2E5ZA

Solution structure of the surp2 domain in splicing factor, arginine/serine-rich 8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
GSSGSSGTSALAPVAAIIPPPPDVQPVIDKLAEYVARNGLKFETSVRAKNDQRFEFLQPWHQYNAYYEFKKQFFLQKEGGDSMQAVSAPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Splicing factor, arginine/serine-rich 8
publication title Solution structure of the surp2 domain in splicing factor, arginine/serine-rich 8
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01805 Surp Surp module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e5zA01
2DT6A 2E60A 1UG0A 2E5ZA 2DT7B 1X4PA 1X4OA 4DGWB
chains in the Genus database with same CATH superfamily
2KIUA 1WJCA 4UHTA 3F6VA 4BUPA 1FP2A 3GTQJ 3J80K 3OYMA 2HPMA 1VQ7I 2Z99A 5HOOA 2PQ8A 4A3FJ 3M4OJ 4Y17A 5JVTA 3N97A 2EINH 5ILVA 4BY1J 3A01A 2JPCA 1IRZA 1OPCA 2XGEA 4G7OF 5L3BA 2Y31A 4UB8C 2L0KA 2XF6A 2RN7A 1SVMA 3CZ6A 3ERMA 3MEXA 4IOAF 3CUOA 2EPFA 4MQVA 1E3HA 1LFPA 2M0MA 2O8KA 1TWAJ 3CDLA 1K7AA 3V8KA 2IGMA 1ZYRF 1WHUA 3ZP5A 1LVAA 1JKPC 4AIHA 1VTNC 3CCQI 4ZYEA 2QWWA 2VIXA 1H0MA 3EDPA 2JVGA 4A5MA 2LY1A 2DCEA 2M87A 3EETA 2KRHA 2QUFA 4S04A 3OSGA 2O6GE 1LQ1A 1OCTC 5E1ZB 5BMZA 1QU3A 3CDHA 4BBRJ 4FT8A 2ZC2A 1DU0A 4Q5SF 4UUVA 5GTIC 3RPUA 3IC7A 1XDSA 4D7NA 1WRJA 2DTZA 3H92A 4E4HA 5M3FJ 1FOXA 2X0LA 1BJZA 2M45A 4IXAA 4A3LJ 2EZLA 4E7IA 2JA8J 4BHPA 2RC4A 3WTUC 2QSHX 4H4KC 2L7FP 4M9XA 5F08A 1XN7A 4RBOA 4A3IJ 3CMMA 3VFZA 1ITYA 2KL4A 5DS9A 2XF5A 3K9TA 2DA5A 4BHBA 3KLOA 4YELA 1MZBA 1R36A 4BS9A 5J1RA 2E34A 2JPBA 1Z3YA 1S8NA 4K2EA 1EH6A 1ZGJA 4OIQF 2KKOA 2VBWA 3T8RA 3OYEA 1YJWI 3I53A 1X2NA 2DI3A 1XGOA 4GYIA 5DDGA 2ISZA 4P9UA 2RQQA 2Z16A 2L7MP 3F8FA 3IH2A 3QYEA 4IQJA 2XVCA 4XKBA 2G9WA 3I55I 2XKOA 3BC8A 2L7ZA 4IKFA 3K4KA 4M3GA 1W36D 1ZGWA 2W4SA 3QQAA 1Q1HA 2E2HJ 3W2VA 4Y3OA 4F91B 2Z5UA 1ZTRA 5F0CA 4GO1A 3RCOA 1TQPA 2HKXA 3WTVC 4L9VA 2VQGA 4EM1A 1OQYA 4HPQA 2DFFA 2VKDA 3RPUD 2M3AA 3SXYA 3E6BA 2MBFA 1J7KA 4Y52J 2OC6A 2W25A 2FQ4A 4NDLA 5IP7J 3RYPA 1I6XA 3B6CA 4HRIA 3CP8A 3GUDA 4XL9A 2E1CA 5IT9Z 3PIPF 4G7ZF 4DYRA 2HQ5A 3IP4B 3OYBA 5L3FA 5DCMB 2E2JJ 2BHZA 3VYTB 2F5EA 4KMUX 1UMQA 2L7KA 3LAPA 1O3TA 1IN6A 2HVQA 2E1OA 3IRRA 1JKOC 4D7MA 2XUBA 1B9NA 2EIKH 2V79A 3JSPA 5EG0A 1L3LA 1B72A 2CFXA 5D6EA 1YS7A 1GUUA 1I1GA 4EEFG 1R9TJ 5B66C 2COBA 3K4LA 5E20A 4FASD 1T95A 1J5YA 3ABMH 1Z91A 1Z05A 4U7BA 4NUBA 1BN5A 2V9KA 1ZRCA 1F36A 1L0OC 2O7OA 2MG4A 1T39A 4CYCA 3PM1A 3TP3A 2EA4A 3LA3A 5K5RA 3T1BA 5J1UA 3GFMA 3G71I 1ETKA 2L02A 1PDNC 1UELB 3AG2H 1VNDA 2EZKA 1SMYF 1IDZA 1QHHD 1UHSA 2E60A 3K7AJ 4U0VA 3LA7A 3T8TA 1WI3A 5CVRA 2V26A 1BC7C 2MABA 2RGVA 4EMSA 2TDXA 2VKVA 2ME6A 2H6BA 1BI3A 1ACIA 3NAUA 1VQPI 3CC4I 1ZLKA 1ETQA 4IJAA 2V1NA 4BXFA 4GYGA 2BE5F 3AG4H 3ASNH 4MFDA 4O5VA 2DMQA 2FU4A 2FMYA 2QGUA 3HJEA 4LB5A 1E2XA 1YW9A 3HSFA 4KN7X 4MNUA 4HNTA 1NTCA 1XB4A 1OISA 4I99C 4A3MJ 1RESA 3FBIB 1BR2A 3S93A 4RB2C 5E17F 3B02A 3BROA 4NC6A 1ZRFA 2QVOA 2EFNA 2G7HA 1QPMA 3FX3A 2HTJA 3RQIA 2R7ZJ 3ZN0A 1U5TB 2ZXWH 3BT9A 1D1BA 1R22A 2QM3A 3I71A 3JTHA 1MDMB 4NQWB 1VQ4I 5HS7A 2ESHA 1K4TA 4BDZA 1YLFA 1QA6A 4X6AJ 4ENNA 3FISA 2FD5A 4M73A 5EEAA 1KU3A 1J9IA 2HNHA 3JREA 3HOSA 4U88A 2PFBA 1SFUA 1KONA 2KQRA 2W57A 2OZUA 1YJNI 1D8JA 2HZTA 2HVSA 3CCYA 2L9NA 3L1PA 4E7KA 3RKQA 4BQAA 2DYRH 3KP5A 2VE8A 4YFKF 1FMWA 4A0XA 1ETVA 1YO5C 2I8DA 4BDYA 1JGSA 3DLAA 1I3AA 3LSMA 3FXOA 1U78A 1XPXA 1F43A 2R3SA 4KIBA 2HDCA 3CCSI 2E5ZA 1JUPA 4F92B 2X9DA 2OCEA 3GYHX 4F3QA 5LFAA 4IHYA 4A3KJ 2CRGA 4MGRA 3TO7A 1XG1A 4HV5A 1D1AA 1Z1DA 4I02A 3LSRA 2HKOA 3SZTA 1TW2A 1WJBA 5FKNA 3WTSC 3C1DA 2ELJA 2X1CA 4DJAA 3SEZA 2CG4A 1G4DA 4KIFA 3SDGA 4IRGA 2BHYA 4S0HB 2DFIA 3QYBA 1R1VA 4RAGA 3ECHA 3FXKA 4C3HJ 5M5WJ 2M34A 4ZTFA 2WAEA 5EJCA 2EFPA 1EA3A 2CMPA 1F9NA 2HYFA 1HKTA 1HQCA 2F5FA 3TO9A 3JR9A 3JCUC 1FIAA 3CLOA 2YR2A 1TT0A 2ZFUA 2VJJA 2MH2A 2JN6A 1WWXA 2O3FA 3V4GA 3VB2A 2VQCA 3R60A 4XOTA 3EYYA 1Q1VA 5J8FA 1P2FA 3MCZA 2CFOA 3DBRB 4HX7A 2JTVA 1GDTA 1EKEA 1MD0A 2PJRB 5B3SH 1X3ZB 3FKIJ 3E5QA 2M4GA 3CJQB 3E5XA 5JI6A 2CYYA 1MBJA 3IWZA 4MEXF 2P7CB 5LHGA 2X1EA 2GA2A 1KA8A 1BJAA 2CS3A 1OYWA 3NWTA 2DOEA 1TP4A 1YIOA 2WADA 4AVPA 4BH9A 1U5TA 2R5ZB 2HZDA 2P0WA 1B59A 5GTHC 2GBYA 2EH3A 4IPAA 3OOUA 3BR3A 3MQ0A 5CYVA 1PUEE 1X58A 4NQWA 5BOXA 4P5OA 1IN5A 2OJED 3BG7A 4G7HF 1LB2A 3FMRA 5C3EJ 3HB9A 1KQ8A 1PUFA 2MLKA 3CF2A 2YU3A 3GMEA 1NK2P 1JJ6C 2MLGA 4M3FA 4NC8A 3ZMDA 3PFYA 5EZHA 3HOTA 2Z33A 2EBIA 2VPRA 2Y30A 3RYRA 2CW0F 3JAMZ 1R71A 3HOVJ 2Y0SA 3NARA 4M9ZA 3VYRB 2ZB9A 3H0GJ 1QQIA 3ULQB 3FK7A 3GW2A 4BQNA 2P8TA 2XAHA 3COAC 3H9JA 4DOZA 5EDNA 1B8IB 1ZAOA 2KRCA 1STZA 2CQKA 3HSRA 1K4SA 2HOAA 5E3MA 1TQMA 3WGGA 1ETWA 2QBYA 3NRVA 2LP0A 3OR1C 3HHGA 2E1MC 2HXOA 1MIJA 3LWFA 3CCJI 1G8XA 1YW7A 4XLHA 2DT7B 2VKHA 3SFZA 3H5RA 4X1EA 5KVRA 3ZQFA 3OYIA 1FC3A 3OS2A 2ESNA 3BPVA 4DBRA 3ELKA 3MFKA 3PL8A 5F1JA 4WF2A 1AA7A 5BNGA 2BVMA 3HYIA 3GZ5A 2FEZA 3G4SI 4G6QA 1ZN2A 3CESA 3M9AA 1OCRH 1QZEA 5L3EA 1BOAA 3LL7A 3B6AA 4BEHB 4DZPA 2KFDA 5IYCJ 3Q0VA 4DW6A 1MH4A 5GAEJ 5J8CA 4BU2A 1O7LA 1U6GA 3DKWA 2E19A 2L01A 1K6YA 2K4BA 2LFBA 2H1LA 3EUHA 5E3LA 1E17A 3ZQGA 1FTZA 2IBDA 2VI6A 2XROA 3K1NA 1ON1A 1H89C 2A6TA 4PJNA 3JW4A 2XPUA 3H5AA 2FSWA 1FBQA 2FBIA 2IS1A 5CVIA 4DZJA 3L09A 2BZTA 2UWMA 3ZPLA 2GIZA 4B3AA 2NAZA 2PJRA 2DLLA 2DMTA 3BJAA 5ICCA 1TT5B 2F2EA 3H1CA 3J80Z 2KPMA 2PBIA 3QP5A 1X1AA 1SC7A 1JI8A 3V8JA 3KP7A 1P6RA 4Y33A 3O2PE 1MNMC 3OL3A 2ZNYA 1WH5A 5BPIA 2EV5A 3TOAA 4CYDA 2EV0A 3DEUA 3S1NJ 4KUMA 4M6XA 2EA2A 1X4PA 4IHXA 1D5YA 1VQKI 2K3FA 2A69F 2QKLB 3KPHA 1W1WE 3FM3A 4CCMA 1VZ0A 4LFUA 3O6BB 5C4JJ 1XDUA 2HGCA 3IH3A 2RREA 2CO5A 1RUOA 1ZQ3P 1IW7F 3OYNA 5GAHJ 1VFCA 2ZSHB 2C6YA 5HVQC 1WJEA 3LQQA 1U9NA 2JRMA 4G6DA 1MMSA 3ZQLA 3FXJA 2RVCA 2XSJC 4RB0A 4HQMA 3S1RJ 5E1WA 2MGQA 5LEJA 2P5LC 1AHDP 2Q0OA 3P7NA 3W3CA 3JRDA 3EYIA 4PJLA 3DEEA 4J01A 3IKTA 2BOLA 2LLKA 2EFOA 4MIMA 3CC2I 3CUQB 4TV7A 3U21A 4A3JJ 2HVRA 4YFNF 2JZYA 3KZIC 1IXCA 3ABTA 3D5LA 1G3WA 4HDVA 4C9YA 1RI7A 2EJRA 3H3ZA 1DDNA 1Y1WJ 4L0YB 4UY8I 1N78A 1Z77A 2GXGA 1HF0A 3MMYB 3I54A 5DYMA 5ERIA 5KCMA 3CCMI 4HNVA 4II3A 1J0RA 2AHQA 3S32A 2PI0A 1YX5A 2K9MA 2KT0A 2Y75A 4P96A 5DM6F 4YEJA 1HSJA 4UVBA 3WG9A 4AIJA 3W2WA 3ROUA 4HZFA 4RM3A 1DQUA 1MJAA 1PP8F 2BY0A 2K02A 3HOWJ 1A36A 5L3CA 5K5QA 2P7VB 4ENMA 3HOZJ 2QENA 2AQEA 3FMSA 2B9SA 3DEWA 2QQ8A 2XC7A 1FYKA 4U0WA 2EFWA 5AIPA 3BG9A 3GWZA 4C2MJ 3GTGJ 5DTDA 2OQRA 2ZJQF 1H9TA 3MD2A 3S8PA 4LOCA 4QPOA 3S15J 2DFEA 2WY8Q 3ZOBA 3NWSA 3WHBA 1FYLA 4D0PA 2IPQX 3EUAA 4UV8A 5IY5H 3DLLF 2DMPA 4RB1A 1U0JA 4Q4ZF 1ZR4A 3OV8A 1XGSA 1T0FA 5HODA 2K9NA 2NOGA 1JT0A 5J47A 1E0EA 5GP9A 3OYKA 4XLCA 4U7DA 1RKTA 2MC3A 1G2HA 3QU3A 4A93J 1PP7U 3Q3SA 3I9V2 1RZ4A 4IRIA 4BQOA 1VQ8I 2LKPA 1SFXA 4OIRF 4XRMA 3GTLJ 2QQBA 3G3ZA 4AWXB 5FLXK 5FO5A 4R1HA 2B7EA 2IRFG 4CDGA 3G73A 1FX7A 1TNSA 3KLNA 4OU0A 3SQNA 2DW4A 3BLYA 3CF5F 3R0AA 2F48A 3QU6A 2R7XA 5B5EC 2ISYA 1CF7B 3GTPJ 2XHKA 5F6FA 2IXSA 2P4WA 1ETXA 1S29A 5CQEA 3R6SA 1F1ZA 1S72I 4M72A 2LKXA 1NG6A 1ZG3A 3LA2A 2X1DA 4BJTA 3Q5FA 2IT0A 2LC2A 3IHUA 1F5TA 1OCOH 3E6DA 2HQNA 2DA1A 2YPRA 4DIQA 2Y2ZA 2KZVA 3BZCA 1T33A 3F8MA 3K4MA 2M8EA 2H6CA 1SFOJ 3BTCA 3VSLA 2ZMEA 2V1UA 1N75A 2QA4I 2R7DA 5C44J 5TRDA 3F22A 2DA7A 2JUGA 2EV6A 3CUQA 5LRRA 3F9KA 3U2RA 3K2ZA 3MKLA 1R5ID 1ZG1A 5FD5A 4RGSA 1TL8A 1IRFA 1RNLA 4M71A 4PFPA 3K4BA 2HOTA 4YIIA 5L3DA 3ZMTA 3LSJA 5J1YA 4XMYA 2JVHA 4FX4A 4C30A 4LG3A 5E18F 1YOVB 4KITB 2D45A 3K1PA 1TBXA 5E3OA 2BY2A 2RV8A 5E1XA 4DNCA 