2XF5A

Crystal structure of bacillus subtilis spp1 phage gp23.1, a putative chaperone.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
49
structure length
49
Chain Sequence
b'SESLLYGYFLDSWLDGTASEEMMRVAVNAGDLTQEEADKIMSYPWGAWN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP23.1
publication title Crystal Structure of Bacillus Subtilis Spp1 Phage Gp23.1, A Putative Chaperone.
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
total genus 13
structure length 49
sequence length 49
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xf5A00
2XF5A 2XF6A 2XF7A
chains in the Genus database with same CATH superfamily
3S2HJ 3K70D 3TOAA 3OIQA 1JJ8C 3IL2A 1P92A 1MH3A 2M1BA 2BGCA 1GXPA 2K9LA 4OU0A 2EFPA 5EDNA 2O3FA 2K9SA 3CCYA 4PSWA 2D1VA 4DYRA 1WI9A 3HG9A 3WG9A 3BCBA 1ZLKA 1OCZH 4CCOA 4HPQA 3LA3A 2DFEA 3ABMH 1P6RA 5LLQA 4IX7A 5J8CA 2STWA 1JJ6C 2IRFG 3TO7A 3LAJA 1XMXA 1EJ9A 1R5ID 3LSGA 1H9GA 3DEWA 4RB1A 1Y56A 2MGQA 2A07F 2OBPA 2CS3A 1Q1HA 3IWZA 5M5WJ 2WAQA 5CVRA 5BPDA 3I64A 2JZYA 4I0AA 3P9CA 1XGOA 2ZB9A 1OLTA 1E17A 4BBRJ 2VJIA 5LEJA 5LD2C 1BN5A 1JHFA 3I3LA 3PNTA 1R9TJ 5LHGA 1TNTA 2DN0A 1R49A 1PUFA 1UAAA 2R93J 3GLXA 3MZ8A 4XICA 3IV5A 4C3HJ 5B5EC 3CCSI 3M8JA 2NNYA 4ZYEA 3A03A 1FP1D 3TDUC 2DT5A 2DTRA 3D5SC 2M4GA 2HS5A 2FU4A 5KAFC 1NG7A 4RB0A 4ABZA 5FJ8J 2E34A 2EBIA 3L09A 3WE3A 1FOXA 4I0BA 1QGPA 1S7OA 2ZSIB 5ILSA 3Q3SA 2KMUA 3UR3C 1SAXA 3CJRB 1GDTA 1A5JA 5HLGA 2P81A 2W48A 1FLIA 2ME0A 2DTZA 4I99C 4MEYF 4L9VA 1H8AC 1RR7A 3LQRA 3GTMJ 3TEDA 2CQKA 2B0LA 5KVRA 3JRGA 4EJWA 5DYMA 4A93J 3H36A 4A3BJ 1WH7A 2WAQN 1YRNB 3V7RA 3OMYA 1TNSA 3JRFA 2IGKA 2BOLA 2R7OA 2HWVA 3DTEA 1YHQI 2BY1A 1LVKA 1T6SA 2VBYA 3NEUA 4RAYA 2GQQA 4I6ZA 3C3WA 1KGSA 3RIRA 4AIKA 1VQLI 4G94A 4A3JJ 3H5NA 2HYGD 4PK4A 3QPSA 5HDNA 1ZH5A 2A5YB 3H35A 2DAOA 2R7WA 1JTXA 2NXNB 3JRCA 2V9KA 4DW6A 2E2JJ 3WGGA 2PBIA 2KRHA 1YX5A 4QPQA 2L54A 4A6DA 2DPDA 3GTQJ 4MHGA 1TZLA 3I59B 2Z5UA 2XAFA 3J80Z 2L0KA 2LMDA 4M72A 4M6YA 5DM7F 3KFWX 1VNDA 4NB5A 3J80K 3BG7A 3OYDA 3HB9A 4IPAA 3O3KA 5HLHA 1ETKA 3CQZJ 5EZHA 3I56I 2LTPA 4IHXA 3IUOA 2EB7A 2K5CA 3FKJA 2L7KA 4X0GA 2ESNA 2KZGA 1DQUA 2A6EF 2HDDA 2CQQA 2K7LA 3CJTB 5IY5H 3L2RA 2K4BA 2XRLA 3H3ZA 3SJMA 1HKSA 1OISA 2ZXWH 2PMUA 1UHSA 3NQOA 2ACJA 5ERIA 2PG4A 1YFHA 3PL8A 4M3EA 2JA2A 2M45A 2DW4A 4KJZA 4NQWA 2ME6A 3RKXA 3VDXA 3K2AA 4PGGA 1MGTA 2HPMA 2LFBA 5CQGA 1IJWC 2CUJA 4HX8A 1BM9A 1UHMA 2H09A 4CUGA 1FOYA 3VYRB 3I4MJ 3FHZA 4A5MA 4V2FA 1LKXA 2W82A 2XPWA 2RN7A 1AOYA 1S6LA 1AKHA 4KT6A 2VI6A 5ICGA 5EZGA 1IDZA 4IZZA 1YLFA 3BG9A 1G3YA 2CUZA 1TP4A 4NHJA 4KITB 1B72B 1S7EA 4RGUA 1KQ9A 2ISYA 4YIFA 5EEAA 3R0JA 1V5GA 2R5YA 1T95A 1K6YA 4PDKA 2JVGA 2V26A 3AG3H 4HDUA 2FNPA 3QU6A 4BS9A 1QZEA 1UG0A 4C2UA 3KYDB 2I10A 1WJFA 4IXAA 2EJRA 3MN2A 1TWAJ 3AG2H 3KP3A 3K4MA 1S29A 3G73A 2PEXA 1W36C 3PNYA 4M9XA 3VSKA 2KLOA 2XHKA 1LEBA 4L5IA 2I5UA 2HVRA 4Y33A 4LLLA 1A6IA 2KISA 1QVTA 4EM1A 2A6HF 2FF4A 3TBIA 2GIVA 3MZHA 2DOAA 2FBHA 2ADUA 1FBQA 1ORKA 1EH7A 4OAYA 1OKRA 3U1KA 2DXIA 3CC4I 2V1DA 3QRFF 4BUPA 3EPZA 2VONA 1TWHJ 1J7KA 1ZLJA 2EA4A 1YQAA 2BE5F 1JKOC 1MZBA 1XS9A 2XROA 4NC8A 3C2GA 3H3VK 1A31A 5J1YA 1W0UA 2ZSHB 1TQPA 1UCRA 1NH3A 2CJJA 3S3NA 4KDPA 4XKCA 2L9RA 1HC8A 5EF6A 4G6TB 4LITA 3GW2A 1USSA 2CH0A 4JX4A 1BBYA 3T5XA 2KL4A 3T8TA 4HV6A 4BYYA 1FTTA 4BXXJ 3CMYA 2V4JC 3HM5A 4MGRA 5HVQC 3KZIC 4Y52J 3GFJA 3F6VA 4YRVA 3PM1A 1R6RA 2RAEA 5F08A 1IG7A 2CFXA 2YPRA 1VQ9I 2E2IJ 2HOSA 3OR1C 3S32A 1E0EA 1KQ0A 1ZYRF 3C1DA 1AWCA 1HF0A 3QPTA 4HLXA 4E6KG 2QKLB 4BH9A 3R61A 4XKBA 1F1ZA 3L2VA 3WTUC 1HDPA 1K78B 1UJ8A 3HDDA 1SD4A 1RIOH 2AXLA 1KU7A 5EGOA 1OJLA 4EJUA 4XL9A 1F9NA 3MMYB 3MCZA 1IO2A 3LSJA 1N75A 5DCFA 2HKXA 4B8XA 1ZREA 2DU9A 4BL0B 2XF7A 3CC7I 3I59A 6PAXA 2K86A 4IRGA 3SFZA 4CYCB 4RGSA 1X1DA 1VZ0A 5FO5A 4C2TA 2FE3A 2E1MB 3E6BA 4UVCA 5E8IA 4OIPF 1RETA 3ZQCA 4QWQA 3SZPA 4Y7NJ 5EG0A 1IXRC 3FWEA 2V1XA 5HNFA 2KP6A 4A0XA 3CJQB 1I6XA 1RZ4A 2UV1A 3HPGA 3N05A 1G4DA 5IT3A 5LBQA 4MO7A 1SFEA 2BZTA 2ZFWA 2JUGA 1PDNC 1LPQA 4U0VA 5JFRA 2JA8J 3EUKL 3ZMZA 3QYEA 3TGNA 3DWLE 2O7OA 2DMTA 4ENNA 2DYSH 5CJ9A 2CO5A 1XG1A 2A61A 2CU7A 2BW3B 2VN2A 3DXJF 2CMPA 3K69A 3U2RA 2GOXB 5GPAA 5IP6A 1ACIA 1F36A 1ZN2A 3GTJJ 2M7AA 2F6CA 4RB3C 5H2FC 1A35A 2K02A 3VYUB 4M3FA 1MW7A 4GRIA 2Y31A 3ZP5A 3DF8A 3K2ZA 2OC6A 3U9GA 1FTZA 3F9KA 3LSIA 3I0TA 3BJAA 3BLYA 3DLAA 1HW1A 4FX0A 3SYTA 3KYLA 1E3HA 3KIOA 1JGGA 3OIOA 4NBQA 2K3FA 4B1RA 2Y30A 2WTEA 1YW8A 2W7NA 1BJZA 1R5HA 5HOOA 1XDSA 4F55A 5EJCA 3DBLB 5B1AH 1Y39A 3KEOA 5F27A 4LOCA 4QLCU 3BG3A 2NVUB 1U2WA 3EQLF 1IV6A 5L3GA 2M34A 2J5PA 4B4CA 3MAJA 4M6VA 4GFBA 4H4KC 1WFXA 3RPQA 1GXQA 1V55H 2LY1A 4E7IA 2IGNA 5DEQA 4ZC3A 3JSOA 4A3LJ 2HQNA 2LP0A 4LJZF 1VQ5I 1UFMA 1YE9A 2E7XA 2MLKA 3HSFA 3ZOBA 4XIDA 4CYDA 3S1NJ 2DJIA 2G0EA 2KKOA 3F21A 1V4RA 3WU1B 5K7ZA 3W2AA 1IDYA 1YS7A 3BP8A 1JT0A 2P7CB 1ETWA 1W36D 1T8IA 4XLFA 4RB2C 1G59A 4UUSA 1MBFA 5JVGF 2YX4A 2MFZA 3QPHA 1GLNA 3HYIA 1IF1A 1W5CC 2H1KA 5A2QK 1YYVA 3HOTA 2LC2A 3L9FA 2ZNZA 5CVUA 4M9ZA 1UMQA 1HOMA 4A3MJ 4BDYA 1SFXA 4RAFA 3JRDA 3K70C 2R5ZB 4FQGA 4J01A 4ESFA 4HG2A 2XAJA 4MEXF 3I58A 2FUG2 2P7VB 1MJ9A 2XASA 4M3GA 4P1WA 4MFEA 3F8BA 5ICEA 4ENKA 2JWTA 4WXCA 3ABTA 1XB4A 1G3WA 4GO1A 5E18F 4YEJA 3J81Z 4L5EA 1B9NA 3OOPA 2BBYA 4O5VA 3J81K 4B43A 1BL0A 2WY8Q 4G7OF 1MMGA 1O3QA 3PIPF 3F8NA 3T0YA 4F92B 2QA4I 1MH4A 2M8GX 3I4NJ 4LIVA 1JI8A 3RKQA 4B44A 3SQNA 4D5CA 1P2FA 2UUZA 3JREA 2BYVE 4HF2A 3RZOJ 1Y8RB 2XIGA 3HBLA 3A01A 2DDAA 4ENMA 2MC4A 1WHUA 4WXHA 2GWRA 2RNJA 4HX4A 2LF7A 4RA2A 3VEPA 3CDHA 5DUKA 2KQRA 1RKTA 4BAYA 2DFHA 3ZPLA 3OYBA 1NK3P 1FIPA 1DU6A 3HEFA 2OTLI 1V3FA 1T98A 4WWCA 3BDDA 5L3EA 4CYCA 4KFCA 3FK7A 1BI2A 1S8NA 2JVHA 3SEQA 1YJWI 3Q0VA 1MSFC 4PZJA 2JRMA 3ROUA 1FC3A 3F22A 1ITYA 2DK8A 2DJNA 3HRMA 5FFZA 5JR3A 1ZGWA 1IW7F 3ISPA 4HF0A 3N4MA 4RM2A 2EK5A 3GCMA 3KZZA 3JCUC 2WADA 2XPUA 3MFKA 2D1HA 2KRFA 1IGNA 2QBYA 1VQNI 5JLWA 5B66C 3J7YJ 3H92A 2AQEA 1YJNI 3W6KB 3S2DJ 1QHGA 1RNLA 3ZMDA 2YSRA 2ZJQF 1JKRC 4ETSA 4F3QA 4I09A 4JQFA 2FJ1A 1LNWA 2BY3A 1PVEA 2CUEA 3SXYA 2Z33A 3OL4A 1ZG3A 1B4AA 2ZMEB 4EATA 5IOYA 3BR3A 3M8FA 5LRSA 2F5CA 1CF7B 3TW6A 1MMDA 4KICA 1ON1A 4CA0A 4BEHB 2DT6A 3D0SA 3OYAA 3DPUA 3I4PA 3M7GA 2V7FA 4BE1A 3U1DA 4XLAA 5FB2A 3D1NI 4P55A 4YIIA 3DKWA 4JX5A 3SDBA 3KLNA 1TQIA 2LRDA 3OV8A 4S04A 3J7AY 3OYNA 1U3EM 4DQ2A 1TWFJ 2XPVA 4QSHA 2QM3A 3EYIA 2IA0A 2DOEA 4GXOA 2XSDC 1MNMC 3GFLA 1R23A 2IT0A 2BY2A 3H3UA 3IRRA 3GFIA 4AIDA 1J2XA 5FKMA 5D4RA 4IQ4A 3LSMA 3WTYC 1YJ9I 1ETQA 3C2HA 4M9SA 2CV2A 3BROA 3K10A 1OYWA 1ZK8A 4KIGA 3PNVA 3FM3A 4KMFA 3ZRGA 2MG4A 2JQ7A 1X1BA 2L4MA 5DCMA 5GAGJ 2DA2A 3PO3J 3BR1A 2DMNA 4F91B 4LFUA 2O6GE 2DMUA 3GX4X 5C4XJ 2DO7A 4IRHA 3MKLA 4NQWB 3KE2A 4B3AA 2MH9A 1XN7A 4II2A 5HS7A 2DOFA 5D5UB 2R0QC 3MWMA 2XV4S 3H5RA 4Y17A 4ESBA 2EZIA 1Z3YA 2R5ZA 3JW4A 3GLLA 3K4KA 2EZKA 2FQ3A 1JKPC 3GTLJ 2K9NA 3MQ0A 3A1YA 2PJRA 4PJMA 4BY1J 4BHPA 3DU6A 3TO9A 3JTGA 3QAHA 1O3RA 3HKZA 1ULYA 3AL0B 4D0PA 3HOWJ 2KDZA 4ZDLA 5LFAA 4FASD 5LGUA 1IN7A 2R5YB 3FHNA 2E1NA 1JE8A 1B1BA 4IHWA 3B6AA 2VJ5A 2WWYA 3KP2A 3HSEA 1FZPB 4P9UA 3OWTA 2XC7A 4BACA 1OR7A 4L0YB 1H9TA 4IEJA 1L0OC 1DU0A 5EEGA 2AHQA 1ZR2A 3CO7C 4HYEA 3BTCA 2B63J 4DYCA 4DBRA 1P4XA 4EM2A 1KQ8A 3AAFA 2NVYJ 2QGUA 3ZMVA 2E7WA 1WGXA 4NDLA 5DS9A 2A68F 4KN7X 2DQRA 1T39A 1RRJA 1KZHA 3F8MA 4I01A 3K9TA 4BQNA 1MKMA 2LK2A 2R4GA 3CD6I 2E35A 4HRIA 3ABKH 4CH7A 4U7DA 5BS6A 2F5VA 4WXDA 2OA4A 2EV5A 1GVDA 2EZHA 3FIWA 2HOTA 