3MEXA

Crystal structure of mexr in oxidized state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
142
structure length
142
Chain Sequence
b'MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQSLAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug resistance operon repressor
publication title Structural insight into the oxidation-sensing mechanism of the antibiotic resistance of regulator MexR
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription, transcription regulation
total genus 48
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mexA01
4WXCA 1QPMA 4A2UA 1P92A 2ZFWA 2O3FA 1ONVA 1KQ0A 2XIGA 1IXSB 4Y17A 4RB1A 4E70A 3BY6A 1QNTA 1K78B 5ICEA 5JR3A 2YPRA 4KMFA 2VBYA 1D5VA 1F9NA 2WV0A 4KYWA 1PP8F 1QBJA 2ESHA 3FMQA 2CO5A 4ZYGA 4HV5A 2Q8KA 4XSXF 1T0FA 3GEZA 2GQQA 2EK5A 4HLYA 2HYGD 2FU4A 1GVJA 4LB5A 4L9NA 1XDSA 4A0XA 2GWRA 2GZWA 2P8TA 3WE2A 4RGSA 2J5OA 2UXNA 1I27A 2GXGA 2XKPA 3O3KA 1EV7A 2YSRA 5F6FA 4BXUA 3L2CA 4BHBA 1UHMA 2BBYA 2QWWA 2BE5F 2PMUA 3I4PA 2CWEA 4I01A 3R0AA 4NB5A 1P2FA 1S6LA 3FMSA 3O2PE 3JSOA 2D45A 3IWZA 4LD5A 5IT9Z 4M6YA 2L3DA 5DV5A 1IAWA 4AVPA 3R6SA 5K5RA 1DUXC 1O7FA 2FE3A 2VE8A 4HDVA 5ICFA 3F23A 1P4XA 1Z6RA 1OYIA 1J9IA 5H6RA 5ED4A 4ZYDA 1HBXG 3HSRA 1ZGJA 1I5ZA 2Z99A 3DKWA 3BWGA 1JE8A 4IPAA 3I54A 3WU1B 1O3TA 1RUNA 4UUVA 2M30A 3KP3A 5E17F 2RN7A 4Z2YA 2GXBA 2DBBA 2DPDA 2QQ9A 3GFLA 3QP6A 2MLGA 2F5CA 4BQAA 1D8JA 1CF7B 3K0LA 1JHHA 3GLXA 3ELKA 3ZMUA 4ENNA 4U0VA 1R36A 2ZXJA 1RI7A 3K69A 2XV4S 4EVIA 1FX7A 2MLKA 2OU2A 2DK8A 2FRHA 1FYLA 1IW7F 1REPC 1IN7A 4UHTA 3HTSB 1ZRCA 3RKYA 5JHUA 4GXOA 3I5UA 1ODDA 1HKTA 2Q0OA 3SQNA 1B6AA 2WWYA 1Z05A 2RVCA 1DPRA 3F21A 3BDDA 2JSCA 2VT2A 2FNPA 3B02A 4R8HA 2P7VB 1LB2A 1XGOA 2FMLA 2YX7A 5FO5A 3FXRA 3NRVA 4UNOA 4ZYEA 2NYXA 3DEUA 4LK1F 2FNAA 1Y0UA 2DPUA 3JAMZ 3JTGA 1S8NA 4GYIA 4OOIA 3OOPA 3GF2A 3F6VA 3ZN0A 3GFIA 4OMYA 3HRSA 1SMTA 2DT5A 4ZYHA 2IA2A 2D1VA 2QQAA 3BZ6A 3V7RA 4Q48A 5E1ZB 4OMZA 1KU7A 2FBKA 1G3TA 1BI0A 2QM3A 4EV0A 4UV8A 1IN4A 2DW4A 4CHUA 3F8MA 5BS6A 3D5LA 2HTSA 3KETA 4PGHA 1CGPA 3I53A 3J81K 3RJPA 1ON1A 1S7AA 2XVCA 3TOAA 4GYGA 1EH8A 2XKOA 4L5IA 3HHHA 4ON0A 2A6HF 2RNJA 5CLSA 2IP2A 1OR7A 2A61A 4O6JA 5F1RA 4FX0A 3BP8A 4KIGA 3I64A 1IXCA 1O7LA 4OINF 2XAQA 3HTUA 3R60A 1B59A 5TRDA 1T39A 2QZ8A 3RIRA 3KCCA 4GCVA 1HXDA 2JRTA 3JSPA 3FM5A 1O3RA 3E6DA 1J75A 1K6OA 4I98B 3R0JA 4LMYA 3KEOA 4RB2C 4JQFA 4RAYA 4U88A 3GXOA 5JI6A 4WXHA 3BJOA 1FWZA 1AWCA 2OA4A 1UCRA 3CUOA 2M5WA 5L3BA 4I7HA 4HQEA 3WU0A 2H6CA 1PP7U 2LNBA 3DFGA 4ASNA 1AOYA 1JXSA 2PI0A 3I58A 3IRRA 2EFOA 5AIQA 2RQPA 1R00A 5CVJA 3S2WA 2L4MA 1FY7A 5LEKA 1Z9CA 1L3LA 3ABUA 3H3UA 3FWEA 1LNWA 1J7KA 3KP5A 2Z3YA 4LG0B 1R7JA 1TQMA 2HFHA 4HV6A 1XSVA 3R4KA 1TBXA 3AAFA 4HZFA 3ZN1A 4G7OF 4IVNA 4OIQF 3G73A 3F22A 2L54A 2FQ3A 1EH6A 2DQRA 2MH2A 1G4DA 3RTRA 3MAJA 1BM9A 4BYYA 3H3ZA 2P5KA 2HOEA 2J5PA 3VEPA 4HF1A 3B73A 4CXFA 2PFBA 4HBLA 2ZKZA 2STWA 1W4MA 1J59A 1D3YA 3KZZA 1YLFA 2V79A 1DP7P 4PZJA 3FX3A 3J80K 4IHSA 3TOBA 5L3GA 3RI4A 1SAXA 3DPLC 3FXUA 1C0WA 2E1NA 1R5GA 2MD5A 3ZMTA 3Q5FA 5A2QZ 1W5SA 2VC1A 1FYKA 3QU3A 3TDZC 5HDKA 3ZMZA 2O8XA 4XSZF 3ZP5A 2ISZA 2AS5F 1LEBA 1HSTA 3BPVA 4H0EA 1WRJA 5AIPA 2KIMA 4BAYA 5E8IA 3LSTA 2M8EA 1YS7A 3LAPA 5L3CA 3C1DA 2DK5A 4GO1A 3SZTA 2H94A 5BMZA 2ZMEB 3E5XA 1RUOA 3N97A 3Q9SA 3U2RA 4WK8F 3HSEA 1ZG5A 4PCQA 2V1XA 4OIPF 5DD4A 3CUQC 3T5XA 2MBFA 1Z7UA 3TGNA 4Q5SF 5D4RA 2D2WA 3GW2A 2F5FA 3GUDA 3M8EA 2K4JA 5DDGA 1JHFA 2Y0MA 4ESFA 4HOBA 1SFXA 2NS0A 1ZREA 3BPXA 4P9FA 2EV6A 4O3MA 3LQRA 3MZYA 2R7DA 1USSA 3WTYC 2VN2A 2EWNA 2EFNA 3V8JA 2RDPA 4XBFA 2XHKA 3ULQB 2OQRA 4CYDA 2ZBKA 1MDMB 4HF2A 2EV0A 1G3WA 3W6KB 4IRIA 2LF8A 1H9GA 3ZMSA 4JK1X 2Z9OA 4G6DA 3C3WA 4M9XA 1SD7A 1ZYRF 4LLNA 1S7OA 1ZARA 2ZJ2A 1ZAOA 3CUQA 3VOEA 2H6BA 1X3UA 3I0TA 2V1UA 2B0LA 4EGZA 4AIJA 2XGXA 2CYYA 1W7PB 2HR3A 4U7BA 4OIOF 3V7CA 4IJAA 5H6QA 4RAZA 4Y15A 2XRNA 5LEJA 2FOKA 2XAFA 4UV9A 1ZG1A 1FZPB 1J2XA 2IVMA 4EJWA 4R79A 6PAXA 1WQ2A 2W57A 1K79A 3L9FA 1RIOH 4G7HF 1Z6TA 3RKWA 4Q4ZF 3ROUA 4UVBA 4MEYF 2RGVA 3KLNA 1XCVA 5D8LB 2HZTA 4A12A 2VXZA 3M9AA 4GGGA 1IZ1A 5K5OA 3C18A 2HDCA 1XMKA 1Z91A 3O6BB 2QYOA 2F2EA 4KNYA 3EETA 3SZPA 3RPQA 1BIAA 1PUEE 3J81Z 1ZH5A 4Q47A 3GZ6A 1W7PD 2X0LA 2PN6A 1IRGA 4QWQA 2ISYA 5FLXK 2ADUA 1KGSA 4MEXF 5LRSA 2KRFA 2ZNYA 1QO0D 4EM1A 1FBSA 2WTEA 1HQCA 3BOQA 4N0BA 3K1MA 1U5TC 5KVRA 4R1HA 4DQ2A 3E6BA 4N9HA 1QZYA 1BC8C 1GXPA 1TQIA 2GIVA 4KT5C 2HTJA 2DO7A 1MZBA 3KEQA 5CJ9A 4OIRF 1IN6A 2QBYA 2W24A 1YIOA 3EQLF 4ETSA 4RGUA 3HYIA 2L02A 3E6MA 3PQKA 5D6EA 5LGTA 1V3FA 4YFKF 3U9GA 3BROA 2AXLA 1FOKA 3GYHX 4YG2F 4P96A 1LEAA 3RKXA 3GZ5A 2COMA 1XGSA 3E97A 1SD4A 3CLOA 4ZZLA 2HS5A 1U5TA 1PDNC 1MJ9A 2WC2A 1R58A 3HOSA 2XUBA 1T38A 1F4KA 2XAHA 5BQTA 5TJJA 4S04A 2MA3A 2UWMA 2W25A 4G8XA 1U2WA 2DLLA 2QUFA 1XSDA 1ZLJA 1J0RA 2D1HA 5IT3A 2HEOA 2HQRA 4HF0A 2K02A 1XSXA 2BEOA 2LKPA 3L00A 1TNSA 1TW3A 2QENA 2ELHA 4KDPA 3ISPA 4U0YA 3SXYA 4KIFA 1TW2A 2M45A 3J80Z 4XRFA 3CO6C 5HLHA 1OYYA 1B9MA 2OQGA 4EMSA 2OD5A 1YQAA 3CO7C 1FBQA 1YS6A 1SFUA 5LLQA 5BPDA 4I0AA 3I59A 4QLCU 5CVRA 4ENJA 5CVUA 2PG4A 1SD5A 3ZPLA 2NNNA 1LQ1A 5E1XA 3ZMVA 1XDUA 1MJBA 1G3YA 3IKVA 4NQWA 3DF8A 3D0SA 2TDXA 3MFKA 4FX4A 2HYFA 4IRHA 3WG9A 4M74A 4AIHA 1XD7A 4I09A 5ILVA 3WTTC 3WTXC 5ILUA 3K1PA 1KQ8A 5D5WB 2QBYB 3KZYA 4YIIA 2G9WA 4JBAA 3T0YA 1YW8A 3WTZA 2E7XA 5CVIA 1ZN2A 2W84A 5LHHA 1H9TA 4WWCA 3EYYA 4L9VA 4KIBA 3DPTA 5H20A 4KUMA 2LDUA 3QU6A 2A6EF 2HKXA 2XROA 4M71A 2V1DA 2CW0F 4CZZA 4EQQA 1BBYA 2EFQA 4L9JA 1FLIA 4M72A 2PQ8A 5HLGA 2YU3A 3G3ZA 2MC3A 2P4WA 1U5TB 2P7CB 2KJCA 4RB3C 3DQVC 3DXJF 2PBIA 3FXQA 3VFZA 3F8BA 2FMYA 2OAZA 1MD0A 1R5HA 4EJOA 2NAZA 1K78A 3KP4A 3GVAA 1MGTA 4BHCA 2Z33A 1LDDA 1HSJA 5D8KB 1KU3A 4EM0B 3LA3A 2JTVA 1EH7A 3KFWX 1USTA 1D8KA 5HDGA 3N4MA 4L5JA 3V4GA 1HW1A 4AWXB 5CVVA 3M1EA 2NNYA 3BJ6A 2F5EA 1A04A 1IN8A 1FPQA 3PFIA 5ILSA 2K86A 4L9TA 4B8XA 2A69F 3K2ZA 2DAOA 4D0PA 4EJVA 5AONA 5DYMA 1FYMA 2ETHA 5D5VB 3F6OA 3I59B 3SFZA 2ESNA 2VBZA 2CGPA 3GFJA 3WGIA 5FD5A 5EEHA 3V7SA 3RYRA 1ZLKA 1BI3A 1XB4A 3GWZA 4NHJA 2XAJA 4I0BA 1VTNC 4S05A 2HQNA 2QQBA 2P5LC 2BV6A 1HW2A 3IWFA 2F5DA 4EM2A 4MTDA 3EUHA 5E20A 2K7LA 3FHZA 4CO8A 3P9IA 3LQQA 5FGMA 3I71A 3VODA 2KIUA 1IUYA 1P4WA 1S3JA 3F8CA 3IC7A 2VODA 5J8FA 2EA4A 2UXXA 2JPBA 2STTA 3VB2A 3WTSC 1WWXA 2CSOA 1UHWA 5K5QA 1KU2A 1KYZA 4O5VA 1HKQA 1YW7A 3Q9VA 4U7DA 4KICA 4P5OA 3OV8A 4BH9A 5FLXZ 4CDGA 5LHIA 3NQOA 5K1YA 5FFZA 4G6QA 4OU0A 2O6GE 5BOXA 2VOOA 1T2KA 3LAJA 3QAHA 2A68F 1YFHA 1IN5A 1P4AA 5ERIA 2G7UA 4P55A 4B09A 5KK1A 2IPQX 3QPTA 5HOOA 4I02A 2M87A 1XGMA 1LJ9A 1CF7A 1SFEA 2EFWA 1IXRC 4HW0A 1SMYF 3TO7A 4PGGA 4YIFA 2LSOA 2YX4A 2IRFG 4G7ZF 5L3EA 3FZVA 1FBUA 4I2OA 1YYVA 1I1SA 3EDPA 3IRQA 1BIBA 4IXAA 4YFNF 4LFUA 3MQ0A 2PJPA 5D4SA 3P7NA 4ENKA 5LGUA 3K1NA 3LA2A 4HYEA 2VE9A 1QZZA 2BYVE 3JTHA 5DCMA 2L01A 3LFKA 3MEXA 2A07F 5D6FA 2M1BA 5A2QK 2O61A 5E1WA 4WX9A 4M6XA 4MHGA 4UVCA 1ZG3A 2XAGA 2QVOA 3HUGA 2OZUA 2KIFA 4P9UA 4MQ9F 3R61A 1K7AA 3REOA 1U6GA 2CQKA 2IT0A 4CGZA 4HDUA 2A3SA 4LLGF 3TKYA 3PQJA 4ZH4F 1YG2A 5ICGA 1FNNA 1Q1HA 3MWMA 4FT8A 3EYIA 1V4RA 2XASA 4N9IA 1G6NA 4WCGA 3F3XA 3IL2A 1R23A 4A0YA 1WSUA 4U0WA 3GX4X 1FT9A 2JZYA 4MQVA 4AIKA 3COAC 2DI3A 1B1BA 4HA8A 1J5YA 3KP2A 5JFRA 1F1ZA 4F7ZA 1E17A 1FP1D 4K2EA 3ERED 2PEXA 1NHAA 3KP6A 3WE3A 2NRAC 2PLYA 4L0YB 3WGGA 5L3DA 4XLNF 3WTUC 1S29A 4FHTA 3KP7A 2Z5UA 2E1CA 2HKOA 2ZCWA 4HX7A 2FBIA 3HIFA 3ECHA 2FXAA 3SHFA 4MNUA 1KQ9A 3LWFA 4WF2A 1R1TA 1OPCA 1RZ4A 2Q2EA 3WTWC 1YTYA 3CUQB 3HRUA 2O03A 2E7WA 1KU9A 1YO5C 1SD6A 1I6XA 2FEZA 2EFPA 1OYWA 1QQIA 4L18B 2DFIA 2VT3A 3NEUA 5DCMB 3V8LA 1L0OC 3E3VA 3T8RA 1ZRFA 4ENMA 1I1GA 4EJTA 5HS7A 5FD6A 3WTVC 2IW5A 3HRTA 3WGHA 4KN4X 3H92A 4HQMA 2P6TA 4LG0A 1LDJA 5IT9K 3C7JA 3M8FA 4IRGA 1KA8A 3HOTA 4IF4A 2BGCA 2V9VA 1TNTA 2DU9A 5HS8A 2RC4A 3TO6A 3W6JB 5E8GA 5HS9A 2FSWA 5F64A 1ZHFA 1ZGAA 3TO9A 3KLOA 4MGRA 4M73A 1GXQA 3HRMA 1UB9A 4XLPF 4Y13A 2LF7A 1T98A 2VC0A 3TQNA 2GAUA 3F72A 1BJAA 5HVQC 1U78A 5FFXA 3QOPA 1LDKB 5DUKA 3QP5A 3ZQ7A 1T6SA 2EV5A 4LGWA 4DNCA 2P5VA 1XGNA 4UVAA 3ABTA 4LB6B 4HX4A 2R3SA 4ZZDA 2KJBA 2L4AA 4IHTA 2FA5A 5DCFA 3P9CA 1XMAA 3DP7A 4YFXF 2IA0A 4A6EA 2OZ6A 2UZKA 5LBQA 2V6CA 1WI9A 3TDUC 1OMIA 3GFMA 1O3QA 1O3SA 1OKRA 4KFCA 2GA1A 4A5MA 4LLLA 1RNLA 1XN7A 4M9ZA 2A5YB 4RGXA 2VBXA 4WXDA 2O0YA 1B9NA 4A6DA 3FF5A 3HHGA 5D5UB 2IA1A 2OBPA 2KKOA 3F8NA 4RGRA 5L3FA 2YR2A 5LHGA 3T1BA 2ZMEA 3L09A 4ESBA 5DEQA 1U8RA 4PDKA 3HSFA 3RYPA 5DD8A 1QGPA 1XCBA 1B4AA 1ON2A 4TV7A 2C6YA 1U3EM 3K9TA 2VOPA 4HLXA 2ACJA 5J6XA 4KMUX 1R1UA 1FP2A 1KYWA 2DTRA 2IJLA 4L0ZB 5ICCA 2R7FA 3J7AO 4KN7X 3P9KA 2EB7A 1DPUA 2EA2A 3DV8A 1ZRDA 4A5NA 1FSEA 5BPIA 5FB2A 3CJNA 1F5TA 2FBHA 1R1VA 1YW9A 2K27A 1BC7C 3JAMK 2GA2A 4G9YA 2H27A 1FC3A 4AD9A 3WODF 2VBWA 3LA7A 2ZO4A 1ULYA 3E5UA 5LGNA 2VONA 4M9SA 1GHCA 1JGSA 1UFMA 4ESJA 3RDIA 1BI2A 3QRFF 1MDMA 1TTYA 2RKHA 5E18F 2P6SA 3GO5A 2EJRA 2CG4A 3CDHA 2Y75A 3MCZA 1MKMA 1FSHA 3V8KA 1TQPA 1BI1A 3E5QA 5CYVA 1BOAA 3MZHA 3BJAA 1P6RA 1HW5A 2JT1A 4LJZF 4KA4A 4EJUA 3T8TA 1W7PA 3FM3A 2RV8A 4UXNA 3ML6A 1HKSA 4RB0A 2K4BA 1LVAA 1DDNA 2PMHA 3RPUA 3KE2A 4G94A 3M7GA 3ECOA 1MJAA 1BN5A 2G7HA 1W5TA 1O57A 1R22A 3F8FA 2Y48A 2JPCA 2H09A 5JVTA 3CTAA 5HLIA 3FMRA 2ZNZA 5HDNA 1E2XA 3L7WA 1TLHB 2HWVA 2HGCA 3JW4A 4RS8A 5DUIA 5EEGA 2W85A 1STZA 4MTEA 3E6CC 1Z1DA 4EGYA 2QLZA 2MH9A 1IF1A 4HAMA 3IKTA 5D5XB 2CFXA 5LRRA 2X4HA 3U1DA 1WKMA 3QPHA 4BHPA 4A0ZA 4BNCA 5J8CA 1IRFA 4CICA 2DQLA 2FF4A 4LK0F 4HX8A 3ZMDA 3IHUA 1G3SA 1H0MA
chains in the Genus database with same CATH superfamily
4RMNA 4XLHA 1XS9A 4WXCA 1QPMA 4A2UA 1HA8A 3W2AA 1P92A 4U87A 2ZFWA 5EG0B 2O3FA 1ONVA 1KQ0A 3GZNB 2XIGA 2DA2A 1IXSB 4Y17A 4RB1A 4E70A 3BY6A 1QNTA 1K78B 5ICEA 1VQ7I 5JR3A 1R5ID 2YPRA 4KMFA 2VBYA 5IOZA 1D5VA 4LITA 2R7XA 3JR9A 1F9NA 2WV0A 4KYWA 1PP8F 2W4SA 2O7OA 1QBJA 2ESHA 2R5ZB 4XKWA 3FMQA 1YJ9I 3G1MA 2CO5A 4BEHB 4ZYGA 4HV5A 2Q8KA 4NUBA 3QPLA 1TT0A 4XSXF 4EATA 1T0FA 3GEZA 2GQQA 2EK5A 3H5AA 4HLYA 2HYGD 3JCUC 1MNMC 2FU4A 1GVJA 4LB5A 2COBA 4L9NA 1TWGJ 1XDSA 1LE8B 4A0XA 2GWRA 2GZWA 2HPIA 3KZIC 2DT6A 2ZXIA 3CMYA 2P8TA 1H88C 3BTIA 3WE2A 2IGKA 1T95A 2IS6A 4RGSA 2J5OA 4DGWB 2UXNA 1I27A 2GXGA 1MMAA 2KRCA 1T56A 2XKPA 2AHQA 3S2DJ 3O3KA 2CUEA 3Q0WA 3L2QA 2V26A 1EV7A 2YSRA 5F6FA 4BXUA 2LREA 1FOYA 1ZK8A 3DU6A 4F3QA 3L2CA 3C2HA 4BHBA 2BVLA 1MMGA 3ZXSA 1UHMA 2BBYA 5J1UA 1EJ9A 3F9KA 2QWWA 2BE5F 2PMUA 3I4PA 2CWEA 4I01A 4X1EA 3O8GA 3R0AA 4NB5A 1A5JA 1P2FA 1A35A 4F91B 1S6LA 1T33A 3FMSA 3O2PE 3JSOA 3DTKA 2D45A 3IWZA 4LD5A 1D0ZA 2VQLA 3K4MA 4BQOA 2LY9A 4M6YA 4CYCB 5IT9Z 4XLFA 2L9NA 2P81A 5GAGJ 3WHBA 2L3DA 5DV5A 2EZHA 3G1LA 4BGDA 5IYDJ 1IAWA 4AVPA 2JSPA 3R6SA 5K5RA 4DZPA 4A3GJ 2FQ4A 1DUXC 1O7FA 2ZJQF 4QIWN 1PUFB 3TL4X 2FE3A 2VE8A 3BR5A 4HDVA 2DA7A 5ICFA 3OYFA 3F23A 4V2GA 2NVUB 3FBNB 3SFIA 2JVGA 1P4XA 1Z6RA 2R4GA 4F92B 1YITI 1OYIA 3S16J 1J9IA 1Z77A 5H6RA 5ED4A 4ZYDA 4A3KJ 1HBXG 3W6VA 4UY8I 3G71I 5E3NA 3BZCA 3HSRA 5GADJ 1ZGJA 5J47A 4RDUA 2WAEA 3GBGA 3S93A 1I5ZA 2X85A 3GLLA 1V5GA 1SVOA 3AL0C 2Z99A 3DKWA 3BWGA 2NVTJ 3CCSI 3DKXA 3DPUA 1JE8A 4PJNA 4IPAA 4N4OB 3I54A 3SJMA 3WG7H 4E6KG 3WU1B 1O3TA 2GM4A 2WY7Q 2KL4A 3OR1C 1RUNA 2UUZA 3AFHA 3MD2A 4UUVA 4E7ZA 2MYSA 2M30A 3KP3A 5E17F 2RN7A 2VB6A 3HKZA 3DLAA 2XPVA 1X1CA 4Z2YA 3OYKA 1GDTA 4G12A 4KJZA 1ETQA 3IUOA 2GXBA 4UB6C 3S32A 2QSGX 3VWBA 5BNGA 2DBBA 3IAS2 3ZOBA 2EZLA 2K9MA 1V5FA 4CZCA 4XOTA 2DPDA 1FJLA 2QQ9A 3GFLA 3QP6A 2MLGA 4XIDA 1R49A 2F5CA 4BQAA 1D8JA 2OTJI 2VLAA 1CF7B 3K70C 1LFPA 3K0LA 1JHHA 1W1WE 3GLXA 3LSPA 1DU0A 3ELKA 2M7BA 4B44A 2GXAA 1IDZA 3ZMUA 1P9QC 4U0VA 4EEFG 4ENNA 1R36A 2ZXJA 4AC0A 3BG3A 1RI7A 3K69A 2XV4S 5M3MJ 1OJLA 