3WTXC

Crystal structure of the complex comprised of ets1(y329a), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
103
structure length
103
Chain Sequence
PIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 35
structure length 103
sequence length 103
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtxC00
2ISYA 5E17F 3KLOA 2G9WA 1I5ZA 2EV6A 5EEGA 2GWRA 5LRRA 4U7BA 1YW9A 3FX3A 4CZZA 3I5UA 5ILSA 1IUYA 3QOPA 2HEOA 1ZG5A 5D5VB 4RS8A 3WTXC 3EYYA 2GA1A 5DYMA 3FXQA 1XGOA 2D1HA 4OOIA 1WRJA 4LLGF 4P5OA 2V9VA 1EH6A 1IN5A 3BWGA 2XRNA 4DQ2A 1FYLA 5HS7A 4OINF 5L3FA 5BQTA 4GO1A 1ZREA 4WX9A 4HF2A 2OU2A 4AD9A 2OZ6A 1BOAA 1HKSA 4G94A 3DXJF 2RV8A 1D8KA 2FXAA 3H92A 3WTTC 3J80K 3TOAA 4JBAA 3CO7C 5E8GA 3DV8A 3U9GA 3KP3A 5A2QZ 1TNTA 1KU9A 1QZZA 1Z9CA 4ZYDA 3FXUA 4M74A 4M9SA 4MEYF 3GFLA 2XVCA 2CYYA 3SFZA 1B9NA 2DFIA 5HLGA 2RNJA 3OOPA 3VOEA 4GGGA 1B59A 2M45A 5DD4A 2VE9A 2HWVA 1I1SA 2F5CA 3ROUA 4LK0F 1QZYA 1XSVA 4OMYA 3F8MA 1E2XA 2W84A 1KGSA 1MKMA 1GVJA 4IRIA 1D3YA 2K7LA 1TW3A 4KIFA 2J5OA 2P6SA 2QWWA 1W7PD 4I01A 3KP4A 2HR3A 3FXRA 2HDCA 1YG2A 3GFIA 3V7SA 4CICA 2FF4A 1TLHB 3V8LA 3QP6A 4Y15A 3CDHA 5E1WA 1NHAA 2MA3A 3Q9SA 2PFBA 5KVRA 2D1VA 2P5KA 2H6CA 2EFOA 2EV0A 5CVUA 4L9TA 2O0YA 4PDKA 4HOBA 2IVMA 1YFHA 2UXNA 2CW0F 3J81K 3P9KA 2YSRA 4ENNA 3C1DA 2ZO4A 3JW4A 4MQ9F 2O6GE 1U8RA 4EM1A 2OBPA 2EA2A 4Y13A 4JK1X 1JXSA 3BJAA 3QRFF 5LGTA 1OYIA 1G3WA 1HKTA 4ZZLA 2J5PA 4QWQA 2VN2A 4XLPF 3W6KB 3WTSC 1IN6A 3LFKA 3BDDA 2VBYA 1X3UA 1G3TA 3TDZC 2H94A 4Z2YA 2C6YA 4HQEA 2DQLA 2QQ9A 3CO6C 3R60A 2JRTA 4G9YA 4L9NA 5ICGA 3ZMZA 4CYDA 4L5JA 2ISZA 5BOXA 4RB2C 4M71A 4Y17A 2EFWA 4G7HF 4AIJA 4Q48A 1SFEA 2V1XA 5BPDA 1BIAA 3F21A 2RQPA 4ZYHA 4U0WA 4RGRA 1LEAA 3HIFA 1I27A 3BPXA 2P4WA 3HRMA 5FLXZ 2D45A 1ZN2A 3C3WA 3VEPA 4RB1A 1OMIA 1AOYA 1G4DA 1GXQA 4OIOF 1ZG1A 4GYGA 4S05A 5D5XB 2Q0OA 2VXZA 4AIKA 2M5WA 1FLIA 1SFXA 2PBIA 2V1UA 5FGMA 4I7HA 2FSWA 2ADUA 2VC0A 3M8FA 2UZKA 2JPBA 1GHCA 1OYWA 3HUGA 3I54A 3LWFA 2RN7A 2IA2A 4EJOA 2M30A 1S7AA 1FBSA 2XUBA 1G3YA 3ECOA 1O3TA 1WSUA 1YW8A 2F2EA 2VC1A 1V4RA 2A5YB 1FBQA 3QAHA 4U0VA 2CGPA 5LEJA 1Z6TA 2PLYA 1IN4A 4NHJA 4R8HA 4P96A 1T39A 1G6NA 3E5UA 4RGXA 4CXFA 4HYEA 2QBYB 2MLGA 3RPUA 1ZRFA 1ZLKA 4LB6B 4EMSA 2P7VB 2JTVA 2VT3A 4AWXB 1TNSA 2UXXA 1F5TA 2EB7A 2STTA 4E70A 2ACJA 2L01A 2V1DA 1ODDA 5HOOA 2A61A 1YLFA 4D0PA 3F6OA 2XKOA 1KYWA 5E1XA 1TQMA 2QBYA 3E3VA 4UUVA 2BGCA 3ERED 2EFPA 2PI0A 1LDDA 4KUMA 4KFCA 2XAHA 3MAJA 2MLKA 5DCMB 4EGYA 3KLNA 1XDUA 3RYRA 2BBYA 3ABTA 1TBXA 3F72A 2KIUA 3I64A 4A0ZA 4R79A 1KQ0A 1USSA 1IW7F 3WTUC 1P4WA 5K5QA 4MQVA 4ZYGA 1R23A 2R7DA 1S6LA 4S04A 1Q1HA 3KETA 1LNWA 5JVTA 3MWMA 1EV7A 2XAJA 4KICA 2OA4A 4OIPF 5DCMA 4WK8F 3ABUA 5HVQC 1XGNA 3ULQB 6PAXA 4HAMA 5FD6A 2EV5A 4U7DA 1P92A 1BJAA 2EK5A 4IXAA 3L09A 3SHFA 5LGNA 2KKOA 3I59B 3M9AA 1IN7A 4LFUA 2L02A 3GXOA 4OU0A 5HDKA 1WKMA 3DFGA 4WF2A 2E7WA 2QZ8A 4KIGA 4OIQF 2CO5A 3CUQC 2NYXA 1RIOH 3TO9A 5HLIA 3I53A 4Q5SF 3F3XA 3GZ6A 3HOSA 2YX4A 3T8TA 1V3FA 5IT9K 2ZNZA 1YS7A 1ZAOA 2KIFA 3LAJA 3TQNA 4U88A 1B6AA 1U5TB 1W5TA 2IP2A 2P5LC 3SZTA 3ECHA 1QQIA 2IA0A 2Y0MA 5LHGA 2F5EA 1Z91A 5K5RA 5D6EA 1P4XA 3WGGA 4ESFA 1QBJA 3IWZA 2CSOA 1HKQA 1BIBA 2IA1A 3HRUA 1FP1D 2Y75A 5E8IA 2G7HA 1RI7A 1RNLA 2DAOA 3BOQA 1JHHA 2Z3YA 2COMA 1U5TA 4HX8A 3COAC 3BZ6A 3QP5A 1S3JA 1IN8A 5K1YA 1ULYA 3O6BB 3WTVC 3T5XA 2K4BA 4M9ZA 2O03A 3KP6A 4LJZF 1IXRC 5CVVA 4N0BA 2LF7A 2KJBA 2M87A 5E20A 3GLXA 3WGHA 4EQQA 1H9TA 2E1CA 2BV6A 1BN5A 3HTUA 4ZZDA 3WE2A 2AXLA 5E1ZB 1BBYA 5FFZA 3PQKA 3HRTA 4BHCA 3HTSB 1B1BA 2JSCA 2GQQA 3R0AA 4CO8A 3ZMUA 3IKVA 4A12A 5D4SA 1BI0A 5TJJA 3KFWX 4I09A 2X4HA 2ESNA 2VT2A 4WXHA 3L9FA 3R4KA 5J6XA 3LSTA 4RAZA 1F9NA 4CHUA 2OD5A 1LJ9A 3GVAA 3RPQA 2LNBA 4EM2A 4A6EA 5AIPA 1BI1A 3DQVC 1T98A 3HOTA 3I58A 1K79A 3ZMTA 2W57A 4HDVA 2Q8KA 4IRGA 1RUNA 4HLXA 4XSZF 2HKXA 3GFJA 2LDUA 5BMZA 3K0LA 1PP7U 4YFXF 2P5VA 3M8EA 1BC7C 3ZP5A 4HZFA 3K1MA 2B0LA 3PQJA 4ENMA 3H3UA 1BI3A 2KRFA 1U3EM 1GXPA 2WWYA 3S2WA 2FBHA 4IHTA 1IXSB 4KNYA 1ZHFA 3RIRA 3TOBA 3JAMZ 3L00A 2FMYA 1U6GA 4IJAA 1J5YA 1JGSA 2FNPA 4UV8A 4IF4A 1MJAA 1AWCA 5FO5A 5DCFA 3LAPA 3WU1B 1S29A 1T2KA 2BEOA 4EM0B 2LKPA 2MD5A 3FM3A 3F6VA 2DU9A 4WXDA 2QYOA 1F1ZA 5ICEA 1IRFA 4RGUA 2CFXA 3DPLC 2DQRA 5HDNA 1HBXG 2MC3A 3WTYC 1LDKB 1MD0A 2FQ3A 3MQ0A 3BJOA 1YO5C 4PCQA 4HX7A 2RC4A 2OAZA 2HQNA 2CWEA 2VBWA 1ZLJA 4EJVA 3R0JA 1O7FA 1RZ4A 1BI2A 1J75A 3E6MA 5CVRA 1XD7A 2ZJ2A 3ZN1A 2WTEA 2DI3A 4N9HA 2GXBA 5HLHA 3ZN0A 1UCRA 5L3EA 2Z99A 3SQNA 2DBBA 1Y0UA 5DEQA 3G73A 5F6FA 2ZKZA 4M72A 1K78B 3U2RA 2HFHA 3WODF 3VFZA 4MHGA 1XDSA 2M8EA 3AAFA 1R1UA 3V7RA 4KDPA 2BE5F 5DD8A 3BJ6A 1YW7A 1L0OC 4BH9A 4I0AA 4H0EA 1XSDA 5F64A 2ZMEB 3P9IA 1KU7A 3SXYA 1QO0D 4ZH4F 1XN7A 1K78A 4OMZA 4AVPA 5D5WB 5L3BA 2Y48A 5HS8A 4JQFA 4LG0B 2L4MA 3CJNA 4LLLA 2P8TA 1FP2A 2KJCA 4YIIA 1FY7A 2ZBKA 2KIMA 1W7PB 2ZMEA 1O7LA 4KMFA 1YS6A 3RYPA 1STZA 5ILVA 4KN4X 1WQ2A 3F8CA 4YFNF 4LG0A 3DKWA 3K1NA 3V8KA 1K7AA 2HZTA 2GXGA 2ESHA 2CQKA 3DP7A 1SFUA 1W7PA 4G7OF 1O57A 5K5OA 1HSTA 4IPAA 1FWZA 1G3SA 2DPDA 3J80Z 1HXDA 2K4JA 3E6BA 2DTRA 1R1TA 2LF8A 2WV0A 2IW5A 2X0LA 4UHTA 4XLNF 2NAZA 5JI6A 4KN7X 3IWFA 4IHSA 5FD5A 1S7OA 1K6OA 1ZRCA 5ERIA 3RDIA 5CLSA 3P9CA 1XSXA 2W25A 2K02A 4TV7A 3E6CC 1P4AA 3KCCA 3M7GA 5CYVA 2NNYA 2PJPA 3MZHA 5CVJA 1HW2A 4EV0A 3R6SA 5L3CA 3JTGA 3RJPA 3WTWC 3K2ZA 1F4KA 2QLZA 3JTHA 4UV9A 4HW0A 4YIFA 2OQRA 4KYWA 1R00A 4BHPA 3MCZA 1S8NA 5D4RA 5A2QK 1TQPA 3ZMDA 1PUEE 5H6RA 4RB3C 3NRVA 4A2UA 3BY6A 2EWNA 1ZG3A 3K1PA 5ED4A 1J7KA 2L3DA 3KP7A 3GW2A 3LA2A 3DF8A 1SAXA 3ELKA 2ETHA 3O3KA 1H0MA 3O2PE 4ESBA 3G3ZA 1P2FA 2NNNA 3F8FA 1HQCA 1FSEA 2EFQA 4M9XA 1U78A 3NQOA 5FFXA 5LEKA 3VB2A 2O8XA 2F5FA 1YTYA 3J81Z 3P7NA 2Z9OA 4G7ZF 2HS5A 1QNTA 1MJBA 2FMLA 1U2WA 2FNAA 1L3LA 1LDJA 1R7JA 5LRSA 1Z6RA 2PMUA 3J7AO 2FOKA 1OYYA 2XAFA 5H6QA 3V7CA 3FMSA 5ICFA 1J2XA 3I4PA 3QPTA 2A6EF 1MDMB 3F8BA 1KYZA 5LHHA 3WE3A 4HV5A 4ENJA 2A6HF 3I59A 2NS0A 1FBUA 4BXUA 4P9UA 3EQLF 1IF1A 4BAYA 4L0YB 3MEXA 4RGSA 3TO6A 2IT0A 5DV5A 1MZBA 2JZYA 3CTAA 3N4MA 2ZFWA 2W24A 2V79A 1FZPB 1MDMA 5IT3A 1ON2A 1QPMA 2VODA 1XMKA 4EGZA 3E97A 5EEHA 3IKTA 2P6TA 3Q5FA 3FMQA 2MBFA 1T6SA 2HYFA 2YR2A 2MH2A 2VOOA 3LA7A 2A68F 1LB2A 2P7CB 2XHKA 4FX0A 3LQQA 1Z1DA 2CG4A 2QM3A 3GUDA 1IXCA 2PMHA 3I0TA 4L18B 2QVOA 1R1VA 1JHFA 1SD4A 2IRFG 2R7FA 2LSOA 1FC3A 5J8FA 1R5HA 1UFMA 1P6RA 2PG4A 1D8JA 2HTJA 3B73A 3QPHA 5FLXK 2FBIA 2G7UA 2PEXA 1IRGA 1O3QA 5CVIA 2O61A 5L3DA 4Q47A 1HW5A 3KEOA 2TDXA 4FT8A 4BNCA 2VBZA 1ZH5A 4GCVA 3BPVA 3KEQA 1DUXC 2O3FA 1TQIA 4A5NA 5L3GA 2FA5A 5J8CA 2VONA 2XROA 4O5VA 4ESJA 1FSHA 1FNNA 1EH7A 3I71A 4PGHA 5LGUA 3RKXA 1FX7A 1KQ9A 4KMUX 1Z05A 3FZVA 2GAUA 2Z5UA 1RUOA 4G8XA 3LQRA 3QU6A 2DW4A 1R58A 3HRSA 2ZXJA 1ZRDA 3SZPA 4PZJA 2H6BA 2IPQX 3W6JB 4RB0A 2QUFA 2WC2A 4YFKF 4UXNA 4ASNA 4AIHA 3BP8A 2ZCWA 5CJ9A 4FX4A 1O3SA 1WWXA 5D6FA 4EJUA 5LBQA 4XRFA 4HQMA 2H27A 1T0FA 5F1RA 3KP5A 4IRHA 4KT5C 2EFNA 3TKYA 4IVNA 1OPCA 4ON0A 2FE3A 5BS6A 1Z7UA 1A04A 2XIGA 4LGWA 5D8KB 5ICCA 1ZYRF 1W4MA 3V8JA 3VODA 1I1GA 1SMYF 3HSFA 3FM5A 3IL2A 1OKRA 5LHIA 2A07F 3E6DA 1U5TC 4KA4A 3GZ5A 2IJLA 3GWZA 4O3MA 3OV8A 1UHMA 2XGXA 3PFIA 1PDNC 4MTEA 4HBLA 3T1BA 2OZUA 2D2WA 1IAWA 2L54A 4L9JA 3TO7A 4LLNA 4HF0A 1FYMA 2XKPA 2YPRA 3B02A 4PGGA 5DDGA 3HSRA 3ZMSA 4BYYA 4BHBA 2FEZA 2UWMA 3RI4A 4O6JA 4A6DA 3RTRA 3C18A 2RVCA 2QENA 5AIQA 5DUIA 4XBFA 4M6YA 5LLQA 2OQGA 1T38A 2Q2EA 2W85A 3E5XA 4G6QA 2XAGA 3ISPA 3KE2A 1QGPA 2K86A 2FBKA 4EJWA 4BQAA 1SD5A 3HHHA 2AS5F 4LB5A 5IT9Z 4I98B 3FF5A 3D0SA 1FT9A 1YQAA 5E18F 2GZWA 3ZMVA 4M73A 3NEUA 3WG9A 4QLCU 1I6XA 2XAQA 1DPUA 2RGVA 2H09A 1TTYA 3K69A 3EDPA 2GA2A 2DK5A 3N97A 1USTA 2Z33A 3E5QA 3MFKA 3M1EA 2HYGD 3ZQ7A 4LMYA 1REPC 3KZZA 1J9IA 1VTNC 1ON1A 2VE8A 1CF7B 1XCVA 1OR7A 3K9TA 4GYIA 1CGPA 4ZYEA 3JSOA 2QQBA 4I2OA 2QQAA 1BC8C 4R1HA 1SD6A 2FRHA 3FHZA 3RKWA 2V6CA 4M6XA 1KU3A 4FHTA 2XASA 2A69F 1XMAA 2GIVA 1J0RA 5JFRA 2E7XA 1YYVA 4DNCA 1CF7A 4ENKA 2YX7A 4YG2F 1FYKA 4A0YA 4LK1F 3CUQB 1DPRA 3RKYA 1IZ1A 1ONVA 4NB5A 1R36A 3IRRA 2F5DA 4N9IA 2RKHA 3GO5A 1KU2A 5KK1A 1J59A 4HA8A 1ZGAA 1FOKA 3H3ZA 3T0YA 4NQWA 2DK8A 2VBXA 3CUQA 3WU0A 4OIRF 5D8LB 1MJ9A 3JSPA 3DEUA 2PQ8A 3T8RA 4L9VA 1DDNA 2FU4A 3EETA 1PP8F 3F8NA 4UVCA 4HV6A 1LVAA 1O3RA 2RDPA 1HW1A 1KA8A 3LA3A 1DP7P 3HYIA 2M1BA 3C7JA 3D5LA 4MTDA 1EH8A 2DLLA 4I02A 1LEBA 2HGCA 4L0ZB 5HDGA 4I0BA 3ML6A 5HS9A 1SD7A 4A5MA 4L5IA 4UVBA 3CLOA 4MEXF 4UNOA 1E17A 2DO7A 1R22A 2BYVE 4MNUA 4RAYA 4P55A 1LQ1A 3REOA 1C0WA 3DPTA 1UB9A 3FWEA 5AONA 3GX4X 2XV4S 2EJRA 4EJTA 3GF2A 5TRDA 1XGMA 2EA4A 4A0XA 4Q4ZF 3WTZA 5D5UB 3IRQA 3JAMK 1XB4A 1XCBA 5BPIA 3HHGA 1MGTA 3HSEA 3V4GA 2HKOA 1W5SA 3KP2A 4HX4A 2PN6A 3BROA 4U0YA 4P9FA 4UVAA 4CDGA 2DPUA 1SMTA 3L2CA 5JR3A 2ZNYA 4GXOA 3IHUA 2ELHA 4KIBA 1B9MA 2HQRA 1R5GA 1ZGJA 4WCGA 2STWA 3ZPLA 3IC7A 4HDUA 3R61A 4MGRA 1D5VA 1B4AA 4G6DA 1TW2A 2HOEA 2HTSA 1KQ8A 3QU3A 3F22A 3CUOA 5FB2A 1YIOA 4HLYA 4ETSA 2A3SA 3F23A 4F7ZA 2JPCA 2K27A 3TGNA 1JE8A 2VOPA 1HSJA 5DUKA 3EYIA 1ZARA 4XSXF 5JHUA 4WXCA 3GEZA 4CGZA 3KZYA 1WI9A 1H9GA 5ILUA 3U1DA 2DT5A 4WWCA 2JT1A 2NRAC 3L7WA 2YU3A 4B8XA 3EUHA 3GFMA 1FPQA 3FMRA 4K2EA 1UHWA 2L4AA 1BM9A 5H20A 3MZYA 2MH9A 2R3SA 4EVIA 4HF1A 2E1NA 3TDUC 3GYHX 4LD5A 4B09A 1XGSA 3Q9VA 3WGIA
chains in the Genus database with same CATH superfamily
1R5ID 2ISYA 5E17F 2V1NA 3RZOJ 3KLOA 4BQQA 2G9WA 1I5ZA 2EV6A 5EEGA 3Q0WA 5C4JJ 2GWRA 2KL4A 5LRRA 2GXAA 4U7BA 5IYCJ 2R7RA 2FD5A 1YW9A 3FX3A 4CZZA 1HDDC 4QIWN 3RKQA 3I5UA 5ILSA 2VLAA 3HDDA 3DKXA 1IUYA 2L9VA 3QOPA 4QTRA 1D1BA 2HEOA 1ZG5A 3CCRI 5EG0B 2ZXHA 5D5VB 1JUMA 2I5UA 1TWAJ 2KQRA 9ANTA 2K9NA 4RS8A 3WTXC 3EYYA 2GA1A 5DYMA 3FXQA 1XGOA 2D1HA 4OOIA 1WRJA 4LG3A 4LLGF 4P5OA 2V9VA 1EH6A 1IN5A 3BWGA 1X1DA 2EZKA 2XRNA 4PFPA 4DQ2A 1FYLA 3ZQGA 1ETXA 5HS7A 1Y1WJ 4OINF 5L3FA 5BQTA 4GO1A 1ZREA 4M3FA 5CQEA 4RAGA 4XKWA 3TW7A 4WX9A 4BKXA 4HF2A 2OU2A 2HVQA 4AD9A 2OZ6A 3K70D 4IOCF 5EG0A 1ZGWA 1BOAA 3GBGA 3VYRB 3I3LA 1HKSA 4G94A 3DPUA 3DXJF 3OYMA 2RV8A 1D8KA 2FXAA 3H92A 2KDZA 3WTTC 1DP3A 3J80K 2DJIA 3TOAA 2CS3A 4JBAA 5BNGA 3CO7C 1IDZA 5E8GA 3DV8A 4FE4A 3U9GA 1LVKA 1HC8A 4HG2A 3KP3A 3B6AA 4RBOA 3K6GA 5A2QZ 1TNTA 1KU9A 1QZZA 2E71A 3DU5A 1Z9CA 4HNVA 4GFBA 2MGQA 4HSRA 4ZYDA 3FXUA 4D5CA 3M4OJ 3FXJA 4M74A 1I50J 4M9SA 4MEYF 3GFLA 2GM4A 2XVCA 2LFBA 1K4TA 2CYYA 2OUMA 2QF7A 3I4NJ 3SFZA 4BACA 1VQPI 2QEXI 1B9NA 2DFIA 5HLGA 2RNJA 3OOPA 3VOEA 4GGGA 1B59A 2M45A 5DD4A 3VPRA 1W36D 3DCFA 2VE9A 1T33A 1TWGJ 2HWVA 1I1SA 2F5CA 1VQMI 3ROUA 1O4XA 4DYCA 4LK0F 5EGOB 1QZYA 3CCYA 4AC0A 1XSVA 4OMYA 3F8MA 1E2XA 2W84A 1KGSA 3UR3C 1IDYA 1MKMA 1GVJA 3HB9A 3L2VA 4E7LA 4IRIA 1D3YA 2K7LA 4BUPA 1TW3A 3EUHC 3H9QA 2X48A 4KIFA 2J5OA 2P6SA 4XRMA 3DTEA 4X0GA 5HNHA 3S1NJ 3MKLA 1VF9A 2R5YB 3FXKA 2QWWA 1W7PD 4I01A 3KP4A 1H88C 2HR3A 3FXRA 4BY1J 2R7OA 2HDCA 1YG2A 2LP0A 1WJEA 3CLQA 4FCYA 4OAYA 3SFIA 3GFIA 3OOUA 3TP3A 3OS0A 5IOZA 1S5LC 3V7SA 5EGOA 4CICA 2FF4A 1TLHB 3V8LA 3QP6A 4Y15A 3CDHA 5E1WA 1NHAA 2DT6A 2MA3A 3BCAA 3Q9SA 1SVMA 2PFBA 1MSFC 2BVLA 1SVOA 1T08B 5KVRA 3TL4X 3L2WA 4BGDA 3JR9A 2D1VA 3I55I 3QPLA 4IKFA 2P5KA 2H6CA 2HZDA 1I3QJ 3E7LA 1QU3A 2R5YA 2EFOA 2A5WA 2F4MB 4IL6C 2EV0A 4J01A 5CVUA 4L9TA 2O0YA 3WHCA 4PDKA 3RZDJ 4HOBA 2HPIA 1YHQI 2IVMA 4XLCA 1YFHA 2UXNA 2CW0F 3J81K 2DYRH 3P9KA 2YSRA 4ENNA 3C1DA 2ZO4A 3H9JA 4AUXA 3JW4A 4MQ9F 2O6GE 3LOCA 1U8RA 2CUFA 1NTCA 3FISA 1X4PA 1TWFJ 4EM1A 5EEAA 3CDIA 2OBPA 2EA2A 2P81A 4Y13A 3LSPA 4JK1X 4S0HB 2EBIA 3ABLH 5GAGJ 1JXSA 4E7ZA 1IJWC 3BJAA 4NDLA 5IY5H 4DGWB 5F1JA 2VQGA 1RR8C 3QRFF 3IAS2 3RCOA 1MNDA 5LGTA 1OYIA 1G3WA 3CQZJ 1HKTA 4ZZLA 2J5PA 4QWQA 2VN2A 1F43A 4DW6A 4XLPF 4M3GA 3JRHA 4CA0A 