3MEXA

Crystal structure of mexr in oxidized state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
142
structure length
142
Chain Sequence
MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQSLAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug resistance operon repressor
publication title Structural insight into the oxidation-sensing mechanism of the antibiotic resistance of regulator MexR
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription, transcription regulation
total genus 48
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mexA01
4G6QA 1YTYA 1W7PA 4XRFA 3FXQA 1T6SA 1SD5A 3ZN0A 3WODF 3L9FA 2EFWA 3J7AO 2FMLA 5CYVA 2QENA 2EK5A 4GYIA 4RB0A 1IZ1A 2ZJ2A 1S8NA 4LLGF 1HSTA 2ZNZA 1BOAA 2CG4A 3WTSC 1HW5A 1P4WA 3WTWC 4BHBA 5DCMB 4I09A 1KA8A 1KU3A 3TGNA 3QP5A 3SZPA 1B4AA 1SMYF 3FWEA 4CICA 4M71A 2A6HF 3HTUA 1IXRC 5FGMA 1U5TB 4UVBA 4G94A 3LA2A 4RGRA 5K5RA 3ZQ7A 3TQNA 4BHPA 2Q2EA 4ZYHA 4KA4A 2P4WA 5J8FA 2DFIA 2KRFA 3C18A 1R23A 4LG0A 3L7WA 3I54A 1R5GA 3GFJA 2CO5A 2O8XA 2EA4A 2CQKA 3FMSA 3JAMK 1YYVA 1CGPA 5LRRA 3FM5A 5BPIA 1OYIA 3TO9A 4O5VA 1FYKA 1J2XA 2V79A 5D5VB 3GFIA 1MZBA 1TQMA 1WRJA 1TNSA 4XLNF 1LB2A 3WE2A 2EFQA 2GWRA 1KU7A 3ULQB 5FFZA 2HFHA 4WK8F 1J7KA 1XMKA 2QWWA 3RI4A 4WF2A 1DDNA 2IVMA 3IWZA 4HF1A 2R7DA 1ZG3A 2P7VB 3M1EA 2YU3A 1HKSA 1I6XA 3DEUA 3DV8A 2X0LA 1V4RA 4R79A 4YIIA 2ISZA 4IHTA 1BIAA 2YPRA 3E6DA 2X4HA 4EM1A 1IN5A 1MDMB 3DQVC 4OU0A 3ROUA 3AAFA 1USSA 4WXHA 2VN2A 3IRQA 3P9KA 2H6BA 1J9IA 1LEBA 2LF8A 1SD4A 2EA2A 2FF4A 4HF0A 3NQOA 5HLIA 2IA1A 1JXSA 2BV6A 2FU4A 3GYHX 1B9NA 2FBIA 3I4PA 2A61A 1QPMA 4KMUX 1FZPB 1R00A 2CYYA 4Q47A 2RV8A 3HRTA 3K1NA 3ZMSA 1U3EM 4HAMA 1MJ9A 2PLYA 4WXDA 2XKOA 2EJRA 2M45A 4P96A 3ZMVA 1S7OA 4E70A 2XAFA 3E6CC 4ENJA 3IL2A 2BBYA 1UHWA 1OMIA 4AD9A 4LK1F 5E1WA 1UFMA 1MJAA 5FD5A 5BPDA 3GEZA 3E5XA 5F64A 4I7HA 3N97A 3RJPA 2VT3A 4CO8A 4AIJA 3FF5A 3HSRA 4ZYDA 3WGGA 3CTAA 1P4AA 2K86A 1XDSA 4EV0A 3RYPA 2W24A 1T38A 4PDKA 2J5PA 4EVIA 4CYDA 2MBFA 3O2PE 1USTA 4I0BA 4MQ9F 3R6SA 1FP1D 2H6CA 4KIGA 3BZ6A 3GW2A 4B09A 1B1BA 3HHHA 1ON2A 1LDJA 2P6TA 3Q9SA 1DP7P 5DD4A 1Z6RA 4M6YA 1R58A 3KZZA 3TOAA 3LQQA 3QRFF 2F5EA 2D2WA 3R0JA 1FWZA 1V3FA 3RYRA 2MLGA 2NAZA 2Z3YA 4ASNA 4HYEA 3GUDA 1KQ9A 3DFGA 3RIRA 1XSVA 2OD5A 1W4MA 1G3SA 3WTTC 4WXCA 1FPQA 3TKYA 1FBQA 1XSXA 2JRTA 5LHGA 1O3TA 2QZ8A 5CVUA 4HV5A 1MKMA 3BOQA 2XKPA 5H6QA 2FNAA 1QO0D 4RAZA 1O57A 1U8RA 4JK1X 4CHUA 1KQ0A 2UZKA 3WTUC 5HDNA 2Q8KA 5BMZA 3JAMZ 3BDDA 4WCGA 2K27A 1I27A 2Z33A 1MD0A 3GVAA 3K9TA 2JSCA 2R7FA 2KIUA 1BI1A 2OQGA 2A07F 4FHTA 1W7PD 2OBPA 5HDKA 3JSOA 2HYGD 4PGGA 3N4MA 4N9IA 2P5VA 2AXLA 4HBLA 3V7RA 5EEHA 4EMSA 5J8CA 4QWQA 1Z05A 2UXXA 5K5QA 5DCMA 2MA3A 2DBBA 5DUKA 2F5DA 2KIFA 1FP2A 2FEZA 2YX4A 3Q9VA 4CXFA 1YW7A 2JT1A 3K1PA 3F6VA 1O7FA 2OAZA 2QQ9A 1Y0UA 3K2ZA 1BN5A 4L5JA 2XAJA 5FO5A 4Y17A 2LF7A 4HLXA 2PMUA 1T2KA 2L54A 4EJUA 1ZRDA 4H0EA 3KE2A 4A0YA 2OU2A 4EJTA 1J5YA 3WGIA 2Y48A 4KDPA 5IT9K 4YFKF 1WI9A 2LKPA 1IXCA 2VONA 2W84A 4UXNA 4A12A 4KN4X 2QBYA 2RVCA 4GXOA 3WTXC 1E17A 4NB5A 3PFIA 2WTEA 4ZZDA 1UCRA 3M8FA 3CLOA 3QOPA 3E5QA 2QLZA 2PMHA 3RKWA 1F4KA 1X3UA 1XN7A 3ZN1A 5L3BA 4L9VA 5TRDA 4HF2A 2ELHA 1T39A 2EV0A 3MFKA 3RPUA 3DP7A 5HS9A 1SD7A 2DQRA 2M87A 2VE8A 4BHCA 2PFBA 5L3GA 2VOOA 1R36A 5AONA 1C0WA 3CUQB 3MZYA 1ZG5A 3KP3A 3NEUA 1RZ4A 3TO6A 3IKVA 3G3ZA 1SFEA 1BC8C 1OYYA 2HQRA 2A5YB 1U78A 5HDGA 2F2EA 1KU9A 4Y13A 1J0RA 5D4RA 2XVCA 2Q0OA 2Z9OA 1P92A 1I1GA 4RAYA 3GWZA 3EUHA 3E6MA 4DQ2A 1FBUA 3KEQA 1YFHA 2GA1A 5LBQA 4M74A 2XASA 1D5VA 4U7BA 5CLSA 4EJOA 2G7HA 4DNCA 3V4GA 4LB6B 1WKMA 1ZRCA 1K7AA 1LDDA 4G7HF 2Z99A 2VT2A 2XAHA 2K4JA 2FQ3A 2V1DA 3HYIA 1XSDA 1RUNA 1IW7F 3KP2A 3ZP5A 4U0VA 3CUQC 3B73A 4YFXF 5JVTA 2D45A 3PQKA 4L0YB 1IN8A 3QAHA 1TQIA 2VOPA 1KQ8A 4BYYA 2V9VA 5JR3A 4L18B 4IPAA 4OINF 3F21A 3MQ0A 4EJWA 4K2EA 1K79A 2XAGA 5ICGA 2DPDA 1ZH5A 4RS8A 2DK8A 4HA8A 5ED4A 4BQAA 3M8EA 5LLQA 3QPHA 2O6GE 3HRMA 4NHJA 2VC0A 2G9WA 3BJOA 4HLYA 2RC4A 3QU6A 4QLCU 3KP6A 3GZ5A 4M9ZA 4G7OF 3T8TA 2PEXA 4UUVA 4CZZA 2DLLA 2V6CA 5E1ZB 2BGCA 1DPRA 1U5TC 1K78A 2ZXJA 4I02A 3JW4A 3I59B 1CF7A 1EH7A 2IP2A 4L9JA 1QGPA 2D1VA 4L9TA 3SFZA 4BXUA 4HOBA 2W85A 3HOSA 1BIBA 5IT9Z 1ULYA 2L4AA 5JFRA 3P9IA 2CFXA 5KK1A 3NRVA 4Q48A 5JHUA 4ZYGA 4A0ZA 4BH9A 3R0AA 1F5TA 1FT9A 1ZAOA 2RNJA 1LEAA 2JPBA 4GGGA 4M6XA 3TDUC 4EGZA 4LGWA 3LA3A 2FOKA 4KFCA 4HQMA 2ISYA 1QNTA 3EYYA 2P5LC 3H3ZA 4ENKA 1YW9A 1KYWA 3H3UA 1BI3A 3F8CA 3WU1B 1SFXA 3BPVA 3FMRA 1BI2A 2R3SA 3RKYA 2IA2A 5ILVA 2HS5A 3E3VA 1HBXG 4EM0B 4CDGA 1D8JA 2ETHA 5TJJA 3KP7A 2EFNA 1ZGAA 1QZZA 1SMTA 4AVPA 4U7DA 1TNTA 3P9CA 1TQPA 1JE8A 3J81K 1R22A 1REPC 2NNNA 4I2OA 3WTZA 1ZREA 2IT0A 6PAXA 4RGXA 2KKOA 1WSUA 3GF2A 2G7UA 4PGHA 2FXAA 5EEGA 2VBXA 2OZUA 1LJ9A 3V8JA 3W6KB 3EYIA 4MNUA 1XB4A 3IWFA 2NRAC 3HRSA 1FYMA 4KYWA 2FBKA 1PUEE 1J75A 5CVRA 2FRHA 4YIFA 2VODA 3BJ6A 1W5TA 2HWVA 2M8EA 1FSHA 4OIOF 3RTRA 4LG0B 1R1UA 1QQIA 3T1BA 1RUOA 3KZYA 1R1VA 3DF8A 4I0AA 3FM3A 4HDUA 2EFOA 1H9TA 1ZLJA 1B6AA 2IA0A 5CJ9A 2UXNA 4M73A 4IRHA 1XGNA 4D0PA 2EB7A 3K1MA 3QP6A 2XV4S 2BYVE 2DI3A 1STZA 2MLKA 1P6RA 1FYLA 3FMQA 1MJBA 4IXAA 3ISPA 4UV8A 4ENNA 5LEJA 4JBAA 1QBJA 2VC1A 1FSEA 3P7NA 3WE3A 3O6BB 3CUQA 2XGXA 3VODA 2ZCWA 5F6FA 3BROA 4R8HA 1G4DA 1D3YA 2BE5F 4EGYA 2QQAA 3VB2A 2B0LA 3COAC 1ZYRF 3WG9A 2FE3A 3R61A 4UNOA 3ZMTA 4LJZF 2STTA 2DU9A 2PQ8A 4RB2C 5L3EA 2XHKA 2JTVA 2RKHA 1S3JA 2KJBA 2GXGA 2ZMEB 4NQWA 4KNYA 2XIGA 2YSRA 5DDGA 1LNWA 5DV5A 2PBIA 4WX9A 1G6NA 3CO6C 1WWXA 4A2UA 4I01A 4A0XA 5D5WB 4IRGA 3U2RA 4ON0A 3V7CA 3J80K 1ZGJA 4KIFA 2CGPA 2O03A 2DO7A 1TBXA 1ZN2A 4LMYA 2PJPA 3IC7A 3KLNA 2VBZA 3MZHA 1H9GA 5FD6A 3ECOA 3MWMA 1XCBA 1U5TA 1Z6TA 3HHGA 3V8LA 3GLXA 2VE9A 2ESHA 2W57A 5E8GA 4U0WA 4BAYA 4AWXB 4GO1A 1U6GA 4MQVA 1ZHFA 2P7CB 5LEKA 1BI0A 2ADUA 3WU0A 4AIKA 1XGMA 5AIQA 5E17F 5ICCA 1AOYA 1TTYA 2IPQX 3D5LA 2PI0A 3BWGA 2MH9A 4Q4ZF 1FX7A 2KIMA 2VBYA 2XAQA 2XUBA 4KUMA 2K4BA 2H94A 1LVAA 2HQNA 4O6JA 3F6OA 1YO5C 4MTEA 1ZRFA 5A2QK 2YX7A 3CO7C 4KT5C 1JHFA 5HS8A 4OMZA 3WTVC 3J81Z 1IN4A 4HDVA 2FNPA 4MHGA 3ZMDA 2GA2A 2QUFA 1S7AA 2CWEA 1EV7A 2NS0A 5HLGA 4M9XA 4ENMA 3BJAA 4ESFA 5E1XA 4KMFA 1HKQA 1D8KA 1IRGA 4XSZF 1OR7A 3MCZA 2MC3A 2A6EF 5CVVA 2P8TA 4L0ZB 2L3DA 4P9FA 4XBFA 3REOA 1Z1DA 2VBWA 1OYWA 4ESJA 1T98A 1LQ1A 5IT3A 3F8FA 3I5UA 1S6LA 3JSPA 2TDXA 4LLLA 4UV9A 4F7ZA 2WC2A 2C6YA 2DW4A 5LGUA 3QPTA 1MDMA 4KN7X 1FOKA 3C1DA 1YIOA 1FLIA 1A04A 4EM2A 3GFMA 4RB3C 2A69F 1Q1HA 3I53A 2CW0F 1PDNC 1TW2A 3FXUA 3G73A 2GAUA 5ICFA 2HGCA 1FBSA 1ZARA 3HTSB 2QYOA 2L4MA 4UHTA 3GXOA 2JPCA 1DUXC 3KFWX 1R5HA 1UB9A 5BS6A 2NYXA 3DKWA 2H27A 2HEOA 4AIHA 2J5OA 4HW0A 4S04A 2RDPA 1IUYA 3BY6A 2ZNYA 2DT5A 5JI6A 1YW8A 4N0BA 4Z2YA 1I5ZA 2M1BA 2PN6A 1JHHA 2ACJA 3SQNA 1RI7A 3ZMZA 1BJAA 3W6JB 3EDPA 2EV6A 1FNNA 2O0YA 3ELKA 4RGUA 4BNCA 3CUOA 3L00A 5E8IA 3I64A 2HTSA 3E5UA 1ZG1A 2A68F 2LNBA 3J80Z 2EWNA 1ON1A 2E7XA 1OKRA 3M9AA 1FY7A 1WQ2A 3V8KA 2GZWA 2EV5A 4L9NA 5D5UB 2OQRA 4ZZLA 4ZH4F 3LFKA 2QBYB 2ZKZA 3GZ6A 5D8KB 4FT8A 2HKOA 4O3MA 2EFPA 4YFNF 5LHIA 4JQFA 5D6EA 3D0SA 1YLFA 2QM3A 3MEXA 4P5OA 2Z5UA 5D5XB 4I98B 5HS7A 4WWCA 3T5XA 2HTJA 5D6FA 1Z7UA 2QVOA 1RIOH 5CVIA 1KYZA 2HZTA 3E97A 5DEQA 1K6OA 4A6DA 4A6EA 2VXZA 5LGTA 4MTDA 4TV7A 1Z91A 3CJNA 1FC3A 2QQBA 2PG4A 4LFUA 1MGTA 1RNLA 4PZJA 4HV6A 5A2QZ 4KICA 1F1ZA 3B02A 1KGSA 2LSOA 3S2WA 1VTNC 1EH8A 2M30A 5H20A 2IRFG 4OIQF 3ZPLA 2GQQA 2BEOA 2ZMEA 1BM9A 5L3CA 1QZYA 3H92A 2DQLA 2ZO4A 1IN6A 1W7PB 5HOOA 2MD5A 2XRNA 3IRRA 2WWYA 5E20A 3Q5FA 3I58A 1E2XA 1ODDA 2MH2A 4KIBA 3ZMUA 5ERIA 4G7ZF 2H09A 3T8RA 4GYGA 3KEOA 1O3SA 4RB1A 1PP7U 2OA4A 4LD5A 2GXBA 1O7LA 4G6DA 5ILSA 2HR3A 3TO7A 3HSEA 3VEPA 3IHUA 4ESBA 4R1HA 1YS6A 5LGNA 1HSJA 5FLXK 3ML6A 5DYMA 3MAJA 4OOIA 3C7JA 1G3WA 5DUIA 1U2WA 3QU3A 2WV0A 1F9NA 1IAWA 1YG2A 2ZFWA 1YS7A 2D1HA 1L3LA 2AS5F 4G9YA 3K0LA 3BPXA 4Q5SF 3KETA 1B59A 4OIPF 5ICEA 3SZTA 1L0OC 3DPLC 4PCQA 2E7WA 4MEYF 2P6SA 5L3FA 3LA7A 4M72A 2V1UA 1HXDA 1T0FA 2K02A 2HOEA 1P4XA 4ETSA 3ABTA 1J59A 3KCCA 2XROA 4IHSA 3RKXA 1OPCA 2W25A 2Y0MA 1GHCA 1IF1A 3EQLF 1IN7A 3LWFA 1NHAA 1XDUA 2RN7A 3KP4A 3ECHA 3U1DA 1ONVA 2DPUA 1JGSA 1BBYA 3FX3A 5H6RA 3EETA 2NNYA 5HVQC 3F72A 3L09A 1XGOA 1SFUA 2UWMA 2RQPA 2E1NA 1KU2A 2YR2A 1O3QA 4YG2F 4LLNA 2O61A 4HX4A 2DTRA 2LDUA 3L2CA 3ABUA 3R4KA 1Z9CA 1PP8F 2F5CA 1ZLKA 4U0YA 1K78B 4EJVA 1CF7B 1O3RA 1G3YA 1GVJA 4FX4A 3SXYA 4XSXF 1R7JA 2GIVA 3HSFA 3RDIA 5F1RA 3R60A 1B9MA 3KP5A 2COMA 3F8NA 4A5NA 4LB5A 2IJLA 2M5WA 3HIFA 2JZYA 3BP8A 4UVCA 3I0TA 4UVAA 3GX4X 4M9SA 1HQCA 1P2FA 2IW5A 2HYFA 3FXRA 2HKXA 3F8MA 3LAJA 3F23A 1G3TA 3FHZA 3IKTA 5KVRA 4S05A 5L3DA 4G8XA 5CVJA 4MEXF 5FFXA 3ERED 3TDZC 5LHHA 2ESNA 3JTGA 1I1SA 1S29A 2L01A 5ILUA 1EH6A 3WTYC 2STWA 4L5IA 4XLPF 2L02A 2FSWA 5BOXA 5D4SA 1TW3A 3HUGA 4HX8A 1IRFA 4IVNA 5DCFA 3F22A 1XMAA 4OIRF 3T0YA 1XD7A 4IF4A 1XGSA 3RPQA 1H0MA 3LAPA 1AWCA 5DD8A 5BQTA 2FMYA 2Y75A 2FBHA 2KJCA 3HRUA 3GO5A 5K5OA 5AIPA 4P55A 4EQQA 4IRIA 3U9GA 2K7LA 3LQRA 4RGSA 3E6BA 1YQAA 1SD6A 5K1YA 3F8BA 3K69A 2CSOA 2DK5A 3VOEA 3WGHA 4OMYA 3V7SA 4HZFA 3GFLA 1TLHB 2O3FA 2V1XA 5E18F 1IXSB 3M7GA 3O3KA 3OV8A 3VFZA 5HLHA 1HKTA 3FZVA 3CDHA 4HX7A 5J6XA 1HW1A 4P9UA 4IJAA 5FLXZ 3I71A 2HDCA 4CGZA 4ZYEA 1W5SA 5LRSA 3I59A 4U88A 4B8XA 4MGRA 1BC7C 3LSTA 2FA5A 1XCVA 4LK0F 4FX0A 3F3XA 2P5KA 3C3WA 5D8LB 1SAXA 3JTHA 4GCVA 1DPUA 5FB2A 2RGVA 2E1CA 3PQJA 1LDKB 4HQEA 1UHMA 4Y15A 1R1TA 3DXJF 1GXQA 2F5FA 3DPTA 2ZBKA 1HW2A 2OZ6A 3HOTA 3SHFA 3OOPA 4N9HA 3TOBA 2A3SA 2DAOA 1GXPA 4A5MA 3KLOA
chains in the Genus database with same CATH superfamily
