2XF5A

Crystal structure of bacillus subtilis spp1 phage gp23.1, a putative chaperone.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
49
structure length
49
Chain Sequence
SESLLYGYFLDSWLDGTASEEMMRVAVNAGDLTQEEADKIMSYPWGAWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Bacillus Subtilis Spp1 Phage Gp23.1, A Putative Chaperone.
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
molecule keywords GP23.1
total genus 13
structure length 49
sequence length 49
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xf5A00
2XF5A 2XF6A 2XF7A
chains in the Genus database with same CATH superfamily
2VL8A 3LQRA 5E1WA 3KX2A 5E17F 3S14J 2G7UA 3I59B 2UUZA 4HX8A 2A6EF 1JI8A 1IRFA 3CUQC 3AKZA 4ENJA 2A68F 3KP4A 5IP6A 3KYLA 4RB3C 2EBIA 2FBKA 1WJAA 3DPLC 1VZ0A 3HOWJ 3BR2A 5E3OA 4ZZDA 2F5VA 1Y56A 2LLKA 2M8EA 4A3DJ 1J9IA 2E1OA 3K2ZA 3I5UA 1BW5A 1L0OC 2R5YA 3WGIA 1PDNC 5LBQA 3O8HA 3COAC 1HCRA 1JKOC 4ESBA 2W85A 3S1RJ 4FX4A 3J7AY 4CSWA 3D1NI 1QPMA 4Q4ZF 3QU3A 3GTJJ 4YELA 3LA2A 1X4PA 2ECBA 3BJ6A 2XKPA 3K0LA 4HW0A 5D5XB 4J01A 4EV0A 3U9GA 1FYMA 1U9NA 4L5JA 1P7IA 1FC3A 3TO9A 1WPKA 3OS1A 1FTTA 3BJOA 3OIQA 2E7XA 3HOTA 2X9DA 1G6NA 5FD6A 1Z6RA 3O6BB 1DGWY 3RZDJ 4CCKA 2DW4A 2MH9A 2VT3A 2HI3A 4YG2F 1SEUA 3BQYA 4XN3A 4XNFA 3GTQJ 1REPC 1EF4A 2IP2A 1FIAA 3L9FA 4DOZA 4LOCA 3M4OJ 3LOCA 3DTEA 5IT9Z 1U9OA 3ZR8X 4L0YB 4LD5A 2JVGA 3O3KA 3I4NJ 2COMA 1XGOA 3AL0C 4YFNF 3KZIC 4WXDA 3VYTB 2XAFA 3DP7A 4B43A 4DYRA 1FX7A 3PFIA 4XIDA 2Z1DA 4Y15A 3DV8A 4F3QA 1YLFA 3CDLA 3ERMA 3HSFA 1KQ8A 1SFUA 3UNGC 1J09A 3HOYJ 1I6HJ 3QRFF 1YW8A 1U8BA 2KP6A 4RLFA 2BE5F 3HSRA 1TWHJ 2ISZA 4ENNA 2F5DA 1B72A 4HQEA 3K6GA 3JCUC 4L5IA 1I39A 2P4WA 1NHAA 5E1ZB 4YRVA 5B3SH 3K7AJ 4MEYF 1IF1A 1SAXA 2DLLA 5GAHJ 2OTLI 2X1EA 3V4GA 1T56A 4PGGA 1A36A 4KIFA 4UVAA 1G3YA 3SFZA 2E5ZA 2VQCA 3BWGA 3OYGA 2JA5J 3S2WA 1TQIA 4MNUA 2W25A 5J47A 5L3CA 3NWTA 2VKHA 2D2WA 3FXOA 4BUPA 3HKZA 3JRHA 1NG7A 3LAPA 1T6SA 4I7HA 3ZQQA 3FMQA 3KYCB 2R7UA 4LG3A 3BCBA 2VQHA 3HL2A 3KP2A 3RKXA 1RESA 3ZQGA 3VPRA 4ZDLA 1TT0A 4NNJA 1R58A 2Q0OA 3WU0A 2ZXIA 2EA4A 5GAEJ 1DPRA 4N9HA 4GXOA 3K1PA 4DBQA 2C6YA 2KRCA 3LSMA 1I1SA 3CMEI 1XN7A 1SMTA 2R3SA 1JGSA 2ZXJA 4XKVA 4RGXA 3WTVC 1FOWA 3TEDA 2ETHA 4OIQF 3H0GJ 4OAYA 1VQ7I 3E1SA 1YQAA 3DEEA 2OF7A 2HPIA 3HYIA 5IPAA 3RYPA 4HNVA 1FIPA 5IOZA 1VTNC 1SD7A 4BE2A 4JP0A 4P55A 2Y0SN 1R1VA 1W36C 3FKIJ 2B63J 3IWZA 1X1BA 2HU9A 4M9XA 1HC8A 2JK3A 2J5PA 4O6JA 2JPBA 3CCYA 2JA7J 1XCVA 1QQIA 1EH8A 2WB1N 2R0QC 1TLHB 3KIOA 3KEQA 4BACA 4AVZA 1TWCJ 3N97A 4LB5A 1IJWC 4LMYA 5FLVA 1IN6A 3JTGA 2EQRA 2OQRA 4KUMA 1TNTA 2ME0A 3IH2A 1HQCA 3N4MA 1X58A 5FLXZ 1KU9A 2EJRA 1WVRA 1LPQA 4MIMA 1XC5A 3WE2A 2X6OA 5A2QK 5GADJ 3DEUA 2DT5A 2R5ZA 3BP8A 1LEBA 5LRRA 2KLOA 3FM5A 4IQ4A 5FO5A 1WJDA 4CXFA 3A02A 1YYVA 2JA8J 2CUJA 2A6TA 3V8KA 4M74A 4XMYA 2NVXJ 3CDHA 3JRGA 3JTHA 4IZZA 1VNDA 4L9NA 2WY8Q 4XORA 5K7HA 4D1QA 3J80Z 3RI4A 4RAYA 4FE4A 3C18A 2M9HA 2VJIA 1YS7A 1YRNB 3GTGJ 3CC2I 3DF8A 2OA4A 5LGUA 3AG3H 1D1AA 3B6AA 1W7PA 4CYCB 3LA7A 2JA6J 2OCCH 1ZN2A 4HA8A 4LIVA 2M7BA 4LIUA 2WAQA 4BBSJ 5IYDJ 4EGZA 2IGKA 2PBIA 4EATA 1XD7A 4U88A 4RAFA 4P9FA 5DV5A 4MHGA 2DFIA 3IH3A 3GZ5A 2CQKA 2X0LA 3F8MA 4YIIA 5KAFC 2DYSH 5JFRA 2UV1A 5LHIA 2K3PA 2HTSA 4JYKA 3IC7A 2L3DA 2UZKA 2A61A 1BL0A 3AG2H 1BI0A 1WCMJ 2ZMEA 2FQ3A 3F21A 3F8BA 3SDGA 3F6OA 1VF9A 3ELKA 1QGPA 4CZZA 2BHZA 4PJJA 2P0WA 3PQJA 5GPAA 4D7NA 3OS2A 3S1QJ 3MZHA 1IXCA 2STTA 3CD6I 2PJPA 3I58A 5DCMA 2IPQX 1JUPA 2LG4A 4BH9A 1JUMA 3SZGA 4EJWA 3PNYA 4GCVA 4E7KA 1S3JA 4AVPA 3CUQB 2HYJA 1D5VA 3GFMA 4EGYA 3RKYA 5EGOA 4C3HJ 2HQAA 3H5NA 3ZPLA 4I02A 2V1NA 3BJAA 5CPRB 1IN8A 1BIAA 3BG6A 2GXGA 4G94A 3OYIA 1I3AA 1KZHA 4BQQA 3RCOA 2YX4A 3TBIA 2HGCA 5FLXK 3FXRA 2GBYA 3PSIA 2Y9ZA 2F4OB 1MSEC 2ME6A 1N77A 4A3GJ 1QU3A 4QIWN 3CCJI 2NS7A 3KP6A 3ABMH 3PNTA 3V7SA 1B59A 5IY5H 5J3LA 3OYFA 4S05A 4XLPF 2RN7A 5B1BH 2LF8A 4PSWA 2KRHA 2OPTA 1X3WB 3SZTA 3IP4B 1V5EA 2DU9A 1YW7A 2UWMA 4LLGF 1RETA 1MBKA 1SVOA 1Z0XA 5CYVA 3ZGKA 5B1AH 2HS5A 3BROA 2DJIA 1D1CA 3PFYA 4AU7A 3G73A 2E35A 4XOPA 4J19A 3GLXA 3ZQLA 1SFKA 3P7NA 2M30A 3K4LA 3EUAA 2LDUA 2CU7A 4E7IA 2VKVA 4R79A 3AL0B 3F8NA 4IRGA 2XB5A 2GA1A 1K79A 4LITA 1D5YA 2GOXB 4S0HB 4KDPA 5FKNA 1HDDC 3HRTA 2M4GA 2M45A 1NTCA 3W6VA 2PMHA 4Y33A 3GLLA 2M7AA 5LFAA 1MGTA 2HKXA 4ETSA 3CTAA 1Z7LA 4HF0A 1JKPC 1WI9A 3MZ8A 3QPTA 2LBFA 3FHZA 1YS6A 5EYRA 4B47A 1U5TC 3WTYC 2TRTA 3QODA 3V8LA 3G2BA 3KP5A 2F5FA 3CCRI 1IC8A 3PUBA 4A2UA 3PM1A 2RVCA 1NG6A 4HEA2 4BL0B 3BTLA 3TKYA 1SMYF 4UUSB 4CCNA 1ZQ3P 3JAMK 1P4XA 1XB4A 3RZOJ 3BG5A 4PCQA 3DU6A 3M1CA 3WG7H 1TWAJ 2PX9A 2P6TA 1UCRA 1X4OA 3ZMTA 2DA3A 2Y30A 4E6KG 5LHGA 1USTA 1HSJA 2F4IA 1P6RA 1IDZA 3PJRA 3JW4A 5HLGA 4W1UA 4MFEA 3KLNA 3HGYA 2R5ZB 3KEOA 2ELJA 2WAEA 2VQLA 3E7LA 3EQLF 4UB6C 2VI6A 2XDVA 2J5OA 2JRTA 4H4KC 3MWMA 3J81Z 2L0KA 5H6QA 3E0JB 4HDVA 1BW6A 1ZG1A 4HX7A 5FLMJ 4MTDA 1ETQA 2ZXHA 2LKSA 1G2HA 4IL6C 3HC7A 4HNUA 3WU1B 3FWEA 3HB9A 3F72A 2LD5A 3E5UA 1ZGWA 2R7ZJ 1RKWA 1FNNA 1PUEE 1R7JA 3LSRA 2I10A 4LG0A 4RDUA 4M72A 4UVCA 5CVIA 1LDJA 2E1CA 2LP0A 3G4SI 3P9IA 3IKTA 5KNLA 1LJ9A 1ZREA 1O3QA 3ZMVA 1OR7C 2E5NA 3LSIA 1J0RA 3JRBA 5HDNA 1E17A 4RB0A 2R7RA 2JUCA 1ZGJA 2CMPA 1ZELA 2RC4A 3NQOA 3EUHC 3G1LA 3FK7A 5BNGA 5E3NA 4RAGA 2Z16A 4ZYHA 2DQLA 2CG4A 1Z9CA 3LMMA 4IHWA 3M8EA 4N9IA 3FX3A 4IXAA 3OYEA 2QKLB 2DMPA 4A0ZA 2BV6A 3JRFA 3C2GA 3CJNA 4U7DA 1B72B 5DEQA 3MKLA 4CA0A 5F1RA 2GXAA 3U1KA 2R7FA 2XC7A 4M9ZA 3RDIA 4FHTA 3DEWA 5EZHA 1KYWA 2K27A 3A0HC 5ICEA 1YIOA 3A01A 3ROUA 3J7YJ 5JVTA 3CCMI 2XRLA 4CUGA 5L3EA 4A3JJ 5F04A 3LL7A 1MH4A 3QWLA 5DD4A 2MH2A 4IF4A 2DMNA 4PJMA 2FNAA 9ANTA 2LSOA 3WGHA 4WK8F 2Z33A 2WWYA 3Q0VA 5HS8A 3K4BA 3HTUA 4CO8A 1DU0A 2E36A 2WV1A 1EJ9A 4DQ2A 2YR2A 2UXXA 3R61A 1EKEA 2VN2A 1IRXA 2KT0A 3CJQB 2L02A 2HVRA 2ELKA 5FD5A 2L7MP 2ZBKA 3I3LA 1T38A 3OYJA 1FSEA 2MC3A 2V6CA 1ZRFA 5FRMA 1G4DA 2HOTA 5IYCJ 5HDKA 3ZXSA 1RC9A 1WQ2A 1FMWA 1FSHA 4BU2A 5L3BA 3G6EI 1UMQA 4KITB 2R7TA 1JT6A 1MW7A 2OJED 1X2MA 3NWSA 4XLCA 1IV6A 1DP3A 5BPIA 3J81K 1AHDP 1P92A 4G6QA 4EQQA 2CGPA 1Q1HA 1K6OA 1EH6A 1ENHA 4EM2A 1MIJA 2H6CA 2B7EA 1FEXA 3C2BA 2P8TA 4MFDA 4XLFA 3QAHA 5ED4A 4ZYDA 1MD0A 3MAJA 3SQNA 4CYCA 2B9SA 2G0EA 3WTXC 1FYKA 1AKHA 3CC4I 1RR7A 2JTVA 1MMAA 1JHHA 2VJJA 3WU2C 5EEGA 5FJ8J 2A5YB 1DGRM 1KONA 5EGOB 3R0JA 2XSJC 3B6CA 3OR1C 3HRUA 3K70C 2FE3A 1W5CC 1MJAA 1FP1D 3CCSI 4ZTJA 3CLOA 5FKLA 3Q0UA 1MSFC 3RKQA 4WCGA 3KPHA 2DI3A 3HRSA 2GIZA 3KYDB 3SDBA 3CCUI 4CZCA 2OV7A 3V7RA 2LF7A 1R6RA 1FOKA 1UHWA 2R7WA 2Z9OA 1P2FA 4AC0A 3CO7C 1AA7A 5DS9A 3MD2A 3DBHB 4F91B 1BC7C 3K69A 3UR3C 4KJZA 4BQNA 1U2WA 1XDSA 1FBUA 1APLC 2X85A 1B1BA 3HHGA 1ON1A 3S3NA 5LEJA 2AHQA 1X19A 4YFKF 4HRIA 3VWBA 3GFJA 5D6EA 1V54H 3W3CA 1O7LA 1GXQA 4UV8A 2K9NA 1HXDA 3MCZA 4U87A 3GTMJ 4V19K 2RV8A 3EUKL 1ZG5A 2H09A 5TISC 2BXYA 2VBWA 1IZ1A 2NYXA 1ZR2A 2IS4A 2GQQA 2QYOA 2K02A 1S6LA 5LHHA 1QZZA 2ESHA 1YX5A 1ZAOA 2KZGA 4BQOA 4X6AJ 5DD8A 3K4NA 4FASD 2CJJA 2DA7A 1U78A 4P5OA 3WTTC 2CO5A 4YIRX 4U7BA 1BA5A 1JE8A 1SFXA 1XPXA 3FXQA 2E2JJ 4X1EA 2JUGA 2IS6A 4OWRB 4JOMA 1OLTA 3FDYA 3VEPA 2IS2A 4I76A 2KDOA 1D3YA 3ZQ7A 4RAZA 5FKMA 4CCMA 4YFXF 1O3RA 1JKRC 1QRYA 1DQUA 1O3TA 4JX5A 1N25A 1R4NB 2L54A 4UUSA 1GVJA 1E3OC 1XX5A 3DPUA 4NUBA 2CQ7A 4PSXA 3R0AA 2L9SA 4HZFA 2DXIA 3L09A 2JMWA 2V6EA 5H2FC 2HKOA 1LB2A 2MYSA 1POGA 3K4JA 5CLSA 3K1NA 2W7NA 2P81A 2W1OA 2FXAA 4RM3A 2A07F 4MQVA 1VQ6I 4KT5C 1E3PA 1YG2A 3IAM2 4M9SA 2BOLA 1K78A 3GTOJ 1IRZA 