1HLVA 5B1BH 1WJAA 3W6KB 3WTSC 1IN6A 3LFKA 3BDDA 2VBYA 4A3BJ 3ONQA 1X3UA 1A35A 1G3TA 2KLOA 3TDZC 2H94A 4Z2YA 3F9KA 2C6YA 4HQEA 2DQLA 2QQ9A 2LOOA 1XTAA 3CO6C 2LMDA 2OF7A 3R60A 2JRTA 2K9SA 4G9YA 4L9NA 1Z67A 4RDUA 5ICGA 3RQ4A 3ZMZA 4CYDA 2HOSA 4L5JA 3ASNH 5FJ8J 2ISZA 4D5FA 5BOXA 3SEQA 1TL8A 4RB2C 4M71A 1T0FC 1ZR2A 3KYDB 4Y17A 2EFWA 2FJ1A 4UUSB 4G7HF 3TBIA 4IQJA 3O8HA 4AIJA 4Q48A 4BXFA 2HI3A 4C2MJ 1LFPA 2HNHA 1SFEA 2V1XA 2Y9ZA 3JREA 1VQ5I 5BPDA 1BIAA 3F21A 2F48A 2RQPA 4ZYHA 4U0WA 4RGRA 1V55H 1LEAA 3BG3A 3HIFA 3MVPA 1QRYA 1N25A 3G4SI 1I27A 3BPXA 1S9HA 2P4WA 3HRMA 5FLXZ 2D45A 3PNYA 1ZN2A 3WU2C 3HBLA 3C3WA 4UUTA 2X6OA 3VEPA 3JRIA 2WY7Q 4RB1A 2E60A 3HUGB 1DU0A 2E2HJ 1QVTA 1OMIA 1AOYA 1ETWA 1G4DA 1GXQA 4OIOF 4ZDOA 3BG9A 1ZG1A 4GYGA 4BQNA 4S05A 5D5XB 2Q0OA 2VXZA 3BR6A 4UUSA 1X2MA 3VYSB 2ZXWH 1NG6A 4AIKA 2M5WA 2DA2A 3OYBA 2MD0A 2WY8Q 1FLIA 3K2AA 1WJ5A 1SFXA 1WVRA 4HNTA 2JUCA 2PBIA 2DMTA 2V1UA 2ZB9A 2WA0A 3BCBA 5FGMA 1OJLA 3M07A 4I7HA 2FSWA 3DEWA 5TISC 1IV6A 2ADUA 4IQ4A 2LK2A 3VYUB 1S72I 3MMYB 1WJCA 2NVXJ 2VC0A 3M8FA 2UZKA 2JPBA 1GHCA 1RPWA 3A0HC 1OYWA 2LTPA 3HUGA 3K4MA 3I54A 3LWFA 1TWCJ 4LITA 2RN7A 2IA2A 4EJOA 2M30A 3FKIJ 2Q1ZB 3G1OA 2HDWA 2LY2A 1S7AA 1FBSA 2XUBA 1X1CA 1G3YA 1ZKGA 3AL0B 1P9QC 3ECOA 1O3TA 3S1MJ 1WSUA 1YW8A 2F2EA 2VC1A 2TRTA 5HNFA 1V4RA 2A5YB 1MW7A 3GTOJ 4U87A 1FBQA 2BY0A 3QAHA 3OYDA 4U0VA 2L7KA 2X51A 2CGPA 5LEJA 3J7ZI 2DA1A 1Z6TA 1N78A 2PLYA 3H5NA 1IN4A 3HOUJ 3L2QA 2R5ZB 1Y0NA 4QSHA 4NHJA 4R8HA 2JK3A 4P96A 4L5EA 1T39A 1UJ8A 1G6NA 2CQXA 2NOGA 3E5UA 4RGXA 3HOZJ 3BG6A 4CXFA 4M3EA 2CQ7A 5FKOA 4HYEA 2QBYB 2ZSIB 2JN6A 2MLGA 1WPKA 3JRDA 3RPUA 1ZRFA 1ZLKA 4PSXA 4XRSG 3ZXSA 1RETA 4LB6B 4EMSA 3AKZA 4A69C 2P7VB 2DTZA 4MO7A 1MNMC 2A05A 2JTVA 2VT3A 4AWXB 2EZIA 4XNFA 1TNSA 3S16J 2UXXA 1F5TA 2EB7A 2STTA 4E70A 2ACJA 2Y0SN 2L01A 2V1DA 2R5ZA 3BR2A 1D1AA 1ODDA 5HOOA 2A61A 1YLFA 2WAQN 4D0PA 3F6OA 4HRIA 3PO2J 2XKOA 1KYWA 5E1XA 2L7MP 1TQMA 1OCZH 2QBYA 2QSFX 3CP8A 1UG0A 3E3VA 4UUVA 2BGCA 3ERED 4V2FA 1UAAA 2EFPA 1RESA 2PI0A 1LDDA 4KUMA 4F92B 4KFCA 2XAHA 3MAJA 2MLKA 5DCMB 3JRFA 4EGYA 1VQ4I 3KLNA 1XDUA 3RYRA 2IS6A 2BBYA 3ABTA 3K4BA 3ZQLA 1GV5A 1TBXA 2KIUA 3F72A 3I64A 5JLXA 4A0ZA 5EJCA 4R79A 3S3OA 1VQ8I 1A31A 1KQ0A 1USSA 3ERMA 2L0KA 1IW7F 2OTLI 3BR5A 3WTUC 4M3BA 1P4WA 5K5QA 4MQVA 4ZYGA 1R23A 3OYCA 2R7DA 2W4SA 4CCMA 1APLC 4ZDPA 2M0CA 1S6LA 2DOEA 4S04A 4G6TB 2M34A 1Q1HA 1ETKA 4CZCA 1LNWA 2LY1A 5JVTA 3KETA 5B66C 4PSWA 3MWMA 1EV7A 2XAJA 4KICA 2OA4A 2H8WA 3ZQHA 4OIPF 3GTQJ 1ENHA 3A2KA 5DCMA 2VASA 3HOVJ 1ETVA 3QQAA 4WK8F 3IUOA 1LFUP 2XPWA 3ABUA 1D0XA 4C2TA 5HVQC 1VNDA 2OJED 4CUGA 1XX5A 4EEFG 1XGNA 1VZ0A 3ULQB 6PAXA 4HAMA 4IHYA 2ZJPF 5FD6A 1Z3YA 3AFHA 3TMOA 3ZQCA 2EV5A 1P7IA 4PJLA 4U7DA 1P92A 2LG4A 4MFEA 1IRXA 1BJAA 1SANA 5IYBJ 1LE8B 3W2VA 1Z21A 2EK5A 4IXAA 4FE7A 3KPHA 2EH3A 3L09A 3SHFA 5B1AH 5F0HA 5LGNA 2KKOA 3I59B 3M9AA 1IN7A 4CH7A 4LFUA 2CFOA 1IG7A 2L02A 3GXOA 3OL3A 4OU0A 5K7ZA 5GP9A 3GTLJ 1DQUA 2DXIA 4KT6A 5HDKA 2XPVA 4JP0A 5E3NA 1WKMA 2VQLA 3DFGA 1TC3C 4WF2A 5GTHC 2E7WA 2QZ8A 4KIGA 2DOFA 3AG4H 4OIQF 2CO5A 3K4CA 3CUQC 1E3OC 2RQQA 2NYXA 5LD2C 2DFFA 2GBYA 2NS8A 1WI3A 1RIOH 4EATA 2O9LA 3ABMH 1HOMA 2D5VA 3TO9A 5HLIA 4YIRX 1LE8A 2LY9A 2XSJC 3I53A 4FQGA 4Q5SF 4XICA 2BHZA 1XS9A 3F3XA 3GZ6A 2L2OA 3HOSA 1X58A 2YX4A 3T8TA 1V3FA 5IT9K 2ZNZA 1YS7A 1ZAOA 3OYEA 2L7FP 1WJBA 2KIFA 1T56A 4F91B 3H5RA 4I6ZA 3LAJA 3TQNA 4I76A 4E7SA 1EJ9A 4U88A 1B6AA 3K4NA 1U5TB 1W5TA 2IP2A 2P5LC 2VQCA 3SZTA 3ECHA 3AL0C 4IHWA 1QQIA 1SC7A 3QODA 2IA0A 3LL7A 2FQ4A 2VJ4A 5TGTA 2Y0MA 2KP6A 1E3PA 5LHGA 2F5EA 1Z91A 3FBNB 4UB6C 5D6EA 5K5RA 1P4XA 3WGGA 4ESFA 1QBJA 3IWZA 4B48A 3FK6A 1FIAA 2CSOA 2HXOA 1DGRM 1HKQA 2ECBA 2HYJA 1BIBA 1JUPA 3BG7A 2IA1A 3HRUA 3IH2A 1FP1D 1FOXA 2Y75A 2WBMA 3MN2A 5E8IA 2G7HA 5FLMJ 4IX7A 2VJJA 1RI7A 1RNLA 2DAOA 3BOQA 1JHHA 5DM6F 4IO9F 1ERDA 3DTIA 1MBEA 4LIUA 2Z3YA 2XF7A 2COMA 1U5TA 4HX8A 3COAC 3E0JB 3BZ6A 3QP5A 1S3JA 1IN8A 4XM3A 5K1YA 1ULYA 3WG7H 3O6BB 3BR1A 1W0UA 3UNGC 4D1QA 3WHBA 5KHDA 3WTVC 2E19A 3T5XA 1LFBA 2K4BA 1OCTC 4M9ZA 2O03A 3KP6A 4BJ6C 1ACIA 5JVGF 4LJZF 1IXRC 5CVVA 4N0BA 2RREA 2LF7A 3LSMA 2KJBA 2M87A 4XR6A 5E20A 3GLXA 4XLFA 3WGHA 1V5GA 4EQQA 1H9TA 3PIOF 2E1CA 2BV6A 1BN5A 3MKYB 3HTUA 4ZZDA 4BEHB 3WE2A 2E2IJ 2AXLA 5E1ZB 2M7BA 2BXZA 2CU7A 4BU2A 3L2RA 4X1EA 4CYCB 1BBYA 5FFZA 3PQKA 2OC6A 3HRTA 4BHCA 3HTSB 4DJAA 2F4OB 1B1BA 1JT6A 2JSCA 3S3NA 4E7KA 2R92J 2CJJA 4OWRB 2GQQA 3R0AA 4CO8A 3BQYA 5FKMA 3ZMUA 3IKVA 4A12A 3CESA 5D4SA 1BI0A 5TJJA 2JWTA 3KEYA 3KFWX 1PUFB 1UHSA 4I09A 2X4HA 4B43A 2ESNA 2VT2A 2DYSH 3F0CA 4WXHA 3L9FA 3CP2A 2XPUA 2V9PA 3R4KA 5J6XA 3LSTA 4RAZA 3JRGA 4BEHA 1F9NA 2M9HA 4CHUA 3QYEA 4CYCA 2OD5A 1UG2A 4BDYA 1LJ9A 4ZJZA 3VSKA 3GVAA 3RPQA 4PJNA 1FMVA 2LNBA 2YU9J 4EM2A 2CW8A 4A6EA 1FEXA 3K4LA 2EILH 5AIPA 1X1BA 1BI1A 3DQVC 1T98A 3HOTA 4KISA 3I58A 2AHQA 5JHFA 1K79A 3CCUI 3ZMTA 2W57A 1PUFA 4HDVA 2Q8KA 3JRBA 4IRGA 2KFDA 1RUNA 4HLXA 4XSZF 1JKQC 1MH4A 3OSFA 2LH9A 2HKXA 3QPSA 2WV1A 3GFJA 2LDUA 3K10A 4P1WA 4QPOA 1NG7A 4ABZA 5BMZA 4AIDA 2R93J 3K0LA 1FTTA 1PP7U 4YFXF 2P5VA 3M8JA 3M8EA 1BC7C 3ZP5A 1HDPA 4HZFA 3K1MA 2KHMA 2B0LA 3PQJA 4ENMA 3G71I 1OQYA 3LSJA 3H3UA 5M3FJ 1Y6IA 1BI3A 2KRFA 1U3EM 4CCOA 1OCRH 1H89C 1GXPA 3LNQA 2WWYA 3C2GA 3S2WA 1Y39A 2EZHA 1QPIA 1A5JA 2FBHA 4IHTA 4PK4A 4A3FJ 4IEJA 3A03A 1IXSB 4FTHA 2HDDA 1ZHFA 4KNYA 4ZC3A 3RIRA 3TOBA 3JAMZ 3CMMA 3L00A 4RLQA 3K4JA 4J19A 3FHNA 1E0EA 2FMYA 1U6GA 4IJAA 3GTMJ 4C2UA 4DZJA 1J5YA 4JX5A 1ZQ3P 1VQOI 1M1EB 3OYFA 1JGSA 2FNPA 3BTIA 4UV8A 4XN3A 2HVSA 2IGKA 4IF4A 1MJAA 5KAFC 2VXDA 1AWCA 3OR1C 5FO5A 4AU7A 5M5YJ 5DCFA 5J40A 2CV0A 3LAPA 2MFZA 5M5XJ 3WU1B 2XF5A 1VQ6I 4A3CJ 1N75A 2CMPA 2E1MB 1S29A 2CQNA 2XAUA 1T2KA 2BEOA 1LPQA 2PJRB 4PUSA 1RRJA 4EM0B 2LKPA 3V42A 2DOAA 2MD5A 5E3LA 3FM3A 2JA5J 3F6VA 4LIVA 2DU9A 3M3YJ 1WFXA 4WXDA 2QYOA 2VIXA 1F1ZA 4XK4A 1Z0XA 1QHHD 5ICEA 1IRFA 5EYRA 4RGUA 2CFXA 3DPLC 2DQRA 3CJRB 5HDNA 1HBXG 2MC3A 1JT0A 3WTYC 1BW5A 3AG2H 2WB1N 4XLHA 1LDKB 1MD0A 2FQ3A 2EIMH 3MQ0A 3BJOA 1YO5C 4PCQA 4HX7A 2LRDA 2ZFUA 3RPUD 2QA4I 1RC9A 2RC4A 2OAZA 4RM3A 1A6IA 4IZZA 2HQNA 2W00A 1X1PA 1FJLA 2CWEA 2VBWA 1ZLJA 4EJVA 2FUG2 2CW7A 3R0JA 1B72B 1O7FA 1RZ4A 1WZ2A 2ME6A 1BI2A 1J75A 1GVDA 3H9GA 3VWBA 3E6MA 5CVRA 1BR2A 3NARA 1XD7A 2Z1DA 4YELA 4A3GJ 2HOAA 2ZJ2A 1G2HA 1RKWA 3ZN1A 1JKOC 5C4XJ 2WTEA 5E3MA 2DI3A 3OYJA 2WB1A 4N9HA 2GXBA 4BJ5C 5HLHA 3ZN0A 2OPTA 1UCRA 5L3EA 3GLLA 1UELB 3W2AA 2Z99A 3SQNA 4Y33A 1RKTA 3DTKA 2HVRA 3SJMA 3BZCA 1B72A 1B8IB 2DBBA 1Y0UA 2K3PA 5DEQA 3D1NI 2X6YA 3G73A 5F6FA 2AQEA 1BW6A 2ZKZA 4ITVA 4M72A 5C3EJ 1K78B 1VQ7I 2R7ZJ 3U2RA 4DIQA 2R7SA 1S7EA 2HFHA 3ZOBA 3QYFA 2PMZN 3FDYA 2VJ5A 4I99C 4JX4A 3WODF 3OYKA 3VFZA 4MHGA 3PO3J 1ETOA 1XDSA 2M8EA 3AAFA 3OL4A 1R1UA 3V7RA 4DBQA 1NK2P 4HSTA 4KDPA 2BE5F 5DD8A 3BJ6A 3O8GA 1YW7A 3S2DJ 1L0OC 4BH9A 1MBFA 4I0AA 4H0EA 2LYCA 1QA6A 4PJMA 1JKPC 2DT7B 5F64A 1XSDA 2ZMEB 4BS9A 3P9IA 1KU7A 4FETA 3SXYA 1B8IA 1QO0D 2JA8J 4ZH4F 4C3IJ 1XN7A 5F27A 3LSIA 1K78A 3DLLF 3S3MA 4OMZA 4AVPA 5D5WB 5GPCA 5L3BA 3S8PA 4F93B 4X6AJ 2Y48A 2PMZA 1MH3A 5HS8A 2W82A 5J4YA 4M6VA 4A3LJ 2M0MA 1YI2I 4JQFA 2EIJH 4BBRJ 4LG0B 3HGYA 1LUJB 2CUEA 2L4MA 2AXTC 3CJNA 4LLLA 1QHGA 2P8TA 1FP2A 2CQQA 3DEEA 2KJCA 4YIIA 1J09A 5KCMA 1FY7A 2ZBKA 2KIMA 1W7PB 3AG3H 1KZHA 3C2BA 2HU9A 1O7LA 2XGEA 2ZMEA 3X2QH 1YX3A 4KMFA 1YS6A 1MMSA 3RYPA 2NVQJ 1STZA 2BVMA 2DDAA 5ILVA 3OWTA 4KN4X 4MFDA 1WQ2A 5F0FA 4XQFA 4XORA 3J7AY 3RSNA 3F8CA 3OYGA 4D7MA 2DA5A 4YFNF 4XIDA 2XSDC 1WH5A 4V19K 3KIOA 4LG0A 1ZR4A 1MNEA 4XLEA 5IPAA 3BC8A 3EUAA 3B6CA 3DKWA 3D5RC 1TWHJ 3K1NA 1CQTA 3V8KA 1K7AA 1YX5A 2HZTA 2GXGA 3OYIA 2ESHA 2CQKA 1AU7A 2KISA 3HL2A 1R4NB 3DP7A 2H1KA 1SFUA 1T95A 2JRMA 1W7PA 2JA6J 4G7OF 2HXIA 1O57A 3G1MA 5K5OA 1HSTA 4IPAA 1FWZA 3FXLA 1G3SA 1JJ8C 2DPDA 2I8DA 3OYLA 1FTZA 3J80Z 1HXDA 2K4JA 3ABKH 3E6BA 1RR7A 2NVTJ 2DTRA 5C44J 3PJRA 3BLYA 1R1TA 2LF8A 2V26A 2VUMJ 2WV0A 2IW5A 2X0LA 4UHTA 4IHVA 4XLNF 5F0CA 3OIPA 2NAZA 5JI6A 2M4GA 4KN7X 2BHYA 3IWFA 4IHSA 5FD5A 1S7OA 3S17J 3PSFA 1K6OA 1ZRCA 1NH3A 4BE0A 5ERIA 4B3AA 4RAFA 3RDIA 5CLSA 2O5RA 3P9CA 1XSXA 2W25A 2X6XA 2K02A 4TV7A 3E6CC 2O8KA 1P4AA 3KCCA 3M7GA 5CYVA 2NNYA 2HQ5A 2PJPA 3MZHA 5CVJA 2RNGA 1BL0A 4EV0A 1HW2A 1WGXA 3R6SA 2QGUA 1FIPA 3CZ6A 5L3CA 3HGGA 3JTGA 2HOTA 2GLOA 3RJPA 3WTWC 2BY1A 2OCEA 3K2ZA 5HODA 1F4KA 2KRHA 2QLZA 1OCPA 3JTHA 4UV9A 2BW3B 3I4MJ 4HW0A 4YIFA 2OQRA 2K5CA 4KYWA 4AVZA 1R00A 4BHPA 2G0EA 1BJZA 3MCZA 1S8NA 5EZGA 2F5VA 1GT0C 5D4RA 5A2QK 1TQPA 3H0GJ 4XOTA 3ZMDA 4RA2A 2IEKA 5CQGA 2K85A 3G6EI 1PUEE 5H6RA 4RB3C 2Y31A 3NRVA 4A2UA 3BY6A 2Y0SA 3MZ8A 5J1UA 3BG5A 2EWNA 3W2WA 2DN0A 4F55A 2QKLB 3L2UA 1ZG3A 3K1PA 5ED4A 2K9MA 3H35A 3RQIA 1J7KA 2L3DA 2VJIA 2WAQA 3KP7A 1Y1VJ 3VYTB 2BW3A 1HA8A 3GW2A 4FASD 3CCJI 1OCOH 3LA2A 1WH7A 3DF8A 2OTJI 3FBIB 1SAXA 3ELKA 2ETHA 2UV1A 4J00A 3O3KA 1I6HJ 1H0MA 3O2PE 3S32A 4ESBA 1VQ9I 2IS2A 4ANJA 1U9OA 2QQ8A 2Z16A 3G3ZA 2LVSA 1P2FA 2NNNA 3F8FA 4ZYAA 1Y8RB 3TP0A 2XB0X 2JA2A 1HQCA 5J3LA 1YE9A 1FSEA 5E3OA 2EFQA 4M9XA 1U78A 3NQOA 2FOWA 5FFXA 1FOWA 3GMEA 2KT0A 2N8GA 3FXOA 5LEKA 3VB2A 2CV2A 2O8XA 2ZJQF 2X9DA 2F5FA 1YTYA 3J81Z 4XKBA 2XB5A 4W97A 4IOAF 3P7NA 2Z9OA 1VFCA 1WJFA 4G7ZF 2HS5A 5EZHA 2CH0A 1QNTA 1MJBA 2FMLA 1MSEC 1GLNA 3PNTA 2ZC2A 1U2WA 1V5FA 3OIOA 2R7XA 2FNAA 1L3LA 2QSHX 1LDJA 2LLKA 1R7JA 1BR1A 1X2NA 5DS9A 5LRSA 1Z6RA 2PMUA 2XC7A 3J7AO 1UMQA 2FOKA 1W0TA 1OYYA 2XAFA 4M3DA 5H6QA 3V7CA 3FMSA 5ICFA 2BY3A 1J2XA 1FMWA 1A6QA 4NC6A 3HEFA 2VKDA 3I4PA 3QPTA 3CF5F 2A6EF 3CCQI 1MDMB 3F8BA 1KYZA 5LHHA 2LBFB 3WE3A 2HQAA 4HV5A 1SVLA 4ENJA 1K4SA 2A6HF 5EF6A 3I59A 3OY9A 4XONA 2NS0A 2Y9YA 1FBUA 4BXUA 5FKNA 4E7HA 4P9UA 1Y56A 3EQLF 4XKCA 3QOEA 1IF1A 4BAYA 2E35A 1I39A 3CCMI 4L0YB 4JYKA 3MEXA 4OAZA 3ASOH 4RGSA 3TO6A 1D5YA 3BQZA 2IT0A 4YRVA 5DV5A 1MZBA 3ESWB 2TCTA 2JZYA 3CTAA 3N4MA 3MD2A 3HXLA 2ZFWA 1PYVA 3GTJJ 4F52A 3HOYJ 2M4KA 2W24A 2V79A 1FZPB 1JI8A 1MDMA 5IT3A 1ON2A 2LBFA 4XN0A 5B3SH 2EINH 1QPMA 2VODA 1XMKA 1TZLA 3MKWB 4EGZA 3E97A 5EEHA 3IKTA 3IAM2 5FKKA 2GIZA 2P6TA 3Q5FA 3KZIC 3DWLE 3FMQA 3ZCOA 1MBHA 2DDBA 1MMGA 3IH3A 4A3KJ 2MBFA 1T6SA 3G2BA 2ECCA 4XRSA 5GTIC 3FIWA 3BTCA 2LKSA 5M3MJ 2HYFA 1WHUA 3I56I 3LSGA 1X3ZB 3TW6A 2KIQA 2YR2A 2MH2A 4C9YA 1AA7A 2VOOA 4E7JA 5LFAA 3LA7A 2A68F 1LB2A 2P7CB 3CMEI 2XHKA 4FX0A 4XL9A 3UKGA 4BBSJ 3LQQA 1Z1DA 2CG4A 2QM3A 3GUDA 1XG1A 5EDNA 1IXCA 2PMHA 3DLAA 2MYSA 4F3QA 3HOWJ 3I0TA 2B9SA 4L18B 2DFHA 1G59A 1D0YA 2QVOA 1R1VA 3A01B 1JHFA 1SD4A 2VI6A 2IRFG 2R7FA 3Q3SA 2LSOA 2XGCA 1FC3A 5J8FA 3H3VK 2IAIA 2LD5A 1DGWY 2E5NA 3SYTA 2CRGA 1R5HA 1HF0A 1UFMA 1P6RA 2PG4A 1D8JA 2HTJA 3B73A 3QPHA 3S2HJ 1XC5A 5FLXK 2FBIA 1VI0A 2G7UA 3U1KA 3FK7A 2PEXA 5KAIC 1IRGA 1O3QA 5KNLA 2VKEA 4N4OB 5CVIA 5L3DA 2O61A 3DBLB 5IP9J 3W6VA 2ELJA 4Q47A 1HW5A 3KEOA 2TDXA 4FT8A 2XDVA 3W3CA 2ZJRF 4BNCA 3A01A 5F04A 5J1RA 1SFOJ 1G8XA 3S1RJ 4NUBA 2YUSA 2VBZA 1ZH5A 4GCVA 3CD6I 3BPVA 3BR0A 4MIMA 3KEQA 1DUXC 2O3FA 2VKHA 1TQIA 2DMNA 4A5NA 5GAEJ 5L3GA 1Z77A 2LC2A 2FA5A 4W1UA 5J8CA 4KITB 2VONA 1SFKA 3ZRGA 2XROA 4O5VA 4ESJA 1FSHA 1YJNI 1FNNA 4CCLA 1EH7A 3I71A 4CCNA 4PGHA 5LGUA 3RKXA 3ZGKA 1FX7A 1KQ9A 4KMUX 1Z05A 3FZVA 2GAUA 2Z5UA 1RUOA 4G8XA 1VQNI 3LQRA 3QU6A 2DW4A 1R58A 3HRSA 2ZXJA 2K9QA 2R7QA 2DA6A 3LSKA 3K4KA 1ZK8A 4RMNA 1ZRDA 2NVYJ 3SZPA 2K40A 4PZJA 2COBA 3NWSA 2H6BA 4NBQA 3SDGA 2IPQX 3W6JB 1OISA 2IGNA 2MW8A 4RB0A 2QUFA 2WC2A 4YFKF 4UXNA 2IXSA 4ASNA 4PJJA 3CCSI 2X1CA 2AQFA 4AIHA 5K7FA 2WAFA 1ETQA 3GCMA 3BP8A 4HEA2 3M1CA 2ZCWA 4KJZA 5M5WJ 1R71A 4II3A 5CJ9A 2L9NA 4FX4A 2K3FA 2EPFA 1O3SA 1WWXA 2QCOA 5D6FA 4EJUA 5LBQA 4XRFA 3EUKL 4HQMA 2H27A 2H1LA 