2E5ZA

Solution structure of the surp2 domain in splicing factor, arginine/serine-rich 8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
GSSGSSGTSALAPVAAIIPPPPDVQPVIDKLAEYVARNGLKFETSVRAKNDQRFEFLQPWHQYNAYYEFKKQFFLQKEGGDSMQAVSAPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Splicing factor, arginine/serine-rich 8
publication title Solution structure of the surp2 domain in splicing factor, arginine/serine-rich 8
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01805 Surp Surp module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e5zA01
4DGWB 2E60A 1X4OA 2E5ZA 1X4PA 2DT7B 1UG0A 2DT6A
chains in the Genus database with same CATH superfamily
2V26A 3GVAA 5BS6A 5TRDA 5K7ZA 1X3WB 3F8FA 1HBXG 4PGGA 3DKXA 1MDMB 2GM4A 5IYCJ 5DD8A 1W1WE 4D7NA 3KX2A 4BBRJ 5HNHA 3I9V2 1T2KA 1FZPB 3HZJA 1V55H 2OTJI 3EUKL 4HBLA 3HGYA 4A12A 1JUMA 3AFHA 2DT6A 5LHIA 5CLSA 4B09A 2LNBA 2FSWA 1IN7A 3CC2I 4MHGA 1KA8A 3V8JA 1Y8RB 4OINF 3HPGA 4HF0A 1BIAA 2W00A 3OV8A 1SANA 2QUFA 2R5YB 3GTQJ 2Q0OA 2GOXB 2HQAA 1DP3A 5F08A 2MBFA 1WJ5A 3HC7A 4IL6C 1IDZA 2AQEA 1WJFA 3CC4I 5ILVA 1S6LA 3BZKA 4HNTA 4RBOA 1OFCX 2VKEA 1LVAA 3Q0UA 3H9GA 2IP2A 4RM3A 2FMLA 3OYBA 4UUVA 2X51A 4TV7A 4UHTA 3CCJI 2HDWA 5M3FJ 1BM9A 1IO2A 5FO5A 1A04A 2Q1ZB 1YTYA 3S14J 3CC7I 1MSEC 3HDDA 3MWMA 4OMZA 3JR9A 3QYFA 1HLVA 4HPQA 2NRAC 2G9WA 1XX5A 2HS5A 5LHGA 2F6CA 3TO9A 1Z1DA 2DDBA 2VLAA 2XKPA 4CO8A 4D5CA 3DLAA 2YX4A 1QZEA 3ZOBA 3GTPJ 2XIGA 3E7LA 3WU0A 4RAZA 4L9JA 3PSFA 5C3EJ 2VC1A 3SFZA 3GXOA 1ZREA 1IN5A 1UHWA 1TP4A 4I0BA 2J5OA 1G6NA 2XRLA 2E2JJ 1MMGA 2A5WA 2OC6A 5IOZA 4UUSA 2E2HJ 3H3VK 2D1VA 2AHQA 5JI6A 3CESA 2RDPA 4M6VA 4Q4ZF 3CO7C 1RPWA 3RI4A 1OPCA 2L2OA 3NAUA 1BC7C 1XC5A 2TRTA 3J81K 3HOUJ 4YRVA 4OIQF 2DJNA 5FLXZ 2QEXI 3DPTA 3ISPA 2RV8A 4BXXJ 4HSTA 1LUJB 3RZDJ 3W6JB 1IRFA 4WK8F 2UV1A 5A2QZ 3S2DJ 1XN7A 2NNYA 5K7HA 1PUFB 2K9QA 1VQ6I 3BG6A 3RPQA 1YHQI 1ZRCA 3OIQA 5DDGA 1IXSB 3KZZA 5CQGA 4G7HF 2H09A 5HVQC 3CF5F 4GFBA 4ZYEA 5J40A 5FLVA 2EQRA 5F0CA 1YW8A 4ENMA 2R7QA 3T0YA 1T0FA 2X48A 2WWYA 3FBIB 1A35A 1OKRA 2IA2A 3S16J 1WHUA 2NVYJ 5CVVA 3D5RC 5FD6A 1XMXA 4BEHA 1MBEA 5KNLA 1FLIA 5HS9A 1F36A 1J59A 1YX5A 2DAOA 3I54A 1UCRA 1ETQA 2HTJA 4C2UA 2JN6A 3WTYC 3HRTA 5IY5H 1X4OA 1MMSA 3FHZA 1WJDA 5IT9K 3MKWB 3ABKH 5B1BH 4HEA2 1IV6A 3KEYA 5ILUA 3RDIA 1RI7A 2F5CA 3MKZA 2QENA 1YRNB 3TOBA 2CV0A 2K5CA 3AG2H 1MW7A 1W5TA 2HOAA 3BJAA 1BR4A 3FXMA 2ZMEA 4UVAA 4BJ6C 1XPXA 4KYWA 1LDKB 1XGNA 3Q3SA 2LTPA 2LSOA 2VC0A 1QZZA 1K78B 2IXSA 3E0JB 4BU2A 3I3LA 3Q9SA 2FOWA 5E8GA 3C7JA 2CU7A 2HGCA 4U0WA 1LFBA 2E7XA 4M6XA 4D1QA 2D1HA 4A5MA 1KGSA 3S1RJ 1Z67A 5LEKA 3PNYA 4PZJA 4B43A 1L3LA 3HPHA 2HOSA 4CH7A 3EUHC 4NC7A 4AD9A 4RDUA 2ZJRF 1DU0A 5EF6A 2HR3A 1LPQA 3P9CA 3VDXA 2FNPA 1WRJA 3CMMA 1Y0NA 3GTMJ 4IPAA 3GF2A 1X1CA 2H8WA 5GAGJ 4CXFA 1P92A 3IRRA 1XSDA 1HSTA 4BQNA 1A36A 5IYDJ 3VFZA 1Z6TA 2R5ZB 2MA3A 5CVIA 1GVDA 2WAQN 4AVPA 1U9OA 3WHBA 4OMYA 4KDPA 1ENHA 1WH7A 1WI3A 2OJED 3QPTA 2AXTC 1ZGWA 2CSOA 3BR2A 3H35A 4ZTFA 2A6EF 4LD5A 3C18A 3JSOA 4P5OA 4UY8I 2HTSA 4G7ZF 5DS9A 4DZJA 3WU1B 2COMA 3F8CA 1XS9A 1TNSA 3ZQLA 3OS1A 2XB0X 1SEUA 2W57A 1R23A 2LF8A 3JRDA 3M07A 1GVJA 5F0FA 5HLIA 1J09A 3OIPA 1SVMA 3F8BA 2F4IA 2HYFA 2PMZA 2WAFA 4LLNA 2IGMA 3FXRA 2CQXA 2CJJA 4J00A 2KLOA 1APLC 2EFQA 5K7FA 4XORA 1Y8QB 2CH0A 4HX7A 2R7TA 2DYSH 1E2XA 3HIFA 3M3YJ 4E70A 3ELKA 2OD5A 4KT5C 2XUBA 3L9FA 2ID6A 3BTIA 4V19K 1S72I 1OR7C 4H4KC 4XR6A 5F27A 1X2NA 2M7BA 5FROA 4BACA 1A6QA 3R0AA 1ETOA 4MQ9F 4OAZA 5BQTA 1MMNA 2H1KA 1OYWA 2HEOA 2BY0A 3VB2A 2HYGD 3OIOA 1IDYA 4G6QA 5C4JJ 1L0OC 2QKLB 1MNEA 4GGGA 2M4GA 1VQ8I 5DM6F 3BZ6A 5HDNA 4IEJA 4DYQA 4OIOF 1PP7U 5M3MJ 2Q2EA 2AXLA 2DTZA 4ON0A 3S1MJ 1FY7A 2VBXA 2UXNA 4LLLA 4FQGA 2JK3A 1X1DA 2KJCA 1LEBA 2BXZA 2E19A 3LQQA 3MZHA 1J0RA 3BQYA 2WV1A 1T08B 2WB1A 2HVRA 3K1PA 5GPCA 4BE0A 4LG0B 2HXIA 4NB5A 1TQPA 1FEXA 2CFXA 5J6XA 1F9NA 1ACIA 2NAZA 2PI0A 2B7EA 2L01A 3K1MA 4B1RA 3GTOJ 4ENNA 3S2HJ 2VBYA 1OCOH 1X1PA 1H9TA 5L3DA 4WXCA 1U5TC 4XNFA 2VQGA 3KP7A 3Q0WA 3WE3A 1FP2A 9ANTA 3K7AJ 1D5YA 1QU3A 1V3FA 1W36D 3B6AA 1QO0D 1YIOA 4YFKF 3CCVI 2B9SA 2K27A 3RYRA 5EDNA 3FDYA 4DJAA 4HX4A 1SD6A 3LMMA 3H5NA 3SXYA 3VSKA 3JRGA 3LFKA 4UVCA 4FX0A 4PJJA 2O8XA 3TOAA 4HDVA 4O3MA 2EV5A 5GTIC 1N75A 3OYFA 5JR3A 3K6GA 3L2QA 2R7SA 3QPSA 5DUKA 4RB0A 1BR2A 3TDUC 2D2WA 1OCTC 1ONVA 2EZIA 2GA1A 1KONA 3G1MA 1K7AA 3O8GA 4NUBA 2XASA 4O5VA 5D5UB 3ZCOA 2V79A 1ZTRA 3FXJA 1YOVB 1UELB 4IHSA 3OYAA 2J5PA 4R79A 4NNJA 3GLXA 1JTYA 4ZH4F 1VQMI 4B3AA 3I4PA 3JW4A 4HQMA 4W97A 1XMKA 3W3CA 2LK2A 2XC7A 2GLOA 2RREA 2DA5A 2STTA 1PJRA 2M30A 4CA0A 3BWGA 3P7NA 5F04A 1BBYA 3FF5A 1SC7A 3WTWC 2DW4A 3GCMA 2IT0A 2HZTA 1SFEA 1P4XA 1A6IA 3BJOA 3OR2C 2CUJA 4BE2A 5E20A 4E7ZA 2E1MC 4AYBA 5F1RA 5CVUA 2ZFWA 3KP4A 4S04A 4ZYGA 2LBFB 2MFZA 1JUPA 2Y48A 2IGOA 3IL2A 2VOOA 1V4RA 2O03A 4M3BA 1SD7A 3KPHA 1ZHFA 2H8RA 1Z3YA 2ZB9A 2W25A 4EMSA 1YFHA 1LQ1A 5EG0A 3BG9A 2K7LA 4RA2A 1R6RA 1R36A 3V4GA 3V7CA 2VOPA 3V8LA 4I6ZA 2WY7Q 1BOAA 1W7PB 5J1RA 4JX6A 1IN4A 5EGOA 4X1EA 1J9IA 1WGXA 2KT0A 2VI6A 4GYIA 1SFOJ 2NS0A 4NQWA 4EM1A 1FPQA 4A93J 2A3SA 4CCKA 3GTLJ 4Q5SF 2KIQA 3GFLA 3HBLA 3IWZA 2R7OA 5B3SH 2HFHA 2BY3A 2H6BA 3HJEA 2GZWA 2DQLA 4M3EA 4WXHA 4PSWA 3EYYA 1U5TB 2X1EA 2E5NA 2HPIA 1VI0A 2DDAA 3BR1A 4WCGA 2DA7A 1EV7A 4ZDLA 2IJLA 2IVMA 3M8JA 4LGWA 2FA5A 1R1UA 3GUDA 2XV4S 4QSHA 1X3ZB 3HUGA 4HW0A 2GQQA 5ICFA 1I50J 1JJ8C 1TWCJ 3B02A 2EIKH 2MGQA 3FXOA 3GMEA 3J7AY 1GUUA 1N78A 4PJNA 4ABZA 1W5SA 3DPLC 1PUEE 2FEZA 4EGYA 3T8RA 1X1BA 3PO3J 3OSFA 4U0VA 2ZSHB 2NVUB 4IRIA 1WVRA 2QKMB 2VKDA 3BCBA 2ZJPF 1B59A 3CUQC 4Q47A 1NK2P 4G94A 1IC8A 2LY2A 3IP4B 4BY7J 4II2A 2KFDA 4AU7A 2OCCH 1HKQA 5ILSA 3DEEA 3HKZN 5DTDA 2ZXJA 1ZKGA 1J75A 2EB7A 3K2AA 4HYEA 1VQ7I 4MQVA 1P7IA 4IZZA 4F92B 2IPQX 5LFAA 1YJ9I 3I4MJ 1TLHB 3S3MA 1QVTA 5HLTA 3ASNH 4IJAA 4M9SA 2IEKA 4UV9A 1P2FA 1ETKA 1NH3A 1OYIA 2RAEA 2PFBA 1KU2A 2Z99A 3BPVA 3HG9A 5TISC 4BS9A 2MD5A 2O8KA 2YS9A 4MTEA 3SJMA 1ZGJA 3OS0A 4EQQA 3CDLA 4PDKA 2QLZA 1FNNA 1KYZA 4ANJA 1G3SA 4B44A 4XSZF 1FOXA 2WC2A 3MVPA 2NVQJ 1WCMJ 3P9KA 4KNYA 1B8IB 3WODF 1JJ6C 4A3KJ 1S29A 5LRSA 1SAXA 4L5IA 4DIQA 1BW6A 3WU2C 2IGNA 2NVTJ 3P5JA 1XDUA 2WTEA 3OOPA 4HV6A 1BI2A 1I39A 3CCYA 4M9ZA 4B8XA 1B1BA 3L00A 2WADA 4CUGA 2VBWA 5L3BA 4C30A 3VODA 3M8FA 1Z05A 3DTEA 2DK8A 3TGNA 1YS6A 4LB5A 4EEFG 2PQ8A 3ZP5A 3PQKA 2HDDA 1WH5A 4G6TB 4I2OA 4PGHA 1VQLI 2HYJA 2M8GX 1ZLJA 2MYSA 3JCUC 4U88A 3CCRI 4Y13A 1HW1A 2JJ7A 4AWXB 1B6AA 2M0CA 2X4HA 1OMIA 3BT9A 3TP3A 3F72A 4A3JJ 3S93A 2FQ4A 2CUZA 3FKIJ 3K4NA 1FYKA 2C6YA 4A3GJ 5KCMA 4MO7A 1SFXA 1RNLA 1FBQA 1XDSA 2ZBKA 3ECHA 4AIKA 1ON1A 3KEQA 3AKZA 4Y33A 1BIBA 1D0XA 4U7DA 1WQ2A 3E6MA 4MLOA 2X6WA 1JKPC 2K4JA 4PK4A 2VIXA 1LE8B 1B9NA 2E1OA 3LAJA 5EZGA 3ZQ7A 3O2PE 2O61A 1VZ0A 4I99C 5FKOA 3KP2A 3PNVA 2Z16A 2EWNA 3CUQB 4JP0A 4BL0B 1NG6A 2DFFA 1YO5C 4IOCF 2H6CA 2XGXA 4G7OF 2R3SA 2QZ8A 2A07F 3M4OJ 1UB9A 1BI3A 1ETYA 3KE2A 1KZHA 2ICWG 4DBRA 2Z5UA 4A3LJ 5J47A 1X58A 3HOTA 2JRTA 2L9SA 2PMUA 5J1UA 1K6YA 4OU0A 2K86A 2V7FA 1TWFJ 2HVQA 4A0YA 3GZNB 3KEOA 2P5LC 4IQJA 2BW3B 2XAQA 3H3UA 4HF1A 3DXJF 4QWQA 3I56I 4JK1X 2PJPA 2ETHA 1VQ9I 1F43A 4CICA 2H94A 3HOWJ 5BNGA 4LIUA 2PX9A 3L2WA 2P0WA 4PFPA 1D8KA 3ML6A 4LK0F 2VPRA 2VJJA 4ZDOA 2F5VA 2P6TA 2PEXA 5D4SA 3OYJA 3WE2A 3HSEA 1OCZH 1AOYA 1TQIA 2MD0A 3S2WA 2KRCA 3TW7A 4XLPF 4FCYA 3HM5A 4ZTJA 2MH2A 2M45A 2UUZA 4DBQA 3KP6A 5IYBJ 1O3QA 4NBQA 3K70C 3QOEA 3U21A 4S05A 5E79C 3OYCA 4IHYA 2DQRA 