3WTXC

Crystal structure of the complex comprised of ets1(y329a), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
103
structure length
103
Chain Sequence
PIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 35
structure length 103
sequence length 103
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtxC00
1R00A 1LQ1A 3HOSA 1LDJA 1DP7P 3LQQA 1SD7A 4D0PA 5ERIA 3FHZA 3H92A 1KU7A 5D5UB 2YU3A 1U5TB 3R61A 4CO8A 5DD4A 1I5ZA 1Z6TA 3BWGA 3O6BB 3WE2A 4HLXA 4U0YA 3DPTA 5K5OA 4CXFA 1IZ1A 1Q1HA 4CDGA 3EUHA 2DU9A 3E5UA 4I0AA 1U5TC 4DNCA 1J7KA 5K5QA 4WF2A 3HRUA 4HDUA 3JSPA 2HR3A 2DPUA 4KYWA 3FX3A 1I1SA 5BMZA 3RTRA 1XSVA 2HQNA 3F6OA 2PG4A 5FLXZ 2GAUA 3WGIA 3GYHX 1R5HA 4MGRA 2DQLA 2YX4A 5HOOA 2XAGA 2Q0OA 3CTAA 5LGTA 1S3JA 1CF7A 4RAYA 3QOPA 4Y13A 2HFHA 3V8KA 1HKTA 5E17F 4RGSA 4LK0F 1RI7A 1GXQA 3N4MA 1KU2A 5J8CA 4CZZA 4MEXF 5BPIA 1IAWA 2M87A 3IRRA 1TNSA 1XGNA 5A2QK 2MC3A 2CW0F 1FOKA 2HYGD 3E5QA 2F5EA 1H9GA 3JSOA 4LLNA 3R60A 5FD6A 3IL2A 2M5WA 3E6CC 5CYVA 3DXJF 2LSOA 4HF0A 3WU0A 4EV0A 3EETA 4TV7A 1IRFA 3U9GA 5CVIA 2K4JA 2A5YB 5LHIA 4L0YB 5D4SA 3KZYA 2L02A 3G3ZA 1R23A 2HTSA 3T0YA 4L9JA 5LHGA 3FXQA 2XAQA 2COMA 1IW7F 4B09A 2F5DA 1TQIA 2JSCA 4G94A 1YTYA 3WODF 2A61A 2HS5A 2LF7A 1G3WA 5JI6A 5HS7A 2E7XA 2A68F 1BBYA 1WQ2A 4I7HA 2OQRA 5CJ9A 3WTTC 4YFXF 2BEOA 4ENNA 4ENJA 1QBJA 4IPAA 1P92A 2ISYA 1YFHA 1KU3A 2HOEA 5HDGA 1BJAA 1FBUA 4EJWA 1C0WA 4A0ZA 2BE5F 3I53A 4BHBA 3BDDA 3GEZA 1P4XA 3VB2A 4PZJA 1X3UA 4LJZF 4AWXB 1XSXA 4AIKA 3PFIA 2VBYA 4RGXA 2E7WA 3K1MA 3TQNA 4KIBA 3GZ5A 1TW2A 3ECHA 2QM3A 3SXYA 1J0RA 4LFUA 1OMIA 3HTUA 2MD5A 5TJJA 5HVQC 4EGYA 2XAJA 4A12A 4BXUA 2O03A 2ISZA 1IN6A 2ELHA 4EMSA 3I54A 3RKYA 2DPDA 4LD5A 3KLNA 3WTUC 3T8RA 3RYPA 2O6GE 2DO7A 3E97A 4KNYA 3LFKA 2DBBA 5CVVA 3HRTA 3PQJA 1D3YA 2ZNYA 2IA0A 1FP1D 2M45A 3GVAA 2YX7A 4HX4A 1FYKA 2NYXA 3RKXA 3FM5A 3CUQB 2GXBA 5FB2A 3E3VA 4LLLA 3FM3A 4P96A 1XDSA 3OOPA 2HZTA 3F6VA 3C3WA 3FZVA 1FYLA 2OD5A 1IN5A 3ABTA 1J9IA 4L5IA 3KETA 3KP6A 2VC1A 2FEZA 4JBAA 4UV8A 1E2XA 4KN4X 3QP5A 3ELKA 1DPRA 1QO0D 3R4KA 2ZJ2A 1V4RA 4MHGA 1TTYA 1FY7A 1XGMA 3ZN1A 3J7AO 1OYIA 1KQ0A 2FNPA 4EJUA 2K27A 3MEXA 3F72A 1GVJA 4KICA 3RPQA 2Y48A 1USTA 1BI1A 3JAMZ 3ISPA 1STZA 4G6DA 3KZZA 3CUQA 1UFMA 1FZPB 1T38A 1Z6RA 2QZ8A 4KIFA 3LA7A 3TDUC 1J2XA 1QNTA 5CVJA 5DEQA 3VOEA 2O0YA 2XUBA 1NHAA 2V1XA 1HW1A 5E1ZB 2PN6A 4HDVA 3RPUA 1MJBA 4HQMA 4N0BA 4EJVA 3DEUA 1W5TA 5CVRA 3TO7A 2XAHA 3R6SA 5BQTA 4ETSA 3GLXA 2F5CA 2JPBA 2AS5F 4P5OA 2FQ3A 2Q2EA 2ACJA 2PJPA 3TDZC 5LRRA 1JE8A 3WE3A 1W5SA 5F64A 5DDGA 2QYOA 2VE9A 2P5KA 3K1PA 1ZGAA 1O3RA 5D5WB 5L3FA 3QPTA 2P8TA 3WTYC 3KCCA 3C7JA 3DQVC 2GWRA 2FMYA 5DCMB 4ZYEA 2ZFWA 1XGOA 3WTSC 3V8JA 4RGUA 1W7PD 3I5UA 4FHTA 4JK1X 3HYIA 1RZ4A 5L3DA 2VBXA 3ECOA 4LG0A 1GHCA 5H6QA 1LDKB 5BOXA 4Z2YA 4M72A 1SD6A 4CYDA 3GXOA 3CO7C 3ZN0A 3JTGA 1QZYA 4I0BA 1L0OC 5ILUA 2UXNA 5J8FA 2OBPA 3HOTA 4OMZA 1V3FA 4ENKA 4GCVA 1B9NA 1BN5A 3TO9A 1FNNA 3I58A 2IP2A 3DFGA 5FGMA 1K79A 2ZBKA 1JHHA 2CFXA 2XVCA 3RYRA 2VBZA 4WX9A 5IT9Z 4EM2A 5IT3A 3KP4A 1A04A 1G6NA 1MKMA 3RIRA 1HBXG 4LGWA 2CG4A 2MLKA 3BP8A 4BHPA 1K78A 1LJ9A 3HUGA 5TRDA 4I2OA 2VBWA 4IRIA 1G3YA 3GFMA 1PUEE 5E8GA 4Q47A 1D8KA 3WGHA 3FWEA 4IF4A 1XMAA 2KIUA 5ED4A 3L00A 1SMTA 4OU0A 4BNCA 2J5OA 2Z33A 4MQ9F 2P7CB 2QLZA 2A3SA 2EFWA 4WWCA 4H0EA 1XB4A 4A2UA 4YFNF 1AWCA 4HBLA 4LG0B 4LK1F 2FBKA 4O5VA 2Z3YA 3FMQA 4Y15A 2ETHA 2ZMEB 4M6YA 3IHUA 3HIFA 3F3XA 2YPRA 3ZQ7A 4CGZA 4RB3C 4ENMA 3HSRA 1ULYA 4I01A 1F1ZA 4RB1A 2ZKZA 3K2ZA 5J6XA 2GZWA 1MGTA 1YQAA 1HKSA 3FMSA 5HDNA 1SFUA 2ADUA 1IN4A 3L7WA 3P9CA 1EH7A 2Y75A 4OOIA 1Z91A 1S8NA 3V7SA 1ZREA 4WXDA 1H0MA 4ZZLA 4L9NA 3I59A 5FFXA 3P7NA 5D8LB 2IPQX 1U6GA 5E1WA 3ROUA 1U2WA 2BYVE 1IXSB 4BAYA 4U0WA 1ZN2A 4Q5SF 2G7HA 4WXCA 5K5RA 2HEOA 4K2EA 1CGPA 5E1XA 2KRFA 2DFIA 4M74A 2M1BA 3DF8A 3IWZA 4OINF 2Z9OA 1PP7U 2IA1A 2JPCA 2V1DA 4RB2C 4MNUA 2H09A 1IRGA 4HF1A 4ESFA 2XKOA 4EM0B 2LNBA 3ML6A 2RKHA 3LSTA 3FMRA 4P9FA 5K1YA 4U7DA 4A5MA 1F4KA 4LB5A 2RC4A 2R7DA 3ZMVA 4IXAA 3WTWC 2GIVA 4ZYGA 4LMYA 2CQKA 1YLFA 2V6CA 2X4HA 5FD5A 4E70A 1YW8A 3VEPA 4O6JA 3K9TA 1IXRC 2UWMA 2BBYA 3G73A 4Q4ZF 2IT0A 4F7ZA 4OIQF 2XKPA 1UHMA 2QVOA 1FSEA 2XROA 3CLOA 2X0LA 1G4DA 1MZBA 5ICEA 2HKOA 3T8TA 1K6OA 2HYFA 3LAPA 3J81K 1MDMB 2G9WA 3M9AA 1P4WA 2WWYA 1U8RA 1Z9CA 1JHFA 1Z05A 2ZMEA 3HSFA 3EQLF 2Z5UA 1RIOH 4XLNF 3TOAA 3KP7A 3TO6A 3F8MA 3AAFA 3E6BA 3ZPLA 2B0LA 4AVPA 5ICFA 5HDKA 5JHUA 3M1EA 1ZG5A 5AIQA 1FPQA 4PGHA 4R1HA 1J59A 3O2PE 3J80Z 2A6EF 1I1GA 1FLIA 1E17A 5E8IA 1I27A 2FU4A 2MH2A 2A07F 2VN2A 1LEBA 2D1VA 1TNTA 4ZYHA 5D6EA 1J75A 3QRFF 4OMYA 3M7GA 3QPHA 3GFLA 1TBXA 3QP6A 1ZRDA 3E6DA 3ZMTA 2L4MA 1VTNC 4PGGA 2RQPA 2M8EA 4Q48A 1CF7B 2NNYA 5D4RA 2K86A 4IHSA 4G7OF 2M30A 3CJNA 3ABUA 2ZO4A 4HA8A 1ZLJA 4R8HA 1G3SA 1B1BA 1S6LA 3M8EA 3ZMUA 4BQAA 2PFBA 1HSJA 3I64A 1WKMA 3BJAA 2P5VA 3GUDA 2FNAA 2PI0A 4BHCA 2PMHA 4HX8A 2VOOA 3EYIA 3FXRA 2HWVA 3GZ6A 2H6CA 4XBFA 2A69F 4IJAA 5HLIA 5LGNA 2RDPA 4EJOA 1B6AA 4WK8F 2D1HA 2EFNA 2JZYA 2FSWA 1XCBA 1U5TA 1ZG1A 1JGSA 1F5TA 4CHUA 1HQCA 3I59B 4KN7X 2FA5A 4ASNA 1O7LA 4A6EA 1G3TA 2PEXA 1RNLA 1DDNA 3F8NA 3BY6A 2BGCA 3B73A 3J81Z 1LB2A 2H94A 1EH8A 2Y0MA 3JTHA 1XD7A 5JFRA 1PDNC 3JW4A 3R0JA 5LBQA 1R22A 2YR2A 1HXDA 1ZRFA 3SHFA 4A5NA 2XAFA 2AXLA 4EQQA 5DUIA 2IRFG 3MZHA 3KE2A 3D5LA 2ZNZA 3S2WA 4EGZA 3I0TA 1B4AA 5JVTA 3OV8A 2W57A 2FRHA 1FBSA 3QU6A 2NNNA 5KVRA 4YFKF 3DP7A 1FSHA 3FF5A 5D5XB 1UCRA 1O3QA 5E18F 2Q8KA 2VODA 3B02A 1Z7UA 4CICA 5CLSA 6PAXA 2FF4A 1ON2A 1WRJA 2EA4A 2OZ6A 4HYEA 5ILVA 5JR3A 4HQEA 2XGXA 3F8FA 2EV5A 1T2KA 3RKWA 1XGSA 1R58A 2E1NA 3NQOA 3U1DA 2QUFA 1H9TA 5DV5A 3H3ZA 3RDIA 1MJ9A 4IRHA 3WTVC 3FXUA 3ZMDA 3RJPA 2W24A 4EVIA 4IHTA 2D2WA 4MTEA 2IJLA 3GO5A 4M9SA 5F6FA 2PBIA 3N97A 1BC7C 1XDUA 4EM1A 4XLPF 1RUNA 2GQQA 2EFPA 1ZAOA 1BC8C 1LVAA 2QQ9A 4KT5C 5D6FA 2KIMA 2FMLA 3LA3A 1T98A 3LQRA 5H20A 5A2QZ 3REOA 4P9UA 5DD8A 5CVUA 5HLHA 2EV0A 1SFEA 4KUMA 1Z1DA 2K7LA 1SD5A 2KIFA 2NS0A 4UVBA 1MD0A 5FLXK 2VXZA 1WI9A 1BI0A 2VONA 5DUKA 5LLQA 1S29A 2K02A 2OA4A 2JT1A 3V4GA 3MWMA 4QWQA 2IW5A 3ZP5A 2WV0A 5EEGA 3KFWX 3BJOA 1KQ9A 2MA3A 1DPUA 3Q9SA 3SZTA 1KYZA 2FOKA 3HRSA 3K0LA 3TKYA 4BYYA 5L3CA 3F8BA 3VODA 4U7BA 4HV6A 5ILSA 1O7FA 3BJ6A 4HLYA 2G7UA 3KLOA 2STWA 3GFIA 3WTZA 2XRNA 4RGRA 3WGGA 1XMKA 3P9IA 5HS9A 1HW2A 5F1RA 2HQRA 4WXHA 1O57A 2HTJA 4KMFA 3KP2A 1SMYF 1HW5A 2F2EA 4UUVA 3HRMA 1KA8A 1D5VA 1TQMA 5HLGA 1R36A 4GXOA 3NRVA 4I02A 4P55A 2DK8A 1YO5C 2EFOA 2ESHA 5ICCA 3BPXA 4UVCA 4ZH4F 3SFZA 3F23A 2J5PA 5FFZA 1FT9A 2IVMA 1ZGJA 3HTSB 2PLYA 5DYMA 1JXSA 3I4PA 1T0FA 4A0XA 1RUOA 3MQ0A 2E1CA 1SFXA 1IXCA 3F8CA 2P4WA 4EJTA 1D8JA 3I71A 1S7AA 1KU9A 1REPC 1ZARA 4I09A 2EJRA 1ZHFA 1GXPA 2UXXA 1YIOA 2FBIA 2RN7A 4HAMA 1XSDA 4HX7A 1UB9A 2O3FA 2FBHA 3RI4A 5H6RA 3QAHA 1LDDA 3GX4X 3IC7A 4ESJA 4M9XA 1YW7A 1I6XA 3MAJA 2CO5A 2OAZA 2H6BA 2QENA 2HDCA 4G8XA 4PDKA 1U78A 2QBYB 4OIPF 2R3SA 3C18A 4IVNA 2QQBA 1EV7A 4UV9A 1XN7A 3WU1B 1LNWA 3M8FA 3HHGA 2MH9A 4KMUX 1B9MA 4I98B 2DW4A 4ON0A 3Q9VA 4GYGA 4NQWA 3K69A 5FO5A 3MCZA 1IUYA 3SZPA 3BPVA 3MZYA 1ZH5A 2DLLA 2V79A 3IWFA 4RAZA 3CUQC 2LDUA 4UNOA 3EDPA 1R1VA 3GW2A 4RB0A 4MEYF 1EH6A 3GWZA 2EK5A 1L3LA 1YYVA 4UHTA 3KP5A 3GF2A 5KK1A 2DAOA 4FX4A 2MBFA 4G7ZF 1FBQA 1OPCA 1J5YA 5DCMA 1QGPA 3K1NA 2OU2A 1IN8A 5LHHA 2FE3A 2XHKA 3V8LA 2JTVA 2DK5A 1ZRCA 4L9TA 3DPLC 1BM9A 2P7VB 1SD4A 2L3DA 3LWFA 2W25A 2P5LC 1BIAA 1WWXA 1KYWA 3ZMZA 2DT5A 4NB5A 1MDMA 5AIPA 2WC2A 1HSTA 4HV5A 5IT9K 5LEJA 4HW0A 1HKQA 4KDPA 1Y0UA 2CGPA 1R5GA 4MTDA 2QBYA 2NRAC 4FT8A 2O8XA 3Q5FA 2RNJA 4AIJA 1F9NA 2HGCA 3MFKA 4B8XA 1IN7A 1ON1A 3ZMSA 2D45A 4MQVA 2V1UA 2C6YA 1UHWA 2ZCWA 4AIHA 1OKRA 3CUOA 3HHHA 2CSOA 1B59A 2UZKA 1P6RA 3L09A 1ZYRF 2KJCA 1YS7A 1WSUA 2L4AA 1TQPA 2F5FA 1ZG3A 3LA2A 1K78B 1BI2A 4A0YA 3HSEA 1P4AA 1K7AA 4RS8A 4HF2A 4HOBA 4S04A 3WTXC 3F22A 1BIBA 1QZZA 3GFJA 1YG2A 3TGNA 3V7RA 2VE8A 5AONA 2CYYA 3D0SA 3COAC 4PCQA 2GA2A 2K4BA 3E5XA 3IKTA 2V9VA 2W84A 2P6TA 2H27A 4XSZF 2EB7A 3WG9A 4HZFA 2RV8A 4ZYDA 3R0AA 3NEUA 1AOYA 3CO6C 4G7HF 3QU3A 2EFQA 2Z99A 1T6SA 2O61A 1S7OA 1FWZA 2OQGA 2P6SA 4G9YA 3P9KA 1R1UA 3PQKA 2RGVA 2FXAA 3H3UA 3ULQB 2XASA 1MJAA 3L2CA 4ZZDA 3T1BA 2VOPA 2VT2A 3CDHA 2GA1A 4KIGA 3DV8A 3KEOA 4N9IA 2HKXA 2VT3A 4NHJA 1KGSA 2KJBA 1DUXC 4KFCA 5ICGA 5LEKA 4O3MA 4FX0A 2EWNA 1OYYA 3T5XA 2YSRA 3F21A 2MLGA 4ESBA 1USSA 1W7PB 3BROA 2RVCA 4QLCU 3W6JB 4OIOF 2JRTA 3J80K 2LKPA 4N9HA 2IA2A 2NAZA 4S05A 3IKVA 1W4MA 5D5VB 4L9VA 2DI3A 5L3EA 1ODDA 4L5JA 1SAXA 1BOAA 4R79A 3KP3A 2EA2A 3VFZA 3LAJA 1FYMA 4LLGF 4YIFA 1R7JA 5L3GA 2DQRA 4GO1A 2XV4S 4IRGA 2VC0A 1PP8F 3KEQA 4KA4A 4U0VA 2OZUA 2TDXA 4UXNA 5D8KB 5EEHA 1YS6A 2PQ8A 2L01A 4UVAA 1FP2A 1TW3A 3IRQA 1ONVA 4M73A 1ZLKA 5HS8A 4Y17A 5DCFA 3V7CA 4G6QA 2KKOA 3C1DA 2L54A 2A6HF 4JQFA 4WCGA 2CWEA 1FX7A 2W85A 3E6MA 4A6DA 4OIRF 1OYWA 4YG2F 4GYIA 1O3SA 1XCVA 4XRFA 1YW9A 2DTRA 1IF1A 5L3BA 3EYYA 1R1TA 4GGGA 1U3EM 4M6XA 4AD9A 3O3KA 1FC3A 3DKWA 1QPMA 2R7FA 3SQNA 5LGUA 4DQ2A 1BI3A 4L18B 5LRSA 2LF8A 5E20A 2EV6A 4LB6B 2QWWA 4YIIA 1P2FA 2ZXJA 4U88A 3BOQA 3JAMK 3W6KB 4XSXF 1LEAA 2ESNA 1KQ8A 1O3TA 2BV6A 1TLHB 5BPDA 4M9ZA 1T39A 3U2RA 2PMUA 1W7PA 5BS6A 1QQIA 4M71A 2QQAA 3BZ6A 2STTA 1OR7A 3ERED 4L0ZB 3L9FA 2WTEA 2XIGA 4BH9A 2GXGA 3TOBA
chains in the Genus database with same CATH superfamily
1R00A 1LQ1A 3HOSA 1LDJA 2NXNB 2I5UA 2ELJA 1DP7P 3LQQA 1MBKA 1SD7A 2E1MC 4BJ5C 4XLAA 4D0PA 5ERIA 1ETXA 3FHZA 3H92A 2JUCA 2N8GA 3H3VK 1KU7A 4OAYA 5D5UB 2AQFA 2YU3A 2VASA 3DEWA 1U5TB 2HPMA 3R61A 1MSEC 1DQUA 3GTQJ 2RQQA 4BQOA 4CO8A 2HNHA 4XIDA 2KL4A 5DD4A 1I5ZA 2GM4A 1Z6TA 3BWGA 4NC6A 3O6BB 3WE2A 1FIPA 4HLXA 4PJJA 4U87A 4U0YA 3DPTA 5K5OA 3HEFA 4CXFA 1IZ1A 1Q1HA 1WH7A 4RLFA 4CDGA 3EUHA 4IEJA 2DU9A 5FJ8J 1M1EB 3E5UA 3K6GA 4I0AA 4XKVA 1NH3A 3K4NA 3AL0C 3L2RA 1U5TC 4DNCA 1X4OA 4Z6YA 5B1AH 1JUSA 1J7KA 1Y6IA 3ZQGA 5K5QA 1A6IA 3CMYA 2L0KA 4WF2A 3EUAA 2FOWA 3HRUA 4HDUA 3JSPA 2HR3A 2DPUA 4KYWA 2XGEA 5J4YA 2VI6A 3FX3A 3E0JB 2M34A 1X4PA 4BDYA 1I1SA 5KAIC 4M3EA 5BMZA 3QYFA 2HPIA 3RTRA 2HDWA 2M4GA 1XSVA 3BR5A 2HQNA 3F6OA 2PG4A 4B3AA 4BJTA 3VWBA 5IP9J 2LH9A 5FLXZ 3DBHB 2GAUA 3LOCA 3WGIA 3GYHX 4Y3OA 3ZR8X 1R5HA 3BR1A 1UG0A 4NC8A 3HXLA 2DQLA 2YX4A 4MGRA 5HOOA 5FKOA 2XAGA 2Q0OA 4D5CA 3CTAA 5LGTA 1S3JA 2WB1A 3SFIA 2L9NA 3TP3A 4Y52J 1CF7A 4RAYA 2F48A 3QOPA 4Y13A 2MGQA 2HFHA 3H9GA 3V8KA 4F93B 1H89C 3ASOH 1HKTA 5IY5H 2YUSA 4PSWA 5J4VA 3G71I 3WHBA 5E17F 3D1NI 4RGSA 3HB9A 4LK0F 3MN2A 5C44J 1I50J 1MIJA 4FASD 1RI7A 1GXQA 3N4MA 1KU2A 2CH0A 5J8CA 4CZZA 1E3OC 4MEXF 1LPQA 5BPIA 2HXOA 2A6TA 1IAWA 4C2MJ 3FXOA 1ETVA 2M87A 2QA4I 3W2WA 3SJMA 3IRRA 1TNSA 4ANJA 1I39A 1T08B 1XGNA 1X19A 5A2QK 2DOAA 2MC3A 3EPZA 3OYKA 4FQGA 2CW0F 1FOKA 2HYGD 3E5QA 3JRFA 1W0TA 1MW7A 2F5EA 1H9GA 3JSOA 4LLNA 3R60A 5FD6A 4YRVA 1HF0A 4XKWA 3IL2A 4BY1J 2M5WA 3ERMA 3W2AA 3CP8A 3MKLA 3V42A 3E6CC 5CYVA 5E3OA 3DXJF 5FKLA 2DXIA 5J3LA 3UKGA 2LSOA 3OOUA 4HF0A 2EZIA 3WU0A 1VQ7I 4EV0A 3EETA 4IL6C 2CUZA 4TV7A 4A69C 1IRFA 2Y30A 3U9GA 3RSNA 2L7ZA 4XRSA 3TBIA 3HDDA 3K7AJ 5CVIA 2K4JA 2A5YB 2FJ1A 3PSIA 2WY8Q 4ZC3A 3OYLA 5LHIA 5D4SA 4L0YB 3KZYA 2IS2A 2L02A 1N75A 3G3ZA 1N25A 1R23A 4BE2A 2HTSA 2KQRA 3T0YA 2DCEA 2PJRB 4L9JA 5JVGF 2R7RA 5LHGA 3FXQA 2XAQA 3GBGA 1J09A 2COMA 1IW7F 3A0HC 2CQQA 2V1NA 2Y0SA 3KEYA 4IQJA 4B09A 2F5DA 4CYCA 1TQIA 5EJCA 2JSCA 4G94A 1YTYA 3WODF 2A61A 2HS5A 2LF7A 1MBEA 1D0XA 1G3WA 4Y7NJ 3RPUD 5JI6A 4HNTA 5HS7A 2E7XA 2JMWA 3N05A 1QU3A 3LSKA 2A68F 1BBYA 4M3DA 1WQ2A 2W00A 2DODA 2KZGA 4I7HA 4V2GA 2OQRA 5CJ9A 3WTTC 5FRMA 5F0CA 3ZGKA 4YFXF 3FKJA 2BEOA 4ENNA 2JN6A 4ENJA 1QBJA 4IPAA 1SVMA 1P92A 2ISYA 1YFHA 1KU3A 2COBA 2HOEA 5HDGA 2FQ4A 