3MEXA

Crystal structure of mexr in oxidized state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
142
structure length
142
Chain Sequence
b'MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQSLAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug resistance operon repressor
molecule tags Transcription, transcription regulation
source organism Pseudomonas aeruginosa
publication title Structural insight into the oxidation-sensing mechanism of the antibiotic resistance of regulator MexR
pubmed doi rcsb
total genus 48
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mexA01
4IXAA 2QBYB 3G3ZA 1U2WA 4RGSA 1CGPA 4TV7A 1FSEA 5HDNA 3K1MA 3K1NA 4LG0B 4EJTA 3ZMDA 4H0EA 1WQ2A 2OZ6A 3IHUA 3H92A 4CGZA 1G3YA 1S6LA 2D1HA 1ZG1A 1XGMA 3V8JA 4AIKA 2MLGA 2DQRA 5BQTA 2ZJ2A 2XKOA 3I64A 2DTRA 1MD0A 1R1UA 1ZRCA 4GCVA 2JPBA 4LG0A 1Z05A 2QLZA 3N4MA 1OYWA 4M72A 2ETHA 4EMSA 1ONVA 2O0YA 4UV8A 3NEUA 3VOEA 3JAMK 3CO7C 1XMKA 1YW9A 2XAFA 3F23A 3PQJA 5HLHA 2DBBA 3F8FA 1LB2A 2EK5A 3BJ6A 1GHCA 3QU6A 2BEOA 1XGSA 1ZARA 4HF0A 5D6FA 4P96A 1G3SA 2J5PA 3R61A 3ECOA 5FD5A 1EH8A 1MZBA 4EV0A 4Q48A 1FPQA 3TO9A 3AAFA 2A6HF 2K4JA 4BNCA 2ZMEA 1LNWA 4YFNF 2HYGD 2FBHA 3EYIA 1QBJA 1FLIA 1LDKB 2QVOA 1O7LA 3ZN0A 4MQ9F 2DW4A 3N97A 3KETA 1MJBA 1HSJA 2UXXA 2V1DA 3L9FA 4I98B 1IUYA 2UWMA 4G8XA 2Q8KA 1ZGAA 1SD7A 5HOOA 1UHWA 2GIVA 1UB9A 1T0FA 1I27A 4Y15A 1EH6A 1H9GA 5CLSA 3LSTA 3F8NA 2BYVE 3OOPA 1ZHFA 4E70A 1FYLA 1I1GA 4G6DA 5DD8A 5IT3A 4GO1A 2HQNA 1SFEA 1SD6A 1T98A 1OYIA 1E17A 4WF2A 2NNNA 2F5CA 1A04A 5E1WA 5D4RA 2D2WA 2GAUA 1KU3A 3JTHA 2P7VB 3D5LA 3F6VA 1T2KA 2JTVA 3DV8A 5FLXZ 3SHFA 3L00A 2O6GE 1J5YA 4EGZA 1USSA 4A0ZA 2H94A 1B9MA 3R60A 4UUVA 1TLHB 3BZ6A 4PGGA 2HTJA 4L9VA 4ZZLA 4FHTA 2FEZA 2XAJA 3I59B 4HAMA 4A2UA 1Z7UA 2VT2A 1YFHA 1HKQA 1FP2A 4PCQA 4DQ2A 4CXFA 2AS5F 2W57A 2CO5A 2PLYA 1BN5A 3K69A 4I09A 1LDDA 3LQRA 3FF5A 4O5VA 3T8TA 2XROA 2ZNYA 2DI3A 2F2EA 1U6GA 5D5XB 2LNBA 4MTDA 3WTTC 4KYWA 4P9FA 4U88A 2XASA 1R5HA 1LVAA 5IT9Z 3M9AA 2NYXA 3KLNA 1J0RA 4BQAA 2YR2A 3C3WA 5DCMA 1JE8A 2L01A 2VODA 2IA2A 3ELKA 1FP1D 3SQNA 3GUDA 3REOA 2DFIA 3K0LA 2UZKA 3GFLA 4HLXA 6PAXA 5ICGA 4KT5C 5L3FA 5D5WB 1KYWA 5A2QZ 3F22A 4NHJA 2W84A 4YFXF 4ZYDA 4Q47A 2EFPA 2Z3YA 3WTWC 2GA2A 2RVCA 2EFQA 1F9NA 1R00A 1X3UA 2V6CA 4ZYGA 5CVVA 5LHIA 2L4AA 3KP2A 2MD5A 1O3SA 1BJAA 3WG9A 1AOYA 3BWGA 2H09A 5ERIA 3O2PE 4HX8A 3ZMTA 2RNJA 3MEXA 1QPMA 2YSRA 2PG4A 1O3QA 3TGNA 2UXNA 4KMFA 4UVCA 2FNAA 4I0BA 3I71A 3QPTA 2Q2EA 1TQMA 3M8EA 3I54A 3GWZA 4ON0A 4G94A 4BHBA 3MAJA 2QBYA 3WU1B 3E5QA 1SAXA 3HRMA 2R3SA 3FHZA 2A5YB 1STZA 2PQ8A 1QZZA 2IW5A 5ED4A 1CF7A 3I4PA 2TDXA 4QLCU 2A07F 2VOPA 2XV4S 2GA1A 4AWXB 4EGYA 1XSXA 3DPLC 3DXJF 3HTSB 4LB5A 3C7JA 1FSHA 3NQOA 1P2FA 2PMUA 4MGRA 5H6QA 1G4DA 4XSXF 4HZFA 2DK8A 4BYYA 5L3GA 5J6XA 1B6AA 2EV0A 2XAHA 4Z2YA 3ERED 2E7WA 3RDIA 5LGTA 2LSOA 2CYYA 2OQRA 2OA4A 2QYOA 2MH2A 4RAYA 5H6RA 3W6KB 1IN6A 3KEOA 5FO5A 3MWMA 3LQQA 1S7OA 1XMAA 1ZN2A 3ZMUA 1J7KA 3BP8A 5CVIA 1LJ9A 1KQ9A 3M8FA 5L3DA 3W6JB 2AXLA 3DPTA 1B1BA 2VOOA 1OKRA 1IN4A 1T38A 2A68F 2J5OA 5HS7A 1I1SA 1DP7P 1FX7A 2V1UA 4ETSA 4CDGA 2L54A 1IRGA 3ROUA 3IKTA 2ZNZA 5HS9A 1RZ4A 3E6BA 1R58A 2EJRA 3GFIA 2CGPA 1YLFA 1MDMB 3RJPA 1O3TA 4ASNA 3U9GA 1ZGJA 1K7AA 5BS6A 1U78A 3QOPA 3HOTA 5K5QA 2GZWA 1D3YA 3LA7A 1IXCA 5D5UB 5HVQC 3F6OA 2HWVA 2PN6A 2NAZA 1XD7A 2PJPA 2Q0OA 2IJLA 4M6XA 4RB2C 5D8KB 1HKSA 2M87A 4EM2A 1Z9CA 2LDUA 2PEXA 4BHPA 2GXBA 2VBYA 4KA4A 1SFXA 4ESJA 4B8XA 4HF1A 4G6QA 1KQ8A 3KZZA 1U8RA 3IKVA 1W5SA 1J2XA 3QAHA 2D45A 4L9TA 2RV8A 4M6YA 2VE9A 4M73A 4DNCA 2YU3A 2O03A 3M1EA 4B09A 3JSPA 4BH9A 4ENJA 1SMYF 3C18A 1TBXA 4AVPA 2L3DA 4AD9A 2NS0A 4ENNA 2KJBA 1K79A 3J81Z 1TNSA 1ZRDA 1PP7U 2PFBA 2HEOA 3JSOA 3GX4X 2IVMA 2RC4A 4LK0F 5ICFA 4KIFA 5E17F 4CO8A 1MGTA 4ZYHA 4LLLA 4AIHA 1UCRA 1MJAA 1EH7A 4WXCA 3WE3A 5A2QK 4N9IA 4M9SA 1TNTA 1PUEE 1SFUA 2BBYA 3P9KA 2FMYA 1O7FA 1FBQA 2EA2A 3CUOA 3TO6A 3QP6A 3VB2A 1H9TA 1YIOA 3GZ5A 4HQMA 3ZN1A 5AONA 1Z91A 2KIFA 4RB0A 3QRFF 4HDUA 3WTZA 5F1RA 4LD5A 4GGGA 3TO7A 4P55A 1T39A 2ACJA 4KN7X 2E7XA 2FBKA 4EM0B 4M74A 1J9IA 2FBIA 5CVRA 1G6NA 1Y0UA 3R6SA 3WTXC 3LFKA 4CYDA 3BJOA 4ZZDA 3JTGA 1FT9A 4M9ZA 4HF2A 1ON2A 5FFZA 3RI4A 3DEUA 1ZG3A 2Z9OA 2K86A 2KIMA 1Q1HA 4QWQA 5FGMA 4R79A 5FFXA 2W85A 2VE8A 4HOBA 1FNNA 4UVAA 4MEYF 2FXAA 4P9UA 2EFOA 4G9YA 3BROA 1FOKA 2NNYA 2EV6A 3P9CA 4IRGA 1REPC 2EWNA 2GXGA 5LHGA 4XSZF 4RB3C 3HSFA 2O61A 1UHMA 2KJCA 3J80Z 3FMSA 3KP5A 3GYHX 2FQ3A 1K6OA 1TW3A 4A6EA 5JR3A 2FNPA 2XKPA 2FA5A 2Y0MA 5BPIA 2XAQA 1LEAA 4L9JA 4ESBA 2YPRA 3CO6C 2MC3A 5CJ9A 3WTVC 4D0PA 4HDVA 5LEKA 2DT5A 1BIAA 4IF4A 3TDUC 2HOEA 1ZREA 1P6RA 2W24A 4U7BA 2R7FA 3VODA 4L9NA 4S04A 5BOXA 2V1XA 5DYMA 4JQFA 5EEHA 3U1DA 2ZKZA 3EDPA 2H6BA 5HS8A 2L4MA 3MCZA 5CYVA 2RDPA 3HOSA 4MNUA 1U3EM 4CZZA 4Y17A 4HX4A 4PGHA 1HKTA 4HA8A 1FWZA 4UVBA 1YS6A 2FSWA 3S2WA 2IA0A 2HYFA 1YS7A 3RYPA 3BPXA 2HKXA 1P4WA 2KKOA 1C0WA 5AIQA 3V7RA 3RKXA 2ELHA 2X0LA 4EJOA 1ULYA 3WTUC 3WTYC 3QPHA 2VXZA 3JW4A 3BPVA 2H6CA 2XUBA 3KP3A 1KQ0A 1IW7F 4XBFA 1O57A 2FOKA 3GW2A 3KZYA 5F6FA 1FBUA 4IHTA 1KGSA 1O3RA 3ABUA 5TRDA 3B73A 1G3TA 3F21A 1GXQA 1HXDA 2P6SA 5ILUA 3KP7A 2RQPA 1YO5C 3BY6A 3I58A 1KYZA 3CDHA 1BIBA 2FRHA 1YTYA 4NQWA 4G7OF 1R23A 3WGIA 1JHFA 1K78A 2BGCA 3HRSA 5D8LB 3FM5A 1EV7A 1R7JA 3ZP5A 4OIOF 4JK1X 1BC8C 3P7NA 1FYKA 3K2ZA 1BI1A 3MFKA 2DO7A 4L18B 5CVUA 3L2CA 4S05A 3H3UA 1F4KA 3G73A 3Q9VA 3F72A 2OU2A 3IRRA 1XDUA 2VBZA 1ZLKA 4N9HA 1PP8F 1ON1A 2CWEA 1W5TA 5E1ZB 4G7ZF 3H3ZA 3HIFA 1Z6TA 5J8CA 1MKMA 5D5VB 4U7DA 5JI6A 3ML6A 5K5RA 1GXPA 3CUQB 1WSUA 3FZVA 4NB5A 1E2XA 5KK1A 2Z99A 4WX9A 2XVCA 5TJJA 5H20A 5L3EA 4HYEA 4UXNA 1V4RA 5FLXK 5L3BA 3U2RA 2JZYA 2OAZA 2A3SA 2DPUA 4RAZA 2EV5A 1HBXG 1Z6RA 4U0YA 4GXOA 3BJAA 3J81K 1BI2A 3R0AA 4OMZA 3WGHA 3IWZA 1R1TA 3Q5FA 1DPRA 3QP5A 2IPQX 5HLIA 2VONA 1OYYA 4WXHA 5KVRA 3CUQA 5F64A 2E1NA 4YIFA 2VBXA 3V4GA 5E1XA 2CSOA 4N0BA 4FX4A 4PDKA 2W25A 4XLNF 4L5IA 4YIIA 4RS8A 4I01A 4OMYA 3FXRA 3R4KA 3V8KA 1IF1A 5D6EA 3F8BA 1P92A 1FY7A 4FX0A 2X4HA 2M30A 3HSEA 4YG2F 1FC3A 2H27A 1GVJA 3F8MA 4WCGA 1L0OC 1ZAOA 4OU0A 4HQEA 5E20A 3CJNA 1SMTA 3CUQC 4OIPF 4BHCA 3V7CA 3VEPA 1IN8A 2XGXA 1IZ1A 4EQQA 3ECHA 1U5TB 1RUOA 2ZBKA 4OINF 1ZLJA 2KRFA 3I5UA 3HHHA 1QQIA 1BOAA 5AIPA 3EETA 1RIOH 2HFHA 3J80K 1BI0A 1DPUA 1ZRFA 1XN7A 4AIJA 2K02A 4A0XA 3V8LA 1H0MA 2M5WA 3EUHA 4ZYEA 4IRHA 3GFMA 2ZMEB 2K4BA 3J7AO 2DU9A 2QUFA 2WV0A 1W7PD 4GYGA 2Z5UA 1YYVA 1ZG5A 1XCVA 4WWCA 3CTAA 2DK5A 1JXSA 2XIGA 4LB6B 3KEQA 5LGNA 4PZJA 4O3MA 1S7AA 2Y75A 5LHHA 5E8GA 4JBAA 1LQ1A 2QZ8A 3TOAA 1USTA 4ESFA 2GQQA 3ZMVA 1ZH5A 3WE2A 1LDJA 2STWA 5CVJA 3M7GA 4LLNA 2P8TA 2CW0F 2V9VA 3COAC 3DFGA 5ICCA 4KUMA 5D4SA 1BM9A 1B9NA 3IC7A 3TOBA 2HS5A 3DP7A 2CFXA 4G7HF 3ZMSA 2DPDA 2JRTA 5LBQA 1B59A 3ZQ7A 1D5VA 1YG2A 3BDDA 1TTYA 4HW0A 1BBYA 3EQLF 1SD5A 1WI9A 1UFMA 1JHHA 3E6DA 3FXUA 2BE5F 2M8EA 2MBFA 2HTSA 5LGUA 5JVTA 1HW5A 3IWFA 1J59A 4K2EA 2LF7A 5EEGA 3FM3A 4LMYA 4O6JA 3FMQA 2WC2A 2M1BA 4OIQF 2P5VA 3HUGA 4MHGA 3ISPA 2MH9A 1K78B 1WWXA 5LRSA 1I5ZA 2HZTA 2ADUA 3HYIA 3RKWA 1HW1A 1YW8A 2E1CA 3I59A 3Q9SA 1ZYRF 3WTSC 3DF8A 2OZUA 2ESNA 2EA4A 3LA3A 3GZ6A 4KNYA 3WODF 2F5FA 2P5LC 1R1VA 1ODDA 1WRJA 1U5TA 4CICA 3GF2A 3VFZA 1XGNA 5DD4A 5ICEA 4U0WA 3KCCA 1W7PA 1YQAA 3K9TA 5E18F 3SZPA 3SZTA 5DUIA 2B0LA 2Z33A 3GXOA 4MTEA 4GYIA 1I6XA 3NRVA 1P4XA 3R0JA 3O6BB 2BV6A 5HLGA 2YX7A 5HDKA 5FB2A 2A69F 1V3FA 4ENKA 3ULQB 4ENMA 5JHUA 1XDSA 2ZCWA 1KA8A 2CG4A 3GLXA 4U0VA 2JT1A 4RGRA 5DCFA 5LEJA 1MJ9A 2XRNA 2JSCA 1IXSB 3HRTA 3KE2A 3B02A 1RI7A 3E5XA 2P4WA 4L5JA 2QQAA 2ZO4A 3HHGA 4HBLA 1IRFA 2LKPA 3TQNA 4P5OA 3ZPLA 2QWWA 2G9WA 4F7ZA 4MQVA 4BXUA 4I7HA 1LEBA 3LWFA 2VN2A 5E8IA 1G3WA 1QGPA 2D1VA 1IN7A 1TQPA 2DLLA 4L0ZB 1TW2A 5DDGA 3KP6A 1FBSA 2OD5A 2ZFWA 1P4AA 1IN5A 1HSTA 2HR3A 4UNOA 3RPQA 3IL2A 3HSRA 3I0TA 1QZYA 4EM1A 3IRQA 3KLOA 3T1BA 4KIBA 2M45A 3RYRA 2XAGA 3L7WA 1W4MA 3DKWA 1R36A 3KP4A 4KIGA 3RPUA 1DDNA 3WGGA 1OR7A 4I02A 1S29A 5HDGA 1PDNC 4KDPA 4KFCA 4WXDA 3ZMZA 3FX3A 4Q4ZF 2Y48A 3TKYA 1BC7C 4A0YA 2O3FA 3PQKA 3V7SA 4LK1F 4HX7A 1R5GA 1RNLA 4CHUA 2ZXJA 2VC1A 2G7UA 3RKYA 1XGOA 4BAYA 5K1YA 2K27A 1L3LA 4RB1A 4MEXF 4OOIA 2A6EF 2HQRA 4OIRF 2QM3A 4R8HA 4M71A 3GEZA 4HLYA 1NHAA 2PBIA 3MQ0A 4LLGF 2IP2A 2R7DA 3TDZC 5DUKA 1KU9A 3JAMZ 3E3VA 4XLPF 2VC0A 1J75A 1XSVA 2G7HA 3ABTA 4XRFA 1F5TA 2FU4A 2QQBA 3RTRA 2QQ9A 3E97A 4FT8A 4UV9A 2RKHA 2ISZA 1XSDA 1BI3A 5J8FA 1KU7A 1WKMA 2EFNA 1JGSA 2IT0A 3FMRA 3KFWX 1B4AA 2C6YA 4UHTA 4A6DA 2HGCA 2OBPA 3HRUA 5LRRA 4A5NA 1FZPB 3LA2A 2PMHA 2FE3A 3T8RA 1MDMA 1XCBA 2MA3A 1T6SA 1OMIA 1KU2A 5JFRA 5ILSA 4KMUX 2KIUA 3OV8A 2LF8A 3E5UA 2L02A 5DCMB 2GWRA 5ILVA 3T0YA 3O3KA 2ISYA 2IRFG 3F3XA 1S3JA 3T5XA 3E6CC 2HDCA 2P6TA 2WTEA 1IAWA 4R1HA 2JPCA 4HV5A 5DV5A 2STTA 1OPCA 3K1PA 2RGVA 1S8NA 1FYMA 1TQIA 2P5KA 2P7CB 1SD4A 2FF4A 4EJVA 3FXQA 4WK8F 2MLKA 4YFKF 2XHKA 1U5TC 3PFIA 3EYYA 4M9XA 1HW2A 3RIRA 2NRAC 2FMLA 2V79A 3LAPA 4LGWA 2A61A 1VTNC 1IXRC 2VT3A 5BPDA 3I53A 4A12A 3F8CA 4IPAA 2RN7A 5L3CA 3L09A 2QENA 4RGXA 5BMZA 3GVAA 4IVNA 2ESHA 4KN4X 3LAJA 4EVIA 4EJWA 1XB4A 1Z1DA 1F1ZA 2COMA 2EFWA 4LFUA 3C1DA 1DUXC 3BOQA 3SXYA 5FD6A 1QNTA 1D8KA 4IRIA 4KICA 5K5OA 4RGUA 3SFZA 3MZYA 4Q5SF 2DAOA 2IA1A 1QO0D 5DEQA 3FWEA 3P9IA 2WWYA 4ZH4F 3QU3A 2HKOA 2PI0A 3GO5A 2YX4A 3HTUA 2EB7A 3MZHA 1AWCA 5LLQA 1RUNA 5IT9K 3D0SA 4A5MA 3E6MA 4Y13A 4I2OA 2F5DA 2K7LA 1W7PB 4LJZF 4IHSA 3DQVC 1CF7B 1YW7A 2OQGA 2CQKA 4HV6A 2VBWA 3CLOA 4IJAA 3GFJA 4I0AA 1HQCA 1R22A 1D8JA 4EJUA 2DQLA 3WU0A 4L0YB 2F5EA 2O8XA
chains in the Genus database with same CATH superfamily
1Z3YA 1ZK8A 2I10A 4IXAA 4N4NB 2DA5A 4ABZA 5K7ZA 2QBYB 3G3ZA 4KJZA 1U2WA 1IGNA 4RGSA 1CGPA 2CU7A 3DWLE 3PO3J 4TV7A 5BNGA 4NBQA 1FSEA 5HDNA 3K1MA 3K1NA 2OF7A 4XR6A 3BQYA 1MBFA 2DOAA 4BE2A 4LG0B 3BTIA 4EJTA 3ZMDA 4H0EA 5J40A 1WQ2A 2OZ6A 2LVSA 3IHUA 3H92A 4XKWA 4HNTA 1JKOC 4CGZA 1G3YA 1S6LA 1SC7A 2D1HA 1ZG1A 1XGMA 3FIWA 3V8JA 3E1SA 4AIKA 4BXXJ 1MNEA 1Z21A 4E7IA 2HU9A 4NUBA 2MLGA 2CUEA 3ZQGA 1JUMA 4DYQA 4IOCF 2DQRA 5BQTA 2ZJ2A 2VXDA 2BW3B 2XKOA 2EILH 3I64A 5KHDA 2DTRA 1MD0A 5B66C 4RAFA 1R1UA 1ZRCA 2LK2A 4GCVA 2JPBA 3OR2C 4LG0A 1Z05A 2QLZA 3N4MA 1OYWA 2M0MA 4M72A 1TWCJ 2E34A 4AU7A 3SEQA 2K3FA 2NVXJ 2LY9A 3S2HJ 3QQAA 2ETHA 2E36A 1X1BA 2HQAA 2LKSA 4EMSA 1ONVA 2O0YA 4UV8A 3KYDB 2OCEA 3NEUA 3VOEA 3JAMK 3CO7C 3DEEA 1XMKA 2ME0A 3OYEA 1YW9A 4RM2A 2K9SA 2XAFA 3I55I 3PQJA 1ENHA 3F23A 5HLHA 2DBBA 4CYCA 2ECBA 3F8FA 1R71A 1LB2A 2EK5A 3BJ6A 1BR4A 1JKRC 4CYCB 1GHCA 3QU6A 2BEOA 2Y0SA 1S9HA 1XGSA 1NG7A 1ZARA 2VI6A 1YJNI 4HF0A 1U8BA 5D6FA 2X1DA 4P96A 2V4JC 1G3SA 2NS7A 3SDBA 5DM7F 2J5PA 2K40A 3S14J 1OCOH 3R61A 2FQ4A 3ECOA 5FD5A 1EH8A 4YRVA 1MZBA 5EZGA 4Q48A 1FPQA 3TO9A 4B48A 4EV0A 3OIQA 2A6HF 3AAFA 1RPWA 5HODA 2K4JA 1TT5B 2A5WA 1N77A 4BNCA 2ZMEA 3A01B 1LNWA 4YFNF 4IEJA 2HYGD 2FBHA 3EYIA 1QBJA 1FLIA 4BY7J 1LDKB 2DFHA 2I5UA 2QVOA 4FE4A 5FROA 1O7LA 3X2QH 3ZN0A 4MQ9F 2QSFX 3S2DJ 2DW4A 3N97A 2CW7A 3CCYA 4BGDA 5IY5H 3KETA 1MJBA 1WGXA 3HC7A 3PSFA 1HSJA 1UMQA 1YOVB 1VQPI 2UXXA 2V1DA 3FKIJ 3L9FA 4I98B 1IUYA 3DTIA 1ETVA 2QGUA 2UWMA 4G8XA 2Q8KA 1ZGAA 1SD7A 5HOOA 1UHWA 3GTOJ 5FKNA 2E5ZA 1UB9A 2GIVA 1RESA 2JMWA 1GT0C 2VPLA 1T0FA 1I27A 4Y15A 1EH6A 1H9GA 5CLSA 4A3CJ 3ZQCA 2FJ1A 2R7OA 3LSTA 3F8NA 2BYVE 4GDFA 1YX5A 2BY1A 3OOPA 3CD6I 1ZHFA 5B3SH 4E70A 2R7ZJ 1FYLA 1I1GA 4F93B 5M5YJ 1RC9A 1W1WE 4G6DA 3KIOA 2JQ7A 5DD8A 5IT3A 4GO1A 2HQNA 4PJ0C 1NK3P 1SFEA 5M5XJ 1WJCA 3WHCA 1SD6A 1T98A 2EPFA 2ZJQF 3FK7A 5TISC 1OYIA 4H4KC 2DFEA 1E17A 3IV5A 4WF2A 1TC3C 2NNNA 2F5CA 1A04A 1BW5A 3A03A 5E1WA 5D4RA 4ZDLA 3JRBA 2D2WA 2KZVA 2V7FA 2GAUA 2V9KA 1KU3A 3JTHA 2DA2A 1R5ID 2P7VB 1OFCX 