2B63J 2B7EA 1T0FA 3HPHA 5F1RA 1FOYA 3KP5A 1Y8QB 2X6WA 3KYCB 4IRHA 4KT5C 2R7WA 4BE1A 2EFNA 4BY7J 3PM1A 3TKYA 2XF6A 4IVNA 3OYNA 3LSHA 1OPCA 2LREA 1K83J 2ME0A 4ON0A 2FE3A 2NVUB 3Q0UA 5BS6A 4BXXJ 1K6YA 4MLOA 1GDTA 1Z7UA 1A04A 4JOMA 4B3XA 4BDZA 3J7YJ 2XIGA 4LGWA 2KMUA 3HOXJ 4G12A 5J47A 4PJ0C 5D8KB 5ICCA 3OS2A 1ZYRF 3CC2I 4IHXA 1W4MA 3IH4A 3V8JA 3VODA 1I1GA 3U21A 1JGGA 1SMYF 3HSFA 2L5QA 3MKZA 3FM5A 3IL2A 1OKRA 5LHIA 2A07F 3E6DA 1ZELA 1U5TC 2MABA 3CF2A 1YRNB 4KA4A 3GZ5A 2JSPA 2IJLA 2MG4A 2VPRA 3GWZA 3ZQFA 3OV8A 4YEJA 2ZSHB 1UHMA 5GPAA 4O3MA 3OMYA 2JVHA 2XGXA 3PFIA 1PDNC 4MTEA 4HBLA 3T1BA 1XPXA 3IV5A 3H36A 2Y2ZA 1PVEA 4A3IJ 2OZUA 2D2WA 1IAWA 2L54A 1EKEA 4L9JA 3TO7A 4LLNA 2Q2EB 3OYAA 4ZTJA 2BOLA 4HF0A 1FYMA 2XKPA 2YPRA 3B02A 4PGGA 1V5EA 5DDGA 3A1YA 3HSRA 3ZMSA 4BYYA 4BL0B 4BHBA 2FEZA 2M2EA 2H8RA 2UWMA 3NWTA 2DODA 3RI4A 4HPQA 4O6JA 3PFYA 4A6DA 2E2JJ 4C3JJ 1YRNA 3RTRA 3C18A 3CCEI 3S93A 2RVCA 2QENA 5AIQA 3CJTB 5DUIA 1IGNA 1D0ZA 4XBFA 4M6YA 5LLQA 1MIJA 4AYBN 2PJRA 2OQGA 3HG9A 1T38A 2Q2EA 2W85A 3OIQA 3E5XA 3A02A 4G6QA 2XAGA 3ISPA 3N05A 3KE2A 1QGPA 1TT5B 1JJ6C 2K86A 2FBKA 4EJWA 3IP4B 4BQAA 1ZTRA 1SD5A 4A93J 3HHHA 3LFUA 1GUUA 4DYRA 1R49A 2AS5F 5H2FC 4D9JA 4LB5A 4QPQA 1Z7LA 5IT9Z 3VDXA 1X1AA 4I98B 3FF5A 1AKHB 1JTYA 5GAHJ 3D0SA 5FLVA 2ICWG 1FT9A 1YQAA 1T8IA 5E18F 4AYBA 2GZWA 3ZMVA 3OS1A 4M73A 3NEUA 1BA5A 2BY2A 2M3AA 3WG9A 4QLCU 4DZPA 2Y30A 1I6XA 2RAEA 2KPMA 4H4KC 4DYQA 1R9TJ 1POGA 5DM7F 4FISA 2XAQA 3DKYA 1DPUA 2RGVA 2H09A 2EIKH 1YJ9I 1TTYA 1GV2A 1MMNA 3K69A 3EDPA 3VSLA 2GA2A 1R4MB 1BR4A 3BT9A 3TEDA 2DK5A 3JCUC 3N97A 3GTPJ 1USTA 2YS9A 2Z33A 4ZTFA 1UZCA 3E5QA 1TT0A 1AKHA 2BXYA 3MFKA 2NOJB 3M1EA 4B1RA 2HYGD 3OR2C 2QSGX 3ZQ7A 4LMYA 3ZR8X 4DBRA 1REPC 3KZZA 5FRMA 1J9IA 3OYHA 1V54H 1VTNC 1ON1A 2VE8A 5CKTA 2MC4A 2DCEA 1CF7B 5E79C 1XCVA 1OR7A 3K9TA 4GYIA 2NXNB 1CGPA 4ZYEA 2R7TA 3JSOA 2QQBA 4I2OA 2QQAA 1KONA 3H0DA 1BC8C 3QWLA 4R1HA 1SD6A 3GTGJ 2FRHA 2MSYA 3FHZA 3RKWA 2V6CA 4M6XA 5IP6A 1KU3A 1YITI 4CSWA 4FHTA 2XASA 2A69F 1XMAA 2GIVA 1ITYA 1J0RA 5B5EC 1OFCX 5JFRA 2GOMA 2E7XA 1YYVA 2E1OA 2OV7A 4NC7A 4Y52J 4DNCA 3SEZA 1CF7A 4NQWB 1MBGA 3PIPF 3CMYA 4ENKA 2CUJA 3EPZA 2L9RA 2YX7A 4YG2F 2ID6A 1FYKA 3PSIA 3LMMA 4A0YA 4GDFA 4LK1F 1SEUA 3CUQB 1N77A 1A36A 1DPRA 1K61A 1NK3P 1PJRA 1IZ1A 3RKYA 1ONVA 4NB5A 4UY8I 4UB8C 1JKRC 1R36A 1X19A 3IRRA 3CC7I 2F5DA 4N9IA 3JRAA 2RKHA 2V4JC 3GO5A 1KU2A 5KK1A 3FXMA 2FX0A 2IBDA 2W48A 1QVUA 3HKZN 1J59A 3Q0VA 4A3MJ 4HA8A 1ZGAA 1FOKA 3H3ZA 3QYBA 3T0YA 2VB6A 4NQWA 2DK8A 5FRNA 2I10A 2KZGA 3C2HA 3DBRB 2PX9A 2Z2SB 2VBXA 2V7FA 2DJNA 3CUQA 3WU0A 2JA7J 1HCRA 4OIRF 1F36A 3CCVI 2ID3A 5D8LB 1EF4A 1EA3A 1JUSA 1MJ9A 1I3AA 2JQ7A 2E1MC 3JSPA 3DEUA 1WJDA 4NC8A 2L7ZA 2PQ8A 3T8RA 5DTDA 2IGOA 4XOPA 4L9VA 3H5AA 1YJWI 1DDNA 5FKLA 2FU4A 1U9NA 3EETA 1PP8F 3HKZA 3F8NA 4UVCA 4E4HA 1OCCH 4LOCA 4HV6A 1LVAA 3KYLA 2L9SA 2RDPA 1SAUA 1O3RA 1OLTA 1HW1A 3A4CA 3CMAI 1KA8A 3LA3A 1DP7P 3NAUA 1IV8A 3HYIA 2M1BA 3CJQB 3C7JA 3I9V2 3D5LA 1Q1VA 1BOBA 3LSRA 3BTJA 4MTDA 1EH8A 2DLLA 4I02A 2DA7A 4PFOA 3AG1H 2QKMB 4C3HJ 1LEBA 2HGCA 2JUGA 2WADA 2AO9A 4L0ZB 3H1CA 5HDGA 4XKVA 3SDBA 3HC7A 2KRCA 4I0BA 3ML6A 5HS9A 1SD7A 3HM5A 5F08A 4A5MA 3K70C 4L5IA 4UVBA 3CLOA 3HZJA 4MEXF 2F6CA 4UNOA 1E17A 1X3WB 2DA3A 2VKVA 3PUFA 2DO7A 1R22A 2BYVE 2R7UA 4MNUA 4RAYA 3L1PA 1ETYA 3A0BC 1W1WE 2DFEA 4P55A 2CV1A 1LQ1A 3REOA 1C0WA 3HPGA 3DPTA 1UB9A 4BE2A 3FWEA 1VQLI 5AONA 3GX4X 4C30A 2XV4S 2EJRA 4EJTA 4A3DJ 3GF2A 1MMDA 5TRDA 2EZLA 3PNVA 2F4IA 1MBKA 4NNJA 2UUZA 4Y7NJ 1XGMA 2EA4A 5K7HA 4A0XA 4AM3A 4B4CA 1OR7C 5IYDJ 1DU6A 4Q4ZF 3WTZA 5D5UB 3IRQA 1MMAA 2R7VA 4RM2A 3JAMK 3E1SA 1XB4A 4B44A 2KZVA 3OSGA 1XCBA 5BPIA 5IP7J 3BR3A 3HHGA 1MGTA 3HSEA 3V4GA 1R6RA 2HKOA 3S15J 1W5SA 4XLAA 4XMYA 2A6TA 3KP2A 4HX4A 2PN6A 3PL8A 3BROA 4U0YA 4BQOA 1YIJI 3G1LA 4DOZA 2ZMEC 4P9FA 4UVAA 4CDGA 2DPUA 3GZNB 1SMTA 2DMUA 2P0WA 2K9LA 1W5CC 2NS7A 1W36C 1TP4A 5J4VA 2JVGA 4Y4RA 1H8AC 1IRZA 3L2CA 4JX6A 5JR3A 2ZNYA 4HNUA 2OCCH 2JMWA 4GXOA 3IHUA 3ZQQA 4A3EJ 2ELHA 4RLFA 4KIBA 1B9MA 2HQRA 1R5GA 5CPRB 4BJTA 1ZGJA 2DMPA 1AHDP 4WCGA 3CCLI 3P5JA 2IS4A 2STWA 4E7IA 3ZPLA 2ZXIA 3IC7A 4HDUA 3R61A 4MGRA 2VPLA 1D5VA 1IO2A 2IGMA 1B4AA 3GTKJ 1WCMJ 4G6DA 1TW2A 2E36A 2HOEA 2HTSA 2X1EA 1KQ8A 3QU3A 3F22A 5JLWA 2HPMA 1ORKA 3CUOA 2LR8A 2M7AA 4Y3OA 2KDOA 5FB2A 3JRCA 1YIOA 1IC8A 2BZTA 3BTLA 4HLYA 4ETSA 3D5SC 2A3SA 3F23A 2IS1A 1QZEA 5J1YA 2ELKA 4F7ZA 2JPCA 2K27A 3TGNA 3CC4I 2EQRA 3S14J 5GADJ 1JE8A 2VOPA 2XGDA 2VL8A 4GRIA 4CCJA 4Z6YA 1HSJA 2Y69H 2X1DA 5DUKA 1MBJA 2WAEA 3EYIA 1LKXA 2R4GA 2R0QC 1ZARA 4XSXF 5JHUA 4WXCA 3SZGA 2JJ7A 2VQHA 3GEZA 1Z3XA 2LKXA 3BZKA 4CGZA 3K7AJ 3KZYA 1WI9A 4D7NA 4E6KG 1H9GA 5ILUA 4CCKA 3FKJA 2W1OA 3PUBA 1VQKI 3U1DA 1X4OA 1P7JA 4V2GA 1E3HA 1IUFA 2DT5A 4WWCA 4II2A 1U8BA 3HJEA 1JTXA 2JT1A 2NRAC 3L7WA 2YU3A 4N4NB 4B8XA 3EUHA 1XMXA 3CDLA 3GFMA 4ZDLA 1FPQA 3FMRA 3KX2A 5FROA 2E34A 3S1QJ 2M8GX 4K2EA 1UHWA 2L4AA 1BM9A 5H20A 3DU6A 3MZYA 5IOYA 2DMQA 2V9KA 2O7OA 2MH9A 2R3SA 4B47A 4EVIA 2CUZA 4HF1A 2E1NA 2DA4A 3ZQIA 3TDUC 3GYHX 2E5ZA 1U0JA 2W7NA 4LD5A 2V6EA 5HLTA 4B09A 2X85A 1YOVB 2GOXB 4A3JJ 2XRLA 1D1CA 1XGSA 3Q9VA 3DBHB 3WGIA
chains in the Genus database with same CATH topology
2ISYA 5E17F 3KLOA 2G9WA 1I5ZA 2EV6A 5EEGA 2GWRA 5LRRA 4U7BA 1YW9A 3FX3A 4CZZA 3I5UA 5ILSA 1IUYA 3QOPA 2HEOA 1ZG5A 5D5VB 4RS8A 3WTXC 3EYYA 2GA1A 5DYMA 3FXQA 1XGOA 2D1HA 4OOIA 1WRJA 4LLGF 4P5OA 2V9VA 1EH6A 1IN5A 3BWGA 2XRNA 4DQ2A 1FYLA 5HS7A 4OINF 5L3FA 5BQTA 4GO1A 1ZREA 4WX9A 4HF2A 2OU2A 4AD9A 2OZ6A 1BOAA 1HKSA 4G94A 3DXJF 2RV8A 1D8KA 2FXAA 3H92A 3WTTC 3J80K 3TOAA 4JBAA 3CO7C 5E8GA 3DV8A 3U9GA 3KP3A 5A2QZ 1TNTA 1KU9A 1QZZA 1Z9CA 4ZYDA 3FXUA 4M74A 4M9SA 4MEYF 3GFLA 2XVCA 2CYYA 3SFZA 1B9NA 2DFIA 5HLGA 2RNJA 3OOPA 3VOEA 4GGGA 1B59A 2M45A 5DD4A 2VE9A 2HWVA 1I1SA 2F5CA 3ROUA 4LK0F 1QZYA 1XSVA 4OMYA 3F8MA 1E2XA 2W84A 1KGSA 1MKMA 1GVJA 4IRIA 1D3YA 2K7LA 1TW3A 4KIFA 2J5OA 2P6SA 2QWWA 1W7PD 4I01A 3KP4A 2HR3A 3FXRA 2HDCA 1YG2A 3GFIA 3V7SA 4CICA 2FF4A 1TLHB 3V8LA 3QP6A 4Y15A 3CDHA 5E1WA 1NHAA 2MA3A 3Q9SA 2PFBA 5KVRA 2D1VA 2P5KA 2H6CA 2EFOA 2EV0A 5CVUA 4L9TA 2O0YA 4PDKA 4HOBA 2IVMA 1YFHA 2UXNA 2CW0F 3J81K 3P9KA 2YSRA 4ENNA 3C1DA 2ZO4A 3JW4A 4MQ9F 2O6GE 1U8RA 4EM1A 2OBPA 2EA2A 4Y13A 4JK1X 1JXSA 3BJAA 3QRFF 5LGTA 1OYIA 1G3WA 1HKTA 4ZZLA 2J5PA 4QWQA 2VN2A 4XLPF 3W6KB 3WTSC 1IN6A 3LFKA 3BDDA 2VBYA 1X3UA 1G3TA 3TDZC 2H94A 4Z2YA 2C6YA 4HQEA 2DQLA 2QQ9A 3CO6C 3R60A 2JRTA 4G9YA 4L9NA 5ICGA 3ZMZA 4CYDA 4L5JA 2ISZA 5BOXA 4RB2C 4M71A 4Y17A 2EFWA 4G7HF 4AIJA 4Q48A 1SFEA 2V1XA 5BPDA 1BIAA 3F21A 2RQPA 4ZYHA 4U0WA 4RGRA 1LEAA 3HIFA 1I27A 3BPXA 2P4WA 3HRMA 5FLXZ 2D45A 1ZN2A 3C3WA 3VEPA 4RB1A 1OMIA 1AOYA 1G4DA 1GXQA 4OIOF 1ZG1A 4GYGA 4S05A 5D5XB 2Q0OA 2VXZA 4AIKA 2M5WA 1FLIA 1SFXA 2PBIA 2V1UA 5FGMA 4I7HA 2FSWA 2ADUA 2VC0A 3M8FA 2UZKA 2JPBA 1GHCA 1OYWA 3HUGA 3I54A 3LWFA 2RN7A 2IA2A 4EJOA 2M30A 1S7AA 1FBSA 2XUBA 1G3YA 3ECOA 1O3TA 1WSUA 1YW8A 2F2EA 2VC1A 1V4RA 2A5YB 1FBQA 3QAHA 4U0VA 2CGPA 5LEJA 1Z6TA 2PLYA 1IN4A 4NHJA 4R8HA 4P96A 1T39A 1G6NA 3E5UA 4RGXA 4CXFA 4HYEA 2QBYB 2MLGA 3RPUA 1ZRFA 1ZLKA 4LB6B 4EMSA 2P7VB 2JTVA 2VT3A 4AWXB 1TNSA 2UXXA 1F5TA 2EB7A 2STTA 4E70A 2ACJA 2L01A 2V1DA 1ODDA 5HOOA 2A61A 1YLFA 4D0PA 3F6OA 2XKOA 1KYWA 5E1XA 1TQMA 2QBYA 3E3VA 4UUVA 2BGCA 3ERED 2EFPA 2PI0A 1LDDA 4KUMA 4KFCA 2XAHA 3MAJA 2MLKA 5DCMB 4EGYA 3KLNA 1XDUA 3RYRA 2BBYA 3ABTA 1TBXA 3F72A 2KIUA 3I64A 4A0ZA 4R79A 1KQ0A 1USSA 1IW7F 3WTUC 1P4WA 5K5QA 4MQVA 4ZYGA 1R23A 2R7DA 1S6LA 4S04A 1Q1HA 3KETA 1LNWA 5JVTA 3MWMA 1EV7A 2XAJA 4KICA 2OA4A 4OIPF 5DCMA 4WK8F 3ABUA 5HVQC 1XGNA 3ULQB 6PAXA 4HAMA 5FD6A 2EV5A 4U7DA 1P92A 1BJAA 2EK5A 4IXAA 3L09A 3SHFA 5LGNA 2KKOA 3I59B 3M9AA 1IN7A 4LFUA 2L02A 3GXOA 4OU0A 5HDKA 1WKMA 3DFGA 4WF2A 2E7WA 2QZ8A 4KIGA 4OIQF 2CO5A 3CUQC 2NYXA 1RIOH 3TO9A 5HLIA 3I53A 4Q5SF 3F3XA 3GZ6A 3HOSA 2YX4A 3T8TA 1V3FA 5IT9K 2ZNZA 1YS7A 1ZAOA 2KIFA 3LAJA 3TQNA 4U88A 1B6AA 1U5TB 1W5TA 2IP2A 2P5LC 3SZTA 3ECHA 1QQIA 2IA0A 2Y0MA 5LHGA 2F5EA 1Z91A 5K5RA 5D6EA 1P4XA 3WGGA 4ESFA 1QBJA 3IWZA 2CSOA 1HKQA 1BIBA 2IA1A 3HRUA 1FP1D 2Y75A 5E8IA 2G7HA 1RI7A 1RNLA 2DAOA 3BOQA 1JHHA 2Z3YA 2COMA 1U5TA 4HX8A 3COAC 3BZ6A 3QP5A 1S3JA 1IN8A 5K1YA 1ULYA 3O6BB 3WTVC 3T5XA 2K4BA 4M9ZA 2O03A 3KP6A 4LJZF 1IXRC 5CVVA 4N0BA 2LF7A 2KJBA 2M87A 5E20A 3GLXA 3WGHA 4EQQA 1H9TA 2E1CA 2BV6A 1BN5A 3HTUA 4ZZDA 3WE2A 2AXLA 5E1ZB 1BBYA 5FFZA 3PQKA 3HRTA 4BHCA 3HTSB 1B1BA 2JSCA 2GQQA 3R0AA 4CO8A 3ZMUA 3IKVA 4A12A 5D4SA 1BI0A 5TJJA 3KFWX 4I09A 2X4HA 2ESNA 2VT2A 4WXHA 3L9FA 3R4KA 5J6XA 3LSTA 4RAZA 1F9NA 4CHUA 2OD5A 1LJ9A 3GVAA 3RPQA 2LNBA 4EM2A 4A6EA 5AIPA 1BI1A 3DQVC 1T98A 3HOTA 3I58A 1K79A 3ZMTA 2W57A 4HDVA 2Q8KA 4IRGA 1RUNA 4HLXA 4XSZF 2HKXA 3GFJA 2LDUA 5BMZA 3K0LA 1PP7U 4YFXF 2P5VA 3M8EA 1BC7C 3ZP5A 4HZFA 3K1MA 2B0LA 3PQJA 4ENMA 3H3UA 1BI3A 2KRFA 1U3EM 1GXPA 2WWYA 3S2WA 2FBHA 4IHTA 1IXSB 4KNYA 1ZHFA 3RIRA 3TOBA 3JAMZ 3L00A 2FMYA 1U6GA 4IJAA 1J5YA 1JGSA 2FNPA 4UV8A 4IF4A 1MJAA 1AWCA 5FO5A 5DCFA 3LAPA 3WU1B 1S29A 1T2KA 2BEOA 4EM0B 2LKPA 2MD5A 3FM3A 3F6VA 2DU9A 4WXDA 2QYOA 1F1ZA 5ICEA 1IRFA 4RGUA 2CFXA 3DPLC 2DQRA 5HDNA 1HBXG 2MC3A 3WTYC 1LDKB 1MD0A 2FQ3A 3MQ0A 3BJOA 1YO5C 4PCQA 4HX7A 2RC4A 2OAZA 2HQNA 2CWEA 2VBWA 1ZLJA 4EJVA 3R0JA 1O7FA 1RZ4A 1BI2A 1J75A 3E6MA 5CVRA 1XD7A 2ZJ2A 3ZN1A 2WTEA 2DI3A 4N9HA 2GXBA 5HLHA 3ZN0A 1UCRA 5L3EA 2Z99A 3SQNA 2DBBA 1Y0UA 5DEQA 3G73A 5F6FA 2ZKZA 4M72A 1K78B 3U2RA 2HFHA 3WODF 3VFZA 4MHGA 1XDSA 2M8EA 3AAFA 1R1UA 3V7RA 4KDPA 2BE5F 5DD8A 3BJ6A 1YW7A 1L0OC 4BH9A 4I0AA 4H0EA 1XSDA 5F64A 2ZMEB 3P9IA 1KU7A 3SXYA 1QO0D 4ZH4F 1XN7A 1K78A 4OMZA 4AVPA 5D5WB 5L3BA 2Y48A 5HS8A 4JQFA 4LG0B 2L4MA 3CJNA 4LLLA 2P8TA 1FP2A 2KJCA 4YIIA 1FY7A 2ZBKA 2KIMA 1W7PB 2ZMEA 1O7LA 4KMFA 1YS6A 3RYPA 1STZA 5ILVA 4KN4X 1WQ2A 3F8CA 4YFNF 4LG0A 3DKWA 3K1NA 3V8KA 1K7AA 2HZTA 2GXGA 2ESHA 2CQKA 3DP7A 1SFUA 1W7PA 4G7OF 1O57A 5K5OA 1HSTA 4IPAA 1FWZA 1G3SA 2DPDA 3J80Z 1HXDA 2K4JA 3E6BA 2DTRA 1R1TA 2LF8A 2WV0A 2IW5A 2X0LA 4UHTA 4XLNF 2NAZA 5JI6A 4KN7X 3IWFA 4IHSA 5FD5A 1S7OA 1K6OA 1ZRCA 5ERIA 3RDIA 5CLSA 3P9CA 1XSXA 2W25A 2K02A 4TV7A 3E6CC 1P4AA 3KCCA 3M7GA 5CYVA 2NNYA 2PJPA 3MZHA 5CVJA 1HW2A 4EV0A 3R6SA 5L3CA 3JTGA 3RJPA 3WTWC 3K2ZA 1F4KA 2QLZA 3JTHA 4UV9A 4HW0A 4YIFA 2OQRA 4KYWA 1R00A 4BHPA 3MCZA 1S8NA 5D4RA 5A2QK 1TQPA 3ZMDA 1PUEE 5H6RA 4RB3C 3NRVA 4A2UA 3BY6A 2EWNA 1ZG3A 3K1PA 5ED4A 1J7KA 2L3DA 3KP7A 3GW2A 3LA2A 3DF8A 1SAXA 3ELKA 2ETHA 3O3KA 1H0MA 3O2PE 4ESBA 3G3ZA 1P2FA 2NNNA 3F8FA 1HQCA 1FSEA 2EFQA 4M9XA 1U78A 3NQOA 5FFXA 5LEKA 3VB2A 2O8XA 2F5FA 1YTYA 3J81Z 3P7NA 2Z9OA 4G7ZF 2HS5A 1QNTA 1MJBA 2FMLA 1U2WA 2FNAA 1L3LA 1LDJA 1R7JA 5LRSA 1Z6RA 2PMUA 3J7AO 2FOKA 1OYYA 2XAFA 5H6QA 3V7CA 3FMSA 5ICFA 1J2XA 3I4PA 3QPTA 2A6EF 1MDMB 3F8BA 1KYZA 5LHHA 3WE3A 4HV5A 4ENJA 2A6HF 3I59A 2NS0A 1FBUA 4BXUA 4P9UA 3EQLF 1IF1A 4BAYA 4L0YB 3MEXA 4RGSA 3TO6A 2IT0A 5DV5A 1MZBA 2JZYA 3CTAA 3N4MA 2ZFWA 2W24A 2V79A 1FZPB 1MDMA 5IT3A 1ON2A 1QPMA 2VODA 1XMKA 4EGZA 3E97A 5EEHA 3IKTA 2P6TA 3Q5FA 3FMQA 2MBFA 1T6SA 2HYFA 2YR2A 2MH2A 2VOOA 3LA7A 2A68F 1LB2A 2P7CB 2XHKA 4FX0A 3LQQA 1Z1DA 2CG4A 2QM3A 3GUDA 1IXCA 2PMHA 3I0TA 4L18B 2QVOA 1R1VA 1JHFA 1SD4A 2IRFG 2R7FA 2LSOA 1FC3A 5J8FA 1R5HA 1UFMA 1P6RA 2PG4A 1D8JA 2HTJA 3B73A 3QPHA 5FLXK 2FBIA 2G7UA 2PEXA 1IRGA 1O3QA 5CVIA 2O61A 5L3DA 4Q47A 1HW5A 3KEOA 2TDXA 4FT8A 4BNCA 2VBZA 1ZH5A 4GCVA 3BPVA 3KEQA 1DUXC 2O3FA 1TQIA 4A5NA 5L3GA 2FA5A 5J8CA 2VONA 2XROA 4O5VA 4ESJA 1FSHA 1FNNA 1EH7A 3I71A 4PGHA 5LGUA 3RKXA 1FX7A 1KQ9A 4KMUX 1Z05A 3FZVA 2GAUA 2Z5UA 1RUOA 4G8XA 3LQRA 3QU6A 2DW4A 1R58A 3HRSA 2ZXJA 