1XMAA 2H8RA 1F5TA 2DTZA 1QHGA 2KPMA 2L9RA 1YIJI 2HQRA 3ISPA 1LQ1A 4FX0A 3BPXA 4XQFA 4IHVA 1QA6A 2EK5A 5FFXA 4BHCA 2DN0A 4HDUA 1X1CA 1HW5A 5FFZA 1I5ZA 2DCEA 1L3LA 2KDZA 1ZTRA 4FISA 4D7MA 1KU2A 1Y1VJ 2IJLA 4EVIA 5EF6A 3ERED 1P4AA 2HDDA 3PO2J 3DLLF 2X1DA 3VB2A 1GXPA 2JSPA 1R1UA 2WAFA 5FKOA 3RQ4A 3GBGA 2HOEA 5E1XA 1X1AA 2MLGA 4LG0B 2F5EA 2DTRA 3W6KB 5JR3A 3QU6A 4UNOA 1SC7A 2OAZA 1XS9A 2N8GA 4OINF 3OSGA 3SHFA 1RRJA 1OCZH 4ZDOA 2DA4A 1ACIA 4ZDPA 1SFEA 3LSJA 1GHCA 3Q5FA 3H9JA 4U0WA 5ILUA 3X2QH 3LAJA 2X1CA 2FOKA 2NOJB 5HLTA 4IHXA 2I5UA 5F6FA 5HS7A 2HXOA 4AYBA 2VODA 2WTEA 1DPUA 1BI3A 1IDYA 3D5SC 4LK0F 4IX7A 2KIUA 3FZVA 1OCOH 2BGCA 2MW8A 3WTUC 2AQEA 1U3EM 2MD0A 1RR8C 1HKSA 1A5JA 1W5SA 3ZMUA 3I0TA 3JAMZ 4GFBA 1Z67A 1G8XA 3JSOA 1VI0A 1X3ZB 2XVCA 4JQFA 3IUOA 2CFXA 1BN5A 1IUYA 4I0AA 5J8FA 2L4MA 3ZP5A 4EJVA 1WHUA 2HOSA 1WJ5A 1YX3A 3S15J 3CUQA 3ZMZA 4G7HF 1W0TA 4Q5SF 1V3FA 3RPQA 4B4CA 3DPTA 4XLHA 1RUNA 1BOAA 4OU0A 5JHUA 2OTJI 5D8LB 2VQGA 4NDLA 5C3EJ 1FPQA 1OQYA 2STWA 5CVUA 3PL8A 2R7QA 3HHHA 4XKCA 4L9JA 3QYBA 1K6YA 2VBZA 1J2XA 4QPQA 3A0BC 3FXKA 3CMAI 1IN7A 2ZJ2A 2A69F 3L2RA 4A3LJ 1WRJA 3KCCA 4V2FA 2FA5A 4BEHA 1VQ9I 3QPLA 5BMZA 4FT8A 2FSWA 3G1OA 4IHSA 1Y1WJ 2OZ6A 1ORKA 4A0XA 3JR9A 1YE9A 2DOFA 4NC8A 2XF7A 1D8KA 2XF5A 3WE3A 2QBYA 4IOCF 3HOZJ 1FOYA 4C2MJ 4BE0A 3BZKA 3OR2C 4HF2A 3C7JA 3GFLA 1MBEA 4A69C 2X4HA 3OV8A 4P1WA 4U0YA 1T08B 4Y52J 2A05A 4QLCU 1PUFA 2BW3B 2BVLA 1JXSA 2BY2A 3BG9A 3PIPF 1WZ2A 3J80K 3L1PA 1B8IB 3M8JA 3OIOA 5FRNA 2PG4A 2XGDA 2VJ5A 4F52A 4EJOA 4L5EA 3A01B 4IHYA 4RM2A 1SVMA 1AOYA 4JX4A 4I09A 1VQOI 1D1BA 5IOYA 4ZYEA 1SFOJ 1QVTA 2MLKA 1OCRH 4IQJA 5IYBJ 1FT9A 1YJWI 4XM3A 3IV5A 3QPSA 4AUXA 4A6DA 3SXYA 1HW2A 1U5TB 1LNWA 1WJBA 4KIBA 1MJ9A 2QENA 5DUIA 3REOA 4AYBN 2LKPA 4UUVA 2L5QA 1Y8QB 1D0XA 3H9GA 4WXHA 3CJRB 3DKWA 1R22A 1OYIA 2GXBA 3CMYA 3K4CA 2ZCWA 1O3SA 2QQAA 1NH3A 1OCCH 2ACJA 2HXIA 3GX4X 3CP2A 3LQQA 2RAEA 1S7OA 1MMNA 3FBIB 4EM0B 2X6YA 2EFPA 2VBYA 4I0BA 3QYFA 4GYGA 1GT0C 5HODA 1ETWA 5LLQA 2PMZA 2P7VB 5LRSA 1F36A 4L9TA 2Q1ZB 4ON0A 2AQFA 3E97A 2ID3A 4FETA 1AKHB 5D5UB 4WXCA 4ZZLA 2VXZA 3MKZA 2ZKZA 4Q47A 3RYRA 2D45A 3H35A 2R7VA 1G59A 1AU7A 1B6AA 3B73A 4UY8I 2CQQA 3ML6A 2VC0A 2COBA 3DKXA 2IA2A 3RJPA 3BLYA 3E6DA 5GTIC 3LA3A 2CQNA 2Z5UA 4OMYA 4XR6A 3GW2A 4M3GA 2DMUA 3MKYB 3F9KA 1XMKA 2E2IJ 2X48A 5F27A 3CCEI 1LUJB 4B44A 2CW7A 3T8RA 2L7KA 3ZMDA 1HSTA 1VQNI 2IT0A 3EUHA 3C1DA 5FROA 3DWLE 3GEZA 1YO5C 4HAMA 1USSA 3T8TA 5BS6A 4A3CJ 3VDXA 4C3JJ 4A3IJ 1QVUA 3HOXJ 3FXJA 4ASNA 2WB1A 3J7AO 1W7PD 3DQVC 3NAUA 1VFCA 1ON2A 3K70D 4KISA 4M6VA 4E7LA 3S1NJ 1S8NA 1G3SA 2EB7A 2Y69H 1FP2A 2Y0SA 2ECCA 3OOUA 2DMTA 4Z2YA 2E2HJ 5K7FA 4A3MJ 2Q2EB 5K5OA 3FHNA 4PJLA 4BJ5C 1I3QJ 1B4AA 2MGQA 2ZFWA 3TDUC 2XKOA 1A6QA 3S32A 3W6JB 3LFKA 2WAQN 2ZXWH 1HF0A 4GYIA 4ZC3A 2XAGA 2XHKA 2A6HF 1I27A 2Z99A 3IHUA 1D0ZA 3ZN0A 4B8XA 1K61A 1F1ZA 2R93J 4WWCA 2DAOA 5KCMA 2YUSA 1EH7A 3MVPA 3JRCA 4CCOA 3TOBA 5J6XA 2LY9A 2EA2A 5HOOA 4IRIA 2AXTC 4IVNA 1KU3A 2O03A 2W57A 4EMSA 2VONA 5GP9A 4EJUA 4X0GA 3L2WA 1Z3XA 4TV7A 2LTPA 3A03A 2OQGA 1UG2A 4G9YA 1OMIA 3CP8A 4FQGA 1FTZA 1T0FC 2K9LA 2QLZA 1R5ID 1JTXA 1CF7B 2CS3A 1TBXA 4A3FJ 2E1MC 3U2RA 3KEYA 4HYEA 5JVGF 2Y0MA 2OBPA 4AD9A 1WJCA 4II3A 4RLQA 5E3LA 4NBQA 5L3GA 5M5WJ 1Y0NA 2BY0A 2CQXA 2JN6A 5F1JA 1XSDA 1ZG3A 3JSPA 3HOSA 4I98B 3G3ZA 4BJTA 1Y0UA 2XAJA 4PJ0C 4NC7A 2CV1A 3M7GA 1NK3P 2HPMA 3VOEA 2GWRA 2HDWA 1W5TA 2P6SA 2QWWA 1PYVA 3QPHA 2DBBA 2R92J 3BZ6A 4M71A 4Y3OA 5J4VA 1UHMA 2ESNA 4KN4X 2EIMH 1TW3A 4NQWA 1TQPA 4CGZA 2DOEA 2KKOA 3FXMA 1ETOA 3IWFA 1V5FA 2YPRA 4N4NB 5LGTA 4BBRJ 1XGSA 2CV2A 1IUFA 5ICFA 1FBSA 1UG0A 2XASA 5TGTA 1IRGA 3IH4A 2VLAA 4XKBA 4C2TA 3MKWB 2IW5A 2VKEA 4QWQA 3HBLA 1OCTC 2P5KA 1M1EB 2HQ5A 5CKTA 4PDKA 4CDGA 5K7ZA 1W7PB 3FM3A 1BJAA 3I4MJ 4BXFA 2DQRA 5ICGA 3BPVA 1MBGA 2LVSA 1YFHA 3WHBA 3OYLA 1HKQA 1Z3YA 2F5CA 4CICA 4DGWB 1V4RA 5HS9A 2GAUA 2PMUA 2F2EA 1MKMA 2KL4A 1Y6IA 3C3WA 4CCJA 1SD6A 4AWXB 3BG7A 2DK5A 2IGOA 2BXZA 2K3FA 4M3BA 1MBFA 2QSGX 1EA3A 3GFIA 3OY9A 4F92B 1YTYA 1A04A 2O61A 3GUDA 4M6YA 5AIQA 5ILVA 1HDPA 3E3VA 3GCMA 4KN7X 3GVAA 3F8CA 3GO5A 1VQ5I 3DLAA 2HDCA 4D5FA 2NVTJ 4B09A 4IO9F 4IPAA 1V5GA 1XGMA 2OD5A 4DNCA 1UJ8A 3RPUD 2IXSA 3TP0A 2DYRH 1IW7F 3H3VK 1A35A 1ZGAA 4GRIA 1Z7UA 2ZJQF 2M0MA 1RKTA 2QSFX 2D1HA 2KHMA 4G8XA 3T0YA 3KP3A 2EV5A 1JUSA 2M5WA 3L2CA 3TOAA 3U1DA 2CW0F 4DW6A 2TCTA 3WG9A 5JI6A 3N05A 2O8KA 1VQPI 2JA2A 3W2AA 3MEXA 4XONA 5L3DA 1P9QC 2FX0A 3I55I 5F0FA 2A5WA 1HA8A 3F6VA 3M3YJ 3EDPA 3ZRGA 5BQTA 1R49A 4NC6A 2GA2A 4E7HA 1S7AA 4II2A 5TRDA 1PJRA 1ZARA 3OYCA 4Z6YA 2Y31A 2EH3A 2R5YB 4XLEA 3I9V2 2DA5A 3PIOF 3ZQFA 3OYMA 1S5LC 3F0CA 3CCQI 1R5HA 4I6ZA 4M3FA 1RIOH 3P5JA 2FRHA 5M3MJ 1RZ4A 4IEJA 4HPQA 4IJAA 1DDNA 2QEXI 3BY6A 5J8CA 2ZNYA 3P9CA 3Q0WA 2CUZA 1TZLA 5EG0A 4AIJA 1MDMA 1KU7A 3TP3A 4A3KJ 2XIGA 3LSTA 2PQ8A 4BEHB 2E60A 1Z1DA 4A5MA 4MLOA 2CW8A 2AXLA 3HG9A 3TQNA 1BR4A 2D5VA 1TQMA 1BIBA 3EPZA 1QNTA 2VOPA 2CH0A 1ODDA 4GO1A 1H9GA 5EJCA 1YHQI 2EIKH 4G7ZF 4FCYA 2OUMA 2JT1A 2LK2A 1FBQA 2Y9YA 3JRAA 4BXUA 1UB9A 1ULYA 1LVAA 3HUGB 5M5XJ 2M3AA 2RNJA 3J7ZI 4K2EA 1R1TA 5BOXA 2QCOA 2FMYA 3HPGA 3HTSB 2M87A 2EZKA 2RQPA 1KYZA 2Z2SB 4FE7A 3BR5A 3HPHA 4MO7A 1F43A 2FD5A 1WFXA 5EEAA 2DO7A 3QP5A 3PUFA 4R8HA 4V2GA 2X6XA 3E6CC 5IT3A 2K4JA 3DXJF 2E7WA 2DFEA 2OZUA 2FOWA 4HLXA 5GAGJ 2XPWA 3CQZJ 3S1MJ 4HOBA 3NEUA 2Y75A 3LNQA 1MMSA 2PFBA 5IP7J 1D0YA 4XKWA 1ETYA 5K5QA 2XV4S 4ESJA 1IXRC 4KNYA 4BYYA 2VB6A 3GYHX 4EM1A 3M8FA 4E70A 3HDDA 3A4CA 3HIFA 1U8RA 5D4SA 2LC2A 3MN2A 3MMYB 4PGHA 2ID6A 2FNPA 4S04A 1G3WA 3DTIA 4KT6A 2CWEA 2V1XA 2QF7A 5J1YA 2BVMA 1VQKI 1ZHFA 4L0ZB 3L2UA 1ZRDA 1UZCA 1WKMA 2FBIA 3SJMA 3HOUJ 2BZTA 5GPCA 5D4RA 3OYKA 3ECHA 4AIDA 3CC7I 3BTJA 1QZYA 1VQLI 3ZMSA 5EZGA 1Y8RB 3LFUA 2W84A 3ECOA 1KA8A 3P9KA 5F0HA 1MBHA 2YX7A 4UVBA 1S72I 1E2XA 3DKYA 1JTYA 3E5XA 4BGDA 2GM4A 3GMEA 2M4KA 3HKZN 1CF7A 2EFQA 3QOPA 4OIOF 4BY7J 2QBYB 5JLXA 3BG3A 2AS5F 1ONVA 3ABLH 2K86A 1FLIA 4G6DA 1BBYA 2VKDA 1X1DA 2E1NA 3H3ZA 5DCFA 5DTDA 4NHJA 3GTPJ 1J75A 2G7HA 5DUKA 1DU6A 3F8FA 3TW7A 2VPRA 3FK6A 4HNTA 2K85A 4E7SA 4JX6A 3BZCA 1IN5A 3JRDA 4OOIA 2BW3A 5F08A 2DMQA 2KZVA 2MA3A 4XSZF 2L7FP 2XROA 2LMDA 1IV8A 1TC3C 2JVHA 2V9KA 2DOAA 1DUXC 1SANA 2R7XA 3I56I 5J1UA 3S3OA 4F93B 5K1YA 4EJTA 3EYYA 4O5VA 4IOAF 3D5RC 4KA4A 2HOAA 3VYRB 1I6XA 3HM5A 4BDZA 3TGNA 2LFBA 2M8GX 1TNSA 3H5RA 3M9AA 3R4KA 5HDGA 3RKWA 2RKHA 2HR3A 5KAIC 2V7FA 1R36A 3QQAA 3FMSA 2E34A 3MZYA 1GV2A 1ETXA 1V55H 2ZMEC 2EPFA 1O57A 2DT7B 2ZO4A 2NAZA 4KYWA 1STZA 2VE8A 3K1MA 1BC8C 1J5YA 3GTKJ 1LDKB 1MMGA 4Q48A 2LY1A 2M0CA 2LBFB 2V26A 3S2HJ 2BY1A 3I53A 4FTHA 1HKTA 3JRIA 1FY7A 1GLNA 5DCMB 4BAYA 5JHFA 1U5TA 3T5XA 3PSFA 3S2DJ 4HV5A 2WBMA 2VJ4A 4DJAA 5BPDA 1QZEA 2L2OA 3MQ0A 3SEZA 5C44J 3W2VA 5CQEA 1VQMI 2MABA 5C4JJ 5HNHA 4A12A 4HF1A 3RIRA 1FYLA 4CHUA 2EZIA 4C3IJ 2PEXA 3CCVI 3VFZA 2IVMA 3DBLB 5B66C 3L00A 2HVSA 3IAS2 4HQMA 1JJ6C 3ZQHA 1OISA 1R5GA 5LGNA 1LDDA 4XRSG 4N0BA 4W97A 4XRSA 2W4SA 1K4TA 1R00A 4ZH4F 5KHDA 4D5CA 5KK1A 3VYSB 1C0WA 2ZNZA 1MNDA 4D0PA 3AFHA 3CCLI 2QVOA 3HRMA 2XSDC 1N78A 2QZ8A 5H6RA 3ZQCA 2VBXA 2YU3A 5HLHA 2EINH 3K9TA 4CH7A 2GOMA 4HG2A 4J00A 4HSRA 4A0YA 4G6TB 3BQZA 1QPIA 2IA1A 3FXLA 3WHCA 1WGXA 2QKMB 3HJEA 3VSLA 4DIQA 2B0LA 3S3MA 2R4GA 5KVRA 4R1HA 4AIKA 2XUBA 2JPCA 1LE8A 5ERIA 1GDTA 3ASNH 3EYIA 4ENKA 1XTAA 2FJ1A 2JSCA 4Y4RA 5C4XJ 4I99C 2CYYA 2HFHA 1H8AC 5F0CA 4OMZA 1MH3A 4QPOA 5E20A 5DDGA 2XPUA 1E0EA 