2E5ZA

Solution structure of the surp2 domain in splicing factor, arginine/serine-rich 8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
GSSGSSGTSALAPVAAIIPPPPDVQPVIDKLAEYVARNGLKFETSVRAKNDQRFEFLQPWHQYNAYYEFKKQFFLQKEGGDSMQAVSAPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Splicing factor, arginine/serine-rich 8
publication title Solution structure of the surp2 domain in splicing factor, arginine/serine-rich 8
rcsb
source organism Homo sapiens
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01805 Surp Surp module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e5zA01
2DT7B 1X4PA 1X4OA 1UG0A 2E60A 2E5ZA 4DGWB 2DT6A
chains in the Genus database with same CATH superfamily
1TNTA 2KIMA 2HPIA 1XPXA 3A0HC 3BQZA 1V4RA 4E7ZA 3RPUD 1HA8A 5ILUA 3P7NA 2ELKA 4RGRA 2XAGA 1GDTA 3ZMUA 3OYEA 3QPHA 2AO9A 3HL2A 4JK1X 1M1EB 1Z05A 3WTZA 2DMUA 3C2BA 1MJAA 1BI1A 2KLOA 1R71A 3RPQA 2D2WA 1RPWA 3RPUA 2RNGA 2A05A 4B44A 1NK3P 1HF0A 1SD7A 1JKPC 2L5QA 4DW6A 3HXLA 2IW5A 1YX5A 2Z1DA 4M73A 3F22A 3JRBA 1NHAA 2QKLB 2E71A 1S29A 2NYXA 3QODA 2P8TA 5EZHA 2NVYJ 3CUOA 2X6XA 2DO7A 2RN7A 5BNGA 2ISYA 5E8GA 2EZIA 3H3ZA 3ABUA 3VODA 4BQNA 4M71A 5GAGJ 5IYBJ 2EFOA 2M8EA 1YLFA 1BW6A 2NVUB 1ZR2A 1A6IA 4OMYA 4QLCU 1JGSA 1IN5A 1G2HA 1JJ6C 2LTPA 2Y69H 2VIXA 1S6LA 4BQAA 3WTYC 2LG4A 3LA2A 1XDSA 5IPAA 1X3ZB 1YJNI 4KMUX 2IJLA 1D5VA 1F9NA 3TP0A 1SD4A 2O03A 2XKPA 1WCMJ 3PM1A 2KRHA 4PJNA 2JT1A 3DU5A 1YW8A 4IXAA 1MNDA 4XKWA 3QPLA 2XASA 3GF2A 4OOIA 5H6RA 4E7IA 2IS6A 1MBEA 2X6WA 1B8IA 1AA7A 3DLAA 5FFXA 3NWSA 3ZQIA 3S16J 2DQLA 5L3DA 2JA2A 2L54A 5IP7J 3DTKA 3T8TA 5HS8A 1YW9A 3G1MA 3U9GA 1ZRFA 4EJWA 3BG6A 4BXFA 3GCMA 4IJAA 4XL9A 3K10A 3K1NA 5D8LB 4EJOA 4S05A 2VODA 2UUZA 4E70A 2VT3A 1J7KA 4I09A 1U0JA 2AQFA 3BLYA 1Q1VA 3F8CA 3O3KA 3RKQA 2ESNA 1DDNA 4N4OB 4BYYA 2LNBA 4KT5C 1IG7A 4GDFA 2HWVA 1WKMA 2L9NA 4RMNA 3ZRGA 2XPVA 1GUUA 3BR5A 2ZFUA 1T0FC 4DNCA 5F0CA 2DYSH 4BE2A 4ESBA 3B73A 2M9HA 2CUZA 1ZHFA 2V1UA 3CO6C 3HRTA 2HQNA 1Y8QB 4EV0A 3ABTA 3LSIA 4UNOA 1I39A 4LG0A 4A69C 3MZ8A 4L5JA 3KYCB 5JHUA 2M30A 5C4XJ 4B3XA 3GTMJ 1G3WA 1X1AA 2H6CA 3ECOA 4IL6C 2Y31A 2K9MA 3LNQA 4Q5SF 1OFCX 4E7KA 3T0YA 4A5MA 3OYNA 4ETSA 3E5UA 1RNLA 3QOPA 3BJAA 3IRRA 1HSTA 4C9YA 3G1LA 3NRVA 3RZOJ 1ETXA 3CCJI 2OZUA 1YI2I 1XC5A 2OU2A 2VQCA 1OR7A 1LEAA 3H5RA 4HQMA 2NOGA 2YX4A 1OCPA 1HW5A 3TL4X 2CW8A 4MFEA 4DIQA 4Y52J 2EFNA 1FYMA 3BZCA 3Q5FA 3QU3A 5DCMB 3M4OJ 4BQQA 5BMZA 1WGXA 1BBYA 1LDJA 3TP3A 2OV7A 2QYOA 4NBQA 5L3CA 3ASOH 1U8RA 1N77A 5E17F 3F8BA 2XAJA 2EV6A 2VXZA 4OMZA 1RKTA 2H8WA 1VF9A 1ETQA 4G6TB 3R6SA 3MD2A 1X1CA 3BP8A 4KIGA 4F3QA 1QA6A 2P7VB 3L09A 4QPQA 1TBXA 2VOPA 4F93B 3K4MA 4F55A 4WXHA 3AG3H 1KQ9A 5K5RA 2P7CB 1ZN2A 3R4KA 1Y0NA 3ZQHA 5HDKA 3H35A 4UY8I 1FEXA 1U78A 2LDUA 4F92B 3IL2A 1AKHB 5D5VB 2BEOA 3L9FA 2VJ4A 2K5CA 5FLMJ 3OYAA 2PMUA 3FXLA 4M9SA 2PQ8A 1X1DA 1QZZA 2W7NA 2E7XA 4O6JA 3IV5A 4X1EA 3ZN0A 5CKTA 3FF5A 3U2RA 5DS9A 1E3HA 2WB1N 4B8XA 3RYPA 4E7LA 3B6CA 2DA4A 3LAPA 4LK1F 1XGNA 2F4MB 2DW4A 2ELJA 5JVTA 4B43A 2W24A 3K7AJ 2M8GX 5HS7A 2UWMA 2FNAA 2BHYA 2O3FA 1D8KA 2FSWA 3CDLA 3DKXA 5CYVA 3EYIA 1ZAOA 4IHYA 1ZR4A 1X1BA 3RKWA 4YIFA 2EWNA 3SXYA 2XGEA 2KDZA 3H1CA 2QBYA 1DQUA 3IC7A 3QQAA 4UV8A 2LY2A 1G3TA 1W5TA 2WY7Q 4Y33A 1A36A 2L3DA 4HG2A 2LBFA 3PL8A 2F5FA 4KFCA 3S8PA 4G7OF 1LEBA 4EM0B 1WSUA 1T6SA 5L3GA 1D0YA 4QTRA 2Y0SA 2KZVA 4D9JA 1KA8A 3I59A 4QPOA 1B59A 5LRSA 3GTGJ 1BR4A 2LFBA 3U1KA 2D5VA 2ETHA 2BY2A 1PVEA 3HGYA 5DD4A 5HLGA 1F4KA 1QHGA 4UUSA 5EGOB 2EV5A 4HZFA 4EVIA 1FYLA 1BI0A 1DGRM 1FNNA 2VT2A 4XRMA 3BG9A 3KCCA 1BIBA 3C7JA 2HS5A 3M8JA 2M1BA 4XORA 4FCYA 2DT5A 2IGMA 3E5QA 4CCJA 2WB1A 5IP9J 1TQPA 3DPLC 2IXSA 4KITB 1FX7A 4LOCA 2ELHA 2V6EA 1DPRA 2MC3A 1WJFA 3QRFF 1MJBA 3D5SC 2XDVA 4BJTA 2HDCA 3M7GA 5J4YA 1LKXA 3MKWB 2ZJRF 2KIFA 1FOXA 4EM2A 5H6QA 3HPGA 3R60A 2GWRA 1Z6RA 4YIRX 2JTVA 3DXJF 1YG2A 2VC1A 5F64A 2CFXA 4LD5A 4V2FA 4CZCA 1OCCH 4A3EJ 1S7OA 4ENMA 1XB4A 4HDUA 2VUMJ 1D3YA 1R5ID 3DF8A 2ZSIB 3DPTA 3I64A 1MMAA 1YW7A 3GWZA 3GFLA 4FE4A 4E6KG 3VB2A 1LDDA 2G9WA 2Y75A 4G9YA 2ZMEB 2ZCWA 5D6EA 4LB5A 1ZRDA 4HBLA 2L9VA 3HUGB 2WV1A 2DA5A 4UVAA 2WWYA 3IH4A 5LLQA 2QSFX 1Z1DA 2XVCA 2V1NA 4AIDA 1S8NA 5J40A 3DCFA 1RKWA 3H0GJ 2DT6A 4PK4A 4NUBA 2Q0OA 3RSNA 1XGOA 2GXGA 3JR9A 1JT6A 2WAQN 4J19A 3N4MA 4UXNA 1DU6A 3K70D 1VTNC 4IHTA 3KEYA 1MNMC 4KDPA 5M5XJ 3F72A 4DZPA 3HRUA 3ZMTA 4OIRF 1MMNA 3RQ4A 1WWXA 3F8NA 4XLCA 5IT9K 2B9SA 5J1UA 3LQQA 4V2GA 3GBGA 2XGXA 3BPXA 4YFKF 2EPFA 5CLSA 2PN6A 3CJNA 5FROA 3DEEA 4BH9A 2R93J 1VQ6I 3DWLE 2ME6A 2IA0A 3HSFA 3GTQJ 3L2UA 1RRJA 4RAFA 1SD5A 2CH0A 4I2OA 1XDUA 2DQRA 4Q48A 2BW3B 2OCCH 3PIPF 5IT9Z 2VB6A 2PJRB 3CF5F 3W6VA 2Q2EA 4BS9A 1SVMA 1Z91A 2K02A 4E7JA 5EG0B 2VKHA 1XS9A 1IUYA 4HNVA 5CVUA 3HOZJ 3BJOA 4PGHA 1WI3A 2QGUA 3DLLF 4DYQA 1TWFJ 3HZJA 3ZGKA 5FO5A 2DYRH 2F5EA 1UMQA 1TW2A 1R4NB 3PQKA 4CICA 4HX7A 5B3SH 3DBLB 1U6GA 1HKQA 3S1NJ 2RQPA 1WJAA 4DBRA 2XAQA 2Z2SB 1BJAA 2VXDA 3HOUJ 4U88A 4I0AA 1TT0A 2CG4A 1WHUA 2R7OA 4G6DA 1P4AA 3J80K 3LA7A 1WH5A 1K4TA 2EFQA 4HLXA 2M3AA 4XICA 1Z67A 2EILH 1KONA 2IA2A 1QVTA 2DK8A 1DGWY 2E1MB 4HA8A 1T38A 3BC8A 3TEDA 2DTZA 1U5TC 1B9MA 4G6QA 1XGSA 2PMZA 1LPQA 1E2XA 1I5ZA 3OR1C 1JUSA 3WTSC 4MQ9F 4RBOA 3JSOA 3ECHA 3L7WA 2H1KA 4M74A 4MEXF 5KNLA 3J80Z 3T5XA 3G2BA 4HV6A 2LH9A 1S9HA 3HEFA 4A3CJ 3U21A 4Z6YA 4U0VA 4CH7A 4XIDA 2DPDA 2FJ1A 3WE2A 1JGGA 1O7FA 2HYFA 3BG7A 1X4PA 1K79A 3JRHA 3FZVA 1FOWA 1YE9A 2W48A 2XB0X 1E17A 2XGDA 3H5NA 5TJJA 4XLNF 2QQAA 3TW7A 3AL0C 3AG4H 4Y7NJ 3CUQA 2HFHA 2HDDA 1SFEA 3TDUC 3S1QJ 2V9VA 3FK6A 4II3A 3RI4A 1X1PA 2YR2A 4HYEA 3W2AA 1D1CA 1WQ2A 2ZJQF 5LHIA 2EH3A 3G3ZA 2DK5A 3BR6A 4YG2F 1KU2A 1QNTA 4IQJA 4LLNA 4CGZA 2JUCA 1R23A 2XV4S 3GFMA 3A2KA 3S93A 5DUIA 2KZGA 2DCEA 3KETA 4ZDPA 3H3UA 1B8IB 3ONQA 2A6HF 3ZQLA 2HXIA 4P5OA 2EIJH 3E0JB 5GP9A 2R5ZA 2KRFA 4BEHA 4C3IJ 5IT3A 3C1DA 1OR7C 3S15J 3JSPA 1HC8A 1ZARA 2FBHA 3LFKA 2DMTA 1I6XA 4HQEA 1BOAA 2YPRA 1T56A 5CVJA 4B09A 1LFPA 1SANA 4JX4A 2BBYA 1ZYRF 2HTSA 2NS7A 2R0QC 2A68F 3HRSA 1BN5A 3WU2C 1MH4A 2MLGA 2WC2A 2HTJA 1G59A 3L2VA 1LE8A 3Q0VA 3EPZA 3WGHA 4UUVA 1MJ9A 1T33A 4A3JJ 5D5WB 3IH2A 1BJZA 2KISA 2JA7J 3KP3A 1XG1A 4AYBN 4BHCA 5EF6A 2VBYA 1F1ZA 3AL0B 4M9ZA 2MGQA 3K9TA 2HPMA 4LG0B 5CVRA 1PJRA 4LG3A 3IKTA 2PX9A 2R92J 1MMDA 2LLKA 1OCZH 1J59A 1QPMA 2LYCA 5GTIC 4I76A 3OIOA 1XCBA 1ETKA 5F6FA 2IS4A 4MTEA 5M5WJ 3CCUI 5ICGA 1E3OC 4HAMA 4ZZDA 3D0SA 3TOAA 2R7RA 5K7FA 3EDPA 1YJWI 1O4XA 1FTZA 2DMNA 1YQAA 4BDZA 5BPIA 1JHFA 1K7AA 5HLHA 3LSRA 1CQTA 2AXLA 4DYCA 2R7TA 1BOBA 2MBFA 4BY7J 1T8IA 3OS0A 4ZYEA 3FHZA 1FSHA 1FP1D 1LQ1A 2JMWA 1J2XA 1IXRC 2BYVE 2JUGA 4N9IA 2DMPA 2IGOA 4CCLA 3RKYA 4U7BA 1BC8C 1I1SA 2DN0A 4BGDA 3FIWA 1D5YA 1R1VA 2X1CA 2XHKA 1L3LA 4Z2YA 1MNEA 3Q0UA 3DTEA 3B02A 4I7HA 2P0WA 2IPQX 5DD8A 2I10A 3JREA 2HNHA 2J5PA 3J81K 5C4JJ 2E7WA 3TGNA 2E1OA 3F21A 2HYJA 3RTRA 5F1JA 1P4XA 2FBKA 2CQNA 3MAJA 1EH8A 1FPQA 3S2DJ 2DOAA 4Q4ZF 1R58A 5F04A 3CMEI 5H20A 1MGTA 1SVLA 1FBSA 1EH6A 2X51A 1USTA 3RJPA 1JTXA 5ICFA 3H9GA 1VQ8I 4EJTA 1MD0A 5E3NA 2JA5J 5HODA 4XLPF 3E7LA 3FKJA 4WX9A 3WU1B 1LVAA 4IX7A 4BE0A 2X9DA 1ZK8A 3BR0A 1W36C 3R61A 3J81Z 2JN6A 4ZJZA 3GMEA 1WRJA 2KFDA 2RC4A 3KYDB 4JQFA 4L5EA 4NC8A 4XOTA 3CF2A 4F7ZA 3K4BA 2W1OA 2E35A 3BTJA 4LITA 1POGA 1YOVB 3GTLJ 5GAEJ 1TZLA 1T2KA 2AQEA 5HDGA 1Z7LA 2QBYB 1I3QJ 4LFUA 2DFFA 1ZG5A 1LUJB 3OYIA 4A93J 1RETA 3JW4A 2Z16A 2XRNA 3G1OA 2HQRA 5B5EC 2LBFB 2DA6A 4LIVA 4XNFA 4B4CA 3BROA 4MHGA 2UZKA 