4KITB 1JUPA 2IXSA 1GVDA 1LFUP 2HVRA 4G6QA 3SEQA 1YTYA 1W7PA 4AYBN 1FOYA 4XRFA 3FXQA 4XR6A 4B48A 1T6SA 1SD5A 1X1CA 3ZN0A 3JRIA 2DA3A 4NDLA 4XM3A 1ETYA 3WODF 3RZDJ 3L9FA 2K9MA 2EFWA 4NQWB 3KEYA 1HDDC 2ZJPF 3J7AO 4ZTFA 2FMLA 2ZB9A 2QENA 5CYVA 2EK5A 4GYIA 4RB0A 3K6GA 1IZ1A 2ZJ2A 1S8NA 4LLGF 1HSTA 2ZNZA 2R7QA 1BOAA 2CG4A 3K4MA 3CC4I 2V26A 3BQYA 3WTSC 1HW5A 3H9JA 1P4WA 3WTWC 3OS1A 2BY1A 2XB5A 4BHBA 5TGTA 2LTPA 3GTMJ 3D5SC 5DCMB 4ZC3A 4I09A 1H89C 3G1MA 1KA8A 1KU3A 3TGNA 3QP5A 3SZPA 1B4AA 1SMYF 3F0CA 3FWEA 4CICA 3GZNB 4JX6A 3PIOF 5E3LA 4BEHA 1SVOA 4M71A 3ZQCA 1DU6A 2A6HF 3DTKA 2X1DA 5F1JA 3HTUA 1IXRC 5FGMA 2M2EA 3JRGA 3S1MJ 3FDYA 3W2WA 4PUSA 1U5TB 2X6OA 4DYCA 3A03A 1U9OA 4UVBA 4G94A 3LA2A 4RGRA 5K5RA 3ZQ7A 2L0KA 1YIJI 4XN3A 3H0GJ 3BQZA 3TQNA 4BHPA 2Q2EA 3HZJA 4D9JA 4ZYHA 3BLYA 4KA4A 2P4WA 5J8FA 2DFIA 3E0JB 2KRFA 2RQQA 3C18A 2DMPA 2LD5A 1R23A 4IHXA 4LG0A 3L7WA 2JRMA 3I54A 3OIPA 2JWTA 1R5GA 3GFJA 2JSPA 2CO5A 1AKHB 2O8XA 1VQMI 2EA4A 4D5FA 3OIQA 2CQKA 3FMSA 3JAMK 1SVMA 1JKPC 4HG2A 3OL4A 1YYVA 1CGPA 2LR8A 3H1CA 5LRRA 3FM5A 2VASA 1X3WB 5BPIA 4PFPA 2CV0A 1OYIA 3TO9A 1BR4A 3S2DJ 2KT0A 3I4NJ 2DMTA 2ELKA 4AM3A 4O5VA 1FYKA 1J2XA 1NK3P 2XGDA 4I99C 4A3BJ 2V79A 5D5VB 3GFIA 2RAEA 4BACA 4CCMA 1V55H 3A4CA 1MZBA 2K5CA 3K4JA 1TQMA 1WRJA 2E34A 1TNSA 1TWHJ 2VKVA 4XLNF 1LB2A 3WE2A 2EFQA 1VQ8I 4V19K 2GWRA 3S17J 3SEZA 1MBEA 1KU7A 3ULQB 3A01B 5FFZA 2HFHA 2L9SA 3B6AA 4F92B 1J7KA 1W1WE 4WK8F 1YITI 5KCMA 1XMKA 1UG2A 5LFAA 3HL2A 2QWWA 1BR1A 3RI4A 2HPIA 1FOXA 1DU0A 4WF2A 4DW6A 1DDNA 1ZELA 2IVMA 3IWZA 3OWTA 4F3QA 4HF1A 2R7DA 1ZG3A 2P7VB 3M1EA 1SAUA 1ETOA 2K9LA 1MBHA 2KL4A 2YU3A 1HKSA 2DMQA 3HGYA 1I6XA 2K3PA 3DEUA 3EPZA 4XRSG 3DV8A 2X0LA 2L9VA 3OMYA 3TP0A 2WY8Q 3TEDA 3A02A 1V4RA 4R79A 4YIIA 3HOWJ 2ISZA 3S32A 4A3KJ 4IHTA 1BIAA 2YPRA 3E6DA 2MABA 2X4HA 4EM1A 3CMMA 1IN5A 2XDVA 1MDMB 3DQVC 2O5RA 4OU0A 3M07A 3ROUA 1USSA 4WXHA 2VN2A 3AAFA 3G4SI 3IRQA 4ZYAA 4XRSA 1LFPA 3P9KA 1WVRA 2H6BA 1J9IA 3DTIA 2NVXJ 3DEEA 1LEBA 2XPVA 3H3VK 2LF8A 2CV1A 1SD4A 2EA2A 2FF4A 2VLAA 4HF0A 1ITYA 2KZVA 3NQOA 3AKZA 5HLIA 1RPWA 5KHDA 2IA1A 2CQNA 3LSJA 2BV6A 2FU4A 1JXSA 3GYHX 1B9NA 2FBIA 3I4PA 2A61A 1W36C 1QPMA 3M8JA 2E2IJ 4KMUX 4CCLA 1FZPB 1R00A 2CYYA 3LSIA 4Q47A 2RV8A 1BOBA 3HRTA 3K1NA 2E2JJ 2X6XA 3ZMSA 1U3EM 2IS4A 3X2QH 4HAMA 1MJ9A 1VQ9I 2PLYA 4WXDA 3PO3J 4CYCA 2QSGX 2DCEA 2Z2SB 4E7LA 2XKOA 1XX5A 2EJRA 4ITVA 2M45A 4P96A 3S8PA 3ZMVA 4HNVA 1TWGJ 3OYLA 1S7OA 4E70A 2XAFA 3E6CC 3CCLI 4ENJA 3IL2A 2BBYA 1UHWA 1OMIA 4F93B 1VQOI 4M6VA 4AD9A 4LK1F 1NTCA 5E1WA 3GTKJ 2MFZA 1UFMA 1MJAA 5FD5A 5BPDA 1WJFA 2X6YA 3GEZA 3E5XA 5F64A 1K61A 4DGWB 4M3EA 3IV5A 4I7HA 3N97A 2WY7Q 3RJPA 3ZXSA 3DKXA 2VT3A 4CO8A 4AIJA 2XSDC 3FF5A 3HSRA 4ZYDA 3WGGA 3CTAA 4C30A 1P4AA 2K86A 1XDSA 4A3IJ 4D5CA 3FBIB 4EV0A 3RYPA 2W24A 4D7NA 3H0DA 3TMOA 3G6EI 3DBRB 1T38A 1GDTA 4PDKA 3W3CA 2F4MB 4W97A 2OTLI 4G12A 2J5PA 2MW8A 4EVIA 4CYDA 1FTZA 1OCCH 2MBFA 3O2PE 4NC6A 1USTA 2W48A 3IAM2 1G8XA 4I0BA 3CCYA 1DGRM 4MQ9F 2L9NA 3R6SA 1FP1D 1OJLA 2H6CA 4KIGA 2DA4A 3I55I 2L7ZA 3BZ6A 3GW2A 1TZLA 4B09A 1B1BA 3PNYA 3H5AA 4A3MJ 3OL3A 3L2VA 3HHHA 1IGNA 1ON2A 1VQ5I 3EUHC 3L2QA 3OYHA 3CCQI 2HNHA 1V5GA 1LDJA 5F04A 2P6TA 4LITA 2GLOA 3Q9SA 4C9YA 1Z21A 1DP7P 5DD4A 1Z6RA 4HRIA 5IYCJ 3W2VA 5GAEJ 3OYBA 3PIPF 4M6YA 3A2KA 2MC4A 1R58A 3KZZA 3TOAA 4YIRX 1Y1VJ 3LQQA 2CMPA 2R5YB 3QRFF 2F5EA 2D2WA 3JCUC 3K4NA 5JVGF 5KAIC 3R0JA 1T8IA 1FWZA 1V3FA 3A1YA 3UNGC 3RYRA 3JRDA 3ZQLA 4M3FA 2MLGA 2NAZA 2Z3YA 4ASNA 2Y0SA 4HYEA 3BTLA 2EBIA 1KQ9A 3GUDA 3PUFA 3DFGA 2X48A 3RIRA 1W36D 1XSVA 1N77A 2QA4I 2OD5A 1MMSA 1W4MA 4A3LJ 3VYTB 1G3SA 4A3CJ 2X6WA 3WTTC 3ZQQA 4WXCA 1FPQA 3TKYA 1FBQA 3PSFA 3HEFA 1JI8A 1XSXA 2JRTA 1WH7A 2QEXI 1FTTA 5LHGA 1O3TA 3RPUD 2QZ8A 2PMZA 5CVUA 4M3BA 2EINH 2NVUB 4HV5A 3VWBA 1IV6A 1N78A 1MKMA 3BOQA 2XKPA 5H6QA 2LKXA 1OCPA 2W00A 2FNAA 1QO0D 4RAZA 1NH3A 1O57A 1U8RA 3HGGA 1IG7A 4JK1X 4A3FJ 4CHUA 1KQ0A 2UZKA 3WTUC 5HDNA 2Q8KA 4FISA 4BDZA 5BMZA 1HCRA 3JAMZ 1K4SA 3WU2C 3SDGA 3BDDA 4WCGA 2KFDA 2K27A 1I27A 1ETWA 2Z33A 1MD0A 3GTJJ 3GVAA 3K9TA 1F43A 2NVQJ 3S3NA 2VPLA 4MLOA 3CCSI 2JSCA 2R7FA 5GP9A 2KIUA 1BI1A 4HSTA 2OQGA 2A07F 1RKTA 4FHTA 1W7PD 2F6CA 2MG4A 2XRLA 5JHFA 4XRMA 5EGOA 1APLC 2OBPA 5HDKA 2VKHA 3JSOA 2HYGD 3P5JA 2IGKA 1MBFA 4PGGA 4V2FA 3N4MA 3OR2C 1VQLI 2R4GA 1NK2P 4N9IA 2P5VA 2AXLA 4IO9F 5F0HA 4HBLA 3LSPA 3V7RA 3TW7A 3ZRGA 4E7JA 5EEHA 1K83J 5M5WJ 3RSNA 2MSYA 4EMSA 5J8CA 1UAAA 3S1QJ 4QWQA 3BZCA 1Z05A 2UXXA 3VYUB 5K5QA 3OYJA 1MH4A 2XAUA 5DCMA 5IY5H 4BXXJ 1QHHD 3HXLA 2MA3A 2KMUA 2DBBA 2F5DA 5DUKA 2KIFA 1FP2A 2XGEA 2FEZA 4I6ZA 5K7ZA 2YX4A 3Q9VA 4P1WA 4CXFA 1YW7A 2JT1A 2V7FA 3K1PA 5J1UA 2WB1A 2COBA 4XKWA 3F6VA 1O7FA 2WADA 1W5CC 2OAZA 2QQ9A 1Y0UA 3K2ZA 4II3A 1BN5A 2M7AA 4L5JA 2XAJA 5FO5A 3HOYJ 3AG1H 1JUSA 4Y17A 2DTZA 2LF7A 4HLXA 2PMUA 1T2KA 1T08B 2L54A 4EJUA 1ZRDA 4LIVA 4AU7A 4H0EA 1YOVB 1WJCA 3KE2A 5EYRA 1BR2A 2FOWA 2RNGA 2OU2A 4A0YA 5FLMJ 4EJTA 1WJAA 1VFCA 1WI3A 1Z67A 1J5YA 2IS2A 4UUTA 2ZSHB 3WGIA 2Y48A 4B47A 4KDPA 2E2HJ 5IT9K 4YFKF 4RLQA 1MIJA 1WGXA 2B7EA 4RM2A 1AKHA 3Q0WA 1WI9A 1R5ID 2LKPA 1IXCA 3HOXJ 2W84A 2VONA 4UXNA 4A12A 4KN4X 2QBYA 2RVCA 2IBDA 4GXOA 3WTXC 1E17A 4NB5A 3PFIA 2WTEA 4ZZDA 1UCRA 2KZGA 3UR3C 4DZPA 1JJ6C 3M8FA 2H8WA 3CC7I 5B1BH 3CLOA 5IP6A 2NOJB 3CJRB 4QTRA 2NS8A 3QOPA 2XF6A 1MMGA 2WAQN 3E5QA 1IC8A 2QLZA 2VIXA 2PMHA 3KPHA 3RKWA 3DU5A 1N25A 2PMZN 5GAGJ 1F4KA 1X3UA 3ZCOA 1D5YA 4IHVA 1XN7A 2CUJA 3ZN1A 5L3BA 2VKDA 2OCEA 4XKBA 4FTHA 1YJ9I 4H4KC 3H5RA 5IOYA 1TT5B 2L2OA 4L9VA 1I3AA 5TRDA 4D7MA 4HF2A 2ELHA 1T39A 1U8BA 2R7OA 2EV0A 2VJ4A 3MFKA 2K40A 2R7XA 4X1EA 4DBRA 3RPUA 1I50J 3DP7A 1FEXA 1Y56A 5HS9A 1SD7A 3V42A 2NVTJ 2DQRA 3A0BC 2M87A 3KYLA 2VE8A 2ZSIB 1WHUA 1I3QJ 4AIDA 4E7HA 5CPRB 2V9KA 2IAIA 4BHCA 4LOCA 5DM6F 2PFBA 5L3GA 4ZTJA 4FE4A 3BG9A 1R36A 2VOOA 3KX2A 1DQUA 5AONA 4HSRA 4X0GA 5F0FA 5KAFC 3CQZJ 1C0WA 4UB6C 2W1OA 3CUQB 1T33A 4JYKA 3MZYA 1FIPA 1ZG5A 3KP3A 3NEUA 1RZ4A 1MMDA 1RR7A 3ZQFA 2IGNA 2JA7J 4A3DJ 1VQNI 3K2AA 3TO6A 2E1MC 3IKVA 2VQGA 3G3ZA 3LSRA 1SFEA 1BC8C 1OYYA 2HQRA 3PM1A 5C3EJ 2A5YB 1OQYA 1U78A 5HDGA 2CW7A 3AG3H 4A3GJ 2F2EA 1MNDA 1V54H 2NOGA 3EUAA 1KU9A 4X6AJ 2BZTA 2ME0A 4XICA 4Y13A 1J0RA 3OYGA 5D4RA 2XVCA 4HNTA 2Q0OA 2CU7A 3JRBA 2Z9OA 2B63J 3BG7A 2N8GA 2BW3B 1P92A 1I1GA 2L7MP 2W82A 3GBGA 2LBFB 3AL0C 2JA6J 3TW6A 4RAYA 3GWZA 5FJ8J 3EUHA 3E6MA 4DQ2A 2WB1N 1FBUA 3KEQA 1YFHA 2IS6A 2GA1A 1F36A 2XGCA 3DBLB 5LBQA 4M74A 1ZK8A 2XASA 1D5VA 4U7BA 2IGOA 5CLSA 3FXLA 4EJOA 2G7HA 4DNCA 3V4GA 3C2BA 5GAHJ 4BBRJ 4LB6B 4F55A 1ETQA 1UMQA 3H5NA 1WKMA 1ZRCA 2LY1A 2KP6A 2OTJI 1K7AA 1LDDA 1XPXA 3I4MJ 4G7HF 2Z99A 2VT2A 2XAHA 2K4JA 2FQ3A 3BG6A 2V1DA 3HYIA 3TBIA 1K6YA 1XSDA 1IW7F 1RUNA 3KP2A 2EQRA 3ZP5A 5FLVA 4U0VA 3CUQC 3B73A 3CD6I 3E1SA 4YFXF 4YELA 5JVTA 1IV8A 2D45A 5HNFA 1SC7A 3M1CA 2CS3A 1D0XA 3PQKA 1MNMC 4L0YB 1IN8A 4MIMA 1VQKI 3QAHA 3OS0A 1QA6A 4M3DA 1TQIA 2L5QA 2VOPA 1KQ8A 5CKTA 5K7HA 3MKZA 1YE9A 4BYYA 1EA3A 4E7KA 2DA6A 3OIOA 1WFXA 2V9VA 5JR3A 4L18B 4IPAA 4OINF 2EPFA 2YU9J 1U0JA 4RBOA 1JTXA 3F21A 3MQ0A 4EJWA 1JT6A 2HXIA 2M4GA 4K2EA 2ZJQF 1K79A 2XAGA 4DYQA 5ICGA 2DPDA 1ZH5A 1X1AA 1T95A 4RS8A 1AA7A 2DK8A 1RKWA 4HA8A 2OV7A 5ED4A 4BQAA 3M8EA 1HC8A 5LLQA 3QPHA 1Z3YA 2O6GE 1MBKA 3HRMA 4XL9A 4FQGA 1Y8QB 2HOAA 4NHJA 3HOZJ 2VC0A 2G9WA 3ABLH 3WHBA 3BJOA 2LY2A 2WBMA 4HLYA 2RC4A 1VF9A 3IP4B 3QU6A 4QLCU 3OYDA 3KP6A 3GZ5A 3BTIA 1Z7LA 2V6EA 4M9ZA 4HEA2 1SANA 3VYRB 5B5EC 4BBSJ 4G7OF 2ECCA 2EIJH 3T8TA 3ZOBA 2PEXA 4UUVA 1IJWC 4CZZA 4IHWA 2DLLA 1ORKA 1ETXA 2V6CA 3ASNH 5E1ZB 2QSHX 2BGCA 2V1NA 1DPRA 3N05A 3ONQA 3CF5F 1U5TC 1K78A 1YRNA 2ZXJA 4I02A 1TWFJ 3JW4A 3I59B 2EH3A 2W4SA 1EH7A 1CF7A 3OYAA 2IP2A 4L9JA 1QGPA 1Y1WJ 1OISA 2R93J 2D1VA 4L9TA 3SFZA 3TP3A 4BXUA 4HOBA 2W85A 3RQ4A 3HOSA 4PJNA 1BJZA 3BG5A 1BIBA 3WG7H 5IT9Z 3ASOH 1ULYA 2L4AA 5JFRA 3DKYA 1B8IB 2HVSA 2E35A 3P9IA 2M34A 2CFXA 1J09A 3QWLA 2JUCA 5KK1A 3NRVA 4Q48A 5JHUA 4ZYGA 4A0ZA 3LSMA 4BH9A 2DA7A 3HKZN 2DODA 4RDUA 3R0AA 1F5TA 4BY1J 1ACIA 1AHDP 1FT9A 4XLAA 3J7AY 1OLTA 1ZAOA 2I5UA 2RNJA 3JRAA 4ZDOA 4KT6A 2M9HA 1LEAA 1Q1VA 2HDWA 2JPBA 4GGGA 4M6XA 3TDUC 3CCRI 1YHQI 4EGZA 4LGWA 3BR1A 2R7ZJ 3H9QA 2VQLA 3LA3A 1CQTA 2E60A 2Y69H 2FOKA 4KFCA 3K4LA 4HQMA 2ISYA 1QNTA 3EYYA 4JX5A 4BUPA 4XLFA 2P5LC 5GTHC 3H3ZA 4GRIA 4ENKA 1S72I 1YW9A 3BTJA 1KYWA 3IUOA 3H3UA 1BI3A 3Q3SA 2RREA 3F8CA 3I3LA 4Y4RA 2L9RA 3WU1B 1SFXA 3OYNA 3W2AA 1OR7C 3BPVA 4PFOA 3K4CA 3FMRA 1BI2A 2R3SA 3RKYA 2IA2A 5ILVA 2HS5A 4IKFA 3E3VA 1HBXG 4EM0B 4CDGA 3JRCA 3EUKL 1D8JA 2ETHA 5TJJA 3KP7A 2EFNA 1VNDA 1WPKA 1G2HA 1ZGAA 1QZZA 1VZ0A 1SMTA 4AVPA 2DA5A 4U7DA 1TNTA 4J01A 1IRZA 3P9CA 2M0CA 5DM7F 1TQPA 2DFHA 3G1OA 1JE8A 3J81K 4CCJA 1R22A 1REPC 1E3OC 2NNNA 4I2OA 3WTZA 2LLKA 1ZQ3P 1ZREA 1EF4A 2IT0A 6PAXA 4RGXA 1PUFB 2D5VA 2KKOA 3FK7A 2EILH 5C4JJ 4BE2A 1WSUA 3GF2A 2G7UA 9ANTA 4BJTA 4E4HA 2R7TA 1X58A 4UY8I 4PGHA 2FXAA 4UB8C 5EEGA 4BEHB 3ZQHA 2VBXA 2OZUA 1X4PA 5JLWA 1HF0A 1LJ9A 3V8JA 3VPRA 2DT7B 3W6KB 2DFEA 2LMDA 3EYIA 4MNUA 3BCAA 1XB4A 3OYCA 2HXOA 1WJBA 3IWFA 2NRAC 3K4KA 5GTIC 2LVSA 2ZXIA 2W7NA 1R6RA 3HRSA 1FYMA 4B44A 3IAS2 4KYWA 3ZGKA 2DOEA 2EIMH 2FBKA 3CMAI 2QQ8A 1PUEE 4MO7A 2O7OA 5M3MJ 2DJIA 4B3AA 2HYJA 1OCTC 4BXFA 5CVRA 1J75A 5J3LA 4JX4A 2FRHA 3VYSB 4YIFA 2VODA 1SFKA 1W5TA 3BJ6A 2VJIA 2HWVA 2M8EA 1FSHA 2PX9A 4ANJA 4OIOF 3RTRA 4LG0B 4E6KG 1R1UA 2Y2ZA 1QQIA 3T1BA 1RUOA 2GOXB 3CCEI 3KZYA 1R1VA 3DF8A 4I0AA 3FM3A 4HDUA 1MBGA 2EFOA 3CP2A 1H9TA 3BCBA 1E0EA 1ZLJA 4PK4A 4XLEA 1B6AA 3ZQIA 4EATA 5EG0A 2IA0A 5B3SH 5CJ9A 2UXNA 2YUSA 2HOTA 4BQOA 2LH9A 4M73A 1D1CA 4IRHA 1XGNA 4D0PA 2EB7A 4DYRA 2BY0A 1TWCJ 2CUFA 2KHMA 2BY2A 2LK2A 3CCUI 2XPWA 2LP0A 3G2BA 5HNHA 3K1MA 3QP6A 1OCRH 2XV4S 2WV1A 2KPMA 2F5VA 2WAQA 1FOWA 3ERMA 2R92J 2BYVE 2DI3A 2L7KA 1STZA 2MLKA 3U21A 5B1AH 3JRFA 1P6RA 2M3AA 3FMQA 1FYLA 1MJBA 4IXAA 4C3HJ 3ISPA 4UV8A 1X2NA 4ENNA 4BU2A 4JBAA 5LEJA 3L2UA 1QBJA 2VC1A 1IO2A 3RZOJ 1FSEA 3DLAA 3P7NA 3WE3A 2H1LA 3O6BB 3PFYA 2ZXHA 3O8GA 3KYDB 3OYMA 4IHYA 3GTQJ 3CUQA 2XGXA 2HQAA 3VODA 2ZCWA 5F6FA 3BROA 4R8HA 1G4DA 1D3YA 2BE5F 3FIWA 4EGYA 1A36A 2QQAA 2LY9A 3VB2A 2ICWG 4XONA 2B0LA 3QQAA 1E3PA 4RAGA 3COAC 1ZYRF 4KISA 3WG9A 2FE3A 4AC0A 2K9QA 1GV5A 2XSJC 3R61A 3I56I 4NC8A 1EKEA 3GTOJ 3PNVA 4DZJA 2G0EA 4UNOA 3ZMTA 2M7BA 1S5LC 4LJZF 5FKNA 2IEKA 3DLLF 2STTA 2DU9A 2PQ8A 3QODA 4RB2C 5L3EA 3DCFA 2XHKA 2JTVA 1TL8A 2RKHA 4A93J 5IP7J 4CA0A 1S3JA 2KJBA 3HBLA 3HOVJ 1YJNI 1MSEC 2GXGA 2ZMEB 4NQWA 3CESA 2BW3A 2JA5J 4KNYA 5IOZA 4XOPA 4DIQA 2XIGA 2YSRA 5DDGA 1LNWA 2QSFX 5DV5A 2LBFA 1A6IA 2PBIA 4WX9A 2IS1A 3J7YJ 1G6NA 5B66C 3CO6C 1R9TJ 2H8RA 1DGWY 1WWXA 3GMEA 4A2UA 1N75A 4I01A 3H9GA 4A0XA 1JUMA 5D5WB 3WHCA 4IRGA 1YJWI 3BT9A 5C4XJ 2JVHA 3U2RA 3D1NI 5TISC 5J4YA 4ON0A 3V7CA 4A69C 3J80K 5CQGA 1ZGJA 4KIFA 4BKXA 2XF7A 2CGPA 3NARA 2KDOA 2UV1A 2O03A 3QYFA 2DO7A 1HDPA 2TRTA 5EDNA 1TBXA 1ZN2A 5J47A 2XF5A 4LMYA 3S93A 3S3OA 1UJ8A 2PJPA 2XC7A 3CLQA 2CQXA 3IC7A 3GCMA 3LSGA 4BJ5C 3KLNA 3FK6A 2A6TA 2QKMB 5CQEA 2VBZA 2BXYA 1MH3A 4G6TB 3MZHA 5FRNA 2QGUA 4CYCB 1H9GA 3D5RC 5M3FJ 5FD6A 1DP3A 5LD2C 3KIOA 3ECOA 2MYSA 3MWMA 1XCBA 1U5TA 4FETA 1Z6TA 3G71I 3HHGA 3Q0UA 4FE7A 4GDFA 3C2GA 3GLXA 3V8LA 4PSXA 2VE9A 3LSHA 1G59A 4J00A 2ESHA 2W57A 5E8GA 1FMWA 3BR3A 4U0WA 2Y30A 4BAYA 4AWXB 4GO1A 2DA2A 1BA5A 4BE1A 4BQNA 1U6GA 2QKLB 1K4TA 1LUJB 4MQVA 1ZHFA 2P7CB 3GTLJ 5LEKA 1BI0A 2O9LA 2Z16A 4XNFA 2ADUA 3WU0A 4QPOA 4MFEA 4AIKA 1GV2A 3H35A 1XGMA 2ZMEC 5AIQA 5E17F 5ICCA 2X85A 1AOYA 3W6VA 2FQ4A 3S14J 1TTYA 2IPQX 4IQ4A 3D5LA 2PI0A 2IGMA 3BWGA 3BR5A 2MH9A 4Q4ZF 1FX7A 1SVLA 3AG4H 4XN0A 5GPAA 2KIMA 2VBYA 2XAQA 1RC9A 2XUBA 4BL0B 4KUMA 2K4BA 2H94A 3G1LA 1LVAA 2HQNA 4O6JA 1R49A 3F6OA 3ABMH 1YO5C 2DFFA 3K10A 3H36A 4MTEA 3ZR8X 1ZRFA 5A2QK 1B72B 3HOUJ 3I9V2 4B43A 2YX7A 4BGDA 3CO7C 4KT5C 4EEFG 1JHFA 5HS8A 4Y3OA 4IZZA 1R4NB 