3MEXA

Crystal structure of mexr in oxidized state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
142
structure length
142
Chain Sequence
MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQSLAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the oxidation-sensing mechanism of the antibiotic resistance of regulator MexR
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription, transcription regulation
molecule keywords Multidrug resistance operon repressor
total genus 48
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mexA01
5DCFA 4HV5A 1D5VA 2VE9A 2XAFA 4KMFA 2KJBA 1UFMA 5LHHA 3HTUA 3F6VA 3ISPA 3D0SA 3FM5A 1WQ2A 3HRMA 3FXQA 2A61A 1B6AA 1JGSA 2DQLA 2VONA 3BJAA 3ZMTA 5BQTA 4B09A 2F5DA 3F8FA 3CUQA 3EYIA 3ZMDA 3CUQC 4KFCA 3ECHA 3GZ5A 2CW0F 4KNYA 4XBFA 3GX4X 4EJTA 3ZMUA 5HS7A 1Z9CA 4FT8A 2GAUA 3F3XA 3I0TA 4G9YA 1XDUA 2ZMEA 1BIAA 4P9FA 1YIOA 4L18B 3K1MA 5JR3A 1O7FA 3CDHA 1LVAA 1LEBA 3BPXA 4I0AA 2ZFWA 4D0PA 2MH2A 1HBXG 3BY6A 5LGUA 2XRNA 2P5LC 1IF1A 2OA4A 2EV6A 3FXRA 3COAC 3G3ZA 2V79A 2DBBA 1BIBA 2FMLA 2VT2A 2XKPA 2PJPA 3ZPLA 1MJAA 4XLPF 2K7LA 3ROUA 1EV7A 2PQ8A 5ED4A 2FQ3A 2IW5A 2R3SA 1YLFA 1KGSA 2VXZA 1FNNA 1GVJA 3M8FA 3QU6A 1ZGJA 3GFIA 2CSOA 1XSXA 2UZKA 5TJJA 2QZ8A 1IXRC 3WGHA 2E1CA 1SMTA 1IN4A 5CVUA 3IL2A 4ENKA 4CDGA 3HRUA 2W84A 3U2RA 2FMYA 4I02A 5J6XA 2VOPA 1V3FA 1W7PA 4LJZF 4EM2A 1R00A 1FBUA 5DD8A 5H20A 1EH6A 2H27A 2V6CA 2FBHA 5IT3A 4ENNA 3ZN0A 2HFHA 1LEAA 2EFPA 2M8EA 4IHTA 3QPHA 2F5FA 3RPUA 2V1DA 3HYIA 2RGVA 1YW8A 3V4GA 4N0BA 2YX4A 3WG9A 1QZYA 3IWZA 1BN5A 5BOXA 3KEOA 5ICEA 2CFXA 2L4AA 3LFKA 4QLCU 3R61A 2ESNA 3V7CA 5J8FA 1JHFA 3H3ZA 2H94A 2X0LA 1K78A 3WODF 5L3GA 3T8TA 3QRFF 3D5LA 3NEUA 1W5SA 1I5ZA 3L9FA 2OU2A 4Y15A 4DNCA 1DPUA 1S3JA 4A12A 2IA0A 4HYEA 3ZP5A 3RKWA 2KIFA 1XCBA 1J0RA 3VOEA 2PN6A 1YS6A 1WKMA 2D2WA 3DKWA 2DT5A 3F8BA 1KU3A 5TRDA 4BAYA 2O6GE 2Q0OA 1P6RA 5DYMA 2RDPA 5K1YA 3RIRA 1OKRA 1BBYA 2G9WA 1KQ9A 3ZMSA 3WU0A 1VTNC 3U1DA 1X3UA 3E6BA 3ZN1A 4Q48A 1WSUA 5D5VB 2VN2A 3MZYA 1S7OA 5E1ZB 1QPMA 5BMZA 3ELKA 1FYLA 5FB2A 1SMYF 1FP1D 2M30A 3WTXC 3LA2A 5E1WA 2PLYA 4U0VA 3RTRA 1ZG1A 4UNOA 3O6BB 5D4RA 1SD7A 1IRFA 3BJ6A 2UXNA 2QBYB 4Y13A 3HIFA 3GW2A 3TO9A 2PBIA 3HTSB 1HKTA 1UHMA 4U0YA 3H3UA 3TQNA 2ZXJA 5F6FA 5L3DA 1ZAOA 1FPQA 2CG4A 2Z99A 3DXJF 1ZG5A 3C18A 1B1BA 4YFXF 3WTSC 1Z91A 1SFEA 3TGNA 2NS0A 4S04A 1FZPB 1F4KA 2LDUA 1DDNA 3ML6A 4L9JA 4A5MA 3JSOA 5D5XB 3B73A 3F22A 1FSHA 4I2OA 1LDDA 4BQAA 3N97A 3R0JA 3SXYA 3VODA 3PFIA 3WTTC 2DO7A 2O3FA 2H09A 2XHKA 3KP7A 5E8GA 2FE3A 3LQQA 4EMSA 3I71A 2UWMA 3K1NA 4G94A 3BWGA 4CICA 2QLZA 4I7HA 5DUIA 1E17A 1HW5A 4A0YA 2IA2A 1DUXC 1LB2A 1D8JA 2CGPA 3IKVA 1CF7B 2ZBKA 2STWA 5CYVA 4UV8A 4RB0A 4MHGA 1YO5C 1IXCA 3HSRA 4KYWA 1V4RA 1J9IA 5ILUA 5HLIA 1WI9A 1P4XA 3JW4A 4Y17A 2Y75A 4RAYA 4EV0A 2WV0A 2D45A 3C1DA 3HRTA 2DU9A 4AVPA 1S7AA 1R5HA 3VEPA 3MCZA 2K27A 4P9UA 2DK5A 2P8TA 3H92A 1W7PB 2VT3A 2MLKA 4ESJA 2F2EA 1BJAA 1KQ8A 2EJRA 4MNUA 4NHJA 2A6HF 2KKOA 5KVRA 3ULQB 2STTA 1H9TA 3QP6A 4ZH4F 3W6KB 2C6YA 2JSCA 2RV8A 3P9IA 3WGGA 1YTYA 5DEQA 4H0EA 2RKHA 3SFZA 3IKTA 2Y48A 4HBLA 2XAHA 1UCRA 1TNTA 2XAJA 2V1UA 1QO0D 4ENMA 2VODA 4KICA 2L3DA 3E5UA 2JRTA 4WCGA 4ZZLA 2TDXA 1IZ1A 2WC2A 5HDGA 1QBJA 1KQ0A 2Z9OA 5ERIA 3AAFA 3HSEA 3V8LA 1TW3A 4KT5C 1LNWA 4G7OF 3F8NA 4MTDA 5L3FA 2K4BA 3IWFA 1HW2A 3GWZA 2GQQA 2OQGA 2IT0A 2F5CA 5E8IA 5F64A 2KIMA 4UXNA 2GXGA 2XIGA 1K78B 4FHTA 1Z05A 1EH8A 2PMHA 1USSA 2IJLA 4R1HA 1RIOH 5FGMA 2DI3A 5CVRA 1REPC 4EJVA 4XSXF 1FYMA 3KZZA 3OOPA 5DD4A 1R58A 2BYVE 5K5OA 5E1XA 1BI0A 4OIOF 3LQRA 1IN7A 1F9NA 2GA2A 1SD4A 1U6GA 4L9NA 2LF8A 5DUKA 2JTVA 5FLXZ 4ZYDA 1ZG3A 5D8KB 3QU3A 2ESHA 3I4PA 3HHGA 3IRRA 1PDNC 1OYWA 2M45A 5D5UB 4I09A 2ISZA 2VBXA 4CHUA 4YIFA 3J81K 4HA8A 4LG0B 3WE2A 2J5OA 4IRHA 3IHUA 2XKOA 4LK0F 5EEGA 3J80K 1SFXA 2JPBA 4GCVA 1R1UA 1HW1A 1I6XA 2W24A 3CTAA 1MJBA 1O3RA 4YIIA 1O3TA 4GXOA 5HVQC 3Q9VA 4Q5SF 1IAWA 4RS8A 1YS7A 1G3SA 2VOOA 5DDGA 2XROA 2ZJ2A 3HOTA 1GHCA 2PEXA 2YX7A 4MEXF 4KIBA 2EV5A 5D6FA 3EETA 2HS5A 2W57A 2DK8A 5LLQA 4GYGA 3GLXA 4HLYA 1WRJA 3V8KA 2MLGA 2ISYA 4FX0A 3L7WA 1U78A 2P5KA 1YYVA 2DQRA 4U7BA 3I59A 1JXSA 2EFOA 4L5JA 4LG0A 2L54A 4Q47A 1R1VA 5J8CA 4PZJA 4HOBA 3CO7C 2YSRA 4OMZA 3RDIA 3S2WA 1TQMA 2EFWA 3R0AA 3DV8A 4O5VA 1XD7A 1LQ1A 2HKXA 1TNSA 3F6OA 3JAMZ 5JI6A 1ULYA 2QWWA 3L09A 2ADUA 2LSOA 3MAJA 1HKSA 3BJOA 1Z6TA 1BI3A 3L2CA 5KK1A 4M6XA 3J81Z 2RNJA 2FA5A 2RN7A 4XRFA 4RAZA 1CF7A 2GXBA 2Z3YA 1IN5A 1IN6A 1IW7F 4IVNA 3HSFA 4G6DA 4YG2F 3F23A 3KEQA 1SD5A 1F1ZA 3HUGA 3FF5A 4XSZF 3F72A 2HZTA 1T2KA 1XSVA 4ASNA 1BI2A 2RVCA 3WU1B 2QVOA 1HKQA 4CO8A 2UXXA 1ZRDA 5CLSA 1MDMB 1XB4A 4WXHA 2QYOA 3B02A 3FMSA 4PCQA 1FBSA 1R22A 2BE5F 2Z5UA 4ESFA 1STZA 2HYGD 1O3QA 4HW0A 1ZREA 4N9HA 1W5TA 2OD5A 2GA1A 2HDCA 3DPLC 3LSTA 3Q5FA 3TOBA 3EQLF 2HTSA 1Z7UA 1P92A 1H9GA 3CUOA 1BC7C 2PG4A 2DFIA 2HWVA 1FBQA 2HGCA 4KDPA 1T38A 4OU0A 2QBYA 5ILSA 2JZYA 1R36A 1XDSA 3WTUC 1OR7A 1XGNA 1WWXA 4IJAA 5F1RA 2CWEA 4LB6B 2ZKZA 2AXLA 2QM3A 4N9IA 5ICGA 2EA4A 3V7RA 2OBPA 1FYKA 2BEOA 2VE8A 4BHPA 1J5YA 5LGNA 1S8NA 3RYRA 3QPTA 2R7DA 3R4KA 3MEXA 2X4HA 3K9TA 4HDVA 1TQPA 2WWYA 1FLIA 2PI0A 4RB3C 3FZVA 1RUNA 2P7VB 4LGWA 1KU9A 3GUDA 2NNYA 3W6JB 2QUFA 1HXDA 3WTYC 6PAXA 4WWCA 5FFZA 2AS5F 2F5EA 1J2XA 2P7CB 4L9VA 2NYXA 4HV6A 5E17F 3M8EA 2LF7A 3NQOA 3KP6A 1OPCA 2M87A 3N4MA 1GXQA 4M73A 1G3TA 4QWQA 1CGPA 4M6YA 4L0YB 5BS6A 3E97A 3FHZA 1RI7A 1C0WA 2DTRA 2FEZA 2EWNA 4AIKA 4MEYF 4RGRA 1A04A 4LB5A 1O3SA 4AIJA 1BOAA 1R5GA 3KP2A 5FO5A 3IC7A 3DP7A 1TTYA 1ZARA 1I27A 4DQ2A 4BXUA 1ONVA 4GGGA 5DV5A 1W7PD 1FY7A 1FX7A 3FM3A 2HQRA 1Z6RA 4G7HF 1L3LA 2EFNA 5JFRA 1PP7U 3F21A 4IPAA 2P5VA 4WX9A 2HKOA 3K1PA 5CVVA 3P9CA 4HF0A 1LDKB 2LKPA 3LAJA 4HDUA 2P4WA 1K79A 2IRFG 5E18F 4UVAA 5HOOA 3KE2A 4ON0A 1G6NA 2KIUA 1EH7A 2EB7A 1U2WA 3IRQA 4HF2A 2ZMEB 4FX4A 2P6SA 2JPCA 3K2ZA 3J80Z 5ICCA 4O6JA 5LHIA 3BZ6A 2ZO4A 2BGCA 5HS8A 5HS9A 4MQVA 1FOKA 4R8HA 5IT9Z 3JTGA 2L02A 2A3SA 3QP5A 4M9XA 3RI4A 2VC1A 2V9VA 3F8MA 4OINF 1MKMA 3I58A 3KP3A 1YW7A 2MD5A 4HQEA 4HZFA 1XGSA 5FD6A 1OMIA 5H6RA 4P96A 5EEHA 4IF4A 1U5TC 3I54A 4IHSA 1JE8A 1OYIA 3LA3A 3GFJA 4RGXA 3M1EA 1Y0UA 4JK1X 4WXCA 3WTVC 3O2PE 1G4DA 1DPRA 4EJWA 1HSTA 3PQJA 4LLNA 5ILVA 1H0MA 3KETA 2YPRA 4EVIA 4ZZDA 1T0FA 4IXAA 1KA8A 2RC4A 3M9AA 2XV4S 4UUVA 4I01A 3TO7A 2HTJA 1MDMA 2NNNA 4RB1A 2DAOA 2O0YA 5HLGA 1TLHB 4YFKF 3FMQA 1ZGAA 5JHUA 3GEZA 3E3VA 2M5WA 1UHWA 4YFNF 1XN7A 2K86A 4U7DA 1G3WA 2E7XA 4XLNF 5ICFA 4AIHA 3QOPA 2QQ9A 1L0OC 3KZYA 5CJ9A 3SZPA 1J59A 1P4AA 4LLGF 3ZMZA 2XAGA 2VBWA 5FLXK 3M7GA 1RZ4A 1U8RA 2A68F 2XAQA 1E2XA 1ZN2A 3BROA 4AD9A 3BDDA 1YW9A 5D5WB 1QQIA 3HHHA 4BNCA 4A6EA 2YR2A 3KLNA 4HX8A 2FRHA 3OV8A 5H6QA 3LAPA 5LHGA 5LEKA 4M9SA 4WK8F 5D6EA 4PGGA 3WE3A 1G3YA 1S6LA 2FBKA 4BHCA 4S05A 4EGYA 2MC3A 5BPIA 2H6CA 3E6CC 2EA2A 4ZYGA 4JBAA 3RKXA 4LD5A 1O7LA 5BPDA 2CYYA 4O3MA 4I98B 4Z2YA 1ZRFA 3NRVA 5AIQA 2H6BA 3JAMK 1ZRCA 1XGOA 4GYIA 3MWMA 3T0YA 4CXFA 3V7SA 1T39A 1YQAA 4KIFA 2KJCA 4EQQA 2ACJA 3ABTA 3Q9SA 3SZTA 1R23A 3FMRA 2MBFA 5DCMB 2O61A 2FBIA 1QNTA 3E5XA 3WTWC 4EJUA 3EUHA 3DF8A 1ZLKA 2QQBA 3G73A 1AOYA 2W85A 1ODDA 4CZZA 3DFGA 5K5QA 1IRGA 4G7ZF 3GXOA 1HSJA 1FT9A 3FWEA 1NHAA 4PGHA 3E6DA 1MZBA 1IN8A 1MD0A 3WTZA 4U88A 2FOKA 4CYDA 5IT9K 1FP2A 4G8XA 2DPUA 4I0BA 1IXSB 3GO5A 2JT1A 1B9MA 2Y0MA 4KUMA 5AONA 2FNAA 2HEOA 2BV6A 4HQMA 1ZLJA 4RGSA 1ZYRF 2HYFA 5LEJA 1MGTA 3I53A 1K7AA 3T8RA 3ZMVA 3TO6A 5LRSA 3U9GA 3TDUC 3RYPA 4L0ZB 1XGMA 1D3YA 1D8KA 1IUYA 4UHTA 1KYZA 1TBXA 1FSEA 4EGZA 1YG2A 2ETHA 3MQ0A 1GXPA 3K69A 2ZCWA 3BPVA 2EFQA 1Z1DA 4NB5A 5L3EA 4IRGA 4EM0B 3BP8A 4AWXB 2W25A 3EDPA 5E20A 3DPTA 4HX7A 1TQIA 4A6DA 1I1GA 2IP2A 1XCVA 1XMAA 3DEUA 2KRFA 3LA7A 3DQVC 4EJOA 3LWFA 4U0WA 2GWRA 3HOSA 4P55A 3GFMA 5FD5A 3JSPA 5FFXA 1B9NA 4OIRF 5JVTA 4A2UA 3VFZA 3JTHA 4ZYHA 4UVBA 2EV0A 2YU3A 1ZH5A 5A2QK 4KN4X 3O3KA 4M74A 5LGTA 2ZNYA 3CUQB 2MA3A 1B4AA 4F7ZA 1BM9A 4OIPF 3K0LA 4NQWA 3GFLA 2D1HA 2XUBA 1USTA 1QZZA 2FU4A 3T1BA 4KA4A 3ECOA 4IRIA 3V8JA 1UB9A 1K6OA 1BI1A 2L01A 4UV9A 1LJ9A 4BHBA 5HLHA 2HR3A 2M1BA 2QQAA 2COMA 3KFWX 1Q1HA 5HDKA 2G7UA 1U5TB 3I5UA 4L9TA 4OOIA 2FXAA 2XASA 3CLOA 3F8CA 1QGPA 4ESBA 4LFUA 2HOEA 4JQFA 2MH9A 4E70A 2O8XA 4LLLA 1PP8F 1TW2A 4LK1F 3KCCA 4HAMA 1R7JA 3GVAA 2DLLA 3TDZC 5DCMA 2IPQX 4M9ZA 1J75A 3TKYA 3GF2A 3P7NA 4A0XA 2NRAC 3C3WA 5D4SA 2QENA 2BBYA 2P6TA 4B8XA 3GZ6A 1KU2A 4KN7X 3MFKA 4MTEA 5LRRA 3EYYA 4HF1A 1S29A 1T98A 4WXDA 1SFUA 3L00A 1P2FA 1FC3A 4A5NA 2E1NA 2DPDA 1FWZA 3ABUA 3SHFA 1AWCA 2K02A 1F5TA 4A0ZA 2IA1A 3RPQA 3ZQ7A 4KMUX 2ZNZA 2RQPA 2A6EF 4M71A 1W4MA 5L3CA 1DP7P 3PQKA 3KP5A 2DW4A 2FNPA 4LMYA 2VBZA 4MQ9F 4RGUA 4EM1A 3WGIA 1U5TA 2EK5A 1ON1A 4ENJA 1RNLA 2OQRA 3ERED 3J7AO 2HQNA 1OYYA 1KYWA 5D8LB 1XSDA 2A07F 5A2QZ 1SAXA 1T6SA 2XGXA 2B0LA 3FXUA 3CO6C 1LDJA 3RKYA 2E7WA 3T5XA 4G6QA 3FX3A 1ON2A 2V1XA 2J5PA 4WF2A 4OIQF 4CGZA 3REOA 1RUOA 3HRSA 1P4WA 2K4JA 2PMUA 2Q8KA 4HLXA 2FSWA 4TV7A 2PFBA 1O57A 5HDNA 4ZYEA 1BC8C 1XMKA 2GIVA 2Q2EA 2ELHA 2IVMA 4ETSA 3MZHA 2GZWA 4OMYA 4GO1A 1YFHA 2Z33A 2OZ6A 1JHHA 4P5OA 3TOAA 4UVCA 1ZHFA 3KP4A 2LNBA 2CQKA 2XVCA 2CO5A 3GYHX 3I59B 2A5YB 2WTEA 4RB2C 4BH9A 4M72A 2OAZA 4KIGA 1I1SA 1HQCA 2FF4A 2G7HA 2NAZA 3SQNA 1MJ9A 4HX4A 4L5IA 4MGRA 4PDKA 5LBQA 2OZUA 1PUEE 3CJNA 3E5QA 3I64A 4R79A 5K5RA 2R7FA 3E6MA 2VC0A 1B59A 3BOQA 3R6SA 5CVJA 4K2EA 1KU7A 2L4MA 5AIPA 5CVIA 3QAHA 3RJPA 2D1VA 2VBYA 2A69F 4BYYA 3P9KA 3VB2A 1R1TA 3C7JA 5L3BA 1SD6A 4Q4ZF 1J7KA 3R60A 1U3EM 3KLOA 2O03A
chains in the Genus database with same CATH superfamily
5DCFA 3G1LA 4HV5A 3TBIA 1Y39A 1D5VA 2VE9A 2XAFA 5C4XJ 4KMFA 4IQ4A 1FMWA 2KJBA 1UFMA 1X3ZB 5LHHA 1BA5A 2L5QA 3HTUA 1FIAA 1JKPC 3F6VA 3ISPA 1HC8A 3D5RC 2BY1A 2K9NA 3D0SA 2MG4A 1D1BA 3K70D 2ZMEC 3FM5A 2IS2A 1WQ2A 3HRMA 3FXQA 2A61A 1X1BA 1FEXA 1B6AA 2PJRB 1JGSA 2DQLA 1Y6IA 4LG3A 2VONA 3BJAA 1E3PA 1HDPA 4NUBA 2M8GX 3ZMTA 2AQEA 5BQTA 4B09A 5LD2C 2F5DA 3ASOH 2EIMH 3NWTA 4HSTA 3F8FA 3HOZJ 3VWBA 1IDZA 2DDAA 3CUQA 1K6YA 3EYIA 3ZMDA 3CUQC 4KFCA 5DM6F 3ECHA 3GZ5A 4F3QA 3BC8A 2CW0F 2E60A 3MKYB 4KNYA 2XB0X 4XBFA 3GX4X 2V9KA 2EIKH 4EJTA 3ZMUA 2ZJPF 5HS7A 1YJ9I 1Z9CA 4FT8A 2GAUA 3F3XA 3I0TA 1E3HA 3ZQHA 2X6YA 4G9YA 1XDUA 2ZMEA 5IP6A 1BIAA 4P9FA 5JLXA 1YIOA 4C3JJ 4L18B 2WAQA 3K1MA 5JR3A 1O7FA 3CDHA 3FXLA 1LVAA 2V9PA 3CZ6A 1LEBA 4FISA 4XRSA 3BPXA 5FKMA 4I0AA 2ZFWA 4D0PA 2MH2A 1HBXG 4BKXA 3BY6A 5LGUA 3OY9A 2XRNA 2P5LC 1IF1A 2PMZA 2OA4A 1TZLA 2EV6A 3L2QA 4V2GA 3CMYA 3FXRA 3ZXSA 3COAC 3G3ZA 1Y1VJ 2CQ7A 1K83J 2V79A 2W82A 3MVPA 2DBBA 1BIBA 2TRTA 2M3AA 4PFOA 2FMLA 2E2HJ 1RRJA 2VT2A 2LC2A 2XKPA 1H89C 3ZPLA 2PJPA 1WCMJ 1JUMA 1MJAA 2RNGA 3LSGA 5KAFC 4XLPF 3RKQA 2K7LA 2KZVA 1EV7A 2PQ8A 3ROUA 1A6IA 5ED4A 3OYDA 2CS3A 2CRGA 5EYRA 2FQ3A 2IW5A 2R3SA 4W97A 5JLWA 1AHDP 1YLFA 2DFFA 1KGSA 5TGTA 2VXZA 1FNNA 1GVJA 3M8FA 3QU6A 1ZGJA 5DS9A 3GFIA 2DXIA 2CSOA 1XSXA 2UZKA 5TJJA 2KIQA 4M3GA 1VQ9I 1U8BA 4B43A 3CCRI 2CMPA 2QZ8A 2QF7A 1IXRC 3WGHA 3CCUI 2E1CA 1SMTA 1IN4A 3OYEA 5CVUA 3IL2A 4ENKA 2H8RA 4CDGA 2L7FP 3HRUA 2W84A 2R7RA 3CCYA 3U2RA 2FMYA 3OWTA 3PSFA 3SZGA 2R0QC 1DP3A 1OCZH 4I02A 5J6XA 2VOPA 1V3FA 1W7PA 4LJZF 1YRNB 4EM2A 1WJCA 4MFDA 5GPAA 1SVLA 1R00A 2XGEA 1FBUA 1WJBA 5DD8A 1I50J 2DJIA 5H20A 1ETOA 1EH6A 3VPRA 5FKKA 4E7ZA 2H27A 1PUFB 4C3IJ 3AL0C 2V6CA 2FBHA 5J1RA 5IT3A 2VLAA 4ENNA 2G0EA 1IRXA 3ZN0A 2GOXB 2HFHA 4BQQA 1LEAA 2EFPA 1XMXA 1HA8A 2M0MA 2M8EA 3W3CA 4IHTA 1IV6A 2DFEA 1HOMA 2WAQN 1A36A 3I55I 4IHXA 3QPHA 2BW3B 2EQRA 4IL6C 2F5FA 2E2IJ 3RPUA 2V1DA 1N75A 5B5EC 3HYIA 2RGVA 1YW8A 3V4GA 4XLFA 1G8XA 4N0BA 2YX4A 3WG9A 1QZYA 1TWCJ 3IWZA 1BN5A 5BOXA 1BW5A 3HBLA 3KEOA 4B1RA 5ICEA 3M07A 2CFXA 3ZRGA 2HPMA 2L4AA 