3WTXC

Crystal structure of the complex comprised of ets1(y329a), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
103
structure length
103
Chain Sequence
PIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 35
structure length 103
sequence length 103
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtxC00
1KA8A 2PG4A 1S29A 4BXUA 3ERED 3I59B 4EGYA 4HLXA 1U3EM 2DTRA 1ZG1A 3GO5A 1YS6A 2P5LC 3GF2A 3M1EA 1FLIA 4MQ9F 3P9IA 1L0OC 3WGHA 1WWXA 1R36A 1S7AA 2O3FA 2TDXA 3KFWX 2C6YA 3HHHA 5CYVA 4N0BA 4WK8F 3ZQ7A 2L4MA 3HRUA 5F6FA 4BH9A 2L01A 3LQQA 1XGOA 2CWEA 1FYMA 5ILVA 2COMA 1WRJA 3U9GA 1B59A 3KZYA 1TBXA 4ENJA 5FFZA 1XSXA 3DXJF 3E3VA 2XAFA 3F8BA 4HQEA 4WXCA 4G7OF 4MGRA 5BS6A 1ZLJA 1XB4A 1T0FA 1J9IA 2VC0A 1D3YA 4G6DA 1ZG5A 2FU4A 2V79A 1BBYA 2WV0A 2ZKZA 2H94A 2K4BA 3PQJA 4M71A 5E20A 2STTA 1IN4A 3L09A 5LGNA 2NAZA 4Q5SF 3CO7C 2WTEA 2XROA 5A2QK 3BP8A 3I0TA 5BOXA 1SAXA 2X0LA 1BI1A 4L5JA 1FBUA 3F23A 1IAWA 2DPUA 1B1BA 3WTWC 3J80Z 3WTVC 1J2XA 1BI2A 1R5HA 2QENA 2XVCA 3V7SA 1X3UA 2HQNA 1ZAOA 4OIRF 2H6CA 3V4GA 2GWRA 3RTRA 4OMZA 2WWYA 3E6MA 2OU2A 2IT0A 3KLNA 1TW2A 1DP7P 1WSUA 1G4DA 1T38A 3ISPA 3ZN1A 3ZP5A 2RGVA 4RB0A 2ZCWA 2OD5A 4L9VA 4M73A 3L00A 4AIHA 1MGTA 2FOKA 2VC1A 1OR7A 3EYYA 3GFJA 3CUQC 3HUGA 4HAMA 5HDNA 3I64A 5DEQA 2CYYA 5JFRA 2MLGA 1E2XA 1PP7U 3K9TA 3E97A 3CO6C 3IRQA 1YFHA 2HKOA 1PDNC 4RGUA 1XD7A 2VE8A 4KMFA 1KU2A 1F1ZA 2GAUA 4KUMA 2QM3A 2EFOA 3EDPA 4RGXA 2R3SA 1G3YA 5HLHA 3ZMTA 5D6EA 1U6GA 2QQAA 4G6QA 1H9TA 2G9WA 4LLLA 2EK5A 1U8RA 3ELKA 2R7FA 3TKYA 1Z6RA 1IXCA 3P9KA 1ONVA 4Y17A 5K5RA 1U78A 3K0LA 1O7FA 3F22A 4OOIA 4KIFA 3F6OA 3J81Z 4I0BA 2DQRA 3E6CC 2VXZA 2PBIA 2BE5F 3BY6A 1OYYA 1XDUA 2X4HA 2ISYA 2MH9A 2P8TA 1WI9A 1C0WA 1RUNA 3D0SA 1K7AA 1P92A 4RAZA 1GXQA 1IN6A 1ZGAA 3WTUC 3K2ZA 1R7JA 1XCBA 1BI0A 1DPUA 4G94A 2EWNA 5LGTA 4PZJA 4KDPA 3WGGA 1TW3A 2ETHA 4XBFA 4UUVA 1YW7A 3B73A 4M9XA 5E1XA 5FGMA 4EQQA 3HRMA 2PMHA 3EETA 5L3GA 3ZMSA 4IRGA 3V8LA 3GUDA 5IT3A 3IL2A 2L4AA 5A2QZ 3ECOA 3WU0A 1MJBA 3FMSA 2CW0F 2GQQA 4WX9A 5CVJA 1DDNA 2VBXA 3I58A 1JHHA 1HKSA 2O6GE 1ZARA 4RB2C 3FM3A 4PGHA 4L5IA 3WGIA 4ZYDA 5L3CA 1Z05A 3DQVC 2QQBA 2DQLA 4HW0A 3BOQA 1Z91A 4YFXF 1LB2A 1XGMA 4Q47A 2O03A 1JE8A 4PCQA 1JXSA 1W4MA 1XSVA 3WTSC 5HLIA 1IN8A 3V8JA 4NHJA 4I02A 4KYWA 2JRTA 1S6LA 2BBYA 4HX4A 2MBFA 3WE2A 5HDKA 1USSA 1YIOA 4UV8A 4LD5A 4MTEA 2RQPA 5DYMA 5BQTA 4M72A 1SD5A 2GXGA 3LWFA 2RDPA 2HR3A 4HZFA 1O57A 2L54A 5F1RA 2DW4A 2A6HF 3ML6A 4N9IA 4BAYA 1UCRA 5ICEA 1LVAA 5D8KB 4OINF 2DU9A 4EJWA 2EJRA 3IKVA 5HLGA 1TTYA 3DFGA 2H6BA 4CO8A 2ZNZA 4XSXF 3GLXA 4IF4A 2E7WA 2MH2A 2QQ9A 1ULYA 4KA4A 3WTZA 4KN4X 1ODDA 1QPMA 1XDSA 2FBIA 4LK1F 2FSWA 4LFUA 3F8NA 3J80K 4EM0B 3SFZA 3J81K 5LLQA 5CVRA 4YG2F 1F9NA 3CDHA 3GZ5A 4I01A 4HF0A 5JI6A 2EV0A 3G73A 3R60A 5HOOA 4BHPA 2PQ8A 3FHZA 1KQ0A 4IHSA 4LG0A 1LEAA 1JGSA 3PQKA 1R22A 2VBWA 1DUXC 2PN6A 5ICCA 1HW5A 1EH6A 3L7WA 4FHTA 4M9ZA 1FY7A 3CUQB 2ADUA 1QQIA 4I7HA 2PJPA 4DQ2A 1U5TC 2XKPA 3RJPA 2Z33A 2FRHA 3FWEA 3OOPA 1V3FA 2QWWA 2XUBA 2F5EA 2M8EA 1FC3A 2RV8A 4DNCA 2GZWA 3CUOA 3GXOA 3WG9A 2HWVA 5E17F 5K5QA 3SQNA 1SFEA 2IA1A 2GA1A 3WODF 3JAMK 2A6EF 3I4PA 4EGZA 1ZREA 3MEXA 2P7CB 4Y13A 3REOA 1TNTA 3K1MA 5D4SA 1B9MA 4JBAA 3RIRA 1ZH5A 2FMLA 5AIQA 2DPDA 3HTUA 4BNCA 3R4KA 4IVNA 5DCMB 4UVAA 5HDGA 4L0YB 3BJAA 3FXRA 1KU3A 4HQMA 3U1DA 3KE2A 5E8IA 3HOSA 1I5ZA 1QZZA 2PMUA 1EH8A 4WCGA 2K27A 2XAHA 2BEOA 3R6SA 3VB2A 5FLXZ 4RAYA 4RGSA 2Y48A 2M87A 3WU1B 1QBJA 5LEKA 1Z1DA 1YW9A 4P96A 5TJJA 4G7HF 2F2EA 1MDMB 2HFHA 4LLNA 3O3KA 4BYYA 2OQRA 3HSFA 2J5PA 2XV4S 5H6RA 3I5UA 3GFMA 5DD8A 3J7AO 1FP1D 2IA2A 4MNUA 4OU0A 5L3DA 2YX4A 2IVMA 4ZH4F 4PDKA 4XSZF 2E1CA 4MEXF 3OV8A 2K02A 5ILUA 5J8FA 3IHUA 3KP7A 1Z9CA 3LA3A 2W84A 2FXAA 2L02A 2HS5A 1YG2A 3GX4X 4P55A 1UHWA 4N9HA 1TQMA 3S2WA 5LHIA 2OAZA 3MQ0A 4KICA 4NQWA 1H0MA 4CYDA 2HKXA 4OIPF 4FX0A 1XSDA 5D5UB 2HDCA 1MJ9A 1FP2A 3GEZA 1BC7C 1K78B 3IRRA 4KN7X 3IWZA 1XGNA 4GYIA 5DV5A 1ZRDA 3ZMZA 1XN7A 1HXDA 1QNTA 2PEXA 5L3EA 4LGWA 2Y0MA 4RB1A 2EFWA 3IC7A 3HOTA 2EB7A 1J59A 2EFNA 3KP3A 2OQGA 4MQVA 3B02A 3C1DA 3TGNA 2P5VA 4EVIA 4HLYA 1F4KA 5CLSA 1E17A 2DT5A 2RC4A 3LAPA 2XAJA 2ISZA 2H09A 2D2WA 1QZYA 2A61A 1LDKB 4EJOA 2FBHA 2IPQX 3F8FA 3RKWA 1D8JA 4HDUA 1EH7A 2STWA 4G7ZF 2YPRA 1FSEA 2RKHA 4KT5C 2M1BA 3HHGA 4R8HA 4A6EA 3KP4A 2QUFA 2V9VA 1YQAA 2YR2A 3GFLA 3TO7A 1FWZA 3C3WA 4RS8A 5LBQA 2FE3A 4ENNA 4UXNA 5H6QA 3ULQB 5ICGA 2D1HA 4JK1X 2EV6A 4CGZA 3M9AA 3VOEA 4AIKA 2XGXA 4I0AA 1BM9A 4LJZF 5DCFA 1XMAA 2XIGA 2J5OA 4UV9A 2A68F 3ECHA 1JHFA 2B0LA 4A2UA 3KEOA 3WTXC 2IA0A 1I6XA 2FEZA 3T8RA 4OMYA 3LAJA 2ESHA 2QYOA 1SFUA 2KJCA 4JQFA 1STZA 2EA4A 5JHUA 3T5XA 2W85A 3CUQA 5LGUA 5HS9A 1P4XA 3L9FA 4QLCU 2RN7A 4G9YA 1R1VA 3LA2A 3LQRA 3CJNA 2NYXA 1SD7A 3W6KB 2HYGD 2NNNA 2V1DA 2VODA 1U5TA 1L3LA 2YU3A 1B9NA 3FF5A 3CTAA 3HSRA 2IP2A 1FX7A 3BWGA 4KNYA 1ON2A 4HV6A 4YFKF 3SHFA 1IXSB 4D0PA 1GVJA 5LHGA 3V7CA 1G3SA 1LDDA 4K2EA 2JPCA 2HTJA 5CVVA 2PLYA 5HS8A 1KU9A 4P5OA 2ACJA 3HYIA 1MZBA 5L3FA 2QZ8A 5D5WB 1O7LA 2MC3A 2OBPA 3GYHX 4EV0A 1VTNC 1I1GA 1T6SA 1FSHA 2WC2A 2QLZA 1V4RA 2NS0A 1KQ8A 2O0YA 5EEGA 3MWMA 3H92A 1Q1HA 1R58A 4WXDA 5FD5A 5K5OA 2YX7A 3IKTA 3FM5A 1KU7A 4OIQF 1D5VA 1K79A 3DF8A 3MAJA 4AD9A 2ZBKA 4A12A 1TQIA 1RNLA 1KYZA 2RVCA 2CSOA 3T0YA 2K4JA 2KIUA 3KP2A 2AXLA 4MTDA 2D45A 2VT3A 4GCVA 5HVQC 3TO6A 4IRHA 3ZMUA 4M6XA 3GFIA 2RNJA 4NB5A 1G3TA 3VODA 1S3JA 1W5TA 2VOOA 4A0ZA 2CFXA 3TDZC 3SZPA 4GO1A 1LNWA 3BJ6A 1FBQA 5E1ZB 3DPLC 2W24A 4CHUA 4KIBA 4HDVA 4L0ZB 1KGSA 3VFZA 4ENMA 1ZN2A 3FMQA 3BZ6A 2G7HA 3JAMZ 2Q2EA 1PUEE 5E8GA 1GHCA 3QRFF 4ZYGA 4KMUX 3N97A 3RI4A 1BJAA 2KRFA 2LKPA 3DPTA 4ON0A 3L2CA 4S04A 1HW1A 1SMTA 1FZPB 3RKYA 1XCVA 5JR3A 3JSOA 3R0AA 2Z3YA 3TDUC 2F5FA 3QAHA 2VBZA 4B09A 1BN5A 2F5DA 3P9CA 4IJAA 3FXUA 2FNAA 2ELHA 3QP5A 2DBBA 1OYWA 4IHTA 1HQCA 2JPBA 1G3WA 4YIFA 5CVUA 1S8NA 2IJLA 2UXNA 5JVTA 4HV5A 1T98A 1FOKA 1FNNA 3E5QA 3FMRA 1ZYRF 2HEOA 1O3RA 1RI7A 1TLHB 4E70A 2L3DA 4MEYF 2UZKA 3E6BA 1YYVA 1S7OA 2ZMEB 2XHKA 2O61A 5D4RA 5ILSA 3E6DA 2QBYA 3E5XA 1P4WA 2M5WA 2P6TA 3NQOA 1MJAA 2XKOA 2P6SA 3VEPA 3T1BA 4EJTA 4UNOA 1BIAA 4I2OA 4ESFA 4TV7A 4ZZLA 2HGCA 2CO5A 1T2KA 3Q9VA 2V1UA 5D5VB 3F8MA 3I53A 3KZZA 2Q0OA 3DEUA 4B8XA 2VE9A 1W7PD 4L18B 4A6DA 5ICFA 3LFKA 3V7RA 5LRSA 4XLNF 2MLKA 1P2FA 1Y0UA 3H3ZA 3FZVA 5FFXA 4HF1A 3K1PA 4HA8A 5CJ9A 2PFBA 3RPQA 2CG4A 2K86A 2JTVA 2Z5UA 3KCCA 4U7DA 2W25A 3IWFA 3QPTA 3C7JA 5J8CA 5AONA 3MZHA 1BC8C 4A0XA 3RPUA 3EUHA 5FLXK 2DI3A 1UHMA 1I27A 5IT9Z 1KQ9A 3KEQA 3QOPA 5EEHA 5D6FA 1HSTA 2O8XA 1IW7F 2A07F 4BQAA 1ZGJA 2LDUA 1OKRA 2VONA 5BMZA 2W57A 4AWXB 5FB2A 2R7DA 3QP6A 2DK5A 2JZYA 1IF1A 1CF7B 2H27A 4FT8A 2EA2A 4IPAA 3ROUA 4U0WA 4HX8A 2HZTA 1YTYA 4EM2A 3RDIA 1IRGA 2M45A 1KYWA 3JSPA 5DUIA 3QU3A 4L9TA 2F5CA 4U0YA 3HSEA 4ETSA 1T39A 4LLGF 2ZO4A 1LDJA 5LEJA 1OPCA 2P5KA 4M9SA 2ZFWA 3AAFA 2GIVA 4R1HA 3K69A 4EJVA 1PP8F 1RUOA 2UWMA 1RIOH 3MFKA 1UFMA 2CGPA 3FXQA 2A3SA 3I59A 4HX7A 3Q5FA 1D8KA 4UHTA 2OA4A 2G7UA 1J0RA 1BI3A 4EJUA 3CLOA 5LRRA 2A69F 2IRFG 5K1YA 1HKQA 2OZUA 5H20A 3M8FA 1YO5C 4WWCA 1HW2A 1ZRCA 5L3BA 2DFIA 2FBKA 2UXXA 4BHBA 1W7PB 3KLOA 3T8TA 2P7VB 4GYGA 1FBSA 1MD0A 3ABUA 2D1VA 2A5YB 2GXBA 2HQRA 4Q48A 4CZZA 3EQLF 3HTSB 3F6VA 3TOAA 4P9UA 1ZHFA 2XRNA 4O5VA 1IRFA 3R0JA 2K7LA 4S05A 1SD6A 3BPVA 4AVPA 3HIFA 1FYLA 3BDDA 3F8CA 3RKXA 2V6CA 2XASA 4Z2YA 1R00A 1YLFA 1J75A 3KP5A 3BPXA 1BOAA 4EM1A 2GA2A 3F21A 1U5TB 4RB3C 5DD4A 3DV8A 5BPDA 4KIGA 3BROA 1EV7A 1G6NA 5ED4A 3I54A 2NNYA 1REPC 2ZXJA 1FT9A 3P7NA 1B6AA 1AOYA 1OYIA 2DK8A 3H3UA 2IW5A 1HBXG 2FA5A 3LA7A 3GZ6A 3N4MA 5BPIA 3EYIA 2EFPA 5E18F 1A04A 3JTGA 4WXHA 4LG0B 5HS7A 2PI0A 5IT9K 2VBYA 1IXRC 2XAQA 4ASNA 5DDGA 1RZ4A 3RYRA 4A0YA 2ZMEA 3SZTA 2YSRA 3I71A 4LMYA 1ON1A 2DAOA 1B4AA 5AIPA 1K78A 2LNBA 1J7KA 2NRAC 1J5YA 2E1NA 1USTA 1WQ2A 4O6JA 4CXFA 1R5GA 1O3SA 1AWCA 4ZZDA 1LJ9A 4GXOA 5FD6A 4PGGA 2BGCA 1W7PA 3M8EA 4R79A 4U0VA 1ZRFA 2MA3A 1W5SA 4LB5A 4ZYHA 2VOPA 4LK0F 5F64A 2AS5F 3PFIA 2BYVE 4WF2A 4ESJA 2CQKA 4UVBA 4G8XA 2Z99A 1IZ1A 1GXPA 1TQPA 4Q4ZF 3R61A 1IN7A 2BV6A 5DUKA 1WKMA 4Y15A 4YIIA 4LB6B 4A5NA 2DO7A 4MHGA 3V8KA 1LEBA 5LHHA 2EFQA 3WE3A 4ESBA 4UVCA 4HF2A 4CICA 4O3MA 1O3QA 2Z9OA 3U2RA 3HRTA 1SFXA 5CVIA 5E1WA 3QPHA 1YW8A 3ZMDA 3NEUA 2DLLA 2E7XA 4U88A 2JSCA 3JTHA 1IN5A 1K6OA 2Y75A 5DCMA 2LF8A 3RYPA 4L9NA 5D8LB 3ZN0A 4IXAA 1F5TA 2HTSA 2QVOA 3MZYA 1XMKA 3F3XA 3DP7A 1P6RA 1HKTA 3F72A 2QBYB 3TOBA 1BIBA 2Q8KA 3HRSA 1IUYA 2HYFA 1R1TA 3D5LA 3COAC 4AIJA 4HOBA 2VN2A 1TNSA 4RGRA 1MDMA 3TO9A 1DPRA 3G3ZA 2ZNYA 1UB9A 2ZJ2A 4BHCA 4M6YA 1LQ1A 4H0EA 1R1UA 5TRDA 4XRFA 1FYKA 2KKOA 3TQNA 4EMSA 1MKMA 1R23A 5KVRA 4I09A 4XLPF 5ERIA 1SMYF 3MCZA 2KIMA 4M74A 1FPQA 4U7BA 3O2PE 4OIOF 4I98B 1U2WA 1O3TA 3WTTC 3WTYC 3JW4A 1Z7UA 3ZPLA 3C18A 4ZYEA 3LSTA 4GGGA 4HYEA 4QWQA 1XGSA 1YS7A 2EV5A 3O6BB 1CGPA 3ABTA 3BJOA 4CDGA 1ZG3A 3KP6A 5J6XA 5FO5A 4P9FA 3FX3A 3GWZA 1P4AA 2FNPA 3W6JB 2JT1A 3NRVA 2KIFA 2KJBA 1QGPA 3ZMVA 2FMYA 2VT2A 2FF4A 4F7ZA 2HOEA 2MD5A 1QO0D 1NHAA 4ENKA 2P4WA 2LSOA 2FQ3A 4YFNF 6PAXA 1Z6TA 2OZ6A 3E5UA 1HSJA 5KK1A 3Q9SA 1H9GA 3QU6A 3GW2A 4KFCA 1CF7A 4HBLA 4FX4A 3KETA 4A5MA 5D5XB 3SXYA 1SD4A 3K1NA 2M30A 4IRIA 2ESNA 2LF7A 3DKWA 2XAGA 1I1SA 1ZLKA 3M7GA 2V1XA 3GVAA 4L9JA 1OMIA
chains in the Genus database with same CATH superfamily
1KA8A 2EQRA 2PG4A 3JRBA 1S29A 2LP0A 1XTAA 2ZXIA 4CH7A 4BXUA 3A0HC 3ERED 2EIKH 3I59B 1JT6A 1RC9A 4EGYA 4HLXA 2DFFA 1U3EM 2DTRA 1VQNI 1JJ8C 1ZG1A 3BQYA 2NOJB 3HGGA 4IZZA 3GO5A 1YS6A 2P5LC 3GF2A 3M1EA 4ABZA 2R0QC 3FK6A 4MQ9F 1FLIA 3P9IA 1L0OC 1Z67A 1X4PA 2M4KA 3WGHA 3BG7A 1WWXA 1R36A 1YRNA 1S7AA 2MGQA 4YIRX 2O3FA 2TDXA 5F1JA 3KFWX 2C6YA 3HHHA 3WG7H 5E3NA 5CYVA 4N0BA 3CMYA 4WK8F 3ZQ7A 3L2UA 2L4MA 2HXOA 3HRUA 5F6FA 4BH9A 2L01A 3LQQA 3HDDA 1XGOA 2CWEA 1FYMA 5ILVA 2COMA 1Y8QB 1WRJA 4ANJA 3U9GA 1B59A 3KZYA 4E7ZA 1TBXA 3H36A 2B9SA 3PO3J 4ENJA 5FFZA 2DDAA 1XSXA 3DXJF 3E3VA 2XAFA 1CQTA 1D1CA 2EZKA 2JA6J 4F91B 3F8BA 2R7QA 3LMMA 5J4YA 5J4VA 1BL0A 1GVDA 4HQEA 1P7JA 3PM1A 2R7ZJ 3Q0WA 4WXCA 3I4NJ 4G7OF 2JA7J 1X1AA 4MGRA 5BS6A 1ZLJA 1XB4A 1T0FA 4YEJA 4ZDPA 4HRIA 1U9OA 1J9IA 2VC0A 2R5YA 4QIWN 1D3YA 4G6DA 1ZG5A 3DBLB 4P1WA 3MN2A 2I8DA 4RAFA 2FU4A 1V5FA 2V79A 1BBYA 2WV0A 2ZKZA 2H94A 4JX6A 4MFDA 5FLMJ 2K4BA 2V6EA 4V19K 3PQJA 4M71A 2QF7A 5E20A 1K4TA 1IDZA 2STTA 2AQFA 3CCMI 1IN4A 3L09A 3PFYA 5LGNA 4RA2A 1MBHA 3KX2A 2NAZA 1IGNA 4Q5SF 4B3AA 3PO2J 3CO7C 2BVLA 3OYMA 2XF5A 2WTEA 2XROA 1MMSA 5A2QK 1ZGWA 3BP8A 3NWSA 4IEJA 3I0TA 1UHSA 5FKOA 2V7FA 2XB0X 5BOXA 4FETA 1SAXA 2X0LA 3NWTA 1BI1A 1U9NA 4L5JA 4AUXA 3K4JA 2LLKA 1FBUA 3F23A 1IAWA 2DPUA 1B1BA 3WTWC 3J80Z 3ZCOA 3WTVC 2KT0A 4W97A 5GAHJ 3CD6I 1J2XA 1BI2A 2AQEA 1R5HA 1VQ6I 1JTXA 1IV8A 2QENA 2XVCA 3V7SA 1K83J 1X3UA 1ZAOA 2HQNA 1T56A 4OIRF 2H6CA 1PUFA 3SZGA 4M3EA 5GP9A 3V4GA 2CQQA 2GWRA 2R4GA 3LSIA 1ZK8A 3KIOA 3RTRA 4OMZA 2RAEA 5IPAA 2AHQA 2WWYA 3E6MA 2OU2A 2IT0A 5B1BH 3KLNA 1YJ9I 1ENHA 1TW2A 3D1NI 5HODA 2N8GA 1V54H 1HOMA 4J00A 1DP7P 1WSUA 1G4DA 1T38A 3ISPA 3ZN1A 3K4NA 3ZP5A 1LE8A 2XB5A 2E71A 2RGVA 4BU2A 1FTZA 3CC4I 4JX5A 4CYCB 3H0GJ 4XLEA 3VYTB 4RB0A 2ZCWA 3CMAI 2OD5A 4L9VA 1KONA 4M73A 1LFUP 2XSDC 1D1AA 3MKYB 1WZ2A 2DA1A 4B44A 3L00A 4AIHA 1MGTA 2FOKA 3BCBA 3OYFA 2VC1A 1OR7A 4AU7A 1UJ8A 2K3PA 2XGEA 3EYYA 3GFJA 1U8BA 1W0UA 4DJAA 3CUQC 3ZOBA 5LD2C 2ID6A 3HUGA 4HAMA 5HDNA 2ME6A 3RZOJ 3I64A 2F5VA 5DEQA 2CYYA 1UG2A 2ECBA 2ZJPF 5JFRA 2JN6A 2H1LA 1GDTA 4BBSJ 2MLGA 1E2XA 3CP2A 4A3KJ 1PP7U 4MO7A 2CUEA 3E97A 3K9TA 4E7IA 3RKQA 1OJLA 2HOSA 2MC4A 3FXJA 1UMQA 4UB6C 3RQIA 1EJ9A 3CO6C 1S5LC 3IRQA 2HKOA 1YFHA 1PDNC 3FBIB 4RGUA 1Y56A 1HC8A 4UB8C 1XD7A 2VE8A 4KMFA 