3WTXC

Crystal structure of the complex comprised of ets1(y329a), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
103
structure length
103
Chain Sequence
PIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 35
structure length 103
sequence length 103
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtxC00
2VC1A 1R1UA 1MDMA 5E8IA 1IRGA 3BWGA 1JE8A 4GCVA 4ENJA 3R0JA 5E1XA 4XBFA 2DTRA 2JSCA 5EEHA 4EMSA 4ESJA 4KNYA 3BJAA 1I1GA 3C3WA 5DD8A 1FSEA 3RJPA 3R60A 3CDHA 4PDKA 3BDDA 4IHSA 2ISZA 3GX4X 3HSEA 3KCCA 3RTRA 1LJ9A 4UHTA 3O3KA 1ZHFA 2NRAC 2Y75A 1R5HA 3BZ6A 4A6DA 2FU4A 2VE8A 2FXAA 3RDIA 2P7CB 1OKRA 5HDNA 3RKWA 1I27A 4KFCA 3WE2A 3GWZA 2FSWA 1U3EM 1ZREA 3JSOA 2VC0A 3WGIA 2MLGA 1FBQA 3GLXA 2R7FA 4Q48A 1ON2A 3FMSA 1WWXA 3E3VA 3WTTC 3GYHX 4YFXF 3N97A 3HHGA 1A04A 3RYRA 1R7JA 3ZN1A 3CUOA 4MTDA 4OIQF 1QZYA 1OYWA 4KYWA 4UV9A 5FGMA 5J8FA 4OMYA 2NS0A 2L54A 5JHUA 2Q2EA 1Q1HA 4AVPA 3M9AA 1QQIA 4N0BA 4YIFA 3FXUA 4ZYDA 3WTWC 2RC4A 1S29A 2KRFA 5BOXA 3SZTA 3K69A 4KUMA 4U7BA 2MA3A 1DP7P 2X4HA 2A6EF 3F8CA 4U88A 1ZG1A 3VFZA 4UXNA 3G73A 2ZMEB 2MC3A 3O2PE 2Z9OA 3P9KA 2E7WA 3TO6A 3FM5A 2YPRA 1RNLA 3IKTA 3ISPA 5LBQA 2A6HF 5HDGA 1TLHB 1Z1DA 2K7LA 2Q8KA 3ROUA 5D6FA 4G7OF 5HLIA 1ON1A 3SXYA 3MCZA 3TO7A 3JW4A 2OBPA 1B59A 2F2EA 4TV7A 4M72A 1R00A 1P92A 1P2FA 2VOOA 1W5SA 2XRNA 5A2QZ 4ZZLA 3ML6A 1OR7A 1D8KA 3AAFA 4FHTA 5FFZA 2JPCA 3V7RA 5E1ZB 4LG0B 2CQKA 2WC2A 1F9NA 5AIPA 2D2WA 1L0OC 5ILSA 3VEPA 3M8EA 4LB6B 4OMZA 2EFOA 3V7SA 5D4SA 2NYXA 1HSTA 3RI4A 1XMKA 3COAC 1ZARA 2EV6A 3G3ZA 4G94A 3FWEA 1IXCA 2Y48A 3Q9VA 1KA8A 3VODA 5LGUA 2OZUA 2O61A 5H6RA 4HF2A 5D5XB 3LQQA 1XN7A 2QBYB 1RI7A 3GFMA 4HQMA 5LRSA 4ON0A 3ZMSA 1W5TA 3TOAA 3HIFA 1FOKA 5DDGA 1ZRFA 1W4MA 3KP6A 1QPMA 1P4XA 2DK5A 4WWCA 2EV5A 3F3XA 2DAOA 2STWA 2BEOA 3IL2A 1H0MA 5F64A 4LK0F 4EJWA 3V7CA 4HA8A 5DV5A 2DQRA 4NHJA 3JAMZ 1V3FA 1FPQA 1U8RA 4ZH4F 3GO5A 3R4KA 4L9JA 4ASNA 3WGHA 4M6XA 2EJRA 4YIIA 5IT3A 1P6RA 1XSDA 1T6SA 1IW7F 2A69F 3TDUC 2O8XA 2G7HA 2BGCA 4O5VA 1XGMA 3L09A 4O3MA 4ZYGA 2M8EA 5FFXA 3F23A 4MNUA 4LD5A 2F5EA 4G9YA 2HGCA 3K9TA 2Z5UA 3BJ6A 3LA3A 3BY6A 2ZMEA 1JHHA 2MBFA 1FP1D 4P55A 5ICFA 3KZZA 2GA2A 2BV6A 2JRTA 2PBIA 2ZBKA 4XSZF 4AIHA 3K0LA 1O3QA 4EJOA 3IC7A 3J81Z 2V79A 4EM1A 5H6QA 5D8KB 1YS6A 1PUEE 4BH9A 5K5RA 4HAMA 4GYGA 1WRJA 4Q5SF 2H6BA 1Z9CA 1ZRDA 3MFKA 2HQNA 2VODA 1JXSA 5CJ9A 2XGXA 3L9FA 5D6EA 3WTZA 4M9SA 4P96A 2RV8A 4Q47A 5CVIA 2ETHA 2AXLA 2D45A 4N9HA 1K78B 2XAQA 2NNYA 2D1VA 4LG0A 2PEXA 3FX3A 5E17F 4CICA 1OPCA 2MD5A 4PCQA 4UVCA 4IRGA 1USSA 4ESBA 2R7DA 3QU6A 4LLGF 2HOEA 3ZMZA 1FC3A 3R61A 1F5TA 4XSXF 2HZTA 1ZLJA 3I58A 4Y13A 3HRTA 2QBYA 4RB2C 4IF4A 3HOTA 1MJAA 4RAYA 1FBSA 3KP3A 5BS6A 4XLPF 3DF8A 2VE9A 3LAPA 1P4AA 5HVQC 2DQLA 4M9XA 2J5PA 4N9IA 2V1XA 1QZZA 1FP2A 5EEGA 1XGNA 4BHCA 1YW8A 3DEUA 1PDNC 2IVMA 3FF5A 3MEXA 2HYGD 3HTUA 1USTA 3C7JA 2YU3A 2L4MA 2PI0A 3MZHA 3TKYA 2KJCA 1OMIA 4MQ9F 4EJUA 3E6MA 2V1UA 2W57A 4AIJA 3RPUA 2VOPA 1R1VA 4KIGA 1LVAA 2LNBA 1YYVA 4R1HA 1G3WA 3HYIA 5FO5A 4AWXB 1UB9A 4M74A 4NQWA 1R22A 3GUDA 4HZFA 4LJZF 4R8HA 2XAJA 2QLZA 3WE3A 2FMYA 3VB2A 5JI6A 1STZA 5L3FA 2HDCA 3ECHA 2EFNA 3LSTA 3I0TA 3CUQB 1W7PD 1EH8A 3CO7C 3CJNA 3KZYA 3QU3A 4HX4A 4YFNF 1ONVA 1MZBA 3ECOA 2ESHA 5D8LB 3H3UA 3ZMUA 1ZGJA 2E1CA 5HS7A 3GVAA 4MGRA 1H9GA 2QYOA 4BHPA 3D5LA 3F8NA 1K79A 3LQRA 4PZJA 3FMQA 1GVJA 3TGNA 2WWYA 2VXZA 3HTSB 5LEJA 5D5VB 4A0XA 3KP4A 4E70A 2W85A 2G9WA 3WTSC 1K78A 4YFKF 1KYZA 4GXOA 1G3TA 2QENA 2VBXA 5A2QK 2L02A 2CO5A 1SD6A 3MWMA 2K02A 2XIGA 3IRRA 1K7AA 2M30A 4LMYA 4UUVA 5F1RA 1U5TB 4EGYA 2DK8A 4LLLA 1ZN2A 4AD9A 2HTSA 1SMTA 2K4JA 5FD6A 2FBHA 3KE2A 5E20A 5ERIA 2ZNZA 1J59A 1IXSB 4BHBA 1UHWA 3EYIA 1XMAA 5ICGA 1O3TA 4RB1A 3E5UA 3ZMTA 1AOYA 1RIOH 2YX7A 1ULYA 1ODDA 3C1DA 3LA7A 2IT0A 3TO9A 3MZYA 2HTJA 3JSPA 1FYLA 1O7LA 4EM0B 4G6DA 1T0FA 3MAJA 5HLGA 2LF8A 3RPQA 3M7GA 1SD4A 2TDXA 2RQPA 1TQIA 1KU3A 3BPXA 4KIFA 1B1BA 2M5WA 3LA2A 2XKPA 2P4WA 1IN7A 1LQ1A 2QWWA 3P9CA 3JAMK 3RIRA 2RGVA 2O6GE 3F8BA 2VBWA 1DUXC 3EUHA 4RGRA 1G4DA 1G3SA 3LWFA 4XRFA 1SMYF 2OD5A 2LF7A 1ZG5A 2FBIA 2EV0A 3QP5A 2EFWA 5K5OA 1J2XA 5ILVA 1RUOA 5E1WA 2J5OA 1Z6RA 3CUQA 1Z6TA 1J9IA 5FD5A 3W6JB 5DD4A 3DPTA 1BIBA 3T1BA 4ENNA 1YG2A 2ZXJA 3F8FA 4MTEA 2IA2A 3HSRA 2HEOA 1MD0A 4HX7A 4IXAA 1TW3A 1KU2A 3ABTA 1FX7A 2Z33A 3FXRA 3J81K 4EVIA 4IRIA 4BYYA 1QBJA 5LHIA 1C0WA 2W84A 4DNCA 4EGZA 1SFUA 1RZ4A 1R36A 1FY7A 1TQMA 4I02A 1XSXA 3FMRA 3F22A 1YS7A 2CG4A 2LDUA 1EV7A 5LEKA 3IWFA 4U7DA 3WU1B 1J7KA 3ZP5A 2M45A 3CTAA 2KIMA 1U5TA 1FYKA 4Q4ZF 2DLLA 2B0LA 1HKSA 2ADUA 4A12A 3NEUA 4WX9A 4FX0A 2FNAA 4H0EA 2PG4A 2XAFA 2VN2A 1U78A 4HOBA 1XD7A 3RYPA 1IXRC 2XKOA 2WTEA 1T98A 3FHZA 3D0SA 3ELKA 3KP7A 4OINF 3KLOA 5TJJA 4O6JA 4HLYA 2VBYA 2D1HA 4BQAA 2XVCA 2CW0F 3GF2A 2H6CA 2PN6A 4OIRF 2RNJA 2QQ9A 3E6BA 5IT9Z 1U2WA 1FBUA 1QNTA 3I4PA 4L9VA 3F8MA 5DUKA 1MGTA 1W7PB 3F21A 2FMLA 4EQQA 1SAXA 1SFEA 3HSFA 2IJLA 5HS8A 4GGGA 4GYIA 2OZ6A 1YW9A 2IP2A 2P5KA 1BC8C 1S7AA 2MLKA 2RVCA 3HRSA 3RKYA 1RUNA 3BROA 3N4MA 1TNTA 2JZYA 1EH7A 3OV8A 2QM3A 1IN8A 4AIKA 2AS5F 4WK8F 2P5VA 1YFHA 3M1EA 5L3CA 2E1NA 1H9TA 4CO8A 1Y0UA 2OAZA 3H3ZA 3WTYC 1FYMA 5CVUA 2G7UA 2FA5A 1BJAA 2XAHA 2A68F 3MQ0A 3TDZC 3ZMVA 1R1TA 4CXFA 1GHCA 1PP8F 1IZ1A 1B9NA 1G6NA 3CO6C 4MEYF 1OYIA 1S6LA 4LGWA 1S3JA 3ABUA 3CLOA 3KP2A 2Z3YA 4HDUA 4U0YA 3L00A 3EQLF 2DFIA 2P5LC 3V8KA 1GXPA 3I54A 4WCGA 3HRMA 3IHUA 2DI3A 2XV4S 3WG9A 5LHGA 3F6VA 3L2CA 2WV0A 2R3SA 3KP5A 1DPUA 5LRRA 1U6GA 4I98B 1JHFA 3E6CC 2LSOA 3GZ5A 2CSOA 4RGUA 2K86A 3F6OA 1ZYRF 1CGPA 4L9TA 2C6YA 3SZPA 2M87A 5E18F 2OQGA 4BAYA 2CGPA 2PQ8A 4KIBA 5AIQA 3QPTA 4GO1A 2FOKA 2NNNA 5L3BA 1SD5A 3HOSA 4A5NA 3QP6A 2M1BA 2FE3A 1KQ8A 3PFIA 5DCFA 1W7PA 1B4AA 1GXQA 4HX8A 4WXCA 3FXQA 3T8RA 3GFLA 4D0PA 2EA4A 4Y15A 1G3YA 3VOEA 1J5YA 4A6EA 1OYYA 3FZVA 3EDPA 1E2XA 1PP7U 3I64A 1S7OA 4NB5A 2RN7A 1KU7A 4S05A 5CVVA 2XROA 3GEZA 3V4GA 3DKWA 1XSVA 3PQKA 1IF1A 2XUBA 4KN7X 2P8TA 3J80Z 2VONA 1V4RA 2EA2A 4YG2F 1TNSA 5J6XA 2GQQA 5CVRA 2HS5A 1D5VA 2PMUA 2DPDA 5L3EA 2FRHA 3V8JA 1LEBA 4MHGA 3RKXA 2YSRA 2O3FA 4I7HA 2E7XA 3QPHA 1XGSA 3LFKA 5ILUA 1FWZA 4G8XA 1WKMA 5TRDA 5HS9A 1T39A 4UVBA 4HBLA 5AONA 4WXHA 1FT9A 2PJPA 2V6CA 4HQEA 5ICEA 1B6AA 3ZPLA 2VBZA 2UXNA 1BI0A 3TQNA 1ZGAA 3T8TA 2A61A 3I71A 4RGSA 1JGSA 3HHHA 3JTHA 4EJVA 2GXBA 1VTNC 5DEQA 4XLNF 3IRQA 5HOOA 2MH9A 1SD7A 2XASA 1HBXG 1LEAA 4B09A 2COMA 1IN6A 3I5UA 4G6QA 1I5ZA 4I0AA 4G7HF 2XAGA 3KEQA 5DCMB 3I53A 1LDDA 1CF7B 2GA1A 5BPIA 2GZWA 1HKTA 2IPQX 1HW5A 4QLCU 4KA4A 2RKHA 2VT3A 2PFBA 3SQNA 2KIFA 2CWEA 1O57A 1YQAA 4LLNA 1DPRA 4ZZDA 2DPUA 4I0BA 5IT9K 4IHTA 5FLXZ 1BI1A 3Q9SA 4P9FA 3WU0A 2EFPA 2DW4A 2OU2A 1BIAA 1FZPB 1Z7UA 1WQ2A 3DV8A 3OOPA 5F6FA 1KQ9A 4JBAA 4B8XA 4HF1A 4UVAA 2HQRA 2EFQA 2ACJA 1UFMA 3C18A 2GAUA 3WODF 2HR3A 1K6OA 1LDKB 4IJAA 2OA4A 4I01A 2UXXA 3SHFA 3ULQB 2STTA 1FSHA 4KMFA 5LGNA 3ZN0A 5ED4A 2A5YB 1IRFA 3L7WA 4L9NA 4CGZA 2DU9A 1SFXA 2KIUA 2A07F 2KJBA 1I1SA 3DP7A 2X0LA 1F1ZA 2ZJ2A 1WSUA 4OOIA 4HV5A 3IWZA 2DT5A 1P4WA 2F5FA 5JVTA 5DUIA 1O3SA 2ESNA 5CLSA 1Z91A 1MJBA 5H20A 4CHUA 2HKOA 5CVJA 2JTVA 5DYMA 1I6XA 4A5MA 2QUFA 1KYWA 3REOA 3O6BB 3DQVC 4M73A 1KU9A 1BN5A 4HLXA 1Z05A 3GW2A 3SFZA 2UZKA 1FLIA 3T0YA 4LK1F 5DCMA 2V9VA 2IW5A 1CF7A 1XCBA 2HWVA 1HQCA 4WXDA 3K2ZA 5JR3A 3HRUA 3P7NA 1IN5A 2MH2A 3EETA 2L4AA 5L3GA 4G7ZF 3BP8A 2EWNA 2NAZA 5FB2A 2FF4A 4HW0A 1ZH5A 1YTYA 3CUQC 2IA0A 3GZ6A 2GWRA 1MKMA 4EJTA 3I59B 1LNWA 2K27A 1HSJA 4L18B 3H92A 5K1YA 4L5JA 3KLNA 3QOPA 3EYYA 2BYVE 2P7VB 1R23A 1TW2A 2QVOA 3J7AO 2CFXA 1YLFA 4KT5C 2ZCWA 3K1MA 3F72A 2YX4A 3LAJA 3BPVA 4FT8A 1BI2A 2VT2A 4WF2A 2PLYA 3W6KB 2DO7A 2DBBA 5E8GA 3WTXC 3DXJF 1HKQA 2F5CA 1U5TC 1E17A 3J80K 4HDVA 1REPC 4I09A 3E5XA 3M8FA 2ZO4A 2FEZA 3NQOA 2Y0MA 1LDJA 3E5QA 4BNCA 4HV6A 3DFGA 4KICA 4CYDA 1TQPA 2H94A 4A2UA 1TBXA 1EH6A 4OIOF 2EB7A 4IRHA 3BJOA 1IUYA 2P6TA 2ZNYA 3GFJA 1UHMA 1XDSA 5L3DA 5J8CA 5D5UB 2O03A 1BBYA 4IVNA 1O3RA 2RDPA 1BM9A 5HDKA 2A3SA 2HKXA 2XHKA 1YO5C 3QAHA 5D4RA 3ERED 3WTUC 3WTVC 3QRFF 1R5GA 4RAZA 1LB2A 4M71A 4A0ZA 2YR2A 3KFWX 4PGHA 3NRVA 4RB0A 4U0VA 5HLHA 2GIVA 1YIOA 4OU0A 5JFRA 1T38A 4ENMA 1NHAA 4RS8A 1YW7A 1WI9A 4KN4X 3GFIA 1QGPA 3T5XA 2FBKA 2FQ3A 4RGXA 2F5DA 1ZLKA 1IN4A 1D3YA 2ZFWA 4FX4A 2JT1A 3U2RA 3U1DA 2V1DA 4UV8A 2BBYA 5LLQA 4KDPA 1XDUA 1BC7C 3I59A 3ZMDA 4PGGA 2W24A 5BPDA 1L3LA 4JK1X 3PQJA 2IA1A 2L3DA 4ZYHA 5FLXK 2KKOA 2Z99A 2ELHA 1XB4A 4HYEA 1O7FA 2PMHA 2QQAA 1B9MA 1HW1A 1MDMB 4LFUA 4M6YA 3IKVA 4M9ZA 4P9UA 5LHHA 4I2OA 3R0AA 4MQVA 2LKPA 4ETSA 1HXDA 2FNPA 3S2WA 4L0ZB 1J75A 3GXOA 2HFHA 5D5WB 5ICCA 1UCRA 4Z2YA 1T2KA 4UNOA 3P9IA 1BOAA 3E6DA 1TTYA 2ZKZA 1QO0D 2HYFA 3HUGA 1ZRCA 4Y17A 4K2EA 5KK1A 2H27A 3K1PA 4L5IA 3WGGA 3B02A 2ISYA 5BQTA 3U9GA 2K4BA 1KGSA 5K5QA 4A0YA 3FM3A 2GXGA 1F4KA 4S04A 2QZ8A 4ESFA 2OQRA 4ENKA 3JTGA 4OIPF 3E97A 4BXUA 1ZG3A 4JQFA 1ZAOA 2Q0OA 4P5OA 1IAWA 1J0RA 1D8JA 4DQ2A 2EK5A 4RB3C 1MJ9A 1BI3A 1XGOA 4R79A 4U0WA 1FNNA 3DPLC 4ZYEA 2O0YA 2UWMA 4CZZA 3BOQA 4MEXF 4EM2A 4HF0A 3B73A 2W25A 5LGTA 1R58A 5CYVA 3Q5FA 1X3UA 3R6SA 2H09A 2IRFG 2P6SA 5KVRA 2L01A 4CDGA 3KEOA 1DDNA 1AWCA 5BMZA 3KETA 6PAXA 1HW2A 3ZQ7A 1S8NA 1KQ0A 3V8LA 4F7ZA 4KMUX 4QWQA 2QQBA 4IPAA 2JPBA 4EV0A 2CYYA 4LB5A 3TOBA 1XCVA 4L0YB 2BE5F 3K1NA
chains in the Genus database with same CATH superfamily
3AL0B 2LG4A 2VC1A 1R1UA 1MDMA 4ZC3A 5E8IA 3CLQA 1T56A 4CSWA 2DA7A 1LPQA 4UB8C 1IRGA 3BWGA 4ANJA 2P0WA 4GCVA 1JE8A 2BHYA 1D5YA 2K85A 4ENJA 3R0JA 2X9DA 5E1XA 4XBFA 5DM6F 2DTRA 5GAEJ 1WJDA 5GTHC 2JSCA 3JRHA 1U9OA 5EEHA 4EMSA 3PIOF 4ESJA 3L2WA 5M5YJ 1VQ6I 3EUKL 4KNYA 1MNMC 2W48A 1KZHA 3BJAA 1PYVA 1I1GA 1BR1A 2K9NA 3C3WA 3BTLA 3CCYA 2CQ7A 5DD8A 1FSEA 3RJPA 2LBFA 3S3OA 3HOXJ 4HNUA 3R60A 2JN6A 3CDHA 4PDKA 4FE7A 4NDLA 3OYHA 1TT0A 3BDDA 1IV8A 2ISZA 4IHSA 2BVMA 2GIZA 3GX4X 3HSEA 1ACIA 3KCCA 3RTRA 3ABMH 1LJ9A 4UHTA 3O3KA 1ZHFA 2HU9A 3CCJI 2HVRA 2NRAC 1IUFA 1R5HA 2Y75A 3BZ6A 3FKIJ 5FKOA 1K4TA 4A6DA 2FU4A 2VE8A 2V7FA 5EJCA 2FXAA 3RDIA 3ZR8X 3BCBA 5E3OA 2P7CB 2VKHA 4QPQA 1XPXA 2QKLB 4XKVA 1OKRA 5B1AH 1Z7LA 3BZKA 5HDNA 3OY9A 2DCEA 2QEXI 3RKWA 1I27A 2NVTJ 4KFCA 3WE2A 4JOMA 3GWZA 2FSWA 2R7VA 2M9HA 1IO2A 1U3EM 1ZREA 4BY7J 2L9VA 3JSOA 1NTCA 2VC0A 4C2TA 3WGIA 2NS8A 2MLGA 2DDBA 2LKSA 1FBQA 3GLXA 1P7JA 2R7FA 2Y9ZA 4Q48A 1ON2A 3FMSA 4KISA 5H2FC 1WWXA 3E3VA 3WTTC 3GYHX 1Y8RB 4YFXF 1SVMA 2WAQN 3HHGA 4ABZA 1A04A 3N97A 3RYRA 1R7JA 3ZN1A 4BXXJ 3CUOA 1JKPC 3HKZA 2JSPA 2MGQA 4MTDA 1X3ZB 3OYEA 4OIQF 1TWCJ 3SEZA 1QZYA 1OYWA 2R7QA 2W00A 4KYWA 3K2AA 1IDZA 4UV9A 4RAFA 5FGMA 2HPIA 5J8FA 4OMYA 3HXLA 2NS0A 2L54A 4C3JJ 5JHUA 4LIVA 3FXMA 2Q2EA 2DYSH 5EZGA 1U8BA 1Q1HA 4AVPA 4V2GA 3M9AA 1QQIA 2Y31A 4N0BA 4YIFA 2MABA 1HDDC 3FXUA 4ZYDA 1DGWY 4CCLA 3WTWC 3WG7H 1VQOI 5EGOA 1VZ0A 1TWFJ 2RC4A 1YX5A 1S29A 3MKLA 1I3QJ 3AG3H 4AUXA 2RNGA 2KRFA 3C2BA 4I99C 2YS9A 2K40A 2WV1A 5BOXA 3SZTA 3K69A 4CCMA 4KUMA 4U7BA 1RRJA 1BOBA 1YI2I 5TISC 1E3HA 2MA3A 1DP7P 3OMYA 2X4HA 2A6EF 3F8CA 4U88A 5HNFA 1YX3A 1IDYA 1ZG1A 5CQEA 3VFZA 2FUG2 4C3HJ 2KHMA 1PVEA 4QIWN 3IAM2 4UXNA 3G73A 2CUJA 2ZMEB 2MC3A 3O2PE 2Z9OA 1EA3A 1OCCH 3P9KA 2E7WA 1ZELA 3BG9A 3TO6A 3OSFA 3FM5A 1AA7A 2YPRA 1RNLA 3IKTA 2JK3A 3ISPA 5LBQA 2A6HF 5HDGA 2L9NA 1DQUA 1TLHB 1Z1DA 2K7LA 5GAHJ 2Q8KA 3ROUA 4HSTA 3LSPA 5D6FA 4G7OF 1RR8C 5HLIA 1ON1A 3PFYA 4D9JA 4IX7A 3SXYA 3MCZA 3TO7A 3JW4A 2OBPA 1B59A 4XM3A 2QSGX 2F2EA 2CUEA 4IL6C 1R00A 4M72A 4TV7A 1P92A 2ZXHA 1P2FA 2VOOA 1W5SA 3FISA 2XRNA 5A2QZ 1FEXA 4ZZLA 3ML6A 5F08A 1OR7A 1D8KA 4IEJA 3AAFA 3QYBA 4FHTA 5J47A 2LMDA 2W4SA 5FFZA 3U21A 2VQGA 2JPCA 3V7RA 5K7FA 5E1ZB 4LG0B 2CQKA 3MN2A 2ZJQF 2WC2A 2VQLA 1F9NA 2ELJA 5AIPA 4BS9A 2VPLA 