2XF5A

Crystal structure of bacillus subtilis spp1 phage gp23.1, a putative chaperone.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
49
structure length
49
Chain Sequence
SESLLYGYFLDSWLDGTASEEMMRVAVNAGDLTQEEADKIMSYPWGAWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP23.1
publication title Crystal Structure of Bacillus Subtilis Spp1 Phage Gp23.1, A Putative Chaperone.
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
total genus 13
structure length 49
sequence length 49
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xf5A00
2XF5A 2XF7A 2XF6A
chains in the Genus database with same CATH superfamily
1YX5A 1RRJA 2IW5A 5DDGA 5J3LA 2FOWA 4IPAA 1W4MA 2F48A 2R7VA 4B3AA 2EJRA 2VJJA 3VODA 5JFRA 3J7AO 3QOEA 1TLHB 1DPRA 1AWCA 3V42A 3IL2A 1E3PA 1XMAA 1NG7A 2BW3A 3G1MA 2M34A 3EUKL 2F5EA 5IT9Z 2Y69H 2V6EA 2IJLA 2M8GX 4P9UA 4XRMA 1O4XA 3DU6A 4DZPA 1APLC 1T56A 1HA8A 3CDIA 4HF2A 2B9SA 1PVEA 2LRDA 2KL4A 2CU7A 4E7KA 3T5XA 1WJAA 5HOOA 5KHDA 3OSFA 2DYRH 2VN2A 4NC7A 1MDMB 1Y6IA 2KPMA 4NHJA 4AIHA 4BUPA 2VJIA 1YS7A 3TL4X 2BBYA 3MKLA 2DI3A 1DGRM 1TWGJ 1O7LA 2A3SA 2JUGA 2OAZA 2BY1A 4PGGA 2LREA 2JT1A 1LEBA 4IJAA 1OPCA 5ICCA 4DYRA 1ZGAA 4RM3A 3ZQFA 3EUHC 5E1ZB 2JWTA 4CO8A 3B02A 1W36D 2WY7Q 1G3YA 2DOFA 4FE4A 2P7CB 2QEXI 1QVUA 3ROUA 3V8JA 1WJCA 2QUFA 3IAM2 3I59A 4RGSA 1QGPA 1W5SA 1XCBA 2XKPA 2GBYA 4YFKF 4I6ZA 1SEUA 3PO2J 2VONA 2BEOA 1R6RA 5DTDA 4RB2C 1FWZA 1Z3YA 3ZRGA 2A6HF 2ZSIB 4GRIA 3V7SA 1F43A 3QPSA 3K6GA 4C3IJ 2ELKA 4ASNA 1XPXA 2HQRA 1MNDA 5FGMA 3ZGKA 3WHCA 2G0EA 2ZKZA 1KU2A 1ETVA 1LE8B 3C1DA 5E79C 3ABLH 2QBYB 3HSEA 4N4NB 2X6OA 3QRFF 3MVPA 4ZDPA 2QKMB 3C3WA 3D5RC 3ISPA 4AYBN 4ESFA 1ITYA 3OYDA 1ZELA 2JQ7A 3W2AA 3LSMA 4Y52J 3LMMA 2OBPA 1TC3C 2FJ1A 1R58A 4LD5A 5IP9J 3RI4A 4AUXA 1AHDP 1S72I 5LGTA 2KP6A 4HZFA 2YU3A 1P4XA 4HG2A 1U5TB 3CF2A 1D3YA 1S7AA 5F0FA 3D1NI 2E71A 2DA3A 2MA3A 3I71A 3GTLJ 3FZVA 3O8GA 5CVRA 3EETA 4BXUA 2NS7A 4NC8A 1ETYA 2R7OA 3KCCA 3MQ0A 1NK3P 1W1WE 1XTAA 4B1RA 4EMSA 2DA4A 4CXFA 1QHHD 3FBNB 3Q0UA 4II3A 3CMEI 2DPDA 4PFOA 2HVQA 3ZMSA 2EB7A 4BJTA 3HOTA 4ESBA 2HZDA 4BDYA 2H27A 2W24A 3FM3A 5L3BA 4C3HJ 1BR4A 4KUMA 2L01A 2JSPA 1JGGA 3UNGC 2CRGA 3OYLA 3DBRB 2Z9OA 2EZKA 5ICEA 3KP3A 4I0AA 2Z16A 2QWWA 1BR1A 1D5VA 2NOJB 1OLTA 4IRHA 5HS9A 4RA2A 2NVYJ 1ULYA 4RAGA 1HDPA 4XSXF 1YTYA 2BVLA 2HS5A 2W57A 5J47A 4FTHA 1ZR2A 1MDMA 1OMIA 2D1HA 3DFGA 2WY8Q 5LBQA 4B09A 2XF5A 4GYIA 5GADJ 1K78A 1X2MA 1DGWY 4JX5A 2GOXB 3S2WA 3V8KA 4M3FA 3JSOA 2JA2A 5K1YA 3RTRA 2VE8A 4CCOA 3BG3A 1BN5A 2P7VB 2H1LA 4BGDA 5D5WB 1B9MA 3S3NA 5ILUA 4UVAA 4U0YA 4IHWA 2R92J 1E17A 3DWLE 4JX6A 1WFXA 3OOUA 2AO9A 2VASA 4DW6A 5D4RA 3PIOF 3M8JA 2MLGA 4UY8I 3CDLA 3HHGA 3GEZA 3BLYA 4OOIA 5ED4A 1R4NB 3F8NA 1ZLKA 1OYYA 3H35A 3ESWB 3WE3A 3BR0A 2HU9A 1ZQ3P 3B6CA 2MABA 3R60A 3VYUB 4W97A 1BW5A 3MWMA 1YJNI 3U1DA 3G71I 4BE1A 1IRGA 3MKYB 3L7WA 3S16J 5DV5A 4AC0A 2FBKA 3B73A 3SEZA 3T8TA 4BYYA 3CCLI 3FK7A 3BR6A 2LKPA 2QBYA 3WG7H 3S8PA 3ZQ7A 1EV7A 3AG3H 1D5YA 1IDYA 5K7ZA 3KP4A 4RAZA 5F0HA 3TO7A 2R7TA 3GZNB 2P81A 4AIKA 1DP3A 1R00A 3L1PA 3JRIA 1EF4A 2V4JC 3VPRA 5LEJA 3R6SA 2EFNA 4Z6YA 3G4SI 1N77A 4CSWA 1FYKA 2CV0A 1R22A 3LSHA 5EDNA 4WF2A 3ZMDA 2ZNYA 3N4MA 4BQAA 2RGVA 2KRHA 2GM4A 2R93J 2L4MA 3KP7A 1Y0NA 1ZAOA 5J6XA 5FLXK 3K4BA 2JA5J 4EATA 2X85A 2IS6A 4HNVA 1X1AA 4XL9A 5D4SA 1YW9A 2BY2A 3FKJA 4LIUA 1MMGA 5KVRA 3WTZA 3ZXSA 2CGPA 2LC2A 3I53A 1B72B 1J9IA 3H36A 1JT6A 4LG3A 2CYYA 2V79A 3F8MA 2GXBA 1POGA 2K3PA 3LSPA 3EQLF 2XGCA 4F7ZA 1G6NA 1BBYA 3CZ6A 4HV6A 3L2WA 3DKXA 5F04A 2GLOA 2X6YA 4ZYDA 2O03A 3DEUA 1R1TA 1AKHB 3OYBA 4V2GA 1IRXA 4DJAA 4A0ZA 2W7NA 4FETA 4ZTJA 2VXDA 3CCJI 4Y33A 1H88C 3I4PA 4XLFA 3GLLA 2CMPA 5E8GA 3LA7A 1YS6A 1XGOA 5IPAA 2ACJA 3H9QA 2LOOA 2BV6A 3HOSA 1G3SA 2DFHA 2DMNA 3OWTA 2FSWA 2R0QC 3CC2I 2DQLA 1YYVA 4D9JA 4E6KG 3EYYA 2XROA 2Y9ZA 4B4CA 1X1DA 3RQIA 3PNVA 2O9LA 4R79A 3A01B 2OU2A 3K1PA 1QPMA 2JK3A 5M5YJ 1FBUA 3H5NA 3BWGA 1MMNA 1T6SA 2XHKA 4LITA 3OYJA 1FNNA 4QTRA 1GXPA 1OQYA 1OYIA 2IGOA 3AAFA 3OV8A 3ZN1A 2IT0A 1KQ0A 3K4MA 3ZR8X 4BAYA 1U2WA 3QOPA 2XAHA 3WODF 1R5HA 1ETXA 2EK5A 2DPUA 1ERDA 3Q3SA 2LP0A 3DTIA 4E70A 1TQMA 2MH9A 3H3VK 4M6YA 1BOBA 4N9HA 3PFIA 2VBYA 3KLNA 1ETWA 1QZYA 5K5OA 1T39A 3R0AA 1TQIA 5ILSA 5FFZA 2XPWA 3M4OJ 2L0KA 3WTVC 4LFUA 3P9IA 4A0XA 1REPC 2VUMJ 1T98A 4L5IA 4UV8A 2RV8A 2WA0A 3CUQB 4KJZA 3CCQI 3HOVJ 3LQQA 3E6CC 4YFXF 1XDUA 2F4MB 3CLOA 2E1CA 2RREA 1I5ZA 1IXCA 4A93J 3BG5A 2CQ7A 1UHMA 3ASOH 1JJ6C 5HLTA 1XN7A 1IRZA 1E0EA 3VFZA 1B8IA 2K4BA 1GDTA 3C2HA 5L3EA 4ZYAA 3W6JB 1HBXG 1TNTA 5HS7A 2H09A 4UUTA 4AU7A 1IF1A 3SYTA 4CYCB 4IHYA 1R4MB 4JOMA 3HRSA 1Z7LA 3J80K 4C3JJ 5EEAA 4UUVA 1MBKA 1O3QA 5DCFA 5E17F 2QENA 2WAEA 4FX4A 1ZREA 4OIQF 2KISA 2VBWA 2XVCA 1QVTA 1J75A 2Z99A 1N75A 1Z3XA 1SFUA 4RS8A 1I3QJ 1B1BA 2EIMH 4YIIA 4FHTA 2DJNA 4LLLA 4QIWN 1TT5B 3KZYA 3I55I 5DYMA 4JK1X 1A6QA 2QLZA 2E7WA 4MEYF 1KONA 4A6DA 5A2QZ 1QO0D 2ZO4A 1MZBA 3I64A 4QPQA 5KCMA 4A0YA 4RB3C 2W25A 4HF0A 2A5YB 1I3AA 2KRCA 4E7SA 2QSFX 1OCZH 4G8XA 1YITI 2DYSH 3PSIA 4HDUA 2CUJA 2ETHA 2EBIA 3SEQA 1CF7B 3ELKA 1FPQA 2DA1A 3F72A 2LFBA 2JVHA 4MTEA 1P4AA 4HOBA 4BACA 2VPRA 2ZMEB 2BHYA 1WCMJ 4G94A 2M8EA 2A05A 2Y2ZA 2M30A 1P7IA 3LA2A 2CFXA 2FBHA 3H5RA 1QZZA 4LMYA 4KYWA 3HJEA 1YI2I 5F27A 2QKLB 1W5CC 3OS2A 1FOKA 5F0CA 2F5VA 2Q1ZB 4NNJA 1RC9A 1VQ7I 2DOAA 1D0ZA 1R49A 4BQNA 3CJTB 2FOKA 5F6FA 2LYCA 2VT2A 1R36A 1BI3A 2X6WA 2R4GA 2WV1A 2L9VA 5EZHA 3G2BA 4TV7A 2V1UA 3BP8A 1Z6TA 2NVQJ 2JVGA 2RKHA 5FLMJ 3KP6A 1D8KA 3HB9A 1QQIA 3FXRA 4J01A 4MLOA 2QQAA 3K4CA 3L2QA 4WX9A 1HXDA 1UMQA 4L5EA 1JHHA 2EZLA 2Q0OA 4GYGA 2PMZN 3S1RJ 1FOYA 2ECCA 1VF9A 3HOZJ 2PJRA 4IQJA 3FXQA 4G12A 4A3JJ 4J00A 4M3BA 2BW3B 1N25A 2B0LA 1IUFA 1X3WB 3QYBA 3Q0WA 1KU9A 2K86A 4CYDA 4II2A 3H9GA 3L9FA 1I6HJ 1WKMA 2I5UA 1R9TJ 3RKXA 3BROA 1MBEA 4ANJA 2VL8A 4LB5A 1ON2A 1R1UA 3T1BA 4WXDA 1ZKGA 1IXRC 5IYBJ 4ZDOA 2KT0A 4AVPA 3MAJA 4P5OA 2EFPA 4NC6A 4B47A 3GTOJ 2UWMA 3PJRA 4HX4A 5LGUA 4UB6C 5GAEJ 4HNUA 4U0WA 1MBGA 4HF1A 1R1VA 2G7HA 2HGCA 4A5MA 1RUOA 3NAUA 1G59A 4BXFA 3R61A 3P9KA 2AS5F 3H0DA 5BMZA 2A6EF 4M6VA 5C4JJ 1VQ8I 2O61A 3KZIC 2X48A 4RM2A 3IH4A 4XRSA 2V1DA 4M9ZA 3AL0C 3BT9A 3VDXA 4OIPF 2HOAA 1OCRH 2DFEA 3HL2A 2P6SA 2Y0SN 2HOTA 1YG2A 1XD7A 2COMA 3MKWB 5IP7J 3PUFA 1I50J 3I59B 4IVNA 1W0UA 4HLXA 3M9AA 1VQPI 2ESNA 1VQLI 1KGSA 1X2NA 2CH0A 4KIGA 2CSOA 3LSRA 1ZRDA 3NARA 2LSOA 3A4CA 4BHPA 5LGNA 3CD6I 4OMZA 3F8BA 2EFQA 2MH2A 3ECOA 1UHSA 2WV0A 3F0CA 3S15J 1FC3A 2LH9A 4CA0A 5EZGA 1FYLA 3GW2A 2EPFA 3SZGA 3HPGA 2Y0MA 1T2KA 4LGWA 5DS9A 4N4OB 3CJQB 3JREA 1Z1DA 3K2AA 2BOLA 2VKHA 1E3HA 4XNFA 5FFXA 3L2UA 2N8GA 1E2XA 4GFBA 1L3LA 1LQ1A 3W2VA 1Y56A 3JW4A 2F5CA 1BR2A 2HYGD 2DA6A 4YELA 2XGEA 2VJ4A 1BI2A 4MHGA 1YIOA 4DNCA 1HKQA 2GQQA 1VZ0A 5BNGA 1T33A 3QU6A 2FQ4A 2VODA 2XAFA 3TDUC 2O7OA 4A3DJ 2WAQA 3LQRA 2A5WA 1B6AA 3E7LA 1J2XA 1RI7A 5HDGA 1TNSA 1Z21A 4F3QA 1STZA 2KIQA 2RQPA 2KIMA 1BJAA 1X3UA 1RR7A 3HPHA 1UAAA 1FMWA 3CO7C 4NDLA 2R3SA 4I99C 2OJED 3I4NJ 3RPQA 2OA4A 3O8HA 1G8XA 2E34A 1UELB 2FD5A 3R0JA 3QP5A 2J5OA 2M0MA 1HCRA 4PSWA 3J81K 1I1GA 2WB1A 2RAEA 4G6DA 4G7OF 3GTQJ 4OAYA 4GCVA 2VQLA 2CJJA 3JRHA 3C2BA 4Z2YA 3CC7I 3RIRA 4YG2F 3W3CA 3HBLA 3VOEA 4C9YA 5L3DA 1F4KA 1JTXA 3CESA 1ZRFA 3F8CA 4YRVA 2PJPA 1GUUA 3TOBA 5B1BH 4NBQA 2XAGA 2OPTA 3X2QH 3TGNA 2M3AA 1ZGJA 3F9KA 4P9FA 4D7MA 3RZDJ 1VFCA 2YX4A 2W85A 1T8IA 1JTYA 1K78B 2DU9A 3RYRA 2EA4A 3CP2A 3KIOA 2HQ5A 4U0VA 3OIQA 3DKYA 2R5ZA 