3WTXC

Crystal structure of the complex comprised of ets1(y329a), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
103
structure length
103
Chain Sequence
PIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
total genus 35
structure length 103
sequence length 103
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtxC00
4KFCA 2MH2A 3OV8A 3L09A 1ZG1A 3JSPA 3WTXC 3CO7C 1BBYA 2H94A 3V4GA 4ESJA 4M6YA 2OQGA 2ZMEB 3JAMZ 2JPBA 3BOQA 1G3SA 1JGSA 3CDHA 3GVAA 3V7CA 3ULQB 2HYGD 5EEHA 3T1BA 1J7KA 2HR3A 4PDKA 4MQVA 1SFXA 3FZVA 2IPQX 1KU9A 1MJ9A 5L3FA 2HDCA 1SD4A 5ICFA 3LA7A 1S7OA 2E1CA 3G73A 1IZ1A 2FMLA 4RGXA 4M9SA 3B73A 2OAZA 3WTSC 2VE8A 3CJNA 1I27A 4HQEA 4DQ2A 2Z3YA 2HYFA 2VODA 1L0OC 3BWGA 2HKXA 2CG4A 3R0JA 4CZZA 5IT3A 1WSUA 2K86A 3GO5A 3NRVA 5D8LB 2EV6A 1TW2A 3TDZC 1QPMA 2XAQA 3HTSB 5DUKA 5CJ9A 2D1HA 4EJTA 2BV6A 2W57A 3TDUC 2EV5A 4CXFA 3I59A 2BYVE 5L3DA 2OBPA 1XCVA 5LRRA 3IHUA 4OU0A 2O03A 3O6BB 4M73A 2STTA 3PFIA 3FF5A 3FX3A 4D0PA 1E2XA 1REPC 2JPCA 1FSHA 1IN6A 4ZZLA 1ZRFA 2YU3A 2EFQA 5JR3A 5BPDA 2XRNA 4ENJA 2QZ8A 3C1DA 4IF4A 1UFMA 4I2OA 4A5NA 4XLNF 5ICCA 2EWNA 4Q48A 2BEOA 5DYMA 1RUOA 1O3TA 3F72A 4ENNA 3JTGA 3I0TA 3GFMA 1ZYRF 2P7VB 2H27A 3ZMDA 3GZ5A 5ICEA 1OYYA 1BI3A 1BIAA 2P5LC 2VBZA 5ERIA 5HLHA 1S3JA 1MJBA 1G3WA 3IWFA 5FD5A 3ZQ7A 2ADUA 3FMRA 1O3RA 1XCBA 4UVAA 5H20A 4OMYA 2FRHA 1I1GA 2DQLA 4M72A 2H09A 4EM0B 2IJLA 4IJAA 5FFZA 2FF4A 2HFHA 1RZ4A 5DEQA 4B09A 2M45A 3KCCA 2DQRA 4EMSA 5IT9Z 1IRFA 2P5KA 5D5UB 5HDKA 4HLYA 2YSRA 1HBXG 1ZN2A 3BJAA 1U78A 4EVIA 2JT1A 1K6OA 1RI7A 5JVTA 5E1ZB 1I1SA 1ODDA 4U0YA 4EQQA 2FEZA 4A2UA 2FBKA 2WC2A 2DFIA 1IF1A 1K78A 3GLXA 2ESNA 2H6BA 1F5TA 1USTA 1Z6RA 4A6EA 4OIOF 3HTUA 2E7WA 2ACJA 2K7LA 5LHGA 3G3ZA 3GWZA 3M7GA 2X0LA 4WCGA 1J2XA 2ZNZA 1W4MA 4KIFA 5E18F 3T8RA 1CGPA 2HKOA 1Z7UA 1R5HA 4RB2C 4BHCA 3HSRA 2NNYA 4Y17A 3QAHA 1J59A 2M1BA 1P6RA 1BJAA 2XASA 3FMSA 4L9VA 1TNSA 4WWCA 2P6SA 2MLGA 4G7ZF 4IPAA 1XGSA 3RPUA 2NS0A 1B59A 3ZN1A 4Q47A 3ERED 3QOPA 5CVIA 1BC7C 1TW3A 1SMTA 5HDGA 3RJPA 5H6RA 2F5FA 5CVUA 3CO6C 1LQ1A 1T6SA 4YFXF 3DPTA 2M8EA 1OYIA 2VBYA 2V1DA 2UXXA 2MH9A 1HW2A 3HIFA 3KP5A 4GYGA 5JFRA 5FFXA 2BBYA 2FNAA 4ZYDA 1Z9CA 4AIKA 1PP8F 1R00A 2JRTA 2VOOA 3O2PE 1HKSA 3F23A 3J81Z 3HHHA 5K1YA 1EH7A 3BPVA 1T0FA 2F5EA 2ZXJA 4OINF 1STZA 3J80Z 1AOYA 1ZRDA 4KMUX 2RVCA 4I02A 3WU0A 3V7SA 2XHKA 1KA8A 2ZJ2A 4A0ZA 5D6EA 1R58A 2DI3A 5D4RA 3ROUA 4YIFA 4ON0A 2PBIA 2HS5A 4KN7X 1HQCA 3R6SA 4XBFA 3FXRA 5L3CA 4HAMA 2LF8A 5LGTA 3T8TA 1V3FA 1FBQA 1SMYF 3Q5FA 2L3DA 3WTUC 2HWVA 4ESBA 3WTVC 5K5QA 5F6FA 4EJOA 2PJPA 2GAUA 4RGUA 5AIQA 1S6LA 3GYHX 4AIHA 5H6QA 3MQ0A 5HLIA 2QBYA 5LEKA 1RNLA 3E5XA 2UZKA 2ZNYA 2FA5A 2IVMA 4N9IA 5DD4A 2XAJA 3U2RA 3ABUA 3BPXA 4LFUA 5ILUA 1HSJA 2RNJA 5DCMB 3P7NA 1ZG5A 2Z9OA 1OPCA 4XSZF 1EH8A 4KIGA 3FM5A 2RC4A 4S04A 5F64A 2P4WA 2STWA 1WWXA 2UXNA 1F1ZA 3BROA 3WODF 3F8FA 1FP2A 1ZARA 5E1XA 2P8TA 1VTNC 3TGNA 4KA4A 1FZPB 3IL2A 4IXAA 1XGOA 4S05A 1UHMA 2Q0OA 1W5TA 1Z1DA 1YTYA 3HSFA 2FXAA 4ZH4F 1TBXA 2XIGA 3P9IA 1P2FA 2F5CA 2HZTA 3ECHA 3TOAA 3F3XA 1W7PB 1IAWA 3V8JA 5DUIA 3EDPA 4M9ZA 4UHTA 1G3TA 4YIIA 2DW4A 4MQ9F 1WI9A 4L18B 5LEJA 1ZREA 1D8JA 1ZGJA 3QU3A 3B02A 1XD7A 3LFKA 4CHUA 2G7UA 3N97A 4G7OF 4R8HA 1ZLJA 2AS5F 3SFZA 5L3EA 1U5TB 4JBAA 1R5GA 3GF2A 1QZYA 1BI1A 1TTYA 3RKYA 4LG0B 4GYIA 3ZMTA 1Q1HA 2EK5A 2EV0A 1BM9A 5HLGA 4L9TA 3LQRA 1DUXC 4KN4X 3S2WA 2PN6A 4KDPA 3BDDA 4Y13A 4NQWA 3K9TA 2R7FA 1G4DA 3KP2A 3MZYA 4CYDA 4WXCA 3I54A 3F21A 4L5JA 4LK1F 5FLXZ 1OMIA 2X4HA 5TJJA 4I01A 4RGRA 4MTDA 3TO6A 1FY7A 4GO1A 4E70A 2V6CA 1WQ2A 4WX9A 3LA2A 1JXSA 4N0BA 4EM2A 1JE8A 1S7AA 4PGHA 1DPUA 1IN5A 2YPRA 2ISZA 3BJOA 4XSXF 5BS6A 4FX4A 1S8NA 2EFNA 1T38A 3NQOA 4WF2A 1J75A 3DV8A 3RKXA 1KQ9A 2Y48A 1XMKA 3GXOA 2A6HF 2J5PA 1LDKB 3ZPLA 5HS9A 4CDGA 3NEUA 5BOXA 5HS8A 2RQPA 2TDXA 3I4PA 1T98A 2A6EF 4ZYEA 1T39A 3K1PA 1XB4A 4EV0A 3E6CC 4XRFA 1P4XA 1YG2A 2DO7A 5ILSA 5L3GA 2FBIA 3M9AA 1P4AA 1FX7A 4G6DA 4UXNA 4JK1X 3AAFA 1L3LA 2FBHA 4PZJA 4KUMA 4EGYA 3M8EA 5BPIA 1KYWA 2CW0F 1R36A 2MA3A 1HSTA 4RAZA 2FOKA 1GXPA 5D5XB 1FT9A 1PP7U 2XROA 2NNNA 1D5VA 1CF7B 4G6QA 4N9HA 1ZLKA 1IUYA 4EM1A 2XKOA 1YW7A 3IKTA 2WTEA 2M5WA 5LGUA 3E6DA 2VONA 3LA3A 4HW0A 4A12A 2Z5UA 2XAHA 4LLLA 3W6JB 4HX8A 5LRSA 3FM3A 4A0XA 2K02A 1V4RA 3KETA 1ON1A 3COAC 3ZMUA 5ED4A 2LKPA 4EJWA 5LBQA 5AONA 4UV8A 4PCQA 3DQVC 3VFZA 3DEUA 2XUBA 5JI6A 2EA2A 1HW5A 2EFOA 3H92A 4MTEA 4GCVA 5D6FA 4LD5A 3WE3A 2R3SA 2PMHA 3SZPA 5L3BA 1FLIA 3GEZA 3GUDA 5CYVA 1DDNA 3P9CA 3RYRA 1H9TA 5LLQA 4ETSA 3CUQB 4I0BA 2V9VA 1S29A 2M30A 3IRQA 4O5VA 2GXBA 1R1VA 3MWMA 5HOOA 2CFXA 1YLFA 3DXJF 4I7HA 3FWEA 3F22A 2AXLA 4M71A 4R1HA 2XV4S 4AVPA 2O6GE 3I71A 3DPLC 4MEYF 2PMUA 3J81K 1F9NA 3KZYA 3E5UA 3ML6A 2M87A 1PUEE 1UHWA 3J80K 1O57A 2Y0MA 4KT5C 2FNPA 3K69A 2GQQA 3OOPA 1MD0A 2K4BA 3C3WA 1B1BA 1LJ9A 3IKVA 2O8XA 1WKMA 5E20A 4L0ZB 2LDUA 4LLNA 1LNWA 1TNTA 2GXGA 4LG0A 2VOPA 2OA4A 3C7JA 2QLZA 3L00A 4KNYA 3ECOA 1R1UA 1KQ8A 4HA8A 4FHTA 2XVCA 1FWZA 2ZMEA 2W25A 3MFKA 3JW4A 3TQNA 5HS7A 1K7AA 3IC7A 3BJ6A 1EV7A 2HQRA 5CVRA 2IA1A 1ZHFA 3GX4X 3F8NA 3F8MA 4QLCU 1KYZA 1HKQA 2H6CA 4JQFA 4G7HF 4EJVA 2IT0A 5LGNA 1TLHB 3EETA 3K2ZA 2EA4A 1KQ0A 2L4MA 2IRFG 2DU9A 1XN7A 3KLOA 4LB5A 1R23A 4FT8A 2HQNA 2VBXA 3M8FA 1O7LA 3KE2A 1U3EM 1FC3A 3HYIA 1QQIA 2QWWA 3L2CA 2IW5A 2A61A 1BC8C 3RI4A 2IA2A 1SFEA 2DPUA 1J5YA 3ABTA 3M1EA 2P6TA 2OQRA 1XSDA 4ASNA 2GZWA 2FMYA 2PEXA 2RGVA 2D2WA 2VN2A 3HRSA 1XDUA 3WGGA 5F1RA 3V8LA 1IN7A 3WGIA 5FD6A 3J7AO 3GFLA 4YG2F 1AWCA 4ENKA 2NAZA 3WTTC 2RDPA 3ZP5A 3HRMA 2ZFWA 3E3VA 3KP3A 2QM3A 4CICA 3WTWC 1MDMB 2XAGA 1TQPA 4HDUA 4OIQF 3U1DA 3KP6A 3REOA 3WGHA 1A04A 1OKRA 5BQTA 3RTRA 5A2QZ 1XGNA 1QBJA 3MAJA 1RUNA 4U0VA 4HX4A 3DFGA 2NYXA 4OOIA 2F5DA 2W84A 5D4SA 4HV5A 4IRHA 4Q5SF 4LK0F 5BMZA 4BQAA 1Z91A 2LSOA 4ZZDA 1LDDA 2VC0A 2W24A 3HHGA 3WTZA 5HDNA 1XMAA 3TOBA 1YW9A 4KYWA 2DK8A 2O0YA 4BXUA 2B0LA 2VXZA 4HYEA 3JAMK 2JTVA 5HVQC 4P55A 2A5YB 2OZ6A 2Z33A 1IXSB 2A68F 1WRJA 3LAJA 1FYKA 1X3UA 1SAXA 1QZZA 1BOAA 1LEAA 4LMYA 5CLSA 2Y75A 1FPQA 1UB9A 3FMQA 3HRTA 4B8XA 2PI0A 3LAPA 3D0SA 2R7DA 3E6MA 1QNTA 3KP7A 3RKWA 3T5XA 2KJBA 4UVBA 5E8GA 1BI2A 2LF7A 3CUQA 3SZTA 4FX0A 1IRGA 3QPHA 4M9XA 1IN8A 2VBWA 4ZYHA 2IA0A 4U7DA 3ELKA 3VB2A 2KIUA 3BP8A 1Z6TA 4EGZA 4YFNF 3QU6A 4Z2YA 2YX4A 2ZCWA 4BNCA 2RKHA 2QQBA 1SD6A 1B9NA 4IRGA 3R4KA 5DCFA 4HBLA 1PDNC 4UNOA 2CO5A 1K79A 2GIVA 1YIOA 4NB5A 4BAYA 4NHJA 2Q2EA 3PQKA 4P96A 2P7CB 5FB2A 3ISPA 1G6NA 1LB2A 1FOKA 3ZMVA 1USSA 2QQ9A 3TO7A 1TQMA 1MKMA 3CUOA 3IRRA 1D3YA 4HOBA 3FXQA 1FNNA 1ZGAA 1J9IA 3DP7A 1JHHA 2V1XA 5K5RA 1SD7A 4UUVA 1R22A 1U2WA 1B4AA 2OD5A 4OIRF 1U8RA 2OU2A 1KU7A 3K1NA 2ZBKA 3QP5A 2COMA 4WK8F 2LNBA 4UVCA 4AIJA 5CVJA 3U9GA 2G7HA 1ZRCA 2FSWA 1XSXA 1I6XA 3FHZA 1O7FA 2YR2A 1E17A 4TV7A 2EB7A 1H0MA 2CGPA 5D8KB 3EQLF 2XAFA 4HF0A 5DV5A 1FBSA 2L01A 3E6BA 1SD5A 1B9MA 1KU3A 5EEGA 3BY6A 1P92A 2XGXA 4GGGA 4BH9A 3Q9SA 3KP4A 3O3KA 5JHUA 2A3SA 5IT9K 2Q8KA 2A69F 5LHIA 5E17F 4MHGA 3D5LA 1KU2A 2L4AA 3QP6A 4U0WA 4HQMA 2MD5A 1U5TC 3MZHA 3SHFA 4M6XA 1Y0UA 4HLXA 5CVVA 1BI0A 3K1MA 2RV8A 1LVAA 2EFPA 1FYMA 2QBYB 2CYYA 1YS6A 2E1NA 1XSVA 1HXDA 1ZG3A 2PQ8A 3DF8A 1J0RA 1BN5A 3KEOA 4PGGA 1MDMA 1EH6A 2HEOA 3HSEA 3ZN0A 3WU1B 2HTSA 3HOTA 3C18A 2VC1A 1YW8A 4K2EA 2HGCA 2QENA 3PQJA 3ZMSA 1NHAA 3GW2A 5TRDA 3E97A 2L02A 5K5OA 4BYYA 2EJRA 4HV6A 2ETHA 1FYLA 2ZKZA 5KK1A 1TQIA 5DCMA 3TKYA 2DK5A 3EYYA 1KGSA 2QVOA 2KRFA 2W85A 1HKTA 2VE9A 3LWFA 1XDSA 1GHCA 3F8CA 4H0EA 3Q9VA 5E1WA 1ULYA 2QUFA 1D8KA 1ZAOA 2CWEA 2G9WA 4L0YB 1SFUA 1P4WA 5D5WB 4BHBA 3ZMZA 3GFJA 1FSEA 3E5QA 4HF1A 2ELHA 2L54A 4LLGF 2PFBA 1W7PA 4RB1A 2FU4A 1T2KA 2C6YA 1O3QA 2GWRA 1ON2A 1OR7A 3QPTA 4P5OA 4YFKF 3HUGA 1DP7P 1ONVA 2HTJA 2DPDA 4I09A 4U88A 4LGWA 1I5ZA 2JZYA 2KKOA 3KEQA 2FE3A 3R61A 1IW7F 2QYOA 4HZFA 2V1UA 1U5TA 3KLNA 4R79A 3MCZA 1YS7A 4WXDA 4ESFA 1HW1A 1JHFA 4G94A 2K27A 2DBBA 4CGZA 2P5VA 2RN7A 3LSTA 1MJAA 2PG4A 3L7WA 3KZZA 3R0AA 2E7XA 2A07F 2FQ3A 2K4JA 2UWMA 4F7ZA 3H3ZA 3KFWX 1LEBA 3JTHA 3CTAA 4AD9A 2ISYA 5E8IA 4GXOA 4L9NA 2ESHA 3N4MA 5DDGA 5A2QK 3RYPA 5ILVA 2MC3A 2F2EA 1MGTA 2MLKA 2BE5F 2DTRA 1F4KA 4KMFA 3WTYC 3K0LA 3F6VA 2O3FA 3I5UA 2DT5A 1XGMA 1R1TA 4KICA 2V79A 3I59B 2VT3A 4O3MA 3F8BA 3CUQC 4ENMA 3W6KB 4RB3C 4IHSA 1QO0D 4ZYGA 2YX7A 4O6JA 4A5MA 4AWXB 3HRUA 5D5VB 3I64A 1IXCA 2CSOA 2EFWA 3GFIA 2KIFA 2KJCA 1LDJA 2GA2A 3I53A 3VODA 4UV9A 4RGSA 5LHHA 4BHPA 2XKPA 4G8XA 4A6DA 5J8CA 2PLYA 2OZUA 1W7PD 2DLLA 1DPRA 3L9FA 4MEXF 4I0AA 3CLOA 3T0YA 3RDIA 2J5OA 1YFHA 3I58A 3SXYA 2QQAA 3SQNA 4WXHA 4HX7A 1QGPA 5FGMA 3LQQA 2JSCA 1B6AA 4CO8A 3HOSA 2D1VA 5AIPA 4LB6B 4EJUA 4LJZF 1IN4A 2O61A 1CF7A 2DAOA 4IRIA 1GVJA 2BGCA 4OMZA 5FO5A 3RIRA 2CQKA 5ICGA 3FXUA 4L5IA 3VOEA 4RS8A 4MGRA 3JSOA 5J6XA 4OIPF 1U6GA 2NRAC 1R7JA 1YQAA 1IXRC 1ZH5A 2KIMA 3H3UA 1MZBA 4A0YA 5J8FA 5DD8A 1Z05A 1H9GA 4HF2A 4HDVA 4RB0A 2MBFA 3EUHA 3R60A 2VT2A 5FLXK 1BIBA 3P9KA 4Q4ZF 4Y15A 3DKWA 4RAYA 4P9FA 3F6OA 4KIBA 1RIOH 1YO5C 3WG9A 2WWYA 1K78B 2GA1A 1G3YA 1OYWA 3RPQA 3TO9A 4IVNA 3EYIA 2Z99A 1C0WA 4G9YA 2ZO4A 3IWZA 4QWQA 3WE2A 6PAXA 2WV0A 1O3SA 1FP1D 3GZ6A 4M74A 4L9JA 1YYVA 1GXQA 2IP2A 1FBUA 3MEXA 5KVRA 3VEPA 3BZ6A 4I98B 4DNCA 4U7BA 2D45A 2HOEA 4XLPF 4P9UA 3V8KA 4IHTA 3QRFF 1UCRA 4MNUA 3V7RA 1W5SA
chains in the Genus database with same CATH superfamily
4KFCA 4AYBN 2P81A 2MH2A 3OV8A 3L09A 3QYFA 1ZG1A 3JSPA 2HQAA 3WTXC 3CO7C 4C2MJ 3DU5A 2VPLA 3BQZA 1VNDA 2Z1DA 1BBYA 2KHMA 4ZDOA 2H94A 3V4GA 4ESJA 4M6YA 2OQGA 2ZMEB 3HKZA 3PNYA 3JAMZ 3H9JA 2DODA 2DA2A 3CDLA 3W2AA 2JPBA 1N77A 3BOQA 1G3SA 2L5QA 1JGSA 3CDHA 3GVAA 3V7CA 3A01B 3ULQB 2HYGD 1GT0C 5EEHA 2JUCA 5JLWA 3T1BA 2H1LA 4A3GJ 1J7KA 2HR3A 4PDKA 4MQVA 2IS2A 4BJ5C 4B43A 4XNFA 2W00A 1SFXA 3FZVA 4DZJA 2R7QA 2Z2SB 2DA3A 1BL0A 3OL4A 3UR3C 2ZFUA 2IPQX 3L2UA 4IEJA 1KU9A 1MJ9A 5F0HA 5L3FA 2HDCA 1SD4A 5ICFA 3CMMA 3FXMA 1HDDC 3BTIA 3LA7A 3K6GA 1S7OA 4J01A 5F1JA 2E1CA 3G73A 1IZ1A 1WCMJ 4IHVA 2DMTA 1JKQC 4XRMA 2FMLA 1X58A 4RGXA 1QHGA 4HSRA 2EZIA 2WA0A 4BACA 2XDVA 1I3AA 4M9SA 1IC8A 2E71A 3B73A 2OAZA 3WTSC 2VE8A 2TCTA 3CJNA 2VLAA 1I27A 1ZTRA 5HLTA 3TBIA 4HQEA 4DQ2A 2Z3YA 2HYFA 3C2BA 2VODA 1L0OC 3BWGA 2HKXA 2CG4A 3TW7A 2E2HJ 1R5ID 3R0JA 4CZZA 5IT3A 1N25A 1WSUA 1Z3YA 2IBDA 4QTRA 2JQ7A 2K86A 3LOCA 3GO5A 3OS2A 3NRVA 2ZSHB 1HLVA 3H3VK 3A03A 5D8LB 3BQYA 3LSRA 1YX5A 2CUFA 2EV6A 3CDIA 1TW2A 2LOOA 4J19A 4IOCF 3TDZC 1QPMA 2HU9A 2XAQA 4DYCA 3HTSB 5DUKA 4RM3A 2D1HA 5CJ9A 2BV6A 4EJTA 2W57A 3ZRGA 1ETOA 3TDUC 5C44J 1YIJI 2EV5A 2FJ1A 4LG3A 4CXFA 3I59A 2BYVE 1QRYA 5L3DA 1D1AA 2EINH 2OBPA 1XCVA 5LRRA 1DU6A 3IHUA 1A31A 1XTAA 1ETXA 1Z0XA 4E7LA 3I9V2 4OU0A 5B5EC 2O03A 4U87A 3O6BB 1V54H 3Q0WA 5EJCA 5KAIC 4M73A 1W1WE 3MZ8A 2STTA 3ZXSA 3EUAA 3PFIA 3FF5A 3S32A 3BT9A 3FX3A 4D0PA 1E2XA 1JJ6C 2BY3A 2ZJRF 1REPC 1X2NA 2EZKA 2JPCA 4XONA 1IN6A 3DPUA 3BG7A 4B48A 2F4OB 4ZZLA 3OYAA 3D1NI 1ZRFA 2YU3A 2M4KA 2EFQA 1X1DA 5JR3A 3HZJA 5BPDA 2XRNA 1FTZA 4ENJA 1F43A 2CW7A 3ONQA 3S1MJ 2QZ8A 3C1DA 3GTLJ 4IF4A 2HXOA 1UFMA 4I2OA 3FKIJ 4BU2A 4A5NA 4XLNF 5ICCA 2EWNA 4Q48A 2BEOA 3OS0A 1YITI 4PJNA 5DYMA 3CMEI 3LSKA 4QPQA 1RUOA 1O3TA 3F72A 3HJEA 2CMPA 2LY2A 1Z7LA 2LKXA 1MBHA 4BXFA 5H2FC 1ZQ3P 4ENNA 4IL6C 3JTGA 3EPZA 4HNUA 3I0TA 3GFMA 1ZYRF 2P7VB 2H27A 3PFYA 3ZMDA 2R7WA 4HEA2 3FBIB 2E19A 1XX5A 1M1EB 4ZDLA 3GZ5A 5ICEA 1OYYA 1BI3A 2QQ8A 1BIAA 2P5LC 2VBZA 1GVDA 5ERIA 5FLVA 5HLHA 3OYCA 3S3NA 1S3JA 1MJBA 1G3WA 3VYTB 3IWFA 4CCLA 2L9RA 1VQ9I 2L9NA 3GTMJ 1WJAA 2CH0A 5FD5A 3ZQ7A 5GAGJ 5FRNA 1B8IA 3DLAA 2MABA 2VXDA 1X1CA 1SVMA 2WADA 2ADUA 3M4OJ 3FMRA 1O3RA 1XCBA 4UVAA 5H20A 4OMYA 2FRHA 4B44A 2JRMA 1GV5A 1I1GA 1Z67A 3ZQGA 4D9JA 4BJ6C 