3MKZA 1KU2A 1F1ZA 2GAUA 4KUMA 2QM3A 2RNGA 1FMWA 2EFOA 3EDPA 3SYTA 4BXXJ 2X9DA 4M3GA 1JTYA 4RGXA 4CCNA 2R3SA 3HXLA 1G3YA 5HLHA 3ZMTA 2FOWA 4YELA 1PUFB 5D6EA 1T8IA 2IGNA 1U6GA 1PYVA 1X19A 4JP0A 1N77A 2QQAA 4G6QA 2LK2A 3S3MA 1H9TA 2G9WA 4LLLA 3S1MJ 2JA2A 2EK5A 4QPOA 2YUSA 4NUBA 4ZTFA 4BBRJ 3UNGC 4C3JJ 3ELKA 5FKKA 1U8RA 2GXAA 3NARA 2R7FA 1XX5A 3HEFA 4BUPA 3TKYA 2DOEA 1Z6RA 1MNMC 1IUFA 2VJIA 4XMYA 1IXCA 4BQOA 3GTPJ 1IDYA 3KPHA 3P9KA 2M7AA 1ONVA 2YU9J 4Y17A 3K70C 4D7NA 5K5RA 1U78A 4IOAF 1POGA 3BCAA 3K0LA 1O7FA 3F22A 3VWBA 4OOIA 4KIFA 3F6OA 1HDPA 4QTRA 3BLYA 3J81Z 4ZJZA 4I0BA 2DQRA 3E6CC 1ORKA 4XK4A 4A3JJ 5K7HA 4NC6A 5KAFC 1WJFA 1UAAA 1MNDA 2WV1A 2VXZA 1Y8RB 4CCOA 1ACIA 2PBIA 2BE5F 2DJIA 2H8WA 3BY6A 3ERMA 1IRXA 1OYYA 2JK3A 3SDBA 3LSPA 1XDUA 2X4HA 3DPUA 2ISYA 1Z77A 3EPZA 3OL3A 2MH9A 3G1OA 2KQRA 3FIWA 2P8TA 1WI9A 1C0WA 4XLFA 3AG4H 1RUNA 3D0SA 4A3MJ 1K7AA 3OS2A 1P92A 4DYQA 4RAZA 5JLWA 1GXQA 1IN6A 1WJAA 1ZGAA 1X1BA 2DA4A 3Q0VA 5BNGA 3K2ZA 3WTUC 1M1EB 4M6VA 1R7JA 1XCBA 1BI0A 1DPUA 4G94A 2EWNA 5LGTA 4PZJA 2PJRA 5FLVA 4A3DJ 5H2FC 4KDPA 1MBGA 3S1NJ 2M0MA 3WGGA 2OC6A 4E7SA 1TW3A 2ETHA 4XBFA 2E2IJ 3M8JA 1I39A 2M9HA 4UUVA 4EEFG 3J7ZI 1H8AC 1YW7A 3B73A 4J01A 4M9XA 1YIJI 5E1XA 5FGMA 3AL0C 4EQQA 1X4OA 3HRMA 3OOUA 1MMNA 2PMHA 3EETA 5L3GA 3ZMSA 3OIPA 4IRGA 3K4LA 3V8LA 4X0GA 2NOGA 3FXLA 3GUDA 5IT3A 3IL2A 2L4AA 1VQ9I 2VJJA 9ANTA 5A2QZ 1NG6A 3ECOA 3WU0A 5EG0A 1MJBA 4UY8I 3OS0A 1Z0XA 2KP6A 3FMSA 2CW0F 4E6KG 2GQQA 5CVJA 4WX9A 2OJED 3OYHA 2DA3A 1DDNA 1SAUA 1WJEA 3LOCA 2Z16A 2PMZN 2VBXA 3DU6A 3I58A 1JHHA 1HKSA 2O6GE 1ZARA 4RB2C 3FM3A 4PGHA 4L5IA 3WGIA 1H89C 2X1DA 2X6XA 3FKJA 4ZYDA 5L3CA 1OCRH 1Z05A 3DQVC 2QQBA 1WH5A 4RM2A 5E3OA 2DQLA 2W4SA 1SC7A 4HW0A 2BZTA 3BOQA 1Z91A 3DTEA 2LREA 3OYIA 1K61A 2WAEA 4YFXF 1AKHA 2K3FA 1LB2A 2X6WA 1XGMA 2WAQN 4Q47A 2X1CA 2HU9A 2O03A 4PCQA 1JE8A 4DGWB 1JXSA 5KHDA 3FDYA 1W4MA 1S7EA 1XSVA 3OMYA 3WTSC 5HLIA 3MKWB 5EGOB 2E2JJ 1IN8A 3G4SI 3V8JA 2E60A 4C3IJ 4FISA 2O7OA 4I02A 4NHJA 2QCOA 5IOZA 3F0CA 3G6EI 4KYWA 2JRTA 1S6LA 1VF9A 2BBYA 4HX4A 2MBFA 4HG2A 3TW7A 4BEHA 3CCQI 3WE2A 5HDKA 3OSFA 1USSA 2X1EA 3BR6A 3PUFA 4UUSA 2ID3A 3CCRI 1BOBA 1YIOA 4UV8A 3ZQCA 4LD5A 4MTEA 2RQPA 5DYMA 3KYDB 5BQTA 4M72A 2ZXHA 3S1RJ 4Z6YA 1SD5A 1SVOA 3H1CA 2GXGA 3OYLA 1FEXA 2R5ZB 1VQPI 3LWFA 4G12A 3K6GA 2L7ZA 3OY9A 2RDPA 3HUGB 2HR3A 4KT6A 4HZFA 1O57A 2L54A 5F1RA 1RESA 2BY1A 2DW4A 3C2HA 1ERDA 2R7TA 4N4NB 2M4GA 4BDYA 1E3OC 2A6HF 1HF0A 2Y30A 3ML6A 4N9IA 1J09A 4BAYA 1UCRA 3G71I 2HDWA 2Z2SB 1TL8A 2EBIA 3MKLA 4XM3A 1FMVA 5ICEA 5HLTA 1LVAA 4LOCA 1IG7A 4AYBN 5D8KB 4OINF 2DU9A 3FKIJ 1D0ZA 4FE7A 1NTCA 1SVLA 4EJWA 3JRDA 2EPFA 2EJRA 3IKVA 2K9MA 4DZPA 2E1MB 5HLGA 1TTYA 3DFGA 1WGXA 1QPIA 4ZTJA 3A02A 2DYRH 2H6BA 3G1MA 4BQNA 1B8IA 3FHNA 1B72A 4CO8A 2ZNZA 3VYSB 1EKEA 1TC3C 3PNTA 3QWLA 4D7MA 1BR1A 5JLXA 2E1MC 4XSXF 3GLXA 4IF4A 2E7WA 2MH2A 2QQ9A 2R93J 2CV2A 1E0EA 3K2AA 1ULYA 2COBA 4KA4A 3WTZA 4XKBA 4KN4X 4XRMA 1T33A 1ODDA 1QPMA 2VASA 1XDSA 2FBIA 2W00A 1MMDA 2FSWA 4LFUA 4LK1F 2DA5A 3F8NA 5B3SH 3J80K 4HNUA 1GV5A 4A3BJ 3W2WA 2LBFB 2HVQA 3SFZA 4EM0B 3J81K 5LLQA 3CC2I 5CVRA 4YG2F 5CQEA 1YRNB 1F9NA 4XOPA 3CDHA 2CFOA 3GZ5A 2HOAA 4I01A 4BACA 1MBJA 4HF0A 5JI6A 2EV0A 4BL0B 3G73A 3HPHA 3EUKL 2MYSA 4XICA 4B43A 1R5ID 3R60A 2UUZA 5EEAA 1Y6IA 2BY0A 5HOOA 3I3LA 4BHPA 2PQ8A 3FHZA 4UUSB 2BVMA 2H1KA 1KQ0A 3E1SA 3PNVA 2XC7A 4IHSA 4E7HA 4LG0A 1A5JA 2JRMA 1LEAA 3QODA 4W1UA 2GLOA 1VZ0A 1JGSA 3PQKA 1R22A 2VBWA 1DUXC 2PN6A 3HZJA 1D0XA 5ICCA 1HW5A 1EH6A 2WADA 3EUAA 2E35A 3L7WA 1ZR4A 4FHTA 3GZNB 4M9ZA 1WCMJ 2JVGA 1FY7A 4DOZA 3CUQB 2ADUA 3GTLJ 1QQIA 2Y0SN 3M1CA 4I7HA 2NVXJ 2PJPA 4DQ2A 1U5TC 2XKPA 2LOOA 3RJPA 5F0FA 1B8IB 3MMYB 2Z33A 3PL8A 3OYBA 1WJBA 2QSHX 2BW3A 2FRHA 3FWEA 4LG3A 4A3EJ 1DU0A 3OOPA 2W7NA 1R9TJ 1V3FA 2QWWA 2XF7A 2XUBA 3HKZA 4D9JA 4IOCF 2ZSIB 2OUMA 2F5EA 2M8EA 3TW6A 1FC3A 4E7KA 2RV8A 1T08B 3RCOA 2DMTA 4DNCA 2GZWA 5CQGA 1HLVA 1AA7A 3RQ4A 3CUOA 2EZLA 3GXOA 2R7UA 3WG9A 4DYRA 2HWVA 4OWRB 1R71A 5K5QA 5E17F 1DP3A 3GCMA 3SQNA 1SFEA 1A31A 2IA1A 2GA1A 4XNFA 3IAM2 5J1RA 3WODF 1VI0A 3VPRA 3JAMK 2RREA 2A6EF 5EYRA 2VLAA 3I4PA 4EGZA 1ZREA 3MEXA 2P7CB 4Y13A 3REOA 1TNTA 3K1MA 3HBLA 1W36C 5D4SA 1BA5A 4C2TA 1B9MA 3D5RC 2QA4I 4JBAA 3RIRA 3BTJA 1ZH5A 2F4MB 2VB6A 2CQNA 1N78A 3FXKA 2FMLA 5AIQA 2CW8A 4E7JA 3GTOJ 2ZJRF 2CJJA 4I99C 2DPDA 3HTUA 4XN3A 4BNCA 3R4KA 4IVNA 5DCMB 4BEHB 3X2QH 4UVAA 5HDGA 4L0YB 2WAQA 2X85A 3BJAA 3CP8A 3FXRA 1KU3A 4HQMA 3U1DA 1R4NB 3KE2A 5E8IA 3HOSA 1I5ZA 1QZZA 4X6AJ 4PK4A 2M2EA 2PMUA 1EH8A 2HYJA 2MSYA 1E3HA 2K27A 4WCGA 2RQQA 3OYDA 1RR8C 2XAHA 3BG9A 2BEOA 2IXSA 3R6SA 3VB2A 5FLXZ 4RAYA 3A1YA 4RGSA 3AFHA 3V42A 5F08A 1MW7A 2DXIA 5EDNA 2Y48A 3S32A 2M87A 1LVKA 2VQLA 3WU1B 1QBJA 1YHQI 2VKDA 3DEEA 5LEKA 1S9HA 1EA3A 1Z1DA 1YW9A 4P96A 5TJJA 3I56I 4G7HF 2F2EA 1MDMB 2HFHA 4LLNA 4BXFA 3PSIA 3O3KA 3QYFA 4BYYA 2OQRA 3HSFA 2J5PA 2XV4S 2BY2A 2WBMA 5J1UA 5H6RA 3I5UA 3GFMA 5DM7F 4IHWA 5DD8A 4PJNA 3J7AO 3CJTB 1FP1D 2IA2A 4MNUA 4OU0A 5L3DA 2YX4A 2IVMA 2VKEA 4LIUA 2WAFA 4ZH4F 4PDKA 4XSZF 2E1CA 2CMPA 3DLAA 4MEXF 1YJNI 1MIJA 2A05A 1WJCA 1APLC 5LFAA 3BTCA 3L1PA 1OCTC 2DMPA 3OV8A 2K02A 3LSMA 1V5GA 4HNTA 5ILUA 3E0JB 4A69C 5J8FA 3IHUA 3KP7A 2Y2ZA 1Z9CA 5JVGF 3LA3A 2W84A 4DYCA 2Y9ZA 2FXAA 2L02A 4IQ4A 2HS5A 1YG2A 3GX4X 2LKXA 3S2HJ 4P55A 5E3MA 1UHWA 1UZCA 4N9HA 2XF6A 4CZCA 1TQMA 1MMGA 5J40A 1Y1VJ 3S2WA 5LHIA 2OAZA 3MQ0A 1V55H 4PJJA 4KICA 4NQWA 1ETQA 1H0MA 4CYDA 2HKXA 1VNDA 2K5CA 2ZB9A 1NH3A 4OIPF 5C3EJ 4FX0A 2R92J 2R7RA 1GLNA 5IYCJ 1XSDA 5D5UB 2HDCA 1MJ9A 1FP2A 2HQ5A 4E7LA 3GEZA 1BC7C 1X1DA 3OSGA 1K78B 3IRRA 4KN7X 4IO9F 3CCEI 3IWZA 2NXNB 1XGNA 4GYIA 5DV5A 5FKNA 2DCEA 3TL4X 1ZRDA 3ZMZA 1LFPA 1XN7A 5FKLA 1HXDA 1JKPC 1QNTA 2PEXA 1YOVB 5L3EA 5GPCA 4LGWA 2Y0MA 4RB1A 2EFWA 4ZYAA 2BXZA 4FE4A 2Q2EB 3IC7A 3HOTA 2EB7A 1J59A 1WJ5A 2JUGA 1YI2I 2EFNA 4JX4A 3KP3A 2O8KA 3HOUJ 2OQGA 4MQVA 3K4CA 3B02A 2NS7A 3C1DA 3H9GA 3OIOA 2P5VA 1OQYA 3TGNA 4EVIA 4HLYA 4XL9A 1F4KA 5CLSA 1E17A 2DT5A 2RC4A 2LMDA 3DTIA 4F93B 4D1QA 2CUZA 3LAPA 2XAJA 2ISZA 2H09A 2D2WA 1QZYA 4F52A 2A61A 3BTIA 2IS4A 2NVYJ 4C2MJ 3L2QA 3A2KA 1HDDC 1LDKB 4EJOA 4S0HB 2FBHA 1VFCA 2IPQX 3F8FA 1K6YA 3RKWA 1D8JA 4HDUA 1EH7A 1TWHJ 2OTLI 4RDUA 4AIDA 2STWA 4G7ZF 2YPRA 2X48A 1FSEA 2RKHA 4KT5C 2M1BA 2V9KA 3HHGA 2XPUA 4R8HA 3ZQGA 4A6EA 4QSHA 2ZMEC 1VQ4I 1ZTRA 3KP4A 4A3FJ 2LTPA 4IHYA 2QUFA 2XGDA 3NAUA 2V9VA 3OYAA 4JYKA 1YQAA 2HZDA 2YR2A 2F4OB 2XPVA 3GFLA 3TO7A 5FRNA 1FWZA 3C3WA 4RS8A 2A6TA 5LBQA 4II2A 1OISA 2FE3A 2K9QA 3MZ8A 3BQZA 4ENNA 2VKVA 3DKXA 4UXNA 1WI3A 1P9QC 5H6QA 3ULQB 5ICGA 2D1HA 1QRYA 4JK1X 2MFZA 1SVMA 2EV6A 4CGZA 3M9AA 3VOEA 4AIKA 2I10A 2XGXA 3J7AY 2VPRA 3HGYA 1BM9A 4I0AA 4LJZF 2ZJQF 3C2BA 4IQJA 2KLOA 5DCFA 3LSHA 3GLLA 2LY9A 5F27A 5TISC 1XMAA 2DA6A 4JOMA 3LFUA 3Q0UA 2XIGA 1OCCH 2J5OA 1BR4A 4UV9A 2A68F 3ECHA 3S2DJ 1JHFA 2E5ZA 3JRFA 2B0LA 4A2UA 2CH0A 1X1CA 3KEOA 3WTXC 2IA0A 1I6XA 3CZ6A 3DLLF 4I76A 2FEZA 3T8RA 4OMYA 4XQFA 1F36A 4A3CJ 3LAJA 1G2HA 2MABA 2ESHA 2EH3A 2QYOA 4KJZA 2KJCA 1SFUA 3DEWA 4JQFA 1STZA 3HB9A 2EA4A 5JHUA 3T5XA 4CCKA 2W85A 3S15J 3IV5A 2ELJA 3CUQA 2NVQJ 5LGUA 2ELKA 5HS9A 1P4XA 3L9FA 4M3BA 4QLCU 4XKWA 2RN7A 2L2OA 4G9YA 1R1VA 3LA2A 5F0HA 3LQRA 1YJWI 3VYUB 3CJNA 3ONQA 2NYXA 1SD7A 3W6KB 2HYGD 2NNNA 2LKSA 2V1DA 2HPMA 2VODA 2HXIA 3JRGA 1U5TA 2IAIA 4BJTA 2OCEA 1L3LA 4B48A 2YU3A 1B9NA 1W5CC 3FF5A 3CTAA 3HSRA 2IP2A 3BR2A 4H4KC 3LNQA 1FX7A 3BWGA 1BW6A 1MSEC 3M4OJ 2L7FP 4KNYA 3BTLA 1ON2A 2TRTA 4HV6A 4YFKF 3SHFA 1IXSB 3KZIC 4D0PA 3H9JA 1GVJA 1W36D 2B63J 5LHGA 2JVHA 4V2GA 3V7CA 3DKYA 5KCMA 3OWTA 1G3SA 3JRIA 1LDDA 4K2EA 2JPCA 2HTJA 5CVVA 2PLYA 1T0FC 3JCUC 3CF2A 5HS8A 1KU9A 4P5OA 3HOXJ 2ACJA 3HYIA 1MZBA 2QQ8A 5L3FA 2QZ8A 2JA5J 5EF6A 5D5WB 1O7LA 4DBQA 2MC3A 4U87A 3H5NA 2OBPA 2IS1A 3KEYA 3GYHX 4EV0A 1VTNC 2JMWA 4XKCA 4CCLA 1I1GA 2KZGA 1T6SA 2EZHA 1FSHA 1X2NA 2KDOA 2BW3B 3OYJA 1FOXA 2WC2A 3L2RA 3J7YJ 2QLZA 2QSFX 1V4RA 2HVRA 3JRAA 2NS0A 2WY7Q 4GDFA 4XLHA 4L5EA 1KQ8A 1MBKA 2O0YA 5EEGA 3SEZA 3MWMA 3H92A 1Q1HA 1R58A 3H0DA 4WXDA 4PJMA 5FD5A 4D5CA 5EJCA 5K5OA 2YX7A 2BOLA 1KZHA 3IKTA 3FM5A 3FISA 1KU7A 4OIQF 2CW7A 3CESA 1D5VA 1K79A 3DF8A 2EINH 3MAJA 4AD9A 2MD0A 2ZBKA 2L7KA 4C2UA 5EZHA 5C4XJ 5JHFA 3H5RA 2OCCH 2E19A 3BG3A 1WJDA 4A12A 1UG0A 1JKRC 2Y31A 1TQIA 1RNLA 1KYZA 2RVCA 2CSOA 3T0YA 2KL4A 4B1RA 2K4JA 3IH3A 2ZXWH 4IHVA 2KIUA 3KP2A 1YE9A 5B5EC 1IO2A 1G59A 1YX3A 1FIAA 4M3FA 2AXLA 4MTDA 2D45A 3LSJA 1JUMA 2HOTA 2W1OA 3CCJI 2VT3A 1QHHD 4GCVA 5HVQC 4PFOA 1OCOH 3TO6A 3QPLA 2PX9A 4IRHA 1TT0A 5GTHC 4NQWB 5FROA 3ZMUA 4M6XA 3GFIA 1TWCJ 2KRHA 2RNJA 4Y3OA 4BJ6C 1Z3YA 2X51A 5GAGJ 1G8XA 5EGOA 1UELB 4RLFA 4NB5A 1DQUA 4BGDA 1G3TA 3VODA 3QYEA 2M3AA 1S3JA 1S72I 2CRGA 3RZDJ 1W5TA 1D0YA 2VOOA 2KRCA 3SDGA 2DODA 4A0ZA 4DW6A 3DU5A 3D5SC 4HSTA 2CFXA 3TDZC 3CCLI 3SZPA 4GO1A 1LNWA 3BJ6A 1FBQA 5E1ZB 3DPLC 2W24A 4CHUA 2WY8Q 3ABKH 4ZC3A 4KIBA 2LVSA 4HDVA 1GUUA 4L0ZB 2LR8A 1KGSA 3VFZA 1RR7A 4ENMA 1NK2P 1ZN2A 3FMQA 3BZ6A 3K7AJ 2VL8A 2VUMJ 2G7HA 4FCYA 3JAMZ 4FQGA 2Q2EA 3VYRB 1PUEE 3CJQB 5E8GA 1GHCA 3QRFF 3CCYA 2VKHA 4ZYGA 4KMUX 3N97A 3RI4A 3M3YJ 1Y0NA 1BJAA 3GTKJ 2XAUA 2KRFA 2LKPA 3OYKA 3DPTA 4ON0A 3L2CA 4S04A 1HW1A 2R5ZA 2LRDA 3S8PA 1SMTA 1FZPB 3A01A 1PVEA 3RKYA 1XCVA 3CDLA 5JR3A 2VPLA 3JSOA 3R0AA 2Z3YA 3TDUC 2F5FA 3QAHA 4PJLA 3KYLA 2F48A 2M8GX 1RRJA 3ZQHA 1VQLI 2VBZA 2L0KA 4B09A 3W3CA 1BN5A 1LUJB 2ZSHB 1VQOI 2DOAA 2F5DA 3P9CA 4RLQA 1T95A 4IJAA 3DBRB 3FXUA 2W82A 2FNAA 2KISA 4X1EA 2ELHA 3QP5A 1VQ7I 2DBBA 3S14J 1OYWA 4IHTA 1HQCA 1Z3XA 1SFKA 3FBNB 2JPBA 1G3WA 1W1WE 3HG9A 4YIFA 3L2WA 1QU3A 3BG6A 5CVUA 1S8NA 2CQXA 2IJLA 4B47A 3W2AA 2UXNA 3L2VA 5JVTA 1D5YA 4HV5A 4AYBA 1AKHB 1T98A 5FKMA 1FOKA 1FNNA 3S17J 2QKLB 3E5QA 3FMRA 5DS9A 1TP4A 2BXYA 1OCZH 2HDDA 3GTGJ 1ZYRF 5CKTA 2HEOA 2KFDA 1O3RA 1RI7A 1TLHB 4E70A 3OYGA 5IP9J 1JKQC 2L3DA 4ZDLA 4MEYF 2QSGX 1H88C 1N25A 2GOMA 2UZKA 2XGCA 3E6BA 1Y1WJ 1YYVA 3ZRGA 1RPWA 1S7OA 2ZMEB 3UKGA 2XHKA 1MBFA 5DM6F 2O61A 1HA8A 5D4RA 5ILSA 4Y7NJ 3E6DA 2QBYA 3E5XA 1BW5A 1RKTA 1P4WA 2M5WA 2P6TA 3IAS2 3NQOA 5K7ZA 1MJAA 2W48A 2CS3A 2XKOA 2P6SA 3VEPA 4FASD 3T1BA 4EJTA 4UNOA 5B66C 3FXMA 4BS9A 2CQ7A 1BIAA 2KIQA 1OLTA 2DA7A 5C44J 4I2OA 4ESFA 1JUPA 4TV7A 1X1PA 4ZZLA 2HGCA 2R5YB 2CO5A 4A3GJ 1T2KA 3CC7I 3CDIA 3BR1A 1XS9A 4BY7J 3Q9VA 2V1UA 4GFBA 3ZGKA 2PJRB 3CCUI 2DDBA 3P5JA 3PIPF 1OCPA 4CUGA 3VDXA 5D5VB 4G6TB 5CPRB 3F8MA 2QEXI 2JQ7A 3I53A 4KISA 3KZZA 2Q0OA 3DEUA 4B8XA 2VE9A 1W7PD 4L18B 2R7OA 1GT0C 4A6DA 2LD5A 2UV1A 5ICFA 4CA0A 4MIMA 2HI3A 3LFKA 1ITYA 3BC8A 3O8GA 3V7RA 3RSNA 5LRSA 1RKWA 4XLNF 1JT0A 3IUOA 4NDLA 1ZELA 1P7IA 2MLKA 1P2FA 1Y0UA 3S3OA 3H3ZA 4XLAA 3FZVA 5FFXA 1YITI 4HF1A 2E5NA 3K1PA 5M5YJ 2O5RA 1JI8A 3HOVJ 3BT9A 4HA8A 3FXOA 2PFBA 5CJ9A 3RPQA 2CG4A 4FTHA 3SJMA 5IP6A 2K86A 3AKZA 2DYSH 4DIQA 3GTQJ 2JTVA 2Z5UA 3KCCA 4F92B 2XPWA 2VXDA 2EILH 1A35A 3HOYJ 2M34A 4U7DA 3QPSA 2W25A 3IWFA 4A3LJ 3QPTA 3C7JA 5J8CA 5AONA 4XR6A 5M3MJ 3MZHA 1BC8C 4A0XA 3RPUA 5GPAA 2WB1A 1IC8A 2FJ1A 3EUHA 2VJ4A 5FLXK 2DI3A 3DTKA 5C4JJ 1UHMA 1I27A 2KDZA 5IT9Z 1KQ9A 3OL4A 1IJWC 3KEQA 5EZGA 3QOPA 4DBRA 2L9RA 4Y52J 5EEHA 5D6FA 1HSTA 1GV2A 3HKZN 4OAYA 4NC8A 5IP7J 5K7FA 2O8XA 2XSJC 4YRVA 1IW7F 1QVTA 1AU7A 2BHZA 1TWAJ 2X6YA 3A0BC 5M3FJ 2B7EA 5IYBJ 4XLCA 2A07F 4BQAA 1ZGJA 2LDUA 1OKRA 4HPQA 2DT6A 2VONA 5BMZA 2W57A 4F55A 3ESWB 4LIVA 4AWXB 1IRZA 5FB2A 2DOFA 4MLOA 2R7DA 3QP6A 2DK5A 2JZYA 3SFIA 1IF1A 1CF7B 2H27A 4FT8A 3F9KA 2EA2A 4IKFA 2V9PA 4OAZA 2QGUA 3A03A 4IPAA 3ROUA 4U0WA 4HX8A 3DCFA 2HZTA 1WHUA 5E3LA 3U1KA 1YTYA 4EM2A 3RDIA 3CCSI 3M07A 1IRGA 5TGTA 2M45A 3H3VK 4PUSA 2VIXA 4E4HA 3UR3C 