2Y2ZA 3LFKA 4QLCU 3R61A 2ESNA 5EEAA 3V7CA 3ZGKA 5J8FA 2HVRA 1S72I 1JHFA 2DA2A 3H3ZA 2E36A 2H94A 2X0LA 3HXLA 4D9JA 1K78A 3WODF 5L3GA 3T8TA 3QRFF 3D5LA 3NEUA 2AHQA 4N4NB 2KZGA 1QVUA 4XL9A 1W5SA 1I5ZA 2DMUA 3L9FA 2DT6A 5CKTA 4B3AA 4J19A 2OU2A 2NVTJ 1MBEA 5GTHC 4Y15A 4DNCA 1DPUA 2UV1A 1S3JA 4A12A 2DA6A 2IA0A 4B48A 3LOCA 4HYEA 1LFPA 3G1OA 1BR2A 3ZP5A 2CV1A 3RKWA 2KIFA 3TW7A 1XCBA 1J0RA 2E2JJ 3OYJA 3VOEA 3QYFA 2PN6A 3CD6I 1YS6A 1WJAA 1WKMA 4HNTA 1W36D 2D2WA 3DKWA 4E6KG 2DT5A 3F8BA 3WU2C 3DLLF 1KU3A 3LMMA 5TRDA 4BAYA 2O6GE 3CJQB 2Q0OA 1P6RA 2XF6A 5DYMA 3S1QJ 2RDPA 5K1YA 4NC7A 2V26A 5J1UA 3MKZA 2K9MA 3RIRA 3BCAA 1OKRA 1MH4A 1BBYA 2G9WA 2QGUA 1KQ9A 1K4TA 2FQ4A 3ZMSA 2H8WA 3WU0A 4XRSG 1OQYA 2JQ7A 5IYCJ 1Z21A 1YJWI 1VTNC 3U1DA 1W1WE 1X3UA 3E6BA 3ZN1A 4Q48A 2W4SA 1WSUA 2EZKA 3OYCA 2QCOA 3BCBA 5D5VB 4A3LJ 2M0CA 2Z1DA 4A3JJ 2VN2A 3PO3J 1E0EA 4XLHA 4IKFA 3MZYA 1S7OA 2LP0A 5E1ZB 1QPMA 3ONQA 3K4CA 3ELKA 2ZB9A 2AXTC 5BMZA 5FLVA 1Z3YA 5IOZA 3CDIA 3HOVJ 4PJ0C 1FYLA 1MBFA 5FB2A 1SMYF 1TC3C 1FP1D 3CDLA 1Y8RB 5H2FC 2M30A 3A03A 4CCMA 3DLAA 3WTXC 3LA2A 1OR7C 3TEDA 2CW7A 1SVMA 5E1WA 2PLYA 2JA7J 4U0VA 3RTRA 2E5ZA 2HPIA 4XN3A 3FKIJ 1ZG1A 4UNOA 3O6BB 1SD7A 1IRFA 3BJ6A 2UXNA 5D4RA 2QBYB 4Y13A 2ZXHA 4V2FA 5GPCA 3HIFA 4CCKA 3GW2A 3TO9A 2DA3A 1IV8A 2PBIA 3CESA 5HNHA 1QZEA 5FRNA 3HTSB 1HKTA 1UHMA 3DEWA 5HNFA 4U0YA 3FBNB 3H3UA 1OFCX 3TQNA 4BQOA 3CLQA 2ZXJA 3BG6A 5F6FA 2NOJB 3ZR8X 2Z16A 4CCJA 5L3DA 1ZAOA 1FPQA 2CG4A 2Z99A 2BY2A 3DXJF 3KIOA 4XKBA 2OCCH 2B63J 2GM4A 3DU6A 1ZG5A 5EZGA 3C18A 1B1BA 3Q3SA 3BLYA 4YFXF 3WTSC 3M4OJ 1Z91A 5DM7F 1QA6A 1SFEA 3TGNA 4BJ5C 3DKXA 2M9HA 3MD2A 3NWSA 3PNTA 4A69C 2LY9A 2NS0A 4ZDLA 4S04A 5C3EJ 1FZPB 4IOAF 2JVGA 1F4KA 2LDUA 1DDNA 4ZC3A 3ML6A 1X58A 3K6GA 4L9JA 1U9OA 2L9SA 2NS8A 4RMNA 4A5MA 3JSOA 2V7FA 5D5XB 3A0HC 3ZQIA 1APLC 2CJJA 3B73A 5CPRB 3F22A 1XX5A 1JJ8C 1MNMC 1FSHA 4I2OA 1LDDA 4LIVA 2V1NA 4LOCA 4BQAA 1IGNA 2VQCA 5F27A 3N97A 4E7HA 3R0JA 3SXYA 3VODA 1ETWA 2WY8Q 3K4NA 3PFIA 4J01A 1X4OA 3WTTC 2DO7A 2HVSA 2O3FA 2BVMA 1VQ5I 3M3YJ 2DOEA 2H09A 2XHKA 3KP7A 5E8GA 2FE3A 3LQQA 5KAIC 1ETXA 4BE0A 4EMSA 3I71A 2KRCA 2JA6J 1XC5A 2Y0SN 3K7AJ 4NNJA 3CCQI 1VQ8I 2UWMA 3K1NA 3CC4I 4G94A 3BWGA 1FMVA 2Y0SA 4CICA 2R5ZA 3H5NA 3FISA 2ICWG 2QLZA 4CCNA 4CH7A 4I7HA 5DUIA 2DA4A 1P9QC 4XRMA 4P1WA 3CCSI 1E17A 1HW5A 3GMEA 4A0YA 2IA2A 4OAYA 4YRVA 1DUXC 1LB2A 4BJ6C 2OV7A 2HNHA 2MABA 1X3WB 4IHYA 1U9NA 2YU9J 1D8JA 4N4OB 2BXZA 3DTIA 2CGPA 3IKVA 1FTZA 5F0CA 1CF7B 2ZBKA 2STWA 1I3QJ 1V5FA 3OIOA 5CYVA 4BDZA 3P5JA 4UV8A 4RB0A 4MHGA 3FBIB 3H5RA 1YO5C 2Y30A 1IXCA 3HSRA 3MZ8A 4KYWA 1V4RA 1J9IA 2KL4A 5ILUA 4I76A 4G6TB 5HLIA 1WI9A 3Q0UA 1P4XA 1MMAA 2DYRH 3HG9A 3JW4A 4Y17A 5GAEJ 2Y75A 1ZGWA 4RAYA 4EV0A 1TP4A 3KPHA 5GADJ 4KJZA 1LFUP 2WV0A 2D45A 3C1DA 3CCMI 1LPQA 2XSDC 1P7IA 3IH2A 2DTZA 3HRTA 3DBHB 2XDVA 2DU9A 4AVPA 2ELJA 1S7AA 2JA8J 1RC9A 2R5ZB 2KDOA 2NVQJ 1R5HA 3VEPA 3MCZA 3GZNB 2K27A 4P9UA 2DK5A 4KISA 2P8TA 4AYBN 3BR2A 3H92A 1W7PB 1RKWA 2MLKA 2VT3A 4FASD 4CSWA 1T0FC 3OSGA 4ESJA 1M1EB 3MN2A 5J47A 2F2EA 2ZFUA 3JRIA 1BJAA 1Y0NA 1V5EA 1TL8A 4UB6C 2IS4A 1KQ8A 2EJRA 4MNUA 4NHJA 2A6HF 5GP9A 2X6OA 2KKOA 1W0TA 5KVRA 3ULQB 1JUSA 4PUSA 2STTA 1H9TA 3QP6A 4ZH4F 1GLNA 1X1CA 2KMUA 3W6KB 3JRHA 1H8AC 3SYTA 4BDYA 2K9SA 2C6YA 2JSCA 2RV8A 3BR1A 3P9IA 1AKHB 2DMTA 2WV1A 3WGGA 3H0GJ 3LFUA 4XICA 1YTYA 5DEQA 4H0EA 2RKHA 2OC6A 3SFZA 2KPMA 3IKTA 3K70C 4C3HJ 2VJIA 2Y48A 4HBLA 2XAHA 1EKEA 1D0ZA 4UUTA 1UCRA 1TNTA 2XAJA 3CP2A 2V1UA 1QO0D 4ENMA 2VODA 4D5CA 4KICA 2L3DA 4RDUA 4IHWA 2L9RA 2XGDA 3E5UA 1JT0A 4DJAA 1U0JA 2JRTA 4CCLA 4ZZLA 4WCGA 3MKLA 2TDXA 1IZ1A 2WC2A 5HDGA 3E1SA 1QBJA 2R7ZJ 1KQ0A 4BE2A 4XMYA 1OCCH 2Z9OA 5ERIA 3AAFA 3HSEA 2QQ8A 2CH0A 3V8LA 4A3IJ 1TW3A 4KT5C 2LVSA 4NC6A 1LNWA 4G7OF 3F8NA 4MTDA 5L3FA 2K4BA 2M2EA 3IWFA 4AIDA 1JKQC 1HW2A 1SFKA 2CQNA 3A4CA 2HDWA 3GWZA 4B44A 2JA5J 1V54H 3FK6A 3IUOA 2ECCA 2GQQA 4G12A 2OQGA 2X85A 1LKXA 3SEQA 2IT0A 2F5CA 1ETKA 2IEKA 4RA2A 2IBDA 5E8IA 1JUPA 5F64A 3I4NJ 1DU6A 2KIMA 4UXNA 1QVTA 1T56A 2GXGA 2XIGA 1K78B 2CFOA 4FHTA 1Z05A 2VI6A 2VKEA 2ELKA 4JOMA 2GOMA 1EH8A 3A1YA 2PMHA 1USSA 2IJLA 1BW6A 3ABLH 4R1HA 1RIOH 4B3XA 4M3EA 5FGMA 5E3MA 4D1QA 2DI3A 3PNVA 2I8DA 5CVRA 1YI2I 2WBMA 3AKZA 1REPC 4EJVA 3BG7A 4XSXF 1IG7A 1FYMA 2ME6A 1NH3A 3KZZA 4A3KJ 2XF5A 1RKTA 3L2WA 3OOPA 1RETA 5DD4A 1R58A 2O7OA 2BYVE 5K5OA 5B66C 5E1XA 2V6EA 3JRGA 1BI0A 4HEA2 4OIOF 3LQRA 1IN7A 1SC7A 1F9NA 4XQFA 2GA2A 5EGOA 1SD4A 1U6GA 1HLVA 3AG3H 4L9NA 1TT5B 2LF8A 1SEUA 2HQAA 3HUGB 5DUKA 2JTVA 5J3LA 3W2AA 5FLXZ 4ZYDA 1ZG3A 3HDDA 3I56I 1OLTA 5D8KB 1WHUA 3K4MA 4DYCA 1JKOC 3H9QA 3QU3A 1G59A 2ESHA 3I4PA 2W00A 3HHGA 3IRRA 1PDNC 1OYWA 1UMQA 2A6TA 2M45A 5D5UB 2XPUA 4I09A 2ISZA 2VBXA 5KHDA 3OMYA 4PJMA 4CHUA 2FJ1A 2LYCA 4OAZA 2KHMA 4XKVA 1FOWA 4M6VA 3H0DA 4YIFA 5JVGF 3J81K 4HA8A 4DGWB 3BG3A 3OOUA 4NC8A 4ZDPA 3PIOF 1X1AA 3MMYB 4LG0B 3WE2A 2J5OA 1TWHJ 2M7BA 4IRHA 3IHUA 2XKOA 2Z2SB 3IP4B 4LK0F 5EEGA 4AUXA 3J80K 4LIUA 1SFXA 2JPBA 3FK7A 4GCVA 3G4SI 1R1UA 1HW1A 1I6XA 2W24A 3CTAA 2CV0A 1MJBA 1N25A 1O3RA 2COBA 4YIIA 1WJ5A 4XLAA 4CYCB 1O3TA 4GXOA 3CF5F 3LSKA 5GAHJ 4A3GJ 1Z77A 4QSHA 5HVQC 3JREA 3W2WA 3Q9VA 4M3FA 1IAWA 4Q5SF 4RS8A 3QOEA 4H4KC 3V42A 3HOUJ 4AU7A 1YS7A 3W6VA 3S16J 1G3SA 2VOOA 5DDGA 2XROA 3BQZA 4JX6A 3DBLB 5GAGJ 2ZJ2A 4JP0A 3HOTA 2MGQA 1GHCA 1WH5A 3HPGA 1E3OC 2PEXA 2YX7A 3BTLA 3RZOJ 4MEXF 5JHFA 4KIBA 3FXOA 2EV5A 2PMZN 5D6FA 3EETA 2HS5A 2KDZA 4HNUA 5IYBJ 2R92J 1OCPA 2CQXA 2DK8A 2W57A 3FKJA 4HNVA 5LLQA 5FRMA 4GYGA 3GLXA 4HLYA 1WRJA 3V8KA 3G6EI 4BE1A 2MLGA 2ISYA 4E4HA 4FX0A 3L7WA 1U78A 2P5KA 3IH3A 1YYVA 2DQRA 1AA7A 2A5WA 2LG4A 1VI0A 3I59A 4U7BA 3WG7H 1VNDA 1JXSA 2NVUB 3PIPF 2EFOA 4ZTJA 4L5JA 4LG0A 2L54A 4Q47A 3FIWA 4Z6YA 3HGYA 1R1VA 5J8CA 4PZJA 4HOBA 3S17J 3CO7C 2YSRA 4OMZA 1X4PA 3RDIA 5E79C 3S2WA 5F0FA 1TQMA 2EFWA 3R0AA 3DV8A 4O5VA 1XD7A 2VQGA 1LQ1A 3I3LA 2HKXA 1TNSA 3F6OA 2F4IA 1UG0A 5TISC 3JAMZ 3ZQGA 5JI6A 1ULYA 2QWWA 3L09A 2GLOA 2R7WA 2ADUA 2QKMB 3AG4H 3LSIA 2LSOA 3MAJA 1HKSA 2ZJQF 3BJOA 1Z6TA 3LSPA 1BI3A 2LLKA 4NQWB 3FHNA 3OYBA 2VL8A 5KK1A 3L2CA 1Q1VA 1B8IA 4CA0A 2EILH 4M6XA 2F6CA 4BEHB 3CC7I 5B1AH 3J81Z 4QPQA 3N05A 2O8KA 2RNJA 4RM3A 3BTIA 3RQIA 4JX4A 5IYDJ 2FA5A 2HOAA 4RBOA 3FXJA 2RN7A 4JYKA 4XRFA 4RAZA 1CF7A 3GTJJ 1IDYA 5M3FJ 4DYRA 2GXBA 3GTPJ 1X2NA 2Z3YA 4XLEA 1IN5A 1IN6A 1IW7F 2Q1ZB 2H1KA 4IVNA 3HSFA 1SVOA 3OL4A 2OUMA 4E7JA 4G6DA 5EF6A 3OSFA 1VQ4I 1TWAJ 4YG2F 3F23A 3KEQA 2XSJC 1SD5A 1F1ZA 1D1CA 3HUGA 3FF5A 4XSZF 5M5WJ 3F72A 3CJTB 4GRIA 2HZTA 1T2KA 2NVXJ 1XSVA 4ASNA 1BI2A 2MYSA 2DOFA 2RVCA 4XOTA 3CMEI 3WU1B 2QVOA 1HKQA 4CO8A 2UXXA 1ZRDA 5CLSA 1MDMB 2CW8A 3HL2A 4BJTA 1XB4A 2KISA 5K7ZA 1TWGJ 2JSPA 2DMNA 3OR2C 4ABZA 4WXHA 4X0GA 2QYOA 2EPFA 4PFPA 3B02A 3S2HJ 3FMSA 1SANA 3OYNA 4E7SA 4PCQA 1FBSA 3DPUA 1R22A 2BE5F 3GLLA 2Z5UA 4ESFA 1STZA 2MFZA 2HYGD 1O3QA 4HW0A 1SFOJ 1ZREA 1X1DA 4N9HA 1W5TA 2OD5A 1T08B 2GA1A 5B3SH 2EH3A 2HDCA 3OYFA 3DPLC 3LSTA 2WAEA 3Q5FA 3TOBA 2F4OB 3EQLF 1Z3XA 4DBRA 3GTKJ 2HTSA 1Z7UA 2E34A 2Y9YA 1P92A 3ESWB 1H9GA 3CUOA 1BC7C 2PG4A 2DFIA 2HWVA 1FBQA 2HGCA 2XAUA 3AFHA 3HZJA 2AQFA 4CYCA 1T38A 4AC0A 4KDPA 1FTTA 4PSXA 4OU0A 2EINH 5ILSA 2QBYA 2JZYA 1R36A 1XDSA 2JRMA 1MNDA 3HOXJ 3WTUC 1OR7A 1XGNA 4E7KA 2JA2A 4MFEA 2FD5A 1WWXA 4XORA 1BJZA 4IJAA 4XLCA 5F1RA 5FJ8J 2CWEA 4LB6B 2ZKZA 2DOAA 1Z67A 3S1NJ 2AXLA 2QM3A 4N9IA 5ICGA 1JTYA 3BR0A 2EA4A 3V7RA 2JUCA 2OBPA 2MW8A 3DBRB 1FYKA 3OYGA 2BEOA 2VE8A 4BHPA 1J5YA 5LGNA 1UJ8A 3WHBA 1S8NA 3RYRA 2IGKA 2L0KA 1MMNA 3EUHC 3QPTA 2IGNA 2R7DA 4IEJA 2ZSIB 3R4KA 1PVEA 2JJ7A 3MEXA 2X4HA 3K9TA 3NAUA 2ZC2A 4B4CA 5EDNA 4HDVA 4YIRX 1GV5A 1TQPA 4FETA 4EATA 2E1MC 2WWYA 1Z7LA 1FLIA 3KZIC 1R71A 3F9KA 2BY3A 2PI0A 2LH9A 4HRIA 2R93J 4RB3C 3FZVA 1RUNA 2P7VB 4LGWA 1KU9A 3GUDA 1CQTA 1A35A 2NNYA 1BL0A 2ECBA 2X6WA 4QIWN 1YX5A 3C2HA 3W6JB 3ZQQA 2QUFA 1HXDA 3H5AA 2ID6A 4F93B 3WTYC 4MO7A 2ME0A 3QYBA 6PAXA 4L5EA 4WWCA 5FFZA 3S1RJ 2AS5F 2HOSA 2VIXA 2F5EA 2QA4I 1J2XA 3Q0WA 2P7CB 1PJRA 4L9VA 2NYXA 1A31A 2VPLA 3RZDJ 4HV6A 3U21A 5E17F 3M8EA 1K4SA 2DN0A 4BEHA 2LF7A 3NQOA 4FE4A 1DU0A 4A3CJ 3KP6A 3KEYA 1OPCA 4D7MA 2M87A 3N4MA 2VKDA 4MIMA 5B1BH 1GXQA 4M73A 2AO9A 3LSHA 2R7XA 1G3TA 3UR3C 4QWQA 1CGPA 5FKOA 3UKGA 2I10A 4M6YA 1UZCA 2HOTA 4L0YB 5BS6A 3E97A 3FHZA 1D5YA 1RI7A 1C0WA 4AVZA 1YRNA 3OYHA 3LNQA 2DTRA 3B6AA 3FXKA 2FEZA 2E19A 2EWNA 4AIKA 4MEYF 4RGRA 1A04A 2K9LA 3JRDA 1RR8C 5E3OA 4LB5A 2HQ5A 1O3SA 2IGMA 4AIJA 2W7NA 4M3DA 1ZR4A 3IAS2 1BOAA 2ZXIA 3QODA 1R5GA 3KP2A 2H1LA 1VQKI 1LUJB 1N77A 5FO5A 5EG0A 3IC7A 3DP7A 1TTYA 1UG2A 3KYDB 1ZARA 1A6QA 1I27A 4AYBA 4CZCA 4DQ2A 4IOCF 2FX0A 4DOZA 4BXUA 3OYIA 1ONVA 4GGGA 5DV5A 2WA0A 1W7PD 1FY7A 1GT0C 1FX7A 2GBYA 4Y52J 3FM3A 2MD0A 2HQRA 4F52A 3A01B 3U1KA 1Z6RA 4G7HF 1L3LA 1OCOH 4CCOA 1VQLI 2EFNA 3ERMA 5JFRA 3SDBA 1PP7U 3F21A 2LKSA 3BTJA 4IPAA 2WB1N 2P5VA 3H3VK 4WX9A 2KLOA 2HKOA 3K1PA 4II3A 1LE8A 3IAM2 2I5UA 5CVVA 3P9CA 4HF0A 2OCEA 1LDKB 5M5YJ 2LKPA 3LAJA 5HLTA 4HDUA 3TP0A 2P4WA 1XS9A 1K79A 2IRFG 5E18F 4UVAA 5HOOA 3KE2A 3BTCA 4ON0A 1G6NA 3RPUD 2KIUA 1EH7A 1GDTA 2EB7A 3VSKA 1U2WA 3LSMA 3IRQA 4HF2A 2ZMEB 4FX4A 2P6SA 2JPCA 2OPTA 3K2ZA 4BGDA 3J80Z 5ICCA 1ZK8A 2VJ5A 4O6JA 2X1CA 1VFCA 4FCYA 5LHIA 3C2BA 1T8IA 3BZ6A 3EPZA 2ZO4A 2BGCA 2RREA 2XC7A 1S5LC 4D7NA 4BY1J 3OYKA 5HS8A 3G71I 5HS9A 2BY0A 2QSHX 3QYEA 1ZELA 4MQVA 1FOKA 4R8HA 5IT9Z 2BVLA 3JTGA 2L02A 4BY7J 2A3SA 4GFBA 3QP5A 4M9XA 3RI4A 1VQMI 2X51A 1YE9A 2VC1A 2LBFA 2V9VA 3F8MA 4OINF 3OYAA 2GIZA 1MKMA 3I58A 3CQZJ 3E0JB 4W1UA 1R4MB 1IUFA 2VXDA 2X1EA 3HEFA 3KP3A 4XKWA 1YW7A 3QPSA 4IQJA 2MD5A 4HQEA 4DW6A 4HZFA 1XGSA 4UUSB 5E3LA 5FD6A 4HG2A 1OMIA 1LE8B 4ZDOA 4NDLA 4XONA 1VZ0A 5H6RA 2DYSH 4P96A 3OR1C 4BS9A 3H35A 2XPVA 1R6RA 3LSJA 3RCOA 5EEHA 4IF4A 1U5TC 2ZSHB 2OTJI 3I54A 5IP9J 4IHSA 3BG5A 2NXNB 1OYIA 1JE8A 3LA3A 4Y7NJ 3GFJA 4RGXA 1T95A 3M1EA 1Y0UA 4JK1X 2X48A 2VB6A 5J1YA 4WXCA 4IHVA 3CCLI 2B9SA 3WTVC 3O2PE 1G4DA 1DPRA 1X2MA 2QSGX 2LY2A 4RLQA 5C4JJ 1OCTC 4EJWA 1HSTA 3PQJA 2HVQA 2PX9A 4LLNA 2LOOA 5ILVA 1H0MA 3KETA 2YPRA 4RM2A 3CJRB 5C44J 4RAFA 3K4BA 3AG1H 4EVIA 4KITB 4ZZDA 4X6AJ 1T0FA 1P7JA 2BZTA 4DYQA 3KX2A 4V19K 2XPWA 2WADA 4IXAA 1XG1A 2NS7A 3CP8A 3GTLJ 1KA8A 3LL7A 1F43A 1RPWA 2RC4A 4NBQA 3M9AA 2LMDA 1VQ6I 4B47A 1YITI 2XV4S 4UUVA 4I01A 3TO7A 2HTJA 1MDMA 2NNNA 4RB1A 2CQQA 2DAOA 2MSYA 2O0YA 1JJ6C 5HLGA 2DFHA 3S14J 1TLHB 4YFKF 3FMQA 1V5GA 3A0BC 1ZGAA 2VPRA 5JHUA 3GEZA 5IP7J 2L9VA 2R7SA 1XTAA 2KFDA 3OIQA 3E3VA 2R7UA 2M5WA 4LITA 1UHWA 4YFNF 1XN7A 2K86A 4U7DA 1G3WA 2E7XA 4XLNF 5K7HA 4II2A 5ICFA 4AIHA 3D1NI 1R9TJ 1GVDA 3QOPA 2QQ9A 5GTIC 1L0OC 1EJ9A 2P81A 3KZYA 3TP3A 5CJ9A 2WAFA 3SZPA 4A3FJ 5CQEA 1JTXA 1J59A 1P4AA 2LY1A 1DGRM 4LLGF 3ZMZA 2XAGA 2VBWA 1OJLA 1IRZA 5FLXK 3M7GA 2CUEA 5J4YA 1IO2A 5IPAA 1RZ4A 3PSIA 3FXMA 1U8RA 2A68F 2XAQA 2LFBA 4S0HB 1E2XA 3K4JA 1ZN2A 3BROA 4AD9A 1B72B 3BDDA 1YW9A 2KT0A 5D5WB 1QQIA 5K7FA 3OL3A 1ETVA 3HHHA 2W1OA 4BNCA 4A6EA 2YR2A 3KLNA 3PUFA 1DGWY 4HX8A 2FRHA 3OV8A 5H6QA 3LAPA 3BR6A 1W36C 3HJEA 5LHGA 5LEKA 4M9SA 4WK8F 1NTCA 2LD5A 5D6EA 4PGGA 3WE3A 1G3YA 1S6LA 3BZKA 2FBKA 2VASA 1AU7A 3VYSB 4BHCA 1VQ7I 4S05A 4EGYA 4YELA 2MC3A 2K9QA 1H88C 5BPIA 2H6CA 3PUBA 3E6CC 2EA2A 4ZYGA 3CCVI 1D0YA 4BBRJ 3MKWB 4JBAA 3RKXA 4LD5A 1O7LA 1W5CC 5BPDA 2CYYA 2IS6A 4O3MA 1MBJA 2CUZA 4I98B 4Z2YA 1ZRFA 2PJRA 4PK4A 2HZDA 1WJFA 2WY7Q 2JVHA 4DBQA 3NRVA 3GTQJ 5AIQA 2H6BA 3JAMK 5IOYA 1ZRCA 1R49A 1QRYA 2O5RA 1XGOA 3CC2I 3OS0A 4GYIA 3MWMA 3T0YA 3VSLA 1UELB 4CXFA 3V7SA 2DA7A 1T39A 1YQAA 1WJDA 4KIFA 2KJCA 3HKZA 4EQQA 2HI3A 2ACJA 3ABTA 3Q9SA 3SZTA 1R23A 3FMRA 3H36A 4IZZA 2MBFA 3S1MJ 4IX7A 5DCMB 1NK2P 1BR1A 1OCRH 