3MEXA

Crystal structure of mexr in oxidized state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
142
structure length
142
Chain Sequence
MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQSLAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the oxidation-sensing mechanism of the antibiotic resistance of regulator MexR
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription, transcription regulation
molecule keywords Multidrug resistance operon repressor
total genus 48
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mexA01
3BJAA 4IHTA 1TQMA 5ICEA 2XAFA 4Q5SF 3JTGA 1RUOA 2QVOA 4EM2A 2XHKA 4OMZA 2K86A 3TO6A 4HAMA 3WTZA 4CICA 3WTYC 1FYLA 2ZMEB 4A0YA 3TDZC 4CYDA 5LGUA 1KA8A 4CXFA 5FGMA 1G3YA 1BOAA 3LWFA 5ICGA 3HRUA 2GXGA 1QO0D 4ENKA 2XAQA 3QOPA 3T1BA 2Z5UA 1TW2A 4Y17A 3GX4X 1LDJA 2E7XA 3CUQA 4K2EA 1YW7A 1IN7A 5LHIA 4ZYDA 5FO5A 1FBQA 2DO7A 5D5VB 5L3DA 1OYIA 5CVIA 2P5KA 3H3UA 2VODA 3FXRA 2KJBA 4CDGA 1WI9A 3KE2A 1BC7C 2FQ3A 3KCCA 3RKYA 2KJCA 2QENA 3FF5A 2PEXA 3G73A 3FZVA 2OZUA 1STZA 1OMIA 2VOOA 2VOPA 2DW4A 1QQIA 2CYYA 3F3XA 4RB0A 2B0LA 1XSDA 1RZ4A 1Z6TA 2XV4S 3E6MA 4MTEA 3WU1B 1YS7A 2HOEA 1MJ9A 4A12A 5LRSA 3ZMZA 3K1MA 4KICA 1O7FA 4HLXA 2EA4A 1ZG5A 3OOPA 4OOIA 4EGZA 3D5LA 5D5UB 1HKTA 5BMZA 4KMFA 4CHUA 3DF8A 3DXJF 3HSEA 1PP7U 1WWXA 2PBIA 2R3SA 3QPTA 5DCFA 5DD4A 1U78A 3VEPA 2Y75A 4LLNA 1YFHA 3I5UA 1SFUA 2XASA 4KIGA 4MEYF 1EH7A 2GA1A 2X0LA 1DDNA 2HGCA 4KFCA 2HTSA 2F5EA 4CGZA 3TQNA 1REPC 2VT3A 5LRRA 5IT3A 4Z2YA 1KGSA 1ZGJA 1KU3A 2W84A 1XGOA 3MFKA 5JHUA 2PG4A 4YFKF 1MDMA 3W6KB 1D8KA 3K1PA 3E3VA 4ZYGA 3RKWA 4B09A 3QP6A 1W7PD 2OD5A 2QBYB 1PDNC 2F5FA 1S29A 3LA3A 3R4KA 3BWGA 4FT8A 2HZTA 4KUMA 5HDKA 5H20A 4EJWA 1Z1DA 3K69A 4I02A 5K1YA 2EFPA 4R79A 4G8XA 3IKTA 4ZH4F 5D5WB 3F8FA 3WTTC 1QGPA 4OU0A 2BE5F 4KT5C 1FSHA 1YQAA 2BEOA 3B73A 1FLIA 2STTA 1DUXC 1ONVA 4WWCA 3K2ZA 4I01A 2M30A 2A6HF 2LSOA 3B02A 3VOEA 1L0OC 2ZBKA 4HOBA 3RKXA 5D8KB 4EJVA 4GO1A 2W24A 1Z05A 4KYWA 3VODA 2RC4A 4AWXB 2ZXJA 4AIHA 1R00A 1XMKA 2L01A 5E1ZB 1R1UA 1ZLKA 3F8BA 1Z6RA 2L4MA 3HHGA 4ASNA 1S8NA 1UB9A 1X3UA 4XBFA 2KKOA 5JVTA 2M87A 2IA1A 3E6BA 2OQGA 3ECOA 4UUVA 1OPCA 2AS5F 1ZLJA 2G7UA 3KEOA 2DAOA 3WG9A 3ZMSA 5CVUA 5A2QK 2GXBA 2FSWA 2EK5A 1ZHFA 3SZTA 3BJOA 3JSPA 3E5UA 2ZO4A 3KP4A 1BI0A 3RIRA 2BYVE 4HF2A 3LQRA 1U2WA 1E17A 1P6RA 2QBYA 2E7WA 2VC0A 5ED4A 3Q9SA 3K0LA 1BN5A 5LHGA 4KIBA 3IL2A 1ODDA 4HDUA 1P4AA 1Y0UA 1P4WA 3FMRA 2IVMA 3BROA 3T5XA 4GXOA 2V1DA 2DBBA 4U0YA 2Z9OA 1U6GA 2BBYA 2UWMA 3Q9VA 1P4XA 5ERIA 4WXCA 1FWZA 1RIOH 1P92A 2ZKZA 3LAJA 1B6AA 2O0YA 1J0RA 2YX4A 5BQTA 3VB2A 5DUKA 2VE8A 2VT2A 1G3WA 1T0FA 2YSRA 2QQBA 5DYMA 3SXYA 2QZ8A 1R23A 1GXPA 2NYXA 1RUNA 5CYVA 1BI2A 3JAMZ 3MZYA 2HFHA 1KU9A 5LLQA 3DFGA 2PMUA 4HX8A 3PQKA 1W4MA 3F22A 1MD0A 2HYFA 3T8RA 5LGTA 1QPMA 4OIPF 4OINF 1J7KA 1O3TA 2LF8A 1BIBA 3KP7A 1R5HA 2ELHA 4L9TA 2EFOA 1BI3A 4BXUA 3IRQA 2RN7A 5JFRA 2FNPA 2LKPA 4ZYEA 1J9IA 4L9VA 3ZQ7A 1R7JA 3T8TA 2J5OA 4HW0A 2VN2A 3EETA 1EH6A 5ILSA 3F72A 3TO7A 2PMHA 4EJOA 1ZRDA 1YLFA 4EM0B 1MJBA 3MEXA 4LMYA 2PN6A 2HKOA 5CVRA 3SHFA 4PGGA 2CG4A 3GUDA 1BBYA 1I27A 3S2WA 4BYYA 1ZARA 4P5OA 1ZH5A 2RGVA 2D1VA 2CQKA 4JBAA 3G3ZA 1B9MA 5H6QA 5K5RA 3EDPA 2ISYA 5A2QZ 2DK5A 4MQVA 1IXCA 3V8JA 5D4RA 5HVQC 2UXNA 3KP6A 1XD7A 1XDSA 1XCVA 1FSEA 5CVJA 3ZMDA 1OYWA 3L9FA 4MGRA 1KYZA 3E6CC 3QU6A 3U1DA 1JE8A 4XLPF 2CW0F 2DQLA 1I5ZA 4AD9A 1F5TA 1R36A 2L54A 1FP2A 4EJUA 1WQ2A 1B1BA 1TW3A 3C1DA 3LFKA 5HDNA 2O03A 1R58A 3R0AA 2ZNYA 4AVPA 2Q0OA 1FZPB 2YR2A 2XKPA 3JAMK 1T38A 3K1NA 4HYEA 2GWRA 2XKOA 4PZJA 3QPHA 1BI1A 3V4GA 4Q48A 4GGGA 2JRTA 4O5VA 2O3FA 4WXDA 1ZREA 2W25A 3COAC 2RDPA 1IXSB 2IA0A 1XB4A 4U0WA 4S05A 4I0BA 2EJRA 3DPTA 2D1HA 4YIFA 1P2FA 3HTUA 4I7HA 2EV0A 4UVBA 3R60A 3FHZA 2P7VB 3ML6A 3RI4A 2HDCA 3IC7A 5D5XB 5FLXZ 4DQ2A 2HQRA 2Y0MA 1USTA 5AIQA 4M74A 2IT0A 3L2CA 2Z33A 1SFEA 4S04A 4LLLA 3V7SA 2DLLA 3T0YA 1HBXG 5KVRA 3DP7A 1FYMA 3I59A 2ZNZA 2DQRA 3TOAA 3I58A 1LQ1A 3WGIA 3FM3A 1J5YA 3ERED 3MWMA 4BHBA 4LGWA 2MH9A 3L7WA 3EYYA 2PFBA 1U5TA 4LD5A 3KZYA 4HF1A 1G3SA 2HTJA 3ULQB 2VBYA 2V6CA 1ZGAA 4UNOA 2BV6A 4LK0F 3HYIA 2QYOA 5K5OA 1EH8A 1SMYF 2F2EA 5IT9Z 3M1EA 4FHTA 3BP8A 1UHWA 1IZ1A 2ETHA 2GAUA 1J59A 4IRHA 1MGTA 1I1SA 3LQQA 5AIPA 1WRJA 3H3ZA 2L02A 4N9HA 3F23A 3R0JA 4OIOF 3MCZA 1CF7A 1V3FA 3J80Z 3ELKA 3CLOA 2Z99A 3F21A 2KIUA 2YU3A 5HLGA 5L3GA 5JR3A 3GFJA 3WTVC 2FOKA 5LBQA 4WF2A 1L3LA 1U5TB 1QNTA 4ON0A 2AXLA 2FRHA 3QRFF 3RJPA 3K9TA 1R5GA 2PQ8A 1FC3A 2Q8KA 1R22A 2ACJA 1S3JA 4A0XA 4U88A 4NQWA 5BS6A 1R1VA 4QLCU 2HWVA 2HYGD 2KIMA 3F8MA 3EQLF 3TOBA 1O3SA 1S6LA 2QM3A 4OMYA 1G4DA 5HS9A 3C3WA 5J6XA 5EEGA 2A6EF 2DI3A 4A0ZA 4PGHA 2JZYA 4ZZDA 1IXRC 1U3EM 1O7LA 2XRNA 3F6OA 4FX0A 2FMLA 3BJ6A 3PFIA 4TV7A 2OU2A 4BHCA 3QP5A 1TTYA 2OQRA 4M71A 2A68F 2RVCA 3U2RA 1BM9A 3LA7A 2YPRA 5DEQA 4MQ9F 1AOYA 4L0ZB 2TDXA 1HW5A 1UHMA 2RNJA 4A6DA 1QZYA 3F6VA 4YFNF 3ZMTA 4LK1F 1E2XA 1OKRA 2QQ9A 3REOA 1D5VA 3RYPA 1IN6A 4L9JA 5D6FA 2EA2A 1BJAA 3KETA 5L3BA 1HXDA 3KZZA 2IW5A 2OZ6A 3DQVC 2L4AA 5KK1A 5J8CA 2FF4A 3OV8A 2P6TA 3PQJA 1IAWA 3GZ6A 2J5PA 4AIJA 3ABTA 5LEKA 2FA5A 2HS5A 2CSOA 1HW1A 3O2PE 4I98B 1CF7B 4MNUA 3NQOA 1GHCA 1YS6A 3H92A 2H09A 2NS0A 3RPUA 2O6GE 4KN7X 4G9YA 2MH2A 2ZFWA 2M45A 1UFMA 4CZZA 2EFQA 1SD7A 1XGSA 3SQNA 5E17F 4XSXF 3TGNA 2PJPA 2E1CA 2V1UA 2X4HA 1K78A 1I1GA 3FMSA 4A2UA 2XAGA 3L00A 1DPUA 5E8IA 1B59A 2UZKA 2WV0A 4HV6A 1JXSA 4A6EA 3ZN0A 2DU9A 5HLIA 1S7AA 2V1XA 5CJ9A 5HS7A 3CTAA 4M73A 3WTUC 3DPLC 3CUQC 2DT5A 1IW7F 2Z3YA 3GLXA 1OR7A 4KIFA 1DP7P 3E5XA 1ZN2A 4L18B 3LSTA 5BPIA 1KQ8A 2RQPA 3FMQA 5LGNA 4CO8A 3V8LA 3IKVA 2HEOA 3MQ0A 2L3DA 3WGGA 1HW2A 3WODF 3KP3A 2QLZA 3V8KA 2FXAA 1SD6A 5TRDA 1LVAA 3C7JA 2W85A 3FX3A 2GZWA 3J81Z 1HSTA 4XLNF 2O8XA 1K6OA 2MLGA 4IRGA 1YG2A 1NHAA 1T2KA 4U7BA 4LB5A 3HRTA 1R1TA 4P9UA 5ICFA 1W5SA 4ESBA 2R7DA 2ZCWA 4L5JA 2P8TA 1TNSA 3GWZA 4E70A 3E5QA 4IPAA 4ESJA 2JT1A 1Z7UA 5E20A 4EV0A 4RS8A 1J75A 2M8EA 4EJTA 3QAHA 4WK8F 4HF0A 2ZMEA 3WTXC 2MC3A 4BNCA 1TNTA 5DCMA 1HKSA 1IN5A 3GEZA 4IRIA 1FP1D 5DUIA 3CO7C 2XUBA 5E1XA 2FMYA 3BDDA 1PP8F 4B8XA 4I0AA 1F9NA 1HSJA 2RV8A 1WKMA 4UVCA 1SD5A 1LNWA 4L9NA 3JW4A 2C6YA 4YIIA 1HKQA 5DCMB 1C0WA 2FBIA 3WTSC 2VXZA 1FYKA 1IN8A 4RGSA 2COMA 3MZHA 1TQIA 4I2OA 4KDPA 1YW9A 1H0MA 4M9SA 4R8HA 3ISPA 3O3KA 2NNYA 1B9NA 1LB2A 2CWEA 1XGMA 1UCRA 3I59B 3KLNA 3I4PA 3M7GA 5D4SA 2A07F 2GQQA 1JHFA 1RNLA 4A5NA 2WC2A 4ZZLA 3F8CA 5HLHA 3R61A 3D0SA 1ZAOA 2IA2A 4YFXF 3KLOA 4RGRA 2H27A 3I64A 4QWQA 1XGNA 4HX4A 4RB3C 2HQNA 3GFIA 3CDHA 1D8JA 4RGXA 4P9FA 1U5TC 2FEZA 1WSUA 3V7RA 4HV5A 4MTDA 4ENNA 3LAPA 2BGCA 4UHTA 4WCGA 4EQQA 3M8EA 3ZPLA 3F8NA 1HQCA 1Q1HA 2A3SA 4HDVA 5F64A 4G7HF 4RAYA 1F1ZA 3FM5A 3GO5A 4N9IA 4HQEA 3EUHA 2P5LC 1T39A 1FBUA 3VFZA 2YX7A 4LFUA 1ZYRF 3BPVA 4Y15A 2JPBA 3GVAA 1VTNC 3V7CA 2F5CA 5HOOA 2EB7A 3KEQA 1TBXA 5FFZA 1KU2A 5DV5A 1O3RA 4EM1A 2XAHA 2MBFA 3ECHA 5EEHA 4JK1X 1FX7A 4LJZF 2K27A 3HUGA 1MDMB 2XGXA 3ROUA 1IRGA 2A61A 2IP2A 3FWEA 2WTEA 3FXQA 2QWWA 2Y48A 1D3YA 4PDKA 1H9GA 3M9AA 3DEUA 1ZG1A 1XMAA 5J8FA 2W57A 2K02A 1FOKA 3RPQA 5ILVA 2IRFG 4N0BA 3W6JB 2NAZA 2XAJA 4M9ZA 1XSVA 2VC1A 4HBLA 1BIAA 4G6DA 2P6SA 2A5YB 5K5QA 3DV8A 2FBHA 5LHHA 3HOTA 2FNAA 4HQMA 5ILUA 3BY6A 4L0YB 5HS8A 1AWCA 3IRRA 2P7CB 1XCBA 3WU0A 4P55A 4LG0B 3NEUA 2JTVA 2R7FA 1LDKB 3I54A 2KIFA 3RTRA 3TDUC 2NNNA 3M8FA 2EFWA 4JQFA 4G7OF 3GYHX 3BPXA 1H9TA 2K4JA 4LLGF 3I71A 2FBKA 2VE9A 5CVVA 2ISZA 4EVIA 2LF7A 1PUEE 3ZMVA 4R1HA 3GZ5A 4WXHA 4U0VA 1TQPA 1T6SA 1TLHB 2FU4A 5CLSA 5FB2A 1CGPA 4M72A 2NRAC 2M5WA 3R6SA 2OA4A 3CUQB 5FLXK 2F5DA 3GXOA 3HIFA 3LA2A 1SD4A 3ABUA 1KQ0A 1USSA 5D6EA 3WTWC 4IVNA 2XIGA 1IF1A 5E1WA 3P9IA 1FPQA 1F4KA 4GYIA 3E97A 5BOXA 3RDIA 3ZN1A 1QBJA 1FBSA 1LEAA 4U7DA 1G3TA 3C18A 5FFXA 4OIRF 4GCVA 3J80K 4EMSA 4YG2F 3N97A 2K7LA 2VONA 5IT9K 1ON1A 2LNBA 2QUFA 4IF4A 4DNCA 3I53A 5JI6A 3L09A 2CGPA 1LDDA 3SFZA 2VBXA 4BH9A 2DPDA 1B4AA 2EV6A 1W5TA 4EGYA 3IHUA 2KRFA 4LB6B 1SFXA 2JSCA 4NHJA 1XDUA 3TO9A 2OBPA 4ESFA 1K7AA 1Z9CA 4H0EA 4BAYA 2O61A 4ZYHA 3ZP5A 4XRFA 2H6CA 2Q2EA 4Q47A 4P96A 4HA8A 2GA2A 4ENJA 3SZPA 2P5VA 4D0PA 3JSOA 5LEJA 2OAZA 4G94A 1Z91A 5F1RA 2D2WA 1KQ9A 3WE2A 5F6FA 4PCQA 4HZFA 2DK8A 3CUOA 2MD5A 4UXNA 2EV5A 1MJAA 5L3EA 2RKHA 1KU7A 2G9WA 2V9VA 3JTHA 2EFNA 4L5IA 1FT9A 4KN4X 3MAJA 4IHSA 4A5MA 2K4BA 3HSRA 3P7NA 5FD5A 3EYIA 4BQAA 1LEBA 4G6QA 4UVAA 3GW2A 3BZ6A 1MZBA 2DFIA 1EV7A 4HX7A 2XVCA 2PLYA 1IRFA 4IXAA 1I6XA 3Q5FA 4AIKA 3FXUA 4G7ZF 3AAFA 2DPUA 2MLKA 4ENMA 2XROA 4UV8A 1K79A 4Y13A 5E8GA 4ETSA 2M1BA 4HLYA 4RGUA 1U8RA 1JGSA 1YYVA 1DPRA 1JHHA 1ON2A 1KYWA 3GFLA 3DKWA 1IN4A 5DDGA 4MHGA 2HKXA 4MEXF 1O57A 2WWYA 1S7OA 3J81K 1LJ9A 1ULYA 3CJNA 4OIQF 3J7AO 1GXQA 5H6RA 3N4MA 2VBZA 3RYRA 3BOQA 4NB5A 1T98A 2ADUA 1O3QA 3HSFA 4BHPA 5HDGA 5TJJA 3HRSA 1XN7A 2ESHA 1MKMA 5D8LB 3IWZA 3WE3A 1G6NA 1YW8A 2EWNA 5ICCA 2STWA 3ZMUA 4RB1A 4FX4A 3KP5A 1J2XA 6PAXA 3WGHA 3TKYA 1FY7A 2MA3A 2VBWA 3GFMA 3U9GA 5L3FA 2IPQX 4WX9A 3HRMA 1ZG3A 3P9KA 2A69F 5FD6A 4O6JA 2V79A 1IUYA 3E6DA 4M6YA 2UXXA 1BC8C 3O6BB 4UV9A 4I09A 4RB2C 1W7PA 2IJLA 4GYGA 3HTSB 4KNYA 1SMTA 4IJAA 4KA4A 1SAXA 4LG0A 1ZRFA 4M9XA 3HOSA 2DTRA 1XSXA 2GIVA 3QU3A 5DD8A 1W7PB 2QQAA 1YO5C 3NRVA 5E18F 3I0TA 5BPDA 2G7HA 4M6XA 5L3CA 2ZJ2A 2CO5A 4Q4ZF 2H6BA 2ESNA 1QZZA 4KMUX 1V4RA 2E1NA 2H94A 1FNNA 4F7ZA 1YTYA 4XSZF 3KP2A 2FE3A 5AONA 3CO6C 2PI0A 1RI7A 4RAZA 3IWFA 2CFXA 3GF2A 1A04A 1YIOA 1ZRCA 3HHHA 2D45A 3P9CA 2JPCA 3KFWX 2P4WA 1K78B 1OYYA 2LDUA 1GVJA 4O3MA 2HR3A
chains in the Genus database with same CATH superfamily
2QKLB 5EG0A 3S3NA 4BACA 5TGTA 3BJAA 4IHTA 1TQMA 2OF7A 5ICEA 2XAFA 4DYCA 1D1BA 3CCRI 4Q5SF 2DFFA 5GADJ 3JTGA 2L5QA 1RUOA 4CCMA 2QVOA 3PNTA 4ZTFA 2HOSA 1HC8A 4EM2A 2HU9A 1ZTRA 2XHKA 4OMZA 5KAIC 2K86A 1JT0A 3TO6A 4HAMA 2GM4A 4XN3A 3WTZA 4IOAF 3JREA 4CICA 1VQ5I 1X1BA 2ZC2A 1VQ4I 2HVSA 3MKLA 4HSTA 3WTYC 4A3MJ 1FYLA 2DJIA 2G0EA 1P7JA 2ZMEB 4A0YA 3TDZC 4CYDA 3DWLE 5LGUA 4CCKA 1KA8A 4CXFA 3JR9A 5FGMA 1G3YA 1BOAA 3LWFA 5ICGA 3HRUA 1YX5A 2GXGA 3LSIA 3H9QA 1QO0D 3AG1H 3U21A 4II3A 2MFZA 4ENKA 2XAQA 3QOPA 3T1BA 2Z5UA 1X4PA 1TW2A 4Y17A 3GX4X 1LDJA 2E7XA 2HQAA 1T0FC 3CUQA 2F6CA 4K2EA 1VQ8I 3QQAA 1OISA 4EEFG 3D5RC 4E7JA 1YW7A 4G12A 1IN7A 1JT6A 5LHIA 4ZYDA 1YE9A 1FBQA 4I99C 5FO5A 2DO7A 2H8WA 3ABMH 4PJLA 5D5VB 5L3DA 1MW7A 1OYIA 5CVIA 1V5EA 2P5KA 3H3UA 4IOCF 2I5UA 2VODA 4BU2A 5C4XJ 3FXRA 2OJED 2KJBA 1V5FA 4CDGA 2LTPA 3FHNA 1WI9A 3KE2A 5C44J 1BC7C 2FQ3A 1K83J 3HXLA 4XRMA 5F1JA 3KCCA 3RKYA 2KJCA 2QENA 2DN0A 4V19K 3CF5F 3FF5A 2LR8A 3AG3H 2PEXA 3G73A 3FZVA 1RETA 2R7XA 2B7EA 2E19A 2OZUA 1STZA 1OMIA 2JA6J 2VOOA 2ZXIA 3G4SI 1B8IB 4C3HJ 4XRSG 2DW4A 2VOPA 1QQIA 2CYYA 4BDZA 1Y8RB 2ME6A 2B63J 4M3BA 1D0YA 4HRIA 2LG4A 3F3XA 2R7SA 2ZSHB 4RB0A 3IH3A 3W2VA 3WG7H 1J09A 2B0LA 2XB5A 1XSDA 1RZ4A 1Z6TA 2XV4S 3E6MA 4MTEA 3WU1B 4GFBA 1YS7A 2IGOA 4HNVA 2HOEA 1RC9A 3ZOBA 1YITI 1MJ9A 3OYIA 4A12A 5LRSA 3VDXA 4M3DA 4ZDPA 2K9SA 2K9QA 5FKLA 3ZMZA 1Y56A 3K1MA 4KICA 1O7FA 1K4TA 2Y30A 4HLXA 2EA4A 2W7NA 1ZG5A 3OOPA 3JRDA 2M8GX 4OOIA 4EGZA 3D5LA 5D5UB 1RR8C 1HKTA 1LPQA 4BL0B 5BMZA 4KMFA 2CFOA 1FOYA 1LVKA 2NVUB 4CHUA 4FASD 3DF8A 3DXJF 3HSEA 1PP7U 2PMZN 1PUFB 1WWXA 4IHXA 2PBIA 2R3SA 3QPTA 2XSJC 5DCFA 2ID6A 5DD4A 1U78A 3VEPA 2Y75A 2WAEA 4II2A 4LLNA 1YFHA 3M4OJ 3TBIA 2JA5J 4MIMA 3OYBA 3HL2A 2R7RA 3I5UA 4FE4A 4HSRA 1SFUA 3JRAA 1Z3YA 2X1DA 2LREA 2XASA 4KIGA 3H3VK 4MEYF 1EH7A 1R6RA 2WAQN 2GA1A 5IP7J 4LG3A 2X51A 2X0LA 3L2QA 4JX4A 1DDNA 2HGCA 2NS7A 3JRFA 2VQLA 4KFCA 1ERDA 3OSGA 1OFCX 2HTSA 2I10A 4W1UA 2MYSA 2KZGA 2F5EA 4CGZA 3TQNA 2BXZA 1REPC 2VT3A 1FMWA 2DODA 5LRRA 5IT3A 4Z2YA 3H9JA 5EZGA 1KGSA 1ZGJA 1KU3A 2W84A 1XGOA 