4EVIA 1YHQI 4B43A 1FX7A 2MLKA 1BR1A 2OU2A 2DK8A 4HEA2 2FRHA 5FKMA 3K7AJ 1LVKA 4BACA 1FYLA 5EYRA 3ZR8X 3S1NJ 1IW7F 1REPC 1IN7A 4UHTA 3PO3J 3HTSB 1ZRCA 4M3FA 3RKYA 5JHUA 1B8IB 2DFEA 1VI0A 2E34A 2PJRB 1MIJA 4GXOA 3I5UA 1ODDA 1E3PA 3S3MA 2W1OA 1HKTA 2Q0OA 3SQNA 1B6AA 2WWYA 2LLKA 5CPRB 2NS8A 1Z05A 2QKMB 1GUUA 4E7LA 2RVCA 3CCYA 3UKGA 3GMEA 4P1WA 2EZKA 1DPRA 2L7KA 3VYTB 3F21A 3BDDA 1YI2I 2G0EA 3RCOA 5IYBJ 2JSCA 1VQ8I 3CMAI 1SVLA 2VT2A 2DA1A 2FNPA 3B02A 4R8HA 3VDXA 1AKHA 3LSKA 2K9SA 1PJRA 3LSHA 1W0UA 2P7VB 4PJJA 2DOAA 2RREA 1LB2A 1XGOA 1XX5A 2FMLA 2YX7A 3FK7A 5FO5A 3FXRA 1OR7C 2X48A 3HUGB 3S1MJ 2BVMA 2RAEA 2HXOA 3NRVA 1R6RA 4UNOA 5F1JA 2KZGA 4FE4A 3A0BC 4ZYEA 2NYXA 3DEUA 4LK1F 4OAZA 1NTCA 3FXJA 2D5VA 2FNAA 1Y0UA 2DPUA 3DTEA 5E79C 4M3BA 3JAMZ 3HKZN 3SDGA 1S8NA 4GYIA 3JTGA 1S5LC 4BE1A 4OOIA 3OOPA 3GF2A 3W2VA 2MFZA 3F6VA 3OOUA 3ZN0A 3NWSA 3GFIA 2HDDA 2GIZA 1SMTA 2DT5A 3HRSA 1RESA 4ZYHA 1GT0C 4OMYA 2IA2A 2D1VA 2QQAA 1TT5B 3BZ6A 4XLAA 4CCMA 3V7RA 2TCTA 4AIDA 4Q48A 5E1ZB 5KNLA 4OMZA 2JA6J 1QRYA 1B72B 4AU7A 1KU7A 1ZR2A 2FBKA 3H5RA 4PK4A 3EUKL 2R93J 1OISA 4KITB 2DDAA 1G3TA 2VIXA 3L2UA 1BI0A 3G6EI 2QM3A 4EV0A 4UV8A 2XSDC 1IN4A 2DW4A 2YS9A 3A01A 4CHUA 1IV6A 2L5QA 3F8MA 2ZMEC 1EKEA 3D5SC 2XPWA 2MABA 5BS6A 3D5LA 2HTSA 4PGHA 3KETA 1CGPA 2XRLA 3I53A 3J81K 3RJPA 4JX4A 3OS0A 2HQ5A 2BZTA 1IC8A 2VJJA 2E35A 1ON1A 2KQRA 1S7AA 3A0HC 1SC7A 3LFUA 2XVCA 3QYEA 4BY7J 4GYGA 2QSFX 3TOAA 1EH8A 2WB1N 2XKOA 4L5IA 1WJEA 4D1QA 3HHHA 5GAEJ 2IXSA 5EEAA 2DDBA 3OYHA 1M1EB 4ON0A 2A6HF 1ZTRA 2F4IA 1HOMA 2EBIA 3NARA 4II3A 2DA4A 2RNJA 1QHHD 5CLSA 2IP2A 1OR7A 2A61A 4O6JA 3VSKA 2OCEA 2NOJB 5F1RA 4FX0A 3MZ8A 3BQZA 2M4KA 3BP8A 5HNHA 4KIGA 1GLNA 3I64A 4B3AA 3L2RA 1IXCA 4XKBA 1O7LA 2E19A 2XAQA 4OINF 1TZLA 4CCJA 2WADA 2BXZA 2EILH 3K10A 3HTUA 3R60A 1B59A 5TRDA 5GPAA 1T39A 5TISC 3NWTA 1Y56A 2QZ8A 3CDIA 1Z3XA 4C3JJ 4IHXA 3RIRA 5E3OA 2H1KA 3KCCA 4YIRX 4GCVA 2BW3B 1HXDA 2JRTA 2IAIA 3JSPA 3TW6A 3FM5A 1O3RA 2V1NA 3E6DA 1J75A 1K6OA 4I98B 1G59A 3R0JA 2HNHA 4LMYA 3KEOA 1JUPA 4RB2C 1YX5A 4JQFA 4RAYA 4U88A 3GXOA 3JRGA 3X2QH 1K4SA 2CW7A 3ASNH 2AQEA 2Q2EB 4WXHA 4BS9A 2VI6A 3BJOA 5JI6A 1FWZA 1AWCA 1MBJA 2OA4A 2O8KA 1UCRA 3CUOA 2M5WA 5L3BA 4I7HA 4HQEA 3WU0A 2H6CA 1PP7U 2LNBA 3DFGA 3QYBA 2P0WA 4ASNA 1AOYA 3B6CA 1OLTA 5GTIC 1JXSA 2PI0A 3I58A 1HCRA 3IRRA 2EFOA 5AIQA 3HOVJ 2X6WA 2DA5A 2RQPA 2X6OA 1R00A 4ITVA 5CVJA 3S2WA 2W7NA 1YJNI 2M0CA 2KRHA 1T08B 3W2WA 2L4MA 1FY7A 1FOWA 4HG2A 5LEKA 1AKHB 1Z9CA 1QZEA 1L3LA 2LBFB 2XB0X 3ABUA 3H3UA 3O8HA 3HDDA 5TGTA 1Z7LA 2ZC2A 3FWEA 1MBFA 1LNWA 1J7KA 3KP5A 4XNFA 4F55A 2Z3YA 4LG0B 1R7JA 1TQMA 4IQJA 2HFHA 4HV6A 1XSVA 3R4KA 1TBXA 4W97A 2K9LA 3AAFA 4HZFA 1ZR4A 1W0TA 1OQYA 2VKDA 2E36A 3ZN1A 4IVNA 1BOBA 4G7OF 1OCPA 3NAUA 3G73A 4OIQF 5FKLA 3F22A 2L54A 2VJIA 2FQ3A 2X1DA 4GRIA 1EH6A 2DQRA 4HPQA 2MH2A 1G4DA 3RTRA 5F08A 4XONA 1DGWY 1I50J 3MAJA 3VYUB 2E1MC 5J40A 3AG4H 4ZTFA 3CCLI 1BA5A 3FXLA 3HPHA 1BM9A 4BYYA 3H3ZA 2YUSA 2P5KA 2HOEA 3JREA 2J5PA 4C3HJ 3OR2C 3VEPA 4HF1A 3TMOA 3B73A 4CXFA 2PFBA 4HBLA 2ZKZA 2STWA 2KDZA 1W4MA 1ENHA 1J59A 1D3YA 3KZZA 1YLFA 2LG4A 2V79A 2WAFA 3A01B 1DP7P 4PZJA 3QPSA 4XLCA 3M4OJ 1WJ5A 5F27A 1MSEC 3FX3A 4XICA 1SFOJ 3FK6A 1UAAA 2JA7J 5K7ZA 2XSJC 3J80K 3ESWB 4IHSA 5EGOA 3BR0A 3TOBA 5L3GA 1UG0A 3RI4A 4MFDA 1SAXA 3DPLC 3FXUA 3CQZJ 1EF4A 1WJCA 1C0WA 2R7TA 2E1NA 5HLTA 1R5GA 2MD5A 2R0QC 3DBLB 4IQ4A 1N77A 2DA6A 4A3EJ 3K4JA 3ZMTA 2NOGA 3Q5FA 5A2QZ 2MD0A 3GTGJ 1W5SA 1WZ2A 2VC1A 1VQKI 1FYKA 2EINH 3IP4B 3QU3A 3TDZC 4YRVA 5HDKA 2R5YB 4ZDLA 3ZRGA 2NS7A 3GTKJ 3DBHB 3ZMZA 2O8XA 4D5FA 4XSZF 1N78A 1MBKA 4XR6A 3ZP5A 2ISZA 1OCOH 2AS5F 2ZB9A 1ACIA 1OCRH 4DZJA 3HOZJ 3RSNA 1LEBA 3DTIA 1HSTA 3TW7A 3H9GA 1UHSA 3BPVA 4BU2A 2BY0A 4H0EA 5EJCA 1WRJA 3GTLJ 5AIPA 1UZCA 1MH4A 1SVMA 2KIMA 4BAYA 3GTPJ 5E8IA 1X19A 3LSTA 2M8EA 2QSHX 1YS7A 3LAPA 5L3CA 3C1DA 2XF5A 2HZDA 2DK5A 4GO1A 3SZTA 2H94A 3CZ6A 4UUSB 2HVRA 5BMZA 2ZMEB 3E5XA 3FDYA 4QTRA 1U0JA 1RUOA 4PJ0C 3N97A 2IBDA 2HXIA 3Q9SA 3U2RA 4WK8F 2L9VA 3HSEA 1VNDA 5IOYA 1ZG5A 4M6VA 4PCQA 2V1XA 4OIPF 2A5WA 5DD4A 2IGNA 3OYGA 2NXNB 4XOPA 3CUQC 3U1KA 3T5XA 1JJ8C 2MBFA 1Z7UA 3TGNA 5DS9A 5J1YA 4Q5SF 5D4RA 3CF5F 4D7NA 4L5EA 5EZHA 4XKCA 1RR8C 2D2WA 3HPGA 3K4NA 3I55I 3GW2A 2F5FA 3GUDA 3M8EA 2K4JA 4DIQA 2LC2A 5DDGA 3ABKH 1JHFA 5IPAA 2Y0MA 2XB5A 3VYRB 1HLVA 5M5WJ 4ESFA 2R7SA 4HOBA 2CUZA 4BBRJ 1SFXA 3H1CA 4BY1J 2DJNA 2NS0A 1ZREA 3SEQA 3BPXA 2JJ7A 4P9FA 2EV6A 4O3MA 3LQRA 3MZYA 3BLYA 2R7DA 1USSA 2R92J 3S2HJ 2CQXA 3WTYC 4GFBA 2WBMA 2VN2A 3CJQB 3ASOH 2EWNA 2EFNA 3V8JA 3OYCA 2RDPA 4FETA 4XBFA 2XHKA 3ULQB 2OQRA 4CYDA 2ZBKA 1MDMB 3MKWB 4HF2A 1TWHJ 2EV0A 1QA6A 1Y1WJ 1G3WA 4ZC3A 1YJWI 3W6KB 4IRIA 4A3IJ 2LF8A 1H9GA 4BJTA 3ZMSA 4JK1X 1DGRM 1XPXA 1V55H 2L7MP 2Z9OA 2OV7A 3OL4A 3CP8A 3AG1H 2ECBA 4G6DA 1A6QA 3C3WA 2Y31A 1KONA 4M9XA 1SD7A 3VPRA 1ZYRF 4LLNA 3J7AY 1S7OA 2H8WA 3FIWA 1ZARA 2WAQA 2K3FA 2ZJ2A 1ZAOA 4UUTA 4PFOA 5DTDA 3CUQA 2CW8A 4XL9A 2H6BA 3VOEA 1X3UA 3BG7A 3DU5A 3SYTA 3I0TA 2V1UA 1RC9A 1XG1A 2B0LA 3H5NA 4EGZA 3CC2I 4JP0A 2DMPA 4AIJA 2JA5J 2XGXA 1ITYA 3S3NA 2QA4I 3WU2C 2CYYA 3DLLF 3I56I 1W7PB 2HR3A 2GBYA 4U7BA 4OIOF 3V7CA 4IJAA 2KDOA 1QU3A 1MMNA 4C3IJ 5H6QA 2CU7A 4NDLA 3JRDA 1A6IA 2Y69H 4RAZA 4Y15A 2XRNA 1RKWA 5LEJA 2FOKA 2XAFA 2VKEA 4UV9A 3FKIJ 1ZG1A 1FZPB 4W1UA 3LL7A 3QOEA 2E60A 1ETWA 1J2XA 2DYSH 2IVMA 4EJWA 3IH4A 1K6YA 4R79A 2E1MB 3L1PA 5FKNA 6PAXA 1ZKGA 1BJZA 1IRXA 2LOOA 1I3QJ 2E2HJ 1WQ2A 3FBIB 4B1RA 5B1BH 3BR2A 2KISA 2W57A 1K79A 3L9FA 2F5VA 2VQGA 1RIOH 4G7HF 1Z6TA 2KT0A 3RKWA 4Q4ZF 3ROUA 4JX6A 4UVBA 2E5NA 4MEYF 3U21A 1WHUA 2RGVA 3JRIA 3KLNA 1XCVA 1D0YA 4Y33A 2HZTA 5D8LB 4RLFA 4A12A 2VXZA 3M9AA 4GGGA 1SEUA 2ZFUA 3BCAA 4IOCF 1IZ1A 2YU9J 5K5OA 3C18A 2HDCA 1XMKA 2OF7A 4D7MA 3E1SA 1Z91A 3K4BA 4MFEA 3A1YA 3O6BB 2QYOA 3BT9A 2F2EA 3QODA 3QQAA 1MSFC 3H3VK 4KNYA 3EETA 3SZPA 3RPQA 1BIAA 1PUEE 4CSWA 3J81Z 1ZH5A 4S0HB 4Q47A 3GZ6A 1I3AA 1W7PD 4MIMA 4IO9F 3S14J 2NVXJ 2X0LA 2FOWA 2PN6A 1IRGA 4QWQA 2ISYA 5FLXK 2ADUA 1OCCH 2BHZA 2F4OB 2X1CA 1KGSA 4NC7A 2IGOA 1H8AC 4MEXF 2WAQN 1YRNA 1FTTA 4JOMA 5LRSA 2KRFA 2ZNYA 1QO0D 1MBGA 4EM1A 3KPHA 4A3CJ 2LD5A 1FBSA 3S8PA 3S17J 1X1AA 2LP0A 2WTEA 1HQCA 3BOQA 4ZJZA 2JA2A 3CCJI 4N0BA 4BKXA 3K1MA 2V9KA 1K61A 3WHCA 2LKSA 1U5TC 1TWCJ 5KVRA 4R1HA 4DQ2A 4E7IA 3E6BA 2EIKH 4Y3OA 4Y52J 2E2IJ 4N9HA 1QZYA 1BC8C 5EDNA 1GXPA 2QF7A 1TQIA 2GIVA 4KT5C 2WB1A 2HTJA 1MMDA 2DO7A 2OUMA 3M8JA 1DQUA 1MZBA 4FISA 1SFKA 3KEQA 5CJ9A 3CC4I 1AU7A 4OIRF 4OAYA 3B6AA 1IN6A 1XTAA 2QBYA 2W24A 1VQPI 4BUPA 5FLVA 1YIOA 3EQLF 4ETSA 1W36D 1U8BA 4RGUA 3V42A 3HYIA 1H89C 3D5RC 2L02A 1JTYA 4PJMA 2HI3A 2HOTA 3E6MA 4C30A 4BQQA 3PQKA 1NG6A 2LH9A 4PJLA 4XLEA 5D6EA 3HOUJ 1PYVA 4AYBN 2LRDA 5LGTA 1V3FA 3J7ZI 4IHVA 3PO2J 4YFKF 3U9GA 2B7EA 2XPUA 3BROA 2VQCA 2AXLA 2JMWA 1FOKA 4J00A 3GYHX 4YG2F 1HDPA 4P96A 1X4OA 1LEAA 1S9HA 3RKXA 3GZ5A 4CCOA 4PFPA 2COMA 2KIQA 3OYDA 1XGSA 3E97A 1SD4A 5B1AH 1X2NA 3CLOA 4ZZLA 2HS5A 1UELB 1U5TA 3IAM2 2WC2A 1MJ9A 4QPOA 1PDNC 1R58A 2A05A 3HOSA 2XUBA 2XF6A 1T38A 4AM3A 1X58A 3C2GA 1F4KA 1LKXA 2XAHA 4F93B 5BQTA 5TJJA 4V19K 4S04A 3OIOA 2MA3A 5H2FC 1Z67A 4BE2A 2UWMA 2JWTA 2W25A 4G8XA 3KIOA 3N05A 1S72I 1U2WA 1UJ8A 2DLLA 2CV0A 2QUFA 1XSDA 1JGGA 4IX7A 1ZLJA 1J0RA 2D1HA 5IT3A 2HEOA 2HQRA 1JT0A 2EH3A 3BG9A 2RQQA 4HF0A 2JN6A 2K02A 1XSXA 3CJRB 2JA8J 4A3LJ 2BEOA 2LKPA 3L00A 1TNSA 1SANA 5C4XJ 1X3WB 4NC8A 1TW3A 3CF2A 2CUFA 2QENA 2ELHA 4KDPA 3SEZA 2V6EA 3ISPA 4U0YA 2XF7A 3SXYA 4KIFA 3DKYA 4MO7A 1TW2A 1RRJA 2M45A 3J80Z 4XRFA 3CO6C 1TWAJ 3RQIA 5M3FJ 5HLHA 1OYYA 1B9MA 2OQGA 2CUJA 3GTQJ 2CH0A 4EMSA 5FKOA 3HG9A 2R7UA 2BY1A 2OD5A 1YQAA 4BL0B 3CO7C 3OYJA 1FBQA 3TEDA 1YS6A 4B48A 5J4VA 2H1LA 1D0XA 1YRNB 1SFUA 5LLQA 1UMQA 5BPDA 4I0AA 4F52A 1Y39A 2VJ5A 3I59A 4QLCU 3OY9A 2VJ4A 1ZQ3P 4BXXJ 1E0EA 5CVRA 4ENJA 5CVUA 3HJEA 3OYMA 2PG4A 1A36A 4XM3A 1SD5A 1ZGWA 2ZXWH 3PNVA 2XDVA 3ZPLA 1Y8RB 3HGGA 1WI3A 2NNNA 1JI8A 2ICWG 1OCTC 1GVDA 1LQ1A 5E1XA 3OYLA 1NH3A 5FLMJ 3ZMVA 1XDUA 3UR3C 3CJTB 2Q1ZB 3JRCA 2X6XA 1MJBA 1G3YA 4D9JA 2K3PA 3IKVA 4NQWA 3DF8A 3TBIA 1VQLI 3D0SA 2H8RA 3K4CA 4LIUA 2TDXA 3MFKA 4FX4A 2HYFA 2K85A 4IRHA 1W5CC 2E1OA 1OFCX 3WG9A 2L9SA 4M74A 4C2MJ 3EUAA 4AIHA 1XD7A 3A03A 4I09A 4E7JA 5ILVA 3S1RJ 1P7JA 3IH3A 1SAUA 3WTTC 3WTXC 1VZ0A 5C3EJ 2GOMA 5ILUA 3K1PA 2KP6A 3AL0B 1FMWA 1KQ8A 5D5WB 1D1BA 2QBYB 3K6GA 3KZYA 4IOAF 3LOCA 5F0CA 5FROA 2QEXI 4YIIA 3BQYA 5IP7J 2G9WA 4JBAA 3T0YA 1LFUP 1D1CA 1YW8A 3WTZA 2E7XA 3AG2H 1R71A 4JX5A 5CVIA 1ZN2A 2CQQA 2W84A 5LHHA 1H9TA 4XRMA 2E71A 4IZZA 1V5EA 4WWCA 3EYYA 5JVGF 4L9VA 4KIBA 3BR6A 3DPTA 5H20A 2KLOA 3LSMA 2LDUA 4KUMA 3QU6A 1RETA 2A6EF 2DMUA 2HKXA 2L0KA 2XROA 4M71A 2V1DA 2CW0F 4Y4RA 3MVPA 2HQAA 4CZZA 1VFCA 1YX3A 4EQQA 2Y9YA 1BBYA 2EFQA 2EIJH 3KX2A 4L9JA 4FASD 1JKQC 2M2EA 1FLIA 1JUSA 4M72A 2PQ8A 4DYQA 5HLGA 2HVQA 1FEXA 2YU3A 3G3ZA 2MC3A 2P4WA 1Y0NA 2K9NA 1U5TB 1T8IA 3OYNA 2P7CB 2KJCA 3DQVC 4RB3C 2LVSA 2PBIA 3DXJF 3FXQA 3VFZA 4XQFA 4BE0A 5EG0A 3F8BA 2FMYA 3OMYA 2OAZA 1ETKA 3ZQHA 3BR1A 1WCMJ 1MD0A 1R5HA 2DFFA 4EJOA 2NAZA 4RM2A 5KCMA 3KP4A 1K78A 4Z6YA 1ETOA 3LSJA 3GVAA 1MGTA 4BHCA 3HOWJ 2Z33A 1LDDA 1HSJA 1HF0A 5F0FA 5FKKA 3EUHC 2DJIA 2O9LA 5KAIC 4E7KA 2NVYJ 2DOEA 3PIPF 2CV1A 3K4KA 5D8KB 4HNTA 1KU3A 4G6TB 4BEHA 4EM0B 3ZGKA 3I4MJ 1ETVA 2JTVA 3LA3A 1EH7A 3ERMA 2EPFA 1D1AA 3AG3H 3KFWX 1USTA 3VYSB 3OWTA 3QYFA 1D8KA 4KT6A 5HDGA 3N4MA 1U9OA 4L5JA 3V4GA 1HW1A 4AWXB 2F4MB 5CVVA 2FX0A 3M1EA 4RA2A 2NNYA 1FIPA 2F5EA 3BJ6A 1A04A 4B47A 5JHFA 1LE8A 2VXDA 2Y0SN 3JRAA 1IN8A 3CESA 1YOVB 2R7QA 4DBRA 3ZQQA 1FPQA 4M3DA 3PFIA 5ILSA 2K86A 4L9TA 3OYIA 1P7IA 4B8XA 2A69F 3K2ZA 5JLXA 1HDDC 2DAOA 4D0PA 2L7FP 3CLQA 4EJVA 4CUGA 5AONA 5DYMA 3OYBA 1FYMA 4ABZA 2ETHA 2X9DA 3ZCOA 3K70D 5C44J 5D5VB 3CCUI 1WH5A 3F6OA 3I59B 3SFZA 3KYDB 2ESNA 2VBZA 3J7YJ 2CGPA 2LFBA 2M4GA 1K4TA 3GFJA 3WGIA 5FD5A 5EEHA 3EPZA 3V7SA 4QPQA 3RYRA 1POGA 1ZLKA 1BI3A 1XB4A 3GWZA 3P5JA 2HOSA 4NHJA 2XAJA 3A4CA 4I0BA 3Q0VA 1VTNC 4S05A 2OTLI 2HQNA 2QQBA 2Z16A 2BV6A 2O5RA 2P5LC 1HW2A 3M3YJ 3IWFA 1NG7A 2F5DA 1GV2A 1WGXA 3VSLA 4A69C 4CYCA 1MNEA 3PNYA 4EM2A 5EF6A 2CMPA 4MTDA 3EUHA 2XC7A 5E20A 1I6HJ 1F36A 1K83J 2K7LA 2LMDA 4IEJA 3FHZA 4CO8A 3G4SI 2CV2A 1VQOI 2QKLB 3P9IA 5CQEA 3LQQA 1JT6A 3GCMA 2MSYA 2HPMA 5FGMA 1PUFA 1Z21A 3I71A 2DTZA 3VODA 2KIUA 3MMYB 4J19A 1MH3A 1IUYA 1BR2A 1EA3A 3ZQIA 1P4WA 1S3JA 4DYRA 3F8CA 3IC7A 2VODA 5J8FA 3HL2A 2VKHA 2EA4A 2UXXA 1IG7A 2JPBA 2FUG2 2W82A 2STTA 3VB2A 3WTSC 3PSIA 1X1BA 2NVQJ 3OYEA 1WWXA 1WJAA 2CSOA 5GAHJ 3DWLE 1UHWA 5K5QA 1KU2A 1KYZA 4O5VA 1HKQA 1YW7A 4XMYA 3JRFA 1XC5A 5GP9A 4HRIA 4XK4A 1HC8A 2DOFA 2GOXB 2W48A 3Q9VA 4U7DA 3Q3SA 2DT7B 2M7AA 3GTMJ 4KICA 4P5OA 2UV1A 3OV8A 4BH9A 2ZJPF 5FLXZ 4V2FA 4CDGA 5LHIA 2M0MA 2ME0A 4ANJA 3NQOA 5K1YA 5FFZA 5E3LA 5FRMA 4G6QA 2VPLA 4OU0A 2O6GE 1VQ5I 2PMZN 5BOXA 2VOOA 4RM3A 4CH7A 1T2KA 3LAJA 1ERDA 3BC8A 3BG5A 3QAHA 1WVRA 3CP2A 2VL8A 5GPCA 2A68F 5IY5H 3PJRA 1YFHA 1IN5A 1P4AA 5ERIA 2G7UA 2LK2A 4P55A 4B09A 2I8DA 2KPMA 2MGQA 5KK1A 2IPQX 1X1DA 1VQ4I 3QPTA 5HOOA 1IV8A 4I02A 3MN2A 1X4PA 5K7FA 2M87A 1XGMA 1LJ9A 1Y6IA 2V4JC 1CF7A 5B66C 1SFEA 2EFWA 1IXRC 4HW0A 1SMYF 3TO7A 4PGGA 4YIFA 3HZJA 4BJ5C 2LSOA 2YX4A 3L2VA 2IRFG 2AQFA 2K5CA 2JUGA 4XN0A 3KYLA 4G7ZF 5L3EA 3FZVA 1FBUA 4I2OA 1YYVA 1I1SA 3ONQA 2W00A 3EDPA 3IRQA 1IRZA 1BIBA 4IXAA 4YFNF 4LFUA 3MQ0A 2PJPA 5D4SA 5EGOB 4II2A 1X3ZB 2BHYA 1B8IA 3P7NA 2PJRA 2EQRA 1U9NA 2CS3A 1MBEA 5LGUA 3L2WA 4ENKA 3K1NA 4X6AJ 3CCEI 3LA2A 4HYEA 2VE9A 3CCMI 2DFHA 1QZZA 2BYVE 4AVZA 3PL8A 3JTHA 2K40A 3TP0A 2HOAA 5DCMA 9ANTA 2MW8A 2R7ZJ 3HM5A 2L01A 3LFKA 3MEXA 2A07F 5D6FA 2M1BA 2A6TA 3M07A 2BOLA 5HODA 3CDLA 5A2QK 4LIVA 