4KA4A 3FMSA 2HDDA 1P7JA 3JRAA 3DEEA 2L7ZA 1Q1VA 2I10A 4BNCA 1H8AC 1K4TA 2ZXJA 3N05A 5F1RA 1X4PA 1WH5A 3QU3A 3K1NA 2VE9A 3OL4A 1HSJA 3PSFA 3OYEA 4XMYA 2F6CA 4CCJA 1GVJA 2HXIA 3PNTA 3RKYA 1J5YA 5BS6A 2R7DA 5CVIA 1MJAA 3BZ6A 3JTHA 3Q9VA 2R7SA 3DPTA 3E6MA 3CCYA 4B43A 4DBRA 1GXQA 3P7NA 2LY1A 3E6BA 3ZMVA 3FXUA 1GVDA 3FXLA 2M7AA 2O0YA 2Y31A 2E1NA 3VEPA 1USTA 1TQPA 3K9TA 4KT5C 3EYIA 2FU4A 2VLAA 2LNBA 1JKPC 1IV6A 1ZRCA 3ABTA 3NWSA 4EJVA 1ZN2A 4EJWA 3P9CA 1IC8A 2BY3A 1DUXC 5LLQA 4C2UA 2IA0A 2ZMEC 3K70C 2KHMA 1S7OA 4UB8C 3WU2C 4B44A 3E6DA 4PUSA 3DLAA 3IH2A 4ZDLA 3IRQA 4ESJA 1O3TA 1O57A 1K6OA 5HVQC 5E3NA 4BKXA 4E7IA 2MW8A 3GZ5A 1X3ZB 5D6EA 5JR3A 1FP1D 2YR2A 4IOAF 2HVRA 3GZ6A 4HQEA 2FA5A 4PCQA 2W1OA 5BQTA 4CCKA 5EG0A 2ECBA 2KQRA 5IYDJ 3GFLA 2JN6A 5CKTA 4WWCA 1ZG1A 3HOUJ 5GTIC 2VXZA 3AG1H 2BYVE 2IPQX 3K7AJ 1S8NA 2LVSA 3QYFA 2ID6A 4O3MA 2XPVA 3H9JA 5CJ9A 4CCMA 2M0CA 4AVZA 3ABMH 1EA3A 1MBHA 2DJIA 2EIJH 4IHTA 3RPUD 4ENMA 3M3YJ 2B7EA 2GXGA 4A3IJ 2PFBA 3TP0A 2HPIA 2EQRA 4XLAA 2TRTA 3IAS2 2XAUA 1GV2A 2COBA 1HDDC 1SVMA 3CQZJ 2EIKH 2PBIA 2XUBA 4F91B 1XSXA 1DDNA 2E2JJ 3SQNA 1UHWA 3BTLA 4F92B 1ETQA 1AOYA 1B59A 4KICA 2D1VA 2IRFG 1LDDA 4KN4X 4CUGA 1T95A 3KEOA 2XRNA 1LB2A 2DO7A 2QM3A 2QQBA 4MIMA 5HLHA 2WB1N 3IH3A 3AG2H 5KAIC 4BEHB 3ZQCA 1K6YA 1VTNC 4A5NA 4DYCA 3DQVC 4LLNA 4BY7J 1EH8A 2QSHX 2Y48A 3OR1C 5IOYA 3BR3A 3M8EA 1B9NA 2X1CA 5JVGF 2EZHA 2MC4A 4XSZF 1MJBA 2H8WA 4IEJA 4YFNF 3HUGA 5CVVA 1JJ8C 2IP2A 1UCRA 1K61A 3ZN0A 1IGNA 2IEKA 4HBLA 3LSTA 5M3MJ 1MH3A 2OCCH 2CQNA 2K4JA 1TZLA 2VC0A 1YOVB 5DUKA 4XKVA 2IS4A 3I3LA 5ICFA 1D1BA 3BZCA 4WK8F 2NNYA 2IVMA 2K9SA 1IO2A 1ZG3A 4PJMA 4XLNF 2DT5A 5DM6F 5DM7F 2X4HA 4MFDA 4IL6C 4XOPA 3CCRI 2F2EA 3S3OA 1MKMA 4QPOA 1G3WA 4ZZDA 3TO6A 3PQJA 2M1BA 2V9VA 2UXNA 1U8BA 2CV2A 2VC1A 2ZJPF 3UR3C 4ZTFA 4RLQA 1HKSA 3CO6C 3ZQHA 4BE0A 1P92A 3K10A 4JQFA 4FCYA 3LSKA 2JA6J 2YUSA 2KDZA 4QWQA 5C44J 4NUBA 2Q8KA 5H6QA 5IP6A 2ID3A 4D1QA 1ODDA 2R7RA 1I6XA 1P9QC 1TW3A 2A61A 4LG0A 3HRMA 4DGWB 1B8IB 1IDZA 2X1EA 3F6OA 2X9DA 3KYLA 3QODA 1A36A 1O7FA 3MD2A 3ZQGA 4MEXF 1YHQI 3HGYA 2W84A 3M8FA 4L9JA 5EJCA 5BPIA 1MBFA 1IN7A 2AQEA 1XC5A 1X1CA 1MSFC 2EFOA 1QA6A 3DP7A 2MBFA 3GX4X 1U0JA 3GCMA 2DFIA 2GZWA 1D1CA 3DKWA 3QPLA 4XKWA 3MMYB 2LDUA 2ZBKA 5D8LB 5LHHA 4S05A 1JKOC 3S3MA 1WQ2A 1G4DA 5L3GA 5H6RA 4HAMA 2L02A 4Y17A 3MFKA 1LDKB 5DEQA 3OOPA 2XF6A 2O6GE 2IAIA 3FK6A 3GFMA 2M4GA 4X0GA 3CJNA 3S1QJ 1H89C 1OR7A 2GXAA 4BHCA 2CQKA 5LHIA 2LF7A 3TEDA 1MBJA 2L3DA 3O6BB 5HDNA 3JRCA 3HEFA 1LVAA 2OZUA 5FD6A 2HQAA 2V9KA 1K83J 1MJ9A 2M45A 1UJ8A 4G7HF 3K4NA 3NRVA 4RGXA 1FY7A 2NOGA 1HW1A 2RC4A 1BL0A 1OFCX 3RPUA 3WE2A 1AA7A 2NAZA 4ZC3A 3TDZC 1IUYA 1ONVA 1OCOH 3HTSB 1JHFA 1U6GA 3DCFA 4YIRX 2JJ7A 3L2VA 5FO5A 5GTHC 3PNYA 1A35A 4AIJA 4BEHA 4CH7A 2P5LC 1LKXA 1X4OA 2WTEA 3H3ZA 3AFHA 3SDGA 5LRSA 1XSDA 2FMLA 2KRFA 3ML6A 1ENHA 1SMTA 2K02A 2XIGA 3VB2A 1T0FC 3J7YJ 3LNQA 1R71A 3U9GA 2WADA 5M5WJ 5D8KB 4HSTA 3IWFA 1DQUA 2XB0X 1ZTRA 2XAQA 5J1YA 5AIPA 1J59A 2IGNA 2LLKA 3GWZA 3A03A 1R5GA 2K40A 4HQMA 4BQQA 4A69C 1MD0A 1W5TA 1V5GA 1PJRA 1SAUA 2JRTA 1JUMA 4LLGF 1GT0C 3FWEA 4Q5SF 2L9NA 5IY5H 5GAGJ 1FBSA 2CUEA 4N9IA 1K4SA 2PI0A 1HQCA 2PJRB 4RGUA 4M6XA 5JI6A 1I39A 1PUEE 1QHGA 1FTTA 5DD8A 1WZ2A 1CQTA 1RR8C 4J19A 2HR3A 1FSEA 2K85A 3HSFA 1F36A 2XASA 3DV8A 4KMFA 5DUIA 1HC8A 4P96A 3A0BC 2KDOA 1UG0A 2NNNA 3G1OA 2ZNZA 3GF2A 2FBIA 5EEHA 2H6BA 2M4KA 2LG4A 2FX0A 4XRSG 3MN2A 2HKOA 4L5JA 5HODA 2D2WA 1VQOI 2LKSA 1W36C 1IZ1A 3K4LA 2GOMA 3ERMA 2NS0A 2XKOA 4PDKA 3KZZA 1TP4A 3BR1A 4P1WA 3WGIA 3MCZA 3BCAA 2R7XA 4IKFA 1XX5A 5J40A 2ZFUA 4AIDA 2UV1A 3KEYA 2GIVA 2VJ5A 2ZJRF 3M07A 4F93B 3H92A 4D0PA 1WI9A 3HRTA 1NK2P 4YIFA 1FOXA 1IRFA 1U5TC 5HDKA 3FISA 1MNEA 2HWVA 2B63J 1LDJA 1BJZA 3BCBA 2Y30A 3DLLF 1IW7F 3WGGA 4UV9A 2TCTA 1OCTC 1ACIA 2VBXA 2MD0A 2ZXWH 4L18B 5LHGA 4HA8A 3L2CA 1S3JA 5CLSA 1KYWA 5K7HA 3CP8A 3CJRB 1PDNC 2HKXA 1YRNA 3BJ6A 3JAMZ 1USSA 1JGSA 5IT9K 3OYHA 3ERED 4CZZA 4DBQA 1Z7UA 4XLPF 1PUFB 3L09A 1FYMA 1QNTA 4XBFA 5EYRA 2DXIA 3E0JB 4A3BJ 2HNHA 3WTYC 3BQYA 3GYHX 3ZP5A 2A07F 4L0YB 3F21A 3S2DJ 2WC2A 3A2KA 4A6EA 4XIDA 3I54A 5FKNA 1VQMI 4A3KJ 2MD5A 4RGRA 3CC4I 1TBXA 1FSHA 2HYFA 2CV1A 3BOQA 2K5CA 3ZMUA 2PMHA 2HEOA 1FIPA 3GXOA 3BDDA 3RSNA 4A3EJ 2DK5A 3BG9A 1ON1A 3COAC 3HM5A 2YSRA 1U8RA 4KDPA 3WU1B 3DPLC 2QSGX 4XLEA 1SFOJ 1C0WA 4M73A 4EV0A 5LD2C 2A6TA 1RPWA 5DCMA 2V1XA 4P55A 2QA4I 2PX9A 3KLOA 3OYGA 4EM2A 5JHUA 2IS2A 4B8XA 1V5EA 3JRDA 1XB4A 2HDWA 1K7AA 1Y0UA 3BC8A 3BQZA 4XLHA 2FE3A 4BDZA 1Y1WJ 2QVOA 1D0XA 4FT8A 4ENKA 3QYEA 5FLXZ 2OTLI 3TW7A 1SFXA 4CICA 3OYCA 3E5QA 4IZZA 3OYNA 1I27A 2ME0A 2BXYA 2IGKA 5CQEA 4XKCA 2X6XA 3SHFA 2JA8J 4XM3A 4BS9A 3LSGA 2V7FA 3F23A 1PP7U 4X1EA 4IRGA 1BA5A 2ESHA 1YFHA 4XKBA 3OS1A 2V6CA 1RZ4A 1EH7A 2KLOA 4QLCU 5H20A 4CCNA 4HX8A 1W7PD 4I01A 4HSRA 1BM9A 4ETSA 1ZHFA 4HPQA 4PFPA 4C2MJ 3CTAA 2M9HA 5EGOA 5HNFA 3PQKA 3KE2A 3FXOA 2VI6A 2R5ZB 4H0EA 1KQ9A 1R7JA 1WJEA 1IXSB 4IQ4A 1J09A 3JRFA 4UVBA 2KMUA 4ITVA 3CCEI 3HDDA 3TO9A 4MQVA 1VNDA 3CCVI 3MZ8A 2R7FA 1JE8A 1KA8A 2K9LA 3ULQB 1QBJA 2QYOA 2XF7A 3OIOA 3E1SA 2XAJA 3FHNA 1WWXA 1IN4A 4X6AJ 3EUHA 2VT3A 3LAPA 1GLNA 1ZH5A 3VYTB 4DYQA 4UVCA 3OYIA 2DDAA 3V7CA 1LPQA 2H8RA 2ZJQF 4A12A 2Z3YA 4E7LA 4F55A 2IA2A 1U78A 4KIFA 2PQ8A 6PAXA 1PUFA 1G3TA 2MFZA 3K69A 2KFDA 2M7BA 3ZMZA 4HLYA 4R8HA 3ASNH 3IWZA 2PMUA 2RNJA 1Y1VJ 1S9HA 4EGYA 2NYXA 2OUMA 3SJMA 4I98B 2P8TA 1WH7A 3S17J 2AXTC 4G6TB 4O6JA 3U2RA 4A2UA 4Y13A 3IKTA 4AYBA 4PZJA 4D7NA 3FKIJ 4UHTA 3H0GJ 2K7LA 2XV4S 5L3CA 1O3RA 3HKZA 3QQAA 4BU2A 2X0LA 4G6QA 4MTDA 4LJZF 3I4MJ 2GA2A 3KETA 1IN5A 1WHUA 2VIXA 4NB5A 1Y39A 4E7JA 1LEAA 1FTZA 3QPTA 1P4WA 3ZQQA 3CCSI 2UXXA 1JKRC 4DOZA 2D5VA 2E5ZA 3HG9A 2VB6A 3ZMTA 1SFEA 2JPCA 2HPMA 3D0SA 2DMUA 5EG0B 2KJCA 5D5UB 2K3FA 1XGNA 2IXSA 2DW4A 2X1DA 4IRIA 3JRBA 1I1SA 4MQ9F 3WTSC 2XDVA 5ERIA 4OAZA 3QPHA 1G2HA 3AKZA 4XN3A 2EFWA 5FD5A 2EA2A 2Q2EA 5K5QA 3OR2C 3OYFA 3KP2A 1BI0A 5D5VB 5ICGA 4GXOA 2V1NA 3K1MA 1U9OA 2L54A 2DT7B 2WBMA 1TWCJ 1QPIA 4PJNA 1R5ID 3NQOA 2P5VA 1FJLA 2E36A 1WPKA 3G73A 3HOWJ 5K7FA 4N0BA 4LK0F 3S2HJ 3GTPJ 1ETOA 4XORA 2R7ZJ 3CUQC 1JI8A 1ZLJA 1MGTA 2DTZA 4RMNA 1JT0A 1MW7A 2ISZA 3I0TA 2HZTA 3RKWA 3RYPA 3OYMA 1RETA 3JSPA 3KPHA 4V2FA 2L4AA 4IHVA 2F4IA 5HS8A 2MYSA 4JP0A 4CDGA 4PJ0C 4D5CA 4PK4A 2CQXA 3V7RA 3S1NJ 1SD5A 3E97A 4QSHA 4U7BA 3OMYA 3AG4H 3KX2A 2F4OB 3HUGB 1XMXA 4W1UA 5FJ8J 4IOCF 2IS1A 2DA5A 5CYVA 1IV8A 5F08A 1W7PA 4MO7A 4KITB 2RDPA 3JTGA 1OKRA 2LD5A 2O8XA 3DXJF 1WJ5A 1H9TA 2GAUA 3R4KA 2OC6A 2QCOA 3VYSB 4C30A 3GUDA 4JBAA 5FKKA 4Y4RA 2RQQA 4EJOA 2ZC2A 2QZ8A 2NVXJ 5CVUA 1TWAJ 3FIWA 2YS9A 2KIFA 3GFIA 5J4YA 2NRAC 1Z05A 2JSCA 1SD4A 3EPZA 2P6TA 3FMRA 3GTMJ 1GV5A 1V55H 1HW5A 2MC3A 3MKZA 1R23A 5M5XJ 1UG2A 1N78A 2HOEA 3VSKA 2L9SA 4EQQA 3LFUA 1V5FA 2KZVA 3DTKA 4OWRB 4XK4A 3K2ZA 2CG4A 3JRGA 1VQ6I 2JZYA 1L0OC 2LBFA 2PN6A 5J4VA 1TWFJ 4LG0B 1X19A 4Y15A 4RB1A 1WGXA 2EV6A 3LAJA 2HVSA 2L7KA 3UKGA 2L7FP 4CHUA 2DN0A 2DTRA 1TL8A 3TP3A 4CZCA 1SMYF 4E7HA 3IUOA 1X1PA 5C3EJ 1FBQA 4BHBA 5FKOA 4ABZA 2PEXA 3LA3A 5D6FA 5GPCA 3U21A 4RB0A 1FT9A 3OSGA 3H3UA 3HKZN 2YX7A 1QZEA 2R7UA 2AHQA 2DODA 3G6EI 3GVAA 5JHFA 1CGPA 3OIPA 5EEGA 3V4GA 5GPAA 4UUSA 4G7ZF 3DF8A 4MFEA 1HLVA 1SC7A 5B66C 2A69F 2A68F 1OJLA 4R1HA 3BR5A 4EM1A 5IT3A 1S5LC 1SD7A 1PYVA 2WAQN 1RKTA 2GIZA 3TBIA 1BC8C 4Q4ZF 4PJLA 1VQ4I 3ABUA 1FP2A 1QRYA 1OYWA 1SD6A 3WTWC 2QGUA 1Z9CA 2NVTJ 1OCPA 4M3DA 3W6VA 3CCMI 2ELJA 4YEJA 3CUOA 