2XF5A

Crystal structure of bacillus subtilis spp1 phage gp23.1, a putative chaperone.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
49
structure length
49
Chain Sequence
SESLLYGYFLDSWLDGTASEEMMRVAVNAGDLTQEEADKIMSYPWGAWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords GP23.1
publication title Crystal Structure of Bacillus Subtilis Spp1 Phage Gp23.1, A Putative Chaperone.
pubmed doi rcsb
source organism Bacillus phage spp1
total genus 13
structure length 49
sequence length 49
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xf5A00
2XF6A 2XF7A 2XF5A
chains in the Genus database with same CATH superfamily
1IJWC 1MMDA 2JTVA 3FM5A 3AKZA 4XKCA 1FBUA 1YS7A 4PJNA 1JHHA 1YG2A 3CTAA 4FX4A 1F4KA 2GIVA 1YIOA 3V8LA 4IHYA 2M0CA 2HZTA 2LNBA 2DAOA 1RZ4A 1UG0A 2PG4A 3QU3A 2DOEA 4IO9F 4EV0A 3U21A 5ILSA 3ULQB 3PNTA 1VF9A 2JZYA 5BS6A 2CUEA 4LD5A 3HRTA 1HKSA 4RS8A 3K10A 3S8PA 3AL0B 3ABKH 1YX3A 1QPIA 3ZQGA 2CW7A 4G6TB 1YRNA 4KUMA 4HNUA 1R36A 1VQMI 1QHGA 2QSGX 2H94A 1YI2I 3SZTA 1HBXG 1LNWA 5CVUA 1I3QJ 4I99C 2STTA 3L09A 3HUGB 3NAUA 2BZTA 3HTUA 5FKMA 2K9LA 4MLOA 3IH4A 1QPMA 1HDDC 3S32A 3DBLB 4XRSA 4JOMA 5CQGA 2IGMA 3CCSI 4M9XA 2ZFUA 2YX7A 5HDKA 1PUFB 2XIGA 1HLVA 2VB6A 4I98B 4I6ZA 3FXUA 3VSKA 4BXUA 2UZKA 2H1KA 2PJRB 3CC4I 3ESWB 1I1SA 4IVNA 3GTLJ 4M3BA 4XQFA 3TEDA 1FYLA 1O3QA 2QSHX 2P5LC 5F6FA 4HSTA 3C2GA 4BAYA 3BJ6A 2BW3A 1OKRA 4NNJA 3GTMJ 1W1WE 2PJPA 4F92B 1ZRDA 1K79A 4BNCA 1WJAA 2AQEA 3MZYA 1XCVA 1JUSA 1YLFA 3KX2A 5FJ8J 1B9NA 4IX7A 4RMNA 1T8IA 2ZXIA 2LBFA 1O3TA 1BOBA 2HOSA 2FJ1A 5E3NA 1WKMA 3NWTA 3H9JA 3ZXSA 3W3CA 3H3ZA 4D0PA 1FSHA 2ZXWH 2H6CA 3DBRB 2CQKA 2WA0A 5HNFA 2V9KA 1A35A 3ONQA 2FX0A 1KYZA 3K4KA 4RLFA 3FXKA 2R7TA 3OYKA 3O6BB 5F64A 4C2TA 2ZJPF 5C3EJ 3G1OA 2KFDA 3GYHX 1P4AA 4UB8C 1X2MA 2DFHA 3FK6A 5KVRA 2VPRA 2NYXA 3F23A 2CWEA 1C0WA 5IYCJ 3CUOA 3HRUA 1ZARA 3K4BA 1IDYA 3JSPA 3LL7A 2M2EA 2ESHA 2ZNYA 3KLOA 4GYIA 1QU3A 4M71A 4KIBA 3M3YJ 4IOAF 4CYCA 3HOZJ 5J4YA 1ZG1A 2JK3A 1PYVA 5FROA 2VE9A 2ZBKA 1FTZA 2QKMB 1EKEA 1WJDA 1P7IA 3GFIA 2X85A 4PSWA 5LHIA 3EYYA 2EJRA 4GCVA 2DI3A 4RGXA 2DYSH 1QZYA 4XORA 2L7ZA 3C18A 2L9VA 4Y15A 4AD9A 4HW0A 3RPUA 5KAFC 1DUXC 4PJJA 2JA5J 3OR1C 5FRNA 5J3LA 1IRGA 2MC3A 3WE2A 3S2HJ 3G6EI 3MKYB 2ME6A 1OJLA 5E1XA 1H9GA 2MH2A 2AQFA 2K9SA 3TO6A 1D0YA 3V4GA 2Z16A 2FD5A 3OOPA 1I50J 3QQAA 4QPQA 3CUQC 4HF1A 4QSHA 4JBAA 3TP3A 3I53A 3S15J 1BI2A 5LLQA 4KITB 3Q0VA 2I10A 2NVQJ 5H6RA 3T8TA 4YIRX 4OMYA 2ID3A 2O7OA 2P7CB 2DJNA 2X0LA 5HLTA 1JJ8C 1P6RA 4I2OA 4X1EA 1VNDA 4ETSA 3JRAA 1XDSA 2LRDA 1I3AA 3SXYA 2I5UA 4AM3A 1FMWA 4UVCA 4ZDPA 1MBHA 3ZQLA 1MNMC 1ZRFA 2TDXA 2YU9J 1OPCA 1L0OC 1MJBA 3M8EA 2LMDA 3GZNB 3AG4H 2DMUA 4EJOA 5LHGA 3ZMSA 3CP2A 2QQAA 4ENNA 5JLWA 1MBKA 1MMGA 2K9MA 1GXPA 5L3EA 5FLXK 2JJ7A 1QGPA 3TW7A 3FM3A 1Y8RB 4KT5C 3HTSB 1SC7A 3I4MJ 1H89C 1DP3A 3K70D 4IRHA 3P9KA 4FETA 1B1BA 3NQOA 3OR2C 5B1BH 2E19A 2FQ3A 5K1YA 1UJ8A 3ABUA 3DF8A 1IC8A 3VOEA 1W0TA 3SZPA 2IA0A 3KPHA 4CGZA 4HOBA 3KP7A 1P7JA 1FJLA 1T0FC 2DODA 2QUFA 3CCVI 1SFEA 4DZPA 1QZZA 2OTJI 2OAZA 5EZHA 4ASNA 1JUPA 3JRIA 2XAHA 4RGUA 2DOAA 2R4GA 2BY3A 2VBYA 4H4KC 2KP6A 3GO5A 3HOUJ 3AG2H 3E0JB 1LFBA 4ESBA 4IF4A 4UHTA 5HLIA 2RAEA 4RAGA 5FFXA 4I7HA 4YG2F 2DT7B 3JR9A 1J75A 3G1LA 4UUVA 4LLGF 2DDBA 1B72A 1MZBA 4XN3A 4HDUA 1Y56A 3QYFA 2QGUA 1U5TC 3JTHA 3K1MA 3L9FA 1H88C 2E60A 4MNUA 3OYEA 5EG0A 1D1AA 4GRIA 1TWHJ 4YFXF 2WADA 1BR1A 1WJCA 2KMUA 3U9GA 1XMAA 1WQ2A 4MHGA 3PQJA 5D8KB 2HDWA 1R4MB 4LMYA 1P92A 1XGNA 2M8EA 3DU6A 4G94A 2A5YB 1ZTRA 2JPBA 1AU7A 1G59A 2P81A 2LVSA 1WSUA 4N0BA 2JA8J 3JREA 2P7VB 2L7KA 4X0GA 4Q4ZF 5D8LB 1WRJA 3DXJF 4OU0A 5BPIA 3EUHA 5H6QA 5IPAA 2E5ZA 4NUBA 3FWEA 1PUEE 1UG2A 3DKWA 2GIZA 1E3PA 2O6GE 3WGIA 5LHHA 2VQHA 4OIQF 2EV0A 1XCBA 4KFCA 3D5SC 4LLLA 2A3SA 2MD0A 3IKVA 3BQYA 1WJBA 2OZ6A 1VQ8I 3IKTA 4QIWN 2LREA 3A02A 1OLTA 3MVPA 1Y0NA 1YFHA 4A3BJ 2DT6A 5LD2C 2VOPA 3SZGA 4A3DJ 3K0LA 3LA3A 4XRSG 2H27A 2KZGA 3BTIA 3HM5A 2OTLI 3QYBA 1X1PA 3OMYA 3CZ6A 4BBRJ 1LDJA 2KHMA 3FHZA 2F6CA 2R5YA 5HS9A 1FBSA 3HSEA 1ETKA 4A3EJ 1HC8A 1FZPB 4F55A 1FYMA 4E6KG 4IXAA 1G8XA 2I8DA 1MSEC 4DYRA 1O4XA 3VYTB 2VQLA 4UUSB 1SVMA 3P5JA 4M74A 2STWA 1FOKA 4KISA 3K1PA 5ED4A 4BKXA 5F1RA 1K78B 3J7ZI 2MBFA 3PJRA 2V1XA 1LKXA 5E18F 4R8HA 3NARA 1VQPI 2V1UA 3DU5A 3GFMA 3CD6I 3S16J 2FQ4A 4E7IA 3PM1A 3AFHA 1W0UA 2DK8A 3V42A 4TV7A 5K7FA 4ABZA 5D5UB 1U0JA 2EPFA 2XRNA 1AKHA 4M6YA 3K2AA 5DUIA 2QZ8A 2ZMEB 2EA4A 3R0JA 1N25A 4PGHA 4RB1A 1VQNI 2E2HJ 3IAM2 1V54H 1RIOH 4HX7A 2XV4S 1NG6A 5A2QZ 3QP5A 2EILH 4MQ9F 3V7RA 2E7XA 3E7LA 3CCJI 1DPRA 3QWLA 4HZFA 3M7GA 3DTKA 1P4WA 2ECCA 4EMSA 2UUZA 4XOPA 2JT1A 1ZK8A 3COAC 4A0ZA 2EZIA 3KYLA 3WTTC 2L5QA 1DU0A 4ZYGA 4GDFA 3IRRA 1ZR4A 2KT0A 2Q8KA 3CO7C 5J8FA 2RDPA 1NK3P 1DGRM 4XSXF 1OMIA 5E1ZB 4PUSA 4U7BA 2IGOA 5GP9A 3DCFA 2BVMA 4QLCU 5E3LA 1R58A 2N8GA 3MCZA 4EJTA 1D1CA 1WH5A 3H36A 1MJ9A 3ASOH 3WTZA 3HRSA 2XAUA 4U0VA 2HNHA 2WY7Q 2E2IJ 1G4DA 3FZVA 5LRSA 4KIFA 2DOFA 2ELHA 2D45A 1HXDA 2E34A 2XPWA 1I6HJ 2R5ZB 2F4MB 1J5YA 4O5VA 2V1NA 4HLYA 1LE8A 1X2NA 4NB5A 4NQWB 2DA4A 3I64A 2X6XA 2AO9A 3W6KB 1FNNA 2ID6A 2DA2A 2EV5A 1T38A 2M30A 1DDNA 2VPLA 3SFIA 4WF2A 5HNHA 1Z05A 3KYDB 3RDIA 4E7SA 3TO7A 3DBHB 4YIFA 3I58A 4RAYA 1R1TA 2R7FA 4XKVA 1XMKA 2FA5A 1X4OA 2ETHA 3VDXA 2KISA 3L2VA 1X3WB 4RA2A 1UFMA 2LG4A 2MD5A 3CJRB 2VJ4A 2RNGA 5E8IA 1P9QC 1Q1HA 1T98A 2KQRA 2HGCA 2A07F 3A03A 5K7HA 3H5AA 4N9HA 4CCKA 2Z5UA 1A5JA 2WB1A 2X1DA 3RKQA 3LSMA 5F0HA 4XICA 3DPTA 4M72A 1YYVA 4LIUA 1R4NB 3GTQJ 2HI3A 2PBIA 1BI3A 2V6CA 4AIHA 1T08B 1A36A 3OYCA 2ISYA 5JHFA 1R6RA 3NWSA 2Z9OA 1SMYF 3H92A 5IP9J 3OYIA 2OF7A 1MNDA 3FMQA 3GUDA 2EV6A 4IHSA 3A4CA 2HQAA 1WGXA 1MJAA 2IJLA 1Z91A 3ZGKA 3CMYA 1XX5A 1T95A 3FKJA 4Y17A 3OYBA 1RR8C 2M0MA 2K7LA 2DLLA 2D1HA 3J7AY 1N77A 3DP7A 3HHGA 3KETA 3IH2A 1LDKB 3TKYA 5J1RA 3LSPA 1EH8A 3E1SA 3HIFA 4HRIA 4G6QA 2LR8A 1PDNC 1ZLJA 3F6OA 5HDGA 3A0BC 2HQRA 4HLXA 2ESNA 3I4PA 2EINH 3QPSA 4DJAA 1MSFC 4Y7NJ 1R1UA 5C4XJ 3G2BA 2IGKA 1I27A 3F8FA 4BJ5C 1K61A 2E1MC 1IO2A 1RRJA 4AIKA 2K3PA 1K7AA 1HSTA 2A61A 1VQ9I 1JJ6C 3P7NA 1FT9A 1A6IA 4HQMA 3MKWB 5JVGF 2GOMA 1DGWY 4HX4A 3S3NA 2V1DA 5DTDA 2BHYA 2XGEA 1VZ0A 4IRGA 4DYCA 4EGZA 4AVZA 1Z21A 2CQ7A 3H0DA 2IA1A 1LB2A 1G3SA 4EJWA 1TP4A 3TOAA 3CO6C 3BR1A 1OCZH 5L3DA 3D1NI 5HLGA 4OIOF 1GUUA 4EGYA 2QKLB 3Q0UA 1E3HA 2L9SA 2IEKA 3U1KA 1QBJA 4MO7A 5IY5H 4E7ZA 2X1EA 1FX7A 2Y0SA 2DA1A 3FXRA 1KZHA 1GT0C 5F0FA 2R7SA 2HOTA 3CC7I 1ZAOA 2DQRA 3BG5A 4A2UA 5D6EA 1M1EB 1OYIA 1D8JA 1WWXA 2YR2A 5K5OA 2GWRA 2HYFA 3F8MA 2EZLA 2LY9A 3ISPA 4IHVA 4M6XA 4A5MA 1MIJA 2IW5A 4IEJA 5F0CA 2IS6A 3PQKA 2ZSHB 2EQRA 2XC7A 3RPUD 2DBBA 3QOPA 1UHWA 4PK4A 3WTUC 3IV5A 5M5YJ 1YRNB 4P5OA 4XKBA 4P9FA 2EZHA 3PSIA 3W6JB 3WODF 2NOJB 4N4OB 5J1YA 4ZDLA 3KZZA 4BHPA 2HVSA 2HZDA 3FBIB 1IUFA 2KJBA 2O5RA 3W2VA 1JI8A 2PMHA 4FISA 2HEOA 3K2ZA 2RC4A 4QPOA 4RM3A 4BEHA 5M5XJ 4LB5A 1SMTA 2XB5A 2PI0A 1U5TA 1LJ9A 1YHQI 3EDPA 3L1PA 3G1MA 4XLPF 3LAPA 1Y1WJ 1TT0A 4I0BA 5EGOA 3CCRI 4LG3A 1Z67A 4KMFA 3KYCB 5EF6A 3I59A 3SHFA 1SFUA 3RQIA 3KP3A 4UXNA 4C3HJ 2MABA 2BW3B 3I0TA 4ZZLA 1YQAA 3L2UA 3WE3A 1TWGJ 3M1CA 5FKOA 4BQQA 3HSRA 3M1EA 5FKLA 3L2WA 3NEUA 2CV1A 2LDUA 4A3MJ 4CHUA 2LBFB 4P1WA 2W25A 3HOSA 3HZJA 2V9PA 2LFBA 3ERMA 4IOCF 2CH0A 4BY1J 1GVJA 1HDPA 1X3ZB 3J80Z 2RQPA 2YS9A 1UMQA 5HS8A 3K1NA 4BHCA 1ETOA 1SD6A 2BXYA 5IP7J 2RREA 1IXRC 2WAEA 3BR6A 2XKPA 2GM4A 2J5PA 4UUTA 3X2QH 5JFRA 3CP8A 1B4AA 2F5DA 1IG7A 2NS8A 