2D2WA 3KPHA 3MMYB 2DA5A 2E2HJ 2EH3A 2KFDA 1L0OC 2XGCA 3O8HA 5ILSA 3VEPA 4FISA 3M8EA 4LB6B 4OMZA 2EFOA 3V7SA 5F04A 3VYUB 5D4SA 2NYXA 1HSTA 2QCOA 2VKVA 3RI4A 1XMKA 3DEWA 3COAC 1ZARA 2EV6A 3G3ZA 4G94A 2OUMA 3VYSB 3FWEA 2V26A 1IXCA 2Y48A 3Q9VA 1KA8A 4LOCA 3M1CA 3VODA 5LGUA 2OZUA 2VPRA 2O61A 5H6RA 4HF2A 5D5XB 3LQQA 3A2KA 1XN7A 2HI3A 3JRBA 2QBYB 1RI7A 3DU6A 3GFMA 4HQMA 5LRSA 2R5YB 4ON0A 2Z16A 1W5TA 3ZMSA 3TOAA 3MKZA 3HIFA 3M07A 1FOKA 5DDGA 1ZRFA 1W4MA 3KP6A 5CKTA 3WHCA 5LFAA 4V2FA 1K6YA 5FLVA 4BBRJ 4XRSG 1QPMA 4OAZA 1P4XA 2ICWG 3H5AA 3S15J 2DK5A 4WWCA 2EV5A 3F3XA 1GT0C 2DAOA 2STWA 1HC8A 2BEOA 2COBA 3IL2A 3PL8A 1H0MA 3OS0A 3PJRA 5F64A 4EATA 4LK0F 4DZJA 3TMOA 2ID3A 2JA7J 2VUMJ 1WCMJ 2E60A 4EJWA 2IGOA 3V7CA 4HA8A 5DV5A 2DQRA 2LH9A 4NHJA 1S9HA 3JAMZ 1V3FA 1FPQA 4DIQA 1U8RA 4ZH4F 2ECBA 3GO5A 4Z6YA 1FOXA 3R4KA 4L9JA 3QQAA 4H4KC 4ASNA 1R6RA 3HGGA 3WGHA 2V1NA 4M6XA 4RA2A 2NVXJ 2KZVA 2EJRA 4YIIA 5IT3A 5FJ8J 1V5GA 2DFFA 4ITVA 1P6RA 1XSDA 2MD0A 1WPKA 4KITB 1X2MA 3PNTA 3A4CA 1F43A 1VFCA 1H89C 1T6SA 1IW7F 2Y9YA 1FOYA 2A69F 3TDUC 2O8XA 1SFOJ 2G7HA 3ZQCA 3CCLI 2BGCA 4O5VA 5M5WJ 4NQWB 1XGMA 3L09A 4JYKA 4ZYGA 4O3MA 3ASNH 2M8EA 5FFXA 3BR5A 3F23A 4MNUA 1B8IB 4ZJZA 3IUOA 2F5EA 4LD5A 2M2EA 2DTZA 2KRCA 4G9YA 3ZXSA 2HGCA 1G8XA 3K9TA 3CC7I 2Z5UA 4I6ZA 3BJ6A 4MIMA 5TGTA 3LA3A 4E7KA 1TWHJ 2IS2A 2EIKH 3BY6A 2ZMEA 1NG7A 1JHHA 2MBFA 1FP1D 1WJ5A 4P55A 5ICFA 1ENHA 2M4KA 3KZZA 2GA2A 1QHHD 2BV6A 2JRTA 3DCFA 2LLKA 3WHBA 1OCTC 2PBIA 2VLAA 3PO2J 2ZBKA 2EQRA 3G1OA 1R4MB 2HOTA 4XSZF 4AIHA 3K0LA 1O3QA 4EJOA 5B5EC 1BL0A 1WZ2A 3IC7A 1SFKA 4F92B 5GPCA 2V79A 3J81Z 4EM1A 2OC6A 3L2RA 3G1LA 2EZHA 5H6QA 2PX9A 2WY8Q 5D8KB 2BY3A 1YS6A 1PUEE 4XLEA 1MSEC 3CP8A 4BH9A 2L2OA 5K5RA 4HAMA 1YITI 4GYGA 4HNTA 1WRJA 4Q5SF 2H6BA 1Y1VJ 1JUPA 3FXKA 1Z9CA 1ZRDA 3MFKA 2HQNA 2NVUB 3OYIA 4F93B 2VODA 1JXSA 5CJ9A 2XGXA 3JCUC 2V4JC 3L9FA 3VWBA 2R7XA 3GMEA 2NVQJ 3G2BA 5D6EA 2ZC2A 4C2MJ 2Y30A 3SYTA 3WTZA 4M9SA 4P96A 4PFOA 2RV8A 4Q47A 5CVIA 1JGGA 2ETHA 2AXLA 3OS1A 2D45A 2DFHA 4N9HA 2XRLA 1LFPA 1UMQA 3BT9A 2BXZA 2HVQA 3C2HA 4NNJA 1K78B 2XAQA 2NNYA 2D1VA 4LG0A 2V9KA 2PEXA 3FX3A 5FLMJ 2VKEA 5E17F 4CICA 1OPCA 2MD5A 4PCQA 2R7TA 2DOFA 2E19A 2JA2A 4UVCA 4IRGA 1USSA 3VPRA 4ESBA 2EZKA 2R7DA 2ID6A 3C2GA 3QU6A 4LLGF 2HOEA 3ZMZA 1FC3A 2LREA 3R61A 4FQGA 1F5TA 2KT0A 4XSXF 2HZTA 1ZLJA 3I58A 3HOWJ 5E79C 4Y13A 4HRIA 3HRTA 2QBYA 4RB2C 2M7AA 4IF4A 3HOTA 4C30A 2R5YA 1MJAA 2HOSA 4RAYA 4GRIA 1EKEA 1FBSA 3KP3A 5BS6A 4XLPF 4P1WA 3DF8A 2VE9A 1G2HA 3LAPA 4N4OB 3ZQGA 1P4AA 5HVQC 5E3NA 1Q1VA 1QHGA 1R71A 2DQLA 4M9XA 2J5PA 2VI6A 4N9IA 2V1XA 1QZZA 1FP2A 2Y0SA 5EEGA 3JR9A 4PJ0C 1XGNA 1FOWA 4C3IJ 1UZCA 4BHCA 1YW8A 3E0JB 3DEUA 4XKWA 2L7FP 4RMNA 2IVMA 1HLVA 1PDNC 2LD5A 3FF5A 3MEXA 1ZGWA 2HYGD 3HTUA 2F4MB 1USTA 3C7JA 3KZIC 2YU3A 2L4MA 2NOJB 2ME6A 3MZHA 2PI0A 2IAIA 3TKYA 1D0YA 2KJCA 3KYDB 1OMIA 1VI0A 2Z1DA 3BR1A 2UV1A 4MQ9F 4EJUA 3CF5F 3E6MA 5M5XJ 1OCZH 3AKZA 2RAEA 2V1UA 2W57A 4XK4A 4CUGA 4AIJA 4J01A 2JQ7A 1T33A 3RPUA 2VOPA 3HDDA 4G6TB 5KAIC 4A3JJ 5C3EJ 1R1VA 2QQ8A 4KIGA 1ORKA 3A02A 1LVAA 1XC5A 3W2AA 2LNBA 1YYVA 4R1HA 4M3GA 1JKRC 1G3WA 3HYIA 5FO5A 2JVHA 4AWXB 1UB9A 1IC8A 2R92J 4M74A 4NQWA 1LUJB 1TWGJ 4BE2A 1R22A 3GUDA 4HZFA 4LJZF 4R8HA 2XC7A 2XAJA 3I9V2 2QLZA 3WE3A 1B8IA 3K4LA 2FMYA 3VB2A 2L7MP 2X48A 1IG7A 1WH5A 5JI6A 4PFPA 2R7WA 1STZA 5E3LA 2LOOA 4D7NA 5L3FA 1WH7A 3HOZJ 2F48A 5F0HA 2HDCA 1MBJA 1R5ID 3ECHA 2DN0A 2EFNA 2GLOA 3LSTA 3I0TA 3PIPF 3CUQB 1YOVB 1W7PD 1EH8A 2DDAA 2DA4A 2E2JJ 3CO7C 3CJNA 4JX4A 4UY8I 3KZYA 3M8JA 3QU3A 4HX4A 3H9QA 2XSDC 5KHDA 4YFNF 1ONVA 1MZBA 3ECOA 2ESHA 2FQ4A 2IEKA 5D8LB 1ETXA 3H3UA 3K7AJ 1WHUA 3ZMUA 1ZGJA 4IO9F 2E1CA 5HS7A 3A01A 2OV7A 3GVAA 2B9SA 4MGRA 1H9GA 3TL4X 5IP6A 1WJAA 2QYOA 3PM1A 4BHPA 3D5LA 5EEAA 3F8NA 5EYRA 3S1RJ 1K79A 3LQRA 1BR2A 4PZJA 4A69C 3FMQA 1GVJA 3TGNA 2M3AA 4II2A 2BY2A 3TW7A 2BZTA 3LSRA 2VXZA 2FJ1A 2WWYA 1SEUA 4A93J 4BDZA 3HTSB 5LEJA 2V9PA 1D0ZA 5CPRB 5D5VB 3HB9A 4A0XA 3CP2A 3KP4A 4LG3A 4E70A 4D5CA 2W85A 2G9WA 3FKJA 3SJMA 5C4XJ 5J4VA 3WTSC 1UELB 1K78A 3MKWB 4YFKF 1KYZA 1X19A 4FETA 4GXOA 1G3TA 3I3LA 2DJIA 2QENA 2VBXA 2VQCA 5A2QK 1V55H 4UUSB 2V6EA 2L02A 1CQTA 3H9GA 1T8IA 3CCMI 3OYFA 4XONA 4M3EA 2CO5A 1SD6A 3MWMA 2K02A 2XIGA 4DYCA 3OYLA 3IRRA 2M30A 4LMYA 1K7AA 2M8GX 4UUVA 5F1RA 1U5TB 2CV0A 4EGYA 2M0CA 4F52A 2DK8A 4LLLA 2L7KA 4B43A 1X4PA 2JVGA 1ZN2A 4AD9A 2HTSA 4BJ5C 1SMTA 2K4JA 5FD6A 1A6IA 2FBHA 3KE2A 2R7ZJ 3BLYA 5E20A 3I4NJ 5ERIA 2KRHA 4IQ4A 2ZNZA 1J59A 1IXSB 2K9QA 1R9TJ 3I4MJ 5K7HA 4BHBA 1UHWA 4L5EA 3EYIA 1XMAA 3D1NI 3DLLF 2NOGA 2DA2A 5ICGA 1O3TA 4RB1A 2NXNB 5KCMA 4IOAF 4D7MA 1X1BA 3E5UA 2X1CA 3ZMTA 1AOYA 3OYDA 3ZCOA 2LK2A 1RIOH 2YX7A 1ULYA 1ODDA 4C2UA 5DM7F 1Z21A 5IYDJ 2YUSA 3C1DA 1K61A 2E71A 2MC4A 5B3SH 3LA7A 2IT0A 2HZDA 3PO3J 3TO9A 4F3QA 2DOEA 3MZYA 2CV2A 3L1PA 3GTQJ 3HPGA 2HTJA 2DXIA 5C44J 2L5QA 3JSPA 2IS4A 3CMMA 3DTEA 3PUFA 1FYLA 1O7LA 3CCVI 4EM0B 4G6DA 1T0FA 3CQZJ 3KX2A 3MAJA 2LKXA 3JRCA 5HLGA 1WI3A 2LF8A 3K4NA 2XF5A 3BCAA 3RPQA 3M7GA 1SD4A 1VF9A 2TDXA 4B4CA 1DP3A 2RQPA 1TQIA 1KU3A 3BPXA 4D5FA 2AHQA 4KIFA 2LTPA 4N4NB 1B1BA 4U87A 1Z0XA 2M5WA 3LA2A 4ZDOA 4PK4A 2XKPA 2P4WA 1IN7A 1LQ1A 2QWWA 3P9CA 3JAMK 3RIRA 2RGVA 1OQYA 2O6GE 3F8BA 2VBWA 1DUXC 3EUHA 1YIJI 2OTJI 1MNEA 3B6CA 3HEFA 4RGRA 4LIUA 1G4DA 5GADJ 4A3CJ 4DBRA 1G3SA 4CCOA 3LWFA 2IGKA 4XRFA 1SMYF 2ELKA 2OD5A 2DYRH 1HF0A 2LF7A 3ZQIA 1IRZA 1ZG5A 2FBIA 2EV0A 3QP5A 4AVZA 1WJCA 2EFWA 2R7SA 5K5OA 3ZQLA 3RCOA 3BQZA 4MO7A 3VSKA 1J2XA 5ILVA 3BR6A 1RUOA 5E1WA 1BW6A 3GCMA 2J5OA 4BUPA 4UUTA 1Z6RA 3CUQA 1Z6TA 1J9IA 5FD5A 3W6JB 2A6TA 3DPTA 5DD4A 1BIBA 3T1BA 4ENNA 1YG2A 1OCPA 2ZXJA 3F8FA 5IOZA 4MTEA 2A5WA 2IA2A 3HSRA 2HEOA 3G4SI 5E3MA 1MD0A 5KNLA 3HOYJ 4BBSJ 4HX7A 4IXAA 2K3PA 1TW3A 3BG5A 2VJ5A 1ETVA 1KU2A 1KONA 2DA1A 1JT0A 3ABTA 4II3A 3H1CA 3LNQA 1FX7A 3FXRA 1RKWA 2ECCA 4EVIA 3J81K 4BYYA 2Z33A 1QBJA 5LHIA 1N25A 4IRIA 1C0WA 3HL2A 3CCEI 4PJJA 2DODA 5EF6A 2W84A 4DNCA 3EPZA 4EGZA 1SFUA 1RZ4A 1R36A 4Y4RA 1FY7A 1TQMA 1Y1WJ 4I02A 1XSXA 5J40A 3FMRA 3F22A 1YS7A 2I5UA 3W2WA 2CG4A 2F4IA 2LDUA 1EV7A 5LEKA 2Z2SB 3IWFA 4NBQA 4XN3A 4UUSA 4U7DA 3WU1B 4B3XA 2GOXB 1J7KA 1X58A 3ZP5A 3M3YJ 2M45A 3CTAA 2X1EA 2KIMA 4GDFA 4S0HB 1U5TA 1W1WE 2CQNA 2DLLA 3FBNB 4Q4ZF 1FYKA 2GXAA 1FIPA 2B0LA 2FOWA 4XOTA 1HKSA 1A6QA 1MBGA 4YELA 4XRSA 2ADUA 4A12A 1LE8B 3ZOBA 1IGNA 3W6VA 1OISA 3NEUA 5FKLA 4WX9A 4FX0A 1VQ4I 1JKOC 2FNAA 1A31A 4KT6A 4H0EA 2PG4A 2XAFA 4BU2A 2MG4A 2VN2A 5JLWA 1U78A 4LITA 1POGA 3P5JA 4HOBA 1XD7A 5JHFA 1BJZA 3RYPA 1GUUA 2VQHA 1IXRC 2EBIA 2D5VA 2XKOA 3H35A 3S16J 2WTEA 1T98A 1GVDA 3FHZA 2HOAA 3D0SA 3ELKA 3JRFA 2DT6A 2CMPA 2DFEA 3KP7A 3LSIA 4OINF 3TEDA 3KLOA 5TJJA 2DJNA 1VQ9I 1P9QC 2VL8A 4O6JA 4HLYA 2VBYA 4NC7A 5IYCJ 2D1HA 4BQAA 4Y33A 1NK3P 3QPSA 2P81A 2E1MB 2XVCA 2CW0F 1JJ6C 3GF2A 1QPIA 2H6CA 2PN6A 3FBIB 3OOUA 1OLTA 4OIRF 1YJNI 2RNJA 2QQ9A 3E6BA 3HM5A 3QWLA 5IT9Z 2XDVA 1U2WA 1SC7A 3QYFA 1FBUA 1QNTA 2HVSA 3I4PA 1ETYA 2R7UA 4L9VA 3F8MA 5DUKA 2BVLA 3Q0UA 1MGTA 1W7PB 3F21A 1OJLA 2FMLA 4EQQA 3HKZN 1SAXA 1SFEA 2IXSA 1DU6A 3HSFA 3VYTB 2IJLA 5HS8A 4GGGA 4AIDA 4GYIA 4ZDPA 2OZ6A 1YW9A 2IP2A 1ZK8A 2P5KA 1MBFA 1BC8C 1MNDA 1S7AA 4M3DA 2HNHA 3LSKA 4XN0A 2K9LA 1H8AC 2MLKA 2RVCA 2KZGA 3AL0C 3HRSA 2WB1A 2X1DA 2M7BA 2VASA 3HPHA 3RKYA 3X2QH 1TZLA 2NVYJ 5DS9A 1RUNA 3BROA 3GTMJ 3N4MA 4QPOA 3NAUA 1OR7C 4E7LA 3K10A 1TNTA 3ZQQA 2JZYA 1Y56A 3RKQA 1MMAA 1EH7A 3OV8A 3SDGA 3ERMA 2QM3A 2Y69H 1IN8A 2XGEA 4AIKA 3A1YA 2AS5F 4WK8F 2P5VA 1SVLA 1YFHA 3M1EA 5L3CA 2E1NA 1H9TA 1IRXA 3TBIA 1APLC 4DYQA 4CO8A 3GTLJ 1Y0UA 1JI8A 4MFDA 2OAZA 3H3ZA 3WTYC 3OYGA 1FYMA 2KDZA 4AM3A 5CVUA 3H3VK 1V5EA 2G7UA 5FROA 2FA5A 1BJAA 2H1KA 2F4OB 3GTGJ 2ZB9A 3IH3A 2XAHA 2A68F 5EG0A 4BQOA 3CESA 4XICA 3CC4I 3MQ0A 3TDZC 2E5NA 3ZMVA 1R1TA 2KP6A 2VKDA 2M0MA 4CXFA 1GHCA 1RC9A 4B48A 3GTKJ 1PP8F 1IZ1A 1HA8A 2BXYA 4RBOA 1B9NA 1G6NA 1YRNB 3CO6C 3S2DJ 2XGDA 3AG1H 4ZDLA 4MEYF 1OYIA 2M4GA 4HG2A 1JTXA 4E4HA 1S6LA 3A01B 4LGWA 1S3JA 3ABUA 3I55I 3CLOA 3KP2A 5F27A 3O8GA 2Z3YA 5IP7J 1LE8A 4HDUA 1FTZA 4U0YA 2LYCA 3L00A 3OYAA 2AQEA 3EQLF 1Y0NA 2F6CA 2DFIA 4CCKA 2P5LC 4E7IA 1S5LC 3U1KA 2QF7A 3V8KA 1GXPA 3I54A 1QZEA 4BQQA 2DOAA 1VQMI 4WCGA 3MD2A 4NC8A 3HRMA 3IHUA 2DI3A 2XV4S 3WG9A 5LHGA 3F6VA 1MBKA 3JRGA 3E7LA 3L2CA 1X1DA 2WV0A 2E36A 2R3SA 3KP5A 1DPUA 5LRRA 4DOZA 1U6GA 3CMYA 1X1CA 4I98B 4HEA2 3S93A 3FK7A 1JHFA 3E6CC 1MH3A 2KL4A 2LSOA 3GZ5A 5IY5H 2CSOA 4PJMA 4RGUA 2K86A 3F6OA 1ZYRF 1CGPA 1IV6A 1UJ8A 4L9TA 3DBHB 5GP9A 3BTJA 2C6YA 4CZCA 3MKYB 2CH0A 3SZPA 4PJLA 2M87A 3I56I 2L0KA 2H1LA 4RLFA 3K4JA 1W5CC 3KYLA 5E18F 2OQGA 2CJJA 5FKMA 4BAYA 4E7SA 4A3MJ 2CGPA 2PQ8A 4KIBA 5AIQA 3QPTA 2G0EA 2BY0A 4J19A 4GO1A 2FOKA 2TCTA 2NNNA 2CS3A 4XKCA 5L3BA 1RR7A 1SD5A 3HOSA 4PUSA 4XNFA 3HGYA 4A5NA 3QP6A 2KMUA 2LVSA 2M1BA 2ZMEC 1Z67A 3S8PA 2MFZA 2FE3A 1KQ8A 3PFIA 5DCFA 1W7PA 1B4AA 2K5CA 1GXQA 4HX8A 1Z77A 3MVPA 4WXCA 2JMWA 3FXQA 3T8RA 4XR6A 3GFLA 1D1BA 4PSXA 4D0PA 4BL0B 2EA4A 3QOEA 1G3YA 4Y15A 3VOEA 4XLCA 4E7ZA 1VQLI 3GBGA 3OR2C 1J5YA 4A6EA 3S2HJ 1OYYA 2W1OA 3FZVA 3EDPA 1E2XA 2CFOA 1PP7U 3I64A 2XPUA 1QVTA 1XG1A 1S7OA 2JRMA 4NB5A 2IBDA 2RN7A 1KU7A 4S05A 4Y3OA 5CVVA 2XROA 1ZKGA 2WBMA 4HNVA 2WAFA 3GEZA 2JA5J 3V4GA 2EZLA 1J09A 3DKWA 2IGMA 4BDYA 1XSVA 3PQKA 1ETOA 1UHSA 4PSWA 1PJRA 3VSLA 5J4YA 3J7ZI 3BTIA 1IF1A 3OYJA 2NS7A 3BZCA 5EZHA 2XUBA 3VDXA 3OSGA 4KN7X 2P8TA 2DA3A 3J80Z 2VONA 1TP4A 3NWSA 4IOCF 3GTOJ 1V4RA 2EA2A 4YG2F 1TNSA 3DBRB 5J6XA 2VJ4A 2LY2A 1UG0A 1YE9A 2GQQA 5CVRA 2HS5A 1SAUA 2PMUA 1D5VA 1MMNA 3SFIA 5L3EA 2DPDA 2FRHA 3DKXA 1N77A 3V8JA 4BE1A 2B63J 4CYCB 1I3AA 3CDIA 1LEBA 1Y6IA 4A3DJ 4MHGA 4X6AJ 1FTTA 3TP0A 3RKXA 3IP4B 2YSRA 2DMTA 2O3FA 4I7HA 5LD2C 2E7XA 5IYBJ 3QPHA 1XGSA 1JT6A 3LFKA 5ILUA 1FMWA 2VJJA 1FWZA 3AFHA 1WKMA 4G8XA 5HS9A 5TRDA 1T39A 4BKXA 4UVBA 2XPVA 2KIQA 2ZSHB 3J7AY 4HBLA 4BXFA 4A3FJ 5AONA 4B1RA 4WXHA 1FT9A 2PJPA 1YRNA 3SEQA 2V6CA 4M3FA 4HQEA 1S72I 5ICEA 1WJBA 4BGDA 3NWTA 1B6AA 1VQ5I 3ZPLA 3CC2I 2VBZA 4QTRA 2UXNA 1E3OC 2MYSA 4E7HA 3BR3A 1BI0A 3H9JA 1ZGAA 4W1UA 3TQNA 3T8TA 2JJ7A 2A61A 3I71A 4RGSA 3EUAA 2ZXIA 1JGSA 3HHHA 3JTHA 4EJVA 3G71I 2GXBA 1VTNC 2KISA 5DEQA 2QSHX 1D1AA 4XLNF 2ZJRF 3CCUI 3IRQA 5HOOA 1A5JA 3UKGA 2X6WA 2MH9A 1SD7A 4CCNA 4B47A 3OIQA 2XASA 3S17J 2XAUA 1I39A 1HBXG 1LEAA 4B09A 2COMA 3B6AA 4JX5A 3K4BA 3MZ8A 1IN6A 3I5UA 3DBLB 2L7ZA 2QSFX 3NARA 4G6QA 1BA5A 5K7ZA 3OL3A 2R93J 1I5ZA 4X0GA 1R4NB 4I0AA 4G7HF 2OTLI 2XAGA 2K9SA 3RPUD 3KEQA 5DCMB 2DA6A 3I53A 3L2QA 1LDDA 1CF7B 2GA1A 2OPTA 5BPIA 2GZWA 3ONQA 2IPQX 2RREA 3HZJA 1HKTA 1HW5A 3CJRB 4QLCU 1UG2A 1X3WB 4KA4A 1MBHA 3KIOA 2L9SA 2RKHA 3RQIA 2Y0SN 3BG6A 2VT3A 1S7EA 1XX5A 2PFBA 1M1EB 1MH4A 3SQNA 1F36A 3G1MA 1X4OA 2KIFA 3M4OJ 1JJ8C 2CWEA 1O57A 1YQAA 4LLNA 1DPRA 2JUCA 4ZZDA 2CUZA 3WU2C 1MMGA 2DPUA 4I0BA 1FMVA 1I6HJ 5IT9K 4IHWA 1UAAA 4IHTA 5FLXZ 4I76A 1BI1A 3Q9SA 2HYJA 1H88C 2AXTC 4P9FA 1XS9A 2EZIA 4JX6A 2FD5A 4Y7NJ 2X85A 2AQFA 3WU0A 4E7JA 2LY9A 3VYRB 2LP0A 4FE4A 2RQQA 4DZPA 2EFPA 5IPAA 2DW4A 2OU2A 1BIAA 1FZPB 2B7EA 4A3BJ 2WADA 1Z7UA 1SVOA 1WQ2A 3FK6A 3DV8A 3OOPA 4UB6C 5F6FA 1KQ9A 4JBAA 4B8XA 3BQYA 2BHZA 4HF1A 4UVAA 2HQRA 4FTHA 3K6GA 2EFQA 2ACJA 5GAGJ 1TL8A 1E0EA 3TP3A 3OIOA 1UFMA 1VQ7I 1FIAA 3C18A 2GAUA 3HJEA 3WODF 3S1QJ 2HR3A 1K6OA 1LDKB 2CU7A 4IJAA 2OA4A 4YIRX 5GPAA 4I01A 2IS1A 3S3NA 2O8KA 2UXXA 2R4GA 2OCEA 2MSYA 3H0GJ 4CYCA 3H0DA 3SHFA 3ULQB 1NH3A 2STTA 1YJWI 3RZDJ 3JRIA 3A0HC 2ZFUA 2QGUA 2PJRB 3HBLA 2CV1A 1FSHA 4KMFA 2EIMH 5LGNA 3ZN0A 5F0CA 4XOPA 5ED4A 3J7YJ 1P7IA 3BTCA 2A5YB 2EIJH 1IRFA 3L7WA 3DKYA 5J3LA 4L9NA 2K3FA 1D0XA 4PJNA 4CGZA 2DU9A 1A35A 