3T0YA 2X51A 3SXYA 4DIQA 3OL3A 4CGZA 5TJJA 5E3OA 5LRRA 3OY9A 2WAFA 2Z1DA 2AQFA 1M1EB 1H0MA 1IJWC 2DAOA 4XICA 4EVIA 4WXHA 3BPVA 4EM0B 1ORKA 2ZCWA 3WTUC 2JPBA 4KMUX 4BL0B 3KFWX 1VQ5I 2FUG2 2JRMA 2KIUA 3PM1A 4RAYA 1V54H 4Q47A 4O5VA 2IGMA 2VPLA 3PIPF 2BY0A 1A5JA 2AXLA 2W00A 3WU0A 2DK8A 4I09A 1KQ8A 1TW2A 2OF7A 4KFCA 2BE5F 4I76A 2MLKA 4IXAA 4ON0A 1T0FA 4XN0A 3I56I 1V4RA 2GA1A 4EJTA 5AIQA 1KU7A 2HFHA 2M5WA 1T08B 1VQ9I 4ZYGA 4XLCA 3BJAA 1FLIA 5TRDA 2KZGA 1Y8RB 2G7UA 3WG9A 3ZCOA 2Z5UA 3W2WA 3S93A 4A3FJ 2ICWG 1SVOA 2DQRA 3FF5A 3HSRA 4KNYA 5A2QK 2RNGA 5E8IA 3RDIA 3FDYA 3EDPA 5E3LA 3O2PE 2E2IJ 2J5PA 2H6CA 4LOCA 3JAMK 3S1MJ 1RNLA 1U9NA 1T38A 4U87A 2K9MA 1VI0A 3Q5FA 1GHCA 3ZQIA 1HOMA 1WJFA 2JUCA 1EJ9A 3KEQA 4H4KC 5J1UA 1NG6A 3BTCA 2EH3A 3A0HC 1JUPA 4EJUA 1YJ9I 4ZYHA 1FMVA 3F3XA 2XGDA 4XOTA 5J8FA 2NS8A 2L2OA 1NHAA 5AONA 5H2FC 4BH9A 3C7JA 1YE9A 4BJ6C 5KNLA 3J81Z 2BZTA 2HXOA 2EILH 1TT0A 5J8CA 2O3FA 3F6VA 3WGHA 4NQWB 5FLVA 3TOAA 5CQGA 3IKVA 3KP5A 4B3XA 3LL7A 1ZR4A 1ZARA 1DU6A 4AM3A 3HIFA 5HLIA 3CDHA 5JVTA 1LE8A 1BI1A 1AU7A 2OZ6A 2E60A 2ZB9A 4LB6B 2HTJA 2R7QA 4I0BA 3CCUI 3LWFA 1D8JA 2VOPA 2EZIA 3IV5A 5HLGA 2LY9A 2VBZA 3I5UA 1J7KA 1F1ZA 3HHHA 4I2OA 2MGQA 2ME6A 2XSDC 1EH6A 3U1KA 3FXMA 3ABKH 1XGMA 2E7XA 2ZSHB 2DLLA 4IHXA 4KT6A 4HDVA 1B4AA 4KN7X 4M9SA 3GO5A 5E1WA 1JKQC 2BGCA 2PLYA 4M3GA 1OISA 1A31A 1WJDA 3AL0B 1P6RA 2XPUA 1U5TA 4PGHA 3G3ZA 1BIBA 3M1EA 1YIJI 3CMAI 5GP9A 3P5JA 2CO5A 2V9PA 1DU0A 3Q9SA 4ZYEA 5L3FA 4A3CJ 4ENNA 1YRNB 2M87A 4JX4A 3DBLB 4Y3OA 2EV0A 3HXLA 5JLXA 3I58A 1PP8F 1UB9A 3HRUA 4MNUA 5F64A 1SANA 2H1KA 4BY1J 3W6KB 1W0TA 2DMTA 4ZH4F 1DP7P 2LKXA 2DOEA 2FNAA 4F52A 2MSYA 2QQ9A 2LMDA 2HI3A 3E3VA 5BPDA 1RUNA 5C4XJ 1SVLA 2P5KA 3RQ4A 1XMKA 4A3MJ 5B5EC 3NEUA 2VKEA 4E4HA 2RN7A 2VKVA 2OD5A 4RBOA 3E5UA 1TWHJ 2P4WA 4UXNA 3L2RA 2JA7J 3M1CA 4RAFA 1MMAA 4IF4A 2FEZA 1YO5C 1WSUA 2V26A 3FXJA 1KU3A 1A04A 2CW8A 5LEKA 3M7GA 3H1CA 2W82A 5BOXA 3PO3J 5IOZA 3JR9A 2E1MB 4A3GJ 1NTCA 4IX7A 5DCMB 4M3EA 4FISA 4EEFG 4PSXA 5KK1A 3V8LA 2DBBA 3OS0A 2ZJ2A 3DEWA 4BBSJ 3GFJA 1YJWI 3GBGA 2OTJI 2PMZA 3BG7A 3CMYA 3HYIA 4Q48A 1X58A 2LR8A 1VQNI 5M3FJ 2L7MP 4MGRA 2ELHA 4ZJZA 2KKOA 4ZZLA 3QAHA 2BHZA 2QQ8A 3H5AA 2VQCA 3D5LA 4IHSA 2EINH 3CLQA 3BY6A 1XCVA 3LOCA 3I9V2 3S14J 3QP6A 2FRHA 3TKYA 4OMYA 3FXKA 4OIRF 2FNPA 1V3FA 1OCCH 3CF5F 1UZCA 5EF6A 2ZXIA 3MZHA 4NQWA 2CW0F 2K27A 3E5XA 3VYRB 4BBRJ 3JCUC 5EGOB 3OYKA 2UZKA 2R5YB 1WRJA 3ZQLA 2EWNA 3A02A 2C6YA 4OU0A 4L0ZB 1ZK8A 4UNOA 4A3LJ 2VQGA 3HOXJ 2CFOA 2ZXHA 2CUFA 3T8RA 4PJJA 3HZJA 3BZKA 4E7ZA 1UFMA 4RLFA 1LJ9A 2OCEA 4HNTA 5LFAA 3PFYA 2IBDA 2CQQA 1MH4A 1F9NA 2FMYA 2OV7A 2W4SA 2Y0SA 3BTJA 1P2FA 1QU3A 4M72A 1IAWA 1HW2A 1LFUP 4GO1A 2E5NA 2IA1A 3PL8A 4KISA 4C2TA 3BR2A 5FKLA 3F8FA 2Y75A 2DA2A 4BXXJ 3SZPA 2BXZA 5E3MA 3TMOA 3MZYA 1WVRA 3DU5A 1SAXA 1Z6RA 1K79A 1BC7C 2LY2A 2NVUB 2JMWA 5KAFC 4KIBA 2BVMA 3IC7A 3VWBA 1B72A 1OR7C 3WTXC 3K70D 9ANTA 3BPXA 2G9WA 2GWRA 2XSJC 5F1JA 4HEA2 4U88A 5FB2A 4Y7NJ 2D45A 3G1LA 3NWTA 1JUSA 1WJBA 1X1BA 2OQGA 5DD4A 3QWLA 5IYCJ 3GTKJ 3IRRA 3K0LA 1AKHA 1RIOH 4M9XA 2DMPA 3S32A 2VKDA 3HOYJ 4FQGA 1BOAA 4AD9A 4HW0A 1BIAA 2JTVA 1D1AA 2OQRA 4HRIA 2P0WA 2Y9YA 2CUZA 3N97A 2DA7A 2MG4A 1FX7A 4FASD 1KZHA 3REOA 1IN8A 1XS9A 1LUJB 3FBIB 5D5XB 3CMMA 4U7DA 2HDCA 1YQAA 2RVCA 3LSJA 4I02A 2XC7A 1J0RA 4DZJA 3Q0VA 3F22A 2CW7A 2HYJA 4HX7A 4XR6A 5HNHA 3RKQA 3D5SC 3A01A 1SFKA 3TW6A 4AWXB 2K9NA 3WTTC 1F5TA 3J7ZI 2Q2EB 4CCLA 5K5RA 2H94A 4ENJA 2XRLA 3RCOA 3RJPA 1E3OC 2W48A 3ZPLA 3GMEA 4V19K 1BW6A 2ZFWA 5GAHJ 4GDFA 2E35A 2L5QA 1ETKA 2FQ3A 2XGXA 4EGZA 2VQHA 2XB5A 3WHBA 2DDBA 4IO9F 1FZPB 2E19A 1LFPA 3SFZA 1LFBA 5FKMA 2R7WA 3FM5A 3A1YA 4FE7A 1HF0A 4BJ5C 2HOSA 1FEXA 1XDSA 2R5YA 1XGSA 3IHUA 4K2EA 3KYCB 5E20A 2M2EA 2PG4A 3HTUA 3CUQA 1YX3A 3LSIA 2YPRA 4L9NA 1MMSA 5E1XA 3L00A 2HTSA 5CVJA 3VSLA 5TGTA 3B6AA 1WI3A 1MIJA 2QF7A 5TISC 1FOWA 4RDUA 4D5FA 1D0YA 3DTEA 4BE2A 5J1RA 3LFKA 2E1OA 2I8DA 1TTYA 1W7PB 2FF4A 4DQ2A 5B3SH 1FIAA 2K9QA 1MSEC 1LNWA 1S7EA 2DMQA 4B48A 2DT6A 1RESA 1MMDA 1Z77A 3C2GA 1XG1A 2TDXA 4FX0A 1DPUA 1XSVA 1Y8QB 1Z67A 4CYCA 2EV5A 1YW7A 3RZOJ 3FMQA 3TQNA 2L9RA 2CS3A 1HSTA 2F5FA 5FROA 5CPRB 1ZG5A 2STWA 1NH3A 1U3EM 3SZTA 1KYZA 5FRNA 4S0HB 3IP4B 1Z91A 2O5RA 3K4JA 3ONQA 2STTA 4L9TA 3C18A 3O3KA 2CWEA 3ECHA 2UUZA 1EKEA 4WXCA 4LIVA 1ZYRF 1Q1HA 2Z33A 2O8KA 2DFFA 2NXNB 5FRMA 3FHZA 3OYAA 1VQKI 5E18F 4XQFA 3ZOBA 4OIOF 3J7AY 1YW8A 4M71A 4HYEA 1O3SA 1JXSA 4XONA 2LTPA 5JLWA 2WWYA 1IG7A 2ISYA 3DPUA 2LBFB 2E2HJ 1CF7A 4BQOA 3EUAA 4HV5A 1Z0XA 2ADUA 3SFIA 2LF8A 2YU9J 2ZMEA 4L9VA 1MNMC 3HGGA 4WCGA 4S04A 1A6IA 2HQNA 4XRFA 4GGGA 3BG6A 2Z2SB 2DCEA 1RKWA 3KYDB 4JYKA 3GTJJ 4I7HA 3GLXA 1IN6A 4M74A 4G9YA 4OINF 4LK1F 3BJOA 3K4KA 2E1MC 3GTGJ 3HC7A 4UUSB 3J80Z 3MEXA 3PUBA 1S29A 3SDBA 2FXAA 1HKTA 2F5DA 1YLFA 5B1AH 2VOOA 1S6LA 3FX3A 1ZGWA 3BTIA 2KJBA 2LK2A 1H9GA 5ILVA 1LVKA 3DBHB
chains in the Genus database with same CATH topology
3OL3A 1YX5A 2X6WA 3AFHA 2R4GA 3OY9A 3G2BA 2WAFA 2R7VA 2JVGA 2Z1DA 2AQFA 1T0FC 2VJJA 3QOEA 2WADA 3V42A 4J01A 4MLOA 4BL0B 3K4CA 4HSTA 3L2QA 1DQUA 1NG7A 2FUG2 2BW3A 3EUKL 2IGNA 2IGMA 2V6EA 2VPLA 3DU6A 2W00A 2PJRA 4IQJA 4BQQA 1HA8A 4J00A 1V5GA 1PJRA 2BW3B 3QYBA 1SAUA 4XN0A 2LRDA 2L9NA 2KL4A 4E7KA 1WJAA 4II2A 5HOOA 3H9GA 2PJRB 5KHDA 4XLCA 4NC7A 1QHGA 1Y6IA 2KPMA 3W2WA 3ZCOA 3S93A 2VJIA 4BUPA 4ANJA 3TL4X 2VL8A 1DGRM 2JUGA 4ZDOA 2KDOA 2RNGA 4P5OA 1UG0A 3FDYA 2LREA 4B47A 2UWMA 2M4KA 2LG4A 3PJRA 1W36C 4U87A 2K9MA 4HNUA 3K4LA 1WJFA 2GOMA 4RM3A 4H4KC 3EUHC 1NG6A 1FMVA 1G59A 4XOTA 4BXFA 1W36D 2L2OA 2WY7Q 3H0DA 4P1WA 5KNLA 1WJCA 1YE9A 4BJ6C 3IAM2 3BCAA 2R7XA 1TT0A 4IKFA 4RM2A 3AL0C 4NQWB 3VDXA 5CQGA 2ZFUA 2UV1A 3KEYA 3LL7A 4B3XA 2VJ5A 1R6RA 3HL2A 4F93B 3MKWB 1Z3YA 3ZRGA 2ZSIB 4GRIA 3K6GA 2E60A 1MNEA 1MNDA 2R7QA 3ZGKA 3BCBA 2CH0A 4N4NB 2MD0A 3A4CA 2ZSHB 4KT6A 3CP8A 2QKMB 3CJRB 3D5RC 4ZDPA 3OYDA 1ZELA 3W2AA 2LH9A 4CA0A 3LSMA 1WJDA 3LMMA 3AL0B 3OYHA 4DBQA 3SZGA 3HPGA 2DXIA 4N4OB 3CJQB 3E0JB 2BOLA 2VKHA 2HNHA 2KP6A 4XNFA 3L2UA 4HG2A 4Y3OA 3CF2A 3W2VA 1Y56A 3HXLA 1BR2A 3A2KA 4YELA 2VJ4A 1VZ0A 4NC8A 2R7OA 2WAQA 2A5WA 4F52A 2CV1A 4F3QA 1Z21A 2K5CA 1QHHD 3FBNB 4II3A 4PFOA 3RQ4A 2HVQA 4BJTA 3HOTA 3RSNA 4E4HA 2HZDA 3HPHA 1UAAA 4BDYA 3L2RA 1FMWA 3DPLC 1BR4A 4XLEA 3M1CA 2JSPA 5LD2C 4DIQA 2A6TA 3UNGC 1MMAA 2V26A 1G8XA 3OYLA 1UELB 2CW8A 3OYGA 2IS2A 2M0MA 2W82A 2Z16A 1V5EA 2HDWA 4PSWA 1BR1A 2WB1A 2NOJB 1OLTA 3BC8A 4XLHA 2E1MB 4IX7A 4OAYA 4BDZA 2VQLA 1D0XA 4PSXA 3QYEA 3W3CA 2BVLA 4C9YA 3OS0A 3CESA 3OYCA 3GBGA 4YRVA 2WY8Q 2XF5A 4IZZA 2PMZA 3OYNA 3BG7A 1DGWY 2IGKA 5CQEA 2GOXB 4XKCA 2X6XA 2M3AA 4ZJZA 2JA2A 4XM3A 3RTRA 4BS9A 3F9KA 2V7FA 3LSGA 4CCOA 3H5AA 2VQCA 3D5LA 4XKBA 3OS1A 2KLOA 3I9V2 4BGDA 3CP2A 3S3NA 3OIQA 4CCNA 3DKYA 3DWLE 1WFXA 3OOUA 4HSRA 2VASA 3DEEA 4HPQA 4PFPA 3M8JA 5HNFA 2ZXIA 3BLYA 3N05A 3H35A 1X4PA 2HU9A 3OL4A 3VYRB 1WJEA 2MABA 3PSFA 4IQ4A 3VYUB 1J09A 4XMYA 3OYEA 2F6CA 3OYKA 4CCJA 2KMUA 4ITVA 3PNTA 2K9LA 2XF7A 3E1SA 2VQGA 4BE1A 2CFOA 2R7SA 2ZXHA 3FHNA 3DPTA 3MKYB 4DBRA 4B43A 4PJJA 2LY1A 3SEZA 4E7ZA 5LFAA 4RLFA 4HNTA 1GLNA 3PFYA 3VYTB 2M7AA 3S8PA 2OV7A 2W4SA 2Y0SA 3OYIA 2R7TA 1QU3A 4E7LA 1DP3A 4F55A 2VLAA 2E5NA 3PL8A 2V4JC 4KISA 4C2TA 1N77A 4CSWA 2MFZA 3NWSA 2CV0A 2M7BA 3TMOA 3DU5A 3LSHA 4C2UA 3K70C 2KHMA 2LY2A 2KRHA 1S9HA 4B44A 4PUSA 2OUMA 2BVMA 3DLAA 4ZDLA 4G6TB 3VWBA 1OR7C 3K70D 4AYBA 3K4BA 5HVQC 4E7IA 4EATA 2X85A 2XSJC 2IS6A 3HKZA 1X1AA 