1WVRA 2HYJA 4D5FA 3J7AY 4ZJZA 2O61A 4I6ZA 2FBIA 3PL8A 1QNTA 3E5XA 3WTWC 4EJUA 4BXXJ 3EUHA 3DF8A 1ZLKA 2KRHA 2QQBA 3G73A 1KZHA 1AOYA 2W85A 3DWLE 4F91B 2CV2A 5KCMA 3ZOBA 1ODDA 2EBIA 3DFGA 4CZZA 1VF9A 5K5QA 1IRGA 3S32A 4G7ZF 5EZHA 3O8GA 2F5VA 1QU3A 3GXOA 3QPLA 4FE7A 1HSJA 1FT9A 3FWEA 3UNGC 1NHAA 4PGHA 1VQPI 3E6DA 1FIPA 1MZBA 2BXYA 1IN8A 3DKYA 1MD0A 1Y56A 1Y1WJ 4AM3A 1MH3A 2VUMJ 1MMGA 1YX3A 3WTZA 4FTHA 3OIPA 4U88A 2DA1A 3KYLA 1D0XA 4U87A 2FOKA 3DEEA 3SDGA 4CYDA 5IT9K 1YOVB 1GV2A 1HF0A 2BW3A 1FP2A 3GTOJ 3PFYA 5FKLA 2L2OA 1OISA 1PYVA 4G8XA 2DPUA 3J7ZI 4I0BA 3S93A 1IXSB 2EZIA 2LK2A 3GO5A 2JT1A 2DMPA 3H9GA 1B9MA 2Y0MA 4KUMA 3GBGA 2K3PA 3IH4A 5AONA 3L2RA 2FNAA 3HC7A 2HEOA 1WI3A 4QPOA 3SJMA 2BV6A 1ACIA 2F48A 1JKRC 4BQNA 4X1EA 2E35A 4HQMA 1ZLJA 2LKXA 3QWLA 4XN0A 1J09A 2HDDA 3JRFA 1KONA 4RGSA 1ZYRF 2HYFA 1HDDC 2EZHA 1S9HA 2F4MB 2RQQA 5LEJA 1MGTA 3CCEI 1WPKA 2IGOA 3I53A 5F08A 4EEFG 1K7AA 3T8RA 2R4GA 1GUUA 2WB1A 3BT9A 3E7LA 3ZMVA 3TO6A 5LRSA 3A02A 2GXAA 3U9GA 3CMMA 3TDUC 3OS1A 3RYPA 3S15J 4L0ZB 1XGMA 1D3YA 1D8KA 2XGCA 2D5VA 2IS1A 3K10A 1IUYA 4UHTA 1KYZA 3K2AA 1TBXA 1FSEA 2HXIA 4EGZA 1YG2A 2X1DA 3F0CA 2ETHA 3PNYA 3MQ0A 5EJCA 1MBKA 1A5JA 1NG7A 1GXPA 3K69A 5KNLA 2R5YA 2ZCWA 1F36A 3BPVA 4BBSJ 2EFQA 3VDXA 1Z1DA 4NB5A 4E7IA 5L3EA 3H1CA 1I39A 5IY5H 4GDFA 3BR5A 4A93J 3TL4X 1MW7A 4IRGA 1ZR2A 4EM0B 1ZKGA 3NARA 3BP8A 4AWXB 2W25A 3EDPA 5E20A 2E5NA 3DPTA 1Z0XA 4HX7A 2QSFX 1TQIA 2W48A 3B6CA 2BHZA 4A6DA 1I1GA 2IP2A 1FOYA 2R7VA 3G2BA 1YJNI 3G1MA 1XCVA 2NVYJ 3HOWJ 2CUFA 2HXOA 3BZCA 1XMAA 3HKZN 1YHQI 2R7TA 3DEUA 2KRFA 3DCFA 3LA7A 3DQVC 2XF7A 4EJOA 3KYCB 4Y3OA 3LWFA 2CUJA 4U0WA 3CCJI 3JR9A 2NOGA 5HODA 2GWRA 5M5XJ 3HOSA 4P55A 3GFMA 1MBHA 3JRBA 5FD5A 3JSPA 5FFXA 2LR8A 1B9NA 4OIRF 4PSWA 3AG2H 5JVTA 2EZLA 4OWRB 3VFZA 2FUG2 4A2UA 3JTHA 4ZYHA 4UVBA 1EF4A 2QKLB 2EV0A 3VYUB 4A3EJ 2ID3A 1N78A 2YU3A 2X6XA 4ITVA 2R7QA 3RQ4A 1ZH5A 5A2QK 3W2VA 3I9V2 1Y8QB 4KN4X 3O3KA 4M74A 5LGTA 2ZNYA 3CUQB 4UY8I 2MA3A 1B4AA 4F7ZA 4M3BA 3DU5A 1BM9A 4Y4RA 4OIPF 1R4NB 3K0LA 4KT6A 4NQWA 3PO2J 3GFLA 1D1AA 3ZQFA 4BXFA 2D1HA 2XUBA 3EUKL 4F55A 1USTA 3FDYA 2MC4A 1QZZA 2FU4A 3T1BA 1QPIA 4A3BJ 4KA4A 3ECOA 2Y69H 4IRIA 2FOWA 3V8JA 4BACA 1UB9A 1K6OA 1UAAA 1BI1A 1W0UA 2L01A 4UV9A 1V55H 2A05A 4ANJA 1ZQ3P 1LJ9A 4BHBA 1VQNI 3S3NA 3TMOA 5HLHA 4ZTFA 2HR3A 5EG0B 2M1BA 3O8HA 2N8GA 2Q2EB 2QQAA 2L7MP 5FLMJ 2K5CA 2COMA 4J00A 3KFWX 4E7LA 1Q1HA 3H9JA 2ZJRF 4MLOA 5HDKA 2G7UA 3JRAA 2P0WA 1U5TB 2DA5A 3I5UA 4L9TA 1ENHA 2FXAA 4OOIA 3SFIA 2XASA 4C30A 3PM1A 3CLOA 3F8CA 1QGPA 4ESBA 4LFUA 2HOEA 2L7ZA 2OF7A 2XRLA 2YUSA 4JQFA 3ABMH 2MH9A 2BHYA 4E70A 2M7AA 1RR7A 1QHGA 2O8XA 1WGXA 4LLLA 1PP8F 4XKCA 1TW2A 4LK1F 3KCCA 3HPHA 1I3AA 4HAMA 1R7JA 4YEJA 2OTLI 3GVAA 5F1JA 2DLLA 5M3MJ 3TDZC 5J40A 5J4VA 2Y31A 1BR4A 2K85A 2TCTA 2IPQX 5DCMA 3VYRB 4M9ZA 1J75A 3TKYA 3GF2A 1DQUA 3P7NA 4A0XA 1MMDA 2NRAC 2DDBA 2CU7A 2IXSA 1JT6A 2QENA 3C3WA 5D4SA 1PUFA 2RAEA 4DZJA 2BBYA 4A3DJ 3ZQCA 2P6TA 3CF2A 3C2GA 4B8XA 3QQAA 2B7EA 3GZ6A 1NK3P 1NG6A 1KU2A 2L7KA 2VJ4A 4KN7X 3SEZA 3MFKA 1MSEC 4MTEA 3S2DJ 5LRRA 3EYYA 3K4KA 1ERDA 2O9LA 1JI8A 4HF1A 1S29A 4CUGA 4F92B 1T98A 4WXDA 1SFUA 2KQRA 3L00A 1P2FA 3DTKA 1MMSA 1FC3A 4A5NA 2E1NA 1R5ID 4FQGA 1AKHA 5BNGA 1FWZA 1AWCA 3ABUA 1ETYA 3SHFA 1BOBA 2DPDA 1B72A 3D5SC 2K02A 1F5TA 3DTEA 4A0ZA 3A2KA 4C9YA 2IA1A 4XIDA 3RPQA 3ZQ7A 1WH7A 3GCMA 2YS9A 4XR6A 1MSFC 2IAIA 4KMUX 2ZNZA 3GTMJ 2RQPA 4XNFA 1WFXA 2A6EF 4M71A 3JRCA 1W4MA 2X9DA 2QEXI 5L3CA 2DT7B 1DP7P 4BU2A 1YIJI 3PQKA 3KP5A 2DW4A 2FNPA 5EGOB 3AL0B 1FOXA 4LMYA 2VBZA 4MQ9F 4RGUA 4EM1A 1U5TA 3WGIA 2EK5A 1ON1A 4ENJA 1SAUA 3IV5A 1RNLA 2OQRA 1MNEA 4ZYAA 2OJED 3ERED 3BG9A 3J7AO 2HQNA 2Y9ZA 1XPXA 3I4MJ 1OYYA 2LRDA 3J7YJ 1KYWA 1TT0A 1FJLA 5D8LB 2HU9A 1EA3A 4PJLA 5DTDA 1XSDA 2A07F 5FKNA 1O4XA 5A2QZ 3L2UA 1SAXA 3ABKH 2JUGA 1T6SA 2XGXA 2B0LA 3FXUA 5CQGA 4DZPA 3CO6C 2JK3A 2XB5A 1LDJA 3X2QH 4C2TA 3RKYA 2DMQA 2E7WA 3T5XA 1IC8A 4G6QA 3FX3A 1ON2A 2V1XA 2J5PA 4WF2A 4OIQF 4CGZA 2JWTA 1WJEA 3TW6A 3REOA 1RUOA 3HRSA 1P4WA 2K4JA 2PMUA 2Q8KA 4BUPA 4HLXA 2JN6A 2FSWA 5FROA 2L9NA 4TV7A 2PFBA 1O57A 2R5YB 3BR3A 5HDNA 9ANTA 1X1PA 4ZYEA 3S3OA 1BC8C 4XOPA 1XMKA 2VKVA 1I6HJ 2JMWA 2GIVA 2Q2EA 1G2HA 1UHSA 2ELHA 2IVMA 4ETSA 5LFAA 1S7EA 2GZWA 3MZHA 4OMYA 2DCEA 4PJNA 1TWFJ 3VYTB 4GO1A 3L1PA 1MIJA 4XM3A 1YFHA 3HOYJ 2Z33A 2OZ6A 2K3FA 4UB8C 1VQOI 3S3MA 1JHHA 4P5OA 2LBFB 3TOAA 3EUAA 2VQHA 4UVCA 1HCRA 1QHHD 1ZHFA 3KP4A 4PJJA 3WHCA 2LNBA 2CQKA 3ASNH 2LTPA 1JGGA 3HGGA 1MBGA 3PJRA 2XVCA 1T33A 1LVKA 3ZCOA 2CO5A 4C2UA 4RAGA 3GYHX 1ITYA 1ZTRA 4A3MJ 3I59B 2A5YB 2WTEA 4RB2C 4BH9A 4M72A 3BQYA 3S8PA 4BL0B 2OAZA 4UUSA 2VKHA 4KIGA 1I1SA 4HSRA 1HQCA 2FF4A 3OYLA 2DODA 3CMAI 2G7HA 2E1MB 4Y33A 2NAZA 2VJJA 4I99C 3SQNA 1MJ9A 1RESA 4HX4A 4L5IA 4MGRA 4PDKA 1K61A 4IO9F 5LBQA 2OZUA 1PUEE 3CJNA 3E5QA 3A01A 3I64A 2ZXWH 3HB9A 4C2MJ 3K4LA 2KP6A 2M34A 4R79A 5K5RA 2K40A 5F04A 3Q0VA 5E3NA 3RSNA 4QTRA 2E1OA 2R7FA 2V4JC 2UUZA 3E6MA 2VC0A 1WZ2A 1B59A 3BOQA 3M8JA 5F0HA 3GTGJ 2M4GA 3R6SA 5CVJA 3HM5A 4K2EA 4RLFA 1KU7A 4JX5A 2DJNA 2L4MA 2M4KA 5AIPA 5CVIA 1ETQA 3QAHA 4XK4A 3RJPA 3M1CA 2D1VA 2BOLA 2VBYA 1LFBA 2A69F 2EIJH 1ORKA 1POGA 3P9KA 2E71A 3VB2A 4BYYA 1R1TA 3OYMA 2R7OA 3L2VA 3C7JA 1B8IB 2LREA 5L3BA 3LSRA 4DIQA 1SD6A 4Q4ZF 3ZQLA 3OS2A 1IJWC 1J7KA 3R60A 1U3EM 4HPQA 3KLOA 3JCUC 2VQLA 2O03A 1X19A
chains in the Genus database with same CATH topology
5DCFA 4HV5A 1D5VA 2VE9A 2XAFA 4KMFA 2KJBA 1UFMA 5LHHA 3HTUA 3F6VA 3ISPA 3D0SA 3FM5A 1WQ2A 3HRMA 3FXQA 2A61A 1B6AA 1JGSA 2DQLA 2VONA 3BJAA 3ZMTA 5BQTA 4B09A 2F5DA 3F8FA 3CUQA 3EYIA 3ZMDA 3CUQC 4KFCA 3ECHA 3GZ5A 2CW0F 4KNYA 4XBFA 3GX4X 4EJTA 3ZMUA 5HS7A 1Z9CA 4FT8A 2GAUA 3F3XA 3I0TA 4G9YA 1XDUA 2ZMEA 1BIAA 4P9FA 1YIOA 4L18B 3K1MA 5JR3A 1O7FA 3CDHA 1LVAA 1LEBA 3BPXA 4I0AA 2ZFWA 4D0PA 2MH2A 1HBXG 3BY6A 5LGUA 2XRNA 2P5LC 1IF1A 2OA4A 2EV6A 3FXRA 3COAC 3G3ZA 2V79A 2DBBA 1BIBA 2FMLA 2VT2A 2XKPA 2PJPA 3ZPLA 1MJAA 4XLPF 2K7LA 3ROUA 1EV7A 2PQ8A 5ED4A 2FQ3A 2IW5A 2R3SA 1YLFA 1KGSA 2VXZA 1FNNA 1GVJA 3M8FA 3QU6A 1ZGJA 3GFIA 2CSOA 1XSXA 2UZKA 5TJJA 2QZ8A 1IXRC 3WGHA 2E1CA 1SMTA 1IN4A 5CVUA 3IL2A 4ENKA 4CDGA 3HRUA 2W84A 3U2RA 2FMYA 4I02A 5J6XA 2VOPA 1V3FA 1W7PA 4LJZF 4EM2A 1R00A 1FBUA 5DD8A 5H20A 1EH6A 2H27A 2V6CA 2FBHA 5IT3A 4ENNA 3ZN0A 2HFHA 1LEAA 2EFPA 2M8EA 4IHTA 3QPHA 2F5FA 3RPUA 2V1DA 3HYIA 2RGVA 1YW8A 3V4GA 4N0BA 2YX4A 3WG9A 1QZYA 3IWZA 1BN5A 5BOXA 3KEOA 5ICEA 2CFXA 2L4AA 3LFKA 4QLCU 3R61A 2ESNA 3V7CA 5J8FA 1JHFA 3H3ZA 2H94A 2X0LA 1K78A 3WODF 5L3GA 3T8TA 3QRFF 3D5LA 3NEUA 1W5SA 1I5ZA 3L9FA 2OU2A 4Y15A 4DNCA 1DPUA 1S3JA 4A12A 2IA0A 4HYEA 3ZP5A 3RKWA 2KIFA 1XCBA 1J0RA 3VOEA 2PN6A 1YS6A 1WKMA 2D2WA 3DKWA 2DT5A 3F8BA 1KU3A 5TRDA 4BAYA 2O6GE 2Q0OA 1P6RA 5DYMA 2RDPA 5K1YA 3RIRA 1OKRA 1BBYA 2G9WA 1KQ9A 3ZMSA 3WU0A 1VTNC 3U1DA 1X3UA 3E6BA 3ZN1A 4Q48A 1WSUA 5D5VB 2VN2A 3MZYA 1S7OA 5E1ZB 1QPMA 5BMZA 3ELKA 1FYLA 5FB2A 1SMYF 1FP1D 2M30A 3WTXC 3LA2A 5E1WA 2PLYA 4U0VA 3RTRA 1ZG1A 4UNOA 3O6BB 5D4RA 1SD7A 1IRFA 3BJ6A 2UXNA 2QBYB 4Y13A 3HIFA 3GW2A 3TO9A 2PBIA 3HTSB 1HKTA 1UHMA 4U0YA 3H3UA 3TQNA 2ZXJA 5F6FA 5L3DA 1ZAOA 1FPQA 2CG4A 2Z99A 3DXJF 1ZG5A 3C18A 1B1BA 4YFXF 3WTSC 1Z91A 1SFEA 3TGNA 2NS0A 4S04A 1FZPB 1F4KA 2LDUA 1DDNA 3ML6A 4L9JA 4A5MA 3JSOA 5D5XB 3B73A 3F22A 1FSHA 4I2OA 1LDDA 4BQAA 3N97A 3R0JA 3SXYA 3VODA 3PFIA 3WTTC 2DO7A 2O3FA 2H09A 2XHKA 3KP7A 5E8GA 2FE3A 3LQQA 4EMSA 3I71A 2UWMA 3K1NA 4G94A 3BWGA 4CICA 2QLZA 4I7HA 5DUIA 1E17A 1HW5A 4A0YA 2IA2A 1DUXC 1LB2A 1D8JA 2CGPA 3IKVA 1CF7B 2ZBKA 2STWA 5CYVA 4UV8A 4RB0A 4MHGA 1YO5C 1IXCA 3HSRA 4KYWA 1V4RA 1J9IA 5ILUA 5HLIA 1WI9A 1P4XA 3JW4A 4Y17A 2Y75A 4RAYA 4EV0A 2WV0A 2D45A 3C1DA 3HRTA 2DU9A 4AVPA 1S7AA 1R5HA 3VEPA 3MCZA 2K27A 4P9UA 2DK5A 2P8TA 3H92A 1W7PB 2VT3A 2MLKA 4ESJA 2F2EA 1BJAA 1KQ8A 2EJRA 4MNUA 4NHJA 2A6HF 2KKOA 5KVRA 3ULQB 2STTA 1H9TA 3QP6A 4ZH4F 3W6KB 2C6YA 2JSCA 2RV8A 3P9IA 3WGGA 1YTYA 5DEQA 4H0EA 2RKHA 3SFZA 3IKTA 2Y48A 4HBLA 2XAHA 1UCRA 1TNTA 2XAJA 2V1UA 1QO0D 4ENMA 2VODA 4KICA 2L3DA 3E5UA 2JRTA 4WCGA 4ZZLA 2TDXA 1IZ1A 2WC2A 5HDGA 1QBJA 1KQ0A 2Z9OA 5ERIA 3AAFA 3HSEA 3V8LA 1TW3A 4KT5C 1LNWA 4G7OF 3F8NA 4MTDA 5L3FA 2K4BA 3IWFA 1HW2A 3GWZA 2GQQA 2OQGA 2IT0A 2F5CA 5E8IA 5F64A 2KIMA 4UXNA 2GXGA 2XIGA 1K78B 4FHTA 1Z05A 1EH8A 2PMHA 1USSA 2IJLA 4R1HA 1RIOH 5FGMA 2DI3A 5CVRA 1REPC 4EJVA 4XSXF 1FYMA 3KZZA 3OOPA 5DD4A 1R58A 2BYVE 5K5OA 5E1XA 1BI0A 4OIOF 3LQRA 1IN7A 1F9NA 2GA2A 1SD4A 1U6GA 4L9NA 2LF8A 5DUKA 2JTVA 5FLXZ 4ZYDA 1ZG3A 5D8KB 3QU3A 2ESHA 3I4PA 3HHGA 3IRRA 1PDNC 1OYWA 2M45A 5D5UB 4I09A 2ISZA 2VBXA 4CHUA 4YIFA 3J81K 4HA8A 4LG0B 3WE2A 2J5OA 4IRHA 3IHUA 2XKOA 4LK0F 5EEGA 3J80K 1SFXA 2JPBA 4GCVA 1R1UA 1HW1A 1I6XA 2W24A 3CTAA 1MJBA 1O3RA 4YIIA 1O3TA 4GXOA 5HVQC 3Q9VA 4Q5SF 1IAWA 4RS8A 1YS7A 1G3SA 2VOOA 5DDGA 2XROA 2ZJ2A 3HOTA 1GHCA 2PEXA 2YX7A 4MEXF 4KIBA 2EV5A 5D6FA 3EETA 2HS5A 2W57A 2DK8A 5LLQA 4GYGA 3GLXA 4HLYA 1WRJA 3V8KA 2MLGA 2ISYA 4FX0A 3L7WA 1U78A 2P5KA 1YYVA 2DQRA 4U7BA 3I59A 1JXSA 2EFOA 4L5JA 4LG0A 2L54A 4Q47A 1R1VA 5J8CA 4PZJA 4HOBA 3CO7C 2YSRA 4OMZA 3RDIA 3S2WA 1TQMA 2EFWA 3R0AA 3DV8A 4O5VA 1XD7A 1LQ1A 2HKXA 1TNSA 3F6OA 3JAMZ 5JI6A 1ULYA 2QWWA 3L09A 2ADUA 2LSOA 3MAJA 1HKSA 3BJOA 1Z6TA 1BI3A 3L2CA 5KK1A 4M6XA 3J81Z 2RNJA 2FA5A 2RN7A 4XRFA 4RAZA 1CF7A 2GXBA 2Z3YA 1IN5A 1IN6A 1IW7F 4IVNA 3HSFA 4G6DA 4YG2F 3F23A 3KEQA 1SD5A 1F1ZA 3HUGA 3FF5A 4XSZF 3F72A 2HZTA 1T2KA 1XSVA 4ASNA 1BI2A 2RVCA 3WU1B 2QVOA 1HKQA 4CO8A 2UXXA 1ZRDA 5CLSA 1MDMB 1XB4A 4WXHA 2QYOA 3B02A 3FMSA 4PCQA 1FBSA 1R22A 2BE5F 2Z5UA 4ESFA 1STZA 2HYGD 1O3QA 4HW0A 1ZREA 4N9HA 1W5TA 2OD5A 2GA1A 2HDCA 3DPLC 3LSTA 3Q5FA 3TOBA 3EQLF 2HTSA 1Z7UA 1P92A 1H9GA 3CUOA 1BC7C 2PG4A 2DFIA 2HWVA 1FBQA 2HGCA 4KDPA 1T38A 4OU0A 2QBYA 5ILSA 2JZYA 1R36A 1XDSA 3WTUC 1OR7A 1XGNA 1WWXA 4IJAA 5F1RA 2CWEA 4LB6B 2ZKZA 2AXLA 2QM3A 4N9IA 5ICGA 2EA4A 3V7RA 2OBPA 1FYKA 2BEOA 2VE8A 4BHPA 1J5YA 5LGNA 1S8NA 3RYRA 3QPTA 2R7DA 3R4KA 3MEXA 2X4HA 3K9TA 4HDVA 1TQPA 2WWYA 1FLIA 2PI0A 4RB3C 3FZVA 1RUNA 2P7VB 4LGWA 1KU9A 3GUDA 2NNYA 3W6JB 2QUFA 1HXDA 3WTYC 6PAXA 4WWCA 5FFZA 2AS5F 2F5EA 1J2XA 2P7CB 4L9VA 2NYXA 4HV6A 5E17F 3M8EA 2LF7A 3NQOA 3KP6A 1OPCA 2M87A 3N4MA 1GXQA 4M73A 1G3TA 4QWQA 1CGPA 4M6YA 4L0YB 5BS6A 3E97A 3FHZA 1RI7A 1C0WA 2DTRA 2FEZA 2EWNA 4AIKA 4MEYF 4RGRA 1A04A 4LB5A 1O3SA 4AIJA 1BOAA 1R5GA 3KP2A 5FO5A 3IC7A 3DP7A 1TTYA 1ZARA 1I27A 4DQ2A 4BXUA 1ONVA 4GGGA 5DV5A 1W7PD 1FY7A 1FX7A 3FM3A 2HQRA 1Z6RA 4G7HF 1L3LA 2EFNA 5JFRA 1PP7U 3F21A 4IPAA 2P5VA 4WX9A 2HKOA 3K1PA 5CVVA 3P9CA 4HF0A 1LDKB 2LKPA 3LAJA 4HDUA 2P4WA 1K79A 2IRFG 5E18F 4UVAA 5HOOA 3KE2A 4ON0A 1G6NA 2KIUA 1EH7A 2EB7A 1U2WA 3IRQA 4HF2A 2ZMEB 4FX4A 2P6SA 2JPCA 3K2ZA 3J80Z 5ICCA 4O6JA 5LHIA 3BZ6A 2ZO4A 2BGCA 5HS8A 5HS9A 4MQVA 1FOKA 4R8HA 5IT9Z 3JTGA 2L02A 2A3SA 3QP5A 4M9XA 3RI4A 2VC1A 2V9VA 3F8MA 4OINF 1MKMA 3I58A 3KP3A 1YW7A 2MD5A 4HQEA 4HZFA 1XGSA 5FD6A 1OMIA 5H6RA 4P96A 5EEHA 4IF4A 1U5TC 3I54A 4IHSA 1JE8A 1OYIA 3LA3A 3GFJA 4RGXA 3M1EA 1Y0UA 4JK1X 4WXCA 3WTVC 3O2PE 1G4DA 1DPRA 4EJWA 1HSTA 3PQJA 4LLNA 5ILVA 1H0MA 3KETA 2YPRA 4EVIA 4ZZDA 1T0FA 4IXAA 1KA8A 2RC4A 3M9AA 2XV4S 4UUVA 4I01A 3TO7A 2HTJA 1MDMA 2NNNA 4RB1A 2DAOA 2O0YA 5HLGA 1TLHB 4YFKF 3FMQA 1ZGAA 5JHUA 3GEZA 3E3VA 2M5WA 1UHWA 4YFNF 1XN7A 2K86A 4U7DA 1G3WA 2E7XA 4XLNF 5ICFA 4AIHA 3QOPA 2QQ9A 1L0OC 3KZYA 5CJ9A 3SZPA 1J59A 1P4AA 4LLGF 3ZMZA 2XAGA 2VBWA 5FLXK 3M7GA 1RZ4A 1U8RA 2A68F 2XAQA 1E2XA 1ZN2A 3BROA 4AD9A 3BDDA 1YW9A 5D5WB 1QQIA 3HHHA 4BNCA 4A6EA 2YR2A 3KLNA 4HX8A 2FRHA 3OV8A 5H6QA 3LAPA 5LHGA 5LEKA 4M9SA 4WK8F 5D6EA 4PGGA 3WE3A 1G3YA 1S6LA 2FBKA 4BHCA 4S05A 4EGYA 2MC3A 5BPIA 2H6CA 