1SFXA 2KIUA 3ZRGA 1JTYA 4XMYA 2A07F 2KJBA 4XQFA 3HOVJ 1HDPA 1OCRH 1I1SA 3DTKA 2HPMA 2ZJPF 3DP7A 2X0LA 1F1ZA 2QKMB 2ZJ2A 1WSUA 1HOMA 4JP0A 4OOIA 3KYCB 2MW8A 3GZNB 2CW7A 4RM2A 3LSMA 4HV5A 1ZQ3P 3BR2A 4XLFA 3DU5A 4A3EJ 3IWZA 1T95A 3OYKA 1N75A 2DT5A 1P4WA 2F5FA 5JVTA 2OF7A 5DUIA 1O3SA 1OCOH 2ESNA 1WVRA 5CLSA 1YJ9I 1T0FC 1Z91A 3S1MJ 1BW5A 2GBYA 4QSHA 1MJBA 5EG0B 2LC2A 4KJZA 5H20A 5M3MJ 4CHUA 1EJ9A 2R5ZB 2HKOA 2FX0A 5CVJA 1G59A 3CMAI 2JTVA 3LSJA 3UR3C 4XRMA 3IH4A 5DYMA 1I6XA 4A5MA 3GLLA 2QUFA 1KYWA 3REOA 2M34A 3EUHC 3O6BB 3DQVC 4M73A 4BY1J 1B72B 1KU9A 1BN5A 1ZR4A 2I8DA 1Z05A 3GW2A 4HLXA 3SFZA 2UZKA 1FLIA 2GOMA 3T0YA 3FXJA 4LK1F 2X6YA 4RDUA 3FIWA 5J1YA 1WGXA 5DCMA 2V9VA 2IW5A 3CJQB 1CF7A 3SDBA 1XCBA 2E5ZA 5IP9J 2HWVA 1HQCA 4WXDA 4CA0A 4DGWB 1GV5A 3K2ZA 1VQNI 5F1JA 5JR3A 3HRUA 1W0TA 2JA6J 3P7NA 3PNVA 1IN5A 2MH2A 3EETA 2L4AA 2OJED 5L3GA 4G7ZF 5FRMA 3BP8A 3HOUJ 2EWNA 2NAZA 5J1RA 5FB2A 2FF4A 2O5RA 2OCCH 2ME0A 4HW0A 1ZH5A 1YTYA 1ZTRA 3OIPA 2A05A 1T08B 3D5SC 4E6KG 4B44A 3CUQC 2WAEA 2IA0A 1O4XA 3GZ6A 4BJ6C 2GWRA 3W2VA 1MKMA 1MW7A 3ABLH 5HLTA 4EJTA 3V42A 1V54H 2HQAA 3I59B 1LNWA 2K27A 2BOLA 4A3GJ 1HSJA 4L18B 3H92A 2VJIA 2DMUA 3CCRI 4NUBA 3FXOA 5K1YA 2IGNA 4L5JA 3KLNA 3K70C 4IKFA 3QOPA 2XF7A 4FASD 3EYYA 2BYVE 2P7VB 4BQNA 1SANA 2N8GA 1R23A 1TW2A 1LFUP 3JRDA 2CUFA 4W97A 2QVOA 3J7AO 2CFXA 3W3CA 1PUFB 1ZR2A 1YLFA 4KT5C 2ZCWA 3RSNA 3CMEI 3K70D 3K1MA 3F72A 3GTJJ 2YX4A 4XORA 3LSHA 3OWTA 3LAJA 1TT5B 3BPVA 4FT8A 1BI2A 2VT2A 4WF2A 2PLYA 3UNGC 3W6KB 2DO7A 2DBBA 3A03A 5FKNA 4AU7A 5CQGA 5GTIC 5E8GA 3WTXC 4FCYA 3DXJF 1HKQA 3CJTB 2F5CA 1U5TC 1E17A 3J80K 4HDVA 1REPC 4X1EA 4I09A 3ESWB 3A0BC 5BNGA 1RESA 3Q0WA 3E5XA 2PJRA 3DLAA 5JLXA 3H5RA 3M8FA 2ZO4A 4DW6A 2FEZA 2WY7Q 3NQOA 2Y0MA 1LDJA 3E5QA 4MLOA 4BNCA 2ZXWH 2DMQA 9ANTA 3HUGB 4HV6A 3DFGA 1QVUA 3K4MA 4KICA 4M6VA 2Q1ZB 4CYDA 4OWRB 1DU0A 1MIJA 2GM4A 2ZSIB 1TQPA 2VXDA 2H94A 4A2UA 1TBXA 1EH6A 2CRGA 2EB7A 4IRHA 3OYMA 4OIOF 3BJOA 1IUYA 3H5NA 3LL7A 2P6TA 2EPFA 2ZNYA 3GFJA 5HODA 4Y52J 4XKBA 3AG4H 1UHMA 5J1UA 2PMZA 4ZTFA 3Q0VA 1XDSA 5L3DA 4AC0A 4DJAA 1OFCX 2H8RA 3BG7A 5J8CA 1JUMA 1VQ8I 3FDYA 4XLHA 5D5UB 2O03A 1BBYA 4GFBA 4IVNA 1DGRM 1O3RA 2RDPA 4C9YA 5B1BH 2R5ZA 1BM9A 3CD6I 5HDKA 2CQQA 1RKTA 2A3SA 2HKXA 2XHKA 4BJTA 4XL9A 1YO5C 1A36A 1EF4A 3E1SA 2XF6A 3QAHA 5D4RA 3ERED 3WTUC 4M3BA 3CZ6A 3DWLE 3WTVC 3QRFF 1B72A 4G12A 1R5GA 4RAZA 1LB2A 4M71A 3QODA 2YR2A 4A0ZA 2JA8J 4DBQA 2R0QC 1LVKA 3BG3A 2AO9A 2KLOA 3F9KA 2VIXA 3KFWX 4EEFG 3OYCA 4PGHA 3ASOH 3NRVA 4RB0A 4U0VA 5HLHA 4A3KJ 2GIVA 2E1OA 1YIOA 1GDTA 4RM3A 2R7RA 4OU0A 4MFEA 2KPMA 5JFRA 3G6EI 1TC3C 1ETQA 1T38A 4ENMA 1NHAA 4RS8A 1YW7A 3CCSI 1WI9A 4KN4X 3GFIA 5DTDA 1QGPA 3T5XA 2F5VA 2LFBA 1VQPI 2FBKA 4XIDA 2FQ3A 2JWTA 4RGXA 1MMDA 2KQRA 4AYBA 3IAS2 4BE0A 3KEYA 1HCRA 2F5DA 1ZLKA 1IN4A 1D3YA 3GTPJ 2ZFWA 2I10A 4FX4A 2JT1A 1K4SA 1U0JA 3U2RA 4YEJA 3U1DA 3S32A 2V1DA 4UV8A 4RLQA 2BBYA 5LLQA 4KDPA 4D1QA 3RZOJ 1XDUA 1BC7C 3I59A 4ZYAA 1ETWA 3ZMDA 1AKHB 2H8WA 2W24A 4PGGA 1GLNA 4CCJA 2BW3B 3PUBA 3OS2A 5BPDA 3D5RC 1WJFA 1L3LA 4JK1X 3PQJA 2HQ5A 2IA1A 2L3DA 3K4KA 4ZYHA 5FLXK 2DMNA 3BC8A 3DEEA 3S1NJ 5JVGF 2XSJC 5B66C 2K9MA 1LFBA 2KKOA 2Z99A 2ELHA 1XB4A 4HYEA 1PUFA 5HNHA 1JUSA 3K4CA 2XB5A 1O7FA 1R49A 3LFUA 2PMHA 1YHQI 4IHXA 4BEHB 3DTIA 1QU3A 2QQAA 4IZZA 1B9MA 1HW1A 1N78A 1MDMB 5M3FJ 2WB1N 4LFUA 4RAGA 3LOCA 1ETKA 4M6YA 3ABKH 2O9LA 3IKVA 4M9ZA 4P9UA 2HDDA 4YRVA 5LHHA 4I2OA 1WJEA 3R0AA 4MQVA 2LKPA 4ETSA 5FKKA 1HXDA 2FNPA 5KAFC 3S2WA 4L0ZB 3QPLA 1VNDA 4CH7A 2LRDA 1J75A 1X1PA 3N05A 3GXOA 2HFHA 5IOYA 5D5WB 3BR0A 5ICCA 1UCRA 3RQ4A 1X1AA 4Z2YA 1T2KA 4UNOA 3P9IA 1BOAA 3E6DA 1W0UA 2HXOA 2LBFB 3F0CA 1AU7A 1TTYA 4V19K 1GV2A 2ZKZA 4XLAA 1QO0D 3CDLA 4HPQA 3S3MA 2YU9J 2HYFA 3HUGA 3L2UA 1ZRCA 3FXLA 4Y17A 4B3AA 4K2EA 1Z3XA 5KK1A 2H27A 1VQKI 3K1PA 4L5IA 5EDNA 3WGGA 3B02A 3JREA 2R7OA 2PMZN 1ERDA 2ISYA 5BQTA 3OYNA 3U9GA 2E34A 1Z3YA 2DMPA 3OYBA 2K4BA 2XB0X 2XPWA 1KGSA 5K5QA 3OR1C 2VB6A 2X51A 4BACA 2CQXA 1MSFC 1JKQC 1NG6A 2HDWA 1LKXA 4A0YA 3S14J 3FM3A 2GXGA 3IH2A 1F4KA 5F0FA 1NK2P 1QA6A 5FRNA 4S04A 1WFXA 2QZ8A 4ESFA 4J00A 2JUGA 3DPUA 2E1MC 1RPWA 4NC6A 2BY1A 2OQRA 4ENKA 3JTGA 2EILH 4OIPF 3L2VA 3PSIA 3TW6A 4A3LJ 3HC7A 3E97A 4BXUA 1ZG3A 4IHVA 4JQFA 1XTAA 1FJLA 1ZAOA 2Q0OA 4P5OA 1W36C 1IAWA 1J0RA 1D8JA 2HXIA 2E35A 4DQ2A 3ZGKA 2EK5A 2QA4I 1V5FA 4RB3C 1Y8QB 3PNYA 1MJ9A 1BI3A 3SZGA 1XGOA 2LY1A 1W36D 3CF2A 4R79A 2W7NA 4U0WA 1FNNA 3PSFA 1K83J 4F91B 1MMSA 3DPLC 3FHNA 1XMXA 4ZYEA 2WAQA 2O0YA 4AYBN 2E2IJ 2UWMA 4CZZA 3BOQA 4MEXF 2Q2EB 4EM2A 1Y39A 4HF0A 3B73A 4IHYA 2X6XA 3Q3SA 2W25A 5LGTA 1X2NA 2O7OA 2UUZA 2LR8A 1R58A 5EGOB 5CYVA 3Q5FA 1X3UA 4IQJA 4ZTJA 3AG2H 2WA0A 3R6SA 2H09A 3ZQFA 2KDOA 3CCQI 2IRFG 2P6SA 2X6OA 5C4JJ 5KVRA 3HG9A 2TRTA 2L01A 2CW8A 4CDGA 1IJWC 1QRYA 3IV5A 3KEOA 1DDNA 1AKHA 1AWCA 2EINH 3JRAA 3QYEA 5BMZA 2BW3A 3LMMA 1TWAJ 4F55A 1RETA 3KETA 2W82A 1HW2A 6PAXA 2L9RA 3ZQ7A 1S8NA 1KQ0A 1I50J 3V8LA 3LSGA 4F7ZA 1U9NA 2DT7B 1AHDP 1D1CA 4KMUX 1MBEA 3ZQHA 4QWQA 1E3PA 2QQBA 4IPAA 2JPBA 1ITYA 4HSRA 4EV0A 2CYYA 3H36A 4OAYA 4LB5A 1BR4A 3TOBA 1XCVA 4DYRA 2Y2ZA 4BEHA 4L0YB 2IS6A 4A3IJ 3OL4A 2BE5F 3K1NA
chains in the Genus database with same CATH topology
2VC1A 1R1UA 1MDMA 5E8IA 1IRGA 3BWGA 1JE8A 4GCVA 4ENJA 3R0JA 5E1XA 4XBFA 2DTRA 2JSCA 5EEHA 4EMSA 4ESJA 4KNYA 3BJAA 1I1GA 3C3WA 5DD8A 1FSEA 3RJPA 3R60A 3CDHA 4PDKA 3BDDA 4IHSA 2ISZA 3GX4X 3HSEA 3KCCA 3RTRA 1LJ9A 4UHTA 3O3KA 1ZHFA 2NRAC 2Y75A 1R5HA 3BZ6A 4A6DA 2FU4A 2VE8A 2FXAA 3RDIA 2P7CB 1OKRA 5HDNA 3RKWA 1I27A 4KFCA 3WE2A 3GWZA 2FSWA 1U3EM 1ZREA 3JSOA 2VC0A 3WGIA 2MLGA 1FBQA 3GLXA 2R7FA 4Q48A 1ON2A 3FMSA 1WWXA 3E3VA 3WTTC 3GYHX 4YFXF 3N97A 3HHGA 1A04A 3RYRA 1R7JA 3ZN1A 3CUOA 4MTDA 4OIQF 1QZYA 1OYWA 4KYWA 4UV9A 5FGMA 5J8FA 4OMYA 2NS0A 2L54A 5JHUA 2Q2EA 1Q1HA 4AVPA 3M9AA 1QQIA 4N0BA 4YIFA 3FXUA 4ZYDA 3WTWC 2RC4A 1S29A 2KRFA 5BOXA 3SZTA 3K69A 4KUMA 4U7BA 2MA3A 1DP7P 2X4HA 2A6EF 3F8CA 4U88A 1ZG1A 3VFZA 4UXNA 3G73A 2ZMEB 2MC3A 3O2PE 2Z9OA 3P9KA 2E7WA 3TO6A 3FM5A 2YPRA 1RNLA 3IKTA 3ISPA 5LBQA 2A6HF 5HDGA 1TLHB 1Z1DA 2K7LA 2Q8KA 3ROUA 5D6FA 4G7OF 5HLIA 1ON1A 3SXYA 3MCZA 3TO7A 3JW4A 2OBPA 1B59A 2F2EA 4TV7A 4M72A 1R00A 1P92A 1P2FA 2VOOA 1W5SA 2XRNA 5A2QZ 4ZZLA 3ML6A 1OR7A 1D8KA 3AAFA 4FHTA 5FFZA 2JPCA 3V7RA 5E1ZB 4LG0B 2CQKA 2WC2A 1F9NA 5AIPA 2D2WA 1L0OC 5ILSA 3VEPA 3M8EA 4LB6B 4OMZA 2EFOA 3V7SA 5D4SA 2NYXA 1HSTA 3RI4A 1XMKA 3COAC 1ZARA 2EV6A 3G3ZA 4G94A 3FWEA 1IXCA 2Y48A 3Q9VA 1KA8A 3VODA 5LGUA 2OZUA 2O61A 5H6RA 4HF2A 5D5XB 3LQQA 1XN7A 2QBYB 1RI7A 3GFMA 4HQMA 5LRSA 4ON0A 3ZMSA 1W5TA 3TOAA 3HIFA 1FOKA 5DDGA 1ZRFA 1W4MA 3KP6A 1QPMA 1P4XA 2DK5A 4WWCA 2EV5A 3F3XA 2DAOA 2STWA 2BEOA 3IL2A 1H0MA 5F64A 4LK0F 4EJWA 3V7CA 4HA8A 5DV5A 2DQRA 4NHJA 3JAMZ 1V3FA 1FPQA 1U8RA 4ZH4F 3GO5A 3R4KA 4L9JA 4ASNA 3WGHA 4M6XA 2EJRA 4YIIA 5IT3A 1P6RA 1XSDA 1T6SA 1IW7F 2A69F 3TDUC 2O8XA 2G7HA 2BGCA 4O5VA 1XGMA 3L09A 4O3MA 4ZYGA 2M8EA 5FFXA 3F23A 4MNUA 4LD5A 2F5EA 4G9YA 2HGCA 3K9TA 2Z5UA 3BJ6A 3LA3A 3BY6A 2ZMEA 1JHHA 2MBFA 1FP1D 4P55A 5ICFA 3KZZA 2GA2A 2BV6A 2JRTA 2PBIA 2ZBKA 4XSZF 4AIHA 3K0LA 1O3QA 4EJOA 3IC7A 3J81Z 2V79A 4EM1A 5H6QA 5D8KB 1YS6A 1PUEE 4BH9A 5K5RA 4HAMA 4GYGA 1WRJA 4Q5SF 2H6BA 1Z9CA 1ZRDA 3MFKA 2HQNA 2VODA 1JXSA 5CJ9A 2XGXA 3L9FA 5D6EA 3WTZA 4M9SA 4P96A 2RV8A 4Q47A 5CVIA 2ETHA 2AXLA 2D45A 4N9HA 1K78B 2XAQA 2NNYA 2D1VA 4LG0A 2PEXA 3FX3A 5E17F 4CICA 1OPCA 2MD5A 4PCQA 4UVCA 4IRGA 1USSA 4ESBA 2R7DA 3QU6A 4LLGF 2HOEA 3ZMZA 1FC3A 3R61A 1F5TA 4XSXF 2HZTA 1ZLJA 3I58A 4Y13A 3HRTA 2QBYA 4RB2C 4IF4A 3HOTA 1MJAA 4RAYA 1FBSA 3KP3A 5BS6A 4XLPF 3DF8A 2VE9A 3LAPA 1P4AA 5HVQC 2DQLA 4M9XA 2J5PA 4N9IA 2V1XA 1QZZA 1FP2A 5EEGA 1XGNA 4BHCA 1YW8A 3DEUA 1PDNC 2IVMA 3FF5A 3MEXA 2HYGD 3HTUA 1USTA 3C7JA 2YU3A 2L4MA 2PI0A 3MZHA 3TKYA 2KJCA 1OMIA 4MQ9F 4EJUA 3E6MA 2V1UA 2W57A 4AIJA 3RPUA 2VOPA 1R1VA 4KIGA 1LVAA 2LNBA 1YYVA 4R1HA 1G3WA 3HYIA 5FO5A 4AWXB 1UB9A 4M74A 4NQWA 1R22A 3GUDA 4HZFA 4LJZF 4R8HA 2XAJA 2QLZA 3WE3A 2FMYA 3VB2A 5JI6A 1STZA 5L3FA 2HDCA 3ECHA 2EFNA 3LSTA 3I0TA 3CUQB 1W7PD 1EH8A 3CO7C 3CJNA 3KZYA 3QU3A 4HX4A 4YFNF 1ONVA 1MZBA 3ECOA 2ESHA 5D8LB 3H3UA 3ZMUA 1ZGJA 2E1CA 5HS7A 3GVAA 4MGRA 1H9GA 2QYOA 4BHPA 3D5LA 3F8NA 1K79A 3LQRA 4PZJA 3FMQA 1GVJA 3TGNA 2WWYA 2VXZA 3HTSB 5LEJA 5D5VB 4A0XA 3KP4A 4E70A 2W85A 2G9WA 3WTSC 1K78A 4YFKF 1KYZA 4GXOA 1G3TA 2QENA 2VBXA 5A2QK 2L02A 2CO5A 1SD6A 3MWMA 2K02A 2XIGA 3IRRA 1K7AA 2M30A 4LMYA 4UUVA 5F1RA 1U5TB 4EGYA 2DK8A 4LLLA 1ZN2A 4AD9A 2HTSA 1SMTA 2K4JA 5FD6A 2FBHA 3KE2A 5E20A 5ERIA 2ZNZA 1J59A 1IXSB 4BHBA 1UHWA 3EYIA 1XMAA 5ICGA 1O3TA 4RB1A 3E5UA 3ZMTA 1AOYA 1RIOH 2YX7A 1ULYA 1ODDA 3C1DA 3LA7A 2IT0A 3TO9A 3MZYA 2HTJA 3JSPA 1FYLA 1O7LA 4EM0B 4G6DA 1T0FA 3MAJA 5HLGA 2LF8A 3RPQA 3M7GA 1SD4A 2TDXA 2RQPA 1TQIA 1KU3A 3BPXA 4KIFA 1B1BA 2M5WA 3LA2A 2XKPA 2P4WA 1IN7A 1LQ1A 2QWWA 3P9CA 3JAMK 3RIRA 2RGVA 2O6GE 3F8BA 2VBWA 1DUXC 3EUHA 4RGRA 1G4DA 1G3SA 3LWFA 4XRFA 1SMYF 2OD5A 2LF7A 1ZG5A 2FBIA 2EV0A 3QP5A 2EFWA 5K5OA 1J2XA 5ILVA 1RUOA 5E1WA 2J5OA 1Z6RA 3CUQA 1Z6TA 1J9IA 5FD5A 3W6JB 5DD4A 3DPTA 1BIBA 3T1BA 4ENNA 1YG2A 2ZXJA 3F8FA 4MTEA 2IA2A 3HSRA 2HEOA 1MD0A 4HX7A 4IXAA 1TW3A 1KU2A 3ABTA 1FX7A 2Z33A 3FXRA 3J81K 4EVIA 4IRIA 4BYYA 1QBJA 5LHIA 1C0WA 2W84A 4DNCA 4EGZA 1SFUA 1RZ4A 1R36A 1FY7A 1TQMA 4I02A 1XSXA 3FMRA 3F22A 1YS7A 2CG4A 2LDUA 1EV7A 5LEKA 3IWFA 4U7DA 3WU1B 1J7KA 3ZP5A 2M45A 3CTAA 2KIMA 1U5TA 1FYKA 4Q4ZF 2DLLA 2B0LA 1HKSA 2ADUA 4A12A 3NEUA 4WX9A 4FX0A 2FNAA 4H0EA 2PG4A 2XAFA 2VN2A 1U78A 4HOBA 1XD7A 3RYPA 1IXRC 2XKOA 2WTEA 1T98A 3FHZA 3D0SA 3ELKA 3KP7A 4OINF 3KLOA 5TJJA 4O6JA 4HLYA 2VBYA 2D1HA 4BQAA 2XVCA 2CW0F 3GF2A 2H6CA 2PN6A 4OIRF 2RNJA 2QQ9A 3E6BA 5IT9Z 1U2WA 1FBUA 1QNTA 3I4PA 4L9VA 3F8MA 5DUKA 1MGTA 1W7PB 3F21A 2FMLA 4EQQA 1SAXA 1SFEA 3HSFA 2IJLA 5HS8A 4GGGA 4GYIA 2OZ6A 1YW9A 2IP2A 2P5KA 1BC8C 1S7AA 2MLKA 2RVCA 3HRSA 3RKYA 1RUNA 3BROA 3N4MA 1TNTA 2JZYA 1EH7A 3OV8A 2QM3A 1IN8A 4AIKA 2AS5F 4WK8F 2P5VA 1YFHA 3M1EA 5L3CA 2E1NA 1H9TA 4CO8A 1Y0UA 2OAZA 3H3ZA 3WTYC 1FYMA 5CVUA 2G7UA 2FA5A 1BJAA 2XAHA 2A68F 3MQ0A 3TDZC 3ZMVA 1R1TA 4CXFA 1GHCA 1PP8F 1IZ1A 1B9NA 1G6NA 3CO6C 4MEYF 1OYIA 1S6LA 4LGWA 1S3JA 3ABUA 3CLOA 3KP2A 2Z3YA 4HDUA 4U0YA 3L00A 3EQLF 2DFIA 2P5LC 3V8KA 1GXPA 3I54A 4WCGA 3HRMA 3IHUA 2DI3A 2XV4S 3WG9A 5LHGA 3F6VA 3L2CA 2WV0A 2R3SA 3KP5A 1DPUA 5LRRA 1U6GA 4I98B 1JHFA 3E6CC 2LSOA 3GZ5A 2CSOA 4RGUA 2K86A 3F6OA 1ZYRF 1CGPA 4L9TA 2C6YA 3SZPA 2M87A 5E18F 2OQGA 4BAYA 2CGPA 2PQ8A 4KIBA 5AIQA 3QPTA 4GO1A 2FOKA 2NNNA 5L3BA 1SD5A 3HOSA 4A5NA 3QP6A 2M1BA 2FE3A 1KQ8A 3PFIA 5DCFA 1W7PA 1B4AA 1GXQA 4HX8A 4WXCA 3FXQA 3T8RA 3GFLA 4D0PA 2EA4A 4Y15A 1G3YA 3VOEA 1J5YA 4A6EA 1OYYA 3FZVA 3EDPA 1E2XA 1PP7U 3I64A 1S7OA 4NB5A 2RN7A 1KU7A 4S05A 5CVVA 2XROA 3GEZA 3V4GA 3DKWA 1XSVA 3PQKA 1IF1A 2XUBA 4KN7X 2P8TA 3J80Z 2VONA 1V4RA 2EA2A 4YG2F 1TNSA 5J6XA 2GQQA 5CVRA 2HS5A 1D5VA 2PMUA 2DPDA 5L3EA 2FRHA 3V8JA 1LEBA 4MHGA 3RKXA 2YSRA 2O3FA 4I7HA 2E7XA 3QPHA 1XGSA 3LFKA 5ILUA 1FWZA 4G8XA 1WKMA 5TRDA 5HS9A 1T39A 4UVBA 4HBLA 5AONA 4WXHA 1FT9A 2PJPA 2V6CA 4HQEA 5ICEA 1B6AA 3ZPLA 2VBZA 2UXNA 1BI0A 3TQNA 1ZGAA 3T8TA 2A61A 3I71A 4RGSA 1JGSA 3HHHA 3JTHA 4EJVA 2GXBA 1VTNC 5DEQA 4XLNF 3IRQA 5HOOA 2MH9A 1SD7A 2XASA 1HBXG 1LEAA 4B09A 2COMA 1IN6A 3I5UA 4G6QA 1I5ZA 4I0AA 4G7HF 2XAGA 3KEQA 5DCMB 3I53A 1LDDA 1CF7B 2GA1A 5BPIA 2GZWA 1HKTA 2IPQX 1HW5A 4QLCU 4KA4A 2RKHA 2VT3A 2PFBA 3SQNA 2KIFA 2CWEA 1O57A 1YQAA 4LLNA 1DPRA 4ZZDA 2DPUA 4I0BA 5IT9K 4IHTA 5FLXZ 1BI1A 3Q9SA 4P9FA 3WU0A 2EFPA 2DW4A 2OU2A 1BIAA 1FZPB 1Z7UA 1WQ2A 3DV8A 3OOPA 5F6FA 1KQ9A 4JBAA 4B8XA 4HF1A 