3GVAA 2GXAA 2X6XA 5J1UA 2Z9OA 1SD6A 3LA7A 3HKZN 3G1OA 2MD0A 5GADJ 3IP4B 3CMMA 2F4MB 2CGPA 2ECCA 4D9JA 1T0FA 2M2EA 2MD5A 4IRIA 1WJDA 2NVTJ 1Q1VA 1Y1VJ 4X6AJ 4E70A 3NARA 2CQXA 3FXLA 2M87A 1OQYA 1DDNA 5CQEA 2Q2EA 2VC1A 3SEZA 5K7HA 3RDIA 2J5OA 3RQIA 5LGTA 1VI0A 4KA4A 2H1LA 4IO9F 1IXCA 3HRUA 2ZMEA 4XLCA 4R79A 4ZYAA 3TDZC 3L00A 4BJ5C 1VQKI 3M1EA 4JP0A 4MTEA 1G8XA 4ZYDA 3ELKA 1CF7A 3ABLH 3FXQA 3I54A 2UWMA 1U0JA 2OCCH 2QSHX 5IT9Z 3V7CA 2RVCA 4BEHA 2Y48A 4EVIA 1CGPA 2KJBA 1VQPI 1OFCX 2DFFA 2OPTA 4L9TA 4RLFA 5IT9K 2RNGA 4UB6C 3ZQ7A 5E3OA 1HLVA 2F4IA 4EJTA 5FLMJ 2IW5A 2L4AA 4KNYA 2A69F 1X3UA 5EGOB 3CMEI 2D45A 4LLNA 2LF8A 2WY7Q 2V9VA 3NRVA 4UUTA 2O0YA 3DBRB 5DTDA 2XAGA 3FMRA 4QTRA 5GAHJ 3LAPA 1VFCA 1H88C 4JOMA 3IC7A 2IGMA 2FMLA 2FXAA 3R0AA 3ZCOA 3P9IA 4CHUA 1X4PA 5IYBJ 5HLTA 3LSHA 1UHWA 4XLEA 3E6CC 5LHIA 2R3SA 4IOCF 3FISA 3VOEA 3LFUA 4WF2A 2HXOA 4B48A 4RGRA 5EG0B 5BOXA 3RCOA 3VWBA 2FOWA 3DCFA 3EUHA 3SDGA 3MEXA 2O9LA 3G71I 5HS8A 3TMOA 4WK8F 3BZCA 1REPC 1WPKA 4ZDOA 1Y0NA 1QRYA 1X3WB 3KCCA 2H6CA 2IA1A 2K40A 1FYLA 3MKWB 2L01A 1MSEC 1LDJA 2L9NA 3TKYA 2L3DA 4XRFA 3E0JB 2IA2A 2EV0A 2E36A 1IN4A 4L5JA 4F7ZA 2LY2A 3ECHA 1LFPA 2LSOA 1D8JA 5E1ZB 4YFKF 1QZZA 1HSJA 1KU2A 3AFHA 1NHAA 2L7MP 4AC0A 3GZNB 2BXYA 5J8FA 3T1BA 4CDGA 2EIMH 2GM4A 2CRGA 5F64A 1K79A 1ZTRA 5E3NA 1X1CA 4Q5SF 4ESJA 2LNBA 4AM3A 1WJAA 2MBFA 3WU0A 1LDKB 2BHYA 3F8FA 1U9NA 2OUMA 2K85A 1BW5A 1EKEA 3E6MA 4DIQA 5KHDA 2JT1A 4H0EA 5HLIA 2X51A 3IKVA 3ZR8X 3S1MJ 3HHHA 3GTPJ 4J19A 2Y0MA 2NRAC 5D5VB 5M5YJ 3LSRA 3TOBA 1TWGJ 2M0MA 4BJTA 3OYLA 3TP0A 4G7HF 3LFKA 1NTCA 4DNCA 1OCOH 3BR0A 4EGZA 5DDGA 1QVUA 3CESA 4HSTA 3VYTB 4NC7A 4BU2A 4A3CJ 1HKQA 1D0ZA 4HW0A 1W7PA 4XLPF 3OSFA 3MKZA 2WAEA 1SVOA 2GZWA 4YELA 5E3MA 1T2KA 1DPUA 3CLOA 5AIPA 3LOCA 2ZNYA 1MBHA 1N77A 2PJPA 5DUIA 2X0LA 4UUSB 1EV7A 1MBJA 3NWTA 2FBKA 2IPQX 1WWXA 2P8TA 1SMYF 4AIJA 2W24A 4NUBA 3LSKA 3DEEA 4HLYA 4LGWA 2ID6A 3WTZA 1B59A 3M3YJ 1GT0C 1MMNA 5IYDJ 2IP2A 3RPUA 4OIOF 1YX3A 2W85A 4L9JA 4CCNA 3K4CA 1KU3A 4CCJA 2EFNA 3VFZA 2Z16A 3V7SA 2XF6A 2EWNA 2VQCA 1ETXA 4Z2YA 1JKQC 3KX2A 3EUAA 3G3ZA 3QU3A 4V19K 3BQYA 2NVQJ 4FE7A 3PSIA 2B7EA 2DA3A 3IKTA 1SMTA 3ONQA 2Y0SA 4ASNA 1PP7U 1BA5A 3F72A 3B02A 1BI1A 2VASA 1Z6TA 5FKNA 4D1QA 4CGZA 5LGNA 1J75A 2IAIA 1W1WE 2HOEA 3I71A 2VE9A 1OPCA 4IQJA 2F48A 4M3DA 2HOAA 2P0WA 1XD7A 3ML6A 1MMSA 2E1MC 3A01B 2ELHA 3BC8A 1PYVA 2RGVA 1BI0A 4LB5A 4OMZA 1FNNA 2BY0A 2KT0A 3HPHA 2VT3A 4YG2F 1HXDA 2TRTA 4BE2A 3KP4A 3Q5FA 2Z2SB 3E5UA 2LBFA 1D5VA 4KYWA 2JA6J 4V2GA 3J7AO 2E60A 2EFOA 4JYKA 1FJLA 3OYHA 3IWFA 4A69C 2W1OA 4CICA 2JJ7A 3BTLA 5E1XA 5B1BH 3W2VA 2IBDA 4HQMA 3REOA 4E7LA 5HS9A 2ZJRF 2LDUA 3DBHB 3GXOA 5GPCA 2IS4A 5CVIA 2EIJH 3WHCA 4ZZLA 3CDLA 4C3JJ 3R60A 3IH2A 4E7JA 1GV5A 2P5LC 1SC7A 2Y0SN 4IHTA 2DA7A 2CQ7A 1SFUA 1TC3C 2VOPA 4RAGA 1R22A 1VQ4I 5C4JJ 1XCVA 4P5OA 3LSPA 1LVAA 4QIWN 4AVZA 2QBYB 2ZCWA 5ILUA 4P9FA 1VF9A 4TV7A 4Y15A 3SZGA 5D6EA 1T08B 3MZYA 3OS1A 4PUSA 4EV0A 2QCOA 5HNHA 3GFMA 5HDKA 4YIRX 1LUJB 9ANTA 2L02A 4OMYA 1D5YA 5K7FA 4FTHA 3CC2I 2R7SA 3MKYB 1YTYA 3OYMA 1M1EB 3K1NA 3ZMSA 2ELKA 1WI3A 4ZDPA 4R1HA 2M7BA 2STTA 4EJVA 3ZQIA 3L2QA 4HNTA 1F5TA 2R7XA 2HYJA 3TP3A 2HZDA 2L7FP 3BT9A 1NK2P 2IS2A 3B73A 1IRZA 4B3XA 4XM3A 1DUXC 1B8IA 1OMIA 3F0CA 5GTHC 4LG0B 2JPCA 3FXOA 3HC7A 1YW7A 4HAMA 4AU7A 4Y13A 2K9QA 1G3SA 3WU2C 3KETA 1ZELA 3W6VA 2VPLA 2A5WA 2ZFUA 3CCLI 3H9JA 1HCRA 1BC8C 1WCMJ 1SEUA 3HOYJ 5AONA 1X1AA 1FWZA 1ODDA 5CLSA 2W00A 1TW2A 2BXZA 2OTJI 2I8DA 5JHUA 1Z6RA 1RPWA 4M73A 1XMKA 2DA4A 5DV5A 4UVAA 1L3LA 2R7VA 4ZJZA 1WQ2A 1Z67A 2NS7A 1XTAA 2K4JA 2X85A 1ZAOA 1P4AA 1X58A 5D5WB 1OCRH 2YX7A 1ZG5A 2HFHA 2XGCA 1TLHB 5DCMB 5C44J 3HTUA 1T33A 3RKYA 1IRGA 2CQNA 2KFDA 2WAFA 2V79A 4OAZA 2JRTA 5A2QZ 1C0WA 1IN5A 3ERMA 2HEOA 2RREA 2VKVA 3ABUA 2VXZA 3VSLA 2R7UA 2H8RA 3G2BA 3BG5A 4XBFA 1I1SA 3OOUA 2CW0F 1DGWY 1LJ9A 2DODA 3Q0UA 3FXRA 3KZYA 5F1JA 3LL7A 2P6SA 4C2MJ 1VTNC 2MSYA 1MNDA 5M3FJ 3DV8A 1SD5A 1OR7C 4U7BA 2W4SA 3VPRA 2BV6A 2XB5A 2JMWA 2IJLA 2M8EA 1MBKA 2PJRB 1XMAA 4PJ0C 1KONA 4C30A 3S1RJ 1O3TA 2H27A 2DBBA 3CO6C 1WZ2A 2ZXJA 1XGMA 3DTKA 4I76A 4PJLA 1J59A 2O8KA 2GXGA 4UNOA 3SFIA 2RKHA 4HX7A 2V6EA 1FOWA 3GTOJ 2HI3A 1K6OA 3HRTA 1ZQ3P 1JT6A 1ZRFA 1QA6A 4HF1A 1ON2A 2FSWA 2PMZA 2N8GA 2OD5A 2HGCA 3A0BC 4P96A 2MC3A 4LG3A 4BHBA 5C3EJ 2X1DA 3GBGA 2EPFA 3S15J 1P4WA 3ZGKA 1OCCH 2LY9A 3FMQA 3GTGJ 2DT7B 1HBXG 1T0FC 2OQRA 4AUXA 2HQAA 2R7DA 3GZ6A 3HZJA 2O03A 1EA3A 1UG2A 2FNAA 3IAM2 2HDWA 2E1OA 4BQQA 4CCLA 1OYIA 1QO0D 4RBOA 3A4CA 4HBLA 1D8KA 3CCEI 3WHBA 1ZRDA 3OYKA 3KEQA 2AXTC 2CV0A 1A36A 3I53A 2D5VA 1OYYA 1PUEE 1O4XA 4LLGF 2E5ZA 3W6JB 2ZMEC 1X2MA 3FXKA 3CP2A 1UB9A 3K7AJ 1XGNA 3BOQA 2HKOA 5J3LA 4CCMA 2WC2A 4EM0B 2JA5J 2PMZN 1X4OA 1JXSA 1R71A 2VKDA 2M5WA 2XDVA 2XGXA 3TW7A 4EEFG 2Q2EB 1OCPA 4XORA 4Y4RA 3WTVC 2ZO4A 1I3QJ 5HDGA 5J47A 2C6YA 2NNNA 1SANA 3DLLF 5D8LB 1ZRCA 3BTIA 1XSXA 1JGSA 3WTWC 1XSDA 1LQ1A 1JHHA 5IPAA 1HA8A 3FBIB 3DP7A 1N25A 2X4HA 3O8GA 4PSXA 2Z3YA 4XRSG 3H9QA 4XQFA 4KISA 5TRDA 3HOXJ 4UY8I 2E2HJ 3KP7A 3DFGA 4BE0A 4CZCA 2H6BA 3CCJI 1QZYA 3WE2A 2IEKA 3QP5A 4XNFA 2Q1ZB 3RYPA 4XN3A 3WGIA 1WH5A 3A02A 1O7LA 4KUMA 3J7ZI 4LG0A 4G6QA 3EUHC 2CG4A 2WV1A 1U78A 1LE8B 2LREA 1ZGAA 3FXMA 3HOVJ 3W2WA 2BHZA 3OSGA 3FMSA 4BXUA 1MBEA 1BIAA 5LHHA 1VQ6I 1TQMA 2HTJA 3RQ4A 2K27A 5IYCJ 3FF5A 2OJED 5BPIA 3UKGA 2QQBA 1KU9A 4G12A 5E17F 2QSFX 5JI6A 3I55I 2ETHA 1KYWA 2D2WA 2DK5A 5F04A 3HOUJ 2HTSA 2V1NA 1GHCA 2UXNA 5KAIC 5F1RA 3JR9A 1P7IA 3VODA 5BNGA 5M5XJ 4OIQF 4E4HA 3ZQFA 2BEOA 1E2XA 3ECOA 2P5KA 4CSWA 4G8XA 2H8WA 3ZMUA 5ED4A 3TL4X 5J6XA 4L18B 1GV2A 1NG6A 2ZBKA 1FPQA 3PSFA 1N78A 3DQVC 5LRRA 1QU3A 3AL0C 2XGDA 3W3CA 3M4OJ 1K83J 1I5ZA 1WJBA 4QPOA 3CUQA 3Q9VA 2TDXA 1HQCA 1U8RA 5E79C 5FKLA 1Z9CA 1Z05A 3V8LA 2Q0OA 2X48A 4B47A 1WSUA 4XN0A 4J00A 1VQ8I 3PFIA 3QOPA 2JPBA 3F6OA 4MTDA 1D0YA 3BZKA 1FIAA 2VBXA 4N9HA 1ETOA 4XRMA 1DPRA 2WA0A 1YG2A 1BI3A 4D7NA 2W25A 2F5DA 2Y2ZA 1HW2A 1A04A 3BTJA 2LOOA 1QQIA 2LR8A 2VJ4A 2JUCA 3C7JA 3JAMK 2QQAA 2IXSA 4IF4A 4PFPA 3F3XA 3RSNA 3IAS2 3BCAA 3B6CA 4HSRA 4LD5A 3ZMTA 5JHFA 2HQRA 1XDUA 1X19A 5KNLA 4BQOA 2Y9YA 1WVRA 4GCVA 4JBAA 4W97A 1W7PB 4XSZF 3OYIA 3CDIA 3V8JA 5FLVA 2XKPA 5F0CA 2HYFA 2CWEA 2EIKH 3KYCB 2VT2A 2XKOA 1AU7A 3OL3A 4XR6A 1EF4A 2X1EA 2Y75A 3L2WA 1RR8C 1OCTC 3M9AA 3HOSA 4EGYA 2HQ5A 1JTYA 1SAUA 1IRXA 4MFDA 5EYRA 2QUFA 1PP8F 3A2KA 2EILH 3S17J 5D8KB 1JUMA 4MIMA 1K4TA 3EETA 1FMVA 2UXXA 3BY6A 4N0BA 5DM6F 1T38A 4A0YA 4IL6C 2L7ZA 4LK0F 1ONVA 5GTIC 1CQTA 1FY7A 5IOZA 4GGGA 2DA6A 2GA2A 1S9HA 4PFOA 2HPIA 1EH6A 1MDMB 3QYBA 2EFWA 1TT5B 2L9SA 2VJJA 2M9HA 1AA7A 3QPLA 4HNVA 1LDDA 2CFOA 3HRSA 3CP8A 2V6CA 3DKYA 1MJAA 3LA2A 3Q9SA 3RKWA 4UV8A 2G7HA 4YFNF 1USTA 2YUSA 1IRFA 1I1GA 5DD8A 1O3SA 5TJJA 2HR3A 4RM3A 1J09A 3SZTA 5KK1A 4O3MA 2KJCA 2KRCA 4A6EA 2QYOA 1FMWA 1X1PA 2QZ8A 3CLQA 1MMAA 1V54H 2X6WA 3QWLA 3E1SA 4R8HA 4XMYA 4I98B 3M1CA 3H5AA 2Y69H 2IVMA 3PQJA 5AIQA 2R7QA 1E3PA 2M3AA 2OQGA 2PQ8A 5H6RA 4U88A 3G6EI 1HDDC 3E3VA 1WJEA 2R92J 5L3DA 3HUGA 4Q47A 2VQHA 1U6GA 1LE8A 1YOVB 4HZFA 3H1CA 2LBFB 3K4JA 2NS0A 2Z1DA 1GUUA 1MD0A 1R1TA 2MA3A 2VQGA 2OAZA 3COAC 1S3JA 4OOIA 5K5OA 3HOZJ 2OV7A 2ZXHA 3KEYA 4W1UA 5D6FA 3ZQQA 3NWSA 4XLNF 2MABA 3VB2A 2DA5A 4CO8A 2VB6A 3QODA 4DOZA 4XRSA 5JVTA 4ITVA 4IHYA 3C2BA 4N4NB 4FISA 1YIJI 2EFQA 5D5XB 4NNJA 2LKSA 3F8CA 1PJRA 4BBSJ 1RI7A 2P4WA 3BR5A 1R00A 3I9V2 2FBIA 1LFBA 1W4MA 2CW7A 1ENHA 3DTIA 2JN6A 3BR2A 1TL8A 2YU9J 1YO5C 