4WXCA 1YTYA 2LOOA 4RAZA 1SD4A 1USSA 2DQLA 1TWFJ 4BXXJ 5LGUA 4JOMA 4EM2A 2HDDA 1QZZA 2BXYA 1WJDA 2HYJA 2K85A 1FSEA 4EJVA 4ABZA 3HUGA 4XOPA 3RQ4A 1WI9A 1SD6A 1IN8A 2F4IA 5F0FA 2LG4A 5FKMA 4EJOA 1O3RA 2L2OA 3CCRI 5LRSA 4UV9A 4DGWB 2ZFWA 4NB5A 2QKMB 1WSUA 2OV7A 3BG3A 2QCOA 2QYOA 2D1HA 1OCZH 3CMAI 4OIOF 1BA5A 2CWEA 2BYVE 1XD7A 1AKHA 1MW7A 2COMA 3MVPA 1BL0A 2OZ6A 3OYGA 4UUSB 3TW6A 1TQIA 5M5YJ 5D5VB 1SAXA 1GVDA 4MTDA 2WAFA 5E79C 4G12A 5HDGA 4RB3C 3BCBA 4NHJA 1UJ8A 5F1RA 2STTA 4B43A 1X19A 1FEXA 4II2A 1LE8B 3J7YJ 3N4MA 3LSKA 2BXZA 2IA2A 3PQKA 4HYEA 2CQQA 5H20A 4E7LA 5HS8A 1W0UA 4ZC3A 4XLFA 5HDKA 1ZK8A 3LSHA 1CQTA 2DT6A 3TP0A 1I50J 4KJZA 2GXBA 3RZDJ 3A0BC 2JRTA 3E97A 1YHQI 2M7BA 4BXUA 1P9QC 4ZYAA 2KMUA 3KE2A 2VODA 2VBXA 1FNNA 4B8XA 4CHUA 3TMOA 3K2AA 1JUSA 2GLOA 2R7RA 3G2BA 4HOBA 2M4KA 5KAFC 3OIQA 5GAGJ 5E3NA 2PMHA 3MN2A 1A5JA 4BBSJ 1O4XA 2VL8A 4Z2YA 3BR0A 1NK3P 4A0YA 2BEOA 2L4AA 1X1DA 5F27A 2DMNA 2V9VA 1PVEA 2A6HF 4WXDA 3ZMSA 4DYCA 3JRGA 4FTHA 5J4YA 5K7ZA 2E2IJ 4W97A 2XPWA 1X2MA 3K6GA 4HQEA 5DCFA 1V5EA 3QPTA 1XMKA 1N25A 2NS0A 2VC0A 1QRYA 2KISA 1A31A 1YRNB 1BBYA 1BI1A 2EQRA 2NVTJ 1O57A 4LJZF 1LDDA 5FFXA 2W24A 2YX7A 5HNFA 4ZTJA 3HKZA 3L2WA 2Y0SN 2W1OA 2D1VA 3IRQA 4AC0A 3F8CA 3E1SA 4L9NA 3RTRA 4F52A 3LFKA 5HLTA 4PCQA 3GXOA 2DK8A 4A69C 4MHGA 2X6WA 2V7FA 2VT3A 3ML6A 4A3GJ 5GPAA 1HXDA 2JA2A 1PYVA 2FOWA 2IJLA 2XB0X 3WGIA 3QOEA 3AL0C 4HSTA 1H9GA 3IH4A 4XSXF 4A3BJ 3EUHC 4ETSA 1O3QA 2NS8A 2DTRA 3PNVA 5LLQA 5BPDA 1W7PB 3HTSB 4IL6C 1IRGA 5EEHA 5B1BH 1UZCA 1HOMA 3FIWA 3OYHA 3MAJA 1D3YA 1YW8A 2BY3A 4PSWA 4LG0B 2WBMA 1XGMA 1SEUA 2BBYA 3R4KA 3C2BA 1SFKA 1Z3XA 4MTEA 3G6EI 2DJNA 4BE1A 3C3WA 3DKYA 3P9IA 1LPQA 1WGXA 2VJ4A 3J7ZI 2FA5A 4KNYA 2A3SA 2GOXB 1Z21A 2DQRA 4EJWA 3MKZA 3QODA 4CH7A 4OMZA 2LSOA 4CCLA 1FYMA 1DP3A 5EGOB 4L5JA 3ABUA 2KIQA 4Y13A 1FLIA 2CQNA 4KICA 1FY7A 3JRAA 2ID6A 4CZZA 4JX4A 1FTTA 2VJ5A 3TKYA 5D5WB 3QYFA 1R5GA 1S7AA 1HBXG 2IAIA 3M1CA 2UZKA 2ECBA 2KDOA 1ERDA 1AU7A 4MEYF 2M9HA 3FBNB 4EGYA 4I6ZA 2AS5F 1FZPB 5TISC 5B1AH 1J59A 3OY9A 4RA2A 2IS2A 5HLGA 2O0YA 1TTYA 1Z0XA 3GO5A 5D8KB 5LD2C 3ZR8X 2A5WA 2OF7A 1BR1A 2IVMA 2ZJPF 4EM0B 2RNJA 3MKWB 3IV5A 3B73A 1EH8A 3G1LA 1AOYA 2Z9OA 4IHSA 3DU6A 1D0XA 4XBFA 3ERED 3ZN1A 3OYAA 2GM4A 2LH9A 5DCMA 2ZBKA 3D5SC 3CJNA 4A0ZA 4AU7A 2PG4A 1I3QJ 2F4OB 1K6OA 4HX4A 2GZWA 3KZYA 1X1PA 2ZO4A 1KZHA 3K10A 3ZRGA 1IJWC 3FXMA 3UKGA 5FRNA 3GF2A 1IUYA 2EZIA 3IKVA 2X51A 5D6FA 2DMUA 3KYCB 1HW2A 2CV1A 4W1UA 1ZR2A 3S16J 3T5XA 2AXLA 2AQFA 1RC9A 4S05A 3A0HC 4QTRA 1LEAA 1SVLA 4YIFA 3J7AY 3RKXA 1HCRA 4XONA 1FSHA 4PJ0C 3CCVI 4GCVA 4Q47A 1JTYA 3LQRA 4XRSG 1J2XA 3HM5A 1V5FA 2WV0A 3L9FA 4HLYA 3KZZA 1P7JA 1W7PA 2LF7A 3GZNB 3L7WA 2FBHA 1SMTA 1IG7A 2WY7Q 2Z1DA 3GLXA 1RR8C 2CUJA 4WXHA 1Y1VJ 2VB6A 3S17J 1QBJA 4KYWA 2F5CA 2ETHA 2P5VA 1OYIA 3FXLA 3SYTA 1G6NA 1ENHA 2EIMH 1X3UA 5FFZA 3V7SA 4FX0A 1LUJB 2BV6A 4RGUA 5K7HA 2XAGA 2VQHA 2X4HA 3AFHA 1T0FC 2LVSA 4HA8A 2HEOA 2WAQA 2Z2SB 4MO7A 4UB6C 1LDJA 1B1BA 3DPUA 2NNNA 2XF7A 1IXRC 5M5XJ 1Y8RB 3O8GA 3I59B 3CMEI 4ENKA 2ELHA 1UCRA 1ZELA 2X85A 3ASOH 1MJBA 4KIGA 3OYJA 1Y8QB 4BAYA 3HXLA 3OYLA 4A3DJ 4ZYGA 3SJMA 2EZHA 3OIOA 4N9HA 5LEKA 2LBFB 2RAEA 4J19A 1ODDA 3FHNA 1EF4A 1P92A 4FQGA 2YS9A 4CCKA 4ZZLA 3HL2A 4RMNA 1FT9A 3BWGA 3BQYA 1MDMA 4XM3A 3T0YA 2JA7J 4LIVA 1I27A 3E7LA 5D4RA 1QZYA 3OMYA 2P6SA 2RQPA 3TO6A 5IYBJ 3FM5A 5D4SA 2QLZA 2CW8A 1W7PD 4Z6YA 4FISA 1TWCJ 4JX6A 4E7ZA 4EQQA 1REPC 2HR3A 1FP1D 2LKSA 4IVNA 1Z9CA 4O6JA 4CUGA 2I10A 3D0SA 4FHTA 4HBLA 1HDPA 2VLAA 2V1XA 1ZGAA 4H0EA 2YSRA 2LR8A 4L9JA 1POGA 2VJIA 3D1NI 2K5CA 2HWVA 2L9RA 4L5EA 4RAYA 2CV2A 1LNWA 3W2AA 3OIPA 1QHGA 4ZYDA 4G6TB 3KETA 2V4JC 4XKWA 3DWLE 1OYYA 4Y15A 1MBGA 1KYZA 1OR7A 1U8BA 5FLVA 2R7VA 1W5SA 1W36C 3RJPA 2VE9A 3HRUA 1Z7UA 1ON2A 3HDDA 5JFRA 2VC1A 5HS9A 4XK4A 4JQFA 4EATA 1FWZA 2P5KA 4NBQA 1YI2I 1D0YA 5D8LB 2WB1A 1FPQA 2K40A 4M3DA 3OS1A 1IXSB 5HLIA 3A1YA 3I4MJ 3DV8A 5K1YA 4I7HA 3H0DA 3CCUI 5CPRB 4IHTA 1RPWA 1HLVA 1FOKA 1WH7A 2ICWG 4IHWA 2HDWA 1JT6A 1D1CA 4F93B 5DUIA 1G3SA 1QNTA 2ECCA 3IAM2 3L2QA 3SDBA 1YYVA 2GIVA 1K61A 1E3PA 4N4OB 1SFEA 3FXUA 5ICFA 2QSFX 2UV1A 3PQJA 4D9JA 3HEFA 1U3EM 3DU5A 2E7XA 4D1QA 2ZXIA 3ZQQA 2BVLA 4EGZA 1ZHFA 3ZMVA 5JVGF 1B4AA 4CGZA 4HG2A 2IEKA 1Z6RA 3VOEA 4AYBA 1DU6A 1O3SA 2XSDC 4PDKA 1OKRA 2HU9A 2K9SA 2M5WA 2CSOA 2KIMA 4U0YA 2KJCA 1S7EA 3GFJA 1ORKA 2L54A 1JGGA 2XAJA 1KGSA 5J3LA 4C3IJ 2R5ZA 4B4CA 3BTLA 2R7TA 1JHHA 3PO2J 1IRXA 3H9QA 1A35A 3Q9SA 1BW6A 5JLXA 2Y9ZA 3OYFA 2GA1A 3HRTA 4IRHA 2BW3B 3H9GA 3PIOF 2JUCA 2XGCA 1LVKA 3CC7I 1V4RA 2UXXA 1U9OA 3AG3H 1MJ9A 1BI2A 5LHIA 1MBHA 1MH3A 1EV7A 2MSYA 2HPIA 3ZCOA 1V55H 1G59A 1SD7A 2XDVA 3W6VA 4EVIA 3U1DA 2M30A 1DPRA 2N8GA 2MD5A 1B8IA 2J5OA 1SANA 2WC2A 1G3YA 5FLMJ 5J40A 4OWRB 3HOYJ 4G94A 3BTJA 2GWRA 1BM9A 1WJ5A 5CVJA 5ILSA 4PSXA 2FMLA 4A12A 2E71A 4G9YA 1W5TA 3WTYC 3FWEA 3JRIA 2K7LA 3CP2A 4IZZA 2PEXA 4BY7J 1TC3C 1NH3A 3VEPA 2JSCA 1FIPA 3ECOA 4LLLA 1MNEA 3K4JA 1ULYA 3BY6A 4BACA 1ZG5A 1GXPA 3QWLA 2IP2A 2VASA 3HSEA 3ISPA 3TL4X 3ABLH 4YFXF 3MZ8A 3O8HA 5LBQA 5FB2A 2DAOA 3ONQA 4M3EA 4BEHA 1FOYA 1EH7A 4I76A 3DKXA 3VDXA 3A01B 1I39A 1DGWY 2OCCH 1D0ZA 5H6QA 1OFCX 3K1MA 1WJAA 3JRHA 3OYCA 3VSKA 5IOYA 2E1MB 3FXRA 3PUBA 2VUMJ 1WCMJ 4P9FA 3E6MA 3HKZN 4PGHA 3IWFA 4CSWA 2FOKA 4A3EJ 3BR6A 3P9KA 4O3MA 1R4NB 5K5OA 3BG5A 2DYSH 4EV0A 4WK8F 2OA4A 4KISA 2FRHA 2ZKZA 1B9MA 2X6OA 3LMMA 3F8NA 3RDIA 4RGXA 1TLHB 1QVTA 2AXTC 4XN3A 4XQFA 1X1CA 1A6IA 3BZKA 1YJ9I 2I5UA 3WTWC 2B0LA 2WA0A 1QO0D 2JJ7A 5HDNA 3FF5A 3MKYB 1I1SA 2YUSA 4UVAA 1XSXA 3EPZA 1WZ2A 1LEBA 1OLTA 3BR2A 3M8JA 4IOCF 1AWCA 1DGRM 3S2HJ 2DPUA 2D5VA 2L9VA 3C2GA 3HOUJ 1A04A 1P4AA 2O9LA 3M3YJ 3DP7A 2DXIA 3RI4A 2DJIA 1GV2A 2R7WA 3Q0UA 2VXDA 1GHCA 4B44A 2XPVA 5IYDJ 4RLFA 5LGNA 2V6CA 2O8XA 3KP4A 1WJFA 4WCGA 2A6EF 3RPQA 1XMXA 5GPCA 1MSEC 2MH9A 4DBQA 5FGMA 2W85A 3UNGC 4R79A 1N77A 2KRFA 2JT1A 3RKWA 1O7FA 3PNYA 2Z3YA 2FUG2 4L5IA 4QLCU 1U8RA 1R7JA 3C18A 2R4GA 5EZGA 2DOFA 2DU9A 3WTZA 2XAFA 2Y48A 3DBHB 5D5UB 4BGDA 5CQGA 5CVVA 4AVZA 5F0HA 1J09A 1XS9A 1V3FA 4A2UA 2DK5A 1RIOH 3RZOJ 2VN2A 3GFIA 2HS5A 1S7OA 5AIQA 1VQ9I 1IAWA 4FE4A 4ZDOA 1QGPA 4J00A 5A2QK 1FMVA 1JUMA 2CUEA 3HPHA 4OAYA 4PJJA 2V9PA 3WODF 2FX0A 4I01A 1LFBA 1DPUA 3O3KA 2QQ9A 4WX9A 3HG9A 3WU1B 1VQ5I 1QVUA 2QSGX 2OAZA 1FBUA 1RKWA 1SAUA 4IF4A 4ASNA 2F5VA 1R58A 4LK0F 4G8XA 3GTJJ 4CICA 1RR7A 1S9HA 2WV1A 2ZXHA 1K78B 4KDPA 1Y0UA 3F0CA 5E8IA 2H1KA 2L9SA 5EG0B 1B72B 3HRMA 3JTGA 1XC5A 2HFHA 1K79A 2NVXJ 3FMQA 4I2OA 2DBBA 5H2FC 3C2HA 1VQMI 3CCEI 4NNJA 1JE8A 3DPLC 2M1BA 2UXNA 1R5HA 1HSTA 2IA1A 5EEGA 4IHVA 4LLGF 2HTSA 4V2FA 2NYXA 1VQ6I 1MKMA 3BQZA 2E7WA 3GCMA 2H09A 3JRCA 2IS6A 2H8WA 4CYCB 4KMFA 2G7UA 1APLC 5DEQA 4CA0A 2M7AA 1ZARA 3H35A 4F7ZA 1IV8A 1T2KA 4QSHA 2XKPA 3DCFA 2CJJA 4BNCA 3PUFA 2A61A 4PK4A 3BR5A 2IGOA 5KNLA 1KU7A 2OPTA 3I0TA 2GQQA 3OSFA 4U87A 5LGTA 4GRIA 2OD5A 2FNPA 3OWTA 2PJPA 2JK3A 1V5GA 4MFEA 1U5TC 4RDUA 4V19K 1MNDA 4ON0A 2YU9J 1XX5A 2ZJRF 4B09A 2HI3A 4E7SA 1VQOI 3VPRA 1CF7A 1XSVA 3H3VK 1TWHJ 2MD0A 2VT2A 2WAQN 4HEA2 4YRVA 5FD6A 1GXQA 1I5ZA 2CW7A 2DDBA 5IP9J 2W84A 3GTOJ 3KYLA 1H8AC 1SVOA 4L0ZB 2R7UA 2B63J 3CQZJ 4UVCA 2DT5A 4ENJA 3WU2C 3J81K 2XAUA 5FRMA 3ESWB 1P4WA 1RUNA 2VQLA 5D5XB 2XGXA 4JBAA 4X0GA 1VQLI 2E35A 2W00A 3TBIA 3CD6I 3QRFF 1MSFC 1Y6IA 2JSPA 1YE9A 2ZCWA 4JYKA 2R7SA 2IS4A 3ZGKA 2EILH 3M1EA 3OR2C 1Y39A 2F4MB 3F6OA 3BCAA 2XV4S 3CDIA 2F5DA 1OR7C 1MMGA 3F8BA 3K70D 5JR3A 4A6DA 2K27A 3F72A 4AUXA 