4OMZA 3WTVC 3PL8A 3J81Z 5HODA 1IN4A 4HDVA 2FNPA 4MHGA 3ZMDA 2GA2A 2HU9A 3OYKA 4XQFA 2OUMA 2QUFA 2GXAA 1S7AA 3LFUA 2O8KA 3OYFA 2CWEA 1EV7A 2NS0A 2NXNB 4M9XA 4DJAA 5HLGA 2KRCA 4ENMA 3BJAA 4ESFA 5E1XA 1X1BA 2GBYA 4KMFA 1HKQA 1D8KA 1KONA 1TWAJ 1IRGA 4XSZF 1OR7A 1D1BA 3MCZA 4A3JJ 1Y0NA 2MC3A 3A01A 2A6EF 5CVVA 5IYBJ 1O4XA 2ZFUA 2P8TA 4L0ZB 4XLCA 2L3DA 5HLTA 2AXTC 2EIKH 4C2MJ 4DBQA 4P9FA 2CV2A 2Z1DA 3AG2H 3QPLA 3REOA 4XBFA 3U1KA 4RA2A 4PJLA 1Z1DA 2HI3A 2Q1ZB 2VBWA 1H8AC 1OYWA 4ESJA 1T98A 3CMYA 1HLVA 1B8IA 1LQ1A 5IT3A 2VUMJ 2KIQA 3F8FA 3I5UA 1S6LA 3JSPA 3QPSA 2TDXA 2WAEA 4LLLA 4UV9A 4F7ZA 2P0WA 2WC2A 3AFHA 5EEAA 2C6YA 1UHSA 2DW4A 5LGUA 2DOFA 3K7AJ 3LL7A 4BDYA 3QPTA 2VL8A 2AQEA 1MDMA 2VPRA 2QF7A 4KN7X 1YI2I 1FOKA 2YS9A 1T0FC 3C1DA 3HDDA 1YIOA 1FLIA 2K3FA 2DMUA 1A04A 1P9QC 2XB0X 4EM2A 2FD5A 1TT0A 3KYCB 5F0CA 1JTYA 3GFMA 4RB3C 2A69F 1XTAA 5FROA 4PJ0C 1LE8B 1Q1HA 3I53A 5FKKA 2CW0F 2UUZA 3HKZA 3O8HA 1PDNC 1TW2A 1ENHA 3FXUA 3G73A 2GAUA 3NWTA 2V4JC 4E7IA 5ICFA 2HGCA 3LSKA 4JOMA 2CUZA 1D0ZA 1FBSA 2HPMA 5EGOB 3C2HA 4V2GA 1ZARA 3CZ6A 5FRMA 4RMNA 1XG1A 3HTSB 3OSGA 4ZDLA 2QYOA 2L4MA 3BR0A 4UHTA 2WA0A 3GXOA 2JPCA 1DUXC 2ZC2A 3KFWX 1R5HA 1UB9A 2JN6A 5BS6A 1VQ4I 4L5EA 2NYXA 2M0MA 3DKWA 2B9SA 2OJED 2CRGA 4XLHA 1RESA 2R5ZB 1EJ9A 2H27A 4Y33A 4YEJA 2HEOA 4AIHA 2J5OA 1S7EA 4HW0A 4S04A 2CFOA 2RDPA 3HUGB 1IUYA 3BY6A 2ZNYA 2DT5A 3LNQA 3FXKA 1OCOH 1MW7A 3MZ8A 5JI6A 1PUFA 4UUSB 1T56A 2FX0A 1YW8A 4CUGA 2R7RA 2EZKA 4N0BA 4Z2YA 1I5ZA 3CMEI 2M1BA 3BZKA 3BR6A 4N4NB 3HJEA 2PN6A 1JJ8C 2FUG2 1JHHA 2ACJA 1MMAA 3SQNA 1RI7A 3ZMZA 1H88C 1SFOJ 1BJAA 4II2A 5K7FA 2DT6A 3W6JB 5EF6A 3EDPA 2EV6A 1FNNA 2O0YA 4Y52J 1POGA 3DPUA 3ELKA 4RGUA 1MBJA 3ESWB 3CDIA 4BNCA 3CUOA 3OYIA 2HDDA 2BY3A 3L00A 4CSWA 5E8IA 3I64A 3L2RA 2HTSA 3E5UA 3S1NJ 1A6QA 2F4IA 1D1AA 1ZG1A 2A68F 2LNBA 5EJCA 3J80Z 2EWNA 3CF2A 1ON1A 2A05A 2VI6A 2DA1A 2E7XA 2VQCA 1OKRA 3M9AA 1V5EA 4YRVA 2DDAA 2LFBA 1FY7A 1WQ2A 2KRHA 3V8KA 2GZWA 4NC7A 2EV5A 2MD0A 4L9NA 3K70C 5D5UB 2OQRA 1UELB 4ZZLA 4ZH4F 3LFKA 3HM5A 2CW8A 4IOAF 2QBYB 1RR8C 2ZKZA 3GZ6A 4AUXA 2R5YA 2X1EA 3CCJI 1U9NA 5D8KB 4FT8A 4CZCA 2HKOA 3B6CA 3CCVI 1LPQA 4O3MA 4NBQA 1IDZA 2MGQA 4PJMA 2EFPA 4YFNF 5LHIA 4I76A 3F9KA 4JQFA 5D6EA 1RRJA 2E1OA 3D0SA 1I6HJ 2F48A 2R7UA 1YLFA 2QM3A 3MEXA 4M3GA 4P5OA 2Z5UA 1TC3C 4XIDA 5D5XB 4I98B 5HS7A 4WWCA 1QHGA 1P7JA 1IUFA 3T5XA 2HTJA 5J1RA 5D6FA 4GFBA 5FKMA 1Z7UA 2QVOA 1RIOH 4CH7A 5CVIA 5EZGA 1KYZA 2HZTA 3E97A 3CP8A 5DEQA 1K6OA 4XKCA 4IQJA 1LKXA 4A6DA 4A6EA 2PJRB 2VXZA 1MMNA 3S2HJ 5LGTA 4MTDA 1X1PA 4TV7A 1BL0A 4XOTA 2HOSA 1Z3XA 2R0QC 1Z91A 4IOCF 1GLNA 3CJNA 5IYDJ 2OPTA 1RETA 2H1KA 1FC3A 2QQBA 2PG4A 4LFUA 1MGTA 1RNLA 4PZJA 2BHYA 4HV6A 5A2QZ 2K85A 1ZGWA 4KICA 1F1ZA 1VQ7I 3B02A 1ZR4A 2JA8J 2XPUA 2Y31A 1R4MB 1KGSA 2EZHA 2LSOA 3S2WA 4AVZA 3BG3A 1EH8A 1VTNC 2M30A 5H20A 3RCOA 2IRFG 2GIZA 1JT0A 1ETKA 4PJJA 4OIQF 2E71A 3ZPLA 2GQQA 2BEOA 3Q0VA 2ZMEA 1BM9A 5L3CA 3L2WA 1JGGA 1QZYA 3H92A 2VB6A 2CH0A 2DQLA 2ZO4A 2TCTA 1IN6A 2GOMA 3DEWA 1W7PB 5HOOA 2MD5A 3FBNB 4NNJA 2XRNA 3IRRA 3RQIA 4J19A 2WWYA 5E20A 5DTDA 3Q5FA 3HG9A 1YX5A 2LKSA 1V5FA 3I58A 5F08A 2DN0A 1E2XA 2CQ7A 2Y9YA 1ODDA 4KJZA 2MH2A 4KIBA 3ZMUA 2I10A 2LC2A 4BY7J 5ERIA 4G7ZF 3DTEA 3FKJA 5M5YJ 2H09A 4RM3A 3T8RA 1UG0A 3S3MA 4GYGA 4C3JJ 4OWRB 3KEOA 3K70D 5EZHA 5FKLA 2JMWA 1O3SA 2VKEA 3PJRA 4F52A 4RB1A 1PP7U 2OA4A 4LD5A 1QPIA 3FXJA 5E3NA 2GXBA 2CQQA 1O7LA 4G6DA 1P7IA 1XC5A 5ILSA 2HR3A 3TO7A 3HSEA 2ELJA 3VEPA 2DXIA 3IHUA 4ESBA 2DJNA 4R1HA 1YS6A 5LGNA 4OAYA 1HSJA 5FLXK 3ML6A 5DYMA 5IP9J 2E19A 4RAFA 3MAJA 4OOIA 3C7JA 1G3WA 5DUIA 5C44J 3MKWB 4FCYA 1U2WA 2DOAA 3QU3A 2V9PA 1MNEA 2OCCH 1QZEA 2M4KA 1NG7A 2WV0A 1F9NA 1IAWA 1YG2A 2ZFWA 4OAZA 1QVTA 1YS7A 2D1HA 1L3LA 2AS5F 3SYTA 4G9YA 3IH4A 3K0LA 2LREA 3BPXA 4D1QA 1JKQC 4Q5SF 4F91B 5GPCA 2AQFA 3GLLA 4JP0A 1B59A 3KETA 4OIPF 5ICEA 3SZTA 2KQRA 1JKOC 1L0OC 3DPLC 4PCQA 2E7WA 4MEYF 2P6SA 5L3FA 2HZDA 2Q2EB 3LA7A 4CCKA 1Z77A 4M72A 3FXMA 2V1UA 5GADJ 4C2TA 1HXDA 4HPQA 2OF7A 5M5XJ 1YX3A 1T0FA 2K02A 1A5JA 2HOEA 1P4XA 5JLXA 4ETSA 1W0TA 3ABKH 3ABTA 3PO2J 1J59A 3KCCA 4S0HB 2XROA 1WCMJ 1B72A 4IHSA 3RKXA 3HC7A 1OPCA 3OYEA 2W25A 2Y0MA 1GHCA 2EZLA 2X1CA 2X9DA 1X4OA 1XS9A 1IF1A 4HNUA 3EQLF 1IN7A 3LWFA 3GTGJ 1NHAA 1XDUA 2WAFA 2RN7A 3SFIA 3OS2A 3JREA 3CC2I 3KP4A 3ECHA 3U1DA 3QYBA 4ABZA 3NWSA 1ONVA 2LRDA 3DWLE 1ZKGA 5E79C 3MD2A 2DPUA 1JGSA 1BBYA 2F4OB 3FX3A 1S9HA 4E7SA 2Y9ZA 3PSIA 5H6RA 3EETA 2NNYA 1JKRC 5HVQC 3F72A 2JJ7A 2R7VA 4Z6YA 3MMYB 3L09A 1KZHA 3BC8A 1XGOA 4MFDA 1SFUA 2UWMA 2RQPA 2E1NA 1KU2A 2OC6A 1VQ6I 2YR2A 1O3QA 4YG2F 4LLNA 2O61A 3GTPJ 4HX4A 1Y39A 2DYSH 2P81A 3OSFA 2DTRA 4ZJZA 2LDUA 3L2CA 3ABUA 3R4KA 1ZR2A 1Z9CA 1Y8RB 3SZGA 1PP8F 2F5CA 1FMVA 1ZLKA 1PVEA 4U0YA 1K78B 2LYCA 4A3EJ 1YRNB 3M4OJ 4EJVA 1CF7B 1NG6A 1O3RA 2E5ZA 1G3YA 4QSHA 1GVJA 4FX4A 3RKQA 3SXYA 4XSXF 4QPQA 2DDBA 3SDBA 1FJLA 1R7JA 2GIVA 5J40A 3HSFA 1MSFC 1X3ZB 1E3HA 4C3IJ 3RDIA 5F1RA 4QIWN 3R60A 1ERDA 1B9MA 3S1RJ 2ME6A 3KP5A 4NUBA 2COMA 3F8NA 4A5NA 4LB5A 2IJLA 2M5WA 1LFBA 3HIFA 2JZYA 2KDZA 2ID6A 3BP8A 5J4VA 4UVCA 3JRHA 1A35A 3I0TA 2E5NA 4UVAA 3GX4X 5IPAA 4BJ6C 4M9SA 1HQCA 1P2FA 4CCOA 1LE8A 2IW5A 2HYFA 3FXRA 2HKXA 3FHNA 4W1UA 3F8MA 2JQ7A 1D0YA 5KNLA 3LAJA 3F23A 1ETVA 1XMXA 1G3TA 3FHZA 3VDXA 3SJMA 2EZIA 3IKTA 4N4OB 3MVPA 5F27A 5KVRA 4S05A 5L3DA 3MKYB 3OY9A 2R7WA 3ZQGA 4G8XA 4BQQA 5CVJA 4MEXF 5FFXA 2JUGA 4FASD 1X1DA 3A0HC 3ERED 4RLFA 3TDZC 4IEJA 5LHHA 2VJ5A 2ESNA 1WJDA 5J1YA 1QVUA 3CJTB 3JTGA 1I39A 2BHZA 1I1SA 1PYVA 1S29A 2L01A 5ILUA 1EH6A 4AYBA 3WTYC 2STWA 3FXOA 3LOCA 4L5IA 4XLPF 2R5ZA 2L02A 2FSWA 2M8GX 4ZDPA 3HB9A 1BW6A 3CJQB 5BOXA 3L1PA 5D4SA 1TW3A 4CCNA 2AHQA 3HUGA 3BTCA 5FKOA 2CUEA 4XKVA 4HX8A 1IRFA 4XK4A 4IVNA 2K9NA 4UUSA 1GT0C 5DCFA 4BE0A 2VQHA 2E36A 3F22A 1XMAA 4OIRF 3T0YA 2JVGA 1HA8A 1UZCA 1XD7A 4IF4A 3VSLA 1XGSA 3RPQA 3DBHB 4IX7A 4B3XA 1H0MA 5DS9A 3LAPA 1AWCA 1VQPI 5DD8A 5BQTA 2FMYA 2Y75A 2FBHA 5E3MA 2JA2A 4U87A 2KJCA 3HRUA 5BNGA 3GO5A 5K5OA 1FIAA 1PJRA 3UKGA 5AIPA 4E7ZA 4P55A 1OFCX 4EQQA 4IRIA 3U9GA 4LG3A 1IRXA 2K7LA 1WH5A 3JR9A 2L7FP 3LQRA 4RGSA 3E6BA 1YQAA 1SD6A 1IDYA 4B1RA 4DOZA 4C2UA 5K1YA 3F8BA 3K69A 2CSOA 2DMNA 3FISA 1QU3A 2DK5A 3VOEA 4IL6C 3WGHA 1X19A 4OMYA 2LOOA 3V7SA 4HZFA 3GFLA 1TLHB 2O3FA 2V1XA 1SEUA 5E18F 2GM4A 1IXSB 2E1MB 3M7GA 2KLOA 3O3KA 3OV8A 4LIUA 2R7SA 2QCOA 1ZTRA 3S16J 3IH2A 3VFZA 2JK3A 1QRYA 5HLHA 1HKTA 2LG4A 1GUUA 3FZVA 2Y0SN 3CDHA 3HPHA 4B4CA 4HX7A 1A31A 3KZIC 5J6XA 3E7LA 1HOMA 1HW1A 4P9UA 4IJAA 5FLXZ 3I71A 2BVLA 5H2FC 2HDCA 2BOLA 1WZ2A 2FJ1A 2VXDA 4CGZA 4ZYEA 1W5SA 5LRSA 3I59A 4U88A 4B8XA 4Y7NJ 2BVMA 2BXZA 4MGRA 5EG0B 1BC7C 1WJ5A 3LSTA 3AL0B 2FA5A 4PSWA 3LMMA 3K4BA 1XCVA 4XMYA 1R71A 4LK0F 3QOEA 5E3OA 3S15J 4FX0A 2PJRA 4BS9A 2NVYJ 3F3XA 3PUBA 2P5KA 3C3WA 5D8LB 2KISA 1SAXA 1M1EB 3QYEA 1AU7A 3JTHA 4GCVA 1OCZH 2VJJA 3PNTA 2A5WA 1DPUA 2ZJRF 2DYRH 3IH3A 3MKLA 1TP4A 5FB2A 1LVKA 1BW5A 2RGVA 2E1CA 3DU6A 3PQJA 2ECBA 2HQ5A 3MN2A 3M3YJ 2ZXWH 1LDKB 3OOUA 4HQEA 1UHMA 4Y15A 1W0UA 2NS7A 1R1TA 3DXJF 1GXQA 3CDLA 2F5FA 3DPTA 2X51A 3FKIJ 1VI0A 1Z0XA 4XORA 2AO9A 3J7ZI 3OR1C 2ZBKA 3VSKA 3HPGA 2K9SA 1HW2A 2OZ6A 3HOTA 1WJEA 2CJJA 3SHFA 2ID3A 2I8DA 3CCMI 1X2MA 2HVQA 3OOPA 4N9HA 3TOBA 2A3SA 1Y6IA 2DAOA 3BR2A 3TL4X 1GXPA 4A5MA 3KLOA 3NAUA
chains in the Genus database with same CATH topology
4G6QA 1YTYA 1W7PA 4XRFA 3FXQA 1T6SA 1SD5A 3ZN0A 3WODF 3L9FA 2EFWA 3J7AO 2FMLA 5CYVA 2QENA 2EK5A 4GYIA 4RB0A 1IZ1A 2ZJ2A 1S8NA 4LLGF 1HSTA 2ZNZA 1BOAA 2CG4A 3WTSC 1HW5A 1P4WA 3WTWC 4BHBA 5DCMB 4I09A 1KA8A 1KU3A 3TGNA 3QP5A 3SZPA 1B4AA 1SMYF 3FWEA 4CICA 4M71A 2A6HF 3HTUA 1IXRC 5FGMA 1U5TB 4UVBA 4G94A 3LA2A 4RGRA 5K5RA 3ZQ7A 3TQNA 4BHPA 2Q2EA 4ZYHA 4KA4A 2P4WA 5J8FA 2DFIA 2KRFA 3C18A 1R23A 4LG0A 3L7WA 3I54A 1R5GA 3GFJA 2CO5A 2O8XA 2EA4A 2CQKA 3FMSA 3JAMK 1YYVA 1CGPA 5LRRA 3FM5A 5BPIA 1OYIA 3TO9A 4O5VA 1FYKA 1J2XA 2V79A 5D5VB 3GFIA 1MZBA 1TQMA 1WRJA 1TNSA 4XLNF 1LB2A 3WE2A 2EFQA 2GWRA 1KU7A 3ULQB 5FFZA 2HFHA 4WK8F 1J7KA 1XMKA 2QWWA 3RI4A 4WF2A 1DDNA 2IVMA 3IWZA 4HF1A 2R7DA 1ZG3A 2P7VB 3M1EA 2YU3A 1HKSA 1I6XA 3DEUA 3DV8A 2X0LA 1V4RA 4R79A 4YIIA 2ISZA 4IHTA 1BIAA 2YPRA 3E6DA 2X4HA 4EM1A 1IN5A 1MDMB 3DQVC 4OU0A 3ROUA 3AAFA 1USSA 4WXHA 2VN2A 3IRQA 3P9KA 2H6BA 1J9IA 1LEBA 2LF8A 1SD4A 2EA2A 2FF4A 4HF0A 3NQOA 5HLIA 2IA1A 1JXSA 2BV6A 2FU4A 3GYHX 1B9NA 2FBIA 3I4PA 2A61A 1QPMA 4KMUX 1FZPB 1R00A 2CYYA 4Q47A 2RV8A 3HRTA 3K1NA 3ZMSA 1U3EM 4HAMA 1MJ9A 2PLYA 4WXDA 2XKOA 2EJRA 2M45A 4P96A 3ZMVA 1S7OA 4E70A 2XAFA 3E6CC 4ENJA 3IL2A 2BBYA 1UHWA 1OMIA 4AD9A 4LK1F 5E1WA 1UFMA 1MJAA 5FD5A 5BPDA 3GEZA 3E5XA 5F64A 4I7HA 3N97A 3RJPA 2VT3A 4CO8A 4AIJA 3FF5A 3HSRA 4ZYDA 3WGGA 3CTAA 1P4AA 2K86A 1XDSA 4EV0A 3RYPA 2W24A 1T38A 4PDKA 2J5PA 4EVIA 4CYDA 2MBFA 3O2PE 1USTA 4I0BA 4MQ9F 3R6SA 1FP1D 2H6CA 4KIGA 3BZ6A 3GW2A 4B09A 1B1BA 3HHHA 1ON2A 1LDJA 2P6TA 3Q9SA 1DP7P 5DD4A 1Z6RA 4M6YA 1R58A 3KZZA 3TOAA 3LQQA 3QRFF 2F5EA 2D2WA 3R0JA 1FWZA 1V3FA 3RYRA 2MLGA 2NAZA 2Z3YA 4ASNA 4HYEA 3GUDA 1KQ9A 3DFGA 3RIRA 1XSVA 2OD5A 1W4MA 1G3SA 3WTTC 4WXCA 1FPQA 3TKYA 1FBQA 1XSXA 2JRTA 5LHGA 1O3TA 2QZ8A 5CVUA 4HV5A 1MKMA 3BOQA 2XKPA 5H6QA 2FNAA 1QO0D 4RAZA 1O57A 1U8RA 4JK1X 4CHUA 1KQ0A 2UZKA 3WTUC 5HDNA 2Q8KA 5BMZA 3JAMZ 3BDDA 4WCGA 2K27A 1I27A 2Z33A 1MD0A 3GVAA 3K9TA 2JSCA 2R7FA 2KIUA 1BI1A 2OQGA 2A07F 4FHTA 1W7PD 2OBPA 5HDKA 3JSOA 2HYGD 4PGGA 3N4MA 4N9IA 2P5VA 2AXLA 4HBLA 3V7RA 5EEHA 4EMSA 5J8CA 4QWQA 1Z05A 2UXXA 5K5QA 5DCMA 2MA3A 2DBBA 5DUKA 2F5DA 2KIFA 1FP2A 2FEZA 2YX4A 3Q9VA 4CXFA 1YW7A 2JT1A 3K1PA 3F6VA 1O7FA 2OAZA 2QQ9A 1Y0UA 3K2ZA 1BN5A 4L5JA 2XAJA 5FO5A 4Y17A 2LF7A 4HLXA 2PMUA 1T2KA 2L54A 4EJUA 1ZRDA 4H0EA 3KE2A 4A0YA 2OU2A 4EJTA 1J5YA 3WGIA 2Y48A 4KDPA 5IT9K 4YFKF 1WI9A 2LKPA 1IXCA 2VONA 2W84A 4UXNA 4A12A 4KN4X 2QBYA 2RVCA 4GXOA 3WTXC 1E17A 4NB5A 3PFIA 2WTEA 4ZZDA 1UCRA 3M8FA 3CLOA 3QOPA 3E5QA 2QLZA 2PMHA 3RKWA 1F4KA 1X3UA 1XN7A 3ZN1A 5L3BA 4L9VA 5TRDA 4HF2A 2ELHA 1T39A 2EV0A 3MFKA 3RPUA 3DP7A 5HS9A 1SD7A 2DQRA 2M87A 2VE8A 4BHCA 2PFBA 5L3GA 2VOOA 1R36A 5AONA 1C0WA 3CUQB 3MZYA 1ZG5A 3KP3A 3NEUA 1RZ4A 3TO6A 3IKVA 3G3ZA 1SFEA 1BC8C 1OYYA 2HQRA 2A5YB 1U78A 5HDGA 2F2EA 1KU9A 4Y13A 1J0RA 5D4RA 2XVCA 2Q0OA 2Z9OA 1P92A 1I1GA 4RAYA 3GWZA 3EUHA 3E6MA 4DQ2A 1FBUA 3KEQA 1YFHA 2GA1A 5LBQA 4M74A 2XASA 1D5VA 4U7BA 5CLSA 4EJOA 2G7HA 4DNCA 3V4GA 4LB6B 1WKMA 1ZRCA 1K7AA 1LDDA 4G7HF 2Z99A 2VT2A 2XAHA 2K4JA 2FQ3A 2V1DA 3HYIA 1XSDA 1RUNA 1IW7F 3KP2A 3ZP5A 4U0VA 3CUQC 3B73A 4YFXF 5JVTA 2D45A 3PQKA 4L0YB 1IN8A 3QAHA 1TQIA 2VOPA 1KQ8A 4BYYA 2V9VA 5JR3A 4L18B 4IPAA 4OINF 3F21A 3MQ0A 4EJWA 4K2EA 1K79A 2XAGA 5ICGA 2DPDA 1ZH5A 4RS8A 2DK8A 4HA8A 5ED4A 4BQAA 3M8EA 5LLQA 3QPHA 2O6GE 