3D5LA 5KAIC 3F6VA 1ZGWA 1T2KA 3DV8A 2JTVA 2EIMH 2JN6A 5FLXZ 1B8IB 3A4CA 4PFPA 2M4KA 3SHFA 4RLQA 1WPKA 3L00A 4XRMA 4NNJA 2O6GE 4C3IJ 1J5YA 2XGCA 3ZCOA 4EGZA 1USSA 1ZR4A 4A0ZA 1U9OA 2H94A 1B9MA 1AA7A 2LTPA 3R60A 4UUVA 1ETQA 1TLHB 1JT6A 3BZ6A 5LFAA 4PGGA 4NC7A 1F36A 3RKQA 2HTJA 4L9VA 1QU3A 4ZZLA 3PUFA 4FHTA 2FEZA 2F5VA 2AQFA 2XAJA 4ZTJA 3IH2A 1AHDP 3I59B 4CZCA 4HAMA 1H8AC 4A2UA 1Z7UA 2VT2A 4YIRX 2AXTC 3QYFA 1YFHA 3U21A 2L7ZA 1T0FC 1HKQA 4XKBA 1FP2A 2XPVA 1OCTC 4PCQA 4M3EA 4DQ2A 2LLKA 4CXFA 2AS5F 2W57A 4PFOA 4CUGA 2CO5A 2PLYA 1BN5A 3K69A 4MFDA 5H2FC 4I09A 1LDDA 3LQRA 3FF5A 2VQGA 4YELA 4O5VA 1SANA 2OTJI 3T8TA 1GV2A 2XROA 2DCEA 2M4GA 2ZNYA 1T8IA 2DI3A 2F2EA 1U6GA 3QPSA 3TL4X 5D5XB 2VKDA 4LIVA 3DLLF 2LNBA 1DGRM 3K4LA 2DJIA 4MTDA 1Y1VJ 3HL2A 2BW3A 4IO9F 3WTTC 2IGNA 4KYWA 1X1DA 4P9FA 3OYNA 4U88A 4CCMA 2DN0A 2KRCA 2XASA 1LFPA 1R5HA 3KYCB 3S1MJ 1QRYA 1LVAA 4XK4A 2E60A 3ZR8X 5IT9Z 3M9AA 3PIPF 3ZQIA 2NYXA 3KLNA 2XSJC 1J0RA 1OCCH 5GPCA 4BQAA 2R0QC 2YR2A 3ZQQA 3CC7I 2H1KA 2R92J 4CCNA 2X1EA 3S1NJ 3C3WA 5DCMA 1JE8A 2L01A 2VODA 4A69C 2IA2A 4AYBN 3ELKA 1FP1D 3L2RA 3SQNA 3GUDA 3REOA 1HCRA 2DFIA 3K0LA 2UZKA 3GFLA 2ZSIB 4HLXA 6PAXA 5CKTA 3OYFA 4M3BA 4XLHA 5ICGA 4KT5C 5L3FA 1T56A 5D5WB 1KYWA 4BBSJ 2GBYA 5A2QZ 3TEDA 3MVPA 2TCTA 3PO2J 2LYCA 1V5FA 3F22A 4NHJA 2W84A 2X6WA 3BQZA 2CH0A 4YFXF 2R5YB 1DU6A 1X1PA 4J19A 4ZYDA 4Q47A 3OYHA 2EFPA 3RPUD 3W6VA 3F0CA 2W4SA 2Z3YA 1ZELA 1QHHD 3WTWC 2A6TA 4DZPA 1X4OA 2GA2A 2RVCA 3LMMA 2M3AA 2EFQA 4IQJA 1F9NA 1FIAA 1R00A 1X3UA 4XRSA 2K9LA 3A1YA 3TP0A 2V6CA 5CQGA 4ZYGA 5CVVA 2PMZA 4MO7A 1VQ4I 5LHIA 2XB0X 2L4AA 3KP2A 2MD5A 1O3SA 2M9HA 1I50J 5F1JA 4GFBA 1BJAA 3WG9A 1K83J 1AOYA 3BWGA 2H09A 5J1RA 1WH7A 5ERIA 1IUFA 2LOOA 1ZKGA 1D1CA 4II2A 3O2PE 3L1PA 4HX8A 3ZMTA 3MKWB 2RNJA 3MEXA 2F4OB 4B3XA 1QPMA 3ASNH 2YSRA 2F4IA 2PG4A 1O3QA 2DDAA 1LE8A 2LY1A 1Y0NA 2BY0A 3A02A 2P81A 5EYRA 3TGNA 5IOYA 4XICA 2UXNA 1E3HA 4KMFA 4UVCA 2FNAA 4XKCA 4I0BA 4II3A 1Y6IA 3I71A 3IAM2 3BR3A 4EATA 3QPTA 4G12A 2Q2EA 3S3OA 2VLAA 1TQMA 3M8EA 2HXOA 3I54A 3GWZA 1U0JA 4ON0A 4G94A 4BHBA 1WHUA 1TL8A 3BG7A 3C2GA 3MAJA 2QBYA 2HQ5A 2XPWA 3WU1B 3H9QA 3MMYB 3PNTA 3E5QA 1SAXA 2WY7Q 3PL8A 3HRMA 1JI8A 2JJ7A 2R3SA 3FHZA 3DEWA 2A5YB 2L2OA 1STZA 4XOPA 2KPMA 4FE7A 5J47A 2PQ8A 2E1OA 1IDYA 3CCQI 1QZZA 1UG2A 2IW5A 5ED4A 4JX4A 1CF7A 3I4PA 2TDXA 2L9RA 4QLCU 2A07F 4A3DJ 3HEFA 2ECCA 2VOPA 2XV4S 4X1EA 1H89C 2DXIA 2GA1A 3OWTA 4AWXB 1ZTRA 4EGYA 3HOVJ 1XSXA 3DPLC 3DXJF 3HTSB 4LB5A 3C7JA 9ANTA 1X1AA 1FSHA 3NQOA 1P2FA 4J00A 3HOWJ 5EGOA 2KHMA 2PMUA 2R5ZA 2HDDA 4MGRA 1GVDA 1IJWC 1NTCA 3HPHA 3GTJJ 1H88C 1MMAA 3AG2H 5H6QA 1G4DA 3C2BA 4XSXF 4HZFA 2DK8A 4BYYA 5L3GA 1IRXA 5J6XA 4CCJA 1B6AA 3SJMA 3CF5F 2EV0A 2X6XA 1VQ5I 4BBRJ 3RSNA 2XAHA 4Z2YA 3ERED 2E7WA 1MIJA 3RDIA 5FJ8J 5LGTA 3S16J 2LSOA 1FOWA 2CYYA 2OQRA 3BR5A 2IAIA 3BG5A 1Z77A 1FMVA 3NWTA 1A35A 1QHGA 1PVEA 3QODA 3LSGA 2OA4A 2X6OA 3OR1C 5B5EC 2QYOA 3H5AA 2MH2A 4RAYA 5H6RA 4BEHA 3W6KB 1IN6A 3KEOA 4PSWA 4C3HJ 5FO5A 3DU6A 1NG6A 2QKLB 1AKHA 3MWMA 2RQQA 1S7OA 3LQQA 1XMAA 1ZN2A 4A3MJ 3ZMUA 1J7KA 1RKTA 3BP8A 4JYKA 2VL8A 5CVIA 4BY1J 1LJ9A 1KQ9A 3GCMA 3MKLA 3M8FA 1GDTA 2NVQJ 5L3DA 3W6JB 2AXLA 3HPGA 3DPTA 3CQZJ 4J01A 3CDIA 2VKHA 1B1BA 1I3AA 1SFOJ 3VYSB 3DCFA 4CCKA 2VOOA 1OKRA 1IN4A 1T38A 4BJ6C 4QTRA 4W97A 1V5EA 2A68F 2J5OA 4PSXA 2DJNA 5HS7A 1DP7P 1I1SA 1FX7A 2E35A 3FDYA 3FXKA 2V1UA 4ETSA 4BDYA 4CDGA 2L54A 1IRGA 2BZTA 1A31A 3ROUA 1BA5A 3IKTA 2ZNZA 5HS9A 2X9DA 1RZ4A 4B3AA 3E6BA 1IDZA 2WBMA 1KONA 1R58A 2EJRA 3BR0A 3GFIA 2CGPA 1YLFA 3H0DA 1MDMB 3LSKA 3ASOH 3JRGA 3RJPA 1O3TA 4ASNA 1K61A 3U9GA 5FLMJ 1ZGJA 1K7AA 5BS6A 1U78A 3QOPA 3S1RJ 2R7TA 2MYSA 3HOTA 2HOTA 2H8RA 5K5QA 4CCOA 5GADJ 2GZWA 1D3YA 2W48A 1IV8A 3LA7A 1IXCA 2ZXWH 5D5UB 5HVQC 3IAS2 3F6OA 2BY2A 3NWSA 2HWVA 2PN6A 2XSDC 3S17J 4RMNA 2NAZA 2K9MA 1FIPA 1XD7A 2PJPA 2Q0OA 1HDPA 1IC8A 2IJLA 4M6XA 4RB2C 3OSFA 4MLOA 5EZHA 1JTXA 2KDOA 5D8KB 4MIMA 5EG0B 1HKSA 3CCRI 2M87A 5J4VA 4EM2A 1Z9CA 2LDUA 2PEXA 3S3NA 4BHPA 3BZKA 3EUAA 2EIKH 1BL0A 2GXBA 2GOMA 2VBYA 1LVKA 4NDLA 1SFXA 4KA4A 4FETA 4ESJA 4B8XA 4HF1A 4G6QA 1KQ8A 3KZZA 1U8RA 2YUSA 3DU5A 3IKVA 3PJRA 2L9VA 3OYAA 1W5SA 1J2XA 3QAHA 4ZDPA 2D45A 5EDNA 4HPQA 4L9TA 2MW8A 3SEZA 3OY9A 2RV8A 4M6YA 2VE9A 4M73A 4DNCA 2YU3A 2O03A 3GBGA 2VQLA 3M1EA 2VKVA 4B09A 3TW6A 2BXZA 3JSPA 4BH9A 4ENJA 4E6KG 2K9NA 1SMYF 2KLOA 1QZEA 3C18A 4MFEA 1TBXA 4AVPA 2L3DA 2LC2A 4AD9A 4IOAF 2NS0A 2R7UA 1W0TA 2E5NA 4ENNA 2EZIA 2KJBA 1K79A 3J81Z 1TNSA 1MSEC 1JT0A 1YRNA 1ZRDA 1PP7U 5IOZA 2PFBA 3HXLA 5J4YA 2K9QA 2HEOA 2F6CA 4FASD 3JSOA 2IVMA 2RC4A 3FBNB 1RETA 4LK0F 3A0HC 5ICFA 3GX4X 4KIFA 4A93J 5E17F 4CO8A 1MGTA 4BDZA 1LUJB 1R6RA 2UV1A 2LH9A 2IGMA 4ZYHA 4HG2A 4CH7A 2R7WA 4LLLA 4AIHA 3JRCA 1WJ5A 4Y7NJ 1UCRA 1MJAA 1EH7A 4WXCA 3WE3A 1X3WB 4IKFA 1WI3A 5A2QK 3H35A 4N9IA 4M9SA 2JA5J 1TNTA 1G2HA 1PUEE 3DTEA 4UB8C 4B1RA 3WU2C 1SFUA 2E1MC 2BBYA 3P9KA 2FMYA 3ABKH 5EG0A 1O7FA 1FBQA 4DOZA 2ZXHA 3M4OJ 2EA2A 3CUOA 3TO6A 3QP6A 3VB2A 3PSIA 1H9TA 2MGQA 1N78A 1YX3A 1YIOA 3GZ5A 1VQKI 4HQMA 3TBIA 4AUXA 5DTDA 2K5CA 3ZN1A 4ANJA 5AONA 4BKXA 1Z91A 1QVTA 2KIFA 3F9KA 4RB0A 3QRFF 2XDVA 4HDUA 3WTZA 5F1RA 4LD5A 4GGGA 2Y2ZA 2OV7A 3TO7A 2DYSH 4P55A 1VQ7I 3KZIC 1T39A 2ACJA 3DPUA 4XLEA 5KNLA 4KN7X 2H1LA 2E7XA 3PM1A 2VUMJ 2FBKA 3HB9A 3BTJA 3OSGA 4EM0B 2XAUA 4M74A 1UJ8A 1J9IA 2FBIA 5CVRA 2IS2A 1WJFA 1IO2A 3GZNB 1G6NA 1Y0UA 3K2AA 2K3PA 3R6SA 3WTXC 2JVHA 3LFKA 4Y4RA 1E3PA 1IG7A 2L5QA 4CYDA 3WG7H 3BJOA 4JX6A 4ZZDA 3JTGA 2HVQA 5E3LA 1FT9A 4M9ZA 4IHYA 3CZ6A 1IV6A 1TT0A 4HF2A 3CJTB 1BW6A 3K4MA 1K4SA 4A3GJ 1ON2A 5F0CA 5FFZA 3RI4A 3DEUA 1ZG3A 1GV5A 3HGYA 2Z9OA 4XN3A 2K86A 2XB5A 1FOXA 2KIMA 1Q1HA 3K4JA 4QWQA 5FGMA 4R79A 4UUSB 2M7AA 1ETOA 5FFXA 3G1MA 2W85A 4Y33A 2VE8A 4HOBA 2B9SA 1FNNA 2DMQA 2CV0A 4UVAA 4RAGA 5B1AH 4B4CA 3RZDJ 4MEYF 2JK3A 2FXAA 4P9UA 4P1WA 3HZJA 1U9NA 2EFOA 4G9YA 2FX0A 3BROA 2NNYA 1FOKA 2EV6A 2WAQA 3P9CA 4IRGA 2LP0A 1REPC 4BEHB 4D5CA 2EWNA 2GXGA 3MD2A 4XSZF 5LHGA 4RB3C 2HYJA 2JUCA 4A3KJ 3HSFA 2JUGA 3GTQJ 2HZDA 1WJEA 4E7KA 1EA3A 2O61A 1UHMA 2KJCA 3ZQLA 3J80Z 3FMSA 4PJJA 3KP5A 3GYHX 2XC7A 2CUFA 2FQ3A 1K6OA 1TW3A 1XX5A 4A6EA 3IP4B 5JR3A 2OTLI 2YU9J 3H3VK 1RRJA 2FNPA 2XKPA 1OLTA 1BR2A 2FA5A 2WB1N 2XAQA 2Y0MA 5BPIA 4ZDOA 1LEAA 1V54H 1SVLA 3LSJA 4XORA 4L9JA 4ESBA 5GTHC 2DMPA 5IPAA 3OS0A 2YPRA 3CO6C 3G71I 2MC3A 5CJ9A 3WTVC 2ZJPF 4D0PA 4HDVA 2LG4A 5LEKA 3JRDA 4BE1A 2DT5A 1Q1VA 3SFIA 2NXNB 1BIAA 4IF4A 1MBHA 3I3LA 4D5FA 3TDUC 3CMAI 2HOEA 1ZREA 3J7AY 5K7HA 1P6RA 3AL0C 2W24A 4U7BA 2KQRA 2R7FA 3VODA 4L9NA 4S04A 1J09A 5BOXA 2V1XA 4A3EJ 5DYMA 4V19K 2X6YA 1N25A 2H8WA 3K7AJ 4GRIA 1A36A 4JQFA 5EEHA 3U1DA 5JLXA 1XMXA 3PFYA 2ZKZA 1ETKA 3EDPA 2H6BA 4S0HB 5GAHJ 2ID6A 5HS8A 3OYGA 2L4MA 1B72A 1SVMA 5F0HA 3MCZA 5CYVA 2RDPA 3HOSA 4MNUA 1MBKA 1U3EM 4CZZA 4Y17A 4HX4A 4PGHA 2D5VA 1HKTA 4HA8A 1WJAA 2LFBA 5GAEJ 1FWZA 1WFXA 3QPLA 2HI3A 4UVBA 4IL6C 1UAAA 1YS6A 3FXMA 2DMTA 4NC8A 2FSWA 1PYVA 3S2WA 2IA0A 5JLWA 2HOAA 1YS7A 2HYFA 2OUMA 3RYPA 3BPXA 2HKXA 4BL0B 1P4WA 4LG3A 2KKOA 1C0WA 5AIQA 3V7RA 2PMZN 3RKXA 2ZC2A 3FXLA 2QEXI 2KIQA 2ELHA 5CPRB 2QSHX 2X0LA 4EJOA 4DYCA 3OYJA 2ICWG 3GTMJ 1ULYA 2JRMA 1T33A 3SDGA 2WAFA 3WTUC 2HPIA 1TWGJ 3WTYC 3MZ8A 3LSMA 5FKKA 1MBGA 3QPHA 2VXZA 3JW4A 3BPVA 2H6CA 2XUBA 3KP3A 1KQ0A 3WHBA 1T08B 1IW7F 4XBFA 1O57A 4XQFA 5LD2C 5IYBJ 1XTAA 3O8GA 1ERDA 1R49A 2FOKA 3W2VA 3OS1A 3BCAA 2FUG2 1E3OC 4A3FJ 3GW2A 1MH4A 3KZYA 3DKXA 1FBUA 5F6FA 2L7MP 4IHTA 4M3GA 1KGSA 1Y39A 3HUGB 1O3RA 2CFOA 3ABUA 4IHWA 5TRDA 3MKZA 3B73A 4AYBA 3OIPA 1G3TA 4DZJA 3F21A 1GXQA 1HXDA 3M1CA 2P6SA 4PUSA 3K4NA 3KP7A 2RQPA 3BG3A 5ILUA 3AKZA 3LSPA 1YO5C 3FK6A 3BY6A 4AM3A 2BVMA 3ZRGA 1WVRA 3I58A 3HOXJ 1TWAJ 3OIOA 2TRTA 3Q3SA 2ME6A 2BHZA 5EF6A 1KYZA 4UB6C 3VYRB 5JHFA 3CDHA 1MBEA 1BIBA 2FRHA 1YTYA 4NQWA 4G7OF 1K4TA 1R23A 2AQEA 3WGIA 3BC8A 2Y30A 3K4CA 1JHFA 5GP9A 2NS8A 3EUKL 1K78A 4IQ4A 3HOZJ 5F0FA 2BY3A 2BGCA 3HRSA 5D8LB 3FM5A 2MG4A 1EV7A 1R7JA 4BQQA 3ZP5A 4OIOF 4JK1X 1BC8C 3P7NA 1FYKA 3K2ZA 1BI1A 3QWLA 3A0BC 1OCZH 3MFKA 3BLYA 3OYLA 3D5RC 2DO7A 4L18B 5CVUA 4RLFA 3L2CA 2DOFA 4S05A 4XONA 3H3UA 1F4KA 4X6AJ 2RREA 3G73A 3Q9VA 3F72A 3W2WA 2OU2A 3IRRA 1XDUA 4Y52J 2ZFUA 2VBZA 1ZLKA 4N9HA 1PP8F 3CF2A 2PJRB 3GTLJ 4DJAA 1ON1A 2CWEA 1W5TA 4EEFG 5E1ZB 1ETWA 4G7ZF 2JA6J 3H3ZA 1HOMA 3HIFA 4XN0A 1Z6TA 5J8CA 3LL7A 1MKMA 4L5EA 5D5VB 4U7DA 5FRNA 5JI6A 3ML6A 1YHQI 5K5RA 1GXPA 2O8KA 3CUQB 3N05A 1WSUA 4G6TB 3FZVA 2AHQA 4PK4A 4RBOA 4NB5A 1E2XA 3KYLA 1PJRA 3RZOJ 1ETXA 5KK1A 4AVZA 5FLVA 1XG1A 3JRAA 2Z99A 4WX9A 2XVCA 5TJJA 2XRLA 2KZGA 5H20A 1YI2I 1OJLA 3ABMH 4JOMA 2KFDA 1RR8C 5L3EA 4HYEA 4B47A 2HDWA 2LBFB 4UXNA 1V4RA 2DMUA 4HNVA 2RNGA 2XF6A 5FLXK 5L3BA 3U2RA 2JZYA 3HJEA 2BXYA 5GTIC 4DGWB 2OAZA 2WA0A 2A3SA 4V2GA 2DPUA 4RAZA 5EGOB 4LITA 3U1KA 2JWTA 3LNQA 3VWBA 1WJDA 2EV5A 2CW8A 1HBXG 2W00A 3H0GJ 4JX5A 1Z6RA 2E1MB 4U0YA 2E2HJ 4GXOA 3BJAA 4RM3A 2W7NA 5IYCJ 1FEXA 3J81K 2DA1A 2CS3A 2B7EA 4QPQA 1BI2A 3R0AA 4OMZA 3S8PA 3WGHA 4BACA 2DA3A 3IWZA 1R1TA 4M3FA 1LPQA 1UHSA 2DMNA 1X4PA 3Q5FA 1JUSA 1FJLA 1DPRA 3QP5A 2IPQX 5HLIA 1YJWI 2VONA 1OYYA 2DTZA 2DYRH 5F04A 4WXHA 2DODA 5KVRA 3CUQA 1DU0A 5F64A 3JRHA 2E1NA 4YIFA 2VBXA 3OL3A 3E7LA 3V4GA 4XKVA 5E1XA 5DS9A 2CSOA 4N0BA 1RKWA 3BG9A 2EIJH 3HKZN 4FX4A 4C30A 4PDKA 2W25A 4XLNF 4L5IA 2I8DA 4NQWB 4YIIA 3H1CA 4RS8A 1NH3A 2Q1ZB 4I01A 4OMYA 4XLFA 3FXRA 3R4KA 3V8KA 1IF1A 1B8IA 1JTYA 4E7ZA 2VJJA 5D6EA 3F8BA 1OCRH 2X1CA 1MMNA 1FY7A 1P92A 2QKMB 4FX0A 2P0WA 4F92B 1HA8A 2X4HA 2M30A 3HSEA 1UELB 4YG2F 1FC3A 5M3MJ 2H27A 1ACIA 3JRFA 2E19A 1GVJA 3F8MA 4WCGA 1L0OC 1ZAOA 3TW7A 4OU0A 3AG1H 1P7JA 4JP0A 4HQEA 1ITYA 5E20A 1HC8A 2KISA 4YEJA 3CJNA 1SMTA 4A3IJ 2ID3A 3HKZA 3CUQC 4OIPF 3H9JA 4BHCA 5B1BH 3V7CA 3VEPA 2V9PA 2LY2A 1IN8A 2XGXA 1IZ1A 4EQQA 3ECHA 1U5TB 2HVSA 2V6EA 1RUOA 4PJMA 2ZBKA 3G4SI 4OINF 1ZLJA 3DLAA 2KRFA 5TGTA 5FKLA 3I5UA 4ZTFA 4E7HA 3HHHA 1QQIA 3G6EI 4B44A 2F4MB 1Y1WJ 4OAZA 5KAFC 4BXFA 2Z16A 1O4XA 3OL4A 1BOAA 4C2UA 1B72B 4D9JA 4XOTA 5AIPA 3EETA 1RIOH 3J7YJ 2CUZA 2VQCA 3C2HA 2R93J 2HFHA 4D1QA 3J80K 5IYDJ 1BI0A 1DPUA 1ZRFA 1XN7A 3CCJI 4AIJA 3CCSI 2CV1A 2Q2EB 4UY8I 2K02A 5F08A 4A0XA 1JUPA 3V8LA 1H0MA 3G1LA 4C9YA 2M5WA 3EUHA 4ZYEA 3K70C 4IRHA 3GFMA 2ZMEB 3A01A 3S3MA 1YJ9I 2K4BA 3HOYJ 3J7AO 2DU9A 2B63J 1LE8B 2QUFA 2WV0A 3OOUA 1W7PD 4GYGA 2Z5UA 3JR9A 2WAEA 1YYVA 4HEA2 1D0YA 1ZG5A 1N75A 1MNDA 2R7SA 1XCVA 4WWCA 2VJ5A 3CTAA 2DK5A 4B43A 1MSFC 2BOLA 5C4XJ 1JXSA 2ELKA 4UUTA 3DTKA 2XIGA 3SZGA 2QF7A 2GXAA 4LB6B 3KEQA 5LGNA 4PZJA 4O3MA 1S7AA 2Y75A 5LHHA 5E8GA 5GPAA 4E4HA 4JBAA 1LQ1A 1Y56A 3BZCA 2QZ8A 3G2BA 3TOAA 4E7LA 1USTA 2NOJB 4ESFA 2GQQA 2VASA 3ZMVA 1ZH5A 2CMPA 2VQHA 2M0CA 1LFBA 2LBFA 3WE2A 1LDJA 2STWA 5GAGJ 5CVJA 2KP6A 3M7GA 1Z7LA 3O8HA 1I3QJ 4LLNA 5F27A 1MMSA 2P8TA 2CW0F 2V9VA 3COAC 3I4MJ 3DFGA 5ICCA 2VKEA 2R7XA 4KUMA 5D4SA 1BM9A 2XF5A 2R5YA 1B9NA 3IC7A 3TOBA 2HS5A 3DP7A 2JA2A 2CFXA 4E7SA 4G7HF 3BG6A 3M07A 5FRMA 3ZMSA 2DPDA 5C4JJ 2R7QA 2X51A 2A05A 2ZB9A 2JRTA 2HXIA 4XRSG 5LBQA 1JKPC 1B59A 3ZQ7A 2OCCH 4QPOA 1MMDA 4F91B 1D5VA 1V5GA 1ZQ3P 3FBIB 4OWRB 1YG2A 3BDDA 1TTYA 3K70D 4HW0A 1BBYA 3EQLF 3QYBA 1SD5A 2IGKA 3A2KA 1WI9A 3VYUB 1UFMA 1JHHA 3E6DA 4XNFA 3FXUA 2BE5F 3FKJA 2M8EA 2MBFA 2HTSA 1R4NB 4CCLA 5LGUA 5JVTA 4DYRA 1HW5A 3IWFA 2HNHA 2KRHA 1J59A 4K2EA 3CP2A 2DDBA 2LF7A 1VQ9I 2EZHA 4CSWA 5EEGA 1JJ8C 3CMEI 3FM3A 4LMYA 4O6JA 3FMQA 1DP3A 2WC2A 4NC6A 2M1BA 2Y69H 4OIQF 3VSKA 4BQOA 1OQYA 1VI0A 1TP4A 2WADA 2P5VA 3HUGA 2XGEA 4MHGA 3ISPA 2MH9A 1K78B 1WWXA 2KMUA 1HF0A 5LRSA 1I5ZA 3I9V2 3BR2A 3HM5A 2HZTA 2ADUA 3HYIA 3RKWA 1HW1A 2GIZA 1D5YA 2V26A 3OS2A 3JRIA 3AFHA 1YW8A 2E1CA 3I59A 3IH3A 