1ZRDA 3SZPA 4PZJA 2H6BA 2IPQX 3W6JB 4RB0A 2QUFA 2WC2A 4YFKF 4UXNA 4ASNA 4AIHA 3BP8A 2ZCWA 5CJ9A 4FX4A 1O3SA 1WWXA 5D6FA 4EJUA 5LBQA 4XRFA 4HQMA 2H27A 1T0FA 5F1RA 3KP5A 4IRHA 4KT5C 2EFNA 3TKYA 4IVNA 1OPCA 4ON0A 2FE3A 5BS6A 1Z7UA 1A04A 2XIGA 4LGWA 5D8KB 5ICCA 1ZYRF 1W4MA 3V8JA 3VODA 1I1GA 1SMYF 3HSFA 3FM5A 3IL2A 1OKRA 5LHIA 2A07F 3E6DA 1U5TC 4KA4A 3GZ5A 2IJLA 3GWZA 4O3MA 3OV8A 1UHMA 2XGXA 3PFIA 1PDNC 4MTEA 4HBLA 3T1BA 2OZUA 2D2WA 1IAWA 2L54A 4L9JA 3TO7A 4LLNA 4HF0A 1FYMA 2XKPA 2YPRA 3B02A 4PGGA 5DDGA 3HSRA 3ZMSA 4BYYA 4BHBA 2FEZA 2UWMA 3RI4A 4O6JA 4A6DA 3RTRA 3C18A 2RVCA 2QENA 5AIQA 5DUIA 4XBFA 4M6YA 5LLQA 2OQGA 1T38A 2Q2EA 2W85A 3E5XA 4G6QA 2XAGA 3ISPA 3KE2A 1QGPA 2K86A 2FBKA 4EJWA 4BQAA 1SD5A 3HHHA 2AS5F 4LB5A 5IT9Z 4I98B 3FF5A 3D0SA 1FT9A 1YQAA 5E18F 2GZWA 3ZMVA 4M73A 3NEUA 3WG9A 4QLCU 1I6XA 2XAQA 1DPUA 2RGVA 2H09A 1TTYA 3K69A 3EDPA 2GA2A 2DK5A 3N97A 1USTA 2Z33A 3E5QA 3MFKA 3M1EA 2HYGD 3ZQ7A 4LMYA 1REPC 3KZZA 1J9IA 1VTNC 1ON1A 2VE8A 1CF7B 1XCVA 1OR7A 3K9TA 4GYIA 1CGPA 4ZYEA 3JSOA 2QQBA 4I2OA 2QQAA 1BC8C 4R1HA 1SD6A 2FRHA 3FHZA 3RKWA 2V6CA 4M6XA 1KU3A 4FHTA 2XASA 2A69F 1XMAA 2GIVA 1J0RA 5JFRA 2E7XA 1YYVA 4DNCA 1CF7A 4ENKA 2YX7A 4YG2F 1FYKA 4A0YA 4LK1F 3CUQB 1DPRA 3RKYA 1IZ1A 1ONVA 4NB5A 1R36A 3IRRA 2F5DA 4N9IA 2RKHA 3GO5A 1KU2A 5KK1A 1J59A 4HA8A 1ZGAA 1FOKA 3H3ZA 3T0YA 4NQWA 2DK8A 2VBXA 3CUQA 3WU0A 4OIRF 5D8LB 1MJ9A 3JSPA 3DEUA 2PQ8A 3T8RA 4L9VA 1DDNA 2FU4A 3EETA 1PP8F 3F8NA 4UVCA 4HV6A 1LVAA 1O3RA 2RDPA 1HW1A 1KA8A 3LA3A 1DP7P 3HYIA 2M1BA 3C7JA 3D5LA 4MTDA 1EH8A 2DLLA 4I02A 1LEBA 2HGCA 4L0ZB 5HDGA 4I0BA 3ML6A 5HS9A 1SD7A 4A5MA 4L5IA 4UVBA 3CLOA 4MEXF 4UNOA 1E17A 2DO7A 1R22A 2BYVE 4MNUA 4RAYA 4P55A 1LQ1A 3REOA 1C0WA 3DPTA 1UB9A 3FWEA 5AONA 3GX4X 2XV4S 2EJRA 4EJTA 3GF2A 5TRDA 1XGMA 2EA4A 4A0XA 4Q4ZF 3WTZA 5D5UB 3IRQA 3JAMK 1XB4A 1XCBA 5BPIA 3HHGA 1MGTA 3HSEA 3V4GA 2HKOA 1W5SA 3KP2A 4HX4A 2PN6A 3BROA 4U0YA 4P9FA 4UVAA 4CDGA 2DPUA 1SMTA 3L2CA 5JR3A 2ZNYA 4GXOA 3IHUA 2ELHA 4KIBA 1B9MA 2HQRA 1R5GA 1ZGJA 4WCGA 2STWA 3ZPLA 3IC7A 4HDUA 3R61A 4MGRA 1D5VA 1B4AA 4G6DA 1TW2A 2HOEA 2HTSA 1KQ8A 3QU3A 3F22A 3CUOA 5FB2A 1YIOA 4HLYA 4ETSA 2A3SA 3F23A 4F7ZA 2JPCA 2K27A 3TGNA 1JE8A 2VOPA 1HSJA 5DUKA 3EYIA 1ZARA 4XSXF 5JHUA 4WXCA 3GEZA 4CGZA 3KZYA 1WI9A 1H9GA 5ILUA 3U1DA 2DT5A 4WWCA 2JT1A 2NRAC 3L7WA 2YU3A 4B8XA 3EUHA 3GFMA 1FPQA 3FMRA 4K2EA 1UHWA 2L4AA 1BM9A 5H20A 3MZYA 2MH9A 2R3SA 4EVIA 4HF1A 2E1NA 3TDUC 3GYHX 4LD5A 4B09A 1XGSA 3Q9VA 3WGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ISY A;  5E17 F;  3KLO A;  2G9W A;  1I5Z A;  2EV6 A;  5EEG A;  2GWR A;  5LRR A;  4U7B A;  1YW9 A;  3FX3 A;  4CZZ A;  3I5U A;  5ILS A;  1IUY A;  3QOP A;  2HEO A;  1ZG5 A;  5D5V B;  4RS8 A;  3WTX C;  3EYY A;  2GA1 A;  5DYM A;  3FXQ A;  1XGO A;  2D1H A;  4OOI A;  1WRJ A;  4LLG F;  4P5O A;  2V9V A;  1EH6 A;  1IN5 A;  3BWG A;  2XRN A;  4DQ2 A;  1FYL A;  5HS7 A;  4OIN F;  5L3F A;  5BQT A;  4GO1 A;  1ZRE A;  4WX9 A;  4HF2 A;  2OU2 A;  4AD9 A;  2OZ6 A;  1BOA A;  1HKS A;  4G94 A;  3DXJ F;  2RV8 A;  1D8K A;  2FXA A;  3H92 A;  3WTT C;  3J80 K;  3TOA A;  4JBA A;  3CO7 C;  5E8G A;  3DV8 A;  3U9G A;  3KP3 A;  5A2Q Z;  1TNT A;  1KU9 A;  1QZZ A;  1Z9C A;  4ZYD A;  3FXU A;  4M74 A;  4M9S A;  4MEY F;  3GFL A;  2XVC A;  2CYY A;  3SFZ A;  1B9N A;  2DFI A;  5HLG A;  2RNJ A;  3OOP A;  3VOE A;  4GGG A;  1B59 A;  2M45 A;  5DD4 A;  2VE9 A;  2HWV A;  1I1S A;  2F5C A;  3ROU A;  4LK0 F;  1QZY A;  1XSV A;  4OMY A;  3F8M A;  1E2X A;  2W84 A;  1KGS A;  1MKM A;  1GVJ A;  4IRI A;  1D3Y A;  2K7L A;  1TW3 A;  4KIF A;  2J5O A;  2P6S A;  2QWW A;  1W7P D;  4I01 A;  3KP4 A;  2HR3 A;  3FXR A;  2HDC A;  1YG2 A;  3GFI A;  3V7S A;  4CIC A;  2FF4 A;  1TLH B;  3V8L A;  3QP6 A;  4Y15 A;  3CDH A;  5E1W A;  1NHA A;  2MA3 A;  3Q9S A;  2PFB A;  5KVR A;  2D1V A;  2P5K A;  2H6C A;  2EFO A;  2EV0 A;  5CVU A;  4L9T A;  2O0Y A;  4PDK A;  4HOB A;  2IVM A;  1YFH A;  2UXN A;  2CW0 F;  3J81 K;  3P9K A;  2YSR A;  4ENN A;  3C1D A;  2ZO4 A;  3JW4 A;  4MQ9 F;  2O6G E;  1U8R A;  4EM1 A;  2OBP A;  2EA2 A;  4Y13 A;  4JK1 X;  1JXS A;  3BJA A;  3QRF F;  5LGT A;  1OYI A;  1G3W A;  1HKT A;  4ZZL A;  2J5P A;  4QWQ A;  2VN2 A;  4XLP F;  3W6K B;  3WTS C;  1IN6 A;  3LFK A;  3BDD A;  2VBY A;  1X3U A;  1G3T A;  3TDZ C;  2H94 A;  4Z2Y A;  2C6Y A;  4HQE A;  2DQL A;  2QQ9 A;  3CO6 C;  3R60 A;  2JRT A;  4G9Y A;  4L9N A;  5ICG A;  3ZMZ A;  4CYD A;  4L5J A;  2ISZ A;  5BOX A;  4RB2 C;  4M71 A;  4Y17 A;  2EFW A;  4G7H F;  4AIJ A;  4Q48 A;  1SFE A;  2V1X A;  5BPD A;  1BIA A;  3F21 A;  2RQP A;  4ZYH A;  4U0W A;  4RGR A;  1LEA A;  3HIF A;  1I27 A;  3BPX A;  2P4W A;  3HRM A;  5FLX Z;  2D45 A;  1ZN2 A;  3C3W A;  3VEP A;  4RB1 A;  1OMI A;  1AOY A;  1G4D A;  1GXQ A;  4OIO F;  1ZG1 A;  4GYG A;  4S05 A;  5D5X B;  2Q0O A;  2VXZ A;  4AIK A;  2M5W A;  1FLI A;  1SFX A;  2PBI A;  2V1U A;  5FGM A;  4I7H A;  2FSW A;  2ADU A;  2VC0 A;  3M8F A;  2UZK A;  2JPB A;  1GHC A;  1OYW A;  3HUG A;  3I54 A;  3LWF A;  2RN7 A;  2IA2 A;  4EJO A;  2M30 A;  1S7A A;  1FBS A;  2XUB A;  1G3Y A;  3ECO A;  1O3T A;  1WSU A;  1YW8 A;  2F2E A;  2VC1 A;  1V4R A;  2A5Y B;  1FBQ A;  3QAH A;  4U0V A;  2CGP A;  5LEJ A;  1Z6T A;  2PLY A;  1IN4 A;  4NHJ A;  4R8H A;  4P96 A;  1T39 A;  1G6N A;  3E5U A;  4RGX A;  4CXF A;  4HYE A;  2QBY B;  2MLG A;  3RPU A;  1ZRF A;  1ZLK A;  4LB6 B;  4EMS A;  2P7V B;  2JTV A;  2VT3 A;  4AWX B;  1TNS A;  2UXX A;  1F5T A;  2EB7 A;  2STT A;  4E70 A;  2ACJ A;  2L01 A;  2V1D A;  1ODD A;  5HOO A;  2A61 A;  1YLF A;  4D0P A;  3F6O A;  2XKO A;  1KYW A;  5E1X A;  1TQM A;  2QBY A;  3E3V A;  4UUV A;  2BGC A;  3ERE D;  2EFP A;  2PI0 A;  1LDD A;  4KUM A;  4KFC A;  2XAH A;  3MAJ A;  2MLK A;  5DCM B;  4EGY A;  3KLN A;  1XDU A;  3RYR A;  2BBY A;  3ABT A;  1TBX A;  3F72 A;  2KIU A;  3I64 A;  4A0Z A;  4R79 A;  1KQ0 A;  1USS A;  1IW7 F;  3WTU C;  1P4W A;  5K5Q A;  4MQV A;  4ZYG A;  1R23 A;  2R7D A;  1S6L A;  4S04 A;  1Q1H A;  3KET A;  1LNW A;  5JVT A;  3MWM A;  1EV7 A;  2XAJ A;  4KIC A;  2OA4 A;  4OIP F;  5DCM A;  4WK8 F;  3ABU A;  5HVQ C;  1XGN A;  3ULQ B;  6PAX A;  4HAM A;  5FD6 A;  2EV5 A;  4U7D A;  1P92 A;  1BJA A;  2EK5 A;  4IXA A;  3L09 A;  3SHF A;  5LGN A;  2KKO A;  3I59 B;  3M9A A;  1IN7 A;  4LFU A;  2L02 A;  3GXO A;  4OU0 A;  5HDK A;  1WKM A;  3DFG A;  4WF2 A;  2E7W A;  2QZ8 A;  4KIG A;  4OIQ F;  2CO5 A;  3CUQ C;  2NYX A;  1RIO H;  3TO9 A;  5HLI A;  3I53 A;  4Q5S F;  3F3X A;  3GZ6 A;  3HOS A;  2YX4 A;  3T8T A;  1V3F A;  5IT9 K;  2ZNZ A;  1YS7 A;  1ZAO A;  2KIF A;  3LAJ A;  3TQN A;  4U88 A;  1B6A A;  1U5T B;  1W5T A;  2IP2 A;  2P5L C;  3SZT A;  3ECH A;  1QQI A;  2IA0 A;  2Y0M A;  5LHG A;  2F5E A;  1Z91 A;  5K5R A;  5D6E A;  1P4X A;  3WGG A;  4ESF A;  1QBJ A;  3IWZ A;  2CSO A;  1HKQ A;  1BIB A;  2IA1 A;  3HRU A;  1FP1 D;  2Y75 A;  5E8I A;  2G7H A;  1RI7 A;  1RNL A;  2DAO A;  3BOQ A;  1JHH A;  2Z3Y A;  2COM A;  1U5T A;  4HX8 A;  3COA C;  3BZ6 A;  3QP5 A;  1S3J A;  1IN8 A;  5K1Y A;  1ULY A;  3O6B B;  3WTV C;  3T5X A;  2K4B A;  4M9Z A;  2O03 A;  3KP6 A;  4LJZ F;  1IXR C;  5CVV A;  4N0B A;  2LF7 A;  2KJB A;  2M87 A;  5E20 A;  3GLX A;  3WGH A;  4EQQ A;  1H9T A;  2E1C A;  2BV6 A;  1BN5 A;  3HTU A;  4ZZD A;  3WE2 A;  2AXL A;  5E1Z B;  1BBY A;  5FFZ A;  3PQK A;  3HRT A;  4BHC A;  3HTS B;  1B1B A;  2JSC A;  2GQQ A;  3R0A A;  4CO8 A;  3ZMU A;  3IKV A;  4A12 A;  5D4S A;  1BI0 A;  5TJJ A;  3KFW X;  4I09 A;  2X4H A;  2ESN A;  2VT2 A;  4WXH A;  3L9F A;  3R4K A;  5J6X A;  3LST A;  4RAZ A;  1F9N A;  4CHU A;  2OD5 A;  1LJ9 A;  3GVA A;  3RPQ A;  2LNB A;  4EM2 A;  4A6E A;  5AIP A;  1BI1 A;  3DQV C;  1T98 A;  3HOT A;  3I58 A;  1K79 A;  3ZMT A;  2W57 A;  4HDV A;  2Q8K A;  4IRG A;  1RUN A;  4HLX A;  4XSZ F;  2HKX A;  3GFJ A;  2LDU A;  5BMZ A;  3K0L A;  1PP7 U;  4YFX F;  2P5V A;  3M8E A;  1BC7 C;  3ZP5 A;  4HZF A;  3K1M A;  2B0L A;  3PQJ A;  4ENM A;  3H3U A;  1BI3 A;  2KRF A;  1U3E M;  1GXP A;  2WWY A;  3S2W A;  2FBH A;  4IHT A;  1IXS B;  4KNY A;  1ZHF A;  3RIR A;  3TOB A;  3JAM Z;  3L00 A;  2FMY A;  1U6G A;  4IJA A;  1J5Y A;  1JGS A;  2FNP A;  4UV8 A;  4IF4 A;  1MJA A;  1AWC A;  5FO5 A;  5DCF A;  3LAP A;  3WU1 B;  1S29 A;  1T2K A;  2BEO A;  4EM0 B;  2LKP A;  2MD5 A;  3FM3 A;  3F6V A;  2DU9 A;  4WXD A;  2QYO A;  1F1Z A;  5ICE A;  1IRF A;  4RGU A;  2CFX A;  3DPL C;  2DQR A;  5HDN A;  1HBX G;  2MC3 A;  3WTY C;  1LDK B;  1MD0 A;  2FQ3 A;  3MQ0 A;  3BJO A;  1YO5 C;  4PCQ A;  4HX7 A;  2RC4 A;  2OAZ A;  2HQN A;  2CWE A;  2VBW A;  1ZLJ A;  4EJV A;  3R0J A;  1O7F A;  1RZ4 A;  1BI2 A;  1J75 A;  3E6M A;  5CVR A;  1XD7 A;  2ZJ2 A;  3ZN1 A;  2WTE A;  2DI3 A;  4N9H A;  2GXB A;  5HLH A;  3ZN0 A;  1UCR A;  5L3E A;  2Z99 A;  3SQN A;  2DBB A;  1Y0U A;  5DEQ A;  3G73 A;  5F6F A;  2ZKZ A;  4M72 A;  1K78 B;  3U2R A;  2HFH A;  3WOD F;  3VFZ A;  4MHG A;  1XDS A;  2M8E A;  3AAF A;  1R1U A;  3V7R A;  4KDP A;  2BE5 F;  5DD8 A;  3BJ6 A;  1YW7 A;  1L0O C;  4BH9 A;  4I0A A;  4H0E A;  1XSD A;  5F64 A;  2ZME B;  3P9I A;  1KU7 A;  3SXY A;  1QO0 D;  4ZH4 F;  1XN7 A;  1K78 A;  4OMZ A;  4AVP A;  5D5W B;  5L3B A;  2Y48 A;  5HS8 A;  4JQF A;  4LG0 B;  2L4M A;  3CJN A;  4LLL A;  2P8T A;  1FP2 A;  2KJC A;  4YII A;  1FY7 A;  2ZBK A;  2KIM A;  1W7P B;  2ZME A;  1O7L A;  4KMF A;  1YS6 A;  3RYP A;  1STZ A;  5ILV A;  4KN4 X;  1WQ2 A;  3F8C A;  4YFN F;  4LG0 A;  3DKW A;  3K1N A;  3V8K A;  1K7A A;  2HZT A;  2GXG A;  2ESH A;  2CQK A;  3DP7 A;  1SFU A;  1W7P A;  4G7O F;  1O57 A;  5K5O A;  1HST A;  4IPA A;  1FWZ A;  1G3S A;  2DPD A;  3J80 Z;  1HXD A;  2K4J A;  3E6B A;  2DTR A;  1R1T A;  2LF8 A;  2WV0 A;  2IW5 A;  2X0L A;  4UHT A;  4XLN F;  2NAZ A;  5JI6 A;  4KN7 X;  3IWF A;  4IHS A;  5FD5 A;  1S7O A;  1K6O A;  1ZRC A;  5ERI A;  3RDI A;  5CLS A;  3P9C A;  1XSX A;  2W25 A;  2K02 A;  4TV7 A;  3E6C C;  1P4A A;  3KCC A;  3M7G A;  5CYV A;  2NNY A;  2PJP A;  3MZH A;  5CVJ A;  1HW2 A;  4EV0 A;  3R6S A;  5L3C A;  3JTG A;  3RJP A;  3WTW C;  3K2Z A;  1F4K A;  2QLZ A;  3JTH A;  4UV9 A;  4HW0 A;  4YIF A;  2OQR A;  4KYW A;  1R00 A;  4BHP A;  3MCZ A;  1S8N A;  5D4R A;  5A2Q K;  1TQP A;  3ZMD A;  1PUE E;  5H6R A;  4RB3 C;  3NRV A;  4A2U A;  3BY6 A;  2EWN A;  1ZG3 A;  3K1P A;  5ED4 A;  1J7K A;  2L3D A;  3KP7 A;  3GW2 A;  3LA2 A;  3DF8 A;  1SAX A;  3ELK A;  2ETH A;  3O3K A;  1H0M A;  3O2P E;  4ESB A;  3G3Z A;  1P2F A;  2NNN A;  3F8F A;  1HQC A;  1FSE A;  2EFQ A;  4M9X A;  1U78 A;  3NQO A;  5FFX A;  5LEK A;  3VB2 A;  2O8X A;  2F5F A;  1YTY A;  3J81 Z;  3P7N A;  2Z9O A;  4G7Z F;  2HS5 A;  1QNT A;  1MJB A;  2FML A;  1U2W A;  2FNA A;  1L3L A;  1LDJ A;  1R7J A;  5LRS A;  1Z6R A;  2PMU A;  3J7A O;  2FOK A;  1OYY A;  2XAF A;  5H6Q A;  3V7C A;  3FMS A;  5ICF A;  1J2X A;  3I4P A;  3QPT A;  2A6E F;  1MDM B;  3F8B A;  1KYZ A;  5LHH A;  3WE3 A;  4HV5 A;  4ENJ A;  2A6H F;  3I59 A;  2NS0 A;  1FBU A;  4BXU A;  4P9U A;  3EQL F;  1IF1 A;  4BAY A;  4L0Y B;  3MEX A;  4RGS A;  3TO6 A;  2IT0 A;  5DV5 A;  1MZB A;  2JZY A;  3CTA A;  3N4M A;  2ZFW A;  2W24 A;  2V79 A;  1FZP B;  1MDM A;  5IT3 A;  1ON2 A;  1QPM A;  2VOD A;  1XMK A;  4EGZ A;  3E97 A;  5EEH A;  3IKT A;  2P6T A;  3Q5F A;  3FMQ A;  2MBF A;  1T6S A;  2HYF A;  2YR2 A;  2MH2 A;  2VOO A;  3LA7 A;  2A68 F;  1LB2 A;  2P7C B;  2XHK A;  4FX0 A;  3LQQ A;  1Z1D A;  2CG4 A;  2QM3 A;  3GUD A;  1IXC A;  2PMH A;  3I0T A;  4L18 B;  2QVO A;  1R1V A;  1JHF A;  1SD4 A;  2IRF G;  2R7F A;  2LSO A;  1FC3 A;  5J8F A;  1R5H A;  1UFM A;  1P6R A;  2PG4 A;  1D8J A;  2HTJ A;  