2O61A 1JUMA 2M34A 4IHWA 3ABLH 1RKTA 5E1WA 4WX9A 3I3LA 4M6XA 4MHGA 4UVCA 1ZG3A 2XAGA 4FQGA 2QVOA 2ELJA 3HUGA 2OZUA 4N4NB 2KIFA 2ECCA 2OPTA 3PNTA 4P9UA 3F0CA 4C2TA 4DW6A 2LYCA 4A3MJ 2LY2A 4MQ9F 4LOCA 3G2BA 3R61A 1K7AA 3REOA 1U6GA 1GV5A 2L9RA 4XRSG 2CQKA 2IT0A 5FRNA 4CGZA 4HDUA 2A3SA 4AYBA 1TWFJ 2B63J 4LLGF 3TKYA 1S7EA 3PQJA 4ZH4F 1YG2A 5ICGA 1FNNA 3OIQA 1Q1HA 3MWMA 4FT8A 5LFAA 1B72A 3EYIA 2XASA 1QVTA 1V4RA 1VQNI 4N9IA 1G6NA 3OSGA 2FJ1A 1BR4A 4WCGA 1NK3P 3F3XA 2VPRA 3FHNA 4M3EA 3DEWA 4BBSJ 2I10A 3KEYA 1MNDA 1QVUA 3IL2A 1R23A 4A0YA 1WSUA 4U0WA 5M5XJ 1G2HA 4HNVA 4E7HA 5DM6F 4ZTJA 3GX4X 1FT9A 2DMQA 2JZYA 2KHMA 4MQVA 3RZDJ 4AIKA 3RPUD 3COAC 2DI3A 1B1BA 3MKYB 4HA8A 4XN3A 3W3CA 4I76A 1ZELA 1J5YA 3KP2A 5JFRA 1F1ZA 2DODA 1MW7A 4F7ZA 1E17A 3FKJA 4MLOA 1Y1VJ 5HNFA 1JKPC 1FP1D 4K2EA 3ERED 1JKOC 2PEXA 1NHAA 3KP6A 3WE3A 2NRAC 1V54H 1E3HA 3UNGC 2PLYA 2MG4A 4CCLA 1A31A 1APLC 4L0YB 3HOYJ 3WGGA 1QHGA 5L3DA 1BW6A 2TRTA 4XLNF 4ZDOA 3I4NJ 2ME6A 3WTUC 2IS2A 2N8GA 1S29A 4UB8C 4FHTA 3Q0UA 4M3GA 3KP7A 2Z5UA 2E1CA 2HKOA 2ZCWA 4HX7A 3ZQCA 2E2JJ 4GDFA 4IL6C 2LR8A 2FBIA 2QGUA 3HIFA 2BW3A 2MC4A 3ECHA 5J3LA 3QWLA 3LSIA 2FXAA 1VF9A 3SHFA 4NC6A 4MNUA 2HDWA 1KQ9A 3LWFA 4WF2A 1R1TA 1OPCA 1IUFA 4E7SA 2DMNA 3FXMA 1RZ4A 5E3MA 5LD2C 4OWRB 3M1CA 2Q2EA 2DN0A 1O4XA 1FIAA 5B3SH 3WTWC 1YTYA 2GLOA 1Z0XA 3PUFA 4FE7A 1R4MB 5K7HA 3CUQB 3FISA 3HRUA 2O03A 2E7WA 1KU9A 2AXTC 4PUSA 1VQ6I 1F43A 3OS1A 1YO5C 3PSFA 3PUBA 2EIMH 3RZOJ 1SD6A 4I99C 1I6XA 2CFOA 2FEZA 2EFPA 1OYWA 4QSHA 1QQIA 4L18B 2DFIA 1ETYA 1DU6A 1D5YA 4XRSA 2VT3A 3NEUA 5CQGA 5DCMB 3V8LA 3AKZA 1L0OC 1PVEA 3E3VA 3T8RA 1ZRFA 3HOXJ 3SDBA 4ENMA 1VQ9I 1I1GA 4EJTA 5HS7A 2XAUA 2V7FA 2Y30A 3OL3A 5FD6A 2BXYA 2XGEA 3WTVC 2IW5A 1IJWC 3S15J 3HRTA 2LBFA 1YE9A 3FXKA 3WGHA 1WJBA 4KN4X 5GTHC 3H92A 1JTXA 3DEEA 1KZHA 4HQMA 4JYKA 2P6TA 2VASA 3GTJJ 3S3OA 4LG0A 4A3DJ 3C2BA 1LDJA 3CCVI 5IT9K 3C7JA 4A3BJ 3M8FA 4IRGA 5IYCJ 1DP3A 4CCKA 1KA8A 2KMUA 4FCYA 1WFXA 3HOTA 4A93J 4IF4A 4IKFA 2DCEA 2BGCA 2V9VA 3TP3A 1X1PA 1Y8QB 1TNTA 2DU9A 4HNUA 5HS8A 2RC4A 3TO6A 3W6JB 3CMMA 2ZXHA 3E7LA 1Z3YA 5J4YA 2HU9A 4HSRA 2DA3A 5E8GA 5HS9A 2FSWA 2R7OA 5F64A 1ZHFA 1ZGAA 3TO9A 3KLOA 4MGRA 4M73A 1GXQA 2JK3A 3HRMA 4C2UA 3CMEI 2PX9A 1UB9A 4XLPF 4Y13A 2LF7A 1T98A 2VC0A 3TQNA 2GAUA 4LG3A 3F72A 5KAFC 2FD5A 2IS1A 4AUXA 4FTHA 1BJAA 3E0JB 4KISA 1X2MA 3H9QA 4H4KC 5HVQC 4RAFA 2DYRH 5F04A 1U78A 5FFXA 2Y2ZA 2QCOA 3QOPA 1OCZH 1LDKB 5DUKA 2I5UA 3QP5A 3PIOF 2JVHA 3ZQ7A 3JRBA 1T6SA 4BDZA 2EV5A 4LGWA 4DNCA 1RR7A 3H36A 2P5VA 1XGNA 2X51A 4UVAA 1R9TJ 4CCNA 3ABTA 4LB6B 4HX4A 2KZVA 2R3SA 3DCFA 3A2KA 4ZZDA 2JRMA 3BG6A 2KJBA 1G8XA 2L4AA 4Y7NJ 3BCBA 4IHTA 1ETXA 2VQHA 1VQMI 2DXIA 2ZSIB 2FA5A 2LKXA 1AHDP 2IEKA 3BTLA 2X6YA 3P9CA 5DCFA 2JQ7A 1XMAA 3DP7A 4YFXF 2CJJA 1UG2A 3IV5A 2R5YA 2IA0A 1IGNA 2CQ7A 2OZ6A 2ZSHB 3LMMA 4A6EA 2UZKA 5LBQA 1N75A 2V6CA 1WI9A 1WH7A 1I39A 5CKTA 3TDUC 1OMIA 3GFMA 1O3QA 3BTJA 1O3SA 3ABMH 1OKRA 4XKVA 5M5YJ 4KFCA 2GA1A 3H9JA 4A5MA 4LLLA 3CCQI 1RNLA 1WJDA 1XN7A 4M9ZA 2Y0SA 2A5YB 4RGXA 3PFYA 2VBXA 4WXDA 2O0YA 1WPKA 1B9NA 2CRGA 3HB9A 2LY1A 4YELA 4A6DA 5B5EC 3FF5A 3A02A 3HHGA 5D5UB 4RLQA 2IA1A 2OBPA 2R7RA 2KKOA 3CD6I 3F8NA 4RGRA 5L3FA 4UUSA 1E3OC 2YR2A 5LHGA 3I9V2 3T1BA 2ZMEA 3L09A 4ESBA 5DEQA 1U8RA 2F6CA 1FMVA 2HYJA 4PDKA 3HSFA 4NBQA 3RYPA 5DD8A 5F0HA 3OYAA 2VUMJ 1QGPA 2M9HA 2VKVA 1XCBA 1B4AA 1ON2A 2CQNA 4TV7A 3MKLA 2OC6A 2C6YA 4E4HA 1U3EM 1CQTA 3IH2A 3K9TA 2QQ8A 4RAGA 2VOPA 3HEFA 1IDYA 4HLXA 2ACJA 3KYCB 2OJED 3K4LA 5J6XA 5KHDA 4KMUX 1R1UA 4NNJA 1FP2A 2ELKA 1KYWA 2DTRA 2IJLA 4L0ZB 5ICCA 4A3JJ 4PSWA 3CC7I 2R7FA 4BJ6C 3J7AO 4PSXA 4KN7X 3P9KA 2EB7A 1XMXA 1N25A 2L2OA 2EA2A 2WA0A 3DV8A 3HXLA 1ZRDA 1DPUA 4A5NA 2KFDA 1FSEA 4D5CA 3HC7A 5JLWA 5BPIA 5FB2A 3CJNA 1LUJB 3JRHA 1F5TA 2FBHA 1R1VA 1YW9A 1IO2A 2K27A 1MMSA 1BC7C 3JAMK 4ZYAA 2GA2A 4G9YA 2XGDA 2H27A 2R7VA 1FC3A 2XGCA 4AD9A 2IGMA 2ID3A 3WODF 2VBWA 3LA7A 4RBOA 2ZO4A 1ULYA 3E5UA 5LGNA 2VONA 1FTZA 2R5ZA 4M9SA 1GHCA 4YEJA 1JGSA 1UFMA 4ESJA 3RDIA 1BI2A 1ORKA 2ID6A 3ZQGA 2M3AA 4I6ZA 3QRFF 1LPQA 1NK2P 1MDMA 1TTYA 2RKHA 5E18F 3RKQA 3H0GJ 2JUCA 4BQNA 4HSTA 4C9YA 2P6SA 3GO5A 2DMTA 2K9QA 3CCRI 2EJRA 2CG4A 3CDHA 1WJFA 1RPWA 2Y75A 3MCZA 1TC3C 1MKMA 4XORA 1FSHA 4BDYA 3V8KA 1J09A 1TQPA 2V9PA 2PMZA 3DBRB 1BI1A 3E5QA 1TP4A 5CYVA 1JKRC 1BOAA 3MZHA 1LFBA 4CA0A 4BXFA 2Z2SB 4A3FJ 2BY3A 3BJAA 3K2AA 1P6RA 1MBHA 3FXOA 4DYCA 3D1NI 4J01A 1QPIA 3BTCA 1HW5A 2JT1A 5DM7F 3LSGA 4LJZF 1W36C 1AA7A 4B4CA 4KA4A 4EJUA 2ZJRF 2E5ZA 3H35A 2WY8Q 3OSFA 5FJ8J 2L7ZA 4IHYA 3T8TA 4X0GA 1W7PA 1FOXA 3FM3A 2RV8A 4UXNA 3ML6A 1HKSA 4RB0A 2IS4A 2K4BA 1LVAA 1TL8A 1DDNA 1JJ6C 2PMHA 2EZIA 2X1EA 3RPUA 3ZQFA 2AO9A 3RQ4A 3HGYA 4NQWB 3KE2A 4G94A 3M7GA 3ECOA 4B3XA 1MJAA 1BN5A 2G7HA 3BR3A 1W5TA 3SZGA 2OCCH 5IP6A 1O57A 1R22A 3S1QJ 3F8FA 2Y48A 2JPCA 2H09A 5JVTA 3CTAA 5HLIA 4DOZA 4DJAA 5C4JJ 3FMRA 3MKZA 2R7WA 2LTPA 2F48A 2ZNZA 4ZDPA 5HDNA 1E2XA 3GTOJ 3L7WA 1TLHB 2HWVA 2HGCA 3BZKA 3JW4A 4RS8A 3H0DA 5DUIA 5EEGA 1Q1VA 2W85A 1BL0A 1BW5A 1STZA 4MTEA 3E6CC 1Z1DA 2BY2A 4EGYA 1T0FC 2MH9A 2QLZA 5EZGA 4DBQA 3LSRA 2Z1DA 2Y9ZA 1IF1A 4HAMA 3OS2A 3OIPA 5D5XB 3IKTA 2CFXA 5LRRA 3HBLA 2X4HA 5J1RA 3U1DA 2B9SA 1WKMA 2M8GX 2WV1A 3PM1A 3QPHA 2RNGA 4BHPA 1YIJI 4A0ZA 2HVSA 4BNCA 5IP9J 5J8CA 1R4NB 1IRFA 2DQLA 3G1OA 2FF4A 4CICA 3LNQA 3ZQLA 4LK0F 4HX8A 3ZMDA 3IHUA 1G3SA 1H0MA
chains in the Genus database with same CATH topology
4WXCA 1QPMA 4A2UA 1P92A 2ZFWA 2O3FA 1ONVA 1KQ0A 2XIGA 1IXSB 4Y17A 4RB1A 4E70A 3BY6A 1QNTA 1K78B 5ICEA 5JR3A 2YPRA 4KMFA 2VBYA 1D5VA 1F9NA 2WV0A 4KYWA 1PP8F 1QBJA 2ESHA 3FMQA 2CO5A 4ZYGA 4HV5A 2Q8KA 4XSXF 1T0FA 3GEZA 2GQQA 2EK5A 4HLYA 2HYGD 2FU4A 1GVJA 4LB5A 4L9NA 1XDSA 4A0XA 2GWRA 2GZWA 2P8TA 3WE2A 4RGSA 2J5OA 2UXNA 1I27A 2GXGA 2XKPA 3O3KA 1EV7A 2YSRA 5F6FA 4BXUA 3L2CA 4BHBA 1UHMA 2BBYA 2QWWA 2BE5F 2PMUA 3I4PA 2CWEA 4I01A 3R0AA 4NB5A 1P2FA 1S6LA 3FMSA 3O2PE 3JSOA 2D45A 3IWZA 4LD5A 5IT9Z 4M6YA 2L3DA 5DV5A 1IAWA 4AVPA 3R6SA 5K5RA 1DUXC 1O7FA 2FE3A 2VE8A 4HDVA 5ICFA 3F23A 1P4XA 1Z6RA 1OYIA 1J9IA 5H6RA 5ED4A 4ZYDA 1HBXG 3HSRA 1ZGJA 1I5ZA 2Z99A 3DKWA 3BWGA 1JE8A 4IPAA 3I54A 3WU1B 1O3TA 1RUNA 4UUVA 2M30A 3KP3A 5E17F 2RN7A 4Z2YA 2GXBA 2DBBA 2DPDA 2QQ9A 3GFLA 3QP6A 2MLGA 2F5CA 4BQAA 1D8JA 1CF7B 3K0LA 1JHHA 3GLXA 3ELKA 3ZMUA 4ENNA 4U0VA 1R36A 2ZXJA 1RI7A 3K69A 2XV4S 4EVIA 1FX7A 2MLKA 2OU2A 2DK8A 2FRHA 1FYLA 1IW7F 1REPC 1IN7A 4UHTA 3HTSB 1ZRCA 3RKYA 5JHUA 4GXOA 3I5UA 1ODDA 1HKTA 2Q0OA 3SQNA 1B6AA 2WWYA 1Z05A 2RVCA 1DPRA 3F21A 3BDDA 2JSCA 2VT2A 2FNPA 3B02A 4R8HA 2P7VB 1LB2A 1XGOA 2FMLA 2YX7A 5FO5A 3FXRA 3NRVA 4UNOA 4ZYEA 2NYXA 3DEUA 4LK1F 2FNAA 1Y0UA 2DPUA 3JAMZ 3JTGA 1S8NA 4GYIA 4OOIA 3OOPA 3GF2A 3F6VA 3ZN0A 3GFIA 4OMYA 3HRSA 1SMTA 2DT5A 4ZYHA 2IA2A 2D1VA 2QQAA 3BZ6A 3V7RA 4Q48A 5E1ZB 4OMZA 1KU7A 2FBKA 1G3TA 1BI0A 2QM3A 4EV0A 4UV8A 1IN4A 2DW4A 4CHUA 3F8MA 5BS6A 3D5LA 2HTSA 3KETA 4PGHA 1CGPA 3I53A 3J81K 3RJPA 1ON1A 1S7AA 2XVCA 3TOAA 4GYGA 1EH8A 2XKOA 4L5IA 3HHHA 4ON0A 2A6HF 2RNJA 5CLSA 2IP2A 1OR7A 2A61A 4O6JA 5F1RA 4FX0A 3BP8A 4KIGA 3I64A 1IXCA 1O7LA 4OINF 2XAQA 3HTUA 3R60A 1B59A 5TRDA 1T39A 2QZ8A 3RIRA 3KCCA 4GCVA 1HXDA 2JRTA 3JSPA 3FM5A 1O3RA 3E6DA 1J75A 1K6OA 4I98B 3R0JA 4LMYA 3KEOA 4RB2C 4JQFA 4RAYA 4U88A 3GXOA 5JI6A 4WXHA 3BJOA 1FWZA 1AWCA 2OA4A 1UCRA 3CUOA 2M5WA 5L3BA 4I7HA 4HQEA 3WU0A 2H6CA 1PP7U 2LNBA 3DFGA 4ASNA 1AOYA 1JXSA 2PI0A 3I58A 3IRRA 2EFOA 5AIQA 2RQPA 1R00A 5CVJA 3S2WA 2L4MA 1FY7A 5LEKA 1Z9CA 1L3LA 3ABUA 3H3UA 3FWEA 1LNWA 1J7KA 3KP5A 2Z3YA 4LG0B 1R7JA 1TQMA 2HFHA 4HV6A 1XSVA 3R4KA 1TBXA 3AAFA 4HZFA 3ZN1A 4G7OF 4IVNA 4OIQF 3G73A 3F22A 2L54A 2FQ3A 1EH6A 2DQRA 2MH2A 1G4DA 3RTRA 3MAJA 1BM9A 4BYYA 3H3ZA 2P5KA 2HOEA 2J5PA 3VEPA 4HF1A 3B73A 4CXFA 2PFBA 4HBLA 2ZKZA 2STWA 1W4MA 1J59A 1D3YA 3KZZA 1YLFA 2V79A 1DP7P 4PZJA 3FX3A 3J80K 4IHSA 3TOBA 5L3GA 3RI4A 1SAXA 3DPLC 3FXUA 1C0WA 2E1NA 1R5GA 2MD5A 3ZMTA 3Q5FA 5A2QZ 1W5SA 2VC1A 1FYKA 3QU3A 3TDZC 5HDKA 3ZMZA 2O8XA 4XSZF 3ZP5A 2ISZA 2AS5F 1LEBA 1HSTA 3BPVA 4H0EA 1WRJA 5AIPA 2KIMA 4BAYA 5E8IA 3LSTA 2M8EA 1YS7A 3LAPA 5L3CA 3C1DA 2DK5A 4GO1A 3SZTA 2H94A 5BMZA 2ZMEB 3E5XA 1RUOA 3N97A 3Q9SA 3U2RA 4WK8F 3HSEA 1ZG5A 4PCQA 2V1XA 4OIPF 5DD4A 3CUQC 3T5XA 2MBFA 1Z7UA 3TGNA 4Q5SF 5D4RA 2D2WA 3GW2A 2F5FA 3GUDA 3M8EA 2K4JA 5DDGA 1JHFA 2Y0MA 4ESFA 4HOBA 1SFXA 2NS0A 1ZREA 3BPXA 4P9FA 2EV6A 4O3MA 3LQRA 3MZYA 2R7DA 1USSA 3WTYC 2VN2A 2EWNA 2EFNA 3V8JA 2RDPA 4XBFA 2XHKA 3ULQB 2OQRA 4CYDA 2ZBKA 1MDMB 4HF2A 2EV0A 1G3WA 3W6KB 4IRIA 2LF8A 1H9GA 3ZMSA 4JK1X 2Z9OA 4G6DA 3C3WA 4M9XA 1SD7A 1ZYRF 4LLNA 1S7OA 1ZARA 2ZJ2A 1ZAOA 3CUQA 3VOEA 2H6BA 1X3UA 3I0TA 2V1UA 2B0LA 4EGZA 4AIJA 2XGXA 2CYYA 1W7PB 2HR3A 4U7BA 4OIOF 3V7CA 4IJAA 5H6QA 4RAZA 4Y15A 2XRNA 5LEJA 2FOKA 2XAFA 4UV9A 1ZG1A 1FZPB 1J2XA 2IVMA 4EJWA 4R79A 6PAXA 1WQ2A 2W57A 1K79A 3L9FA 1RIOH 4G7HF 1Z6TA 3RKWA 4Q4ZF 3ROUA 4UVBA 4MEYF 2RGVA 3KLNA 1XCVA 5D8LB 2HZTA 4A12A 2VXZA 3M9AA 4GGGA 1IZ1A 5K5OA 3C18A 2HDCA 1XMKA 1Z91A 3O6BB 2QYOA 2F2EA 4KNYA 3EETA 3SZPA 3RPQA 1BIAA 1PUEE 3J81Z 1ZH5A 4Q47A 3GZ6A 1W7PD 2X0LA 2PN6A 1IRGA 4QWQA 2ISYA 5FLXK 2ADUA 1KGSA 4MEXF 5LRSA 2KRFA 2ZNYA 1QO0D 4EM1A 1FBSA 2WTEA 1HQCA 3BOQA 4N0BA 3K1MA 1U5TC 5KVRA 4R1HA 4DQ2A 3E6BA 4N9HA 1QZYA 1BC8C 1GXPA 1TQIA 2GIVA 4KT5C 2HTJA 2DO7A 1MZBA 3KEQA 5CJ9A 4OIRF 1IN6A 2QBYA 2W24A 1YIOA 3EQLF 4ETSA 4RGUA 3HYIA 2L02A 3E6MA 3PQKA 5D6EA 5LGTA 1V3FA 4YFKF 3U9GA 3BROA 2AXLA 1FOKA 3GYHX 4YG2F 4P96A 1LEAA 3RKXA 3GZ5A 2COMA 1XGSA 3E97A 1SD4A 3CLOA 4ZZLA 2HS5A 1U5TA 1PDNC 1MJ9A 2WC2A 1R58A 3HOSA 2XUBA 1T38A 1F4KA 2XAHA 5BQTA 5TJJA 4S04A 2MA3A 2UWMA 2W25A 4G8XA 1U2WA 2DLLA 2QUFA 1XSDA 1ZLJA 1J0RA 2D1HA 5IT3A 2HEOA 2HQRA 4HF0A 2K02A 1XSXA 2BEOA 2LKPA 3L00A 1TNSA 1TW3A 2QENA 2ELHA 4KDPA 3ISPA 4U0YA 3SXYA 4KIFA 1TW2A 2M45A 3J80Z 4XRFA 3CO6C 5HLHA 1OYYA 1B9MA 2OQGA 4EMSA 2OD5A 1YQAA 3CO7C 1FBQA 1YS6A 1SFUA 5LLQA 5BPDA 4I0AA 3I59A 4QLCU 5CVRA 4ENJA 5CVUA 2PG4A 1SD5A 3ZPLA 2NNNA 1LQ1A 5E1XA 3ZMVA 1XDUA 1MJBA 1G3YA 3IKVA 4NQWA 3DF8A 3D0SA 2TDXA 3MFKA 4FX4A 2HYFA 4IRHA 3WG9A 4M74A 4AIHA 1XD7A 4I09A 5ILVA 3WTTC 3WTXC 5ILUA 3K1PA 1KQ8A 5D5WB 2QBYB 3KZYA 4YIIA 2G9WA 4JBAA 3T0YA 1YW8A 3WTZA 2E7XA 5CVIA 1ZN2A 2W84A 5LHHA 1H9TA 4WWCA 3EYYA 4L9VA 4KIBA 3DPTA 5H20A 4KUMA 2LDUA 3QU6A 2A6EF 2HKXA 2XROA 4M71A 2V1DA 2CW0F 4CZZA 4EQQA 1BBYA 2EFQA 4L9JA 1FLIA 4M72A 2PQ8A 5HLGA 2YU3A 3G3ZA 2MC3A 2P4WA 1U5TB 2P7CB 2KJCA 4RB3C 3DQVC 3DXJF 2PBIA 3FXQA 3VFZA 3F8BA 2FMYA 2OAZA 1MD0A 1R5HA 4EJOA 2NAZA 1K78A 3KP4A 3GVAA 1MGTA 4BHCA 2Z33A 1LDDA 1HSJA 5D8KB 1KU3A 4EM0B 3LA3A 2JTVA 1EH7A 3KFWX 1USTA 1D8KA 5HDGA 3N4MA 4L5JA 3V4GA 1HW1A 4AWXB 5CVVA 3M1EA 2NNYA 3BJ6A 2F5EA 1A04A 1IN8A 1FPQA 3PFIA 5ILSA 2K86A 4L9TA 4B8XA 2A69F 3K2ZA 2DAOA 4D0PA 4EJVA 5AONA 5DYMA 1FYMA 2ETHA 5D5VB 3F6OA 3I59B 3SFZA 2ESNA 2VBZA 2CGPA 3GFJA 3WGIA 5FD5A 5EEHA 3V7SA 3RYRA 1ZLKA 1BI3A 1XB4A 3GWZA 4NHJA 2XAJA 4I0BA 1VTNC 4S05A 2HQNA 2QQBA 2P5LC 2BV6A 1HW2A 3IWFA 2F5DA 4EM2A 4MTDA 3EUHA 5E20A 2K7LA 3FHZA 4CO8A 3P9IA 3LQQA 5FGMA 3I71A 3VODA 2KIUA 1IUYA 1P4WA 1S3JA 3F8CA 3IC7A 2VODA 5J8FA 2EA4A 2UXXA 2JPBA 2STTA 3VB2A 3WTSC 1WWXA 2CSOA 1UHWA 5K5QA 1KU2A 1KYZA 4O5VA 1HKQA 1YW7A 3Q9VA 4U7DA 4KICA 4P5OA 3OV8A 4BH9A 5FLXZ 4CDGA 5LHIA 3NQOA 5K1YA 5FFZA 4G6QA 4OU0A 2O6GE 5BOXA 2VOOA 1T2KA 3LAJA 3QAHA 2A68F 1YFHA 1IN5A 1P4AA 5ERIA 2G7UA 4P55A 4B09A 5KK1A 2IPQX 3QPTA 5HOOA 4I02A 2M87A 1XGMA 1LJ9A 1CF7A 1SFEA 2EFWA 1IXRC 4HW0A 1SMYF 3TO7A 4PGGA 4YIFA 2LSOA 2YX4A 2IRFG 4G7ZF 5L3EA 3FZVA 1FBUA 4I2OA 1YYVA 1I1SA 3EDPA 3IRQA 1BIBA 4IXAA 4YFNF 4LFUA 3MQ0A 2PJPA 5D4SA 3P7NA 4ENKA 5LGUA 3K1NA 3LA2A 4HYEA 2VE9A 1QZZA 