4NC6A 1MBFA 1R49A 3FXKA 3MFKA 3PUFA 5IPAA 5JHUA 3L2UA 2PG4A 5K7ZA 3FXOA 4YFKF 3KX2A 3NWSA 3BR5A 3TMOA 1MDMA 3W6KB 1WH5A 2E5ZA 1D8KA 3K1PA 2P0WA 3E3VA 3AL0C 2E60A 4ZYGA 3RKWA 2VKEA 4B09A 1ETOA 2O9LA 3QP6A 1W7PD 2ID3A 2OD5A 2DMNA 4PK4A 3A2KA 3BR3A 2H8RA 2HOAA 2QBYB 4PJMA 2F5FA 1PDNC 1S29A 2Y0SN 3I56I 1YX3A 3LA3A 1GUUA 3CF2A 3R4KA 3BWGA 4FT8A 4BJTA 2HZTA 1DU0A 1FIAA 4KUMA 5HDKA 5H20A 2QSHX 4MFEA 1Z1DA 4EJWA 2X6OA 1UZCA 3K69A 3HJEA 1HF0A 5M3FJ 4I02A 5K1YA 2ECBA 1XTAA 2EFPA 4R79A 4G8XA 3IKTA 3JRHA 2W00A 5EGOB 2EINH 2N8GA 3D5SC 4ZH4F 4QPQA 5D5WB 3F8FA 3WTTC 1NG7A 1QGPA 3FIWA 4OU0A 5IP9J 4JOMA 2BE5F 2DMPA 4KT5C 1FSHA 2QSGX 5DS9A 1QZEA 1BW6A 5IYCJ 2GIZA 1YQAA 3FKIJ 2V4JC 2DOFA 1AHDP 2BEOA 3B73A 2VQHA 1FLIA 2STTA 3GCMA 3PJRA 1DUXC 1ONVA 1QHGA 4WWCA 1MBEA 3K2ZA 3KIOA 2VB6A 2R93J 4I01A 5J1YA 2M30A 2A6HF 3S3MA 3HM5A 2LSOA 3LSRA 3B02A 2E5NA 3VOEA 4KT6A 1L0OC 2ZBKA 3FXMA 4HOBA 3RKXA 5D8KB 2WB1N 4EJVA 4GO1A 1BOBA 2W24A 1Z05A 4KYWA 1D1CA 2WADA 3AG2H 3HGYA 5DM6F 3AFHA 3VODA 1KONA 2RC4A 1ZKGA 4AWXB 1V5GA 1X58A 3S2DJ 2ZXJA 2LH9A 1R00A 4AIHA 3OYMA 2X6WA 1XMKA 2L01A 4B47A 3BTCA 5E1ZB 1R1UA 1U8BA 1ZLKA 4YRVA 4FCYA 1BL0A 3F8BA 4CCOA 1Z6RA 2L4MA 4CSWA 2OCCH 3MVPA 3HHGA 3SFIA 4ASNA 3M07A 3S1MJ 1UB9A 1S8NA 1X3UA 2O7OA 2KKOA 4XBFA 5JVTA 2M87A 3LNQA 2IA1A 1SVMA 3E6BA 2V6EA 3PNYA 2OQGA 4BQOA 4D7MA 2Y9ZA 2EH3A 3ECOA 4UUVA 2IAIA 2VQGA 1OPCA 2AS5F 1ZLJA 2G7UA 3KEOA 2DAOA 3WG9A 3ZMSA 5CVUA 5A2QK 2E1MB 3A01B 2GXBA 2EK5A 2FSWA 3BG5A 3CMYA 1ZHFA 3OYEA 3SZTA 3U1KA 3BJOA 2BY3A 1IUFA 3JSPA 5GAGJ 5E79C 2L9NA 2P81A 1JI8A 3E5UA 2ZO4A 3KP4A 1BI0A 2F4MB 4BJ5C 2XGCA 2EQRA 2MABA 2DA5A 2VKHA 3RIRA 2BYVE 4HF2A 3HUGB 3HOVJ 3LQRA 2FUG2 1U2WA 2ZMEC 3Q0UA 2DYRH 3MZ8A 1P6RA 1E17A 5GPAA 3K4MA 2QBYA 3MKZA 2KIQA 2E7WA 2VC0A 3IP4B 5ED4A 2HZDA 1VQLI 3Q9SA 1S9HA 1Z3XA 3K0LA 4M3FA 3ONQA 1T95A 1BN5A 4F92B 5LHGA 1YIJI 4KIBA 3IL2A 1ODDA 1SANA 4D9JA 4HDUA 1I3AA 4OAZA 1P4AA 1Y0UA 3KEYA 1P4WA 4RDUA 3CDIA 3CMMA 3FMRA 2IVMA 5EG0B 3BROA 4IZZA 3T5XA 1W36C 4GXOA 2V1DA 1A35A 1HOMA 2DBBA 1SFKA 4U0YA 1VQPI 4CA0A 2Z9OA 2NOJB 1WJEA 1U6GA 2HXIA 2BBYA 2UWMA 3Q9VA 1P4XA 5ERIA 1MMDA 2A6TA 4WXCA 4BS9A 4IHYA 4JYKA 1FWZA 2L7FP 2GLOA 2CUJA 3H5RA 4CYCB 1RIOH 1P92A 2ZKZA 3LAJA 2XDVA 5CKTA 3A0HC 5HODA 1B6AA 5CPRB 5J4VA 2O0YA 4MLOA 1J0RA 2IS4A 2YX4A 1LFBA 5BQTA 4E7KA 2EBIA 3VB2A 2CQQA 5DUKA 2L0KA 2VE8A 4GDFA 4MO7A 4A3FJ 2VT2A 3A4CA 1G3WA 1T0FA 2TRTA 2YSRA 3BTLA 2QQBA 5DYMA 3SXYA 3S1RJ 2Q1ZB 2QZ8A 1R23A 5B1BH 1GXPA 1APLC 1SVLA 2RREA 2NYXA 2L2OA 4C9YA 5F0HA 1JJ8C 5CYVA 1RUNA 1BI2A 3JAMZ 1YRNB 3MZYA 2HFHA 4O3MA 3OIPA 1KU9A 1I39A 1H8AC 4XK4A 2ZB9A 5LLQA 3DFGA 2PMUA 4HX8A 1W4MA 3PQKA 1EKEA 3F22A 1MD0A 2HYFA 2HDDA 3GZNB 3T8RA 5LGTA 1QPMA 4OIPF 4OINF 2PJRB 1J7KA 1O3TA 2LF8A 2WY8Q 1ETVA 3K70D 2L7MP 1A6IA 1BIBA 2L9VA 2BY0A 3KP7A 1R5HA 2ELHA 4L9TA 2EFOA 1BI3A 4BXUA 4DBRA 2DXIA 3IRQA 2RN7A 3G6EI 1P7IA 5JFRA 2FNPA 2LKPA 4ZYEA 4BY1J 4XR6A 3LSHA 2W48A 3OL4A 4CCJA 1IO2A 2E34A 1J9IA 4L9VA 2CRGA 1R7JA 3ZQ7A 3T8TA 2J5OA 2ZXHA 4HW0A 2VN2A 3EETA 1EH6A 1EJ9A 3P5JA 5ILSA 3F72A 3HBLA 3TO7A 2PMHA 4FISA 3J7YJ 2XRLA 4XKCA 4EJOA 1ZRDA 3CCVI 1YLFA 2X1EA 4EM0B 1MJBA 5IYDJ 3MEXA 1IJWC 4HEA2 3HOYJ 4LMYA 2PN6A 1VFCA 2HKOA 5CVRA 3SHFA 3NAUA 4PGGA 2NS8A 1TWCJ 2CG4A 3OWTA 2WB1A 4I76A 3GUDA 3OYFA 3DU6A 4XM3A 1BBYA 1I27A 3M3YJ 3S2WA 4BYYA 4C2MJ 3CP2A 3OS1A 1ZARA 5IOYA 4P5OA 2XGEA 1ZH5A 3L2VA 2RGVA 2D1VA 2CQKA 4JBAA 3G3ZA 5E3LA 1B9MA 3KPHA 2JK3A 5H6QA 3PSFA 2FJ1A 5K5RA 3S2HJ 4IQ4A 5FJ8J 3EDPA 1V54H 1MH4A 2LFBA 2XC7A 3ZQGA 3BG6A 4A69C 2ISYA 5A2QZ 2DK5A 4MQVA 1IXCA 3V8JA 5D4RA 1JUMA 3A0BC 5HVQC 2UXNA 3BR6A 1KZHA 3KP6A 3LFUA 1XD7A 1XDSA 4BXFA 3K7AJ 2VJ4A 1R9TJ 1XCVA 1FSEA 5CVJA 3ZMDA 1HA8A 4J01A 1OYWA 3L9FA 3GTQJ 4MGRA 3MMYB 1KYZA 3E6CC 2HI3A 3QU6A 4JX5A 3U1DA 1JE8A 4XLPF 2CW0F 5KHDA 4ZYAA 3PIPF 2VJ5A 3HB9A 5E3OA 3VYSB 5B1AH 5FLMJ 3OYNA 5B3SH 2DQLA 3I9V2 1I5ZA 4AD9A 1F5TA 2ICWG 1R36A 2ELKA 2L54A 3OR1C 3K70C 2ZJPF 3FBIB 3I4NJ 1FP2A 4EJUA 2WAQA 1WQ2A 1B1BA 1TW3A 3C1DA 3LFKA 3VPRA 3OYJA 4UB8C 5HDNA 3CP8A 3J7ZI 2O03A 1R58A 3CC7I 2QGUA 4A93J 4MFDA 3FKJA 4F91B 3R0AA 1HLVA 1BR4A 3DBLB 1QPIA 2ZNYA 4AVPA 4HNUA 3OS2A 2BZTA 1FTZA 4BXXJ 2Q0OA 2R92J 1FZPB 2YR2A 3S15J 5LD2C 4F52A 2XKPA 2DA3A 3JAMK 2BHYA 4Y4RA 1T38A 3K1NA 2JA2A 3RQ4A 4HYEA 1S5LC 2GWRA 2LRDA 1ZR4A 4DGWB 1DU6A 2XKOA 3H9GA 3HEFA 4BDYA 4PZJA 3PNVA 3QPHA 1OCCH 2MGQA 4AUXA 3DU5A 2DOEA 1MNDA 2HVRA 1YI2I 1BI1A 3V4GA 4Q48A 5BNGA 4GGGA 2JRTA 2VASA 2O3FA 4O5VA 2JN6A 4WXDA 2ZJRF 1ZREA 2W25A 3COAC 2M34A 3CD6I 4DOZA 1QA6A 4XLAA 3KYLA 2HVQA 2RDPA 1IXSB 2IA0A 1XB4A 2X48A 3BLYA 4RM2A 4U0WA 2CQ7A 4I0BA 4S05A 2EJRA 3LMMA 3HDDA 2BVMA 3DPTA 2D1HA 5J4YA 1RKTA 2DDAA 3TL4X 2GOXB 4YIFA 2EILH 2R7OA 2JUCA 2OPTA 4HG2A 4CZCA 2GOMA 1Y8QB 2L9RA 4UY8I 1P2FA 1NTCA 3HTUA 5F08A 1FOWA 3BR0A 4I7HA 2EV0A 1ZGWA 1IGNA 1SVOA 4UVBA 3Q0VA 4E6KG 1RRJA 3R60A 2CQXA 3FHZA 1WCMJ 2P7VB 1Y0NA 3ML6A 3RI4A 2HDCA 3IC7A 3CCMI 5D5XB 2XF5A 2NVQJ 4A3BJ 5FLXZ 4DQ2A 2OC6A 4D5CA 2HQRA 2Y0MA 2EZHA 2VIXA 1USTA 4ZC3A 5AIQA 4M74A 1LFUP 5FROA 5M3MJ 2IT0A 3L2CA 3CCJI 2Z33A 1SFEA 4S04A 4LLLA 3W2AA 3H0GJ 1N78A 3EUAA 2DLLA 3T0YA 3V7SA 2E2JJ 1HBXG 4IKFA 1AA7A 5KVRA 3DP7A 2M0CA 1FYMA 3I59A 2ZNZA 1QU3A 2DQRA 3TOAA 3DCFA 3I58A 1G59A 2HQ5A 2Q2EB 4M3GA 5JHFA 4XL9A 1LQ1A 3WGIA 4J19A 2CV0A 3FM3A 4AYBA 1J5YA 3ERED 5JVGF 3MWMA 4BHBA 4LGWA 2MH9A 3L7WA 3EYYA 2PFBA 1U5TA 1TZLA 1T33A 4LD5A 3KZYA 4HF1A 1G3SA 2HTJA 3ULQB 2VBYA 3S8PA 3QYFA 1UHSA 2V6CA 2WV1A 3AG4H 2QA4I 1ZGAA 1K61A 4UNOA 2BV6A 4LK0F 4XMYA 2JQ7A 1F43A 3HYIA 2QEXI 3FBNB 2GXAA 2QYOA 1V55H 1YJWI 1W0TA 2W82A 4AVZA 1ETQA 5K5OA 1EH8A 1SMYF 3SEQA 1MNEA 2QF7A 1N75A 2F2EA 5IT9Z 4A3LJ 4DYQA 3M1EA 4FHTA 3TW7A 2WAFA 3BP8A 1UHWA 4IHWA 4IX7A 5GTIC 3ZXSA 1UJ8A 1IZ1A 2ETHA 3J7AY 1DP3A 2GAUA 1J59A 1OR7C 4IRHA 1MGTA 3BR1A 3VSLA 1I1SA 3LQQA 1TWGJ 3JRIA 1TL8A 5AIPA 4B44A 2W4SA 1WRJA 1JUSA 2CW8A 4RM3A 3H3ZA 2L02A 4N9HA 1VQOI 1XC5A 3R0JA 3F23A 1JTXA 1PVEA 3A01A 4OIOF 2JVGA 3MCZA 1NK3P 3CJRB 1CF7A 3ASOH 1V3FA 2W1OA 3LSKA 3J80Z 4AM3A 2IS1A 3ELKA 2E2IJ 1DGWY 3CLOA 4XNFA 2Z99A 3F21A 2KIUA 2YU3A 5HLGA 2PMZA 5L3GA 5JR3A 3GFJA 2JA8J 3WTVC 4D7NA 3S17J 2FOKA 3OIQA 5LBQA 4WF2A 4XRSA 3OS0A 1L3LA 1U5TB 1QNTA 2DJNA 1MIJA 4ON0A 2AXLA 2R5YB 3C2GA 4PSXA 4RAGA 4BE2A 3K4NA 2FRHA 3QRFF 2XPVA 3RJPA 3GTJJ 3K9TA 5GPCA 1R5GA 3ASNH 3V42A 2PQ8A 4B3AA 1FC3A 3FXJA 2Q8KA 1R22A 2ACJA 1S3JA 1X3ZB 4A0XA 2DA7A 3RCOA 4U88A 4NQWA 4AYBN 3PIOF 3Q0WA 5BS6A 1R1VA 4QLCU 2HWVA 2HYGD 2KIMA 2ZFUA 1PYVA 3F8MA 3RZDJ 3EQLF 3TOBA 2XAUA 1O3SA 4QPOA 3O8HA 1MBHA 1S6LA 3O8GA 4XLHA 4EATA 2QM3A 3CC4I 5EDNA 4OMYA 1QVTA 5LFAA 1G4DA 5HS9A 3QPSA 1ACIA 1Q1VA 3C3WA 5J6XA 5EEGA 4PFOA 2A6EF 2DI3A 1X1DA 4A0ZA 4PGHA 4QIWN 4B43A 2JZYA 3CJQB 4ZZDA 1IXRC 1NG6A 1U3EM 1O7LA 2XRNA 1W5CC 2IGKA 3SDGA 2CV1A 3F6OA 4FX0A 4E7LA 2FMLA 1OJLA 4YELA 3BJ6A 3PFIA 4TV7A 4D5FA 2OU2A 4BHCA 2HYJA 4XONA 3QP5A 1TTYA 3LSJA 4IEJA 5EF6A 4V2GA 1UG2A 3FK7A 4DZPA 2OQRA 4M71A 2A68F 2RVCA 3FISA 4ANJA 3BR2A 5FKMA 2BY2A 3U2RA 1BM9A 3LA7A 2YPRA 3DEWA 5DEQA 4MQ9F 3WU2C 2KPMA 3OYDA 3K4BA 2LVSA 4L0ZB 1AOYA 1VI0A 4JP0A 1Y1VJ 1W0UA 2TDXA 1HW5A 1UHMA 2RNJA 4H4KC 4A6DA 4IL6C 2HPIA 1QZYA 3F6VA 2M2EA 3K4JA 4YFNF 3ZMTA 4CCNA 4LK1F 4XLCA 1E2XA 2HXOA 3I4MJ 1OKRA 1WJCA 2JJ7A 2K3PA 3LL7A 2QQ9A 4AC0A 3REOA 2KDOA 1FOXA 1D5VA 1BJZA 4X0GA 3VWBA 5K7FA 3RYPA 1IN6A 4L9JA 5EJCA 1GV2A 2R4GA 5D6FA 1BR2A 1BJAA 2EA2A 3KETA 5L3BA 3ZQIA 4M6VA 1HXDA 3KZZA 2ZXWH 2IW5A 2OZ6A 3CCQI 3DQVC 2HOTA 4ZJZA 2L4AA 3BT9A 5CQGA 5KAFC 3Q3SA 4PJ0C 3OSFA 3HZJA 3E7LA 5KK1A 3RQIA 5J8CA 2FF4A 2JVHA 3OV8A 2P6TA 4UUSB 3PQJA 4NQWB 1IAWA 3S14J 3DTKA 4Y52J 3GZ6A 1D0XA 2J5PA 4AIJA 2VUMJ 3ABTA 5LEKA 2FA5A 1I3QJ 2HS5A 2CSOA 2V9KA 1HW1A 3O2PE 4I98B 1CF7B 4MNUA 3NQOA 1GHCA 1GLNA 1YS6A 3H92A 3JRGA 2H09A 3VSKA 2NS0A 1SAUA 3RPUA 2JSPA 2O6GE 4KN7X 5HNFA 3AKZA 4G9YA 2MH2A 2ZFWA 2M45A 1I50J 2LY9A 1UFMA 4CZZA 2EFQA 1A5JA 1SD7A 1XGSA 4F93B 3SQNA 5E17F 4XSXF 3TGNA 2PJPA 2E1CA 1TWFJ 3OYLA 2V1UA 2LKXA 2COBA 4UUSA 2R5ZA 1EA3A 2X4HA 1K78A 3HC7A 1I1GA 3S1QJ 2R7QA 3FMSA 4A2UA 4BBSJ 2XAGA 3L00A 4DIQA 2DDBA 1DPUA 4XICA 5E8IA 2DTZA 1B59A 2UZKA 1SEUA 4W97A 3QPLA 2WV0A 4HV6A 1MBGA 3W3CA 1JXSA 5IP6A 4A6EA 3ZN0A 1PJRA 2DU9A 1D1AA 5HLIA 1S7AA 4KJZA 2H1LA 1LE8A 4XOTA 2V1XA 5CJ9A 5HS7A 1Y39A 3CTAA 4M73A 3WTUC 3DPLC 3S3OA 4E7IA 3CUQC 2DT5A 2IGNA 4XKWA 2JUGA 4BBRJ 1IW7F 2Z3YA 3GLXA 3ZGKA 3RKQA 1OR7A 4KIFA 1DP7P 3E5XA 4PUSA 4BKXA 3B6CA 1ZN2A 4L18B 4XKVA 3LSTA 3GLLA 5BPIA 3BG9A 2DA4A 1KQ8A 5F27A 2RQPA 1F36A 3FMQA 2IS6A 5LGNA 1LUJB 4CO8A 2NOGA 2BW3A 1TP4A 2RQQA 3F9KA 1YHQI 1JUPA 2KLOA 2E1MC 3V8LA 3IKVA 2HEOA 3MQ0A 4NDLA 5E3MA 2L3DA 3WGGA 1S72I 1HW2A 1BR1A 3HKZA 1D5YA 2K3FA 3PFYA 3WODF 5IY5H 1Z77A 3KP3A 1B8IA 2QLZA 3V8KA 1WH7A 1SD6A 2FXAA 5TRDA 3BC8A 3BZKA 1LVAA 1YJ9I 3OYKA 1K4SA 3DBHB 2F5VA 2W85A 3C7JA 3FX3A 2GZWA 3J81Z 5GP9A 1HSTA 4XLNF 2O8XA 1JKOC 2VXDA 1K6OA 3IUOA 3PM1A 2MLGA 4IRGA 1JKPC 1YG2A 3A1YA 1NHAA 1N25A 5F04A 2B9SA 3IAM2 3ZQFA 1T2KA 1RESA 4U7BA 3CJTB 4LB5A 3HRTA 2ECCA 2FD5A 2JA7J 1VZ0A 1DGRM 1R1TA 4P9UA 2MC4A 5F0FA 5ICFA 4FE7A 5TISC 3CZ6A 1W5SA 4ESBA 1RPWA 2R7DA 2ZCWA 4L5JA 2P8TA 1Z7LA 1G8XA 1TNSA 3QYBA 5EZHA 4QSHA 5KCMA 3NARA 1AKHB 2AQFA 3GWZA 4E70A 2DA1A 3E5QA 2CW7A 4IPAA 3OYAA 2F4OB 2LKSA 2NVXJ 4Y7NJ 4ESJA 1TWHJ 2K9NA 2JT1A 2CQNA 4ZTJA 3VYTB 1Z7UA 5E20A 4EV0A 2Y0SA 4N4NB 3BZCA 4RS8A 2EZLA 4F3QA 1J75A 2CS3A 3C2BA 2M8EA 4EJTA 2AHQA 3FDYA 1E3HA 3QAHA 4WK8F 4HF0A 1R4MB 5JLWA 2ZMEA 3WTXC 1OCZH 2MC3A 1OCTC 4BNCA 1TNTA 9ANTA 5DCMA 4AIDA 4YIRX 4RAFA 3GEZA 1IN5A 1HKSA 3CDLA 2EZIA 4IRIA 3ZQCA 4BUPA 4BE1A 3SJMA 2VPLA 1FP1D 5DUIA 1UAAA 2KZVA 3SDBA 3OL3A 1JKQC 2XUBA 5E1XA 3CO7C 2FMYA 1OCRH 1SC7A 4LITA 3BQZA 3BDDA 1X1PA 1PP8F 4B8XA 1R4NB 1IV6A 4I0AA 1F9NA 1HSJA 2RV8A 1WKMA 1MMNA 2LY2A 1OQYA 2OTJI 4UVCA 4P1WA 1YJNI 4C3JJ 2XF6A 1I6HJ 1SD5A 4NBQA 1LNWA 4L9NA 4DJAA 3GTPJ 3JW4A 2C6YA 4YIIA 1HKQA 3IV5A 5DCMB 2FQ4A 1A31A 1BA5A 1C0WA 4BJ6C 2FBIA 3WTSC 2VQCA 2UUZA 4V2FA 2VXZA 1ORKA 2IEKA 1FJLA 3W6VA 1U9NA 1D0ZA 1FYKA 1IN8A 4RGSA 3AL0B 3IH2A 5J1UA 2COMA 3F0CA 3MZHA 1TQIA 1XPXA 4KDPA 1A6QA 4I2OA 2PJRA 1YW9A 1H0MA 4M9SA 4R8HA 4E4HA 1IG7A 1MH3A 2M4GA 3ISPA 3HOUJ 3O3KA 4C2TA 2NNYA 2MW8A 5DTDA 1B9NA 3MN2A 4LIUA 2JWTA 1LB2A 2CWEA 1XGMA 1WJFA 4XQFA 1UCRA 2LD5A 2MG4A 3I59B 3KLNA 1MBJA 1WHUA 3I4PA 1IC8A 3DBRB 3M7GA 5D4SA 3S1NJ 5H2FC 1B72B 2A07F 2GQQA 1JHFA 3TEDA 4HNTA 1JKRC 2CU7A 4RA2A 1X2NA 4UUTA 1WVRA 1RNLA 4A5NA 2WC2A 4ZZLA 3F8CA 3I3LA 3BG7A 3HG9A 5HLHA 3R61A 4PJNA 3D0SA 2CV2A 1WGXA 3CESA 1ZAOA 4LOCA 5JLXA 3C2HA 2IA2A 3EUHC 3RPUD 4YFXF 2O8KA 2R7TA 2MSYA 2KDZA 4XLEA 3KLOA 4RGRA 4ABZA 5FRNA 3I64A 4A3JJ 2H27A 2L7ZA 4QWQA 1XGNA 4HX4A 3UKGA 4RB3C 1B72A 3CCYA 2HQNA 3GFIA 3CDHA 4U87A 1D8JA 4RGXA 4P9FA 1U5TC 2FEZA 1WSUA 3V7RA 4HV5A 3CCEI 3BTJA 1U0JA 4G6TB 2Z1DA 1T56A 2E71A 4MTDA 4ENNA 3LAPA 3GTMJ 2BGCA 2F48A 3G1MA 4UHTA 3M8EA 4EQQA 4WCGA 3ZPLA 2DCEA 3F8NA 1Q1HA 1HQCA 4Y3OA 1WZ2A 2XSDC 1ZR2A 3JCUC 2A3SA 3IAS2 5F64A 4HDVA 4G7HF 1VNDA 1VQMI 4CYCA 2L7KA 4NC7A 4RAYA 1F1ZA 2ZSIB 3FM5A 3GO5A 2LLKA 3EPZA 4N9IA 4HQEA 1WJDA 3EUHA 1ETXA 2Y31A 2P5LC 5EGOA 1T39A 1FBUA 3L2RA 3DEEA 3VFZA 2FX0A 2YX7A 4LFUA 1ZYRF 2R7WA 3BPVA 2KISA 4Y15A 2JPBA 2L9SA 3GVAA 2Y2ZA 1VTNC 1Z0XA 3CCUI 3V7CA 3PSIA 3S16J 2F5CA 5HOOA 3L1PA 2EB7A 3KEQA 1TBXA 5FFZA 5J47A 2JRMA 3CCLI 2PX9A 4B48A 2KL4A 1KU2A 2LC2A 5DV5A 1O3RA 2AQEA 1YRNA 1GT0C 5CQEA 4EM1A 2XAHA 3M8JA 1H88C 2EZKA 2MBFA 3ECHA 5EEHA 4JK1X 1FX7A 2M3AA 5GAEJ 4LJZF 3ERMA 2K27A 2X1CA 3OOUA 2VPRA 5HLTA 1O4XA 3HUGA 3BG3A 2V26A 1MDMB 2XGXA 3ROUA 2OCEA 1IRGA 2A61A 4C3IJ 1WI3A 1YOVB 2IP2A 3FWEA 2KP6A 