3MEXA

Crystal structure of mexr in oxidized state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
142
structure length
142
Chain Sequence
MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQSLAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transcription regulation
molecule keywords Multidrug resistance operon repressor
publication title Structural insight into the oxidation-sensing mechanism of the antibiotic resistance of regulator MexR
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 48
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mexA01
4Z2YA 5D4SA 2QQ9A 2GZWA 2X0LA 1YS6A 1O3TA 1OYWA 2Y48A 3JSPA 3DFGA 4U88A 2YSRA 2O0YA 2W57A 3TGNA 2IW5A 1MJAA 3JSOA 2CGPA 2IPQX 3E6BA 3U1DA 3I5UA 2QQAA 4HX7A 2HTJA 5JFRA 3V4GA 2HKOA 4P9FA 1O57A 3MAJA 2L02A 4ENKA 3WTXC 1XGOA 1YQAA 1XN7A 2FF4A 1U6GA 1J75A 1FSHA 5FD6A 3WU1B 4G7ZF 2HQNA 3V8LA 2FBKA 1FBUA 4ZZDA 4HDUA 5LGUA 1U2WA 3CO7C 2QENA 3F8FA 3ZP5A 5AIPA 1QQIA 5JHUA 2PLYA 3BPXA 2UWMA 3Q9SA 3ERED 1VTNC 2JRTA 1B1BA 2QVOA 4BAYA 2FA5A 5CVUA 1SAXA 1O3QA 1D3YA 1FC3A 2WV0A 4KDPA 4M9XA 2HYFA 4R8HA 3G3ZA 3I71A 3HUGA 3I4PA 3E5UA 3GVAA 3T8RA 3GXOA 1W5TA 1J7KA 2RN7A 1HSJA 1ON2A 4RGSA 2OQRA 3RPUA 1TQPA 2A6HF 4U7BA 3IRRA 1ZRFA 1ULYA 3HRUA 2VT2A 1T6SA 1Z91A 2K27A 4IHTA 5L3EA 1QPMA 3DXJF 4MEYF 5CLSA 3AAFA 4HLYA 5CYVA 1U5TB 5D8LB 1T98A 1BOAA 3DV8A 4E70A 2CSOA 1DP7P 3WTTC 2QZ8A 4RB0A 3GZ6A 3DPLC 1Z6RA 1E2XA 4EMSA 5BOXA 3ZPLA 3MZYA 5DYMA 2A5YB 2QBYA 2BGCA 4EV0A 3WGIA 3F22A 3RDIA 3QU3A 3DQVC 3BWGA 4OMZA 1R1TA 3LSTA 4EQQA 2ZKZA 1OR7A 3HRMA 2PBIA 2FMLA 3FM3A 1DUXC 2IP2A 3J80K 4L0ZB 3M1EA 1PP7U 4LLLA 4PCQA 5HDGA 3BP8A 5LRRA 1TLHB 2JT1A 2WWYA 3VEPA 2ZO4A 4MNUA 3R0AA 1YW8A 5HLGA 2L3DA 1ZLJA 3P9IA 4QWQA 1MGTA 4GYIA 3ZMDA 2Z33A 2YX7A 1J9IA 2HR3A 4G9YA 4YIIA 1TNSA 4MGRA 3HTSB 2P4WA 5DCMA 2XV4S 3VFZA 2PN6A 4EM2A 2VN2A 2M30A 2A61A 3IKVA 2NNYA 3T0YA 2FBIA 3FWEA 4GGGA 2VOOA 4HV6A 1FT9A 5ED4A 1V4RA 2W24A 2XAQA 1IN8A 4UHTA 1P2FA 1XDUA 5HS7A 4L0YB 1HW2A 1ZGAA 4CHUA 3TO9A 2R7FA 3GYHX 1OYYA 5DD8A 2JPBA 3EYIA 1USTA 1HXDA 3P7NA 3J81Z 5D8KB 4ZZLA 1F9NA 1QBJA 1RIOH 3H3UA 2HDCA 5LHIA 2WTEA 3MZHA 2WC2A 5LHHA 3KFWX 3FMSA 1HSTA 4UV9A 4MHGA 3F23A 3ZMVA 2IVMA 3DEUA 4O3MA 1TBXA 2ESHA 4MTEA 5JI6A 4L9JA 1YS7A 4ZYEA 3EUHA 1O7LA 2E7XA 2FRHA 4IPAA 1SMTA 4HQEA 2P8TA 2ESNA 4A6EA 5HS8A 3MEXA 2K86A 1CGPA 2BYVE 5D5XB 1JHFA 2D2WA 2VC1A 4PZJA 2RQPA 4FHTA 5K5RA 1HBXG 1IAWA 2V1UA 4HQMA 2EWNA 2F5EA 3WGGA 1GVJA 3TKYA 1RUOA 3HOTA 2EFOA 1KGSA 3QP5A 3EDPA 3SQNA 1J2XA 2GA1A 1XGNA 3K2ZA 1IZ1A 1IXRC 1KQ9A 3CTAA 3QPHA 4UVBA 3QRFF 3GFLA 4CZZA 5LGTA 2YU3A 4P96A 3I54A 4RB1A 1R5HA 2ZNYA 3C7JA 2EA4A 2QBYB 3IL2A 1BI2A 1R1UA 4HBLA 4M6YA 4HX4A 4Q48A 1YW7A 2YR2A 5HLHA 1P92A 3ISPA 1IXSB 4ETSA 1IUYA 3M7GA 4CO8A 4WXDA 1DDNA 1F1ZA 4UV8A 2BEOA 2VE8A 1RNLA 2H94A 2XUBA 1LJ9A 5K5OA 4ESJA 4ESFA 3FMRA 4KIFA 3K0LA 2XIGA 3MCZA 1S6LA 3QAHA 2G9WA 3EYYA 4EJWA 2ZFWA 4CICA 5E8GA 2VODA 1EH7A 2CG4A 2FXAA 2VBXA 3CJNA 2DFIA 3LAJA 1CF7A 4EVIA 4N0BA 1ZARA 3KP5A 4KUMA 4RAZA 3IC7A 3HRTA 2JZYA 2KIUA 2QLZA 1HKTA 1ZH5A 2DAOA 2GWRA 3TOAA 5J6XA 3HIFA 1D8KA 4Q5SF 5DCMB 2R3SA 1P4WA 5H6QA 1Y0UA 4GO1A 4G7HF 4OU0A 2G7UA 2A07F 2P5KA 1TTYA 2FNPA 2PI0A 3HRSA 1QZYA 4LB5A 5ERIA 2HEOA 4R1HA 2HS5A 2PMHA 2FU4A 3BJOA 4M74A 4Y17A 1LVAA 1EH8A 4S04A 1BI3A 4YFNF 3PQKA 1R58A 2NNNA 1SFEA 1SFXA 3E97A 2KJCA 1P6RA 5DCFA 1KU2A 2ELHA 1ONVA 2EV0A 3QOPA 3TO6A 3WG9A 1K78A 3E5QA 3HTUA 3K1PA 4I01A 2XVCA 2IA2A 1FP1D 1G3YA 3B73A 4ZYDA 5CVJA 1XDSA 4L9TA 4HYEA 2EFNA 2IA1A 1R7JA 1P4AA 3FXUA 4ASNA 2PFBA 3BJAA 1Z05A 2MH9A 1G4DA 3FXQA 2DK8A 1U5TC 2O8XA 3WGHA 4D0PA 3F8MA 1Z9CA 5LHGA 2RKHA 1S7AA 2Q0OA 4CYDA 3V7CA 1AWCA 1LNWA 1UHMA 5DUKA 1MJBA 2CQKA 4K2EA 3GWZA 5FFZA 3N4MA 4GCVA 4LK0F 2O3FA 3HHGA 2OU2A 4AIJA 2EJRA 1RI7A 2VBWA 2C6YA 3PQJA 2W25A 3C1DA 4Q47A 3K1NA 2CYYA 2JPCA 4KFCA 5IT9K 4RGUA 1G3WA 1F4KA 2L54A 5D6EA 4I98B 2KRFA 3FM5A 2ZJ2A 3GFIA 1BIBA 3R6SA 1BN5A 3R0JA 1TQMA 3GUDA 3LQRA 1TW2A 1O3SA 1FOKA 1XCBA 2ZBKA 2DBBA 1I1SA 3FF5A 4YFKF 1FWZA 2XKPA 4QLCU 1XD7A 4A5NA 5E8IA 5L3FA 5L3BA 3GZ5A 3VODA 2QQBA 2KIFA 2MC3A 2E1NA 3RTRA 2QYOA 2DPUA 1LQ1A 2QM3A 5F1RA 3RJPA 3O2PE 1OMIA 5ILSA 4XSXF 1ZG1A 2Q8KA 3WTUC 5E17F 2IA0A 1CF7B 4GXOA 4KYWA 4OIRF 2FBHA 1KU3A 3RKYA 1YO5C 2PG4A 5L3DA 5KK1A 3ULQB 2ZXJA 2ACJA 3KP6A 2F2EA 2OA4A 2XAGA 1SMYF 1MDMB 3M9AA 2FE3A 3C3WA 4OOIA 2DT5A 4EGYA 1WWXA 1ZG3A 2GXGA 1FNNA 3O3KA 3Q5FA 1FY7A 2TDXA 4PGHA 5ICEA 3NRVA 4HV5A 1ZRDA 5JVTA 1I27A 2Y0MA 2PQ8A 1GXQA 2E1CA 2F5DA 5EEHA 3BDDA 2P7CB 1QGPA 2DO7A 1YIOA 4EM1A 4ENMA 3KCCA 4AD9A 5CVVA 1K78B 1WQ2A 4RB2C 3GX4X 1XSDA 4EJUA 2K4BA 1HKQA 1K79A 3VOEA 5TJJA 1EV7A 1U3EM 1I6XA 2H6BA 5DUIA 4M6XA 4M9SA 2JTVA 1DPRA 4BYYA 1GXPA 2R7DA 1D5VA 3KLNA 1IN4A 2CW0F 2O03A 3U9GA 4HF2A 4XLPF 1FLIA 4LD5A 3RYRA 3TO7A 3BJ6A 1FYMA 1TQIA 2H27A 2A69F 4UUVA 1R36A 5DV5A 4EGZA 2XKOA 3ZMTA 1P4XA 2DQRA 4EJVA 1B9MA 2HYGD 3TQNA 3ZMUA 1LDKB 3E3VA 1IRGA 4U0WA 3NQOA 1KU9A 4HAMA 1HKSA 5HDNA 5J8CA 2KJBA 3QPTA 4G94A 4XRFA 3GFJA 3LA7A 4LFUA 1A04A 4RS8A 2GA2A 3CUQA 3WU0A 1IRFA 4KMFA 4ENJA 3R60A 4AIHA 1REPC 1Z7UA 3ABTA 2M8EA 4HF0A 1L3LA 1XSXA 2ISZA 4UVCA 5A2QZ 4WWCA 4AWXB 5FGMA 1Z6TA 3P9CA 2RDPA 3CLOA 3WTYC 4IJAA 2CO5A 5D5VB 3COAC 4OIOF 1HW1A 3SZPA 2OQGA 4P55A 5ILVA 2P6SA 2KIMA 5D5UB 2LF8A 2D1HA 3RIRA 3V7SA 2DW4A 3MFKA 1O7FA 2HWVA 2CFXA 5F6FA 2XAFA 3L09A 3OOPA 3PFIA 1JXSA 4BHBA 2FQ3A 2XROA 5HVQC 1FP2A 1ZRCA 4BHPA 1FX7A 2L01A 2ISYA 3CO6C 2P7VB 3K9TA 2VE9A 4R79A 2YPRA 1EH6A 1JGSA 2ZMEA 2LF7A 2VT3A 2NRAC 1YTYA 1SD6A 2GQQA 4DQ2A 3J7AO 1TW3A 1J5YA 3E6CC 1KU7A 3ZN1A 5H20A 4M73A 1H9GA 2HQRA 1KYZA 3I0TA 2HKXA 2D45A 3ZN0A 3F6OA 1W7PA 2H6CA 1BM9A 4LB6B 3F21A 3F8NA 3SXYA 3E6MA 4M72A 3LA2A 2QUFA 2A68F 2BE5F 1IW7F 4IVNA 4OINF 2FNAA 2EV6A 3LQQA 1ZYRF 1WI9A 3LWFA 1OKRA 1ZLKA 3DP7A 5CJ9A 1BC8C 1MZBA 4ENNA 1V3FA 2STTA 4O5VA 3KP4A 3T1BA 4MTDA 1Q1HA 4G6DA 1W4MA 4BXUA 2XASA 1LB2A 1IN7A 1PUEE 1SD5A 2M87A 1TNTA 4XLNF 4BQAA 2W84A 2XRNA 2GAUA 2A6EF 2VC0A 4UNOA 4IF4A 1J59A 3L7WA 3FMQA 3U2RA 3TDUC 1XCVA 3WTZA 2HZTA 4IRGA 3F8BA 1KYWA 1ZHFA 4N9IA 3L2CA 3J81K 1R00A 3S2WA 4OIQF 2W85A 5BMZA 3GO5A 3KE2A 5HOOA 4F7ZA 3GW2A 2FEZA 1B59A 4WCGA 2Z3YA 4I2OA 1XB4A 5DEQA 4YIFA 1J0RA 5A2QK 2EFQA 3G73A 1ZGJA 1FBQA 3DF8A 2LKPA 4RGXA 1WKMA 4L5IA 4M9ZA 1FYLA 4KN7X 1BIAA 4HF1A 1NHAA 3WODF 1OPCA 1G3TA 3T8TA 2ZNZA 4MQVA 3GEZA 5K1YA 3SFZA 3J80Z 2QWWA 3ML6A 1SD4A 3GLXA 5LBQA 2F5CA 1X3UA 2IRFG 4KICA 4H0EA 3QU6A 1T0FA 5KVRA 1B6AA 3ROUA 3IKTA 5L3GA 3Q9VA 4CXFA 2V79A 3B02A 3I53A 1WRJA 2VBZA 2D1VA 4HLXA 1RZ4A 3RYPA 3SZTA 4I02A 2FOKA 3IWZA 4IRIA 1ON1A 2F5FA 2J5OA 4GYGA 1BI1A 2RV8A 5E18F 4P9UA 4HOBA 1PP8F 2L4AA 2IJLA 1BBYA 4FT8A 3KP7A 3W6KB 3M8EA 4U0VA 5AONA 2O6GE 2M5WA 3ECOA 3V8JA 2P6TA 1T38A 4LLNA 3KZYA 4BNCA 2V9VA 4FX4A 4JK1X 5FD5A 1FPQA 5LEKA 2ZMEB 4JBAA 3REOA 5BPIA 1D8JA 5E1XA 3D5LA 3F6VA 4OMYA 2MBFA 1G3SA 4RAYA 1S7OA 3HSFA 1W7PB 1ZG5A 4M71A 6PAXA 5ICFA 4IXAA 5E1ZB 2P5LC 4LG0A 2M1BA 1IXCA 1Z1DA 1PDNC 3FX3A 2MLGA 1W5SA 4CDGA 2X4HA 1BJAA 3W6JB 4WK8F 3F3XA 1WSUA 4DNCA 4FX0A 2Z5UA 2Y75A 1YFHA 1YLFA 1H0MA 1HQCA 1YYVA 3GF2A 2K02A 3ECHA 5D6FA 2V1XA 1H9TA 1UB9A 3TOBA 4KNYA 1K7AA 1E17A 1S29A 1HW5A 3CDHA 1QZZA 3BPVA 1ODDA 2FSWA 4A0ZA 2DPDA 1R23A 5E1WA 1MKMA 2HGCA 5E20A 1AOYA 3C18A 2DI3A 1L0OC 1YW9A 1O3RA 3I58A 2EK5A 2RGVA 4AIKA 2JSCA 1G6NA 5BPDA 1RUNA 4Y15A 4LMYA 4A12A 4ZH4F 1DPUA 4AVPA 2K4JA 3HYIA 2OZUA 2O61A 3MQ0A 3TDZC 2MA3A 1U8RA 2UXNA 4Q4ZF 4LK1F 5HLIA 3JAMZ 3I59A 2ZCWA 3HSRA 5H6RA 1K6OA 4O6JA 4I7HA 4L9VA 1F5TA 2DLLA 3IHUA 3LA3A 5LLQA 4P5OA 4WXHA 5HDKA 5CVRA 2LSOA 3MWMA 4HZFA 3I64A 5DDGA 2P5VA 3KP3A 1B4AA 2DU9A 5L3CA 1XGMA 1KA8A 4LGWA 2XAJA 2PEXA 2HTSA 3EETA 2VBYA 4LJZF 4MQ9F 3ZQ7A 1U78A 1MD0A 3P9KA 4HA8A 4N9HA 2PJPA 2HFHA 5FLXZ 3JTHA 1OYIA 2B0LA 1USSA 5HS9A 3F8CA 2OAZA 2VONA 2ETHA 4A5MA 3WTVC 2V1DA 3QP6A 3O6BB 1R1VA 2EFPA 3CUOA 3NEUA 3T5XA 3KP2A 2AXLA 3BY6A 1KQ8A 2LDUA 5K5QA 3ZMSA 4HW0A 5F64A 2BV6A 1XMKA 4YG2F 4LLGF 4B8XA 1W7PD 1LDDA 4IHSA 3KLOA 2DQLA 4PDKA 2M45A 2OZ6A 2H09A 4WXCA 3FZVA 3KEQA 3SHFA 2MD5A 4B09A 1IN6A 4L9NA 2K7LA 2GIVA 4XBFA 3HSEA 3R4KA 4ON0A 3L9FA 3N97A 1STZA 5BS6A 4NQWA 4LG0B 2RC4A 1JHHA 4TV7A 4BH9A 1LEBA 4I09A 1YG2A 4PGGA 4EJTA 3OV8A 3ZMZA 3RKXA 3DKWA 5ILUA 2UZKA 3L00A 3RPQA 2LNBA 3EQLF 1C0WA 2VXZA 4IRHA 2J5PA 2EFWA 1QNTA 2GXBA 1MJ9A 4XSZF 1I1GA 4JQFA 2AS5F 2VOPA 3JW4A 1XSVA 5CVIA 2YX4A 4L5JA 3KZZA 4I0AA 3R61A 2G7HA 2XGXA 2XHKA 4UVAA 2STWA 2BBYA 4HX8A 4U7DA 2OBPA 2EB7A 2NAZA 3CUQC 3BZ6A 3WTWC 2IT0A 3RKWA 1S3JA 4KIGA 2HOEA 1GHCA 2RVCA 5TRDA 1R22A 3JAMK 3LFKA 4HDVA 3FHZA 3DPTA 4EM0B 3VB2A 3WE3A 5JR3A 2Q2EA 4NHJA 2OD5A 5IT3A 4A0YA 1ZREA 5LRSA 3WTSC 5IT9Z 3I59B 5FO5A 3ABUA 5FB2A 5ICGA 1BI0A 1T2KA 3ELKA 3JTGA 3HHHA 1T39A 2CWEA 5D4RA 3GFMA 1LDJA 3IWFA 4MEXF 4KA4A 2RNJA 3E6DA 2Z9OA 1SFUA 4A0XA 1ZAOA 2COMA 1I5ZA 3F72A 3KETA 3WE2A 4I0BA 5FLXK 5FFXA 4ZYGA 2NS0A 2EV5A 3H3ZA 1IF1A 3V7RA 5DD4A 4BHCA 4A6DA 1KQ0A 2A3SA 4ESBA 2DK5A 2XAHA 5ICCA 2MH2A 3D0SA 4OIPF 1S8NA 2UXXA 1U5TA 3BROA 3IRQA 1UFMA 3K69A 4YFXF 2NYXA 5LGNA 4RB3C 4CGZA 3RI4A 4ZYHA 3FXRA 1FZPB 1SD7A 2MLKA 5AIQA 5BQTA 1IN5A 3V8KA 2E7WA 1R5GA 4KIBA 1MDMA 4WX9A 1LEAA 4G7OF 1FSEA 1BC7C 5LEJA 4UXNA 3KEOA 3HOSA 4KMUX 4G6QA 5EEGA 3CUQB 4Y13A 4RGRA 4L18B 4EJOA 3LAPA 4WF2A 1UHWA 2Z99A 4U0YA 4A2UA 3H92A 3E5XA 1QO0D 3K1MA 1ZN2A 2V6CA 1FBSA 5D5WB 2L4MA 4KN4X 4G8XA 5J8FA 2DTRA 1XGSA 3BOQA 3M8FA 2EA2A 4NB5A 1FYKA 1B9NA 4KT5C 1XMAA 2PMUA 2FMYA 1JE8A 4S05A 1UCRA 2KKOA 2ADUA
chains in the Genus database with same CATH superfamily
4KJZA 4Z2YA 5D4SA 2QQ9A 2GZWA 2NOGA 3AL0B 2X0LA 1YS6A 1O3TA 1OYWA 2Y48A 3JSPA 3DFGA 2FJ1A 3GZNB 3RCOA 5C44J 2K9LA 4U88A 3F9KA 1V5EA 2YSRA 2O0YA 2W57A 2LYCA 3S2DJ 1WH5A 3TGNA 4AIDA 2IW5A 1MJAA 3JSOA 2CGPA 2IPQX 3E6BA 3U1DA 2QKLB 4HG2A 4XK4A 1D0XA 3I5UA 2QQAA 4HX7A 3HGYA 2CW7A 5EGOA 5F0FA 2HTJA 3L2VA 5JFRA 2AQEA 3V4GA 3ERMA 2HKOA 4N4OB 1YRNA 4JOMA 4P9FA 1O57A 3MAJA 1YITI 2L02A 4ENKA 2FQ4A 2Y0SN 1WZ2A 2IXSA 1GUUA 3CCJI 3WTXC 1XGOA 1K83J 3OR1C 1YQAA 4PJNA 4D5FA 4OWRB 1XN7A 2FF4A 3CDIA 4M3DA 1U6GA 3LSGA 1J75A 1JT6A 1FSHA 5FD6A 3WU1B 4G7ZF 2HQNA 3FKIJ 3V8LA 2WAEA 3CCLI 2FBKA 1FBUA 4ZZDA 4HDUA 2DFHA 3OYMA 5DM7F 1W5CC 5LGUA 1U2WA 3CO7C 2QENA 3F8FA 5JHUA 5AIPA 1QQIA 3ZP5A 2LG4A 2PLYA 2E2JJ 3BPXA 4AYBA 2EINH 2Q2EB 2DYSH 2UWMA 1WJBA 3Q9SA 4UUSB 3ERED 1VTNC 1G2HA 2JRTA 1B1BA 1MBJA 2QVOA 4BAYA 1ETKA 2FA5A 5CVUA 1IC8A 2KISA 1VQPI 1SAXA 1O3QA 1D3YA 5KCMA 4JX6A 3WHCA 1QVTA 5B66C 1FC3A 1T0FC 5LFAA 2WV0A 4KDPA 1N78A 4M9XA 2HYFA 5J4YA 1Y1WJ 3TBIA 1RR8C 4R8HA 3LFUA 5EEAA 4B4CA 4ZDPA 1IUFA 2V9PA 3G3ZA 4XRSG 2XGEA 2VQGA 2E19A 3I71A 3I55I 3HUGA 3I4PA 3CJQB 4B44A 3IV5A 1AU7A 2BZTA 3K4MA 4LG3A 3A01A 2MW8A 3E5UA 2M7AA 3AG2H 3GVAA 1W36C 1X1AA 3T8RA 1HDDC 3GXOA 1W5TA 1J7KA 1PVEA 2RN7A 1HSJA 2L2OA 2IAIA 1ON2A 1U9NA 1B72A 4RGSA 1VQNI 2OQRA 3RPUA 1TQPA 2A6HF 4U7BA 4CH7A 3IRRA 5M5YJ 1ULYA 4BE2A 1ZRFA 2CH0A 1VQ9I 1WHUA 2XB0X 3HRUA 2VT2A 3IAS2 1T6SA 1Z91A 5HLTA 3HEFA 3HPHA 2K27A 4W1UA 5L3EA 4IHTA 1QPMA 5KNLA 3BTIA 1H8AC 3DXJF 4MEYF 3VSKA 5CLSA 4BUPA 3AAFA 2CUFA 2VKEA 4IHWA 4HLYA 5CYVA 1U5TB 5D8LB 1T98A 1BOAA 3OIPA 3DV8A 5DM6F 5GPAA 3CCUI 4E70A 2CSOA 3PFYA 1DP7P 4RM2A 1EF4A 3WTTC 2JVHA 2QZ8A 4HRIA 4RB0A 3GZ6A 5J1UA 4FCYA 4X6AJ 4G12A 1I3QJ 3DPLC 1Z6RA 1E2XA 4EMSA 3HB9A 5BOXA 2M0CA 2ZJQF 3ZPLA 2ZSIB 4BY7J 1SVLA 4FASD 3MZYA 5DYMA 4BJTA 2A5YB 1P7IA 2GOXB 4CCLA 1HC8A 2QBYA 2BGCA 4EV0A 2VPRA 3WGIA 3F22A 2CUJA 4M3EA 3RDIA 3QU3A 3DQVC 3BWGA 4OMZA 1R1TA 4UUTA 3LSTA 4MFDA 4EQQA 1KONA 1Y1VJ 2ZKZA 1OR7A 3HRMA 2PBIA 2FMLA 3FM3A 1DUXC 4B48A 4RMNA 2IP2A 3J80K 3BZKA 4BE0A 2B63J 3CJTB 3ABMH 