2BYVE 3JTHA 5DCMA 2L01A 3LFKA 3MEXA 2A07F 5D6FA 2M1BA 5A2QK 2O61A 5E1WA 4WX9A 4M6XA 4MHGA 4UVCA 1ZG3A 2XAGA 2QVOA 3HUGA 2OZUA 2KIFA 4P9UA 4MQ9F 3R61A 1K7AA 3REOA 1U6GA 2CQKA 2IT0A 4CGZA 4HDUA 2A3SA 4LLGF 3TKYA 3PQJA 4ZH4F 1YG2A 5ICGA 1FNNA 1Q1HA 3MWMA 4FT8A 3EYIA 1V4RA 2XASA 4N9IA 1G6NA 4WCGA 3F3XA 3IL2A 1R23A 4A0YA 1WSUA 4U0WA 3GX4X 1FT9A 2JZYA 4MQVA 4AIKA 3COAC 2DI3A 1B1BA 4HA8A 1J5YA 3KP2A 5JFRA 1F1ZA 4F7ZA 1E17A 1FP1D 4K2EA 3ERED 2PEXA 1NHAA 3KP6A 3WE3A 2NRAC 2PLYA 4L0YB 3WGGA 5L3DA 4XLNF 3WTUC 1S29A 4FHTA 3KP7A 2Z5UA 2E1CA 2HKOA 2ZCWA 4HX7A 2FBIA 3HIFA 3ECHA 2FXAA 3SHFA 4MNUA 1KQ9A 3LWFA 4WF2A 1R1TA 1OPCA 1RZ4A 2Q2EA 3WTWC 1YTYA 3CUQB 3HRUA 2O03A 2E7WA 1KU9A 1YO5C 1SD6A 1I6XA 2FEZA 2EFPA 1OYWA 1QQIA 4L18B 2DFIA 2VT3A 3NEUA 5DCMB 3V8LA 1L0OC 3E3VA 3T8RA 1ZRFA 4ENMA 1I1GA 4EJTA 5HS7A 5FD6A 3WTVC 2IW5A 3HRTA 3WGHA 4KN4X 3H92A 4HQMA 2P6TA 4LG0A 1LDJA 5IT9K 3C7JA 3M8FA 4IRGA 1KA8A 3HOTA 4IF4A 2BGCA 2V9VA 1TNTA 2DU9A 5HS8A 2RC4A 3TO6A 3W6JB 5E8GA 5HS9A 2FSWA 5F64A 1ZHFA 1ZGAA 3TO9A 3KLOA 4MGRA 4M73A 1GXQA 3HRMA 1UB9A 4XLPF 4Y13A 2LF7A 1T98A 2VC0A 3TQNA 2GAUA 3F72A 1BJAA 5HVQC 1U78A 5FFXA 3QOPA 1LDKB 5DUKA 3QP5A 3ZQ7A 1T6SA 2EV5A 4LGWA 4DNCA 2P5VA 1XGNA 4UVAA 3ABTA 4LB6B 4HX4A 2R3SA 4ZZDA 2KJBA 2L4AA 4IHTA 2FA5A 5DCFA 3P9CA 1XMAA 3DP7A 4YFXF 2IA0A 4A6EA 2OZ6A 2UZKA 5LBQA 2V6CA 1WI9A 3TDUC 1OMIA 3GFMA 1O3QA 1O3SA 1OKRA 4KFCA 2GA1A 4A5MA 4LLLA 1RNLA 1XN7A 4M9ZA 2A5YB 4RGXA 2VBXA 4WXDA 2O0YA 1B9NA 4A6DA 3FF5A 3HHGA 5D5UB 2IA1A 2OBPA 2KKOA 3F8NA 4RGRA 5L3FA 2YR2A 5LHGA 3T1BA 2ZMEA 3L09A 4ESBA 5DEQA 1U8RA 4PDKA 3HSFA 3RYPA 5DD8A 1QGPA 1XCBA 1B4AA 1ON2A 4TV7A 2C6YA 1U3EM 3K9TA 2VOPA 4HLXA 2ACJA 5J6XA 4KMUX 1R1UA 1FP2A 1KYWA 2DTRA 2IJLA 4L0ZB 5ICCA 2R7FA 3J7AO 4KN7X 3P9KA 2EB7A 1DPUA 2EA2A 3DV8A 1ZRDA 4A5NA 1FSEA 5BPIA 5FB2A 3CJNA 1F5TA 2FBHA 1R1VA 1YW9A 2K27A 1BC7C 3JAMK 2GA2A 4G9YA 2H27A 1FC3A 4AD9A 3WODF 2VBWA 3LA7A 2ZO4A 1ULYA 3E5UA 5LGNA 2VONA 4M9SA 1GHCA 1JGSA 1UFMA 4ESJA 3RDIA 1BI2A 3QRFF 1MDMA 1TTYA 2RKHA 5E18F 2P6SA 3GO5A 2EJRA 2CG4A 3CDHA 2Y75A 3MCZA 1MKMA 1FSHA 3V8KA 1TQPA 1BI1A 3E5QA 5CYVA 1BOAA 3MZHA 3BJAA 1P6RA 1HW5A 2JT1A 4LJZF 4KA4A 4EJUA 3T8TA 1W7PA 3FM3A 2RV8A 4UXNA 3ML6A 1HKSA 4RB0A 2K4BA 1LVAA 1DDNA 2PMHA 3RPUA 3KE2A 4G94A 3M7GA 3ECOA 1MJAA 1BN5A 2G7HA 1W5TA 1O57A 1R22A 3F8FA 2Y48A 2JPCA 2H09A 5JVTA 3CTAA 5HLIA 3FMRA 2ZNZA 5HDNA 1E2XA 3L7WA 1TLHB 2HWVA 2HGCA 3JW4A 4RS8A 5DUIA 5EEGA 2W85A 1STZA 4MTEA 3E6CC 1Z1DA 4EGYA 2QLZA 2MH9A 1IF1A 4HAMA 3IKTA 5D5XB 2CFXA 5LRRA 2X4HA 3U1DA 1WKMA 3QPHA 4BHPA 4A0ZA 4BNCA 5J8CA 1IRFA 4CICA 2DQLA 2FF4A 4LK0F 4HX8A 3ZMDA 3IHUA 1G3SA 1H0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WXC A;  1QPM A;  4A2U A;  1P92 A;  2ZFW A;  2O3F A;  1ONV A;  1KQ0 A;  2XIG A;  1IXS B;  4Y17 A;  4RB1 A;  4E70 A;  3BY6 A;  1QNT A;  1K78 B;  5ICE A;  5JR3 A;  2YPR A;  4KMF A;  2VBY A;  1D5V A;  1F9N A;  2WV0 A;  4KYW A;  1PP8 F;  1QBJ A;  2ESH A;  3FMQ A;  2CO5 A;  4ZYG A;  4HV5 A;  2Q8K A;  4XSX F;  1T0F A;  3GEZ A;  2GQQ A;  2EK5 A;  4HLY A;  2HYG D;  2FU4 A;  1GVJ A;  4LB5 A;  4L9N A;  1XDS A;  4A0X A;  2GWR A;  2GZW A;  2P8T A;  3WE2 A;  4RGS A;  2J5O A;  2UXN A;  1I27 A;  2GXG A;  2XKP A;  3O3K A;  1EV7 A;  2YSR A;  5F6F A;  4BXU A;  3L2C A;  4BHB A;  1UHM A;  2BBY A;  2QWW A;  2BE5 F;  2PMU A;  3I4P A;  2CWE A;  4I01 A;  3R0A A;  4NB5 A;  1P2F A;  1S6L A;  3FMS A;  3O2P E;  3JSO A;  2D45 A;  3IWZ A;  4LD5 A;  5IT9 Z;  4M6Y A;  2L3D A;  5DV5 A;  1IAW A;  4AVP A;  3R6S A;  5K5R A;  1DUX C;  1O7F A;  2FE3 A;  2VE8 A;  4HDV A;  5ICF A;  3F23 A;  1P4X A;  1Z6R A;  1OYI A;  1J9I A;  5H6R A;  5ED4 A;  4ZYD A;  1HBX G;  3HSR A;  1ZGJ A;  1I5Z A;  2Z99 A;  3DKW A;  3BWG A;  1JE8 A;  4IPA A;  3I54 A;  3WU1 B;  1O3T A;  1RUN A;  4UUV A;  2M30 A;  3KP3 A;  5E17 F;  2RN7 A;  4Z2Y A;  2GXB A;  2DBB A;  2DPD A;  2QQ9 A;  3GFL A;  3QP6 A;  2MLG A;  2F5C A;  4BQA A;  1D8J A;  1CF7 B;  3K0L A;  1JHH A;  3GLX A;  3ELK A;  3ZMU A;  4ENN A;  4U0V A;  1R36 A;  2ZXJ A;  1RI7 A;  3K69 A;  2XV4 S;  4EVI A;  1FX7 A;  2MLK A;  2OU2 A;  2DK8 A;  2FRH A;  1FYL A;  1IW7 F;  1REP C;  1IN7 A;  4UHT A;  3HTS B;  1ZRC A;  3RKY A;  5JHU A;  4GXO A;  3I5U A;  1ODD A;  1HKT A;  2Q0O A;  3SQN A;  1B6A A;  2WWY A;  1Z05 A;  2RVC A;  1DPR A;  3F21 A;  3BDD A;  2JSC A;  2VT2 A;  2FNP A;  3B02 A;  4R8H A;  2P7V B;  1LB2 A;  1XGO A;  2FML A;  2YX7 A;  5FO5 A;  3FXR A;  3NRV A;  4UNO A;  4ZYE A;  2NYX A;  3DEU A;  4LK1 F;  2FNA A;  1Y0U A;  2DPU A;  3JAM Z;  3JTG A;  1S8N A;  4GYI A;  4OOI A;  3OOP A;  3GF2 A;  3F6V A;  3ZN0 A;  3GFI A;  4OMY A;  3HRS A;  1SMT A;  2DT5 A;  4ZYH A;  2IA2 A;  2D1V A;  2QQA A;  3BZ6 A;  3V7R A;  4Q48 A;  5E1Z B;  4OMZ A;  1KU7 A;  2FBK A;  1G3T A;  1BI0 A;  2QM3 A;  4EV0 A;  4UV8 A;  1IN4 A;  2DW4 A;  4CHU A;  3F8M A;  5BS6 A;  3D5L A;  2HTS A;  3KET A;  4PGH A;  1CGP A;  3I53 A;  3J81 K;  3RJP A;  1ON1 A;  1S7A A;  2XVC A;  3TOA A;  4GYG A;  1EH8 A;  2XKO A;  4L5I A;  3HHH A;  4ON0 A;  2A6H F;  2RNJ A;  5CLS A;  2IP2 A;  1OR7 A;  2A61 A;  4O6J A;  5F1R A;  4FX0 A;  3BP8 A;  4KIG A;  3I64 A;  1IXC A;  1O7L A;  4OIN F;  2XAQ A;  3HTU A;  3R60 A;  1B59 A;  5TRD A;  1T39 A;  2QZ8 A;  3RIR A;  3KCC A;  4GCV A;  1HXD A;  2JRT A;  3JSP A;  3FM5 A;  1O3R A;  3E6D A;  1J75 A;  1K6O A;  4I98 B;  3R0J A;  4LMY A;  3KEO A;  4RB2 C;  4JQF A;  4RAY A;  4U88 A;  3GXO A;  5JI6 A;  4WXH A;  3BJO A;  1FWZ A;  1AWC A;  2OA4 A;  1UCR A;  3CUO A;  2M5W A;  5L3B A;  4I7H A;  4HQE A;  3WU0 A;  2H6C A;  1PP7 U;  2LNB A;  3DFG A;  4ASN A;  1AOY A;  1JXS A;  2PI0 A;  3I58 A;  3IRR A;  2EFO A;  5AIQ A;  2RQP A;  1R00 A;  5CVJ A;  3S2W A;  2L4M A;  1FY7 A;  5LEK A;  1Z9C A;  1L3L A;  3ABU A;  3H3U A;  3FWE A;  1LNW A;  1J7K A;  3KP5 A;  2Z3Y A;  4LG0 B;  1R7J A;  1TQM A;  2HFH A;  4HV6 A;  1XSV A;  3R4K A;  1TBX A;  3AAF A;  4HZF A;  3ZN1 A;  4G7O F;  4IVN A;  4OIQ F;  3G73 A;  3F22 A;  2L54 A;  2FQ3 A;  1EH6 A;  2DQR A;  2MH2 A;  1G4D A;  3RTR A;  3MAJ A;  1BM9 A;  4BYY A;  3H3Z A;  2P5K A;  2HOE A;  2J5P A;  3VEP A;  4HF1 A;  3B73 A;  4CXF A;  2PFB A;  4HBL A;  2ZKZ A;  2STW A;  1W4M A;  1J59 A;  1D3Y A;  3KZZ A;  1YLF A;  2V79 A;  1DP7 P;  4PZJ A;  3FX3 A;  3J80 K;  4IHS A;  3TOB A;  5L3G A;  3RI4 A;  1SAX A;  3DPL C;  3FXU A;  1C0W A;  2E1N A;  1R5G A;  2MD5 A;  3ZMT A;  3Q5F A;  5A2Q Z;  1W5S A;  2VC1 A;  1FYK A;  3QU3 A;  3TDZ C;  5HDK A;  3ZMZ A;  2O8X A;  4XSZ F;  3ZP5 A;  2ISZ A;  2AS5 F;  1LEB A;  1HST A;  3BPV A;  4H0E A;  1WRJ A;  5AIP A;  2KIM A;  4BAY A;  5E8I A;  3LST A;  2M8E A;  1YS7 A;  3LAP A;  5L3C A;  3C1D A;  2DK5 A;  4GO1 A;  3SZT A;  2H94 A;  5BMZ A;  2ZME B;  3E5X A;  1RUO A;  3N97 A;  3Q9S A;  3U2R A;  4WK8 F;  3HSE A;  1ZG5 A;  4PCQ A;  2V1X A;  4OIP F;  5DD4 A;  3CUQ C;  3T5X A;  2MBF A;  1Z7U A;  3TGN A;  4Q5S F;  5D4R A;  2D2W A;  3GW2 A;  2F5F A;  3GUD A;  3M8E A;  2K4J A;  5DDG A;  1JHF A;  2Y0M A;  4ESF A;  4HOB A;  1SFX A;  2NS0 A;  1ZRE A;  3BPX A;  4P9F A;  2EV6 A;  4O3M A;  3LQR A;  3MZY A;  2R7D A;  1USS A;  3WTY C;  2VN2 A;  2EWN A;  2EFN A;  3V8J A;  2RDP A;  4XBF A;  2XHK A;  3ULQ B;  2OQR A;  4CYD A;  2ZBK A;  1MDM B;  4HF2 A;  2EV0 A;  1G3W A;  3W6K B;  4IRI A;  2LF8 A;  1H9G A;  3ZMS A;  4JK1 X;  2Z9O A;  4G6D A;  3C3W A;  4M9X A;  1SD7 A;  1ZYR F;  4LLN A;  1S7O A;  1ZAR A;  2ZJ2 A;  1ZAO A;  3CUQ A;  3VOE A;  2H6B A;  1X3U A;  3I0T A;  2V1U A;  2B0L A;  4EGZ A;  4AIJ A;  2XGX A;  2CYY A;  1W7P B;  2HR3 A;  4U7B A;  4OIO F;  3V7C A;  4IJA A;  5H6Q A;  4RAZ A;  4Y15 A;  2XRN A;  5LEJ A;  2FOK A;  2XAF A;  4UV9 A;  1ZG1 A;  1FZP B;  1J2X A;  2IVM A;  4EJW A;  4R79 A;  6PAX A;  1WQ2 A;  2W57 A;  1K79 A;  3L9F A;  1RIO H;  4G7H F;  1Z6T A;  3RKW A;  4Q4Z F;  3ROU A;  4UVB A;  4MEY F;  2RGV A;  3KLN A;  1XCV A;  5D8L B;  2HZT A;  4A12 A;  2VXZ A;  3M9A A;  4GGG A;  1IZ1 A;  5K5O A;  3C18 A;  2HDC A;  1XMK A;  1Z91 A;  3O6B B;  2QYO A;  2F2E A;  4KNY A;  3EET A;  3SZP A;  3RPQ A;  1BIA A;  1PUE E;  3J81 Z;  1ZH5 A;  4Q47 A;  3GZ6 A;  1W7P D;  2X0L A;  2PN6 A;  1IRG A;  4QWQ A;  2ISY A;  5FLX K;  2ADU A;  1KGS A;  4MEX F;  5LRS A;  2KRF A;  2ZNY A;  1QO0 D;  4EM1 A;  1FBS A;  2WTE A;  1HQC A;  3BOQ A;  4N0B A;  3K1M A;  1U5T C;  5KVR A;  4R1H A;  4DQ2 A;  3E6B A;  4N9H A;  1QZY A;  1BC8 C;  1GXP A;  1TQI A;  2GIV A;  4KT5 C;  2HTJ A;  2DO7 A;  1MZB A;  3KEQ A;  5CJ9 A;  4OIR F;  1IN6 A;  2QBY A;  2W24 A;  1YIO A;  3EQL F;  4ETS A;  4RGU A;  3HYI A;  2L02 A;  3E6M A;  3PQK A;  5D6E A;  5LGT A;  1V3F A;  4YFK F;  3U9G A;  3BRO A;  2AXL A;  1FOK A;  3GYH X;  4YG2 F;  4P96 A;  1LEA A;  3RKX A;  3GZ5 A;  2COM A;  1XGS A;  3E97 A;  1SD4 A;  3CLO A;  4ZZL A;  2HS5 A;  1U5T A;  1PDN C;  1MJ9 A;  2WC2 A;  1R58 A;  3HOS A;  2XUB A;  1T38 A;  1F4K A;  2XAH A;  5BQT A;  5TJJ A;  4S04 A;  2MA3 A;  2UWM A;  2W25 A;  4G8X A;  1U2W A;  2DLL A;  2QUF A;  1XSD A;  1ZLJ A;  1J0R A;  2D1H A;  5IT3 A;  2HEO A;  2HQR A;  4HF0 A;  2K02 A;  1XSX A;  2BEO A;  2LKP A;  3L00 A;  1TNS A;  1TW3 A;  2QEN A;  2ELH A;  4KDP A;  3ISP A;  4U0Y A;  3SXY A;  4KIF A;  1TW2 A;  2M45 A;  3J80 Z;  4XRF A;  3CO6 C;  5HLH A;  1OYY A;  1B9M A;  2OQG A;  4EMS A;  2OD5 A;  1YQA A;  3CO7 C;  1FBQ A;  1YS6 A;  1SFU A;  5LLQ A;  5BPD A;  4I0A A;  3I59 A;  4QLC U;  5CVR A;  4ENJ A;  5CVU A;  2PG4 A;  1SD5 A;  3ZPL A;  2NNN A;  1LQ1 A;  5E1X A;  3ZMV A;  1XDU A;  1MJB A;  1G3Y A;  3IKV A;  4NQW A;  3DF8 A;  3D0S A;  2TDX A;  3MFK A;  4FX4 A;  2HYF A;  4IRH A;  3WG9 A;  4M74 A;  4AIH A;  1XD7 A;  4I09 A;  5ILV A;  3WTT C;  3WTX C;  5ILU A;  3K1P A;  1KQ8 A;  5D5W B;  2QBY B;  3KZY A;  4YII A;  2G9W A;  4JBA A;  3T0Y A;  1YW8 A;  3WTZ A;  2E7X A;  5CVI A;  1ZN2 A;  2W84 A;  5LHH A;  1H9T A;  4WWC A;  3EYY A;  4L9V A;  4KIB A;  3DPT A;  5H20 A;  4KUM A;  2LDU A;  3QU6 A;  2A6E F;  2HKX A;  2XRO A;  4M71 A;  2V1D A;  2CW0 F;  4CZZ A;  4EQQ A;  1BBY A;  2EFQ A;  4L9J A;  1FLI A;  4M72 A;  2PQ8 A;  5HLG A;  2YU3 A;  3G3Z A;  2MC3 A;  2P4W A;  1U5T B;  2P7C B;  2KJC A;  4RB3 C;  3DQV C;  3DXJ F;  2PBI A;  3FXQ A;  3VFZ A;  3F8B A;  2FMY A;  2OAZ A;  1MD0 A;  1R5H A;  4EJO A;  2NAZ A;  1K78 A;  3KP4 A;  3GVA A;  1MGT A;  4BHC A;  2Z33 A;  1LDD A;  1HSJ A;  5D8K B;  1KU3 A;  4EM0 B;  3LA3 A;  2JTV A;  1EH7 A;  3KFW X;  1UST A;  1D8K A;  5HDG A;  3N4M A;  4L5J A;  3V4G A;  1HW1 A;  4AWX B;  5CVV A;  3M1E A;  2NNY A;  3BJ6 A;  2F5E A;  1A04 A;  1IN8 A;  1FPQ A;  3PFI A;  5ILS A;  2K86 A;  4L9T A;  4B8X A;  2A69 F;  3K2Z A;  2DAO A;  4D0P A;  4EJV A;  5AON A;  5DYM A;  1FYM A;  2ETH A;  5D5V B;  3F6O A;  3I59 B;  3SFZ A;  2ESN A;  2VBZ A;  2CGP A;  3GFJ A;  3WGI A;  5FD5 A;  5EEH A;  3V7S A;  3RYR A;  1ZLK A;  1BI3 A;  1XB4 A;  3GWZ A;  4NHJ A;  2XAJ A;  4I0B A;  1VTN C;  4S05 A;  2HQN A;  2QQB A;  2P5L C;  2BV6 A;  1HW2 A;  3IWF A;  2F5D A;  4EM2 A;  4MTD A;  3EUH A;  5E20 A;  2K7L A;  3FHZ A;  4CO8 A;  3P9I A;  3LQQ A;  5FGM A;  3I71 A;  3VOD A;  2KIU A;  1IUY A;  1P4W A;  1S3J A;  3F8C A;  3IC7 A;  2VOD A;  5J8F A;  2EA4 A;  2UXX A;  2JPB A;  2STT A;  3VB2 A;  3WTS C;  1WWX A;  2CSO A;  1UHW A;  5K5Q A;  1KU2 A;  1KYZ A;  4O5V A;  1HKQ A;  1YW7 A;  3Q9V A;  4U7D A;  4KIC A;  4P5O A;  3OV8 A;  4BH9 A;  5FLX Z;  4CDG A;  5LHI A;  3NQO A;  5K1Y A;  5FFZ A;  4G6Q A;  4OU0 A;  2O6G E;  5BOX A;  2VOO A;  1T2K A;  3LAJ A;  3QAH A;  2A68 F;  1YFH A;  1IN5 A;  1P4A A;  5ERI A;  2G7U A;  4P55 A;  4B09 A;  5KK1 A;  2IPQ X;  