2DQLA 1D0YA 4M72A 3LSJA 2JSPA 4Y4RA 4CSWA 5M3MJ 2H09A 4XQFA 3JRAA 2NVYJ 4ABZA 4EM0B 2IJLA 4IJAA 5FFZA 2R92J 2FF4A 1O4XA 3ESWB 2HFHA 1RZ4A 1WGXA 5DEQA 4X1EA 2XB5A 1T0FC 4B09A 2M45A 3KCCA 4A3LJ 1YI2I 1OCCH 4RDUA 2DQRA 2BY2A 4EMSA 2AQFA 4MFDA 5IT9Z 2IS4A 1HOMA 4PJMA 3CCMI 1IRFA 3H5RA 2EIKH 2P5KA 2QSFX 3Q3SA 3X2QH 5D5UB 5HDKA 4HLYA 2R93J 3S14J 2WB1A 3SYTA 2L7MP 2YSRA 4IQ4A 4XR6A 1HBXG 4BL0B 1ZN2A 4EATA 1GUUA 3ZR8X 3BJAA 1U78A 1SC7A 1MNDA 3DBLB 2X1EA 3FISA 4EVIA 4CH7A 2Y9YA 2JT1A 4AYBA 4PFPA 2R5ZB 3PO2J 1K6OA 1RI7A 5JVTA 5E1ZB 1I1SA 2JWTA 1ODDA 4U0YA 1K6YA 2A5WA 4EQQA 2FEZA 2X1CA 2RREA 4A2UA 4XN0A 3RZDJ 2FBKA 2WC2A 1W0UA 1H89C 1MBFA 4H4KC 2DFIA 3LSPA 1IF1A 1AKHB 1K78A 3GLXA 2QCOA 2ESNA 2H6BA 1F5TA 5EZGA 1T95A 3CCUI 1FOXA 1USTA 2F6CA 1Z6RA 2M3AA 4A6EA 4M6VA 3ABMH 2R7VA 1UAAA 1SFKA 4OIOF 3S1QJ 3HTUA 3K7AJ 2E7WA 4NNJA 5F27A 2ACJA 2K7LA 1VQLI 5LHGA 3G3ZA 2F5VA 3GWZA 3M7GA 2X0LA 2MYSA 4WCGA 3S17J 1J2XA 2ZNZA 1W4MA 1W0TA 2DN0A 4KIFA 5E18F 3ABLH 1AA7A 2PX9A 1ENHA 2DT7B 2EZLA 3T8RA 1Y39A 3TP3A 1CGPA 3OYIA 2HKOA 1Z7UA 1R5HA 2L9SA 4RB2C 3HBLA 4BHCA 3HSRA 1TWCJ 3GBGA 2NNYA 4Y17A 1MNEA 2OV7A 3QAHA 3G1MA 1J59A 3CCVI 2M1BA 1P6RA 2MSYA 1BJAA 1PJRA 2XASA 1QA6A 1U0JA 4B1RA 4XMYA 4RLFA 5J1YA 3FMSA 4JYKA 3CC4I 4L9VA 1TNSA 4XLAA 4WWCA 3AG3H 2KPMA 3RQIA 3OYFA 2P6SA 1MBGA 2LH9A 2MLGA 1E3OC 3CZ6A 4G7ZF 4IPAA 1XGSA 1U9NA 3H9QA 1KZHA 3RPUA 2FQ4A 2NS0A 1B59A 3ZN1A 5JHFA 4A3DJ 4Q47A 1TWAJ 4A3KJ 3J7ZI 2LK2A 3ERED 3QOPA 2JMWA 5CVIA 2BZTA 4UUSA 3BLYA 2FX0A 1TW3A 1SMTA 5HDGA 3RJPA 1BC7C 2V7FA 1Y1WJ 1WJCA 1FOWA 1BR4A 3K70C 5H6RA 3MN2A 2F5FA 2HXIA 2B7EA 3HC7A 5CVUA 5FROA 1T6SA 3CO6C 1LQ1A 4YFXF 1MH4A 2Y2ZA 3DPTA 4AIDA 2M8EA 2L9VA 2X48A 1OYIA 2W48A 1MBJA 5FKKA 2VBYA 3J7AY 2V1DA 3DTIA 2UXXA 4IOAF 2MH9A 1HW2A 1LFUP 3HIFA 3KP5A 4GYGA 1I3QJ 2JA5J 3BG3A 5FFXA 5JFRA 2BBYA 2FNAA 4ZYDA 1XS9A 1Z9CA 3U21A 4AIKA 1PP8F 1R00A 2JRTA 4CCNA 3MKWB 5CKTA 3O2PE 2VOOA 1OCPA 1HKSA 3F23A 5J1RA 3J81Z 3CC2I 3HHHA 5K1YA 4M3DA 1EH7A 2ID3A 3BPVA 1T0FA 2ZXJA 2F5EA 2X6WA 4OINF 4PSXA 1STZA 4C30A 3J80Z 1AOYA 3L2WA 1ZRDA 4KMUX 2R7ZJ 2RVCA 5KHDA 3DBHB 4I02A 3S15J 3OYKA 3WU0A 4BEHA 3IH4A 3V7SA 3KIOA 2XHKA 4CZCA 2M0CA 3MD2A 4BUPA 1KA8A 3RCOA 2V26A 2ZJ2A 4A0ZA 5D6EA 2UUZA 4Y3OA 2LRDA 3ABKH 3BR2A 4MFEA 1R58A 1IUFA 4XKBA 3DLLF 2E1MB 1NG7A 2DI3A 2DT6A 5D4RA 3ROUA 4CA0A 4YIFA 4ON0A 4XK4A 2PBIA 3OSFA 1TC3C 2HOAA 2EIMH 2HS5A 2OC6A 1HQCA 4KN7X 2HQ5A 3CCSI 3R6SA 3OR2C 4XBFA 3FXRA 5L3CA 4HAMA 2LF8A 5JLXA 5LGTA 1LFBA 3T8TA 1UELB 1V3FA 1X4OA 1FBQA 1SMYF 2WY8Q 4XRSA 1Y56A 5EGOB 1Y0NA 3MKZA 2L3DA 3Q5FA 1MBKA 3WTUC 3BR5A 2HWVA 1N75A 4JP0A 2JA2A 4E7SA 2XSDC 4ESBA 3WTVC 2Y0SA 2JUGA 2VJ4A 5K5QA 5F6FA 2QA4I 3SZGA 4EJOA 2PJPA 1IO2A 2GAUA 4NC8A 3BTCA 4RGUA 5AIQA 3H0DA 1S6LA 3GYHX 3LMMA 4AIHA 5H6QA 3RSNA 3MQ0A 3OYBA 5HLIA 4XLCA 1PUFB 2QBYA 5LEKA 1RR7A 4AU7A 3HL2A 2V6EA 1RNLA 3E5XA 2E5ZA 3L1PA 2UZKA 3FXJA 2ZNYA 2FA5A 2IVMA 4N9IA 3OYLA 4KITB 1OFCX 3AFHA 5DD4A 5FKLA 2XAJA 3U2RA 2EPFA 3ABUA 3PIPF 2RQQA 1P7JA 2DDBA 3BPXA 4LFUA 5M3FJ 5ILUA 3H1CA 1HSJA 4MLOA 3M3YJ 2RNJA 5DCMB 1T56A 3GTQJ 3P7NA 1YE9A 1ZG5A 2Z9OA 1OPCA 4XSZF 3BC8A 1EH8A 4KIGA 3FM5A 2DOFA 3DCFA 3HPGA 2RC4A 4S04A 1DQUA 1VQPI 1E0EA 5F64A 2R7UA 2P4WA 1W36D 2STWA 3OIOA 3BTLA 4D5FA 1WWXA 2UXNA 1F1ZA 3RPUD 3BROA 3WODF 3JREA 3F8FA 1FP2A 1XG1A 1ZARA 5E1XA 2LREA 2P8TA 1VTNC 3TGNA 1VQMI 4FE7A 4KA4A 1AU7A 1FZPB 3IL2A 1WH7A 4IXAA 1TWHJ 1WJ5A 4Y7NJ 1XGOA 2DDAA 4S05A 2BHZA 1UHMA 2Q0OA 1MMDA 1W5TA 1Z1DA 1YTYA 3HSFA 3KEYA 2B63J 2FXAA 3K10A 4ZH4F 2WAQN 1TBXA 3C2GA 3HM5A 2XIGA 1EJ9A 3P9IA 2AXTC 4PUSA 1P2FA 2OCEA 3CJRB 2F5CA 2HZTA 3UNGC 3ECHA 1MMSA 2K5CA 3TOAA 3F3XA 1W7PB 1IAWA 4KISA 3V8JA 5DUIA 2M0MA 5DTDA 3EDPA 4M9ZA 4UHTA 1G3TA 4YIIA 2DW4A 2JVGA 4MQ9F 1WI9A 3K4LA 4L18B 2NS8A 2HNHA 3HOXJ 2LVSA 3HOZJ 5LEJA 4ITVA 3SDGA 5IYCJ 3LSMA 1ZREA 2VQLA 1MBEA 2M7AA 3FKJA 3HUGB 1BJZA 1ZGJA 3A0HC 3QWLA 5HNHA 3QU3A 3B02A 1XD7A 4XRSG 3LFKA 4CHUA 2G7UA 3N97A 4IHYA 4R8HA 4G7OF 4UUTA 4E7JA 1ZLJA 2AS5F 3IH3A 2DJNA 2ZXWH 3SFZA 3VSLA 5L3EA 3A1YA 2IAIA 1U5TB 4JBAA 1MSEC 4A3CJ 1R5GA 3VPRA 3GF2A 1TT0A 5IOZA 1HCRA 3RQ4A 1QZYA 1BI1A 1TTYA 5K7FA 3RKYA 4LG0B 4GYIA 1K61A 2VQGA 3ZMTA 1NK3P 2DJIA 1Q1HA 2EK5A 2WV1A 2KL4A 2EV0A 3LL7A 1BM9A 5HLGA 2DXIA 5F0CA 2GBYA 4L9TA 3LQRA 4MO7A 1MNMC 4KJZA 1DUXC 3AG4H 1IRXA 1Z3XA 1JKPC 2Y31A 4KN4X 3S2WA 1G59A 1ZR2A 2PN6A 4KDPA 3BDDA 4Y13A 4NQWA 3K9TA 2R7FA 4D7NA 1G4DA 3I56I 5DM6F 2BY1A 4W1UA 5FRMA 3KP2A 4OWRB 3MZYA 5FKMA 9ANTA 4CYDA 4WXCA 3I54A 1IJWC 3F21A 5TISC 3QYBA 2XPVA 3VYSB 4L5JA 4LK1F 4D7MA 5FLXZ 1OMIA 3CMAI 1OCOH 2X4HA 3OWTA 5TJJA 3WHCA 3PNVA 4I01A 4A69C 4RGRA 4MTDA 3TO6A 2NOGA 1FY7A 4GO1A 1BOBA 2ELKA 4E70A 2V6CA 1WQ2A 4JX6A 3LA2A 4WX9A 1JXSA 5IOYA 3KYCB 4N0BA 4EM2A 3OYDA 5KNLA 1T33A 2VPRA 1JE8A 1S7AA 1D0ZA 4PGHA 1DPUA 4YRVA 1VFCA 1IN5A 3QOEA 4IX7A 3E7LA 3IH2A 3OL3A 2R5YA 1JT0A 2KZVA 5K7HA 2YPRA 2ISZA 3BJOA 4XSXF 5BS6A 4FX4A 2B9SA 1S8NA 2EFNA 1T38A 3NQOA 4A3FJ 4WF2A 1J75A 3DV8A 2XRLA 4YELA 3RKXA 1KQ9A 2Y48A 1XMKA 3GXOA 2A6HF 2J5PA 2QSGX 1LDKB 3ZPLA 5HS9A 4CDGA 2XPWA 4M3FA 4IZZA 3NEUA 2X6YA 5BOXA 2VASA 2TRTA 3GMEA 2RQPA 2JVHA 2TDXA 3FXKA 4E6KG 5HS8A 3HOYJ 1PYVA 3I4PA 1T98A 2CV2A 2A6EF 2ZC2A 4ZYEA 2EQRA 4E7HA 1T39A 3K1PA 1XB4A 1OCTC 1DU0A 2V1NA 2OPTA 4EV0A 3E6CC 1CQTA 4D5CA 5B1AH 4XRFA 1ERDA 3OY9A 1P4XA 1YG2A 2DO7A 2HI3A 1VQ4I 5ILSA 5L3GA 2FBIA 3M9AA 4FASD 1P4AA 2K9QA 1FX7A 3F0CA 2NXNB 4G6DA 3O8HA 4F55A 3W6VA 4UXNA 2V9PA 4JK1X 3AAFA 1L3LA 5GPAA 2EH3A 2CQQA 2FBHA 1JTYA 5J3LA 4PZJA 1MMNA 3U1KA 3KZIC 3CCYA 2QKLB 2LD5A 5EEAA 3OYHA 5FKOA 1D5YA 4KUMA 4EGYA 3M8EA 4BS9A 5GP9A 2KDOA 5BPIA 1KYWA 2CW0F 5GAHJ 2JK3A 2JA7J 1R36A 2MA3A 1ITYA 1HSTA 1VQOI 1V5EA 4RAZA 2FOKA 1GXPA 5D5XB 1FT9A 1PP7U 2XROA 3N05A 3B6AA 2NNNA 2XF5A 1D5VA 1CF7B 2JA8J 3LSHA 4G6QA 2V9KA 4V19K 2ZMEC 1RC9A 4N9HA 1ZLKA 3S2DJ 1JTXA 4EM1A 5J4VA 1IUYA 3BR3A 2XKOA 1YW7A 3IKTA 4PFOA 5E3OA 1VQ6I 2R7TA 2WTEA 3HG9A 2M5WA 5LGUA 3V42A 3QYEA 4ZTJA 3E6DA 2VONA 2WAQA 2E1OA 3I4MJ 3LA3A 1TZLA 3CP8A 4HW0A 2LBFB 4A12A 2Z5UA 1D0XA 3JRBA 1K4TA 2XAHA 4LLLA 3W6JB 4DGWB 1VQKI 4HX8A 1X3WB 2RNGA 3FM3A 3H0GJ 4A0XA 5LRSA 2K02A 1V4RA 3KETA 1ON1A 3COAC 3ZMUA 5ED4A 2VKDA 2KDZA 2LKPA 3Q0VA 4NBQA 4EJWA 5FLMJ 5LBQA 2WAFA 3E1SA 4II2A 1A36A 3ZQIA 5AONA 2QSHX 4UV8A 4PCQA 2CUEA 3OYJA 4F91B 4PJJA 3DEWA 3DQVC 4XKVA 3VFZA 2ELJA 3DEUA 2XUBA 3WHBA 5JI6A 2EA2A 1HW5A 2W82A 2EFOA 3H92A 4MTEA 3G1LA 4GCVA 5KAFC 5HODA 1A6QA 5D6FA 4LD5A 3WE3A 1SEUA 2R3SA 1ZR4A 2DA7A 2PMHA 3SZPA 5L3BA 1FLIA 2F4MB 3GEZA 2R7RA 1FTTA 4IKFA 2HPMA 3GUDA 3HDDA 5CYVA 1FMWA 1DDNA 3P9CA 3RYRA 1H9TA 5LLQA 2CQNA 4ETSA 4RA2A 4ZJZA 3CUQB 4I0BA 1OQYA 2V9VA 2QEXI 1S29A 2M30A 2XPUA 2NOJB 4AC0A 3IRQA 3ZOBA 4O5VA 2GXBA 1R1VA 3MWMA 2LYCA 2JJ7A 5HOOA 2CFXA 4JX4A 1YLFA 2DOAA 2G0EA 1NTCA 3DXJF 5F04A 2EIJH 2EILH 4I7HA 4NC7A 4NUBA 2BVMA 3M8JA 3FWEA 1TL8A 3F22A 3SEZA 2PMZN 2AXLA 1A6IA 4M71A 4R1HA 2XV4S 1JI8A 3BR0A 3LFUA 4AVPA 1G2HA 4DJAA 3OYNA 2O6GE 4HRIA 3I71A 4L5EA 3DPLC 2BW3B 1WJFA 2DA6A 4MEYF 1A35A 2PMUA 4OAZA 3J81K 2K3FA 1F9NA 3KZYA 3E5UA 4X6AJ 2NVTJ 3ML6A 2M87A 2Q2EB 1PUEE 1UHWA 3QPSA 1GDTA 4I99C 3J80K 3VWBA 1O57A 4BY1J 2Y0MA 4KT5C 1K4SA 3WU2C 2FNPA 2Y69H 3VYUB 1YRNB 3MKYB 4C3IJ 2D5VA 3K69A 2GQQA 1V5GA 3OOPA 1MD0A 2K4BA 3C3WA 4C9YA 5B3SH 1ZGWA 1D8JA 1B1BA 1LJ9A 1P9QC 1SANA 3IKVA 2O8XA 3M1CA 4F3QA 1WKMA 4P1WA 4CYCA 5E20A 3S93A 2KT0A 1GLNA 4L0ZB 2LDUA 4LLNA 5C3EJ 1LNWA 1TNTA 2GXGA 1QU3A 1R71A 4LG0A 2VOPA 2A05A 2OA4A 3C7JA 2QLZA 3L00A 4KNYA 3ECOA 5CPRB 1X1AA 1R1UA 2FD5A 2JN6A 4XLEA 4RM2A 1KQ8A 4HA8A 4FHTA 2XVCA 1FWZA 5LD2C 2LTPA 2HDDA 2ZMEA 2PJRB 2W25A 3MFKA 4CCKA 3JW4A 3TQNA 5HS7A 2MW8A 3S8PA 1K7AA 3IC7A 3BJ6A 1BA5A 1EV7A 2GOXB 2HQRA 2ME6A 3A01A 5CVRA 4NC6A 2IA1A 1ZHFA 3GX4X 3F8NA 3F8MA 2CQ7A 4QLCU 1KYZA 1HKQA 1OCZH 4BBSJ 2H6CA 4JQFA 5DS9A 4G7HF 5M5WJ 4EJVA 3EUKL 1JJ8C 2VQHA 2IT0A 5LGNA 2M8GX 1JKOC 4DOZA 2BXYA 1TLHB 3OYMA 2E36A 1YJWI 3EETA 2BVLA 3K2ZA 2DTZA 2ZXHA 3DKYA 2KRHA 4XKWA 4LITA 2I8DA 4E7ZA 2EA4A 1KQ0A 3FXLA 2L4MA 1QVUA 2IRFG 2DU9A 1XN7A 1OCRH 3KLOA 3DTEA 4LB5A 1R23A 4FT8A 2HQNA 2VBXA 3CCLI 3M8FA 2K9LA 1O7LA 2E5NA 2MFZA 2VUMJ 5EYRA 1FIPA 3KE2A 1I50J 1U3EM 1FC3A 4BE0A 3HYIA 3SJMA 1QQIA 2QWWA 3L2CA 2EZHA 3HOVJ 5FJ8J 2IW5A 2A61A 1BC8C 3RI4A 1E3HA 2IA2A 4B3XA 4ZTFA 1JT6A 1SFEA 4E7IA 2DPUA 1J5YA 2CUJA 4HSTA 3ABTA 2L2OA 3M1EA 2P6TA 2YS9A 2OQRA 1XSDA 4ASNA 2OTLI 2GZWA 3GTGJ 2IEKA 3H5NA 1R4NB 2IGKA 2YUSA 2RAEA 2FMYA 2XGCA 2PEXA 2RGVA 4A3IJ 1X4PA 1ETKA 1XC5A 2D2WA 2VN2A 3HRSA 3S3OA 4E7KA 1XDUA 3WGGA 5F1RA 3NWSA 3V8LA 1IN7A 4XOTA 3WGIA 5FD6A 3J7AO 3SFIA 4IO9F 2QKMB 3BR1A 3G6EI 3GFLA 2K85A 4YG2F 1RRJA 2H1KA 1LE8B 2VKHA 3HPHA 1AWCA 4ENKA 2NAZA 3WTTC 2KLOA 5J47A 2RDPA 3ZP5A 3HRMA 3PSIA 1WJEA 2ZFWA 4RAFA 3MKLA 4ZYAA 1NG6A 2NVXJ 4E4HA 3E3VA 3DTKA 3KP3A 2QM3A 5CQEA 3TP0A 5EG0B 1YX3A 4CICA 3WTWC 1MDMB 2XAGA 1S9HA 1TQPA 4HDUA 2LMDA 3U1DA 2DMUA 4OIQF 3KP6A 2XGDA 3REOA 3WGHA 2MC4A 2O9LA 1A04A 1IGNA 1TWFJ 1SFOJ 2GIZA 3OIQA 1OKRA 3L2QA 1NH3A 3QQAA 5IPAA 1UJ8A 2ZSIB 5BQTA 2VJJA 3JRGA 3ZQQA 3RTRA 5A2QZ 1XGNA 1QBJA 1G8XA 3MAJA 2OF7A 2AO9A 4S0HB 1Y6IA 1RUNA 2HVSA 4U0VA 4W97A 3ZCOA 4HX4A 4HNVA 3DFGA 1VZ0A 2NYXA 2FUG2 3FIWA 4OOIA 2ID6A 2F5DA 1B8IB 2W84A 5D4SA 3KYLA 4HV5A 4IRHA 4JX5A 1WJDA 2NVUB 4LK0F 1R4MB 5B66C 4F93B 4Q5SF 5B1BH 5IP9J 5BMZA 4BQAA 1Z91A 2LSOA 4ZZDA 1LDDA 3AL0B 1EKEA 2VC0A 2ME0A 2OJED 2W24A 2X51A 4BBRJ 3HHGA 1BR1A 4QIWN 5M5XJ 3WTZA 3PUBA 5HDNA 3J7YJ 3HOUJ 1XMAA 3TOBA 1YW9A 3G1OA 4A3EJ 4KYWA 4II3A 3E0JB 4JOMA 2DK8A 3NARA 4YIRX 2O0YA 1J09A 4BXUA 4M3BA 3G2BA 2XGEA 4DYRA 2B0LA 2VXZA 4HYEA 3JAMK 1QPIA 2LBFA 2JTVA 5HVQC 1F36A 2PMZA 4P55A 4PSWA 5GAEJ 1X1BA 2A5YB 2OZ6A 4LIUA 2Z33A 1AHDP 1IXSB 2A68F 1WRJA 3LAJA 1LFPA 1FYKA 1X3UA 1SAXA 5E3LA 1QZZA 2O7OA 1RKTA 1BOAA 3BG9A 1LEAA 4LMYA 4UB6C 5CLSA 2CU7A 2Y75A 1FPQA 4XKCA 3DKXA 1UB9A 3FMQA 3HRTA 3IP4B 4B8XA 2PI0A 2GM4A 3S1NJ 3LAPA 2W1OA 2Y9ZA 2NVQJ 3D0SA 4XORA 2R7DA 3BR6A 3E6MA 3VYRB 1QNTA 2CV0A 3KP7A 3RKWA 1RESA 4ZC3A 1X3ZB 4CCMA 2KP6A 1B72B 3T5XA 1KONA 2KJBA 3S2HJ 4UVBA 5E8GA 3DWLE 4V2FA 1IDZA 5IY5H 4YEJA 1FOYA 1D1CA 1BI2A 4FE4A 4XOPA 2LF7A 3CUQA 3SZTA 4BE1A 2M9HA 4FX0A 1BW5A 2OCCH 3QPHA 4M9XA 1IRGA 2E1MC 4GRIA 1JKRC 1IN8A 2DA4A 2VBWA 2R5ZA 4ZYHA 2R4GA 1ZK8A 2IA0A 4U7DA 4C2TA 2R7XA 3ELKA 2XF7A 3VB2A 2KIUA 3BP8A 1YJ9I 1Z6TA 3BG6A 3CMYA 1ORKA 4EGZA 4F92B 1WZ2A 4YFNF 2WAEA 3QU6A 4Z2YA 3S16J 3C2HA 2YX4A 2ZCWA 4BNCA 2RKHA 3A2KA 2QQBA 1SD6A 1YJNI 1AKHA 3QODA 2L7KA 1Q1VA 4BQQA 1B9NA 1QHHD 1HF0A 4IRGA 3R4KA 1QVTA 2BOLA 5DCFA 4ZDPA 2BW3A 4AUXA 3A02A 2H8RA 4HBLA 1PDNC 2WB1N 5E3NA 4UNOA 2CO5A 1K79A 4DBQA 2GIVA 1Y8QB 2IGNA 1IV8A 1YIOA 3VSKA 2JA6J 4NB5A 4BAYA 4FETA 3CESA 4NHJA 2XAUA 3CQZJ 1BW6A 2Q2EA 3PQKA 4BXXJ 4P96A 2COBA 1R9TJ 2P7CB 3ZGKA 2KIQA 4N4OB 5FB2A 3ISPA 1G6NA 1LB2A 3H36A 1FOKA 1YRNA 3TEDA 1WVRA 3CCQI 3VDXA 2Y30A 3OR1C 3ZMVA 1USSA 2KQRA 2CFOA 2QQ9A 4UY8I 3TO7A 3NAUA 1UZCA 2X6XA 1TQMA 2ZJPF 4UUSB 4C3HJ 1MKMA 2OUMA 4QSHA 3CUOA 2KFDA 3IRRA 1D3YA 1R6RA 4CUGA 1LUJB 1WJBA 4G6TB 4HOBA 3FXQA 3WG7H 1TT5B 4QPOA 1IRZA 1FNNA 1ZGAA 1J9IA 3DP7A 3IAS2 1JHHA 3AL0C 2LG4A 1RR8C 2V1XA 4BY7J 5K5RA 1SD7A 4UUVA 4DYQA 1H88C 2DA5A 1R22A 1U2WA 1B4AA 2OD5A 1RKWA 5EZHA 4OIRF 3TL4X 2PJRA 2KMUA 3BTJA 1U8RA 1VQ5I 1WFXA 2CS3A 2OU2A 4AVZA 2GXAA 1KU7A 3K1NA 4Y33A 4DBRA 2XSJC 2XF6A 4BJTA 2ZBKA 3QP5A 2COMA 2LNBA 4WK8F 1OLTA 3FXOA 4UVCA 3CCEI 5CVJA 3U9GA 2FOWA 4AIJA 4BDZA 1FSHA 2G7HA 1OISA 3KYDB 1ZRCA 1Z77A 1OJLA 3DBRB 3BG5A 1ETVA 2FSWA 1XSXA 1I6XA 4LOCA 2XC7A 3FHZA 1O7FA 4BEHB 3K70D 2YR2A 4A3MJ 1E17A 2YU9J 2IXSA 3RKQA 4TV7A 2EB7A 3UKGA 