3HRMA 4NHJA 2VC0A 2G9WA 3BJOA 4HLYA 2RC4A 3QU6A 4QLCU 3KP6A 3GZ5A 4M9ZA 4G7OF 3T8TA 2PEXA 4UUVA 4CZZA 2DLLA 2V6CA 5E1ZB 2BGCA 1DPRA 1U5TC 1K78A 2ZXJA 4I02A 3JW4A 3I59B 1CF7A 1EH7A 2IP2A 4L9JA 1QGPA 2D1VA 4L9TA 3SFZA 4BXUA 4HOBA 2W85A 3HOSA 1BIBA 5IT9Z 1ULYA 2L4AA 5JFRA 3P9IA 2CFXA 5KK1A 3NRVA 4Q48A 5JHUA 4ZYGA 4A0ZA 4BH9A 3R0AA 1F5TA 1FT9A 1ZAOA 2RNJA 1LEAA 2JPBA 4GGGA 4M6XA 3TDUC 4EGZA 4LGWA 3LA3A 2FOKA 4KFCA 4HQMA 2ISYA 1QNTA 3EYYA 2P5LC 3H3ZA 4ENKA 1YW9A 1KYWA 3H3UA 1BI3A 3F8CA 3WU1B 1SFXA 3BPVA 3FMRA 1BI2A 2R3SA 3RKYA 2IA2A 5ILVA 2HS5A 3E3VA 1HBXG 4EM0B 4CDGA 1D8JA 2ETHA 5TJJA 3KP7A 2EFNA 1ZGAA 1QZZA 1SMTA 4AVPA 4U7DA 1TNTA 3P9CA 1TQPA 1JE8A 3J81K 1R22A 1REPC 2NNNA 4I2OA 3WTZA 1ZREA 2IT0A 6PAXA 4RGXA 2KKOA 1WSUA 3GF2A 2G7UA 4PGHA 2FXAA 5EEGA 2VBXA 2OZUA 1LJ9A 3V8JA 3W6KB 3EYIA 4MNUA 1XB4A 3IWFA 2NRAC 3HRSA 1FYMA 4KYWA 2FBKA 1PUEE 1J75A 5CVRA 2FRHA 4YIFA 2VODA 3BJ6A 1W5TA 2HWVA 2M8EA 1FSHA 4OIOF 3RTRA 4LG0B 1R1UA 1QQIA 3T1BA 1RUOA 3KZYA 1R1VA 3DF8A 4I0AA 3FM3A 4HDUA 2EFOA 1H9TA 1ZLJA 1B6AA 2IA0A 5CJ9A 2UXNA 4M73A 4IRHA 1XGNA 4D0PA 2EB7A 3K1MA 3QP6A 2XV4S 2BYVE 2DI3A 1STZA 2MLKA 1P6RA 1FYLA 3FMQA 1MJBA 4IXAA 3ISPA 4UV8A 4ENNA 5LEJA 4JBAA 1QBJA 2VC1A 1FSEA 3P7NA 3WE3A 3O6BB 3CUQA 2XGXA 3VODA 2ZCWA 5F6FA 3BROA 4R8HA 1G4DA 1D3YA 2BE5F 4EGYA 2QQAA 3VB2A 2B0LA 3COAC 1ZYRF 3WG9A 2FE3A 3R61A 4UNOA 3ZMTA 4LJZF 2STTA 2DU9A 2PQ8A 4RB2C 5L3EA 2XHKA 2JTVA 2RKHA 1S3JA 2KJBA 2GXGA 2ZMEB 4NQWA 4KNYA 2XIGA 2YSRA 5DDGA 1LNWA 5DV5A 2PBIA 4WX9A 1G6NA 3CO6C 1WWXA 4A2UA 4I01A 4A0XA 5D5WB 4IRGA 3U2RA 4ON0A 3V7CA 3J80K 1ZGJA 4KIFA 2CGPA 2O03A 2DO7A 1TBXA 1ZN2A 4LMYA 2PJPA 3IC7A 3KLNA 2VBZA 3MZHA 1H9GA 5FD6A 3ECOA 3MWMA 1XCBA 1U5TA 1Z6TA 3HHGA 3V8LA 3GLXA 2VE9A 2ESHA 2W57A 5E8GA 4U0WA 4BAYA 4AWXB 4GO1A 1U6GA 4MQVA 1ZHFA 2P7CB 5LEKA 1BI0A 2ADUA 3WU0A 4AIKA 1XGMA 5AIQA 5E17F 5ICCA 1AOYA 1TTYA 2IPQX 3D5LA 2PI0A 3BWGA 2MH9A 4Q4ZF 1FX7A 2KIMA 2VBYA 2XAQA 2XUBA 4KUMA 2K4BA 2H94A 1LVAA 2HQNA 4O6JA 3F6OA 1YO5C 4MTEA 1ZRFA 5A2QK 2YX7A 3CO7C 4KT5C 1JHFA 5HS8A 4OMZA 3WTVC 3J81Z 1IN4A 4HDVA 2FNPA 4MHGA 3ZMDA 2GA2A 2QUFA 1S7AA 2CWEA 1EV7A 2NS0A 5HLGA 4M9XA 4ENMA 3BJAA 4ESFA 5E1XA 4KMFA 1HKQA 1D8KA 1IRGA 4XSZF 1OR7A 3MCZA 2MC3A 2A6EF 5CVVA 2P8TA 4L0ZB 2L3DA 4P9FA 4XBFA 3REOA 1Z1DA 2VBWA 1OYWA 4ESJA 1T98A 1LQ1A 5IT3A 3F8FA 3I5UA 1S6LA 3JSPA 2TDXA 4LLLA 4UV9A 4F7ZA 2WC2A 2C6YA 2DW4A 5LGUA 3QPTA 1MDMA 4KN7X 1FOKA 3C1DA 1YIOA 1FLIA 1A04A 4EM2A 3GFMA 4RB3C 2A69F 1Q1HA 3I53A 2CW0F 1PDNC 1TW2A 3FXUA 3G73A 2GAUA 5ICFA 2HGCA 1FBSA 1ZARA 3HTSB 2QYOA 2L4MA 4UHTA 3GXOA 2JPCA 1DUXC 3KFWX 1R5HA 1UB9A 5BS6A 2NYXA 3DKWA 2H27A 2HEOA 4AIHA 2J5OA 4HW0A 4S04A 2RDPA 1IUYA 3BY6A 2ZNYA 2DT5A 5JI6A 1YW8A 4N0BA 4Z2YA 1I5ZA 2M1BA 2PN6A 1JHHA 2ACJA 3SQNA 1RI7A 3ZMZA 1BJAA 3W6JB 3EDPA 2EV6A 1FNNA 2O0YA 3ELKA 4RGUA 4BNCA 3CUOA 3L00A 5E8IA 3I64A 2HTSA 3E5UA 1ZG1A 2A68F 2LNBA 3J80Z 2EWNA 1ON1A 2E7XA 1OKRA 3M9AA 1FY7A 1WQ2A 3V8KA 2GZWA 2EV5A 4L9NA 5D5UB 2OQRA 4ZZLA 4ZH4F 3LFKA 2QBYB 2ZKZA 3GZ6A 5D8KB 4FT8A 2HKOA 4O3MA 2EFPA 4YFNF 5LHIA 4JQFA 5D6EA 3D0SA 1YLFA 2QM3A 3MEXA 4P5OA 2Z5UA 5D5XB 4I98B 5HS7A 4WWCA 3T5XA 2HTJA 5D6FA 1Z7UA 2QVOA 1RIOH 5CVIA 1KYZA 2HZTA 3E97A 5DEQA 1K6OA 4A6DA 4A6EA 2VXZA 5LGTA 4MTDA 4TV7A 1Z91A 3CJNA 1FC3A 2QQBA 2PG4A 4LFUA 1MGTA 1RNLA 4PZJA 4HV6A 5A2QZ 4KICA 1F1ZA 3B02A 1KGSA 2LSOA 3S2WA 1VTNC 1EH8A 2M30A 5H20A 2IRFG 4OIQF 3ZPLA 2GQQA 2BEOA 2ZMEA 1BM9A 5L3CA 1QZYA 3H92A 2DQLA 2ZO4A 1IN6A 1W7PB 5HOOA 2MD5A 2XRNA 3IRRA 2WWYA 5E20A 3Q5FA 3I58A 1E2XA 1ODDA 2MH2A 4KIBA 3ZMUA 5ERIA 4G7ZF 2H09A 3T8RA 4GYGA 3KEOA 1O3SA 4RB1A 1PP7U 2OA4A 4LD5A 2GXBA 1O7LA 4G6DA 5ILSA 2HR3A 3TO7A 3HSEA 3VEPA 3IHUA 4ESBA 4R1HA 1YS6A 5LGNA 1HSJA 5FLXK 3ML6A 5DYMA 3MAJA 4OOIA 3C7JA 1G3WA 5DUIA 1U2WA 3QU3A 2WV0A 1F9NA 1IAWA 1YG2A 2ZFWA 1YS7A 2D1HA 1L3LA 2AS5F 4G9YA 3K0LA 3BPXA 4Q5SF 3KETA 1B59A 4OIPF 5ICEA 3SZTA 1L0OC 3DPLC 4PCQA 2E7WA 4MEYF 2P6SA 5L3FA 3LA7A 4M72A 2V1UA 1HXDA 1T0FA 2K02A 2HOEA 1P4XA 4ETSA 3ABTA 1J59A 3KCCA 2XROA 4IHSA 3RKXA 1OPCA 2W25A 2Y0MA 1GHCA 1IF1A 3EQLF 1IN7A 3LWFA 1NHAA 1XDUA 2RN7A 3KP4A 3ECHA 3U1DA 1ONVA 2DPUA 1JGSA 1BBYA 3FX3A 5H6RA 3EETA 2NNYA 5HVQC 3F72A 3L09A 1XGOA 1SFUA 2UWMA 2RQPA 2E1NA 1KU2A 2YR2A 1O3QA 4YG2F 4LLNA 2O61A 4HX4A 2DTRA 2LDUA 3L2CA 3ABUA 3R4KA 1Z9CA 1PP8F 2F5CA 1ZLKA 4U0YA 1K78B 4EJVA 1CF7B 1O3RA 1G3YA 1GVJA 4FX4A 3SXYA 4XSXF 1R7JA 2GIVA 3HSFA 3RDIA 5F1RA 3R60A 1B9MA 3KP5A 2COMA 3F8NA 4A5NA 4LB5A 2IJLA 2M5WA 3HIFA 2JZYA 3BP8A 4UVCA 3I0TA 4UVAA 3GX4X 4M9SA 1HQCA 1P2FA 2IW5A 2HYFA 3FXRA 2HKXA 3F8MA 3LAJA 3F23A 1G3TA 3FHZA 3IKTA 5KVRA 4S05A 5L3DA 4G8XA 5CVJA 4MEXF 5FFXA 3ERED 3TDZC 5LHHA 2ESNA 3JTGA 1I1SA 1S29A 2L01A 5ILUA 1EH6A 3WTYC 2STWA 4L5IA 4XLPF 2L02A 2FSWA 5BOXA 5D4SA 1TW3A 3HUGA 4HX8A 1IRFA 4IVNA 5DCFA 3F22A 1XMAA 4OIRF 3T0YA 1XD7A 4IF4A 1XGSA 3RPQA 1H0MA 3LAPA 1AWCA 5DD8A 5BQTA 2FMYA 2Y75A 2FBHA 2KJCA 3HRUA 3GO5A 5K5OA 5AIPA 4P55A 4EQQA 4IRIA 3U9GA 2K7LA 3LQRA 4RGSA 3E6BA 1YQAA 1SD6A 5K1YA 3F8BA 3K69A 2CSOA 2DK5A 3VOEA 3WGHA 4OMYA 3V7SA 4HZFA 3GFLA 1TLHB 2O3FA 2V1XA 5E18F 1IXSB 3M7GA 3O3KA 3OV8A 3VFZA 5HLHA 1HKTA 3FZVA 3CDHA 4HX7A 5J6XA 1HW1A 4P9UA 4IJAA 5FLXZ 3I71A 2HDCA 4CGZA 4ZYEA 1W5SA 5LRSA 3I59A 4U88A 4B8XA 4MGRA 1BC7C 3LSTA 2FA5A 1XCVA 4LK0F 4FX0A 3F3XA 2P5KA 3C3WA 5D8LB 1SAXA 3JTHA 4GCVA 1DPUA 5FB2A 2RGVA 2E1CA 3PQJA 1LDKB 4HQEA 1UHMA 4Y15A 1R1TA 3DXJF 1GXQA 2F5FA 3DPTA 2ZBKA 1HW2A 2OZ6A 3HOTA 3SHFA 3OOPA 4N9HA 3TOBA 2A3SA 2DAOA 1GXPA 4A5MA 3KLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G6Q A;  1YTY A;  1W7P A;  4XRF A;  3FXQ A;  1T6S A;  1SD5 A;  3ZN0 A;  3WOD F;  3L9F A;  2EFW A;  3J7A O;  2FML A;  5CYV A;  2QEN A;  2EK5 A;  4GYI A;  4RB0 A;  1IZ1 A;  2ZJ2 A;  1S8N A;  4LLG F;  1HST A;  2ZNZ A;  1BOA A;  2CG4 A;  3WTS C;  1HW5 A;  1P4W A;  3WTW C;  4BHB A;  5DCM B;  4I09 A;  1KA8 A;  1KU3 A;  3TGN A;  3QP5 A;  3SZP A;  1B4A A;  1SMY F;  3FWE A;  4CIC A;  4M71 A;  2A6H F;  3HTU A;  1IXR C;  5FGM A;  1U5T B;  4UVB A;  4G94 A;  3LA2 A;  4RGR A;  5K5R A;  3ZQ7 A;  3TQN A;  4BHP A;  2Q2E A;  4ZYH A;  4KA4 A;  2P4W A;  5J8F A;  2DFI A;  2KRF A;  3C18 A;  1R23 A;  4LG0 A;  3L7W A;  3I54 A;  1R5G A;  3GFJ A;  2CO5 A;  2O8X A;  2EA4 A;  2CQK A;  3FMS A;  3JAM K;  1YYV A;  1CGP A;  5LRR A;  3FM5 A;  5BPI A;  1OYI A;  3TO9 A;  4O5V A;  1FYK A;  1J2X A;  2V79 A;  5D5V B;  3GFI A;  1MZB A;  1TQM A;  1WRJ A;  1TNS A;  4XLN F;  1LB2 A;  3WE2 A;  2EFQ A;  2GWR A;  1KU7 A;  3ULQ B;  5FFZ A;  2HFH A;  4WK8 F;  1J7K A;  1XMK A;  2QWW A;  3RI4 A;  4WF2 A;  1DDN A;  2IVM A;  3IWZ A;  4HF1 A;  2R7D A;  1ZG3 A;  2P7V B;  3M1E A;  2YU3 A;  1HKS A;  1I6X A;  3DEU A;  3DV8 A;  2X0L A;  1V4R A;  4R79 A;  4YII A;  2ISZ A;  4IHT A;  1BIA A;  2YPR A;  3E6D A;  2X4H A;  4EM1 A;  1IN5 A;  1MDM B;  3DQV C;  4OU0 A;  3ROU A;  3AAF A;  1USS A;  4WXH A;  2VN2 A;  3IRQ A;  3P9K A;  2H6B A;  1J9I A;  1LEB A;  2LF8 A;  1SD4 A;  2EA2 A;  2FF4 A;  4HF0 A;  3NQO A;  5HLI A;  2IA1 A;  1JXS A;  2BV6 A;  2FU4 A;  3GYH X;  1B9N A;  2FBI A;  3I4P A;  2A61 A;  1QPM A;  4KMU X;  1FZP B;  1R00 A;  2CYY A;  4Q47 A;  2RV8 A;  3HRT A;  3K1N A;  3ZMS A;  1U3E M;  4HAM A;  1MJ9 A;  2PLY A;  4WXD A;  2XKO A;  2EJR A;  2M45 A;  4P96 A;  3ZMV A;  1S7O A;  4E70 A;  2XAF A;  3E6C C;  4ENJ A;  3IL2 A;  2BBY A;  1UHW A;  1OMI A;  4AD9 A;  4LK1 F;  5E1W A;  1UFM A;  1MJA A;  5FD5 A;  5BPD A;  3GEZ A;  3E5X A;  5F64 A;  4I7H A;  3N97 A;  3RJP A;  2VT3 A;  4CO8 A;  4AIJ A;  3FF5 A;  3HSR A;  4ZYD A;  3WGG A;  3CTA A;  1P4A A;  2K86 A;  1XDS A;  4EV0 A;  3RYP A;  2W24 A;  1T38 A;  4PDK A;  2J5P A;  4EVI A;  4CYD A;  2MBF A;  3O2P E;  1UST A;  4I0B A;  4MQ9 F;  3R6S A;  1FP1 D;  2H6C A;  4KIG A;  3BZ6 A;  3GW2 A;  4B09 A;  1B1B A;  3HHH A;  1ON2 A;  1LDJ A;  2P6T A;  3Q9S A;  1DP7 P;  5DD4 A;  1Z6R A;  4M6Y A;  1R58 A;  3KZZ A;  3TOA A;  3LQQ A;  3QRF F;  2F5E A;  2D2W A;  3R0J A;  1FWZ A;  1V3F A;  3RYR A;  2MLG A;  2NAZ A;  2Z3Y A;  4ASN A;  4HYE A;  3GUD A;  1KQ9 A;  3DFG A;  3RIR A;  1XSV A;  2OD5 A;  1W4M A;  1G3S A;  3WTT C;  4WXC A;  1FPQ A;  3TKY A;  1FBQ A;  1XSX A;  2JRT A;  5LHG A;  1O3T A;  2QZ8 A;  5CVU A;  4HV5 A;  1MKM A;  3BOQ A;  2XKP A;  5H6Q A;  2FNA A;  1QO0 D;  4RAZ A;  1O57 A;  1U8R A;  4JK1 X;  4CHU A;  1KQ0 A;  2UZK A;  3WTU C;  5HDN A;  2Q8K A;  5BMZ A;  3JAM Z;  3BDD A;  4WCG A;  2K27 A;  1I27 A;  2Z33 A;  1MD0 A;  3GVA A;  3K9T A;  2JSC A;  2R7F A;  2KIU A;  1BI1 A;  2OQG A;  2A07 F;  4FHT A;  1W7P D;  2OBP A;  5HDK A;  3JSO A;  2HYG D;  4PGG A;  3N4M A;  4N9I A;  2P5V A;  2AXL A;  4HBL A;  3V7R A;  5EEH A;  4EMS A;  5J8C A;  4QWQ A;  1Z05 A;  2UXX A;  5K5Q A;  5DCM A;  2MA3 A;  2DBB A;  5DUK A;  2F5D A;  2KIF A;  1FP2 A;  2FEZ A;  2YX4 A;  3Q9V A;  4CXF A;  1YW7 A;  2JT1 A;  3K1P A;  3F6V A;  1O7F A;  2OAZ A;  2QQ9 A;  1Y0U A;  3K2Z A;  1BN5 A;  4L5J A;  2XAJ A;  5FO5 A;  4Y17 A;  2LF7 A;  4HLX A;  2PMU A;  1T2K A;  2L54 A;  4EJU A;  1ZRD A;  4H0E A;  3KE2 A;  4A0Y A;  2OU2 A;  4EJT A;  1J5Y A;  3WGI A;  2Y48 A;  4KDP A;  5IT9 K;  4YFK F;  1WI9 A;  2LKP A;  1IXC A;  2VON A;  2W84 A;  4UXN A;  4A12 A;  4KN4 X;  2QBY A;  2RVC A;  4GXO A;  3WTX C;  1E17 A;  4NB5 A;  3PFI A;  2WTE A;  4ZZD A;  1UCR A;  3M8F A;  3CLO A;  3QOP A;  3E5Q A;  2QLZ A;  2PMH A;  3RKW A;  1F4K A;  1X3U A;  1XN7 A;  3ZN1 A;  5L3B A;  4L9V A;  5TRD A;  4HF2 A;  2ELH A;  1T39 A;  2EV0 A;  3MFK A;  3RPU A;  3DP7 A;  5HS9 A;  1SD7 A;  2DQR A;  2M87 A;  2VE8 A;  4BHC A;  2PFB A;  5L3G A;  2VOO A;  1R36 A;  5AON A;  1C0W A;  3CUQ B;  3MZY A;  1ZG5 A;  3KP3 A;  3NEU A;  1RZ4 A;  3TO6 A;  3IKV A;  3G3Z A;  1SFE A;  1BC8 C;  1OYY A;  2HQR A;  2A5Y B;  1U78 A;  5HDG A;  2F2E A;  1KU9 A;  4Y13 A;  1J0R A;  5D4R A;  2XVC A;  2Q0O A;  2Z9O A;  1P92 A;  1I1G A;  4RAY A;  3GWZ A;  3EUH A;  3E6M A;  4DQ2 A;  1FBU A;  3KEQ A;  1YFH A;  2GA1 A;  5LBQ A;  4M74 A;  2XAS A;  1D5V A;  4U7B A;  5CLS A;  4EJO A;  2G7H A;  4DNC A;  3V4G A;  4LB6 B;  1WKM A;  1ZRC A;  1K7A A;  1LDD A;  4G7H F;  2Z99 A;  2VT2 A;  2XAH A;  2K4J A;  2FQ3 A;  2V1D A;  3HYI A;  1XSD A;  1RUN A;  1IW7 F;  3KP2 A;  3ZP5 A;  4U0V A;  3CUQ C;  3B73 A;  4YFX F;  5JVT A;  2D45 A;  3PQK A;  4L0Y B;  1IN8 A;  3QAH A;  1TQI A;  2VOP A;  1KQ8 A;  4BYY A;  2V9V A;  5JR3 A;  4L18 B;  4IPA A;  4OIN F;  3F21 A;  3MQ0 A;  4EJW A;  4K2E A;  1K79 A;  2XAG A;  5ICG A;  2DPD A;  1ZH5 A;  4RS8 A;  2DK8 A;  4HA8 A;  5ED4 A;  4BQA A;  3M8E A;  5LLQ A;  3QPH A;  2O6G E;  3HRM A;  4NHJ A;  2VC0 A;  2G9W A;  3BJO A;  4HLY A;  2RC4 A;  3QU6 A;  