1B9MA 1Y0UA 1QNTA 3CTAA 2AQFA 1Y1WJ 5JLXA 2VOOA 2VPRA 1D1BA 1SVLA 2LG4A 2X6YA 4G9YA 2DPUA 2QVOA 5F0FA 4BXFA 4IJAA 1X2NA 1W0TA 1I39A 5GAEJ 2CV1A 2DMPA 2BVMA 3OS0A 2GA1A 4XLHA 1W5TA 3S1QJ 4BY7J 2VXDA 2Y9ZA 4HEA2 1B8IB 3FXJA 1HSTA 1BC7C 2ELJA 3E5XA 3T8RA 5CYVA 3S14J 2COMA 1J0RA 4N9IA 5H6QA 1XX5A 4MQ9F 1Z77A 2COBA 3WTTC 4HDVA 3PO2J 4EMSA 3FKIJ 1RC9A 3P5JA 2DQLA 3S3OA 2OZUA 2EA2A 3GF2A 1RKWA 4AYBA 1U5TA 4DZPA 1W7PD 3GEZA 3OS2A 1FSEA 2KDOA 3OYEA 2IS6A 4HQEA 5J40A 2RQPA 4OINF 5F6FA 4FCYA 1G2HA 3K4LA 1STZA 4XKWA 5CVVA 3G4SI 1FBSA 3JRBA 3S8PA 3WODF 4WX9A 2K3PA 3K4NA 5L3CA 4B09A 1BR2A 4NC6A 3HJEA 1MNEA 2LKPA 1MJBA 3O2PE 1DGRM 1T56A 4M3BA 2PN6A 3D5RC 2R7TA 3LMMA 4DYQA 2XAQA 5CPRB 4ZYGA 4AVPA 3O6BB 4GDFA 3RPUD 3ZN1A 1TBXA 3E6DA 3IRQA 2KPMA 2OZ6A 4I2OA 3E5QA 4XONA 2OF7A 3BJOA 1R7JA 4L9NA 1K61A 1APLC 2PMHA 3DU5A 4LK1F 2HZTA 5FFXA 2CSOA 2ICWG 1FX7A 4AYBN 4BKXA 1I3AA 4KIBA 4ANJA 2FMYA 1MDMA 1Z7UA 1ZG1A 2O61A 1F43A 4GYGA 2NS8A 2QF7A 5FROA 5H20A 1YW9A 1D3YA 3KP5A 3BPXA 3V8KA 4Q4ZF 1VQOI 3CUOA 2DLLA 1ZGJA 3WG7H 3L1PA 1V5FA 3KPHA 2QLZA 3L2UA 1Z0XA 1V5EA 1S5LC 2VBZA 3VYSB 3L7WA 1I50J 4II3A 4Y3OA 4A3KJ 1IC8A 2AS5F 1S7AA 2VBWA 3FXUA 4UVBA 3M8EA 4OIRF 5FKOA 2O8XA 2X9DA 1FP2A 3BJ6A 4M6XA 1DP7P 1U9OA 4DGWB 1R4MB 1RUOA 1YRNA 4UHTA 4EQQA 1D0XA 5CVJA 4BGDA 2VE8A 2JK3A 5KCMA 1A6QA 1ZHFA 2ECBA 5F0HA 2R7ZJ 1GVJA 2L9VA 4S0HB 4CXFA 4U0YA 2QENA 2R7RA 4PGHA 2E1CA 3S16J 2DYRH 3E7LA 4YFXF 4BJ6C 1YITI 1WKMA 2IS1A 2HVQA 1IV8A 5DD4A 2XAUA 2ZXIA 5TGTA 3G1LA 3F23A 3CCVI 3LSTA 5K1YA 5J1RA 2MH2A 2WV0A 2LYCA 2XSJC 5GP9A 4E7ZA 3CJNA 1S72I 5TISC 1POGA 3R4KA 4C9YA 1U8BA 4F93B 2VLAA 2KHMA 2ISZA 3LWFA 4MQVA 3KP6A 4DJAA 2KIUA 4ZYHA 5FD5A 1SD7A 1WRJA 1B6AA 3H0DA 3ZQLA 1FYKA 5FRMA 2O5RA 5L3BA 2FOKA 3K6GA 2JSCA 5FLXZ 4ZTJA 5FD6A 2VUMJ 4WCGA 1DP3A 5FLXK 4AWXB 4IVNA 5K5QA 3PUBA 4JK1X 3WTSC 2HXIA 2QWWA 3ERED 1Z7LA 1IXSB 2W84A 1EH8A 3JSPA 1TW3A 3SHFA 2VKHA 5ICFA 3OYCA 4A5NA 2EQRA 3EDPA 4U0WA 3GTKJ 2PI0A 2ZKZA 3OYFA 1I27A 4EJOA 2NVXJ 4BNCA 1BR4A 2M0CA 2EINH 3K0LA 1ETYA 4HV5A 3ZQGA 4UB8C 4IHSA 3C18A 4AD9A 3FM5A 2LD5A 5K5RA 2VL8A 4A0ZA 2JSPA 1BW6A 4RAZA 3TO6A 5EEHA 5D4SA 2HU9A 3OY9A 2QQ8A 2QQ9A 4XOTA 4HNUA 3JRAA 3GZ5A 5IP9J 1SFOJ 1SFKA 2VC0A 3HHGA 4GYIA 4PJJA 1P7JA 3BQZA 1XGSA 3FX3A 2RC4A 3WTXC 2VQLA 4X1EA 2XB0X 1LEAA 2L2OA 3AG1H 3M07A 2VIXA 2WB1A 3CCUI 1ETVA 3CUQC 2F5EA 4IOAF 1B72A 4OWRB 5FRNA 2XF5A 1FYMA 1MBGA 1UZCA 3GUDA 4M71A 1FSHA 2ESHA 2K9MA 2UZKA 4XK4A 1YI2I 1MIJA 1BR1A 2XVCA 4RGXA 4RLQA 2GIZA 5CKTA 4MLOA 1BOAA 1XPXA 1JUSA 2A6TA 3NAUA 3DEUA 1JUPA 1R36A 3H9GA 3HL2A 1E3OC 3ESWB 3HGGA 3S2WA 4A12A 3AKZA 1K4SA 3CUQB 4FE4A 3DKXA 2MW8A 3Q0WA 3BWGA 5ICCA 2JTVA 2NOJB 3L2CA 3GO5A 4Q48A 2Q8KA 1IZ1A 4RMNA 1XC5A 3ZXSA 3HGYA 4MNUA 2CW8A 2DFIA 2CYYA 2ZC2A 4A2UA 2XUBA 4F52A 4A3DJ 2V1UA 3P9KA 3QYFA 3JRIA 1LB2A 2VODA 2A05A 4HOBA 1D1CA 3CCRI 3DPLC 2FA5A 2WB1N 4PCQA 1FT9A 2NAZA 1VQ7I 2GBYA 2RV8A 1XCBA 3V4GA 2LKXA 3MVPA 2XAHA 3K1MA 1P9QC 4XSXF 1YIOA 2F5FA 2A3SA 2BVLA 1W5SA 2LVSA 4K2EA 2ID3A 4FETA 1QPIA 4D7MA 5J4VA 2JA7J 4I7HA 2XGEA 3ZQHA 4BHCA 4XKVA 1HW5A 1BJAA 1ZKGA 2KIMA 2EH3A 3MD2A 2W57A 2OU2A 2B9SA 2P6TA 3N97A 3G1MA 1SVMA 3A0HC 3P7NA 3QP6A 4CZZA 3RJPA 3OYJA 3DPTA 2X1CA 4RS8A 1G3TA 3X2QH 1R5GA 2KZVA 4ON0A 4ZTFA 2L5QA 2XRNA 1X3ZB 2F2EA 3I5UA 3ZN0A 4G7ZF 4RDUA 3HXLA 1YS6A 1K7AA 3CF5F 3FZVA 1KA8A 3BPVA 4I02A 4O6JA 1K78A 1R1VA 4A3GJ 2MYSA 2KIQA 1QBJA 3JTHA 1KYZA 3RZDJ 1UELB 3IH3A 3ULQB 3ASOH 3LNQA 4FX4A 4UUVA 1ERDA 1IN8A 2HNHA 1R1UA 2PLYA 1WJ5A 1Z21A 4G6DA 2GXBA 3HSRA 2DDBA 4KT5C 4ZH4F 1AHDP 5E20A 2GAUA 1FOKA 3PFYA 3K1PA 1IUYA 1HKTA 2WBMA 2FRHA 3S93A 2ZJPF 4E7KA 3GWZA 4BDZA 1PUFB 5E3LA 2QKMB 4BQAA 1IUFA 1ZR4A 3GYHX 1G6NA 4LB6B 3OR2C 3AG4H 2LH9A 2OCEA 1LFUP 3HTSB 4UV9A 5E8GA 2FEZA 1H0MA 2AO9A 3R6SA 2V9PA 3PJRA 2YR2A 1D1AA 4KIFA 4L0ZB 2VKEA 1I6HJ 3IHUA 3RI4A 5ILVA 2TCTA 4HA8A 4DZJA 2E71A 3CZ6A 1H89C 3V42A 5BQTA 2NYXA 5L3FA 4C3IJ 1J9IA 2M4KA 3HUGB 5FGMA 1ZARA 2BW3A 3CF2A 3K4BA 4D5FA 4Z6YA 4XOPA 1QPMA 2EV6A 3HIFA 1BIBA 3OYGA 3KLOA 2DMQA 5J4YA 1O7FA 2G9WA 2DA1A 3OIPA 4KMUX 2FQ4A 1QHHD 4JX6A 3RTRA 2RQQA 3WGHA 4ZZDA 3LQQA 4E7HA 3BR6A 1RESA 4PJNA 1IN6A 2ZJ2A 2P5VA 1TTYA 3D5LA 2FD5A 2QEXI 2RDPA 4AIHA 3PIOF 1R4NB 2DCEA 3QQAA 4A3EJ 3RYRA 1XSVA 4A3FJ 4KN4X 2NOGA 4S05A 1WJCA 2G7UA 1TT0A 3S3MA 2M30A 3UNGC 5B3SH 4E7SA 3EYYA 4UXNA 3E97A 2QSGX 2E19A 2E5NA 3IH4A 2HVSA 3BG6A 1RUNA 4DBQA 4A3IJ 4IHVA 1R58A 4LMYA 2X6OA 3O8HA 2IGOA 3PQKA 5IP7J 5HODA 2PX9A 2GOMA 2KIFA 3BZ6A 1BOBA 2YU3A 2PFBA 1VQMI 4M74A 2EZLA 5LEKA 4LIUA 1U5TC 2YS9A 5M3MJ 2MLGA 4N4OB 1F4KA 3U21A 1Y6IA 3FDYA 1J5YA 5E1WA 5FKKA 3FBNB 4U87A 1Z1DA 4ENJA 3ASNH 3CMAI 3TQNA 2GLOA 4FHTA 2DI3A 1FBUA 2CUFA 2HDCA 2LLKA 3CCQI 1Z91A 1Y8QB 1Z3XA 3FK6A 3CCMI 1O57A 2H94A 3JAMZ 3GMEA 4FT8A 1FEXA 1U5TB 3H0GJ 1TWCJ 2F4OB 2R7FA 1AKHB 5BMZA 2Z99A 3PUFA 4CCKA 2FX0A 3QOEA 1IAWA 3JRHA 4IKFA
chains in the Genus database with same CATH topology
3K70D 3OIQA 3OYBA 3SZGA 2VXDA 4HEA2 2K9LA 3OS1A 4PUSA 5HNHA 2ELJA 4PSWA 3HG9A 2JVHA 3SEQA 3BCBA 2R7SA 4CCOA 3MKYB 4HPQA 3S3OA 3OYMA 4IX7A 4ZDPA 2M7BA 4AYBA 3LSGA 3L2QA 4HNTA 2R7XA 3OS2A 2HZDA 4RM2A 2KDOA 3OYEA 2IS6A 2IS2A 1Y56A 2WADA 2CS3A 3K4LA 4B3XA 4XKWA 2WAQA 2AQEA 4XM3A 1QHGA 3S8PA 3HC7A 2K3PA 3K4NA 1OLTA 4F3QA 4JQFA 2VJIA 4AU7A 1BR2A 5LD2C 1MNEA 1ZELA 3I3LA 3OL4A 3PNTA 4EATA 2A5WA 2ZFUA 2VPLA 1DGRM 3D5RC 3H9JA 1UAAA 2R7TA 3LMMA 1X1AA 5CPRB 3M8JA 2W00A 1MMDA 4CA0A 3RPUD 3D5SC 4BEHB 2I8DA 2M4GA 1NG7A 2KPMA 2DT6A 3OYAA 3DPUA 4XONA 4BE1A 2V7FA 2R7VA 2ZSIB 4ZJZA 4XLAA 3DU5A 2X85A 2KMUA 3UR3C 3CJRB 3SDBA 2LRDA 3J7AY 3OYNA 4ANJA 2WAFA 4OAZA 5FROA 3OMYA 2RREA 2VXZA 3VSLA 2IGKA 2BOLA 2R7OA 3DTEA 3G2BA 2R7UA 1LVKA 4IQ4A 3OOUA 3LSMA 1DGWY 3C2HA 1V5FA 2CV2A 3H5NA 4PK4A 3LL7A 3L2UA 3K10A 1MNDA 1V5EA 3H35A 1OR7C 4U7BA 3PNVA 2R7WA 2W4SA 3VYSB 2V9KA 3ZRGA 4II3A 4Y3OA 2PJRB 1X1BA 1KONA 4C30A 2KRHA 1YX5A 4QPQA 3DTKA 4PJLA 1TZLA 2V6EA 4F91B 4DGWB 1D0XA 4BGDA 4NQWB 5KCMA 4II2A 3BG7A 3OYDA 2PMZA 3IUOA 3H5RA 2R7RA 4LG3A 2K5CA 1Z3YA 3FKJA 2X1DA 3GBGA 3K4KA 2L7KA 4BJ6C 4X0GA 1DQUA 3ZGKA 2IS1A 2HVQA 3A1YA 2DT7B 2PJRA 4PJMA 2XAUA 2ZXIA 1T0FC 5TGTA 2HQAA 3DU6A 3L2RA 3HKZA 1EA3A 2LYCA 3IAM2 2XSJC 2HDWA 4E7ZA 4BQQA 4CCLA 3AL0B 4ZDLA 4C9YA 4F93B 3PL8A 5LFAA 2JA2A 4KJZA 4FASD 2KHMA 3VDXA 2VLAA 3FHNA 3A4CA 4DJAA 2HPMA 5CQGA 2CUJA 3H0DA 2VJ5A 3OYKA 5FRMA 2O5RA 4CUGA 3OWTA 3VYRB 2XC7A 3K6GA 4BACA 2CV0A 4ZTJA 2E5ZA 1DP3A 1LKXA 2W82A 3CP2A 3PUBA 4DBRA 4CCMA 4KT6A 1Z7LA 1X4OA 4IZZA 2CUZA 2VKDA 2XDVA 2VKHA 3OYCA 2Q2EB 4KITB 4BQNA 4XORA 4Y4RA 2R4GA 4HRIA 3OYFA 4CH7A 2F5VA 1V5GA 1K6YA 1T95A 1BR4A 2JVGA 2V26A 1HA8A 3FBIB 4PSXA 2X6XA 4BS9A 1UG0A 4C2UA 2MD0A 2VL8A 1WJFA 3H9QA 4XQFA 3IP4B 4KISA 2JSPA 3CMMA 2HU9A 3K4MA 4BE0A 4D9JA 1W36C 3OY9A 4XOTA 3PNYA 4HNUA 4CZCA 3VSKA 2KLOA 1SFKA 1WJDA 4PJJA 2HVRA 4XNFA 2Q1ZB 4Y33A 2VQLA 2L2OA 4XN3A 2VIXA 2WB1A 3TBIA 5CQEA 2DOAA 4OWRB 3EUHC 4OAYA 3SEZA 2DXIA 2XF5A 5FRNA 4BUPA 3EPZA 2K9MA 2LREA 1BR1A 3W2WA 4RLQA 5CKTA 4MLOA 4XLCA 4R79A 4ZYAA 4BJ5C 2A6TA 3RQ4A 1G8XA 4NC8A 3C2GA 3H9GA 3HL2A 2UWMA 2ZSHB 1U0JA 4BEHA 3S3NA 4XKCA 3AKZA 4RLFA 2RNGA 4G6TB 3DKXA 4LITA 2F4IA 2V1NA 2CH0A 2NOJB 4RMNA 3ZXSA 2CW8A 2KL4A 2WY7Q 4F52A 4E4HA 2V4JC 5HVQC 3QYFA 4JOMA 4YRVA 2IGMA 1R6RA 4CSWA 3ZCOA 1D1CA 3DPLC 3TL4X 1X4PA 1NG6A 3PSFA 5HLTA 1N78A 3LSHA 3DQVC 3OR1C 4XLEA 3S32A 1QU3A 1E0EA 3AL0C 1P9QC 3LFUA 3W3CA 4B48A 1WJBA 4QPOA 2BVLA 4E6KG 