2G9WA 2P7CB 2IS1A 3EETA 2EWNA 3K4MA 1R9TJ 1CQTA 2IBDA 4I2OA 3F23A 3SFIA 1FMVA 2ICWG 2BYVE 3RQIA 3U21A 3HSEA 3O2PE 1R71A 2W24A 3KFWX 3S93A 3RPUA 2FU4A 2K5CA 2QQ8A 1OCPA 4BNCA 1OJLA 2ZSIB 1H9TA 4RB2C 3H5AA 3SYTA 3LSPA 3E5QA 1B9NA 1N75A 1Q1VA 2PN6A 4MEXF 1S29A 3LWFA 2HEOA 4E4HA 2DDBA 3CO6C 4XSXF 1O4XA 2DA6A 3I71A 4M73A 1R23A 3ONQA 1OYWA 1MJBA 4ITVA 3BR6A 1H0MA 1SD4A 3FF5A 4PFPA 3WTZA 2EFOA 4PK4A 4UXNA 5EEHA 4MTEA 2L7ZA 4CCLA 2V4JC 6PAXA 2FBHA 3FKJA 3F3XA 2ZJPF 3AG4H 2R7SA 2KFDA 2P5VA 3OL3A 3QYEA 2X51A 3MFKA 3S16J 1FOXA 3HZJA 2MD5A 4CYDA 2OCEA 2K9QA 4XN0A 2EFWA 3WGGA 1R4MB 5H20A 2LYCA 2L9VA 2QQBA 3SZPA 1SAUA 3QOEA 4IRHA 3CLQA 1UAAA 1MZBA 1RUOA 1JJ8C 1IG7A 1CGPA 2XF6A 3A1YA 3BTCA 4XBFA 1SVLA 5JLWA 1BOBA 3H0DA 4HLYA 4UUTA 5AONA 3C2HA 3H36A 4IKFA 3ESWB 1QBJA 1PP7U 1BR2A 2O5RA 1T95A 3HUGA 2X6WA 3K10A 1D8JA 1MBJA 4BXXJ 1IAWA 3LSKA 4QTRA 4A3BJ 1KQ0A 3CJTB 3ZN1A 3VYUB 2VPLA 5GTHC 1BI2A 3BTIA 4ZYAA 3GXOA 4HBLA 2EFNA 4WX9A 4O3MA 2QA4I 1TWGJ 4C9YA 2OC6A 3CESA 4L18B 2QSHX 2LOOA 2H94A 2HQNA 1KQ9A 3CZ6A 4U0VA 1VQ8I 3FXUA 4M6XA 1A31A 2QUFA 1WH5A 1K83J 2DDAA 2RREA 3NARA 1UELB 4RGSA 1GUUA 2WV0A 4NQWB 3WTSC 4LFUA 2HNHA 5IP9J 2JZYA 4KMUX 2L01A 5L3FA 1UFMA 2WC2A 2GIVA 4A6EA 2HVQA 2Y2ZA 1AWCA 2Z3YA 5E8IA 4RA2A 3OL4A 3ULQB 3BCAA 4M3EA 2FUG2 2FF4A 4AM3A 2HYFA 2H6BA 4G12A 2HYGD 3TDZC 3GF2A 2NVUB 4XLNF 2F4MB 2CUEA 1S7EA 1Z91A 3KZYA 3M07A 2JWTA 4RBOA 1T8IA 3IL2A 4UHTA 5IT9K 2VASA 4UB8C 3BR0A 3KP7A 2D1VA 3KZZA 3F22A 3OWTA 3IRRA 3L7WA 1W36D 3BT9A 1WJFA 3D5LA 2KRFA 1HOMA 2A3SA 2PLYA 3DFGA 3RSNA 1ZH5A 3VODA 3LSGA 5E18F 2GLOA 2QQ9A 5M3FJ 1RNLA 3OYHA 1YOVB 1SD5A 4GDFA 2EV6A 3FBNB 2NOGA 2V1DA 2LKXA 2QM3A 4P9UA 2CRGA 2H8WA 3V8JA 5K5RA 1UHSA 2VT2A 2XPVA 3CF2A 4XOTA 5TJJA 2PMZN 2O8XA 5DYMA 2CSOA 2ZC2A 1T39A 1ERDA 1XDUA 3IRQA 2NNYA 2UXNA 1A6IA 2EIJH 1J7KA 2NS0A 4ZJZA 1IXSB 1O7FA 4BHBA 1OKRA 2KIFA 2O6GE 3KETA 4ESFA 1ETKA 5ILSA 1JKQC 3I4PA 3OS0A 1WI3A 2MC4A 2K9MA 2KJCA 1LFUP 3M1EA 1LE8B 2EV0A 3H92A 1XSVA 1S9HA 1Z77A 1K78B 2IRFG 2PI0A 4KIGA 2NRAC 2WADA 4EEFG 4LLNA 5EG0B 2ZB9A 1MDMB 1XMXA 3BOQA 2P5LC 2V9VA 3ABTA 2F48A 3DU5A 2RGVA 4HX4A 3G1MA 2HZDA 4JK1X 3GZ6A 2NS8A 1I50J 2IAIA 1ZR4A 4G7OF 4ZTFA 4LK1F 2W00A 4OIRF 1DP7P 3OYDA 2XGCA 3BR3A 1P7JA 2JRMA 1TW2A 1YJNI 4DYCA 4H0EA 3TMOA 3GTLJ 3OMYA 1Z21A 1MMDA 3T1BA 2JQ7A 3OYAA 2LH9A 1OPCA 3BC8A 4B3AA 3OIPA 5CVRA 3ABUA 2MG4A 3TW6A 1T98A 3CUOA 2DA1A 4QSHA 1OFCX 1TTYA 2IGMA 3FMRA 4YIFA 1I1GA 2RNGA 2VC1A 3TL4X 3E6BA 4HV6A 4B3XA 4YEJA 3WODF 4F55A 2ISYA 1ZLJA 2Q8KA 4BQAA 1Z05A 2L9NA 5HLIA 2DPUA 1YW9A 4E7ZA 1T0FA 2LRDA 1KGSA 2WA0A 1ETVA 4LJZF 2NXNB 1JHFA 4I01A 2YS9A 4DBRA 5J4YA 1OR7A 3D0SA 5FB2A 3OOPA 1GV5A 1H89C 1NK2P 1BR1A 1W4MA 3GZNB 4A3EJ 4NB5A 3L2VA 3I59A 2W82A 1E3HA 2VXDA 2E19A 4C2UA 2KMUA 2V9PA 5FKKA 4MGRA 1WH7A 3BDDA 3DCFA 2V79A 2BHYA 1X2NA 1VQ4I 5CVVA 1PP8F 2PJRB 4C30A 5D5VB 3HXLA 4A93J 1IN4A 3IKVA 5LD2C 2VOOA 2F6CA 4A5NA 4HSTA 5A2QZ 4Y7NJ 3OYNA 5F64A 1QO0D 3TO7A 5HNFA 4BJ6C 3FIWA 2ZSHB 2DK8A 1ITYA 1X1PA 1LFPA 3HGGA 3G71I 1FJLA 2YSRA 4XRFA 3UKGA 4B1RA 1W0UA 1FZPB 4MQ9F 2ZJRF 2AO9A 3K4KA 1YI2I 2FQ4A 2OU2A 4Y17A 2NVQJ 2O9LA 2XRNA 2YU9J 1RPWA 2BY3A 2O7OA 2O3FA 3H1CA 3O8GA 2HTJA 1WSUA 4BY1J 4UV9A 3W2WA 1TT5B 2DT6A 2CFOA 4ZYGA 1XG1A 2LY2A 4KMFA 3GWZA 4AIHA 2LNBA 2XGEA 1HBXG 1PVEA 2ZFUA 4WF2A 2DPDA 2K9SA 2KJBA 2KISA 2WY7Q 1TWFJ 1J59A 5AIPA 1LVKA 1X3UA 2EZLA 1BI1A 2O0YA 5CJ9A 1MNMC 2LR8A 5LEKA 1YJ9I 1T33A 3CDIA 3RTRA 2XAHA 4M3DA 1WWXA 1HLVA 2CV0A 2XB0X 3Q9SA 4E7JA 4LGWA 3VSKA 2E1MB 2R7OA 4RB1A 1U0JA 4LLLA 4DZPA 2ELHA 1GVDA 3R60A 2FMLA 1U6GA 2Y48A 1LEAA 3FISA 2K7LA 2M34A 2IEKA 1FWZA 2VUMJ 4ABZA 1P4WA 2XGXA 1PUFB 4RS8A 1W1WE 3LSHA 5FGMA 1G3TA 1JGGA 3HOVJ 4BDYA 1ZK8A 4L9VA 5J40A 3H9QA 3E6MA 3S8PA 2MSYA 5ICCA 1XSXA 1EV7A 2HZTA 4XLAA 1RI7A 3SEQA 2NVYJ 3I54A 2RQQA 2E71A 1YITI 4BS9A 4XICA 5E3MA 4BKXA 2VE9A 1B8IA 5J1RA 3JREA 3V7CA 2ZMEB 2I8DA 3ABKH 2H27A 4RGRA 2M1BA 2DA2A 3PO3J 3H3UA 1XGNA 2R7DA 4XRMA 2ADUA 1YRNA 1K4SA 2DODA 4PZJA 2MFZA 3B02A 1B9MA 3CF5F 2W48A 1ZKGA 1LFBA 2QGUA 4LB6B 4F7ZA 4KFCA 1BJZA 2KIQA 1HW1A 1MNEA 2M2EA 3CMMA 1LKXA 4PUSA 5E79C 1IO2A 3Q9VA 4D9JA 4XK4A 4BE1A 4PFOA 1F9NA 4Y13A 3OSFA 3DTKA 2XAQA 2KIMA 5HVQC 4GGGA 2H1KA 3A2KA 1IGNA 2CUFA 2VIXA 4XL9A 2MBFA 1JT0A 2JJ7A 1QHHD 3I64A 1ZRCA 3Q3SA 5E8GA 2DJNA 2TDXA 4ENMA 3K2AA 4OIPF 3HEFA 1TL8A 4DYQA 3OYBA 1TP4A 2Q2EA 2EZHA 5CQGA 3TO6A 3ZQIA 3ZCOA 1BM9A 1F4KA 5EDNA 4RGUA 2H1LA 3AG1H 2BBYA 4BHPA 3ZOBA 3ASOH 2IA0A 1OYYA 1Z6TA 4N4OB 4ANJA 2L4AA 5D6FA 4B48A 2EILH 3PNVA 4PJNA 1Y39A 2KQRA 1XCBA 3WTWC 1K7AA 4DZJA 3L2QA 5DM6F 5CVJA 3NRVA 3AAFA 5D5WB 3R6SA 2DFHA 3BR1A 2XAUA 3S17J 2IGNA 3KLOA 3V42A 4OAZA 4P96A 5M5YJ 4IHTA 2GZWA 1T2KA 3DBRB 2V1UA 3PQKA 2LREA 2NNNA 1H88C 1ZLKA 4RMNA 1WJEA 2HWVA 2K40A 5DM7F 1ZYRF 2BEOA 5D8KB 4JBAA 4KICA 2PJRA 5B5EC 3QP6A 2FEZA 2K4BA 2DFFA 2RDPA 3KE2A
chains in the Genus database with same CATH topology
2VL8A 3KX2A 2ZSIB 4CUGA 2UUZA 5KCMA 1JI8A 3AKZA 3LL7A 3H5AA 3KYLA 3SYTA 1WJAA 1N75A 3DPLC 1VZ0A 4CCOA 4PJMA 4E4HA 2F5VA 1Y56A 5HOOA 3ONQA 4ITVA 4X0GA 4PFPA 3L2WA 1Z3XA 3K4BA 4PK4A 3J7AY 4CSWA 4CCLA 2V4JC 1IRXA 3CJQB 3FKJA 4YELA 2HVRA 2R7SA 1X4PA 3OL3A 3CP8A 3QYEA 2X51A 3I3LA 4J01A 1T0FC 2K9LA 3OYJA 4XN0A 5FRMA 2CS3A 3ZXSA 2LYCA 2E1MC 3KEYA 3OS1A 1FMWA 3OIQA 1SAUA 3QOEA 4BU2A 3HOTA 1WJCA 4II3A 4RLQA 4KITB 2R7TA 1UAAA 1DGWY 1MW7A 4CCKA 3NWSA 4XLCA 3HOSA 1DP3A 4BJTA 2XF6A 3A1YA 4NC7A 4XN3A 4XNFA 2CV1A 2HPMA 2HDWA 1BOBA 1PYVA 3H0DA 4DOZA 3DTEA 3ZR8X 3C2HA 4IKFA 2JVGA 4Y3OA 4XLFA 1BR2A 3AL0C 2O5RA 1T95A 3VYTB 4B43A 2X6WA 3K10A 2Z1DA 1V5FA 4N4NB 3LSKA 1MMAA 4F3QA 2VJJA 3VYUB 2CV2A 1DGRM 1KONA 2VPLA 1UG0A 4ZYAA 5TGTA 2XSJC 3OR1C 2VLAA 3UNGC 1J09A 4XKBA 3K70C 4J00A 4C2TA 3MKWB 2KP6A 4C9YA 2OC6A 3CESA 4RLFA 4ZTJA 2LOOA 3CZ6A 5CKTA 3K6GA 3SDBA 4YRVA 4CZCA 2OV7A 2RREA 1R6RA 1UELB 4BXFA 4NQWB 2R7WA 2HNHA 1AA7A 2X1EA 3MD2A 4F91B 2HVQA 3OYLA 1Z3YA 4DGWB 2E5ZA 2VQCA 4KJZA 3UR3C 3OYGA 4BQNA 3OL4A 3BCAA 2KL4A 1Y6IA 3NWTA 2VKHA 2FUG2 4CCJA 2X85A 3BG7A 2IGOA 3HKZA 4BUPA 3S3NA 1NG7A 1X19A 4HRIA 3ZQQA 3VWBA 1EA3A 3OY9A 2R7UA 4LG3A 3W3CA 4F92B 3BCBA 2VQHA 3HL2A 4U87A 3EUKL 2VASA 3DLAA 4ZDLA 1TT0A 3OWTA 4NNJA 1V5GA 1W36D 2ZXIA 3RPUD 1WJFA 2IXSA 3D5LA 2IS4A 4DBQA 2KRCA 3LSMA 3RSNA 4GRIA 3LSGA 1YX5A 4BQOA 2M0MA 4XKVA 3K4NA 4FASD 3OYHA 2KHMA 3FBNB 4P5OA 4OAYA 3E1SA 4U7BA 3DEEA 2HPIA 3CF2A 4XOTA 2JUGA 2IS6A 3N05A 4OWRB 1ERDA 4JOMA 1OLTA 2JA2A 3FDYA 4BE2A 2IS2A 3W2AA 2KDOA 4XONA 1P9QC 2A5WA 1W36C 1HA8A 4ZJZA 1X1BA 2HU9A 4CCMA 1DQUA 3ZRGA 4E7HA 4II2A 1PJRA 3DPUA 4NUBA 4PSXA 3OYCA 2L9SA 3OS0A 2DXIA 4BACA 4AVZA 2MC4A 2K9MA 4XLEA 3I9V2 2V6EA 3OYMA 2MYSA 3K4JA 1S9HA 2W7NA 2W1OA 4RM3A 2WADA 3IAM2 4HPQA 2BOLA 1QHGA 2KPMA 3DU5A 2HZDA 2KLOA 2CUZA 1TZLA 4XQFA 4ZTFA 2W00A 4IQ4A 1WJDA 3OYDA 1X1CA 3TMOA 3OMYA 2CUJA 2A6TA 1Z21A 1MMDA 4BEHB 2E60A 2DCEA 4XMYA 3OYAA 1D0ZA 4IZZA 2LH9A 4MLOA 2CW8A 2WY8Q 4XORA 3BC8A 4D1QA 3HG9A 3OIPA 1BR4A 2X1DA 3EPZA 2JSPA 2VJIA 2WAFA 2CH0A 3GBGA 3RQ4A 2IGMA 1X1AA 2OUMA 2RNGA 3TL4X 1D1AA 4B3XA 4YEJA 3HUGB 4F55A 2M3AA 4ZDOA 4LIVA 2L9NA 2M7BA 4LIUA 2WAQA 4E7ZA 4ZDPA 2LRDA 2WA0A 3HPGA 4DBRA 2IGKA 4EATA 2Z2SB 3H9JA 3HPHA 2X1CA 2NOJB 5HLTA 1WFXA 1BR1A 4AYBA 2X6XA 3L2VA 2W82A 2VXDA 4C2UA 2KMUA 3D5SC 2UV1A 2K3PA 4IX7A 1D0YA 4XKWA 2AQEA 2MD0A 2PJRB 4C30A 3HXLA 2VB6A 1G8XA 5LD2C 2F6CA 4HSTA 4JQFA 3A4CA 3IUOA 3OYNA 5HNFA 2LC2A 4BJ6C 3MMYB 2ZSHB 4PJJA 1LFPA 