1R00A 1ZLJA 3C7JA 5KAIC 4LIUA 1UB9A 3DQVC 3F3XA 2HOEA 2Q2EB 1X3WB 3MWMA 3QPLA 2NS7A 1IDYA 2R7FA 4CCOA 5JHFA 4HLXA 1GVJA 1VF9A 2IW5A 2PMZA 5E8GA 1K78A 3DPTA 2D2WA 1T98A 3WU0A 1S3JA 4UUTA 2JA5J 3ZQIA 2DOAA 3KEQA 4HSRA 2VOOA 1R49A 1T6SA 1XTAA 2ZXJA 6PAXA 3M8FA 4OAZA 2VKEA 3GFLA 4R8HA 2XASA 2Q1ZB 4ZDLA 2DA2A 1P4XA 2NNYA 3KEOA 4RM2A 3RIRA 5BQTA 4AIKA 1GLNA 2WB1N 2R7QA 2KZGA 3KX2A 4UUSA 2H94A 2STWA 4Q48A 2PLYA 4QWQA 2JA6J 1T8IA 1LE8A 4HAMA 1R23A 3SHFA 2GXAA 1MBFA 3TOBA 1DP7P 2CQXA 1ETOA 2FE3A 2XB5A 2VXZA 2KP6A 1YIJI 1KU2A 3HGYA 3I4NJ 2K86A 4F55A 3TGNA 3QP6A 3I4PA 2VBYA 2DA3A 2ELKA 2QZ8A 1OCCH 2M8GX 2Q8KA 3GBGA 1D5VA 1D8KA 3G1MA 1WKMA 3OL4A 1OCPA 4I98B 4BHCA 1PJRA 4AYBN 3HGGA 3E3VA 1TWGJ 4I09A 3E0JB 2F6CA 4UXNA 3ZXSA 4XKCA 1U2WA 2FF4A 1KU9A 4M3BA 3ZMZA 3IUOA 3V42A 3ZQ7A 4HNUA 5FROA 1HKQA 2VBZA 3LSTA 3PSIA 5K7FA 4AD9A 3LSGA 2IGKA 3FKJA 4EJUA 4B3XA 3RKYA 4OMYA 1YS6A 2Y0MA 3H5NA 3I3LA 4HF2A 3AKZA 3GZ6A 1R4MB 2O61A 3NQOA 5J6XA 3LFUA 3ABKH 3S2DJ 2EK5A 3M7GA 4ANJA 2FXAA 3OS0A 3LAJA 4QPQA 1YRNA 4CCNA 3TEDA 3UR3C 1TW3A 2NVQJ 4I0BA 1PUFB 2FNAA 5GADJ 3IL2A 4JX5A 3K69A 2DA6A 4BJ6C 1I6HJ 2Q2EA 1XSDA 1HW5A 2NVYJ 1R1UA 1Y0NA 3X2QH 3VYUB 2LY2A 4E7JA 4XRFA 1IV6A 4E6KG 5J4VA 3BZ6A 1RRJA 4I0AA 4FETA 2UUZA 3BJ6A 5IP6A 5CJ9A 4XR6A 2LTPA 2NRAC 1X1BA 5IT3A 3FHZA 4KA4A 2L3DA 2RDPA 2G0EA 2YX4A 2QBYB 2ACJA 4PUSA 3U1KA 2LYCA 1JKRC 4Y4RA 3Q0WA 3DFGA 3HIFA 1OMIA 4PGGA 4GDFA 1BW5A 2Y9YA 4LG0A 2QEXI 4QIWN 4KT6A 3HRSA 2P81A 2R5YB 2LY9A 2OTLI 4BJ5C 3S14J 3OYDA 1LDKB 5ED4A 2CH0A 2XAQA 1YQAA 4NC7A 3P5JA 5IPAA 2H27A 3I64A 1UG2A 4L9TA 4XLEA 3F23A 2KDZA 3WE2A 2J5PA 1USTA 3J7AO 1B6AA 2IGNA 5DD4A 5DD8A 1JHFA 4ZDPA 1MMNA 2K3PA 2PN6A 2XGDA 4ESJA 1EJ9A 5EGOA 3AL0B 3PO3J 5IT9K 3V7CA 4YIRX 3JSOA 4Y7NJ 2TRTA 2JQ7A 3KCCA 4OOIA 1Z67A 4BKXA 3A4CA 3K4NA 3PFIA 5FKKA 3PSFA 1YITI 1W0TA 3DBLB 4GFBA 2E5NA 3AG1H 2H8RA 4XICA 1FBSA 2ME0A 4ZH4F 3KYDB 1X4OA 4N9IA 3FZVA 2NVUB 3L2VA 3S1QJ 1IZ1A 4XSZF 2DN0A 1UHMA 3H36A 1WVRA 4LGWA 4RLQA 4XNFA 1XCVA 4JP0A 3GTKJ 3EUKL 3FXQA 1JKQC 3N05A 3MZYA 4PFOA 4HW0A 1HW1A 3BG6A 4HX8A 2DODA 2V6EA 3GEZA 2DFHA 3WHCA 2R7OA 4P1WA 3D5RC 4AM3A 4RGRA 4P55A 1Z6TA 3AAFA 2ZMEC 2L4MA 2RNGA 2ZSIB 3QPSA 3L2RA 3PNTA 3U9GA 3E6CC 1JJ8C 3VWBA 3CUQC 4ZJZA 3CJTB 1MMAA 3IAS2 3CCLI 1R1TA 2GAUA 3E5UA 1OJLA 4CXFA 2R92J 1SD5A 1ONVA 3RSNA 1MGTA 3I56I 4BE0A 4GGGA 1VQNI 5EF6A 1ZRDA 3TW7A 4UNOA 2FQ3A 2ADUA 2O03A 1S5LC 2V1DA 1LJ9A 4N4NB 4GXOA 2DPDA 3SZPA 1TNTA 2Y69H 5IOZA 3LOCA 1KQ0A 2MYSA 1ZH5A 2HXIA 1E3OC 5FLXZ 4JK1X 4WWCA 5KHDA 3Q9VA 3F21A 4FCYA 4AIDA 5TJJA 3V7RA 1UAAA 2M0CA 4RS8A 1FOWA 3SFIA 2XIGA 3KP3A 3ZMUA 3A02A 2FJ1A 2EFQA 3DTKA 4C3JJ 5EYRA 2DA4A 5FKOA 2OBPA 2R5YA 2DDAA 4LK1F 3A03A 4LB6B 5JLWA 1MBEA 3CTAA 4B48A 3S3MA 3DXJF 2HOSA 1UFMA 4CCJA 5L3GA 1JTXA 3GX4X 4XLPF 5ICEA 4E70A 1CGPA 1HDDC 4HF1A 3VODA 1LFUP 1HC8A 3HC7A 1V54H 2LMDA 3K70C 1BIBA 1BR4A 2K9QA 3I59A 3M8EA 4FE7A 2K9LA 2OUMA 4M74A 4OINF 5CKTA 5ICGA 1Z7LA 5F64A 3JRFA 3LNQA 1XMAA 2A07F 3SEQA 1J75A 3HPGA 2CQ7A 3OOPA 3P9CA 3QOPA 1IGNA 1IO2A 5DUKA 4B47A 3TDZC 4E7HA 4EJTA 4XLNF 5CVUA 5A2QZ 2XRNA 4M6YA 1MBKA 2LBFA 5HNHA 4PJMA 1RETA 2KJBA 2L5QA 1BI0A 2JWTA 2K4JA 2X48A 2A05A 2WWYA 1S6LA 4L18B 2OU2A 2BGCA 1BIAA 1NG7A 3QPHA 4M6VA 4LMYA 4XLAA 3WTXC 3CMYA 3LSIA 1DUXC 1M1EB 4XKVA 3S2WA 2LF8A 1VI0A 3R0JA 1WQ2A 4XN0A 3WGHA 1R6RA 5BS6A 2TCTA 2JMWA 4HDUA 4RAFA 2X6YA 2BY1A 2LK2A 4C2TA 5JHUA 3WTTC 3GTMJ 3L2UA 1IC8A 2ID3A 3FDYA 3CO7C 1GV5A 4N0BA 5H6RA 3HBLA 2P6TA 4IQ4A 2EB7A 2EIJH 4OIPF 2WTEA 4CZCA 2OTJI 5DM7F 1KQ9A 4V2GA 1BC8C 3KEYA 1YG2A 4BYYA 1FJLA 2X6XA 4M9SA 2NXNB 4IX7A 1WPKA 2E1NA 3BR1A 2MW8A 4HV6A 3S3OA 4LLNA 4BQQA 2XRLA 2KIFA 2MFZA 4MLOA 2MC4A 3TDUC 5AONA 4XIDA 2VONA 5FJ8J 2LRDA 1P7IA 3WE3A 3I5UA 5F04A 3BDDA 2ZMEB 3NEUA 1T08B 1F4KA 2PX9A 3LSPA 2KLOA 4KFCA 3DF8A 2HYGD 2LREA 3W6KB 1A6QA 3BPXA 4LD5A 4IO9F 1ZREA 4ESBA 2W7NA 3K0LA 3K4CA 4IEJA 3TQNA 2HQAA 3CO6C 3REOA 3DTEA 5DV5A 1HKSA 3ZQHA 1UHWA 3GVAA 4D5FA 2DO7A 2R93J 1IN4A 3MZHA 3L00A 1BOBA 2LD5A 5FKLA 2QQAA 1Y56A 3G1OA 2CGPA 3J81Z 3S1MJ 2ZNZA 2RKHA 2QF7A 1UG0A 5KK1A 3VYSB 2PMZN 4XRSA 5ILUA 3GLLA 2NOJB 1QPIA 3JAMK 3QAHA 3HZJA 1TZLA 2EWNA 4PZJA 4B1RA 3KIOA 3R61A 2KHMA 1JXSA 3HUGB 3FK6A 4BL0B 2O5RA 5CLSA 4CO8A 1K83J 1KYWA 3HHHA 2W48A 4KT5C 2ZJ2A 2VOPA 3HTUA 4LITA 1MMDA 4ZZDA 1T56A 2BW3A 1IN7A 3L2CA 2W82A 3V8LA 1GT0C 2AO9A 4XORA 2E36A 1H88C 4DYQA 5LHHA 2CU7A 2CV0A 1IUFA 1YX3A 1AKHB 1WFXA 1XGNA 3CLQA 1NHAA 2LNBA 3CJRB 3DTIA 2IA0A 4ITVA 2A68F 3S3NA 3A2KA 3BJOA 3EQLF 4A6EA 2CUZA 3JRBA 2OQGA 1YFHA 1ZKGA 3I58A 3HOXJ 2M2EA 2R0QC 4C2UA 4BE2A 3KP6A 1ETYA 1C0WA 4DQ2A 3SZGA 3BP8A 4MQ9F 1HA8A 1IF1A 4KN4X 5TGTA 3BOQA 4A3CJ 2CUFA 1G3TA 3KFWX 3H3UA 3PJRA 4A5NA 4D5CA 5HLHA 9ANTA 4ESFA 1T38A 2A5YB 4ZYHA 3ZQCA 5C4XJ 4YG2F 2HQRA 3KP2A 5M3MJ 1W5CC 2MA3A 4HF0A 2VPLA 3W6JB 1XCBA 2PMUA 3BTIA 2LDUA 2GOMA 3WG7H 3M07A 1LKXA 2FBKA 1W4MA
chains in the Genus database with same CATH topology
2PMZA 3DPTA 1WJCA 1X4PA 2VQHA 3AFHA 1T0FC 2QKLB 2WAQA 2DOAA 2Z2SB 4HSRA 4BUPA 3OYMA 2HPMA 3DPUA 4CCMA 5HOOA 1VZ0A 4OAZA 2XF7A 2Q1ZB 4ZDLA 2RREA 4RM2A 1ZELA 2X85A 2XF6A 3OYNA 1GLNA 3OYJA 3OYLA 3HXLA 3CZ6A 2R7QA 2ZSHB 3KX2A 1LFPA 5HVQC 2M0MA 2LBFB 1WJEA 3FHNA 4CCKA 3HL2A 4RMNA 2IGMA 4XM3A 2XSJC 4LIVA 3OMYA 3W3CA 2VIXA 2JVGA 2CW8A 2LY1A 4PJLA 3DEEA 2DCEA 4J01A 2BOLA 2VXZA 2KRHA 2KP6A 4E7ZA 1QU3A 3U21A 2HVRA 4F55A 3D5LA 4CUGA 3GBGA 4C9YA 2VLAA 3OL4A 1PJRA 4E4HA 2VJIA 1N78A 2K5CA 3MMYB 5KCMA 3E0JB 2F6CA 2CV2A 4E7IA 3ZXSA 4XKCA 4II3A 3S32A 3IUOA 4H4KC 1YX5A 2K9MA 3V42A 3W2AA 3OIPA 4HNUA 4YEJA 1QHGA 5FROA 4G6TB 3W2WA 3CMMA 2KL4A 2XF5A 2V4JC 4XKWA 4RM3A 3PSIA 1DQUA 3DWLE 4YELA 4BS9A 3LSGA 2IGKA 3FKJA 4B3XA 2R7VA 1W36C 1Z3YA 3I3LA 3H5NA 2AQEA 3AKZA 2XC7A 3LFUA 3OYEA 4JQFA 4EATA 2RQQA 2Z16A 4ANJA 3OS0A 4QPQA 1D0YA 3MD2A 2WB1A 3S8PA 4QPOA 3OS1A 3QYEA 4CCNA 3A1YA 3UR3C 2WY8Q 4XKBA 4IQJA 3NWSA 3BC8A 3H0DA 4IKFA 3K4KA 5CPRB 3EUAA 1W36D 2W4SA 1U0JA 4BJ6C 3W2VA 4Y3OA 2HDWA 4F91B 1D1CA 4F93B 1E0EA 3OYKA 4XLCA 3IAM2 3L2QA 3SDBA 3RCOA 3VYUB 2LY2A 4E7JA 3I9V2 4N4OB 4BQOA 2VQGA 4E6KG 2UV1A 4HPQA 4FETA 2UUZA 4D9JA 4XR6A 3DU5A 2VKDA 3RPUD 4D1QA 2M3AA 1X1BA 2ZXIA 3ZQQA 2BVLA 4PUSA 2OC6A 2LYCA 4HG2A 4Y4RA 4AYBA 3BLYA 4HRIA 3CP8A 2R7XA 4XL9A 2HU9A 3IP4B 3OYBA 2IXSA 5CQEA 3VYTB 4KT6A 2L7KA 1NG6A 4BJTA 2X1DA 2HVQA 4BJ5C 3OYDA 2LC2A 2R7TA 1LDKB 2CH0A 4NC7A 4DIQA 1IRXA 3H9QA 4XLEA 2KZVA 3K4MA 3OYFA 2BW3B 2IGNA 3H9GA 3K4LA 4ZDPA 3VSLA 1MMNA 2K3PA 1T95A 4FASD 1N75A 3AL0B 1LVKA 4U7BA 4NUBA 2V9KA 2JUGA 3F9KA 2HPIA 3ZCOA 3A4CA 3K4NA 3PSFA 1G59A 2XDVA 2E5NA 4PFPA 3K4BA 1UELB 1X4OA 4XMYA 1QHHD 2JVHA 2E60A 3L2VA 4C30A 4LG3A 4OWRB 2V26A 4KITB 2MABA 4RLQA 4XNFA 3EUKL 1WJ5A 3N05A 4PFOA 4PSXA 2LOOA 3BG6A 2V6EA 3CP2A 2V1NA 4IZZA 2R7OA 4P1WA 3D5RC 4BXFA 4JOMA 1WJDA 2ZSIB 2RNGA 1MNEA 3K4JA 4BACA 3L2RA 3PNTA 4XOPA 3RQ4A 2F4IA 2VASA 3VWBA 2LG4A 3TL4X 4HNTA 4ZJZA 5JHFA 1MMAA 3IAS2 2L2OA 3ONQA 4BEHA 3FBIB 3RSNA 4DGWB 1BR2A 3S93A 3DKXA 3VDXA 2QKMB 1DGWY 1D0ZA 4BE0A 2OV7A 1WJAA 3OYCA 1MW7A 3VSKA 2E1MB 3PUBA 3OYGA 4N4NB 2WAFA 1D1BA 4CSWA 3BCBA 4NQWB 4B43A 1X19A 2MYSA 4II2A 3LSKA 4E7LA 4KISA 4ZC3A 4BDZA 4XLFA 3LSHA 5KHDA 2DT6A 3LMMA 4KJZA 4XN3A 4XQFA 1X1CA 2WA0A 2HNHA 3HOSA 1UAAA 2M7BA 3MKYB 1KONA 1P9QC 2KQRA 4ZYAA 3EPZA 2KMUA 1OLTA 3M8JA 3DTKA 2HVSA 2L9NA 1DGRM 3TMOA 4E7KA 3C2GA 2R7RA 3G2BA 4B48A 1FMWA 3S3MA 2M4KA 2I8DA 3OIQA 4CCJA 4BDYA 2DXIA 3DLAA 2VL8A 3LSMA 