2XF5A

Crystal structure of bacillus subtilis spp1 phage gp23.1, a putative chaperone.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
49
structure length
49
Chain Sequence
SESLLYGYFLDSWLDGTASEEMMRVAVNAGDLTQEEADKIMSYPWGAWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP23.1
publication title Crystal Structure of Bacillus Subtilis Spp1 Phage Gp23.1, A Putative Chaperone.
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
total genus 13
structure length 49
sequence length 49
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xf5A00
2XF5A 2XF7A 2XF6A
chains in the Genus database with same CATH superfamily
1ZHFA 3VYSB 2G0EA 3PQJA 2R92J 4OMYA 3OL4A 5DUKA 4EM0B 2GLOA 4ETSA 3OYFA 2IS4A 2O5RA 4U88A 4X1EA 5IPAA 3HOYJ 2PJRA 3VSLA 3OL3A 2A6TA 2D1VA 5M3FJ 2Y48A 2XF6A 4HQMA 3FX3A 1O7LA 1IV6A 4Y7NJ 4KFCA 5HS7A 1W0UA 3ZPLA 1J09A 4HRIA 4LK1F 2YSRA 1L3LA 2DMQA 3VOEA 2GIVA 1W7PA 3NEUA 3ABKH 3TKYA 1UAAA 3PSFA 4FISA 2LY2A 4Z6YA 2XVCA 5JFRA 1I1GA 3P9CA 5EZHA 2DMTA 2Z99A 3TEDA 4H4KC 3G6EI 4ENKA 1G59A 2NAZA 4YFNF 1FYLA 3RZOJ 1YTYA 4XN3A 1QHHD 3JRDA 1Z1DA 3DU5A 2FF4A 3K1NA 1TP4A 2NNNA 3E0JB 3IWZA 4X0GA 5AIPA 4BQQA 4CHUA 1XD7A 1APLC 3JAMK 4UUVA 4PZJA 4WXCA 1XSXA 2GBYA 3E1SA 5J8CA 1V55H 2VE8A 2HEOA 2M3AA 3TQNA 2W7NA 1M1EB 3HOVJ 1MH3A 2K9QA 3CMMA 4BJ5C 1ETQA 1IDZA 3I4MJ 1IDYA 3SQNA 1T56A 1MMDA 5IT9Z 2CMPA 2KIFA 2EILH 2AQEA 3DP7A 2PFBA 3BR0A 3GFLA 4QSHA 3BTIA 2ZSHB 4HYEA 3WTXC 1BIBA 1FSEA 1OCCH 5CVUA 4ZDLA 2CO5A 5IYBJ 2CGPA 2IA2A 3I5UA 1W1WE 4KUMA 5D4RA 1Z7LA 3TOAA 2O03A 2OQRA 3Q9VA 3H3VK 1FEXA 1J0RA 3BZCA 3F72A 2D45A 2DTZA 1TW3A 1ETOA 4KMUX 4RGXA 2LVSA 3KYLA 5CVJA 1WZ2A 1SVMA 4LG3A 4KITB 2L9VA 1UB9A 5HOOA 1TWFJ 1P4XA 2VBYA 4K2EA 3CUOA 1A35A 2BVMA 1SMYF 3S1QJ 3LNQA 3WGHA 3CMEI 1WH5A 1XMXA 2K3PA 3CMAI 1QVTA 3OYGA 4DZPA 4DW6A 3WGIA 5TGTA 4KT5C 4XLAA 4DBQA 3G1LA 2HKXA 2OD5A 2W24A 3C2BA 5DCMA 3R0AA 1R23A 4P5OA 2HZTA 3OR2C 4Y3OA 1YJ9I 2W48A 5BOXA 1YW7A 3N05A 2P6TA 1TWAJ 4G7HF 3CDLA 1QO0D 2KIMA 3FZVA 4EJVA 3S3MA 5BPIA 3LAJA 2W25A 2QM3A 2XGXA 1ZR4A 1IRZA 1C0WA 3VFZA 4WXDA 5HNFA 4ITVA 1B59A 3WE2A 4RAFA 2L4MA 3CJTB 3P7NA 3ABTA 2ZJ2A 3ZQCA 1RUNA 4UVBA 3DF8A 3RYRA 2H27A 1HA8A 3C3WA 2XIGA 4J19A 1X1BA 4IX7A 4G7OF 1GDTA 1U8BA 4D5FA 3BR5A 3C18A 2A5WA 2ZXIA 1KYWA 2VJ5A 3I4PA 4AVPA 2O6GE 5CVRA 1ZG1A 3K2ZA 2Y31A 1LFBA 2XGDA 2DW4A 2QSGX 3PNTA 4F92B 2OUMA 1H88C 1U2WA 1JT6A 4HV6A 5C3EJ 3OR1C 3OYHA 1TNSA 2DMUA 3BJ6A 4J01A 1E3HA 2G7HA 4XMYA 4LFUA 2X4HA 5EZGA 2WA0A 4CCOA 2MD5A 5H6QA 4NB5A 2XV4S 3FXJA 2VQGA 3ZQGA 3F9KA 3OYJA 3K0LA 4ZYDA 1YS6A 4D1QA 2B9SA 3AAFA 4LIUA 2IA1A 1FC3A 1R00A 1JJ6C 5E3MA 3HOUJ 4E7HA 2W4SA 1A5JA 1G2HA 4RM2A 1LB2A 1T39A 1OKRA 2FNPA 4RB0A 1R4NB 4UUSB 2EV0A 1DP3A 5K1YA 2E1NA 2DU9A 4LB6B 3CLQA 2NXNB 3O8HA 2LP0A 4XORA 4HLYA 1DDNA 2FQ4A 4LLLA 1Y6IA 2D2WA 1YO5C 2KRCA 4BHCA 2HOTA 1ZGJA 3OS1A 3JRFA 1UELB 3BG7A 4HOBA 5EEGA 1S8NA 4NNJA 2EJRA 2P4WA 2CH0A 1GVJA 2E1MC 1N25A 4G9YA 4DJAA 2ZMEB 2YS9A 2HYJA 3QYEA 1BN5A 2XRNA 3GFJA 2R7VA 1BI1A 4UB8C 1G8XA 3K69A 4IHXA 2CW7A 3D5SC 1MKMA 3TOBA 1OCRH 4L0YB 3S3NA 1VZ0A 2PBIA 3PO3J 1AA7A 3QYFA 4GGGA 2DBBA 2OU2A 4HA8A 2FE3A 1DU0A 1Y56A 2YX7A 1VNDA 2KJBA 6PAXA 5M5YJ 3AG2H 5LGUA 1NH3A 1FWZA 3DWLE 4NC6A 4IJAA 2KQRA 1XCVA 3OWTA 3I9V2 1SEUA 2VXDA 5DUIA 1YJNI 1GHCA 1MW7A 1FIPA 3GTOJ 3IL2A 1IV8A 1ZGAA 1WJ5A 2LBFA 3OYMA 1MNMC 4XBFA 3T0YA 2H6BA 1YW9A 2RQQA 2MH2A 3GWZA 1D0ZA 4A3FJ 3TDUC 1VTNC 4XQFA 2DOAA 3FKJA 3DQVC 2ESHA 5GPAA 1PYVA 4MFEA 1BL0A 4RAGA 4Z2YA 2G9WA 5ERIA 1JHFA 5GTHC 3SEQA 3HOZJ 2K7LA 2K9SA 2D5VA 3L2QA 2V1DA 2ZB9A 4AIJA 1D8KA 3HOXJ 2ZBKA 1LPQA 1ETYA 2OQGA 2X1DA 4XKBA 2IRFG 3DKWA 1ZYRF 1X2NA 5D5XB 3ZMUA 3TW7A 3M3YJ 1B6AA 2VJ4A 3HHHA 3ABMH 4YIIA 5DEQA 2LF8A 4OMZA 3EUKL 3UR3C 5JR3A 1IN6A 4M74A 2RKHA 3CCVI 3GTJJ 1WJAA 1T6SA 4CXFA 3LL7A 2L7ZA 3RPQA 2XKOA 3IUOA 3EYIA 2XAHA 3L9FA 2H8RA 2HQAA 3QAHA 5K5RA 5LRSA 4GCVA 4HX7A 3CP2A 1PUEE 2J5PA 4A2UA 2JPCA 1HXDA 2AXTC 3O8GA 4XL9A 2LOOA 4LLGF 2ZJRF 1J59A 4HSTA 1YYVA 2JA6J 2X1EA 2W1OA 1KQ8A 2TRTA 4XLNF 1HKSA 5JVGF 2FRHA 4A0ZA 2WADA 2QSFX 2ZFWA 5D4SA 1IF1A 1BJZA 2STWA 3RDIA 3IRRA 1XCBA 3WHBA 1YS7A 2BY2A 2YPRA 3T8TA 2K85A 2R93J 3GEZA 4PSXA 1LUJB 1FTTA 2ACJA 3HDDA 2J5OA 3MZYA 2M9HA 3GTKJ 4B3XA 1POGA 4NDLA 2VASA 1Z91A 1XGNA 3BCBA 1S29A 1AU7A 1T08B 5D8KB 5J8FA 4KDPA 3LSPA 1DP7P 4RLQA 4CCNA 2L01A 3V42A 1SD6A 1N77A 3QPLA 2M7AA 3MVPA 2IGNA 5ICCA 4AVZA 3OYEA 3RKYA 2CQ7A 4XR6A 2QSHX 3V7SA 2NOJB 3KP2A 4DQ2A 4ZJZA 1VQ4I 4L9VA 2LKXA 4IHYA 1J2XA 3H0GJ 3GZ5A 1MBFA 2GOXB 3W6KB 3RKQA 3U1DA 1LVAA 3VYUB 3ERED 1LQ1A 4G8XA 3MWMA 2QGUA 2COBA 4FX4A 1V54H 1Y0NA 2LFBA 4P1WA 2DQRA 4RAYA 2MG4A 1LVKA 2L54A 3I58A 4Y4RA 5E79C 2DK8A 3P5JA 4A69C 3FISA 3ULQB 2VJIA 1QBJA 2PQ8A 4RM3A 2RC4A 3FMSA 2GZWA 4MTEA 5F27A 2OCCH 5ED4A 2WTEA 2ICWG 3BG3A 2RAEA 3CESA 3FHZA 3NAUA 5D8LB 3NWTA 3RIRA 3PL8A 1VQ6I 1P4AA 5HLTA 2HFHA 2DJIA 1RKWA 1X1AA 4UUTA 1SFEA 1A36A 4C30A 1Z0XA 2XAGA 3ASOH 1OLTA 3LA2A 2FOKA 5CLSA 1E0EA 1IC8A 1ETXA 2HXOA 3NRVA 2DO7A 2E35A 4S04A 3K2AA 2I5UA 3FXKA 2QWWA 2EB7A 4IRHA 3M7GA 2E5ZA 4JK1X 4D7MA 4CGZA 5J3LA 2MSYA 3HOWJ 2R5YB 1XX5A 2QQBA 1R6RA 1SAXA 4YFKF 2JTVA 2VB6A 5JHFA 1S6LA 1P7IA 3GX4X 3SEZA 2VT3A 1O4XA 1FOYA 5M3MJ 3I59A 4OU0A 5KK1A 5IP6A 2I10A 4PJMA 2M34A 4MLOA 4PK4A 4FHTA 3CCMI 4F52A 3ABLH 2MFZA 4MQVA 3GW2A 4IHTA 2M2EA 1NG7A 1TC3C 1F1ZA 2Y30A 1KZHA 5HLGA 3DEWA 3ZR8X 3HYIA 3M9AA 4L5IA 4KIGA 4L9JA 1AOYA 3HL2A 1U9OA 5M5WJ 3BR1A 4HPQA 1X3WB 5E8IA 1FPQA 4IPAA 4HLXA 3CF5F 2R7RA 3VDXA 4M3GA 4FX0A 1VQOI 2ISZA 5DCFA 2A5YB 3HB9A 2QBYA 1H8AC 1DGWY 1PUFB 3N97A 5IYCJ 3H35A 1IN5A 1NK2P 2EWNA 1NG6A 3M1CA 3QWLA 1WI9A 2GIZA 2F4MB 3E97A 3KZYA 3GFMA 4XNFA 3CC7I 2VKHA 3BJAA 2HOSA 1R5ID 2FX0A 1XB4A 4LIVA 3S2DJ 1X1DA 3RYPA 4CYCA 2DJNA 4A3KJ 2Q2EB 1B8IB 2TDXA 5EEAA 2M1BA 2RNGA 2IA0A 4CCJA 3DEEA 2VBZA 4M6VA 1O57A 2XAFA 2JUCA 3FF5A 1X2MA 2I8DA 5GTIC 3OYKA 3MZHA 1JKPC 1FY7A 2CRGA 4DIQA 2A3SA 3H0DA 4RA2A 2M30A 1MH4A 4HNUA 3G71I 2BW3B 3KETA 3TDZC 1BW5A 4JBAA 4ZTFA 2E19A 3F8BA 4PFOA 3CJQB 3TP3A 3FXMA 3S17J 3ASNH 3HSRA 4MO7A 1VQ8I 1T38A 1ZG3A 4PSWA 3PM1A 1PDNC 4A5NA 3V7CA 3BR2A 2CV1A 3HZJA 4NHJA 2Y0SN 4E7JA 2M8GX 3MN2A 1L0OC 2CQQA 4LGWA 1GT0C 5J6XA 3WG9A 4I01A 2HYGD 2NVTJ 1Y1VJ 2XAUA 2F5CA 1DPRA 2E1MB 2WAFA 1IG7A 3DPLC 1UJ8A 2FD5A 1LFPA 2RVCA 4UVCA 4CCKA 3LFUA 2Q1ZB 2VKVA 5L3FA 3OYBA 2M7BA 2LD5A 1OMIA 5K5QA 5DV5A 1J7KA 1KA8A 3GTQJ 2B7EA 5K7HA 1BIAA 1HW5A 2IP2A 2QVOA 2DTRA 2P5KA 2Z3YA 1U6GA 2A6EF 4W1UA 2LDUA 3H1CA 3HKZA 5L3EA 1CQTA 1ON1A 3S3OA 1X1CA 2JSPA 5F0FA 4N9IA 1WQ2A 1T98A 1MMNA 1BI2A 2ELJA 1YW8A 5LHGA 3L2VA 1QPIA 1X19A 4F55A 1BC8C 1BR2A 2JK3A 3LQQA 1YI2I 1S7AA 3DBLB 1K6YA 2PN6A 3PFIA 5HODA 1F4KA 5B1BH 5KVRA 1U8RA 4YG2F 1RETA 1IW7F 4HDVA 2ZXJA 3DBHB 3ZMSA 2K5CA 3KP5A 4TV7A 1QZEA 2BVLA 2EH3A 3K4BA 2K9NA 1MDMB 4Y13A 1MMSA 1P2FA 2BHZA 4G6DA 3LMMA 3A01A 2QLZA 4OINF 3SXYA 2IJLA 3LSJA 2WY7Q 1IN8A 2NS8A 4B8XA 4PUSA 5E3OA 3LSTA 1S9HA 3L7WA 3OYLA 2PJRB 1D8JA 1QPMA 3T1BA 2JZYA 1ETVA 5CQGA 4FTHA 2LYCA 4A3IJ 5H2FC 1D3YA 1KQ9A 1MJBA 3JRGA 1HKTA 1LJ9A 4HQEA 4FE4A 3J80Z 3PFYA 4QWQA 1HBXG 2HVQA 3I0TA 2LC2A 1KYZA 3OOPA 1QA6A 1K79A 5H20A 1W7PB 2A05A 2WY8Q 3QU3A 4P96A 4ANJA 3A2KA 1X58A 5CKTA 4O5VA 4XSZF 2GWRA 2DA1A 1IGNA 3MFKA 2VBWA 4A3MJ 2O0YA 5B1AH 1VQ7I 3TP0A 1MSEC 5KAFC 1QZZA 1RPWA 3SYTA 2Z16A 2M4KA 2VODA 2VKEA 2R4GA 4UVAA 5FKOA 4Q4ZF 2ZO4A 1J9IA 4ENJA 5DM6F 3SJMA 2P5VA 2XUBA 3BP8A 3HSEA 1KQ0A 5D6FA 3PNVA 4I7HA 