2P0WA 3DTIA 4KT6A 3OS2A 1WJ5A 1YX3A 2BVMA 2LG4A 3SZGA 3K4KA 3L2UA 3PNYA 4E7KA 3DPTA 4XLHA 2VQGA 3OYKA 2HQAA 3H5NA 2V1NA 3LFUA 5CPRB 3W2WA 3BG6A 2DT6A 2CFOA 3OYIA 3PL8A 2LY2A 2R7QA 4XKCA 3QYBA 1K6YA 4BQQA 3RCOA 4QPQA 3TBIA 3DKYA 3PSIA 3L2RA 4BGDA 2ZFUA 2M4KA 1N77A 4BEHA 1QU3A 2WY7Q 1LVKA 1YE9A 3PNTA 4NC8A 2XF7A 2VKDA 1X1DA 3OYFA 2XF5A 4PSWA 4HNTA 3RTRA 2KRHA 4BE0A 4E7SA 3OR2C 3IP4B 1V5EA 2CV0A 2UWMA 4E7JA 3VSKA 2BW3A 2E1MB 2R7OA 2KZVA 4P1WA 3ZGKA 1U0JA 2DJIA 1D1CA 3PFYA 4AU7A 2BW3B 4XOPA 2BVLA 2JVHA 2V9KA 1SFKA 2DOAA 2R7XA 3K4LA 3S3OA 3EUAA 3M8JA 4F93B 5FRNA 4E7IA 3LSHA 2VJ5A 4F52A 4BDYA 3D5RC 4RM2A 3VYRB 3H9QA 4R79A 3S8PA 4BDZA 3AL0B 3H5RA 1D1BA 2V7FA 4LITA 4IQJA 2GOXB 4XM3A 4XLAA 3SEQA 2M4GA 4Y33A 2RQQA 2M7AA 1WJBA 5LFAA 2DT7B 1Z7LA 4BS9A 2LBFA 2L5QA 1LDKB 4B47A 1MMGA 1D0XA 3H9GA 2I8DA 3CJRB 2LY1A 3QODA 2LBFB 3K4CA 2V26A 3G2BA 3PUBA 3CP2A 1NG6A 4HEA2 1MMNA 4BL0B 3FBIB 2X6YA 4CCNA 1GLNA 3QYFA 3DU6A 3M1CA 2MFZA 5JHFA 2PMZA 1X4OA 2Q1ZB 3PSFA 2AQFA 4E6KG 4FETA 1MNEA 2F4IA 2WBMA 2VJ4A 2VXZA 3CMMA 4DJAA 3MKZA 1LKXA 4PUSA 2L2OA 3SEZA 3PJRA 3W2VA 3H35A 2R7VA 5CQEA 4D9JA 1G59A 2MABA 5HNHA 4BE1A 4PFOA 3DKXA 2ELJA 2WAEA 2VQLA 3BLYA 3DTKA 5HVQC 3A2KA 4XR6A 2VIXA 2XDVA 2HVSA 3IAS2 4XL9A 4H4KC 1QHHD 3MKYB 3F9KA 3E0JB 2ZXHA 4B44A 2CW7A 2L7KA 2W4SA 3HC7A 4HNUA 3OYBA 5KHDA 5CQGA 3VYSB 3ZCOA 1MNDA 3DWLE 3AFHA 5FROA 1N78A 3VDXA 4CH7A 5KNLA 2GOMA 2WB1A 4HG2A 3DQVC 1OR7C 2E5NA 3LSIA 4G6TB 4HSRA 4N4OB 4B48A 4ANJA 2QKMB 3VSLA 3K70D 3PNVA 4PJNA 4DIQA 2R7RA 4KISA 2KQRA 4E7LA 3S3MA 2R4GA 2CMPA 1ZELA 3L2QA 3EUHC 2Y0SA 2Z16A 3OOUA 3LMMA 4Y4RA 2Q2EB 3FHNA 2XAUA 4QPOA 4PJLA 2IGNA 4BJ5C 3OYEA 2QKLB 4OAZA 3V42A 2IS1A 1E0EA 3C2GA 2LREA 3K4MA 3S32A 4RMNA 1WJEA 4CA0A 2XC7A 1FMVA 3U21A 2PJRA 4ZC3A 3S93A 2K5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XF5 A;  2XF6 A;  2XF7 A; 
#chains in the Genus database with same CATH topology
 2VL8 A;  3LQR A;  5E1W A;  3KX2 A;  5E17 F;  3S14 J;  2G7U A;  3I59 B;  2UUZ A;  4HX8 A;  2A6E F;  1JI8 A;  1IRF A;  3CUQ C;  3AKZ A;  4ENJ A;  2A68 F;  3KP4 A;  5IP6 A;  3KYL A;  4RB3 C;  2EBI A;  2FBK A;  1WJA A;  3DPL C;  1VZ0 A;  3HOW J;  3BR2 A;  5E3O A;  4ZZD A;  2F5V A;  1Y56 A;  2LLK A;  2M8E A;  4A3D J;  1J9I A;  2E1O A;  3K2Z A;  3I5U A;  1BW5 A;  1L0O C;  2R5Y A;  3WGI A;  1PDN C;  5LBQ A;  3O8H A;  3COA C;  1HCR A;  1JKO C;  4ESB A;  2W85 A;  3S1R J;  4FX4 A;  3J7A Y;  4CSW A;  3D1N I;  1QPM A;  4Q4Z F;  3QU3 A;  3GTJ J;  4YEL A;  3LA2 A;  1X4P A;  2ECB A;  3BJ6 A;  2XKP A;  3K0L A;  4HW0 A;  5D5X B;  4J01 A;  4EV0 A;  3U9G A;  1FYM A;  1U9N A;  4L5J A;  1P7I A;  1FC3 A;  3TO9 A;  1WPK A;  3OS1 A;  1FTT A;  3BJO A;  3OIQ A;  2E7X A;  3HOT A;  2X9D A;  1G6N A;  5FD6 A;  1Z6R A;  3O6B B;  1DGW Y;  3RZD J;  4CCK A;  2DW4 A;  2MH9 A;  2VT3 A;  2HI3 A;  4YG2 F;  1SEU A;  3BQY A;  4XN3 A;  4XNF A;  3GTQ J;  1REP C;  1EF4 A;  2IP2 A;  1FIA A;  3L9F A;  4DOZ A;  4LOC A;  3M4O J;  3LOC A;  3DTE A;  5IT9 Z;  1U9O A;  3ZR8 X;  4L0Y B;  4LD5 A;  2JVG A;  3O3K A;  3I4N J;  2COM A;  1XGO A;  3AL0 C;  4YFN F;  3KZI C;  4WXD A;  3VYT B;  2XAF A;  3DP7 A;  4B43 A;  4DYR A;  1FX7 A;  3PFI A;  4XID A;  2Z1D A;  4Y15 A;  3DV8 A;  4F3Q A;  1YLF A;  3CDL A;  3ERM A;  3HSF A;  1KQ8 A;  1SFU A;  3UNG C;  1J09 A;  3HOY J;  1I6H J;  3QRF F;  1YW8 A;  1U8B A;  2KP6 A;  4RLF A;  2BE5 F;  3HSR A;  1TWH J;  2ISZ A;  4ENN A;  2F5D A;  1B72 A;  4HQE A;  3K6G A;  3JCU C;  4L5I A;  1I39 A;  2P4W A;  1NHA A;  5E1Z B;  4YRV A;  5B3S H;  3K7A J;  4MEY F;  1IF1 A;  1SAX A;  2DLL A;  5GAH J;  2OTL I;  2X1E A;  3V4G A;  1T56 A;  4PGG A;  1A36 A;  4KIF A;  4UVA A;  1G3Y A;  3SFZ A;  2E5Z A;  2VQC A;  3BWG A;  3OYG A;  2JA5 J;  3S2W A;  1TQI A;  4MNU A;  2W25 A;  5J47 A;  5L3C A;  3NWT A;  2VKH A;  2D2W A;  3FXO A;  4BUP A;  3HKZ A;  3JRH A;  1NG7 A;  3LAP A;  1T6S A;  4I7H A;  3ZQQ A;  3FMQ A;  3KYC B;  2R7U A;  4LG3 A;  3BCB A;  2VQH A;  3HL2 A;  3KP2 A;  3RKX A;  1RES A;  3ZQG A;  3VPR A;  4ZDL A;  1TT0 A;  4NNJ A;  1R58 A;  2Q0O A;  3WU0 A;  2ZXI A;  2EA4 A;  5GAE J;  1DPR A;  4N9H A;  4GXO A;  3K1P A;  4DBQ A;  2C6Y A;  2KRC A;  3LSM A;  1I1S A;  3CME I;  1XN7 A;  1SMT A;  2R3S A;  1JGS A;  2ZXJ A;  4XKV A;  4RGX A;  3WTV C;  1FOW A;  3TED A;  2ETH A;  4OIQ F;  3H0G J;  4OAY A;  1VQ7 I;  3E1S A;  1YQA A;  3DEE A;  2OF7 A;  2HPI A;  3HYI A;  5IPA A;  3RYP A;  4HNV A;  1FIP A;  5IOZ A;  1VTN C;  1SD7 A;  4BE2 A;  4JP0 A;  4P55 A;  2Y0S N;  1R1V A;  1W36 C;  3FKI J;  2B63 J;  3IWZ A;  1X1B A;  2HU9 A;  4M9X A;  1HC8 A;  2JK3 A;  2J5P A;  4O6J A;  2JPB A;  3CCY A;  2JA7 J;  1XCV A;  1QQI A;  1EH8 A;  2WB1 N;  2R0Q C;  1TLH B;  3KIO A;  3KEQ A;  4BAC A;  4AVZ A;  1TWC J;  3N97 A;  4LB5 A;  1IJW C;  4LMY A;  5FLV A;  1IN6 A;  3JTG A;  2EQR A;  2OQR A;  4KUM A;  1TNT A;  2ME0 A;  3IH2 A;  1HQC A;  3N4M A;  1X58 A;  5FLX Z;  1KU9 A;  2EJR A;  1WVR A;  1LPQ A;  4MIM A;  1XC5 A;  3WE2 A;  2X6O A;  5A2Q K;  5GAD J;  3DEU A;  2DT5 A;  2R5Z A;  3BP8 A;  1LEB A;  5LRR A;  2KLO A;  3FM5 A;  4IQ4 A;  5FO5 A;  1WJD A;  4CXF A;  3A02 A;  1YYV A;  2JA8 J;  2CUJ A;  2A6T A;  3V8K A;  4M74 A;  4XMY A;  2NVX J;  3CDH A;  3JRG A;  3JTH A;  4IZZ A;  1VND A;  4L9N A;  2WY8 Q;  4XOR A;  5K7H A;  4D1Q A;  3J80 Z;  3RI4 A;  4RAY A;  4FE4 A;  3C18 A;  2M9H A;  2VJI A;  1YS7 A;  1YRN B;  3GTG J;  3CC2 I;  3DF8 A;  2OA4 A;  5LGU A;  3AG3 H;  1D1A A;  3B6A A;  1W7P A;  4CYC B;  3LA7 A;  2JA6 J;  2OCC H;  1ZN2 A;  4HA8 A;  4LIV A;  2M7B A;  4LIU A;  2WAQ A;  4BBS J;  5IYD J;  4EGZ A;  2IGK A;  2PBI A;  4EAT A;  1XD7 A;  4U88 A;  4RAF A;  4P9F A;  5DV5 A;  4MHG A;  2DFI A;  3IH3 A;  3GZ5 A;  2CQK A;  2X0L A;  3F8M A;  4YII A;  5KAF C;  2DYS H;  5JFR A;  2UV1 A;  5LHI A;  2K3P A;  2HTS A;  4JYK A;  3IC7 A;  2L3D A;  2UZK A;  2A61 A;  1BL0 A;  3AG2 H;  1BI0 A;  1WCM J;  2ZME A;  2FQ3 A;  3F21 A;  3F8B A;  3SDG A;  3F6O A;  1VF9 A;  3ELK A;  1QGP A;  4CZZ A;  2BHZ A;  4PJJ A;  2P0W A;  3PQJ A;  5GPA A;  4D7N A;  3OS2 A;  3S1Q J;  3MZH A;  1IXC A;  2STT A;  3CD6 I;  2PJP A;  3I58 A;  5DCM A;  2IPQ X;  1JUP A;  2LG4 A;  4BH9 A;  1JUM A;  3SZG A;  4EJW A;  3PNY A;  4GCV A;  4E7K A;  1S3J A;  4AVP A;  3CUQ B;  2HYJ A;  1D5V A;  3GFM A;  4EGY A;  3RKY A;  5EGO A;  4C3H J;  2HQA A;  3H5N A;  3ZPL A;  4I02 A;  2V1N A;  3BJA A;  5CPR B;  1IN8 A;  1BIA A;  3BG6 A;  2GXG A;  4G94 A;  3OYI A;  1I3A A;  1KZH A;  4BQQ A;  3RCO A;  2YX4 A;  3TBI A;  2HGC A;  5FLX K;  3FXR A;  2GBY A;  3PSI A;  2Y9Z A;  2F4O B;  1MSE C;  2ME6 A;  1N77 A;  4A3G J;  1QU3 A;  4QIW N;  3CCJ I;  2NS7 A;  3KP6 A;  3ABM H;  3PNT A;  3V7S A;  1B59 A;  5IY5 H;  5J3L A;  3OYF A;  4S05 A;  4XLP F;  2RN7 A;  5B1B H;  2LF8 A;  4PSW A;  2KRH A;  2OPT A;  1X3W B;  3SZT A;  3IP4 B;  1V5E A;  2DU9 A;  1YW7 A;  2UWM A;  4LLG F;  1RET A;  1MBK A;  1SVO A;  1Z0X A;  5CYV A;  3ZGK A;  5B1A H;  2HS5 A;  3BRO A;  2DJI A;  1D1C A;  3PFY A;  4AU7 A;  3G73 A;  2E35 A;  4XOP A;  4J19 A;  3GLX A;  3ZQL A;  1SFK A;  3P7N A;  2M30 A;  3K4L A;  3EUA A;  2LDU A;  2CU7 A;  4E7I A;  2VKV A;  4R79 A;  3AL0 B;  3F8N A;  4IRG A;  2XB5 A;  2GA1 A;  1K79 A;  4LIT A;  1D5Y A;  2GOX B;  4S0H B;  4KDP A;  5FKN A;  1HDD C;  3HRT A;  2M4G A;  2M45 A;  1NTC A;  3W6V A;  2PMH A;  4Y33 A;  3GLL A;  2M7A A;  5LFA A;  1MGT A;  2HKX A;  