3DBRB 1FMVA 4L0ZB 3CP8A 3M1EA 2CU7A 1PP7U 1V5GA 4LLLA 1PYVA 3OL4A 4PCQA 5HDGA 3LL7A 2CJJA 3BG5A 3BP8A 2HXOA 5LRRA 1R49A 1FOWA 1TLHB 2XF6A 5DS9A 5CKTA 2L7KA 2JT1A 3W2WA 3PO3J 2WWYA 4ITVA 2EBIA 4RA2A 1WJDA 1YOVB 3VEPA 2MABA 5J3LA 2QCOA 2V1NA 2ZO4A 4MNUA 4A69C 3R0AA 3UNGC 1DQUA 1YE9A 4S0HB 2DTZA 1YW8A 1LVKA 3A0BC 3MVPA 2ZXIA 5HLGA 2H1LA 3RSNA 2L3DA 5TISC 5BNGA 1ZLJA 3ABLH 3P9IA 4QWQA 1MGTA 5JVGF 4GYIA 1RETA 4C2TA 3PNYA 1M1EB 5B1AH 3ZMDA 2Z33A 2R7TA 2YX7A 1J9IA 2HR3A 3HPGA 4G9YA 4YIIA 1TNSA 4MGRA 2E1MC 3HTSB 2L9VA 2JRMA 2K9MA 2OUMA 2P4WA 4M6VA 2PMZA 5DCMA 2TRTA 1ZKGA 2KIQA 2YS9A 2XV4S 1VI0A 4BGDA 3H1CA 3VFZA 3OYAA 4BL0B 1BW5A 2PN6A 1HOMA 4EM2A 2KMUA 2VN2A 3K10A 5EGOB 2M30A 3K6GA 1POGA 4YRVA 3HOVJ 1K6YA 4IL6C 2A61A 1JKPC 4DYQA 3IKVA 3OYJA 2NNYA 3T0YA 2BXZA 4F93B 1YRNB 2FBIA 3FWEA 3W3CA 1MBKA 4GGGA 3L2RA 2VOOA 2CUZA 1JUSA 4HV6A 1FT9A 1KZHA 1JTYA 5ED4A 1V4RA 2W24A 2XAQA 1RC9A 3LNQA 4D7MA 1IN8A 4UHTA 1P2FA 4A3BJ 1XDUA 5HS7A 2B7EA 1Y0NA 4L0YB 4BQOA 4B43A 1HW2A 4XR6A 1ZGAA 1PJRA 3G71I 4CHUA 3TO9A 2R7FA 2FUG2 3GYHX 4HNTA 2GIZA 2BOLA 3SEZA 1OYYA 5JLWA 2HQ5A 5DD8A 2JPBA 3EYIA 1USTA 1HXDA 3L2WA 3P7NA 2VKDA 3J81Z 1B8IA 2Y9YA 4AUXA 1X2NA 4QSHA 2DA2A 3QOEA 1HDPA 2KZGA 5D8KB 4ZZLA 5IP7J 5FLMJ 4UB8C 1F9NA 2KDOA 1QBJA 1RIOH 3H3UA 2HDCA 5LHIA 2WTEA 2ZXWH 3MZHA 1IDZA 4LIVA 1QU3A 4RLQA 2WC2A 4RM3A 5LHHA 5JLXA 2NOJB 5IPAA 3KFWX 5K7ZA 2W00A 1ETQA 1R71A 3FMSA 3K4CA 1HSTA 4NNJA 4UV9A 4MHGA 2LBFA 4ZC3A 3F23A 3G1OA 4C2UA 4IEJA 2Z2SB 3ZMVA 2IVMA 3DEUA 4MLOA 4O3MA 1TBXA 3FIWA 2ESHA 4MTEA 5JI6A 4L9JA 1YS7A 4ZYEA 3EUHA 4DZPA 3PSFA 3FISA 1O7LA 5M5WJ 4V19K 2K3FA 2E7XA 2FRHA 4IPAA 3A01B 1SMTA 4HQEA 2P8TA 2ESNA 4IO9F 4A6EA 1U0JA 1QVUA 3MEXA 3FBNB 5HS8A 2K86A 1BR4A 3BR6A 1CGPA 3BC8A 1B72B 3RQ4A 3SEQA 2HPMA 2BYVE 3GLLA 5D5XB 3GTPJ 1JHFA 1ZTRA 2D2WA 2VC1A 3F0CA 2RQPA 4PZJA 2K9NA 4BXFA 5FLVA 3ASNH 4FHTA 5K5RA 1HBXG 2CQXA 1IAWA 2V1UA 3E1SA 4HQMA 2EWNA 1APLC 2F5EA 3WGGA 1GVJA 3TKYA 1RUOA 1NTCA 4B3XA 4XMYA 3HOTA 2EFOA 1KGSA 1AKHB 1H88C 3QP5A 3EDPA 3SQNA 1J2XA 5DTDA 1YHQI 2R7RA 2NS8A 2GA1A 1W0UA 3HXLA 4M3BA 1MBGA 3BG7A 1XGNA 5F27A 3K2ZA 2E1MB 1IZ1A 3CTAA 1IXRC 1KQ9A 2X9DA 1U8BA 3QPHA 1FJLA 4UVBA 1QPIA 1WI3A 3QRFF 3DBHB 3VPRA 3E0JB 3GFLA 3KZIC 4CZZA 5LGTA 2YU3A 4P96A 3ZQCA 2LRDA 3I54A 5CPRB 1N75A 1R5HA 4RB1A 2ZNYA 3SZGA 3C7JA 2EA4A 1UJ8A 1DGWY 2X48A 3BCAA 2LP0A 2QBYB 5M3FJ 3IL2A 1BI2A 1R1UA 3OYFA 2X6XA 4DGWB 2R7QA 4HBLA 1TWHJ 2K85A 4M6YA 4HX4A 4Q48A 1YW7A 2YR2A 4V2FA 5HLHA 1XTAA 5E3MA 3GTKJ 1P92A 4AC0A 4J19A 3ISPA 1IXSB 1MW7A 2P0WA 4ETSA 1IUYA 3M7GA 3K2AA 1XX5A 2R4GA 2PJRB 4CO8A 4WXDA 1DDNA 2M0MA 1F1ZA 3BR3A 4UV8A 1TWAJ 4QPOA 2BEOA 3CESA 2EIKH 3DU6A 3FKJA 2VE8A 2P81A 1TZLA 1RNLA 3AL0C 2H94A 2XUBA 1FMWA 2EZIA 1LJ9A 4EATA 5K5OA 4ESJA 2NVQJ 4ESFA 1YI2I 3FMRA 4KIFA 3OYDA 3K0LA 2XIGA 3DEEA 3MCZA 1D5YA 2HVRA 1S6LA 3GBGA 2OCEA 3QAHA 3DU5A 3PL8A 2G9WA 3EYYA 4EJWA 1YJ9I 2ZFWA 3PUBA 5K7HA 4CICA 1JI8A 2ZJPF 2VJ4A 5E8GA 2VODA 1EH7A 5F08A 2R7VA 2TCTA 2CG4A 1Z7LA 2FXAA 2VBXA 3CJNA 2DFIA 2KFDA 2XF7A 3LAJA 1CF7A 5IYDJ 1R4MB 1DGRM 4N0BA 4EVIA 1ZARA 3KP5A 4KUMA 1R9TJ 4RAZA 3IC7A 3HRTA 2JZYA 2KIUA 2QLZA 5LD2C 1HKTA 1ZH5A 1JKQC 4BS9A 2E5ZA 3JRCA 4A3EJ 2DAOA 5C4JJ 2GWRA 2OC6A 5J47A 3TOAA 5J6XA 3HIFA 1D8KA 2VB6A 4Q5SF 2CMPA 5DCMB 2R3SA 1IJWC 5B5EC 5IOZA 1P4WA 3CCRI 5H6QA 3BR1A 1Y0UA 4GO1A 4G7HF 4OU0A 2QSGX 3DLLF 1XG1A 1MH3A 2G7UA 2A07F 2P5KA 4ZYAA 1IRZA 2VKHA 4E6KG 1TTYA 2FNPA 2PI0A 4DYCA 1UAAA 2I8DA 3HRSA 1AHDP 4PFPA 1H89C 2EZKA 1V5FA 3HKZA 1QZYA 2KPMA 4LB5A 2F48A 1TT5B 5ERIA 1WJCA 3S3MA 3PM1A 2HEOA 2BW3B 2HS5A 4R1HA 2PMHA 4U87A 2FU4A 3BJOA 1FIAA 4M74A 4Y17A 1LVAA 1EH8A 5F1JA 4S04A 3UKGA 1BI3A 4YFNF 2X85A 4J00A 3PQKA 1R58A 2NNNA 3GTOJ 5K7FA 1SFEA 2NXNB 2HI3A 3FBIB 1SFXA 2E34A 3E97A 2KJCA 1JKOC 1P6RA 3K4LA 5DCFA 3C2BA 1KU2A 2ELHA 3V42A 1ONVA 2EV0A 3QOPA 3TO6A 3WG9A 1K78A 3H5RA 2JA6J 3E5QA 3HTUA 3K1PA 2JA2A 4I01A 2DCEA 2XVCA 2IA2A 1FP1D 2IBDA 4IQJA 1G3YA 5J1RA 1MH4A 3B73A 2LBFB 4ZYDA 2I10A 4CYCB 5CVJA 1XDSA 3H9QA 1D0ZA 4L9TA 4HYEA 2EFNA 2IA1A 1R7JA 1GLNA 1P4AA 3LSPA 4NC6A 4B1RA 3S2HJ 3FXUA 4ASNA 3RPUD 5GTIC 2PFBA 3OSFA 1VQMI 3BJAA 1Z05A 2MH9A 3WU2C 4XRSA 3H3VK 1G4DA 3OYEA 3HOWJ 1Z0XA 1QZEA 1MBEA 3FXQA 2DK8A 1U5TC 2O8XA 4YIRX 1UG2A 1MMAA 3WGHA 2EH3A 3K7AJ 4D0PA 2BY2A 3F8MA 1Z9CA 5LHGA 4AYBN 3OYCA 5EJCA 2RKHA 1S7AA 1K4TA 2Q0OA 2DXIA 1QHHD 1W1WE 5J4VA 4FETA 4CYDA 3V7CA 4XKWA 1AWCA 4ZDOA 1LFBA 1LNWA 1UHMA 5DUKA 2R7XA 1MJBA 3CCMI 1FEXA 2CQKA 2X1DA 4K2EA 1MNDA 3GWZA 5FFZA 3N4MA 3W6VA 1VQKI 2L5QA 4GCVA 4LK0F 2O3FA 5M3MJ 3HHGA 2OU2A 4AIJA 2KL4A 2EJRA 4C30A 3WHBA 1RI7A 3BTLA 2VBWA 4E7ZA 2C6YA 3PQJA 3HZJA 1JKRC 5EF6A 1YJNI 1UELB 2LR8A 2W25A 3C1DA 4HNUA 2DDAA 4Q47A 3K1NA 3VYTB 2CYYA 3K4JA 1R5ID 1OFCX 2JPCA 4D9JA 2EIJH 4KFCA 2JA5J 5IT9K 2ID6A 2EIMH 4RGUA 1G3WA 1F4KA 3CMYA 2L54A 5D6EA 5EG0A 2HDDA 1FTZA 4I98B 2KRFA 4HPQA 3QPSA 3FM5A 2XAUA 4C3HJ 2ZJ2A 3GFIA 1BIBA 3R6SA 1BN5A 3R0JA 2VQLA 1ZELA 4FE4A 1SVMA 1TQMA 3DTEA 3GUDA 3LQRA 2RAEA 1TW2A 2VQCA 1O3SA 1FOKA 3M3YJ 2F5VA 2K9QA 1OCZH 1XCBA 2ZBKA 2B9SA 2DBBA 1I1SA 3FF5A 4YFKF 4XONA 4Y52J 2Y30A 1E0EA 1FWZA 2XKPA 4QLCU 1XD7A 4A5NA 2CQNA 5E8IA 4BDYA 5L3FA 5L3BA 5F04A 3GZ5A 3VODA 2QQBA 2KIFA 3K4KA 3OOUA 2VASA 3K70D 3CMEI 2BHZA 2MC3A 2E1NA 2DJNA 3RTRA 2EZHA 2QYOA 2DPUA 2H8RA 1LQ1A 3Q0UA 1QRYA 2QM3A 5FRNA 2M3AA 4F3QA 2WAQA 5F1RA 2F4OB 1BA5A 2CUEA 3RJPA 3O2PE 1OMIA 2OF7A 2Y0SA 3DPUA 2EQRA 5ILSA 1PUFA 4XSXF 1IV6A 1MBFA 4HEA2 3S1RJ 2WV1A 1ZG1A 2Q8KA 2ELJA 3WTUC 2FD5A 2XRLA 5E17F 2IA0A 1CF7B 4GXOA 1HLVA 3HJEA 4KYWA 4OIRF 3JRIA 2FBHA 3OL3A 3O8GA 1KU3A 4II3A 1BJZA 3RKYA 1YO5C 3D1NI 3N05A 1VFCA 2PG4A 5L3DA 5KK1A 3ULQB 3DWLE 1V54H 4D7NA 3G6EI 1GDTA 4Z6YA 4KISA 3DCFA 4XKCA 3ZR8X 2ZXJA 3C2HA 2ACJA 3KP6A 2ME6A 2F2EA 2OA4A 3H0DA 4J01A 2XAGA 1SMYF 3CLQA 1OCCH 3Q0VA 4YELA 1MDMB 3M9AA 2FE3A 2VL8A 2ZJRF 4PUSA 2XGCA 2QKMB 3C3WA 4OOIA 4GFBA 2UUZA 2DT5A 4EGYA 1WWXA 1ZG3A 2GXGA 1VQ5I 1FNNA 3O3KA 4Y4RA 4E7HA 3Q5FA 1FY7A 2HVQA 3AFHA 3TW6A 1Z67A 1OCOH 2TDXA 4A3DJ 1IDYA 2W4SA 2MSYA 4PGHA 3ZQHA 4KITB 2DA1A 5ICEA 3NRVA 3OYKA 2BY3A 4JP0A 4HV5A 4DBQA 1ZRDA 2A05A 5JVTA 1I27A 2Y0MA 2PQ8A 1GXQA 1NK2P 2F5DA 4RLFA 2E1CA 1VQLI 2R7WA 3KYCB 5E3NA 2F4IA 5EEHA 4D5CA 3CC7I 3BDDA 1WH7A 1MMGA 4XM3A 3MKZA 2M7BA 2P7CB 1QGPA 2DO7A 1YIOA 4AVZA 1I50J 4EM1A 4ENMA 2XC7A 3KCCA 4AD9A 3HBLA 3QPLA 5CVVA 3HC7A 3QODA 3PIPF 2DOEA 1K78B 2R5YA 1WQ2A 4RB2C 3GX4X 2OJED 1XSDA 1DP3A 1WFXA 4EJUA 4PSWA 4F91B 1HCRA 2K4BA 1HKQA 1HA8A 1X19A 5CQGA 1K79A 3VOEA 1RKTA 5TJJA 4BBSJ 1EV7A 1UMQA 2KRCA 4QPQA 5GPCA 1U3EM 2WAFA 2JMWA 1I6XA 4F92B 2H6BA 5DUIA 1WJEA 4M6XA 4M9SA 1MIJA 3ZQGA 2JTVA 1G59A 1X1PA 1DPRA 4BYYA 1GXPA 4DW6A 2R7DA 1D5VA 3KLNA 2ECBA 1IN4A 3O8HA 2W7NA 3JRDA 4ABZA 4AM3A 2KZVA 1T56A 3BQZA 1IO2A 2CW0F 2O03A 3H36A 3U9GA 4HF2A 4XLPF 1EJ9A 1FLIA 1SANA 1Y56A 4LD5A 4XN3A 2V7FA 3RYRA 3ZQFA 3TO7A 2X6YA 3A02A 3BJ6A 1FYMA 1TQIA 2BY0A 1BOBA 4IHXA 2H27A 2A69F 1TT0A 4UUVA 1R36A 5DV5A 4EGZA 3H35A 3TL4X 2XKOA 3H9GA 4RAFA 3ZMTA 4LITA 1P4XA 2DQRA 4EJVA 1B9MA 2HYGD 4IZZA 4QIWN 4BJ5C 1P7JA 3TQNA 3ZMUA 1LDKB 2Y2ZA 3E3VA 1IRGA 1AA7A 4U0WA 1ENHA 2IGMA 3NQOA 4I76A 3PIOF 1VNDA 4XLFA 1KU9A 1OR7C 4HAMA 1Z21A 1HKSA 4CCOA 5HDNA 2GLOA 5J8CA 2KJBA 3QPTA 4IOCF 4G94A 4ZDLA 4XRFA 4RBOA 3GFJA 2LD5A 3LA7A 4LFUA 3S3OA 1A04A 3CCEI 1RRJA 3JCUC 4RS8A 5EG0B 2R5ZA 2GA2A 3NARA 3VDXA 3CUQA 3WU0A 1VQ4I 1IRFA 4KMFA 5FROA 4ENJA 2K9SA 2E2IJ 2GM4A 2K3PA 3E7LA 3R60A 4AIHA 3EUAA 2E35A 3JRFA 2RREA 5IOYA 1REPC 1Z7UA 2R7SA 1WCMJ 3DLAA 3ABTA 2M8EA 4HF0A 1L3LA 4GRIA 1XSXA 2ISZA 3FXJA 3MZ8A 3B6AA 4UVCA 2JA7J 4E7SA 5A2QZ 4WWCA 2CRGA 3K70C 2R7ZJ 2DMUA 4AWXB 5GAGJ 4A93J 3VYRB 3CZ6A 3C2GA 4JX4A 5FGMA 2MC4A 4L5EA 1HF0A 1Z6TA 1A35A 3MKYB 4HNVA 3OYLA 2VQHA 3BTJA 3P9CA 1F36A 2RDPA 3CLOA 5FKOA 3WTYC 4IJAA 2CO5A 4NUBA 5D5VB 3COAC 3HUGB 4CZCA 4OIOF 1HW1A 5E79C 3S93A 2VLAA 3SZPA 2OQGA 2LVSA 4P55A 3FXOA 5ILVA 5C4XJ 2P6SA 2KIMA 2R93J 1VQ6I 5D5UB 1PUFB 3QQAA 2LF8A 2D1HA 3RIRA 3V7SA 4XQFA 2DW4A 4XLAA 4E4HA 1NH3A 3RKQA 3MFKA 1O7FA 2HWVA 2CFXA 2LY9A 5F6FA 2XAFA 3L09A 3FDYA 3OOPA 1RPWA 3PFIA 1JT0A 2HOSA 2XB5A 2RQQA 1JXSA 4BHBA 2FQ3A 4FTHA 4A3GJ 1XC5A 2XROA 5HVQC 1FP2A 1ZRCA 5KAIC 3MKWB 3S14J 1R4NB 1ETVA 4BHPA 2A5WA 4FE7A 1FX7A 5GTHC 4BY1J 2OPTA 2MGQA 2L01A 3A2KA 4NDLA 2ISYA 1JJ6C 5EZGA 2E2HJ 3CO6C 4JYKA 1Q1VA 2P7VB 1X3WB 3K9TA 2VE9A 1JGGA 5FJ8J 4R79A 4XIDA 4E7JA 2YPRA 4A3JJ 1EH6A 1ZGWA 1JGSA 3AG1H 5F0CA 1X2MA 5IP9J 2HOAA 2ZMEA 2LF7A 2VT3A 2DOAA 2NRAC 3U21A 1YTYA 3WG7H 1SD6A 2GQQA 2AO9A 2VIXA 4DQ2A 3J7AO 2CV1A 1TW3A 1J5YA 3E6CC 3BT9A 1KU7A 5KAFC 3CCYA 3ZN1A 5H20A 1ZK8A 2KDZA 4M73A 4C9YA 1H9GA 1SFOJ 2HQRA 1KYZA 1WPKA 2HKXA 3I0TA 4LOCA 2Q1ZB 5B1BH 2D45A 1R6RA 2LC2A 2IEKA 3B6CA 1TC3C 4FISA 3ZN0A 2ID3A 3OYHA 1LUJB 3F6OA 1W7PA 1VZ0A 3HOZJ 2H6CA 2JUGA 2VJ5A 2LK2A 4X0GA 4UUSA 3S17J 2Y69H 3PNVA 1BM9A 4LB6B 2L9RA 3A4CA 2K5CA 3EUHC 4MIMA 3F8NA 2EILH 3SXYA 3E6MA 4M72A 3F21A 3LA2A 2QUFA 2A68F 1OJLA 2BE5F 1IW7F 2W1OA 4IVNA 4OINF 2FNAA 3OIOA 3GTJJ 2EV6A 3LQQA 1ZYRF 2KLOA 4XLEA 1WI9A 4PJJA 3D5RC 3LWFA 1A36A 1OKRA 3OSGA 1MNEA 2E71A 2KP6A 1BL0A 1ZLKA 3ZOBA 2OTLI 3GTGJ 3DP7A 5CJ9A 1BC8C 2VI6A 1MZBA 4BQNA 2D5VA 3HKZN 2V26A 4ENNA 1V3FA 4GDFA 2STTA 4O5VA 2ECCA 3KP4A 4NBQA 3T1BA 4MO7A 4MTDA 3S8PA 5IY5H 1Q1HA 4G6DA 1A6IA 2L7FP 1W4MA 4BXUA 2XASA 1LB2A 1IN7A 1PUEE 1SD5A 2M87A 4XLCA 4C3JJ 1TNTA 4XLNF 4BQAA 2W84A 3SFIA 1ITYA 2XRNA 1SC7A 1D1CA 2GAUA 2A6EF 2VC0A 3OIQA 1OCRH 1EA3A 4UNOA 3NWTA 4IF4A 1J59A 3BZCA 3L7WA 3CMMA 3FMQA 3U2RA 3TDUC 3A0HC 2CV0A 1E3HA 2LKXA 2LTPA 1XCVA 3WTZA 2HZTA 1ETOA 3HL2A 4IRGA 3EUKL 1GT0C 2VKVA 3CP2A 3F8BA 1KYWA 2LLKA 2LKSA 4XL9A 1ZHFA 3NWSA 4N9IA 3L2CA 3KYDB 3J81K 1R00A 4C2MJ 3S2WA 5HNHA 2ZC2A 5IYBJ 4OIQF 2W85A 1LPQA 3BG3A 2JQ7A 5BMZA 3GO5A 2BY1A 3PNTA 1N25A 3KE2A 5HOOA 3AG3H 4A3MJ 4F7ZA 4CUGA 1W0TA 2LOOA 2M8GX 3GW2A 2IGOA 2FEZA 3SJMA 1B59A 3OYIA 1BW6A 4WCGA 2Z3YA 2PX9A 4F52A 5F0HA 3W2VA 1A31A 4I2OA 1XB4A 5FKMA 5DEQA 1B8IB 4YIFA 1J0RA 5A2QK 4OAZA 3OS1A 1ETYA 5C3EJ 2EFQA 4A3FJ 3FXLA 3G73A 4XLHA 1ZGJA 3I4MJ 1FBQA 3DF8A 3G1MA 1V55H 2LKPA 4RGXA 4QTRA 2M34A 1WKMA 2X51A 1MSFC 2YU9J 3U1KA 1T8IA 4L5IA 2LY2A 2V4JC 1YX3A 1JUMA 1FOYA 4M9ZA 1FYLA 4KN7X 1BIAA 4HF1A 1E3PA 1NHAA 3WODF 1OPCA 1G3TA 1MMNA 3T8TA 2XSDC 2XF5A 2ZNZA 4MQVA 3GEZA 5K1YA 2DFFA 3SFZA 1MNMC 3J80Z 2QWWA 3ML6A 2VJJA 1SD4A 1TWCJ 3PJRA 3GLXA 1IV8A 4AU7A 1SAUA 5LBQA 1UZCA 2F5CA 1X3UA 2IRFG 4KICA 4ZJZA 4H0EA 4XKBA 3QU6A 4XORA 1T0FA 1MSEC 5KVRA 2ZB9A 1B6AA 2XGDA 5GADJ 5KHDA 2EPFA 3ROUA 2XPVA 3LSHA 5FKNA 1OCTC 3IKTA 5L3GA 3CCSI 3Q9VA 5GAEJ 1X1BA 4CXFA 2V79A 3TP0A 3B02A 5E3LA 3FXKA 3I53A 1WRJA 2L7MP 1YJWI 2VBZA 2YUSA 9ANTA 2D1VA 1MMSA 2WB1A 5H2FC 4HLXA 1MMDA 1RZ4A 3BR5A 3SDGA 3I3LA 2QA4I 3AG4H 4B47A 3RYPA 2O9LA 3SZTA 4I02A 2FOKA 2AQFA 3S1NJ 3IWZA 1ETXA 2VJIA 3VYUB 4IRIA 1ORKA 1ON1A 2BXYA 2F5FA 2J5OA 3BQYA 4GYGA 1BI1A 3TW7A 4A3KJ 2DMPA 1Y6IA 2RV8A 5E18F 2E5NA 4HOBA 4P9UA 1PP8F 2L4AA 2HDWA 3PO2J 2IJLA 4IOAF 1BBYA 1LFUP 4FT8A 3KP7A 3W6KB 3M8EA 4U0VA 5AONA 2ZXHA 4E7KA 2O6GE 2M5WA 2WAQN 3ECOA 3V8JA 2P6TA 5HNFA 1T38A 4LLNA 3KZYA 3ASOH 1ZR4A 2R7OA 4BNCA 2V9VA 4FX4A 4JK1X 3S32A 5FD5A 1FPQA 5LEKA 2ZMEB 5B3SH 4JBAA 1I6HJ 3REOA 5JHFA 3ZQIA 5BPIA 1D8JA 1I39A 3DTKA 2HQAA 3KIOA 3D5LA 1YX5A 3GCMA 2HYJA 4LIUA 5E1XA 2HVSA 3F6VA 1G8XA 3TP3A 3GMEA 4OMYA 2MBFA 1G3SA 4RAYA 1S7OA 3HSFA 1W7PB 4I6ZA 1ZG5A 4M71A 1TP4A 6PAXA 5ICFA 2CQQA 2OV7A 4IXAA 2MYSA 5E1ZB 2P5LC 1Z3XA 4LG0A 1A5JA 2DA3A 2M4KA 2M1BA 1IXCA 1Z1DA 2HXIA 4JX5A 2JA8J 3A1YA 1TWGJ 3ZRGA 1PDNC 3MN2A 3FX3A 2MLGA 1W5SA 3OR2C 4CDGA 3CCQI 1NK3P 2X4HA 1BJAA 3W6JB 4WK8F 1S5LC 3F3XA 1RR7A 2IS6A 