4BS9A 2R7RA 2R7VA 3Q9SA 1ZYRF 4XLCA 3WTSC 2RAEA 3DF8A 2OZUA 2E71A 2ESNA 4FTHA 2EA4A 4UUSA 2K85A 3LA3A 3ZOBA 2DOEA 1KZHA 1QVUA 1UZCA 3GZ6A 4KNYA 1X19A 1MMGA 3WODF 3GTPJ 3LSHA 2F5FA 1R1VA 1ODDA 2P5LC 1WRJA 1F43A 1U5TA 2COBA 4CICA 3HDDA 4C2MJ 3GF2A 3VFZA 1XGNA 3QOEA 4PJLA 5DD4A 1G59A 3RCOA 5ICEA 4U0WA 3KCCA 1W7PA 1YQAA 3K9TA 5E18F 3D1NI 2IXSA 3H5RA 5IP6A 2GLOA 3BTLA 3SZPA 1UG0A 3SZTA 5DUIA 2B0LA 5FKMA 3ERMA 2Z33A 3GTKJ 1I6HJ 3GXOA 2VB6A 4MTEA 3CESA 1FTTA 2EINH 2NVTJ 1Z67A 1I6XA 3CJRB 1P4XA 3NRVA 3R0JA 4GYIA 3CCLI 1DQUA 3O6BB 2BV6A 5HLGA 2YX7A 3D5SC 5HDKA 5IP7J 4U87A 1A6IA 5FB2A 2M2EA 2VJ4A 5C3EJ 2A69F 1NK2P 1V3FA 3VPRA 4ENKA 4QIWN 2IGOA 4IHXA 3ULQB 4CA0A 4ENMA 4F3QA 4C3JJ 5JHUA 3GLLA 1XDSA 2ZCWA 1KA8A 2JA7J 1TWHJ 1OISA 3TMOA 2GOXB 4BE0A 2CG4A 1K6YA 3GLXA 1D0ZA 4U0VA 3OYIA 2JT1A 4RGRA 1APLC 4XIDA 3ONQA 5DCFA 5LEJA 2PJRA 1YITI 2WAQN 1MJ9A 3EUHC 2XRNA 2JSCA 1IXSB 3HRTA 3KE2A 3B02A 1RI7A 2R4GA 2G0EA 2XPUA 3E5XA 5IP9J 2CV2A 2P4WA 4L5JA 2LKXA 3HGGA 2QQAA 2DFFA 2XF7A 2ZO4A 3OMYA 4ZYAA 3HHGA 4HBLA 4F55A 1IRFA 5E3MA 2LD5A 1T95A 2F48A 2LKPA 3TQNA 1WZ2A 1S7EA 4D7NA 4P5OA 3ZPLA 1MBJA 4I76A 2PX9A 2QWWA 3CC4I 2G9WA 4F7ZA 4MQVA 3OYDA 2DA4A 2DT6A 2X48A 4M6VA 4BXUA 1YRNB 4I7HA 1LEBA 2O7OA 3LWFA 2VN2A 5E8IA 1G3WA 1QGPA 2D1VA 1JJ6C 2KL4A 4W1UA 1RR7A 2NVUB 1IN7A 2QSGX 1TQPA 2DLLA 4L0ZB 1VNDA 1TW2A 1POGA 5DDGA 5M5WJ 3KP6A 1FBSA 2OD5A 2QQ8A 5C44J 4Z6YA 2ZFWA 3TP3A 4ZC3A 4M3DA 1P4AA 1IN5A 5E3NA 1HSTA 2HR3A 4UNOA 1WH5A 3RPQA 3IL2A 3HSRA 3I0TA 3CCUI 1QZYA 4EM1A 3DKYA 3IRQA 3BR6A 2OPTA 3KLOA 3T1BA 3JCUC 1S5LC 4KIBA 1GUUA 4A3BJ 2M45A 3K6GA 4BUPA 3OYBA 1BR1A 3RYRA 2XAGA 3KX2A 3L7WA 1W4MA 3M3YJ 3DKWA 1R36A 3KP4A 4X0GA 4KIGA 3RPUA 1DDNA 3DBRB 1MW7A 3WGGA 1OR7A 2MABA 4I02A 1S29A 2EBIA 5HDGA 1PDNC 4KDPA 3BTCA 4KFCA 4WXDA 1FTZA 2OJED 2M34A 3QYEA 3ZMZA 1VQMI 3FX3A 4Q4ZF 1I39A 2Y48A 5J1UA 3TKYA 1BC7C 4A0YA 1VZ0A 3PIOF 4FISA 2O3FA 1JKQC 3RQ4A 3IH4A 3PQKA 1Z0XA 2IS6A 3V7SA 1W36C 4LK1F 4DBRA 1DGWY 4HX7A 1R5GA 2DA6A 1W5CC 1VQ6I 1RNLA 4CHUA 2OC6A 4XL9A 2ZXJA 3ABLH 4ITVA 3HBLA 1OR7C 2VC1A 3CMMA 2BHYA 2G7UA 3RKYA 1Y8RB 1HLVA 4AIDA 1XGOA 4RA2A 1PUFA 3ESWB 3BR1A 4BAYA 5K1YA 2K27A 4IHVA 1Z3XA 1M1EB 3KEYA 1OCPA 1X58A 1VFCA 3CP8A 1XS9A 3VYTB 4RB1A 1L3LA 3H9GA 1W36D 4MEXF 2IS1A 1ETYA 2AO9A 4OOIA 1V55H 2A6EF 2HQRA 2KDZA 4AC0A 2VPRA 4OIRF 4DBQA 2QM3A 4R8HA 4M71A 2VJIA 3GEZA 1W0UA 4HLYA 1NHAA 2PBIA 3MQ0A 3AG4H 5HLTA 5E3OA 3OYCA 4LLGF 2IP2A 2R7DA 3Q0WA 3TDZC 5DUKA 3LFUA 3FISA 3AG3H 3PNVA 3CDLA 1KU9A 3CC2I 3JAMZ 3VSLA 3UKGA 3E3VA 4XLPF 2VC0A 2IS4A 2QA4I 1J75A 1XSVA 1IRZA 1EKEA 2G7HA 3ABTA 4PJNA 5FKOA 3ZXSA 4LOCA 4XRFA 3I4NJ 1ZR2A 3DBHB 1F5TA 2O5RA 2MD0A 2FU4A 2QQBA 3RTRA 4F52A 2ZSHB 4N4OB 2Y31A 2QQ9A 2CQQA 4DW6A 3E97A 4FT8A 2M8GX 3H36A 2RKHA 4HSTA 4UV9A 2ISZA 1XSDA 4KITB 1R9TJ 1BI3A 3L2VA 5J8FA 1X2MA 4XM3A 1FMWA 1KU7A 1WKMA 3GMEA 2EFNA 1JGSA 2UUZA 2IT0A 4A3JJ 3FMRA 2GM4A 2L7KA 3KFWX 1B4AA 1EJ9A 1BOBA 4UHTA 4A6DA 2C6YA 2HGCA 2OBPA 3HRUA 5LRRA 4A5NA 5J3LA 1FZPB 3RQIA 2EQRA 3NARA 3LA2A 1P9QC 2FE3A 2PMHA 1X3ZB 2WB1A 2CQ7A 3T8RA 4DIQA 1MDMA 1VQ8I 1XCBA 2MA3A 1T6SA 2JVGA 1OMIA 4IX7A 1PUFB 1KU2A 3MN2A 4XLAA 5JFRA 2L9NA 4BQNA 5ILSA 3OYKA 2NVYJ 2E2IJ 4KMUX 3CJQB 1CQTA 2KIUA 3S93A 3OV8A 2LF8A 3E5UA 2E2JJ 1BJZA 2FOWA 2L02A 5DCMB 1TZLA 2GWRA 1LKXA 3J7ZI 5ILVA 3T0YA 1VF9A 3O3KA 1E0EA 2ISYA 2HOSA 2YS9A 1ORKA 2IRFG 1HDDC 2DA7A 2ZMEC 3F3XA 1S3JA 3T5XA 3E6CC 3W2AA 3K4BA 3CMYA 2HDCA 1WCMJ 2CJJA 2P6TA 2WTEA 3CCMI 4XMYA 1D1AA 5J1YA 4Y3OA 1IAWA 4R1HA 2JPCA 4HV5A 2ZJRF 5DV5A 1VQOI 2STTA 1OPCA 3K1PA 4I99C 4LIUA 1QA6A 4FQGA 2RGVA 4A3LJ 5DM6F 1S8NA 1FYMA 3P5JA 1MH3A 1TQIA 1VQLI 2IBDA 2P5KA 2P7CB 4KT6A 2NOGA 4BJ5C 1SD4A 3PNYA 2JSPA 3G1OA 3V42A 5EEAA 2FF4A 4EJVA 3FXQA 3L2QA 4QSHA 3CCEI 3KPHA 2KT0A 4WK8F 2MLKA 1G8XA 1TWFJ 2ZXIA 1P7IA 1FOYA 4YFKF 2DT7B 2XHKA 5M3FJ 4RDUA 1U5TC 2CQNA 3JREA 5CQEA 3PFIA 3L2WA 2LRDA 3ZQHA 4BU2A 2L0KA 3EYYA 4M9XA 3BT9A 1HW2A 3CLQA 3RIRA 2EZKA 2Z1DA 2LMDA 1AU7A 3LSRA 5HNFA 1A5JA 4E7JA 2Z2SB 2ELJA 3B6CA 5K7FA 2Y9YA 2NRAC 2FMLA 4ZJZA 2V79A 3LAPA 4LGWA 3HOUJ 1AKHB 2A61A 1VTNC 2L7FP 2O9LA 3W3CA 1IXRC 2VT3A 2Y9ZA 3BCBA 5BPDA 3NAUA 3I53A 1WJBA 4A12A 1XC5A 3F8CA 1X2NA 2M7BA 4IPAA 4HSRA 2RN7A 2MSYA 3L09A 2QENA 5L3CA 3FXJA 3DBLB 4RGXA 2LR8A 5BMZA 3GVAA 3E0JB 3I56I 2HVRA 4IVNA 2ESHA 3LOCA 4KN4X 1SEUA 3LAJA 4EVIA 2Y0SN 4EJWA 4C2TA 1XB4A 1Z1DA 1F1ZA 1YE9A 2COMA 2WY8Q 2EFWA 4LFUA 3OYMA 1SAUA 3C1DA 3L2UA 1DUXC 3BOQA 1A6QA 3SXYA 5FD6A 3M8JA 1QNTA 1D8KA 1SVOA 5HNHA 4IRIA 2W82A 3VDXA 4KICA 5K5OA 4RGUA 1Y8QB 4V2FA 3FXOA 3SFZA 1D1BA 3MZYA 3S32A 5JVGF 2MC4A 2N8GA 2VIXA 4KISA 3S1QJ 4Q5SF 1EF4A 2DAOA 4FCYA 2R5ZB 2IA1A 2EH3A 1QO0D 5DEQA 3B6AA 3FWEA 2JA8J 5E79C 3EPZA 1VQNI 3FHNA 3P9IA 2W1OA 3Q0UA 2CQXA 2IEKA 5EJCA 4ZH4F 2WWYA 3QU3A 3SYTA 1R4MB 3UNGC 2HKOA 2PI0A 2WV1A 2YX4A 3GO5A 3HTUA 3K10A 2EB7A 4BJTA 3MZHA 1AWCA 3CCVI 3IUOA 4IZZA 5LLQA 1MNMC 2QCOA 1RUNA 5IT9K 4D7MA 3D0SA 4A5MA 3ZQFA 2EZLA 3E6MA 3MKYB 4Y13A 4I2OA 4HNUA 3GTGJ 4OAYA 3S15J 3K4KA 2F5DA 2K7LA 1W7PB 4LJZF 4IHSA 3AL0B 3LSIA 3ZGKA 1X1CA 2V1NA 2XGDA 3Q0VA 2L9SA 3DQVC 1SFKA 3HG9A 2CUJA 2CRGA 2MFZA 2X85A 5KCMA 2HPMA 1XPXA 2LREA 3PUBA 1YW7A 2OQGA 1CF7B 2CQKA 4HV6A 3H5NA 1QPIA 2VBWA 3CLOA 4IJAA 3GFJA 4I0AA 4HRIA 4I6ZA 1HQCA 1R22A 1D8JA 3UR3C 4EJUA 1S72I 1LFUP 2DQLA 3WU0A 4L0YB 2FD5A 2F5EA 1D0XA 2BVLA 2O8XA 1GLNA 1YIJI 1JGGA
chains in the Genus database with same CATH topology
4IXAA 2QBYB 3G3ZA 1U2WA 4RGSA 1CGPA 4TV7A 1FSEA 5HDNA 3K1MA 3K1NA 4LG0B 4EJTA 3ZMDA 4H0EA 1WQ2A 2OZ6A 3IHUA 3H92A 4CGZA 1G3YA 1S6LA 2D1HA 1ZG1A 1XGMA 3V8JA 4AIKA 2MLGA 2DQRA 5BQTA 2ZJ2A 2XKOA 3I64A 2DTRA 1MD0A 1R1UA 1ZRCA 4GCVA 2JPBA 4LG0A 1Z05A 2QLZA 3N4MA 1OYWA 4M72A 2ETHA 4EMSA 1ONVA 2O0YA 4UV8A 3NEUA 3VOEA 3JAMK 3CO7C 1XMKA 1YW9A 2XAFA 3F23A 3PQJA 5HLHA 2DBBA 3F8FA 1LB2A 2EK5A 3BJ6A 1GHCA 3QU6A 2BEOA 1XGSA 1ZARA 4HF0A 5D6FA 4P96A 1G3SA 2J5PA 3R61A 3ECOA 5FD5A 1EH8A 1MZBA 4EV0A 4Q48A 1FPQA 3TO9A 3AAFA 2A6HF 2K4JA 4BNCA 2ZMEA 1LNWA 4YFNF 2HYGD 2FBHA 3EYIA 1QBJA 1FLIA 1LDKB 2QVOA 1O7LA 3ZN0A 4MQ9F 2DW4A 3N97A 3KETA 1MJBA 1HSJA 2UXXA 2V1DA 3L9FA 4I98B 1IUYA 2UWMA 4G8XA 2Q8KA 1ZGAA 1SD7A 5HOOA 1UHWA 2GIVA 1UB9A 1T0FA 1I27A 4Y15A 1EH6A 1H9GA 5CLSA 3LSTA 3F8NA 2BYVE 3OOPA 1ZHFA 4E70A 1FYLA 1I1GA 4G6DA 5DD8A 5IT3A 4GO1A 2HQNA 1SFEA 1SD6A 1T98A 1OYIA 1E17A 4WF2A 2NNNA 2F5CA 1A04A 5E1WA 5D4RA 2D2WA 2GAUA 1KU3A 3JTHA 2P7VB 3D5LA 3F6VA 1T2KA 2JTVA 3DV8A 5FLXZ 3SHFA 3L00A 2O6GE 1J5YA 4EGZA 1USSA 4A0ZA 2H94A 1B9MA 3R60A 4UUVA 1TLHB 3BZ6A 4PGGA 2HTJA 4L9VA 4ZZLA 4FHTA 2FEZA 2XAJA 3I59B 4HAMA 4A2UA 1Z7UA 2VT2A 1YFHA 1HKQA 1FP2A 4PCQA 4DQ2A 4CXFA 2AS5F 2W57A 2CO5A 2PLYA 1BN5A 3K69A 4I09A 1LDDA 3LQRA 3FF5A 4O5VA 3T8TA 2XROA 2ZNYA 2DI3A 2F2EA 1U6GA 5D5XB 2LNBA 4MTDA 3WTTC 4KYWA 4P9FA 4U88A 2XASA 1R5HA 1LVAA 5IT9Z 3M9AA 2NYXA 3KLNA 1J0RA 4BQAA 2YR2A 3C3WA 5DCMA 1JE8A 2L01A 2VODA 2IA2A 3ELKA 1FP1D 3SQNA 3GUDA 3REOA 2DFIA 3K0LA 2UZKA 3GFLA 4HLXA 6PAXA 5ICGA 4KT5C 5L3FA 5D5WB 1KYWA 5A2QZ 3F22A 4NHJA 2W84A 4YFXF 4ZYDA 4Q47A 2EFPA 2Z3YA 3WTWC 2GA2A 2RVCA 2EFQA 1F9NA 1R00A 1X3UA 2V6CA 4ZYGA 5CVVA 5LHIA 2L4AA 3KP2A 2MD5A 1O3SA 1BJAA 3WG9A 1AOYA 3BWGA 2H09A 5ERIA 3O2PE 4HX8A 3ZMTA 2RNJA 3MEXA 1QPMA 2YSRA 2PG4A 1O3QA 3TGNA 2UXNA 4KMFA 4UVCA 2FNAA 4I0BA 3I71A 3QPTA 2Q2EA 1TQMA 3M8EA 3I54A 3GWZA 4ON0A 4G94A 4BHBA 3MAJA 2QBYA 3WU1B 3E5QA 1SAXA 3HRMA 2R3SA 3FHZA 2A5YB 1STZA 2PQ8A 1QZZA 2IW5A 5ED4A 1CF7A 3I4PA 2TDXA 4QLCU 2A07F 2VOPA 2XV4S 2GA1A 4AWXB 4EGYA 1XSXA 3DPLC 3DXJF 3HTSB 4LB5A 3C7JA 1FSHA 3NQOA 1P2FA 2PMUA 4MGRA 5H6QA 1G4DA 4XSXF 4HZFA 2DK8A 4BYYA 5L3GA 5J6XA 1B6AA 2EV0A 2XAHA 4Z2YA 3ERED 2E7WA 3RDIA 5LGTA 2LSOA 2CYYA 2OQRA 2OA4A 2QYOA 2MH2A 4RAYA 5H6RA 3W6KB 1IN6A 3KEOA 5FO5A 3MWMA 3LQQA 1S7OA 1XMAA 1ZN2A 3ZMUA 1J7KA 3BP8A 5CVIA 1LJ9A 1KQ9A 3M8FA 5L3DA 3W6JB 2AXLA 3DPTA 1B1BA 2VOOA 1OKRA 1IN4A 1T38A 2A68F 2J5OA 5HS7A 1I1SA 1DP7P 1FX7A 2V1UA 4ETSA 4CDGA 2L54A 1IRGA 3ROUA 3IKTA 2ZNZA 5HS9A 1RZ4A 3E6BA 1R58A 2EJRA 3GFIA 2CGPA 1YLFA 1MDMB 3RJPA 1O3TA 4ASNA 3U9GA 1ZGJA 1K7AA 5BS6A 1U78A 3QOPA 3HOTA 5K5QA 2GZWA 1D3YA 3LA7A 1IXCA 5D5UB 5HVQC 3F6OA 2HWVA 2PN6A 2NAZA 1XD7A 2PJPA 2Q0OA 2IJLA 4M6XA 4RB2C 5D8KB 1HKSA 2M87A 4EM2A 1Z9CA 2LDUA 2PEXA 4BHPA 2GXBA 2VBYA 4KA4A 1SFXA 4ESJA 4B8XA 4HF1A 4G6QA 1KQ8A 3KZZA 1U8RA 3IKVA 1W5SA 1J2XA 3QAHA 2D45A 4L9TA 2RV8A 4M6YA 2VE9A 4M73A 4DNCA 2YU3A 2O03A 3M1EA 4B09A 3JSPA 4BH9A 4ENJA 1SMYF 3C18A 1TBXA 4AVPA 2L3DA 4AD9A 2NS0A 4ENNA 2KJBA 1K79A 3J81Z 1TNSA 1ZRDA 1PP7U 2PFBA 2HEOA 3JSOA 3GX4X 2IVMA 2RC4A 4LK0F 5ICFA 4KIFA 5E17F 4CO8A 1MGTA 4ZYHA 4LLLA 4AIHA 1UCRA 1MJAA 1EH7A 4WXCA 3WE3A 5A2QK 4N9IA 4M9SA 1TNTA 1PUEE 1SFUA 2BBYA 3P9KA 2FMYA 1O7FA 1FBQA 2EA2A 3CUOA 3TO6A 3QP6A 3VB2A 1H9TA 1YIOA 3GZ5A 4HQMA 3ZN1A 5AONA 1Z91A 2KIFA 4RB0A 3QRFF 4HDUA 3WTZA 5F1RA 4LD5A 4GGGA 3TO7A 4P55A 1T39A 2ACJA 4KN7X 2E7XA 2FBKA 4EM0B 4M74A 1J9IA 2FBIA 5CVRA 1G6NA 1Y0UA 3R6SA 3WTXC 3LFKA 4CYDA 3BJOA 4ZZDA 3JTGA 1FT9A 4M9ZA 4HF2A 1ON2A 5FFZA 3RI4A 3DEUA 1ZG3A 2Z9OA 2K86A 2KIMA 1Q1HA 4QWQA 5FGMA 4R79A 5FFXA 2W85A 2VE8A 4HOBA 1FNNA 4UVAA 4MEYF 2FXAA 4P9UA 2EFOA 4G9YA 3BROA 1FOKA 2NNYA 2EV6A 3P9CA 4IRGA 1REPC 2EWNA 2GXGA 5LHGA 4XSZF 4RB3C 3HSFA 2O61A 1UHMA 2KJCA 3J80Z 3FMSA 3KP5A 3GYHX 2FQ3A 1K6OA 1TW3A 4A6EA 5JR3A 2FNPA 2XKPA 2FA5A 2Y0MA 5BPIA 2XAQA 1LEAA 4L9JA 4ESBA 2YPRA 3CO6C 2MC3A 5CJ9A 3WTVC 4D0PA 4HDVA 5LEKA 2DT5A 1BIAA 4IF4A 3TDUC 2HOEA 1ZREA 1P6RA 2W24A 4U7BA 2R7FA 3VODA 4L9NA 4S04A 5BOXA 2V1XA 5DYMA 4JQFA 5EEHA 3U1DA 2ZKZA 3EDPA 2H6BA 5HS8A 2L4MA 3MCZA 5CYVA 2RDPA 3HOSA 4MNUA 1U3EM 4CZZA 4Y17A 4HX4A 4PGHA 1HKTA 4HA8A 1FWZA 4UVBA 1YS6A 2FSWA 3S2WA 2IA0A 2HYFA 1YS7A 3RYPA 3BPXA 2HKXA 1P4WA 2KKOA 1C0WA 5AIQA 3V7RA 3RKXA 2ELHA 2X0LA 4EJOA 1ULYA 3WTUC 3WTYC 3QPHA 2VXZA 3JW4A 3BPVA 2H6CA 2XUBA 3KP3A 1KQ0A 1IW7F 4XBFA 1O57A 2FOKA 3GW2A 3KZYA 5F6FA 1FBUA 4IHTA 1KGSA 1O3RA 3ABUA 5TRDA 3B73A 1G3TA 3F21A 1GXQA 1HXDA 2P6SA 5ILUA 3KP7A 2RQPA 1YO5C 3BY6A 3I58A 1KYZA 3CDHA 1BIBA 2FRHA 1YTYA 4NQWA 4G7OF 1R23A 3WGIA 1JHFA 1K78A 2BGCA 3HRSA 5D8LB 3FM5A 1EV7A 1R7JA 3ZP5A 4OIOF 4JK1X 1BC8C 3P7NA 1FYKA 3K2ZA 1BI1A 3MFKA 2DO7A 4L18B 5CVUA 3L2CA 4S05A 3H3UA 1F4KA 3G73A 3Q9VA 3F72A 2OU2A 3IRRA 1XDUA 2VBZA 1ZLKA 4N9HA 1PP8F 1ON1A 2CWEA 1W5TA 5E1ZB 4G7ZF 3H3ZA 3HIFA 1Z6TA 5J8CA 1MKMA 5D5VB 4U7DA 5JI6A 3ML6A 5K5RA 1GXPA 3CUQB 1WSUA 3FZVA 4NB5A 1E2XA 5KK1A 2Z99A 4WX9A 2XVCA 5TJJA 5H20A 5L3EA 4HYEA 4UXNA 1V4RA 5FLXK 5L3BA 3U2RA 2JZYA 2OAZA 2A3SA 2DPUA 4RAZA 2EV5A 1HBXG 1Z6RA 4U0YA 4GXOA 3BJAA 3J81K 1BI2A 3R0AA 4OMZA 3WGHA 3IWZA 1R1TA 3Q5FA 1DPRA 3QP5A 2IPQX 5HLIA 2VONA 1OYYA 4WXHA 5KVRA 3CUQA 5F64A 2E1NA 4YIFA 2VBXA 3V4GA 5E1XA 2CSOA 4N0BA 4FX4A 4PDKA 2W25A 4XLNF 4L5IA 4YIIA 4RS8A 4I01A 4OMYA 3FXRA 3R4KA 3V8KA 1IF1A 5D6EA 3F8BA 1P92A 1FY7A 4FX0A 2X4HA 2M30A 3HSEA 4YG2F 1FC3A 2H27A 1GVJA 3F8MA 4WCGA 1L0OC 1ZAOA 4OU0A 4HQEA 5E20A 3CJNA 1SMTA 3CUQC 4OIPF 4BHCA 3V7CA 3VEPA 1IN8A 2XGXA 1IZ1A 4EQQA 3ECHA 1U5TB 1RUOA 2ZBKA 4OINF 1ZLJA 2KRFA 3I5UA 3HHHA 1QQIA 1BOAA 5AIPA 3EETA 1RIOH 2HFHA 3J80K 1BI0A 1DPUA 1ZRFA 1XN7A 4AIJA 2K02A 4A0XA 3V8LA 1H0MA 2M5WA 3EUHA 4ZYEA 4IRHA 3GFMA 2ZMEB 2K4BA 3J7AO 2DU9A 2QUFA 2WV0A 1W7PD 4GYGA 2Z5UA 1YYVA 1ZG5A 1XCVA 4WWCA 3CTAA 2DK5A 1JXSA 2XIGA 4LB6B 3KEQA 5LGNA 4PZJA 4O3MA 1S7AA 2Y75A 5LHHA 5E8GA 4JBAA 1LQ1A 2QZ8A 3TOAA 1USTA 4ESFA 2GQQA 3ZMVA 1ZH5A 3WE2A 1LDJA 2STWA 5CVJA 3M7GA 4LLNA 2P8TA 2CW0F 2V9VA 3COAC 3DFGA 5ICCA 4KUMA 5D4SA 1BM9A 1B9NA 3IC7A 3TOBA 2HS5A 3DP7A 2CFXA 4G7HF 3ZMSA 2DPDA 2JRTA 5LBQA 1B59A 3ZQ7A 1D5VA 1YG2A 3BDDA 1TTYA 4HW0A 1BBYA 3EQLF 