4FASD 5E3OA 2XSJC 2KQRA 1NG7A 3J7YJ 1SMTA 2P81A 3V42A 3GZ6A 2VQLA 2OTLI 3G71I 4XKVA 5LGNA 2PJRB 1BI1A 3FMRA 3TW6A 2GXAA 3LSPA 1T38A 1JI8A 1OLTA 3P9IA 2ESHA 2P4WA 3SEZA 1TWHJ 2YPRA 3M8EA 3LSRA 4A3DJ 1I1GA 5JVTA 4CGZA 4FT8A 5LRRA 3JRHA 1ODDA 2CO5A 4RB1A 1JT0A 3ONQA 1DPRA 4G9YA 2R93J 3G2BA 2YU3A 2LY9A 3M1CA 2CWEA 2KRHA 2QQ8A 4HX8A 2NXNB 3SQNA 4A0XA 3WTXC 1B4AA 4LJZF 2XAFA 1WI9A 2GIZA 4OWRB 1RETA 3F0CA 2QA4I 2VB6A 3MMYB 2FX0A 4JYKA 3GFMA 1XCBA 4IHTA 4IO9F 1IN8A 2IW5A 2X1CA 2R7DA 5KVRA 2CQKA 3I59A 3PM1A 5LEJA 3KYLA 1S7OA 3F8NA 5M5XJ 2CUFA 4ZZLA 4P9UA 3D5LA 1YW9A 4OAYA 2CGPA 1WZ2A 3ZMVA 3KP5A 1E17A 2YU9J 3FKJA 2NOGA 4ENJA 1Y1VJ 3HHHA 1RUNA 3A03A 3RKYA 2HZDA 3J81Z 1YX3A 4CDGA 1AU7A 2M87A 4CZZA 3J80K 1Y6IA 2E71A 2XAHA 4F3QA 5ICCA 3LSTA 1T0FC 4EVIA 5J3LA 5D4RA 1QVUA 3TO6A 3OY9A 1IRZA 1AKHA 4UUTA 3B73A 3CJQB 5D5VB 2Y0SA 2VJIA 4F91B 3AG4H 1YE9A 4YG2F 1ZR4A 2RQPA 4V2GA 2FBIA 2O7OA 4RGRA 2STWA 4XOPA 2NYXA 1K83J 3E5QA 1FBUA 1F5TA 1XCVA 2CMPA 2ESNA 5L3CA 2JA7J 1UG0A 5CVRA 2DPDA 2QSHX 2ZMEC 1R00A 1S8NA 1Q1HA 3WTSC 1WJBA 3LSIA 4IXAA 2A5YB 1K61A 3VYTB 3A01A 3OSGA 5D8LB 3IWFA 1WJAA 1I27A 3G3ZA 3KYCB 2ZO4A 3VEPA 1OCRH 5IT9Z 1IJWC 3FXQA 1LDJA 4BNCA 3DU6A 3IH3A 2JA6J 1USTA 1SD4A 2EFNA 4QTRA 1EKEA 3IHUA 2XF6A 4XKBA 1TQMA 2LR8A 3HSFA 3QODA 3CMAI 4F55A 1CF7A 1XGMA 2DO7A 2HI3A 4UB8C 3JAMK 4BQOA 3HTUA 5F0HA 4I02A 3M7GA 3CLQA 2X1DA 5HNFA 3MQ0A 4UXNA 2G7HA 5LD2C 3EYIA 1T39A 4U7BA 2I10A 3L2VA 1KQ0A 2CS3A 5ICGA 1X4PA 1ZELA 3K4KA 2IS4A 2X6YA 2H1LA 1ON2A 2PMHA 2EIMH 1BR1A 3QU6A 1WJEA 4C3HJ 4FISA 3E5XA 5FFXA 2JSCA 3G73A 4MEYF 1VQ5I 1TWAJ 2Y0MA 1B9MA 2DODA 3PUFA 2V9KA 4S0HB 4UUSB 3LSHA 2Y75A 3RIRA 2CQQA 1NK3P 3MZ8A 3BC8A 2EIJH 3EUHA 3BR0A 5E1WA 3MN2A 3AG1H 3COAC 3WGHA 1QQIA 1VTNC 2MW8A 1P9QC 3WHCA 1QPIA 4RB3C 1LJ9A 1Z6RA 4XMYA 1GV2A 1N25A 2VN2A 5HOOA 4KISA 3CCUI 2AO9A 1U78A 4I09A 3WG7H 2OCEA 1JHHA 3E6BA 2L54A 2EZHA 3JRCA 2CG4A 2EV6A 1P4AA 4P96A 1G4DA 2AS5F 2QBYA 2L0KA 3T8TA 1SVLA 4QPQA 3NQOA 3W2AA 2LF7A 3WTTC 3IAS2 2GBYA 1B72A 4G6DA 2JMWA 1DQUA 4J19A 1MIJA 2PMZN 3SDGA 3ZQHA 5F64A 2F48A 2JVGA 2JA5J 2HQRA 3H3ZA 3PQJA 1W4MA 3SFIA 1D5VA 3HOVJ 3QAHA 2EFWA 3I53A 5LHHA 4M3FA 2DMNA 3IUOA 5JVGF 1R71A 5HDKA 2XPUA 1N77A 3MFKA 2KIUA 2H27A 4BHPA 4YFXF 5FLMJ 4H0EA 4C2TA 3BQZA 3FMQA 2KISA 3FXKA 4WXDA 1R5HA 5FKLA 1FSHA 2Y69H 2ZMEB 1YITI 3CP2A 4FX4A 1V5EA 1F1ZA 2ZNZA 3GBGA 1T33A 3GTJJ 5FFZA 4C3IJ 1H0MA 3OYLA 1OQYA 1RUOA 3HL2A 2WBMA 3BR3A 3DKWA 1OR7A 2FBKA 4HAMA 4IOAF 2EV0A 5FKKA 3ABMH 3OS2A 2IGKA 4IX7A 3EQLF 4NC8A 1U6GA 1VQKI 2Q8KA 1FYMA 2XPWA 2EFPA 4BJ5C 1OCCH 5DV5A 2KIMA 2LY1A 5D6FA 2K9SA 4Y7NJ 1DPUA 2JPBA 5BPDA 5K5OA 1ZLKA 4KIBA 2HKOA 5C44J 2WB1N 2XPVA 5CQEA 5HS8A 2QQAA 4RAYA 2XF5A 4XRSA 1GDTA 2W4SA 2NOJB 1U2WA 2M5WA 1R4NB 1JKQC 1FOWA 1D1AA 1MBFA 1RIOH 4IHWA 3F6VA 2DA2A 3PL8A 5FB2A 4YIFA 3EDPA 4MTDA 3I64A 5DUIA 2R92J 3I0TA 3DV8A 2W24A 1O57A 4HA8A 2LLKA 4KMUX 2BY1A 1CQTA 4M74A 1VF9A 2DT5A 4E7LA 5FRNA 3KIOA 5FKMA 2B63J 4BHCA 2FF4A 4FTHA 1IV8A 3HSRA 4ZDPA 3Q5FA 3RPUD 5DCMA 4JX5A 2X6XA 2K4BA 4M72A 4B3XA 1D0YA 3RZOJ 3OYHA 4WWCA 1ZQ3P 1FMWA 3FM5A 3BTJA 4ETSA 1MZBA 1MKMA 2FOKA 2KHMA 2OQRA 1KYWA 4XN3A 4BGDA 1HDDC 1J5YA 1EH7A 2V1DA 2ISZA 3FM3A 4IQ4A 1MH4A 3K10A 4IKFA 2JSPA 4A3MJ 2EPFA 1XGSA 3KYDB 2VE9A 3PJRA 1R7JA 1TL8A 3IH2A 3K0LA 3H0DA 3BPXA 3TP0A 3G6EI 3WTUC 5AIQA 3I58A 4OOIA 4Z6YA 2ISYA 2X6OA 3J7AO 2DPUA 3BY6A 2KJBA 1HF0A 5HS7A 3IV5A 2V1NA 3DF8A 5GAHJ 3I4NJ 2Y9ZA 3BR5A 2VT2A 3IH4A 2MLGA 3GWZA 3E5UA 2JT1A 2LKPA 3BTCA 3ZMSA 3VYUB 1JT6A 2JVHA 5GTHC 4EJTA 1ZG3A 2VKHA 2E5ZA 1U8BA 1MJBA 2CRGA 1ETXA 4MFDA 4P1WA 2IA1A 1RR7A 3JTGA 3LSKA 3GTGJ 2DFEA 4AYBN 4Y15A 3CCMI 3RKQA 1HQCA 4XK4A 3QRFF 3OOUA 3N4MA 4L5JA 3GLLA 2CUEA 2HU9A 2L9VA 3ZRGA 1XB4A 2CQ7A 1HW2A 1A5JA 3U1KA 3RCOA 3IKTA 4CYCB 3PFIA 5IP9J 2EK5A 4A6DA 1Z91A 1UAAA 3FMSA 4LOCA 5IPAA 3A2KA 1KU9A 4BUPA 2KDOA 3B6CA 2ZC2A 1HW5A 2XKOA 2XAUA 2VASA 1NTCA 3H5RA 2CW8A 3M9AA 3BG7A 3VSLA 2M3AA 4L5EA 3OYKA 1FOYA 2QGUA 5J8FA 4ESJA 4EGZA 5JHUA 1WPKA 3DTIA 3LA3A 4CSWA 3KP3A 2QF7A 1DGRM 4A5NA 4RGSA 3CTAA 4UV8A 1OYYA 4PCQA 2HNHA 5CPRB 2E1NA 3PIPF 3H9JA 3AAFA 1G3YA 2YSRA 5ICEA 1V5GA 1UMQA 4MGRA 2FNAA 2V6EA 1IF1A 4L9NA 2RGVA 2M1BA 5HLGA 3GO5A 1G59A 4Y52J 1EJ9A 1EH6A 4DQ2A 1HOMA 3A0BC 4AC0A 2FE3A 4CCOA 1G8XA 4RLFA 2RVCA 2HXOA 2Y9YA 5E1ZB 3W2VA 3HEFA 4AIHA 4BAYA 3QP6A 1RRJA 3ERED 3MKLA 2E35A 1TZLA 3A02A 4HSRA 3SDBA 2DMTA 2XDVA 2BBYA 2QCOA 2F5FA 1P4WA 2NS8A 1DUXC 3M1EA 2IAIA 1H8AC 4A6EA 3RYPA 4N4NB 2BXYA 4Y4RA 1TW3A 3FISA 2MLKA 3ZMTA 2ZXIA 2PG4A 4HNUA 4ESBA 2ZFUA 2DFIA 4RS8A 2QYOA 3FX3A 2UWMA 3TO7A 2D45A 1LB2A 2R0QC 3K69A 1TT0A 1LFPA 4A2UA 3ZN0A 3K4MA 1W7PD 3RQ4A 2M34A 4JBAA 4BXUA 2DK5A 1FT9A 1GXPA 1GLNA 2L7KA 3DPUA 4UVBA 5E1XA 2OU2A 3CCLI 1IRXA 1QNTA 5LGUA 1XSVA 2JA8J 2JTVA 5KHDA 2XF7A 4WF2A 5EG0B 3CCSI 1QHGA 2DOEA 2M9HA 3G1LA 1FSEA 4MFEA 1ZG1A 1QHHD 1FBSA 2P7CB 5EGOB 3ZMUA 3U2RA 4ITVA 1PP8F 4NQWB 4GCVA 1H9GA 2LG4A 4KJZA 1P7JA 3F6OA 1K4SA 2A61A 2Y31A 3BP8A 2P8TA 2ELJA 4XICA 5E8IA 1ZN2A 1BL0A 1MDMA 3A0HC 1HKSA 4LLGF 4XIDA 5EYRA 3F23A 1YIJI 1TBXA 4BBSJ 5CJ9A 4F7ZA 3DU5A 5JLWA 3SEQA 3LSGA 4IRHA 1YYVA 1R5GA 1ZYRF 2DA1A 2G7UA 3OYGA 3CCEI 4HQEA 2VPLA 4JQFA 4M73A 2RC4A 3ECOA 4EM2A 5FD5A 2L9NA 4B47A 1IZ1A 4E7HA 1UJ8A 4KT6A 4LG3A 3E97A 5IOYA 5L3EA 3CCQI 2R5YA 1USSA 1AWCA 3ESWB 2FD5A 3JRIA 3HUGB 1O3RA 1MMDA 1HCRA 1IRGA 4A3EJ 4DGWB 1I6XA 4XRSG 3UNGC 3HOXJ 5DD4A 4FE4A 1G2HA 4XONA 1HSJA 3DKYA 1R9TJ 1KU7A 4L0ZB 3JRAA 3GX4X 1SD5A 2ZCWA 2V9PA 3PSIA 2O6GE 1MJ9A 4CHUA 1STZA 2XSDC 4L9VA 4KA4A 4Y3OA 1JXSA 1UG2A 1WKMA 2QQ9A 5K5RA 3KETA 4LIVA 3DEWA 1VQNI 1SVOA 1YLFA 1O7FA 3DWLE 2LMDA 2DN0A 4I76A 2O9LA 1S3JA 3BCAA 3KZIC 1QPMA 4IF4A 2DJIA 3IC7A 4XBFA 3HRMA 4BQAA 2LRDA 1YQAA 4BHBA 2BY2A 2HKXA 3CF2A 3FZVA 4HOBA 3K4JA 2P7VB 2JZYA 2CV1A 2LOOA 2RNJA 6PAXA 3ZQQA 5H6RA 2R7VA 4XN0A 1IN6A 4NDLA 4FETA 2XRNA 1LEAA 4KUMA 1FTTA 2EILH 2Z2SB 2BE5F 1O4XA 3CUOA 1E3HA 1JE8A 4N0BA 1X2MA 5J8CA 2K85A 1XSXA 2O0YA 2EA2A 3W6VA 4MNUA 3OMYA 4ZZDA 3V8KA 2EINH 2EFOA 3R4KA 4AIDA 5IP7J 1Y39A 3O3KA 4P55A 2Z33A 1D0ZA 1F4KA 2P6SA 5H2FC 1WJCA 2X9DA 1QRYA 2DU9A 2EBIA 2YR2A 2GWRA 1X19A 1FWZA 3Q0VA 2OUMA 1AHDP 1AA7A 2P5KA 1LFUP 3QYBA 4I01A 3C3WA 4IHXA 1PUFA 1O7LA 2DI3A 3D5SC 4YIIA 4A3IJ 2DA6A 5JHFA 3CO6C 4XLFA 1MNMC 2W48A 4ZYAA 3RTRA 2L4AA 1HKTA 3N97A 1U3EM 2X85A 1SFKA 1DP7P 2JRMA 4AUXA 3G4SI 3FBNB 4MIMA 5FGMA 2GXBA 1GV5A 1W0TA 3LSJA 3TDZC 2JA2A 5L3FA 2L9RA 3REOA 1RESA 4CCNA 2L02A 3QP5A 3WGGA 2ZSIB 4E6KG 3DTKA 4M71A 4EJUA 2W82A 3BTLA 2DLLA 2V4JC 1MBHA 4D0PA 1FJLA 5EZHA 1FP1D 1FYLA 4JOMA 3GFIA 2K9NA 3BDDA 3HTSB 2KPMA 1FIAA 1YRNA 1JHFA 3CDIA 3SZPA 1BC8C 4IRGA 4BKXA 1U8RA 2KIFA 1QGPA 1FOKA 5K1YA 4BE1A 4YELA 3RQIA 2ZNYA 1XGOA 1SFUA 1K78A 1I5ZA 4G12A 5F6FA 5D5XB 1K4TA 2G0EA 4RB2C 4KN4X 1IG7A 3OYMA 2OPTA 1RKTA 1MSFC 4BDZA 2QVOA 3ASOH 4R1HA 1FC3A 3E6DA 2ZXWH 1UHMA 4D7MA 3E6CC 3DFGA 3CJTB 2LFBA 1C0WA 2JUGA 2NS7A 3H1CA 1EH8A 4HF2A 1ZAOA 3CMYA 3BG5A 1WWXA 4LITA 2OZUA 1Z77A 2DOFA 2M0MA 3ZQGA 2R5ZA 1X1AA 4RGUA 3KFWX 5FLXK 1QBJA 2ME0A 1UZCA 5LBQA 2GOMA 1VQ4I 5J4VA 4GYGA 5ED4A 1MD0A 4I98B 3DBHB 2P5VA 1TNTA 3WGIA 3H0GJ 4E7SA 3S1NJ 5H6QA 1H89C 5A2QK 2HVSA 3QQAA 3BG3A 3CD6I 5LGTA 1W36C 1FIPA 4BXFA 1ZGAA 3TL4X 4XL9A 3UKGA 2GXGA 5KK1A 2F5DA 3K9TA 4RAFA 1BN5A 1S7EA 2DTRA 2CFOA 1XTAA 3EETA 2FU4A 3ZMZA 2ECBA 3J80Z 2EA4A 2XAGA 3ULQB 2FXAA 2QSFX 2KDZA 1KQ9A 4M6YA 3S15J 3QOPA 1D3YA 2Y0SN 4A0ZA 5E3NA 5GP9A 4ENKA 3S1QJ 2VUMJ 