3HOUJ 4J00A 1BJAA 1FBUA 4EJWA 4A3MJ 1Z3YA 1C0WA 1SFKA 4A0ZA 4UY8I 3GTKJ 2BE5F 3I53A 4PJLA 4BHBA 1LVKA 3BDDA 3A02A 1T95A 3GEZA 1MMGA 4XONA 2CFOA 1Y0NA 1P4XA 3VB2A 4PZJA 1DP3A 1HC8A 1X3UA 5C4JJ 1VNDA 3ZQLA 4LJZF 4AWXB 1XSXA 4BQQA 4AIKA 2CRGA 1BOBA 1HDDC 3F9KA 1WJCA 1OCRH 2HZDA 2VBYA 3PFIA 2ZB9A 2DOFA 2Y9ZA 2CV2A 3S1RJ 2DDAA 4RGXA 1PYVA 2E7WA 3K1MA 3TQNA 3K4LA 4KIBA 3GZ5A 1TW2A 3HOVJ 2HOSA 3S1MJ 1RETA 3ECHA 1UAAA 2QM3A 3SXYA 1J0RA 4LFUA 1N78A 1OMIA 2EINH 3HTUA 2MD5A 3LSMA 5TJJA 3G2BA 5HVQC 4EGYA 1TC3C 2XAJA 4A12A 2R7TA 4XLEA 4M6VA 4BXUA 2O03A 3I55I 3HL2A 4JYKA 4LOCA 2ISZA 1IN6A 2R4GA 4YEJA 2JUGA 2ELHA 3BTIA 3A1YA 4EMSA 3I54A 3I3LA 3RKYA 3L2VA 4LD5A 3U21A 2DPDA 3KLNA 2UV1A 3WTUC 3T8RA 4C3HJ 3RYPA 3DU5A 2O6GE 3DKXA 2DO7A 1OCTC 3E97A 4KNYA 1WVRA 2CV0A 3LFKA 2DBBA 5CVVA 3HRTA 3PQJA 1D3YA 3QWLA 1ORKA 1FTTA 5M5XJ 5J47A 2ZNYA 3AKZA 2IA0A 4ZTJA 2CS3A 1FP1D 2Q1ZB 3CCEI 2M45A 3GVAA 4F91B 3S3OA 2JVHA 2YX7A 2K85A 4HX4A 1FYKA 5EZHA 1GV5A 5GPCA 2NYXA 4NQWB 3RKXA 3FM5A 1QVUA 5JLXA 1LKXA 3OYAA 2VKVA 3CUQB 2KDOA 2GXBA 2E19A 5FB2A 3L2UA 3FDYA 2EIJH 3E3VA 5EGOB 4LLLA 3FM3A 4P96A 5J1YA 2CW7A 5J1UA 1UELB 2DA6A 3BQYA 1XDSA 3OOPA 2HZTA 3D5SC 3F6VA 1G2HA 3A01B 5F1JA 3C3WA 4BE0A 3S17J 4LG3A 5E3MA 4A3GJ 3CCVI 2EZKA 3FZVA 1FYLA 2OD5A 1JI8A 1NG6A 1IN5A 4XK4A 1NG7A 3ABTA 1J9IA 3HOWJ 4L5IA 3ZCOA 1NK3P 1U9OA 3KETA 2HDDA 3KP6A 1TWHJ 2VC1A 2FEZA 4BS9A 3OL4A 4JBAA 3BCAA 1B72A 3S16J 2KMUA 1BJZA 4UV8A 1VQKI 1E2XA 1WPKA 2HI3A 3P5JA 4KN4X 3QP5A 2XPVA 3C2HA 3CC2I 2H1LA 3ELKA 1YJ9I 1DPRA 1VQ6I 1QO0D 3R4KA 2ZJ2A 1V4RA 4MHGA 1ETQA 1TTYA 1FY7A 2QKLB 1XGMA 2DT6A 4FCYA 3S1QJ 3ZN1A 3J7AO 1OYIA 1KQ0A 2VJ5A 2FNPA 4EJUA 2F4IA 3CMEI 2K27A 2XF7A 3MEXA 3F72A 3PIOF 1GVJA 4KICA 4DGWB 2XF5A 3RPQA 2Y48A 1I3QJ 1USTA 1BI1A 3JAMZ 2I10A 3ISPA 1STZA 3GTMJ 3CC7I 1FTZA 2QSFX 2R7UA 1WCMJ 1JKPC 4G6DA 2WAFA 2VLAA 1U9NA 2ZSHB 2KIQA 3KZZA 3CUQA 2X9DA 1UFMA 4RM3A 1IUFA 3FIWA 1FZPB 1QHGA 4BUPA 3SZGA 4BEHB 1T38A 3CZ6A 2ZSIB 3M07A 1Z6RA 3DWLE 4ZJZA 1A5JA 5H2FC 2QZ8A 4KIFA 3QYBA 3LA7A 4KJZA 3TDUC 3FHNA 4D7NA 1J2XA 1ITYA 1QNTA 5CVJA 3SDBA 5DEQA 2LMDA 2LBFB 2ME6A 1EKEA 2WADA 2X48A 1ETKA 3VOEA 4EEFG 2O0YA 4HG2A 1T0FC 3GMEA 1MBHA 2H1KA 1JJ8C 2XUBA 1NHAA 3PL8A 2V1XA 3RCOA 1HW1A 5E1ZB 2PN6A 4HDVA 3S2DJ 3RPUA 5EDNA 4D5FA 3A01A 2B7EA 4XORA 1MJBA 4HQMA 4N0BA 2E1OA 3QQAA 4EJVA 2R7SA 3DEUA 2Z2SB 1W5TA 4FE7A 5CVRA 3TO7A 3JRHA 2XAHA 3R6SA 1KONA 5BQTA 4ETSA 5JLWA 4PFOA 3GLXA 2F5CA 2JPBA 5F08A 2AS5F 4P5OA 2FQ3A 2Q2EA 2ACJA 3A2KA 2PJPA 2MFZA 3TDZC 2VKHA 1R5ID 4J01A 5LRRA 1JE8A 1UG2A 5TGTA 1W5SA 3WE3A 3CCMI 5F64A 5DDGA 2QYOA 3PNVA 2VE9A 2P5KA 4HNUA 3I9V2 3K1PA 1ZGAA 1SVLA 4B44A 1X2MA 5D5WB 1O3RA 5L3FA 4RMNA 4DZJA 3QPTA 3Q3SA 2L7FP 2P8TA 4CSWA 1YIJI 3WTYC 3KCCA 3C7JA 3DQVC 5M5WJ 2JA7J 2GWRA 4IX7A 2DN0A 2FMYA 3IH4A 5DCMB 3PNYA 2EZLA 4ZYEA 2ZFWA 3HPHA 1XGOA 2LC2A 2R5YB 3WTSC 3V8JA 3KIOA 2BOLA 4X1EA 2NOJB 4RGUA 1W7PD 2QCOA 3BR3A 3I5UA 1R4MB 4FHTA 4JK1X 9ANTA 3HYIA 2DA3A 2QQ8A 1RZ4A 2IGMA 2R93J 5L3DA 3ZQIA 2VBXA 3ECOA 4LG0A 1JUMA 1GHCA 5H6QA 3ABLH 1LDKB 4IHVA 5EG0B 5BOXA 2E5NA 2F4MB 3CCLI 1MNMC 4Z2YA 4L5EA 3H5RA 2NVXJ 4M72A 1SD6A 2R7VA 4FE4A 2ZC2A 5IP6A 2KISA 4MIMA 3U1KA 4CYDA 3BC8A 1KZHA 3GXOA 3HUGB 3CO7C 1CQTA 1JKQC 5HNHA 3ZN0A 3BT9A 3JTGA 1QZYA 2WB1N 4I0BA 3BG6A 1L0OC 5ILUA 2HQAA 2UXNA 2NVQJ 3MKZA 3S15J 2JK3A 1MSFC 4HNVA 1POGA 1X1BA 4AYBA 5J8FA 2OBPA 3HOTA 4OMZA 1V3FA 3FKIJ 4ENKA 4GCVA 4BEHA 1IO2A 1B9NA 1BN5A 3TO9A 1FNNA 1MNEA 2IP2A 3I58A 1MH4A 3DFGA 2AQEA 5FGMA 1K79A 2ZBKA 3JREA 1JHHA 2CFXA 2XVCA 3RYRA 5FLVA 2KPMA 2B63J 3C2BA 2VBZA 4WX9A 5IT9Z 4EM2A 5IT3A 3KP4A 4LIUA 1A04A 2CQNA 1G6NA 3NARA 4XQFA 1XPXA 2QSGX 1MKMA 5IP7J 1GVDA 3IV5A 2Z16A 2VKDA 4OWRB 3LSIA 5GPAA 3RIRA 1HBXG 3HZJA 4LGWA 1VQOI 2HOTA 2VQCA 2CG4A 2BW3A 2MLKA 4HSRA 3BP8A 1ZQ3P 5CPRB 4A3LJ 3OYJA 2Y2ZA 4BHPA 4I6ZA 1K78A 1LJ9A 4IOCF 5M3MJ 3HUGA 3BG3A 2LBFA 4W1UA 5TRDA 3PO2J 2VJIA 3OYBA 1Z3XA 4I2OA 2VBWA 3K4CA 2EPFA 4IRIA 5JHFA 1SEUA 2JA5J 2A5WA 1GT0C 1G3YA 3GFMA 1PUEE 5E8GA 3EUHC 1T56A 4Q47A 2OCEA 1D8KA 3OR2C 4AIDA 3WGHA 3FWEA 4IF4A 3VSKA 1XMAA 2KIUA 4UB6C 5GP9A 5ED4A 3L00A 5FKMA 3CDLA 1SMTA 1G8XA 4OU0A 4BNCA 2L7MP 2J5OA 3PJRA 4BBSJ 2Z33A 4MQ9F 2P7CB 2QLZA 3BG9A 2BY3A 2A3SA 2NS8A 3K4JA 3GLLA 3NAUA 1WJDA 2EFWA 2V7FA 4WWCA 4H0EA 5K7ZA 1XB4A 2AO9A 2DA5A 3ESWB 3LFUA 1XC5A 2CMPA 4A2UA 2GLOA 4YFNF 1AWCA 1Y39A 4HBLA 4B3XA 4LG0B 1GV2A 4A3CJ 4LK1F 2MSYA 3JRCA 2VPLA 2FBKA 4E4HA 2GIZA 5HNFA 1LFUP 1JKRC 4O5VA 2BW3B 1OR7C 3I4MJ 3LL7A 3TW6A 4E7SA 2Z3YA 3FMQA 4Y15A 2DA7A 4DJAA 2ETHA 1B8IB 2KDZA 2ZMEB 4M6YA 2IBDA 3IHUA 3HIFA 3F3XA 2YPRA 3ZQ7A 3M3YJ 2LREA 2EQRA 4CGZA 4RB3C 4LIVA 3AFHA 4ENMA 3HSRA 1F43A 1ULYA 4I01A 4PJMA 1F1ZA 1V5EA 2E5ZA 1D1AA 3LNQA 2X1CA 2ZKZA 2WV1A 3K2ZA 4RB1A 3JR9A 4E7LA 5J6XA 2BY2A 2GZWA 4A3DJ 1MGTA 1YQAA 1HKSA 3DTEA 3FMSA 5HDNA 2E34A 1BR1A 1SFUA 3MKYB 2ADUA 5EZGA 1R49A 5EG0A 1IN4A 3L7WA 3H5AA 3P9CA 1EH7A 5DTDA 2Y75A 2WAQN 2L9RA 1Z91A 4OOIA 1S8NA 3CD6I 4IOAF 3V7SA 1ZREA 2LY2A 1R9TJ 4WXDA 1H0MA 1VQ5I 4ZZLA 2QGUA 4L9NA 4C9YA 3CCUI 3I59A 3OIQA 2IS6A 5FFXA 2LR8A 3P7NA 2Y0SN 5D8LB 3L2WA 2IPQX 1U6GA 5E1WA 4PJNA 3ROUA 1H8AC 1U2WA 3LSHA 4XMYA 4RAGA 2BYVE 5B66C 3TMOA 1IXSB 4BAYA 2BZTA 4GFBA 1V5GA 2ZJRF 2HOAA 4U0WA 1HLVA 5CKTA 3OYDA 1ZN2A 4Q5SF 3HGYA 3KYDB 4ITVA 1A31A 1T33A 2G7HA 4WXCA 5K5RA 1YITI 1PUFB 2HEOA 2IS4A 1HDPA 4K2EA 1QA6A 3RZDJ 1CGPA 2DA1A 3VYSB 1EJ9A 5E1XA 1JUPA 1ACIA 2KRFA 2DFIA 4JX6A 4M74A 5C3EJ 3IH2A 4A93J 2M1BA 3DF8A 2DTZA 4F52A 1FOXA 2CUEA 1RESA 4BY7J 3IWZA 3UNGC 4OINF 5IOYA 2E2JJ 2Z9OA 2UUZA 1VQPI 4NDLA 1PP7U 2IA1A 2JPCA 2EILH 2V1DA 4RB2C 1MBGA 4MNUA 2H09A 1IRGA 2XAUA 4ESFA 4HF1A 2XKOA 4EM0B 2LNBA 4F3QA 1B72B 3ML6A 2RKHA 3LSTA 3FMRA 3DEEA 4P9FA 2M2EA 1HOMA 5K1YA 3DLLF 4U7DA 2DDBA 1RR8C 3H9JA 2M3AA 4A5MA 3DTIA 1F4KA 2RREA 2RC4A 4LB5A 2R7DA 2QF7A 3VSLA 3ZMVA 4IXAA 3WTWC 2GIVA 3QPLA 1OCZH 2ZFUA 4ZYGA 4LMYA 2CQKA 1WJAA 1PJRA 3OYCA 1YLFA 2V6CA 2X4HA 5FD5A 4E70A 1S72I 3DCFA 1TL8A 1YW8A 3VEPA 3CJQB 4O6JA 2OPTA 3K9TA 1IXRC 4BACA 2UWMA 5J1RA 2BBYA 3RQIA 4HPQA 3OYNA 3G73A 3S2HJ 4Q4ZF 4XLCA 2TRTA 4UUSB 2IT0A 1WJ5A 4F7ZA 2ECCA 2XKPA 4OIQF 1UHMA 2QVOA 1FSEA 1FOYA 2K40A 4XOTA 4F55A 1BW5A 2ZXWH 2V4JC 2XROA 3CLOA 4M3BA 4A3KJ 2K3FA 2X0LA 3IH3A 1G4DA 1MZBA 5ICEA 4CCJA 2HKOA 3T8TA 4QPQA 1K6OA 2HYFA 3LAPA 3J81K 1MDMB 1AKHA 2G9WA 3M9AA 4ZDLA 1P4WA 3OY9A 2M0CA 5HODA 2M8GX 4C2TA 2WWYA 1U8RA 4BGDA 1Z9CA 1JHFA 1Z05A 1IRZA 2LKSA 2ZMEA 3EQLF 3HSFA 2Z5UA 3BTLA 1RIOH 2EIMH 4XLNF 3TOAA 3KP7A 3TO6A 3K2AA 3F8MA 4DYRA 3AAFA 2XF6A 3E6BA 3ZPLA 1LE8B 2B0LA 4AVPA 2HQ5A 4EATA 5ICFA 2I8DA 5HDKA 5JHUA 3SEZA 5CQGA 3M1EA 2D5VA 3CP2A 1ZG5A 5AIQA 1LUJB 1FPQA 4PGHA 4R1HA 4CZCA 1J59A 4DZPA 3O2PE 1WFXA 1V54H 2HYJA 1SANA 3J80Z 2A6EF 1I1GA 1FLIA 1E17A 2LKXA 4KISA 2K9MA 3L2QA 5E8IA 2V6EA 1I27A 2FU4A 3ZRGA 2MH2A 2A07F 2VN2A 1LEBA 2G0EA 2CW8A 5GAGJ 2D1VA 1TWCJ 1TNTA 4Y4RA 4ZYHA 2ME0A 5D6EA 1J75A 3QRFF 5LD2C 2DYSH 1RR7A 4OMYA 3PNTA 3M7GA 3QPHA 3GFLA 1TBXA 4IHXA 3QP6A 1ZRDA 3E6DA 2DFEA 3HG9A 3ZMTA 2EH3A 2L4MA 3PUFA 1VTNC 4PGGA 1X1CA 3A0BC 2RQPA 1Z67A 3LMMA 2M8EA 3FBNB 4Q48A 5E3LA 1CF7B 1VQ9I 2NNYA 5D4RA 2KT0A 2K5CA 2DMQA 2JQ7A 4D1QA 1MBFA 2K86A 3MKWB 2XB0X 4ZYAA 4S0HB 4IHSA 1VQMI 4G7OF 2R7OA 1ETWA 2M30A 3CJNA 3HBLA 3ABUA 1Y8RB 2ZO4A 2FX0A 4HA8A 1ZLJA 2WA0A 2XPWA 3OR1C 4R8HA 1G3SA 3HOYJ 1UHSA 2JA2A 3CMMA 1V55H 5FRNA 1B1BA 1S6LA 3S1NJ 3M8EA 4A3BJ 2X6OA 1HA8A 1DU6A 3ZMUA 2R7XA 4BQAA 2PFBA 1HSJA 3I64A 1WKMA 1D0ZA 3BJAA 3BTJA 2P5VA 2F5VA 2OTLI 3GUDA 2FNAA 2PI0A 1PVEA 1YHQI 4BHCA 3JRDA 3CJTB 2PMHA 3FXJA 4HX8A 3LSPA 2LG4A 3EYIA 3FXRA 2VOOA 2HWVA 2R92J 2VB6A 3GZ6A 2H6CA 4IZZA 4XBFA 3BG5A 2A69F 2W4SA 4IJAA 5HLIA 5LGNA 2RDPA 1A6QA 1RKWA 2QSHX 1TT0A 3G6EI 2LFBA 3QPSA 4EJOA 1H88C 1B6AA 1IRXA 4WK8F 1DGWY 2D1HA 2EFNA 2A05A 1Q1VA 2FSWA 2JZYA 1XCBA 1U5TA 3AG1H 1ZG1A 2KRCA 1JGSA 1F5TA 4CHUA 1HQCA 1E3HA 3I59B 3I56I 2M4KA 4KN7X 2HVRA 3E1SA 4I99C 1MMNA 2FA5A 4ASNA 3CF5F 1O7LA 2XRLA 3J7YJ 2OTJI 4A6EA 3J7AY 3BQZA 1G3TA 2PEXA 1RNLA 5DM7F 2WY7Q 4XOPA 2EIKH 2MABA 4IHWA 1DDNA 3F8NA 3QODA 2DMPA 3BY6A 4QIWN 2BGCA 3B73A 1P7JA 3J81Z 1LB2A 2H94A 1EH8A 2DYRH 2Y0MA 3JTHA 1XD7A 4Y33A 4B48A 5JFRA 1PDNC 3FBIB 2IGNA 3JW4A 4A3FJ 2OC6A 3OIOA 5GAHJ 3L1PA 3R0JA 5LBQA 1R22A 1SVOA 4AVZA 1B8IA 2YR2A 1HXDA 2ID3A 1Z7LA 3AG4H 1ZRFA 3SHFA 2ID6A 1XTAA 2H8WA 2WBMA 1WJEA 4A5NA 2XAFA 2AXLA 2CU7A 4EQQA 5DUIA 4GRIA 2IRFG 3MZHA 3KE2A 3D5LA 1X1AA 3DU6A 1P7IA 1MMSA 3OYFA 4I76A 2MG4A 2ZNZA 3S2WA 2LRDA 2LY9A 4XN0A 4EGZA 3S3NA 3I0TA 1B4AA 1VI0A 1TT5B 5JVTA 3OV8A 2W57A 2FRHA 1FBSA 1MNDA 3QU6A 2NNNA 5KVRA 3B6CA 4YFKF 2JA6J 3DP7A 2IEKA 1RC9A 2X6XA 5E79C 1FSHA 3FF5A 5D5XB 3H1CA 1UCRA 5IPAA 1O3QA 1HCRA 5E18F 2X85A 2YU9J 2Q8KA 2VODA 3B02A 1A35A 1Z7UA 3DBLB 4CICA 3K70D 5CLSA 4E7ZA 3S3MA 1BR4A 6PAXA 3GTGJ 2FF4A 1ON2A 2XSDC 1WRJA 2EA4A 1QHHD 2CQ7A 2K9LA 2OZ6A 4HYEA 3HKZN 2CV1A 5ILVA 5JR3A 1YX5A 1OCPA 4HQEA 1IV6A 2XGXA 3F8FA 1BR2A 2M7BA 1D0YA 2EV5A 1WJBA 5K7HA 2PMZA 1T2KA 3RKWA 4D9JA 1XGSA 4DYQA 4RBOA 4C3JJ 1R58A 4MFDA 4XRMA 2R5ZA 1U0JA 3CC4I 4D7MA 4XKBA 3JRBA 2E1NA 3NQOA 4YIRX 4IKFA 4KITB 3U1DA 2QUFA 1IC8A 3NWTA 1H9TA 5DV5A 3GTLJ 3C2GA 3HOXJ 3H3ZA 3RDIA 1MJ9A 4AC0A 4IRHA 3WTVC 3FXUA 2HVSA 3ZMDA 3K4KA 2O9LA 3RJPA 2W24A 3AL0B 1TP4A 4EVIA 4IHTA 2LK2A 2D2WA 4MTEA 1E3PA 2IJLA 3GO5A 4M9SA 5F6FA 4QTRA 2PBIA 5LFAA 1GDTA 1JT0A 3N97A 1BC7C 1XDUA 4EM1A 4XLPF 1RUNA 2GQQA 2EFPA 1ZAOA 1BA5A 1BC8C 3KX2A 5KCMA 3TL4X 1IDYA 1LVAA 2QQ9A 4KT5C 5D6FA 2KIMA 4FISA 2FMLA 3LA3A 1BW6A 2L5QA 1MMDA 1AU7A 1T98A 3LQRA 5H20A 5A2QZ 3A4CA 2B9SA 2L9SA 3REOA 4P9UA 1OJLA 1FMVA 2LY1A 4RLQA 5GTHC 5DD8A 5CVUA 5HLHA 3VYRB 1ZR4A 2EV0A 1DU0A 3KYLA 1SFEA 4KUMA 2FUG2 3W6VA 5EF6A 4ZDPA 1Z1DA 5M5YJ 3IAM2 2K7LA 1SD5A 2KIFA 4F92B 4CYCB 2NS0A 4UVBA 3OYMA 1MD0A 5FLXK 2VXZA 1WI9A 1BI0A 2VONA 1G59A 2ICWG 5FKKA 5DUKA 2LP0A 3DPUA 5LLQA 1S29A 4E7JA 2K02A 3OYHA 2DFHA 2OA4A 4BL0B 1IDZA 2JT1A 3V4GA 4N4OB 3MWMA 2RNGA 3K10A 4QWQA 3VYUB 2IW5A 5E3NA 1QVTA 1FEXA 4QSHA 3ZP5A 2WV0A 4JP0A 5EEGA 2WAEA 5TISC 3KFWX 4BU2A 3BJOA 2HVQA 1V5FA 1KQ9A 2NS7A 5F27A 2MA3A 3E7LA 3IAS2 2R5YA 1OISA 1DPUA 3Q9SA 3SZTA 2E71A 1KYZA 2FOKA 3HRSA 3K0LA 3TKYA 4BYYA 5L3CA 3F8BA 1JGGA 2GOMA 2P0WA 1VQNI 3VODA 1Y56A 2IGKA 4U7BA 2VXDA 1QPIA 1P9QC 3CCSI 4HV6A 5ILSA 3OMYA 1W36C 2R7WA 2DMUA 1O7FA 3BJ6A 4XR6A 4GDFA 2R7QA 2ZXHA 1K61A 4HLYA 3QYEA 2G7UA 1TZLA 5FLMJ 4E7IA 1WI3A 3KLOA 3CDIA 2STWA 4CCNA 3GFIA 4E7KA 2NOGA 3WTZA 2XRNA 4RGRA 3WGGA 1XMKA 1I6HJ 3P9IA 5B1BH 1JT6A 2P81A 5HS9A 3ONQA 1HW2A 2L2OA 5F1RA 4CCOA 2HQRA 2LTPA 2K9QA 1O57A 3PM1A 4WXHA 2HTJA 1IG7A 2JSPA 4KMFA 3KP2A 4JX5A 2DFFA 2M9HA 2F6CA 5IYCJ 1SMYF 1HW5A 1RKTA 2F2EA 4BKXA 3M1CA 5B5EC 2ZXIA 4UUVA 3HRMA 1KA8A 1D5VA 1TQMA 5HLGA 1OQYA 3S8PA 4HRIA 1R36A 3AG2H 4GXOA 2LOOA 4II2A 3NRVA 3OS1A 3VPRA 2HU9A 4JOMA 3BR6A 4I02A 2V9PA 4P55A 2DK8A 2O5RA 2EFOA 1YO5C 2ESHA 5ICCA 3BPXA 4UVCA 4QPOA 3OS0A 1GLNA 5EGOA 4ZH4F 2LLKA 3SFZA 3F23A 3K70C 5C4XJ 1JTYA 2J5PA 4XLFA 4AUXA 2R5ZB 5FFZA 1FT9A 2IVMA 1ZGWA 1ZGJA 3HTSB 2PLYA 5DYMA 4P1WA 1JXSA 2AXTC 2VQLA 1X1DA 3I4PA 1T0FA 3HOZJ 2TCTA 4A0XA 2XSJC 1RUOA 3MQ0A 2E1CA 4ABZA 1ZK8A 1SFXA 2JVGA 3ZQQA 1IXCA 2V26A 3F8CA 2P4WA 2IXSA 3Q0WA 4EJTA 1D8JA 2W48A 3I71A 2GXAA 4OAZA 1S7AA 3CCQI 1IV8A 1KU9A 1REPC 3JRIA 1ZARA 4I09A 2EJRA 2VQHA 1T8IA 1EA3A 2VJ4A 1ZHFA 4LITA 2OV7A 2BY1A 3EUKL 4PUSA 1GXPA 2UXXA 3HM5A 3IP4B 3AG3H 3GTOJ 3HJEA 3CF2A 3MZ8A 1UZCA 1YIOA 2JRMA 4BBRJ 2FBIA 2RN7A 2BHYA 4HAMA 2QEXI 1XSDA 3CCRI 4HX7A 1UB9A 2O3FA 2FBHA 3RI4A 3OS2A 2Y31A 2Y69H 4CUGA 2VPRA 5H6RA 3QAHA 4CCKA 1LDDA 3GX4X 3IC7A 1UMQA 4ESJA 4M9XA 1YW7A 