5FKNA 2LFBA 1H0MA 3OSGA 3K4BA 2CGPA 2EBIA 5D8KB 4C3JJ 3K4NA 1VQ8I 4BQNA 2WY7Q 3EQLF 2XAFA 4HF0A 5DV5A 2DA1A 2O8KA 1FBSA 2IS6A 2AQEA 2HVQA 2L01A 2E34A 3E6BA 1OR7C 1SD5A 1B9MA 3CC7I 3HGYA 1KU3A 5EEGA 3BY6A 1P92A 2XGXA 4BQOA 3Q0UA 4GGGA 4BH9A 3Q9SA 3OOUA 3KP4A 3O3KA 3A4CA 3HOWJ 5JHUA 1WPKA 2A3SA 5IT9K 4GFBA 3CCRI 2Q8KA 1SVOA 2A69F 5LHIA 1R49A 5E17F 4MHGA 4A93J 3D5LA 2E60A 1IG7A 1KU2A 2LC2A 2L4AA 3QP6A 4U0WA 2HDWA 3I3LA 4HQMA 3MVPA 2MD5A 2O5RA 2R7OA 1U5TC 3MZHA 1EF4A 1T8IA 2Z16A 3LNQA 3SHFA 4M6XA 2ICWG 1FEXA 1Y0UA 4I6ZA 4HG2A 4HLXA 5CVVA 3AKZA 1BI0A 3K1MA 1FJLA 2RV8A 1LVAA 2EFPA 1FYMA 2QBYB 5KCMA 3D5SC 2CYYA 3JCUC 5EGOA 1YS6A 2E1NA 3PM1A 1LE8A 1XSVA 3PIOF 4A3JJ 2LKSA 2R7SA 2NS7A 2CV1A 1HXDA 1ZG3A 2PQ8A 4XICA 1UMQA 4J00A 3FDYA 3DF8A 1J0RA 1D1BA 2VI6A 3CD6I 1BN5A 3KEOA 1YOVB 3CJQB 4PGGA 2DYSH 5EG0A 1BR2A 1MDMA 1IV6A 3JRHA 1EH6A 1W36C 3ZQLA 4MIMA 2K3PA 3ASNH 1RPWA 2LLKA 2HEOA 1FMVA 3CF2A 1PUFA 3HSEA 4IHWA 3ZN0A 1APLC 2DCEA 2F4IA 3WU1B 2HTSA 3HOTA 3C18A 2VC1A 1LVKA 4N4NB 4AM3A 1YW8A 4K2EA 3D5RC 2HGCA 2QENA 2MGQA 1A5JA 3PQJA 3ZMSA 1NHAA 3BCBA 5K7ZA 3GW2A 5TRDA 3CJTB 3E97A 2CQXA 2BXZA 2CRGA 4PJLA 2GOMA 2L02A 5K5OA 4B4CA 4BYYA 2EJRA 1ZKGA 2Y0SN 3ERMA 4HV6A 1MSFC 2ETHA 1FYLA 2AHQA 2ZKZA 5KK1A 3PO3J 1TQIA 2ECBA 5DCMA 2W7NA 3TKYA 2DK5A 3EYYA 1KGSA 2QVOA 2KRFA 2W85A 1HKTA 4D1QA 3OYGA 2VE9A 2A6TA 3LWFA 1XDSA 1GHCA 5LFAA 2M34A 1ETWA 3F8CA 2LP0A 4H0EA 2HVRA 1LPQA 3Q9VA 5E1WA 1ULYA 3L2RA 2QUFA 5C4JJ 1D8KA 1ZAOA 2CWEA 1WHUA 3DU6A 2KISA 5EDNA 2G9WA 5J40A 3AG2H 3KX2A 4L0YB 1SFUA 1VF9A 2I5UA 4DIQA 1TWGJ 3OYEA 1P4WA 5D5WB 1W5CC 4HNTA 2DFFA 4BHBA 3ZMZA 3GFJA 1ETYA 1FSEA 2L7FP 1Y1VJ 3HB9A 3E5QA 4HF1A 2OTJI 2K9NA 5F0FA 3CCJI 2IS1A 2ELHA 2L54A 4LLGF 1S5LC 2PFBA 5TGTA 3BCAA 2M2EA 2W4SA 1W7PA 3G71I 2QF7A 2MG4A 4FISA 2ZB9A 5F08A 4RB1A 3OIPA 2FU4A 1T2KA 2C6YA 1O3QA 2GWRA 1ON2A 4G12A 2V4JC 1OR7A 3QPTA 4XN3A 1HDPA 3KPHA 4P5OA 4YFKF 5GPCA 2DFHA 4XLHA 1B72A 2HOSA 3HUGA 3IV5A 1DP7P 1VQ7I 2E2JJ 1HA8A 1YHQI 3M07A 1ONVA 2HTJA 2VQCA 3K4MA 2DPDA 4I09A 4U88A 3PNTA 4LGWA 1I5ZA 2JZYA 2KKOA 3KEQA 2FE3A 1DGWY 1MIJA 3R61A 1IW7F 4KT6A 4FCYA 2QYOA 4HZFA 2V1UA 3ASOH 1U5TA 1U8BA 3KLNA 2VIXA 3MCZA 4R79A 1YS7A 4WXDA 1SVLA 4BGDA 4ESFA 1HW1A 1JHFA 2XB0X 4G94A 4NQWB 2K27A 1EA3A 2DBBA 3S1RJ 4CGZA 2P5VA 3FHNA 5HNFA 1X19A 1I39A 2X6OA 2IGOA 1VQNI 1Y8RB 1MH3A 1JUPA 3LSIA 1FIAA 2RN7A 3LSTA 4RMNA 2VKEA 1MJAA 2PG4A 3L7WA 3OS1A 3KZZA 3R0AA 1MMGA 2E7XA 2A07F 3NWTA 2FQ3A 4BDYA 1WI3A 1DP3A 3IUOA 2K4JA 2CW8A 4ANJA 1V55H 3I4NJ 3K4KA 1ETQA 4M3GA 4PJ0C 2UWMA 4F7ZA 3H3ZA 4DZPA 3KFWX 2HOTA 1LEBA 4V2GA 3JTHA 3CP2A 3TMOA 2X9DA 3CF5F 3CTAA 3GLLA 2VB6A 1MW7A 4AD9A 3G4SI 2ISYA 5E8IA 5GTIC 4FQGA 4GDFA 5E3MA 1S7EA 2QGUA 3SDBA 3S3MA 4GXOA 3GTOJ 2DOEA 4L9NA 3K4JA 2ESHA 2VKVA 3N4MA 3AG1H 5DDGA 1XMXA 2L7ZA 5A2QK 5JVGF 3GTKJ 3RYPA 3EUHC 5ILVA 2R5YB 2MC3A 2F2EA 3HKZN 1UG2A 4XIDA 3HGGA 1MGTA 2MLKA 5IP7J 3PJRA 3A0BC 4RAGA 4Z6YA 2BE5F 3ZQFA 3GCMA 4C2UA 3DEEA 2DTRA 1F4KA 3HXLA 4KMFA 3WTYC 3K0LA 1MMAA 2O3FA 3F6VA 2DT5A 3I5UA 1XGMA 3B6CA 1R1TA 4I76A 1QZEA 3FBNB 3PSFA 2V79A 3I59B 2VT3A 4KICA 3F8BA 4BE2A 4O3MA 2L0KA 3CUQC 4ENMA 1LKXA 3W6KB 4RB3C 1XPXA 5E79C 4IHSA 1JUSA 1QO0D 4ZYGA 4HPQA 2YX7A 3P5JA 4O6JA 4A5MA 4AWXB 3HRUA 5D5VB 1I6HJ 4M3EA 1IDYA 3I64A 1IXCA 2CSOA 1ACIA 2EFWA 3GFIA 2KIFA 2KJCA 4B3AA 1LDJA 4Y52J 2GA2A 3I53A 3VODA 1K83J 4UV9A 4RGSA 5LHHA 4BHPA 2XKPA 4CCJA 2BY0A 2HZDA 2I10A 4G8XA 4A6DA 2BHYA 4EEFG 2OZUA 5J8CA 2R0QC 2PLYA 4CCOA 1S72I 3JRIA 5J1UA 1W7PD 4RLQA 2DLLA 1DPRA 3H35A 2ZJQF 3L9FA 3GTPJ 4MEXF 4I0AA 4A3BJ 3CLOA 3T0YA 3RDIA 2J5OA 2VJ5A 1YFHA 3MMYB 3H5AA 2X85A 3IAM2 2DFEA 3I58A 3SXYA 2CJJA 2QQAA 3SQNA 1N78A 1UG0A 4WXHA 3PUFA 4HX7A 3W2VA 1QGPA 1NK2P 5FGMA 3LQQA 2JSCA 4X0GA 2P0WA 1TP4A 3JRFA 1B6AA 2ECCA 4NDLA 3W3CA 4BKXA 4CO8A 2K40A 4XL9A 1P7IA 3HOSA 2X1DA 2D1VA 2DMQA 3L2VA 2N8GA 2K9SA 5AIPA 4PK4A 1Z21A 4LB6B 3QPLA 4EJUA 4LJZF 5J4YA 1IN4A 3CLQA 2O61A 5GADJ 5M5YJ 1X2MA 1CF7A 2F48A 2DAOA 4IRIA 1GVJA 4B47A 2HYJA 4LIVA 2IGMA 4UB8C 3FK7A 5CQGA 2BGCA 2E35A 4OMZA 3JRCA 1RETA 5FO5A 3RIRA 1SAUA 2CQKA 4XLFA 5ICGA 4IQJA 2UV1A 3FXUA 4F52A 2KRCA 5IYDJ 4IHXA 4L5IA 3VOEA 2Q1ZB 4XM3A 4RS8A 1POGA 4MGRA 3JSOA 1ZELA 3PL8A 5J6XA 2LY1A 4OIPF 1U6GA 3H9GA 3ZQCA 2NRAC 1R7JA 3W2WA 1YQAA 5DM7F 5C4XJ 1IXRC 3RZOJ 1ZH5A 2KIMA 2HPIA 1UHSA 2ZXIA 2LR8A 3H3UA 1MZBA 1U9OA 2MD0A 4OAYA 4A0YA 1HC8A 5J8FA 5DD8A 1Z05A 1H9GA 1T08B 1DGRM 3HEFA 4HF2A 4HDVA 4RB0A 4FTHA 2MBFA 3EUHA 2GLOA 2VL8A 3R60A 2VT2A 2DMNA 3O8GA 3SEQA 1X1PA 5FLXK 1BIBA 3P9KA 4Q4ZF 4Y15A 3DKWA 3GZNB 2DYRH 3BZCA 2LY9A 4RAYA 4RBOA 4P9FA 3F6OA 3K2AA 3GTJJ 4KIBA 1RIOH 1YO5C 2WBMA 3WG9A 1WH5A 2WWYA 3BZKA 3LSGA 1K78B 2DMPA 2GA1A 1G3YA 1E3PA 1OYWA 3RPQA 3TO9A 4IVNA 3EYIA 1JUMA 3TW6A 1VI0A 2Z99A 1C0WA 4G9YA 2ZO4A 1GV2A 2VJIA 3JR9A 2K9MA 3IWZA 4QWQA 2E2IJ 3WE2A 6PAXA 2WV0A 1O3SA 1FP1D 3F9KA 3GZ6A 3JRDA 3OMYA 3ZQHA 4M74A 4L9JA 1YYVA 1GXQA 5GTHC 3I55I 1V5FA 4DW6A 2IP2A 1FBUA 2M7BA 3MEXA 5KVRA 1PVEA 3VEPA 3BZ6A 4I98B 4DNCA 5EF6A 4U7BA 1H8AC 1JGGA 2D45A 2HOEA 2KZGA 5BNGA 4XLPF 4P9UA 3V8KA 4IHTA 3K4CA 3QRFF 4CYCB 1UCRA 3FK6A 4MNUA 2M4GA 3V7RA 5IYBJ 2CUZA 5IP6A 1W5SA 2H8WA
chains in the Genus database with same CATH topology
4KFCA 2MH2A 3OV8A 3L09A 1ZG1A 3JSPA 3WTXC 3CO7C 1BBYA 2H94A 3V4GA 4ESJA 4M6YA 2OQGA 2ZMEB 3JAMZ 2JPBA 3BOQA 1G3SA 1JGSA 3CDHA 3GVAA 3V7CA 3ULQB 2HYGD 5EEHA 3T1BA 1J7KA 2HR3A 4PDKA 4MQVA 1SFXA 3FZVA 2IPQX 1KU9A 1MJ9A 5L3FA 2HDCA 1SD4A 5ICFA 3LA7A 1S7OA 2E1CA 3G73A 1IZ1A 2FMLA 4RGXA 4M9SA 3B73A 2OAZA 3WTSC 2VE8A 3CJNA 1I27A 4HQEA 4DQ2A 2Z3YA 2HYFA 2VODA 1L0OC 3BWGA 2HKXA 2CG4A 3R0JA 4CZZA 5IT3A 1WSUA 2K86A 3GO5A 3NRVA 5D8LB 2EV6A 1TW2A 3TDZC 1QPMA 2XAQA 3HTSB 5DUKA 5CJ9A 2D1HA 4EJTA 2BV6A 2W57A 3TDUC 2EV5A 4CXFA 3I59A 2BYVE 5L3DA 2OBPA 1XCVA 5LRRA 3IHUA 4OU0A 2O03A 3O6BB 4M73A 2STTA 3PFIA 3FF5A 3FX3A 4D0PA 1E2XA 1REPC 2JPCA 1FSHA 1IN6A 4ZZLA 1ZRFA 2YU3A 2EFQA 5JR3A 5BPDA 2XRNA 4ENJA 2QZ8A 3C1DA 4IF4A 1UFMA 4I2OA 4A5NA 4XLNF 5ICCA 2EWNA 4Q48A 2BEOA 5DYMA 1RUOA 1O3TA 3F72A 4ENNA 3JTGA 3I0TA 3GFMA 1ZYRF 2P7VB 2H27A 3ZMDA 3GZ5A 5ICEA 1OYYA 1BI3A 1BIAA 2P5LC 2VBZA 5ERIA 5HLHA 1S3JA 1MJBA 1G3WA 3IWFA 5FD5A 3ZQ7A 2ADUA 3FMRA 1O3RA 1XCBA 4UVAA 5H20A 4OMYA 2FRHA 1I1GA 2DQLA 4M72A 2H09A 4EM0B 2IJLA 4IJAA 5FFZA 2FF4A 2HFHA 1RZ4A 5DEQA 4B09A 2M45A 3KCCA 2DQRA 4EMSA 5IT9Z 1IRFA 2P5KA 5D5UB 5HDKA 4HLYA 2YSRA 1HBXG 1ZN2A 3BJAA 1U78A 4EVIA 2JT1A 1K6OA 1RI7A 5JVTA 5E1ZB 1I1SA 1ODDA 4U0YA 4EQQA 2FEZA 4A2UA 2FBKA 2WC2A 2DFIA 1IF1A 1K78A 3GLXA 2ESNA 2H6BA 1F5TA 1USTA 1Z6RA 4A6EA 4OIOF 3HTUA 2E7WA 2ACJA 2K7LA 5LHGA 3G3ZA 3GWZA 3M7GA 2X0LA 4WCGA 1J2XA 2ZNZA 1W4MA 4KIFA 5E18F 3T8RA 1CGPA 2HKOA 1Z7UA 1R5HA 4RB2C 4BHCA 3HSRA 2NNYA 4Y17A 3QAHA 1J59A 2M1BA 1P6RA 1BJAA 2XASA 3FMSA 4L9VA 1TNSA 4WWCA 2P6SA 2MLGA 4G7ZF 4IPAA 1XGSA 3RPUA 2NS0A 1B59A 3ZN1A 4Q47A 3ERED 3QOPA 5CVIA 1BC7C 1TW3A 1SMTA 5HDGA 3RJPA 5H6RA 2F5FA 5CVUA 3CO6C 1LQ1A 1T6SA 4YFXF 3DPTA 2M8EA 1OYIA 2VBYA 2V1DA 2UXXA 2MH9A 1HW2A 3HIFA 3KP5A 4GYGA 5JFRA 5FFXA 2BBYA 2FNAA 4ZYDA 1Z9CA 4AIKA 1PP8F 1R00A 2JRTA 2VOOA 3O2PE 1HKSA 3F23A 3J81Z 3HHHA 5K1YA 1EH7A 3BPVA 1T0FA 2F5EA 2ZXJA 4OINF 1STZA 3J80Z 1AOYA 1ZRDA 4KMUX 2RVCA 4I02A 3WU0A 3V7SA 2XHKA 1KA8A 2ZJ2A 4A0ZA 5D6EA 1R58A 2DI3A 5D4RA 3ROUA 4YIFA 4ON0A 2PBIA 2HS5A 4KN7X 1HQCA 3R6SA 4XBFA 3FXRA 5L3CA 4HAMA 2LF8A 5LGTA 3T8TA 1V3FA 1FBQA 1SMYF 3Q5FA 2L3DA 3WTUC 2HWVA 4ESBA 3WTVC 5K5QA 5F6FA 4EJOA 2PJPA 2GAUA 4RGUA 5AIQA 1S6LA 3GYHX 4AIHA 5H6QA 3MQ0A 5HLIA 2QBYA 5LEKA 1RNLA 3E5XA 2UZKA 2ZNYA 2FA5A 2IVMA 4N9IA 5DD4A 2XAJA 3U2RA 3ABUA 3BPXA 4LFUA 5ILUA 1HSJA 2RNJA 5DCMB 3P7NA 1ZG5A 2Z9OA 1OPCA 4XSZF 1EH8A 4KIGA 3FM5A 2RC4A 4S04A 5F64A 2P4WA 2STWA 1WWXA 2UXNA 1F1ZA 3BROA 3WODF 3F8FA 1FP2A 1ZARA 5E1XA 2P8TA 1VTNC 3TGNA 4KA4A 1FZPB 3IL2A 4IXAA 1XGOA 4S05A 1UHMA 2Q0OA 1W5TA 1Z1DA 1YTYA 3HSFA 2FXAA 4ZH4F 1TBXA 2XIGA 3P9IA 1P2FA 2F5CA 2HZTA 3ECHA 3TOAA 3F3XA 1W7PB 1IAWA 3V8JA 5DUIA 3EDPA 4M9ZA 4UHTA 1G3TA 4YIIA 2DW4A 4MQ9F 1WI9A 4L18B 5LEJA 1ZREA 1D8JA 1ZGJA 3QU3A 3B02A 1XD7A 3LFKA 4CHUA 2G7UA 3N97A 4G7OF 4R8HA 1ZLJA 2AS5F 3SFZA 5L3EA 1U5TB 4JBAA 1R5GA 3GF2A 1QZYA 1BI1A 1TTYA 3RKYA 4LG0B 4GYIA 3ZMTA 1Q1HA 2EK5A 2EV0A 1BM9A 5HLGA 4L9TA 3LQRA 1DUXC 4KN4X 3S2WA 2PN6A 4KDPA 3BDDA 4Y13A 4NQWA 3K9TA 2R7FA 1G4DA 3KP2A 3MZYA 4CYDA 4WXCA 3I54A 3F21A 4L5JA 4LK1F 5FLXZ 1OMIA 2X4HA 5TJJA 4I01A 4RGRA 4MTDA 3TO6A 1FY7A 4GO1A 4E70A 2V6CA 1WQ2A 4WX9A 3LA2A 1JXSA 4N0BA 4EM2A 1JE8A 1S7AA 4PGHA 1DPUA 1IN5A 2YPRA 2ISZA 3BJOA 4XSXF 5BS6A 4FX4A 1S8NA 2EFNA 1T38A 3NQOA 4WF2A 1J75A 3DV8A 3RKXA 1KQ9A 2Y48A 1XMKA 3GXOA 2A6HF 2J5PA 1LDKB 3ZPLA 5HS9A 4CDGA 3NEUA 5BOXA 5HS8A 2RQPA 2TDXA 3I4PA 1T98A 2A6EF 4ZYEA 1T39A 3K1PA 1XB4A 4EV0A 3E6CC 4XRFA 1P4XA 1YG2A 2DO7A 5ILSA 5L3GA 2FBIA 3M9AA 1P4AA 1FX7A 4G6DA 4UXNA 4JK1X 3AAFA 1L3LA 2FBHA 4PZJA 4KUMA 4EGYA 3M8EA 5BPIA 1KYWA 2CW0F 1R36A 2MA3A 1HSTA 4RAZA 2FOKA 1GXPA 5D5XB 1FT9A 1PP7U 2XROA 2NNNA 1D5VA 1CF7B 4G6QA 4N9HA 1ZLKA 1IUYA 4EM1A 2XKOA 1YW7A 3IKTA 2WTEA 2M5WA 5LGUA 3E6DA 2VONA 3LA3A 4HW0A 4A12A 2Z5UA 2XAHA 4LLLA 3W6JB 4HX8A 5LRSA 3FM3A 4A0XA 2K02A 1V4RA 3KETA 1ON1A 3COAC 3ZMUA 5ED4A 2LKPA 4EJWA 5LBQA 5AONA 4UV8A 4PCQA 3DQVC 3VFZA 3DEUA 2XUBA 5JI6A 2EA2A 1HW5A 2EFOA 3H92A 4MTEA 4GCVA 5D6FA 4LD5A 3WE3A 2R3SA 2PMHA 3SZPA 5L3BA 1FLIA 3GEZA 3GUDA 5CYVA 1DDNA 3P9CA 3RYRA 1H9TA 5LLQA 4ETSA 3CUQB 4I0BA 2V9VA 1S29A 2M30A 3IRQA 4O5VA 2GXBA 1R1VA 3MWMA 5HOOA 2CFXA 1YLFA 3DXJF 4I7HA 3FWEA 3F22A 2AXLA 4M71A 4R1HA 2XV4S 4AVPA 2O6GE 3I71A 3DPLC 4MEYF 2PMUA 3J81K 1F9NA 3KZYA 3E5UA 3ML6A 2M87A 1PUEE 1UHWA 3J80K 1O57A 2Y0MA 4KT5C 2FNPA 3K69A 2GQQA 3OOPA 1MD0A 2K4BA 3C3WA 1B1BA 1LJ9A 3IKVA 2O8XA 1WKMA 5E20A 4L0ZB 2LDUA 4LLNA 1LNWA 1TNTA 2GXGA 4LG0A 2VOPA 2OA4A 3C7JA 2QLZA 3L00A 4KNYA 3ECOA 1R1UA 1KQ8A 4HA8A 4FHTA 2XVCA 1FWZA 2ZMEA 2W25A 3MFKA 3JW4A 3TQNA 5HS7A 1K7AA 3IC7A 3BJ6A 1EV7A 2HQRA 5CVRA 2IA1A 1ZHFA 3GX4X 3F8NA 3F8MA 4QLCU 1KYZA 1HKQA 2H6CA 4JQFA 4G7HF 4EJVA 2IT0A 5LGNA 1TLHB 3EETA 3K2ZA 2EA4A 1KQ0A 2L4MA 2IRFG 2DU9A 1XN7A 3KLOA 4LB5A 1R23A 4FT8A 2HQNA 2VBXA 3M8FA 1O7LA 3KE2A 1U3EM 1FC3A 3HYIA 1QQIA 2QWWA 3L2CA 2IW5A 2A61A 1BC8C 3RI4A 2IA2A 1SFEA 2DPUA 1J5YA 3ABTA 3M1EA 2P6TA 2OQRA 1XSDA 4ASNA 2GZWA 2FMYA 2PEXA 2RGVA 2D2WA 2VN2A 3HRSA 1XDUA 3WGGA 5F1RA 3V8LA 1IN7A 3WGIA 5FD6A 3J7AO 3GFLA 4YG2F 1AWCA 4ENKA 2NAZA 3WTTC 2RDPA 3ZP5A 3HRMA 2ZFWA 3E3VA 3KP3A 2QM3A 4CICA 3WTWC 1MDMB 2XAGA 1TQPA 4HDUA 4OIQF 3U1DA 3KP6A 3REOA 3WGHA 1A04A 1OKRA 5BQTA 3RTRA 5A2QZ 1XGNA 1QBJA 3MAJA 1RUNA 4U0VA 4HX4A 3DFGA 2NYXA 4OOIA 2F5DA 2W84A 5D4SA 4HV5A 4IRHA 4Q5SF 4LK0F 5BMZA 4BQAA 1Z91A 2LSOA 4ZZDA 1LDDA 2VC0A 2W24A 3HHGA 3WTZA 5HDNA 1XMAA 3TOBA 1YW9A 4KYWA 2DK8A 2O0YA 4BXUA 2B0LA 2VXZA 4HYEA 3JAMK 2JTVA 5HVQC 4P55A 2A5YB 2OZ6A 2Z33A 1IXSB 2A68F 1WRJA 3LAJA 1FYKA 1X3UA 1SAXA 1QZZA 1BOAA 1LEAA 4LMYA 5CLSA 2Y75A 1FPQA 1UB9A 3FMQA 3HRTA 4B8XA 2PI0A 3LAPA 3D0SA 2R7DA 3E6MA 1QNTA 3KP7A 3RKWA 3T5XA 2KJBA 4UVBA 5E8GA 1BI2A 2LF7A 3CUQA 3SZTA 4FX0A 1IRGA 3QPHA 4M9XA 1IN8A 2VBWA 4ZYHA 2IA0A 4U7DA 3ELKA 3VB2A 2KIUA 3BP8A 1Z6TA 4EGZA 4YFNF 3QU6A 4Z2YA 2YX4A 2ZCWA 4BNCA 2RKHA 2QQBA 1SD6A 1B9NA 4IRGA 3R4KA 5DCFA 4HBLA 1PDNC 4UNOA 2CO5A 1K79A 2GIVA 1YIOA 4NB5A 4BAYA 4NHJA 2Q2EA 3PQKA 4P96A 2P7CB 5FB2A 3ISPA 1G6NA 1LB2A 1FOKA 3ZMVA 1USSA 2QQ9A 3TO7A 1TQMA 1MKMA 3CUOA 3IRRA 1D3YA 4HOBA 3FXQA 1FNNA 1ZGAA 1J9IA 3DP7A 1JHHA 2V1XA 5K5RA 1SD7A 4UUVA 1R22A 1U2WA 1B4AA 2OD5A 4OIRF 1U8RA 2OU2A 1KU7A 3K1NA 2ZBKA 3QP5A 2COMA 4WK8F 2LNBA 4UVCA 4AIJA 5CVJA 3U9GA 2G7HA 1ZRCA 