2V1XA 2MH9A 4CCLA 2L3DA 2VJ5A 5IP6A 4BDYA 1M1EB 3RPUA 1ZK8A 3HHGA 3OYDA 1YJNI 2QQBA 3QU3A 4EM0B 3LL7A 3O6BB 4KFCA 1LDDA 3BLYA 5E18F 3WTZA 1ETWA 3F3XA 4II3A 2LREA 1JKOC 2A68F 2IS1A 3N05A 3S3NA 3O8HA 3A4CA 4QIWN 3WTVC 2A05A 3WG9A 3A1YA 3G1OA 5FRMA 3ABLH 4I0AA 4HNVA 1MMAA 3OYIA 3VOEA 2QSGX 2BYVE 3GTKJ 2E36A 1T6SA 1VFCA 3K4BA 5DM7F 1D1CA 5GAEJ 2DFHA 2MG4A 1W5CC 1Z7LA 3AL0C 2KZVA 3NARA 2RQQA 3ABTA 5CVJA 4KITB 4KMFA 5BMZA 3ZXSA 3BJ6A 2K3PA 4YFNF 3I55I 4EJOA 4DOZA 3FHNA 2OZ6A 2V6CA 5IT3A 4XKCA 2E2IJ 2FMYA 2K40A 3JAMZ 2VQHA 3C2GA 2ADUA 3BROA 2IA0A 3TEDA 5L3GA 1JUSA 1QZYA 3CDHA 4LG0A 1Z3XA 2XGEA 4PUSA 5E3LA 2BHYA 3SZGA 1POGA 3AG3H 1Z21A 2VJ4A 3JTHA 2WAQA 4LB6B 3I59B 2DT7B 1WSUA 2IS2A 1J7KA 4B4CA 1FMVA 2VXZA 2DCEA 4A69C 4HDUA 1MH3A 3DBLB 4A3CJ 1MJAA 3QWLA 2VONA 1TC3C 3T5XA 1VQPI 1BA5A 3OWTA 2A6TA 4PSXA 2HWVA 4ZC3A 2D5VA 3H9QA 2Z3YA 3TKYA 4ESFA 4M3GA 4LK1F 3GFJA 4GO1A 4BQQA 2L5QA 2COBA 4LMYA 1AKHB 5D5WB 3DQVC 2A6HF 3L1PA 2R7WA 2FJ1A 4BEHB 4J01A 2PBIA 1DU6A 3LSMA 3K70D 1UHSA 2QM3A 2BGCA 2XROA 2VKVA 3U9GA 1W0UA 2M4KA 4DW6A 2K9LA 2WV0A 1V5FA 3KCCA 3LWFA 2X0LA 2QWWA 3VWBA 1RC9A 1D8JA 2ZXHA 2DOAA 2OAZA 1JKRC 2KL4A 3A01B 1G3TA 1O3TA 3LFUA 3FK6A 3F22A 4LFUA 3ZQFA 4Q48A 3L09A 3ZMDA 1ERDA 2EZKA 3R6SA 5EEGA 3GYHX 3E3VA 2F5EA 3MD2A 3BR6A 5CYVA 2ZKZA 4U87A 1CF7B 4XOTA 2M2EA 1U0JA 5D6EA 2L7FP 3QYEA 1I3AA 3C2BA 2LH9A 3PO2J 2LBFA 3K4LA 5B1AH 1IXCA 2WAEA 1XD7A 2EZLA 4XLEA 4RLQA 2R7FA 3AL0B 2OA4A 3CJNA 2BV6A 4PJ0C 3HYIA 2TDXA 2DA4A 1FX7A 1TTYA 2LVSA 4CCMA 3TMOA 5H20A 1PVEA 2LDUA 4ZYHA 3OR1C 1W7PA 2XGCA 4P9FA 5JFRA 5LLQA 2R7ZJ 3KLOA 1WFXA 4C3JJ 1E3PA 2FRHA 4CYCA 4XLAA 1IXRC 4F93B 3T1BA 2DXIA 2LKXA 4A3FJ 5F1JA 1EF4A 1FTZA 3Q9VA 3NEUA 1OCPA 3OL4A 4PJMA 1HC8A 2KMUA 4I7HA 4FE7A 1U5TA 3U1DA 3FXUA 3IRQA 1ETVA 1R1VA 3C2HA 1E0EA 2QBYB 2XB5A 4XRMA 2UXXA 2RN7A 2VL8A 1LNWA 3S8PA 5HODA 2TCTA 1OJLA 1GXQA 1BW5A 2FBHA 3EUAA 2FUG2 4X6AJ 1ZG5A 1I6HJ 1Y0UA 4RMNA 3H36A 1B72B 2JQ7A 3LAPA 2BVMA 2N8GA 2GAUA 5K5QA 4W1UA 3C1DA 4XSXF 2M7AA 3DEUA 1EA3A 2W84A 4FHTA 1MGTA 1IUYA 3CLOA 1SMYF 5KAFC 4YIRX 3L2UA 4GXOA 2PLYA 2OV7A 3BZCA 3I71A 2E7WA 3W6KB 1CGPA 3IAM2 4O6JA 2DBBA 1YI2I 3L2RA 1IW7F 4DYRA 5ERIA 4BYYA 3L2CA 2IRFG 2VBZA 1ZR2A 4XRFA 2DA3A 2ELKA 4XLNF 3DLLF 4UNOA 3MAJA 4OIRF 4EV0A 3R61A 2R7XA 2Q2EB 4BH9A 2R7RA 2JUCA 4NHJA 2OF7A 1T8IA 2ZJ2A 3D0SA 2CW7A 3HOYJ 1P6RA 3HRUA 4XQFA 4NC6A 2E1CA 4HLXA 2ID3A 3CMEI 5EEAA 1MBKA 5B5EC 1REPC 3FXLA 3ZQCA 4G8XA 2I5UA 3BOQA 3JRBA 1DDNA 3HB9A 1K6OA 2ACJA 2O3FA 3FWEA 2MC3A 5AIPA 2W85A 3MCZA 1ZH5A 1I1SA 3GW2A 4PFOA 2MABA 3MZYA 5J4YA 3LOCA 4C2MJ 3PFYA 3PIOF 1B8IA 5TGTA 2KRFA 3TQNA 3F21A 2DYRH 4HZFA 2IBDA 2W7NA 4D9JA 4E7KA 1XMAA 2LP0A 2B0LA 1O3SA 2DMPA 1IAWA 4AIJA 3VYSB 1S7AA 2R7UA 2M8EA 1S5LC 5M5YJ 5E3MA 2Z9OA 4BY1J 2ELHA 1JGSA 1ULYA 4HRIA 1TWGJ 5DCMB 1ITYA 1PYVA 4M9XA 4RAGA 2RNGA 3VYRB 5BOXA 4C9YA 3PUBA 3SHFA 1ZRFA 4L0YB 3R0JA 4HV5A 1R4MB 3HRSA 2NNNA 4KIFA 2L7MP 2JPCA 2RKHA 2WA0A 4R8HA 1YW7A 3MEXA 3R60A 2HDCA 2AQFA 2FQ3A 4Z2YA 2BVLA 3TBIA 5J1YA 2GIVA 2BHZA 1U9NA 5AONA 4KIGA 3SZTA 2E60A 2YUSA 4RGXA 3ZGKA 4QLCU 3KZYA 1TT5B 3PNTA 4M3DA 1UFMA 4DYCA 1S9HA 2HQ5A 3OYEA 3DBRB 1BJAA 1ZARA 3F8MA 1YS7A 1VNDA 3LA2A 1K79A 1G3WA 4DNCA 3HOSA 3W2WA 1IUFA 2E34A 3RKWA 3CJRB 3HXLA 4XLCA 1J2XA 3S32A 3OYNA 1YG2A 3HKZA 1LE8A 4IHVA 2YX7A 1OISA 2DMUA 3FK7A 5KAIC 2K02A 2NVXJ 2O5RA 2BOLA 2HPMA 5GPAA 1I3QJ 2VE8A 1R1TA 3X2QH 3KLNA 3NRVA 2R4GA 3ZN1A 4JX4A 1BJZA 1TW2A 1X3UA 3CUQA 5DEQA 2ZJQF 3F9KA 5EJCA 1KQ8A 1Y56A 2PN6A 3GZ5A 4KN7X 4B48A 2F4OB 1JTXA 4GRIA 1NHAA 2W1OA 1R49A 1E3OC 1GT0C 1ZRDA 1BOBA 5E17F 1PDNC 2XAJA 3RKXA 1HXDA 4CCJA 2OBPA 2E1MB 5EEHA 4UB6C 2XVCA 3E1SA 4XM3A 2ME6A 2A69F 2BW3A 4EJVA 1HDPA 5M5WJ 4L18B 3K4CA 1MBGA 2F2EA 4U0YA 1Z0XA 3V7SA 4F52A 3UR3C 3LA7A 4QPOA 2HOTA 3CZ6A 3ROUA 2WY8Q 3NWSA 4AVZA 5HDGA 3L7WA 2LC2A 4XKWA 4D5FA 3RJPA 2VQCA 4EJWA 2UZKA 4E7JA 2KKOA 2CV2A 3DCFA 3S17J 5GADJ 3HOZJ 4CYDA 2EJRA 3I5UA 1T98A 3SYTA 1RKWA 3CQZJ 4E4HA 4KICA 4OIPF 2KP6A 3RSNA 1DGWY 4N9IA 3ZR8X 3LNQA 1IGNA 1MBJA 3ABUA 3H92A 1LVKA 2VODA 2HOEA 1R58A 1T95A 2HQNA 3K1NA 2L7ZA 3D1NI 2Z1DA 5FJ8J 2Y30A 1XG1A 3ZPLA 3NWTA 5JLXA 4YEJA 1Q1VA 2LKSA 2MC4A 4Y17A 1JGGA 2PJRA 1LKXA 3ERMA 4EATA 1RR8C 1H88C 2Y2ZA 2IS6A 4BJTA 2CYYA 4CZCA 2ECCA 4PJLA 2KZGA 5D8KB 1R5ID 3JREA 1D1BA 4XLHA 4K2EA 4X0GA 3OL3A 1GHCA 2GA2A 2LYCA 4N4OB 1HA8A 4N9HA 4DZPA 2V9VA 3JRFA 4AM3A 2XHKA 4RM2A 4MEXF 4WX9A 2I8DA 5BPIA 4ZYDA 5DCFA 3S3OA 1V54H 2EH3A 4IVNA 3LQRA 4L9TA 5DYMA 1Z7UA 1SAUA 3HGGA 2DMQA 3V7RA 2BEOA 1QA6A 2CQNA 2F4MB 2CW0F 1RZ4A 2BZTA 3IKVA 4HLYA 2JWTA 5FKNA 1Y1WJ 3ZQIA 5TJJA 4A3BJ 5C4XJ 2LD5A 1BI0A 3MKYB 2V1UA 3VPRA 1MNDA 3DP7A 3FIWA 1R22A 5CKTA 3JSPA 2OQGA 1Z9CA 2VXDA 5B66C 1VQOI 2XGDA 3CP8A 4V2FA 3H5AA 3QPLA 2L4MA 5HLHA 2MSYA 3EPZA 4HG2A 3GEZA 2K3FA 1YJWI 4E7IA 2K9MA 1T56A 2VT3A 1KU3A 3K2ZA 3QPHA 4GDFA 1A31A 3J7ZI 4ZJZA 4ASNA 1ORKA
chains in the Genus database with same CATH topology
2V26A 5FRNA 3DEEA 1Z7LA 3AL0C 2KZVA 2RQQA 4KITB 3DKXA 3ZXSA 4ZDPA 4IZZA 4F92B 2K3PA 5LFAA 3KX2A 5HNHA 3I9V2 3RPUD 2X6XA 4B3XA 1D0YA 5HLTA 4DOZA 3FHNA 3S3MA 3EUKL 4XKCA 3OYHA 1FMWA 2DT6A 3AFHA 2VQHA 3C2GA 4BS9A 2KHMA 3HG9A 4XN3A 4BGDA 3HPGA 2W00A 3OS0A 4IQ4A 3K10A 4IKFA 2JSPA 1Z3XA 2GOXB 3PJRA 4PUSA 2HQAA 1DP3A 4ANJA 3SZGA 3H0DA 4B44A 1Z21A 2VJ4A 1WJ5A 3HC7A 2WAQA 2AQEA 1WJFA 2DT7B 2IS2A 4HNTA 3H9GA 1FMVA 4RM3A 2VXZA 3OYBA 4DIQA 2X51A 2DCEA 2V1NA 2HDWA 2IGNA 2Q1ZB 3OWTA 2A6TA 4PSXA 3QYFA 4CUGA 2WADA 4HPQA 4ZC3A 4C30A 3H9QA 2F6CA 3VYUB 3DTEA 2JVHA 2VLAA 4BQQA 2L5QA 3DLAA 2VKHA 2E5ZA 3DQVC 4P1WA 4G6TB 3LSKA 2R7WA 2MYSA 4BEHB 4J01A 3OOUA 3PSFA 2HU9A 3LSMA 3K70D 1MMGA 2A5WA 2OC6A 3ZRGA 3S93A 2CUZA 3K4NA 3RCOA 2M4KA 3CESA 2K9LA 1V5FA 3VWBA 5KCMA 1UAAA 3A2KA 2L2OA 4BUPA 2KDOA 2ZXHA 2DOAA 2KL4A 3AKZA 4Y33A 2XAUA 2VASA 3H5RA 4YRVA 2CW8A 3BG7A 3DPTA 3LFUA 1D0XA 2M3AA 3VSLA 4HSTA 3OYKA 4MLOA 2X6WA 1ERDA 4PK4A 2VIXA 2UV1A 3DTIA 4CSWA 3BG6A 3MD2A 1DGRM 1VZ0A 3OIQA 4U87A 4XOTA 1U0JA 3PNVA 5CQGA 2Z16A 5HVQC 3QYEA 2HNHA 4BL0B 5CPRB 1NG6A 3H9JA 2LH9A 1V5GA 2LBFA 3K4LA 2V6EA 2WAEA 4XLEA 2R7QA 4RLQA 3FBIB 3AL0B 1G59A 4DBRA 3D5RC 5KNLA 4BEHA 1YX5A 4CCMA 3HOTA 4C2UA 3TMOA 2L9SA 1X4OA 1K6YA 4CCOA 1G8XA 1WJDA 3OR1C 4RLFA 3W2VA 2V7FA 3MKWB 1WFXA 4HEA2 3KEYA 2HVQA 4XLAA 1TZLA 4HSRA 4F93B 3SDBA 2XDVA 3MKZA 2CV0A 2DXIA 4IQJA 2BW3B 2K5CA 1MW7A 1BR4A 4BJ6C 1LDKB 4N4NB 4Y4RA 4LIUA 3L2WA 2P0WA 4PFPA 3OL4A 4PJMA 2IXSA 2KMUA 3E0JB 4BU2A 3I3LA 2VJJA 2ZXIA 2F5VA 4ZDOA 4HNUA 2ZFUA 2UWMA 3OYJA 3C2HA 1E0EA 4D1QA 2MD0A 1TT0A 2VL8A 3PNYA 3S8PA 1LFPA 4B43A 2KRCA 3HPHA 4ZTJA 4CH7A 3EUHC 4NC7A 3K4MA 2UUZA 3EUAA 2FUG2 4DBQA 3RQ4A 3VDXA 4RMNA 3K70C 3CMMA 3QOEA 3U21A 2BVMA 1GLNA 2L7KA 3DPUA 1X1CA 3OYCA 1IRXA 4BQNA 5KHDA 4FASD 2XF7A 2XSJC 2M7AA 1QHGA 1NG7A 2KQRA 1EA3A 3V42A 2VQLA 4XKVA 2PJRB 1QHHD 3L2UA 2OV7A 4ITVA 1JI8A 1OLTA 3IAM2 4NQWB 3L2RA 3H35A 2LG4A 4KJZA 4ZTFA 3SEZA 4P5OA 2ELJA 2R7XA 2Q2EB 2R7RA 3OS1A 3ONQA 2CW7A 3G2BA 3M1CA 4XQFA 3DU5A 3SEQA 2KRHA 1J09A 3LSGA 2VPLA 3OYGA 3OIPA 4JQFA 2F4IA 2PMZA 2WAFA 4OWRB 2L9NA 2IGMA 4B47A 4E7HA 4KT6A 2VB6A 4LG3A 3MMYB 4J00A 2KLOA 3HUGB 1MMDA 4XORA 2CH0A 4DGWB 2R7TA 2X1CA 3UNGC 4XONA 4PFOA 2MABA 3DKYA 3KYLA 3PFYA 3D5LA 4OAYA 3PSIA 5TGTA 1OR7C 4H4KC 4XR6A 3FKJA 2M7BA 5FROA 4BACA 4Y3OA 4OAZA 1MMNA 2W7NA 4D9JA 4E7KA 4LIVA 2HZDA 1YX3A 3DWLE 1Y6IA 2QKLB 1MNEA 3VYSB 3BCAA 4F3QA 2R7UA 2DJIA 2M4GA 1T0FC 2LRDA 3OY9A 4HRIA 