3I56I 2E34A 2L5QA 2MBFA 4GXOA 3SDBA 1OPCA 3KCCA 4L5JA 5FKLA 2R5ZA 3FDYA 4XLFA 2CUEA 2E1CA 2XAJA 5GAGJ 4B43A 4YFXF 4M71A 1K78A 2JMWA 1OCPA 2FJ1A 3GUDA 3A1YA 3NQOA 3BY6A 2HQRA 2ZXWH 2RGVA 5LHIA 4JP0A 2STTA 1U9NA 5ILUA 4IOCF 1WJFA 1H9TA 3EPZA 1G4DA 4GFBA 1HDDC 2HGCA 2K4BA 4CA0A 3L2RA 1B9MA 4CICA 1GXPA 1JT0A 3U2RA 2CWEA 1MD0A 3J7YJ 1RUOA 1FOKA 3AL0C 1TTYA 2QF7A 2HDCA 3BLYA 4RGSA 4BDZA 1OJLA 2IS1A 2OTLI 2P7CB 4OIOF 2LLKA 1CF7A 4XIDA 2PJPA 2X6XA 3W2VA 3J7AY 1X3ZB 3CDIA 3G2BA 1FP1D 1DPUA 1OCTC 4ZH4F 4D5CA 3FXUA 3ZQFA 3DPUA 2P81A 2VOOA 1B72A 4BE0A 3KIOA 1B9NA 1LE8A 3TO9A 5DCMB 2BGCA 2ZKZA 5GADJ 2Z5UA 1W7PD 2P0WA 5FGMA 3JRIA 3S1NJ 1WJCA 2ADUA 3E3VA 3V8JA 3IH4A 1BR4A 1P92A 4AU7A 4LG0A 2LH9A 4BQAA 1DQUA 1LDJA 1XG1A 2MYSA 1HDPA 4BS9A 3PNYA 1XTAA 3DEUA 4BKXA 1ORKA 2JA7J 4XICA 2CQXA 5D5VB 3E6BA 4A6DA 3HKZN 2LY1A 3ZN1A 5JVTA 4A0YA 2YU9J 4S0HB 3J81K 1STZA 2DQLA 3TBIA 4I09A 1XC5A 1GV2A 2O7OA 4CZCA 5FLVA 5A2QZ 2AO9A 1YLFA 4XLEA 3M8FA 2V9VA 5HLHA 4UY8I 3SHFA 2LF7A 1P6RA 3MKYB 2XAQA 3WHCA 2VUMJ 2KMUA 3BTCA 2P7VB 1WFXA 3RI4A 1I6HJ 3S2WA 4HZFA 4RAZA 2QENA 3S32A 3R60A 2BZTA 4MIMA 2VIXA 2CFXA 3F8MA 1RI7A 5CQEA 2Y75A 2ZCWA 4BNCA 1FTZA 2JUGA 3LSMA 3BWGA 1MIJA 2OAZA 2CG4A 2YX4A 4ZDOA 1LEBA 4BYYA 2EK5A 2HKOA 4YIRX 3N4MA 3PSIA 4LOCA 2X85A 2B0LA 2FXAA 3GTLJ 1HLVA 3HIFA 1V5EA 5J4YA 2JVHA 1I6XA 2UXNA 4IO9F 2MGQA 1EF4A 4I02A 4ZYHA 4G12A 1UHSA 2M4GA 4BXFA 2A6HF 1JTXA 2R7DA 5D6EA 2L4AA 4XKWA 2WAQN 4A0XA 4IEJA 4G6QA 4AWXB 1IJWC 1E3OC 3ZOBA 2OA4A 3E6DA 2QQ8A 1PJRA 1HOMA 1ZN2A 1SD5A 3WU2C 5D5UB 2DA6A 1Z21A 1GV5A 3ZQQA 2NS0A 3O6BB 2V1XA 2EA2A 4RB1A 3DLLF 1RKTA 1V5FA 4X6AJ 2ME6A 3ZQLA 1WI3A 1NHAA 4M6YA 3C7JA 2WV0A 3FXQA 2DA3A 2CFOA 4RB2C 3UKGA 2VBXA 3GO5A 3GLXA 3R61A 2ELHA 3S93A 3MCZA 5FLXK 4BHPA 3P9KA 3ML6A 1YX3A 3BR3A 4G7ZF 1ETKA 1QVUA 2BOLA 2E71A 4B44A 1ZQ3P 4BGDA 4IF4A 3QP5A 5EJCA 1S3JA 4A12A 1SVLA 3CC2I 4CZZA 3RTRA 1WVRA 3ZGKA 2VQHA 4M9ZA 3CF2A 1XMKA 4MGRA 4A3JJ 2LBFB 1USTA 1MBEA 3K4MA 1YFHA 1FNNA 3GBGA 4QPQA 1WH7A 3FM5A 5FKKA 3VYRB 2O8KA 1JKRC 2JRTA 2OBPA 2ZC2A 3M07A 5K7ZA 2OC6A 1GXQA 5F0HA 2NVUB 3DLAA 3HRTA 4M3FA 3WTZA 4ESJA 5IP7J 1E2XA 3REOA 1Z6RA 2A07F 9ANTA 2R7WA 3HRMA 2CUJA 2RV8A 2GQQA 3F8CA 5HDKA 3CCYA 4U87A 3GXOA 4Y52J 1QZYA 3F3XA 4HAMA 3FHNA 3GZNB 2IGOA 2ZNYA 3S15J 5FKNA 1BA5A 2CUFA 2V4JC 5EDNA 4XLHA 4BEHA 1BW6A 1YJWI 1YQAA 3ZN0A 3H9GA 1TLHB 3FK7A 2LG4A 1ITYA 3JAMZ 3KP6A 3ZQIA 3GLLA 5DS9A 1AWCA 3PUFA 2KRFA 4BBRJ 2M8EA 5L3GA 1XSVA 1XMAA 3ZCOA 2BY3A 4KICA 3GTGJ 2LY9A 4XONA 3F8FA 4AIKA 1ZKGA 2IPQX 2K02A 2ZJQF 1HSJA 3HG9A 5M5XJ 4A5MA 3KYDB 2E2HJ 5F04A 1F43A 3FWEA 4IQ4A 1SFXA 2EIJH 2Y0MA 5KCMA 3HM5A 5CVVA 2OV7A 2XSDC 4C3IJ 3MAJA 4KN4X 1T0FA 1ODDA 3SFZA 5ICGA 1QU3A 5LFAA 3ONQA 3Q0WA 3H3UA 2QUFA 1B4AA 5FFXA 3OYIA 5EG0A 5LRRA 2HS5A 4LB5A 3IH3A 3K4KA 3KEQA 4BXUA 2TCTA 2DPDA 1IUFA 2EIKH 4NUBA 1IZ1A 5J1RA 2XPWA 2OCEA 3KX2A 3FXRA 1ZRDA 2GXGA 2L9RA 3SZTA 4MEXF 4CSWA 2HR3A 3QOEA 2VQLA 3M1EA 3HGGA 3FXOA 2Y0SA 4XM3A 2ME0A 5TISC 2HXIA 1Z77A 1P4WA 2UV1A 1BI3A 2WB1A 1JE8A 3IAM2 2L0KA 4CUGA 4HF2A 1H9GA 2CW8A 4EV0A 4M3BA 2DOFA 3TMOA 2BEOA 2CV2A 5E17F 3F6VA 5LHHA 2NVXJ 2G7UA 2ZSIB 2VT2A 2VOPA 4HNTA 2QA4I 2V1UA 3B02A 3I4NJ 1KU7A 2FMLA 2HOEA 2ZJPF 4RLFA 2H6CA 2L7FP 2HDDA 2GXAA 3VPRA 4KISA 2JA8J 3IP4B 4RS8A 1ONVA 4II3A 3J7ZI 1BJAA 2PEXA 4QPOA 2P8TA 2GXBA 3E6CC 3BZ6A 1IN4A 5HDNA 1TL8A 2KDOA 4HW0A 5J47A 3H3ZA 3Q9SA 4I6ZA 5JHUA 2COMA 1G3SA 3KYCB 1ON2A 2IAIA 2HQ5A 2K4JA 1G3YA 2CU7A 1SFOJ 3HBLA 3L2CA 3AL0B 1YE9A 5J4VA 1DU6A 2DT5A 4XLCA 2RDPA 4D7NA 1K4TA 4JX5A 3FXLA 4I2OA 3CTAA 4KNYA 2KZVA 3FBIB 4Y15A 3ZMVA 5F1JA 2IEKA 4FT8A 3M8JA 2BBYA 2P6SA 2ISYA 4GYIA 1D1BA 3VWBA 4E7IA 4MEYF 3WU1B 3I59B 1R9TJ 4MFDA 2KZGA 4ENMA 1D1CA 3LSIA 2V9PA 3W6JB 3DXJF 1F5TA 4B09A 2VL8A 2A68F 2QCOA 4KIBA 1XSDA 4A93J 3V8KA 3K1MA 1AKHA 3ECHA 5CYVA 1UG0A 2DI3A 2GOMA 1ZR2A 4L9TA 1IXCA 1YG2A 5AIQA 1V5GA 4F7ZA 1JTYA 2F4OB 3QQAA 5LEJA 2DFEA 4UNOA 1Y39A 3LQRA 4C2MJ 2WWYA 4AM3A 4PJ0C 5IOYA 3HGYA 2QBYB 1TZLA 3ABUA 3FM3A 1XPXA 1WSUA 5EGOA 2VXZA 2Y69H 1Y8QB 2NNYA 3SFIA 3ZMDA 1D1AA 3ERMA 4XKCA 5E18F 4XSXF 3PUBA 5FO5A 4BJTA 4EJOA 2DDAA 4O6JA 3H92A 3BPVA 4HG2A 4E7KA 5L3CA 1IRXA 1WWXA 3K6GA 3S16J 1WRJA 1HCRA 2R7ZJ 4EEFG 1ULYA 2F48A 4CYCB 1VQMI 1F9NA 1OYWA 5K5OA 2E7WA 2CV0A 1JKOC 1YRNA 1IXSB 1HW1A 1LNWA 1YX5A 4KT6A 2CQNA 1MMGA 3CUQA 2F2EA 3KP7A 1K6OA 3ECOA 4N4NB 1R71A 2EFWA 4IHVA 2CUZA 3HUGA 2E2IJ 1LFUP 3JSOA 3RQ4A 4OWRB 2BE5F 2YU3A 4B3AA 3OYNA 1IAWA 4AYBA 2KT0A 4L0ZB 2Q0OA 2V79A 5IT9K 4PGGA 4I0BA 3JR9A 2K9LA 2H94A 3RQIA 3H9QA 4JOMA 1R5GA 3DFGA 3CP8A 1OR7A 2CSOA 3I71A 4NQWA 2WC2A 1W36C 1N78A 2KKOA 1KU2A 2M87A 3IC7A 4RGRA 1EV7A 1JXSA 2X0LA 4BQNA 4EVIA 2KRHA 1K83J 1EH6A 2ZXHA 4OIRF 4XKVA 3KLNA 2M5WA 5CVIA 1NK3P 5E8GA 1ZRCA 5LBQA 1USSA 1FLIA 2FOWA 5CJ9A 1ZK8A 1OCOH 2KIQA 1U5TA 1WHUA 5F6FA 1T33A 2ECBA 2MLGA 4Q48A 1R1VA 2Z2SB 1VF9A 1TWHJ 2WB1N 3QODA 2Y9YA 3VSKA 5FLMJ 3CZ6A 4W97A 4IQJA 2BY0A 4EATA 2DAOA 2XGCA 1X4PA 1FX7A 1I39A 4Y33A 2EFPA 2UXXA 4Q5SF 5KHDA 2XF7A 4HF0A 1TWGJ 3KZZA 1DGRM 4I0AA 3V8LA 3FIWA 4JQFA 1O3RA 1R36A 1BR1A 3CMYA 2FNAA 1I1SA 3PIOF 1W0TA 3IV5A 4XRFA 1ZRFA 2RN7A 2E36A 4HSRA 4BE1A 4YIFA 1MSFC 4F3QA 2GA2A 4FASD 1HKQA 4ZYGA 3Q5FA 4RB3C 3EQLF 3KLOA 4GDFA 1QGPA 2LSOA 4B48A 3LFKA 1RZ4A 3A01B 3V7RA 1FJLA 4BBSJ 3I3LA 4R8HA 4BY7J 5LD2C 2YR2A 2DPUA 5B3SH 1XGMA 4CYDA 1K4SA 3CO6C 1T0FC 1VQNI 3KEYA 4RBOA 1SAUA 3A03A 1V4RA 2R7XA 1MGTA 3SZGA 3Q3SA 2ECCA 3R6SA 1R58A 4BDYA 2DA2A 2D1HA 2HTJA 2XPVA 1MBKA 4WX9A 4FCYA 3F23A 3G3ZA 4XOPA 2FBKA 4E6KG 3F0CA 3TL4X 4G6TB 1K61A 2E60A 2E7XA 3T8RA 3RKWA 2NOGA 3OSFA 3ZQHA 1RIOH 4PCQA 4KYWA 2H8WA 2LNBA 4WXHA 4AD9A 4IRIA 1IRGA 1S7EA 2WAQA 4BAYA 2M0MA 1I50J 2HDWA 2EIMH 5DTDA 2EV5A 4YRVA 3BC8A 4A3BJ 3RSNA 3BZKA 3QYBA 1MJ9A 1MBGA 2Z1DA 4XOTA 1Y0UA 1GVDA 2PLYA 3CDHA 1A04A 2HZDA 2XGEA 4HX8A 1KU3A 2X9DA 2VLAA 2F6CA 4E7ZA 2R5ZB 1Y8RB 3JSPA 1DUXC 4LMYA 2KHMA 1JGGA 1TT0A 3LOCA 2M45A 5J1YA 1K78B 1R4MB 3HHGA 2P5LC 2QQ9A 2LRDA 2R7FA 4HBLA 2VPLA 1TQPA 3H5AA 5KAIC 2UUZA 2BY1A 2CJJA 4PDKA 4IXAA 5HS9A 3O2PE 3HPGA 5BQTA 3CJRB 3UNGC 5F08A 1UG2A 2Q8KA 5EEHA 1EKEA 3D0SA 3ZXSA 3BCAA 5JI6A 2HI3A 2FSWA 2BXZA 2IS6A 4AYBN 2DFIA 3ROUA 1X3UA 2QKLB 3GCMA 1NTCA 3IAS2 1WJDA 3DTEA 5CPRB 1OCZH 3A4CA 1D5YA 1VFCA 1CF7B 4V2FA 1ACIA 2QYOA 1EH7A 1HSTA 5FRMA 2JA5J 3R0JA 4QLCU 3BG5A 5LGTA 1F36A 2VN2A 3C2GA 3HTUA 1WGXA 4CCLA 1HW2A 1T8IA 3D5LA 1B72B 5JLXA 3JRAA 2DMPA 5FB2A 1MMAA 1LE8B 2KL4A 1D0XA 2O61A 2AXLA 1X4OA 2OTJI 1I3AA 2DLLA 5C44J 1X1PA 3AFHA 5J1UA 3WE3A 2H1KA 2MC4A 3DKXA 4E7SA 3K4CA 5ICFA 2W84A 2NVYJ 4BH9A 4R79A 3WTUC 2BYVE 1BM9A 2EQRA 2R7TA 3BJOA 3JW4A 5FROA 3RZDJ 4LG0B 1D5VA 1OISA 2NYXA 3B6CA 2HPIA 3IH2A 3WODF 3CO7C 1SFKA 2QQAA 2X1CA 3GTMJ 1LEAA 1EA3A 4PFPA 4FQGA 3AG1H 3VEPA 5E3NA 2EV6A 1MBHA 4F93B 3LSRA 2ZFUA 2R7SA 2DT7B 2OJED 1H0MA 1A31A 1SMTA 3H36A 5DD4A 5ILVA 5DYMA 2JA2A 2OPTA 4RMNA 2X6YA 3RCOA 2DA7A 1U78A 3QOPA 4BQOA 5GPCA 4OIQF 4L9NA 1D0YA 3SZPA 4CDGA 1VQPI 2L7KA 2XPUA 3JTGA 2VONA 2L2OA 4C3JJ 1UCRA 2UZKA 4N0BA 2QKMB 3HOSA 2HYFA 4A3LJ 2HNHA 5ILSA 4KIFA 1Z7UA 2UWMA 4NC8A 3CUQC 1U3EM 5LEKA 1FZPB 3EUHA 2JVGA 2K9MA 4OIPF 2VQCA 2MW8A 4ESFA 4IOAF 2LREA 2VC1A 3LAPA 5B5EC 4GO1A 1RESA 4H0EA 5BS6A 5TJJA 1TQMA 1I5ZA 2FA5A 2NS7A 2PG4A 2XRLA 2JWTA 1P9QC 2BHYA 2PI0A 3G1MA 2JPBA 1B1BA 1UMQA 4M3EA 1OR7C 1VQ5I 2XASA 4EJWA 3A02A 4U7DA 1ZGWA 1JJ8C 4J00A 3OIPA 3V4GA 3BG6A 3ZMTA 1Y1WJ 1SFUA 1S72I 1O3TA 2IGMA 4YEJA 