3E6CC 2EA2A 4ZYGA 4JBAA 3RKXA 4LD5A 1O7LA 5BPDA 2CYYA 4O3MA 4I98B 4Z2YA 1ZRFA 3NRVA 5AIQA 2H6BA 3JAMK 1ZRCA 1XGOA 4GYIA 3MWMA 3T0YA 4CXFA 3V7SA 1T39A 1YQAA 4KIFA 2KJCA 4EQQA 2ACJA 3ABTA 3Q9SA 3SZTA 1R23A 3FMRA 2MBFA 5DCMB 2O61A 2FBIA 1QNTA 3E5XA 3WTWC 4EJUA 3EUHA 3DF8A 1ZLKA 2QQBA 3G73A 1AOYA 2W85A 1ODDA 4CZZA 3DFGA 5K5QA 1IRGA 4G7ZF 3GXOA 1HSJA 1FT9A 3FWEA 1NHAA 4PGHA 3E6DA 1MZBA 1IN8A 1MD0A 3WTZA 4U88A 2FOKA 4CYDA 5IT9K 1FP2A 4G8XA 2DPUA 4I0BA 1IXSB 3GO5A 2JT1A 1B9MA 2Y0MA 4KUMA 5AONA 2FNAA 2HEOA 2BV6A 4HQMA 1ZLJA 4RGSA 1ZYRF 2HYFA 5LEJA 1MGTA 3I53A 1K7AA 3T8RA 3ZMVA 3TO6A 5LRSA 3U9GA 3TDUC 3RYPA 4L0ZB 1XGMA 1D3YA 1D8KA 1IUYA 4UHTA 1KYZA 1TBXA 1FSEA 4EGZA 1YG2A 2ETHA 3MQ0A 1GXPA 3K69A 2ZCWA 3BPVA 2EFQA 1Z1DA 4NB5A 5L3EA 4IRGA 4EM0B 3BP8A 4AWXB 2W25A 3EDPA 5E20A 3DPTA 4HX7A 1TQIA 4A6DA 1I1GA 2IP2A 1XCVA 1XMAA 3DEUA 2KRFA 3LA7A 3DQVC 4EJOA 3LWFA 4U0WA 2GWRA 3HOSA 4P55A 3GFMA 5FD5A 3JSPA 5FFXA 1B9NA 4OIRF 5JVTA 4A2UA 3VFZA 3JTHA 4ZYHA 4UVBA 2EV0A 2YU3A 1ZH5A 5A2QK 4KN4X 3O3KA 4M74A 5LGTA 2ZNYA 3CUQB 2MA3A 1B4AA 4F7ZA 1BM9A 4OIPF 3K0LA 4NQWA 3GFLA 2D1HA 2XUBA 1USTA 1QZZA 2FU4A 3T1BA 4KA4A 3ECOA 4IRIA 3V8JA 1UB9A 1K6OA 1BI1A 2L01A 4UV9A 1LJ9A 4BHBA 5HLHA 2HR3A 2M1BA 2QQAA 2COMA 3KFWX 1Q1HA 5HDKA 2G7UA 1U5TB 3I5UA 4L9TA 4OOIA 2FXAA 2XASA 3CLOA 3F8CA 1QGPA 4ESBA 4LFUA 2HOEA 4JQFA 2MH9A 4E70A 2O8XA 4LLLA 1PP8F 1TW2A 4LK1F 3KCCA 4HAMA 1R7JA 3GVAA 2DLLA 3TDZC 5DCMA 2IPQX 4M9ZA 1J75A 3TKYA 3GF2A 3P7NA 4A0XA 2NRAC 3C3WA 5D4SA 2QENA 2BBYA 2P6TA 4B8XA 3GZ6A 1KU2A 4KN7X 3MFKA 4MTEA 5LRRA 3EYYA 4HF1A 1S29A 1T98A 4WXDA 1SFUA 3L00A 1P2FA 1FC3A 4A5NA 2E1NA 2DPDA 1FWZA 3ABUA 3SHFA 1AWCA 2K02A 1F5TA 4A0ZA 2IA1A 3RPQA 3ZQ7A 4KMUX 2ZNZA 2RQPA 2A6EF 4M71A 1W4MA 5L3CA 1DP7P 3PQKA 3KP5A 2DW4A 2FNPA 4LMYA 2VBZA 4MQ9F 4RGUA 4EM1A 3WGIA 1U5TA 2EK5A 1ON1A 4ENJA 1RNLA 2OQRA 3ERED 3J7AO 2HQNA 1OYYA 1KYWA 5D8LB 1XSDA 2A07F 5A2QZ 1SAXA 1T6SA 2XGXA 2B0LA 3FXUA 3CO6C 1LDJA 3RKYA 2E7WA 3T5XA 4G6QA 3FX3A 1ON2A 2V1XA 2J5PA 4WF2A 4OIQF 4CGZA 3REOA 1RUOA 3HRSA 1P4WA 2K4JA 2PMUA 2Q8KA 4HLXA 2FSWA 4TV7A 2PFBA 1O57A 5HDNA 4ZYEA 1BC8C 1XMKA 2GIVA 2Q2EA 2ELHA 2IVMA 4ETSA 3MZHA 2GZWA 4OMYA 4GO1A 1YFHA 2Z33A 2OZ6A 1JHHA 4P5OA 3TOAA 4UVCA 1ZHFA 3KP4A 2LNBA 2CQKA 2XVCA 2CO5A 3GYHX 3I59B 2A5YB 2WTEA 4RB2C 4BH9A 4M72A 2OAZA 4KIGA 1I1SA 1HQCA 2FF4A 2G7HA 2NAZA 3SQNA 1MJ9A 4HX4A 4L5IA 4MGRA 4PDKA 5LBQA 2OZUA 1PUEE 3CJNA 3E5QA 3I64A 4R79A 5K5RA 2R7FA 3E6MA 2VC0A 1B59A 3BOQA 3R6SA 5CVJA 4K2EA 1KU7A 2L4MA 5AIPA 5CVIA 3QAHA 3RJPA 2D1VA 2VBYA 2A69F 4BYYA 3P9KA 3VB2A 1R1TA 3C7JA 5L3BA 1SD6A 4Q4ZF 1J7KA 3R60A 1U3EM 3KLOA 2O03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DCF A;  4HV5 A;  1D5V A;  2VE9 A;  2XAF A;  4KMF A;  2KJB A;  1UFM A;  5LHH A;  3HTU A;  3F6V A;  3ISP A;  3D0S A;  3FM5 A;  1WQ2 A;  3HRM A;  3FXQ A;  2A61 A;  1B6A A;  1JGS A;  2DQL A;  2VON A;  3BJA A;  3ZMT A;  5BQT A;  4B09 A;  2F5D A;  3F8F A;  3CUQ A;  3EYI A;  3ZMD A;  3CUQ C;  4KFC A;  3ECH A;  3GZ5 A;  2CW0 F;  4KNY A;  4XBF A;  3GX4 X;  4EJT A;  3ZMU A;  5HS7 A;  1Z9C A;  4FT8 A;  2GAU A;  3F3X A;  3I0T A;  4G9Y A;  1XDU A;  2ZME A;  1BIA A;  4P9F A;  1YIO A;  4L18 B;  3K1M A;  5JR3 A;  1O7F A;  3CDH A;  1LVA A;  1LEB A;  3BPX A;  4I0A A;  2ZFW A;  4D0P A;  2MH2 A;  1HBX G;  3BY6 A;  5LGU A;  2XRN A;  2P5L C;  1IF1 A;  2OA4 A;  2EV6 A;  3FXR A;  3COA C;  3G3Z A;  2V79 A;  2DBB A;  1BIB A;  2FML A;  2VT2 A;  2XKP A;  2PJP A;  3ZPL A;  1MJA A;  4XLP F;  2K7L A;  3ROU A;  1EV7 A;  2PQ8 A;  5ED4 A;  2FQ3 A;  2IW5 A;  2R3S A;  1YLF A;  1KGS A;  2VXZ A;  1FNN A;  1GVJ A;  3M8F A;  3QU6 A;  1ZGJ A;  3GFI A;  2CSO A;  1XSX A;  2UZK A;  5TJJ A;  2QZ8 A;  1IXR C;  3WGH A;  2E1C A;  1SMT A;  1IN4 A;  5CVU A;  3IL2 A;  4ENK A;  4CDG A;  3HRU A;  2W84 A;  3U2R A;  2FMY A;  4I02 A;  5J6X A;  2VOP A;  1V3F A;  1W7P A;  4LJZ F;  4EM2 A;  1R00 A;  1FBU A;  5DD8 A;  5H20 A;  1EH6 A;  2H27 A;  2V6C A;  2FBH A;  5IT3 A;  4ENN A;  3ZN0 A;  2HFH A;  1LEA A;  2EFP A;  2M8E A;  4IHT A;  3QPH A;  2F5F A;  3RPU A;  2V1D A;  3HYI A;  2RGV A;  1YW8 A;  3V4G A;  4N0B A;  2YX4 A;  3WG9 A;  1QZY A;  3IWZ A;  1BN5 A;  5BOX A;  3KEO A;  5ICE A;  2CFX A;  2L4A A;  3LFK A;  4QLC U;  3R61 A;  2ESN A;  3V7C A;  5J8F A;  1JHF A;  3H3Z A;  2H94 A;  2X0L A;  1K78 A;  3WOD F;  5L3G A;  3T8T A;  3QRF F;  3D5L A;  3NEU A;  1W5S A;  1I5Z A;  3L9F A;  2OU2 A;  4Y15 A;  4DNC A;  1DPU A;  1S3J A;  4A12 A;  2IA0 A;  4HYE A;  3ZP5 A;  3RKW A;  2KIF A;  1XCB A;  1J0R A;  3VOE A;  2PN6 A;  1YS6 A;  1WKM A;  2D2W A;  3DKW A;  2DT5 A;  3F8B A;  1KU3 A;  5TRD A;  4BAY A;  2O6G E;  2Q0O A;  1P6R A;  5DYM A;  2RDP A;  5K1Y A;  3RIR A;  1OKR A;  1BBY A;  2G9W A;  1KQ9 A;  3ZMS A;  3WU0 A;  1VTN C;  3U1D A;  1X3U A;  3E6B A;  3ZN1 A;  4Q48 A;  1WSU A;  5D5V B;  2VN2 A;  3MZY A;  1S7O A;  5E1Z B;  1QPM A;  5BMZ A;  3ELK A;  1FYL A;  5FB2 A;  1SMY F;  1FP1 D;  2M30 A;  3WTX C;  3LA2 A;  5E1W A;  2PLY A;  4U0V A;  3RTR A;  1ZG1 A;  4UNO A;  3O6B B;  5D4R A;  1SD7 A;  1IRF A;  3BJ6 A;  2UXN A;  2QBY B;  4Y13 A;  3HIF A;  3GW2 A;  3TO9 A;  2PBI A;  3HTS B;  1HKT A;  1UHM A;  4U0Y A;  3H3U A;  3TQN A;  2ZXJ A;  5F6F A;  5L3D A;  1ZAO A;  1FPQ A;  2CG4 A;  2Z99 A;  3DXJ F;  1ZG5 A;  3C18 A;  1B1B A;  4YFX F;  3WTS C;  1Z91 A;  1SFE A;  3TGN A;  2NS0 A;  4S04 A;  1FZP B;  1F4K A;  2LDU A;  1DDN A;  3ML6 A;  4L9J A;  4A5M A;  3JSO A;  5D5X B;  3B73 A;  3F22 A;  1FSH A;  4I2O A;  1LDD A;  4BQA A;  3N97 A;  3R0J A;  3SXY A;  3VOD A;  3PFI A;  3WTT C;  2DO7 A;  2O3F A;  2H09 A;  2XHK A;  3KP7 A;  5E8G A;  2FE3 A;  3LQQ A;  4EMS A;  3I71 A;  2UWM A;  3K1N A;  4G94 A;  3BWG A;  4CIC A;  2QLZ A;  4I7H A;  5DUI A;  1E17 A;  1HW5 A;  4A0Y A;  2IA2 A;  1DUX C;  1LB2 A;  1D8J A;  2CGP A;  3IKV A;  1CF7 B;  2ZBK A;  2STW A;  5CYV A;  4UV8 A;  4RB0 A;  4MHG A;  1YO5 C;  1IXC A;  3HSR A;  4KYW A;  1V4R A;  1J9I A;  5ILU A;  5HLI A;  1WI9 A;  1P4X A;  3JW4 A;  4Y17 A;  2Y75 A;  4RAY A;  4EV0 A;  2WV0 A;  2D45 A;  3C1D A;  3HRT A;  2DU9 A;  4AVP A;  1S7A A;  1R5H A;  3VEP A;  3MCZ A;  2K27 A;  4P9U A;  2DK5 A;  2P8T A;  3H92 A;  1W7P B;  2VT3 A;  2MLK A;  4ESJ A;  2F2E A;  1BJA A;  1KQ8 A;  2EJR A;  4MNU A;  4NHJ A;  2A6H F;  2KKO A;  5KVR A;  3ULQ B;  2STT A;  1H9T A;  3QP6 A;  4ZH4 F;  3W6K B;  2C6Y A;  2JSC A;  2RV8 A;  3P9I A;  3WGG A;  1YTY A;  5DEQ A;  4H0E A;  2RKH A;  3SFZ A;  3IKT A;  2Y48 A;  4HBL A;  2XAH A;  1UCR A;  1TNT A;  2XAJ A;  2V1U A;  1QO0 D;  4ENM A;  2VOD A;  4KIC A;  2L3D A;  3E5U A;  2JRT A;  4WCG A;  4ZZL A;  2TDX A;  1IZ1 A;  2WC2 A;  5HDG A;  1QBJ A;  1KQ0 A;  2Z9O A;  5ERI A;  3AAF A;  3HSE A;  3V8L A;  1TW3 A;  4KT5 C;  1LNW A;  4G7O F;  3F8N A;  4MTD A;  5L3F A;  2K4B A;  3IWF A;  1HW2 A;  3GWZ A;  2GQQ A;  2OQG A;  2IT0 A;  2F5C A;  5E8I A;  5F64 A;  2KIM A;  4UXN A;  2GXG A;  2XIG A;  1K78 B;  4FHT A;  1Z05 A;  1EH8 A;  2PMH A;  1USS A;  2IJL A;  4R1H A;  1RIO H;  5FGM A;  2DI3 A;  5CVR A;  1REP C;  4EJV A;  4XSX F;  1FYM A;  3KZZ A;  3OOP A;  5DD4 A;  1R58 A;  2BYV E;  5K5O A;  5E1X A;  1BI0 A;  4OIO F;  3LQR A;  1IN7 A;  1F9N A;  2GA2 A;  1SD4 A;  1U6G A;  4L9N A;  2LF8 A;  5DUK A;  2JTV A;  5FLX Z;  4ZYD A;  1ZG3 A;  5D8K B;  3QU3 A;  2ESH A;  3I4P A;  3HHG A;  3IRR A;  1PDN C;  1OYW A;  2M45 A;  5D5U B;  4I09 A;  2ISZ A;  2VBX A;  4CHU A;  4YIF A;  3J81 K;  4HA8 A;  4LG0 B;  3WE2 A;  2J5O A;  4IRH A;  3IHU A;  2XKO A;  4LK0 F;  5EEG A;  3J80 K;  1SFX A;  2JPB A;  4GCV A;  1R1U A;  1HW1 A;  1I6X A;  2W24 A;  3CTA A;  1MJB A;  1O3R A;  4YII A;  1O3T A;  4GXO A;  5HVQ C;  3Q9V A;  4Q5S F;  1IAW A;  4RS8 A;  1YS7 A;  1G3S A;  2VOO A;  5DDG A;  2XRO A;  2ZJ2 A;  3HOT A;  1GHC A;  2PEX A;  2YX7 A;  4MEX F;  4KIB A;  2EV5 A;  5D6F A;  3EET A;  2HS5 A;  2W57 A;  2DK8 A;  5LLQ A;  4GYG A;  3GLX A;  4HLY A;  1WRJ A;  3V8K A;  2MLG A;  2ISY A;  4FX0 A;  3L7W A;  1U78 A;  2P5K A;  1YYV A;  2DQR A;  4U7B A;  3I59 A;  1JXS A;  2EFO A;  4L5J A;  4LG0 A;  2L54 A;  4Q47 A;  1R1V A;  5J8C A;  4PZJ A;  4HOB A;  3CO7 C;  2YSR A;  4OMZ A;  3RDI A;  3S2W A;  1TQM A;  2EFW A;  3R0A A;  3DV8 A;  4O5V A;  1XD7 A;  1LQ1 A;  2HKX A;  1TNS A;  3F6O A;  3JAM Z;  5JI6 A;  1ULY A;  2QWW A;  3L09 A;  2ADU A;  2LSO A;  3MAJ A;  1HKS A;  3BJO A;  1Z6T A;  1BI3 A;  3L2C A;  5KK1 A;  4M6X A;  3J81 Z;  2RNJ A;  2FA5 A;  2RN7 A;  4XRF A;  4RAZ A;  1CF7 A;  2GXB A;  2Z3Y A;  1IN5 A;  1IN6 A;  1IW7 F;  4IVN A;  3HSF A;  4G6D A;  4YG2 F;  3F23 A;  3KEQ A;  1SD5 A;  1F1Z A;  3HUG A;  3FF5 A;  4XSZ F;  3F72 A;  2HZT A;  1T2K A;  1XSV A;  4ASN A;  1BI2 A;  2RVC A;  3WU1 B;  2QVO A;  1HKQ A;  4CO8 A;  2UXX A;  1ZRD A;  5CLS A;  1MDM B;  1XB4 A;  4WXH A;  2QYO A;  3B02 A;  3FMS A;  4PCQ A;  1FBS A;  1R22 A;  2BE5 F;  2Z5U A;  4ESF A;  1STZ A;  2HYG D;  1O3Q A;  4HW0 A;  1ZRE A;  4N9H A;  1W5T A;  2OD5 A;  2GA1 A;  2HDC A;  3DPL C;  3LST A;  3Q5F A;  3TOB A;  3EQL F;  2HTS A;  1Z7U A;  1P92 A;  1H9G A;  3CUO A;  1BC7 C;  2PG4 A;  2DFI A;  2HWV A;  1FBQ A;  2HGC A;  4KDP A;  1T38 A;  4OU0 A;  2QBY A;  5ILS A;  2JZY A;  1R36 A;  1XDS A;  3WTU C;  1OR7 A;  1XGN A;  1WWX A;  4IJA A;  5F1R A;  2CWE A;  4LB6 B;  2ZKZ A;  2AXL A;  2QM3 A;  4N9I A;  5ICG A;  2EA4 A;  3V7R A;  2OBP A;  1FYK A;  2BEO A;  2VE8 A;  4BHP A;  1J5Y A;  5LGN A;  1S8N A;  3RYR A;  3QPT A;  2R7D A;  3R4K A;  3MEX A;  2X4H A;  3K9T A;  4HDV A;  1TQP A;  2WWY A;  1FLI A;  2PI0 A;  4RB3 C;  3FZV A;  1RUN A;  2P7V B;  4LGW A;  1KU9 A;  3GUD A;  2NNY A;  3W6J B;  2QUF A;  1HXD A;  3WTY C;  6PAX A;  4WWC A;  5FFZ A;  2AS5 F;  2F5E A;  1J2X A;  2P7C B;  4L9V A;  2NYX A;  4HV6 A;  5E17 F;  3M8E A;  2LF7 A;  3NQO A;  3KP6 A;  1OPC A;  2M87 A;  3N4M A;  1GXQ A;  4M73 A;  1G3T A;  4QWQ A;  1CGP A;  4M6Y A;  4L0Y B;  5BS6 A;  3E97 A;  3FHZ A;  1RI7 A;  1C0W A;  2DTR A;  2FEZ A;  2EWN A;  4AIK A;  4MEY F;  4RGR A;  1A04 A;  4LB5 A;  1O3S A;  4AIJ A;  1BOA A;  1R5G A;  3KP2 A;  5FO5 A;  3IC7 A;  3DP7 A;  1TTY A;  1ZAR A;  1I27 A;  4DQ2 A;  4BXU A;  1ONV A;  4GGG A;  5DV5 A;  1W7P D;  1FY7 A;  1FX7 A;  3FM3 A;  2HQR A;  1Z6R A;  4G7H F;  1L3L A;  2EFN A;  5JFR A;  1PP7 U;  3F21 A;  4IPA A;  2P5V A;  4WX9 A;  2HKO A;  3K1P A;  5CVV A;  3P9C A;  4HF0 A;  1LDK B;  2LKP A;  3LAJ A;  4HDU A;  2P4W A;  1K79 A;  2IRF G;  5E18 F;  4UVA A;  5HOO A;  3KE2 A;  4ON0 A;  1G6N A;  2KIU A;  1EH7 A;  2EB7 A;  1U2W A;  3IRQ A;  4HF2 A;  2ZME B;  4FX4 A;  2P6S A;  2JPC A;  3K2Z A;  3J80 Z;  5ICC A;  4O6J A;  5LHI A;  3BZ6 A;  2ZO4 A;  2BGC A;  5HS8 A;  5HS9 A;  4MQV A;  1FOK A;  4R8H A;  5IT9 Z;  3JTG A;  2L02 A;  2A3S A;  3QP5 A;  4M9X A;  3RI4 A;  2VC1 A;  2V9V A;  3F8M A;  4OIN F;  1MKM A;  3I58 A;  3KP3 A;  1YW7 A;  2MD5 A;  4HQE A;  4HZF A;  1XGS A;  5FD6 A;  1OMI A;  5H6R A;  4P96 A;  5EEH A;  4IF4 A;  1U5T C;  3I54 A;  4IHS A;  1JE8 A;  1OYI A;  3LA3 A;  3GFJ A;  4RGX A;  3M1E A;  1Y0U A;  4JK1 X;  4WXC A;  3WTV C;  3O2P E;  1G4D A;  1DPR A;  4EJW A;  1HST A;  3PQJ A;  4LLN A;  5ILV A;  1H0M A;  3KET A;  2YPR A;  4EVI A;  4ZZD A;  1T0F A;  4IXA A;  1KA8 A;  2RC4 A;  3M9A A;  2XV4 S;  4UUV A;  4I01 A;  3TO7 A;  2HTJ A;  1MDM A;  2NNN A;  4RB1 A;  2DAO A;  2O0Y A;  5HLG A;  1TLH B;  4YFK F;  3FMQ A;  1ZGA A;  5JHU A;  3GEZ A;  3E3V A;  2M5W A;  1UHW A;  4YFN F;  1XN7 A;  2K86 A;  4U7D A;  1G3W A;  2E7X A;  4XLN F;  5ICF A;  4AIH A;  3QOP A;  2QQ9 A;  1L0O C;  3KZY A;  5CJ9 A;  3SZP A;  1J59 A;  1P4A A;  4LLG F;  