2DJIA 2R7WA 2VXDA 4B44A 1X1DA 3HC7A 2E5ZA 4RLFA 4F92B 3K70C 1BR4A 1WJFA 4F3QA 2K9LA 2OUMA 5LFAA 5CKTA 1Z7LA 1D1AA 3SEQA 3HPGA 1WJBA 3K6GA 4DBQA 1N77A 3UNGC 4R79A 4B47A 1V5EA 2ELJA 4E7HA 2X1CA 4DJAA 3SEZA 2LBFA 5HNHA 4PJMA 3PNYA 2L5QA 2FUG2 2R4GA 3QYBA 5HNFA 4ZTJA 3HKZA 3L2WA 4ZTFA 2W1OA 2WAEA 1NG7A 4BGDA 5CQGA 4AVZA 1J09A 1EA3A 4XLAA 2CMPA 3E1SA 3RTRA 4F52A 3LSIA 5HLTA 2ZFUA 1TT0A 2VJJA 4XKVA 2X6WA 4ZDOA 2V7FA 4XN0A 4J00A 2VQCA 1FMVA 4XOTA 1R6RA 1PYVA 2JA2A 3HPHA 4OAYA 4PJJA 3QOEA 2X6YA 4C2TA 3AL0C 2CFOA 4HSTA 3L2UA 3EUHC 3FDYA 3PNVA 2PJRB 4IQ4A 3HG9A 2M4GA 3CJQB 4CZCA 3OYHA 1SAUA 2X1EA 2CS3A 4PSWA 2F5VA 2WBMA 3KEYA 3NWTA 2WADA 2X6XA 4IX7A 1SFKA 1Z3XA 2HZDA 1S9HA 2P0WA 2ZXHA 3S3OA 3OOUA 4BQQA 2L9SA 4BE1A 3DKYA 2MFZA 4MLOA 2MC4A 2VJ4A 4P5OA 2GOXB 1Z21A 3BG7A 2LRDA 3MKZA 3QODA 4CH7A 3C2HA 4CCLA 4NNJA 1DP3A 3DPLC 3CF2A 4NC8A 2KLOA 3PFYA 3HOTA 2VJ5A 2IS6A 2LREA 2Y0SA 4CA0A 3QYFA 3VYRB 2W7NA 2M7AA 3H35A 3M1CA 3K4CA 4BQNA 2KDOA 1ERDA 3H9JA 4DOZA 2KRCA 2HQAA 4PK4A 3FBNB 3DTEA 2IGOA 5KNLA 3OY9A 2IS2A 1BOBA 4U87A 3OR1C 4GRIA 2E1MC 1Y56A 3OWTA 5LD2C 1V5GA 3ZR8X 2A5WA 1G8XA 1BR1A 1UG0A 1MNDA 3VYSB 4XLHA 2DT7B 2VKHA 3OYIA 3H5RA 3MKWB 4E7SA 3OS2A 2NOJB 1TZLA 4DBRA 2MD0A 3DU6A 1D0XA 4HEA2 4YRVA 3OYAA 3PL8A 2LH9A 2CW7A 3D5SC 4AU7A 1AA7A 2BVMA 2KHMA 3KYLA 3HUGB 4BL0B 2O5RA 3ZRGA 3K10A 3CESA 2R7UA 3LL7A 4LITA 4BEHB 5FRNA 1MMDA 2XAUA 5FRMA 2BW3A 2X51A 2VQLA 4BU2A 4X0GA 2W82A 2W00A 1K6YA 3TBIA 4XORA 2CV1A 2CV0A 1YX3A 2AQFA 1WFXA 1Y6IA 1YE9A 2JSPA 2R7SA 2IS4A 3CJRB 3DTIA 3ZGKA 3J7AY 3OR2C 4ITVA 3S3NA 2A6TA 4PJNA 4XONA 3A2KA 2CUZA 3H5AA 3BCAA 2IS1A 4C2UA 4BE2A 1V5FA 1OR7C 2UWMA 1MMGA 3SZGA 3K70D 2PJRA 1HA8A 5TGTA 2WY7Q 2Z1DA 3PJRA 2CUJA 2VB6A 2KPMA 4LIUA 3DQVC 1X1AA 2Q2EB 2VPLA 1JI8A 3SYTA 2GOMA 4Y33A 1LKXA 4CCOA 3OL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DT6 A;  2E60 A;  1UG0 A;  2E5Z A;  2DT7 B;  1X4P A;  1X4O A;  4DGW B; 
#chains in the Genus database with same CATH topology
 2KIU A;  1WJC A;  4UHT A;  3F6V A;  4BUP A;  1FP2 A;  3GTQ J;  3J80 K;  3OYM A;  2HPM A;  1VQ7 I;  2Z99 A;  5HOO A;  2PQ8 A;  4A3F J;  3M4O J;  4Y17 A;  5JVT A;  3N97 A;  2EIN H;  5ILV A;  4BY1 J;  3A01 A;  2JPC A;  1IRZ A;  1OPC A;  2XGE A;  4G7O F;  5L3B A;  2Y31 A;  4UB8 C;  2L0K A;  2XF6 A;  2RN7 A;  1SVM A;  3CZ6 A;  3ERM A;  3MEX A;  4IOA F;  3CUO A;  2EPF A;  4MQV A;  1E3H A;  1LFP A;  2M0M A;  2O8K A;  1TWA J;  3CDL A;  1K7A A;  3V8K A;  2IGM A;  1ZYR F;  1WHU A;  3ZP5 A;  1LVA A;  1JKP C;  4AIH A;  1VTN C;  3CCQ I;  4ZYE A;  2QWW A;  2VIX A;  1H0M A;  3EDP A;  2JVG A;  4A5M A;  2LY1 A;  2DCE A;  2M87 A;  3EET A;  2KRH A;  2QUF A;  4S04 A;  3OSG A;  2O6G E;  1LQ1 A;  1OCT C;  5E1Z B;  5BMZ A;  1QU3 A;  3CDH A;  4BBR J;  4FT8 A;  2ZC2 A;  1DU0 A;  4Q5S F;  4UUV A;  5GTI C;  3RPU A;  3IC7 A;  1XDS A;  4D7N A;  1WRJ A;  2DTZ A;  3H92 A;  4E4H A;  5M3F J;  1FOX A;  2X0L A;  1BJZ A;  2M45 A;  4IXA A;  4A3L J;  2EZL A;  4E7I A;  2JA8 J;  4BHP A;  2RC4 A;  3WTU C;  2QSH X;  4H4K C;  2L7F P;  4M9X A;  5F08 A;  1XN7 A;  4RBO A;  4A3I J;  3CMM A;  3VFZ A;  1ITY A;  2KL4 A;  5DS9 A;  2XF5 A;  3K9T A;  2DA5 A;  4BHB A;  3KLO A;  4YEL A;  1MZB A;  1R36 A;  4BS9 A;  5J1R A;  2E34 A;  2JPB A;  1Z3Y A;  1S8N A;  4K2E A;  1EH6 A;  1ZGJ A;  4OIQ F;  2KKO A;  2VBW A;  3T8R A;  3OYE A;  1YJW I;  3I53 A;  1X2N A;  2DI3 A;  1XGO A;  4GYI A;  5DDG A;  2ISZ A;  4P9U A;  2RQQ A;  2Z16 A;  2L7M P;  3F8F A;  3IH2 A;  3QYE A;  4IQJ A;  2XVC A;  4XKB A;  2G9W A;  3I55 I;  2XKO A;  3BC8 A;  2L7Z A;  4IKF A;  3K4K A;  4M3G A;  1W36 D;  1ZGW A;  2W4S A;  3QQA A;  1Q1H A;  2E2H J;  3W2V A;  4Y3O A;  4F91 B;  2Z5U A;  1ZTR A;  5F0C A;  4GO1 A;  3RCO A;  1TQP A;  2HKX A;  3WTV C;  4L9V A;  2VQG A;  4EM1 A;  1OQY A;  4HPQ A;  2DFF A;  2VKD A;  3RPU D;  2M3A A;  3SXY A;  3E6B A;  2MBF A;  1J7K A;  4Y52 J;  2OC6 A;  2W25 A;  2FQ4 A;  4NDL A;  5IP7 J;  3RYP A;  1I6X A;  3B6C A;  4HRI A;  3CP8 A;  3GUD A;  4XL9 A;  2E1C A;  5IT9 Z;  3PIP F;  4G7Z F;  4DYR A;  2HQ5 A;  3IP4 B;  3OYB A;  5L3F A;  5DCM B;  2E2J J;  2BHZ A;  3VYT B;  2F5E A;  4KMU X;  1UMQ A;  2L7K A;  3LAP A;  1O3T A;  1IN6 A;  2HVQ A;  2E1O A;  3IRR A;  1JKO C;  4D7M A;  2XUB A;  1B9N A;  2EIK H;  2V79 A;  3JSP A;  5EG0 A;  1L3L A;  1B72 A;  2CFX A;  5D6E A;  1YS7 A;  1GUU A;  1I1G A;  4EEF G;  1R9T J;  5B66 C;  2COB A;  3K4L A;  5E20 A;  4FAS D;  1T95 A;  1J5Y A;  3ABM H;  1Z91 A;  1Z05 A;  4U7B A;  4NUB A;  1BN5 A;  2V9K A;  1ZRC A;  1F36 A;  1L0O C;  2O7O A;  2MG4 A;  1T39 A;  4CYC A;  3PM1 A;  3TP3 A;  2EA4 A;  3LA3 A;  5K5R A;  3T1B A;  5J1U A;  3GFM A;  3G71 I;  1ETK A;  2L02 A;  1PDN C;  1UEL B;  3AG2 H;  1VND A;  2EZK A;  1SMY F;  1IDZ A;  1QHH D;  1UHS A;  2E60 A;  3K7A J;  4U0V A;  3LA7 A;  3T8T A;  1WI3 A;  5CVR A;  2V26 A;  1BC7 C;  2MAB A;  2RGV A;  4EMS A;  2TDX A;  2VKV A;  2ME6 A;  2H6B A;  1BI3 A;  1ACI A;  3NAU A;  1VQP I;  3CC4 I;  1ZLK A;  1ETQ A;  4IJA A;  2V1N A;  4BXF A;  4GYG A;  2BE5 F;  3AG4 H;  3ASN H;  4MFD A;  4O5V A;  2DMQ A;  2FU4 A;  2FMY A;  2QGU A;  3HJE A;  4LB5 A;  1E2X A;  1YW9 A;  3HSF A;  4KN7 X;  4MNU A;  4HNT A;  1NTC A;  1XB4 A;  1OIS A;  4I99 C;  4A3M J;  1RES A;  3FBI B;  1BR2 A;  3S93 A;  4RB2 C;  5E17 F;  3B02 A;  3BRO A;  4NC6 A;  1ZRF A;  2QVO A;  2EFN A;  2G7H A;  1QPM A;  3FX3 A;  2HTJ A;  3RQI A;  2R7Z J;  3ZN0 A;  1U5T B;  2ZXW H;  3BT9 A;  1D1B A;  1R22 A;  2QM3 A;  3I71 A;  3JTH A;  1MDM B;  4NQW B;  1VQ4 I;  5HS7 A;  2ESH A;  1K4T A;  4BDZ A;  1YLF A;  1QA6 A;  4X6A J;  4ENN A;  3FIS A;  2FD5 A;  4M73 A;  5EEA A;  1KU3 A;  1J9I A;  2HNH A;  3JRE A;  3HOS A;  4U88 A;  2PFB A;  1SFU A;  1KON A;  2KQR A;  2W57 A;  2OZU A;  1YJN I;  1D8J A;  2HZT A;  2HVS A;  3CCY A;  2L9N A;  3L1P A;  4E7K A;  3RKQ A;  4BQA A;  2DYR H;  3KP5 A;  2VE8 A;  4YFK F;  1FMW A;  4A0X A;  1ETV A;  1YO5 C;  2I8D A;  4BDY A;  1JGS A;  3DLA A;  1I3A A;  3LSM A;  3FXO A;  1U78 A;  1XPX A;  1F43 A;  2R3S A;  4KIB A;  2HDC A;  3CCS I;  2E5Z A;  1JUP A;  4F92 B;  2X9D A;  2OCE A;  3GYH X;  4F3Q A;  5LFA A;  4IHY A;  4A3K J;  2CRG A;  4MGR A;  3TO7 A;  1XG1 A;  4HV5 A;  1D1A A;  1Z1D A;  4I02 A;  3LSR A;  2HKO A;  3SZT A;  1TW2 A;  1WJB A;  5FKN A;  3WTS C;  3C1D A;  2ELJ A;  2X1C A;  4DJA A;  3SEZ A;  2CG4 A;  1G4D A;  4KIF A;  3SDG A;  4IRG A;  2BHY A;  4S0H B;  2DFI A;  3QYB A;  1R1V A;  4RAG A;  3ECH A;  3FXK A;  4C3H J;  5M5W J;  2M34 A;  4ZTF A;  2WAE A;  5EJC A;  2EFP A;  1EA3 A;  2CMP A;  1F9N A;  2HYF A;  1HKT A;  1HQC A;  2F5F A;  3TO9 A;  3JR9 A;  3JCU C;  1FIA A;  3CLO A;  2YR2 A;  1TT0 A;  2ZFU A;  2VJJ A;  2MH2 A;  2JN6 A;  1WWX A;  2O3F A;  3V4G A;  3VB2 A;  2VQC A;  3R60 A;  4XOT A;  3EYY A;  1Q1V A;  5J8F A;  1P2F A;  3MCZ A;  2CFO A;  3DBR B;  4HX7 A;  2JTV A;  1GDT A;  1EKE A;  1MD0 A;  2PJR B;  5B3S H;  1X3Z B;  3FKI J;  3E5Q A;  2M4G A;  3CJQ B;  3E5X A;  5JI6 A;  2CYY A;  1MBJ A;  3IWZ A;  4MEX F;  2P7C B;  5LHG A;  2X1E A;  2GA2 A;  1KA8 A;  1BJA A;  2CS3 A;  1OYW A;  3NWT A;  2DOE A;  1TP4 A;  1YIO A;  2WAD A;  4AVP A;  4BH9 A;  1U5T A;  2R5Z B;  2HZD A;  2P0W A;  1B59 A;  5GTH C;  2GBY A;  2EH3 A;  4IPA A;  3OOU A;  3BR3 A;  3MQ0 A;  5CYV A;  1PUE E;  1X58 A;  4NQW A;  5BOX A;  4P5O A;  1IN5 A;  2OJE D;  3BG7 A;  4G7H F;  1LB2 A;  3FMR A;  5C3E J;  3HB9 A;  1KQ8 A;  1PUF A;  2MLK A;  3CF2 A;  2YU3 A;  3GME A;  1NK2 P;  1JJ6 C;  2MLG A;  4M3F A;  4NC8 A;  3ZMD A;  3PFY A;  5EZH A;  3HOT A;  2Z33 A;  2EBI A;  2VPR A;  2Y30 A;  3RYR A;  2CW0 F;  3JAM Z;  1R71 A;  3HOV J;  2Y0S A;  3NAR A;  4M9Z A;  3VYR B;  2ZB9 A;  3H0G J;  1QQI A;  3ULQ B;  3FK7 A;  3GW2 A;  4BQN A;  2P8T A;  2XAH A;  3COA C;  3H9J A;  4DOZ A;  5EDN A;  1B8I B;  1ZAO A;  2KRC A;  1STZ A;  2CQK A;  3HSR A;  1K4S A;  2HOA A;  5E3M A;  1TQM A;  3WGG A;  1ETW A;  2QBY A;  3NRV A;  2LP0 A;  3OR1 C;  3HHG A;  2E1M C;  2HXO A;  1MIJ A;  3LWF A;  3CCJ I;  1G8X A;  1YW7 A;  4XLH A;  2DT7 B;  2VKH A;  3SFZ A;  3H5R A;  4X1E A;  5KVR A;  3ZQF A;  3OYI A;  1FC3 A;  3OS2 A;  2ESN A;  3BPV A;  4DBR A;  3ELK A;  3MFK A;  3PL8 A;  5F1J A;  4WF2 A;  1AA7 A;  5BNG A;  2BVM A;  3HYI A;  3GZ5 A;  2FEZ A;  3G4S I;  4G6Q A;  1ZN2 A;  3CES A;  3M9A A;  1OCR H;  1QZE A;  5L3E A;  1BOA A;  3LL7 A;  3B6A A;  4BEH B;  4DZP A;  2KFD A;  5IYC J;  3Q0V A;  4DW6 A;  1MH4 A;  5GAE J;  5J8C A;  4BU2 A;  1O7L A;  1U6G A;  3DKW A;  2E19 A;  2L01 A;  1K6Y A;  2K4B A;  2LFB A;  2H1L A;  3EUH A;  5E3L A;  1E17 A;  3ZQG A;  1FTZ A;  2IBD A;  2VI6 A;  2XRO A;  3K1N A;  1ON1 A;  1H89 C;  2A6T A;  4PJN A;  3JW4 A;  2XPU A;  3H5A A;  2FSW A;  1FBQ A;  2FBI A;  2IS1 A;  5CVI A;  4DZJ A;  3L09 A;  2BZT A;  2UWM A;  3ZPL A;  2GIZ A;  4B3A A;  2NAZ A;  2PJR A;  2DLL A;  2DMT A;  3BJA A;  5ICC A;  1TT5 B;  2F2E A;  3H1C A;  3J80 Z;  2KPM A;  2PBI A;  3QP5 A;  1X1A A;  1SC7 A;  1JI8 A;  3V8J A;  3KP7 A;  1P6R A;  4Y33 A;  3O2P E;  1MNM C;  3OL3 A;  2ZNY A;  1WH5 A;  5BPI A;  2EV5 A;  3TOA A;  4CYD A;  2EV0 A;  3DEU A;  3S1N J;  4KUM A;  4M6X A;  2EA2 A;  1X4P A;  4IHX A;  1D5Y A;  1VQK I;  2K3F A;  2A69 F;  2QKL B;  3KPH A;  1W1W E;  3FM3 A;  4CCM A;  1VZ0 A;  4LFU A;  3O6B B;  5C4J J;  1XDU A;  2HGC A;  3IH3 A;  2RRE A;  2CO5 A;  1RUO A;  1ZQ3 P;  1IW7 F;  3OYN A;  5GAH J;  1VFC A;  2ZSH B;  2C6Y A;  5HVQ C;  1WJE A;  3LQQ A;  1U9N A;  2JRM A;  4G6D A;  1MMS A;  3ZQL A;  3FXJ A;  2RVC A;  2XSJ C;  4RB0 A;  4HQM A;  3S1R J;  5E1W A;  2MGQ A;  5LEJ A;  2P5L C;  1AHD P;  2Q0O A;  3P7N A;  3W3C A;  3JRD A;  3EYI A;  4PJL A;  3DEE A;  4J01 A;  3IKT A;  2BOL A;  2LLK A;  2EFO A;  4MIM A;  3CC2 I;  3CUQ B;  4TV7 A;  3U21 A;  4A3J J;  2HVR A;  4YFN F;  2JZY A;  3KZI C;  1IXC A;  3ABT A;  3D5L A;  1G3W A;  4HDV A;  4C9Y A;  1RI7 A;  2EJR A;  3H3Z A;  1DDN A;  1Y1W J;  4L0Y B;  4UY8 I;  1N78 A;  1Z77 A;  2GXG A;  1HF0 A;  3MMY B;  3I54 A;  5DYM A;  5ERI A;  5KCM A;  3CCM I;  4HNV A;  4II3 A;  1J0R A;  2AHQ A;  3S32 A;  2PI0 A;  1YX5 A;  2K9M A;  2KT0 A;  2Y75 A;  4P96 A;  5DM6 F;  4YEJ A;  1HSJ A;  4UVB A;  3WG9 A;  4AIJ A;  3W2W A;  3ROU A;  4HZF A;  4RM3 A;  1DQU A;  1MJA A;  1PP8 F;  2BY0 A;  2K02 A;  3HOW J;  1A36 A;  5L3C A;  5K5Q A;  2P7V B;  4ENM A;  3HOZ J;  2QEN A;  2AQE A;  3FMS A;  2B9S A;  3DEW A;  2QQ8 A;  2XC7 A;  1FYK A;  4U0W A;  2EFW A;  5AIP A;  3BG9 A;  3GWZ A;  4C2M J;  3GTG J;  5DTD A;  2OQR A;  2ZJQ F;  1H9T A;  3MD2 A;  3S8P A;  4LOC A;  4QPO A;  3S15 J;  2DFE A;  2WY8 Q;  3ZOB A;  3NWS A;  3WHB A;  1FYL A;  4D0P A;  2IPQ X;  3EUA A;  4UV8 A;  5IY5 H;  3DLL F;  2DMP A;  4RB1 A;  1U0J A;  4Q4Z F;  1ZR4 A;  3OV8 A;  1XGS A;  1T0F A;  5HOD A;  2K9N A;  2NOG A;  1JT0 A;  5J47 A;  1E0E A;  5GP9 A;  3OYK A;  4XLC A;  4U7D A;  1RKT A;  2MC3 A;  1G2H A;  3QU3 A;  4A93 J;  1PP7 U;  3Q3S A;  3I9V 2;  1RZ4 A;  4IRI A;  4BQO A;  1VQ8 I;  2LKP A;  1SFX A;  4OIR F;  4XRM A;  3GTL J;  2QQB A;  3G3Z A;  4AWX B;  5FLX K;  5FO5 A;  4R1H A;  2B7E A;  2IRF G;  4CDG A;  3G73 A;  1FX7 A;  1TNS A;  3KLN A;  4OU0 A;  3SQN A;  2DW4 A;  3BLY A;  3CF5 F;  3R0A A;  2F48 A;  3QU6 A;  2R7X A;  5B5E C;  2ISY A;  1CF7 B;  3GTP J;  2XHK A;  5F6F A;  2IXS A;  2P4W A;  1ETX A;  1S29 A;  5CQE A;  3R6S A;  1F1Z A;  1S72 I;  4M72 A;  2LKX A;  1NG6 A;  1ZG3 A;  3LA2 A;  2X1D A;  4BJT A;  3Q5F A;  2IT0 A;  2LC2 A;  3IHU A;  1F5T A;  1OCO H;  3E6D A;  2HQN A;  2DA1 A;  2YPR A;  4DIQ A;  2Y2Z A;  2KZV A;  3BZC A;  1T33 A;  3F8M A;  3K4M A;  2M8E A;  2H6C A;  1SFO J;  3BTC A;  3VSL A;  2ZME A;  2V1U A;  1N75 A;  2QA4 I;  2R7D A;  5C44 J;  5TRD A;  3F22 A;  2DA7 A;  2JUG A;  2EV6 A;  3CUQ A;  5LRR A;  3F9K A;  3U2R A;  3K2Z A;  3MKL A;  1R5I D;  1ZG1 A;  5FD5 A;  4RGS A;  1TL8 A;  1IRF A;  1RNL A;  4M71 A;  4PFP A;  3K4B A;  2HOT A;  4YII A;  5L3D A;  3ZMT A;  3LSJ A;  5J1Y A;  4XMY A;  2JVH A;  4FX4 A;  4C30 A;  4LG3 A;  5E18 F;  1YOV B;  4KIT B;  2D45 A;  3K1P A;  1TBX A;  5E3O A;  2BY2 A;  2RV8 A;  5E1X A;  4DNC A;  4WXC A;  1YTY A;  2LOO A;  4RAZ A;  1SD4 A;  1USS A;  2DQL A;  1TWF J;  4BXX J;  5LGU A;  4JOM A;  4EM2 A;  2HDD A;  1QZZ A;  2BXY A;  1WJD A;  2HYJ A;  2K85 A;  1FSE A;  4EJV A;  4ABZ A;  3HUG A;  4XOP A;  3RQ4 A;  1WI9 A;  1SD6 A;  1IN8 A;  2F4I A;  5F0F A;  2LG4 A;  5FKM A;  4EJO A;  1O3R A;  2L2O A;  3CCR I;  5LRS A;  4UV9 A;  4DGW B;  2ZFW A;  4NB5 A;  2QKM B;  1WSU A;  2OV7 A;  3BG3 A;  2QCO A;  2QYO A;  2D1H A;  1OCZ H;  3CMA I;  4OIO F;  1BA5 A;  2CWE A;  2BYV E;  1XD7 A;  1AKH A;  1MW7 A;  2COM A;  3MVP A;  1BL0 A;  2OZ6 A;  3OYG A;  4UUS B;  3TW6 A;  1TQI A;  5M5Y J;  5D5V B;  1SAX A;  1GVD A;  4MTD A;  2WAF A;  5E79 C;  4G12 A;  5HDG A;  4RB3 C;  3BCB A;  4NHJ A;  1UJ8 A;  5F1R A;  2STT A;  4B43 A;  1X19 A;  1FEX A;  4II2 A;  1LE8 B;  3J7Y J;  3N4M A;  3LSK A;  2BXZ A;  2IA2 A;  3PQK A;  4HYE A;  2CQQ A;  5H20 A;  4E7L A;  5HS8 A;  1W0U A;  4ZC3 A;  4XLF A;  5HDK A;  1ZK8 A;  3LSH A;  1CQT A;  2DT6 A;  3TP0 A;  1I50 J;  4KJZ A;  2GXB A;  3RZD J;  3A0B C;  2JRT A;  3E97 A;  1YHQ I;  2M7B A;  4BXU A;  1P9Q C;  4ZYA A;  2KMU A;  3KE2 A;  2VOD A;  2VBX A;  1FNN A;  4B8X A;  4CHU A;  3TMO A;  3K2A A;  1JUS A;  2GLO A;  2R7R A;  3G2B A;  4HOB A;  2M4K A;  5KAF C;  3OIQ A;  5GAG J;  5E3N A;  2PMH A;  3MN2 A;  1A5J A;  4BBS J;  1O4X A;  2VL8 A;  4Z2Y A;  3BR0 A;  1NK3 P;  4A0Y A;  2BEO A;  2L4A A;  1X1D A;  5F27 A;  2DMN A;  2V9V A;  1PVE A;  2A6H F;  4WXD A;  3ZMS A;  4DYC A;  3JRG A;  4FTH A;  5J4Y A;  5K7Z A;  2E2I J;  4W97 A;  2XPW A;  1X2M A;  3K6G A;  4HQE A;  5DCF A;  1V5E A;  3QPT A;  1XMK A;  1N25 A;  2NS0 A;  2VC0 A;  1QRY A;  2KIS A;  1A31 A;  1YRN B;  1BBY A;  1BI1 A;  2EQR A;  2NVT J;  1O57 A;  4LJZ F;  1LDD A;  5FFX A;  2W24 A;  2YX7 A;  5HNF A;  4ZTJ A;  3HKZ A;  3L2W A;  2Y0S N;  2W1O A;  2D1V A;  3IRQ A;  4AC0 A;  3F8C A;  3E1S A;  4L9N A;  3RTR A;  4F52 A;  3LFK A;  5HLT A;  4PCQ A;  3GXO A;  2DK8 A;  4A69 C;  4MHG A;  2X6W A;  2V7F A;  2VT3 A;  3ML6 A;  4A3G J;  5GPA A;  1HXD A;  2JA2 A;  1PYV A;  2FOW A;  2IJL A;  2XB0 X;  3WGI A;  3QOE A;  3AL0 C;  4HST A;  1H9G A;  3IH4 A;  4XSX F;  4A3B J;  3EUH C;  4ETS A;  1O3Q A;  2NS8 A;  2DTR A;  3PNV A;  5LLQ A;  5BPD A;  1W7P B;  3HTS B;  4IL6 C;  1IRG A;  5EEH A;  5B1B H;  1UZC A;  1HOM A;  3FIW A;  3OYH A;  3MAJ A;  1D3Y A;  1YW8 A;  2BY3 A;  4PSW A;  4LG0 B;  2WBM A;  1XGM A;  1SEU A;  2BBY A;  3R4K A;  3C2B A;  1SFK A;  1Z3X A;  4MTE A;  3G6E I;  2DJN A;  4BE1 A;  3C3W A;  3DKY A;  3P9I A;  1LPQ A;  1WGX A;  2VJ4 A;  3J7Z I;  2FA5 A;  4KNY A;  2A3S A;  2GOX B;  1Z21 A;  2DQR A;  4EJW A;  3MKZ A;  3QOD A;  4CH7 A;  4OMZ A;  2LSO A;  4CCL A;  1FYM A;  1DP3 A;  5EGO B;  4L5J A;  3ABU A;  2KIQ A;  4Y13 