1SD5A 1WI9A 1UFMA 1JHHA 3E6DA 3FXUA 2BE5F 2M8EA 2MBFA 2HTSA 5LGUA 5JVTA 1HW5A 3IWFA 1J59A 4K2EA 2LF7A 5EEGA 3FM3A 4LMYA 4O6JA 3FMQA 2WC2A 2M1BA 4OIQF 2P5VA 3HUGA 4MHGA 3ISPA 2MH9A 1K78B 1WWXA 5LRSA 1I5ZA 2HZTA 2ADUA 3HYIA 3RKWA 1HW1A 1YW8A 2E1CA 3I59A 3Q9SA 1ZYRF 3WTSC 3DF8A 2OZUA 2ESNA 2EA4A 3LA3A 3GZ6A 4KNYA 3WODF 2F5FA 2P5LC 1R1VA 1ODDA 1WRJA 1U5TA 4CICA 3GF2A 3VFZA 1XGNA 5DD4A 5ICEA 4U0WA 3KCCA 1W7PA 1YQAA 3K9TA 5E18F 3SZPA 3SZTA 5DUIA 2B0LA 2Z33A 3GXOA 4MTEA 4GYIA 1I6XA 3NRVA 1P4XA 3R0JA 3O6BB 2BV6A 5HLGA 2YX7A 5HDKA 5FB2A 2A69F 1V3FA 4ENKA 3ULQB 4ENMA 5JHUA 1XDSA 2ZCWA 1KA8A 2CG4A 3GLXA 4U0VA 2JT1A 4RGRA 5DCFA 5LEJA 1MJ9A 2XRNA 2JSCA 1IXSB 3HRTA 3KE2A 3B02A 1RI7A 3E5XA 2P4WA 4L5JA 2QQAA 2ZO4A 3HHGA 4HBLA 1IRFA 2LKPA 3TQNA 4P5OA 3ZPLA 2QWWA 2G9WA 4F7ZA 4MQVA 4BXUA 4I7HA 1LEBA 3LWFA 2VN2A 5E8IA 1G3WA 1QGPA 2D1VA 1IN7A 1TQPA 2DLLA 4L0ZB 1TW2A 5DDGA 3KP6A 1FBSA 2OD5A 2ZFWA 1P4AA 1IN5A 1HSTA 2HR3A 4UNOA 3RPQA 3IL2A 3HSRA 3I0TA 1QZYA 4EM1A 3IRQA 3KLOA 3T1BA 4KIBA 2M45A 3RYRA 2XAGA 3L7WA 1W4MA 3DKWA 1R36A 3KP4A 4KIGA 3RPUA 1DDNA 3WGGA 1OR7A 4I02A 1S29A 5HDGA 1PDNC 4KDPA 4KFCA 4WXDA 3ZMZA 3FX3A 4Q4ZF 2Y48A 3TKYA 1BC7C 4A0YA 2O3FA 3PQKA 3V7SA 4LK1F 4HX7A 1R5GA 1RNLA 4CHUA 2ZXJA 2VC1A 2G7UA 3RKYA 1XGOA 4BAYA 5K1YA 2K27A 1L3LA 4RB1A 4MEXF 4OOIA 2A6EF 2HQRA 4OIRF 2QM3A 4R8HA 4M71A 3GEZA 4HLYA 1NHAA 2PBIA 3MQ0A 4LLGF 2IP2A 2R7DA 3TDZC 5DUKA 1KU9A 3JAMZ 3E3VA 4XLPF 2VC0A 1J75A 1XSVA 2G7HA 3ABTA 4XRFA 1F5TA 2FU4A 2QQBA 3RTRA 2QQ9A 3E97A 4FT8A 4UV9A 2RKHA 2ISZA 1XSDA 1BI3A 5J8FA 1KU7A 1WKMA 2EFNA 1JGSA 2IT0A 3FMRA 3KFWX 1B4AA 2C6YA 4UHTA 4A6DA 2HGCA 2OBPA 3HRUA 5LRRA 4A5NA 1FZPB 3LA2A 2PMHA 2FE3A 3T8RA 1MDMA 1XCBA 2MA3A 1T6SA 1OMIA 1KU2A 5JFRA 5ILSA 4KMUX 2KIUA 3OV8A 2LF8A 3E5UA 2L02A 5DCMB 2GWRA 5ILVA 3T0YA 3O3KA 2ISYA 2IRFG 3F3XA 1S3JA 3T5XA 3E6CC 2HDCA 2P6TA 2WTEA 1IAWA 4R1HA 2JPCA 4HV5A 5DV5A 2STTA 1OPCA 3K1PA 2RGVA 1S8NA 1FYMA 1TQIA 2P5KA 2P7CB 1SD4A 2FF4A 4EJVA 3FXQA 4WK8F 2MLKA 4YFKF 2XHKA 1U5TC 3PFIA 3EYYA 4M9XA 1HW2A 3RIRA 2NRAC 2FMLA 2V79A 3LAPA 4LGWA 2A61A 1VTNC 1IXRC 2VT3A 5BPDA 3I53A 4A12A 3F8CA 4IPAA 2RN7A 5L3CA 3L09A 2QENA 4RGXA 5BMZA 3GVAA 4IVNA 2ESHA 4KN4X 3LAJA 4EVIA 4EJWA 1XB4A 1Z1DA 1F1ZA 2COMA 2EFWA 4LFUA 3C1DA 1DUXC 3BOQA 3SXYA 5FD6A 1QNTA 1D8KA 4IRIA 4KICA 5K5OA 4RGUA 3SFZA 3MZYA 4Q5SF 2DAOA 2IA1A 1QO0D 5DEQA 3FWEA 3P9IA 2WWYA 4ZH4F 3QU3A 2HKOA 2PI0A 3GO5A 2YX4A 3HTUA 2EB7A 3MZHA 1AWCA 5LLQA 1RUNA 5IT9K 3D0SA 4A5MA 3E6MA 4Y13A 4I2OA 2F5DA 2K7LA 1W7PB 4LJZF 4IHSA 3DQVC 1CF7B 1YW7A 2OQGA 2CQKA 4HV6A 2VBWA 3CLOA 4IJAA 3GFJA 4I0AA 1HQCA 1R22A 1D8JA 4EJUA 2DQLA 3WU0A 4L0YB 2F5EA 2O8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IXA A;  2QBY B;  3G3Z A;  1U2W A;  4RGS A;  1CGP A;  4TV7 A;  1FSE A;  5HDN A;  3K1M A;  3K1N A;  4LG0 B;  4EJT A;  3ZMD A;  4H0E A;  1WQ2 A;  2OZ6 A;  3IHU A;  3H92 A;  4CGZ A;  1G3Y A;  1S6L A;  2D1H A;  1ZG1 A;  1XGM A;  3V8J A;  4AIK A;  2MLG A;  2DQR A;  5BQT A;  2ZJ2 A;  2XKO A;  3I64 A;  2DTR A;  1MD0 A;  1R1U A;  1ZRC A;  4GCV A;  2JPB A;  4LG0 A;  1Z05 A;  2QLZ A;  3N4M A;  1OYW A;  4M72 A;  2ETH A;  4EMS A;  1ONV A;  2O0Y A;  4UV8 A;  3NEU A;  3VOE A;  3JAM K;  3CO7 C;  1XMK A;  1YW9 A;  2XAF A;  3F23 A;  3PQJ A;  5HLH A;  2DBB A;  3F8F A;  1LB2 A;  2EK5 A;  3BJ6 A;  1GHC A;  3QU6 A;  2BEO A;  1XGS A;  1ZAR A;  4HF0 A;  5D6F A;  4P96 A;  1G3S A;  2J5P A;  3R61 A;  3ECO A;  5FD5 A;  1EH8 A;  1MZB A;  4EV0 A;  4Q48 A;  1FPQ A;  3TO9 A;  3AAF A;  2A6H F;  2K4J A;  4BNC A;  2ZME A;  1LNW A;  4YFN F;  2HYG D;  2FBH A;  3EYI A;  1QBJ A;  1FLI A;  1LDK B;  2QVO A;  1O7L A;  3ZN0 A;  4MQ9 F;  2DW4 A;  3N97 A;  3KET A;  1MJB A;  1HSJ A;  2UXX A;  2V1D A;  3L9F A;  4I98 B;  1IUY A;  2UWM A;  4G8X A;  2Q8K A;  1ZGA A;  1SD7 A;  5HOO A;  1UHW A;  2GIV A;  1UB9 A;  1T0F A;  1I27 A;  4Y15 A;  1EH6 A;  1H9G A;  5CLS A;  3LST A;  3F8N A;  2BYV E;  3OOP A;  1ZHF A;  4E70 A;  1FYL A;  1I1G A;  4G6D A;  5DD8 A;  5IT3 A;  4GO1 A;  2HQN A;  1SFE A;  1SD6 A;  1T98 A;  1OYI A;  1E17 A;  4WF2 A;  2NNN A;  2F5C A;  1A04 A;  5E1W A;  5D4R A;  2D2W A;  2GAU A;  1KU3 A;  3JTH A;  2P7V B;  3D5L A;  3F6V A;  1T2K A;  2JTV A;  3DV8 A;  5FLX Z;  3SHF A;  3L00 A;  2O6G E;  1J5Y A;  4EGZ A;  1USS A;  4A0Z A;  2H94 A;  1B9M A;  3R60 A;  4UUV A;  1TLH B;  3BZ6 A;  4PGG A;  2HTJ A;  4L9V A;  4ZZL A;  4FHT A;  2FEZ A;  2XAJ A;  3I59 B;  4HAM A;  4A2U A;  1Z7U A;  2VT2 A;  1YFH A;  1HKQ A;  1FP2 A;  4PCQ A;  4DQ2 A;  4CXF A;  2AS5 F;  2W57 A;  2CO5 A;  2PLY A;  1BN5 A;  3K69 A;  4I09 A;  1LDD A;  3LQR A;  3FF5 A;  4O5V A;  3T8T A;  2XRO A;  2ZNY A;  2DI3 A;  2F2E A;  1U6G A;  5D5X B;  2LNB A;  4MTD A;  3WTT C;  4KYW A;  4P9F A;  4U88 A;  2XAS A;  1R5H A;  1LVA A;  5IT9 Z;  3M9A A;  2NYX A;  3KLN A;  1J0R A;  4BQA A;  2YR2 A;  3C3W A;  5DCM A;  1JE8 A;  2L01 A;  2VOD A;  2IA2 A;  3ELK A;  1FP1 D;  3SQN A;  3GUD A;  3REO A;  2DFI A;  3K0L A;  2UZK A;  3GFL A;  4HLX A;  6PAX A;  5ICG A;  4KT5 C;  5L3F A;  5D5W B;  1KYW A;  5A2Q Z;  3F22 A;  4NHJ A;  2W84 A;  4YFX F;  4ZYD A;  4Q47 A;  2EFP A;  2Z3Y A;  3WTW C;  2GA2 A;  2RVC A;  2EFQ A;  1F9N A;  1R00 A;  1X3U A;  2V6C A;  4ZYG A;  5CVV A;  5LHI A;  2L4A A;  3KP2 A;  2MD5 A;  1O3S A;  1BJA A;  3WG9 A;  1AOY A;  3BWG A;  2H09 A;  5ERI A;  3O2P E;  4HX8 A;  3ZMT A;  2RNJ A;  3MEX A;  1QPM A;  2YSR A;  2PG4 A;  1O3Q A;  3TGN A;  2UXN A;  4KMF A;  4UVC A;  2FNA A;  4I0B A;  3I71 A;  3QPT A;  2Q2E A;  1TQM A;  3M8E A;  3I54 A;  3GWZ A;  4ON0 A;  4G94 A;  4BHB A;  3MAJ A;  2QBY A;  3WU1 B;  3E5Q A;  1SAX A;  3HRM A;  2R3S A;  3FHZ A;  2A5Y B;  1STZ A;  2PQ8 A;  1QZZ A;  2IW5 A;  5ED4 A;  1CF7 A;  3I4P A;  2TDX A;  4QLC U;  2A07 F;  2VOP A;  2XV4 S;  2GA1 A;  4AWX B;  4EGY A;  1XSX A;  3DPL C;  3DXJ F;  3HTS B;  4LB5 A;  3C7J A;  1FSH A;  3NQO A;  1P2F A;  2PMU A;  4MGR A;  5H6Q A;  1G4D A;  4XSX F;  4HZF A;  2DK8 A;  4BYY A;  5L3G A;  5J6X A;  1B6A A;  2EV0 A;  2XAH A;  4Z2Y A;  3ERE D;  2E7W A;  3RDI A;  5LGT A;  2LSO A;  2CYY A;  2OQR A;  2OA4 A;  2QYO A;  2MH2 A;  4RAY A;  5H6R A;  3W6K B;  1IN6 A;  3KEO A;  5FO5 A;  3MWM A;  3LQQ A;  1S7O A;  1XMA A;  1ZN2 A;  3ZMU A;  1J7K A;  3BP8 A;  5CVI A;  1LJ9 A;  1KQ9 A;  3M8F A;  5L3D A;  3W6J B;  2AXL A;  3DPT A;  1B1B A;  2VOO A;  1OKR A;  1IN4 A;  1T38 A;  2A68 F;  2J5O A;  5HS7 A;  1I1S A;  1DP7 P;  1FX7 A;  2V1U A;  4ETS A;  4CDG A;  2L54 A;  1IRG A;  3ROU A;  3IKT A;  2ZNZ A;  5HS9 A;  1RZ4 A;  3E6B A;  1R58 A;  2EJR A;  3GFI A;  2CGP A;  1YLF A;  1MDM B;  3RJP A;  1O3T A;  4ASN A;  3U9G A;  1ZGJ A;  1K7A A;  5BS6 A;  1U78 A;  3QOP A;  3HOT A;  5K5Q A;  2GZW A;  1D3Y A;  3LA7 A;  1IXC A;  5D5U B;  5HVQ C;  3F6O A;  2HWV A;  2PN6 A;  2NAZ A;  1XD7 A;  2PJP A;  2Q0O A;  2IJL A;  4M6X A;  4RB2 C;  5D8K B;  1HKS A;  2M87 A;  4EM2 A;  1Z9C A;  2LDU A;  2PEX A;  4BHP A;  2GXB A;  2VBY A;  4KA4 A;  1SFX A;  4ESJ A;  4B8X A;  4HF1 A;  4G6Q A;  1KQ8 A;  3KZZ A;  1U8R A;  3IKV A;  1W5S A;  1J2X A;  3QAH A;  2D45 A;  4L9T A;  2RV8 A;  4M6Y A;  2VE9 A;  4M73 A;  4DNC A;  2YU3 A;  2O03 A;  3M1E A;  4B09 A;  3JSP A;  4BH9 A;  4ENJ A;  1SMY F;  3C18 A;  1TBX A;  4AVP A;  2L3D A;  4AD9 A;  2NS0 A;  4ENN A;  2KJB A;  1K79 A;  3J81 Z;  1TNS A;  1ZRD A;  1PP7 U;  2PFB A;  2HEO A;  3JSO A;  3GX4 X;  2IVM A;  2RC4 A;  4LK0 F;  5ICF A;  4KIF A;  5E17 F;  4CO8 A;  1MGT A;  4ZYH A;  4LLL A;  4AIH A;  1UCR A;  1MJA A;  1EH7 A;  4WXC A;  3WE3 A;  5A2Q K;  4N9I A;  4M9S A;  1TNT A;  1PUE E;  1SFU A;  2BBY A;  3P9K A;  2FMY A;  1O7F A;  1FBQ A;  2EA2 A;  3CUO A;  3TO6 A;  3QP6 A;  3VB2 A;  1H9T A;  1YIO A;  3GZ5 A;  4HQM A;  3ZN1 A;  5AON A;  1Z91 A;  2KIF A;  4RB0 A;  3QRF F;  4HDU A;  3WTZ A;  5F1R A;  4LD5 A;  4GGG A;  3TO7 A;  4P55 A;  1T39 A;  2ACJ A;  4KN7 X;  2E7X A;  2FBK A;  4EM0 B;  4M74 A;  1J9I A;  2FBI A;  5CVR A;  1G6N A;  1Y0U A;  3R6S A;  3WTX C;  3LFK A;  4CYD A;  3BJO A;  4ZZD A;  3JTG A;  1FT9 A;  4M9Z A;  4HF2 A;  1ON2 A;  5FFZ A;  3RI4 A;  3DEU A;  1ZG3 A;  2Z9O A;  2K86 A;  2KIM A;  1Q1H A;  4QWQ A;  5FGM A;  4R79 A;  5FFX A;  2W85 A;  2VE8 A;  4HOB A;  1FNN A;  4UVA A;  4MEY F;  2FXA A;  4P9U A;  2EFO A;  4G9Y A;  3BRO A;  1FOK A;  2NNY A;  2EV6 A;  3P9C A;  4IRG A;  1REP C;  2EWN A;  2GXG A;  5LHG A;  4XSZ F;  4RB3 C;  3HSF A;  2O61 A;  1UHM A;  2KJC A;  3J80 Z;  3FMS A;  3KP5 A;  3GYH X;  2FQ3 A;  1K6O A;  1TW3 A;  4A6E A;  5JR3 A;  2FNP A;  2XKP A;  2FA5 A;  2Y0M A;  5BPI A;  2XAQ A;  1LEA A;  4L9J A;  4ESB A;  2YPR A;  3CO6 C;  2MC3 A;  5CJ9 A;  3WTV C;  4D0P A;  4HDV A;  5LEK A;  2DT5 A;  1BIA A;  4IF4 A;  3TDU C;  2HOE A;  1ZRE A;  1P6R A;  2W24 A;  4U7B A;  2R7F A;  3VOD A;  4L9N A;  4S04 A;  5BOX A;  2V1X A;  5DYM A;  4JQF A;  5EEH A;  3U1D A;  2ZKZ A;  3EDP A;  2H6B A;  5HS8 A;  2L4M A;  3MCZ A;  5CYV A;  2RDP A;  3HOS A;  4MNU A;  1U3E M;  4CZZ A;  4Y17 A;  4HX4 A;  4PGH A;  1HKT A;  4HA8 A;  1FWZ A;  4UVB A;  1YS6 A;  2FSW A;  3S2W A;  2IA0 A;  2HYF A;  1YS7 A;  3RYP A;  3BPX A;  2HKX A;  1P4W A;  2KKO A;  1C0W A;  5AIQ A;  3V7R A;  3RKX A;  2ELH A;  2X0L A;  4EJO A;  1ULY A;  3WTU C;  3WTY C;  3QPH A;  2VXZ A;  3JW4 A;  3BPV A;  2H6C A;  2XUB A;  3KP3 A;  1KQ0 A;  1IW7 F;  4XBF A;  1O57 A;  2FOK A;  3GW2 A;  3KZY A;  5F6F A;  1FBU A;  4IHT A;  1KGS A;  1O3R A;  3ABU A;  5TRD A;  3B73 A;  1G3T A;  3F21 A;  1GXQ A;  1HXD A;  2P6S A;  5ILU A;  3KP7 A;  2RQP A;  1YO5 C;  3BY6 A;  3I58 A;  1KYZ A;  3CDH A;  1BIB A;  2FRH A;  1YTY A;  4NQW A;  4G7O F;  1R23 A;  3WGI A;  1JHF A;  1K78 A;  2BGC A;  3HRS A;  5D8L B;  3FM5 A;  1EV7 A;  1R7J A;  3ZP5 A;  4OIO F;  4JK1 X;  1BC8 C;  3P7N A;  1FYK A;  3K2Z A;  1BI1 A;  3MFK A;  2DO7 A;  4L18 B;  5CVU A;  3L2C A;  4S05 A;  3H3U A;  1F4K A;  3G73 A;  3Q9V A;  3F72 A;  2OU2 A;  3IRR A;  1XDU A;  2VBZ A;  1ZLK A;  4N9H A;  1PP8 F;  1ON1 A;  2CWE A;  1W5T A;  5E1Z B;  4G7Z F;  3H3Z A;  3HIF A;  1Z6T A;  5J8C A;  1MKM A;  5D5V B;  4U7D A;  5JI6 A;  3ML6 A;  5K5R A;  1GXP A;  3CUQ B;  1WSU A;  3FZV A;  4NB5 A;  1E2X A;  5KK1 A;  2Z99 A;  4WX9 A;  2XVC A;  5TJJ A;  5H20 A;  5L3E A;  4HYE A;  4UXN A;  1V4R A;  5FLX K;  5L3B A;  3U2R A;  2JZY A;  2OAZ A;  2A3S A;  2DPU A;  4RAZ A;  2EV5 A;  1HBX G;  1Z6R A;  4U0Y A;  4GXO A;  3BJA A;  3J81 K;  1BI2 A;  3R0A A;  4OMZ A;  3WGH A;  3IWZ A;  1R1T A;  3Q5F A;  1DPR A;  3QP5 A;  2IPQ X;  5HLI A;  2VON A;  1OYY A;  4WXH A;  5KVR A;  3CUQ A;  5F64 A;  2E1N A;  4YIF A;  2VBX A;  3V4G A;  5E1X A;  2CSO A;  4N0B A;  4FX4 A;  4PDK A;  2W25 A;  4XLN F;  4L5I A;  4YII A;  4RS8 A;  4I01 A;  4OMY A;  3FXR A;  3R4K A;  3V8K A;  1IF1 A;  5D6E A;  3F8B A;  1P92 A;  1FY7 A;  4FX0 A;  2X4H A;  2M30 A;  3HSE A;  4YG2 F;  1FC3 A;  2H27 A;  1GVJ A;  3F8M A;  4WCG A;  1L0O C;  1ZAO A;  4OU0 A;  4HQE A;  5E20 A;  3CJN A;  1SMT A;  3CUQ C;  4OIP F;  4BHC A;  3V7C A;  3VEP A;  1IN8 A;  2XGX A;  1IZ1 A;  4EQQ A;  3ECH A;  1U5T B;  1RUO A;  2ZBK A;  4OIN F;  1ZLJ A;  2KRF A;  3I5U A;  3HHH A;  1QQI A;  1BOA A;  5AIP A;  3EET A;  1RIO H;  2HFH A;  3J80 K;  1BI0 A;  1DPU A;  1ZRF A;  1XN7 A;  4AIJ A;  2K02 A;  4A0X A;  3V8L A;  1H0M A;  2M5W A;  3EUH A;  4ZYE A;  4IRH A;  3GFM A;  2ZME B;  2K4B A;  3J7A O;  2DU9 A;  2QUF A;  2WV0 A;  1W7P D;  4GYG A;  2Z5U A;  1YYV A;  1ZG5 A;  1XCV A;  4WWC A;  3CTA A;  2DK5 A;  1JXS A;  2XIG A;  4LB6 B;  3KEQ A;  5LGN A;  4PZJ A;  4O3M A;  1S7A A;  2Y75 A;  5LHH A;  5E8G A;  4JBA A;  1LQ1 A;  2QZ8 A;  