4UVAA 2HQRA 2EFQA 2ACJA 1UFMA 3C18A 2GAUA 3WODF 2HR3A 1K6OA 1LDKB 4IJAA 2OA4A 4I01A 2UXXA 3SHFA 3ULQB 2STTA 1FSHA 4KMFA 5LGNA 3ZN0A 5ED4A 2A5YB 1IRFA 3L7WA 4L9NA 4CGZA 2DU9A 1SFXA 2KIUA 2A07F 2KJBA 1I1SA 3DP7A 2X0LA 1F1ZA 2ZJ2A 1WSUA 4OOIA 4HV5A 3IWZA 2DT5A 1P4WA 2F5FA 5JVTA 5DUIA 1O3SA 2ESNA 5CLSA 1Z91A 1MJBA 5H20A 4CHUA 2HKOA 5CVJA 2JTVA 5DYMA 1I6XA 4A5MA 2QUFA 1KYWA 3REOA 3O6BB 3DQVC 4M73A 1KU9A 1BN5A 4HLXA 1Z05A 3GW2A 3SFZA 2UZKA 1FLIA 3T0YA 4LK1F 5DCMA 2V9VA 2IW5A 1CF7A 1XCBA 2HWVA 1HQCA 4WXDA 3K2ZA 5JR3A 3HRUA 3P7NA 1IN5A 2MH2A 3EETA 2L4AA 5L3GA 4G7ZF 3BP8A 2EWNA 2NAZA 5FB2A 2FF4A 4HW0A 1ZH5A 1YTYA 3CUQC 2IA0A 3GZ6A 2GWRA 1MKMA 4EJTA 3I59B 1LNWA 2K27A 1HSJA 4L18B 3H92A 5K1YA 4L5JA 3KLNA 3QOPA 3EYYA 2BYVE 2P7VB 1R23A 1TW2A 2QVOA 3J7AO 2CFXA 1YLFA 4KT5C 2ZCWA 3K1MA 3F72A 2YX4A 3LAJA 3BPVA 4FT8A 1BI2A 2VT2A 4WF2A 2PLYA 3W6KB 2DO7A 2DBBA 5E8GA 3WTXC 3DXJF 1HKQA 2F5CA 1U5TC 1E17A 3J80K 4HDVA 1REPC 4I09A 3E5XA 3M8FA 2ZO4A 2FEZA 3NQOA 2Y0MA 1LDJA 3E5QA 4BNCA 4HV6A 3DFGA 4KICA 4CYDA 1TQPA 2H94A 4A2UA 1TBXA 1EH6A 4OIOF 2EB7A 4IRHA 3BJOA 1IUYA 2P6TA 2ZNYA 3GFJA 1UHMA 1XDSA 5L3DA 5J8CA 5D5UB 2O03A 1BBYA 4IVNA 1O3RA 2RDPA 1BM9A 5HDKA 2A3SA 2HKXA 2XHKA 1YO5C 3QAHA 5D4RA 3ERED 3WTUC 3WTVC 3QRFF 1R5GA 4RAZA 1LB2A 4M71A 4A0ZA 2YR2A 3KFWX 4PGHA 3NRVA 4RB0A 4U0VA 5HLHA 2GIVA 1YIOA 4OU0A 5JFRA 1T38A 4ENMA 1NHAA 4RS8A 1YW7A 1WI9A 4KN4X 3GFIA 1QGPA 3T5XA 2FBKA 2FQ3A 4RGXA 2F5DA 1ZLKA 1IN4A 1D3YA 2ZFWA 4FX4A 2JT1A 3U2RA 3U1DA 2V1DA 4UV8A 2BBYA 5LLQA 4KDPA 1XDUA 1BC7C 3I59A 3ZMDA 4PGGA 2W24A 5BPDA 1L3LA 4JK1X 3PQJA 2IA1A 2L3DA 4ZYHA 5FLXK 2KKOA 2Z99A 2ELHA 1XB4A 4HYEA 1O7FA 2PMHA 2QQAA 1B9MA 1HW1A 1MDMB 4LFUA 4M6YA 3IKVA 4M9ZA 4P9UA 5LHHA 4I2OA 3R0AA 4MQVA 2LKPA 4ETSA 1HXDA 2FNPA 3S2WA 4L0ZB 1J75A 3GXOA 2HFHA 5D5WB 5ICCA 1UCRA 4Z2YA 1T2KA 4UNOA 3P9IA 1BOAA 3E6DA 1TTYA 2ZKZA 1QO0D 2HYFA 3HUGA 1ZRCA 4Y17A 4K2EA 5KK1A 2H27A 3K1PA 4L5IA 3WGGA 3B02A 2ISYA 5BQTA 3U9GA 2K4BA 1KGSA 5K5QA 4A0YA 3FM3A 2GXGA 1F4KA 4S04A 2QZ8A 4ESFA 2OQRA 4ENKA 3JTGA 4OIPF 3E97A 4BXUA 1ZG3A 4JQFA 1ZAOA 2Q0OA 4P5OA 1IAWA 1J0RA 1D8JA 4DQ2A 2EK5A 4RB3C 1MJ9A 1BI3A 1XGOA 4R79A 4U0WA 1FNNA 3DPLC 4ZYEA 2O0YA 2UWMA 4CZZA 3BOQA 4MEXF 4EM2A 4HF0A 3B73A 2W25A 5LGTA 1R58A 5CYVA 3Q5FA 1X3UA 3R6SA 2H09A 2IRFG 2P6SA 5KVRA 2L01A 4CDGA 3KEOA 1DDNA 1AWCA 5BMZA 3KETA 6PAXA 1HW2A 3ZQ7A 1S8NA 1KQ0A 3V8LA 4F7ZA 4KMUX 4QWQA 2QQBA 4IPAA 2JPBA 4EV0A 2CYYA 4LB5A 3TOBA 1XCVA 4L0YB 2BE5F 3K1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VC1 A;  1R1U A;  1MDM A;  5E8I A;  1IRG A;  3BWG A;  1JE8 A;  4GCV A;  4ENJ A;  3R0J A;  5E1X A;  4XBF A;  2DTR A;  2JSC A;  5EEH A;  4EMS A;  4ESJ A;  4KNY A;  3BJA A;  1I1G A;  3C3W A;  5DD8 A;  1FSE A;  3RJP A;  3R60 A;  3CDH A;  4PDK A;  3BDD A;  4IHS A;  2ISZ A;  3GX4 X;  3HSE A;  3KCC A;  3RTR A;  1LJ9 A;  4UHT A;  3O3K A;  1ZHF A;  2NRA C;  2Y75 A;  1R5H A;  3BZ6 A;  4A6D A;  2FU4 A;  2VE8 A;  2FXA A;  3RDI A;  2P7C B;  1OKR A;  5HDN A;  3RKW A;  1I27 A;  4KFC A;  3WE2 A;  3GWZ A;  2FSW A;  1U3E M;  1ZRE A;  3JSO A;  2VC0 A;  3WGI A;  2MLG A;  1FBQ A;  3GLX A;  2R7F A;  4Q48 A;  1ON2 A;  3FMS A;  1WWX A;  3E3V A;  3WTT C;  3GYH X;  4YFX F;  3N97 A;  3HHG A;  1A04 A;  3RYR A;  1R7J A;  3ZN1 A;  3CUO A;  4MTD A;  4OIQ F;  1QZY A;  1OYW A;  4KYW A;  4UV9 A;  5FGM A;  5J8F A;  4OMY A;  2NS0 A;  2L54 A;  5JHU A;  2Q2E A;  1Q1H A;  4AVP A;  3M9A A;  1QQI A;  4N0B A;  4YIF A;  3FXU A;  4ZYD A;  3WTW C;  2RC4 A;  1S29 A;  2KRF A;  5BOX A;  3SZT A;  3K69 A;  4KUM A;  4U7B A;  2MA3 A;  1DP7 P;  2X4H A;  2A6E F;  3F8C A;  4U88 A;  1ZG1 A;  3VFZ A;  4UXN A;  3G73 A;  2ZME B;  2MC3 A;  3O2P E;  2Z9O A;  3P9K A;  2E7W A;  3TO6 A;  3FM5 A;  2YPR A;  1RNL A;  3IKT A;  3ISP A;  5LBQ A;  2A6H F;  5HDG A;  1TLH B;  1Z1D A;  2K7L A;  2Q8K A;  3ROU A;  5D6F A;  4G7O F;  5HLI A;  1ON1 A;  3SXY A;  3MCZ A;  3TO7 A;  3JW4 A;  2OBP A;  1B59 A;  2F2E A;  4TV7 A;  4M72 A;  1R00 A;  1P92 A;  1P2F A;  2VOO A;  1W5S A;  2XRN A;  5A2Q Z;  4ZZL A;  3ML6 A;  1OR7 A;  1D8K A;  3AAF A;  4FHT A;  5FFZ A;  2JPC A;  3V7R A;  5E1Z B;  4LG0 B;  2CQK A;  2WC2 A;  1F9N A;  5AIP A;  2D2W A;  1L0O C;  5ILS A;  3VEP A;  3M8E A;  4LB6 B;  4OMZ A;  2EFO A;  3V7S A;  5D4S A;  2NYX A;  1HST A;  3RI4 A;  1XMK A;  3COA C;  1ZAR A;  2EV6 A;  3G3Z A;  4G94 A;  3FWE A;  1IXC A;  2Y48 A;  3Q9V A;  1KA8 A;  3VOD A;  5LGU A;  2OZU A;  2O61 A;  5H6R A;  4HF2 A;  5D5X B;  3LQQ A;  1XN7 A;  2QBY B;  1RI7 A;  3GFM A;  4HQM A;  5LRS A;  4ON0 A;  3ZMS A;  1W5T A;  3TOA A;  3HIF A;  1FOK A;  5DDG A;  1ZRF A;  1W4M A;  3KP6 A;  1QPM A;  1P4X A;  2DK5 A;  4WWC A;  2EV5 A;  3F3X A;  2DAO A;  2STW A;  2BEO A;  3IL2 A;  1H0M A;  5F64 A;  4LK0 F;  4EJW A;  3V7C A;  4HA8 A;  5DV5 A;  2DQR A;  4NHJ A;  3JAM Z;  1V3F A;  1FPQ A;  1U8R A;  4ZH4 F;  3GO5 A;  3R4K A;  4L9J A;  4ASN A;  3WGH A;  4M6X A;  2EJR A;  4YII A;  5IT3 A;  1P6R A;  1XSD A;  1T6S A;  1IW7 F;  2A69 F;  3TDU C;  2O8X A;  2G7H A;  2BGC A;  4O5V A;  1XGM A;  3L09 A;  4O3M A;  4ZYG A;  2M8E A;  5FFX A;  3F23 A;  4MNU A;  4LD5 A;  2F5E A;  4G9Y A;  2HGC A;  3K9T A;  2Z5U A;  3BJ6 A;  3LA3 A;  3BY6 A;  2ZME A;  1JHH A;  2MBF A;  1FP1 D;  4P55 A;  5ICF A;  3KZZ A;  2GA2 A;  2BV6 A;  2JRT A;  2PBI A;  2ZBK A;  4XSZ F;  4AIH A;  3K0L A;  1O3Q A;  4EJO A;  3IC7 A;  3J81 Z;  2V79 A;  4EM1 A;  5H6Q A;  5D8K B;  1YS6 A;  1PUE E;  4BH9 A;  5K5R A;  4HAM A;  4GYG A;  1WRJ A;  4Q5S F;  2H6B A;  1Z9C A;  1ZRD A;  3MFK A;  2HQN A;  2VOD A;  1JXS A;  5CJ9 A;  2XGX A;  3L9F A;  5D6E A;  3WTZ A;  4M9S A;  4P96 A;  2RV8 A;  4Q47 A;  5CVI A;  2ETH A;  2AXL A;  2D45 A;  4N9H A;  1K78 B;  2XAQ A;  2NNY A;  2D1V A;  4LG0 A;  2PEX A;  3FX3 A;  5E17 F;  4CIC A;  1OPC A;  2MD5 A;  4PCQ A;  4UVC A;  4IRG A;  1USS A;  4ESB A;  2R7D A;  3QU6 A;  4LLG F;  2HOE A;  3ZMZ A;  1FC3 A;  3R61 A;  1F5T A;  4XSX F;  2HZT A;  1ZLJ A;  3I58 A;  4Y13 A;  3HRT A;  2QBY A;  4RB2 C;  4IF4 A;  3HOT A;  1MJA A;  4RAY A;  1FBS A;  3KP3 A;  5BS6 A;  4XLP F;  3DF8 A;  2VE9 A;  3LAP A;  1P4A A;  5HVQ C;  2DQL A;  4M9X A;  2J5P A;  4N9I A;  2V1X A;  1QZZ A;  1FP2 A;  5EEG A;  1XGN A;  4BHC A;  1YW8 A;  3DEU A;  1PDN C;  2IVM A;  3FF5 A;  3MEX A;  2HYG D;  3HTU A;  1UST A;  3C7J A;  2YU3 A;  2L4M A;  2PI0 A;  3MZH A;  3TKY A;  2KJC A;  1OMI A;  4MQ9 F;  4EJU A;  3E6M A;  2V1U A;  2W57 A;  4AIJ A;  3RPU A;  2VOP A;  1R1V A;  4KIG A;  1LVA A;  2LNB A;  1YYV A;  4R1H A;  1G3W A;  3HYI A;  5FO5 A;  4AWX B;  1UB9 A;  4M74 A;  4NQW A;  1R22 A;  3GUD A;  4HZF A;  4LJZ F;  4R8H A;  2XAJ A;  2QLZ A;  3WE3 A;  2FMY A;  3VB2 A;  5JI6 A;  1STZ A;  5L3F A;  2HDC A;  3ECH A;  2EFN A;  3LST A;  3I0T A;  3CUQ B;  1W7P D;  1EH8 A;  3CO7 C;  3CJN A;  3KZY A;  3QU3 A;  4HX4 A;  4YFN F;  1ONV A;  1MZB A;  3ECO A;  2ESH A;  5D8L B;  3H3U A;  3ZMU A;  1ZGJ A;  2E1C A;  5HS7 A;  3GVA A;  4MGR A;  1H9G A;  2QYO A;  4BHP A;  3D5L A;  3F8N A;  1K79 A;  3LQR A;  4PZJ A;  3FMQ A;  1GVJ A;  3TGN A;  2WWY A;  2VXZ A;  3HTS B;  5LEJ A;  5D5V B;  4A0X A;  3KP4 A;  4E70 A;  2W85 A;  2G9W A;  3WTS C;  1K78 A;  4YFK F;  1KYZ A;  4GXO A;  1G3T A;  2QEN A;  2VBX A;  5A2Q K;  2L02 A;  2CO5 A;  1SD6 A;  3MWM A;  2K02 A;  2XIG A;  3IRR A;  1K7A A;  2M30 A;  4LMY A;  4UUV A;  5F1R A;  1U5T B;  4EGY A;  2DK8 A;  4LLL A;  1ZN2 A;  4AD9 A;  2HTS A;  1SMT A;  2K4J A;  5FD6 A;  2FBH A;  3KE2 A;  5E20 A;  5ERI A;  2ZNZ A;  1J59 A;  1IXS B;  4BHB A;  1UHW A;  3EYI A;  1XMA A;  5ICG A;  1O3T A;  4RB1 A;  3E5U A;  3ZMT A;  1AOY A;  1RIO H;  2YX7 A;  1ULY A;  1ODD A;  3C1D A;  3LA7 A;  2IT0 A;  3TO9 A;  3MZY A;  2HTJ A;  3JSP A;  1FYL A;  1O7L A;  4EM0 B;  4G6D A;  1T0F A;  3MAJ A;  5HLG A;  2LF8 A;  3RPQ A;  3M7G A;  1SD4 A;  2TDX A;  2RQP A;  1TQI A;  1KU3 A;  3BPX A;  4KIF A;  1B1B A;  2M5W A;  3LA2 A;  2XKP A;  2P4W A;  1IN7 A;  1LQ1 A;  2QWW A;  3P9C A;  3JAM K;  3RIR A;  2RGV A;  2O6G E;  3F8B A;  2VBW A;  1DUX C;  3EUH A;  4RGR A;  1G4D A;  1G3S A;  3LWF A;  4XRF A;  1SMY F;  2OD5 A;  2LF7 A;  1ZG5 A;  2FBI A;  2EV0 A;  3QP5 A;  2EFW A;  5K5O A;  1J2X A;  5ILV A;  1RUO A;  5E1W A;  2J5O A;  1Z6R A;  3CUQ A;  1Z6T A;  1J9I A;  5FD5 A;  3W6J B;  5DD4 A;  3DPT A;  1BIB A;  3T1B A;  4ENN A;  1YG2 A;  2ZXJ A;  3F8F A;  4MTE A;  2IA2 A;  3HSR A;  2HEO A;  1MD0 A;  4HX7 A;  4IXA A;  1TW3 A;  1KU2 A;  3ABT A;  1FX7 A;  2Z33 A;  3FXR A;  3J81 K;  4EVI A;  4IRI A;  4BYY A;  1QBJ A;  5LHI A;  1C0W A;  2W84 A;  4DNC A;  4EGZ A;  1SFU A;  1RZ4 A;  1R36 A;  1FY7 A;  1TQM A;  4I02 A;  1XSX A;  3FMR A;  3F22 A;  1YS7 A;  2CG4 A;  2LDU A;  1EV7 A;  5LEK A;  3IWF A;  4U7D A;  3WU1 B;  1J7K A;  3ZP5 A;  2M45 A;  3CTA A;  2KIM A;  1U5T A;  1FYK A;  4Q4Z F;  2DLL A;  2B0L A;  1HKS A;  2ADU A;  4A12 A;  3NEU A;  4WX9 A;  4FX0 A;  2FNA A;  4H0E A;  2PG4 A;  2XAF A;  2VN2 A;  1U78 A;  4HOB A;  1XD7 A;  3RYP A;  1IXR C;  2XKO A;  2WTE A;  1T98 A;  3FHZ A;  3D0S A;  3ELK A;  3KP7 A;  4OIN F;  3KLO A;  5TJJ A;  4O6J A;  4HLY A;  2VBY A;  2D1H A;  4BQA A;  2XVC A;  2CW0 F;  3GF2 A;  2H6C A;  2PN6 A;  4OIR F;  2RNJ A;  2QQ9 A;  3E6B A;  5IT9 Z;  1U2W A;  1FBU A;  1QNT A;  3I4P A;  4L9V A;  3F8M A;  5DUK A;  1MGT A;  1W7P B;  3F21 A;  2FML A;  4EQQ A;  1SAX A;  1SFE A;  3HSF A;  2IJL A;  5HS8 A;  4GGG A;  4GYI A;  2OZ6 A;  1YW9 A;  2IP2 A;  2P5K A;  1BC8 C;  1S7A A;  2MLK A;  2RVC A;  3HRS A;  3RKY A;  1RUN A;  3BRO A;  3N4M A;  1TNT A;  2JZY A;  1EH7 A;  3OV8 A;  2QM3 A;  1IN8 A;  4AIK A;  2AS5 F;  4WK8 F;  2P5V A;  1YFH A;  3M1E A;  5L3C A;  2E1N A;  1H9T A;  4CO8 A;  1Y0U A;  2OAZ A;  3H3Z A;  3WTY C;  1FYM A;  5CVU A;  2G7U A;  2FA5 A;  1BJA A;  2XAH A;  2A68 F;  3MQ0 A;  3TDZ C;  3ZMV A;  1R1T A;  4CXF A;  1GHC A;  1PP8 F;  1IZ1 A;  1B9N A;  1G6N A;  3CO6 C;  4MEY F;  1OYI A;  1S6L A;  4LGW A;  1S3J A;  3ABU A;  3CLO A;  3KP2 A;  2Z3Y A;  4HDU A;  4U0Y A;  3L00 A;  3EQL F;  2DFI A;  2P5L C;  3V8K A;  1GXP A;  3I54 A;  4WCG A;  3HRM A;  3IHU A;  2DI3 A;  2XV4 S;  3WG9 A;  5LHG A;  3F6V A;  3L2C A;  2WV0 A;  2R3S A;  3KP5 A;  1DPU A;  5LRR A;  1U6G A;  4I98 B;  1JHF A;  3E6C C;  2LSO A;  3GZ5 A;  2CSO A;  4RGU A;  2K86 A;  3F6O A;  1ZYR F;  1CGP A;  4L9T A;  2C6Y A;  3SZP A;  2M87 A;  5E18 F;  2OQG A;  4BAY A;  2CGP A;  2PQ8 A;  4KIB A;  5AIQ A;  3QPT A;  4GO1 A;  2FOK A;  2NNN A;  5L3B A;  1SD5 A;  3HOS A;  4A5N A;  3QP6 A;  2M1B A;  2FE3 A;  1KQ8 A;  3PFI A;  5DCF A;  1W7P A;  1B4A A;  1GXQ A;  4HX8 A;  4WXC A;  3FXQ A;  3T8R A;  3GFL A;  4D0P A;  2EA4 A;  4Y15 A;  1G3Y A;  3VOE A;  1J5Y A;  4A6E A;  1OYY A;  3FZV A;  3EDP A;  1E2X A;  1PP7 U;  3I64 A;  1S7O A;  4NB5 A;  2RN7 A;  1KU7 A;  4S05 A;  5CVV A;  2XRO A;  3GEZ A;  3V4G A;  3DKW A;  1XSV A;  3PQK A;  1IF1 A;  2XUB A;  4KN7 X;  2P8T A;  3J80 Z;  2VON A;  1V4R A;  2EA2 A;  4YG2 F;  1TNS A;  5J6X A;  2GQQ A;  5CVR A;  2HS5 A;  1D5V A;  2PMU A;  2DPD A;  5L3E A;  2FRH A;  3V8J A;  1LEB A;  4MHG A;  3RKX A;  2YSR A;  2O3F A;  4I7H A;  2E7X A;  3QPH A;  1XGS A;  3LFK A;  5ILU A;  1FWZ A;  4G8X A;  1WKM A;  5TRD A;  5HS9 A;  1T39 A;  4UVB A;  4HBL A;  5AON A;  4WXH A;  1FT9 A;  2PJP A;  2V6C A;  4HQE A;  5ICE A;  1B6A A;  3ZPL A;  2VBZ A;  2UXN A;  1BI0 A;  3TQN A;  1ZGA A;  3T8T A;  2A61 A;  3I71 A;  4RGS A;  1JGS A;  3HHH A;  3JTH A;  4EJV A;  2GXB A;  1VTN C;  5DEQ A;  4XLN F;  3IRQ A;  5HOO A;  2MH9 A;  1SD7 A;  2XAS A;  1HBX G;  1LEA A;  4B09 A;  