3ZRGA 1QQIA 2HPMA 3GTPJ 3ELKA 3PQKA 3JCUC 3I55I 2XDVA 3I53A 4BL0B 2EZKA 3MEXA 1U5TC 3BTLA 1BBYA 3GF2A 1S7OA 2VKDA 4U0VA 3WTVC 3EDPA 3W3CA 4IRGA 3QRFF 1JUSA 1KU9A 3LWFA 3BDDA 5HS8A 3OY9A 5DD8A 1E17A 4ASNA 3JRHA 2W00A 3HRUA 2K86A 3CCQI 4KA4A 3VB2A 1FBSA 3M4OJ 3ESWB 2GAUA 1JHHA 2DFFA 1Q1VA 3D5RC 4PJNA 1ZARA 1XN7A 3G73A 3O3KA 1BC7C 5IT3A 2F5FA 3HEFA 4BACA 2LMDA 2FBIA 1UHMA 2DYRH 5L3BA 2L9SA 2FUG2 2YUSA 4KJZA 5LGNA 1ZLKA 4BY1J 2EZLA 4HNVA 3QPSA 5IY5H 2E5NA 3RPUA 4O3MA 1P7JA 2JN6A 1G6NA 4AC0A 1JKQC 2EBIA 2F5VA 3GVAA 5LLQA 2CYYA 2KIUA 3WGGA 4OAYA 2EZHA 5E1ZB 3KFWX 1FT9A 2JRMA 3GYHX 3B6AA 1FP2A 4DZJA 4LLNA 2DOEA 4DNCA 2HWVA 4A3GJ 1IXRC 2X48A 2DDBA 3P9IA 2KFDA 3G4SI 4IL6C 2IW5A 3DPTA 2EA4A 2KJCA 1OYYA 1YIJI 3KZIC 4M6XA 4DYQA 4DBRA 1PP7U 1MNEA 4ABZA 2CQKA 4BEHB 5HLIA 1BOAA 2Y2ZA 2DA4A 4UUSA 2DYSH 3JRCA 2HVRA 4AIHA 4I99C 2XHKA 3LA3A 3DKYA 3JREA 2L02A 3OYDA 3D1NI 1BOBA 3CCJI 3K9TA 1EH8A 1VI0A 4II2A 2NVQJ 3CJNA 2ID3A 3OS0A 2ZMEA 2X6WA 2HU9A 4M9XA 5HVQC 2XC7A 1R22A 4QTRA 2CS3A 1WJBA 1SC7A 5H6RA 2PMUA 3B73A 3K70D 3S1MJ 2K40A 4RDUA 1CGPA 4XN0A 1Z3YA 1XDUA 1I3QJ 2CW0F 1XDSA 2PMHA 2PMZA 3HPHA 3IKVA 3TO6A 1Z9CA 4EM1A 1HF0A 3GZ6A 5HNHA 3AG3H 3BT9A 3K7AJ 3CD6I 2FQ3A 3S14J 2FU4A 3DBRB 3RPUD 4C2UA 4FETA 1YHQI 2DXIA 3EUAA 5F64A 5FRNA 2V26A 2O8XA 4N9HA 5ICEA 1S5LC 1SANA 3CCLI 2NRAC 1LDDA 5EG0B 3IHUA 1R5HA 1G3WA 1MJAA 2XKPA 3BROA 4DYRA 3X2QH 5EF6A 2V9KA 1WPKA 2DT6A 3HRSA 1O3QA 2R0QC 4P9UA 3L2UA 1KONA 1W36D 2L3DA 2KP6A 1UHWA 1ETWA 3A0HC 2AQFA 5KNLA 2V7FA 1GUUA 2DFHA 1MNDA 3OOUA 4B1RA 2VE9A 1VQLI 4B4CA 3CCEI 5J40A 1SD7A 4AIDA 2JQ7A 2WAEA 5E1XA 4C2TA 4HF1A 3L00A 3E7LA 3ZP5A 2VI6A 1TQIA 5DDGA 3BG9A 1N75A 3Q0UA 1SVOA 1R49A 1Z3XA 2MC3A 3S2HJ 3PO2J 2FEZA 3S1RJ 3KP4A 4ZZLA 2WBMA 4ESBA 1GLNA 3CLOA 2GM4A 2MLKA 2L7MP 1O3SA 1VQ9I 3EETA 3MKZA 3W2AA 2O3FA 5BNGA 5K7FA 3HSFA 5FD5A 4D0PA 3S8PA 3MQ0A 5IYDJ 2E2JJ 1V3FA 3F8NA 4EGYA 1JUMA 4JX4A 3J81Z 2IVMA 2F4IA 4EMSA 3CCUI 3I54A 4M73A 3AKZA 3IKTA 3VODA 4NC7A 2RNJA 2RREA 3MKLA 3WG7H 1YITI 1IUYA 3U9GA 1LKXA 4UB6C 4M9SA 3HOTA 2AS5F 4QIWN 4A3EJ 2HQNA 3K1PA 1RR7A 3KPHA 1ZTRA 3I64A 2EPFA 4MNUA 3TO7A 1ZH5A 4ON0A 2OZUA 4E4HA 1K7AA 3RKXA 2ETHA 2K3FA 3HC7A 1PP8F 4BJ6C 1ZREA 2DODA 2DCEA 2HTSA 3DCFA 4IHSA 4DOZA 3OYAA 3LSHA 4MTDA 3J7AO 4EJUA 2W82A 1KGSA 4JYKA 3OV8A 1IN7A 4GRIA 4L18B 2ID6A 3F6OA 4GYGA 2XSJC 2LKPA 2V6CA 5L3DA 5FD6A 4R1HA 4N4OB 3E5QA 4A3DJ 3OS2A 4P9FA 1WKMA 4U7BA 4M3DA 4F91B 4BXXJ 2QZ8A 1QRYA 1OYIA 2K27A 4PJLA 4I98B 3EUHC 1RNLA 1W4MA 4WCGA 3DV8A 4ZDPA 5GP9A 4C3HJ 4E70A 1BI0A 1AKHB 1R7JA 4HX4A 3WTTC 4OAZA 3BTJA 5IP9J 3L1PA 1HC8A 1MZBA 3H5RA 4HDUA 4P55A 2MD0A 2X6OA 1T95A 4S05A 2BXYA 3C2HA 4WWCA 1REPC 5C4JJ 2LKSA 2O9LA 3J80K 1FMVA 4UXNA 2KPMA 1VQKI 2R3SA 5EGOB 4U0YA 1WCMJ 1Z05A 4RGUA 5GAEJ 1G3TA 2L9NA 4A3CJ 5FLXZ 4BUPA 5E3LA 5BPDA 4ZYAA 5DM7F 2AHQA 1HQCA 5AONA 5EYRA 2A61A 4PJJA 4UV9A 2M0CA 1R1TA 2BV6A 4UV8A 3FK6A 1FYMA 3OSGA 1FBUA 2R7QA 3KE2A 5FKMA 1YRNB 4KN7X 2IS2A 3FMRA 1SD4A 1AHDP 2VJJA 3CUQB 3CCRI 3Q0VA 3LSGA 1W5SA 3QPTA 4I76A 3JRBA 1JGSA 1MBJA 2DA5A 3LA7A 3HUGB 3BOQA 4IVNA 4NBQA 3K4LA 3CCSI 3FMQA 1ZG5A 4A6EA 1YOVB 4ZC3A 3DTKA 3K4NA 2PMZN 4IZZA 4LJZF 4PGHA 1FSHA 3WU0A 3HTSB 4D9JA 4CH7A 2RQPA 3OIOA 4XK4A 2JT1A 3BQYA 2ELKA 1A6IA 1JUPA 4IKFA 3K70C 4EGZA 2R5YA 2IGKA 2V1NA 4XRSA 4NQWB 2H1LA 3F21A 2IXSA 4CO8A 2H09A 1TWCJ 3ZMZA 4LK0F 3MMYB 2V6EA 1RC9A 2KISA 3EYYA 2EFNA 1OFCX 3VYTB 4E7LA 3COAC 1EJ9A 1Z6TA 5TRDA 1R1UA 3E5UA 5E20A 3MKWB 3FKIJ 3E6MA 2Y9ZA 1ENHA 2HOAA 2R7UA 2MH9A 1U5TB 5BMZA 4M72A 5FJ8J 1W5TA 5IOZA 2GA1A 1PVEA 1IRFA 1TNTA 4L5EA 5B66C 3L2WA 3FBNB 2DMNA 1XS9A 4V19K 3OMYA 1Q1HA 4Q47A 3U1KA 2QEXI 2ESNA 1FOWA 3IWFA 1QNTA 3OIQA 3TW6A 2C6YA 5GAHJ 2VC0A 1T2KA 4UHTA 5HDGA 1J5YA 3PJRA 1RR8C 4ZYEA 2ZNZA 3G1OA 1PUFA 3NARA 3L09A 2KDZA 4LD5A 1WJEA 4IHWA 1FIAA 2WV1A 4ZTJA 3HJEA 4BHBA 2XROA 2N8GA 1ERDA 3MD2A 1U0JA 1FOXA 3OYCA 1B8IA 2Q2EA 2ZMEC 2HVSA 3C1DA 3KP3A 1XGSA 4HEA2 5JLWA 4C9YA 5F1RA 3RJPA 3DTIA 4CCMA 4BE2A 3CQZJ 4ZZDA 1IO2A 3WTWC 2E1OA 3R4KA 1Z67A 3QPHA 4G94A 1I27A 5A2QK 3H9JA 4MQ9F 2OZ6A 3ZQ7A 2DN0A 1E3PA 3BPXA 3QU6A 4WF2A 4AUXA 2BW3A 1FYKA 3T5XA 3K4JA 4EQQA 1UFMA 3HXLA 1ZLJA 3WTSC 2IT0A 2B63J 3W2WA 1QHGA 5F0CA 3BQZA 3JTHA 3MZ8A 3TGNA 4MHGA 4YELA 4ENNA 2R7OA 1JI8A 4XRSG 2FBHA 2FMYA 1A6QA 1YIOA 1O7FA 4LITA 4XRMA 1OQYA 2KLOA 4KMFA 2F5EA 2Z9OA 4DYCA 4WK8F 2XF5A 2XB5A 2LK2A 2Z33A 2EFQA 2XB0X 2VPRA 2MABA 4XLPF 4JX6A 3W6VA 2LTPA 1UZCA 3A0BC 3NWSA 1XGOA 4U0WA 2MA3A 5E1WA 1RRJA 3E5XA 1FMWA 2PX9A 3KEOA 1TW2A 3SDGA 4B47A 3QP6A 5C4XJ 2W57A 3BR6A 4HV5A 1W5CC 3DU6A 3K10A 4BU2A 1FBQA 2JJ7A 4OOIA 4EM2A 1J75A 2LR8A 4EJTA 5D5WB 2JSCA 2OF7A 4FE7A 1TT5B 4Y17A 2X51A 3M8EA 3F22A 1ZAOA 1LDKB 2F5DA 3U21A 3CC4I 1TBXA 5FFZA 3WTYC 1ZELA 2EFOA 4V2GA 2A69F 3IRQA 3AG4H 2DK5A 3H5NA 1H89C 3LSKA 2W85A 3GMEA 3ISPA 2EZIA 4DGWB 1MDMA 2EINH 3PIPF 3GFIA 2IBDA
chains in the Genus database with same CATH topology
3H35A 2VKDA 3VYSB 1NG6A 3M1CA 3OL4A 3W3CA 3OYFA 4NUBA 2IS4A 4XNFA 3KX2A 2O5RA 2VKHA 3OY9A 2PJRA 2W00A 4CSWA 4LIVA 3VSLA 1X1DA 2A6TA 3OL3A 2VQLA 3QOEA 2Q2EB 2XF6A 2Y0SA 4XM3A 3D5RC 2RNGA 4PJNA 4CCJA 2UV1A 3DEEA 2WB1A 4HRIA 1J09A 3IAM2 2I8DA 4CUGA 3OYKA 4BACA 2CW8A 3TMOA 1UAAA 2CV2A 3PSFA 4DIQA 2L9SA 2FUG2 2LY2A 4KJZA 3H0DA 4HNUA 2BW3B 2ZSIB 4HNTA 4H4KC 2E5NA 4ZTFA 1G59A 4PFOA 3CJQB 4XN3A 2F5VA 1QHHD 3DU5A 4OAYA 4PSWA 4RLFA 2CV1A 3E0JB 4KISA 4X0GA 3IP4B 4BQQA 4E7JA 4II3A 4QPOA 3E1SA 2KDOA 2M3AA 3DPTA 2W7NA 2XAUA 3CMMA 4BJ5C 2WAFA 2E1MB 4DBRA 3DPLC 1MMDA 2CMPA 1LFPA 2AQEA 4CCKA 1MNEA 3LFUA 2Q1ZB 3AL0B 4BEHB 1YE9A 2M7BA 3OYBA 4XLCA 2ZSHB 2HVRA 4ZDLA 2KZVA 3FBIB 3DKYA 3OYDA 1BOBA 3M8JA 4II2A 1Z7LA 1D1BA 3HKZA 3VWBA 4E7IA 3OS0A 2X6WA 2HU9A 5HVQC 2XC7A 3S3OA 2CS3A 3KYLA 1X1CA 1D1CA 2JSPA 3LSIA 1WJBA 1MMNA 2ELJA 3K70D 4LG3A 4KITB 2VL8A 3L2VA 1X19A 4XN0A 1Z3YA 4F55A 5HOOA 1BR2A 2PMZA 3HPHA 1K6YA 2BVMA 5HNHA 1UG0A 2GOMA 2K3PA 3RPUD 4C2UA 4FETA 3OYGA 1V5GA 2DXIA 3EUAA 2K5CA 2BVLA 5TGTA 3K4BA 2V26A 4XLAA 4DBQA 5FRNA 3LMMA 1TZLA 2VXZA 4P5OA 4Y3OA 3OR2C 2V9KA 2DT6A 1D1AA 3L2UA 1KONA 2WY7Q 4XKCA 1W36D 3PUBA 2KP6A 4BJTA 3N05A 2AQFA 4PUSA 5KNLA 3S3MA 1S9HA 4HG2A 4E7KA 3OYLA 2V7FA 2PJRB 1MNDA 1IRXA 3K6GA 5CQGA 3OOUA 2LYCA 5HNFA 4C2TA 2WAEA 4ITVA 2CV0A 3PFYA 2HVQA 1N75A 2LC2A 4KT6A 1YX5A 1Z3XA 1MMGA 1HA8A 2WY8Q 4ANJA 4N4NB 3A2KA 1X1BA 2CUZA 2WBMA 5CKTA 4IX7A 1GLNA 3W2AA 3MKZA 3RQ4A 4OWRB 2A5WA 2ZXIA 3OYNA 2VJ5A 4AYBA 3S8PA 3PNTA 3SYTA 4F92B 2OUMA 2M4KA 2Z16A 2R4GA 3OR1C 3OYHA 2K9LA 4J01A 3H9QA 4XMYA 4JOMA 2F4IA 3CP8A 3AKZA 2WA0A 4CCOA 3PNVA 1W36C 4NC7A 2VQGA 3OYJA 2RREA 3F9KA 1N78A 4D1QA 2L5QA 3SDBA 4LIUA 1LKXA 3FDYA 2KRHA 4XLFA 2ZXHA 4BQNA 4B43A 4XKVA 3HOTA 4E7HA 2W4SA 3A1YA 4RM2A 4E4HA 1DP3A 3HC7A 2Z2SB 4XORA 4BJ6C 3QODA 3VSKA 2DCEA 1Y6IA 3CZ6A 1WJFA 2KRCA 4IQJA 4DOZA 3EPZA 4EATA 3OS1A 3OYAA 3LSHA 1UELB 1X4PA 3BG7A 4NNJA 4CA0A 3L2RA 2CH0A 4Y33A 2E1MC 2W82A 4DJAA 5KHDA 2XF7A 3QYEA 4GRIA 1DGRM 2XSJC 2R7VA 3AL0C 4JQFA 4N4OB 3BLYA 1BR1A 1G8XA 3OS2A 2CW7A 3D5SC 4BDZA 4U7BA 4F91B 2IS1A 3S3NA 1VZ0A 4PJLA 1AA7A 3QYFA 3EUHC 2X6XA 3W2VA 4HSRA 4ZDPA 3J7AY 4BE1A 1Y56A 3G2BA 4F3QA 4OAZA 4FASD 3DWLE 2KQRA 3H5RA 3DPUA 2MD0A 1T95A 3C2HA 3OWTA 3I9V2 2VXDA 4BE0A 1MW7A 1FMVA 4B48A 2KPMA 1WJ5A 2LBFA 3I3LA 3OYMA 2P0WA 2RQQA 5LD2C 2L9NA 1D0ZA 1WJCA 4XQFA 2DOAA 4BUPA 1BR4A 3FKJA 4AU7A 4ZYAA 1T0FC 3DQVC 1PYVA 2LH9A 1DQUA 3KEYA 1SAUA 2MYSA 2R7XA 4BS9A 4PJJA 3PNYA 