1WSUA 4DNCA 3I9V2 4FX0A 3HDDA 3S15J 2Z5UA 2Y75A 1YFHA 1YLFA 3M07A 1H0MA 3KX2A 4DYRA 1HQCA 1YYVA 1FOXA 4RDUA 3GF2A 2K02A 2XDVA 2M2EA 4XKVA 3ECHA 4FQGA 2NVTJ 5D6FA 2F6CA 4CCJA 3I4NJ 3D5SC 2V1XA 1H9TA 2BVMA 2MG4A 3RZOJ 3CJRB 4PJLA 4A3CJ 1UB9A 1A6QA 3TOBA 1JJ8C 4KNYA 1K7AA 1E17A 2ELKA 1S29A 1HW5A 3CDHA 1QZZA 3LSJA 3BPVA 5FKKA 1ODDA 2FSWA 4A0ZA 2DPDA 1R23A 2M4GA 4UY8I 5E1WA 1MKMA 4IHVA 3M1CA 1AKHA 2JK3A 2HGCA 1S7EA 5E20A 1AOYA 1D0YA 3FHNA 2K40A 4CCKA 2CV2A 2IGNA 1E3OC 3M4OJ 3C18A 2X6WA 2DI3A 1L0OC 1X1DA 1YW9A 1O3RA 3I58A 4BEHA 3JRGA 2EK5A 2RGVA 1D1BA 5GP9A 2FOWA 1Y8QB 4DZJA 1UHSA 1P9QC 4AIKA 2JSCA 2AXTC 1G6NA 3OMYA 1X4OA 5BPDA 2DJIA 1RUNA 4Y15A 4LMYA 4A12A 4ZH4F 1DPUA 4AVPA 2K4JA 3HYIA 2MD0A 1ACIA 3CD6I 2OZUA 5GAHJ 2NVXJ 2F4MB 3MQ0A 2QSFX 2LFBA 3H5AA 3J7AY 2O61A 3TDZC 2JUCA 2MA3A 3DTIA 5J40A 4HSRA 1U8RA 4BKXA 3W2AA 3UR3C 1U9OA 2PMZN 2UXNA 4Q4ZF 4LK1F 5HLIA 3JAMZ 3I59A 3QWLA 2ZCWA 3HSRA 5H6RA 1K6OA 4O6JA 2XPWA 1VQOI 4I7HA 1TL8A 1N77A 3PUFA 4L9VA 1O4XA 1F5TA 2PJRA 2DLLA 2X6OA 3IHUA 3LA3A 3QYFA 5LLQA 4P5OA 3LSRA 1X1CA 2QF7A 4I99C 4HSTA 4WXHA 3BR2A 2DMQA 2DA5A 5HDKA 4IHYA 3MMYB 4BQQA 2LREA 5CVRA 2LSOA 3MWMA 5EDNA 1S72I 4HZFA 2OTJI 3I64A 4ANJA 5DDGA 2P5VA 3KP3A 3VSLA 3ESWB 4YEJA 4KT6A 2GBYA 1B4AA 2HNHA 2JWTA 2JVGA 2JSPA 2DU9A 2R0QC 5L3CA 1XGMA 1KA8A 4LGWA 2XAJA 2PEXA 1NG7A 3CF5F 3CCVI 2HTSA 2O7OA 2ZSHB 3EETA 3HOYJ 1DU0A 1F43A 2VBYA 4LJZF 3LSMA 3JRHA 4MQ9F 2KHMA 1XPXA 4RAGA 2WADA 1GV2A 3ZQ7A 1U78A 5J1YA 3CMAI 1MD0A 2E60A 4A3IJ 4PSXA 3P9KA 4HA8A 3ZQLA 1X4PA 3CDLA 1Z3YA 4N9HA 4X1EA 3ABKH 2PJPA 2E36A 3MD2A 3P5JA 2DT6A 2HFHA 5FLXZ 2L9NA 3JTHA 1OYIA 2B0LA 1USSA 1CQTA 3QYBA 5CQEA 5HS9A 3F8CA 2HOTA 4Y3OA 4CCMA 2OAZA 3CF2A 2VONA 5EZHA 2ETHA 3HOXJ 4M3FA 4A5MA 3WTVC 3LSKA 3IH2A 2V1DA 3QP6A 3O6BB 1R1VA 2EFPA 1FTTA 3CUOA 4BU2A 2DFEA 4H4KC 3NEUA 3T5XA 3KP2A 2L7ZA 1LE8A 2QQ8A 2OCCH 3GTMJ 2AXLA 3BY6A 2QGUA 1SVOA 2LDUA 5K5QA 5E3OA 1KQ8A 4MFEA 5HODA 3ZMSA 2HPIA 4HW0A 2QSHX 5F64A 2BV6A 1XMKA 4YG2F 4LLGF 4B8XA 1W7PD 2HU9A 1LDDA 2W48A 4XN0A 4E7IA 2LH9A 2BW3A 4IHSA 3KLOA 3K4NA 2E1OA 2DQLA 4PDKA 2M45A 2OZ6A 1T08B 2H09A 4WXCA 3FZVA 2L0KA 3KEQA 3SHFA 3J7YJ 2I5UA 3OYNA 2MD5A 5FKLA 4B09A 2N8GA 1IN6A 2M9HA 4L9NA 2K7LA 2GIVA 4M3GA 3L1PA 4XBFA 3HSEA 2BHYA 1VF9A 2DT7B 3R4KA 4CA0A 2HZDA 4ON0A 3L9FA 3BR0A 4Y7NJ 2R7UA 3N97A 3KEYA 1STZA 5BS6A 4NQWA 3OY9A 2WY7Q 2IS1A 4ZTFA 4LG0B 2XSJC 2H8WA 3ZCOA 1OLTA 2FX0A 1X3ZB 2RC4A 1JHHA 4A3LJ 4TV7A 2X1EA 4BH9A 2IS2A 4BJ6C 1LEBA 4I09A 3BCBA 1YG2A 4B3AA 4PGGA 4OAYA 4EJTA 3VYSB 4CYCA 1OQYA 3OV8A 3ZMZA 1GVDA 1DU6A 1T95A 3RKXA 3DKWA 5ILUA 2UZKA 3L00A 3RPQA 2ICWG 2LNBA 3EQLF 3JREA 1C0WA 3CC4I 1NG6A 2VXZA 4IRHA 2J5PA 2DOFA 2EFWA 4PFOA 1QNTA 2GXBA 1MJ9A 3S1QJ 4XSZF 4XOTA 1I1GA 4JQFA 2W82A 2AS5F 2VOPA 4BE1A 3JW4A 3Q0WA 4BACA 3CC2I 1XSVA 2DMNA 3K4BA 5CVIA 2DODA 2YX4A 3IAM2 4L5JA 3KZZA 3GTLJ 3DBLB 1ZQ3P 2ZFUA 4I0AA 4F55A 3R61A 2G7HA 2WBMA 4XOPA 3KYLA 2XGXA 2XHKA 1EKEA 2DYRH 4UVAA 2STWA 1WJAA 4W97A 1Y8RB 2Z1DA 2WA0A 3RZDJ 3S1MJ 2BBYA 4HX8A 2NVUB 3G2BA 2CS3A 2DN0A 4Y33A 4U7DA 3OS0A 2DA6A 2OBPA 4V2GA 2EB7A 2NAZA 4XICA 3CUQC 3BZ6A 3WTWC 4N4NB 3PSIA 4BEHB 2IT0A 3RKWA 1S3JA 3NAUA 4PJ0C 4KIGA 2X1CA 1WJ5A 2HOEA 4II2A 1IG7A 2COBA 1GHCA 2RVCA 1BR2A 2GOMA 5TRDA 3EPZA 1R22A 3J7ZI 2CFOA 2UV1A 3ONQA 3JAMK 3OYGA 1XS9A 3LFKA 4HDVA 3FK6A 3FHZA 3FXMA 4ZTJA 4PJMA 3DPTA 4EM0B 3VB2A 3WE3A 1QA6A 4IX7A 2JJ7A 5JR3A 2Q2EA 4NHJA 2OD5A 5IT3A 2VPLA 3L2UA 1XMXA 4A0YA 1ZREA 5LRSA 5IYCJ 3S3NA 2CW8A 3WTSC 3S16J 5IT9Z 2WY8Q 3I59B 3H0GJ 3L2QA 5FO5A 3ABUA 3G1LA 3I56I 5FB2A 3LSIA 5ICGA 1BI0A 1T2KA 3ELKA 3JTGA 2R5YB 3HHHA 1T39A 3VWBA 3IH3A 2CWEA 5D4RA 3BG9A 3GFMA 3SDBA 1J09A 3DKYA 4XRMA 3A03A 1LDJA 1RKWA 3BG6A 3IWFA 4MEXF 4KA4A 1WJFA 1ZR2A 3TEDA 2DMTA 3MKLA 2H1KA 2L9SA 3HGGA 2ME0A 4XNFA 3OS2A 3Q3SA 1GV5A 2KRHA 5TGTA 2RNJA 3E6DA 1D1AA 2Y9ZA 2Z9OA 1SFUA 3IUOA 4BBRJ 4A0XA 1ZAOA 4BXXJ 2COMA 3M8JA 2VUMJ 1I5ZA 3F72A 3KETA 3WE2A 4I0BA 5FLXK 5FFXA 2NS0A 4ZYGA 2EV5A 1IGNA 4C3IJ 3H3ZA 1IF1A 2EZLA 3V7RA 1W36D 5DD4A 4BHCA 4IKFA 2O5RA 4A6DA 1KQ0A 1JUPA 5M5XJ 2A3SA 3ZXSA 3HOUJ 2BVLA 4ESBA 3AKZA 2DK5A 2XAHA 5ICCA 2MH2A 3CQZJ 1ERDA 3D0SA 2IGKA 2RNGA 4OIPF 1S8NA 3ZGKA 1OISA 2UXXA 3X2QH 1U5TA 3BROA 1SFKA 2KT0A 4NC7A 3IRQA 1UFMA 3K69A 4YFXF 2QEXI 2DA7A 2O8KA 2NYXA 2ZMEC 5LGNA 2R92J 3KPHA 3GTQJ 4RB3C 4CGZA 1K61A 3DKXA 3RI4A 1VQ8I 3TMOA 4ZYHA 3FXRA 3HM5A 4UB6C 3IH4A 1Y39A 1SD7A 1FZPB 2MLKA 3LMMA 5AIQA 5EYRA 5BQTA 1IN5A 3V8KA 1ETWA 2E7WA 1R5GA 4KIBA 2IS4A 4E7LA 1MDMA 4WX9A 1FIPA 2NS7A 1LE8B 1WVRA 3OYBA 3SYTA 1LEAA 4G7OF 1FSEA 1I3AA 1BC7C 1UG0A 1X58A 5LEJA 4UXNA 3G4SI 1YIJI 1IRXA 3KEOA 3HOSA 1Z77A 4NC8A 4P1WA 4DJAA 2R5ZB 4KMUX 2LY1A 4G6QA 5EEGA 3CUQB 1LKXA 2GXAA 4Y13A 4RGRA 4L18B 2XPUA 4DIQA 4EJOA 3LAPA 1QHGA 4WF2A 4D1QA 1OCPA 3H9JA 1UHWA 3JRBA 2Z99A 2NVYJ 5IP6A 4U0YA 2WB1N 4CSWA 1LFPA 1WGXA 4BDZA 4DOZA 4A2UA 2KQRA 1MBHA 3OWTA 3BTCA 3DEWA 3H92A 3IP4B 3E5XA 2Y31A 4PK4A 1QO0D 1S9HA 1VQ7I 3K1MA 1ZN2A 4IQ4A 1SEUA 2V6CA 1FBSA 2VXDA 2Z16A 3FK7A 5D5WB 2DDBA 2L4MA 3H5NA 3ZQQA 4KN4X 3JRAA 4G8XA 5J8FA 2DTRA 4NQWB 2V9KA 3QYEA 1XGSA 3BOQA 3RQIA 4EEFG 2G0EA 3M8FA 4CCNA 1BR1A 2EA2A 4NB5A 1FYKA 1T33A 2V6EA 1B9NA 4KT5C 1XMAA 2CQ7A 1K4SA 2PMUA 5FRMA 2FMYA 4G6TB 1TWFJ 2MFZA 4DBRA 2AHQA 3BLYA 1JE8A 3HG9A 4S05A 3LOCA 1UCRA 1JTXA 2JN6A 2KKOA 1RESA 2LMDA 3JR9A 2ADUA 2DA4A 2A6TA
chains in the Genus database with same CATH topology
4Z2YA 5D4SA 2QQ9A 2GZWA 2X0LA 1YS6A 1O3TA 1OYWA 2Y48A 3JSPA 3DFGA 4U88A 2YSRA 2O0YA 2W57A 3TGNA 2IW5A 1MJAA 3JSOA 2CGPA 2IPQX 3E6BA 3U1DA 3I5UA 2QQAA 4HX7A 2HTJA 5JFRA 3V4GA 2HKOA 4P9FA 1O57A 3MAJA 2L02A 4ENKA 3WTXC 1XGOA 1YQAA 1XN7A 2FF4A 1U6GA 1J75A 1FSHA 5FD6A 3WU1B 4G7ZF 2HQNA 3V8LA 2FBKA 1FBUA 4ZZDA 4HDUA 5LGUA 1U2WA 3CO7C 2QENA 3F8FA 3ZP5A 5AIPA 1QQIA 5JHUA 2PLYA 3BPXA 2UWMA 3Q9SA 3ERED 1VTNC 2JRTA 1B1BA 2QVOA 4BAYA 2FA5A 5CVUA 1SAXA 1O3QA 1D3YA 1FC3A 2WV0A 4KDPA 4M9XA 2HYFA 4R8HA 3G3ZA 3I71A 3HUGA 3I4PA 3E5UA 3GVAA 3T8RA 3GXOA 1W5TA 1J7KA 2RN7A 1HSJA 1ON2A 4RGSA 2OQRA 3RPUA 1TQPA 2A6HF 4U7BA 3IRRA 1ZRFA 1ULYA 3HRUA 2VT2A 1T6SA 1Z91A 2K27A 4IHTA 5L3EA 1QPMA 3DXJF 4MEYF 5CLSA 3AAFA 4HLYA 5CYVA 1U5TB 5D8LB 1T98A 1BOAA 3DV8A 4E70A 2CSOA 1DP7P 3WTTC 2QZ8A 4RB0A 3GZ6A 3DPLC 1Z6RA 1E2XA 4EMSA 5BOXA 3ZPLA 3MZYA 5DYMA 2A5YB 2QBYA 2BGCA 4EV0A 3WGIA 3F22A 3RDIA 3QU3A 3DQVC 3BWGA 4OMZA 1R1TA 3LSTA 4EQQA 2ZKZA 1OR7A 3HRMA 2PBIA 2FMLA 3FM3A 1DUXC 2IP2A 3J80K 4L0ZB 3M1EA 1PP7U 4LLLA 4PCQA 5HDGA 3BP8A 5LRRA 1TLHB 2JT1A 2WWYA 3VEPA 2ZO4A 4MNUA 3R0AA 1YW8A 5HLGA 2L3DA 1ZLJA 3P9IA 4QWQA 1MGTA 4GYIA 3ZMDA 2Z33A 2YX7A 1J9IA 2HR3A 4G9YA 4YIIA 1TNSA 4MGRA 3HTSB 2P4WA 5DCMA 2XV4S 3VFZA 2PN6A 4EM2A 2VN2A 2M30A 2A61A 3IKVA 2NNYA 3T0YA 2FBIA 3FWEA 4GGGA 2VOOA 4HV6A 1FT9A 5ED4A 1V4RA 2W24A 2XAQA 1IN8A 4UHTA 1P2FA 1XDUA 5HS7A 4L0YB 1HW2A 1ZGAA 4CHUA 3TO9A 2R7FA 3GYHX 1OYYA 5DD8A 2JPBA 3EYIA 1USTA 1HXDA 3P7NA 3J81Z 5D8KB 4ZZLA 1F9NA 1QBJA 1RIOH 3H3UA 2HDCA 5LHIA 2WTEA 3MZHA 2WC2A 5LHHA 3KFWX 3FMSA 1HSTA 4UV9A 4MHGA 3F23A 3ZMVA 2IVMA 3DEUA 4O3MA 1TBXA 2ESHA 4MTEA 5JI6A 4L9JA 1YS7A 4ZYEA 3EUHA 1O7LA 2E7XA 2FRHA 4IPAA 1SMTA 4HQEA 2P8TA 2ESNA 4A6EA 5HS8A 3MEXA 2K86A 1CGPA 2BYVE 5D5XB 1JHFA 2D2WA 2VC1A 4PZJA 2RQPA 4FHTA 5K5RA 1HBXG 1IAWA 2V1UA 4HQMA 2EWNA 2F5EA 3WGGA 1GVJA 3TKYA 1RUOA 3HOTA 2EFOA 1KGSA 3QP5A 3EDPA 3SQNA 1J2XA 2GA1A 1XGNA 3K2ZA 1IZ1A 1IXRC 1KQ9A 3CTAA 3QPHA 4UVBA 3QRFF 3GFLA 4CZZA 5LGTA 2YU3A 4P96A 3I54A 4RB1A 1R5HA 2ZNYA 3C7JA 2EA4A 2QBYB 3IL2A 1BI2A 1R1UA 4HBLA 4M6YA 4HX4A 4Q48A 1YW7A 2YR2A 5HLHA 1P92A 3ISPA 1IXSB 4ETSA 1IUYA 3M7GA 4CO8A 4WXDA 1DDNA 1F1ZA 4UV8A 2BEOA 2VE8A 1RNLA 2H94A 2XUBA 1LJ9A 5K5OA 4ESJA 4ESFA 3FMRA 4KIFA 3K0LA 2XIGA 3MCZA 1S6LA 3QAHA 2G9WA 3EYYA 4EJWA 2ZFWA 4CICA 5E8GA 2VODA 1EH7A 2CG4A 2FXAA 2VBXA 3CJNA 2DFIA 3LAJA 1CF7A 4EVIA 4N0BA 1ZARA 3KP5A 4KUMA 4RAZA 3IC7A 3HRTA 2JZYA 2KIUA 2QLZA 1HKTA 1ZH5A 2DAOA 2GWRA 3TOAA 5J6XA 3HIFA 1D8KA 4Q5SF 5DCMB 2R3SA 1P4WA 5H6QA 1Y0UA 4GO1A 4G7HF 4OU0A 2G7UA 2A07F 2P5KA 1TTYA 2FNPA 2PI0A 3HRSA 1QZYA 4LB5A 5ERIA 2HEOA 4R1HA 2HS5A 2PMHA 2FU4A 3BJOA 4M74A 4Y17A 1LVAA 1EH8A 4S04A 1BI3A 4YFNF 3PQKA 1R58A 2NNNA 1SFEA 1SFXA 3E97A 2KJCA 1P6RA 5DCFA 1KU2A 2ELHA 1ONVA 2EV0A 3QOPA 3TO6A 3WG9A 1K78A 3E5QA 3HTUA 3K1PA 4I01A 2XVCA 2IA2A 1FP1D 1G3YA 3B73A 4ZYDA 5CVJA 1XDSA 4L9TA 4HYEA 2EFNA 2IA1A 1R7JA 1P4AA 3FXUA 4ASNA 2PFBA 3BJAA 1Z05A 2MH9A 1G4DA 3FXQA 2DK8A 1U5TC 2O8XA 3WGHA 4D0PA 3F8MA 1Z9CA 5LHGA 2RKHA 1S7AA 2Q0OA 4CYDA 3V7CA 1AWCA 1LNWA 1UHMA 5DUKA 1MJBA 2CQKA 4K2EA 3GWZA 5FFZA 3N4MA 4GCVA 4LK0F 2O3FA 3HHGA 2OU2A 4AIJA 2EJRA 1RI7A 2VBWA 2C6YA 3PQJA 2W25A 3C1DA 4Q47A 3K1NA 2CYYA 2JPCA 4KFCA 5IT9K 4RGUA 1G3WA 1F4KA 2L54A 5D6EA 4I98B 2KRFA 3FM5A 2ZJ2A 3GFIA 1BIBA 3R6SA 1BN5A 3R0JA 1TQMA 3GUDA 3LQRA 1TW2A 1O3SA 1FOKA 1XCBA 2ZBKA 2DBBA 1I1SA 3FF5A 4YFKF 1FWZA 2XKPA 4QLCU 1XD7A 4A5NA 5E8IA 5L3FA 5L3BA 3GZ5A 3VODA 2QQBA 2KIFA 2MC3A 2E1NA 3RTRA 2QYOA 2DPUA 1LQ1A 2QM3A 5F1RA 3RJPA 3O2PE 1OMIA 5ILSA 4XSXF 1ZG1A 2Q8KA 3WTUC 5E17F 2IA0A 1CF7B 4GXOA 4KYWA 4OIRF 2FBHA 1KU3A 3RKYA 1YO5C 2PG4A 5L3DA 5KK1A 3ULQB 2ZXJA 2ACJA 3KP6A 2F2EA 2OA4A 2XAGA 1SMYF 1MDMB 3M9AA 2FE3A 3C3WA 4OOIA 2DT5A 4EGYA 1WWXA 1ZG3A 2GXGA 1FNNA 3O3KA 3Q5FA 1FY7A 2TDXA 4PGHA 5ICEA 3NRVA 4HV5A 1ZRDA 5JVTA 1I27A 2Y0MA 2PQ8A 1GXQA 2E1CA 2F5DA 5EEHA 3BDDA 2P7CB 1QGPA 2DO7A 1YIOA 4EM1A 4ENMA 3KCCA 4AD9A 5CVVA 1K78B 1WQ2A 4RB2C 3GX4X 1XSDA 4EJUA 2K4BA 1HKQA 1K79A 3VOEA 5TJJA 1EV7A 1U3EM 1I6XA 2H6BA 5DUIA 4M6XA 4M9SA 2JTVA 1DPRA 4BYYA 1GXPA 2R7DA 1D5VA 3KLNA 1IN4A 2CW0F 2O03A 3U9GA 4HF2A 4XLPF 1FLIA 4LD5A 3RYRA 3TO7A 3BJ6A 1FYMA 1TQIA 2H27A 2A69F 4UUVA 1R36A 5DV5A 4EGZA 2XKOA 3ZMTA 1P4XA 2DQRA 4EJVA 1B9MA 2HYGD 3TQNA 3ZMUA 1LDKB 3E3VA 1IRGA 4U0WA 3NQOA 1KU9A 4HAMA 1HKSA 5HDNA 5J8CA 2KJBA 3QPTA 4G94A 4XRFA 3GFJA 3LA7A 4LFUA 1A04A 4RS8A 2GA2A 3CUQA 3WU0A 1IRFA 4KMFA 4ENJA 3R60A 4AIHA 1REPC 1Z7UA 3ABTA 2M8EA 4HF0A 1L3LA 1XSXA 2ISZA 4UVCA 5A2QZ 4WWCA 4AWXB 5FGMA 1Z6TA 3P9CA 2RDPA 3CLOA 3WTYC 4IJAA 2CO5A 5D5VB 3COAC 4OIOF 1HW1A 3SZPA 2OQGA 4P55A 5ILVA 2P6SA 2KIMA 5D5UB 2LF8A 2D1HA 3RIRA 3V7SA 2DW4A 3MFKA 1O7FA 2HWVA 2CFXA 5F6FA 2XAFA 3L09A 3OOPA 3PFIA 1JXSA 4BHBA 2FQ3A 2XROA 5HVQC 1FP2A 1ZRCA 4BHPA 1FX7A 2L01A 2ISYA 3CO6C 2P7VB 3K9TA 2VE9A 4R79A 2YPRA 1EH6A 1JGSA 2ZMEA 2LF7A 2VT3A 2NRAC 1YTYA 1SD6A 2GQQA 4DQ2A 3J7AO 1TW3A 1J5YA 3E6CC 1KU7A 3ZN1A 5H20A 4M73A 1H9GA 2HQRA 1KYZA 3I0TA 2HKXA 2D45A 3ZN0A 3F6OA 1W7PA 2H6CA 1BM9A 4LB6B 3F21A 3F8NA 3SXYA 3E6MA 4M72A 3LA2A 2QUFA 2A68F 2BE5F 1IW7F 4IVNA 4OINF 2FNAA 2EV6A 3LQQA 1ZYRF 1WI9A 3LWFA 1OKRA 1ZLKA 3DP7A 5CJ9A 1BC8C 1MZBA 4ENNA 1V3FA 2STTA 4O5VA 3KP4A 3T1BA 4MTDA 1Q1HA 4G6DA 1W4MA 4BXUA 2XASA 1LB2A 1IN7A 1PUEE 1SD5A 2M87A 1TNTA 4XLNF 4BQAA 2W84A 2XRNA 2GAUA 2A6EF 2VC0A 4UNOA 4IF4A 1J59A 3L7WA 3FMQA 3U2RA 3TDUC 1XCVA 3WTZA 2HZTA 4IRGA 3F8BA 1KYWA 1ZHFA 4N9IA 3L2CA 3J81K 1R00A 3S2WA 4OIQF 2W85A 5BMZA 3GO5A 3KE2A 5HOOA 4F7ZA 3GW2A 2FEZA 1B59A 4WCGA 2Z3YA 4I2OA 1XB4A 5DEQA 4YIFA 1J0RA 5A2QK 2EFQA 3G73A 1ZGJA 1FBQA 3DF8A 2LKPA 4RGXA 1WKMA 4L5IA 4M9ZA 1FYLA 4KN7X 1BIAA 4HF1A 1NHAA 3WODF 1OPCA 1G3TA 3T8TA 2ZNZA 4MQVA 3GEZA 5K1YA 3SFZA 3J80Z 2QWWA 3ML6A 1SD4A 3GLXA 5LBQA 2F5CA 1X3UA 2IRFG 4KICA 4H0EA 3QU6A 1T0FA 5KVRA 1B6AA 3ROUA 3IKTA 5L3GA 3Q9VA 4CXFA 2V79A 3B02A 3I53A 1WRJA 2VBZA 2D1VA 4HLXA 1RZ4A 3RYPA 3SZTA 4I02A 2FOKA 3IWZA 4IRIA 1ON1A 2F5FA 2J5OA 4GYGA 1BI1A 2RV8A 5E18F 4P9UA 4HOBA 1PP8F 2L4AA 2IJLA 1BBYA 4FT8A 3KP7A 3W6KB 3M8EA 4U0VA 5AONA 2O6GE 2M5WA 3ECOA 3V8JA 2P6TA 1T38A 4LLNA 3KZYA 4BNCA 2V9VA 4FX4A 4JK1X 5FD5A 1FPQA 5LEKA 