3QPT A;  5HOO A;  4I02 A;  2M87 A;  1XGM A;  1LJ9 A;  1CF7 A;  1SFE A;  2EFW A;  1IXR C;  4HW0 A;  1SMY F;  3TO7 A;  4PGG A;  4YIF A;  2LSO A;  2YX4 A;  2IRF G;  4G7Z F;  5L3E A;  3FZV A;  1FBU A;  4I2O A;  1YYV A;  1I1S A;  3EDP A;  3IRQ A;  1BIB A;  4IXA A;  4YFN F;  4LFU A;  3MQ0 A;  2PJP A;  5D4S A;  3P7N A;  4ENK A;  5LGU A;  3K1N A;  3LA2 A;  4HYE A;  2VE9 A;  1QZZ A;  2BYV E;  3JTH A;  5DCM A;  2L01 A;  3LFK A;  3MEX A;  2A07 F;  5D6F A;  2M1B A;  5A2Q K;  2O61 A;  5E1W A;  4WX9 A;  4M6X A;  4MHG A;  4UVC A;  1ZG3 A;  2XAG A;  2QVO A;  3HUG A;  2OZU A;  2KIF A;  4P9U A;  4MQ9 F;  3R61 A;  1K7A A;  3REO A;  1U6G A;  2CQK A;  2IT0 A;  4CGZ A;  4HDU A;  2A3S A;  4LLG F;  3TKY A;  3PQJ A;  4ZH4 F;  1YG2 A;  5ICG A;  1FNN A;  1Q1H A;  3MWM A;  4FT8 A;  3EYI A;  1V4R A;  2XAS A;  4N9I A;  1G6N A;  4WCG A;  3F3X A;  3IL2 A;  1R23 A;  4A0Y A;  1WSU A;  4U0W A;  3GX4 X;  1FT9 A;  2JZY A;  4MQV A;  4AIK A;  3COA C;  2DI3 A;  1B1B A;  4HA8 A;  1J5Y A;  3KP2 A;  5JFR A;  1F1Z A;  4F7Z A;  1E17 A;  1FP1 D;  4K2E A;  3ERE D;  2PEX A;  1NHA A;  3KP6 A;  3WE3 A;  2NRA C;  2PLY A;  4L0Y B;  3WGG A;  5L3D A;  4XLN F;  3WTU C;  1S29 A;  4FHT A;  3KP7 A;  2Z5U A;  2E1C A;  2HKO A;  2ZCW A;  4HX7 A;  2FBI A;  3HIF A;  3ECH A;  2FXA A;  3SHF A;  4MNU A;  1KQ9 A;  3LWF A;  4WF2 A;  1R1T A;  1OPC A;  1RZ4 A;  2Q2E A;  3WTW C;  1YTY A;  3CUQ B;  3HRU A;  2O03 A;  2E7W A;  1KU9 A;  1YO5 C;  1SD6 A;  1I6X A;  2FEZ A;  2EFP A;  1OYW A;  1QQI A;  4L18 B;  2DFI A;  2VT3 A;  3NEU A;  5DCM B;  3V8L A;  1L0O C;  3E3V A;  3T8R A;  1ZRF A;  4ENM A;  1I1G A;  4EJT A;  5HS7 A;  5FD6 A;  3WTV C;  2IW5 A;  3HRT A;  3WGH A;  4KN4 X;  3H92 A;  4HQM A;  2P6T A;  4LG0 A;  1LDJ A;  5IT9 K;  3C7J A;  3M8F A;  4IRG A;  1KA8 A;  3HOT A;  4IF4 A;  2BGC A;  2V9V A;  1TNT A;  2DU9 A;  5HS8 A;  2RC4 A;  3TO6 A;  3W6J B;  5E8G A;  5HS9 A;  2FSW A;  5F64 A;  1ZHF A;  1ZGA A;  3TO9 A;  3KLO A;  4MGR A;  4M73 A;  1GXQ A;  3HRM A;  1UB9 A;  4XLP F;  4Y13 A;  2LF7 A;  1T98 A;  2VC0 A;  3TQN A;  2GAU A;  3F72 A;  1BJA A;  5HVQ C;  1U78 A;  5FFX A;  3QOP A;  1LDK B;  5DUK A;  3QP5 A;  3ZQ7 A;  1T6S A;  2EV5 A;  4LGW A;  4DNC A;  2P5V A;  1XGN A;  4UVA A;  3ABT A;  4LB6 B;  4HX4 A;  2R3S A;  4ZZD A;  2KJB A;  2L4A A;  4IHT A;  2FA5 A;  5DCF A;  3P9C A;  1XMA A;  3DP7 A;  4YFX F;  2IA0 A;  4A6E A;  2OZ6 A;  2UZK A;  5LBQ A;  2V6C A;  1WI9 A;  3TDU C;  1OMI A;  3GFM A;  1O3Q A;  1O3S A;  1OKR A;  4KFC A;  2GA1 A;  4A5M A;  4LLL A;  1RNL A;  1XN7 A;  4M9Z A;  2A5Y B;  4RGX A;  2VBX A;  4WXD A;  2O0Y A;  1B9N A;  4A6D A;  3FF5 A;  3HHG A;  5D5U B;  2IA1 A;  2OBP A;  2KKO A;  3F8N A;  4RGR A;  5L3F A;  2YR2 A;  5LHG A;  3T1B A;  2ZME A;  3L09 A;  4ESB A;  5DEQ A;  1U8R A;  4PDK A;  3HSF A;  3RYP A;  5DD8 A;  1QGP A;  1XCB A;  1B4A A;  1ON2 A;  4TV7 A;  2C6Y A;  1U3E M;  3K9T A;  2VOP A;  4HLX A;  2ACJ A;  5J6X A;  4KMU X;  1R1U A;  1FP2 A;  1KYW A;  2DTR A;  2IJL A;  4L0Z B;  5ICC A;  2R7F A;  3J7A O;  4KN7 X;  3P9K A;  2EB7 A;  1DPU A;  2EA2 A;  3DV8 A;  1ZRD A;  4A5N A;  1FSE A;  5BPI A;  5FB2 A;  3CJN A;  1F5T A;  2FBH A;  1R1V A;  1YW9 A;  2K27 A;  1BC7 C;  3JAM K;  2GA2 A;  4G9Y A;  2H27 A;  1FC3 A;  4AD9 A;  3WOD F;  2VBW A;  3LA7 A;  2ZO4 A;  1ULY A;  3E5U A;  5LGN A;  2VON A;  4M9S A;  1GHC A;  1JGS A;  1UFM A;  4ESJ A;  3RDI A;  1BI2 A;  3QRF F;  1MDM A;  1TTY A;  2RKH A;  5E18 F;  2P6S A;  3GO5 A;  2EJR A;  2CG4 A;  3CDH A;  2Y75 A;  3MCZ A;  1MKM A;  1FSH A;  3V8K A;  1TQP A;  1BI1 A;  3E5Q A;  5CYV A;  1BOA A;  3MZH A;  3BJA A;  1P6R A;  1HW5 A;  2JT1 A;  4LJZ F;  4KA4 A;  4EJU A;  3T8T A;  1W7P A;  3FM3 A;  2RV8 A;  4UXN A;  3ML6 A;  1HKS A;  4RB0 A;  2K4B A;  1LVA A;  1DDN A;  2PMH A;  3RPU A;  3KE2 A;  4G94 A;  3M7G A;  3ECO A;  1MJA A;  1BN5 A;  2G7H A;  1W5T A;  1O57 A;  1R22 A;  3F8F A;  2Y48 A;  2JPC A;  2H09 A;  5JVT A;  3CTA A;  5HLI A;  3FMR A;  2ZNZ A;  5HDN A;  1E2X A;  3L7W A;  1TLH B;  2HWV A;  2HGC A;  3JW4 A;  4RS8 A;  5DUI A;  5EEG A;  2W85 A;  1STZ A;  4MTE A;  3E6C C;  1Z1D A;  4EGY A;  2QLZ A;  2MH9 A;  1IF1 A;  4HAM A;  3IKT A;  5D5X B;  2CFX A;  5LRR A;  2X4H A;  3U1D A;  1WKM A;  3QPH A;  4BHP A;  4A0Z A;  4BNC A;  5J8C A;  1IRF A;  4CIC A;  2DQL A;  2FF4 A;  4LK0 F;  4HX8 A;  3ZMD A;  3IHU A;  1G3S A;  1H0M A; 
#chains in the Genus database with same CATH topology
 4RMN A;  4XLH A;  1XS9 A;  4WXC A;  1QPM A;  4A2U A;  1HA8 A;  3W2A A;  1P92 A;  4U87 A;  2ZFW A;  5EG0 B;  2O3F A;  1ONV A;  1KQ0 A;  3GZN B;  2XIG A;  2DA2 A;  1IXS B;  4Y17 A;  4RB1 A;  4E70 A;  3BY6 A;  1QNT A;  1K78 B;  5ICE A;  1VQ7 I;  5JR3 A;  1R5I D;  2YPR A;  4KMF A;  2VBY A;  5IOZ A;  1D5V A;  4LIT A;  2R7X A;  3JR9 A;  1F9N A;  2WV0 A;  4KYW A;  1PP8 F;  2W4S A;  2O7O A;  1QBJ A;  2ESH A;  2R5Z B;  4XKW A;  3FMQ A;  1YJ9 I;  3G1M A;  2CO5 A;  4BEH B;  4ZYG A;  4HV5 A;  2Q8K A;  4NUB A;  3QPL A;  1TT0 A;  4XSX F;  4EAT A;  1T0F A;  3GEZ A;  2GQQ A;  2EK5 A;  3H5A A;  4HLY A;  2HYG D;  3JCU C;  1MNM C;  2FU4 A;  1GVJ A;  4LB5 A;  2COB A;  4L9N A;  1TWG J;  1XDS A;  1LE8 B;  4A0X A;  2GWR A;  2GZW A;  2HPI A;  3KZI C;  2DT6 A;  2ZXI A;  3CMY A;  2P8T A;  1H88 C;  3BTI A;  3WE2 A;  2IGK A;  1T95 A;  2IS6 A;  4RGS A;  2J5O A;  4DGW B;  2UXN A;  1I27 A;  2GXG A;  1MMA A;  2KRC A;  1T56 A;  2XKP A;  2AHQ A;  3S2D J;  3O3K A;  2CUE A;  3Q0W A;  3L2Q A;  2V26 A;  1EV7 A;  2YSR A;  5F6F A;  4BXU A;  2LRE A;  1FOY A;  1ZK8 A;  3DU6 A;  4F3Q A;  3L2C A;  3C2H A;  4BHB A;  2BVL A;  1MMG A;  3ZXS A;  1UHM A;  2BBY A;  5J1U A;  1EJ9 A;  3F9K A;  2QWW A;  2BE5 F;  2PMU A;  3I4P A;  2CWE A;  4I01 A;  4X1E A;  3O8G A;  3R0A A;  4NB5 A;  1A5J A;  1P2F A;  1A35 A;  4F91 B;  1S6L A;  1T33 A;  3FMS A;  3O2P E;  3JSO A;  3DTK A;  2D45 A;  3IWZ A;  4LD5 A;  1D0Z A;  2VQL A;  3K4M A;  4BQO A;  2LY9 A;  4M6Y A;  4CYC B;  5IT9 Z;  4XLF A;  2L9N A;  2P81 A;  5GAG J;  3WHB A;  2L3D A;  5DV5 A;  2EZH A;  3G1L A;  4BGD A;  5IYD J;  1IAW A;  4AVP A;  2JSP A;  3R6S A;  5K5R A;  4DZP A;  4A3G J;  2FQ4 A;  1DUX C;  1O7F A;  2ZJQ F;  4QIW N;  1PUF B;  3TL4 X;  2FE3 A;  2VE8 A;  3BR5 A;  4HDV A;  2DA7 A;  5ICF A;  3OYF A;  3F23 A;  4V2G A;  2NVU B;  3FBN B;  3SFI A;  2JVG A;  1P4X A;  1Z6R A;  2R4G A;  4F92 B;  1YIT I;  1OYI A;  3S16 J;  1J9I A;  1Z77 A;  5H6R A;  5ED4 A;  4ZYD A;  4A3K J;  1HBX G;  3W6V A;  4UY8 I;  3G71 I;  5E3N A;  3BZC A;  3HSR A;  5GAD J;  1ZGJ A;  5J47 A;  4RDU A;  2WAE A;  3GBG A;  3S93 A;  1I5Z A;  2X85 A;  3GLL A;  1V5G A;  1SVO A;  3AL0 C;  2Z99 A;  3DKW A;  3BWG A;  2NVT J;  3CCS I;  3DKX A;  3DPU A;  1JE8 A;  4PJN A;  4IPA A;  4N4O B;  3I54 A;  3SJM A;  3WG7 H;  4E6K G;  3WU1 B;  1O3T A;  2GM4 A;  2WY7 Q;  2KL4 A;  3OR1 C;  1RUN A;  2UUZ A;  3AFH A;  3MD2 A;  4UUV A;  4E7Z A;  2MYS A;  2M30 A;  3KP3 A;  5E17 F;  2RN7 A;  2VB6 A;  3HKZ A;  3DLA A;  2XPV A;  1X1C A;  4Z2Y A;  3OYK A;  1GDT A;  4G12 A;  4KJZ A;  1ETQ A;  3IUO A;  2GXB A;  4UB6 C;  3S32 A;  2QSG X;  3VWB A;  5BNG A;  2DBB A;  3IAS 2;  3ZOB A;  2EZL A;  2K9M A;  1V5F A;  4CZC A;  4XOT A;  2DPD A;  1FJL A;  2QQ9 A;  3GFL A;  3QP6 A;  2MLG A;  4XID A;  1R49 A;  2F5C A;  4BQA A;  1D8J A;  2OTJ I;  2VLA A;  1CF7 B;  3K70 C;  1LFP A;  3K0L A;  1JHH A;  1W1W E;  3GLX A;  3LSP A;  1DU0 A;  3ELK A;  2M7B A;  4B44 A;  2GXA A;  1IDZ A;  3ZMU A;  1P9Q C;  4U0V A;  4EEF G;  4ENN A;  1R36 A;  2ZXJ A;  4AC0 A;  3BG3 A;  1RI7 A;  3K69 A;  2XV4 S;  5M3M J;  1OJL A;  4EVI A;  1YHQ I;  4B43 A;  1FX7 A;  2MLK A;  1BR1 A;  2OU2 A;  2DK8 A;  4HEA 2;  2FRH A;  5FKM A;  3K7A J;  1LVK A;  4BAC A;  1FYL A;  5EYR A;  3ZR8 X;  3S1N J;  1IW7 F;  1REP C;  1IN7 A;  4UHT A;  3PO3 J;  3HTS B;  1ZRC A;  4M3F A;  3RKY A;  5JHU A;  1B8I B;  2DFE A;  1VI0 A;  2E34 A;  2PJR B;  1MIJ A;  4GXO A;  3I5U A;  1ODD A;  1E3P A;  3S3M A;  2W1O A;  1HKT A;  2Q0O A;  3SQN A;  1B6A A;  2WWY A;  2LLK A;  5CPR B;  2NS8 A;  1Z05 A;  2QKM B;  1GUU A;  4E7L A;  2RVC A;  3CCY A;  3UKG A;  3GME A;  4P1W A;  2EZK A;  1DPR A;  2L7K A;  3VYT B;  3F21 A;  3BDD A;  1YI2 I;  2G0E A;  3RCO A;  5IYB J;  2JSC A;  1VQ8 I;  3CMA I;  1SVL A;  2VT2 A;  2DA1 A;  2FNP A;  3B02 A;  4R8H A;  3VDX A;  1AKH A;  3LSK A;  2K9S A;  1PJR A;  3LSH A;  1W0U A;  2P7V B;  4PJJ A;  2DOA A;  2RRE A;  1LB2 A;  1XGO A;  1XX5 A;  2FML A;  2YX7 A;  3FK7 A;  5FO5 A;  3FXR A;  1OR7 C;  2X48 A;  3HUG B;  3S1M J;  2BVM A;  2RAE A;  2HXO A;  3NRV A;  1R6R A;  4UNO A;  5F1J A;  2KZG A;  4FE4 A;  3A0B C;  4ZYE A;  2NYX A;  3DEU A;  4LK1 F;  4OAZ A;  1NTC A;  3FXJ A;  2D5V A;  2FNA A;  1Y0U A;  2DPU A;  3DTE A;  5E79 C;  4M3B A;  3JAM Z;  3HKZ N;  3SDG A;  1S8N A;  4GYI A;  3JTG A;  1S5L C;  4BE1 A;  4OOI A;  3OOP A;  3GF2 A;  3W2V A;  2MFZ A;  3F6V A;  3OOU A;  3ZN0 A;  3NWS A;  3GFI A;  2HDD A;  2GIZ A;  1SMT A;  2DT5 A;  3HRS A;  1RES A;  4ZYH A;  1GT0 C;  4OMY A;  2IA2 A;  2D1V A;  2QQA A;  1TT5 B;  3BZ6 A;  4XLA A;  4CCM A;  3V7R A;  2TCT A;  4AID A;  4Q48 A;  5E1Z B;  5KNL A;  4OMZ A;  2JA6 J;  1QRY A;  1B72 B;  4AU7 A;  1KU7 A;  1ZR2 A;  2FBK A;  3H5R A;  4PK4 A;  3EUK L;  2R93 J;  1OIS A;  4KIT B;  2DDA A;  1G3T A;  2VIX A;  3L2U A;  1BI0 A;  3G6E I;  2QM3 A;  4EV0 A;  4UV8 A;  2XSD C;  1IN4 A;  2DW4 A;  2YS9 A;  3A01 A;  4CHU A;  1IV6 A;  2L5Q A;  3F8M A;  2ZME C;  1EKE A;  3D5S C;  2XPW A;  2MAB A;  5BS6 A;  3D5L A;  2HTS A;  4PGH A;  3KET A;  1CGP A;  2XRL A;  3I53 A;  3J81 K;  3RJP A;  4JX4 A;  3OS0 A;  2HQ5 A;  2BZT A;  1IC8 A;  2VJJ A;  2E35 A;  1ON1 A;  2KQR A;  1S7A A;  3A0H C;  1SC7 A;  3LFU A;  2XVC A;  3QYE A;  4BY7 J;  4GYG A;  2QSF X;  3TOA A;  1EH8 A;  2WB1 N;  2XKO A;  4L5I A;  1WJE A;  4D1Q A;  3HHH A;  5GAE J;  2IXS A;  5EEA A;  2DDB A;  3OYH A;  1M1E B;  4ON0 A;  2A6H F;  1ZTR A;  2F4I A;  1HOM A;  2EBI A;  3NAR A;  4II3 A;  2DA4 A;  2RNJ A;  1QHH D;  5CLS A;  2IP2 A;  1OR7 A;  2A61 A;  4O6J A;  3VSK A;  2OCE A;  2NOJ B;  5F1R A;  4FX0 A;  3MZ8 A;  3BQZ A;  2M4K A;  3BP8 A;  5HNH A;  4KIG A;  1GLN A;  3I64 A;  4B3A A;  3L2R A;  1IXC A;  4XKB A;  1O7L A;  2E19 A;  2XAQ A;  4OIN F;  1TZL A;  4CCJ A;  2WAD A;  2BXZ A;  2EIL H;  3K10 A;  3HTU A;  3R60 A;  1B59 A;  5TRD A;  5GPA A;  1T39 A;  5TIS C;  3NWT A;  1Y56 A;  2QZ8 A;  3CDI A;  1Z3X A;  4C3J J;  4IHX A;  3RIR A;  5E3O A;  2H1K A;  3KCC A;  4YIR X;  4GCV A;  2BW3 B;  1HXD A;  2JRT A;  2IAI A;  3JSP A;  3TW6 A;  3FM5 A;  1O3R A;  2V1N A;  3E6D A;  1J75 A;  1K6O A;  4I98 B;  1G59 A;  3R0J A;  2HNH A;  4LMY A;  3KEO A;  1JUP A;  4RB2 C;  1YX5 A;  4JQF A;  4RAY A;  4U88 A;  3GXO A;  3JRG A;  3X2Q H;  1K4S A;  2CW7 A;  3ASN H;  2AQE A;  2Q2E B;  4WXH A;  4BS9 A;  2VI6 A;  3BJO A;  5JI6 A;  1FWZ A;  1AWC A;  1MBJ A;  2OA4 A;  2O8K A;  1UCR A;  3CUO A;  2M5W A;  5L3B A;  4I7H A;  4HQE A;  3WU0 A;  2H6C A;  1PP7 U;  2LNB A;  3DFG A;  3QYB A;  2P0W A;  4ASN A;  1AOY A;  3B6C A;  1OLT A;  5GTI C;  1JXS A;  2PI0 A;  3I58 A;  1HCR A;  3IRR A;  2EFO A;  5AIQ A;  3HOV J;  2X6W A;  2DA5 A;  2RQP A;  2X6O A;  1R00 A;  4ITV A;  5CVJ A;  3S2W A;  2W7N A;  1YJN I;  2M0C A;  2KRH A;  1T08 B;  3W2W A;  2L4M A;  1FY7 A;  1FOW A;  4HG2 A;  5LEK A;  1AKH B;  1Z9C A;  1QZE A;  1L3L A;  2LBF B;  2XB0 X;  3ABU A;  3H3U A;  3O8H A;  3HDD A;  5TGT A;  1Z7L A;  2ZC2 A;  3FWE A;  1MBF A;  1LNW A;  1J7K A;  3KP5 A;  4XNF A;  4F55 A;  2Z3Y A;  4LG0 B;  1R7J A;  1TQM A;  4IQJ A;  2HFH A;  4HV6 A;  1XSV A;  3R4K A;  1TBX A;  4W97 A;  