1X1PA 1I6XA 2XB5A 3O8HA 3HC7A 3X2QH 3MAJA 2CO5A 2MC4A 1QZEA 1W5CC 2OAZA 4HSTA 2H6BA 3M8JA 2QENA 2HDCA 4G8XA 3F0CA 1LFBA 4PDKA 1U78A 2QBYB 2R3SA 4OIPF 1ETYA 3C18A 3H36A 4IVNA 2QQBA 1OCCH 4UB8C 4G12A 1FIAA 1EV7A 4UV9A 1XN7A 2DA2A 4II3A 1LFPA 1LNWA 3WU1B 3M8FA 4C2UA 3HHGA 2MH9A 1O4XA 2VQGA 2M7AA 3RKQA 4KMUX 1B9MA 3PIPF 4I98B 2DW4A 4E6KG 3QOEA 4ON0A 3Q9VA 4GYGA 5GAEJ 2X51A 4NQWA 3OSFA 3K69A 1TWAJ 4NUBA 5FO5A 5DS9A 2KLOA 4BXXJ 3S32A 3H0DA 3S93A 3MCZA 2IAIA 3HKZA 1IUYA 3FXLA 3SZPA 3BPVA 3MZYA 1ZH5A 2DLLA 2V79A 3IWFA 4RAZA 3OYGA 3CUQC 2LDUA 4UNOA 2BXZA 3EDPA 3O8GA 4UUTA 3G1OA 4DYCA 5KHDA 1R4NB 1JJ6C 2VUMJ 1APLC 2R0QC 1R1VA 2PMZN 1X58A 3GW2A 1YI2I 1PUFA 4FTHA 1BL0A 4RB0A 4MEYF 1MMAA 1EH6A 1W1WE 1VQLI 2BXYA 2Q2EB 5IOZA 2V9KA 3GWZA 1AA7A 2EK5A 4CCLA 1L3LA 1YYVA 1WJFA 3OSGA 4UHTA 3KP5A 1U8BA 4XRSG 3GF2A 5KK1A 2DAOA 2YS9A 4FX4A 1OLTA 4PK4A 2MBFA 2DJNA 3WG7H 4IO9F 4E7HA 2XC7A 3CESA 4G7ZF 1FBQA 1OPCA 1J5YA 1YX3A 3B6AA 5DCMA 1QGPA 4A3EJ 3H5NA 1GUUA 5EYRA 4A3JJ 3CLQA 3K1NA 1F36A 2VJJA 2OU2A 1IN8A 5LHHA 1D1BA 2FE3A 2XHKA 3ZQHA 2DMNA 3V8LA 3BCBA 1I3AA 2JTVA 1ZELA 2X6WA 2DJIA 2DK5A 3KZIC 1ZRCA 4L9TA 1ERDA 3DPLC 2CJJA 1BM9A 2P7VB 1SD4A 5K7FA 2L3DA 3LWFA 1Z21A 2W25A 4FETA 2P5LC 3GZNB 1BIAA 3BR0A 1MBJA 3W2VA 1FMWA 1WWXA 2E2HJ 2KP6A 4UUSA 1KYWA 2L9VA 3ZMZA 2DT5A 2Y9YA 4NB5A 1MDMA 1AKHB 5AIPA 4DIQA 2WC2A 1HSTA 2IGOA 2PX9A 2DOEA 2OJED 4HV5A 1N77A 5IT9K 4A3IJ 5LEJA 2W1OA 1HKQA 2X1EA 4HW0A 3VDXA 1Y0UA 4KDPA 2CGPA 2E36A 2E60A 1R5GA 4MTDA 2W82A 3D5RC 4AM3A 3ABKH 5M3FJ 2QBYA 2NRAC 4FT8A 2O8XA 3WHCA 3Q5FA 4NC7A 2RNJA 4AIJA 1F9NA 4V19K 2CUJA 2HGCA 2WAQA 1WHUA 2LVSA 4JX4A 3MFKA 2VL8A 4B8XA 1IN7A 1ON1A 3ZMSA 4NNJA 2QKMB 2D45A 4MQVA 2V1UA 5GTIC 2C6YA 1UHWA 2ZCWA 4AIHA 1OKRA 3CUOA 3HHHA 2ZJQF 1LE8A 3VYTB 3HPGA 2CSOA 1B59A 2UZKA 2X1DA 4CCMA 1P6RA 3L09A 1ZYRF 2KJCA 1YS7A 4G6TB 3J7ZI 1WSUA 4XL9A 1S5LC 2L4AA 1TQPA 3CJRB 2F5FA 3FK7A 3JCUC 2NVTJ 3TP0A 1NK2P 1ZG3A 3LA2A 4DW6A 1K78B 1BI2A 4A0YA 2JJ7A 3HSEA 3H9QA 3NWSA 4BJ6C 1P4AA 3CMAI 3BTCA 1K7AA 4RS8A 3BZKA 3PUBA 4HF2A 1JTXA 4HOBA 5F04A 4S04A 3WTXC 1VZ0A 3F22A 1BIBA 1QZZA 3GFJA 3OWTA 1YG2A 3TGNA 2E35A 3V7RA 4N4NB 2VE8A 5AONA 2LYCA 4W97A 2CYYA 3D0SA 3COAC 1K83J 4PCQA 2GA2A 1IJWC 2K4BA 1YRNB 3G1MA 3E5XA 4RAFA 3IKTA 1RRJA 2IS1A 5CQEA 2CUFA 2V9VA 1SAUA 2W84A 2P6TA 2H27A 3SYTA 3BG7A 4XSZF 1OFCX 1Y1WJ 1DGRM 2EB7A 4CA0A 3WG9A 2XDVA 4HZFA 2RV8A 3SEQA 4ZYDA 2KFDA 3I4NJ 3R0AA 3NEUA 4H4KC 1AOYA 3CO6C 4G7HF 3QU3A 2EFQA 2Z99A 1T6SA 2O61A 4B4CA 1S7OA 4IHYA 1FWZA 3BLYA 2OQGA 3UR3C 2P6SA 3FXMA 4G9YA 1Y8QB 3P9KA 4CH7A 3GTJJ 3PFYA 3LSGA 1R1UA 4NBQA 4YELA 2O8KA 3PQKA 1YOVB 2X6YA 4RA2A 1XS9A 5KNLA 1S7EA 1W0UA 2RGVA 1D5YA 1X3WB 2FXAA 3H3UA 1WZ2A 3MMYB 3ULQB 4MO7A 5HLTA 1VQ8I 4MFEA 3IUOA 2XASA 1MJAA 1YE9A 4MLOA 3L2CA 2MYSA 4ZZDA 3T1BA 2VOPA 3JRGA 2EBIA 2VT2A 3CDHA 3Q0VA 2ZJPF 2GA1A 4KIGA 3DV8A 4KT6A 4AYBN 4RDUA 3G1LA 3KEOA 1ZKGA 3G4SI 4N9IA 2HKXA 2VT3A 4BE1A 3ABMH 2W7NA 4IQ4A 4NHJA 3JRAA 1KGSA 2MW8A 3M4OJ 3K4BA 4PFPA 3SDGA 2KJBA 1DUXC 4XM3A 1QRYA 1X3ZB 4KFCA 3K4MA 4XKCA 5ICGA 1NTCA 3GCMA 5LEKA 4O3MA 4FX0A 1K4TA 3KPHA 2EWNA 3KYCB 4BXFA 5DM6F 3MVPA 4HEA2 3ZOBA 1OYYA 3OIPA 1JKOC 4V2FA 3T5XA 2BVLA 2YSRA 3F21A 1VFCA 1EF4A 2MLGA 4ESBA 1K4SA 1USSA 2BVMA 1W7PB 3BROA 5J40A 2KHMA 2RVCA 2ZMEC 2AHQA 4QLCU 3W6JB 2K9SA 3ZQCA 5B3SH 4M3FA 4OIOF 2VIXA 2JRTA 5IYBJ 3DKYA 3J80K 2LKPA 3DLAA 4N9HA 2IA2A 1R71A 2NAZA 3CQZJ 1ZTRA 3DBRB 4S05A 3LSRA 2K3PA 2L7KA 2XGCA 1XMXA 4ZDOA 3IKVA 2OUMA 1W4MA 4BQNA 5D5VB 4L9VA 2DI3A 5L3EA 1ODDA 2H8RA 4C3IJ 3OL3A 4RM2A 3PSFA 3BR2A 4L5JA 1SAXA 2OF7A 4DOZA 1YJNI 1BOAA 4R79A 3KP3A 2EA2A 1SFOJ 3VFZA 2XPUA 3LAJA 1FYMA 1YJWI 4LLGF 4YIFA 1R7JA 2GOXB 4XLHA 3ZQFA 5L3GA 3BZCA 2DQRA 4GO1A 1ETOA 5GADJ 3S14J 1IGNA 5IYDJ 2XGDA 2XV4S 4IRGA 2VC0A 4DBRA 3GTPJ 1MH3A 1PP8F 2NVUB 3Q0UA 3KEQA 4KA4A 2O7OA 4U0VA 4B1RA 2OZUA 4PSXA 5FKNA 1A36A 2TDXA 2KZVA 2FD5A 4UXNA 5D8KB 5EEHA 1YS6A 2PQ8A 5FROA 2L01A 4UVAA 2ELKA 1FP2A 1TW3A 4ZTFA 3LSJA 3FXKA 3IRQA 2NVYJ 1ONVA 4J19A 4M73A 1FJLA 4AU7A 1ZLKA 4BDZA 5HS8A 1SC7A 1WH5A 5BNGA 4Y17A 1RPWA 3FISA 3CCJI 3H0GJ 2EZHA 5DCFA 3V7CA 4G6QA 2F4OB 2KKOA 1XG1A 3C1DA 2L54A 1YRNA 2A6HF 4JQFA 4WCGA 2PJRA 1Z0XA 2CWEA 3W3CA 1FX7A 2W85A 2DA4A 3HGGA 3E6MA 4A6DA 4OIRF 1TWGJ 2LD5A 1OYWA 4YG2F 4GYIA 5EEAA 1O3SA 1XCVA 4XRFA 4XNFA 2ECBA 4DBQA 1YW9A 2DTRA 1Y1VJ 1IF1A 2JA8J 5L3BA 3EYYA 1R1TA 4GGGA 1U3EM 4M6XA 4AD9A 3O3KA 1FC3A 4M3GA 3TEDA 3ZXSA 1Z77A 3DKWA 3OYEA 1QPMA 2R7FA 4XN3A 3MD2A 3SQNA 2E2IJ 1X2NA 5LGUA 1WGXA 2BY0A 3A03A 1BI3A 4DQ2A 2DT7B 4X0GA 4L18B 2JWTA 4PJ0C 2OCCH 3WU2C 1FOWA 3TW7A 5F0HA 5LRSA 1AHDP 1E0EA 1TWFJ 2LF8A 5E20A 2EV6A 4LB6B 2E1MB 2QWWA 2K9NA 4YIIA 1P2FA 2ZXJA 3DTKA 1UJ8A 3PO3J 2RAEA 2DMTA 2R7ZJ 4U88A 3BOQA 3JAMK 2GBYA 1K6YA 3W6KB 2HXIA 1VF9A 4XSXF 1LEAA 2ESNA 2M0MA 1XX5A 1KQ8A 1ENHA 3FK6A 4B47A 1O3TA 3OYIA 4X6AJ 2BV6A 5KAFC 4C30A 1OCOH 1TLHB 5BPDA 4M9ZA 2VKEA 3CCYA 2MD0A 1ZR2A 1T39A 4XICA 2CQXA 3U2RA 2PMUA 3ASNH 3RQ4A 1W36D 2KRHA 2BHZA 4B43A 1W7PA 5BS6A 1QQIA 4M71A 2QQAA 1VQ4I 3H35A 3BZ6A 2STTA 1OR7A 3ERED 4L0ZB 1S9HA 2WTEA 3L9FA 3RZOJ 2XIGA 1D1CA 4BH9A 5F0FA 2GXGA 3TOBA 1R6RA 2Z1DA
chains in the Genus database with same CATH topology
1R00A 1LQ1A 3HOSA 1LDJA 1DP7P 3LQQA 1SD7A 4D0PA 5ERIA 3FHZA 3H92A 1KU7A 5D5UB 2YU3A 1U5TB 3R61A 4CO8A 5DD4A 1I5ZA 1Z6TA 3BWGA 3O6BB 3WE2A 4HLXA 4U0YA 3DPTA 5K5OA 4CXFA 1IZ1A 1Q1HA 4CDGA 3EUHA 2DU9A 3E5UA 4I0AA 1U5TC 4DNCA 1J7KA 5K5QA 4WF2A 3HRUA 4HDUA 3JSPA 2HR3A 2DPUA 4KYWA 3FX3A 1I1SA 5BMZA 3RTRA 1XSVA 2HQNA 3F6OA 2PG4A 5FLXZ 2GAUA 3WGIA 3GYHX 1R5HA 4MGRA 2DQLA 2YX4A 5HOOA 2XAGA 2Q0OA 3CTAA 5LGTA 1S3JA 1CF7A 4RAYA 3QOPA 4Y13A 2HFHA 3V8KA 1HKTA 5E17F 4RGSA 4LK0F 1RI7A 1GXQA 3N4MA 1KU2A 5J8CA 4CZZA 4MEXF 5BPIA 1IAWA 2M87A 3IRRA 1TNSA 1XGNA 5A2QK 2MC3A 2CW0F 1FOKA 2HYGD 3E5QA 2F5EA 1H9GA 3JSOA 4LLNA 3R60A 5FD6A 3IL2A 2M5WA 3E6CC 5CYVA 3DXJF 2LSOA 4HF0A 3WU0A 4EV0A 3EETA 4TV7A 1IRFA 3U9GA 5CVIA 2K4JA 2A5YB 5LHIA 4L0YB 5D4SA 3KZYA 2L02A 3G3ZA 1R23A 2HTSA 3T0YA 4L9JA 5LHGA 3FXQA 2XAQA 2COMA 1IW7F 4B09A 2F5DA 1TQIA 2JSCA 4G94A 1YTYA 3WODF 2A61A 2HS5A 2LF7A 1G3WA 5JI6A 5HS7A 2E7XA 2A68F 1BBYA 1WQ2A 4I7HA 2OQRA 5CJ9A 3WTTC 4YFXF 2BEOA 4ENNA 4ENJA 1QBJA 4IPAA 1P92A 2ISYA 1YFHA 1KU3A 2HOEA 5HDGA 1BJAA 1FBUA 4EJWA 1C0WA 4A0ZA 2BE5F 3I53A 4BHBA 3BDDA 3GEZA 1P4XA 3VB2A 4PZJA 1X3UA 4LJZF 4AWXB 1XSXA 4AIKA 3PFIA 2VBYA 4RGXA 2E7WA 3K1MA 3TQNA 4KIBA 3GZ5A 1TW2A 3ECHA 2QM3A 3SXYA 1J0RA 4LFUA 1OMIA 3HTUA 2MD5A 5TJJA 5HVQC 4EGYA 2XAJA 4A12A 4BXUA 2O03A 2ISZA 1IN6A 2ELHA 4EMSA 3I54A 3RKYA 2DPDA 4LD5A 3KLNA 3WTUC 3T8RA 3RYPA 2O6GE 2DO7A 3E97A 4KNYA 3LFKA 2DBBA 5CVVA 3HRTA 3PQJA 1D3YA 2ZNYA 2IA0A 1FP1D 2M45A 3GVAA 2YX7A 4HX4A 1FYKA 2NYXA 3RKXA 3FM5A 3CUQB 2GXBA 5FB2A 3E3VA 4LLLA 3FM3A 4P96A 1XDSA 3OOPA 2HZTA 3F6VA 3C3WA 3FZVA 1FYLA 2OD5A 1IN5A 3ABTA 1J9IA 4L5IA 3KETA 3KP6A 2VC1A 2FEZA 4JBAA 4UV8A 1E2XA 4KN4X 3QP5A 3ELKA 1DPRA 1QO0D 3R4KA 2ZJ2A 1V4RA 4MHGA 1TTYA 1FY7A 1XGMA 3ZN1A 3J7AO 1OYIA 1KQ0A 2FNPA 4EJUA 2K27A 3MEXA 3F72A 1GVJA 4KICA 3RPQA 2Y48A 1USTA 1BI1A 3JAMZ 3ISPA 1STZA 4G6DA 3KZZA 3CUQA 1UFMA 1FZPB 1T38A 1Z6RA 2QZ8A 4KIFA 3LA7A 3TDUC 1J2XA 1QNTA 5CVJA 5DEQA 3VOEA 2O0YA 2XUBA 1NHAA 2V1XA 1HW1A 5E1ZB 2PN6A 4HDVA 3RPUA 1MJBA 4HQMA 4N0BA 4EJVA 3DEUA 1W5TA 5CVRA 3TO7A 2XAHA 3R6SA 5BQTA 4ETSA 3GLXA 2F5CA 2JPBA 2AS5F 4P5OA 2FQ3A 2Q2EA 2ACJA 2PJPA 3TDZC 5LRRA 1JE8A 3WE3A 1W5SA 5F64A 5DDGA 2QYOA 2VE9A 2P5KA 3K1PA 1ZGAA 1O3RA 5D5WB 5L3FA 3QPTA 2P8TA 3WTYC 3KCCA 3C7JA 3DQVC 2GWRA 2FMYA 5DCMB 4ZYEA 2ZFWA 1XGOA 3WTSC 3V8JA 4RGUA 1W7PD 3I5UA 4FHTA 4JK1X 3HYIA 1RZ4A 5L3DA 2VBXA 3ECOA 4LG0A 1GHCA 5H6QA 1LDKB 5BOXA 4Z2YA 4M72A 1SD6A 4CYDA 3GXOA 3CO7C 3ZN0A 3JTGA 1QZYA 4I0BA 1L0OC 5ILUA 2UXNA 5J8FA 2OBPA 3HOTA 4OMZA 1V3FA 4ENKA 4GCVA 1B9NA 1BN5A 3TO9A 1FNNA 3I58A 2IP2A 3DFGA 5FGMA 1K79A 2ZBKA 1JHHA 2CFXA 2XVCA 3RYRA 2VBZA 4WX9A 5IT9Z 4EM2A 5IT3A 3KP4A 1A04A 1G6NA 1MKMA 3RIRA 1HBXG 4LGWA 2CG4A 2MLKA 3BP8A 4BHPA 1K78A 1LJ9A 3HUGA 5TRDA 4I2OA 2VBWA 4IRIA 1G3YA 3GFMA 1PUEE 5E8GA 4Q47A 1D8KA 3WGHA 3FWEA 4IF4A 1XMAA 2KIUA 5ED4A 3L00A 1SMTA 4OU0A 4BNCA 2J5OA 2Z33A 4MQ9F 2P7CB 2QLZA 2A3SA 2EFWA 4WWCA 4H0EA 1XB4A 4A2UA 4YFNF 1AWCA 4HBLA 4LG0B 4LK1F 2FBKA 4O5VA 2Z3YA 3FMQA 4Y15A 2ETHA 2ZMEB 4M6YA 3IHUA 3HIFA 3F3XA 2YPRA 3ZQ7A 4CGZA 4RB3C 4ENMA 3HSRA 1ULYA 4I01A 1F1ZA 4RB1A 2ZKZA 3K2ZA 5J6XA 2GZWA 1MGTA 1YQAA 1HKSA 3FMSA 5HDNA 1SFUA 2ADUA 1IN4A 3L7WA 3P9CA 1EH7A 2Y75A 4OOIA 1Z91A 1S8NA 3V7SA 1ZREA 4WXDA 1H0MA 4ZZLA 4L9NA 3I59A 5FFXA 3P7NA 5D8LB 2IPQX 1U6GA 5E1WA 3ROUA 1U2WA 2BYVE 1IXSB 4BAYA 4U0WA 1ZN2A 4Q5SF 2G7HA 4WXCA 5K5RA 2HEOA 4K2EA 1CGPA 5E1XA 2KRFA 2DFIA 4M74A 2M1BA 3DF8A 3IWZA 4OINF 2Z9OA 1PP7U 2IA1A 2JPCA 2V1DA 4RB2C 4MNUA 2H09A 1IRGA 4HF1A 4ESFA 2XKOA 4EM0B 2LNBA 3ML6A 2RKHA 3LSTA 3FMRA 4P9FA 5K1YA 4U7DA 4A5MA 1F4KA 4LB5A 2RC4A 2R7DA 3ZMVA 4IXAA 3WTWC 2GIVA 4ZYGA 4LMYA 2CQKA 1YLFA 2V6CA 2X4HA 5FD5A 4E70A 1YW8A 3VEPA 4O6JA 3K9TA 1IXRC 2UWMA 2BBYA 3G73A 4Q4ZF 2IT0A 4F7ZA 4OIQF 2XKPA 1UHMA 2QVOA 1FSEA 2XROA 3CLOA 2X0LA 1G4DA 1MZBA 5ICEA 2HKOA 3T8TA 1K6OA 2HYFA 3LAPA 3J81K 1MDMB 2G9WA 3M9AA 1P4WA 2WWYA 1U8RA 1Z9CA 1JHFA 1Z05A 2ZMEA 3HSFA 3EQLF 2Z5UA 1RIOH 4XLNF 3TOAA 3KP7A 3TO6A 3F8MA 3AAFA 3E6BA 3ZPLA 2B0LA 4AVPA 5ICFA 5HDKA 5JHUA 3M1EA 1ZG5A 5AIQA 1FPQA 4PGHA 4R1HA 1J59A 3O2PE 3J80Z 2A6EF 1I1GA 1FLIA 1E17A 5E8IA 1I27A 2FU4A 2MH2A 2A07F 2VN2A 1LEBA 2D1VA 1TNTA 4ZYHA 5D6EA 1J75A 3QRFF 4OMYA 3M7GA 3QPHA 3GFLA 1TBXA 3QP6A 1ZRDA 3E6DA 3ZMTA 2L4MA 1VTNC 4PGGA 2RQPA 2M8EA 4Q48A 1CF7B 2NNYA 5D4RA 2K86A 4IHSA 4G7OF 2M30A 3CJNA 3ABUA 2ZO4A 4HA8A 1ZLJA 4R8HA 1G3SA 1B1BA 1S6LA 3M8EA 3ZMUA 4BQAA 2PFBA 1HSJA 3I64A 1WKMA 3BJAA 2P5VA 3GUDA 2FNAA 2PI0A 4BHCA 2PMHA 4HX8A 2VOOA 3EYIA 3FXRA 2HWVA 3GZ6A 2H6CA 4XBFA 2A69F 4IJAA 5HLIA 5LGNA 2RDPA 4EJOA 1B6AA 4WK8F 2D1HA 2EFNA 2JZYA 2FSWA 1XCBA 1U5TA 1ZG1A 1JGSA 1F5TA 4CHUA 1HQCA 3I59B 4KN7X 2FA5A 4ASNA 1O7LA 4A6EA 1G3TA 2PEXA 1RNLA 1DDNA 3F8NA 3BY6A 2BGCA 3B73A 3J81Z 1LB2A 2H94A 1EH8A 2Y0MA 3JTHA 1XD7A 5JFRA 1PDNC 3JW4A 3R0JA 5LBQA 1R22A 2YR2A 1HXDA 1ZRFA 3SHFA 4A5NA 2XAFA 2AXLA 4EQQA 5DUIA 2IRFG 3MZHA 3KE2A 3D5LA 2ZNZA 3S2WA 4EGZA 3I0TA 1B4AA 5JVTA 3OV8A 2W57A 2FRHA 1FBSA 3QU6A 2NNNA 5KVRA 4YFKF 3DP7A 1FSHA 3FF5A 5D5XB 1UCRA 1O3QA 5E18F 2Q8KA 2VODA 3B02A 1Z7UA 4CICA 5CLSA 6PAXA 2FF4A 1ON2A 1WRJA 2EA4A 2OZ6A 4HYEA 5ILVA 5JR3A 4HQEA 2XGXA 3F8FA 2EV5A 1T2KA 3RKWA 1XGSA 1R58A 2E1NA 3NQOA 3U1DA 2QUFA 1H9TA 5DV5A 3H3ZA 3RDIA 1MJ9A 4IRHA 3WTVC 3FXUA 3ZMDA 3RJPA 2W24A 4EVIA 4IHTA 2D2WA 4MTEA 2IJLA 3GO5A 4M9SA 5F6FA 2PBIA 3N97A 1BC7C 1XDUA 4EM1A 4XLPF 1RUNA 2GQQA 2EFPA 1ZAOA 1BC8C 1LVAA 2QQ9A 4KT5C 5D6FA 2KIMA 2FMLA 3LA3A 1T98A 3LQRA 5H20A 5A2QZ 3REOA 4P9UA 5DD8A 5CVUA 5HLHA 2EV0A 1SFEA 4KUMA 1Z1DA 2K7LA 1SD5A 2KIFA 2NS0A 4UVBA 1MD0A 5FLXK 2VXZA 1WI9A 1BI0A 2VONA 5DUKA 5LLQA 1S29A 2K02A 2OA4A 2JT1A 3V4GA 3MWMA 4QWQA 2IW5A 3ZP5A 2WV0A 5EEGA 3KFWX 3BJOA 1KQ9A 2MA3A 1DPUA 3Q9SA 3SZTA 1KYZA 2FOKA 3HRSA 3K0LA 3TKYA 4BYYA 5L3CA 3F8BA 3VODA 4U7BA 4HV6A 5ILSA 1O7FA 3BJ6A 4HLYA 2G7UA 3KLOA 2STWA 3GFIA 3WTZA 2XRNA 4RGRA 3WGGA 1XMKA 3P9IA 5HS9A 1HW2A 5F1RA 2HQRA 4WXHA 1O57A 2HTJA 4KMFA 3KP2A 1SMYF 1HW5A 2F2EA 4UUVA 3HRMA 1KA8A 1D5VA 1TQMA 5HLGA 1R36A 4GXOA 3NRVA 4I02A 4P55A 2DK8A 1YO5C 2EFOA 2ESHA 5ICCA 3BPXA 4UVCA 4ZH4F 3SFZA 3F23A 2J5PA 5FFZA 1FT9A 2IVMA 1ZGJA 3HTSB 2PLYA 5DYMA 1JXSA 3I4PA 1T0FA 4A0XA 1RUOA 3MQ0A 2E1CA 1SFXA 1IXCA 3F8CA 2P4WA 4EJTA 1D8JA 3I71A 1S7AA 1KU9A 1REPC 1ZARA 4I09A 2EJRA 1ZHFA 1GXPA 2UXXA 1YIOA 2FBIA 2RN7A 4HAMA 