2FSWA 1XSXA 1I6XA 3FHZA 1O7FA 2YR2A 1E17A 4TV7A 2EB7A 1H0MA 2CGPA 5D8KB 3EQLF 2XAFA 4HF0A 5DV5A 1FBSA 2L01A 3E6BA 1SD5A 1B9MA 1KU3A 5EEGA 3BY6A 1P92A 2XGXA 4GGGA 4BH9A 3Q9SA 3KP4A 3O3KA 5JHUA 2A3SA 5IT9K 2Q8KA 2A69F 5LHIA 5E17F 4MHGA 3D5LA 1KU2A 2L4AA 3QP6A 4U0WA 4HQMA 2MD5A 1U5TC 3MZHA 3SHFA 4M6XA 1Y0UA 4HLXA 5CVVA 1BI0A 3K1MA 2RV8A 1LVAA 2EFPA 1FYMA 2QBYB 2CYYA 1YS6A 2E1NA 1XSVA 1HXDA 1ZG3A 2PQ8A 3DF8A 1J0RA 1BN5A 3KEOA 4PGGA 1MDMA 1EH6A 2HEOA 3HSEA 3ZN0A 3WU1B 2HTSA 3HOTA 3C18A 2VC1A 1YW8A 4K2EA 2HGCA 2QENA 3PQJA 3ZMSA 1NHAA 3GW2A 5TRDA 3E97A 2L02A 5K5OA 4BYYA 2EJRA 4HV6A 2ETHA 1FYLA 2ZKZA 5KK1A 1TQIA 5DCMA 3TKYA 2DK5A 3EYYA 1KGSA 2QVOA 2KRFA 2W85A 1HKTA 2VE9A 3LWFA 1XDSA 1GHCA 3F8CA 4H0EA 3Q9VA 5E1WA 1ULYA 2QUFA 1D8KA 1ZAOA 2CWEA 2G9WA 4L0YB 1SFUA 1P4WA 5D5WB 4BHBA 3ZMZA 3GFJA 1FSEA 3E5QA 4HF1A 2ELHA 2L54A 4LLGF 2PFBA 1W7PA 4RB1A 2FU4A 1T2KA 2C6YA 1O3QA 2GWRA 1ON2A 1OR7A 3QPTA 4P5OA 4YFKF 3HUGA 1DP7P 1ONVA 2HTJA 2DPDA 4I09A 4U88A 4LGWA 1I5ZA 2JZYA 2KKOA 3KEQA 2FE3A 3R61A 1IW7F 2QYOA 4HZFA 2V1UA 1U5TA 3KLNA 4R79A 3MCZA 1YS7A 4WXDA 4ESFA 1HW1A 1JHFA 4G94A 2K27A 2DBBA 4CGZA 2P5VA 2RN7A 3LSTA 1MJAA 2PG4A 3L7WA 3KZZA 3R0AA 2E7XA 2A07F 2FQ3A 2K4JA 2UWMA 4F7ZA 3H3ZA 3KFWX 1LEBA 3JTHA 3CTAA 4AD9A 2ISYA 5E8IA 4GXOA 4L9NA 2ESHA 3N4MA 5DDGA 5A2QK 3RYPA 5ILVA 2MC3A 2F2EA 1MGTA 2MLKA 2BE5F 2DTRA 1F4KA 4KMFA 3WTYC 3K0LA 3F6VA 2O3FA 3I5UA 2DT5A 1XGMA 1R1TA 4KICA 2V79A 3I59B 2VT3A 4O3MA 3F8BA 3CUQC 4ENMA 3W6KB 4RB3C 4IHSA 1QO0D 4ZYGA 2YX7A 4O6JA 4A5MA 4AWXB 3HRUA 5D5VB 3I64A 1IXCA 2CSOA 2EFWA 3GFIA 2KIFA 2KJCA 1LDJA 2GA2A 3I53A 3VODA 4UV9A 4RGSA 5LHHA 4BHPA 2XKPA 4G8XA 4A6DA 5J8CA 2PLYA 2OZUA 1W7PD 2DLLA 1DPRA 3L9FA 4MEXF 4I0AA 3CLOA 3T0YA 3RDIA 2J5OA 1YFHA 3I58A 3SXYA 2QQAA 3SQNA 4WXHA 4HX7A 1QGPA 5FGMA 3LQQA 2JSCA 1B6AA 4CO8A 3HOSA 2D1VA 5AIPA 4LB6B 4EJUA 4LJZF 1IN4A 2O61A 1CF7A 2DAOA 4IRIA 1GVJA 2BGCA 4OMZA 5FO5A 3RIRA 2CQKA 5ICGA 3FXUA 4L5IA 3VOEA 4RS8A 4MGRA 3JSOA 5J6XA 4OIPF 1U6GA 2NRAC 1R7JA 1YQAA 1IXRC 1ZH5A 2KIMA 3H3UA 1MZBA 4A0YA 5J8FA 5DD8A 1Z05A 1H9GA 4HF2A 4HDVA 4RB0A 2MBFA 3EUHA 3R60A 2VT2A 5FLXK 1BIBA 3P9KA 4Q4ZF 4Y15A 3DKWA 4RAYA 4P9FA 3F6OA 4KIBA 1RIOH 1YO5C 3WG9A 2WWYA 1K78B 2GA1A 1G3YA 1OYWA 3RPQA 3TO9A 4IVNA 3EYIA 2Z99A 1C0WA 4G9YA 2ZO4A 3IWZA 4QWQA 3WE2A 6PAXA 2WV0A 1O3SA 1FP1D 3GZ6A 4M74A 4L9JA 1YYVA 1GXQA 2IP2A 1FBUA 3MEXA 5KVRA 3VEPA 3BZ6A 4I98B 4DNCA 4U7BA 2D45A 2HOEA 4XLPF 4P9UA 3V8KA 4IHTA 3QRFF 1UCRA 4MNUA 3V7RA 1W5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KFC A;  2MH2 A;  3OV8 A;  3L09 A;  1ZG1 A;  3JSP A;  3WTX C;  3CO7 C;  1BBY A;  2H94 A;  3V4G A;  4ESJ A;  4M6Y A;  2OQG A;  2ZME B;  3JAM Z;  2JPB A;  3BOQ A;  1G3S A;  1JGS A;  3CDH A;  3GVA A;  3V7C A;  3ULQ B;  2HYG D;  5EEH A;  3T1B A;  1J7K A;  2HR3 A;  4PDK A;  4MQV A;  1SFX A;  3FZV A;  2IPQ X;  1KU9 A;  1MJ9 A;  5L3F A;  2HDC A;  1SD4 A;  5ICF A;  3LA7 A;  1S7O A;  2E1C A;  3G73 A;  1IZ1 A;  2FML A;  4RGX A;  4M9S A;  3B73 A;  2OAZ A;  3WTS C;  2VE8 A;  3CJN A;  1I27 A;  4HQE A;  4DQ2 A;  2Z3Y A;  2HYF A;  2VOD A;  1L0O C;  3BWG A;  2HKX A;  2CG4 A;  3R0J A;  4CZZ A;  5IT3 A;  1WSU A;  2K86 A;  3GO5 A;  3NRV A;  5D8L B;  2EV6 A;  1TW2 A;  3TDZ C;  1QPM A;  2XAQ A;  3HTS B;  5DUK A;  5CJ9 A;  2D1H A;  4EJT A;  2BV6 A;  2W57 A;  3TDU C;  2EV5 A;  4CXF A;  3I59 A;  2BYV E;  5L3D A;  2OBP A;  1XCV A;  5LRR A;  3IHU A;  4OU0 A;  2O03 A;  3O6B B;  4M73 A;  2STT A;  3PFI A;  3FF5 A;  3FX3 A;  4D0P A;  1E2X A;  1REP C;  2JPC A;  1FSH A;  1IN6 A;  4ZZL A;  1ZRF A;  2YU3 A;  2EFQ A;  5JR3 A;  5BPD A;  2XRN A;  4ENJ A;  2QZ8 A;  3C1D A;  4IF4 A;  1UFM A;  4I2O A;  4A5N A;  4XLN F;  5ICC A;  2EWN A;  4Q48 A;  2BEO A;  5DYM A;  1RUO A;  1O3T A;  3F72 A;  4ENN A;  3JTG A;  3I0T A;  3GFM A;  1ZYR F;  2P7V B;  2H27 A;  3ZMD A;  3GZ5 A;  5ICE A;  1OYY A;  1BI3 A;  1BIA A;  2P5L C;  2VBZ A;  5ERI A;  5HLH A;  1S3J A;  1MJB A;  1G3W A;  3IWF A;  5FD5 A;  3ZQ7 A;  2ADU A;  3FMR A;  1O3R A;  1XCB A;  4UVA A;  5H20 A;  4OMY A;  2FRH A;  1I1G A;  2DQL A;  4M72 A;  2H09 A;  4EM0 B;  2IJL A;  4IJA A;  5FFZ A;  2FF4 A;  2HFH A;  1RZ4 A;  5DEQ A;  4B09 A;  2M45 A;  3KCC A;  2DQR A;  4EMS A;  5IT9 Z;  1IRF A;  2P5K A;  5D5U B;  5HDK A;  4HLY A;  2YSR A;  1HBX G;  1ZN2 A;  3BJA A;  1U78 A;  4EVI A;  2JT1 A;  1K6O A;  1RI7 A;  5JVT A;  5E1Z B;  1I1S A;  1ODD A;  4U0Y A;  4EQQ A;  2FEZ A;  4A2U A;  2FBK A;  2WC2 A;  2DFI A;  1IF1 A;  1K78 A;  3GLX A;  2ESN A;  2H6B A;  1F5T A;  1UST A;  1Z6R A;  4A6E A;  4OIO F;  3HTU A;  2E7W A;  2ACJ A;  2K7L A;  5LHG A;  3G3Z A;  3GWZ A;  3M7G A;  2X0L A;  4WCG A;  1J2X A;  2ZNZ A;  1W4M A;  4KIF A;  5E18 F;  3T8R A;  1CGP A;  2HKO A;  1Z7U A;  1R5H A;  4RB2 C;  4BHC A;  3HSR A;  2NNY A;  4Y17 A;  3QAH A;  1J59 A;  2M1B A;  1P6R A;  1BJA A;  2XAS A;  3FMS A;  4L9V A;  1TNS A;  4WWC A;  2P6S A;  2MLG A;  4G7Z F;  4IPA A;  1XGS A;  3RPU A;  2NS0 A;  1B59 A;  3ZN1 A;  4Q47 A;  3ERE D;  3QOP A;  5CVI A;  1BC7 C;  1TW3 A;  1SMT A;  5HDG A;  3RJP A;  5H6R A;  2F5F A;  5CVU A;  3CO6 C;  1LQ1 A;  1T6S A;  4YFX F;  3DPT A;  2M8E A;  1OYI A;  2VBY A;  2V1D A;  2UXX A;  2MH9 A;  1HW2 A;  3HIF A;  3KP5 A;  4GYG A;  5JFR A;  5FFX A;  2BBY A;  2FNA A;  4ZYD A;  1Z9C A;  4AIK A;  1PP8 F;  1R00 A;  2JRT A;  2VOO A;  3O2P E;  1HKS A;  3F23 A;  3J81 Z;  3HHH A;  5K1Y A;  1EH7 A;  3BPV A;  1T0F A;  2F5E A;  2ZXJ A;  4OIN F;  1STZ A;  3J80 Z;  1AOY A;  1ZRD A;  4KMU X;  2RVC A;  4I02 A;  3WU0 A;  3V7S A;  2XHK A;  1KA8 A;  2ZJ2 A;  4A0Z A;  5D6E A;  1R58 A;  2DI3 A;  5D4R A;  3ROU A;  4YIF A;  4ON0 A;  2PBI A;  2HS5 A;  4KN7 X;  1HQC A;  3R6S A;  4XBF A;  3FXR A;  5L3C A;  4HAM A;  2LF8 A;  5LGT A;  3T8T A;  1V3F A;  1FBQ A;  1SMY F;  3Q5F A;  2L3D A;  3WTU C;  2HWV A;  4ESB A;  3WTV C;  5K5Q A;  5F6F A;  4EJO A;  2PJP A;  2GAU A;  4RGU A;  5AIQ A;  1S6L A;  3GYH X;  4AIH A;  5H6Q A;  3MQ0 A;  5HLI A;  2QBY A;  5LEK A;  1RNL A;  3E5X A;  2UZK A;  2ZNY A;  2FA5 A;  2IVM A;  4N9I A;  5DD4 A;  2XAJ A;  3U2R A;  3ABU A;  3BPX A;  4LFU A;  5ILU A;  1HSJ A;  2RNJ A;  5DCM B;  3P7N A;  1ZG5 A;  2Z9O A;  1OPC A;  4XSZ F;  1EH8 A;  4KIG A;  3FM5 A;  2RC4 A;  4S04 A;  5F64 A;  2P4W A;  2STW A;  1WWX A;  2UXN A;  1F1Z A;  3BRO A;  3WOD F;  3F8F A;  1FP2 A;  1ZAR A;  5E1X A;  2P8T A;  1VTN C;  3TGN A;  4KA4 A;  1FZP B;  3IL2 A;  4IXA A;  1XGO A;  4S05 A;  1UHM A;  2Q0O A;  1W5T A;  1Z1D A;  1YTY A;  3HSF A;  2FXA A;  4ZH4 F;  1TBX A;  2XIG A;  3P9I A;  1P2F A;  2F5C A;  2HZT A;  3ECH A;  3TOA A;  3F3X A;  1W7P B;  1IAW A;  3V8J A;  5DUI A;  3EDP A;  4M9Z A;  4UHT A;  1G3T A;  4YII A;  2DW4 A;  4MQ9 F;  1WI9 A;  4L18 B;  5LEJ A;  1ZRE A;  1D8J A;  1ZGJ A;  3QU3 A;  3B02 A;  1XD7 A;  3LFK A;  4CHU A;  2G7U A;  3N97 A;  4G7O F;  4R8H A;  1ZLJ A;  2AS5 F;  3SFZ A;  5L3E A;  1U5T B;  4JBA A;  1R5G A;  3GF2 A;  1QZY A;  1BI1 A;  1TTY A;  3RKY A;  4LG0 B;  4GYI A;  3ZMT A;  1Q1H A;  2EK5 A;  2EV0 A;  1BM9 A;  5HLG A;  4L9T A;  3LQR A;  1DUX C;  4KN4 X;  3S2W A;  2PN6 A;  4KDP A;  3BDD A;  4Y13 A;  4NQW A;  3K9T A;  2R7F A;  1G4D A;  3KP2 A;  3MZY A;  4CYD A;  4WXC A;  3I54 A;  3F21 A;  4L5J A;  4LK1 F;  5FLX Z;  1OMI A;  2X4H A;  5TJJ A;  4I01 A;  4RGR A;  4MTD A;  3TO6 A;  1FY7 A;  4GO1 A;  4E70 A;  2V6C A;  1WQ2 A;  4WX9 A;  3LA2 A;  1JXS A;  4N0B A;  4EM2 A;  1JE8 A;  1S7A A;  4PGH A;  1DPU A;  1IN5 A;  2YPR A;  2ISZ A;  3BJO A;  4XSX F;  5BS6 A;  4FX4 A;  1S8N A;  2EFN A;  1T38 A;  3NQO A;  4WF2 A;  1J75 A;  3DV8 A;  3RKX A;  1KQ9 A;  2Y48 A;  1XMK A;  3GXO A;  2A6H F;  2J5P A;  1LDK B;  3ZPL A;  5HS9 A;  4CDG A;  3NEU A;  5BOX A;  5HS8 A;  2RQP A;  2TDX A;  3I4P A;  1T98 A;  2A6E F;  4ZYE A;  1T39 A;  3K1P A;  1XB4 A;  4EV0 A;  3E6C C;  4XRF A;  1P4X A;  1YG2 A;  2DO7 A;  5ILS A;  5L3G A;  2FBI A;  3M9A A;  1P4A A;  1FX7 A;  4G6D A;  4UXN A;  4JK1 X;  3AAF A;  1L3L A;  2FBH A;  4PZJ A;  4KUM A;  4EGY A;  3M8E A;  5BPI A;  1KYW A;  2CW0 F;  1R36 A;  2MA3 A;  1HST A;  4RAZ A;  2FOK A;  1GXP A;  5D5X B;  1FT9 A;  1PP7 U;  2XRO A;  2NNN A;  1D5V A;  1CF7 B;  4G6Q A;  4N9H A;  1ZLK A;  1IUY A;  4EM1 A;  2XKO A;  1YW7 A;  3IKT A;  2WTE A;  2M5W A;  5LGU A;  3E6D A;  2VON A;  3LA3 A;  4HW0 A;  4A12 A;  2Z5U A;  2XAH A;  4LLL A;  3W6J B;  4HX8 A;  5LRS A;  3FM3 A;  4A0X A;  2K02 A;  1V4R A;  3KET A;  1ON1 A;  3COA C;  3ZMU A;  5ED4 A;  2LKP A;  4EJW A;  5LBQ A;  5AON A;  4UV8 A;  4PCQ A;  3DQV C;  3VFZ A;  3DEU A;  2XUB A;  5JI6 A;  2EA2 A;  1HW5 A;  2EFO A;  3H92 A;  4MTE A;  4GCV A;  5D6F A;  4LD5 A;  3WE3 A;  2R3S A;  2PMH A;  3SZP A;  5L3B A;  1FLI A;  3GEZ A;  3GUD A;  5CYV A;  1DDN A;  3P9C A;  3RYR A;  1H9T A;  5LLQ A;  4ETS A;  3CUQ B;  4I0B A;  2V9V A;  1S29 A;  2M30 A;  3IRQ A;  4O5V A;  2GXB A;  1R1V A;  3MWM A;  5HOO A;  2CFX A;  1YLF A;  3DXJ F;  4I7H A;  3FWE A;  3F22 A;  2AXL A;  4M71 A;  4R1H A;  2XV4 S;  4AVP A;  2O6G E;  3I71 A;  3DPL C;  4MEY F;  2PMU A;  3J81 K;  1F9N A;  3KZY A;  3E5U A;  3ML6 A;  2M87 A;  1PUE E;  1UHW A;  3J80 K;  1O57 A;  2Y0M A;  4KT5 C;  2FNP A;  3K69 A;  2GQQ A;  3OOP A;  1MD0 A;  2K4B A;  3C3W A;  1B1B A;  1LJ9 A;  3IKV A;  2O8X A;  1WKM A;  5E20 A;  4L0Z B;  2LDU A;  4LLN A;  1LNW A;  1TNT A;  2GXG A;  4LG0 A;  2VOP A;  2OA4 A;  3C7J A;  2QLZ A;  3L00 A;  4KNY A;  3ECO A;  1R1U A;  1KQ8 A;  4HA8 A;  4FHT A;  2XVC A;  1FWZ A;  2ZME A;  2W25 A;  3MFK A;  3JW4 A;  3TQN A;  5HS7 A;  1K7A A;  3IC7 A;  3BJ6 A;  1EV7 A;  2HQR A;  5CVR A;  2IA1 A;  1ZHF A;  3GX4 X;  3F8N A;  3F8M A;  4QLC U;  1KYZ A;  1HKQ A;  2H6C A;  4JQF A;  4G7H F;  4EJV A;  2IT0 A;  5LGN A;  1TLH B;  3EET A;  3K2Z A;  2EA4 A;  1KQ0 A;  2L4M A;  2IRF G;  2DU9 A;  1XN7 A;  3KLO A;  4LB5 A;  1R23 A;  4FT8 A;  2HQN A;  2VBX A;  3M8F A;  1O7L A;  3KE2 A;  1U3E M;  1FC3 A;  3HYI A;  1QQI A;  2QWW A;  3L2C A;  2IW5 A;  2A61 A;  1BC8 C;  3RI4 A;  2IA2 A;  1SFE A;  2DPU A;  1J5Y A;  3ABT A;  3M1E A;  2P6T A;  2OQR A;  1XSD A;  4ASN A;  2GZW A;  2FMY A;  2PEX A;  2RGV A;  2D2W A;  2VN2 A;  3HRS A;  1XDU A;  3WGG A;  5F1R A;  3V8L A;  1IN7 A;  3WGI A;  5FD6 A;  3J7A O;  3GFL A;  4YG2 F;  1AWC A;  4ENK A;  2NAZ A;  3WTT C;  2RDP A;  3ZP5 A;  3HRM A;  2ZFW A;  3E3V A;  3KP3 A;  2QM3 A;  4CIC A;  3WTW C;  1MDM B;  2XAG A;  1TQP A;  4HDU A;  4OIQ F;  3U1D A;  3KP6 A;  3REO A;  3WGH A;  1A04 A;  1OKR A;  5BQT A;  3RTR A;  5A2Q Z;  1XGN A;  1QBJ A;  3MAJ A;  1RUN A;  4U0V A;  4HX4 A;  3DFG A;  2NYX A;  4OOI A;  2F5D A;  2W84 A;  5D4S A;  4HV5 A;  4IRH A;  4Q5S F;  4LK0 F;  5BMZ A;  4BQA A;  1Z91 A;  2LSO A;  4ZZD A;  1LDD A;  2VC0 A;  2W24 A;  3HHG A;  3WTZ A;  5HDN A;  1XMA A;  3TOB A;  1YW9 A;  4KYW A;  2DK8 A;  2O0Y A;  4BXU A;  2B0L A;  2VXZ A;  4HYE A;  3JAM K;  2JTV A;  5HVQ C;  4P55 A;  2A5Y B;  2OZ6 A;  2Z33 A;  1IXS B;  2A68 F;  1WRJ A;  3LAJ A;  1FYK A;  1X3U A;  1SAX A;  1QZZ A;  1BOA A;  1LEA A;  4LMY A;  5CLS A;  2Y75 A;  1FPQ A;  1UB9 A;  3FMQ A;  3HRT A;  4B8X A;  2PI0 A;  3LAP A;  3D0S A;  2R7D A;  3E6M A;  1QNT A;  3KP7 A;  3RKW A;  3T5X A;  2KJB A;  4UVB A;  5E8G A;  1BI2 A;  2LF7 A;  3CUQ A;  3SZT A;  4FX0 A;  1IRG A;  3QPH A;  4M9X A;  1IN8 A;  2VBW A;  4ZYH A;  2IA0 A;  4U7D A;  3ELK A;  3VB2 A;  2KIU A;  3BP8 A;  1Z6T A;  4EGZ A;  4YFN F;  3QU6 A;  4Z2Y A;  2YX4 A;  2ZCW A;  4BNC A;  2RKH A;  2QQB A;  1SD6 A;  1B9N A;  4IRG A;  3R4K A;  5DCF A;  4HBL A;  1PDN C;  4UNO A;  2CO5 A;  1K79 A;  2GIV