4HEA2 4XL9A 4BU2A 3NWTA 2HVRA 1WJBA 1X1BA 3FKJA 1MMGA 4LIUA 3ZXSA 2W1OA 2LC2A 2VIXA 4CCKA 2KQRA 4E7JA 5CKTA 4LG3A 3ZQQA 2VXZA 2K3PA 4DOZA 2E5ZA 3QYFA 3S32A 3HG9A 2VKDA 2VB6A 3CZ6A 3H9JA 3L2WA 3DKXA 4AVZA 4CCMA 2HPMA 2X6YA 1EA3A 2DJIA 1D1AA 3RPUD 4HRIA 2P0WA 3OYBA 2CUZA 4DJAA 1IRXA 2IXSA 2W7NA 4FETA 2X1DA 4ZTJA 2VXDA 4FASD 2XDVA 4Y33A 2HPIA 3FBIB 4XLFA 3CMMA 2CMPA 4OAZA 4XLAA 3IAS2 3AKZA 2XAUA 4XN3A 2XC7A 3H9QA 3OR2C 2CW7A 2LOOA 4XR6A 4F91B 5HNHA 3OYFA 3HOSA 3D5SC 3OWTA 4F92B 1SFKA 2V1NA 4D9JA 2DT7B 2WBMA 4E6KG 4CUGA 1T95A 2Q2EB 4CCLA 1X1DA 4PJNA 3PNVA 4R79A 3RCOA 3H5NA 4BEHB 1K6YA 1MMNA 3DQVC 4LITA 3OYJA 4XORA 3OR1C 1JI8A 2L5QA 2IGOA 2X1CA 2MC4A 4RMNA 1MW7A 2VQHA 3K4MA 3ZR8X 3OYMA 1LFPA 1ERDA 2R7WA 2F4IA 3A1YA 2MYSA 3DTIA 4BJ5C 4PK4A 1BOBA 4U7BA 3OMYA 1TZLA 3KX2A 3HUGB 4XKVA 1YX3A 3LSIA 2IS4A 3I3LA 2IS1A 1D1BA 4KITB 3VSLA 5TGTA 4PJMA 1WJ5A 4XOPA 3S3OA 2WA0A 4KJZA 1D0YA 3DTEA 2OC6A 4QPOA 4BE2A 2I8DA 3VYSB 4C30A 2CV2A 2RREA 4B48A 2DT6A 3UR3C 4Y4RA 4ZTFA 1MMDA 2RQQA 3C2GA 4RLQA 4BE0A 5HLTA 1E0EA 3K10A 4JQFA 3LSKA 3C2HA 4NUBA 4ZYAA 2CS3A 5FROA 3EPZA 5CPRB 4AU7A 5FRNA 4D1QA 3IP4B 3SYTA 2O5RA 3K4JA 3ONQA 2R7RA 4JOMA 1P9QC 4DGWB 3MKZA 1Z7LA 2X1EA 3KYLA 1N78A 2UUZA 3QODA 3VSKA 2L9SA 3MD2A 3LFUA 4LIVA 1V5FA 2KZVA 3DTKA 4OWRB 2WAEA 2AQEA 5FRMA 2LBFA 3OYAA 1N75A 1Z3XA 1X19A 1X1CA 4XQFA 2HVSA 2L7KA 3J7AY 1U0JA 1D1CA 4XKWA 4XONA 3MMYB 4CZCA 4E7HA 3IUOA 3S3MA 1KONA 3DPUA 2LBFB 4BQOA 4QPQA 3EUAA 5KCMA 3U21A 2KRCA 1LDKB 4E7SA 2XF6A 2R7UA 3PSIA 2CUJA 3BG6A 2Z2SB 3SEQA 5JHFA 2DCEA 2M4GA 3OIPA 4X0GA 2JVHA 4BACA 3K4KA 2HQAA 1PYVA 2V9KA 2E1MC 3H5RA 3K4NA 3TBIA 3HC7A 4PJLA 3PUBA 2QKLB 3SDBA 3OS2A 1AA7A 4ZC3A 2F5VA 2Q1ZB 4NNJA 3L2VA 2DOAA 1D0ZA 3PNYA 2ELJA 4YEJA 4BQNA 2X51A 4BEHA 4CH7A 2LYCA 1LKXA 1X4OA 1LVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XF5 A;  2XF7 A;  2XF6 A; 
#chains in the Genus database with same CATH topology
 1YX5 A;  1RRJ A;  2IW5 A;  5DDG A;  5J3L A;  2FOW A;  4IPA A;  1W4M A;  2F48 A;  2R7V A;  4B3A A;  2EJR A;  2VJJ A;  3VOD A;  5JFR A;  3J7A O;  3QOE A;  1TLH B;  1DPR A;  1AWC A;  3V42 A;  3IL2 A;  1E3P A;  1XMA A;  1NG7 A;  2BW3 A;  3G1M A;  2M34 A;  3EUK L;  2F5E A;  5IT9 Z;  2Y69 H;  2V6E A;  2IJL A;  2M8G X;  4P9U A;  4XRM A;  1O4X A;  3DU6 A;  4DZP A;  1APL C;  1T56 A;  1HA8 A;  3CDI A;  4HF2 A;  2B9S A;  1PVE A;  2LRD A;  2KL4 A;  2CU7 A;  4E7K A;  3T5X A;  1WJA A;  5HOO A;  5KHD A;  3OSF A;  2DYR H;  2VN2 A;  4NC7 A;  1MDM B;  1Y6I A;  2KPM A;  4NHJ A;  4AIH A;  4BUP A;  2VJI A;  1YS7 A;  3TL4 X;  2BBY A;  3MKL A;  2DI3 A;  1DGR M;  1TWG J;  1O7L A;  2A3S A;  2JUG A;  2OAZ A;  2BY1 A;  4PGG A;  2LRE A;  2JT1 A;  1LEB A;  4IJA A;  1OPC A;  5ICC A;  4DYR A;  1ZGA A;  4RM3 A;  3ZQF A;  3EUH C;  5E1Z B;  2JWT A;  4CO8 A;  3B02 A;  1W36 D;  2WY7 Q;  1G3Y A;  2DOF A;  4FE4 A;  2P7C B;  2QEX I;  1QVU A;  3ROU A;  3V8J A;  1WJC A;  2QUF A;  3IAM 2;  3I59 A;  4RGS A;  1QGP A;  1W5S A;  1XCB A;  2XKP A;  2GBY A;  4YFK F;  4I6Z A;  1SEU A;  3PO2 J;  2VON A;  2BEO A;  1R6R A;  5DTD A;  4RB2 C;  1FWZ A;  1Z3Y A;  3ZRG A;  2A6H F;  2ZSI B;  4GRI A;  3V7S A;  1F43 A;  3QPS A;  3K6G A;  4C3I J;  2ELK A;  4ASN A;  1XPX A;  2HQR A;  1MND A;  5FGM A;  3ZGK A;  3WHC A;  2G0E A;  2ZKZ A;  1KU2 A;  1ETV A;  1LE8 B;  3C1D A;  5E79 C;  3ABL H;  2QBY B;  3HSE A;  4N4N B;  2X6O A;  3QRF F;  3MVP A;  4ZDP A;  2QKM B;  3C3W A;  3D5R C;  3ISP A;  4AYB N;  4ESF A;  1ITY A;  3OYD A;  1ZEL A;  2JQ7 A;  3W2A A;  3LSM A;  4Y52 J;  3LMM A;  2OBP A;  1TC3 C;  2FJ1 A;  1R58 A;  4LD5 A;  5IP9 J;  3RI4 A;  4AUX A;  1AHD P;  1S72 I;  5LGT A;  2KP6 A;  4HZF A;  2YU3 A;  1P4X A;  4HG2 A;  1U5T B;  3CF2 A;  1D3Y A;  1S7A A;  5F0F A;  3D1N I;  2E71 A;  2DA3 A;  2MA3 A;  3I71 A;  3GTL J;  3FZV A;  3O8G A;  5CVR A;  3EET A;  4BXU A;  2NS7 A;  4NC8 A;  1ETY A;  2R7O A;  3KCC A;  3MQ0 A;  1NK3 P;  1W1W E;  1XTA A;  4B1R A;  4EMS A;  2DA4 A;  4CXF A;  1QHH D;  3FBN B;  3Q0U A;  4II3 A;  3CME I;  2DPD A;  4PFO A;  2HVQ A;  3ZMS A;  2EB7 A;  4BJT A;  3HOT A;  4ESB A;  2HZD A;  4BDY A;  2H27 A;  2W24 A;  3FM3 A;  5L3B A;  4C3H J;  1BR4 A;  4KUM A;  2L01 A;  2JSP A;  1JGG A;  3UNG C;  2CRG A;  3OYL A;  3DBR B;  2Z9O A;  2EZK A;  5ICE A;  3KP3 A;  4I0A A;  2Z16 A;  2QWW A;  1BR1 A;  1D5V A;  2NOJ B;  1OLT A;  4IRH A;  5HS9 A;  4RA2 A;  2NVY J;  1ULY A;  4RAG A;  1HDP A;  4XSX F;  1YTY A;  2BVL A;  2HS5 A;  2W57 A;  5J47 A;  4FTH A;  1ZR2 A;  1MDM A;  1OMI A;  2D1H A;  3DFG A;  2WY8 Q;  5LBQ A;  4B09 A;  2XF5 A;  4GYI A;  5GAD J;  1K78 A;  1X2M A;  1DGW Y;  4JX5 A;  2GOX B;  3S2W A;  3V8K A;  4M3F A;  3JSO A;  2JA2 A;  5K1Y A;  3RTR A;  2VE8 A;  4CCO A;  3BG3 A;  1BN5 A;  2P7V B;  2H1L A;  4BGD A;  5D5W B;  1B9M A;  3S3N A;  5ILU A;  4UVA A;  4U0Y A;  4IHW A;  2R92 J;  1E17 A;  3DWL E;  4JX6 A;  1WFX A;  3OOU A;  2AO9 A;  2VAS A;  4DW6 A;  5D4R A;  3PIO F;  3M8J A;  2MLG A;  4UY8 I;  3CDL A;  3HHG A;  3GEZ A;  3BLY A;  4OOI A;  5ED4 A;  1R4N B;  3F8N A;  1ZLK A;  1OYY A;  3H35 A;  3ESW B;  3WE3 A;  3BR0 A;  2HU9 A;  1ZQ3 P;  3B6C A;  2MAB A;  3R60 A;  3VYU B;  4W97 A;  1BW5 A;  3MWM A;  1YJN I;  3U1D A;  3G71 I;  4BE1 A;  1IRG A;  3MKY B;  3L7W A;  3S16 J;  5DV5 A;  4AC0 A;  2FBK A;  3B73 A;  3SEZ A;  3T8T A;  4BYY A;  3CCL I;  3FK7 A;  3BR6 A;  2LKP A;  2QBY A;  3WG7 H;  3S8P A;  3ZQ7 A;  1EV7 A;  3AG3 H;  1D5Y A;  1IDY A;  5K7Z A;  3KP4 A;  4RAZ A;  5F0H A;  3TO7 A;  2R7T A;  3GZN B;  2P81 A;  4AIK A;  1DP3 A;  1R00 A;  3L1P A;  3JRI A;  1EF4 A;  2V4J C;  3VPR A;  5LEJ A;  3R6S A;  2EFN A;  4Z6Y A;  3G4S I;  1N77 A;  4CSW A;  1FYK A;  2CV0 A;  1R22 A;  3LSH A;  5EDN A;  4WF2 A;  3ZMD A;  2ZNY A;  3N4M A;  4BQA A;  2RGV A;  2KRH A;  2GM4 A;  2R93 J;  2L4M A;  3KP7 A;  1Y0N A;  1ZAO A;  5J6X A;  5FLX K;  3K4B A;  2JA5 J;  4EAT A;  2X85 A;  2IS6 A;  4HNV A;  1X1A A;  4XL9 A;  5D4S A;  1YW9 A;  2BY2 A;  3FKJ A;  4LIU A;  1MMG A;  5KVR A;  3WTZ A;  3ZXS A;  2CGP A;  2LC2 A;  3I53 A;  1B72 B;  1J9I A;  3H36 A;  1JT6 A;  4LG3 A;  2CYY A;  2V79 A;  3F8M A;  2GXB A;  1POG A;  2K3P A;  3LSP A;  3EQL F;  2XGC A;  4F7Z A;  1G6N A;  1BBY A;  3CZ6 A;  4HV6 A;  3L2W A;  3DKX A;  5F04 A;  2GLO A;  2X6Y A;  4ZYD A;  2O03 A;  3DEU A;  1R1T A;  1AKH B;  3OYB A;  4V2G A;  1IRX A;  4DJA A;  4A0Z A;  2W7N A;  4FET A;  4ZTJ A;  2VXD A;  3CCJ I;  4Y33 A;  1H88 C;  3I4P A;  4XLF A;  3GLL A;  2CMP A;  5E8G A;  3LA7 A;  1YS6 A;  1XGO A;  5IPA A;  2ACJ A;  3H9Q A;  2LOO A;  2BV6 A;  3HOS A;  1G3S A;  2DFH A;  2DMN A;  3OWT A;  2FSW A;  2R0Q C;  3CC2 I;  2DQL A;  1YYV A;  4D9J A;  4E6K G;  3EYY A;  2XRO A;  2Y9Z A;  4B4C A;  1X1D A;  3RQI A;  3PNV A;  2O9L A;  4R79 A;  3A01 B;  2OU2 A;  3K1P A;  1QPM A;  2JK3 A;  5M5Y J;  1FBU A;  3H5N A;  3BWG A;  1MMN A;  1T6S A;  2XHK A;  4LIT A;  3OYJ A;  1FNN A;  4QTR A;  1GXP A;  1OQY A;  1OYI A;  2IGO A;  3AAF A;  3OV8 A;  3ZN1 A;  2IT0 A;  1KQ0 A;  3K4M A;  3ZR8 X;  4BAY A;  1U2W A;  3QOP A;  2XAH A;  3WOD F;  1R5H A;  1ETX A;  2EK5 A;  2DPU A;  1ERD A;  3Q3S A;  2LP0 A;  3DTI A;  4E70 A;  1TQM A;  2MH9 A;  3H3V K;  4M6Y A;  1BOB A;  4N9H A;  3PFI A;  2VBY A;  3KLN A;  1ETW A;  1QZY A;  5K5O A;  1T39 A;  3R0A A;  1TQI A;  5ILS A;  5FFZ A;  2XPW A;  3M4O J;  2L0K A;  3WTV C;  4LFU A;  3P9I A;  4A0X A;  1REP C;  2VUM