94 A;  3I4M J;  1HKS A;  2X6O A;  1AHD P;  1GDT A;  2KIM A;  2LYC A;  4XRM A;  1YIO A;  4FE4 A;  3GTG J;  2NS7 A;  2DTZ A;  2K27 A;  2HDC A;  1WI9 A;  4OIQ F;  3CUQ A;  1V5E A;  4Y33 A;  4HNV A;  3OS1 A;  1KGS A;  2M8G X;  3HXL A;  3OL3 A;  3RJP A;  1I3Q J;  1YYV A;  2BXY A;  3GFL A;  2HGC A;  2ZBK A;  4M3D A;  4E4H A;  3IH2 A;  1IRZ A;  2COB A;  3CJQ B;  3LAJ A;  1IUY A;  3MCZ A;  3RCO A;  4Y52 J;  3W6J B;  3HJE A;  1R36 A;  2NXN B;  1Z7U A;  3KZY A;  3WU2 C;  4ZH4 F;  1L3L A;  1U5T A;  1X2M A;  3RSN A;  3U1K A;  4NDL A;  2DMT A;  1W4M A;  2R5Y B;  3MKW B;  4P96 A;  2JA6 J;  4DJA A;  3B73 A;  3H3U A;  2HYJ A;  1FOX A;  3FKJ A;  2BZT A;  3HGY A;  1RZ4 A;  2MD0 A;  5IT3 A;  3NEU A;  3BR2 A;  2JN6 A;  1MJ9 A;  1SD7 A;  4FT8 A;  2D1V A;  1D1B A;  3OYG A;  2VQL A;  2PX9 A;  5JFR A;  2XF7 A;  2G7U A;  5DYM A;  5F0F A;  4AD9 A;  4BXF A;  1T39 A;  3VYR B;  4XMY A;  3G6E I;  2E1M C;  3LL7 A;  2XGX A;  4EM0 B;  2W82 A;  1FTT A;  3DPU A;  1CQT A;  2KIF A;  4I0B A;  3BOQ A;  4A3K J;  5EEG A;  1W36 C;  1QHG A;  2EZH A;  4A6E A;  2Y0M A;  3BTC A;  1NH3 A;  2OV7 A;  1IO2 A;  3P7N A;  1DU0 A;  1LPQ A;  3FM3 A;  2L02 A;  1Z0X A;  4HV6 A;  3ULQ B;  2W00 A;  3BG6 A;  3MAJ A;  3OL4 A;  3M1C A;  3TKY A;  4M73 A;  3AFH A;  3RZD J;  4ITV A;  3J7Y J;  2FOW A;  3DEU A;  1JHF A;  2DA2 A;  1IV6 A;  4HEA 2;  1VQK I;  3CCE I;  5E1X A;  4U88 A;  2IS2 A;  3M9A A;  1IZ1 A;  1D8K A;  2VKE A;  4BQO A;  3DTK A;  2DFE A;  1BM9 A;  2EIL H;  3HRS A;  4ETS A;  4BQA A;  4UUT A;  1Z7L A;  5HS9 A;  1Z6T A;  2BW3 A;  2R7D A;  1HXD A;  3PJR A;  3K2A A;  2ECC A;  3G1M A;  4OAY A;  3DKY A;  3LSJ A;  1FSH A;  4XLP F;  2ZCW A;  1B72 B;  1FX7 A;  1PP7 U;  4BNC A;  4XOT A;  1WZ2 A;  4RB3 C;  3BCA A;  3JRC A;  3ESW B;  3S8P A;  1W7P D;  2HYG D;  1R5H A;  1VND A;  2KDO A;  2WA0 A;  1N25 A;  3K70 C;  4ZJZ A;  3H92 A;  2OCC H;  4F7Z A;  3IKV A;  5FD5 A;  3IWZ A;  5JHF A;  4CO8 A;  4EAT A;  3L2C A;  3CCY A;  1P7I A;  2VT3 A;  4XNF A;  4L5I A;  1FYM A;  4EMS A;  1HST A;  4BHB A;  1NK3 P;  1E3H A;  5F6F A;  1S5L C;  1OMI A;  5DM6 F;  1XMK A;  5FD6 A;  1MSE C;  3DBL B;  3CCL I;  3L09 A;  4GO1 A;  4V2F A;  2E2H J;  4HX7 A;  3BR1 A;  2FBH A;  2VQH A;  2HKX A;  4HZF A;  4BXX J;  5B1B H;  1BR4 A;  3ABT A;  2DMP A;  2EBI A;  4BU2 A;  3DU6 A;  1T0F A;  1WI3 A;  1HDD C;  2OZU A;  1D5Y A;  3E97 A;  3ML6 A;  2CV1 A;  1RNL A;  3GME A;  2V6C A;  4IHW A;  4PSX A;  2JT1 A;  1V55 H;  4LLG F;  3OYN A;  5CQG A;  4AVZ A;  3FMS A;  3M4O J;  1FTZ A;  2VKD A;  3C2H A;  3RQI A;  3DLL F;  2R7W A;  4BE0 A;  3BG9 A;  1NK2 P;  4RGR A;  4WCG A;  2R7Z J;  3O3K A;  3QYB A;  3TGN A;  2BVM A;  5GTH C;  4RDU A;  4KMF A;  3R61 A;  2KIS A;  1FY7 A;  2PLY A;  4ZYA A;  4RGU A;  1XTA A;  3IH3 A;  3CMY A;  3HOU J;  4YEJ A;  4DBQ A;  4C9Y A;  3GX4 X;  1K83 J;  2MD5 A;  2QZ8 A;  3COA C;  2GM4 A;  5M3M J;  1G3W A;  2CYY A;  2QCO A;  1I1G A;  5ERI A;  3PIO F;  4HYE A;  4A6D A;  1R7J A;  3ZQ7 A;  1GVD A;  1G8X A;  2F5E A;  3QOP A;  