3M8JA 3HXLA 2UXXA 2LLKA 4E7JA 2HPIA 4P55A 2XUBA 4BDYA 4XLHA 1MBFA 1X1AA 4Y3OA 3CDIA 2LY2A 2K02A 3O2PE 4FT8A 2IXSA 5FLVA 1MBEA 4CYCB 2HWVA 2WAQN 1IAWA 1FLIA 4C30A 2X6OA 3JSOA 1APLC 1G3WA 1JGGA 3SEZA 1U2WA 3E6CC 4Y52J 3S93A 1XN7A 1KQ0A 1ZG3A 1IXSB 3LFUA 2BXZA 5LFAA 3BLYA 4ZZDA 2E2JJ 2L7MP 2VOOA 2FF4A 3VPRA 4MEXF 5DV5A 1WH7A 3VFZA 1LFUP 2QLZA 2OCEA 4CA0A 4IHWA 1X1CA 3MD2A 2K4JA 4UVBA 2ZJRF 2HYGD 3ROUA 1W4MA 4PSXA 3Q3SA 5L3GA 2M8GX 4ITVA 2XROA 4RGSA 3KP2A 5HODA 4LG0B 2JA6J 3T5XA 2DN0A 4DGWB 2HFHA 3PO2J 1FP2A 4OIRF 2NVXJ 5F27A 3RI4A 5M5WJ 1YW7A 3P9CA 1B6AA 1MH3A 2R7ZJ 4A3LJ 3WGHA 5EEHA 2WY8Q 4XM3A 3TOBA 1X4PA 2DO7A 1FBQA 4P9UA 4L5JA 4D7MA 1CQTA 3CCLI 2XB0X 2O3FA 2DDAA 3V8KA 1RUNA 4G6DA 3PSFA 2Y75A 2R7VA 3IHUA 1K4SA 5EEGA 3J81K 5M3FJ 4CCMA 4OAYA 4CDGA 1BC8C 4ZC3A 4BS9A 2LD5A 3RZOJ 1FOYA 4FQGA 2ZC2A 3KE2A 3H3UA 1BI1A 3F9KA 2M9HA 2XF5A 2M4KA 1Y6IA 2FNPA 5J4VA 1SVOA 1W36C 1STZA 3ZOBA 4N9IA 2Z33A 3OL4A 3F8BA 4FASD 3C2HA 4NC8A 4WXCA 5EEAA 2ZJ2A 5GTHC 3R0AA 3CJTB 2FRHA 2EFNA 4AWXB 3FXQA 1Y0UA 5L3CA 4M9ZA 1D3YA 2RVCA 2OQRA 4B4CA 3GTGJ 3W2AA 5LRRA 3K69A 2HS5A 4LG0A 5DM6F 3OS0A 5KAIC 2QQBA 3DFGA 4OMZA 2HU9A 1UELB 4RB3C 2RN7A 1BC7C 2YPRA 3K9TA 3CCYA 4HYEA 3BDDA 3EETA 2NRAC 1WFXA 2RNJA 3HKZA 2M3AA 4R1HA 4G8XA 1R00A 4FE7A 2HOAA 2F48A 4RAFA 3E6DA 1S29A 4A6DA 1LVKA 5JHUA 1H8AC 3C3WA 3D5RC 1JKQC 3R6SA 3QAHA 4OWRB 2WWYA 3FXOA 1XB4A 3MKLA 4BQNA 1S5LC 4BH9A 2YUSA 4OAZA 2C6YA 2RGVA 1TC3C 1ETWA 2OCCH 2XDVA 1K6OA 1ITYA 5E79C 1B72B 2DA7A 3BTJA 3HOTA 3DEEA 3QRFF 3JCUC 2R7RA 3GXOA 5E8GA 3OYHA 4U87A 1F5TA 2P5KA 5EG0B 4UNOA 3GTPJ 3BG9A 1REPC 5IT9K 1HF0A 4XLFA 5KNLA 1ODDA 4BXFA 3WTXC 4IZZA 4MIMA 4HNTA 1I6XA 4G12A 4IRIA 3LA7A 4A3KJ 1PVEA 2F4OB 3R61A 2R7WA 2M7BA 5DDGA 2L01A 2G9WA 4KA4A 2JRMA 1K4TA 1JHFA 2YX4A 2DU9A 1PJRA 1F43A 2VJ5A 4B48A 1GXQA 1E17A 2V79A 3S2DJ 2X4HA 3GLXA 5E3MA 5JR3A 3ZR8X 4XR6A 2HQ5A 3EUAA 3TDUC 1BM9A 2B0LA 2GXGA 4KT6A 4B43A 2QBYA 3W6VA 2HR3A 3BG3A 1YTYA 1FY7A 2EFPA 5AONA 4DYQA 3KCCA 4XIDA 2WB1N 2IS2A 3DLAA 2DQLA 3DEUA 1OQYA 4YELA 1R22A 1RESA 2V7FA 2AXLA 2CW8A 1E3OC 4F91B 4E4HA 4S0HB 2BY1A 1O57A 2M7AA 2H8WA 2HTSA 4EATA 2XPUA 2P5VA 2JN6A 3E97A 4HV5A 4PDKA 3PNYA 1QNTA 4G9YA 4RB0A 1J9IA 4PJMA 4D5CA 4DBRA 3OSGA 4A5NA 1H9TA 4BACA 2HPMA 2R5YB 2HDCA 3GZ5A 4XSZF 3J7AO 1V5EA 2H6BA 1WZ2A 2K4BA 2XAFA 2GOXB 2EIKH 4HSRA 3H3VK 4I09A 3GWZA 3JRGA 4HDVA 2KRHA 3DKXA 4RGRA 5FKNA 4Z2YA 4W1UA 2V6EA 2B7EA 2AHQA 3CLQA 3QU6A 3RKWA 4WXHA 3ZMTA 5BMZA 2CV0A 2WAQA 4GGGA 1BIBA 4U7DA 3TO9A 2XAQA 3KP6A 2P6SA 1V4RA 1BJZA 3DPLC 3JRFA 2JVHA 3H9GA 1W5SA 2VONA 3BG7A 3CJQB 4BE1A 4L9TA 2Z1DA 2E1NA 2BY2A 4B1RA 4A3GJ 2QSFX 4ZDOA 3MEXA 5FO5A 1EH7A 1S8NA 3IH3A 1AKHB 1F9NA 3M8FA 5H20A 3WG9A 3ZMVA 1SFOJ 2UXNA 4FE4A 1YIJI 1W7PA 2FU4A 2CFOA 5CQEA 4BU2A 2M45A 5EDNA 4X6AJ 3BR5A 4AVPA 3TBIA 2P8TA 1MH4A 3ZQHA 2Z99A 4LB6B 1TWFJ 1HCRA 3C1DA 4M9SA 4L9VA 2L0KA 3L7WA 4MFEA 2DFFA 2Y0SN 3Q9SA 5HVQC 3ZMUA 3LMMA 4II3A 1IGNA 1IN8A 2Q2EA 3E5QA 2PMUA 1T39A 1ZGAA 2XSJC 1MGTA 2KLOA 3CF5F 3CQZJ 3A01A 2RV8A 2XKOA 3HG9A 2QWWA 2GZWA 2ZFWA 4XLNF 3REOA 4JX4A 3SQNA 3U1DA 2DK5A 4UB6C 1VQ7I 3UNGC 2JA7J 1J7KA 2GA1A 3BCAA 2DXIA 3GX4X 3HSFA 4I02A 1LEAA 4EQQA 3T8RA 1P2FA 1KYWA 3O3KA 3W2WA 1UHMA 3WTWC 2GXBA 3HOVJ 2Y48A 3LNQA 1Z1DA 3EPZA 4L5EA 4L0ZB 1LFPA 1XGMA 1BBYA 1MW7A 3FK7A 2MFZA 3AL0C 2PQ8A 2K3FA 1LE8B 2R7XA 4IL6C 3IUOA 2K85A 3ASNH 1MMSA 3VYRB 2MA3A 1A04A 4CICA 5K7ZA 2OZUA 3QPLA 2VIXA 2BOLA 1SANA 4IJAA 4PJLA 3TQNA 3KP5A 2E35A 4EM2A 3N97A 2IP2A 3BOQA 1RI7A 2EIJH 4JX6A 3BR2A 1ETVA 1O7FA 1YS6A 3E5UA 5E20A 2WC2A 3S1QJ 4LFUA 4C3IJ 2FBKA 1TQPA 3TL4X 4GXOA 2XGDA 2OA4A 2D1VA 3I3LA 2EFWA 3RSNA 5J1UA 4WWCA 3MKZA 2YU3A 2EFQA 2HYJA 1NK2P 1FTTA 3ECOA 4UVAA 2O61A 3IWFA 3K4MA 4ZYHA 1XPXA 3KZYA 3WU1B 4RBOA 3WTSC 1HW2A 5ICEA 4U0YA 1ON1A 1X58A 4WXDA 4QTRA 1AA7A 1BR4A 5K5RA 3OV8A 5TISC 2XF7A 4S04A 2A6HF 2RQQA 4O6JA 2UWMA 2IVMA 3T0YA 3GTOJ 1SFXA 4HA8A 2CUFA 1AHDP 1ORKA 2GA2A 1FIPA 1Z6RA 4KNYA 4HF0A 2VC0A 2XSDC 4ZTFA 2J5OA 3CMEI 2VUMJ 5ICGA 3FDYA 1ZN2A 2CUJA 2KRCA 2VJIA 3FHNA 2QQ8A 2FMYA 2LF8A 5J6XA 2LF7A 2FNAA 3BPXA 3FMRA 2F2EA 1XTAA 3HJEA 1R5HA 2VI6A 4M73A 2V26A 3DWLE 2X6YA 4LIVA 2LYCA 1RKTA 5BOXA 5ILVA 4RDUA 3CCUI 3BT9A 2DA3A 2NVTJ 1DPUA 4V19K 2COMA 2EH3A 3RQ4A 1JGSA 1OFCX 2BYVE 2MGQA 3HPHA 3KIOA 2E1OA 4M3FA 1YITI 4A3JJ 4IHXA 1LUJB 2G7HA 4JP0A 4EJVA 4ZYDA 2M1BA 2ZO4A 1EF4A 3VSLA 4J00A 3DQVC 2KL4A 4DNCA 2X51A 4CSWA 1QA6A 3LSHA 4HQEA 3S3MA 4GYGA 3VODA 1YJNI 2D5VA 3S1MJ 1R71A 1WJ5A 2K40A 4ZJZA 3SDGA 3CMAI 1PP8F 1EV7A 1ZKGA 4QWQA 3S17J 1SD7A 3OIQA 2GXAA 1WVRA 3JRHA 1S72I 4BQAA 2P0WA 4LK0F 2JRTA 1JKOC 2GLOA 4XBFA 1RR7A 5ICCA 1R23A 3ABMH 2XAJA 2EFOA 2NAZA 5E1WA 5D5XB 1D1BA 3GEZA 1BR2A 2OQGA 4PZJA 3RKXA 1F36A 4D7NA 3OYMA 1ON2A 3G71I 2R7OA 4BL0B 3WG7H 2M87A 2VKVA 3F21A 2FUG2 1TQMA 1TWAJ 1AOYA 5DCMA 4NHJA 3LSRA 4ESJA 1WPKA 5KHDA 2BEOA 2OUMA 1TTYA 3K6GA 3CLOA 5CKTA 4E7HA 3CUQA 2MSYA 5FLXZ 3B6CA 2CMPA 2KIMA 2CSOA 3K4LA 4K2EA 3ZN0A 2H8RA 4XLEA 5TGTA 1O7LA 4BJ6C 1VQKI 3GBGA 2VE8A 2K27A 2IPQX 1AWCA 1B8IA 3P9IA 3S14J 1HSJA 1D8KA 2BGCA 4D9JA 3LSIA 4C3JJ 1ONVA 5J8CA 3ZP5A 2L54A 2IA2A 2CFXA 4L9NA 3F22A 3MFKA 3HL2A 3HHHA 1LVAA 4BY7J 1OR7C 4YFNF 2IS4A 2V4JC 2KPMA 1EA3A 4BEHB 3HGYA 1O3RA 3BC8A 4XN0A 1U5TB 4DW6A 2CYYA 3OYFA 4B47A 3HKZN 2CV2A 4Q47A 2OD5A 4EVIA 1YOVB 1SAXA 5DD4A 1MNEA 2KIUA 3GLLA 3HRMA 4PFPA 2PX9A 4ZH4F 1U9OA 5EGOB 3HDDA 3ZQIA 3LSGA 3CCQI 2E1CA 2XGCA 4BHBA 2X48A 3BR0A 3H9QA 3IL2A 2BHZA 2R92J 3I59B 4A3IJ 3WTVC 3ZMZA 4BUPA 2GAUA 4AU7A 3GFLA 5KK1A 2L4AA 3RPQA 3CJNA 4Q48A 4YIIA 5DEQA 4KN4X 4XRFA 4ENJA 4FCYA 2X9DA 2HVQA 1T0FA 2VT3A 3PIPF 3OYJA 1JE8A 2FMLA 4II2A 3RTRA 1VFCA 1SD5A 4HX8A 5ILUA 1DQUA 3I54A 2ISZA 1V55H 3PNVA 3FXLA 1MDMA 4AUXA 2NOGA 3K4NA 2CGPA 1DU6A 1RKWA 2DA6A 1BIAA 1OCRH 3E6BA 4YRVA 1Z9CA 5EZGA 1KONA 4GFBA 5C44J 3CMMA 1Z7LA 4L9JA 3CESA 2A68F 2YSRA 3ABTA 4A0YA 1YO5C 2A69F 4ZYEA 3L00A 1Z6TA 2P4WA 1MBGA 3LSTA 3BR3A 5CVIA 2XF6A 4KMUX 1IXCA 3L2QA 3EYIA 1UZCA 3K4JA 2EZKA 4HAMA 3F0CA 1X1BA 1TQIA 4F3QA 3MZHA 4CO8A 5K5QA 3HPGA 2DFEA 2LOOA 3HB9A 3R60A 4UV9A 3GVAA 2LH9A 4MQVA 4G7OF 3LQRA 3TDZC 2F4IA 1I1GA 5DD8A 4LLNA 3FXJA 4XLAA 1Z7UA 1UB9A 1FMVA 2R7QA 4CCNA 1S3JA 3DKYA 4N4NB 3PFYA 2PLYA 2EBIA 3L2CA 4A12A 4MFDA 2BV6A 2PMZN 4MTEA 2LKSA 5TJJA 4BYYA 3OS2A 2WBMA 1Q1VA 1YJWI 5BPDA 4U0WA 2R93J 4L0YB 4YEJA 2Y31A 4MGRA 2VBWA 5LGUA 2Z2SB 2VXDA 1NH3A 2JWTA 3ZQQA 1X1DA 1QHHD 2ELKA 2MW8A 3L2RA 3BQZA 2NXNB 2TRTA 3KEYA 4JK1X 4JX5A 4BBSJ 3K70C 2OJED 2HDDA 1KU7A 1E2XA 1ZYRF 1TLHB 4DZJA 1FWZA 2Q0OA 2VKEA 2L4MA 5HOOA 4F7ZA 5D5VB 1CF7A 2FE3A 3UR3C 4Y13A 2BVLA 2ECBA 2LSOA 3OIPA 3CDHA 4A3CJ 2W00A 3BZCA 5E3OA 2OBPA 1K83J 1V5GA 2HXOA 2K9NA 3I5UA 3DTEA 2IS1A 3BPVA 1MMNA 3OWTA 3BP8A 1JTYA 2XVCA 1YX5A 1Z3YA 4RAZA 1ZGJA 1IF1A 1TW2A 5A2QK 2XASA 3O8HA 2TCTA 2XRLA 2ZMEC 2DMNA 4C2MJ 2NS7A 4BGDA 2Y9YA 5J40A 2A5WA 1LQ1A 6PAXA 2L9RA 3PFIA 3WTYC 1DP7P 1G6NA 3VWBA 1QVUA 3G4SI 3SJMA 2Y69H 2Y9ZA 3AAFA 2VBZA 2CRGA 5JLXA 3ZPLA 4IHTA 5GAGJ 1Y8QB 2HTJA 4M6VA 3OYLA 2DMPA 3ZCOA 1Z0XA 1K6YA 3HYIA 1SFKA 2K86A 1L3LA 4PJ0C 5HDNA 3T1BA 1A31A 1G3TA 3ZQ7A 1WJFA 2O8KA 1HOMA 3HUGA 2ZNZA 3HEFA 1WI3A 3O8GA 1S6LA 2KZVA 5TRDA 1FSEA 1N75A 3FKIJ 2IT0A 3BWGA 3PL8A 1GHCA 1A6QA 4I0AA 1J0RA 2CQQA 3SYTA 5EJCA 3JRCA 4XRMA 4XLCA 2X1CA 4XMYA 2QM3A 2P6TA 1R7JA 1PUFA 2OC6A 4MEYF 3G73A 3ZQCA 1MMAA 1W7PD 2PJRA 3OS1A 2RKHA 3LQQA 4PGGA 3HOXJ 1R5ID 2IRFG 2G0EA 2CJJA 4YFKF 3GCMA 4CYDA 