2K9L A;  3AAF A;  4HZF A;  1ZR4 A;  1W0T A;  1OQY A;  2VKD A;  2E36 A;  3ZN1 A;  4IVN A;  1BOB A;  4G7O F;  1OCP A;  3NAU A;  3G73 A;  4OIQ F;  5FKL A;  3F22 A;  2L54 A;  2VJI A;  2FQ3 A;  2X1D A;  4GRI A;  1EH6 A;  2DQR A;  4HPQ A;  2MH2 A;  1G4D A;  3RTR A;  5F08 A;  4XON A;  1DGW Y;  1I50 J;  3MAJ A;  3VYU B;  2E1M C;  5J40 A;  3AG4 H;  4ZTF A;  3CCL I;  1BA5 A;  3FXL A;  3HPH A;  1BM9 A;  4BYY A;  3H3Z A;  2YUS A;  2P5K A;  2HOE A;  3JRE A;  2J5P A;  4C3H J;  3OR2 C;  3VEP A;  4HF1 A;  3TMO A;  3B73 A;  4CXF A;  2PFB A;  4HBL A;  2ZKZ A;  2STW A;  2KDZ A;  1W4M A;  1ENH A;  1J59 A;  1D3Y A;  3KZZ A;  1YLF A;  2LG4 A;  2V79 A;  2WAF A;  3A01 B;  1DP7 P;  4PZJ A;  3QPS A;  4XLC A;  3M4O J;  1WJ5 A;  5F27 A;  1MSE C;  3FX3 A;  4XIC A;  1SFO J;  3FK6 A;  1UAA A;  2JA7 J;  5K7Z A;  2XSJ C;  3J80 K;  3ESW B;  4IHS A;  5EGO A;  3BR0 A;  3TOB A;  5L3G A;  1UG0 A;  3RI4 A;  4MFD A;  1SAX A;  3DPL C;  3FXU A;  3CQZ J;  1EF4 A;  1WJC A;  1C0W A;  2R7T A;  2E1N A;  5HLT A;  1R5G A;  2MD5 A;  2R0Q C;  3DBL B;  4IQ4 A;  1N77 A;  2DA6 A;  4A3E J;  3K4J A;  3ZMT A;  2NOG A;  3Q5F A;  5A2Q Z;  2MD0 A;  3GTG J;  1W5S A;  1WZ2 A;  2VC1 A;  1VQK I;  1FYK A;  2EIN H;  3IP4 B;  3QU3 A;  3TDZ C;  4YRV A;  5HDK A;  2R5Y B;  4ZDL A;  3ZRG A;  2NS7 A;  3GTK J;  3DBH B;  3ZMZ A;  2O8X A;  4D5F A;  4XSZ F;  1N78 A;  1MBK A;  4XR6 A;  3ZP5 A;  2ISZ A;  1OCO H;  2AS5 F;  2ZB9 A;  1ACI A;  1OCR H;  4DZJ A;  3HOZ J;  3RSN A;  1LEB A;  3DTI A;  1HST A;  3TW7 A;  3H9G A;  1UHS A;  3BPV A;  4BU2 A;  2BY0 A;  4H0E A;  5EJC A;  1WRJ A;  3GTL J;  5AIP A;  1UZC A;  1MH4 A;  1SVM A;  2KIM A;  4BAY A;  3GTP J;  5E8I A;  1X19 A;  3LST A;  2M8E A;  2QSH X;  1YS7 A;  3LAP A;  5L3C A;  3C1D A;  2XF5 A;  2HZD A;  2DK5 A;  4GO1 A;  3SZT A;  2H94 A;  3CZ6 A;  4UUS B;  2HVR A;  5BMZ A;  2ZME B;  3E5X A;  3FDY A;  4QTR A;  1U0J A;  1RUO A;  4PJ0 C;  3N97 A;  2IBD A;  2HXI A;  3Q9S A;  3U2R A;  4WK8 F;  2L9V A;  3HSE A;  1VND A;  5IOY A;  1ZG5 A;  4M6V A;  4PCQ A;  2V1X A;  4OIP F;  2A5W A;  5DD4 A;  2IGN A;  3OYG A;  2NXN B;  4XOP A;  3CUQ C;  3U1K A;  3T5X A;  1JJ8 C;  2MBF A;  1Z7U A;  3TGN A;  5DS9 A;  5J1Y A;  4Q5S F;  5D4R A;  3CF5 F;  4D7N A;  4L5E A;  5EZH A;  4XKC A;  1RR8 C;  2D2W A;  3HPG A;  3K4N A;  3I55 I;  3GW2 A;  2F5F A;  3GUD A;  3M8E A;  2K4J A;  4DIQ A;  2LC2 A;  5DDG A;  3ABK H;  1JHF A;  5IPA A;  2Y0M A;  2XB5 A;  3VYR B;  1HLV A;  5M5W J;  4ESF A;  2R7S A;  4HOB A;  2CUZ A;  4BBR J;  1SFX A;  3H1C A;  4BY1 J;  2DJN A;  2NS0 A;  1ZRE A;  3SEQ A;  3BPX A;  2JJ7 A;  4P9F A;  2EV6 A;  4O3M A;  3LQR A;  3MZY A;  3BLY A;  2R7D A;  1USS A;  2R92 J;  3S2H J;  2CQX A;  3WTY C;  4GFB A;  2WBM A;  2VN2 A;  3CJQ B;  3ASO H;  2EWN A;  2EFN A;  3V8J A;  3OYC A;  2RDP A;  4FET A;  4XBF A;  2XHK A;  3ULQ B;  2OQR A;  4CYD A;  2ZBK A;  1MDM B;  3MKW B;  4HF2 A;  1TWH J;  2EV0 A;  1QA6 A;  1Y1W J;  1G3W A;  4ZC3 A;  1YJW I;  3W6K B;  4IRI A;  4A3I J;  2LF8 A;  1H9G A;  4BJT A;  3ZMS A;  4JK1 X;  1DGR M;  1XPX A;  1V55 H;  2L7M P;  2Z9O A;  2OV7 A;  3OL4 A;  3CP8 A;  3AG1 H;  2ECB A;  4G6D A;  1A6Q A;  3C3W A;  2Y31 A;  1KON A;  4M9X A;  1SD7 A;  3VPR A;  1ZYR F;  4LLN A;  3J7A Y;  1S7O A;  2H8W A;  3FIW A;  1ZAR A;  2WAQ A;  2K3F A;  2ZJ2 A;  1ZAO A;  4UUT A;  4PFO A;  5DTD A;  3CUQ A;  2CW8 A;  4XL9 A;  2H6B A;  3VOE A;  1X3U A;  3BG7 A;  3DU5 A;  3SYT A;  3I0T A;  2V1U A;  1RC9 A;  1XG1 A;  2B0L A;  3H5N A;  4EGZ A;  3CC2 I;  4JP0 A;  2DMP A;  4AIJ A;  2JA5 J;  2XGX A;  1ITY A;  3S3N A;  2QA4 I;  3WU2 C;  2CYY A;  3DLL F;  3I56 I;  1W7P B;  2HR3 A;  2GBY A;  4U7B A;  4OIO F;  3V7C A;  4IJA A;  2KDO A;  1QU3 A;  1MMN A;  4C3I J;  5H6Q A;  2CU7 A;  4NDL A;  3JRD A;  1A6I A;  2Y69 H;  4RAZ A;  4Y15 A;  2XRN A;  1RKW A;  5LEJ A;  2FOK A;  2XAF A;  2VKE A;  4UV9 A;  3FKI J;  1ZG1 A;  1FZP B;  4W1U A;  3LL7 A;  3QOE A;  2E60 A;  1ETW A;  1J2X A;  2DYS H;  2IVM A;  4EJW A;  3IH4 A;  1K6Y A;  4R79 A;  2E1M B;  3L1P A;  5FKN A;  6PAX A;  1ZKG A;  1BJZ A;  1IRX A;  2LOO A;  1I3Q J;  2E2H J;  1WQ2 A;  3FBI B;  4B1R A;  5B1B H;  3BR2 A;  2KIS A;  2W57 A;  1K79 A;  3L9F A;  2F5V A;  2VQG A;  1RIO H;  4G7H F;  1Z6T A;  2KT0 A;  3RKW A;  4Q4Z F;  3ROU A;  4JX6 A;  4UVB A;  2E5N A;  4MEY F;  3U21 A;  1WHU A;  2RGV A;  3JRI A;  3KLN A;  1XCV A;  1D0Y A;  4Y33 A;  2HZT A;  5D8L B;  4RLF A;  4A12 A;  2VXZ A;  3M9A A;  4GGG A;  1SEU A;  2ZFU A;  3BCA A;  4IOC F;  1IZ1 A;  2YU9 J;  5K5O A;  3C18 A;  2HDC A;  1XMK A;  2OF7 A;  4D7M A;  3E1S A;  1Z91 A;  3K4B A;  4MFE A;  3A1Y A;  3O6B B;  2QYO A;  3BT9 A;  2F2E A;  3QOD A;  3QQA A;  1MSF C;  3H3V K;  4KNY A;  3EET A;  3SZP A;  3RPQ A;  1BIA A;  1PUE E;  4CSW A;  3J81 Z;  1ZH5 A;  4S0H B;  4Q47 A;  3GZ6 A;  1I3A A;  1W7P D;  4MIM A;  4IO9 F;  3S14 J;  2NVX J;  2X0L A;  2FOW A;  2PN6 A;  1IRG A;  4QWQ A;  2ISY A;  5FLX K;  2ADU A;  1OCC H;  2BHZ A;  2F4O B;  2X1C A;  1KGS A;  4NC7 A;  2IGO A;  1H8A C;  4MEX F;  2WAQ N;  1YRN A;  1FTT A;  4JOM A;  5LRS A;  2KRF A;  2ZNY A;  1QO0 D;  1MBG A;  4EM1 A;  3KPH A;  4A3C J;  2LD5 A;  1FBS A;  3S8P A;  3S17 J;  1X1A A;  2LP0 A;  2WTE A;  1HQC A;  3BOQ A;  4ZJZ A;  2JA2 A;  3CCJ I;  4N0B A;  4BKX A;  3K1M A;  2V9K A;  1K61 A;  3WHC A;  2LKS A;  1U5T C;  1TWC J;  5KVR A;  4R1H A;  4DQ2 A;  4E7I A;  3E6B A;  2EIK H;  4Y3O A;  4Y52 J;  2E2I J;  4N9H A;  1QZY A;  1BC8 C;  5EDN A;  1GXP A;  2QF7 A;  1TQI A;  2GIV A;  4KT5 C;  2WB1 A;  2HTJ A;  1MMD A;  2DO7 A;  2OUM A;  3M8J A;  1DQU A;  1MZB A;  4FIS A;  1SFK A;  3KEQ A;  5CJ9 A;  3CC4 I;  1AU7 A;  4OIR F;  4OAY A;  3B6A A;  1IN6 A;  1XTA A;  2QBY A;  2W24 A;  1VQP I;  4BUP A;  5FLV A;  1YIO A;  3EQL F;  4ETS A;  1W36 D;  1U8B A;  4RGU A;  3V42 A;  3HYI A;  1H89 C;  3D5R C;  2L02 A;  1JTY A;  4PJM A;  2HI3 A;  2HOT A;  3E6M A;  4C30 A;  4BQQ A;  3PQK A;  1NG6 A;  2LH9 A;  4PJL A;  4XLE A;  5D6E A;  3HOU J;  1PYV A;  4AYB N;  2LRD A;  5LGT A;  1V3F A;  3J7Z I;  4IHV A;  3PO2 J;  4YFK F;  3U9G A;  2B7E A;  2XPU A;  3BRO A;  2VQC A;  2AXL A;  2JMW A;  1FOK A;  4J00 A;  3GYH X;  4YG2 F;  1HDP A;  4P96 A;  1X4O A;  1LEA A;  1S9H A;  3RKX A;  3GZ5 A;  4CCO A;  4PFP A;  2COM A;  2KIQ A;  3OYD A;  1XGS A;  3E97 A;  1SD4 A;  5B1A H;  1X2N A;  3CLO A;  4ZZL A;  2HS5 A;  1UEL B;  1U5T A;  3IAM 2;  2WC2 A;  1MJ9 A;  4QPO A;  1PDN C;  1R58 A;  2A05 A;  3HOS A;  2XUB A;  2XF6 A;  1T38 A;  4AM3 A;  1X58 A;  3C2G A;  1F4K A;  1LKX A;  2XAH A;  4F93 B;  5BQT A;  5TJJ A;  4V19 K;  4S04 A;  3OIO A;  2MA3 A;  5H2F C;  1Z67 A;  4BE2 A;  2UWM A;  2JWT A;  2W25 A;  4G8X A;  3KIO A;  3N05 A;  1S72 I;  1U2W A;  1UJ8 A;  2DLL A;  2CV0 A;  2QUF A;  1XSD A;  1JGG A;  4IX7 A;  1ZLJ A;  1J0R A;  2D1H A;  5IT3 A;  2HEO A;  2HQR A;  1JT0 A;  2EH3 A;  3BG9 A;  2RQQ A;  4HF0 A;  2JN6 A;  2K02 A;  1XSX A;  3CJR B;  2JA8 J;  4A3L J;  2BEO A;  2LKP A;  3L00 A;  1TNS A;  1SAN A;  5C4X J;  1X3W B;  4NC8 A;  1TW3 A;  3CF2 A;  2CUF A;  2QEN A;  2ELH A;  4KDP A;  3SEZ A;  2V6E A;  3ISP A;  4U0Y A;  2XF7 A;  3SXY A;  4KIF A;  3DKY A;  4MO7 A;  1TW2 A;  1RRJ A;  2M45 A;  3J80 Z;  4XRF A;  3CO6 C;  1TWA J;  3RQI A;  5M3F J;  5HLH A;  1OYY A;  1B9M A;  2OQG A;  2CUJ A;  3GTQ J;  2CH0 A;  4EMS A;  5FKO A;  3HG9 A;  2R7U A;  2BY1 A;  2OD5 A;  1YQA A;  4BL0 B;  3CO7 C;  3OYJ A;  1FBQ A;  3TED A;  1YS6 A;  4B48 A;  5J4V A;  2H1L A;  1D0X A;  1YRN B;  1SFU A;  5LLQ A;  1UMQ A;  5BPD A;  4I0A A;  4F52 A;  1Y39 A;  2VJ5 A;  3I59 A;  4QLC U;  3OY9 A;  2VJ4 A;  1ZQ3 P;  4BXX J;  1E0E A;  5CVR A;  4ENJ A;  5CVU A;  3HJE A;  3OYM A;  2PG4 A;  1A36 A;  4XM3 A;  1SD5 A;  1ZGW A;  2ZXW H;  3PNV A;  2XDV A;  3ZPL A;  1Y8R B;  3HGG A;  1WI3 A;  2NNN A;  1JI8 A;  2ICW G;  1OCT C;  1GVD A;  1LQ1 A;  5E1X A;  3OYL A;  1NH3 A;  5FLM J;  3ZMV A;  1XDU A;  3UR3 C;  3CJT B;  2Q1Z B;  3JRC A;  2X6X A;  1MJB A;  1G3Y A;  4D9J A;  2K3P A;  3IKV A;  4NQW A;  3DF8 A;  3TBI A;  1VQL I;  3D0S A;  2H8R A;  3K4C A;  4LIU A;  2TDX A;  3MFK A;  4FX4 A;  2HYF A;  2K85 A;  4IRH A;  1W5C C;  2E1O A;  1OFC X;  3WG9 A;  2L9S A;  4M74 A;  4C2M J;  3EUA A;  4AIH A;  1XD7 A;  3A03 A;  4I09 A;  4E7J A;  5ILV A;  3S1R J;  1P7J A;  3IH3 A;  1SAU A;  3WTT C;  3WTX C;  1VZ0 A;  5C3E J;  2GOM A;  5ILU A;  3K1P A;  2KP6 A;  3AL0 B;  1FMW A;  1KQ8 A;  5D5W B;  1D1B A;  2QBY B;  3K6G A;  3KZY A;  4IOA F;  3LOC A;  5F0C A;  5FRO A;  2QEX I;  4YII A;  3BQY A;  5IP7 J;  2G9W A;  4JBA A;  3T0Y A;  1LFU P;  1D1C A;  1YW8 A;  3WTZ A;  2E7X A;  3AG2 H;  1R71 A;  4JX5 A;  5CVI A;  1ZN2 A;  2CQQ A;  2W84 A;  5LHH A;  1H9T A;  4XRM A;  2E71 A;  4IZZ A;  1V5E A;  4WWC A;  3EYY A;  5JVG F;  4L9V A;  4KIB A;  3BR6 A;  3DPT A;  5H20 A;  2KLO A;  3LSM A;  2LDU A;  4KUM A;  3QU6 A;  1RET A;  2A6E F;  2DMU A;  2HKX A;  2L0K A;  2XRO A;  4M71 A;  2V1D A;  2CW0 F;  4Y4R A;  3MVP A;  2HQA A;  4CZZ A;  1VFC A;  1YX3 A;  4EQQ A;  2Y9Y A;  1BBY A;  2EFQ A;  2EIJ H;  3KX2 A;  4L9J A;  4FAS D;  1JKQ C;  2M2E A;  1FLI A;  1JUS A;  4M72 A;  2PQ8 A;  4DYQ A;  5HLG A;  2HVQ A;  1FEX A;  2YU3 A;  3G3Z A;  2MC3 A;  2P4W A;  1Y0N A;  2K9N A;  1U5T B;  1T8I A;  3OYN A;  2P7C B;  2KJC A;  3DQV C;  4RB3 C;  2LVS A;  2PBI A;  3DXJ F;  3FXQ A;  3VFZ A;  4XQF A;  4BE0 A;  5EG0 A;  3F8B A;  2FMY A;  3OMY A;  2OAZ A;  1ETK A;  3ZQH A;  3BR1 A;  1WCM J;  1MD0 A;  1R5H A;  2DFF A;  4EJO A;  2NAZ A;  4RM2 A;  5KCM A;  3KP4 A;  1K78 A;  4Z6Y A;  1ETO A;  3LSJ A;  3GVA A;  1MGT A;  4BHC A;  3HOW J;  2Z33 A;  1LDD A;  1HSJ A;  1HF0 A;  5F0F A;  5FKK A;  3EUH C;  2DJI A;  2O9L A;  5KAI C;  4E7K A;  2NVY J;  2DOE A;  3PIP F;  2CV1 A;  3K4K A;  5D8K B;  4HNT A;  1KU3 A;  4G6T B;  4BEH A;  4EM0 B;  3ZGK A;  3I4M J;  1ETV A;  2JTV A;  3LA3 A;  1EH7 A;  3ERM A;  2EPF A;  1D1A A;  3AG3 H;  3KFW X;  1UST A;  3VYS B;  3OWT A;  3QYF A;  1D8K A;  4KT6 A;  5HDG A;  3N4M A;  1U9O A;  4L5J A;  3V4G A;  1HW1 A;  4AWX B;  2F4M B;  5CVV A;  2FX0 A;  3M1E A;  4RA2 A;  2NNY A;  1FIP A;  2F5E A;  3BJ6 A;  1A04 A;  4B47 A;  5JHF A;  1LE8 A;  2VXD A;  2Y0S N;  3JRA A;  1IN8 A;  3CES A;  1YOV B;  2R7Q A;  4DBR A;  3ZQQ A;  1FPQ A;  4M3D A;  3PFI A;  5ILS A;  2K86 A;  4L9T A;  3OYI A;  1P7I A;  4B8X A;  2A69 F;  3K2Z A;  5JLX A;  1HDD C;  2DAO A;  4D0P A;  2L7F P;  3CLQ A;  4EJV A;  4CUG A;  5AON A;  5DYM A;  3OYB A;  1FYM A;  4ABZ A;  2ETH A;  2X9D A;  3ZCO A;  3K70 D;  5C44 J;  5D5V B;  3CCU I;  1WH5 A;  3F6O A;  3I59 B;  3SFZ A;  3KYD B;  2ESN A;  2VBZ A;  3J7Y J;  2CGP A;  2LFB A;  2M4G A;  1K4T A;  3GFJ A;  3WGI A;  5FD5 A;  5EEH A;  3EPZ A;  3V7S A;  4QPQ A;  3RYR A;  1POG A;  1ZLK A;  1BI3 A;  1XB4 A;  3GWZ A;  3P5J A;  2HOS A;  4NHJ A;  2XAJ A;  3A4C A;  4I0B A;  3Q0V A;  1VTN C;  4S05 A;  2OTL I;  2HQN A;  2QQB A;  2Z16 A;  2BV6 A;  2O5R A;  2P5L C;  1HW2 A;  3M3Y J;  3IWF A;  1NG7 A;  2F5D A;  1GV2 A;  1WGX A;  3VSL A;  4A69 C;  4CYC A;  1MNE A;  3PNY A;  4EM2 A;  5EF6 A;  2CMP A;  4MTD A;  3EUH A;  2XC7 A;  5E20 A;  1I6H J;  1F36 A;  1K83 J;  2K7L A;  2LMD A;  4IEJ A;  3FHZ A;  4CO8 A;  3G4S I;  2CV2 A;  1VQO I;  2QKL B;  3P9I A;  5CQE A;  3LQQ A;  1JT6 A;  3GCM A;  2MSY A;  2HPM A;  5FGM A;  1PUF A;  1Z21 A;  3I71 A;  2DTZ A;  3VOD A;  2KIU A;  3MMY B;  4J19 A;  1MH3 A;  1IUY A;  1BR2 A;  1EA3 A;  3ZQI A;  1P4W A;  1S3J A;  4DYR A;  3F8C A;  3IC7 A;  2VOD A;  5J8F A;  3HL2 A;  2VKH A;  2EA4 A;  2UXX A;  1IG7 A;  2JPB A;  2FUG 2;  2W82 A;  2STT A;  3VB2 A;  3WTS C;  3PSI