1XSDA 4HX7A 1UB9A 2O3FA 2FBHA 3RI4A 5H6RA 3QAHA 1LDDA 3GX4X 3IC7A 4ESJA 4M9XA 1YW7A 1I6XA 3MAJA 2CO5A 2OAZA 2H6BA 2QENA 2HDCA 4G8XA 4PDKA 1U78A 2QBYB 4OIPF 2R3SA 3C18A 4IVNA 2QQBA 1EV7A 4UV9A 1XN7A 3WU1B 1LNWA 3M8FA 3HHGA 2MH9A 4KMUX 1B9MA 4I98B 2DW4A 4ON0A 3Q9VA 4GYGA 4NQWA 3K69A 5FO5A 3MCZA 1IUYA 3SZPA 3BPVA 3MZYA 1ZH5A 2DLLA 2V79A 3IWFA 4RAZA 3CUQC 2LDUA 4UNOA 3EDPA 1R1VA 3GW2A 4RB0A 4MEYF 1EH6A 3GWZA 2EK5A 1L3LA 1YYVA 4UHTA 3KP5A 3GF2A 5KK1A 2DAOA 4FX4A 2MBFA 4G7ZF 1FBQA 1OPCA 1J5YA 5DCMA 1QGPA 3K1NA 2OU2A 1IN8A 5LHHA 2FE3A 2XHKA 3V8LA 2JTVA 2DK5A 1ZRCA 4L9TA 3DPLC 1BM9A 2P7VB 1SD4A 2L3DA 3LWFA 2W25A 2P5LC 1BIAA 1WWXA 1KYWA 3ZMZA 2DT5A 4NB5A 1MDMA 5AIPA 2WC2A 1HSTA 4HV5A 5IT9K 5LEJA 4HW0A 1HKQA 4KDPA 1Y0UA 2CGPA 1R5GA 4MTDA 2QBYA 2NRAC 4FT8A 2O8XA 3Q5FA 2RNJA 4AIJA 1F9NA 2HGCA 3MFKA 4B8XA 1IN7A 1ON1A 3ZMSA 2D45A 4MQVA 2V1UA 2C6YA 1UHWA 2ZCWA 4AIHA 1OKRA 3CUOA 3HHHA 2CSOA 1B59A 2UZKA 1P6RA 3L09A 1ZYRF 2KJCA 1YS7A 1WSUA 2L4AA 1TQPA 2F5FA 1ZG3A 3LA2A 1K78B 1BI2A 4A0YA 3HSEA 1P4AA 1K7AA 4RS8A 4HF2A 4HOBA 4S04A 3WTXC 3F22A 1BIBA 1QZZA 3GFJA 1YG2A 3TGNA 3V7RA 2VE8A 5AONA 2CYYA 3D0SA 3COAC 4PCQA 2GA2A 2K4BA 3E5XA 3IKTA 2V9VA 2W84A 2P6TA 2H27A 4XSZF 2EB7A 3WG9A 4HZFA 2RV8A 4ZYDA 3R0AA 3NEUA 1AOYA 3CO6C 4G7HF 3QU3A 2EFQA 2Z99A 1T6SA 2O61A 1S7OA 1FWZA 2OQGA 2P6SA 4G9YA 3P9KA 1R1UA 3PQKA 2RGVA 2FXAA 3H3UA 3ULQB 2XASA 1MJAA 3L2CA 4ZZDA 3T1BA 2VOPA 2VT2A 3CDHA 2GA1A 4KIGA 3DV8A 3KEOA 4N9IA 2HKXA 2VT3A 4NHJA 1KGSA 2KJBA 1DUXC 4KFCA 5ICGA 5LEKA 4O3MA 4FX0A 2EWNA 1OYYA 3T5XA 2YSRA 3F21A 2MLGA 4ESBA 1USSA 1W7PB 3BROA 2RVCA 4QLCU 3W6JB 4OIOF 2JRTA 3J80K 2LKPA 4N9HA 2IA2A 2NAZA 4S05A 3IKVA 1W4MA 5D5VB 4L9VA 2DI3A 5L3EA 1ODDA 4L5JA 1SAXA 1BOAA 4R79A 3KP3A 2EA2A 3VFZA 3LAJA 1FYMA 4LLGF 4YIFA 1R7JA 5L3GA 2DQRA 4GO1A 2XV4S 4IRGA 2VC0A 1PP8F 3KEQA 4KA4A 4U0VA 2OZUA 2TDXA 4UXNA 5D8KB 5EEHA 1YS6A 2PQ8A 2L01A 4UVAA 1FP2A 1TW3A 3IRQA 1ONVA 4M73A 1ZLKA 5HS8A 4Y17A 5DCFA 3V7CA 4G6QA 2KKOA 3C1DA 2L54A 2A6HF 4JQFA 4WCGA 2CWEA 1FX7A 2W85A 3E6MA 4A6DA 4OIRF 1OYWA 4YG2F 4GYIA 1O3SA 1XCVA 4XRFA 1YW9A 2DTRA 1IF1A 5L3BA 3EYYA 1R1TA 4GGGA 1U3EM 4M6XA 4AD9A 3O3KA 1FC3A 3DKWA 1QPMA 2R7FA 3SQNA 5LGUA 4DQ2A 1BI3A 4L18B 5LRSA 2LF8A 5E20A 2EV6A 4LB6B 2QWWA 4YIIA 1P2FA 2ZXJA 4U88A 3BOQA 3JAMK 3W6KB 4XSXF 1LEAA 2ESNA 1KQ8A 1O3TA 2BV6A 1TLHB 5BPDA 4M9ZA 1T39A 3U2RA 2PMUA 1W7PA 5BS6A 1QQIA 4M71A 2QQAA 3BZ6A 2STTA 1OR7A 3ERED 4L0ZB 3L9FA 2WTEA 2XIGA 4BH9A 2GXGA 3TOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R00 A;  1LQ1 A;  3HOS A;  1LDJ A;  1DP7 P;  3LQQ A;  1SD7 A;  4D0P A;  5ERI A;  3FHZ A;  3H92 A;  1KU7 A;  5D5U B;  2YU3 A;  1U5T B;  3R61 A;  4CO8 A;  5DD4 A;  1I5Z A;  1Z6T A;  3BWG A;  3O6B B;  3WE2 A;  4HLX A;  4U0Y A;  3DPT A;  5K5O A;  4CXF A;  1IZ1 A;  1Q1H A;  4CDG A;  3EUH A;  2DU9 A;  3E5U A;  4I0A A;  1U5T C;  4DNC A;  1J7K A;  5K5Q A;  4WF2 A;  3HRU A;  4HDU A;  3JSP A;  2HR3 A;  2DPU A;  4KYW A;  3FX3 A;  1I1S A;  5BMZ A;  3RTR A;  1XSV A;  2HQN A;  3F6O A;  2PG4 A;  5FLX Z;  2GAU A;  3WGI A;  3GYH X;  1R5H A;  4MGR A;  2DQL A;  2YX4 A;  5HOO A;  2XAG A;  2Q0O A;  3CTA A;  5LGT A;  1S3J A;  1CF7 A;  4RAY A;  3QOP A;  4Y13 A;  2HFH A;  3V8K A;  1HKT A;  5E17 F;  4RGS A;  4LK0 F;  1RI7 A;  1GXQ A;  3N4M A;  1KU2 A;  5J8C A;  4CZZ A;  4MEX F;  5BPI A;  1IAW A;  2M87 A;  3IRR A;  1TNS A;  1XGN A;  5A2Q K;  2MC3 A;  2CW0 F;  1FOK A;  2HYG D;  3E5Q A;  2F5E A;  1H9G A;  3JSO A;  4LLN A;  3R60 A;  5FD6 A;  3IL2 A;  2M5W A;  3E6C C;  5CYV A;  3DXJ F;  2LSO A;  4HF0 A;  3WU0 A;  4EV0 A;  3EET A;  4TV7 A;  1IRF A;  3U9G A;  5CVI A;  2K4J A;  2A5Y B;  5LHI A;  4L0Y B;  5D4S A;  3KZY A;  2L02 A;  3G3Z A;  1R23 A;  2HTS A;  3T0Y A;  4L9J A;  5LHG A;  3FXQ A;  2XAQ A;  2COM A;  1IW7 F;  4B09 A;  2F5D A;  1TQI A;  2JSC A;  4G94 A;  1YTY A;  3WOD F;  2A61 A;  2HS5 A;  2LF7 A;  1G3W A;  5JI6 A;  5HS7 A;  2E7X A;  2A68 F;  1BBY A;  1WQ2 A;  4I7H A;  2OQR A;  5CJ9 A;  3WTT C;  4YFX F;  2BEO A;  4ENN A;  4ENJ A;  1QBJ A;  4IPA A;  1P92 A;  2ISY A;  1YFH A;  1KU3 A;  2HOE A;  5HDG A;  1BJA A;  1FBU A;  4EJW A;  1C0W A;  4A0Z A;  2BE5 F;  3I53 A;  4BHB A;  3BDD A;  3GEZ A;  1P4X A;  3VB2 A;  4PZJ A;  1X3U A;  4LJZ F;  4AWX B;  1XSX A;  4AIK A;  3PFI A;  2VBY A;  4RGX A;  2E7W A;  3K1M A;  3TQN A;  4KIB A;  3GZ5 A;  1TW2 A;  3ECH A;  2QM3 A;  3SXY A;  1J0R A;  4LFU A;  1OMI A;  3HTU A;  2MD5 A;  5TJJ A;  5HVQ C;  4EGY A;  2XAJ A;  4A12 A;  4BXU A;  2O03 A;  2ISZ A;  1IN6 A;  2ELH A;  4EMS A;  3I54 A;  3RKY A;  2DPD A;  4LD5 A;  3KLN A;  3WTU C;  3T8R A;  3RYP A;  2O6G E;  2DO7 A;  3E97 A;  4KNY A;  3LFK A;  2DBB A;  5CVV A;  3HRT A;  3PQJ A;  1D3Y A;  2ZNY A;  2IA0 A;  1FP1 D;  2M45 A;  3GVA A;  2YX7 A;  4HX4 A;  1FYK A;  2NYX A;  3RKX A;  3FM5 A;  3CUQ B;  2GXB A;  5FB2 A;  3E3V A;  4LLL A;  3FM3 A;  4P96 A;  1XDS A;  3OOP A;  2HZT A;  3F6V A;  3C3W A;  3FZV A;  1FYL A;  2OD5 A;  1IN5 A;  3ABT A;  1J9I A;  4L5I A;  3KET A;  3KP6 A;  2VC1 A;  2FEZ A;  4JBA A;  4UV8 A;  1E2X A;  4KN4 X;  3QP5 A;  3ELK A;  1DPR A;  1QO0 D;  3R4K A;  2ZJ2 A;  1V4R A;  4MHG A;  1TTY A;  1FY7 A;  1XGM A;  3ZN1 A;  3J7A O;  1OYI A;  1KQ0 A;  2FNP A;  4EJU A;  2K27 A;  3MEX A;  3F72 A;  1GVJ A;  4KIC A;  3RPQ A;  2Y48 A;  1UST A;  1BI1 A;  3JAM Z;  3ISP A;  1STZ A;  4G6D A;  3KZZ A;  3CUQ A;  1UFM A;  1FZP B;  1T38 A;  1Z6R A;  2QZ8 A;  4KIF A;  3LA7 A;  3TDU C;  1J2X A;  1QNT A;  5CVJ A;  5DEQ A;  3VOE A;  2O0Y A;  2XUB A;  1NHA A;  2V1X A;  1HW1 A;  5E1Z B;  2PN6 A;  4HDV A;  3RPU A;  1MJB A;  4HQM A;  4N0B A;  4EJV A;  3DEU A;  1W5T A;  5CVR A;  3TO7 A;  2XAH A;  3R6S A;  5BQT A;  4ETS A;  3GLX A;  2F5C A;  2JPB A;  2AS5 F;  4P5O A;  2FQ3 A;  2Q2E A;  2ACJ A;  2PJP A;  3TDZ C;  5LRR A;  1JE8 A;  3WE3 A;  1W5S A;  5F64 A;  5DDG A;  2QYO A;  2VE9 A;  2P5K A;  3K1P A;  1ZGA A;  1O3R A;  5D5W B;  5L3F A;  3QPT A;  2P8T A;  3WTY C;  3KCC A;  3C7J A;  3DQV C;  2GWR A;  2FMY A;  5DCM B;  4ZYE A;  2ZFW A;  1XGO A;  3WTS C;  3V8J A;  4RGU A;  1W7P D;  3I5U A;  4FHT A;  4JK1 X;  3HYI A;  1RZ4 A;  5L3D A;  2VBX A;  3ECO A;  4LG0 A;  1GHC A;  5H6Q A;  1LDK B;  5BOX A;  4Z2Y A;  4M72 A;  1SD6 A;  4CYD A;  3GXO A;  3CO7 C;  3ZN0 A;  3JTG A;  1QZY A;  4I0B A;  1L0O C;  5ILU A;  2UXN A;  5J8F A;  2OBP A;  3HOT A;  4OMZ A;  1V3F A;  4ENK A;  4GCV A;  1B9N A;  1BN5 A;  3TO9 A;  1FNN A;  3I58 A;  2IP2 A;  3DFG A;  5FGM A;  1K79 A;  2ZBK A;  1JHH A;  2CFX A;  2XVC A;  3RYR A;  2VBZ A;  4WX9 A;  5IT9 Z;  4EM2 A;  5IT3 A;  3KP4 A;  1A04 A;  1G6N A;  1MKM A;  3RIR A;  1HBX G;  4LGW A;  2CG4 A;  2MLK A;  3BP8 A;  4BHP A;  1K78 A;  1LJ9 A;  3HUG A;  5TRD A;  4I2O A;  2VBW A;  4IRI A;  1G3Y A;  3GFM A;  1PUE E;  5E8G A;  4Q47 A;  1D8K A;  3WGH A;  3FWE A;  4IF4 A;  1XMA A;  2KIU A;  5ED4 A;  3L00 A;  1SMT A;  4OU0 A;  4BNC A;  2J5O A;  2Z33 A;  4MQ9 F;  2P7C B;  2QLZ A;  2A3S A;  2EFW A;  4WWC A;  4H0E A;  1XB4 A;  4A2U A;  4YFN F;  1AWC A;  4HBL A;  4LG0 B;  4LK1 F;  2FBK A;  4O5V A;  2Z3Y A;  3FMQ A;  4Y15 A;  2ETH A;  2ZME B;  4M6Y A;  3IHU A;  3HIF A;  3F3X A;  2YPR A;  3ZQ7 A;  4CGZ A;  4RB3 C;  4ENM A;  3HSR A;  1ULY A;  4I01 A;  1F1Z A;  4RB1 A;  2ZKZ A;  3K2Z A;  5J6X A;  2GZW A;  1MGT A;  1YQA A;  1HKS A;  3FMS A;  5HDN A;  1SFU A;  2ADU A;  1IN4 A;  3L7W A;  3P9C A;  1EH7 A;  2Y75 A;  4OOI A;  1Z91 A;  1S8N A;  3V7S A;  1ZRE A;  4WXD A;  1H0M A;  4ZZL A;  4L9N A;  3I59 A;  5FFX A;  3P7N A;  5D8L B;  2IPQ X;  1U6G A;  5E1W A;  3ROU A;  1U2W A;  2BYV E;  1IXS B;  4BAY A;  4U0W A;  1ZN2 A;  4Q5S F;  2G7H A;  4WXC A;  5K5R A;  2HEO A;  4K2E A;  1CGP A;  5E1X A;  2KRF A;  2DFI A;  4M74 A;  2M1B A;  3DF8 A;  3IWZ A;  4OIN F;  2Z9O A;  1PP7 U;  2IA1 A;  2JPC A;  2V1D A;  4RB2 C;  4MNU A;  2H09 A;  1IRG A;  4HF1 A;  4ESF A;  2XKO A;  4EM0 B;  2LNB A;  3ML6 A;  2RKH A;  3LST A;  3FMR A;  4P9F A;  5K1Y A;  4U7D A;  4A5M A;  1F4K A;  4LB5 A;  2RC4 A;  2R7D A;  3ZMV A;  4IXA A;  3WTW C;  2GIV A;  4ZYG A;  4LMY A;  2CQK A;  1YLF A;  2V6C A;  2X4H A;  5FD5 A;  4E70 A;  1YW8 A;  3VEP A;  4O6J A;  3K9T A;  1IXR C;  2UWM A;  2BBY A;  3G73 A;  4Q4Z F;  2IT0 A;  4F7Z A;  4OIQ F;  2XKP A;  1UHM A;  2QVO A;  1FSE A;  2XRO A;  3CLO A;  2X0L A;  1G4D A;  1MZB A;  5ICE A;  2HKO A;  3T8T A;  1K6O A;  2HYF A;  3LAP A;  3J81 K;  1MDM B;  2G9W A;  3M9A A;  1P4W A;  2WWY A;  1U8R A;  1Z9C A;  1JHF A;  1Z05 A;  2ZME A;  3HSF A;  3EQL F;  2Z5U A;  1RIO H;  4XLN F;  3TOA A;  3KP7 A;  3TO6 A;  3F8M A;  3AAF A;  3E6B A;  3ZPL A;  2B0L A;  4AVP A;  5ICF A;  5HDK A;  5JHU A;  3M1E A;  1ZG5 A;  5AIQ A;  1FPQ A;  4PGH A;  4R1H A;  1J59 A;  3O2P E;  3J80 Z;  2A6E F;  1I1G A;  1FLI A;  1E17 A;  5E8I A;  1I27 A;  2FU4 A;  2MH2 A;  2A07 F;  2VN2 A;  1LEB A;  2D1V A;  1TNT A;  4ZYH A;  5D6E A;  1J75 A;  3QRF F;  4OMY A;  3M7G A;  3QPH A;  3GFL A;  1TBX A;  3QP6 A;  1ZRD A;  3E6D A;  3ZMT A;  2L4M A;  1VTN C;  4PGG A;  2RQP A;  2M8E A;  4Q48 A;  1CF7 B;  2NNY A;  5D4R A;  2K86 A;  4IHS A;  4G7O F;  2M30 A;  3CJN A;  3ABU A;  2ZO4 A;  4HA8 A;  1ZLJ A;  4R8H A;  1G3S A;  1B1B A;  1S6L A;  3M8E A;  3ZMU A;  4BQA A;  2PFB A;  1HSJ A;  3I64 A;  1WKM A;  3BJA A;  2P5V A;  3GUD A;  2FNA A;  2PI0 A;  4BHC A;  2PMH A;  4HX8 A;  2VOO A;  3EYI A;  3FXR A;  2HWV A;  3GZ6 A;  2H6C A;  4XBF A;  2A69 F;  4IJA A;  5HLI A;  5LGN A;  2RDP A;  4EJO A;  1B6A A;  4WK8 F;  2D1H A;  2EFN A;  2JZY A;  2FSW A;  1XCB A;  1U5T A;  1ZG1 A;  1JGS A;  1F5T A;  4CHU A;  1HQC A;  3I59 B;  4KN7 X;  2FA5 A;  4ASN A;  1O7L A;  4A6E A;  1G3T A;  2PEX A;  1RNL A;  1DDN A;  3F8N A;  3BY6 A;  2BGC A;  3B73 A;  3J81 Z;  1LB2 A;  2H94 A;  1EH8 A;  2Y0M A;  3JTH A;  1XD7 A;  5JFR A;  1PDN C;  3JW4 A;  3R0J A;  5LBQ A;  1R22 A;  2YR2 A;  1HXD A;  1ZRF A;  3SHF A;  4A5N A;  2XAF A;  2AXL A;  4EQQ A;  5DUI A;  2IRF G;  3MZH A;  3KE2 A;  3D5L A;  2ZNZ A;  3S2W A;  4EGZ A;  3I0T A;  1B4A A;  5JVT A;  3OV8 A;  2W57 A;  2FRH A;  1FBS A;  3QU6 A;  2NNN A;  5KVR A;  4YFK F;  3DP7 A;  1FSH A;  3FF5 A;  5D5X B;  1UCR A;  1O3Q A;  5E18 F;  2Q8K A;  2VOD A;  3B02 A;  1Z7U A;  4CIC A;  5CLS A;  6PAX A;  2FF4 A;  1ON2 A;  1WRJ A;  2EA4 A;  2OZ6 A;  4HYE A;  5ILV A;  5JR3 A;  4HQE A;  2XGX A;  3F8F A;  2EV5 A;  1T2K A;  3RKW A;  1XGS A;  1R58 A;  2E1N A;  3NQO A;  3U1D A;  2QUF A;  1H9T A;  5DV5 A;  3H3Z A;  3RDI A;  1MJ9 A;  4IRH A;  3WTV C;  3FXU A;  3ZMD A;  3RJP A;  2W24 A;  4EVI A;  4IHT A;  2D2W A;  4MTE A;  2IJL A;  3GO5 A;  4M9S A;  5F6F A;  2PBI A;  3N97 A;  1BC7 C;  1XDU A;  4EM1 A;  4XLP F;  1RUN A;  2GQQ A;  2EFP A;  1ZAO A;  1BC8 C;  1LVA A;  2QQ9 A;  4KT5 C;  5D6F A;  2KIM A;  2FML A;  3LA3 A;  1T98 A;  3LQR A;  5H20 A;  5A2Q Z;  3REO A;  4P9U A;  5DD8 A;  5CVU A;  5HLH A;  2EV0 A;  1SFE A;  4KUM A;  1Z1D A;  2K7L A;  1SD5 A;  2KIF A;  2NS0 A;  4UVB A;  1MD0 A;  5FLX K;  2VXZ A;  1WI9 A;  1BI0 A;  2VON A;  5DUK A;  5LLQ A;  1S29 A;  2K02 A;  2OA4 A;  2JT1 A;  3V4G A;  3MWM A;  4QWQ A;  2IW5 A;  3ZP5 A;  2WV0 A;  5EEG A;  3KFW X;  3BJO A;  1KQ9 A;  2MA3 A;  1DPU A;  3Q9S A;  3SZT A;  1KYZ A;  2FOK A;  3HRS A;  3K0L A;  3TKY A;  4BYY A;  5L3C A;  3F8B A;  3VOD A;  4U7B A;  4HV6 A;  5ILS A;  1O7F A;  3BJ6 A;  4HLY A;  2G7U A;  3KLO A;  2STW A;  3GFI A;  3WTZ A;  2XRN A;  4RGR A;  3WGG A;  1XMK A;  3P9I A;  5HS9 A;  1HW2 A;  5F1R A;  2HQR A;  4WXH A;  1O57 A;  2HTJ A;  4KMF A;  3KP2 A;  1SMY F;  1HW5 A;  2F2E A;  4UUV A;  