1KYWA 4HNVA 3AL0B 4Y33A 4XIDA 2A5WA 3JSPA 5DUIA 3QU3A 3A01B 4L9TA 2F5CA 4U0YA 1ETXA 3HSEA 4ETSA 1T39A 2I5UA 4LLGF 2JJ7A 2ZO4A 1LDJA 1WFXA 5LEJA 1MH4A 2Y0SA 1OPCA 2MG4A 2P5KA 3JRHA 1R4MB 4M9SA 2ZFWA 3AAFA 2GIVA 5FJ8J 1LFBA 1N75A 4R1HA 3K69A 4EJVA 1PP8F 1RUOA 2UWMA 1RIOH 3MFKA 1UFMA 2Q1ZB 3QYBA 2IGKA 3K70D 2CGPA 3FXQA 5HNHA 2A3SA 3ZQLA 3I59A 4HX7A 3Q5FA 4KITB 1D8KA 4UHTA 1PJRA 2OA4A 2G7UA 1J0RA 1BI3A 3S93A 3CLOA 4EJUA 5LRRA 4IHXA 2A69F 4ZDOA 2IRFG 3VSLA 4J19A 5B1AH 2O9LA 5K1YA 1HKQA 2OZUA 5H20A 2FX0A 3M8FA 1YO5C 4WWCA 1I3QJ 1ZR2A 4BE0A 3CF5F 2IBDA 1HW2A 3HPGA 3I9V2 1JUSA 1ZRCA 5L3BA 1I50J 2DFIA 2DFEA 2FBKA 2MW8A 2UXXA 4BHBA 1W7PB 4AC0A 3KLOA 3T8TA 4C30A 2P7VB 4GYGA 2Z1DA 1FBSA 5DTDA 1MD0A 4XONA 3HC7A 3ABUA 2D1VA 2R7XA 2IS2A 2A5YB 2GXBA 1WPKA 2R7SA 2HQRA 4Q48A 4RM3A 4CZZA 3EQLF 3HTSB 5IY5H 3TEDA 3CQZJ 3F6VA 3TOAA 3LSGA 2ZFUA 5J47A 2CV0A 3PNYA 2BHYA 2AXTC 1ZQ3P 4P9UA 1ZHFA 3WHBA 2XRNA 1QVUA 2IGOA 3OYCA 4XOTA 4XORA 4O5VA 1IRFA 4D5FA 1NK3P 3R0JA 2K7LA 2Y69H 1SD6A 3BPVA 2GOXB 4S05A 4AVPA 1OR7C 1ETOA 3HIFA 3FK7A 1FYLA 1JJ6C 3BDDA 1XG1A 3F8CA 3RKXA 3DWLE 5HNFA 2CUFA 2VQHA 1ZKGA 2V6CA 2XASA 4Z2YA 2QKMB 1VQ5I 4V2FA 1R00A 1YLFA 4N4OB 1J75A 3GTMJ 3KP5A 4BJ5C 3HL2A 3B6CA 3WHCA 4C3HJ 2GIZA 1BOAA 3BPXA 2GA2A 4EM1A 1W0TA 3HOWJ 3F21A 1U5TB 4RB3C 5DD4A 3DV8A 5BPDA 1A36A 2R7VA 4KIGA 2ME0A 3BROA 1EV7A 3W6VA 1G6NA 5M5WJ 1FTTA 5ED4A 1JGGA 3I54A 2DMUA 3N05A 1X2MA 2NNYA 1REPC 1ETKA 1V5EA 2LY2A 2ZXJA 3OR1C 2E1OA 1FT9A 4RAGA 3ZQQA 1ETYA 2FQ4A 3P7NA 1B6AA 2CV1A 1AOYA 4I6ZA 1OYIA 3OYEA 3JREA 2DK8A 3H3UA 2IW5A 4IX7A 4XRSA 2YS9A 3OS1A 1HBXG 2FA5A 1MMAA 3LA7A 3GZ6A 3N4MA 5BPIA 2KHMA 4CCJA 3EYIA 1X58A 1A6QA 4NBQA 2EFPA 5E18F 3K10A 1A04A 3JTGA 4WXHA 3CMMA 3MVPA 4LG0B 5HS7A 2PI0A 1YX5A 1DGRM 2L5QA 4BE2A 5IT9K 2VBYA 3CCVI 2H8RA 1IXRC 2XAQA 4ASNA 5DDGA 1O4XA 1RZ4A 3RYRA 4A0YA 2ZMEA 3SZTA 3BZKA 2YSRA 3I71A 4LMYA 1ON1A 2DAOA 2GBYA 1B4AA 1XPXA 5AIPA 2WA0A 2P81A 5EG0B 1XC5A 2X6OA 1K78A 3S16J 2K85A 2LBFA 5IOYA 2L7MP 2LNBA 1J7KA 2NRAC 1J5YA 2E1NA 1USTA 1MH3A 1WQ2A 2G0EA 3BR0A 2JA8J 4LITA 1Y39A 3PUBA 4O6JA 5GADJ 4CXFA 4B4CA 3Q3SA 1R5GA 1O3SA 1AWCA 2AO9A 1MNEA 4ZZDA 1LJ9A 2KZVA 4GXOA 2VJ5A 3S1QJ 5FD6A 4PGGA 2BGCA 2P0WA 3BG5A 4UUTA 1VQ8I 1W7PA 4AM3A 5FRMA 2E36A 3M8EA 2DT7B 3OIQA 4R79A 1B72B 4U0VA 1ZRFA 2MA3A 1FIPA 2EZIA 1D1BA 1W5SA 4LB5A 4ZYHA 1I6HJ 2VOPA 2BY3A 3BZCA 4LK0F 2DMNA 5F64A 2AS5F 2DN0A 2LC2A 3PFIA 2BYVE 4WF2A 2D5VA 2FD5A 3ZXSA 4ESJA 2HNHA 2CQKA 2F4IA 4UVBA 1Q1VA 2M0CA 3TP3A 3EUHC 4G8XA 2Z99A 3AG2H 1VQMI 3E7LA 1IZ1A 3CMEI 2KMUA 1TQPA 1GXPA 1E3PA 4Q4ZF 3R61A 4PJ0C 1XMXA 2HPIA 1IN7A 2LY1A 2NS8A 3SEQA 2FUG2 3W2VA 3HJEA 2DTZA 2BV6A 2ECCA 1MSFC 1QZEA 3K4KA 2PMZA 5DUKA 1WKMA 4Y15A 3TMOA 4YIIA 1BR2A 2ICWG 1SANA 2V4JC 2EIMH 4LB6B 4NNJA 4A93J 4BKXA 4A5NA 2DO7A 4M3DA 3QOEA 4RMNA 4MHGA 3V8KA 2E2HJ 1ETVA 2LFBA 1TZLA 3JRCA 4CCMA 4BDZA 1LEBA 4CYCA 5LHHA 2EFQA 3K4MA 3WE3A 2V26A 4NC7A 3S3NA 4DZJA 2OTJI 2IGMA 3DBHB 3O8HA 4ESBA 2DA2A 4UVCA 4HF2A 4XN0A 1FOWA 3LL7A 2OF7A 4CICA 1O3QA 4O3MA 2Z9OA 3U2RA 2IEKA 2R7WA 3HRTA 3GTJJ 1SFXA 5CVIA 5E1WA 3QPHA 1QHGA 3LSRA 3PIOF 1YW8A 3ZMDA 2CUJA 3NEUA 4GRIA 4A3IJ 2GM4A 2DLLA 2E7XA 1DU6A 2E34A 4U88A 2JSCA 3JTHA 1IN5A 1R49A 1K6OA 1A6IA 4F3QA 2Y75A 5DCMA 2K9NA 1DGWY 2LF8A 3RYPA 4L9NA 4XKVA 3G1LA 5D8LB 4PSXA 2NVTJ 3ZN0A 4IXAA 1F5TA 1X3WB 2HTSA 1JKOC 1FOYA 2QVOA 3MZYA 3IH4A 1XMKA 3F3XA 1VQKI 3DP7A 1QA6A 1P6RA 4PSWA 1HKTA 2DJNA 3ABMH 2VQCA 3F72A 3OYNA 5KNLA 3C2GA 2CU7A 3HM5A 1U0JA 2QBYB 2XDVA 2TCTA 3TOBA 1BIBA 3CJRB 2Q8KA 3HRSA 1IUYA 2LH9A 5J1YA 2HYFA 4XRSG 1R1TA 1WH7A 3D5LA 2L9SA 3COAC 4AIJA 4HOBA 2VN2A 3B6AA 5E79C 1TNSA 4RGRA 1MDMA 1I3AA 4AVZA 3TO9A 3ZR8X 1DPRA 1NG7A 3ABLH 3G3ZA 2ZNYA 1UB9A 2ZJ2A 3ASOH 4M6YA 4BHCA 1LQ1A 4H0EA 1R1UA 5TRDA 4XRFA 2K9LA 1FYKA 1BJZA 1X3ZB 1K4SA 5GTIC 1Z7LA 2DFHA 3BR5A 2KKOA 2ZC2A 3TQNA 4EMSA 1MKMA 1R23A 3KYCB 3QQAA 3A4CA 3TP0A 5KVRA 2LYCA 4I09A 1ETWA 2K40A 3LSKA 4XLPF 4CSWA 3ZQIA 2KPMA 3H9QA 3GMEA 5ERIA 1SMYF 3MCZA 4QPQA 2KIMA 3H5AA 2OV7A 4M74A 3H35A 1F43A 1FPQA 4U7BA 3O2PE 4OIOF 4IL6C 4I98B 1U2WA 1O3TA 1TWFJ 3AG1H 2OPTA 3WTTC 3I55I 2M7BA 5IYDJ 5F0CA 3WTYC 2IS6A 4BY1J 3JW4A 1Z7UA 1SEUA 1TT5B 1HCRA 3ZPLA 3C18A 4ZYEA 1IV6A 3LSTA 5GAEJ 3ZQFA 4GGGA 4HYEA 2LG4A 4QWQA 2K9SA 4PFPA 1XGSA 1YS7A 2EV5A 3O6BB 3GBGA 3ABTA 3BJOA 3IP4B 4CDGA 1CGPA 2JWTA 1Z21A 1ZG3A 4HSRA 2HVSA 3ASNH 3KP6A 3U21A 5J6XA 5FO5A 4P9FA 1AHDP 2JSPA 3I4MJ 2L9NA 3FX3A 3GWZA 1LKXA 3PSFA 1P4AA 1R6RA 2FNPA 3RPUD 3W6JB 2JT1A 3NRVA 2XRLA 3TBIA 2KIFA 2KJBA 1QGPA 3IH2A 3ZMVA 2L9VA 1WVRA 2FMYA 3VSKA 2VT2A 2FF4A 4F7ZA 2HOEA 2MD5A 1QO0D 1NHAA 4ENKA 2P4WA 1LPQA 2LSOA 2FQ3A 3AG3H 4RBOA 2EIJH 4YFNF 1OFCX 3MD2A 6PAXA 4ITVA 1Z6TA 2OZ6A 3E5UA 3BR3A 5F04A 2NVUB 1HSJA 3WU2C 5KK1A 3Q9SA 1H9GA 3QU6A 2WB1N 3GW2A 4KFCA 1CF7A 1SFOJ 3CLQA 3PJRA 4HBLA 1RETA 4B3XA 1LE8B 4FX4A 3OR2C 1TWGJ 3K4BA 4EATA 3KETA 3JR9A 3HOZJ 4BQQA 4A5MA 5D5XB 2DMQA 2Y9YA 4II3A 3SXYA 1SD4A 3K1NA 2M30A 1FJLA 4IRIA 3G2BA 4BE1A 5KAIC 2HQAA 4MFEA 2ESNA 2LF7A 3DKWA 4HEA2 2JUCA 2VQGA 2XAGA 5M5XJ 4Y4RA 2VI6A 5J3LA 1ZLKA 1I1SA 3M7GA 1MBEA 2V1XA 1EF4A 2V1NA 3GVAA 2F6CA 4C9YA 4L9JA 1OMIA
chains in the Genus database with same CATH topology
1KA8A 2PG4A 1S29A 4BXUA 3ERED 3I59B 4EGYA 4HLXA 1U3EM 2DTRA 1ZG1A 3GO5A 1YS6A 2P5LC 3GF2A 3M1EA 1FLIA 4MQ9F 3P9IA 1L0OC 3WGHA 1WWXA 1R36A 1S7AA 2O3FA 2TDXA 3KFWX 2C6YA 3HHHA 5CYVA 4N0BA 4WK8F 3ZQ7A 2L4MA 3HRUA 5F6FA 4BH9A 2L01A 3LQQA 1XGOA 2CWEA 1FYMA 5ILVA 2COMA 1WRJA 3U9GA 1B59A 3KZYA 1TBXA 4ENJA 5FFZA 1XSXA 3DXJF 3E3VA 2XAFA 3F8BA 4HQEA 4WXCA 4G7OF 4MGRA 5BS6A 1ZLJA 1XB4A 1T0FA 1J9IA 2VC0A 1D3YA 4G6DA 1ZG5A 2FU4A 2V79A 1BBYA 2WV0A 2ZKZA 2H94A 2K4BA 3PQJA 4M71A 5E20A 2STTA 1IN4A 3L09A 5LGNA 2NAZA 4Q5SF 3CO7C 2WTEA 2XROA 5A2QK 3BP8A 3I0TA 5BOXA 1SAXA 2X0LA 1BI1A 4L5JA 1FBUA 3F23A 1IAWA 2DPUA 1B1BA 3WTWC 3J80Z 3WTVC 1J2XA 1BI2A 1R5HA 2QENA 2XVCA 3V7SA 1X3UA 2HQNA 1ZAOA 4OIRF 2H6CA 3V4GA 2GWRA 3RTRA 4OMZA 2WWYA 3E6MA 2OU2A 2IT0A 3KLNA 1TW2A 1DP7P 1WSUA 1G4DA 1T38A 3ISPA 3ZN1A 3ZP5A 2RGVA 4RB0A 2ZCWA 2OD5A 4L9VA 4M73A 3L00A 4AIHA 1MGTA 2FOKA 2VC1A 1OR7A 3EYYA 3GFJA 3CUQC 3HUGA 4HAMA 5HDNA 3I64A 5DEQA 2CYYA 5JFRA 2MLGA 1E2XA 1PP7U 3K9TA 3E97A 3CO6C 3IRQA 1YFHA 2HKOA 1PDNC 4RGUA 1XD7A 2VE8A 4KMFA 1KU2A 1F1ZA 2GAUA 4KUMA 2QM3A 2EFOA 3EDPA 4RGXA 2R3SA 1G3YA 5HLHA 3ZMTA 5D6EA 1U6GA 2QQAA 4G6QA 1H9TA 2G9WA 4LLLA 2EK5A 1U8RA 3ELKA 2R7FA 3TKYA 1Z6RA 1IXCA 3P9KA 1ONVA 4Y17A 5K5RA 1U78A 3K0LA 1O7FA 3F22A 4OOIA 4KIFA 3F6OA 3J81Z 4I0BA 2DQRA 3E6CC 2VXZA 2PBIA 2BE5F 3BY6A 1OYYA 1XDUA 2X4HA 2ISYA 2MH9A 2P8TA 1WI9A 1C0WA 1RUNA 3D0SA 1K7AA 1P92A 4RAZA 1GXQA 1IN6A 1ZGAA 3WTUC 3K2ZA 1R7JA 1XCBA 1BI0A 1DPUA 4G94A 2EWNA 5LGTA 4PZJA 4KDPA 3WGGA 1TW3A 2ETHA 4XBFA 4UUVA 1YW7A 3B73A 4M9XA 5E1XA 5FGMA 4EQQA 3HRMA 2PMHA 3EETA 5L3GA 3ZMSA 4IRGA 3V8LA 3GUDA 5IT3A 3IL2A 2L4AA 5A2QZ 3ECOA 3WU0A 1MJBA 3FMSA 2CW0F 2GQQA 4WX9A 5CVJA 1DDNA 2VBXA 3I58A 1JHHA 1HKSA 2O6GE 1ZARA 4RB2C 3FM3A 4PGHA 4L5IA 3WGIA 4ZYDA 5L3CA 1Z05A 3DQVC 2QQBA 2DQLA 4HW0A 3BOQA 1Z91A 4YFXF 1LB2A 1XGMA 4Q47A 2O03A 1JE8A 4PCQA 1JXSA 1W4MA 1XSVA 3WTSC 5HLIA 1IN8A 3V8JA 4NHJA 4I02A 4KYWA 2JRTA 1S6LA 2BBYA 4HX4A 2MBFA 3WE2A 5HDKA 1USSA 1YIOA 4UV8A 4LD5A 4MTEA 2RQPA 5DYMA 5BQTA 4M72A 1SD5A 2GXGA 3LWFA 2RDPA 2HR3A 4HZFA 1O57A 2L54A 5F1RA 2DW4A 2A6HF 3ML6A 4N9IA 4BAYA 1UCRA 5ICEA 1LVAA 5D8KB 4OINF 2DU9A 4EJWA 2EJRA 3IKVA 5HLGA 1TTYA 3DFGA 2H6BA 4CO8A 2ZNZA 4XSXF 3GLXA 4IF4A 2E7WA 2MH2A 2QQ9A 1ULYA 4KA4A 3WTZA 4KN4X 1ODDA 1QPMA 1XDSA 2FBIA 4LK1F 2FSWA 4LFUA 3F8NA 3J80K 4EM0B 3SFZA 3J81K 5LLQA 5CVRA 4YG2F 1F9NA 3CDHA 3GZ5A 4I01A 4HF0A 5JI6A 2EV0A 3G73A 3R60A 5HOOA 4BHPA 2PQ8A 3FHZA 1KQ0A 4IHSA 4LG0A 1LEAA 1JGSA 3PQKA 1R22A 2VBWA 1DUXC 2PN6A 5ICCA 1HW5A 1EH6A 3L7WA 4FHTA 4M9ZA 1FY7A 3CUQB 2ADUA 1QQIA 4I7HA 2PJPA 4DQ2A 1U5TC 2XKPA 3RJPA 2Z33A 2FRHA 3FWEA 3OOPA 1V3FA 2QWWA 2XUBA 2F5EA 2M8EA 1FC3A 2RV8A 4DNCA 2GZWA 3CUOA 3GXOA 3WG9A 2HWVA 5E17F 5K5QA 3SQNA 1SFEA 2IA1A 2GA1A 3WODF 3JAMK 2A6EF 3I4PA 4EGZA 1ZREA 3MEXA 2P7CB 4Y13A 3REOA 1TNTA 3K1MA 5D4SA 1B9MA 4JBAA 3RIRA 1ZH5A 2FMLA 5AIQA 2DPDA 3HTUA 4BNCA 3R4KA 4IVNA 5DCMB 4UVAA 5HDGA 4L0YB 3BJAA 3FXRA 1KU3A 4HQMA 3U1DA 3KE2A 5E8IA 3HOSA 1I5ZA 1QZZA 2PMUA 1EH8A 4WCGA 2K27A 2XAHA 2BEOA 3R6SA 3VB2A 5FLXZ 4RAYA 4RGSA 2Y48A 2M87A 3WU1B 1QBJA 5LEKA 1Z1DA 1YW9A 4P96A 5TJJA 4G7HF 2F2EA 1MDMB 2HFHA 4LLNA 3O3KA 4BYYA 2OQRA 3HSFA 2J5PA 2XV4S 5H6RA 3I5UA 3GFMA 5DD8A 3J7AO 1FP1D 2IA2A 4MNUA 4OU0A 5L3DA 2YX4A 2IVMA 4ZH4F 4PDKA 4XSZF 2E1CA 4MEXF 3OV8A 2K02A 5ILUA 5J8FA 3IHUA 3KP7A 1Z9CA 3LA3A 2W84A 2FXAA 2L02A 2HS5A 1YG2A 3GX4X 4P55A 1UHWA 4N9HA 1TQMA 3S2WA 5LHIA 2OAZA 3MQ0A 4KICA 4NQWA 1H0MA 4CYDA 2HKXA 4OIPF 4FX0A 1XSDA 5D5UB 2HDCA 1MJ9A 1FP2A 3GEZA 1BC7C 1K78B 3IRRA 4KN7X 3IWZA 1XGNA 4GYIA 5DV5A 1ZRDA 3ZMZA 1XN7A 1HXDA 1QNTA 2PEXA 5L3EA 4LGWA 2Y0MA 4RB1A 2EFWA 3IC7A 3HOTA 2EB7A 1J59A 2EFNA 3KP3A 2OQGA 4MQVA 3B02A 3C1DA 3TGNA 2P5VA 4EVIA 4HLYA 1F4KA 5CLSA 1E17A 2DT5A 2RC4A 3LAPA 2XAJA 2ISZA 2H09A 2D2WA 1QZYA 2A61A 1LDKB 4EJOA 2FBHA 2IPQX 3F8FA 3RKWA 1D8JA 4HDUA 1EH7A 2STWA 4G7ZF 2YPRA 1FSEA 2RKHA 4KT5C 2M1BA 3HHGA 4R8HA 4A6EA 3KP4A 2QUFA 2V9VA 1YQAA 2YR2A 3GFLA 3TO7A 1FWZA 3C3WA 4RS8A 5LBQA 2FE3A 4ENNA 4UXNA 5H6QA 3ULQB 5ICGA 2D1HA 4JK1X 2EV6A 4CGZA 3M9AA 3VOEA 4AIKA 2XGXA 4I0AA 1BM9A 4LJZF 5DCFA 1XMAA 2XIGA 2J5OA 4UV9A 2A68F 3ECHA 1JHFA 2B0LA 4A2UA 3KEOA 3WTXC 2IA0A 1I6XA 2FEZA 3T8RA 4OMYA 3LAJA 2ESHA 2QYOA 1SFUA 2KJCA 4JQFA 1STZA 2EA4A 5JHUA 3T5XA 2W85A 3CUQA 5LGUA 5HS9A 1P4XA 3L9FA 4QLCU 2RN7A 4G9YA 1R1VA 3LA2A 3LQRA 3CJNA 2NYXA 1SD7A 3W6KB 2HYGD 2NNNA 2V1DA 2VODA 1U5TA 1L3LA 2YU3A 1B9NA 3FF5A 3CTAA 3HSRA 2IP2A 1FX7A 3BWGA 4KNYA 1ON2A 4HV6A 4YFKF 3SHFA 1IXSB 4D0PA 1GVJA 5LHGA 3V7CA 1G3SA 1LDDA 4K2EA 2JPCA 2HTJA 5CVVA 2PLYA 5HS8A 1KU9A 4P5OA 2ACJA 3HYIA 1MZBA 5L3FA 2QZ8A 5D5WB 1O7LA 2MC3A 2OBPA 3GYHX 4EV0A 1VTNC 1I1GA 1T6SA 1FSHA 2WC2A 2QLZA 1V4RA 2NS0A 1KQ8A 2O0YA 5EEGA 3MWMA 3H92A 1Q1HA 1R58A 4WXDA 5FD5A 5K5OA 2YX7A 3IKTA 3FM5A 1KU7A 4OIQF 1D5VA 1K79A 3DF8A 3MAJA 4AD9A 2ZBKA 4A12A 1TQIA 1RNLA 1KYZA 2RVCA 2CSOA 3T0YA 2K4JA 2KIUA 3KP2A 2AXLA 4MTDA 2D45A 2VT3A 4GCVA 5HVQC 3TO6A 4IRHA 3ZMUA 4M6XA 3GFIA 2RNJA 4NB5A 1G3TA 3VODA 1S3JA 1W5TA 2VOOA 4A0ZA 2CFXA 3TDZC 3SZPA 4GO1A 1LNWA 3BJ6A 1FBQA 5E1ZB 3DPLC 2W24A 4CHUA 4KIBA 4HDVA 4L0ZB 1KGSA 3VFZA 4ENMA 1ZN2A 3FMQA 3BZ6A 2G7HA 3JAMZ 2Q2EA 1PUEE 5E8GA 1GHCA 3QRFF 4ZYGA 4KMUX 3N97A 3RI4A 1BJAA 2KRFA 2LKPA 3DPTA 4ON0A 3L2CA 4S04A 1HW1A 1SMTA 1FZPB 3RKYA 1XCVA 5JR3A 3JSOA 3R0AA 2Z3YA 3TDUC 2F5FA 3QAHA 2VBZA 4B09A 1BN5A 2F5DA 3P9CA 4IJAA 3FXUA 2FNAA 2ELHA 3QP5A 2DBBA 1OYWA 4IHTA 1HQCA 2JPBA 1G3WA 4YIFA 5CVUA 1S8NA 2IJLA 2UXNA 5JVTA 4HV5A 1T98A 1FOKA 1FNNA 3E5QA 3FMRA 1ZYRF 2HEOA 1O3RA 1RI7A 1TLHB 4E70A 2L3DA 4MEYF 2UZKA 3E6BA 1YYVA 1S7OA 2ZMEB 2XHKA 2O61A 5D4RA 5ILSA 3E6DA 2QBYA 3E5XA 1P4WA 2M5WA 2P6TA 3NQOA 1MJAA 2XKOA 2P6SA 3VEPA 3T1BA 4EJTA 4UNOA 1BIAA 4I2OA 4ESFA 4TV7A 4ZZLA 2HGCA 2CO5A 1T2KA 3Q9VA 2V1UA 5D5VB 3F8MA 3I53A 3KZZA 2Q0OA 3DEUA 4B8XA 2VE9A 1W7PD 4L18B 4A6DA 5ICFA 3LFKA 3V7RA 5LRSA 4XLNF 2MLKA 1P2FA 1Y0UA 3H3ZA 3FZVA 5FFXA 4HF1A 3K1PA 4HA8A 5CJ9A 2PFBA 3RPQA 2CG4A 2K86A 2JTVA 2Z5UA 3KCCA 4U7DA 2W25A 3IWFA 3QPTA 3C7JA 5J8CA 5AONA 3MZHA 1BC8C 4A0XA 3RPUA 3EUHA 5FLXK 2DI3A 1UHMA 1I27A 5IT9Z 1KQ9A 3KEQA 3QOPA 5EEHA 5D6FA 1HSTA 2O8XA 1IW7F 2A07F 4BQAA 1ZGJA 2LDUA 1OKRA 2VONA 5BMZA 2W57A 4AWXB 5FB2A 2R7DA 3QP6A 2DK5A 2JZYA 1IF1A 1CF7B 2H27A 4FT8A 2EA2A 4IPAA 3ROUA 4U0WA 4HX8A 2HZTA 1YTYA 4EM2A 3RDIA 1IRGA 