A;  1X1B A;  2NVQ J;  3OYE A;  1WWX A;  1WJA A;  2CSO A;  5GAH J;  3DWL E;  1UHW A;  5K5Q A;  1KU2 A;  1KYZ A;  4O5V A;  1HKQ A;  1YW7 A;  4XMY A;  3JRF A;  1XC5 A;  5GP9 A;  4HRI A;  4XK4 A;  1HC8 A;  2DOF A;  2GOX B;  2W48 A;  3Q9V A;  4U7D A;  3Q3S A;  2DT7 B;  2M7A A;  3GTM J;  4KIC A;  4P5O A;  2UV1 A;  3OV8 A;  4BH9 A;  2ZJP F;  5FLX Z;  4V2F A;  4CDG A;  5LHI A;  2M0M A;  2ME0 A;  4ANJ A;  3NQO A;  5K1Y A;  5FFZ A;  5E3L A;  5FRM A;  4G6Q A;  2VPL A;  4OU0 A;  2O6G E;  1VQ5 I;  2PMZ N;  5BOX A;  2VOO A;  4RM3 A;  4CH7 A;  1T2K A;  3LAJ A;  1ERD A;  3BC8 A;  3BG5 A;  3QAH A;  1WVR A;  3CP2 A;  2VL8 A;  5GPC A;  2A68 F;  5IY5 H;  3PJR A;  1YFH A;  1IN5 A;  1P4A A;  5ERI A;  2G7U A;  2LK2 A;  4P55 A;  4B09 A;  2I8D A;  2KPM A;  2MGQ A;  5KK1 A;  2IPQ X;  1X1D A;  1VQ4 I;  3QPT A;  5HOO A;  1IV8 A;  4I02 A;  3MN2 A;  1X4P A;  5K7F A;  2M87 A;  1XGM A;  1LJ9 A;  1Y6I A;  2V4J C;  1CF7 A;  5B66 C;  1SFE A;  2EFW A;  1IXR C;  4HW0 A;  1SMY F;  3TO7 A;  4PGG A;  4YIF A;  3HZJ A;  4BJ5 C;  2LSO A;  2YX4 A;  3L2V A;  2IRF G;  2AQF A;  2K5C A;  2JUG A;  4XN0 A;  3KYL A;  4G7Z F;  5L3E A;  3FZV A;  1FBU A;  4I2O A;  1YYV A;  1I1S A;  3ONQ A;  2W00 A;  3EDP A;  3IRQ A;  1IRZ A;  1BIB A;  4IXA A;  4YFN F;  4LFU A;  3MQ0 A;  2PJP A;  5D4S A;  5EGO B;  4II2 A;  1X3Z B;  2BHY A;  1B8I A;  3P7N A;  2PJR A;  2EQR A;  1U9N A;  2CS3 A;  1MBE A;  5LGU A;  3L2W A;  4ENK A;  3K1N A;  4X6A J;  3CCE I;  3LA2 A;  4HYE A;  2VE9 A;  3CCM I;  2DFH A;  1QZZ A;  2BYV E;  4AVZ A;  3PL8 A;  3JTH A;  2K40 A;  3TP0 A;  2HOA A;  5DCM A;  9ANT A;  2MW8 A;  2R7Z J;  3HM5 A;  2L01 A;  3LFK A;  3MEX A;  2A07 F;  5D6F A;  2M1B A;  2A6T A;  3M07 A;  2BOL A;  5HOD A;  3CDL A;  5A2Q K;  4LIV A;  2O61 A;  1JUM A;  2M34 A;  4IHW A;  3ABL H;  1RKT A;  5E1W A;  4WX9 A;  3I3L A;  4M6X A;  4MHG A;  4UVC A;  1ZG3 A;  2XAG A;  4FQG A;  2QVO A;  2ELJ A;  3HUG A;  2OZU A;  4N4N B;  2KIF A;  2ECC A;  2OPT A;  3PNT A;  4P9U A;  3F0C A;  4C2T A;  4DW6 A;  2LYC A;  4A3M J;  2LY2 A;  4MQ9 F;  4LOC A;  3G2B A;  3R61 A;  1K7A A;  3REO A;  1U6G A;  1GV5 A;  2L9R A;  4XRS G;  2CQK A;  2IT0 A;  5FRN A;  4CGZ A;  4HDU A;  2A3S A;  4AYB A;  1TWF J;  2B63 J;  4LLG F;  3TKY A;  1S7E A;  3PQJ A;  4ZH4 F;  1YG2 A;  5ICG A;  1FNN A;  3OIQ A;  1Q1H A;  3MWM A;  4FT8 A;  5LFA A;  1B72 A;  3EYI A;  2XAS A;  1QVT A;  1V4R A;  1VQN I;  4N9I A;  1G6N A;  3OSG A;  2FJ1 A;  1BR4 A;  4WCG A;  1NK3 P;  3F3X A;  2VPR A;  3FHN A;  4M3E A;  3DEW A;  4BBS J;  2I10 A;  3KEY A;  1MND A;  1QVU A;  3IL2 A;  1R23 A;  4A0Y A;  1WSU A;  4U0W A;  5M5X J;  1G2H A;  4HNV A;  4E7H A;  5DM6 F;  4ZTJ A;  3GX4 X;  1FT9 A;  2DMQ A;  2JZY A;  2KHM A;  4MQV A;  3RZD J;  4AIK A;  3RPU D;  3COA C;  2DI3 A;  1B1B A;  3MKY B;  4HA8 A;  4XN3 A;  3W3C A;  4I76 A;  1ZEL A;  1J5Y A;  3KP2 A;  5JFR A;  1F1Z A;  2DOD A;  1MW7 A;  4F7Z A;  1E17 A;  3FKJ A;  4MLO A;  1Y1V J;  5HNF A;  1JKP C;  1FP1 D;  4K2E A;  3ERE D;  1JKO C;  2PEX A;  1NHA A;  3KP6 A;  3WE3 A;  2NRA C;  1V54 H;  1E3H A;  3UNG C;  2PLY A;  2MG4 A;  4CCL A;  1A31 A;  1APL C;  4L0Y B;  3HOY J;  3WGG A;  1QHG A;  5L3D A;  1BW6 A;  2TRT A;  4XLN F;  4ZDO A;  3I4N J;  2ME6 A;  3WTU C;  2IS2 A;  2N8G A;  1S29 A;  4UB8 C;  4FHT A;  3Q0U A;  4M3G A;  3KP7 A;  2Z5U A;  2E1C A;  2HKO A;  2ZCW A;  4HX7 A;  3ZQC A;  2E2J J;  4GDF A;  4IL6 C;  2LR8 A;  2FBI A;  2QGU A;  3HIF A;  2BW3 A;  2MC4 A;  3ECH A;  5J3L A;  3QWL A;  3LSI A;  2FXA A;  1VF9 A;  3SHF A;  4NC6 A;  4MNU A;  2HDW A;  1KQ9 A;  3LWF A;  4WF2 A;  1R1T A;  1OPC A;  1IUF A;  4E7S A;  2DMN A;  3FXM A;  1RZ4 A;  5E3M A;  5LD2 C;  4OWR B;  3M1C A;  2Q2E A;  2DN0 A;  1O4X A;  1FIA A;  5B3S H;  3WTW C;  1YTY A;  2GLO A;  1Z0X A;  3PUF A;  4FE7 A;  1R4M B;  5K7H A;  3CUQ B;  3FIS A;  3HRU A;  2O03 A;  2E7W A;  1KU9 A;  2AXT C;  4PUS A;  1VQ6 I;  1F43 A;  3OS1 A;  1YO5 C;  3PSF A;  3PUB A;  2EIM H;  3RZO J;  1SD6 A;  4I99 C;  1I6X A;  2CFO A;  2FEZ A;  2EFP A;  1OYW A;  4QSH A;  1QQI A;  4L18 B;  2DFI A;  1ETY A;  1DU6 A;  1D5Y A;  4XRS A;  2VT3 A;  3NEU A;  5CQG A;  5DCM B;  3V8L A;  3AKZ A;  1L0O C;  1PVE A;  3E3V A;  3T8R A;  1ZRF A;  3HOX J;  3SDB A;  4ENM A;  1VQ9 I;  1I1G A;  4EJT A;  5HS7 A;  2XAU A;  2V7F A;  2Y30 A;  3OL3 A;  5FD6 A;  2BXY A;  2XGE A;  3WTV C;  2IW5 A;  1IJW C;  3S15 J;  3HRT A;  2LBF A;  1YE9 A;  3FXK A;  3WGH A;  1WJB A;  4KN4 X;  5GTH C;  3H92 A;  1JTX A;  3DEE A;  1KZH A;  4HQM A;  4JYK A;  2P6T A;  2VAS A;  3GTJ J;  3S3O A;  4LG0 A;  4A3D J;  3C2B A;  1LDJ A;  3CCV I;  5IT9 K;  3C7J A;  4A3B J;  3M8F A;  4IRG A;  5IYC J;  1DP3 A;  4CCK A;  1KA8 A;  2KMU A;  4FCY A;  1WFX A;  3HOT A;  4A93 J;  4IF4 A;  4IKF A;  2DCE A;  2BGC A;  2V9V A;  3TP3 A;  1X1P A;  1Y8Q B;  1TNT A;  2DU9 A;  4HNU A;  5HS8 A;  2RC4 A;  3TO6 A;  3W6J B;  3CMM A;  2ZXH A;  3E7L A;  1Z3Y A;  5J4Y A;  2HU9 A;  4HSR A;  2DA3 A;  5E8G A;  5HS9 A;  2FSW A;  2R7O A;  5F64 A;  1ZHF A;  1ZGA A;  3TO9 A;  3KLO A;  4MGR A;  4M73 A;  1GXQ A;  2JK3 A;  3HRM A;  4C2U A;  3CME I;  2PX9 A;  1UB9 A;  4XLP F;  4Y13 A;  2LF7 A;  1T98 A;  2VC0 A;  3TQN A;  2GAU A;  4LG3 A;  3F72 A;  5KAF C;  2FD5 A;  2IS1 A;  4AUX A;  4FTH A;  1BJA A;  3E0J B;  4KIS A;  1X2M A;  3H9Q A;  4H4K C;  5HVQ C;  4RAF A;  2DYR H;  5F04 A;  1U78 A;  5FFX A;  2Y2Z A;  2QCO A;  3QOP A;  1OCZ H;  1LDK B;  5DUK A;  2I5U A;  3QP5 A;  3PIO F;  2JVH A;  3ZQ7 A;  3JRB A;  1T6S A;  4BDZ A;  2EV5 A;  4LGW A;  4DNC A;  1RR7 A;  3H36 A;  2P5V A;  1XGN A;  2X51 A;  4UVA A;  1R9T J;  4CCN A;  3ABT A;  4LB6 B;  4HX4 A;  2KZV A;  2R3S A;  3DCF A;  3A2K A;  4ZZD A;  2JRM A;  3BG6 A;  2KJB A;  1G8X A;  2L4A A;  4Y7N J;  3BCB A;  4IHT A;  1ETX A;  2VQH A;  1VQM I;  2DXI A;  2ZSI B;  2FA5 A;  2LKX A;  1AHD P;  2IEK A;  3BTL A;  2X6Y A;  3P9C A;  5DCF A;  2JQ7 A;  1XMA A;  3DP7 A;  4YFX F;  2CJJ A;  1UG2 A;  3IV5 A;  2R5Y A;  2IA0 A;  1IGN A;  2CQ7 A;  2OZ6 A;  2ZSH B;  3LMM A;  4A6E A;  2UZK A;  5LBQ A;  1N75 A;  2V6C A;  1WI9 A;  1WH7 A;  1I39 A;  5CKT A;  3TDU C;  1OMI A;  3GFM A;  1O3Q A;  3BTJ A;  1O3S A;  3ABM H;  1OKR A;  4XKV A;  5M5Y J;  4KFC A;  2GA1 A;  3H9J A;  4A5M A;  4LLL A;  3CCQ I;  1RNL A;  1WJD A;  1XN7 A;  4M9Z A;  2Y0S A;  2A5Y B;  4RGX A;  3PFY A;  2VBX A;  4WXD A;  2O0Y A;  1WPK A;  1B9N A;  2CRG A;  3HB9 A;  2LY1 A;  4YEL A;  4A6D A;  5B5E C;  3FF5 A;  3A02 A;  3HHG A;  5D5U B;  4RLQ A;  2IA1 A;  2OBP A;  2R7R A;  2KKO A;  3CD6 I;  3F8N A;  4RGR A;  5L3F A;  4UUS A;  1E3O C;  2YR2 A;  5LHG A;  3I9V 2;  3T1B A;  2ZME A;  3L09 A;  4ESB A;  5DEQ A;  1U8R A;  2F6C A;  1FMV A;  2HYJ A;  4PDK A;  3HSF A;  4NBQ A;  3RYP A;  5DD8 A;  5F0H A;  3OYA A;  2VUM J;  1QGP A;  2M9H A;  2VKV A;  1XCB A;  1B4A A;  1ON2 A;  2CQN A;  4TV7 A;  3MKL A;  2OC6 A;  2C6Y A;  4E4H A;  1U3E M;  1CQT A;  3IH2 A;  3K9T A;  2QQ8 A;  4RAG A;  2VOP A;  3HEF A;  1IDY A;  4HLX A;  2ACJ A;  3KYC B;  2OJE D;  3K4L A;  5J6X A;  5KHD A;  4KMU X;  1R1U A;  4NNJ A;  1FP2 A;  2ELK A;  1KYW A;  2DTR A;  2IJL A;  4L0Z B;  5ICC A;  4A3J J;  4PSW A;  3CC7 I;  2R7F A;  4BJ6 C;  3J7A O;  4PSX A;  4KN7 X;  3P9K A;  2EB7 A;  1XMX A;  1N25 A;  2L2O A;  2EA2 A;  2WA0 A;  3DV8 A;  3HXL A;  1ZRD A;  1DPU A;  4A5N A;  2KFD A;  1FSE A;  4D5C A;  3HC7 A;  5JLW A;  5BPI A;  5FB2 A;  3CJN A;  1LUJ B;  3JRH A;  1F5T A;  2FBH A;  1R1V A;  1YW9 A;  1IO2 A;  2K27 A;  1MMS A;  1BC7 C;  3JAM K;  4ZYA A;  2GA2 A;  4G9Y A;  2XGD A;  2H27 A;  2R7V A;  1FC3 A;  2XGC A;  4AD9 A;  2IGM A;  2ID3 A;  3WOD F;  2VBW A;  3LA7 A;  4RBO A;  2ZO4 A;  1ULY A;  3E5U A;  5LGN A;  2VON A;  1FTZ A;  2R5Z A;  4M9S A;  1GHC A;  4YEJ A;  1JGS A;  1UFM A;  4ESJ A;  3RDI A;  1BI2 A;  1ORK A;  2ID6 A;  3ZQG A;  2M3A A;  4I6Z A;  3QRF F;  1LPQ A;  1NK2 P;  1MDM A;  1TTY A;  2RKH A;  5E18 F;  3RKQ A;  3H0G J;  2JUC A;  4BQN A;  4HST A;  4C9Y A;  2P6S A;  3GO5 A;  2DMT A;  2K9Q A;  3CCR I;  2EJR A;  2CG4 A;  3CDH A;  1WJF A;  1RPW A;  2Y75 A;  3MCZ A;  1TC3 C;  1MKM A;  4XOR A;  1FSH A;  4BDY A;  3V8K A;  1J09 A;  1TQP A;  2V9P A;  2PMZ A;  3DBR B;  1BI1 A;  3E5Q A;  1TP4 A;  5CYV A;  1JKR C;  1BOA A;  3MZH A;  1LFB A;  4CA0 A;  4BXF A;  2Z2S B;  4A3F J;  2BY3 A;  3BJA A;  3K2A A;  1P6R A;  1MBH A;  3FXO A;  4DYC A;  3D1N I;  4J01 A;  1QPI A;  3BTC A;  1HW5 A;  2JT1 A;  5DM7 F;  3LSG A;  4LJZ F;  1W36 C;  1AA7 A;  4B4C A;  4KA4 A;  4EJU A;  2ZJR F;  2E5Z A;  3H35 A;  2WY8 Q;  3OSF A;  5FJ8 J;  2L7Z A;  4IHY A;  3T8T A;  4X0G A;  1W7P A;  1FOX A;  3FM3 A;  2RV8 A;  4UXN A;  3ML6 A;  1HKS A;  4RB0 A;  2IS4 A;  2K4B A;  1LVA A;  1TL8 A;  1DDN A;  1JJ6 C;  2PMH A;  2EZI A;  2X1E A;  3RPU A;  3ZQF A;  2AO9 A;  3RQ4 A;  3HGY A;  4NQW B;  3KE2 A;  4G94 A;  3M7G A;  3ECO A;  4B3X A;  1MJA A;  1BN5 A;  2G7H A;  3BR3 A;  1W5T A;  3SZG A;  2OCC H;  5IP6 A;  1O57 A;  1R22 A;  3S1Q J;  3F8F A;  2Y48 A;  2JPC A;  2H09 A;  5JVT A;  3CTA A;  5HLI A;  4DOZ A;  4DJA A;  5C4J J;  3FMR A;  3MKZ A;  2R7W A;  2LTP A;  2F48 A;  2ZNZ A;  4ZDP A;  5HDN A;  1E2X A;  3GTO J;  3L7W A;  1TLH B;  2HWV A;  2HGC A;  3BZK A;  3JW4 A;  4RS8 A;  3H0D A;  5DUI A;  5EEG A;  1Q1V A;  2W85 A;  1BL0 A;  1BW5 A;  1STZ A;  4MTE A;  3E6C C;  1Z1D A;  2BY2 A;  4EGY A;  1T0F C;  2MH9 A;  2QLZ A;  5EZG A;  4DBQ A;  3LSR A;  2Z1D A;  2Y9Z A;  1IF1 A;  4HAM A;  3OS2 A;  3OIP A;  5D5X B;  3IKT A;  2CFX A;  5LRR A;  3HBL A;  2X4H A;  5J1R A;  3U1D A;  2B9S A;  1WKM A;  2M8G X;  2WV1 A;  3PM1 A;  3QPH A;  2RNG A;  4BHP A;  1YIJ I;  4A0Z A;  2HVS A;  4BNC A;  5IP9 J;  5J8C A;  1R4N B;  1IRF A;  2DQL A;  3G1O A;  2FF4 A;  4CIC A;  3LNQ A;  3ZQL A;  4LK0 F;  4HX8 A;  3ZMD A;  3IHU A;  1G3S A;  1H0M A; 
#chains in the Genus database with same CATH homology