4QLC U;  3KP6 A;  3GZ5 A;  4M9Z A;  4G7O F;  3T8T A;  2PEX A;  4UUV A;  4CZZ A;  2DLL A;  2V6C A;  5E1Z B;  2BGC A;  1DPR A;  1U5T C;  1K78 A;  2ZXJ A;  4I02 A;  3JW4 A;  3I59 B;  1CF7 A;  1EH7 A;  2IP2 A;  4L9J A;  1QGP A;  2D1V A;  4L9T A;  3SFZ A;  4BXU A;  4HOB A;  2W85 A;  3HOS A;  1BIB A;  5IT9 Z;  1ULY A;  2L4A A;  5JFR A;  3P9I A;  2CFX A;  5KK1 A;  3NRV A;  4Q48 A;  5JHU A;  4ZYG A;  4A0Z A;  4BH9 A;  3R0A A;  1F5T A;  1FT9 A;  1ZAO A;  2RNJ A;  1LEA A;  2JPB A;  4GGG A;  4M6X A;  3TDU C;  4EGZ A;  4LGW A;  3LA3 A;  2FOK A;  4KFC A;  4HQM A;  2ISY A;  1QNT A;  3EYY A;  2P5L C;  3H3Z A;  4ENK A;  1YW9 A;  1KYW A;  3H3U A;  1BI3 A;  3F8C A;  3WU1 B;  1SFX A;  3BPV A;  3FMR A;  1BI2 A;  2R3S A;  3RKY A;  2IA2 A;  5ILV A;  2HS5 A;  3E3V A;  1HBX G;  4EM0 B;  4CDG A;  1D8J A;  2ETH A;  5TJJ A;  3KP7 A;  2EFN A;  1ZGA A;  1QZZ A;  1SMT A;  4AVP A;  4U7D A;  1TNT A;  3P9C A;  1TQP A;  1JE8 A;  3J81 K;  1R22 A;  1REP C;  2NNN A;  4I2O A;  3WTZ A;  1ZRE A;  2IT0 A;  6PAX A;  4RGX A;  2KKO A;  1WSU A;  3GF2 A;  2G7U A;  4PGH A;  2FXA A;  5EEG A;  2VBX A;  2OZU A;  1LJ9 A;  3V8J A;  3W6K B;  3EYI A;  4MNU A;  1XB4 A;  3IWF A;  2NRA C;  3HRS A;  1FYM A;  4KYW A;  2FBK A;  1PUE E;  1J75 A;  5CVR A;  2FRH A;  4YIF A;  2VOD A;  3BJ6 A;  1W5T A;  2HWV A;  2M8E A;  1FSH A;  4OIO F;  3RTR A;  4LG0 B;  1R1U A;  1QQI A;  3T1B A;  1RUO A;  3KZY A;  1R1V A;  3DF8 A;  4I0A A;  3FM3 A;  4HDU A;  2EFO A;  1H9T A;  1ZLJ A;  1B6A A;  2IA0 A;  5CJ9 A;  2UXN A;  4M73 A;  4IRH A;  1XGN A;  4D0P A;  2EB7 A;  3K1M A;  3QP6 A;  2XV4 S;  2BYV E;  2DI3 A;  1STZ A;  2MLK A;  1P6R A;  1FYL A;  3FMQ A;  1MJB A;  4IXA A;  3ISP A;  4UV8 A;  4ENN A;  5LEJ A;  4JBA A;  1QBJ A;  2VC1 A;  1FSE A;  3P7N A;  3WE3 A;  3O6B B;  3CUQ A;  2XGX A;  3VOD A;  2ZCW A;  5F6F A;  3BRO A;  4R8H A;  1G4D A;  1D3Y A;  2BE5 F;  4EGY A;  2QQA A;  3VB2 A;  2B0L A;  3COA C;  1ZYR F;  3WG9 A;  2FE3 A;  3R61 A;  4UNO A;  3ZMT A;  4LJZ F;  2STT A;  2DU9 A;  2PQ8 A;  4RB2 C;  5L3E A;  2XHK A;  2JTV A;  2RKH A;  1S3J A;  2KJB A;  2GXG A;  2ZME B;  4NQW A;  4KNY A;  2XIG A;  2YSR A;  5DDG A;  1LNW A;  5DV5 A;  2PBI A;  4WX9 A;  1G6N A;  3CO6 C;  1WWX A;  4A2U A;  4I01 A;  4A0X A;  5D5W B;  4IRG A;  3U2R A;  4ON0 A;  3V7C A;  3J80 K;  1ZGJ A;  4KIF A;  2CGP A;  2O03 A;  2DO7 A;  1TBX A;  1ZN2 A;  4LMY A;  2PJP A;  3IC7 A;  3KLN A;  2VBZ A;  3MZH A;  1H9G A;  5FD6 A;  3ECO A;  3MWM A;  1XCB A;  1U5T A;  1Z6T A;  3HHG A;  3V8L A;  3GLX A;  2VE9 A;  2ESH A;  2W57 A;  5E8G A;  4U0W A;  4BAY A;  4AWX B;  4GO1 A;  1U6G A;  4MQV A;  1ZHF A;  2P7C B;  5LEK A;  1BI0 A;  2ADU A;  3WU0 A;  4AIK A;  1XGM A;  5AIQ A;  5E17 F;  5ICC A;  1AOY A;  1TTY A;  2IPQ X;  3D5L A;  2PI0 A;  3BWG A;  2MH9 A;  4Q4Z F;  1FX7 A;  2KIM A;  2VBY A;  2XAQ A;  2XUB A;  4KUM A;  2K4B A;  2H94 A;  1LVA A;  2HQN A;  4O6J A;  3F6O A;  1YO5 C;  4MTE A;  1ZRF A;  5A2Q K;  2YX7 A;  3CO7 C;  4KT5 C;  1JHF A;  5HS8 A;  4OMZ A;  3WTV C;  3J81 Z;  1IN4 A;  4HDV A;  2FNP A;  4MHG A;  3ZMD A;  2GA2 A;  2QUF A;  1S7A A;  2CWE A;  1EV7 A;  2NS0 A;  5HLG A;  4M9X A;  4ENM A;  3BJA A;  4ESF A;  5E1X A;  4KMF A;  1HKQ A;  1D8K A;  1IRG A;  4XSZ F;  1OR7 A;  3MCZ A;  2MC3 A;  2A6E F;  5CVV A;  2P8T A;  4L0Z B;  2L3D A;  4P9F A;  4XBF A;  3REO A;  1Z1D A;  2VBW A;  1OYW A;  4ESJ A;  1T98 A;  1LQ1 A;  5IT3 A;  3F8F A;  3I5U A;  1S6L A;  3JSP A;  2TDX A;  4LLL A;  4UV9 A;  4F7Z A;  2WC2 A;  2C6Y A;  2DW4 A;  5LGU A;  3QPT A;  1MDM A;  4KN7 X;  1FOK A;  3C1D A;  1YIO A;  1FLI A;  1A04 A;  4EM2 A;  3GFM A;  4RB3 C;  2A69 F;  1Q1H A;  3I53 A;  2CW0 F;  1PDN C;  1TW2 A;  3FXU A;  3G73 A;  2GAU A;  5ICF A;  2HGC A;  1FBS A;  1ZAR A;  3HTS B;  2QYO A;  2L4M A;  4UHT A;  3GXO A;  2JPC A;  1DUX C;  3KFW X;  1R5H A;  1UB9 A;  5BS6 A;  2NYX A;  3DKW A;  2H27 A;  2HEO A;  4AIH A;  2J5O A;  4HW0 A;  4S04 A;  2RDP A;  1IUY A;  3BY6 A;  2ZNY A;  2DT5 A;  5JI6 A;  1YW8 A;  4N0B A;  4Z2Y A;  1I5Z A;  2M1B A;  2PN6 A;  1JHH A;  2ACJ A;  3SQN A;  1RI7 A;  3ZMZ A;  1BJA A;  3W6J B;  3EDP A;  2EV6 A;  1FNN A;  2O0Y A;  3ELK A;  4RGU A;  4BNC A;  3CUO A;  3L00 A;  5E8I A;  3I64 A;  2HTS A;  3E5U A;  1ZG1 A;  2A68 F;  2LNB A;  3J80 Z;  2EWN A;  1ON1 A;  2E7X A;  1OKR A;  3M9A A;  1FY7 A;  1WQ2 A;  3V8K A;  2GZW A;  2EV5 A;  4L9N A;  5D5U B;  2OQR A;  4ZZL A;  4ZH4 F;  3LFK A;  2QBY B;  2ZKZ A;  3GZ6 A;  5D8K B;  4FT8 A;  2HKO A;  4O3M A;  2EFP A;  4YFN F;  5LHI A;  4JQF A;  5D6E A;  3D0S A;  1YLF A;  2QM3 A;  3MEX A;  4P5O A;  2Z5U A;  5D5X B;  4I98 B;  5HS7 A;  4WWC A;  3T5X A;  2HTJ A;  5D6F A;  1Z7U A;  2QVO A;  1RIO H;  5CVI A;  1KYZ A;  2HZT A;  3E97 A;  5DEQ A;  1K6O A;  4A6D A;  4A6E A;  2VXZ A;  5LGT A;  4MTD A;  4TV7 A;  1Z91 A;  3CJN A;  1FC3 A;  2QQB A;  2PG4 A;  4LFU A;  1MGT A;  1RNL A;  4PZJ A;  4HV6 A;  5A2Q Z;  4KIC A;  1F1Z A;  3B02 A;  1KGS A;  2LSO A;  3S2W A;  1VTN C;  1EH8 A;  2M30 A;  5H20 A;  2IRF G;  4OIQ F;  3ZPL A;  2GQQ A;  2BEO A;  2ZME A;  1BM9 A;  5L3C A;  1QZY A;  3H92 A;  2DQL A;  2ZO4 A;  1IN6 A;  1W7P B;  5HOO A;  2MD5 A;  2XRN A;  3IRR A;  2WWY A;  5E20 A;  3Q5F A;  3I58 A;  1E2X A;  1ODD A;  2MH2 A;  4KIB A;  3ZMU A;  5ERI A;  4G7Z F;  2H09 A;  3T8R A;  4GYG A;  3KEO A;  1O3S A;  4RB1 A;  1PP7 U;  2OA4 A;  4LD5 A;  2GXB A;  1O7L A;  4G6D A;  5ILS A;  2HR3 A;  3TO7 A;  3HSE A;  3VEP A;  3IHU A;  4ESB A;  4R1H A;  1YS6 A;  5LGN A;  1HSJ A;  5FLX K;  3ML6 A;  5DYM A;  3MAJ A;  4OOI A;  3C7J A;  1G3W A;  5DUI A;  1U2W A;  3QU3 A;  2WV0 A;  1F9N A;  1IAW A;  1YG2 A;  2ZFW A;  1YS7 A;  2D1H A;  1L3L A;  2AS5 F;  4G9Y A;  3K0L A;  3BPX A;  4Q5S F;  3KET A;  1B59 A;  4OIP F;  5ICE A;  3SZT A;  1L0O C;  3DPL C;  4PCQ A;  2E7W A;  4MEY F;  2P6S A;  5L3F A;  3LA7 A;  4M72 A;  2V1U A;  1HXD A;  1T0F A;  2K02 A;  2HOE A;  1P4X A;  4ETS A;  3ABT A;  1J59 A;  3KCC A;  2XRO A;  4IHS A;  3RKX A;  1OPC A;  2W25 A;  2Y0M A;  1GHC A;  1IF1 A;  3EQL F;  1IN7 A;  3LWF A;  1NHA A;  1XDU A;  2RN7 A;  3KP4 A;  3ECH A;  3U1D A;  1ONV A;  2DPU A;  1JGS A;  1BBY A;  3FX3 A;  5H6R A;  3EET A;  2NNY A;  5HVQ C;  3F72 A;  3L09 A;  1XGO A;  1SFU A;  2UWM A;  2RQP A;  2E1N A;  1KU2 A;  2YR2 A;  1O3Q A;  4YG2 F;  4LLN A;  2O61 A;  4HX4 A;  2DTR A;  2LDU A;  3L2C A;  3ABU A;  3R4K A;  1Z9C A;  1PP8 F;  2F5C A;  1ZLK A;  4U0Y A;  1K78 B;  4EJV A;  1CF7 B;  1O3R A;  1G3Y A;  1GVJ A;  4FX4 A;  3SXY A;  4XSX F;  1R7J A;  2GIV A;  3HSF A;  3RDI A;  5F1R A;  3R60 A;  1B9M A;  3KP5 A;  2COM A;  3F8N A;  4A5N A;  4LB5 A;  2IJL A;  2M5W A;  3HIF A;  2JZY A;  3BP8 A;  4UVC A;  3I0T A;  4UVA A;  3GX4 X;  4M9S A;  1HQC A;  1P2F A;  2IW5 A;  2HYF A;  3FXR A;  2HKX A;  3F8M A;  3LAJ A;  3F23 A;  1G3T A;  3FHZ A;  3IKT A;  5KVR A;  4S05 A;  5L3D A;  4G8X A;  5CVJ A;  4MEX F;  5FFX A;  3ERE D;  3TDZ C;  5LHH A;  2ESN A;  3JTG A;  1I1S A;  1S29 A;  2L01 A;  5ILU A;  1EH6 A;  3WTY C;  2STW A;  4L5I A;  4XLP F;  2L02 A;  2FSW A;  5BOX A;  5D4S A;  1TW3 A;  3HUG A;  4HX8 A;  1IRF A;  4IVN A;  5DCF A;  3F22 A;  1XMA A;  4OIR F;  3T0Y A;  1XD7 A;  4IF4 A;  1XGS A;  3RPQ A;  1H0M A;  3LAP A;  1AWC A;  5DD8 A;  5BQT A;  2FMY A;  2Y75 A;  2FBH A;  2KJC A;  3HRU A;  3GO5 A;  5K5O A;  5AIP A;  4P55 A;  4EQQ A;  4IRI A;  3U9G A;  2K7L A;  3LQR A;  4RGS A;  3E6B A;  1YQA A;  1SD6 A;  5K1Y A;  3F8B A;  3K69 A;  2CSO A;  2DK5 A;  3VOE A;  3WGH A;  4OMY A;  3V7S A;  4HZF A;  3GFL A;  1TLH B;  2O3F A;  2V1X A;  5E18 F;  1IXS B;  3M7G A;  3O3K A;  3OV8 A;  3VFZ A;  5HLH A;  1HKT A;  3FZV A;  3CDH A;  4HX7 A;  5J6X A;  1HW1 A;  4P9U A;  4IJA A;  5FLX Z;  3I71 A;  2HDC A;  4CGZ A;  4ZYE A;  1W5S A;  5LRS A;  3I59 A;  4U88 A;  4B8X A;  4MGR A;  1BC7 C;  3LST A;  2FA5 A;  1XCV A;  4LK0 F;  4FX0 A;  3F3X A;  2P5K A;  3C3W A;  5D8L B;  1SAX A;  3JTH A;  4GCV A;  1DPU A;  5FB2 A;  2RGV A;  2E1C A;  3PQJ A;  1LDK B;  4HQE A;  1UHM A;  4Y15 A;  1R1T A;  3DXJ F;  1GXQ A;  2F5F A;  3DPT A;  2ZBK A;  1HW2 A;  2OZ6 A;  3HOT A;  3SHF A;  3OOP A;  4N9H A;  3TOB A;  2A3S A;  2DAO A;  1GXP A;  4A5M A;  3KLO A; 
#chains in the Genus database with same CATH topology
 4KIT B;  1JUP A;  2IXS A;  1GVD A;  1LFU P;  2HVR A;  4G6Q A;  3SEQ A;  1YTY A;  1W7P A;  4AYB N;  1FOY A;  4XRF A;  3FXQ A;  4XR6 A;  4B48 A;  1T6S A;  1SD5 A;  1X1C A;  3ZN0 A;  3JRI A;  2DA3 A;  4NDL A;  4XM3 A;  1ETY A;  3WOD F;  3RZD J;  3L9F A;  2K9M A;  2EFW A;  4NQW B;  3KEY A;  1HDD C;  2ZJP F;  3J7A O;  4ZTF A;  2FML A;  2ZB9 A;  2QEN A;  5CYV A;  2EK5 A;  4GYI A;  4RB0 A;  3K6G A;  1IZ1 A;  2ZJ2 A;  1S8N A;  4LLG F;  1HST A;  2ZNZ A;  2R7Q A;  1BOA A;  2CG4 A;  3K4M A;  3CC4 I;  2V26 A;  3BQY A;  3WTS C;  1HW5 A;  3H9J A;  1P4W A;  3WTW C;  3OS1 A;  2BY1 A;  2XB5 A;  4BHB A;  5TGT A;  2LTP A;  3GTM J;  3D5S C;  5DCM B;  4ZC3 A;  4I09 A;  1H89 C;  3G1M A;  1KA8 A;  1KU3 A;  3TGN A;  3QP5 A;  3SZP A;  1B4A A;  1SMY F;  3F0C A;  3FWE A;  4CIC A;  3GZN B;  4JX6 A;  3PIO F;  5E3L A;  4BEH A;  1SVO A;  4M71 A;  3ZQC A;  1DU6 A;  2A6H F;  3DTK A;  2X1D A;  5F1J A;  3HTU A;  1IXR C;  5FGM A;  2M2E A;  3JRG A;  3S1M J;  3FDY A;  3W2W A;  4PUS A;  1U5T B;  2X6O A;  4DYC A;  3A03 A;  1U9O A;  4UVB A;  4G94 A;  3LA2 A;  4RGR A;  5K5R A;  3ZQ7 A;  2L0K A;  1YIJ I;  4XN3 A;  3H0G J;  3BQZ A;  3TQN A;  4BHP A;  2Q2E A;  3HZJ A;  4D9J A;  4ZYH A;  3BLY A;  4KA4 A;  2P4W A;  5J8F A;  2DFI A;  3E0J B;  2KRF A;  2RQQ A;  3C18 A;  2DMP A;  2LD5 A;  1R23 A;  4IHX A;  4LG0 A;  3L7W A;  2JRM A;  3I54 A;  3OIP A;  2JWT A;  1R5G A;  3GFJ A;  2JSP A;  2CO5 A;  1AKH B;  2O8X A;  1VQM I;  2EA4 A;  4D5F A;  3OIQ A;  2CQK A;  3FMS A;  3JAM K;  1SVM A;  1JKP C;  4HG2 A;  3OL4 A;  1YYV A;  1CGP A;  2LR8 A;  3H1C A;  5LRR A;  3FM5 A;  2VAS A;  1X3W B;  5BPI A;  4PFP A;  2CV0 A;  1OYI A;  3TO9 A;  1BR4 A;  3S2D J;  2KT0 A;  3I4N J;  2DMT A;  2ELK A;  4AM3 A;  4O5V A;  1FYK A;  1J2X A;  1NK3 P;  2XGD A;  4I99 C;  4A3B J;  2V79 A;  5D5V B;  3GFI A;  2RAE A;  4BAC A;  4CCM A;  1V55 H;  3A4C A;  1MZB A;  2K5C A;  3K4J A;  1TQM A;  1WRJ A;  2E34 A;  1TNS A;  1TWH J;  2VKV A;  4XLN F;  1LB2 A;  3WE2 A;  2EFQ A;  1VQ8 I;  4V19 K;  2GWR A;  3S17 J;  3SEZ A;  1MBE A;  1KU7 A;  3ULQ B;  3A01 B;  5FFZ A;  2HFH A;  2L9S A;  3B6A A;  4F92 B;  1J7K A;  1W1W E;  4WK8 F;  1YIT I;  5KCM A;  1XMK A;  1UG2 A;  5LFA A;  3HL2 A;  2QWW A;  1BR1 A;  3RI4 A;  2HPI A;  1FOX A;  1DU0 A;  4WF2 A;  4DW6 A;  1DDN A;  1ZEL A;  2IVM A;  3IWZ A;  3OWT A;  4F3Q A;  4HF1 A;  2R7D