3TOA A;  1UST A;  4ESF A;  2GQQ A;  3ZMV A;  1ZH5 A;  3WE2 A;  1LDJ A;  2STW A;  5CVJ A;  3M7G A;  4LLN A;  2P8T A;  2CW0 F;  2V9V A;  3COA C;  3DFG A;  5ICC A;  4KUM A;  5D4S A;  1BM9 A;  1B9N A;  3IC7 A;  3TOB A;  2HS5 A;  3DP7 A;  2CFX A;  4G7H F;  3ZMS A;  2DPD A;  2JRT A;  5LBQ A;  1B59 A;  3ZQ7 A;  1D5V A;  1YG2 A;  3BDD A;  1TTY A;  4HW0 A;  1BBY A;  3EQL F;  1SD5 A;  1WI9 A;  1UFM A;  1JHH A;  3E6D A;  3FXU A;  2BE5 F;  2M8E A;  2MBF A;  2HTS A;  5LGU A;  5JVT A;  1HW5 A;  3IWF A;  1J59 A;  4K2E A;  2LF7 A;  5EEG A;  3FM3 A;  4LMY A;  4O6J A;  3FMQ A;  2WC2 A;  2M1B A;  4OIQ F;  2P5V A;  3HUG A;  4MHG A;  3ISP A;  2MH9 A;  1K78 B;  1WWX A;  5LRS A;  1I5Z A;  2HZT A;  2ADU A;  3HYI A;  3RKW A;  1HW1 A;  1YW8 A;  2E1C A;  3I59 A;  3Q9S A;  1ZYR F;  3WTS C;  3DF8 A;  2OZU A;  2ESN A;  2EA4 A;  3LA3 A;  3GZ6 A;  4KNY A;  3WOD F;  2F5F A;  2P5L C;  1R1V A;  1ODD A;  1WRJ A;  1U5T A;  4CIC A;  3GF2 A;  3VFZ A;  1XGN A;  5DD4 A;  5ICE A;  4U0W A;  3KCC A;  1W7P A;  1YQA A;  3K9T A;  5E18 F;  3SZP A;  3SZT A;  5DUI A;  2B0L A;  2Z33 A;  3GXO A;  4MTE A;  4GYI A;  1I6X A;  3NRV A;  1P4X A;  3R0J A;  3O6B B;  2BV6 A;  5HLG A;  2YX7 A;  5HDK A;  5FB2 A;  2A69 F;  1V3F A;  4ENK A;  3ULQ B;  4ENM A;  5JHU A;  1XDS A;  2ZCW A;  1KA8 A;  2CG4 A;  3GLX A;  4U0V A;  2JT1 A;  4RGR A;  5DCF A;  5LEJ A;  1MJ9 A;  2XRN A;  2JSC A;  1IXS B;  3HRT A;  3KE2 A;  3B02 A;  1RI7 A;  3E5X A;  2P4W A;  4L5J A;  2QQA A;  2ZO4 A;  3HHG A;  4HBL A;  1IRF A;  2LKP A;  3TQN A;  4P5O A;  3ZPL A;  2QWW A;  2G9W A;  4F7Z A;  4MQV A;  4BXU A;  4I7H A;  1LEB A;  3LWF A;  2VN2 A;  5E8I A;  1G3W A;  1QGP A;  2D1V A;  1IN7 A;  1TQP A;  2DLL A;  4L0Z B;  1TW2 A;  5DDG A;  3KP6 A;  1FBS A;  2OD5 A;  2ZFW A;  1P4A A;  1IN5 A;  1HST A;  2HR3 A;  4UNO A;  3RPQ A;  3IL2 A;  3HSR A;  3I0T A;  1QZY A;  4EM1 A;  3IRQ A;  3KLO A;  3T1B A;  4KIB A;  2M45 A;  3RYR A;  2XAG A;  3L7W A;  1W4M A;  3DKW A;  1R36 A;  3KP4 A;  4KIG A;  3RPU A;  1DDN A;  3WGG A;  1OR7 A;  4I02 A;  1S29 A;  5HDG A;  1PDN C;  4KDP A;  4KFC A;  4WXD A;  3ZMZ A;  3FX3 A;  4Q4Z F;  2Y48 A;  3TKY A;  1BC7 C;  4A0Y A;  2O3F A;  3PQK A;  3V7S A;  4LK1 F;  4HX7 A;  1R5G A;  1RNL A;  4CHU A;  2ZXJ A;  2VC1 A;  2G7U A;  3RKY A;  1XGO A;  4BAY A;  5K1Y A;  2K27 A;  1L3L A;  4RB1 A;  4MEX F;  4OOI A;  2A6E F;  2HQR A;  4OIR F;  2QM3 A;  4R8H A;  4M71 A;  3GEZ A;  4HLY A;  1NHA A;  2PBI A;  3MQ0 A;  4LLG F;  2IP2 A;  2R7D A;  3TDZ C;  5DUK A;  1KU9 A;  3JAM Z;  3E3V A;  4XLP F;  2VC0 A;  1J75 A;  1XSV A;  2G7H A;  3ABT A;  4XRF A;  1F5T A;  2FU4 A;  2QQB A;  3RTR A;  2QQ9 A;  3E97 A;  4FT8 A;  4UV9 A;  2RKH A;  2ISZ A;  1XSD A;  1BI3 A;  5J8F A;  1KU7 A;  1WKM A;  2EFN A;  1JGS A;  2IT0 A;  3FMR A;  3KFW X;  1B4A A;  2C6Y A;  4UHT A;  4A6D A;  2HGC A;  2OBP A;  3HRU A;  5LRR A;  4A5N A;  1FZP B;  3LA2 A;  2PMH A;  2FE3 A;  3T8R A;  1MDM A;  1XCB A;  2MA3 A;  1T6S A;  1OMI A;  1KU2 A;  5JFR A;  5ILS A;  4KMU X;  2KIU A;  3OV8 A;  2LF8 A;  3E5U A;  2L02 A;  5DCM B;  2GWR A;  5ILV A;  3T0Y A;  3O3K A;  2ISY A;  2IRF G;  3F3X A;  1S3J A;  3T5X A;  3E6C C;  2HDC A;  2P6T A;  2WTE A;  1IAW A;  4R1H A;  2JPC A;  4HV5 A;  5DV5 A;  2STT A;  1OPC A;  3K1P A;  2RGV A;  1S8N A;  1FYM A;  1TQI A;  2P5K A;  2P7C B;  1SD4 A;  2FF4 A;  4EJV A;  3FXQ A;  4WK8 F;  2MLK A;  4YFK F;  2XHK A;  1U5T C;  3PFI A;  3EYY A;  4M9X A;  1HW2 A;  3RIR A;  2NRA C;  2FML A;  2V79 A;  3LAP A;  4LGW A;  2A61 A;  1VTN C;  1IXR C;  2VT3 A;  5BPD A;  3I53 A;  4A12 A;  3F8C A;  4IPA A;  2RN7 A;  5L3C A;  3L09 A;  2QEN A;  4RGX A;  5BMZ A;  3GVA A;  4IVN A;  2ESH A;  4KN4 X;  3LAJ A;  4EVI A;  4EJW A;  1XB4 A;  1Z1D A;  1F1Z A;  2COM A;  2EFW A;  4LFU A;  3C1D A;  1DUX C;  3BOQ A;  3SXY A;  5FD6 A;  1QNT A;  1D8K A;  4IRI A;  4KIC A;  5K5O A;  4RGU A;  3SFZ A;  3MZY A;  4Q5S F;  2DAO A;  2IA1 A;  1QO0 D;  5DEQ A;  3FWE A;  3P9I A;  2WWY A;  4ZH4 F;  3QU3 A;  2HKO A;  2PI0 A;  3GO5 A;  2YX4 A;  3HTU A;  2EB7 A;  3MZH A;  1AWC A;  5LLQ A;  1RUN A;  5IT9 K;  3D0S A;  4A5M A;  3E6M A;  4Y13 A;  4I2O A;  2F5D A;  2K7L A;  1W7P B;  4LJZ F;  4IHS A;  3DQV C;  1CF7 B;  1YW7 A;  2OQG A;  2CQK A;  4HV6 A;  2VBW A;  3CLO A;  4IJA A;  3GFJ A;  4I0A A;  1HQC A;  1R22 A;  1D8J A;  4EJU A;  2DQL A;  3WU0 A;  4L0Y B;  2F5E A;  2O8X A; 
#chains in the Genus database with same CATH topology
 1Z3Y A;  1ZK8 A;  2I10 A;  4IXA A;  4N4N B;  2DA5 A;  4ABZ A;  5K7Z A;  2QBY B;  3G3Z A;  4KJZ A;  1U2W A;  1IGN A;  4RGS A;  1CGP A;  2CU7 A;  3DWL E;  3PO3 J;  4TV7 A;  5BNG A;  4NBQ A;  1FSE A;  5HDN A;  3K1M A;  3K1N A;  2OF7 A;  4XR6 A;  3BQY A;  1MBF A;  2DOA A;  4BE2 A;  4LG0 B;  3BTI A;  4EJT A;  3ZMD A;  4H0E A;  5J40 A;  1WQ2 A;  2OZ6 A;  2LVS A;  3IHU A;  3H92 A;  4XKW A;  4HNT A;  1JKO C;  4CGZ A;  1G3Y A;  1S6L A;  1SC7 A;  2D1H A;  1ZG1 A;  1XGM A;  3FIW A;  3V8J A;  3E1S A;  4AIK A;  4BXX J;  1MNE A;  1Z21 A;  4E7I A;  2HU9 A;  4NUB A;  2MLG A;  2CUE A;  3ZQG A;  1JUM A;  4DYQ A;  4IOC F;  2DQR A;  5BQT A;  2ZJ2 A;  2VXD A;  2BW3 B;  2XKO A;  2EIL H;  3I64 A;  5KHD A;  2DTR A;  1MD0 A;  5B66 C;  4RAF A;  1R1U A;  1ZRC A;  2LK2 A;  4GCV A;  2JPB A;  3OR2 C;  4LG0 A;  1Z05 A;  2QLZ A;  3N4M A;  1OYW A;  2M0M A;  4M72 A;  1TWC J;  2E34 A;  4AU7 A;  3SEQ A;  2K3F A;  2NVX J;  2LY9 A;  3S2H J;  3QQA A;  2ETH A;  2E36 A;  1X1B A;  2HQA A;  2LKS A;  4EMS A;  1ONV A;  2O0Y A;  4UV8 A;  3KYD B;  2OCE A;  3NEU A;  3VOE A;  3JAM K;  3CO7 C;  3DEE A;  1XMK A;  2ME0 A;  3OYE A;  1YW9 A;  4RM2 A;  2K9S A;  2XAF A;  3I55 I;  3PQJ A;  1ENH A;  3F23 A;  5HLH A;  2DBB A;  4CYC A;  2ECB A;  3F8F A;  1R71 A;  1LB2 A;  2EK5 A;  3BJ6 A;  1BR4 A;  1JKR C;  4CYC B;  1GHC A;  3QU6 A;  2BEO A;  2Y0S A;  1S9H A;  1XGS A;  1NG7 A;  1ZAR A;  2VI6 A;  1YJN I;  4HF0 A;  1U8B A;  5D6F A;  2X1D A;  4P96 A;  2V4J C;  1G3S A;  2NS7 A;  3SDB A;  5DM7 F;  2J5P A;  2K40 A;  3S14 J;  1OCO H;  3R61 A;  2FQ4 A;  3ECO A;  5FD5 A;  1EH8 A;  4YRV A;  1MZB A;  5EZG A;  4Q48 A;  1FPQ A;  3TO9 A;  4B48 A;  4EV0 A;  3OIQ A;  2A6H F;  3AAF A;  1RPW A;  5HOD A;  2K4J A;  1TT5 B;  2A5W A;  1N77 A;  4BNC A;  2ZME A;  3A01 B;  1LNW A;  4YFN F;  4IEJ A;  2HYG D;  2FBH A;  3EYI A;  1QBJ A;  1FLI A;  4BY7 J;  1LDK B;  2DFH A;  2I5U A;  2QVO A;  4FE4 A;  5FRO A;  1O7L A;  3X2Q H;  3ZN0 A;  4MQ9 F;  2QSF X;  3S2D J;  2DW4 A;  3N97 A;  2CW7 A;  3CCY A;  4BGD A;  5IY5 H;  3KET A;  1MJB A;  1WGX A;  3HC7 A;  3PSF A;  1HSJ A;  1UMQ A;  1YOV B;  1VQP I;  2UXX A;  2V1D A;  3FKI J;  3L9F A;  4I98 B;  1IUY A;  3DTI A;  1ETV A;  2QGU A;  2UWM A;  4G8X A;  2Q8K A;  1ZGA A;  1SD7 A;  5HOO A;  1UHW A;  3GTO J;  5FKN A;  2E5Z A;  1UB9 A;  2GIV A;  1RES A;  2JMW A;  1GT0 C;  2VPL A;  1T0F A;  1I27 A;  4Y15 A;  1EH6 A;  1H9G A;  5CLS A;  4A3C J;  3ZQC A;  2FJ1 A;  2R7O A;  3LST A;  3F8N A;  2BYV E;  4GDF A;  1YX5 A;  2BY1 A;  3OOP A;  3CD6 I;  1ZHF A;  5B3S H;  4E70 A;  2R7Z J;  1FYL A;  1I1G A;  4F93 B;  5M5Y J;  1RC9 A;  1W1W E;  4G6D A;  3KIO A;  2JQ7 A;  5DD8 A;  5IT3 A;  4GO1 A;  2HQN A;  4PJ0 C;  1NK3 P;  1SFE A;  5M5X J;  1WJC A;  3WHC A;  1SD6 A;  1T98 A;  2EPF A;  2ZJQ F;  3FK7 A;  5TIS C;  1OYI A;  4H4K C;  2DFE A;  1E17 A;  3IV5 A;  4WF2 A;  1TC3 C;  2NNN A;  2F5C A;  1A04 A;  1BW5 A;  3A03 A;  5E1W A;  5D4R A;  4ZDL A;  3JRB A;  2D2W A;  2KZV A;  2V7F A;  2GAU A;  2V9K A;  1KU3 A;  3JTH A;  2DA2 A;  1R5I D;  2P7V B;  1OFC X;  3D5L A;  5KAI C;  3F6V A;  1ZGW A;  1T2K A;  3DV8 A;  2JTV A;  2EIM H;  2JN6 A;  5FLX Z;  1B8I B;  3A4C A;  4PFP A;  2M4K A;  3SHF A;  4RLQ A;  1WPK A;  3L00 A;  4XRM A;  4NNJ A;  2O6G E;  4C3I J;  1J5Y A;  2XGC A;  3ZCO A;  4EGZ A;  1USS A;  1ZR4 A;  4A0Z A;  1U9O A;  2H94 A;  1B9M A;  1AA7 A;  2LTP A;  3R60 A;  4UUV A;  1ETQ A;  1TLH B;  1JT6 A;  3BZ6 A;  5LFA A;  4PGG A;  4NC7 A;  1F36 A;  3RKQ A;  2HTJ A;  4L9V A;  1QU3 A;  4ZZL A;  3PUF A;  4FHT A;  2FEZ A;  2F5V A;  2AQF A;  2XAJ A;  4ZTJ A;  3IH2 A;  1AHD P;  3I59 B;  4CZC A;  4HAM A;  1H8A C;  4A2U A;  1Z7U A;  2VT2 A;  4YIR X;  2AXT C;  3QYF A;  1YFH A;  3U21 A;  2L7Z A;  1T0F C;  1HKQ A;  4XKB A;  1FP2 A;  2XPV A;  1OCT C;  4PCQ A;  4M3E A;  4DQ2 A;  2LLK A;  4CXF A;  2AS5 F;  2W57 A;  4PFO A;  4CUG A;  2CO5 A;  2PLY A;  1BN5 A;  3K69 A;  4MFD A;  5H2F C;  4I09 A;  1LDD A;  3LQR A;  3FF5 A;  2VQG A;  4YEL A;  4O5V A;  1SAN A;  2OTJ I;  3T8T A;  1GV2 A;  2XRO A;  2DCE A;  2M4G A;  2ZNY A;  1T8I A;  2DI3 A;  2F2E A;  1U6G A;  3QPS A;  3TL4 X;  5D5X B;  2VKD A;  4LIV A;  3DLL F;  2LNB A;  1DGR M;  3K4L A;  2DJI A;  4MTD A;  1Y1V J;  3HL2 A;  2BW3 A;  4IO9 F;  3WTT C;  2IGN A;  4KYW A;  1X1D A;  4P9F A;  3OYN A;  4U88 A;  4CCM A;  2DN0 A;  2KRC A;  2XAS A;  1LFP A;  1R5H A;  3KYC B;  3S1M J;  1QRY A;  1LVA A;  4XK4 A;  2E60 A;  3ZR8 X;  5IT9 Z;  3M9A A;  3PIP F;  3ZQI A;  2NYX A;  3KLN A;  2XSJ C;  1J0R A;  1OCC H;  5GPC A;  4BQA A;  2R0Q C;  2YR2 A;  3ZQQ A;  3CC7 I;  2H1K A;  2R92 J;  4CCN A;  2X1E A;  3S1N J;  3C3W A;  5DCM A;  1JE8 A;  2L01 A;  2VOD A;  4A69 C;  2IA2 A;  4AYB N;  3ELK A;  1FP1 D;  3L2R A;  3SQN A;  3GUD A;  3REO A;  1HCR A;  2DFI A;  3K0L A;  2UZK A;  3GFL A;  2ZSI B;  4HLX A;  6PAX A;  5CKT A;  3OYF A;  4M3B A;  4XLH A;  5ICG A;  4KT5 C;  5L3F A;  1T56 A;  5D5W B;  1KYW A;  4BBS J;  2GBY A;  5A2Q Z;  3TED A;  3MVP A;  2TCT A;  3PO2 J;  2LYC A;  1V5F A;  3F22 A;  4NHJ A;  2W84 A;  2X6W A;  3BQZ A;  2CH0 A;  4YFX F;  2R5Y B;  1DU6 A;  1X1P A;  4J19 A;  4ZYD A;  4Q47 A;  3OYH A;  2EFP A;  3RPU D;  3W6V A;  3F0C A;  2W4S A;  2Z3Y A;  1ZEL A;  1QHH D;  3WTW C;  2A6T A;  4DZP A;  1X4O A;  2GA2 A;  2RVC A;  3LMM A;  2M3A A;  2EFQ A;  4IQJ A;  1F9N A;  1FIA A;  1R00 A;  1X3U A;  4XRS A;  2K9L A;  3A1Y A;  3TP0 A;  2V6C A;  5CQG A;  4ZYG A;  5CVV A;  2PMZ A;  4MO7 A;  1VQ4 I;  5LHI A;  2XB0 X;  2L4A A;  3KP2 A;  2MD5 A;  1O3S A;  2M9H A;  1I50 J;  5F1J A;  4GFB A;  1BJA A;  3WG9 A;  1K83 J;  1AOY A;  3BWG A;  2H09 A;  5J1R A;  1WH7 A;  5ERI A;  1IUF A;  2LOO A;  1ZKG A;  1D1C A;  4II2 A;  3O2P E;  3L1P A;  4HX8 A;  3ZMT A;  3MKW B;  2RNJ A;  3MEX A;  2F4O B;  4B3X A;  1QPM A;  3ASN H;  2YSR A;  2F4I A;  2PG4 A;  1O3Q A;  2DDA A;  1LE8 A;  2LY1 A;  1Y0N A;  2BY0 A;  3A02 A;  2P81 A;  5EYR A;  3TGN A;  5IOY A;  4XIC A;  2UXN A;  1E3H A;  4KMF A;  4UVC A;  2FNA A;  4XKC A;  4I0B A;  4II3 A;  1Y6I A;  3I71 A;  3IAM 2;  3BR3 A;  4EAT A;  3QPT A;  4G12 A;  2Q2E A;  3S3O A;  2VLA A;  1TQM A;  3M8E A;  2HXO A;  3I54 A;  3GWZ A;  1U0J A;  4ON0 A;  4G94 A;  4BHB A;  1WHU A;  1TL8 A;  3BG7 A;  3C2G A;  3MAJ A;  2QBY A;  2HQ5 A;  2XPW A;  3WU1 B;  3H9Q A;  3MMY B;  3PNT A;  3E5Q A;  1SAX A;  2WY7 Q;  3PL8 A;  3HRM A;  1JI8 A;  2JJ7 A;  2R3S A;  3FHZ A;  3DEW A;  2A5Y B;  2L2O A;  1STZ A;  4XOP A;  2KPM A;  4FE7 A;  5J47 A;  2PQ8 A;  2E1O A;  1IDY A;  3CCQ I;  1QZZ A;  1UG2 A;  2IW5 A;  5ED4 A;  4JX4 A;  1CF7 A;  3I4P A;  2TDX A;  2L9R A;  4QLC U;  2A07 F;  4A3D J;  3HEF A;  2ECC A;  2VOP A;  2XV4 S;  4X1E A;  1H89 C;  2DXI A;  2GA1 A;  3OWT A;  4AWX B;  1ZTR A;  4EGY A;  3HOV J;  1XSX A;  3DPL C;  3DXJ F;  3HTS B;  4LB5 A;  3C7J A;  9ANT A;  1X1A A;  1FSH A;  3NQO A;  1P2F A;  4J00 A;  3HOW J;  5EGO A;  2KHM A;  2PMU A;  2R5Z A;  2HDD A;  4MGR A;  1GVD A;  1IJW C;  1NTC A;  3HPH A;  3GTJ J;  1H88 C;  1MMA A;  3AG2 H;  5H6Q A;  1G4D A;  3C2B A;  4XSX F;  4HZF A;  2DK8 A;  4BYY A;  5L3G A;  1IRX A;  5J6X A;  4CCJ A;  1B6A A;  3SJM A;  3CF5 F;  2EV0 A;  2X6X A;  1VQ5 I;  4BBR J;  3RSN A;  2XAH A;  4Z2Y A;  3ERE D;  2E7W A;  1MIJ A;  3RDI A;  5FJ8 J;  5LGT A;  3S16 J;  2LSO A;  1FOW A;  2CYY A;  2OQR A;  3BR5 A;  2IAI A;  3BG5 A;  1Z77 A;  1FMV A;  3NWT A;  1A35 A;  1QHG A;  1PVE A;  3QOD A;  3LSG A;  2OA4 A;  2X6O A;  3OR1 C;  5B5E C;  2QYO A;  3H5A A;  2MH2 A;  4RAY A;  5H6R A;  4BEH A;  3W6K B;  1IN6 A;  3KEO A;  4PSW A;  4C3H J;  5FO5 A;  3DU6 A;  1NG6 A;  2QKL B;  1AKH A;  3MWM A;  2RQQ A;  1S7O A;  3LQQ A;  1XMA A;  1ZN2 A;  4A3M J;  3ZMU A;  1J7K A;  1RKT A;  3BP8 A;  4JYK A;  2VL8 A;  5CVI A;  4BY1 J;  1LJ9 A;  1KQ9 A;  3GCM A;  3MKL A;  3M8F A;  1GDT A;  2NVQ J;  5L3D A;  3W6J B;  2AXL A;  3HPG A;  3DPT A;  3CQZ J;  4J01 A;  3CDI A;  2VKH A;  1B1B A;  1I3A A;  1SFO J;  3VYS B;  3DCF A;  4CCK A;  2VOO A;  1OKR A;  1IN4 A;  1T38 A;  4BJ6 C;  4QTR A;  4W97 A;  1V5E A;  2A68 F;  2J5O A;  4PSX A;  2DJN A;  5HS7 A;  1DP7 P;  1I1S A;  1FX7 A;  2E35 A;  3FDY A;  3FXK A;  2V1U A;  4ETS A;  4BDY A;  4CDG A;  2L54 A;  1IRG A;  2BZT A;  1A31 A;  3ROU A;  1BA5 A;  3IKT A;  2ZNZ A;  5HS9 A;  2X9D A;  1RZ4 A;  4B3A A;  3E6B A;  1IDZ A;  2WBM A;  1KON A;  1R58 A;  2EJR A;  3BR0 A;  3GFI A;  2CGP A;  1YLF A;  3H0D A;  1MDM B;  3LSK A;  3ASO H;  3JRG A;  3RJP A;  1O3T A;  4ASN A;  1K61 A;  3U9G A;  5FLM J;  1ZGJ A;  1K7A A;  5BS6 A;  1U78 A;  3QOP A;  3S1R J;  2R7T A;  2MYS A;  3HOT A;  2HOT A;  2H8R A;  5K5Q A;  4CCO A;  5GAD J;  2GZW A;  1D3Y A;  2W48 A;  1IV8 A;  3LA7 A;  1IXC A;  2ZXW H;  5D5U B;  5HVQ C;  3IAS 2;  3F6O A;  2BY2 A;  3NWS A;  2HWV A;  2PN6 A;  2XSD C;  3S17 J;  4RMN A;  2NAZ A;  2K9M A;  1FIP A;  1XD7 A;  2PJP A;  2Q0O A;  1HDP A;  1IC8 A;  2IJL A;  4M6X A;  4RB2 C;  3OSF A;  4MLO A;  5EZH A;  1JTX A;  2KDO A;  5D8K B;  4MIM A;  5EG0 B;  1HKS A;  3CCR I;  2M87 A;  5J4V A;  4EM2 A;  1Z9C A;  2LDU A;  2PEX A;  3S3N A;  4BHP A;  3BZK A;  3EUA A;  2EIK H;  1BL0 A;  2GXB A;  2GOM A;  2VBY A;  1LVK A;  4NDL A;  1SFX A;  4KA4 A;  4FET A;  4ESJ A;  4B8X A;  4HF1 A;  4G6Q A;  1KQ8 A;  3KZZ A;  1U8R A;  2YUS A;  3DU5 A;  3IKV A;  3PJR A;  2L9V A;  3OYA A;  1W5S A;  1J2X A;  3QAH A;  4ZDP A;  2D45 A;  5EDN A;  4HPQ A;  4L9T A;  2MW8 A;  3SEZ A;  3OY9 A;  2RV8 A;  4M6Y A;  2VE9 A;  4M73 A;  4DNC A;  2YU3 A;  2O03 A;  3GBG A;  2VQL A;  3M1E A;  2VKV A;  4B09 A;  3TW6 A;  2BXZ A;  3JSP A;  4BH9 A;  4ENJ A;  4E6K G;  2K9N A;  1SMY F;  2KLO A;  1QZE A;  3C18 A;  4MFE A;  1TBX A;  4AVP A;  2L3D A;  2LC2 A;  4AD9 A;  4IOA F;  2NS0 A;  2R7U A;  1W0T A;  2E5N A;  4ENN A;  2EZI A;  2KJB A;  1K79 A;  3J81 Z;  1TNS A;  1MSE C;  1JT0 A;  1YRN A;  1ZRD A;  1PP7 U;  5IOZ A;  2PFB A;  3HXL A;  5J4Y A;  2K9Q A;  2HEO A;  2F6C A;  4FAS D;  3JSO A;  2IVM A;  2RC4 A;  3FBN B;  1RET A;  4LK0 F;  3A0H C;  5ICF A;  3GX4 X;  4KIF A;  4A93 J;  5E17 F;  4CO8 A;  1MGT A;  4BDZ A;  1LUJ B;  1R6R A;  2UV1 A;  2LH9 A;  2IGM A;  4ZYH A;  4HG2 A;  4CH7 A;  2R7W A;  4LLL A;  4AIH A;  3JRC A;  1WJ5 A;  4Y7N J;  1UCR A;  1MJA A;  1EH7 A;  4WXC A;  3WE3 A;  1X3W B;  4IKF A;  1WI3 A;  5A2Q K;  3H35 A;  4N9I A;  4M9S A;  2JA5 J;  1TNT A;  1G2H A;  1PUE E;  3DTE A;  4UB8 C;  4B1R A;  3WU2 C;  1SFU A;  2E1M C;  2BBY A;  3P9K A;  2FMY A;  3ABK H;  5EG0 A;  1O7F A;  1FBQ A;  4DOZ A;  2ZXH A;  3M4O J;  2EA2 A;  3CUO A;  3TO6 A;  3QP6 A;  3VB2 A;  3PSI A;  1H9T A;  2MGQ A;  1N78 A;  1YX3 A;  1YIO A;  3GZ5 A;  1VQK I;  4HQM A;  3TBI A;  4AUX A;  5DTD A;  2K5C A;  3ZN1 A;  4ANJ A;  5AON A;  4BKX A;  1Z91 A;  1QVT A;  2KIF A;  3F9K A;  4RB0 A;  3QRF F;  2XDV A;  4HDU A;  3WTZ A;  5F1R A;  4LD5 A;  4GGG A;  2Y2Z A;  2OV7 A;  3TO7 A;  2DYS H;  4P55 A;  1VQ7 I;  3KZI C;  1T39 A;  2ACJ A;  3DPU A;  4XLE A;  5KNL A;  4KN7 X;  2H1L A;  2E7X A;  3PM1 A;  2VUM J;  2FBK A;  3HB9 A;  3BTJ A;  3OSG A;  4EM0 B;  2XAU A;  4M74 A;  1UJ8 A;  1J9I A;  2FBI A;  5CVR A;  2IS2 A;  1WJF A;  1IO2 A;  3GZN B;  1G6N A;  1Y0U A;  3K2A A;  2K3P A;  3R6S A;  3WTX C;  2JVH A;  3LFK A;  4Y4R A;  1E3P A;  1IG7 A;  2L5Q A;  4CYD A;  3WG7 H;  3BJO A;  4JX6 A;  4ZZD A;  3JTG A;  2HVQ A;  5E3L A;  1FT9 A;  4M9Z A;  4IHY A;  3CZ6 A;  1IV6 A;  1TT0 A;  4HF2 A;  3CJT B;  1BW6 A;  3K4M A;  1K4S A;  4A3G J;  1ON2 A;  5F0C A;  5FFZ A;  3RI4 A;  3DEU A;  1ZG3 A;  1GV5 A;  3HGY A;  2Z9O A;  4XN3 A;  2K86 A;  2XB5 A;  1FOX A;  2KIM A;  1Q1H A;  3K4J A;  4QWQ A;  5FGM A;  4R79 A;  4UUS B;  2M7A A;  1ETO A;  5FFX A;  3G1M A;  2W85 A;  4Y33 A;  2VE8 A;  4HOB A;  2B9S A;  1FNN A;  2DMQ A;  2CV0 A;  4UVA A;  4RAG A;  5B1A H;  4B4C A;  3RZD J;  4MEY F;  2JK3 A;  2FXA A;  4P9U A;  4P1W A;  3HZJ A;  1U9N A;  2EFO A;  4G9Y A;  2FX0 A;  3BRO A;  2NNY A;  1FOK A;  2EV6 A;  2WAQ A;  3P9C A;  4IRG A;  2LP0 A;  1REP C;  4BEH B;  4D5C A;  2EWN A;  2GXG A;  3MD2 A;  4XSZ F;  5LHG A;  4RB3 C;  2HYJ A;  2JUC A;  4A3K J;  3HSF A;  2JUG A;  3GTQ J;  2HZD A;  1WJE A;  4E7K A;  1EA3 A;  2O61 A;  1UHM A;  2KJC A;  3ZQL A;  3J80 Z;  3FMS A;  4PJJ A;  3KP5 A;  3GYH X;  2XC7 A;  2CUF A;  2FQ3 A;  1K6O A;  1TW3 A;  1XX5 A;  4A6E A;  3IP4 B;  5JR3 A;  2OTL I;  2YU9 J;  3H3V K;  1RRJ A;  2FNP A;  2XKP A;  1OLT A;  1BR2 A;  2FA5 A;  2WB1 N;  2XAQ A;  2Y0M A;  5BPI A;  4ZDO A;  1LEA A;  1V54 H;  1SVL A;  3LSJ A;  4XOR A;  4L9J A;  4ESB A;  5GTH C;  2DMP A;  5IPA A;  3OS0 A;  2YPR A;  3CO6 C;  3G71 I;  2MC3 A;  5CJ9 A;  3WTV C;  2ZJP F;  4D0P A;  4HDV A;  2LG4 A;  5LEK A;  3JRD A;  4BE1 A;  2DT5 A;  1Q1V A;  3SFI A;  2NXN B;  1BIA A;  4IF4 A;  1MBH A;  3I3L A;  4D5F A;  3TDU C;  3CMA I;  2HOE A;  1ZRE A;  3J7A Y;  5K7H A;  1P6R A;  3AL0 C;  2W24 A;  4U7B A;  2KQR A;  2R7F A;  3VOD A;  4L9N A;  4S04 A;  1J09 A;  5BOX A;  2V1X A;  4A3E J;  5DYM A;  4V19 K;  2X6Y A;  1N25 A;  2H8W A;  3K7A J;  4GRI A;  1A36 A;  4JQF A;  5EEH A;  3U1D A;  5JLX A;  1XMX A;  3PFY A;  2ZKZ A;  1ETK A;  3EDP A;  2H6B A;  4S0H B;  5GAH J;  2ID6 A;  5HS8 A;  3OYG A;  2L4M A;  1B72 A;  1SVM A;  5F0H A;  3MCZ A;  5CYV A;  2RDP A;  3HOS A;  4MNU A;  1MBK A;  1U3E M;  4CZZ A;  4Y17 A;  4HX4 A;  4PGH A;  2D5V A;  1HKT A;  4HA8 A;  1WJA A;  2LFB A;  5GAE J;  1FWZ A;  1WFX A;  3QPL A;  2HI3 A;  4UVB A;  4IL6 C;  1UAA A;  1YS6 A;  3FXM A;  2DMT A;  4NC8 A;  2FSW A;  1PYV A;  3S2W A;  2IA0 A;  5JLW A;  2HOA A;  1YS7 A;  2HYF A;  2OUM A;  3RYP A;  3BPX A;  2HKX A;  4BL0 B;  1P4W A;  4LG3 A;  2KKO A;  1C0W A;  5AIQ A;  3V7R A;  2PMZ N;  3RKX A;  2ZC2 A;  3FXL A;  2QEX I;  2KIQ A;  2ELH A;  5CPR B;  2QSH X;  2X0L A;  4EJO A;  4DYC A;  3OYJ A;  2ICW G;  3GTM J;  1ULY A;  2JRM A;  1T33 A;  3SDG A;  2WAF A;  3WTU C;  2HPI A;  1TWG J;  3WTY C;  3MZ8 A;  3LSM A;  5FKK A;  1MBG A;  3QPH A;  2VXZ A;  3JW4 A;  3BPV A;  2H6C A;  2XUB A;  3KP3 A;  1KQ0 A;  3WHB A;  1T08 B;  1IW7 F;  4XBF A;  1O57 A;  4XQF A;  5LD2 C;  5IYB J;  1XTA A;  3O8G A;  1ERD A;  1R49 A;  2FOK A;  3W2V A;  3OS1 A;  3BCA A;  2FUG 2;  1E3O C;  4A3F J;  3GW2 A;  1MH4 A;  3KZY A;  3DKX A;  1FBU A;  5F6F A;  2L7M P;  4IHT A;  4M3G A;  1KGS A;  1Y39 A;  3HUG B;  1O3R A;  2CFO A;  3ABU A;  4IHW A;  5TRD A;  3MKZ A;  3B73 A;  4AYB A;  3OIP A;  1G3T A;  4DZJ A;  3F21 A;  1GXQ A;  1HXD A;  3M1C A;  2P6S A;  4PUS A;  3K4N A;  3KP7 A;  2RQP A;  3BG3 A;  5ILU A;  3AKZ A;  3LSP A;  1YO5 C;  3FK6 A;  3BY6 A;  4AM3 A;  2BVM A;  3ZRG A;  1WVR A;  3I58 A;  3HOX J;  1TWA J;  3OIO A;  2TRT A;  3Q3S A;  2ME6 A;  2BHZ A;  5EF6 A;  1KYZ A;  4UB6 C;  3VYR B;  5JHF A;  3CDH A;  1MBE A;  1BIB A;  2FRH A;  1YTY A;  4NQW A;  4G7O F;  1K4T A;  1R23 A;  2AQE A;  3WGI A;  3BC8 A;  2Y30 A;  3K4C A;  1JHF A;  5GP9 A;  2NS8 A;  3EUK L;  1K78 A;  4IQ4 A;  3HOZ J;  5F0F A;  2BY3 A;  2BGC A;  3HRS A;  5D8L B;  3FM5 A;  2MG4 A;  1EV7 A;  1R7J A;  4BQQ A;  3ZP5 A;  4OIO F;  4JK1 X;  1BC8 C;  3P7N A;  1FYK A;  3K2Z A;  1BI1 A;  3QWL A;  3A0B C;  1OCZ H;  3MFK A;  3BLY A;  3OYL A;  3D5R C;  2DO7 A;  4L18 B;  5CVU A;  4RLF A;  3L2C A;  2DOF A;  4S05 A;  4XON A;  3H3U A;  1F4K A;  4X6A J;  2RRE A;  3G73 A;  3Q9V A;  3F72 A;  3W2W A;  2OU2 A;  3IRR A;  1XDU A;  4Y52 J;  2ZFU A;  2VBZ A;  1ZLK A;  4N9H A;  1PP8 F;  3CF2 A;  2PJR B;  3GTL J;  4DJA A;  1ON1 A;  2CWE A;  1W5T A;  4EEF G;  5E1Z B;  1ETW A;  4G7Z F;  2JA6 J;  3H3Z A;  1HOM A;  3HIF A;  4XN0 A;  1Z6T A;  5J8C A;  3LL7 A;  1MKM A;  4L5E A;  5D5V B;  4U7D A;  5FRN A;  5JI6 A;  3ML6 A;  1YHQ I;  5K5R A;  1GXP A;  2O8K A;  3CUQ B;  3N05 A;  1WSU A;  4G6T B;  3FZV A;  2AHQ A;  4PK4 A;  4RBO A;  4NB5 A;  1E2X A;  3KYL A;  1PJR A;  3RZO J;  1ETX A;  5KK1 A;  4AVZ A;  5FLV A;  1XG1 A;  3JRA A;  2Z99 A;  4WX9 A;  2XVC A;  5TJJ A;  2XRL A;  2KZG A;  5H20 A;  1YI2 I;  1OJL A;  3ABM H;  4JOM A;  2KFD A;  1RR8 C;  5L3E A;  4HYE A;  4B47 A;  2HDW A;  2LBF B;  4UXN A;  1V4R A;  2DMU A;  4HNV A;  2RNG A;  2XF6 A;  5FLX K;  5L3B A;  3U2R A;  2JZY A;  3HJE A;  2BXY A;  5GTI C;  4DGW B;  2OAZ A;  2WA0 A;  2A3S A;  4V2G A;  2DPU A;  4RAZ A;  5EGO B;  4LIT A;  3U1K A;  2JWT A;  3LNQ A;  3VWB A;  1WJD A;  2EV5 A;  2CW8 A;  1HBX G;  2W00 A;  3H0G J;  4JX5 A;  1Z6R A;  2E1M B;  4U0Y A;  2E2H J;  4GXO A;  3BJA A;  4RM3 A;  2W7N A;  5IYC J;  1FEX A;  3J81 K;  2DA1 A;  2CS3 A;  2B7E A;  4QPQ A;  1BI2 A;  3R0A A;  4OMZ A;  3S8P A;  3WGH A;  4BAC A;  2DA3 A;  3IWZ A;  1R1T A;  4M3F A;  1LPQ A;  1UHS A;  2DMN A;  1X4P A;  3Q5F A;  1JUS A;  1FJL A;  1DPR A;  3QP5 A;  2IPQ X;  5HLI A;  1YJW I;  2VON A;  1OYY A;  2DTZ A;  2DYR H;  5F04 A;  4WXH A;  2DOD A;  5KVR A;  3CUQ A;  1DU0 A;  5F64 A;  3JRH A;  2E1N A;  4YIF A;  2VBX A;  3OL3 A;  3E7L A;  3V4G A;  4XKV A;  5E1X A;  5DS9 A;  2CSO A;  4N0B A;  1RKW A;  3BG9 A;  2EIJ H;  3HKZ N;  4FX4 A;  4C30 A;  4PDK A;  2W25 A;  4XLN F;  4L5I A;  2I8D A;  4NQW B;  4YII A;  3H1C A;  4RS8 A;  1NH3 A;  2Q1Z B;  4I01 A;  4OMY A;  4XLF A;  3FXR A;  3R4K A;  3V8K A;  1IF1 A;  1B8I A;  1JTY A;  4E7Z A;  2VJJ A;  5D6E A;  3F8B A;  1OCR H;  2X1C A;  1MMN A;  1FY7 A;  1P92 A;  2QKM B;  4FX0 A;  2P0W A;  4F92 B;  1HA8 A;  2X4H A;  2M30 A;  3HSE A;  1UEL B;  4YG2 F;  1FC3 A;  5M3M J;  2H27 A;  1ACI A;  3JRF A;  2E19 A;  1GVJ A;  3F8M A;  4WCG A;  1L0O C;  1ZAO A;  3TW7 A;  4OU0 A;  3AG1 H;  1P7J A;  4JP0 A;  4HQE A;  1ITY A;  5E20 A;  1HC8 A;  2KIS A;  4YEJ A;  3CJN A;  1SMT A;  4A3I J;  2ID3 A;  3HKZ A;  3CUQ C;  4OIP F;  3H9J A;  4BHC A;  5B1B H;  3V7C A;  3VEP A;  2V9P A;  2LY2 A;  1IN8 A;  2XGX A;  1IZ1 A;  4EQQ A;  3ECH A;  1U5T B;  2HVS A;  2V6E A;  1RUO A;  4PJM A;  2ZBK A;  3G4S I;  4OIN F;  1ZLJ A;  3DLA A;  2KRF A;  5TGT A;  5FKL A;  3I5U A;  4ZTF A;  4E7H A;  3HHH A;  1QQI A;  3G6E I;  4B44 A;  2F4M B;  1Y1W J;  4OAZ A;  5KAF C;  4BXF A;  2Z16 A;  1O4X A;  3OL4 A;  1BOA A;  4C2U A;  1B72 B;  4D9J A;  4XOT A;  5AIP A;  3EET A;  1RIO H;  3J7Y J;  2CUZ A;  2VQC A;  3C2H A;  2R93 J;  2HFH A;  4D1Q A;  3J80 K;  5IYD J;  1BI0 A;  1DPU A;  1ZRF A;  1XN7 A;  3CCJ I;  4AIJ A;  3CCS I;  2CV1 A;  2Q2E B;  4UY8 I;  2K02 A;  5F08 A;  4A0X A;  1JUP A;  3V8L A;  1H0M A;  3G1L A;  4C9Y A;  2M5W A;  3EUH A;  4ZYE A;  3K70 C;  4IRH A;  3GFM A;  2ZME B;  3A01 A;  3S3M A;  1YJ9 I;  2K4B A;  3HOY J;  3J7A O;  2DU9 A;  2B63 J;  1LE8 B;  2QUF A;  2WV0 A;  3OOU A;  1W7P D;  4GYG A;  2Z5U A;  3JR9 A;  2WAE A;  1YYV A;  4HEA 2;  1D0Y A;  1ZG5 A;  1N75 A;  1MND A;  2R7S A;  1XCV A;  4WWC A;  2VJ5 A;  3CTA A;  2DK5 A;  4B43 A;  1MSF C;  2BOL A;  5C4X J;  1JXS A;  2ELK A;  4UUT A;  3DTK A;  2XIG