2COM A;  1IN6 A;  3I5U A;  4G6Q A;  1I5Z A;  4I0A A;  4G7H F;  2XAG A;  3KEQ A;  5DCM B;  3I53 A;  1LDD A;  1CF7 B;  2GA1 A;  5BPI A;  2GZW A;  1HKT A;  2IPQ X;  1HW5 A;  4QLC U;  4KA4 A;  2RKH A;  2VT3 A;  2PFB A;  3SQN A;  2KIF A;  2CWE A;  1O57 A;  1YQA A;  4LLN A;  1DPR A;  4ZZD A;  2DPU A;  4I0B A;  5IT9 K;  4IHT A;  5FLX Z;  1BI1 A;  3Q9S A;  4P9F A;  3WU0 A;  2EFP A;  2DW4 A;  2OU2 A;  1BIA A;  1FZP B;  1Z7U A;  1WQ2 A;  3DV8 A;  3OOP A;  5F6F A;  1KQ9 A;  4JBA A;  4B8X A;  4HF1 A;  4UVA A;  2HQR A;  2EFQ A;  2ACJ A;  1UFM A;  3C18 A;  2GAU A;  3WOD F;  2HR3 A;  1K6O A;  1LDK B;  4IJA A;  2OA4 A;  4I01 A;  2UXX A;  3SHF A;  3ULQ B;  2STT A;  1FSH A;  4KMF A;  5LGN A;  3ZN0 A;  5ED4 A;  2A5Y B;  1IRF A;  3L7W A;  4L9N A;  4CGZ A;  2DU9 A;  1SFX A;  2KIU A;  2A07 F;  2KJB A;  1I1S A;  3DP7 A;  2X0L A;  1F1Z A;  2ZJ2 A;  1WSU A;  4OOI A;  4HV5 A;  3IWZ A;  2DT5 A;  1P4W A;  2F5F A;  5JVT A;  5DUI A;  1O3S A;  2ESN A;  5CLS A;  1Z91 A;  1MJB A;  5H20 A;  4CHU A;  2HKO A;  5CVJ A;  2JTV A;  5DYM A;  1I6X A;  4A5M A;  2QUF A;  1KYW A;  3REO A;  3O6B B;  3DQV C;  4M73 A;  1KU9 A;  1BN5 A;  4HLX A;  1Z05 A;  3GW2 A;  3SFZ A;  2UZK A;  1FLI A;  3T0Y A;  4LK1 F;  5DCM A;  2V9V A;  2IW5 A;  1CF7 A;  1XCB A;  2HWV A;  1HQC A;  4WXD A;  3K2Z A;  5JR3 A;  3HRU A;  3P7N A;  1IN5 A;  2MH2 A;  3EET A;  2L4A A;  5L3G A;  4G7Z F;  3BP8 A;  2EWN A;  2NAZ A;  5FB2 A;  2FF4 A;  4HW0 A;  1ZH5 A;  1YTY A;  3CUQ C;  2IA0 A;  3GZ6 A;  2GWR A;  1MKM A;  4EJT A;  3I59 B;  1LNW A;  2K27 A;  1HSJ A;  4L18 B;  3H92 A;  5K1Y A;  4L5J A;  3KLN A;  3QOP A;  3EYY A;  2BYV E;  2P7V B;  1R23 A;  1TW2 A;  2QVO A;  3J7A O;  2CFX A;  1YLF A;  4KT5 C;  2ZCW A;  3K1M A;  3F72 A;  2YX4 A;  3LAJ A;  3BPV A;  4FT8 A;  1BI2 A;  2VT2 A;  4WF2 A;  2PLY A;  3W6K B;  2DO7 A;  2DBB A;  5E8G A;  3WTX C;  3DXJ F;  1HKQ A;  2F5C A;  1U5T C;  1E17 A;  3J80 K;  4HDV A;  1REP C;  4I09 A;  3E5X A;  3M8F A;  2ZO4 A;  2FEZ A;  3NQO A;  2Y0M A;  1LDJ A;  3E5Q A;  4BNC A;  4HV6 A;  3DFG A;  4KIC A;  4CYD A;  1TQP A;  2H94 A;  4A2U A;  1TBX A;  1EH6 A;  4OIO F;  2EB7 A;  4IRH A;  3BJO A;  1IUY A;  2P6T A;  2ZNY A;  3GFJ A;  1UHM A;  1XDS A;  5L3D A;  5J8C A;  5D5U B;  2O03 A;  1BBY A;  4IVN A;  1O3R A;  2RDP A;  1BM9 A;  5HDK A;  2A3S A;  2HKX A;  2XHK A;  1YO5 C;  3QAH A;  5D4R A;  3ERE D;  3WTU C;  3WTV C;  3QRF F;  1R5G A;  4RAZ A;  1LB2 A;  4M71 A;  4A0Z A;  2YR2 A;  3KFW X;  4PGH A;  3NRV A;  4RB0 A;  4U0V A;  5HLH A;  2GIV A;  1YIO A;  4OU0 A;  5JFR A;  1T38 A;  4ENM A;  1NHA A;  4RS8 A;  1YW7 A;  1WI9 A;  4KN4 X;  3GFI A;  1QGP A;  3T5X A;  2FBK A;  2FQ3 A;  4RGX A;  2F5D A;  1ZLK A;  1IN4 A;  1D3Y A;  2ZFW A;  4FX4 A;  2JT1 A;  3U2R A;  3U1D A;  2V1D A;  4UV8 A;  2BBY A;  5LLQ A;  4KDP A;  1XDU A;  1BC7 C;  3I59 A;  3ZMD A;  4PGG A;  2W24 A;  5BPD A;  1L3L A;  4JK1 X;  3PQJ A;  2IA1 A;  2L3D A;  4ZYH A;  5FLX K;  2KKO A;  2Z99 A;  2ELH A;  1XB4 A;  4HYE A;  1O7F A;  2PMH A;  2QQA A;  1B9M A;  1HW1 A;  1MDM B;  4LFU A;  4M6Y A;  3IKV A;  4M9Z A;  4P9U A;  5LHH A;  4I2O A;  3R0A A;  4MQV A;  2LKP A;  4ETS A;  1HXD A;  2FNP A;  3S2W A;  4L0Z B;  1J75 A;  3GXO A;  2HFH A;  5D5W B;  5ICC A;  1UCR A;  4Z2Y A;  1T2K A;  4UNO A;  3P9I A;  1BOA A;  3E6D A;  1TTY A;  2ZKZ A;  1QO0 D;  2HYF A;  3HUG A;  1ZRC A;  4Y17 A;  4K2E A;  5KK1 A;  2H27 A;  3K1P A;  4L5I A;  3WGG A;  3B02 A;  2ISY A;  5BQT A;  3U9G A;  2K4B A;  1KGS A;  5K5Q A;  4A0Y A;  3FM3 A;  2GXG A;  1F4K A;  4S04 A;  2QZ8 A;  4ESF A;  2OQR A;  4ENK A;  3JTG A;  4OIP F;  3E97 A;  4BXU A;  1ZG3 A;  4JQF A;  1ZAO A;  2Q0O A;  4P5O A;  1IAW A;  1J0R A;  1D8J A;  4DQ2 A;  2EK5 A;  4RB3 C;  1MJ9 A;  1BI3 A;  1XGO A;  4R79 A;  4U0W A;  1FNN A;  3DPL C;  4ZYE A;  2O0Y A;  2UWM A;  4CZZ A;  3BOQ A;  4MEX F;  4EM2 A;  4HF0 A;  3B73 A;  2W25 A;  5LGT A;  1R58 A;  5CYV A;  3Q5F A;  1X3U A;  3R6S A;  2H09 A;  2IRF G;  2P6S A;  5KVR A;  2L01 A;  4CDG A;  3KEO A;  1DDN A;  1AWC A;  5BMZ A;  3KET A;  6PAX A;  1HW2 A;  3ZQ7 A;  1S8N A;  1KQ0 A;  3V8L A;  4F7Z A;  4KMU X;  4QWQ A;  2QQB A;  4IPA A;  2JPB A;  4EV0 A;  2CYY A;  4LB5 A;  3TOB A;  1XCV A;  4L0Y B;  2BE5 F;  3K1N A; 
#chains in the Genus database with same CATH topology
 3AL0 B;  2LG4 A;  2VC1 A;  1R1U A;  1MDM A;  4ZC3 A;  5E8I A;  3CLQ A;  1T56 A;  4CSW A;  2DA7 A;  1LPQ A;  4UB8 C;  1IRG A;  3BWG A;  4ANJ A;  2P0W A;  4GCV A;  1JE8 A;  2BHY A;  1D5Y A;  2K85 A;  4ENJ A;  3R0J A;  2X9D A;  5E1X A;  4XBF A;  5DM6 F;  2DTR A;  5GAE J;  1WJD A;  5GTH C;  2JSC A;  3JRH A;  1U9O A;  5EEH A;  4EMS A;  3PIO F;  4ESJ A;  3L2W A;  5M5Y J;  1VQ6 I;  3EUK L;  4KNY A;  1MNM C;  2W48 A;  1KZH A;  3BJA A;  1PYV A;  1I1G A;  1BR1 A;  2K9N A;  3C3W A;  3BTL A;  3CCY A;  2CQ7 A;  5DD8 A;  1FSE A;  3RJP A;  2LBF A;  3S3O A;  3HOX J;  4HNU A;  3R60 A;  2JN6 A;  3CDH A;  4PDK A;  4FE7 A;  4NDL A;  3OYH A;  1TT0 A;  3BDD A;  1IV8 A;  2ISZ A;  4IHS A;  2BVM A;  2GIZ A;  3GX4 X;  3HSE A;  1ACI A;  3KCC A;  3RTR A;  3ABM H;  1LJ9 A;  4UHT A;  3O3K A;  1ZHF A;  2HU9 A;  3CCJ I;  2HVR A;  2NRA C;  1IUF A;  1R5H A;  2Y75 A;  3BZ6 A;  3FKI J;  5FKO A;  1K4T A;  4A6D A;  2FU4 A;  2VE8 A;  2V7F A;  5EJC A;  2FXA A;  3RDI A;  3ZR8 X;  3BCB A;  5E3O A;  2P7C B;  2VKH A;  4QPQ A;  1XPX A;  2QKL B;  4XKV A;  1OKR A;  5B1A H;  1Z7L A;  3BZK A;  5HDN A;  3OY9 A;  2DCE A;  2QEX I;  3RKW A;  1I27 A;  2NVT J;  4KFC A;  3WE2 A;  4JOM A;  3GWZ A;  2FSW A;  2R7V A;  2M9H A;  1IO2 A;  1U3E M;  1ZRE A;  4BY7 J;  2L9V A;  3JSO A;  1NTC A;  2VC0 A;  4C2T A;  3WGI A;  2NS8 A;  2MLG A;  2DDB A;  2LKS A;  1FBQ A;  3GLX A;  1P7J A;  2R7F A;  2Y9Z A;  4Q48 A;  1ON2 A;  3FMS A;  4KIS A;  5H2F C;  1WWX A;  3E3V A;  3WTT C;  3GYH X;  1Y8R B;  4YFX F;  1SVM A;  2WAQ N;  3HHG A;  4ABZ A;  1A04 A;  3N97 A;  3RYR A;  1R7J A;  3ZN1 A;  4BXX J;  3CUO A;  1JKP C;  3HKZ A;  2JSP A;  2MGQ A;  4MTD A;  1X3Z B;  3OYE A;  4OIQ F;  1TWC J;  3SEZ A;  1QZY A;  1OYW A;  2R7Q A;  2W00 A;  4KYW A;  3K2A A;  1IDZ A;  4UV9 A;  4RAF A;  5FGM A;  2HPI A;  5J8F A;  4OMY A;  3HXL A;  2NS0 A;  2L54 A;  4C3J J;  5JHU A;  4LIV A;  3FXM A;  2Q2E A;  2DYS H;  5EZG A;  1U8B A;  1Q1H A;  4AVP A;  4V2G A;  3M9A A;  1QQI A;  2Y31 A;  4N0B A;  4YIF A;  2MAB A;  1HDD C;  3FXU A;  4ZYD A;  1DGW Y;  4CCL A;  3WTW C;  3WG7 H;  1VQO I;  5EGO A;  1VZ0 A;  1TWF J;  2RC4 A;  1YX5 A;  1S29 A;  3MKL A;  1I3Q J;  3AG3 H;  4AUX A;  2RNG A;  2KRF A;  3C2B A;  4I99 C;  2YS9 A;  2K40 A;  2WV1 A;  5BOX A;  3SZT A;  3K69 A;  4CCM A;  4KUM A;  4U7B A;  1RRJ A;  1BOB A;  1YI2 I;  5TIS C;  1E3H A;  2MA3 A;  1DP7 P;  3OMY A;  2X4H A;  2A6E F;  3F8C A;  4U88 A;  5HNF A;  1YX3 A;  1IDY A;  1ZG1 A;  5CQE A;  3VFZ A;  2FUG 2;  4C3H J;  2KHM A;  1PVE A;  4QIW N;  3IAM 2;  4UXN A;  3G73 A;  2CUJ A;  2ZME B;  2MC3 A;  3O2P E;  2Z9O A;  1EA3 A;  1OCC H;  3P9K A;  2E7W A;  1ZEL A;  3BG9 A;  3TO6 A;  3OSF A;  3FM5 A;  1AA7 A;  2YPR A;  1RNL A;  3IKT A;  2JK3 A;  3ISP A;  5LBQ A;  2A6H F;  5HDG A;  2L9N A;  1DQU A;  1TLH B;  1Z1D A;  2K7L A;  5GAH J;  2Q8K A;  3ROU A;  4HST A;  3LSP A;  5D6F A;  4G7O F;  1RR8 C;  5HLI A;  1ON1 A;  3PFY A;  4D9J A;  4IX7 A;  3SXY A;  3MCZ A;  3TO7 A;  3JW4 A;  2OBP A;  1B59 A;  4XM3 A;  2QSG X;  2F2E A;  2CUE A;  4IL6 C;  1R00 A;  4M72 A;  4TV7 A;  1P92 A;  2ZXH A;  1P2F A;  2VOO A;  1W5S A;  3FIS A;  2XRN A;  5A2Q Z;  1FEX A;  4ZZL A;  3ML6 A;  5F08 A;  1OR7 A;  1D8K A;  4IEJ A;  3AAF A;  3QYB A;  4FHT A;  5J47 A;  2LMD A;  2W4S A;  5FFZ A;  3U21 A;  2VQG A;  2JPC A;  3V7R A;  5K7F A;  5E1Z B;  4LG0 B;  2CQK A;  3MN2 A;  2ZJQ F;  2WC2 A;  2VQL A;  1F9N A;  2ELJ A;  5AIP A;  4BS9 A;  2VPL A;  2D2W A;  3KPH A;  3MMY B;  2DA5 A;  2E2H J;  2EH3 A;  2KFD A;  1L0O C;  2XGC A;  3O8H A;  5ILS A;  3VEP A;  4FIS A;  3M8E A;  4LB6 B;  4OMZ A;  2EFO A;  3V7S A;  5F04 A;  3VYU B;  5D4S A;  2NYX A;  1HST A;  2QCO A;  2VKV A;  3RI4 A;  1XMK A;  3DEW A;  3COA C;  1ZAR A;  2EV6 A;  3G3Z A;  4G94 A;  2OUM A;  3VYS B;  3FWE A;  2V26 A;  1IXC A;  2Y48 A;  3Q9V A;  1KA8 A;  4LOC A;  3M1C A;  3VOD A;  5LGU A;  2OZU A;  2VPR A;  2O61 A;  5H6R A;  4HF2 A;  5D5X B;  3LQQ A;  3A2K A;  1XN7 A;  2HI3 A;  3JRB A;  2QBY B;  1RI7 A;  3DU6 A;  3GFM A;  4HQM A;  5LRS A;  2R5Y B;  4ON0 A;  2Z16 A;  1W5T A;  3ZMS A;  3TOA A;  3MKZ A;  3HIF A;  3M07 A;  1FOK A;  5DDG A;  1ZRF A;  1W4M A;  3KP6 A;  5CKT A;  3WHC A;  5LFA A;  4V2F A;  1K6Y A;  5FLV A;  4BBR J;  4XRS G;  1QPM A;  4OAZ A;  1P4X A;  2ICW G;  3H5A A;  3S15 J;  2DK5 A;  4WWC A;  2EV5 A;  3F3X A;  1GT0 C;  2DAO A;  2STW A;  1HC8 A;  2BEO A;  2COB A;  3IL2 A;  3PL8 A;  1H0M A;  3OS0 A;  3PJR A;  5F64 A;  4EAT A;  4LK0 F;  4DZJ A;  3TMO A;  2ID3 A;  2JA7 J;  2VUM J;  1WCM J;  2E60 A;  4EJW A;  2IGO A;  3V7C A;  4HA8 A;  5DV5 A;  2DQR A;  2LH9 A;  4NHJ A;  1S9H A;  3JAM Z;  1V3F A;  1FPQ A;  4DIQ A;  1U8R A;  4ZH4 F;  2ECB A;  3GO5 A;  4Z6Y A;  1FOX A;  3R4K A;  4L9J A;  3QQA A;  4H4K C;  4ASN A;  1R6R A;  3HGG A;  3WGH A;  2V1N A;  4M6X A;  4RA2 A;  2NVX J;  2KZV A;  2EJR A;  4YII A;  5IT3 A;  5FJ8 J;  1V5G A;  2DFF A;  4ITV A;  1P6R A;  1XSD A;  2MD0 A;  1WPK A;  4KIT B;  1X2M A;  3PNT A;  3A4C A;  1F43 A;  1VFC A;  1H89 C;  1T6S A;  1IW7 F;  2Y9Y A;  1FOY A;  2A69 F;  3TDU C;  2O8X A;  1SFO J;  2G7H A;  3ZQC A;  3CCL I;  2BGC A;  4O5V A;  5M5W J;  4NQW B;  1XGM A;  3L09 A;  4JYK A;  4ZYG A;  4O3M A;  3ASN H;  2M8E A;  5FFX A;  3BR5 A;  3F23 A;  4MNU A;  1B8I B;  4ZJZ A;  3IUO A;  2F5E A;  4LD5 A;  2M2E A;  2DTZ A;  2KRC A;  4G9Y A;  3ZXS A;  2HGC A;  1G8X A;  3K9T A;  3CC7 I;  2Z5U A;  4I6Z A;  3BJ6 A;  4MIM A;  5TGT A;  3LA3 A;  4E7K A;  1TWH J;  2IS2 A;  2EIK H;  3BY6 A;  2ZME A;  1NG7 A;  1JHH A;  2MBF A;  1FP1 D;  1WJ5 A;  4P55 A;  5ICF A;  1ENH A;  2M4K A;  3KZZ A;  2GA2 A;  1QHH D;  2BV6 A;  2JRT A;  3DCF A;  2LLK A;  3WHB A;  1OCT C;  2PBI A;  2VLA A;  3PO2 J;  2ZBK A;  2EQR A;  3G1O A;  1R4M B;  2HOT A;  4XSZ F;  4AIH A;  3K0L A;  1O3Q A;  4EJO A;  5B5E C;  1BL0 A;  1WZ2 A;  3IC7 A;  1SFK A;  4F92 B;  5GPC A;  2V79 A;  3J81 Z;  4EM1 A;  2OC6 A;  3L2R A;  3G1L A;  2EZH A;  5H6Q A;  2PX9 A;  2WY8 Q;  5D8K B;  2BY3 A;  1YS6 A;  1PUE E;  4XLE A;  1MSE C;  3CP8 A;  4BH9 A;  2L2O A;  5K5R A;  4HAM A;  1YIT I;  4GYG A;  4HNT A;  1WRJ A;  4Q5S F;  2H6B A;  1Y1V J;  1JUP A;  3FXK A;  1Z9C A;  1ZRD A;  3MFK A;  2HQN A;  2NVU B;  3OYI A;  4F93 B;  2VOD A;  1JXS A;  5CJ9 A;  2XGX A;  3JCU C;  2V4J C;  3L9F A;  3VWB A;  2R7X A;  3GME A;  2NVQ J;  3G2B A;  5D6E A;  2ZC2 A;  4C2M J;  2Y30 A;  3SYT A;  3WTZ A;  4M9S A;  4P96 A;  4PFO A;  2RV8 A;  4Q47 A;  5CVI A;  1JGG A;  2ETH A;  2AXL A;  3OS1 A;  2D45 A;  2DFH A;  4N9H A;  2XRL A;  1LFP A;  1UMQ A;  3BT9 A;  2BXZ A;  2HVQ A;  3C2H A;  4NNJ A;  1K78 B;  2XAQ A;  2NNY A;  2D1V A;  4LG0 A;  2V9K A;  2PEX A;  3FX3 A;  5FLM J;  2VKE A;  5E17 F;  4CIC A;  1OPC A;  2MD5 A;  4PCQ A;  2R7T A;  2DOF A;  2E19 A;  2JA2 A;  4UVC A;  4IRG A;  1USS A;  3VPR A;  4ESB A;  2EZK A;  2R7D A;  2ID6 A;  3C2G A;  3QU6 A;  4LLG F;  2HOE A;  3ZMZ A;  1FC3 A;  2LRE A;  3R61 A;  4FQG A;  1F5T A;  2KT0 A;  4XSX F;  2HZT A;  1ZLJ A;  3I58 A;  3HOW J;  5E79 C;  4Y13 A;  4HRI A;  3HRT A;  2QBY A;  4RB2 C;  2M7A A;  4IF4 A;  3HOT A;  4C30 A;  2R5Y A;  1MJA A;  2HOS A;  4RAY A;  4GRI A;  1EKE A;  1FBS A;  3KP3 A;  5BS6 A;  4XLP F;  4P1W A;  3DF8 A;  2VE9 A;  