3HRM A;  1KA8 A;  1D5V A;  1TQM A;  5HLG A;  1R36 A;  4GXO A;  3NRV A;  4I02 A;  4P55 A;  2DK8 A;  1YO5 C;  2EFO A;  2ESH A;  5ICC A;  3BPX A;  4UVC A;  4ZH4 F;  3SFZ A;  3F23 A;  2J5P A;  5FFZ A;  1FT9 A;  2IVM A;  1ZGJ A;  3HTS B;  2PLY A;  5DYM A;  1JXS A;  3I4P A;  1T0F A;  4A0X A;  1RUO A;  3MQ0 A;  2E1C A;  1SFX A;  1IXC A;  3F8C A;  2P4W A;  4EJT A;  1D8J A;  3I71 A;  1S7A A;  1KU9 A;  1REP C;  1ZAR A;  4I09 A;  2EJR A;  1ZHF A;  1GXP A;  2UXX A;  1YIO A;  2FBI A;  2RN7 A;  4HAM A;  1XSD A;  4HX7 A;  1UB9 A;  2O3F A;  2FBH A;  3RI4 A;  5H6R A;  3QAH A;  1LDD A;  3GX4 X;  3IC7 A;  4ESJ A;  4M9X A;  1YW7 A;  1I6X A;  3MAJ A;  2CO5 A;  2OAZ A;  2H6B A;  2QEN A;  2HDC A;  4G8X A;  4PDK A;  1U78 A;  2QBY B;  4OIP F;  2R3S A;  3C18 A;  4IVN A;  2QQB A;  1EV7 A;  4UV9 A;  1XN7 A;  3WU1 B;  1LNW A;  3M8F A;  3HHG A;  2MH9 A;  4KMU X;  1B9M A;  4I98 B;  2DW4 A;  4ON0 A;  3Q9V A;  4GYG A;  4NQW A;  3K69 A;  5FO5 A;  3MCZ A;  1IUY A;  3SZP A;  3BPV A;  3MZY A;  1ZH5 A;  2DLL A;  2V79 A;  3IWF A;  4RAZ A;  3CUQ C;  2LDU A;  4UNO A;  3EDP A;  1R1V A;  3GW2 A;  4RB0 A;  4MEY F;  1EH6 A;  3GWZ A;  2EK5 A;  1L3L A;  1YYV A;  4UHT A;  3KP5 A;  3GF2 A;  5KK1 A;  2DAO A;  4FX4 A;  2MBF A;  4G7Z F;  1FBQ A;  1OPC A;  1J5Y A;  5DCM A;  1QGP A;  3K1N A;  2OU2 A;  1IN8 A;  5LHH A;  2FE3 A;  2XHK A;  3V8L A;  2JTV A;  2DK5 A;  1ZRC A;  4L9T A;  3DPL C;  1BM9 A;  2P7V B;  1SD4 A;  2L3D A;  3LWF A;  2W25 A;  2P5L C;  1BIA A;  1WWX A;  1KYW A;  3ZMZ A;  2DT5 A;  4NB5 A;  1MDM A;  5AIP A;  2WC2 A;  1HST A;  4HV5 A;  5IT9 K;  5LEJ A;  4HW0 A;  1HKQ A;  4KDP A;  1Y0U A;  2CGP A;  1R5G A;  4MTD A;  2QBY A;  2NRA C;  4FT8 A;  2O8X A;  3Q5F A;  2RNJ A;  4AIJ A;  1F9N A;  2HGC A;  3MFK A;  4B8X A;  1IN7 A;  1ON1 A;  3ZMS A;  2D45 A;  4MQV A;  2V1U A;  2C6Y A;  1UHW A;  2ZCW A;  4AIH A;  1OKR A;  3CUO A;  3HHH A;  2CSO A;  1B59 A;  2UZK A;  1P6R A;  3L09 A;  1ZYR F;  2KJC A;  1YS7 A;  1WSU A;  2L4A A;  1TQP A;  2F5F A;  1ZG3 A;  3LA2 A;  1K78 B;  1BI2 A;  4A0Y A;  3HSE A;  1P4A A;  1K7A A;  4RS8 A;  4HF2 A;  4HOB A;  4S04 A;  3WTX C;  3F22 A;  1BIB A;  1QZZ A;  3GFJ A;  1YG2 A;  3TGN A;  3V7R A;  2VE8 A;  5AON A;  2CYY A;  3D0S A;  3COA C;  4PCQ A;  2GA2 A;  2K4B A;  3E5X A;  3IKT A;  2V9V A;  2W84 A;  2P6T A;  2H27 A;  4XSZ F;  2EB7 A;  3WG9 A;  4HZF A;  2RV8 A;  4ZYD A;  3R0A A;  3NEU A;  1AOY A;  3CO6 C;  4G7H F;  3QU3 A;  2EFQ A;  2Z99 A;  1T6S A;  2O61 A;  1S7O A;  1FWZ A;  2OQG A;  2P6S A;  4G9Y A;  3P9K A;  1R1U A;  3PQK A;  2RGV A;  2FXA A;  3H3U A;  3ULQ B;  2XAS A;  1MJA A;  3L2C A;  4ZZD A;  3T1B A;  2VOP A;  2VT2 A;  3CDH A;  2GA1 A;  4KIG A;  3DV8 A;  3KEO A;  4N9I A;  2HKX A;  2VT3 A;  4NHJ A;  1KGS A;  2KJB A;  1DUX C;  4KFC A;  5ICG A;  5LEK A;  4O3M A;  4FX0 A;  2EWN A;  1OYY A;  3T5X A;  2YSR A;  3F21 A;  2MLG A;  4ESB A;  1USS A;  1W7P B;  3BRO A;  2RVC A;  4QLC U;  3W6J B;  4OIO F;  2JRT A;  3J80 K;  2LKP A;  4N9H A;  2IA2 A;  2NAZ A;  4S05 A;  3IKV A;  1W4M A;  5D5V B;  4L9V A;  2DI3 A;  5L3E A;  1ODD A;  4L5J A;  1SAX A;  1BOA A;  4R79 A;  3KP3 A;  2EA2 A;  3VFZ A;  3LAJ A;  1FYM A;  4LLG F;  4YIF A;  1R7J A;  5L3G A;  2DQR A;  4GO1 A;  2XV4 S;  4IRG A;  2VC0 A;  1PP8 F;  3KEQ A;  4KA4 A;  4U0V A;  2OZU A;  2TDX A;  4UXN A;  5D8K B;  5EEH A;  1YS6 A;  2PQ8 A;  2L01 A;  4UVA A;  1FP2 A;  1TW3 A;  3IRQ A;  1ONV A;  4M73 A;  1ZLK A;  5HS8 A;  4Y17 A;  5DCF A;  3V7C A;  4G6Q A;  2KKO A;  3C1D A;  2L54 A;  2A6H F;  4JQF A;  4WCG A;  2CWE A;  1FX7 A;  2W85 A;  3E6M A;  4A6D A;  4OIR F;  1OYW A;  4YG2 F;  4GYI A;  1O3S A;  1XCV A;  4XRF A;  1YW9 A;  2DTR A;  1IF1 A;  5L3B A;  3EYY A;  1R1T A;  4GGG A;  1U3E M;  4M6X A;  4AD9 A;  3O3K A;  1FC3 A;  3DKW A;  1QPM A;  2R7F A;  3SQN A;  5LGU A;  4DQ2 A;  1BI3 A;  4L18 B;  5LRS A;  2LF8 A;  5E20 A;  2EV6 A;  4LB6 B;  2QWW A;  4YII A;  1P2F A;  2ZXJ A;  4U88 A;  3BOQ A;  3JAM K;  3W6K B;  4XSX F;  1LEA A;  2ESN A;  1KQ8 A;  1O3T A;  2BV6 A;  1TLH B;  5BPD A;  4M9Z A;  1T39 A;  3U2R A;  2PMU A;  1W7P A;  5BS6 A;  1QQI A;  4M71 A;  2QQA A;  3BZ6 A;  2STT A;  1OR7 A;  3ERE D;  4L0Z B;  3L9F A;  2WTE A;  2XIG A;  4BH9 A;  2GXG A;  3TOB A; 
#chains in the Genus database with same CATH topology
 1R00 A;  1LQ1 A;  3HOS A;  1LDJ A;  2NXN B;  2I5U A;  2ELJ A;  1DP7 P;  3LQQ A;  1MBK A;  1SD7 A;  2E1M C;  4BJ5 C;  4XLA A;  4D0P A;  5ERI A;  1ETX A;  3FHZ A;  3H92 A;  2JUC A;  2N8G A;  3H3V K;  1KU7 A;  4OAY A;  5D5U B;  2AQF A;  2YU3 A;  2VAS A;  3DEW A;  1U5T B;  2HPM A;  3R61 A;  1MSE C;  1DQU A;  3GTQ J;  2RQQ A;  4BQO A;  4CO8 A;  2HNH A;  4XID A;  2KL4 A;  5DD4 A;  1I5Z A;  2GM4 A;  1Z6T A;  3BWG A;  4NC6 A;  3O6B B;  3WE2 A;  1FIP A;  4HLX A;  4PJJ A;  4U87 A;  4U0Y A;  3DPT A;  5K5O A;  3HEF A;  4CXF A;  1IZ1 A;  1Q1H A;  1WH7 A;  4RLF A;  4CDG A;  3EUH A;  4IEJ A;  2DU9 A;  5FJ8 J;  1M1E B;  3E5U A;  3K6G A;  4I0A A;  4XKV A;  1NH3 A;  3K4N A;  3AL0 C;  3L2R A;  1U5T C;  4DNC A;  1X4O A;  4Z6Y A;  5B1A H;  1JUS A;  1J7K A;  1Y6I A;  3ZQG A;  5K5Q A;  1A6I A;  3CMY A;  2L0K A;  4WF2 A;  3EUA A;  2FOW A;  3HRU A;  4HDU A;  3JSP A;  2HR3 A;  2DPU A;  4KYW A;  2XGE A;  5J4Y A;  2VI6 A;  3FX3 A;  3E0J B;  2M34 A;  1X4P A;  4BDY A;  1I1S A;  5KAI C;  4M3E A;  5BMZ A;  3QYF A;  2HPI A;  3RTR A;  2HDW A;  2M4G A;  1XSV A;  3BR5 A;  2HQN A;  3F6O A;  2PG4 A;  4B3A A;  4BJT A;  3VWB A;  5IP9 J;  2LH9 A;  5FLX Z;  3DBH B;  2GAU A;  3LOC A;  3WGI A;  3GYH X;  4Y3O A;  3ZR8 X;  1R5H A;  3BR1 A;  1UG0 A;  4NC8 A;  3HXL A;  2DQL A;  2YX4 A;  4MGR A;  5HOO A;  5FKO A;  2XAG A;  2Q0O A;  4D5C A;  3CTA A;  5LGT A;  1S3J A;  2WB1 A;  3SFI A;  2L9N A;  3TP3 A;  4Y52 J;  1CF7 A;  4RAY A;  2F48 A;  3QOP A;  4Y13 A;  2MGQ A;  2HFH A;  3H9G A;  3V8K A;  4F93 B;  1H89 C;  3ASO H;  1HKT A;  5IY5 H;  2YUS A;  4PSW A;  5J4V A;  3G71 I;  3WHB A;  5E17 F;  3D1N I;  4RGS A;  3HB9 A;  4LK0 F;  3MN2 A;  5C44 J;  1I50 J;  1MIJ A;  4FAS D;  1RI7 A;  1GXQ A;  3N4M A;  1KU2 A;  2CH0 A;  5J8C A;  4CZZ A;  1E3O C;  4MEX F;  1LPQ A;  5BPI A;  2HXO A;  2A6T A;  1IAW A;  4C2M J;  3FXO A;  1ETV A;  2M87 A;  2QA4 I;  3W2W A;  3SJM A;  3IRR A;  1TNS A;  4ANJ A;  1I39 A;  1T08 B;  1XGN A;  1X19 A;  5A2Q K;  2DOA A;  2MC3 A;  3EPZ A;  3OYK A;  4FQG A;  2CW0 F;  1FOK A;  2HYG D;  3E5Q A;  3JRF A;  1W0T A;  1MW7 A;  2F5E A;  1H9G A;  3JSO A;  4LLN A;  3R60 A;  5FD6 A;  4YRV A;  1HF0 A;  4XKW A;  3IL2 A;  4BY1 J;  2M5W A;  3ERM A;  3W2A A;  3CP8 A;  3MKL A;  3V42 A;  3E6C C;  5CYV A;  5E3O A;  3DXJ F;  5FKL A;  2DXI A;  5J3L A;  3UKG A;  2LSO A;  3OOU A;  4HF0 A;  2EZI A;  3WU0 A;  1VQ7 I;  4EV0 A;  3EET A;  4IL6 C;  2CUZ A;  4TV7 A;  4A69 C;  1IRF A;  2Y30 A;  3U9G A;  3RSN A;  2L7Z A;  4XRS A;  3TBI A;  3HDD A;  3K7A J;  5CVI A;  2K4J A;  2A5Y B;  2FJ1 A;  3PSI A;  2WY8 Q;  4ZC3 A;  3OYL A;  5LHI A;  5D4S A;  4L0Y B;  3KZY A;  2IS2 A;  2L02 A;  1N75 A;  3G3Z A;  1N25 A;  1R23 A;  4BE2 A;  2HTS A;  2KQR A;  3T0Y A;  2DCE A;  2PJR B;  4L9J A;  5JVG F;  2R7R A;  5LHG A;  3FXQ A;  2XAQ A;  3GBG A;  1J09 A;  2COM A;  1IW7 F;  3A0H C;  2CQQ A;  2V1N A;  2Y0S A;  3KEY A;  4IQJ A;  4B09 A;  2F5D A;  4CYC A;  1TQI A;  5EJC A;  2JSC A;  4G94 A;  1YTY A;  3WOD F;  2A61 A;  2HS5 A;  2LF7 A;  1MBE A;  1D0X A;  1G3W A;  4Y7N J;  3RPU D;  5JI6 A;  4HNT A;  5HS7 A;  2E7X A;  2JMW A;  3N05 A;  1QU3 A;  3LSK A;  2A68 F;  1BBY A;  4M3D A;  1WQ2 A;  2W00 A;  2DOD A;  2KZG A;  4I7H A;  4V2G A;  2OQR A;  5CJ9 A;  3WTT C;  5FRM A;  5F0C A;  3ZGK A;  4YFX F;  3FKJ A;  2BEO A;  4ENN A;  2JN6 A;  4ENJ A;  1QBJ A;  4IPA A;  1SVM A;  1P92 A;  2ISY A;  1YFH A;  1KU3 A;  2COB A;  2HOE A;  5HDG A;  2FQ4 A;  3HOU J;  4J00 A;  1BJA A;  1FBU A;  4EJW A;  4A3M J;  1Z3Y A;  1C0W A;  1SFK A;  4A0Z A;  4UY8 I;  3GTK J;  2BE5 F;  3I53 A;  4PJL A;  4BHB A;  1LVK A;  3BDD A;  3A02 A;  1T95 A;  3GEZ A;  1MMG A;  4XON A;  2CFO A;  1Y0N A;  1P4X A;  3VB2 A;  4PZJ A;  1DP3 A;  1HC8 A;  1X3U A;  5C4J J;  1VND A;  3ZQL A;  4LJZ F;  4AWX B;  1XSX A;  4BQQ A;  4AIK A;  2CRG A;  1BOB A;  1HDD C;  3F9K A;  1WJC A;  1OCR H;  2HZD A;  2VBY A;  3PFI A;  2ZB9 A;  2DOF A;  2Y9Z A;  2CV2 A;  3S1R J;  2DDA A;  4RGX A;  1PYV A;  2E7W A;  3K1M A;  3TQN A;  3K4L A;  4KIB A;  3GZ5 A;  1TW2 A;  3HOV J;  2HOS A;  3S1M J;  1RET A;  3ECH A;  1UAA A;  2QM3 A;  3SXY A;  1J0R A;  4LFU A;  1N78 A;  1OMI A;  2EIN H;  3HTU A;  2MD5 A;  3LSM A;  5TJJ A;  3G2B A;  5HVQ C;  4EGY A;  1TC3 C;  2XAJ A;  4A12 A;  2R7T A;  4XLE A;  4M6V A;  4BXU A;  2O03 A;  3I55 I;  3HL2 A;  4JYK A;  4LOC A;  2ISZ A;  1IN6 A;  2R4G A;  4YEJ A;  2JUG A;  2ELH A;  3BTI A;  3A1Y A;  4EMS A;  3I54 A;  3I3L A;  3RKY A;  3L2V A;  4LD5 A;  3U21 A;  2DPD A;  3KLN A;  2UV1 A;  3WTU C;  3T8R A;  4C3H J;  3RYP A;  3DU5 A;  2O6G E;  3DKX A;  2DO7 A;  1OCT C;  3E97 A;  4KNY A;  1WVR A;  2CV0 A;  3LFK A;  2DBB A;  5CVV A;  3HRT A;  3PQJ A;  1D3Y A;  3QWL A;  1ORK A;  1FTT A;  5M5X J;  5J47 A;  2ZNY A;  3AKZ A;  2IA0 A;  4ZTJ A;  2CS3 A;  1FP1 D;  2Q1Z B;  3CCE I;  2M45 A;  3GVA A;  4F91 B;  3S3O A;  2JVH A;  2YX7 A;  2K85 A;  4HX4 A;  1FYK A;  5EZH A;  1GV5 A;  5GPC A;  2NYX A;  4NQW B;  3RKX A;  3FM5 A;  1QVU A;  5JLX A;  1LKX A;  3OYA A;  2VKV A;  3CUQ B;  2KDO A;  2GXB A;  2E19 A;  5FB2 A;  3L2U A;  3FDY A;  2EIJ H;  3E3V A;  5EGO B;  4LLL A;  3FM3 A;  4P96 A;  5J1Y A;  2CW7 A;  5J1U A;  1UEL B;  2DA6 A;  3BQY A;  1XDS A;  3OOP A;  2HZT A;  3D5S C;  3F6V A;  1G2H A;  3A01 B;  5F1J A;  3C3W A;  4BE0 A;  3S17 J;  4LG3 A;  5E3M A;  4A3G J;  3CCV I;  2EZK A;  3FZV A;  1FYL A;  2OD5 A;  1JI8 A;  1NG6 A;  1IN5 A;  4XK4 A;  1NG7 A;  3ABT A;  1J9I A;  3HOW J;  4L5I A;  3ZCO A;  1NK3 P;  1U9O A;  3KET A;  2HDD A;  3KP6 A;  1TWH J;  2VC1 A;  2FEZ A;  4BS9 A;  3OL4 A;  4JBA A;  3BCA A;  1B72 A;  3S16 J;  2KMU A;  1BJZ A;  4UV8 A;  1VQK I;  1E2X A;  1WPK A;  2HI3 A;  3P5J A;  4KN4 X;  3QP5 A;  2XPV A;  3C2H A;  3CC2 I;  2H1L A;  3ELK A;  1YJ9 I;  1DPR A;  1VQ6 I;  1QO0 D;  3R4K A;  2ZJ2 A;  1V4R A;  4MHG A;  1ETQ A;  1TTY A;  1FY7 A;  2QKL B;  1XGM A;  2DT6 A;  4FCY A;  3S1Q J;  3ZN1 A;  3J7A O;  1OYI A;  1KQ0 A;  2VJ5 A;  2FNP A;  4EJU A;  2F4I A;  3CME I;  2K27 A;  2XF7 A;  3MEX A;  3F72 A;  3PIO F;  1GVJ A;  4KIC A;  4DGW B;  2XF5 A;  3RPQ A;  2Y48 A;  1I3Q J;  1UST A;  1BI1 A;  3JAM Z;  2I10 A;  3ISP A;  1STZ A;  3GTM J;  3CC7 I;  1FTZ A;  2QSF X;  2R7U A;  1WCM J;  1JKP C;  4G6D A;  2WAF A;  2VLA A;  1U9N A;  2ZSH B;  2KIQ A;  3KZZ A;  3CUQ A;  2X9D A;  1UFM A;  4RM3 A;  1IUF A;  3FIW A;  1FZP B;  1QHG A;  4BUP A;  3SZG A;  4BEH B;  1T38 A;  3CZ6 A;  2ZSI B;  3M07 A;  1Z6R A;  3DWL E;  4ZJZ A;  1A5J A;  5H2F C;  2QZ8 A;  4KIF A;  3QYB A;  3LA7 A;  4KJZ A;  3TDU C;  3FHN A;  4D7N A;  1J2X A;  1ITY A;  1QNT A;  5CVJ A;  3SDB A;  5DEQ A;  2LMD A;  2LBF B;  2ME6 A;  1EKE A;  2WAD A;  2X48 A;  1ETK A;  3VOE A;  4EEF G;  2O0Y A;  4HG2 A;  1T0F C;  3GME A;  1MBH A;  2H1K A;  1JJ8 C;  2XUB A;  1NHA A;  3PL8 A;  2V1X A;  3RCO A;  1HW1 A;  5E1Z B;  2PN6 A;  4HDV A;  3S2D J;  3RPU A;  5EDN A;  4D5F A;  3A01 A;  2B7E A;  4XOR A;  1MJB A;  4HQM A;  4N0B A;  2E1O A;  3QQA A;  4EJV A;  2R7S A;  3DEU A;  2Z2S B;  1W5T A;  4FE7 A;  5CVR A;  3TO7 A;  3JRH A;  2XAH A;  3R6S A;  1KON A;  5BQT A;  4ETS A;  5JLW A;  4PFO A;  3GLX A;  2F5C A;  2JPB A;  5F08 A;  2AS5 F;  4P5O A;  2FQ3 A;  2Q2E A;  2ACJ A;  3A2K A;  