3HM5 A;  2P7V B;  2IBD A;  5JVT A;  2VAS A;  4M6Y A;  4I2O A;  5D5V B;  2BOL A;  1N78 A;  3SZP A;  1O7F A;  1RES A;  4RA2 A;  5IPA A;  2VQG A;  3NAR A;  1JTY A;  2LK2 A;  2LR8 A;  3DBH B;  1JKR C;  3JRE A;  4QTR A;  2KJC A;  3LSH A;  4JX4 A;  2ZME B;  2EA2 A;  3IKT A;  2RVC A;  1MMD A;  4CGZ A;  5J3L A;  3QU6 A;  3HHH A;  4AID A;  4CH7 A;  2A5Y B;  3RQ4 A;  3GTJ J;  2E2I J;  4A3J J;  2JRM A;  2CFX A;  2MC3 A;  3J81 K;  2P6T A;  3I9V 2;  3GCM A;  4LG0 B;  3E6M A;  1U5T C;  2VI6 A;  4M9S A;  2Y9Z A;  3FDY A;  1X19 A;  2G7H A;  3W2W A;  3BWG A;  1P4W A;  1X4O A;  1QPI A;  1VQP I;  1WJE A;  4DYC A;  2M9H A;  3RTR A;  3TP3 A;  5ILU A;  2AXT C;  2M8E A;  3E5X A;  4UB6 C;  1JGG A;  2HDW A;  4IHV A;  4PFP A;  3E5Q A;  2E1N A;  1MH3 A;  4NC6 A;  1FBS A;  1HSJ A;  1XDS A;  2DBB A;  4LD5 A;  5LFA A;  4A3I J;  1PP8 F;  3ABK H;  3G3Z A;  1K4T A;  2R7T A;  1A5J A;  3MZY A;  2CG4 A;  5D5U B;  2XKP A;  2XVC A;  4M9X A;  5AIP A;  5JHU A;  2X6Y A;  2M3A A;  2H8R A;  2WAQ N;  2HPM A;  1SFX A;  5E3L A;  1FWZ A;  2QSH X;  4KNY A;  3EDP A;  3MKL A;  5K7F A;  2KZG A;  1Z05 A;  2BY2 A;  5LGU A;  5IYB J;  5HDK A;  4YFK F;  4P9F A;  2O8X A;  4RGS A;  4U7D A;  2FNP A;  3OYF A;  1ACI A;  2Y0S N;  2J5O A;  2B9S A;  3OYK A;  2BVL A;  3TED A;  4CCK A;  3HKZ N;  2O03 A;  5FKM A;  2MLK A;  3HUG A;  3G1L A;  4WXC A;  1R71 A;  4M6V A;  4ZYD A;  3R0J A;  3IWF A;  2W7N A;  3W6V A;  4WWC A;  3ABU A;  5CVV A;  3JSO A;  2M7B A;  4IQ4 A;  1VQ9 I;  3DV8 A;  3GZN B;  5GPC A;  4CCO A;  2WY7 Q;  1XSX A;  1BJZ A;  3H5A A;  5J1R A;  2CU7 A;  1N77 A;  2X51 A;  4E7H A;  1F5T A;  4II2 A;  5CVU A;  2QQ9 A;  3J80 Z;  3HGG A;  2EIN H;  1DGR M;  3HBL A;  1WRJ A;  3K0L A;  4R79 A;  2R93 J;  3BPX A;  2FJ1 A;  2Q1Z B;  4HW0 A;  5F1J A;  1Y56 A;  5DUI A;  4XID A;  4U0W A;  1ETX A;  4DZJ A;  4CYD A;  3ZMT A;  5HNF A;  3L9F A;  4B44 A;  3WGI A;  1RPW A;  1K4S A;  1Y8R B;  4UB8 C;  2P5K A;  1FOK A;  4UXN A;  4A5M A;  2MA3 A;  3HPH A;  4C2U A;  2KFD A;  1MBE A;  1P4X A;  2HVQ A;  2ZKZ A;  3WHC A;  3S3M A;  1HF0 A;  1SD5 A;  3A03 A;  4D1Q A;  3CME I;  4BQQ A;  5F04 A;  4D9J A;  3DCF A;  4ZZL A;  2MC4 A;  5E1Z B;  1F4K A;  1Z21 A;  3BTI A;  4AWX B;  2K4B A;  4A0X A;  3I4N J;  3M8F A;  3C3W A;  3D5R C;  2CV2 A;  1K61 A;  4BEH A;  4L9V A;  2K85 A;  5HS7 A;  5TRD A;  5DEQ A;  2O5R A;  3I59 A;  2VC0 A;  1MBF A;  3IP4 B;  2BXZ A;  2IPQ X;  1Z3X A;  9ANT A;  1T0F C;  2HEO A;  2ID6 A;  3FKI J;  4BS9 A;  1OLT A;  3QU3 A;  1XSD A;  3JRF A;  2RDP A;  4KJZ A;  1DUX C;  4A5N A;  1U6G A;  4OAZ A;  3V7S A;  4UUV A;  4IQJ A;  2CQN A;  2X6W A;  4AIH A;  1U9O A;  1Z67 A;  1WWX A;  5B5E C;  1VZ0 A;  1FYL A;  2BYV E;  2GWR A;  2R7R A;  3C18 A;  3PUF A;  3TQN A;  3TMO A;  1EV7 A;  2ME0 A;  2VLA A;  1OJL A;  3S32 A;  2DI3 A;  2Q2E A;  2QBY A;  4DBR A;  3S17 J;  2NAZ A;  2XV4 S;  2MFZ A;  1IV8 A;  4BH9 A;  1D0Z A;  4ENJ A;  2EV5 A;  4A3F J;  2LY2 A;  1JUP A;  3KYL A;  1D0X A;  1ERD A;  5HLH A;  4HV5 A;  1VQL I;  3RIR A;  