1XMAA 3IH3A 4GGGA 3I59B 1IGNA 4OIQF 3CMMA 1GVJA 2IBDA 5DYMA 1X3WB 2RV8A 3WHBA 4UUSB 3ESWB 3PUBA 3N97A 2X6OA 1PP7U 4P9FA 2Y48A 2Z99A 2CQ7A 3NEUA 3HOXJ 3DFGA 1Z7UA 2XPUA 5LHGA 3BCBA 1QQIA 1Y0UA 2CQXA 2HU9A 3U1DA 4IHVA 5K7HA 6PAXA 3OIPA 1G3SA 2WA0A 4A0XA 2EA4A 1MBKA 3GZ5A 2M5WA 5K7ZA 1RR7A 3GTJJ 2OQGA 2OA4A 2FEZA 1HBXG 4A0ZA 1JJ8C 4AWXB 5DUKA 3WTVC 2KT0A 3F8FA 4BUPA 4ZZLA 4XKVA 1GVDA 3IAS2 5CVVA 1WVRA 2DT7B 3VWBA 3CD6I 3QAHA 2VLAA 4BJ5C 4A3FJ 2GOXB 3OS1A 4XRSA 2GXBA 2R7QA 3KP6A 3L2RA 5ICCA 2IVMA 1HCRA 1HLVA 1ON2A 3A01A 1FBUA 1R22A 1X3UA 3S1RJ 3B6AA 1OLTA 4MEYF 3JRDA 4M3DA 4L0YB 3CESA 3PJRA 3I9V2 2K9LA 1W7PD 2QUFA 3O8GA 3I58A 3PO2J 1MMSA 1MSEC 3CMYA 1WFXA 2QVOA 1T08B 3ZQQA 3HB9A 1FC3A 3H3VK 1ZGAA 3M1CA 5GADJ 3M3YJ 3MEXA 3W6JB 1YIOA 1TL8A 3HPHA 3E5XA 1X2MA 1Y6IA 3AG2H 1W7PA 2VE9A 3SZTA 1FWZA 2CFOA 2A69F 3W3CA 3FHNA 4AVZA 2IAIA 2AS5F 2EK5A 1N75A 4GXOA 1PP8F 2FF4A 4WWCA 5IYDJ 1EF4A 2DFHA 3H92A 2O8KA 1MZBA 3ELKA 3CJRB 2NS0A 3GFIA 3OMYA 2NRAC 1X58A 2W82A 4Y17A 4IOAF 2QCOA 4G12A 3OSFA 2WADA 1E0EA 2HDWA 2QEXI 5F0FA 1TQMA 2R7XA 1IDYA 3OYMA 4FTHA 2F2EA 4XR6A 1Q1HA 5JVGF 1GHCA 2TDXA 1XCVA 4OIPF 1J9IA 1XSXA 1VQ9I 2DA3A 3S1MJ 1K83J 1DP3A 3DKYA 4CDGA 4DYRA 1UB9A 1XX5A 4HW0A 2FNPA 4XSXF 4A3BJ 2O0YA 4RM2A 2V26A 2PBIA 1IV8A 2YUSA 5DV5A 3M07A 4XBFA 4AU7A 3J7YJ 1ZLKA 5FJ8J 2QF7A 2HYGD 4HSTA 3MQ0A 3V8KA 2XPWA 2Q2EB 4XLEA 3BDDA 1BR2A 2BOLA 1ETVA 3W2WA 3EUHC 2Y9ZA 1TNSA 3SEZA 1CF7A 3I0TA 2CV2A 1O57A 1XGMA 4YRVA 4CYDA 1UG0A 1RZ4A 3T8RA 5L3BA 4G8XA 5E18F 2Y2ZA 3A1YA 2Y0SN 2OCEA 5K5QA 1B72A 4AD9A 1Z0XA 2BVLA 4IHSA 4LK0F 1J5YA 2EA2A 2KP6A 1K6YA 3X2QH 1S7AA 3V7CA 2IT0A 2HOAA 1O3SA 5EEGA 4CSWA 2NS8A 5LD2C 1WZ2A 5J1YA 2W4SA 5JR3A 5DEQA 2F48A 3CCSI 2V1XA 3JRCA 1TTYA 2KJBA 4D7MA 1UJ8A 4IKFA 1KYZA 2STWA 1HDPA 4PGGA 1U8BA 3VPRA 3FMQA 1ZRCA 2HOEA 2IRFG 4EGYA 4V19K 4M6XA 1ZTRA 2M34A 2L0KA 2LOOA 2FMYA 1HKTA 3SHFA 5LBQA 3EUKL 3CCVI 3OY9A 2ZMEC 4RAZA 1JHHA 1QHHD 5EEAA 3CCEI 4CCMA 2KJCA 3OV8A 2R7SA 1FLIA 2MA3A 2HQ5A 4XKBA 2CUFA 4GCVA 3HDDA 5FRMA 5ILVA 4IOCF 2P6TA 3K4KA 1V5FA 2ZNZA 1VQ4I 2V6CA 1IJWC 2X6YA 1NH3A 3RDIA 4CCOA 1IRXA 5M3MJ 2DA7A 3HBLA 1SFOJ 5AIPA 3GW2A 3UKGA 2L2OA 4R79A 5KHDA 1VNDA 3OYJA 2IGKA 4F52A 1JTYA 3CUQB 1K61A 2NAZA 2PG4A 3TOBA 4NQWA 2NNYA 2LY1A 4BDYA 1BW5A 4IF4A 3FXQA 4BHPA 2B0LA 2CUEA 2E1NA 3CLOA 4BXUA 1UAAA 2P5LC 3Q3SA 1ACIA 1MBFA 2VQHA 5BS6A 5F27A 1ETWA 5LEKA 4ZTFA 3DTIA 1UHMA 2DI3A 4MO7A 2R7ZJ 2LC2A 4M72A 4B48A 1MKMA 4FISA 2UV1A 4UHTA 3W2VA 3ZQ7A 4U7DA 2WAEA 3FXKA 2V1DA 3KEQA 5JLWA 2R5ZB 4WF2A 4BEHB 5E3MA 3VYUB 4L18B 2LKXA 3V4GA 2GA2A 3ZPLA 2VPRA 4UB8C 1IN7A 2TCTA 1P92A 5CQEA 3OYLA 2XROA 2DJIA 3FMRA 3PSIA 1V55H 2FA5A 4H4KC 3QPTA 1ZELA 3L2QA 4D7NA 2L7KA 2F6CA 3BPVA 3VYSB 4UUTA 4QIWN 1IW7F 1LE8B 2BE5F 4R1HA 1XSVA 4GRIA 1KU3A 1Z6TA 2OQRA 2DOFA 5ERIA 3VFZA 5HNFA 3DQVC 4LJZF 3JTHA 3HOTA 1ZGWA 3JRIA 1A35A 1IZ1A 1SMYF 4M3BA 3BZ6A 1B4AA 2K40A 3JCUC 4ZH4F 4PJ0C 5F08A 2P6SA 3PSFA 2M7AA 1VQLI 2GQQA 2ECCA 3KP7A 2IS2A 3KP5A 5E1WA 2IEKA 3LSKA 2IP2A 1P9QC 4F91B 3LA3A 1IRGA 1OCOH 4GO1A 1S7EA 3C3WA 3BWGA 2JPCA 2MD5A 3IAM2 2VPLA 2CW7A 2QQBA 3SFZA 3AAFA 2O61A 1TT5B 1BI3A 3PFIA 3BY6A 1PUFA 1S5LC 3JAMZ 3BR1A 1BA5A 4BNCA 2E1MC 1O3QA 2FRHA 2XAHA 4X0GA 2GZWA 1KYWA 2E2IJ 3E6BA 3HGGA 3BCAA 3GUDA 3MWMA 1HW2A 5CJ9A 2JSCA 1ZQ3P 2IS1A 4FE7A 2CJJA 1KQ8A 4BXXJ 1Z3YA 2JPBA 1OCTC 3GXOA 2A6TA 3MKZA 1ZG1A 2EIMH 1NG6A 4A3MJ 3CCYA 4HSRA 1ONVA 4FASD 4A3KJ 4XN0A 4M3FA 3ZMVA 3KLOA 2MSYA 2XSJC 2X48A 2E5NA 3HTUA 4OAYA 2CO5A 2PMZN 2Y9YA 3FM3A 3I55I 2ZSHB 3P5JA 4RB0A 1EA3A 2QKMB 3OYGA 5IY5H 4BE1A 3IWFA 3GTOJ 3WGGA 3RZDJ 3GO5A 3OSGA 1F43A 1D0XA 2QSGX 1J0RA 2HOSA 4HF0A 4Y13A 2QWWA 4MLOA 2DJNA 2LF8A 4EATA 3ABMH 2QM3A 2RKHA 1C0WA 1QO0D 1G4DA 1T0FA 1LB2A 1JKOC 4A3DJ 1ULYA 1PDNC 3ZMZA 1MSFC 4DZJA 2CMPA 3FWEA 1BI2A 2LF7A 2M0MA 3LSGA 2DU9A 3LAJA 1ETYA 2JVGA 3FXOA 2EB7A 2XGCA 3GZNB 2K86A 4G7ZF 3I56I 2E2JJ 4HOBA 2CWEA 2YX7A 5CPRB 2G7UA 1H9TA 1ITYA 3LMMA 2O5RA 5EJCA 3KYLA 4L9NA 2DBBA 3F6VA 5HLTA 2K7LA 5A2QK 3D5RC 3BR2A 4O5VA 2LR8A 4MTDA 2AHQA 3SJMA 1VI0A 4K2EA 1REPC 4KA4A 2FBIA 4L9TA 1I3AA 2MH2A 3DPUA 1ZGJA 3HOVJ 3OS2A 2F4OB 4JOMA 5E79C 2ZB9A 5GPCA 4ENKA 4LLGF 2R7VA 2LKPA 2XF7A 2I5UA 1N78A 1FBQA 5IYCJ 2RNJA 1RI7A 1VQ7I 1QVUA 2BVMA 3FBIB 1TW3A 4DGWB 1HSJA 3C18A 1BM9A 3L1PA 3FDYA 3HKZA 1J75A 5A2QZ 4A3IJ 1V5GA 2DA2A 1WJDA 3RKXA 2D1VA 2L7MP 2M2EA 2MH9A 1TWAJ 1D1AA 2FX0A 3V7RA 4C2TA 2STTA 2A07F 2M0CA 5E3OA 2ZBKA 2C6YA 3NQOA 1KU7A 3SZGA 5CVIA 4RGSA 2RAEA 1T39A 3GTKJ 1QGPA 2HI3A 1IN6A 1R5HA 1KQ0A 3QYFA 3QP5A 3TO9A 1QU3A 1HQCA 2RVCA 5KCMA 4WXDA 3H9QA 4FQGA 3CCMI 4D1QA 4ZTJA 1X4OA 1ZREA 4Y4RA 2XC7A 1TP4A 4DQ2A 3L00A 2GIZA 4ANJA 3E6CC 1XN7A 3LSHA 3A01B 5FLVA 2OD5A 4KN7X 3HHGA 4GYIA 3WG9A 1ODDA 4HEA2 2RREA 2DXIA 3Q9SA 1ZH5A 3QYEA 3HJEA 2K3PA 3BT9A 3M8FA 3RQIA 2QSHX 1BIAA 1UZCA 2XF6A 1JUMA 4IQ4A 2H8RA 5D4RA 1F5TA 3LSJA 4QSHA 2BY3A 2W85A 3GEZA 2MD0A 4XSZF 1TQIA 1S72I 4KNYA 4A5NA 2ZNYA 2KDOA 1FIPA 2EZKA 4PJMA 2A3SA 1U9NA 5TISC 2D45A 2JSPA 3RIRA 3F6OA 1W7PB 4C30A 2GBYA 2LP0A 1SC7A 3DEWA 1RESA 1ZG3A 2K85A 4NB5A 3ZOBA 1HKSA 1A04A 3BG3A 2H6BA 4RLFA 3VSLA 5D4SA 2XF5A 1GV2A 1MBJA 1ZLJA 2VBZA 2E1CA 5D8KB 3L2CA 3GLLA 1YRNA 2MW8A 1K78A 4RLQA 3F8MA 2L9SA 1YJ9I 5KAFC 3CZ6A 5KVRA 2V79A 1GT0C 2J5OA 1KZHA 3SYTA 3OYDA 1WPKA 1K6OA 4KYWA 3SZPA 1YTYA 2Z3YA 1EV7A 2B63J 5J8CA 1NG7A 2BZTA 2K27A 1U3EM 4HF1A 1AHDP 4AVPA 4C2UA 5KK1A 3J7ZI 2YU3A 5IP6A 1W4MA 1VQNI 2DFEA 3QP6A 4J01A 2XIGA 5E3LA 2HKXA 2KPMA 3LL7A 2EJRA 2IGNA 3BJ6A 4BU2A 4ESJA 4P1WA 1R7JA 3FKIJ 2VKVA 1FIAA 4IPAA 1H0MA 1DPUA 2Z9OA 1UHSA 2ZFWA 1UHWA 4KT6A 2QQ9A 2Q1ZB 1SFXA 1HDDC 5H2FC 4ZYGA 5HLIA 3ABKH 2M87A 3G71I 4UVCA 4PFOA 3IWZA 2K9QA 3TMOA 1R6RA 1CF7B 1P6RA 1YS6A 2VQGA 1R9TJ 4PJJA 3IRQA 2KIUA 3PUFA 1Z3XA 3J7AO 3CP2A 3TDZC 5L3EA 3V8JA 2E2HJ 4E7SA 5L3FA 5M5YJ 2YSRA 2ACJA 2P4WA 3K4LA 3JRFA 2JA8J 1R1UA 4EM1A 3H5AA 3KZZA 1GV5A 3GLXA 1B72B 2BXZA 1FOKA 3LFUA 2R7UA 2BGCA 1RUNA 1HOMA 2H09A 1QRYA 3D1NI 4JX5A 4I0BA 1P7JA 2BXYA 5ED4A 4BY1J 5AIQA 1JKRC 3PQJA 1MDMA 3I4MJ 3V7SA 5D5XB 4J00A 3FXMA 3OOPA 4B47A 5C44J 4EMSA 2W57A 1D8JA 2DMQA 2FXAA 3E1SA 2BV6A 3WODF 1XD7A 3BTCA 4L9VA 2GOMA 3IHUA 3ZMDA 1P4WA 3VYTB 4DBQA 3WHCA 5F1RA 5FKMA 1Y56A 5DCFA 3LOCA 3HTSB 4BAYA 4S04A 2MYSA 2DODA 2VOOA 1HW1A 1IUFA 2R5YA 4XKCA 1W5CC 4XLHA 4XLFA 5LFAA 1A6QA 2CU7A 3VOEA 3ZR8X 5FB2A 1R5GA 2AXTC 3EYYA 3ZP5A 3K4NA 4D0PA 4W1UA 2OF7A 2LSOA 1JXSA 1F36A 4E4HA 3O8HA 1GLNA 4I6ZA 3A03A 2QLZA 4Q47A 4XRFA 5K1YA 4CHUA 4IHWA 2V9PA 3ASNH 1YHQI 5FKOA 4JP0A 1YX3A 1Z77A 3JTGA 4W97A 3LSMA 2A5YB 1T95A 3ZXSA 4NQWB 1PYVA 4OWRB 1D1BA 1NTCA 1V5EA 2K9SA 4D5CA 5LGNA 3HOSA 1JE8A 2XAUA 4P96A 1QPIA 1SEUA 3L2WA 2O8XA 1EJ9A 1MBGA 4KICA 3HOYJ 4DJAA 3K70C 4YELA 4A12A 5FD6A 2OTLI 4HNUA 3KZIC 3K1PA 4D5FA 3WG7H 4ZYDA 1KGSA 4RB1A 3I5UA 1LDKB 2Z33A 1I1GA 1FOYA 2N8GA 3ABLH 5GPAA 1RUOA 2W84A 2XRLA 2E36A 4EGZA 4LLLA 2K4BA 1B1BA 1U5TA 2EIKH 1S3JA 2ZJ2A 5LRRA 3VDXA 2PLYA 1UFMA 4CYCA 2B7EA 2ID3A 2GLOA 2CRGA 4I98B 4G7HF 4FHTA 5J6XA 1T98A 1L0OC 3ZMSA 2KHMA 1IXSB 1OYIA 4LIUA 1JI8A 2L4MA 1TWHJ 3S3OA 1Y39A 1I6HJ 4NDLA 4S0HB 3ROUA 2FD5A 2ZO4A 4YFXF 3H0DA 4M6YA 2PMHA 2DTRA 3AFHA 3F0CA 3E6DA 4RS8A 4RB3C 4ASNA 2E34A 1PUFB 3TO6A 9ANTA 3V42A 1W5SA 3M9AA 2UXNA 4L9JA 3HM5A 3DBHB 5EEHA 1UG2A 1SVOA 3LSTA 2F5DA 4ENNA 2W00A 3CLQA 2M4KA 2MC4A 4N0BA 1IRZA 1IO2A 1O3TA 3CC7I 2PEXA 1VQOI 3HC7A 1I50J 5TGTA 2MABA 2ICWG 3UNGC 5FRNA 3DV8A 4XM3A 4ZDOA 4PDKA 5AONA 