A;  1FLI A;  2CQN A;  4KIC A;  1FY7 A;  3JRA A;  2ID6 A;  4CZZ A;  4JX4 A;  1FTT A;  2VJ5 A;  3TKY A;  5D5W B;  3QYF A;  1R5G A;  1S7A A;  1HBX G;  2IAI A;  3M1C A;  2UZK A;  2ECB A;  2KDO A;  1ERD A;  1AU7 A;  4MEY F;  2M9H A;  3FBN B;  4EGY A;  4I6Z A;  2AS5 F;  1FZP B;  5TIS C;  5B1A H;  1J59 A;  3OY9 A;  4RA2 A;  2IS2 A;  5HLG A;  2O0Y A;  1TTY A;  1Z0X A;  3GO5 A;  5D8K B;  5LD2 C;  3ZR8 X;  2A5W A;  2OF7 A;  1BR1 A;  2IVM A;  2ZJP F;  4EM0 B;  2RNJ A;  3MKW B;  3IV5 A;  3B73 A;  1EH8 A;  3G1L A;  1AOY A;  2Z9O A;  4IHS A;  3DU6 A;  1D0X A;  4XBF A;  3ERE D;  3ZN1 A;  3OYA A;  2GM4 A;  2LH9 A;  5DCM A;  2ZBK A;  3D5S C;  3CJN A;  4A0Z A;  4AU7 A;  2PG4 A;  1I3Q J;  2F4O B;  1K6O A;  4HX4 A;  2GZW A;  3KZY A;  1X1P A;  2ZO4 A;  1KZH A;  3K10 A;  3ZRG A;  1IJW C;  3FXM A;  3UKG A;  5FRN A;  3GF2 A;  1IUY A;  2EZI A;  3IKV A;  2X51 A;  5D6F A;  2DMU A;  3KYC B;  1HW2 A;  2CV1 A;  4W1U A;  1ZR2 A;  3S16 J;  3T5X A;  2AXL A;  2AQF A;  1RC9 A;  4S05 A;  3A0H C;  4QTR A;  1LEA A;  1SVL A;  4YIF A;  3J7A Y;  3RKX A;  1HCR A;  4XON A;  1FSH A;  4PJ0 C;  3CCV I;  4GCV A;  4Q47 A;  1JTY A;  3LQR A;  4XRS G;  1J2X A;  3HM5 A;  1V5F A;  2WV0 A;  3L9F A;  4HLY A;  3KZZ A;  1P7J A;  1W7P A;  2LF7 A;  3GZN B;  3L7W A;  2FBH A;  1SMT A;  1IG7 A;  2WY7 Q;  2Z1D A;  3GLX A;  1RR8 C;  2CUJ A;  4WXH A;  1Y1V J;  2VB6 A;  3S17 J;  1QBJ A;  4KYW A;  2F5C A;  2ETH A;  2P5V A;  1OYI A;  3FXL A;  3SYT A;  1G6N A;  1ENH A;  2EIM H;  1X3U A;  5FFZ A;  3V7S A;  4FX0 A;  1LUJ B;  2BV6 A;  4RGU A;  5K7H A;  2XAG A;  2VQH A;  2X4H A;  3AFH A;  1T0F C;  2LVS A;  4HA8 A;  2HEO A;  2WAQ A;  2Z2S B;  4MO7 A;  4UB6 C;  1LDJ A;  1B1B A;  3DPU A;  2NNN A;  2XF7 A;  1IXR C;  5M5X J;  1Y8R B;  3O8G A;  3I59 B;  3CME I;  4ENK A;  2ELH A;  1UCR A;  1ZEL A;  2X85 A;  3ASO H;  1MJB A;  4KIG A;  3OYJ A;  1Y8Q B;  4BAY A;  3HXL A;  3OYL A;  4A3D J;  4ZYG A;  3SJM A;  2EZH A;  3OIO A;  4N9H A;  5LEK A;  2LBF B;  2RAE A;  4J19 A;  1ODD A;  3FHN A;  1EF4 A;  1P92 A;  4FQG A;  2YS9 A;  4CCK A;  4ZZL A;  3HL2 A;  4RMN A;  1FT9 A;  3BWG A;  3BQY A;  1MDM A;  4XM3 A;  3T0Y A;  2JA7 J;  4LIV A;  1I27 A;  3E7L A;  5D4R A;  1QZY A;  3OMY A;  2P6S A;  2RQP A;  3TO6 A;  5IYB J;  3FM5 A;  5D4S A;  2QLZ A;  2CW8 A;  1W7P D;  4Z6Y A;  4FIS A;  1TWC J;  4JX6 A;  4E7Z A;  4EQQ A;  1REP C;  2HR3 A;  1FP1 D;  2LKS A;  4IVN A;  1Z9C A;  4O6J A;  4CUG A;  2I10 A;  3D0S A;  4FHT A;  4HBL A;  1HDP A;  2VLA A;  2V1X A;  1ZGA A;  4H0E A;  2YSR A;  2LR8 A;  4L9J A;  1POG A;  2VJI A;  3D1N I;  2K5C A;  2HWV A;  2L9R A;  4L5E A;  4RAY A;  2CV2 A;  1LNW A;  3W2A A;  3OIP A;  1QHG A;  4ZYD A;  4G6T B;  3KET A;  2V4J C;  4XKW A;  3DWL E;  1OYY A;  4Y15 A;  1MBG A;  1KYZ A;  1OR7 A;  1U8B A;  5FLV A;  2R7V A;  1W5S A;  1W36 C;  3RJP A;  2VE9 A;  3HRU A;  1Z7U A;  1ON2 A;  3HDD A;  5JFR A;  2VC1 A;  5HS9 A;  4XK4 A;  4JQF A;  4EAT A;  1FWZ A;  2P5K A;  4NBQ A;  1YI2 I;  1D0Y A;  5D8L B;  2WB1 A;  1FPQ A;  2K40 A;  4M3D A;  3OS1 A;  1IXS B;  5HLI A;  3A1Y A;  3I4M J;  3DV8 A;  5K1Y A;  4I7H A;  3H0D A;  3CCU I;  5CPR B;  4IHT A;  1RPW A;  1HLV A;  1FOK A;  1WH7 A;  2ICW G;  4IHW A;  2HDW A;  1JT6 A;  1D1C A;  4F93 B;  5DUI A;  1G3S A;  1QNT A;  2ECC A;  3IAM 2;  3L2Q A;  3SDB A;  1YYV A;  2GIV A;  1K61 A;  1E3P A;  4N4O B;  1SFE A;  3FXU A;  5ICF A;  2QSF X;  2UV1 A;  3PQJ A;  4D9J A;  3HEF A;  1U3E M;  3DU5 A;  2E7X A;  4D1Q A;  2ZXI A;  3ZQQ A;  2BVL A;  4EGZ A;  1ZHF A;  3ZMV A;  5JVG F;  1B4A A;  4CGZ A;  4HG2 A;  2IEK A;  1Z6R A;  3VOE A;  4AYB A;  1DU6 A;  1O3S A;  2XSD C;  4PDK A;  1OKR A;  2HU9 A;  2K9S A;  2M5W A;  2CSO A;  2KIM A;  4U0Y A;  2KJC A;  1S7E A;  3GFJ A;  1ORK A;  2L54 A;  1JGG A;  2XAJ A;  1KGS A;  5J3L A;  4C3I J;  2R5Z A;  4B4C A;  3BTL A;  2R7T A;  1JHH A;  3PO2 J;  1IRX A;  3H9Q A;  1A35 A;  3Q9S A;  1BW6 A;  5JLX A;  2Y9Z A;  3OYF A;  2GA1 A;  3HRT A;  4IRH A;  2BW3 B;  3H9G A;  3PIO F;  2JUC A;  2XGC A;  1LVK A;  3CC7 I;  1V4R A;  2UXX A;  1U9O A;  3AG3 H;  1MJ9 A;  1BI2 A;  5LHI A;  1MBH A;  1MH3 A;  1EV7 A;  2MSY A;  2HPI A;  3ZCO A;  1V55 H;  1G59 A;  1SD7 A;  2XDV A;  3W6V A;  4EVI A;  3U1D A;  2M30 A;  1DPR A;  2N8G A;  2MD5 A;  1B8I A;  2J5O A;  1SAN A;  2WC2 A;  1G3Y A;  5FLM J;  5J40 A;  4OWR B;  3HOY J;  4G94 A;  3BTJ A;  2GWR A;  1BM9 A;  1WJ5 A;  5CVJ A;  5ILS A;  4PSX A;  2FML A;  4A12 A;  2E71 A;  4G9Y A;  1W5T A;  3WTY C;  3FWE A;  3JRI A;  2K7L A;  3CP2 A;  4IZZ A;  2PEX A;  4BY7 J;  1TC3 C;  1NH3 A;  3VEP A;  2JSC A;  1FIP A;  3ECO A;  4LLL A;  1MNE A;  3K4J A;  1ULY A;  3BY6 A;  4BAC A;  1ZG5 A;  1GXP A;  3QWL A;  2IP2 A;  2VAS A;  3HSE A;  3ISP A;  3TL4 X;  3ABL H;  4YFX F;  3MZ8 A;  3O8H A;  5LBQ A;  5FB2 A;  2DAO A;  3ONQ A;  4M3E A;  4BEH A;  1FOY A;  1EH7 A;  4I76 A;  3DKX A;  3VDX A;  3A01 B;  1I39 A;  1DGW Y;  2OCC H;  1D0Z A;  5H6Q A;  1OFC X;  3K1M A;  1WJA A;  3JRH A;  3OYC A;  3VSK A;  5IOY A;  2E1M B;  3FXR A;  3PUB A;  2VUM J;  1WCM J;  4P9F A;  3E6M A;  3HKZ N;  4PGH A;  3IWF A;  4CSW A;  2FOK A;  4A3E J;  3BR6 A;  3P9K A;  4O3M A;  1R4N B;  5K5O A;  3BG5 A;  2DYS H;  4EV0 A;  4WK8 F;  2OA4 A;  4KIS A;  2FRH A;  2ZKZ A;  1B9M A;  2X6O A;  3LMM A;  3F8N A;  3RDI A;  4RGX A;  1TLH B;  1QVT A;  2AXT C;  4XN3 A;  4XQF A;  1X1C A;  1A6I A;  3BZK A;  1YJ9 I;  2I5U A;  3WTW C;  2B0L A;  2WA0 A;  1QO0 D;  2JJ7 A;  5HDN A;  3FF5 A;  3MKY B;  1I1S A;  2YUS A;  4UVA A;  1XSX A;  3EPZ A;  1WZ2 A;  1LEB A;  1OLT A;  3BR2 A;  3M8J A;  4IOC F;  1AWC A;  1DGR M;  3S2H J;  2DPU A;  2D5V A;  2L9V A;  3C2G A;  3HOU J;  1A04 A;  1P4A A;  2O9L A;  3M3Y J;  3DP7 A;  2DXI A;  3RI4 A;  2DJI A;  1GV2 A;  2R7W A;  3Q0U A;  2VXD A;  1GHC A;  4B44 A;  2XPV A;  5IYD J;  4RLF A;  5LGN A;  2V6C A;  2O8X A;  3KP4 A;  1WJF A;  4WCG A;  2A6E F;  3RPQ A;  1XMX A;  5GPC A;  1MSE C;  2MH9 A;  4DBQ A;  5FGM A;  2W85 A;  3UNG C;  4R79 A;  1N77 A;  2KRF A;  2JT1 A;  3RKW A;  1O7F A;  3PNY A;  2Z3Y A;  2FUG 2;  4L5I A;  4QLC U;  1U8R A;  1R7J A;  3C18 A;  2R4G A;  5EZG A;  2DOF A;  2DU9 A;  3WTZ A;  2XAF A;  2Y48 A;  3DBH B;  5D5U B;  4BGD A;  5CQG A;  5CVV A;  4AVZ A;  5F0H A;  1J09 A;  1XS9 A;  1V3F A;  4A2U A;  2DK5 A;  1RIO H;  3RZO J;  2VN2 A;  3GFI A;  2HS5 A;  1S7O A;  5AIQ A;  1VQ9 I;  1IAW A;  4FE4 A;  4ZDO A;  1QGP A;  4J00 A;  5A2Q K;  1FMV A;  1JUM A;  2CUE A;  3HPH A;  4OAY A;  4PJJ A;  2V9P A;  3WOD F;  2FX0 A;  4I01 A;  1LFB A;  1DPU A;  3O3K A;  2QQ9 A;  4WX9 A;  3HG9 A;  3WU1 B;  1VQ5 I;  1QVU A;  2QSG X;  2OAZ A;  1FBU A;  1RKW A;  1SAU A;  4IF4 A;  4ASN A;  2F5V A;  1R58 A;  4LK0 F;  4G8X A;  3GTJ J;  4CIC A;  1RR7 A;  1S9H A;  2WV1 A;  2ZXH A;  1K78 B;  4KDP A;  1Y0U A;  3F0C A;  5E8I A;  2H1K A;  2L9S A;  5EG0 B;  1B72 B;  3HRM A;  3JTG A;  1XC5 A;  2HFH A;  1K79 A;  2NVX J;  3FMQ A;  4I2O A;  2DBB A;  5H2F C;  3C2H A;  1VQM I;  3CCE I;  4NNJ A;  1JE8 A;  3DPL C;  2M1B A;  2UXN A;  1R5H A;  1HST A;  2IA1 A;  5EEG A;  4IHV A;  4LLG F;  2HTS A;  4V2F A;  2NYX A;  1VQ6 I;  1MKM A;  3BQZ A;  2E7W A;  3GCM A;  2H09 A;  3JRC A;  2IS6 A;  2H8W A;  4CYC B;  4KMF A;  2G7U A;  1APL C;  5DEQ A;  4CA0 A;  2M7A A;  1ZAR A;  3H35 A;  4F7Z A;  1IV8 A;  1T2K A;  4QSH A;  2XKP A;  3DCF A;  2CJJ A;  4BNC A;  3PUF A;  2A61 A;  4PK4 A;  3BR5 A;  2IGO A;  5KNL A;  