1G2H A;  3LAP A;  4N4O B;  3ZQG A;  1P4A A;  5HVQ C;  5E3N A;  1Q1V A;  1QHG A;  1R71 A;  2DQL A;  4M9X A;  2J5P A;  2VI6 A;  4N9I A;  2V1X A;  1QZZ A;  1FP2 A;  2Y0S A;  5EEG A;  3JR9 A;  4PJ0 C;  1XGN A;  1FOW A;  4C3I J;  1UZC A;  4BHC A;  1YW8 A;  3E0J B;  3DEU A;  4XKW A;  2L7F P;  4RMN A;  2IVM A;  1HLV A;  1PDN C;  2LD5 A;  3FF5 A;  3MEX A;  1ZGW A;  2HYG D;  3HTU A;  2F4M B;  1UST A;  3C7J A;  3KZI C;  2YU3 A;  2L4M A;  2NOJ B;  2ME6 A;  3MZH A;  2PI0 A;  2IAI A;  3TKY A;  1D0Y A;  2KJC A;  3KYD B;  1OMI A;  1VI0 A;  2Z1D A;  3BR1 A;  2UV1 A;  4MQ9 F;  4EJU A;  3CF5 F;  3E6M A;  5M5X J;  1OCZ H;  3AKZ A;  2RAE A;  2V1U A;  2W57 A;  4XK4 A;  4CUG A;  4AIJ A;  4J01 A;  2JQ7 A;  1T33 A;  3RPU A;  2VOP A;  3HDD A;  4G6T B;  5KAI C;  4A3J J;  5C3E J;  1R1V A;  2QQ8 A;  4KIG A;  1ORK A;  3A02 A;  1LVA A;  1XC5 A;  3W2A A;  2LNB A;  1YYV A;  4R1H A;  4M3G A;  1JKR C;  1G3W A;  3HYI A;  5FO5 A;  2JVH A;  4AWX B;  1UB9 A;  1IC8 A;  2R92 J;  4M74 A;  4NQW A;  1LUJ B;  1TWG J;  4BE2 A;  1R22 A;  3GUD A;  4HZF A;  4LJZ F;  4R8H A;  2XC7 A;  2XAJ A;  3I9V 2;  2QLZ A;  3WE3 A;  1B8I A;  3K4L A;  2FMY A;  3VB2 A;  2L7M P;  2X48 A;  1IG7 A;  1WH5 A;  5JI6 A;  4PFP A;  2R7W A;  1STZ A;  5E3L A;  2LOO A;  4D7N A;  5L3F A;  1WH7 A;  3HOZ J;  2F48 A;  5F0H A;  2HDC A;  1MBJ A;  1R5I D;  3ECH A;  2DN0 A;  2EFN A;  2GLO A;  3LST A;  3I0T A;  3PIP F;  3CUQ B;  1YOV B;  1W7P D;  1EH8 A;  2DDA A;  2DA4 A;  2E2J J;  3CO7 C;  3CJN A;  4JX4 A;  4UY8 I;  3KZY A;  3M8J A;  3QU3 A;  4HX4 A;  3H9Q A;  2XSD C;  5KHD A;  4YFN F;  1ONV A;  1MZB A;  3ECO A;  2ESH A;  2FQ4 A;  2IEK A;  5D8L B;  1ETX A;  3H3U A;  3K7A J;  1WHU A;  3ZMU A;  1ZGJ A;  4IO9 F;  2E1C A;  5HS7 A;  3A01 A;  2OV7 A;  3GVA A;  2B9S A;  4MGR A;  1H9G A;  3TL4 X;  5IP6 A;  1WJA A;  2QYO A;  3PM1 A;  4BHP A;  3D5L A;  5EEA A;  3F8N A;  5EYR A;  3S1R J;  1K79 A;  3LQR A;  1BR2 A;  4PZJ A;  4A69 C;  3FMQ A;  1GVJ A;  3TGN A;  2M3A A;  4II2 A;  2BY2 A;  3TW7 A;  2BZT A;  3LSR A;  2VXZ A;  2FJ1 A;  2WWY A;  1SEU A;  4A93 J;  4BDZ A;  3HTS B;  5LEJ A;  2V9P A;  1D0Z A;  5CPR B;  5D5V B;  3HB9 A;  4A0X A;  3CP2 A;  3KP4 A;  4LG3 A;  4E70 A;  4D5C A;  2W85 A;  2G9W A;  3FKJ A;  3SJM A;  5C4X J;  5J4V A;  3WTS C;  1UEL B;  1K78 A;  3MKW B;  4YFK F;  1KYZ A;  1X19 A;  4FET A;  4GXO A;  1G3T A;  3I3L A;  2DJI A;  2QEN A;  2VBX A;  2VQC A;  5A2Q K;  1V55 H;  4UUS B;  2V6E A;  2L02 A;  1CQT A;  3H9G A;  1T8I A;  3CCM I;  3OYF A;  4XON A;  4M3E A;  2CO5 A;  1SD6 A;  3MWM A;  2K02 A;  2XIG A;  4DYC A;  3OYL A;  3IRR A;  2M30 A;  4LMY A;  1K7A A;  2M8G X;  4UUV A;  5F1R A;  1U5T B;  2CV0 A;  4EGY A;  2M0C A;  4F52 A;  2DK8 A;  4LLL A;  2L7K A;  4B43 A;  1X4P A;  2JVG A;  1ZN2 A;  4AD9 A;  2HTS A;  4BJ5 C;  1SMT A;  2K4J A;  5FD6 A;  1A6I A;  2FBH A;  3KE2 A;  2R7Z J;  3BLY A;  5E20 A;  3I4N J;  5ERI A;  2KRH A;  4IQ4 A;  2ZNZ A;  1J59 A;  1IXS B;  2K9Q A;  1R9T J;  3I4M J;  5K7H A;  4BHB A;  1UHW A;  4L5E A;  3EYI A;  1XMA A;  3D1N I;  3DLL F;  2NOG A;  2DA2 A;  5ICG A;  1O3T A;  4RB1 A;  2NXN B;  5KCM A;  4IOA F;  4D7M A;  1X1B A;  3E5U A;  2X1C A;  3ZMT A;  1AOY A;  3OYD A;  3ZCO A;  2LK2 A;  1RIO H;  2YX7 A;  1ULY A;  1ODD A;  4C2U A;  5DM7 F;  1Z21 A;  5IYD J;  2YUS A;  3C1D A;  1K61 A;  2E71 A;  2MC4 A;  5B3S H;  3LA7 A;  2IT0 A;  2HZD A;  3PO3 J;  3TO9 A;  4F3Q A;  2DOE A;  3MZY A;  2CV2 A;  3L1P A;  3GTQ J;  3HPG A;  2HTJ A;  2DXI A;  5C44 J;  2L5Q A;  3JSP A;  2IS4 A;  3CMM A;  3DTE A;  3PUF A;  1FYL A;  1O7L A;  3CCV I;  4EM0 B;  4G6D A;  1T0F A;  3CQZ J;  3KX2 A;  3MAJ A;  2LKX A;  3JRC A;  5HLG A;  1WI3 A;  2LF8 A;  3K4N A;  2XF5 A;  3BCA A;  3RPQ A;  3M7G A;  1SD4 A;  1VF9 A;  2TDX A;  4B4C A;  1DP3 A;  2RQP A;  1TQI A;  1KU3 A;  3BPX A;  4D5F A;  2AHQ A;  4KIF A;  2LTP A;  4N4N B;  1B1B A;  4U87 A;  1Z0X A;  2M5W A;  3LA2 A;  4ZDO A;  4PK4 A;  2XKP A;  2P4W A;  1IN7 A;  1LQ1 A;  2QWW A;  3P9C A;  3JAM K;  3RIR A;  2RGV A;  1OQY A;  2O6G E;  3F8B A;  2VBW A;  1DUX C;  3EUH A;  1YIJ I;  2OTJ I;  1MNE A;  3B6C A;  3HEF A;  4RGR A;  4LIU A;  1G4D A;  5GAD J;  4A3C J;  4DBR A;  1G3S A;  4CCO A;  3LWF A;  2IGK A;  4XRF A;  1SMY F;  2ELK A;  2OD5 A;  2DYR H;  1HF0 A;  2LF7 A;  3ZQI A;  1IRZ A;  1ZG5 A;  2FBI A;  2EV0 A;  3QP5 A;  4AVZ A;  1WJC A;  2EFW A;  2R7S A;  5K5O A;  3ZQL A;  3RCO A;  3BQZ A;  4MO7 A;  3VSK A;  1J2X A;  5ILV A;  3BR6 A;  1RUO A;  5E1W A;  1BW6 A;  3GCM A;  2J5O A;  4BUP A;  4UUT A;  1Z6R A;  3CUQ A;  1Z6T A;  1J9I A;  5FD5 A;  3W6J B;  2A6T A;  3DPT A;  5DD4 A;  1BIB A;  3T1B A;  4ENN A;  1YG2 A;  1OCP A;  2ZXJ A;  3F8F A;  5IOZ A;  4MTE A;  2A5W A;  2IA2 A;  3HSR A;  2HEO A;  3G4S I;  5E3M A;  1MD0 A;  5KNL A;  3HOY J;  4BBS J;  4HX7 A;  4IXA A;  2K3P A;  1TW3 A;  3BG5 A;  2VJ5 A;  1ETV A;  1KU2 A;  1KON A;  2DA1 A;  1JT0 A;  3ABT A;  4II3 A;  3H1C A;  3LNQ A;  1FX7 A;  3FXR A;  1RKW A;  2ECC A;  4EVI A;  3J81 K;  4BYY A;  2Z33 A;  1QBJ A;  5LHI A;  1N25 A;  4IRI A;  1C0W A;  3HL2 A;  3CCE I;  4PJJ A;  2DOD A;  5EF6 A;  2W84 A;  4DNC A;  3EPZ A;  4EGZ A;  1SFU A;  1RZ4 A;  1R36 A;  4Y4R A;  1FY7 A;  1TQM A;  1Y1W J;  4I02 A;  1XSX A;  5J40 A;  3FMR A;  3F22 A;  1YS7 A;  2I5U A;  3W2W A;  2CG4 A;  2F4I A;  2LDU A;  1EV7 A;  5LEK A;  2Z2S B;  3IWF A;  4NBQ A;  4XN3 A;  4UUS A;  4U7D A;  3WU1 B;  4B3X A;  2GOX B;  1J7K A;  1X58 A;  3ZP5 A;  3M3Y J;  2M45 A;  3CTA A;  2X1E A;  2KIM A;  4GDF A;  4S0H B;  1U5T A;  1W1W E;  2CQN A;  2DLL A;  3FBN B;  4Q4Z F;  1FYK A;  2GXA A;  1FIP A;  2B0L A;  2FOW A;  4XOT A;  1HKS A;  1A6Q A;  1MBG A;  4YEL A;  4XRS A;  2ADU A;  4A12 A;  1LE8 B;  3ZOB A;  1IGN A;  3W6V A;  1OIS A;  3NEU A;  5FKL A;  4WX9 A;  4FX0 A;  1VQ4 I;  1JKO C;  2FNA A;  1A31 A;  4KT6 A;  4H0E A;  2PG4 A;  2XAF A;  4BU2 A;  2MG4 A;  2VN2 A;  5JLW A;  1U78 A;  4LIT A;  1POG A;  3P5J A;  4HOB A;  1XD7 A;  5JHF A;  1BJZ A;  3RYP A;  1GUU A;  2VQH A;  1IXR C;  2EBI A;  2D5V A;  2XKO A;  3H35 A;  3S16 J;  2WTE A;  1T98 A;  1GVD A;  3FHZ A;  2HOA A;  3D0S A;  3ELK A;  3JRF A;  2DT6 A;  2CMP A;  2DFE A;  3KP7 A;  3LSI A;  4OIN F;  3TED A;  3KLO A;  5TJJ A;  2DJN A;  1VQ9 I;  1P9Q C;  2VL8 A;  4O6J A;  4HLY A;  2VBY A;  4NC7 A;  5IYC J;  2D1H A;  4BQA A;  4Y33 A;  1NK3 P;  3QPS A;  2P81 A;  2E1M B;  2XVC A;  2CW0 F;  1JJ6 C;  3GF2 A;  1QPI A;  2H6C A;  2PN6 A;  3FBI B;  3OOU A;  1OLT A;  4OIR F;  1YJN I;  2RNJ A;  2QQ9 A;  3E6B A;  3HM5 A;  3QWL A;  5IT9 Z;  2XDV A;  1U2W A;  1SC7 A;  3QYF A;  1FBU A;  1QNT A;  2HVS A;  3I4P A;  1ETY A;  2R7U A;  4L9V A;  3F8M A;  5DUK A;  2BVL A;  3Q0U A;  1MGT A;  1W7P B;  3F21 A;  1OJL A;  2FML A;  4EQQ A;  3HKZ N;  1SAX A;  1SFE A;  2IXS A;  1DU6 A;  3HSF A;  3VYT B;  2IJL A;  5HS8 A;  4GGG A;  4AID A;  4GYI A;  4ZDP A;  2OZ6 A;  1YW9 A;  2IP2 A;  1ZK8 A;  2P5K A;  1MBF A;  1BC8 C;  1MND A;  1S7A A;  4M3D A;  2HNH A;  3LSK A;  4XN0 A;  2K9L A;  1H8A C;  2MLK A;  2RVC A;  2KZG A;  3AL0 C;  3HRS A;  2WB1 A;  2X1D A;  2M7B A;  2VAS A;  3HPH A;  3RKY A;  3X2Q H;  1TZL A;  2NVY J;  5DS9 A;  1RUN A;  3BRO A;  3GTM J;  3N4M A;  4QPO A;  3NAU A;  1OR7 C;  4E7L A;  3K10 A;  1TNT A;  3ZQQ A;  2JZY A;  1Y56 A;  3RKQ A;  1MMA A;  1EH7 A;  3OV8 A;  3SDG A;  3ERM A;  2QM3 A;  2Y69 H;  1IN8 A;  2XGE A;  4AIK A;  3A1Y A;  2AS5 F;  4WK8 F;  2P5V A;  1SVL A;  1YFH A;  3M1E A;  5L3C A;  2E1N A;  1H9T A;  1IRX A;  3TBI A;  1APL C;  4DYQ A;  4CO8 A;  3GTL J;  1Y0U A;  1JI8 A;  4MFD A;  2OAZ A;  3H3Z A;  3WTY C;  3OYG A;  1FYM A;  2KDZ A;  4AM3 A;  5CVU A;  3H3V K;  1V5E A;  2G7U A;  5FRO A;  2FA5 A;  1BJA A;  2H1K A;  2F4O B;  3GTG J;  2ZB9 A;  3IH3 A;  2XAH A;  2A68 F;  5EG0 A;  4BQO A;  3CES A;  4XIC A;  3CC4 I;  3MQ0 A;  3TDZ C;  2E5N A;  3ZMV A;  1R1T A;  2KP6 A;  2VKD A;  2M0M A;  4CXF A;  1GHC A;  1RC9 A;  4B48 A;  3GTK J;  1PP8 F;  1IZ1 A;  1HA8 A;  2BXY A;  4RBO A;  1B9N A;  1G6N A;  1YRN B;  3CO6 C;  3S2D J;  2XGD A;  3AG1 H;  4ZDL A;  4MEY F;  1OYI A;  2M4G A;  4HG2 A;  1JTX A;  4E4H A;  1S6L A;  3A01 B;  4LGW A;  1S3J A;  3ABU A;  3I55 I;  3CLO A;  3KP2 A;  5F27 A;  3O8G A;  2Z3Y A;  5IP7 J;  1LE8 A;  4HDU A;  1FTZ A;  4U0Y A;  2LYC A;  3L00 A;  3OYA A;  2AQE A;  3EQL F;  1Y0N A;  2F6C A;  2DFI A;  4CCK A;  2P5L C;  4E7I A;  1S5L C;  3U1K A;  2QF7 A;  3V8K A;  1GXP A;  3I54 A;  1QZE A;  4BQQ A;  2DOA A;  1VQM I;  4WCG A;  3MD2 A;  4NC8 A;  3HRM A;  3IHU A;  2DI3 A;  2XV4 S;  3WG9 A;  5LHG A;  3F6V A;  1MBK A;  3JRG A;  3E7L A;  3L2C A;  1X1D A;  2WV0 A;  2E36 A;  2R3S A;  3KP5 A;  1DPU A;  5LRR A;  4DOZ A;  1U6G A;  3CMY A;  1X1C A;  4I98 B;  4HEA 2;  3S93 A;  3FK7 A;  1JHF A;  3E6C C;  1MH3 A;  2KL4 A;  2LSO A;  3GZ5 A;  5IY5 H;  2CSO A;  4PJM A;  4RGU A;  2K86 A;  3F6O A;  1ZYR F;  1CGP A;  1IV6 A;  1UJ8 A;  4L9T A;  3DBH B;  5GP9 A;  3BTJ A;  2C6Y A;  4CZC A;  3MKY B;  2CH0 A;  3SZP A;  4PJL A;  2M87 A;  3I56 I;  2L0K A;  2H1L A;  4RLF A;  3K4J A;  1W5C C;  3KYL A;  5E18 F;  2OQG A;  2CJJ A;  5FKM A;  4BAY A;  4E7S A;  4A3M J;  2CGP A;  2PQ8 A;  4KIB A;  5AIQ A;  3QPT A;  2G0E A;  2BY0 A;  4J19 A;  4GO1 A;  2FOK A;  2TCT A;  2NNN A;  2CS3 A;  4XKC A;  5L3B A;  1RR7 A;  1SD5 A;  3HOS A;  4PUS A;  4XNF A;  3HGY A;  4A5N A;  3QP6 A;  2KMU A;  2LVS A;  2M1B A;  2ZME C;  1Z67 A;  3S8P A;  2MFZ A;  2FE3 A;  1KQ8 A;  3PFI A;  5DCF A;  1W7P A;  1B4A A;  2K5C A;  1GXQ A;  4HX8 A;  1Z77 A;  3MVP A;  4WXC A;  2JMW A;  3FXQ A;  3T8R A;  4XR6 A;  3GFL A;  1D1B A;  4PSX A;  4D0P A;  4BL0 B;  2EA4 A;  3QOE A;  1G3Y A;  4Y15 A;  3VOE A;  4XLC A;  4E7Z A;  1VQL I;  3GBG A;  3OR2 C;  1J5Y A;  4A6E A;  3S2H J;  1OYY A;  2W1O A;  3FZV A;  3EDP A;  1E2X A;  2CFO A;  1PP7 U;  3I64 A;  2XPU A;  1QVT A;  1XG1 A;  1S7O A;  2JRM A;  4NB5 A;  2IBD A;  2RN7 A;  1KU7 A;  4S05 A;  4Y3O A;  5CVV A;  2XRO A;  1ZKG A;  2WBM A;  4HNV A;  2WAF A;  3GEZ A;  2JA5 J;  3V4G A;  2EZL A;  1J09 A;  3DKW A;  2IGM A;  4BDY A;  1XSV A;  3PQK A;  1ETO A;  1UHS A;  4PSW A;  1PJR A;  3VSL A;  5J4Y A;  3J7Z I;  3BTI A;  1IF1 A;  3OYJ A;  2NS7 A;  3BZC A;  5EZH A;  2XUB A;  3VDX A;  3OSG A;  4KN7 X;  2P8T A;  2DA3 A;  3J80 Z;  2VON A;  1TP4 A;  3NWS A;  4IOC F;  3GTO J;  1V4R A;  2EA2 A;  4YG2 F;  1TNS A;  3DBR B;  5J6X A;  2VJ4 A;  2LY2 A;  1UG0 A;  1YE9 A;  2GQQ A;  5CVR A;  2HS5 A;  1SAU A;  2PMU A;  1D5V A;  1MMN A;  3SFI A;  5L3E A;  2DPD A;  2FRH A;  3DKX A;  1N77 A;  3V8J A;  4BE1 A;  2B63 J;  4CYC B;  1I3A A;  3CDI A;  1LEB A;  1Y6I A;  4A3D J;  4MHG A;  4X6A J;  1FTT A;  3TP0 A;  3RKX A;  3IP4 B;  2YSR A;  2DMT A;  2O3F A;  4I7H A;  5LD2 C;  2E7X A;  5IYB J;  3QPH A;  1XGS A;  1JT6 A;  3LFK A;  5ILU A;  1FMW A;  2VJJ A;  1FWZ A;  3AFH A;  1WKM A;  4G8X A;  5HS9 A;  5TRD A;  1T39 A;  4BKX A;  4UVB A;  2XPV A;  2KIQ A;  2ZSH B;  3J7A Y;  4HBL A;  4BXF A;  4A3F J;  5AON A;  4B1R A;  4WXH A;  1FT9 A;  2PJP A;  1YRN A;  3SEQ A;  2V6C A;  4M3F A;  4HQE A;  1S72 I;  5ICE A;  1WJB A;  4BGD A;  3NWT A;  1B6A A;  1VQ5 I;  3ZPL A;  3CC2 I;  2VBZ A;  4QTR A;  2UXN A;  1E3O C;  2MYS A;  4E7H A;  3BR3 A;  1BI0 A;  3H9J A;  1ZGA A;  4W1U A;  3TQN A;  3T8T A;  2JJ7 A;  2A61 A;  3I71 A;  4RGS A;  3EUA A;  2ZXI A;  1JGS A;  3HHH A;  3JTH A;  4EJV A;  3G71 I;  2GXB A;  1VTN C;  2KIS A;  5DEQ A;  2QSH X;  1D1A A;  4XLN F;  2ZJR F;  3CCU I;  3IRQ A;  5HOO A;  1A5J A;  3UKG A;  2X6W A;  2MH9 A;  1SD7 A;  4CCN A;  4B47 A;  3OIQ A;  2XAS