A;  1YIO A;  4NB5 A;  4BAY A;  4NHJ A;  2Q2E A;  3PQK A;  4P96 A;  2P7C B;  5FB2 A;  3ISP A;  1G6N A;  1LB2 A;  1FOK A;  3ZMV A;  1USS A;  2QQ9 A;  3TO7 A;  1TQM A;  1MKM A;  3CUO A;  3IRR A;  1D3Y A;  4HOB A;  3FXQ A;  1FNN A;  1ZGA A;  1J9I A;  3DP7 A;  1JHH A;  2V1X A;  5K5R A;  1SD7 A;  4UUV A;  1R22 A;  1U2W A;  1B4A A;  2OD5 A;  4OIR F;  1U8R A;  2OU2 A;  1KU7 A;  3K1N A;  2ZBK A;  3QP5 A;  2COM A;  4WK8 F;  2LNB A;  4UVC A;  4AIJ A;  5CVJ A;  3U9G A;  2G7H A;  1ZRC A;  2FSW A;  1XSX A;  1I6X A;  3FHZ A;  1O7F A;  2YR2 A;  1E17 A;  4TV7 A;  2EB7 A;  1H0M A;  2CGP A;  5D8K B;  3EQL F;  2XAF A;  4HF0 A;  5DV5 A;  1FBS A;  2L01 A;  3E6B A;  1SD5 A;  1B9M A;  1KU3 A;  5EEG A;  3BY6 A;  1P92 A;  2XGX A;  4GGG A;  4BH9 A;  3Q9S A;  3KP4 A;  3O3K A;  5JHU A;  2A3S A;  5IT9 K;  2Q8K A;  2A69 F;  5LHI A;  5E17 F;  4MHG A;  3D5L A;  1KU2 A;  2L4A A;  3QP6 A;  4U0W A;  4HQM A;  2MD5 A;  1U5T C;  3MZH A;  3SHF A;  4M6X A;  1Y0U A;  4HLX A;  5CVV A;  1BI0 A;  3K1M A;  2RV8 A;  1LVA A;  2EFP A;  1FYM A;  2QBY B;  2CYY A;  1YS6 A;  2E1N A;  1XSV A;  1HXD A;  1ZG3 A;  2PQ8 A;  3DF8 A;  1J0R A;  1BN5 A;  3KEO A;  4PGG A;  1MDM A;  1EH6 A;  2HEO A;  3HSE A;  3ZN0 A;  3WU1 B;  2HTS A;  3HOT A;  3C18 A;  2VC1 A;  1YW8 A;  4K2E A;  2HGC A;  2QEN A;  3PQJ A;  3ZMS A;  1NHA A;  3GW2 A;  5TRD A;  3E97 A;  2L02 A;  5K5O A;  4BYY A;  2EJR A;  4HV6 A;  2ETH A;  1FYL A;  2ZKZ A;  5KK1 A;  1TQI A;  5DCM A;  3TKY A;  2DK5 A;  3EYY A;  1KGS A;  2QVO A;  2KRF A;  2W85 A;  1HKT A;  2VE9 A;  3LWF A;  1XDS A;  1GHC A;  3F8C A;  4H0E A;  3Q9V A;  5E1W A;  1ULY A;  2QUF A;  1D8K A;  1ZAO A;  2CWE A;  2G9W A;  4L0Y B;  1SFU A;  1P4W A;  5D5W B;  4BHB A;  3ZMZ A;  3GFJ A;  1FSE A;  3E5Q A;  4HF1 A;  2ELH A;  2L54 A;  4LLG F;  2PFB A;  1W7P A;  4RB1 A;  2FU4 A;  1T2K A;  2C6Y A;  1O3Q A;  2GWR A;  1ON2 A;  1OR7 A;  3QPT A;  4P5O A;  4YFK F;  3HUG A;  1DP7 P;  1ONV A;  2HTJ A;  2DPD A;  4I09 A;  4U88 A;  4LGW A;  1I5Z A;  2JZY A;  2KKO A;  3KEQ A;  2FE3 A;  3R61 A;  1IW7 F;  2QYO A;  4HZF A;  2V1U A;  1U5T A;  3KLN A;  4R79 A;  3MCZ A;  1YS7 A;  4WXD A;  4ESF A;  1HW1 A;  1JHF A;  4G94 A;  2K27 A;  2DBB A;  4CGZ A;  2P5V A;  2RN7 A;  3LST A;  1MJA A;  2PG4 A;  3L7W A;  3KZZ A;  3R0A A;  2E7X A;  2A07 F;  2FQ3 A;  2K4J A;  2UWM A;  4F7Z A;  3H3Z A;  3KFW X;  1LEB A;  3JTH A;  3CTA A;  4AD9 A;  2ISY A;  5E8I A;  4GXO A;  4L9N A;  2ESH A;  3N4M A;  5DDG A;  5A2Q K;  3RYP A;  5ILV A;  2MC3 A;  2F2E A;  1MGT A;  2MLK A;  2BE5 F;  2DTR A;  1F4K A;  4KMF A;  3WTY C;  3K0L A;  3F6V A;  2O3F A;  3I5U A;  2DT5 A;  1XGM A;  1R1T A;  4KIC A;  2V79 A;  3I59 B;  2VT3 A;  4O3M A;  3F8B A;  3CUQ C;  4ENM A;  3W6K B;  4RB3 C;  4IHS A;  1QO0 D;  4ZYG A;  2YX7 A;  4O6J A;  4A5M A;  4AWX B;  3HRU A;  5D5V B;  3I64 A;  1IXC A;  2CSO A;  2EFW A;  3GFI A;  2KIF A;  2KJC A;  1LDJ A;  2GA2 A;  3I53 A;  3VOD A;  4UV9 A;  4RGS A;  5LHH A;  4BHP A;  2XKP A;  4G8X A;  4A6D A;  5J8C A;  2PLY A;  2OZU A;  1W7P D;  2DLL A;  1DPR A;  3L9F A;  4MEX F;  4I0A A;  3CLO A;  3T0Y A;  3RDI A;  2J5O A;  1YFH A;  3I58 A;  3SXY A;  2QQA A;  3SQN A;  4WXH A;  4HX7 A;  1QGP A;  5FGM A;  3LQQ A;  2JSC A;  1B6A A;  4CO8 A;  3HOS A;  2D1V A;  5AIP A;  4LB6 B;  4EJU A;  4LJZ F;  1IN4 A;  2O61 A;  1CF7 A;  2DAO A;  4IRI A;  1GVJ A;  2BGC A;  4OMZ A;  5FO5 A;  3RIR A;  2CQK A;  5ICG A;  3FXU A;  4L5I A;  3VOE A;  4RS8 A;  4MGR A;  3JSO A;  5J6X A;  4OIP F;  1U6G A;  2NRA C;  1R7J A;  1YQA A;  1IXR C;  1ZH5 A;  2KIM A;  3H3U A;  1MZB A;  4A0Y A;  5J8F A;  5DD8 A;  1Z05 A;  1H9G A;  4HF2 A;  4HDV A;  4RB0 A;  2MBF A;  3EUH A;  3R60 A;  2VT2 A;  5FLX K;  1BIB A;  3P9K A;  4Q4Z F;  4Y15 A;  3DKW A;  4RAY A;  4P9F A;  3F6O A;  4KIB A;  1RIO H;  1YO5 C;  3WG9 A;  2WWY A;  1K78 B;  2GA1 A;  1G3Y A;  1OYW A;  3RPQ A;  3TO9 A;  4IVN A;  3EYI A;  2Z99 A;  1C0W A;  4G9Y A;  2ZO4 A;  3IWZ A;  4QWQ A;  3WE2 A;  6PAX A;  2WV0 A;  1O3S A;  1FP1 D;  3GZ6 A;  4M74 A;  4L9J A;  1YYV A;  1GXQ A;  2IP2 A;  1FBU A;  3MEX A;  5KVR A;  3VEP A;  3BZ6 A;  4I98 B;  4DNC A;  4U7B A;  2D45 A;  2HOE A;  4XLP F;  4P9U A;  3V8K A;  4IHT A;  3QRF F;  1UCR A;  4MNU A;  3V7R A;  1W5S A; 
#chains in the Genus database with same CATH topology
 4KFC A;  4AYB N;  2P81 A;  2MH2 A;  3OV8 A;  3L09 A;  3QYF A;  1ZG1 A;  3JSP A;  2HQA A;  3WTX C;  3CO7 C;  4C2M J;  3DU5 A;  2VPL A;  3BQZ A;  1VND A;  2Z1D A;  1BBY A;  2KHM A;  4ZDO A;  2H94 A;  3V4G A;  4ESJ A;  4M6Y A;  2OQG A;  2ZME B;  3HKZ A;  3PNY A;  3JAM Z;  3H9J A;  2DOD A;  2DA2 A;  3CDL A;  3W2A A;  2JPB A;  1N77 A;  3BOQ A;  1G3S A;  2L5Q A;  1JGS A;  3CDH A;  3GVA A;  3V7C A;  3A01 B;  3ULQ B;  2HYG D;  1GT0 C;  5EEH A;  2JUC A;  5JLW A;  3T1B A;  2H1L A;  4A3G J;  1J7K A;  2HR3 A;  4PDK A;  4MQV A;  2IS2 A;  4BJ5 C;  4B43 A;  4XNF A;  2W00 A;  1SFX A;  3FZV A;  4DZJ A;  2R7Q A;  2Z2S B;  2DA3 A;  1BL0 A;  3OL4 A;  3UR3 C;  2ZFU A;  2IPQ X;  3L2U A;  4IEJ A;  1KU9 A;  1MJ9 A;  5F0H A;  5L3F A;  2HDC A;  1SD4 A;  5ICF A;  3CMM A;  3FXM A;  1HDD C;  3BTI A;  3LA7 A;  3K6G A;  1S7O A;  4J01 A;  5F1J A;  2E1C A;  3G73 A;  1IZ1 A;  1WCM J;  4IHV A;  2DMT A;  1JKQ C;  4XRM A;  2FML A;  1X58 A;  4RGX A;  1QHG A;  4HSR A;  2EZI A;  2WA0 A;  4BAC A;  2XDV A;  1I3A A;  4M9S A;  1IC8 A;  2E71 A;  3B73 A;  2OAZ A;  3WTS C;  2VE8 A;  2TCT A;  3CJN A;  2VLA A;  1I27 A;  1ZTR A;  5HLT A;  3TBI A;  4HQE A;  4DQ2 A;  2Z3Y A;  2HYF A;  3C2B A;  2VOD A;  1L0O C;  3BWG A;  2HKX A;  2CG4 A;  3TW7 A;  2E2H J;  1R5I D;  3R0J A;  4CZZ A;  5IT3 A;  1N25 A;  1WSU A;  1Z3Y A;  2IBD A;  4QTR A;  2JQ7 A;  2K86 A;  3LOC A;  3GO5 A;  3OS2 A;  3NRV A;  2ZSH B;  1HLV A;  3H3V K;  3A03 A;  5D8L B;  3BQY A;  3LSR A;  1YX5 A;  2CUF A;  2EV6 A;  3CDI A;  1TW2 A;  2LOO A;  4J19 A;  4IOC F;  3TDZ C;  1QPM A;  2HU9 A;  2XAQ A;  4DYC A;  3HTS B;  5DUK A;  4RM3 A;  2D1H A;  5CJ9 A;  2BV6 A;  4EJT A;  2W57 A;  3ZRG A;  1ETO A;  3TDU C;  5C44 J;  1YIJ I;  2EV5 A;  2FJ1 A;  4LG3 A;  4CXF A;  3I59 A;  2BYV E;  1QRY A;  5L3D A;  1D1A A;  2EIN H;  2OBP A;  1XCV A;  5LRR A;  1DU6 A;  3IHU A;  1A31 A;  1XTA A;  1ETX A;  1Z0X A;  4E7L A;  3I9V 2;  4OU0 A;  5B5E C;  2O03 A;  4U87 A;  3O6B B;  1V54 H;  3Q0W A;  5EJC A;  5KAI C;  4M73 A;  1W1W E;  3MZ8 A;  2STT A;  3ZXS A;  3EUA A;  3PFI A;  3FF5 A;  3S32 A;  3BT9 A;  3FX3 A;  4D0P A;  1E2X A;  1JJ6 C;  2BY3 A;  2ZJR F;  1REP C;  1X2N A;  2EZK A;  2JPC A;  4XON A;  1IN6 A;  3DPU A;  3BG7 A;  4B48 A;  2F4O B;  4ZZL A;  3OYA A;  3D1N I;  1ZRF A;  2YU3 A;  2M4K A;  2EFQ A;  1X1D A;  5JR3 A;  3HZJ A;  5BPD A;  2XRN A;  1FTZ A;  4ENJ A;  1F43 A;  2CW7 A;  3ONQ A;  3S1M J;  2QZ8 A;  3C1D A;  3GTL J;  4IF4 A;  2HXO A;  1UFM A;  4I2O A;  3FKI J;  4BU2 A;  4A5N A;  4XLN F;  5ICC A;  2EWN A;  4Q48 A;  2BEO A;  3OS0 A;  1YIT I;  4PJN A;  5DYM A;  3CME I;  3LSK A;  4QPQ A;  1RUO A;  1O3T A;  3F72 A;  3HJE A;  2CMP A;  2LY2 A;  1Z7L A;  2LKX A;  1MBH A;  4BXF A;  5H2F C;  1ZQ3 P;  4ENN A;  4IL6 C;  3JTG A;  3EPZ A;  4HNU A;  3I0T A;  3GFM A;  1ZYR F;  2P7V B;  2H27 A;  3PFY A;  3ZMD A;  2R7W A;  4HEA 2;  3FBI B;  2E19 A;  1XX5 A;  1M1E B;  4ZDL A;  3GZ5 A;  5ICE A;  1OYY A;  1BI3 A;  2QQ8 A;  1BIA A;  2P5L C;  2VBZ A;  1GVD A;  5ERI A;  5FLV A;  5HLH A;  3OYC A;  3S3N A;  1S3J A;  1MJB A;  1G3W A;  3VYT B;  3IWF A;  4CCL A;  2L9R A;  1VQ9 I;  2L9N A;  3GTM J;  1WJA A;  2CH0 A;  5FD5 A;  3ZQ7 A;  5GAG J;  5FRN A;  1B8I A;  3DLA A;  2MAB A;  2VXD A;  1X1C A;  1SVM A;  2WAD A;  2ADU A;  3M4O J;  3FMR A;  1O3R A;  1XCB A;  4UVA A;  5H20 A;  4OMY A;  2FRH A;  4B44 A;  2JRM A;  1GV5 A;  1I1G A;  1Z67 A;  3ZQG A;  4D9J A;  4BJ6 C;  2DQL A;  1D0Y A;  4M72 A;  3LSJ A;  2JSP A;  4Y4R A;  4CSW A;  5M3M J;  2H09 A;  4XQF A;  3JRA A;  2NVY J;  4ABZ A;  4EM0 B;  2IJL A;  4IJA A;  5FFZ A;  2R92 J;  2FF4 A;  1O4X A;  3ESW B;  2HFH A;  1RZ4 A;  1WGX A;  5DEQ A;  4X1E A;  2XB5 A;  1T0F C;  4B09 A;  2M45 A;  3KCC A;  4A3L J;  1YI2 I;  1OCC H;  4RDU A;  2DQR A;  2BY2 A;  4EMS A;  2AQF A;  4MFD A;  5IT9 Z;  2IS4 A;  1HOM A;  4PJM A;  3CCM I;  1IRF A;  3H5R A;  2EIK H;  2P5K A;  2QSF X;  3Q3S A;  3X2Q H;  5D5U B;  5HDK A;  4HLY A;  2R93 J;  3S14 J;  2WB1 A;  3SYT A;  2L7M P;  2YSR A;  4IQ4 A;  4XR6 A;  1HBX G;  4BL0 B;  1ZN2 A;  4EAT A;  1GUU A;  3ZR8 X;  3BJA A;  1U78 A;  1SC7 A;  1MND A;  3DBL B;  2X1E A;  3FIS A;  4EVI A;  4CH7 A;  2Y9Y A;  2JT1 A;  4AYB A;  4PFP A;  2R5Z B;  3PO2 J;  1K6O A;  1RI7 A;  5JVT A;  5E1Z B;  1I1S A;  2JWT A;  1ODD A;  4U0Y A;  1K6Y A;  2A5W A;  4EQQ A;  2FEZ A;  2X1C A;  2RRE A;  4A2U A;  4XN0 A;  3RZD J;  2FBK A;  2WC2 A;  1W0U A;  1H89 C;  1MBF A;  4H4K C;  2DFI A;  3LSP A;  1IF1 A;  1AKH B;  1K78 A;  3GLX A;  2QCO A;  2ESN A;  2H6B A;  1F5T A;  5EZG A;  1T95 A;  3CCU I;  1FOX A;  1UST A;  2F6C A;  1Z6R A;  2M3A A;  4A6E A;  4M6V A;  3ABM H;  2R7V A;  1UAA A;  1SFK A;  4OIO F;  3S1Q J;  3HTU A;  3K7A J;  2E7W A;  4NNJ A;  5F27 A;  2ACJ A;  2K7L A;  1VQL I;  5LHG A;  3G3Z A;  2F5V A;  3GWZ A;  3M7G A;  2X0L A;  2MYS A;  4WCG A;  3S17 J;  1J2X A;  2ZNZ A;  1W4M A;  1W0T A;  2DN0 A;  4KIF A;  5E18 F;  3ABL H;  1AA7 A;  2PX9 A;  1ENH A;  2DT7 B;  2EZL A;  3T8R A;  1Y39 A;  3TP3 A;  1CGP A;  3OYI A;  2HKO A;  1Z7U A;  1R5H A;  2L9S A;  4RB2 C;  3HBL A;  4BHC A;  3HSR A;  1TWC J;  3GBG A;  2NNY A;  4Y17 A;  1MNE A;  2OV7 A;  3QAH A;  3G1M A;  1J59 A;  3CCV I;  2M1B A;  1P6R A;  2MSY A;  1BJA A;  1PJR A;  2XAS A;  1QA6 A;  1U0J A;  4B1R A;  4XMY A;  4RLF A;  5J1Y A;  3FMS A;  4JYK A;  3CC4 I;  4L9V A;  1TNS A;  4XLA A;  4WWC A;  3AG3 H;  2KPM A;  3RQI A;  3OYF A;  2P6S A;  1MBG A;  2LH9 A;  2MLG A;  1E3O C;  3CZ6 A;  4G7Z F;  4IPA A;  1XGS A;  1U9N A;  3H9Q A;  1KZH A;  3RPU A;  2FQ4 A;  2NS0 A;  1B59 A;  3ZN1 A;  5JHF A;  4A3D J;  4Q47 A;  1TWA J;  4A3K J;  3J7Z I;  2LK2 A;  3ERE D;  3QOP A;  2JMW A;  5CVI A;  2BZT A;  4UUS A;  3BLY A;  2FX0 A;  1TW3 A;  1SMT A;  5HDG A;  3RJP A;  1BC7 C;  2V7F A;  1Y1W J;  1WJC A;  1FOW A;  1BR4 A;  3K70 C;  5H6R A;  3MN2 A;  2F5F A;  2HXI A;  2B7E A;  3HC7 A;  5CVU A;  5FRO A;  1T6S A;  3CO6 C;  1LQ1 A;  4YFX F;  1MH4 A;  2Y2Z A;  3DPT A;  4AID A;  2M8E A;  2L9V A;  2X48 A;  1OYI A;  2W48 A;  1MBJ A;  5FKK A;  2VBY A;  3J7A Y;  2V1D A;  3DTI A;  2UXX A;  4IOA F;  2MH9 A;  1HW2 A;  1LFU P;  3HIF A;  3KP5 A;  4GYG A;  1I3Q J;  2JA5 J;  3BG3 A;  5FFX A;  5JFR A;  2BBY A;  2FNA A;  4ZYD A;  1XS9 A;  1Z9C A;  3U21 A;  4AIK A;  1PP8 F;  1R00 A;  2JRT A;  4CCN A;  3MKW B;  5CKT A;  3O2P E;  2VOO A;  1OCP A;  1HKS A;  3F23 A;  5J1R A;  3J81 Z;  3CC2 I;  3HHH A;  5K1Y A;  4M3D A;  1EH7 A;  2ID3 A;  3BPV A;  1T0F A;  2ZXJ A;  2F5E A;  2X6W A;  4OIN F;  4PSX A;  1STZ A;  4C30 A;  3J80 Z;  1AOY A;  3L2W A;  1ZRD A;  4KMU X;  2R7Z J;  2RVC A;  5KHD A;  3DBH B;  4I02 A;  3S15 J;  3OYK A;  3WU0 A;  4BEH A;  3IH4 A;  3V7S A;  3KIO A;  2XHK A;  4CZC A;  2M0C A;  3MD2 A;  4BUP A;  1KA8 A;  3RCO A;  2V26 A;  2ZJ2 A;  4A0Z A;  5D6E A;  2UUZ A;  4Y3O A;  2LRD A;  3ABK H;  3BR2 A;  4MFE A;  1R58 A;  1IUF A;  4XKB A;  3DLL F;  2E1M B;  1NG7 A;  2DI3 A;  2DT6 A;  5D4R A;  3ROU A;  4CA0 A;  4YIF A;  4ON0 A;  4XK4 A;  2PBI A;  3OSF A;  1TC3 C;  2HOA A;  2EIM H;  2HS5 A;  2OC6 A;  1HQC A;  4KN7 X;  2HQ5 A;  3CCS I;  3R6S A;  3OR2 C;  4XBF A;  3FXR A;  5L3C A;  4HAM A;  2LF8 A;  5JLX A;  5LGT A;  1LFB A;  3T8T A;  1UEL B;  1V3F