A;  1ZG3 A;  2P7V B;  3M1E A;  1SAU A;  1ETO A;  2K9L A;  1MBH A;  2KL4 A;  2YU3 A;  1HKS A;  2DMQ A;  3HGY A;  1I6X A;  2K3P A;  3DEU A;  3EPZ A;  4XRS G;  3DV8 A;  2X0L A;  2L9V A;  3OMY A;  3TP0 A;  2WY8 Q;  3TED A;  3A02 A;  1V4R A;  4R79 A;  4YII A;  3HOW J;  2ISZ A;  3S32 A;  4A3K J;  4IHT A;  1BIA A;  2YPR A;  3E6D A;  2MAB A;  2X4H A;  4EM1 A;  3CMM A;  1IN5 A;  2XDV A;  1MDM B;  3DQV C;  2O5R A;  4OU0 A;  3M07 A;  3ROU A;  1USS A;  4WXH A;  2VN2 A;  3AAF A;  3G4S I;  3IRQ A;  4ZYA A;  4XRS A;  1LFP A;  3P9K A;  1WVR A;  2H6B A;  1J9I A;  3DTI A;  2NVX J;  3DEE A;  1LEB A;  2XPV A;  3H3V K;  2LF8 A;  2CV1 A;  1SD4 A;  2EA2 A;  2FF4 A;  2VLA A;  4HF0 A;  1ITY A;  2KZV A;  3NQO A;  3AKZ A;  5HLI A;  1RPW A;  5KHD A;  2IA1 A;  2CQN A;  3LSJ A;  2BV6 A;  2FU4 A;  1JXS A;  3GYH X;  1B9N A;  2FBI A;  3I4P A;  2A61 A;  1W36 C;  1QPM A;  3M8J A;  2E2I J;  4KMU X;  4CCL A;  1FZP B;  1R00 A;  2CYY A;  3LSI A;  4Q47 A;  2RV8 A;  1BOB A;  3HRT A;  3K1N A;  2E2J J;  2X6X A;  3ZMS A;  1U3E M;  2IS4 A;  3X2Q H;  4HAM A;  1MJ9 A;  1VQ9 I;  2PLY A;  4WXD A;  3PO3 J;  4CYC A;  2QSG X;  2DCE A;  2Z2S B;  4E7L A;  2XKO A;  1XX5 A;  2EJR A;  4ITV A;  2M45 A;  4P96 A;  3S8P A;  3ZMV A;  4HNV A;  1TWG J;  3OYL A;  1S7O A;  4E70 A;  2XAF A;  3E6C C;  3CCL I;  4ENJ A;  3IL2 A;  2BBY A;  1UHW A;  1OMI A;  4F93 B;  1VQO I;  4M6V A;  4AD9 A;  4LK1 F;  1NTC A;  5E1W A;  3GTK J;  2MFZ A;  1UFM A;  1MJA A;  5FD5 A;  5BPD A;  1WJF A;  2X6Y A;  3GEZ A;  3E5X A;  5F64 A;  1K61 A;  4DGW B;  4M3E A;  3IV5 A;  4I7H A;  3N97 A;  2WY7 Q;  3RJP A;  3ZXS A;  3DKX A;  2VT3 A;  4CO8 A;  4AIJ A;  2XSD C;  3FF5 A;  3HSR A;  4ZYD A;  3WGG A;  3CTA A;  4C30 A;  1P4A A;  2K86 A;  1XDS A;  4A3I J;  4D5C A;  3FBI B;  4EV0 A;  3RYP A;  2W24 A;  4D7N A;  3H0D A;  3TMO A;  3G6E I;  3DBR B;  1T38 A;  1GDT A;  4PDK A;  3W3C A;  2F4M B;  4W97 A;  2OTL I;  4G12 A;  2J5P A;  2MW8 A;  4EVI A;  4CYD A;  1FTZ A;  1OCC H;  2MBF A;  3O2P E;  4NC6 A;  1UST A;  2W48 A;  3IAM 2;  1G8X A;  4I0B A;  3CCY A;  1DGR M;  4MQ9 F;  2L9N A;  3R6S A;  1FP1 D;  1OJL A;  2H6C A;  4KIG A;  2DA4 A;  3I55 I;  2L7Z A;  3BZ6 A;  3GW2 A;  1TZL A;  4B09 A;  1B1B A;  3PNY A;  3H5A A;  4A3M J;  3OL3 A;  3L2V A;  3HHH A;  1IGN A;  1ON2 A;  1VQ5 I;  3EUH C;  3L2Q A;  3OYH A;  3CCQ I;  2HNH A;  1V5G A;  1LDJ A;  5F04 A;  2P6T A;  4LIT A;  2GLO A;  3Q9S A;  4C9Y A;  1Z21 A;  1DP7 P;  5DD4 A;  1Z6R A;  4HRI A;  5IYC J;  3W2V A;  5GAE J;  3OYB A;  3PIP F;  4M6Y A;  3A2K A;  2MC4 A;  1R58 A;  3KZZ A;  3TOA A;  4YIR X;  1Y1V J;  3LQQ A;  2CMP A;  2R5Y B;  3QRF F;  2F5E A;  2D2W A;  3JCU C;  3K4N A;  5JVG F;  5KAI C;  3R0J A;  1T8I A;  1FWZ A;  1V3F A;  3A1Y A;  3UNG C;  3RYR A;  3JRD A;  3ZQL A;  4M3F A;  2MLG A;  2NAZ A;  2Z3Y A;  4ASN A;  2Y0S A;  4HYE A;  3BTL A;  2EBI A;  1KQ9 A;  3GUD A;  3PUF A;  3DFG A;  2X48 A;  3RIR A;  1W36 D;  1XSV A;  1N77 A;  2QA4 I;  2OD5 A;  1MMS A;  1W4M A;  4A3L J;  3VYT B;  1G3S A;  4A3C J;  2X6W A;  3WTT C;  3ZQQ A;  4WXC A;  1FPQ A;  3TKY A;  1FBQ A;  3PSF A;  3HEF A;  1JI8 A;  1XSX A;  2JRT A;  1WH7 A;  2QEX I;  1FTT A;  5LHG A;  1O3T A;  3RPU D;  2QZ8 A;  2PMZ A;  5CVU A;  4M3B A;  2EIN H;  2NVU B;  4HV5 A;  3VWB A;  1IV6 A;  1N78 A;  1MKM A;  3BOQ A;  2XKP A;  5H6Q A;  2LKX A;  1OCP A;  2W00 A;  2FNA A;  1QO0 D;  4RAZ A;  1NH3 A;  1O57 A;  1U8R A;  3HGG A;  1IG7 A;  4JK1 X;  4A3F J;  4CHU A;  1KQ0 A;  2UZK A;  3WTU C;  5HDN A;  2Q8K A;  4FIS A;  4BDZ A;  5BMZ A;  1HCR A;  3JAM Z;  1K4S A;  3WU2 C;  3SDG A;  3BDD A;  4WCG A;  2KFD A;  2K27 A;  1I27 A;  1ETW A;  2Z33 A;  1MD0 A;  3GTJ J;  3GVA A;  3K9T A;  1F43 A;  2NVQ J;  3S3N A;  2VPL A;  4MLO A;  3CCS I;  2JSC A;  2R7F A;  5GP9 A;  2KIU A;  1BI1 A;  4HST A;  2OQG A;  2A07 F;  1RKT A;  4FHT A;  1W7P D;  2F6C A;  2MG4 A;  2XRL A;  5JHF A;  4XRM A;  5EGO A;  1APL C;  2OBP A;  5HDK A;  2VKH A;  3JSO A;  2HYG D;  3P5J A;  2IGK A;  1MBF A;  4PGG A;  4V2F A;  3N4M A;  3OR2 C;  1VQL I;  2R4G A;  1NK2 P;  4N9I A;  2P5V A;  2AXL A;  4IO9 F;  5F0H A;  4HBL A;  3LSP A;  3V7R A;  3TW7 A;  3ZRG A;  4E7J A;  5EEH A;  1K83 J;  5M5W J;  3RSN A;  2MSY A;  4EMS A;  5J8C A;  1UAA A;  3S1Q J;  4QWQ A;  3BZC A;  1Z05 A;  2UXX A;  3VYU B;  5K5Q A;  3OYJ A;  1MH4 A;  2XAU A;  5DCM A;  5IY5 H;  4BXX J;  1QHH D;  3HXL A;  2MA3 A;  2KMU A;  2DBB A;  2F5D A;  5DUK A;  2KIF A;  1FP2 A;  2XGE A;  2FEZ A;  4I6Z A;  5K7Z A;  2YX4 A;  3Q9V A;  4P1W A;  4CXF A;  1YW7 A;  2JT1 A;  2V7F A;  3K1P A;  5J1U A;  2WB1 A;  2COB A;  4XKW A;  3F6V A;  1O7F A;  2WAD A;  1W5C C;  2OAZ A;  2QQ9 A;  1Y0U A;  3K2Z A;  4II3 A;  1BN5 A;  2M7A A;  4L5J A;  2XAJ A;  5FO5 A;  3HOY J;  3AG1 H;  1JUS A;  4Y17 A;  2DTZ A;  2LF7 A;  4HLX A;  2PMU A;  1T2K A;  1T08 B;  2L54 A;  4EJU A;  1ZRD A;  4LIV A;  4AU7 A;  4H0E A;  1YOV B;  1WJC A;  3KE2 A;  5EYR A;  1BR2 A;  2FOW A;  2RNG A;  2OU2 A;  4A0Y A;  5FLM J;  4EJT A;  1WJA A;  1VFC A;  1WI3 A;  1Z67 A;  1J5Y A;  2IS2 A;  4UUT A;  2ZSH B;  3WGI A;  2Y48 A;  4B47 A;  4KDP A;  2E2H J;  5IT9 K;  4YFK F;  4RLQ A;  1MIJ A;  1WGX A;  2B7E A;  4RM2 A;  1AKH A;  3Q0W A;  1WI9 A;  1R5I D;  2LKP A;  1IXC A;  3HOX J;  2W84 A;  2VON A;  4UXN A;  4A12 A;  4KN4 X;  2QBY A;  2RVC A;  2IBD A;  4GXO A;  3WTX C;  1E17 A;  4NB5 A;  3PFI A;  2WTE A;  4ZZD A;  1UCR A;  2KZG A;  3UR3 C;  4DZP A;  1JJ6 C;  3M8F A;  2H8W A;  3CC7 I;  5B1B H;  3CLO A;  5IP6 A;  2NOJ B;  3CJR B;  4QTR A;  2NS8 A;  3QOP A;  2XF6 A;  1MMG A;  2WAQ N;  3E5Q A;  1IC8 A;  2QLZ A;  2VIX A;  2PMH A;  3KPH A;  3RKW A;  3DU5 A;  1N25 A;  2PMZ N;  5GAG J;  1F4K A;  1X3U A;  3ZCO A;  1D5Y A;  4IHV A;  1XN7 A;  2CUJ A;  3ZN1 A;  5L3B A;  2VKD A;  2OCE A;  4XKB A;  4FTH A;  1YJ9 I;  4H4K C;  3H5R A;  5IOY A;  1TT5 B;  2L2O A;  4L9V A;  1I3A A;  5TRD A;  4D7M A;  4HF2 A;  2ELH A;  1T39 A;  1U8B A;  2R7O A;  2EV0 A;  2VJ4 A;  3MFK A;  2K40 A;  2R7X A;  4X1E A;  4DBR A;  3RPU A;  1I50 J;  3DP7 A;  1FEX A;  1Y56 A;  5HS9 A;  1SD7 A;  3V42 A;  2NVT J;  2DQR A;  3A0B C;  2M87 A;  3KYL A;  2VE8 A;  2ZSI B;  1WHU A;  1I3Q J;  4AID A;  4E7H A;  5CPR B;  2V9K A;  2IAI A;  4BHC A;  4LOC A;  5DM6 F;  2PFB A;  5L3G A;  4ZTJ A;  4FE4 A;  3BG9 A;  1R36 A;  2VOO A;  3KX2 A;  1DQU A;  5AON A;  4HSR A;  4X0G A;  5F0F A;  5KAF C;  3CQZ J;  1C0W A;  4UB6 C;  2W1O A;  3CUQ B;  1T33 A;  4JYK A;  3MZY A;  1FIP A;  1ZG5 A;  3KP3 A;  3NEU A;  1RZ4 A;  1MMD A;  1RR7 A;  3ZQF A;  2IGN A;  2JA7 J;  4A3D J;  1VQN I;  3K2A A;  3TO6 A;  2E1M C;  3IKV A;  2VQG A;  3G3Z A;  3LSR A;  1SFE A;  1BC8 C;  1OYY A;  2HQR A;  3PM1 A;  5C3E J;  2A5Y B;  1OQY A;  1U78 A;  5HDG A;  2CW7 A;  3AG3 H;  4A3G J;  2F2E A;  1MND A;  1V54 H;  2NOG A;  3EUA A;  1KU9 A;  4X6A J;  2BZT A;  2ME0 A;  4XIC A;  4Y13 A;  1J0R A;  3OYG A;  5D4R A;  2XVC A;  4HNT A;  2Q0O A;  2CU7 A;  3JRB A;  2Z9O A;  2B63 J;  3BG7 A;  2N8G A;  2BW3 B;  1P92 A;  1I1G A;  2L7M P;  2W82 A;  3GBG A;  2LBF B;  3AL0 C;  2JA6 J;  3TW6 A;  4RAY A;  3GWZ A;  5FJ8 J;  3EUH A;  3E6M A;  4DQ2 A;  2WB1 N;  1FBU A;  3KEQ A;  1YFH A;  2IS6 A;  2GA1 A;  1F36 A;  2XGC A;  3DBL B;  5LBQ A;  4M74 A;  1ZK8 A;  2XAS A;  1D5V A;  4U7B A;  2IGO A;  5CLS A;  3FXL A;  4EJO A;  2G7H A;  4DNC A;  3V4G A;  3C2B A;  5GAH J;  4BBR J;  4LB6 B;  4F55 A;  1ETQ A;  1UMQ A;  3H5N A;  1WKM A;  1ZRC A;  2LY1 A;  2KP6 A;  2OTJ I;  1K7A A;  1LDD A;  1XPX A;  3I4M J;  4G7H F;  2Z99 A;  2VT2 A;  2XAH A;  2K4J A;  2FQ3 A;  3BG6 A;  2V1D A;  3HYI A;  3TBI A;  1K6Y A;  1XSD A;  1IW7 F;  1RUN A;  3KP2 A;  2EQR A;  3ZP5 A;  5FLV A;  4U0V A;  3CUQ C;  3B73 A;  3CD6 I;  3E1S A;  4YFX F;  4YEL A;  5JVT A;  1IV8 A;  2D45 A;  5HNF A;  1SC7 A;  3M1C A;  2CS3 A;  1D0X A;  3PQK A;  1MNM C;  4L0Y B;  1IN8 A;  4MIM A;  1VQK I;  3QAH A;  3OS0 A;  1QA6 A;  4M3D A;  1TQI A;  2L5Q A;  2VOP A;  1KQ8 A;  5CKT A;  5K7H A;  3MKZ A;  1YE9 A;  4BYY A;  1EA3 A;  4E7K A;  2DA6 A;  3OIO A;  1WFX A;  2V9V A;  5JR3 A;  4L18 B;  4IPA A;  4OIN F;  2EPF A;  2YU9 J;  1U0J A;  4RBO A;  1JTX A;  3F21 A;  3MQ0 A;  4EJW A;  1JT6 A;  2HXI A;  2M4G A;  4K2E A;  2ZJQ F;  1K79 A;  2XAG A;  4DYQ A;  5ICG A;  2DPD A;  1ZH5 A;  1X1A A;  1T95 A;  4RS8 A;  1AA7 A;  2DK8 A;  1RKW A;  4HA8 A;  2OV7 A;  5ED4 A;  4BQA A;  3M8E A;  1HC8 A;  5LLQ A;  3QPH A;  1Z3Y A;  2O6G E;  1MBK A;  3HRM A;  4XL9 A;  4FQG A;  1Y8Q B;  2HOA A;  4NHJ A;  3HOZ J;  2VC0 A;  2G9W A;  3ABL H;  3WHB A;  3BJO A;  2LY2 A;  2WBM A;  4HLY A;  2RC4 A;  1VF9 A;  3IP4 B;  3QU6 A;  4QLC U;  3OYD A;  3KP6 A;  3GZ5 A;  3BTI A;  1Z7L A;  2V6E A;  4M9Z A;  4HEA 2;  1SAN A;  3VYR B;  5B5E C;  4BBS J;  4G7O F;  2ECC A;  2EIJ H;  3T8T A;  3ZOB A;  2PEX A;  4UUV A;  1IJW C;  4CZZ A;  4IHW A;  2DLL A;  1ORK A;  1ETX A;  2V6C A;  3ASN H;  5E1Z B;  2QSH X;  2BGC A;  2V1N A;  1DPR A;  3N05 A;  3ONQ A;  3CF5 F;  1U5T C;  1K78 A;  1YRN A;  2ZXJ A;  4I02 A;  1TWF J;  3JW4 A;  3I59 B;  2EH3 A;  2W4S A;  1EH7 A;  1CF7 A;  3OYA A;  2IP2 A;  4L9J A;  1QGP A;  1Y1W J;  1OIS A;  2R93 J;  2D1V A;  4L9T A;  3SFZ A;  3TP3 A;  4BXU A;  4HOB A;  2W85 A;  3RQ4 A;  3HOS A;  4PJN A;  1BJZ A;  3BG5 A;  1BIB A;  3WG7 H;  5IT9 Z;  3ASO H;  1ULY A;  2L4A A;  5JFR A;  3DKY A;  1B8I B;  2HVS A;  2E35 A;  3P9I A;  2M34 A;  2CFX A;  1J09 A;  3QWL A;  2JUC A;  5KK1 A;  3NRV A;  4Q48 A;  5JHU A;  4ZYG A;  4A0Z A;  3LSM A;  4BH9 A;  2DA7 A;  3HKZ N;  2DOD A;  4RDU A;  3R0A A;  1F5T A;  4BY1 J;  1ACI A;  1AHD P;  1FT9 A;  4XLA A;  3J7A Y;  1OLT A;  1ZAO A;  2I5U A;  2RNJ A;  3JRA A;  4ZDO A;  4KT6 A;  2M9H A;  1LEA A;  1Q1V A;  2HDW A;  2JPB A;  4GGG A;  4M6X A;  3TDU C;  3CCR I;  1YHQ I;  4EGZ A;  4LGW A;  3BR1 A;  2R7Z J;  3H9Q A;  2VQL A;  3LA3 A;  1CQT A;  2E60 A;  2Y69 H;  2FOK A;  4KFC A;  3K4L A;  4HQM A;  2ISY A;  1QNT A;  3EYY A;  4JX5 A;  4BUP A;  4XLF A;  2P5L C;  5GTH C;  3H3Z A;  4GRI A;  4ENK A;  1S72 I;  1YW9 A;  3BTJ A;  1KYW A;  3IUO A;  3H3U A;  1BI3 A;  3Q3S A;  2RRE A;  3F8C A;  3I3L A;  4Y4R A;  2L9R A;  3WU1 B;  1SFX A;  3OYN A;  3W2A A;  1OR7 C;  3BPV A;  4PFO A;  3K4C A;  3FMR A;  1BI2 A;  2R3S A;  3RKY A;  2IA2 A;  5ILV A;  2HS5 A;  4IKF A;  3E3V A;  1HBX G;  4EM0 B;  4CDG A;  3JRC A;  3EUK L;  1D8J A;  2ETH A;  5TJJ A;  3KP7 A;  2EFN A;  1VND A;  1WPK A;  1G2H A;  1ZGA A;  1QZZ A;  1VZ0 A;  1SMT A;  4AVP A;  2DA5 A;  4U7D A;  1TNT A;  4J01 A;  1IRZ A;  3P9C A;  2M0C A;  5DM7 F;  1TQP A;  2DFH A;  3G1O A;  1JE8 A;  3J81 K;  4CCJ A;  1R22 A;  1REP C;  1E3O C;  2NNN A;  4I2O