J;  1T98 A;  4L5I A;  4UV8 A;  2RV8 A;  2WA0 A;  3CUQ B;  4KJZ A;  3CCQ I;  3HOV J;  3LQQ A;  3E6C C;  4YFX F;  1XDU A;  2F4M B;  3CLO A;  2E1C A;  2RRE A;  1I5Z A;  1IXC A;  4A93 J;  3BG5 A;  2CQ7 A;  1UHM A;  3ASO H;  1JJ6 C;  5HLT A;  1XN7 A;  1IRZ A;  1E0E A;  3VFZ A;  1B8I A;  2K4B A;  1GDT A;  3C2H A;  5L3E A;  4ZYA A;  3W6J B;  1HBX G;  1TNT A;  5HS7 A;  2H09 A;  4UUT A;  4AU7 A;  1IF1 A;  3SYT A;  4CYC B;  4IHY A;  1R4M B;  4JOM A;  3HRS A;  1Z7L A;  3J80 K;  4C3J J;  5EEA A;  4UUV A;  1MBK A;  1O3Q A;  5DCF A;  5E17 F;  2QEN A;  2WAE A;  4FX4 A;  1ZRE A;  4OIQ F;  2KIS A;  2VBW A;  2XVC A;  1QVT A;  1J75 A;  2Z99 A;  1N75 A;  1Z3X A;  1SFU A;  4RS8 A;  1I3Q J;  1B1B A;  2EIM H;  4YII A;  4FHT A;  2DJN A;  4LLL A;  4QIW N;  1TT5 B;  3KZY A;  3I55 I;  5DYM A;  4JK1 X;  1A6Q A;  2QLZ A;  2E7W A;  4MEY F;  1KON A;  4A6D A;  5A2Q Z;  1QO0 D;  2ZO4 A;  1MZB A;  3I64 A;  4QPQ A;  5KCM A;  4A0Y A;  4RB3 C;  2W25 A;  4HF0 A;  2A5Y B;  1I3A A;  2KRC A;  4E7S A;  2QSF X;  1OCZ H;  4G8X A;  1YIT I;  2DYS H;  3PSI A;  4HDU A;  2CUJ A;  2ETH A;  2EBI A;  3SEQ A;  1CF7 B;  3ELK A;  1FPQ A;  2DA1 A;  3F72 A;  2LFB A;  2JVH A;  4MTE A;  1P4A A;  4HOB A;  4BAC A;  2VPR A;  2ZME B;  2BHY A;  1WCM J;  4G94 A;  2M8E A;  2A05 A;  2Y2Z A;  2M30 A;  1P7I A;  3LA2 A;  2CFX A;  2FBH A;  3H5R A;  1QZZ A;  4LMY A;  4KYW A;  3HJE A;  1YI2 I;  5F27 A;  2QKL B;  1W5C C;  3OS2 A;  1FOK A;  5F0C A;  2F5V A;  2Q1Z B;  4NNJ A;  1RC9 A;  1VQ7 I;  2DOA A;  1D0Z A;  1R49 A;  4BQN A;  3CJT B;  2FOK A;  5F6F A;  2LYC A;  2VT2 A;  1R36 A;  1BI3 A;  2X6W A;  2R4G A;  2WV1 A;  2L9V A;  5EZH A;  3G2B A;  4TV7 A;  2V1U A;  3BP8 A;  1Z6T A;  2NVQ J;  2JVG A;  2RKH A;  5FLM J;  3KP6 A;  1D8K A;  3HB9 A;  1QQI A;  3FXR A;  4J01 A;  4MLO A;  2QQA A;  3K4C A;  3L2Q A;  4WX9 A;  1HXD A;  1UMQ A;  4L5E A;  1JHH A;  2EZL A;  2Q0O A;  4GYG A;  2PMZ N;  3S1R J;  1FOY A;  2ECC A;  1VF9 A;  3HOZ J;  2PJR A;  4IQJ A;  3FXQ A;  4G12 A;  4A3J J;  4J00 A;  4M3B A;  2BW3 B;  1N25 A;  2B0L A;  1IUF A;  1X3W B;  3QYB A;  3Q0W A;  1KU9 A;  2K86 A;  4CYD A;  4II2 A;  3H9G A;  3L9F A;  1I6H J;  1WKM A;  2I5U A;  1R9T J;  3RKX A;  3BRO A;  1MBE A;  4ANJ A;  2VL8 A;  4LB5 A;  1ON2 A;  1R1U A;  3T1B A;  4WXD A;  1ZKG A;  1IXR C;  5IYB J;  4ZDO A;  2KT0 A;  4AVP A;  3MAJ A;  4P5O A;  2EFP A;  4NC6 A;  4B47 A;  3GTO J;  2UWM A;  3PJR A;  4HX4 A;  5LGU A;  4UB6 C;  5GAE J;  4HNU A;  4U0W A;  1MBG A;  4HF1 A;  1R1V A;  2G7H A;  2HGC A;  4A5M A;  1RUO A;  3NAU A;  1G59 A;  4BXF A;  3R61 A;  3P9K A;  2AS5 F;  3H0D A;  5BMZ A;  2A6E F;  4M6V A;  5C4J J;  1VQ8 I;  2O61 A;  3KZI C;  2X48 A;  4RM2 A;  3IH4 A;  4XRS A;  2V1D A;  4M9Z A;  3AL0 C;  3BT9 A;  3VDX A;  4OIP F;  2HOA A;  1OCR H;  2DFE A;  3HL2 A;  2P6S A;  2Y0S N;  2HOT A;  1YG2 A;  1XD7 A;  2COM A;  3MKW B;  5IP7 J;  3PUF A;  1I50 J;  3I59 B;  4IVN A;  1W0U A;  4HLX A;  3M9A A;  1VQP I;  2ESN A;  1VQL I;  1KGS A;  1X2N A;  2CH0 A;  4KIG A;  2CSO A;  3LSR A;  1ZRD A;  3NAR A;  2LSO A;  3A4C A;  4BHP A;  5LGN A;  3CD6 I;  4OMZ A;  3F8B A;  2EFQ A;  2MH2 A;  3ECO A;  1UHS A;  2WV0 A;  3F0C A;  3S15 J;  1FC3 A;  2LH9 A;  4CA0 A;  5EZG A;  1FYL A;  3GW2 A;  2EPF A;  3SZG A;  3HPG A;  2Y0M A;  1T2K A;  4LGW A;  5DS9 A;  4N4O B;  3CJQ B;  3JRE A;  1Z1D A;  3K2A A;  2BOL A;  2VKH A;  1E3H A;  4XNF A;  5FFX A;  3L2U A;  2N8G A;  1E2X A;  4GFB A;  1L3L A;  1LQ1 A;  3W2V A;  1Y56 A;  3JW4 A;  2F5C A;  1BR2 A;  2HYG D;  2DA6 A;  4YEL A;  2XGE A;  2VJ4 A;  1BI2 A;  4MHG A;  1YIO A;  4DNC A;  1HKQ A;  2GQQ A;  1VZ0 A;  5BNG A;  1T33 A;  3QU6 A;  2FQ4 A;  2VOD A;  2XAF A;  3TDU C;  2O7O A;  4A3D J;  2WAQ A;  3LQR A;  2A5W A;  1B6A A;  3E7L A;  1J2X A;  1RI7 A;  5HDG A;  1TNS A;  1Z21 A;  4F3Q A;  1STZ A;  2KIQ A;  2RQP A;  2KIM A;  1BJA A;  1X3U A;  1RR7 A;  3HPH A;  1UAA A;  1FMW A;  3CO7 C;  4NDL A;  2R3S A;  4I99 C;  2OJE D;  3I4N J;  3RPQ A;  2OA4 A;  3O8H A;  1G8X A;  2E34 A;  1UEL B;  2FD5 A;  3R0J A;  3QP5 A;  2J5O A;  2M0M A;  1HCR A;  4PSW A;  3J81 K;  1I1G A;  2WB1 A;  2RAE A;  4G6D A;  4G7O F;  3GTQ J;  4OAY A;  4GCV A;  2VQL A;  2CJJ A;  3JRH A;  3C2B A;  4Z2Y A;  3CC7 I;  3RIR A;  4YG2 F;  3W3C A;  3HBL A;  3VOE A;  4C9Y A;  5L3D A;  1F4K A;  1JTX A;  3CES A;  1ZRF A;  3F8C A;  4YRV A;  2PJP A;  1GUU A;  3TOB A;  5B1B H;  4NBQ A;  2XAG A;  2OPT A;  3X2Q H;  3TGN A;  2M3A A;  1ZGJ A;  3F9K A;  4P9F A;  4D7M A;  3RZD J;  1VFC A;  2YX4 A;  2W85 A;  1T8I A;  1JTY A;  1K78 B;  2DU9 A;  3RYR A;  2EA4 A;  3CP2 A;  3KIO A;  2HQ5 A;  4U0V A;  3OIQ A;  3DKY A;  2R5Z A;  4KA4 A;  3FMS A;  2HDD A;  1P7J A;  3JRA A;  3DEE A;  2L7Z A;  1Q1V A;  2I10 A;  4BNC A;  1H8A C;  1K4T A;  2ZXJ A;  3N05 A;  5F1R A;  1X4P A;  1WH5 A;  3QU3 A;  3K1N A;  2VE9 A;  3OL4 A;  1HSJ A;  3PSF A;  3OYE A;  4XMY A;  2F6C A;  4CCJ A;  1GVJ A;  2HXI A;  3PNT A;  3RKY A;  1J5Y A;  5BS6 A;  2R7D A;  5CVI A;  1MJA A;  3BZ6 A;  3JTH A;  3Q9V A;  2R7S A;  3DPT A;  3E6M A;  3CCY A;  4B43 A;  4DBR A;  1GXQ A;  3P7N A;  2LY1 A;  3E6B A;  3ZMV A;  3FXU A;  1GVD A;  3FXL A;  2M7A A;  2O0Y A;  2Y31 A;  2E1N A;  3VEP A;  1UST A;  1TQP A;  3K9T A;  4KT5 C;  3EYI A;  2FU4 A;  2VLA A;  2LNB A;  1JKP C;  1IV6 A;  1ZRC A;  3ABT A;  3NWS A;  4EJV A;  1ZN2 A;  4EJW A;  3P9C A;  1IC8 A;  2BY3 A;  1DUX C;  5LLQ A;  4C2U A;  2IA0 A;  2ZME C;  3K70 C;  2KHM A;  1S7O A;  4UB8 C;  3WU2 C;  4B44 A;  3E6D A;  4PUS A;  3DLA A;  3IH2 A;  4ZDL A;  3IRQ A;  4ESJ A;  1O3T A;  1O57 A;  1K6O A;  5HVQ C;  5E3N A;  4BKX A;  4E7I A;  2MW8 A;  3GZ5 A;  1X3Z B;  5D6E A;  5JR3 A;  1FP1 D;  2YR2 A;  4IOA F;  2HVR A;  3GZ6 A;  4HQE A;  2FA5 A;  4PCQ A;  2W1O A;  5BQT A;  4CCK A;  5EG0 A;  2ECB A;  2KQR A;  5IYD J;  3GFL A;  2JN6 A;  5CKT A;  4WWC A;  1ZG1 A;  3HOU J;  5GTI C;  2VXZ A;  3AG1 H;  2BYV E;  2IPQ X;  3K7A J;  1S8N A;  2LVS A;  3QYF A;  2ID6 A;  4O3M A;  2XPV A;  3H9J A;  5CJ9 A;  4CCM A;  2M0C A;  4AVZ A;  3ABM H;  1EA3 A;  1MBH A;  2DJI A;  2EIJ H;  4IHT A;  3RPU D;  4ENM A;  3M3Y J;  2B7E A;  2GXG A;  4A3I J;  2PFB A;  3TP0 A;  2HPI A;  2EQR A;  4XLA A;  2TRT A;  3IAS 2;  2XAU A;  1GV2 A;  2COB A;  1HDD C;  1SVM A;  3CQZ J;  2EIK H;  2PBI A;  2XUB A;  4F91 B;  1XSX A;  1DDN A;  2E2J J;  3SQN A;  1UHW A;  3BTL A;  4F92 B;  1ETQ A;  1AOY A;  1B59 A;  4KIC A;  2D1V A;  2IRF G;  1LDD A;  4KN4 X;  4CUG A;  1T95 A;  3KEO A;  2XRN A;  1LB2 A;  2DO7 A;  2QM3 A;  2QQB A;  4MIM A;  5HLH A;  2WB1 N;  3IH3 A;  3AG2 H;  5KAI C;  4BEH B;  3ZQC A;  1K6Y A;  1VTN C;  4A5N A;  4DYC A;  3DQV C;  4LLN A;  4BY7 J;  1EH8 A;  2QSH X;  2Y48 A;  3OR1 C;  5IOY A;  3BR3 A;  3M8E A;  1B9N A;  2X1C A;  5JVG F;  2EZH A;  2MC4 A;  4XSZ F;  1MJB A;  2H8W A;  4IEJ A;  4YFN F;  3HUG A;  5CVV A;  1JJ8 C;  2IP2 A;  1UCR A;  1K61 A;  3ZN0 A;  1IGN A;  2IEK A;  4HBL A;  3LST A;  5M3M J;  1MH3 A;  2OCC H;  2CQN A;  2K4J A;  1TZL A;  2VC0 A;  1YOV B;  5DUK A;  4XKV A;  2IS4 A;  3I3L A;  5ICF A;  1D1B A;  3BZC A;  4WK8 F;  2NNY A;  2IVM A;  2K9S A;  1IO2 A;  1ZG3 A;  4PJM A;  4XLN F;  2DT5 A;  5DM6 F;  5DM7 F;  2X4H A;  4MFD A;  4IL6 C;  4XOP A;  3CCR I;  2F2E A;  3S3O A;  1MKM A;  4QPO A;  1G3W A;  4ZZD A;  3TO6 A;  3PQJ A;  2M1B A;  2V9V A;  2UXN A;  1U8B A;  2CV2 A;  2VC1 A;  2ZJP F;  3UR3 C;  4ZTF A;  4RLQ A;  