2VL8A 1F1ZA 2FEZA 1BW6A 1W5CC 4R79A 1RPWA 1WJEA 1TBXA 2QVOA 2XGXA 3SFZA 3M4OJ 4IQJA 3MQ0A 3RZDJ 2PEXA 4IQ4A 1XMXA 2BBYA 4C9YA 3QPHA 1NG7A 4ESFA 1ZRCA 3BG6A 3ML6A 3GF2A 1RNLA 3Q9VA 1QVTA 3AG1H 1D0XA 5B5EC 4A0XA 3GTJJ 2L9NA 2QBYB 2VC1A 4AYBA 4V2GA 1XDUA 3S1RJ 4XL9A 2JUGA 1S7OA 4HV6A 1FYKA 5LEJA 1OISA 3LA2A 2K5CA 1R1VA 4J19A 3HC7A 3WHBA 2CW0F 1QZEA 2B9SA 1FOXA 4WX9A 3OIOA 3ZMDA 3JTGA 1O3SA 2ZXJA 1USSA 3ERED 4O3MA 3DPUA 3ECHA 1V5FA 2AS5F 2EB7A 2ZKZA 4AIJA 3MAJA 1XC5A 2E1MB 1HW1A 1FPQA 4HPQA 5D6FA 5DCFA 3D5LA 3RKYA 2QYOA 5GAEJ 3LSJA 5E17F 2DPUA 2DPDA 1KA8A 3HGGA 5B1AH 2JUCA 3B02A 3ELKA 3F72A 4CZZA 2F5FA 4B8XA 4AIDA 4I01A 3GZ6A 4XONA 1OCTC 2JSCA 2EIMH 1LEBA 2VXZA 5LGTA 4XNFA 4EM0B 4C2UA 4HF2A 4Y33A 1XSXA 3JW4A 4XKWA 3TGNA 4DIQA 3KLNA 1GVDA 1B59A 1I5ZA 1JTXA 2CO5A 5GAHJ 3FXMA 2E5NA 5CJ9A 5IOYA 1RC9A 1HQCA 1XS9A 1IZ1A 1RUOA 3A2KA 2DA5A 3LFKA 1USTA 2CS3A 3EUKL 1ZQ3P 1T56A 1BL0A 3FX3A 2OV7A 2MLKA 1HKQA 2COBA 4Z6YA 1KU9A 2O03A 5B66C 1ZELA 1IRZA 1ETQA 4JYKA 3KP4A 5FFZA 2FBIA 2F5VA 3JAMK 1D5VA 1B9MA 1JXSA 2PMZA 1IRXA 2BY0A 1W7PB 5JVTA 3VYSB 3DLLF 1FEXA 5FD5A 4E7LA 1SEUA 1Z3XA 4KICA 3KFWX 1JT0A 2ZCWA 4ZYAA 3PUFA 3LAJA 3BTCA 3FMSA 4CCJA 2W84A 1LDDA 3OSFA 3JRDA 2EA2A 5BQTA 1KU3A 1TZLA 4B3XA 4G7ZF 3VB2A 3AG3H 2B63J 1QO0D 2Q2EB 2OPTA 1TWCJ 2PN6A 1PP7U 4HG2A 2ZXHA 3MZ8A 4J01A 4BDZA 1ZLKA 3A01B 1MKMA 1ENHA 1Y1VJ 1JT6A 2W85A 4M3GA 4LGWA 2FOWA 3RYPA 3CF2A 2DW4A 3F8NA 3H1CA 1XG1A 3SDBA 4A3FJ 1OR7A 3GTKJ 2DJIA 4M3EA 5ERIA 2K9QA 1R49A 4KN7X 2LTPA 5IT3A 4KYWA 2DMQA 2LKXA 3I4NJ 1FC3A 3DV8A 3F8CA 4BJTA 1TW3A 2A05A 3OY9A 3C2BA 2F5EA 2R7DA 5DS9A 2JMWA 3Q0WA 3ZQFA 2NNNA 3U2RA 1IV8A 2XPVA 5FD6A 2MYSA 3MWMA 2VODA 1W36D 3J7YJ 2DYRH 2FSWA 5AIPA 5DM7F 2JSPA 5JI6A 1BI0A 2HVRA 1IRFA 2VKDA 2PFBA 1IDZA 1TL8A 2L02A 4HEA2 2NNYA 5CPRB 3I55I 3VYUB 1ETXA 4B3AA 4CH7A 3N4MA 1HW5A 2KDOA 2M34A 3V7SA 1YW8A 3CDLA 3FISA 2IAIA 3BJAA 5H2FC 2KDZA 2HXIA 5HS7A 3HOWJ 1UHSA 2R7UA 1XSVA 1ZREA 2QQ9A 4XOTA 1YJ9I 5FB2A 3M9AA 3TMOA 2L3DA 4IKFA 5AIQA 4WK8F 3IRQA 1KQ9A 1WCMJ 1N78A 3J80K 1I39A 3IWZA 3R4KA 2WTEA 3UKGA 5BNGA 2W57A 1R5GA 9ANTA 3LSKA 1GDTA 3HOYJ 2GQQA 4U88A 2JA2A 2GBYA 5KCMA 1CGPA 4I76A 1U78A 2ZB9A 2XAGA 2ACJA 4GO1A 2EWNA 5LBQA 3VEPA 2A6EF 2ZJQF 3FBNB 4JQFA 3RIRA 1E0EA 5L3BA 2Y30A 3IC7A 3CC2I 1U6GA 3PO3J 2FBHA 4PCQA 1U8RA 3LWFA 2W4SA 3V7CA 2JQ7A 2DTRA 5D4RA 1XGSA 1G2HA 1T6SA 2H09A 1XD7A 3NRVA 1ULYA 1HKTA 2DT5A 4ON0A 2QA4I 1D5YA 5IYDJ 2H1LA 2VT2A 5F1JA 2VN2A 1ZG5A 2NVUB 4FX0A 4KJZA 2UV1A 4G7HF 1SAUA 3FF5A 2VBXA 3B6AA 2ME0A 3WHCA 4L18B 3DEWA 3BY6A 1JKRC 2OU2A 3G3ZA 4Q5SF 3IP4B 4P96A 5FRMA 2O9LA 3BZ6A 4W97A 1OCCH 4UV8A 4DOZA 3OL3A 4ENMA 5J47A 2IBDA 1S9HA 4UUSA 1FOWA 1P4XA 1KQ8A 4FTHA 3RCOA 3RYRA 1K78A 3MMYB 2BE5F 3PUBA 3QOEA 3J81Z 5FKKA 4LOCA 4AC0A 1EJ9A 2DFIA 1ACIA 1Z77A 3QP6A 4EJUA 1BOAA 3K7AJ 2IGNA 2NS0A 1VQ4I 2HQNA 3F3XA 3I9V2 5GPAA 4OINF 1KGSA 1FIAA 4B09A 1ERDA 3WU0A 3LOCA 1OCPA 1QRYA 1H0MA 4UY8I 2Q1ZB 1TNSA 5FLMJ 2ZMEA 2W7NA 5GPCA 1TT5B 5DCMB 2DCEA 2E36A 2KJCA 4E70A 4LK1F 4MTDA 2DMTA 2CQXA 3JRBA 4RM2A 1VQ6I 3CUQB 3E5XA 3E6MA 1XSDA 4NDLA 2ICWG 3EQLF 3OYDA 4PFOA 3TP0A 2KRFA 4FHTA 1BN5A 2L2OA 1GV5A 2WV0A 4V2FA 1B8IB 4CZCA 2LK2A 2XHKA 1J09A 2ADUA 4EM1A 1S7EA 2LC2A 2CG4A 3QPTA 4D1QA 5CVRA 2JVGA 3OYGA 1T2KA 2VJJA 1T33A 5IOZA 4KDPA 4BQOA 1IN4A 1IN6A 2F5CA 4NC6A 4XK4A 4Y4RA 2KIFA 3F6VA 3H5RA 1SD4A 1HA8A 1UCRA 2CU7A 2Y0MA 3GFJA 2QEXI 1JKPC 5FGMA 3RJPA 2NVYJ 3WGGA 4A93J 1EH6A 3OYAA 5F04A 2HOEA 2ZSIB 5D4SA 2VLAA 5GADJ 4E7KA 3MN2A 2KIQA 4F52A 2MG4A 2O8XA 2VASA 2W48A 3ABLH 2R5ZA 4ZTJA 1U9NA 1X3UA 2KKOA 3BJOA 4NC7A 1ZGWA 3QODA 1VTNC 3KZIC 2MLGA 4NQWA 3D0SA 3E3VA 1ETYA 5DYMA 2CQNA 1POGA 2A6TA 3QYEA 2WV1A 1S7AA 2W24A 2E7WA 1WHUA 3BCBA 3ZN1A 5D5WB 4H0EA 5IT9Z 3BROA 3C7JA 4KIGA 2R0QC 3CCMI 1UAAA 1VQLI 5LEKA 1NHAA 1IW7F 2MH9A 3A0HC 3OOUA 1BJAA 1WI9A 2M4GA 1IUYA 3GW2A 3ZRGA 1OCOH 1OYWA 3H0GJ 2LKPA 1MDMB 2FOKA 5IP6A 2E71A 3K4CA 4BE2A 4IPAA 3PIOF 3GMEA 4ENKA 1X19A 2CUZA 4NBQA 1Y39A 3B73A 4A69C 2JPCA 5CLSA 1BA5A 1KU2A 1XGOA 2MC4A 2Y2ZA 3S3OA 3H5NA 5ICFA 3OYNA 1V3FA 1IV6A 5CYVA 2VQCA 1QQIA 4WCGA 3V8JA 4BE0A 3S2WA 1JUMA 4D5FA 1J2XA 1VQOI 3FIWA 5IYBJ 5LGNA 2M5WA 4LITA 2D2WA 2EK5A 3CCEI 2HKXA 4LJZF 1IN5A 5C4JJ 4B44A 3JAMZ 4AYBN 3EUHC 4CCOA 2QF7A 5EYRA 1GV2A 1MBJA 3KEOA 2O0YA 3N05A 1YE9A 4OOIA 3HBLA 2LY1A 4A6EA 3BZKA 3Q5FA 2AXTC 5B3SH 4EEFG 4RB2C 1SVLA 2G7UA 3M07A 5CVJA 2VQGA 3TW6A 5M3MJ 2VKHA 4BXXJ 3I71A 2Z3YA 3KEQA 1IN7A 1J59A 1FP1D 3WU2C 2W82A 3I56I 1MD0A 1ZH5A 3BTLA 4S05A 4HBLA 1W5TA 2R3SA 5HLHA 5L3FA 1VQ5I 3S1NJ 2DTZA 3SEQA 2V9VA 1OYYA 2QENA 3IAS2 4RLQA 4CXFA 4L5IA 4M3DA 2L7FP 4DBQA 1ZHFA 2FXAA 5F08A 2X6WA 2HKOA 1TNTA 2LP0A 4CCLA 2QCOA 4DQ2A 5GTIC 1G3YA 1CF7B 1VI0A 4ANJA 4CUGA 4HNVA 4F93B 1BW5A 1RETA 1GLNA 2WAFA 3A1YA 5DUKA 2W1OA 1R9TJ 1U3EM 3DTIA 4OIPF 1YW9A 1LPQA 1NTCA 3H35A 5CVVA 2ELJA 1U8BA 1ZR2A 1D0ZA
chains in the Genus database with same CATH topology
1MMDA 2KQRA 3AKZA 4XKCA 1D0XA 3H5AA 4PJNA 3TBIA 4CCKA 2WB1A 2X1DA 3LSMA 3DPTA 2L9NA 4LIUA 4AYBA 4XL9A 5HVQC 2JUGA 3LMMA 4II3A 3OYCA 1UG0A 5JHFA 2XSJC 2K5CA 2KLOA 1R6RA 3NWSA 3U21A 3OYIA 3HC7A 1MNDA 3PNTA 3HG9A 3A4CA 2HQAA 3ZGKA 3FKJA 1T95A 3K10A 3S8PA 3OYBA 3UNGC 2M0MA 3DPUA 3BCAA 3AL0B 1YX3A 1V5FA 2DXIA 3J7AY 1N77A 2CW7A 4G6TB 1LDKB 4HPQA 2E1MB 4HNUA 3D5LA 1QHGA 3E1SA 4HRIA 3W2WA 3HUGB 3EPZA 1LFPA 4XONA 2K9LA 1MW7A 4DJAA 2VXZA 4XNFA 4MLOA 2MFZA 3AL0C 4C2UA 3S32A 3G2BA 4Y33A 2IGKA 4BJ5C 2R7XA 4JOMA 5CQGA 2E1MC 3IUOA 2IGMA 4XKWA 4DIQA 2ZFUA 2VB6A 3VYRB 2K3PA 3VSKA 2PJRB 2E5NA 3MKWB 4XQFA 2GOMA 2VIXA 1DGWY 3A2KA 2BOLA 3EUKL 2CS3A 3S3NA 4HSTA 3C2GA 1VZ0A 2BW3A 4NNJA 4PJLA 2OV7A 4F92B 4AVZA 1Z21A 1WJAA 2AQEA 3H0DA 3KX2A 1ZELA 2F5VA 4IX7A 4RMNA 2ZXIA 2LBFA 2PMZA 1IRXA 1BOBA 2QKLB 3TL4X 2L9SA 3NWTA 3VYSB 3H9JA 3ZXSA 3W3CA 4E7ZA 4E7LA 2X1EA 3I3LA 2Y0SA 1Z3XA 3RSNA 2WA0A 5HNFA 2V9KA 3MKZA 2R7SA 4ZYAA 3ONQA 3K4KA 4RLFA 2R7TA 3OYKA 4CCJA 4C2TA 3K4MA 1TZLA 4B3XA 2Q2EB 4HG2A 1AA7A 1BR4A 2ZXHA 4J01A 4BDZA 2XF7A 2RQQA 2UWMA 3K4BA 3LL7A 2IS6A 2ZSHB 1QU3A 3CF2A 2XC7A 3RPUD 4PK4A 3SDBA 4ZTFA 2DJIA 3FDYA 2CUJA 2KRCA 2VJIA 3FHNA 4P5OA 4XKBA 1PYVA 5FROA 3PSIA 2QKMB 1WJDA 2NOJB 4N4OB 4ZDLA 2HVSA 2HZDA 2X85A 4PSWA 4BJTA 2V26A 3FBIB 2X6YA 3DWLE 4LIVA 3OY9A 2LYCA 2O5RA 3W2VA 1JI8A 4XORA 4QPOA 4RM3A 3RQ4A 4BEHA 3HPHA 4PJJA 3OR1C 5FRNA 2MYSA 1W36D 2JSPA 2HVRA 2VKDA 3VSLA 4J00A 1TT0A 3MKYB 3DQVC 4LG3A 2KL4A 2AQFA 4HEA2 2X51A 1D0YA 5CPRB 4CSWA 3LSHA 2Z16A 3VYUB 3S3MA 4CH7A 2KDOA 2MABA 2BW3B 3L2UA 1WJ5A 4QPQA 4ZJZA 3M1CA 2R7UA 4BQQA 3OIQA 3L2WA 2CV1A 4XOTA 4KITB 2P0WA 2LBFB 3TMOA 4P1WA 4IKFA 3HOSA 5HLTA 2CH0A 2LRDA 1N78A 1D1BA 1BR2A 1FMWA 2RREA 3OYMA 4ZDPA 2WAEA 2R7OA 4BL0B 3LSKA 3CP8A 2FUG2 3M8JA 3HXLA 2JA2A 5KCMA 3CP2A 5KHDA 4E7JA 2OUMA 2HPIA 3K6GA 5CKTA 4E7HA 4BDYA 4XLHA 1X1AA 4Y3OA 2CMPA 1MMGA 2K9MA 3K4LA 2LY2A 4XLEA 2IXSA 5TGTA 4BJ6C 3FBNB 4JQFA 3GBGA 4C30A 1DP3A 1E0EA 3K70D 4FETA 3OR2C 3SEZA 2W4SA 3S93A 4D9JA 2IS4A 3LFUA 3LSIA 5LFAA 3BLYA 1T0FC 3HL2A 1OR7C 4CA0A 2V4JC 1X1CA 2KPMA 3MD2A 1EA3A 4BEHB 4KJZA 2UV1A 2DOAA 2R4GA 3BC8A 1SAUA 4XN0A 4H4KC 3OYFA 4PSXA 4B47A 2KP6A 2CV2A 4ITVA 3E0JB 1MNEA 3IP4B 4PFPA 5FRMA 3LSGA 4DGWB 3H9QA 4DOZA 3OL3A 2DT7B 1S9HA 4BUPA 4AU7A 4XN3A 1Y56A 2WY8Q 3QYFA 4XM3A 1X4PA 3RCOA 2E60A 2HVQA 3MMYB 3OYEA 3QOEA 3PUBA 3OYJA 3PSFA 1D1AA 4GRIA 2R7VA 3RTRA 4II2A 2WADA 1BR1A 1WJCA 2KMUA 4CCMA 4OAYA 2IGNA 3I9V2 1DQUA 4ZC3A 