3SZGA 3SEQA 2R7QA 2LY1A 3L2QA 4BDYA 2IS2A 3TBIA 2X1DA 4XKBA 2VJJA 4CZCA 4XOPA 2VJ4A 3LSGA 4XLEA 4E6KG 3HUGB 3TL4X 3K4LA 4G6TB 3EUKL 3UR3C 3MKYB 2E60A 4ZC3A 3DTKA 2KMUA 3K4NA 1WJAA 4IZZA 1WFXA 3LL7A 3IUOA 4D9JA 4CH7A 2WAQA 3S32A 2M0MA 2HDWA 2HQAA 2VIXA 4YRVA 3BC8A 4IKFA 3RSNA 3K70C 3QYBA 5CQEA 2Z1DA 3CP2A 2IGKA 2V1NA 2JUGA 3LSMA 4XOTA 4NQWB 2IXSA 4XL9A 2LOOA 2HZDA 4ZDOA 3MMYB 2VLAA 2V6EA 4HSTA 2X1EA 2W1OA 3VYTB 2F6CA 4E7LA 3PSIA 2X85A 4E7ZA 1V5EA 2KHMA 2JVHA 2WADA 3MKWB 1TT0A 2LRDA 2M4GA 4BXFA 2R7UA 2VPLA 3H5AA 4PSXA 4XKWA 2UUZA 3L2WA 1PJRA 3HPGA 3FBNB 4B3XA 3CJRB 2VASA 3OMYA 3UNGC 1Z21A 3ZQQA 3BCBA 3OIQA 3ZXSA 3BCAA 3PJRA 1V5FA 4RLQA 4CCNA 2IS6A 3V42A 2CFOA 1N77A 2M7AA 2QKLB 3IAS2 2IGNA 1WJDA 3DTEA 5CPRB 3A4CA 3S93A 4AVZA 3OYEA 4XR6A 4ZJZA 2NOJB 1WJEA 1YX3A 5FRMA 2BOLA 4ZTJA 4B44A 1ERDA 3MD2A 1U0JA 4BGDA 2GOXB 3C2GA 3OYCA 4CCLA 3VYUB 2HVSA 4HEA2 4C9YA 3D5LA 3RTRA 3DTIA 4CCMA 4BE2A 3ZGKA 2VQHA 1MMAA 3CF2A 4P1WA 2KL4A 1D0XA 1X4OA 1LVKA 2LBFB 4Y4RA 3H9JA 3AFHA 3K4MA 2MC4A 3DKXA 3GBGA 3K4CA 4QPQA 4E7SA 4R79A 3VYRB 2R7TA 2BW3A 5FROA 2VJIA 3K4JA 3HXLA 4RM3A 2HPIA 2OC6A 3W2WA 1SFKA 1QHGA 3DLAA 2X1CA 3CESA 1EA3A 4PFPA 4YELA 1JI8A 2R7OA 3NWTA 4F93B 3PL8A 2ZFUA 2R7SA 2DT7B 2R7WA 2CUJA 5HLTA 2DJIA 2JA2A 4RMNA 4U87A 1X1AA 2X6YA 3RCOA 4LITA 2KLOA 4C30A 4BQOA 3FHNA 2XF5A 2IGOA 1OLTA 1D0YA 2L7KA 1E0EA 2MABA 2L2OA 2V4JC 3NWSA 4XLHA 4BEHA 2QKMB 3HOSA 3H9GA 2E5ZA 2HNHA 2UWMA 4NC8A 1FMWA 2LG4A 4B47A 2JVGA 1R6RA 2K9MA 2VQCA 2VB6A 3DU6A 3K10A 4BU2A 5JHFA 2LREA 3SEZA 3ZCOA 4PJMA 4XONA 4MLOA 4PK4A 4F52A 1P9QC 2MFZA 3HG9A 1NG7A 2X51A 3ZR8X 4IQ4A 1LDKB 1OR7C 3U21A 5KCMA 1ZELA 2OV7A 3H5NA 3HL2A 3OIPA 4J00A 3LSKA 3BG6A 1QU3A 4HPQA 5LFAA 3ONQA 2IGMA 4YEJA 3ZRGA 2HPMA 4DGWB 3VDXA 2R7RA 3OYIA 1DGWY 2XDVA 4BL0B 3K4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XF5 A;  2XF7 A;  2XF6 A; 
#chains in the Genus database with same CATH topology
 1ZHF A;  3VYS B;  2G0E A;  3PQJ A;  2R92 J;  4OMY A;  3OL4 A;  5DUK A;  4EM0 B;  2GLO A;  4ETS A;  3OYF A;  2IS4 A;  2O5R A;  4U88 A;  4X1E A;  5IPA A;  3HOY J;  2PJR A;  3VSL A;  3OL3 A;  2A6T A;  2D1V A;  5M3F J;  2Y48 A;  2XF6 A;  4HQM A;  3FX3 A;  1O7L A;  1IV6 A;  4Y7N J;  4KFC A;  5HS7 A;  1W0U A;  3ZPL A;  1J09 A;  4HRI A;  4LK1 F;  2YSR A;  1L3L A;  2DMQ A;  3VOE A;  2GIV A;  1W7P A;  3NEU A;  3ABK H;  3TKY A;  1UAA A;  3PSF A;  4FIS A;  2LY2 A;  4Z6Y A;  2XVC A;  5JFR A;  1I1G A;  3P9C A;  5EZH A;  2DMT A;  2Z99 A;  3TED A;  4H4K C;  3G6E I;  4ENK A;  1G59 A;  2NAZ A;  4YFN F;  1FYL A;  3RZO J;  1YTY A;  4XN3 A;  1QHH D;  3JRD A;  1Z1D A;  3DU5 A;  2FF4 A;  3K1N A;  1TP4 A;  2NNN A;  3E0J B;  3IWZ A;  4X0G A;  5AIP A;  4BQQ A;  4CHU A;  1XD7 A;  1APL C;  3JAM K;  4UUV A;  4PZJ A;  4WXC A;  1XSX A;  2GBY A;  3E1S A;  5J8C A;  1V55 H;  2VE8 A;  2HEO A;  2M3A A;  3TQN A;  2W7N A;  1M1E B;  3HOV J;  1MH3 A;  2K9Q A;  3CMM A;  4BJ5 C;  1ETQ A;  1IDZ A;  3I4M J;  1IDY A;  3SQN A;  1T56 A;  1MMD A;  5IT9 Z;  2CMP A;  2KIF A;  2EIL H;  2AQE A;  3DP7 A;  2PFB A;  3BR0 A;  3GFL A;  4QSH A;  3BTI A;  2ZSH B;  4HYE A;  3WTX C;  1BIB A;  1FSE A;  1OCC H;  5CVU A;  4ZDL A;  2CO5 A;  5IYB J;  2CGP A;  2IA2 A;  3I5U A;  1W1W E;  4KUM A;  5D4R A;  1Z7L A;  3TOA A;  2O03 A;  2OQR A;  3Q9V A;  3H3V K;  1FEX A;  1J0R A;  3BZC A;  3F72 A;  2D45 A;  2DTZ A;  1TW3 A;  1ETO A;  4KMU X;  4RGX A;  2LVS A;  3KYL A;  5CVJ A;  1WZ2 A;  1SVM A;  4LG3 A;  4KIT B;  2L9V A;  1UB9 A;  5HOO A;  1TWF J;  1P4X A;  2VBY A;  4K2E A;  3CUO A;  1A35 A;  2BVM A;  1SMY F;  3S1Q J;  3LNQ A;  3WGH A;  3CME I;  1WH5 A;  1XMX A;  2K3P A;  3CMA I;  1QVT A;  3OYG A;  4DZP A;  4DW6 A;  3WGI A;  5TGT A;  4KT5 C;  4XLA A;  4DBQ A;  3G1L A;  2HKX A;  2OD5 A;  2W24 A;  3C2B A;  5DCM A;  3R0A A;  1R23 A;  4P5O A;  2HZT A;  3OR2 C;  4Y3O A;  1YJ9 I;  2W48 A;  5BOX A;  1YW7 A;  3N05 A;  2P6T A;  1TWA J;  4G7H F;  3CDL A;  1QO0 D;  2KIM A;  3FZV A;  4EJV A;  3S3M A;  5BPI A;  3LAJ A;  2W25 A;  2QM3 A;  2XGX A;  1ZR4 A;  1IRZ A;  1C0W A;  3VFZ A;  4WXD A;  5HNF A;  4ITV A;  1B59 A;  3WE2 A;  4RAF A;  2L4M A;  3CJT B;  3P7N A;  3ABT A;  2ZJ2 A;  3ZQC A;  1RUN A;  4UVB A;  3DF8 A;  3RYR A;  2H27 A;  1HA8 A;  3C3W A;  2XIG A;  4J19 A;  1X1B A;  4IX7 A;  4G7O F;  1GDT A;  1U8B A;  4D5F A;  3BR5 A;  3C18 A;  2A5W A;  2ZXI A;  1KYW A;  2VJ5 A;  3I4P A;  4AVP A;  2O6G E;  5CVR A;  1ZG1 A;  3K2Z A;  2Y31 A;  1LFB A;  2XGD A;  2DW4 A;  2QSG X;  3PNT A;  4F92 B;  2OUM A;  1H88 C;  1U2W A;  1JT6 A;  4HV6 A;  5C3E J;  3OR1 C;  3OYH A;  1TNS A;  2DMU A;  3BJ6 A;  4J01 A;  1E3H A;  2G7H A;  4XMY A;  4LFU A;  2X4H A;  5EZG A;  2WA0 A;  4CCO A;  2MD5 A;  5H6Q A;  4NB5 A;  2XV4 S;  3FXJ A;  2VQG A;  3ZQG A;  3F9K A;  3OYJ A;  3K0L A;  4ZYD A;  1YS6 A;  4D1Q A;  2B9S A;  3AAF A;  4LIU A;  2IA1 A;  1FC3 A;  1R00 A;  1JJ6 C;  5E3M A;  3HOU J;  4E7H A;  2W4S A;  1A5J A;  1G2H A;  4RM2 A;  1LB2 A;  1T39 A;  1OKR A;  2FNP A;  4RB0 A;  1R4N B;  4UUS B;  2EV0 A;  1DP3 A;  5K1Y A;  2E1N A;  2DU9 A;  4LB6 B;  3CLQ A;  2NXN B;  3O8H A;  2LP0 A;  4XOR A;  4HLY A;  1DDN A;  2FQ4 A;  4LLL A;  1Y6I A;  2D2W A;  1YO5 C;  2KRC A;  4BHC A;  2HOT A;  1ZGJ A;  3OS1 A;  3JRF A;  1UEL B;  3BG7 A;  4HOB A;  5EEG A;  1S8N A;  4NNJ A;  2EJR A;  2P4W A;  2CH0 A;  1GVJ A;  2E1M C;  1N25 A;  4G9Y A;  4DJA A;  2ZME B;  2YS9 A;  2HYJ A;  3QYE A;  1BN5 A;  2XRN A;  3GFJ A;  2R7V A;  1BI1 A;  4UB8 C;  1G8X A;  3K69 A;  4IHX A;  2CW7 A;  3D5S C;  1MKM A;  3TOB A;  1OCR H;  4L0Y B;  3S3N A;  1VZ0 A;  2PBI A;  3PO3 J;  1AA7 A;  3QYF A;  4GGG A;  2DBB A;  2OU2 A;  4HA8 A;  2FE3 A;  1DU0 A;  1Y56 A;  2YX7 A;  1VND A;  2KJB A;  6PAX A;  5M5Y J;  3AG2 H;  5LGU A;  1NH3 A;  1FWZ A;  3DWL E;  4NC6 A;  4IJA A;  2KQR A;  1XCV A;  3OWT A;  3I9V 2;  1SEU A;  2VXD A;  5DUI A;  1YJN I;  1GHC A;  1MW7 A;  1FIP A;  3GTO J;  3IL2 A;  1IV8 A;  1ZGA A;  1WJ5 A;  2LBF A;  3OYM A;  1MNM C;  4XBF A;  3T0Y A;  2H6B A;  1YW9 A;  2RQQ A;  2MH2 A;  3GWZ A;  1D0Z A;  4A3F J;  3TDU C;  1VTN C;  4XQF A;  2DOA A;  3FKJ A;  3DQV C;  2ESH A;  5GPA A;  1PYV A;  4MFE A;  1BL0 A;  4RAG A;  4Z2Y A;  2G9W A;  5ERI A;  1JHF A;  5GTH C;  3SEQ A;  3HOZ J;  2K7L A;  2K9S A;  2D5V A;  3L2Q A;  2V1D A;  2ZB9 A;  4AIJ A;  1D8K A;  3HOX J;  2ZBK A;  1LPQ A;  1ETY A;  2OQG A;  2X1D A;  4XKB A;  2IRF G;  3DKW A;  1ZYR F;  1X2N A;  5D5X B;  3ZMU A;  3TW7 A;  3M3Y J;  1B6A A;  2VJ4 A;  3HHH A;  3ABM H;  4YII A;  5DEQ A;  2LF8 A;  4OMZ A;  3EUK L;  3UR3 C;  5JR3 A;  1IN6 A;  4M74 A;  2RKH A;  3CCV I;  3GTJ J;  1WJA A;  1T6S A;  4CXF A;  3LL7 A;  2L7Z A;  3RPQ A;  2XKO A;  3IUO A;  3EYI A;  2XAH A;  3L9F A;  2H8R A;  2HQA A;  3QAH A;  5K5R A;  5LRS A;  4GCV A;  4HX7 A;  3CP2 A;  1PUE E;  2J5P A;  4A2U A;  2JPC A;  1HXD A;  2AXT C;  3O8G A;  4XL9 A;  2LOO A;  4LLG F;  2ZJR F;  1J59 A;  4HST A;  1YYV A;  2JA6 J;  2X1E A;  2W1O A;  1KQ8 A;  2TRT A;  4XLN F;  1HKS A;  5JVG F;  2FRH A;  4A0Z A;  2WAD A;  2QSF X;  2ZFW A;  5D4S A;  1IF1 A;  1BJZ A;  2STW A;  3RDI A;  3IRR A;  1XCB A;  3WHB A;  1YS7 A;  2BY2 A;  2YPR A;  3T8T A;  2K85 A;  2R93 J;  3GEZ A;  4PSX A;  1LUJ B;  1FTT A;  2ACJ A;  3HDD A;  2J5O A;  3MZY A;  2M9H A;  3GTK J;  4B3X A;  1POG A;  4NDL A;  2VAS A;  1Z91 A;  1XGN A;  3BCB A;  1S29 A;  1AU7 A;  1T08 B;  5D8K B;  5J8F