1HKS A;  3CO6 C;  3ZQH A;  4BE0 A;  1P92 A;  3K10 A;  4JQF A;  4FCY A;  3LSK A;  2JA6 J;  2YUS A;  2KDZ A;  4QWQ A;  5C44 J;  4NUB A;  2Q8K A;  5H6Q A;  5IP6 A;  2ID3 A;  4D1Q A;  1ODD A;  2R7R A;  1I6X A;  1P9Q C;  1TW3 A;  2A61 A;  4LG0 A;  3HRM A;  4DGW B;  1B8I B;  1IDZ A;  2X1E A;  3F6O A;  2X9D A;  3KYL A;  3QOD A;  1A36 A;  1O7F A;  3MD2 A;  3ZQG A;  4MEX F;  1YHQ I;  3HGY A;  2W84 A;  3M8F A;  4L9J A;  5EJC A;  5BPI A;  1MBF A;  1IN7 A;  2AQE A;  1XC5 A;  1X1C A;  1MSF C;  2EFO A;  1QA6 A;  3DP7 A;  2MBF A;  3GX4 X;  1U0J A;  3GCM A;  2DFI A;  2GZW A;  1D1C A;  3DKW A;  3QPL A;  4XKW A;  3MMY B;  2LDU A;  2ZBK A;  5D8L B;  5LHH A;  4S05 A;  1JKO C;  3S3M A;  1WQ2 A;  1G4D A;  5L3G A;  5H6R A;  4HAM A;  2L02 A;  4Y17 A;  3MFK A;  1LDK B;  5DEQ A;  3OOP A;  2XF6 A;  2O6G E;  2IAI A;  3FK6 A;  3GFM A;  2M4G A;  4X0G A;  3CJN A;  3S1Q J;  1H89 C;  1OR7 A;  2GXA A;  4BHC A;  2CQK A;  5LHI A;  2LF7 A;  3TED A;  1MBJ A;  2L3D A;  3O6B B;  5HDN A;  3JRC A;  3HEF A;  1LVA A;  2OZU A;  5FD6 A;  2HQA A;  2V9K A;  1K83 J;  1MJ9 A;  2M45 A;  1UJ8 A;  4G7H F;  3K4N A;  3NRV A;  4RGX A;  1FY7 A;  2NOG A;  1HW1 A;  2RC4 A;  1BL0 A;  1OFC X;  3RPU A;  3WE2 A;  1AA7 A;  2NAZ A;  4ZC3 A;  3TDZ C;  1IUY A;  1ONV A;  1OCO H;  3HTS B;  1JHF A;  1U6G A;  3DCF A;  4YIR X;  2JJ7 A;  3L2V A;  5FO5 A;  5GTH C;  3PNY A;  1A35 A;  4AIJ A;  4BEH A;  4CH7 A;  2P5L C;  1LKX A;  1X4O A;  2WTE A;  3H3Z A;  3AFH A;  3SDG A;  5LRS A;  1XSD A;  2FML A;  2KRF A;  3ML6 A;  1ENH A;  1SMT A;  2K02 A;  2XIG A;  3VB2 A;  1T0F C;  3J7Y J;  3LNQ A;  1R71 A;  3U9G A;  2WAD A;  5M5W J;  5D8K B;  4HST A;  3IWF A;  1DQU A;  2XB0 X;  1ZTR A;  2XAQ A;  5J1Y A;  5AIP A;  1J59 A;  2IGN A;  2LLK A;  3GWZ A;  3A03 A;  1R5G A;  2K40 A;  4HQM A;  4BQQ A;  4A69 C;  1MD0 A;  1W5T A;  1V5G A;  1PJR A;  1SAU A;  2JRT A;  1JUM A;  4LLG F;  1GT0 C;  3FWE A;  4Q5S F;  2L9N A;  5IY5 H;  5GAG J;  1FBS A;  2CUE A;  4N9I A;  1K4S A;  2PI0 A;  1HQC A;  2PJR B;  4RGU A;  4M6X A;  5JI6 A;  1I39 A;  1PUE E;  1QHG A;  1FTT A;  5DD8 A;  1WZ2 A;  1CQT A;  1RR8 C;  4J19 A;  2HR3 A;  1FSE A;  2K85 A;  3HSF A;  1F36 A;  2XAS A;  3DV8 A;  4KMF A;  5DUI A;  1HC8 A;  4P96 A;  3A0B C;  2KDO A;  1UG0 A;  2NNN A;  3G1O A;  2ZNZ A;  3GF2 A;  2FBI A;  5EEH A;  2H6B A;  2M4K A;  2LG4 A;  2FX0 A;  4XRS G;  3MN2 A;  2HKO A;  4L5J A;  5HOD A;  2D2W A;  1VQO I;  2LKS A;  1W36 C;  1IZ1 A;  3K4L A;  2GOM A;  3ERM A;  2NS0 A;  2XKO A;  4PDK A;  3KZZ A;  1TP4 A;  3BR1 A;  4P1W A;  3WGI A;  3MCZ A;  3BCA A;  2R7X A;  4IKF A;  1XX5 A;  5J40 A;  2ZFU A;  4AID A;  2UV1 A;  3KEY A;  2GIV A;  2VJ5 A;  2ZJR F;  3M07 A;  4F93 B;  3H92 A;  4D0P A;  1WI9 A;  3HRT A;  1NK2 P;  4YIF A;  1FOX A;  1IRF A;  1U5T C;  5HDK A;  3FIS A;  1MNE A;  2HWV A;  2B63 J;  1LDJ A;  1BJZ A;  3BCB A;  2Y30 A;  3DLL F;  1IW7 F;  3WGG A;  4UV9 A;  2TCT A;  1OCT C;  1ACI A;  2VBX A;  2MD0 A;  2ZXW H;  4L18 B;  5LHG A;  4HA8 A;  3L2C A;  1S3J A;  5CLS A;  1KYW A;  5K7H A;  3CP8 A;  3CJR B;  1PDN C;  2HKX A;  1YRN A;  3BJ6 A;  3JAM Z;  1USS A;  1JGS A;  5IT9 K;  3OYH A;  3ERE D;  4CZZ A;  4DBQ A;  1Z7U A;  4XLP F;  1PUF B;  3L09 A;  1FYM A;  1QNT A;  4XBF A;  5EYR A;  2DXI A;  3E0J B;  4A3B J;  2HNH A;  3WTY C;  3BQY A;  3GYH X;  3ZP5 A;  2A07 F;  4L0Y B;  3F21 A;  3S2D J;  2WC2 A;  3A2K A;  4A6E A;  4XID A;  3I54 A;  5FKN A;  1VQM I;  4A3K J;  2MD5 A;  4RGR A;  3CC4 I;  1TBX A;  1FSH A;  2HYF A;  2CV1 A;  3BOQ A;  2K5C A;  3ZMU A;  2PMH A;  2HEO A;  1FIP A;  3GXO A;  3BDD A;  3RSN A;  4A3E J;  2DK5 A;  3BG9 A;  1ON1 A;  3COA C;  3HM5 A;  2YSR A;  1U8R A;  4KDP A;  3WU1 B;  3DPL C;  2QSG X;  4XLE A;  1SFO J;  1C0W A;  4M73 A;  4EV0 A;  5LD2 C;  2A6T A;  1RPW A;  5DCM A;  2V1X A;  4P55 A;  2QA4 I;  2PX9 A;  3KLO A;  3OYG A;  4EM2 A;  5JHU A;  2IS2 A;  4B8X A;  1V5E A;  3JRD A;  1XB4 A;  2HDW A;  1K7A A;  1Y0U A;  3BC8 A;  3BQZ A;  4XLH A;  2FE3 A;  4BDZ A;  1Y1W J;  2QVO A;  1D0X A;  4FT8 A;  4ENK A;  3QYE A;  5FLX Z;  2OTL I;  3TW7 A;  1SFX A;  4CIC A;  3OYC A;  3E5Q A;  4IZZ A;  3OYN A;  1I27 A;  2ME0 A;  2BXY A;  2IGK A;  5CQE A;  4XKC A;  2X6X A;  3SHF A;  2JA8 J;  4XM3 A;  4BS9 A;  3LSG A;  2V7F A;  3F23 A;  1PP7 U;  4X1E A;  4IRG A;  1BA5 A;  2ESH A;  1YFH A;  4XKB A;  3OS1 A;  2V6C A;  1RZ4 A;  1EH7 A;  2KLO A;  4QLC U;  5H20 A;  4CCN A;  4HX8 A;  1W7P D;  4I01 A;  4HSR A;  1BM9 A;  4ETS A;  1ZHF A;  4HPQ A;  4PFP A;  4C2M J;  3CTA A;  2M9H A;  5EGO A;  5HNF A;  3PQK A;  3KE2 A;  3FXO A;  2VI6 A;  2R5Z B;  4H0E A;  1KQ9 A;  1R7J A;  1WJE A;  1IXS B;  4IQ4 A;  1J09 A;  3JRF A;  4UVB A;  2KMU A;  4ITV A;  3CCE I;  3HDD A;  3TO9 A;  4MQV A;  1VND A;  3CCV I;  3MZ8 A;  2R7F A;  1JE8 A;  1KA8 A;  2K9L A;  3ULQ B;  1QBJ A;  2QYO A;  2XF7 A;  3OIO A;  3E1S A;  2XAJ A;  3FHN A;  1WWX A;  1IN4 A;  4X6A J;  3EUH A;  2VT3 A;  3LAP A;  1GLN A;  1ZH5 A;  3VYT B;  4DYQ A;  4UVC A;  3OYI A;  2DDA A;  3V7C A;  1LPQ A;  2H8R A;  2ZJQ F;  4A12 A;  2Z3Y A;  4E7L A;  4F55 A;  2IA2 A;  1U78 A;  4KIF A;  2PQ8 A;  6PAX A;  1PUF A;  1G3T A;  2MFZ A;  3K69 A;  2KFD A;  2M7B A;  3ZMZ A;  4HLY A;  4R8H A;  3ASN H;  3IWZ A;  2PMU A;  2RNJ A;  1Y1V J;  1S9H A;  4EGY A;  2NYX A;  2OUM A;  3SJM A;  4I98 B;  2P8T A;  1WH7 A;  3S17 J;  2AXT C;  4G6T B;  4O6J A;  3U2R A;  4A2U A;  4Y13 A;  3IKT A;  4AYB A;  4PZJ A;  4D7N A;  3FKI J;  4UHT A;  3H0G J;  2K7L A;  2XV4 S;  5L3C A;  1O3R A;  3HKZ A;  3QQA A;  4BU2 A;  2X0L A;  4G6Q A;  4MTD A;  4LJZ F;  3I4M J;  2GA2 A;  3KET A;  1IN5 A;  1WHU A;  2VIX A;  4NB5 A;  1Y39 A;  4E7J A;  1LEA A;  1FTZ A;  3QPT A;  1P4W A;  3ZQQ A;  3CCS I;  2UXX A;  1JKR C;  4DOZ A;  2D5V A;  2E5Z A;  3HG9 A;  2VB6 A;  3ZMT A;  1SFE A;  2JPC A;  2HPM A;  3D0S A;  2DMU A;  5EG0 B;  2KJC A;  5D5U B;  2K3F A;  1XGN A;  2IXS A;  2DW4 A;  2X1D A;  4IRI A;  3JRB A;  1I1S A;  4MQ9 F;  3WTS C;  2XDV A;  5ERI A;  4OAZ A;  3QPH A;  1G2H A;  3AKZ A;  4XN3 A;  2EFW A;  5FD5 A;  2EA2 A;  2Q2E A;  5K5Q A;  3OR2 C;  3OYF A;  3KP2 A;  1BI0 A;  5D5V B;  5ICG A;  4GXO A;  2V1N A;  3K1M A;  1U9O A;  2L54 A;  2DT7 B;  2WBM A;  1TWC J;  1QPI A;  4PJN A;  1R5I D;  3NQO A;  2P5V A;  1FJL A;  2E36 A;  1WPK A;  3G73 A;  3HOW J;  5K7F A;  4N0B A;  4LK0 F;  3S2H J;  3GTP J;  1ETO A;  4XOR A;  2R7Z J;  3CUQ C;  1JI8 A;  1ZLJ A;  1MGT A;  2DTZ A;  4RMN A;  1JT0 A;  1MW7 A;  2ISZ A;  3I0T A;  2HZT A;  3RKW A;  3RYP A;  3OYM A;  1RET A;  3JSP A;  3KPH A;  4V2F A;  2L4A A;  4IHV A;  2F4I A;  5HS8 A;  2MYS A;  4JP0 A;  4CDG A;  4PJ0 C;  4D5C A;  4PK4 A;  2CQX A;  3V7R A;  3S1N J;  1SD5 A;  3E97 A;  4QSH A;  4U7B A;  3OMY A;  3AG4 H;  3KX2 A;  2F4O B;  3HUG B;  1XMX A;  4W1U A;  5FJ8 J;  4IOC F;  2IS1 A;  2DA5 A;  5CYV A;  1IV8 A;  5F08 A;  1W7P A;  4MO7 A;  4KIT B;  2RDP A;  3JTG A;  1OKR A;  2LD5 A;  2O8X A;  3DXJ F;  1WJ5 A;  1H9T A;  2GAU A;  3R4K A;  2OC6 A;  2QCO A;  3VYS B;  4C30 A;  3GUD A;  4JBA A;  5FKK A;  4Y4R A;  2RQQ A;  4EJO A;  2ZC2 A;  2QZ8 A;  2NVX J;  5CVU A;  1TWA J;  3FIW A;  2YS9 A;  2KIF A;  3GFI A;  5J4Y A;  2NRA C;  1Z05 A;  2JSC A;  1SD4 A;  3EPZ A;  2P6T A;  3FMR A;  3GTM J;  1GV5 A;  1V55 H;  1HW5 A;  2MC3 A;  3MKZ A;  1R23 A;  5M5X J;  1UG2 A;  1N78 A;  2HOE A;  3VSK A;  2L9S A;  4EQQ A;  3LFU A;  1V5F A;  2KZV A;  3DTK A;  