A;  1X4O A;  1FBQ A;  1SMY F;  2WY8 Q;  4XRS A;  1Y56 A;  5EGO B;  1Y0N A;  3MKZ A;  2L3D A;  3Q5F A;  1MBK A;  3WTU C;  3BR5 A;  2HWV A;  1N75 A;  4JP0 A;  2JA2 A;  4E7S A;  2XSD C;  4ESB A;  3WTV C;  2Y0S A;  2JUG A;  2VJ4 A;  5K5Q A;  5F6F A;  2QA4 I;  3SZG A;  4EJO A;  2PJP A;  1IO2 A;  2GAU A;  4NC8 A;  3BTC A;  4RGU A;  5AIQ A;  3H0D A;  1S6L A;  3GYH X;  3LMM A;  4AIH A;  5H6Q A;  3RSN A;  3MQ0 A;  3OYB A;  5HLI A;  4XLC A;  1PUF B;  2QBY A;  5LEK A;  1RR7 A;  4AU7 A;  3HL2 A;  2V6E A;  1RNL A;  3E5X A;  2E5Z A;  3L1P A;  2UZK A;  3FXJ A;  2ZNY A;  2FA5 A;  2IVM A;  4N9I A;  3OYL A;  4KIT B;  1OFC X;  3AFH A;  5DD4 A;  5FKL A;  2XAJ A;  3U2R A;  2EPF A;  3ABU A;  3PIP F;  2RQQ A;  1P7J A;  2DDB A;  3BPX A;  4LFU A;  5M3F J;  5ILU A;  3H1C A;  1HSJ A;  4MLO A;  3M3Y J;  2RNJ A;  5DCM B;  1T56 A;  3GTQ J;  3P7N A;  1YE9 A;  1ZG5 A;  2Z9O A;  1OPC A;  4XSZ F;  3BC8 A;  1EH8 A;  4KIG A;  3FM5 A;  2DOF A;  3DCF A;  3HPG A;  2RC4 A;  4S04 A;  1DQU A;  1VQP I;  1E0E A;  5F64 A;  2R7U A;  2P4W A;  1W36 D;  2STW A;  3OIO A;  3BTL A;  4D5F A;  1WWX A;  2UXN A;  1F1Z A;  3RPU D;  3BRO A;  3WOD F;  3JRE A;  3F8F A;  1FP2 A;  1XG1 A;  1ZAR A;  5E1X A;  2LRE A;  2P8T A;  1VTN C;  3TGN A;  1VQM I;  4FE7 A;  4KA4 A;  1AU7 A;  1FZP B;  3IL2 A;  1WH7 A;  4IXA A;  1TWH J;  1WJ5 A;  4Y7N J;  1XGO A;  2DDA A;  4S05 A;  2BHZ A;  1UHM A;  2Q0O A;  1MMD A;  1W5T A;  1Z1D A;  1YTY A;  3HSF A;  3KEY A;  2B63 J;  2FXA A;  3K10 A;  4ZH4 F;  2WAQ N;  1TBX A;  3C2G A;  3HM5 A;  2XIG A;  1EJ9 A;  3P9I A;  2AXT C;  4PUS A;  1P2F A;  2OCE A;  3CJR B;  2F5C A;  2HZT A;  3UNG C;  3ECH A;  1MMS A;  2K5C A;  3TOA A;  3F3X A;  1W7P B;  1IAW A;  4KIS A;  3V8J A;  5DUI A;  2M0M A;  5DTD A;  3EDP A;  4M9Z A;  4UHT A;  1G3T A;  4YII A;  2DW4 A;  2JVG A;  4MQ9 F;  1WI9 A;  3K4L A;  4L18 B;  2NS8 A;  2HNH A;  3HOX J;  2LVS A;  3HOZ J;  5LEJ A;  4ITV A;  3SDG A;  5IYC J;  3LSM A;  1ZRE A;  2VQL A;  1MBE A;  2M7A A;  3FKJ A;  3HUG B;  1BJZ A;  1ZGJ A;  3A0H C;  3QWL A;  5HNH A;  3QU3 A;  3B02 A;  1XD7 A;  4XRS G;  3LFK A;  4CHU A;  2G7U A;  3N97 A;  4IHY A;  4R8H A;  4G7O F;  4UUT A;  4E7J A;  1ZLJ A;  2AS5 F;  3IH3 A;  2DJN A;  2ZXW H;  3SFZ A;  3VSL A;  5L3E A;  3A1Y A;  2IAI A;  1U5T B;  4JBA A;  1MSE C;  4A3C J;  1R5G A;  3VPR A;  3GF2 A;  1TT0 A;  5IOZ A;  1HCR A;  3RQ4 A;  1QZY A;  1BI1 A;  1TTY A;  5K7F A;  3RKY A;  4LG0 B;  4GYI A;  1K61 A;  2VQG A;  3ZMT A;  1NK3 P;  2DJI A;  1Q1H A;  2EK5 A;  2WV1 A;  2KL4 A;  2EV0 A;  3LL7 A;  1BM9 A;  5HLG A;  2DXI A;  5F0C A;  2GBY A;  4L9T A;  3LQR A;  4MO7 A;  1MNM C;  4KJZ A;  1DUX C;  3AG4 H;  1IRX A;  1Z3X A;  1JKP C;  2Y31 A;  4KN4 X;  3S2W A;  1G59 A;  1ZR2 A;  2PN6 A;  4KDP A;  3BDD A;  4Y13 A;  4NQW A;  3K9T A;  2R7F A;  4D7N A;  1G4D A;  3I56 I;  5DM6 F;  2BY1 A;  4W1U A;  5FRM A;  3KP2 A;  4OWR B;  3MZY A;  5FKM A;  9ANT A;  4CYD A;  4WXC A;  3I54 A;  1IJW C;  3F21 A;  5TIS C;  3QYB A;  2XPV A;  3VYS B;  4L5J A;  4LK1 F;  4D7M A;  5FLX Z;  1OMI A;  3CMA I;  1OCO H;  2X4H A;  3OWT A;  5TJJ A;  3WHC A;  3PNV A;  4I01 A;  4A69 C;  4RGR A;  4MTD A;  3TO6 A;  2NOG A;  1FY7 A;  4GO1 A;  1BOB A;  2ELK A;  4E70 A;  2V6C A;  1WQ2 A;  4JX6 A;  3LA2 A;  4WX9 A;  1JXS A;  5IOY A;  3KYC B;  4N0B A;  4EM2 A;  3OYD A;  5KNL A;  1T33 A;  2VPR A;  1JE8 A;  1S7A A;  1D0Z A;  4PGH A;  1DPU A;  4YRV A;  1VFC A;  1IN5 A;  3QOE A;  4IX7 A;  3E7L A;  3IH2 A;  3OL3 A;  2R5Y A;  1JT0 A;  2KZV A;  5K7H A;  2YPR A;  2ISZ A;  3BJO A;  4XSX F;  5BS6 A;  4FX4 A;  2B9S A;  1S8N A;  2EFN A;  1T38 A;  3NQO A;  4A3F J;  4WF2 A;  1J75 A;  3DV8 A;  2XRL A;  4YEL A;  3RKX A;  1KQ9 A;  2Y48 A;  1XMK A;  3GXO A;  2A6H F;  2J5P A;  2QSG X;  1LDK B;  3ZPL A;  5HS9 A;  4CDG A;  2XPW A;  4M3F A;  4IZZ A;  3NEU A;  2X6Y A;  5BOX A;  2VAS A;  2TRT A;  3GME A;  2RQP A;  2JVH A;  2TDX A;  3FXK A;  4E6K G;  5HS8 A;  3HOY J;  1PYV A;  3I4P A;  1T98 A;  2CV2 A;  2A6E F;  2ZC2 A;  4ZYE A;  2EQR A;  4E7H A;  1T39 A;  3K1P A;  1XB4 A;  1OCT C;  1DU0 A;  2V1N A;  2OPT A;  4EV0 A;  3E6C C;  1CQT A;  4D5C A;  5B1A H;  4XRF A;  1ERD A;  3OY9 A;  1P4X A;  1YG2 A;  2DO7 A;  2HI3 A;  1VQ4 I;  5ILS A;  5L3G A;  2FBI A;  3M9A A;  4FAS D;  1P4A A;  2K9Q A;  1FX7 A;  3F0C A;  2NXN B;  4G6D A;  3O8H A;  4F55 A;  3W6V A;  4UXN A;  2V9P A;  4JK1 X;  3AAF A;  1L3L A;  5GPA A;  2EH3 A;  2CQQ A;  2FBH A;  1JTY A;  5J3L A;  4PZJ A;  1MMN A;  3U1K A;  3KZI C;  3CCY A;  2QKL B;  2LD5 A;  5EEA A;  3OYH A;  5FKO A;  1D5Y A;  4KUM A;  4EGY A;  3M8E A;  4BS9 A;  5GP9 A;  2KDO A;  5BPI A;  1KYW A;  2CW0 F;  5GAH J;  2JK3 A;  2JA7 J;  1R36 A;  2MA3 A;  1ITY A;  1HST A;  1VQO I;  1V5E A;  4RAZ A;  2FOK A;  1GXP A;  5D5X B;  1FT9 A;  1PP7 U;  2XRO A;  3N05 A;  3B6A A;  2NNN A;  2XF5 A;  1D5V A;  1CF7 B;  2JA8 J;  3LSH A;  4G6Q A;  2V9K A;  4V19 K;  2ZME C;  1RC9 A;  4N9H A;  1ZLK A;  3S2D J;  1JTX A;  4EM1 A;  5J4V A;  1IUY A;  3BR3 A;  2XKO A;  1YW7 A;  3IKT A;  4PFO A;  5E3O A;  1VQ6 I;  2R7T A;  2WTE A;  3HG9 A;  2M5W A;  5LGU A;  3V42 A;  3QYE A;  4ZTJ A;  3E6D A;  2VON A;  2WAQ A;  2E1O A;  3I4M J;  3LA3 A;  1TZL A;  3CP8 A;  4HW0 A;  2LBF B;  4A12 A;  2Z5U A;  1D0X A;  3JRB A;  1K4T A;  2XAH A;  4LLL A;  3W6J B;  4DGW B;  1VQK I;  4HX8 A;  1X3W B;  2RNG A;  3FM3 A;  3H0G J;  4A0X A;  5LRS A;  2K02 A;  1V4R A;  3KET A;  1ON1 A;  3COA C;  3ZMU A;  5ED4 A;  2VKD A;  2KDZ A;  2LKP A;  3Q0V A;  4NBQ A;  4EJW A;  5FLM J;  5LBQ A;  2WAF A;  3E1S A;  4II2 A;  1A36 A;  3ZQI A;  5AON A;  2QSH X;  4UV8 A;  4PCQ A;  2CUE A;  3OYJ A;  4F91 B;  4PJJ A;  3DEW A;  3DQV C;  4XKV A;  3VFZ A;  2ELJ A;  3DEU A;  2XUB A;  3WHB A;  5JI6 A;  2EA2 A;  1HW5 A;  2W82 A;  2EFO A;  3H92 A;  4MTE A;  3G1L A;  4GCV A;  5KAF C;  5HOD A;  1A6Q A;  5D6F A;  4LD5 A;  3WE3 A;  1SEU A;  2R3S A;  1ZR4 A;  2DA7 A;  2PMH A;  3SZP A;  5L3B A;  1FLI A;  2F4M B;  3GEZ A;  2R7R A;  1FTT A;  4IKF A;  2HPM A;  3GUD A;  3HDD A;  5CYV A;  1FMW A;  1DDN A;  3P9C A;  3RYR A;  1H9T A;  5LLQ A;  2CQN A;  4ETS A;  4RA2 A;  4ZJZ A;  3CUQ B;  4I0B A;  1OQY A;  2V9V A;  2QEX I;  1S29 A;  2M30 A;  2XPU A;  2NOJ B;  4AC0 A;  3IRQ A;  3ZOB A;  4O5V A;  2GXB A;  1R1V A;  3MWM A;  2LYC A;  2JJ7 A;  5HOO A;  2CFX A;  4JX4 A;  1YLF A;  2DOA A;  2G0E A;  1NTC A;  3DXJ F;  5F04 A;  2EIJ H;  2EIL H;  4I7H A;  4NC7 A;  4NUB A;  2BVM A;  3M8J A;  3FWE A;  1TL8 A;  3F22 A;  3SEZ A;  2PMZ N;  2AXL A;  1A6I A;  4M71 A;  4R1H A;  2XV4 S;  1JI8 A;  3BR0 A;  3LFU A;  4AVP A;  1G2H A;  4DJA A;  3OYN A;  2O6G E;  4HRI A;  3I71 A;  4L5E A;  3DPL C;  2BW3 B;  1WJF A;  2DA6 A;  4MEY F;  1A35 A;  2PMU A;  4OAZ A;  3J81 K;  2K3F A;  1F9N A;  3KZY A;  3E5U A;  4X6A J;  2NVT J;  3ML6 A;  2M87 A;  2Q2E B;  1PUE E;  1UHW A;  3QPS A;  1GDT A;  4I99 C;  3J80 K;  3VWB A;  1O57 A;  4BY1 J;  2Y0M A;  4KT5 C;  1K4S A;  3WU2 C;  2FNP A;  2Y69 H;  3VYU B;  1YRN B;  3MKY B;  4C3I J;  2D5V A;  3K69 A;  2GQQ A;  1V5G A;  3OOP A;  1MD0 A;  2K4B A;  3C3W A;  4C9Y A;  5B3S H;  1ZGW A;  1D8J A;  1B1B A;  1LJ9 A;  1P9Q C;  1SAN A;  3IKV A;  2O8X A;  3M1C A;  4F3Q A;  1WKM A;  4P1W A;  4CYC A;  5E20 A;  3S93 A;  2KT0 A;  1GLN A;  4L0Z B;  2LDU A;  4LLN A;  5C3E J;  1LNW A;  1TNT A;  2GXG A;  1QU3 A;  1R71 A;  4LG0 A;  2VOP A;  2A05 A;  2OA4 A;  3C7J A;  2QLZ A;  3L00 A;  4KNY A;  3ECO A;  5CPR B;  1X1A A;  1R1U A;  2FD5 A;  2JN6 A;  4XLE A;  4RM2 A;  1KQ8 A;  4HA8 A;  4FHT A;  2XVC A;  1FWZ A;  5LD2 C;  2LTP A;  2HDD A;  2ZME A;  2PJR B;  2W25 A;  3MFK A;  4CCK A;  3JW4 A;  3TQN A;  5HS7 A;  2MW8 A;  3S8P A;  1K7A A;  3IC7 A;  3BJ6 A;  1BA5 A;  1EV7 A;  2GOX B;  2HQR A;  2ME6 A;  3A01 A;  5CVR A;  4NC6 A;  2IA1 A;  1ZHF A;  3GX4 X;  3F8N A;  3F8M A;  2CQ7 A;  4QLC U;  1KYZ A;  1HKQ A;  1OCZ H;  4BBS J;  2H6C A;  4JQF A;  5DS9 A;  4G7H F;  5M5W J;  4EJV A;  3EUK L;  1JJ8 C;  2VQH A;  2IT0 A;  5LGN A;  2M8G X;  1JKO C;  4DOZ A;  2BXY A;  1TLH B;  3OYM A;  2E36 A;  1YJW I;  3EET A;  2BVL A;  3K2Z A;  2DTZ A;  2ZXH A;  3DKY A;  2KRH A;  4XKW A;  4LIT A;  2I8D A;  4E7Z A;  2EA4 A;  1KQ0 A;  3FXL A;  2L4M A;  1QVU A;  2IRF G;  2DU9 A;  1XN7 A;  1OCR H;  3KLO A;  3DTE A;  4LB5 A;  1R23 A;  4FT8 A;  2HQN A;  2VBX A;  3CCL I;  3M8F A;  2K9L A;  1O7L A;  2E5N A;  2MFZ A;  2VUM J;  5EYR A;  1FIP A;  3KE2 A;  1I50 J;  1U3E M;  1FC3 A;  4BE0 A;  3HYI A;  3SJM A;  1QQI A;  2QWW A;  3L2C A;  2EZH A;  3HOV J;  5FJ8 J;  2IW5 A;  2A61 A;  1BC8 C;  3RI4 A;  1E3H A;  2IA2 A;  4B3X A;  4ZTF A;  1JT6 A;  1SFE A;  4E7I A;  2DPU A;  1J5Y A;  2CUJ A;  4HST A;  3ABT A;  2L2O A;  3M1E A;  2P6T A;  2YS9 A;  2OQR A;  1XSD A;  4ASN A;  2OTL I;  2GZW A;  3GTG J;  2IEK A;  3H5N A;  1R4N B;  2IGK A;  2YUS A;  2RAE A;  2FMY A;  2XGC A;  2PEX A;  2RGV A;  4A3I J;  1X4P A;  1ETK A;  1XC5 A;  2D2W A;  2VN2 A;  3HRS A;  3S3O A;  4E7K A;  1XDU A;  3WGG A;  5F1R A;  3NWS A;  3V8L A;  1IN7 A;  4XOT A;  3WGI A;  5FD6 A;  3J7A O;  3SFI A;  4IO9 F;  2QKM B;  3BR1 A;  3G6E I;  3GFL A;  2K85 A;  4YG2 F;  1RRJ A;  2H1K A;  1LE8 B;  2VKH A;  3HPH A;  1AWC A;  4ENK A;  2NAZ A;  3WTT C;  2KLO A;  5J47 A;  2RDP A;  3ZP5 A;  3HRM A;  3PSI A;  1WJE A;  2ZFW A;  4RAF A;  3MKL A;  4ZYA A;  1NG6 A;  2NVX J;  4E4H A;  3E3V A;  3DTK A;  3KP3 A;  2QM3 A;  5CQE A;  3TP0 A;  5EG0 B;  1YX3 A;  4CIC A;  3WTW C;  1MDM B;  2XAG A;  1S9H A;  1TQP A;  4HDU A;  2LMD A;  3U1D A;  2DMU A;  4OIQ F;  3KP6 A;  2XGD A;  3REO A;  3WGH A;  2MC4 A;  2O9L A;  1A04 A;  1IGN A;  1TWF J;  1SFO J;  2GIZ A;  3OIQ A;  1OKR A;  3L2Q A;  1NH3 A;  3QQA A;  5IPA A;  1UJ8 A;  2ZSI B;  5BQT A;  2VJJ A;  3JRG A;  3ZQQ A;  3RTR A;  5A2Q Z;  1XGN A;  1QBJ A;  1G8X A;  3MAJ A;  2OF7 A;  2AO9 A;  4S0H B;  1Y6I A;  1RUN A;  2HVS A;  4U0V A;  4W97 A;  3ZCO A;  4HX4 A;  4HNV A;  3DFG A;  1VZ0 A;  2NYX A;  2FUG 2;  3FIW A;  4OOI A;  2ID6 A;  2F5D A;  1B8I B;  2W84 A;  5D4S A;  3KYL A;  4HV5 A;  4IRH A;  4JX5 A;  1WJD A;  2NVU B;  4LK0 F;  1R4M B;  5B66 C;  4F93 B;  4Q5S F;  5B1B H;  5IP9 J;  5BMZ A;  4BQA A;  1Z91 A;  2LSO A;  4ZZD A;  1LDD A;  3AL0 B;  1EKE A;  2VC0 A;  2ME0 A;  2OJE D;  2W24 A;  2X51 A;  4BBR J;  3HHG A;  1BR1 A;  4QIW N;  5M5X J;  3WTZ A;  3PUB A;  5HDN A;  3J7Y J;  3HOU J;  1XMA A;  3TOB A;  1YW9 A;  3G1O A;  4A3E J;  4KYW A;  4II3 A;  3E0J B;  4JOM A;  2DK8 A;  3NAR A;  4YIR X;  2O0Y A;  1J09 A;  4BXU A;  4M3B A;  3G2B A;  2XGE A;  4DYR A;  2B0L A;  2VXZ A;  4HYE A;  3JAM K;  1QPI A;  2LBF A;  2JTV A;  5HVQ C;  1F36 A;  2PMZ A;  4P55 A;  4PSW A;  5GAE J;  1X1B A;  2A5Y B;  2OZ6 A;  4LIU A;  2Z33 A;  1AHD P;  1IXS B;  2A68 F;  1WRJ A;  3LAJ A;  1LFP A;  1FYK A;  1X3U A;  1SAX A;  5E3L A;  1QZZ A;  2O7O A;  1RKT A;  1BOA A;  3BG9 A;  1LEA A;  4LMY A;  4UB6 C;  5CLS A;  2CU7 A;  2Y75 A;  1FPQ A;  4XKC A;  3DKX A;  1UB9 A;  3FMQ A;  3HRT A;  3IP4 B;  4B8X A;  2PI0 A;  2GM4 A;  3S1N J;  3LAP A;  2W1O A;  2Y9Z A;  2NVQ J;  3D0S A;  4XOR A;  2R7D A;  3BR6 A;  3E6M A;  3VYR B;  1QNT A;  2CV0 A;  3KP7 A;  3RKW A;  1RES A;  4ZC3 A;  1X3Z B;  4CCM A;  2KP6 A;  1B72 B;  3T5X A;  1KON A;  2KJB A;  3S2H J;  4UVB A;  5E8G A;  3DWL E;  4V2F A;  1IDZ A;  5IY5 H;  4YEJ A;  1FOY A;  1D1C A;  1BI2 A;  4FE4 A;  4XOP A;  2LF7 A;  3CUQ A;  3SZT A;  4BE1 A;  2M9H A;  4FX0 A;  1BW5 A;  2OCC H;  3QPH A;  4M9X A;  1IRG A;  2E1M C;  4GRI A;  1JKR C;  1IN8 A;  2DA4 A;  2VBW A;  2R5Z A;  4ZYH A;  2R4G A;  1ZK8 A;  