3ZMZ A;  2XAG A;  2VBW A;  5FLX K;  3M7G A;  1RZ4 A;  1U8R A;  2A68 F;  2XAQ A;  1E2X A;  1ZN2 A;  3BRO A;  4AD9 A;  3BDD A;  1YW9 A;  5D5W B;  1QQI A;  3HHH A;  4BNC A;  4A6E A;  2YR2 A;  3KLN A;  4HX8 A;  2FRH A;  3OV8 A;  5H6Q A;  3LAP A;  5LHG A;  5LEK A;  4M9S A;  4WK8 F;  5D6E A;  4PGG A;  3WE3 A;  1G3Y A;  1S6L A;  2FBK A;  4BHC A;  4S05 A;  4EGY A;  2MC3 A;  5BPI A;  2H6C A;  3E6C C;  2EA2 A;  4ZYG A;  4JBA A;  3RKX A;  4LD5 A;  1O7L A;  5BPD A;  2CYY A;  4O3M A;  4I98 B;  4Z2Y A;  1ZRF A;  3NRV A;  5AIQ A;  2H6B A;  3JAM K;  1ZRC A;  1XGO A;  4GYI A;  3MWM A;  3T0Y A;  4CXF A;  3V7S A;  1T39 A;  1YQA A;  4KIF A;  2KJC A;  4EQQ A;  2ACJ A;  3ABT A;  3Q9S A;  3SZT A;  1R23 A;  3FMR A;  2MBF A;  5DCM B;  2O61 A;  2FBI A;  1QNT A;  3E5X A;  3WTW C;  4EJU A;  3EUH A;  3DF8 A;  1ZLK A;  2QQB A;  3G73 A;  1AOY A;  2W85 A;  1ODD A;  4CZZ A;  3DFG A;  5K5Q A;  1IRG A;  4G7Z F;  3GXO A;  1HSJ A;  1FT9 A;  3FWE A;  1NHA A;  4PGH A;  3E6D A;  1MZB A;  1IN8 A;  1MD0 A;  3WTZ A;  4U88 A;  2FOK A;  4CYD A;  5IT9 K;  1FP2 A;  4G8X A;  2DPU A;  4I0B A;  1IXS B;  3GO5 A;  2JT1 A;  1B9M A;  2Y0M A;  4KUM A;  5AON A;  2FNA A;  2HEO A;  2BV6 A;  4HQM A;  1ZLJ A;  4RGS A;  1ZYR F;  2HYF A;  5LEJ A;  1MGT A;  3I53 A;  1K7A A;  3T8R A;  3ZMV A;  3TO6 A;  5LRS A;  3U9G A;  3TDU C;  3RYP A;  4L0Z B;  1XGM A;  1D3Y A;  1D8K A;  1IUY A;  4UHT A;  1KYZ A;  1TBX A;  1FSE A;  4EGZ A;  1YG2 A;  2ETH A;  3MQ0 A;  1GXP A;  3K69 A;  2ZCW A;  3BPV A;  2EFQ A;  1Z1D A;  4NB5 A;  5L3E A;  4IRG A;  4EM0 B;  3BP8 A;  4AWX B;  2W25 A;  3EDP A;  5E20 A;  3DPT A;  4HX7 A;  1TQI A;  4A6D A;  1I1G A;  2IP2 A;  1XCV A;  1XMA A;  3DEU A;  2KRF A;  3LA7 A;  3DQV C;  4EJO A;  3LWF A;  4U0W A;  2GWR A;  3HOS A;  4P55 A;  3GFM A;  5FD5 A;  3JSP A;  5FFX A;  1B9N A;  4OIR F;  5JVT A;  4A2U A;  3VFZ A;  3JTH A;  4ZYH A;  4UVB A;  2EV0 A;  2YU3 A;  1ZH5 A;  5A2Q K;  4KN4 X;  3O3K A;  4M74 A;  5LGT A;  2ZNY A;  3CUQ B;  2MA3 A;  1B4A A;  4F7Z A;  1BM9 A;  4OIP F;  3K0L A;  4NQW A;  3GFL A;  2D1H A;  2XUB A;  1UST A;  1QZZ A;  2FU4 A;  3T1B A;  4KA4 A;  3ECO A;  4IRI A;  3V8J A;  1UB9 A;  1K6O A;  1BI1 A;  2L01 A;  4UV9 A;  1LJ9 A;  4BHB A;  5HLH A;  2HR3 A;  2M1B A;  2QQA A;  2COM A;  3KFW X;  1Q1H A;  5HDK A;  2G7U A;  1U5T B;  3I5U A;  4L9T A;  4OOI A;  2FXA A;  2XAS A;  3CLO A;  3F8C A;  1QGP A;  4ESB A;  4LFU A;  2HOE A;  4JQF A;  2MH9 A;  4E70 A;  2O8X A;  4LLL A;  1PP8 F;  1TW2 A;  4LK1 F;  3KCC A;  4HAM A;  1R7J A;  3GVA A;  2DLL A;  3TDZ C;  5DCM A;  2IPQ X;  4M9Z A;  1J75 A;  3TKY A;  3GF2 A;  3P7N A;  4A0X A;  2NRA C;  3C3W A;  5D4S A;  2QEN A;  2BBY A;  2P6T A;  4B8X A;  3GZ6 A;  1KU2 A;  4KN7 X;  3MFK A;  4MTE A;  5LRR A;  3EYY A;  4HF1 A;  1S29 A;  1T98 A;  4WXD A;  1SFU A;  3L00 A;  1P2F A;  1FC3 A;  4A5N A;  2E1N A;  2DPD A;  1FWZ A;  3ABU A;  3SHF A;  1AWC A;  2K02 A;  1F5T A;  4A0Z A;  2IA1 A;  3RPQ A;  3ZQ7 A;  4KMU X;  2ZNZ A;  2RQP A;  2A6E F;  4M71 A;  1W4M A;  5L3C A;  1DP7 P;  3PQK A;  3KP5 A;  2DW4 A;  2FNP A;  4LMY A;  2VBZ A;  4MQ9 F;  4RGU A;  4EM1 A;  3WGI A;  1U5T A;  2EK5 A;  1ON1 A;  4ENJ A;  1RNL A;  2OQR A;  3ERE D;  3J7A O;  2HQN A;  1OYY A;  1KYW A;  5D8L B;  1XSD A;  2A07 F;  5A2Q Z;  1SAX A;  1T6S A;  2XGX A;  2B0L A;  3FXU A;  3CO6 C;  1LDJ A;  3RKY A;  2E7W A;  3T5X A;  4G6Q A;  3FX3 A;  1ON2 A;  2V1X A;  2J5P A;  4WF2 A;  4OIQ F;  4CGZ A;  3REO A;  1RUO A;  3HRS A;  1P4W A;  2K4J A;  2PMU A;  2Q8K A;  4HLX A;  2FSW A;  4TV7 A;  2PFB A;  1O57 A;  5HDN A;  4ZYE A;  1BC8 C;  1XMK A;  2GIV A;  2Q2E A;  2ELH A;  2IVM A;  4ETS A;  3MZH A;  2GZW A;  4OMY A;  4GO1 A;  1YFH A;  2Z33 A;  2OZ6 A;  1JHH A;  4P5O A;  3TOA A;  4UVC A;  1ZHF A;  3KP4 A;  2LNB A;  2CQK A;  2XVC A;  2CO5 A;  3GYH X;  3I59 B;  2A5Y B;  2WTE A;  4RB2 C;  4BH9 A;  4M72 A;  2OAZ A;  4KIG A;  1I1S A;  1HQC A;  2FF4 A;  2G7H A;  2NAZ A;  3SQN A;  1MJ9 A;  4HX4 A;  4L5I A;  4MGR A;  4PDK A;  5LBQ A;  2OZU A;  1PUE E;  3CJN A;  3E5Q A;  3I64 A;  4R79 A;  5K5R A;  2R7F A;  3E6M A;  2VC0 A;  1B59 A;  3BOQ A;  3R6S A;  5CVJ A;  4K2E A;  1KU7 A;  2L4M A;  5AIP A;  5CVI A;  3QAH A;  3RJP A;  2D1V A;  2VBY A;  2A69 F;  4BYY A;  3P9K A;  3VB2 A;  1R1T A;  3C7J A;  5L3B A;  1SD6 A;  4Q4Z F;  1J7K A;  3R60 A;  1U3E M;  3KLO A;  2O03 A; 
#chains in the Genus database with same CATH topology
 5DCF A;  3G1L A;  4HV5 A;  3TBI A;  1Y39 A;  1D5V A;  2VE9 A;  2XAF A;  5C4X J;  4KMF A;  4IQ4 A;  1FMW A;  2KJB A;  1UFM A;  1X3Z B;  5LHH A;  1BA5 A;  2L5Q A;  3HTU A;  1FIA A;  1JKP C;  3F6V A;  3ISP A;  1HC8 A;  3D5R C;  2BY1 A;  2K9N A;  3D0S A;  2MG4 A;  1D1B A;  3K70 D;  2ZME C;  3FM5 A;  2IS2 A;  1WQ2 A;  3HRM A;  3FXQ A;  2A61 A;  1X1B A;  1FEX A;  1B6A A;  2PJR B;  1JGS A;  2DQL A;  1Y6I A;  4LG3 A;  2VON A;  3BJA A;  1E3P A;  1HDP A;  4NUB A;  2M8G X;  3ZMT A;  2AQE A;  5BQT A;  4B09 A;  5LD2 C;  2F5D A;  3ASO H;  2EIM H;  3NWT A;  4HST A;  3F8F A;  3HOZ J;  3VWB A;  1IDZ A;  2DDA A;  3CUQ A;  1K6Y A;  3EYI A;  3ZMD A;  3CUQ C;  4KFC A;  5DM6 F;  3ECH A;  3GZ5 A;  4F3Q A;  3BC8 A;  2CW0 F;  2E60 A;  3MKY B;  4KNY A;  2XB0 X;  4XBF A;  3GX4 X;  2V9K A;  2EIK H;  4EJT A;  3ZMU A;  2ZJP F;  5HS7 A;  1YJ9 I;  1Z9C A;  4FT8 A;  2GAU A;  3F3X A;  3I0T A;  1E3H A;  3ZQH A;  2X6Y A;  4G9Y A;  1XDU A;  2ZME A;  5IP6 A;  1BIA A;  4P9F A;  5JLX A;  1YIO A;  4C3J J;  4L18 B;  2WAQ A;  3K1M A;  5JR3 A;  1O7F A;  3CDH A;  3FXL A;  1LVA A;  2V9P A;  3CZ6 A;  1LEB A;  4FIS A;  4XRS A;  3BPX A;  5FKM A;  4I0A A;  2ZFW A;  4D0P A;  2MH2 A;  1HBX G;  4BKX A;  3BY6 A;  5LGU A;  3OY9 A;  2XRN A;  2P5L C;  1IF1 A;  2PMZ A;  2OA4 A;  1TZL A;  2EV6 A;  3L2Q A;  4V2G A;  3CMY A;  3FXR A;  3ZXS A;  3COA C;  3G3Z A;  1Y1V J;  2CQ7 A;  1K83 J;  2V79 A;  2W82 A;  3MVP A;  2DBB A;  1BIB A;  2TRT A;  2M3A A;  4PFO A;  2FML A;  2E2H J;  1RRJ A;  2VT2 A;  2LC2 A;  2XKP A;  1H89 C;  3ZPL A;  2PJP A;  1WCM J;  1JUM A;  1MJA A;  2RNG A;  3LSG A;  5KAF C;  4XLP F;  3RKQ A;  2K7L A;  2KZV A;  1EV7 A;  2PQ8 A;  3ROU A;  1A6I A;  5ED4 A;  3OYD A;  2CS3 A;  2CRG A;  5EYR A;  2FQ3 A;  2IW5 A;  2R3S A;  4W97 A;  5JLW A;  1AHD P;  1YLF A;  2DFF A;  1KGS A;  5TGT A;  2VXZ A;  1FNN A;  1GVJ A;  3M8F A;  3QU6 A;  1ZGJ A;  5DS9 A;  3GFI A;  2DXI A;  2CSO A;  1XSX A;  2UZK A;  5TJJ A;  2KIQ A;  4M3G A;  1VQ9 I;  1U8B A;  4B43 A;  3CCR I;  2CMP A;  2QZ8 A;  2QF7 A;  1IXR C;  3WGH A;  3CCU I;  2E1C A;  1SMT A;  1IN4 A;  3OYE A;  5CVU A;  3IL2 A;  4ENK A;  2H8R A;  4CDG A;  2L7F P;  3HRU A;  2W84 A;  2R7R A;  3CCY A;  3U2R A;  2FMY A;  3OWT A;  3PSF A;  3SZG A;  2R0Q C;  1DP3 A;  1OCZ H;  4I02 A;  5J6X A;  2VOP A;  1V3F A;  1W7P A;  4LJZ F;  1YRN B;  4EM2 A;  1WJC A;  4MFD A;  5GPA A;  1SVL A;  1R00 A;  2XGE A;  1FBU A;  1WJB A;  5DD8 A;  1I50 J;  2DJI A;  5H20 A;  1ETO A;  1EH6 A;  3VPR A;  5FKK A;  4E7Z A;  2H27 A;  1PUF B;  4C3I J;  3AL0 C;  2V6C A;  2FBH A;  5J1R A;  5IT3 A;  2VLA A;  4ENN A;  2G0E A;  1IRX A;  3ZN0 A;  2GOX B;  2HFH A;  4BQQ A;  1LEA A;  2EFP A;  1XMX A;  1HA8 A;  2M0M A;  2M8E A;  3W3C A;  4IHT A;  1IV6 A;  2DFE A;  1HOM A;  2WAQ N;  1A36 A;  3I55 I;  4IHX A;  3QPH A;  2BW3 B;  2EQR A;  4IL6 C;  2F5F A;  2E2I J;  3RPU A;  2V1D A;  1N75 A;  5B5E C;  3HYI A;  2RGV A;  1YW8 A;  3V4G A;  4XLF A;  1G8X A;  4N0B A;  2YX4 A;  3WG9 A;  1QZY A;  1TWC J;  3IWZ A;  1BN5 A;  5BOX A;  1BW5 A;  3HBL A;  3KEO A;  4B1R A;  5ICE A;  3M07 A;  2CFX A;  3ZRG A;  2HPM A;  2L4A A;  2Y2Z A;  3LFK A;  4QLC U;  3R61 A;  2ESN A;  5EEA A;  3V7C A;  3ZGK A;  5J8F A;  2HVR A;  1S72 I;  1JHF A;  2DA2 A;  3H3Z A;  2E36 A;  2H94 A;  2X0L A;  3HXL A;  4D9J A;  1K78 A;  3WOD F;  5L3G A;  3T8T A;  3QRF F;  3D5L A;  3NEU A;  2AHQ A;  4N4N B;  2KZG A;  1QVU A;  4XL9 A;  1W5S A;  1I5Z A;  2DMU A;  3L9F A;  2DT6 A;  5CKT A;  4B3A A;  4J19 A;  2OU2 A;  2NVT J;  1MBE A;  5GTH C;  4Y15 A;  4DNC A;  1DPU A;  2UV1 A;  1S3J A;  4A12 A;  2DA6 A;  2IA0 A;  4B48 A;  3LOC A;  4HYE A;  1LFP A;  3G1O A;  1BR2 A;  3ZP5 A;  2CV1 A;  3RKW A;  2KIF A;  3TW7 A;  1XCB A;  1J0R A;  2E2J J;  3OYJ A;  3VOE A;  3QYF A;  2PN6 A;  3CD6 I;  1YS6 A;  1WJA A;  1WKM A;  4HNT A;  1W36 D;  2D2W A;  3DKW A;  4E6K G;  2DT5 A;  3F8B A;  3WU2 C;  3DLL F;  1KU3 A;  3LMM A;  5TRD A;  4BAY A;  2O6G E;  3CJQ B;  2Q0O A;  1P6R A;  2XF6 A;  5DYM A;  3S1Q J;  2RDP A;  5K1Y A;  4NC7 A;  2V26 A;  5J1U A;  3MKZ A;  2K9M A;  3RIR A;  3BCA A;  1OKR A;  1MH4 A;  1BBY A;  2G9W A;  2QGU A;  1KQ9 A;  1K4T A;  2FQ4 A;  3ZMS A;  2H8W A;  3WU0 A;  4XRS G;  1OQY A;  2JQ7 A;  5IYC J;  1Z21 A;  1YJW I;  1VTN C;  3U1D A;  1W1W E;  1X3U A;  3E6B A;  3ZN1 A;  4Q48 A;  2W4S A;  1WSU A;  2EZK A;  3OYC A;  2QCO A;  3BCB A;  5D5V B;  4A3L J;  2M0C A;  2Z1D A;  4A3J J;  2VN2 A;  3PO3 J;  1E0E A;  4XLH A;  4IKF A;  3MZY A;  1S7O A;  2LP0 A;  5E1Z B;  1QPM A;  3ONQ A;  3K4C A;  3ELK A;  2ZB9 A;  2AXT C;  5BMZ A;  5FLV A;  1Z3Y A;  5IOZ A;  3CDI A;  3HOV J;  4PJ0 C;  1FYL A;  1MBF A;  5FB2 A;  1SMY F;  1TC3 C;  1FP1 D;  3CDL A;  1Y8R B;  5H2F C;  2M30 A;  3A03 A;  4CCM A;  3DLA A;  3WTX C;  3LA2 A;  1OR7 C;  3TED A;  2CW7 A;  1SVM A;  5E1W A;  2PLY A;  2JA7 J;  4U0V A;  3RTR A;  2E5Z A;  2HPI A;  4XN3 A;  3FKI J;  1ZG1 A;  4UNO A;  3O6B B;  1SD7 A;  1IRF A;  3BJ6 A;  2UXN A;  5D4R A;  2QBY B;  4Y13 A;  2ZXH A;  4V2F A;  5GPC A;  3HIF A;  4CCK A;  3GW2 A;  3TO9 A;  2DA3 A;  1IV8 A;  2PBI A;  3CES A;  5HNH A;  1QZE A;  5FRN A;  3HTS B;  1HKT A;  1UHM A;  3DEW A;  5HNF A;  4U0Y A;  3FBN B;  3H3U A;  1OFC X;  3TQN A;  4BQO A;  3CLQ A;  2ZXJ A;  3BG6 A;  5F6F A;  2NOJ B;  3ZR8 X;  2Z16 A;  4CCJ A;  5L3D A;  1ZAO A;  1FPQ A;  2CG4 A;  2Z99 A;  2BY2 A;  3DXJ F;  3KIO A;  4XKB A;  2OCC H;  2B63 J;  2GM4 A;  3DU6 A;  1ZG5 A;  5EZG A;  3C18 A;  1B1B A;  3Q3S A;  3BLY A;  4YFX F;  3WTS C;  3M4O J;  1Z91 A;  5DM7 F;  1QA6 A;  1SFE A;  3TGN A;  4BJ5 C;  3DKX A;  2M9H A;  3MD2 A;  3NWS A;  3PNT A;  4A69 C;  2LY9 A;  2NS0 A;  4ZDL A;  4S04 A;  5C3E J;  1FZP B;  4IOA F;  2JVG A;  1F4K A;  2LDU A;  1DDN A;  4ZC3 A;  3ML6 A;  1X58 A;  3K6G A;  4L9J A;  1U9O A;  2L9S A;  2NS8 A;  4RMN A;  4A5M A;  3JSO A;  2V7F A;  5D5X B;  3A0H C;  3ZQI A;  1APL C;  2CJJ A;  3B73 A;  5CPR B;  3F22 A;  1XX5 A;  1JJ8 C;  1MNM C;  1FSH A;  4I2O A;  1LDD A;  4LIV A;  2V1N A;  4LOC A;  4BQA A;  1IGN A;  2VQC A;  5F27 A;  3N97 A;  4E7H A;  3R0J A;  3SXY A;  3VOD A;  1ETW A;  2WY8 Q;  3K4N A;  3PFI A;  4J01 A;  1X4O A;  3WTT C;  2DO7 A;  2HVS A;  2O3F A;  2BVM A;  1VQ5 I;  3M3Y J;  2DOE A;  2H09 A;  2XHK A;  3KP7 A;  5E8G A;  2FE3 A;  3LQQ A;  5KAI C;  1ETX A;  4BE0 A;  4EMS A;  3I71 A;  2KRC A;  2JA6 J;  1XC5 A;  2Y0S N;  3K7A J;  4NNJ A;  3CCQ I;  1VQ8 I;  2UWM A;  3K1N A;  3CC4 I;  4G94 A;  3BWG A;  1FMV A;  2Y0S A;  4CIC A;  2R5Z A;  3H5N A;  3FIS A;  2ICW G;  2QLZ A;  4CCN A;  4CH7 A;  4I7H A;  5DUI A;  2DA4 A;  1P9Q C;  4XRM A;  4P1W A;  3CCS I;  1E17 A;  1HW5 A;  3GME A;  4A0Y A;  2IA2 A;  4OAY A;  4YRV A;  1DUX C;  1LB2 A;  4BJ6 C;  2OV7 A;  2HNH A;  2MAB A;  1X3W B;  4IHY A;  1U9N A;  2YU9 J;  1D8J A;  4N4O B;  2BXZ A;  3DTI A;  2CGP A;  3IKV A;  1FTZ A;  5F0C A;  1CF7 B;  2ZBK A;  2STW A;  1I3Q J;  1V5F A;  3OIO A;  5CYV A;  4BDZ A;  3P5J A;  4UV8 A;  4RB0 A;  4MHG A;  3FBI B;  3H5R A;  1YO5 C;  2Y30 A;  1IXC A;  3HSR A;  3MZ8 A;  4KYW A;  1V4R A;  1J9I A;  2KL4 A;  5ILU A;  4I76 A;  4G6T B;  5HLI A;  1WI9 A;  