2DFHA 2K9LA 3RSNA 3FXQA 2WTEA 2QWWA 2Y48A 3QODA 1D3YA 4CH7A 4PDKA 1H9GA 3M9AA 3DEUA 1ZG1A 3HOZJ 4XN0A 1XMAA 3KYDB 5J8FA 2W57A 3ABLH 1R71A 1Z67A 2K02A 5EYRA 1HDPA 3RPQA 2A5WA 2E35A 5ILVA 1FOKA 2IRFG 1WJ5A 4N0BA 3W6JB 2NAZA 2XAJA 4RLQA 2QCOA 3H35A 2VKDA 4M9ZA 3QWLA 2RNGA 1AKHA 1XSVA 2VC1A 4ZDLA 2DT7B 4HBLA 4E7HA 1BIAA 4G6DA 4LIVA 3PO2J 3RZOJ 3MKWB 2P6SA 2A5YB 3ZQQA 5K5QA 5B66C 3DV8A 2FBHA 5LHHA 3B6AA 1MMSA 2BY1A 3LOCA 3S32A 2KRHA 5DM7F 3HOTA 2XB0X 1MSFC 3CMAI 3N05A 5M5WJ 2FNAA 4N4OB 3DLLF 2DA2A 2YS9A 2VJJA 4HQMA 2VJIA 5IYBJ 4D1QA 3GTKJ 3K6GA 5ILUA 4XORA 3BY6A 4L0YB 5HS8A 1AWCA 1JJ6C 3IRRA 2VL8A 1X3WB 4OAYA 3VYUB 3SYTA 2P7CB 2OV7A 1XCBA 3E1SA 4A3KJ 3WU0A 2K40A 2HPMA 4P55A 4LG0B 3G2BA 3NEUA 4RBOA 1ETWA 3DPUA 2NXNB 1RR7A 2JTVA 3KZIC 4KISA 2CUFA 2CUZA 4E7ZA 2R7FA 1LDKB 2KQRA 2YUSA 1TC3C 3I54A 2KIFA 1NH3A 2H1KA 2EPFA 3OYCA 3RTRA 3H0DA 2EIMH 3TDUC 2VI6A 2NNNA 4BEHB 3M8FA 3SZGA 2EFWA 4JQFA 4G7OF 3GYHX 1G2HA 3BPXA 1H9TA 1FMVA 2K4JA 1MMAA 4LLGF 1VQ9I 3I71A 2CUEA 2Y69H 3GTLJ 2FBKA 1VQ6I 2CJJA 2AXTC 2VE9A 3K4KA 2NVTJ 5CVVA 2GBYA 3M1CA 2ISZA 2R5YA 4ZDOA 4EVIA 2AO9A 2LF7A 4NC8A 4OWRB 2Z16A 1VF9A 3MKYB 3G1LA 1PUEE 3H5AA 5EEAA 3ZMVA 4R1HA 3GZ5A 3ABKH 4WXHA 4U0VA 1TQPA 3NWTA 1T6SA 1TLHB 2DOAA 2FU4A 3GTOJ 5CLSA 5FB2A 1CGPA 4M72A 2KRCA 3PUBA 2NRAC 2M5WA 3R6SA 3OMYA 2LYCA 2OA4A 1E3PA 3CUQB 2DA6A 5FLXK 3CCSI 2D5VA 2E1OA 2E2HJ 2F5DA 3GXOA 3HIFA 3LA2A 1Y6IA 1TWAJ 1SD4A 1P9QC 3ABUA 3HPGA 3G1OA 1GVDA 1KQ0A 4A3EJ 1USSA 5D6EA 2LMDA 3WTWC 3QOEA 4IVNA 3IH4A 4DZJA 1QVUA 2A05A 2XIGA 3X2QH 1IF1A 5E1WA 3OYHA 2R7VA 1ETYA 3P9IA 1FPQA 1F4KA 1XX5A 1VQ7I 3OY9A 1E3OC 4A3DJ 2KFDA 1QRYA 3E97A 4GYIA 5BOXA 3RDIA 2XPWA 3MD2A 5C3EJ 3ZN1A 1E0EA 3SEZA 3LSGA 1QBJA 1OCPA 1FBSA 1LEAA 4U7DA 1G3TA 1OLTA 3C18A 5FFXA 1DQUA 4OIRF 4BY7J 4GCVA 3J80K 4EMSA 3H36A 4YG2F 4IQJA 1TT0A 3N97A 2K7LA 2VONA 5IT9K 1ON1A 2LNBA 2QUFA 2XGDA 4IF4A 4DNCA 1XS9A 3I53A 3BQYA 3L09A 5JI6A 1UMQA 1LDDA 4NUBA 2CGPA 4A3GJ 4C2UA 2WA0A 3SFZA 2VBXA 4BH9A 2DPDA 1B4AA 2EV6A 1W5TA 4EGYA 1T8IA 1T08B 1XG1A 2KRFA 3IHUA 3ZRGA 1H89C 4LB6B 1SFXA 2JSCA 4NHJA 1XDUA 3TO9A 2OBPA 4ESFA 1K7AA 5FLVA 3HOWJ 1Z9CA 4Z6YA 4H0EA 4BAYA 4F55A 1POGA 2BVLA 1X1CA 2O61A 4ZYHA 3ZP5A 4XRFA 4IHVA 2H6CA 5F0CA 2Q2EA 4Q47A 4P96A 4HA8A 2LY1A 2GA2A 3CLQA 4ENJA 3SZPA 1NK2P 2CMPA 1N77A 3GTGJ 4X6AJ 4J00A 5FRMA 2P5VA 2X85A 4D0PA 3JSOA 5LEJA 3ZQHA 1LKXA 4AU7A 2OAZA 4G94A 5GTHC 1S7EA 4BEHA 1Z91A 5F1RA 3ZQLA 4CUGA 2D2WA 4XKBA 1KQ9A 3WE2A 1QHHD 5F6FA 4PCQA 1W1WE 4HZFA 1IRZA 1ZELA 2DK8A 1GV5A 4B1RA 3CMEI 3CC2I 4PSWA 3CUOA 2MD5A 4UXNA 1ENHA 2EV5A 1MJAA 4S0HB 5L3EA 2ME0A 2RKHA 1KU7A 1PUFA 2G9WA 2V9VA 4DW6A 3JTHA 2EFNA 1RKWA 2UV1A 4L5IA 1FT9A 2K85A 2TCTA 4KN4X 1MNMC 1MMGA 1X19A 3MAJA 4IHSA 1VQNI 3BCBA 3JRCA 4A5MA 1HDDC 2K4BA 3HSRA 1X2MA 3P7NA 2VLAA 3A03A 5FD5A 1XMXA 3JRBA 3EYIA 1JTYA 4BQAA 4FETA 1UG0A 3H5NA 1LEBA 4G6QA 2VKVA 2OUMA 4UVAA 3GW2A 1HCRA 3BZ6A 1MZBA 2FOWA 2DFIA 1IDYA 1EV7A 4HX7A 2XVCA 2PLYA 3WHBA 1GDTA 1UELB 1IRFA 5HNHA 2OTLI 4RLFA 1IV8A 5FKNA 1EF4A 4IXAA 1I6XA 3FXLA 3Q5FA 2QKMB 4AIKA 3BCAA 3FXUA 4G7ZF 3AAFA 5K7HA 2DPUA 2MLKA 1TT5B 4ENMA 2XROA 3TP0A 4UV8A 2KMUA 1K79A 2X6YA 5M5YJ 4Y13A 5E8GA 4ETSA 2R5ZB 2M1BA 4B3XA 4HLYA 3A02A 2O5RA 4XLFA 3DTEA 4RGUA 4A3IJ 4B4CA 5J1RA 1U8RA 1ZK8A 4Y33A 1WFXA 2IXSA 1JGSA 1LFPA 1DPRA 1YYVA 1JHHA 1M1EB 1ON2A 1KYWA 3GFLA 4DYRA 3DKWA 2M4KA 2R7ZJ 3I55I 3FK6A 1IN4A 3D1NI 2MD0A 5DDGA 1SFOJ 4C30A 4MHGA 3K4LA 3LSPA 1AU7A 1U9OA 3E0JB 2HKXA 4MEXF 1O57A 2WWYA 2E36A 3DLAA 2DYSH 2R0QC 2V1NA 1S7OA 2F4IA 3J81K 1WJAA 3CQZJ 2HDWA 1LJ9A 1ULYA 3CJNA 3VYRB 2DMQA 2BHZA 4OIQF 2LBFB 1IRXA 3J7AO 2QSFX 1LE8B 2BXYA 1GXQA 3G71I 4KITB 3ZCOA 5H6RA 2YU9J 3OYGA 4FTHA 4BE0A 2VBZA 3RYRA 3N4MA 1FEXA 3BOQA 4NB5A 1T98A 3UR3C 1WPKA 2ADUA 1O3QA 4L5EA 3HSFA 4UB6C 2WBMA 4BHPA 5HDGA 4NNJA 5TJJA 2M7AA 3ESWB 3HRSA 1IDZA 1WJBA 1ETKA 1XN7A 2ESHA 1MKMA 5D8LB 2WY7Q 3IWZA 1G6NA 3WE3A 4QTRA 1YW8A 2EWNA 2LP0A 2QQ8A 5ICCA 2STWA 2IS2A 3ZMUA 3S93A 3TW6A 4RB1A 2LOOA 4FX4A 3KP5A 1J2XA 2Y9YA 6PAXA 2V9PA 3WGHA 5GAHJ 3TKYA 4X1EA 1FY7A 2MA3A 3DKXA 2VBWA 3GFMA 4BQQA 5C4JJ 3U9GA 5L3FA 2X9DA 2IPQX 2R7UA 1R5ID 2HNHA 4FQGA 1CQTA 4WX9A 2DT6A 2RAEA 3GBGA 3HRMA 3OR2C 1X4OA 1ZG3A 4XOPA 3P9KA 3HPHA 2A69F 5FD6A 3PO3J 3HGGA 1OCOH 2V79A 4O6JA 2BOLA 5FKOA 1K6YA 1IUYA 3E6DA 1MBKA 4M6YA 2UXXA 5FKKA 1BC8C 3TP3A 3O6BB 4UV9A 4I09A 4RB2C 1W7PA 2EIJH 2IJLA 2NVYJ 2IBDA 4CCLA 4GYGA 3WHCA 3W2WA 1Z21A 3HTSB 3UNGC 4BQNA 4KNYA 3HOXJ 1SMTA 4IJAA 4KA4A 2K5CA 2M7BA 1SAXA 3BTIA 4LG0A 5IOZA 3DKYA 3K10A 2X6XA 3OIOA 1ZRFA 5E3NA 1BW5A 4BGDA 4M9XA 4E7SA 1ZQ3P 2M0MA 3GMEA 4XIDA 2DFEA 3HOSA 3ZR8X 1MSEC 2DTRA 5KNLA 4YEJA 3KYCB 1XSXA 2GIVA 3QU3A 2XPUA 5DD8A 1A36A 4DBQA 3L2WA 1W7PB 2ELJA 3H1CA 2QQAA 1YO5C 4PFPA 2ZJQF 3NRVA 5E18F 2M9HA 3I0TA 5BPDA 2BW3B 2G7HA 4M3EA 4M6XA 5L3CA 3LSMA 2ZJ2A 2CH0A 3HKZN 3DTIA 2CO5A 2KT0A 4Q4ZF 3QYEA 5B5EC 3EUKL 1FTTA 2H6BA 1X1AA 1QZZA 2ESNA 4KMUX 1V4RA 2E1NA 2H94A 2EIKH 2IGMA 2Z2SB 4JX6A 3K2AA 5M5XJ 1FNNA 4ITVA 4F7ZA 1YTYA 2XF7A 4XSZF 3KP2A 1W36D 1VQKI 4GRIA 2LBFA 2KHMA 3PL8A 2FE3A 5AONA 2LK2A 3CO6C 2PI0A 1RI7A 1ITYA 4RAZA 3IWFA 4A3CJ 2CFXA 3GF2A 1A04A 2JMWA 1YIOA 4I6ZA 4PJJA 1ZRCA 2V7FA 2K9MA 3HHHA 1Y1WJ 2D45A 3P9CA 2JPCA 2DMUA 3KFWX 1FIPA 2P4WA 4HPQA 3K4CA 2DMTA 1K78B 1OYYA 2LDUA 1JGGA 1GVJA 2I8DA 4RMNA 5J3LA 4IO9F 5J40A 2HR3A
chains in the Genus database with same CATH topology
3BJAA 4IHTA 1TQMA 5ICEA 2XAFA 4Q5SF 3JTGA 1RUOA 2QVOA 4EM2A 2XHKA 4OMZA 2K86A 3TO6A 4HAMA 3WTZA 4CICA 3WTYC 1FYLA 2ZMEB 4A0YA 3TDZC 4CYDA 5LGUA 1KA8A 4CXFA 5FGMA 1G3YA 1BOAA 3LWFA 5ICGA 3HRUA 2GXGA 1QO0D 4ENKA 2XAQA 3QOPA 3T1BA 2Z5UA 1TW2A 4Y17A 3GX4X 1LDJA 2E7XA 3CUQA 4K2EA 1YW7A 1IN7A 5LHIA 4ZYDA 5FO5A 1FBQA 2DO7A 5D5VB 5L3DA 1OYIA 5CVIA 2P5KA 3H3UA 2VODA 3FXRA 2KJBA 4CDGA 1WI9A 3KE2A 1BC7C 2FQ3A 3KCCA 3RKYA 2KJCA 2QENA 3FF5A 2PEXA 3G73A 3FZVA 2OZUA 1STZA 1OMIA 2VOOA 2VOPA 2DW4A 1QQIA 2CYYA 3F3XA 4RB0A 2B0LA 1XSDA 1RZ4A 1Z6TA 2XV4S 3E6MA 4MTEA 3WU1B 1YS7A 2HOEA 1MJ9A 4A12A 5LRSA 3ZMZA 3K1MA 4KICA 1O7FA 4HLXA 2EA4A 1ZG5A 3OOPA 4OOIA 4EGZA 3D5LA 5D5UB 1HKTA 5BMZA 4KMFA 4CHUA 3DF8A 3DXJF 3HSEA 1PP7U 1WWXA 2PBIA 2R3SA 3QPTA 5DCFA 5DD4A 1U78A 3VEPA 2Y75A 4LLNA 1YFHA 3I5UA 1SFUA 2XASA 4KIGA 4MEYF 1EH7A 2GA1A 2X0LA 1DDNA 2HGCA 4KFCA 2HTSA 2F5EA 4CGZA 3TQNA 1REPC 2VT3A 5LRRA 5IT3A 4Z2YA 1KGSA 1ZGJA 1KU3A 2W84A 1XGOA 3MFKA 5JHUA 2PG4A 4YFKF 1MDMA 3W6KB 1D8KA 3K1PA 3E3VA 4ZYGA 3RKWA 4B09A 3QP6A 1W7PD 2OD5A 2QBYB 1PDNC 2F5FA 1S29A 3LA3A 3R4KA 3BWGA 4FT8A 2HZTA 4KUMA 5HDKA 5H20A 4EJWA 1Z1DA 3K69A 4I02A 5K1YA 2EFPA 4R79A 4G8XA 3IKTA 4ZH4F 5D5WB 3F8FA 3WTTC 1QGPA 4OU0A 2BE5F 4KT5C 1FSHA 1YQAA 2BEOA 3B73A 1FLIA 2STTA 1DUXC 1ONVA 4WWCA 3K2ZA 4I01A 2M30A 2A6HF 2LSOA 3B02A 3VOEA 1L0OC 2ZBKA 4HOBA 3RKXA 5D8KB 4EJVA 4GO1A 2W24A 1Z05A 4KYWA 3VODA 2RC4A 4AWXB 2ZXJA 4AIHA 1R00A 1XMKA 2L01A 5E1ZB 1R1UA 1ZLKA 3F8BA 1Z6RA 2L4MA 3HHGA 4ASNA 1S8NA 1UB9A 1X3UA 4XBFA 2KKOA 5JVTA 2M87A 2IA1A 3E6BA 2OQGA 3ECOA 4UUVA 1OPCA 2AS5F 1ZLJA 2G7UA 3KEOA 2DAOA 3WG9A 3ZMSA 5CVUA 5A2QK 2GXBA 2FSWA 2EK5A 1ZHFA 3SZTA 3BJOA 3JSPA 3E5UA 2ZO4A 3KP4A 1BI0A 3RIRA 2BYVE 4HF2A 3LQRA 1U2WA 1E17A 1P6RA 2QBYA 2E7WA 2VC0A 5ED4A 3Q9SA 3K0LA 1BN5A 5LHGA 4KIBA 3IL2A 1ODDA 4HDUA 1P4AA 1Y0UA 1P4WA 3FMRA 2IVMA 3BROA 3T5XA 4GXOA 2V1DA 2DBBA 4U0YA 2Z9OA 1U6GA 2BBYA 2UWMA 3Q9VA 1P4XA 5ERIA 4WXCA 1FWZA 1RIOH 1P92A 2ZKZA 3LAJA 1B6AA 2O0YA 1J0RA 2YX4A 5BQTA 3VB2A 5DUKA 2VE8A 2VT2A 1G3WA 1T0FA 2YSRA 2QQBA 5DYMA 3SXYA 2QZ8A 1R23A 1GXPA 2NYXA 1RUNA 5CYVA 1BI2A 3JAMZ 3MZYA 2HFHA 1KU9A 5LLQA 3DFGA 2PMUA 4HX8A 3PQKA 1W4MA 3F22A 1MD0A 2HYFA 3T8RA 5LGTA 1QPMA 4OIPF 4OINF 1J7KA 1O3TA 2LF8A 1BIBA 3KP7A 1R5HA 2ELHA 4L9TA 2EFOA 1BI3A 4BXUA 3IRQA 2RN7A 5JFRA 2FNPA 2LKPA 4ZYEA 1J9IA 4L9VA 3ZQ7A 1R7JA 3T8TA 2J5OA 4HW0A 2VN2A 3EETA 1EH6A 5ILSA 3F72A 3TO7A 2PMHA 4EJOA 1ZRDA 1YLFA 4EM0B 1MJBA 3MEXA 4LMYA 2PN6A 2HKOA 5CVRA 3SHFA 4PGGA 2CG4A 3GUDA 1BBYA 1I27A 3S2WA 4BYYA 1ZARA 4P5OA 1ZH5A 2RGVA 2D1VA 2CQKA 4JBAA 3G3ZA 1B9MA 5H6QA 5K5RA 3EDPA 2ISYA 5A2QZ 2DK5A 4MQVA 1IXCA 3V8JA 5D4RA 5HVQC 2UXNA 3KP6A 1XD7A 1XDSA 1XCVA 1FSEA 5CVJA 3ZMDA 1OYWA 3L9FA 4MGRA 1KYZA 3E6CC 3QU6A 3U1DA 1JE8A 4XLPF 2CW0F 2DQLA 1I5ZA 4AD9A 1F5TA 1R36A 2L54A 1FP2A 4EJUA 1WQ2A 1B1BA 1TW3A 3C1DA 3LFKA 5HDNA 2O03A 1R58A 3R0AA 2ZNYA 4AVPA 2Q0OA 1FZPB 2YR2A 2XKPA 3JAMK 1T38A 3K1NA 4HYEA 2GWRA 2XKOA 4PZJA 3QPHA 1BI1A 3V4GA 4Q48A 4GGGA 2JRTA 4O5VA 2O3FA 4WXDA 1ZREA 2W25A 3COAC 2RDPA 1IXSB 2IA0A 1XB4A 4U0WA 4S05A 4I0BA 2EJRA 3DPTA 2D1HA 4YIFA 1P2FA 3HTUA 4I7HA 2EV0A 4UVBA 3R60A 3FHZA 2P7VB 3ML6A 3RI4A 2HDCA 3IC7A 5D5XB 5FLXZ 4DQ2A 2HQRA 2Y0MA 1USTA 5AIQA 4M74A 2IT0A 3L2CA 2Z33A 1SFEA 4S04A 4LLLA 3V7SA 2DLLA 3T0YA 1HBXG 5KVRA 3DP7A 1FYMA 3I59A 2ZNZA 2DQRA 3TOAA 3I58A 1LQ1A 3WGIA 3FM3A 1J5YA 3ERED 3MWMA 4BHBA 4LGWA 2MH9A 3L7WA 3EYYA 2PFBA 1U5TA 4LD5A 3KZYA 4HF1A 1G3SA 2HTJA 3ULQB 2VBYA 2V6CA 1ZGAA 4UNOA 2BV6A 4LK0F 3HYIA 2QYOA 5K5OA 1EH8A 1SMYF 2F2EA 5IT9Z 3M1EA 4FHTA 3BP8A 1UHWA 1IZ1A 2ETHA 2GAUA 1J59A 4IRHA 1MGTA 1I1SA 3LQQA 5AIPA 1WRJA 3H3ZA 2L02A 4N9HA 3F23A 3R0JA 4OIOF 3MCZA 1CF7A 1V3FA 3J80Z 3ELKA 3CLOA 2Z99A 3F21A 2KIUA 2YU3A 5HLGA 5L3GA 5JR3A 3GFJA 3WTVC 2FOKA 5LBQA 4WF2A 1L3LA 1U5TB 1QNTA 4ON0A 2AXLA 2FRHA 3QRFF 3RJPA 3K9TA 1R5GA 2PQ8A 1FC3A 2Q8KA 1R22A 2ACJA 1S3JA 4A0XA 4U88A 4NQWA 5BS6A 1R1VA 4QLCU 2HWVA 2HYGD 2KIMA 3F8MA 3EQLF 3TOBA 1O3SA 1S6LA 2QM3A 4OMYA 1G4DA 5HS9A 3C3WA 5J6XA 5EEGA 2A6EF 2DI3A 4A0ZA 4PGHA 2JZYA 4ZZDA 1IXRC 1U3EM 1O7LA 2XRNA 3F6OA 4FX0A 2FMLA 3BJ6A 3PFIA 4TV7A 2OU2A 4BHCA 3QP5A 1TTYA 2OQRA 4M71A 2A68F 2RVCA 3U2RA 1BM9A 3LA7A 2YPRA 5DEQA 4MQ9F 1AOYA 4L0ZB 2TDXA 1HW5A 1UHMA 2RNJA 4A6DA 1QZYA 3F6VA 4YFNF 3ZMTA 4LK1F 1E2XA 1OKRA 2QQ9A 3REOA 1D5VA 3RYPA 1IN6A 4L9JA 5D6FA 2EA2A 1BJAA 3KETA 5L3BA 1HXDA 3KZZA 2IW5A 2OZ6A 3DQVC 2L4AA 5KK1A 5J8CA 2FF4A 3OV8A 2P6TA 3PQJA 1IAWA 3GZ6A 2J5PA 4AIJA 3ABTA 5LEKA 2FA5A 2HS5A 2CSOA 1HW1A 3O2PE 4I98B 1CF7B 4MNUA 3NQOA 1GHCA 1YS6A 3H92A 2H09A 2NS0A 3RPUA 2O6GE 4KN7X 4G9YA 2MH2A 2ZFWA 2M45A 1UFMA 4CZZA 2EFQA 1SD7A 1XGSA 3SQNA 5E17F 4XSXF 3TGNA 2PJPA 2E1CA 2V1UA 2X4HA 1K78A 1I1GA 3FMSA 4A2UA 2XAGA 3L00A 1DPUA 5E8IA 1B59A 2UZKA 2WV0A 4HV6A 1JXSA 4A6EA 3ZN0A 2DU9A 5HLIA 1S7AA 2V1XA 5CJ9A 5HS7A 3CTAA 4M73A 3WTUC 3DPLC 3CUQC 2DT5A 1IW7F 2Z3YA 3GLXA 1OR7A 4KIFA 1DP7P 3E5XA 1ZN2A 4L18B 3LSTA 5BPIA 1KQ8A 2RQPA 3FMQA 5LGNA 4CO8A 3V8LA 3IKVA 2HEOA 3MQ0A 2L3DA 3WGGA 1HW2A 3WODF 3KP3A 2QLZA 3V8KA 2FXAA 1SD6A 5TRDA 1LVAA 3C7JA 2W85A 3FX3A 2GZWA 3J81Z 1HSTA 4XLNF 2O8XA 1K6OA 2MLGA 4IRGA 1YG2A 1NHAA 1T2KA 4U7BA 4LB5A 3HRTA 1R1TA 4P9UA 5ICFA 1W5SA 4ESBA 2R7DA 2ZCWA 4L5JA 2P8TA 1TNSA 3GWZA 4E70A 3E5QA 4IPAA 4ESJA 2JT1A 1Z7UA 5E20A 4EV0A 4RS8A 1J75A 2M8EA 4EJTA 3QAHA 4WK8F 4HF0A 2ZMEA 3WTXC 2MC3A 4BNCA 1TNTA 5DCMA 1HKSA 1IN5A 3GEZA 4IRIA 1FP1D 5DUIA 3CO7C 2XUBA 5E1XA 2FMYA 3BDDA 1PP8F 4B8XA 4I0AA 1F9NA 1HSJA 2RV8A 1WKMA 4UVCA 1SD5A 1LNWA 4L9NA 3JW4A 2C6YA 4YIIA 1HKQA 5DCMB 1C0WA 2FBIA 3WTSC 2VXZA 1FYKA 1IN8A 4RGSA 2COMA 3MZHA 1TQIA 4I2OA 4KDPA 1YW9A 1H0MA 4M9SA 4R8HA 3ISPA 3O3KA 2NNYA 1B9NA 1LB2A 2CWEA 1XGMA 1UCRA 3I59B 3KLNA 3I4PA 3M7GA 5D4SA 2A07F 2GQQA 1JHFA 1RNLA 4A5NA 2WC2A 4ZZLA 3F8CA 5HLHA 3R61A 3D0SA 1ZAOA 2IA2A 4YFXF 3KLOA 4RGRA 2H27A 3I64A 4QWQA 1XGNA 4HX4A 4RB3C 2HQNA 3GFIA 3CDHA 1D8JA 4RGXA 4P9FA 1U5TC 2FEZA 1WSUA 3V7RA 4HV5A 4MTDA 4ENNA 3LAPA 2BGCA 4UHTA 4WCGA 4EQQA 3M8EA 3ZPLA 3F8NA 1HQCA 1Q1HA 2A3SA 4HDVA 5F64A 4G7HF 4RAYA 1F1ZA 3FM5A 3GO5A 4N9IA 4HQEA 3EUHA 2P5LC 1T39A 1FBUA 3VFZA 2YX7A 4LFUA 1ZYRF 3BPVA 4Y15A 2JPBA 3GVAA 1VTNC 3V7CA 