A;  3WTZ A;  2LLK A;  1ZQ3 P;  1ZRE A;  1EF4 A;  2IT0 A;  6PAX A;  4RGX A;  1PUF B;  2D5V A;  2KKO A;  3FK7 A;  2EIL H;  5C4J J;  4BE2 A;  1WSU A;  3GF2 A;  2G7U A;  9ANT A;  4BJT A;  4E4H A;  2R7T A;  1X58 A;  4UY8 I;  4PGH A;  2FXA A;  4UB8 C;  5EEG A;  4BEH B;  3ZQH A;  2VBX A;  2OZU A;  1X4P A;  5JLW A;  1HF0 A;  1LJ9 A;  3V8J A;  3VPR A;  2DT7 B;  3W6K B;  2DFE A;  2LMD A;  3EYI A;  4MNU A;  3BCA A;  1XB4 A;  3OYC A;  2HXO A;  1WJB A;  3IWF A;  2NRA C;  3K4K A;  5GTI C;  2LVS A;  2ZXI A;  2W7N A;  1R6R A;  3HRS A;  1FYM A;  4B44 A;  3IAS 2;  4KYW A;  3ZGK A;  2DOE A;  2EIM H;  2FBK A;  3CMA I;  2QQ8 A;  1PUE E;  4MO7 A;  2O7O A;  5M3M J;  2DJI A;  4B3A A;  2HYJ A;  1OCT C;  4BXF A;  5CVR A;  1J75 A;  5J3L A;  4JX4 A;  2FRH A;  3VYS B;  4YIF A;  2VOD A;  1SFK A;  1W5T A;  3BJ6 A;  2VJI A;  2HWV A;  2M8E A;  1FSH A;  2PX9 A;  4ANJ A;  4OIO F;  3RTR A;  4LG0 B;  4E6K G;  1R1U A;  2Y2Z A;  1QQI A;  3T1B A;  1RUO A;  2GOX B;  3CCE I;  3KZY A;  1R1V A;  3DF8 A;  4I0A A;  3FM3 A;  4HDU A;  1MBG A;  2EFO A;  3CP2 A;  1H9T A;  3BCB A;  1E0E A;  1ZLJ A;  4PK4 A;  4XLE A;  1B6A A;  3ZQI A;  4EAT A;  5EG0 A;  2IA0 A;  5B3S H;  5CJ9 A;  2UXN A;  2YUS A;  2HOT A;  4BQO A;  2LH9 A;  4M73 A;  1D1C A;  4IRH A;  1XGN A;  4D0P A;  2EB7 A;  4DYR A;  2BY0 A;  1TWC J;  2CUF A;  2KHM A;  2BY2 A;  2LK2 A;  3CCU I;  2XPW A;  2LP0 A;  3G2B A;  5HNH A;  3K1M A;  3QP6 A;  1OCR H;  2XV4 S;  2WV1 A;  2KPM A;  2F5V A;  2WAQ A;  1FOW A;  3ERM A;  2R92 J;  2BYV E;  2DI3 A;  2L7K A;  1STZ A;  2MLK A;  3U21 A;  5B1A H;  3JRF A;  1P6R A;  2M3A A;  3FMQ A;  1FYL A;  1MJB A;  4IXA A;  4C3H J;  3ISP A;  4UV8 A;  1X2N A;  4ENN A;  4BU2 A;  4JBA A;  5LEJ A;  3L2U A;  1QBJ A;  2VC1 A;  1IO2 A;  3RZO J;  1FSE A;  3DLA A;  3P7N A;  3WE3 A;  2H1L A;  3O6B B;  3PFY A;  2ZXH A;  3O8G A;  3KYD B;  3OYM A;  4IHY A;  3GTQ J;  3CUQ A;  2XGX A;  2HQA A;  3VOD A;  2ZCW A;  5F6F A;  3BRO A;  4R8H A;  1G4D A;  1D3Y A;  2BE5 F;  3FIW A;  4EGY A;  1A36 A;  2QQA A;  2LY9 A;  3VB2 A;  2ICW G;  4XON A;  2B0L A;  3QQA A;  1E3P A;  4RAG A;  3COA C;  1ZYR F;  4KIS A;  3WG9 A;  2FE3 A;  4AC0 A;  2K9Q A;  1GV5 A;  2XSJ C;  3R61 A;  3I56 I;  4NC8 A;  1EKE A;  3GTO J;  3PNV A;  4DZJ A;  2G0E A;  4UNO A;  3ZMT A;  2M7B A;  1S5L C;  4LJZ F;  5FKN A;  2IEK A;  3DLL F;  2STT A;  2DU9 A;  2PQ8 A;  3QOD A;  4RB2 C;  5L3E A;  3DCF A;  2XHK A;  2JTV A;  1TL8 A;  2RKH A;  4A93 J;  5IP7 J;  4CA0 A;  1S3J A;  2KJB A;  3HBL A;  3HOV J;  1YJN I;  1MSE C;  2GXG A;  2ZME B;  4NQW A;  3CES A;  2BW3 A;  2JA5 J;  4KNY A;  5IOZ A;  4XOP A;  4DIQ A;  2XIG A;  2YSR A;  5DDG A;  1LNW A;  2QSF X;  5DV5 A;  2LBF A;  1A6I A;  2PBI A;  4WX9 A;  2IS1 A;  3J7Y J;  1G6N A;  5B66 C;  3CO6 C;  1R9T J;  2H8R A;  1DGW Y;  1WWX A;  3GME A;  4A2U A;  1N75 A;  4I01 A;  3H9G A;  4A0X A;  1JUM A;  5D5W B;  3WHC A;  4IRG A;  1YJW I;  3BT9 A;  5C4X J;  2JVH A;  3U2R A;  3D1N I;  5TIS C;  5J4Y A;  4ON0 A;  3V7C A;  4A69 C;  3J80 K;  5CQG A;  1ZGJ A;  4KIF A;  4BKX A;  2XF7 A;  2CGP A;  3NAR A;  2KDO A;  2UV1 A;  2O03 A;  3QYF A;  2DO7 A;  1HDP A;  2TRT A;  5EDN A;  1TBX A;  1ZN2 A;  5J47 A;  2XF5 A;  4LMY A;  3S93 A;  3S3O A;  1UJ8 A;  2PJP A;  2XC7 A;  3CLQ A;  2CQX A;  3IC7 A;  3GCM A;  3LSG A;  4BJ5 C;  3KLN A;  3FK6 A;  2A6T A;  2QKM B;  5CQE A;  2VBZ A;  2BXY A;  1MH3 A;  4G6T B;  3MZH A;  5FRN A;  2QGU A;  4CYC B;  1H9G A;  3D5R C;  5M3F J;  5FD6 A;  1DP3 A;  5LD2 C;  3KIO A;  3ECO A;  2MYS A;  3MWM A;  1XCB A;  1U5T A;  4FET A;  1Z6T A;  3G71 I;  3HHG A;  3Q0U A;  4FE7 A;  4GDF A;  3C2G A;  3GLX A;  3V8L A;  4PSX A;  2VE9 A;  3LSH A;  1G59 A;  4J00 A;  2ESH A;  2W57 A;  5E8G A;  1FMW A;  3BR3 A;  4U0W A;  2Y30 A;  4BAY A;  4AWX B;  4GO1 A;  2DA2 A;  1BA5 A;  4BE1 A;  4BQN A;  1U6G A;  2QKL B;  1K4T A;  1LUJ B;  4MQV A;  1ZHF A;  2P7C B;  3GTL J;  5LEK A;  1BI0 A;  2O9L A;  2Z16 A;  4XNF A;  2ADU A;  3WU0 A;  4QPO A;  4MFE A;  4AIK A;  1GV2 A;  3H35 A;  1XGM A;  2ZME C;  5AIQ A;  5E17 F;  5ICC A;  2X85 A;  1AOY A;  3W6V A;  2FQ4 A;  3S14 J;  1TTY A;  2IPQ X;  4IQ4 A;  3D5L A;  2PI0 A;  2IGM A;  3BWG A;  3BR5 A;  2MH9 A;  4Q4Z F;  1FX7 A;  1SVL A;  3AG4 H;  4XN0 A;  5GPA A;  2KIM A;  2VBY A;  2XAQ A;  1RC9 A;  2XUB A;  4BL0 B;  4KUM A;  2K4B A;  2H94 A;  3G1L A;  1LVA A;  2HQN A;  4O6J A;  1R49 A;  3F6O A;  3ABM H;  1YO5 C;  2DFF A;  3K10 A;  3H36 A;  4MTE A;  3ZR8 X;  1ZRF A;  5A2Q K;  1B72 B;  3HOU J;  3I9V 2;  4B43 A;  2YX7 A;  4BGD A;  3CO7 C;  4KT5 C;  4EEF G;  1JHF A;  5HS8 A;  4Y3O A;  4IZZ A;  1R4N B;  4OMZ A;  3WTV C;  3PL8 A;  3J81 Z;  5HOD A;  1IN4 A;  4HDV A;  2FNP A;  4MHG A;  3ZMD A;  2GA2 A;  2HU9 A;  3OYK A;  4XQF A;  2OUM A;  2QUF A;  2GXA A;  1S7A A;  3LFU A;  2O8K A;  3OYF A;  2CWE A;  1EV7 A;  2NS0 A;  2NXN B;  4M9X A;  4DJA A;  5HLG A;  2KRC A;  4ENM A;  3BJA A;  4ESF A;  5E1X A;  1X1B A;  2GBY A;  4KMF A;  1HKQ A;  1D8K A;  1KON A;  1TWA J;  1IRG A;  4XSZ F;  1OR7 A;  1D1B A;  3MCZ A;  4A3J J;  1Y0N A;  2MC3 A;  3A01 A;  2A6E F;  5CVV A;  5IYB J;  1O4X A;  2ZFU A;  2P8T A;  4L0Z B;  4XLC A;  2L3D A;  5HLT A;  2AXT C;  2EIK H;  4C2M J;  4DBQ A;  4P9F A;  2CV2 A;  2Z1D A;  3AG2 H;  3QPL A;  3REO A;  4XBF A;  3U1K A;  4RA2 A;  4PJL A;  1Z1D A;  2HI3 A;  2Q1Z B;  2VBW A;  1H8A C;  1OYW A;  4ESJ A;  1T98 A;  3CMY A;  1HLV A;  1B8I A;  1LQ1 A;  5IT3 A;  2VUM J;  2KIQ A;  3F8F A;  3I5U A;  1S6L A;  3JSP A;  3QPS A;  2TDX A;  2WAE A;  4LLL A;  4UV9 A;  4F7Z A;  2P0W A;  2WC2 A;  3AFH A;  5EEA A;  2C6Y A;  1UHS A;  2DW4 A;  5LGU A;  2DOF A;  3K7A J;  3LL7 A;  4BDY A;  3QPT A;  2VL8 A;  2AQE A;  1MDM A;  2VPR A;  2QF7 A;  4KN7 X;  1YI2 I;  1FOK A;  2YS9 A;  1T0F C;  3C1D A;  3HDD A;  1YIO A;  1FLI A;  2K3F A;  2DMU A;  1A04 A;  1P9Q C;  2XB0 X;  4EM2 A;  2FD5 A;  1TT0 A;  3KYC B;  5F0C A;  1JTY A;  3GFM A;  4RB3 C;  2A69 F;  1XTA A;  5FRO A;  4PJ0 C;  1LE8 B;  1Q1H A;  3I53 A;  5FKK A;  2CW0 F;  2UUZ A;  3HKZ A;  3O8H A;  1PDN C;  1TW2 A;  1ENH A;  3FXU A;  3G73 A;  2GAU A;  3NWT A;  2V4J C;  4E7I A;  5ICF A;  2HGC A;  3LSK A;  4JOM A;  2CUZ A;  1D0Z A;  1FBS A;  2HPM A;  5EGO B;  3C2H A;  4V2G A;  1ZAR A;  3CZ6 A;  5FRM A;  4RMN A;  1XG1 A;  3HTS B;  3OSG A;  4ZDL A;  2QYO A;  2L4M A;  3BR0 A;  4UHT A;  2WA0 A;  3GXO A;  2JPC A;  1DUX C;  2ZC2 A;  3KFW X;  1R5H A;  1UB9 A;  2JN6 A;  5BS6 A;  1VQ4 I;  4L5E A;  2NYX A;  2M0M A;  3DKW A;  2B9S A;  2OJE D;  2CRG A;  4XLH A;  1RES A;  2R5Z B;  1EJ9 A;  2H27 A;  4Y33 A;  4YEJ A;  2HEO A;  4AIH A;  2J5O A;  1S7E A;  4HW0 A;  4S04 A;  2CFO A;  2RDP A;  3HUG B;  1IUY A;  3BY6 A;  2ZNY A;  2DT5 A;  3LNQ A;  3FXK A;  1OCO H;  1MW7 A;  3MZ8 A;  5JI6 A;  1PUF A;  4UUS B;  1T56 A;  2FX0 A;  1YW8 A;  4CUG A;  2R7R A;  2EZK A;  4N0B A;  4Z2Y A;  1I5Z A;  3CME I;  2M1B A;  3BZK A;  3BR6 A;  4N4N B;  3HJE A;  2PN6 A;  1JJ8 C;  2FUG 2;  1JHH A;  2ACJ A;  1MMA A;  3SQN A;  1RI7 A;  3ZMZ A;  1H88 C;  1SFO J;  1BJA A;  4II2 A;  5K7F A;  2DT6 A;  3W6J B;  5EF6 A;  3EDP A;  2EV6 A;  1FNN A;  2O0Y A;  4Y52 J;  1POG A;  3DPU A;  3ELK A;  4RGU A;  1MBJ A;  3ESW B;  3CDI A;  4BNC A;  3CUO A;  3OYI A;  2HDD A;  2BY3 A;  3L00 A;  4CSW A;  5E8I A;  3I64 A;  3L2R A;  2HTS A;  3E5U A;  3S1N J;  1A6Q A;  2F4I A;  1D1A A;  1ZG1 A;  2A68 F;  2LNB A;  5EJC A;  3J80 Z;  2EWN A;  3CF2 A;  1ON1 A;  2A05 A;  2VI6 A;  2DA1 A;  2E7X A;  2VQC A;  1OKR A;  3M9A A;  1V5E A;  4YRV A;  2DDA A;  2LFB A;  1FY7 A;  1WQ2 A;  2KRH A;  3V8K A;  2GZW A;  4NC7 A;  2EV5 A;  2MD0 A;  4L9N A;  3K70 C;  5D5U B;  2OQR A;  1UEL B;  4ZZL A;  4ZH4 F;  3LFK A;  3HM5 A;  2CW8 A;  4IOA F;  2QBY B;  1RR8 C;  2ZKZ A;  3GZ6 A;  4AUX A;  2R5Y A;  2X1E A;  3CCJ I;  1U9N A;  5D8K B;  4FT8 A;  4CZC A;  2HKO A;  3B6C A;  3CCV I;  1LPQ A;  4O3M A;  4NBQ A;  1IDZ A;  2MGQ A;  4PJM A;  2EFP A;  4YFN F;  5LHI A;  4I76 A;  3F9K A;  4JQF A;  5D6E A;  1RRJ A;  2E1O A;  3D0S A;  1I6H J;  2F48 A;  2R7U A;  1YLF A;  2QM3 A;  3MEX A;  4M3G A;  4P5O A;  2Z5U A;  1TC3 C;  4XID A;  5D5X B;  4I98 B;  5HS7 A;  4WWC A;  1QHG A;  1P7J A;  1IUF A;  3T5X A;  2HTJ A;  5J1R A;  5D6F A;  4GFB A;  5FKM A;  1Z7U A;  2QVO A;  1RIO H;  4CH7 A;  5CVI A;  5EZG A;  1KYZ A;  2HZT A;  3E97 A;  3CP8 A;  5DEQ A;  1K6O A;  4XKC A;  4IQJ A;  1LKX A;  4A6D A;  4A6E A;  2PJR B;  2VXZ A;  1MMN A;  3S2H J;  5LGT A;  4MTD A;  1X1P A;  4TV7 A;  1BL0 A;  4XOT A;  2HOS A;  1Z3X A;  2R0Q C;  1Z91 A;  4IOC F;  1GLN A;  3CJN A;  5IYD J;  2OPT A;  1RET A;  2H1K A;  1FC3 A;  2QQB A;  2PG4 A;  4LFU A;  1MGT A;  1RNL A;  4PZJ A;  2BHY A;  4HV6 A;  5A2Q Z;  2K85 A;  1ZGW A;  4KIC A;  1F1Z A;  1VQ7 I;  3B02 A;  1ZR4 A;  2JA8 J;  2XPU A;  2Y31 A;  1R4M B;  1KGS A;  2EZH A;  2LSO A;  3S2W A;  4AVZ A;  3BG3 A;  1EH8 A;  1VTN C;  2M30 A;  5H20 A;  3RCO A;  2IRF G;  2GIZ A;  1JT0 A;  1ETK A;  4PJJ A;  4OIQ F;  2E71 A;  3ZPL A;  2GQQ A;  2BEO A;  3Q0V A;  2ZME A;  1BM9 A;  5L3C A;  3L2W A;  1JGG A;  1QZY A;  3H92 A;  2VB6 A;  2CH0 A;  2DQL A;  2ZO4 A;  2TCT A;  1IN6 A;  2GOM A;  3DEW A;  1W7P B;  5HOO A;  2MD5 A;  3FBN B;  4NNJ A;  2XRN A;  3IRR A;  3RQI A;  4J19 A;  2WWY A;  5E20 A;  5DTD A;  3Q5F A;  3HG9 A;  1YX5 A;  2LKS A;  1V5F A;  3I58 A;  5F08 A;  2DN0 A;  1E2X A;  2CQ7 A;  2Y9Y A;  1ODD A;  4KJZ A;  2MH2 A;  4KIB A;  3ZMU A;  2I10 A;  2LC2 A;  4BY7 J;  5ERI A;  4G7Z F;  3DTE A;  3FKJ A;  5M5Y J;  2H09 A;  4RM3 A;  3T8R A;  1UG0 A;  3S3M A;  4GYG A;  4C3J J;  4OWR B;  3KEO A;  3K70 D;  5EZH A;  5FKL A;  2JMW A;  1O3S A;  2VKE A;  3PJR A;  4F52 A;  4RB1 A;  1PP7 U;  2OA4 A;  4LD5 A;  1QPI A;  3FXJ A;  5E3N A;  2GXB A;  2CQQ A;  1O7L A;  4G6D A;  1P7I A;  1XC5 A;  5ILS A;  2HR3 A;  3TO7 A;  3HSE A;  2ELJ A;  3VEP A;  2DXI A;  3IHU A;  4ESB A;  2DJN A;  4R1H A;  1YS6 A;  5LGN A;  4OAY A;  1HSJ A;  5FLX K;  3ML6 A;  5DYM A;  5IP9 J;  2E19 A;  4RAF A;  3MAJ A;  4OOI A;  3C7J A;  1G3W A;  5DUI A;  5C44 J;  3MKW B;  4FCY A;  1U2W A;  2DOA A;  3QU3 A;  2V9P A;  1MNE A;  2OCC H;  1QZE A;  2M4K A;  1NG7 A;  2WV0 A;  1F9N A;  1IAW A;  1YG2 A;  2ZFW A;  4OAZ A;  1QVT A;  1YS7 A;  2D1H A;  1L3L A;  2AS5 F;  3SYT A;  4G9Y A;  3IH4 A;  3K0L A;  2LRE A;  3BPX A;  4D1Q A;  1JKQ C;  4Q5S F;  4F91 B;  5GPC A;  2AQF A;  3GLL A;  4JP0 A;  1B59 A;  3KET A;  4OIP F;  5ICE A;  3SZT A;  2KQR A;  1JKO C;  1L0O C;  3DPL C;  4PCQ A;  2E7W A;  4MEY F;  2P6S A;  5L3F A;  2HZD A;  2Q2E B;  3LA7 A;  4CCK A;  1Z77 A;  4M72 A;  3FXM A;  2V1U A;  5GAD J;  4C2T A;  1HXD A;  4HPQ A;  2OF7 A;  