4ETS A;  3CTA A;  1Z7L A;  4HF0 A;  1JKP C;  1WI9 A;  3MZ8 A;  3QPT A;  2LBF A;  3FHZ A;  1YS6 A;  5EYR A;  4B47 A;  1U5T C;  3WTY C;  2TRT A;  3QOD A;  3V8L A;  3G2B A;  3KP5 A;  2F5F A;  3CCR I;  1IC8 A;  3PUB A;  4A2U A;  3PM1 A;  2RVC A;  1NG6 A;  4HEA 2;  4BL0 B;  3BTL A;  3TKY A;  1SMY F;  4UUS B;  4CCN A;  1ZQ3 P;  3JAM K;  1P4X A;  1XB4 A;  3RZO J;  3BG5 A;  4PCQ A;  3DU6 A;  3M1C A;  3WG7 H;  1TWA J;  2PX9 A;  2P6T A;  1UCR A;  1X4O A;  3ZMT A;  2DA3 A;  2Y30 A;  4E6K G;  5LHG A;  1UST A;  1HSJ A;  2F4I A;  1P6R A;  1IDZ A;  3PJR A;  3JW4 A;  5HLG A;  4W1U A;  4MFE A;  3KLN A;  3HGY A;  2R5Z B;  3KEO A;  2ELJ A;  2WAE A;  2VQL A;  3E7L A;  3EQL F;  4UB6 C;  2VI6 A;  2XDV A;  2J5O A;  2JRT A;  4H4K C;  3MWM A;  3J81 Z;  2L0K A;  5H6Q A;  3E0J B;  4HDV A;  1BW6 A;  1ZG1 A;  4HX7 A;  5FLM J;  4MTD A;  1ETQ A;  2ZXH A;  2LKS A;  1G2H A;  4IL6 C;  3HC7 A;  4HNU A;  3WU1 B;  3FWE A;  3HB9 A;  3F72 A;  2LD5 A;  3E5U A;  1ZGW A;  2R7Z J;  1RKW A;  1FNN A;  1PUE E;  1R7J A;  3LSR A;  2I10 A;  4LG0 A;  4RDU A;  4M72 A;  4UVC A;  5CVI A;  1LDJ A;  2E1C A;  2LP0 A;  3G4S I;  3P9I A;  3IKT A;  5KNL A;  1LJ9 A;  1ZRE A;  1O3Q A;  3ZMV A;  1OR7 C;  2E5N A;  3LSI A;  1J0R A;  3JRB A;  5HDN A;  1E17 A;  4RB0 A;  2R7R A;  2JUC A;  1ZGJ A;  2CMP A;  1ZEL A;  2RC4 A;  3NQO A;  3EUH C;  3G1L A;  3FK7 A;  5BNG A;  5E3N A;  4RAG A;  2Z16 A;  4ZYH A;  2DQL A;  2CG4 A;  1Z9C A;  3LMM A;  4IHW A;  3M8E A;  4N9I A;  3FX3 A;  4IXA A;  3OYE A;  2QKL B;  2DMP A;  4A0Z A;  2BV6 A;  3JRF A;  3C2G A;  3CJN A;  4U7D A;  1B72 B;  5DEQ A;  3MKL A;  4CA0 A;  5F1R A;  2GXA A;  3U1K A;  2R7F A;  2XC7 A;  4M9Z A;  3RDI A;  4FHT A;  3DEW A;  5EZH A;  1KYW A;  2K27 A;  3A0H C;  5ICE A;  1YIO A;  3A01 A;  3ROU A;  3J7Y J;  5JVT A;  3CCM I;  2XRL A;  4CUG A;  5L3E A;  4A3J J;  5F04 A;  3LL7 A;  1MH4 A;  3QWL A;  5DD4 A;  2MH2 A;  4IF4 A;  2DMN A;  4PJM A;  2FNA A;  9ANT A;  2LSO A;  3WGH A;  4WK8 F;  2Z33 A;  2WWY A;  3Q0V A;  5HS8 A;  3K4B A;  3HTU A;  4CO8 A;  1DU0 A;  2E36 A;  2WV1 A;  1EJ9 A;  4DQ2 A;  2YR2 A;  2UXX A;  3R61 A;  1EKE A;  2VN2 A;  1IRX A;  2KT0 A;  3CJQ B;  2L02 A;  2HVR A;  2ELK A;  5FD5 A;  2L7M P;  2ZBK A;  3I3L A;  1T38 A;  3OYJ A;  1FSE A;  2MC3 A;  2V6C A;  1ZRF A;  5FRM A;  1G4D A;  2HOT A;  5IYC J;  5HDK A;  3ZXS A;  1RC9 A;  1WQ2 A;  1FMW A;  1FSH A;  4BU2 A;  5L3B A;  3G6E I;  1UMQ A;  4KIT B;  2R7T A;  1JT6 A;  1MW7 A;  2OJE D;  1X2M A;  3NWS A;  4XLC A;  1IV6 A;  1DP3 A;  5BPI A;  3J81 K;  1AHD P;  1P92 A;  4G6Q A;  4EQQ A;  2CGP A;  1Q1H A;  1K6O A;  1EH6 A;  1ENH A;  4EM2 A;  1MIJ A;  2H6C A;  2B7E A;  1FEX A;  3C2B A;  2P8T A;  4MFD A;  4XLF A;  3QAH A;  5ED4 A;  4ZYD A;  1MD0 A;  3MAJ A;  3SQN A;  4CYC A;  2B9S A;  2G0E A;  3WTX C;  1FYK A;  1AKH A;  3CC4 I;  1RR7 A;  2JTV A;  1MMA A;  1JHH A;  2VJJ A;  3WU2 C;  5EEG A;  5FJ8 J;  2A5Y B;  1DGR M;  1KON A;  5EGO B;  3R0J A;  2XSJ C;  3B6C A;  3OR1 C;  3HRU A;  3K70 C;  2FE3 A;  1W5C C;  1MJA A;  1FP1 D;  3CCS I;  4ZTJ A;  3CLO A;  5FKL A;  3Q0U A;  1MSF C;  3RKQ A;  4WCG A;  3KPH A;  2DI3 A;  3HRS A;  2GIZ A;  3KYD B;  3SDB A;  3CCU I;  4CZC A;  2OV7 A;  3V7R A;  2LF7 A;  1R6R A;  1FOK A;  1UHW A;  2R7W A;  2Z9O A;  1P2F A;  4AC0 A;  3CO7 C;  1AA7 A;  5DS9 A;  3MD2 A;  3DBH B;  4F91 B;  1BC7 C;  3K69 A;  3UR3 C;  4KJZ A;  4BQN A;  1U2W A;  1XDS A;  1FBU A;  1APL C;  2X85 A;  1B1B A;  3HHG A;  1ON1 A;  3S3N A;  5LEJ A;  2AHQ A;  1X19 A;  4YFK F;  4HRI A;  3VWB A;  3GFJ A;  5D6E A;  1V54 H;  3W3C A;  1O7L A;  1GXQ A;  4UV8 A;  2K9N A;  1HXD A;  3MCZ A;  4U87 A;  3GTM J;  4V19 K;  2RV8 A;  3EUK L;  1ZG5 A;  2H09 A;  5TIS C;  2BXY A;  2VBW A;  1IZ1 A;  2NYX A;  1ZR2 A;  2IS4 A;  2GQQ A;  2QYO A;  2K02 A;  1S6L A;  5LHH A;  1QZZ A;  2ESH A;  1YX5 A;  1ZAO A;  2KZG A;  4BQO A;  4X6A J;  5DD8 A;  3K4N A;  4FAS D;  2CJJ A;  2DA7 A;  1U78 A;  4P5O A;  3WTT C;  2CO5 A;  4YIR X;  4U7B A;  1BA5 A;  1JE8 A;  1SFX A;  1XPX A;  3FXQ A;  2E2J J;  4X1E A;  2JUG A;  2IS6 A;  4OWR B;  4JOM A;  1OLT A;  3FDY A;  3VEP A;  2IS2 A;  4I76 A;  2KDO A;  1D3Y A;  3ZQ7 A;  4RAZ A;  5FKM A;  4CCM A;  4YFX F;  1O3R A;  1JKR C;  1QRY A;  1DQU A;  1O3T A;  4JX5 A;  1N25 A;  1R4N B;  2L54 A;  4UUS A;  1GVJ A;  1E3O C;  1XX5 A;  3DPU A;  4NUB A;  2CQ7 A;  4PSX A;  3R0A A;  2L9S A;  4HZF A;  2DXI A;  3L09 A;  2JMW A;  2V6E A;  5H2F C;  2HKO A;  1LB2 A;  2MYS A;  1POG A;  3K4J A;  5CLS A;  3K1N A;  2W7N A;  2P81 A;  2W1O A;  2FXA A;  4RM3 A;  2A07 F;  4MQV A;  1VQ6 I;  4KT5 C;  1E3P A;  1YG2 A;  3IAM 2;  4M9S A;  2BOL A;  1K78 A;  3GTO J;  1IRZ A;  1XMA A;  2H8R A;  1F5T A;  2DTZ A;  1QHG A;  2KPM A;  2L9R A;  1YIJ I;  2HQR A;  3ISP A;  1LQ1 A;  4FX0 A;  3BPX A;  4XQF A;  4IHV A;  1QA6 A;  2EK5 A;  5FFX A;  4BHC A;  2DN0 A;  4HDU A;  1X1C A;  1HW5 A;  5FFZ A;  1I5Z A;  2DCE A;  1L3L A;  2KDZ A;  1ZTR A;  4FIS A;  4D7M A;  1KU2 A;  1Y1V J;  2IJL A;  4EVI A;  5EF6 A;  3ERE D;  1P4A A;  2HDD A;  3PO2 J;  3DLL F;  2X1D A;  3VB2 A;  1GXP A;  2JSP A;  1R1U A;  2WAF A;  5FKO A;  3RQ4 A;  3GBG A;  2HOE A;  5E1X A;  1X1A A;  2MLG A;  4LG0 B;  2F5E A;  2DTR A;  3W6K B;  5JR3 A;  3QU6 A;  4UNO A;  1SC7 A;  2OAZ A;  1XS9 A;  2N8G A;  4OIN F;  3OSG A;  3SHF A;  1RRJ A;  1OCZ H;  4ZDO A;  2DA4 A;  1ACI A;  4ZDP A;  1SFE A;  3LSJ A;  1GHC A;  3Q5F A;  3H9J A;  4U0W A;  5ILU A;  3X2Q H;  3LAJ A;  2X1C A;  2FOK A;  2NOJ B;  5HLT A;  4IHX A;  2I5U A;  5F6F A;  5HS7 A;  2HXO A;  4AYB A;  2VOD A;  2WTE A;  1DPU A;  1BI3 A;  1IDY A;  3D5S C;  4LK0 F;  4IX7 A;  2KIU A;  3FZV A;  1OCO H;  2BGC A;  2MW8 A;  3WTU C;  2AQE A;  1U3E M;  2MD0 A;  1RR8 C;  1HKS A;  1A5J A;  1W5S A;  3ZMU A;  3I0T A;  3JAM Z;  4GFB A;  1Z67 A;  1G8X A;  3JSO A;  1VI0 A;  1X3Z B;  2XVC A;  4JQF A;  3IUO A;  2CFX A;  1BN5 A;  1IUY A;  4I0A A;  5J8F A;  2L4M A;  3ZP5 A;  4EJV A;  1WHU A;  2HOS A;  1WJ5 A;  1YX3 A;  3S15 J;  3CUQ A;  3ZMZ A;  4G7H F;  1W0T A;  4Q5S F;  1V3F A;  3RPQ A;  4B4C A;  3DPT A;  4XLH A;  1RUN A;  1BOA A;  4OU0 A;  5JHU A;  2OTJ I;  5D8L B;  2VQG A;  4NDL A;  5C3E J;  1FPQ A;  1OQY A;  2STW A;  5CVU A;  3PL8 A;  2R7Q A;  3HHH A;  4XKC A;  4L9J A;  3QYB A;  1K6Y A;  2VBZ A;  1J2X A;  4QPQ A;  3A0B C;  3FXK A;  3CMA I;  1IN7 A;  2ZJ2 A;  2A69 F;  3L2R A;  4A3L J;  1WRJ A;  3KCC A;  4V2F A;  2FA5 A;  4BEH A;  1VQ9 I;  3QPL A;  5BMZ A;  4FT8 A;  2FSW A;  3G1O A;  4IHS A;  1Y1W J;  2OZ6 A;  1ORK A;  4A0X A;  3JR9 A;  1YE9 A;  2DOF A;  4NC8 A;  2XF7 A;  1D8K A;  2XF5 A;  3WE3 A;  2QBY A;  4IOC F;  3HOZ J;  1FOY A;  4C2M J;  4BE0 A;  3BZK A;  3OR2 C;  4HF2 A;  3C7J A;  3GFL A;  1MBE A;  4A69 C;  2X4H A;  3OV8 A;  4P1W A;  4U0Y A;  1T08 B;  4Y52 J;  2A05 A;  4QLC U;  1PUF A;  2BW3 B;  2BVL A;  1JXS A;  2BY2 A;  3BG9 A;  3PIP F;  1WZ2 A;  3J80 K;  3L1P A;  1B8I B;  3M8J A;  3OIO A;  5FRN A;  2PG4 A;  2XGD A;  2VJ5 A;  4F52 A;  4EJO A;  4L5E A;  3A01 B;  4IHY A;  4RM2 A;  1SVM A;  1AOY A;  4JX4 A;  4I09 A;  1VQO I;  1D1B A;  5IOY A;  4ZYE A;  1SFO J;  1QVT A;  2MLK A;  1OCR H;  4IQJ A;  5IYB J;  1FT9 A;  1YJW I;  4XM3 A;  3IV5 A;  3QPS A;  4AUX A;  4A6D A;  3SXY A;  1HW2 A;  1U5T B;  1LNW A;  1WJB A;  4KIB A;  1MJ9 A;  2QEN A;  5DUI A;  3REO A;  4AYB N;  2LKP A;  4UUV A;  2L5Q A;  1Y8Q B;  1D0X A;  3H9G A;  4WXH A;  