2F5CA 5HOOA 2EB7A 3KEQA 1TBXA 5FFZA 1KU2A 5DV5A 1O3RA 4EM1A 2XAHA 2MBFA 3ECHA 5EEHA 4JK1X 1FX7A 4LJZF 2K27A 3HUGA 1MDMB 2XGXA 3ROUA 1IRGA 2A61A 2IP2A 3FWEA 2WTEA 3FXQA 2QWWA 2Y48A 1D3YA 4PDKA 1H9GA 3M9AA 3DEUA 1ZG1A 1XMAA 5J8FA 2W57A 2K02A 1FOKA 3RPQA 5ILVA 2IRFG 4N0BA 3W6JB 2NAZA 2XAJA 4M9ZA 1XSVA 2VC1A 4HBLA 1BIAA 4G6DA 2P6SA 2A5YB 5K5QA 3DV8A 2FBHA 5LHHA 3HOTA 2FNAA 4HQMA 5ILUA 3BY6A 4L0YB 5HS8A 1AWCA 3IRRA 2P7CB 1XCBA 3WU0A 4P55A 4LG0B 3NEUA 2JTVA 2R7FA 1LDKB 3I54A 2KIFA 3RTRA 3TDUC 2NNNA 3M8FA 2EFWA 4JQFA 4G7OF 3GYHX 3BPXA 1H9TA 2K4JA 4LLGF 3I71A 2FBKA 2VE9A 5CVVA 2ISZA 4EVIA 2LF7A 1PUEE 3ZMVA 4R1HA 3GZ5A 4WXHA 4U0VA 1TQPA 1T6SA 1TLHB 2FU4A 5CLSA 5FB2A 1CGPA 4M72A 2NRAC 2M5WA 3R6SA 2OA4A 3CUQB 5FLXK 2F5DA 3GXOA 3HIFA 3LA2A 1SD4A 3ABUA 1KQ0A 1USSA 5D6EA 3WTWC 4IVNA 2XIGA 1IF1A 5E1WA 3P9IA 1FPQA 1F4KA 4GYIA 3E97A 5BOXA 3RDIA 3ZN1A 1QBJA 1FBSA 1LEAA 4U7DA 1G3TA 3C18A 5FFXA 4OIRF 4GCVA 3J80K 4EMSA 4YG2F 3N97A 2K7LA 2VONA 5IT9K 1ON1A 2LNBA 2QUFA 4IF4A 4DNCA 3I53A 5JI6A 3L09A 2CGPA 1LDDA 3SFZA 2VBXA 4BH9A 2DPDA 1B4AA 2EV6A 1W5TA 4EGYA 3IHUA 2KRFA 4LB6B 1SFXA 2JSCA 4NHJA 1XDUA 3TO9A 2OBPA 4ESFA 1K7AA 1Z9CA 4H0EA 4BAYA 2O61A 4ZYHA 3ZP5A 4XRFA 2H6CA 2Q2EA 4Q47A 4P96A 4HA8A 2GA2A 4ENJA 3SZPA 2P5VA 4D0PA 3JSOA 5LEJA 2OAZA 4G94A 1Z91A 5F1RA 2D2WA 1KQ9A 3WE2A 5F6FA 4PCQA 4HZFA 2DK8A 3CUOA 2MD5A 4UXNA 2EV5A 1MJAA 5L3EA 2RKHA 1KU7A 2G9WA 2V9VA 3JTHA 2EFNA 4L5IA 1FT9A 4KN4X 3MAJA 4IHSA 4A5MA 2K4BA 3HSRA 3P7NA 5FD5A 3EYIA 4BQAA 1LEBA 4G6QA 4UVAA 3GW2A 3BZ6A 1MZBA 2DFIA 1EV7A 4HX7A 2XVCA 2PLYA 1IRFA 4IXAA 1I6XA 3Q5FA 4AIKA 3FXUA 4G7ZF 3AAFA 2DPUA 2MLKA 4ENMA 2XROA 4UV8A 1K79A 4Y13A 5E8GA 4ETSA 2M1BA 4HLYA 4RGUA 1U8RA 1JGSA 1YYVA 1DPRA 1JHHA 1ON2A 1KYWA 3GFLA 3DKWA 1IN4A 5DDGA 4MHGA 2HKXA 4MEXF 1O57A 2WWYA 1S7OA 3J81K 1LJ9A 1ULYA 3CJNA 4OIQF 3J7AO 1GXQA 5H6RA 3N4MA 2VBZA 3RYRA 3BOQA 4NB5A 1T98A 2ADUA 1O3QA 3HSFA 4BHPA 5HDGA 5TJJA 3HRSA 1XN7A 2ESHA 1MKMA 5D8LB 3IWZA 3WE3A 1G6NA 1YW8A 2EWNA 5ICCA 2STWA 3ZMUA 4RB1A 4FX4A 3KP5A 1J2XA 6PAXA 3WGHA 3TKYA 1FY7A 2MA3A 2VBWA 3GFMA 3U9GA 5L3FA 2IPQX 4WX9A 3HRMA 1ZG3A 3P9KA 2A69F 5FD6A 4O6JA 2V79A 1IUYA 3E6DA 4M6YA 2UXXA 1BC8C 3O6BB 4UV9A 4I09A 4RB2C 1W7PA 2IJLA 4GYGA 3HTSB 4KNYA 1SMTA 4IJAA 4KA4A 1SAXA 4LG0A 1ZRFA 4M9XA 3HOSA 2DTRA 1XSXA 2GIVA 3QU3A 5DD8A 1W7PB 2QQAA 1YO5C 3NRVA 5E18F 3I0TA 5BPDA 2G7HA 4M6XA 5L3CA 2ZJ2A 2CO5A 4Q4ZF 2H6BA 2ESNA 1QZZA 4KMUX 1V4RA 2E1NA 2H94A 1FNNA 4F7ZA 1YTYA 4XSZF 3KP2A 2FE3A 5AONA 3CO6C 2PI0A 1RI7A 4RAZA 3IWFA 2CFXA 3GF2A 1A04A 1YIOA 1ZRCA 3HHHA 2D45A 3P9CA 2JPCA 3KFWX 2P4WA 1K78B 1OYYA 2LDUA 1GVJA 4O3MA 2HR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJA A;  4IHT A;  1TQM A;  5ICE A;  2XAF A;  4Q5S F;  3JTG A;  1RUO A;  2QVO A;  4EM2 A;  2XHK A;  4OMZ A;  2K86 A;  3TO6 A;  4HAM A;  3WTZ A;  4CIC A;  3WTY C;  1FYL A;  2ZME B;  4A0Y A;  3TDZ C;  4CYD A;  5LGU A;  1KA8 A;  4CXF A;  5FGM A;  1G3Y A;  1BOA A;  3LWF A;  5ICG A;  3HRU A;  2GXG A;  1QO0 D;  4ENK A;  2XAQ A;  3QOP A;  3T1B A;  2Z5U A;  1TW2 A;  4Y17 A;  3GX4 X;  1LDJ A;  2E7X A;  3CUQ A;  4K2E A;  1YW7 A;  1IN7 A;  5LHI A;  4ZYD A;  5FO5 A;  1FBQ A;  2DO7 A;  5D5V B;  5L3D A;  1OYI A;  5CVI A;  2P5K A;  3H3U A;  2VOD A;  3FXR A;  2KJB A;  4CDG A;  1WI9 A;  3KE2 A;  1BC7 C;  2FQ3 A;  3KCC A;  3RKY A;  2KJC A;  2QEN A;  3FF5 A;  2PEX A;  3G73 A;  3FZV A;  2OZU A;  1STZ A;  1OMI A;  2VOO A;  2VOP A;  2DW4 A;  1QQI A;  2CYY A;  3F3X A;  4RB0 A;  2B0L A;  1XSD A;  1RZ4 A;  1Z6T A;  2XV4 S;  3E6M A;  4MTE A;  3WU1 B;  1YS7 A;  2HOE A;  1MJ9 A;  4A12 A;  5LRS A;  3ZMZ A;  3K1M A;  4KIC A;  1O7F A;  4HLX A;  2EA4 A;  1ZG5 A;  3OOP A;  4OOI A;  4EGZ A;  3D5L A;  5D5U B;  1HKT A;  5BMZ A;  4KMF A;  4CHU A;  3DF8 A;  3DXJ F;  3HSE A;  1PP7 U;  1WWX A;  2PBI A;  2R3S A;  3QPT A;  5DCF A;  5DD4 A;  1U78 A;  3VEP A;  2Y75 A;  4LLN A;  1YFH A;  3I5U A;  1SFU A;  2XAS A;  4KIG A;  4MEY F;  1EH7 A;  2GA1 A;  2X0L A;  1DDN A;  2HGC A;  4KFC A;  2HTS A;  2F5E A;  4CGZ A;  3TQN A;  1REP C;  2VT3 A;  5LRR A;  5IT3 A;  4Z2Y A;  1KGS A;  1ZGJ A;  1KU3 A;  2W84 A;  1XGO A;  3MFK A;  5JHU A;  2PG4 A;  4YFK F;  1MDM A;  3W6K B;  1D8K A;  3K1P A;  3E3V A;  4ZYG A;  3RKW A;  4B09 A;  3QP6 A;  1W7P D;  2OD5 A;  2QBY B;  1PDN C;  2F5F A;  1S29 A;  3LA3 A;  3R4K A;  3BWG A;  4FT8 A;  2HZT A;  4KUM A;  5HDK A;  5H20 A;  4EJW A;  1Z1D A;  3K69 A;  4I02 A;  5K1Y A;  2EFP A;  4R79 A;  4G8X A;  3IKT A;  4ZH4 F;  5D5W B;  3F8F A;  3WTT C;  1QGP A;  4OU0 A;  2BE5 F;  4KT5 C;  1FSH A;  1YQA A;  2BEO A;  3B73 A;  1FLI A;  2STT A;  1DUX C;  1ONV A;  4WWC A;  3K2Z A;  4I01 A;  2M30 A;  2A6H F;  2LSO A;  3B02 A;  3VOE A;  1L0O C;  2ZBK A;  4HOB A;  3RKX A;  5D8K B;  4EJV A;  4GO1 A;  2W24 A;  1Z05 A;  4KYW A;  3VOD A;  2RC4 A;  4AWX B;  2ZXJ A;  4AIH A;  1R00 A;  1XMK A;  2L01 A;  5E1Z B;  1R1U A;  1ZLK A;  3F8B A;  1Z6R A;  2L4M A;  3HHG A;  4ASN A;  1S8N A;  1UB9 A;  1X3U A;  4XBF A;  2KKO A;  5JVT A;  2M87 A;  2IA1 A;  3E6B A;  2OQG A;  3ECO A;  4UUV A;  1OPC A;  2AS5 F;  1ZLJ A;  2G7U A;  3KEO A;  2DAO A;  3WG9 A;  3ZMS A;  5CVU A;  5A2Q K;  2GXB A;  2FSW A;  2EK5 A;  1ZHF A;  3SZT A;  3BJO A;  3JSP A;  3E5U A;  2ZO4 A;  3KP4 A;  1BI0 A;  3RIR A;  2BYV E;  4HF2 A;  3LQR A;  1U2W A;  1E17 A;  1P6R A;  2QBY A;  2E7W A;  2VC0 A;  5ED4 A;  3Q9S A;  3K0L A;  1BN5 A;  5LHG A;  4KIB A;  3IL2 A;  1ODD A;  4HDU A;  1P4A A;  1Y0U A;  1P4W A;  3FMR A;  2IVM A;  3BRO A;  3T5X A;  4GXO A;  2V1D A;  2DBB A;  4U0Y A;  2Z9O A;  1U6G A;  2BBY A;  2UWM A;  3Q9V A;  1P4X A;  5ERI A;  4WXC A;  1FWZ A;  1RIO H;  1P92 A;  2ZKZ A;  3LAJ A;  1B6A A;  2O0Y A;  1J0R A;  2YX4 A;  5BQT A;  3VB2 A;  5DUK A;  2VE8 A;  2VT2 A;  1G3W A;  1T0F A;  2YSR A;  2QQB A;  5DYM A;  3SXY A;  2QZ8 A;  1R23 A;  1GXP A;  2NYX A;  1RUN A;  5CYV A;  1BI2 A;  3JAM Z;  3MZY A;  2HFH A;  1KU9 A;  5LLQ A;  3DFG A;  2PMU A;  4HX8 A;  3PQK A;  1W4M A;  3F22 A;  1MD0 A;  2HYF A;  3T8R A;  5LGT A;  1QPM A;  4OIP F;  4OIN F;  1J7K A;  1O3T A;  2LF8 A;  1BIB A;  3KP7 A;  1R5H A;  2ELH A;  4L9T A;  2EFO A;  1BI3 A;  4BXU A;  3IRQ A;  2RN7 A;  5JFR A;  2FNP A;  2LKP A;  4ZYE A;  1J9I A;  4L9V A;  3ZQ7 A;  1R7J A;  3T8T A;  2J5O A;  4HW0 A;  2VN2 A;  3EET A;  1EH6 A;  5ILS A;  3F72 A;  3TO7 A;  2PMH A;  4EJO A;  1ZRD A;  1YLF A;  4EM0 B;  1MJB A;  3MEX A;  4LMY A;  2PN6 A;  2HKO A;  5CVR A;  3SHF A;  4PGG A;  2CG4 A;  3GUD A;  1BBY A;  1I27 A;  3S2W A;  4BYY A;  1ZAR A;  4P5O A;  1ZH5 A;  2RGV A;  2D1V A;  2CQK A;  4JBA A;  3G3Z A;  1B9M A;  5H6Q A;  5K5R A;  3EDP A;  2ISY A;  5A2Q Z;  2DK5 A;  4MQV A;  1IXC A;  3V8J A;  5D4R A;  5HVQ C;  2UXN A;  3KP6 A;  1XD7 A;  1XDS A;  1XCV A;  1FSE A;  5CVJ A;  3ZMD A;  1OYW A;  3L9F A;  4MGR A;  1KYZ A;  3E6C C;  3QU6 A;  3U1D A;  1JE8 A;  4XLP F;  2CW0 F;  2DQL A;  1I5Z A;  4AD9 A;  1F5T A;  1R36 A;  2L54 A;  1FP2 A;  4EJU A;  1WQ2 A;  1B1B A;  1TW3 A;  3C1D A;  3LFK A;  5HDN A;  2O03 A;  1R58 A;  3R0A A;  2ZNY A;  4AVP A;  2Q0O A;  1FZP B;  2YR2 A;  2XKP A;  3JAM K;  1T38 A;  3K1N A;  4HYE A;  2GWR A;  2XKO A;  4PZJ A;  3QPH A;  1BI1 A;  3V4G A;  4Q48 A;  4GGG A;  2JRT A;  4O5V A;  2O3F A;  4WXD A;  1ZRE A;  2W25 A;  3COA C;  2RDP A;  1IXS B;  2IA0 A;  1XB4 A;  4U0W A;  4S05 A;  4I0B A;  2EJR A;  3DPT A;  2D1H A;  4YIF A;  1P2F A;  3HTU A;  4I7H A;  2EV0 A;  4UVB A;  3R60 A;  3FHZ A;  2P7V B;  3ML6 A;  3RI4 A;  2HDC A;  3IC7 A;  5D5X B;  5FLX Z;  4DQ2 A;  2HQR A;  2Y0M A;  1UST A;  5AIQ A;  4M74 A;  2IT0 A;  3L2C A;  2Z33 A;  1SFE A;  4S04 A;  4LLL A;  3V7S A;  2DLL A;  3T0Y A;  1HBX G;  5KVR A;  3DP7 A;  1FYM A;  3I59 A;  2ZNZ A;  2DQR A;  3TOA A;  3I58 A;  1LQ1 A;  3WGI A;  3FM3 A;  1J5Y A;  3ERE D;  3MWM A;  4BHB A;  4LGW A;  2MH9 A;  3L7W A;  3EYY A;  2PFB A;  1U5T A;  4LD5 A;  3KZY A;  4HF1 A;  1G3S A;  2HTJ A;  3ULQ B;  2VBY A;  2V6C A;  1ZGA A;  4UNO A;  2BV6 A;  4LK0 F;  3HYI A;  2QYO A;  5K5O A;  1EH8 A;  1SMY F;  2F2E A;  5IT9 Z;  3M1E A;  4FHT A;  3BP8 A;  1UHW A;  1IZ1 A;  2ETH A;  2GAU A;  1J59 A;  4IRH A;  1MGT A;  1I1S A;  3LQQ A;  5AIP A;  1WRJ A;  3H3Z A;  2L02 A;  4N9H A;  3F23 A;  3R0J A;  4OIO F;  3MCZ A;  1CF7 A;  1V3F A;  3J80 Z;  3ELK A;  3CLO A;  2Z99 A;  3F21 A;  2KIU A;  2YU3 A;  5HLG A;  5L3G A;  5JR3 A;  3GFJ A;  3WTV C;  2FOK A;  5LBQ A;  4WF2 A;  1L3L A;  1U5T B;  1QNT A;  4ON0 A;  2AXL A;  2FRH A;  3QRF F;  3RJP A;  3K9T A;  1R5G A;  2PQ8 A;  1FC3 A;  2Q8K A;  1R22 A;  2ACJ A;  1S3J A;  4A0X A;  4U88 A;  4NQW A;  5BS6 A;  1R1V A;  4QLC U;  2HWV A;  2HYG D;  2KIM A;  3F8M A;  3EQL F;  3TOB A;  1O3S A;  1S6L A;  2QM3 A;  4OMY A;  1G4D A;  5HS9 A;  3C3W A;  5J6X A;  5EEG A;  2A6E F;  2DI3 A;  4A0Z A;  4PGH A;  2JZY A;  4ZZD A;  1IXR C;  1U3E M;  1O7L A;  2XRN A;  3F6O A;  4FX0 A;  2FML A;  3BJ6 A;  3PFI A;  4TV7 A;  2OU2 A;  4BHC A;  3QP5 A;  1TTY A;  2OQR A;  4M71 A;  2A68 F;  2RVC A;  3U2R A;  1BM9 A;  3LA7 A;  2YPR A;  5DEQ A;  4MQ9 F;  1AOY A;  4L0Z B;  2TDX A;  1HW5 A;  1UHM A;  2RNJ A;  4A6D A;  1QZY A;  3F6V A;  4YFN F;  3ZMT A;  4LK1 F;  1E2X A;  1OKR A;  2QQ9 A;  3REO A;  1D5V A;  3RYP A;  1IN6 A;  4L9J A;  5D6F A;  2EA2 A;  1BJA A;  3KET A;  5L3B A;  1HXD A;  3KZZ A;  2IW5 A;  2OZ6 A;  3DQV C;  2L4A A;  5KK1 A;  5J8C A;  2FF4 A;  3OV8 A;  2P6T A;  3PQJ A;  1IAW A;  3GZ6 A;  2J5P A;  4AIJ A;  3ABT A;  5LEK A;  2FA5 A;  2HS5 A;  2CSO A;  1HW1 A;  3O2P E;  4I98 B;  1CF7 B;  4MNU A;  3NQO A;  1GHC A;  1YS6 A;  3H92 A;  2H09 A;  2NS0 A;  3RPU A;  2O6G E;  4KN7 X;  4G9Y A;  2MH2 A;  2ZFW A;  2M45 A;  1UFM A;  4CZZ A;  2EFQ A;  1SD7 A;  1XGS A;  3SQN A;  5E17 F;  4XSX F;  3TGN A;  2PJP A;  2E1C A;  2V1U A;  2X4H A;  1K78 A;  1I1G A;  3FMS A;  4A2U A;  2XAG A;  3L00 A;  1DPU A;  5E8I A;  1B59 A;  2UZK A;  2WV0 A;  4HV6 A;  1JXS A;  4A6E A;  3ZN0 A;  2DU9 A;  5HLI A;  1S7A A;  2V1X A;  5CJ9 A;  5HS7 A;  3CTA A;  4M73 A;  3WTU C;  3DPL C;  3CUQ C;  2DT5 A;  1IW7 F;  2Z3Y A;  3GLX A;  1OR7 A;  4KIF A;  1DP7 P;  3E5X A;  1ZN2 A;  4L18 B;  3LST A;  5BPI A;  1KQ8 A;  2RQP A;  3FMQ A;  5LGN A;  4CO8 A;  3V8L A;  3IKV A;  2HEO A;  3MQ0 A;  2L3D A;  3WGG A;  1HW2 A;  3WOD F;  3KP3 A;  2QLZ A;  3V8K A;  2FXA A;  1SD6 A;  5TRD A;  1LVA A;  3C7J A;  2W85 A;  3FX3 A;  2GZW A;  3J81 Z;  1HST A;  4XLN F;  2O8X A;  1K6O A;  2MLG A;  4IRG A;  1YG2 A;  1NHA A;  1T2K A;  4U7B A;  4LB5 A;  3HRT A;  1R1T A;  4P9U A;  5ICF A;  1W5S A;  4ESB A;  2R7D A;  2ZCW A;  4L5J A;  2P8T A;  1TNS A;  3GWZ A;  4E70 A;  3E5Q A;  4IPA A;  4ESJ A;  2JT1 A;  1Z7U A;  5E20 A;  4EV0 A;  4RS8 A;  1J75 A;  2M8E A;  4EJT A;  3QAH A;  4WK8 F;  4HF0 A;  2ZME A;  3WTX C;  2MC3 A;  4BNC A;  1TNT A;  5DCM A;  1HKS A;  1IN5 A;  3GEZ A;  4IRI A;  1FP1 D;  5DUI A;  3CO7 C;  2XUB A;  5E1X A;  2FMY A;  3BDD A;  1PP8 F;  4B8X A;  4I0A A;  1F9N A;  1HSJ A;  2RV8 A;  1WKM A;  4UVC A;  1SD5 A;  1LNW A;  4L9N A;  3JW4 A;  2C6Y A;  4YII A;  1HKQ A;  5DCM B;  1C0W A;  2FBI A;  3WTS C;  2VXZ A;  1FYK A;  1IN8 A;  4RGS A;  2COM A;  3MZH A;  1TQI A;  4I2O A;  4KDP A;  1YW9 A;  1H0M A;  4M9S A;  4R8H A;  3ISP A;  3O3K A;  2NNY A;  1B9N A;  1LB2 A;  2CWE A;  1XGM A;  1UCR A;  3I59 B;  3KLN A;  3I4P A;  3M7G A;  5D4S A;  2A07 F;  2GQQ A;  1JHF A;  1RNL A;  4A5N A;  2WC2 A;  4ZZL A;  3F8C A;  5HLH A;  3R61 A;  3D0S A;  1ZAO A;  2IA2 A;  4YFX F;  3KLO A;  4RGR A;  2H27 A;  3I64 A;  4QWQ A;  1XGN A;  4HX4 A;  4RB3 C;  2HQN A;  3GFI A;  3CDH A;  1D8J A;  4RGX