2QKLB 4XKBA 3RCOA 3VWBA 3L2VA 4FETA 4B47A 4XKVA 3TMOA 4XN0A 4J00A 3MD2A 4ZDOA 4XL9A 3MMYB 1D0YA 3MKWB 1N75A 2L9NA 3OYJA 4BL0B 2XF7A 3DPTA 2X1CA 3E0JB 2KZVA 4ZTFA 2L5QA 1X1DA 1VZ0A 4C2TA 2LY2A 2WA0A 3HXLA 1LFPA 2E1MB 2LOOA 2VJ4A 3AFHA 2IXSA 4PFPA 3RSNA 3IAS2 3BCAA 5HNFA 2KP6A 4HSRA 5JHFA 3CJQB 2MYSA 2UV1A 3HPGA 1X1CA 1X19A 3N05A 5KNLA 4BQOA 1UELB 1WJAA 1LDKB 2JUGA 1ERDA 3OYIA 2HNHA 1WJ5A 1Z21A 3EUKL 2OUMA 3QYEA 3DWLE 4DIQA 5KHDA 3OL3A 4XR6A 2X1EA 3PFYA 2X51A 3ZR8X 3L2WA 3HOSA 2WBMA 2BW3B 3S93A 4E7KA 2CMPA 1SAUA 4BDZA 1IRXA 2GOXB 2QKMB 2M7AA 2F6CA 2M0MA 3A2KA 4BJTA 3OYLA 3VYUB 1FMVA 3OR2C 1MW7A 4GRIA 2LH9A 2OC6A 3CESA 4HSTA 3VYTB 4NC7A 3F9KA 4BU2A 3LSIA 3BLYA 3DLAA 3PJRA 3SYTA 1D1AA 1D0ZA 3KYLA 3MKZA 2WAEA 1S9HA 4PFOA 2HPIA 3CZ6A 3QYBA 2L9SA 2VJJA 4YELA 3V42A 1AA7A 2W7NA 2CFOA 1N77A 2M4KA 3HUGB 5HOOA 3CP8A 4F55A 2BW3A 3DKYA 3CF2A 3K4BA 3NWTA 4XOPA 4NUBA 3LSKA 3OYGA 3DEEA 4RM3A 1J09A 4H4KC 1WFXA 3OIPA 1MMNA 1QHHD 2KRCA 3RTRA 2LY1A 4E7IA 2IGNA 1FMWA 2RQQA 4ZC3A 4E7HA 1MMAA 2X6WA 1YX3A 3E1SA 4CCNA 1YE9A 3K4CA 4XMYA 3M1CA 3H5AA 4PJNA 2DJIA 4CCJA 2Z16A 3D5LA 2R7QA 2M3AA 2XF6A 3W2AA 2VQCA 3KX2A 3EUAA 1WJEA 1W36D 2DCEA 2VQHA 4XLFA 1G59A 3PSIA 2MFZA 1GLNA 2LBFB 3K4JA 3ONQA 2Y0SA 1WJCA 2Z1DA 3HOTA 1TT0A 2LC2A 2VASA 3UNGC 4D1QA 3S3MA 4E7SA 2VQGA 4BDYA 4IQJA 2ZXHA 2OV7A 3KEYA 2E5NA 2HVSA 3ZQQA 3NWSA 3BG6A 2MABA 4DBQA 3K70C 4J01A 4HG2A 2IGOA 2P0WA 2VB6A 3QODA 4DOZA 2GOMA 2FUG2 2E1MC 1BOBA 4P1WA 3BC8A 1PYVA 4ITVA 4N4NB 4LIUA 4NNJA 3HPHA 4N4OB 1PJRA 4YEJA 3U21A 4BE2A 1Y6IA 3FDYA 3FBNB 4U87A 2Z2SB 4B43A 2WY8Q 2LBFA 1MMGA 3I9V2 2E60A 4F92B 2CW7A 3OYHA 2W1OA 3DTIA 3W2VA 4LIVA 1JI8A 4E7LA 2IS4A 1Z3XA 4B44A 2AQFA 4E7JA 2UUZA 1D1BA 2LG4A 2X6YA 4BXFA 2MC4A 4CCKA 4IKFA 3QOEA 2CV1A 4P5OA 2KQRA 4AVZA 2BVMA 3OS0A 4XLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XF5 A;  2XF6 A;  2XF7 A; 
#chains in the Genus database with same CATH topology
 3S2H J;  3K70 D;  3TOA A;  3OIQ A;  1JJ8 C;  3IL2 A;  1P92 A;  1MH3 A;  2M1B A;  2BGC A;  1GXP A;  2K9L A;  4OU0 A;  2EFP A;  5EDN A;  2O3F A;  2K9S A;  3CCY A;  4PSW A;  2D1V A;  4DYR A;  1WI9 A;  3HG9 A;  3WG9 A;  3BCB A;  1ZLK A;  1OCZ H;  4CCO A;  4HPQ A;  3LA3 A;  2DFE A;  3ABM H;  1P6R A;  5LLQ A;  4IX7 A;  5J8C A;  2STW A;  1JJ6 C;  2IRF G;  3TO7 A;  3LAJ A;  1XMX A;  1EJ9 A;  1R5I D;  3LSG A;  1H9G A;  3DEW A;  4RB1 A;  1Y56 A;  2MGQ A;  2A07 F;  2OBP A;  2CS3 A;  1Q1H A;  3IWZ A;  5M5W J;  2WAQ A;  5CVR A;  5BPD A;  3I64 A;  2JZY A;  4I0A A;  3P9C A;  1XGO A;  2ZB9 A;  1OLT A;  1E17 A;  4BBR J;  2VJI A;  5LEJ A;  5LD2 C;  1BN5 A;  1JHF A;  3I3L A;  3PNT A;  1R9T J;  5LHG A;  1TNT A;  2DN0 A;  1R49 A;  1PUF A;  1UAA A;  2R93 J;  3GLX A;  3MZ8 A;  4XIC A;  3IV5 A;  4C3H J;  5B5E C;  3CCS I;  3M8J A;  2NNY A;  4ZYE A;  3A03 A;  1FP1 D;  3TDU C;  2DT5 A;  2DTR A;  3D5S C;  2M4G A;  2HS5 A;  2FU4 A;  5KAF C;  1NG7 A;  4RB0 A;  4ABZ A;  5FJ8 J;  2E34 A;  2EBI A;  3L09 A;  3WE3 A;  1FOX A;  4I0B A;  1QGP A;  1S7O A;  2ZSI B;  5ILS A;  3Q3S A;  2KMU A;  3UR3 C;  1SAX A;  3CJR B;  1GDT A;  1A5J A;  5HLG A;  2P81 A;  2W48 A;  1FLI A;  2ME0 A;  2DTZ A;  4I99 C;  4MEY F;  4L9V A;  1H8A C;  1RR7 A;  3LQR A;  3GTM J;  3TED A;  2CQK A;  2B0L A;  5KVR A;  3JRG A;  4EJW A;  5DYM A;  4A93 J;  3H36 A;  4A3B J;  1WH7 A;  2WAQ N;  1YRN B;  3V7R A;  3OMY A;  1TNS A;  3JRF A;  2IGK A;  2BOL A;  2R7O A;  2HWV A;  3DTE A;  1YHQ I;  2BY1 A;  1LVK A;  1T6S A;  2VBY A;  3NEU A;  4RAY A;  2GQQ A;  4I6Z A;  3C3W A;  1KGS A;  3RIR A;  4AIK A;  1VQL I;  4G94 A;  4A3J J;  3H5N A;  2HYG D;  4PK4 A;  3QPS A;  5HDN A;  1ZH5 A;  2A5Y B;  3H35 A;  2DAO A;  2R7W A;  1JTX A;  2NXN B;  3JRC A;  2V9K A;  4DW6 A;  2E2J J;  3WGG A;  2PBI A;  2KRH A;  1YX5 A;  4QPQ A;  2L54 A;  4A6D A;  2DPD A;  3GTQ J;  4MHG A;  1TZL A;  3I59 B;  2Z5U A;  2XAF A;  3J80 Z;  2L0K A;  2LMD A;  4M72 A;  4M6Y A;  5DM7 F;  3KFW X;  1VND A;  4NB5 A;  3J80 K;  3BG7 A;  3OYD A;  3HB9 A;  4IPA A;  3O3K A;  5HLH A;  1ETK A;  3CQZ J;  5EZH A;  3I56 I;  2LTP A;  4IHX A;  3IUO A;  2EB7 A;  2K5C A;  3FKJ A;  2L7K A;  4X0G A;  2ESN A;  2KZG A;  1DQU A;  2A6E F;  2HDD A;  2CQQ A;  2K7L A;  3CJT B;  5IY5 H;  3L2R A;  2K4B A;  2XRL A;  3H3Z A;  3SJM A;  1HKS A;  1OIS A;  2ZXW H;  2PMU A;  1UHS A;  3NQO A;  2ACJ A;  5ERI A;  2PG4 A;  1YFH A;  3PL8 A;  4M3E A;  2JA2 A;  2M45 A;  2DW4 A;  4KJZ A;  4NQW A;  2ME6 A;  3RKX A;  3VDX A;  3K2A A;  4PGG A;  1MGT A;  2HPM A;  2LFB A;  5CQG A;  1IJW C;  2CUJ A;  4HX8 A;  1BM9 A;  1UHM A;  2H09 A;  4CUG A;  1FOY A;  3VYR B;  3I4M J;  3FHZ A;  4A5M A;  4V2F A;  1LKX A;  2W82 A;  2XPW A;  2RN7 A;  1AOY A;  1S6L A;  1AKH A;  4KT6 A;  2VI6 A;  5ICG A;  5EZG A;  1IDZ A;  4IZZ A;  1YLF A;  3BG9 A;  1G3Y A;  2CUZ A;  1TP4 A;  4NHJ A;  4KIT B;  1B72 B;  1S7E A;  4RGU A;  1KQ9 A;  2ISY A;  4YIF A;  5EEA A;  3R0J A;  1V5G A;  2R5Y A;  1T95 A;  1K6Y A;  4PDK A;  2JVG A;  2V26 A;  3AG3 H;  4HDU A;  2FNP A;  3QU6 A;  4BS9 A;  1QZE A;  1UG0 A;  4C2U A;  3KYD B;  2I10 A;  1WJF A;  4IXA A;  2EJR A;  3MN2 A;  1TWA J;  3AG2 H;  3KP3 A;  3K4M A;  1S29 A;  3G73 A;  2PEX A;  1W36 C;  3PNY A;  4M9X A;  3VSK A;  2KLO A;  2XHK A;  1LEB A;  4L5I A;  2I5U A;  2HVR A;  4Y33 A;  4LLL A;  1A6I A;  2KIS A;  1QVT A;  4EM1 A;  2A6H F;  2FF4 A;  3TBI A;  2GIV A;  3MZH A;  2DOA A;  2FBH A;  2ADU A;  1FBQ A;  1ORK A;  1EH7 A;  4OAY A;  1OKR A;  3U1K A;  2DXI A;  3CC4 I;  2V1D A;  3QRF F;  4BUP A;  3EPZ A;  2VON A;  1TWH J;  1J7K A;  1ZLJ A;  2EA4 A;  1YQA A;  2BE5 F;  1JKO C;  1MZB A;  1XS9 A;  2XRO A;  4NC8 A;  3C2G A;  3H3V K;  1A31 A;  5J1Y A;  1W0U A;  2ZSH B;  1TQP A;  1UCR A;  1NH3 A;  2CJJ A;  3S3N A;  4KDP A;  4XKC A;  2L9R A;  1HC8 A;  5EF6 A;  4G6T B;  4LIT A;  3GW2 A;  1USS A;  2CH0 A;  4JX4 A;  1BBY A;  3T5X A;  2KL4 A;  3T8T A;  4HV6 A;  4BYY A;  1FTT A;  4BXX J;  3CMY A;  2V4J C;  3HM5 A;  4MGR A;  5HVQ C;  3KZI C;  4Y52 J;  3GFJ A;  3F6V A;  4YRV A;  3PM1 A;  1R6R A;  2RAE A;  5F08 A;  1IG7 A;  2CFX A;  2YPR A;  1VQ9 I;  2E2I J;  2HOS A;  3OR1 C;  3S32 A;  1E0E A;  1KQ0 A;  1ZYR F;  3C1D A;  1AWC A;  1HF0 A;  3QPT A;  4HLX A;  4E6K G;  2QKL B;  4BH9 A;  3R61 A;  4XKB A;  1F1Z A;  3L2V A;  3WTU C;  1HDP A;  1K78 B;  1UJ8 A;  3HDD A;  1SD4 A;  1RIO H;  2AXL A;  1KU7 A;  5EGO A;  1OJL A;  4EJU A;  4XL9 A;  1F9N A;  3MMY B;  3MCZ A;  1IO2 A;  3LSJ A;  1N75 A;  5DCF A;  2HKX A;  4B8X A;  1ZRE A;  2DU9 A;  4BL0 B;  2XF7 A;  3CC7 I;  3I59 A;  6PAX A;  2K86 A;  4IRG A;  3SFZ A;  4CYC B;  4RGS A;  1X1D A;  1VZ0 A;  5FO5 A;  4C2T A;  2FE3 A;  2E1M B;  3E6B A;  4UVC A;  5E8I A;  4OIP F;  1RET A;  3ZQC A;  4QWQ A;  3SZP A;  4Y7N J;  5EG0 A;  1IXR C;  3FWE A;  2V1X A;  5HNF A;  2KP6 A;  4A0X A;  3CJQ B;  1I6X A;  1RZ4 A;  2UV1 A;  3HPG A;  3N05 A;  1G4D A;  5IT3 A;  5LBQ A;  4MO7 A;  1SFE A;  2BZT A;  2ZFW A;  2JUG A;  1PDN C;  1LPQ A;  4U0V A;  5JFR A;  2JA8 J;  3EUK L;  3ZMZ A;  3QYE A;  3TGN A;  3DWL E;  2O7O A;  2DMT A;  4ENN A;  2DYS H;  5CJ9 A;  2CO5 A;  1XG1 A;  2A61 A;  2CU7 A;  2BW3 B;  2VN2 A;  3DXJ F;  2CMP A;  3K69 A;  3U2R A;  2GOX B;  5GPA A;  5IP6 A;  1ACI A;  1F36 A;  1ZN2 A;  3GTJ J;  2M7A A;  2F6C A;  4RB3 C;  5H2F C;  1A35 A;  2K02 A;  3VYU B;  4M3F A;  1MW7 A;  4GRI A;  2Y31 A;  3ZP5 A;  3DF8 A;  3K2Z A;  2OC6 A;  3U9G A;  1FTZ A;  3F9K A;  3LSI A;  3I0T A;  3BJA A;  3BLY A;  3DLA A;  1HW1 A;  4FX0 A;  3SYT A;  3KYL A;  1E3H A;  3KIO A;  1JGG A;  3OIO A;  4NBQ A;  2K3F A;  4B1R A;  2Y30 A;  2WTE A;  1YW8 A;  2W7N A;  1BJZ A;  1R5H A;  5HOO A;  1XDS A;  4F55 A;  5EJC A;  3DBL B;  5B1A H;  1Y39 A;  3KEO A;  5F27 A;  4LOC A;  4QLC U;  3BG3 A;  2NVU B;  1U2W A;  3EQL F;  1IV6 A;  5L3G A;  2M34 A;  2J5P A;  4B4C A;  3MAJ A;  4M6V A;  4GFB A;  4H4K C;  1WFX A;  3RPQ A;  1GXQ A;  1V55 H;  2LY1 A;  4E7I A;  2IGN A;  5DEQ A;  4ZC3 A;  3JSO A;  4A3L J;  2HQN A;  2LP0 A;  4LJZ F;  1VQ5 I;  1UFM A;  1YE9 A;  2E7X A;  2MLK A;  3HSF A;  3ZOB A;  4XID A;  4CYD A;  3S1N J;  2DJI A;  2G0E A;  2KKO A;  3F21 A;  1V4R A;  3WU1 B;  5K7Z A;  3W2A A;  1IDY A;  1YS7 A;  3BP8 A;  1JT0 A;  2P7C B;  1ETW A;  1W36 D;  1T8I A;  4XLF A;  4RB2 C;  1G59 A;  4UUS A;  1MBF A;  5JVG F;  2YX4 A;  2MFZ A;  3QPH A;  1GLN A;  3HYI A;  1IF1 A;  1W5C C;  2H1K A;  5A2Q K;  1YYV A;  3HOT A;  2LC2 A;  3L9F A;  2ZNZ A;  5CVU A;  4M9Z A;  1UMQ A;  1HOM A;  4A3M J;  4BDY A;  1SFX A;  4RAF A;  3JRD A;  3K70 C;  2R5Z B;  4FQG A;  4J01 A;  4ESF A;  4HG2 A;  2XAJ A;  4MEX F;  3I58 A;  2FUG 2;  2P7V B;  1MJ9 A;  2XAS A;  4M3G A;  4P1W A;  4MFE A;  3F8B A;  5ICE A;  4ENK A;  2JWT A;  4WXC A;  3ABT A;  1XB4 A;  1G3W A;  4GO1 A;  5E18 F;  4YEJ A;  3J81 Z;  4L5E A;  1B9N A;  3OOP A;  2BBY A;  4O5V A;  3J81 K;  4B43 A;  1BL0 A;  2WY8 Q;  4G7O F;  1MMG A;  1O3Q A;  3PIP F;  3F8N A;  3T0Y A;  4F92 B;  2QA4 I;  1MH4 A;  2M8G X;  3I4N J;  4LIV A;  1JI8 A;  3RKQ A;  4B44 A;  3SQN A;  4D5C A;  1P2F A;  2UUZ A;  3JRE A;  2BYV E;  4HF2 A;  3RZO J;  1Y8R B;  2XIG A;  3HBL A;  3A01 A;  2DDA A;  4ENM A;  2MC4 A;  1WHU A;  4WXH A;  2GWR A;  2RNJ A;  4HX4 A;  2LF7 A;  4RA2 A;  3VEP A;  3CDH A;  5DUK A;  2KQR A;  1RKT A;  4BAY A;  2DFH A;  3ZPL A;  3OYB A;  1NK3 P;  1FIP A;  1DU6 A;  3HEF A;  2OTL I;  1V3F A;  1T98 A;  4WWC A;  3BDD A;  5L3E A;  4CYC A;  4KFC A;  3FK7 A;  1BI2 A;  1S8N A;  2JVH A;  3SEQ A;  1YJW I;  3Q0V A;  1MSF C;  4PZJ A;  2JRM A;  3ROU A;  1FC3 A;  3F22 A;  1ITY A;  2DK8 A;  2DJN A;  3HRM A;  5FFZ A;  5JR3 A;  1ZGW A;  1IW7 F;  3ISP A;  4HF0 A;  3N4M A;  4RM2 A;  2EK5 A;  3GCM A;  3KZZ A;  3JCU C;  2WAD A;  2XPU A;  3MFK A;  2D1H A;  2KRF A;  1IGN A;  2QBY A;  1VQN I;  5JLW A;  5B66 C;  3J7Y J;  3H92 A;  2AQE A;  1YJN I;  3W6K B;  3S2D J;  1QHG A;  1RNL A;  3ZMD A;  2YSR A;  2ZJQ F;  1JKR C;  4ETS A;  4F3Q A;  4I09 A;  4JQF A;  2FJ1 A;  1LNW A;  2BY3 A;  1PVE A;  2CUE A;  3SXY A;  2Z33 A;  3OL4 A;  1ZG3 A;  1B4A A;  2ZME B;  4EAT A;  5IOY A;  3BR3 A;  3M8F A;  5LRS A;  2F5C A;  1CF7 B;  3TW6 A;  1MMD A;  4KIC A;  1ON1 A;  4CA0 A;  4BEH B;  2DT6 A;  3D0S A;  3OYA A;  3DPU A;  3I4P A;  3M7G A;  2V7F A;  4BE1 A;  3U1D A;  4XLA A;  5FB2 A;  3D1N I;  4P55 A;  4YII A;  3DKW A;  4JX5 A;  3SDB A;  3KLN A;  1TQI A;  2LRD A;  3OV8 A;  4S04 A;  3J7A Y;  3OYN A;  1U3E M;  4DQ2 A;  1TWF J;  2XPV A;  4QSH A;  2QM3 A;  3EYI A;  2IA0 A;  2DOE A;  4GXO A;  2XSD C;  1MNM C;  3GFL A;  1R23 A;  2IT0 A;  2BY2 A;  3H3U A;  3IRR A;  3GFI A;  4AID A;  1J2X A;  5FKM A;  5D4R A;  4IQ4 A;  3LSM A;  3WTY C;  1YJ9 I;  1ETQ A;  3C2H A;  4M9S A;  2CV2 A;  3BRO A;  3K10 A;  1OYW A;  1ZK8 A;  4KIG A;  3PNV A;  3FM3 A;  4KMF A;  3ZRG A;  2MG4 A;  2JQ7 A;  1X1B A;  2L4M A;  5DCM A;  5GAG J;  2DA2 A;  3PO3 J;  3BR1 A;  2DMN A;  4F91 B;  4LFU A;  2O6G E;  2DMU A;  3GX4 X;  5C4X J;  2DO7 A;  4IRH A;  3MKL A;  4NQW B;  3KE2 A;  4B3A A;  2MH9 A;  1XN7 A;  4II2 A;  5HS7 A;  2DOF A;  5D5U B;  2R0Q C;  3MWM A;  2XV4 S;  3H5R A;  4Y17 A;  4ESB A;  2EZI A;  1Z3Y A;  2R5Z A;  3JW4 A;  3GLL A;  3K4K A;  2EZK A;  2FQ3 A;  1JKP C;  3GTL J;  2K9N A;  3MQ0 A;  3A1Y A;  2PJR A;  4PJM A;  4BY1 J;  4BHP A;  3DU6 A;  3TO9 A;  3JTG A;  3QAH A;  1O3R A;  3HKZ A;  1ULY A;  3AL0 B;  4D0P A;  3HOW J;  2KDZ A;  4ZDL A;  5LFA A;  4FAS D;  5LGU A;  1IN7 A;  2R5Y B;  3FHN A;  2E1N A;  1JE8 A;  1B1B A;  4IHW A;  3B6A A;  2VJ5 A;  2WWY A;  3KP2 A;  3HSE A;  1FZP B;  4P9U A;  3OWT A;  2XC7 A;  4BAC A;  1OR7 A;  4L0Y B;  1H9T A;  4IEJ A;  1L0O C;  1DU0 A;  5EEG A;  2AHQ A;  1ZR2 A;  3CO7 C;  4HYE A;  3BTC A;  2B63 J;  4DYC A;  4DBR A;  1P4X A;  4EM2 A;  1KQ8 A;  3AAF A;  2NVY J;  2QGU A;  3ZMV A;  2E7W A;  1WGX A;  4NDL A;  5DS9 A;  2A68 F;  4KN7 X;  2DQR A;  1T39 A;  1RRJ A;  1KZH A;  3F8M A;  4I01 A;  3K9T A;  4BQN A;  1MKM A;  2LK2 A;  2R4G A;  3CD6 I;  2E35 A;  4HRI A;  3ABK H;  4CH7 A;  4U7D A;  5BS6 A;  2F5V A;  4WXD A;  2OA4 A;  2EV5 A;  1GVD A;  2EZH A;  3FIW A;  2HOT A;  3GVA A;  2GXA A;  2X6X A;  5J1U A;  2Z9O A;  1SD6 A;  3LA7 A;  3HKZ N;  3G1O A;  2MD0 A;  5GAD J;  3IP4 B;  3CMM A;  2F4M B;  2CGP A;  2ECC A;  4D9J A;  1T0F A;  2M2E A;  2MD5 A;  4IRI A;  1WJD A;  2NVT J;  1Q1V A;  1Y1V J;  4X6A J;  4E70 A;  3NAR A;  2CQX A;  3FXL A;  2M87 A;  1OQY A;  1DDN A;  5CQE A;  2Q2E A;  2VC1 A;  3SEZ A;  5K7H A;  3RDI A;  2J5O A;  3RQI A;  5LGT A;  1VI0 A;  4KA4 A;  2H1L A;  4IO9 F;  1IXC A;  3HRU A;  2ZME A;  4XLC A;  4R79 A;  4ZYA A;  3TDZ C;  3L00 A;  4BJ5 C;  1VQK I;  3M1E A;  4JP0 A;  4MTE A;  1G8X A;  4ZYD A;  3ELK A;  1CF7 A;  3ABL H;  3FXQ A;  3I54 A;  2UWM A;  1U0J A;  2OCC H;  2QSH X;  5IT9 Z;  3V7C A;  2RVC A;  4BEH A;  2Y48 A;  4EVI A;  1CGP A;  2KJB A;  1VQP I;  1OFC X;  2DFF A;  2OPT A;  4L9T A;  4RLF A;  5IT9 K;  2RNG A;  4UB6 C;  3ZQ7 A;  5E3O A;  1HLV A;  2F4I A;  4EJT A;  5FLM J;  2IW5 A;  2L4A A;  4KNY A;  2A69 F;  1X3U A;  5EGO B;  3CME I;  2D45 A;  4LLN A;  2LF8 A;  2WY7 Q;  2V9V A;  3NRV A;  4UUT A;  2O0Y A;  3DBR B;  5DTD A;  2XAG A;  3FMR A;  4QTR A;  5GAH J;  3LAP A;  1VFC A;  1H88 C;  4JOM A;  3IC7 A;  2IGM A;  2FML A;  2FXA A;  3R0A A;  3ZCO A;  3P9I A;  4CHU A;  1X4P A;  5IYB J;  5HLT A;  3LSH A;  1UHW A;  4XLE A;  3E6C C;  5LHI A;  2R3S A;  4IOC F;  3FIS A;  3VOE A;  3LFU A;  4WF2 A;  2HXO A;  4B48 A;  4RGR A;  5EG0 B;  5BOX A;  3RCO A;  3VWB A;  2FOW A;  3DCF A;  3EUH A;  3SDG A;  3MEX A;  2O9L A;  3G71 I;  5HS8 A;  3TMO A;  4WK8 F;  3BZC A;  1REP C;  1WPK A;  4ZDO A;  1Y0N A;  1QRY A;  1X3W B;  3KCC A;  2H6C A;  2IA1 A;  2K40 A;  1FYL A;  3MKW B;  2L01 A;  1MSE C;  1LDJ A;  2L9N A;  3TKY A;  2L3D A;  4XRF A;  3E0J B;  2IA2 A;  2EV0 A;  2E36 A;  1IN4 A;  4L5J A;  4F7Z A;  2LY2 A;  3ECH A;  1LFP A;  2LSO A;  1D8J A;  5E1Z B;  4YFK F;  1QZZ A;  1HSJ A;  1KU2 A;  3AFH A;  1NHA A;  2L7M P;  4AC0 A;  3GZN B;  2BXY A;  5J8F A;  3T1B A;  4CDG A;  2EIM H;  2GM4 A;  2CRG A;  5F64 A;  1K79 A;  1ZTR A;  5E3N A;  1X1C A;  4Q5S F;  4ESJ A;  2LNB A;  4AM3 A;  1WJA A;  2MBF A;  3WU0 A;  1LDK B;  2BHY A;  3F8F A;  1U9N A;  2OUM A;  2K85 A;  1BW5 A;  1EKE A;  3E6M A;  4DIQ A;  5KHD A;  2JT1 A;  4H0E A;  5HLI A;  2X51 A;  3IKV A;  3ZR8 X;  3S1M J;  3HHH A;  3GTP J;  4J19 A;  2Y0M A;  2NRA C;  5D5V B;  5M5Y J;  3LSR A;  3TOB A;  1TWG J;  2M0M A;  4BJT A;  3OYL A;  3TP0 A;  4G7H F;  3LFK A;  1NTC A;  4DNC A;  1OCO H;  3BR0 A;  4EGZ A;  5DDG A;  1QVU A;  3CES A;  4HST A;  3VYT B;  4NC7 A;  4BU2 A;  4A3C J;  1HKQ A;  1D0Z A;  4HW0 A;  1W7P A;  4XLP F;  3OSF A;  3MKZ A;  2WAE A;  1SVO A;  2GZW A;  4YEL A;  5E3M A;  1T2K A;  1DPU A;  3CLO A;  5AIP A;  3LOC A;  2ZNY A;  1MBH A;  1N77 A;  2PJP A;  5DUI A;  2X0L A;  4UUS B;  1EV7 A;  