4BS9A 2HDWA 3PNVA 1ERDA 3DU6A 3F9KA 3K4NA 2XF5A 2M4KA 1Y6IA 2Q1ZB 1G59A 1W36C 4YRVA 3OL4A 2W7NA 4FASD 1KONA 3C2HA 3CMMA 4NC8A 1Z7LA 2L7KA 2DCEA 3CESA 4X0GA 4RM2A 2E5ZA 4NUBA 2XF6A 3L2QA 3OYDA 3K4JA 4PFOA 1X1BA 3W2AA 4F3QA 2L2OA 2VQHA 4CZCA 3OS0A 3HPGA 2LOOA 3D5SC 1J09A 1UELB 2HU9A 2LH9A 2LC2A 2MD0A 4D1QA 3OYGA 2JVGA 1WJBA 2VJJA 4BQOA 2F4IA 4BU2A 2LREA 1OLTA 4XLAA 4Y4RA 1WFXA 3HKZA 2DT6A 3H5RA 5LD2C 1HA8A 1FMVA 2R7QA 2M3AA 4CCNA 3DKYA 4N4NB 3SZGA 3PFYA 3QYBA 3OMYA 3CZ6A 1LVKA 3OYAA 2ZSIB 2KHMA 2F6CA 3D5RC 2VLAA 4E7KA 4OWRB 2WBMA 3OS2A 4BQNA 4F52A 4OAZA 4YEJA 2VASA 4F55A 4E6KG 1G8XA 4ZTJA 2I8DA 2XDVA 3VYTB 2VQLA 2Z2SB 4NC7A 2VXDA 3QODA 3ZQQA 1X1DA 1QHHD 3HOTA 3DEEA 3L2RA 3KEYA 4KISA 2R7RA 2A6TA 3QYEA 3K70C 3BCBA 3OYHA 4U87A 3PJRA 1LKXA 1UAAA 4XLFA 5HOOA 5KNLA 4BXFA 3OOUA 3UR3C 2M4GA 4IZZA 2BVLA 3DU5A 3OIPA 4HNTA 2W00A 3ZRGA 4E7IA 3AFHA 3V42A 3K4CA 2R7WA 1U0JA 2M7BA 4BE2A 1V5GA 5CQEA 1X19A 1PJRA 3DTEA 2VJ5A 2CUZA 2IS1A 4B48A 1MMNA 3OWTA 3IAM2 1YX5A 1Z3YA 3ZR8X 4XR6A 2MC4A 3EUAA 3S3OA 3H5NA 4KT6A 1NG6A 3OYNA 4B43A 2VQCA 4BE0A 3DTKA 2UUZA 4LITA 4XOPA 2IS2A 3KYLA 3DLAA 2L5QA 4BGDA 4YELA 2A5WA 4B44A 2V7FA 3EUHC 2CW8A 4F91B 4CCOA 4E4HA 1DGRM 3VWBA 2M7AA 4EATA 4PUSA 4U7BA 2IGOA 3N05A 2BVMA 1YE9A 3PNYA 2LY1A 1D1CA 4PJMA 4DBRA 2XAUA 3OYLA 4BACA 3ZCOA 1K6YA 2VQGA 1SFKA 2HNHA 2WY7Q 2HPMA 2VKHA 1WJFA 1V5EA 2GOXB 2W82A 4HSRA 2KZVA 1N75A 2KRHA 3PL8A 3DKXA 2V1NA 3SEQA 3SYTA 2V6EA 4NQWB 4XLCA 2X1CA 2CV0A 2X6XA 4XMYA 3IAS2 4RLQA 2WAQA 2OC6A 4DBQA 1MMAA 2PJRA 2X6WA 4CCLA 3OS1A 2VPLA 5HNHA 4E7SA 3DPLC 2JVHA 3H9GA 3BG7A 3CJQB 4BE1A 4ANJA 4CUGA 2Z1DA 4F93B 1GLNA 2WAFA 2VL8A 4ZDOA 3A1YA 2W1OA 4XKVA 3DTIA 4R79A 1WJEA 1X4OA 3VDXA 3L2VA 4IQJA 2LG4A 3H35A 4IQ4A 4C9YA 3CJRB 1NG7A 2VJ4A 2RNGA 2ELJA 2CFOA 1D0ZA 1P9QC 3BG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XF6 A;  2XF7 A;  2XF5 A; 
#chains in the Genus database with same CATH topology
 1IJW C;  1MMD A;  2JTV A;  3FM5 A;  3AKZ A;  4XKC A;  1FBU A;  1YS7 A;  4PJN A;  1JHH A;  1YG2 A;  3CTA A;  4FX4 A;  1F4K A;  2GIV A;  1YIO A;  3V8L A;  4IHY A;  2M0C A;  2HZT A;  2LNB A;  2DAO A;  1RZ4 A;  1UG0 A;  2PG4 A;  3QU3 A;  2DOE A;  4IO9 F;  4EV0 A;  3U21 A;  5ILS A;  3ULQ B;  3PNT A;  1VF9 A;  2JZY A;  5BS6 A;  2CUE A;  4LD5 A;  3HRT A;  1HKS A;  4RS8 A;  3K10 A;  3S8P A;  3AL0 B;  3ABK H;  1YX3 A;  1QPI A;  3ZQG A;  2CW7 A;  4G6T B;  1YRN A;  4KUM A;  4HNU A;  1R36 A;  1VQM I;  1QHG A;  2QSG X;  2H94 A;  1YI2 I;  3SZT A;  1HBX G;  1LNW A;  5CVU A;  1I3Q J;  4I99 C;  2STT A;  3L09 A;  3HUG B;  3NAU A;  2BZT A;  3HTU A;  5FKM A;  2K9L A;  4MLO A;  3IH4 A;  1QPM A;  1HDD C;  3S32 A;  3DBL B;  4XRS A;  4JOM A;  5CQG A;  2IGM A;  3CCS I;  4M9X A;  2ZFU A;  2YX7 A;  5HDK A;  1PUF B;  2XIG A;  1HLV A;  2VB6 A;  4I98 B;  4I6Z A;  3FXU A;  3VSK A;  4BXU A;  2UZK A;  2H1K A;  2PJR B;  3CC4 I;  3ESW B;  1I1S A;  4IVN A;  3GTL J;  4M3B A;  4XQF A;  3TED A;  1FYL A;  1O3Q A;  2QSH X;  2P5L C;  5F6F A;  4HST A;  3C2G A;  4BAY A;  3BJ6 A;  2BW3 A;  1OKR A;  4NNJ A;  3GTM J;  1W1W E;  2PJP A;  4F92 B;  1ZRD A;  1K79 A;  4BNC A;  1WJA A;  2AQE A;  3MZY A;  1XCV A;  1JUS A;  1YLF A;  3KX2 A;  5FJ8 J;  1B9N A;  4IX7 A;  4RMN A;  1T8I A;  2ZXI A;  2LBF A;  1O3T A;  1BOB A;  2HOS A;  2FJ1 A;  5E3N A;  1WKM A;  3NWT A;  3H9J A;  3ZXS A;  3W3C A;  3H3Z A;  4D0P A;  1FSH A;  2ZXW H;  2H6C A;  3DBR B;  2CQK A;  2WA0 A;  5HNF A;  2V9K A;  1A35 A;  3ONQ A;  2FX0 A;  1KYZ A;  3K4K A;  4RLF A;  3FXK A;  2R7T A;  3OYK A;  3O6B B;  5F64 A;  4C2T A;  2ZJP F;  5C3E J;  3G1O A;  2KFD A;  3GYH X;  1P4A A;  4UB8 C;  1X2M A;  2DFH A;  3FK6 A;  5KVR A;  2VPR A;  2NYX A;  3F23 A;  2CWE A;  1C0W A;  5IYC J;  3CUO A;  3HRU A;  1ZAR A;  3K4B A;  1IDY A;  3JSP A;  3LL7 A;  2M2E A;  2ESH A;  2ZNY A;  3KLO A;  4GYI A;  1QU3 A;  4M71 A;  4KIB A;  3M3Y J;  4IOA F;  4CYC A;  3HOZ J;  5J4Y A;  1ZG1 A;  2JK3 A;  1PYV A;  5FRO A;  2VE9 A;  2ZBK A;  1FTZ A;  2QKM B;  1EKE A;  1WJD A;  1P7I A;  3GFI A;  2X85 A;  4PSW A;  5LHI A;  3EYY A;  2EJR A;  4GCV A;  2DI3 A;  4RGX A;  2DYS H;  1QZY A;  4XOR A;  2L7Z A;  3C18 A;  2L9V A;  4Y15 A;  4AD9 A;  4HW0 A;  3RPU A;  5KAF C;  1DUX C;  4PJJ A;  2JA5 J;  3OR1 C;  5FRN A;  5J3L A;  1IRG A;  2MC3 A;  3WE2 A;  3S2H J;  3G6E I;  3MKY B;  2ME6 A;  1OJL A;  5E1X A;  1H9G A;  2MH2 A;  2AQF A;  2K9S A;  3TO6 A;  1D0Y A;  3V4G A;  2Z16 A;  2FD5 A;  3OOP A;  1I50 J;  3QQA A;  4QPQ A;  3CUQ C;  4HF1 A;  4QSH A;  4JBA A;  3TP3 A;  3I53 A;  3S15 J;  1BI2 A;  5LLQ A;  4KIT B;  3Q0V A;  2I10 A;  2NVQ J;  5H6R A;  3T8T A;  4YIR X;  4OMY A;  2ID3 A;  2O7O A;  2P7C B;  2DJN A;  2X0L A;  5HLT A;  1JJ8 C;  1P6R A;  4I2O A;  4X1E A;  1VND A;  4ETS A;  3JRA A;  1XDS A;  2LRD A;  1I3A A;  3SXY A;  2I5U A;  4AM3 A;  1FMW A;  4UVC A;  4ZDP A;  1MBH A;  3ZQL A;  1MNM C;  1ZRF A;  2TDX A;  2YU9 J;  1OPC A;  1L0O C;  1MJB A;  3M8E A;  2LMD A;  3GZN B;  3AG4 H;  2DMU A;  4EJO A;  5LHG A;  3ZMS A;  3CP2 A;  2QQA A;  4ENN A;  5JLW A;  1MBK A;  1MMG A;  2K9M A;  1GXP A;  5L3E A;  5FLX K;  2JJ7 A;  1QGP A;  3TW7 A;  3FM3 A;  1Y8R B;  4KT5 C;  3HTS B;  1SC7 A;  3I4M J;  1H89 C;  1DP3 A;  3K70 D;  4IRH A;  3P9K A;  4FET A;  1B1B A;  3NQO A;  3OR2 C;  5B1B H;  2E19 A;  2FQ3 A;  5K1Y A;  1UJ8 A;  3ABU A;  3DF8 A;  1IC8 A;  3VOE A;  1W0T A;  3SZP A;  2IA0 A;  3KPH A;  4CGZ A;  4HOB A;  3KP7 A;  1P7J A;  1FJL A;  1T0F C;  2DOD A;  2QUF A;  3CCV I;  1SFE A;  4DZP A;  1QZZ A;  2OTJ I;  2OAZ A;  5EZH A;  4ASN A;  1JUP A;  3JRI A;  2XAH A;  4RGU A;  2DOA A;  2R4G A;  2BY3 A;  2VBY A;  4H4K C;  2KP6 A;  3GO5 A;  3HOU J;  3AG2 H;  3E0J B;  1LFB A;  4ESB A;  4IF4 A;  4UHT A;  5HLI A;  2RAE A;  4RAG A;  5FFX A;  4I7H A;  4YG2 F;  2DT7 B;  3JR9 A;  1J75 A;  3G1L A;  4UUV A;  4LLG F;  2DDB A;  1B72 A;  1MZB A;  4XN3 A;  4HDU A;  1Y56 A;  3QYF A;  2QGU A;  1U5T C;  3JTH A;  3K1M A;  3L9F A;  1H88 C;  2E60 A;  4MNU A;  3OYE A;  5EG0 A;  1D1A A;  4GRI A;  1TWH J;  4YFX F;  2WAD A;  1BR1 A;  1WJC A;  2KMU A;  3U9G A;  1XMA A;  1WQ2 A;  4MHG A;  3PQJ A;  5D8K B;  2HDW A;  1R4M B;  4LMY A;  1P92 A;  1XGN A;  2M8E A;  3DU6 A;  4G94 A;  2A5Y B;  1ZTR A;  2JPB A;  1AU7 A;  1G59 A;  2P81 A;  2LVS A;  1WSU A;  4N0B A;  2JA8 J;  3JRE A;  2P7V B;  2L7K A;  4X0G A;  4Q4Z F;  5D8L B;  1WRJ A;  3DXJ F;  4OU0 A;  5BPI A;  3EUH A;  5H6Q A;  5IPA A;  2E5Z A;  4NUB A;  3FWE A;  1PUE E;  1UG2 A;  3DKW A;  2GIZ A;  1E3P A;  2O6G E;  3WGI A;  5LHH A;  2VQH A;  4OIQ F;  2EV0 A;  1XCB A;  4KFC A;  3D5S C;  4LLL A;  2A3S A;  2MD0 A;  3IKV A;  3BQY A;  1WJB A;  2OZ6 A;  1VQ8 I;  3IKT A;  4QIW N;  2LRE A;  3A02 A;  1OLT A;  3MVP A;  1Y0N A;  1YFH A;  4A3B J;  2DT6 A;  5LD2 C;  2VOP A;  3SZG A;  4A3D J;  3K0L A;  3LA3 A;  4XRS G;  2H27 A;  2KZG A;  3BTI A;  3HM5 A;  2OTL I;  3QYB A;  1X1P A;  3OMY A;  3CZ6 A;  4BBR J;  1LDJ A;  2KHM A;  3FHZ A;  2F6C A;  2R5Y A;  5HS9 A;  1FBS A;  3HSE A;  1ETK A;  4A3E J;  1HC8 A;  1FZP B;  4F55 A;  1FYM A;  4E6K G;  4IXA A;  1G8X A;  2I8D A;  1MSE C;  4DYR A;  1O4X A;  3VYT B;  2VQL A;  4UUS B;  1SVM A;  3P5J A;  4M74 A;  2STW A;  1FOK A;  4KIS A;  3K1P A;  5ED4 A;  4BKX A;  5F1R A;  1K78 B;  3J7Z I;  2MBF A;  3PJR A;  2V1X A;  1LKX A;  5E18 F;  4R8H A;  3NAR A;  1VQP I;  2V1U A;  3DU5 A;  3GFM A;  3CD6 I;  3S16 J;  2FQ4 A;  4E7I A;  3PM1 A;  3AFH A;  1W0U A;  2DK8 A;  3V42 A;  4TV7 A;  5K7F A;  4ABZ A;  5D5U B;  1U0J A;  2EPF A;  2XRN A;  1AKH A;  4M6Y A;  3K2A A;  5DUI A;  2QZ8 A;  2ZME B;  2EA4 A;  3R0J A;  1N25 A;  4PGH A;  4RB1 A;  1VQN I;  2E2H J;  3IAM 2;  1V54 H;  1RIO H;  4HX7 A;  2XV4 S;  1NG6 A;  5A2Q Z;  3QP5 A;  2EIL H;  4MQ9 F;  3V7R A;  2E7X A;  3E7L A;  3CCJ I;  1DPR A;  3QWL A;  4HZF A;  3M7G A;  3DTK A;  1P4W A;  2ECC A;  4EMS A;  2UUZ A;  4XOP A;  2JT1 A;  1ZK8 A;  3COA C;  4A0Z A;  2EZI A;  3KYL A;  3WTT C;  2L5Q A;  1DU0 A;  4ZYG A;  4GDF A;  3IRR A;  1ZR4 A;  2KT0 A;  2Q8K A;  3CO7 C;  5J8F A;  2RDP A;  1NK3 P;  1DGR M;  4XSX F;  1OMI A;  5E1Z B;  4PUS A;  4U7B A;  2IGO A;  5GP9 A;  3DCF A;  2BVM A;  4QLC U;  5E3L A;  1R58 A;  2N8G A;  3MCZ A;  4EJT A;  1D1C A;  1WH5 A;  3H36 A;  1MJ9 A;  3ASO H;  3WTZ A;  3HRS A;  2XAU A;  4U0V A;  2HNH A;  2WY7 Q;  2E2I J;  1G4D A;  3FZV A;  5LRS A;  4KIF A;  2DOF A;  2ELH A;  2D45 A;  1HXD A;  2E34 A;  2XPW A;  1I6H J;  2R5Z B;  2F4M B;  1J5Y A;  4O5V A;  2V1N A;  4HLY A;  1LE8 A;  1X2N A;  4NB5 A;  4NQW B;  2DA4 A;  3I64 A;  2X6X A;  2AO9 A;  3W6K B;  1FNN A;  2ID6 A;  2DA2 A;  2EV5 A;  1T38 A;  2M30 A;  1DDN A;  2VPL A;  3SFI A;  4WF2 A;  5HNH A;  1Z05 A;  3KYD B;  3RDI A;  4E7S A;  3TO7 A;  3DBH B;  4YIF A;  3I58 A;  4RAY A;  1R1T A;  2R7F A;  4XKV A;  1XMK A;  2FA5 A;  1X4O A;  2ETH A;  3VDX A;  2KIS A;  3L2V A;  1X3W B;  4RA2 A;  1UFM A;  2LG4 A;  2MD5 A;  3CJR B;  2VJ4 A;  2RNG A;  5E8I A;  1P9Q C;  1Q1H A;  1T98 A;  2KQR A;  2HGC A;  2A07 F;  3A03 A;  5K7H A;  3H5A A;  4N9H A;  4CCK A;  2Z5U A;  1A5J A;  2WB1 A;  2X1D A;  3RKQ A;  3LSM A;  5F0H A;  4XIC A;  3DPT A;  4M72 A;  1YYV A;  4LIU A;  1R4N B;  3GTQ J;  2HI3 A;  2PBI A;  1BI3 A;  2V6C A;  4AIH A;  1T08 B;  1A36 A;  3OYC A;  2ISY A;  5JHF A;  1R6R A;  3NWS A;  2Z9O A;  1SMY F;  3H92 A;  5IP9 J;  3OYI A;  2OF7 A;  1MND A;  3FMQ A;  3GUD A;  2EV6 A;  4IHS A;  3A4C A;  2HQA A;  1WGX A;  1MJA A;  2IJL A;  1Z91 A;  3ZGK A;  3CMY A;  1XX5 A;  1T95 A;  3FKJ A;  4Y17 A;  3OYB A;  1RR8 C;  2M0M A;  2K7L A;  2DLL A;  2D1H A;  3J7A Y;  1N77 A;  3DP7 A;  3HHG A;  3KET A;  3IH2 A;  1LDK B;  3TKY A;  5J1R A;  3LSP A;  1EH8 A;  3E1S A;  3HIF A;  4HRI A;  4G6Q A;  2LR8 A;  1PDN C;  1ZLJ A;  3F6O A;  5HDG A;  3A0B C;  2HQR A;  4HLX A;  2ESN A;  3I4P A;  2EIN H;  3QPS A;  4DJA A;  1MSF C;  4Y7N J;  1R1U A;  5C4X J;  3G2B A;  2IGK A;  1I27 A;  3F8F A;  4BJ5 C;  1K61 A;  2E1M C;  1IO2 A;  1RRJ A;  4AIK A;  2K3P A;  1K7A A;  1HST A;  2A61 A;  1VQ9 I;  1JJ6 C;  3P7N A;  1FT9 A;  1A6I A;  4HQM A;  3MKW B;  5JVG F;  2GOM A;  1DGW Y;  4HX4 A;  3S3N A;  2V1D A;  5DTD A;  2BHY A;  2XGE A;  1VZ0 A;  4IRG A;  4DYC A;  4EGZ A;  4AVZ A;  1Z21 A;  2CQ7 A;  3H0D A;  2IA1 A;  1LB2 A;  1G3S A;  4EJW A;  1TP4 A;  3TOA A;  3CO6 C;  3BR1 A;  1OCZ H;  5L3D A;  3D1N I;  5HLG A;  4OIO F;  1GUU A;  4EGY A;  2QKL B;  3Q0U A;  1E3H A;  2L9S A;  2IEK A;  3U1K A;  1QBJ A;  4MO7 A;  5IY5 H;  4E7Z A;  2X1E A;  1FX7 A;  2Y0S A;  2DA1 A;  3FXR A;  1KZH A;  1GT0 C;  5F0F A;  2R7S A;  2HOT A;  3CC7 I;  1ZAO A;  2DQR A;  3BG5 A;  4A2U A;  5D6E A;  1M1E B;  1OYI A;  1D8J A;  1WWX A;  2YR2 A;  5K5O A;  2GWR A;  2HYF A;  3F8M A;  2EZL A;  2LY9 A;  3ISP A;  4IHV A;  4M6X A;  4A5M A;  1MIJ A;  2IW5 A;  4IEJ A;  5F0C A;  2IS6 A;  3PQK A;  2ZSH B;  2EQR A;  2XC7 A;  3RPU D;  2DBB A;  3QOP A;  1UHW A;  4PK4 A;  3WTU C;  3IV5 A;  5M5Y J;  1YRN B;  4P5O A;  4XKB A;  4P9F A;  2EZH A;  3PSI A;  3W6J B;  3WOD F;  2NOJ B;  4N4O B;  5J1Y A;  4ZDL A;  3KZZ A;  4BHP A;  2HVS A;  2HZD A;  3FBI B;  1IUF A;  2KJB A;  2O5R A;  3W2V A;  1JI8 A;  2PMH A;  4FIS A;  2HEO A;  3K2Z A;  2RC4 A;  4QPO A;  4RM3 A;  4BEH A;  5M5X J;  4LB5 A;  1SMT A;  2XB5 A;  2PI0 A;  1U5T A;  1LJ9 A;  1YHQ I;  3EDP A;  3L1P A;  3G1M A;  4XLP F;  3LAP A;  1Y1W J;  1TT0 A;  4I0B A;  5EGO A;  3CCR I;  4LG3 A;  1Z67 A;  4KMF A;  3KYC B;  5EF6 A;  3I59 A;  3SHF A;  1SFU A;  3RQI A;  3KP3 A;  4UXN A;  4C3H J;  2MAB A;  2BW3 B;  3I0T A;  4ZZL A;  1YQA A;  3L2U A;  3WE3 A;  1TWG J;  3M1C A;  5FKO A;  4BQQ A;  3HSR A;  3M1E A;  5FKL A;  3L2W A;  3NEU A;  2CV1 A;  2LDU A;  4A3M J;  4CHU A;  2LBF B;  4P1W A;  2W25 A;  3HOS A;  3HZJ A;  2V9P A;  2LFB A;  3ERM A;  4IOC F;  2CH0 A;  4BY1 J;  1GVJ A;  1HDP A;  1X3Z B;  3J80 Z;  2RQP A;  2YS9 A;  1UMQ A;  5HS8 A;  3K1N A;  4BHC A;  1ETO A;  1SD6 A;  2BXY A;  5IP7 J;  2RRE A;  1IXR C;  2WAE A;  3BR6 A;  2XKP A;  2GM4 A;  2J5P A;  4UUT A;  3X2Q H;  5JFR A;  3CP8 A;  1B4A A;  2F5D A;  1IG7 A;  2NS8 A;  3M8J A;  3HXL A;  2UXX A;  2LLK A;  4E7J A;  2HPI A;  4P55 A;  2XUB A;  4BDY A;  4XLH A;  1MBF A;  1X1A A;  4Y3O A;  3CDI A;  2LY2 A;  2K02 A;  3O2P E;  4FT8 A;  2IXS A;  5FLV A;  1MBE A;  4CYC B;  2HWV A;  2WAQ N;  1IAW A;  1FLI A;  4C30 A;  2X6O A;  3JSO A;  1APL C;  1G3W A;  1JGG A;  3SEZ A;  1U2W A;  3E6C C;  4Y52 J;  3S93 A;  1XN7 A;  1KQ0 A;  1ZG3 A;  1IXS B;  3LFU A;  2BXZ A;  5LFA A;  3BLY A;  4ZZD A;  2E2J J;  2L7M P;  2VOO A;  2FF4 A;  3VPR A;  4MEX F;  5DV5 A;  1WH7 A;  3VFZ A;  1LFU P;  2QLZ A;  2OCE A;  4CA0 A;  4IHW A;  1X1C A;  3MD2 A;  2K4J A;  4UVB A;  2ZJR F;  2HYG D;  3ROU A;  1W4M A;  4PSX A;  3Q3S A;  5L3G A;  2M8G X;  4ITV A;  2XRO A;  4RGS A;  3KP2 A;  5HOD A;  4LG0 B;  2JA6 J;  3T5X A;  2DN0 A;  4DGW B;  2HFH A;  3PO2 J;  1FP2 A;  4OIR F;  2NVX J;  5F27 A;  3RI4 A;  5M5W J;  1YW7 A;  3P9C A;  1B6A A;  1MH3 A;  2R7Z J;  4A3L J;  3WGH A;  5EEH A;  2WY8 Q;  4XM3 A;  3TOB A;  1X4P A;  2DO7 A;  1FBQ A;  4P9U A;  4L5J A;  4D7M A;  1CQT A;  3CCL I;  2XB0 X;  2O3F A;  2DDA A;  3V8K A;  1RUN A;  4G6D A;  3PSF A;  2Y75 A;  2R7V A;  3IHU A;  1K4S A;  5EEG A;  3J81 K;  5M3F J;  4CCM A;  4OAY A;  4CDG A;  1BC8 C;  4ZC3 A;  4BS9 A;  2LD5 A;  3RZO J;  1FOY A;  4FQG A;  2ZC2 A;  3KE2 A;  3H3U A;  1BI1 A;  3F9K A;  2M9H A;  2XF5 A;  2M4K A;  1Y6I A;  2FNP A;  5J4V A;  1SVO A;  1W36 C;  1STZ A;  3ZOB A;  4N9I A;  2Z33 A;  3OL4 A;  3F8B A;  4FAS D;  3C2H A;  4NC8 A;  4WXC A;  5EEA A;  2ZJ2 A;  5GTH C;  3R0A A;  3CJT B;  2FRH A;  2EFN A;  4AWX B;  3FXQ A;  1Y0U A;  5L3C A;  4M9Z A;  1D3Y A;  2RVC A;  2OQR A;  4B4C A;  3GTG J;  3W2A A;  5LRR A;  3K69 A;  2HS5 A;  4LG0 A;  5DM6 F;  3OS0 A;  5KAI C;  2QQB A;  3DFG A;  4OMZ A;  2HU9 A;  1UEL B;  4RB3 C;  2RN7 A;  1BC7 C;  2YPR A;  3K9T A;  3CCY A;  4HYE A;  3BDD A;  3EET A;  2NRA C;  1WFX A;  2RNJ A;  3HKZ A;  2M3A A;  4R1H A;  4G8X A;  1R00 A;  4FE7 A;  2HOA A;  2F48 A;  4RAF A;  3E6D A;  1S29 A;  4A6D A;  1LVK A;  5JHU A;  1H8A C;  3C3W A;  3D5R C;  1JKQ C;  3R6S A;  3QAH A;  4OWR B;  2WWY A;  3FXO A;  1XB4 A;  3MKL A;  4BQN A;  1S5L C;  4BH9 A;  2YUS A;  4OAZ A;  2C6Y A;  2RGV A;  1TC3 C;  1ETW A;  2OCC H;  2XDV A;  1K6O A;  1ITY A;  5E79 C;  1B72 B;  2DA7 A;  3BTJ A;  3HOT A;  3DEE A;  3QRF F;  3JCU C;  2R7R A;  3GXO A;  5E8G A;  3OYH A;  4U87 A;  1F5T A;  2P5K A;  5EG0 B;  4UNO A;  3GTP J;  3BG9 A;  1REP C;  5IT9 K;  1HF0 A;  4XLF A;  5KNL A;  1ODD A;  4BXF A;  3WTX C;  4IZZ A;  4MIM A;  4HNT A;  1I6X A;  4G12 A;  4IRI A;  3LA7 A;  4A3K J;  1PVE A;  2F4O B;  3R61 A;  2R7W A;  2M7B A;  5DDG A;  2L01 A;  2G9W A;  4KA4 A;  2JRM A;  1K4T A;  1JHF A;  2YX4 A;  2DU9 A;  1PJR A;  1F43 A;  2VJ5 A;  4B48 A;  1GXQ A;  