3CJR B;  3DKW A;  1R22 A;  1OYI A;  2GXB A;  3CMY A;  3K4C A;  2ZCW A;  1O3S A;  2QQA A;  1NH3 A;  1OCC H;  2ACJ A;  2HXI A;  3GX4 X;  3CP2 A;  3LQQ A;  2RAE A;  1S7O A;  1MMN A;  3FBI B;  4EM0 B;  2X6Y A;  2EFP A;  2VBY A;  4I0B A;  3QYF A;  4GYG A;  1GT0 C;  5HOD A;  1ETW A;  5LLQ A;  2PMZ A;  2P7V B;  5LRS A;  1F36 A;  4L9T A;  2Q1Z B;  4ON0 A;  2AQF A;  3E97 A;  2ID3 A;  4FET A;  1AKH B;  5D5U B;  4WXC A;  4ZZL A;  2VXZ A;  3MKZ A;  2ZKZ A;  4Q47 A;  3RYR A;  2D45 A;  3H35 A;  2R7V A;  1G59 A;  1AU7 A;  1B6A A;  3B73 A;  4UY8 I;  2CQQ A;  3ML6 A;  2VC0 A;  2COB A;  3DKX A;  2IA2 A;  3RJP A;  3BLY A;  3E6D A;  5GTI C;  3LA3 A;  2CQN A;  2Z5U A;  4OMY A;  4XR6 A;  3GW2 A;  4M3G A;  2DMU A;  3MKY B;  3F9K A;  1XMK A;  2E2I J;  2X48 A;  5F27 A;  3CCE I;  1LUJ B;  4B44 A;  2CW7 A;  3T8R A;  2L7K A;  3ZMD A;  1HST A;  1VQN I;  2IT0 A;  3EUH A;  3C1D A;  5FRO A;  3DWL E;  3GEZ A;  1YO5 C;  4HAM A;  1USS A;  3T8T A;  5BS6 A;  4A3C J;  3VDX A;  4C3J J;  4A3I J;  1QVU A;  3HOX J;  3FXJ A;  4ASN A;  2WB1 A;  3J7A O;  1W7P D;  3DQV C;  3NAU A;  1VFC A;  1ON2 A;  3K70 D;  4KIS A;  4M6V A;  4E7L A;  3S1N J;  1S8N A;  1G3S A;  2EB7 A;  2Y69 H;  1FP2 A;  2Y0S A;  2ECC A;  3OOU A;  2DMT A;  4Z2Y A;  2E2H J;  5K7F A;  4A3M J;  2Q2E B;  5K5O A;  3FHN A;  4PJL A;  4BJ5 C;  1I3Q J;  1B4A A;  2MGQ A;  2ZFW A;  3TDU C;  2XKO A;  1A6Q A;  3S32 A;  3W6J B;  3LFK A;  2WAQ N;  2ZXW H;  1HF0 A;  4GYI A;  4ZC3 A;  2XAG A;  2XHK A;  2A6H F;  1I27 A;  2Z99 A;  3IHU A;  1D0Z A;  3ZN0 A;  4B8X A;  1K61 A;  1F1Z A;  2R93 J;  4WWC A;  2DAO A;  5KCM A;  2YUS A;  1EH7 A;  3MVP A;  3JRC A;  4CCO A;  3TOB A;  5J6X A;  2LY9 A;  2EA2 A;  5HOO A;  4IRI A;  2AXT C;  4IVN A;  1KU3 A;  2O03 A;  2W57 A;  4EMS A;  2VON A;  5GP9 A;  4EJU A;  4X0G A;  3L2W A;  1Z3X A;  4TV7 A;  2LTP A;  3A03 A;  2OQG A;  1UG2 A;  4G9Y A;  1OMI A;  3CP8 A;  4FQG A;  1FTZ A;  1T0F C;  2K9L A;  2QLZ A;  1R5I D;  1JTX A;  1CF7 B;  2CS3 A;  1TBX A;  4A3F J;  2E1M C;  3U2R A;  3KEY A;  4HYE A;  5JVG F;  2Y0M A;  2OBP A;  4AD9 A;  1WJC A;  4II3 A;  4RLQ A;  5E3L A;  4NBQ A;  5L3G A;  5M5W J;  1Y0N A;  2BY0 A;  2CQX A;  2JN6 A;  5F1J A;  1XSD A;  1ZG3 A;  3JSP A;  3HOS A;  4I98 B;  3G3Z A;  4BJT A;  1Y0U A;  2XAJ A;  4PJ0 C;  4NC7 A;  2CV1 A;  3M7G A;  1NK3 P;  2HPM A;  3VOE A;  2GWR A;  2HDW A;  1W5T A;  2P6S A;  2QWW A;  1PYV A;  3QPH A;  2DBB A;  2R92 J;  3BZ6 A;  4M71 A;  4Y3O A;  5J4V A;  1UHM A;  2ESN A;  4KN4 X;  2EIM H;  1TW3 A;  4NQW A;  1TQP A;  4CGZ A;  2DOE A;  2KKO A;  3FXM A;  1ETO A;  3IWF A;  1V5F A;  2YPR A;  4N4N B;  5LGT A;  4BBR J;  1XGS A;  2CV2 A;  1IUF A;  5ICF A;  1FBS A;  1UG0 A;  2XAS A;  5TGT A;  1IRG A;  3IH4 A;  2VLA A;  4XKB A;  4C2T A;  3MKW B;  2IW5 A;  2VKE A;  4QWQ A;  3HBL A;  1OCT C;  2P5K A;  1M1E B;  2HQ5 A;  5CKT A;  4PDK A;  4CDG A;  5K7Z A;  1W7P B;  3FM3 A;  1BJA A;  3I4M J;  4BXF A;  2DQR A;  5ICG A;  3BPV A;  1MBG A;  2LVS A;  1YFH A;  3WHB A;  3OYL A;  1HKQ A;  1Z3Y A;  2F5C A;  4CIC A;  4DGW B;  1V4R A;  5HS9 A;  2GAU A;  2PMU A;  2F2E A;  1MKM A;  2KL4 A;  1Y6I A;  3C3W A;  4CCJ A;  1SD6 A;  4AWX B;  3BG7 A;  2DK5 A;  2IGO A;  2BXZ A;  2K3F A;  4M3B A;  1MBF A;  2QSG X;  1EA3 A;  3GFI A;  3OY9 A;  4F92 B;  1YTY A;  1A04 A;  2O61 A;  3GUD A;  4M6Y A;  5AIQ A;  5ILV A;  1HDP A;  3E3V A;  3GCM A;  4KN7 X;  3GVA A;  3F8C A;  3GO5 A;  1VQ5 I;  3DLA A;  2HDC A;  4D5F A;  2NVT J;  4B09 A;  4IO9 F;  4IPA A;  1V5G A;  1XGM A;  2OD5 A;  4DNC A;  1UJ8 A;  3RPU D;  2IXS A;  3TP0 A;  2DYR H;  1IW7 F;  3H3V K;  1A35 A;  1ZGA A;  4GRI A;  1Z7U A;  2ZJQ F;  2M0M A;  1RKT A;  2QSF X;  2D1H A;  2KHM A;  4G8X A;  3T0Y A;  3KP3 A;  2EV5 A;  1JUS A;  2M5W A;  3L2C A;  3TOA A;  3U1D A;  2CW0 F;  4DW6 A;  2TCT A;  3WG9 A;  5JI6 A;  3N05 A;  2O8K A;  1VQP I;  2JA2 A;  3W2A A;  3MEX A;  4XON A;  5L3D A;  1P9Q C;  2FX0 A;  3I55 I;  5F0F A;  2A5W A;  1HA8 A;  3F6V A;  3M3Y J;  3EDP A;  3ZRG A;  5BQT A;  1R49 A;  4NC6 A;  2GA2 A;  4E7H A;  1S7A A;  4II2 A;  5TRD A;  1PJR A;  1ZAR A;  3OYC A;  4Z6Y A;  2Y31 A;  2EH3 A;  2R5Y B;  4XLE A;  3I9V 2;  2DA5 A;  3PIO F;  3ZQF A;  3OYM A;  1S5L C;  3F0C A;  3CCQ I;  1R5H A;  4I6Z A;  4M3F A;  1RIO H;  3P5J A;  2FRH A;  5M3M J;  1RZ4 A;  4IEJ A;  4HPQ A;  4IJA A;  1DDN A;  2QEX I;  3BY6 A;  5J8C A;  2ZNY A;  3P9C A;  3Q0W A;  2CUZ A;  1TZL A;  5EG0 A;  4AIJ A;  1MDM A;  1KU7 A;  3TP3 A;  4A3K J;  2XIG A;  3LST A;  2PQ8 A;  4BEH B;  2E60 A;  1Z1D A;  4A5M A;  4MLO A;  2CW8 A;  2AXL A;  3HG9 A;  3TQN A;  1BR4 A;  2D5V A;  1TQM A;  1BIB A;  3EPZ A;  1QNT A;  2VOP A;  2CH0 A;  1ODD A;  4GO1 A;  1H9G A;  5EJC A;  1YHQ I;  2EIK H;  4G7Z F;  4FCY A;  2OUM A;  2JT1 A;  2LK2 A;  1FBQ A;  2Y9Y A;  3JRA A;  4BXU A;  1UB9 A;  1ULY A;  1LVA A;  3HUG B;  5M5X J;  2M3A A;  2RNJ A;  3J7Z I;  4K2E A;  1R1T A;  5BOX A;  2QCO A;  2FMY A;  3HPG A;  3HTS B;  2M87 A;  2EZK A;  2RQP A;  1KYZ A;  2Z2S B;  4FE7 A;  3BR5 A;  3HPH A;  4MO7 A;  1F43 A;  2FD5 A;  1WFX A;  5EEA A;  2DO7 A;  3QP5 A;  3PUF A;  4R8H A;  4V2G A;  2X6X A;  3E6C C;  5IT3 A;  2K4J A;  3DXJ F;  2E7W A;  2DFE A;  2OZU A;  2FOW A;  4HLX A;  5GAG J;  2XPW A;  3CQZ J;  3S1M J;  4HOB A;  3NEU A;  2Y75 A;  3LNQ A;  1MMS A;  2PFB A;  5IP7 J;  1D0Y A;  4XKW A;  1ETY A;  5K5Q A;  2XV4 S;  4ESJ A;  1IXR C;  4KNY A;  4BYY A;  2VB6 A;  3GYH X;  4EM1 A;  3M8F A;  4E70 A;  3HDD A;  3A4C A;  3HIF A;  1U8R A;  5D4S A;  2LC2 A;  3MN2 A;  3MMY B;  4PGH A;  2ID6 A;  2FNP A;  4S04 A;  1G3W A;  3DTI A;  4KT6 A;  2CWE A;  2V1X A;  2QF7 A;  5J1Y A;  2BVM A;  1VQK I;  1ZHF A;  4L0Z B;  3L2U A;  1ZRD A;  1UZC A;  1WKM A;  2FBI A;  3SJM A;  3HOU J;  2BZT A;  5GPC A;  5D4R A;  3OYK A;  3ECH A;  4AID A;  3CC7 I;  3BTJ A;  1QZY A;  1VQL I;  3ZMS A;  5EZG A;  1Y8R B;  3LFU A;  2W84 A;  3ECO A;  1KA8 A;  3P9K A;  5F0H A;  1MBH A;  2YX7 A;  4UVB A;  1S72 I;  1E2X A;  3DKY A;  1JTY A;  3E5X A;  4BGD A;  2GM4 A;  3GME A;  2M4K A;  3HKZ N;  1CF7 A;  2EFQ A;  3QOP A;  4OIO F;  4BY7 J;  2QBY B;  5JLX A;  3BG3 A;  2AS5 F;  1ONV A;  3ABL H;  2K86 A;  1FLI A;  4G6D A;  1BBY A;  2VKD A;  1X1D A;  2E1N A;  3H3Z A;  5DCF A;  5DTD A;  4NHJ A;  3GTP J;  1J75 A;  2G7H A;  5DUK A;  1DU6 A;  3F8F A;  3TW7 A;  2VPR A;  3FK6 A;  4HNT A;  2K85 A;  4E7S A;  4JX6 A;  3BZC A;  1IN5 A;  3JRD A;  4OOI A;  2BW3 A;  5F08 A;  2DMQ A;  2KZV A;  2MA3 A;  4XSZ F;  2L7F P;  2XRO A;  2LMD A;  1IV8 A;  1TC3 C;  2JVH A;  2V9K A;  2DOA A;  1DUX C;  1SAN A;  2R7X A;  3I56 I;  5J1U A;  3S3O A;  4F93 B;  5K1Y A;  4EJT A;  3EYY A;  4O5V A;  4IOA F;  3D5R C;  4KA4 A;  2HOA A;  3VYR B;  1I6X A;  3HM5 A;  4BDZ A;  3TGN A;  2LFB A;  2M8G X;  1TNS A;  3H5R A;  3M9A A;  3R4K A;  5HDG A;  3RKW A;  2RKH A;  2HR3 A;  5KAI C;  2V7F A;  1R36 A;  3QQA A;  3FMS A;  2E34 A;  3MZY A;  1GV2 A;  1ETX A;  1V55 H;  2ZME C;  2EPF A;  1O57 A;  2DT7 B;  2ZO4 A;  2NAZ A;  4KYW A;  1STZ A;  2VE8 A;  3K1M A;  1BC8 C;  1J5Y A;  3GTK J;  1LDK B;  1MMG A;  4Q48 A;  2LY1 A;  2M0C A;  2LBF B;  2V26 A;  3S2H J;  2BY1 A;  3I53 A;  4FTH A;  1HKT A;  3JRI A;  1FY7 A;  1GLN A;  5DCM B;  4BAY A;  5JHF A;  1U5T A;  3T5X A;  3PSF A;  3S2D J;  4HV5 A;  2WBM A;  2VJ4 A;  4DJA A;  5BPD A;  1QZE A;  2L2O A;  3MQ0 A;  3SEZ A;  5C44 J;  3W2V A;  5CQE A;  1VQM I;  2MAB