2ZMEB 4JBAA 3REOA 5BPIA 1D8JA 5E1XA 3D5LA 3F6VA 4OMYA 2MBFA 1G3SA 4RAYA 1S7OA 3HSFA 1W7PB 1ZG5A 4M71A 6PAXA 5ICFA 4IXAA 5E1ZB 2P5LC 4LG0A 2M1BA 1IXCA 1Z1DA 1PDNC 3FX3A 2MLGA 1W5SA 4CDGA 2X4HA 1BJAA 3W6JB 4WK8F 3F3XA 1WSUA 4DNCA 4FX0A 2Z5UA 2Y75A 1YFHA 1YLFA 1H0MA 1HQCA 1YYVA 3GF2A 2K02A 3ECHA 5D6FA 2V1XA 1H9TA 1UB9A 3TOBA 4KNYA 1K7AA 1E17A 1S29A 1HW5A 3CDHA 1QZZA 3BPVA 1ODDA 2FSWA 4A0ZA 2DPDA 1R23A 5E1WA 1MKMA 2HGCA 5E20A 1AOYA 3C18A 2DI3A 1L0OC 1YW9A 1O3RA 3I58A 2EK5A 2RGVA 4AIKA 2JSCA 1G6NA 5BPDA 1RUNA 4Y15A 4LMYA 4A12A 4ZH4F 1DPUA 4AVPA 2K4JA 3HYIA 2OZUA 2O61A 3MQ0A 3TDZC 2MA3A 1U8RA 2UXNA 4Q4ZF 4LK1F 5HLIA 3JAMZ 3I59A 2ZCWA 3HSRA 5H6RA 1K6OA 4O6JA 4I7HA 4L9VA 1F5TA 2DLLA 3IHUA 3LA3A 5LLQA 4P5OA 4WXHA 5HDKA 5CVRA 2LSOA 3MWMA 4HZFA 3I64A 5DDGA 2P5VA 3KP3A 1B4AA 2DU9A 5L3CA 1XGMA 1KA8A 4LGWA 2XAJA 2PEXA 2HTSA 3EETA 2VBYA 4LJZF 4MQ9F 3ZQ7A 1U78A 1MD0A 3P9KA 4HA8A 4N9HA 2PJPA 2HFHA 5FLXZ 3JTHA 1OYIA 2B0LA 1USSA 5HS9A 3F8CA 2OAZA 2VONA 2ETHA 4A5MA 3WTVC 2V1DA 3QP6A 3O6BB 1R1VA 2EFPA 3CUOA 3NEUA 3T5XA 3KP2A 2AXLA 3BY6A 1KQ8A 2LDUA 5K5QA 3ZMSA 4HW0A 5F64A 2BV6A 1XMKA 4YG2F 4LLGF 4B8XA 1W7PD 1LDDA 4IHSA 3KLOA 2DQLA 4PDKA 2M45A 2OZ6A 2H09A 4WXCA 3FZVA 3KEQA 3SHFA 2MD5A 4B09A 1IN6A 4L9NA 2K7LA 2GIVA 4XBFA 3HSEA 3R4KA 4ON0A 3L9FA 3N97A 1STZA 5BS6A 4NQWA 4LG0B 2RC4A 1JHHA 4TV7A 4BH9A 1LEBA 4I09A 1YG2A 4PGGA 4EJTA 3OV8A 3ZMZA 3RKXA 3DKWA 5ILUA 2UZKA 3L00A 3RPQA 2LNBA 3EQLF 1C0WA 2VXZA 4IRHA 2J5PA 2EFWA 1QNTA 2GXBA 1MJ9A 4XSZF 1I1GA 4JQFA 2AS5F 2VOPA 3JW4A 1XSVA 5CVIA 2YX4A 4L5JA 3KZZA 4I0AA 3R61A 2G7HA 2XGXA 2XHKA 4UVAA 2STWA 2BBYA 4HX8A 4U7DA 2OBPA 2EB7A 2NAZA 3CUQC 3BZ6A 3WTWC 2IT0A 3RKWA 1S3JA 4KIGA 2HOEA 1GHCA 2RVCA 5TRDA 1R22A 3JAMK 3LFKA 4HDVA 3FHZA 3DPTA 4EM0B 3VB2A 3WE3A 5JR3A 2Q2EA 4NHJA 2OD5A 5IT3A 4A0YA 1ZREA 5LRSA 3WTSC 5IT9Z 3I59B 5FO5A 3ABUA 5FB2A 5ICGA 1BI0A 1T2KA 3ELKA 3JTGA 3HHHA 1T39A 2CWEA 5D4RA 3GFMA 1LDJA 3IWFA 4MEXF 4KA4A 2RNJA 3E6DA 2Z9OA 1SFUA 4A0XA 1ZAOA 2COMA 1I5ZA 3F72A 3KETA 3WE2A 4I0BA 5FLXK 5FFXA 4ZYGA 2NS0A 2EV5A 3H3ZA 1IF1A 3V7RA 5DD4A 4BHCA 4A6DA 1KQ0A 2A3SA 4ESBA 2DK5A 2XAHA 5ICCA 2MH2A 3D0SA 4OIPF 1S8NA 2UXXA 1U5TA 3BROA 3IRQA 1UFMA 3K69A 4YFXF 2NYXA 5LGNA 4RB3C 4CGZA 3RI4A 4ZYHA 3FXRA 1FZPB 1SD7A 2MLKA 5AIQA 5BQTA 1IN5A 3V8KA 2E7WA 1R5GA 4KIBA 1MDMA 4WX9A 1LEAA 4G7OF 1FSEA 1BC7C 5LEJA 4UXNA 3KEOA 3HOSA 4KMUX 4G6QA 5EEGA 3CUQB 4Y13A 4RGRA 4L18B 4EJOA 3LAPA 4WF2A 1UHWA 2Z99A 4U0YA 4A2UA 3H92A 3E5XA 1QO0D 3K1MA 1ZN2A 2V6CA 1FBSA 5D5WB 2L4MA 4KN4X 4G8XA 5J8FA 2DTRA 1XGSA 3BOQA 3M8FA 2EA2A 4NB5A 1FYKA 1B9NA 4KT5C 1XMAA 2PMUA 2FMYA 1JE8A 4S05A 1UCRA 2KKOA 2ADUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z2Y A;  5D4S A;  2QQ9 A;  2GZW A;  2X0L A;  1YS6 A;  1O3T A;  1OYW A;  2Y48 A;  3JSP A;  3DFG A;  4U88 A;  2YSR A;  2O0Y A;  2W57 A;  3TGN A;  2IW5 A;  1MJA A;  3JSO A;  2CGP A;  2IPQ X;  3E6B A;  3U1D A;  3I5U A;  2QQA A;  4HX7 A;  2HTJ A;  5JFR A;  3V4G A;  2HKO A;  4P9F A;  1O57 A;  3MAJ A;  2L02 A;  4ENK A;  3WTX C;  1XGO A;  1YQA A;  1XN7 A;  2FF4 A;  1U6G A;  1J75 A;  1FSH A;  5FD6 A;  3WU1 B;  4G7Z F;  2HQN A;  3V8L A;  2FBK A;  1FBU A;  4ZZD A;  4HDU A;  5LGU A;  1U2W A;  3CO7 C;  2QEN A;  3F8F A;  3ZP5 A;  5AIP A;  1QQI A;  5JHU A;  2PLY A;  3BPX A;  2UWM A;  3Q9S A;  3ERE D;  1VTN C;  2JRT A;  1B1B A;  2QVO A;  4BAY A;  2FA5 A;  5CVU A;  1SAX A;  1O3Q A;  1D3Y A;  1FC3 A;  2WV0 A;  4KDP A;  4M9X A;  2HYF A;  4R8H A;  3G3Z A;  3I71 A;  3HUG A;  3I4P A;  3E5U A;  3GVA A;  3T8R A;  3GXO A;  1W5T A;  1J7K A;  2RN7 A;  1HSJ A;  1ON2 A;  4RGS A;  2OQR A;  3RPU A;  1TQP A;  2A6H F;  4U7B A;  3IRR A;  1ZRF A;  1ULY A;  3HRU A;  2VT2 A;  1T6S A;  1Z91 A;  2K27 A;  4IHT A;  5L3E A;  1QPM A;  3DXJ F;  4MEY F;  5CLS A;  3AAF A;  4HLY A;  5CYV A;  1U5T B;  5D8L B;  1T98 A;  1BOA A;  3DV8 A;  4E70 A;  2CSO A;  1DP7 P;  3WTT C;  2QZ8 A;  4RB0 A;  3GZ6 A;  3DPL C;  1Z6R A;  1E2X A;  4EMS A;  5BOX A;  3ZPL A;  3MZY A;  5DYM A;  2A5Y B;  2QBY A;  2BGC A;  4EV0 A;  3WGI A;  3F22 A;  3RDI A;  3QU3 A;  3DQV C;  3BWG A;  4OMZ A;  1R1T A;  3LST A;  4EQQ A;  2ZKZ A;  1OR7 A;  3HRM A;  2PBI A;  2FML A;  3FM3 A;  1DUX C;  2IP2 A;  3J80 K;  4L0Z B;  3M1E A;  1PP7 U;  4LLL A;  4PCQ A;  5HDG A;  3BP8 A;  5LRR A;  1TLH B;  2JT1 A;  2WWY A;  3VEP A;  2ZO4 A;  4MNU A;  3R0A A;  1YW8 A;  5HLG A;  2L3D A;  1ZLJ A;  3P9I A;  4QWQ A;  1MGT A;  4GYI A;  3ZMD A;  2Z33 A;  2YX7 A;  1J9I A;  2HR3 A;  4G9Y A;  4YII A;  1TNS A;  4MGR A;  3HTS B;  2P4W A;  5DCM A;  2XV4 S;  3VFZ A;  2PN6 A;  4EM2 A;  2VN2 A;  2M30 A;  2A61 A;  3IKV A;  2NNY A;  3T0Y A;  2FBI A;  3FWE A;  4GGG A;  2VOO A;  4HV6 A;  1FT9 A;  5ED4 A;  1V4R A;  2W24 A;  2XAQ A;  1IN8 A;  4UHT A;  1P2F A;  1XDU A;  5HS7 A;  4L0Y B;  1HW2 A;  1ZGA A;  4CHU A;  3TO9 A;  2R7F A;  3GYH X;  1OYY A;  5DD8 A;  2JPB A;  3EYI A;  1UST A;  1HXD A;  3P7N A;  3J81 Z;  5D8K B;  4ZZL A;  1F9N A;  1QBJ A;  1RIO H;  3H3U A;  2HDC A;  5LHI A;  2WTE A;  3MZH A;  2WC2 A;  5LHH A;  3KFW X;  3FMS A;  1HST A;  4UV9 A;  4MHG A;  3F23 A;  3ZMV A;  2IVM A;  3DEU A;  4O3M A;  1TBX A;  2ESH A;  4MTE A;  5JI6 A;  4L9J A;  1YS7 A;  4ZYE A;  3EUH A;  1O7L A;  2E7X A;  2FRH A;  4IPA A;  1SMT A;  4HQE A;  2P8T A;  2ESN A;  4A6E A;  5HS8 A;  3MEX A;  2K86 A;  1CGP A;  2BYV E;  5D5X B;  1JHF A;  2D2W A;  2VC1 A;  4PZJ A;  2RQP A;  4FHT A;  5K5R A;  1HBX G;  1IAW A;  2V1U A;  4HQM A;  2EWN A;  2F5E A;  3WGG A;  1GVJ A;  3TKY A;  1RUO A;  3HOT A;  2EFO A;  1KGS A;  3QP5 A;  3EDP A;  3SQN A;  1J2X A;  2GA1 A;  1XGN A;  3K2Z A;  1IZ1 A;  1IXR C;  1KQ9 A;  3CTA A;  3QPH A;  4UVB A;  3QRF F;  3GFL A;  4CZZ A;  5LGT A;  2YU3 A;  4P96 A;  3I54 A;  4RB1 A;  1R5H A;  2ZNY A;  3C7J A;  2EA4 A;  2QBY B;  3IL2 A;  1BI2 A;  1R1U A;  4HBL A;  4M6Y A;  4HX4 A;  4Q48 A;  1YW7 A;  2YR2 A;  5HLH A;  1P92 A;  3ISP A;  1IXS B;  4ETS A;  1IUY A;  3M7G A;  4CO8 A;  4WXD A;  1DDN A;  1F1Z A;  4UV8 A;  2BEO A;  2VE8 A;  1RNL A;  2H94 A;  2XUB A;  1LJ9 A;  5K5O A;  4ESJ A;  4ESF A;  3FMR A;  4KIF A;  3K0L A;  2XIG A;  3MCZ A;  1S6L A;  3QAH A;  2G9W A;  3EYY A;  4EJW A;  2ZFW A;  4CIC A;  5E8G A;  2VOD A;  1EH7 A;  2CG4 A;  2FXA A;  2VBX A;  3CJN A;  2DFI A;  3LAJ A;  1CF7 A;  4EVI A;  4N0B A;  1ZAR A;  3KP5 A;  4KUM A;  4RAZ A;  3IC7 A;  3HRT A;  2JZY A;  2KIU A;  2QLZ A;  1HKT A;  1ZH5 A;  2DAO A;  2GWR A;  3TOA A;  5J6X A;  3HIF A;  1D8K A;  4Q5S F;  5DCM B;  2R3S A;  1P4W A;  5H6Q A;  1Y0U A;  4GO1 A;  4G7H F;  4OU0 A;  2G7U A;  2A07 F;  2P5K A;  1TTY A;  2FNP A;  2PI0 A;  3HRS A;  1QZY A;  4LB5 A;  5ERI A;  2HEO A;  4R1H A;  2HS5 A;  2PMH A;  2FU4 A;  3BJO A;  4M74 A;  4Y17 A;  1LVA A;  1EH8 A;  4S04 A;  1BI3 A;  4YFN F;  3PQK A;  1R58 A;  2NNN A;  1SFE A;  1SFX A;  3E97 A;  2KJC A;  1P6R A;  5DCF A;  1KU2 A;  2ELH A;  1ONV A;  2EV0 A;  3QOP A;  3TO6 A;  3WG9 A;  1K78 A;  3E5Q A;  3HTU A;  3K1P A;  4I01 A;  2XVC A;  2IA2 A;  1FP1 D;  1G3Y A;  3B73 A;  4ZYD A;  5CVJ A;  1XDS A;  4L9T A;  4HYE A;  2EFN A;  2IA1 A;  1R7J A;  1P4A A;  3FXU A;  4ASN A;  2PFB A;  3BJA A;  1Z05 A;  2MH9 A;  1G4D A;  3FXQ A;  2DK8 A;  1U5T C;  2O8X A;  3WGH A;  4D0P A;  3F8M A;  1Z9C A;  5LHG A;  2RKH A;  1S7A A;  2Q0O A;  4CYD A;  3V7C A;  1AWC A;  1LNW A;  1UHM A;  5DUK A;  1MJB A;  2CQK A;  4K2E A;  3GWZ A;  5FFZ A;  3N4M A;  4GCV A;  4LK0 F;  2O3F A;  3HHG A;  2OU2 A;  4AIJ A;  2EJR A;  1RI7 A;  2VBW A;  2C6Y A;  3PQJ A;  2W25 A;  3C1D A;  4Q47 A;  3K1N A;  2CYY A;  2JPC A;  4KFC A;  5IT9 K;  4RGU A;  1G3W A;  1F4K A;  2L54 A;  5D6E A;  4I98 B;  2KRF A;  3FM5 A;  2ZJ2 A;  3GFI A;  1BIB A;  3R6S A;  1BN5 A;  3R0J A;  1TQM A;  3GUD A;  3LQR A;  1TW2 A;  1O3S A;  1FOK A;  1XCB A;  2ZBK A;  2DBB A;  1I1S A;  3FF5 A;  4YFK F;  1FWZ A;  2XKP A;  4QLC U;  1XD7 A;  4A5N A;  5E8I A;  5L3F A;  5L3B A;  3GZ5 A;  3VOD A;  2QQB A;  2KIF A;  2MC3 A;  2E1N A;  3RTR A;  2QYO A;  2DPU A;  1LQ1 A;  2QM3 A;  5F1R A;  3RJP A;  3O2P E;  1OMI A;  5ILS A;  4XSX F;  1ZG1 A;  2Q8K A;  3WTU C;  5E17 F;  2IA0 A;  1CF7 B;  4GXO A;  4KYW A;  4OIR F;  2FBH A;  1KU3 A;  3RKY A;  1YO5 C;  2PG4 A;  5L3D A;  5KK1 A;  3ULQ B;  2ZXJ A;  2ACJ A;  3KP6 A;  2F2E A;  2OA4 A;  2XAG A;  1SMY F;  1MDM B;  3M9A A;  2FE3 A;  3C3W A;  4OOI A;  2DT5 A;  4EGY A;  1WWX A;  1ZG3 A;  2GXG A;  1FNN A;  3O3K A;  3Q5F A;  1FY7 A;  2TDX A;  4PGH A;  5ICE A;  3NRV A;  4HV5 A;  1ZRD A;  5JVT A;  1I27 A;  2Y0M A;  2PQ8 A;  1GXQ A;  2E1C A;  2F5D A;  5EEH A;  3BDD A;  2P7C B;  1QGP A;  2DO7 A;  1YIO A;  4EM1 A;  4ENM A;  3KCC A;  4AD9 A;  5CVV A;  1K78 B;  1WQ2 A;  4RB2 C;  3GX4 X;  1XSD A;  4EJU A;  2K4B A;  1HKQ A;  1K79 A;  3VOE A;  5TJJ A;  1EV7 A;  1U3E M;  1I6X A;  2H6B A;  5DUI A;  4M6X A;  4M9S A;  2JTV A;  1DPR A;  4BYY A;  1GXP A;  2R7D A;  1D5V A;  3KLN A;  1IN4 A;  2CW0 F;  2O03 A;  3U9G A;  4HF2 A;  4XLP F;  1FLI A;  4LD5 A;  3RYR A;  3TO7 A;  3BJ6 A;  1FYM A;  1TQI A;  2H27 A;  2A69 F;  4UUV A;  1R36 A;  5DV5 A;  4EGZ A;  2XKO A;  3ZMT A;  1P4X A;  2DQR A;  4EJV A;  1B9M A;  2HYG D;  3TQN A;  3ZMU A;  1LDK B;  3E3V A;  1IRG A;  4U0W A;  3NQO A;  1KU9 A;  4HAM A;  1HKS A;  5HDN A;  5J8C A;  2KJB A;  3QPT A;  4G94 A;  4XRF A;  3GFJ A;  3LA7 A;  4LFU A;  1A04 A;  4RS8 A;  2GA2 A;  3CUQ A;  3WU0 A;  1IRF A;  4KMF A;  4ENJ A;  3R60 A;  4AIH A;  1REP C;  1Z7U A;  3ABT A;  2M8E A;  4HF0 A;  1L3L A;  1XSX A;  2ISZ A;  4UVC A;  5A2Q Z;  4WWC A;  4AWX B;  5FGM A;  1Z6T A;  3P9C A;  2RDP A;  3CLO A;  3WTY C;  4IJA A;  2CO5 A;  5D5V B;  3COA C;  4OIO F;  1HW1 A;  3SZP A;  2OQG A;  4P55 A;  5ILV A;  2P6S A;  2KIM A;  5D5U B;  2LF8 A;  2D1H A;  3RIR A;  3V7S A;  2DW4 A;  3MFK A;  1O7F A;  2HWV A;  2CFX A;  5F6F A;  2XAF A;  3L09 A;  3OOP A;  3PFI A;  1JXS A;  4BHB A;  2FQ3 A;  2XRO A;  5HVQ C;  1FP2 A;  1ZRC A;  4BHP A;  1FX7 A;  2L01 A;  2ISY A;  3CO6 C;  2P7V B;  3K9T A;  2VE9 A;  4R79 A;  2YPR A;  1EH6 A;  1JGS A;  2ZME A;  2LF7 A;  2VT3 A;  2NRA C;  1YTY A;  1SD6 A;  2GQQ A;  4DQ2 A;  3J7A O;  1TW3 A;  1J5Y A;  3E6C C;  1KU7 A;  3ZN1 A;  5H20 A;  4M73 A;  1H9G A;  2HQR A;  1KYZ A;  3I0T A;  2HKX A;  2D45 A;  3ZN0 A;  3F6O A;  1W7P A;  2H6C A;  1BM9 A;  4LB6 B;  3F21 A;  3F8N A;  3SXY A;  3E6M A;  4M72 A;  3LA2 A;  2QUF A;  2A68 F;  2BE5 F;  1IW7 F;  4IVN A;  4OIN F;  2FNA A;  2EV6 A;  3LQQ A;  1ZYR F;  1WI9 A;  3LWF A;  1OKR A;  1ZLK A;  3DP7 A;  5CJ9 A;  1BC8 C;  1MZB A;  4ENN A;  1V3F A;  2STT A;  4O5V A;  3KP4 A;  3T1B A;  4MTD A;  1Q1H A;  4G6D A;  1W4M A;  4BXU A;  2XAS A;  1LB2 A;  1IN7 A;  1PUE E;  1SD5 A;  2M87 A;  1TNT A;  4XLN F;  4BQA A;  2W84 A;  2XRN A;  2GAU A;  2A6E F;  2VC0 A;  4UNO A;  4IF4 A;  1J59 A;  3L7W A;  3FMQ A;  3U2R A;  3TDU C;  1XCV A;  3WTZ A;  2HZT A;  4IRG A;  3F8B A;  1KYW A;  1ZHF A;  4N9I A;  3L2C A;  3J81 K;  1R00 A;  3S2W A;  4OIQ F;  2W85 A;  5BMZ A;  3GO5 A;  3KE2 A;  5HOO A;  4F7Z A;  3GW2 A;  2FEZ A;  1B59 A;  4WCG A;  2Z3Y A;  4I2O A;  1XB4 A;  5DEQ A;  4YIF A;  1J0R A;  5A2Q K;  2EFQ A;  3G73 A;  1ZGJ A;  1FBQ A;  3DF8 A;  2LKP A;  4RGX A;  1WKM A;  4L5I A;  4M9Z A;  1FYL A;  4KN7 X;  1BIA A;  4HF1 A;  1NHA A;  3WOD F;  1OPC A;  1G3T A;  3T8T A;  2ZNZ A;  4MQV A;  3GEZ A;  5K1Y A;  3SFZ A;  3J80 Z;  2QWW A;  3ML6 A;  1SD4 A;  3GLX A;  5LBQ A;  2F5C A;  1X3U A;  2IRF G;  4KIC A;  4H0E A;  3QU6 A;  1T0F A;  5KVR A;  1B6A A;  3ROU A;  3IKT A;  5L3G A;  3Q9V A;  4CXF A;  2V79 A;  3B02 A;  3I53 A;  1WRJ A;  2VBZ A;  2D1V A;  