2PJP A;  2MFZ A;  3TDZ C;  2VKH A;  1R5I D;  4J01 A;  5LRR A;  1JE8 A;  1UG2 A;  5TGT A;  1W5S A;  3WE3 A;  3CCM I;  5F64 A;  5DDG A;  2QYO A;  3PNV A;  2VE9 A;  2P5K A;  4HNU A;  3I9V 2;  3K1P A;  1ZGA A;  1SVL A;  4B44 A;  1X2M A;  5D5W B;  1O3R A;  5L3F A;  4RMN A;  4DZJ A;  3QPT A;  3Q3S A;  2L7F P;  2P8T A;  4CSW A;  1YIJ I;  3WTY C;  3KCC A;  3C7J A;  3DQV C;  5M5W J;  2JA7 J;  2GWR A;  4IX7 A;  2DN0 A;  2FMY A;  3IH4 A;  5DCM B;  3PNY A;  2EZL A;  4ZYE A;  2ZFW A;  3HPH A;  1XGO A;  2LC2 A;  2R5Y B;  3WTS C;  3V8J A;  3KIO A;  2BOL A;  4X1E A;  2NOJ B;  4RGU A;  1W7P D;  2QCO A;  3BR3 A;  3I5U A;  1R4M B;  4FHT A;  4JK1 X;  9ANT A;  3HYI A;  2DA3 A;  2QQ8 A;  1RZ4 A;  2IGM A;  2R93 J;  5L3D A;  3ZQI A;  2VBX A;  3ECO A;  4LG0 A;  1JUM A;  1GHC A;  5H6Q A;  3ABL H;  1LDK B;  4IHV A;  5EG0 B;  5BOX A;  2E5N A;  2F4M B;  3CCL I;  1MNM C;  4Z2Y A;  4L5E A;  3H5R A;  2NVX J;  4M72 A;  1SD6 A;  2R7V A;  4FE4 A;  2ZC2 A;  5IP6 A;  2KIS A;  4MIM A;  3U1K A;  4CYD A;  3BC8 A;  1KZH A;  3GXO A;  3HUG B;  3CO7 C;  1CQT A;  1JKQ C;  5HNH A;  3ZN0 A;  3BT9 A;  3JTG A;  1QZY A;  2WB1 N;  4I0B A;  3BG6 A;  1L0O C;  5ILU A;  2HQA A;  2UXN A;  2NVQ J;  3MKZ A;  3S15 J;  2JK3 A;  1MSF C;  4HNV A;  1POG A;  1X1B A;  4AYB A;  5J8F A;  2OBP A;  3HOT A;  4OMZ A;  1V3F A;  3FKI J;  4ENK A;  4GCV A;  4BEH A;  1IO2 A;  1B9N A;  1BN5 A;  3TO9 A;  1FNN A;  1MNE A;  2IP2 A;  3I58 A;  1MH4 A;  3DFG A;  2AQE A;  5FGM A;  1K79 A;  2ZBK A;  3JRE A;  1JHH A;  2CFX A;  2XVC A;  3RYR A;  5FLV A;  2KPM A;  2B63 J;  3C2B A;  2VBZ A;  4WX9 A;  5IT9 Z;  4EM2 A;  5IT3 A;  3KP4 A;  4LIU A;  1A04 A;  2CQN A;  1G6N A;  3NAR A;  4XQF A;  1XPX A;  2QSG X;  1MKM A;  5IP7 J;  1GVD A;  3IV5 A;  2Z16 A;  2VKD A;  4OWR B;  3LSI A;  5GPA A;  3RIR A;  1HBX G;  3HZJ A;  4LGW A;  1VQO I;  2HOT A;  2VQC A;  2CG4 A;  2BW3 A;  2MLK A;  4HSR A;  3BP8 A;  1ZQ3 P;  5CPR B;  4A3L J;  3OYJ A;  2Y2Z A;  4BHP A;  4I6Z A;  1K78 A;  1LJ9 A;  4IOC F;  5M3M J;  3HUG A;  3BG3 A;  2LBF A;  4W1U A;  5TRD A;  3PO2 J;  2VJI A;  3OYB A;  1Z3X A;  4I2O A;  2VBW A;  3K4C A;  2EPF A;  4IRI A;  5JHF A;  1SEU A;  2JA5 J;  2A5W A;  1GT0 C;  1G3Y A;  3GFM A;  1PUE E;  5E8G A;  3EUH C;  1T56 A;  4Q47 A;  2OCE A;  1D8K A;  3OR2 C;  4AID A;  3WGH A;  3FWE A;  4IF4 A;  3VSK A;  1XMA A;  2KIU A;  4UB6 C;  5GP9 A;  5ED4 A;  3L00 A;  5FKM A;  3CDL A;  1SMT A;  1G8X A;  4OU0 A;  4BNC A;  2L7M P;  2J5O A;  3PJR A;  4BBS J;  2Z33 A;  4MQ9 F;  2P7C B;  2QLZ A;  3BG9 A;  2BY3 A;  2A3S A;  2NS8 A;  3K4J A;  3GLL A;  3NAU A;  1WJD A;  2EFW A;  2V7F A;  4WWC A;  4H0E A;  5K7Z A;  1XB4 A;  2AO9 A;  2DA5 A;  3ESW B;  3LFU A;  1XC5 A;  2CMP A;  4A2U A;  2GLO A;  4YFN F;  1AWC A;  1Y39 A;  4HBL A;  4B3X A;  4LG0 B;  1GV2 A;  4A3C J;  4LK1 F;  2MSY A;  3JRC A;  2VPL A;  2FBK A;  4E4H A;  2GIZ A;  5HNF A;  1LFU P;  1JKR C;  4O5V A;  2BW3 B;  1OR7 C;  3I4M J;  3LL7 A;  3TW6 A;  4E7S A;  2Z3Y A;  3FMQ A;  4Y15 A;  2DA7 A;  4DJA A;  2ETH A;  1B8I B;  2KDZ A;  2ZME B;  4M6Y A;  2IBD A;  3IHU A;  3HIF A;  3F3X A;  2YPR A;  3ZQ7 A;  3M3Y J;  2LRE A;  2EQR A;  4CGZ A;  4RB3 C;  4LIV A;  3AFH A;  4ENM A;  3HSR A;  1F43 A;  1ULY A;  4I01 A;  4PJM A;  1F1Z A;  1V5E A;  2E5Z A;  1D1A A;  3LNQ A;  2X1C A;  2ZKZ A;  2WV1 A;  3K2Z A;  4RB1 A;  3JR9 A;  4E7L A;  5J6X A;  2BY2 A;  2GZW A;  4A3D J;  1MGT A;  1YQA A;  1HKS A;  3DTE A;  3FMS A;  5HDN A;  2E34 A;  1BR1 A;  1SFU A;  3MKY B;  2ADU A;  5EZG A;  1R49 A;  5EG0 A;  1IN4 A;  3L7W A;  3H5A A;  3P9C A;  1EH7 A;  5DTD A;  2Y75 A;  2WAQ N;  2L9R A;  1Z91 A;  4OOI A;  1S8N A;  3CD6 I;  4IOA F;  3V7S A;  1ZRE A;  2LY2 A;  1R9T J;  4WXD A;  1H0M A;  1VQ5 I;  4ZZL A;  2QGU A;  4L9N A;  4C9Y A;  3CCU I;  3I59 A;  3OIQ A;  2IS6 A;  5FFX A;  2LR8 A;  3P7N A;  2Y0S N;  5D8L B;  3L2W A;  2IPQ X;  1U6G A;  5E1W A;  4PJN A;  3ROU A;  1H8A C;  1U2W A;  3LSH A;  4XMY A;  4RAG A;  2BYV E;  5B66 C;  3TMO A;  1IXS B;  4BAY A;  2BZT A;  4GFB A;  1V5G A;  2ZJR F;  2HOA A;  4U0W A;  1HLV A;  5CKT A;  3OYD A;  1ZN2 A;  4Q5S F;  3HGY A;  3KYD B;  4ITV A;  1A31 A;  1T33 A;  2G7H A;  4WXC A;  5K5R A;  1YIT I;  1PUF B;  2HEO A;  2IS4 A;  1HDP A;  4K2E A;  1QA6 A;  3RZD J;  1CGP A;  2DA1 A;  3VYS B;  1EJ9 A;  5E1X A;  1JUP A;  1ACI A;  2KRF A;  2DFI A;  4JX6 A;  4M74 A;  5C3E J;  3IH2 A;  4A93 J;  2M1B A;  3DF8 A;  2DTZ A;  4F52 A;  1FOX A;  2CUE A;  1RES A;  4BY7 J;  3IWZ A;  3UNG C;  4OIN F;  5IOY A;  2E2J J;  2Z9O A;  2UUZ A;  1VQP I;  4NDL A;  1PP7 U;  2IA1 A;  2JPC A;  2EIL H;  2V1D A;  4RB2 C;  1MBG A;  4MNU A;  2H09 A;  1IRG A;  2XAU A;  4ESF A;  4HF1 A;  2XKO A;  4EM0 B;  2LNB A;  4F3Q A;  1B72 B;  3ML6 A;  2RKH A;  3LST A;  3FMR A;  3DEE A;  4P9F A;  2M2E A;  1HOM A;  5K1Y A;  3DLL F;  4U7D A;  2DDB A;  1RR8 C;  3H9J A;  2M3A A;  4A5M A;  3DTI A;  1F4K A;  2RRE A;  2RC4 A;  4LB5 A;  2R7D A;  2QF7 A;  3VSL A;  3ZMV A;  4IXA A;  3WTW C;  2GIV A;  3QPL A;  1OCZ H;  2ZFU A;  4ZYG A;  4LMY A;  2CQK A;  1WJA A;  1PJR A;  3OYC A;  1YLF A;  2V6C A;  2X4H A;  5FD5 A;  4E70 A;  1S72 I;  3DCF A;  1TL8 A;  1YW8 A;  3VEP A;  3CJQ B;  4O6J A;  2OPT A;  3K9T A;  1IXR C;  4BAC A;  2UWM A;  5J1R A;  2BBY A;  3RQI A;  4HPQ A;  3OYN A;  3G73 A;  3S2H J;  4Q4Z F;  4XLC A;  2TRT A;  4UUS B;  2IT0 A;  1WJ5 A;  4F7Z A;  2ECC A;  2XKP A;  4OIQ F;  1UHM A;  2QVO A;  1FSE A;  1FOY A;  2K40 A;  4XOT A;  4F55 A;  1BW5 A;  2ZXW H;  2V4J C;  2XRO A;  3CLO A;  4M3B A;  4A3K J;  2K3F A;  2X0L A;  3IH3 A;  1G4D A;  1MZB A;  5ICE A;  4CCJ A;  2HKO A;  3T8T A;  4QPQ A;  1K6O A;  2HYF A;  3LAP A;  3J81 K;  1MDM B;  1AKH A;  2G9W A;  3M9A A;  4ZDL A;  1P4W A;  3OY9 A;  2M0C A;  5HOD A;  2M8G X;  4C2T A;  2WWY A;  1U8R A;  4BGD A;  1Z9C A;  1JHF A;  1Z05 A;  1IRZ A;  2LKS A;  2ZME A;  3EQL F;  3HSF A;  2Z5U A;  3BTL A;  1RIO H;  2EIM H;  4XLN F;  3TOA A;  3KP7 A;  3TO6 A;  3K2A A;  3F8M A;  4DYR A;  3AAF A;  2XF6 A;  3E6B A;  3ZPL A;  1LE8 B;  2B0L A;  4AVP A;  2HQ5 A;  4EAT A;  5ICF A;  2I8D A;  5HDK A;  5JHU A;  3SEZ A;  5CQG A;  3M1E A;  2D5V A;  3CP2 A;  1ZG5 A;  5AIQ A;  1LUJ B;  1FPQ A;  4PGH A;  4R1H A;  4CZC A;  1J59 A;  4DZP A;  3O2P E;  1WFX A;  1V54 H;  2HYJ A;  1SAN A;  3J80 Z;  2A6E F;  1I1G A;  1FLI A;  1E17 A;  2LKX A;  4KIS A;  2K9M A;  3L2Q A;  5E8I A;  2V6E A;  1I27 A;  2FU4 A;  3ZRG A;  2MH2 A;  2A07 F;  2VN2 A;  1LEB A;  2G0E A;  2CW8 A;  5GAG J;  2D1V A;  1TWC J;  1TNT A;  4Y4R A;  4ZYH A;  2ME0 A;  5D6E A;  1J75 A;  3QRF F;  5LD2 C;  2DYS H;  1RR7 A;  4OMY A;  3PNT A;  3M7G A;  3QPH A;  3GFL A;  1TBX A;  4IHX A;  3QP6 A;  1ZRD A;  3E6D A;  2DFE A;  3HG9 A;  3ZMT A;  2EH3 A;  2L4M A;  3PUF A;  1VTN C;  4PGG A;  1X1C A;  3A0B C;  2RQP A;  1Z67 A;  3LMM A;  2M8E A;  3FBN B;  4Q48 A;  5E3L A;  1CF7 B;  1VQ9 I;  2NNY A;  5D4R A;  2KT0 A;  2K5C A;  2DMQ A;  2JQ7 A;  4D1Q A;  1MBF A;  2K86 A;  3MKW B;  2XB0 X;  4ZYA A;  4S0H B;  4IHS A;  1VQM I;  4G7O F;  2R7O A;  1ETW A;  2M30 A;  3CJN A;  3HBL A;  3ABU A;  1Y8R B;  2ZO4 A;  2FX0 A;  4HA8 A;  1ZLJ A;  2WA0 A;  2XPW A;  3OR1 C;  4R8H A;  1G3S A;  3HOY J;  1UHS A;  2JA2 A;  3CMM A;  1V55 H;  5FRN A;  1B1B A;  1S6L A;  3S1N J;  3M8E A;  4A3B J;  2X6O A;  1HA8 A;  1DU6 A;  3ZMU A;  2R7X A;  4BQA A;  2PFB A;  1HSJ A;  3I64 A;  1WKM A;  1D0Z A;  3BJA A;  3BTJ A;  2P5V A;  2F5V A;  2OTL I;  3GUD A;  2FNA A;  2PI0 A;  1PVE A;  1YHQ I;  4BHC A;  3JRD A;  3CJT B;  2PMH A;  3FXJ A;  4HX8 A;  3LSP A;  2LG4 A;  3EYI A;  3FXR A;  2VOO A;  2HWV A;  2R92 J;  2VB6 A;  3GZ6 A;  2H6C A;  4IZZ A;  4XBF A;  3BG5 A;  2A69 F;  2W4S A;  4IJA A;  5HLI A;  5LGN A;  2RDP A;  1A6Q A;  1RKW A;  2QSH X;  1TT0 A;  3G6E I;  2LFB A;  3QPS A;  4EJO A;  1H88 C;  1B6A A;  1IRX A;  4WK8 F;  1DGW Y;  2D1H A;  2EFN A;  2A05 A;  1Q1V A;  2FSW A;  2JZY A;  1XCB A;  1U5T A;  3AG1 H;  1ZG1 A;  2KRC A;  1JGS A;  1F5T A;  4CHU A;  1HQC A;  1E3H A;  3I59 B;  3I56 I;  2M4K A;  4KN7 X;  2HVR A;  3E1S A;  4I99 C;  1MMN A;  2FA5 A;  4ASN A;  3CF5 F;  1O7L A;  2XRL A;  3J7Y J;  2OTJ I;  4A6E A;  3J7A Y;  3BQZ A;  1G3T A;  2PEX A;  1RNL A;  5DM7 F;  2WY7 Q;  4XOP A;  2EIK H;  2MAB A;  4IHW A;  1DDN A;  3F8N A;  3QOD A;  2DMP A;  3BY6 A;  4QIW N;  2BGC A;  3B73 A;  1P7J A;  3J81 Z;  1LB2 A;  2H94 A;  1EH8 A;  2DYR H;  2Y0M A;  3JTH A;  1XD7 A;  4Y33 A;  4B48 A;  5JFR A;  1PDN C;  3FBI B;  2IGN A;  3JW4 A;  4A3F J;  2OC6 A;  3OIO A;  5GAH J;  3L1P A;  3R0J A;  5LBQ A;  1R22 A;  1SVO A;  4AVZ A;  1B8I A;  2YR2 A;  1HXD A;  2ID3 A;  1Z7L A;  3AG4 H;  1ZRF A;  3SHF A;  2ID6 A;  1XTA A;  2H8W A;  2WBM A;  1WJE A;  4A5N A;  2XAF A;  2AXL A;  2CU7 A;  4EQQ A;  5DUI A;  4GRI A;  2IRF G;  3MZH A;  3KE2 A;  3D5L A;  1X1A A;  3DU6 A;  1P7I A;  1MMS A;  3OYF A;  4I76 A;  2MG4 A;  2ZNZ A;  3S2W A;  2LRD A;  2LY9 A;  4XN0 A;  4EGZ A;  3S3N A;  3I0T A;  1B4A A;  1VI0 A;  1TT5 B;  5JVT A;  3OV8 A;  2W57 A;  2FRH A;  1FBS A;  1MND A;  3QU6 A;  2NNN A;  5KVR A;  3B6C A;  4YFK F;  2JA6 J;  3DP7 A;  2IEK A;  1RC9 A;  2X6X A;  5E79 C;  1FSH A;  3FF5 A;  5D5X B;  3H1C A;  1UCR A;  5IPA A;  1O3Q A;  1HCR A;  5E18 F;  2X85 A;  2YU9 J;  2Q8K A;  2VOD A;  3B02 A;  1A35 A;  1Z7U A;  3DBL B;  4CIC A;  3K70 D;  5CLS A;  4E7Z A;  3S3M A;  1BR4 A;  6PAX A;  3GTG J;  2FF4 A;  1ON2 A;  2XSD C;  1WRJ A;  2EA4 A;  1QHH D;  2CQ7 A;  2K9L A;  2OZ6 A;  4HYE A;  3HKZ N;  2CV1 A;  5ILV A;  5JR3 A;  1YX5 A;  1OCP A;  4HQE A;  1IV6 A;  2XGX A;  3F8F A;  1BR2 A;  2M7B A;  1D0Y A;  2EV5 A;  1WJB A;  5K7H A;  2PMZ A;  1T2K A;  3RKW A;  4D9J A;  1XGS A;  4DYQ A;  4RBO A;  4C3J J;  1R58 A;  4MFD A;  4XRM A;  2R5Z A;  1U0J A;  3CC4 I;  4D7M A;  4XKB A;  3JRB A;  2E1N A;  3NQO A;  4YIR X;  4IKF A;  4KIT B;  3U1D A;  2QUF A;  1IC8 A;  3NWT A;  1H9T A;  5DV5 A;  3GTL J;  3C2G A;  3HOX J;  3H3Z A;  3RDI A;  1MJ9 A;  4AC0 A;  4IRH A;  3WTV C;  3FXU A;  2HVS A;  3ZMD A;  3K4K A;  2O9L A;  3RJP A;  2W24 A;  3AL0 B;  1TP4 A;  4EVI A;  4IHT A;  2LK2 A;  2D2W A;  4MTE A;  1E3P A;  2IJL A;  3GO5 A;  4M9S A;  5F6F A;  4QTR A;  2PBI A;  5LFA A;  1GDT A;  1JT0 A;  3N97 A;  1BC7 C;  1XDU A;  4EM1 A;  4XLP F;  1RUN A;  2GQQ A;  2EFP A;  1ZAO A;  1BA5 A;  1BC8 C;  3KX2 A;  5KCM A;  3TL4 X;  1IDY A;  1LVA A;  2QQ9 A;  4KT5 C;  5D6F A;  2KIM A;  4FIS A;  2FML A;  3LA3 A;  1BW6 A;  2L5Q A;  1MMD A;  1AU7 A;  1T98 A;  3LQR A;  5H20 A;  5A2Q Z;  3A4C A;  2B9S A;  2L9S A;  3REO A;  4P9U A;  1OJL A;  1FMV A;  2LY1 A;  4RLQ A;  5GTH C;  5DD8 A;  5CVU A;  5HLH A;  3VYR B;  1ZR4 A;  2EV0 A;  1DU0 A;  3KYL A;  1SFE A;  4KUM A;  2FUG 2;  3W6V A;  5EF6 A;  4ZDP A;  1Z1D A;  5M5Y J;  3IAM 2;  2K7L A;  1SD5 A;  2KIF A;  4F92 B;  4CYC B;  2NS0 A;  4UVB A;  3OYM A;  1MD0 A;  5FLX K;  2VXZ A;  1WI9 A;  1BI0 A;  2VON A;  1G59 A;  2ICW G;  5FKK A;  5DUK A;  2LP0 A;  3DPU A;  5LLQ A;  1S29 A;  4E7J A;  2K02 A;  3OYH A;  2DFH A;  2OA4 A;  4BL0 B;  1IDZ A;  2JT1 A;  3V4G A;  4N4O B;  3MWM A;  2RNG A;  3K10 A;  4QWQ A;  3VYU B;  2IW5 A;  5E3N A;  1QVT A;  1FEX A;  4QSH A;  3ZP5 A;  2WV0 A;  4JP0 A;  5EEG A;  2WAE A;  5TIS C;  3KFW X;  4BU2 A;  3BJO A;  2HVQ A;  1V5F A;  1KQ9 A;  2NS7 A;  5F27 A;  2MA3 A;  3E7L A;  3IAS 2;  2R5Y A;  1OIS A;  1DPU A;  3Q9S A;  3SZT A;  2E71 A;  1KYZ A;  2FOK A;  3HRS A;  3K0L A;  3TKY A;  4BYY A;  5L3C A;  3F8B A;  1JGG A;  2GOM A;  2P0W A;  1VQN I;  3VOD A;  1Y56 A;  2IGK A;  4U7B A;  2VXD A;  1QPI A;  1P9Q