1O7LA 3OYBA 2VBXA 5EYRA 5F0HA 1CGPA 2MLKA 3S3MA 2V7FA 2KKOA 2R7WA 4U87A 2COMA 2JK3A 4C2MJ 4IRHA 1W1WE 3TO7A 3JRGA 1OYYA 2CQQA 4HNTA 3WTUC 1IN4A 2GA1A 3E6MA 5IOZA 4IRIA 3BOQA 1WJBA 3CUQC 4KN4X 3ZQFA 2OZ6A 1EH7A 1QBJA 2VBWA 1SAUA 3OOUA 4A0YA 1IC8A 3G6EI 1JKQC 4O3MA 5J8FA 3HIFA 4M3EA 4IO9F 4R8HA 3SEQA 5BPDA 3OL4A 3S32A 5K5OA 2HVQA 2K9NA 1BC7C 1Y8RB 2HR3A 4FETA 5E20A 5DTDA 4BQOA 5B66C 2G7HA 2Z5UA 2RDPA 4FT8A 4MGRA 4BHBA 3ZQGA 1G3YA 4ESFA 2WY8Q 4BACA 2EQRA 1WI9A 1R00A 2L7FP 4EJVA 3CO7C 3MZHA 1YFHA 1QZEA 1U2WA 3A02A 2JJ7A 3ZN1A 3H36A 1OPCA 4II2A 2H27A 4GYGA 4AIJA 2F5VA 5DDGA 3BTIA 4XLAA 3K0LA 1GXQA 1V3FA 1VZ0A 3QYBA 2CGPA 2TRTA 3QOEA 4CA0A 4M3GA 5HS9A 1MH3A 4L0ZB 1IXCA 3ULQB 1TWCJ 2OC6A 2UXXA 3KP2A 3QWLA 2ISZA 2HKOA 2LRDA 1A31A 4IHXA 5E1ZB 3KPHA 3KZYA 3N05A 2JWTA 4MNUA 3MVPA 3WTWC 5DM7F 1NK2P 1DP7P 1D0ZA 3HG9A 5EDNA 2NVQJ 3ZQCA 2FU4A 3NWTA 2L9RA 4A3GJ 3K1MA 1FMVA 4GFBA 2P5KA 2EZHA 3HRMA 3CCLI 3CC2I 4ZYAA 1U9OA 1YS7A 4H0EA 3DP7A 3GVAA 5C3EJ 5HOOA 2JVHA 2NVXJ 1ZKGA 5HDNA 2Y0MA 3D5LA 4MFDA 1AWCA 2ZXWH 4KJZA 2JRMA 3FISA 4RB2C 3KX2A 2LK2A 3E97A 1V54H 2RQQA 2R7FA 3HYIA 4HX8A 3OR2C 2MFZA 1H9GA 4WK8F 2EFWA 5FD5A 1MMGA 3NAUA 5FGMA 3CTAA 1W36D 3P9CA 1BL0A 1I27A 2HVRA 4C3JJ 1B9NA 2L7ZA 2HGCA 1AU7A 3M1EA 3LQRA 2VN2A 4OINF 4HX4A 2XKOA 2KMUA 2OUMA 1VQMI 1LVKA 3K4CA 3F3XA 1O3RA 3FX3A 1H89C 1SAXA 2JQ7A 4HDVA 2KQRA 3CCQI 1IV6A 2QA4I 3OWTA 2QENA 2V4JC 4HLYA 3A0BC 3CP8A 3QU6A 4ENJA 1R4MB 2VE8A 1N25A 2D1HA 2VJJA 3DBRB 2HOTA 3TBIA 3JAMK 2VASA 1ETOA 2M45A 4CZZA 1VQPI 1OQYA 1STZA 3K4JA 2WTEA 1Y1VJ 4ITVA 3FK7A 4HPQA 4CO8A 2VONA 2FMLA 3S3NA 3FXJA 1HXDA 3PNVA 4QWQA 4RA2A 1ON1A 3J7AY 2GXAA 5LGUA 1IN8A 4B1RA 3SFIA 4XN3A 1RR8C 5J47A 3BG5A 2YS9A 2LY9A 2HEOA 1YITI 1YRNB 5J3LA 1OYWA 5FLXK 2F5CA 1USSA 4NC6A 1K78B 5EZGA 5BOXA 2FQ3A 1YO5C 2M7BA 3MKLA 5GTHC 3KP4A 1OMIA 4WCGA 3WTTC 5FFZA 1GXPA 4YEJA 2FE3A 2VC0A 1FJLA 2CYYA 3WTXC 1FT9A 2JZYA 4C3HJ 3K2ZA 3CQZJ 2RGVA 2ADUA 3VEPA 1H8AC 1OISA 1YIJI 3WE3A 3CDHA 2CV0A 4ON0A 2XSDC 2X85A 4Y15A 1Y1WJ 2VJ5A 3OYFA 4UB6C 3TW6A 5LHHA 2WAFA 2X1EA 3PNTA 4OAZA 5FLXZ 3VSKA 1TLHB 1WJ5A 1R1TA 2A6EF 2R3SA 5IOYA 4BJ6C 2BY1A 5CQGA 2NXNB 5J1RA 3MCZA 3OYCA 2O6GE 4YFNF 1TWGJ 3I71A 4ZYHA 3CCRI 1DUXC 4AIKA 5D5UB 1SFKA 2VI6A 3S14J 3GZ6A 4PSWA 2ZC2A 4A3LJ 3HHHA 2CS3A 1OJLA 4M6VA 1OKRA 1WH7A 5B1BH 4AC0A 4IRGA 2NNNA 3T1BA 5DCMA 4CUGA 5JI6A 2FQ4A 2DDAA 4EQQA 3WGIA 2WAQA 3SQNA 4KMFA 4AIHA 1FZPB 2LMDA 3I4PA 4CCNA 1H88C 2EFPA 2VL8A 1RC9A 2HVSA 2ME0A 4N9HA 4XQFA 4LGWA 2EBIA 5FKNA 3R0JA 2W25A 3P9IA 3C2GA 1BR1A 2H1LA 3UR3C 2LKSA 4NNJA 3PO3J 3KFWX 1IF1A 3HKZN 5ILSA 2ECBA 4KISA 1JUPA 1MDMB 2ID6A 3I54A 2LREA 3RYRA 2Y30A 4HF2A 3S2HJ 1MBHA 1AKHA 2CV1A 2HZDA 3M8EA 1Z9CA 4Y3OA 4HV5A 2DAOA 2DDBA 3FXRA 2X1DA 4UV9A 4RM3A 2ZXIA 2E60A 2XUBA 2R7DA 4UVBA 2K3FA 2EINH 2X0LA 2R5YB 2VKEA 2NVTJ 3KLNA 5JFRA 2OTJI 3CMAI 1ORKA 2FOKA 3G73A 3CJQB 4TV7A 1FSEA 5JLXA 4HRIA 1P2FA 4XK4A 3RCOA 2MG4A 4EJUA 5JHFA 3MFKA 4B3AA 3LSPA 1XSDA 1X19A 4BKXA 2JA6J 4A2UA 3O6BB 3MMYB 1PUEE 1G8XA 2WBMA 1LFUP 2DA1A 3EQLF 3IP4B 4NC7A 4CCKA 4JX6A 4MQVA 5LEJA 1WJEA 1W0TA 3K69A 3ERMA 2VQLA 3W6KB 3FM5A 4CXFA 2ESHA 2CSOA 4BL0B 2A61A 5EGOA 5FKLA 4KIFA 3EUHA 2H94A 4P55A 2LD5A 2ZXHA 1EKEA 3DEUA 2WV0A 3OYHA 4OU0A 4RAYA 1YYVA 2O7OA 4RDUA 2OBPA 1SFUA 3PIOF 1SMTA 2DOEA 2OJED 2L4AA 1G6NA 4G94A 3TKYA 4M9XA 4IVNA 4XMYA 3AG1H 4DOZA 2GIVA 5E1XA 4L5IA 3GYHX 1FTTA 3A4CA 4U0YA 1R36A 1APLC 3CDIA 2DFIA 3FBNB 2R4GA 5D6FA 1ENHA 2KL4A 1E3PA 5J4VA 2EZLA 2LVSA 2I8DA 1VQKI 3I4NJ 4AM3A 4PZJA 3EUAA 3I53A 4XOPA 2ZJPF 3REOA 3GTPJ 3C2HA 1R49A 4ABZA 3OYKA 3OIQA 2HXOA 3S17J 2Q8KA 2G0EA 1A5JA 2L01A 4RGUA 2QQ8A 3F23A 3ML6A 4FX0A 1W0UA 3CC4I 4MIMA 1FYKA 1K4SA 3MN2A 1U5TB 3K2AA 4XRSG 1DU0A 3HOWJ 3V8LA 4I99C 4CYCB 1XMXA 2A5WA 2PFBA 2ZMEA 3P9KA 2P81A 3HUGA 2CW0F 3H9JA 1LFBA 3Q9VA 4EEFG 3JRAA 2F4IA 2COBA 4ZDLA 3EETA 2O9LA 5KAIC 2E19A 4A6DA 1AOYA 3BR3A 1WJCA 3GX4X 2P5VA 5ICEA 2M4GA 2GAUA 5TRDA 2V9KA 3OL3A 3G4SI 2QZ8A 4KUMA 3FXUA 2HQAA 2OPTA 1J09A 4NHJA 4I02A 4U0WA 4ZC3A 4PJLA 3O2PE 2YU9J 4OIOF 4PCQA 2K4JA 1FY7A 5BQTA 3WU0A 1ERDA 3CJTB 1P7IA 4IEJA 2ZXJA 4YIIA 4BBSJ 3NARA 3E3VA 3PFYA 1KU9A 3HSEA 3F9KA 4PFPA 1IRFA 1QZYA 3SDBA 3QPSA 1Z21A 2EV0A 1XTAA 1IAWA 5HVQC 2HZTA 4RGXA 3ISPA 3SDGA 2BY0A 2CQKA 5DM6F 3AKZA 2XAFA 4RAGA 4LMYA 3IKVA 2JRTA 2X4HA 4JYKA 4BBRJ 4X6AJ 2FOWA 1X2NA 2FUG2 1LJ9A 2ZKZA 3Q0WA 5GAHJ 2BHZA 1TC3C 2PJPA 1B6AA 1FP2A 2L02A 3DKWA 1UCRA 3KEOA 3COAC 4FX4A 4LB6B 2CUJA 2IA1A 3HSRA 1SD6A 3ZCOA 2BW3A 4AYBA 5B1AH 4PUSA 2DPUA 2GM4A 4AUXA 2PJRA 4PSXA 4XONA 3LWFA 5LGTA 5FKKA 1IDZA 3BTLA 2NOJB 4A6EA 2XB5A 3BQYA 5EG0A 4IZZA 1OCRH 3BZKA 4WXCA 5HNHA 1UELB 3VYRB 4P9UA 4I01A 2OAZA 5M3FJ 4JBAA 3S2WA 3KE2A 4E7HA 3MKYB 3ERED 1JT0A 3IUOA 2KIQA 3PNYA 2VKDA 3DU6A 1XMKA 2DLLA 3KIOA 5E8IA 4KIBA 2KRCA 2VJIA 1RIOH 3TQNA 3GFJA 3FMSA 1MIJA 1MW7A 1FMWA 3I3LA 4N4NB 1VQ5I 2E5ZA 2PI0A 1VFCA 1LNWA 3MZYA 3R0AA 3K6GA
chains in the Genus database with same CATH topology
3DQVC 2HPIA 3HOTA 4II3A 4E7ZA 3W2AA 3RPUD 1HA8A 1D1CA 3S3MA 3PSFA 2V7FA 2R7WA 2M7AA 4U87A 2IS2A 3OYEA 3LSKA 4HNTA 1P9QC 3HL2A 4F91B 4IQJA 3A2KA 3S93A 3IAM2 2KLOA 2DCEA 1WJBA 2VPLA 2CW7A 2RNGA 4ZDPA 4B44A 1SAUA 3ONQA 3OOUA 4P5OA 3E0JB 2L5QA 3HXLA 4BEHA 3SEQA 3OL4A 3S32A 1OR7C 2HVQA 2E1MC 4X0GA 4FETA 1YX5A 2Z1DA 4BQOA 2QKLB 3BCAA 3QODA 2X6XA 1LFPA 2IS1A 2WY8Q 4BQNA 4BACA 1Z3YA 2A6TA 3MKZA 1G59A 1NG6A 3L2VA 3EPZA 4HSRA 4FASD 4XN0A 2VIXA 2XSJC 4II2A 2E5NA 2LG4A 4OAYA 2F5VA 4XLAA 1VZ0A 2ZSHB 3QYBA 3AL0B 2KRHA 4PJNA 2HPMA 1EA3A 2QKMB 3QOEA 3DU5A 3OYGA 1PJRA 1MNDA 4LG3A 4XKWA 4CA0A 4BE1A 1MMDA 2OC6A 4E7IA 2LYCA 2LRDA 2IS6A 1D0XA 2X6WA 1AA7A 3DLAA 3N05A 3NWSA 2IS4A 2JA2A 4MLOA 3DTKA 4EATA 1D0ZA 3HG9A 3BG6A 2R7RA 4BXFA 4XL9A 3NWTA 3K10A 1FMVA 4BDZA 2UUZA 2CMPA 2R7TA 1BOBA 1U0JA 2M0MA 3LSGA 2AQFA 3OS0A 4ZYAA 3BLYA 5HOOA 2JVHA 4N4OB 2JVGA 3D5LA 4KJZA 4RMNA 2L9NA 3ZRGA 3KX2A 2JUGA 2IGOA 2ZFUA 1T0FC 5CPRB 4CCLA 4U7BA 3LMMA 2O5RA 2RQQA 4BE2A 3KYLA 3OR2C 2MFZA 4BGDA 5HLTA 1MMGA 2CUZA 3D5RC 2X1CA 1W36D 3LSIA 2HVRA 1MNEA 3DTEA 3DPUA 3OS2A 2P0WA 4JOMA 2R7VA 2KMUA 2OUMA 2HNHA 4B3XA 1LVKA 3K4CA 1X1AA 2XF7A 1N78A 2KQRA 2K9MA 3OWTA 4E7KA 2BVMA 3RTRA 3FBIB 2V4JC 4DGWB 3OYNA 3CP8A 3FDYA 3HKZA 1V5GA 2VJJA 1WJDA 2DOAA 4C9YA 3TBIA 2VASA 2X51A 3H9GA 1D1AA 2VQCA 4C2TA 3FKJA 4IX7A 4BE0A 3H5RA 3K4JA 4ITVA 1W36C 4HPQA 3SZGA 4ZJZA 3TL4X 2CW8A 4NC8A 4JQFA 4DIQA 3S3NA 3PNVA 4XOTA 3J7AY 3CF2A 3K4BA 4XN3A 4BQQA 2W1OA 3QYFA 4LITA 1QU3A 5KCMA 1TZLA 2OV7A 3H9QA 2AQEA 4D1QA 1Z7LA 4ZTJA 1N77A 1X4OA 4Y4RA 2XC7A 3OYIA 2M7BA 2VXZA 2Z16A 4ANJA 2LBFB 3LSHA 4LIVA 4G6TB 4XNFA 3MD2A 1X1CA 4YEJA 4F3QA 2DXIA 4QPQA 4HEA2 2RREA 4F93B 3K4MA 4F55A 3QYEA 2K3PA 3CMMA 2CV0A 2XF6A 2X85A 3PUBA 4IQ4A 3H35A 2VJ5A 3OYFA 2WAFA 2X1EA 3PNTA 4OAZA 4F92B 3VSKA 1WJ5A 2MD0A 2VJ4A 4BJ6C 2K5CA 3OYAA 2KDOA 3BCBA 2HU9A 5CQGA 3OYCA 4PJMA 3OIPA 2JSPA 1X1DA 2WA0A 4C30A 2W7NA 1SFKA 5CKTA 4PSWA 4E7LA 2CS3A 4RLFA 2ELJA 3VSLA 4BUPA 4XKVA 2XF5A 4B43A 4CUGA 2UWMA 3IAS2 3VWBA 2DT7B 3DKXA 2WAQA 2VLAA 4BJ5C 2GOXB 1X1BA 3OS1A 2R7QA 4RLQA 4CCNA 2VL8A 1DQUA 2L9SA 2LY2A 3L2RA 2WY7Q 4Y33A 2HVSA 4HG2A 2LBFA 3CZ6A 3PL8A 4XQFA 3S8PA 3SYTA 3OYDA 1OLTA 1D0YA 2Y0SA 2KZVA 4D9JA 3C2GA 1BR1A 4QPOA 3UR3C 1NG7A 4NNJA 3CESA 1BR4A 3PJRA 3I9V2 2K9LA 4KISA 1QHGA 4C2UA 2LREA 1DGRM 1WFXA 4J01A 3M8JA 3ZQQA 2KPMA 3LL7A 2IGNA 4XORA 2HZDA 4BU2A 2CV1A 4P1WA 4Y3OA 2IGMA 3M1CA 4CCJA 2WB1A 3HPHA 2X1DA 3DPLC 