4HLX A;  1RZ4 A;  3RYP A;  3SZT A;  4I02 A;  2FOK A;  3IWZ A;  4IRI A;  1ON1 A;  2F5F A;  2J5O A;  4GYG A;  1BI1 A;  2RV8 A;  5E18 F;  4P9U A;  4HOB A;  1PP8 F;  2L4A A;  2IJL A;  1BBY A;  4FT8 A;  3KP7 A;  3W6K B;  3M8E A;  4U0V A;  5AON A;  2O6G E;  2M5W A;  3ECO A;  3V8J A;  2P6T A;  1T38 A;  4LLN A;  3KZY A;  4BNC A;  2V9V A;  4FX4 A;  4JK1 X;  5FD5 A;  1FPQ A;  5LEK A;  2ZME B;  4JBA A;  3REO A;  5BPI A;  1D8J A;  5E1X A;  3D5L A;  3F6V A;  4OMY A;  2MBF A;  1G3S A;  4RAY A;  1S7O A;  3HSF A;  1W7P B;  1ZG5 A;  4M71 A;  6PAX A;  5ICF A;  4IXA A;  5E1Z B;  2P5L C;  4LG0 A;  2M1B A;  1IXC A;  1Z1D A;  1PDN C;  3FX3 A;  2MLG A;  1W5S A;  4CDG A;  2X4H A;  1BJA A;  3W6J B;  4WK8 F;  3F3X A;  1WSU A;  4DNC A;  4FX0 A;  2Z5U A;  2Y75 A;  1YFH A;  1YLF A;  1H0M A;  1HQC A;  1YYV A;  3GF2 A;  2K02 A;  3ECH A;  5D6F A;  2V1X A;  1H9T A;  1UB9 A;  3TOB A;  4KNY A;  1K7A A;  1E17 A;  1S29 A;  1HW5 A;  3CDH A;  1QZZ A;  3BPV A;  1ODD A;  2FSW A;  4A0Z A;  2DPD A;  1R23 A;  5E1W A;  1MKM A;  2HGC A;  5E20 A;  1AOY A;  3C18 A;  2DI3 A;  1L0O C;  1YW9 A;  1O3R A;  3I58 A;  2EK5 A;  2RGV A;  4AIK A;  2JSC A;  1G6N A;  5BPD A;  1RUN A;  4Y15 A;  4LMY A;  4A12 A;  4ZH4 F;  1DPU A;  4AVP A;  2K4J A;  3HYI A;  2OZU A;  2O61 A;  3MQ0 A;  3TDZ C;  2MA3 A;  1U8R A;  2UXN A;  4Q4Z F;  4LK1 F;  5HLI A;  3JAM Z;  3I59 A;  2ZCW A;  3HSR A;  5H6R A;  1K6O A;  4O6J A;  4I7H A;  4L9V A;  1F5T A;  2DLL A;  3IHU A;  3LA3 A;  5LLQ A;  4P5O A;  4WXH A;  5HDK A;  5CVR A;  2LSO A;  3MWM A;  4HZF A;  3I64 A;  5DDG A;  2P5V A;  3KP3 A;  1B4A A;  2DU9 A;  5L3C A;  1XGM A;  1KA8 A;  4LGW A;  2XAJ A;  2PEX A;  2HTS A;  3EET A;  2VBY A;  4LJZ F;  4MQ9 F;  3ZQ7 A;  1U78 A;  1MD0 A;  3P9K A;  4HA8 A;  4N9H A;  2PJP A;  2HFH A;  5FLX Z;  3JTH A;  1OYI A;  2B0L A;  1USS A;  5HS9 A;  3F8C A;  2OAZ A;  2VON A;  2ETH A;  4A5M A;  3WTV C;  2V1D A;  3QP6 A;  3O6B B;  1R1V A;  2EFP A;  3CUO A;  3NEU A;  3T5X A;  3KP2 A;  2AXL A;  3BY6 A;  1KQ8 A;  2LDU A;  5K5Q A;  3ZMS A;  4HW0 A;  5F64 A;  2BV6 A;  1XMK A;  4YG2 F;  4LLG F;  4B8X A;  1W7P D;  1LDD A;  4IHS A;  3KLO A;  2DQL A;  4PDK A;  2M45 A;  2OZ6 A;  2H09 A;  4WXC A;  3FZV A;  3KEQ A;  3SHF A;  2MD5 A;  4B09 A;  1IN6 A;  4L9N A;  2K7L A;  2GIV A;  4XBF A;  3HSE A;  3R4K A;  4ON0 A;  3L9F A;  3N97 A;  1STZ A;  5BS6 A;  4NQW A;  4LG0 B;  2RC4 A;  1JHH A;  4TV7 A;  4BH9 A;  1LEB A;  4I09 A;  1YG2 A;  4PGG A;  4EJT A;  3OV8 A;  3ZMZ A;  3RKX A;  3DKW A;  5ILU A;  2UZK A;  3L00 A;  3RPQ A;  2LNB A;  3EQL F;  1C0W A;  2VXZ A;  4IRH A;  2J5P A;  2EFW A;  1QNT A;  2GXB A;  1MJ9 A;  4XSZ F;  1I1G A;  4JQF A;  2AS5 F;  2VOP A;  3JW4 A;  1XSV A;  5CVI A;  2YX4 A;  4L5J A;  3KZZ A;  4I0A A;  3R61 A;  2G7H A;  2XGX A;  2XHK A;  4UVA A;  2STW A;  2BBY A;  4HX8 A;  4U7D A;  2OBP A;  2EB7 A;  2NAZ A;  3CUQ C;  3BZ6 A;  3WTW C;  2IT0 A;  3RKW A;  1S3J A;  4KIG A;  2HOE A;  1GHC A;  2RVC A;  5TRD A;  1R22 A;  3JAM K;  3LFK A;  4HDV A;  3FHZ A;  3DPT A;  4EM0 B;  3VB2 A;  3WE3 A;  5JR3 A;  2Q2E A;  4NHJ A;  2OD5 A;  5IT3 A;  4A0Y A;  1ZRE A;  5LRS A;  3WTS C;  5IT9 Z;  3I59 B;  5FO5 A;  3ABU A;  5FB2 A;  5ICG A;  1BI0 A;  1T2K A;  3ELK A;  3JTG A;  3HHH A;  1T39 A;  2CWE A;  5D4R A;  3GFM A;  1LDJ A;  3IWF A;  4MEX F;  4KA4 A;  2RNJ A;  3E6D A;  2Z9O A;  1SFU A;  4A0X A;  1ZAO A;  2COM A;  1I5Z A;  3F72 A;  3KET A;  3WE2 A;  4I0B A;  5FLX K;  5FFX A;  4ZYG A;  2NS0 A;  2EV5 A;  3H3Z A;  1IF1 A;  3V7R A;  5DD4 A;  4BHC A;  4A6D A;  1KQ0 A;  2A3S A;  4ESB A;  2DK5 A;  2XAH A;  5ICC A;  2MH2 A;  3D0S A;  4OIP F;  1S8N A;  2UXX A;  1U5T A;  3BRO A;  3IRQ A;  1UFM A;  3K69 A;  4YFX F;  2NYX A;  5LGN A;  4RB3 C;  4CGZ A;  3RI4 A;  4ZYH A;  3FXR A;  1FZP B;  1SD7 A;  2MLK A;  5AIQ A;  5BQT A;  1IN5 A;  3V8K A;  2E7W A;  1R5G A;  4KIB A;  1MDM A;  4WX9 A;  1LEA A;  4G7O F;  1FSE A;  1BC7 C;  5LEJ A;  4UXN A;  3KEO A;  3HOS A;  4KMU X;  4G6Q A;  5EEG A;  3CUQ B;  4Y13 A;  4RGR A;  4L18 B;  4EJO A;  3LAP A;  4WF2 A;  1UHW A;  2Z99 A;  4U0Y A;  4A2U A;  3H92 A;  3E5X A;  1QO0 D;  3K1M A;  1ZN2 A;  2V6C A;  1FBS A;  5D5W B;  2L4M A;  4KN4 X;  4G8X A;  5J8F A;  2DTR A;  1XGS A;  3BOQ A;  3M8F A;  2EA2 A;  4NB5 A;  1FYK A;  1B9N A;  4KT5 C;  1XMA A;  2PMU A;  2FMY A;  1JE8 A;  4S05 A;  1UCR A;  2KKO A;  2ADU A; 
#chains in the Genus database with same CATH topology
 4KJZ A;  4Z2Y A;  5D4S A;  2QQ9 A;  2GZW A;  2NOG A;  3AL0 B;  2X0L A;  1YS6 A;  1O3T A;  1OYW A;  2Y48 A;  3JSP A;  3DFG A;  2FJ1 A;  3GZN B;  3RCO A;  5C44 J;  2K9L A;  4U88 A;  3F9K A;  1V5E A;  2YSR A;  2O0Y A;  2W57 A;  2LYC A;  3S2D J;  1WH5 A;  3TGN A;  4AID A;  2IW5 A;  1MJA A;  3JSO A;  2CGP A;  2IPQ X;  3E6B A;  3U1D A;  2QKL B;  4HG2 A;  4XK4 A;  1D0X A;  3I5U A;  2QQA A;  4HX7 A;  3HGY A;  2CW7 A;  5EGO A;  5F0F A;  2HTJ A;  3L2V A;  5JFR A;  2AQE A;  3V4G A;  3ERM A;  2HKO A;  4N4O B;  1YRN A;  4JOM A;  4P9F A;  1O57 A;  3MAJ A;  1YIT I;  2L02 A;  4ENK A;  2FQ4 A;  2Y0S N;  1WZ2 A;  2IXS A;  1GUU A;  3CCJ I;  3WTX C;  1XGO A;  1K83 J;  3OR1 C;  1YQA A;  4PJN A;  4D5F A;  4OWR B;  1XN7 A;  2FF4 A;  3CDI A;  4M3D A;  1U6G A;  3LSG A;  1J75 A;  1JT6 A;  1FSH A;  5FD6 A;  3WU1 B;  4G7Z F;  2HQN A;  3FKI J;  3V8L A;  2WAE A;  3CCL I;  2FBK A;  1FBU A;  4ZZD A;  4HDU A;  2DFH A;  3OYM A;  5DM7 F;  1W5C C;  5LGU A;  1U2W A;  3CO7 C;  2QEN A;  3F8F A;  5JHU A;  5AIP A;  1QQI A;  3ZP5 A;  2LG4 A;  2PLY A;  2E2J J;  3BPX A;  4AYB A;  2EIN H;  2Q2E B;  2DYS H;  2UWM A;  1WJB A;  3Q9S A;  4UUS B;  3ERE D;  1VTN C;  1G2H A;  2JRT A;  1B1B A;  1MBJ A;  2QVO A;  4BAY A;  1ETK A;  2FA5 A;  5CVU A;  1IC8 A;  2KIS A;  1VQP I;  1SAX A;  1O3Q A;  1D3Y A;  5KCM A;  4JX6 A;  3WHC A;  1QVT A;  5B66 C;  1FC3 A;  1T0F C;  5LFA A;  2WV0 A;  4KDP A;  1N78 A;  4M9X A;  2HYF A;  5J4Y A;  1Y1W J;  3TBI A;  1RR8 C;  4R8H A;  3LFU A;  5EEA A;  4B4C A;  4ZDP A;  1IUF A;  2V9P A;  3G3Z A;  4XRS G;  2XGE A;  2VQG A;  2E19 A;  3I71 A;  3I55 I;  3HUG A;  3I4P A;  3CJQ B;  4B44 A;  3IV5 A;  1AU7 A;  2BZT A;  3K4M A;  4LG3 A;  3A01 A;  2MW8 A;  3E5U A;  2M7A A;  3AG2 H;  3GVA A;  1W36 C;  1X1A A;  3T8R A;  1HDD C;  3GXO A;  1W5T A;  1J7K A;  1PVE A;  2RN7 A;  1HSJ A;  2L2O A;  2IAI A;  1ON2 A;  1U9N A;  1B72 A;  4RGS A;  1VQN I;  2OQR A;  3RPU A;  1TQP A;  2A6H F;  4U7B A;  4CH7 A;  3IRR A;  5M5Y J;  1ULY A;  4BE2 A;  1ZRF A;  2CH0 A;  1VQ9 I;  1WHU A;  2XB0 X;  3HRU A;  2VT2 A;  3IAS 2;  1T6S A;  1Z91 A;  5HLT A;  3HEF A;  3HPH A;  2K27 A;  4W1U A;  5L3E A;  4IHT A;  1QPM A;  5KNL A;  3BTI A;  1H8A C;  3DXJ F;  4MEY F;  3VSK A;  5CLS A;  4BUP A;  3AAF A;  2CUF A;  2VKE A;  4IHW A;  4HLY A;  5CYV A;  1U5T B;  5D8L B;  1T98 A;  1BOA A;  3OIP A;  3DV8 A;  5DM6 F;  5GPA A;  3CCU I;  4E70 A;  2CSO A;  3PFY A;  1DP7 P;  4RM2 A;  1EF4 A;  3WTT C;  2JVH A;  2QZ8 A;  4HRI A;  4RB0 A;  3GZ6 A;  5J1U A;  4FCY A;  4X6A J;  4G12 A;  1I3Q J;  3DPL C;  1Z6R A;  1E2X A;  4EMS A;  3HB9 A;  5BOX A;  2M0C A;  2ZJQ F;  3ZPL A;  2ZSI B;  4BY7 J;  1SVL A;  4FAS D;  3MZY A;  5DYM A;  4BJT A;  2A5Y B;  1P7I A;  2GOX B;  4CCL A;  1HC8 A;  2QBY A;  2BGC A;  4EV0 A;  2VPR A;  3WGI A;  3F22 A;  2CUJ A;  4M3E A;  3RDI A;  3QU3 A;  3DQV C;  3BWG A;  4OMZ A;  1R1T A;  4UUT A;  3LST A;  4MFD A;  4EQQ A;  1KON A;  1Y1V J;  2ZKZ A;  1OR7 A;  3HRM A;  2PBI A;  2FML A;  3FM3 A;  1DUX C;  4B48 A;  4RMN A;  2IP2 A;  3J80 K;  3BZK A;  4BE0 A;  2B63 J;  3CJT B;  3ABM H;  3DBR B;  1FMV A;  4L0Z B;  3CP8 A;  3M1E A;  2CU7 A;  1PP7 U;  1V5G A;  4LLL A;  1PYV A;  3OL4 A;  4PCQ A;  5HDG A;  3LL7 A;  2CJJ A;  3BG5 A;  3BP8 A;  2HXO A;  5LRR A;  1R49 A;  1FOW A;  1TLH B;  2XF6 A;  5DS9 A;  5CKT A;  2L7K A;  2JT1 A;  3W2W A;  3PO3 J;  2WWY A;  4ITV A;  2EBI A;  4RA2 A;  1WJD A;  1YOV B;  3VEP A;  2MAB A;  5J3L A;  2QCO A;  2V1N A;  2ZO4 A;  4MNU A;  4A69 C;  3R0A A;  3UNG C;  1DQU A;  1YE9 A;  4S0H B;  2DTZ A;  1YW8 A;  1LVK A;  3A0B C;  3MVP A;  2ZXI A;  5HLG A;  2H1L A;  3RSN A;  2L3D A;  5TIS C;  5BNG A;  1ZLJ A;  3ABL H;  3P9I A;  4QWQ A;  1MGT A;  5JVG F;  4GYI A;  1RET A;  4C2T A;  3PNY A;  1M1E B;  5B1A H;  3ZMD A;  2Z33 A;  2R7T A;  2YX7 A;  1J9I A;  2HR3 A;  3HPG A;  4G9Y A;  4YII A;  1TNS A;  4MGR A;  2E1M C;  3HTS B;  2L9V A;  2JRM A;  2K9M A;  2OUM A;  2P4W A;  4M6V A;  2PMZ A;  5DCM A;  2TRT A;  1ZKG A;  2KIQ A;  2YS9 A;  2XV4 S;  1VI0 A;  4BGD A;  3H1C A;  3VFZ A;  3OYA A;  4BL0 B;  1BW5 A;  2PN6 A;  1HOM A;  4EM2 A;  2KMU A;  2VN2 A;  3K10 A;  5EGO B;  2M30 A;  3K6G A;  1POG A;  4YRV A;  3HOV J;  1K6Y A;  4IL6 C;  2A61 A;  1JKP C;  4DYQ A;  3IKV A;  3OYJ A;  2NNY A;  3T0Y A;  2BXZ A;  4F93 B;  1YRN B;  2FBI A;  3FWE A;  3W3C A;  1MBK A;  4GGG A;  3L2R A;  2VOO A;  2CUZ A;  1JUS A;  4HV6 A;  1FT9 A;  1KZH A;  1JTY A;  5ED4 A;  1V4R A;  2W24 A;  2XAQ A;  1RC9 A;  3LNQ A;  4D7M A;  1IN8 A;  4UHT A;  1P2F A;  4A3B J;  1XDU A;  5HS7 A;  2B7E A;  1Y0N A;  4L0Y B;  4BQO A;  4B43 A;  1HW2 A;  4XR6 A;  1ZGA A;  1PJR A;  3G71 I;  4CHU A;  3TO9 A;  2R7F A;  2FUG 2;  3GYH X;  4HNT A;  2GIZ A;  2BOL A;  3SEZ A;  1OYY A;  5JLW A;  2HQ5 A;  5DD8 A;  2JPB A;  3EYI A;  1UST A;  1HXD A;  3L2W A;  3P7N A;  2VKD A;  3J81 Z;  1B8I A;  2Y9Y A;  4AUX A;  1X2N A;  4QSH A;  2DA2 A;  3QOE A;  1HDP A;  2KZG A;  5D8K B;  4ZZL A;  5IP7 J;  5FLM J;  4UB8 C;  1F9N A;  2KDO A;  1QBJ A;  1RIO H;  3H3U A;  2HDC A;  5LHI A;  2WTE A;  2ZXW H;  3MZH A;  1IDZ A;  4LIV A;  1QU3 A;  4RLQ A;  2WC2 A;  4RM3 A;  5LHH A;  5JLX A;  2NOJ B;  5IPA A;  3KFW X;  5K7Z A;  2W00 A;  1ETQ A;  1R71 A;  3FMS A;  3K4C A;  1HST A;  4NNJ A;  4UV9 A;  4MHG A;  2LBF A;  4ZC3 A;  3F23 A;  3G1O A;  4C2U A;  4IEJ A;  2Z2S B;  3ZMV A;  2IVM A;  3DEU A;  4MLO A;  4O3M A;  1TBX A;  3FIW A;  2ESH A;  4MTE A;  5JI6 A;  4L9J A;  1YS7 A;  4ZYE A;  3EUH A;  4DZP A;  3PSF A;  3FIS A;  1O7L A;  5M5W J;  4V19 K;  2K3F A;  2E7X A;  2FRH A;  4IPA A;  3A01 B;  1SMT A;  4HQE A;  2P8T A;  2ESN A;  4IO9 F;  4A6E A;  1U0J A;  1QVU A;  3MEX A;  3FBN B;  5HS8 A;  2K86 A;  1BR4 A;  3BR6 A;  1CGP A;  3BC8 A;  1B72 B;  3RQ4 A;  3SEQ A;  2HPM A;  2BYV E;  3GLL A;  5D5X B;  3GTP J;  1JHF A;  1ZTR A;  2D2W A;  2VC1 A;  3F0C A;  2RQP A;  4PZJ A;  2K9N A;  4BXF A;  5FLV A;  3ASN H;  4FHT A;  5K5R A;  1HBX G;  2CQX A;  1IAW A;  2V1U A;  3E1S A;  4HQM A;  2EWN A;  1APL C;  2F5E A;  3WGG A;  1GVJ A;  3TKY A;  1RUO A;  1NTC A;  4B3X A;  4XMY A;  3HOT A;  2EFO A;  1KGS A;  1AKH B;  1H88 C;  3QP5 A;  3EDP A;  3SQN A;  1J2X A;  5DTD A;  1YHQ I;  2R7R A;  2NS8 A;  2GA1 A;  1W0U A;  3HXL A;  4M3B A;  1MBG A;  3BG7 A;  1XGN A;  5F27 A;  3K2Z A;  2E1M B;  1IZ1 A;  3CTA A;  1IXR C;  1KQ9 A;  2X9D A;  1U8B A;  3QPH A;  1FJL A;  4UVB A;  1QPI A;  1WI3 A;  3QRF F;  3DBH B;  3VPR A;  3E0J B;  3GFL A;  3KZI C;  4CZZ A;  5LGT A;  2YU3 A;  4P96 A;  3ZQC A;  2LRD A;  3I54 A;  5CPR B;  1N75 A;  1R5H A;  4RB1 A;  2ZNY A;  3SZG A;  3C7J A;  2EA4 A;  1UJ8 A;  1DGW Y;  2X48 A;  3BCA A;  2LP0 A;  2QBY B;  5M3F J;  3IL2 A;  1BI2 A;  1R1U A;  3OYF A;  2X6X A;  4DGW B;  2R7Q A;  4HBL A;  1TWH J;  2K85 A;  4M6Y A;  4HX4 A;  4Q48 A;  1YW7 A;  2YR2 A;  4V2F A;  5HLH A;  1XTA A;  5E3M A;  3GTK J;  1P92 A;  4AC0 A;  4J19 A;  3ISP A;  1IXS B;  1MW7 A;  2P0W A;  4ETS A;  1IUY A;  3M7G A;  3K2A A;  1XX5 A;  2R4G A;  2PJR B;  4CO8 A;  4WXD A;  1DDN A;  2M0M A;  1F1Z A;  3BR3 A;  4UV8 A;  1TWA J;  4QPO A;  2BEO A;  3CES A;  2EIK H;  