3CF2A 3K4JA 3CJQB 2Y0SA 2CV1A 2VJIA 1PYVA 2LOOA 3VYRB 2RNGA 1YE9A 4F91B 4C9YA 3PUBA 1X1DA 3ZQQA 2R7VA 2WA0A 4XOPA 4XN0A 4FETA 2CMPA 2AQFA 2BVLA 3TBIA 2WB1A 2HVRA 4BE0A 1UG0A 2Z2SB 2E60A 3ZGKA 3PNTA 1WJBA 1S9HA 3LSIA 3OYEA 3OMYA 3VYTB 1WJAA 4XNFA 2VQGA 1D0ZA 3HOSA 1WJCA 3W2WA 3DU6A 3CJRB 3HXLA 1QU3A 4XLCA 1X19A 2OUMA 4XKBA 3S32A 1AA7A 2XF6A 3HKZA 3OYNA 1W36D 3QYBA 3QODA 4F55A 2O5RA 2BOLA 2HPMA 3FDYA 4DJAA 3D5SC 4BQOA 2R4GA 3LMMA 3H5NA 3VSKA 5JHFA 4XLFA 2X1DA 4ZYAA 4PJJA 3RTRA 5HNFA 5LD2C 4U7BA 3L2VA 2X85A 2CS3A 1SFKA 3F9KA 1Y56A 1X4PA 3FBNB 1ZELA 3K4KA 2IS4A 2X6YA 1N75A 4B48A 3OYFA 3K6GA 3L2QA 2R7SA 2JA2A 1BR1A 1BR2A 1WJEA 4GRIA 2W1OA 4CCNA 1KONA 2ZSIB 4NUBA 1BOBA 4E6KG 2V9KA 3DTKA 2W82A 3LSHA 2V4JC 3ZCOA 4JOMA 1UELB 4CCJA 3OYAA 3BC8A 2E1MB 4R79A 4NNJA 2KPMA 3E1SA 4XM3A 2BW3A 3W3CA 3K4CA 1P9QC 2XC7A 4F52A 2RREA 3UR3C 1PJRA 4XMYA 4CA0A 4BE1A 4KISA 4YELA 5HOOA 4QPOA 3CZ6A 2WY8Q 3OYMA 3NWSA 4AVZA 2LC2A 4XKWA 4BDZA 2VQCA 3OR2C 2CUJA 4E7JA 2CV2A 4BE2A 4E7ZA 2E1MC 4AYBA 3SYTA 4E4HA 2KP6A 3RSNA 1DGWY 4QPQA 3W2AA 3IAS2 2LBFB 3ZR8X 2MFZA 1LVKA 1DQUA 2IGOA 2JUGA 2JVGA 1T95A 4LITA 1Z3YA 2Z1DA 2M0MA 3NWTA 1X1AA 1R6RA 4YEJA 3IUOA 2GOMA 2MC4A 2WY7Q 2PJRA 1LKXA 1N77A 4EATA 2IS6A 4BJTA 4C2TA 4CZCA 4E7SA 4PJLA 2HVSA 4CCKA 1W36C 4BXFA 1D1BA 3CP2A 1V5EA 3TL4X 4XL9A 2R7OA 4XLHA 3GBGA 4X0GA 3OL3A 2LYCA 4N4OB 2CFOA 4PSWA 1HA8A 2X1EA 3OYLA 2E5NA 2HPIA 4RM2A 2I8DA 2WBMA 3HL2A 3S3OA 4ZDLA 3OS2A 2IGKA 4IX7A 4NC8A 3M8JA 1SAUA 4CCLA 4BJ5C 2VJ5A 4BDYA 2LY1A 3OYDA 3LL7A 3BLYA 3J7AY 5CQEA 1N78A 2XF5A 4PJNA 4II3A 2W4SA 3MKYB 2NOJB 2LREA 1MNDA 3DPLC 5CKTA 2IS1A 3N05A 3S3NA 2VXDA 1X1BA 1D1AA 3CP8A 3A4CA 3H5AA 2ZSHB 5FRMA 3A1YA 3PL8A 1MMAA 3EPZA 2QKMB 2VKDA 3BCBA 3OYIA 4HG2A 3K4BA 2K9MA 4E7IA 1D1CA 2LY2A 3IP4B 4II2A 4ZJZA 4AU7A 4E7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DGW B;  2E60 A;  1X4O A;  2E5Z A;  1X4P A;  2DT7 B;  1UG0 A;  2DT6 A; 
#chains in the Genus database with same CATH topology
 2V26 A;  3GVA A;  5BS6 A;  5TRD A;  5K7Z A;  1X3W B;  3F8F A;  1HBX G;  4PGG A;  3DKX A;  1MDM B;  2GM4 A;  5IYC J;  5DD8 A;  1W1W E;  4D7N A;  3KX2 A;  4BBR J;  5HNH A;  3I9V 2;  1T2K A;  1FZP B;  3HZJ A;  1V55 H;  2OTJ I;  3EUK L;  4HBL A;  3HGY A;  4A12 A;  1JUM A;  3AFH A;  2DT6 A;  5LHI A;  5CLS A;  4B09 A;  2LNB A;  2FSW A;  1IN7 A;  3CC2 I;  4MHG A;  1KA8 A;  3V8J A;  1Y8R B;  4OIN F;  3HPG A;  4HF0 A;  1BIA A;  2W00 A;  3OV8 A;  1SAN A;  2QUF A;  2R5Y B;  3GTQ J;  2Q0O A;  2GOX B;  2HQA A;  1DP3 A;  5F08 A;  2MBF A;  1WJ5 A;  3HC7 A;  4IL6 C;  1IDZ A;  2AQE A;  1WJF A;  3CC4 I;  5ILV A;  1S6L A;  3BZK A;  4HNT A;  4RBO A;  1OFC X;  2VKE A;  1LVA A;  3Q0U A;  3H9G A;  2IP2 A;  4RM3 A;  2FML A;  3OYB A;  4UUV A;  2X51 A;  4TV7 A;  4UHT A;  3CCJ I;  2HDW A;  5M3F J;  1BM9 A;  1IO2 A;  5FO5 A;  1A04 A;  2Q1Z B;  1YTY A;  3S14 J;  3CC7 I;  1MSE C;  3HDD A;  3MWM A;  4OMZ A;  3JR9 A;  3QYF A;  1HLV A;  4HPQ A;  2NRA C;  2G9W A;  1XX5 A;  2HS5 A;  5LHG A;  2F6C A;  3TO9 A;  1Z1D A;  2DDB A;  2VLA A;  2XKP A;  4CO8 A;  4D5C A;  3DLA A;  2YX4 A;  1QZE A;  3ZOB A;  3GTP J;  2XIG A;  3E7L A;  3WU0 A;  4RAZ A;  4L9J A;  3PSF A;  5C3E J;  2VC1 A;  3SFZ A;  3GXO A;  1ZRE A;  1IN5 A;  1UHW A;  1TP4 A;  4I0B A;  2J5O A;  1G6N A;  2XRL A;  2E2J J;  1MMG A;  2A5W A;  2OC6 A;  5IOZ A;  4UUS A;  2E2H J;  3H3V K;  2D1V A;  2AHQ A;  5JI6 A;  3CES A;  2RDP A;  4M6V A;  4Q4Z F;  3CO7 C;  1RPW A;  3RI4 A;  1OPC A;  2L2O A;  3NAU A;  1BC7 C;  1XC5 A;  2TRT A;  3J81 K;  3HOU J;  4YRV A;  4OIQ F;  2DJN A;  5FLX Z;  2QEX I;  3DPT A;  3ISP A;  2RV8 A;  4BXX J;  4HST A;  1LUJ B;  3RZD J;  3W6J B;  1IRF A;  4WK8 F;  2UV1 A;  5A2Q Z;  3S2D J;  1XN7 A;  2NNY A;  5K7H A;  1PUF B;  2K9Q A;  1VQ6 I;  3BG6 A;  3RPQ A;  1YHQ I;  1ZRC A;  3OIQ A;  5DDG A;  1IXS B;  3KZZ A;  5CQG A;  4G7H F;  2H09 A;  5HVQ C;  3CF5 F;  4GFB A;  4ZYE A;  5J40 A;  5FLV A;  2EQR A;  5F0C A;  1YW8 A;  4ENM A;  2R7Q A;  3T0Y A;  1T0F A;  2X48 A;  2WWY A;  3FBI B;  1A35 A;  1OKR A;  2IA2 A;  3S16 J;  1WHU A;  2NVY J;  5CVV A;  3D5R C;  5FD6 A;  1XMX A;  4BEH A;  1MBE A;  5KNL A;  1FLI A;  5HS9 A;  1F36 A;  1J59 A;  1YX5 A;  2DAO A;  3I54 A;  1UCR A;  1ETQ A;  2HTJ A;  4C2U A;  2JN6 A;  3WTY C;  3HRT A;  5IY5 H;  1X4O A;  1MMS A;  3FHZ A;  1WJD A;  5IT9 K;  3MKW B;  3ABK H;  5B1B H;  4HEA 2;  1IV6 A;  3KEY A;  5ILU A;  3RDI A;  1RI7 A;  2F5C A;  3MKZ A;  2QEN A;  1YRN B;  3TOB A;  2CV0 A;  2K5C A;  3AG2 H;  1MW7 A;  1W5T A;  2HOA A;  3BJA A;  1BR4 A;  3FXM A;  2ZME A;  4UVA A;  4BJ6 C;  1XPX A;  4KYW A;  1LDK B;  1XGN A;  3Q3S A;  2LTP A;  2LSO A;  2VC0 A;  1QZZ A;  1K78 B;  2IXS A;  3E0J B;  4BU2 A;  3I3L A;  3Q9S A;  2FOW A;  5E8G A;  3C7J A;  2CU7 A;  2HGC A;  4U0W A;  1LFB A;  2E7X A;  4M6X A;  4D1Q A;  2D1H A;  4A5M A;  1KGS A;  3S1R J;  1Z67 A;  5LEK A;  3PNY A;  4PZJ A;  4B43 A;  1L3L A;  3HPH A;  2HOS A;  4CH7 A;  3EUH C;  4NC7 A;  4AD9 A;  4RDU A;  2ZJR F;  1DU0 A;  5EF6 A;  2HR3 A;  1LPQ A;  3P9C A;  3VDX A;  2FNP A;  1WRJ A;  3CMM A;  1Y0N A;  3GTM J;  4IPA A;  3GF2 A;  1X1C A;  2H8W A;  5GAG J;  4CXF A;  1P92 A;  3IRR A;  1XSD A;  1HST A;  4BQN A;  1A36 A;  5IYD J;  3VFZ A;  1Z6T A;  2R5Z B;  2MA3 A;  5CVI A;  1GVD A;  2WAQ N;  4AVP A;  1U9O A;  3WHB A;  4OMY A;  4KDP A;  1ENH A;  1WH7 A;  1WI3 A;  2OJE D;  3QPT A;  2AXT C;  1ZGW A;  2CSO A;  3BR2 A;  3H35 A;  4ZTF A;  2A6E F;  4LD5 A;  3C18 A;  3JSO A;  4P5O A;  4UY8 I;  2HTS A;  4G7Z F;  5DS9 A;  4DZJ A;  3WU1 B;  2COM A;  3F8C A;  1XS9 A;  1TNS A;  3ZQL A;  3OS1 A;  2XB0 X;  1SEU A;  2W57 A;  1R23 A;  2LF8 A;  3JRD A;  3M07 A;  1GVJ A;  5F0F A;  5HLI A;  1J09 A;  3OIP A;  1SVM A;  3F8B A;  2F4I A;  2HYF A;  2PMZ A;  2WAF A;  4LLN A;  2IGM A;  3FXR A;  2CQX A;  2CJJ A;  4J00 A;  2KLO A;  1APL C;  2EFQ A;  5K7F A;  4XOR A;  1Y8Q B;  2CH0 A;  4HX7 A;  2R7T A;  2DYS H;  1E2X A;  3HIF A;  3M3Y J;  4E70 A;  3ELK A;  2OD5 A;  4KT5 C;  2XUB A;  3L9F A;  2ID6 A;  3BTI A;  4V19 K;  1S72 I;  1OR7 C;  4H4K C;  4XR6 A;  5F27 A;  1X2N A;  2M7B A;  5FRO A;  4BAC A;  1A6Q A;  3R0A A;  1ETO A;  4MQ9 F;  4OAZ A;  5BQT A;  1MMN A;  2H1K A;  1OYW A;  2HEO A;  2BY0 A;  3VB2 A;  2HYG D;  3OIO A;  1IDY A;  4G6Q A;  5C4J J;  1L0O C;  2QKL B;  1MNE A;  4GGG A;  2M4G A;  1VQ8 I;  5DM6 F;  3BZ6 A;  5HDN A;  4IEJ A;  4DYQ A;  4OIO F;  1PP7 U;  5M3M J;  2Q2E A;  2AXL A;  2DTZ A;  4ON0 A;  3S1M J;  1FY7 A;  2VBX A;  2UXN A;  4LLL A;  4FQG A;  2JK3 A;  1X1D A;  2KJC A;  1LEB A;  2BXZ A;  2E19 A;  3LQQ A;  3MZH A;  1J0R A;  3BQY A;  2WV1 A;  1T08 B;  2WB1 A;  2HVR A;  3K1P A;  5GPC A;  4BE0 A;  4LG0 B;  2HXI A;  4NB5 A;  1TQP A;  1FEX A;  2CFX A;  5J6X A;  1F9N A;  1ACI A;  2NAZ A;  2PI0 A;  2B7E A;  2L01 A;  3K1M A;  4B1R A;  3GTO J;  4ENN A;  3S2H J;  2VBY A;  1OCO H;  1X1P A;  1H9T A;  5L3D A;  4WXC A;  1U5T C;  4XNF A;  2VQG A;  3KP7 A;  3Q0W A;  3WE3 A;  1FP2 A;  9ANT A;  3K7A J;  1D5Y A;  1QU3 A;  1V3F A;  1W36 D;  3B6A A;  1QO0 D;  1YIO A;  4YFK F;  3CCV I;  2B9S A;  2K27 A;  3RYR A;  5EDN A;  3FDY A;  4DJA A;  4HX4 A;  1SD6 A;  3LMM A;  3H5N A;  3SXY A;  3VSK A;  3JRG A;  3LFK A;  4UVC A;  4FX0 A;  4PJJ A;  2O8X A;  3TOA A;  4HDV A;  4O3M A;  2EV5 A;  5GTI C;  1N75 A;  3OYF A;  5JR3 A;  3K6G A;  3L2Q A;  2R7S A;  3QPS A;  5DUK A;  4RB0 A;  1BR2 A;  3TDU C;  