3Q0U A;  1P4X A;  1MMA A;  2DYR H;  3HG9 A;  3JW4 A;  4Y17 A;  5GAE J;  2Y75 A;  1ZGW A;  4RAY A;  4EV0 A;  1TP4 A;  3KPH A;  5GAD J;  4KJZ A;  1LFU P;  2WV0 A;  2D45 A;  3C1D A;  3CCM I;  1LPQ A;  2XSD C;  1P7I A;  3IH2 A;  2DTZ A;  3HRT A;  3DBH B;  2XDV A;  2DU9 A;  4AVP A;  2ELJ A;  1S7A A;  2JA8 J;  1RC9 A;  2R5Z B;  2KDO A;  2NVQ J;  1R5H A;  3VEP A;  3MCZ A;  3GZN B;  2K27 A;  4P9U A;  2DK5 A;  4KIS A;  2P8T A;  4AYB N;  3BR2 A;  3H92 A;  1W7P B;  1RKW A;  2MLK A;  2VT3 A;  4FAS D;  4CSW A;  1T0F C;  3OSG A;  4ESJ A;  1M1E B;  3MN2 A;  5J47 A;  2F2E A;  2ZFU A;  3JRI A;  1BJA A;  1Y0N A;  1V5E A;  1TL8 A;  4UB6 C;  2IS4 A;  1KQ8 A;  2EJR A;  4MNU A;  4NHJ A;  2A6H F;  5GP9 A;  2X6O A;  2KKO A;  1W0T A;  5KVR A;  3ULQ B;  1JUS A;  4PUS A;  2STT A;  1H9T A;  3QP6 A;  4ZH4 F;  1GLN A;  1X1C A;  2KMU A;  3W6K B;  3JRH A;  1H8A C;  3SYT A;  4BDY A;  2K9S A;  2C6Y A;  2JSC A;  2RV8 A;  3BR1 A;  3P9I A;  1AKH B;  2DMT A;  2WV1 A;  3WGG A;  3H0G J;  3LFU A;  4XIC A;  1YTY A;  5DEQ A;  4H0E A;  2RKH A;  2OC6 A;  3SFZ A;  2KPM A;  3IKT A;  3K70 C;  4C3H J;  2VJI A;  2Y48 A;  4HBL A;  2XAH A;  1EKE A;  1D0Z A;  4UUT A;  1UCR A;  1TNT A;  2XAJ A;  3CP2 A;  2V1U A;  1QO0 D;  4ENM A;  2VOD A;  4D5C A;  4KIC A;  2L3D A;  4RDU A;  4IHW A;  2L9R A;  2XGD A;  3E5U A;  1JT0 A;  4DJA A;  1U0J A;  2JRT A;  4CCL A;  4ZZL A;  4WCG A;  3MKL A;  2TDX A;  1IZ1 A;  2WC2 A;  5HDG A;  3E1S A;  1QBJ A;  2R7Z J;  1KQ0 A;  4BE2 A;  4XMY A;  1OCC H;  2Z9O A;  5ERI A;  3AAF A;  3HSE A;  2QQ8 A;  2CH0 A;  3V8L A;  4A3I J;  1TW3 A;  4KT5 C;  2LVS A;  4NC6 A;  1LNW A;  4G7O F;  3F8N A;  4MTD A;  5L3F A;  2K4B A;  2M2E A;  3IWF A;  4AID A;  1JKQ C;  1HW2 A;  1SFK A;  2CQN A;  3A4C A;  2HDW A;  3GWZ A;  4B44 A;  2JA5 J;  1V54 H;  3FK6 A;  3IUO A;  2ECC A;  2GQQ A;  4G12 A;  2OQG A;  2X85 A;  1LKX A;  3SEQ A;  2IT0 A;  2F5C A;  1ETK A;  2IEK A;  4RA2 A;  2IBD A;  5E8I A;  1JUP A;  5F64 A;  3I4N J;  1DU6 A;  2KIM A;  4UXN A;  1QVT A;  1T56 A;  2GXG A;  2XIG A;  1K78 B;  2CFO A;  4FHT A;  1Z05 A;  2VI6 A;  2VKE A;  2ELK A;  4JOM A;  2GOM A;  1EH8 A;  3A1Y A;  2PMH A;  1USS A;  2IJL A;  1BW6 A;  3ABL H;  4R1H A;  1RIO H;  4B3X A;  4M3E A;  5FGM A;  5E3M A;  4D1Q A;  2DI3 A;  3PNV A;  2I8D A;  5CVR A;  1YI2 I;  2WBM A;  3AKZ A;  1REP C;  4EJV A;  3BG7 A;  4XSX F;  1IG7 A;  1FYM A;  2ME6 A;  1NH3 A;  3KZZ A;  4A3K J;  2XF5 A;  1RKT A;  3L2W A;  3OOP A;  1RET A;  5DD4 A;  1R58 A;  2O7O A;  2BYV E;  5K5O A;  5B66 C;  5E1X A;  2V6E A;  3JRG A;  1BI0 A;  4HEA 2;  4OIO F;  3LQR A;  1IN7 A;  1SC7 A;  1F9N A;  4XQF A;  2GA2 A;  5EGO A;  1SD4 A;  1U6G A;  1HLV A;  3AG3 H;  4L9N A;  1TT5 B;  2LF8 A;  1SEU A;  2HQA A;  3HUG B;  5DUK A;  2JTV A;  5J3L A;  3W2A A;  5FLX Z;  4ZYD A;  1ZG3 A;  3HDD A;  3I56 I;  1OLT A;  5D8K B;  1WHU A;  3K4M A;  4DYC A;  1JKO C;  3H9Q A;  3QU3 A;  1G59 A;  2ESH A;  3I4P A;  2W00 A;  3HHG A;  3IRR A;  1PDN C;  1OYW A;  1UMQ A;  2A6T A;  2M45 A;  5D5U B;  2XPU A;  4I09 A;  2ISZ A;  2VBX A;  5KHD A;  3OMY A;  4PJM A;  4CHU A;  2FJ1 A;  2LYC A;  4OAZ A;  2KHM A;  4XKV A;  1FOW A;  4M6V A;  3H0D A;  4YIF A;  5JVG F;  3J81 K;  4HA8 A;  4DGW B;  3BG3 A;  3OOU A;  4NC8 A;  4ZDP A;  3PIO F;  1X1A A;  3MMY B;  4LG0 B;  3WE2 A;  2J5O A;  1TWH J;  2M7B A;  4IRH A;  3IHU A;  2XKO A;  2Z2S B;  3IP4 B;  4LK0 F;  5EEG A;  4AUX A;  3J80 K;  4LIU A;  1SFX A;  2JPB A;  3FK7 A;  4GCV A;  3G4S I;  1R1U A;  1HW1 A;  1I6X A;  2W24 A;  3CTA A;  2CV0 A;  1MJB A;  1N25 A;  1O3R A;  2COB A;  4YII A;  1WJ5 A;  4XLA A;  4CYC B;  1O3T A;  4GXO A;  3CF5 F;  3LSK A;  5GAH J;  4A3G J;  1Z77 A;  4QSH A;  5HVQ C;  3JRE A;  3W2W A;  3Q9V A;  4M3F A;  1IAW A;  4Q5S F;  4RS8 A;  3QOE A;  4H4K C;  3V42 A;  3HOU J;  4AU7 A;  1YS7 A;  3W6V A;  3S16 J;  1G3S A;  2VOO A;  5DDG A;  2XRO A;  3BQZ A;  4JX6 A;  3DBL B;  5GAG J;  2ZJ2 A;  4JP0 A;  3HOT A;  2MGQ A;  1GHC A;  1WH5 A;  3HPG A;  1E3O C;  2PEX A;  2YX7 A;  3BTL A;  3RZO J;  4MEX F;  5JHF A;  4KIB A;  3FXO A;  2EV5 A;  2PMZ N;  5D6F A;  3EET A;  2HS5 A;  2KDZ A;  4HNU A;  5IYB J;  2R92 J;  1OCP A;  2CQX A;  2DK8 A;  2W57 A;  3FKJ A;  4HNV A;  5LLQ A;  5FRM A;  4GYG A;  3GLX A;  4HLY A;  1WRJ A;  3V8K A;  3G6E I;  4BE1 A;  2MLG A;  2ISY A;  4E4H A;  4FX0 A;  3L7W A;  1U78 A;  2P5K A;  3IH3 A;  1YYV A;  2DQR A;  1AA7 A;  2A5W A;  2LG4 A;  1VI0 A;  3I59 A;  4U7B A;  3WG7 H;  1VND A;  1JXS A;  2NVU B;  3PIP F;  2EFO A;  4ZTJ A;  4L5J A;  4LG0 A;  2L54 A;  4Q47 A;  3FIW A;  4Z6Y A;  3HGY A;  1R1V A;  5J8C A;  4PZJ A;  4HOB A;  3S17 J;  3CO7 C;  2YSR A;  4OMZ A;  1X4P A;  3RDI A;  5E79 C;  3S2W A;  5F0F A;  1TQM A;  2EFW A;  3R0A A;  3DV8 A;  4O5V A;  1XD7 A;  2VQG A;  1LQ1 A;  3I3L A;  2HKX A;  1TNS A;  3F6O A;  2F4I A;  1UG0 A;  5TIS C;  3JAM Z;  3ZQG A;  5JI6 A;  1ULY A;  2QWW A;  3L09 A;  2GLO A;  2R7W A;  2ADU A;  2QKM B;  3AG4 H;  3LSI A;  2LSO A;  3MAJ A;  1HKS A;  2ZJQ F;  3BJO A;  1Z6T A;  3LSP A;  1BI3 A;  2LLK A;  4NQW B;  3FHN A;  3OYB A;  2VL8 A;  5KK1 A;  3L2C A;  1Q1V A;  1B8I A;  4CA0 A;  2EIL H;  4M6X A;  2F6C A;  4BEH B;  3CC7 I;  5B1A H;  3J81 Z;  4QPQ A;  3N05 A;  2O8K A;  2RNJ A;  4RM3 A;  3BTI A;  3RQI A;  4JX4 A;  5IYD J;  2FA5 A;  2HOA A;  4RBO A;  3FXJ A;  2RN7 A;  4JYK A;  4XRF A;  4RAZ A;  1CF7 A;  3GTJ J;  1IDY A;  5M3F J;  4DYR A;  2GXB A;  3GTP J;  1X2N A;  2Z3Y A;  4XLE A;  1IN5 A;  1IN6 A;  1IW7 F;  2Q1Z B;  2H1K A;  4IVN A;  3HSF A;  1SVO A;  3OL4 A;  2OUM A;  4E7J A;  4G6D A;  5EF6 A;  3OSF A;  1VQ4 I;  1TWA J;  4YG2 F;  3F23 A;  3KEQ A;  2XSJ C;  1SD5 A;  1F1Z A;  1D1C A;  3HUG A;  3FF5 A;  4XSZ F;  5M5W J;  3F72 A;  3CJT B;  4GRI A;  2HZT A;  1T2K A;  2NVX J;  1XSV A;  4ASN A;  1BI2 A;  2MYS A;  2DOF A;  2RVC A;  4XOT A;  3CME I;  3WU1 B;  2QVO A;  1HKQ A;  4CO8 A;  2UXX A;  1ZRD A;  5CLS A;  1MDM B;  2CW8 A;  3HL2 A;  4BJT A;  1XB4 A;  2KIS A;  5K7Z A;  1TWG J;  2JSP A;  2DMN A;  3OR2 C;  4ABZ A;  4WXH A;  4X0G A;  2QYO A;  2EPF A;  4PFP A;  3B02 A;  3S2H J;  3FMS A;  1SAN A;  3OYN A;  4E7S A;  4PCQ A;  1FBS A;  3DPU A;  1R22 A;  2BE5 F;  3GLL A;  2Z5U A;  4ESF A;  1STZ A;  2MFZ A;  2HYG D;  1O3Q A;  4HW0 A;  1SFO J;  1ZRE A;  1X1D A;  4N9H A;  1W5T A;  2OD5 A;  1T08 B;  2GA1 A;  5B3S H;  2EH3 A;  2HDC A;  3OYF A;  3DPL C;  3LST A;  2WAE A;  3Q5F A;  3TOB A;  2F4O B;  3EQL F;  1Z3X A;  4DBR A;  3GTK J;  2HTS A;  1Z7U A;  2E34 A;  2Y9Y A;  1P92 A;  3ESW B;  1H9G A;  3CUO A;  1BC7 C;  2PG4 A;  2DFI A;  2HWV A;  1FBQ A;  2HGC A;  2XAU A;  3AFH A;  3HZJ A;  2AQF A;  4CYC A;  1T38 A;  4AC0 A;  4KDP A;  1FTT A;  4PSX A;  4OU0 A;  2EIN H;  5ILS A;  2QBY A;  2JZY A;  1R36 A;  1XDS A;  2JRM A;  1MND A;  3HOX J;  3WTU C;  1OR7 A;  1XGN A;  4E7K A;  2JA2 A;  4MFE A;  2FD5 A;  1WWX A;  4XOR A;  1BJZ A;  4IJA A;  4XLC A;  5F1R A;  5FJ8 J;  2CWE A;  4LB6 B;  2ZKZ A;  2DOA A;  1Z67 A;  3S1N J;  2AXL A;  2QM3 A;  4N9I A;  5ICG A;  1JTY A;  3BR0 A;  2EA4 A;  3V7R A;  2JUC A;  2OBP A;  2MW8 A;  3DBR B;  1FYK A;  3OYG A;  2BEO A;  2VE8 A;  4BHP A;  1J5Y A;  5LGN A;  1UJ8 A;  3WHB A;  1S8N A;  3RYR A;  2IGK A;  2L0K A;  1MMN A;  3EUH C;  3QPT A;  2IGN A;  2R7D A;  4IEJ A;  2ZSI B;  3R4K A;  1PVE A;  2JJ7 A;  3MEX A;  2X4H A;  3K9T A;  3NAU A;  2ZC2 A;  4B4C A;  5EDN A;  4HDV A;  4YIR X;  1GV5 A;  1TQP A;  4FET A;  4EAT A;  2E1M C;  2WWY A;  1Z7L A;  1FLI A;  3KZI C;  1R71 A;  3F9K A;  2BY3 A;  2PI0 A;  2LH9 A;  4HRI A;  2R93 J;  4RB3 C;  3FZV A;  1RUN A;  2P7V B;  4LGW A;  1KU9 A;  3GUD A;  1CQT A;  1A35 A;  2NNY A;  1BL0 A;  2ECB A;  2X6W A;  4QIW N;  1YX5 A;  3C2H A;  3W6J B;  3ZQQ A;  2QUF A;  1HXD A;  3H5A A;  2ID6 A;  4F93 B;  3WTY C;  4MO7 A;  2ME0 A;  3QYB A;  6PAX A;  4L5E A;  4WWC A;  5FFZ A;  3S1R J;  2AS5 F;  2HOS A;  2VIX A;  2F5E A;  2QA4 I;  1J2X A;  3Q0W A;  2P7C B;  1PJR A;  4L9V A;  2NYX A;  1A31 A;  2VPL A;  3RZD J;  4HV6 A;  3U21 A;  5E17 F;  3M8E A;  1K4S A;  2DN0 A;  4BEH A;  2LF7 A;  3NQO A;  4FE4 A;  1DU0 A;  4A3C J;  3KP6 A;  3KEY A;  1OPC A;  4D7M A;  2M87 A;  3N4M A;  2VKD A;  4MIM A;  5B1B H;  1GXQ A;  4M73 A;  2AO9 A;  3LSH A;  2R7X A;  1G3T A;  3UR3 C;  4QWQ A;  1CGP A;  5FKO A;  3UKG A;  2I10 A;  4M6Y A;  1UZC A;  2HOT A;  4L0Y B;  5BS6 A;  3E97 A;  3FHZ A;  1D5Y A;  1RI7 A;  1C0W A;  4AVZ A;  1YRN A;  3OYH A;  3LNQ A;  2DTR A;  3B6A A;  3FXK A;  2FEZ A;  2E19 A;  2EWN A;  4AIK A;  4MEY F;  4RGR A;  1A04 A;  2K9L A;  3JRD A;  1RR8 C;  5E3O A;  4LB5 A;  2HQ5 A;  1O3S A;  2IGM A;  4AIJ A;  2W7N A;  4M3D A;  1ZR4 A;  3IAS 2;  1BOA A;  2ZXI A;  3QOD A;  1R5G A;  3KP2 A;  2H1L A;  1VQK I;  1LUJ B;  1N77 A;  5FO5 A;  5EG0 A;  3IC7 A;  3DP7 A;  1TTY A;  1UG2 A;  3KYD B;  1ZAR A;  1A6Q A;  1I27 A;  4AYB A;  4CZC A;  4DQ2 A;  4IOC F;  2FX0 A;  4DOZ A;  4BXU A;  3OYI A;  1ONV A;  4GGG A;  5DV5 A;  2WA0 A;  1W7P D;  1FY7 A;  1GT0 C;  1FX7 A;  2GBY A;  4Y52 J;  3FM3 A;  2MD0 A;  2HQR A;  4F52 A;  3A01 B;  3U1K A;  1Z6R A;  4G7H F;  1L3L A;  1OCO H;  4CCO A;  1VQL I;  2EFN A;  3ERM A;  5JFR A;  3SDB A;  1PP7 U;  3F21 A;  2LKS A;  3BTJ A;  4IPA A;  2WB1 N;  2P5V A;  3H3V K;  4WX9 A;  2KLO A;  2HKO A;  3K1P A;  4II3 A;  1LE8 A;  3IAM 2;  2I5U A;  5CVV A;  3P9C A;  4HF0 A;  2OCE A;  1LDK B;  5M5Y J;  2LKP A;  3LAJ A;  5HLT A;  4HDU A;  3TP0 A;  2P4W A;  1XS9 A;  1K79 A;  2IRF G;  5E18 F;  4UVA A;  5HOO A;  3KE2 A;  3BTC A;  4ON0 A;  1G6N A;  3RPU D;  2KIU A;  1EH7 A;  1GDT A;  2EB7 A;  3VSK A;  1U2W A;  3LSM A;  3IRQ A;  4HF2 A;  2ZME B;  4FX4 A;  2P6S A;  2JPC A;  2OPT A;  3K2Z A;  4BGD A;  3J80 Z;  5ICC A;  1ZK8 A;  2VJ5 A;  4O6J A;  2X1C A;  1VFC A;  4FCY A;  5LHI A;  3C2B A;  1T8I A;  3BZ6 A;  3EPZ A;  2ZO4 A;  2BGC A;  2RRE A;  2XC7 A;  1S5L C;  4D7N A;  4BY1 J;  3OYK A;  5HS8 A;  3G71 I;  5HS9 A;  2BY0 A;  2QSH X;  3QYE A;  1ZEL A;  4MQV A;  1FOK A;  4R8H A;  5IT9 Z;  2BVL A;  3JTG A;  2L02 A;  4BY7 J;  2A3S A;  4GFB A;  3QP5 A;  4M9X A;  3RI4 A;  1VQM I;  2X51 A;  1YE9 A;  2VC1 A;  2LBF A;  2V9V A;  3F8M A;  4OIN F;  3OYA A;  2GIZ A;  1MKM A;  3I58 A;  3CQZ J;  3E0J B;  4W1U A;  1R4M B;  1IUF A;  2VXD A;  2X1E A;  3HEF A;  3KP3 A;  4XKW A;  1YW7 A;  3QPS A;  4IQJ A;  2MD5 A;  4HQE A;  4DW6 A;  4HZF A;  1XGS A;  4UUS B;  5E3L A;  5FD6 A;  4HG2 A;  1OMI A;  1LE8 B;  4ZDO A;  4NDL A;  4XON A;  1VZ0 A;  5H6R A;  2DYS H;  4P96 A;  3OR1 C;  4BS9 A;  3H35 A;  2XPV A;  1R6R A;  3LSJ A;  3RCO A;  5EEH A;  4IF4 A;  1U5T C;  2ZSH B;  2OTJ I;  3I54 A;  5IP9 J;  4IHS A;  3BG5 A;  2NXN B;  1OYI A;  1JE8 A;  3LA3 A;  4Y7N J;  3GFJ A;  4RGX A;  1T95 A;  3M1E A;  1Y0U A;  4JK1 X;  2X48 A;  2VB6 A;  5J1Y A;  4WXC A;  4IHV A;  3CCL I;  2B9S A;  3WTV C;  3O2P E;  1G4D A;  1DPR A;  1X2M A;  2QSG X;  2LY2 A;  4RLQ A;  5C4J J;  1OCT C;  4EJW A;  1HST A;  3PQJ A;  2HVQ A;  2PX9 A;  4LLN A;  2LOO A;  5ILV A;  1H0M A;  3KET A;  2YPR A;  4RM2 A;  3CJR B;  5C44 J;  4RAF A;  3K4B A;  3AG1 H;  4EVI A;  4KIT B;  4ZZD A;  4X6A J;  1T0F A;  1P7J A;  2BZT A;  4DYQ A;  3KX2 A;  4V19 K;  2XPW A;  2WAD A;  4IXA A;  1XG1 A;  2NS7 A;  3CP8 A;  3GTL J;  1KA8 A;  3LL7 A;  1F43 A;  1RPW A;  2RC4 A;  4NBQ A;  3M9A A;  2LMD A;  1VQ6 I;  4B47 A;  1YIT I;  2XV4 S;  4UUV A;  4I01 A;  3TO7 A;  2HTJ A;  1MDM A;  2NNN A;  4RB1 A;  2CQQ A;  2DAO A;  2MSY A;  2O0Y A;  1JJ6 C;  5HLG A;  2DFH A;  3S14 J;  1TLH B;  4YFK F;  3FMQ A;  1V5G A;  3A0B C;  1ZGA A;  2VPR A;  5JHU A;  3GEZ A;  5IP7 J;  2L9V A;  2R7S A;  