A;  5C4J J;  5HNH A;  4A12 A;  4HF1 A;  3RIR A;  1FYL A;  4CHU A;  2EZI A;  4C3I J;  2PEX A;  3CCV I;  3VFZ A;  2IVM A;  3DBL B;  5B66 C;  3L00 A;  2HVS A;  3IAS 2;  4HQM A;  1JJ6 C;  3ZQH A;  1OIS A;  1R5G A;  5LGN A;  1LDD A;  4XRS G;  4N0B A;  4W97 A;  4XRS A;  2W4S A;  1K4T A;  1R00 A;  4ZH4 F;  5KHD A;  4D5C A;  5KK1 A;  3VYS B;  1C0W A;  2ZNZ A;  1MND A;  4D0P A;  3AFH A;  3CCL I;  2QVO A;  3HRM A;  2XSD C;  1N78 A;  2QZ8 A;  5H6R A;  3ZQC A;  2VBX A;  2YU3 A;  5HLH A;  2EIN H;  3K9T A;  4CH7 A;  2GOM A;  4HG2 A;  4J00 A;  4HSR A;  4A0Y A;  4G6T B;  3BQZ A;  1QPI A;  2IA1 A;  3FXL A;  3WHC A;  1WGX A;  2QKM B;  3HJE A;  3VSL A;  4DIQ A;  2B0L A;  3S3M A;  2R4G A;  5KVR A;  4R1H A;  4AIK A;  2XUB A;  2JPC A;  1LE8 A;  5ERI A;  1GDT A;  3ASN H;  3EYI A;  4ENK A;  1XTA A;  2FJ1 A;  2JSC A;  4Y4R A;  5C4X J;  4I99 C;  2CYY A;  2HFH A;  1H8A C;  5F0C A;  4OMZ A;  1MH3 A;  4QPO A;  5E20 A;  5DDG A;  2XPU A;  1E0E A;  2G9W A;  2P7C B;  2IS1 A;  3EET A;  2EWN A;  3K4M A;  1R9T J;  1CQT A;  2IBD A;  4I2O A;  3F23 A;  3SFI A;  1FMV A;  2ICW G;  2BYV E;  3RQI A;  3U21 A;  3HSE A;  3O2P E;  1R71 A;  2W24 A;  3KFW X;  3S93 A;  3RPU A;  2FU4 A;  2K5C A;  2QQ8 A;  1OCP A;  4BNC A;  1OJL A;  2ZSI B;  1H9T A;  4RB2 C;  3H5A A;  3SYT A;  3LSP A;  3E5Q A;  1B9N A;  1N75 A;  1Q1V A;  2PN6 A;  4MEX F;  1S29 A;  3LWF A;  2HEO A;  4E4H A;  2DDB A;  3CO6 C;  4XSX F;  1O4X A;  2DA6 A;  3I71 A;  4M73 A;  1R23 A;  3ONQ A;  1OYW A;  1MJB A;  4ITV A;  3BR6 A;  1H0M A;  1SD4 A;  3FF5 A;  4PFP A;  3WTZ A;  2EFO A;  4PK4 A;  4UXN A;  5EEH A;  4MTE A;  2L7Z A;  4CCL A;  2V4J C;  6PAX A;  2FBH A;  3FKJ A;  3F3X A;  2ZJP F;  3AG4 H;  2R7S A;  2KFD A;  2P5V A;  3OL3 A;  3QYE A;  2X51 A;  3MFK A;  3S16 J;  1FOX A;  3HZJ A;  2MD5 A;  4CYD A;  2OCE A;  2K9Q A;  4XN0 A;  2EFW A;  3WGG A;  1R4M B;  5H20 A;  2LYC A;  2L9V A;  2QQB A;  3SZP A;  1SAU A;  3QOE A;  4IRH A;  3CLQ A;  1UAA A;  1MZB A;  1RUO A;  1JJ8 C;  1IG7 A;  1CGP A;  2XF6 A;  3A1Y A;  3BTC A;  4XBF A;  1SVL A;  5JLW A;  1BOB A;  3H0D A;  4HLY A;  4UUT A;  5AON A;  3C2H A;  3H36 A;  4IKF A;  3ESW B;  1QBJ A;  1PP7 U;  1BR2 A;  2O5R A;  1T95 A;  3HUG A;  2X6W A;  3K10 A;  1D8J A;  1MBJ A;  4BXX J;  1IAW A;  3LSK A;  4QTR A;  4A3B J;  1KQ0 A;  3CJT B;  3ZN1 A;  3VYU B;  2VPL A;  5GTH C;  1BI2 A;  3BTI A;  4ZYA A;  3GXO A;  4HBL A;  2EFN A;  4WX9 A;  4O3M A;  2QA4 I;  1TWG J;  4C9Y A;  2OC6 A;  3CES A;  4L18 B;  2QSH X;  2LOO A;  2H94 A;  2HQN A;  1KQ9 A;  3CZ6 A;  4U0V A;  1VQ8 I;  3FXU A;  4M6X A;  1A31 A;  2QUF A;  1WH5 A;  1K83 J;  2DDA A;  2RRE A;  3NAR A;  1UEL B;  4RGS A;  1GUU A;  2WV0 A;  4NQW B;  3WTS C;  4LFU A;  2HNH A;  5IP9 J;  2JZY A;  4KMU X;  2L01 A;  5L3F A;  1UFM A;  2WC2 A;  2GIV A;  4A6E A;  2HVQ A;  2Y2Z A;  1AWC A;  2Z3Y A;  5E8I A;  4RA2 A;  3OL4 A;  3ULQ B;  3BCA A;  4M3E A;  2FUG 2;  2FF4 A;  4AM3 A;  2HYF A;  2H6B A;  4G12 A;  2HYG D;  3TDZ C;  3GF2 A;  2NVU B;  4XLN F;  2F4M B;  2CUE A;  1S7E A;  1Z91 A;  3KZY A;  3M07 A;  2JWT A;  4RBO A;  1T8I A;  3IL2 A;  4UHT A;  5IT9 K;  2VAS A;  4UB8 C;  3BR0 A;  3KP7 A;  2D1V A;  3KZZ A;  3F22 A;  3OWT A;  3IRR A;  3L7W A;  1W36 D;  3BT9 A;  1WJF A;  3D5L A;  2KRF A;  1HOM A;  2A3S A;  2PLY A;  3DFG A;  3RSN A;  1ZH5 A;  3VOD A;  3LSG A;  5E18 F;  2GLO A;  2QQ9 A;  5M3F J;  1RNL A;  3OYH A;  1YOV B;  1SD5 A;  4GDF A;  2EV6 A;  3FBN B;  2NOG A;  2V1D A;  2LKX A;  2QM3 A;  4P9U A;  2CRG A;  2H8W A;  3V8J A;  5K5R A;  1UHS A;  2VT2 A;  2XPV A;  3CF2 A;  4XOT A;  5TJJ A;  2PMZ N;  2O8X A;  5DYM A;  2CSO A;  2ZC2 A;  1T39 A;  1ERD A;  1XDU A;  3IRQ A;  2NNY A;  2UXN A;  1A6I A;  2EIJ H;  1J7K A;  2NS0 A;  4ZJZ A;  1IXS B;  1O7F A;  4BHB A;  1OKR A;  2KIF A;  2O6G E;  3KET A;  4ESF A;  1ETK A;  5ILS A;  1JKQ C;  3I4P A;  3OS0 A;  1WI3 A;  2MC4 A;  2K9M A;  2KJC A;  1LFU P;  3M1E A;  1LE8 B;  2EV0 A;  3H92 A;  1XSV A;  1S9H A;  1Z77 A;  1K78 B;  2IRF G;  2PI0 A;  4KIG A;  2NRA C;  2WAD A;  4EEF G;  4LLN A;  5EG0 B;  2ZB9 A;  1MDM B;  1XMX A;  3BOQ A;  2P5L C;  2V9V A;  3ABT A;  2F48 A;  3DU5 A;  2RGV A;  4HX4 A;  3G1M A;  2HZD A;  4JK1 X;  3GZ6 A;  2NS8 A;  1I50 J;  2IAI A;  1ZR4 A;  4G7O F;  4ZTF A;  4LK1 F;  2W00 A;  4OIR F;  1DP7 P;  3OYD A;  2XGC A;  3BR3 A;  1P7J A;  2JRM A;  1TW2 A;  1YJN I;  4DYC A;  4H0E A;  3TMO A;  3GTL J;  3OMY A;  1Z21 A;  1MMD A;  3T1B A;  2JQ7 A;  3OYA A;  2LH9 A;  1OPC A;  3BC8 A;  4B3A A;  3OIP A;  5CVR A;  3ABU A;  2MG4 A;  3TW6 A;  1T98 A;  3CUO A;  2DA1 A;  4QSH A;  1OFC X;  1TTY A;  2IGM A;  3FMR A;  4YIF A;  1I1G A;  2RNG A;  2VC1 A;  3TL4 X;  3E6B A;  4HV6 A;  4B3X A;  4YEJ A;  3WOD F;  4F55 A;  2ISY A;  1ZLJ A;  2Q8K A;  4BQA A;  1Z05 A;  2L9N A;  5HLI A;  2DPU A;  1YW9 A;  4E7Z A;  1T0F A;  2LRD A;  1KGS A;  2WA0 A;  1ETV A;  4LJZ F;  2NXN B;  1JHF A;  4I01 A;  2YS9 A;  4DBR A;  5J4Y A;  1OR7 A;  3D0S A;  5FB2 A;  3OOP A;  1GV5 A;  1H89 C;  1NK2 P;  1BR1 A;  1W4M A;  3GZN B;  4A3E J;  4NB5 A;  3L2V A;  3I59 A;  2W82 A;  1E3H A;  2VXD A;  2E19 A;  4C2U A;  2KMU A;  2V9P A;  5FKK A;  4MGR A;  1WH7 A;  3BDD A;  3DCF A;  2V79 A;  2BHY A;  1X2N A;  1VQ4 I;  5CVV A;  1PP8 F;  2PJR B;  4C30 A;  5D5V B;  3HXL A;  4A93 J;  1IN4 A;  3IKV A;  5LD2 C;  2VOO A;  2F6C A;  4A5N A;  4HST A;  5A2Q Z;  4Y7N J;  3OYN A;  5F64 A;  1QO0 D;  3TO7 A;  5HNF A;  4BJ6 C;  3FIW A;  2ZSH B;  2DK8 A;  1ITY A;  1X1P A;  1LFP A;  3HGG A;  3G71 I;  1FJL A;  2YSR A;  4XRF A;  3UKG A;  4B1R A;  1W0U A;  1FZP B;  4MQ9 F;  2ZJR F;  2AO9 A;  3K4K A;  1YI2 I;  2FQ4 A;  2OU2 A;  4Y17 A;  2NVQ J;  2O9L A;  2XRN A;  2YU9 J;  1RPW A;  2BY3 A;  2O7O A;  2O3F A;  3H1C A;  3O8G A;  2HTJ A;  1WSU A;  4BY1 J;  4UV9 A;  3W2W A;  1TT5 B;  2DT6 A;  2CFO A;  4ZYG A;  1XG1 A;  2LY2 A;  4KMF A;  3GWZ A;  4AIH A;  2LNB A;  2XGE A;  1HBX G;  1PVE A;  2ZFU A;  4WF2 A;  2DPD A;  2K9S A;  2KJB A;  2KIS A;  2WY7 Q;  1TWF J;  1J59 A;  5AIP A;  1LVK A;  1X3U A;  2EZL A;  1BI1 A;  2O0Y A;  5CJ9 A;  1MNM C;  2LR8 A;  5LEK A;  1YJ9 I;  1T33 A;  3CDI A;  3RTR A;  2XAH A;  4M3D A;  1WWX A;  1HLV A;  2CV0 A;  2XB0 X;  3Q9S A;  4E7J A;  4LGW A;  3VSK A;  2E1M B;  2R7O A;  4RB1 A;  1U0J A;  4LLL A;  4DZP A;  2ELH A;  1GVD A;  3R60 A;  2FML A;  1U6G A;  2Y48 A;  1LEA A;  3FIS A;  2K7L A;  2M34 A;  2IEK A;  1FWZ A;  2VUM J;  4ABZ A;  1P4W A;  2XGX A;  1PUF B;  4RS8 A;  1W1W E;  3LSH A;  5FGM A;  1G3T A;  1JGG A;  3HOV J;  4BDY A;  1ZK8 A;  4L9V A;  5J40 A;  3H9Q A;  3E6M A;  3S8P A;  2MSY A;  5ICC A;  1XSX A;  1EV7 A;  2HZT A;  4XLA A;  1RI7 A;  3SEQ A;  2NVY J;  3I54 A;  2RQQ A;  2E71 A;  1YIT I;  4BS9 A;  4XIC A;  5E3M A;  4BKX A;  2VE9 A;  1B8I A;  5J1R A;  3JRE A;  3V7C A;  2ZME B;  2I8D A;  3ABK H;  2H27 A;  4RGR A;  2M1B A;  2DA2 A;  3PO3 J;  3H3U A;  1XGN A;  2R7D A;  4XRM A;  2ADU A;  1YRN A;  1K4S A;  2DOD A;  4PZJ A;  2MFZ A;  3B02 A;  1B9M A;  3CF5 F;  2W48 A;  1ZKG A;  1LFB A;  2QGU A;  4LB6 B;  4F7Z A;  4KFC A;  1BJZ A;  2KIQ A;  1HW1 A;  1MNE A;  2M2E A;  3CMM A;  1LKX A;  4PUS A;  5E79 C;  1IO2 A;  3Q9V A;  4D9J A;  4XK4 A;  4BE1 A;  4PFO A;  1F9N A;  4Y13 A;  3OSF A;  3DTK A;  2XAQ A;  2KIM A;  5HVQ C;  4GGG A;  2H1K A;  3A2K A;  1IGN A;  2CUF A;  2VIX A;  4XL9 A;  2MBF A;  1JT0 A;  2JJ7 A;  1QHH D;  3I64 A;  1ZRC A;  3Q3S A;  5E8G A;  2DJN A;  2TDX A;  4ENM A;  3K2A A;  4OIP F;  3HEF A;  1TL8 A;  4DYQ A;  3OYB A;  1TP4 A;  2Q2E A;  2EZH A;  5CQG A;  3TO6 A;  3ZQI A;  3ZCO A;  1BM9 A;  1F4K A;  5EDN A;  4RGU A;  2H1L A;  3AG1 H;  2BBY A;  4BHP A;  3ZOB A;  3ASO H;  2IA0 A;  1OYY A;  1Z6T A;  4N4O B;  4ANJ A;  2L4A A;  5D6F A;  4B48 A;  2EIL H;  3PNV A;  4PJN A;  1Y39 A;  2KQR A;  1XCB A;  3WTW C;  1K7A A;  4DZJ A;  3L2Q A;  5DM6 F;  5CVJ A;  3NRV A;  3AAF A;  5D5W B;  3R6S A;  2DFH A;  3BR1 A;  2XAU A;  3S17 J;  2IGN A;  3KLO A;  3V42 A;  4OAZ A;  4P96 A;  5M5Y J;  4IHT A;  2GZW A;  1T2K A;  3DBR B;  2V1U A;  3PQK A;  2LRE A;  2NNN A;  1H88 C;  1ZLK A;  4RMN A;  1WJE A;  2HWV A;  2K40 A;  5DM7 F;  1ZYR F;  2BEO A;  5D8K B;  4JBA A;  4KIC A;  2PJR A;  5B5E C;  3QP6 A;  2FEZ A;  2K4B A;  2DFF A;  2RDP A;  3KE2 A; 