3DU6 A;  3FKJ A;  2VE8 A;  2P81 A;  1TZL A;  1RNL A;  3AL0 C;  2H94 A;  2XUB A;  1FMW A;  2EZI A;  1LJ9 A;  4EAT A;  5K5O A;  4ESJ A;  2NVQ J;  4ESF A;  1YI2 I;  3FMR A;  4KIF A;  3OYD A;  3K0L A;  2XIG A;  3DEE A;  3MCZ A;  1D5Y A;  2HVR A;  1S6L A;  3GBG A;  2OCE A;  3QAH A;  3DU5 A;  3PL8 A;  2G9W A;  3EYY A;  4EJW A;  1YJ9 I;  2ZFW A;  3PUB A;  5K7H A;  4CIC A;  1JI8 A;  2ZJP F;  2VJ4 A;  5E8G A;  2VOD A;  1EH7 A;  5F08 A;  2R7V A;  2TCT A;  2CG4 A;  1Z7L A;  2FXA A;  2VBX A;  3CJN A;  2DFI A;  2KFD A;  2XF7 A;  3LAJ A;  1CF7 A;  5IYD J;  1R4M B;  1DGR M;  4N0B A;  4EVI A;  1ZAR A;  3KP5 A;  4KUM A;  1R9T J;  4RAZ A;  3IC7 A;  3HRT A;  2JZY A;  2KIU A;  2QLZ A;  5LD2 C;  1HKT A;  1ZH5 A;  1JKQ C;  4BS9 A;  2E5Z A;  3JRC A;  4A3E J;  2DAO A;  5C4J J;  2GWR A;  2OC6 A;  5J47 A;  3TOA A;  5J6X A;  3HIF A;  1D8K A;  2VB6 A;  4Q5S F;  2CMP A;  5DCM B;  2R3S A;  1IJW C;  5B5E C;  5IOZ A;  1P4W A;  3CCR I;  5H6Q A;  3BR1 A;  1Y0U A;  4GO1 A;  4G7H F;  4OU0 A;  2QSG X;  3DLL F;  1XG1 A;  1MH3 A;  2G7U A;  2A07 F;  2P5K A;  4ZYA A;  1IRZ A;  2VKH A;  4E6K G;  1TTY A;  2FNP A;  2PI0 A;  4DYC A;  1UAA A;  2I8D A;  3HRS A;  1AHD P;  4PFP A;  1H89 C;  2EZK A;  1V5F A;  3HKZ A;  1QZY A;  2KPM A;  4LB5 A;  2F48 A;  1TT5 B;  5ERI A;  1WJC A;  3S3M A;  3PM1 A;  2HEO A;  2BW3 B;  2HS5 A;  4R1H A;  2PMH A;  4U87 A;  2FU4 A;  3BJO A;  1FIA A;  4M74 A;  4Y17 A;  1LVA A;  1EH8 A;  5F1J A;  4S04 A;  3UKG A;  1BI3 A;  4YFN F;  2X85 A;  4J00 A;  3PQK A;  1R58 A;  2NNN A;  3GTO J;  5K7F A;  1SFE A;  2NXN B;  2HI3 A;  3FBI B;  1SFX A;  2E34 A;  3E97 A;  2KJC A;  1JKO C;  1P6R A;  3K4L A;  5DCF A;  3C2B A;  1KU2 A;  2ELH A;  3V42 A;  1ONV A;  2EV0 A;  3QOP A;  3TO6 A;  3WG9 A;  1K78 A;  3H5R A;  2JA6 J;  3E5Q A;  3HTU A;  3K1P A;  2JA2 A;  4I01 A;  2DCE A;  2XVC A;  2IA2 A;  1FP1 D;  2IBD A;  4IQJ A;  1G3Y A;  5J1R A;  1MH4 A;  3B73 A;  2LBF B;  4ZYD A;  2I10 A;  4CYC B;  5CVJ A;  1XDS A;  3H9Q A;  1D0Z A;  4L9T A;  4HYE A;  2EFN A;  2IA1 A;  1R7J A;  1GLN A;  1P4A A;  3LSP A;  4NC6 A;  4B1R A;  3S2H J;  3FXU A;  4ASN A;  3RPU D;  5GTI C;  2PFB A;  3OSF A;  1VQM I;  3BJA A;  1Z05 A;  2MH9 A;  3WU2 C;  4XRS A;  3H3V K;  1G4D A;  3OYE A;  3HOW J;  1Z0X A;  1QZE A;  1MBE A;  3FXQ A;  2DK8 A;  1U5T C;  2O8X A;  4YIR X;  1UG2 A;  1MMA A;  3WGH A;  2EH3 A;  3K7A J;  4D0P A;  2BY2 A;  3F8M A;  1Z9C A;  5LHG A;  4AYB N;  3OYC A;  5EJC A;  2RKH A;  1S7A A;  1K4T A;  2Q0O A;  2DXI A;  1QHH D;  1W1W E;  5J4V A;  4FET A;  4CYD A;  3V7C A;  4XKW A;  1AWC A;  4ZDO A;  1LFB A;  1LNW A;  1UHM A;  5DUK A;  2R7X A;  1MJB A;  3CCM I;  1FEX A;  2CQK A;  2X1D A;  4K2E A;  1MND A;  3GWZ A;  5FFZ A;  3N4M A;  3W6V A;  1VQK I;  2L5Q A;  4GCV A;  4LK0 F;  2O3F A;  5M3M J;  3HHG A;  2OU2 A;  4AIJ A;  2KL4 A;  2EJR A;  4C30 A;  3WHB A;  1RI7 A;  3BTL A;  2VBW A;  4E7Z A;  2C6Y A;  3PQJ A;  3HZJ A;  1JKR C;  5EF6 A;  1YJN I;  1UEL B;  2LR8 A;  2W25 A;  3C1D A;  4HNU A;  2DDA A;  4Q47 A;  3K1N A;  3VYT B;  2CYY A;  3K4J A;  1R5I D;  1OFC X;  2JPC A;  4D9J A;  2EIJ H;  4KFC A;  2JA5 J;  5IT9 K;  2ID6 A;  2EIM H;  4RGU A;  1G3W A;  1F4K A;  3CMY A;  2L54 A;  5D6E A;  5EG0 A;  2HDD A;  1FTZ A;  4I98 B;  2KRF A;  4HPQ A;  3QPS A;  3FM5 A;  2XAU A;  4C3H J;  2ZJ2 A;  3GFI A;  1BIB A;  3R6S A;  1BN5 A;  3R0J A;  2VQL A;  1ZEL A;  4FE4 A;  1SVM A;  1TQM A;  3DTE A;  3GUD A;  3LQR A;  2RAE A;  1TW2 A;  2VQC A;  1O3S A;  1FOK A;  3M3Y J;  2F5V A;  2K9Q A;  1OCZ H;  1XCB A;  2ZBK A;  2B9S A;  2DBB A;  1I1S A;  3FF5 A;  4YFK F;  4XON A;  4Y52 J;  2Y30 A;  1E0E A;  1FWZ A;  2XKP A;  4QLC U;  1XD7 A;  4A5N A;  2CQN A;  5E8I A;  4BDY A;  5L3F A;  5L3B A;  5F04 A;  3GZ5 A;  3VOD A;  2QQB A;  2KIF A;  3K4K A;  3OOU A;  2VAS A;  3K70 D;  3CME I;  2BHZ A;  2MC3 A;  2E1N A;  2DJN A;  3RTR A;  2EZH A;  2QYO A;  2DPU A;  2H8R A;  1LQ1 A;  3Q0U A;  1QRY A;  2QM3 A;  5FRN A;  2M3A A;  4F3Q A;  2WAQ A;  5F1R A;  2F4O B;  1BA5 A;  2CUE A;  3RJP A;  3O2P E;  1OMI A;  2OF7 A;  2Y0S A;  3DPU A;  2EQR A;  5ILS A;  1PUF A;  4XSX F;  1IV6 A;  1MBF A;  4HEA 2;  3S1R J;  2WV1 A;  1ZG1 A;  2Q8K A;  2ELJ A;  3WTU C;  2FD5 A;  2XRL A;  5E17 F;  2IA0 A;  1CF7 B;  4GXO A;  1HLV A;  3HJE A;  4KYW A;  4OIR F;  3JRI A;  2FBH A;  3OL3 A;  3O8G A;  1KU3 A;  4II3 A;  1BJZ A;  3RKY A;  1YO5 C;  3D1N I;  3N05 A;  1VFC A;  2PG4 A;  5L3D A;  5KK1 A;  3ULQ B;  3DWL E;  1V54 H;  4D7N A;  3G6E I;  1GDT A;  4Z6Y A;  4KIS A;  3DCF A;  4XKC A;  3ZR8 X;  2ZXJ A;  3C2H A;  2ACJ A;  3KP6 A;  2ME6 A;  2F2E A;  2OA4 A;  3H0D A;  4J01 A;  2XAG A;  1SMY F;  3CLQ A;  1OCC H;  3Q0V A;  4YEL A;  1MDM B;  3M9A A;  2FE3 A;  2VL8 A;  2ZJR F;  4PUS A;  2XGC A;  2QKM B;  3C3W A;  4OOI A;  4GFB A;  2UUZ A;  2DT5 A;  4EGY A;  1WWX A;  1ZG3 A;  2GXG A;  1VQ5 I;  1FNN A;  3O3K A;  4Y4R A;  4E7H A;  3Q5F A;  1FY7 A;  2HVQ A;  3AFH A;  3TW6 A;  1Z67 A;  1OCO H;  2TDX A;  4A3D J;  1IDY A;  2W4S A;  2MSY A;  4PGH A;  3ZQH A;  4KIT B;  2DA1 A;  5ICE A;  3NRV A;  3OYK A;  2BY3 A;  4JP0 A;  4HV5 A;  4DBQ A;  1ZRD A;  2A05 A;  5JVT A;  1I27 A;  2Y0M A;  2PQ8 A;  1GXQ A;  1NK2 P;  2F5D A;  4RLF A;  2E1C A;  1VQL I;  2R7W A;  3KYC B;  5E3N A;  2F4I A;  5EEH A;  4D5C A;  3CC7 I;  3BDD A;  1WH7 A;  1MMG A;  4XM3 A;  3MKZ A;  2M7B A;  2P7C B;  1QGP A;  2DO7 A;  1YIO A;  4AVZ A;  1I50 J;  4EM1 A;  4ENM A;  2XC7 A;  3KCC A;  4AD9 A;  3HBL A;  3QPL A;  5CVV A;  3HC7 A;  3QOD A;  3PIP F;  2DOE A;  1K78 B;  2R5Y A;  1WQ2 A;  4RB2 C;  3GX4 X;  2OJE D;  1XSD A;  1DP3 A;  1WFX A;  4EJU A;  4PSW A;  4F91 B;  1HCR A;  2K4B A;  1HKQ A;  1HA8 A;  1X19 A;  5CQG A;  1K79 A;  3VOE A;  1RKT A;  5TJJ A;  4BBS J;  1EV7 A;  1UMQ A;  2KRC A;  4QPQ A;  5GPC A;  1U3E M;  2WAF A;  2JMW A;  1I6X A;  4F92 B;  2H6B A;  5DUI A;  1WJE A;  4M6X A;  4M9S A;  1MIJ A;  3ZQG A;  2JTV A;  1G59 A;  1X1P A;  1DPR A;  4BYY A;  1GXP A;  4DW6 A;  2R7D A;  1D5V A;  3KLN A;  2ECB A;  1IN4 A;  3O8H A;  2W7N A;  3JRD A;  4ABZ A;  4AM3 A;  2KZV A;  1T56 A;  3BQZ A;  1IO2 A;  2CW0 F;  2O03 A;  3H36 A;  3U9G A;  4HF2 A;  4XLP F;  1EJ9 A;  1FLI A;  1SAN A;  1Y56 A;  4LD5 A;  4XN3 A;  2V7F A;  3RYR A;  3ZQF A;  3TO7 A;  2X6Y A;  3A02 A;  3BJ6 A;  1FYM A;  1TQI A;  2BY0 A;  1BOB A;  4IHX A;  2H27 A;  2A69 F;  1TT0 A;  4UUV A;  1R36 A;  5DV5 A;  4EGZ A;  3H35 A;  3TL4 X;  2XKO A;  3H9G A;  4RAF A;  3ZMT A;  4LIT A;  1P4X A;  2DQR A;  4EJV A;  1B9M A;  2HYG D;  4IZZ A;  4QIW N;  4BJ5 C;  1P7J A;  3TQN A;  3ZMU A;  1LDK B;  2Y2Z A;  3E3V A;  1IRG A;  1AA7 A;  4U0W A;  1ENH A;  2IGM A;  3NQO A;  4I76 A;  3PIO F;  1VND A;  4XLF A;  1KU9 A;  1OR7 C;  4HAM A;  1Z21 A;  1HKS A;  4CCO A;  5HDN A;  2GLO A;  5J8C A;  2KJB A;  3QPT A;  4IOC F;  4G94 A;  4ZDL A;  4XRF A;  4RBO A;  3GFJ A;  2LD5 A;  3LA7 A;  4LFU A;  3S3O A;  1A04 A;  3CCE I;  1RRJ A;  3JCU C;  4RS8 A;  5EG0 B;  2R5Z A;  2GA2 A;  3NAR A;  3VDX A;  3CUQ A;  3WU0 A;  1VQ4 I;  1IRF A;  4KMF A;  5FRO A;  4ENJ A;  2K9S A;  2E2I J;  2GM4 A;  2K3P A;  3E7L A;  3R60 A;  4AIH A;  3EUA A;  2E35 A;  3JRF A;  2RRE A;  5IOY A;  1REP C;  1Z7U A;  2R7S A;  1WCM J;  3DLA A;  3ABT A;  2M8E A;  4HF0 A;  1L3L A;  4GRI A;  1XSX A;  2ISZ A;  3FXJ A;  3MZ8 A;  3B6A A;  4UVC A;  2JA7 J;  4E7S A;  5A2Q Z;  4WWC A;  2CRG A;  3K70 C;  2R7Z J;  2DMU A;  4AWX B;  5GAG J;  4A93 J;  3VYR B;  3CZ6 A;  3C2G A;  4JX4 A;  5FGM A;  2MC4 A;  4L5E A;  1HF0 A;  1Z6T A;  1A35 A;  3MKY B;  4HNV A;  3OYL A;  2VQH A;  3BTJ A;  3P9C A;  1F36 A;  2RDP A;  3CLO A;  5FKO A;  3WTY C;  4IJA A;  2CO5 A;  4NUB A;  5D5V B;  3COA C;  3HUG B;  4CZC A;  4OIO F;  1HW1 A;  5E79 C;  3S93 A;  2VLA A;  3SZP A;  2OQG A;  2LVS A;  4P55 A;  3FXO A;  5ILV A;  5C4X J;  2P6S A;  2KIM A;  2R93 J;  1VQ6 I;  5D5U B;  1PUF B;  3QQA A;  2LF8 A;  2D1H A;  3RIR A;  3V7S A;  4XQF A;  2DW4 A;  4XLA A;  4E4H A;  1NH3 A;  3RKQ A;  3MFK A;  1O7F A;  2HWV A;  2CFX A;  2LY9 A;  5F6F A;  2XAF A;  3L09 A;  3FDY A;  3OOP A;  1RPW A;  3PFI A;  1JT0 A;  2HOS A;  2XB5 A;  2RQQ A;  1JXS A;  4BHB A;  2FQ3 A;  4FTH A;  4A3G J;  1XC5 A;  2XRO A;  5HVQ C;  1FP2 A;  1ZRC A;  5KAI C;  3MKW B;  3S14 J;  1R4N B;  1ETV A;  4BHP A;  2A5W A;  4FE7 A;  1FX7 A;  5GTH C;  4BY1 J;  2OPT A;  2MGQ A;  2L01 A;  3A2K A;  4NDL A;  2ISY A;  1JJ6 C;  5EZG A;  2E2H J;  3CO6 C;  4JYK A;  1Q1V A;  2P7V B;  1X3W B;  3K9T A;  2VE9 A;  1JGG A;  5FJ8 J;  4R79 A;  4XID A;  4E7J A;  2YPR A;  4A3J J;  1EH6 A;  1ZGW A;  1JGS A;  3AG1 H;  5F0C A;  1X2M A;  5IP9 J;  2HOA A;  2ZME A;  2LF7 A;  2VT3 A;  2DOA A;  2NRA C;  3U21 A;  1YTY A;  3WG7 H;  1SD6 A;  2GQQ A;  2AO9 A;  2VIX A;  4DQ2 A;  3J7A O;  2CV1 A;  1TW3 A;  1J5Y A;  3E6C C;  3BT9 A;  1KU7 A;  5KAF C;  3CCY A;  3ZN1 A;  5H20 A;  1ZK8 A;  2KDZ A;  4M73 A;  4C9Y A;  1H9G A;  1SFO J;  2HQR A;  1KYZ A;  1WPK A;  2HKX A;  3I0T A;  4LOC A;  2Q1Z B;  5B1B H;  2D45 A;  1R6R A;  2LC2 A;  2IEK A;  3B6C A;  1TC3 C;  4FIS A;  3ZN0 A;  2ID3 A;  3OYH A;  1LUJ B;  3F6O A;  1W7P A;  1VZ0 A;  3HOZ J;  2H6C A;  2JUG A;  2VJ5 A;  2LK2 A;  4X0G A;  4UUS A;  3S17 J;  2Y69 H;  3PNV A;  1BM9 A;  4LB6 B;  2L9R A;  3A4C A;  2K5C A;  3EUH C;  4MIM A;  3F8N A;  2EIL H;  3SXY A;  3E6M A;  4M72 A;  3F21 A;  3LA2 A;  2QUF A;  2A68 F;  1OJL A;  2BE5 F;  1IW7 F;  2W1O A;  4IVN A;  4OIN F;  2FNA A;  3OIO A;  3GTJ J;  2EV6 A;  3LQQ A;  1ZYR F;  2KLO A;  4XLE A;  1WI9 A;  4PJJ A;  3D5R C;  3LWF A;  1A36 A;  1OKR A;  3OSG A;  1MNE A;  2E71 A;  2KP6 A;  1BL0 A;  1ZLK A;  3ZOB A;  2OTL I;  3GTG J;  3DP7 A;  5CJ9 A;  1BC8 C;  2VI6 A;  1MZB A;  4BQN A;  2D5V A;  3HKZ N;  2V26 A;  4ENN A;  1V3F A;  4GDF A;  2STT A;  4O5V A;  2ECC A;  3KP4 A;  4NBQ A;  3T1B A;  4MO7 A;  4MTD A;  3S8P A;  5IY5 H;  1Q1H A;  4G6D A;  1A6I A;  2L7F P;  1W4M A;  4BXU A;  2XAS A;  1LB2 A;  1IN7 A;  1PUE E;  1SD5 A;  2M87 A;  4XLC A;  4C3J J;  1TNT A;  4XLN F;  4BQA A;  2W84 A;  3SFI A;  1ITY A;  2XRN A;  1SC7 A;  1D1C A;  2GAU A;  2A6E F;  2VC0 A;  3OIQ A;  1OCR H;  1EA3 A;  4UNO A;  3NWT A;  4IF4 A;  1J59 A;  3BZC A;  3L7W A;  3CMM A;  3FMQ A;  3U2R A;  3TDU C;  3A0H C;  2CV0 A;  1E3H A;  2LKX A;  2LTP A;  1XCV A;  3WTZ A;  2HZT A;  1ETO A;  3HL2 A;  4IRG A;  3EUK L;  1GT0 C;  2VKV A;  3CP2 A;  3F8B A;  1KYW A;  2LLK A;  2LKS A;  4XL9 A;  1ZHF A;  3NWS A;  4N9I A;  3L2C A;  3KYD B;  3J81 K;  1R00 A;  4C2M J;  3S2W A;  5HNH A;  2ZC2 A;  5IYB J;  4OIQ F;  2W85 A;  1LPQ A;  3BG3 A;  2JQ7 A;  5BMZ A;  3GO5 A;  2BY1 A;  3PNT A;  1N25 A;  3KE2 A;  5HOO A;  3AG3 H;  4A3M J;  4F7Z A;  4CUG A;  1W0T A;  2LOO A;  2M8G X;  3GW2 A;  2IGO A;  2FEZ A;  3SJM A;  1B59 A;  3OYI A;  1BW6 A;  4WCG A;  2Z3Y A;  2PX9 A;  4F52 A;  5F0H A;  3W2V A;  1A31 A;  4I2O A;  1XB4 A;  5FKM A;  5DEQ A;  1B8I B;  4YIF A;  1J0R A;  5A2Q K;  4OAZ A;  3OS1 A;  1ETY A;  5C3E J;  2EFQ A;  4A3F J;  3FXL A;  3G73 A;  4XLH A;  1ZGJ A;  3I4M J;  1FBQ A;  3DF8 A;  3G1M A;  1V55 H;  2LKP A;  4RGX A;  4QTR A;  2M34 A;  1WKM A;  2X51 A;  1MSF C;  2YU9 J;  3U1K A;  1T8I A;  4L5I A;  2LY2 A;  2V4J C;  1YX3 A;  1JUM A;  1FOY A;  4M9Z A;  1FYL A;  4KN7 X;  1BIA A;  4HF1 A;  1E3P A;  1NHA A;  3WOD F;  1OPC A;  1G3T A;  1MMN A;  3T8T A;  2XSD C;  2XF5 A;  2ZNZ A;  4MQV A;  3GEZ A;  5K1Y A;  2DFF A;  3SFZ A;  1MNM C;  3J80 Z;  2QWW A;  3ML6 A;  2VJJ A;  1SD4 A;  1TWC J;  3PJR A;  3GLX A;  1IV8 A;  4AU7 A;  1SAU A;  5LBQ A;  1UZC A;  2F5C A;  1X3U A;  2IRF G;  4KIC A;  4ZJZ A;  4H0E A;  4XKB A;  3QU6 