3B73 A;  3QPH A;  5FLX K;  2FBI A;  2G7U A;  2PEX A;  1IRG A;  1O3Q A;  5CVI A;  2O61 A;  5L3D A;  4Q47 A;  1HW5 A;  3KEO A;  2TDX A;  4FT8 A;  4BNC A;  2VBZ A;  1ZH5 A;  4GCV A;  3BPV A;  3KEQ A;  1DUX C;  2O3F A;  1TQI A;  4A5N A;  5L3G A;  2FA5 A;  5J8C A;  2VON A;  2XRO A;  4O5V A;  4ESJ A;  1FSH A;  1FNN A;  1EH7 A;  3I71 A;  4PGH A;  5LGU A;  3RKX A;  1FX7 A;  1KQ9 A;  4KMU X;  1Z05 A;  3FZV A;  2GAU A;  2Z5U A;  1RUO A;  4G8X A;  3LQR A;  3QU6 A;  2DW4 A;  1R58 A;  3HRS A;  2ZXJ A;  1ZRD A;  3SZP A;  4PZJ A;  2H6B A;  2IPQ X;  3W6J B;  4RB0 A;  2QUF A;  2WC2 A;  4YFK F;  4UXN A;  4ASN A;  4AIH A;  3BP8 A;  2ZCW A;  5CJ9 A;  4FX4 A;  1O3S A;  1WWX A;  5D6F A;  4EJU A;  5LBQ A;  4XRF A;  4HQM A;  2H27 A;  1T0F A;  5F1R A;  3KP5 A;  4IRH A;  4KT5 C;  2EFN A;  3TKY A;  4IVN A;  1OPC A;  4ON0 A;  2FE3 A;  5BS6 A;  1Z7U A;  1A04 A;  2XIG A;  4LGW A;  5D8K B;  5ICC A;  1ZYR F;  1W4M A;  3V8J A;  3VOD A;  1I1G A;  1SMY F;  3HSF A;  3FM5 A;  3IL2 A;  1OKR A;  5LHI A;  2A07 F;  3E6D A;  1U5T C;  4KA4 A;  3GZ5 A;  2IJL A;  3GWZ A;  4O3M A;  3OV8 A;  1UHM A;  2XGX A;  3PFI A;  1PDN C;  4MTE A;  4HBL A;  3T1B A;  2OZU A;  2D2W A;  1IAW A;  2L54 A;  4L9J A;  3TO7 A;  4LLN A;  4HF0 A;  1FYM A;  2XKP A;  2YPR A;  3B02 A;  4PGG A;  5DDG A;  3HSR A;  3ZMS A;  4BYY A;  4BHB A;  2FEZ A;  2UWM A;  3RI4 A;  4O6J A;  4A6D A;  3RTR A;  3C18 A;  2RVC A;  2QEN A;  5AIQ A;  5DUI A;  4XBF A;  4M6Y A;  5LLQ A;  2OQG A;  1T38 A;  2Q2E A;  2W85 A;  3E5X A;  4G6Q A;  2XAG A;  3ISP A;  3KE2 A;  1QGP A;  2K86 A;  2FBK A;  4EJW A;  4BQA A;  1SD5 A;  3HHH A;  2AS5 F;  4LB5 A;  5IT9 Z;  4I98 B;  3FF5 A;  3D0S A;  1FT9 A;  1YQA A;  5E18 F;  2GZW A;  3ZMV A;  4M73 A;  3NEU A;  3WG9 A;  4QLC U;  1I6X A;  2XAQ A;  1DPU A;  2RGV A;  2H09 A;  1TTY A;  3K69 A;  3EDP A;  2GA2 A;  2DK5 A;  3N97 A;  1UST A;  2Z33 A;  3E5Q A;  3MFK A;  3M1E A;  2HYG D;  3ZQ7 A;  4LMY A;  1REP C;  3KZZ A;  1J9I A;  1VTN C;  1ON1 A;  2VE8 A;  1CF7 B;  1XCV A;  1OR7 A;  3K9T A;  4GYI A;  1CGP A;  4ZYE A;  3JSO A;  2QQB A;  4I2O A;  2QQA A;  1BC8 C;  4R1H A;  1SD6 A;  2FRH A;  3FHZ A;  3RKW A;  2V6C A;  4M6X A;  1KU3 A;  4FHT A;  2XAS A;  2A69 F;  1XMA A;  2GIV A;  1J0R A;  5JFR A;  2E7X A;  1YYV A;  4DNC A;  1CF7 A;  4ENK A;  2YX7 A;  4YG2 F;  1FYK A;  4A0Y A;  4LK1 F;  3CUQ B;  1DPR A;  3RKY A;  1IZ1 A;  1ONV A;  4NB5 A;  1R36 A;  3IRR A;  2F5D A;  4N9I A;  2RKH A;  3GO5 A;  1KU2 A;  5KK1 A;  1J59 A;  4HA8 A;  1ZGA A;  1FOK A;  3H3Z A;  3T0Y A;  4NQW A;  2DK8 A;  2VBX A;  3CUQ A;  3WU0 A;  4OIR F;  5D8L B;  1MJ9 A;  3JSP A;  3DEU A;  2PQ8 A;  3T8R A;  4L9V A;  1DDN A;  2FU4 A;  3EET A;  1PP8 F;  3F8N A;  4UVC A;  4HV6 A;  1LVA A;  1O3R A;  2RDP A;  1HW1 A;  1KA8 A;  3LA3 A;  1DP7 P;  3HYI A;  2M1B A;  3C7J A;  3D5L A;  4MTD A;  1EH8 A;  2DLL A;  4I02 A;  1LEB A;  2HGC A;  4L0Z B;  5HDG A;  4I0B A;  3ML6 A;  5HS9 A;  1SD7 A;  4A5M A;  4L5I A;  4UVB A;  3CLO A;  4MEX F;  4UNO A;  1E17 A;  2DO7 A;  1R22 A;  2BYV E;  4MNU A;  4RAY A;  4P55 A;  1LQ1 A;  3REO A;  1C0W A;  3DPT A;  1UB9 A;  3FWE A;  5AON A;  3GX4 X;  2XV4 S;  2EJR A;  4EJT A;  3GF2 A;  5TRD A;  1XGM A;  2EA4 A;  4A0X A;  4Q4Z F;  3WTZ A;  5D5U B;  3IRQ A;  3JAM K;  1XB4 A;  1XCB A;  5BPI A;  3HHG A;  1MGT A;  3HSE A;  3V4G A;  2HKO A;  1W5S A;  3KP2 A;  4HX4 A;  2PN6 A;  3BRO A;  4U0Y A;  4P9F A;  4UVA A;  4CDG A;  2DPU A;  1SMT A;  3L2C A;  5JR3 A;  2ZNY A;  4GXO A;  3IHU A;  2ELH A;  4KIB A;  1B9M A;  2HQR A;  1R5G A;  1ZGJ A;  4WCG A;  2STW A;  3ZPL A;  3IC7 A;  4HDU A;  3R61 A;  4MGR A;  1D5V A;  1B4A A;  4G6D A;  1TW2 A;  2HOE A;  2HTS A;  1KQ8 A;  3QU3 A;  3F22 A;  3CUO A;  5FB2 A;  1YIO A;  4HLY A;  4ETS A;  2A3S A;  3F23 A;  4F7Z A;  2JPC A;  2K27 A;  3TGN A;  1JE8 A;  2VOP A;  1HSJ A;  5DUK A;  3EYI A;  1ZAR A;  4XSX F;  5JHU A;  4WXC A;  3GEZ A;  4CGZ A;  3KZY A;  1WI9 A;  1H9G A;  5ILU A;  3U1D A;  2DT5 A;  4WWC A;  2JT1 A;  2NRA C;  3L7W A;  2YU3 A;  4B8X A;  3EUH A;  3GFM A;  1FPQ A;  3FMR A;  4K2E A;  1UHW A;  2L4A A;  1BM9 A;  5H20 A;  3MZY A;  2MH9 A;  2R3S A;  4EVI A;  4HF1 A;  2E1N A;  3TDU C;  3GYH X;  4LD5 A;  4B09 A;  1XGS A;  3Q9V A;  3WGI A; 
#chains in the Genus database with same CATH topology
 1R5I D;  2ISY A;  5E17 F;  2V1N A;  3RZO J;  3KLO A;  4BQQ A;  2G9W A;  1I5Z A;  2EV6 A;  5EEG A;  3Q0W A;  5C4J J;  2GWR A;  2KL4 A;  5LRR A;  2GXA A;  4U7B A;  5IYC J;  2R7R A;  2FD5 A;  1YW9 A;  3FX3 A;  4CZZ A;  1HDD C;  4QIW N;  3RKQ A;  3I5U A;  5ILS A;  2VLA A;  3HDD A;  3DKX A;  1IUY A;  2L9V A;  3QOP A;  4QTR A;  1D1B A;  2HEO A;  1ZG5 A;  3CCR I;  5EG0 B;  2ZXH A;  5D5V B;  1JUM A;  2I5U A;  1TWA J;  2KQR A;  9ANT A;  2K9N A;  4RS8 A;  3WTX C;  3EYY A;  2GA1 A;  5DYM A;  3FXQ A;  1XGO A;  2D1H A;  4OOI A;  1WRJ A;  4LG3 A;  4LLG F;  4P5O A;  2V9V A;  1EH6 A;  1IN5 A;  3BWG A;  1X1D A;  2EZK A;  2XRN A;  4PFP A;  4DQ2 A;  1FYL A;  3ZQG A;  1ETX A;  5HS7 A;  1Y1W J;  4OIN F;  5L3F A;  5BQT A;  4GO1 A;  1ZRE A;  4M3F A;  5CQE A;  4RAG A;  4XKW A;  3TW7 A;  4WX9 A;  4BKX A;  4HF2 A;  2OU2 A;  2HVQ A;  4AD9 A;  2OZ6 A;  3K70 D;  4IOC F;  5EG0 A;  1ZGW A;  1BOA A;  3GBG A;  3VYR B;  3I3L A;  1HKS A;  4G94 A;  3DPU A;  3DXJ F;  3OYM A;  2RV8 A;  1D8K A;  2FXA A;  3H92 A;  2KDZ A;  3WTT C;  1DP3 A;  3J80 K;  2DJI A;  3TOA A;  2CS3 A;  4JBA A;  5BNG A;  3CO7 C;  1IDZ A;  5E8G A;  3DV8 A;  4FE4 A;  3U9G A;  1LVK A;  1HC8 A;  4HG2 A;  3KP3 A;  3B6A A;  4RBO A;  3K6G A;  5A2Q Z;  1TNT A;  1KU9 A;  1QZZ A;  2E71 A;  3DU5 A;  1Z9C A;  4HNV A;  4GFB A;  2MGQ A;  4HSR A;  4ZYD A;  3FXU A;  4D5C A;  3M4O J;  3FXJ A;  4M74 A;  1I50 J;  4M9S A;  4MEY F;  3GFL A;  2GM4 A;  2XVC A;  2LFB A;  1K4T A;  2CYY A;  2OUM A;  2QF7 A;  3I4N J;  3SFZ A;  4BAC A;  1VQP I;  2QEX I;  1B9N A;  2DFI A;  5HLG A;  2RNJ A;  3OOP A;  3VOE A;  4GGG A;  1B59 A;  2M45 A;  5DD4 A;  3VPR A;  1W36 D;  3DCF A;  2VE9 A;  1T33 A;  1TWG J;  2HWV A;  1I1S A;  2F5C A;  1VQM I;  3ROU A;  1O4X A;  4DYC A;  4LK0 F;  5EGO B;  1QZY A;  3CCY A;  4AC0 A;  1XSV A;  4OMY A;  3F8M A;  1E2X A;  2W84 A;  1KGS A;  3UR3 C;  1IDY A;  1MKM A;  1GVJ A;  3HB9 A;  3L2V A;  4E7L A;  4IRI A;  1D3Y A;  2K7L A;  4BUP A;  1TW3 A;  3EUH C;  3H9Q A;  2X48 A;  4KIF A;  2J5O A;  2P6S A;  4XRM A;  3DTE A;  4X0G A;  5HNH A;  3S1N J;  3MKL A;  1VF9 A;  2R5Y B;  3FXK A;  2QWW A;  1W7P D;  4I01 A;  3KP4 A;  1H88 C;  2HR3 A;  3FXR A;  4BY1 J;  2R7O A;  2HDC A;  1YG2 A;  2LP0 A;  1WJE A;  3CLQ A;  4FCY A;  4OAY A;  3SFI A;  3GFI A;  3OOU A;  3TP3 A;  3OS0 A;  5IOZ A;  1S5L C;  3V7S A;  5EGO A;  4CIC A;  2FF4 A;  1TLH B;  3V8L A;  3QP6 A;  4Y15 A;  3CDH A;  5E1W A;  1NHA A;  2DT6 A;  2MA3 A;  3BCA A;  3Q9S A;  1SVM A;  2PFB A;  1MSF C;  2BVL A;  1SVO A;  1T08 B;  5KVR A;  3TL4 X;  3L2W A;  4BGD A;  3JR9 A;  2D1V A;  3I55 I;  3QPL A;  4IKF A;  2P5K A;  2H6C A;  2HZD A;  1I3Q J;  3E7L A;  1QU3 A;  2R5Y A;  2EFO A;  2A5W A;  2F4M B;  4IL6 C;  2EV0 A;  4J01 A;  5CVU A;  4L9T A;  2O0Y A;  3WHC A;  4PDK A;  3RZD J;  4HOB A;  2HPI A;  1YHQ I;  2IVM A;  4XLC A;  1YFH A;  2UXN A;  2CW0 F;  3J81 K;  2DYR H;  3P9K A;  2YSR A;  4ENN A;  3C1D A;  2ZO4 A;  3H9J A;  4AUX A;  3JW4 A;  4MQ9 F;  2O6G E;  3LOC A;  1U8R A;  2CUF A;  1NTC A;  3FIS A;  1X4P A;  1TWF J;  4EM1 A;  5EEA A;  3CDI A;  2OBP A;  2EA2 A;  2P81 A;  4Y13 A;  3LSP A;  4JK1 X;  4S0H B;  2EBI A;  3ABL H;  5GAG J;  1JXS A;  4E7Z A;  1IJW C;  3BJA A;  4NDL A;  5IY5 H;  4DGW B;  5F1J A;  2VQG A;  1RR8 C;  3QRF F;  3IAS 2;  3RCO A;  1MND A;  5LGT A;  1OYI A;  1G3W A;  3CQZ J;  1HKT A;  4ZZL A;  2J5P A;  4QWQ A;  2VN2 A;  1F43 A;  4DW6 A;  4XLP F;  4M3G A;  3JRH A;  4CA0 A;  1HLV A;  5B1B H;  1WJA A;  3W6K B;  3WTS C;  1IN6 A;  3LFK A;  3BDD A;  2VBY A;  4A3B J;  3ONQ A;  1X3U A;  1A35 A;  1G3T A;  2KLO A;  3TDZ C;  2H94 A;  4Z2Y A;  3F9K A;  2C6Y A;  4HQE A;  2DQL A;  2QQ9 A;  2LOO A;  1XTA A;  3CO6 C;  2LMD A;  2OF7 A;  3R60 A;  2JRT A;  2K9S A;  4G9Y A;  4L9N A;  1Z67 A;  4RDU A;  5ICG A;  3RQ4 A;  3ZMZ A;  4CYD A;  2HOS A;  4L5J A;  3ASN H;  5FJ8 J;  2ISZ A;  4D5F A;  5BOX A;  3SEQ A;  1TL8 A;  4RB2 C;  4M71 A;  1T0F C;  1ZR2 A;  3KYD B;  4Y17 A;  2EFW A;  2FJ1 A;  4UUS B;  4G7H F;  3TBI A;  4IQJ A;  3O8H A;  4AIJ A;  4Q48 A;  4BXF A;  2HI3 A;  4C2M J;  1LFP A;  2HNH A;  1SFE A;  2V1X A;  2Y9Z A;  3JRE A;  1VQ5 I;  5BPD A;  1BIA A;  3F21 A;  2F48 A;  2RQP A;  4ZYH A;  4U0W A;  4RGR A;  1V55 H;  1LEA A;  3BG3 A;  3HIF A;  3MVP A;  1QRY A;  1N25 A;  3G4S I;  1I27 A;  3BPX A;  1S9H A;  2P4W A;  3HRM A;  5FLX Z;  2D45 A;  3PNY A;  1ZN2 A;  3WU2 C;  3HBL A;  3C3W A;  4UUT A;  2X6O A;  3VEP A;  3JRI A;  2WY7 Q;  4RB1 A;  2E60 A;  3HUG B;  1DU0 A;  2E2H J;  1QVT A;  1OMI A;  1AOY A;  1ETW A;  1G4D A;  1GXQ A;  4OIO F;  4ZDO A;  3BG9 A;  1ZG1 A;  4GYG A;  4BQN A;  4S05 A;  5D5X B;  2Q0O A;  2VXZ A;  3BR6 A;  4UUS A;  1X2M A;  3VYS B;  2ZXW H;  1NG6 A;  4AIK A;  2M5W A;  2DA2 A;  3OYB A;  2MD0 A;  2WY8 Q;  1FLI A;  3K2A A;  1WJ5 A;  1SFX A;  1WVR A;  4HNT A;  2JUC A;  2PBI A;  2DMT A;  2V1U A;  2ZB9 A;  2WA0 A;  3BCB A;  5FGM A;  1OJL A;  3M07 A;  4I7H A;  2FSW A;  3DEW A;  5TIS C;  1IV6 A;  2ADU A;  4IQ4 A;  2LK2 A;  3VYU B;  1S72 I;  3MMY B;  1WJC A;  2NVX J;  2VC0 A;  3M8F A;  2UZK A;  2JPB A;  1GHC A;  1RPW A;  3A0H C;  1OYW A;  2LTP A;  3HUG A;  3K4M A;  3I54 A;  3LWF A;  1TWC J;  4LIT A;  2RN7 A;  2IA2 A;  4EJO A;  2M30 A;  3FKI J;  2Q1Z B;  3G1O A;  2HDW A;  2LY2 A;  1S7A A;  1FBS A;  2XUB A;  1X1C A;  1G3Y A;  1ZKG A;  3AL0 B;  1P9Q C;  3ECO A;  1O3T A;  3S1M J;  1WSU A;  1YW8 A;  2F2E A;  2VC1 A;  2TRT A;  5HNF A;  1V4R A;  2A5Y B;  1MW7 A;  3GTO J;  4U87 A;  1FBQ A;  2BY0 A;  3QAH A;  3OYD A;  4U0V A;  2L7K A;  2X51 A;  2CGP A;  5LEJ A;  3J7Z I;  2DA1 A;  1Z6T A;  1N78 A;  2PLY A;  3H5N A;  1IN4 A;  3HOU J;  3L2Q A;  2R5Z B;  1Y0N A;  4QSH A;  4NHJ A;  4R8H A;  2JK3 A;  4P96 A;  4L5E A;  1T39 A;  1UJ8 A;  1G6N A;  2CQX A;  2NOG A;  3E5U A;  4RGX A;  3HOZ J;  3BG6 A;  4CXF A;  4M3E A;  2CQ7 A;  5FKO A;  4HYE A;  2QBY B;  2ZSI B;  2JN6 A;  2MLG A;  1WPK A;  3JRD A;  3RPU A;  1ZRF A;  1ZLK A;  4PSX A;  4XRS G;  3ZXS A;  1RET A;  4LB6 B;  4EMS A;  3AKZ A;  4A69 C;  2P7V B;  2DTZ A;  4MO7 A;  1MNM C;  2A05 A;  2JTV A;  2VT3 A;  4AWX B;  2EZI A;  4XNF A;  1TNS A;  3S16 J;  2UXX A;  1F5T A;  2EB7 A;  2STT A;  4E70 A;  2ACJ A;  2Y0S N;  2L01 A;  2V1D A;  2R5Z A;  3BR2 A;  1D1A A;  1ODD A;  5HOO A;  2A61 A;  1YLF A;  2WAQ N;  4D0P A;  3F6O A;  4HRI A;  3PO2 J;  2XKO A;  1KYW A;  5E1X A;  2L7M P;  1TQM A;  1OCZ H;  2QBY A;  2QSF X;  3CP8 A;  1UG0 A;  3E3V A;  4UUV A;  2BGC A;  3ERE D;  4V2F A;  1UAA A;  2EFP A;  1RES A;  2PI0 A;  1LDD A;  4KUM A;  4F92 B;  4KFC A;  2XAH A;  3MAJ A;  2MLK A;  5DCM B;  3JRF A;  4EGY A;  1VQ4 I;  3KLN A;  1XDU A;  3RYR A;  2IS6 A;  2BBY A;  3ABT A;  3K4B A;  3ZQL A;  1GV5 A;  1TBX A;  2KIU A;  3F72 A;  3I64 A;  5JLX A;  4A0Z A;  5EJC A;  4R79 A;  3S3O A;  1VQ8 I;  1A31 A;  1KQ0 A;  1USS A;  3ERM A;  2L0K A;  1IW7 F;  2OTL I;  3BR5 A;  3WTU C;  4M3B A;  1P4W A;  5K5Q A;  4MQV A;  4ZYG A;  1R23 A;  3OYC A;  2R7D A;  2W4S A;  4CCM A;  1APL C;  4ZDP A;  2M0C A;  1S6L A;  2DOE A;  4S04 A;  4G6T B;  2M34 A;  1Q1H A;  1ETK A;  4CZC A;  1LNW A;  2LY1 A;  5JVT A;  3KET A;  5B66 C;  4PSW A;  3MWM A;  1EV7 A;  2XAJ A;  4KIC A;  2OA4 A;  2H8W A;  3ZQH A;  4OIP F;  