#chains in the Genus database with same CATH homology
 2VL8 A;  3KX2 A;  2ZSI B;  4CUG A;  2UUZ A;  5KCM A;  1JI8 A;  3AKZ A;  3LL7 A;  3H5A A;  3KYL A;  3SYT A;  1WJA A;  1N75 A;  3DPL C;  1VZ0 A;  4CCO A;  4PJM A;  4E4H A;  2F5V A;  1Y56 A;  5HOO A;  3ONQ A;  4ITV A;  4X0G A;  4PFP A;  3L2W A;  1Z3X A;  3K4B A;  4PK4 A;  3J7A Y;  4CSW A;  4CCL A;  2V4J C;  1IRX A;  3CJQ B;  3FKJ A;  4YEL A;  2HVR A;  2R7S A;  1X4P A;  3OL3 A;  3CP8 A;  3QYE A;  2X51 A;  3I3L A;  4J01 A;  1T0F C;  2K9L A;  3OYJ A;  4XN0 A;  5FRM A;  2CS3 A;  3ZXS A;  2LYC A;  2E1M C;  3KEY A;  3OS1 A;  1FMW A;  3OIQ A;  1SAU A;  3QOE A;  4BU2 A;  3HOT A;  1WJC A;  4II3 A;  4RLQ A;  4KIT B;  2R7T A;  1UAA A;  1DGW Y;  1MW7 A;  4CCK A;  3NWS A;  4XLC A;  3HOS A;  1DP3 A;  4BJT A;  2XF6 A;  3A1Y A;  4NC7 A;  4XN3 A;  4XNF A;  2CV1 A;  2HPM A;  2HDW A;  1BOB A;  1PYV A;  3H0D A;  4DOZ A;  3DTE A;  3ZR8 X;  3C2H A;  4IKF A;  2JVG A;  4Y3O A;  4XLF A;  1BR2 A;  3AL0 C;  2O5R A;  1T95 A;  3VYT B;  4B43 A;  2X6W A;  3K10 A;  2Z1D A;  1V5F A;  4N4N B;  3LSK A;  1MMA A;  4F3Q A;  2VJJ A;  3VYU B;  2CV2 A;  1DGR M;  1KON A;  2VPL A;  1UG0 A;  4ZYA A;  5TGT A;  2XSJ C;  3OR1 C;  2VLA A;  3UNG C;  1J09 A;  4XKB A;  3K70 C;  4J00 A;  4C2T A;  3MKW B;  2KP6 A;  4C9Y A;  2OC6 A;  3CES A;  4RLF A;  4ZTJ A;  2LOO A;  3CZ6 A;  5CKT A;  3K6G A;  3SDB A;  4YRV A;  4CZC A;  2OV7 A;  2RRE A;  1R6R A;  1UEL B;  4BXF A;  4NQW B;  2R7W A;  2HNH A;  1AA7 A;  2X1E A;  3MD2 A;  4F91 B;  2HVQ A;  3OYL A;  1Z3Y A;  4DGW B;  2E5Z A;  2VQC A;  4KJZ A;  3UR3 C;  3OYG A;  4BQN A;  3OL4 A;  3BCA A;  2KL4 A;  1Y6I A;  3NWT A;  2VKH A;  2FUG 2;  4CCJ A;  2X85 A;  3BG7 A;  2IGO A;  3HKZ A;  4BUP A;  3S3N A;  1NG7 A;  1X19 A;  4HRI A;  3ZQQ A;  3VWB A;  1EA3 A;  3OY9 A;  2R7U A;  4LG3 A;  3W3C A;  4F92 B;  3BCB A;  2VQH A;  3HL2 A;  4U87 A;  3EUK L;  2VAS A;  3DLA A;  4ZDL A;  1TT0 A;  3OWT A;  4NNJ A;  1V5G A;  1W36 D;  2ZXI A;  3RPU D;  1WJF A;  2IXS A;  3D5L A;  2IS4 A;  4DBQ A;  2KRC A;  3LSM A;  3RSN A;  4GRI A;  3LSG A;  1YX5 A;  4BQO A;  2M0M A;  4XKV A;  3K4N A;  4FAS D;  3OYH A;  2KHM A;  3FBN B;  4P5O A;  4OAY A;  3E1S A;  4U7B A;  3DEE A;  2HPI A;  3CF2 A;  4XOT A;  2JUG A;  2IS6 A;  3N05 A;  4OWR B;  1ERD A;  4JOM A;  1OLT A;  2JA2 A;  3FDY A;  4BE2 A;  2IS2 A;  3W2A A;  2KDO A;  4XON A;  1P9Q C;  2A5W A;  1W36 C;  1HA8 A;  4ZJZ A;  1X1B A;  2HU9 A;  4CCM A;  1DQU A;  3ZRG A;  4E7H A;  4II2 A;  1PJR A;  3DPU A;  4NUB A;  4PSX A;  3OYC A;  2L9S A;  3OS0 A;  2DXI A;  4BAC A;  4AVZ A;  2MC4 A;  2K9M A;  4XLE A;  3I9V 2;  2V6E A;  3OYM A;  2MYS A;  3K4J A;  1S9H A;  2W7N A;  2W1O A;  4RM3 A;  2WAD A;  3IAM 2;  4HPQ A;  2BOL A;  1QHG A;  2KPM A;  3DU5 A;  2HZD A;  2KLO A;  2CUZ A;  1TZL A;  4XQF A;  4ZTF A;  2W00 A;  4IQ4 A;  1WJD A;  3OYD A;  1X1C A;  3TMO A;  3OMY A;  2CUJ A;  2A6T A;  1Z21 A;  1MMD A;  4BEH B;  2E60 A;  2DCE A;  4XMY A;  3OYA A;  1D0Z A;  4IZZ A;  2LH9 A;  4MLO A;  2CW8 A;  2WY8 Q;  4XOR A;  3BC8 A;  4D1Q A;  3HG9 A;  3OIP A;  1BR4 A;  2X1D A;  3EPZ A;  2JSP A;  2VJI A;  2WAF A;  2CH0 A;  3GBG A;  3RQ4 A;  2IGM A;  1X1A A;  2OUM A;  2RNG A;  3TL4 X;  1D1A A;  4B3X A;  4YEJ A;  3HUG B;  4F55 A;  2M3A A;  4ZDO A;  4LIV A;  2L9N A;  2M7B A;  4LIU A;  2WAQ A;  4E7Z A;  4ZDP A;  2LRD A;  2WA0 A;  3HPG A;  4DBR A;  2IGK A;  4EAT A;  2Z2S B;  3H9J A;  3HPH A;  2X1C A;  2NOJ B;  5HLT A;  1WFX A;  1BR1 A;  4AYB A;  2X6X A;  3L2V A;  2W82 A;  2VXD A;  4C2U A;  2KMU A;  3D5S C;  2UV1 A;  2K3P A;  4IX7 A;  1D0Y A;  4XKW A;  2AQE A;  2MD0 A;  2PJR B;  4C30 A;  3HXL A;  2VB6 A;  1G8X A;  5LD2 C;  2F6C A;  4HST A;  4JQF A;  3A4C A;  3IUO A;  3OYN A;  5HNF A;  2LC2 A;  4BJ6 C;  3MMY B;  2ZSH B;  4PJJ A;  1LFP A;  2P0W A;  3DTI A;  4KT6 A;  3OS2 A;  1WJ5 A;  1YX3 A;  2BVM A;  2LG4 A;  3SZG A;  3K4K A;  3L2U A;  3PNY A;  4E7K A;  3DPT A;  4XLH A;  2VQG A;  3OYK A;  2HQA A;  3H5N A;  2V1N A;  3LFU A;  5CPR B;  3W2W A;  3BG6 A;  2DT6 A;  2CFO A;  3OYI A;  3PL8 A;  2LY2 A;  2R7Q A;  4XKC A;  3QYB A;  1K6Y A;  4BQQ A;  3RCO A;  4QPQ A;  3TBI A;  3DKY A;  3PSI A;  3L2R A;  4BGD A;  2ZFU A;  2M4K A;  1N77 A;  4BEH A;  1QU3 A;  2WY7 Q;  1LVK A;  1YE9 A;  3PNT A;  4NC8 A;  2XF7 A;  2VKD A;  1X1D A;  3OYF A;  2XF5 A;  4PSW A;  4HNT A;  3RTR A;  2KRH A;  4BE0 A;  4E7S A;  3OR2 C;  3IP4 B;  1V5E A;  2CV0 A;  2UWM A;  4E7J A;  3VSK A;  2BW3 A;  2E1M B;  2R7O A;  2KZV A;  4P1W A;  3ZGK A;  1U0J A;  2DJI A;  1D1C A;  3PFY A;  4AU7 A;  2BW3 B;  4XOP A;  2BVL A;  2JVH A;  2V9K A;  1SFK A;  2DOA A;  2R7X A;  3K4L A;  3S3O A;  3EUA A;  3M8J A;  4F93 B;  5FRN A;  4E7I A;  3LSH A;  2VJ5 A;  4F52 A;  4BDY A;  3D5R C;  4RM2 A;  3VYR B;  3H9Q A;  4R79 A;  3S8P A;  4BDZ A;  3AL0 B;  3H5R A;  1D1B A;  2V7F A;  4LIT A;  4IQJ A;  2GOX B;  4XM3 A;  4XLA A;  3SEQ A;  2M4G A;  4Y33 A;  2RQQ A;  2M7A A;  1WJB A;  5LFA A;  2DT7 B;  1Z7L A;  4BS9 A;  2LBF A;  2L5Q A;  1LDK B;  4B47 A;  1MMG A;  1D0X A;  3H9G A;  2I8D A;  3CJR B;  2LY1 A;  3QOD A;  2LBF B;  3K4C A;  2V26 A;  3G2B A;  3PUB A;  3CP2 A;  1NG6 A;  4HEA 2;  1MMN A;  4BL0 B;  3FBI B;  2X6Y A;  4CCN A;  1GLN A;  3QYF A;  3DU6 A;  3M1C A;  2MFZ A;  5JHF A;  2PMZ A;  1X4O A;  2Q1Z B;  3PSF A;  2AQF A;  4E6K G;  4FET A;  1MNE A;  2F4I A;  2WBM A;  2VJ4 A;  2VXZ A;  3CMM A;  4DJA A;  3MKZ A;  1LKX A;  4PUS A;  2L2O A;  3SEZ A;  3PJR A;  3W2V A;  3H35 A;  2R7V A;  5CQE A;  4D9J A;  1G59 A;  2MAB A;  5HNH A;  4BE1 A;  4PFO A;  3DKX A;  2ELJ A;  2WAE A;  2VQL A;  3BLY A;  3DTK A;  5HVQ C;  3A2K A;  4XR6 A;  2VIX A;  2XDV A;  2HVS A;  3IAS 2;  4XL9 A;  4H4K C;  1QHH D;  3MKY B;  3F9K A;  3E0J B;  2ZXH A;  4B44 A;  2CW7 A;  2L7K A;  2W4S A;  3HC7 A;  4HNU A;  3OYB A;  5KHD A;  5CQG A;  3VYS B;  3ZCO A;  1MND A;  3DWL E;  3AFH A;  5FRO A;  1N78 A;  3VDX A;  4CH7 A;  5KNL A;  2GOM A;  2WB1 A;  4HG2 A;  3DQV C;  1OR7 C;  2E5N A;  3LSI A;  4G6T B;  4HSR A;  4N4O B;  4B48 A;  4ANJ A;  2QKM B;  3VSL A;  3K70 D;  3PNV A;  4PJN A;  4DIQ A;  2R7R A;  4KIS A;  2KQR A;  4E7L A;  3S3M A;  2R4G A;  2CMP A;  1ZEL A;  3L2Q A;  3EUH C;  2Y0S A;  2Z16 A;  3OOU A;  3LMM A;  4Y4R A;  2Q2E B;  3FHN A;  2XAU A;  4QPO A;  4PJL A;  2IGN A;  4BJ5 C;  3OYE A;  2QKL B;  4OAZ A;  3V42 A;  2IS1 A;  1E0E A;  3C2G A;  2LRE A;  3K4M A;  3S32 A;  4RMN A;  1WJE A;  4CA0 A;  2XC7 A;  1FMV A;  3U21 A;  2PJR A;  4ZC3 A;  3S93 A;  2K5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...