3H9J A;  2PMH A;  1RKW A;  4KIG A;  1UAA A;  2PN6 A;  4M9Z A;  2FD5 A;  2E36 A;  4MFD A;  4B1R A;  1A6Q A;  3HSR A;  4ZDO A;  2AQF A;  2O7O A;  1VQ7 I;  5C44 J;  5EZH A;  2CW0 F;  3D0S A;  4EJU A;  2F4O B;  3B02 A;  1MDM A;  3NWT A;  3A0H C;  1WH5 A;  2WV1 A;  1MGT A;  5LHH A;  1B59 A;  5HVQ C;  5KNL A;  3HOT A;  5J1U A;  3NQO A;  3HOY J;  3LSP A;  1YW9 A;  5CYV A;  2VL8 A;  3LFU A;  4ZDL A;  4KDP A;  2V6E A;  3ZMV A;  2A61 A;  4XOP A;  4IF4 A;  1J0R A;  4XLH A;  1FT9 A;  5L3E A;  1P6R A;  1D1C A;  2F6C A;  1FP1 D;  3DTE A;  2DT6 A;  2EV6 A;  2CMP A;  3M07 A;  3MWM A;  2JA7 J;  3CD6 I;  1B6A A;  1T08 B;  1JUS A;  2EWN A;  2O0Y A;  3A01 A;  5BS6 A;  1SC7 A;  1UCR A;  4OIP F;  3H0G J;  3Q9V A;  5EG0 A;  1SVM A;  2IS4 A;  2EPF A;  2EQR A;  2R7F A;  5DS9 A;  3GFI A;  3GUD A;  3GVA A;  1QHH D;  1LQ1 A;  3WTU C;  1SFU A;  4RAY A;  1Z1D A;  3H5N A;  4RB2 C;  5DCM B;  1S7A A;  2E35 A;  3ZQG A;  2DA6 A;  3GO5 A;  3QPH A;  3MN2 A;  1TQM A;  2W85 A;  2OF7 A;  2E5N A;  3HOV J;  2ECB A;  1WJ5 A;  1OCO H;  3O2P E;  4E7S A;  3KLN A;  3KP2 A;  5D5W B;  1NG7 A;  1B8I A;  1XS9 A;  1V4R A;  4B43 A;  5LRS A;  1F36 A;  2DMU A;  2DOA A;  2XAF A;  5K1Y A;  5F27 A;  5FKN A;  3MQ0 A;  1X3W B;  2P0W A;  2HFH A;  3BG3 A;  4CYC B;  3FHN A;  3PNY A;  3MKZ A;  3LST A;  1HW5 A;  1ETY A;  2L5Q A;  2LF7 A;  2P4W A;  4KT5 C;  1FIA A;  1A35 A;  1P7J A;  1P9Q C;  2EZL A;  3FK7 A;  4LMY A;  3J80 K;  4R8H A;  4MTE A;  1HBX G;  5DDG A;  2XSD C;  2NVT J;  3C7J A;  4FIS A;  4UHT A;  1OFC X;  3I54 A;  3V8K A;  2KIQ A;  5B66 C;  1YHQ I;  3CDH A;  5HNH A;  5A2Q K;  4OU0 A;  4OWR B;  4IRH A;  2BBY A;  2ELH A;  4EQQ A;  5DTD A;  2MSY A;  4CZC A;  4D0P A;  3P9C A;  4I7H A;  4EJV A;  5EEA A;  1MKM A;  1RUN A;  1MBH A;  1S3J A;  3FF5 A;  5IP7 J;  3J7A Y;  4JBA A;  1JTX A;  3J7A O;  3FXJ A;  1V5G A;  3WE3 A;  2DN0 A;  4G6D A;  3RYP A;  1BI0 A;  3GBG A;  1X58 A;  1LE8 B;  2XRO A;  2DOF A;  3ABM H;  4Y7N J;  1IN7 A;  1OCZ H;  2W57 A;  1VQ5 I;  1VTN C;  1Z3Y A;  1H89 C;  3OOP A;  4LIT A;  3ZQC A;  3F8F A;  2QA4 I;  2EFQ A;  4BDZ A;  1Z9C A;  1LFP A;  2R7X A;  2EFW A;  4GYI A;  3V4G A;  1RR8 C;  3VFZ A;  5F1R A;  1IF1 A;  3GW2 A;  1J09 A;  1E3P A;  3DKW A;  1GVJ A;  1HA8 A;  4U87 A;  1UG0 A;  3SFZ A;  2VON A;  3IH4 A;  3ELK A;  1FBU A;  1JJ8 C;  2OZ6 A;  2R5Y A;  5JLX A;  4W97 A;  3G73 A;  5KAI C;  2QQA A;  3CLO A;  1FYK A;  3LWF A;  2HZT A;  4B47 A;  3ZQF A;  2WAD A;  5J40 A;  3DTI A;  3WTT C;  4I98 B;  3G71 I;  4OMY A;  2MGQ A;  4ENM A;  3KYD B;  1W7P B;  2PJR B;  2LMD A;  3VOE A;  1IN4 A;  3JAM Z;  3L2U A;  2WWY A;  1QNT A;  4HLX A;  5FJ8 J;  4JX6 A;  4IO9 F;  4A3D J;  1DDN A;  2NNY A;  1KYW A;  1KU7 A;  1X4P A;  3CC7 I;  3V7R A;  4A93 J;  2XPW A;  2HPI A;  4BUP A;  1AA7 A;  2VXZ A;  2KMU A;  5LHG A;  3SZG A;  1PUF B;  2W1O A;  3ISP A;  3R0A A;  2VIX A;  2CGP A;  2FML A;  4E7K A;  1IC8 A;  2HVS A;  2ZJP F;  5HDN A;  2ZNY A;  2LKP A;  2V1D A;  2OU2 A;  2HQR A;  1WFX A;  4JOM A;  5IT9 