C;  3CCS I;  4HV6 A;  5ILS A;  3OMY A;  1W36 C;  2R7W A;  2DMU A;  1O7F A;  3BJ6 A;  4XR6 A;  4GDF A;  2R7Q A;  2ZXH A;  1K61 A;  4HLY A;  3QYE A;  2G7U A;  1TZL A;  5FLM J;  4E7I A;  1WI3 A;  3KLO A;  3CDI A;  2STW A;  4CCN A;  3GFI A;  4E7K A;  2NOG A;  3WTZ A;  2XRN A;  4RGR A;  3WGG A;  1XMK A;  1I6H J;  3P9I A;  5B1B H;  1JT6 A;  2P81 A;  5HS9 A;  3ONQ A;  1HW2 A;  2L2O A;  5F1R A;  4CCO A;  2HQR A;  2LTP A;  2K9Q A;  1O57 A;  3PM1 A;  4WXH A;  2HTJ A;  1IG7 A;  2JSP A;  4KMF A;  3KP2 A;  4JX5 A;  2DFF A;  2M9H A;  2F6C A;  5IYC J;  1SMY F;  1HW5 A;  1RKT A;  2F2E A;  4BKX A;  3M1C A;  5B5E C;  2ZXI A;  4UUV A;  3HRM A;  1KA8 A;  1D5V A;  1TQM A;  5HLG A;  1OQY A;  3S8P A;  4HRI A;  1R36 A;  3AG2 H;  4GXO A;  2LOO A;  4II2 A;  3NRV A;  3OS1 A;  3VPR A;  2HU9 A;  4JOM A;  3BR6 A;  4I02 A;  2V9P A;  4P55 A;  2DK8 A;  2O5R A;  2EFO A;  1YO5 C;  2ESH A;  5ICC A;  3BPX A;  4UVC A;  4QPO A;  3OS0 A;  1GLN A;  5EGO A;  4ZH4 F;  2LLK A;  3SFZ A;  3F23 A;  3K70 C;  5C4X J;  1JTY A;  2J5P A;  4XLF A;  4AUX A;  2R5Z B;  5FFZ A;  1FT9 A;  2IVM A;  1ZGW A;  1ZGJ A;  3HTS B;  2PLY A;  5DYM A;  4P1W A;  1JXS A;  2AXT C;  2VQL A;  1X1D A;  3I4P A;  1T0F A;  3HOZ J;  2TCT A;  4A0X A;  2XSJ C;  1RUO A;  3MQ0 A;  2E1C A;  4ABZ A;  1ZK8 A;  1SFX A;  2JVG A;  3ZQQ A;  1IXC A;  2V26 A;  3F8C A;  2P4W A;  2IXS A;  3Q0W A;  4EJT A;  1D8J A;  2W48 A;  3I71 A;  2GXA A;  4OAZ A;  1S7A A;  3CCQ I;  1IV8 A;  1KU9 A;  1REP C;  3JRI A;  1ZAR A;  4I09 A;  2EJR A;  2VQH A;  1T8I A;  1EA3 A;  2VJ4 A;  1ZHF A;  4LIT A;  2OV7 A;  2BY1 A;  3EUK L;  4PUS A;  1GXP A;  2UXX A;  3HM5 A;  3IP4 B;  3AG3 H;  3GTO J;  3HJE A;  3CF2 A;  3MZ8 A;  1UZC A;  1YIO A;  2JRM A;  4BBR J;  2FBI A;  2RN7 A;  2BHY A;  4HAM A;  2QEX I;  1XSD A;  3CCR I;  4HX7 A;  1UB9 A;  2O3F A;  2FBH A;  3RI4 A;  3OS2 A;  2Y31 A;  2Y69 H;  4CUG A;  2VPR A;  5H6R A;  3QAH A;  4CCK A;  1LDD A;  3GX4 X;  3IC7 A;  1UMQ A;  4ESJ A;  4M9X A;  1YW7 A;  1X1P A;  1I6X A;  2XB5 A;  3O8H A;  3HC7 A;  3X2Q H;  3MAJ A;  2CO5 A;  2MC4 A;  1QZE A;  1W5C C;  2OAZ A;  4HST A;  2H6B A;  3M8J A;  2QEN A;  2HDC A;  4G8X A;  3F0C A;  1LFB A;  4PDK A;  1U78 A;  2QBY B;  2R3S A;  4OIP F;  1ETY A;  3C18 A;  3H36 A;  4IVN A;  2QQB A;  1OCC H;  4UB8 C;  4G12 A;  1FIA A;  1EV7 A;  4UV9 A;  1XN7 A;  2DA2 A;  4II3 A;  1LFP A;  1LNW A;  3WU1 B;  3M8F A;  4C2U A;  3HHG A;  2MH9 A;  1O4X A;  2VQG A;  2M7A A;  3RKQ A;  4KMU X;  1B9M A;  3PIP F;  4I98 B;  2DW4 A;  4E6K G;  3QOE A;  4ON0 A;  3Q9V A;  4GYG A;  5GAE J;  2X51 A;  4NQW A;  3OSF A;  3K69 A;  1TWA J;  4NUB A;  5FO5 A;  5DS9 A;  2KLO A;  4BXX J;  3S32 A;  3H0D A;  3S93 A;  3MCZ A;  2IAI A;  3HKZ A;  1IUY A;  3FXL A;  3SZP A;  3BPV A;  3MZY A;  1ZH5 A;  2DLL A;  2V79 A;  3IWF A;  4RAZ A;  3OYG A;  3CUQ C;  2LDU A;  4UNO A;  2BXZ A;  3EDP A;  3O8G A;  4UUT A;  3G1O A;  4DYC A;  5KHD A;  1R4N B;  1JJ6 C;  2VUM J;  1APL C;  2R0Q C;  1R1V A;  2PMZ N;  1X58 A;  3GW2 A;  1YI2 I;  1PUF A;  4FTH A;  1BL0 A;  4RB0 A;  4MEY F;  1MMA A;  1EH6 A;  1W1W E;  1VQL I;  2BXY A;  2Q2E B;  5IOZ A;  2V9K A;  3GWZ A;  1AA7 A;  2EK5 A;  4CCL A;  1L3L A;  1YYV A;  1WJF A;  3OSG A;  4UHT A;  3KP5 A;  1U8B A;  4XRS G;  3GF2 A;  5KK1 A;  2DAO A;  2YS9 A;  4FX4 A;  1OLT A;  4PK4 A;  2MBF A;  2DJN A;  3WG7 H;  4IO9 F;  4E7H A;  2XC7 A;  3CES A;  4G7Z F;  1FBQ A;  1OPC A;  1J5Y A;  1YX3 A;  3B6A A;  5DCM A;  1QGP A;  4A3E J;  3H5N A;  1GUU A;  5EYR A;  4A3J J;  3CLQ A;  3K1N A;  1F36 A;  2VJJ A;  2OU2 A;  1IN8 A;  5LHH A;  1D1B A;  2FE3 A;  2XHK A;  3ZQH A;  2DMN A;  3V8L A;  3BCB A;  1I3A A;  2JTV A;  1ZEL A;  2X6W A;  2DJI A;  2DK5 A;  3KZI C;  1ZRC A;  4L9T A;  1ERD A;  3DPL C;  2CJJ A;  1BM9 A;  2P7V B;  1SD4 A;  5K7F A;  2L3D A;  3LWF A;  1Z21 A;  2W25 A;  4FET A;  2P5L C;  3GZN B;  1BIA A;  3BR0 A;  1MBJ A;  3W2V A;  1FMW A;  1WWX A;  2E2H J;  2KP6 A;  4UUS A;  1KYW A;  2L9V A;  3ZMZ A;  2DT5 A;  2Y9Y A;  4NB5 A;  1MDM A;  1AKH B;  5AIP A;  4DIQ A;  2WC2 A;  1HST A;  2IGO A;  2PX9 A;  2DOE A;  2OJE D;  4HV5 A;  1N77 A;  5IT9 K;  4A3I J;  5LEJ A;  2W1O A;  1HKQ A;  2X1E A;  4HW0 A;  3VDX A;  1Y0U A;  4KDP A;  2CGP A;  2E36 A;  2E60 A;  1R5G A;  4MTD A;  2W82 A;  3D5R C;  4AM3 A;  3ABK H;  5M3F J;  2QBY A;  2NRA C;  4FT8 A;  2O8X A;  3WHC A;  3Q5F A;  4NC7 A;  2RNJ A;  4AIJ A;  1F9N A;  4V19 K;  2CUJ A;  2HGC A;  2WAQ A;  1WHU A;  2LVS A;  4JX4 A;  3MFK A;  2VL8 A;  4B8X A;  1IN7 A;  1ON1 A;  3ZMS A;  4NNJ A;  2QKM B;  2D45 A;  4MQV A;  2V1U A;  5GTI C;  2C6Y A;  1UHW A;  2ZCW A;  4AIH A;  1OKR A;  3CUO A;  3HHH A;  2ZJQ F;  1LE8 A;  3VYT B;  3HPG A;  2CSO A;  1B59 A;  2UZK A;  2X1D A;  4CCM A;  1P6R A;  3L09 A;  1ZYR F;  2KJC A;  1YS7 A;  4G6T B;  3J7Z I;  1WSU A;  4XL9 A;  1S5L C;  2L4A A;  1TQP A;  3CJR B;  2F5F A;  3FK7 A;  3JCU C;  2NVT J;  3TP0 A;  1NK2 P;  1ZG3 A;  3LA2 A;  4DW6 A;  1K78 B;  1BI2 A;  4A0Y A;  2JJ7 A;  3HSE A;  3H9Q A;  3NWS A;  4BJ6 C;  1P4A A;  3CMA I;  3BTC A;  1K7A A;  4RS8 A;  3BZK A;  3PUB A;  4HF2 A;  1JTX A;  4HOB A;  5F04 A;  4S04 A;  3WTX C;  1VZ0 A;  3F22 A;  1BIB A;  1QZZ A;  3GFJ A;  3OWT A;  1YG2 A;  3TGN A;  2E35 A;  3V7R A;  4N4N B;  2VE8 A;  5AON A;  2LYC A;  4W97 A;  2CYY A;  3D0S A;  3COA C;  1K83 J;  4PCQ A;  2GA2 A;  1IJW C;  2K4B A;  1YRN B;  3G1M A;  3E5X A;  4RAF A;  3IKT A;  1RRJ A;  2IS1 A;  5CQE A;  2CUF A;  2V9V A;  1SAU A;  2W84 A;  2P6T A;  2H27 A;  3SYT A;  3BG7 A;  4XSZ F;  1OFC X;  1Y1W J;  1DGR M;  2EB7 A;  4CA0 A;  3WG9 A;  2XDV A;  4HZF A;  2RV8 A;  3SEQ A;  4ZYD A;  2KFD A;  3I4N J;  3R0A A;  3NEU A;  4H4K C;  1AOY A;  3CO6 C;  4G7H F;  3QU3 A;  2EFQ A;  2Z99 A;  1T6S A;  2O61 A;  4B4C A;  1S7O A;  4IHY A;  1FWZ A;  3BLY A;  2OQG A;  3UR3 C;  2P6S A;  3FXM A;  4G9Y A;  1Y8Q B;  3P9K A;  4CH7 A;  3GTJ J;  3PFY A;  3LSG A;  1R1U A;  4NBQ A;  4YEL A;  2O8K A;  3PQK A;  1YOV B;  2X6Y A;  4RA2 A;  1XS9 A;  5KNL A;  1S7E A;  1W0U A;  2RGV A;  1D5Y A;  1X3W B;  2FXA A;  3H3U A;  1WZ2 A;  3MMY B;  3ULQ B;  4MO7 A;  5HLT A;  1VQ8 I;  4MFE A;  3IUO A;  2XAS A;  1MJA A;  1YE9 A;  4MLO A;  3L2C A;  2MYS A;  4ZZD A;  3T1B A;  2VOP A;  3JRG A;  2EBI A;  2VT2 A;  3CDH A;  3Q0V A;  2ZJP F;  2GA1 A;  4KIG A;  3DV8 A;  4KT6 A;  4AYB N;  4RDU A;  3G1L A;  3KEO A;  1ZKG A;  3G4S I;  4N9I A;  2HKX A;  2VT3 A;  4BE1 A;  3ABM H;  2W7N A;  4IQ4 A;  4NHJ A;  3JRA A;  1KGS A;  2MW8 A;  3M4O J;  3K4B A;  4PFP A;  3SDG A;  2KJB A;  1DUX C;  4XM3 A;  1QRY A;  1X3Z B;  4KFC A;  3K4M A;  4XKC A;  5ICG A;  1NTC A;  3GCM A;  5LEK A;  4O3M A;  4FX0 A;  1K4T A;  3KPH A;  2EWN A;  3KYC B;  4BXF A;  5DM6 F;  3MVP A;  4HEA 2;  3ZOB A;  1OYY A;  3OIP A;  1JKO C;  4V2F A;  3T5X A;  2BVL A;  2YSR A;  3F21 A;  1VFC A;  1EF4 A;  2MLG A;  4ESB A;  1K4S A;  1USS A;  2BVM A;  1W7P B;  3BRO A;  5J40 A;  2KHM A;  2RVC A;  2ZME C;  2AHQ A;  4QLC U;  3W6J B;  2K9S A;  3ZQC A;  5B3S H;  4M3F A;  4OIO F;  2VIX A;  2JRT A;  5IYB J;  3DKY A;  3J80 K;  2LKP A;  3DLA A;  4N9H A;  2IA2 A;  1R71 A;  2NAZ A;  3CQZ J;  1ZTR A;  3DBR B;  4S05 A;  3LSR A;  2K3P A;  2L7K A;  2XGC A;  1XMX A;  4ZDO A;  3IKV A;  2OUM A;  1W4M A;  4BQN A;  5D5V B;  4L9V A;  2DI3 A;  5L3E A;  1ODD A;  2H8R A;  4C3I J;  3OL3 A;  4RM2 A;  3PSF A;  3BR2 A;  4L5J A;  1SAX A;  2OF7 A;  4DOZ A;  1YJN I;  1BOA A;  4R79 A;  3KP3 A;  2EA2 A;  1SFO J;  3VFZ A;  2XPU A;  3LAJ A;  1FYM A;  1YJW I;  4LLG F;  4YIF A;  1R7J A;  2GOX B;  4XLH A;  3ZQF A;  5L3G A;  3BZC A;  2DQR A;  4GO1 A;  1ETO A;  5GAD J;  3S14 J;  1IGN A;  5IYD J;  2XGD A;  2XV4 S;  4IRG A;  2VC0 A;  4DBR A;  3GTP J;  1MH3 A;  1PP8 F;  2NVU B;  3Q0U A;  3KEQ A;  4KA4 A;  2O7O A;  4U0V A;  4B1R A;  2OZU A;  4PSX A;  5FKN A;  1A36 A;  2TDX A;  2KZV A;  2FD5 A;  4UXN A;  5D8K B;  5EEH A;  1YS6 A;  2PQ8 A;  5FRO A;  2L01 A;  4UVA A;  2ELK A;  1FP2 A;  1TW3 A;  4ZTF A;  3LSJ A;  3FXK A;  3IRQ A;  2NVY J;  1ONV A;  4J19 A;  4M73 A;  1FJL A;  4AU7 A;  1ZLK A;  4BDZ A;  5HS8 A;  1SC7 A;  1WH5 A;  5BNG A;  4Y17 A;  1RPW A;  3FIS A;  3CCJ I;  3H0G J;  2EZH A;  5DCF A;  3V7C A;  4G6Q A;  2F4O B;  2KKO A;  1XG1 A;  3C1D A;  2L54 A;  1YRN A;  2A6H F;  4JQF A;  4WCG A;  2PJR A;  1Z0X A;  2CWE A;  3W3C A;  1FX7 A;  2W85 A;  2DA4 A;  3HGG A;  3E6M A;  4A6D A;  4OIR F;  1TWG J;  2LD5 A;  1OYW A;  4YG2 F;  4GYI A;  5EEA A;  1O3S A;  1XCV A;  4XRF A;  4XNF A;  2ECB A;  4DBQ A;  1YW9 A;  2DTR A;  1Y1V J;  1IF1 A;  2JA8 J;  5L3B A;  3EYY A;  1R1T A;  4GGG A;  1U3E M;  4M6X A;  4AD9 A;  3O3K A;  1FC3 A;  4M3G A;  3TED A;  3ZXS A;  1Z77 A;  3DKW A;  3OYE A;  1QPM A;  2R7F A;  4XN3 A;  3MD2 A;  3SQN A;  2E2I J;  1X2N A;  5LGU A;  1WGX A;  2BY0 A;  3A03 A;  1BI3 A;  4DQ2 A;  2DT7 B;  4X0G A;  4L18 B;  2JWT A;  4PJ0 C;  2OCC H;  3WU2 C;  1FOW A;  3TW7 A;  5F0H A;  5LRS A;  1AHD P;  1E0E A;  1TWF J;  2LF8 A;  5E20 A;  2EV6 A;  4LB6 B;  2E1M B;  2QWW A;  2K9N A;  4YII A;  1P2F A;  2ZXJ A;  3DTK A;  1UJ8 A;  3PO3 J;  2RAE A;  2DMT A;  2R7Z J;  4U88 A;  3BOQ A;  3JAM K;  2GBY A;  1K6Y A;  3W6K B;  2HXI A;  1VF9 A;  4XSX F;  1LEA A;  2ESN A;  2M0M A;  1XX5 A;  1KQ8 A;  1ENH A;  3FK6 A;  4B47 A;  1O3T A;  3OYI A;  4X6A J;  2BV6 A;  5KAF C;  4C30 A;  1OCO H;  1TLH B;  5BPD A;  4M9Z A;  2VKE A;  3CCY A;  2MD0 A;  1ZR2 A;  1T39 A;  4XIC A;  2CQX A;  3U2R A;  2PMU A;  3ASN H;  3RQ4 A;  1W36 D;  2KRH A;  2BHZ A;  4B43 A;  1W7P A;  5BS6 A;  1QQI A;  4M71 A;  2QQA A;  1VQ4 I;  3H35 A;  3BZ6 A;  2STT A;  1OR7 A;  3ERE D;  4L0Z B;  1S9H A;  2WTE A;  3L9F A;  3RZO J;  2XIG A;  1D1C A;  4BH9 A;  5F0F A;  2GXG A;  3TOB A;  1R6R A;  2Z1D A; 
#chains in the Genus database with same CATH homology
 1R00 A;  1LQ1 A;  3HOS A;  1LDJ A;  1DP7 P;  3LQQ A;  1SD7 A;  4D0P A;  5ERI A;  3FHZ A;  3H92 A;  1KU7 A;  5D5U B;  2YU3 A;  1U5T B;  3R61 A;  4CO8 A;  5DD4 A;  1I5Z A;  1Z6T A;  3BWG A;  3O6B B;  3WE2 A;  4HLX A;  4U0Y A;  3DPT A;  5K5O A;  4CXF A;  1IZ1 A;  1Q1H A;  4CDG A;  3EUH A;  2DU9 A;  3E5U A;  4I0A A;  1U5T C;  4DNC A;  1J7K A;  5K5Q A;  4WF2 A;  3HRU A;  4HDU A;  3JSP A;  2HR3 A;  2DPU A;  4KYW A;  3FX3 A;  1I1S A;  5BMZ A;  3RTR A;  1XSV A;  2HQN A;  3F6O A;  2PG4 A;  5FLX Z;  2GAU A;  3WGI A;  3GYH X;  1R5H A;  4MGR A;  2DQL A;  2YX4 A;  5HOO A;  2XAG A;  2Q0O A;  3CTA A;  5LGT A;  1S3J A;  1CF7 A;  4RAY A;  3QOP A;  4Y13 A;  2HFH A;  3V8K A;  1HKT A;  5E17 F;  4RGS A;  4LK0 F;  1RI7 A;  1GXQ A;  3N4M A;  1KU2 A;  5J8C A;  4CZZ A;  4MEX F;  5BPI A;  1IAW A;  2M87 A;  3IRR A;  1TNS A;  1XGN A;  5A2Q K;  2MC3 A;  2CW0 F;  1FOK A;  2HYG D;  3E5Q A;  2F5E A;  1H9G A;  3JSO A;  4LLN A;  3R60 A;  5FD6 A;  3IL2 A;  2M5W A;  3E6C C;  5CYV A;  3DXJ F;  2LSO A;  4HF0 A;  3WU0 A;  4EV0 A;  3EET A;  4TV7 A;  1IRF A;  3U9G A;  5CVI A;  2K4J A;  2A5Y B;  5LHI A;  4L0Y B;  5D4S A;  3KZY A;  2L02 A;  3G3Z A;  1R23 A;  2HTS A;  3T0Y A;  4L9J A;  5LHG A;  3FXQ A;  2XAQ A;  2COM A;  1IW7 F;  4B09 A;  2F5D A;  1TQI A;  2JSC A;  4G94 A;  1YTY A;  3WOD F;  2A61 A;  2HS5 A;  2LF7 A;  1G3W A;  5JI6 A;  5HS7 A;  2E7X A;  2A68 F;  1BBY A;  1WQ2 A;  4I7H A;  2OQR A;  5CJ9 A;  3WTT C;  4YFX F;  2BEO A;  4ENN A;  4ENJ A;  1QBJ A;  4IPA A;  1P92 A;  2ISY A;  1YFH A;  1KU3 A;  2HOE A;  5HDG A;  1BJA A;  1FBU A;  4EJW A;  1C0W A;  4A0Z A;  2BE5 F;  3I53 A;  4BHB A;  3BDD A;  3GEZ A;  1P4X A;  3VB2 A;  4PZJ A;  1X3U A;  4LJZ F;  4AWX B;  1XSX A;  4AIK A;  3PFI A;  