A;  4P9F A;  1U5T C;  2FEZ A;  1WSU A;  3V7R A;  4HV5 A;  4MTD A;  4ENN A;  3LAP A;  2BGC A;  4UHT A;  4WCG A;  4EQQ A;  3M8E A;  3ZPL A;  3F8N A;  1HQC A;  1Q1H A;  2A3S A;  4HDV A;  5F64 A;  4G7H F;  4RAY A;  1F1Z A;  3FM5 A;  3GO5 A;  4N9I A;  4HQE A;  3EUH A;  2P5L C;  1T39 A;  1FBU A;  3VFZ A;  2YX7 A;  4LFU A;  1ZYR F;  3BPV A;  4Y15 A;  2JPB A;  3GVA A;  1VTN C;  3V7C A;  2F5C A;  5HOO A;  2EB7 A;  3KEQ A;  1TBX A;  5FFZ A;  1KU2 A;  5DV5 A;  1O3R A;  4EM1 A;  2XAH A;  2MBF A;  3ECH A;  5EEH A;  4JK1 X;  1FX7 A;  4LJZ F;  2K27 A;  3HUG A;  1MDM B;  2XGX A;  3ROU A;  1IRG A;  2A61 A;  2IP2 A;  3FWE A;  2WTE A;  3FXQ A;  2QWW A;  2Y48 A;  1D3Y A;  4PDK A;  1H9G A;  3M9A A;  3DEU A;  1ZG1 A;  1XMA A;  5J8F A;  2W57 A;  2K02 A;  1FOK A;  3RPQ A;  5ILV A;  2IRF G;  4N0B A;  3W6J B;  2NAZ A;  2XAJ A;  4M9Z A;  1XSV A;  2VC1 A;  4HBL A;  1BIA A;  4G6D A;  2P6S A;  2A5Y B;  5K5Q A;  3DV8 A;  2FBH A;  5LHH A;  3HOT A;  2FNA A;  4HQM A;  5ILU A;  3BY6 A;  4L0Y B;  5HS8 A;  1AWC A;  3IRR A;  2P7C B;  1XCB A;  3WU0 A;  4P55 A;  4LG0 B;  3NEU A;  2JTV A;  2R7F A;  1LDK B;  3I54 A;  2KIF A;  3RTR A;  3TDU C;  2NNN A;  3M8F A;  2EFW A;  4JQF A;  4G7O F;  3GYH X;  3BPX A;  1H9T A;  2K4J A;  4LLG F;  3I71 A;  2FBK A;  2VE9 A;  5CVV A;  2ISZ A;  4EVI A;  2LF7 A;  1PUE E;  3ZMV A;  4R1H A;  3GZ5 A;  4WXH A;  4U0V A;  1TQP A;  1T6S A;  1TLH B;  2FU4 A;  5CLS A;  5FB2 A;  1CGP A;  4M72 A;  2NRA C;  2M5W A;  3R6S A;  2OA4 A;  3CUQ B;  5FLX K;  2F5D A;  3GXO A;  3HIF A;  3LA2 A;  1SD4 A;  3ABU A;  1KQ0 A;  1USS A;  5D6E A;  3WTW C;  4IVN A;  2XIG A;  1IF1 A;  5E1W A;  3P9I A;  1FPQ A;  1F4K A;  4GYI A;  3E97 A;  5BOX A;  3RDI A;  3ZN1 A;  1QBJ A;  1FBS A;  1LEA A;  4U7D A;  1G3T A;  3C18 A;  5FFX A;  4OIR F;  4GCV A;  3J80 K;  4EMS A;  4YG2 F;  3N97 A;  2K7L A;  2VON A;  5IT9 K;  1ON1 A;  2LNB A;  2QUF A;  4IF4 A;  4DNC A;  3I53 A;  5JI6 A;  3L09 A;  2CGP A;  1LDD A;  3SFZ A;  2VBX A;  4BH9 A;  2DPD A;  1B4A A;  2EV6 A;  1W5T A;  4EGY A;  3IHU A;  2KRF A;  4LB6 B;  1SFX A;  2JSC A;  4NHJ A;  1XDU A;  3TO9 A;  2OBP A;  4ESF A;  1K7A A;  1Z9C A;  4H0E A;  4BAY A;  2O61 A;  4ZYH A;  3ZP5 A;  4XRF A;  2H6C A;  2Q2E A;  4Q47 A;  4P96 A;  4HA8 A;  2GA2 A;  4ENJ A;  3SZP A;  2P5V A;  4D0P A;  3JSO A;  5LEJ A;  2OAZ A;  4G94 A;  1Z91 A;  5F1R A;  2D2W A;  1KQ9 A;  3WE2 A;  5F6F A;  4PCQ A;  4HZF A;  2DK8 A;  3CUO A;  2MD5 A;  4UXN A;  2EV5 A;  1MJA A;  5L3E A;  2RKH A;  1KU7 A;  2G9W A;  2V9V A;  3JTH A;  2EFN A;  4L5I A;  1FT9 A;  4KN4 X;  3MAJ A;  4IHS A;  4A5M A;  2K4B A;  3HSR A;  3P7N A;  5FD5 A;  3EYI A;  4BQA A;  1LEB A;  4G6Q A;  4UVA A;  3GW2 A;  3BZ6 A;  1MZB A;  2DFI A;  1EV7 A;  4HX7 A;  2XVC A;  2PLY A;  1IRF A;  4IXA A;  1I6X A;  3Q5F A;  4AIK A;  3FXU A;  4G7Z F;  3AAF A;  2DPU A;  2MLK A;  4ENM A;  2XRO A;  4UV8 A;  1K79 A;  4Y13 A;  5E8G A;  4ETS A;  2M1B A;  4HLY A;  4RGU A;  1U8R A;  1JGS A;  1YYV A;  1DPR A;  1JHH A;  1ON2 A;  1KYW A;  3GFL A;  3DKW A;  1IN4 A;  5DDG A;  4MHG A;  2HKX A;  4MEX F;  1O57 A;  2WWY A;  1S7O A;  3J81 K;  1LJ9 A;  1ULY A;  3CJN A;  4OIQ F;  3J7A O;  1GXQ A;  5H6R A;  3N4M A;  2VBZ A;  3RYR A;  3BOQ A;  4NB5 A;  1T98 A;  2ADU A;  1O3Q A;  3HSF A;  4BHP A;  5HDG A;  5TJJ A;  3HRS A;  1XN7 A;  2ESH A;  1MKM A;  5D8L B;  3IWZ A;  3WE3 A;  1G6N A;  1YW8 A;  2EWN A;  5ICC A;  2STW A;  3ZMU A;  4RB1 A;  4FX4 A;  3KP5 A;  1J2X A;  6PAX A;  3WGH A;  3TKY A;  1FY7 A;  2MA3 A;  2VBW A;  3GFM A;  3U9G A;  5L3F A;  2IPQ X;  4WX9 A;  3HRM A;  1ZG3 A;  3P9K A;  2A69 F;  5FD6 A;  4O6J A;  2V79 A;  1IUY A;  3E6D A;  4M6Y A;  2UXX A;  1BC8 C;  3O6B B;  4UV9 A;  4I09 A;  4RB2 C;  1W7P A;  2IJL A;  4GYG A;  3HTS B;  4KNY A;  1SMT A;  4IJA A;  4KA4 A;  1SAX A;  4LG0 A;  1ZRF A;  4M9X A;  3HOS A;  2DTR A;  1XSX A;  2GIV A;  3QU3 A;  5DD8 A;  1W7P B;  2QQA A;  1YO5 C;  3NRV A;  5E18 F;  3I0T A;  5BPD A;  2G7H A;  4M6X A;  5L3C A;  2ZJ2 A;  2CO5 A;  4Q4Z F;  2H6B A;  2ESN A;  1QZZ A;  4KMU X;  1V4R A;  2E1N A;  2H94 A;  1FNN A;  4F7Z A;  1YTY A;  4XSZ F;  3KP2 A;  2FE3 A;  5AON A;  3CO6 C;  2PI0 A;  1RI7 A;  4RAZ A;  3IWF A;  2CFX A;  3GF2 A;  1A04 A;  1YIO A;  1ZRC A;  3HHH A;  2D45 A;  3P9C A;  2JPC A;  3KFW X;  2P4W A;  1K78 B;  1OYY A;  2LDU A;  1GVJ A;  4O3M A;  2HR3 A; 
#chains in the Genus database with same CATH topology
 2QKL B;  5EG0 A;  3S3N A;  4BAC A;  5TGT A;  3BJA A;  4IHT A;  1TQM A;  2OF7 A;  5ICE A;  2XAF A;  4DYC A;  1D1B A;  3CCR I;  4Q5S F;  2DFF A;  5GAD J;  3JTG A;  2L5Q A;  1RUO A;  4CCM A;  2QVO A;  3PNT A;  4ZTF A;  2HOS A;  1HC8 A;  4EM2 A;  2HU9 A;  1ZTR A;  2XHK A;  4OMZ A;  5KAI C;  2K86 A;  1JT0 A;  3TO6 A;  4HAM A;  2GM4 A;  4XN3 A;  3WTZ A;  4IOA F;  3JRE A;  4CIC A;  1VQ5 I;  1X1B A;  2ZC2 A;  1VQ4 I;  2HVS A;  3MKL A;  4HST A;  3WTY C;  4A3M J;  1FYL A;  2DJI A;  2G0E A;  1P7J A;  2ZME B;  4A0Y A;  3TDZ C;  4CYD A;  3DWL E;  5LGU A;  4CCK A;  1KA8 A;  4CXF A;  3JR9 A;  5FGM A;  1G3Y A;  1BOA A;  3LWF A;  5ICG A;  3HRU A;  1YX5 A;  2GXG A;  3LSI A;  3H9Q A;  1QO0 D;  3AG1 H;  3U21 A;  4II3 A;  2MFZ A;  4ENK A;  2XAQ A;  3QOP A;  3T1B A;  2Z5U A;  1X4P A;  1TW2 A;  4Y17 A;  3GX4 X;  1LDJ A;  2E7X A;  2HQA A;  1T0F C;  3CUQ A;  2F6C A;  4K2E A;  1VQ8 I;  3QQA A;  1OIS A;  4EEF G;  3D5R C;  4E7J A;  1YW7 A;  4G12 A;  1IN7 A;  1JT6 A;  5LHI A;  4ZYD A;  1YE9 A;  1FBQ A;  4I99 C;  5FO5 A;  2DO7 A;  2H8W A;  3ABM H;  4PJL A;  5D5V B;  5L3D A;  1MW7 A;  1OYI A;  5CVI A;  1V5E A;  2P5K A;  3H3U A;  4IOC F;  2I5U A;  2VOD A;  4BU2 A;  5C4X J;  3FXR A;  2OJE D;  2KJB A;  1V5F A;  4CDG A;  2LTP A;  3FHN A;  1WI9 A;  3KE2 A;  5C44 J;  1BC7 C;  2FQ3 A;  1K83 J;  3HXL A;  4XRM A;  5F1J A;  3KCC A;  3RKY A;  2KJC A;  2QEN A;  2DN0 A;  4V19 K;  3CF5 F;  3FF5 A;  2LR8 A;  3AG3 H;  2PEX A;  3G73 A;  3FZV A;  1RET A;  2R7X A;  2B7E A;  2E19 A;  2OZU A;  1STZ A;  1OMI A;  2JA6 J;  2VOO A;  2ZXI A;  3G4S I;  1B8I B;  4C3H J;  4XRS G;  2DW4 A;  2VOP A;  1QQI A;  2CYY A;  4BDZ A;  1Y8R B;  2ME6 A;  2B63 J;  4M3B A;  1D0Y A;  4HRI A;  2LG4 A;  3F3X A;  2R7S A;  2ZSH B;  4RB0 A;  3IH3 A;  3W2V A;  3WG7 H;  1J09 A;  2B0L A;  2XB5 A;  1XSD A;  1RZ4 A;  1Z6T A;  2XV4 S;  3E6M A;  4MTE A;  3WU1 B;  4GFB A;  1YS7 A;  2IGO A;  4HNV A;  2HOE A;  1RC9 A;  3ZOB A;  1YIT I;  1MJ9 A;  3OYI A;  4A12 A;  5LRS A;  3VDX A;  4M3D A;  4ZDP A;  2K9S A;  2K9Q A;  5FKL A;  3ZMZ A;  1Y56 A;  3K1M A;  4KIC A;  1O7F A;  1K4T A;  2Y30 A;  4HLX A;  2EA4 A;  2W7N A;  1ZG5 A;  3OOP A;  3JRD A;  2M8G X;  4OOI A;  4EGZ A;  3D5L A;  5D5U B;  1RR8 C;  1HKT A;  1LPQ A;  4BL0 B;  5BMZ A;  4KMF A;  2CFO A;  1FOY A;  1LVK A;  2NVU B;  4CHU A;  4FAS D;  3DF8 A;  3DXJ F;  3HSE A;  1PP7 U;  2PMZ N;  1PUF B;  1WWX A;  4IHX A;  2PBI A;  2R3S A;  3QPT A;  2XSJ C;  5DCF A;  2ID6 A;  5DD4 A;  1U78 A;  3VEP A;  2Y75 A;  2WAE A;  4II2 A;  4LLN A;  1YFH A;  3M4O J;  3TBI A;  2JA5 J;  4MIM A;  3OYB A;  3HL2 A;  2R7R A;  3I5U A;  4FE4 A;  4HSR A;  1SFU A;  3JRA A;  1Z3Y A;  2X1D A;  2LRE A;  2XAS A;  4KIG A;  3H3V K;  4MEY F;  1EH7 A;  1R6R A;  2WAQ N;  2GA1 A;  5IP7 J;  4LG3 A;  2X51 A;  2X0L A;  3L2Q A;  4JX4 A;  1DDN A;  2HGC A;  2NS7 A;  3JRF A;  2VQL A;  4KFC A;  1ERD A;  3OSG A;  1OFC X;  2HTS A;  2I10 A;  4W1U A;  2MYS A;  2KZG A;  2F5E A;  4CGZ A;  3TQN A;  2BXZ A;  1REP C;  2VT3 A;  1FMW A;  2DOD A;  5LRR A;  5IT3 A;  4Z2Y A;  3H9J A;  5EZG A;  1KGS A;  1ZGJ A;  1KU3 A;  2W84 A;  1XGO A;  4NC6 A;  1MBF A;  1R49 A;  3FXK A;  3MFK A;  3PUF A;  5IPA A;  5JHU A;  3L2U A;  2PG4 A;  5K7Z A;  3FXO A;  4YFK F;  3KX2 A;  3NWS A;  3BR5 A;  3TMO A;  1MDM A;  3W6K B;  1WH5 A;  2E5Z A;  1D8K A;  3K1P A;  2P0W A;  3E3V A;  3AL0 C;  2E60 A;  4ZYG A;  3RKW A;  2VKE A;  4B09 A;  1ETO A;  2O9L A;  3QP6 A;  1W7P D;  2ID3 A;  2OD5 A;  2DMN A;  4PK4 A;  3A2K A;  3BR3 A;  2H8R A;  2HOA A;  2QBY B;  4PJM A;  2F5F A;  1PDN C;  1S29 A;  2Y0S N;  3I56 I;  1YX3 A;  3LA3 A;  1GUU A;  3CF2 A;  3R4K A;  3BWG A;  4FT8 A;  4BJT A;  2HZT A;  1DU0 A;  1FIA A;  4KUM A;  5HDK A;  5H20 A;  2QSH X;  4MFE A;  1Z1D A;  4EJW A;  2X6O A;  1UZC A;  3K69 A;  3HJE A;  1HF0 A;  5M3F J;  4I02 A;  5K1Y A;  2ECB A;  1XTA A;  2EFP A;  4R79 A;  4G8X A;  3IKT A;  3JRH A;  2W00 A;  5EGO B;  2EIN H;  2N8G A;  3D5S C;  4ZH4 F;  4QPQ A;  5D5W B;  3F8F A;  3WTT C;  1NG7 A;  1QGP A;  3FIW A;  4OU0 A;  5IP9 J;  4JOM A;  2BE5 F;  2DMP A;  4KT5 C;  1FSH A;  2QSG X;  5DS9 A;  1QZE A;  1BW6 A;  5IYC J;  2GIZ A;  1YQA A;  3FKI J;  2V4J C;  2DOF A;  1AHD P;  2BEO A;  3B73 A;  2VQH A;  1FLI A;  2STT A;  3GCM A;  3PJR A;  1DUX C;  1ONV A;  1QHG A;  4WWC A;  1MBE A;  3K2Z A;  3KIO A;  2VB6 A;  2R93 J;  4I01 A;  5J1Y A;  2M30 A;  2A6H F;  3S3M A;  3HM5 A;  2LSO A;  3LSR A;  3B02 A;  2E5N A;  3VOE A;  4KT6 A;  1L0O C;  2ZBK A;  3FXM A;  4HOB A;  3RKX A;  5D8K B;  2WB1 N;  4EJV A;  4GO1 A;  1BOB A;  2W24 A;  1Z05 A;  4KYW A;  1D1C A;  2WAD A;  3AG2 H;  3HGY A;  5DM6 F;  3AFH A;  3VOD A;  1KON A;  2RC4 A;  1ZKG A;  4AWX B;  1V5G A;  1X58 A;  3S2D J;  2ZXJ A;  2LH9 A;  1R00 A;  4AIH A;  3OYM A;  2X6W A;  1XMK A;  2L01 A;  4B47 A;  3BTC A;  5E1Z B;  1R1U A;  1U8B A;  1ZLK A;  4YRV A;  4FCY A;  1BL0 A;  3F8B A;  4CCO A;  1Z6R A;  2L4M A;  4CSW A;  2OCC H;  3MVP A;  3HHG A;  3SFI A;  4ASN A;  3M07 A;  3S1M J;  1UB9 A;  1S8N A;  1X3U A;  2O7O A;  2KKO A;  4XBF A;  5JVT A;  2M87 A;  3LNQ A;  2IA1 A;  1SVM A;  3E6B A;  2V6E A;  3PNY A;  2OQG A;  4BQO A;  4D7M A;  2Y9Z A;  2EH3 A;  3ECO A;  4UUV A;  2IAI A;  2VQG A;  1OPC A;  2AS5 F;  1ZLJ A;  2G7U A;  3KEO A;  2DAO A;  3WG9 A;  3ZMS A;  5CVU A;  5A2Q K;  2E1M B;  3A01 B;  2GXB A;  2EK5 A;  2FSW A;  3BG5 A;  3CMY A;  1ZHF A;  3OYE A;  3SZT A;  3U1K A;  3BJO A;  2BY3 A;  1IUF A;  3JSP A;  5GAG J;  5E79 C;  2L9N A;  2P81 A;  1JI8 A;  3E5U A;  2ZO4 A;  3KP4 A;  1BI0 A;  2F4M B;  4BJ5 C;  2XGC A;  2EQR A;  2MAB A;  2DA5 A;  2VKH A;  3RIR A;  2BYV E;  4HF2 A;  3HUG B;  3HOV J;  3LQR A;  2FUG 2;  1U2W A;  2ZME C;  3Q0U A;  2DYR H;  3MZ8 A;  1P6R A;  1E17 A;  5GPA A;  3K4M A;  2QBY A;  3MKZ A;  2KIQ A;  2E7W A;  2VC0 A;  3IP4 B;  5ED4 A;  2HZD A;  1VQL I;  3Q9S A;  1S9H A;  1Z3X A;  3K0L A;  4M3F A;  3ONQ A;  1T95 A;  1BN5 A;  4F92 B;  5LHG A;  1YIJ I;  4KIB A;  3IL2 A;  1ODD A;  1SAN A;  4D9J A;  4HDU A;  1I3A A;  4OAZ A;  1P4A A;  1Y0U A;  3KEY A;  1P4W A;  4RDU A;  3CDI A;  3CMM A;  3FMR A;  2IVM A;  5EG0 B;  3BRO A;  4IZZ A;  3T5X A;  1W36 C;  4GXO A;  2V1D A;  1A35 A;  1HOM A;  2DBB A;  1SFK A;  4U0Y A;  1VQP I;  4CA0 A;  2Z9O A;  2NOJ B;  1WJE A;  1U6G A;  2HXI A;  2BBY A;  2UWM A;  3Q9V A;  1P4X A;  5ERI A;  1MMD A;  2A6T A;  4WXC A;  4BS9 A;  4IHY A;  4JYK A;  1FWZ A;  2L7F P;  2GLO A;  2CUJ A;  3H5R A;  4CYC B;  1RIO H;  1P92 A;  2ZKZ A;  3LAJ A;  2XDV A;  5CKT A;  3A0H C;  5HOD A;  1B6A A;  5CPR B;  5J4V A;  2O0Y A;  4MLO A;  1J0R A;  2IS4 A;  2YX4 A;  1LFB A;  5BQT A;  4E7K A;  2EBI A;  3VB2 A;  2CQQ A;  5DUK A;  2L0K A;  2VE8 A;  4GDF A;  4MO7 A;  4A3F J;  2VT2 A;  3A4C A;  1G3W A;  1T0F A;  2TRT A;  2YSR A;  3BTL A;  2QQB A;  5DYM A;  3SXY A;  3S1R J;  2Q1Z B;  2QZ8 A;  1R23 A;  5B1B H;  1GXP A;  1APL C;  1SVL A;  2RRE A;  2NYX A;  2L2O A;  4C9Y A;  5F0H A;  1JJ8 C;  5CYV A;  1RUN A;  1BI2 A;  3JAM Z;  1YRN B;  3MZY A;  2HFH A;  4O3M A;  3OIP A;  1KU9 A;  1I39 A;  1H8A C;  4XK4 A;  2ZB9 A;  5LLQ A;  3DFG A;  2PMU A;  4HX8 A;  1W4M A;  