2D2W A;  1OCT C;  1ONV A;  2EZI A;  2GA1 A;  1KON A;  3G1M A;  1K7A A;  3O8G A;  4NUB A;  2XAS A;  4O5V A;  5D5U B;  3ZCO A;  2V79 A;  1ZTR A;  3FXJ A;  1YOV B;  1UEL B;  4IHS A;  3OYA A;  2J5P A;  4R79 A;  4NNJ A;  3GLX A;  1JTY A;  4ZH4 F;  1VQM I;  4B3A A;  3I4P A;  3JW4 A;  4HQM A;  4W97 A;  1XMK A;  3W3C A;  2LK2 A;  2XC7 A;  2GLO A;  2RRE A;  2DA5 A;  2STT A;  1PJR A;  2M30 A;  4CA0 A;  3BWG A;  3P7N A;  5F04 A;  1BBY A;  3FF5 A;  1SC7 A;  3WTW C;  2DW4 A;  3GCM A;  2IT0 A;  2HZT A;  1SFE A;  1P4X A;  1A6I A;  3BJO A;  3OR2 C;  2CUJ A;  4BE2 A;  5E20 A;  4E7Z A;  2E1M C;  4AYB A;  5F1R A;  5CVU A;  2ZFW A;  3KP4 A;  4S04 A;  4ZYG A;  2LBF B;  2MFZ A;  1JUP A;  2Y48 A;  2IGO A;  3IL2 A;  2VOO A;  1V4R A;  2O03 A;  4M3B A;  1SD7 A;  3KPH A;  1ZHF A;  2H8R A;  1Z3Y A;  2ZB9 A;  2W25 A;  4EMS A;  1YFH A;  1LQ1 A;  5EG0 A;  3BG9 A;  2K7L A;  4RA2 A;  1R6R A;  1R36 A;  3V4G A;  3V7C A;  2VOP A;  3V8L A;  4I6Z A;  2WY7 Q;  1BOA A;  1W7P B;  5J1R A;  4JX6 A;  1IN4 A;  5EGO A;  4X1E A;  1J9I A;  1WGX A;  2KT0 A;  2VI6 A;  4GYI A;  1SFO J;  2NS0 A;  4NQW A;  4EM1 A;  1FPQ A;  4A93 J;  2A3S A;  4CCK A;  3GTL J;  4Q5S F;  2KIQ A;  3GFL A;  3HBL A;  3IWZ A;  2R7O A;  5B3S H;  2HFH A;  2BY3 A;  2H6B A;  3HJE A;  2GZW A;  2DQL A;  4M3E A;  4WXH A;  4PSW A;  3EYY A;  1U5T B;  2X1E A;  2E5N A;  2HPI A;  1VI0 A;  2DDA A;  3BR1 A;  4WCG A;  2DA7 A;  1EV7 A;  4ZDL A;  2IJL A;  2IVM A;  3M8J A;  4LGW A;  2FA5 A;  1R1U A;  3GUD A;  2XV4 S;  4QSH A;  1X3Z B;  3HUG A;  4HW0 A;  2GQQ A;  5ICF A;  1I50 J;  1JJ8 C;  1TWC J;  3B02 A;  2EIK H;  2MGQ A;  3FXO A;  3GME A;  3J7A Y;  1GUU A;  1N78 A;  4PJN A;  4ABZ A;  1W5S A;  3DPL C;  1PUE E;  2FEZ A;  4EGY A;  3T8R A;  1X1B A;  3PO3 J;  3OSF A;  4U0V A;  2ZSH B;  2NVU B;  4IRI A;  1WVR A;  2QKM B;  2VKD A;  3BCB A;  2ZJP F;  1B59 A;  3CUQ C;  4Q47 A;  1NK2 P;  4G94 A;  1IC8 A;  2LY2 A;  3IP4 B;  4BY7 J;  4II2 A;  2KFD A;  4AU7 A;  2OCC H;  1HKQ A;  5ILS A;  3DEE A;  3HKZ N;  5DTD A;  2ZXJ A;  1ZKG A;  1J75 A;  2EB7 A;  3K2A A;  4HYE A;  1VQ7 I;  4MQV A;  1P7I A;  4IZZ A;  4F92 B;  2IPQ X;  5LFA A;  1YJ9 I;  3I4M J;  1TLH B;  3S3M A;  1QVT A;  5HLT A;  3ASN H;  4IJA A;  4M9S A;  2IEK A;  4UV9 A;  1P2F A;  1ETK A;  1NH3 A;  1OYI A;  2RAE A;  2PFB A;  1KU2 A;  2Z99 A;  3BPV A;  3HG9 A;  5TIS C;  4BS9 A;  2MD5 A;  2O8K A;  2YS9 A;  4MTE A;  3SJM A;  1ZGJ A;  3OS0 A;  4EQQ A;  3CDL A;  4PDK A;  2QLZ A;  1FNN A;  1KYZ A;  4ANJ A;  1G3S A;  4B44 A;  4XSZ F;  1FOX A;  2WC2 A;  3MVP A;  2NVQ J;  1WCM J;  3P9K A;  4KNY A;  1B8I B;  3WOD F;  1JJ6 C;  4A3K J;  1S29 A;  5LRS A;  1SAX A;  4L5I A;  4DIQ A;  1BW6 A;  3WU2 C;  2IGN A;  2NVT J;  3P5J A;  1XDU A;  2WTE A;  3OOP A;  4HV6 A;  1BI2 A;  1I39 A;  3CCY A;  4M9Z A;  4B8X A;  1B1B A;  3L00 A;  2WAD A;  4CUG A;  2VBW A;  5L3B A;  4C30 A;  3VOD A;  3M8F A;  1Z05 A;  3DTE A;  2DK8 A;  3TGN A;  1YS6 A;  4LB5 A;  4EEF G;  2PQ8 A;  3ZP5 A;  3PQK A;  2HDD A;  1WH5 A;  4G6T B;  4I2O A;  4PGH A;  1VQL I;  2HYJ A;  2M8G X;  1ZLJ A;  2MYS A;  3JCU C;  4U88 A;  3CCR I;  4Y13 A;  1HW1 A;  2JJ7 A;  4AWX B;  1B6A A;  2M0C A;  2X4H A;  1OMI A;  3BT9 A;  3TP3 A;  3F72 A;  4A3J J;  3S93 A;  2FQ4 A;  2CUZ A;  3FKI J;  3K4N A;  1FYK A;  2C6Y A;  4A3G J;  5KCM A;  4MO7 A;  1SFX A;  1RNL A;  1FBQ A;  1XDS A;  2ZBK A;  3ECH A;  4AIK A;  1ON1 A;  3KEQ A;  3AKZ A;  4Y33 A;  1BIB A;  1D0X A;  4U7D A;  1WQ2 A;  3E6M A;  4MLO A;  2X6W A;  1JKP C;  2K4J A;  4PK4 A;  2VIX A;  1LE8 B;  1B9N A;  2E1O A;  3LAJ A;  5EZG A;  3ZQ7 A;  3O2P E;  2O61 A;  1VZ0 A;  4I99 C;  5FKO A;  3KP2 A;  3PNV A;  2Z16 A;  2EWN A;  3CUQ B;  4JP0 A;  4BL0 B;  1NG6 A;  2DFF A;  1YO5 C;  4IOC F;  2H6C A;  2XGX A;  4G7O F;  2R3S A;  2QZ8 A;  2A07 F;  3M4O J;  1UB9 A;  1BI3 A;  1ETY A;  3KE2 A;  1KZH A;  2ICW G;  4DBR A;  2Z5U A;  4A3L J;  5J47 A;  1X58 A;  3HOT A;  2JRT A;  2L9S A;  2PMU A;  5J1U A;  1K6Y A;  4OU0 A;  2K86 A;  2V7F A;  1TWF J;  2HVQ A;  4A0Y A;  3GZN B;  3KEO A;  2P5L C;  4IQJ A;  2BW3 B;  2XAQ A;  3H3U A;  4HF1 A;  3DXJ F;  4QWQ A;  3I56 I;  4JK1 X;  2PJP A;  2ETH A;  1VQ9 I;  1F43 A;  4CIC A;  2H94 A;  3HOW J;  5BNG A;  4LIU A;  2PX9 A;  3L2W A;  2P0W A;  4PFP A;  1D8K A;  3ML6 A;  4LK0 F;  2VPR A;  2VJJ A;  4ZDO A;  2F5V A;  2P6T A;  2PEX A;  5D4S A;  3OYJ A;  3WE2 A;  3HSE A;  1OCZ H;  1AOY A;  1TQI A;  2MD0 A;  3S2W A;  2KRC A;  3TW7 A;  4XLP F;  4FCY A;  3HM5 A;  4ZTJ A;  2MH2 A;  2M45 A;  2UUZ A;  4DBQ A;  3KP6 A;  5IYB J;  1O3Q A;  4NBQ A;  3K70 C;  3QOE A;  3U21 A;  4S05 A;  5E79 C;  3OYC A;  4IHY A;  2DQR A;  4FAS D;  5E3O A;  2XSJ C;  2KQR A;  1NG7 A;  3J7Y J;  1SMT A;  2P81 A;  3V42 A;  3GZ6 A;  2VQL A;  2OTL I;  3G71 I;  4XKV A;  5LGN A;  2PJR B;  1BI1 A;  3FMR A;  3TW6 A;  2GXA A;  3LSP A;  1T38 A;  1JI8 A;  1OLT A;  3P9I A;  2ESH A;  2P4W A;  3SEZ A;  1TWH J;  2YPR A;  3M8E A;  3LSR A;  4A3D J;  1I1G A;  5JVT A;  4CGZ A;  4FT8 A;  5LRR A;  3JRH A;  1ODD A;  2CO5 A;  4RB1 A;  1JT0 A;  3ONQ A;  1DPR A;  4G9Y A;  2R93 J;  3G2B A;  2YU3 A;  2LY9 A;  3M1C A;  2CWE A;  2KRH A;  2QQ8 A;  4HX8 A;  2NXN B;  3SQN A;  4A0X A;  3WTX C;  1B4A A;  4LJZ F;  2XAF A;  1WI9 A;  2GIZ A;  4OWR B;  1RET A;  3F0C A;  2QA4 I;  2VB6 A;  3MMY B;  2FX0 A;  4JYK A;  3GFM A;  1XCB A;  4IHT A;  4IO9 F;  1IN8 A;  2IW5 A;  2X1C A;  2R7D A;  5KVR A;  2CQK A;  3I59 A;  3PM1 A;  5LEJ A;  3KYL A;  1S7O A;  3F8N A;  5M5X J;  2CUF A;  4ZZL A;  4P9U A;  3D5L A;  1YW9 A;  4OAY A;  2CGP A;  1WZ2 A;  3ZMV A;  3KP5 A;  1E17 A;  2YU9 J;  3FKJ A;  2NOG A;  4ENJ A;  1Y1V J;  3HHH A;  1RUN A;  3A03 A;  3RKY A;  2HZD A;  3J81 Z;  1YX3 A;  4CDG A;  1AU7 A;  2M87 A;  4CZZ A;  3J80 K;  1Y6I A;  2E71 A;  2XAH A;  4F3Q A;  5ICC A;  3LST A;  1T0F C;  4EVI A;  5J3L A;  5D4R A;  1QVU A;  3TO6 A;  3OY9 A;  1IRZ A;  1AKH A;  4UUT A;  3B73 A;  3CJQ B;  5D5V B;  2Y0S A;  2VJI A;  4F91 B;  3AG4 H;  1YE9 A;  4YG2 F;  1ZR4 A;  2RQP A;  4V2G A;  2FBI A;  2O7O A;  4RGR A;  2STW A;  4XOP A;  2NYX A;  1K83 J;  3E5Q A;  1FBU A;  1F5T A;  1XCV A;  2CMP A;  2ESN A;  5L3C A;  2JA7 J;  1UG0 A;  5CVR A;  2DPD A;  2QSH X;  2ZME C;  1R00 A;  1S8N A;  1Q1H A;  3WTS C;  1WJB A;  3LSI A;  4IXA A;  2A5Y B;  1K61 A;  3VYT B;  3A01 A;  3OSG A;  5D8L B;  3IWF A;  1WJA A;  1I27 A;  3G3Z A;  3KYC B;  2ZO4 A;  3VEP A;  1OCR H;  5IT9 Z;  1IJW C;  3FXQ A;  1LDJ A;  4BNC A;  3DU6 A;  3IH3 A;  2JA6 J;  1UST A;  1SD4 A;  2EFN A;  4QTR A;  1EKE A;  3IHU A;  2XF6 A;  4XKB A;  1TQM A;  2LR8 A;  3HSF A;  3QOD A;  3CMA I;  4F55 A;  1CF7 A;  1XGM A;  2DO7 A;  2HI3 A;  4UB8 C;  3JAM K;  4BQO A;  3HTU A;  5F0H A;  4I02 A;  3M7G A;  3CLQ A;  2X1D A;  5HNF A;  3MQ0 A;  4UXN A;  2G7H A;  5LD2 C;  3EYI A;  1T39 A;  4U7B A;  2I10 A;  3L2V A;  1KQ0 A;  2CS3 A;  5ICG A;  1X4P A;  1ZEL A;  3K4K A;  2IS4 A;  2X6Y A;  2H1L A;  1ON2 A;  2PMH A;  2EIM H;  1BR1 A;  3QU6 A;  1WJE A;  4C3H J;  4FIS A;  3E5X A;  5FFX A;  2JSC A;  3G73 A;  4MEY F;  1VQ5 I;  1TWA J;  2Y0M A;  1B9M A;  2DOD A;  3PUF A;  2V9K A;  4S0H B;  4UUS B;  3LSH A;  2Y75 A;  3RIR A;  2CQQ A;  1NK3 P;  3MZ8 A;  3BC8 A;  2EIJ H;  3EUH A;  3BR0 A;  5E1W A;  3MN2 A;  3AG1 H;  3COA C;  3WGH A;  1QQI A;  1VTN C;  2MW8 A;  1P9Q C;  3WHC A;  1QPI A;  4RB3 C;  1LJ9 A;  1Z6R A;  4XMY A;  1GV2 A;  1N25 A;  2VN2 A;  5HOO