2M45A 1KYWA 3JSPA 5DUIA 3QU3A 4L9TA 2F5CA 4U0YA 3HSEA 4ETSA 1T39A 4LLGF 2ZO4A 1LDJA 5LEJA 1OPCA 2P5KA 4M9SA 2ZFWA 3AAFA 2GIVA 4R1HA 3K69A 4EJVA 1PP8F 1RUOA 2UWMA 1RIOH 3MFKA 1UFMA 2CGPA 3FXQA 2A3SA 3I59A 4HX7A 3Q5FA 1D8KA 4UHTA 2OA4A 2G7UA 1J0RA 1BI3A 4EJUA 3CLOA 5LRRA 2A69F 2IRFG 5K1YA 1HKQA 2OZUA 5H20A 3M8FA 1YO5C 4WWCA 1HW2A 1ZRCA 5L3BA 2DFIA 2FBKA 2UXXA 4BHBA 1W7PB 3KLOA 3T8TA 2P7VB 4GYGA 1FBSA 1MD0A 3ABUA 2D1VA 2A5YB 2GXBA 2HQRA 4Q48A 4CZZA 3EQLF 3HTSB 3F6VA 3TOAA 4P9UA 1ZHFA 2XRNA 4O5VA 1IRFA 3R0JA 2K7LA 4S05A 1SD6A 3BPVA 4AVPA 3HIFA 1FYLA 3BDDA 3F8CA 3RKXA 2V6CA 2XASA 4Z2YA 1R00A 1YLFA 1J75A 3KP5A 3BPXA 1BOAA 4EM1A 2GA2A 3F21A 1U5TB 4RB3C 5DD4A 3DV8A 5BPDA 4KIGA 3BROA 1EV7A 1G6NA 5ED4A 3I54A 2NNYA 1REPC 2ZXJA 1FT9A 3P7NA 1B6AA 1AOYA 1OYIA 2DK8A 3H3UA 2IW5A 1HBXG 2FA5A 3LA7A 3GZ6A 3N4MA 5BPIA 3EYIA 2EFPA 5E18F 1A04A 3JTGA 4WXHA 4LG0B 5HS7A 2PI0A 5IT9K 2VBYA 1IXRC 2XAQA 4ASNA 5DDGA 1RZ4A 3RYRA 4A0YA 2ZMEA 3SZTA 2YSRA 3I71A 4LMYA 1ON1A 2DAOA 1B4AA 5AIPA 1K78A 2LNBA 1J7KA 2NRAC 1J5YA 2E1NA 1USTA 1WQ2A 4O6JA 4CXFA 1R5GA 1O3SA 1AWCA 4ZZDA 1LJ9A 4GXOA 5FD6A 4PGGA 2BGCA 1W7PA 3M8EA 4R79A 4U0VA 1ZRFA 2MA3A 1W5SA 4LB5A 4ZYHA 2VOPA 4LK0F 5F64A 2AS5F 3PFIA 2BYVE 4WF2A 4ESJA 2CQKA 4UVBA 4G8XA 2Z99A 1IZ1A 1GXPA 1TQPA 4Q4ZF 3R61A 1IN7A 2BV6A 5DUKA 1WKMA 4Y15A 4YIIA 4LB6B 4A5NA 2DO7A 4MHGA 3V8KA 1LEBA 5LHHA 2EFQA 3WE3A 4ESBA 4UVCA 4HF2A 4CICA 4O3MA 1O3QA 2Z9OA 3U2RA 3HRTA 1SFXA 5CVIA 5E1WA 3QPHA 1YW8A 3ZMDA 3NEUA 2DLLA 2E7XA 4U88A 2JSCA 3JTHA 1IN5A 1K6OA 2Y75A 5DCMA 2LF8A 3RYPA 4L9NA 5D8LB 3ZN0A 4IXAA 1F5TA 2HTSA 2QVOA 3MZYA 1XMKA 3F3XA 3DP7A 1P6RA 1HKTA 3F72A 2QBYB 3TOBA 1BIBA 2Q8KA 3HRSA 1IUYA 2HYFA 1R1TA 3D5LA 3COAC 4AIJA 4HOBA 2VN2A 1TNSA 4RGRA 1MDMA 3TO9A 1DPRA 3G3ZA 2ZNYA 1UB9A 2ZJ2A 4BHCA 4M6YA 1LQ1A 4H0EA 1R1UA 5TRDA 4XRFA 1FYKA 2KKOA 3TQNA 4EMSA 1MKMA 1R23A 5KVRA 4I09A 4XLPF 5ERIA 1SMYF 3MCZA 2KIMA 4M74A 1FPQA 4U7BA 3O2PE 4OIOF 4I98B 1U2WA 1O3TA 3WTTC 3WTYC 3JW4A 1Z7UA 3ZPLA 3C18A 4ZYEA 3LSTA 4GGGA 4HYEA 4QWQA 1XGSA 1YS7A 2EV5A 3O6BB 1CGPA 3ABTA 3BJOA 4CDGA 1ZG3A 3KP6A 5J6XA 5FO5A 4P9FA 3FX3A 3GWZA 1P4AA 2FNPA 3W6JB 2JT1A 3NRVA 2KIFA 2KJBA 1QGPA 3ZMVA 2FMYA 2VT2A 2FF4A 4F7ZA 2HOEA 2MD5A 1QO0D 1NHAA 4ENKA 2P4WA 2LSOA 2FQ3A 4YFNF 6PAXA 1Z6TA 2OZ6A 3E5UA 1HSJA 5KK1A 3Q9SA 1H9GA 3QU6A 3GW2A 4KFCA 1CF7A 4HBLA 4FX4A 3KETA 4A5MA 5D5XB 3SXYA 1SD4A 3K1NA 2M30A 4IRIA 2ESNA 2LF7A 3DKWA 2XAGA 1I1SA 1ZLKA 3M7GA 2V1XA 3GVAA 4L9JA 1OMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KA8 A;  2PG4 A;  1S29 A;  4BXU A;  3ERE D;  3I59 B;  4EGY A;  4HLX A;  1U3E M;  2DTR A;  1ZG1 A;  3GO5 A;  1YS6 A;  2P5L C;  3GF2 A;  3M1E A;  1FLI A;  4MQ9 F;  3P9I A;  1L0O C;  3WGH A;  1WWX A;  1R36 A;  1S7A A;  2O3F A;  2TDX A;  3KFW X;  2C6Y A;  3HHH A;  5CYV A;  4N0B A;  4WK8 F;  3ZQ7 A;  2L4M A;  3HRU A;  5F6F A;  4BH9 A;  2L01 A;  3LQQ A;  1XGO A;  2CWE A;  1FYM A;  5ILV A;  2COM A;  1WRJ A;  3U9G A;  1B59 A;  3KZY A;  1TBX A;  4ENJ A;  5FFZ A;  1XSX A;  3DXJ F;  3E3V A;  2XAF A;  3F8B A;  4HQE A;  4WXC A;  4G7O F;  4MGR A;  5BS6 A;  1ZLJ A;  1XB4 A;  1T0F A;  1J9I A;  2VC0 A;  1D3Y A;  4G6D A;  1ZG5 A;  2FU4 A;  2V79 A;  1BBY A;  2WV0 A;  2ZKZ A;  2H94 A;  2K4B A;  3PQJ A;  4M71 A;  5E20 A;  2STT A;  1IN4 A;  3L09 A;  5LGN A;  2NAZ A;  4Q5S F;  3CO7 C;  2WTE A;  2XRO A;  5A2Q K;  3BP8 A;  3I0T A;  5BOX A;  1SAX A;  2X0L A;  1BI1 A;  4L5J A;  1FBU A;  3F23 A;  1IAW A;  2DPU A;  1B1B A;  3WTW C;  3J80 Z;  3WTV C;  1J2X A;  1BI2 A;  1R5H A;  2QEN A;  2XVC A;  3V7S A;  1X3U A;  2HQN A;  1ZAO A;  4OIR F;  2H6C A;  3V4G A;  2GWR A;  3RTR A;  4OMZ A;  2WWY A;  3E6M A;  2OU2 A;  2IT0 A;  3KLN A;  1TW2 A;  1DP7 P;  1WSU A;  1G4D A;  1T38 A;  3ISP A;  3ZN1 A;  3ZP5 A;  2RGV A;  4RB0 A;  2ZCW A;  2OD5 A;  4L9V A;  4M73 A;  3L00 A;  4AIH A;  1MGT A;  2FOK A;  2VC1 A;  1OR7 A;  3EYY A;  3GFJ A;  3CUQ C;  3HUG A;  4HAM A;  5HDN A;  3I64 A;  5DEQ A;  2CYY A;  5JFR A;  2MLG A;  1E2X A;  1PP7 U;  3K9T A;  3E97 A;  3CO6 C;  3IRQ A;  1YFH A;  2HKO A;  1PDN C;  4RGU A;  1XD7 A;  2VE8 A;  4KMF A;  1KU2 A;  1F1Z A;  2GAU A;  4KUM A;  2QM3 A;  2EFO A;  3EDP A;  4RGX A;  2R3S A;  1G3Y A;  5HLH A;  3ZMT A;  5D6E A;  1U6G A;  2QQA A;  4G6Q A;  1H9T A;  2G9W A;  4LLL A;  2EK5 A;  1U8R A;  3ELK A;  2R7F A;  3TKY A;  1Z6R A;  1IXC A;  3P9K A;  1ONV A;  4Y17 A;  5K5R A;  1U78 A;  3K0L A;  1O7F A;  3F22 A;  4OOI A;  4KIF A;  3F6O A;  3J81 Z;  4I0B A;  2DQR A;  3E6C C;  2VXZ A;  2PBI A;  2BE5 F;  3BY6 A;  1OYY A;  1XDU A;  2X4H A;  2ISY A;  2MH9 A;  2P8T A;  1WI9 A;  1C0W A;  1RUN A;  3D0S A;  1K7A A;  1P92 A;  4RAZ A;  1GXQ A;  1IN6 A;  1ZGA A;  3WTU C;  3K2Z A;  1R7J A;  1XCB A;  1BI0 A;  1DPU A;  4G94 A;  2EWN A;  5LGT A;  4PZJ A;  4KDP A;  3WGG A;  1TW3 A;  2ETH A;  4XBF A;  4UUV A;  1YW7 A;  3B73 A;  4M9X A;  5E1X A;  5FGM A;  4EQQ A;  3HRM A;  2PMH A;  3EET A;  5L3G A;  3ZMS A;  4IRG A;  3V8L A;  3GUD A;  5IT3 A;  3IL2 A;  2L4A A;  5A2Q Z;  3ECO A;  3WU0 A;  1MJB A;  3FMS A;  2CW0 F;  2GQQ A;  4WX9 A;  5CVJ A;  1DDN A;  2VBX A;  3I58 A;  1JHH A;  1HKS A;  2O6G E;  1ZAR A;  4RB2 C;  3FM3 A;  4PGH A;  4L5I A;  3WGI A;  4ZYD A;  5L3C A;  1Z05 A;  3DQV C;  2QQB A;  2DQL A;  4HW0 A;  3BOQ A;  1Z91 A;  4YFX F;  1LB2 A;  1XGM A;  4Q47 A;  2O03 A;  1JE8 A;  4PCQ A;  1JXS A;  1W4M A;  1XSV A;  3WTS C;  5HLI A;  1IN8 A;  3V8J A;  4NHJ A;  4I02 A;  4KYW A;  2JRT A;  1S6L A;  2BBY A;  4HX4 A;  2MBF A;  3WE2 A;  5HDK A;  1USS A;  1YIO A;  4UV8 A;  4LD5 A;  4MTE A;  2RQP A;  5DYM A;  5BQT A;  4M72 A;  1SD5 A;  2GXG A;  3LWF A;  2RDP A;  2HR3 A;  4HZF A;  1O57 A;  2L54 A;  5F1R A;  2DW4 A;  2A6H F;  3ML6 A;  4N9I A;  4BAY A;  1UCR A;  5ICE A;  1LVA A;  5D8K B;  4OIN F;  2DU9 A;  4EJW A;  2EJR A;  3IKV A;  5HLG A;  1TTY A;  3DFG A;  2H6B A;  4CO8 A;  2ZNZ A;  4XSX F;  3GLX A;  4IF4 A;  2E7W A;  2MH2 A;  2QQ9 A;  1ULY A;  4KA4 A;  3WTZ A;  4KN4 X;  1ODD A;  1QPM A;  1XDS A;  2FBI A;  4LK1 F;  2FSW A;  4LFU A;  3F8N A;  3J80 K;  4EM0 B;  3SFZ A;  3J81 K;  5LLQ A;  5CVR A;  4YG2 F;  1F9N A;  3CDH A;  3GZ5 A;  4I01 A;  4HF0 A;  5JI6 A;  2EV0 A;  3G73 A;  3R60 A;  5HOO A;  4BHP A;  2PQ8 A;  3FHZ A;  1KQ0 A;  4IHS A;  4LG0 A;  1LEA A;  1JGS A;  3PQK A;  1R22 A;  2VBW A;  1DUX C;  2PN6 A;  5ICC A;  1HW5 A;  1EH6 A;  3L7W A;  4FHT A;  4M9Z A;  1FY7 A;  3CUQ B;  2ADU A;  1QQI A;  4I7H A;  2PJP A;  4DQ2 A;  1U5T C;  2XKP A;  3RJP A;  2Z33 A;  2FRH A;  3FWE A;  3OOP A;  1V3F A;  2QWW A;  2XUB A;  2F5E A;  2M8E A;  1FC3 A;  2RV8 A;  4DNC A;  2GZW A;  3CUO A;  3GXO A;  3WG9 A;  2HWV A;  5E17 F;  5K5Q A;  3SQN A;  1SFE A;  2IA1 A;  2GA1 A;  3WOD F;  3JAM K;  2A6E F;  3I4P A;  4EGZ A;  1ZRE A;  3MEX A;  2P7C B;  4Y13 A;  3REO A;  1TNT A;  3K1M A;  5D4S A;  1B9M A;  4JBA A;  3RIR A;  1ZH5 A;  2FML A;  5AIQ A;  2DPD A;  3HTU A;  4BNC A;  3R4K A;  4IVN A;  5DCM B;  4UVA A;  5HDG A;  4L0Y B;  3BJA A;  3FXR A;  1KU3 A;  4HQM A;  3U1D A;  3KE2 A;  5E8I A;  3HOS A;  1I5Z A;  1QZZ A;  2PMU A;  1EH8 A;  4WCG A;  2K27 A;  2XAH A;  2BEO A;  3R6S A;  3VB2 A;  5FLX Z;  4RAY A;  4RGS A;  2Y48 A;  2M87 A;  3WU1 B;  1QBJ A;  5LEK A;  1Z1D A;  1YW9 A;  4P96 A;  5TJJ A;  4G7H F;  2F2E A;  1MDM B;  2HFH A;  4LLN A;  3O3K A;  4BYY A;  2OQR A;  3HSF A;  2J5P A;  2XV4 S;  5H6R A;  3I5U A;  3GFM A;  5DD8 A;  3J7A O;  1FP1 D;  2IA2 A;  4MNU A;  4OU0 A;  5L3D A;  2YX4 A;  2IVM A;  4ZH4 F;  4PDK A;  4XSZ F;  2E1C A;  4MEX F;  3OV8 A;  2K02 A;  5ILU A;  5J8F A;  3IHU A;  3KP7 A;  1Z9C A;  3LA3 A;  2W84 A;  2FXA A;  2L02 A;  2HS5 A;  1YG2 A;  3GX4 X;  4P55 A;  1UHW A;  4N9H A;  1TQM A;  3S2W A;  5LHI A;  2OAZ A;  3MQ0 A;  4KIC A;  4NQW A;  1H0M A;  4CYD A;  2HKX A;  4OIP F;  4FX0 A;  1XSD A;  5D5U B;  2HDC A;  1MJ9 A;  1FP2 A;  3GEZ A;  1BC7 C;  1K78 B;  3IRR A;  4KN7 X;  3IWZ A;  1XGN A;  4GYI A;  5DV5 A;  1ZRD A;  3ZMZ A;  1XN7 A;  1HXD A;  1QNT A;  2PEX A;  5L3E A;  4LGW A;  2Y0M A;  4RB1 A;  2EFW A;  3IC7 A;  3HOT A;  2EB7 A;  1J59 A;  2EFN A;  3KP3 A;  2OQG A;  4MQV A;  3B02 A;  3C1D A;  3TGN A;  2P5V A;  4EVI A;  4HLY A;  1F4K A;  5CLS A;  1E17 A;  2DT5 A;  2RC4 A;  3LAP A;  2XAJ A;  2ISZ A;  2H09 A;  2D2W A;  1QZY A;  2A61 A;  1LDK B;  4EJO A;  2FBH A;  2IPQ X;  3F8F A;  3RKW A;  1D8J A;  4HDU A;  1EH7 A;  2STW A;  4G7Z F;  2YPR A;  1FSE A;  2RKH A;  4KT5 C;  2M1B A;  3HHG A;  4R8H A;  4A6E A;  3KP4 A;  2QUF A;  2V9V A;  1YQA A;  2YR2 A;  3GFL A;  3TO7 A;  1FWZ A;  3C3W A;  4RS8 A;  5LBQ A;  2FE3 A;  4ENN A;  4UXN A;  5H6Q A;  3ULQ B;  5ICG A;  2D1H A;  4JK1 X;  2EV6 A;  4CGZ A;  3M9A A;  3VOE A;  4AIK A;  2XGX A;  4I0A A;  1BM9 A;  4LJZ F;  5DCF A;  1XMA A;  2XIG A;  2J5O A;  4UV9 A;  2A68 F;  3ECH A;  1JHF A;  2B0L A;  4A2U A;  3KEO A;  3WTX C;  2IA0 A;  1I6X A;  2FEZ A;  3T8R A;  4OMY A;  3LAJ A;  2ESH A;  2QYO A;  1SFU A;  2KJC A;  4JQF A;  1STZ A;  2EA4 A;  5JHU A;  3T5X A;  2W85 A;  3CUQ A;  5LGU A;  5HS9 A;  1P4X A;  3L9F A;  4QLC U;  2RN7 A;  4G9Y A;  1R1V A;  3LA2 A;  3LQR A;  3CJN A;  2NYX A;  1SD7 A;  3W6K B;  2HYG D;  2NNN A;  2V1D A;  2VOD A;  1U5T A;  1L3L A;  2YU3 A;  1B9N A;  3FF5 A;  3CTA A;  3HSR A;  2IP2 A;  1FX7 A;  3BWG A;  4KNY A;  1ON2 A;  4HV6 A;  4YFK F;  3SHF A;  1IXS B;  4D0P A;  1GVJ A;  5LHG A;  3V7C A;  1G3S A;  1LDD A;  4K2E A;  2JPC A;  2HTJ A;  5CVV A;  2PLY A;  5HS8 A;  1KU9 A;  4P5O A;  2ACJ A;  3HYI A;  1MZB A;  5L3F A;  2QZ8 A;  5D5W B;  1O7L A;  2MC3 A;  2OBP A;  3GYH X;  4EV0 A;  1VTN C;  1I1G A;  1T6S A;  1FSH A;  2WC2 A;  2QLZ A;  1V4R A;  2NS0 A;  1KQ8 A;  2O0Y A;  5EEG A;  3MWM A;  3H92 A;  1Q1H A;  1R58 A;  4WXD A;  5FD5 A;  5K5O A;  2YX7 A;  3IKT A;  3FM5 A;  1KU7 A;  4OIQ F;  1D5V A;  1K79 A;  3DF8 A;  3MAJ A;  4AD9 A;  2ZBK A;  4A12 A;  1TQI A;  1RNL A;  1KYZ A;  2RVC A;  2CSO A;  3T0Y A;  2K4J A;  2KIU A;  3KP2 A;  2AXL A;  4MTD A;  2D45 A;  2VT3 A;  4GCV A;  5HVQ C;  3TO6 A;  4IRH A;  3ZMU A;  4M6X A;  3GFI A;  2RNJ A;  4NB5 A;  1G3T A;  3VOD A;  1S3J A;  1W5T A;  2VOO A;  4A0Z A;  2CFX A;  3TDZ C;  3SZP A;  4GO1 A;  1LNW A;  3BJ6 A;  1FBQ A;  5E1Z B;  3DPL C;  2W24 A;  4CHU A;  4KIB A;  4HDV A;  4L0Z B;  1KGS A;  3VFZ A;  4ENM A;  1ZN2 A;  3FMQ A;  3BZ6 A;  2G7H A;  3JAM Z;  2Q2E A;  1PUE E;  5E8G A;  1GHC A;  3QRF F;  4ZYG A;  4KMU X;  3N97 A;  3RI4 A;  1BJA A;  2KRF A;  2LKP A;  3DPT A;  4ON0 A;  3L2C A;  4S04 A;  1HW1 A;  1SMT A;  1FZP B;  3RKY A;  1XCV A;  5JR3 A;  3JSO A;  3R0A A;  2Z3Y A;  3TDU C;  2F5F A;  3QAH A;  2VBZ A;  4B09 A;  1BN5 A;  2F5D A;  3P9C A;  4IJA A;  3FXU A;  2FNA A;  2ELH A;  3QP5 A;  2DBB A;  1OYW A;  4IHT A;  1HQC A;  2JPB A;  1G3W A;  4YIF A;  5CVU A;  1S8N A;  2IJL A;  2UXN A;  5JVT A;  4HV5 A;  1T98 A;  1FOK A;  1FNN A;  3E5Q A;  3FMR A;  1ZYR F;  2HEO A;  1O3R A;  1RI7 A;  1TLH B;  4E70 A;  2L3D A;  4MEY F;  2UZK A;  3E6B A;  1YYV A;  1S7O A;  2ZME B;  2XHK A;  2O61 A;  5D4R A;  5ILS A;  3E6D A;  2QBY A;  3E5X A;  1P4W A;  2M5W A;  2P6T A;  3NQO A;  1MJA A;  2XKO A;  2P6S A;  3VEP A;  3T1B A;  4EJT A;  4UNO A;  1BIA A;  4I2O A;  4ESF A;  4TV7 A;  4ZZL A;  2HGC A;  2CO5 A;  1T2K A;  3Q9V A;  2V1U A;  5D5V B;  3F8M A;  3I53 A;  3KZZ A;  2Q0O A;  3DEU A;  4B8X A;  2VE9 A;  1W7P D;  4L18 B;  4A6D A;  5ICF A;  3LFK A;  3V7R A;  5LRS A;  4XLN F;  2MLK A;  1P2F A;  1Y0U A;  3H3Z A;  3FZV A;  5FFX A;  4HF1 A;  3K1P A;  4HA8 A;  5CJ9 A;  2PFB A;  3RPQ A;  2CG4 A;  2K86 A;  2JTV A;  