3PQK A;  1EKE A;  3F22 A;  1MD0 A;  2HYF A;  2HDD A;  3GZN B;  3T8R A;  5LGT A;  1QPM A;  4OIP F;  4OIN F;  2PJR B;  1J7K A;  1O3T A;  2LF8 A;  2WY8 Q;  1ETV A;  3K70 D;  2L7M P;  1A6I A;  1BIB A;  2L9V A;  2BY0 A;  3KP7 A;  1R5H A;  2ELH A;  4L9T A;  2EFO A;  1BI3 A;  4BXU A;  4DBR A;  2DXI A;  3IRQ A;  2RN7 A;  3G6E I;  1P7I A;  5JFR A;  2FNP A;  2LKP A;  4ZYE A;  4BY1 J;  4XR6 A;  3LSH A;  2W48 A;  3OL4 A;  4CCJ A;  1IO2 A;  2E34 A;  1J9I A;  4L9V A;  2CRG A;  1R7J A;  3ZQ7 A;  3T8T A;  2J5O A;  2ZXH A;  4HW0 A;  2VN2 A;  3EET A;  1EH6 A;  1EJ9 A;  3P5J A;  5ILS A;  3F72 A;  3HBL A;  3TO7 A;  2PMH A;  4FIS A;  3J7Y J;  2XRL A;  4XKC A;  4EJO A;  1ZRD A;  3CCV I;  1YLF A;  2X1E A;  4EM0 B;  1MJB A;  5IYD J;  3MEX A;  1IJW C;  4HEA 2;  3HOY J;  4LMY A;  2PN6 A;  1VFC A;  2HKO A;  5CVR A;  3SHF A;  3NAU A;  4PGG A;  2NS8 A;  1TWC J;  2CG4 A;  3OWT A;  2WB1 A;  4I76 A;  3GUD A;  3OYF A;  3DU6 A;  4XM3 A;  1BBY A;  1I27 A;  3M3Y J;  3S2W A;  4BYY A;  4C2M J;  3CP2 A;  3OS1 A;  1ZAR A;  5IOY A;  4P5O A;  2XGE A;  1ZH5 A;  3L2V A;  2RGV A;  2D1V A;  2CQK A;  4JBA A;  3G3Z A;  5E3L A;  1B9M A;  3KPH A;  2JK3 A;  5H6Q A;  3PSF A;  2FJ1 A;  5K5R A;  3S2H J;  4IQ4 A;  5FJ8 J;  3EDP A;  1V54 H;  1MH4 A;  2LFB A;  2XC7 A;  3ZQG A;  3BG6 A;  4A69 C;  2ISY A;  5A2Q Z;  2DK5 A;  4MQV A;  1IXC A;  3V8J A;  5D4R A;  1JUM A;  3A0B C;  5HVQ C;  2UXN A;  3BR6 A;  1KZH A;  3KP6 A;  3LFU A;  1XD7 A;  1XDS A;  4BXF A;  3K7A J;  2VJ4 A;  1R9T J;  1XCV A;  1FSE A;  5CVJ A;  3ZMD A;  1HA8 A;  4J01 A;  1OYW A;  3L9F A;  3GTQ J;  4MGR A;  3MMY B;  1KYZ A;  3E6C C;  2HI3 A;  3QU6 A;  4JX5 A;  3U1D A;  1JE8 A;  4XLP F;  2CW0 F;  5KHD A;  4ZYA A;  3PIP F;  2VJ5 A;  3HB9 A;  5E3O A;  3VYS B;  5B1A H;  5FLM J;  3OYN A;  5B3S H;  2DQL A;  3I9V 2;  1I5Z A;  4AD9 A;  1F5T A;  2ICW G;  1R36 A;  2ELK A;  2L54 A;  3OR1 C;  3K70 C;  2ZJP F;  3FBI B;  3I4N J;  1FP2 A;  4EJU A;  2WAQ A;  1WQ2 A;  1B1B A;  1TW3 A;  3C1D A;  3LFK A;  3VPR A;  3OYJ A;  4UB8 C;  5HDN A;  3CP8 A;  3J7Z I;  2O03 A;  1R58 A;  3CC7 I;  2QGU A;  4A93 J;  4MFD A;  3FKJ A;  4F91 B;  3R0A A;  1HLV A;  1BR4 A;  3DBL B;  1QPI A;  2ZNY A;  4AVP A;  4HNU A;  3OS2 A;  2BZT A;  1FTZ A;  4BXX J;  2Q0O A;  2R92 J;  1FZP B;  2YR2 A;  3S15 J;  5LD2 C;  4F52 A;  2XKP A;  2DA3 A;  3JAM K;  2BHY A;  4Y4R A;  1T38 A;  3K1N A;  2JA2 A;  3RQ4 A;  4HYE A;  1S5L C;  2GWR A;  2LRD A;  1ZR4 A;  4DGW B;  1DU6 A;  2XKO A;  3H9G A;  3HEF A;  4BDY A;  4PZJ A;  3PNV A;  3QPH A;  1OCC H;  2MGQ A;  4AUX A;  3DU5 A;  2DOE A;  1MND A;  2HVR A;  1YI2 I;  1BI1 A;  3V4G A;  4Q48 A;  5BNG A;  4GGG A;  2JRT A;  2VAS A;  2O3F A;  4O5V A;  2JN6 A;  4WXD A;  2ZJR F;  1ZRE A;  2W25 A;  3COA C;  2M34 A;  3CD6 I;  4DOZ A;  1QA6 A;  4XLA A;  3KYL A;  2HVQ A;  2RDP A;  1IXS B;  2IA0 A;  1XB4 A;  2X48 A;  3BLY A;  4RM2 A;  4U0W A;  2CQ7 A;  4I0B A;  4S05 A;  2EJR A;  3LMM A;  3HDD A;  2BVM A;  3DPT A;  2D1H A;  5J4Y A;  1RKT A;  2DDA A;  3TL4 X;  2GOX B;  4YIF A;  2EIL H;  2R7O A;  2JUC A;  2OPT A;  4HG2 A;  4CZC A;  2GOM A;  1Y8Q B;  2L9R A;  4UY8 I;  1P2F A;  1NTC A;  3HTU A;  5F08 A;  1FOW A;  3BR0 A;  4I7H A;  2EV0 A;  1ZGW A;  1IGN A;  1SVO A;  4UVB A;  3Q0V A;  4E6K G;  1RRJ A;  3R60 A;  2CQX A;  3FHZ A;  1WCM J;  2P7V B;  1Y0N A;  3ML6 A;  3RI4 A;  2HDC A;  3IC7 A;  3CCM I;  5D5X B;  2XF5 A;  2NVQ J;  4A3B J;  5FLX Z;  4DQ2 A;  2OC6 A;  4D5C A;  2HQR A;  2Y0M A;  2EZH A;  2VIX A;  1UST A;  4ZC3 A;  5AIQ A;  4M74 A;  1LFU P;  5FRO A;  5M3M J;  2IT0 A;  3L2C A;  3CCJ I;  2Z33 A;  1SFE A;  4S04 A;  4LLL A;  3W2A A;  3H0G J;  1N78 A;  3EUA A;  2DLL A;  3T0Y A;  3V7S A;  2E2J J;  1HBX G;  4IKF A;  1AA7 A;  5KVR A;  3DP7 A;  2M0C A;  1FYM A;  3I59 A;  2ZNZ A;  1QU3 A;  2DQR A;  3TOA A;  3DCF A;  3I58 A;  1G59 A;  2HQ5 A;  2Q2E B;  4M3G A;  5JHF A;  4XL9 A;  1LQ1 A;  3WGI A;  4J19 A;  2CV0 A;  3FM3 A;  4AYB A;  1J5Y A;  3ERE D;  5JVG F;  3MWM A;  4BHB A;  4LGW A;  2MH9 A;  3L7W A;  3EYY A;  2PFB A;  1U5T A;  1TZL A;  1T33 A;  4LD5 A;  3KZY A;  4HF1 A;  1G3S A;  2HTJ A;  3ULQ B;  2VBY A;  3S8P A;  3QYF A;  1UHS A;  2V6C A;  2WV1 A;  3AG4 H;  2QA4 I;  1ZGA A;  1K61 A;  4UNO A;  2BV6 A;  4LK0 F;  4XMY A;  2JQ7 A;  1F43 A;  3HYI A;  2QEX I;  3FBN B;  2GXA A;  2QYO A;  1V55 H;  1YJW I;  1W0T A;  2W82 A;  4AVZ A;  1ETQ A;  5K5O A;  1EH8 A;  1SMY F;  3SEQ A;  1MNE A;  2QF7 A;  1N75 A;  2F2E A;  5IT9 Z;  4A3L J;  4DYQ A;  3M1E A;  4FHT A;  3TW7 A;  2WAF A;  3BP8 A;  1UHW A;  4IHW A;  4IX7 A;  5GTI C;  3ZXS A;  1UJ8 A;  1IZ1 A;  2ETH A;  3J7A Y;  1DP3 A;  2GAU A;  1J59 A;  1OR7 C;  4IRH A;  1MGT A;  3BR1 A;  3VSL A;  1I1S A;  3LQQ A;  1TWG J;  3JRI A;  1TL8 A;  5AIP A;  4B44 A;  2W4S A;  1WRJ A;  1JUS A;  2CW8 A;  4RM3 A;  3H3Z A;  2L02 A;  4N9H A;  1VQO I;  1XC5 A;  3R0J A;  3F23 A;  1JTX A;  1PVE A;  3A01 A;  4OIO F;  2JVG A;  3MCZ A;  1NK3 P;  3CJR B;  1CF7 A;  3ASO H;  1V3F A;  2W1O A;  3LSK A;  3J80 Z;  4AM3 A;  2IS1 A;  3ELK A;  2E2I J;  1DGW Y;  3CLO A;  4XNF A;  2Z99 A;  3F21 A;  2KIU A;  2YU3 A;  5HLG A;  2PMZ A;  5L3G A;  5JR3 A;  3GFJ A;  2JA8 J;  3WTV C;  4D7N A;  3S17 J;  2FOK A;  3OIQ A;  5LBQ A;  4WF2 A;  4XRS A;  3OS0 A;  1L3L A;  1U5T B;  1QNT A;  2DJN A;  1MIJ A;  4ON0 A;  2AXL A;  2R5Y B;  3C2G A;  4PSX A;  4RAG A;  4BE2 A;  3K4N A;  2FRH A;  3QRF F;  2XPV A;  3RJP A;  3GTJ J;  3K9T A;  5GPC A;  1R5G A;  3ASN H;  3V42 A;  2PQ8 A;  4B3A A;  1FC3 A;  3FXJ A;  2Q8K A;  1R22 A;  2ACJ A;  1S3J A;  1X3Z B;  4A0X A;  2DA7 A;  3RCO A;  4U88 A;  4NQW A;  4AYB N;  3PIO F;  3Q0W A;  5BS6 A;  1R1V A;  4QLC U;  2HWV A;  2HYG D;  2KIM A;  2ZFU A;  1PYV A;  3F8M A;  3RZD J;  3EQL F;  3TOB A;  2XAU A;  1O3S A;  4QPO A;  3O8H A;  1MBH A;  1S6L A;  3O8G A;  4XLH A;  4EAT A;  2QM3 A;  3CC4 I;  5EDN A;  4OMY A;  1QVT A;  5LFA A;  1G4D A;  5HS9 A;  3QPS A;  1ACI A;  1Q1V A;  3C3W A;  5J6X A;  5EEG A;  4PFO A;  2A6E F;  2DI3 A;  1X1D A;  4A0Z A;  4PGH A;  4QIW N;  4B43 A;  2JZY A;  3CJQ B;  4ZZD A;  1IXR C;  1NG6 A;  1U3E M;  1O7L A;  2XRN A;  1W5C C;  2IGK A;  3SDG A;  2CV1 A;  3F6O A;  4FX0 A;  4E7L A;  2FML A;  1OJL A;  4YEL A;  3BJ6 A;  3PFI A;  4TV7 A;  4D5F A;  2OU2 A;  4BHC A;  2HYJ A;  4XON A;  3QP5 A;  1TTY A;  3LSJ A;  4IEJ A;  5EF6 A;  4V2G A;  1UG2 A;  3FK7 A;  4DZP A;  2OQR A;  4M71 A;  2A68 F;  2RVC A;  3FIS A;  4ANJ A;  3BR2 A;  5FKM A;  2BY2 A;  3U2R A;  1BM9 A;  3LA7 A;  2YPR A;  3DEW A;  5DEQ A;  4MQ9 F;  3WU2 C;  2KPM A;  3OYD A;  3K4B A;  2LVS A;  4L0Z B;  1AOY A;  1VI0 A;  4JP0 A;  1Y1V J;  1W0U A;  2TDX A;  1HW5 A;  1UHM A;  2RNJ A;  4H4K C;  4A6D A;  4IL6 C;  2HPI A;  1QZY A;  3F6V A;  2M2E A;  3K4J A;  4YFN F;  3ZMT A;  4CCN A;  4LK1 F;  4XLC A;  1E2X A;  2HXO A;  3I4M J;  1OKR A;  1WJC A;  2JJ7 A;  2K3P A;  3LL7 A;  2QQ9 A;  4AC0 A;  3REO A;  2KDO A;  1FOX A;  1D5V A;  1BJZ A;  4X0G A;  3VWB A;  5K7F A;  3RYP A;  1IN6 A;  4L9J A;  5EJC A;  1GV2 A;  2R4G A;  5D6F A;  1BR2 A;  1BJA A;  2EA2 A;  3KET A;  5L3B A;  3ZQI A;  4M6V A;  1HXD A;  3KZZ A;  2ZXW H;  2IW5 A;  2OZ6 A;  3CCQ I;  3DQV C;  2HOT A;  4ZJZ A;  2L4A A;  3BT9 A;  5CQG A;  5KAF C;  3Q3S A;  4PJ0 C;  3OSF A;  3HZJ A;  3E7L A;  5KK1 A;  3RQI A;  5J8C A;  2FF4 A;  2JVH A;  3OV8 A;  2P6T A;  4UUS B;  3PQJ A;  4NQW B;  1IAW A;  3S14 J;  3DTK A;  4Y52 J;  3GZ6 A;  1D0X A;  2J5P A;  4AIJ A;  2VUM J;  3ABT A;  5LEK A;  2FA5 A;  1I3Q J;  2HS5 A;  2CSO A;  2V9K A;  1HW1 A;  3O2P E;  4I98 B;  1CF7 B;  4MNU A;  3NQO A;  1GHC A;  1GLN A;  1YS6 A;  3H92 A;  3JRG A;  2H09 A;  3VSK A;  2NS0 A;  1SAU A;  3RPU A;  2JSP A;  2O6G E;  4KN7 X;  5HNF A;  3AKZ A;  4G9Y A;  2MH2 A;  2ZFW A;  2M45 A;  1I50 J;  2LY9 A;  1UFM A;  4CZZ A;  2EFQ A;  1A5J A;  1SD7 A;  1XGS A;  4F93 B;  3SQN A;  5E17 F;  4XSX F;  3TGN A;  2PJP A;  2E1C A;  1TWF J;  3OYL A;  2V1U A;  2LKX A;  2COB A;  4UUS A;  2R5Z A;  1EA3 A;  2X4H A;  1K78 A;  3HC7 A;  1I1G A;  3S1Q J;  2R7Q A;  3FMS A;  4A2U A;  4BBS J;  2XAG A;  3L00 A;  4DIQ A;  2DDB A;  1DPU A;  4XIC A;  5E8I A;  2DTZ A;  1B59 A;  2UZK A;  1SEU A;  4W97 A;  3QPL A;  2WV0 A;  4HV6 A;  1MBG A;  3W3C A;  1JXS A;  5IP6 A;  4A6E A;  3ZN0 A;  1PJR A;  2DU9 A;  1D1A A;  5HLI A;  1S7A A;  4KJZ A;  2H1L A;  1LE8 A;  4XOT A;  2V1X A;  5CJ9 A;  5HS7 A;  1Y39 A;  3CTA A;  4M73 A;  3WTU C;  3DPL C;  3S3O A;  4E7I A;  3CUQ C;  2DT5 A;  2IGN A;  4XKW A;  2JUG A;  4BBR J;  1IW7 F;  2Z3Y A;  3GLX A;  3ZGK A;  3RKQ A;  1OR7 A;  4KIF A;  1DP7 P;  3E5X A;  4PUS A;  4BKX A;  3B6C A;  1ZN2 A;  4L18 B;  4XKV A;  3LST A;  3GLL A;  5BPI A;  3BG9 A;  2DA4 A;  1KQ8 A;  5F27 A;  2RQP A;  1F36 A;  3FMQ A;  2IS6 A;  5LGN A;  1LUJ B;  4CO8 A;  2NOG A;  2BW3 A;  1TP4 A;  2RQQ A;  3F9K A;  1YHQ I;  1JUP A;  2KLO A;  2E1M C;  3V8L A;  3IKV A;  2HEO A;  3MQ0 A;  4NDL A;  5E3M A;  2L3D A;  3WGG A;  1S72 I;  1HW2 A;  1BR1 A;  3HKZ A;  1D5Y A;  2K3F A;  3PFY A;  3WOD F;  5IY5 H;  1Z77 A;  3KP3 A;  1B8I A;  2QLZ A;  3V8K A;  1WH7 A;  1SD6 A;  2FXA A;  5TRD A;  3BC8 A;  3BZK A;  1LVA A;  1YJ9 I;  3OYK A;  1K4S A;  3DBH B;  2F5V A;  2W85 A;  3C7J A;  3FX3 A;  2GZW A;  3J81 Z;  5GP9 A;  1HST A;  4XLN F;  2O8X A;  1JKO C;  2VXD A;  1K6O A;  3IUO A;  3PM1 A;  2MLG A;  4IRG A;  1JKP C;  1YG2 A;  3A1Y A;  1NHA A;  1N25 A;  5F04 A;  2B9S A;  3IAM 2;  3ZQF A;  1T2K A;  1RES A;  4U7B A;  3CJT B;  4LB5 A;  3HRT A;  2ECC A;  2FD5 A;  2JA7 J;  1VZ0 A;  1DGR M;  1R1T A;  4P9U A;  2MC4 A;  5F0F A;  5ICF A;  4FE7 A;  5TIS C;  3CZ6 A;  1W5S A;  4ESB A;  1RPW A;  2R7D A;  2ZCW A;  4L5J A;  2P8T A;  1Z7L A;  1G8X A;  1TNS A;  3QYB A;  5EZH A;  4QSH A;  5KCM A;  3NAR A;  1AKH B;  2AQF A;  3GWZ A;  4E70 A;  2DA1 A;  3E5Q A;  2CW7 A;  4IPA A;  3OYA A;  2F4O B;  2LKS A;  2NVX J;  4Y7N J;  4ESJ A;  1TWH J;  2K9N A;  2JT1 A;  2CQN A;  4ZTJ A;  3VYT B;  1Z7U A;  5E20 A;  4EV0 A;  2Y0S A;  4N4N B;  3BZC A;  4RS8 A;  2EZL A;  4F3Q A;  1J75 A;  2CS3 A;  3C2B A;  2M8E A;  4EJT A;  2AHQ A;  3FDY A;  1E3H A;  3QAH A;  4WK8 F;  4HF0 A;  1R4M B;  5JLW A;  2ZME A;  3WTX C;  1OCZ H;  2MC3 A;  1OCT C;  4BNC A;  1TNT A;  9ANT A;  5DCM A;  4AID A;  4YIR X;  4RAF A;  3GEZ A;  1IN5 A;  1HKS A;  3CDL A;  2EZI A;  4IRI A;  3ZQC A;  4BUP A;  4BE1 A;  3SJM A;  2VPL A;  1FP1 D;  5DUI A;  1UAA A;  2KZV A;  3SDB A;  3OL3 A;  1JKQ C;  2XUB A;  5E1X A;  3CO7 C;  2FMY A;  1OCR H;  1SC7 A;  4LIT A;  3BQZ A;  3BDD A;  1X1P A;  1PP8 F;  4B8X A;  1R4N B;  1IV6 A;  4I0A A;  1F9N A;  1HSJ A;  2RV8 A;  1WKM A;  1MMN A;  2LY2 A;  1OQY A;  2OTJ I;  4UVC A;  4P1W A;  1YJN I;  4C3J J;  2XF6 A;  1I6H J;  1SD5 A;  4NBQ A;  1LNW A;  4L9N A;  4DJA A;  3GTP J;  3JW4 A;  2C6Y A;  4YII A;  1HKQ A;  3IV5 A;  5DCM B;  2FQ4 A;  1A31 A;  1BA5 A;  1C0W A;  4BJ6 C;  2FBI A;  3WTS C;  2VQC A;  2UUZ A;  4V2F A;  2VXZ A;  1ORK A;  2IEK A;  1FJL A;  3W6V A;  1U9N A;  1D0Z A;  1FYK A;  1IN8 A;  4RGS A;  3AL0 B;  3IH2 A;  5J1U A;  2COM A;  3F0C A;  3MZH A;  1TQI A;  1XPX A;  4KDP A;  1A6Q A;  4I2O A;  2PJR A;  1YW9 A;  1H0M A;  4M9S A;  4R8H A;  4E4H A;  1IG7 A;  1MH3 A;  2M4G A;  3ISP A;  3HOU J;  3O3K A;  4C2T A;  2NNY A;  2MW8 A;  5DTD A;  1B9N A;  3MN2 A;  4LIU A;  2JWT A;  1LB2 A;  2CWE A;  1XGM A;  1WJF A;  4XQF A;  1UCR A;  2LD5 A;  2MG4 A;  3I59 B;  3KLN A;  1MBJ A;  1WHU A;  3I4P A;  1IC8 A;  3DBR B;  3M7G A;  5D4S A;  3S1N J;  5H2F C;  1B72 B;  2A07 F;  2GQQ A;  1JHF A;  3TED A;  4HNT A;  1JKR C;  2CU7 A;  4RA2 A;  1X2N A;  