1E17 A;  2V79 A;  3S2D J;  2X4H A;  3GLX A;  5E3M A;  5JR3 A;  3ZR8 X;  4XR6 A;  2HQ5 A;  3EUA A;  3TDU C;  1BM9 A;  2B0L A;  2GXG A;  4KT6 A;  4B43 A;  2QBY A;  3W6V A;  2HR3 A;  3BG3 A;  1YTY A;  1FY7 A;  2EFP A;  5AON A;  4DYQ A;  3KCC A;  4XID A;  2WB1 N;  2IS2 A;  3DLA A;  2DQL A;  3DEU A;  1OQY A;  4YEL A;  1R22 A;  1RES A;  2V7F A;  2AXL A;  2CW8 A;  1E3O C;  4F91 B;  4E4H A;  4S0H B;  2BY1 A;  1O57 A;  2M7A A;  2H8W A;  2HTS A;  4EAT A;  2XPU A;  2P5V A;  2JN6 A;  3E97 A;  4HV5 A;  4PDK A;  3PNY A;  1QNT A;  4G9Y A;  4RB0 A;  1J9I A;  4PJM A;  4D5C A;  4DBR A;  3OSG A;  4A5N A;  1H9T A;  4BAC A;  2HPM A;  2R5Y B;  2HDC A;  3GZ5 A;  4XSZ F;  3J7A O;  1V5E A;  2H6B A;  1WZ2 A;  2K4B A;  2XAF A;  2GOX B;  2EIK H;  4HSR A;  3H3V K;  4I09 A;  3GWZ A;  3JRG A;  4HDV A;  2KRH A;  3DKX A;  4RGR A;  5FKN A;  4Z2Y A;  4W1U A;  2V6E A;  2B7E A;  2AHQ A;  3CLQ A;  3QU6 A;  3RKW A;  4WXH A;  3ZMT A;  5BMZ A;  2CV0 A;  2WAQ A;  4GGG A;  1BIB A;  4U7D A;  3TO9 A;  2XAQ A;  3KP6 A;  2P6S A;  1V4R A;  1BJZ A;  3DPL C;  3JRF A;  2JVH A;  3H9G A;  1W5S A;  2VON A;  3BG7 A;  3CJQ B;  4BE1 A;  4L9T A;  2Z1D A;  2E1N A;  2BY2 A;  4B1R A;  4A3G J;  2QSF X;  4ZDO A;  3MEX A;  5FO5 A;  1EH7 A;  1S8N A;  3IH3 A;  1AKH B;  1F9N A;  3M8F A;  5H20 A;  3WG9 A;  3ZMV A;  1SFO J;  2UXN A;  4FE4 A;  1YIJ I;  1W7P A;  2FU4 A;  2CFO A;  5CQE A;  4BU2 A;  2M45 A;  5EDN A;  4X6A J;  3BR5 A;  4AVP A;  3TBI A;  2P8T A;  1MH4 A;  3ZQH A;  2Z99 A;  4LB6 B;  1TWF J;  1HCR A;  3C1D A;  4M9S A;  4L9V A;  2L0K A;  3L7W A;  4MFE A;  2DFF A;  2Y0S N;  3Q9S A;  5HVQ C;  3ZMU A;  3LMM A;  4II3 A;  1IGN A;  1IN8 A;  2Q2E A;  3E5Q A;  2PMU A;  1T39 A;  1ZGA A;  2XSJ C;  1MGT A;  2KLO A;  3CF5 F;  3CQZ J;  3A01 A;  2RV8 A;  2XKO A;  3HG9 A;  2QWW A;  2GZW A;  2ZFW A;  4XLN F;  3REO A;  4JX4 A;  3SQN A;  3U1D A;  2DK5 A;  4UB6 C;  1VQ7 I;  3UNG C;  2JA7 J;  1J7K A;  2GA1 A;  3BCA A;  2DXI A;  3GX4 X;  3HSF A;  4I02 A;  1LEA A;  4EQQ A;  3T8R A;  1P2F A;  1KYW A;  3O3K A;  3W2W A;  1UHM A;  3WTW C;  2GXB A;  3HOV J;  2Y48 A;  3LNQ A;  1Z1D A;  3EPZ A;  4L5E A;  4L0Z B;  1LFP A;  1XGM A;  1BBY A;  1MW7 A;  3FK7 A;  2MFZ A;  3AL0 C;  2PQ8 A;  2K3F A;  1LE8 B;  2R7X A;  4IL6 C;  3IUO A;  2K85 A;  3ASN H;  1MMS A;  3VYR B;  2MA3 A;  1A04 A;  4CIC A;  5K7Z A;  2OZU A;  3QPL A;  2VIX A;  2BOL A;  1SAN A;  4IJA A;  4PJL A;  3TQN A;  3KP5 A;  2E35 A;  4EM2 A;  3N97 A;  2IP2 A;  3BOQ A;  1RI7 A;  2EIJ H;  4JX6 A;  3BR2 A;  1ETV A;  1O7F A;  1YS6 A;  3E5U A;  5E20 A;  2WC2 A;  3S1Q J;  4LFU A;  4C3I J;  2FBK A;  1TQP A;  3TL4 X;  4GXO A;  2XGD A;  2OA4 A;  2D1V A;  3I3L A;  2EFW A;  3RSN A;  5J1U A;  4WWC A;  3MKZ A;  2YU3 A;  2EFQ A;  2HYJ A;  1NK2 P;  1FTT A;  3ECO A;  4UVA A;  2O61 A;  3IWF A;  3K4M A;  4ZYH A;  1XPX A;  3KZY A;  3WU1 B;  4RBO A;  3WTS C;  1HW2 A;  5ICE A;  4U0Y A;  1ON1 A;  1X58 A;  4WXD A;  4QTR A;  1AA7 A;  1BR4 A;  5K5R A;  3OV8 A;  5TIS C;  2XF7 A;  4S04 A;  2A6H F;  2RQQ A;  4O6J A;  2UWM A;  2IVM A;  3T0Y A;  3GTO J;  1SFX A;  4HA8 A;  2CUF A;  1AHD P;  1ORK A;  2GA2 A;  1FIP A;  1Z6R A;  4KNY A;  4HF0 A;  2VC0 A;  2XSD C;  4ZTF A;  2J5O A;  3CME I;  2VUM J;  5ICG A;  3FDY A;  1ZN2 A;  2CUJ A;  2KRC A;  2VJI A;  3FHN A;  2QQ8 A;  2FMY A;  2LF8 A;  5J6X A;  2LF7 A;  2FNA A;  3BPX A;  3FMR A;  2F2E A;  1XTA A;  3HJE A;  1R5H A;  2VI6 A;  4M73 A;  2V26 A;  3DWL E;  2X6Y A;  4LIV A;  2LYC A;  1RKT A;  5BOX A;  5ILV A;  4RDU A;  3CCU I;  3BT9 A;  2DA3 A;  2NVT J;  1DPU A;  4V19 K;  2COM A;  2EH3 A;  3RQ4 A;  1JGS A;  1OFC X;  2BYV E;  2MGQ A;  3HPH A;  3KIO A;  2E1O A;  4M3F A;  1YIT I;  4A3J J;  4IHX A;  1LUJ B;  2G7H A;  4JP0 A;  4EJV A;  4ZYD A;  2M1B A;  2ZO4 A;  1EF4 A;  3VSL A;  4J00 A;  3DQV C;  2KL4 A;  4DNC A;  2X51 A;  4CSW A;  1QA6 A;  3LSH A;  4HQE A;  3S3M A;  4GYG A;  3VOD A;  1YJN I;  2D5V A;  3S1M J;  1R71 A;  1WJ5 A;  2K40 A;  4ZJZ A;  3SDG A;  3CMA I;  1PP8 F;  1EV7 A;  1ZKG A;  4QWQ A;  3S17 J;  1SD7 A;  3OIQ A;  2GXA A;  1WVR A;  3JRH A;  1S72 I;  4BQA A;  2P0W A;  4LK0 F;  2JRT A;  1JKO C;  2GLO A;  4XBF A;  1RR7 A;  5ICC A;  1R23 A;  3ABM H;  2XAJ A;  2EFO A;  2NAZ A;  5E1W A;  5D5X B;  1D1B A;  3GEZ A;  1BR2 A;  2OQG A;  4PZJ A;  3RKX A;  1F36 A;  4D7N A;  3OYM A;  1ON2 A;  3G71 I;  2R7O A;  4BL0 B;  3WG7 H;  2M87 A;  2VKV A;  3F21 A;  2FUG 2;  1TQM A;  1TWA J;  1AOY A;  5DCM A;  4NHJ A;  3LSR A;  4ESJ A;  1WPK A;  5KHD A;  2BEO A;  2OUM A;  1TTY A;  3K6G A;  3CLO A;  5CKT A;  4E7H A;  3CUQ A;  2MSY A;  5FLX Z;  3B6C A;  2CMP A;  2KIM A;  2CSO A;  3K4L A;  4K2E A;  3ZN0 A;  2H8R A;  4XLE A;  5TGT A;  1O7L A;  4BJ6 C;  1VQK I;  3GBG A;  2VE8 A;  2K27 A;  2IPQ X;  1AWC A;  1B8I A;  3P9I A;  3S14 J;  1HSJ A;  1D8K A;  2BGC A;  4D9J A;  3LSI A;  4C3J J;  1ONV A;  5J8C A;  3ZP5 A;  2L54 A;  2IA2 A;  2CFX A;  4L9N A;  3F22 A;  3MFK A;  3HL2 A;  3HHH A;  1LVA A;  4BY7 J;  1OR7 C;  4YFN F;  2IS4 A;  2V4J C;  2KPM A;  1EA3 A;  4BEH B;  3HGY A;  1O3R A;  3BC8 A;  4XN0 A;  1U5T B;  4DW6 A;  2CYY A;  3OYF A;  4B47 A;  3HKZ N;  2CV2 A;  4Q47 A;  2OD5 A;  4EVI A;  1YOV B;  1SAX A;  5DD4 A;  1MNE A;  2KIU A;  3GLL A;  3HRM A;  4PFP A;  2PX9 A;  4ZH4 F;  1U9O A;  5EGO B;  3HDD A;  3ZQI A;  3LSG A;  3CCQ I;  2E1C A;  2XGC A;  4BHB A;  2X48 A;  3BR0 A;  3H9Q A;  3IL2 A;  2BHZ A;  2R92 J;  3I59 B;  4A3I J;  3WTV C;  3ZMZ A;  4BUP A;  2GAU A;  4AU7 A;  3GFL A;  5KK1 A;  2L4A A;  3RPQ A;  3CJN A;  4Q48 A;  4YII A;  5DEQ A;  4KN4 X;  4XRF A;  4ENJ A;  4FCY A;  2X9D A;  2HVQ A;  1T0F A;  2VT3 A;  3PIP F;  3OYJ A;  1JE8 A;  2FML A;  4II2 A;  3RTR A;  1VFC A;  1SD5 A;  4HX8 A;  5ILU A;  1DQU A;  3I54 A;  2ISZ A;  1V55 H;  3PNV A;  3FXL A;  1MDM A;  4AUX A;  2NOG A;  3K4N A;  2CGP A;  1DU6 A;  1RKW A;  2DA6 A;  1BIA A;  1OCR H;  3E6B A;  4YRV A;  1Z9C A;  5EZG A;  1KON A;  4GFB A;  5C44 J;  3CMM A;  1Z7L A;  4L9J A;  3CES A;  2A68 F;  2YSR A;  3ABT A;  4A0Y A;  1YO5 C;  2A69 F;  4ZYE A;  3L00 A;  1Z6T A;  2P4W A;  1MBG A;  3LST A;  3BR3 A;  5CVI A;  2XF6 A;  4KMU X;  1IXC A;  3L2Q A;  3EYI A;  1UZC A;  3K4J A;  2EZK A;  4HAM A;  3F0C A;  1X1B A;  1TQI A;  4F3Q A;  3MZH A;  4CO8 A;  5K5Q A;  3HPG A;  2DFE A;  2LOO A;  3HB9 A;  3R60 A;  4UV9 A;  3GVA A;  2LH9 A;  4MQV A;  4G7O F;  3LQR A;  3TDZ C;  2F4I A;  1I1G A;  5DD8 A;  4LLN A;  3FXJ A;  4XLA A;  1Z7U A;  1UB9 A;  1FMV A;  2R7Q A;  4CCN A;  1S3J A;  3DKY A;  4N4N B;  3PFY A;  2PLY A;  2EBI A;  3L2C A;  4A12 A;  4MFD A;  2BV6 A;  2PMZ N;  4MTE A;  2LKS A;  5TJJ A;  4BYY A;  3OS2 A;  2WBM A;  1Q1V A;  1YJW I;  5BPD A;  4U0W A;  2R93 J;  4L0Y B;  4YEJ A;  2Y31 A;  4MGR A;  2VBW A;  5LGU A;  2Z2S B;  2VXD A;  1NH3 A;  2JWT A;  3ZQQ A;  1X1D A;  1QHH D;  2ELK A;  2MW8 A;  3L2R A;  3BQZ A;  2NXN B;  2TRT A;  3KEY A;  4JK1 X;  4JX5 A;  4BBS J;  3K70 C;  2OJE D;  2HDD A;  1KU7 A;  1E2X A;  1ZYR F;  1TLH B;  4DZJ A;  1FWZ A;  2Q0O A;  2VKE A;  2L4M A;  5HOO A;  4F7Z A;  5D5V B;  1CF7 A;  2FE3 A;  3UR3 C;  4Y13 A;  2BVL A;  2ECB A;  2LSO A;  3OIP A;  3CDH A;  4A3C J;  2W00 A;  3BZC A;  5E3O A;  2OBP A;  1K83 J;  1V5G A;  2HXO A;  2K9N A;  3I5U A;  3DTE A;  2IS1 A;  3BPV A;  1MMN A;  3OWT A;  3BP8 A;  1JTY A;  2XVC A;  1YX5 A;  1Z3Y A;  4RAZ A;  1ZGJ A;  1IF1 A;  1TW2 A;  5A2Q K;  2XAS A;  