2Z5U A;  3KCC A;  4U7D A;  2W25 A;  3IWF A;  3QPT A;  3C7J A;  5J8C A;  5AON A;  3MZH A;  1BC8 C;  4A0X A;  3RPU A;  3EUH A;  5FLX K;  2DI3 A;  1UHM A;  1I27 A;  5IT9 Z;  1KQ9 A;  3KEQ A;  3QOP A;  5EEH A;  5D6F A;  1HST A;  2O8X A;  1IW7 F;  2A07 F;  4BQA A;  1ZGJ A;  2LDU A;  1OKR A;  2VON A;  5BMZ A;  2W57 A;  4AWX B;  5FB2 A;  2R7D A;  3QP6 A;  2DK5 A;  2JZY A;  1IF1 A;  1CF7 B;  2H27 A;  4FT8 A;  2EA2 A;  4IPA A;  3ROU A;  4U0W A;  4HX8 A;  2HZT A;  1YTY A;  4EM2 A;  3RDI A;  1IRG A;  2M45 A;  1KYW A;  3JSP A;  5DUI A;  3QU3 A;  4L9T A;  2F5C A;  4U0Y A;  3HSE A;  4ETS A;  1T39 A;  4LLG F;  2ZO4 A;  1LDJ A;  5LEJ A;  1OPC A;  2P5K A;  4M9S A;  2ZFW A;  3AAF A;  2GIV A;  4R1H A;  3K69 A;  4EJV A;  1PP8 F;  1RUO A;  2UWM A;  1RIO H;  3MFK A;  1UFM A;  2CGP A;  3FXQ A;  2A3S A;  3I59 A;  4HX7 A;  3Q5F A;  1D8K A;  4UHT A;  2OA4 A;  2G7U A;  1J0R A;  1BI3 A;  4EJU A;  3CLO A;  5LRR A;  2A69 F;  2IRF G;  5K1Y A;  1HKQ A;  2OZU A;  5H20 A;  3M8F A;  1YO5 C;  4WWC A;  1HW2 A;  1ZRC A;  5L3B A;  2DFI A;  2FBK A;  2UXX A;  4BHB A;  1W7P B;  3KLO A;  3T8T A;  2P7V B;  4GYG A;  1FBS A;  1MD0 A;  3ABU A;  2D1V A;  2A5Y B;  2GXB A;  2HQR A;  4Q48 A;  4CZZ A;  3EQL F;  3HTS B;  3F6V A;  3TOA A;  4P9U A;  1ZHF A;  2XRN A;  4O5V A;  1IRF A;  3R0J A;  2K7L A;  4S05 A;  1SD6 A;  3BPV A;  4AVP A;  3HIF A;  1FYL A;  3BDD A;  3F8C A;  3RKX A;  2V6C A;  2XAS A;  4Z2Y A;  1R00 A;  1YLF A;  1J75 A;  3KP5 A;  3BPX A;  1BOA A;  4EM1 A;  2GA2 A;  3F21 A;  1U5T B;  4RB3 C;  5DD4 A;  3DV8 A;  5BPD A;  4KIG A;  3BRO A;  1EV7 A;  1G6N A;  5ED4 A;  3I54 A;  2NNY A;  1REP C;  2ZXJ A;  1FT9 A;  3P7N A;  1B6A A;  1AOY A;  1OYI A;  2DK8 A;  3H3U A;  2IW5 A;  1HBX G;  2FA5 A;  3LA7 A;  3GZ6 A;  3N4M A;  5BPI A;  3EYI A;  2EFP A;  5E18 F;  1A04 A;  3JTG A;  4WXH A;  4LG0 B;  5HS7 A;  2PI0 A;  5IT9 K;  2VBY A;  1IXR C;  2XAQ A;  4ASN A;  5DDG A;  1RZ4 A;  3RYR A;  4A0Y A;  2ZME A;  3SZT A;  2YSR A;  3I71 A;  4LMY A;  1ON1 A;  2DAO A;  1B4A A;  5AIP A;  1K78 A;  2LNB A;  1J7K A;  2NRA C;  1J5Y A;  2E1N A;  1UST A;  1WQ2 A;  4O6J A;  4CXF A;  1R5G A;  1O3S A;  1AWC A;  4ZZD A;  1LJ9 A;  4GXO A;  5FD6 A;  4PGG A;  2BGC A;  1W7P A;  3M8E A;  4R79 A;  4U0V A;  1ZRF A;  2MA3 A;  1W5S A;  4LB5 A;  4ZYH A;  2VOP A;  4LK0 F;  5F64 A;  2AS5 F;  3PFI A;  2BYV E;  4WF2 A;  4ESJ A;  2CQK A;  4UVB A;  4G8X A;  2Z99 A;  1IZ1 A;  1GXP A;  1TQP A;  4Q4Z F;  3R61 A;  1IN7 A;  2BV6 A;  5DUK A;  1WKM A;  4Y15 A;  4YII A;  4LB6 B;  4A5N A;  2DO7 A;  4MHG A;  3V8K A;  1LEB A;  5LHH A;  2EFQ A;  3WE3 A;  4ESB A;  4UVC A;  4HF2 A;  4CIC A;  4O3M A;  1O3Q A;  2Z9O A;  3U2R A;  3HRT A;  1SFX A;  5CVI A;  5E1W A;  3QPH A;  1YW8 A;  3ZMD A;  3NEU A;  2DLL A;  2E7X A;  4U88 A;  2JSC A;  3JTH A;  1IN5 A;  1K6O A;  2Y75 A;  5DCM A;  2LF8 A;  3RYP A;  4L9N A;  5D8L B;  3ZN0 A;  4IXA A;  1F5T A;  2HTS A;  2QVO A;  3MZY A;  1XMK A;  3F3X A;  3DP7 A;  1P6R A;  1HKT A;  3F72 A;  2QBY B;  3TOB A;  1BIB A;  2Q8K A;  3HRS A;  1IUY A;  2HYF A;  1R1T A;  3D5L A;  3COA C;  4AIJ A;  4HOB A;  2VN2 A;  1TNS A;  4RGR A;  1MDM A;  3TO9 A;  1DPR A;  3G3Z A;  2ZNY A;  1UB9 A;  2ZJ2 A;  4BHC A;  4M6Y A;  1LQ1 A;  4H0E A;  1R1U A;  5TRD A;  4XRF A;  1FYK A;  2KKO A;  3TQN A;  4EMS A;  1MKM A;  1R23 A;  5KVR A;  4I09 A;  4XLP F;  5ERI A;  1SMY F;  3MCZ A;  2KIM A;  4M74 A;  1FPQ A;  4U7B A;  3O2P E;  4OIO F;  4I98 B;  1U2W A;  1O3T A;  3WTT C;  3WTY C;  3JW4 A;  1Z7U A;  3ZPL A;  3C18 A;  4ZYE A;  3LST A;  4GGG A;  4HYE A;  4QWQ A;  1XGS A;  1YS7 A;  2EV5 A;  3O6B B;  1CGP A;  3ABT A;  3BJO A;  4CDG A;  1ZG3 A;  3KP6 A;  5J6X A;  5FO5 A;  4P9F A;  3FX3 A;  3GWZ A;  1P4A A;  2FNP A;  3W6J B;  2JT1 A;  3NRV A;  2KIF A;  2KJB A;  1QGP A;  3ZMV A;  2FMY A;  2VT2 A;  2FF4 A;  4F7Z A;  2HOE A;  2MD5 A;  1QO0 D;  1NHA A;  4ENK A;  2P4W A;  2LSO A;  2FQ3 A;  4YFN F;  6PAX A;  1Z6T A;  2OZ6 A;  3E5U A;  1HSJ A;  5KK1 A;  3Q9S A;  1H9G A;  3QU6 A;  3GW2 A;  4KFC A;  1CF7 A;  4HBL A;  4FX4 A;  3KET A;  4A5M A;  5D5X B;  3SXY A;  1SD4 A;  3K1N A;  2M30 A;  4IRI A;  2ESN A;  2LF7 A;  3DKW A;  2XAG A;  1I1S A;  1ZLK A;  3M7G A;  2V1X A;  3GVA A;  4L9J A;  1OMI A; 
#chains in the Genus database with same CATH topology
 1KA8 A;  2EQR A;  2PG4 A;  3JRB A;  1S29 A;  2LP0 A;  1XTA A;  2ZXI A;  4CH7 A;  4BXU A;  3A0H C;  3ERE D;  2EIK H;  3I59 B;  1JT6 A;  1RC9 A;  4EGY A;  4HLX A;  2DFF A;  1U3E M;  2DTR A;  1VQN I;  1JJ8 C;  1ZG1 A;  3BQY A;  2NOJ B;  3HGG A;  4IZZ A;  3GO5 A;  1YS6 A;  2P5L C;  3GF2 A;  3M1E A;  4ABZ A;  2R0Q C;  3FK6 A;  4MQ9 F;  1FLI A;  3P9I A;  1L0O C;  1Z67 A;  1X4P A;  2M4K A;  3WGH A;  3BG7 A;  1WWX A;  1R36 A;  1YRN A;  1S7A A;  2MGQ A;  4YIR X;  2O3F A;  2TDX A;  5F1J A;  3KFW X;  2C6Y A;  3HHH A;  3WG7 H;  5E3N A;  5CYV A;  4N0B A;  3CMY A;  4WK8 F;  3ZQ7 A;  3L2U A;  2L4M A;  2HXO A;  3HRU A;  5F6F A;  4BH9 A;  2L01 A;  3LQQ A;  3HDD A;  1XGO A;  2CWE A;  1FYM A;  5ILV A;  2COM A;  1Y8Q B;  1WRJ A;  4ANJ A;  3U9G A;  1B59 A;  3KZY A;  4E7Z A;  1TBX A;  3H36 A;  2B9S A;  3PO3 J;  4ENJ A;  5FFZ A;  2DDA A;  1XSX A;  3DXJ F;  3E3V A;  2XAF A;  1CQT A;  1D1C A;  2EZK A;  2JA6 J;  4F91 B;  3F8B A;  2R7Q A;  3LMM A;  5J4Y A;  5J4V A;  1BL0 A;  1GVD A;  4HQE A;  1P7J A;  3PM1 A;  2R7Z J;  3Q0W A;  4WXC A;  3I4N J;  4G7O F;  2JA7 J;  1X1A A;  4MGR A;  5BS6 A;  1ZLJ A;  1XB4 A;  1T0F A;  4YEJ A;  4ZDP A;  4HRI A;  1U9O A;  1J9I A;  2VC0 A;  2R5Y A;  4QIW N;  1D3Y A;  4G6D A;  1ZG5 A;  3DBL B;  4P1W A;  3MN2 A;  2I8D A;  4RAF A;  2FU4 A;  1V5F A;  2V79 A;  1BBY A;  2WV0 A;  2ZKZ A;  2H94 A;  4JX6 A;  4MFD A;  5FLM J;  2K4B A;  2V6E A;  4V19 K;  3PQJ A;  4M71 A;  2QF7 A;  5E20 A;  1K4T A;  1IDZ A;  2STT A;  2AQF A;  3CCM I;  1IN4 A;  3L09 A;  3PFY A;  5LGN A;  4RA2 A;  1MBH A;  3KX2 A;  2NAZ A;  1IGN A;  4Q5S F;  4B3A A;  3PO2 J;  3CO7 C;  2BVL A;  3OYM A;  2XF5 A;  2WTE A;  2XRO A;  1MMS A;  5A2Q K;  1ZGW A;  3BP8 A;  3NWS A;  4IEJ A;  3I0T A;  1UHS A;  5FKO A;  2V7F A;  2XB0 X;  5BOX A;  4FET A;  1SAX A;  2X0L A;  3NWT A;  1BI1 A;  1U9N A;  4L5J A;  4AUX A;  3K4J A;  2LLK A;  1FBU A;  3F23 A;  1IAW A;  2DPU A;  1B1B A;  3WTW C;  3J80 Z;  3ZCO A;  3WTV C;  2KT0 A;  4W97 A;  5GAH J;  3CD6 I;  1J2X A;  1BI2 A;  2AQE A;  1R5H A;  1VQ6 I;  1JTX A;  1IV8 A;  2QEN A;  2XVC A;  3V7S A;  1K83 J;  1X3U A;  1ZAO A;  2HQN A;  1T56 A;  4OIR F;  2H6C A;  1PUF A;  3SZG A;  4M3E A;  5GP9 A;  3V4G A;  2CQQ A;  2GWR A;  2R4G A;  3LSI A;  1ZK8 A;  3KIO A;  3RTR A;  4OMZ A;  2RAE A;  5IPA A;  2AHQ A;  2WWY A;  3E6M A;  2OU2 A;  2IT0 A;  5B1B H;  3KLN A;  1YJ9 I;  1ENH A;  1TW2 A;  3D1N I;  5HOD A;  2N8G A;  1V54 H;  1HOM A;  4J00 A;  1DP7 P;  1WSU A;  1G4D A;  1T38 A;  3ISP A;  3ZN1 A;  3K4N A;  3ZP5 A;  1LE8 A;  2XB5 A;  2E71 A;  2RGV A;  4BU2 A;  1FTZ A;  3CC4 I;  4JX5 A;  4CYC B;  3H0G J;  4XLE A;  3VYT B;  4RB0 A;  2ZCW A;  3CMA I;  2OD5 A;  4L9V A;  1KON A;  4M73 A;  1LFU P;  2XSD C;  1D1A A;  3MKY B;  1WZ2 A;  2DA1 A;  4B44 A;  3L00 A;  4AIH A;  1MGT A;  2FOK A;  3BCB A;  3OYF A;  2VC1 A;  1OR7 A;  4AU7 A;  1UJ8 A;  2K3P A;  2XGE A;  3EYY A;  3GFJ A;  1U8B A;  1W0U A;  4DJA A;  3CUQ C;  3ZOB A;  5LD2 C;  2ID6 A;  3HUG A;  4HAM A;  5HDN A;  2ME6 A;  3RZO J;  3I64 A;  2F5V A;  5DEQ A;  2CYY A;  1UG2 A;  2ECB A;  2ZJP F;  5JFR A;  2JN6 A;  2H1L A;  1GDT A;  4BBS J;  2MLG A;  1E2X A;  3CP2 A;  4A3K J;  1PP7 U;  4MO7 A;  2CUE A;  3E97 A;  3K9T A;  4E7I A;  3RKQ A;  1OJL A;  2HOS A;  2MC4 A;  3FXJ A;  1UMQ A;  4UB6 C;  3RQI A;  1EJ9 A;  3CO6 C;  1S5L C;  3IRQ A;  2HKO A;  1YFH A;  1PDN C;  3FBI B;  4RGU A;  1Y56 A;  1HC8 A;  4UB8 C;  1XD7 A;  2VE8 A;  4KMF A;  3MKZ A;  1KU2 A;  1F1Z A;  2GAU A;  4KUM A;  2QM3 A;  2RNG A;  1FMW A;  2EFO A;  3EDP A;  3SYT A;  4BXX J;  2X9D A;  4M3G A;  1JTY A;  4RGX A;  4CCN A;  2R3S A;  3HXL A;  1G3Y A;  5HLH A;  3ZMT A;  2FOW A;  4YEL A;  1PUF B;  5D6E A;  1T8I A;  2IGN A;  1U6G A;  1PYV A;  1X19 A;  4JP0 A;  1N77 A;  2QQA A;  4G6Q A;  2LK2 A;  3S3M A;  1H9T A;  2G9W A;  4LLL A;  3S1M J;  2JA2 A;  2EK5 A;  4QPO A;  2YUS A;  4NUB A;  4ZTF A;  4BBR J;  3UNG C;  4C3J J;  3ELK A;  5FKK A;  1U8R A;  2GXA A;  3NAR A;  2R7F A;  1XX5 A;  3HEF A;  4BUP A;  3TKY A;  2DOE A;  1Z6R A;  1MNM C;  1IUF A;  2VJI A;  4XMY A;  1IXC A;  4BQO A;  3GTP J;  1IDY A;  3KPH A;  3P9K A;  2M7A A;  1ONV A;  2YU9 J;  4Y17 A;  3K70 C;  4D7N A;  5K5R A;  1U78 A;  4IOA F;  1POG A;  3BCA A;  3K0L A;  1O7F A;  3F22 A;  3VWB A;  4OOI A;  4KIF A;  3F6O A;  1HDP A;  4QTR A;  3BLY A;  3J81 Z;  4ZJZ A;  4I0B A;  2DQR A;  3E6C C;  1ORK A;  4XK4 A;  4A3J J;  5K7H A;  4NC6 A;  5KAF C;  1WJF A;  1UAA A;  1MND A;  2WV1 A;  2VXZ A;  1Y8R B;  4CCO A;  1ACI A;  2PBI A;  2BE5 F;  2DJI A;  2H8W A;  3BY6 A;  3ERM A;  1IRX A;  1OYY A;  2JK3 A;  3SDB A;  3LSP A;  1XDU A;  2X4H A;  3DPU A;  2ISY A;  1Z77 A;  3EPZ A;  3OL3 A;  2MH9 A;  3G1O A;  2KQR A;  3FIW A;  2P8T A;  1WI9 A;  1C0W A;  4XLF A;  3AG4 H;  1RUN A;  3D0S A;  4A3M J;  1K7A A;  3OS2 A;  1P92 A;  4DYQ A;  4RAZ A;  5JLW A;  1GXQ A;  1IN6 A;  1WJA A;  1ZGA A;  1X1B A;  2DA4 A;  3Q0V A;  5BNG A;  3K2Z A;  3WTU C;  1M1E B;  4M6V A;  1R7J A;  1XCB A;  1BI0 A;  1DPU A;  4G94 A;  2EWN A;  5LGT A;  4PZJ A;  2PJR A;  5FLV A;  4A3D J;  5H2F C;  4KDP A;  1MBG A;  3S1N J;  2M0M A;  3WGG A;  2OC6 A;  4E7S A;  1TW3 A;  2ETH A;  4XBF A;  2E2I J;  3M8J A;  1I39 A;  2M9H A;  4UUV A;  4EEF G;  3J7Z I;  1H8A C;  1YW7 A;  3B73 A;  4J01 A;  4M9X A;  1YIJ I;  5E1X A;  5FGM A;  3AL0 C;  4EQQ A;  1X4O A;  3HRM A;  3OOU A;  1MMN A;  2PMH A;  3EET A;  5L3G A;  3ZMS A;  3OIP A;  4IRG A;  3K4L A;  3V8L A;  4X0G A;  2NOG A;  3FXL A;  3GUD A;  5IT3 A;  3IL2 A;  2L4A A;  1VQ9 I;  2VJJ A;  9ANT A;  5A2Q Z;  1NG6 A;  3ECO A;  3WU0 A;  5EG0 A;  1MJB A;  4UY8 I;  3OS0 A;  1Z0X A;  2KP6 A;  3FMS A;  2CW0 F;  4E6K G;  2GQQ A;  5CVJ A;  4WX9 A;  2OJE D;  3OYH A;  2DA3 A;  1DDN A;  1SAU A;  1WJE A;  3LOC A;  2Z16 A;  2PMZ N;  2VBX A;  3DU6 A;  3I58 A;  1JHH A;  1HKS A;  2O6G E;  1ZAR A;  4RB2 C;  3FM3 A;  4PGH A;  4L5I A;  3WGI A;  1H89 C;  2X1D A;  2X6X A;  3FKJ A;  4ZYD A;  5L3C A;  1OCR H;  1Z05 A;  3DQV C;  2QQB A;  1WH5 A;  4RM2 A;  5E3O A;  2DQL A;  2W4S A;  1SC7 A;  4HW0 A;  2BZT A;  3BOQ A;  1Z91 A;  3DTE A;  2LRE A;  3OYI A;  1K61 A;  2WAE A;  4YFX F;  1AKH A;  2K3F A;  1LB2 A;  2X6W A;  1XGM A;  2WAQ N;  4Q47 A;  2X1C A;  2HU9 A;  2O03 A;  4PCQ A;  1JE8 A;  4DGW B;  1JXS A;  5KHD A;  3FDY A;  1W4M A;  1S7E A;  1XSV A;  3OMY A;  3WTS C;  5HLI A;  3MKW B;  5EGO B;  2E2J J;  1IN8 A;  3G4S I;  3V8J A;  2E60 A;  4C3I J;  4FIS A;  2O7O A;  4I02 A;  4NHJ A;  2QCO A;  5IOZ A;  3F0C A;  3G6E I;  4KYW A;  2JRT A;  1S6L A;  1VF9 A;  2BBY A;  4HX4 A;  2MBF A;  4HG2 A;  3TW7 A;  4BEH A;  3CCQ I;  3WE2 A;  5HDK A;  3OSF A;  1USS A;  2X1E A;  3BR6 A;  3PUF A;  4UUS A;  2ID3 A;  3CCR I;  1BOB A;  1YIO A;  4UV8 A;  3ZQC A;  4LD5 A;  4MTE A;  2RQP A;  5DYM A;  3KYD B;  5BQT A;  4M72 A;  2ZXH A;  3S1R J;  4Z6Y A;  1SD5 A;  1SVO A;  3H1C A;  2GXG A;  3OYL A;  1FEX A;  2R5Z B;  1VQP I;  3LWF A;  4G12 A;  3K6G A;  2L7Z A;  3OY9 A;  2RDP A;  3HUG B;  2HR3 A;  4KT6 A;  4HZF A;  1O57 A;  2L54 A;  5F1R A;  1RES A;  2BY1 A;  2DW4 A;  3C2H A;  1ERD A;  2R7T A;  4N4N B;  2M4G A;  4BDY A;  1E3O C;  2A6H F;  1HF0 A;  2Y30 A;  3ML6 A;  4N9I A;  1J09 A;  4BAY A;  1UCR A;  3G71 I;  