4UUT A;  1WVR A;  1RNL A;  4A5N A;  2WC2 A;  4ZZL A;  3F8C A;  3I3L A;  3BG7 A;  3HG9 A;  5HLH A;  3R61 A;  4PJN A;  3D0S A;  2CV2 A;  1WGX A;  3CES A;  1ZAO A;  4LOC A;  5JLX A;  3C2H A;  2IA2 A;  3EUH C;  3RPU D;  4YFX F;  2O8K A;  2R7T A;  2MSY A;  2KDZ A;  4XLE A;  3KLO A;  4RGR A;  4ABZ A;  5FRN A;  3I64 A;  4A3J J;  2H27 A;  2L7Z A;  4QWQ A;  1XGN A;  4HX4 A;  3UKG A;  4RB3 C;  1B72 A;  3CCY A;  2HQN A;  3GFI A;  3CDH A;  4U87 A;  1D8J A;  4RGX A;  4P9F A;  1U5T C;  2FEZ A;  1WSU A;  3V7R A;  4HV5 A;  3CCE I;  3BTJ A;  1U0J A;  4G6T B;  2Z1D A;  1T56 A;  2E71 A;  4MTD A;  4ENN A;  3LAP A;  3GTM J;  2BGC A;  2F48 A;  3G1M A;  4UHT A;  3M8E A;  4EQQ A;  4WCG A;  3ZPL A;  2DCE A;  3F8N A;  1Q1H A;  1HQC A;  4Y3O A;  1WZ2 A;  2XSD C;  1ZR2 A;  3JCU C;  2A3S A;  3IAS 2;  5F64 A;  4HDV A;  4G7H F;  1VND A;  1VQM I;  4CYC A;  2L7K A;  4NC7 A;  4RAY A;  1F1Z A;  2ZSI B;  3FM5 A;  3GO5 A;  2LLK A;  3EPZ A;  4N9I A;  4HQE A;  1WJD A;  3EUH A;  1ETX A;  2Y31 A;  2P5L C;  5EGO A;  1T39 A;  1FBU A;  3L2R A;  3DEE A;  3VFZ A;  2FX0 A;  2YX7 A;  4LFU A;  1ZYR F;  2R7W A;  3BPV A;  2KIS A;  4Y15 A;  2JPB A;  2L9S A;  3GVA A;  2Y2Z A;  1VTN C;  1Z0X A;  3CCU I;  3V7C A;  3PSI A;  3S16 J;  2F5C A;  5HOO A;  3L1P A;  2EB7 A;  3KEQ A;  1TBX A;  5FFZ A;  5J47 A;  2JRM A;  3CCL I;  2PX9 A;  4B48 A;  2KL4 A;  1KU2 A;  2LC2 A;  5DV5 A;  1O3R A;  2AQE A;  1YRN A;  1GT0 C;  5CQE A;  4EM1 A;  2XAH A;  3M8J A;  1H88 C;  2EZK A;  2MBF A;  3ECH A;  5EEH A;  4JK1 X;  1FX7 A;  2M3A A;  5GAE J;  4LJZ F;  3ERM A;  2K27 A;  2X1C A;  3OOU A;  2VPR A;  5HLT A;  1O4X A;  3HUG A;  3BG3 A;  2V26 A;  1MDM B;  2XGX A;  3ROU A;  2OCE A;  1IRG A;  2A61 A;  4C3I J;  1WI3 A;  1YOV B;  2IP2 A;  3FWE A;  2KP6 A;  2DFH A;  2K9L A;  3RSN A;  3FXQ A;  2WTE A;  2QWW A;  2Y48 A;  3QOD A;  1D3Y A;  4CH7 A;  4PDK A;  1H9G A;  3M9A A;  3DEU A;  1ZG1 A;  3HOZ J;  4XN0 A;  1XMA A;  3KYD B;  5J8F A;  2W57 A;  3ABL H;  1R71 A;  1Z67 A;  2K02 A;  5EYR A;  1HDP A;  3RPQ A;  2A5W A;  2E35 A;  5ILV A;  1FOK A;  2IRF G;  1WJ5 A;  4N0B A;  3W6J B;  2NAZ A;  2XAJ A;  4RLQ A;  2QCO A;  3H35 A;  2VKD A;  4M9Z A;  3QWL A;  2RNG A;  1AKH A;  1XSV A;  2VC1 A;  4ZDL A;  2DT7 B;  4HBL A;  4E7H A;  1BIA A;  4G6D A;  4LIV A;  3PO2 J;  3RZO J;  3MKW B;  2P6S A;  2A5Y B;  3ZQQ A;  5K5Q A;  5B66 C;  3DV8 A;  2FBH A;  5LHH A;  3B6A A;  1MMS A;  2BY1 A;  3LOC A;  3S32 A;  2KRH A;  5DM7 F;  3HOT A;  2XB0 X;  1MSF C;  3CMA I;  3N05 A;  5M5W J;  2FNA A;  4N4O B;  3DLL F;  2DA2 A;  2YS9 A;  2VJJ A;  4HQM A;  2VJI A;  5IYB J;  4D1Q A;  3GTK J;  3K6G A;  5ILU A;  4XOR A;  3BY6 A;  4L0Y B;  5HS8 A;  1AWC A;  1JJ6 C;  3IRR A;  2VL8 A;  1X3W B;  4OAY A;  3VYU B;  3SYT A;  2P7C B;  2OV7 A;  1XCB A;  3E1S A;  4A3K J;  3WU0 A;  2K40 A;  2HPM A;  4P55 A;  4LG0 B;  3G2B A;  3NEU A;  4RBO A;  1ETW A;  3DPU A;  2NXN B;  1RR7 A;  2JTV A;  3KZI C;  4KIS A;  2CUF A;  2CUZ A;  4E7Z A;  2R7F A;  1LDK B;  2KQR A;  2YUS A;  1TC3 C;  3I54 A;  2KIF A;  1NH3 A;  2H1K A;  2EPF A;  3OYC A;  3RTR A;  3H0D A;  2EIM H;  3TDU C;  2VI6 A;  2NNN A;  4BEH B;  3M8F A;  3SZG A;  2EFW A;  4JQF A;  4G7O F;  3GYH X;  1G2H A;  3BPX A;  1H9T A;  1FMV A;  2K4J A;  1MMA A;  4LLG F;  1VQ9 I;  3I71 A;  2CUE A;  2Y69 H;  3GTL J;  2FBK A;  1VQ6 I;  2CJJ A;  2AXT C;  2VE9 A;  3K4K A;  2NVT J;  5CVV A;  2GBY A;  3M1C A;  2ISZ A;  2R5Y A;  4ZDO A;  4EVI A;  2AO9 A;  2LF7 A;  4NC8 A;  4OWR B;  2Z16 A;  1VF9 A;  3MKY B;  3G1L A;  1PUE E;  3H5A A;  5EEA A;  3ZMV A;  4R1H A;  3GZ5 A;  3ABK H;  4WXH A;  4U0V A;  1TQP A;  3NWT A;  1T6S A;  1TLH B;  2DOA A;  2FU4 A;  3GTO J;  5CLS A;  5FB2 A;  1CGP A;  4M72 A;  2KRC A;  3PUB A;  2NRA C;  2M5W A;  3R6S A;  3OMY A;  2LYC A;  2OA4 A;  1E3P A;  3CUQ B;  2DA6 A;  5FLX K;  3CCS I;  2D5V A;  2E1O A;  2E2H J;  2F5D A;  3GXO A;  3HIF A;  3LA2 A;  1Y6I A;  1TWA J;  1SD4 A;  1P9Q C;  3ABU A;  3HPG A;  3G1O A;  1GVD A;  1KQ0 A;  4A3E J;  1USS A;  5D6E A;  2LMD A;  3WTW C;  3QOE A;  4IVN A;  3IH4 A;  4DZJ A;  1QVU A;  2A05 A;  2XIG A;  3X2Q H;  1IF1 A;  5E1W A;  3OYH A;  2R7V A;  1ETY A;  3P9I A;  1FPQ A;  1F4K A;  1XX5 A;  1VQ7 I;  3OY9 A;  1E3O C;  4A3D J;  2KFD A;  1QRY A;  3E97 A;  4GYI A;  5BOX A;  3RDI A;  2XPW A;  3MD2 A;  5C3E J;  3ZN1 A;  1E0E A;  3SEZ A;  3LSG A;  1QBJ A;  1OCP A;  1FBS A;  1LEA A;  4U7D A;  1G3T A;  1OLT A;  3C18 A;  5FFX A;  1DQU A;  4OIR F;  4BY7 J;  4GCV A;  3J80 K;  4EMS A;  3H36 A;  4YG2 F;  4IQJ A;  1TT0 A;  3N97 A;  2K7L A;  2VON A;  5IT9 K;  1ON1 A;  2LNB A;  2QUF A;  2XGD A;  4IF4 A;  4DNC A;  1XS9 A;  3I53 A;  3BQY A;  3L09 A;  5JI6 A;  1UMQ A;  1LDD A;  4NUB A;  2CGP A;  4A3G J;  4C2U A;  2WA0 A;  3SFZ A;  2VBX A;  4BH9 A;  2DPD A;  1B4A A;  2EV6 A;  1W5T A;  4EGY A;  1T8I A;  1T08 B;  1XG1 A;  2KRF A;  3IHU A;  3ZRG A;  1H89 C;  4LB6 B;  1SFX A;  2JSC A;  4NHJ A;  1XDU A;  3TO9 A;  2OBP A;  4ESF A;  1K7A A;  5FLV A;  3HOW J;  1Z9C A;  4Z6Y A;  4H0E A;  4BAY A;  4F55 A;  1POG A;  2BVL A;  1X1C A;  2O61 A;  4ZYH A;  3ZP5 A;  4XRF A;  4IHV A;  2H6C A;  5F0C A;  2Q2E A;  4Q47 A;  4P96 A;  4HA8 A;  2LY1 A;  2GA2 A;  3CLQ A;  4ENJ A;  3SZP A;  1NK2 P;  2CMP A;  1N77 A;  3GTG J;  4X6A J;  4J00 A;  5FRM A;  2P5V A;  2X85 A;  4D0P A;  3JSO A;  5LEJ A;  3ZQH A;  1LKX A;  4AU7 A;  2OAZ A;  4G94 A;  5GTH C;  1S7E A;  4BEH A;  1Z91 A;  5F1R A;  3ZQL A;  4CUG A;  2D2W A;  4XKB A;  1KQ9 A;  3WE2 A;  1QHH D;  5F6F A;  4PCQ A;  1W1W E;  4HZF A;  1IRZ A;  1ZEL A;  2DK8 A;  1GV5 A;  4B1R A;  3CME I;  3CC2 I;  4PSW A;  3CUO A;  2MD5 A;  4UXN A;  1ENH A;  2EV5 A;  1MJA A;  4S0H B;  5L3E A;  2ME0 A;  2RKH A;  1KU7 A;  1PUF A;  2G9W A;  2V9V A;  4DW6 A;  3JTH A;  2EFN A;  1RKW A;  2UV1 A;  4L5I A;  1FT9 A;  2K85 A;  2TCT A;  4KN4 X;  1MNM C;  1MMG A;  1X19 A;  3MAJ A;  4IHS A;  1VQN I;  3BCB A;  3JRC A;  4A5M A;  1HDD C;  2K4B A;  3HSR A;  1X2M A;  3P7N A;  2VLA A;  3A03 A;  5FD5 A;  1XMX A;  3JRB A;  3EYI A;  1JTY A;  4BQA A;  4FET A;  1UG0 A;  3H5N A;  1LEB A;  4G6Q A;  2VKV A;  2OUM A;  4UVA A;  3GW2 A;  1HCR A;  3BZ6 A;  1MZB A;  2FOW A;  2DFI A;  1IDY A;  1EV7 A;  4HX7 A;  2XVC A;  2PLY A;  3WHB A;  1GDT A;  1UEL B;  1IRF A;  5HNH A;  2OTL I;  4RLF A;  1IV8 A;  5FKN A;  1EF4 A;  4IXA A;  1I6X A;  3FXL A;  3Q5F A;  2QKM B;  4AIK A;  3BCA A;  3FXU A;  4G7Z F;  3AAF A;  5K7H A;  2DPU A;  2MLK A;  1TT5 B;  4ENM A;  2XRO A;  3TP0 A;  4UV8 A;  2KMU A;  1K79 A;  2X6Y A;  5M5Y J;  4Y13 A;  5E8G A;  4ETS A;  2R5Z B;  2M1B A;  4B3X A;  4HLY A;  3A02 A;  2O5R A;  4XLF A;  3DTE A;  4RGU A;  4A3I J;  4B4C A;  5J1R A;  1U8R A;  1ZK8 A;  4Y33 A;  1WFX A;  2IXS A;  1JGS A;  1LFP A;  1DPR A;  1YYV A;  1JHH A;  1M1E B;  1ON2 A;  1KYW A;  3GFL A;  4DYR A;  3DKW A;  2M4K A;  2R7Z J;  3I55 I;  3FK6 A;  1IN4 A;  3D1N I;  2MD0 A;  5DDG A;  1SFO J;  4C30 A;  4MHG A;  3K4L A;  3LSP A;  1AU7 A;  1U9O A;  3E0J B;  2HKX A;  4MEX F;  1O57 A;  2WWY A;  2E36 A;  3DLA A;  2DYS H;  2R0Q C;  2V1N A;  1S7O A;  2F4I A;  3J81 K;  1WJA A;  3CQZ J;  2HDW A;  1LJ9 A;  1ULY A;  3CJN A;  3VYR B;  2DMQ A;  2BHZ A;  4OIQ F;  2LBF B;  1IRX A;  3J7A O;  2QSF X;  1LE8 B;  2BXY A;  1GXQ A;  3G71 I;  4KIT B;  3ZCO A;  5H6R A;  2YU9 J;  3OYG A;  4FTH A;  4BE0 A;  2VBZ A;  3RYR A;  3N4M A;  1FEX A;  3BOQ A;  4NB5 A;  1T98 A;  3UR3 C;  1WPK A;  2ADU A;  1O3Q A;  4L5E A;  3HSF A;  4UB6 C;  2WBM A;  4BHP A;  5HDG A;  4NNJ A;  5TJJ A;  2M7A A;  3ESW B;  3HRS A;  1IDZ A;  1WJB A;  1ETK A;  1XN7 A;  2ESH A;  1MKM A;  5D8L B;  2WY7 Q;  3IWZ A;  1G6N A;  3WE3 A;  4QTR A;  1YW8 A;  2EWN A;  2LP0 A;  2QQ8 A;  5ICC A;  2STW A;  2IS2 A;  3ZMU A;  3S93 A;  3TW6 A;  4RB1 A;  2LOO A;  4FX4 A;  3KP5 A;  1J2X A;  2Y9Y A;  6PAX A;  2V9P A;  3WGH A;  5GAH J;  3TKY A;  4X1E A;  1FY7 A;  2MA3 A;  3DKX A;  2VBW A;  3GFM A;  4BQQ A;  5C4J J;  3U9G A;  5L3F A;  2X9D A;  2IPQ X;  2R7U A;  1R5I D;  2HNH A;  4FQG A;  1CQT A;  4WX9 A;  2DT6 A;  2RAE A;  3GBG A;  3HRM A;  3OR2 C;  1X4O A;  1ZG3 A;  4XOP A;  3P9K A;  3HPH A;  2A69 F;  5FD6 A;  3PO3 J;  3HGG A;  1OCO H;  2V79 A;  4O6J A;  2BOL A;  5FKO A;  1K6Y A;  1IUY A;  3E6D A;  1MBK A;  4M6Y A;  2UXX A;  5FKK A;  1BC8 C;  3TP3 A;  3O6B B;  4UV9 A;  4I09 A;  4RB2 C;  1W7P A;  2EIJ H;  2IJL A;  2NVY J;  2IBD A;  4CCL A;  4GYG A;  3WHC A;  3W2W A;  1Z21 A;  3HTS B;  3UNG C;  4BQN A;  4KNY A;  3HOX J;  1SMT A;  4IJA A;  4KA4 A;  2K5C A;  2M7B A;  1SAX A;  3BTI A;  4LG0 A;  5IOZ A;  3DKY A;  3K10 A;  2X6X A;  3OIO A;  1ZRF A;  5E3N A;  1BW5 A;  4BGD A;  4M9X A;  4E7S A;  1ZQ3 P;  2M0M A;  3GME A;  4XID A;  2DFE A;  3HOS A;  3ZR8 X;  1MSE C;  2DTR A;  5KNL A;  4YEJ A;  3KYC B;  1XSX A;  2GIV A;  3QU3 A;  2XPU A;  5DD8 A;  1A36 A;  4DBQ A;  3L2W A;  1W7P B;  2ELJ A;  3H1C A;  2QQA A;  1YO5 C;  4PFP A;  2ZJQ F;  3NRV A;  5E18 F;  2M9H A;  3I0T A;  5BPD A;  2BW3 B;  2G7H A;  4M3E A;  4M6X A;  5L3C A;  3LSM A;  2ZJ2 A;  2CH0 A;  3HKZ N;  3DTI A;  2CO5 A;  2KT0 A;  4Q4Z F;  3QYE A;  5B5E C;  3EUK L;  1FTT A;  2H6B A;  1X1A A;  1QZZ A;  2ESN A;  4KMU X;  1V4R A;  2E1N A;  2H94 A;  2EIK H;  2IGM A;  2Z2S B;  4JX6 A;  3K2A A;  5M5X J;  1FNN A;  4ITV A;  4F7Z A;  1YTY A;  2XF7 A;  4XSZ F;  3KP2 A;  1W36 D;  1VQK I;  4GRI A;  2LBF A;  2KHM A;  3PL8 A;  2FE3 A;  5AON A;  2LK2 A;  3CO6 C;  2PI0 A;  1RI7 A;  1ITY A;  4RAZ A;  3IWF A;  4A3C J;  2CFX A;  3GF2 A;  1A04 A;  2JMW A;  1YIO A;  4I6Z A;  4PJJ A;  1ZRC A;  2V7F A;  2K9M A;  3HHH A;  1Y1W J;  2D45 A;  3P9C A;  2JPC A;  2DMU A;  3KFW X;  1FIP A;  2P4W A;  4HPQ A;  3K4C A;  2DMT A;  1K78 B;  1OYY A;  2LDU A;  1JGG A;  1GVJ A;  2I8D A;  4RMN A;  5J3L A;  4IO9 F;  5J40 A;  2HR3 A; 
#chains in the Genus database with same CATH homology