4KT6A 2IXSA 1Y6IA 2ZXIA 4RM3A 4KITB 2E60A 2V6EA 2Q1ZB 1WJFA 2CFOA 2XDVA 3D5SC 4PFOA 3FHNA 3W3CA 4AVZA 3TMOA 4BJTA 1R6RA 1LKXA 1N75A 3MKWB 2VQGA 4PJJA 1Z3XA 3HPGA 3CJQB 3CJRB 4HRIA 4CZCA 3CP2A 3RCOA 3OMYA 4E7SA 5JHFA 1X19A 2W82A 3K4LA 3H5AA 2R7UA 2ZSIB 3LFUA 1G8XA 2WBMA 1MMAA 3DPTA 3MMYB 4CCKA 3IP4B 2WADA 4NC7A 1E0EA 2HDWA 1WJEA 4E6KG 2R7XA 3OYMA 4XR6A 2VQLA 4BL0B 3HUGB 4J00A 1DP3A 3DKYA 4B47A 2ZXHA 3OYHA 2V1NA 3E1SA 4RM2A 2V26A 2GOMA 3VYTB 4DBQA 2DT6A 1Y56A 4PK4A 4AU7A 4NUBA 4XMYA 3RSNA 4DOZA 4HSTA 2Q2EB 4XLEA 1BR2A 2BOLA 2MYSA 3A4CA 3W2WA 3EUHC 4XKCA 3SEZA 4XLHA 4XLFA 5LFAA 3FBNB 2R4GA 2CV2A 2KL4A 3ZR8X 4YRVA 2I8DA 3K70D 3EUAA 3K4NA 4XOPA 3KEYA 3C2HA 1UG0A 3OYKA 3OIQA 3A1YA 4E4HA 1GLNA 1MMNA 3RQ4A 4XLCA 2BVLA 2KP6A 1K6YA 3GBGA 4CSWA 5LD2C 1YX3A 2A5WA 3LSMA 1T95A 2W4SA 3ZXSA 4NQWB 1PYVA 4OWRB 1D1BA 5FROA 3DEEA 1V5EA 3H9JA 3HOSA 2XAUA 2F4IA 3DWLE 4IKFA 3L2WA 4ZDLA 3L2UA 2CH0A 4DJAA 3K70C 2BW3B 1WJCA 4YELA 2VB6A 4HNUA 2M4GA 2LOOA 2V9KA 3OL3A 2PJRB 3EUKL 3OY9A 2HQAA 4BS9A 1J09A 1QHHD 4E7JA 4CCMA 2VKHA 4PJLA 4ZC3A 2R7SA 4XKBA 1LDKB 1ERDA 5FRMA 3K4KA 1V5FA 3ZGKA 3PFYA 2X6YA 4CCOA 1IRXA 3F9KA 4PFPA 3SDBA 1Z21A 5HVQC 2L2OA 1WJAA 4R79A 5KHDA 4DBRA 3OYJA 2Z2SB 3VDXA 3AKZA 2IGKA 2VXDA 4F52A 1TT0A 2R7OA 2LY1A 4BDYA 2M3AA 2FUG2 1UAAA 1KONA 2KHMA 1JI8A 4LIUA 1DGWY 2E1MB 2VQHA 2CUJA 3S3OA 3BC8A 4ZTFA 3DTIA 2BW3A 3ZCOA 3H0DA 4AYBA 2PMZA 4PUSA 3OR1C 2LC2A 2PJRA 4PSXA 4B48A 4XONA 3AFHA 2UV1A 3W2VA 2NOJB 5KNLA 4IZZA 2WAEA 3V42A 3G2BA 2LH9A 1S9HA 4BEHB 3VYUB 5HNHA 1UELB 3VYRB 3U21A 4CH7A 5CQEA 2W00A 2M4KA 2MC4A 3OYLA 3MKYB 4E7HA 2DJIA 3IUOA 3PSIA 3PNYA 3BG7A 2VKDA 1X4PA 3DU6A 4H4KC 3HC7A 1ZELA 3L2QA 5TGTA 2L7KA 1YE9A 2F6CA 2KRCA 2MABA 2VJIA 3VYSB 3UNGC 4N4NB 5FRNA 1MW7A 3I3LA 1FMWA 3H5NA 4XM3A 4ZDOA 2E5ZA 3AL0C 5HNFA 4GRIA 3OYBA 3K6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DT7 B;  1X4P A;  1X4O A;  1UG0 A;  2E60 A;  2E5Z A;  4DGW B;  2DT6 A; 
#chains in the Genus database with same CATH topology
 1TNT A;  2KIM A;  2HPI A;  1XPX A;  3A0H C;  3BQZ A;  1V4R A;  4E7Z A;  3RPU D;  1HA8 A;  5ILU A;  3P7N A;  2ELK A;  4RGR A;  2XAG A;  1GDT A;  3ZMU A;  3OYE A;  3QPH A;  2AO9 A;  3HL2 A;  4JK1 X;  1M1E B;  1Z05 A;  3WTZ A;  2DMU A;  3C2B A;  1MJA A;  1BI1 A;  2KLO A;  1R71 A;  3RPQ A;  2D2W A;  1RPW A;  3RPU A;  2RNG A;  2A05 A;  4B44 A;  1NK3 P;  1HF0 A;  1SD7 A;  1JKP C;  2L5Q A;  4DW6 A;  3HXL A;  2IW5 A;  1YX5 A;  2Z1D A;  4M73 A;  3F22 A;  3JRB A;  1NHA A;  2QKL B;  2E71 A;  1S29 A;  2NYX A;  3QOD A;  2P8T A;  5EZH A;  2NVY J;  3CUO A;  2X6X A;  2DO7 A;  2RN7 A;  5BNG A;  2ISY A;  5E8G A;  2EZI A;  3H3Z A;  3ABU A;  3VOD A;  4BQN A;  4M71 A;  5GAG J;  5IYB J;  2EFO A;  2M8E A;  1YLF A;  1BW6 A;  2NVU B;  1ZR2 A;  1A6I A;  4OMY A;  4QLC U;  1JGS A;  1IN5 A;  1G2H A;  1JJ6 C;  2LTP A;  2Y69 H;  2VIX A;  1S6L A;  4BQA A;  3WTY C;  2LG4 A;  3LA2 A;  1XDS A;  5IPA A;  1X3Z B;  1YJN I;  4KMU X;  2IJL A;  1D5V A;  1F9N A;  3TP0 A;  1SD4 A;  2O03 A;  2XKP A;  1WCM J;  3PM1 A;  2KRH A;  4PJN A;  2JT1 A;  3DU5 A;  1YW8 A;  4IXA A;  1MND A;  4XKW A;  3QPL A;  2XAS A;  3GF2 A;  4OOI A;  5H6R A;  4E7I A;  2IS6 A;  1MBE A;  2X6W A;  1B8I A;  1AA7 A;  3DLA A;  5FFX A;  3NWS A;  3ZQI A;  3S16 J;  2DQL A;  5L3D A;  2JA2 A;  2L54 A;  5IP7 J;  3DTK A;  3T8T A;  5HS8 A;  1YW9 A;  3G1M A;  3U9G A;  1ZRF A;  4EJW A;  3BG6 A;  4BXF A;  3GCM A;  4IJA A;  4XL9 A;  3K10 A;  3K1N A;  5D8L B;  4EJO A;  4S05 A;  2VOD A;  2UUZ A;  4E70 A;  2VT3 A;  1J7K A;  4I09 A;  1U0J A;  2AQF A;  3BLY A;  1Q1V A;  3F8C A;  3O3K A;  3RKQ A;  2ESN A;  1DDN A;  4N4O B;  4BYY A;  2LNB A;  4KT5 C;  1IG7 A;  4GDF A;  2HWV A;  1WKM A;  2L9N A;  4RMN A;  3ZRG A;  2XPV A;  1GUU A;  3BR5 A;  2ZFU A;  1T0F C;  4DNC A;  5F0C A;  2DYS H;  4BE2 A;  4ESB A;  3B73 A;  2M9H A;  2CUZ A;  1ZHF A;  2V1U A;  3CO6 C;  3HRT A;  2HQN A;  1Y8Q B;  4EV0 A;  3ABT A;  3LSI A;  4UNO A;  1I39 A;  4LG0 A;  4A69 C;  3MZ8 A;  4L5J A;  3KYC B;  5JHU A;  2M30 A;  5C4X J;  4B3X A;  3GTM J;  1G3W A;  1X1A A;  2H6C A;  3ECO A;  4IL6 C;  2Y31 A;  2K9M A;  3LNQ A;  4Q5S F;  1OFC X;  4E7K A;  3T0Y A;  4A5M A;  3OYN A;  4ETS A;  3E5U A;  1RNL A;  3QOP A;  3BJA A;  3IRR A;  1HST A;  4C9Y A;  3G1L A;  3NRV A;  3RZO J;  1ETX A;  3CCJ I;  2OZU A;  1YI2 I;  1XC5 A;  2OU2 A;  2VQC A;  1OR7 A;  1LEA A;  3H5R A;  4HQM A;  2NOG A;  2YX4 A;  1OCP A;  1HW5 A;  3TL4 X;  2CW8 A;  4MFE A;  4DIQ A;  4Y52 J;  2EFN A;  1FYM A;  3BZC A;  3Q5F A;  3QU3 A;  5DCM B;  3M4O J;  4BQQ A;  5BMZ A;  1WGX A;  1BBY A;  1LDJ A;  3TP3 A;  2OV7 A;  2QYO A;  4NBQ A;  5L3C A;  3ASO H;  1U8R A;  1N77 A;  5E17 F;  3F8B A;  2XAJ A;  2EV6 A;  2VXZ A;  4OMZ A;  1RKT A;  2H8W A;  1VF9 A;  1ETQ A;  4G6T B;  3R6S A;  3MD2 A;  1X1C A;  3BP8 A;  4KIG A;  4F3Q A;  1QA6 A;  2P7V B;  3L09 A;  4QPQ A;  1TBX A;  2VOP A;  4F93 B;  3K4M A;  4F55 A;  4WXH A;  3AG3 H;  1KQ9 A;  5K5R A;  2P7C B;  1ZN2 A;  3R4K A;  1Y0N A;  3ZQH A;  5HDK A;  3H35 A;  4UY8 I;  1FEX A;  1U78 A;  2LDU A;  4F92 B;  3IL2 A;  1AKH B;  5D5V B;  2BEO A;  3L9F A;  2VJ4 A;  2K5C A;  5FLM J;  3OYA A;  2PMU A;  3FXL A;  4M9S A;  2PQ8 A;  1X1D A;  1QZZ A;  2W7N A;  2E7X A;  4O6J A;  3IV5 A;  4X1E A;  3ZN0 A;  5CKT A;  3FF5 A;  3U2R A;  5DS9 A;  1E3H A;  2WB1 N;  4B8X A;  3RYP A;  4E7L A;  3B6C A;  2DA4 A;  3LAP A;  4LK1 F;  1XGN A;  2F4M B;  2DW4 A;  2ELJ A;  5JVT A;  4B43 A;  2W24 A;  3K7A J;  2M8G X;  5HS7 A;  2UWM A;  2FNA A;  2BHY A;  2O3F A;  1D8K A;  2FSW A;  3CDL A;  3DKX A;  5CYV A;  3EYI A;  1ZAO A;  4IHY A;  1ZR4 A;  1X1B A;  3RKW A;  4YIF A;  2EWN A;  3SXY A;  2XGE A;  2KDZ A;  3H1C A;  2QBY A;  1DQU A;  3IC7 A;  3QQA A;  4UV8 A;  2LY2 A;  1G3T A;  1W5T A;  2WY7 Q;  4Y33 A;  1A36 A;  2L3D A;  4HG2 A;  2LBF A;  3PL8 A;  2F5F A;  4KFC A;  3S8P A;  4G7O F;  1LEB A;  4EM0 B;  1WSU A;  1T6S A;  5L3G A;  1D0Y A;  4QTR A;  2Y0S A;  2KZV A;  4D9J A;  1KA8 A;  3I59 A;  4QPO A;  1B59 A;  5LRS A;  3GTG J;  1BR4 A;  2LFB A;  3U1K A;  2D5V A;  2ETH A;  2BY2 A;  1PVE A;  3HGY A;  5DD4 A;  5HLG A;  1F4K A;  1QHG A;  4UUS A;  5EGO B;  2EV5 A;  4HZF A;  4EVI A;  1FYL A;  1BI0 A;  1DGR M;  1FNN A;  2VT2 A;  4XRM A;  3BG9 A;  3KCC A;  1BIB A;  3C7J A;  2HS5 A;  3M8J A;  2M1B A;  4XOR A;  4FCY A;  2DT5 A;  2IGM A;  3E5Q A;  4CCJ A;  2WB1 A;  5IP9 J;  1TQP A;  3DPL C;  2IXS A;  4KIT B;  1FX7 A;  4LOC A;  2ELH A;  2V6E A;  1DPR A;  2MC3 A;  1WJF A;  3QRF F;  1MJB A;  3D5S C;  2XDV A;  4BJT A;  2HDC A;  3M7G A;  5J4Y A;  1LKX A;  3MKW B;  2ZJR F;  2KIF A;  1FOX A;  4EM2 A;  5H6Q A;  3HPG A;  3R60 A;  2GWR A;  1Z6R A;  4YIR X;  2JTV A;  3DXJ F;  1YG2 A;  2VC1 A;  5F64 A;  2CFX A;  4LD5 A;  4V2F A;  4CZC A;  1OCC H;  4A3E J;  1S7O A;  4ENM A;  1XB4 A;  4HDU A;  2VUM J;  1D3Y A;  1R5I D;  3DF8 A;  2ZSI B;  3DPT A;  3I64 A;  1MMA A;  1YW7 A;  3GWZ A;  3GFL A;  4FE4 A;  4E6K G;  3VB2 A;  1LDD A;  2G9W A;  2Y75 A;  4G9Y A;  2ZME B;  2ZCW A;  5D6E A;  4LB5 A;  1ZRD A;  4HBL A;  2L9V A;  3HUG B;  2WV1 A;  2DA5 A;  4UVA A;  2WWY A;  3IH4 A;  5LLQ A;  2QSF X;  1Z1D A;  2XVC A;  2V1N A;  4AID A;  1S8N A;  5J40 A;  3DCF A;  1RKW A;  3H0G J;  2DT6 A;  4PK4 A;  4NUB A;  2Q0O A;  3RSN A;  1XGO A;  2GXG A;  3JR9 A;  1JT6 A;  2WAQ N;  4J19 A;  3N4M A;  4UXN A;  1DU6 A;  3K70 D;  1VTN C;  4IHT A;  3KEY A;  1MNM C;  