A;  4XOR A;  1T0F A;  1MSE C;  5KVR A;  2ZB9 A;  1B6A A;  2XGD A;  5GAD J;  5KHD A;  2EPF A;  3ROU A;  2XPV A;  3LSH A;  5FKN A;  1OCT C;  3IKT A;  5L3G A;  3CCS I;  3Q9V A;  5GAE J;  1X1B A;  4CXF A;  2V79 A;  3TP0 A;  3B02 A;  5E3L A;  3FXK A;  3I53 A;  1WRJ A;  2L7M P;  1YJW I;  2VBZ A;  2YUS A;  9ANT A;  2D1V A;  1MMS A;  2WB1 A;  5H2F C;  4HLX A;  1MMD A;  1RZ4 A;  3BR5 A;  3SDG A;  3I3L A;  2QA4 I;  3AG4 H;  4B47 A;  3RYP A;  2O9L A;  3SZT A;  4I02 A;  2FOK A;  2AQF A;  3S1N J;  3IWZ A;  1ETX A;  2VJI A;  3VYU B;  4IRI A;  1ORK A;  1ON1 A;  2BXY A;  2F5F A;  2J5O A;  3BQY A;  4GYG A;  1BI1 A;  3TW7 A;  4A3K J;  2DMP A;  1Y6I A;  2RV8 A;  5E18 F;  2E5N A;  4HOB A;  4P9U A;  1PP8 F;  2L4A A;  2HDW A;  3PO2 J;  2IJL A;  4IOA F;  1BBY A;  1LFU P;  4FT8 A;  3KP7 A;  3W6K B;  3M8E A;  4U0V A;  5AON A;  2ZXH A;  4E7K A;  2O6G E;  2M5W A;  2WAQ N;  3ECO A;  3V8J A;  2P6T A;  5HNF A;  1T38 A;  4LLN A;  3KZY A;  3ASO H;  1ZR4 A;  2R7O A;  4BNC A;  2V9V A;  4FX4 A;  4JK1 X;  3S32 A;  5FD5 A;  1FPQ A;  5LEK A;  2ZME B;  5B3S H;  4JBA A;  1I6H J;  3REO A;  5JHF A;  3ZQI A;  5BPI A;  1D8J A;  1I39 A;  3DTK A;  2HQA A;  3KIO A;  3D5L A;  1YX5 A;  3GCM A;  2HYJ A;  4LIU A;  5E1X A;  2HVS A;  3F6V A;  1G8X A;  3TP3 A;  3GME A;  4OMY A;  2MBF A;  1G3S A;  4RAY A;  1S7O A;  3HSF A;  1W7P B;  4I6Z A;  1ZG5 A;  4M71 A;  1TP4 A;  6PAX A;  5ICF A;  2CQQ A;  2OV7 A;  4IXA A;  2MYS A;  5E1Z B;  2P5L C;  1Z3X A;  4LG0 A;  1A5J A;  2DA3 A;  2M4K A;  2M1B A;  1IXC A;  1Z1D A;  2HXI A;  4JX5 A;  2JA8 J;  3A1Y A;  1TWG J;  3ZRG A;  1PDN C;  3MN2 A;  3FX3 A;  2MLG A;  1W5S A;  3OR2 C;  4CDG A;  3CCQ I;  1NK3 P;  2X4H A;  1BJA A;  3W6J B;  4WK8 F;  1S5L C;  3F3X A;  1RR7 A;  2IS6 A;  1WSU A;  4DNC A;  3I9V 2;  4FX0 A;  3HDD A;  3S15 J;  2Z5U A;  2Y75 A;  1YFH A;  1YLF A;  3M07 A;  1H0M A;  3KX2 A;  4DYR A;  1HQC A;  1YYV A;  1FOX A;  4RDU A;  3GF2 A;  2K02 A;  2XDV A;  2M2E A;  4XKV A;  3ECH A;  4FQG A;  2NVT J;  5D6F A;  2F6C A;  4CCJ A;  3I4N J;  3D5S C;  2V1X A;  1H9T A;  2BVM A;  2MG4 A;  3RZO J;  3CJR B;  4PJL A;  4A3C J;  1UB9 A;  1A6Q A;  3TOB A;  1JJ8 C;  4KNY A;  1K7A A;  1E17 A;  2ELK A;  1S29 A;  1HW5 A;  3CDH A;  1QZZ A;  3LSJ A;  3BPV A;  5FKK A;  1ODD A;  2FSW A;  4A0Z A;  2DPD A;  1R23 A;  2M4G A;  4UY8 I;  5E1W A;  1MKM A;  4IHV A;  3M1C A;  1AKH A;  2JK3 A;  2HGC A;  1S7E A;  5E20 A;  1AOY A;  1D0Y A;  3FHN A;  2K40 A;  4CCK A;  2CV2 A;  2IGN A;  1E3O C;  3M4O J;  3C18 A;  2X6W A;  2DI3 A;  1L0O C;  1X1D A;  1YW9 A;  1O3R A;  3I58 A;  4BEH A;  3JRG A;  2EK5 A;  2RGV A;  1D1B A;  5GP9 A;  2FOW A;  1Y8Q B;  4DZJ A;  1UHS A;  1P9Q C;  4AIK A;  2JSC A;  2AXT C;  1G6N A;  3OMY A;  1X4O A;  5BPD A;  2DJI A;  1RUN A;  4Y15 A;  4LMY A;  4A12 A;  4ZH4 F;  1DPU A;  4AVP A;  2K4J A;  3HYI A;  2MD0 A;  1ACI A;  3CD6 I;  2OZU A;  5GAH J;  2NVX J;  2F4M B;  3MQ0 A;  2QSF X;  2LFB A;  3H5A A;  3J7A Y;  2O61 A;  3TDZ C;  2JUC A;  2MA3 A;  3DTI A;  5J40 A;  4HSR A;  1U8R A;  4BKX A;  3W2A A;  3UR3 C;  1U9O A;  2PMZ N;  2UXN A;  4Q4Z F;  4LK1 F;  5HLI A;  3JAM Z;  3I59 A;  3QWL A;  2ZCW A;  3HSR A;  5H6R A;  1K6O A;  4O6J A;  2XPW A;  1VQO I;  4I7H A;  1TL8 A;  1N77 A;  3PUF A;  4L9V A;  1O4X A;  1F5T A;  2PJR A;  2DLL A;  2X6O A;  3IHU A;  3LA3 A;  3QYF A;  5LLQ A;  4P5O A;  3LSR A;  1X1C A;  2QF7 A;  4I99 C;  4HST A;  4WXH A;  3BR2 A;  2DMQ A;  2DA5 A;  5HDK A;  4IHY A;  3MMY B;  4BQQ A;  2LRE A;  5CVR A;  2LSO A;  3MWM A;  5EDN A;  1S72 I;  4HZF A;  2OTJ I;  3I64 A;  4ANJ A;  5DDG A;  2P5V A;  3KP3 A;  3VSL A;  3ESW B;  4YEJ A;  4KT6 A;  2GBY A;  1B4A A;  2HNH A;  2JWT A;  2JVG A;  2JSP A;  2DU9 A;  2R0Q C;  5L3C A;  1XGM A;  1KA8 A;  4LGW A;  2XAJ A;  2PEX A;  1NG7 A;  3CF5 F;  3CCV I;  2HTS A;  2O7O A;  2ZSH B;  3EET A;  3HOY J;  1DU0 A;  1F43 A;  2VBY A;  4LJZ F;  3LSM A;  3JRH A;  4MQ9 F;  2KHM A;  1XPX A;  4RAG A;  2WAD A;  1GV2 A;  3ZQ7 A;  1U78 A;  5J1Y A;  3CMA I;  1MD0 A;  2E60 A;  4A3I J;  4PSX A;  3P9K A;  4HA8 A;  3ZQL A;  1X4P A;  3CDL A;  1Z3Y A;  4N9H A;  4X1E A;  3ABK H;  2PJP A;  2E36 A;  3MD2 A;  3P5J A;  2DT6 A;  2HFH A;  5FLX Z;  2L9N A;  3JTH A;  1OYI A;  2B0L A;  1USS A;  1CQT A;  3QYB A;  5CQE A;  5HS9 A;  3F8C A;  2HOT A;  4Y3O A;  4CCM A;  2OAZ A;  3CF2 A;  2VON A;  5EZH A;  2ETH A;  3HOX J;  4M3F A;  4A5M A;  3WTV C;  3LSK A;  3IH2 A;  2V1D A;  3QP6 A;  3O6B B;  1R1V A;  2EFP A;  1FTT A;  3CUO A;  4BU2 A;  2DFE A;  4H4K C;  3NEU A;  3T5X A;  3KP2 A;  2L7Z A;  1LE8 A;  2QQ8 A;  2OCC H;  3GTM J;  2AXL A;  3BY6 A;  2QGU A;  1SVO A;  2LDU A;  5K5Q A;  5E3O A;  1KQ8 A;  4MFE A;  5HOD A;  3ZMS A;  2HPI A;  4HW0 A;  2QSH X;  5F64 A;  2BV6 A;  1XMK A;  4YG2 F;  4LLG F;  4B8X A;  1W7P D;  2HU9 A;  1LDD A;  2W48 A;  4XN0 A;  4E7I A;  2LH9 A;  2BW3 A;  4IHS A;  3KLO A;  3K4N A;  2E1O A;  2DQL A;  4PDK A;  2M45 A;  2OZ6 A;  1T08 B;  2H09 A;  4WXC A;  3FZV A;  2L0K A;  3KEQ A;  3SHF A;  3J7Y J;  2I5U A;  3OYN A;  2MD5 A;  5FKL A;  4B09 A;  2N8G A;  1IN6 A;  2M9H A;  4L9N A;  2K7L A;  2GIV A;  4M3G A;  3L1P A;  4XBF A;  3HSE A;  2BHY A;  1VF9 A;  2DT7 B;  3R4K A;  4CA0 A;  2HZD A;  4ON0 A;  3L9F A;  3BR0 A;  4Y7N J;  2R7U A;  3N97 A;  3KEY A;  1STZ A;  5BS6 A;  4NQW A;  3OY9 A;  2WY7 Q;  2IS1 A;  4ZTF A;  4LG0 B;  2XSJ C;  2H8W A;  3ZCO A;  1OLT A;  2FX0 A;  1X3Z B;  2RC4 A;  1JHH A;  4A3L J;  4TV7 A;  2X1E A;  4BH9 A;  2IS2 A;  4BJ6 C;  1LEB A;  4I09 A;  3BCB A;  1YG2 A;  4B3A A;  4PGG A;  4OAY A;  4EJT A;  3VYS B;  4CYC A;  1OQY A;  3OV8 A;  3ZMZ A;  1GVD A;  1DU6 A;  1T95 A;  3RKX A;  3DKW A;  5ILU A;  2UZK A;  3L00 A;  3RPQ A;  2ICW G;  2LNB A;  3EQL F;  3JRE A;  1C0W A;  3CC4 I;  1NG6 A;  2VXZ A;  4IRH A;  2J5P A;  2DOF A;  2EFW A;  4PFO A;  1QNT A;  2GXB A;  1MJ9 A;  3S1Q J;  4XSZ F;  4XOT A;  1I1G A;  4JQF A;  2W82 A;  2AS5 F;  2VOP A;  4BE1 A;  3JW4 A;  3Q0W A;  4BAC A;  3CC2 I;  1XSV A;  2DMN A;  3K4B A;  5CVI A;  2DOD A;  2YX4 A;  3IAM 2;  4L5J A;  3KZZ A;  3GTL J;  3DBL B;  1ZQ3 P;  2ZFU A;  4I0A A;  4F55 A;  3R61 A;  2G7H A;  2WBM A;  4XOP A;  3KYL A;  2XGX A;  2XHK A;  1EKE A;  2DYR H;  4UVA A;  2STW A;  1WJA A;  4W97 A;  1Y8R B;  2Z1D A;  2WA0 A;  3RZD J;  3S1M J;  2BBY A;  4HX8 A;  2NVU B;  3G2B A;  2CS3 A;  2DN0 A;  4Y33 A;  4U7D A;  3OS0 A;  2DA6 A;  2OBP A;  4V2G A;  2EB7 A;  2NAZ A;  4XIC A;  3CUQ C;  3BZ6 A;  3WTW C;  4N4N B;  3PSI A;  4BEH B;  2IT0 A;  3RKW A;  1S3J A;  3NAU A;  4PJ0 C;  4KIG A;  2X1C A;  1WJ5 A;  2HOE A;  4II2 A;  1IG7 A;  2COB A;  1GHC A;  2RVC A;  1BR2 A;  2GOM A;  5TRD A;  3EPZ A;  1R22 A;  3J7Z I;  2CFO A;  2UV1 A;  3ONQ A;  3JAM K;  3OYG A;  1XS9 A;  3LFK A;  4HDV A;  3FK6 A;  3FHZ A;  3FXM A;  4ZTJ A;  4PJM A;  3DPT A;  4EM0 B;  3VB2 A;  3WE3 A;  1QA6 A;  4IX7 A;  2JJ7 A;  5JR3 A;  2Q2E A;  4NHJ A;  2OD5 A;  5IT3 A;  2VPL A;  3L2U A;  1XMX A;  4A0Y A;  1ZRE A;  5LRS A;  5IYC J;  3S3N A;  2CW8 A;  3WTS C;  3S16 J;  5IT9 Z;  2WY8 Q;  3I59 B;  3H0G J;  3L2Q A;  5FO5 A;  3ABU A;  3G1L A;  3I56 I;  5FB2 A;  3LSI A;  5ICG A;  1BI0 A;  1T2K A;  3ELK A;  3JTG A;  2R5Y B;  3HHH A;  1T39 A;  3VWB A;  3IH3 A;  2CWE A;  5D4R A;  3BG9 A;  3GFM A;  3SDB A;  1J09 A;  3DKY A;  4XRM A;  3A03 A;  1LDJ A;  1RKW A;  3BG6 A;  3IWF A;  4MEX F;  4KA4 A;  1WJF A;  1ZR2 A;  3TED A;  2DMT A;  3MKL A;  2H1K A;  2L9S A;  3HGG A;  2ME0 A;  4XNF A;  3OS2 A;  3Q3S A;  1GV5 A;  2KRH A;  5TGT A;  2RNJ A;  3E6D A;  1D1A A;  2Y9Z A;  2Z9O A;  1SFU A;  3IUO A;  4BBR J;  4A0X A;  1ZAO A;  4BXX J;  2COM A;  3M8J A;  2VUM J;  1I5Z A;  3F72 A;  3KET A;  3WE2 A;  4I0B A;  5FLX K;  5FFX A;  2NS0 A;  4ZYG A;  2EV5 A;  1IGN A;  4C3I J;  3H3Z A;  1IF1 A;  2EZL A;  3V7R A;  1W36 D;  5DD4 A;  4BHC A;  4IKF A;  2O5R A;  4A6D A;  1KQ0 A;  1JUP A;  5M5X J;  2A3S A;  3ZXS A;  3HOU J;  2BVL A;  4ESB A;  3AKZ A;  2DK5 A;  2XAH A;  5ICC A;  2MH2 A;  3CQZ J;  1ERD A;  3D0S A;  2IGK A;  2RNG A;  4OIP F;  1S8N A;  3ZGK A;  1OIS A;  2UXX A;  3X2Q H;  1U5T A;  3BRO A;  1SFK A;  2KT0 A;  4NC7 A;  3IRQ A;  1UFM A;  3K69 A;  4YFX F;  2QEX I;  2DA7 A;  2O8K A;  2NYX A;  2ZME C;  5LGN A;  2R92 J;  3KPH A;  3GTQ J;  4RB3 C;  4CGZ A;  1K61 A;  3DKX A;  3RI4 A;  1VQ8 I;  3TMO A;  4ZYH A;  3FXR A;  3HM5 A;  4UB6 C;  3IH4 A;  1Y39 A;  1SD7 A;  1FZP B;  2MLK A;  3LMM A;  5AIQ A;  5EYR A;  5BQT A;  1IN5 A;  3V8K A;  1ETW A;  2E7W A;  1R5G A;  4KIB A;  2IS4 A;  4E7L A;  1MDM A;  4WX9 A;  1FIP A;  2NS7 A;  1LE8 B;  1WVR A;  3OYB A;  3SYT A;  1LEA A;  4G7O F;  1FSE A;  1I3A A;  1BC7 C;  1UG0 A;  1X58 A;  5LEJ A;  4UXN A;  3G4S I;  1YIJ I;  1IRX A;  3KEO A;  3HOS A;  1Z77 A;  4NC8 A;  4P1W A;  4DJA A;  2R5Z B;  4KMU X;  2LY1 A;  4G6Q A;  5EEG A;  3CUQ B;  1LKX A;  2GXA A;  4Y13 A;  4RGR A;  4L18 B;  2XPU A;  4DIQ A;  4EJO A;  3LAP A;  1QHG A;  4WF2 A;  4D1Q A;  1OCP A;  3H9J A;  1UHW A;  3JRB A;  2Z99 A;  2NVY J;  5IP6 A;  4U0Y A;  2WB1 N;  4CSW A;  1LFP A;  1WGX A;  4BDZ A;  4DOZ A;  4A2U A;  2KQR A;  1MBH A;  3OWT A;  3BTC A;  3DEW A;  3H92 A;  3IP4 B;  3E5X A;  2Y31 A;  4PK4 A;  1QO0 D;  1S9H A;  1VQ7 I;  3K1M A;  1ZN2 A;  4IQ4 A;  1SEU A;  2V6C A;  1FBS A;  2VXD A;  2Z16 A;  3FK7 A;  5D5W B;  2DDB A;  2L4M A;  3H5N A;  3ZQQ A;  4KN4 X;  3JRA A;  4G8X A;  5J8F A;  2DTR A;  4NQW B;  2V9K A;  3QYE A;  1XGS A;  3BOQ A;  3RQI A;  4EEF G;  2G0E A;  3M8F A;  4CCN A;  1BR1 A;  2EA2 A;  4NB5 A;  1FYK A;  1T33 A;  2V6E A;  1B9N A;  4KT5 C;  1XMA A;  2CQ7 A;  1K4S A;  2PMU A;  5FRM A;  2FMY A;  4G6T B;  1TWF J;  2MFZ A;  4DBR A;  2AHQ A;  3BLY A;  1JE8 A;  3HG9 A;  4S05 A;  3LOC A;  1UCR A;  1JTX A;  2JN6 A;  2KKO A;  1RES A;  2LMD A;  3JR9 A;  2ADU A;  2DA4 A;  2A6T A; 
#chains in the Genus database with same CATH homology