1MBJ A;  3NWT A;  2FBK A;  2IPQ X;  1WWX A;  2P8T A;  1SMY F;  4AIJ A;  2W24 A;  4NUB A;  3LSK A;  3DEE A;  4HLY A;  4LGW A;  2ID6 A;  3WTZ A;  1B59 A;  3M3Y J;  1GT0 C;  1MMN A;  5IYD J;  2IP2 A;  3RPU A;  4OIO F;  1YX3 A;  2W85 A;  4L9J A;  4CCN A;  3K4C A;  1KU3 A;  4CCJ A;  2EFN A;  3VFZ A;  2Z16 A;  3V7S A;  2XF6 A;  2EWN A;  2VQC A;  1ETX A;  4Z2Y A;  1JKQ C;  3KX2 A;  3EUA A;  3G3Z A;  3QU3 A;  4V19 K;  3BQY A;  2NVQ J;  4FE7 A;  3PSI A;  2B7E A;  2DA3 A;  3IKT A;  1SMT A;  3ONQ A;  2Y0S A;  4ASN A;  1PP7 U;  1BA5 A;  3F72 A;  3B02 A;  1BI1 A;  2VAS A;  1Z6T A;  5FKN A;  4D1Q A;  4CGZ A;  5LGN A;  1J75 A;  2IAI A;  1W1W E;  2HOE A;  3I71 A;  2VE9 A;  1OPC A;  4IQJ A;  2F48 A;  4M3D A;  2HOA A;  2P0W A;  1XD7 A;  3ML6 A;  1MMS A;  2E1M C;  3A01 B;  2ELH A;  3BC8 A;  1PYV A;  2RGV A;  1BI0 A;  4LB5 A;  4OMZ A;  1FNN A;  2BY0 A;  2KT0 A;  3HPH A;  2VT3 A;  4YG2 F;  1HXD A;  2TRT A;  4BE2 A;  3KP4 A;  3Q5F A;  2Z2S B;  3E5U A;  2LBF A;  1D5V A;  4KYW A;  2JA6 J;  4V2G A;  3J7A O;  2E60 A;  2EFO A;  4JYK A;  1FJL A;  3OYH A;  3IWF A;  4A69 C;  2W1O A;  4CIC A;  2JJ7 A;  3BTL A;  5E1X A;  5B1B H;  3W2V A;  2IBD A;  4HQM A;  3REO A;  4E7L A;  5HS9 A;  2ZJR F;  2LDU A;  3DBH B;  3GXO A;  5GPC A;  2IS4 A;  5CVI A;  2EIJ H;  3WHC A;  4ZZL A;  3CDL A;  4C3J J;  3R60 A;  3IH2 A;  4E7J A;  1GV5 A;  2P5L C;  1SC7 A;  2Y0S N;  4IHT A;  2DA7 A;  2CQ7 A;  1SFU A;  1TC3 C;  2VOP A;  4RAG A;  1R22 A;  1VQ4 I;  5C4J J;  1XCV A;  4P5O A;  3LSP A;  1LVA A;  4QIW N;  4AVZ A;  2QBY B;  2ZCW A;  5ILU A;  4P9F A;  1VF9 A;  4TV7 A;  4Y15 A;  3SZG A;  5D6E A;  1T08 B;  3MZY A;  3OS1 A;  4PUS A;  4EV0 A;  2QCO A;  5HNH A;  3GFM A;  5HDK A;  4YIR X;  1LUJ B;  9ANT A;  2L02 A;  4OMY A;  1D5Y A;  5K7F A;  4FTH A;  3CC2 I;  2R7S A;  3MKY B;  1YTY A;  3OYM A;  1M1E B;  3K1N A;  3ZMS A;  2ELK A;  1WI3 A;  4ZDP A;  4R1H A;  2M7B A;  2STT A;  4EJV A;  3ZQI A;  3L2Q A;  4HNT A;  1F5T A;  2R7X A;  2HYJ A;  3TP3 A;  2HZD A;  2L7F P;  3BT9 A;  1NK2 P;  2IS2 A;  3B73 A;  1IRZ A;  4B3X A;  4XM3 A;  1DUX C;  1B8I A;  1OMI A;  3F0C A;  5GTH C;  4LG0 B;  2JPC A;  3FXO A;  3HC7 A;  1YW7 A;  4HAM A;  4AU7 A;  4Y13 A;  2K9Q A;  1G3S A;  3WU2 C;  3KET A;  1ZEL A;  3W6V A;  2VPL A;  2A5W A;  2ZFU A;  3CCL I;  3H9J A;  1HCR A;  1BC8 C;  1WCM J;  1SEU A;  3HOY J;  5AON A;  1X1A A;  1FWZ A;  1ODD A;  5CLS A;  2W00 A;  1TW2 A;  2BXZ A;  2OTJ I;  2I8D A;  5JHU A;  1Z6R A;  1RPW A;  4M73 A;  1XMK A;  2DA4 A;  5DV5 A;  4UVA A;  1L3L A;  2R7V A;  4ZJZ A;  1WQ2 A;  1Z67 A;  2NS7 A;  1XTA A;  2K4J A;  2X85 A;  1ZAO A;  1P4A A;  1X58 A;  5D5W B;  1OCR H;  2YX7 A;  1ZG5 A;  2HFH A;  2XGC A;  1TLH B;  5DCM B;  5C44 J;  3HTU A;  1T33 A;  3RKY A;  1IRG A;  2CQN A;  2KFD A;  2WAF A;  2V79 A;  4OAZ A;  2JRT A;  5A2Q Z;  1C0W A;  1IN5 A;  3ERM A;  2HEO A;  2RRE A;  2VKV A;  3ABU A;  2VXZ A;  3VSL A;  2R7U A;  2H8R A;  3G2B A;  3BG5 A;  4XBF A;  1I1S A;  3OOU A;  2CW0 F;  1DGW Y;  1LJ9 A;  2DOD A;  3Q0U A;  3FXR A;  3KZY A;  5F1J A;  3LL7 A;  2P6S A;  4C2M J;  1VTN C;  2MSY A;  1MND A;  5M3F J;  3DV8 A;  1SD5 A;  1OR7 C;  4U7B A;  2W4S A;  3VPR A;  2BV6 A;  2XB5 A;  2JMW A;  2IJL A;  2M8E A;  1MBK A;  2PJR B;  1XMA A;  4PJ0 C;  1KON A;  4C30 A;  3S1R J;  1O3T A;  2H27 A;  2DBB A;  3CO6 C;  1WZ2 A;  2ZXJ A;  1XGM A;  3DTK A;  4I76 A;  4PJL A;  1J59 A;  2O8K A;  2GXG A;  4UNO A;  3SFI A;  2RKH A;  4HX7 A;  2V6E A;  1FOW A;  3GTO J;  2HI3 A;  1K6O A;  3HRT A;  1ZQ3 P;  1JT6 A;  1ZRF A;  1QA6 A;  4HF1 A;  1ON2 A;  2FSW A;  2PMZ A;  2N8G A;  2OD5 A;  2HGC A;  3A0B C;  4P96 A;  2MC3 A;  4LG3 A;  4BHB A;  5C3E J;  2X1D A;  3GBG A;  2EPF A;  3S15 J;  1P4W A;  3ZGK A;  1OCC H;  2LY9 A;  3FMQ A;  3GTG J;  2DT7 B;  1HBX G;  1T0F C;  2OQR A;  4AUX A;  2HQA A;  2R7D A;  3GZ6 A;  3HZJ A;  2O03 A;  1EA3 A;  1UG2 A;  2FNA A;  3IAM 2;  2HDW A;  2E1O A;  4BQQ A;  4CCL A;  1OYI A;  1QO0 D;  4RBO A;  3A4C A;  4HBL A;  1D8K A;  3CCE I;  3WHB A;  1ZRD A;  3OYK A;  3KEQ A;  2AXT C;  2CV0 A;  1A36 A;  3I53 A;  2D5V A;  1OYY A;  1PUE E;  1O4X A;  4LLG F;  2E5Z A;  3W6J B;  2ZME C;  1X2M A;  3FXK A;  3CP2 A;  1UB9 A;  3K7A J;  1XGN A;  3BOQ A;  2HKO A;  5J3L A;  4CCM A;  2WC2 A;  4EM0 B;  2JA5 J;  2PMZ N;  1X4O A;  1JXS A;  1R71 A;  2VKD A;  2M5W A;  2XDV A;  2XGX A;  3TW7 A;  4EEF G;  2Q2E B;  1OCP A;  4XOR A;  4Y4R A;  3WTV C;  2ZO4 A;  1I3Q J;  5HDG A;  5J47 A;  2C6Y A;  2NNN A;  1SAN A;  3DLL F;  5D8L B;  1ZRC A;  3BTI A;  1XSX A;  1JGS A;  3WTW C;  1XSD A;  1LQ1 A;  1JHH A;  5IPA A;  1HA8 A;  3FBI B;  3DP7 A;  1N25 A;  2X4H A;  3O8G A;  4PSX A;  2Z3Y A;  4XRS G;  3H9Q A;  4XQF A;  4KIS A;  5TRD A;  3HOX J;  4UY8 I;  2E2H J;  3KP7 A;  3DFG A;  4BE0 A;  4CZC A;  2H6B A;  3CCJ I;  1QZY A;  3WE2 A;  2IEK A;  3QP5 A;  4XNF A;  2Q1Z B;  3RYP A;  4XN3 A;  3WGI A;  1WH5 A;  3A02 A;  1O7L A;  4KUM A;  3J7Z I;  4LG0 A;  4G6Q A;  3EUH C;  2CG4 A;  2WV1 A;  1U78 A;  1LE8 B;  2LRE A;  1ZGA A;  3FXM A;  3HOV J;  3W2W A;  2BHZ A;  3OSG A;  3FMS A;  4BXU A;  1MBE A;  1BIA A;  5LHH A;  1VQ6 I;  1TQM A;  2HTJ A;  3RQ4 A;  2K27 A;  5IYC J;  3FF5 A;  2OJE D;  5BPI A;  3UKG A;  2QQB A;  1KU9 A;  4G12 A;  5E17 F;  2QSF X;  5JI6 A;  3I55 I;  2ETH A;  1KYW A;  2D2W A;  2DK5 A;  5F04 A;  3HOU J;  2HTS A;  2V1N A;  1GHC A;  2UXN A;  5KAI C;  5F1R A;  3JR9 A;  1P7I A;  3VOD A;  5BNG A;  5M5X J;  4OIQ F;  4E4H A;  3ZQF A;  2BEO A;  1E2X A;  3ECO A;  2P5K A;  4CSW A;  4G8X A;  2H8W A;  3ZMU A;  5ED4 A;  3TL4 X;  5J6X A;  4L18 B;  1GV2 A;  1NG6 A;  2ZBK A;  1FPQ A;  3PSF A;  1N78 A;  3DQV C;  5LRR A;  1QU3 A;  3AL0 C;  2XGD A;  3W3C A;  3M4O J;  1K83 J;  1I5Z A;  1WJB A;  4QPO A;  3CUQ A;  3Q9V A;  2TDX A;  1HQC A;  1U8R A;  5E79 C;  5FKL A;  1Z9C A;  1Z05 A;  3V8L A;  2Q0O A;  2X48 A;  4B47 A;  1WSU A;  4XN0 A;  4J00 A;  1VQ8 I;  3PFI A;  3QOP A;  2JPB A;  3F6O A;  4MTD A;  1D0Y A;  3BZK A;  1FIA A;  2VBX A;  4N9H A;  1ETO A;  4XRM A;  1DPR A;  2WA0 A;  1YG2 A;  1BI3 A;  4D7N A;  2W25 A;  2F5D A;  2Y2Z A;  1HW2 A;  1A04 A;  3BTJ A;  2LOO A;  1QQI A;  2LR8 A;  2VJ4 A;  2JUC A;  3C7J A;  3JAM K;  2QQA A;  2IXS A;  4IF4 A;  4PFP A;  3F3X A;  3RSN A;  3IAS 2;  3BCA A;  3B6C A;  4HSR A;  4LD5 A;  3ZMT A;  5JHF A;  2HQR A;  1XDU A;  1X19 A;  5KNL A;  4BQO A;  2Y9Y A;  1WVR A;  4GCV A;  4JBA A;  4W97 A;  1W7P B;  4XSZ F;  3OYI A;  3CDI A;  3V8J A;  5FLV A;  2XKP A;  5F0C A;  2HYF A;  2CWE A;  2EIK H;  3KYC B;  2VT2 A;  2XKO A;  1AU7 A;  3OL3 A;  4XR6 A;  1EF4 A;  2X1E A;  2Y75 A;  3L2W A;  1RR8 C;  1OCT C;  3M9A A;  3HOS A;  4EGY A;  2HQ5 A;  1JTY A;  1SAU A;  1IRX A;  4MFD A;  5EYR A;  2QUF A;  1PP8 F;  3A2K A;  2EIL H;  3S17 J;  5D8K B;  1JUM A;  4MIM A;  1K4T A;  3EET A;  1FMV A;  2UXX A;  3BY6 A;  4N0B A;  5DM6 F;  1T38 A;  4A0Y A;  4IL6 C;  2L7Z A;  4LK0 F;  1ONV A;  5GTI C;  1CQT A;  1FY7 A;  5IOZ A;  4GGG A;  2DA6 A;  2GA2 A;  1S9H A;  4PFO A;  2HPI A;  1EH6 A;  1MDM B;  3QYB A;  2EFW A;  1TT5 B;  2L9S A;  2VJJ A;  2M9H A;  1AA7 A;  3QPL A;  4HNV A;  1LDD A;  2CFO A;  3HRS A;  3CP8 A;  2V6C A;  3DKY A;  1MJA A;  3LA2 A;  3Q9S A;  3RKW A;  4UV8 A;  2G7H A;  4YFN F;  1UST A;  2YUS A;  1IRF A;  1I1G A;  5DD8 A;  1O3S A;  5TJJ A;  2HR3 A;  4RM3 A;  1J09 A;  3SZT A;  5KK1 A;  4O3M A;  2KJC A;  2KRC A;  4A6E A;  