4OWR B;  4XK4 A;  3K2Z A;  2CG4 A;  3JRG A;  1VQ6 I;  2JZY A;  1L0O C;  2LBF A;  2PN6 A;  5J4V A;  1TWF J;  4LG0 B;  1X19 A;  4Y15 A;  4RB1 A;  1WGX A;  2EV6 A;  3LAJ A;  2HVS A;  2L7K A;  3UKG A;  2L7F P;  4CHU A;  2DN0 A;  2DTR A;  1TL8 A;  3TP3 A;  4CZC A;  1SMY F;  4E7H A;  3IUO A;  1X1P A;  5C3E J;  1FBQ A;  4BHB A;  5FKO A;  4ABZ A;  2PEX A;  3LA3 A;  5D6F A;  5GPC A;  3U21 A;  4RB0 A;  1FT9 A;  3OSG A;  3H3U A;  3HKZ N;  2YX7 A;  1QZE A;  2R7U A;  2AHQ A;  2DOD A;  3G6E I;  3GVA A;  5JHF A;  1CGP A;  3OIP A;  5EEG A;  3V4G A;  5GPA A;  4UUS A;  4G7Z F;  3DF8 A;  4MFE A;  1HLV A;  1SC7 A;  5B66 C;  2A69 F;  2A68 F;  1OJL A;  4R1H A;  3BR5 A;  4EM1 A;  5IT3 A;  1S5L C;  1SD7 A;  1PYV A;  2WAQ N;  1RKT A;  2GIZ A;  3TBI A;  1BC8 C;  4Q4Z F;  4PJL A;  1VQ4 I;  3ABU A;  1FP2 A;  1QRY A;  1OYW A;  1SD6 A;  3WTW C;  2QGU A;  1Z9C A;  2NVT J;  1OCP A;  4M3D A;  3W6V A;  3CCM I;  2ELJ A;  4YEJ A;  3CUO A;  3T0Y A;  2X51 A;  3SXY A;  4DIQ A;  3OL3 A;  4CGZ A;  5TJJ A;  5E3O A;  5LRR A;  3OY9 A;  2WAF A;  2Z1D A;  2AQF A;  1M1E B;  1H0M A;  1IJW C;  2DAO A;  4XIC A;  4EVI A;  4WXH A;  3BPV A;  4EM0 B;  1ORK A;  2ZCW A;  3WTU C;  2JPB A;  4KMU X;  4BL0 B;  3KFW X;  1VQ5 I;  2FUG 2;  2JRM A;  2KIU A;  3PM1 A;  4RAY A;  1V54 H;  4Q47 A;  4O5V A;  2IGM A;  2VPL A;  3PIP F;  2BY0 A;  1A5J A;  2AXL A;  2W00 A;  3WU0 A;  2DK8 A;  4I09 A;  1KQ8 A;  1TW2 A;  2OF7 A;  4KFC A;  2BE5 F;  4I76 A;  2MLK A;  4IXA A;  4ON0 A;  1T0F A;  4XN0 A;  3I56 I;  1V4R A;  2GA1 A;  4EJT A;  5AIQ A;  1KU7 A;  2HFH A;  2M5W A;  1T08 B;  1VQ9 I;  4ZYG A;  4XLC A;  3BJA A;  1FLI A;  5TRD A;  2KZG A;  1Y8R B;  2G7U A;  3WG9 A;  3ZCO A;  2Z5U A;  3W2W A;  3S93 A;  4A3F J;  2ICW G;  1SVO A;  2DQR A;  3FF5 A;  3HSR A;  4KNY A;  5A2Q K;  2RNG A;  5E8I A;  3RDI A;  3FDY A;  3EDP A;  5E3L A;  3O2P E;  2E2I J;  2J5P A;  2H6C A;  4LOC A;  3JAM K;  3S1M J;  1RNL A;  1U9N A;  1T38 A;  4U87 A;  2K9M A;  1VI0 A;  3Q5F A;  1GHC A;  3ZQI A;  1HOM A;  1WJF A;  2JUC A;  1EJ9 A;  3KEQ A;  4H4K C;  5J1U A;  1NG6 A;  3BTC A;  2EH3 A;  3A0H C;  1JUP A;  4EJU A;  1YJ9 I;  4ZYH A;  1FMV A;  3F3X A;  2XGD A;  4XOT A;  5J8F A;  2NS8 A;  2L2O A;  1NHA A;  5AON A;  5H2F C;  4BH9 A;  3C7J A;  1YE9 A;  4BJ6 C;  5KNL A;  3J81 Z;  2BZT A;  2HXO A;  2EIL H;  1TT0 A;  5J8C A;  2O3F A;  3F6V A;  3WGH A;  4NQW B;  5FLV A;  3TOA A;  5CQG A;  3IKV A;  3KP5 A;  4B3X A;  3LL7 A;  1ZR4 A;  1ZAR A;  1DU6 A;  4AM3 A;  3HIF A;  5HLI A;  3CDH A;  5JVT A;  1LE8 A;  1BI1 A;  1AU7 A;  2OZ6 A;  2E60 A;  2ZB9 A;  4LB6 B;  2HTJ A;  2R7Q A;  4I0B A;  3CCU I;  3LWF A;  1D8J A;  2VOP A;  2EZI A;  3IV5 A;  5HLG A;  2LY9 A;  2VBZ A;  3I5U A;  1J7K A;  1F1Z A;  3HHH A;  4I2O A;  2MGQ A;  2ME6 A;  2XSD C;  1EH6 A;  3U1K A;  3FXM A;  3ABK H;  1XGM A;  2E7X A;  2ZSH B;  2DLL A;  4IHX A;  4KT6 A;  4HDV A;  1B4A A;  4KN7 X;  4M9S A;  3GO5 A;  5E1W A;  1JKQ C;  2BGC A;  2PLY A;  4M3G A;  1OIS A;  1A31 A;  1WJD A;  3AL0 B;  1P6R A;  2XPU A;  1U5T A;  4PGH A;  3G3Z A;  1BIB A;  3M1E A;  1YIJ I;  3CMA I;  5GP9 A;  3P5J A;  2CO5 A;  2V9P A;  1DU0 A;  3Q9S A;  4ZYE A;  5L3F A;  4A3C J;  4ENN A;  1YRN B;  2M87 A;  4JX4 A;  3DBL B;  4Y3O A;  2EV0 A;  3HXL A;  5JLX A;  3I58 A;  1PP8 F;  1UB9 A;  3HRU A;  4MNU A;  5F64 A;  1SAN A;  2H1K A;  4BY1 J;  3W6K B;  1W0T A;  2DMT A;  4ZH4 F;  1DP7 P;  2LKX A;  2DOE A;  2FNA A;  4F52 A;  2MSY A;  2QQ9 A;  2LMD A;  2HI3 A;  3E3V A;  5BPD A;  1RUN A;  5C4X J;  1SVL A;  2P5K A;  3RQ4 A;  1XMK A;  4A3M J;  5B5E C;  3NEU A;  2VKE A;  4E4H A;  2RN7 A;  2VKV A;  2OD5 A;  4RBO A;  3E5U A;  1TWH J;  2P4W A;  4UXN A;  3L2R A;  2JA7 J;  3M1C A;  4RAF A;  1MMA A;  4IF4 A;  2FEZ A;  1YO5 C;  1WSU A;  2V26 A;  3FXJ A;  1KU3 A;  1A04 A;  2CW8 A;  5LEK A;  3M7G A;  3H1C A;  2W82 A;  5BOX A;  3PO3 J;  5IOZ A;  3JR9 A;  2E1M B;  4A3G J;  1NTC A;  4IX7 A;  5DCM B;  4M3E A;  4FIS A;  4EEF G;  4PSX A;  5KK1 A;  3V8L A;  2DBB A;  3OS0 A;  2ZJ2 A;  3DEW A;  4BBS J;  3GFJ A;  1YJW I;  3GBG A;  2OTJ I;  2PMZ A;  3BG7 A;  3CMY A;  3HYI A;  4Q48 A;  1X58 A;  2LR8 A;  1VQN I;  5M3F J;  2L7M P;  4MGR A;  2ELH A;  4ZJZ A;  2KKO A;  4ZZL A;  3QAH A;  2BHZ A;  2QQ8 A;  3H5A A;  2VQC A;  3D5L A;  4IHS A;  2EIN H;  3CLQ A;  3BY6 A;  1XCV A;  3LOC A;  3I9V 2;  3S14 J;  3QP6 A;  2FRH A;  3TKY A;  4OMY A;  3FXK A;  4OIR F;  2FNP A;  1V3F A;  1OCC H;  3CF5 F;  1UZC A;  5EF6 A;  2ZXI A;  3MZH A;  4NQW A;  2CW0 F;  2K27 A;  3E5X A;  3VYR B;  4BBR J;  3JCU C;  5EGO B;  3OYK A;  2UZK A;  2R5Y B;  1WRJ A;  3ZQL A;  2EWN A;  3A02 A;  2C6Y A;  4OU0 A;  4L0Z B;  1ZK8 A;  4UNO A;  4A3L J;  2VQG A;  3HOX J;  2CFO A;  2ZXH A;  2CUF A;  3T8R A;  4PJJ A;  3HZJ A;  3BZK A;  4E7Z A;  1UFM A;  4RLF A;  1LJ9 A;  2OCE A;  4HNT A;  5LFA A;  3PFY A;  2IBD A;  2CQQ A;  1MH4 A;  1F9N A;  2FMY A;  2OV7 A;  2W4S A;  2Y0S A;  3BTJ A;  1P2F A;  1QU3 A;  4M72 A;  1IAW A;  1HW2 A;  1LFU P;  4GO1 A;  2E5N A;  2IA1 A;  3PL8 A;  4KIS A;  4C2T A;  3BR2 A;  5FKL A;  3F8F A;  2Y75 A;  2DA2 A;  4BXX J;  3SZP A;  2BXZ A;  5E3M A;  3TMO A;  3MZY A;  1WVR A;  3DU5 A;  1SAX A;  1Z6R A;  1K79 A;  1BC7 C;  2LY2 A;  2NVU B;  2JMW A;  5KAF C;  4KIB A;  2BVM A;  3IC7 A;  3VWB A;  1B72 A;  1OR7 C;  3WTX C;  3K70 D;  9ANT A;  3BPX A;  2G9W A;  2GWR A;  2XSJ C;  5F1J A;  4HEA 2;  4U88 A;  5FB2 A;  4Y7N J;  2D45 A;  3G1L A;  3NWT A;  1JUS A;  1WJB A;  1X1B A;  2OQG A;  5DD4 A;  3QWL A;  5IYC J;  3GTK J;  3IRR A;  3K0L A;  1AKH A;  1RIO H;  4M9X A;  2DMP A;  3S32 A;  2VKD A;  3HOY J;  4FQG A;  1BOA A;  4AD9 A;  4HW0 A;  1BIA A;  2JTV A;  1D1A A;  2OQR A;  4HRI A;  2P0W A;  2Y9Y A;  2CUZ A;  3N97 A;  2DA7 A;  2MG4 A;  1FX7 A;  4FAS D;  1KZH A;  3REO A;  1IN8 A;  1XS9 A;  1LUJ B;  3FBI B;  5D5X B;  3CMM A;  4U7D A;  2HDC A;  1YQA A;  2RVC A;  3LSJ A;  4I02 A;  2XC7 A;  1J0R A;  4DZJ A;  3Q0V A;  3F22 A;  2CW7 A;  2HYJ A;  4HX7 A;  4XR6 A;  5HNH A;  3RKQ A;  3D5S C;  3A01 A;  1SFK A;  3TW6 A;  4AWX B;  2K9N A;  3WTT C;  1F5T A;  3J7Z I;  2Q2E B;  4CCL A;  5K5R A;  2H94 A;  4ENJ A;  2XRL A;  3RCO A;  3RJP A;  1E3O C;  2W48 A;  3ZPL A;  3GME A;  4V19 K;  1BW6 A;  2ZFW A;  5GAH J;  4GDF A;  2E35 A;  2L5Q A;  1ETK A;  2FQ3 A;  2XGX A;  4EGZ A;  2VQH A;  2XB5 A;  3WHB A;  2DDB A;  4IO9 F;  1FZP B;  2E19 A;  1LFP A;  3SFZ A;  1LFB A;  5FKM A;  2R7W A;  3FM5 A;  3A1Y A;  4FE7 A;  1HF0 A;  4BJ5 C;  2HOS A;  1FEX A;  1XDS A;  2R5Y A;  1XGS A;  3IHU A;  4K2E A;  3KYC B;  5E20 A;  2M2E A;  2PG4 A;  3HTU A;  3CUQ A;  1YX3 A;  3LSI A;  2YPR A;  4L9N A;  1MMS A;  5E1X A;  3L00 A;  2HTS A;  5CVJ A;  3VSL A;  5TGT A;  3B6A A;  1WI3 A;  1MIJ A;  2QF7 A;  5TIS C;  1FOW A;  4RDU A;  4D5F A;  1D0Y A;  3DTE A;  4BE2 A;  5J1R A;  3LFK A;  2E1O A;  2I8D A;  1TTY A;  1W7P B;  2FF4 A;  4DQ2 A;  5B3S H;  1FIA A;  2K9Q A;  1MSE C;  1LNW A;  1S7E A;  2DMQ A;  4B48 A;  2DT6 A;  1RES A;  1MMD A;  1Z77 A;  3C2G A;  1XG1 A;  2TDX A;  4FX0 A;  1DPU A;  1XSV A;  1Y8Q B;  1Z67 A;  4CYC A;  2EV5 A;  1YW7 A;  3RZO J;  3FMQ A;  3TQN A;  2L9R A;  2CS3 A;  1HST A;  2F5F A;  5FRO A;  5CPR B;  1ZG5 A;  2STW A;  1NH3 A;  1U3E M;  3SZT A;  1KYZ A;  5FRN A;  4S0H B;  3IP4 B;  1Z91 A;  2O5R A;  3K4J A;  3ONQ A;  2STT A;  4L9T A;  3C18 A;  3O3K A;  2CWE A;  3ECH A;  2UUZ A;  1EKE A;  4WXC A;  4LIV A;  1ZYR F;  1Q1H A;  2Z33 A;  2O8K A;  2DFF A;  2NXN B;  5FRM A;  3FHZ A;  3OYA A;  1VQK I;  5E18 F;  4XQF A;  3ZOB A;  4OIO F;  3J7A Y;  1YW8 A;  4M71 A;  4HYE A;  1O3S A;  1JXS A;  4XON A;  2LTP A;  5JLW A;  2WWY A;  1IG7 A;  2ISY A;  3DPU A;  2LBF B;  2E2H J;  1CF7 A;  4BQO A;  3EUA A;  4HV5 A;  1Z0X A;  2ADU A;  3SFI A;  2LF8 A;  2YU9 J;  2ZME A;  4L9V A;  1MNM C;  3HGG A;  4WCG A;  4S04 A;  1A6I A;  2HQN A;  4XRF A;  4GGG A;  3BG6 A;  2Z2S B;  2DCE A;  1RKW A;  3KYD B;  4JYK A;  3GTJ J;  4I7H A;  3GLX A;  1IN6 A;  4M74 A;  4G9Y A;  4OIN F;  4LK1 F;  3BJO A;  3K4K A;  2E1M C;  3GTG J;  3HC7 A;  4UUS B;  3J80 Z;  3MEX A;  3PUB A;  1S29 A;  3SDB A;  2FXA A;  1HKT A;  2F5D A;  1YLF A;  5B1A H;  2VOO A;  1S6L A;  3FX3 A;  1ZGW A;  3BTI A;  2KJB A;  2LK2 A;  1H9G A;  5ILV A;  1LVK A;  3DBH B; 