A;  4KIS A;  3CCU I;  2AO9 A;  1U78 A;  4I09 A;  3WG7 H;  2OCE A;  1JHH A;  3E6B A;  2L54 A;  2EZH A;  3JRC A;  2CG4 A;  2EV6 A;  1P4A A;  4P96 A;  1G4D A;  2AS5 F;  2QBY A;  2L0K A;  3T8T A;  1SVL A;  4QPQ A;  3NQO A;  3W2A A;  2LF7 A;  3WTT C;  3IAS 2;  2GBY A;  1B72 A;  4G6D A;  2JMW A;  1DQU A;  4J19 A;  1MIJ A;  2PMZ N;  3SDG A;  3ZQH A;  5F64 A;  2F48 A;  2JVG A;  2JA5 J;  2HQR A;  3H3Z A;  3PQJ A;  1W4M A;  3SFI A;  1D5V A;  3HOV J;  3QAH A;  2EFW A;  3I53 A;  5LHH A;  4M3F A;  2DMN A;  3IUO A;  5JVG F;  1R71 A;  5HDK A;  2XPU A;  1N77 A;  3MFK A;  2KIU A;  2H27 A;  4BHP A;  4YFX F;  5FLM J;  4H0E A;  4C2T A;  3BQZ A;  3FMQ A;  2KIS A;  3FXK A;  4WXD A;  1R5H A;  5FKL A;  1FSH A;  2Y69 H;  2ZME B;  1YIT I;  3CP2 A;  4FX4 A;  1V5E A;  1F1Z A;  2ZNZ A;  3GBG A;  1T33 A;  3GTJ J;  5FFZ A;  4C3I J;  1H0M A;  3OYL A;  1OQY A;  1RUO A;  3HL2 A;  2WBM A;  3BR3 A;  3DKW A;  1OR7 A;  2FBK A;  4HAM A;  4IOA F;  2EV0 A;  5FKK A;  3ABM H;  3OS2 A;  2IGK A;  4IX7 A;  3EQL F;  4NC8 A;  1U6G A;  1VQK I;  2Q8K A;  1FYM A;  2XPW A;  2EFP A;  4BJ5 C;  1OCC H;  5DV5 A;  2KIM A;  2LY1 A;  5D6F A;  2K9S A;  4Y7N J;  1DPU A;  2JPB A;  5BPD A;  5K5O A;  1ZLK A;  4KIB A;  2HKO A;  5C44 J;  2WB1 N;  2XPV A;  5CQE A;  5HS8 A;  2QQA A;  4RAY A;  2XF5 A;  4XRS A;  1GDT A;  2W4S A;  2NOJ B;  1U2W A;  2M5W A;  1R4N B;  1JKQ C;  1FOW A;  1D1A A;  1MBF A;  1RIO H;  4IHW A;  3F6V A;  2DA2 A;  3PL8 A;  5FB2 A;  4YIF A;  3EDP A;  4MTD A;  3I64 A;  5DUI A;  2R92 J;  3I0T A;  3DV8 A;  2W24 A;  1O57 A;  4HA8 A;  2LLK A;  4KMU X;  2BY1 A;  1CQT A;  4M74 A;  1VF9 A;  2DT5 A;  4E7L A;  5FRN A;  3KIO A;  5FKM A;  2B63 J;  4BHC A;  2FF4 A;  4FTH A;  1IV8 A;  3HSR A;  4ZDP A;  3Q5F A;  3RPU D;  5DCM A;  4JX5 A;  2X6X A;  2K4B A;  4M72 A;  4B3X A;  1D0Y A;  3RZO J;  3OYH A;  4WWC A;  1ZQ3 P;  1FMW A;  3FM5 A;  3BTJ A;  4ETS A;  1MZB A;  1MKM A;  2FOK A;  2KHM A;  2OQR A;  1KYW A;  4XN3 A;  4BGD A;  1HDD C;  1J5Y A;  1EH7 A;  2V1D A;  2ISZ A;  3FM3 A;  4IQ4 A;  1MH4 A;  3K10 A;  4IKF A;  2JSP A;  4A3M J;  2EPF A;  1XGS A;  3KYD B;  2VE9 A;  3PJR A;  1R7J A;  1TL8 A;  3IH2 A;  3K0L A;  3H0D A;  3BPX A;  3TP0 A;  3G6E I;  3WTU C;  5AIQ A;  3I58 A;  4OOI A;  4Z6Y A;  2ISY A;  2X6O A;  3J7A O;  2DPU A;  3BY6 A;  2KJB A;  1HF0 A;  5HS7 A;  3IV5 A;  2V1N A;  3DF8 A;  5GAH J;  3I4N J;  2Y9Z A;  3BR5 A;  2VT2 A;  3IH4 A;  2MLG A;  3GWZ A;  3E5U A;  2JT1 A;  2LKP A;  3BTC A;  3ZMS A;  3VYU B;  1JT6 A;  2JVH A;  5GTH C;  4EJT A;  1ZG3 A;  2VKH A;  2E5Z A;  1U8B A;  1MJB A;  2CRG A;  1ETX A;  4MFD A;  4P1W A;  2IA1 A;  1RR7 A;  3JTG A;  3LSK A;  3GTG J;  2DFE A;  4AYB N;  4Y15 A;  3CCM I;  3RKQ A;  1HQC A;  4XK4 A;  3QRF F;  3OOU A;  3N4M A;  4L5J A;  3GLL A;  2CUE A;  2HU9 A;  2L9V A;  3ZRG A;  1XB4 A;  2CQ7 A;  1HW2 A;  1A5J A;  3U1K A;  3RCO A;  3IKT A;  4CYC B;  3PFI A;  5IP9 J;  2EK5 A;  4A6D A;  1Z91 A;  1UAA A;  3FMS A;  4LOC A;  5IPA A;  3A2K A;  1KU9 A;  4BUP A;  2KDO A;  3B6C A;  2ZC2 A;  1HW5 A;  2XKO A;  2XAU A;  2VAS A;  1NTC A;  3H5R A;  2CW8 A;  3M9A A;  3BG7 A;  3VSL A;  2M3A A;  4L5E A;  3OYK A;  1FOY A;  2QGU A;  5J8F A;  4ESJ A;  4EGZ A;  5JHU A;  1WPK A;  3DTI A;  3LA3 A;  4CSW A;  3KP3 A;  2QF7 A;  1DGR M;  4A5N A;  4RGS A;  3CTA A;  4UV8 A;  1OYY A;  4PCQ A;  2HNH A;  5CPR B;  2E1N A;  3PIP F;  3H9J A;  3AAF A;  1G3Y A;  2YSR A;  5ICE A;  1V5G A;  1UMQ A;  4MGR A;  2FNA A;  2V6E A;  1IF1 A;  4L9N A;  2RGV A;  2M1B A;  5HLG A;  3GO5 A;  1G59 A;  4Y52 J;  1EJ9 A;  1EH6 A;  4DQ2 A;  1HOM A;  3A0B C;  4AC0 A;  2FE3 A;  4CCO A;  1G8X A;  4RLF A;  2RVC A;  2HXO A;  2Y9Y A;  5E1Z B;  3W2V A;  3HEF A;  4AIH A;  4BAY A;  3QP6 A;  1RRJ A;  3ERE D;  3MKL A;  2E35 A;  1TZL A;  3A02 A;  4HSR A;  3SDB A;  2DMT A;  2XDV A;  2BBY A;  2QCO A;  2F5F A;  1P4W A;  2NS8 A;  1DUX C;  3M1E A;  2IAI A;  1H8A C;  4A6E A;  3RYP A;  4N4N B;  2BXY A;  4Y4R A;  1TW3 A;  3FIS A;  2MLK A;  3ZMT A;  2ZXI A;  2PG4 A;  4HNU A;  4ESB A;  2ZFU A;  2DFI A;  4RS8 A;  2QYO A;  3FX3 A;  2UWM A;  3TO7 A;  2D45 A;  1LB2 A;  2R0Q C;  3K69 A;  1TT0 A;  1LFP A;  4A2U A;  3ZN0 A;  3K4M A;  1W7P D;  3RQ4 A;  2M34 A;  4JBA A;  4BXU A;  2DK5 A;  1FT9 A;  1GXP A;  1GLN A;  2L7K A;  3DPU A;  4UVB A;  5E1X A;  2OU2 A;  3CCL I;  1IRX A;  1QNT A;  5LGU A;  1XSV A;  2JA8 J;  2JTV A;  5KHD A;  2XF7 A;  4WF2 A;  5EG0 B;  3CCS I;  1QHG A;  2DOE A;  2M9H A;  3G1L A;  1FSE A;  4MFE A;  1ZG1 A;  1QHH D;  1FBS A;  2P7C B;  5EGO B;  3ZMU A;  3U2R A;  4ITV A;  1PP8 F;  4NQW B;  4GCV A;  1H9G A;  2LG4 A;  4KJZ A;  1P7J A;  3F6O A;  1K4S A;  2A61 A;  2Y31 A;  3BP8 A;  2P8T A;  2ELJ A;  4XIC A;  5E8I A;  1ZN2 A;  1BL0 A;  1MDM A;  3A0H C;  1HKS A;  4LLG F;  4XID A;  5EYR A;  3F23 A;  1YIJ I;  1TBX A;  4BBS J;  5CJ9 A;  4F7Z A;  3DU5 A;  5JLW A;  3SEQ A;  3LSG A;  4IRH A;  1YYV A;  1R5G A;  1ZYR F;  2DA1 A;  2G7U A;  3OYG A;  3CCE I;  4HQE A;  2VPL A;  4JQF A;  4M73 A;  2RC4 A;  3ECO A;  4EM2 A;  5FD5 A;  2L9N A;  4B47 A;  1IZ1 A;  4E7H A;  1UJ8 A;  4KT6 A;  4LG3 A;  3E97 A;  5IOY A;  5L3E A;  3CCQ I;  2R5Y A;  1USS A;  1AWC A;  3ESW B;  2FD5 A;  3JRI A;  3HUG B;  1O3R A;  1MMD A;  1HCR A;  1IRG A;  4A3E J;  4DGW B;  1I6X A;  4XRS G;  3UNG C;  3HOX J;  5DD4 A;  4FE4 A;  1G2H A;  4XON A;  1HSJ A;  3DKY A;  1R9T J;  1KU7 A;  4L0Z B;  3JRA A;  3GX4 X;  1SD5 A;  2ZCW A;  2V9P A;  3PSI A;  2O6G E;  1MJ9 A;  4CHU A;  1STZ A;  2XSD C;  4L9V A;  4KA4 A;  4Y3O A;  1JXS A;  1UG2 A;  1WKM A;  2QQ9 A;  5K5R A;  3KET A;  4LIV A;  3DEW A;  1VQN I;  1SVO A;  1YLF A;  1O7F A;  3DWL E;  2LMD A;  2DN0 A;  4I76 A;  2O9L A;  1S3J A;  3BCA A;  3KZI C;  1QPM A;  4IF4 A;  2DJI A;  3IC7 A;  4XBF A;  3HRM A;  4BQA A;  2LRD A;  1YQA A;  4BHB A;  2BY2 A;  2HKX A;  3CF2 A;  3FZV A;  4HOB A;  3K4J A;  2P7V B;  2JZY A;  2CV1 A;  2LOO A;  2RNJ A;  6PAX A;  3ZQQ A;  5H6R A;  2R7V A;  4XN0 A;  1IN6 A;  4NDL A;  4FET A;  2XRN A;  1LEA A;  4KUM A;  1FTT A;  2EIL H;  2Z2S B;  2BE5 F;  1O4X A;  3CUO A;  1E3H A;  1JE8 A;  4N0B A;  1X2M A;  5J8C A;  2K85 A;  1XSX A;  2O0Y A;  2EA2 A;  3W6V A;  4MNU A;  3OMY A;  4ZZD A;  3V8K A;  2EIN H;  2EFO A;  3R4K A;  4AID A;  5IP7 J;  1Y39 A;  3O3K A;  4P55 A;  2Z33 A;  1D0Z A;  1F4K A;  2P6S A;  5H2F C;  1WJC A;  2X9D A;  1QRY A;  2DU9 A;  2EBI A;  2YR2 A;  2GWR A;  1X19 A;  1FWZ A;  3Q0V A;  2OUM A;  1AHD P;  1AA7 A;  2P5K A;  1LFU P;  3QYB A;  4I01 A;  3C3W A;  4IHX A;  1PUF A;  1O7L A;  2DI3 A;  3D5S C;  4YII A;  4A3I J;  2DA6 A;  5JHF A;  3CO6 C;  4XLF A;  1MNM C;  2W48 A;  4ZYA A;  3RTR A;  2L4A A;  1HKT A;  3N97 A;  1U3E M;  2X85 A;  1SFK A;  1DP7 P;  2JRM A;  4AUX A;  3G4S I;  3FBN B;  4MIM A;  5FGM A;  2GXB A;  1GV5 A;  1W0T A;  3LSJ A;  3TDZ C;  2JA2 A;  5L3F A;  2L9R A;  3REO A;  1RES A;  4CCN A;  2L02 A;  3QP5 A;  3WGG A;  2ZSI B;  4E6K G;  3DTK A;  4M71 A;  4EJU A;  2W82 A;  3BTL A;  2DLL A;  2V4J C;  1MBH A;  4D0P A;  1FJL A;  5EZH A;  1FP1 D;  1FYL A;  4JOM A;  3GFI A;  2K9N A;  3BDD A;  3HTS B;  2KPM A;  1FIA A;  1YRN A;  1JHF A;  3CDI A;  3SZP A;  1BC8 C;  4IRG A;  4BKX A;  1U8R A;  2KIF A;  1QGP A;  1FOK A;  5K1Y A;  4BE1 A;  4YEL A;  3RQI A;  2ZNY A;  1XGO A;  1SFU A;  1K78 A;  1I5Z A;  4G12 A;  5F6F A;  5D5X B;  1K4T A;  2G0E A;  4RB2 C;  4KN4 X;  1IG7 A;  3OYM A;  2OPT A;  1RKT A;  