2QYO A;  1FMW A;  1X1P A;  2QZ8 A;  3CLQ A;  1MMA A;  1V54 H;  2X6W A;  3QWL A;  3E1S A;  4R8H A;  4XMY A;  4I98 B;  3M1C A;  3H5A A;  2Y69 H;  2IVM A;  3PQJ A;  5AIQ A;  2R7Q A;  1E3P A;  2M3A A;  2OQG A;  2PQ8 A;  5H6R A;  4U88 A;  3G6E I;  1HDD C;  3E3V A;  1WJE A;  2R92 J;  5L3D A;  3HUG A;  4Q47 A;  2VQH A;  1U6G A;  1LE8 A;  1YOV B;  4HZF A;  3H1C A;  2LBF B;  3K4J A;  2NS0 A;  2Z1D A;  1GUU A;  1MD0 A;  1R1T A;  2MA3 A;  2VQG A;  2OAZ A;  3COA C;  1S3J A;  4OOI A;  5K5O A;  3HOZ J;  2OV7 A;  2ZXH A;  3KEY A;  4W1U A;  5D6F A;  3ZQQ A;  3NWS A;  4XLN F;  2MAB A;  3VB2 A;  2DA5 A;  4CO8 A;  2VB6 A;  3QOD A;  4DOZ A;  4XRS A;  5JVT A;  4ITV A;  4IHY A;  3C2B A;  4N4N B;  4FIS A;  1YIJ I;  2EFQ A;  5D5X B;  4NNJ A;  2LKS A;  3F8C A;  1PJR A;  4BBS J;  1RI7 A;  2P4W A;  3BR5 A;  1R00 A;  3I9V 2;  2FBI A;  1LFB A;  1W4M A;  2CW7 A;  1ENH A;  3DTI A;  2JN6 A;  3BR2 A;  1TL8 A;  2YU9 J;  1YO5 C;  1B9M A;  1Y0U A;  1QNT A;  3CTA A;  2AQF A;  1Y1W J;  5JLX A;  2VOO A;  2VPR A;  1D1B A;  1SVL A;  2LG4 A;  2X6Y A;  4G9Y A;  2DPU A;  2QVO A;  5F0F A;  4BXF A;  4IJA A;  1X2N A;  1W0T A;  1I39 A;  5GAE J;  2CV1 A;  2DMP A;  2BVM A;  3OS0 A;  2GA1 A;  4XLH A;  1W5T A;  3S1Q J;  4BY7 J;  2VXD A;  2Y9Z A;  4HEA 2;  1B8I B;  3FXJ A;  1HST A;  1BC7 C;  2ELJ A;  3E5X A;  3T8R A;  5CYV A;  3S14 J;  2COM A;  1J0R A;  4N9I A;  5H6Q A;  1XX5 A;  4MQ9 F;  1Z77 A;  2COB A;  3WTT C;  4HDV A;  3PO2 J;  4EMS A;  3FKI J;  1RC9 A;  3P5J A;  2DQL A;  3S3O A;  2OZU A;  2EA2 A;  3GF2 A;  1RKW A;  4AYB A;  1U5T A;  4DZP A;  1W7P D;  3GEZ A;  3OS2 A;  1FSE A;  2KDO A;  3OYE A;  2IS6 A;  4HQE A;  5J40 A;  2RQP A;  4OIN F;  5F6F A;  4FCY A;  1G2H A;  3K4L A;  1STZ A;  4XKW A;  5CVV A;  3G4S I;  1FBS A;  3JRB A;  3S8P A;  3WOD F;  4WX9 A;  2K3P A;  3K4N A;  5L3C A;  4B09 A;  1BR2 A;  4NC6 A;  3HJE A;  1MNE A;  2LKP A;  1MJB A;  3O2P E;  1DGR M;  1T56 A;  4M3B A;  2PN6 A;  3D5R C;  2R7T A;  3LMM A;  4DYQ A;  2XAQ A;  5CPR B;  4ZYG A;  4AVP A;  3O6B B;  4GDF A;  3RPU D;  3ZN1 A;  1TBX A;  3E6D A;  3IRQ A;  2KPM A;  2OZ6 A;  4I2O A;  3E5Q A;  4XON A;  2OF7 A;  3BJO A;  1R7J A;  4L9N A;  1K61 A;  1APL C;  2PMH A;  3DU5 A;  4LK1 F;  2HZT A;  5FFX A;  2CSO A;  2ICW G;  1FX7 A;  4AYB N;  4BKX A;  1I3A A;  4KIB A;  4ANJ A;  2FMY A;  1MDM A;  1Z7U A;  1ZG1 A;  2O61 A;  1F43 A;  4GYG A;  2NS8 A;  2QF7 A;  5FRO A;  5H20 A;  1YW9 A;  1D3Y A;  3KP5 A;  3BPX A;  3V8K A;  4Q4Z F;  1VQO I;  3CUO A;  2DLL A;  1ZGJ A;  3WG7 H;  3L1P A;  1V5F A;  3KPH A;  2QLZ A;  3L2U A;  1Z0X A;  1V5E A;  1S5L C;  2VBZ A;  3VYS B;  3L7W A;  1I50 J;  4II3 A;  4Y3O A;  4A3K J;  1IC8 A;  2AS5 F;  1S7A A;  2VBW A;  3FXU A;  4UVB A;  3M8E A;  4OIR F;  5FKO A;  2O8X A;  2X9D A;  1FP2 A;  3BJ6 A;  4M6X A;  1DP7 P;  1U9O A;  4DGW B;  1R4M B;  1RUO A;  1YRN A;  4UHT A;  4EQQ A;  1D0X A;  5CVJ A;  4BGD A;  2VE8 A;  2JK3 A;  5KCM A;  1A6Q A;  1ZHF A;  2ECB A;  5F0H A;  2R7Z J;  1GVJ A;  2L9V A;  4S0H B;  4CXF A;  4U0Y A;  2QEN A;  2R7R A;  4PGH A;  2E1C A;  3S16 J;  2DYR H;  3E7L A;  4YFX F;  4BJ6 C;  1YIT I;  1WKM A;  2IS1 A;  2HVQ A;  1IV8 A;  5DD4 A;  2XAU A;  2ZXI A;  5TGT A;  3G1L A;  3F23 A;  3CCV I;  3LST A;  5K1Y A;  5J1R A;  2MH2 A;  2WV0 A;  2LYC A;  2XSJ C;  5GP9 A;  4E7Z A;  3CJN A;  1S72 I;  5TIS C;  1POG A;  3R4K A;  4C9Y A;  1U8B A;  4F93 B;  2VLA A;  2KHM A;  2ISZ A;  3LWF A;  4MQV A;  3KP6 A;  4DJA A;  2KIU A;  4ZYH A;  5FD5 A;  1SD7 A;  1WRJ A;  1B6A A;  3H0D A;  3ZQL A;  1FYK A;  5FRM A;  2O5R A;  5L3B A;  2FOK A;  3K6G A;  2JSC A;  5FLX Z;  4ZTJ A;  5FD6 A;  2VUM J;  4WCG A;  1DP3 A;  5FLX K;  4AWX B;  4IVN A;  5K5Q A;  3PUB A;  4JK1 X;  3WTS C;  2HXI A;  2QWW A;  3ERE D;  1Z7L A;  1IXS B;  2W84 A;  1EH8 A;  3JSP A;  1TW3 A;  3SHF A;  2VKH A;  5ICF A;  3OYC A;  4A5N A;  2EQR A;  3EDP A;  4U0W A;  3GTK J;  2PI0 A;  2ZKZ A;  3OYF A;  1I27 A;  4EJO A;  2NVX J;  4BNC A;  1BR4 A;  2M0C A;  2EIN H;  3K0L A;  1ETY A;  4HV5 A;  3ZQG A;  4UB8 C;  4IHS A;  3C18 A;  4AD9 A;  3FM5 A;  2LD5 A;  5K5R A;  2VL8 A;  4A0Z A;  2JSP A;  1BW6 A;  4RAZ A;  3TO6 A;  5EEH A;  5D4S A;  2HU9 A;  3OY9 A;  2QQ8 A;  2QQ9 A;  4XOT A;  4HNU A;  3JRA A;  3GZ5 A;  5IP9 J;  1SFO J;  1SFK A;  2VC0 A;  3HHG A;  4GYI A;  4PJJ A;  1P7J A;  3BQZ A;  1XGS A;  3FX3 A;  2RC4 A;  3WTX C;  2VQL A;  4X1E A;  2XB0 X;  1LEA A;  2L2O A;  3AG1 H;  3M07 A;  2VIX A;  2WB1 A;  3CCU I;  1ETV A;  3CUQ C;  2F5E A;  4IOA F;  1B72 A;  4OWR B;  5FRN A;  2XF5 A;  1FYM A;  1MBG A;  1UZC A;  3GUD A;  4M71 A;  1FSH A;  2ESH A;  2K9M A;  2UZK A;  4XK4 A;  1YI2 I;  1MIJ A;  1BR1 A;  2XVC A;  4RGX A;  4RLQ A;  2GIZ A;  5CKT A;  4MLO A;  1BOA A;  1XPX A;  1JUS A;  2A6T A;  3NAU A;  3DEU A;  1JUP A;  1R36 A;  3H9G A;  3HL2 A;  1E3O C;  3ESW B;  3HGG A;  3S2W A;  4A12 A;  3AKZ A;  1K4S A;  3CUQ B;  4FE4 A;  3DKX A;  2MW8 A;  3Q0W A;  3BWG A;  5ICC A;  2JTV A;  2NOJ B;  3L2C A;  3GO5 A;  4Q48 A;  2Q8K A;  1IZ1 A;  4RMN A;  1XC5 A;  3ZXS A;  3HGY A;  4MNU A;  2CW8 A;  2DFI A;  2CYY A;  2ZC2 A;  4A2U A;  2XUB A;  4F52 A;  4A3D J;  2V1U A;  3P9K A;  3QYF A;  3JRI A;  1LB2 A;  2VOD A;  2A05 A;  4HOB A;  1D1C A;  3CCR I;  3DPL C;  2FA5 A;  2WB1 N;  4PCQ A;  1FT9 A;  2NAZ A;  1VQ7 I;  2GBY A;  2RV8 A;  1XCB A;  3V4G A;  2LKX A;  3MVP A;  2XAH A;  3K1M A;  1P9Q C;  4XSX F;  1YIO A;  2F5F A;  2A3S A;  2BVL A;  1W5S A;  2LVS A;  4K2E A;  2ID3 A;  4FET A;  1QPI A;  4D7M A;  5J4V A;  2JA7 J;  4I7H A;  2XGE A;  3ZQH A;  4BHC A;  4XKV A;  1HW5 A;  1BJA A;  1ZKG A;  2KIM A;  2EH3 A;  3MD2 A;  2W57 A;  2OU2 A;  2B9S A;  2P6T A;  3N97 A;  3G1M A;  1SVM A;  3A0H C;  3P7N A;  3QP6 A;  4CZZ A;  3RJP A;  3OYJ A;  3DPT A;  2X1C A;  4RS8 A;  1G3T A;  3X2Q H;  1R5G A;  2KZV A;  4ON0 A;  4ZTF A;  2L5Q A;  2XRN A;  1X3Z B;  2F2E A;  3I5U A;  3ZN0 A;  4G7Z F;  4RDU A;  3HXL A;  1YS6 A;  1K7A A;  3CF5 F;  3FZV A;  1KA8 A;  3BPV A;  4I02 A;  4O6J A;  1K78 A;  1R1V A;  4A3G J;  2MYS A;  2KIQ A;  1QBJ A;  3JTH A;  1KYZ A;  3RZD J;  1UEL B;  3IH3 A;  3ULQ B;  3ASO H;  3LNQ A;  4FX4 A;  4UUV A;  1ERD A;  1IN8 A;  2HNH A;  1R1U A;  2PLY A;  1WJ5 A;  1Z21 A;  4G6D A;  2GXB A;  3HSR A;  2DDB A;  4KT5 C;  4ZH4 F;  1AHD P;  5E20 A;  2GAU A;  1FOK A;  3PFY A;  3K1P A;  1IUY A;  1HKT A;  2WBM A;  2FRH A;  3S93 A;  2ZJP F;  4E7K A;  3GWZ A;  4BDZ A;  1PUF B;  5E3L A;  2QKM B;  4BQA A;  1IUF A;  1ZR4 A;  3GYH X;  1G6N A;  4LB6 B;  3OR2 C;  3AG4 H;  2LH9 A;  2OCE A;  1LFU P;  3HTS B;  4UV9 A;  5E8G A;  2FEZ A;  1H0M A;  2AO9 A;  3R6S A;  2V9P A;  3PJR A;  2YR2 A;  1D1A A;  4KIF A;  4L0Z B;  2VKE A;  1I6H J;  3IHU A;  3RI4 A;  5ILV A;  2TCT A;  4HA8 A;  4DZJ A;  2E71 A;  3CZ6 A;  1H89 C;  3V42 A;  5BQT A;  2NYX A;  5L3F A;  4C3I J;  1J9I A;  2M4K A;  3HUG B;  5FGM A;  1ZAR A;  2BW3 A;  3CF2 A;  3K4B A;  4D5F A;  4Z6Y A;  4XOP A;  1QPM A;  2EV6 A;  3HIF A;  1BIB A;  3OYG A;  3KLO A;  2DMQ A;  5J4Y A;  1O7F A;  2G9W A;  2DA1 A;  3OIP A;  4KMU X;  2FQ4 A;  1QHH D;  4JX6 A;  3RTR A;  2RQQ A;  3WGH A;  4ZZD A;  3LQQ A;  4E7H A;  3BR6 A;  1RES A;  4PJN A;  1IN6 A;  2ZJ2 A;  2P5V A;  1TTY A;  3D5L A;  2FD5 A;  2QEX I;  2RDP A;  4AIH A;  3PIO F;  1R4N B;  2DCE A;  3QQA A;  4A3E J;  3RYR A;  1XSV A;  4A3F J;  4KN4 X;  2NOG A;  4S05 A;  1WJC A;  2G7U A;  1TT0 A;  3S3M A;  2M30 A;  3UNG C;  5B3S H;  4E7S A;  3EYY A;  4UXN A;  3E97 A;  2QSG X;  2E19 A;  2E5N A;  3IH4 A;  2HVS A;  3BG6 A;  1RUN A;  4DBQ A;  4A3I J;  4IHV A;  1R58 A;  4LMY A;  2X6O A;  3O8H A;  2IGO A;  3PQK A;  5IP7 J;  5HOD A;  2PX9 A;  2GOM A;  2KIF A;  3BZ6 A;  1BOB A;  2YU3 A;  2PFB A;  1VQM I;  4M74 A;  2EZL A;  5LEK A;  4LIU A;  1U5T C;  2YS9 A;  5M3M J;  2MLG A;  4N4O B;  1F4K A;  3U21 A;  1Y6I A;  3FDY A;  1J5Y A;  5E1W A;  5FKK A;  3FBN B;  4U87 A;  1Z1D A;  4ENJ A;  3ASN H;  3CMA I;  3TQN A;  2GLO A;  4FHT A;  2DI3 A;  1FBU A;  2CUF A;  2HDC A;  2LLK A;  3CCQ I;  1Z91 A;  1Y8Q B;  1Z3X A;  3FK6 A;  3CCM I;  1O57 A;  2H94 A;  3JAM Z;  3GME A;  4FT8 A;  1FEX A;  1U5T B;  3H0G J;  1TWC J;  2F4O B;  2R7F A;  1AKH B;  5BMZ A;  2Z99 A;  3PUF A;  4CCK A;  2FX0 A;  3QOE A;  1IAW A;  3JRH A;  4IKF A; 