K;  3WTZ A;  2CO5 A;  2E1M B;  2VE9 A;  5CKT A;  4PZJ A;  3WU0 A;  1BC7 C;  2R5Z B;  1TZL A;  4U7B A;  3BZ6 A;  2XAS A;  1ETK A;  2DA4 A;  1FNN A;  6PAX A;  1TL8 A;  4MLO A;  1QA6 A;  1SD6 A;  2UXX A;  2YX4 A;  5J8C A;  3F3X A;  4A2U A;  1V3F A;  3OIO A;  1BW6 A;  3OYL A;  3EUK L;  2ISY A;  3K9T A;  2ADU A;  2QYO A;  2L9S A;  1QBJ A;  2K9N A;  4M3B A;  1AU7 A;  1R9T J;  4LGW A;  2ZFU A;  2XPV A;  2W48 A;  3KFW X;  4B8X A;  2BEO A;  3Q5F A;  1T98 A;  2HDD A;  2MYS A;  4NQW A;  2B63 J;  2HOA A;  1IN6 A;  4ESF A;  1SFO J;  2DPU A;  1G6N A;  3K1N A;  1G3Y A;  2DA1 A;  2X85 A;  3CJN A;  4BAY A;  2NNN A;  2PEX A;  2DXI A;  3AG2 H;  3IC7 A;  2IVM A;  3TDZ C;  3VDX A;  1ZKG A;  4WK8 F;  1BIA A;  3M3Y J;  3DPL C;  1YRN B;  1WPK A;  2OQG A;  1NG6 A;  5FO5 A;  1ZG3 A;  2EB7 A;  2XDV A;  2KQR A;  2Z9O A;  2NYX A;  3C2G A;  4YIR X;  2XAG A;  4CIC A;  4FET A;  2XGC A;  1VQO I;  3F72 A;  4CCM A;  5LD2 C;  1IG7 A;  4BHP A;  1I6X A;  5LGT A;  1IJW C;  1EKE A;  1HW1 A;  3K4J A;  4D5F A;  3LA3 A;  3LSG A;  3V8J A;  3DBR B;  4KUM A;  4XLE A;  1TW2 A;  3OSG A;  4PJJ A;  2HTS A;  4JK1 X;  4A0Y A;  2QM3 A;  1ETW A;  1V5F A;  2K4J A;  2KZV A;  1X1B A;  3DF8 A;  5E8I A;  2LP0 A;  2UWM A;  2JJ7 A;  3HYI A;  3K1P A;  3W6K B;  4QIW N;  2QUF A;  3S14 J;  5E3M A;  2Z99 A;  1XGS A;  4XR6 A;  3EYI A;  1R6R A;  1T33 A;  3SXY A;  3KZZ A;  2XAQ A;  4KA4 A;  2STT A;  1ON2 A;  4PJN A;  1K6O A;  1D5V A;  3BR3 A;  3FHZ A;  2R92 J;  2MH2 A;  3O8H A;  2WC2 A;  1SMT A;  1SFE A;  2HZD A;  2MG4 A;  3HSF A;  3S16 J;  5HS8 A;  2E7W A;  3CCV I;  3MZH A;  4LB5 A;  4CA0 A;  5FKL A;  3OYD A;  4BHC A;  4F52 A;  2DA7 A;  1PUE E;  2OTL I;  3BG5 A;  4IZZ A;  3QOE A;  4AC0 A;  2HQA A;  5DM7 F;  1QPM A;  2DYR H;  4AUX A;  1SFK A;  3WGG A;  1ZLJ A;  3F21 A;  2DOE A;  2L01 A;  3BZK A;  1TNT A;  2JUG A;  4P5O A;  4XL9 A;  1UST A;  4XRS G;  3AL0 B;  2E19 A;  5K5O A;  2KPM A;  3DKX A;  1X1P A;  3G2B A;  4OOI A;  3W2V A;  2JK3 A;  2RKH A;  4IJA A;  3FIS A;  2L7K A;  3CF2 A;  4QLC U;  2L0K A;  2RC4 A;  2ZME A;  2XAJ A;  5E79 C;  4DYR A;  1C0W A;  3VYS B;  3RYR A;  1RIO H;  2KRF A;  1LJ9 A;  2XUB A;  1XSV A;  1XX5 A;  3BR6 A;  2A07 F;  2HOT A;  2PMZ A;  3S93 A;  1RET A;  5EGO A;  5ICF A;  1WJB A;  2Z2S B;  5GAG J;  4LG0 A;  1WKM A;  5D5X B;  2VJ4 A;  4LLN A;  3OYC A;  2V1N A;  4XLC A;  3W3C A;  3P5J A;  2M1B A;  3F22 A;  3GLX A;  3ZQI A;  2F2E A;  1XPX A;  1EH7 A;  1FOY A;  1MJA A;  1MW7 A;  1OCP A;  1QQI A;  1XG1 A;  3F6V A;  4WXH A;  5EYR A;  2STW A;  3I0T A;  2E7X A;  1HQC A;  5IOY A;  2X48 A;  2RRE A;  1QRY A;  1O3T A;  4IX7 A;  3NWS A;  1STZ A;  2A5W A;  2UXN A;  1ZRF A;  5J8F A;  1W5S A;  4UVC A;  3I64 A;  1T2K A;  1FSE A;  3ROU A;  5LLQ A;  3R4K A;  1USS A;  1Y39 A;  3F6O A;  3EYY A;  1W36 D;  1S8N A;  3EQL F;  5FRM A;  4NC7 A;  4YEL A;  1VFC A;  2YSR A;  3WE2 A;  3S3N A;  2GA2 A;  3FK6 A;  5H2F C;  2KRH A;  3CP8 A;  3K4M A;  2OTJ I;  1ON1 A;  4PJM A;  1CF7 B;  1G2H A;  3I5U A;  5C4J J;  3F23 