2HDW A;  2Z2S B;  1TL8 A;  2EBI A;  3MKL A;  4XM3 A;  1FMV A;  5ICE A;  5HLT A;  1LVA A;  4LOC A;  1IG7 A;  4AYB N;  5D8K B;  4OIN F;  2DU9 A;  3FKI J;  1D0Z A;  4FE7 A;  1NTC A;  1SVL A;  4EJW A;  3JRD A;  2EPF A;  2EJR A;  3IKV A;  2K9M A;  4DZP A;  2E1M B;  5HLG A;  1TTY A;  3DFG A;  1WGX A;  1QPI A;  4ZTJ A;  3A02 A;  2DYR H;  2H6B A;  3G1M A;  4BQN A;  1B8I A;  3FHN A;  1B72 A;  4CO8 A;  2ZNZ A;  3VYS B;  1EKE A;  1TC3 C;  3PNT A;  3QWL A;  4D7M A;  1BR1 A;  5JLX A;  2E1M C;  4XSX F;  3GLX A;  4IF4 A;  2E7W A;  2MH2 A;  2QQ9 A;  2R93 J;  2CV2 A;  1E0E A;  3K2A A;  1ULY A;  2COB A;  4KA4 A;  3WTZ A;  4XKB A;  4KN4 X;  4XRM A;  1T33 A;  1ODD A;  1QPM A;  2VAS A;  1XDS A;  2FBI A;  2W00 A;  1MMD A;  2FSW A;  4LFU A;  4LK1 F;  2DA5 A;  3F8N A;  5B3S H;  3J80 K;  4HNU A;  1GV5 A;  4A3B J;  3W2W A;  2LBF B;  2HVQ A;  3SFZ A;  4EM0 B;  3J81 K;  5LLQ A;  3CC2 I;  5CVR A;  4YG2 F;  5CQE A;  1YRN B;  1F9N A;  4XOP A;  3CDH A;  2CFO A;  3GZ5 A;  2HOA A;  4I01 A;  4BAC A;  1MBJ A;  4HF0 A;  5JI6 A;  2EV0 A;  4BL0 B;  3G73 A;  3HPH A;  3EUK L;  2MYS A;  4XIC A;  4B43 A;  1R5I D;  3R60 A;  2UUZ A;  5EEA A;  1Y6I A;  2BY0 A;  5HOO A;  3I3L A;  4BHP A;  2PQ8 A;  3FHZ A;  4UUS B;  2BVM A;  2H1K A;  1KQ0 A;  3E1S A;  3PNV A;  2XC7 A;  4IHS A;  4E7H A;  4LG0 A;  1A5J A;  2JRM A;  1LEA A;  3QOD A;  4W1U A;  2GLO A;  1VZ0 A;  1JGS A;  3PQK A;  1R22 A;  2VBW A;  1DUX C;  2PN6 A;  3HZJ A;  1D0X A;  5ICC A;  1HW5 A;  1EH6 A;  2WAD A;  3EUA A;  2E35 A;  3L7W A;  1ZR4 A;  4FHT A;  3GZN B;  4M9Z A;  1WCM J;  2JVG A;  1FY7 A;  4DOZ A;  3CUQ B;  2ADU A;  3GTL J;  1QQI A;  2Y0S N;  3M1C A;  4I7H A;  2NVX J;  2PJP A;  4DQ2 A;  1U5T C;  2XKP A;  2LOO A;  3RJP A;  5F0F A;  1B8I B;  3MMY B;  2Z33 A;  3PL8 A;  3OYB A;  1WJB A;  2QSH X;  2BW3 A;  2FRH A;  3FWE A;  4LG3 A;  4A3E J;  1DU0 A;  3OOP A;  2W7N A;  1R9T J;  1V3F A;  2QWW A;  2XF7 A;  2XUB A;  3HKZ A;  4D9J A;  4IOC F;  2ZSI B;  2OUM A;  2F5E A;  2M8E A;  3TW6 A;  1FC3 A;  4E7K A;  2RV8 A;  1T08 B;  3RCO A;  2DMT A;  4DNC A;  2GZW A;  5CQG A;  1HLV A;  1AA7 A;  3RQ4 A;  3CUO A;  2EZL A;  3GXO A;  2R7U A;  3WG9 A;  4DYR A;  2HWV A;  4OWR B;  1R71 A;  5K5Q A;  5E17 F;  1DP3 A;  3GCM A;  3SQN A;  1SFE A;  1A31 A;  2IA1 A;  2GA1 A;  4XNF A;  3IAM 2;  5J1R A;  3WOD F;  1VI0 A;  3VPR A;  3JAM K;  2RRE A;  2A6E F;  5EYR A;  2VLA A;  3I4P A;  4EGZ A;  1ZRE A;  3MEX A;  2P7C B;  4Y13 A;  3REO A;  1TNT A;  3K1M A;  3HBL A;  1W36 C;  5D4S A;  1BA5 A;  4C2T A;  1B9M A;  3D5R C;  2QA4 I;  4JBA A;  3RIR A;  3BTJ A;  1ZH5 A;  2F4M B;  2VB6 A;  2CQN A;  1N78 A;  3FXK A;  2FML A;  5AIQ A;  2CW8 A;  4E7J A;  3GTO J;  2ZJR F;  2CJJ A;  4I99 C;  2DPD A;  3HTU A;  4XN3 A;  4BNC A;  3R4K A;  4IVN A;  5DCM B;  4BEH B;  3X2Q H;  4UVA A;  5HDG A;  4L0Y B;  2WAQ A;  2X85 A;  3BJA A;  3CP8 A;  3FXR A;  1KU3 A;  4HQM A;  3U1D A;  1R4N B;  3KE2 A;  5E8I A;  3HOS A;  1I5Z A;  1QZZ A;  4X6A J;  4PK4 A;  2M2E A;  2PMU A;  1EH8 A;  2HYJ A;  2MSY A;  1E3H A;  2K27 A;  4WCG A;  2RQQ A;  3OYD A;  1RR8 C;  2XAH A;  3BG9 A;  2BEO A;  2IXS A;  3R6S A;  3VB2 A;  5FLX Z;  4RAY A;  3A1Y A;  4RGS A;  3AFH A;  3V42 A;  5F08 A;  1MW7 A;  2DXI A;  5EDN A;  2Y48 A;  3S32 A;  2M87 A;  1LVK A;  2VQL A;  3WU1 B;  1QBJ A;  1YHQ I;  2VKD A;  3DEE A;  5LEK A;  1S9H A;  1EA3 A;  1Z1D A;  1YW9 A;  4P96 A;  5TJJ A;  3I56 I;  4G7H F;  2F2E A;  1MDM B;  2HFH A;  4LLN A;  4BXF A;  3PSI A;  3O3K A;  3QYF A;  4BYY A;  2OQR A;  3HSF A;  2J5P A;  2XV4 S;  2BY2 A;  2WBM A;  5J1U A;  5H6R A;  3I5U A;  3GFM A;  5DM7 F;  4IHW A;  5DD8 A;  4PJN A;  3J7A O;  3CJT B;  1FP1 D;  2IA2 A;  4MNU A;  4OU0 A;  5L3D A;  2YX4 A;  2IVM A;  2VKE A;  4LIU A;  2WAF A;  4ZH4 F;  4PDK A;  4XSZ F;  2E1C A;  2CMP A;  3DLA A;  4MEX F;  1YJN I;  1MIJ A;  2A05 A;  1WJC A;  1APL C;  5LFA A;  3BTC A;  3L1P A;  1OCT C;  2DMP A;  3OV8 A;  2K02 A;  3LSM A;  1V5G A;  4HNT A;  5ILU A;  3E0J B;  4A69 C;  5J8F A;  3IHU A;  3KP7 A;  2Y2Z A;  1Z9C A;  5JVG F;  3LA3 A;  2W84 A;  4DYC A;  2Y9Z A;  2FXA A;  2L02 A;  4IQ4 A;  2HS5 A;  1YG2 A;  3GX4 X;  2LKX A;  3S2H J;  4P55 A;  5E3M A;  1UHW A;  1UZC A;  4N9H A;  2XF6 A;  4CZC A;  1TQM A;  1MMG A;  5J40 A;  1Y1V J;  3S2W A;  5LHI A;  2OAZ A;  3MQ0 A;  1V55 H;  4PJJ A;  4KIC A;  4NQW A;  1ETQ A;  1H0M A;  4CYD A;  2HKX A;  1VND A;  2K5C A;  2ZB9 A;  1NH3 A;  4OIP F;  5C3E J;  4FX0 A;  2R92 J;  2R7R A;  1GLN A;  5IYC J;  1XSD A;  5D5U B;  2HDC A;  1MJ9 A;  1FP2 A;  2HQ5 A;  4E7L A;  3GEZ A;  1BC7 C;  1X1D A;  3OSG A;  1K78 B;  3IRR A;  4KN7 X;  4IO9 F;  3CCE I;  3IWZ A;  2NXN B;  1XGN A;  4GYI A;  5DV5 A;  5FKN A;  2DCE A;  3TL4 X;  1ZRD A;  3ZMZ A;  1LFP A;  1XN7 A;  5FKL A;  1HXD A;  1JKP C;  1QNT A;  2PEX A;  1YOV B;  5L3E A;  5GPC A;  4LGW A;  2Y0M A;  4RB1 A;  2EFW A;  4ZYA A;  2BXZ A;  4FE4 A;  2Q2E B;  3IC7 A;  3HOT A;  2EB7 A;  1J59 A;  1WJ5 A;  2JUG A;  1YI2 I;  2EFN A;  4JX4 A;  3KP3 A;  2O8K A;  3HOU J;  2OQG A;  4MQV A;  3K4C A;  3B02 A;  2NS7 A;  3C1D A;  3H9G A;  3OIO A;  2P5V A;  1OQY A;  3TGN A;  4EVI A;  4HLY A;  4XL9 A;  1F4K A;  5CLS A;  1E17 A;  2DT5 A;  2RC4 A;  2LMD A;  3DTI A;  4F93 B;  4D1Q A;  2CUZ A;  3LAP A;  2XAJ A;  2ISZ A;  2H09 A;  2D2W A;  1QZY A;  4F52 A;  2A61 A;  3BTI A;  2IS4 A;  2NVY J;  4C2M J;  3L2Q A;  3A2K A;  1HDD C;  1LDK B;  4EJO A;  4S0H B;  2FBH A;  1VFC A;  2IPQ X;  3F8F A;  1K6Y A;  3RKW A;  1D8J A;  4HDU A;  1EH7 A;  1TWH J;  2OTL I;  4RDU A;  4AID A;  2STW A;  4G7Z F;  2YPR A;  2X48 A;  1FSE A;  2RKH A;  4KT5 C;  2M1B A;  2V9K A;  3HHG A;  2XPU A;  4R8H A;  3ZQG A;  4A6E A;  4QSH A;  2ZME C;  1VQ4 I;  1ZTR A;  3KP4 A;  4A3F J;  2LTP A;  4IHY A;  2QUF A;  2XGD A;  3NAU A;  2V9V A;  3OYA A;  4JYK A;  1YQA A;  2HZD A;  2YR2 A;  2F4O B;  2XPV A;  3GFL A;  3TO7 A;  5FRN A;  1FWZ A;  3C3W A;  4RS8 A;  2A6T A;  5LBQ A;  4II2 A;  1OIS A;  2FE3 A;  2K9Q A;  3MZ8 A;  3BQZ A;  4ENN A;  2VKV A;  3DKX A;  4UXN A;  1WI3 A;  1P9Q C;  5H6Q A;  3ULQ B;  5ICG A;  2D1H A;  1QRY A;  4JK1 X;  2MFZ A;  1SVM A;  2EV6 A;  4CGZ A;  3M9A A;  3VOE A;  4AIK A;  2I10 A;  2XGX A;  3J7A Y;  2VPR A;  3HGY A;  1BM9 A;  4I0A A;  4LJZ F;  2ZJQ F;  3C2B A;  4IQJ A;  2KLO A;  5DCF A;  3LSH A;  3GLL A;  2LY9 A;  5F27 A;  5TIS C;  1XMA A;  2DA6 A;  4JOM A;  3LFU A;  3Q0U A;  2XIG A;  1OCC H;  2J5O A;  1BR4 A;  4UV9 A;  2A68 F;  3ECH A;  3S2D J;  1JHF A;  2E5Z A;  3JRF A;  2B0L A;  4A2U A;  2CH0 A;  1X1C A;  3KEO A;  3WTX C;  2IA0 A;  1I6X A;  3CZ6 A;  3DLL F;  4I76 A;  2FEZ A;  3T8R A;  4OMY A;  4XQF A;  1F36 A;  4A3C J;  3LAJ A;  1G2H A;  2MAB A;  2ESH A;  2EH3 A;  2QYO A;  4KJZ A;  2KJC A;  1SFU A;  3DEW A;  4JQF A;  1STZ A;  3HB9 A;  2EA4 A;  5JHU A;  3T5X A;  4CCK A;  2W85 A;  3S15 J;  3IV5 A;  2ELJ A;  3CUQ A;  2NVQ J;  5LGU A;  2ELK A;  5HS9 A;  1P4X A;  3L9F A;  4M3B A;  4QLC U;  4XKW A;  2RN7 A;  2L2O A;  4G9Y A;  1R1V A;  3LA2 A;  5F0H A;  3LQR A;  1YJW I;  3VYU B;  3CJN A;  3ONQ A;  2NYX A;  1SD7 A;  3W6K B;  2HYG D;  2NNN A;  2LKS A;  2V1D A;  2HPM A;  2VOD A;  2HXI A;  3JRG A;  1U5T A;  2IAI A;  4BJT A;  2OCE A;  1L3L A;  4B48 A;  2YU3 A;  1B9N A;  1W5C C;  3FF5 A;  3CTA A;  3HSR A;  2IP2 A;  3BR2 A;  4H4K C;  3LNQ A;  1FX7 A;  3BWG A;  1BW6 A;  1MSE C;  3M4O J;  2L7F P;  4KNY A;  3BTL A;  1ON2 A;  2TRT A;  4HV6 A;  4YFK F;  3SHF A;  1IXS B;  3KZI C;  4D0P A;  3H9J A;  1GVJ A;  1W36 D;  2B63 J;  5LHG A;  2JVH A;  4V2G A;  3V7C A;  3DKY A;  5KCM A;  3OWT A;  1G3S A;  3JRI A;  1LDD A;  4K2E A;  2JPC A;  2HTJ A;  5CVV A;  2PLY A;  1T0F C;  3JCU C;  3CF2 A;  5HS8 A;  1KU9 A;  4P5O A;  3HOX J;  2ACJ A;  3HYI A;  1MZB A;  2QQ8 A;  5L3F A;  2QZ8 A;  2JA5 J;  5EF6 A;  5D5W B;  1O7L A;  4DBQ A;  2MC3 A;  4U87 A;  3H5N A;  2OBP A;  2IS1 A;  3KEY A;  3GYH X;  4EV0 A;  1VTN C;  2JMW A;  4XKC A;  4CCL A;  1I1G A;  2KZG A;  1T6S A;  2EZH A;  1FSH A;  1X2N A;  2KDO A;  2BW3 B;  3OYJ A;  1FOX A;  2WC2 A;  3L2R A;  3J7Y J;  2QLZ A;  2QSF X;  1V4R A;  2HVR A;  3JRA A;  2NS0 A;  2WY7 Q;  4GDF A;  4XLH A;  4L5E A;  1KQ8 A;  1MBK A;  2O0Y A;  5EEG A;  3SEZ A;  3MWM A;  3H92 A;  1Q1H A;  1R58 A;  3H0D A;  4WXD A;  4PJM A;  5FD5 A;  4D5C A;  5EJC A;  5K5O A;  2YX7 A;  2BOL A;  1KZH A;  3IKT A;  3FM5 A;  3FIS A;  1KU7 A;  4OIQ F;  2CW7 A;  3CES A;  1D5V A;  1K79 A;  3DF8 A;  2EIN H;  3MAJ A;  4AD9 A;  2MD0 A;  2ZBK A;  2L7K A;  4C2U A;  5EZH A;  5C4X J;  5JHF A;  3H5R A;  2OCC H;  2E19 A;  3BG3 A;  1WJD A;  4A12 A;  1UG0 A;  1JKR C;  2Y31 A;  1TQI A;  1RNL A;  1KYZ A;  2RVC A;  2CSO A;  3T0Y A;  2KL4 A;  4B1R A;  2K4J A;  3IH3 A;  2ZXW H;  4IHV A;  2KIU A;  3KP2 A;  1YE9 A;  5B5E C;  1IO2 A;  1G59 A;  1YX3 A;  1FIA A;  4M3F A;  2AXL A;  4MTD A;  2D45 A;  3LSJ A;  1JUM A;  2HOT A;  2W1O A;  3CCJ I;  2VT3 A;  1QHH D;  4GCV A;  5HVQ C;  4PFO A;  1OCO H;  3TO6 A;  3QPL A;  2PX9 A;  4IRH A;  1TT0 A;  5GTH C;  4NQW B;  5FRO A;  3ZMU A;  4M6X A;  3GFI A;  1TWC J;  2KRH A;  2RNJ A;  4Y3O A;  4BJ6 C;  1Z3Y A;  2X51 A;  5GAG J;  1G8X A;  5EGO A;  1UEL B;  4RLF A;  4NB5 A;  1DQU A;  4BGD A;  1G3T A;  3VOD A;  3QYE A;  2M3A A;  1S3J A;  1S72 I;  2CRG A;  3RZD J;  1W5T A;  1D0Y A;  2VOO A;  2KRC A;  3SDG A;  2DOD A;  4A0Z A;  4DW6 A;  3DU5 A;  3D5S C;  4HST A;  2CFX A;  3TDZ C;  3CCL I;  3SZP A;  4GO1 A;  1LNW A;  3BJ6 A;  1FBQ A;  5E1Z B;  3DPL C;  2W24 A;  4CHU A;  2WY8 Q;  3ABK H;  4ZC3 A;  4KIB A;  2LVS A;  4HDV A;  1GUU A;  4L0Z B;  2LR8 A;  1KGS A;  3VFZ A;  1RR7 A;  4ENM A;  1NK2 P;  1ZN2 A;  3FMQ A;  3BZ6 A;  3K7A J;  2VL8 A;  2VUM J;  2G7H A;  4FCY A;  3JAM Z;  4FQG A;  2Q2E A;  3VYR B;  1PUE E;  3CJQ B;  5E8G A;  1GHC A;  3QRF F;  3CCY A;  2VKH A;  4ZYG A;  4KMU X;  3N97 A;  3RI4 A;  3M3Y J;  1Y0N A;  1BJA A;  3GTK J;  2XAU A;  2KRF A;  2LKP A;  3OYK A;  3DPT A;  4ON0 A;  3L2C A;  4S04 A;  1HW1 A;  2R5Z A;  2LRD A;  3S8P A;  1SMT A;  1FZP B;  3A01 A;  1PVE A;  3RKY A;  1XCV A;  3CDL A;  5JR3 A;  2VPL A;  3JSO A;  3R0A A;  2Z3Y A;  3TDU C;  2F5F A;  3QAH A;  4PJL A;  3KYL A;  2F48 A;  2M8G X;  1RRJ A;  3ZQH A;  1VQL I;  2VBZ A;  2L0K A;  4B09 A;  3W3C A;  1BN5 A;  1LUJ B;  2ZSH B;  1VQO I;  2DOA A;  2F5D A;  3P9C A;  4RLQ A;  1T95 A;  4IJA A;  3DBR B;  3FXU A;  2W82 A;  2FNA A;  2KIS A;  4X1E A;  2ELH A;  3QP5 A;  1VQ7 I;  2DBB A;  3S14 J;  1OYW A;  4IHT A;  1HQC A;  1Z3X A;  1SFK A;  3FBN B;  2JPB A;  1G3W A;  1W1W E;  3HG9 A;  4YIF A;  3L2W A;  1QU3 A;  3BG6 A;  5CVU A;  1S8N A;  2CQX A;  2IJL A;  4B47 A;  3W2A A;  2UXN A;  3L2V A;  5JVT A;  1D5Y A;  4HV5 A;  4AYB A;  1AKH B;  1T98 A;  5FKM A;  1FOK A;  1FNN A;  3S17 J;  2QKL B;  3E5Q A;  3FMR A;  5DS9 A;  1TP4 A;  2BXY A;  1OCZ H;  2HDD A;  3GTG J;  1ZYR F;  5CKT A;  2HEO A;  2KFD A;  1O3R A;  1RI7 A;  1TLH B;  4E70 A;  3OYG A;  5IP9 J;  1JKQ C;  2L3D A;  4ZDL A;  4MEY F;  2QSG X;  1H88 C;  1N25 A;  2GOM A;  2UZK A;  2XGC A;  3E6B A;  1Y1W J;  1YYV A;  3ZRG A;  1RPW A;  1S7O A;  2ZME B;  3UKG A;  2XHK A;  1MBF A;  5DM6 F;  2O61 A;  1HA8 A;  5D4R A;  5ILS A;  4Y7N J;  3E6D A;  2QBY A;  3E5X A;  1BW5 A;  1RKT A;  1P4W A;  2M5W A;  2P6T A;  3IAS 2;  3NQO A;  5K7Z A;  1MJA A;  2W48 A;  2CS3 A;  2XKO A;  2P6S A;  3VEP A;  4FAS D;  3T1B A;  4EJT A;  4UNO A;  5B66 C;  3FXM A;  4BS9 A;  2CQ7 A;  1BIA A;  2KIQ A;  1OLT A;  2DA7 A;  5C44 J;  4I2O A;  4ESF A;  1JUP A;  4TV7 A;  1X1P A;  4ZZL A;  2HGC A;  2R5Y B;  2CO5 A;  4A3G J;  1T2K A;  3CC7 