A;  3S17 J;  2XAU A;  1I39 A;  1HBX G;  1LEA A;  4B09 A;  2COM A;  3B6A A;  4JX5 A;  3K4B A;  3MZ8 A;  1IN6 A;  3I5U A;  3DBL B;  2L7Z A;  2QSF X;  3NAR A;  4G6Q A;  1BA5 A;  5K7Z A;  3OL3 A;  2R93 J;  1I5Z A;  4X0G A;  1R4N B;  4I0A A;  4G7H F;  2OTL I;  2XAG A;  2K9S A;  3RPU D;  3KEQ A;  5DCM B;  2DA6 A;  3I53 A;  3L2Q A;  1LDD A;  1CF7 B;  2GA1 A;  2OPT A;  5BPI A;  2GZW A;  3ONQ A;  2IPQ X;  2RRE A;  3HZJ A;  1HKT A;  1HW5 A;  3CJR B;  4QLC U;  1UG2 A;  1X3W B;  4KA4 A;  1MBH A;  3KIO A;  2L9S A;  2RKH A;  3RQI A;  2Y0S N;  3BG6 A;  2VT3 A;  1S7E A;  1XX5 A;  2PFB A;  1M1E B;  1MH4 A;  3SQN A;  1F36 A;  3G1M A;  1X4O A;  2KIF A;  3M4O J;  1JJ8 C;  2CWE A;  1O57 A;  1YQA A;  4LLN A;  1DPR A;  2JUC A;  4ZZD A;  2CUZ A;  3WU2 C;  1MMG A;  2DPU A;  4I0B A;  1FMV A;  1I6H J;  5IT9 K;  4IHW A;  1UAA A;  4IHT A;  5FLX Z;  4I76 A;  1BI1 A;  3Q9S A;  2HYJ A;  1H88 C;  2AXT C;  4P9F A;  1XS9 A;  2EZI A;  4JX6 A;  2FD5 A;  4Y7N J;  2X85 A;  2AQF A;  3WU0 A;  4E7J A;  2LY9 A;  3VYR B;  2LP0 A;  4FE4 A;  2RQQ A;  4DZP A;  2EFP A;  5IPA A;  2DW4 A;  2OU2 A;  1BIA A;  1FZP B;  2B7E A;  4A3B J;  2WAD A;  1Z7U A;  1SVO A;  1WQ2 A;  3FK6 A;  3DV8 A;  3OOP A;  4UB6 C;  5F6F A;  1KQ9 A;  4JBA A;  4B8X A;  3BQY A;  2BHZ A;  4HF1 A;  4UVA A;  2HQR A;  4FTH A;  3K6G A;  2EFQ A;  2ACJ A;  5GAG J;  1TL8 A;  1E0E A;  3TP3 A;  3OIO A;  1UFM A;  1VQ7 I;  1FIA A;  3C18 A;  2GAU A;  3HJE A;  3WOD F;  3S1Q J;  2HR3 A;  1K6O A;  1LDK B;  2CU7 A;  4IJA A;  2OA4 A;  4YIR X;  5GPA A;  4I01 A;  2IS1 A;  3S3N A;  2O8K A;  2UXX A;  2R4G A;  2OCE A;  2MSY A;  3H0G J;  4CYC A;  3H0D A;  3SHF A;  3ULQ B;  1NH3 A;  2STT A;  1YJW I;  3RZD J;  3JRI A;  3A0H C;  2ZFU A;  2QGU A;  2PJR B;  3HBL A;  2CV1 A;  1FSH A;  4KMF A;  2EIM H;  5LGN A;  3ZN0 A;  5F0C A;  4XOP A;  5ED4 A;  3J7Y J;  1P7I A;  3BTC A;  2A5Y B;  2EIJ H;  1IRF A;  3L7W A;  3DKY A;  5J3L A;  4L9N A;  2K3F A;  1D0X A;  4PJN A;  4CGZ A;  2DU9 A;  1A35 A;  1SFX A;  2KIU A;  3ZRG A;  1JTY A;  4XMY A;  2A07 F;  2KJB A;  4XQF A;  3HOV J;  1HDP A;  1OCR H;  1I1S A;  3DTK A;  2HPM A;  2ZJP F;  3DP7 A;  2X0L A;  1F1Z A;  2QKM B;  2ZJ2 A;  1WSU A;  1HOM A;  4JP0 A;  4OOI A;  3KYC B;  2MW8 A;  3GZN B;  2CW7 A;  4RM2 A;  3LSM A;  4HV5 A;  1ZQ3 P;  3BR2 A;  4XLF A;  3DU5 A;  4A3E J;  3IWZ A;  1T95 A;  3OYK A;  1N75 A;  2DT5 A;  1P4W A;  2F5F A;  5JVT A;  2OF7 A;  5DUI A;  1O3S A;  1OCO H;  2ESN A;  1WVR A;  5CLS A;  1YJ9 I;  1T0F C;  1Z91 A;  3S1M J;  1BW5 A;  2GBY A;  4QSH A;  1MJB A;  5EG0 B;  2LC2 A;  4KJZ A;  5H20 A;  5M3M J;  4CHU A;  1EJ9 A;  2R5Z B;  2HKO A;  2FX0 A;  5CVJ A;  1G59 A;  3CMA I;  2JTV A;  3LSJ A;  3UR3 C;  4XRM A;  3IH4 A;  5DYM A;  1I6X A;  4A5M A;  3GLL A;  2QUF A;  1KYW A;  3REO A;  2M34 A;  3EUH C;  3O6B B;  3DQV C;  4M73 A;  4BY1 J;  1B72 B;  1KU9 A;  1BN5 A;  1ZR4 A;  2I8D A;  1Z05 A;  3GW2 A;  4HLX A;  3SFZ A;  2UZK A;  1FLI A;  2GOM A;  3T0Y A;  3FXJ A;  4LK1 F;  2X6Y A;  4RDU A;  3FIW A;  5J1Y A;  1WGX A;  5DCM A;  2V9V A;  2IW5 A;  3CJQ B;  1CF7 A;  3SDB A;  1XCB A;  2E5Z A;  5IP9 J;  2HWV A;  1HQC A;  4WXD A;  4CA0 A;  4DGW B;  1GV5 A;  3K2Z A;  1VQN I;  5F1J A;  5JR3 A;  3HRU A;  1W0T A;  2JA6 J;  3P7N A;  3PNV A;  1IN5 A;  2MH2 A;  3EET A;  2L4A A;  2OJE D;  5L3G A;  4G7Z F;  5FRM A;  3BP8 A;  3HOU J;  2EWN A;  2NAZ A;  5J1R A;  5FB2 A;  2FF4 A;  2O5R A;  2OCC H;  2ME0 A;  4HW0 A;  1ZH5 A;  1YTY A;  1ZTR A;  3OIP A;  2A05 A;  1T08 B;  3D5S C;  4E6K G;  4B44 A;  3CUQ C;  2WAE A;  2IA0 A;  1O4X A;  3GZ6 A;  4BJ6 C;  2GWR A;  3W2V A;  1MKM A;  1MW7 A;  3ABL H;  5HLT A;  4EJT A;  3V42 A;  1V54 H;  2HQA A;  3I59 B;  1LNW A;  2K27 A;  2BOL A;  4A3G J;  1HSJ A;  4L18 B;  3H92 A;  2VJI A;  2DMU A;  3CCR I;  4NUB A;  3FXO A;  5K1Y A;  2IGN A;  4L5J A;  3KLN A;  3K70 C;  4IKF A;  3QOP A;  2XF7 A;  4FAS D;  3EYY A;  2BYV E;  2P7V B;  4BQN A;  1SAN A;  2N8G A;  1R23 A;  1TW2 A;  1LFU P;  3JRD A;  2CUF A;  4W97 A;  2QVO A;  3J7A O;  2CFX A;  3W3C A;  1PUF B;  1ZR2 A;  1YLF A;  4KT5 C;  2ZCW A;  3RSN A;  3CME I;  3K70 D;  3K1M A;  3F72 A;  3GTJ J;  2YX4 A;  4XOR A;  3LSH A;  3OWT A;  3LAJ A;  1TT5 B;  3BPV A;  4FT8 A;  1BI2 A;  2VT2 A;  4WF2 A;  2PLY A;  3UNG C;  3W6K B;  2DO7 A;  2DBB A;  3A03 A;  5FKN A;  4AU7 A;  5CQG A;  5GTI C;  5E8G A;  3WTX C;  4FCY A;  3DXJ F;  1HKQ A;  3CJT B;  2F5C A;  1U5T C;  1E17 A;  3J80 K;  4HDV A;  1REP C;  4X1E A;  4I09 A;  3ESW B;  3A0B C;  5BNG A;  1RES A;  3Q0W A;  3E5X A;  2PJR A;  3DLA A;  5JLX A;  3H5R A;  3M8F A;  2ZO4 A;  4DW6 A;  2FEZ A;  2WY7 Q;  3NQO A;  2Y0M A;  1LDJ A;  3E5Q A;  4MLO A;  4BNC A;  2ZXW H;  2DMQ A;  9ANT A;  3HUG B;  4HV6 A;  3DFG A;  1QVU A;  3K4M A;  4KIC A;  4M6V A;  2Q1Z B;  4CYD A;  4OWR B;  1DU0 A;  1MIJ A;  2GM4 A;  2ZSI B;  1TQP A;  2VXD A;  2H94 A;  4A2U A;  1TBX A;  1EH6 A;  2CRG A;  2EB7 A;  4IRH A;  3OYM A;  4OIO F;  3BJO A;  1IUY A;  3H5N A;  3LL7 A;  2P6T A;  2EPF A;  2ZNY A;  3GFJ A;  5HOD A;  4Y52 J;  4XKB A;  3AG4 H;  1UHM A;  5J1U A;  2PMZ A;  4ZTF A;  3Q0V A;  1XDS A;  5L3D A;  4AC0 A;  4DJA A;  1OFC X;  2H8R A;  3BG7 A;  5J8C A;  1JUM A;  1VQ8 I;  3FDY A;  4XLH A;  5D5U B;  2O03 A;  1BBY A;  4GFB A;  4IVN A;  1DGR M;  1O3R A;  2RDP A;  4C9Y A;  5B1B H;  2R5Z A;  1BM9 A;  3CD6 I;  5HDK A;  2CQQ A;  1RKT A;  2A3S A;  2HKX A;  2XHK A;  4BJT A;  4XL9 A;  1YO5 C;  1A36 A;  1EF4 A;  3E1S A;  2XF6 A;  3QAH A;  5D4R A;  3ERE D;  3WTU C;  4M3B A;  3CZ6 A;  3DWL E;  3WTV C;  3QRF F;  1B72 A;  4G12 A;  1R5G A;  4RAZ A;  1LB2 A;  4M71 A;  3QOD A;  2YR2 A;  4A0Z A;  2JA8 J;  4DBQ A;  2R0Q C;  1LVK A;  3BG3 A;  2AO9 A;  2KLO A;  3F9K A;  2VIX A;  3KFW X;  4EEF G;  3OYC A;  4PGH A;  3ASO H;  3NRV A;  4RB0 A;  4U0V A;  5HLH A;  4A3K J;  2GIV A;  2E1O A;  1YIO A;  1GDT A;  4RM3 A;  2R7R A;  4OU0 A;  4MFE A;  2KPM A;  5JFR A;  3G6E I;  1TC3 C;  1ETQ A;  1T38 A;  4ENM A;  1NHA A;  4RS8 A;  1YW7 A;  3CCS I;  1WI9 A;  4KN4 X;  3GFI A;  5DTD A;  1QGP A;  3T5X A;  2F5V A;  2LFB A;  1VQP I;  2FBK A;  4XID A;  2FQ3 A;  2JWT A;  4RGX A;  1MMD A;  2KQR A;  4AYB A;  3IAS 2;  4BE0 A;  3KEY A;  1HCR A;  2F5D A;  1ZLK A;  1IN4 A;  1D3Y A;  3GTP J;  2ZFW A;  2I10 A;  4FX4 A;  2JT1 A;  1K4S A;  1U0J A;  3U2R A;  4YEJ A;  3U1D A;  3S32 A;  2V1D A;  4UV8 A;  4RLQ A;  2BBY A;  5LLQ A;  4KDP A;  4D1Q A;  3RZO J;  1XDU A;  1BC7 C;  3I59 A;  4ZYA A;  1ETW A;  3ZMD A;  1AKH B;  2H8W A;  2W24 A;  4PGG A;  1GLN A;  4CCJ A;  2BW3 B;  3PUB A;  3OS2 A;  5BPD A;  3D5R C;  1WJF A;  1L3L A;  4JK1 X;  3PQJ A;  2HQ5 A;  2IA1 A;  2L3D A;  3K4K A;  4ZYH A;  5FLX K;  2DMN A;  3BC8 A;  3DEE A;  3S1N J;  5JVG F;  2XSJ C;  5B66 C;  2K9M A;  1LFB A;  2KKO A;  2Z99 A;  2ELH A;  1XB4 A;  4HYE A;  1PUF A;  5HNH A;  1JUS A;  3K4C A;  2XB5 A;  1O7F A;  1R49 A;  3LFU A;  2PMH A;  1YHQ I;  4IHX A;  4BEH B;  3DTI A;  1QU3 A;  2QQA A;  4IZZ A;  1B9M A;  1HW1 A;  1N78 A;  1MDM B;  5M3F J;  2WB1 N;  4LFU A;  4RAG A;  3LOC A;  1ETK A;  4M6Y A;  3ABK H;  2O9L A;  3IKV A;  4M9Z A;  4P9U A;  2HDD A;  4YRV A;  5LHH A;  4I2O A;  1WJE A;  3R0A A;  4MQV A;  2LKP A;  4ETS A;  5FKK A;  1HXD A;  2FNP A;  5KAF C;  3S2W A;  4L0Z B;  3QPL A;  1VND A;  4CH7 A;  2LRD A;  1J75 A;  1X1P A;  3N05 A;  3GXO A;  2HFH A;  5IOY A;  5D5W B;  3BR0 A;  5ICC A;  1UCR A;  3RQ4 A;  1X1A A;  4Z2Y A;  1T2K A;  4UNO A;  3P9I A;  1BOA A;  3E6D A;  1W0U A;  2HXO A;  2LBF B;  3F0C A;  1AU7 A;  1TTY A;  4V19 K;  1GV2 A;  2ZKZ A;  4XLA A;  1QO0 D;  3CDL A;  4HPQ A;  3S3M A;  2YU9 J;  2HYF A;  3HUG A;  3L2U A;  1ZRC A;  3FXL A;  4Y17 A;  4B3A A;  4K2E A;  1Z3X A;  5KK1 A;  2H27 A;  1VQK I;  3K1P A;  4L5I A;  5EDN A;  3WGG A;  3B02 A;  3JRE A;  2R7O A;  2PMZ N;  1ERD A;  2ISY A;  5BQT A;  3OYN A;  3U9G A;  2E34 A;  1Z3Y A;  2DMP A;  3OYB A;  2K4B A;  2XB0 X;  2XPW A;  1KGS A;  5K5Q A;  3OR1 C;  2VB6 A;  2X51 A;  4BAC A;  2CQX A;  1MSF C;  1JKQ C;  1NG6 A;  2HDW A;  1LKX A;  4A0Y A;  3S14 J;  3FM3 A;  2GXG A;  3IH2 A;  1F4K A;  5F0F A;  1NK2 P;  1QA6 A;  5FRN A;  4S04 A;  1WFX A;  2QZ8 A;  4ESF A;  4J00 A;  2JUG A;  3DPU A;  2E1M C;  1RPW A;  4NC6 A;  2BY1 A;  2OQR A;  4ENK A;  3JTG A;  2EIL H;  4OIP F;  3L2V A;  3PSI A;  3TW6 A;  4A3L J;  3HC7 A;  3E97 A;  4BXU A;  1ZG3 A;  4IHV A;  4JQF A;  1XTA A;  1FJL A;  1ZAO A;  2Q0O A;  4P5O A;  1W36 C;  1IAW A;  1J0R A;  1D8J A;  2HXI A;  2E35 A;  4DQ2 A;  3ZGK A;  2EK5 A;  2QA4 I;  1V5F A;  4RB3 C;  1Y8Q B;  3PNY A;  1MJ9 A;  1BI3 A;  3SZG A;  1XGO A;  2LY1 A;  1W36 D;  3CF2 A;  4R79 A;  2W7N A;  4U0W A;  1FNN A;  3PSF A;  1K83 J;  4F91 B;  1MMS A;  3DPL C;  3FHN A;  1XMX A;  4ZYE A;  2WAQ A;  2O0Y A;  4AYB N;  2E2I J;  2UWM A;  4CZZ A;  3BOQ A;  4MEX F;  2Q2E B;  4EM2 A;  1Y39 A;  4HF0 A;  3B73 A;  4IHY A;  2X6X A;  3Q3S A;  2W25 A;  5LGT A;  1X2N A;  2O7O A;  2UUZ A;  2LR8 A;  1R58 A;  5EGO B;  5CYV A;  3Q5F A;  1X3U A;  4IQJ A;  4ZTJ A;  3AG2 H;  2WA0 A;  3R6S A;  2H09 A;  3ZQF A;  2KDO A;  3CCQ I;  2IRF G;  2P6S A;  2X6O A;  5C4J J;  5KVR A;  3HG9 A;  2TRT A;  2L01 A;  2CW8 A;  4CDG A;  1IJW C;  1QRY A;  3IV5 A;  3KEO A;  1DDN A;  1AKH A;  1AWC A;  2EIN H;  3JRA A;  3QYE A;  5BMZ A;  2BW3 A;  3LMM A;  1TWA J;  4F55 A;  1RET A;  3KET A;  2W82 A;  1HW2 A;  6PAX A;  2L9R A;  3ZQ7 A;  1S8N A;  1KQ0 A;  1I50 J;  3V8L A;  3LSG A;  4F7Z A;  1U9N A;  2DT7 B;  1AHD P;  1D1C A;  4KMU X;  1MBE A;  3ZQH A;  4QWQ A;  1E3P A;  2QQB A;  4IPA A;  2JPB A;  1ITY A;  4HSR A;  4EV0 A;  2CYY A;  3H36 A;  4OAY A;  4LB5 A;  1BR4 A;  3TOB A;  1XCV A;  4DYR A;  2Y2Z A;  4BEH A;  4L0Y B;  2IS6 A;  4A3I J;  3OL4 A;  2BE5 F;  3K1N A; 
#chains in the Genus database with same CATH homology
 2VC1 A;  1R1U A;  1MDM A;  5E8I A;  1IRG A;  3BWG A;  1JE8 A;  4GCV A;  4ENJ A;  3R0J A;  5E1X A;  4XBF A;  2DTR A;  2JSC A;  5EEH A;  4EMS A;  4ESJ A;  4KNY A;  3BJA A;  1I1G A;  3C3W A;  5DD8 A;  1FSE A;  3RJP A;  3R60 A;  3CDH A;  4PDK A;  3BDD A;  4IHS A;  2ISZ A;  3GX4 X;  3HSE A;  3KCC A;  3RTR A;  1LJ9 A;  4UHT A;  3O3K A;  1ZHF A;  2NRA C;  2Y75 A;  1R5H A;  3BZ6 A;  4A6D A;  2FU4 A;  2VE8 A;  2FXA A;  3RDI A;  2P7C B;  1OKR A;  5HDN A;  3RKW A;  1I27 A;  4KFC A;  3WE2 A;  3GWZ A;  2FSW A;  1U3E M;  1ZRE A;  3JSO A;  2VC0 A;  3WGI A;  2MLG A;  1FBQ A;  3GLX A;  2R7F A;  4Q48 A;  1ON2 A;  3FMS A;  1WWX A;  3E3V A;  3WTT C;  3GYH X;  4YFX F;  3N97 A;  3HHG A;  1A04 A;  3RYR A;  1R7J A;  3ZN1 A;  3CUO A;  4MTD A;  4OIQ F;  1QZY A;  1OYW A;  4KYW A;  4UV9 A;  5FGM A;  5J8F A;  4OMY A;  2NS0 A;  2L54 A;  5JHU A;  2Q2E A;  1Q1H A;  4AVP A;  3M9A A;  1QQI A;  4N0B A;  4YIF A;  3FXU A;  4ZYD A;  3WTW C;  2RC4 A;  1S29 A;  2KRF A;  5BOX A;  3SZT A;  3K69 A;  4KUM A;  4U7B A;  2MA3 A;  1DP7 P;  2X4H A;  2A6E F;  3F8C A;  4U88 A;  1ZG1 A;  3VFZ A;  4UXN A;  3G73 A;  2ZME B;  2MC3 A;  3O2P E;  2Z9O A;  3P9K A;  2E7W A;  3TO6 A;  3FM5 A;  2YPR A;  1RNL A;  3IKT A;  3ISP A;  5LBQ A;  2A6H F;  5HDG A;  1TLH B;  1Z1D A;  2K7L A;  2Q8K A;  3ROU A;  5D6F A;  4G7O F;  5HLI A;  1ON1 A;  3SXY A;  3MCZ A;  3TO7 A;  3JW4 A;  2OBP A;  1B59 A;  2F2E A;  4TV7 A;  4M72 A;  1R00 A;  1P92 A;  1P2F A;  2VOO A;  1W5S A;  2XRN A;  5A2Q Z;  4ZZL A;  3ML6 A;  1OR7 A;  1D8K A;  3AAF A;  4FHT A;  5FFZ A;  2JPC A;  3V7R A;  5E1Z B;  4LG0 B;  2CQK A;  2WC2 A;  1F9N A;  5AIP A;  2D2W A;  1L0O C;  5ILS A;  3VEP A;  3M8E A;  4LB6 B;  4OMZ A;  2EFO A;  3V7S A;  5D4S A;  2NYX A;  