A;  3OY9 A;  1JKO C;  3MEX A;  1R4N B;  1Y6I A;  4IEJ A;  1SAN A;  5E17 F;  1B4A A;  4HG2 A;  1Z77 A;  1A31 A;  1ZH5 A;  3S15 J;  1R1V A;  2NVY J;  2QF7 A;  1XB4 A;  3SYT A;  2IGO A;  2JVH A;  3TOA A;  2R0Q C;  4EV0 A;  1HKQ A;  1I5Z A;  3GZ6 A;  1TW3 A;  5D4S A;  3CO6 C;  5FLM J;  3K1M A;  4PUS A;  3S1R J;  1LEA A;  1S29 A;  5HOO A;  2JTV A;  2GIZ A;  3CUQ C;  3VSK A;  4NNJ A;  1R5I D;  2M2E A;  1XGM A;  1D8J A;  2IRF G;  5JLW A;  3NAU A;  2JZY A;  1P2F A;  4M3G A;  4PSW A;  2I5U A;  1RI7 A;  2DFF A;  4P9U A;  2ZJR F;  1GXP A;  2R3S A;  2XHK A;  3RPU A;  1KQ9 A;  1UMQ A;  2Y69 H;  2BV6 A;  3H5R A;  4BJ6 C;  4RB1 A;  2KDZ A;  1SAU A;  3BY6 A;  3CCR I;  3ZRG A;  4XKC A;  3FWE A;  4DQ2 A;  3MKY B;  1T6S A;  2BW3 B;  4GFB A;  2WAE A;  4IHX A;  3C2B A;  3IL2 A;  2O6G E;  3PM1 A;  2FE3 A;  3HSE A;  2A3S A;  2XRL A;  1LDK B;  4XLN F;  2D1H A;  1BI2 A;  2OQR A;  3N97 A;  5ED4 A;  4UV8 A;  3LAP A;  4B09 A;  4D7M A;  3OSF A;  1U8B A;  5EF6 A;  1I3A A;  3BCB A;  3D5S C;  2ELK A;  2FF4 A;  3K69 A;  3LMM A;  2L7F P;  4BGD A;  5ICC A;  2L9R A;  1YJN I;  1JJ6 C;  3KIO A;  2H8W A;  1XGN A;  4HST A;  3KP7 A;  1D0Y A;  2OBP A;  3R60 A;  3AAF A;  4S04 A;  3QP6 A;  1YE9 A;  4LFU A;  4PJL A;  2E5Z A;  2VBY A;  3MZ8 A;  5GP9 A;  1GUU A;  3HRM A;  4RAF A;  4IL6 C;  1JXS A;  1S9H A;  1BN5 A;  1R23 A;  3ZOB A;  3UKG A;  1X1D A;  3U1D A;  3PQK A;  4AVP A;  1M1E B;  1W0T A;  1MNE A;  4FTH A;  5J4V A;  3DPT A;  4Y4R A;  1TNS A;  2F4M B;  3KZI C;  4NC8 A;  2P6S A;  2WY8 Q;  3QYF A;  1RKT A;  3JRB A;  2IT0 A;  1ZRC A;  4BE1 A;  2G0E A;  4RBO A;  2HYF A;  4V19 K;  5GPA A;  2BY0 A;  3HPG A;  5M5X J;  1PYV A;  1ZN2 A;  3K4L A;  2H09 A;  2C6Y A;  4FAS D;  2V7F A;  2M45 A;  1YS6 A;  1W5T A;  1YS7 A;  4F91 B;  4W1U A;  3K4C A;  3E6C C;  1AKH A;  1BJA A;  4A3E J;  1OIS A;  2HS5 A;  1FOW A;  3QAH A;  1OPC A;  2XKO A;  2ZME C;  3VSL A;  3IRQ A;  5BPD A;  4M3E A;  1D1A A;  3GFJ A;  2RNJ A;  3TL4 X;  3SQN A;  2Q0O A;  1N75 A;  2JSP A;  1UB9 A;  1DGW Y;  3CZ6 A;  4KIT B;  2GXB A;  4QPQ A;  1EH6 A;  3QWL A;  3ZMS A;  3P9I A;  2RV8 A;  4C3J J;  3JR9 A;  2Z3Y A;  2LD5 A;  2M4K A;  2WBM A;  2IW5 A;  1YTY A;  3ZMD A;  3RKQ A;  2A6H F;  3CUO A;  3ZMU A;  2VC1 A;  1VQM I;  2NVX J;  3GTK J;  4ZDP A;  2OD5 A;  2DAO A;  4CHU A;  3FXR A;  2ZNZ A;  4IOC F;  2O9L A;  4XIC A;  2KLO A;  5IYD J;  2M30 A;  1R5G A;  1ZRD A;  4IVN A;  2CS3 A;  4BBR J;  4L9T A;  3CC4 I;  3G1O A;  2IGM A;  3OOU A;  5KHD A;  5KAF C;  4O3M A;  4GYG A;  2R7O A;  2DPD A;  5GAD J;  2NVU B;  1TC3 C;  1QZE A;  3REO A;  1H0M A;  4WF2 A;  1O3Q A;  2K5C A;  2K86 A;  2VKH A;  1TLH B;  3F9K A;  5BPI A;  5L3D A;  5FLX Z;  2LVS A;  1FPQ A;  3IAM 2;  2CWE A;  5DV5 A;  5GAE J;  1R49 A;  3BR5 A;  4CYC A;  3KYC B;  1WJD A;  2XRN A;  1GT0 C;  1LDD A;  2ZB9 A;  4BY1 J;  3GTM J;  2FBI A;  4YFN F;  2PJP A;  2VOD A;  4RLF A;  3FXU A;  1KU2 A;  4R1H A;  3QRF F;  5IP9 J;  2XF5 A;  3H0D A;  1FJL A;  2LFB A;  1WJF A;  4M6X A;  5HOD A;  3VOD