#chains in the Genus database with same CATH homology
 3K70 D;  3OIQ A;  3OYB A;  3SZG A;  2VXD A;  4HEA 2;  2K9L A;  3OS1 A;  4PUS A;  5HNH A;  2ELJ A;  4PSW A;  3HG9 A;  2JVH A;  3SEQ A;  3BCB A;  2R7S A;  4CCO A;  3MKY B;  4HPQ A;  3S3O A;  3OYM A;  4IX7 A;  4ZDP A;  2M7B A;  4AYB A;  3LSG A;  3L2Q A;  4HNT A;  2R7X A;  3OS2 A;  2HZD A;  4RM2 A;  2KDO A;  3OYE A;  2IS6 A;  2IS2 A;  1Y56 A;  2WAD A;  2CS3 A;  3K4L A;  4B3X A;  4XKW A;  2WAQ A;  2AQE A;  4XM3 A;  1QHG A;  3S8P A;  3HC7 A;  2K3P A;  3K4N A;  1OLT A;  4F3Q A;  4JQF A;  2VJI A;  4AU7 A;  1BR2 A;  5LD2 C;  1MNE A;  1ZEL A;  3I3L A;  3OL4 A;  3PNT A;  4EAT A;  2A5W A;  2ZFU A;  2VPL A;  1DGR M;  3D5R C;  3H9J A;  1UAA A;  2R7T A;  3LMM A;  1X1A A;  5CPR B;  3M8J A;  2W00 A;  1MMD A;  4CA0 A;  3RPU D;  3D5S C;  4BEH B;  2I8D A;  2M4G A;  1NG7 A;  2KPM A;  2DT6 A;  3OYA A;  3DPU A;  4XON A;  4BE1 A;  2V7F A;  2R7V A;  2ZSI B;  4ZJZ A;  4XLA A;  3DU5 A;  2X85 A;  2KMU A;  3UR3 C;  3CJR B;  3SDB A;  2LRD A;  3J7A Y;  3OYN A;  4ANJ A;  2WAF A;  4OAZ A;  5FRO A;  3OMY A;  2RRE A;  2VXZ A;  3VSL A;  2IGK A;  2BOL A;  2R7O A;  3DTE A;  3G2B A;  2R7U A;  1LVK A;  4IQ4 A;  3OOU A;  3LSM A;  1DGW Y;  3C2H A;  1V5F A;  2CV2 A;  3H5N A;  4PK4 A;  3LL7 A;  3L2U A;  3K10 A;  1MND A;  1V5E A;  3H35 A;  1OR7 C;  4U7B A;  3PNV A;  2R7W A;  2W4S A;  3VYS B;  2V9K A;  3ZRG A;  4II3 A;  4Y3O A;  2PJR B;  1X1B A;  1KON A;  4C30 A;  2KRH A;  1YX5 A;  4QPQ A;  3DTK A;  4PJL A;  1TZL A;  2V6E A;  4F91 B;  4DGW B;  1D0X A;  4BGD A;  4NQW B;  5KCM A;  4II2 A;  3BG7 A;  3OYD A;  2PMZ A;  3IUO A;  3H5R A;  2R7R A;  4LG3 A;  2K5C A;  1Z3Y A;  3FKJ A;  2X1D A;  3GBG A;  3K4K A;  2L7K A;  4BJ6 C;  4X0G A;  1DQU A;  3ZGK A;  2IS1 A;  2HVQ A;  3A1Y A;  2DT7 B;  2PJR A;  4PJM A;  2XAU A;  2ZXI A;  1T0F C;  5TGT A;  2HQA A;  3DU6 A;  3L2R A;  3HKZ A;  1EA3 A;  2LYC A;  3IAM 2;  2XSJ C;  2HDW A;  4E7Z A;  4BQQ A;  4CCL A;  3AL0 B;  4ZDL A;  4C9Y A;  4F93 B;  3PL8 A;  5LFA A;  2JA2 A;  4KJZ A;  4FAS D;  2KHM A;  3VDX A;  2VLA A;  3FHN A;  3A4C A;  4DJA A;  2HPM A;  5CQG A;  2CUJ A;  3H0D A;  2VJ5 A;  3OYK A;  5FRM A;  2O5R A;  4CUG A;  3OWT A;  3VYR B;  2XC7 A;  3K6G A;  4BAC A;  2CV0 A;  4ZTJ A;  2E5Z A;  1DP3 A;  1LKX A;  2W82 A;  3CP2 A;  3PUB A;  4DBR A;  4CCM A;  4KT6 A;  1Z7L A;  1X4O A;  4IZZ A;  2CUZ A;  2VKD A;  2XDV A;  2VKH A;  3OYC A;  2Q2E B;  4KIT B;  4BQN A;  4XOR A;  4Y4R A;  2R4G A;  4HRI A;  3OYF A;  4CH7 A;  2F5V A;  1V5G A;  1K6Y A;  1T95 A;  1BR4 A;  2JVG A;  2V26 A;  1HA8 A;  3FBI B;  4PSX A;  2X6X A;  4BS9 A;  1UG0 A;  4C2U A;  2MD0 A;  2VL8 A;  1WJF A;  3H9Q A;  4XQF A;  3IP4 B;  4KIS A;  2JSP A;  3CMM A;  2HU9 A;  3K4M A;  4BE0 A;  4D9J A;  1W36 C;  3OY9 A;  4XOT A;  3PNY A;  4HNU A;  4CZC A;  3VSK A;  2KLO A;  1SFK A;  1WJD A;  4PJJ A;  2HVR A;  4XNF A;  2Q1Z B;  4Y33 A;  2VQL A;  2L2O A;  4XN3 A;  2VIX A;  2WB1 A;  3TBI A;  5CQE A;  2DOA A;  4OWR B;  3EUH C;  4OAY A;  3SEZ A;  2DXI A;  2XF5 A;  5FRN A;  4BUP A;  3EPZ A;  2K9M A;  2LRE A;  1BR1 A;  3W2W A;  4RLQ A;  5CKT A;  4MLO A;  4XLC A;  4R79 A;  4ZYA A;  4BJ5 C;  2A6T A;  3RQ4 A;  1G8X A;  4NC8 A;  3C2G A;  3H9G A;  3HL2 A;  2UWM A;  2ZSH B;  1U0J A;  4BEH A;  3S3N A;  4XKC A;  3AKZ A;  4RLF A;  2RNG A;  4G6T B;  3DKX A;  4LIT A;  2F4I A;  2V1N A;  2CH0 A;  2NOJ B;  4RMN A;  3ZXS A;  2CW8 A;  2KL4 A;  2WY7 Q;  4F52 A;  4E4H A;  2V4J C;  5HVQ C;  3QYF A;  4JOM A;  4YRV A;  2IGM A;  1R6R A;  4CSW A;  3ZCO A;  1D1C A;  3DPL C;  3TL4 X;  1X4P A;  1NG6 A;  3PSF A;  5HLT A;  1N78 A;  3LSH A;  3DQV C;  3OR1 C;  4XLE A;  3S32 A;  1QU3 A;  1E0E A;  3AL0 C;  1P9Q C;  3LFU A;  3W3C A;  4B48 A;  1WJB A;  4QPO A;  2BVL A;  4E6K G;  2QKL B;  4XKB A;  3RCO A;  3VWB A;  3L2V A;  4FET A;  4B47 A;  4XKV A;  3TMO A;  4XN0 A;  4J00 A;  3MD2 A;  4ZDO A;  4XL9 A;  3MMY B;  1D0Y A;  3MKW B;  1N75 A;  2L9N A;  3OYJ A;  4BL0 B;  2XF7 A;  3DPT A;  2X1C A;  3E0J B;  2KZV A;  4ZTF A;  2L5Q A;  1X1D A;  1VZ0 A;  4C2T A;  2LY2 A;  2WA0 A;  3HXL A;  1LFP A;  2E1M B;  2LOO A;  2VJ4 A;  3AFH A;  2IXS A;  4PFP A;  3RSN A;  3IAS 2;  3BCA A;  5HNF A;  2KP6 A;  4HSR A;  5JHF A;  3CJQ B;  2MYS A;  2UV1 A;  3HPG A;  1X1C A;  1X19 A;  3N05 A;  5KNL A;  4BQO A;  1UEL B;  1WJA A;  1LDK B;  2JUG A;  1ERD A;  3OYI A;  2HNH A;  1WJ5 A;  1Z21 A;  3EUK L;  2OUM A;  3QYE A;  3DWL E;  4DIQ A;  5KHD A;  3OL3 A;  4XR6 A;  2X1E A;  3PFY A;  2X51 A;  3ZR8 X;  3L2W A;  3HOS A;  2WBM A;  2BW3 B;  3S93 A;  4E7K A;  2CMP A;  1SAU A;  4BDZ A;  1IRX A;  2GOX B;  2QKM B;  2M7A A;  2F6C A;  2M0M A;  3A2K A;  4BJT A;  3OYL A;  3VYU B;  1FMV A;  3OR2 C;  1MW7 A;  4GRI A;  2LH9 A;  2OC6 A;  3CES A;  4HST A;  3VYT B;  4NC7 A;  3F9K A;  4BU2 A;  3LSI A;  3BLY A;  3DLA A;  3PJR A;  3SYT A;  1D1A A;  1D0Z A;  3KYL A;  3MKZ A;  2WAE A;  1S9H A;  4PFO A;  2HPI A;  3CZ6 A;  3QYB A;  2L9S A;  2VJJ A;  4YEL A;  3V42 A;  1AA7 A;  2W7N A;  2CFO A;  1N77 A;  2M4K A;  3HUG B;  5HOO A;  3CP8 A;  4F55 A;  2BW3 A;  3DKY A;  3CF2 A;  3K4B A;  3NWT A;  4XOP A;  4NUB A;  3LSK A;  3OYG A;  3DEE A;  4RM3 A;  1J09 A;  4H4K C;  1WFX A;  3OIP A;  1MMN A;  1QHH D;  2KRC A;  3RTR A;  2LY1 A;  4E7I A;  2IGN A;  1FMW A;  2RQQ A;  4ZC3 A;  4E7H A;  1MMA A;  2X6W A;  1YX3 A;  3E1S A;  4CCN A;  1YE9 A;  3K4C A;  4XMY A;  3M1C A;  3H5A A;  4PJN A;  2DJI A;  4CCJ A;  2Z16 A;  3D5L A;  2R7Q A;  2M3A A;  2XF6 A;  3W2A A;  2VQC A;  3KX2 A;  3EUA A;  1WJE A;  1W36 D;  2DCE A;  2VQH A;  4XLF A;  1G59 A;  3PSI A;  2MFZ A;  1GLN A;  2LBF B;  3K4J A;  3ONQ A;  2Y0S A;  1WJC A;  2Z1D A;  3HOT A;  1TT0 A;  2LC2 A;  2VAS A;  3UNG C;  4D1Q A;  3S3M A;  4E7S A;  2VQG A;  4BDY A;  4IQJ A;  2ZXH A;  2OV7 A;  3KEY A;  2E5N A;  2HVS A;  3ZQQ A;  3NWS A;  3BG6 A;  2MAB A;  4DBQ A;  3K70 C;  4J01 A;  4HG2 A;  2IGO A;  2P0W A;  2VB6 A;  3QOD A;  4DOZ A;  2GOM A;  2FUG 2;  2E1M C;  1BOB A;  4P1W A;  3BC8 A;  1PYV A;  4ITV A;  4N4N B;  4LIU A;  4NNJ A;  3HPH A;  4N4O B;  1PJR A;  4YEJ A;  3U21 A;  4BE2 A;  1Y6I A;  3FDY A;  3FBN B;  4U87 A;  2Z2S B;  4B43 A;  2WY8 Q;  2LBF A;  1MMG A;  3I9V 2;  2E60 A;  4F92 B;  2CW7 A;  3OYH A;  2W1O A;  3DTI A;  3W2V A;  4LIV A;  1JI8 A;  4E7L A;  2IS4 A;  1Z3X A;  4B44 A;  2AQF A;  4E7J A;  2UUZ A;  1D1B A;  2LG4 A;  2X6Y A;  4BXF A;  2MC4 A;  4CCK A;  4IKF A;  3QOE A;  2CV1 A;  4P5O A;  2KQR A;  4AVZ A;  2BVM A;  3OS0 A;  4XLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...