3GTQ J;  1ENH A;  3A2K A;  5DCM A;  2VAS A;  3HOV J;  1ETV A;  3QQA A;  4WK8 F;  3IUO A;  1LFU P;  2XPW A;  3ABU A;  1D0X A;  4C2T A;  5HVQ C;  1VND A;  2OJE D;  4CUG A;  1XX5 A;  4EEF G;  1XGN A;  1VZ0 A;  3ULQ B;  6PAX A;  4HAM A;  4IHY A;  2ZJP F;  5FD6 A;  1Z3Y A;  3AFH A;  3TMO A;  3ZQC A;  2EV5 A;  1P7I A;  4PJL A;  4U7D A;  1P92 A;  2LG4 A;  4MFE A;  1IRX A;  1BJA A;  1SAN A;  5IYB J;  1LE8 B;  3W2V A;  1Z21 A;  2EK5 A;  4IXA A;  4FE7 A;  3KPH A;  2EH3 A;  3L09 A;  3SHF A;  5B1A H;  5F0H A;  5LGN A;  2KKO A;  3I59 B;  3M9A A;  1IN7 A;  4CH7 A;  4LFU A;  2CFO A;  1IG7 A;  2L02 A;  3GXO A;  3OL3 A;  4OU0 A;  5K7Z A;  5GP9 A;  3GTL J;  1DQU A;  2DXI A;  4KT6 A;  5HDK A;  2XPV A;  4JP0 A;  5E3N A;  1WKM A;  2VQL A;  3DFG A;  1TC3 C;  4WF2 A;  5GTH C;  2E7W A;  2QZ8 A;  4KIG A;  2DOF A;  3AG4 H;  4OIQ F;  2CO5 A;  3K4C A;  3CUQ C;  1E3O C;  2RQQ A;  2NYX A;  5LD2 C;  2DFF A;  2GBY A;  2NS8 A;  1WI3 A;  1RIO H;  4EAT A;  2O9L A;  3ABM H;  1HOM A;  2D5V A;  3TO9 A;  5HLI A;  4YIR X;  1LE8 A;  2LY9 A;  2XSJ C;  3I53 A;  4FQG A;  4Q5S F;  4XIC A;  2BHZ A;  1XS9 A;  3F3X A;  3GZ6 A;  2L2O A;  3HOS A;  1X58 A;  2YX4 A;  3T8T A;  1V3F A;  5IT9 K;  2ZNZ A;  1YS7 A;  1ZAO A;  3OYE A;  2L7F P;  1WJB A;  2KIF A;  1T56 A;  4F91 B;  3H5R A;  4I6Z A;  3LAJ A;  3TQN A;  4I76 A;  4E7S A;  1EJ9 A;  4U88 A;  1B6A A;  3K4N A;  1U5T B;  1W5T A;  2IP2 A;  2P5L C;  2VQC A;  3SZT A;  3ECH A;  3AL0 C;  4IHW A;  1QQI A;  1SC7 A;  3QOD A;  2IA0 A;  3LL7 A;  2FQ4 A;  2VJ4 A;  5TGT A;  2Y0M A;  2KP6 A;  1E3P A;  5LHG A;  2F5E A;  1Z91 A;  3FBN B;  4UB6 C;  5D6E A;  5K5R A;  1P4X A;  3WGG A;  4ESF A;  1QBJ A;  3IWZ A;  4B48 A;  3FK6 A;  1FIA A;  2CSO A;  2HXO A;  1DGR M;  1HKQ A;  2ECB A;  2HYJ A;  1BIB A;  1JUP A;  3BG7 A;  2IA1 A;  3HRU A;  3IH2 A;  1FP1 D;  1FOX A;  2Y75 A;  2WBM A;  3MN2 A;  5E8I A;  2G7H A;  5FLM J;  4IX7 A;  2VJJ A;  1RI7 A;  1RNL A;  2DAO A;  3BOQ A;  1JHH A;  5DM6 F;  4IO9 F;  1ERD A;  3DTI A;  1MBE A;  4LIU A;  2Z3Y A;  2XF7 A;  2COM A;  1U5T A;  4HX8 A;  3COA C;  3E0J B;  3BZ6 A;  3QP5 A;  1S3J A;  1IN8 A;  4XM3 A;  5K1Y A;  1ULY A;  3WG7 H;  3O6B B;  3BR1 A;  1W0U A;  3UNG C;  4D1Q A;  3WHB A;  5KHD A;  3WTV C;  2E19 A;  3T5X A;  1LFB A;  2K4B A;  1OCT C;  4M9Z A;  2O03 A;  3KP6 A;  4BJ6 C;  1ACI A;  5JVG F;  4LJZ F;  1IXR C;  5CVV A;  4N0B A;  2RRE A;  2LF7 A;  3LSM A;  2KJB A;  2M87 A;  4XR6 A;  5E20 A;  3GLX A;  4XLF A;  3WGH A;  1V5G A;  4EQQ A;  1H9T A;  3PIO F;  2E1C A;  2BV6 A;  1BN5 A;  3MKY B;  3HTU A;  4ZZD A;  4BEH B;  3WE2 A;  2E2I J;  2AXL A;  5E1Z B;  2M7B A;  2BXZ A;  2CU7 A;  4BU2 A;  3L2R A;  4X1E A;  4CYC B;  1BBY A;  5FFZ A;  3PQK A;  2OC6 A;  3HRT A;  4BHC A;  3HTS B;  4DJA A;  2F4O B;  1B1B A;  1JT6 A;  2JSC A;  3S3N A;  4E7K A;  2R92 J;  2CJJ A;  4OWR B;  2GQQ A;  3R0A A;  4CO8 A;  3BQY A;  5FKM A;  3ZMU A;  3IKV A;  4A12 A;  3CES A;  5D4S A;  1BI0 A;  5TJJ A;  2JWT A;  3KEY A;  3KFW X;  1PUF B;  1UHS A;  4I09 A;  2X4H A;  4B43 A;  2ESN A;  2VT2 A;  2DYS H;  3F0C A;  4WXH A;  3L9F A;  3CP2 A;  2XPU A;  2V9P A;  3R4K A;  5J6X A;  3LST A;  4RAZ A;  3JRG A;  4BEH A;  1F9N A;  2M9H A;  4CHU A;  3QYE A;  4CYC A;  2OD5 A;  1UG2 A;  4BDY A;  1LJ9 A;  4ZJZ A;  3VSK A;  3GVA A;  3RPQ A;  4PJN A;  1FMV A;  2LNB A;  2YU9 J;  4EM2 A;  2CW8 A;  4A6E A;  1FEX A;  3K4L A;  2EIL H;  5AIP A;  1X1B A;  1BI1 A;  3DQV C;  1T98 A;  3HOT A;  4KIS A;  3I58 A;  2AHQ A;  5JHF A;  1K79 A;  3CCU I;  3ZMT A;  2W57 A;  1PUF A;  4HDV A;  2Q8K A;  3JRB A;  4IRG A;  2KFD A;  1RUN A;  4HLX A;  4XSZ F;  1JKQ C;  1MH4 A;  3OSF A;  2LH9 A;  2HKX A;  3QPS A;  2WV1 A;  3GFJ A;  2LDU A;  3K10 A;  4P1W A;  4QPO A;  1NG7 A;  4ABZ A;  5BMZ A;  4AID A;  2R93 J;  3K0L A;  1FTT A;  1PP7 U;  4YFX F;  2P5V A;  3M8J A;  3M8E A;  1BC7 C;  3ZP5 A;  1HDP A;  4HZF A;  3K1M A;  2KHM A;  2B0L A;  3PQJ A;  4ENM A;  3G71 I;  1OQY A;  3LSJ A;  3H3U A;  5M3F J;  1Y6I A;  1BI3 A;  2KRF A;  1U3E M;  4CCO A;  1OCR H;  1H89 C;  1GXP A;  3LNQ A;  2WWY A;  3C2G A;  3S2W A;  1Y39 A;  2EZH A;  1QPI A;  1A5J A;  2FBH A;  4IHT A;  4PK4 A;  4A3F J;  4IEJ A;  3A03 A;  1IXS B;  4FTH A;  2HDD A;  1ZHF A;  4KNY A;  4ZC3 A;  3RIR A;  3TOB A;  3JAM Z;  3CMM A;  3L00 A;  4RLQ A;  3K4J A;  4J19 A;  3FHN A;  1E0E A;  2FMY A;  1U6G A;  4IJA A;  3GTM J;  4C2U A;  4DZJ A;  1J5Y A;  4JX5 A;  1ZQ3 P;  1VQO I;  1M1E B;  3OYF A;  1JGS A;  2FNP A;  3BTI A;  4UV8 A;  4XN3 A;  2HVS A;  2IGK A;  4IF4 A;  1MJA A;  5KAF C;  2VXD A;  1AWC A;  3OR1 C;  5FO5 A;  4AU7 A;  5M5Y J;  5DCF A;  5J40 A;  2CV0 A;  3LAP A;  2MFZ A;  5M5X J;  3WU1 B;  2XF5 A;  1VQ6 I;  4A3C J;  1N75 A;  2CMP A;  2E1M B;  1S29 A;  2CQN A;  2XAU A;  1T2K A;  2BEO A;  1LPQ A;  2PJR B;  4PUS A;  1RRJ A;  4EM0 B;  2LKP A;  3V42 A;  2DOA A;  2MD5 A;  5E3L A;  3FM3 A;  2JA5 J;  3F6V A;  4LIV A;  2DU9 A;  3M3Y J;  1WFX A;  4WXD A;  2QYO A;  2VIX A;  1F1Z A;  4XK4 A;  1Z0X A;  1QHH D;  5ICE A;  1IRF A;  5EYR A;  4RGU A;  2CFX A;  3DPL C;  2DQR A;  3CJR B;  5HDN A;  1HBX G;  2MC3 A;  1JT0 A;  3WTY C;  1BW5 A;  3AG2 H;  2WB1 N;  4XLH A;  1LDK B;  1MD0 A;  2FQ3 A;  2EIM H;  3MQ0 A;  3BJO A;  1YO5 C;  4PCQ A;  4HX7 A;  2LRD A;  2ZFU A;  3RPU D;  2QA4 I;  1RC9 A;  2RC4 A;  2OAZ A;  4RM3 A;  1A6I A;  4IZZ A;  2HQN A;  2W00 A;  1X1P A;  1FJL A;  2CWE A;  2VBW A;  1ZLJ A;  4EJV A;  2FUG 2;  2CW7 A;  3R0J A;  1B72 B;  1O7F A;  1RZ4 A;  1WZ2 A;  2ME6 A;  1BI2 A;  1J75 A;  1GVD A;  3H9G A;  3VWB A;  3E6M A;  5CVR A;  1BR2 A;  3NAR A;  1XD7 A;  2Z1D A;  4YEL A;  4A3G J;  2HOA A;  2ZJ2 A;  1G2H A;  1RKW A;  3ZN1 A;  1JKO C;  5C4X J;  2WTE A;  5E3M A;  2DI3 A;  3OYJ A;  2WB1 A;  4N9H A;  2GXB A;  4BJ5 C;  5HLH A;  3ZN0 A;  2OPT A;  1UCR A;  5L3E A;  3GLL A;  1UEL B;  3W2A A;  2Z99 A;  3SQN A;  4Y33 A;  1RKT A;  3DTK A;  2HVR A;  3SJM A;  3BZC A;  1B72 A;  1B8I B;  2DBB A;  1Y0U A;  2K3P A;  5DEQ A;  3D1N I;  2X6Y A;  3G73 A;  5F6F A;  2AQE A;  1BW6 A;  2ZKZ A;  4ITV A;  4M72 A;  5C3E J;  1K78 B;  1VQ7 I;  2R7Z J;  3U2R A;  4DIQ A;  2R7S A;  1S7E A;  2HFH A;  3ZOB A;  3QYF A;  2PMZ N;  3FDY A;  2VJ5 A;  4I99 C;  4JX4 A;  3WOD F;  3OYK A;  3VFZ A;  4MHG A;  3PO3 J;  1ETO A;  1XDS A;  2M8E A;  3AAF A;  3OL4 A;  1R1U A;  3V7R A;  4DBQ A;  1NK2 P;  4HST A;  4KDP A;  2BE5 F;  5DD8 A;  3BJ6 A;  3O8G A;  1YW7 A;  3S2D J;  1L0O C;  4BH9 A;  1MBF A;  4I0A A;  4H0E A;  2LYC A;  1QA6 A;  4PJM A;  1JKP C;  2DT7 B;  5F64 A;  1XSD A;  2ZME B;  4BS9 A;  3P9I A;  1KU7 A;  4FET A;  3SXY A;  1B8I A;  1QO0 D;  2JA8 J;  4ZH4 F;  4C3I J;  1XN7 A;  5F27 A;  3LSI A;  1K78 A;  3DLL F;  3S3M A;  4OMZ A;  4AVP A;  5D5W B;  5GPC A;  5L3B A;  3S8P A;  4F93 B;  4X6A J;  2Y48 A;  2PMZ A;  1MH3 A;  5HS8 A;  2W82 A;  5J4Y A;  4M6V A;  4A3L J;  2M0M A;  1YI2 I;  4JQF A;  2EIJ H;  4BBR J;  4LG0 B;  3HGY A;  1LUJ B;  2CUE A;  2L4M A;  2AXT C;  3CJN A;  4LLL A;  1QHG A;  2P8T A;  1FP2 A;  2CQQ A;  3DEE A;  2KJC A;  4YII A;  1J09 A;  5KCM A;  1FY7 A;  2ZBK A;  2KIM A;  1W7P B;  3AG3 H;  1KZH A;  3C2B A;  2HU9 A;  1O7L A;  2XGE A;  2ZME A;  3X2Q H;  1YX3 A;  4KMF A;  1YS6 A;  1MMS A;  3RYP A;  2NVQ J;  1STZ A;  2BVM A;  2DDA A;  5ILV A;  3OWT A;  4KN4 X;  4MFD A;  1WQ2 A;  5F0F A;  4XQF A;  4XOR A;  3J7A Y;  3RSN A;  3F8C A;  3OYG A;  4D7M A;  2DA5 A;  4YFN F;  4XID A;  2XSD C;  1WH5 A;  4V19 K;  3KIO A;  4LG0 A;  1ZR4 A;  1MNE A;  4XLE A;  5IPA A;  3BC8 A;  3EUA A;  3B6C A;  3DKW A;  3D5R C;  1TWH J;  3K1N A;  1CQT A;  3V8K A;  1K7A A;  1YX5 A;  2HZT A;  2GXG A;  3OYI A;  2ESH A;  2CQK A;  1AU7 A;  2KIS A;  3HL2 A;  1R4N B;  3DP7 A;  2H1K A;  1SFU A;  1T95 A;  2JRM A;  1W7P A;  2JA6 J;  4G7O F;  2HXI A;  1O57 A;  3G1M A;  5K5O A;  1HST A;  4IPA A;  1FWZ A;  3FXL A;  1G3S A;  1JJ8 C;  2DPD A;  2I8D A;  3OYL A;  1FTZ A;  3J80 Z;  1HXD A;  2K4J A;  3ABK H;  3E6B A;  1RR7 A;  2NVT J;  2DTR A;  5C44 J;  3PJR A;  3BLY A;  1R1T A;  2LF8 A;  2V26 A;  2VUM J;  2WV0 A;  2IW5 A;  2X0L A;  4UHT A;  4IHV A;  4XLN F;  5F0C A;  3OIP A;  2NAZ A;  5JI6 A;  2M4G A;  4KN7 X;  2BHY A;  3IWF A;  4IHS A;  5FD5 A;  1S7O A;  3S17 J;  3PSF A;  1K6O A;  1ZRC A;  1NH3 A;  4BE0 A;  5ERI A;  4B3A A;  4RAF A;  3RDI A;  5CLS A;  2O5R A;  3P9C A;  1XSX A;  2W25 A;  2X6X A;  2K02 A;  4TV7 A;  3E6C C;  2O8K A;  1P4A A;  3KCC A;  3M7G A;  5CYV A;  2NNY A;  2HQ5 A;  2PJP A;  3MZH A;  5CVJ A;  2RNG A;  1BL0 A;  4EV0 A;  1HW2 A;  1WGX A;  3R6S A;  2QGU A;  1FIP A;  3CZ6 A;  5L3C A;  3HGG A;  3JTG A;  2HOT A;  2GLO A;  3RJP A;  3WTW C;  2BY1 A;  2OCE A;  3K2Z A;  5HOD A;  1F4K A;  2KRH A;  2QLZ A;  1OCP A;  3JTH A;  4UV9 A;  2BW3 B;  3I4M J;  4HW0 A;  4YIF A;  2OQR A;  2K5C A;  4KYW A;  4AVZ A;  1R00 A;  4BHP A;  2G0E A;  1BJZ A;  3MCZ A;  1S8N A;  5EZG A;  2F5V A;  1GT0 C;  5D4R A;  5A2Q K;  1TQP A;  3H0G J;  4XOT A;  3ZMD A;  4RA2 A;  2IEK A;  5CQG A;  2K85 A;  3G6E I;  1PUE E;  5H6R A;  4RB3 C;  2Y31 A;  3NRV A;  4A2U A;  3BY6 A;  2Y0S A;  3MZ8 A;  5J1U A;  3BG5 A;  2EWN A;  3W2W A;  2DN0 A;  4F55 A;  2QKL B;  3L2U A;  1ZG3 A;  3K1P A;  5ED4 A;  2K9M A;  3H35 A;  3RQI A;  1J7K A;  2L3D A;  2VJI A;  2WAQ A;  3KP7 A;  1Y1V J;  3VYT B;  2BW3 A;  1HA8 A;  3GW2 A;  4FAS D;  3CCJ I;  1OCO H;  3LA2 A;  1WH7 A;  3DF8 A;  2OTJ I;  3FBI B;  1SAX A;  3ELK A;  2ETH A;  2UV1 A;  4J00 A;  3O3K A;  1I6H J;  1H0M A;  3O2P E;  3S32 A;  4ESB A;  1VQ9 I;  2IS2 A;  4ANJ A;  1U9O A;  2QQ8 A;  2Z16 A;  3G3Z A;  2LVS A;  1P2F A;  2NNN A;  3F8F A;  4ZYA A;  1Y8R B;  3TP0 A;  2XB0 X;  2JA2 A;  1HQC A;  5J3L A;  1YE9 A;  1FSE A;  5E3O A;  2EFQ A;  4M9X A;  1U78 A;  3NQO A;  2FOW A;  5FFX A;  1FOW A;  3GME A;  2KT0 A;  2N8G A;  3FXO A;  5LEK A;  3VB2 A;  2CV2 A;  2O8X A;  2ZJQ F;  2X9D A;  2F5F A;  1YTY A;  3J81 Z;  4XKB A;  2XB5 A;  4W97 A;  4IOA F;  3P7N A;  2Z9O A;  1VFC A;  1WJF A;  4G7Z F;  2HS5 A;  5EZH A;  2CH0 A;  1QNT A;  1MJB A;  2FML A;  1MSE C;  1GLN A;  3PNT A;  2ZC2 A;  1U2W A;  1V5F A;  3OIO A;  2R7X A;  2FNA A;  1L3L A;  2QSH X;  1LDJ A;  2LLK A;  1R7J A;  1BR1 A;  1X2N A;  5DS9 A;  5LRS A;  1Z6R A;  2PMU A;  2XC7 A;  3J7A O;  1UMQ A;  2FOK A;  1W0T A;  1OYY A;  2XAF A;  4M3D A;  5H6Q A;  3V7C A;  3FMS A;  5ICF A;  2BY3 A;  1J2X A;  1FMW A;  1A6Q A;  4NC6 A;  3HEF A;  2VKD A;  3I4P A;  3QPT A;  3CF5 F;  2A6E F;  3CCQ I;  1MDM B;  3F8B A;  1KYZ A;  5LHH A;  2LBF B;  3WE3 A;  2HQA A;  4HV5 A;  1SVL A;  4ENJ A;  1K4S A;  2A6H F;  5EF6 A;  3I59 A;  3OY9 A;  4XON A;  2NS0 A;  2Y9Y A;  1FBU A;  4BXU A;  5FKN A;  4E7H A;  4P9U A;  1Y56 A;  3EQL F;  4XKC A;  3QOE A;  1IF1 A;  4BAY A;  2E35 A;  1I39 A;  3CCM I;  4L0Y B;  4JYK A;  3MEX A;  4OAZ A;  3ASO H;  4RGS A;  3TO6 A;  1D5Y A;  3BQZ A;  2IT0 A;  4YRV A;  5DV5 A;  1MZB A;  3ESW B;  2TCT A;  2JZY A;  3CTA A;  3N4M A;  3MD2 A;  3HXL A;  2ZFW A;  1PYV A;  3GTJ J;  4F52 A;  3HOY J;  2M4K A;  2W24 A;  2V79 A;  1FZP B;  1JI8 A;  1MDM A;  5IT3 A;  1ON2 A;  2LBF A;  4XN0 A;  5B3S H;  2EIN H;  1QPM A;  2VOD A;  1XMK A;  1TZL A;  3MKW B;  4EGZ A;  3E97 A;  5EEH A;  3IKT A;  3IAM 2;  5FKK A;  2GIZ A;  2P6T A;  3Q5F A;  3KZI C;  3DWL E;  3FMQ A;  3ZCO A;  1MBH A;  2DDB A;  1MMG A;  3IH3 A;  4A3K J;  2MBF A;  1T6S A;  3G2B A;  2ECC A;  4XRS A;  5GTI C;  3FIW A;  3BTC A;  2LKS A;  5M3M J;  2HYF A;  1WHU A;  3I56 I;  3LSG A;  1X3Z B;  3TW6 A;  2KIQ A;  2YR2 A;  2MH2 A;  4C9Y A;  1AA7 A;  2VOO A;  4E7J A;  5LFA A;  3LA7 A;  2A68 