A;  4UUS A;  2G9W A;  4II3 A;  5K7Z A;  3L2Q A;  5D8L B;  4Q5S F;  4D5C A;  2XPU A;  3L7W A;  3V8L A;  3KLO A;  1ZG5 A;  1OR7 A;  3S2W A;  3MMY B;  1IRX A;  4NBQ A;  4UVA A;  1YG2 A;  1REP C;  5IOZ A;  5LBQ A;  4RLQ A;  1JE8 A;  5ILS A;  4G94 A;  4QPO A;  1TP4 A;  4AIJ A;  3IUO A;  4XBF A;  4L18 B;  2L7M P;  1R22 A;  2PQ8 A;  1DQU A;  5FKO A;  1IXC A;  1ONV A;  3QPT A;  2CW8 A;  1KA8 A;  2IGK A;  3DXJ F;  1DPR A;  1Y1W J;  1I50 J;  3SDB A;  2LDU A;  1IW7 F;  1FBQ A;  1ODD A;  4YFX F;  1KQ0 A;  4ABZ A;  2GIV A;  2R7V A;  2RNG A;  4JX5 A;  3H1C A;  1IDZ A;  1J9I A;  2ZSI B;  4LIV A;  2L4M A;  3ZN1 A;  3FXK A;  3ASN H;  3OYM A;  4ZTJ A;  2X4H A;  4GRI A;  2DTR A;  4M74 A;  5F0C A;  3CDL A;  4I0A A;  2CQK A;  3FZV A;  1XMA A;  2PMZ N;  3VWB A;  2DDA A;  3LQQ A;  3ZQQ A;  2R7S A;  4A3L J;  3OV8 A;  4RB0 A;  2A6E F;  4YRV A;  1BW5 A;  4WXD A;  1T38 A;  2YPR A;  3WTX C;  2JA5 J;  1WVR A;  1SVO A;  3FBN B;  4P55 A;  3OIQ A;  4YIF A;  5CJ9 A;  4F93 B;  1FMW A;  2H27 A;  3GXO A;  3CDI A;  4LLL A;  5F0H A;  4ESJ A;  1W7P A;  3OR2 C;  2GAU A;  1IN5 A;  4LG3 A;  1TWA J;  3K4N A;  2IA0 A;  2V9K A;  5GAH J;  3CCS I;  4A3M J;  1R58 A;  1KYZ A;  1H8A C;  3BZC A;  4NUB A;  1GLN A;  2ELJ A;  4MHG A;  1ZQ3 P;  2LY9 A;  4Y17 A;  1W5C C;  1YIT I;  4N4N B;  2H1K A;  3HZJ A;  3KEY A;  2VOP A;  4C3I J;  2MW8 A;  1RC9 A;  3I58 A;  4BEH B;  1EA3 A;  4MTD A;  2LSO A;  4FE7 A;  3WTV C;  4IHT A;  3ASO H;  3OYJ A;  2ACJ A;  4NB5 A;  4Y13 A;  4XRS A;  4ZZD A;  5BOX A;  3HTS B;  1ZR4 A;  2WV0 A;  5HLI A;  2QKL B;  3FIW A;  3ZMZ A;  2FMY A;  2NOJ B;  2AXL A;  3CES A;  2F5C A;  3SDG A;  4Q4Z F;  3PIP F;  2R5Z A;  3LSM A;  3ERM A;  1LFU P;  2WB1 A;  2ZJQ F;  2QKM B;  2KIU A;  4S05 A;  1UFM A;  2YR2 A;  1EH8 A;  4I09 A;  1BIB A;  1R1T A;  5E3N A;  1BL0 A;  3BLY A;  3T0Y A;  2ZSH B;  3GTP J;  5D8K B;  2Q2E B;  1QVT A;  2FBK A;  5HLG A;  4KIS A;  3IV5 A;  4CXF A;  5H6R A;  2B7E A;  1UHS A;  4RGX A;  2F5D A;  2VBZ A;  3DEE A;  4BY7 J;  5EJC A;  1O57 A;  4Y15 A;  2L7Z A;  4EEF G;  3ZCO A;  1UZC A;  3BJO A;  1WJC A;  4HDU A;  5FB2 A;  2E34 A;  1WH7 A;  4MNU A;  3FXL A;  3RPU D;  2V9V A;  4KT6 A;  5DD8 A;  5EZG A;  4PJ0 C;  4PFO A;  4EM2 A;  4CCJ A;  1PJR A;  3OYE A;  1UG2 A;  2DK5 A;  3S3O A;  2ZXJ A;  2J5P A;  2YS9 A;  4O6J A;  3QPL A;  2D5V A;  3QP5 A;  4M72 A;  5J47 A;  4X1E A;  1W1W E;  1MDM B;  1YRN A;  1MMG A;  1OYI A;  3IAS 2;  3H36 A;  3SZT A;  3EUA A;  4S0H B;  2WTE A;  2Y30 A;  1KU3 A;  1VQN I;  3BPV A;  1TWG J;  3JW4 A; 
#chains in the Genus database with same CATH homology