4KDP A;  5M5X J;  3F72 A;  4DZP A;  3HRU A;  3ZMT A;  4OIR F;  1MMN A;  3RQ4 A;  1WWX A;  3F8N A;  4XLC A;  5IT9 K;  2B9S A;  5J1U A;  3LQQ A;  4V2G A;  3GBG A;  2XGX A;  3BPX A;  4YFK F;  2EPF A;  5CLS A;  2PN6 A;  3CJN A;  5FRO A;  3DEE A;  4BH9 A;  2R93 J;  1VQ6 I;  3DWL E;  2ME6 A;  2IA0 A;  3HSF A;  3GTQ J;  3L2U A;  1RRJ A;  4RAF A;  1SD5 A;  2CH0 A;  4I2O A;  1XDU A;  2DQR A;  4Q48 A;  2BW3 B;  2OCC H;  3PIP F;  5IT9 Z;  2VB6 A;  2PJR B;  3CF5 F;  3W6V A;  2Q2E A;  4BS9 A;  1SVM A;  1Z91 A;  2K02 A;  4E7J A;  5EG0 B;  2VKH A;  1XS9 A;  1IUY A;  4HNV A;  5CVU A;  3HOZ J;  3BJO A;  4PGH A;  1WI3 A;  2QGU A;  3DLL F;  4DYQ A;  1TWF J;  3HZJ A;  3ZGK A;  5FO5 A;  2DYR H;  2F5E A;  1UMQ A;  1TW2 A;  1R4N B;  3PQK A;  4CIC A;  4HX7 A;  5B3S H;  3DBL B;  1U6G A;  1HKQ A;  3S1N J;  2RQP A;  1WJA A;  4DBR A;  2XAQ A;  2Z2S B;  1BJA A;  2VXD A;  3HOU J;  4U88 A;  4I0A A;  1TT0 A;  2CG4 A;  1WHU A;  2R7O A;  4G6D A;  1P4A A;  3J80 K;  3LA7 A;  1WH5 A;  1K4T A;  2EFQ A;  4HLX A;  2M3A A;  4XIC A;  1Z67 A;  2EIL H;  1KON A;  2IA2 A;  1QVT A;  2DK8 A;  1DGW Y;  2E1M B;  4HA8 A;  1T38 A;  3BC8 A;  3TED A;  2DTZ A;  1U5T C;  1B9M A;  4G6Q A;  1XGS A;  2PMZ A;  1LPQ A;  1E2X A;  1I5Z A;  3OR1 C;  1JUS A;  3WTS C;  4MQ9 F;  4RBO A;  3JSO A;  3ECH A;  3L7W A;  2H1K A;  4M74 A;  4MEX F;  5KNL A;  3J80 Z;  3T5X A;  3G2B A;  4HV6 A;  2LH9 A;  1S9H A;  3HEF A;  4A3C J;  3U21 A;  4Z6Y A;  4U0V A;  4CH7 A;  4XID A;  2DPD A;  2FJ1 A;  3WE2 A;  1JGG A;  1O7F A;  2HYF A;  3BG7 A;  1X4P A;  1K79 A;  3JRH A;  3FZV A;  1FOW A;  1YE9 A;  2W48 A;  2XB0 X;  1E17 A;  2XGD A;  3H5N A;  5TJJ A;  4XLN F;  2QQA A;  3TW7 A;  3AL0 C;  3AG4 H;  4Y7N J;  3CUQ A;  2HFH A;  2HDD A;  1SFE A;  3TDU C;  3S1Q J;  2V9V A;  3FK6 A;  4II3 A;  3RI4 A;  1X1P A;  2YR2 A;  4HYE A;  3W2A A;  1D1C A;  1WQ2 A;  2ZJQ F;  5LHI A;  2EH3 A;  3G3Z A;  2DK5 A;  3BR6 A;  4YG2 F;  1KU2 A;  1QNT A;  4IQJ A;  4LLN A;  4CGZ A;  2JUC A;  1R23 A;  2XV4 S;  3GFM A;  3A2K A;  3S93 A;  5DUI A;  2KZG A;  2DCE A;  3KET A;  4ZDP A;  3H3U A;  1B8I B;  3ONQ A;  2A6H F;  3ZQL A;  2HXI A;  4P5O A;  2EIJ H;  3E0J B;  5GP9 A;  2R5Z A;  2KRF A;  4BEH A;  4C3I J;  5IT3 A;  3C1D A;  1OR7 C;  3S15 J;  3JSP A;  1HC8 A;  1ZAR A;  2FBH A;  3LFK A;  2DMT A;  1I6X A;  4HQE A;  1BOA A;  2YPR A;  1T56 A;  5CVJ A;  4B09 A;  1LFP A;  1SAN A;  4JX4 A;  2BBY A;  1ZYR F;  2HTS A;  2NS7 A;  2R0Q C;  2A68 F;  3HRS A;  1BN5 A;  3WU2 C;  1MH4 A;  2MLG A;  2WC2 A;  2HTJ A;  1G59 A;  3L2V A;  1LE8 A;  3Q0V A;  3EPZ A;  3WGH A;  4UUV A;  1MJ9 A;  1T33 A;  4A3J J;  5D5W B;  3IH2 A;  1BJZ A;  2KIS A;  2JA7 J;  3KP3 A;  1XG1 A;  4AYB N;  4BHC A;  5EF6 A;  2VBY A;  1F1Z A;  3AL0 B;  4M9Z A;  2MGQ A;  3K9T A;  2HPM A;  4LG0 B;  5CVR A;  1PJR A;  4LG3 A;  3IKT A;  2PX9 A;  2R92 J;  1MMD A;  2LLK A;  1OCZ H;  1J59 A;  1QPM A;  2LYC A;  5GTI C;  4I76 A;  3OIO A;  1XCB A;  1ETK A;  5F6F A;  2IS4 A;  4MTE A;  5M5W J;  3CCU I;  5ICG A;  1E3O C;  4HAM A;  4ZZD A;  3D0S A;  3TOA A;  2R7R A;  5K7F A;  3EDP A;  1YJW I;  1O4X A;  1FTZ A;  2DMN A;  1YQA A;  4BDZ A;  5BPI A;  1JHF A;  1K7A A;  5HLH A;  3LSR A;  1CQT A;  2AXL A;  4DYC A;  2R7T A;  1BOB A;  2MBF A;  4BY7 J;  1T8I A;  3OS0 A;  4ZYE A;  3FHZ A;  1FSH A;  1FP1 D;  1LQ1 A;  2JMW A;  1J2X A;  1IXR C;  2BYV E;  2JUG A;  4N9I A;  2DMP A;  2IGO A;  4CCL A;  3RKY A;  4U7B A;  1BC8 C;  1I1S A;  2DN0 A;  4BGD A;  3FIW A;  1D5Y A;  1R1V A;  2X1C A;  2XHK A;  1L3L A;  4Z2Y A;  1MNE A;  3Q0U A;  3DTE A;  3B02 A;  4I7H A;  2P0W A;  2IPQ X;  5DD8 A;  2I10 A;  3JRE A;  2HNH A;  2J5P A;  3J81 K;  5C4J J;  2E7W A;  3TGN A;  2E1O A;  3F21 A;  2HYJ A;  3RTR A;  5F1J A;  1P4X A;  2FBK A;  2CQN A;  3MAJ A;  1EH8 A;  1FPQ A;  3S2D J;  2DOA A;  4Q4Z F;  1R58 A;  5F04 A;  3CME I;  5H20 A;  1MGT A;  1SVL A;  1FBS A;  1EH6 A;  2X51 A;  1UST A;  3RJP A;  1JTX A;  5ICF A;  3H9G A;  1VQ8 I;  4EJT A;  1MD0 A;  5E3N A;  2JA5 J;  5HOD A;  4XLP F;  3E7L A;  3FKJ A;  4WX9 A;  3WU1 B;  1LVA A;  4IX7 A;  4BE0 A;  2X9D A;  1ZK8 A;  3BR0 A;  1W36 C;  3R61 A;  3J81 Z;  2JN6 A;  4ZJZ A;  3GME A;  1WRJ A;  2KFD A;  2RC4 A;  3KYD B;  4JQF A;  4L5E A;  4NC8 A;  4XOT A;  3CF2 A;  4F7Z A;  3K4B A;  2W1O A;  2E35 A;  3BTJ A;  4LIT A;  1POG A;  1YOV B;  3GTL J;  5GAE J;  1TZL A;  1T2K A;  2AQE A;  5HDG A;  1Z7L A;  2QBY B;  1I3Q J;  4LFU A;  2DFF A;  1ZG5 A;  1LUJ B;  3OYI A;  4A93 J;  1RET A;  3JW4 A;  2Z16 A;  2XRN A;  3G1O A;  2HQR A;  5B5E C;  2LBF B;  2DA6 A;  4LIV A;  4XNF A;  4B4C A;  3BRO A;  4MHG A;  2UZK A;  1XMA A;  3IH3 A;  4GGG A;  3I59 B;  1IGN A;  4OIQ F;  3CMM A;  1GVJ A;  2IBD A;  5DYM A;  1X3W B;  2RV8 A;  3WHB A;  4UUS B;  3ESW B;  3PUB A;  3N97 A;  2X6O A;  1PP7 U;  4P9F A;  2Y48 A;  2Z99 A;  2CQ7 A;  3NEU A;  3HOX J;  3DFG A;  1Z7U A;  2XPU A;  5LHG A;  3BCB A;  1QQI A;  1Y0U A;  2CQX A;  2HU9 A;  3U1D A;  4IHV A;  5K7H A;  6PAX A;  3OIP A;  1G3S A;  2WA0 A;  4A0X A;  2EA4 A;  1MBK A;  3GZ5 A;  2M5W A;  5K7Z A;  1RR7 A;  3GTJ J;  2OQG A;  2OA4 A;  2FEZ A;  1HBX G;  4A0Z A;  1JJ8 C;  4AWX B;  5DUK A;  3WTV C;  2KT0 A;  3F8F A;  4BUP A;  4ZZL A;  4XKV A;  1GVD A;  3IAS 2;  5CVV A;  1WVR A;  2DT7 B;  3VWB A;  3CD6 I;  3QAH A;  2VLA A;  4BJ5 C;  4A3F J;  2GOX B;  3OS1 A;  4XRS A;  2GXB A;  2R7Q A;  3KP6 A;  3L2R A;  5ICC A;  2IVM A;  1HCR A;  1HLV A;  1ON2 A;  3A01 A;  1FBU A;  1R22 A;  1X3U A;  3S1R J;  3B6A A;  1OLT A;  4MEY F;  3JRD A;  4M3D A;  4L0Y B;  3CES A;  3PJR A;  3I9V 2;  2K9L A;  1W7P D;  2QUF A;  3O8G A;  3I58 A;  3PO2 J;  1MMS A;  1MSE C;  3CMY A;  1WFX A;  2QVO A;  1T08 B;  3ZQQ A;  3HB9 A;  1FC3 A;  3H3V K;  1ZGA A;  3M1C A;  5GAD J;  3M3Y J;  3MEX A;  3W6J B;  1YIO A;  1TL8 A;  3HPH A;  3E5X A;  1X2M A;  1Y6I A;  3AG2 H;  1W7P A;  2VE9 A;  3SZT A;  1FWZ A;  2CFO A;  2A69 F;  3W3C A;  3FHN A;  4AVZ A;  2IAI A;  2AS5 F;  2EK5 A;  1N75 A;  4GXO A;  1PP8 F;  2FF4 A;  4WWC A;  5IYD J;  1EF4 A;  2DFH A;  3H92 A;  2O8K A;  1MZB A;  3ELK A;  3CJR B;  2NS0 A;  3GFI A;  3OMY A;  2NRA C;  1X58 A;  2W82 A;  4Y17 A;  4IOA F;  2QCO A;  4G12 A;  3OSF A;  2WAD A;  1E0E A;  2HDW A;  2QEX I;  5F0F A;  1TQM A;  2R7X A;  1IDY A;  3OYM A;  4FTH A;  2F2E A;  4XR6 A;  1Q1H A;  5JVG F;  1GHC A;  2TDX A;  1XCV A;  4OIP F;  1J9I A;  1XSX A;  1VQ9 I;  2DA3 A;  3S1M J;  1K83 J;  1DP3 A;  3DKY A;  4CDG A;  4DYR A;  1UB9 A;  1XX5 A;  4HW0 A;  2FNP A;  4XSX F;  4A3B J;  2O0Y A;  4RM2 A;  2V26 A;  2PBI A;  1IV8 A;  2YUS A;  5DV5 A;  3M07 A;  4XBF A;  4AU7 A;  3J7Y J;  1ZLK A;  5FJ8 J;  2QF7 A;  2HYG D;  4HST A;  3MQ0 A;  3V8K A;  2XPW A;  2Q2E B;  4XLE A;  3BDD A;  1BR2 A;  2BOL A;  1ETV A;  3W2W A;  3EUH C;  2Y9Z A;  1TNS A;  3SEZ A;  1CF7 A;  3I0T A;  2CV2 A;  1O57 A;  1XGM A;  4YRV A;  4CYD A;  1UG0 A;  1RZ4 A;  3T8R A;  5L3B A;  4G8X A;  5E18 F;  2Y2Z A;  3A1Y A;  2Y0S N;  2OCE A;  5K5Q A;  1B72 A;  4AD9 A;  1Z0X A;  2BVL A;  4IHS A;  4LK0 F;  1J5Y A;  2EA2 A;  2KP6 A;  1K6Y A;  3X2Q H;  1S7A A;  3V7C A;  2IT0 A;  2HOA A;  1O3S A;  5EEG A;  4CSW A;  2NS8 A;  5LD2 C;  1WZ2 A;  5J1Y A;  2W4S A;  5JR3 A;  5DEQ A;  2F48 A;  3CCS I;  2V1X A;  3JRC A;  1TTY A;  2KJB A;  4D7M A;  1UJ8 A;  4IKF A;  1KYZ A;  2STW A;  1HDP A;  4PGG A;  1U8B A;  3VPR A;  3FMQ A;  1ZRC A;  2HOE A;  2IRF G;  4EGY A;  4V19 K;  4M6X A;  