2IA0 A;  4U7D A;  4C2T A;  2R7X A;  3ELK A;  2XF7 A;  3VB2 A;  2KIU A;  3BP8 A;  1YJ9 I;  1Z6T A;  3BG6 A;  3CMY A;  1ORK A;  4EGZ A;  4F92 B;  1WZ2 A;  4YFN F;  2WAE A;  3QU6 A;  4Z2Y A;  3S16 J;  3C2H A;  2YX4 A;  2ZCW A;  4BNC A;  2RKH A;  3A2K A;  2QQB A;  1SD6 A;  1YJN I;  1AKH A;  3QOD A;  2L7K A;  1Q1V A;  4BQQ A;  1B9N A;  1QHH D;  1HF0 A;  4IRG A;  3R4K A;  1QVT A;  2BOL A;  5DCF A;  4ZDP A;  2BW3 A;  4AUX A;  3A02 A;  2H8R A;  4HBL A;  1PDN C;  2WB1 N;  5E3N A;  4UNO A;  2CO5 A;  1K79 A;  4DBQ A;  2GIV A;  1Y8Q B;  2IGN A;  1IV8 A;  1YIO A;  3VSK A;  2JA6 J;  4NB5 A;  4BAY A;  4FET A;  3CES A;  4NHJ A;  2XAU A;  3CQZ J;  1BW6 A;  2Q2E A;  3PQK A;  4BXX J;  4P96 A;  2COB A;  1R9T J;  2P7C B;  3ZGK A;  2KIQ A;  4N4O B;  5FB2 A;  3ISP A;  1G6N A;  1LB2 A;  3H36 A;  1FOK A;  1YRN A;  3TED A;  1WVR A;  3CCQ I;  3VDX A;  2Y30 A;  3OR1 C;  3ZMV A;  1USS A;  2KQR A;  2CFO A;  2QQ9 A;  4UY8 I;  3TO7 A;  3NAU A;  1UZC A;  2X6X A;  1TQM A;  2ZJP F;  4UUS B;  4C3H J;  1MKM A;  2OUM A;  4QSH A;  3CUO A;  2KFD A;  3IRR A;  1D3Y A;  1R6R A;  4CUG A;  1LUJ B;  1WJB A;  4G6T B;  4HOB A;  3FXQ A;  3WG7 H;  1TT5 B;  4QPO A;  1IRZ A;  1FNN A;  1ZGA A;  1J9I A;  3DP7 A;  3IAS 2;  1JHH A;  3AL0 C;  2LG4 A;  1RR8 C;  2V1X A;  4BY7 J;  5K5R A;  1SD7 A;  4UUV A;  4DYQ A;  1H88 C;  2DA5 A;  1R22 A;  1U2W A;  1B4A A;  2OD5 A;  1RKW A;  5EZH A;  4OIR F;  3TL4 X;  2PJR A;  2KMU A;  3BTJ A;  1U8R A;  1VQ5 I;  1WFX A;  2CS3 A;  2OU2 A;  4AVZ A;  2GXA A;  1KU7 A;  3K1N A;  4Y33 A;  4DBR A;  2XSJ C;  2XF6 A;  4BJT A;  2ZBK A;  3QP5 A;  2COM A;  2LNB A;  4WK8 F;  1OLT A;  3FXO A;  4UVC A;  3CCE I;  5CVJ A;  3U9G A;  2FOW A;  4AIJ A;  4BDZ A;  1FSH A;  2G7H A;  1OIS A;  3KYD B;  1ZRC A;  1Z77 A;  1OJL A;  3DBR B;  3BG5 A;  1ETV A;  2FSW A;  1XSX A;  1I6X A;  4LOC A;  2XC7 A;  3FHZ A;  1O7F A;  4BEH B;  3K70 D;  2YR2 A;  4A3M J;  1E17 A;  2YU9 J;  2IXS A;  3RKQ A;  4TV7 A;  2EB7 A;  3UKG A;  5FKN A;  2LFB A;  1H0M A;  3OSG A;  3K4B A;  2CGP A;  2EBI A;  5D8K B;  4C3J J;  3K4N A;  1VQ8 I;  4BQN A;  2WY7 Q;  3EQL F;  2XAF A;  4HF0 A;  5DV5 A;  2DA1 A;  2O8K A;  1FBS A;  2IS6 A;  2AQE A;  2HVQ A;  2L01 A;  2E34 A;  3E6B A;  1OR7 C;  1SD5 A;  1B9M A;  3CC7 I;  3HGY A;  1KU3 A;  5EEG A;  3BY6 A;  1P92 A;  2XGX A;  4BQO A;  3Q0U A;  4GGG A;  4BH9 A;  3Q9S A;  3OOU A;  3KP4 A;  3O3K A;  3A4C A;  3HOW J;  5JHU A;  1WPK A;  2A3S A;  5IT9 K;  4GFB A;  3CCR I;  2Q8K A;  1SVO A;  2A69 F;  5LHI A;  1R49 A;  5E17 F;  4MHG A;  4A93 J;  3D5L A;  2E60 A;  1IG7 A;  1KU2 A;  2LC2 A;  2L4A A;  3QP6 A;  4U0W A;  2HDW A;  3I3L A;  4HQM A;  3MVP A;  2MD5 A;  2O5R A;  2R7O A;  1U5T C;  3MZH A;  1EF4 A;  1T8I A;  2Z16 A;  3LNQ A;  3SHF A;  4M6X A;  2ICW G;  1FEX A;  1Y0U A;  4I6Z A;  4HG2 A;  4HLX A;  5CVV A;  3AKZ A;  1BI0 A;  3K1M A;  1FJL A;  2RV8 A;  1LVA A;  2EFP A;  1FYM A;  2QBY B;  5KCM A;  3D5S C;  2CYY A;  3JCU C;  5EGO A;  1YS6 A;  2E1N A;  3PM1 A;  1LE8 A;  1XSV A;  3PIO F;  4A3J J;  2LKS A;  2R7S A;  2NS7 A;  2CV1 A;  1HXD A;  1ZG3 A;  2PQ8 A;  4XIC A;  1UMQ A;  4J00 A;  3FDY A;  3DF8 A;  1J0R A;  1D1B A;  2VI6 A;  3CD6 I;  1BN5 A;  3KEO A;  1YOV B;  3CJQ B;  4PGG A;  2DYS H;  5EG0 A;  1BR2 A;  1MDM A;  1IV6 A;  3JRH A;  1EH6 A;  1W36 C;  3ZQL A;  4MIM A;  2K3P A;  3ASN H;  1RPW A;  2LLK A;  2HEO A;  1FMV A;  3CF2 A;  1PUF A;  3HSE A;  4IHW A;  3ZN0 A;  1APL C;  2DCE A;  2F4I A;  3WU1 B;  2HTS A;  3HOT A;  3C18 A;  2VC1 A;  1LVK A;  4N4N B;  4AM3 A;  1YW8 A;  4K2E A;  3D5R C;  2HGC A;  2QEN A;  2MGQ A;  1A5J A;  3PQJ A;  3ZMS A;  1NHA A;  3BCB A;  5K7Z A;  3GW2 A;  5TRD A;  3CJT B;  3E97 A;  2CQX A;  2BXZ A;  2CRG A;  4PJL A;  2GOM A;  2L02 A;  5K5O A;  4B4C A;  4BYY A;  2EJR A;  1ZKG A;  2Y0S N;  3ERM A;  4HV6 A;  1MSF C;  2ETH A;  1FYL A;  2AHQ A;  2ZKZ A;  5KK1 A;  3PO3 J;  1TQI A;  2ECB A;  5DCM A;  2W7N A;  3TKY A;  2DK5 A;  3EYY A;  1KGS A;  2QVO A;  2KRF A;  2W85 A;  1HKT A;  4D1Q A;  3OYG A;  2VE9 A;  2A6T A;  3LWF A;  1XDS A;  1GHC A;  5LFA A;  2M34 A;  1ETW A;  3F8C A;  2LP0 A;  4H0E A;  2HVR A;  1LPQ A;  3Q9V A;  5E1W A;  1ULY A;  3L2R A;  2QUF A;  5C4J J;  1D8K A;  1ZAO A;  2CWE A;  1WHU A;  3DU6 A;  2KIS A;  5EDN A;  2G9W A;  5J40 A;  3AG2 H;  3KX2 A;  4L0Y B;  1SFU A;  1VF9 A;  2I5U A;  4DIQ A;  1TWG J;  3OYE A;  1P4W A;  5D5W B;  1W5C C;  4HNT A;  2DFF A;  4BHB A;  3ZMZ A;  3GFJ A;  1ETY A;  1FSE A;  2L7F P;  1Y1V J;  3HB9 A;  3E5Q A;  4HF1 A;  2OTJ I;  2K9N A;  5F0F A;  3CCJ I;  2IS1 A;  2ELH A;  2L54 A;  4LLG F;  1S5L C;  2PFB A;  5TGT A;  3BCA A;  2M2E A;  2W4S A;  1W7P A;  3G71 I;  2QF7 A;  2MG4 A;  4FIS A;  2ZB9 A;  5F08 A;  4RB1 A;  3OIP A;  2FU4 A;  1T2K A;  2C6Y A;  1O3Q A;  2GWR A;  1ON2 A;  4G12 A;  2V4J C;  1OR7 A;  3QPT A;  4XN3 A;  1HDP A;  3KPH A;  4P5O A;  4YFK F;  5GPC A;  2DFH A;  4XLH A;  1B72 A;  2HOS A;  3HUG A;  3IV5 A;  1DP7 P;  1VQ7 I;  2E2J J;  1HA8 A;  1YHQ I;  3M07 A;  1ONV A;  2HTJ A;  2VQC A;  3K4M A;  2DPD A;  4I09 A;  4U88 A;  3PNT A;  4LGW A;  1I5Z A;  2JZY A;  2KKO A;  3KEQ A;  2FE3 A;  1DGW Y;  1MIJ A;  3R61 A;  1IW7 F;  4KT6 A;  4FCY A;  2QYO A;  4HZF A;  2V1U A;  3ASO H;  1U5T A;  1U8B A;  3KLN A;  2VIX A;  3MCZ A;  4R79 A;  1YS7 A;  4WXD A;  1SVL A;  4BGD A;  4ESF A;  1HW1 A;  1JHF A;  2XB0 X;  4G94 A;  4NQW B;  2K27 A;  1EA3 A;  2DBB A;  3S1R J;  4CGZ A;  2P5V A;  3FHN A;  5HNF A;  1X19 A;  1I39 A;  2X6O A;  2IGO A;  1VQN I;  1Y8R B;  1MH3 A;  1JUP A;  3LSI A;  1FIA A;  2RN7 A;  3LST A;  4RMN A;  2VKE A;  1MJA A;  2PG4 A;  3L7W A;  3OS1 A;  3KZZ A;  3R0A A;  1MMG A;  2E7X A;  2A07 F;  3NWT A;  2FQ3 A;  4BDY A;  1WI3 A;  1DP3 A;  3IUO A;  2K4J A;  2CW8 A;  4ANJ A;  1V55 H;  3I4N J;  3K4K A;  1ETQ A;  4M3G A;  4PJ0 C;  2UWM A;  4F7Z A;  3H3Z A;  4DZP A;  3KFW X;  2HOT A;  1LEB A;  4V2G A;  3JTH A;  3CP2 A;  3TMO A;  2X9D A;  3CF5 F;  3CTA A;  3GLL A;  2VB6 A;  1MW7 A;  4AD9 A;  3G4S I;  2ISY A;  5E8I A;  5GTI C;  4FQG A;  4GDF A;  5E3M A;  1S7E A;  2QGU A;  3SDB A;  3S3M A;  4GXO A;  3GTO J;  2DOE A;  4L9N A;  3K4J A;  2ESH A;  2VKV A;  3N4M A;  3AG1 H;  5DDG A;  1XMX A;  2L7Z A;  5A2Q K;  5JVG F;  3GTK J;  3RYP A;  3EUH C;  5ILV A;  2R5Y B;  2MC3 A;  2F2E A;  3HKZ N;  1UG2 A;  4XID A;  3HGG A;  1MGT A;  2MLK A;  5IP7 J;  3PJR A;  3A0B C;  4RAG A;  4Z6Y A;  2BE5 F;  3ZQF A;  3GCM A;  4C2U A;  3DEE A;  2DTR A;  1F4K A;  3HXL A;  4KMF A;  3WTY C;  3K0L A;  1MMA A;  2O3F A;  3F6V A;  2DT5 A;  3I5U A;  1XGM A;  3B6C A;  1R1T A;  4I76 A;  1QZE A;  3FBN B;  3PSF A;  2V79 A;  3I59 B;  2VT3 A;  4KIC A;  3F8B A;  4BE2 A;  4O3M A;  2L0K A;  3CUQ C;  4ENM A;  1LKX A;  3W6K B;  4RB3 C;  1XPX A;  5E79 C;  4IHS A;  1JUS A;  1QO0 D;  4ZYG A;  4HPQ A;  2YX7 A;  3P5J A;  4O6J A;  4A5M A;  4AWX B;  3HRU A;  5D5V B;  1I6H J;  4M3E A;  1IDY A;  3I64 A;  1IXC A;  2CSO A;  1ACI A;  2EFW A;  3GFI A;  2KIF A;  2KJC A;  4B3A A;  1LDJ A;  4Y52 J;  2GA2 A;  3I53 A;  3VOD A;  1K83 J;  4UV9 A;  4RGS A;  5LHH A;  4BHP A;  2XKP A;  4CCJ A;  2BY0 A;  2HZD A;  2I10 A;  4G8X A;  4A6D A;  2BHY A;  4EEF G;  2OZU A;  5J8C A;  2R0Q C;  2PLY A;  4CCO A;  1S72 I;  3JRI A;  5J1U A;  1W7P D;  4RLQ A;  2DLL A;  1DPR A;  3H35 A;  2ZJQ F;  3L9F A;  3GTP J;  4MEX F;  4I0A A;  4A3B J;  3CLO A;  3T0Y A;  3RDI A;  2J5O A;  2VJ5 A;  1YFH A;  3MMY B;  3H5A A;  2X85 A;  3IAM 2;  2DFE A;  3I58 A;  3SXY A;  2CJJ A;  2QQA A;  3SQN A;  1N78 A;  1UG0 A;  4WXH A;  3PUF A;  4HX7 A;  3W2V A;  1QGP A;  1NK2 P;  5FGM A;  3LQQ A;  2JSC A;  4X0G A;  2P0W A;  1TP4 A;  3JRF A;  1B6A A;  2ECC A;  4NDL A;  3W3C A;  4BKX A;  4CO8 A;  2K40 A;  4XL9 A;  1P7I A;  3HOS A;  2X1D A;  2D1V A;  2DMQ A;  3L2V A;  2N8G A;  2K9S A;  5AIP A;  4PK4 A;  1Z21 A;  4LB6 B;  3QPL A;  4EJU A;  4LJZ F;  5J4Y A;  1IN4 A;  3CLQ A;  2O61 A;  5GAD J;  5M5Y J;  1X2M A;  1CF7 A;  2F48 A;  2DAO A;  4IRI A;  1GVJ A;  4B47 A;  2HYJ A;  4LIV A;  2IGM A;  4UB8 C;  3FK7 A;  5CQG A;  2BGC A;  2E35 A;  4OMZ A;  3JRC A;  1RET A;  5FO5 A;  3RIR A;  1SAU A;  2CQK A;  4XLF A;  5ICG A;  4IQJ A;  2UV1 A;  3FXU A;  4F52 A;  2KRC A;  5IYD J;  4IHX A;  4L5I A;  3VOE A;  2Q1Z B;  4XM3 A;  4RS8 A;  1POG A;  4MGR A;  3JSO A;  1ZEL A;  3PL8 A;  5J6X A;  2LY1 A;  4OIP F;  1U6G A;  3H9G A;  3ZQC A;  2NRA C;  1R7J A;  3W2W A;  1YQA A;  5DM7 F;  5C4X J;  1IXR C;  3RZO J;  1ZH5 A;  2KIM A;  2HPI A;  1UHS A;  2ZXI A;  2LR8 A;  3H3U A;  1MZB A;  1U9O A;  2MD0 A;  4OAY A;  4A0Y A;  1HC8 A;  5J8F A;  5DD8 A;  1Z05 A;  1H9G A;  1T08 B;  1DGR M;  3HEF A;  4HF2 A;  4HDV A;  4RB0 A;  4FTH A;  2MBF A;  3EUH A;  2GLO A;  2VL8 A;  3R60 A;  2VT2 A;  2DMN A;  3O8G A;  3SEQ A;  1X1P A;  5FLX K;  1BIB A;  3P9K A;  4Q4Z F;  4Y15 A;  3DKW A;  3GZN B;  2DYR H;  3BZC A;  2LY9 A;  4RAY A;  4RBO A;  4P9F A;  3F6O A;  3K2A A;  3GTJ J;  4KIB A;  1RIO H;  1YO5 C;  2WBM A;  3WG9 A;  1WH5 A;  2WWY A;  3BZK A;  3LSG A;  1K78 B;  2DMP A;  2GA1 A;  1G3Y A;  1E3P A;  1OYW A;  3RPQ A;  3TO9 A;  4IVN A;  3EYI A;  1JUM A;  3TW6 A;  1VI0 A;  2Z99 A;  1C0W A;  4G9Y A;  2ZO4 A;  1GV2 A;  2VJI A;  3JR9 A;  2K9M A;  3IWZ A;  4QWQ A;  2E2I J;  3WE2 A;  6PAX A;  2WV0 A;  1O3S A;  1FP1 D;  3F9K A;  3GZ6 A;  3JRD A;  3OMY A;  3ZQH A;  4M74 A;  4L9J A;  1YYV A;  1GXQ A;  5GTH C;  3I55 I;  1V5F A;  4DW6 A;  2IP2 A;  1FBU A;  2M7B A;  3MEX A;  5KVR A;  1PVE A;  3VEP A;  3BZ6 A;  4I98 B;  4DNC A;  5EF6 A;  4U7B A;  1H8A C;  1JGG A;  2D45 A;  2HOE A;  2KZG A;  5BNG A;  4XLP F;  4P9U A;  3V8K A;  4IHT A;  3K4C A;  3QRF F;  4CYC B;  1UCR A;  3FK6 A;  4MNU A;  2M4G A;  3V7R A;  5IYB J;  2CUZ A;  5IP6 A;  1W5S A;  2H8W A; 
#chains in the Genus database with same CATH homology
 4KFC A;  2MH2 A;  3OV8 A;  3L09 A;  1ZG1 A;  3JSP A;  3WTX C;  3CO7 C;  1BBY A;  2H94 A;  3V4G A;  4ESJ A;  4M6Y A;  2OQG A;  2ZME B;  3JAM Z;  2JPB A;  3BOQ A;  1G3S A;  1JGS A;  3CDH A;  3GVA A;  3V7C A;  3ULQ B;  2HYG D;  5EEH A;  3T1B A;  1J7K A;  2HR3 A;  4PDK A;  4MQV A;  1SFX A;  3FZV A;  2IPQ X;  1KU9 A;  1MJ9 A;  5L3F A;  2HDC A;  1SD4 A;  5ICF A;  3LA7 A;  1S7O A;  2E1C A;  3G73 A;  1IZ1 A;  2FML A;  4RGX A;  4M9S A;  3B73 A;  2OAZ A;  3WTS C;  2VE8 A;  3CJN A;  1I27 A;  4HQE A;  4DQ2 A;  2Z3Y A;  2HYF A;  2VOD A;  1L0O C;  3BWG A;  2HKX A;  2CG4 A;  3R0J A;  4CZZ A;  5IT3 A;  1WSU A;  2K86 A;  3GO5 A;  3NRV A;  5D8L B;  2EV6 A;  1TW2 A;  3TDZ C;  1QPM A;  2XAQ A;  3HTS B;  5DUK A;  5CJ9 A;  2D1H A;  4EJT A;  2BV6 A;  2W57 A;  3TDU C;  2EV5 A;  4CXF A;  3I59 A;  2BYV E;  5L3D A;  2OBP A;  1XCV A;  5LRR A;  3IHU A;  4OU0 A;  2O03 A;  3O6B B;  4M73 A;  2STT A;  3PFI A;  3FF5 A;  3FX3 A;  4D0P A;  1E2X A;  1REP C;  2JPC A;  1FSH A;  1IN6 A;  4ZZL A;  1ZRF A;  2YU3 A;  2EFQ A;  5JR3 A;  5BPD A;  2XRN A;  4ENJ A;  2QZ8 A;  3C1D A;  4IF4 A;  1UFM A;  4I2O A;  4A5N A;  4XLN F;  5ICC A;  2EWN A;  4Q48 A;  2BEO A;  5DYM A;  1RUO A;  1O3T A;  3F72 A;  4ENN A;  3JTG A;  3I0T A;  3GFM A;  1ZYR F;  2P7V B;  2H27 A;  3ZMD A;  3GZ5 A;  5ICE A;  1OYY A;  1BI3 A;  1BIA A;  2P5L C;  2VBZ A;  5ERI A;  5HLH A;  1S3J A;  1MJB A;  1G3W A;  3IWF A;  5FD5 A;  3ZQ7 A;  2ADU A;  3FMR A;  1O3R A;  1XCB A;  4UVA A;  5H20 A;  4OMY A;  2FRH A;  1I1G A;  2DQL A;  4M72 A;  2H09 A;  4EM0 B;  2IJL A;  4IJA A;  5FFZ A;  2FF4 A;  2HFH A;  1RZ4 A;  5DEQ A;  4B09 A;  2M45 A;  3KCC A;  2DQR A;  4EMS A;  5IT9 Z;  1IRF A;  2P5K A;  5D5U B;  5HDK A;  4HLY A;  2YSR A;  1HBX