1KU7 A;  2OPT A;  3I0T A;  2GQQ A;  3OSF A;  4U87 A;  5LGT A;  4GRI A;  2OD5 A;  2FNP A;  3OWT A;  2PJP A;  2JK3 A;  1V5G A;  4MFE A;  1U5T C;  4RDU A;  4V19 K;  1MND A;  4ON0 A;  2YU9 J;  1XX5 A;  2ZJR F;  4B09 A;  2HI3 A;  4E7S A;  1VQO I;  3VPR A;  1CF7 A;  1XSV A;  3H3V K;  1TWH J;  2MD0 A;  2VT2 A;  2WAQ N;  4HEA 2;  4YRV A;  5FD6 A;  1GXQ A;  1I5Z A;  2CW7 A;  2DDB A;  5IP9 J;  2W84 A;  3GTO J;  3KYL A;  1H8A C;  1SVO A;  4L0Z B;  2R7U A;  2B63 J;  3CQZ J;  4UVC A;  2DT5 A;  4ENJ A;  3WU2 C;  3J81 K;  2XAU A;  5FRM A;  3ESW B;  1P4W A;  1RUN A;  2VQL A;  5D5X B;  2XGX A;  4JBA A;  4X0G A;  1VQL I;  2E35 A;  2W00 A;  3TBI A;  3CD6 I;  3QRF F;  1MSF C;  1Y6I A;  2JSP A;  1YE9 A;  2ZCW A;  4JYK A;  2R7S A;  2IS4 A;  3ZGK A;  2EIL H;  3M1E A;  3OR2 C;  1Y39 A;  2F4M B;  3F6O A;  3BCA A;  2XV4 S;  3CDI A;  2F5D A;  1OR7 C;  1MMG A;  3F8B A;  3K70 D;  5JR3 A;  4A6D A;  2K27 A;  3F72 A;  4AUX A;  1R00 A;  1ZLJ A;  3C7J A;  5KAI C;  4LIU A;  1UB9 A;  3DQV C;  3F3X A;  2HOE A;  2Q2E B;  1X3W B;  3MWM A;  3QPL A;  2NS7 A;  1IDY A;  2R7F A;  4CCO A;  5JHF A;  4HLX A;  1GVJ A;  1VF9 A;  2IW5 A;  2PMZ A;  5E8G A;  1K78 A;  3DPT A;  2D2W A;  1T98 A;  3WU0 A;  1S3J A;  4UUT A;  2JA5 J;  3ZQI A;  2DOA A;  3KEQ A;  4HSR A;  2VOO A;  1R49 A;  1T6S A;  1XTA A;  2ZXJ A;  6PAX A;  3M8F A;  4OAZ A;  2VKE A;  3GFL A;  4R8H A;  2XAS A;  2Q1Z B;  4ZDL A;  2DA2 A;  1P4X A;  2NNY A;  3KEO A;  4RM2 A;  3RIR A;  5BQT A;  4AIK A;  1GLN A;  2WB1 N;  2R7Q A;  2KZG A;  3KX2 A;  4UUS A;  2H94 A;  2STW A;  4Q48 A;  2PLY A;  4QWQ A;  2JA6 J;  1T8I A;  1LE8 A;  4HAM A;  1R23 A;  3SHF A;  2GXA A;  1MBF A;  3TOB A;  1DP7 P;  2CQX A;  1ETO A;  2FE3 A;  2XB5 A;  2VXZ A;  2KP6 A;  1YIJ I;  1KU2 A;  3HGY A;  3I4N J;  2K86 A;  4F55 A;  3TGN A;  3QP6 A;  3I4P A;  2VBY A;  2DA3 A;  2ELK A;  2QZ8 A;  1OCC H;  2M8G X;  2Q8K A;  3GBG A;  1D5V A;  1D8K A;  3G1M A;  1WKM A;  3OL4 A;  1OCP A;  4I98 B;  4BHC A;  1PJR A;  4AYB N;  3HGG A;  3E3V A;  1TWG J;  4I09 A;  3E0J B;  2F6C A;  4UXN A;  3ZXS A;  4XKC A;  1U2W A;  2FF4 A;  1KU9 A;  4M3B A;  3ZMZ A;  3IUO A;  3V42 A;  3ZQ7 A;  4HNU A;  5FRO A;  1HKQ A;  2VBZ A;  3LST A;  3PSI A;  5K7F A;  4AD9 A;  3LSG A;  2IGK A;  3FKJ A;  4EJU A;  4B3X A;  3RKY A;  4OMY A;  1YS6 A;  2Y0M A;  3H5N A;  3I3L A;  4HF2 A;  3AKZ A;  3GZ6 A;  1R4M B;  2O61 A;  3NQO A;  5J6X A;  3LFU A;  3ABK H;  3S2D J;  2EK5 A;  3M7G A;  4ANJ A;  2FXA A;  3OS0 A;  3LAJ A;  4QPQ A;  1YRN A;  4CCN A;  3TED A;  3UR3 C;  1TW3 A;  2NVQ J;  4I0B A;  1PUF B;  2FNA A;  5GAD J;  3IL2 A;  4JX5 A;  3K69 A;  2DA6 A;  4BJ6 C;  1I6H J;  2Q2E A;  1XSD A;  1HW5 A;  2NVY J;  1R1U A;  1Y0N A;  3X2Q H;  3VYU B;  2LY2 A;  4E7J A;  4XRF A;  1IV6 A;  4E6K G;  5J4V A;  3BZ6 A;  1RRJ A;  4I0A A;  4FET A;  2UUZ A;  3BJ6 A;  5IP6 A;  5CJ9 A;  4XR6 A;  2LTP A;  2NRA C;  1X1B A;  5IT3 A;  3FHZ A;  4KA4 A;  2L3D A;  2RDP A;  2G0E A;  2YX4 A;  2QBY B;  2ACJ A;  4PUS A;  3U1K A;  2LYC A;  1JKR C;  4Y4R A;  3Q0W A;  3DFG A;  3HIF A;  1OMI A;  4PGG A;  4GDF A;  1BW5 A;  2Y9Y A;  4LG0 A;  2QEX I;  4QIW N;  4KT6 A;  3HRS A;  2P81 A;  2R5Y B;  2LY9 A;  2OTL I;  4BJ5 C;  3S14 J;  3OYD A;  1LDK B;  5ED4 A;  2CH0 A;  2XAQ A;  1YQA A;  4NC7 A;  3P5J A;  5IPA A;  2H27 A;  3I64 A;  1UG2 A;  4L9T A;  4XLE A;  3F23 A;  2KDZ A;  3WE2 A;  2J5P A;  1UST A;  3J7A O;  1B6A A;  2IGN A;  5DD4 A;  5DD8 A;  1JHF A;  4ZDP A;  1MMN A;  2K3P A;  2PN6 A;  2XGD A;  4ESJ A;  1EJ9 A;  5EGO A;  3AL0 B;  3PO3 J;  5IT9 K;  3V7C A;  4YIR X;  3JSO A;  4Y7N J;  2TRT A;  2JQ7 A;  3KCC A;  4OOI A;  1Z67 A;  4BKX A;  3A4C A;  3K4N A;  3PFI A;  5FKK A;  3PSF A;  1YIT I;  1W0T A;  3DBL B;  4GFB A;  2E5N A;  3AG1 H;  2H8R A;  4XIC A;  1FBS A;  2ME0 A;  4ZH4 F;  3KYD B;  1X4O A;  4N9I A;  3FZV A;  2NVU B;  3L2V A;  3S1Q J;  1IZ1 A;  4XSZ F;  2DN0 A;  1UHM A;  3H36 A;  1WVR A;  4LGW A;  4RLQ A;  4XNF A;  1XCV A;  4JP0 A;  3GTK J;  3EUK L;  3FXQ A;  1JKQ C;  3N05 A;  3MZY A;  4PFO A;  4HW0 A;  1HW1 A;  3BG6 A;  4HX8 A;  2DOD A;  2V6E A;  3GEZ A;  2DFH A;  3WHC A;  2R7O A;  4P1W A;  3D5R C;  4AM3 A;  4RGR A;  4P55 A;  1Z6T A;  3AAF A;  2ZME C;  2L4M A;  2RNG A;  2ZSI B;  3QPS A;  3L2R A;  3PNT A;  3U9G A;  3E6C C;  1JJ8 C;  3VWB A;  3CUQ C;  4ZJZ A;  3CJT B;  1MMA A;  3IAS 2;  3CCL I;  1R1T A;  2GAU A;  3E5U A;  1OJL A;  4CXF A;  2R92 J;  1SD5 A;  1ONV A;  3RSN A;  1MGT A;  3I56 I;  4BE0 A;  4GGG A;  1VQN I;  5EF6 A;  1ZRD A;  3TW7 A;  4UNO A;  2FQ3 A;  2ADU A;  2O03 A;  1S5L C;  2V1D A;  1LJ9 A;  4N4N B;  4GXO A;  2DPD A;  3SZP A;  1TNT A;  2Y69 H;  5IOZ A;  3LOC A;  1KQ0 A;  2MYS A;  1ZH5 A;  2HXI A;  1E3O C;  5FLX Z;  4JK1 X;  4WWC A;  5KHD A;  3Q9V A;  3F21 A;  4FCY A;  4AID A;  5TJJ A;  3V7R A;  1UAA A;  2M0C A;  4RS8 A;  1FOW A;  3SFI A;  2XIG A;  3KP3 A;  3ZMU A;  3A02 A;  2FJ1 A;  2EFQ A;  3DTK A;  4C3J J;  5EYR A;  2DA4 A;  5FKO A;  2OBP A;  2R5Y A;  2DDA A;  4LK1 F;  3A03 A;  4LB6 B;  5JLW A;  1MBE A;  3CTA A;  4B48 A;  3S3M A;  3DXJ F;  2HOS A;  1UFM A;  4CCJ A;  5L3G A;  1JTX A;  3GX4 X;  4XLP F;  5ICE A;  4E70 A;  1CGP A;  1HDD C;  4HF1 A;  3VOD A;  1LFU P;  1HC8 A;  3HC7 A;  1V54 H;  2LMD A;  3K70 C;  1BIB A;  1BR4 A;  2K9Q A;  3I59 A;  3M8E A;  4FE7 A;  2K9L A;  2OUM A;  4M74 A;  4OIN F;  5CKT A;  5ICG A;  1Z7L A;  5F64 A;  3JRF A;  3LNQ A;  1XMA A;  2A07 F;  3SEQ A;  1J75 A;  3HPG A;  2CQ7 A;  3OOP A;  3P9C A;  3QOP A;  1IGN A;  1IO2 A;  5DUK A;  4B47 A;  3TDZ C;  4E7H A;  4EJT A;  4XLN F;  5CVU A;  5A2Q Z;  2XRN A;  4M6Y A;  1MBK A;  2LBF A;  5HNH A;  4PJM A;  1RET A;  2KJB A;  2L5Q A;  1BI0 A;  2JWT A;  2K4J A;  2X48 A;  2A05 A;  2WWY A;  1S6L A;  4L18 B;  2OU2 A;  2BGC A;  1BIA A;  1NG7 A;  3QPH A;  4M6V A;  4LMY A;  4XLA A;  3WTX C;  3CMY A;  3LSI A;  1DUX C;  1M1E B;  4XKV A;  3S2W A;  2LF8 A;  1VI0 A;  3R0J A;  1WQ2 A;  4XN0 A;  3WGH A;  1R6R A;  5BS6 A;  2TCT A;  2JMW A;  4HDU A;  4RAF A;  2X6Y A;  2BY1 A;  2LK2 A;  4C2T A;  5JHU A;  3WTT C;  3GTM J;  3L2U A;  1IC8 A;  2ID3 A;  3FDY A;  3CO7 C;  1GV5 A;  4N0B A;  5H6R A;  3HBL A;  2P6T A;  4IQ4 A;  2EB7 A;  2EIJ H;  4OIP F;  2WTE A;  4CZC A;  2OTJ I;  5DM7 F;  1KQ9 A;  4V2G A;  1BC8 C;  3KEY A;  1YG2 A;  4BYY A;  1FJL A;  2X6X A;  4M9S A;  2NXN B;  4IX7 A;  1WPK A;  2E1N A;  3BR1 A;  2MW8 A;  4HV6 A;  3S3O A;  4LLN A;  4BQQ A;  2XRL A;  2KIF A;  2MFZ A;  4MLO A;  2MC4 A;  3TDU C;  5AON A;  4XID A;  2VON A;  5FJ8 J;  2LRD A;  1P7I A;  3WE3 A;  3I5U A;  5F04 A;  3BDD A;  2ZME B;  3NEU A;  1T08 B;  1F4K A;  2PX9 A;  3LSP A;  2KLO A;  4KFC A;  3DF8 A;  2HYG D;  2LRE A;  3W6K B;  1A6Q A;  3BPX A;  4LD5 A;  4IO9 F;  1ZRE A;  4ESB A;  2W7N A;  3K0L A;  3K4C A;  4IEJ A;  3TQN A;  2HQA A;  3CO6 C;  3REO A;  3DTE A;  5DV5 A;  1HKS A;  3ZQH A;  1UHW A;  3GVA A;  4D5F A;  2DO7 A;  2R93 J;  1IN4 A;  3MZH A;  3L00 A;  1BOB A;  2LD5 A;  5FKL A;  2QQA A;  1Y56 A;  3G1O A;  2CGP A;  3J81 Z;  3S1M J;  2ZNZ A;  2RKH A;  2QF7 A;  1UG0 A;  5KK1 A;  3VYS B;  2PMZ N;  4XRS A;  5ILU A;  3GLL A;  2NOJ B;  1QPI A;  3JAM K;  3QAH A;  3HZJ A;  1TZL A;  2EWN A;  4PZJ A;  4B1R A;  3KIO A;  3R61 A;  2KHM A;  1JXS A;  3HUG B;  3FK6 A;  4BL0 B;  2O5R A;  5CLS A;  4CO8 A;  1K83 J;  1KYW A;  3HHH A;  2W48 A;  4KT5 C;  2ZJ2 A;  2VOP A;  3HTU A;  4LIT A;  1MMD A;  4ZZD A;  1T56 A;  2BW3 A;  1IN7 A;  3L2C A;  2W82 A;  3V8L A;  1GT0 C;  2AO9 A;  4XOR A;  2E36 A;  1H88 C;  4DYQ A;  5LHH A;  2CU7 A;  2CV0 A;  1IUF A;  1YX3 A;  1AKH B;  1WFX A;  1XGN A;  3CLQ A;  1NHA A;  2LNB A;  3CJR B;  3DTI A;  2IA0 A;  4ITV A;  2A68 F;  3S3N A;  3A2K A;  3BJO A;  3EQL F;  4A6E A;  2CUZ A;  3JRB A;  2OQG A;  1YFH A;  1ZKG A;  3I58 A;  3HOX J;  2M2E A;  2R0Q C;  4C2U A;  4BE2 A;  3KP6 A;  1ETY A;  1C0W A;  4DQ2 A;  3SZG A;  3BP8 A;  4MQ9 F;  1HA8 A;  1IF1 A;  4KN4 X;  5TGT A;  3BOQ A;  4A3C J;  2CUF A;  1G3T A;  3KFW X;  3H3U A;  3PJR A;  4A5N A;  4D5C A;  5HLH A;  9ANT A;  4ESF A;  1T38 A;  2A5Y B;  4ZYH A;  3ZQC A;  5C4X J;  4YG2 F;  2HQR A;  3KP2 A;  5M3M J;  1W5C C;  2MA3 A;  4HF0 A;  2VPL A;  3W6J B;  1XCB A;  2PMU A;  3BTI A;  2LDU A;  2GOM A;  3WG7 H;  3M07 A;  1LKX A;  2FBK A;  1W4M A; 