I;  3CDI A;  3BR1 A;  1XS9 A;  4BY7 J;  3Q9V A;  2V1U A;  4GFB A;  3ZGK A;  2PJR B;  3CCU I;  2DDB A;  3P5J A;  3PIP F;  1OCP A;  4CUG A;  3VDX A;  5D5V B;  4G6T B;  5CPR B;  3F8M A;  2QEX I;  2JQ7 A;  3I53 A;  4KIS A;  3KZZ A;  2Q0O A;  3DEU A;  4B8X A;  2VE9 A;  1W7P D;  4L18 B;  2R7O A;  1GT0 C;  4A6D A;  2LD5 A;  2UV1 A;  5ICF A;  4CA0 A;  4MIM A;  2HI3 A;  3LFK A;  1ITY A;  3BC8 A;  3O8G A;  3V7R A;  3RSN A;  5LRS A;  1RKW A;  4XLN F;  1JT0 A;  3IUO A;  4NDL A;  1ZEL A;  1P7I A;  2MLK A;  1P2F A;  1Y0U A;  3S3O A;  3H3Z A;  4XLA A;  3FZV A;  5FFX A;  1YIT I;  4HF1 A;  2E5N A;  3K1P A;  5M5Y J;  2O5R A;  1JI8 A;  3HOV J;  3BT9 A;  4HA8 A;  3FXO A;  2PFB A;  5CJ9 A;  3RPQ A;  2CG4 A;  4FTH A;  3SJM A;  5IP6 A;  2K86 A;  3AKZ A;  2DYS H;  4DIQ A;  3GTQ J;  2JTV A;  2Z5U A;  3KCC A;  4F92 B;  2XPW A;  2VXD A;  2EIL H;  1A35 A;  3HOY J;  2M34 A;  4U7D A;  3QPS A;  2W25 A;  3IWF A;  4A3L J;  3QPT A;  3C7J A;  5J8C A;  5AON A;  4XR6 A;  5M3M J;  3MZH A;  1BC8 C;  4A0X A;  3RPU A;  5GPA A;  2WB1 A;  1IC8 A;  2FJ1 A;  3EUH A;  2VJ4 A;  5FLX K;  2DI3 A;  3DTK A;  5C4J J;  1UHM A;  1I27 A;  2KDZ A;  5IT9 Z;  1KQ9 A;  3OL4 A;  1IJW C;  3KEQ A;  5EZG A;  3QOP A;  4DBR A;  2L9R A;  4Y52 J;  5EEH A;  5D6F A;  1HST A;  1GV2 A;  3HKZ N;  4OAY A;  4NC8 A;  5IP7 J;  5K7F A;  2O8X A;  2XSJ C;  4YRV A;  1IW7 F;  1QVT A;  1AU7 A;  2BHZ A;  1TWA J;  2X6Y A;  3A0B C;  5M3F J;  2B7E A;  5IYB J;  4XLC A;  2A07 F;  4BQA A;  1ZGJ A;  2LDU A;  1OKR A;  4HPQ A;  2DT6 A;  2VON A;  5BMZ A;  2W57 A;  4F55 A;  3ESW B;  4LIV A;  4AWX B;  1IRZ A;  5FB2 A;  2DOF A;  4MLO A;  2R7D A;  3QP6 A;  2DK5 A;  2JZY A;  3SFI A;  1IF1 A;  1CF7 B;  2H27 A;  4FT8 A;  3F9K A;  2EA2 A;  4IKF A;  2V9P A;  4OAZ A;  2QGU A;  3A03 A;  4IPA A;  3ROU A;  4U0W A;  4HX8 A;  3DCF A;  2HZT A;  1WHU A;  5E3L A;  3U1K A;  1YTY A;  4EM2 A;  3RDI A;  3CCS I;  3M07 A;  1IRG A;  5TGT A;  2M45 A;  3H3V K;  4PUS A;  2VIX A;  4E4H A;  3UR3 C;  1KYW A;  4HNV A;  3AL0 B;  4Y33 A;  4XID A;  2A5W A;  3JSP A;  5DUI A;  3QU3 A;  3A01 B;  4L9T A;  2F5C A;  4U0Y A;  1ETX A;  3HSE A;  4ETS A;  1T39 A;  2I5U A;  4LLG F;  2JJ7 A;  2ZO4 A;  1LDJ A;  1WFX A;  5LEJ A;  1MH4 A;  2Y0S A;  1OPC A;  2MG4 A;  2P5K A;  3JRH A;  1R4M B;  4M9S A;  2ZFW A;  3AAF A;  2GIV A;  5FJ8 J;  1LFB A;  1N75 A;  4R1H A;  3K69 A;  4EJV A;  1PP8 F;  1RUO A;  2UWM A;  1RIO H;  3MFK A;  1UFM A;  2Q1Z B;  3QYB A;  2IGK A;  3K70 D;  2CGP A;  3FXQ A;  5HNH A;  2A3S A;  3ZQL A;  3I59 A;  4HX7 A;  3Q5F A;  4KIT B;  1D8K A;  4UHT A;  1PJR A;  2OA4 A;  2G7U A;  1J0R A;  1BI3 A;  3S93 A;  3CLO A;  4EJU A;  5LRR A;  4IHX A;  2A69 F;  4ZDO A;  2IRF G;  3VSL A;  4J19 A;  5B1A H;  2O9L A;  5K1Y A;  1HKQ A;  2OZU A;  5H20 A;  2FX0 A;  3M8F A;  1YO5 C;  4WWC A;  1I3Q J;  1ZR2 A;  4BE0 A;  3CF5 F;  2IBD A;  1HW2 A;  3HPG A;  3I9V 2;  1JUS A;  1ZRC A;  5L3B A;  1I50 J;  2DFI A;  2DFE A;  2FBK A;  2MW8 A;  2UXX A;  4BHB A;  1W7P B;  4AC0 A;  3KLO A;  3T8T A;  4C30 A;  2P7V B;  4GYG A;  2Z1D A;  1FBS A;  5DTD A;  1MD0 A;  4XON A;  3HC7 A;  3ABU A;  2D1V A;  2R7X A;  2IS2 A;  2A5Y B;  2GXB A;  1WPK A;  2R7S A;  2HQR A;  4Q48 A;  4RM3 A;  4CZZ A;  3EQL F;  3HTS B;  5IY5 H;  3TED A;  3CQZ J;  3F6V A;  3TOA A;  3LSG A;  2ZFU A;  5J47 A;  2CV0 A;  3PNY A;  2BHY A;  2AXT C;  1ZQ3 P;  4P9U A;  1ZHF A;  3WHB A;  2XRN A;  1QVU A;  2IGO A;  3OYC A;  4XOT A;  4XOR A;  4O5V A;  1IRF A;  4D5F A;  1NK3 P;  3R0J A;  2K7L A;  2Y69 H;  1SD6 A;  3BPV A;  2GOX B;  4S05 A;  4AVP A;  1OR7 C;  1ETO A;  3HIF A;  3FK7 A;  1FYL A;  1JJ6 C;  3BDD A;  1XG1 A;  3F8C A;  3RKX A;  3DWL E;  5HNF A;  2CUF A;  2VQH A;  1ZKG A;  2V6C A;  2XAS A;  4Z2Y A;  2QKM B;  1VQ5 I;  4V2F A;  1R00 A;  1YLF A;  4N4O B;  1J75 A;  3GTM J;  3KP5 A;  4BJ5 C;  3HL2 A;  3B6C A;  3WHC A;  4C3H J;  2GIZ A;  1BOA A;  3BPX A;  2GA2 A;  4EM1 A;  1W0T A;  3HOW J;  3F21 A;  1U5T B;  4RB3 C;  5DD4 A;  3DV8 A;  5BPD A;  1A36 A;  2R7V A;  4KIG A;  2ME0 A;  3BRO A;  1EV7 A;  3W6V A;  1G6N A;  5M5W J;  1FTT A;  5ED4 A;  1JGG A;  3I54 A;  2DMU A;  3N05 A;  1X2M A;  2NNY A;  1REP C;  1ETK A;  1V5E A;  2LY2 A;  2ZXJ A;  3OR1 C;  2E1O A;  1FT9 A;  4RAG A;  3ZQQ A;  1ETY A;  2FQ4 A;  3P7N A;  1B6A A;  2CV1 A;  1AOY A;  4I6Z A;  1OYI A;  3OYE A;  3JRE A;  2DK8 A;  3H3U A;  2IW5 A;  4IX7 A;  4XRS A;  2YS9 A;  3OS1 A;  1HBX G;  2FA5 A;  1MMA A;  3LA7 A;  3GZ6 A;  3N4M A;  5BPI A;  2KHM A;  4CCJ A;  3EYI A;  1X58 A;  1A6Q A;  4NBQ A;  2EFP A;  5E18 F;  3K10 A;  1A04 A;  3JTG A;  4WXH A;  3CMM A;  3MVP A;  4LG0 B;  5HS7 A;  2PI0 A;  1YX5 A;  1DGR M;  2L5Q A;  4BE2 A;  5IT9 K;  2VBY A;  3CCV I;  2H8R A;  1IXR C;  2XAQ A;  4ASN A;  5DDG A;  1O4X A;  1RZ4 A;  3RYR A;  4A0Y A;  2ZME A;  3SZT A;  3BZK A;  2YSR A;  3I71 A;  4LMY A;  1ON1 A;  2DAO A;  2GBY A;  1B4A A;  1XPX A;  5AIP A;  2WA0 A;  2P81 A;  5EG0 B;  1XC5 A;  2X6O A;  1K78 A;  3S16 J;  2K85 A;  2LBF A;  5IOY A;  2L7M P;  2LNB A;  1J7K A;  2NRA C;  1J5Y A;  2E1N A;  1UST A;  1MH3 A;  1WQ2 A;  2G0E A;  3BR0 A;  2JA8 J;  4LIT A;  1Y39 A;  3PUB A;  4O6J A;  5GAD J;  4CXF A;  4B4C A;  3Q3S A;  1R5G A;  1O3S A;  1AWC A;  2AO9 A;  1MNE A;  4ZZD A;  1LJ9 A;  2KZV A;  4GXO A;  2VJ5 A;  3S1Q J;  5FD6 A;  4PGG A;  2BGC A;  2P0W A;  3BG5 A;  4UUT A;  1VQ8 I;  1W7P A;  4AM3 A;  5FRM A;  2E36 A;  3M8E A;  2DT7 B;  3OIQ A;  4R79 A;  1B72 B;  4U0V A;  1ZRF A;  2MA3 A;  1FIP A;  2EZI A;  1D1B A;  1W5S A;  4LB5 A;  4ZYH A;  1I6H J;  2VOP A;  2BY3 A;  3BZC A;  4LK0 F;  2DMN A;  5F64 A;  2AS5 F;  2DN0 A;  2LC2 A;  3PFI A;  2BYV E;  4WF2 A;  2D5V A;  2FD5 A;  3ZXS A;  4ESJ A;  2HNH A;  2CQK A;  2F4I A;  4UVB A;  1Q1V A;  2M0C A;  3TP3 A;  3EUH C;  4G8X A;  2Z99 A;  3AG2 H;  1VQM I;  3E7L A;  1IZ1 A;  3CME I;  2KMU A;  1TQP A;  1GXP A;  1E3P A;  4Q4Z F;  3R61 A;  4PJ0 C;  1XMX A;  2HPI A;  1IN7 A;  2LY1 A;  2NS8 A;  3SEQ A;  2FUG 2;  3W2V A;  3HJE A;  2DTZ A;  2BV6 A;  2ECC A;  1MSF C;  1QZE A;  3K4K A;  2PMZ A;  5DUK A;  1WKM A;  4Y15 A;  3TMO A;  4YII A;  1BR2 A;  2ICW G;  1SAN A;  2V4J C;  2EIM H;  4LB6 B;  4NNJ A;  4A93 J;  4BKX A;  4A5N A;  2DO7 A;  4M3D A;  3QOE A;  4RMN A;  4MHG A;  3V8K A;  2E2H J;  1ETV A;  2LFB A;  1TZL A;  3JRC A;  4CCM A;  4BDZ A;  1LEB A;  4CYC A;  5LHH A;  2EFQ A;  3K4M A;  3WE3 A;  2V26 A;  4NC7 A;  3S3N A;  4DZJ A;  2OTJ I;  2IGM A;  3DBH B;  3O8H A;  4ESB A;  2DA2 A;  4UVC A;  4HF2 A;  4XN0 A;  1FOW A;  3LL7 A;  2OF7 A;  4CIC A;  1O3Q A;  4O3M A;  2Z9O A;  3U2R A;  2IEK A;  2R7W A;  3HRT A;  3GTJ J;  1SFX A;  5CVI A;  5E1W A;  3QPH A;  1QHG A;  3LSR A;  3PIO F;  1YW8 A;  3ZMD A;  2CUJ A;  3NEU A;  4GRI A;  4A3I J;  2GM4 A;  2DLL A;  2E7X A;  1DU6 A;  2E34 A;  4U88 A;  2JSC A;  3JTH A;  1IN5 A;  1R49 A;  1K6O A;  1A6I A;  4F3Q A;  2Y75 A;  5DCM A;  2K9N A;  1DGW Y;  2LF8 A;  3RYP A;  4L9N A;  4XKV A;  3G1L A;  5D8L B;  4PSX A;  2NVT J;  3ZN0 A;  4IXA A;  1F5T A;  1X3W B;  2HTS A;  1JKO C;  1FOY A;  2QVO A;  3MZY A;  3IH4 A;  1XMK A;  3F3X A;  1VQK I;  3DP7 A;  1QA6 A;  1P6R A;  4PSW A;  1HKT A;  2DJN A;  3ABM H;  2VQC A;  3F72 A;  3OYN A;  5KNL A;  3C2G A;  2CU7 A;  3HM5 A;  1U0J A;  2QBY B;  2XDV A;  2TCT A;  3TOB A;  1BIB A;  3CJR B;  2Q8K A;  3HRS A;  1IUY A;  2LH9 A;  5J1Y A;  2HYF A;  4XRS G;  1R1T A;  1WH7 A;  3D5L A;  2L9S A;  3COA C;  4AIJ A;  4HOB A;  2VN2 A;  3B6A A;  5E79 C;  1TNS A;  4RGR A;  1MDM A;  1I3A A;  4AVZ A;  3TO9 A;  3ZR8 X;  1DPR A;  1NG7 A;  3ABL H;  3G3Z A;  2ZNY A;  1UB9 A;  2ZJ2 A;  3ASO H;  4M6Y A;  4BHC A;  1LQ1 A;  4H0E A;  1R1U A;  5TRD A;  4XRF A;  2K9L A;  1FYK A;  1BJZ A;  1X3Z B;  1K4S A;  5GTI C;  1Z7L A;  2DFH A;  3BR5 A;  2KKO A;  2ZC2 A;  3TQN A;  4EMS A;  1MKM A;  1R23 A;  3KYC B;  3QQA A;  3A4C A;  3TP0 A;  5KVR A;  2LYC A;  4I09 A;  1ETW A;  2K40 A;  3LSK A;  4XLP F;  4CSW A;  3ZQI A;  2KPM A;  3H9Q A;  3GME A;  5ERI A;  1SMY F;  3MCZ A;  4QPQ A;  2KIM A;  3H5A A;  2OV7 A;  4M74 A;  3H35 A;  1F43 A;  1FPQ A;  4U7B A;  3O2P E;  4OIO F;  4IL6 C;  4I98 B;  1U2W A;  1O3T A;  1TWF J;  3AG1 H;  2OPT A;  3WTT C;  3I55 I;  2M7B A;  5IYD J;  5F0C A;  3WTY C;  2IS6 A;  4BY1 J;  3JW4 A;  1Z7U A;  1SEU A;  1TT5 B;  1HCR A;  3ZPL A;  3C18 A;  4ZYE A;  1IV6 A;  3LST A;  5GAE J;  3ZQF A;  4GGG A;  4HYE A;  2LG4 A;  4QWQ A;  2K9S A;  4PFP A;  1XGS A;  1YS7 A;  2EV5 A;  3O6B B;  3GBG A;  3ABT A;  3BJO A;  3IP4 B;  4CDG A;  1CGP A;  2JWT A;  1Z21 A;  1ZG3 A;  4HSR A;  2HVS A;  3ASN H;  3KP6 A;  3U21 A;  5J6X A;  5FO5 A;  4P9F A;  1AHD P;  2JSP A;  3I4M J;  2L9N A;  3FX3 A;  3GWZ A;  1LKX A;  3PSF A;  1P4A A;  1R6R A;  2FNP A;  3RPU D;  3W6J B;  2JT1 A;  3NRV A;  2XRL A;  3TBI A;  2KIF A;  2KJB A;  1QGP A;  3IH2 A;  3ZMV A;  2L9V A;  1WVR A;  2FMY A;  3VSK A;  2VT2 A;  2FF4 A;  4F7Z A;  2HOE A;  2MD5 A;  1QO0 D;  1NHA A;  4ENK A;  2P4W A;  1LPQ A;  2LSO A;  2FQ3 A;  3AG3 H;  4RBO A;  2EIJ H;  4YFN F;  1OFC X;  3MD2 A;  6PAX A;  4ITV A;  1Z6T A;  2OZ6 A;  3E5U A;  3BR3 A;  5F04 A;  2NVU B;  1HSJ A;  3WU2 C;  5KK1 A;  3Q9S A;  1H9G A;  3QU6 A;  2WB1 N;  3GW2 A;  4KFC A;  1CF7 A;  1SFO J;  3CLQ A;  3PJR A;  4HBL A;  1RET A;  4B3X A;  1LE8 B;  4FX4 A;  3OR2 C;  1TWG J;  3K4B A;  4EAT A;  3KET A;  3JR9 A;  3HOZ J;  4BQQ A;  4A5M A;  5D5X B;  2DMQ A;  2Y9Y A;  4II3 A;  3SXY A;  1SD4 A;  3K1N A;  2M30 A;  1FJL A;  4IRI A;  3G2B A;  4BE1 A;  5KAI C;  2HQA A;  4MFE A;  2ESN A;  2LF7 A;  3DKW A;  4HEA 2;  2JUC A;  2VQG A;  2XAG A;  5M5X J;  4Y4R A;  2VI6 A;  5J3L A;  1ZLK A;  1I1S A;  3M7G A;  1MBE A;  2V1X A;  1EF4 A;  2V1N A;  3GVA A;  2F6C A;  4C9Y A;  4L9J A;  1OMI A; 
#chains in the Genus database with same CATH homology
 1KA8 A;  2PG4 A;  1S29 A;  4BXU A;  3ERE D;  3I59 B;  4EGY A;  4HLX A;  1U3E M;  2DTR A;  1ZG1 A;  3GO5 A;  1YS6 A;  2P5L C;  3GF2 A;  3M1E A;  1FLI A;  4MQ9 F;  3P9I A;  1L0O C;  3WGH A;  1WWX A;  1R36 A;  1S7A A;  2O3F A;  2TDX A;  3KFW X;  2C6Y A;  3HHH A;  5CYV A;  4N0B A;  4WK8 F;  3ZQ7 A;  2L4M A;  3HRU A;  5F6F A;  4BH9 A;  2L01 A;  3LQQ A;  1XGO A;  2CWE A;  1FYM A;  5ILV A;  2COM A;  1WRJ A;  3U9G A;  1B59 A;  3KZY A;  1TBX A;  4ENJ A;  5FFZ A;  1XSX A;  3DXJ F;  3E3V A;  2XAF A;  3F8B A;  4HQE A;  4WXC A;  4G7O F;  4MGR A;  5BS6 A;  1ZLJ A;  1XB4 A;  1T0F A;  1J9I A;  2VC0 A;  1D3Y A;  4G6D A;  1ZG5 A;  2FU4 A;  2V79 A;  1BBY A;  2WV0 A;  2ZKZ A;  2H94 A;  2K4B A;  3PQJ A;  4M71 A;  5E20 A;  2STT A;  1IN4 A;  3L09 A;  5LGN A;  2NAZ A;  4Q5S F;  3CO7 C;  2WTE A;  2XRO A;  5A2Q K;  3BP8 A;  3I0T A;  5BOX A;  1SAX A;  2X0L A;  1BI1 A;  4L5J A;  1FBU A;  3F23 A;  1IAW A;  2DPU A;  1B1B A;  3WTW C;  3J80 Z;  3WTV C;  1J2X A;  1BI2 A;  1R5H A;  2QEN A;  2XVC A;  3V7S A;  1X3U A;  2HQN A;  1ZAO A;  4OIR F;  2H6C A;  3V4G A;  2GWR A;  3RTR A;  4OMZ A;  2WWY A;  3E6M A;  2OU2 A;  2IT0 A;  3KLN A;  1TW2 A;  1DP7 P;  1WSU A;  1G4D A;  1T38 A;  3ISP A;  3ZN1 A;  3ZP5 A;  2RGV A;  4RB0 A;  2ZCW A;  2OD5 A;  4L9V A;  4M73 A;  3L00 A;  4AIH A;  1MGT A;  2FOK A;  2VC1 A;  1OR7 A;  3EYY A;  3GFJ A;  3CUQ C;  3HUG A;  4HAM A;  5HDN A;  3I64 A;  5DEQ A;  2CYY A;  5JFR A;  2MLG A;  1E2X A;  1PP7 U;  3K9T A;  3E97 A;  3CO6 C;  3IRQ A;  1YFH A;  2HKO A;  1PDN C;  4RGU A;  1XD7 A;  2VE8 A;  4KMF A;  1KU2 A;  1F1Z A;  2GAU A;  4KUM A;  2QM3 A;  2EFO A;  3EDP A;  4RGX A;  2R3S A;  1G3Y A;  5HLH A;  3ZMT A;  5D6E A;  1U6G A;  2QQA A;  4G6Q A;  1H9T A;  2G9W A;  