1XTA A;  2KFD A;  3OIQ A;  3E3V A;  2R7U A;  2M5W A;  4LIT A;  1UHW A;  4YFN F;  1XN7 A;  2K86 A;  4U7D A;  1G3W A;  2E7X A;  4XLN F;  5K7H A;  4II2 A;  5ICF A;  4AIH A;  3D1N I;  1R9T J;  1GVD A;  3QOP A;  2QQ9 A;  5GTI C;  1L0O C;  1EJ9 A;  2P81 A;  3KZY A;  3TP3 A;  5CJ9 A;  2WAF A;  3SZP A;  4A3F J;  5CQE A;  1JTX A;  1J59 A;  1P4A A;  2LY1 A;  1DGR M;  4LLG F;  3ZMZ A;  2XAG A;  2VBW A;  1OJL A;  1IRZ A;  5FLX K;  3M7G A;  2CUE A;  5J4Y A;  1IO2 A;  5IPA A;  1RZ4 A;  3PSI A;  3FXM A;  1U8R A;  2A68 F;  2XAQ A;  2LFB A;  4S0H B;  1E2X A;  3K4J A;  1ZN2 A;  3BRO A;  4AD9 A;  1B72 B;  3BDD A;  1YW9 A;  2KT0 A;  5D5W B;  1QQI A;  5K7F A;  3OL3 A;  1ETV A;  3HHH A;  2W1O A;  4BNC A;  4A6E A;  2YR2 A;  3KLN A;  3PUF A;  1DGW Y;  4HX8 A;  2FRH A;  3OV8 A;  5H6Q A;  3LAP A;  3BR6 A;  1W36 C;  3HJE A;  5LHG A;  5LEK A;  4M9S A;  4WK8 F;  1NTC A;  2LD5 A;  5D6E A;  4PGG A;  3WE3 A;  1G3Y A;  1S6L A;  3BZK A;  2FBK A;  2VAS A;  1AU7 A;  3VYS B;  4BHC A;  1VQ7 I;  4S05 A;  4EGY A;  4YEL A;  2MC3 A;  2K9Q A;  1H88 C;  5BPI A;  2H6C A;  3PUB A;  3E6C C;  2EA2 A;  4ZYG A;  3CCV I;  1D0Y A;  4BBR J;  3MKW B;  4JBA A;  3RKX A;  4LD5 A;  1O7L A;  1W5C C;  5BPD A;  2CYY A;  2IS6 A;  4O3M A;  1MBJ A;  2CUZ A;  4I98 B;  4Z2Y A;  1ZRF A;  2PJR A;  4PK4 A;  2HZD A;  1WJF A;  2WY7 Q;  2JVH A;  4DBQ A;  3NRV A;  3GTQ J;  5AIQ A;  2H6B A;  3JAM K;  5IOY A;  1ZRC A;  1R49 A;  1QRY A;  2O5R A;  1XGO A;  3CC2 I;  3OS0 A;  4GYI A;  3MWM A;  3T0Y A;  3VSL A;  1UEL B;  4CXF A;  3V7S A;  2DA7 A;  1T39 A;  1YQA A;  1WJD A;  4KIF A;  2KJC A;  3HKZ A;  4EQQ A;  2HI3 A;  2ACJ A;  3ABT A;  3Q9S A;  3SZT A;  1R23 A;  3FMR A;  3H36 A;  4IZZ A;  2MBF A;  3S1M J;  4IX7 A;  5DCM B;  1NK2 P;  1BR1 A;  1OCR H;  1WVR A;  2HYJ A;  4D5F A;  3J7A Y;  4ZJZ A;  2O61 A;  4I6Z A;  2FBI A;  3PL8 A;  1QNT A;  3E5X A;  3WTW C;  4EJU A;  4BXX J;  3EUH A;  3DF8 A;  1ZLK A;  2KRH A;  2QQB A;  3G73 A;  1KZH A;  1AOY A;  2W85 A;  3DWL E;  4F91 B;  2CV2 A;  5KCM A;  3ZOB A;  1ODD A;  2EBI A;  3DFG A;  4CZZ A;  1VF9 A;  5K5Q A;  1IRG A;  3S32 A;  4G7Z F;  5EZH A;  3O8G A;  2F5V A;  1QU3 A;  3GXO A;  3QPL A;  4FE7 A;  1HSJ A;  1FT9 A;  3FWE A;  3UNG C;  1NHA A;  4PGH A;  1VQP I;  3E6D A;  1FIP A;  1MZB A;  2BXY A;  1IN8 A;  3DKY A;  1MD0 A;  1Y56 A;  1Y1W J;  4AM3 A;  1MH3 A;  2VUM J;  1MMG A;  1YX3 A;  3WTZ A;  4FTH A;  3OIP A;  4U88 A;  2DA1 A;  3KYL A;  1D0X A;  4U87 A;  2FOK A;  3DEE A;  3SDG A;  4CYD A;  5IT9 K;  1YOV B;  1GV2 A;  1HF0 A;  2BW3 A;  1FP2 A;  3GTO J;  3PFY A;  5FKL A;  2L2O A;  1OIS A;  1PYV A;  4G8X A;  2DPU A;  3J7Z I;  4I0B A;  3S93 A;  1IXS B;  2EZI A;  2LK2 A;  3GO5 A;  2JT1 A;  2DMP A;  3H9G A;  1B9M A;  2Y0M A;  4KUM A;  3GBG A;  2K3P A;  3IH4 A;  5AON A;  3L2R A;  2FNA A;  3HC7 A;  2HEO A;  1WI3 A;  4QPO A;  3SJM A;  2BV6 A;  1ACI A;  2F48 A;  1JKR C;  4BQN A;  4X1E A;  2E35 A;  4HQM A;  1ZLJ A;  2LKX A;  3QWL A;  4XN0 A;  1J09 A;  2HDD A;  3JRF A;  1KON A;  4RGS A;  1ZYR F;  2HYF A;  1HDD C;  2EZH A;  1S9H A;  2F4M B;  2RQQ A;  5LEJ A;  1MGT A;  3CCE I;  1WPK A;  2IGO A;  3I53 A;  5F08 A;  4EEF G;  1K7A A;  3T8R A;  2R4G A;  1GUU A;  2WB1 A;  3BT9 A;  3E7L A;  3ZMV A;  3TO6 A;  5LRS A;  3A02 A;  2GXA A;  3U9G A;  3CMM A;  3TDU C;  3OS1 A;  3RYP A;  3S15 J;  4L0Z B;  1XGM A;  1D3Y A;  1D8K A;  2XGC A;  2D5V A;  2IS1 A;  3K10 A;  1IUY A;  4UHT A;  1KYZ A;  3K2A A;  1TBX A;  1FSE A;  2HXI A;  4EGZ A;  1YG2 A;  2X1D A;  3F0C A;  2ETH A;  3PNY A;  3MQ0 A;  5EJC A;  1MBK A;  1A5J A;  1NG7 A;  1GXP A;  3K69 A;  5KNL A;  2R5Y A;  2ZCW A;  1F36 A;  3BPV A;  4BBS J;  2EFQ A;  3VDX A;  1Z1D A;  4NB5 A;  4E7I A;  5L3E A;  3H1C A;  1I39 A;  5IY5 H;  4GDF A;  3BR5 A;  4A93 J;  3TL4 X;  1MW7 A;  4IRG A;  1ZR2 A;  4EM0 B;  1ZKG A;  3NAR A;  3BP8 A;  4AWX B;  2W25 A;  3EDP A;  5E20 A;  2E5N A;  3DPT A;  1Z0X A;  4HX7 A;  2QSF X;  1TQI A;  2W48 A;  3B6C A;  2BHZ A;  4A6D A;  1I1G A;  2IP2 A;  1FOY A;  2R7V A;  3G2B A;  1YJN I;  3G1M A;  1XCV A;  2NVY J;  3HOW J;  2CUF A;  2HXO A;  3BZC A;  1XMA A;  3HKZ N;  1YHQ I;  2R7T A;  3DEU A;  2KRF A;  3DCF A;  3LA7 A;  3DQV C;  2XF7 A;  4EJO A;  3KYC B;  4Y3O A;  3LWF A;  2CUJ A;  4U0W A;  3CCJ I;  3JR9 A;  2NOG A;  5HOD A;  2GWR A;  5M5X J;  3HOS A;  4P55 A;  3GFM A;  1MBH A;  3JRB A;  5FD5 A;  3JSP A;  5FFX A;  2LR8 A;  1B9N A;  4OIR F;  4PSW A;  3AG2 H;  5JVT A;  2EZL A;  4OWR B;  3VFZ A;  2FUG 2;  4A2U A;  3JTH A;  4ZYH A;  4UVB A;  1EF4 A;  2QKL B;  2EV0 A;  3VYU B;  4A3E J;  2ID3 A;  1N78 A;  2YU3 A;  2X6X A;  4ITV A;  2R7Q A;  3RQ4 A;  1ZH5 A;  5A2Q K;  3W2V A;  3I9V 2;  1Y8Q B;  4KN4 X;  3O3K A;  4M74 A;  5LGT A;  2ZNY A;  3CUQ B;  4UY8 I;  2MA3 A;  1B4A A;  4F7Z A;  4M3B A;  3DU5 A;  1BM9 A;  4Y4R A;  4OIP F;  1R4N B;  3K0L A;  4KT6 A;  4NQW A;  3PO2 J;  3GFL A;  1D1A A;  3ZQF A;  4BXF A;  2D1H A;  2XUB A;  3EUK L;  4F55 A;  1UST A;  3FDY A;  2MC4 A;  1QZZ A;  2FU4 A;  3T1B A;  1QPI A;  4A3B J;  4KA4 A;  3ECO A;  2Y69 H;  4IRI A;  2FOW A;  3V8J A;  4BAC A;  1UB9 A;  1K6O A;  1UAA A;  1BI1 A;  1W0U A;  2L01 A;  4UV9 A;  1V55 H;  2A05 A;  4ANJ A;  1ZQ3 P;  1LJ9 A;  4BHB A;  1VQN I;  3S3N A;  3TMO A;  5HLH A;  4ZTF A;  2HR3 A;  5EG0 B;  2M1B A;  3O8H A;  2N8G A;  2Q2E B;  2QQA A;  2L7M P;  5FLM J;  2K5C A;  2COM A;  4J00 A;  3KFW X;  4E7L A;  1Q1H A;  3H9J A;  2ZJR F;  4MLO A;  5HDK A;  2G7U A;  3JRA A;  2P0W A;  1U5T B;  2DA5 A;  3I5U A;  4L9T A;  1ENH A;  2FXA A;  4OOI A;  3SFI A;  2XAS A;  4C30 A;  3PM1 A;  3CLO A;  3F8C A;  1QGP A;  4ESB A;  4LFU A;  2HOE A;  2L7Z A;  2OF7 A;  2XRL A;  2YUS A;  4JQF A;  3ABM H;  2MH9 A;  2BHY A;  4E70 A;  2M7A A;  1RR7 A;  1QHG A;  2O8X A;  1WGX A;  4LLL A;  1PP8 F;  4XKC A;  1TW2 A;  4LK1 F;  3KCC A;  3HPH A;  1I3A A;  4HAM A;  1R7J A;  4YEJ A;  2OTL I;  3GVA A;  5F1J A;  2DLL A;  5M3M J;  3TDZ C;  5J40 A;  5J4V A;  2Y31 A;  1BR4 A;  2K85 A;  2TCT A;  2IPQ X;  5DCM A;  3VYR B;  4M9Z A;  1J75 A;  3TKY A;  3GF2 A;  1DQU A;  3P7N A;  4A0X A;  1MMD A;  2NRA C;  2DDB A;  2CU7 A;  2IXS A;  1JT6 A;  2QEN A;  3C3W A;  5D4S A;  1PUF A;  2RAE A;  4DZJ A;  2BBY A;  4A3D J;  3ZQC A;  2P6T A;  3CF2 A;  3C2G A;  4B8X A;  3QQA A;  2B7E A;  3GZ6 A;  1NK3 P;  1NG6 A;  1KU2 A;  2L7K A;  2VJ4 A;  4KN7 X;  3SEZ A;  3MFK A;  1MSE C;  4MTE A;  3S2D J;  5LRR A;  3EYY A;  3K4K A;  1ERD A;  2O9L A;  1JI8 A;  4HF1 A;  1S29 A;  4CUG A;  4F92 B;  1T98 A;  4WXD A;  1SFU A;  2KQR A;  3L00 A;  1P2F A;  3DTK A;  1MMS A;  1FC3 A;  4A5N A;  2E1N A;  1R5I D;  4FQG A;  1AKH A;  5BNG A;  1FWZ A;  1AWC A;  3ABU A;  1ETY A;  3SHF A;  1BOB A;  2DPD A;  1B72 A;  3D5S C;  2K02 A;  1F5T A;  3DTE A;  4A0Z A;  3A2K A;  4C9Y A;  2IA1 A;  4XID A;  3RPQ A;  3ZQ7 A;  1WH7 A;  3GCM A;  2YS9 A;  4XR6 A;  1MSF C;  2IAI A;  4KMU X;  2ZNZ A;  3GTM J;  2RQP A;  4XNF A;  1WFX A;  2A6E F;  4M71 A;  3JRC A;  1W4M A;  2X9D A;  2QEX I;  5L3C A;  2DT7 B;  1DP7 P;  4BU2 A;  1YIJ I;  3PQK A;  3KP5 A;  2DW4 A;  2FNP A;  5EGO B;  3AL0 B;  1FOX A;  4LMY A;  2VBZ A;  4MQ9 F;  4RGU A;  4EM1 A;  1U5T A;  3WGI A;  2EK5 A;  1ON1 A;  4ENJ A;  1SAU A;  3IV5 A;  1RNL A;  2OQR A;  1MNE A;  4ZYA A;  2OJE D;  3ERE D;  3BG9 A;  3J7A O;  2HQN A;  2Y9Z A;  1XPX A;  3I4M J;  1OYY A;  2LRD A;  3J7Y J;  1KYW A;  1TT0 A;  1FJL A;  5D8L B;  2HU9 A;  1EA3 A;  4PJL A;  5DTD A;  1XSD A;  2A07 F;  5FKN A;  1O4X A;  5A2Q Z;  3L2U A;  1SAX A;  3ABK H;  2JUG A;  1T6S A;  2XGX A;  2B0L A;  3FXU A;  5CQG A;  4DZP A;  3CO6 C;  2JK3 A;  2XB5 A;  1LDJ A;  3X2Q H;  4C2T A;  3RKY A;  2DMQ A;  2E7W A;  3T5X A;  1IC8 A;  4G6Q A;  3FX3 A;  1ON2 A;  2V1X A;  2J5P A;  4WF2 A;  4OIQ F;  4CGZ A;  2JWT A;  1WJE A;  3TW6 A;  3REO A;  1RUO A;  3HRS A;  1P4W A;  2K4J A;  2PMU A;  2Q8K A;  4BUP A;  4HLX A;  2JN6 A;  2FSW A;  5FRO A;  2L9N A;  4TV7 A;  2PFB A;  1O57 A;  2R5Y B;  3BR3 A;  5HDN A;  9ANT A;  1X1P A;  4ZYE A;  3S3O A;  1BC8 C;  4XOP A;  1XMK A;  2VKV A;  1I6H J;  2JMW A;  2GIV A;  2Q2E A;  1G2H A;  1UHS A;  2ELH A;  2IVM A;  4ETS A;  5LFA A;  1S7E A;  2GZW A;  3MZH A;  4OMY A;  2DCE A;  4PJN A;  1TWF J;  3VYT B;  4GO1 A;  3L1P A;  1MIJ A;  4XM3 A;  1YFH A;  3HOY J;  2Z33 A;  2OZ6 A;  2K3F A;  4UB8 C;  1VQO I;  3S3M A;  1JHH A;  4P5O A;  2LBF B;  3TOA A;  3EUA A;  2VQH A;  4UVC A;  1HCR A;  1QHH D;  1ZHF A;  3KP4 A;  4PJJ A;  3WHC A;  2LNB A;  2CQK A;  3ASN H;  2LTP A;  1JGG A;  3HGG A;  1MBG A;  3PJR A;  2XVC A;  1T33 A;  1LVK A;  3ZCO A;  2CO5 A;  4C2U A;  4RAG A;  3GYH X;  1ITY A;  1ZTR A;  4A3M J;  3I59 B;  2A5Y B;  2WTE A;  4RB2 C;  4BH9 A;  4M72 A;  3BQY A;  3S8P A;  4BL0 B;  2OAZ A;  4UUS A;  2VKH A;  4KIG A;  1I1S A;  4HSR A;  1HQC A;  2FF4 A;  3OYL A;  2DOD A;  3CMA I;  2G7H A;  2E1M B;  4Y33 A;  2NAZ A;  2VJJ A;  4I99 C;  3SQN A;  1MJ9 A;  1RES A;  4HX4 A;  4L5I A;  4MGR A;  4PDK A;  1K61 A;  4IO9 F;  5LBQ A;  2OZU A;  1PUE E;  3CJN A;  3E5Q A;  3A01 A;  3I64 A;  2ZXW H;  3HB9 A;  4C2M J;  3K4L A;  2KP6 A;  2M34 A;  4R79 A;  5K5R A;  2K40 A;  5F04 A;  3Q0V A;  5E3N A;  3RSN A;  4QTR A;  2E1O A;  2R7F A;  2V4J C;  2UUZ A;  3E6M A;  2VC0 A;  1WZ2 A;  1B59 A;  3BOQ A;  3M8J A;  5F0H A;  3GTG J;  2M4G A;  3R6S A;  5CVJ A;  3HM5 A;  4K2E A;  4RLF A;  1KU7 A;  4JX5 A;  2DJN A;  2L4M A;  2M4K A;  5AIP A;  5CVI A;  1ETQ A;  3QAH A;  4XK4 A;  3RJP A;  3M1C A;  2D1V A;  2BOL A;  2VBY A;  1LFB A;  2A69 F;  2EIJ H;  1ORK A;  1POG A;  3P9K A;  2E71 A;  3VB2 A;  4BYY A;  1R1T A;  3OYM A;  2R7O A;  3L2V A;  3C7J A;  1B8I B;  2LRE A;  5L3B A;  3LSR A;  4DIQ A;  1SD6 A;  4Q4Z F;  3ZQL A;  3OS2 A;  1IJW C;  1J7K A;  3R60 A;  1U3E M;  4HPQ A;  3KLO A;  3JCU C;  2VQL A;  2O03 A;  1X19 A; 
#chains in the Genus database with same CATH homology