1ZTR A;  2M34 A;  2L0K A;  2LOO A;  2FMY A;  1HKT A;  3SHF A;  5LBQ A;  3EUK L;  3CCV I;  3OY9 A;  2ZME C;  4RAZ A;  1JHH A;  1QHH D;  5EEA A;  3CCE I;  4CCM A;  2KJC A;  3OV8 A;  2R7S A;  1FLI A;  2MA3 A;  2HQ5 A;  4XKB A;  2CUF A;  4GCV A;  3HDD A;  5FRM A;  5ILV A;  4IOC F;  2P6T A;  3K4K A;  1V5F A;  2ZNZ A;  1VQ4 I;  2V6C A;  1IJW C;  2X6Y A;  1NH3 A;  3RDI A;  4CCO A;  1IRX A;  5M3M J;  2DA7 A;  3HBL A;  1SFO J;  5AIP A;  3GW2 A;  3UKG A;  2L2O A;  4R79 A;  5KHD A;  1VND A;  3OYJ A;  2IGK A;  4F52 A;  1JTY A;  3CUQ B;  1K61 A;  2NAZ A;  2PG4 A;  3TOB A;  4NQW A;  2NNY A;  2LY1 A;  4BDY A;  1BW5 A;  4IF4 A;  3FXQ A;  4BHP A;  2B0L A;  2CUE A;  2E1N A;  3CLO A;  4BXU A;  1UAA A;  2P5L C;  3Q3S A;  1ACI A;  1MBF A;  2VQH A;  5BS6 A;  5F27 A;  1ETW A;  5LEK A;  4ZTF A;  3DTI A;  1UHM A;  2DI3 A;  4MO7 A;  2R7Z J;  2LC2 A;  4M72 A;  4B48 A;  1MKM A;  4FIS A;  2UV1 A;  4UHT A;  3W2V A;  3ZQ7 A;  4U7D A;  2WAE A;  3FXK A;  2V1D A;  3KEQ A;  5JLW A;  2R5Z B;  4WF2 A;  4BEH B;  5E3M A;  3VYU B;  4L18 B;  2LKX A;  3V4G A;  2GA2 A;  3ZPL A;  2VPR A;  4UB8 C;  1IN7 A;  2TCT A;  1P92 A;  5CQE A;  3OYL A;  2XRO A;  2DJI A;  3FMR A;  3PSI A;  1V55 H;  2FA5 A;  4H4K C;  3QPT A;  1ZEL A;  3L2Q A;  4D7N A;  2L7K A;  2F6C A;  3BPV A;  3VYS B;  4UUT A;  4QIW N;  1IW7 F;  1LE8 B;  2BE5 F;  4R1H A;  1XSV A;  4GRI A;  1KU3 A;  1Z6T A;  2OQR A;  2DOF A;  5ERI A;  3VFZ A;  5HNF A;  3DQV C;  4LJZ F;  3JTH A;  3HOT A;  1ZGW A;  3JRI A;  1A35 A;  1IZ1 A;  1SMY F;  4M3B A;  3BZ6 A;  1B4A A;  2K40 A;  3JCU C;  4ZH4 F;  4PJ0 C;  5F08 A;  2P6S A;  3PSF A;  2M7A A;  1VQL I;  2GQQ A;  2ECC A;  3KP7 A;  2IS2 A;  3KP5 A;  5E1W A;  2IEK A;  3LSK A;  2IP2 A;  1P9Q C;  4F91 B;  3LA3 A;  1IRG A;  1OCO H;  4GO1 A;  1S7E A;  3C3W A;  3BWG A;  2JPC A;  2MD5 A;  3IAM 2;  2VPL A;  2CW7 A;  2QQB A;  3SFZ A;  3AAF A;  2O61 A;  1TT5 B;  1BI3 A;  3PFI A;  3BY6 A;  1PUF A;  1S5L C;  3JAM Z;  3BR1 A;  1BA5 A;  4BNC A;  2E1M C;  1O3Q A;  2FRH A;  2XAH A;  4X0G A;  2GZW A;  1KYW A;  2E2I J;  3E6B A;  3HGG A;  3BCA A;  3GUD A;  3MWM A;  1HW2 A;  5CJ9 A;  2JSC A;  1ZQ3 P;  2IS1 A;  4FE7 A;  2CJJ A;  1KQ8 A;  4BXX J;  1Z3Y A;  2JPB A;  1OCT C;  3GXO A;  2A6T A;  3MKZ A;  1ZG1 A;  2EIM H;  1NG6 A;  4A3M J;  3CCY A;  4HSR A;  1ONV A;  4FAS D;  4A3K J;  4XN0 A;  4M3F A;  3ZMV A;  3KLO A;  2MSY A;  2XSJ C;  2X48 A;  2E5N A;  3HTU A;  4OAY A;  2CO5 A;  2PMZ N;  2Y9Y A;  3FM3 A;  3I55 I;  2ZSH B;  3P5J A;  4RB0 A;  1EA3 A;  2QKM B;  3OYG A;  5IY5 H;  4BE1 A;  3IWF A;  3GTO J;  3WGG A;  3RZD J;  3GO5 A;  3OSG A;  1F43 A;  1D0X A;  2QSG X;  1J0R A;  2HOS A;  4HF0 A;  4Y13 A;  2QWW A;  4MLO A;  2DJN A;  2LF8 A;  4EAT A;  3ABM H;  2QM3 A;  2RKH A;  1C0W A;  1QO0 D;  1G4D A;  1T0F A;  1LB2 A;  1JKO C;  4A3D J;  1ULY A;  1PDN C;  3ZMZ A;  1MSF C;  4DZJ A;  2CMP A;  3FWE A;  1BI2 A;  2LF7 A;  2M0M A;  3LSG A;  2DU9 A;  3LAJ A;  1ETY A;  2JVG A;  3FXO A;  2EB7 A;  2XGC A;  3GZN B;  2K86 A;  4G7Z F;  3I56 I;  2E2J J;  4HOB A;  2CWE A;  2YX7 A;  5CPR B;  2G7U A;  1H9T A;  1ITY A;  3LMM A;  2O5R A;  5EJC A;  3KYL A;  4L9N A;  2DBB A;  3F6V A;  5HLT A;  2K7L A;  5A2Q K;  3D5R C;  3BR2 A;  4O5V A;  2LR8 A;  4MTD A;  2AHQ A;  3SJM A;  1VI0 A;  4K2E A;  1REP C;  4KA4 A;  2FBI A;  4L9T A;  1I3A A;  2MH2 A;  3DPU A;  1ZGJ A;  3HOV J;  3OS2 A;  2F4O B;  4JOM A;  5E79 C;  2ZB9 A;  5GPC A;  4ENK A;  4LLG F;  2R7V A;  2LKP A;  2XF7 A;  2I5U A;  1N78 A;  1FBQ A;  5IYC J;  2RNJ A;  1RI7 A;  1VQ7 I;  1QVU A;  2BVM A;  3FBI B;  1TW3 A;  4DGW B;  1HSJ A;  3C18 A;  1BM9 A;  3L1P A;  3FDY A;  3HKZ A;  1J75 A;  5A2Q Z;  4A3I J;  1V5G A;  2DA2 A;  1WJD A;  3RKX A;  2D1V A;  2L7M P;  2M2E A;  2MH9 A;  1TWA J;  1D1A A;  2FX0 A;  3V7R A;  4C2T A;  2STT A;  2A07 F;  2M0C A;  5E3O A;  2ZBK A;  2C6Y A;  3NQO A;  1KU7 A;  3SZG A;  5CVI A;  4RGS A;  2RAE A;  1T39 A;  3GTK J;  1QGP A;  2HI3 A;  1IN6 A;  1R5H A;  1KQ0 A;  3QYF A;  3QP5 A;  3TO9 A;  1QU3 A;  1HQC A;  2RVC A;  5KCM A;  4WXD A;  3H9Q A;  4FQG A;  3CCM I;  4D1Q A;  4ZTJ A;  1X4O A;  1ZRE A;  4Y4R A;  2XC7 A;  1TP4 A;  4DQ2 A;  3L00 A;  2GIZ A;  4ANJ A;  3E6C C;  1XN7 A;  3LSH A;  3A01 B;  5FLV A;  2OD5 A;  4KN7 X;  3HHG A;  4GYI A;  3WG9 A;  1ODD A;  4HEA 2;  2RRE A;  2DXI A;  3Q9S A;  1ZH5 A;  3QYE A;  3HJE A;  2K3P A;  3BT9 A;  3M8F A;  3RQI A;  2QSH X;  1BIA A;  1UZC A;  2XF6 A;  1JUM A;  4IQ4 A;  2H8R A;  5D4R A;  1F5T A;  3LSJ A;  4QSH A;  2BY3 A;  2W85 A;  3GEZ A;  2MD0 A;  4XSZ F;  1TQI A;  1S72 I;  4KNY A;  4A5N A;  2ZNY A;  2KDO A;  1FIP A;  2EZK A;  4PJM A;  2A3S A;  1U9N A;  5TIS C;  2D45 A;  2JSP A;  3RIR A;  3F6O A;  1W7P B;  4C30 A;  2GBY A;  2LP0 A;  1SC7 A;  3DEW A;  1RES A;  1ZG3 A;  2K85 A;  4NB5 A;  3ZOB A;  1HKS A;  1A04 A;  3BG3 A;  2H6B A;  4RLF A;  3VSL A;  5D4S A;  2XF5 A;  1GV2 A;  1MBJ A;  1ZLJ A;  2VBZ A;  2E1C A;  5D8K B;  3L2C A;  3GLL A;  1YRN A;  2MW8 A;  1K78 A;  4RLQ A;  3F8M A;  2L9S A;  1YJ9 I;  5KAF C;  3CZ6 A;  5KVR A;  2V79 A;  1GT0 C;  2J5O A;  1KZH A;  3SYT A;  3OYD A;  1WPK A;  1K6O A;  4KYW A;  3SZP A;  1YTY A;  2Z3Y A;  1EV7 A;  2B63 J;  5J8C A;  1NG7 A;  2BZT A;  2K27 A;  1U3E M;  4HF1 A;  1AHD P;  4AVP A;  4C2U A;  5KK1 A;  3J7Z I;  2YU3 A;  5IP6 A;  1W4M A;  1VQN I;  2DFE A;  3QP6 A;  4J01 A;  2XIG A;  5E3L A;  2HKX A;  2KPM A;  3LL7 A;  2EJR A;  2IGN A;  3BJ6 A;  4BU2 A;  4ESJ A;  4P1W A;  1R7J A;  3FKI J;  2VKV A;  1FIA A;  4IPA A;  1H0M A;  1DPU A;  2Z9O A;  1UHS A;  2ZFW A;  1UHW A;  4KT6 A;  2QQ9 A;  2Q1Z B;  1SFX A;  1HDD C;  5H2F C;  4ZYG A;  5HLI A;  3ABK H;  2M87 A;  3G71 I;  4UVC A;  4PFO A;  3IWZ A;  2K9Q A;  3TMO A;  1R6R A;  1CF7 B;  1P6R A;  1YS6 A;  2VQG A;  1R9T J;  4PJJ A;  3IRQ A;  2KIU A;  3PUF A;  1Z3X A;  3J7A O;  3CP2 A;  3TDZ C;  5L3E A;  3V8J A;  2E2H J;  4E7S A;  5L3F A;  5M5Y J;  2YSR A;  2ACJ A;  2P4W A;  3K4L A;  3JRF A;  2JA8 J;  1R1U A;  4EM1 A;  3H5A A;  3KZZ A;  1GV5 A;  3GLX A;  1B72 B;  2BXZ A;  1FOK A;  3LFU A;  2R7U A;  2BGC A;  1RUN A;  1HOM A;  2H09 A;  1QRY A;  3D1N I;  4JX5 A;  4I0B A;  1P7J A;  2BXY A;  5ED4 A;  4BY1 J;  5AIQ A;  1JKR C;  3PQJ A;  1MDM A;  3I4M J;  3V7S A;  5D5X B;  4J00 A;  3FXM A;  3OOP A;  4B47 A;  5C44 J;  4EMS A;  2W57 A;  1D8J A;  2DMQ A;  2FXA A;  3E1S A;  2BV6 A;  3WOD F;  1XD7 A;  3BTC A;  4L9V A;  2GOM A;  3IHU A;  3ZMD A;  1P4W A;  3VYT B;  4DBQ A;  3WHC A;  5F1R A;  5FKM A;  1Y56 A;  5DCF A;  3LOC A;  3HTS B;  4BAY A;  4S04 A;  2MYS A;  2DOD A;  2VOO A;  1HW1 A;  1IUF A;  2R5Y A;  4XKC A;  1W5C C;  4XLH A;  4XLF A;  5LFA A;  1A6Q A;  2CU7 A;  3VOE A;  3ZR8 X;  5FB2 A;  1R5G A;  2AXT C;  3EYY A;  3ZP5 A;  3K4N A;  4D0P A;  4W1U A;  2OF7 A;  2LSO A;  1JXS A;  1F36 A;  4E4H A;  3O8H A;  1GLN A;  4I6Z A;  3A03 A;  2QLZ A;  4Q47 A;  4XRF A;  5K1Y A;  4CHU A;  4IHW A;  2V9P A;  3ASN H;  1YHQ I;  5FKO A;  4JP0 A;  1YX3 A;  1Z77 A;  3JTG A;  4W97 A;  3LSM A;  2A5Y B;  1T95 A;  3ZXS A;  4NQW B;  1PYV A;  4OWR B;  1D1B A;  1NTC A;  1V5E A;  2K9S A;  4D5C A;  5LGN A;  3HOS A;  1JE8 A;  2XAU A;  4P96 A;  1QPI A;  1SEU A;  3L2W A;  2O8X A;  1EJ9 A;  1MBG A;  4KIC A;  3HOY J;  4DJA A;  3K70 C;  4YEL A;  4A12 A;  5FD6 A;  2OTL I;  4HNU A;  3KZI C;  3K1P A;  4D5F A;  3WG7 H;  4ZYD A;  1KGS A;  4RB1 A;  3I5U A;  1LDK B;  2Z33 A;  1I1G A;  1FOY A;  