 3I9V 2;  1DP3 A;  4CA0 A;  2A6T A;  4XKW A;  3DQV C;  3OYD A;  1KON A;  4F52 A;  3FDY A;  1X19 A;  2K9M A;  3W2W A;  3HUG B;  4IZZ A;  1X4O A;  1X1C A;  3H9G A;  1WJE A;  3QOE A;  4XKV A;  2HQA A;  2LG4 A;  2V26 A;  3RTR A;  1SFK A;  1BOB A;  2V4J C;  4XM3 A;  4P5O A;  4XL9 A;  2JUG A;  2HDW A;  2FUG 2;  4PFP A;  3AL0 B;  4X0G A;  4BL0 B;  2KPM A;  3ONQ A;  3ZR8 X;  2CUJ A;  2R7T A;  3DKX A;  5LFA A;  3G2B A;  3W2V A;  2AQE A;  2L7K A;  2CUZ A;  3EUH C;  2X6Y A;  2M3A A;  3CF2 A;  4DIQ A;  2HPM A;  3K4B A;  3VYS B;  4E7Z A;  3QYE A;  2JVG A;  2PMZ A;  3S93 A;  1WJB A;  3OYF A;  2Z2S B;  5FRN A;  2X1E A;  3OYK A;  2BVL A;  2VJ4 A;  4CCK A;  3ZXS A;  4CCL A;  2GOM A;  3OYB A;  3OYC A;  2V1N A;  3UR3 C;  4XLC A;  3W3C A;  1OR7 C;  2Y0S A;  2UUZ A;  2ZXH A;  2W7N A;  2PJR A;  1MW7 A;  3HC7 A;  3HKZ A;  2M7B A;  3PFY A;  2RQQ A;  4IQ4 A;  2RRE A;  4CCO A;  2WY7 Q;  2VXD A;  4IX7 A;  3NWS A;  3AKZ A;  2A5W A;  3H5A A;  1N77 A;  2CH0 A;  2UV1 A;  2X51 A;  4E7H A;  3W2A A;  4G6T B;  4RMN A;  4II2 A;  2R4G A;  4E7I A;  3LSI A;  1W36 D;  1DGR M;  4R79 A;  2Q1Z B;  4XOR A;  4AYB A;  3QOD A;  1Y56 A;  5FRM A;  4RM2 A;  4NC7 A;  3H9Q A;  4YEL A;  2DJI A;  4AU7 A;  3S3N A;  3DU5 A;  4ANJ A;  5HNF A;  2HU9 A;  2KRH A;  3CP8 A;  3K4M A;  4B44 A;  4H4K C;  4HSR A;  4PJM A;  2VPL A;  1U0J A;  5CQE A;  2MAB A;  3K10 A;  3E0J B;  3PSI A;  4BJ5 C;  2WAF A;  3HPH A;  4XN3 A;  4C2U A;  4CUG A;  3OMY A;  2HVQ A;  4XLA A;  4DGW B;  3OY9 A;  4E7J A;  3U21 A;  3DWL E;  3S3M A;  1Y6I A;  4ZC3 A;  1LKX A;  3VYU B;  2L9N A;  4HG2 A;  4D1Q A;  4BQQ A;  4D9J A;  3SYT A;  2MC4 A;  2IGO A;  2JVH A;  1Z21 A;  4HNT A;  5HLT A;  2CV0 A;  3TBI A;  4XQF A;  4IKF A;  2CV2 A;  3D5R C;  3K6G A;  4BEH A;  3MD2 A;  3UNG C;  4E7L A;  2O5R A;  4PUS A;  5HOO A;  3IP4 B;  1K6Y A;  1MND A;  4NNJ A;  3VSK A;  2KRC A;  3L2R A;  1Z3X A;  2LBF B;  1T0F C;  5KCM A;  4BS9 A;  4PSW A;  1OLT A;  3SEZ A;  4F55 A;  4KJZ A;  3K70 D;  3H5R A;  4BJ6 C;  4OAZ A;  1SAU A;  2R7Q A;  4IQJ A;  4DOZ A;  2X6W A;  4XN0 A;  3ZRG A;  1VZ0 A;  4XKC A;  5FRO A;  3K4K A;  4B3X A;  4F3Q A;  2R7R A;  2Z1D A;  1T95 A;  2F5V A;  3MKY B;  3TMO A;  3HOS A;  2L2O A;  1BR1 A;  2BW3 B;  2LH9 A;  2F4I A;  2VLA A;  1X1A A;  2WAE A;  3PL8 A;  3S32 A;  2KP6 A;  4DBR A;  1LDK B;  4F92 B;  2MFZ A;  3LSK A;  3OS0 A;  1ZEL A;  3V42 A;  3OYH A;  3VYT B;  1D0Z A;  2CFO A;  4J00 A;  2LY2 A;  3KYL A;  2X1D A;  2XAU A;  2KL4 A;  1D0X A;  1ERD A;  3BCB A;  4BQN A;  3BC8 A;  3D5S C;  3H9J A;  3LMM A;  3L2W A;  1UAA A;  4BGD A;  4ZDO A;  2LBF A;  2AQF A;  2E60 A;  4HRI A;  3PNV A;  2ZXI A;  3N05 A;  4HST A;  4BDY A;  4PK4 A;  1D0Y A;  3CJR B;  3NWT A;  2XSJ C;  1YE9 A;  3I3L A;  2LY1 A;  5HVQ C;  5KNL A;  3HOT A;  2OUM A;  2WAQ A;  3PUB A;  4PJL A;  2E5Z A;  2X1C A;  3DLA A;  3OIP A;  4CCN A;  2M4G A;  2VL8 A;  3LFU A;  4ZDL A;  2DCE A;  3M8J A;  4NQW B;  2V6E A;  3A4C A;  4XOP A;  1S9H A;  4XLH A;  1X1D A;  1E0E A;  1D1C A;  2F6C A;  3DTE A;  2I8D A;  2DT6 A;  3OYA A;  2CMP A;  1MNE A;  3DPT A;  4Y4R A;  3PNT A;  4P1W A;  4NC8 A;  3BG7 A;  2M7A A;  2IS4 A;  2WY8 Q;  3QYF A;  4B48 A;  1BR2 A;  1YX5 A;  2VJ5 A;  1QHH D;  4BE1 A;  3OWT A;  4HNU A;  3L2V A;  3OYI A;  3HPG A;  1PYV A;  3K4L A;  4BJT A;  3H5N A;  1TT0 A;  3OS2 A;  4FAS D;  2V7F A;  1WJA A;  2LRE A;  4F91 B;  2E5N A;  3K4C A;  1FMV A;  1WJ5 A;  4E7S A;  2LYC A;  