#chains in the Genus database with same CATH homology
 3OL3 A;  1YX5 A;  2X6W A;  3AFH A;  2R4G A;  3OY9 A;  3G2B A;  2WAF A;  2R7V A;  2JVG A;  2Z1D A;  2AQF A;  1T0F C;  2VJJ A;  3QOE A;  2WAD A;  3V42 A;  4J01 A;  4MLO A;  4BL0 B;  3K4C A;  4HST A;  3L2Q A;  1DQU A;  1NG7 A;  2FUG 2;  2BW3 A;  3EUK L;  2IGN A;  2IGM A;  2V6E A;  2VPL A;  3DU6 A;  2W00 A;  2PJR A;  4IQJ A;  4BQQ A;  1HA8 A;  4J00 A;  1V5G A;  1PJR A;  2BW3 B;  3QYB A;  1SAU A;  4XN0 A;  2LRD A;  2L9N A;  2KL4 A;  4E7K A;  1WJA A;  4II2 A;  5HOO A;  3H9G A;  2PJR B;  5KHD A;  4XLC A;  4NC7 A;  1QHG A;  1Y6I A;  2KPM A;  3W2W A;  3ZCO A;  3S93 A;  2VJI A;  4BUP A;  4ANJ A;  3TL4 X;  2VL8 A;  1DGR M;  2JUG A;  4ZDO A;  2KDO A;  2RNG A;  4P5O A;  1UG0 A;  3FDY A;  2LRE A;  4B47 A;  2UWM A;  2M4K A;  2LG4 A;  3PJR A;  1W36 C;  4U87 A;  2K9M A;  4HNU A;  3K4L A;  1WJF A;  2GOM A;  4RM3 A;  4H4K C;  3EUH C;  1NG6 A;  1FMV A;  1G59 A;  4XOT A;  4BXF A;  1W36 D;  2L2O A;  2WY7 Q;  3H0D A;  4P1W A;  5KNL A;  1WJC A;  1YE9 A;  4BJ6 C;  3IAM 2;  3BCA A;  2R7X A;  1TT0 A;  4IKF A;  4RM2 A;  3AL0 C;  4NQW B;  3VDX A;  5CQG A;  2ZFU A;  2UV1 A;  3KEY A;  3LL7 A;  4B3X A;  2VJ5 A;  1R6R A;  3HL2 A;  4F93 B;  3MKW B;  1Z3Y A;  3ZRG A;  2ZSI B;  4GRI A;  3K6G A;  2E60 A;  1MNE A;  1MND A;  2R7Q A;  3ZGK A;  3BCB A;  2CH0 A;  4N4N B;  2MD0 A;  3A4C A;  2ZSH B;  4KT6 A;  3CP8 A;  2QKM B;  3CJR B;  3D5R C;  4ZDP A;  3OYD A;  1ZEL A;  3W2A A;  2LH9 A;  4CA0 A;  3LSM A;  1WJD A;  3LMM A;  3AL0 B;  3OYH A;  4DBQ A;  3SZG A;  3HPG A;  2DXI A;  4N4O B;  3CJQ B;  3E0J B;  2BOL A;  2VKH A;  2HNH A;  2KP6 A;  4XNF A;  3L2U A;  4HG2 A;  4Y3O A;  3CF2 A;  3W2V A;  1Y56 A;  3HXL A;  1BR2 A;  3A2K A;  4YEL A;  2VJ4 A;  1VZ0 A;  4NC8 A;  2R7O A;  2WAQ A;  2A5W A;  4F52 A;  2CV1 A;  4F3Q A;  1Z21 A;  2K5C A;  1QHH D;  3FBN B;  4II3 A;  4PFO A;  3RQ4 A;  2HVQ A;  4BJT A;  3HOT A;  3RSN A;  4E4H A;  2HZD A;  3HPH A;  1UAA A;  4BDY A;  3L2R A;  1FMW A;  3DPL C;  1BR4 A;  4XLE A;  3M1C A;  2JSP A;  5LD2 C;  4DIQ A;  2A6T A;  3UNG C;  1MMA A;  2V26 A;  1G8X A;  3OYL A;  1UEL B;  2CW8 A;  3OYG A;  2IS2 A;  2M0M A;  2W82 A;  2Z16 A;  1V5E A;  2HDW A;  4PSW A;  1BR1 A;  2WB1 A;  2NOJ B;  1OLT A;  3BC8 A;  4XLH A;  2E1M B;  4IX7 A;  4OAY A;  4BDZ A;  2VQL A;  1D0X A;  4PSX A;  3QYE A;  3W3C A;  2BVL A;  4C9Y A;  3OS0 A;  3CES A;  3OYC A;  3GBG A;  4YRV A;  2WY8 Q;  2XF5 A;  4IZZ A;  2PMZ A;  3OYN A;  3BG7 A;  1DGW Y;  2IGK A;  5CQE A;  2GOX B;  4XKC A;  2X6X A;  2M3A A;  4ZJZ A;  2JA2 A;  4XM3 A;  3RTR A;  4BS9 A;  3F9K A;  2V7F A;  3LSG A;  4CCO A;  3H5A A;  2VQC A;  3D5L A;  4XKB A;  3OS1 A;  2KLO A;  3I9V 2;  4BGD A;  3CP2 A;  3S3N A;  3OIQ A;  4CCN A;  3DKY A;  3DWL E;  1WFX A;  3OOU A;  4HSR A;  2VAS A;  3DEE A;  4HPQ A;  4PFP A;  3M8J A;  5HNF A;  2ZXI A;  3BLY A;  3N05 A;  3H35 A;  1X4P A;  2HU9 A;  3OL4 A;  3VYR B;  1WJE A;  2MAB A;  3PSF A;  4IQ4 A;  3VYU B;  1J09 A;  4XMY A;  3OYE A;  2F6C A;  3OYK A;  4CCJ A;  2KMU A;  4ITV A;  3PNT A;  2K9L A;  2XF7 A;  3E1S A;  2VQG A;  4BE1 A;  2CFO A;  2R7S A;  2ZXH A;  3FHN A;  3DPT A;  3MKY B;  4DBR A;  4B43 A;  4PJJ A;  2LY1 A;  3SEZ A;  4E7Z A;  5LFA A;  4RLF A;  4HNT A;  1GLN A;  3PFY A;  3VYT B;  2M7A A;  3S8P A;  2OV7 A;  2W4S A;  2Y0S A;  3OYI A;  2R7T A;  1QU3 A;  4E7L A;  1DP3 A;  4F55 A;  2VLA A;  2E5N A;  3PL8 A;  2V4J C;  4KIS A;  4C2T A;  1N77 A;  4CSW A;  2MFZ A;  3NWS A;  2CV0 A;  2M7B A;  3TMO A;  3DU5 A;  3LSH A;  4C2U A;  3K70 C;  2KHM A;  2LY2 A;  2KRH A;  1S9H A;  4B44 A;  4PUS A;  2OUM A;  2BVM A;  3DLA A;  4ZDL A;  4G6T B;  3VWB A;  1OR7 C;  3K70 D;  4AYB A;  3K4B A;  5HVQ C;  4E7I A;  4EAT A;  2X85 A;  2XSJ C;  2IS6 A;  3HKZ A;  1X1A A;  4HEA 2;  4XL9 A;  4BU2 A;  3NWT A;  2HVR A;  1WJB A;  1X1B A;  3FKJ A;  1MMG A;  4LIU A;  3ZXS A;  2W1O A;  2LC2 A;  2VIX A;  4CCK A;  2KQR A;  4E7J A;  5CKT A;  4LG3 A;  3ZQQ A;  2VXZ A;  2K3P A;  4DOZ A;  2E5Z A;  3QYF A;  3S32 A;  3HG9 A;  2VKD A;  2VB6 A;  3CZ6 A;  3H9J A;  3L2W A;  3DKX A;  4AVZ A;  4CCM A;  2HPM A;  2X6Y A;  1EA3 A;  2DJI A;  1D1A A;  3RPU D;  4HRI A;  2P0W A;  3OYB A;  2CUZ A;  4DJA A;  1IRX A;  2IXS A;  2W7N A;  4FET A;  2X1D A;  4ZTJ A;  2VXD A;  4FAS D;  2XDV A;  4Y33 A;  2HPI A;  3FBI B;  4XLF A;  3CMM A;  2CMP A;  4OAZ A;  4XLA A;  3IAS 2;  3AKZ A;  2XAU A;  4XN3 A;  2XC7 A;  3H9Q A;  3OR2 C;  2CW7 A;  2LOO A;  4XR6 A;  4F91 B;  5HNH A;  3OYF A;  3HOS A;  3D5S C;  3OWT A;  4F92 B;  1SFK A;  2V1N A;  4D9J A;  2DT7 B;  2WBM A;  4E6K G;  4CUG A;  1T95 A;  2Q2E B;  4CCL A;  1X1D A;  4PJN A;  3PNV A;  4R79 A;  3RCO A;  3H5N A;  4BEH B;  1K6Y A;  1MMN A;  3DQV C;  4LIT A;  3OYJ A;  4XOR A;  3OR1 C;  1JI8 A;  2L5Q A;  2IGO A;  2X1C A;  2MC4 A;  4RMN A;  1MW7 A;  2VQH A;  3K4M A;  3ZR8 X;  3OYM A;  1LFP A;  1ERD A;  2R7W A;  2F4I A;  3A1Y A;  2MYS A;  3DTI A;  4BJ5 C;  4PK4 A;  1BOB A;  4U7B A;  3OMY A;  1TZL A;  3KX2 A;  3HUG B;  4XKV A;  1YX3 A;  3LSI A;  2IS4 A;  3I3L A;  2IS1 A;  1D1B A;  4KIT B;  3VSL A;  5TGT A;  4PJM A;  1WJ5 A;  4XOP A;  3S3O A;  2WA0 A;  4KJZ A;  1D0Y A;  3DTE A;  2OC6 A;  4QPO A;  4BE2 A;  2I8D A;  3VYS B;  4C30 A;  2CV2 A;  2RRE A;  4B48 A;  2DT6 A;  3UR3 C;  4Y4R A;  4ZTF A;  1MMD A;  2RQQ A;  3C2G A;  4RLQ A;  4BE0 A;  5HLT A;  1E0E A;  3K10 A;  4JQF A;  3LSK A;  3C2H A;  4NUB A;  4ZYA A;  2CS3 A;  5FRO A;  3EPZ A;  5CPR B;  4AU7 A;  5FRN A;  4D1Q A;  3IP4 B;  3SYT A;  2O5R A;  3K4J A;  3ONQ A;  2R7R A;  4JOM A;  1P9Q C;  4DGW B;  3MKZ A;  1Z7L A;  2X1E A;  3KYL A;  1N78 A;  2UUZ A;  3QOD A;  3VSK A;  2L9S A;  3MD2 A;  3LFU A;  4LIV A;  1V5F A;  2KZV A;  3DTK A;  4OWR B;  2WAE A;  2AQE A;  5FRM A;  2LBF A;  3OYA A;  1N75 A;  1Z3X A;  1X19 A;  1X1C A;  4XQF A;  2HVS A;  2L7K A;  3J7A Y;  1U0J A;  1D1C A;  4XKW A;  4XON A;  3MMY B;  4CZC A;  4E7H A;  3IUO A;  3S3M A;  1KON A;  3DPU A;  2LBF B;  4BQO A;  4QPQ A;  3EUA A;  5KCM A;  3U21 A;  2KRC A;  1LDK B;  4E7S A;  2XF6 A;  2R7U A;  3PSI A;  2CUJ A;  3BG6 A;  2Z2S B;  3SEQ A;  5JHF A;  2DCE A;  2M4G A;  3OIP A;  4X0G A;  2JVH A;  4BAC A;  3K4K A;  2HQA A;  1PYV A;  2V9K A;  2E1M C;  3H5R A;  3K4N A;  3TBI A;  3HC7 A;  4PJL A;  3PUB A;  2QKL B;  3SDB A;  3OS2 A;  1AA7 A;  4ZC3 A;  2F5V A;  2Q1Z B;  4NNJ A;  3L2V A;  2DOA A;  1D0Z A;  3PNY A;  2ELJ A;  4YEJ A;  4BQN A;  2X51 A;  4BEH A;  4CH7 A;  2LYC A;  1LKX A;  1X4O A;  1LVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...