 4Z2Y A;  5D4S A;  2QQ9 A;  2GZW A;  2X0L A;  1YS6 A;  1O3T A;  1OYW A;  2Y48 A;  3JSP A;  3DFG A;  4U88 A;  2YSR A;  2O0Y A;  2W57 A;  3TGN A;  2IW5 A;  1MJA A;  3JSO A;  2CGP A;  2IPQ X;  3E6B A;  3U1D A;  3I5U A;  2QQA A;  4HX7 A;  2HTJ A;  5JFR A;  3V4G A;  2HKO A;  4P9F A;  1O57 A;  3MAJ A;  2L02 A;  4ENK A;  3WTX C;  1XGO A;  1YQA A;  1XN7 A;  2FF4 A;  1U6G A;  1J75 A;  1FSH A;  5FD6 A;  3WU1 B;  4G7Z F;  2HQN A;  3V8L A;  2FBK A;  1FBU A;  4ZZD A;  4HDU A;  5LGU A;  1U2W A;  3CO7 C;  2QEN A;  3F8F A;  3ZP5 A;  5AIP A;  1QQI A;  5JHU A;  2PLY A;  3BPX A;  2UWM A;  3Q9S A;  3ERE D;  1VTN C;  2JRT A;  1B1B A;  2QVO A;  4BAY A;  2FA5 A;  5CVU A;  1SAX A;  1O3Q A;  1D3Y A;  1FC3 A;  2WV0 A;  4KDP A;  4M9X A;  2HYF A;  4R8H A;  3G3Z A;  3I71 A;  3HUG A;  3I4P A;  3E5U A;  3GVA A;  3T8R A;  3GXO A;  1W5T A;  1J7K A;  2RN7 A;  1HSJ A;  1ON2 A;  4RGS A;  2OQR A;  3RPU A;  1TQP A;  2A6H F;  4U7B A;  3IRR A;  1ZRF A;  1ULY A;  3HRU A;  2VT2 A;  1T6S A;  1Z91 A;  2K27 A;  4IHT A;  5L3E A;  1QPM A;  3DXJ F;  4MEY F;  5CLS A;  3AAF A;  4HLY A;  5CYV A;  1U5T B;  5D8L B;  1T98 A;  1BOA A;  3DV8 A;  4E70 A;  2CSO A;  1DP7 P;  3WTT C;  2QZ8 A;  4RB0 A;  3GZ6 A;  3DPL C;  1Z6R A;  1E2X A;  4EMS A;  5BOX A;  3ZPL A;  3MZY A;  5DYM A;  2A5Y B;  2QBY A;  2BGC A;  4EV0 A;  3WGI A;  3F22 A;  3RDI A;  3QU3 A;  3DQV C;  3BWG A;  4OMZ A;  1R1T A;  3LST A;  4EQQ A;  2ZKZ A;  1OR7 A;  3HRM A;  2PBI A;  2FML A;  3FM3 A;  1DUX C;  2IP2 A;  3J80 K;  4L0Z B;  3M1E A;  1PP7 U;  4LLL A;  4PCQ A;  5HDG A;  3BP8 A;  5LRR A;  1TLH B;  2JT1 A;  2WWY A;  3VEP A;  2ZO4 A;  4MNU A;  3R0A A;  1YW8 A;  5HLG A;  2L3D A;  1ZLJ A;  3P9I A;  4QWQ A;  1MGT A;  4GYI A;  3ZMD A;  2Z33 A;  2YX7 A;  1J9I A;  2HR3 A;  4G9Y A;  4YII A;  1TNS A;  4MGR A;  3HTS B;  2P4W A;  5DCM A;  2XV4 S;  3VFZ A;  2PN6 A;  4EM2 A;  2VN2 A;  2M30 A;  2A61 A;  3IKV A;  2NNY A;  3T0Y A;  2FBI A;  3FWE A;  4GGG A;  2VOO A;  4HV6 A;  1FT9 A;  5ED4 A;  1V4R A;  2W24 A;  2XAQ A;  1IN8 A;  4UHT A;  1P2F A;  1XDU A;  5HS7 A;  4L0Y B;  1HW2 A;  1ZGA A;  4CHU A;  3TO9 A;  2R7F A;  3GYH X;  1OYY A;  5DD8 A;  2JPB A;  3EYI A;  1UST A;  1HXD A;  3P7N A;  3J81 Z;  5D8K B;  4ZZL A;  1F9N A;  1QBJ A;  1RIO H;  3H3U A;  2HDC A;  5LHI A;  2WTE A;  3MZH A;  2WC2 A;  5LHH A;  3KFW X;  3FMS A;  1HST A;  4UV9 A;  4MHG A;  3F23 A;  3ZMV A;  2IVM A;  3DEU A;  4O3M A;  1TBX A;  2ESH A;  4MTE A;  5JI6 A;  4L9J A;  1YS7 A;  4ZYE A;  3EUH A;  1O7L A;  2E7X A;  2FRH A;  4IPA A;  1SMT A;  4HQE A;  2P8T A;  2ESN A;  4A6E A;  5HS8 A;  3MEX A;  2K86 A;  1CGP A;  2BYV E;  5D5X B;  1JHF A;  2D2W A;  2VC1 A;  4PZJ A;  2RQP A;  4FHT A;  5K5R A;  1HBX G;  1IAW A;  2V1U A;  4HQM A;  2EWN A;  2F5E A;  3WGG A;  1GVJ A;  3TKY A;  1RUO A;  3HOT A;  2EFO A;  1KGS A;  3QP5 A;  3EDP A;  3SQN A;  1J2X A;  2GA1 A;  1XGN A;  3K2Z A;  1IZ1 A;  1IXR C;  1KQ9 A;  3CTA A;  3QPH A;  4UVB A;  3QRF F;  3GFL A;  4CZZ A;  5LGT A;  2YU3 A;  4P96 A;  3I54 A;  4RB1 A;  1R5H A;  2ZNY A;  3C7J A;  2EA4 A;  2QBY B;  3IL2 A;  1BI2 A;  1R1U A;  4HBL A;  4M6Y A;  4HX4 A;  4Q48 A;  1YW7 A;  2YR2 A;  5HLH A;  1P92 A;  3ISP A;  1IXS B;  4ETS A;  1IUY A;  3M7G A;  4CO8 A;  4WXD A;  1DDN A;  1F1Z A;  4UV8 A;  2BEO A;  2VE8 A;  1RNL A;  2H94 A;  2XUB A;  1LJ9 A;  5K5O A;  4ESJ A;  4ESF A;  3FMR A;  4KIF A;  3K0L A;  2XIG A;  3MCZ A;  1S6L A;  3QAH A;  2G9W A;  3EYY A;  4EJW A;  2ZFW A;  4CIC A;  5E8G A;  2VOD A;  1EH7 A;  2CG4 A;  2FXA A;  2VBX A;  3CJN A;  2DFI A;  3LAJ A;  1CF7 A;  4EVI A;  4N0B A;  1ZAR A;  3KP5 A;  4KUM A;  4RAZ A;  3IC7 A;  3HRT A;  2JZY A;  2KIU A;  2QLZ A;  1HKT A;  1ZH5 A;  2DAO A;  2GWR A;  3TOA A;  5J6X A;  3HIF A;  1D8K A;  4Q5S F;  5DCM B;  2R3S A;  1P4W A;  5H6Q A;  1Y0U A;  4GO1 A;  4G7H F;  4OU0 A;  2G7U A;  2A07 F;  2P5K A;  1TTY A;  2FNP A;  2PI0 A;  3HRS A;  1QZY A;  4LB5 A;  5ERI A;  2HEO A;  4R1H A;  2HS5 A;  2PMH A;  2FU4 A;  3BJO A;  4M74 A;  4Y17 A;  1LVA A;  1EH8 A;  4S04 A;  1BI3 A;  4YFN F;  3PQK A;  1R58 A;  2NNN A;  1SFE A;  1SFX A;  3E97 A;  2KJC A;  1P6R A;  5DCF A;  1KU2 A;  2ELH A;  1ONV A;  2EV0 A;  3QOP A;  3TO6 A;  3WG9 A;  1K78 A;  3E5Q A;  3HTU A;  3K1P A;  4I01 A;  2XVC A;  2IA2 A;  1FP1 D;  1G3Y A;  3B73 A;  4ZYD A;  5CVJ A;  1XDS A;  4L9T A;  4HYE A;  2EFN A;  2IA1 A;  1R7J A;  1P4A A;  3FXU A;  4ASN A;  2PFB A;  3BJA A;  1Z05 A;  2MH9 A;  1G4D A;  3FXQ A;  2DK8 A;  1U5T C;  2O8X A;  3WGH A;  4D0P A;  3F8M A;  1Z9C A;  5LHG A;  2RKH A;  1S7A A;  2Q0O A;  4CYD A;  3V7C A;  1AWC A;  1LNW A;  1UHM A;  5DUK A;  1MJB A;  2CQK A;  4K2E A;  3GWZ A;  5FFZ A;  3N4M A;  4GCV A;  4LK0 F;  2O3F A;  3HHG A;  2OU2 A;  4AIJ A;  2EJR A;  1RI7 A;  2VBW A;  2C6Y A;  3PQJ A;  2W25 A;  3C1D A;  4Q47 A;  3K1N A;  2CYY A;  2JPC A;  4KFC A;  5IT9 K;  4RGU A;  1G3W A;  1F4K A;  2L54 A;  5D6E A;  4I98 B;  2KRF A;  3FM5 A;  2ZJ2 A;  3GFI A;  1BIB A;  3R6S A;  1BN5 A;  3R0J A;  1TQM A;  3GUD A;  3LQR A;  1TW2 A;  1O3S A;  1FOK A;  1XCB A;  2ZBK A;  2DBB A;  1I1S A;  3FF5 A;  4YFK F;  1FWZ A;  2XKP A;  4QLC U;  1XD7 A;  4A5N A;  5E8I A;  5L3F A;  5L3B A;  3GZ5 A;  3VOD A;  2QQB A;  2KIF A;  2MC3 A;  2E1N A;  3RTR A;  2QYO A;  2DPU A;  1LQ1 A;  2QM3 A;  5F1R A;  3RJP A;  3O2P E;  1OMI A;  5ILS A;  4XSX F;  1ZG1 A;  2Q8K A;  3WTU C;  5E17 F;  2IA0 A;  1CF7 B;  4GXO A;  4KYW A;  4OIR F;  2FBH A;  1KU3 A;  3RKY A;  1YO5 C;  2PG4 A;  5L3D A;  5KK1 A;  3ULQ B;  2ZXJ A;  2ACJ A;  3KP6 A;  2F2E A;  2OA4 A;  2XAG A;  1SMY F;  1MDM B;  3M9A A;  2FE3 A;  3C3W A;  4OOI A;  2DT5 A;  4EGY A;  1WWX A;  1ZG3 A;  2GXG A;  1FNN A;  3O3K A;  3Q5F A;  1FY7 A;  2TDX A;  4PGH A;  5ICE A;  3NRV A;  4HV5 A;  1ZRD A;  5JVT A;  1I27 A;  2Y0M A;  2PQ8 A;  1GXQ A;  2E1C A;  2F5D A;  5EEH A;  3BDD A;  2P7C B;  1QGP A;  2DO7 A;  1YIO A;  4EM1 A;  4ENM A;  3KCC A;  4AD9 A;  5CVV A;  1K78 B;  1WQ2 A;  4RB2 C;  3GX4 X;  1XSD A;  4EJU A;  2K4B A;  1HKQ A;  1K79 A;  3VOE A;  5TJJ A;  1EV7 A;  1U3E M;  1I6X A;  2H6B A;  5DUI A;  4M6X A;  4M9S A;  2JTV A;  1DPR A;  4BYY A;  1GXP A;  2R7D A;  1D5V A;  3KLN A;  1IN4 A;  2CW0 F;  2O03 A;  3U9G A;  4HF2 A;  4XLP F;  1FLI A;  4LD5 A;  3RYR A;  3TO7 A;  3BJ6 A;  1FYM A;  1TQI A;  2H27 A;  2A69 F;  4UUV A;  1R36 A;  5DV5 A;  4EGZ A;  2XKO A;  3ZMT A;  1P4X A;  2DQR A;  4EJV A;  1B9M A;  2HYG D;  3TQN A;  3ZMU A;  1LDK B;  3E3V A;  1IRG A;  4U0W A;  3NQO A;  1KU9 A;  4HAM A;  1HKS A;  5HDN A;  5J8C A;  2KJB A;  3QPT A;  4G94 A;  4XRF A;  3GFJ A;  3LA7 A;  4LFU A;  1A04 A;  4RS8 A;  2GA2 A;  3CUQ A;  3WU0 A;  1IRF A;  4KMF A;  4ENJ A;  3R60 A;  4AIH A;  1REP C;  1Z7U A;  3ABT A;  2M8E A;  4HF0 A;  1L3L A;  1XSX A;  2ISZ A;  4UVC A;  5A2Q Z;  4WWC A;  4AWX B;  5FGM A;  1Z6T A;  3P9C A;  2RDP A;  3CLO A;  3WTY C;  4IJA A;  2CO5 A;  5D5V B;  3COA C;  4OIO F;  1HW1 A;  3SZP A;  2OQG A;  4P55 A;  5ILV A;  2P6S A;  2KIM A;  5D5U B;  2LF8 A;  2D1H A;  3RIR A;  3V7S A;  2DW4 A;  3MFK A;  1O7F A;  2HWV A;  2CFX A;  5F6F A;  2XAF A;  3L09 A;  3OOP A;  3PFI A;  1JXS A;  4BHB A;  2FQ3 A;  2XRO A;  5HVQ C;  1FP2 A;  1ZRC A;  4BHP A;  1FX7 A;  2L01 A;  2ISY A;  3CO6 C;  2P7V B;  3K9T A;  2VE9 A;  4R79 A;  2YPR A;  1EH6 A;  1JGS A;  2ZME A;  2LF7 A;  2VT3 A;  2NRA C;  1YTY A;  1SD6 A;  2GQQ A;  4DQ2 A;  3J7A O;  1TW3 A;  1J5Y A;  3E6C C;  1KU7 A;  3ZN1 A;  5H20 A;  4M73 A;  1H9G A;  2HQR A;  1KYZ A;  3I0T A;  2HKX A;  2D45 A;  3ZN0 A;  3F6O A;  1W7P A;  2H6C A;  1BM9 A;  4LB6 B;  3F21 A;  3F8N A;  3SXY A;  3E6M A;  4M72 A;  3LA2 A;  2QUF A;  2A68 F;  2BE5 F;  1IW7 F;  4IVN A;  4OIN F;  2FNA A;  2EV6 A;  3LQQ A;  1ZYR F;  1WI9 A;  3LWF A;  1OKR A;  1ZLK A;  3DP7 A;  5CJ9 A;  1BC8 C;  1MZB A;  4ENN A;  1V3F A;  2STT A;  4O5V A;  3KP4 A;  3T1B A;  4MTD A;  1Q1H A;  4G6D A;  1W4M A;  4BXU A;  2XAS A;  1LB2 A;  1IN7 A;  1PUE E;  1SD5 A;  2M87 A;  1TNT A;  4XLN F;  4BQA A;  2W84 A;  2XRN A;  2GAU A;  2A6E F;  2VC0 A;  4UNO A;  4IF4 A;  1J59 A;  3L7W A;  3FMQ A;  3U2R A;  3TDU C;  1XCV A;  3WTZ A;  2HZT A;  4IRG A;  3F8B A;  1KYW A;  1ZHF A;  4N9I A;  3L2C A;  3J81 K;  1R00 A;  3S2W A;  4OIQ F;  2W85 A;  5BMZ A;  3GO5 A;  3KE2 A;  5HOO A;  4F7Z A;  3GW2 A;  2FEZ A;  1B59 A;  4WCG A;  2Z3Y A;  4I2O A;  1XB4 A;  5DEQ A;  4YIF A;  1J0R A;  5A2Q K;  2EFQ A;  3G73 A;  1ZGJ A;  1FBQ A;  3DF8 A;  2LKP A;  4RGX A;  1WKM A;  4L5I A;  4M9Z A;  1FYL A;  4KN7 X;  1BIA A;  4HF1 A;  1NHA A;  3WOD F;  1OPC A;  1G3T A;  3T8T A;  2ZNZ A;  4MQV A;  3GEZ A;  5K1Y A;  3SFZ A;  3J80 Z;  2QWW A;  3ML6 A;  1SD4 A;  3GLX A;  5LBQ A;  2F5C A;  1X3U A;  2IRF G;  4KIC A;  4H0E A;  3QU6 A;  1T0F A;  5KVR A;  1B6A A;  3ROU A;  3IKT A;  5L3G A;  3Q9V A;  4CXF A;  2V79 A;  3B02 A;  3I53 A;  1WRJ A;  2VBZ A;  2D1V A;  4HLX A;  1RZ4 A;  3RYP A;  3SZT A;  4I02 A;  2FOK A;  3IWZ A;  4IRI A;  1ON1 A;  2F5F A;  2J5O A;  4GYG A;  1BI1 A;  2RV8 A;  5E18 F;  4P9U A;  4HOB A;  1PP8 F;  2L4A A;  2IJL A;  1BBY A;  4FT8 A;  3KP7 A;  3W6K B;  3M8E A;  4U0V A;  5AON A;  2O6G E;  2M5W A;  3ECO A;  3V8J A;  2P6T A;  1T38 A;  4LLN A;  3KZY A;  4BNC A;  2V9V A;  4FX4 A;  4JK1 X;  5FD5 A;  1FPQ A;  5LEK A;  2ZME B;  4JBA A;  3REO A;  5BPI A;  1D8J A;  5E1X A;  3D5L A;  3F6V A;  4OMY A;  2MBF A;  1G3S A;  4RAY A;  1S7O A;  3HSF A;  1W7P B;  1ZG5 A;  4M71 A;  6PAX A;  5ICF A;  4IXA A;  5E1Z B;  2P5L C;  4LG0 A;  2M1B A;  1IXC A;  1Z1D A;  1PDN C;  3FX3 A;  2MLG A;  1W5S A;  4CDG A;  2X4H A;  1BJA A;  3W6J B;  4WK8 F;  3F3X A;  1WSU A;  4DNC A;  4FX0 A;  2Z5U A;  2Y75 A;  1YFH A;  1YLF A;  1H0M A;  1HQC A;  1YYV A;  3GF2 A;  2K02 A;  3ECH A;  5D6F A;  2V1X A;  1H9T A;  1UB9 A;  3TOB A;  4KNY A;  1K7A A;  1E17 A;  1S29 A;  1HW5 A;  3CDH A;  1QZZ A;  3BPV A;  1ODD A;  2FSW A;  4A0Z A;  2DPD A;  1R23 A;  5E1W A;  1MKM A;  2HGC A;  5E20 A;  1AOY A;  3C18 A;  2DI3 A;  1L0O C;  1YW9 A;  1O3R A;  3I58 A;  2EK5 A;  2RGV A;  4AIK A;  2JSC A;  1G6N A;  5BPD A;  1RUN A;  4Y15 A;  4LMY A;  4A12 A;  4ZH4 F;  1DPU A;  4AVP A;  2K4J A;  3HYI A;  2OZU A;  2O61 A;  3MQ0 A;  3TDZ C;  2MA3 A;  1U8R A;  2UXN A;  4Q4Z F;  4LK1 F;  5HLI A;  3JAM Z;  3I59 A;  2ZCW A;  3HSR A;  5H6R A;  1K6O A;  4O6J A;  4I7H A;  4L9V A;  1F5T A;  2DLL A;  3IHU A;  3LA3 A;  5LLQ A;  4P5O A;  4WXH A;  5HDK A;  5CVR A;  2LSO A;  3MWM A;  4HZF A;  3I64 A;  5DDG A;  2P5V A;  3KP3 A;  1B4A A;  2DU9 A;  5L3C A;  1XGM A;  1KA8 A;  4LGW A;  2XAJ A;  2PEX A;  2HTS A;  3EET A;  2VBY A;  4LJZ F;  4MQ9 F;  3ZQ7 A;  1U78 A;  1MD0 A;  3P9K A;  4HA8 A;  4N9H A;  2PJP A;  2HFH A;  5FLX Z;  3JTH A;  1OYI A;  2B0L A;  1USS A;  5HS9 A;  3F8C A;  2OAZ A;  2VON A;  2ETH A;  4A5M A;  3WTV C;  2V1D A;  3QP6 A;  3O6B B;  1R1V A;  2EFP A;  3CUO A;  3NEU A;  3T5X A;  3KP2 A;  2AXL A;  3BY6 A;  1KQ8 A;  2LDU A;  5K5Q A;  3ZMS A;  4HW0 A;  5F64 A;  2BV6 A;  1XMK A;  4YG2 F;  4LLG F;  4B8X A;  1W7P D;  1LDD A;  4IHS A;  3KLO A;  2DQL A;  4PDK A;  2M45 A;  2OZ6 A;  2H09 A;  4WXC A;  3FZV A;  3KEQ A;  3SHF A;  2MD5 A;  4B09 A;  1IN6 A;  4L9N A;  2K7L A;  2GIV A;  4XBF A;  3HSE A;  3R4K A;  4ON0 A;  3L9F A;  3N97 A;  1STZ A;  5BS6 A;  4NQW A;  4LG0 B;  2RC4 A;  1JHH A;  4TV7 A;  4BH9 A;  1LEB A;  4I09 A;  1YG2 A;  4PGG A;  4EJT A;  3OV8 A;  3ZMZ A;  3RKX A;  3DKW A;  5ILU A;  2UZK A;  3L00 A;  3RPQ A;  2LNB A;  3EQL F;  1C0W A;  2VXZ A;  4IRH A;  2J5P A;  2EFW A;  1QNT A;  2GXB A;  1MJ9 A;  4XSZ F;  1I1G A;  4JQF A;  2AS5 F;  2VOP A;  3JW4 A;  1XSV A;  5CVI A;  2YX4 A;  4L5J A;  3KZZ A;  4I0A A;  3R61 A;  2G7H A;  2XGX A;  2XHK A;  4UVA A;  2STW A;  2BBY A;  4HX8 A;  4U7D A;  2OBP A;  2EB7 A;  2NAZ A;  3CUQ C;  3BZ6 A;  3WTW C;  2IT0 A;  3RKW A;  1S3J A;  4KIG A;  2HOE A;  1GHC A;  2RVC A;  5TRD A;  1R22 A;  3JAM K;  3LFK A;  4HDV A;  3FHZ A;  3DPT A;  4EM0 B;  3VB2 A;  3WE3 A;  5JR3 A;  2Q2E A;  4NHJ A;  2OD5 A;  5IT3 A;  4A0Y A;  1ZRE A;  5LRS A;  3WTS C;  5IT9 Z;  3I59 B;  5FO5 A;  3ABU A;  5FB2 A;  5ICG A;  1BI0 A;  1T2K A;  3ELK A;  3JTG A;  3HHH A;  1T39 A;  2CWE A;  5D4R A;  3GFM A;  1LDJ A;  3IWF A;  4MEX F;  4KA4 A;  2RNJ A;  3E6D A;  2Z9O A;  1SFU A;  4A0X A;  1ZAO A;  2COM A;  1I5Z A;  3F72 A;  3KET A;  3WE2 A;  4I0B A;  5FLX K;  5FFX A;  4ZYG A;  2NS0 A;  2EV5 A;  3H3Z A;  1IF1 A;  3V7R A;  5DD4 A;  4BHC A;  4A6D A;  1KQ0 A;  2A3S A;  4ESB A;  2DK5 A;  2XAH A;  5ICC A;  2MH2 A;  3D0S A;  4OIP F;  1S8N A;  2UXX A;  1U5T A;  3BRO A;  3IRQ A;  1UFM A;  3K69 A;  4YFX F;  2NYX A;  5LGN A;  4RB3 C;  4CGZ A;  3RI4 A;  4ZYH A;  3FXR A;  1FZP B;  1SD7 A;  2MLK A;  5AIQ A;  5BQT A;  1IN5 A;  3V8K A;  2E7W A;  1R5G A;  4KIB A;  1MDM A;  4WX9 A;  1LEA A;  4G7O F;  1FSE A;  1BC7 C;  5LEJ A;  4UXN A;  3KEO A;  3HOS A;  4KMU X;  4G6Q A;  5EEG A;  3CUQ B;  4Y13 A;  4RGR A;  4L18 B;  4EJO A;  3LAP A;  4WF2 A;  1UHW A;  2Z99 A;  4U0Y A;  4A2U A;  3H92 A;  3E5X A;  1QO0 D;  3K1M A;  1ZN2 A;  2V6C A;  1FBS A;  5D5W B;  2L4M A;  4KN4 X;  4G8X A;  5J8F A;  2DTR A;  1XGS A;  3BOQ A;  3M8F A;  2EA2 A;  4NB5 A;  1FYK A;  1B9N A;  4KT5 C;  1XMA A;  2PMU A;  2FMY A;  1JE8 A;  4S05 A;  1UCR A;  2KKO A;  2ADU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...