1HST A;  3RI4 A;  1XMK A;  3COA C;  1ZAR A;  2EV6 A;  3G3Z A;  4G94 A;  3FWE A;  1IXC A;  2Y48 A;  3Q9V A;  1KA8 A;  3VOD A;  5LGU A;  2OZU A;  2O61 A;  5H6R A;  4HF2 A;  5D5X B;  3LQQ A;  1XN7 A;  2QBY B;  1RI7 A;  3GFM A;  4HQM A;  5LRS A;  4ON0 A;  3ZMS A;  1W5T A;  3TOA A;  3HIF A;  1FOK A;  5DDG A;  1ZRF A;  1W4M A;  3KP6 A;  1QPM A;  1P4X A;  2DK5 A;  4WWC A;  2EV5 A;  3F3X A;  2DAO A;  2STW A;  2BEO A;  3IL2 A;  1H0M A;  5F64 A;  4LK0 F;  4EJW A;  3V7C A;  4HA8 A;  5DV5 A;  2DQR A;  4NHJ A;  3JAM Z;  1V3F A;  1FPQ A;  1U8R A;  4ZH4 F;  3GO5 A;  3R4K A;  4L9J A;  4ASN A;  3WGH A;  4M6X A;  2EJR A;  4YII A;  5IT3 A;  1P6R A;  1XSD A;  1T6S A;  1IW7 F;  2A69 F;  3TDU C;  2O8X A;  2G7H A;  2BGC A;  4O5V A;  1XGM A;  3L09 A;  4O3M A;  4ZYG A;  2M8E A;  5FFX A;  3F23 A;  4MNU A;  4LD5 A;  2F5E A;  4G9Y A;  2HGC A;  3K9T A;  2Z5U A;  3BJ6 A;  3LA3 A;  3BY6 A;  2ZME A;  1JHH A;  2MBF A;  1FP1 D;  4P55 A;  5ICF A;  3KZZ A;  2GA2 A;  2BV6 A;  2JRT A;  2PBI A;  2ZBK A;  4XSZ F;  4AIH A;  3K0L A;  1O3Q A;  4EJO A;  3IC7 A;  3J81 Z;  2V79 A;  4EM1 A;  5H6Q A;  5D8K B;  1YS6 A;  1PUE E;  4BH9 A;  5K5R A;  4HAM A;  4GYG A;  1WRJ A;  4Q5S F;  2H6B A;  1Z9C A;  1ZRD A;  3MFK A;  2HQN A;  2VOD A;  1JXS A;  5CJ9 A;  2XGX A;  3L9F A;  5D6E A;  3WTZ A;  4M9S A;  4P96 A;  2RV8 A;  4Q47 A;  5CVI A;  2ETH A;  2AXL A;  2D45 A;  4N9H A;  1K78 B;  2XAQ A;  2NNY A;  2D1V A;  4LG0 A;  2PEX A;  3FX3 A;  5E17 F;  4CIC A;  1OPC A;  2MD5 A;  4PCQ A;  4UVC A;  4IRG A;  1USS A;  4ESB A;  2R7D A;  3QU6 A;  4LLG F;  2HOE A;  3ZMZ A;  1FC3 A;  3R61 A;  1F5T A;  4XSX F;  2HZT A;  1ZLJ A;  3I58 A;  4Y13 A;  3HRT A;  2QBY A;  4RB2 C;  4IF4 A;  3HOT A;  1MJA A;  4RAY A;  1FBS A;  3KP3 A;  5BS6 A;  4XLP F;  3DF8 A;  2VE9 A;  3LAP A;  1P4A A;  5HVQ C;  2DQL A;  4M9X A;  2J5P A;  4N9I A;  2V1X A;  1QZZ A;  1FP2 A;  5EEG A;  1XGN A;  4BHC A;  1YW8 A;  3DEU A;  1PDN C;  2IVM A;  3FF5 A;  3MEX A;  2HYG D;  3HTU A;  1UST A;  3C7J A;  2YU3 A;  2L4M A;  2PI0 A;  3MZH A;  3TKY A;  2KJC A;  1OMI A;  4MQ9 F;  4EJU A;  3E6M A;  2V1U A;  2W57 A;  4AIJ A;  3RPU A;  2VOP A;  1R1V A;  4KIG A;  1LVA A;  2LNB A;  1YYV A;  4R1H A;  1G3W A;  3HYI A;  5FO5 A;  4AWX B;  1UB9 A;  4M74 A;  4NQW A;  1R22 A;  3GUD A;  4HZF A;  4LJZ F;  4R8H A;  2XAJ A;  2QLZ A;  3WE3 A;  2FMY A;  3VB2 A;  5JI6 A;  1STZ A;  5L3F A;  2HDC A;  3ECH A;  2EFN A;  3LST A;  3I0T A;  3CUQ B;  1W7P D;  1EH8 A;  3CO7 C;  3CJN A;  3KZY A;  3QU3 A;  4HX4 A;  4YFN F;  1ONV A;  1MZB A;  3ECO A;  2ESH A;  5D8L B;  3H3U A;  3ZMU A;  1ZGJ A;  2E1C A;  5HS7 A;  3GVA A;  4MGR A;  1H9G A;  2QYO A;  4BHP A;  3D5L A;  3F8N A;  1K79 A;  3LQR A;  4PZJ A;  3FMQ A;  1GVJ A;  3TGN A;  2WWY A;  2VXZ A;  3HTS B;  5LEJ A;  5D5V B;  4A0X A;  3KP4 A;  4E70 A;  2W85 A;  2G9W A;  3WTS C;  1K78 A;  4YFK F;  1KYZ A;  4GXO A;  1G3T A;  2QEN A;  2VBX A;  5A2Q K;  2L02 A;  2CO5 A;  1SD6 A;  3MWM A;  2K02 A;  2XIG A;  3IRR A;  1K7A A;  2M30 A;  4LMY A;  4UUV A;  5F1R A;  1U5T B;  4EGY A;  2DK8 A;  4LLL A;  1ZN2 A;  4AD9 A;  2HTS A;  1SMT A;  2K4J A;  5FD6 A;  2FBH A;  3KE2 A;  5E20 A;  5ERI A;  2ZNZ A;  1J59 A;  1IXS B;  4BHB A;  1UHW A;  3EYI A;  1XMA A;  5ICG A;  1O3T A;  4RB1 A;  3E5U A;  3ZMT A;  1AOY A;  1RIO H;  2YX7 A;  1ULY A;  1ODD A;  3C1D A;  3LA7 A;  2IT0 A;  3TO9 A;  3MZY A;  2HTJ A;  3JSP A;  1FYL A;  1O7L A;  4EM0 B;  4G6D A;  1T0F A;  3MAJ A;  5HLG A;  2LF8 A;  3RPQ A;  3M7G A;  1SD4 A;  2TDX A;  2RQP A;  1TQI A;  1KU3 A;  3BPX A;  4KIF A;  1B1B A;  2M5W A;  3LA2 A;  2XKP A;  2P4W A;  1IN7 A;  1LQ1 A;  2QWW A;  3P9C A;  3JAM K;  3RIR A;  2RGV A;  2O6G E;  3F8B A;  2VBW A;  1DUX C;  3EUH A;  4RGR A;  1G4D A;  1G3S A;  3LWF A;  4XRF A;  1SMY F;  2OD5 A;  2LF7 A;  1ZG5 A;  2FBI A;  2EV0 A;  3QP5 A;  2EFW A;  5K5O A;  1J2X A;  5ILV A;  1RUO A;  5E1W A;  2J5O A;  1Z6R A;  3CUQ A;  1Z6T A;  1J9I A;  5FD5 A;  3W6J B;  5DD4 A;  3DPT A;  1BIB A;  3T1B A;  4ENN A;  1YG2 A;  2ZXJ A;  3F8F A;  4MTE A;  2IA2 A;  3HSR A;  2HEO A;  1MD0 A;  4HX7 A;  4IXA A;  1TW3 A;  1KU2 A;  3ABT A;  1FX7 A;  2Z33 A;  3FXR A;  3J81 K;  4EVI A;  4IRI A;  4BYY A;  1QBJ A;  5LHI A;  1C0W A;  2W84 A;  4DNC A;  4EGZ A;  1SFU A;  1RZ4 A;  1R36 A;  1FY7 A;  1TQM A;  4I02 A;  1XSX A;  3FMR A;  3F22 A;  1YS7 A;  2CG4 A;  2LDU A;  1EV7 A;  5LEK A;  3IWF A;  4U7D A;  3WU1 B;  1J7K A;  3ZP5 A;  2M45 A;  3CTA A;  2KIM A;  1U5T A;  1FYK A;  4Q4Z F;  2DLL A;  2B0L A;  1HKS A;  2ADU A;  4A12 A;  3NEU A;  4WX9 A;  4FX0 A;  2FNA A;  4H0E A;  2PG4 A;  2XAF A;  2VN2 A;  1U78 A;  4HOB A;  1XD7 A;  3RYP A;  1IXR C;  2XKO A;  2WTE A;  1T98 A;  3FHZ A;  3D0S A;  3ELK A;  3KP7 A;  4OIN F;  3KLO A;  5TJJ A;  4O6J A;  4HLY A;  2VBY A;  2D1H A;  4BQA A;  2XVC A;  2CW0 F;  3GF2 A;  2H6C A;  2PN6 A;  4OIR F;  2RNJ A;  2QQ9 A;  3E6B A;  5IT9 Z;  1U2W A;  1FBU A;  1QNT A;  3I4P A;  4L9V A;  3F8M A;  5DUK A;  1MGT A;  1W7P B;  3F21 A;  2FML A;  4EQQ A;  1SAX A;  1SFE A;  3HSF A;  2IJL A;  5HS8 A;  4GGG A;  4GYI A;  2OZ6 A;  1YW9 A;  2IP2 A;  2P5K A;  1BC8 C;  1S7A A;  2MLK A;  2RVC A;  3HRS A;  3RKY A;  1RUN A;  3BRO A;  3N4M A;  1TNT A;  2JZY A;  1EH7 A;  3OV8 A;  2QM3 A;  1IN8 A;  4AIK A;  2AS5 F;  4WK8 F;  2P5V A;  1YFH A;  3M1E A;  5L3C A;  2E1N A;  1H9T A;  4CO8 A;  1Y0U A;  2OAZ A;  3H3Z A;  3WTY C;  1FYM A;  5CVU A;  2G7U A;  2FA5 A;  1BJA A;  2XAH A;  2A68 F;  3MQ0 A;  3TDZ C;  3ZMV A;  1R1T A;  4CXF A;  1GHC A;  1PP8 F;  1IZ1 A;  1B9N A;  1G6N A;  3CO6 C;  4MEY F;  1OYI A;  1S6L A;  4LGW A;  1S3J A;  3ABU A;  3CLO A;  3KP2 A;  2Z3Y A;  4HDU A;  4U0Y A;  3L00 A;  3EQL F;  2DFI A;  2P5L C;  3V8K A;  1GXP A;  3I54 A;  4WCG A;  3HRM A;  3IHU A;  2DI3 A;  2XV4 S;  3WG9 A;  5LHG A;  3F6V A;  3L2C A;  2WV0 A;  2R3S A;  3KP5 A;  1DPU A;  5LRR A;  1U6G A;  4I98 B;  1JHF A;  3E6C C;  2LSO A;  3GZ5 A;  2CSO A;  4RGU A;  2K86 A;  3F6O A;  1ZYR F;  1CGP A;  4L9T A;  2C6Y A;  3SZP A;  2M87 A;  5E18 F;  2OQG A;  4BAY A;  2CGP A;  2PQ8 A;  4KIB A;  5AIQ A;  3QPT A;  4GO1 A;  2FOK A;  2NNN A;  5L3B A;  1SD5 A;  3HOS A;  4A5N A;  3QP6 A;  2M1B A;  2FE3 A;  1KQ8 A;  3PFI A;  5DCF A;  1W7P A;  1B4A A;  1GXQ A;  4HX8 A;  4WXC A;  3FXQ A;  3T8R A;  3GFL A;  4D0P A;  2EA4 A;  4Y15 A;  1G3Y A;  3VOE A;  1J5Y A;  4A6E A;  1OYY A;  3FZV A;  3EDP A;  1E2X A;  1PP7 U;  3I64 A;  1S7O A;  4NB5 A;  2RN7 A;  1KU7 A;  4S05 A;  5CVV A;  2XRO A;  3GEZ A;  3V4G A;  3DKW A;  1XSV A;  3PQK A;  1IF1 A;  2XUB A;  4KN7 X;  2P8T A;  3J80 Z;  2VON A;  1V4R A;  2EA2 A;  4YG2 F;  1TNS A;  5J6X A;  2GQQ A;  5CVR A;  2HS5 A;  1D5V A;  2PMU A;  2DPD A;  5L3E A;  2FRH A;  3V8J A;  1LEB A;  4MHG A;  3RKX A;  2YSR A;  2O3F A;  4I7H A;  2E7X A;  3QPH A;  1XGS A;  3LFK A;  5ILU A;  1FWZ A;  4G8X A;  1WKM A;  5TRD A;  5HS9 A;  1T39 A;  4UVB A;  4HBL A;  5AON A;  4WXH A;  1FT9 A;  2PJP A;  2V6C A;  4HQE A;  5ICE A;  1B6A A;  3ZPL A;  2VBZ A;  2UXN A;  1BI0 A;  3TQN A;  1ZGA A;  3T8T A;  2A61 A;  3I71 A;  4RGS A;  1JGS A;  3HHH A;  3JTH A;  4EJV A;  2GXB A;  1VTN C;  5DEQ A;  4XLN F;  3IRQ A;  5HOO A;  2MH9 A;  1SD7 A;  2XAS A;  1HBX G;  1LEA A;  4B09 A;  2COM A;  1IN6 A;  3I5U A;  4G6Q A;  1I5Z A;  4I0A A;  4G7H F;  2XAG A;  3KEQ A;  5DCM B;  3I53 A;  1LDD A;  1CF7 B;  2GA1 A;  5BPI A;  2GZW A;  1HKT A;  2IPQ X;  1HW5 A;  4QLC U;  4KA4 A;  2RKH A;  2VT3 A;  2PFB A;  3SQN A;  2KIF A;  2CWE A;  1O57 A;  1YQA A;  4LLN A;  1DPR A;  4ZZD A;  2DPU A;  4I0B A;  5IT9 K;  4IHT A;  5FLX Z;  1BI1 A;  3Q9S A;  4P9F A;  3WU0 A;  2EFP A;  2DW4 A;  2OU2 A;  1BIA A;  1FZP B;  1Z7U A;  1WQ2 A;  3DV8 A;  3OOP A;  5F6F A;  1KQ9 A;  4JBA A;  4B8X A;  4HF1 A;  4UVA A;  2HQR A;  2EFQ A;  2ACJ A;  1UFM A;  3C18 A;  2GAU A;  3WOD F;  2HR3 A;  1K6O A;  1LDK B;  4IJA A;  2OA4 A;  4I01 A;  2UXX A;  3SHF A;  3ULQ B;  2STT A;  1FSH A;  4KMF A;  5LGN A;  3ZN0 A;  5ED4 A;  2A5Y B;  1IRF A;  3L7W A;  4L9N A;  4CGZ A;  2DU9 A;  1SFX A;  2KIU A;  2A07 F;  2KJB A;  1I1S A;  3DP7 A;  2X0L A;  1F1Z A;  2ZJ2 A;  1WSU A;  4OOI A;  4HV5 A;  3IWZ A;  2DT5 A;  1P4W A;  2F5F A;  5JVT A;  5DUI A;  1O3S A;  2ESN A;  5CLS A;  1Z91 A;  1MJB A;  5H20 A;  4CHU A;  2HKO A;  5CVJ A;  2JTV A;  5DYM A;  1I6X A;  4A5M A;  2QUF A;  1KYW A;  3REO A;  3O6B B;  3DQV C;  4M73 A;  1KU9 A;  1BN5 A;  4HLX A;  1Z05 A;  3GW2 A;  3SFZ A;  2UZK A;  1FLI A;  3T0Y A;  4LK1 F;  5DCM A;  2V9V A;  2IW5 A;  1CF7 A;  1XCB A;  2HWV A;  1HQC A;  4WXD A;  3K2Z A;  5JR3 A;  3HRU A;  3P7N A;  1IN5 A;  2MH2 A;  3EET A;  2L4A A;  5L3G A;  4G7Z F;  3BP8 A;  2EWN A;  2NAZ A;  5FB2 A;  2FF4 A;  4HW0 A;  1ZH5 A;  1YTY A;  3CUQ C;  2IA0 A;  3GZ6 A;  2GWR A;  1MKM A;  4EJT A;  3I59 B;  1LNW A;  2K27 A;  1HSJ A;  4L18 B;  3H92 A;  5K1Y A;  4L5J A;  3KLN A;  3QOP A;  3EYY A;  2BYV E;  2P7V B;  1R23 A;  1TW2 A;  2QVO A;  3J7A O;  2CFX A;  1YLF A;  4KT5 C;  2ZCW A;  3K1M A;  3F72 A;  2YX4 A;  3LAJ A;  3BPV A;  4FT8 A;  1BI2 A;  2VT2 A;  4WF2 A;  2PLY A;  3W6K B;  2DO7 A;  2DBB A;  5E8G A;  3WTX C;  3DXJ F;  1HKQ A;  2F5C A;  1U5T C;  1E17 A;  3J80 K;  4HDV A;  1REP C;  4I09 A;  3E5X A;  3M8F A;  2ZO4 A;  2FEZ A;  3NQO A;  2Y0M A;  1LDJ A;  3E5Q A;  4BNC A;  4HV6 A;  3DFG A;  4KIC A;  4CYD A;  1TQP A;  2H94 A;  4A2U A;  1TBX A;  1EH6 A;  4OIO F;  2EB7 A;  4IRH A;  3BJO A;  1IUY A;  2P6T A;  2ZNY A;  3GFJ A;  1UHM A;  1XDS A;  5L3D A;  5J8C A;  5D5U B;  2O03 A;  1BBY A;  4IVN A;  1O3R A;  2RDP A;  1BM9 A;  5HDK A;  2A3S A;  2HKX A;  2XHK A;  1YO5 C;  3QAH A;  5D4R A;  3ERE D;  3WTU C;  3WTV C;  3QRF F;  1R5G A;  4RAZ A;  1LB2 A;  4M71 A;  4A0Z A;  2YR2 A;  3KFW X;  4PGH A;  3NRV A;  4RB0 A;  4U0V A;  5HLH A;  2GIV A;  1YIO A;  4OU0 A;  5JFR A;  1T38 A;  4ENM A;  1NHA A;  4RS8 A;  1YW7 A;  1WI9 A;  4KN4 X;  3GFI A;  1QGP A;  3T5X A;  2FBK A;  2FQ3 A;  4RGX A;  2F5D A;  1ZLK A;  1IN4 A;  1D3Y A;  2ZFW A;  4FX4 A;  2JT1 A;  3U2R A;  3U1D A;  2V1D A;  4UV8 A;  2BBY A;  5LLQ A;  4KDP A;  1XDU A;  1BC7 C;  3I59 A;  3ZMD A;  4PGG A;  2W24 A;  5BPD A;  1L3L A;  4JK1 X;  3PQJ A;  2IA1 A;  2L3D A;  4ZYH A;  5FLX K;  2KKO A;  2Z99 A;  2ELH A;  1XB4 A;  4HYE A;  1O7F A;  2PMH A;  2QQA A;  1B9M A;  1HW1 A;  1MDM B;  4LFU A;  4M6Y A;  3IKV A;  4M9Z A;  4P9U A;  5LHH A;  4I2O A;  3R0A A;  4MQV A;  2LKP A;  4ETS A;  1HXD A;  2FNP A;  3S2W A;  4L0Z B;  1J75 A;  3GXO A;  2HFH A;  5D5W B;  5ICC A;  1UCR A;  4Z2Y A;  1T2K A;  4UNO A;  3P9I A;  1BOA A;  3E6D A;  1TTY A;  2ZKZ A;  1QO0 D;  2HYF A;  3HUG A;  1ZRC A;  4Y17 A;  4K2E A;  5KK1 A;  2H27 A;  3K1P A;  4L5I A;  3WGG A;  3B02 A;  2ISY A;  5BQT A;  3U9G A;  2K4B A;  1KGS A;  5K5Q A;  4A0Y A;  3FM3 A;  2GXG A;  1F4K A;  4S04 A;  2QZ8 A;  4ESF A;  2OQR A;  4ENK A;  3JTG A;  4OIP F;  3E97 A;  4BXU A;  1ZG3 A;  4JQF A;  1ZAO A;  2Q0O A;  4P5O A;  1IAW A;  1J0R A;  1D8J A;  4DQ2 A;  2EK5 A;  4RB3 C;  1MJ9 A;  1BI3 A;  1XGO A;  4R79 A;  4U0W A;  1FNN A;  3DPL C;  4ZYE A;  2O0Y A;  2UWM A;  4CZZ A;  3BOQ A;  4MEX F;  4EM2 A;  4HF0 A;  3B73 A;  2W25 A;  5LGT A;  1R58 A;  5CYV A;  3Q5F A;  1X3U A;  3R6S A;  2H09 A;  2IRF G;  2P6S A;  5KVR A;  2L01 A;  4CDG A;  3KEO A;  1DDN A;  1AWC A;  5BMZ A;  3KET A;  6PAX A;  1HW2 A;  3ZQ7 A;  1S8N A;  1KQ0 A;  3V8L A;  4F7Z A;  4KMU X;  4QWQ A;  2QQB A;  4IPA A;  2JPB A;  4EV0 A;  2CYY A;  4LB5 A;  3TOB A;  1XCV A;  4L0Y B;  2BE5 F;  3K1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...