A;  4KDP A;  3LSP A;  1DP7 P;  4RLQ A;  4CCN A;  2L01 A;  3V42 A;  1SD6 A;  1N77 A;  3QPL A;  2M7A A;  3MVP A;  2IGN A;  5ICC A;  4AVZ A;  3OYE A;  3RKY A;  2CQ7 A;  4XR6 A;  2QSH X;  3V7S A;  2NOJ B;  3KP2 A;  4DQ2 A;  4ZJZ A;  1VQ4 I;  4L9V A;  2LKX A;  4IHY A;  1J2X A;  3H0G J;  3GZ5 A;  1MBF A;  2GOX B;  3W6K B;  3RKQ A;  3U1D A;  1LVA A;  3VYU B;  3ERE D;  1LQ1 A;  4G8X A;  3MWM A;  2QGU A;  2COB A;  4FX4 A;  1V54 H;  1Y0N A;  2LFB A;  4P1W A;  2DQR A;  4RAY A;  2MG4 A;  1LVK A;  2L54 A;  3I58 A;  4Y4R A;  5E79 C;  2DK8 A;  3P5J A;  4A69 C;  3FIS A;  3ULQ B;  2VJI A;  1QBJ A;  2PQ8 A;  4RM3 A;  2RC4 A;  3FMS A;  2GZW A;  4MTE A;  5F27 A;  2OCC H;  5ED4 A;  2WTE A;  2ICW G;  3BG3 A;  2RAE A;  3CES A;  3FHZ A;  3NAU A;  5D8L B;  3NWT A;  3RIR A;  3PL8 A;  1VQ6 I;  1P4A A;  5HLT A;  2HFH A;  2DJI A;  1RKW A;  1X1A A;  4UUT A;  1SFE A;  1A36 A;  4C30 A;  1Z0X A;  2XAG A;  3ASO H;  1OLT A;  3LA2 A;  2FOK A;  5CLS A;  1E0E A;  1IC8 A;  1ETX A;  2HXO A;  3NRV A;  2DO7 A;  2E35 A;  4S04 A;  3K2A A;  2I5U A;  3FXK A;  2QWW A;  2EB7 A;  4IRH A;  3M7G A;  2E5Z A;  4JK1 X;  4D7M A;  4CGZ A;  5J3L A;  2MSY A;  3HOW J;  2R5Y B;  1XX5 A;  2QQB A;  1R6R A;  1SAX A;  4YFK F;  2JTV A;  2VB6 A;  5JHF A;  1S6L A;  1P7I A;  3GX4 X;  3SEZ A;  2VT3 A;  1O4X A;  1FOY A;  5M3M J;  3I59 A;  4OU0 A;  5KK1 A;  5IP6 A;  2I10 A;  4PJM A;  2M34 A;  4MLO A;  4PK4 A;  4FHT A;  3CCM I;  4F52 A;  3ABL H;  2MFZ A;  4MQV A;  3GW2 A;  4IHT A;  2M2E A;  1NG7 A;  1TC3 C;  1F1Z A;  2Y30 A;  1KZH A;  5HLG A;  3DEW A;  3ZR8 X;  3HYI A;  3M9A A;  4L5I A;  4KIG A;  4L9J A;  1AOY A;  3HL2 A;  1U9O A;  5M5W J;  3BR1 A;  4HPQ A;  1X3W B;  5E8I A;  1FPQ A;  4IPA A;  4HLX A;  3CF5 F;  2R7R A;  3VDX A;  4M3G A;  4FX0 A;  1VQO I;  2ISZ A;  5DCF A;  2A5Y B;  3HB9 A;  2QBY A;  1H8A C;  1DGW Y;  1PUF B;  3N97 A;  5IYC J;  3H35 A;  1IN5 A;  1NK2 P;  2EWN A;  1NG6 A;  3M1C A;  3QWL A;  1WI9 A;  2GIZ A;  2F4M B;  3E97 A;  3KZY A;  3GFM A;  4XNF A;  3CC7 I;  2VKH A;  3BJA A;  2HOS A;  1R5I D;  2FX0 A;  1XB4 A;  4LIV A;  3S2D J;  1X1D A;  3RYP A;  4CYC A;  2DJN A;  4A3K J;  2Q2E B;  1B8I B;  2TDX A;  5EEA A;  2M1B A;  2RNG A;  2IA0 A;  4CCJ A;  3DEE A;  2VBZ A;  4M6V A;  1O57 A;  2XAF A;  2JUC A;  3FF5 A;  1X2M A;  2I8D A;  5GTI C;  3OYK A;  3MZH A;  1JKP C;  1FY7 A;  2CRG A;  4DIQ A;  2A3S A;  3H0D A;  4RA2 A;  2M30 A;  1MH4 A;  4HNU A;  3G71 I;  2BW3 B;  3KET A;  3TDZ C;  1BW5 A;  4JBA A;  4ZTF A;  2E19 A;  3F8B A;  4PFO A;  3CJQ B;  3TP3 A;  3FXM A;  3S17 J;  3ASN H;  3HSR A;  4MO7 A;  1VQ8 I;  1T38 A;  1ZG3 A;  4PSW A;  3PM1 A;  1PDN C;  4A5N A;  3V7C A;  3BR2 A;  2CV1 A;  3HZJ A;  4NHJ A;  2Y0S N;  4E7J A;  2M8G X;  3MN2 A;  1L0O C;  2CQQ A;  4LGW A;  1GT0 C;  5J6X A;  3WG9 A;  4I01 A;  2HYG D;  2NVT J;  1Y1V J;  2XAU A;  2F5C A;  1DPR A;  2E1M B;  2WAF A;  1IG7 A;  3DPL C;  1UJ8 A;  2FD5 A;  1LFP A;  2RVC A;  4UVC A;  4CCK A;  3LFU A;  2Q1Z B;  2VKV A;  5L3F A;  3OYB A;  2M7B A;  2LD5 A;  1OMI A;  5K5Q A;  5DV5 A;  1J7K A;  1KA8 A;  3GTQ J;  2B7E A;  5K7H A;  1BIA A;  1HW5 A;  2IP2 A;  2QVO A;  2DTR A;  2P5K A;  2Z3Y A;  1U6G A;  2A6E F;  4W1U A;  2LDU A;  3H1C A;  3HKZ A;  5L3E A;  1CQT A;  1ON1 A;  3S3O A;  1X1C A;  2JSP A;  5F0F A;  4N9I A;  1WQ2 A;  1T98 A;  1MMN A;  1BI2 A;  2ELJ A;  1YW8 A;  5LHG A;  3L2V A;  1QPI A;  1X19 A;  4F55 A;  1BC8 C;  1BR2 A;  2JK3 A;  3LQQ A;  1YI2 I;  1S7A A;  3DBL B;  1K6Y A;  2PN6 A;  3PFI A;  5HOD A;  1F4K A;  5B1B H;  5KVR A;  1U8R A;  4YG2 F;  1RET A;  1IW7 F;  4HDV A;  2ZXJ A;  3DBH B;  3ZMS A;  2K5C A;  3KP5 A;  4TV7 A;  1QZE A;  2BVL A;  2EH3 A;  3K4B A;  2K9N A;  1MDM B;  4Y13 A;  1MMS A;  1P2F A;  2BHZ A;  4G6D A;  3LMM A;  3A01 A;  2QLZ A;  4OIN F;  3SXY A;  2IJL A;  3LSJ A;  2WY7 Q;  1IN8 A;  2NS8 A;  4B8X A;  4PUS A;  5E3O A;  3LST A;  1S9H A;  3L7W A;  3OYL A;  2PJR B;  1D8J A;  1QPM A;  3T1B A;  2JZY A;  1ETV A;  5CQG A;  4FTH A;  2LYC A;  4A3I J;  5H2F C;  1D3Y A;  1KQ9 A;  1MJB A;  3JRG A;  1HKT A;  1LJ9 A;  4HQE A;  4FE4 A;  3J80 Z;  3PFY A;  4QWQ A;  1HBX G;  2HVQ A;  3I0T A;  2LC2 A;  1KYZ A;  3OOP A;  1QA6 A;  1K79 A;  5H20 A;  1W7P B;  2A05 A;  2WY8 Q;  3QU3 A;  4P96 A;  4ANJ A;  3A2K A;  1X58 A;  5CKT A;  4O5V A;  4XSZ F;  2GWR A;  2DA1 A;  1IGN A;  3MFK A;  2VBW A;  4A3M J;  2O0Y A;  5B1A H;  1VQ7 I;  3TP0 A;  1MSE C;  5KAF C;  1QZZ A;  1RPW A;  3SYT A;  2Z16 A;  2M4K A;  2VOD A;  2VKE A;  2R4G A;  4UVA A;  5FKO A;  4Q4Z F;  2ZO4 A;  1J9I A;  4ENJ A;  5DM6 F;  3SJM A;  2P5V A;  2XUB A;  3BP8 A;  3HSE A;  1KQ0 A;  5D6F A;  3PNV A;  4I7H A;  3I56 I;  2E34 A;  2L5Q A;  2MBF A;  4GXO A;  3SDB A;  1OPC A;  3KCC A;  4L5J A;  5FKL A;  2R5Z A;  3FDY A;  4XLF A;  2CUE A;  2E1C A;  2XAJ A;  5GAG J;  4B43 A;  4YFX F;  4M71 A;  1K78 A;  2JMW A;  1OCP A;  2FJ1 A;  3GUD A;  3A1Y A;  3NQO A;  3BY6 A;  2HQR A;  2ZXW H;  2RGV A;  5LHI A;  4JP0 A;  2STT A;  1U9N A;  5ILU A;  4IOC F;  1WJF A;  1H9T A;  3EPZ A;  1G4D A;  4GFB A;  1HDD C;  2HGC A;  2K4B A;  4CA0 A;  3L2R A;  1B9M A;  4CIC A;  1GXP A;  1JT0 A;  3U2R A;  2CWE A;  1MD0 A;  3J7Y J;  1RUO A;  1FOK A;  3AL0 C;  1TTY A;  2QF7 A;  2HDC A;  3BLY A;  4RGS A;  4BDZ A;  1OJL A;  2IS1 A;  2OTL I;  2P7C B;  4OIO F;  2LLK A;  1CF7 A;  4XID A;  2PJP A;  2X6X A;  3W2V A;  3J7A Y;  1X3Z B;  3CDI A;  3G2B A;  1FP1 D;  1DPU A;  1OCT C;  4ZH4 F;  4D5C A;  3FXU A;  3ZQF A;  3DPU A;  2P81 A;  2VOO A;  1B72 A;  4BE0 A;  3KIO A;  1B9N A;  1LE8 A;  3TO9 A;  5DCM B;  2BGC A;  2ZKZ A;  5GAD J;  2Z5U A;  1W7P D;  2P0W A;  5FGM A;  3JRI A;  3S1N J;  1WJC A;  2ADU A;  3E3V A;  3V8J A;  3IH4 A;  1BR4 A;  1P92 A;  4AU7 A;  4LG0 A;  2LH9 A;  4BQA A;  1DQU A;  1LDJ A;  1XG1 A;  2MYS A;  1HDP A;  4BS9 A;  3PNY A;  1XTA A;  3DEU A;  4BKX A;  1ORK A;  2JA7 J;  4XIC A;  2CQX A;  5D5V B;  3E6B A;  4A6D A;  3HKZ N;  2LY1 A;  3ZN1 A;  5JVT A;  4A0Y A;  2YU9 J;  4S0H B;  3J81 K;  1STZ A;  2DQL A;  3TBI A;  4I09 A;  1XC5 A;  1GV2 A;  2O7O A;  4CZC A;  5FLV A;  5A2Q Z;  2AO9 A;  1YLF A;  4XLE A;  3M8F A;  2V9V A;  5HLH A;  4UY8 I;  3SHF A;  2LF7 A;  1P6R A;  3MKY B;  2XAQ A;  3WHC A;  2VUM J;  2KMU A;  3BTC A;  2P7V B;  1WFX A;  3RI4 A;  1I6H J;  3S2W A;  4HZF A;  4RAZ A;  2QEN A;  3S32 A;  3R60 A;  2BZT A;  4MIM A;  2VIX A;  2CFX A;  3F8M A;  1RI7 A;  5CQE A;  2Y75 A;  2ZCW A;  4BNC A;  1FTZ A;  2JUG A;  3LSM A;  3BWG A;  1MIJ A;  2OAZ A;  2CG4 A;  2YX4 A;  4ZDO A;  1LEB A;  4BYY A;  2EK5 A;  2HKO A;  4YIR X;  3N4M A;  3PSI A;  4LOC A;  2X85 A;  2B0L A;  2FXA A;  3GTL J;  1HLV A;  3HIF A;  1V5E A;  5J4Y A;  2JVH A;  1I6X A;  2UXN A;  4IO9 F;  2MGQ A;  1EF4 A;  4I02 A;  4ZYH A;  4G12 A;  1UHS A;  2M4G A;  4BXF A;  2A6H F;  1JTX A;  2R7D A;  5D6E A;  2L4A A;  4XKW A;  2WAQ N;  4A0X A;  4IEJ A;  4G6Q A;  4AWX B;  1IJW C;  1E3O C;  3ZOB A;  2OA4 A;  3E6D A;  2QQ8 A;  1PJR A;  1HOM A;  1ZN2 A;  1SD5 A;  3WU2 C;  5D5U B;  2DA6 A;  1Z21 A;  1GV5 A;  3ZQQ A;  2NS0 A;  3O6B B;  2V1X A;  2EA2 A;  4RB1 A;  3DLL F;  1RKT A;  1V5F A;  4X6A J;  2ME6 A;  3ZQL A;  1WI3 A;  1NHA A;  4M6Y A;  3C7J A;  2WV0 A;  3FXQ A;  2DA3 A;  2CFO A;  4RB2 C;  3UKG A;  2VBX A;  3GO5 A;  3GLX A;  3R61 A;  2ELH A;  3S93 A;  3MCZ A;  5FLX K;  4BHP A;  3P9K A;  3ML6 A;  1YX3 A;  3BR3 A;  4G7Z F;  1ETK A;  1QVU A;  2BOL A;  