2XC7 A;  1NG7 A;  3HG9 A;  4B43 A;  3VSL A;  2IGN A;  1G59 A;  1D1A A;  1V5E A;  2DOA A;  4Y33 A;  4XLF A;  3TL4 X;  3OS1 A;  2P0W A;  3HXL A;  1N75 A;  2LOO A;  2JSP A;  3OL3 A;  4E4H A;  1DGW Y;  3FHN A;  3PNY A;  3MKZ A;  3CZ6 A;  4KIT B;  4ZTF A;  2LC2 A;  4QPQ A;  2L5Q A;  3CJQ B;  3ZGK A;  2X6X A;  1P9Q C;  4CSW A;  3RCO A;  2M4K A;  2WBM A;  2K3P A;  4XON A;  2VQC A;  2KHM A;  4ZDP A;  3KX2 A;  3RSN A;  2R7U A;  5HNH A;  3AL0 C;  3MKW B;  4OWR B;  2KLO A;  3CMM A;  4DJA A;  2VJJ A;  2CS3 A;  4CZC A;  2IGM A;  3FKJ A;  3OOU A;  3D5L A;  5KHD A;  2W4S A;  3J7A Y;  2MD0 A;  2R7O A;  1V5G A;  3HL2 A;  1D1B A;  2K5C A;  3OYG A;  2VKH A;  2VQL A;  3F9K A;  2HNH A;  3GBG A;  3PSF A;  2XF7 A;  3IAM 2;  4BXF A;  3VYR B;  4XMY A;  1WJD A;  2E1M C;  1Z3Y A;  2IXS A;  3LL7 A;  2W82 A;  3E1S A;  4LIT A;  3DPU A;  2GOX B;  4BDZ A;  1LFP A;  2R7X A;  4RLF A;  2JA2 A;  2XF5 A;  3H0D A;  1W36 C;  1QHG A;  1J09 A;  1WJF A;  3EPZ A;  1HA8 A;  4U87 A;  1UG0 A;  4II3 A;  3L2Q A;  4BE2 A;  2OV7 A;  4XKB A;  3MMY B;  1IRX A;  2W00 A;  3BG6 A;  4RLQ A;  3OL4 A;  4B47 A;  3M1C A;  2WAD A;  4QPO A;  3DTI A;  3IUO A;  2LRD A;  3AFH A;  4ITV A;  1DQU A;  4HEA 2;  2CW8 A;  2PJR B;  2CW7 A;  3FBI B;  3L2U A;  2IGK A;  4LIU A;  2IS2 A;  1UEL B;  4BQO A;  3DTK A;  4RM3 A;  4BAC A;  3SDB A;  1X4P A;  4E6K G;  1Z7L A;  2HPI A;  4BUP A;  1AA7 A;  2R7V A;  2RNG A;  2BW3 A;  2VXZ A;  2KMU A;  4N4O B;  3PJR A;  2ZSI B;  4LIV A;  4C30 A;  3SZG A;  2W1O A;  1JI8 A;  2VIX A;  3OYM A;  4OAY A;  4ZTJ A;  3DKY A;  4GRI A;  1MMA A;  4E7K A;  2HVR A;  2HVS A;  2M0M A;  3VWB A;  4XOT A;  3ZQQ A;  2R7S A;  3BCA A;  4YRV A;  3S8P A;  4JOM A;  1WFX A;  2KDO A;  2E1M B;  2WA0 A;  3K70 C;  5CKT A;  4ZJZ A;  1TZL A;  4U7B A;  3FBN B;  3OIQ A;  4F93 B;  4J01 A;  5JHF A;  1FMW A;  4EAT A;  4HPQ A;  4MLO A;  4XNF A;  3OYL A;  3OR2 C;  3EUK L;  4LG3 A;  2L9S A;  3K4N A;  2V9K A;  2OC6 A;  1MMN A;  1QU3 A;  2VQH A;  2ZFU A;  4NUB A;  3SEQ A;  1GLN A;  2ELJ A;  1BR4 A;  1LVK A;  4N4N B;  2MYS A;  4BU2 A;  3KEY A;  3DU6 A;  2VB6 A;  4BEH B;  1EA3 A;  3OYJ A;  2X85 A;  2CV1 A;  1YX3 A;  4PSX A;  2DXI A;  2QKL B;  3OYN A;  5CQG A;  4AVZ A;  2VKD A;  3C2H A;  2R7W A;  2XF6 A;  5TGT A;  3VDX A;  4BE0 A;  2NOJ B;  2VJI A;  3QYB A;  3DPL C;  2BVM A;  3CES A;  3LSM A;  2WB1 A;  1NG6 A;  2QKM B;  2XDV A;  4ZYA A;  2KQR A;  3C2G A;  4YEJ A;  3BLY A;  4C9Y A;  4DBQ A;  3A2K A;  2ZSH B;  4FET A;  4CCM A;  5LD2 C;  2Z16 A;  2K9L A;  2Q2E B;  4KIS A;  3K4J A;  3LSG A;  3CP2 A;  4XLE A;  1G8X A;  4PJJ A;  3DEE A;  3ZCO A;  2VAS A;  1WJC A;  1V5F A;  3A1Y A;  2KZV A;  1X1B A;  2BOL A;  1N78 A;  3RPU D;  2UWM A;  4KT6 A;  2VQG A;  2DT7 B;  4PFO A;  4XR6 A;  4CCJ A;  4Y3O A;  1PJR A;  1R6R A;  3OYE A;  4C2T A;  5CPR B;  3S3O A;  3H35 A;  3LSH A;  4PJN A;  4JQF A;  2IS6 A;  1MMG A;  1MMD A;  3IAS 2;  2IS1 A;  3EUA A;  4CH7 A;  2HZD A;  3RQ4 A;  3OR1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...