3O8H A;  2TCT A;  2XRL A;  2ZME C;  2DMN A;  4C2M J;  2NS7 A;  4BGD A;  2Y9Y A;  5J40 A;  2A5W A;  1LQ1 A;  6PAX A;  2L9R A;  3PFI A;  3WTY C;  1DP7 P;  1G6N A;  3VWB A;  1QVU A;  3G4S I;  3SJM A;  2Y69 H;  2Y9Z A;  3AAF A;  2VBZ A;  2CRG A;  5JLX A;  3ZPL A;  4IHT A;  5GAG J;  1Y8Q B;  2HTJ A;  4M6V A;  3OYL A;  2DMP A;  3ZCO A;  1Z0X A;  1K6Y A;  3HYI A;  1SFK A;  2K86 A;  1L3L A;  4PJ0 C;  5HDN A;  3T1B A;  1A31 A;  1G3T A;  3ZQ7 A;  1WJF A;  2O8K A;  1HOM A;  3HUG A;  2ZNZ A;  3HEF A;  1WI3 A;  3O8G A;  1S6L A;  2KZV A;  5TRD A;  1FSE A;  1N75 A;  3FKI J;  2IT0 A;  3BWG A;  3PL8 A;  1GHC A;  1A6Q A;  4I0A A;  1J0R A;  2CQQ A;  3SYT A;  5EJC A;  3JRC A;  4XRM A;  4XLC A;  2X1C A;  4XMY A;  2QM3 A;  2P6T A;  1R7J A;  1PUF A;  2OC6 A;  4MEY F;  3G73 A;  3ZQC A;  1MMA A;  1W7P D;  2PJR A;  3OS1 A;  2RKH A;  3LQQ A;  4PGG A;  3HOX J;  1R5I D;  2IRF G;  2G0E A;  2CJJ A;  4YFK F;  3GCM A;  4CYD A;  2VL8 A;  1F1Z A;  2FEZ A;  1BW6 A;  1W5C C;  4R79 A;  1RPW A;  1WJE A;  1TBX A;  2QVO A;  2XGX A;  3SFZ A;  3M4O J;  4IQJ A;  3MQ0 A;  3RZD J;  2PEX A;  4IQ4 A;  1XMX A;  2BBY A;  4C9Y A;  3QPH A;  1NG7 A;  4ESF A;  1ZRC A;  3BG6 A;  3ML6 A;  3GF2 A;  1RNL A;  3Q9V A;  1QVT A;  3AG1 H;  1D0X A;  5B5E C;  4A0X A;  3GTJ J;  2L9N A;  2QBY B;  2VC1 A;  4AYB A;  4V2G A;  1XDU A;  3S1R J;  4XL9 A;  2JUG A;  1S7O A;  4HV6 A;  1FYK A;  5LEJ A;  1OIS A;  3LA2 A;  2K5C A;  1R1V A;  4J19 A;  3HC7 A;  3WHB A;  2CW0 F;  1QZE A;  2B9S A;  1FOX A;  4WX9 A;  3OIO A;  3ZMD A;  3JTG A;  1O3S A;  2ZXJ A;  1USS A;  3ERE D;  4O3M A;  3DPU A;  3ECH A;  1V5F A;  2AS5 F;  2EB7 A;  2ZKZ A;  4AIJ A;  3MAJ A;  1XC5 A;  2E1M B;  1HW1 A;  1FPQ A;  4HPQ A;  5D6F A;  5DCF A;  3D5L A;  3RKY A;  2QYO A;  5GAE J;  3LSJ A;  5E17 F;  2DPU A;  2DPD A;  1KA8 A;  3HGG A;  5B1A H;  2JUC A;  3B02 A;  3ELK A;  3F72 A;  4CZZ A;  2F5F A;  4B8X A;  4AID A;  4I01 A;  3GZ6 A;  4XON A;  1OCT C;  2JSC A;  2EIM H;  1LEB A;  2VXZ A;  5LGT A;  4XNF A;  4EM0 B;  4C2U A;  4HF2 A;  4Y33 A;  1XSX A;  3JW4 A;  4XKW A;  3TGN A;  4DIQ A;  3KLN A;  1GVD A;  1B59 A;  1I5Z A;  1JTX A;  2CO5 A;  5GAH J;  3FXM A;  2E5N A;  5CJ9 A;  5IOY A;  1RC9 A;  1HQC A;  1XS9 A;  1IZ1 A;  1RUO A;  3A2K A;  2DA5 A;  3LFK A;  1UST A;  2CS3 A;  3EUK L;  1ZQ3 P;  1T56 A;  1BL0 A;  3FX3 A;  2OV7 A;  2MLK A;  1HKQ A;  2COB A;  4Z6Y A;  1KU9 A;  2O03 A;  5B66 C;  1ZEL A;  1IRZ A;  1ETQ A;  4JYK A;  3KP4 A;  5FFZ A;  2FBI A;  2F5V A;  3JAM K;  1D5V A;  1B9M A;  1JXS A;  2PMZ A;  1IRX A;  2BY0 A;  1W7P B;  5JVT A;  3VYS B;  3DLL F;  1FEX A;  5FD5 A;  4E7L A;  1SEU A;  1Z3X A;  4KIC A;  3KFW X;  1JT0 A;  2ZCW A;  4ZYA A;  3PUF A;  3LAJ A;  3BTC A;  3FMS A;  4CCJ A;  2W84 A;  1LDD A;  3OSF A;  3JRD A;  2EA2 A;  5BQT A;  1KU3 A;  1TZL A;  4B3X A;  4G7Z F;  3VB2 A;  3AG3 H;  2B63 J;  1QO0 D;  2Q2E B;  2OPT A;  1TWC J;  2PN6 A;  1PP7 U;  4HG2 A;  2ZXH A;  3MZ8 A;  4J01 A;  4BDZ A;  1ZLK A;  3A01 B;  1MKM A;  1ENH A;  1Y1V J;  1JT6 A;  2W85 A;  4M3G A;  4LGW A;  2FOW A;  3RYP A;  3CF2 A;  2DW4 A;  3F8N A;  3H1C A;  1XG1 A;  3SDB A;  4A3F J;  1OR7 A;  3GTK J;  2DJI A;  4M3E A;  5ERI A;  2K9Q A;  1R49 A;  4KN7 X;  2LTP A;  5IT3 A;  4KYW A;  2DMQ A;  2LKX A;  3I4N J;  1FC3 A;  3DV8 A;  3F8C A;  4BJT A;  1TW3 A;  2A05 A;  3OY9 A;  3C2B A;  2F5E A;  2R7D A;  5DS9 A;  2JMW A;  3Q0W A;  3ZQF A;  2NNN A;  3U2R A;  1IV8 A;  2XPV A;  5FD6 A;  2MYS A;  3MWM A;  2VOD A;  1W36 D;  3J7Y J;  2DYR H;  2FSW A;  5AIP A;  5DM7 F;  2JSP A;  5JI6 A;  1BI0 A;  2HVR A;  1IRF A;  2VKD A;  2PFB A;  1IDZ A;  1TL8 A;  2L02 A;  4HEA 2;  2NNY A;  5CPR B;  3I55 I;  3VYU B;  1ETX A;  4B3A A;  4CH7 A;  3N4M A;  1HW5 A;  2KDO A;  2M34 A;  3V7S A;  1YW8 A;  3CDL A;  3FIS A;  2IAI A;  3BJA A;  5H2F C;  2KDZ A;  2HXI A;  5HS7 A;  3HOW J;  1UHS A;  2R7U A;  1XSV A;  1ZRE A;  2QQ9 A;  4XOT A;  1YJ9 I;  5FB2 A;  3M9A A;  3TMO A;  2L3D A;  4IKF A;  5AIQ A;  4WK8 F;  3IRQ A;  1KQ9 A;  1WCM J;  1N78 A;  3J80 K;  1I39 A;  3IWZ A;  3R4K A;  2WTE A;  3UKG A;  5BNG A;  2W57 A;  1R5G A;  9ANT A;  3LSK A;  1GDT A;  3HOY J;  2GQQ A;  4U88 A;  2JA2 A;  2GBY A;  5KCM A;  1CGP A;  4I76 A;  1U78 A;  2ZB9 A;  2XAG A;  2ACJ A;  4GO1 A;  2EWN A;  5LBQ A;  3VEP A;  2A6E F;  2ZJQ F;  3FBN B;  4JQF A;  3RIR A;  1E0E A;  5L3B A;  2Y30 A;  3IC7 A;  3CC2 I;  1U6G A;  3PO3 J;  2FBH A;  4PCQ A;  1U8R A;  3LWF A;  2W4S A;  3V7C A;  2JQ7 A;  2DTR A;  5D4R A;  1XGS A;  1G2H A;  1T6S A;  2H09 A;  1XD7 A;  3NRV A;  1ULY A;  1HKT A;  2DT5 A;  4ON0 A;  2QA4 I;  1D5Y A;  5IYD J;  2H1L A;  2VT2 A;  5F1J A;  2VN2 A;  1ZG5 A;  2NVU B;  4FX0 A;  4KJZ A;  2UV1 A;  4G7H F;  1SAU A;  3FF5 A;  2VBX A;  3B6A A;  2ME0 A;  3WHC A;  4L18 B;  3DEW A;  3BY6 A;  1JKR C;  2OU2 A;  3G3Z A;  4Q5S F;  3IP4 B;  4P96 A;  5FRM A;  2O9L A;  3BZ6 A;  4W97 A;  1OCC H;  4UV8 A;  4DOZ A;  3OL3 A;  4ENM A;  5J47 A;  2IBD A;  1S9H A;  4UUS A;  1FOW A;  1P4X A;  1KQ8 A;  4FTH A;  3RCO A;  3RYR A;  1K78 A;  3MMY B;  2BE5 F;  3PUB A;  3QOE A;  3J81 Z;  5FKK A;  4LOC A;  4AC0 A;  1EJ9 A;  2DFI A;  1ACI A;  1Z77 A;  3QP6 A;  4EJU A;  1BOA A;  3K7A J;  2IGN A;  2NS0 A;  1VQ4 I;  2HQN A;  3F3X A;  3I9V 2;  5GPA A;  4OIN F;  1KGS A;  1FIA A;  4B09 A;  1ERD A;  3WU0 A;  3LOC A;  1OCP A;  1QRY A;  1H0M A;  4UY8 I;  2Q1Z B;  1TNS A;  5FLM J;  2ZME A;  2W7N A;  5GPC A;  1TT5 B;  5DCM B;  2DCE A;  2E36 A;  2KJC A;  4E70 A;  4LK1 F;  4MTD A;  2DMT A;  2CQX A;  3JRB A;  4RM2 A;  1VQ6 I;  3CUQ B;  3E5X A;  3E6M A;  1XSD A;  4NDL A;  2ICW G;  3EQL F;  3OYD A;  4PFO A;  3TP0 A;  2KRF A;  4FHT A;  1BN5 A;  2L2O A;  1GV5 A;  2WV0 A;  4V2F A;  1B8I B;  4CZC A;  2LK2 A;  2XHK A;  1J09 A;  2ADU A;  4EM1 A;  1S7E A;  2LC2 A;  2CG4 A;  3QPT A;  4D1Q A;  5CVR A;  2JVG A;  3OYG A;  1T2K A;  2VJJ A;  1T33 A;  5IOZ A;  4KDP A;  4BQO A;  1IN4 A;  1IN6 A;  2F5C A;  4NC6 A;  4XK4 A;  4Y4R A;  2KIF A;  3F6V A;  3H5R A;  1SD4 A;  1HA8 A;  1UCR A;  2CU7 A;  2Y0M A;  3GFJ A;  2QEX I;  1JKP C;  5FGM A;  3RJP A;  2NVY J;  3WGG A;  4A93 J;  1EH6 A;  3OYA A;  5F04 A;  2HOE A;  2ZSI B;  5D4S A;  2VLA A;  5GAD J;  4E7K A;  3MN2 A;  2KIQ A;  4F52 A;  2MG4 A;  2O8X A;  2VAS A;  2W48 A;  3ABL H;  2R5Z A;  4ZTJ A;  1U9N A;  1X3U A;  2KKO A;  3BJO A;  4NC7 A;  1ZGW A;  3QOD A;  1VTN C;  3KZI C;  2MLG A;  4NQW A;  3D0S A;  3E3V A;  1ETY A;  5DYM A;  2CQN A;  1POG A;  2A6T A;  3QYE A;  2WV1 A;  1S7A A;  2W24 A;  2E7W A;  1WHU A;  3BCB A;  3ZN1 A;  5D5W B;  4H0E A;  5IT9 Z;  3BRO A;  3C7J A;  4KIG A;  2R0Q C;  3CCM I;  1UAA A;  1VQL I;  5LEK A;  1NHA A;  1IW7 F;  2MH9 A;  3A0H C;  3OOU A;  1BJA A;  1WI9 A;  2M4G A;  1IUY A;  3GW2 A;  3ZRG A;  1OCO H;  1OYW A;  3H0G J;  2LKP A;  1MDM B;  2FOK A;  5IP6 A;  2E71 A;  3K4C A;  4BE2 A;  4IPA A;  3PIO F;  3GME A;  4ENK A;  1X19 A;  2CUZ A;  4NBQ A;  1Y39 A;  3B73 A;  4A69 C;  2JPC A;  5CLS A;  1BA5 A;  1KU2 A;  1XGO A;  2MC4 A;  2Y2Z A;  3S3O A;  3H5N A;  5ICF A;  3OYN A;  1V3F A;  1IV6 A;  5CYV A;  2VQC A;  1QQI A;  4WCG A;  3V8J A;  4BE0 A;  3S2W A;  1JUM A;  4D5F A;  1J2X A;  1VQO I;  3FIW A;  5IYB J;  5LGN A;  2M5W A;  4LIT A;  2D2W A;  2EK5 A;  3CCE I;  2HKX A;  4LJZ F;  1IN5 A;  5C4J J;  4B44 A;  3JAM Z;  4AYB N;  3EUH C;  4CCO A;  2QF7 A;  5EYR A;  1GV2 A;  1MBJ A;  3KEO A;  2O0Y A;  3N05 A;  1YE9 A;  4OOI A;  3HBL A;  2LY1 A;  4A6E A;  3BZK A;  3Q5F A;  2AXT C;  5B3S H;  4EEF G;  4RB2 C;  1SVL A;  2G7U A;  3M07 A;  5CVJ A;  2VQG A;  3TW6 A;  5M3M J;  2VKH A;  4BXX J;  3I71 A;  2Z3Y A;  3KEQ A;  1IN7 A;  1J59 A;  1FP1 D;  3WU2 C;  2W82 A;  3I56 I;  1MD0 A;  1ZH5 A;  3BTL A;  4S05 A;  4HBL A;  1W5T A;  2R3S A;  5HLH A;  5L3F A;  1VQ5 I;  3S1N J;  2DTZ A;  3SEQ A;  2V9V A;  1OYY A;  2QEN A;  3IAS 2;  4RLQ A;  4CXF A;  4L5I A;  4M3D A;  2L7F P;  4DBQ A;  1ZHF A;  2FXA A;  5F08 A;  2X6W A;  2HKO A;  1TNT A;  2LP0 A;  4CCL A;  2QCO A;  4DQ2 A;  5GTI C;  1G3Y A;  1CF7 B;  1VI0 A;  4ANJ A;  4CUG A;  4HNV A;  4F93 B;  1BW5 A;  1RET A;  1GLN A;  2WAF A;  3A1Y A;  5DUK A;  2W1O A;  1R9T J;  1U3E M;  3DTI A;  4OIP F;  1YW9 A;  1LPQ A;  1NTC A;  3H35 A;  5CVV A;  2ELJ A;  1U8B A;  1ZR2 A;  1D0Z A; 