 5DCF A;  4HV5 A;  1D5V A;  2VE9 A;  2XAF A;  4KMF A;  2KJB A;  1UFM A;  5LHH A;  3HTU A;  3F6V A;  3ISP A;  3D0S A;  3FM5 A;  1WQ2 A;  3HRM A;  3FXQ A;  2A61 A;  1B6A A;  1JGS A;  2DQL A;  2VON A;  3BJA A;  3ZMT A;  5BQT A;  4B09 A;  2F5D A;  3F8F A;  3CUQ A;  3EYI A;  3ZMD A;  3CUQ C;  4KFC A;  3ECH A;  3GZ5 A;  2CW0 F;  4KNY A;  4XBF A;  3GX4 X;  4EJT A;  3ZMU A;  5HS7 A;  1Z9C A;  4FT8 A;  2GAU A;  3F3X A;  3I0T A;  4G9Y A;  1XDU A;  2ZME A;  1BIA A;  4P9F A;  1YIO A;  4L18 B;  3K1M A;  5JR3 A;  1O7F A;  3CDH A;  1LVA A;  1LEB A;  3BPX A;  4I0A A;  2ZFW A;  4D0P A;  2MH2 A;  1HBX G;  3BY6 A;  5LGU A;  2XRN A;  2P5L C;  1IF1 A;  2OA4 A;  2EV6 A;  3FXR A;  3COA C;  3G3Z A;  2V79 A;  2DBB A;  1BIB A;  2FML A;  2VT2 A;  2XKP A;  2PJP A;  3ZPL A;  1MJA A;  4XLP F;  2K7L A;  3ROU A;  1EV7 A;  2PQ8 A;  5ED4 A;  2FQ3 A;  2IW5 A;  2R3S A;  1YLF A;  1KGS A;  2VXZ A;  1FNN A;  1GVJ A;  3M8F A;  3QU6 A;  1ZGJ A;  3GFI A;  2CSO A;  1XSX A;  2UZK A;  5TJJ A;  2QZ8 A;  1IXR C;  3WGH A;  2E1C A;  1SMT A;  1IN4 A;  5CVU A;  3IL2 A;  4ENK A;  4CDG A;  3HRU A;  2W84 A;  3U2R A;  2FMY A;  4I02 A;  5J6X A;  2VOP A;  1V3F A;  1W7P A;  4LJZ F;  4EM2 A;  1R00 A;  1FBU A;  5DD8 A;  5H20 A;  1EH6 A;  2H27 A;  2V6C A;  2FBH A;  5IT3 A;  4ENN A;  3ZN0 A;  2HFH A;  1LEA A;  2EFP A;  2M8E A;  4IHT A;  3QPH A;  2F5F A;  3RPU A;  2V1D A;  3HYI A;  2RGV A;  1YW8 A;  3V4G A;  4N0B A;  2YX4 A;  3WG9 A;  1QZY A;  3IWZ A;  1BN5 A;  5BOX A;  3KEO A;  5ICE A;  2CFX A;  2L4A A;  3LFK A;  4QLC U;  3R61 A;  2ESN A;  3V7C A;  5J8F A;  1JHF A;  3H3Z A;  2H94 A;  2X0L A;  1K78 A;  3WOD F;  5L3G A;  3T8T A;  3QRF F;  3D5L A;  3NEU A;  1W5S A;  1I5Z A;  3L9F A;  2OU2 A;  4Y15 A;  4DNC A;  1DPU A;  1S3J A;  4A12 A;  2IA0 A;  4HYE A;  3ZP5 A;  3RKW A;  2KIF A;  1XCB A;  1J0R A;  3VOE A;  2PN6 A;  1YS6 A;  1WKM A;  2D2W A;  3DKW A;  2DT5 A;  3F8B A;  1KU3 A;  5TRD A;  4BAY A;  2O6G E;  2Q0O A;  1P6R A;  5DYM A;  2RDP A;  5K1Y A;  3RIR A;  1OKR A;  1BBY A;  2G9W A;  1KQ9 A;  3ZMS A;  3WU0 A;  1VTN C;  3U1D A;  1X3U A;  3E6B A;  3ZN1 A;  4Q48 A;  1WSU A;  5D5V B;  2VN2 A;  3MZY A;  1S7O A;  5E1Z B;  1QPM A;  5BMZ A;  3ELK A;  1FYL A;  5FB2 A;  1SMY F;  1FP1 D;  2M30 A;  3WTX C;  3LA2 A;  5E1W A;  2PLY A;  4U0V A;  3RTR A;  1ZG1 A;  4UNO A;  3O6B B;  5D4R A;  1SD7 A;  1IRF A;  3BJ6 A;  2UXN A;  2QBY B;  4Y13 A;  3HIF A;  3GW2 A;  3TO9 A;  2PBI A;  3HTS B;  1HKT A;  1UHM A;  4U0Y A;  3H3U A;  3TQN A;  2ZXJ A;  5F6F A;  5L3D A;  1ZAO A;  1FPQ A;  2CG4 A;  2Z99 A;  3DXJ F;  1ZG5 A;  3C18 A;  1B1B A;  4YFX F;  3WTS C;  1Z91 A;  1SFE A;  3TGN A;  2NS0 A;  4S04 A;  1FZP B;  1F4K A;  2LDU A;  1DDN A;  3ML6 A;  4L9J A;  4A5M A;  3JSO A;  5D5X B;  3B73 A;  3F22 A;  1FSH A;  4I2O A;  1LDD A;  4BQA A;  3N97 A;  3R0J A;  3SXY A;  3VOD A;  3PFI A;  3WTT C;  2DO7 A;  2O3F A;  2H09 A;  2XHK A;  3KP7 A;  5E8G A;  2FE3 A;  3LQQ A;  4EMS A;  3I71 A;  2UWM A;  3K1N A;  4G94 A;  3BWG A;  4CIC A;  2QLZ A;  4I7H A;  5DUI A;  1E17 A;  1HW5 A;  4A0Y A;  2IA2 A;  1DUX C;  1LB2 A;  1D8J A;  2CGP A;  3IKV A;  1CF7 B;  2ZBK A;  2STW A;  5CYV A;  4UV8 A;  4RB0 A;  4MHG A;  1YO5 C;  1IXC A;  3HSR A;  4KYW A;  1V4R A;  1J9I A;  5ILU A;  5HLI A;  1WI9 A;  1P4X A;  3JW4 A;  4Y17 A;  2Y75 A;  4RAY A;  4EV0 A;  2WV0 A;  2D45 A;  3C1D A;  3HRT A;  2DU9 A;  4AVP A;  1S7A A;  1R5H A;  3VEP A;  3MCZ A;  2K27 A;  4P9U A;  2DK5 A;  2P8T A;  3H92 A;  1W7P B;  2VT3 A;  2MLK A;  4ESJ A;  2F2E A;  1BJA A;  1KQ8 A;  2EJR A;  4MNU A;  4NHJ A;  2A6H F;  2KKO A;  5KVR A;  3ULQ B;  2STT A;  1H9T A;  3QP6 A;  4ZH4 F;  3W6K B;  2C6Y A;  2JSC A;  2RV8 A;  3P9I A;  3WGG A;  1YTY A;  5DEQ A;  4H0E A;  2RKH A;  3SFZ A;  3IKT A;  2Y48 A;  4HBL A;  2XAH A;  1UCR A;  1TNT A;  2XAJ A;  2V1U A;  1QO0 D;  4ENM A;  2VOD A;  4KIC A;  2L3D A;  3E5U A;  2JRT A;  4WCG A;  4ZZL A;  2TDX A;  1IZ1 A;  2WC2 A;  5HDG A;  1QBJ A;  1KQ0 A;  2Z9O A;  5ERI A;  3AAF A;  3HSE A;  3V8L A;  1TW3 A;  4KT5 C;  1LNW A;  4G7O F;  3F8N A;  4MTD A;  5L3F A;  2K4B A;  3IWF A;  1HW2 A;  3GWZ A;  2GQQ A;  2OQG A;  2IT0 A;  2F5C A;  5E8I A;  5F64 A;  2KIM A;  4UXN A;  2GXG A;  2XIG A;  1K78 B;  4FHT A;  1Z05 A;  1EH8 A;  2PMH A;  1USS A;  2IJL A;  4R1H A;  1RIO H;  5FGM A;  2DI3 A;  5CVR A;  1REP C;  4EJV A;  4XSX F;  1FYM A;  3KZZ A;  3OOP A;  5DD4 A;  1R58 A;  2BYV E;  5K5O A;  5E1X A;  1BI0 A;  4OIO F;  3LQR A;  1IN7 A;  1F9N A;  2GA2 A;  1SD4 A;  1U6G A;  4L9N A;  2LF8 A;  5DUK A;  2JTV A;  5FLX Z;  4ZYD A;  1ZG3 A;  5D8K B;  3QU3 A;  2ESH A;  3I4P A;  3HHG A;  3IRR A;  1PDN C;  1OYW A;  2M45 A;  5D5U B;  4I09 A;  2ISZ A;  2VBX A;  4CHU A;  4YIF A;  3J81 K;  4HA8 A;  4LG0 B;  3WE2 A;  2J5O A;  4IRH A;  3IHU A;  2XKO A;  4LK0 F;  5EEG A;  3J80 K;  1SFX A;  2JPB A;  4GCV A;  1R1U A;  1HW1 A;  1I6X A;  2W24 A;  3CTA A;  1MJB A;  1O3R A;  4YII A;  1O3T A;  4GXO A;  5HVQ C;  3Q9V A;  4Q5S F;  1IAW A;  4RS8 A;  1YS7 A;  1G3S A;  2VOO A;  5DDG A;  2XRO A;  2ZJ2 A;  3HOT A;  1GHC A;  2PEX A;  2YX7 A;  4MEX F;  4KIB A;  2EV5 A;  5D6F A;  3EET A;  2HS5 A;  2W57 A;  2DK8 A;  5LLQ A;  4GYG A;  3GLX A;  4HLY A;  1WRJ A;  3V8K A;  2MLG A;  2ISY A;  4FX0 A;  3L7W A;  1U78 A;  2P5K A;  1YYV A;  2DQR A;  4U7B A;  3I59 A;  1JXS A;  2EFO A;  4L5J A;  4LG0 A;  2L54 A;  4Q47 A;  1R1V A;  5J8C A;  4PZJ A;  4HOB A;  3CO7 C;  2YSR A;  4OMZ A;  3RDI A;  3S2W A;  1TQM A;  2EFW A;  3R0A A;  3DV8 A;  4O5V A;  1XD7 A;  1LQ1 A;  2HKX A;  1TNS A;  3F6O A;  3JAM Z;  5JI6 A;  1ULY A;  2QWW A;  3L09 A;  2ADU A;  2LSO A;  3MAJ A;  1HKS A;  3BJO A;  1Z6T A;  1BI3 A;  3L2C A;  5KK1 A;  4M6X A;  3J81 Z;  2RNJ A;  2FA5 A;  2RN7 A;  4XRF A;  4RAZ A;  1CF7 A;  2GXB A;  2Z3Y A;  1IN5 A;  1IN6 A;  1IW7 F;  4IVN A;  3HSF A;  4G6D A;  4YG2 F;  3F23 A;  3KEQ A;  1SD5 A;  1F1Z A;  3HUG A;  3FF5 A;  4XSZ F;  3F72 A;  2HZT A;  1T2K A;  1XSV A;  4ASN A;  1BI2 A;  2RVC A;  3WU1 B;  2QVO A;  1HKQ A;  4CO8 A;  2UXX A;  1ZRD A;  5CLS A;  1MDM B;  1XB4 A;  4WXH A;  2QYO A;  3B02 A;  3FMS A;  4PCQ A;  1FBS A;  1R22 A;  2BE5 F;  2Z5U A;  4ESF A;  1STZ A;  2HYG D;  1O3Q A;  4HW0 A;  1ZRE A;  4N9H A;  1W5T A;  2OD5 A;  2GA1 A;  2HDC A;  3DPL C;  3LST A;  3Q5F A;  3TOB A;  3EQL F;  2HTS A;  1Z7U A;  1P92 A;  1H9G A;  3CUO A;  1BC7 C;  2PG4 A;  2DFI A;  2HWV A;  1FBQ A;  2HGC A;  4KDP A;  1T38 A;  4OU0 A;  2QBY A;  5ILS A;  2JZY A;  1R36 A;  1XDS A;  3WTU C;  1OR7 A;  1XGN A;  1WWX A;  4IJA A;  5F1R A;  2CWE A;  4LB6 B;  2ZKZ A;  2AXL A;  2QM3 A;  4N9I A;  5ICG A;  2EA4 A;  3V7R A;  2OBP A;  1FYK A;  2BEO A;  2VE8 A;  4BHP A;  1J5Y A;  5LGN A;  1S8N A;  3RYR A;  3QPT A;  2R7D A;  3R4K A;  3MEX A;  2X4H A;  3K9T A;  4HDV A;  1TQP A;  2WWY A;  1FLI A;  2PI0 A;  4RB3 C;  3FZV A;  1RUN A;  2P7V B;  4LGW A;  1KU9 A;  3GUD A;  2NNY A;  3W6J B;  2QUF A;  1HXD A;  3WTY C;  6PAX A;  4WWC A;  5FFZ A;  2AS5 F;  2F5E A;  1J2X A;  2P7C B;  4L9V A;  2NYX A;  4HV6 A;  5E17 F;  3M8E A;  2LF7 A;  3NQO A;  3KP6 A;  1OPC A;  2M87 A;  3N4M A;  1GXQ A;  4M73 A;  1G3T A;  4QWQ A;  1CGP A;  4M6Y A;  4L0Y B;  5BS6 A;  3E97 A;  3FHZ A;  1RI7 A;  1C0W A;  2DTR A;  2FEZ A;  2EWN A;  4AIK A;  4MEY F;  4RGR A;  1A04 A;  4LB5 A;  1O3S A;  4AIJ A;  1BOA A;  1R5G A;  3KP2 A;  5FO5 A;  3IC7 A;  3DP7 A;  1TTY A;  1ZAR A;  1I27 A;  4DQ2 A;  4BXU A;  1ONV A;  4GGG A;  5DV5 A;  1W7P D;  1FY7 A;  1FX7 A;  3FM3 A;  2HQR A;  1Z6R A;  4G7H F;  1L3L A;  2EFN A;  5JFR A;  1PP7 U;  3F21 A;  4IPA A;  2P5V A;  4WX9 A;  2HKO A;  3K1P A;  5CVV A;  3P9C A;  4HF0 A;  1LDK B;  2LKP A;  3LAJ A;  4HDU A;  2P4W A;  1K79 A;  2IRF G;  5E18 F;  4UVA A;  5HOO A;  3KE2 A;  4ON0 A;  1G6N A;  2KIU A;  1EH7 A;  2EB7 A;  1U2W A;  3IRQ A;  4HF2 A;  2ZME B;  4FX4 A;  2P6S A;  2JPC A;  3K2Z A;  3J80 Z;  5ICC A;  4O6J A;  5LHI A;  3BZ6 A;  2ZO4 A;  2BGC A;  5HS8 A;  5HS9 A;  4MQV A;  1FOK A;  4R8H A;  5IT9 Z;  3JTG A;  2L02 A;  2A3S A;  3QP5 A;  4M9X A;  3RI4 A;  2VC1 A;  2V9V A;  3F8M A;  4OIN F;  1MKM A;  3I58 A;  3KP3 A;  1YW7 A;  2MD5 A;  4HQE A;  4HZF A;  1XGS A;  5FD6 A;  1OMI A;  5H6R A;  4P96 A;  5EEH A;  4IF4 A;  1U5T C;  3I54 A;  4IHS A;  1JE8 A;  1OYI A;  3LA3 A;  3GFJ A;  4RGX A;  3M1E A;  1Y0U A;  4JK1 X;  4WXC A;  3WTV C;  3O2P E;  1G4D A;  1DPR A;  4EJW A;  1HST A;  3PQJ A;  4LLN A;  5ILV A;  1H0M A;  3KET A;  2YPR A;  4EVI A;  4ZZD A;  1T0F A;  4IXA A;  1KA8 A;  2RC4 A;  3M9A A;  2XV4 S;  4UUV A;  4I01 A;  3TO7 A;  2HTJ A;  1MDM A;  2NNN A;  4RB1 A;  2DAO A;  2O0Y A;  5HLG A;  1TLH B;  4YFK F;  3FMQ A;  1ZGA A;  5JHU A;  3GEZ A;  3E3V A;  2M5W A;  1UHW A;  4YFN F;  1XN7 A;  2K86 A;  4U7D A;  1G3W A;  2E7X A;  4XLN F;  5ICF A;  4AIH A;  3QOP A;  2QQ9 A;  1L0O C;  3KZY A;  5CJ9 A;  3SZP A;  1J59 A;  1P4A A;  4LLG F;  3ZMZ A;  2XAG A;  2VBW A;  5FLX K;  3M7G A;  1RZ4 A;  1U8R A;  2A68 F;  2XAQ A;  1E2X A;  1ZN2 A;  3BRO A;  4AD9 A;  3BDD A;  1YW9 A;  5D5W B;  1QQI A;  3HHH A;  4BNC A;  4A6E A;  2YR2 A;  3KLN A;  4HX8 A;  2FRH A;  3OV8 A;  5H6Q A;  3LAP A;  5LHG A;  5LEK A;  4M9S A;  4WK8 F;  5D6E A;  4PGG A;  3WE3 A;  1G3Y A;  1S6L A;  2FBK A;  4BHC A;  4S05 A;  4EGY A;  2MC3 A;  5BPI A;  2H6C A;  3E6C C;  2EA2 A;  4ZYG A;  4JBA A;  3RKX A;  4LD5 A;  1O7L A;  5BPD A;  2CYY A;  4O3M A;  4I98 B;  4Z2Y A;  1ZRF A;  3NRV A;  5AIQ A;  2H6B A;  3JAM K;  1ZRC A;  1XGO A;  4GYI A;  3MWM A;  3T0Y A;  4CXF A;  3V7S A;  1T39 A;  1YQA A;  4KIF A;  2KJC A;  4EQQ A;  2ACJ A;  3ABT A;  3Q9S A;  3SZT A;  1R23 A;  3FMR A;  2MBF A;  5DCM B;  2O61 A;  2FBI A;  1QNT A;  3E5X A;  3WTW C;  4EJU A;  3EUH A;  3DF8 A;  1ZLK A;  2QQB A;  3G73 A;  1AOY A;  2W85 A;  1ODD A;  4CZZ A;  3DFG A;  5K5Q A;  1IRG A;  4G7Z F;  3GXO A;  1HSJ A;  1FT9 A;  3FWE A;  1NHA A;  4PGH A;  3E6D A;  1MZB A;  1IN8 A;  1MD0 A;  3WTZ A;  4U88 A;  2FOK A;  4CYD A;  5IT9 K;  1FP2 A;  4G8X A;  2DPU A;  4I0B A;  1IXS B;  3GO5 A;  2JT1 A;  1B9M A;  2Y0M A;  4KUM A;  5AON A;  2FNA A;  2HEO A;  2BV6 A;  4HQM A;  1ZLJ A;  4RGS A;  1ZYR F;  2HYF A;  5LEJ A;  1MGT A;  3I53 A;  1K7A A;  3T8R A;  3ZMV A;  3TO6 A;  5LRS A;  3U9G A;  3TDU C;  3RYP A;  4L0Z B;  1XGM A;  1D3Y A;  1D8K A;  1IUY A;  4UHT A;  1KYZ A;  1TBX A;  1FSE A;  4EGZ A;  1YG2 A;  2ETH A;  3MQ0 A;  1GXP A;  3K69 A;  2ZCW A;  3BPV A;  2EFQ A;  1Z1D A;  4NB5 A;  5L3E A;  4IRG A;  4EM0 B;  3BP8 A;  4AWX B;  2W25 A;  3EDP A;  5E20 A;  3DPT A;  4HX7 A;  1TQI A;  4A6D A;  1I1G A;  2IP2 A;  1XCV A;  1XMA A;  3DEU A;  2KRF A;  3LA7 A;  3DQV C;  4EJO A;  3LWF A;  4U0W A;  2GWR A;  3HOS A;  4P55 A;  3GFM A;  5FD5 A;  3JSP A;  5FFX A;  1B9N A;  4OIR F;  5JVT A;  4A2U A;  3VFZ A;  3JTH A;  4ZYH A;  4UVB A;  2EV0 A;  2YU3 A;  1ZH5 A;  5A2Q K;  4KN4 X;  3O3K A;  4M74 A;  5LGT A;  2ZNY A;  3CUQ B;  2MA3 A;  1B4A A;  4F7Z A;  1BM9 A;  4OIP F;  3K0L A;  4NQW A;  3GFL A;  2D1H A;  2XUB A;  1UST A;  1QZZ A;  2FU4 A;  3T1B A;  4KA4 A;  3ECO A;  4IRI A;  3V8J A;  1UB9 A;  1K6O A;  1BI1 A;  2L01 A;  4UV9 A;  1LJ9 A;  4BHB A;  5HLH A;  2HR3 A;  2M1B A;  2QQA A;  2COM A;  3KFW X;  1Q1H A;  5HDK A;  2G7U A;  1U5T B;  3I5U A;  4L9T A;  4OOI A;  2FXA A;  2XAS A;  3CLO A;  3F8C A;  1QGP A;  4ESB A;  4LFU A;  2HOE A;  4JQF A;  2MH9 A;  4E70 A;  2O8X A;  4LLL A;  1PP8 F;  1TW2 A;  4LK1 F;  3KCC A;  4HAM A;  1R7J A;  3GVA A;  2DLL A;  3TDZ C;  5DCM A;  2IPQ X;  4M9Z A;  1J75 A;  3TKY A;  3GF2 A;  3P7N A;  4A0X A;  2NRA C;  3C3W A;  5D4S A;  2QEN A;  2BBY A;  2P6T A;  4B8X A;  3GZ6 A;  1KU2 A;  4KN7 X;  3MFK A;  4MTE A;  5LRR A;  3EYY A;  4HF1 A;  1S29 A;  1T98 A;  4WXD A;  1SFU A;  3L00 A;  1P2F A;  1FC3 A;  4A5N A;  2E1N A;  2DPD A;  1FWZ A;  3ABU A;  3SHF A;  1AWC A;  2K02 A;  1F5T A;  4A0Z A;  2IA1 A;  3RPQ A;  3ZQ7 A;  4KMU X;  2ZNZ A;  2RQP A;  2A6E F;  4M71 A;  1W4M A;  5L3C A;  1DP7 P;  3PQK A;  3KP5 A;  2DW4 A;  2FNP A;  4LMY A;  2VBZ A;  4MQ9 F;  4RGU A;  4EM1 A;  3WGI A;  1U5T A;  2EK5 A;  1ON1 A;  4ENJ A;  1RNL A;  2OQR A;  3ERE D;  3J7A O;  2HQN A;  1OYY A;  1KYW A;  5D8L B;  1XSD A;  2A07 F;  5A2Q Z;  1SAX A;  1T6S A;  2XGX A;  2B0L A;  3FXU A;  3CO6 C;  1LDJ A;  3RKY A;  2E7W A;  3T5X A;  4G6Q A;  3FX3 A;  1ON2 A;  2V1X A;  2J5P A;  4WF2 A;  4OIQ F;  4CGZ A;  3REO A;  1RUO A;  3HRS A;  1P4W A;  2K4J A;  2PMU A;  2Q8K A;  4HLX A;  2FSW A;  4TV7 A;  2PFB A;  1O57 A;  5HDN A;  4ZYE A;  1BC8 C;  1XMK A;  2GIV A;  2Q2E A;  2ELH A;  2IVM A;  4ETS A;  3MZH A;  2GZW A;  4OMY A;  4GO1 A;  1YFH A;  2Z33 A;  2OZ6 A;  1JHH A;  4P5O A;  3TOA A;  4UVC A;  1ZHF A;  3KP4 A;  2LNB A;  2CQK A;  2XVC A;  2CO5 A;  3GYH X;  3I59 B;  2A5Y B;  2WTE A;  4RB2 C;  4BH9 A;  4M72 A;  2OAZ A;  4KIG A;  1I1S A;  1HQC A;  2FF4 A;  2G7H A;  2NAZ A;  3SQN A;  1MJ9 A;  4HX4 A;  4L5I A;  4MGR A;  4PDK A;  5LBQ A;  2OZU A;  1PUE E;  3CJN A;  3E5Q A;  3I64 A;  4R79 A;  5K5R A;  2R7F A;  3E6M A;  2VC0 A;  1B59 A;  3BOQ A;  3R6S A;  5CVJ A;  4K2E A;  1KU7 A;  2L4M A;  5AIP A;  5CVI A;  3QAH A;  3RJP A;  2D1V A;  2VBY A;  2A69 F;  4BYY A;  3P9K A;  3VB2 A;  1R1T A;  3C7J A;  5L3B A;  1SD6 A;  4Q4Z F;  1J7K A;  3R60 A;  1U3E M;  3KLO A;  2O03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...