4LLL A;  2EK5 A;  1U8R A;  3ELK A;  2R7F A;  3TKY A;  1Z6R A;  1IXC A;  3P9K A;  1ONV A;  4Y17 A;  5K5R A;  1U78 A;  3K0L A;  1O7F A;  3F22 A;  4OOI A;  4KIF A;  3F6O A;  3J81 Z;  4I0B A;  2DQR A;  3E6C C;  2VXZ A;  2PBI A;  2BE5 F;  3BY6 A;  1OYY A;  1XDU A;  2X4H A;  2ISY A;  2MH9 A;  2P8T A;  1WI9 A;  1C0W A;  1RUN A;  3D0S A;  1K7A A;  1P92 A;  4RAZ A;  1GXQ A;  1IN6 A;  1ZGA A;  3WTU C;  3K2Z A;  1R7J A;  1XCB A;  1BI0 A;  1DPU A;  4G94 A;  2EWN A;  5LGT A;  4PZJ A;  4KDP A;  3WGG A;  1TW3 A;  2ETH A;  4XBF A;  4UUV A;  1YW7 A;  3B73 A;  4M9X A;  5E1X A;  5FGM A;  4EQQ A;  3HRM A;  2PMH A;  3EET A;  5L3G A;  3ZMS A;  4IRG A;  3V8L A;  3GUD A;  5IT3 A;  3IL2 A;  2L4A A;  5A2Q Z;  3ECO A;  3WU0 A;  1MJB A;  3FMS A;  2CW0 F;  2GQQ A;  4WX9 A;  5CVJ A;  1DDN A;  2VBX A;  3I58 A;  1JHH A;  1HKS A;  2O6G E;  1ZAR A;  4RB2 C;  3FM3 A;  4PGH A;  4L5I A;  3WGI A;  4ZYD A;  5L3C A;  1Z05 A;  3DQV C;  2QQB A;  2DQL A;  4HW0 A;  3BOQ A;  1Z91 A;  4YFX F;  1LB2 A;  1XGM A;  4Q47 A;  2O03 A;  1JE8 A;  4PCQ A;  1JXS A;  1W4M A;  1XSV A;  3WTS C;  5HLI A;  1IN8 A;  3V8J A;  4NHJ A;  4I02 A;  4KYW A;  2JRT A;  1S6L A;  2BBY A;  4HX4 A;  2MBF A;  3WE2 A;  5HDK A;  1USS A;  1YIO A;  4UV8 A;  4LD5 A;  4MTE A;  2RQP A;  5DYM A;  5BQT A;  4M72 A;  1SD5 A;  2GXG A;  3LWF A;  2RDP A;  2HR3 A;  4HZF A;  1O57 A;  2L54 A;  5F1R A;  2DW4 A;  2A6H F;  3ML6 A;  4N9I A;  4BAY A;  1UCR A;  5ICE A;  1LVA A;  5D8K B;  4OIN F;  2DU9 A;  4EJW A;  2EJR A;  3IKV A;  5HLG A;  1TTY A;  3DFG A;  2H6B A;  4CO8 A;  2ZNZ A;  4XSX F;  3GLX A;  4IF4 A;  2E7W A;  2MH2 A;  2QQ9 A;  1ULY A;  4KA4 A;  3WTZ A;  4KN4 X;  1ODD A;  1QPM A;  1XDS A;  2FBI A;  4LK1 F;  2FSW A;  4LFU A;  3F8N A;  3J80 K;  4EM0 B;  3SFZ A;  3J81 K;  5LLQ A;  5CVR A;  4YG2 F;  1F9N A;  3CDH A;  3GZ5 A;  4I01 A;  4HF0 A;  5JI6 A;  2EV0 A;  3G73 A;  3R60 A;  5HOO A;  4BHP A;  2PQ8 A;  3FHZ A;  1KQ0 A;  4IHS A;  4LG0 A;  1LEA A;  1JGS A;  3PQK A;  1R22 A;  2VBW A;  1DUX C;  2PN6 A;  5ICC A;  1HW5 A;  1EH6 A;  3L7W A;  4FHT A;  4M9Z A;  1FY7 A;  3CUQ B;  2ADU A;  1QQI A;  4I7H A;  2PJP A;  4DQ2 A;  1U5T C;  2XKP A;  3RJP A;  2Z33 A;  2FRH A;  3FWE A;  3OOP A;  1V3F A;  2QWW A;  2XUB A;  2F5E A;  2M8E A;  1FC3 A;  2RV8 A;  4DNC A;  2GZW A;  3CUO A;  3GXO A;  3WG9 A;  2HWV A;  5E17 F;  5K5Q A;  3SQN A;  1SFE A;  2IA1 A;  2GA1 A;  3WOD F;  3JAM K;  2A6E F;  3I4P A;  4EGZ A;  1ZRE A;  3MEX A;  2P7C B;  4Y13 A;  3REO A;  1TNT A;  3K1M A;  5D4S A;  1B9M A;  4JBA A;  3RIR A;  1ZH5 A;  2FML A;  5AIQ A;  2DPD A;  3HTU A;  4BNC A;  3R4K A;  4IVN A;  5DCM B;  4UVA A;  5HDG A;  4L0Y B;  3BJA A;  3FXR A;  1KU3 A;  4HQM A;  3U1D A;  3KE2 A;  5E8I A;  3HOS A;  1I5Z A;  1QZZ A;  2PMU A;  1EH8 A;  4WCG A;  2K27 A;  2XAH A;  2BEO A;  3R6S A;  3VB2 A;  5FLX Z;  4RAY A;  4RGS A;  2Y48 A;  2M87 A;  3WU1 B;  1QBJ A;  5LEK A;  1Z1D A;  1YW9 A;  4P96 A;  5TJJ A;  4G7H F;  2F2E A;  1MDM B;  2HFH A;  4LLN A;  3O3K A;  4BYY A;  2OQR A;  3HSF A;  2J5P A;  2XV4 S;  5H6R A;  3I5U A;  3GFM A;  5DD8 A;  3J7A O;  1FP1 D;  2IA2 A;  4MNU A;  4OU0 A;  5L3D A;  2YX4 A;  2IVM A;  4ZH4 F;  4PDK A;  4XSZ F;  2E1C A;  4MEX F;  3OV8 A;  2K02 A;  5ILU A;  5J8F A;  3IHU A;  3KP7 A;  1Z9C A;  3LA3 A;  2W84 A;  2FXA A;  2L02 A;  2HS5 A;  1YG2 A;  3GX4 X;  4P55 A;  1UHW A;  4N9H A;  1TQM A;  3S2W A;  5LHI A;  2OAZ A;  3MQ0 A;  4KIC A;  4NQW A;  1H0M A;  4CYD A;  2HKX A;  4OIP F;  4FX0 A;  1XSD A;  5D5U B;  2HDC A;  1MJ9 A;  1FP2 A;  3GEZ A;  1BC7 C;  1K78 B;  3IRR A;  4KN7 X;  3IWZ A;  1XGN A;  4GYI A;  5DV5 A;  1ZRD A;  3ZMZ A;  1XN7 A;  1HXD A;  1QNT A;  2PEX A;  5L3E A;  4LGW A;  2Y0M A;  4RB1 A;  2EFW A;  3IC7 A;  3HOT A;  2EB7 A;  1J59 A;  2EFN A;  3KP3 A;  2OQG A;  4MQV A;  3B02 A;  3C1D A;  3TGN A;  2P5V A;  4EVI A;  4HLY A;  1F4K A;  5CLS A;  1E17 A;  2DT5 A;  2RC4 A;  3LAP A;  2XAJ A;  2ISZ A;  2H09 A;  2D2W A;  1QZY A;  2A61 A;  1LDK B;  4EJO A;  2FBH A;  2IPQ X;  3F8F A;  3RKW A;  1D8J A;  4HDU A;  1EH7 A;  2STW A;  4G7Z F;  2YPR A;  1FSE A;  2RKH A;  4KT5 C;  2M1B A;  3HHG A;  4R8H A;  4A6E A;  3KP4 A;  2QUF A;  2V9V A;  1YQA A;  2YR2 A;  3GFL A;  3TO7 A;  1FWZ A;  3C3W A;  4RS8 A;  5LBQ A;  2FE3 A;  4ENN A;  4UXN A;  5H6Q A;  3ULQ B;  5ICG A;  2D1H A;  4JK1 X;  2EV6 A;  4CGZ A;  3M9A A;  3VOE A;  4AIK A;  2XGX A;  4I0A A;  1BM9 A;  4LJZ F;  5DCF A;  1XMA A;  2XIG A;  2J5O A;  4UV9 A;  2A68 F;  3ECH A;  1JHF A;  2B0L A;  4A2U A;  3KEO A;  3WTX C;  2IA0 A;  1I6X A;  2FEZ A;  3T8R A;  4OMY A;  3LAJ A;  2ESH A;  2QYO A;  1SFU A;  2KJC A;  4JQF A;  1STZ A;  2EA4 A;  5JHU A;  3T5X A;  2W85 A;  3CUQ A;  5LGU A;  5HS9 A;  1P4X A;  3L9F A;  4QLC U;  2RN7 A;  4G9Y A;  1R1V A;  3LA2 A;  3LQR A;  3CJN A;  2NYX A;  1SD7 A;  3W6K B;  2HYG D;  2NNN A;  2V1D A;  2VOD A;  1U5T A;  1L3L A;  2YU3 A;  1B9N A;  3FF5 A;  3CTA A;  3HSR A;  2IP2 A;  1FX7 A;  3BWG A;  4KNY A;  1ON2 A;  4HV6 A;  4YFK F;  3SHF A;  1IXS B;  4D0P A;  1GVJ A;  5LHG A;  3V7C A;  1G3S A;  1LDD A;  4K2E A;  2JPC A;  2HTJ A;  5CVV A;  2PLY A;  5HS8 A;  1KU9 A;  4P5O A;  2ACJ A;  3HYI A;  1MZB A;  5L3F A;  2QZ8 A;  5D5W B;  1O7L A;  2MC3 A;  2OBP A;  3GYH X;  4EV0 A;  1VTN C;  1I1G A;  1T6S A;  1FSH A;  2WC2 A;  2QLZ A;  1V4R A;  2NS0 A;  1KQ8 A;  2O0Y A;  5EEG A;  3MWM A;  3H92 A;  1Q1H A;  1R58 A;  4WXD A;  5FD5 A;  5K5O A;  2YX7 A;  3IKT A;  3FM5 A;  1KU7 A;  4OIQ F;  1D5V A;  1K79 A;  3DF8 A;  3MAJ A;  4AD9 A;  2ZBK A;  4A12 A;  1TQI A;  1RNL A;  1KYZ A;  2RVC A;  2CSO A;  3T0Y A;  2K4J A;  2KIU A;  3KP2 A;  2AXL A;  4MTD A;  2D45 A;  2VT3 A;  4GCV A;  5HVQ C;  3TO6 A;  4IRH A;  3ZMU A;  4M6X A;  3GFI A;  2RNJ A;  4NB5 A;  1G3T A;  3VOD A;  1S3J A;  1W5T A;  2VOO A;  4A0Z A;  2CFX A;  3TDZ C;  3SZP A;  4GO1 A;  1LNW A;  3BJ6 A;  1FBQ A;  5E1Z B;  3DPL C;  2W24 A;  4CHU A;  4KIB A;  4HDV A;  4L0Z B;  1KGS A;  3VFZ A;  4ENM A;  1ZN2 A;  3FMQ A;  3BZ6 A;  2G7H A;  3JAM Z;  2Q2E A;  1PUE E;  5E8G A;  1GHC A;  3QRF F;  4ZYG A;  4KMU X;  3N97 A;  3RI4 A;  1BJA A;  2KRF A;  2LKP A;  3DPT A;  4ON0 A;  3L2C A;  4S04 A;  1HW1 A;  1SMT A;  1FZP B;  3RKY A;  1XCV A;  5JR3 A;  3JSO A;  3R0A A;  2Z3Y A;  3TDU C;  2F5F A;  3QAH A;  2VBZ A;  4B09 A;  1BN5 A;  2F5D A;  3P9C A;  4IJA A;  3FXU A;  2FNA A;  2ELH A;  3QP5 A;  2DBB A;  1OYW A;  4IHT A;  1HQC A;  2JPB A;  1G3W A;  4YIF A;  5CVU A;  1S8N A;  2IJL A;  2UXN A;  5JVT A;  4HV5 A;  1T98 A;  1FOK A;  1FNN A;  3E5Q A;  3FMR A;  1ZYR F;  2HEO A;  1O3R A;  1RI7 A;  1TLH B;  4E70 A;  2L3D A;  4MEY F;  2UZK A;  3E6B A;  1YYV A;  1S7O A;  2ZME B;  2XHK A;  2O61 A;  5D4R A;  5ILS A;  3E6D A;  2QBY A;  3E5X A;  1P4W A;  2M5W A;  2P6T A;  3NQO A;  1MJA A;  2XKO A;  2P6S A;  3VEP A;  3T1B A;  4EJT A;  4UNO A;  1BIA A;  4I2O A;  4ESF A;  4TV7 A;  4ZZL A;  2HGC A;  2CO5 A;  1T2K A;  3Q9V A;  2V1U A;  5D5V B;  3F8M A;  3I53 A;  3KZZ A;  2Q0O A;  3DEU A;  4B8X A;  2VE9 A;  1W7P D;  4L18 B;  4A6D A;  5ICF A;  3LFK A;  3V7R A;  5LRS A;  4XLN F;  2MLK A;  1P2F A;  1Y0U A;  3H3Z A;  3FZV A;  5FFX A;  4HF1 A;  3K1P A;  4HA8 A;  5CJ9 A;  2PFB A;  3RPQ A;  2CG4 A;  2K86 A;  2JTV A;  2Z5U A;  3KCC A;  4U7D A;  2W25 A;  3IWF A;  3QPT A;  3C7J A;  5J8C A;  5AON A;  3MZH A;  1BC8 C;  4A0X A;  3RPU A;  3EUH A;  5FLX K;  2DI3 A;  1UHM A;  1I27 A;  5IT9 Z;  1KQ9 A;  3KEQ A;  3QOP A;  5EEH A;  5D6F A;  1HST A;  2O8X A;  1IW7 F;  2A07 F;  4BQA A;  1ZGJ A;  2LDU A;  1OKR A;  2VON A;  5BMZ A;  2W57 A;  4AWX B;  5FB2 A;  2R7D A;  3QP6 A;  2DK5 A;  2JZY A;  1IF1 A;  1CF7 B;  2H27 A;  4FT8 A;  2EA2 A;  4IPA A;  3ROU A;  4U0W A;  4HX8 A;  2HZT A;  1YTY A;  4EM2 A;  3RDI A;  1IRG A;  2M45 A;  1KYW A;  3JSP A;  5DUI A;  3QU3 A;  4L9T A;  2F5C A;  4U0Y A;  3HSE A;  4ETS A;  1T39 A;  4LLG F;  2ZO4 A;  1LDJ A;  5LEJ A;  1OPC A;  2P5K A;  4M9S A;  2ZFW A;  3AAF A;  2GIV A;  4R1H A;  3K69 A;  4EJV A;  1PP8 F;  1RUO A;  2UWM A;  1RIO H;  3MFK A;  1UFM A;  2CGP A;  3FXQ A;  2A3S A;  3I59 A;  4HX7 A;  3Q5F A;  1D8K A;  4UHT A;  2OA4 A;  2G7U A;  1J0R A;  1BI3 A;  4EJU A;  3CLO A;  5LRR A;  2A69 F;  2IRF G;  5K1Y A;  1HKQ A;  2OZU A;  5H20 A;  3M8F A;  1YO5 C;  4WWC A;  1HW2 A;  1ZRC A;  5L3B A;  2DFI A;  2FBK A;  2UXX A;  4BHB A;  1W7P B;  3KLO A;  3T8T A;  2P7V B;  4GYG A;  1FBS A;  1MD0 A;  3ABU A;  2D1V A;  2A5Y B;  2GXB A;  2HQR A;  4Q48 A;  4CZZ A;  3EQL F;  3HTS B;  3F6V A;  3TOA A;  4P9U A;  1ZHF A;  2XRN A;  4O5V A;  1IRF A;  3R0J A;  2K7L A;  4S05 A;  1SD6 A;  3BPV A;  4AVP A;  3HIF A;  1FYL A;  3BDD A;  3F8C A;  3RKX A;  2V6C A;  2XAS A;  4Z2Y A;  1R00 A;  1YLF A;  1J75 A;  3KP5 A;  3BPX A;  1BOA A;  4EM1 A;  2GA2 A;  3F21 A;  1U5T B;  4RB3 C;  5DD4 A;  3DV8 A;  5BPD A;  4KIG A;  3BRO A;  1EV7 A;  1G6N A;  5ED4 A;  3I54 A;  2NNY A;  1REP C;  2ZXJ A;  1FT9 A;  3P7N A;  1B6A A;  1AOY A;  1OYI A;  2DK8 A;  3H3U A;  2IW5 A;  1HBX G;  2FA5 A;  3LA7 A;  3GZ6 A;  3N4M A;  5BPI A;  3EYI A;  2EFP A;  5E18 F;  1A04 A;  3JTG A;  4WXH A;  4LG0 B;  5HS7 A;  2PI0 A;  5IT9 K;  2VBY A;  1IXR C;  2XAQ A;  4ASN A;  5DDG A;  1RZ4 A;  3RYR A;  4A0Y A;  2ZME A;  3SZT A;  2YSR A;  3I71 A;  4LMY A;  1ON1 A;  2DAO A;  1B4A A;  5AIP A;  1K78 A;  2LNB A;  1J7K A;  2NRA C;  1J5Y A;  2E1N A;  1UST A;  1WQ2 A;  4O6J A;  4CXF A;  1R5G A;  1O3S A;  1AWC A;  4ZZD A;  1LJ9 A;  4GXO A;  5FD6 A;  4PGG A;  2BGC A;  1W7P A;  3M8E A;  4R79 A;  4U0V A;  1ZRF A;  2MA3 A;  1W5S A;  4LB5 A;  4ZYH A;  2VOP A;  4LK0 F;  5F64 A;  2AS5 F;  3PFI A;  2BYV E;  4WF2 A;  4ESJ A;  2CQK A;  4UVB A;  4G8X A;  2Z99 A;  1IZ1 A;  1GXP A;  1TQP A;  4Q4Z F;  3R61 A;  1IN7 A;  2BV6 A;  5DUK A;  1WKM A;  4Y15 A;  4YII A;  4LB6 B;  4A5N A;  2DO7 A;  4MHG A;  3V8K A;  1LEB A;  5LHH A;  2EFQ A;  3WE3 A;  4ESB A;  4UVC A;  4HF2 A;  4CIC A;  4O3M A;  1O3Q A;  2Z9O A;  3U2R A;  3HRT A;  1SFX A;  5CVI A;  5E1W A;  3QPH A;  1YW8 A;  3ZMD A;  3NEU A;  2DLL A;  2E7X A;  4U88 A;  2JSC A;  3JTH A;  1IN5 A;  1K6O A;  2Y75 A;  5DCM A;  2LF8 A;  3RYP A;  4L9N A;  5D8L B;  3ZN0 A;  4IXA A;  1F5T A;  2HTS A;  2QVO A;  3MZY A;  1XMK A;  3F3X A;  3DP7 A;  1P6R A;  1HKT A;  3F72 A;  2QBY B;  3TOB A;  1BIB A;  2Q8K A;  3HRS A;  1IUY A;  2HYF A;  1R1T A;  3D5L A;  3COA C;  4AIJ A;  4HOB A;  2VN2 A;  1TNS A;  4RGR A;  1MDM A;  3TO9 A;  1DPR A;  3G3Z A;  2ZNY A;  1UB9 A;  2ZJ2 A;  4BHC A;  4M6Y A;  1LQ1 A;  4H0E A;  1R1U A;  5TRD A;  4XRF A;  1FYK A;  2KKO A;  3TQN A;  4EMS A;  1MKM A;  1R23 A;  5KVR A;  4I09 A;  4XLP F;  5ERI A;  1SMY F;  3MCZ A;  2KIM A;  4M74 A;  1FPQ A;  4U7B A;  3O2P E;  4OIO F;  4I98 B;  1U2W A;  1O3T A;  3WTT C;  3WTY C;  3JW4 A;  1Z7U A;  3ZPL A;  3C18 A;  4ZYE A;  3LST A;  4GGG A;  4HYE A;  4QWQ A;  1XGS A;  1YS7 A;  2EV5 A;  3O6B B;  1CGP A;  3ABT A;  3BJO A;  4CDG A;  1ZG3 A;  3KP6 A;  5J6X A;  5FO5 A;  4P9F A;  3FX3 A;  3GWZ A;  1P4A A;  2FNP A;  3W6J B;  2JT1 A;  3NRV A;  2KIF A;  2KJB A;  1QGP A;  3ZMV A;  2FMY A;  2VT2 A;  2FF4 A;  4F7Z A;  2HOE A;  2MD5 A;  1QO0 D;  1NHA A;  4ENK A;  2P4W A;  2LSO A;  2FQ3 A;  4YFN F;  6PAX A;  1Z6T A;  2OZ6 A;  3E5U A;  1HSJ A;  5KK1 A;  3Q9S A;  1H9G A;  3QU6 A;  3GW2 A;  4KFC A;  1CF7 A;  4HBL A;  4FX4 A;  3KET A;  4A5M A;  5D5X B;  3SXY A;  1SD4 A;  3K1N A;  2M30 A;  4IRI A;  2ESN A;  2LF7 A;  3DKW A;  2XAG A;  1I1S A;  1ZLK A;  3M7G A;  2V1X A;  3GVA A;  4L9J A;  1OMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...