#chains in the Genus database with same CATH homology
 2PMZ A;  3DPT A;  1WJC A;  1X4P A;  2VQH A;  3AFH A;  1T0F C;  2QKL B;  2WAQ A;  2DOA A;  2Z2S B;  4HSR A;  4BUP A;  3OYM A;  2HPM A;  3DPU A;  4CCM A;  5HOO A;  1VZ0 A;  4OAZ A;  2XF7 A;  2Q1Z B;  4ZDL A;  2RRE A;  4RM2 A;  1ZEL A;  2X85 A;  2XF6 A;  3OYN A;  1GLN A;  3OYJ A;  3OYL A;  3HXL A;  3CZ6 A;  2R7Q A;  2ZSH B;  3KX2 A;  1LFP A;  5HVQ C;  2M0M A;  2LBF B;  1WJE A;  3FHN A;  4CCK A;  3HL2 A;  4RMN A;  2IGM A;  4XM3 A;  2XSJ C;  4LIV A;  3OMY A;  3W3C A;  2VIX A;  2JVG A;  2CW8 A;  2LY1 A;  4PJL A;  3DEE A;  2DCE A;  4J01 A;  2BOL A;  2VXZ A;  2KRH A;  2KP6 A;  4E7Z A;  1QU3 A;  3U21 A;  2HVR A;  4F55 A;  3D5L A;  4CUG A;  3GBG A;  4C9Y A;  2VLA A;  3OL4 A;  1PJR A;  4E4H A;  2VJI A;  1N78 A;  2K5C A;  3MMY B;  5KCM A;  3E0J B;  2F6C A;  2CV2 A;  4E7I A;  3ZXS A;  4XKC A;  4II3 A;  3S32 A;  3IUO A;  4H4K C;  1YX5 A;  2K9M A;  3V42 A;  3W2A A;  3OIP A;  4HNU A;  4YEJ A;  1QHG A;  5FRO A;  4G6T B;  3W2W A;  3CMM A;  2KL4 A;  2XF5 A;  2V4J C;  4XKW A;  4RM3 A;  3PSI A;  1DQU A;  3DWL E;  4YEL A;  4BS9 A;  3LSG A;  2IGK A;  3FKJ A;  4B3X A;  2R7V A;  1W36 C;  1Z3Y A;  3I3L A;  3H5N A;  2AQE A;  3AKZ A;  2XC7 A;  3LFU A;  3OYE A;  4JQF A;  4EAT A;  2RQQ A;  2Z16 A;  4ANJ A;  3OS0 A;  4QPQ A;  1D0Y A;  3MD2 A;  2WB1 A;  3S8P A;  4QPO A;  3OS1 A;  3QYE A;  4CCN A;  3A1Y A;  3UR3 C;  2WY8 Q;  4XKB A;  4IQJ A;  3NWS A;  3BC8 A;  3H0D A;  4IKF A;  3K4K A;  5CPR B;  3EUA A;  1W36 D;  2W4S A;  1U0J A;  4BJ6 C;  3W2V A;  4Y3O A;  2HDW A;  4F91 B;  1D1C A;  4F93 B;  1E0E A;  3OYK A;  4XLC A;  3IAM 2;  3L2Q A;  3SDB A;  3RCO A;  3VYU B;  2LY2 A;  4E7J A;  3I9V 2;  4N4O B;  4BQO A;  2VQG A;  4E6K G;  2UV1 A;  4HPQ A;  4FET A;  2UUZ A;  4D9J A;  4XR6 A;  3DU5 A;  2VKD A;  3RPU D;  4D1Q A;  2M3A A;  1X1B A;  2ZXI A;  3ZQQ A;  2BVL A;  4PUS A;  2OC6 A;  2LYC A;  4HG2 A;  4Y4R A;  4AYB A;  3BLY A;  4HRI A;  3CP8 A;  2R7X A;  4XL9 A;  2HU9 A;  3IP4 B;  3OYB A;  2IXS A;  5CQE A;  3VYT B;  4KT6 A;  2L7K A;  1NG6 A;  4BJT A;  2X1D A;  2HVQ A;  4BJ5 C;  3OYD A;  2LC2 A;  2R7T A;  1LDK B;  2CH0 A;  4NC7 A;  4DIQ A;  1IRX A;  3H9Q A;  4XLE A;  2KZV A;  3K4M A;  3OYF A;  2BW3 B;  2IGN A;  3H9G A;  3K4L A;  4ZDP A;  3VSL A;  1MMN A;  2K3P A;  1T95 A;  4FAS D;  1N75 A;  3AL0 B;  1LVK A;  4U7B A;  4NUB A;  2V9K A;  2JUG A;  3F9K A;  2HPI A;  3ZCO A;  3A4C A;  3K4N A;  3PSF A;  1G59 A;  2XDV A;  2E5N A;  4PFP A;  3K4B A;  1UEL B;  1X4O A;  4XMY A;  1QHH D;  2JVH A;  2E60 A;  3L2V A;  4C30 A;  4LG3 A;  4OWR B;  2V26 A;  4KIT B;  2MAB A;  4RLQ A;  4XNF A;  3EUK L;  1WJ5 A;  3N05 A;  4PFO A;  4PSX A;  2LOO A;  3BG6 A;  2V6E A;  3CP2 A;  2V1N A;  4IZZ A;  2R7O A;  4P1W A;  3D5R C;  4BXF A;  4JOM A;  1WJD A;  2ZSI B;  2RNG A;  1MNE A;  3K4J A;  4BAC A;  3L2R A;  3PNT A;  4XOP A;  3RQ4 A;  2F4I A;  2VAS A;  3VWB A;  2LG4 A;  3TL4 X;  4HNT A;  4ZJZ A;  5JHF A;  1MMA A;  3IAS 2;  2L2O A;  3ONQ A;  4BEH A;  3FBI B;  3RSN A;  4DGW B;  1BR2 A;  3S93 A;  3DKX A;  3VDX A;  2QKM B;  1DGW Y;  1D0Z A;  4BE0 A;  2OV7 A;  1WJA A;  3OYC A;  1MW7 A;  3VSK A;  2E1M B;  3PUB A;  3OYG A;  4N4N B;  2WAF A;  1D1B A;  4CSW A;  3BCB A;  4NQW B;  4B43 A;  1X19 A;  2MYS A;  4II2 A;  3LSK A;  4E7L A;  4KIS A;  4ZC3 A;  4BDZ A;  4XLF A;  3LSH A;  5KHD A;  2DT6 A;  3LMM A;  4KJZ A;  4XN3 A;  4XQF A;  1X1C A;  2WA0 A;  2HNH A;  3HOS A;  1UAA A;  2M7B A;  3MKY B;  1KON A;  1P9Q C;  2KQR A;  4ZYA A;  3EPZ A;  2KMU A;  1OLT A;  3M8J A;  3DTK A;  2HVS A;  2L9N A;  1DGR M;  3TMO A;  4E7K A;  3C2G A;  2R7R A;  3G2B A;  4B48 A;  1FMW A;  3S3M A;  2M4K A;  2I8D A;  3OIQ A;  4CCJ A;  4BDY A;  2DXI A;  3DLA A;  2VL8 A;  3LSM A;  2DJI A;  2R7W A;  2VXD A;  4B44 A;  1X1D A;  3HC7 A;  2E5Z A;  4RLF A;  4F92 B;  3K70 C;  1BR4 A;  1WJF A;  4F3Q A;  2K9L A;  2OUM A;  5LFA A;  5CKT A;  1Z7L A;  1D1A A;  3SEQ A;  3HPG A;  1WJB A;  3K6G A;  4DBQ A;  1N77 A;  3UNG C;  4R79 A;  4B47 A;  1V5E A;  2ELJ A;  4E7H A;  2X1C A;  4DJA A;  3SEZ A;  2LBF A;  5HNH A;  4PJM A;  3PNY A;  2L5Q A;  2FUG 2;  2R4G A;  3QYB A;  5HNF A;  4ZTJ A;  3HKZ A;  3L2W A;  4ZTF A;  2W1O A;  2WAE A;  1NG7 A;  4BGD A;  5CQG A;  4AVZ A;  1J09 A;  1EA3 A;  4XLA A;  2CMP A;  3E1S A;  3RTR A;  4F52 A;  3LSI A;  5HLT A;  2ZFU A;  1TT0 A;  2VJJ A;  4XKV A;  2X6W A;  4ZDO A;  2V7F A;  4XN0 A;  4J00 A;  2VQC A;  1FMV A;  4XOT A;  1R6R A;  1PYV A;  2JA2 A;  3HPH A;  4OAY A;  4PJJ A;  3QOE A;  2X6Y A;  4C2T A;  3AL0 C;  2CFO A;  4HST A;  3L2U A;  3EUH C;  3FDY A;  3PNV A;  2PJR B;  4IQ4 A;  3HG9 A;  2M4G A;  3CJQ B;  4CZC A;  3OYH A;  1SAU A;  2X1E A;  2CS3 A;  4PSW A;  2F5V A;  2WBM A;  3KEY A;  3NWT A;  2WAD A;  2X6X A;  4IX7 A;  1SFK A;  1Z3X A;  2HZD A;  1S9H A;  2P0W A;  2ZXH A;  3S3O A;  3OOU A;  4BQQ A;  2L9S A;  4BE1 A;  3DKY A;  2MFZ A;  4MLO A;  2MC4 A;  2VJ4 A;  4P5O A;  2GOX B;  1Z21 A;  3BG7 A;  2LRD A;  3MKZ A;  3QOD A;  4CH7 A;  3C2H A;  4CCL A;  4NNJ A;  1DP3 A;  3DPL C;  3CF2 A;  4NC8 A;  2KLO A;  3PFY A;  3HOT A;  2VJ5 A;  2IS6 A;  2LRE A;  2Y0S A;  4CA0 A;  3QYF A;  3VYR B;  2W7N A;  2M7A A;  3H35 A;  3M1C A;  3K4C A;  4BQN A;  2KDO A;  1ERD A;  3H9J A;  4DOZ A;  2KRC A;  2HQA A;  4PK4 A;  3FBN B;  3DTE A;  2IGO A;  5KNL A;  3OY9 A;  2IS2 A;  1BOB A;  4U87 A;  3OR1 C;  4GRI A;  2E1M C;  1Y56 A;  3OWT A;  5LD2 C;  1V5G A;  3ZR8 X;  2A5W A;  1G8X A;  1BR1 A;  1UG0 A;  1MND A;  3VYS B;  4XLH A;  2DT7 B;  2VKH A;  3OYI A;  3H5R A;  3MKW B;  4E7S A;  3OS2 A;  2NOJ B;  1TZL A;  4DBR A;  2MD0 A;  3DU6 A;  1D0X A;  4HEA 2;  4YRV A;  3OYA A;  3PL8 A;  2LH9 A;  2CW7 A;  3D5S C;  4AU7 A;  1AA7 A;  2BVM A;  2KHM A;  3KYL A;  3HUG B;  4BL0 B;  2O5R A;  3ZRG A;  3K10 A;  3CES A;  2R7U A;  3LL7 A;  4LIT A;  4BEH B;  5FRN A;  1MMD A;  2XAU A;  5FRM A;  2BW3 A;  2X51 A;  2VQL A;  4BU2 A;  4X0G A;  2W82 A;  2W00 A;  1K6Y A;  3TBI A;  4XOR A;  2CV1 A;  2CV0 A;  1YX3 A;  2AQF A;  1WFX A;  1Y6I A;  1YE9 A;  2JSP A;  2R7S A;  2IS4 A;  3CJR B;  3DTI A;  3ZGK A;  3J7A Y;  3OR2 C;  4ITV A;  3S3N A;  2A6T A;  4PJN A;  4XON A;  3A2K A;  2CUZ A;  3H5A A;  3BCA A;  2IS1 A;  4C2U A;  4BE2 A;  1V5F A;  1OR7 C;  2UWM A;  1MMG A;  3SZG A;  3K70 D;  2PJR A;  1HA8 A;  5TGT A;  2WY7 Q;  2Z1D A;  3PJR A;  2CUJ A;  2VB6 A;  2KPM A;  4LIU A;  3DQV C;  1X1A A;  2Q2E B;  2VPL A;  1JI8 A;  3SYT A;  2GOM A;  4Y33 A;  1LKX A;  4CCO A;  3OL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...