2VBY A;  4RGX A;  2E7W A;  3K1M A;  3TQN A;  4KIB A;  3GZ5 A;  1TW2 A;  3ECH A;  2QM3 A;  3SXY A;  1J0R A;  4LFU A;  1OMI A;  3HTU A;  2MD5 A;  5TJJ A;  5HVQ C;  4EGY A;  2XAJ A;  4A12 A;  4BXU A;  2O03 A;  2ISZ A;  1IN6 A;  2ELH A;  4EMS A;  3I54 A;  3RKY A;  2DPD A;  4LD5 A;  3KLN A;  3WTU C;  3T8R A;  3RYP A;  2O6G E;  2DO7 A;  3E97 A;  4KNY A;  3LFK A;  2DBB A;  5CVV A;  3HRT A;  3PQJ A;  1D3Y A;  2ZNY A;  2IA0 A;  1FP1 D;  2M45 A;  3GVA A;  2YX7 A;  4HX4 A;  1FYK A;  2NYX A;  3RKX A;  3FM5 A;  3CUQ B;  2GXB A;  5FB2 A;  3E3V A;  4LLL A;  3FM3 A;  4P96 A;  1XDS A;  3OOP A;  2HZT A;  3F6V A;  3C3W A;  3FZV A;  1FYL A;  2OD5 A;  1IN5 A;  3ABT A;  1J9I A;  4L5I A;  3KET A;  3KP6 A;  2VC1 A;  2FEZ A;  4JBA A;  4UV8 A;  1E2X A;  4KN4 X;  3QP5 A;  3ELK A;  1DPR A;  1QO0 D;  3R4K A;  2ZJ2 A;  1V4R A;  4MHG A;  1TTY A;  1FY7 A;  1XGM A;  3ZN1 A;  3J7A O;  1OYI A;  1KQ0 A;  2FNP A;  4EJU A;  2K27 A;  3MEX A;  3F72 A;  1GVJ A;  4KIC A;  3RPQ A;  2Y48 A;  1UST A;  1BI1 A;  3JAM Z;  3ISP A;  1STZ A;  4G6D A;  3KZZ A;  3CUQ A;  1UFM A;  1FZP B;  1T38 A;  1Z6R A;  2QZ8 A;  4KIF A;  3LA7 A;  3TDU C;  1J2X A;  1QNT A;  5CVJ A;  5DEQ A;  3VOE A;  2O0Y A;  2XUB A;  1NHA A;  2V1X A;  1HW1 A;  5E1Z B;  2PN6 A;  4HDV A;  3RPU A;  1MJB A;  4HQM A;  4N0B A;  4EJV A;  3DEU A;  1W5T A;  5CVR A;  3TO7 A;  2XAH A;  3R6S A;  5BQT A;  4ETS A;  3GLX A;  2F5C A;  2JPB A;  2AS5 F;  4P5O A;  2FQ3 A;  2Q2E A;  2ACJ A;  2PJP A;  3TDZ C;  5LRR A;  1JE8 A;  3WE3 A;  1W5S A;  5F64 A;  5DDG A;  2QYO A;  2VE9 A;  2P5K A;  3K1P A;  1ZGA A;  1O3R A;  5D5W B;  5L3F A;  3QPT A;  2P8T A;  3WTY C;  3KCC A;  3C7J A;  3DQV C;  2GWR A;  2FMY A;  5DCM B;  4ZYE A;  2ZFW A;  1XGO A;  3WTS C;  3V8J A;  4RGU A;  1W7P D;  3I5U A;  4FHT A;  4JK1 X;  3HYI A;  1RZ4 A;  5L3D A;  2VBX A;  3ECO A;  4LG0 A;  1GHC A;  5H6Q A;  1LDK B;  5BOX A;  4Z2Y A;  4M72 A;  1SD6 A;  4CYD A;  3GXO A;  3CO7 C;  3ZN0 A;  3JTG A;  1QZY A;  4I0B A;  1L0O C;  5ILU A;  2UXN A;  5J8F A;  2OBP A;  3HOT A;  4OMZ A;  1V3F A;  4ENK A;  4GCV A;  1B9N A;  1BN5 A;  3TO9 A;  1FNN A;  3I58 A;  2IP2 A;  3DFG A;  5FGM A;  1K79 A;  2ZBK A;  1JHH A;  2CFX A;  2XVC A;  3RYR A;  2VBZ A;  4WX9 A;  5IT9 Z;  4EM2 A;  5IT3 A;  3KP4 A;  1A04 A;  1G6N A;  1MKM A;  3RIR A;  1HBX G;  4LGW A;  2CG4 A;  2MLK A;  3BP8 A;  4BHP A;  1K78 A;  1LJ9 A;  3HUG A;  5TRD A;  4I2O A;  2VBW A;  4IRI A;  1G3Y A;  3GFM A;  1PUE E;  5E8G A;  4Q47 A;  1D8K A;  3WGH A;  3FWE A;  4IF4 A;  1XMA A;  2KIU A;  5ED4 A;  3L00 A;  1SMT A;  4OU0 A;  4BNC A;  2J5O A;  2Z33 A;  4MQ9 F;  2P7C B;  2QLZ A;  2A3S A;  2EFW A;  4WWC A;  4H0E A;  1XB4 A;  4A2U A;  4YFN F;  1AWC A;  4HBL A;  4LG0 B;  4LK1 F;  2FBK A;  4O5V A;  2Z3Y A;  3FMQ A;  4Y15 A;  2ETH A;  2ZME B;  4M6Y A;  3IHU A;  3HIF A;  3F3X A;  2YPR A;  3ZQ7 A;  4CGZ A;  4RB3 C;  4ENM A;  3HSR A;  1ULY A;  4I01 A;  1F1Z A;  4RB1 A;  2ZKZ A;  3K2Z A;  5J6X A;  2GZW A;  1MGT A;  1YQA A;  1HKS A;  3FMS A;  5HDN A;  1SFU A;  2ADU A;  1IN4 A;  3L7W A;  3P9C A;  1EH7 A;  2Y75 A;  4OOI A;  1Z91 A;  1S8N A;  3V7S A;  1ZRE A;  4WXD A;  1H0M A;  4ZZL A;  4L9N A;  3I59 A;  5FFX A;  3P7N A;  5D8L B;  2IPQ X;  1U6G A;  5E1W A;  3ROU A;  1U2W A;  2BYV E;  1IXS B;  4BAY A;  4U0W A;  1ZN2 A;  4Q5S F;  2G7H A;  4WXC A;  5K5R A;  2HEO A;  4K2E A;  1CGP A;  5E1X A;  2KRF A;  2DFI A;  4M74 A;  2M1B A;  3DF8 A;  3IWZ A;  4OIN F;  2Z9O A;  1PP7 U;  2IA1 A;  2JPC A;  2V1D A;  4RB2 C;  4MNU A;  2H09 A;  1IRG A;  4HF1 A;  4ESF A;  2XKO A;  4EM0 B;  2LNB A;  3ML6 A;  2RKH A;  3LST A;  3FMR A;  4P9F A;  5K1Y A;  4U7D A;  4A5M A;  1F4K A;  4LB5 A;  2RC4 A;  2R7D A;  3ZMV A;  4IXA A;  3WTW C;  2GIV A;  4ZYG A;  4LMY A;  2CQK A;  1YLF A;  2V6C A;  2X4H A;  5FD5 A;  4E70 A;  1YW8 A;  3VEP A;  4O6J A;  3K9T A;  1IXR C;  2UWM A;  2BBY A;  3G73 A;  4Q4Z F;  2IT0 A;  4F7Z A;  4OIQ F;  2XKP A;  1UHM A;  2QVO A;  1FSE A;  2XRO A;  3CLO A;  2X0L A;  1G4D A;  1MZB A;  5ICE A;  2HKO A;  3T8T A;  1K6O A;  2HYF A;  3LAP A;  3J81 K;  1MDM B;  2G9W A;  3M9A A;  1P4W A;  2WWY A;  1U8R A;  1Z9C A;  1JHF A;  1Z05 A;  2ZME A;  3HSF A;  3EQL F;  2Z5U A;  1RIO H;  4XLN F;  3TOA A;  3KP7 A;  3TO6 A;  3F8M A;  3AAF A;  3E6B A;  3ZPL A;  2B0L A;  4AVP A;  5ICF A;  5HDK A;  5JHU A;  3M1E A;  1ZG5 A;  5AIQ A;  1FPQ A;  4PGH A;  4R1H A;  1J59 A;  3O2P E;  3J80 Z;  2A6E F;  1I1G A;  1FLI A;  1E17 A;  5E8I A;  1I27 A;  2FU4 A;  2MH2 A;  2A07 F;  2VN2 A;  1LEB A;  2D1V A;  1TNT A;  4ZYH A;  5D6E A;  1J75 A;  3QRF F;  4OMY A;  3M7G A;  3QPH A;  3GFL A;  1TBX A;  3QP6 A;  1ZRD A;  3E6D A;  3ZMT A;  2L4M A;  1VTN C;  4PGG A;  2RQP A;  2M8E A;  4Q48 A;  1CF7 B;  2NNY A;  5D4R A;  2K86 A;  4IHS A;  4G7O F;  2M30 A;  3CJN A;  3ABU A;  2ZO4 A;  4HA8 A;  1ZLJ A;  4R8H A;  1G3S A;  1B1B A;  1S6L A;  3M8E A;  3ZMU A;  4BQA A;  2PFB A;  1HSJ A;  3I64 A;  1WKM A;  3BJA A;  2P5V A;  3GUD A;  2FNA A;  2PI0 A;  4BHC A;  2PMH A;  4HX8 A;  2VOO A;  3EYI A;  3FXR A;  2HWV A;  3GZ6 A;  2H6C A;  4XBF A;  2A69 F;  4IJA A;  5HLI A;  5LGN A;  2RDP A;  4EJO A;  1B6A A;  4WK8 F;  2D1H A;  2EFN A;  2JZY A;  2FSW A;  1XCB A;  1U5T A;  1ZG1 A;  1JGS A;  1F5T A;  4CHU A;  1HQC A;  3I59 B;  4KN7 X;  2FA5 A;  4ASN A;  1O7L A;  4A6E A;  1G3T A;  2PEX A;  1RNL A;  1DDN A;  3F8N A;  3BY6 A;  2BGC A;  3B73 A;  3J81 Z;  1LB2 A;  2H94 A;  1EH8 A;  2Y0M A;  3JTH A;  1XD7 A;  5JFR A;  1PDN C;  3JW4 A;  3R0J A;  5LBQ A;  1R22 A;  2YR2 A;  1HXD A;  1ZRF A;  3SHF A;  4A5N A;  2XAF A;  2AXL A;  4EQQ A;  5DUI A;  2IRF G;  3MZH A;  3KE2 A;  3D5L A;  2ZNZ A;  3S2W A;  4EGZ A;  3I0T A;  1B4A A;  5JVT A;  3OV8 A;  2W57 A;  2FRH A;  1FBS A;  3QU6 A;  2NNN A;  5KVR A;  4YFK F;  3DP7 A;  1FSH A;  3FF5 A;  5D5X B;  1UCR A;  1O3Q A;  5E18 F;  2Q8K A;  2VOD A;  3B02 A;  1Z7U A;  4CIC A;  5CLS A;  6PAX A;  2FF4 A;  1ON2 A;  1WRJ A;  2EA4 A;  2OZ6 A;  4HYE A;  5ILV A;  5JR3 A;  4HQE A;  2XGX A;  3F8F A;  2EV5 A;  1T2K A;  3RKW A;  1XGS A;  1R58 A;  2E1N A;  3NQO A;  3U1D A;  2QUF A;  1H9T A;  5DV5 A;  3H3Z A;  3RDI A;  1MJ9 A;  4IRH A;  3WTV C;  3FXU A;  3ZMD A;  3RJP A;  2W24 A;  4EVI A;  4IHT A;  2D2W A;  4MTE A;  2IJL A;  3GO5 A;  4M9S A;  5F6F A;  2PBI A;  3N97 A;  1BC7 C;  1XDU A;  4EM1 A;  4XLP F;  1RUN A;  2GQQ A;  2EFP A;  1ZAO A;  1BC8 C;  1LVA A;  2QQ9 A;  4KT5 C;  5D6F A;  2KIM A;  2FML A;  3LA3 A;  1T98 A;  3LQR A;  5H20 A;  5A2Q Z;  3REO A;  4P9U A;  5DD8 A;  5CVU A;  5HLH A;  2EV0 A;  1SFE A;  4KUM A;  1Z1D A;  2K7L A;  1SD5 A;  2KIF A;  2NS0 A;  4UVB A;  1MD0 A;  5FLX K;  2VXZ A;  1WI9 A;  1BI0 A;  2VON A;  5DUK A;  5LLQ A;  1S29 A;  2K02 A;  2OA4 A;  2JT1 A;  3V4G A;  3MWM A;  4QWQ A;  2IW5 A;  3ZP5 A;  2WV0 A;  5EEG A;  3KFW X;  3BJO A;  1KQ9 A;  2MA3 A;  1DPU A;  3Q9S A;  3SZT A;  1KYZ A;  2FOK A;  3HRS A;  3K0L A;  3TKY A;  4BYY A;  5L3C A;  3F8B A;  3VOD A;  4U7B A;  4HV6 A;  5ILS A;  1O7F A;  3BJ6 A;  4HLY A;  2G7U A;  3KLO A;  2STW A;  3GFI A;  3WTZ A;  2XRN A;  4RGR A;  3WGG A;  1XMK A;  3P9I A;  5HS9 A;  1HW2 A;  5F1R A;  2HQR A;  4WXH A;  1O57 A;  2HTJ A;  4KMF A;  3KP2 A;  1SMY F;  1HW5 A;  2F2E A;  4UUV A;  3HRM A;  1KA8 A;  1D5V A;  1TQM A;  5HLG A;  1R36 A;  4GXO A;  3NRV A;  4I02 A;  4P55 A;  2DK8 A;  1YO5 C;  2EFO A;  2ESH A;  5ICC A;  3BPX A;  4UVC A;  4ZH4 F;  3SFZ A;  3F23 A;  2J5P A;  5FFZ A;  1FT9 A;  2IVM A;  1ZGJ A;  3HTS B;  2PLY A;  5DYM A;  1JXS A;  3I4P A;  1T0F A;  4A0X A;  1RUO A;  3MQ0 A;  2E1C A;  1SFX A;  1IXC A;  3F8C A;  2P4W A;  4EJT A;  1D8J A;  3I71 A;  1S7A A;  1KU9 A;  1REP C;  1ZAR A;  4I09 A;  2EJR A;  1ZHF A;  1GXP A;  2UXX A;  1YIO A;  2FBI A;  2RN7 A;  4HAM A;  1XSD A;  4HX7 A;  1UB9 A;  2O3F A;  2FBH A;  3RI4 A;  5H6R A;  3QAH A;  1LDD A;  3GX4 X;  3IC7 A;  4ESJ A;  4M9X A;  1YW7 A;  1I6X A;  3MAJ A;  2CO5 A;  2OAZ A;  2H6B A;  2QEN A;  2HDC A;  4G8X A;  4PDK A;  1U78 A;  2QBY B;  4OIP F;  2R3S A;  3C18 A;  4IVN A;  2QQB A;  1EV7 A;  4UV9 A;  1XN7 A;  3WU1 B;  1LNW A;  3M8F A;  3HHG A;  2MH9 A;  4KMU X;  1B9M A;  4I98 B;  2DW4 A;  4ON0 A;  3Q9V A;  4GYG A;  4NQW A;  3K69 A;  5FO5 A;  3MCZ A;  1IUY A;  3SZP A;  3BPV A;  3MZY A;  1ZH5 A;  2DLL A;  2V79 A;  3IWF A;  4RAZ A;  3CUQ C;  2LDU A;  4UNO A;  3EDP A;  1R1V A;  3GW2 A;  4RB0 A;  4MEY F;  1EH6 A;  3GWZ A;  2EK5 A;  1L3L A;  1YYV A;  4UHT A;  3KP5 A;  3GF2 A;  5KK1 A;  2DAO A;  4FX4 A;  2MBF A;  4G7Z F;  1FBQ A;  1OPC A;  1J5Y A;  5DCM A;  1QGP A;  3K1N A;  2OU2 A;  1IN8 A;  5LHH A;  2FE3 A;  2XHK A;  3V8L A;  2JTV A;  2DK5 A;  1ZRC A;  4L9T A;  3DPL C;  1BM9 A;  2P7V B;  1SD4 A;  2L3D A;  3LWF A;  2W25 A;  2P5L C;  1BIA A;  1WWX A;  1KYW A;  3ZMZ A;  2DT5 A;  4NB5 A;  1MDM A;  5AIP A;  2WC2 A;  1HST A;  4HV5 A;  5IT9 K;  5LEJ A;  4HW0 A;  1HKQ A;  4KDP A;  1Y0U A;  2CGP A;  1R5G A;  4MTD A;  2QBY A;  2NRA C;  4FT8 A;  2O8X A;  3Q5F A;  2RNJ A;  4AIJ A;  1F9N A;  2HGC A;  3MFK A;  4B8X A;  1IN7 A;  1ON1 A;  3ZMS A;  2D45 A;  4MQV A;  2V1U A;  2C6Y A;  1UHW A;  2ZCW A;  4AIH A;  1OKR A;  3CUO A;  3HHH A;  2CSO A;  1B59 A;  2UZK A;  1P6R A;  3L09 A;  1ZYR F;  2KJC A;  1YS7 A;  1WSU A;  2L4A A;  1TQP A;  2F5F A;  1ZG3 A;  3LA2 A;  1K78 B;  1BI2 A;  4A0Y A;  3HSE A;  1P4A A;  1K7A A;  4RS8 A;  4HF2 A;  4HOB A;  4S04 A;  3WTX C;  3F22 A;  1BIB A;  1QZZ A;  3GFJ A;  1YG2 A;  3TGN A;  3V7R A;  2VE8 A;  5AON A;  2CYY A;  3D0S A;  3COA C;  4PCQ A;  2GA2 A;  2K4B A;  3E5X A;  3IKT A;  2V9V A;  2W84 A;  2P6T A;  2H27 A;  4XSZ F;  2EB7 A;  3WG9 A;  4HZF A;  2RV8 A;  4ZYD A;  3R0A A;  3NEU A;  1AOY A;  3CO6 C;  4G7H F;  3QU3 A;  2EFQ A;  2Z99 A;  1T6S A;  2O61 A;  1S7O A;  1FWZ A;  2OQG A;  2P6S A;  4G9Y A;  3P9K A;  1R1U A;  3PQK A;  2RGV A;  2FXA A;  3H3U A;  3ULQ B;  2XAS A;  1MJA A;  3L2C A;  4ZZD A;  3T1B A;  2VOP A;  2VT2 A;  3CDH A;  2GA1 A;  4KIG A;  3DV8 A;  3KEO A;  4N9I A;  2HKX A;  2VT3 A;  4NHJ A;  1KGS A;  2KJB A;  1DUX C;  4KFC A;  5ICG A;  5LEK A;  4O3M A;  4FX0 A;  2EWN A;  1OYY A;  3T5X A;  2YSR A;  3F21 A;  2MLG A;  4ESB A;  1USS A;  1W7P B;  3BRO A;  2RVC A;  4QLC U;  3W6J B;  4OIO F;  2JRT A;  3J80 K;  2LKP A;  4N9H A;  2IA2 A;  2NAZ A;  4S05 A;  3IKV A;  1W4M A;  5D5V B;  4L9V A;  2DI3 A;  5L3E A;  1ODD A;  4L5J A;  1SAX A;  1BOA A;  4R79 A;  3KP3 A;  2EA2 A;  3VFZ A;  3LAJ A;  1FYM A;  4LLG F;  4YIF A;  1R7J A;  5L3G A;  2DQR A;  4GO1 A;  2XV4 S;  4IRG A;  2VC0 A;  1PP8 F;  3KEQ A;  4KA4 A;  4U0V A;  2OZU A;  2TDX A;  4UXN A;  5D8K B;  5EEH A;  1YS6 A;  2PQ8 A;  2L01 A;  4UVA A;  1FP2 A;  1TW3 A;  3IRQ A;  1ONV A;  4M73 A;  1ZLK A;  5HS8 A;  4Y17 A;  5DCF A;  3V7C A;  4G6Q A;  2KKO A;  3C1D A;  2L54 A;  2A6H F;  4JQF A;  4WCG A;  2CWE A;  1FX7 A;  2W85 A;  3E6M A;  4A6D A;  4OIR F;  1OYW A;  4YG2 F;  4GYI A;  1O3S A;  1XCV A;  4XRF A;  1YW9 A;  2DTR A;  1IF1 A;  5L3B A;  3EYY A;  1R1T A;  4GGG A;  1U3E M;  4M6X A;  4AD9 A;  3O3K A;  1FC3 A;  3DKW A;  1QPM A;  2R7F A;  3SQN A;  5LGU A;  4DQ2 A;  1BI3 A;  4L18 B;  5LRS A;  2LF8 A;  5E20 A;  2EV6 A;  4LB6 B;  2QWW A;  4YII A;  1P2F A;  2ZXJ A;  4U88 A;  3BOQ A;  3JAM K;  3W6K B;  4XSX F;  1LEA A;  2ESN A;  1KQ8 A;  1O3T A;  2BV6 A;  1TLH B;  5BPD A;  4M9Z A;  1T39 A;  3U2R A;  2PMU A;  1W7P A;  5BS6 A;  1QQI A;  4M71 A;  2QQA A;  3BZ6 A;  2STT A;  1OR7 A;  3ERE D;  4L0Z B;  3L9F A;  2WTE A;  2XIG A;  4BH9 A;  2GXG A;  3TOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...