2N8G A;  3ABL H;  5GPA A;  1RUO A;  2W84 A;  2XRL A;  2E36 A;  4EGZ A;  4LLL A;  2K4B A;  1B1B A;  1U5T A;  2EIK H;  1S3J A;  2ZJ2 A;  5LRR A;  3VDX A;  2PLY A;  1UFM A;  4CYC A;  2B7E A;  2ID3 A;  2GLO A;  2CRG A;  4I98 B;  4G7H F;  4FHT A;  5J6X A;  1T98 A;  1L0O C;  3ZMS A;  2KHM A;  1IXS B;  1OYI A;  4LIU A;  1JI8 A;  2L4M A;  1TWH J;  3S3O A;  1Y39 A;  1I6H J;  4NDL A;  4S0H B;  3ROU A;  2FD5 A;  2ZO4 A;  4YFX F;  3H0D A;  4M6Y A;  2PMH A;  2DTR A;  3AFH A;  3F0C A;  3E6D A;  4RS8 A;  4RB3 C;  4ASN A;  2E34 A;  1PUF B;  3TO6 A;  9ANT A;  3V42 A;  1W5S A;  3M9A A;  2UXN A;  4L9J A;  3HM5 A;  3DBH B;  5EEH A;  1UG2 A;  1SVO A;  3LST A;  2F5D A;  4ENN A;  2W00 A;  3CLQ A;  2M4K A;  2MC4 A;  4N0B A;  1IRZ A;  1IO2 A;  1O3T A;  3CC7 I;  2PEX A;  1VQO I;  3HC7 A;  1I50 J;  5TGT A;  2MAB A;  2ICW G;  3UNG C;  5FRN A;  3DV8 A;  4XM3 A;  4ZDO A;  4PDK A;  5AON A;  1O7L A;  3OYB A;  2VBX A;  5EYR A;  5F0H A;  1CGP A;  2MLK A;  3S3M A;  2V7F A;  2KKO A;  2R7W A;  4U87 A;  2COM A;  2JK3 A;  4C2M J;  4IRH A;  1W1W E;  3TO7 A;  3JRG A;  1OYY A;  2CQQ A;  4HNT A;  3WTU C;  1IN4 A;  2GA1 A;  3E6M A;  5IOZ A;  4IRI A;  3BOQ A;  1WJB A;  3CUQ C;  4KN4 X;  3ZQF A;  2OZ6 A;  1EH7 A;  1QBJ A;  2VBW A;  1SAU A;  3OOU A;  4A0Y A;  1IC8 A;  3G6E I;  1JKQ C;  4O3M A;  5J8F A;  3HIF A;  4M3E A;  4IO9 F;  4R8H A;  3SEQ A;  5BPD A;  3OL4 A;  3S32 A;  5K5O A;  2HVQ A;  2K9N A;  1BC7 C;  1Y8R B;  2HR3 A;  4FET A;  5E20 A;  5DTD A;  4BQO A;  5B66 C;  2G7H A;  2Z5U A;  2RDP A;  4FT8 A;  4MGR A;  4BHB A;  3ZQG A;  1G3Y A;  4ESF A;  2WY8 Q;  4BAC A;  2EQR A;  1WI9 A;  1R00 A;  2L7F P;  4EJV A;  3CO7 C;  3MZH A;  1YFH A;  1QZE A;  1U2W A;  3A02 A;  2JJ7 A;  3ZN1 A;  3H36 A;  1OPC A;  4II2 A;  2H27 A;  4GYG A;  4AIJ A;  2F5V A;  5DDG A;  3BTI A;  4XLA A;  3K0L A;  1GXQ A;  1V3F A;  1VZ0 A;  3QYB A;  2CGP A;  2TRT A;  3QOE A;  4CA0 A;  4M3G A;  5HS9 A;  1MH3 A;  4L0Z B;  1IXC A;  3ULQ B;  1TWC J;  2OC6 A;  2UXX A;  3KP2 A;  3QWL A;  2ISZ A;  2HKO A;  2LRD A;  1A31 A;  4IHX A;  5E1Z B;  3KPH A;  3KZY A;  3N05 A;  2JWT A;  4MNU A;  3MVP A;  3WTW C;  5DM7 F;  1NK2 P;  1DP7 P;  1D0Z A;  3HG9 A;  5EDN A;  2NVQ J;  3ZQC A;  2FU4 A;  3NWT A;  2L9R A;  4A3G J;  3K1M A;  1FMV A;  4GFB A;  2P5K A;  2EZH A;  3HRM A;  3CCL I;  3CC2 I;  4ZYA A;  1U9O A;  1YS7 A;  4H0E A;  3DP7 A;  3GVA A;  5C3E J;  5HOO A;  2JVH A;  2NVX J;  1ZKG A;  5HDN A;  2Y0M A;  3D5L A;  4MFD A;  1AWC A;  2ZXW H;  4KJZ A;  2JRM A;  3FIS A;  4RB2 C;  3KX2 A;  2LK2 A;  3E97 A;  1V54 H;  2RQQ A;  2R7F A;  3HYI A;  4HX8 A;  3OR2 C;  2MFZ A;  1H9G A;  4WK8 F;  2EFW A;  5FD5 A;  1MMG A;  3NAU A;  5FGM A;  3CTA A;  1W36 D;  3P9C A;  1BL0 A;  1I27 A;  2HVR A;  4C3J J;  1B9N A;  2L7Z A;  2HGC A;  1AU7 A;  3M1E A;  3LQR A;  2VN2 A;  4OIN F;  4HX4 A;  2XKO A;  2KMU A;  2OUM A;  1VQM I;  1LVK A;  3K4C A;  3F3X A;  1O3R A;  3FX3 A;  1H89 C;  1SAX A;  2JQ7 A;  4HDV A;  2KQR A;  3CCQ I;  1IV6 A;  2QA4 I;  3OWT A;  2QEN A;  2V4J C;  4HLY A;  3A0B C;  3CP8 A;  3QU6 A;  4ENJ A;  1R4M B;  2VE8 A;  1N25 A;  2D1H A;  2VJJ A;  3DBR B;  2HOT A;  3TBI A;  3JAM K;  2VAS A;  1ETO A;  2M45 A;  4CZZ A;  1VQP I;  1OQY A;  1STZ A;  3K4J A;  2WTE A;  1Y1V J;  4ITV A;  3FK7 A;  4HPQ A;  4CO8 A;  2VON A;  2FML A;  3S3N A;  3FXJ A;  1HXD A;  3PNV A;  4QWQ A;  4RA2 A;  1ON1 A;  3J7A Y;  2GXA A;  5LGU A;  1IN8 A;  4B1R A;  3SFI A;  4XN3 A;  1RR8 C;  5J47 A;  3BG5 A;  2YS9 A;  2LY9 A;  2HEO A;  1YIT I;  1YRN B;  5J3L A;  1OYW A;  5FLX K;  2F5C A;  1USS A;  4NC6 A;  1K78 B;  5EZG A;  5BOX A;  2FQ3 A;  1YO5 C;  2M7B A;  3MKL A;  5GTH C;  3KP4 A;  1OMI A;  4WCG A;  3WTT C;  5FFZ A;  1GXP A;  4YEJ A;  2FE3 A;  2VC0 A;  1FJL A;  2CYY A;  3WTX C;  1FT9 A;  2JZY A;  4C3H J;  3K2Z A;  3CQZ J;  2RGV A;  2ADU A;  3VEP A;  1H8A C;  1OIS A;  1YIJ I;  3WE3 A;  3CDH A;  2CV0 A;  4ON0 A;  2XSD C;  2X85 A;  4Y15 A;  1Y1W J;  2VJ5 A;  3OYF A;  4UB6 C;  3TW6 A;  5LHH A;  2WAF A;  2X1E A;  3PNT A;  4OAZ A;  5FLX Z;  3VSK A;  1TLH B;  1WJ5 A;  1R1T A;  2A6E F;  2R3S A;  5IOY A;  4BJ6 C;  2BY1 A;  5CQG A;  2NXN B;  5J1R A;  3MCZ A;  3OYC A;  2O6G E;  4YFN F;  1TWG J;  3I71 A;  4ZYH A;  3CCR I;  1DUX C;  4AIK A;  5D5U B;  1SFK A;  2VI6 A;  3S14 J;  3GZ6 A;  4PSW A;  2ZC2 A;  4A3L J;  3HHH A;  2CS3 A;  1OJL A;  4M6V A;  1OKR A;  1WH7 A;  5B1B H;  4AC0 A;  4IRG A;  2NNN A;  3T1B A;  5DCM A;  4CUG A;  5JI6 A;  2FQ4 A;  2DDA A;  4EQQ A;  3WGI A;  2WAQ A;  3SQN A;  4KMF A;  4AIH A;  1FZP B;  2LMD A;  3I4P A;  4CCN A;  1H88 C;  2EFP A;  2VL8 A;  1RC9 A;  2HVS A;  2ME0 A;  4N9H A;  4XQF A;  4LGW A;  2EBI A;  5FKN A;  3R0J A;  2W25 A;  3P9I A;  3C2G A;  1BR1 A;  2H1L A;  3UR3 C;  2LKS A;  4NNJ A;  3PO3 J;  3KFW X;  1IF1 A;  3HKZ N;  5ILS A;  2ECB A;  4KIS A;  1JUP A;  1MDM B;  2ID6 A;  3I54 A;  2LRE A;  3RYR A;  2Y30 A;  4HF2 A;  3S2H J;  1MBH A;  1AKH A;  2CV1 A;  2HZD A;  3M8E A;  1Z9C A;  4Y3O A;  4HV5 A;  2DAO A;  2DDB A;  3FXR A;  2X1D A;  4UV9 A;  4RM3 A;  2ZXI A;  2E60 A;  2XUB A;  2R7D A;  4UVB A;  2K3F A;  2EIN H;  2X0L A;  2R5Y B;  2VKE A;  2NVT J;  3KLN A;  5JFR A;  2OTJ I;  3CMA I;  1ORK A;  2FOK A;  3G73 A;  3CJQ B;  4TV7 A;  1FSE A;  5JLX A;  4HRI A;  1P2F A;  4XK4 A;  3RCO A;  2MG4 A;  4EJU A;  5JHF A;  3MFK A;  4B3A A;  3LSP A;  1XSD A;  1X19 A;  4BKX A;  2JA6 J;  4A2U A;  3O6B B;  3MMY B;  1PUE E;  1G8X A;  2WBM A;  1LFU P;  2DA1 A;  3EQL F;  3IP4 B;  4NC7 A;  4CCK A;  4JX6 A;  4MQV A;  5LEJ A;  1WJE A;  1W0T A;  3K69 A;  3ERM A;  2VQL A;  3W6K B;  3FM5 A;  4CXF A;  2ESH A;  2CSO A;  4BL0 B;  2A61 A;  5EGO A;  5FKL A;  4KIF A;  3EUH A;  2H94 A;  4P55 A;  2LD5 A;  2ZXH A;  1EKE A;  3DEU A;  2WV0 A;  3OYH A;  4OU0 A;  4RAY A;  1YYV A;  2O7O A;  4RDU A;  2OBP A;  1SFU A;  3PIO F;  1SMT A;  2DOE A;  2OJE D;  2L4A A;  1G6N A;  4G94 A;  3TKY A;  4M9X A;  4IVN A;  4XMY A;  3AG1 H;  4DOZ A;  2GIV A;  5E1X A;  4L5I A;  3GYH X;  1FTT A;  3A4C A;  4U0Y A;  1R36 A;  1APL C;  3CDI A;  2DFI A;  3FBN B;  2R4G A;  5D6F A;  1ENH A;  2KL4 A;  1E3P A;  5J4V A;  2EZL A;  2LVS A;  2I8D A;  1VQK I;  3I4N J;  4AM3 A;  4PZJ A;  3EUA A;  3I53 A;  4XOP A;  2ZJP F;  3REO A;  3GTP J;  3C2H A;  1R49 A;  4ABZ A;  3OYK A;  3OIQ A;  2HXO A;  3S17 J;  2Q8K A;  2G0E A;  1A5J A;  2L01 A;  4RGU A;  2QQ8 A;  3F23 A;  3ML6 A;  4FX0 A;  1W0U A;  3CC4 I;  4MIM A;  1FYK A;  1K4S A;  3MN2 A;  1U5T B;  3K2A A;  4XRS G;  1DU0 A;  3HOW J;  3V8L A;  4I99 C;  4CYC B;  1XMX A;  2A5W A;  2PFB A;  2ZME A;  3P9K A;  2P81 A;  3HUG A;  2CW0 F;  3H9J A;  1LFB A;  3Q9V A;  4EEF G;  3JRA A;  2F4I A;  2COB A;  4ZDL A;  3EET A;  2O9L A;  5KAI C;  2E19 A;  4A6D A;  1AOY A;  3BR3 A;  1WJC A;  3GX4 X;  2P5V A;  5ICE A;  2M4G A;  2GAU A;  5TRD A;  2V9K A;  3OL3 A;  3G4S I;  2QZ8 A;  4KUM A;  3FXU A;  2HQA A;  2OPT A;  1J09 A;  4NHJ A;  4I02 A;  4U0W A;  4ZC3 A;  4PJL A;  3O2P E;  2YU9 J;  4OIO F;  4PCQ A;  2K4J A;  1FY7 A;  5BQT A;  3WU0 A;  1ERD A;  3CJT B;  1P7I A;  4IEJ A;  2ZXJ A;  4YII A;  4BBS J;  3NAR A;  3E3V A;  3PFY A;  1KU9 A;  3HSE A;  3F9K A;  4PFP A;  1IRF A;  1QZY A;  3SDB A;  3QPS A;  1Z21 A;  2EV0 A;  1XTA A;  1IAW A;  5HVQ C;  2HZT A;  4RGX A;  3ISP A;  3SDG A;  2BY0 A;  2CQK A;  5DM6 F;  3AKZ A;  2XAF A;  4RAG A;  4LMY A;  3IKV A;  2JRT A;  2X4H A;  4JYK A;  4BBR J;  4X6A J;  2FOW A;  1X2N A;  2FUG 2;  1LJ9 A;  2ZKZ A;  3Q0W A;  5GAH J;  2BHZ A;  1TC3 C;  2PJP A;  1B6A A;  1FP2 A;  2L02 A;  3DKW A;  1UCR A;  3KEO A;  3COA C;  4FX4 A;  4LB6 B;  2CUJ A;  2IA1 A;  3HSR A;  1SD6 A;  3ZCO A;  2BW3 A;  4AYB A;  5B1A H;  4PUS A;  2DPU A;  2GM4 A;  4AUX A;  2PJR A;  4PSX A;  4XON A;  3LWF A;  5LGT A;  5FKK A;  1IDZ A;  3BTL A;  2NOJ B;  4A6E A;  2XB5 A;  3BQY A;  5EG0 A;  4IZZ A;  1OCR H;  3BZK A;  4WXC A;  5HNH A;  1UEL B;  3VYR B;  4P9U A;  4I01 A;  2OAZ A;  5M3F J;  4JBA A;  3S2W A;  3KE2 A;  4E7H A;  3MKY B;  3ERE D;  1JT0 A;  3IUO A;  2KIQ A;  3PNY A;  2VKD A;  3DU6 A;  1XMK A;  2DLL A;  3KIO A;  5E8I A;  4KIB A;  2KRC A;  2VJI A;  1RIO H;  3TQN A;  3GFJ A;  3FMS A;  1MIJ A;  1MW7 A;  1FMW A;  3I3L A;  4N4N B;  1VQ5 I;  2E5Z A;  2PI0 A;  1VFC A;  1LNW A;  3MZY A;  3R0A A;  3K6G A; 