F;  1LB2 A;  2P7C B;  3CME I;  2XHK A;  4FX0 A;  4XL9 A;  3UKG A;  4BBS J;  3LQQ A;  1Z1D A;  2CG4 A;  2QM3 A;  3GUD A;  1XG1 A;  5EDN A;  1IXC A;  2PMH A;  3DLA A;  2MYS A;  4F3Q A;  3HOW J;  3I0T A;  2B9S A;  4L18 B;  2DFH A;  1G59 A;  1D0Y A;  2QVO A;  1R1V A;  3A01 B;  1JHF A;  1SD4 A;  2VI6 A;  2IRF G;  2R7F A;  3Q3S A;  2LSO A;  2XGC A;  1FC3 A;  5J8F A;  3H3V K;  2IAI A;  2LD5 A;  1DGW Y;  2E5N A;  3SYT A;  2CRG A;  1R5H A;  1HF0 A;  1UFM A;  1P6R A;  2PG4 A;  1D8J A;  2HTJ A;  3B73 A;  3QPH A;  3S2H J;  1XC5 A;  5FLX K;  2FBI A;  1VI0 A;  2G7U A;  3U1K A;  3FK7 A;  2PEX A;  5KAI C;  1IRG A;  1O3Q A;  5KNL A;  2VKE A;  4N4O B;  5CVI A;  5L3D A;  2O61 A;  3DBL B;  5IP9 J;  3W6V A;  2ELJ A;  4Q47 A;  1HW5 A;  3KEO A;  2TDX A;  4FT8 A;  2XDV A;  3W3C A;  2ZJR F;  4BNC A;  3A01 A;  5F04 A;  5J1R A;  1SFO J;  1G8X A;  3S1R J;  4NUB A;  2YUS A;  2VBZ A;  1ZH5 A;  4GCV A;  3CD6 I;  3BPV A;  3BR0 A;  4MIM A;  3KEQ A;  1DUX C;  2O3F A;  2VKH A;  1TQI A;  2DMN A;  4A5N A;  5GAE J;  5L3G A;  1Z77 A;  2LC2 A;  2FA5 A;  4W1U A;  5J8C A;  4KIT B;  2VON A;  1SFK A;  3ZRG A;  2XRO A;  4O5V A;  4ESJ A;  1FSH A;  1YJN I;  1FNN A;  4CCL A;  1EH7 A;  3I71 A;  4CCN A;  4PGH A;  5LGU A;  3RKX A;  3ZGK A;  1FX7 A;  1KQ9 A;  4KMU X;  1Z05 A;  3FZV A;  2GAU A;  2Z5U A;  1RUO A;  4G8X A;  1VQN I;  3LQR A;  3QU6 A;  2DW4 A;  1R58 A;  3HRS A;  2ZXJ A;  2K9Q A;  2R7Q A;  2DA6 A;  3LSK A;  3K4K A;  1ZK8 A;  4RMN A;  1ZRD A;  2NVY J;  3SZP A;  2K40 A;  4PZJ A;  2COB A;  3NWS A;  2H6B A;  4NBQ A;  3SDG A;  2IPQ X;  3W6J B;  1OIS A;  2IGN A;  2MW8 A;  4RB0 A;  2QUF A;  2WC2 A;  4YFK F;  4UXN A;  2IXS A;  4ASN A;  4PJJ A;  3CCS I;  2X1C A;  2AQF A;  4AIH A;  5K7F A;  2WAF A;  1ETQ A;  3GCM A;  3BP8 A;  4HEA 2;  3M1C A;  2ZCW A;  4KJZ A;  5M5W J;  1R71 A;  4II3 A;  5CJ9 A;  2L9N A;  4FX4 A;  2K3F A;  2EPF A;  1O3S A;  1WWX A;  2QCO A;  5D6F A;  4EJU A;  5LBQ A;  4XRF A;  3EUK L;  4HQM A;  2H27 A;  2H1L A;  2B63 J;  2B7E A;  1T0F A;  3HPH A;  5F1R A;  1FOY A;  3KP5 A;  1Y8Q B;  2X6W A;  3KYC B;  4IRH A;  4KT5 C;  2R7W A;  4BE1 A;  2EFN A;  4BY7 J;  3PM1 A;  3TKY A;  2XF6 A;  4IVN A;  3OYN A;  3LSH A;  1OPC A;  2LRE A;  1K83 J;  2ME0 A;  4ON0 A;  2FE3 A;  2NVU B;  3Q0U A;  5BS6 A;  4BXX J;  1K6Y A;  4MLO A;  1GDT A;  1Z7U A;  1A04 A;  4JOM A;  4B3X A;  4BDZ A;  3J7Y J;  2XIG A;  4LGW A;  2KMU A;  3HOX J;  4G12 A;  5J47 A;  4PJ0 C;  5D8K B;  5ICC A;  3OS2 A;  1ZYR F;  3CC2 I;  4IHX A;  1W4M A;  3IH4 A;  3V8J A;  3VOD A;  1I1G A;  3U21 A;  1JGG A;  1SMY F;  3HSF A;  2L5Q A;  3MKZ A;  3FM5 A;  3IL2 A;  1OKR A;  5LHI A;  2A07 F;  3E6D A;  1ZEL A;  1U5T C;  2MAB A;  3CF2 A;  1YRN B;  4KA4 A;  3GZ5 A;  2JSP A;  2IJL A;  2MG4 A;  2VPR A;  3GWZ A;  3ZQF A;  3OV8 A;  4YEJ A;  2ZSH B;  1UHM A;  5GPA A;  4O3M A;  3OMY A;  2JVH A;  2XGX A;  3PFI A;  1PDN C;  4MTE A;  4HBL A;  3T1B A;  1XPX A;  3IV5 A;  3H36 A;  2Y2Z A;  1PVE A;  4A3I J;  2OZU A;  2D2W A;  1IAW A;  2L54 A;  1EKE A;  4L9J A;  3TO7 A;  4LLN A;  2Q2E B;  3OYA A;  4ZTJ A;  2BOL A;  4HF0 A;  1FYM A;  2XKP A;  2YPR A;  3B02 A;  4PGG A;  1V5E A;  5DDG A;  3A1Y A;  3HSR A;  3ZMS A;  4BYY A;  4BL0 B;  4BHB A;  2FEZ A;  2M2E A;  2H8R A;  2UWM A;  3NWT A;  2DOD A;  3RI4 A;  4HPQ A;  4O6J A;  3PFY A;  4A6D A;  2E2J J;  4C3J J;  1YRN A;  3RTR A;  3C18 A;  3CCE I;  3S93 A;  2RVC A;  2QEN A;  5AIQ A;  3CJT B;  5DUI A;  1IGN A;  1D0Z A;  4XBF A;  4M6Y A;  5LLQ A;  1MIJ A;  4AYB N;  2PJR A;  2OQG A;  3HG9 A;  1T38 A;  2Q2E A;  2W85 A;  3OIQ A;  3E5X A;  3A02 A;  4G6Q A;  2XAG A;  3ISP A;  3N05 A;  3KE2 A;  1QGP A;  1TT5 B;  1JJ6 C;  2K86 A;  2FBK A;  4EJW A;  3IP4 B;  4BQA A;  1ZTR A;  1SD5 A;  4A93 J;  3HHH A;  3LFU A;  1GUU A;  4DYR A;  1R49 A;  2AS5 F;  5H2F C;  4D9J A;  4LB5 A;  4QPQ A;  1Z7L A;  5IT9 Z;  3VDX A;  1X1A A;  4I98 B;  3FF5 A;  1AKH B;  1JTY A;  5GAH J;  3D0S A;  5FLV A;  2ICW G;  1FT9 A;  1YQA A;  1T8I A;  5E18 F;  4AYB A;  2GZW A;  3ZMV A;  3OS1 A;  4M73 A;  3NEU A;  1BA5 A;  2BY2 A;  2M3A A;  3WG9 A;  4QLC U;  4DZP A;  2Y30 A;  1I6X A;  2RAE A;  2KPM A;  4H4K C;  4DYQ A;  1R9T J;  1POG A;  5DM7 F;  4FIS A;  2XAQ A;  3DKY A;  1DPU A;  2RGV A;  2H09 A;  2EIK H;  1YJ9 I;  1TTY A;  1GV2 A;  1MMN A;  3K69 A;  3EDP A;  3VSL A;  2GA2 A;  1R4M B;  1BR4 A;  3BT9 A;  3TED A;  2DK5 A;  3JCU C;  3N97 A;  3GTP J;  1UST A;  2YS9 A;  2Z33 A;  4ZTF A;  1UZC A;  3E5Q A;  1TT0 A;  1AKH A;  2BXY A;  3MFK A;  2NOJ B;  3M1E A;  4B1R A;  2HYG D;  3OR2 C;  2QSG X;  3ZQ7 A;  4LMY A;  3ZR8 X;  4DBR A;  1REP C;  3KZZ A;  5FRM A;  1J9I A;  3OYH A;  1V54 H;  1VTN C;  1ON1 A;  2VE8 A;  5CKT A;  2MC4 A;  2DCE A;  1CF7 B;  5E79 C;  1XCV A;  1OR7 A;  3K9T A;  4GYI A;  2NXN B;  1CGP A;  4ZYE A;  2R7T A;  3JSO A;  2QQB A;  4I2O A;  2QQA A;  1KON A;  3H0D A;  1BC8 C;  3QWL A;  4R1H A;  1SD6 A;  3GTG J;  2FRH A;  2MSY A;  3FHZ A;  3RKW A;  2V6C A;  4M6X A;  5IP6 A;  1KU3 A;  1YIT I;  4CSW A;  4FHT A;  2XAS A;  2A69 F;  1XMA A;  2GIV A;  1ITY A;  1J0R A;  5B5E C;  1OFC X;  5JFR A;  2GOM A;  2E7X A;  1YYV A;  2E1O A;  2OV7 A;  4NC7 A;  4Y52 J;  4DNC A;  3SEZ A;  1CF7 A;  4NQW B;  1MBG A;  3PIP F;  3CMY A;  4ENK A;  2CUJ A;  3EPZ A;  2L9R A;  2YX7 A;  4YG2 F;  2ID6 A;  1FYK A;  3PSI A;  3LMM A;  4A0Y A;  4GDF A;  4LK1 F;  1SEU A;  3CUQ B;  1N77 A;  1A36 A;  1DPR A;  1K61 A;  1NK3 P;  1PJR A;  1IZ1 A;  3RKY A;  1ONV A;  4NB5 A;  4UY8 I;  4UB8 C;  1JKR C;  1R36 A;  1X19 A;  3IRR A;  3CC7 I;  2F5D A;  4N9I A;  3JRA A;  2RKH A;  2V4J C;  3GO5 A;  1KU2 A;  5KK1 A;  3FXM A;  2FX0 A;  2IBD A;  2W48 A;  1QVU A;  3HKZ N;  1J59 A;  3Q0V A;  4A3M J;  4HA8 A;  1ZGA A;  1FOK A;  3H3Z A;  3QYB A;  3T0Y A;  2VB6 A;  4NQW A;  2DK8 A;  5FRN A;  2I10 A;  2KZG A;  3C2H A;  3DBR B;  2PX9 A;  2Z2S B;  2VBX A;  2V7F A;  2DJN A;  3CUQ A;  3WU0 A;  2JA7 J;  1HCR A;  4OIR F;  1F36 A;  3CCV I;  2ID3 A;  5D8L B;  1EF4 A;  1EA3 A;  1JUS A;  1MJ9 A;  1I3A A;  2JQ7 A;  2E1M C;  3JSP A;  3DEU A;  1WJD A;  4NC8 A;  2L7Z A;  2PQ8 A;  3T8R A;  5DTD A;  2IGO A;  4XOP A;  4L9V A;  3H5A A;  1YJW I;  1DDN A;  5FKL A;  2FU4 A;  1U9N A;  3EET A;  1PP8 F;  3HKZ A;  3F8N A;  4UVC A;  4E4H A;  1OCC H;  4LOC A;  4HV6 A;  1LVA A;  3KYL A;  2L9S A;  2RDP A;  1SAU A;  1O3R A;  1OLT A;  1HW1 A;  3A4C A;  3CMA I;  1KA8 A;  3LA3 A;  1DP7 P;  3NAU A;  1IV8 A;  3HYI A;  2M1B A;  3CJQ B;  3C7J A;  3I9V 2;  3D5L A;  1Q1V A;  1BOB A;  3LSR A;  3BTJ A;  4MTD A;  1EH8 A;  2DLL A;  4I02 A;  2DA7 A;  4PFO A;  3AG1 H;  2QKM B;  4C3H J;  1LEB A;  2HGC A;  2JUG A;  2WAD A;  2AO9 A;  4L0Z B;  3H1C A;  5HDG A;  4XKV A;  3SDB A;  3HC7 A;  2KRC A;  4I0B A;  3ML6 A;  5HS9 A;  1SD7 A;  3HM5 A;  5F08 A;  4A5M A;  3K70 C;  4L5I A;  4UVB A;  3CLO A;  3HZJ A;  4MEX F;  2F6C A;  4UNO A;  1E17 A;  1X3W B;  2DA3 A;  2VKV A;  3PUF A;  2DO7 A;  1R22 A;  2BYV E;  2R7U A;  4MNU A;  4RAY A;  3L1P A;  1ETY A;  3A0B C;  1W1W E;  2DFE A;  4P55 A;  2CV1 A;  1LQ1 A;  3REO A;  1C0W A;  3HPG A;  3DPT A;  1UB9 A;  4BE2 A;  3FWE A;  1VQL I;  5AON A;  3GX4 X;  4C30 A;  2XV4 S;  2EJR A;  4EJT A;  4A3D J;  3GF2 A;  1MMD A;  5TRD A;  2EZL A;  3PNV A;  2F4I A;  1MBK A;  4NNJ A;  2UUZ A;  4Y7N J;  1XGM A;  2EA4 A;  5K7H A;  4A0X A;  4AM3 A;  4B4C A;  1OR7 C;  5IYD J;  1DU6 A;  4Q4Z F;  3WTZ A;  5D5U B;  3IRQ A;  1MMA A;  2R7V A;  4RM2 A;  3JAM K;  3E1S A;  1XB4 A;  4B44 A;  2KZV A;  3OSG A;  1XCB A;  5BPI A;  5IP7 J;  3BR3 A;  3HHG A;  1MGT A;  3HSE A;  3V4G A;  1R6R A;  2HKO A;  3S15 J;  1W5S A;  4XLA A;  4XMY A;  2A6T A;  3KP2 A;  4HX4 A;  2PN6 A;  3PL8 A;  3BRO A;  4U0Y A;  4BQO A;  1YIJ I;  3G1L A;  4DOZ A;  2ZME C;  4P9F A;  4UVA A;  4CDG A;  2DPU A;  3GZN B;  1SMT A;  2DMU A;  2P0W A;  2K9L A;  1W5C C;  2NS7 A;  1W36 C;  1TP4 A;  5J4V A;  2JVG A;  4Y4R A;  1H8A C;  1IRZ A;  3L2C A;  4JX6 A;  5JR3 A;  2ZNY A;  4HNU A;  2OCC H;  2JMW A;  4GXO A;  3IHU A;  3ZQQ A;  4A3E J;  2ELH A;  4RLF A;  4KIB A;  1B9M A;  2HQR A;  1R5G A;  5CPR B;  4BJT A;  1ZGJ A;  2DMP A;  1AHD P;  4WCG A;  3CCL I;  3P5J A;  2IS4 A;  2STW A;  4E7I A;  3ZPL A;  2ZXI A;  3IC7 A;  4HDU A;  3R61 A;  4MGR A;  2VPL A;  1D5V A;  1IO2 A;  2IGM A;  1B4A A;  3GTK J;  1WCM J;  4G6D A;  1TW2 A;  2E36 A;  2HOE A;  2HTS A;  2X1E A;  1KQ8 A;  3QU3 A;  3F22 A;  5JLW A;  2HPM A;  1ORK A;  3CUO A;  2LR8 A;  2M7A A;  4Y3O A;  2KDO A;  5FB2 A;  3JRC A;  1YIO A;  1IC8 A;  2BZT A;  3BTL A;  4HLY A;  4ETS A;  3D5S C;  2A3S A;  3F23 A;  2IS1 A;  1QZE A;  5J1Y A;  2ELK A;  4F7Z A;  2JPC A;  2K27 A;  3TGN A;  3CC4 I;  2EQR A;  3S14 J;  5GAD J;  1JE8 A;  2VOP A;  2XGD A;  2VL8 A;  4GRI A;  4CCJ A;  4Z6Y A;  1HSJ A;  2Y69 H;  2X1D A;  5DUK A;  1MBJ A;  2WAE A;  3EYI A;  1LKX A;  2R4G A;  2R0Q C;  1ZAR A;  4XSX F;  5JHU A;  4WXC A;  3SZG A;  2JJ7 A;  2VQH A;  3GEZ A;  1Z3X A;  2LKX A;  3BZK A;  4CGZ A;  3K7A J;  3KZY A;  1WI9 A;  4D7N A;  4E6K G;  1H9G A;  5ILU A;  4CCK A;  3FKJ A;  2W1O A;  3PUB A;  1VQK I;  3U1D A;  1X4O A;  1P7J A;  4V2G A;  1E3H A;  1IUF A;  2DT5 A;  4WWC A;  4II2 A;  1U8B A;  3HJE A;  1JTX A;  2JT1 A;  2NRA C;  3L7W A;  2YU3 A;  4N4N B;  4B8X A;  3EUH A;  1XMX A;  3CDL A;  3GFM A;  4ZDL A;  1FPQ A;  3FMR A;  3KX2 A;  5FRO A;  2E34 A;  3S1Q J;  2M8G X;  4K2E A;  1UHW A;  2L4A A;  1BM9 A;  5H20 A;  3DU6 A;  3MZY A;  5IOY A;  2DMQ A;  2V9K A;  2O7O A;  2MH9 A;  2R3S A;  4B47 A;  4EVI A;  2CUZ A;  4HF1 A;  2E1N A;  2DA4 A;  3ZQI A;  3TDU C;  3GYH X;  2E5Z A;  1U0J A;  2W7N A;  4LD5 A;  2V6E A;  5HLT A;  4B09 A;  2X85 A;  1YOV B;  2GOX B;  4A3J J;  2XRL A;  1D1C A;  1XGS A;  3Q9V A;  3DBH B;  3WGI A; 
#chains in the Genus database with same CATH homology
 2ISY A;  5E17 F;  3KLO A;  2G9W A;  1I5Z A;  2EV6 A;  5EEG A;  2GWR A;  5LRR A;  4U7B A;  1YW9 A;  3FX3 A;  4CZZ A;  3I5U A;  5ILS A;  1IUY A;  3QOP A;  2HEO A;  1ZG5 A;  5D5V B;  4RS8 A;  3WTX C;  3EYY A;  2GA1 A;  5DYM A;  3FXQ A;  1XGO A;  2D1H A;  4OOI A;  1WRJ A;  4LLG F;  4P5O A;  2V9V A;  1EH6 A;  1IN5 A;  3BWG A;  2XRN A;  4DQ2 A;  1FYL A;  5HS7 A;  4OIN F;  5L3F A;  5BQT A;  4GO1 A;  1ZRE A;  4WX9 A;  4HF2 A;  2OU2 A;  4AD9 A;  2OZ6 A;  1BOA A;  1HKS A;  4G94 A;  3DXJ F;  2RV8 A;  1D8K A;  2FXA A;  3H92 A;  3WTT C;  3J80 K;  3TOA A;  4JBA A;  3CO7 C;  5E8G A;  3DV8 A;  3U9G A;  3KP3 A;  5A2Q Z;  1TNT A;  1KU9 A;  1QZZ A;  1Z9C A;  4ZYD A;  3FXU A;  4M74 A;  4M9S A;  4MEY F;  3GFL A;  2XVC A;  2CYY A;  3SFZ A;  1B9N A;  2DFI A;  5HLG A;  2RNJ A;  3OOP A;  3VOE A;  4GGG A;  1B59 A;  2M45 A;  5DD4 A;  2VE9 A;  2HWV A;  1I1S A;  2F5C A;  3ROU A;  4LK0 F;  1QZY A;  1XSV A;  4OMY A;  3F8M A;  1E2X A;  2W84 A;  1KGS A;  1MKM A;  1GVJ A;  4IRI A;  1D3Y A;  2K7L A;  1TW3 A;  4KIF A;  2J5O A;  2P6S A;  2QWW A;  1W7P D;  4I01 A;  3KP4 A;  2HR3 A;  3FXR A;  2HDC A;  1YG2 A;  3GFI A;  3V7S A;  4CIC A;  2FF4 A;  1TLH B;  3V8L A;  3QP6 A;  4Y15 A;  3CDH A;  5E1W A;  1NHA A;  2MA3 A;  3Q9S A;  2PFB A;  5KVR A;  2D1V A;  2P5K A;  2H6C A;  2EFO A;  2EV0 A;  5CVU A;  4L9T A;  2O0Y A;  4PDK A;  4HOB A;  2IVM A;  1YFH A;  2UXN A;  2CW0 F;  3J81 K;  3P9K A;  2YSR A;  4ENN A;  3C1D A;  2ZO4 A;  3JW4 A;  4MQ9 F;  2O6G E;  1U8R A;  4EM1 A;  2OBP A;  2EA2 A;  4Y13 A;  4JK1 X;  1JXS A;  3BJA A;  3QRF F;  5LGT A;  1OYI A;  1G3W A;  1HKT A;  4ZZL A;  2J5P A;  4QWQ A;  2VN2 A;  4XLP F;  3W6K B;  3WTS C;  1IN6 A;  3LFK A;  3BDD A;  2VBY A;  1X3U A;  1G3T A;  3TDZ C;  