G;  1ZN2 A;  3BJA A;  1U78 A;  4EVI A;  2JT1 A;  1K6O A;  1RI7 A;  5JVT A;  5E1Z B;  1I1S A;  1ODD A;  4U0Y A;  4EQQ A;  2FEZ A;  4A2U A;  2FBK A;  2WC2 A;  2DFI A;  1IF1 A;  1K78 A;  3GLX A;  2ESN A;  2H6B A;  1F5T A;  1UST A;  1Z6R A;  4A6E A;  4OIO F;  3HTU A;  2E7W A;  2ACJ A;  2K7L A;  5LHG A;  3G3Z A;  3GWZ A;  3M7G A;  2X0L A;  4WCG A;  1J2X A;  2ZNZ A;  1W4M A;  4KIF A;  5E18 F;  3T8R A;  1CGP A;  2HKO A;  1Z7U A;  1R5H A;  4RB2 C;  4BHC A;  3HSR A;  2NNY A;  4Y17 A;  3QAH A;  1J59 A;  2M1B A;  1P6R A;  1BJA A;  2XAS A;  3FMS A;  4L9V A;  1TNS A;  4WWC A;  2P6S A;  2MLG A;  4G7Z F;  4IPA A;  1XGS A;  3RPU A;  2NS0 A;  1B59 A;  3ZN1 A;  4Q47 A;  3ERE D;  3QOP A;  5CVI A;  1BC7 C;  1TW3 A;  1SMT A;  5HDG A;  3RJP A;  5H6R A;  2F5F A;  5CVU A;  3CO6 C;  1LQ1 A;  1T6S A;  4YFX F;  3DPT A;  2M8E A;  1OYI A;  2VBY A;  2V1D A;  2UXX A;  2MH9 A;  1HW2 A;  3HIF A;  3KP5 A;  4GYG A;  5JFR A;  5FFX A;  2BBY A;  2FNA A;  4ZYD A;  1Z9C A;  4AIK A;  1PP8 F;  1R00 A;  2JRT A;  2VOO A;  3O2P E;  1HKS A;  3F23 A;  3J81 Z;  3HHH A;  5K1Y A;  1EH7 A;  3BPV A;  1T0F A;  2F5E A;  2ZXJ A;  4OIN F;  1STZ A;  3J80 Z;  1AOY A;  1ZRD A;  4KMU X;  2RVC A;  4I02 A;  3WU0 A;  3V7S A;  2XHK A;  1KA8 A;  2ZJ2 A;  4A0Z A;  5D6E A;  1R58 A;  2DI3 A;  5D4R A;  3ROU A;  4YIF A;  4ON0 A;  2PBI A;  2HS5 A;  4KN7 X;  1HQC A;  3R6S A;  4XBF A;  3FXR A;  5L3C A;  4HAM A;  2LF8 A;  5LGT A;  3T8T A;  1V3F A;  1FBQ A;  1SMY F;  3Q5F A;  2L3D A;  3WTU C;  2HWV A;  4ESB A;  3WTV C;  5K5Q A;  5F6F A;  4EJO A;  2PJP A;  2GAU A;  4RGU A;  5AIQ A;  1S6L A;  3GYH X;  4AIH A;  5H6Q A;  3MQ0 A;  5HLI A;  2QBY A;  5LEK A;  1RNL A;  3E5X A;  2UZK A;  2ZNY A;  2FA5 A;  2IVM A;  4N9I A;  5DD4 A;  2XAJ A;  3U2R A;  3ABU A;  3BPX A;  4LFU A;  5ILU A;  1HSJ A;  2RNJ A;  5DCM B;  3P7N A;  1ZG5 A;  2Z9O A;  1OPC A;  4XSZ F;  1EH8 A;  4KIG A;  3FM5 A;  2RC4 A;  4S04 A;  5F64 A;  2P4W A;  2STW A;  1WWX A;  2UXN A;  1F1Z A;  3BRO A;  3WOD F;  3F8F A;  1FP2 A;  1ZAR A;  5E1X A;  2P8T A;  1VTN C;  3TGN A;  4KA4 A;  1FZP B;  3IL2 A;  4IXA A;  1XGO A;  4S05 A;  1UHM A;  2Q0O A;  1W5T A;  1Z1D A;  1YTY A;  3HSF A;  2FXA A;  4ZH4 F;  1TBX A;  2XIG A;  3P9I A;  1P2F A;  2F5C A;  2HZT A;  3ECH A;  3TOA A;  3F3X A;  1W7P B;  1IAW A;  3V8J A;  5DUI A;  3EDP A;  4M9Z A;  4UHT A;  1G3T A;  4YII A;  2DW4 A;  4MQ9 F;  1WI9 A;  4L18 B;  5LEJ A;  1ZRE A;  1D8J A;  1ZGJ A;  3QU3 A;  3B02 A;  1XD7 A;  3LFK A;  4CHU A;  2G7U A;  3N97 A;  4G7O F;  4R8H A;  1ZLJ A;  2AS5 F;  3SFZ A;  5L3E A;  1U5T B;  4JBA A;  1R5G A;  3GF2 A;  1QZY A;  1BI1 A;  1TTY A;  3RKY A;  4LG0 B;  4GYI A;  3ZMT A;  1Q1H A;  2EK5 A;  2EV0 A;  1BM9 A;  5HLG A;  4L9T A;  3LQR A;  1DUX C;  4KN4 X;  3S2W A;  2PN6 A;  4KDP A;  3BDD A;  4Y13 A;  4NQW A;  3K9T A;  2R7F A;  1G4D A;  3KP2 A;  3MZY A;  4CYD A;  4WXC A;  3I54 A;  3F21 A;  4L5J A;  4LK1 F;  5FLX Z;  1OMI A;  2X4H A;  5TJJ A;  4I01 A;  4RGR A;  4MTD A;  3TO6 A;  1FY7 A;  4GO1 A;  4E70 A;  2V6C A;  1WQ2 A;  4WX9 A;  3LA2 A;  1JXS A;  4N0B A;  4EM2 A;  1JE8 A;  1S7A A;  4PGH A;  1DPU A;  1IN5 A;  2YPR A;  2ISZ A;  3BJO A;  4XSX F;  5BS6 A;  4FX4 A;  1S8N A;  2EFN A;  1T38 A;  3NQO A;  4WF2 A;  1J75 A;  3DV8 A;  3RKX A;  1KQ9 A;  2Y48 A;  1XMK A;  3GXO A;  2A6H F;  2J5P A;  1LDK B;  3ZPL A;  5HS9 A;  4CDG A;  3NEU A;  5BOX A;  5HS8 A;  2RQP A;  2TDX A;  3I4P A;  1T98 A;  2A6E F;  4ZYE A;  1T39 A;  3K1P A;  1XB4 A;  4EV0 A;  3E6C C;  4XRF A;  1P4X A;  1YG2 A;  2DO7 A;  5ILS A;  5L3G A;  2FBI A;  3M9A A;  1P4A A;  1FX7 A;  4G6D A;  4UXN A;  4JK1 X;  3AAF A;  1L3L A;  2FBH A;  4PZJ A;  4KUM A;  4EGY A;  3M8E A;  5BPI A;  1KYW A;  2CW0 F;  1R36 A;  2MA3 A;  1HST A;  4RAZ A;  2FOK A;  1GXP A;  5D5X B;  1FT9 A;  1PP7 U;  2XRO A;  2NNN A;  1D5V A;  1CF7 B;  4G6Q A;  4N9H A;  1ZLK A;  1IUY A;  4EM1 A;  2XKO A;  1YW7 A;  3IKT A;  2WTE A;  2M5W A;  5LGU A;  3E6D A;  2VON A;  3LA3 A;  4HW0 A;  4A12 A;  2Z5U A;  2XAH A;  4LLL A;  3W6J B;  4HX8 A;  5LRS A;  3FM3 A;  4A0X A;  2K02 A;  1V4R A;  3KET A;  1ON1 A;  3COA C;  3ZMU A;  5ED4 A;  2LKP A;  4EJW A;  5LBQ A;  5AON A;  4UV8 A;  4PCQ A;  3DQV C;  3VFZ A;  3DEU A;  2XUB A;  5JI6 A;  2EA2 A;  1HW5 A;  2EFO A;  3H92 A;  4MTE A;  4GCV A;  5D6F A;  4LD5 A;  3WE3 A;  2R3S A;  2PMH A;  3SZP A;  5L3B A;  1FLI A;  3GEZ A;  3GUD A;  5CYV A;  1DDN A;  3P9C A;  3RYR A;  1H9T A;  5LLQ A;  4ETS A;  3CUQ B;  4I0B A;  2V9V A;  1S29 A;  2M30 A;  3IRQ A;  4O5V A;  2GXB A;  1R1V A;  3MWM A;  5HOO A;  2CFX A;  1YLF A;  3DXJ F;  4I7H A;  3FWE A;  3F22 A;  2AXL A;  4M71 A;  4R1H A;  2XV4 S;  4AVP A;  2O6G E;  3I71 A;  3DPL C;  4MEY F;  2PMU A;  3J81 K;  1F9N A;  3KZY A;  3E5U A;  3ML6 A;  2M87 A;  1PUE E;  1UHW A;  3J80 K;  1O57 A;  2Y0M A;  4KT5 C;  2FNP A;  3K69 A;  2GQQ A;  3OOP A;  1MD0 A;  2K4B A;  3C3W A;  1B1B A;  1LJ9 A;  3IKV A;  2O8X A;  1WKM A;  5E20 A;  4L0Z B;  2LDU A;  4LLN A;  1LNW A;  1TNT A;  2GXG A;  4LG0 A;  2VOP A;  2OA4 A;  3C7J A;  2QLZ A;  3L00 A;  4KNY A;  3ECO A;  1R1U A;  1KQ8 A;  4HA8 A;  4FHT A;  2XVC A;  1FWZ A;  2ZME A;  2W25 A;  3MFK A;  3JW4 A;  3TQN A;  5HS7 A;  1K7A A;  3IC7 A;  3BJ6 A;  1EV7 A;  2HQR A;  5CVR A;  2IA1 A;  1ZHF A;  3GX4 X;  3F8N A;  3F8M A;  4QLC U;  1KYZ A;  1HKQ A;  2H6C A;  4JQF A;  4G7H F;  4EJV A;  2IT0 A;  5LGN A;  1TLH B;  3EET A;  3K2Z A;  2EA4 A;  1KQ0 A;  2L4M A;  2IRF G;  2DU9 A;  1XN7 A;  3KLO A;  4LB5 A;  1R23 A;  4FT8 A;  2HQN A;  2VBX A;  3M8F A;  1O7L A;  3KE2 A;  1U3E M;  1FC3 A;  3HYI A;  1QQI A;  2QWW A;  3L2C A;  2IW5 A;  2A61 A;  1BC8 C;  3RI4 A;  2IA2 A;  1SFE A;  2DPU A;  1J5Y A;  3ABT A;  3M1E A;  2P6T A;  2OQR A;  1XSD A;  4ASN A;  2GZW A;  2FMY A;  2PEX A;  2RGV A;  2D2W A;  2VN2 A;  3HRS A;  1XDU A;  3WGG A;  5F1R A;  3V8L A;  1IN7 A;  3WGI A;  5FD6 A;  3J7A O;  3GFL A;  4YG2 F;  1AWC A;  4ENK A;  2NAZ A;  3WTT C;  2RDP A;  3ZP5 A;  3HRM A;  2ZFW A;  3E3V A;  3KP3 A;  2QM3 A;  4CIC A;  3WTW C;  1MDM B;  2XAG A;  1TQP A;  4HDU A;  4OIQ F;  3U1D A;  3KP6 A;  3REO A;  3WGH A;  1A04 A;  1OKR A;  5BQT A;  3RTR A;  5A2Q Z;  1XGN A;  1QBJ A;  3MAJ A;  1RUN A;  4U0V A;  4HX4 A;  3DFG A;  2NYX A;  4OOI A;  2F5D A;  2W84 A;  5D4S A;  4HV5 A;  4IRH A;  4Q5S F;  4LK0 F;  5BMZ A;  4BQA A;  1Z91 A;  2LSO A;  4ZZD A;  1LDD A;  2VC0 A;  2W24 A;  3HHG A;  3WTZ A;  5HDN A;  1XMA A;  3TOB A;  1YW9 A;  4KYW A;  2DK8 A;  2O0Y A;  4BXU A;  2B0L A;  2VXZ A;  4HYE A;  3JAM K;  2JTV A;  5HVQ C;  4P55 A;  2A5Y B;  2OZ6 A;  2Z33 A;  1IXS B;  2A68 F;  1WRJ A;  3LAJ A;  1FYK A;  1X3U A;  1SAX A;  1QZZ A;  1BOA A;  1LEA A;  4LMY A;  5CLS A;  2Y75 A;  1FPQ A;  1UB9 A;  3FMQ A;  3HRT A;  4B8X A;  2PI0 A;  3LAP A;  3D0S A;  2R7D A;  3E6M A;  1QNT A;  3KP7 A;  3RKW A;  3T5X A;  2KJB A;  4UVB A;  5E8G A;  1BI2 A;  2LF7 A;  3CUQ A;  3SZT A;  4FX0 A;  1IRG A;  3QPH A;  4M9X A;  1IN8 A;  2VBW A;  4ZYH A;  2IA0 A;  4U7D A;  3ELK A;  3VB2 A;  2KIU A;  3BP8 A;  1Z6T A;  4EGZ A;  4YFN F;  3QU6 A;  4Z2Y A;  2YX4 A;  2ZCW A;  4BNC A;  2RKH A;  2QQB A;  1SD6 A;  1B9N A;  4IRG A;  3R4K A;  5DCF A;  4HBL A;  1PDN C;  4UNO A;  2CO5 A;  1K79 A;  2GIV A;  1YIO A;  4NB5 A;  4BAY A;  4NHJ A;  2Q2E A;  3PQK A;  4P96 A;  2P7C B;  5FB2 A;  3ISP A;  1G6N A;  1LB2 A;  1FOK A;  3ZMV A;  1USS A;  2QQ9 A;  3TO7 A;  1TQM A;  1MKM A;  3CUO A;  3IRR A;  1D3Y A;  4HOB A;  3FXQ A;  1FNN A;  1ZGA A;  1J9I A;  3DP7 A;  1JHH A;  2V1X A;  5K5R A;  1SD7 A;  4UUV A;  1R22 A;  1U2W A;  1B4A A;  2OD5 A;  4OIR F;  1U8R A;  2OU2 A;  1KU7 A;  3K1N A;  2ZBK A;  3QP5 A;  2COM A;  4WK8 F;  2LNB A;  4UVC A;  4AIJ A;  5CVJ A;  3U9G A;  2G7H A;  1ZRC A;  2FSW A;  1XSX A;  1I6X A;  3FHZ A;  1O7F A;  2YR2 A;  1E17 A;  4TV7 A;  2EB7 A;  1H0M A;  2CGP A;  5D8K B;  3EQL F;  2XAF A;  4HF0 A;  5DV5 A;  1FBS A;  2L01 A;  3E6B A;  1SD5 A;  1B9M A;  1KU3 A;  5EEG A;  3BY6 A;  1P92 A;  2XGX A;  4GGG A;  4BH9 A;  3Q9S A;  3KP4 A;  3O3K A;  5JHU A;  2A3S A;  5IT9 K;  2Q8K A;  2A69 F;  5LHI A;  5E17 F;  4MHG A;  3D5L A;  1KU2 A;  2L4A A;  3QP6 A;  4U0W A;  4HQM A;  2MD5 A;  1U5T C;  3MZH A;  3SHF A;  4M6X A;  1Y0U A;  4HLX A;  5CVV A;  1BI0 A;  3K1M A;  2RV8 A;  1LVA A;  2EFP A;  1FYM A;  2QBY B;  2CYY A;  1YS6 A;  2E1N A;  1XSV A;  1HXD A;  1ZG3 A;  2PQ8 A;  3DF8 A;  1J0R A;  1BN5 A;  3KEO A;  4PGG A;  1MDM A;  1EH6 A;  2HEO A;  3HSE A;  3ZN0 A;  3WU1 B;  2HTS A;  3HOT A;  3C18 A;  2VC1 A;  1YW8 A;  4K2E A;  2HGC A;  2QEN A;  3PQJ A;  3ZMS A;  1NHA A;  3GW2 A;  5TRD A;  3E97 A;  2L02 A;  5K5O A;  4BYY A;  2EJR A;  4HV6 A;  2ETH A;  1FYL A;  2ZKZ A;  5KK1 A;  1TQI A;  5DCM A;  3TKY A;  2DK5 A;  3EYY A;  1KGS A;  2QVO A;  2KRF A;  2W85 A;  1HKT A;  2VE9 A;  3LWF A;  1XDS A;  1GHC A;  3F8C A;  4H0E A;  3Q9V A;  5E1W A;  1ULY A;  2QUF A;  1D8K A;  1ZAO A;  2CWE A;  2G9W A;  4L0Y B;  1SFU A;  1P4W A;  5D5W B;  4BHB A;  3ZMZ A;  3GFJ A;  1FSE A;  3E5Q A;  4HF1 A;  2ELH A;  2L54 A;  4LLG F;  2PFB A;  1W7P A;  4RB1 A;  2FU4 A;  1T2K A;  2C6Y A;  1O3Q A;  2GWR A;  1ON2 A;  1OR7 A;  3QPT A;  4P5O A;  4YFK F;  3HUG A;  1DP7 P;  1ONV A;  2HTJ A;  2DPD A;  4I09 A;  4U88 A;  4LGW A;  1I5Z A;  2JZY A;  2KKO A;  3KEQ A;  2FE3 A;  3R61 A;  1IW7 F;  2QYO A;  4HZF A;  2V1U A;  1U5T A;  3KLN A;  4R79 A;  3MCZ A;  1YS7 A;  4WXD A;  4ESF A;  1HW1 A;  1JHF A;  4G94 A;  2K27 A;  2DBB A;  4CGZ A;  2P5V A;  2RN7 A;  3LST A;  1MJA A;  2PG4 A;  3L7W A;  3KZZ A;  3R0A A;  2E7X A;  2A07 F;  2FQ3 A;  2K4J A;  2UWM A;  4F7Z A;  3H3Z A;  3KFW X;  1LEB A;  3JTH A;  3CTA A;  4AD9 A;  2ISY A;  5E8I A;  4GXO A;  4L9N A;  2ESH A;  3N4M A;  5DDG A;  5A2Q K;  3RYP A;  5ILV A;  2MC3 A;  2F2E A;  1MGT A;  2MLK A;  2BE5 F;  2DTR A;  1F4K A;  4KMF A;  3WTY C;  3K0L A;  3F6V A;  2O3F A;  3I5U A;  2DT5 A;  1XGM A;  1R1T A;  4KIC A;  2V79 A;  3I59 B;  2VT3 A;  4O3M A;  3F8B A;  3CUQ C;  4ENM A;  3W6K B;  4RB3 C;  4IHS A;  1QO0 D;  4ZYG A;  2YX7 A;  4O6J A;  4A5M A;  4AWX B;  3HRU A;  5D5V B;  3I64 A;  1IXC A;  2CSO A;  2EFW A;  3GFI A;  2KIF A;  2KJC A;  1LDJ A;  2GA2 A;  3I53 A;  3VOD A;  4UV9 A;  4RGS A;  5LHH A;  4BHP A;  2XKP A;  4G8X A;  4A6D A;  5J8C A;  2PLY A;  2OZU A;  1W7P D;  2DLL A;  1DPR A;  3L9F A;  4MEX F;  4I0A A;  3CLO A;  3T0Y A;  3RDI A;  2J5O A;  1YFH A;  3I58 A;  3SXY A;  2QQA A;  3SQN A;  4WXH A;  4HX7 A;  1QGP A;  5FGM A;  3LQQ A;  2JSC A;  1B6A A;  4CO8 A;  3HOS A;  2D1V A;  5AIP A;  4LB6 B;  4EJU A;  4LJZ F;  1IN4 A;  2O61 A;  1CF7 A;  2DAO A;  4IRI A;  1GVJ A;  2BGC A;  4OMZ A;  5FO5 A;  3RIR A;  2CQK A;  5ICG A;  3FXU A;  4L5I A;  3VOE A;  4RS8 A;  4MGR A;  3JSO A;  5J6X A;  4OIP F;  1U6G A;  2NRA C;  1R7J A;  1YQA A;  1IXR C;  1ZH5 A;  2KIM A;  3H3U A;  1MZB A;  4A0Y A;  5J8F A;  5DD8 A;  1Z05 A;  1H9G A;  4HF2 A;  4HDV A;  4RB0 A;  2MBF A;  3EUH A;  3R60 A;  2VT2 A;  5FLX K;  1BIB A;  3P9K A;  4Q4Z F;  4Y15 A;  3DKW A;  4RAY A;  4P9F A;  3F6O A;  4KIB A;  1RIO H;  1YO5 C;  3WG9 A;  2WWY A;  1K78 B;  2GA1 A;  1G3Y A;  1OYW A;  3RPQ A;  3TO9 A;  4IVN A;  3EYI A;  2Z99 A;  1C0W A;  4G9Y A;  2ZO4 A;  3IWZ A;  4QWQ A;  3WE2 A;  6PAX A;  2WV0 A;  1O3S A;  1FP1 D;  3GZ6 A;  4M74 A;  4L9J A;  1YYV A;  1GXQ A;  2IP2 A;  1FBU A;  3MEX A;  5KVR A;  3VEP A;  3BZ6 A;  4I98 B;  4DNC A;  4U7B A;  2D45 A;  2HOE A;  4XLP F;  4P9U A;  3V8K A;  4IHT A;  3QRF F;  1UCR A;  4MNU A;  3V7R A;  1W5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...