2E71 A;  4B44 A;  1ZQ3 P;  4BGD A;  4IF4 A;  3QP5 A;  5EJC A;  1S3J A;  4A12 A;  1SVL A;  3CC2 I;  4CZZ A;  3RTR A;  1WVR A;  3ZGK A;  2VQH A;  4M9Z A;  3CF2 A;  1XMK A;  4MGR A;  4A3J J;  2LBF B;  1UST A;  1MBE A;  3K4M A;  1YFH A;  1FNN A;  3GBG A;  4QPQ A;  1WH7 A;  3FM5 A;  5FKK A;  3VYR B;  2O8K A;  1JKR C;  2JRT A;  2OBP A;  2ZC2 A;  3M07 A;  5K7Z A;  2OC6 A;  1GXQ A;  5F0H A;  2NVU B;  3DLA A;  3HRT A;  4M3F A;  3WTZ A;  4ESJ A;  5IP7 J;  1E2X A;  3REO A;  1Z6R A;  2A07 F;  9ANT A;  2R7W A;  3HRM A;  2CUJ A;  2RV8 A;  2GQQ A;  3F8C A;  5HDK A;  3CCY A;  4U87 A;  3GXO A;  4Y52 J;  1QZY A;  3F3X A;  4HAM A;  3FHN A;  3GZN B;  2IGO A;  2ZNY A;  3S15 J;  5FKN A;  1BA5 A;  2CUF A;  2V4J C;  5EDN A;  4XLH A;  4BEH A;  1BW6 A;  1YJW I;  1YQA A;  3ZN0 A;  3H9G A;  1TLH B;  3FK7 A;  2LG4 A;  1ITY A;  3JAM Z;  3KP6 A;  3ZQI A;  3GLL A;  5DS9 A;  1AWC A;  3PUF A;  2KRF A;  4BBR J;  2M8E A;  5L3G A;  1XSV A;  1XMA A;  3ZCO A;  2BY3 A;  4KIC A;  3GTG J;  2LY9 A;  4XON A;  3F8F A;  4AIK A;  1ZKG A;  2IPQ X;  2K02 A;  2ZJQ F;  1HSJ A;  3HG9 A;  5M5X J;  4A5M A;  3KYD B;  2E2H J;  5F04 A;  1F43 A;  3FWE A;  4IQ4 A;  1SFX A;  2EIJ H;  2Y0M A;  5KCM A;  3HM5 A;  5CVV A;  2OV7 A;  2XSD C;  4C3I J;  3MAJ A;  4KN4 X;  1T0F A;  1ODD A;  3SFZ A;  5ICG A;  1QU3 A;  5LFA A;  3ONQ A;  3Q0W A;  3H3U A;  2QUF A;  1B4A A;  5FFX A;  3OYI A;  5EG0 A;  5LRR A;  2HS5 A;  4LB5 A;  3IH3 A;  3K4K A;  3KEQ A;  4BXU A;  2TCT A;  2DPD A;  1IUF A;  2EIK H;  4NUB A;  1IZ1 A;  5J1R A;  2XPW A;  2OCE A;  3KX2 A;  3FXR A;  1ZRD A;  2GXG A;  2L9R A;  3SZT A;  4MEX F;  4CSW A;  2HR3 A;  3QOE A;  2VQL A;  3M1E A;  3HGG A;  3FXO A;  2Y0S A;  4XM3 A;  2ME0 A;  5TIS C;  2HXI A;  1Z77 A;  1P4W A;  2UV1 A;  1BI3 A;  2WB1 A;  1JE8 A;  3IAM 2;  2L0K A;  4CUG A;  4HF2 A;  1H9G A;  2CW8 A;  4EV0 A;  4M3B A;  2DOF A;  3TMO A;  2BEO A;  2CV2 A;  5E17 F;  3F6V A;  5LHH A;  2NVX J;  2G7U A;  2ZSI B;  2VT2 A;  2VOP A;  4HNT A;  2QA4 I;  2V1U A;  3B02 A;  3I4N J;  1KU7 A;  2FML A;  2HOE A;  2ZJP F;  4RLF A;  2H6C A;  2L7F P;  2HDD A;  2GXA A;  3VPR A;  4KIS A;  2JA8 J;  3IP4 B;  4RS8 A;  1ONV A;  4II3 A;  3J7Z I;  1BJA A;  2PEX A;  4QPO A;  2P8T A;  2GXB A;  3E6C C;  3BZ6 A;  1IN4 A;  5HDN A;  1TL8 A;  2KDO A;  4HW0 A;  5J47 A;  3H3Z A;  3Q9S A;  4I6Z A;  5JHU A;  2COM A;  1G3S A;  3KYC B;  1ON2 A;  2IAI A;  2HQ5 A;  2K4J A;  1G3Y A;  2CU7 A;  1SFO J;  3HBL A;  3L2C A;  3AL0 B;  1YE9 A;  5J4V A;  1DU6 A;  2DT5 A;  4XLC A;  2RDP A;  4D7N A;  1K4T A;  4JX5 A;  3FXL A;  4I2O A;  3CTA A;  4KNY A;  2KZV A;  3FBI B;  4Y15 A;  3ZMV A;  5F1J A;  2IEK A;  4FT8 A;  3M8J A;  2BBY A;  2P6S A;  2ISY A;  4GYI A;  1D1B A;  3VWB A;  4E7I A;  4MEY F;  3WU1 B;  3I59 B;  1R9T J;  4MFD A;  2KZG A;  4ENM A;  1D1C A;  3LSI A;  2V9P A;  3W6J B;  3DXJ F;  1F5T A;  4B09 A;  2VL8 A;  2A68 F;  2QCO A;  4KIB A;  1XSD A;  4A93 J;  3V8K A;  3K1M A;  1AKH A;  3ECH A;  5CYV A;  1UG0 A;  2DI3 A;  2GOM A;  1ZR2 A;  4L9T A;  1IXC A;  1YG2 A;  5AIQ A;  1V5G A;  4F7Z A;  1JTY A;  2F4O B;  3QQA A;  5LEJ A;  2DFE A;  4UNO A;  1Y39 A;  3LQR A;  4C2M J;  2WWY A;  4AM3 A;  4PJ0 C;  5IOY A;  3HGY A;  2QBY B;  1TZL A;  3ABU A;  3FM3 A;  1XPX A;  1WSU A;  5EGO A;  2VXZ A;  2Y69 H;  1Y8Q B;  2NNY A;  3SFI A;  3ZMD A;  1D1A A;  3ERM A;  4XKC A;  5E18 F;  4XSX F;  3PUB A;  5FO5 A;  4BJT A;  4EJO A;  2DDA A;  4O6J A;  3H92 A;  3BPV A;  4HG2 A;  4E7K A;  5L3C A;  1IRX A;  1WWX A;  3K6G A;  3S16 J;  1WRJ A;  1HCR A;  2R7Z J;  4EEF G;  1ULY A;  2F48 A;  4CYC B;  1VQM I;  1F9N A;  1OYW A;  5K5O A;  2E7W A;  2CV0 A;  1JKO C;  1YRN A;  1IXS B;  1HW1 A;  1LNW A;  1YX5 A;  4KT6 A;  2CQN A;  1MMG A;  3CUQ A;  2F2E A;  3KP7 A;  1K6O A;  3ECO A;  4N4N B;  1R71 A;  2EFW A;  4IHV A;  2CUZ A;  3HUG A;  2E2I J;  1LFU P;  3JSO A;  3RQ4 A;  4OWR B;  2BE5 F;  2YU3 A;  4B3A A;  3OYN A;  1IAW A;  4AYB A;  2KT0 A;  4L0Z B;  2Q0O A;  2V79 A;  5IT9 K;  4PGG A;  4I0B A;  3JR9 A;  2K9L A;  2H94 A;  3RQI A;  3H9Q A;  4JOM A;  1R5G A;  3DFG A;  3CP8 A;  1OR7 A;  2CSO A;  3I71 A;  4NQW A;  2WC2 A;  1W36 C;  1N78 A;  2KKO A;  1KU2 A;  2M87 A;  3IC7 A;  4RGR A;  1EV7 A;  1JXS A;  2X0L A;  4BQN A;  4EVI A;  2KRH A;  1K83 J;  1EH6 A;  2ZXH A;  4OIR F;  4XKV A;  3KLN A;  2M5W A;  5CVI A;  1NK3 P;  5E8G A;  1ZRC A;  5LBQ A;  1USS A;  1FLI A;  2FOW A;  5CJ9 A;  1ZK8 A;  1OCO H;  2KIQ A;  1U5T A;  1WHU A;  5F6F A;  1T33 A;  2ECB A;  2MLG A;  4Q48 A;  1R1V A;  2Z2S B;  1VF9 A;  1TWH J;  2WB1 N;  3QOD A;  2Y9Y A;  3VSK A;  5FLM J;  3CZ6 A;  4W97 A;  4IQJ A;  2BY0 A;  4EAT A;  2DAO A;  2XGC A;  1X4P A;  1FX7 A;  1I39 A;  4Y33 A;  2EFP A;  2UXX A;  4Q5S F;  5KHD A;  2XF7 A;  4HF0 A;  1TWG J;  3KZZ A;  1DGR M;  4I0A A;  3V8L A;  3FIW A;  4JQF A;  1O3R A;  1R36 A;  1BR1 A;  3CMY A;  2FNA A;  1I1S A;  3PIO F;  1W0T A;  3IV5 A;  4XRF A;  1ZRF A;  2RN7 A;  2E36 A;  4HSR A;  4BE1 A;  4YIF A;  1MSF C;  4F3Q A;  2GA2 A;  4FAS D;  1HKQ A;  4ZYG A;  3Q5F A;  4RB3 C;  3EQL F;  3KLO A;  4GDF A;  1QGP A;  2LSO A;  4B48 A;  3LFK A;  1RZ4 A;  3A01 B;  3V7R A;  1FJL A;  4BBS J;  3I3L A;  4R8H A;  4BY7 J;  5LD2 C;  2YR2 A;  2DPU A;  5B3S H;  1XGM A;  4CYD A;  1K4S A;  3CO6 C;  1T0F C;  1VQN I;  3KEY A;  4RBO A;  1SAU A;  3A03 A;  1V4R A;  2R7X A;  1MGT A;  3SZG A;  3Q3S A;  2ECC A;  3R6S A;  1R58 A;  4BDY A;  2DA2 A;  2D1H A;  2HTJ A;  2XPV A;  1MBK A;  4WX9 A;  4FCY A;  3F23 A;  3G3Z A;  4XOP A;  2FBK A;  4E6K G;  3F0C A;  3TL4 X;  4G6T B;  1K61 A;  2E60 A;  2E7X A;  3T8R A;  3RKW A;  2NOG A;  3OSF A;  3ZQH A;  1RIO H;  4PCQ A;  4KYW A;  2H8W A;  2LNB A;  4WXH A;  4AD9 A;  4IRI A;  1IRG A;  1S7E A;  2WAQ A;  4BAY A;  2M0M A;  1I50 J;  2HDW A;  2EIM H;  5DTD A;  2EV5 A;  4YRV A;  3BC8 A;  4A3B J;  3RSN A;  3BZK A;  3QYB A;  1MJ9 A;  1MBG A;  2Z1D A;  4XOT A;  1Y0U A;  1GVD A;  2PLY A;  3CDH A;  1A04 A;  2HZD A;  2XGE A;  4HX8 A;  1KU3 A;  2X9D A;  2VLA A;  2F6C A;  4E7Z A;  2R5Z B;  1Y8R B;  3JSP A;  1DUX C;  4LMY A;  2KHM A;  1JGG A;  1TT0 A;  3LOC A;  2M45 A;  5J1Y A;  1K78 B;  1R4M B;  3HHG A;  2P5L C;  2QQ9 A;  2LRD A;  2R7F A;  4HBL A;  2VPL A;  1TQP A;  3H5A A;  5KAI C;  2UUZ A;  2BY1 A;  2CJJ A;  4PDK A;  4IXA A;  5HS9 A;  3O2P E;  3HPG A;  5BQT A;  3CJR B;  3UNG C;  5F08 A;  1UG2 A;  2Q8K A;  5EEH A;  1EKE A;  3D0S A;  3ZXS A;  3BCA A;  5JI6 A;  2HI3 A;  2FSW A;  2BXZ A;  2IS6 A;  4AYB N;  2DFI A;  3ROU A;  1X3U A;  2QKL B;  3GCM A;  1NTC A;  3IAS 2;  1WJD A;  3DTE A;  5CPR B;  1OCZ H;  3A4C A;  1D5Y A;  1VFC A;  1CF7 B;  4V2F A;  1ACI A;  2QYO A;  1EH7 A;  1HST A;  5FRM A;  2JA5 J;  3R0J A;  4QLC U;  3BG5 A;  5LGT A;  1F36 A;  2VN2 A;  3C2G A;  3HTU A;  1WGX A;  4CCL A;  1HW2 A;  1T8I A;  3D5L A;  1B72 B;  5JLX A;  3JRA A;  2DMP A;  5FB2 A;  1MMA A;  1LE8 B;  2KL4 A;  1D0X A;  2O61 A;  2AXL A;  1X4O A;  2OTJ I;  1I3A A;  2DLL A;  5C44 J;  1X1P A;  3AFH A;  5J1U A;  3WE3 A;  2H1K A;  2MC4 A;  3DKX A;  4E7S A;  3K4C A;  5ICF A;  2W84 A;  2NVY J;  4BH9 A;  4R79 A;  3WTU C;  2BYV E;  1BM9 A;  2EQR A;  2R7T A;  3BJO A;  3JW4 A;  5FRO A;  3RZD J;  4LG0 B;  1D5V A;  1OIS A;  2NYX A;  3B6C A;  2HPI A;  3IH2 A;  3WOD F;  3CO7 C;  1SFK A;  2QQA A;  2X1C A;  3GTM J;  1LEA A;  1EA3 A;  4PFP A;  4FQG A;  3AG1 H;  3VEP A;  5E3N A;  2EV6 A;  1MBH A;  4F93 B;  