 4WXC A;  1QPM A;  4A2U A;  1P92 A;  2ZFW A;  2O3F A;  1ONV A;  1KQ0 A;  2XIG A;  1IXS B;  4Y17 A;  4RB1 A;  4E70 A;  3BY6 A;  1QNT A;  1K78 B;  5ICE A;  5JR3 A;  2YPR A;  4KMF A;  2VBY A;  1D5V A;  1F9N A;  2WV0 A;  4KYW A;  1PP8 F;  1QBJ A;  2ESH A;  3FMQ A;  2CO5 A;  4ZYG A;  4HV5 A;  2Q8K A;  4XSX F;  1T0F A;  3GEZ A;  2GQQ A;  2EK5 A;  4HLY A;  2HYG D;  2FU4 A;  1GVJ A;  4LB5 A;  4L9N A;  1XDS A;  4A0X A;  2GWR A;  2GZW A;  2P8T A;  3WE2 A;  4RGS A;  2J5O A;  2UXN A;  1I27 A;  2GXG A;  2XKP A;  3O3K A;  1EV7 A;  2YSR A;  5F6F A;  4BXU A;  3L2C A;  4BHB A;  1UHM A;  2BBY A;  2QWW A;  2BE5 F;  2PMU A;  3I4P A;  2CWE A;  4I01 A;  3R0A A;  4NB5 A;  1P2F A;  1S6L A;  3FMS A;  3O2P E;  3JSO A;  2D45 A;  3IWZ A;  4LD5 A;  5IT9 Z;  4M6Y A;  2L3D A;  5DV5 A;  1IAW A;  4AVP A;  3R6S A;  5K5R A;  1DUX C;  1O7F A;  2FE3 A;  2VE8 A;  4HDV A;  5ICF A;  3F23 A;  1P4X A;  1Z6R A;  1OYI A;  1J9I A;  5H6R A;  5ED4 A;  4ZYD A;  1HBX G;  3HSR A;  1ZGJ A;  1I5Z A;  2Z99 A;  3DKW A;  3BWG A;  1JE8 A;  4IPA A;  3I54 A;  3WU1 B;  1O3T A;  1RUN A;  4UUV A;  2M30 A;  3KP3 A;  5E17 F;  2RN7 A;  4Z2Y A;  2GXB A;  2DBB A;  2DPD A;  2QQ9 A;  3GFL A;  3QP6 A;  2MLG A;  2F5C A;  4BQA A;  1D8J A;  1CF7 B;  3K0L A;  1JHH A;  3GLX A;  3ELK A;  3ZMU A;  4ENN A;  4U0V A;  1R36 A;  2ZXJ A;  1RI7 A;  3K69 A;  2XV4 S;  4EVI A;  1FX7 A;  2MLK A;  2OU2 A;  2DK8 A;  2FRH A;  1FYL A;  1IW7 F;  1REP C;  1IN7 A;  4UHT A;  3HTS B;  1ZRC A;  3RKY A;  5JHU A;  4GXO A;  3I5U A;  1ODD A;  1HKT A;  2Q0O A;  3SQN A;  1B6A A;  2WWY A;  1Z05 A;  2RVC A;  1DPR A;  3F21 A;  3BDD A;  2JSC A;  2VT2 A;  2FNP A;  3B02 A;  4R8H A;  2P7V B;  1LB2 A;  1XGO A;  2FML A;  2YX7 A;  5FO5 A;  3FXR A;  3NRV A;  4UNO A;  4ZYE A;  2NYX A;  3DEU A;  4LK1 F;  2FNA A;  1Y0U A;  2DPU A;  3JAM Z;  3JTG A;  1S8N A;  4GYI A;  4OOI A;  3OOP A;  3GF2 A;  3F6V A;  3ZN0 A;  3GFI A;  4OMY A;  3HRS A;  1SMT A;  2DT5 A;  4ZYH A;  2IA2 A;  2D1V A;  2QQA A;  3BZ6 A;  3V7R A;  4Q48 A;  5E1Z B;  4OMZ A;  1KU7 A;  2FBK A;  1G3T A;  1BI0 A;  2QM3 A;  4EV0 A;  4UV8 A;  1IN4 A;  2DW4 A;  4CHU A;  3F8M A;  5BS6 A;  3D5L A;  2HTS A;  3KET A;  4PGH A;  1CGP A;  3I53 A;  3J81 K;  3RJP A;  1ON1 A;  1S7A A;  2XVC A;  3TOA A;  4GYG A;  1EH8 A;  2XKO A;  4L5I A;  3HHH A;  4ON0 A;  2A6H F;  2RNJ A;  5CLS A;  2IP2 A;  1OR7 A;  2A61 A;  4O6J A;  5F1R A;  4FX0 A;  3BP8 A;  4KIG A;  3I64 A;  1IXC A;  1O7L A;  4OIN F;  2XAQ A;  3HTU A;  3R60 A;  1B59 A;  5TRD A;  1T39 A;  2QZ8 A;  3RIR A;  3KCC A;  4GCV A;  1HXD A;  2JRT A;  3JSP A;  3FM5 A;  1O3R A;  3E6D A;  1J75 A;  1K6O A;  4I98 B;  3R0J A;  4LMY A;  3KEO A;  4RB2 C;  4JQF A;  4RAY A;  4U88 A;  3GXO A;  5JI6 A;  4WXH A;  3BJO A;  1FWZ A;  1AWC A;  2OA4 A;  1UCR A;  3CUO A;  2M5W A;  5L3B A;  4I7H A;  4HQE A;  3WU0 A;  2H6C A;  1PP7 U;  2LNB A;  3DFG A;  4ASN A;  1AOY A;  1JXS A;  2PI0 A;  3I58 A;  3IRR A;  2EFO A;  5AIQ A;  2RQP A;  1R00 A;  5CVJ A;  3S2W A;  2L4M A;  1FY7 A;  5LEK A;  1Z9C A;  1L3L A;  3ABU A;  3H3U A;  3FWE A;  1LNW A;  1J7K A;  3KP5 A;  2Z3Y A;  4LG0 B;  1R7J A;  1TQM A;  2HFH A;  4HV6 A;  1XSV A;  3R4K A;  1TBX A;  3AAF A;  4HZF A;  3ZN1 A;  4G7O F;  4IVN A;  4OIQ F;  3G73 A;  3F22 A;  2L54 A;  2FQ3 A;  1EH6 A;  2DQR A;  2MH2 A;  1G4D A;  3RTR A;  3MAJ A;  1BM9 A;  4BYY A;  3H3Z A;  2P5K A;  2HOE A;  2J5P A;  3VEP A;  4HF1 A;  3B73 A;  4CXF A;  2PFB A;  4HBL A;  2ZKZ A;  2STW A;  1W4M A;  1J59 A;  1D3Y A;  3KZZ A;  1YLF A;  2V79 A;  1DP7 P;  4PZJ A;  3FX3 A;  3J80 K;  4IHS A;  3TOB A;  5L3G A;  3RI4 A;  1SAX A;  3DPL C;  3FXU A;  1C0W A;  2E1N A;  1R5G A;  2MD5 A;  3ZMT A;  3Q5F A;  5A2Q Z;  1W5S A;  2VC1 A;  1FYK A;  3QU3 A;  3TDZ C;  5HDK A;  3ZMZ A;  2O8X A;  4XSZ F;  3ZP5 A;  2ISZ A;  2AS5 F;  1LEB A;  1HST A;  3BPV A;  4H0E A;  1WRJ A;  5AIP A;  2KIM A;  4BAY A;  5E8I A;  3LST A;  2M8E A;  1YS7 A;  3LAP A;  5L3C A;  3C1D A;  2DK5 A;  4GO1 A;  3SZT A;  2H94 A;  5BMZ A;  2ZME B;  3E5X A;  1RUO A;  3N97 A;  3Q9S A;  3U2R A;  4WK8 F;  3HSE A;  1ZG5 A;  4PCQ A;  2V1X A;  4OIP F;  5DD4 A;  3CUQ C;  3T5X A;  2MBF A;  1Z7U A;  3TGN A;  4Q5S F;  5D4R A;  2D2W A;  3GW2 A;  2F5F A;  3GUD A;  3M8E A;  2K4J A;  5DDG A;  1JHF A;  2Y0M A;  4ESF A;  4HOB A;  1SFX A;  2NS0 A;  1ZRE A;  3BPX A;  4P9F A;  2EV6 A;  4O3M A;  3LQR A;  3MZY A;  2R7D A;  1USS A;  3WTY C;  2VN2 A;  2EWN A;  2EFN A;  3V8J A;  2RDP A;  4XBF A;  2XHK A;  3ULQ B;  2OQR A;  4CYD A;  2ZBK A;  1MDM B;  4HF2 A;  2EV0 A;  1G3W A;  3W6K B;  4IRI A;  2LF8 A;  1H9G A;  3ZMS A;  4JK1 X;  2Z9O A;  4G6D A;  3C3W A;  4M9X A;  1SD7 A;  1ZYR F;  4LLN A;  1S7O A;  1ZAR A;  2ZJ2 A;  1ZAO A;  3CUQ A;  3VOE A;  2H6B A;  1X3U A;  3I0T A;  2V1U A;  2B0L A;  4EGZ A;  4AIJ A;  2XGX A;  2CYY A;  1W7P B;  2HR3 A;  4U7B A;  4OIO F;  3V7C A;  4IJA A;  5H6Q A;  4RAZ A;  4Y15 A;  2XRN A;  5LEJ A;  2FOK A;  2XAF A;  4UV9 A;  1ZG1 A;  1FZP B;  1J2X A;  2IVM A;  4EJW A;  4R79 A;  6PAX A;  1WQ2 A;  2W57 A;  1K79 A;  3L9F A;  1RIO H;  4G7H F;  1Z6T A;  3RKW A;  4Q4Z F;  3ROU A;  4UVB A;  4MEY F;  2RGV A;  3KLN A;  1XCV A;  5D8L B;  2HZT A;  4A12 A;  2VXZ A;  3M9A A;  4GGG A;  1IZ1 A;  5K5O A;  3C18 A;  2HDC A;  1XMK A;  1Z91 A;  3O6B B;  2QYO A;  2F2E A;  4KNY A;  3EET A;  3SZP A;  3RPQ A;  1BIA A;  1PUE E;  3J81 Z;  1ZH5 A;  4Q47 A;  3GZ6 A;  1W7P D;  2X0L A;  2PN6 A;  1IRG A;  4QWQ A;  2ISY A;  5FLX K;  2ADU A;  1KGS A;  4MEX F;  5LRS A;  2KRF A;  2ZNY A;  1QO0 D;  4EM1 A;  1FBS A;  2WTE A;  1HQC A;  3BOQ A;  4N0B A;  3K1M A;  1U5T C;  5KVR A;  4R1H A;  4DQ2 A;  3E6B A;  4N9H A;  1QZY A;  1BC8 C;  1GXP A;  1TQI A;  2GIV A;  4KT5 C;  2HTJ A;  2DO7 A;  1MZB A;  3KEQ A;  5CJ9 A;  4OIR F;  1IN6 A;  2QBY A;  2W24 A;  1YIO A;  3EQL F;  4ETS A;  4RGU A;  3HYI A;  2L02 A;  3E6M A;  3PQK A;  5D6E A;  5LGT A;  1V3F A;  4YFK F;  3U9G A;  3BRO A;  2AXL A;  1FOK A;  3GYH X;  4YG2 F;  4P96 A;  1LEA A;  3RKX A;  3GZ5 A;  2COM A;  1XGS A;  3E97 A;  1SD4 A;  3CLO A;  4ZZL A;  2HS5 A;  1U5T A;  1PDN C;  1MJ9 A;  2WC2 A;  1R58 A;  3HOS A;  2XUB A;  1T38 A;  1F4K A;  2XAH A;  5BQT A;  5TJJ A;  4S04 A;  2MA3 A;  2UWM A;  2W25 A;  4G8X A;  1U2W A;  2DLL A;  2QUF A;  1XSD A;  1ZLJ A;  1J0R A;  2D1H A;  5IT3 A;  2HEO A;  2HQR A;  4HF0 A;  2K02 A;  1XSX A;  2BEO A;  2LKP A;  3L00 A;  1TNS A;  1TW3 A;  2QEN A;  2ELH A;  4KDP A;  3ISP A;  4U0Y A;  3SXY A;  4KIF A;  1TW2 A;  2M45 A;  3J80 Z;  4XRF A;  3CO6 C;  5HLH A;  1OYY A;  1B9M A;  2OQG A;  4EMS A;  2OD5 A;  1YQA A;  3CO7 C;  1FBQ A;  1YS6 A;  1SFU A;  5LLQ A;  5BPD A;  4I0A A;  3I59 A;  4QLC U;  5CVR A;  4ENJ A;  5CVU A;  2PG4 A;  1SD5 A;  3ZPL A;  2NNN A;  1LQ1 A;  5E1X A;  3ZMV A;  1XDU A;  1MJB A;  1G3Y A;  3IKV A;  4NQW A;  3DF8 A;  3D0S A;  2TDX A;  3MFK A;  4FX4 A;  2HYF A;  4IRH A;  3WG9 A;  4M74 A;  4AIH A;  1XD7 A;  4I09 A;  5ILV A;  3WTT C;  3WTX C;  5ILU A;  3K1P A;  1KQ8 A;  5D5W B;  2QBY B;  3KZY A;  4YII A;  2G9W A;  4JBA A;  3T0Y A;  1YW8 A;  3WTZ A;  2E7X A;  5CVI A;  1ZN2 A;  2W84 A;  5LHH A;  1H9T A;  4WWC A;  3EYY A;  4L9V A;  4KIB A;  3DPT A;  5H20 A;  4KUM A;  2LDU A;  3QU6 A;  2A6E F;  2HKX A;  2XRO A;  4M71 A;  2V1D A;  2CW0 F;  4CZZ A;  4EQQ A;  1BBY A;  2EFQ A;  4L9J A;  1FLI A;  4M72 A;  2PQ8 A;  5HLG A;  2YU3 A;  3G3Z A;  2MC3 A;  2P4W A;  1U5T B;  2P7C B;  2KJC A;  4RB3 C;  3DQV C;  3DXJ F;  2PBI A;  3FXQ A;  3VFZ A;  3F8B A;  2FMY A;  2OAZ A;  1MD0 A;  1R5H A;  4EJO A;  2NAZ A;  1K78 A;  3KP4 A;  3GVA A;  1MGT A;  4BHC A;  2Z33 A;  1LDD A;  1HSJ A;  5D8K B;  1KU3 A;  4EM0 B;  3LA3 A;  2JTV A;  1EH7 A;  3KFW X;  1UST A;  1D8K A;  5HDG A;  3N4M A;  4L5J A;  3V4G A;  1HW1 A;  4AWX B;  5CVV A;  3M1E A;  2NNY A;  3BJ6 A;  2F5E A;  1A04 A;  1IN8 A;  1FPQ A;  3PFI A;  5ILS A;  2K86 A;  4L9T A;  4B8X A;  2A69 F;  3K2Z A;  2DAO A;  4D0P A;  4EJV A;  5AON A;  5DYM A;  1FYM A;  2ETH A;  5D5V B;  3F6O A;  3I59 B;  3SFZ A;  2ESN A;  2VBZ A;  2CGP A;  3GFJ A;  3WGI A;  5FD5 A;  5EEH A;  3V7S A;  3RYR A;  1ZLK A;  1BI3 A;  1XB4 A;  3GWZ A;  4NHJ A;  2XAJ A;  4I0B A;  1VTN C;  4S05 A;  2HQN A;  2QQB A;  2P5L C;  2BV6 A;  1HW2 A;  3IWF A;  2F5D A;  4EM2 A;  4MTD A;  3EUH A;  5E20 A;  2K7L A;  3FHZ A;  4CO8 A;  3P9I A;  3LQQ A;  5FGM A;  3I71 A;  3VOD A;  2KIU A;  1IUY A;  1P4W A;  1S3J A;  3F8C A;  3IC7 A;  2VOD A;  5J8F A;  2EA4 A;  2UXX A;  2JPB A;  2STT A;  3VB2 A;  3WTS C;  1WWX A;  2CSO A;  1UHW A;  5K5Q A;  1KU2 A;  1KYZ A;  4O5V A;  1HKQ A;  1YW7 A;  3Q9V A;  4U7D A;  4KIC A;  4P5O A;  3OV8 A;  4BH9 A;  5FLX Z;  4CDG A;  5LHI A;  3NQO A;  5K1Y A;  5FFZ A;  4G6Q A;  4OU0 A;  2O6G E;  5BOX A;  2VOO A;  1T2K A;  3LAJ A;  3QAH A;  2A68 F;  1YFH A;  1IN5 A;  1P4A A;  5ERI A;  2G7U A;  4P55 A;  4B09 A;  5KK1 A;  2IPQ X;  3QPT A;  5HOO A;  4I02 A;  2M87 A;  1XGM A;  1LJ9 A;  1CF7 A;  1SFE A;  2EFW A;  1IXR C;  4HW0 A;  1SMY F;  3TO7 A;  4PGG A;  4YIF A;  2LSO A;  2YX4 A;  2IRF G;  4G7Z F;  5L3E A;  3FZV A;  1FBU A;  4I2O A;  1YYV A;  1I1S A;  3EDP A;  3IRQ A;  1BIB A;  4IXA A;  4YFN F;  4LFU A;  3MQ0 A;  2PJP A;  5D4S A;  3P7N A;  4ENK A;  5LGU A;  3K1N A;  3LA2 A;  4HYE A;  2VE9 A;  1QZZ A;  2BYV E;  3JTH A;  5DCM A;  2L01 A;  3LFK A;  3MEX A;  2A07 F;  5D6F A;  2M1B A;  5A2Q K;  2O61 A;  5E1W A;  4WX9 A;  4M6X A;  4MHG A;  4UVC A;  1ZG3 A;  2XAG A;  2QVO A;  3HUG A;  2OZU A;  2KIF A;  4P9U A;  4MQ9 F;  3R61 A;  1K7A A;  3REO A;  1U6G A;  2CQK A;  2IT0 A;  4CGZ A;  4HDU A;  2A3S A;  4LLG F;  3TKY A;  3PQJ A;  4ZH4 F;  1YG2 A;  5ICG A;  1FNN A;  1Q1H A;  3MWM A;  4FT8 A;  3EYI A;  1V4R A;  2XAS A;  4N9I A;  1G6N A;  4WCG A;  3F3X A;  3IL2 A;  1R23 A;  4A0Y A;  1WSU A;  4U0W A;  3GX4 X;  1FT9 A;  2JZY A;  4MQV A;  4AIK A;  3COA C;  2DI3 A;  1B1B A;  4HA8 A;  1J5Y A;  3KP2 A;  5JFR A;  1F1Z A;  4F7Z A;  1E17 A;  1FP1 D;  4K2E A;  3ERE D;  2PEX A;  1NHA A;  3KP6 A;  3WE3 A;  2NRA C;  2PLY A;  4L0Y B;  3WGG A;  5L3D A;  4XLN F;  3WTU C;  1S29 A;  4FHT A;  3KP7 A;  2Z5U A;  2E1C A;  2HKO A;  2ZCW A;  4HX7 A;  2FBI A;  3HIF A;  3ECH A;  2FXA A;  3SHF A;  4MNU A;  1KQ9 A;  3LWF A;  4WF2 A;  1R1T A;  1OPC A;  1RZ4 A;  2Q2E A;  3WTW C;  1YTY A;  3CUQ B;  3HRU A;  2O03 A;  2E7W A;  1KU9 A;  1YO5 C;  1SD6 A;  1I6X A;  2FEZ A;  2EFP A;  1OYW A;  1QQI A;  4L18 B;  2DFI A;  2VT3 A;  3NEU A;  5DCM B;  3V8L A;  1L0O C;  3E3V A;  3T8R A;  1ZRF A;  4ENM A;  1I1G A;  4EJT A;  5HS7 A;  5FD6 A;  3WTV C;  2IW5 A;  3HRT A;  3WGH A;  4KN4 X;  3H92 A;  4HQM A;  2P6T A;  4LG0 A;  1LDJ A;  5IT9 K;  3C7J A;  3M8F A;  4IRG A;  1KA8 A;  3HOT A;  4IF4 A;  2BGC A;  2V9V A;  1TNT A;  2DU9 A;  5HS8 A;  2RC4 A;  3TO6 A;  3W6J B;  5E8G A;  5HS9 A;  2FSW A;  5F64 A;  1ZHF A;  1ZGA A;  3TO9 A;  3KLO A;  4MGR A;  4M73 A;  1GXQ A;  3HRM A;  1UB9 A;  4XLP F;  4Y13 A;  2LF7 A;  1T98 A;  2VC0 A;  3TQN A;  2GAU A;  3F72 A;  1BJA A;  5HVQ C;  1U78 A;  5FFX A;  3QOP A;  1LDK B;  5DUK A;  3QP5 A;  3ZQ7 A;  1T6S A;  2EV5 A;  4LGW A;  4DNC A;  2P5V A;  1XGN A;  4UVA A;  3ABT A;  4LB6 B;  4HX4 A;  2R3S A;  4ZZD A;  2KJB A;  2L4A A;  4IHT A;  2FA5 A;  5DCF A;  3P9C A;  1XMA A;  3DP7 A;  4YFX F;  2IA0 A;  4A6E A;  2OZ6 A;  2UZK A;  5LBQ A;  2V6C A;  1WI9 A;  3TDU C;  1OMI A;  3GFM A;  1O3Q A;  1O3S A;  1OKR A;  4KFC A;  2GA1 A;  4A5M A;  4LLL A;  1RNL A;  1XN7 A;  4M9Z A;  2A5Y B;  4RGX A;  2VBX A;  4WXD A;  2O0Y A;  1B9N A;  4A6D A;  3FF5 A;  3HHG A;  5D5U B;  2IA1 A;  2OBP A;  2KKO A;  3F8N A;  4RGR A;  5L3F A;  2YR2 A;  5LHG A;  3T1B A;  2ZME A;  3L09 A;  4ESB A;  5DEQ A;  1U8R A;  4PDK A;  3HSF A;  3RYP A;  5DD8 A;  1QGP A;  1XCB A;  1B4A A;  1ON2 A;  4TV7 A;  2C6Y A;  1U3E M;  3K9T A;  2VOP A;  4HLX A;  2ACJ A;  5J6X A;  4KMU X;  1R1U A;  1FP2 A;  1KYW A;  2DTR A;  2IJL A;  4L0Z B;  5ICC A;  2R7F A;  3J7A O;  4KN7 X;  3P9K A;  2EB7 A;  1DPU A;  2EA2 A;  3DV8 A;  1ZRD A;  4A5N A;  1FSE A;  5BPI A;  5FB2 A;  3CJN A;  1F5T A;  2FBH A;  1R1V A;  1YW9 A;  2K27 A;  1BC7 C;  3JAM K;  2GA2 A;  4G9Y A;  2H27 A;  1FC3 A;  4AD9 A;  3WOD F;  2VBW A;  3LA7 A;  2ZO4 A;  1ULY A;  3E5U A;  5LGN A;  2VON A;  4M9S A;  1GHC A;  1JGS A;  1UFM A;  4ESJ A;  3RDI A;  1BI2 A;  3QRF F;  1MDM A;  1TTY A;  2RKH A;  5E18 F;  2P6S A;  3GO5 A;  2EJR A;  2CG4 A;  3CDH A;  2Y75 A;  3MCZ A;  1MKM A;  1FSH A;  3V8K A;  1TQP A;  1BI1 A;  3E5Q A;  5CYV A;  1BOA A;  3MZH A;  3BJA A;  1P6R A;  1HW5 A;  2JT1 A;  4LJZ F;  4KA4 A;  4EJU A;  3T8T A;  1W7P A;  3FM3 A;  2RV8 A;  4UXN A;  3ML6 A;  1HKS A;  4RB0 A;  2K4B A;  1LVA A;  1DDN A;  2PMH A;  3RPU A;  3KE2 A;  4G94 A;  3M7G A;  3ECO A;  1MJA A;  1BN5 A;  2G7H A;  1W5T A;  1O57 A;  1R22 A;  3F8F A;  2Y48 A;  2JPC A;  2H09 A;  5JVT A;  3CTA A;  5HLI A;  3FMR A;  2ZNZ A;  5HDN A;  1E2X A;  3L7W A;  1TLH B;  2HWV A;  2HGC A;  3JW4 A;  4RS8 A;  5DUI A;  5EEG A;  2W85 A;  1STZ A;  4MTE A;  3E6C C;  1Z1D A;  4EGY A;  2QLZ A;  2MH9 A;  1IF1 A;  4HAM A;  3IKT A;  5D5X B;  2CFX A;  5LRR A;  2X4H A;  3U1D A;  1WKM A;  3QPH A;  4BHP A;  4A0Z A;  4BNC A;  5J8C A;  1IRF A;  4CIC A;  2DQL A;  2FF4 A;  4LK0 F;  4HX8 A;  3ZMD A;  3IHU A;  1G3S A;  1H0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...