1MSF C;  4BDZ A;  2QVO A;  3ASO H;  4R1H A;  1FC3 A;  3E6D A;  2ZXW H;  1UHM A;  4D7M A;  3E6C C;  3DFG A;  3CJT B;  2LFB A;  1C0W A;  2JUG A;  2NS7 A;  3H1C A;  1EH8 A;  4HF2 A;  1ZAO A;  3CMY A;  3BG5 A;  1WWX A;  4LIT A;  2OZU A;  1Z77 A;  2DOF A;  2M0M A;  3ZQG A;  2R5Z A;  1X1A A;  4RGU A;  3KFW X;  5FLX K;  1QBJ A;  2ME0 A;  1UZC A;  5LBQ A;  2GOM A;  1VQ4 I;  5J4V A;  4GYG A;  5ED4 A;  1MD0 A;  4I98 B;  3DBH B;  2P5V A;  1TNT A;  3WGI A;  3H0G J;  4E7S A;  3S1N J;  5H6Q A;  1H89 C;  5A2Q K;  2HVS A;  3QQA A;  3BG3 A;  3CD6 I;  5LGT A;  1W36 C;  1FIP A;  4BXF A;  1ZGA A;  3TL4 X;  4XL9 A;  3UKG A;  2GXG A;  5KK1 A;  2F5D A;  3K9T A;  4RAF A;  1BN5 A;  1S7E A;  2DTR A;  2CFO A;  1XTA A;  3EET A;  2FU4 A;  3ZMZ A;  2ECB A;  3J80 Z;  2EA4 A;  2XAG A;  3ULQ B;  2FXA A;  2QSF X;  2KDZ A;  1KQ9 A;  4M6Y A;  3S15 J;  3QOP A;  1D3Y A;  2Y0S N;  4A0Z A;  5E3N A;  5GP9 A;  4ENK A;  3S1Q J;  2VUM J;  2V1X A;  2MH9 A;  4CCL A;  2L3D A;  2VJ5 A;  5IP6 A;  4BDY A;  1M1E B;  3RPU A;  1ZK8 A;  3HHG A;  3OYD A;  1YJN I;  2QQB A;  3QU3 A;  4EM0 B;  3LL7 A;  3O6B B;  4KFC A;  1LDD A;  3BLY A;  5E18 F;  3WTZ A;  1ETW A;  3F3X A;  4II3 A;  2LRE A;  1JKO C;  2A68 F;  2IS1 A;  3N05 A;  3S3N A;  3O8H A;  3A4C A;  4QIW N;  3WTV C;  2A05 A;  3WG9 A;  3A1Y A;  3G1O A;  5FRM A;  3ABL H;  4I0A A;  4HNV A;  1MMA A;  3OYI A;  3VOE A;  2QSG X;  2BYV E;  3GTK J;  2E36 A;  1T6S A;  1VFC A;  3K4B A;  5DM7 F;  1D1C A;  5GAE J;  2DFH A;  2MG4 A;  1W5C C;  1Z7L A;  3AL0 C;  2KZV A;  3NAR A;  2RQQ A;  3ABT A;  5CVJ A;  4KIT B;  4KMF A;  5BMZ A;  3ZXS A;  3BJ6 A;  2K3P A;  4YFN F;  3I55 I;  4EJO A;  4DOZ A;  3FHN A;  2OZ6 A;  2V6C A;  5IT3 A;  4XKC A;  2E2I J;  2FMY A;  2K40 A;  3JAM Z;  2VQH A;  3C2G A;  2ADU A;  3BRO A;  2IA0 A;  3TED A;  5L3G A;  1JUS A;  1QZY A;  3CDH A;  4LG0 A;  1Z3X A;  2XGE A;  4PUS A;  5E3L A;  2BHY A;  3SZG A;  1POG A;  3AG3 H;  1Z21 A;  2VJ4 A;  3JTH A;  2WAQ A;  4LB6 B;  3I59 B;  2DT7 B;  1WSU A;  2IS2 A;  1J7K A;  4B4C A;  1FMV A;  2VXZ A;  2DCE A;  4A69 C;  4HDU A;  1MH3 A;  3DBL B;  4A3C J;  1MJA A;  3QWL A;  2VON A;  1TC3 C;  3T5X A;  1VQP I;  1BA5 A;  3OWT A;  2A6T A;  4PSX A;  2HWV A;  4ZC3 A;  2D5V A;  3H9Q A;  2Z3Y A;  3TKY A;  4ESF A;  4M3G A;  4LK1 F;  3GFJ A;  4GO1 A;  4BQQ A;  2L5Q A;  2COB A;  4LMY A;  1AKH B;  5D5W B;  3DQV C;  2A6H F;  3L1P A;  2R7W A;  2FJ1 A;  4BEH B;  4J01 A;  2PBI A;  1DU6 A;  3LSM A;  3K70 D;  1UHS A;  2QM3 A;  2BGC A;  2XRO A;  2VKV A;  3U9G A;  1W0U A;  2M4K A;  4DW6 A;  2K9L A;  2WV0 A;  1V5F A;  3KCC A;  3LWF A;  2X0L A;  2QWW A;  3VWB A;  1RC9 A;  1D8J A;  2ZXH A;  2DOA A;  2OAZ A;  1JKR C;  2KL4 A;  3A01 B;  1G3T A;  1O3T A;  3LFU A;  3FK6 A;  3F22 A;  4LFU A;  3ZQF A;  4Q48 A;  3L09 A;  3ZMD A;  1ERD A;  2EZK A;  3R6S A;  5EEG A;  3GYH X;  3E3V A;  2F5E A;  3MD2 A;  3BR6 A;  5CYV A;  2ZKZ A;  4U87 A;  1CF7 B;  4XOT A;  2M2E A;  1U0J A;  5D6E A;  2L7F P;  3QYE A;  1I3A A;  3C2B A;  2LH9 A;  3PO2 J;  2LBF A;  3K4L A;  5B1A H;  1IXC A;  2WAE A;  1XD7 A;  2EZL A;  4XLE A;  4RLQ A;  2R7F A;  3AL0 B;  2OA4 A;  3CJN A;  2BV6 A;  4PJ0 C;  3HYI A;  2TDX A;  2DA4 A;  1FX7 A;  1TTY A;  2LVS A;  4CCM A;  3TMO A;  5H20 A;  1PVE A;  2LDU A;  4ZYH A;  3OR1 C;  1W7P A;  2XGC A;  4P9F A;  5JFR A;  5LLQ A;  2R7Z J;  3KLO A;  1WFX A;  4C3J J;  1E3P A;  2FRH A;  4CYC A;  4XLA A;  1IXR C;  4F93 B;  3T1B A;  2DXI A;  2LKX A;  4A3F J;  5F1J A;  1EF4 A;  1FTZ A;  3Q9V A;  3NEU A;  1OCP A;  3OL4 A;  4PJM A;  1HC8 A;  2KMU A;  4I7H A;  4FE7 A;  1U5T A;  3U1D A;  3FXU A;  3IRQ A;  1ETV A;  1R1V A;  3C2H A;  1E0E A;  2QBY B;  2XB5 A;  4XRM A;  2UXX A;  2RN7 A;  2VL8 A;  1LNW A;  3S8P A;  5HOD A;  2TCT A;  1OJL A;  1GXQ A;  1BW5 A;  2FBH A;  3EUA A;  2FUG 2;  4X6A J;  1ZG5 A;  1I6H J;  1Y0U A;  4RMN A;  3H36 A;  1B72 B;  2JQ7 A;  3LAP A;  2BVM A;  2N8G A;  2GAU A;  5K5Q A;  4W1U A;  3C1D A;  4XSX F;  2M7A A;  3DEU A;  1EA3 A;  2W84 A;  4FHT A;  1MGT A;  1IUY A;  3CLO A;  1SMY F;  5KAF C;  4YIR X;  3L2U A;  4GXO A;  2PLY A;  2OV7 A;  3BZC A;  3I71 A;  2E7W A;  3W6K B;  1CGP A;  3IAM 2;  4O6J A;  2DBB A;  1YI2 I;  3L2R A;  1IW7 F;  4DYR A;  5ERI A;  4BYY A;  3L2C A;  2IRF G;  2VBZ A;  1ZR2 A;  4XRF A;  2DA3 A;  2ELK A;  4XLN F;  3DLL F;  4UNO A;  3MAJ A;  4OIR F;  4EV0 A;  3R61 A;  2R7X A;  2Q2E B;  4BH9 A;  2R7R A;  2JUC A;  4NHJ A;  2OF7 A;  1T8I A;  2ZJ2 A;  3D0S A;  2CW7 A;  3HOY J;  1P6R A;  3HRU A;  4XQF A;  4NC6 A;  2E1C A;  4HLX A;  2ID3 A;  3CME I;  5EEA A;  1MBK A;  5B5E C;  1REP C;  3FXL A;  3ZQC A;  4G8X A;  2I5U A;  3BOQ A;  3JRB A;  1DDN A;  3HB9 A;  1K6O A;  2ACJ A;  2O3F A;  3FWE A;  2MC3 A;  5AIP A;  2W85 A;  3MCZ A;  1ZH5 A;  1I1S A;  3GW2 A;  4PFO A;  2MAB A;  3MZY A;  5J4Y A;  3LOC A;  4C2M J;  3PFY A;  3PIO F;  1B8I A;  5TGT A;  2KRF A;  3TQN A;  3F21 A;  2DYR H;  4HZF A;  2IBD A;  2W7N A;  4D9J A;  4E7K A;  1XMA A;  2LP0 A;  2B0L A;  1O3S A;  2DMP A;  1IAW A;  4AIJ A;  3VYS B;  1S7A A;  2R7U A;  2M8E A;  1S5L C;  5M5Y J;  5E3M A;  2Z9O A;  4BY1 J;  2ELH A;  1JGS A;  1ULY A;  4HRI A;  1TWG J;  5DCM B;  1ITY A;  1PYV A;  4M9X A;  4RAG A;  2RNG A;  3VYR B;  5BOX A;  4C9Y A;  3PUB A;  3SHF A;  1ZRF A;  4L0Y B;  3R0J A;  4HV5 A;  1R4M B;  3HRS A;  2NNN A;  4KIF A;  2L7M P;  2JPC A;  2RKH A;  2WA0 A;  4R8H A;  1YW7 A;  3MEX A;  3R60 A;  2HDC A;  2AQF A;  2FQ3 A;  4Z2Y A;  2BVL A;  3TBI A;  5J1Y A;  2GIV A;  2BHZ A;  1U9N A;  5AON A;  4KIG A;  3SZT A;  2E60 A;  2YUS A;  4RGX A;  3ZGK A;  4QLC U;  3KZY A;  1TT5 B;  3PNT A;  4M3D A;  1UFM A;  4DYC A;  1S9H A;  2HQ5 A;  3OYE A;  3DBR B;  1BJA A;  1ZAR A;  3F8M A;  1YS7 A;  1VND A;  3LA2 A;  1K79 A;  1G3W A;  4DNC A;  3HOS A;  3W2W A;  1IUF A;  2E34 A;  3RKW A;  3CJR B;  3HXL A;  4XLC A;  1J2X A;  3S32 A;  3OYN A;  1YG2 A;  3HKZ A;  1LE8 A;  4IHV A;  2YX7 A;  1OIS A;  2DMU A;  3FK7 A;  5KAI C;  2K02 A;  2NVX J;  2O5R A;  2BOL A;  2HPM A;  5GPA A;  1I3Q J;  2VE8 A;  1R1T A;  3X2Q H;  3KLN A;  3NRV A;  2R4G A;  3ZN1 A;  4JX4 A;  1BJZ A;  1TW2 A;  1X3U A;  3CUQ A;  5DEQ A;  2ZJQ F;  3F9K A;  5EJC A;  1KQ8 A;  1Y56 A;  2PN6 A;  3GZ5 A;  4KN7 X;  4B48 A;  2F4O B;  1JTX A;  4GRI A;  1NHA A;  2W1O A;  1R49 A;  1E3O C;  1GT0 C;  1ZRD A;  1BOB A;  5E17 F;  1PDN C;  2XAJ A;  3RKX A;  1HXD A;  4CCJ A;  2OBP A;  2E1M B;  5EEH A;  4UB6 C;  2XVC A;  3E1S A;  4XM3 A;  2ME6 A;  2A69 F;  2BW3 A;  4EJV A;  1HDP A;  5M5W J;  4L18 B;  3K4C A;  1MBG A;  2F2E A;  4U0Y A;  1Z0X A;  3V7S A;  4F52 A;  3UR3 C;  3LA7 A;  4QPO A;  2HOT A;  3CZ6 A;  3ROU A;  2WY8 Q;  3NWS A;  4AVZ A;  5HDG A;  3L7W A;  2LC2 A;  4XKW A;  4D5F A;  3RJP A;  2VQC A;  4EJW A;  2UZK A;  4E7J A;  2KKO A;  2CV2 A;  3DCF A;  3S17 J;  5GAD J;  3HOZ J;  4CYD A;  2EJR A;  3I5U A;  1T98 A;  3SYT A;  1RKW A;  3CQZ J;  4E4H A;  4KIC A;  4OIP F;  2KP6 A;  3RSN A;  1DGW Y;  4N9I A;  3ZR8 X;  3LNQ A;  1IGN A;  1MBJ A;  3ABU A;  3H92 A;  1LVK A;  2VOD A;  2HOE A;  1R58 A;  1T95 A;  2HQN A;  3K1N A;  2L7Z A;  3D1N I;  2Z1D A;  5FJ8 J;  2Y30 A;  1XG1 A;  3ZPL A;  3NWT A;  5JLX A;  4YEJ A;  1Q1V A;  2LKS A;  2MC4 A;  4Y17 A;  1JGG A;  2PJR A;  1LKX A;  3ERM A;  4EAT A;  1RR8 C;  1H88 C;  2Y2Z A;  2IS6 A;  4BJT A;  2CYY A;  4CZC A;  2ECC A;  4PJL A;  2KZG A;  5D8K B;  1R5I D;  3JRE A;  1D1B A;  4XLH A;  4K2E A;  4X0G A;  3OL3 A;  1GHC A;  2GA2 A;  2LYC A;  4N4O B;  1HA8 A;  4N9H A;  4DZP A;  2V9V A;  3JRF A;  4AM3 A;  2XHK A;  4RM2 A;  4MEX F;  4WX9 A;  2I8D A;  5BPI A;  4ZYD A;  5DCF A;  3S3O A;  1V54 H;  2EH3 A;  4IVN A;  3LQR A;  4L9T A;  5DYM A;  1Z7U A;  1SAU A;  3HGG A;  2DMQ A;  3V7R A;  2BEO A;  1QA6 A;  2CQN A;  2F4M B;  2CW0 F;  1RZ4 A;  2BZT A;  3IKV A;  4HLY A;  2JWT A;  5FKN A;  1Y1W J;  3ZQI A;  5TJJ A;  4A3B J;  5C4X J;  2LD5 A;  1BI0 A;  3MKY B;  2V1U A;  3VPR A;  1MND A;  3DP7 A;  3FIW A;  1R22 A;  5CKT A;  3JSP A;  2OQG A;  1Z9C A;  2VXD A;  5B66 C;  1VQO I;  2XGD A;  3CP8 A;  4V2F A;  3H5A A;  3QPL A;  2L4M A;  5HLH A;  2MSY A;  3EPZ A;  4HG2 A;  3GEZ A;  2K3F A;  1YJW I;  4E7I A;  2K9M A;  1T56 A;  2VT3 A;  1KU3 A;  3K2Z A;  3QPH A;  4GDF A;  1A31 A;  3J7Z I;  4ZJZ A;  4ASN A;  1ORK A; 