3LSR A;  2ZFU A;  2R7S A;  2DT7 B;  2OJE D;  1H0M A;  1A31 A;  1SMT A;  3H36 A;  5DD4 A;  5ILV A;  5DYM A;  2JA2 A;  2OPT A;  4RMN A;  2X6Y A;  3RCO A;  2DA7 A;  1U78 A;  3QOP A;  4BQO A;  5GPC A;  4OIQ F;  4L9N A;  1D0Y A;  3SZP A;  4CDG A;  1VQP I;  2L7K A;  2XPU A;  3JTG A;  2VON A;  2L2O A;  4C3J J;  1UCR A;  2UZK A;  4N0B A;  2QKM B;  3HOS A;  2HYF A;  4A3L J;  2HNH A;  5ILS A;  4KIF A;  1Z7U A;  2UWM A;  4NC8 A;  3CUQ C;  1U3E M;  5LEK A;  1FZP B;  3EUH A;  2JVG A;  2K9M A;  4OIP F;  2VQC A;  2MW8 A;  4ESF A;  4IOA F;  2LRE A;  2VC1 A;  3LAP A;  5B5E C;  4GO1 A;  1RES A;  4H0E A;  5BS6 A;  5TJJ A;  1TQM A;  1I5Z A;  2FA5 A;  2NS7 A;  2PG4 A;  2XRL A;  2JWT A;  1P9Q C;  2BHY A;  2PI0 A;  3G1M A;  2JPB A;  1B1B A;  1UMQ A;  4M3E A;  1OR7 C;  1VQ5 I;  2XAS A;  4EJW A;  3A02 A;  4U7D A;  1ZGW A;  1JJ8 C;  4J00 A;  3OIP A;  3V4G A;  3BG6 A;  3ZMT A;  1Y1W J;  1SFU A;  1S72 I;  1O3T A;  2IGM A;  4YEJ A;  3ZRG A;  1QQI A;  2HPM A;  3GTP J;  3ELK A;  3PQK A;  3JCU C;  3I55 I;  2XDV A;  3I53 A;  4BL0 B;  2EZK A;  3MEX A;  1U5T C;  3BTL A;  1BBY A;  3GF2 A;  1S7O A;  2VKD A;  4U0V A;  3WTV C;  3EDP A;  3W3C A;  4IRG A;  3QRF F;  1JUS A;  1KU9 A;  3LWF A;  3BDD A;  5HS8 A;  3OY9 A;  5DD8 A;  1E17 A;  4ASN A;  3JRH A;  2W00 A;  3HRU A;  2K86 A;  3CCQ I;  4KA4 A;  3VB2 A;  1FBS A;  3M4O J;  3ESW B;  2GAU A;  1JHH A;  2DFF A;  1Q1V A;  3D5R C;  4PJN A;  1ZAR A;  1XN7 A;  3G73 A;  3O3K A;  1BC7 C;  5IT3 A;  2F5F A;  3HEF A;  4BAC A;  2LMD A;  2FBI A;  1UHM A;  2DYR H;  5L3B A;  2L9S A;  2FUG 2;  2YUS A;  4KJZ A;  5LGN A;  1ZLK A;  4BY1 J;  2EZL A;  4HNV A;  3QPS A;  5IY5 H;  2E5N A;  3RPU A;  4O3M A;  1P7J A;  2JN6 A;  1G6N A;  4AC0 A;  1JKQ C;  2EBI A;  2F5V A;  3GVA A;  5LLQ A;  2CYY A;  2KIU A;  3WGG A;  4OAY A;  2EZH A;  5E1Z B;  3KFW X;  1FT9 A;  2JRM A;  3GYH X;  3B6A A;  1FP2 A;  4DZJ A;  4LLN A;  2DOE A;  4DNC A;  2HWV A;  4A3G J;  1IXR C;  2X48 A;  2DDB A;  3P9I A;  2KFD A;  3G4S I;  4IL6 C;  2IW5 A;  3DPT A;  2EA4 A;  2KJC A;  1OYY A;  1YIJ I;  3KZI C;  4M6X A;  4DYQ A;  4DBR A;  1PP7 U;  1MNE A;  4ABZ A;  2CQK A;  4BEH B;  5HLI A;  1BOA A;  2Y2Z A;  2DA4 A;  4UUS A;  2DYS H;  3JRC A;  2HVR A;  4AIH A;  4I99 C;  2XHK A;  3LA3 A;  3DKY A;  3JRE A;  2L02 A;  3OYD A;  3D1N I;  1BOB A;  3CCJ I;  3K9T A;  1EH8 A;  1VI0 A;  4II2 A;  2NVQ J;  3CJN A;  2ID3 A;  3OS0 A;  2ZME A;  2X6W A;  2HU9 A;  4M9X A;  5HVQ C;  2XC7 A;  1R22 A;  4QTR A;  2CS3 A;  1WJB A;  1SC7 A;  5H6R A;  2PMU A;  3B73 A;  3K70 D;  3S1M J;  2K40 A;  4RDU A;  1CGP A;  4XN0 A;  1Z3Y A;  1XDU A;  1I3Q J;  2CW0 F;  1XDS A;  2PMH A;  2PMZ A;  3HPH A;  3IKV A;  3TO6 A;  1Z9C A;  4EM1 A;  1HF0 A;  3GZ6 A;  5HNH A;  3AG3 H;  3BT9 A;  3K7A J;  3CD6 I;  2FQ3 A;  3S14 J;  2FU4 A;  3DBR B;  3RPU D;  4C2U A;  4FET A;  1YHQ I;  2DXI A;  3EUA A;  5F64 A;  5FRN A;  2V26 A;  2O8X A;  4N9H A;  5ICE A;  1S5L C;  1SAN A;  3CCL I;  2NRA C;  1LDD A;  5EG0 B;  3IHU A;  1R5H A;  1G3W A;  1MJA A;  2XKP A;  3BRO A;  4DYR A;  3X2Q H;  5EF6 A;  2V9K A;  1WPK A;  2DT6 A;  3HRS A;  1O3Q A;  2R0Q C;  4P9U A;  3L2U A;  1KON A;  1W36 D;  2L3D A;  2KP6 A;  1UHW A;  1ETW A;  3A0H C;  2AQF A;  5KNL A;  2V7F A;  1GUU A;  2DFH A;  1MND A;  3OOU A;  4B1R A;  2VE9 A;  1VQL I;  4B4C A;  3CCE I;  5J40 A;  1SD7 A;  4AID A;  2JQ7 A;  2WAE A;  5E1X A;  4C2T A;  4HF1 A;  3L00 A;  3E7L A;  3ZP5 A;  2VI6 A;  1TQI A;  5DDG A;  3BG9 A;  1N75 A;  3Q0U A;  1SVO A;  1R49 A;  1Z3X A;  2MC3 A;  3S2H J;  3PO2 J;  2FEZ A;  3S1R J;  3KP4 A;  4ZZL A;  2WBM A;  4ESB A;  1GLN A;  3CLO A;  2GM4 A;  2MLK A;  2L7M P;  1O3S A;  1VQ9 I;  3EET A;  3MKZ A;  3W2A A;  2O3F A;  5BNG A;  5K7F A;  3HSF A;  5FD5 A;  4D0P A;  3S8P A;  3MQ0 A;  5IYD J;  2E2J J;  1V3F A;  3F8N A;  4EGY A;  1JUM A;  4JX4 A;  3J81 Z;  2IVM A;  2F4I A;  4EMS A;  3CCU I;  3I54 A;  4M73 A;  3AKZ A;  3IKT A;  3VOD A;  4NC7 A;  2RNJ A;  2RRE A;  3MKL A;  3WG7 H;  1YIT I;  1IUY A;  3U9G A;  1LKX A;  4UB6 C;  4M9S A;  3HOT A;  2AS5 F;  4QIW N;  4A3E J;  2HQN A;  3K1P A;  1RR7 A;  3KPH A;  1ZTR A;  3I64 A;  2EPF A;  4MNU A;  3TO7 A;  1ZH5 A;  4ON0 A;  2OZU A;  4E4H A;  1K7A A;  3RKX A;  2ETH A;  2K3F A;  3HC7 A;  1PP8 F;  4BJ6 C;  1ZRE A;  2DOD A;  2DCE A;  2HTS A;  3DCF A;  4IHS A;  4DOZ A;  3OYA A;  3LSH A;  4MTD A;  3J7A O;  4EJU A;  2W82 A;  1KGS A;  4JYK A;  3OV8 A;  1IN7 A;  4GRI A;  4L18 B;  2ID6 A;  3F6O A;  4GYG A;  2XSJ C;  2LKP A;  2V6C A;  5L3D A;  5FD6 A;  4R1H A;  4N4O B;  3E5Q A;  4A3D J;  3OS2 A;  4P9F A;  1WKM A;  4U7B A;  4M3D A;  4F91 B;  4BXX J;  2QZ8 A;  1QRY A;  1OYI A;  2K27 A;  4PJL A;  4I98 B;  3EUH C;  1RNL A;  1W4M A;  4WCG A;  3DV8 A;  4ZDP A;  5GP9 A;  4C3H J;  4E70 A;  1BI0 A;  1AKH B;  1R7J A;  4HX4 A;  3WTT C;  4OAZ A;  3BTJ A;  5IP9 J;  3L1P A;  1HC8 A;  1MZB A;  3H5R A;  4HDU A;  4P55 A;  2MD0 A;  2X6O A;  1T95 A;  4S05 A;  2BXY A;  3C2H A;  4WWC A;  1REP C;  5C4J J;  2LKS A;  2O9L A;  3J80 K;  1FMV A;  4UXN A;  2KPM A;  1VQK I;  2R3S A;  5EGO B;  4U0Y A;  1WCM J;  1Z05 A;  4RGU A;  5GAE J;  1G3T A;  2L9N A;  4A3C J;  5FLX Z;  4BUP A;  5E3L A;  5BPD A;  4ZYA A;  5DM7 F;  2AHQ A;  1HQC A;  5AON A;  5EYR A;  2A61 A;  4PJJ A;  4UV9 A;  2M0C A;  1R1T A;  2BV6 A;  4UV8 A;  3FK6 A;  1FYM A;  3OSG A;  1FBU A;  2R7Q A;  3KE2 A;  5FKM A;  1YRN B;  4KN7 X;  2IS2 A;  3FMR A;  1SD4 A;  1AHD P;  2VJJ A;  3CUQ B;  3CCR I;  3Q0V A;  3LSG A;  1W5S A;  3QPT A;  4I76 A;  3JRB A;  1JGS A;  1MBJ A;  2DA5 A;  3LA7 A;  3HUG B;  3BOQ A;  4IVN A;  4NBQ A;  3K4L A;  3CCS I;  3FMQ A;  1ZG5 A;  4A6E A;  1YOV B;  4ZC3 A;  3DTK A;  3K4N A;  2PMZ N;  4IZZ A;  4LJZ F;  4PGH A;  1FSH A;  3WU0 A;  3HTS B;  4D9J A;  4CH7 A;  2RQP A;  3OIO A;  4XK4 A;  2JT1 A;  3BQY A;  2ELK A;  1A6I A;  1JUP A;  4IKF A;  3K70 C;  4EGZ A;  2R5Y A;  2IGK A;  2V1N A;  4XRS A;  4NQW B;  2H1L A;  3F21 A;  2IXS A;  4CO8 A;  2H09 A;  1TWC J;  3ZMZ A;  4LK0 F;  3MMY B;  2V6E A;  1RC9 A;  2KIS A;  3EYY A;  2EFN A;  1OFC X;  3VYT B;  4E7L A;  3COA C;  1EJ9 A;  1Z6T A;  5TRD A;  1R1U A;  3E5U A;  5E20 A;  3MKW B;  3FKI J;  3E6M A;  2Y9Z A;  1ENH A;  2HOA A;  2R7U A;  2MH9 A;  1U5T B;  5BMZ A;  4M72 A;  5FJ8 J;  1W5T A;  5IOZ A;  2GA1 A;  1PVE A;  1IRF A;  1TNT A;  4L5E A;  5B66 C;  3L2W A;  3FBN B;  2DMN A;  1XS9 A;  4V19 K;  3OMY A;  1Q1H A;  4Q47 A;  3U1K A;  2QEX I;  2ESN A;  1FOW A;  3IWF A;  1QNT A;  3OIQ A;  3TW6 A;  2C6Y A;  5GAH J;  2VC0 A;  1T2K A;  4UHT A;  5HDG A;  1J5Y A;  3PJR A;  1RR8 C;  4ZYE A;  2ZNZ A;  3G1O A;  1PUF A;  3NAR A;  3L09 A;  2KDZ A;  4LD5 A;  1WJE A;  4IHW A;  1FIA A;  2WV1 A;  4ZTJ A;  3HJE A;  4BHB A;  2XRO A;  2N8G A;  1ERD A;  3MD2 A;  1U0J A;  1FOX A;  3OYC A;  1B8I A;  2Q2E A;  2ZME C;  2HVS A;  3C1D A;  3KP3 A;  1XGS A;  4HEA 2;  5JLW A;  4C9Y A;  5F1R A;  3RJP A;  3DTI A;  4CCM A;  4BE2 A;  3CQZ J;  4ZZD A;  1IO2 A;  3WTW C;  2E1O A;  3R4K A;  1Z67 A;  3QPH A;  4G94 A;  1I27 A;  5A2Q K;  3H9J A;  4MQ9 F;  2OZ6 A;  3ZQ7 A;  2DN0 A;  1E3P A;  3BPX A;  3QU6 A;  4WF2 A;  4AUX A;  2BW3 A;  1FYK A;  3T5X A;  3K4J A;  4EQQ A;  1UFM A;  3HXL A;  1ZLJ A;  3WTS C;  2IT0 A;  2B63 J;  3W2W A;  1QHG A;  5F0C A;  3BQZ A;  3JTH A;  3MZ8 A;  3TGN A;  4MHG A;  4YEL A;  4ENN A;  2R7O A;  1JI8 A;  4XRS G;  2FBH A;  2FMY A;  1A6Q A;  1YIO A;  1O7F A;  4LIT A;  4XRM A;  1OQY A;  2KLO A;  4KMF A;  2F5E A;  2Z9O A;  4DYC A;  4WK8 F;  2XF5 A;  2XB5 A;  2LK2 A;  2Z33 A;  2EFQ A;  2XB0 X;  2VPR A;  2MAB A;  4XLP F;  4JX6 A;  3W6V A;  2LTP A;  1UZC A;  3A0B C;  3NWS A;  1XGO A;  4U0W A;  2MA3 A;  5E1W A;  1RRJ A;  3E5X A;  1FMW A;  2PX9 A;  3KEO A;  1TW2 A;  3SDG A;  4B47 A;  3QP6 A;  5C4X J;  2W57 A;  3BR6 A;  4HV5 A;  1W5C C;  3DU6 A;  3K10 A;  4BU2 A;  1FBQ A;  2JJ7 A;  4OOI A;  4EM2 A;  1J75 A;  2LR8 A;  4EJT A;  5D5W B;  2JSC A;  2OF7 A;  4FE7 A;  1TT5 B;  4Y17 A;  2X51 A;  3M8E A;  3F22 A;  1ZAO A;  1LDK B;  2F5D A;  3U21 A;  3CC4 I;  1TBX A;  5FFZ A;  3WTY C;  1ZEL A;  2EFO A;  4V2G A;  2A69 F;  3IRQ A;  3AG4 H;  2DK5 A;  3H5N A;  1H89 C;  3LSK A;  2W85 A;  3GME A;  3ISP A;  2EZI A;  4DGW B;  1MDM A;  2EIN H;  3PIP F;  3GFI A;  2IBD A; 