 3BJA A;  4IHT A;  1TQM A;  5ICE A;  2XAF A;  4Q5S F;  3JTG A;  1RUO A;  2QVO A;  4EM2 A;  2XHK A;  4OMZ A;  2K86 A;  3TO6 A;  4HAM A;  3WTZ A;  4CIC A;  3WTY C;  1FYL A;  2ZME B;  4A0Y A;  3TDZ C;  4CYD A;  5LGU A;  1KA8 A;  4CXF A;  5FGM A;  1G3Y A;  1BOA A;  3LWF A;  5ICG A;  3HRU A;  2GXG A;  1QO0 D;  4ENK A;  2XAQ A;  3QOP A;  3T1B A;  2Z5U A;  1TW2 A;  4Y17 A;  3GX4 X;  1LDJ A;  2E7X A;  3CUQ A;  4K2E A;  1YW7 A;  1IN7 A;  5LHI A;  4ZYD A;  5FO5 A;  1FBQ A;  2DO7 A;  5D5V B;  5L3D A;  1OYI A;  5CVI A;  2P5K A;  3H3U A;  2VOD A;  3FXR A;  2KJB A;  4CDG A;  1WI9 A;  3KE2 A;  1BC7 C;  2FQ3 A;  3KCC A;  3RKY A;  2KJC A;  2QEN A;  3FF5 A;  2PEX A;  3G73 A;  3FZV A;  2OZU A;  1STZ A;  1OMI A;  2VOO A;  2VOP A;  2DW4 A;  1QQI A;  2CYY A;  3F3X A;  4RB0 A;  2B0L A;  1XSD A;  1RZ4 A;  1Z6T A;  2XV4 S;  3E6M A;  4MTE A;  3WU1 B;  1YS7 A;  2HOE A;  1MJ9 A;  4A12 A;  5LRS A;  3ZMZ A;  3K1M A;  4KIC A;  1O7F A;  4HLX A;  2EA4 A;  1ZG5 A;  3OOP A;  4OOI A;  4EGZ A;  3D5L A;  5D5U B;  1HKT A;  5BMZ A;  4KMF A;  4CHU A;  3DF8 A;  3DXJ F;  3HSE A;  1PP7 U;  1WWX A;  2PBI A;  2R3S A;  3QPT A;  5DCF A;  5DD4 A;  1U78 A;  3VEP A;  2Y75 A;  4LLN A;  1YFH A;  3I5U A;  1SFU A;  2XAS A;  4KIG A;  4MEY F;  1EH7 A;  2GA1 A;  2X0L A;  1DDN A;  2HGC A;  4KFC A;  2HTS A;  2F5E A;  4CGZ A;  3TQN A;  1REP C;  2VT3 A;  5LRR A;  5IT3 A;  4Z2Y A;  1KGS A;  1ZGJ A;  1KU3 A;  2W84 A;  1XGO A;  3MFK A;  5JHU A;  2PG4 A;  4YFK F;  1MDM A;  3W6K B;  1D8K A;  3K1P A;  3E3V A;  4ZYG A;  3RKW A;  4B09 A;  3QP6 A;  1W7P D;  2OD5 A;  2QBY B;  1PDN C;  2F5F A;  1S29 A;  3LA3 A;  3R4K A;  3BWG A;  4FT8 A;  2HZT A;  4KUM A;  5HDK A;  5H20 A;  4EJW A;  1Z1D A;  3K69 A;  4I02 A;  5K1Y A;  2EFP A;  4R79 A;  4G8X A;  3IKT A;  4ZH4 F;  5D5W B;  3F8F A;  3WTT C;  1QGP A;  4OU0 A;  2BE5 F;  4KT5 C;  1FSH A;  1YQA A;  2BEO A;  3B73 A;  1FLI A;  2STT A;  1DUX C;  1ONV A;  4WWC A;  3K2Z A;  4I01 A;  2M30 A;  2A6H F;  2LSO A;  3B02 A;  3VOE A;  1L0O C;  2ZBK A;  4HOB A;  3RKX A;  5D8K B;  4EJV A;  4GO1 A;  2W24 A;  1Z05 A;  4KYW A;  3VOD A;  2RC4 A;  4AWX B;  2ZXJ A;  4AIH A;  1R00 A;  1XMK A;  2L01 A;  5E1Z B;  1R1U A;  1ZLK A;  3F8B A;  1Z6R A;  2L4M A;  3HHG A;  4ASN A;  1S8N A;  1UB9 A;  1X3U A;  4XBF A;  2KKO A;  5JVT A;  2M87 A;  2IA1 A;  3E6B A;  2OQG A;  3ECO A;  4UUV A;  1OPC A;  2AS5 F;  1ZLJ A;  2G7U A;  3KEO A;  2DAO A;  3WG9 A;  3ZMS A;  5CVU A;  5A2Q K;  2GXB A;  2FSW A;  2EK5 A;  1ZHF A;  3SZT A;  3BJO A;  3JSP A;  3E5U A;  2ZO4 A;  3KP4 A;  1BI0 A;  3RIR A;  2BYV E;  4HF2 A;  3LQR A;  1U2W A;  1E17 A;  1P6R A;  2QBY A;  2E7W A;  2VC0 A;  5ED4 A;  3Q9S A;  3K0L A;  1BN5 A;  5LHG A;  4KIB A;  3IL2 A;  1ODD A;  4HDU A;  1P4A A;  1Y0U A;  1P4W A;  3FMR A;  2IVM A;  3BRO A;  3T5X A;  4GXO A;  2V1D A;  2DBB A;  4U0Y A;  2Z9O A;  1U6G A;  2BBY A;  2UWM A;  3Q9V A;  1P4X A;  5ERI A;  4WXC A;  1FWZ A;  1RIO H;  1P92 A;  2ZKZ A;  3LAJ A;  1B6A A;  2O0Y A;  1J0R A;  2YX4 A;  5BQT A;  3VB2 A;  5DUK A;  2VE8 A;  2VT2 A;  1G3W A;  1T0F A;  2YSR A;  2QQB A;  5DYM A;  3SXY A;  2QZ8 A;  1R23 A;  1GXP A;  2NYX A;  1RUN A;  5CYV A;  1BI2 A;  3JAM Z;  3MZY A;  2HFH A;  1KU9 A;  5LLQ A;  3DFG A;  2PMU A;  4HX8 A;  3PQK A;  1W4M A;  3F22 A;  1MD0 A;  2HYF A;  3T8R A;  5LGT A;  1QPM A;  4OIP F;  4OIN F;  1J7K A;  1O3T A;  2LF8 A;  1BIB A;  3KP7 A;  1R5H A;  2ELH A;  4L9T A;  2EFO A;  1BI3 A;  4BXU A;  3IRQ A;  2RN7 A;  5JFR A;  2FNP A;  2LKP A;  4ZYE A;  1J9I A;  4L9V A;  3ZQ7 A;  1R7J A;  3T8T A;  2J5O A;  4HW0 A;  2VN2 A;  3EET A;  1EH6 A;  5ILS A;  3F72 A;  3TO7 A;  2PMH A;  4EJO A;  1ZRD A;  1YLF A;  4EM0 B;  1MJB A;  3MEX A;  4LMY A;  2PN6 A;  2HKO A;  5CVR A;  3SHF A;  4PGG A;  2CG4 A;  3GUD A;  1BBY A;  1I27 A;  3S2W A;  4BYY A;  1ZAR A;  4P5O A;  1ZH5 A;  2RGV A;  2D1V A;  2CQK A;  4JBA A;  3G3Z A;  1B9M A;  5H6Q A;  5K5R A;  3EDP A;  2ISY A;  5A2Q Z;  2DK5 A;  4MQV A;  1IXC A;  3V8J A;  5D4R A;  5HVQ C;  2UXN A;  3KP6 A;  1XD7 A;  1XDS A;  1XCV A;  1FSE A;  5CVJ A;  3ZMD A;  1OYW A;  3L9F A;  4MGR A;  1KYZ A;  3E6C C;  3QU6 A;  3U1D A;  1JE8 A;  4XLP F;  2CW0 F;  2DQL A;  1I5Z A;  4AD9 A;  1F5T A;  1R36 A;  2L54 A;  1FP2 A;  4EJU A;  1WQ2 A;  1B1B A;  1TW3 A;  3C1D A;  3LFK A;  5HDN A;  2O03 A;  1R58 A;  3R0A A;  2ZNY A;  4AVP A;  2Q0O A;  1FZP B;  2YR2 A;  2XKP A;  3JAM K;  1T38 A;  3K1N A;  4HYE A;  2GWR A;  2XKO A;  4PZJ A;  3QPH A;  1BI1 A;  3V4G A;  4Q48 A;  4GGG A;  2JRT A;  4O5V A;  2O3F A;  4WXD A;  1ZRE A;  2W25 A;  3COA C;  2RDP A;  1IXS B;  2IA0 A;  1XB4 A;  4U0W A;  4S05 A;  4I0B A;  2EJR A;  3DPT A;  2D1H A;  4YIF A;  1P2F A;  3HTU A;  4I7H A;  2EV0 A;  4UVB A;  3R60 A;  3FHZ A;  2P7V B;  3ML6 A;  3RI4 A;  2HDC A;  3IC7 A;  5D5X B;  5FLX Z;  4DQ2 A;  2HQR A;  2Y0M A;  1UST A;  5AIQ A;  4M74 A;  2IT0 A;  3L2C A;  2Z33 A;  1SFE A;  4S04 A;  4LLL A;  3V7S A;  2DLL A;  3T0Y A;  1HBX G;  5KVR A;  3DP7 A;  1FYM A;  3I59 A;  2ZNZ A;  2DQR A;  3TOA A;  3I58 A;  1LQ1 A;  3WGI A;  3FM3 A;  1J5Y A;  3ERE D;  3MWM A;  4BHB A;  4LGW A;  2MH9 A;  3L7W A;  3EYY A;  2PFB A;  1U5T A;  4LD5 A;  3KZY A;  4HF1 A;  1G3S A;  2HTJ A;  3ULQ B;  2VBY A;  2V6C A;  1ZGA A;  4UNO A;  2BV6 A;  4LK0 F;  3HYI A;  2QYO A;  5K5O A;  1EH8 A;  1SMY F;  2F2E A;  5IT9 Z;  3M1E A;  4FHT A;  3BP8 A;  1UHW A;  1IZ1 A;  2ETH A;  2GAU A;  1J59 A;  4IRH A;  1MGT A;  1I1S A;  3LQQ A;  5AIP A;  1WRJ A;  3H3Z A;  2L02 A;  4N9H A;  3F23 A;  3R0J A;  4OIO F;  3MCZ A;  1CF7 A;  1V3F A;  3J80 Z;  3ELK A;  3CLO A;  2Z99 A;  3F21 A;  2KIU A;  2YU3 A;  5HLG A;  5L3G A;  5JR3 A;  3GFJ A;  3WTV C;  2FOK A;  5LBQ A;  4WF2 A;  1L3L A;  1U5T B;  1QNT A;  4ON0 A;  2AXL A;  2FRH A;  3QRF F;  3RJP A;  3K9T A;  1R5G A;  2PQ8 A;  1FC3 A;  2Q8K A;  1R22 A;  2ACJ A;  1S3J A;  4A0X A;  4U88 A;  4NQW A;  5BS6 A;  1R1V A;  4QLC U;  2HWV A;  2HYG D;  2KIM A;  3F8M A;  3EQL F;  3TOB A;  1O3S A;  1S6L A;  2QM3 A;  4OMY A;  1G4D A;  5HS9 A;  3C3W A;  5J6X A;  5EEG A;  2A6E F;  2DI3 A;  4A0Z A;  4PGH A;  2JZY A;  4ZZD A;  1IXR C;  1U3E M;  1O7L A;  2XRN A;  3F6O A;  4FX0 A;  2FML A;  3BJ6 A;  3PFI A;  4TV7 A;  2OU2 A;  4BHC A;  3QP5 A;  1TTY A;  2OQR A;  4M71 A;  2A68 F;  2RVC A;  3U2R A;  1BM9 A;  3LA7 A;  2YPR A;  5DEQ A;  4MQ9 F;  1AOY A;  4L0Z B;  2TDX A;  1HW5 A;  1UHM A;  2RNJ A;  4A6D A;  1QZY A;  3F6V A;  4YFN F;  3ZMT A;  4LK1 F;  1E2X A;  1OKR A;  2QQ9 A;  3REO A;  1D5V A;  3RYP A;  1IN6 A;  4L9J A;  5D6F A;  2EA2 A;  1BJA A;  3KET A;  5L3B A;  1HXD A;  3KZZ A;  2IW5 A;  2OZ6 A;  3DQV C;  2L4A A;  5KK1 A;  5J8C A;  2FF4 A;  3OV8 A;  2P6T A;  3PQJ A;  1IAW A;  3GZ6 A;  2J5P A;  4AIJ A;  3ABT A;  5LEK A;  2FA5 A;  2HS5 A;  2CSO A;  1HW1 A;  3O2P E;  4I98 B;  1CF7 B;  4MNU A;  3NQO A;  1GHC A;  1YS6 A;  3H92 A;  2H09 A;  2NS0 A;  3RPU A;  2O6G E;  4KN7 X;  4G9Y A;  2MH2 A;  2ZFW A;  2M45 A;  1UFM A;  4CZZ A;  2EFQ A;  1SD7 A;  1XGS A;  3SQN A;  5E17 F;  4XSX F;  3TGN A;  2PJP A;  2E1C A;  2V1U A;  2X4H A;  1K78 A;  1I1G A;  3FMS A;  4A2U A;  2XAG A;  3L00 A;  1DPU A;  5E8I A;  1B59 A;  2UZK A;  2WV0 A;  4HV6 A;  1JXS A;  4A6E A;  3ZN0 A;  2DU9 A;  5HLI A;  1S7A A;  2V1X A;  5CJ9 A;  5HS7 A;  3CTA A;  4M73 A;  3WTU C;  3DPL C;  3CUQ C;  2DT5 A;  1IW7 F;  2Z3Y A;  3GLX A;  1OR7 A;  4KIF A;  1DP7 P;  3E5X A;  1ZN2 A;  4L18 B;  3LST A;  5BPI A;  1KQ8 A;  2RQP A;  3FMQ A;  5LGN A;  4CO8 A;  3V8L A;  3IKV A;  2HEO A;  3MQ0 A;  2L3D A;  3WGG A;  1HW2 A;  3WOD F;  3KP3 A;  2QLZ A;  3V8K A;  2FXA A;  1SD6 A;  5TRD A;  1LVA A;  3C7J A;  2W85 A;  3FX3 A;  2GZW A;  3J81 Z;  1HST A;  4XLN F;  2O8X A;  1K6O A;  2MLG A;  4IRG A;  1YG2 A;  1NHA A;  1T2K A;  4U7B A;  4LB5 A;  3HRT A;  1R1T A;  4P9U A;  5ICF A;  1W5S A;  4ESB A;  2R7D A;  2ZCW A;  4L5J A;  2P8T A;  1TNS A;  3GWZ A;  4E70 A;  3E5Q A;  4IPA A;  4ESJ A;  2JT1 A;  1Z7U A;  5E20 A;  4EV0 A;  4RS8 A;  1J75 A;  2M8E A;  4EJT A;  3QAH A;  4WK8 F;  4HF0 A;  2ZME A;  3WTX C;  2MC3 A;  4BNC A;  1TNT A;  5DCM A;  1HKS A;  1IN5 A;  3GEZ A;  4IRI A;  1FP1 D;  5DUI A;  3CO7 C;  2XUB A;  5E1X A;  2FMY A;  3BDD A;  1PP8 F;  4B8X A;  4I0A A;  1F9N A;  1HSJ A;  2RV8 A;  1WKM A;  4UVC A;  1SD5 A;  1LNW A;  4L9N A;  3JW4 A;  2C6Y A;  4YII A;  1HKQ A;  5DCM B;  1C0W A;  2FBI A;  3WTS C;  2VXZ A;  1FYK A;  1IN8 A;  4RGS A;  2COM A;  3MZH A;  1TQI A;  4I2O A;  4KDP A;  1YW9 A;  1H0M A;  4M9S A;  4R8H A;  3ISP A;  3O3K A;  2NNY A;  1B9N A;  1LB2 A;  2CWE A;  1XGM A;  1UCR A;  3I59 B;  3KLN A;  3I4P A;  3M7G A;  5D4S A;  2A07 F;  2GQQ A;  1JHF A;  1RNL A;  4A5N A;  2WC2 A;  4ZZL A;  3F8C A;  5HLH A;  3R61 A;  3D0S A;  1ZAO A;  2IA2 A;  4YFX F;  3KLO A;  4RGR A;  2H27 A;  3I64 A;  4QWQ A;  1XGN A;  4HX4 A;  4RB3 C;  2HQN A;  3GFI A;  3CDH A;  1D8J A;  4RGX A;  4P9F A;  1U5T C;  2FEZ A;  1WSU A;  3V7R A;  4HV5 A;  4MTD A;  4ENN A;  3LAP A;  2BGC A;  4UHT A;  4WCG A;  4EQQ A;  3M8E A;  3ZPL A;  3F8N A;  1HQC A;  1Q1H A;  2A3S A;  4HDV A;  5F64 A;  4G7H F;  4RAY A;  1F1Z A;  3FM5 A;  3GO5 A;  4N9I A;  4HQE A;  3EUH A;  2P5L C;  1T39 A;  1FBU A;  3VFZ A;  2YX7 A;  4LFU A;  1ZYR F;  3BPV A;  4Y15 A;  2JPB A;  3GVA A;  1VTN C;  3V7C A;  2F5C A;  5HOO A;  2EB7 A;  3KEQ A;  1TBX A;  5FFZ A;  1KU2 A;  5DV5 A;  1O3R A;  4EM1 A;  2XAH A;  2MBF A;  3ECH A;  5EEH A;  4JK1 X;  1FX7 A;  4LJZ F;  2K27 A;  3HUG A;  1MDM B;  2XGX A;  3ROU A;  1IRG A;  2A61 A;  2IP2 A;  3FWE A;  2WTE A;  3FXQ A;  2QWW A;  2Y48 A;  1D3Y A;  4PDK A;  1H9G A;  3M9A A;  3DEU A;  1ZG1 A;  1XMA A;  5J8F A;  2W57 A;  2K02 A;  1FOK A;  3RPQ A;  5ILV A;  2IRF G;  4N0B A;  3W6J B;  2NAZ A;  2XAJ A;  4M9Z A;  1XSV A;  2VC1 A;  4HBL A;  1BIA A;  4G6D A;  2P6S A;  2A5Y B;  5K5Q A;  3DV8 A;  2FBH A;  5LHH A;  3HOT A;  2FNA A;  4HQM A;  5ILU A;  3BY6 A;  4L0Y B;  5HS8 A;  1AWC A;  3IRR A;  2P7C B;  1XCB A;  3WU0 A;  4P55 A;  4LG0 B;  3NEU A;  2JTV A;  2R7F A;  1LDK B;  3I54 A;  2KIF A;  3RTR A;  3TDU C;  2NNN A;  3M8F A;  2EFW A;  4JQF A;  4G7O F;  3GYH X;  3BPX A;  1H9T A;  2K4J A;  4LLG F;  3I71 A;  2FBK A;  2VE9 A;  5CVV A;  2ISZ A;  4EVI A;  2LF7 A;  1PUE E;  3ZMV A;  4R1H A;  3GZ5 A;  4WXH A;  4U0V A;  1TQP A;  1T6S A;  1TLH B;  2FU4 A;  5CLS A;  5FB2 A;  1CGP A;  4M72 A;  2NRA C;  2M5W A;  3R6S A;  2OA4 A;  3CUQ B;  5FLX K;  2F5D A;  3GXO A;  3HIF A;  3LA2 A;  1SD4 A;  3ABU A;  1KQ0 A;  1USS A;  5D6E A;  3WTW C;  4IVN A;  2XIG A;  1IF1 A;  5E1W A;  3P9I A;  1FPQ A;  1F4K A;  4GYI A;  3E97 A;  5BOX A;  3RDI A;  3ZN1 A;  1QBJ A;  1FBS A;  1LEA A;  4U7D A;  1G3T A;  3C18 A;  5FFX A;  4OIR F;  4GCV A;  3J80 K;  4EMS A;  4YG2 F;  3N97 A;  2K7L A;  2VON A;  5IT9 K;  1ON1 A;  2LNB A;  2QUF A;  4IF4 A;  4DNC A;  3I53 A;  5JI6 A;  3L09 A;  2CGP A;  1LDD A;  3SFZ A;  2VBX A;  4BH9 A;  2DPD A;  1B4A A;  2EV6 A;  1W5T A;  4EGY A;  3IHU A;  2KRF A;  4LB6 B;  1SFX A;  2JSC A;  4NHJ A;  1XDU A;  3TO9 A;  2OBP A;  4ESF A;  1K7A A;  1Z9C A;  4H0E A;  4BAY A;  2O61 A;  4ZYH A;  3ZP5 A;  4XRF A;  2H6C A;  2Q2E A;  4Q47 A;  4P96 A;  4HA8 A;  2GA2 A;  4ENJ A;  3SZP A;  2P5V A;  4D0P A;  3JSO A;  5LEJ A;  2OAZ A;  4G94 A;  1Z91 A;  5F1R A;  2D2W A;  1KQ9 A;  3WE2 A;  5F6F A;  4PCQ A;  4HZF A;  2DK8 A;  3CUO A;  2MD5 A;  4UXN A;  2EV5 A;  1MJA A;  5L3E A;  2RKH A;  1KU7 A;  2G9W A;  2V9V A;  3JTH A;  2EFN A;  4L5I A;  1FT9 A;  4KN4 X;  3MAJ A;  4IHS A;  4A5M A;  2K4B A;  3HSR A;  3P7N A;  5FD5 A;  3EYI A;  4BQA A;  1LEB A;  4G6Q A;  4UVA A;  3GW2 A;  3BZ6 A;  1MZB A;  2DFI A;  1EV7 A;  4HX7 A;  2XVC A;  2PLY A;  1IRF A;  4IXA A;  1I6X A;  3Q5F A;  4AIK A;  3FXU A;  4G7Z F;  3AAF A;  2DPU A;  2MLK A;  4ENM A;  2XRO A;  4UV8 A;  1K79 A;  4Y13 A;  5E8G A;  4ETS A;  2M1B A;  4HLY A;  4RGU A;  1U8R A;  1JGS A;  1YYV A;  1DPR A;  1JHH A;  1ON2 A;  1KYW A;  3GFL A;  3DKW A;  1IN4 A;  5DDG A;  4MHG A;  2HKX A;  4MEX F;  1O57 A;  2WWY A;  1S7O A;  3J81 K;  1LJ9 A;  1ULY A;  3CJN A;  4OIQ F;  3J7A O;  1GXQ A;  5H6R A;  3N4M A;  2VBZ A;  3RYR A;  3BOQ A;  4NB5 A;  1T98 A;  2ADU A;  1O3Q A;  3HSF A;  4BHP A;  5HDG A;  5TJJ A;  3HRS A;  1XN7 A;  2ESH A;  1MKM A;  5D8L B;  3IWZ A;  3WE3 A;  1G6N A;  1YW8 A;  2EWN A;  5ICC A;  2STW A;  3ZMU A;  4RB1 A;  4FX4 A;  3KP5 A;  1J2X A;  6PAX A;  3WGH A;  3TKY A;  1FY7 A;  2MA3 A;  2VBW A;  3GFM A;  3U9G A;  5L3F A;  2IPQ X;  4WX9 A;  3HRM A;  1ZG3 A;  3P9K A;  2A69 F;  5FD6 A;  4O6J A;  2V79 A;  1IUY A;  3E6D A;  4M6Y A;  2UXX A;  1BC8 C;  3O6B B;  4UV9 A;  4I09 A;  4RB2 C;  1W7P A;  2IJL A;  4GYG A;  3HTS B;  4KNY A;  1SMT A;  4IJA A;  4KA4 A;  1SAX A;  4LG0 A;  1ZRF A;  4M9X A;  3HOS A;  2DTR A;  1XSX A;  2GIV A;  3QU3 A;  5DD8 A;  1W7P B;  2QQA A;  1YO5 C;  3NRV A;  5E18 F;  3I0T A;  5BPD A;  2G7H A;  4M6X A;  5L3C A;  2ZJ2 A;  2CO5 A;  4Q4Z F;  2H6B A;  2ESN A;  1QZZ A;  4KMU X;  1V4R A;  2E1N A;  2H94 A;  1FNN A;  4F7Z A;  1YTY A;  4XSZ F;  3KP2 A;  2FE3 A;  5AON A;  3CO6 C;  2PI0 A;  1RI7 A;  4RAZ A;  3IWF A;  2CFX A;  3GF2 A;  1A04 A;  1YIO A;  1ZRC A;  3HHH A;  2D45 A;  3P9C A;  2JPC A;  3KFW X;  2P4W A;  1K78 B;  1OYY A;  2LDU A;  1GVJ A;  4O3M A;  2HR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...