#chains in the Genus database with same CATH homology
 3DQV C;  2HPI A;  3HOT A;  4II3 A;  4E7Z A;  3W2A A;  3RPU D;  1HA8 A;  1D1C A;  3S3M A;  3PSF A;  2V7F A;  2R7W A;  2M7A A;  4U87 A;  2IS2 A;  3OYE A;  3LSK A;  4HNT A;  1P9Q C;  3HL2 A;  4F91 B;  4IQJ A;  3A2K A;  3S93 A;  3IAM 2;  2KLO A;  2DCE A;  1WJB A;  2VPL A;  2CW7 A;  2RNG A;  4ZDP A;  4B44 A;  1SAU A;  3ONQ A;  3OOU A;  4P5O A;  3E0J B;  2L5Q A;  3HXL A;  4BEH A;  3SEQ A;  3OL4 A;  3S32 A;  1OR7 C;  2HVQ A;  2E1M C;  4X0G A;  4FET A;  1YX5 A;  2Z1D A;  4BQO A;  2QKL B;  3BCA A;  3QOD A;  2X6X A;  1LFP A;  2IS1 A;  2WY8 Q;  4BQN A;  4BAC A;  1Z3Y A;  2A6T A;  3MKZ A;  1G59 A;  1NG6 A;  3L2V A;  3EPZ A;  4HSR A;  4FAS D;  4XN0 A;  2VIX A;  2XSJ C;  4II2 A;  2E5N A;  2LG4 A;  4OAY A;  2F5V A;  4XLA A;  1VZ0 A;  2ZSH B;  3QYB A;  3AL0 B;  2KRH A;  4PJN A;  2HPM A;  1EA3 A;  2QKM B;  3QOE A;  3DU5 A;  3OYG A;  1PJR A;  1MND A;  4LG3 A;  4XKW A;  4CA0 A;  4BE1 A;  1MMD A;  2OC6 A;  4E7I A;  2LYC A;  2LRD A;  2IS6 A;  1D0X A;  2X6W A;  1AA7 A;  3DLA A;  3N05 A;  3NWS A;  2IS4 A;  2JA2 A;  4MLO A;  3DTK A;  4EAT A;  1D0Z A;  3HG9 A;  3BG6 A;  2R7R A;  4BXF A;  4XL9 A;  3NWT A;  3K10 A;  1FMV A;  4BDZ A;  2UUZ A;  2CMP A;  2R7T A;  1BOB A;  1U0J A;  2M0M A;  3LSG A;  2AQF A;  3OS0 A;  4ZYA A;  3BLY A;  5HOO A;  2JVH A;  4N4O B;  2JVG A;  3D5L A;  4KJZ A;  4RMN A;  2L9N A;  3ZRG A;  3KX2 A;  2JUG A;  2IGO A;  2ZFU A;  1T0F C;  5CPR B;  4CCL A;  4U7B A;  3LMM A;  2O5R A;  2RQQ A;  4BE2 A;  3KYL A;  3OR2 C;  2MFZ A;  4BGD A;  5HLT A;  1MMG A;  2CUZ A;  3D5R C;  2X1C A;  1W36 D;  3LSI A;  2HVR A;  1MNE A;  3DTE A;  3DPU A;  3OS2 A;  2P0W A;  4JOM A;  2R7V A;  2KMU A;  2OUM A;  2HNH A;  4B3X A;  1LVK A;  3K4C A;  1X1A A;  2XF7 A;  1N78 A;  2KQR A;  2K9M A;  3OWT A;  4E7K A;  2BVM A;  3RTR A;  3FBI B;  2V4J C;  4DGW B;  3OYN A;  3CP8 A;  3FDY A;  3HKZ A;  1V5G A;  2VJJ A;  1WJD A;  2DOA A;  4C9Y A;  3TBI A;  2VAS A;  2X51 A;  3H9G A;  1D1A A;  2VQC A;  4C2T A;  3FKJ A;  4IX7 A;  4BE0 A;  3H5R A;  3K4J A;  4ITV A;  1W36 C;  4HPQ A;  3SZG A;  4ZJZ A;  3TL4 X;  2CW8 A;  4NC8 A;  4JQF A;  4DIQ A;  3S3N A;  3PNV A;  4XOT A;  3J7A Y;  3CF2 A;  3K4B A;  4XN3 A;  4BQQ A;  2W1O A;  3QYF A;  4LIT A;  1QU3 A;  5KCM A;  1TZL A;  2OV7 A;  3H9Q A;  2AQE A;  4D1Q A;  1Z7L A;  4ZTJ A;  1N77 A;  1X4O A;  4Y4R A;  2XC7 A;  3OYI A;  2M7B A;  2VXZ A;  2Z16 A;  4ANJ A;  2LBF B;  3LSH A;  4LIV A;  4G6T B;  4XNF A;  3MD2 A;  1X1C A;  4YEJ A;  4F3Q A;  2DXI A;  4QPQ A;  4HEA 2;  2RRE A;  4F93 B;  3K4M A;  4F55 A;  3QYE A;  2K3P A;  3CMM A;  2CV0 A;  2XF6 A;  2X85 A;  3PUB A;  4IQ4 A;  3H35 A;  2VJ5 A;  3OYF A;  2WAF A;  2X1E A;  3PNT A;  4OAZ A;  4F92 B;  3VSK A;  1WJ5 A;  2MD0 A;  2VJ4 A;  4BJ6 C;  2K5C A;  3OYA A;  2KDO A;  3BCB A;  2HU9 A;  5CQG A;  3OYC A;  4PJM A;  3OIP A;  2JSP A;  1X1D A;  2WA0 A;  4C30 A;  2W7N A;  1SFK A;  5CKT A;  4PSW A;  4E7L A;  2CS3 A;  4RLF A;  2ELJ A;  3VSL A;  4BUP A;  4XKV A;  2XF5 A;  4B43 A;  4CUG A;  2UWM A;  3IAS 2;  3VWB A;  2DT7 B;  3DKX A;  2WAQ A;  2VLA A;  4BJ5 C;  2GOX B;  1X1B A;  3OS1 A;  2R7Q A;  4RLQ A;  4CCN A;  2VL8 A;  1DQU A;  2L9S A;  2LY2 A;  3L2R A;  2WY7 Q;  4Y33 A;  2HVS A;  4HG2 A;  2LBF A;  3CZ6 A;  3PL8 A;  4XQF A;  3S8P A;  3SYT A;  3OYD A;  1OLT A;  1D0Y A;  2Y0S A;  2KZV A;  4D9J A;  3C2G A;  1BR1 A;  4QPO A;  3UR3 C;  1NG7 A;  4NNJ A;  3CES A;  1BR4 A;  3PJR A;  3I9V 2;  2K9L A;  4KIS A;  1QHG A;  4C2U A;  2LRE A;  1DGR M;  1WFX A;  4J01 A;  3M8J A;  3ZQQ A;  2KPM A;  3LL7 A;  2IGN A;  4XOR A;  2HZD A;  4BU2 A;  2CV1 A;  4P1W A;  4Y3O A;  2IGM A;  3M1C A;  4CCJ A;  2WB1 A;  3HPH A;  2X1D A;  3DPL C;  4KT6 A;  2IXS A;  1Y6I A;  2ZXI A;  4RM3 A;  4KIT B;  2E60 A;  2V6E A;  2Q1Z B;  1WJF A;  2CFO A;  2XDV A;  3D5S C;  4PFO A;  3FHN A;  3W3C A;  4AVZ A;  3TMO A;  4BJT A;  1R6R A;  1LKX A;  1N75 A;  3MKW B;  2VQG A;  4PJJ A;  1Z3X A;  3HPG A;  3CJQ B;  3CJR B;  4HRI A;  4CZC A;  3CP2 A;  3RCO A;  3OMY A;  4E7S A;  5JHF A;  1X19 A;  2W82 A;  3K4L A;  3H5A A;  2R7U A;  2ZSI B;  3LFU A;  1G8X A;  2WBM A;  1MMA A;  3DPT A;  3MMY B;  4CCK A;  3IP4 B;  2WAD A;  4NC7 A;  1E0E A;  2HDW A;  1WJE A;  4E6K G;  2R7X A;  3OYM A;  4XR6 A;  2VQL A;  4BL0 B;  3HUG B;  4J00 A;  1DP3 A;  3DKY A;  4B47 A;  2ZXH A;  3OYH A;  2V1N A;  3E1S A;  4RM2 A;  2V26 A;  2GOM A;  3VYT B;  4DBQ A;  2DT6 A;  1Y56 A;  4PK4 A;  4AU7 A;  4NUB A;  4XMY A;  3RSN A;  4DOZ A;  4HST A;  2Q2E B;  4XLE A;  1BR2 A;  2BOL A;  2MYS A;  3A4C A;  3W2W A;  3EUH C;  4XKC A;  3SEZ A;  4XLH A;  4XLF A;  5LFA A;  3FBN B;  2R4G A;  2CV2 A;  2KL4 A;  3ZR8 X;  4YRV A;  2I8D A;  3K70 D;  3EUA A;  3K4N A;  4XOP A;  3KEY A;  3C2H A;  1UG0 A;  3OYK A;  3OIQ A;  3A1Y A;  4E4H A;  1GLN A;  1MMN A;  3RQ4 A;  4XLC A;  2BVL A;  2KP6 A;  1K6Y A;  3GBG A;  4CSW A;  5LD2 C;  1YX3 A;  2A5W A;  3LSM A;  1T95 A;  2W4S A;  3ZXS A;  4NQW B;  1PYV A;  4OWR B;  1D1B A;  5FRO A;  3DEE A;  1V5E A;  3H9J A;  3HOS A;  2XAU A;  2F4I A;  3DWL E;  4IKF A;  3L2W A;  4ZDL A;  3L2U A;  2CH0 A;  4DJA A;  3K70 C;  2BW3 B;  1WJC A;  4YEL A;  2VB6 A;  4HNU A;  2M4G A;  2LOO A;  2V9K A;  3OL3 A;  2PJR B;  3EUK L;  3OY9 A;  2HQA A;  4BS9 A;  1J09 A;  1QHH D;  4E7J A;  4CCM A;  2VKH A;  4PJL A;  4ZC3 A;  2R7S A;  4XKB A;  1LDK B;  1ERD A;  5FRM A;  3K4K A;  1V5F A;  3ZGK A;  3PFY A;  2X6Y A;  4CCO A;  1IRX A;  3F9K A;  4PFP A;  3SDB A;  1Z21 A;  5HVQ C;  2L2O A;  1WJA A;  4R79 A;  5KHD A;  4DBR A;  3OYJ A;  2Z2S B;  3VDX A;  3AKZ A;  2IGK A;  2VXD A;  4F52 A;  1TT0 A;  2R7O A;  2LY1 A;  4BDY A;  2M3A A;  2FUG 2;  1UAA A;  1KON A;  2KHM A;  1JI8 A;  4LIU A;  1DGW Y;  2E1M B;  2VQH A;  2CUJ A;  3S3O A;  3BC8 A;  4ZTF A;  3DTI A;  2BW3 A;  3ZCO A;  3H0D A;  4AYB A;  2PMZ A;  4PUS A;  3OR1 C;  2LC2 A;  2PJR A;  4PSX A;  4B48 A;  4XON A;  3AFH A;  2UV1 A;  3W2V A;  2NOJ B;  5KNL A;  4IZZ A;  2WAE A;  3V42 A;  3G2B A;  2LH9 A;  1S9H A;  4BEH B;  3VYU B;  5HNH A;  1UEL B;  3VYR B;  3U21 A;  4CH7 A;  5CQE A;  2W00 A;  2M4K A;  2MC4 A;  3OYL A;  3MKY B;  4E7H A;  2DJI A;  3IUO A;  3PSI A;  3PNY A;  3BG7 A;  2VKD A;  1X4P A;  3DU6 A;  4H4K C;  3HC7 A;  1ZEL A;  3L2Q A;  5TGT A;  2L7K A;  1YE9 A;  2F6C A;  2KRC A;  2MAB A;  2VJI A;  3VYS B;  3UNG C;  4N4N B;  5FRN A;  1MW7 A;  3I3L A;  1FMW A;  3H5N A;  4XM3 A;  4ZDO A;  2E5Z A;  3AL0 C;  5HNF A;  4GRI A;  3OYB A;  3K6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...