#chains in the Genus database with same CATH homology
 2V26 A;  5FRN A;  3DEE A;  1Z7L A;  3AL0 C;  2KZV A;  2RQQ A;  4KIT B;  3DKX A;  3ZXS A;  4ZDP A;  4IZZ A;  4F92 B;  2K3P A;  5LFA A;  3KX2 A;  5HNH A;  3I9V 2;  3RPU D;  2X6X A;  4B3X A;  1D0Y A;  5HLT A;  4DOZ A;  3FHN A;  3S3M A;  3EUK L;  4XKC A;  3OYH A;  1FMW A;  2DT6 A;  3AFH A;  2VQH A;  3C2G A;  4BS9 A;  2KHM A;  3HG9 A;  4XN3 A;  4BGD A;  3HPG A;  2W00 A;  3OS0 A;  4IQ4 A;  3K10 A;  4IKF A;  2JSP A;  1Z3X A;  2GOX B;  3PJR A;  4PUS A;  2HQA A;  1DP3 A;  4ANJ A;  3SZG A;  3H0D A;  4B44 A;  1Z21 A;  2VJ4 A;  1WJ5 A;  3HC7 A;  2WAQ A;  2AQE A;  1WJF A;  2DT7 B;  2IS2 A;  4HNT A;  3H9G A;  1FMV A;  4RM3 A;  2VXZ A;  3OYB A;  4DIQ A;  2X51 A;  2DCE A;  2V1N A;  2HDW A;  2IGN A;  2Q1Z B;  3OWT A;  2A6T A;  4PSX A;  3QYF A;  4CUG A;  2WAD A;  4HPQ A;  4ZC3 A;  4C30 A;  3H9Q A;  2F6C A;  3VYU B;  3DTE A;  2JVH A;  2VLA A;  4BQQ A;  2L5Q A;  3DLA A;  2VKH A;  2E5Z A;  3DQV C;  4P1W A;  4G6T B;  3LSK A;  2R7W A;  2MYS A;  4BEH B;  4J01 A;  3OOU A;  3PSF A;  2HU9 A;  3LSM A;  3K70 D;  1MMG A;  2A5W A;  2OC6 A;  3ZRG A;  3S93 A;  2CUZ A;  3K4N A;  3RCO A;  2M4K A;  3CES A;  2K9L A;  1V5F A;  3VWB A;  5KCM A;  1UAA A;  3A2K A;  2L2O A;  4BUP A;  2KDO A;  2ZXH A;  2DOA A;  2KL4 A;  3AKZ A;  4Y33 A;  2XAU A;  2VAS A;  3H5R A;  4YRV A;  2CW8 A;  3BG7 A;  3DPT A;  3LFU A;  1D0X A;  2M3A A;  3VSL A;  4HST A;  3OYK A;  4MLO A;  2X6W A;  1ERD A;  4PK4 A;  2VIX A;  2UV1 A;  3DTI A;  4CSW A;  3BG6 A;  3MD2 A;  1DGR M;  1VZ0 A;  3OIQ A;  4U87 A;  4XOT A;  1U0J A;  3PNV A;  5CQG A;  2Z16 A;  5HVQ C;  3QYE A;  2HNH A;  4BL0 B;  5CPR B;  1NG6 A;  3H9J A;  2LH9 A;  1V5G A;  2LBF A;  3K4L A;  2V6E A;  2WAE A;  4XLE A;  2R7Q A;  4RLQ A;  3FBI B;  3AL0 B;  1G59 A;  4DBR A;  3D5R C;  5KNL A;  4BEH A;  1YX5 A;  4CCM A;  3HOT A;  4C2U A;  3TMO A;  2L9S A;  1X4O A;  1K6Y A;  4CCO A;  1G8X A;  1WJD A;  3OR1 C;  4RLF A;  3W2V A;  2V7F A;  3MKW B;  1WFX A;  4HEA 2;  3KEY A;  2HVQ A;  4XLA A;  1TZL A;  4HSR A;  4F93 B;  3SDB A;  2XDV A;  3MKZ A;  2CV0 A;  2DXI A;  4IQJ A;  2BW3 B;  2K5C A;  1MW7 A;  1BR4 A;  4BJ6 C;  1LDK B;  4N4N B;  4Y4R A;  4LIU A;  3L2W A;  2P0W A;  4PFP A;  3OL4 A;  4PJM A;  2IXS A;  2KMU A;  3E0J B;  4BU2 A;  3I3L A;  2VJJ A;  2ZXI A;  2F5V A;  4ZDO A;  4HNU A;  2ZFU A;  2UWM A;  3OYJ A;  3C2H A;  1E0E A;  4D1Q A;  2MD0 A;  1TT0 A;  2VL8 A;  3PNY A;  3S8P A;  1LFP A;  4B43 A;  2KRC A;  3HPH A;  4ZTJ A;  4CH7 A;  3EUH C;  4NC7 A;  3K4M A;  2UUZ A;  3EUA A;  2FUG 2;  4DBQ A;  3RQ4 A;  3VDX A;  4RMN A;  3K70 C;  3CMM A;  3QOE A;  3U21 A;  2BVM A;  1GLN A;  2L7K A;  3DPU A;  1X1C A;  3OYC A;  1IRX A;  4BQN A;  5KHD A;  4FAS D;  2XF7 A;  2XSJ C;  2M7A A;  1QHG A;  1NG7 A;  2KQR A;  1EA3 A;  3V42 A;  2VQL A;  4XKV A;  2PJR B;  1QHH D;  3L2U A;  2OV7 A;  4ITV A;  1JI8 A;  1OLT A;  3IAM 2;  4NQW B;  3L2R A;  3H35 A;  2LG4 A;  4KJZ A;  4ZTF A;  3SEZ A;  4P5O A;  2ELJ A;  2R7X A;  2Q2E B;  2R7R A;  3OS1 A;  3ONQ A;  2CW7 A;  3G2B A;  3M1C A;  4XQF A;  3DU5 A;  3SEQ A;  2KRH A;  1J09 A;  3LSG A;  2VPL A;  3OYG A;  3OIP A;  4JQF A;  2F4I A;  2PMZ A;  2WAF A;  4OWR B;  2L9N A;  2IGM A;  4B47 A;  4E7H A;  4KT6 A;  2VB6 A;  4LG3 A;  3MMY B;  4J00 A;  2KLO A;  3HUG B;  1MMD A;  4XOR A;  2CH0 A;  4DGW B;  2R7T A;  2X1C A;  3UNG C;  4XON A;  4PFO A;  2MAB A;  3DKY A;  3KYL A;  3PFY A;  3D5L A;  4OAY A;  3PSI A;  5TGT A;  1OR7 C;  4H4K C;  4XR6 A;  3FKJ A;  2M7B A;  5FRO A;  4BAC A;  4Y3O A;  4OAZ A;  1MMN A;  2W7N A;  4D9J A;  4E7K A;  4LIV A;  2HZD A;  1YX3 A;  3DWL E;  1Y6I A;  2QKL B;  1MNE A;  3VYS B;  3BCA A;  4F3Q A;  2R7U A;  2DJI A;  2M4G A;  1T0F C;  2LRD A;  3OY9 A;  4HRI A;  3CF2 A;  3K4J A;  3CJQ B;  2Y0S A;  2CV1 A;  2VJI A;  1PYV A;  2LOO A;  3VYR B;  2RNG A;  1YE9 A;  4F91 B;  4C9Y A;  3PUB A;  1X1D A;  3ZQQ A;  2R7V A;  2WA0 A;  4XOP A;  4XN0 A;  4FET A;  2CMP A;  2AQF A;  2BVL A;  3TBI A;  2WB1 A;  2HVR A;  4BE0 A;  1UG0 A;  2Z2S B;  2E60 A;  3ZGK A;  3PNT A;  1WJB A;  1S9H A;  3LSI A;  3OYE A;  3OMY A;  3VYT B;  1WJA A;  4XNF A;  2VQG A;  1D0Z A;  3HOS A;  1WJC A;  3W2W A;  3DU6 A;  3CJR B;  3HXL A;  1QU3 A;  4XLC A;  1X19 A;  2OUM A;  4XKB A;  3S32 A;  1AA7 A;  2XF6 A;  3HKZ A;  3OYN A;  1W36 D;  3QYB A;  3QOD A;  4F55 A;  2O5R A;  2BOL A;  2HPM A;  3FDY A;  4DJA A;  3D5S C;  4BQO A;  2R4G A;  3LMM A;  3H5N A;  3VSK A;  5JHF A;  4XLF A;  2X1D A;  4ZYA A;  4PJJ A;  3RTR A;  5HNF A;  5LD2 C;  4U7B A;  3L2V A;  2X85 A;  2CS3 A;  1SFK A;  3F9K A;  1Y56 A;  1X4P A;  3FBN B;  1ZEL A;  3K4K A;  2IS4 A;  2X6Y A;  1N75 A;  4B48 A;  3OYF A;  3K6G A;  3L2Q A;  2R7S A;  2JA2 A;  1BR1 A;  1BR2 A;  1WJE A;  4GRI A;  2W1O A;  4CCN A;  1KON A;  2ZSI B;  4NUB A;  1BOB A;  4E6K G;  2V9K A;  3DTK A;  2W82 A;  3LSH A;  2V4J C;  3ZCO A;  4JOM A;  1UEL B;  4CCJ A;  3OYA A;  3BC8 A;  2E1M B;  4R79 A;  4NNJ A;  2KPM A;  3E1S A;  4XM3 A;  2BW3 A;  3W3C A;  3K4C A;  1P9Q C;  2XC7 A;  4F52 A;  2RRE A;  3UR3 C;  1PJR A;  4XMY A;  4CA0 A;  4BE1 A;  4KIS A;  4YEL A;  5HOO A;  4QPO A;  3CZ6 A;  2WY8 Q;  3OYM A;  3NWS A;  4AVZ A;  2LC2 A;  4XKW A;  4BDZ A;  2VQC A;  3OR2 C;  2CUJ A;  4E7J A;  2CV2 A;  4BE2 A;  4E7Z A;  2E1M C;  4AYB A;  3SYT A;  4E4H A;  2KP6 A;  3RSN A;  1DGW Y;  4QPQ A;  3W2A A;  3IAS 2;  2LBF B;  3ZR8 X;  2MFZ A;  1LVK A;  1DQU A;  2IGO A;  2JUG A;  2JVG A;  1T95 A;  4LIT A;  1Z3Y A;  2Z1D A;  2M0M A;  3NWT A;  1X1A A;  1R6R A;  4YEJ A;  3IUO A;  2GOM A;  2MC4 A;  2WY7 Q;  2PJR A;  1LKX A;  1N77 A;  4EAT A;  2IS6 A;  4BJT A;  4C2T A;  4CZC A;  4E7S A;  4PJL A;  2HVS A;  4CCK A;  1W36 C;  4BXF A;  1D1B A;  3CP2 A;  1V5E A;  3TL4 X;  4XL9 A;  2R7O A;  4XLH A;  3GBG A;  4X0G A;  3OL3 A;  2LYC A;  4N4O B;  2CFO A;  4PSW A;  1HA8 A;  2X1E A;  3OYL A;  2E5N A;  2HPI A;  4RM2 A;  2I8D A;  2WBM A;  3HL2 A;  3S3O A;  4ZDL A;  3OS2 A;  2IGK A;  4IX7 A;  4NC8 A;  3M8J A;  1SAU A;  4CCL A;  4BJ5 C;  2VJ5 A;  4BDY A;  2LY1 A;  3OYD A;  3LL7 A;  3BLY A;  3J7A Y;  5CQE A;  1N78 A;  2XF5 A;  4PJN A;  4II3 A;  2W4S A;  3MKY B;  2NOJ B;  2LRE A;  1MND A;  3DPL C;  5CKT A;  2IS1 A;  3N05 A;  3S3N A;  2VXD A;  1X1B A;  1D1A A;  3CP8 A;  3A4C A;  3H5A A;  2ZSH B;  5FRM A;  3A1Y A;  3PL8 A;  1MMA A;  3EPZ A;  2QKM B;  2VKD A;  3BCB A;  3OYI A;  4HG2 A;  3K4B A;  2K9M A;  4E7I A;  1D1C A;  2LY2 A;  3IP4 B;  4II2 A;  4ZJZ A;  4AU7 A;  4E7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...