A;  3SZG A;  2QF7 A;  2GXA A;  4LB6 B;  3KEQ A;  5LGN A;  4PZJ A;  4O3M A;  1S7A A;  2Y75 A;  5LHH A;  5E8G A;  5GPA A;  4E4H A;  4JBA A;  1LQ1 A;  1Y56 A;  3BZC A;  2QZ8 A;  3G2B A;  3TOA A;  4E7L A;  1UST A;  2NOJ B;  4ESF A;  2GQQ A;  2VAS A;  3ZMV A;  1ZH5 A;  2CMP A;  2VQH A;  2M0C A;  1LFB A;  2LBF A;  3WE2 A;  1LDJ A;  2STW A;  5GAG J;  5CVJ A;  2KP6 A;  3M7G A;  1Z7L A;  3O8H A;  1I3Q J;  4LLN A;  5F27 A;  1MMS A;  2P8T A;  2CW0 F;  2V9V A;  3COA C;  3I4M J;  3DFG A;  5ICC A;  2VKE A;  2R7X A;  4KUM A;  5D4S A;  1BM9 A;  2XF5 A;  2R5Y A;  1B9N A;  3IC7 A;  3TOB A;  2HS5 A;  3DP7 A;  2JA2 A;  2CFX A;  4E7S A;  4G7H F;  3BG6 A;  3M07 A;  5FRM A;  3ZMS A;  2DPD A;  5C4J J;  2R7Q A;  2X51 A;  2A05 A;  2ZB9 A;  2JRT A;  2HXI A;  4XRS G;  5LBQ A;  1JKP C;  1B59 A;  3ZQ7 A;  2OCC H;  4QPO A;  1MMD A;  4F91 B;  1D5V A;  1V5G A;  1ZQ3 P;  3FBI B;  4OWR B;  1YG2 A;  3BDD A;  1TTY A;  3K70 D;  4HW0 A;  1BBY A;  3EQL F;  3QYB A;  1SD5 A;  2IGK A;  3A2K A;  1WI9 A;  3VYU B;  1UFM A;  1JHH A;  3E6D A;  4XNF A;  3FXU A;  2BE5 F;  3FKJ A;  2M8E A;  2MBF A;  2HTS A;  1R4N B;  4CCL A;  5LGU A;  5JVT A;  4DYR A;  1HW5 A;  3IWF A;  2HNH A;  2KRH A;  1J59 A;  4K2E A;  3CP2 A;  2DDB A;  2LF7 A;  1VQ9 I;  2EZH A;  4CSW A;  5EEG A;  1JJ8 C;  3CME I;  3FM3 A;  4LMY A;  4O6J A;  3FMQ A;  1DP3 A;  2WC2 A;  4NC6 A;  2M1B A;  2Y69 H;  4OIQ F;  3VSK A;  4BQO A;  1OQY A;  1VI0 A;  1TP4 A;  2WAD A;  2P5V A;  3HUG A;  2XGE A;  4MHG A;  3ISP A;  2MH9 A;  1K78 B;  1WWX A;  2KMU A;  1HF0 A;  5LRS A;  1I5Z A;  3I9V 2;  3BR2 A;  3HM5 A;  2HZT A;  2ADU A;  3HYI A;  3RKW A;  1HW1 A;  2GIZ A;  1D5Y A;  2V26 A;  3OS2 A;  3JRI A;  3AFH A;  1YW8 A;  2E1C A;  3I59 A;  3IH3 A;  4BS9 A;  2R7R A;  2R7V A;  3Q9S A;  1ZYR F;  4XLC A;  3WTS C;  2RAE A;  3DF8 A;  2OZU A;  2E71 A;  2ESN A;  4FTH A;  2EA4 A;  4UUS A;  2K85 A;  3LA3 A;  3ZOB A;  2DOE A;  1KZH A;  1QVU A;  1UZC A;  3GZ6 A;  4KNY A;  1X19 A;  1MMG A;  3WOD F;  3GTP J;  3LSH A;  2F5F A;  1R1V A;  1ODD A;  2P5L C;  1WRJ A;  1F43 A;  1U5T A;  2COB A;  4CIC A;  3HDD A;  4C2M J;  3GF2 A;  3VFZ A;  1XGN A;  3QOE A;  4PJL A;  5DD4 A;  1G59 A;  3RCO A;  5ICE A;  4U0W A;  3KCC A;  1W7P A;  1YQA A;  3K9T A;  5E18 F;  3D1N I;  2IXS A;  3H5R A;  5IP6 A;  2GLO A;  3BTL A;  3SZP A;  1UG0 A;  3SZT A;  5DUI A;  2B0L A;  5FKM A;  3ERM A;  2Z33 A;  3GTK J;  1I6H J;  3GXO A;  2VB6 A;  4MTE A;  3CES A;  1FTT A;  2EIN H;  2NVT J;  1Z67 A;  1I6X A;  3CJR B;  1P4X A;  3NRV A;  3R0J A;  4GYI A;  3CCL I;  1DQU A;  3O6B B;  2BV6 A;  5HLG A;  2YX7 A;  3D5S C;  5HDK A;  5IP7 J;  4U87 A;  1A6I A;  5FB2 A;  2M2E A;  2VJ4 A;  5C3E J;  2A69 F;  1NK2 P;  1V3F A;  3VPR A;  4ENK A;  4QIW N;  2IGO A;  4IHX A;  3ULQ B;  4CA0 A;  4ENM A;  4F3Q A;  4C3J J;  5JHU A;  3GLL A;  1XDS A;  2ZCW A;  1KA8 A;  2JA7 J;  1TWH J;  1OIS A;  3TMO A;  2GOX B;  4BE0 A;  2CG4 A;  1K6Y A;  3GLX A;  1D0Z A;  4U0V A;  3OYI A;  2JT1 A;  4RGR A;  1APL C;  4XID A;  3ONQ A;  5DCF A;  5LEJ A;  2PJR A;  1YIT I;  2WAQ N;  1MJ9 A;  3EUH C;  2XRN A;  2JSC A;  1IXS B;  3HRT A;  3KE2 A;  3B02 A;  1RI7 A;  2R4G A;  2G0E A;  2XPU A;  3E5X A;  5IP9 J;  2CV2 A;  2P4W A;  4L5J A;  2LKX A;  3HGG A;  2QQA A;  2DFF A;  2XF7 A;  2ZO4 A;  3OMY A;  4ZYA A;  3HHG A;  4HBL A;  4F55 A;  1IRF A;  5E3M A;  2LD5 A;  1T95 A;  2F48 A;  2LKP A;  3TQN A;  1WZ2 A;  1S7E A;  4D7N A;  4P5O A;  3ZPL A;  1MBJ A;  4I76 A;  2PX9 A;  2QWW A;  3CC4 I;  2G9W A;  4F7Z A;  4MQV A;  3OYD A;  2DA4 A;  2DT6 A;  2X48 A;  4M6V A;  4BXU A;  1YRN B;  4I7H A;  1LEB A;  2O7O A;  3LWF A;  2VN2 A;  5E8I A;  1G3W A;  1QGP A;  2D1V A;  1JJ6 C;  2KL4 A;  4W1U A;  1RR7 A;  2NVU B;  1IN7 A;  2QSG X;  1TQP A;  2DLL A;  4L0Z B;  1VND A;  1TW2 A;  1POG A;  5DDG A;  5M5W J;  3KP6 A;  1FBS A;  2OD5 A;  2QQ8 A;  5C44 J;  4Z6Y A;  2ZFW A;  3TP3 A;  4ZC3 A;  4M3D A;  1P4A A;  1IN5 A;  5E3N A;  1HST A;  2HR3 A;  4UNO A;  1WH5 A;  3RPQ A;  3IL2 A;  3HSR A;  3I0T A;  3CCU I;  1QZY A;  4EM1 A;  3DKY A;  3IRQ A;  3BR6 A;  2OPT A;  3KLO A;  3T1B A;  3JCU C;  1S5L C;  4KIB A;  1GUU A;  4A3B J;  2M45 A;  3K6G A;  4BUP A;  3OYB A;  1BR1 A;  3RYR A;  2XAG A;  3KX2 A;  3L7W A;  1W4M A;  3M3Y J;  3DKW A;  1R36 A;  3KP4 A;  4X0G A;  4KIG A;  3RPU A;  1DDN A;  3DBR B;  1MW7 A;  3WGG A;  1OR7 A;  2MAB A;  4I02 A;  1S29 A;  2EBI A;  5HDG A;  1PDN C;  4KDP A;  3BTC A;  4KFC A;  4WXD A;  1FTZ A;  2OJE D;  2M34 A;  3QYE A;  3ZMZ A;  1VQM I;  3FX3 A;  4Q4Z F;  1I39 A;  2Y48 A;  5J1U A;  3TKY A;  1BC7 C;  4A0Y A;  1VZ0 A;  3PIO F;  4FIS A;  2O3F A;  1JKQ C;  3RQ4 A;  3IH4 A;  3PQK A;  1Z0X A;  2IS6 A;  3V7S A;  1W36 C;  4LK1 F;  4DBR A;  1DGW Y;  4HX7 A;  1R5G A;  2DA6 A;  1W5C C;  1VQ6 I;  1RNL A;  4CHU A;  2OC6 A;  4XL9 A;  2ZXJ A;  3ABL H;  4ITV A;  3HBL A;  1OR7 C;  2VC1 A;  3CMM A;  2BHY A;  2G7U A;  3RKY A;  1Y8R B;  1HLV A;  4AID A;  1XGO A;  4RA2 A;  1PUF A;  3ESW B;  3BR1 A;  4BAY A;  5K1Y A;  2K27 A;  4IHV A;  1Z3X A;  1M1E B;  3KEY A;  1OCP A;  1X58 A;  1VFC A;  3CP8 A;  1XS9 A;  3VYT B;  4RB1 A;  1L3L A;  3H9G A;  1W36 D;  4MEX F;  2IS1 A;  1ETY A;  2AO9 A;  4OOI A;  1V55 H;  2A6E F;  2HQR A;  2KDZ A;  4AC0 A;  2VPR A;  4OIR F;  4DBQ A;  2QM3 A;  4R8H A;  4M71 A;  2VJI A;  3GEZ A;  1W0U A;  4HLY A;  1NHA A;  2PBI A;  3MQ0 A;  3AG4 H;  5HLT A;  5E3O A;  3OYC A;  4LLG F;  2IP2 A;  2R7D A;  3Q0W A;  3TDZ C;  5DUK A;  3LFU A;  3FIS A;  3AG3 H;  3PNV A;  3CDL A;  1KU9 A;  3CC2 I;  3JAM Z;  3VSL A;  3UKG A;  3E3V A;  4XLP F;  2VC0 A;  2IS4 A;  2QA4 I;  1J75 A;  1XSV A;  1IRZ A;  1EKE A;  2G7H A;  3ABT A;  4PJN A;  5FKO A;  3ZXS A;  4LOC A;  4XRF A;  3I4N J;  1ZR2 A;  3DBH B;  1F5T A;  2O5R A;  2MD0 A;  2FU4 A;  2QQB A;  3RTR A;  4F52 A;  2ZSH B;  4N4O B;  2Y31 A;  2QQ9 A;  2CQQ A;  4DW6 A;  3E97 A;  4FT8 A;  2M8G X;  3H36 A;  2RKH A;  4HST A;  4UV9 A;  2ISZ A;  1XSD A;  4KIT B;  1R9T J;  1BI3 A;  3L2V A;  5J8F A;  1X2M A;  4XM3 A;  1FMW A;  1KU7 A;  1WKM A;  3GME A;  2EFN A;  1JGS A;  2UUZ A;  2IT0 A;  4A3J J;  3FMR A;  2GM4 A;  2L7K A;  3KFW X;  1B4A A;  1EJ9 A;  1BOB A;  4UHT A;  4A6D A;  2C6Y A;  2HGC A;  2OBP A;  3HRU A;  5LRR A;  4A5N A;  5J3L A;  1FZP B;  3RQI A;  2EQR A;  3NAR A;  3LA2 A;  1P9Q C;  2FE3 A;  2PMH A;  1X3Z B;  2WB1 A;  2CQ7 A;  3T8R A;  4DIQ A;  1MDM A;  1VQ8 I;  1XCB A;  2MA3 A;  1T6S A;  2JVG A;  1OMI A;  4IX7 A;  1PUF B;  1KU2 A;  3MN2 A;  4XLA A;  5JFR A;  2L9N A;  4BQN A;  5ILS A;  3OYK A;  2NVY J;  2E2I J;  4KMU X;  3CJQ B;  1CQT A;  2KIU A;  3S93 A;  3OV8 A;  2LF8 A;  3E5U A;  2E2J J;  1BJZ A;  2FOW A;  2L02 A;  5DCM B;  1TZL A;  2GWR A;  1LKX A;  3J7Z I;  5ILV A;  3T0Y A;  1VF9 A;  3O3K A;  1E0E A;  2ISY A;  2HOS A;  2YS9 A;  1ORK A;  2IRF G;  1HDD C;  2DA7 A;  2ZME C;  3F3X A;  1S3J A;  3T5X A;  3E6C C;  3W2A A;  3K4B A;  3CMY A;  2HDC A;  1WCM J;  2CJJ A;  2P6T A;  2WTE A;  3CCM I;  4XMY A;  1D1A A;  5J1Y A;  4Y3O A;  1IAW A;  4R1H A;  2JPC A;  4HV5 A;  2ZJR F;  5DV5 A;  1VQO I;  2STT A;  1OPC A;  3K1P A;  4I99 C;  4LIU A;  1QA6 A;  4FQG A;  2RGV A;  4A3L J;  5DM6 F;  1S8N A;  1FYM A;  3P5J A;  1MH3 A;  1TQI A;  1VQL I;  2IBD A;  2P5K A;  2P7C B;  4KT6 A;  2NOG A;  4BJ5 C;  1SD4 A;  3PNY A;  2JSP A;  3G1O A;  3V42 A;  5EEA A;  2FF4 A;  4EJV A;  3FXQ A;  3L2Q A;  4QSH A;  3CCE I;  3KPH A;  2KT0 A;  4WK8 F;  2MLK A;  1G8X A;  1TWF J;  2ZXI A;  1P7I A;  1FOY A;  4YFK F;  2DT7 B;  2XHK A;  5M3F J;  4RDU A;  1U5T C;  2CQN A;  3JRE A;  5CQE A;  3PFI A;  3L2W A;  2LRD A;  3ZQH A;  4BU2 A;  2L0K A;  3EYY A;  4M9X A;  3BT9 A;  1HW2 A;  3CLQ A;  3RIR A;  2EZK A;  2Z1D A;  2LMD A;  1AU7 A;  3LSR A;  5HNF A;  1A5J A;  4E7J A;  2Z2S B;  2ELJ A;  3B6C A;  5K7F A;  2Y9Y A;  2NRA C;  2FML A;  4ZJZ A;  2V79 A;  3LAP A;  4LGW A;  3HOU J;  1AKH B;  2A61 A;  1VTN C;  2L7F P;  2O9L A;  3W3C A;  1IXR C;  2VT3 A;  2Y9Z A;  3BCB A;  5BPD A;  3NAU A;  3I53 A;  1WJB A;  4A12 A;  1XC5 A;  3F8C A;  1X2N A;  2M7B A;  4IPA A;  4HSR A;  2RN7 A;  2MSY A;  3L09 A;  2QEN A;  5L3C A;  3FXJ A;  3DBL B;  4RGX A;  2LR8 A;  5BMZ A;  3GVA A;  3E0J B;  3I56 I;  2HVR A;  4IVN A;  2ESH A;  3LOC A;  4KN4 X;  1SEU A;  3LAJ A;  4EVI A;  2Y0S N;  4EJW A;  4C2T A;  1XB4 A;  1Z1D A;  1F1Z A;  1YE9 A;  2COM A;  2WY8 Q;  2EFW A;  4LFU A;  3OYM A;  1SAU A;  3C1D A;  3L2U A;  1DUX C;  3BOQ A;  1A6Q A;  3SXY A;  5FD6 A;  3M8J A;  1QNT A;  1D8K A;  1SVO A;  5HNH A;  4IRI A;  2W82 A;  3VDX A;  4KIC A;  5K5O A;  4RGU A;  1Y8Q B;  4V2F A;  3FXO A;  3SFZ A;  1D1B A;  3MZY A;  3S32 A;  5JVG F;  2MC4 A;  2N8G A;  2VIX A;  4KIS A;  3S1Q J;  4Q5S F;  1EF4 A;  2DAO A;  4FCY A;  2R5Z B;  2IA1 A;  2EH3 A;  1QO0 D;  5DEQ A;  3B6A A;  3FWE A;  2JA8 J;  5E79 C;  3EPZ A;  1VQN I;  3FHN A;  3P9I A;  2W1O A;  3Q0U A;  2CQX A;  2IEK A;  5EJC A;  4ZH4 F;  2WWY A;  3QU3 A;  3SYT A;  1R4M B;  3UNG C;  2HKO A;  2PI0 A;  2WV1 A;  2YX4 A;  3GO5 A;  3HTU A;  3K10 A;  2EB7 A;  4BJT A;  3MZH A;  1AWC A;  3CCV I;  3IUO A;  4IZZ A;  5LLQ A;  1MNM C;  2QCO A;  1RUN A;  5IT9 K;  4D7M A;  3D0S A;  4A5M A;  3ZQF A;  2EZL A;  3E6M A;  3MKY B;  4Y13 A;  4I2O A;  4HNU A;  3GTG J;  4OAY A;  3S15 J;  3K4K A;  2F5D A;  2K7L A;  1W7P B;  4LJZ F;  4IHS A;  3AL0 B;  3LSI A;  3ZGK A;  1X1C A;  2V1N A;  2XGD A;  3Q0V A;  2L9S A;  3DQV C;  1SFK A;  3HG9 A;  2CUJ A;  2CRG A;  2MFZ A;  2X85 A;  5KCM A;  2HPM A;  1XPX A;  2LRE A;  3PUB A;  1YW7 A;  2OQG A;  1CF7 B;  2CQK A;  4HV6 A;  3H5N A;  1QPI A;  2VBW A;  3CLO A;  4IJA A;  3GFJ A;  4I0A A;  4HRI A;  4I6Z A;  1HQC A;  1R22 A;  1D8J A;  3UR3 C;  4EJU A;  1S72 I;  1LFU P;  2DQL A;  3WU0 A;  4L0Y B;  2FD5 A;  2F5E A;  1D0X A;  2BVL A;  2O8X A;  1GLN A;  1YIJ I;  1JGG A; 
#chains in the Genus database with same CATH homology