2H94 A;  4Z2Y A;  2C6Y A;  4HQE A;  2DQL A;  2QQ9 A;  3CO6 C;  3R60 A;  2JRT A;  4G9Y A;  4L9N A;  5ICG A;  3ZMZ A;  4CYD A;  4L5J A;  2ISZ A;  5BOX A;  4RB2 C;  4M71 A;  4Y17 A;  2EFW A;  4G7H F;  4AIJ A;  4Q48 A;  1SFE A;  2V1X A;  5BPD A;  1BIA A;  3F21 A;  2RQP A;  4ZYH A;  4U0W A;  4RGR A;  1LEA A;  3HIF A;  1I27 A;  3BPX A;  2P4W A;  3HRM A;  5FLX Z;  2D45 A;  1ZN2 A;  3C3W A;  3VEP A;  4RB1 A;  1OMI A;  1AOY A;  1G4D A;  1GXQ A;  4OIO F;  1ZG1 A;  4GYG A;  4S05 A;  5D5X B;  2Q0O A;  2VXZ A;  4AIK A;  2M5W A;  1FLI A;  1SFX A;  2PBI A;  2V1U A;  5FGM A;  4I7H A;  2FSW A;  2ADU A;  2VC0 A;  3M8F A;  2UZK A;  2JPB A;  1GHC A;  1OYW A;  3HUG A;  3I54 A;  3LWF A;  2RN7 A;  2IA2 A;  4EJO A;  2M30 A;  1S7A A;  1FBS A;  2XUB A;  1G3Y A;  3ECO A;  1O3T A;  1WSU A;  1YW8 A;  2F2E A;  2VC1 A;  1V4R A;  2A5Y B;  1FBQ A;  3QAH A;  4U0V A;  2CGP A;  5LEJ A;  1Z6T A;  2PLY A;  1IN4 A;  4NHJ A;  4R8H A;  4P96 A;  1T39 A;  1G6N A;  3E5U A;  4RGX A;  4CXF A;  4HYE A;  2QBY B;  2MLG A;  3RPU A;  1ZRF A;  1ZLK A;  4LB6 B;  4EMS A;  2P7V B;  2JTV A;  2VT3 A;  4AWX B;  1TNS A;  2UXX A;  1F5T A;  2EB7 A;  2STT A;  4E70 A;  2ACJ A;  2L01 A;  2V1D A;  1ODD A;  5HOO A;  2A61 A;  1YLF A;  4D0P A;  3F6O A;  2XKO A;  1KYW A;  5E1X A;  1TQM A;  2QBY A;  3E3V A;  4UUV A;  2BGC A;  3ERE D;  2EFP A;  2PI0 A;  1LDD A;  4KUM A;  4KFC A;  2XAH A;  3MAJ A;  2MLK A;  5DCM B;  4EGY A;  3KLN A;  1XDU A;  3RYR A;  2BBY A;  3ABT A;  1TBX A;  3F72 A;  2KIU A;  3I64 A;  4A0Z A;  4R79 A;  1KQ0 A;  1USS A;  1IW7 F;  3WTU C;  1P4W A;  5K5Q A;  4MQV A;  4ZYG A;  1R23 A;  2R7D A;  1S6L A;  4S04 A;  1Q1H A;  3KET A;  1LNW A;  5JVT A;  3MWM A;  1EV7 A;  2XAJ A;  4KIC A;  2OA4 A;  4OIP F;  5DCM A;  4WK8 F;  3ABU A;  5HVQ C;  1XGN A;  3ULQ B;  6PAX A;  4HAM A;  5FD6 A;  2EV5 A;  4U7D A;  1P92 A;  1BJA A;  2EK5 A;  4IXA A;  3L09 A;  3SHF A;  5LGN A;  2KKO A;  3I59 B;  3M9A A;  1IN7 A;  4LFU A;  2L02 A;  3GXO A;  4OU0 A;  5HDK A;  1WKM A;  3DFG A;  4WF2 A;  2E7W A;  2QZ8 A;  4KIG A;  4OIQ F;  2CO5 A;  3CUQ C;  2NYX A;  1RIO H;  3TO9 A;  5HLI A;  3I53 A;  4Q5S F;  3F3X A;  3GZ6 A;  3HOS A;  2YX4 A;  3T8T A;  1V3F A;  5IT9 K;  2ZNZ A;  1YS7 A;  1ZAO A;  2KIF A;  3LAJ A;  3TQN A;  4U88 A;  1B6A A;  1U5T B;  1W5T A;  2IP2 A;  2P5L C;  3SZT A;  3ECH A;  1QQI A;  2IA0 A;  2Y0M A;  5LHG A;  2F5E A;  1Z91 A;  5K5R A;  5D6E A;  1P4X A;  3WGG A;  4ESF A;  1QBJ A;  3IWZ A;  2CSO A;  1HKQ A;  1BIB A;  2IA1 A;  3HRU A;  1FP1 D;  2Y75 A;  5E8I A;  2G7H A;  1RI7 A;  1RNL A;  2DAO A;  3BOQ A;  1JHH A;  2Z3Y A;  2COM A;  1U5T A;  4HX8 A;  3COA C;  3BZ6 A;  3QP5 A;  1S3J A;  1IN8 A;  5K1Y A;  1ULY A;  3O6B B;  3WTV C;  3T5X A;  2K4B A;  4M9Z A;  2O03 A;  3KP6 A;  4LJZ F;  1IXR C;  5CVV A;  4N0B A;  2LF7 A;  2KJB A;  2M87 A;  5E20 A;  3GLX A;  3WGH A;  4EQQ A;  1H9T A;  2E1C A;  2BV6 A;  1BN5 A;  3HTU A;  4ZZD A;  3WE2 A;  2AXL A;  5E1Z B;  1BBY A;  5FFZ A;  3PQK A;  3HRT A;  4BHC A;  3HTS B;  1B1B A;  2JSC A;  2GQQ A;  3R0A A;  4CO8 A;  3ZMU A;  3IKV A;  4A12 A;  5D4S A;  1BI0 A;  5TJJ A;  3KFW X;  4I09 A;  2X4H A;  2ESN A;  2VT2 A;  4WXH A;  3L9F A;  3R4K A;  5J6X A;  3LST A;  4RAZ A;  1F9N A;  4CHU A;  2OD5 A;  1LJ9 A;  3GVA A;  3RPQ A;  2LNB A;  4EM2 A;  4A6E A;  5AIP A;  1BI1 A;  3DQV C;  1T98 A;  3HOT A;  3I58 A;  1K79 A;  3ZMT A;  2W57 A;  4HDV A;  2Q8K A;  4IRG A;  1RUN A;  4HLX A;  4XSZ F;  2HKX A;  3GFJ A;  2LDU A;  5BMZ A;  3K0L A;  1PP7 U;  4YFX F;  2P5V A;  3M8E A;  1BC7 C;  3ZP5 A;  4HZF A;  3K1M A;  2B0L A;  3PQJ A;  4ENM A;  3H3U A;  1BI3 A;  2KRF A;  1U3E M;  1GXP A;  2WWY A;  3S2W A;  2FBH A;  4IHT A;  1IXS B;  4KNY A;  1ZHF A;  3RIR A;  3TOB A;  3JAM Z;  3L00 A;  2FMY A;  1U6G A;  4IJA A;  1J5Y A;  1JGS A;  2FNP A;  4UV8 A;  4IF4 A;  1MJA A;  1AWC A;  5FO5 A;  5DCF A;  3LAP A;  3WU1 B;  1S29 A;  1T2K A;  2BEO A;  4EM0 B;  2LKP A;  2MD5 A;  3FM3 A;  3F6V A;  2DU9 A;  4WXD A;  2QYO A;  1F1Z A;  5ICE A;  1IRF A;  4RGU A;  2CFX A;  3DPL C;  2DQR A;  5HDN A;  1HBX G;  2MC3 A;  3WTY C;  1LDK B;  1MD0 A;  2FQ3 A;  3MQ0 A;  3BJO A;  1YO5 C;  4PCQ A;  4HX7 A;  2RC4 A;  2OAZ A;  2HQN A;  2CWE A;  2VBW A;  1ZLJ A;  4EJV A;  3R0J A;  1O7F A;  1RZ4 A;  1BI2 A;  1J75 A;  3E6M A;  5CVR A;  1XD7 A;  2ZJ2 A;  3ZN1 A;  2WTE A;  2DI3 A;  4N9H A;  2GXB A;  5HLH A;  3ZN0 A;  1UCR A;  5L3E A;  2Z99 A;  3SQN A;  2DBB A;  1Y0U A;  5DEQ A;  3G73 A;  5F6F A;  2ZKZ A;  4M72 A;  1K78 B;  3U2R A;  2HFH A;  3WOD F;  3VFZ A;  4MHG A;  1XDS A;  2M8E A;  3AAF A;  1R1U A;  3V7R A;  4KDP A;  2BE5 F;  5DD8 A;  3BJ6 A;  1YW7 A;  1L0O C;  4BH9 A;  4I0A A;  4H0E A;  1XSD A;  5F64 A;  2ZME B;  3P9I A;  1KU7 A;  3SXY A;  1QO0 D;  4ZH4 F;  1XN7 A;  1K78 A;  4OMZ A;  4AVP A;  5D5W B;  5L3B A;  2Y48 A;  5HS8 A;  4JQF A;  4LG0 B;  2L4M A;  3CJN A;  4LLL A;  2P8T A;  1FP2 A;  2KJC A;  4YII A;  1FY7 A;  2ZBK A;  2KIM A;  1W7P B;  2ZME A;  1O7L A;  4KMF A;  1YS6 A;  3RYP A;  1STZ A;  5ILV A;  4KN4 X;  1WQ2 A;  3F8C A;  4YFN F;  4LG0 A;  3DKW A;  3K1N A;  3V8K A;  1K7A A;  2HZT A;  2GXG A;  2ESH A;  2CQK A;  3DP7 A;  1SFU A;  1W7P A;  4G7O F;  1O57 A;  5K5O A;  1HST A;  4IPA A;  1FWZ A;  1G3S A;  2DPD A;  3J80 Z;  1HXD A;  2K4J A;  3E6B A;  2DTR A;  1R1T A;  2LF8 A;  2WV0 A;  2IW5 A;  2X0L A;  4UHT A;  4XLN F;  2NAZ A;  5JI6 A;  4KN7 X;  3IWF A;  4IHS A;  5FD5 A;  1S7O A;  1K6O A;  1ZRC A;  5ERI A;  3RDI A;  5CLS A;  3P9C A;  1XSX A;  2W25 A;  2K02 A;  4TV7 A;  3E6C C;  1P4A A;  3KCC A;  3M7G A;  5CYV A;  2NNY A;  2PJP A;  3MZH A;  5CVJ A;  1HW2 A;  4EV0 A;  3R6S A;  5L3C A;  3JTG A;  3RJP A;  3WTW C;  3K2Z A;  1F4K A;  2QLZ A;  3JTH A;  4UV9 A;  4HW0 A;  4YIF A;  2OQR A;  4KYW A;  1R00 A;  4BHP A;  3MCZ A;  1S8N A;  5D4R A;  5A2Q K;  1TQP A;  3ZMD A;  1PUE E;  5H6R A;  4RB3 C;  3NRV A;  4A2U A;  3BY6 A;  2EWN A;  1ZG3 A;  3K1P A;  5ED4 A;  1J7K A;  2L3D A;  3KP7 A;  3GW2 A;  3LA2 A;  3DF8 A;  1SAX A;  3ELK A;  2ETH A;  3O3K A;  1H0M A;  3O2P E;  4ESB A;  3G3Z A;  1P2F A;  2NNN A;  3F8F A;  1HQC A;  1FSE A;  2EFQ A;  4M9X A;  1U78 A;  3NQO A;  5FFX A;  5LEK A;  3VB2 A;  2O8X A;  2F5F A;  1YTY A;  3J81 Z;  3P7N A;  2Z9O A;  4G7Z F;  2HS5 A;  1QNT A;  1MJB A;  2FML A;  1U2W A;  2FNA A;  1L3L A;  1LDJ A;  1R7J A;  5LRS A;  1Z6R A;  2PMU A;  3J7A O;  2FOK A;  1OYY A;  2XAF A;  5H6Q A;  3V7C A;  3FMS A;  5ICF A;  1J2X A;  3I4P A;  3QPT A;  2A6E F;  1MDM B;  3F8B A;  1KYZ A;  5LHH A;  3WE3 A;  4HV5 A;  4ENJ A;  2A6H F;  3I59 A;  2NS0 A;  1FBU A;  4BXU A;  4P9U A;  3EQL F;  1IF1 A;  4BAY A;  4L0Y B;  3MEX A;  4RGS A;  3TO6 A;  2IT0 A;  5DV5 A;  1MZB A;  2JZY A;  3CTA A;  3N4M A;  2ZFW A;  2W24 A;  2V79 A;  1FZP B;  1MDM A;  5IT3 A;  1ON2 A;  1QPM A;  2VOD A;  1XMK A;  4EGZ A;  3E97 A;  5EEH A;  3IKT A;  2P6T A;  3Q5F A;  3FMQ A;  2MBF A;  1T6S A;  2HYF A;  2YR2 A;  2MH2 A;  2VOO A;  3LA7 A;  2A68 F;  1LB2 A;  2P7C B;  2XHK A;  4FX0 A;  3LQQ A;  1Z1D A;  2CG4 A;  2QM3 A;  3GUD A;  1IXC A;  2PMH A;  3I0T A;  4L18 B;  2QVO A;  1R1V A;  1JHF A;  1SD4 A;  2IRF G;  2R7F A;  2LSO A;  1FC3 A;  5J8F A;  1R5H A;  1UFM A;  1P6R A;  2PG4 A;  1D8J A;  2HTJ A;  3B73 A;  3QPH A;  5FLX K;  2FBI A;  2G7U A;  2PEX A;  1IRG A;  1O3Q A;  5CVI A;  2O61 A;  5L3D A;  4Q47 A;  1HW5 A;  3KEO A;  2TDX A;  4FT8 A;  4BNC A;  2VBZ A;  1ZH5 A;  4GCV A;  3BPV A;  3KEQ A;  1DUX C;  2O3F A;  1TQI A;  4A5N A;  5L3G A;  2FA5 A;  5J8C A;  2VON A;  2XRO A;  4O5V A;  4ESJ A;  1FSH A;  1FNN A;  1EH7 A;  3I71 A;  4PGH A;  5LGU A;  3RKX A;  1FX7 A;  1KQ9 A;  4KMU X;  1Z05 A;  3FZV A;  2GAU A;  2Z5U A;  1RUO A;  4G8X A;  3LQR A;  3QU6 A;  2DW4 A;  1R58 A;  3HRS A;  2ZXJ A;  1ZRD A;  3SZP A;  4PZJ A;  2H6B A;  2IPQ X;  3W6J B;  4RB0 A;  2QUF A;  2WC2 A;  4YFK F;  4UXN A;  4ASN A;  4AIH A;  3BP8 A;  2ZCW A;  5CJ9 A;  4FX4 A;  1O3S A;  1WWX A;  5D6F A;  4EJU A;  5LBQ A;  4XRF A;  4HQM A;  2H27 A;  1T0F A;  5F1R A;  3KP5 A;  4IRH A;  4KT5 C;  2EFN A;  3TKY A;  4IVN A;  1OPC A;  4ON0 A;  2FE3 A;  5BS6 A;  1Z7U A;  1A04 A;  2XIG A;  4LGW A;  5D8K B;  5ICC A;  1ZYR F;  1W4M A;  3V8J A;  3VOD A;  1I1G A;  1SMY F;  3HSF A;  3FM5 A;  3IL2 A;  1OKR A;  5LHI A;  2A07 F;  3E6D A;  1U5T C;  4KA4 A;  3GZ5 A;  2IJL A;  3GWZ A;  4O3M A;  3OV8 A;  1UHM A;  2XGX A;  3PFI A;  1PDN C;  4MTE A;  4HBL A;  3T1B A;  2OZU A;  2D2W A;  1IAW A;  2L54 A;  4L9J A;  3TO7 A;  4LLN A;  4HF0 A;  1FYM A;  2XKP A;  2YPR A;  3B02 A;  4PGG A;  5DDG A;  3HSR A;  3ZMS A;  4BYY A;  4BHB A;  2FEZ A;  2UWM A;  3RI4 A;  4O6J A;  4A6D A;  3RTR A;  3C18 A;  2RVC A;  2QEN A;  5AIQ A;  5DUI A;  4XBF A;  4M6Y A;  5LLQ A;  2OQG A;  1T38 A;  2Q2E A;  2W85 A;  3E5X A;  4G6Q A;  2XAG A;  3ISP A;  3KE2 A;  1QGP A;  2K86 A;  2FBK A;  4EJW A;  4BQA A;  1SD5 A;  3HHH A;  2AS5 F;  4LB5 A;  5IT9 Z;  4I98 B;  3FF5 A;  3D0S A;  1FT9 A;  1YQA A;  5E18 F;  2GZW A;  3ZMV A;  4M73 A;  3NEU A;  3WG9 A;  4QLC U;  1I6X A;  2XAQ A;  1DPU A;  2RGV A;  2H09 A;  1TTY A;  3K69 A;  3EDP A;  2GA2 A;  2DK5 A;  3N97 A;  1UST A;  2Z33 A;  3E5Q A;  3MFK A;  3M1E A;  2HYG D;  3ZQ7 A;  4LMY A;  1REP C;  3KZZ A;  1J9I A;  1VTN C;  1ON1 A;  2VE8 A;  1CF7 B;  1XCV A;  1OR7 A;  3K9T A;  4GYI A;  1CGP A;  4ZYE A;  3JSO A;  2QQB A;  4I2O A;  2QQA A;  1BC8 C;  4R1H A;  1SD6 A;  2FRH A;  3FHZ A;  3RKW A;  2V6C A;  4M6X A;  1KU3 A;  4FHT A;  2XAS A;  2A69 F;  1XMA A;  2GIV A;  1J0R A;  5JFR A;  2E7X A;  1YYV A;  4DNC A;  1CF7 A;  4ENK A;  2YX7 A;  4YG2 F;  1FYK A;  4A0Y A;  4LK1 F;  3CUQ B;  1DPR A;  3RKY A;  1IZ1 A;  1ONV A;  4NB5 A;  1R36 A;  3IRR A;  2F5D A;  4N9I A;  2RKH A;  3GO5 A;  1KU2 A;  5KK1 A;  1J59 A;  4HA8 A;  1ZGA A;  1FOK A;  3H3Z A;  3T0Y A;  4NQW A;  2DK8 A;  2VBX A;  3CUQ A;  3WU0 A;  4OIR F;  5D8L B;  1MJ9 A;  3JSP A;  3DEU A;  2PQ8 A;  3T8R A;  4L9V A;  1DDN A;  2FU4 A;  3EET A;  1PP8 F;  3F8N A;  4UVC A;  4HV6 A;  1LVA A;  1O3R A;  2RDP A;  1HW1 A;  1KA8 A;  3LA3 A;  1DP7 P;  3HYI A;  2M1B A;  3C7J A;  3D5L A;  4MTD A;  1EH8 A;  2DLL A;  4I02 A;  1LEB A;  2HGC A;  4L0Z B;  5HDG A;  4I0B A;  3ML6 A;  5HS9 A;  1SD7 A;  4A5M A;  4L5I A;  4UVB A;  3CLO A;  4MEX F;  4UNO A;  1E17 A;  2DO7 A;  1R22 A;  2BYV E;  4MNU A;  4RAY A;  4P55 A;  1LQ1 A;  3REO A;  1C0W A;  3DPT A;  1UB9 A;  3FWE A;  5AON A;  3GX4 X;  2XV4 S;  2EJR A;  4EJT A;  3GF2 A;  5TRD A;  1XGM A;  2EA4 A;  4A0X A;  4Q4Z F;  3WTZ A;  5D5U B;  3IRQ A;  3JAM K;  1XB4 A;  1XCB A;  5BPI A;  3HHG A;  1MGT A;  3HSE A;  3V4G A;  2HKO A;  1W5S A;  3KP2 A;  4HX4 A;  2PN6 A;  3BRO A;  4U0Y A;  4P9F A;  4UVA A;  4CDG A;  2DPU A;  1SMT A;  3L2C A;  5JR3 A;  2ZNY A;  4GXO A;  3IHU A;  2ELH A;  4KIB A;  1B9M A;  2HQR A;  1R5G A;  1ZGJ A;  4WCG A;  2STW A;  3ZPL A;  3IC7 A;  4HDU A;  3R61 A;  4MGR A;  1D5V A;  1B4A A;  4G6D A;  1TW2 A;  2HOE A;  2HTS A;  1KQ8 A;  3QU3 A;  3F22 A;  3CUO A;  5FB2 A;  1YIO A;  4HLY A;  4ETS A;  2A3S A;  3F23 A;  4F7Z A;  2JPC A;  2K27 A;  3TGN A;  1JE8 A;  2VOP A;  1HSJ A;  5DUK A;  3EYI A;  1ZAR A;  4XSX F;  5JHU A;  4WXC A;  3GEZ A;  4CGZ A;  3KZY A;  1WI9 A;  1H9G A;  5ILU A;  3U1D A;  2DT5 A;  4WWC A;  2JT1 A;  2NRA C;  3L7W A;  2YU3 A;  4B8X A;  3EUH A;  3GFM A;  1FPQ A;  3FMR A;  4K2E A;  1UHW A;  2L4A A;  1BM9 A;  5H20 A;  3MZY A;  2MH9 A;  2R3S A;  4EVI A;  4HF1 A;  2E1N A;  3TDU C;  3GYH X;  4LD5 A;  4B09 A;  1XGS A;  3Q9V A;  3WGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...