#chains in the Genus database with same CATH homology
 1MMD A;  2KQR A;  3AKZ A;  4XKC A;  1D0X A;  3H5A A;  4PJN A;  3TBI A;  4CCK A;  2WB1 A;  2X1D A;  3LSM A;  3DPT A;  2L9N A;  4LIU A;  4AYB A;  4XL9 A;  5HVQ C;  2JUG A;  3LMM A;  4II3 A;  3OYC A;  1UG0 A;  5JHF A;  2XSJ C;  2K5C A;  2KLO A;  1R6R A;  3NWS A;  3U21 A;  3OYI A;  3HC7 A;  1MND A;  3PNT A;  3HG9 A;  3A4C A;  2HQA A;  3ZGK A;  3FKJ A;  1T95 A;  3K10 A;  3S8P A;  3OYB A;  3UNG C;  2M0M A;  3DPU A;  3BCA A;  3AL0 B;  1YX3 A;  1V5F A;  2DXI A;  3J7A Y;  1N77 A;  2CW7 A;  4G6T B;  1LDK B;  4HPQ A;  2E1M B;  4HNU A;  3D5L A;  1QHG A;  3E1S A;  4HRI A;  3W2W A;  3HUG B;  3EPZ A;  1LFP A;  4XON A;  2K9L A;  1MW7 A;  4DJA A;  2VXZ A;  4XNF A;  4MLO A;  2MFZ A;  3AL0 C;  4C2U A;  3S32 A;  3G2B A;  4Y33 A;  2IGK A;  4BJ5 C;  2R7X A;  4JOM A;  5CQG A;  2E1M C;  3IUO A;  2IGM A;  4XKW A;  4DIQ A;  2ZFU A;  2VB6 A;  3VYR B;  2K3P A;  3VSK A;  2PJR B;  2E5N A;  3MKW B;  4XQF A;  2GOM A;  2VIX A;  1DGW Y;  3A2K A;  2BOL A;  3EUK L;  2CS3 A;  3S3N A;  4HST A;  3C2G A;  1VZ0 A;  2BW3 A;  4NNJ A;  4PJL A;  2OV7 A;  4F92 B;  4AVZ A;  1Z21 A;  1WJA A;  2AQE A;  3H0D A;  3KX2 A;  1ZEL A;  2F5V A;  4IX7 A;  4RMN A;  2ZXI A;  2LBF A;  2PMZ A;  1IRX A;  1BOB A;  2QKL B;  3TL4 X;  2L9S A;  3NWT A;  3VYS B;  3H9J A;  3ZXS A;  3W3C A;  4E7Z A;  4E7L A;  2X1E A;  3I3L A;  2Y0S A;  1Z3X A;  3RSN A;  2WA0 A;  5HNF A;  2V9K A;  3MKZ A;  2R7S A;  4ZYA A;  3ONQ A;  3K4K A;  4RLF A;  2R7T A;  3OYK A;  4CCJ A;  4C2T A;  3K4M A;  1TZL A;  4B3X A;  2Q2E B;  4HG2 A;  1AA7 A;  1BR4 A;  2ZXH A;  4J01 A;  4BDZ A;  2XF7 A;  2RQQ A;  2UWM A;  3K4B A;  3LL7 A;  2IS6 A;  2ZSH B;  1QU3 A;  3CF2 A;  2XC7 A;  3RPU D;  4PK4 A;  3SDB A;  4ZTF A;  2DJI A;  3FDY A;  2CUJ A;  2KRC A;  2VJI A;  3FHN A;  4P5O A;  4XKB A;  1PYV A;  5FRO A;  3PSI A;  2QKM B;  1WJD A;  2NOJ B;  4N4O B;  4ZDL A;  2HVS A;  2HZD A;  2X85 A;  4PSW A;  4BJT A;  2V26 A;  3FBI B;  2X6Y A;  3DWL E;  4LIV A;  3OY9 A;  2LYC A;  2O5R A;  3W2V A;  1JI8 A;  4XOR A;  4QPO A;  4RM3 A;  3RQ4 A;  4BEH A;  3HPH A;  4PJJ A;  3OR1 C;  5FRN A;  2MYS A;  1W36 D;  2JSP A;  2HVR A;  2VKD A;  3VSL A;  4J00 A;  1TT0 A;  3MKY B;  3DQV C;  4LG3 A;  2KL4 A;  2AQF A;  4HEA 2;  2X51 A;  1D0Y A;  5CPR B;  4CSW A;  3LSH A;  2Z16 A;  3VYU B;  3S3M A;  4CH7 A;  2KDO A;  2MAB A;  2BW3 B;  3L2U A;  1WJ5 A;  4QPQ A;  4ZJZ A;  3M1C A;  2R7U A;  4BQQ A;  3OIQ A;  3L2W A;  2CV1 A;  4XOT A;  4KIT B;  2P0W A;  2LBF B;  3TMO A;  4P1W A;  4IKF A;  3HOS A;  5HLT A;  2CH0 A;  2LRD A;  1N78 A;  1D1B A;  1BR2 A;  1FMW A;  2RRE A;  3OYM A;  4ZDP A;  2WAE A;  2R7O A;  4BL0 B;  3LSK A;  3CP8 A;  2FUG 2;  3M8J A;  3HXL A;  2JA2 A;  5KCM A;  3CP2 A;  5KHD A;  4E7J A;  2OUM A;  2HPI A;  3K6G A;  5CKT A;  4E7H A;  4BDY A;  4XLH A;  1X1A A;  4Y3O A;  2CMP A;  1MMG A;  2K9M A;  3K4L A;  2LY2 A;  4XLE A;  2IXS A;  5TGT A;  4BJ6 C;  3FBN B;  4JQF A;  3GBG A;  4C30 A;  1DP3 A;  1E0E A;  3K70 D;  4FET A;  3OR2 C;  3SEZ A;  2W4S A;  3S93 A;  4D9J A;  2IS4 A;  3LFU A;  3LSI A;  5LFA A;  3BLY A;  1T0F C;  3HL2 A;  1OR7 C;  4CA0 A;  2V4J C;  1X1C A;  2KPM A;  3MD2 A;  1EA3 A;  4BEH B;  4KJZ A;  2UV1 A;  2DOA A;  2R4G A;  3BC8 A;  1SAU A;  4XN0 A;  4H4K C;  3OYF A;  4PSX A;  4B47 A;  2KP6 A;  2CV2 A;  4ITV A;  3E0J B;  1MNE A;  3IP4 B;  4PFP A;  5FRM A;  3LSG A;  4DGW B;  3H9Q A;  4DOZ A;  3OL3 A;  2DT7 B;  1S9H A;  4BUP A;  4AU7 A;  4XN3 A;  1Y56 A;  2WY8 Q;  3QYF A;  4XM3 A;  1X4P A;  3RCO A;  2E60 A;  2HVQ A;  3MMY B;  3OYE A;  3QOE A;  3PUB A;  3OYJ A;  3PSF A;  1D1A A;  4GRI A;  2R7V A;  3RTR A;  4II2 A;  2WAD A;  1BR1 A;  1WJC A;  2KMU A;  4CCM A;  4OAY A;  2IGN A;  3I9V 2;  1DQU A;  4ZC3 A;  4BS9 A;  2HDW A;  3PNV A;  1ERD A;  3DU6 A;  3F9K A;  3K4N A;  2XF5 A;  2M4K A;  1Y6I A;  2Q1Z B;  1G59 A;  1W36 C;  4YRV A;  3OL4 A;  2W7N A;  4FAS D;  1KON A;  3C2H A;  3CMM A;  4NC8 A;  1Z7L A;  2L7K A;  2DCE A;  3CES A;  4X0G A;  4RM2 A;  2E5Z A;  4NUB A;  2XF6 A;  3L2Q A;  3OYD A;  3K4J A;  4PFO A;  1X1B A;  3W2A A;  4F3Q A;  2L2O A;  2VQH A;  4CZC A;  3OS0 A;  3HPG A;  2LOO A;  3D5S C;  1J09 A;  1UEL B;  2HU9 A;  2LH9 A;  2LC2 A;  2MD0 A;  4D1Q A;  3OYG A;  2JVG A;  1WJB A;  2VJJ A;  4BQO A;  2F4I A;  4BU2 A;  2LRE A;  1OLT A;  4XLA A;  4Y4R A;  1WFX A;  3HKZ A;  2DT6 A;  3H5R A;  5LD2 C;  1HA8 A;  1FMV A;  2R7Q A;  2M3A A;  4CCN A;  3DKY A;  4N4N B;  3SZG A;  3PFY A;  3QYB A;  3OMY A;  3CZ6 A;  1LVK A;  3OYA A;  2ZSI B;  2KHM A;  2F6C A;  3D5R C;  2VLA A;  4E7K A;  4OWR B;  2WBM A;  3OS2 A;  4BQN A;  4F52 A;  4OAZ A;  4YEJ A;  2VAS A;  4F55 A;  4E6K G;  1G8X A;  4ZTJ A;  2I8D A;  2XDV A;  3VYT B;  2VQL A;  2Z2S B;  4NC7 A;  2VXD A;  3QOD A;  3ZQQ A;  1X1D A;  1QHH D;  3HOT A;  3DEE A;  3L2R A;  3KEY A;  4KIS A;  2R7R A;  2A6T A;  3QYE A;  3K70 C;  3BCB A;  3OYH A;  4U87 A;  3PJR A;  1LKX A;  1UAA A;  4XLF A;  5HOO A;  5KNL A;  4BXF A;  3OOU A;  3UR3 C;  2M4G A;  4IZZ A;  2BVL A;  3DU5 A;  3OIP A;  4HNT A;  2W00 A;  3ZRG A;  4E7I A;  3AFH A;  3V42 A;  3K4C A;  2R7W A;  1U0J A;  2M7B A;  4BE2 A;  1V5G A;  5CQE A;  1X19 A;  1PJR A;  3DTE A;  2VJ5 A;  2CUZ A;  2IS1 A;  4B48 A;  1MMN A;  3OWT A;  3IAM 2;  1YX5 A;  1Z3Y A;  3ZR8 X;  4XR6 A;  2MC4 A;  3EUA A;  3S3O A;  3H5N A;  4KT6 A;  1NG6 A;  3OYN A;  4B43 A;  2VQC A;  4BE0 A;  3DTK A;  2UUZ A;  4LIT A;  4XOP A;  2IS2 A;  3KYL A;  3DLA A;  2L5Q A;  4BGD A;  4YEL A;  2A5W A;  4B44 A;  2V7F A;  3EUH C;  2CW8 A;  4F91 B;  4CCO A;  4E4H A;  1DGR M;  3VWB A;  2M7A A;  4EAT A;  4PUS A;  4U7B A;  2IGO A;  3N05 A;  2BVM A;  1YE9 A;  3PNY A;  2LY1 A;  1D1C A;  4PJM A;  4DBR A;  2XAU A;  3OYL A;  4BAC A;  3ZCO A;  1K6Y A;  2VQG A;  1SFK A;  2HNH A;  2WY7 Q;  2HPM A;  2VKH A;  1WJF A;  1V5E A;  2GOX B;  2W82 A;  4HSR A;  2KZV A;  1N75 A;  2KRH A;  3PL8 A;  3DKX A;  2V1N A;  3SEQ A;  3SYT A;  2V6E A;  4NQW B;  4XLC A;  2X1C A;  2CV0 A;  2X6X A;  4XMY A;  3IAS 2;  4RLQ A;  2WAQ A;  2OC6 A;  4DBQ A;  1MMA A;  2PJR A;  2X6W A;  4CCL A;  3OS1 A;  2VPL A;  5HNH A;  4E7S A;  3DPL C;  2JVH A;  3H9G A;  3BG7 A;  3CJQ B;  4BE1 A;  4ANJ A;  4CUG A;  2Z1D A;  4F93 B;  1GLN A;  2WAF A;  2VL8 A;  4ZDO A;  3A1Y A;  2W1O A;  4XKV A;  3DTI A;  4R79 A;  1WJE A;  1X4O A;  3VDX A;  3L2V A;  4IQJ A;  2LG4 A;  3H35 A;  4IQ4 A;  4C9Y A;  3CJR B;  1NG7 A;  2VJ4 A;  2RNG A;  2ELJ A;  2CFO A;  1D0Z A;  1P9Q C;  3BG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...