 4IXA A;  2QBY B;  3G3Z A;  1U2W A;  4RGS A;  1CGP A;  4TV7 A;  1FSE A;  5HDN A;  3K1M A;  3K1N A;  4LG0 B;  4EJT A;  3ZMD A;  4H0E A;  1WQ2 A;  2OZ6 A;  3IHU A;  3H92 A;  4CGZ A;  1G3Y A;  1S6L A;  2D1H A;  1ZG1 A;  1XGM A;  3V8J A;  4AIK A;  2MLG A;  2DQR A;  5BQT A;  2ZJ2 A;  2XKO A;  3I64 A;  2DTR A;  1MD0 A;  1R1U A;  1ZRC A;  4GCV A;  2JPB A;  4LG0 A;  1Z05 A;  2QLZ A;  3N4M A;  1OYW A;  4M72 A;  2ETH A;  4EMS A;  1ONV A;  2O0Y A;  4UV8 A;  3NEU A;  3VOE A;  3JAM K;  3CO7 C;  1XMK A;  1YW9 A;  2XAF A;  3F23 A;  3PQJ A;  5HLH A;  2DBB A;  3F8F A;  1LB2 A;  2EK5 A;  3BJ6 A;  1GHC A;  3QU6 A;  2BEO A;  1XGS A;  1ZAR A;  4HF0 A;  5D6F A;  4P96 A;  1G3S A;  2J5P A;  3R61 A;  3ECO A;  5FD5 A;  1EH8 A;  1MZB A;  4EV0 A;  4Q48 A;  1FPQ A;  3TO9 A;  3AAF A;  2A6H F;  2K4J A;  4BNC A;  2ZME A;  1LNW A;  4YFN F;  2HYG D;  2FBH A;  3EYI A;  1QBJ A;  1FLI A;  1LDK B;  2QVO A;  1O7L A;  3ZN0 A;  4MQ9 F;  2DW4 A;  3N97 A;  3KET A;  1MJB A;  1HSJ A;  2UXX A;  2V1D A;  3L9F A;  4I98 B;  1IUY A;  2UWM A;  4G8X A;  2Q8K A;  1ZGA A;  1SD7 A;  5HOO A;  1UHW A;  2GIV A;  1UB9 A;  1T0F A;  1I27 A;  4Y15 A;  1EH6 A;  1H9G A;  5CLS A;  3LST A;  3F8N A;  2BYV E;  3OOP A;  1ZHF A;  4E70 A;  1FYL A;  1I1G A;  4G6D A;  5DD8 A;  5IT3 A;  4GO1 A;  2HQN A;  1SFE A;  1SD6 A;  1T98 A;  1OYI A;  1E17 A;  4WF2 A;  2NNN A;  2F5C A;  1A04 A;  5E1W A;  5D4R A;  2D2W A;  2GAU A;  1KU3 A;  3JTH A;  2P7V B;  3D5L A;  3F6V A;  1T2K A;  2JTV A;  3DV8 A;  5FLX Z;  3SHF A;  3L00 A;  2O6G E;  1J5Y A;  4EGZ A;  1USS A;  4A0Z A;  2H94 A;  1B9M A;  3R60 A;  4UUV A;  1TLH B;  3BZ6 A;  4PGG A;  2HTJ A;  4L9V A;  4ZZL A;  4FHT A;  2FEZ A;  2XAJ A;  3I59 B;  4HAM A;  4A2U A;  1Z7U A;  2VT2 A;  1YFH A;  1HKQ A;  1FP2 A;  4PCQ A;  4DQ2 A;  4CXF A;  2AS5 F;  2W57 A;  2CO5 A;  2PLY A;  1BN5 A;  3K69 A;  4I09 A;  1LDD A;  3LQR A;  3FF5 A;  4O5V A;  3T8T A;  2XRO A;  2ZNY A;  2DI3 A;  2F2E A;  1U6G A;  5D5X B;  2LNB A;  4MTD A;  3WTT C;  4KYW A;  4P9F A;  4U88 A;  2XAS A;  1R5H A;  1LVA A;  5IT9 Z;  3M9A A;  2NYX A;  3KLN A;  1J0R A;  4BQA A;  2YR2 A;  3C3W A;  5DCM A;  1JE8 A;  2L01 A;  2VOD A;  2IA2 A;  3ELK A;  1FP1 D;  3SQN A;  3GUD A;  3REO A;  2DFI A;  3K0L A;  2UZK A;  3GFL A;  4HLX A;  6PAX A;  5ICG A;  4KT5 C;  5L3F A;  5D5W B;  1KYW A;  5A2Q Z;  3F22 A;  4NHJ A;  2W84 A;  4YFX F;  4ZYD A;  4Q47 A;  2EFP A;  2Z3Y A;  3WTW C;  2GA2 A;  2RVC A;  2EFQ A;  1F9N A;  1R00 A;  1X3U A;  2V6C A;  4ZYG A;  5CVV A;  5LHI A;  2L4A A;  3KP2 A;  2MD5 A;  1O3S A;  1BJA A;  3WG9 A;  1AOY A;  3BWG A;  2H09 A;  5ERI A;  3O2P E;  4HX8 A;  3ZMT A;  2RNJ A;  3MEX A;  1QPM A;  2YSR A;  2PG4 A;  1O3Q A;  3TGN A;  2UXN A;  4KMF A;  4UVC A;  2FNA A;  4I0B A;  3I71 A;  3QPT A;  2Q2E A;  1TQM A;  3M8E A;  3I54 A;  3GWZ A;  4ON0 A;  4G94 A;  4BHB A;  3MAJ A;  2QBY A;  3WU1 B;  3E5Q A;  1SAX A;  3HRM A;  2R3S A;  3FHZ A;  2A5Y B;  1STZ A;  2PQ8 A;  1QZZ A;  2IW5 A;  5ED4 A;  1CF7 A;  3I4P A;  2TDX A;  4QLC U;  2A07 F;  2VOP A;  2XV4 S;  2GA1 A;  4AWX B;  4EGY A;  1XSX A;  3DPL C;  3DXJ F;  3HTS B;  4LB5 A;  3C7J A;  1FSH A;  3NQO A;  1P2F A;  2PMU A;  4MGR A;  5H6Q A;  1G4D A;  4XSX F;  4HZF A;  2DK8 A;  4BYY A;  5L3G A;  5J6X A;  1B6A A;  2EV0 A;  2XAH A;  4Z2Y A;  3ERE D;  2E7W A;  3RDI A;  5LGT A;  2LSO A;  2CYY A;  2OQR A;  2OA4 A;  2QYO A;  2MH2 A;  4RAY A;  5H6R A;  3W6K B;  1IN6 A;  3KEO A;  5FO5 A;  3MWM A;  3LQQ A;  1S7O A;  1XMA A;  1ZN2 A;  3ZMU A;  1J7K A;  3BP8 A;  5CVI A;  1LJ9 A;  1KQ9 A;  3M8F A;  5L3D A;  3W6J B;  2AXL A;  3DPT A;  1B1B A;  2VOO A;  1OKR A;  1IN4 A;  1T38 A;  2A68 F;  2J5O A;  5HS7 A;  1I1S A;  1DP7 P;  1FX7 A;  2V1U A;  4ETS A;  4CDG A;  2L54 A;  1IRG A;  3ROU A;  3IKT A;  2ZNZ A;  5HS9 A;  1RZ4 A;  3E6B A;  1R58 A;  2EJR A;  3GFI A;  2CGP A;  1YLF A;  1MDM B;  3RJP A;  1O3T A;  4ASN A;  3U9G A;  1ZGJ A;  1K7A A;  5BS6 A;  1U78 A;  3QOP A;  3HOT A;  5K5Q A;  2GZW A;  1D3Y A;  3LA7 A;  1IXC A;  5D5U B;  5HVQ C;  3F6O A;  2HWV A;  2PN6 A;  2NAZ A;  1XD7 A;  2PJP A;  2Q0O A;  2IJL A;  4M6X A;  4RB2 C;  5D8K B;  1HKS A;  2M87 A;  4EM2 A;  1Z9C A;  2LDU A;  2PEX A;  4BHP A;  2GXB A;  2VBY A;  4KA4 A;  1SFX A;  4ESJ A;  4B8X A;  4HF1 A;  4G6Q A;  1KQ8 A;  3KZZ A;  1U8R A;  3IKV A;  1W5S A;  1J2X A;  3QAH A;  2D45 A;  4L9T A;  2RV8 A;  4M6Y A;  2VE9 A;  4M73 A;  4DNC A;  2YU3 A;  2O03 A;  3M1E A;  4B09 A;  3JSP A;  4BH9 A;  4ENJ A;  1SMY F;  3C18 A;  1TBX A;  4AVP A;  2L3D A;  4AD9 A;  2NS0 A;  4ENN A;  2KJB A;  1K79 A;  3J81 Z;  1TNS A;  1ZRD A;  1PP7 U;  2PFB A;  2HEO A;  3JSO A;  3GX4 X;  2IVM A;  2RC4 A;  4LK0 F;  5ICF A;  4KIF A;  5E17 F;  4CO8 A;  1MGT A;  4ZYH A;  4LLL A;  4AIH A;  1UCR A;  1MJA A;  1EH7 A;  4WXC A;  3WE3 A;  5A2Q K;  4N9I A;  4M9S A;  1TNT A;  1PUE E;  1SFU A;  2BBY A;  3P9K A;  2FMY A;  1O7F A;  1FBQ A;  2EA2 A;  3CUO A;  3TO6 A;  3QP6 A;  3VB2 A;  1H9T A;  1YIO A;  3GZ5 A;  4HQM A;  3ZN1 A;  5AON A;  1Z91 A;  2KIF A;  4RB0 A;  3QRF F;  4HDU A;  3WTZ A;  5F1R A;  4LD5 A;  4GGG A;  3TO7 A;  4P55 A;  1T39 A;  2ACJ A;  4KN7 X;  2E7X A;  2FBK A;  4EM0 B;  4M74 A;  1J9I A;  2FBI A;  5CVR A;  1G6N A;  1Y0U A;  3R6S A;  3WTX C;  3LFK A;  4CYD A;  3BJO A;  4ZZD A;  3JTG A;  1FT9 A;  4M9Z A;  4HF2 A;  1ON2 A;  5FFZ A;  3RI4 A;  3DEU A;  1ZG3 A;  2Z9O A;  2K86 A;  2KIM A;  1Q1H A;  4QWQ A;  5FGM A;  4R79 A;  5FFX A;  2W85 A;  2VE8 A;  4HOB A;  1FNN A;  4UVA A;  4MEY F;  2FXA A;  4P9U A;  2EFO A;  4G9Y A;  3BRO A;  1FOK A;  2NNY A;  2EV6 A;  3P9C A;  4IRG A;  1REP C;  2EWN A;  2GXG A;  5LHG A;  4XSZ F;  4RB3 C;  3HSF A;  2O61 A;  1UHM A;  2KJC A;  3J80 Z;  3FMS A;  3KP5 A;  3GYH X;  2FQ3 A;  1K6O A;  1TW3 A;  4A6E A;  5JR3 A;  2FNP A;  2XKP A;  2FA5 A;  2Y0M A;  5BPI A;  2XAQ A;  1LEA A;  4L9J A;  4ESB A;  2YPR A;  3CO6 C;  2MC3 A;  5CJ9 A;  3WTV C;  4D0P A;  4HDV A;  5LEK A;  2DT5 A;  1BIA A;  4IF4 A;  3TDU C;  2HOE A;  1ZRE A;  1P6R A;  2W24 A;  4U7B A;  2R7F A;  3VOD A;  4L9N A;  4S04 A;  5BOX A;  2V1X A;  5DYM A;  4JQF A;  5EEH A;  3U1D A;  2ZKZ A;  3EDP A;  2H6B A;  5HS8 A;  2L4M A;  3MCZ A;  5CYV A;  2RDP A;  3HOS A;  4MNU A;  1U3E M;  4CZZ A;  4Y17 A;  4HX4 A;  4PGH A;  1HKT A;  4HA8 A;  1FWZ A;  4UVB A;  1YS6 A;  2FSW A;  3S2W A;  2IA0 A;  2HYF A;  1YS7 A;  3RYP A;  3BPX A;  2HKX A;  1P4W A;  2KKO A;  1C0W A;  5AIQ A;  3V7R A;  3RKX A;  2ELH A;  2X0L A;  4EJO A;  1ULY A;  3WTU C;  3WTY C;  3QPH A;  2VXZ A;  3JW4 A;  3BPV A;  2H6C A;  2XUB A;  3KP3 A;  1KQ0 A;  1IW7 F;  4XBF A;  1O57 A;  2FOK A;  3GW2 A;  3KZY A;  5F6F A;  1FBU A;  4IHT A;  1KGS A;  1O3R A;  3ABU A;  5TRD A;  3B73 A;  1G3T A;  3F21 A;  1GXQ A;  1HXD A;  2P6S A;  5ILU A;  3KP7 A;  2RQP A;  1YO5 C;  3BY6 A;  3I58 A;  1KYZ A;  3CDH A;  1BIB A;  2FRH A;  1YTY A;  4NQW A;  4G7O F;  1R23 A;  3WGI A;  1JHF A;  1K78 A;  2BGC A;  3HRS A;  5D8L B;  3FM5 A;  1EV7 A;  1R7J A;  3ZP5 A;  4OIO F;  4JK1 X;  1BC8 C;  3P7N A;  1FYK A;  3K2Z A;  1BI1 A;  3MFK A;  2DO7 A;  4L18 B;  5CVU A;  3L2C A;  4S05 A;  3H3U A;  1F4K A;  3G73 A;  3Q9V A;  3F72 A;  2OU2 A;  3IRR A;  1XDU A;  2VBZ A;  1ZLK A;  4N9H A;  1PP8 F;  1ON1 A;  2CWE A;  1W5T A;  5E1Z B;  4G7Z F;  3H3Z A;  3HIF A;  1Z6T A;  5J8C A;  1MKM A;  5D5V B;  4U7D A;  5JI6 A;  3ML6 A;  5K5R A;  1GXP A;  3CUQ B;  1WSU A;  3FZV A;  4NB5 A;  1E2X A;  5KK1 A;  2Z99 A;  4WX9 A;  2XVC A;  5TJJ A;  5H20 A;  5L3E A;  4HYE A;  4UXN A;  1V4R A;  5FLX K;  5L3B A;  3U2R A;  2JZY A;  2OAZ A;  2A3S A;  2DPU A;  4RAZ A;  2EV5 A;  1HBX G;  1Z6R A;  4U0Y A;  4GXO A;  3BJA A;  3J81 K;  1BI2 A;  3R0A A;  4OMZ A;  3WGH A;  3IWZ A;  1R1T A;  3Q5F A;  1DPR A;  3QP5 A;  2IPQ X;  5HLI A;  2VON A;  1OYY A;  4WXH A;  5KVR A;  3CUQ A;  5F64 A;  2E1N A;  4YIF A;  2VBX A;  3V4G A;  5E1X A;  2CSO A;  4N0B A;  4FX4 A;  4PDK A;  2W25 A;  4XLN F;  4L5I A;  4YII A;  4RS8 A;  4I01 A;  4OMY A;  3FXR A;  3R4K A;  3V8K A;  1IF1 A;  5D6E A;  3F8B A;  1P92 A;  1FY7 A;  4FX0 A;  2X4H A;  2M30 A;  3HSE A;  4YG2 F;  1FC3 A;  2H27 A;  1GVJ A;  3F8M A;  4WCG A;  1L0O C;  1ZAO A;  4OU0 A;  4HQE A;  5E20 A;  3CJN A;  1SMT A;  3CUQ C;  4OIP F;  4BHC A;  3V7C A;  3VEP A;  1IN8 A;  2XGX A;  1IZ1 A;  4EQQ A;  3ECH A;  1U5T B;  1RUO A;  2ZBK A;  4OIN F;  1ZLJ A;  2KRF A;  3I5U A;  3HHH A;  1QQI A;  1BOA A;  5AIP A;  3EET A;  1RIO H;  2HFH A;  3J80 K;  1BI0 A;  1DPU A;  1ZRF A;  1XN7 A;  4AIJ A;  2K02 A;  4A0X A;  3V8L A;  1H0M A;  2M5W A;  3EUH A;  4ZYE A;  4IRH A;  3GFM A;  2ZME B;  2K4B A;  3J7A O;  2DU9 A;  2QUF A;  2WV0 A;  1W7P D;  4GYG A;  2Z5U A;  1YYV A;  1ZG5 A;  1XCV A;  4WWC A;  3CTA A;  2DK5 A;  1JXS A;  2XIG A;  4LB6 B;  3KEQ A;  5LGN A;  4PZJ A;  4O3M A;  1S7A A;  2Y75 A;  5LHH A;  5E8G A;  4JBA A;  1LQ1 A;  2QZ8 A;  3TOA A;  1UST A;  4ESF A;  2GQQ A;  3ZMV A;  1ZH5 A;  3WE2 A;  1LDJ A;  2STW A;  5CVJ A;  3M7G A;  4LLN A;  2P8T A;  2CW0 F;  2V9V A;  3COA C;  3DFG A;  5ICC A;  4KUM A;  5D4S A;  1BM9 A;  1B9N A;  3IC7 A;  3TOB A;  2HS5 A;  3DP7 A;  2CFX A;  4G7H F;  3ZMS A;  2DPD A;  2JRT A;  5LBQ A;  1B59 A;  3ZQ7 A;  1D5V A;  1YG2 A;  3BDD A;  1TTY A;  4HW0 A;  1BBY A;  3EQL F;  1SD5 A;  1WI9 A;  1UFM A;  1JHH A;  3E6D A;  3FXU A;  2BE5 F;  2M8E A;  2MBF A;  2HTS A;  5LGU A;  5JVT A;  1HW5 A;  3IWF A;  1J59 A;  4K2E A;  2LF7 A;  5EEG A;  3FM3 A;  4LMY A;  4O6J A;  3FMQ A;  2WC2 A;  2M1B A;  4OIQ F;  2P5V A;  3HUG A;  4MHG A;  3ISP A;  2MH9 A;  1K78 B;  1WWX A;  5LRS A;  1I5Z A;  2HZT A;  2ADU A;  3HYI A;  3RKW A;  1HW1 A;  1YW8 A;  2E1C A;  3I59 A;  3Q9S A;  1ZYR F;  3WTS C;  3DF8 A;  2OZU A;  2ESN A;  2EA4 A;  3LA3 A;  3GZ6 A;  4KNY A;  3WOD F;  2F5F A;  2P5L C;  1R1V A;  1ODD A;  1WRJ A;  1U5T A;  4CIC A;  3GF2 A;  3VFZ A;  1XGN A;  5DD4 A;  5ICE A;  4U0W A;  3KCC A;  1W7P A;  1YQA A;  3K9T A;  5E18 F;  3SZP A;  3SZT A;  5DUI A;  2B0L A;  2Z33 A;  3GXO A;  4MTE A;  4GYI A;  1I6X A;  3NRV A;  1P4X A;  3R0J A;  3O6B B;  2BV6 A;  5HLG A;  2YX7 A;  5HDK A;  5FB2 A;  2A69 F;  1V3F A;  4ENK A;  3ULQ B;  4ENM A;  5JHU A;  1XDS A;  2ZCW A;  1KA8 A;  2CG4 A;  3GLX A;  4U0V A;  2JT1 A;  4RGR A;  5DCF A;  5LEJ A;  1MJ9 A;  2XRN A;  2JSC A;  1IXS B;  3HRT A;  3KE2 A;  3B02 A;  1RI7 A;  3E5X A;  2P4W A;  4L5J A;  2QQA A;  2ZO4 A;  3HHG A;  4HBL A;  1IRF A;  2LKP A;  3TQN A;  4P5O A;  3ZPL A;  2QWW A;  2G9W A;  4F7Z A;  4MQV A;  4BXU A;  4I7H A;  1LEB A;  3LWF A;  2VN2 A;  5E8I A;  1G3W A;  1QGP A;  2D1V A;  1IN7 A;  1TQP A;  2DLL A;  4L0Z B;  1TW2 A;  5DDG A;  3KP6 A;  1FBS A;  2OD5 A;  2ZFW A;  1P4A A;  1IN5 A;  1HST A;  2HR3 A;  4UNO A;  3RPQ A;  3IL2 A;  3HSR A;  3I0T A;  1QZY A;  4EM1 A;  3IRQ A;  3KLO A;  3T1B A;  4KIB A;  2M45 A;  3RYR A;  2XAG A;  3L7W A;  1W4M A;  3DKW A;  1R36 A;  3KP4 A;  4KIG A;  3RPU A;  1DDN A;  3WGG A;  1OR7 A;  4I02 A;  1S29 A;  5HDG A;  1PDN C;  4KDP A;  4KFC A;  4WXD A;  3ZMZ A;  3FX3 A;  4Q4Z F;  2Y48 A;  3TKY A;  1BC7 C;  4A0Y A;  2O3F A;  3PQK A;  3V7S A;  4LK1 F;  4HX7 A;  1R5G A;  1RNL A;  4CHU A;  2ZXJ A;  2VC1 A;  2G7U A;  3RKY A;  1XGO A;  4BAY A;  5K1Y A;  2K27 A;  1L3L A;  4RB1 A;  4MEX F;  4OOI A;  2A6E F;  2HQR A;  4OIR F;  2QM3 A;  4R8H A;  4M71 A;  3GEZ A;  4HLY A;  1NHA A;  2PBI A;  3MQ0 A;  4LLG F;  2IP2 A;  2R7D A;  3TDZ C;  5DUK A;  1KU9 A;  3JAM Z;  3E3V A;  4XLP F;  2VC0 A;  1J75 A;  1XSV A;  2G7H A;  3ABT A;  4XRF A;  1F5T A;  2FU4 A;  2QQB A;  3RTR A;  2QQ9 A;  3E97 A;  4FT8 A;  4UV9 A;  2RKH A;  2ISZ A;  1XSD A;  1BI3 A;  5J8F A;  1KU7 A;  1WKM A;  2EFN A;  1JGS A;  2IT0 A;  3FMR A;  3KFW X;  1B4A A;  2C6Y A;  4UHT A;  4A6D A;  2HGC A;  2OBP A;  3HRU A;  5LRR A;  4A5N A;  1FZP B;  3LA2 A;  2PMH A;  2FE3 A;  3T8R A;  1MDM A;  1XCB A;  2MA3 A;  1T6S A;  1OMI A;  1KU2 A;  5JFR A;  5ILS A;  4KMU X;  2KIU A;  3OV8 A;  2LF8 A;  3E5U A;  2L02 A;  5DCM B;  2GWR A;  5ILV A;  3T0Y A;  3O3K A;  2ISY A;  2IRF G;  3F3X A;  1S3J A;  3T5X A;  3E6C C;  2HDC A;  2P6T A;  2WTE A;  1IAW A;  4R1H A;  2JPC A;  4HV5 A;  5DV5 A;  2STT A;  1OPC A;  3K1P A;  2RGV A;  1S8N A;  1FYM A;  1TQI A;  2P5K A;  2P7C B;  1SD4 A;  2FF4 A;  4EJV A;  3FXQ A;  4WK8 F;  2MLK A;  4YFK F;  2XHK A;  1U5T C;  3PFI A;  3EYY A;  4M9X A;  1HW2 A;  3RIR A;  2NRA C;  2FML A;  2V79 A;  3LAP A;  4LGW A;  2A61 A;  1VTN C;  1IXR C;  2VT3 A;  5BPD A;  3I53 A;  4A12 A;  3F8C A;  4IPA A;  2RN7 A;  5L3C A;  3L09 A;  2QEN A;  4RGX A;  5BMZ A;  3GVA A;  4IVN A;  2ESH A;  4KN4 X;  3LAJ A;  4EVI A;  4EJW A;  1XB4 A;  1Z1D A;  1F1Z A;  2COM A;  2EFW A;  4LFU A;  3C1D A;  1DUX C;  3BOQ A;  3SXY A;  5FD6 A;  1QNT A;  1D8K A;  4IRI A;  4KIC A;  5K5O A;  4RGU A;  3SFZ A;  3MZY A;  4Q5S F;  2DAO A;  2IA1 A;  1QO0 D;  5DEQ A;  3FWE A;  3P9I A;  2WWY A;  4ZH4 F;  3QU3 A;  2HKO A;  2PI0 A;  3GO5 A;  2YX4 A;  3HTU A;  2EB7 A;  3MZH A;  1AWC A;  5LLQ A;  1RUN A;  5IT9 K;  3D0S A;  4A5M A;  3E6M A;  4Y13 A;  4I2O A;  2F5D A;  2K7L A;  1W7P B;  4LJZ F;  4IHS A;  3DQV C;  1CF7 B;  1YW7 A;  2OQG A;  2CQK A;  4HV6 A;  2VBW A;  3CLO A;  4IJA A;  3GFJ A;  4I0A A;  1HQC A;  1R22 A;  1D8J A;  4EJU A;  2DQL A;  3WU0 A;  4L0Y B;  2F5E A;  2O8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...