#chains in the Genus database with same CATH homology
 3H35 A;  2VKD A;  3VYS B;  1NG6 A;  3M1C A;  3OL4 A;  3W3C A;  3OYF A;  4NUB A;  2IS4 A;  4XNF A;  3KX2 A;  2O5R A;  2VKH A;  3OY9 A;  2PJR A;  2W00 A;  4CSW A;  4LIV A;  3VSL A;  1X1D A;  2A6T A;  3OL3 A;  2VQL A;  3QOE A;  2Q2E B;  2XF6 A;  2Y0S A;  4XM3 A;  3D5R C;  2RNG A;  4PJN A;  4CCJ A;  2UV1 A;  3DEE A;  2WB1 A;  4HRI A;  1J09 A;  3IAM 2;  2I8D A;  4CUG A;  3OYK A;  4BAC A;  2CW8 A;  3TMO A;  1UAA A;  2CV2 A;  3PSF A;  4DIQ A;  2L9S A;  2FUG 2;  2LY2 A;  4KJZ A;  3H0D A;  4HNU A;  2BW3 B;  2ZSI B;  4HNT A;  4H4K C;  2E5N A;  4ZTF A;  1G59 A;  4PFO A;  3CJQ B;  4XN3 A;  2F5V A;  1QHH D;  3DU5 A;  4OAY A;  4PSW A;  4RLF A;  2CV1 A;  3E0J B;  4KIS A;  4X0G A;  3IP4 B;  4BQQ A;  4E7J A;  4II3 A;  4QPO A;  3E1S A;  2KDO A;  2M3A A;  3DPT A;  2W7N A;  2XAU A;  3CMM A;  4BJ5 C;  2WAF A;  2E1M B;  4DBR A;  3DPL C;  1MMD A;  2CMP A;  1LFP A;  2AQE A;  4CCK A;  1MNE A;  3LFU A;  2Q1Z B;  3AL0 B;  4BEH B;  1YE9 A;  2M7B A;  3OYB A;  4XLC A;  2ZSH B;  2HVR A;  4ZDL A;  2KZV A;  3FBI B;  3DKY A;  3OYD A;  1BOB A;  3M8J A;  4II2 A;  1Z7L A;  1D1B A;  3HKZ A;  3VWB A;  4E7I A;  3OS0 A;  2X6W A;  2HU9 A;  5HVQ C;  2XC7 A;  3S3O A;  2CS3 A;  3KYL A;  1X1C A;  1D1C A;  2JSP A;  3LSI A;  1WJB A;  1MMN A;  2ELJ A;  3K70 D;  4LG3 A;  4KIT B;  2VL8 A;  3L2V A;  1X19 A;  4XN0 A;  1Z3Y A;  4F55 A;  5HOO A;  1BR2 A;  2PMZ A;  3HPH A;  1K6Y A;  2BVM A;  5HNH A;  1UG0 A;  2GOM A;  2K3P A;  3RPU D;  4C2U A;  4FET A;  3OYG A;  1V5G A;  2DXI A;  3EUA A;  2K5C A;  2BVL A;  5TGT A;  3K4B A;  2V26 A;  4XLA A;  4DBQ A;  5FRN A;  3LMM A;  1TZL A;  2VXZ A;  4P5O A;  4Y3O A;  3OR2 C;  2V9K A;  2DT6 A;  1D1A A;  3L2U A;  1KON A;  2WY7 Q;  4XKC A;  1W36 D;  3PUB A;  2KP6 A;  4BJT A;  3N05 A;  2AQF A;  4PUS A;  5KNL A;  3S3M A;  1S9H A;  4HG2 A;  4E7K A;  3OYL A;  2V7F A;  2PJR B;  1MND A;  1IRX A;  3K6G A;  5CQG A;  3OOU A;  2LYC A;  5HNF A;  4C2T A;  2WAE A;  4ITV A;  2CV0 A;  3PFY A;  2HVQ A;  1N75 A;  2LC2 A;  4KT6 A;  1YX5 A;  1Z3X A;  1MMG A;  1HA8 A;  2WY8 Q;  4ANJ A;  4N4N B;  3A2K A;  1X1B A;  2CUZ A;  2WBM A;  5CKT A;  4IX7 A;  1GLN A;  3W2A A;  3MKZ A;  3RQ4 A;  4OWR B;  2A5W A;  2ZXI A;  3OYN A;  2VJ5 A;  4AYB A;  3S8P A;  3PNT A;  3SYT A;  4F92 B;  2OUM A;  2M4K A;  2Z16 A;  2R4G A;  3OR1 C;  3OYH A;  2K9L A;  4J01 A;  3H9Q A;  4XMY A;  4JOM A;  2F4I A;  3CP8 A;  3AKZ A;  2WA0 A;  4CCO A;  3PNV A;  1W36 C;  4NC7 A;  2VQG A;  3OYJ A;  2RRE A;  3F9K A;  1N78 A;  4D1Q A;  2L5Q A;  3SDB A;  4LIU A;  1LKX A;  3FDY A;  2KRH A;  4XLF A;  2ZXH A;  4BQN A;  4B43 A;  4XKV A;  3HOT A;  4E7H A;  2W4S A;  3A1Y A;  4RM2 A;  4E4H A;  1DP3 A;  3HC7 A;  2Z2S B;  4XOR A;  4BJ6 C;  3QOD A;  3VSK A;  2DCE A;  1Y6I A;  3CZ6 A;  1WJF A;  2KRC A;  4IQJ A;  4DOZ A;  3EPZ A;  4EAT A;  3OS1 A;  3OYA A;  3LSH A;  1UEL B;  1X4P A;  3BG7 A;  4NNJ A;  4CA0 A;  3L2R A;  2CH0 A;  4Y33 A;  2E1M C;  2W82 A;  4DJA A;  5KHD A;  2XF7 A;  3QYE A;  4GRI A;  1DGR M;  2XSJ C;  2R7V A;  3AL0 C;  4JQF A;  4N4O B;  3BLY A;  1BR1 A;  1G8X A;  3OS2 A;  2CW7 A;  3D5S C;  4BDZ A;  4U7B A;  4F91 B;  2IS1 A;  3S3N A;  1VZ0 A;  4PJL A;  1AA7 A;  3QYF A;  3EUH C;  2X6X A;  3W2V A;  4HSR A;  4ZDP A;  3J7A Y;  4BE1 A;  1Y56 A;  3G2B A;  4F3Q A;  4OAZ A;  4FAS D;  3DWL E;  2KQR A;  3H5R A;  3DPU A;  2MD0 A;  1T95 A;  3C2H A;  3OWT A;  3I9V 2;  2VXD A;  4BE0 A;  1MW7 A;  1FMV A;  4B48 A;  2KPM A;  1WJ5 A;  2LBF A;  3I3L A;  3OYM A;  2P0W A;  2RQQ A;  5LD2 C;  2L9N A;  1D0Z A;  1WJC A;  4XQF A;  2DOA A;  4BUP A;  1BR4 A;  3FKJ A;  4AU7 A;  4ZYA A;  1T0F C;  3DQV C;  1PYV A;  2LH9 A;  1DQU A;  3KEY A;  1SAU A;  2MYS A;  2R7X A;  4BS9 A;  4PJJ A;  3PNY A;  3SZG A;  3SEQ A;  2R7Q A;  2LY1 A;  3L2Q A;  4BDY A;  2IS2 A;  3TBI A;  2X1D A;  4XKB A;  2VJJ A;  4CZC A;  4XOP A;  2VJ4 A;  3LSG A;  4XLE A;  4E6K G;  3HUG B;  3TL4 X;  3K4L A;  4G6T B;  3EUK L;  3UR3 C;  3MKY B;  2E60 A;  4ZC3 A;  3DTK A;  2KMU A;  3K4N A;  1WJA A;  4IZZ A;  1WFX A;  3LL7 A;  3IUO A;  4D9J A;  4CH7 A;  2WAQ A;  3S32 A;  2M0M A;  2HDW A;  2HQA A;  2VIX A;  4YRV A;  3BC8 A;  4IKF A;  3RSN A;  3K70 C;  3QYB A;  5CQE A;  2Z1D A;  3CP2 A;  2IGK A;  2V1N A;  2JUG A;  3LSM A;  4XOT A;  4NQW B;  2IXS A;  4XL9 A;  2LOO A;  2HZD A;  4ZDO A;  3MMY B;  2VLA A;  2V6E A;  4HST A;  2X1E A;  2W1O A;  3VYT B;  2F6C A;  4E7L A;  3PSI A;  2X85 A;  4E7Z A;  1V5E A;  2KHM A;  2JVH A;  2WAD A;  3MKW B;  1TT0 A;  2LRD A;  2M4G A;  4BXF A;  2R7U A;  2VPL A;  3H5A A;  4PSX A;  4XKW A;  2UUZ A;  3L2W A;  1PJR A;  3HPG A;  3FBN B;  4B3X A;  3CJR B;  2VAS A;  3OMY A;  3UNG C;  1Z21 A;  3ZQQ A;  3BCB A;  3OIQ A;  3ZXS A;  3BCA A;  3PJR A;  1V5F A;  4RLQ A;  4CCN A;  2IS6 A;  3V42 A;  2CFO A;  1N77 A;  2M7A A;  2QKL B;  3IAS 2;  2IGN A;  1WJD A;  3DTE A;  5CPR B;  3A4C A;  3S93 A;  4AVZ A;  3OYE A;  4XR6 A;  4ZJZ A;  2NOJ B;  1WJE A;  1YX3 A;  5FRM A;  2BOL A;  4ZTJ A;  4B44 A;  1ERD A;  3MD2 A;  1U0J A;  4BGD A;  2GOX B;  3C2G A;  3OYC A;  4CCL A;  3VYU B;  2HVS A;  4HEA 2;  4C9Y A;  3D5L A;  3RTR A;  3DTI A;  4CCM A;  4BE2 A;  3ZGK A;  2VQH A;  1MMA A;  3CF2 A;  4P1W A;  2KL4 A;  1D0X A;  1X4O A;  1LVK A;  2LBF B;  4Y4R A;  3H9J A;  3AFH A;  3K4M A;  2MC4 A;  3DKX A;  3GBG A;  3K4C A;  4QPQ A;  4E7S A;  4R79 A;  3VYR B;  2R7T A;  2BW3 A;  5FRO A;  2VJI A;  3K4J A;  3HXL A;  4RM3 A;  2HPI A;  2OC6 A;  3W2W A;  1SFK A;  1QHG A;  3DLA A;  2X1C A;  3CES A;  1EA3 A;  4PFP A;  4YEL A;  1JI8 A;  2R7O A;  3NWT A;  4F93 B;  3PL8 A;  2ZFU A;  2R7S A;  2DT7 B;  2R7W A;  2CUJ A;  5HLT A;  2DJI A;  2JA2 A;  4RMN A;  4U87 A;  1X1A A;  2X6Y A;  3RCO A;  4LIT A;  2KLO A;  4C30 A;  4BQO A;  3FHN A;  2XF5 A;  2IGO A;  1OLT A;  1D0Y A;  2L7K A;  1E0E A;  2MAB A;  2L2O A;  2V4J C;  3NWS A;  4XLH A;  4BEH A;  2QKM B;  3HOS A;  3H9G A;  2E5Z A;  2HNH A;  2UWM A;  4NC8 A;  1FMW A;  2LG4 A;  4B47 A;  2JVG A;  1R6R A;  2K9M A;  2VQC A;  2VB6 A;  3DU6 A;  3K10 A;  4BU2 A;  5JHF A;  2LRE A;  3SEZ A;  3ZCO A;  4PJM A;  4XON A;  4MLO A;  4PK4 A;  4F52 A;  1P9Q C;  2MFZ A;  3HG9 A;  1NG7 A;  2X51 A;  3ZR8 X;  4IQ4 A;  1LDK B;  1OR7 C;  3U21 A;  5KCM A;  1ZEL A;  2OV7 A;  3H5N A;  3HL2 A;  3OIP A;  4J00 A;  3LSK A;  3BG6 A;  1QU3 A;  4HPQ A;  5LFA A;  3ONQ A;  2IGM A;  4YEJ A;  3ZRG A;  2HPM A;  4DGW B;  3VDX A;  2R7R A;  3OYI A;  1DGW Y;  2XDV A;  4BL0 B;  3K4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...