5M5X J;  1YX3 A;  1T0F A;  2K02 A;  1A5J A;  2HOE A;  1P4X A;  5JLX A;  4ETS A;  1W0T A;  3ABK H;  3ABT A;  3PO2 J;  1J59 A;  3KCC A;  4S0H B;  2XRO A;  1WCM J;  1B72 A;  4IHS A;  3RKX A;  3HC7 A;  1OPC A;  3OYE A;  2W25 A;  2Y0M A;  1GHC A;  2EZL A;  2X1C A;  2X9D A;  1X4O A;  1XS9 A;  1IF1 A;  4HNU A;  3EQL F;  1IN7 A;  3LWF A;  3GTG J;  1NHA A;  1XDU A;  2WAF A;  2RN7 A;  3SFI A;  3OS2 A;  3JRE A;  3CC2 I;  3KP4 A;  3ECH A;  3U1D A;  3QYB A;  4ABZ A;  3NWS A;  1ONV A;  2LRD A;  3DWL E;  1ZKG A;  5E79 C;  3MD2 A;  2DPU A;  1JGS A;  1BBY A;  2F4O B;  3FX3 A;  1S9H A;  4E7S A;  2Y9Z A;  3PSI A;  5H6R A;  3EET A;  2NNY A;  1JKR C;  5HVQ C;  3F72 A;  2JJ7 A;  2R7V A;  4Z6Y A;  3MMY B;  3L09 A;  1KZH A;  3BC8 A;  1XGO A;  4MFD A;  1SFU A;  2UWM A;  2RQP A;  2E1N A;  1KU2 A;  2OC6 A;  1VQ6 I;  2YR2 A;  1O3Q A;  4YG2 F;  4LLN A;  2O61 A;  3GTP J;  4HX4 A;  1Y39 A;  2DYS H;  2P81 A;  3OSF A;  2DTR A;  4ZJZ A;  2LDU A;  3L2C A;  3ABU A;  3R4K A;  1ZR2 A;  1Z9C A;  1Y8R B;  3SZG A;  1PP8 F;  2F5C A;  1FMV A;  1ZLK A;  1PVE A;  4U0Y A;  1K78 B;  2LYC A;  4A3E J;  1YRN B;  3M4O J;  4EJV A;  1CF7 B;  1NG6 A;  1O3R A;  2E5Z A;  1G3Y A;  4QSH A;  1GVJ A;  4FX4 A;  3RKQ A;  3SXY A;  4XSX F;  4QPQ A;  2DDB A;  3SDB A;  1FJL A;  1R7J A;  2GIV A;  5J40 A;  3HSF A;  1MSF C;  1X3Z B;  1E3H A;  4C3I J;  3RDI A;  5F1R A;  4QIW N;  3R60 A;  1ERD A;  1B9M A;  3S1R J;  2ME6 A;  3KP5 A;  4NUB A;  2COM A;  3F8N A;  4A5N A;  4LB5 A;  2IJL A;  2M5W A;  1LFB A;  3HIF A;  2JZY A;  2KDZ A;  2ID6 A;  3BP8 A;  5J4V A;  4UVC A;  3JRH A;  1A35 A;  3I0T A;  2E5N A;  4UVA A;  3GX4 X;  5IPA A;  4BJ6 C;  4M9S A;  1HQC A;  1P2F A;  4CCO A;  1LE8 A;  2IW5 A;  2HYF A;  3FXR A;  2HKX A;  3FHN A;  4W1U A;  3F8M A;  2JQ7 A;  1D0Y A;  5KNL A;  3LAJ A;  3F23 A;  1ETV A;  1XMX A;  1G3T A;  3FHZ A;  3VDX A;  3SJM A;  2EZI A;  3IKT A;  4N4O B;  3MVP A;  5F27 A;  5KVR A;  4S05 A;  5L3D A;  3MKY B;  3OY9 A;  2R7W A;  3ZQG A;  4G8X A;  4BQQ A;  5CVJ A;  4MEX F;  5FFX A;  2JUG A;  4FAS D;  1X1D A;  3A0H C;  3ERE D;  4RLF A;  3TDZ C;  4IEJ A;  5LHH A;  2VJ5 A;  2ESN A;  1WJD A;  5J1Y A;  1QVU A;  3CJT B;  3JTG A;  1I39 A;  2BHZ A;  1I1S A;  1PYV A;  1S29 A;  2L01 A;  5ILU A;  1EH6 A;  4AYB A;  3WTY C;  2STW A;  3FXO A;  3LOC A;  4L5I A;  4XLP F;  2R5Z A;  2L02 A;  2FSW A;  2M8G X;  4ZDP A;  3HB9 A;  1BW6 A;  3CJQ B;  5BOX A;  3L1P A;  5D4S A;  1TW3 A;  4CCN A;  2AHQ A;  3HUG A;  3BTC A;  5FKO A;  2CUE A;  4XKV A;  4HX8 A;  1IRF A;  4XK4 A;  4IVN A;  2K9N A;  4UUS A;  1GT0 C;  5DCF A;  4BE0 A;  2VQH A;  2E36 A;  3F22 A;  1XMA A;  4OIR F;  3T0Y A;  2JVG A;  1HA8 A;  1UZC A;  1XD7 A;  4IF4 A;  3VSL A;  1XGS A;  3RPQ A;  3DBH B;  4IX7 A;  4B3X A;  1H0M A;  5DS9 A;  3LAP A;  1AWC A;  1VQP I;  5DD8 A;  5BQT A;  2FMY A;  2Y75 A;  2FBH A;  5E3M A;  2JA2 A;  4U87 A;  2KJC A;  3HRU A;  5BNG A;  3GO5 A;  5K5O A;  1FIA A;  1PJR A;  3UKG A;  5AIP A;  4E7Z A;  4P55 A;  1OFC X;  4EQQ A;  4IRI A;  3U9G A;  4LG3 A;  1IRX A;  2K7L A;  1WH5 A;  3JR9 A;  2L7F P;  3LQR A;  4RGS A;  3E6B A;  1YQA A;  1SD6 A;  1IDY A;  4B1R A;  4DOZ A;  4C2U A;  5K1Y A;  3F8B A;  3K69 A;  2CSO A;  2DMN A;  3FIS A;  1QU3 A;  2DK5 A;  3VOE A;  4IL6 C;  3WGH A;  1X19 A;  4OMY A;  2LOO A;  3V7S A;  4HZF A;  3GFL A;  1TLH B;  2O3F A;  2V1X A;  1SEU A;  5E18 F;  2GM4 A;  1IXS B;  2E1M B;  3M7G A;  2KLO A;  3O3K A;  3OV8 A;  4LIU A;  2R7S A;  2QCO A;  1ZTR A;  3S16 J;  3IH2 A;  3VFZ A;  2JK3 A;  1QRY A;  5HLH A;  1HKT A;  2LG4 A;  1GUU A;  3FZV A;  2Y0S N;  3CDH A;  3HPH A;  4B4C A;  4HX7 A;  1A31 A;  3KZI C;  5J6X A;  3E7L A;  1HOM A;  1HW1 A;  4P9U A;  4IJA A;  5FLX Z;  3I71 A;  2BVL A;  5H2F C;  2HDC A;  2BOL A;  1WZ2 A;  2FJ1 A;  2VXD A;  4CGZ A;  4ZYE A;  1W5S A;  5LRS A;  3I59 A;  4U88 A;  4B8X A;  4Y7N J;  2BVM A;  2BXZ A;  4MGR A;  5EG0 B;  1BC7 C;  1WJ5 A;  3LST A;  3AL0 B;  2FA5 A;  4PSW A;  3LMM A;  3K4B A;  1XCV A;  4XMY A;  1R71 A;  4LK0 F;  3QOE A;  5E3O A;  3S15 J;  4FX0 A;  2PJR A;  4BS9 A;  2NVY J;  3F3X A;  3PUB A;  2P5K A;  3C3W A;  5D8L B;  2KIS A;  1SAX A;  1M1E B;  3QYE A;  1AU7 A;  3JTH A;  4GCV A;  1OCZ H;  2VJJ A;  3PNT A;  2A5W A;  1DPU A;  2ZJR F;  2DYR H;  3IH3 A;  3MKL A;  1TP4 A;  5FB2 A;  1LVK A;  1BW5 A;  2RGV A;  2E1C A;  3DU6 A;  3PQJ A;  2ECB A;  2HQ5 A;  3MN2 A;  3M3Y J;  2ZXW H;  1LDK B;  3OOU A;  4HQE A;  1UHM A;  4Y15 A;  1W0U A;  2NS7 A;  1R1T A;  3DXJ F;  1GXQ A;  3CDL A;  2F5F A;  3DPT A;  2X51 A;  3FKI J;  1VI0 A;  1Z0X A;  4XOR A;  2AO9 A;  3J7Z I;  3OR1 C;  2ZBK A;  3VSK A;  3HPG A;  2K9S A;  1HW2 A;  2OZ6 A;  3HOT A;  1WJE A;  2CJJ A;  3SHF A;  2ID3 A;  2I8D A;  3CCM I;  1X2M A;  2HVQ A;  3OOP A;  4N9H A;  3TOB A;  2A3S A;  1Y6I A;  2DAO A;  3BR2 A;  3TL4 X;  1GXP A;  4A5M A;  3KLO A;  3NAU A; 
#chains in the Genus database with same CATH homology
 4G6Q A;  1YTY A;  1W7P A;  4XRF A;  3FXQ A;  1T6S A;  1SD5 A;  3ZN0 A;  3WOD F;  3L9F A;  2EFW A;  3J7A O;  2FML A;  5CYV A;  2QEN A;  2EK5 A;  4GYI A;  4RB0 A;  1IZ1 A;  2ZJ2 A;  1S8N A;  4LLG F;  1HST A;  2ZNZ A;  1BOA A;  2CG4 A;  3WTS C;  1HW5 A;  1P4W A;  3WTW C;  4BHB A;  5DCM B;  4I09 A;  1KA8 A;  1KU3 A;  3TGN A;  3QP5 A;  3SZP A;  1B4A A;  1SMY F;  3FWE A;  4CIC A;  4M71 A;  2A6H F;  3HTU A;  1IXR C;  5FGM A;  1U5T B;  4UVB A;  4G94 A;  3LA2 A;  4RGR A;  5K5R A;  3ZQ7 A;  3TQN A;  4BHP A;  2Q2E A;  4ZYH A;  4KA4 A;  2P4W A;  5J8F A;  2DFI A;  2KRF A;  3C18 A;  1R23 A;  4LG0 A;  3L7W A;  3I54 A;  1R5G A;  3GFJ A;  2CO5 A;  2O8X A;  2EA4 A;  2CQK A;  3FMS A;  3JAM K;  1YYV A;  1CGP A;  5LRR A;  3FM5 A;  5BPI A;  1OYI A;  3TO9 A;  4O5V A;  1FYK A;  1J2X A;  2V79 A;  5D5V B;  3GFI A;  1MZB A;  1TQM A;  1WRJ A;  1TNS A;  4XLN F;  1LB2 A;  3WE2 A;  2EFQ A;  2GWR A;  1KU7 A;  3ULQ B;  5FFZ A;  2HFH A;  4WK8 F;  1J7K A;  1XMK A;  2QWW A;  3RI4 A;  4WF2 A;  1DDN A;  2IVM A;  3IWZ A;  4HF1 A;  2R7D A;  1ZG3 A;  2P7V B;  3M1E A;  2YU3 A;  1HKS A;  1I6X A;  3DEU A;  3DV8 A;  2X0L A;  1V4R A;  4R79 A;  4YII A;  2ISZ A;  4IHT A;  1BIA A;  2YPR A;  3E6D A;  2X4H A;  4EM1 A;  1IN5 A;  1MDM B;  3DQV C;  4OU0 A;  3ROU A;  3AAF A;  1USS A;  4WXH A;  2VN2 A;  3IRQ A;  3P9K A;  2H6B A;  1J9I A;  1LEB A;  2LF8 A;  1SD4 A;  2EA2 A;  2FF4 A;  4HF0 A;  3NQO A;  5HLI A;  2IA1 A;  1JXS A;  2BV6 A;  2FU4 A;  3GYH X;  1B9N A;  2FBI A;  3I4P A;  2A61 A;  1QPM A;  4KMU X;  1FZP B;  1R00 A;  2CYY A;  4Q47 A;  2RV8 A;  3HRT A;  3K1N A;  3ZMS A;  1U3E M;  4HAM A;  1MJ9 A;  2PLY A;  4WXD A;  2XKO A;  2EJR A;  2M45 A;  4P96 A;  3ZMV A;  1S7O A;  4E70 A;  2XAF A;  3E6C C;  4ENJ A;  3IL2 A;  2BBY A;  1UHW A;  1OMI A;  4AD9 A;  4LK1 F;  5E1W A;  1UFM A;  1MJA A;  5FD5 A;  5BPD A;  3GEZ A;  3E5X A;  5F64 A;  4I7H A;  3N97 A;  3RJP A;  2VT3 A;  4CO8 A;  4AIJ A;  3FF5 A;  3HSR A;  4ZYD A;  3WGG A;  3CTA A;  1P4A A;  2K86 A;  1XDS A;  4EV0 A;  3RYP A;  2W24 A;  1T38 A;  4PDK A;  2J5P A;  4EVI A;  4CYD A;  2MBF A;  3O2P E;  1UST A;  4I0B A;  4MQ9 F;  3R6S A;  1FP1 D;  2H6C A;  4KIG A;  3BZ6 A;  3GW2 A;  4B09 A;  1B1B A;  3HHH A;  1ON2 A;  1LDJ A;  2P6T A;  3Q9S A;  1DP7 P;  5DD4 A;  1Z6R A;  4M6Y A;  1R58 A;  3KZZ A;  3TOA A;  3LQQ A;  3QRF F;  2F5E A;  2D2W A;  3R0J A;  1FWZ A;  1V3F A;  3RYR A;  2MLG A;  2NAZ A;  2Z3Y A;  4ASN A;  4HYE A;  3GUD A;  1KQ9 A;  3DFG A;  3RIR A;  1XSV A;  2OD5 A;  1W4M A;  1G3S A;  3WTT C;  4WXC A;  1FPQ A;  3TKY A;  1FBQ A;  1XSX A;  2JRT A;  5LHG A;  1O3T A;  2QZ8 A;  5CVU A;  4HV5 A;  1MKM A;  3BOQ A;  2XKP A;  5H6Q A;  2FNA A;  1QO0 D;  4RAZ A;  1O57 A;  1U8R A;  4JK1 X;  4CHU A;  1KQ0 A;  2UZK A;  3WTU C;  5HDN A;  2Q8K A;  5BMZ A;  3JAM Z;  3BDD A;  4WCG A;  2K27 A;  1I27 A;  2Z33 A;  1MD0 A;  3GVA A;  3K9T A;  2JSC A;  2R7F A;  2KIU A;  1BI1 A;  2OQG A;  2A07 F;  4FHT A;  1W7P D;  2OBP A;  5HDK A;  3JSO A;  2HYG D;  4PGG A;  3N4M A;  4N9I A;  2P5V A;  2AXL A;  4HBL A;  3V7R A;  5EEH A;  4EMS A;  5J8C A;  4QWQ A;  1Z05 A;  2UXX A;  5K5Q A;  5DCM A;  2MA3 A;  2DBB A;  5DUK A;  2F5D A;  2KIF A;  1FP2 A;  2FEZ A;  2YX4 A;  3Q9V A;  4CXF A;  1YW7 A;  2JT1 A;  3K1P A;  3F6V A;  1O7F A;  2OAZ A;  2QQ9 A;  1Y0U A;  3K2Z A;  1BN5 A;  4L5J A;  2XAJ A;  5FO5 A;  4Y17 A;  2LF7 A;  4HLX A;  2PMU A;  1T2K A;  2L54 A;  4EJU A;  1ZRD A;  4H0E A;  3KE2 A;  4A0Y A;  2OU2 A;  4EJT A;  1J5Y A;  3WGI A;  2Y48 A;  4KDP A;  5IT9 K;  4YFK F;  1WI9 A;  2LKP A;  1IXC A;  2VON A;  2W84 A;  4UXN A;  4A12 A;  4KN4 X;  2QBY A;  2RVC A;  4GXO A;  3WTX C;  1E17 A;  4NB5 A;  3PFI A;  2WTE A;  4ZZD A;  1UCR A;  3M8F A;  3CLO A;  3QOP A;  3E5Q A;  2QLZ A;  2PMH A;  3RKW A;  1F4K A;  1X3U A;  1XN7 A;  3ZN1 A;  5L3B A;  4L9V A;  5TRD A;  4HF2 A;  2ELH A;  1T39 A;  2EV0 A;  3MFK A;  3RPU A;  3DP7 A;  5HS9 A;  1SD7 A;  2DQR A;  2M87 A;  2VE8 A;  4BHC A;  2PFB A;  5L3G A;  2VOO A;  1R36 A;  5AON A;  1C0W A;  3CUQ B;  3MZY A;  1ZG5 A;  3KP3 A;  3NEU A;  1RZ4 A;  3TO6 A;  3IKV A;  3G3Z A;  1SFE A;  1BC8 C;  1OYY A;  2HQR A;  2A5Y B;  1U78 A;  5HDG A;  2F2E A;  1KU9 A;  4Y13 A;  1J0R A;  5D4R A;  2XVC A;  2Q0O A;  2Z9O A;  1P92 A;  1I1G A;  4RAY A;  3GWZ A;  3EUH A;  3E6M A;  4DQ2 A;  1FBU A;  3KEQ A;  1YFH A;  2GA1 A;  5LBQ A;  4M74 A;  2XAS A;  1D5V A;  4U7B A;  5CLS A;  4EJO A;  2G7H A;  4DNC A;  3V4G A;  4LB6 B;  1WKM A;  1ZRC A;  1K7A A;  1LDD A;  4G7H F;  2Z99 A;  2VT2 A;  2XAH A;  2K4J A;  2FQ3 A;  2V1D A;  3HYI A;  1XSD A;  1RUN A;  1IW7 F;  3KP2 A;  3ZP5 A;  4U0V A;  3CUQ C;  3B73 A;  4YFX F;  5JVT A;  2D45 A;  3PQK A;  4L0Y B;  1IN8 A;  3QAH A;  1TQI A;  2VOP A;  1KQ8 A;  4BYY A;  2V9V A;  5JR3 A;  4L18 B;  4IPA A;  4OIN F;  3F21 A;  3MQ0 A;  4EJW A;  4K2E A;  1K79 A;  2XAG A;  5ICG A;  2DPD A;  1ZH5 A;  4RS8 A;  2DK8 A;  4HA8 A;  5ED4 A;  4BQA A;  3M8E A;  5LLQ A;  3QPH A;  2O6G E;  3HRM A;  4NHJ A;  2VC0 A;  2G9W A;  3BJO A;  4HLY A;  2RC4 A;  3QU6 A;  4QLC U;  3KP6 A;  3GZ5 A;  4M9Z A;  4G7O F;  3T8T A;  2PEX A;  4UUV A;  4CZZ A;  2DLL A;  2V6C A;  5E1Z B;  2BGC A;  1DPR A;  1U5T C;  1K78 A;  2ZXJ A;  4I02 A;  3JW4 A;  3I59 B;  1CF7 A;  1EH7 A;  2IP2 A;  4L9J A;  1QGP A;  2D1V A;  4L9T A;  3SFZ A;  4BXU A;  4HOB A;  2W85 A;  3HOS A;  1BIB A;  5IT9 Z;  1ULY A;  2L4A A;  5JFR A;  3P9I A;  2CFX A;  5KK1 A;  3NRV A;  4Q48 A;  5JHU A;  4ZYG A;  4A0Z A;  4BH9 A;  3R0A A;  1F5T A;  1FT9 A;  1ZAO A;  2RNJ A;  1LEA A;  2JPB A;  4GGG A;  4M6X A;  3TDU C;  4EGZ A;  4LGW A;  3LA3 A;  2FOK A;  4KFC A;  4HQM A;  2ISY A;  1QNT A;  3EYY A;  2P5L C;  3H3Z A;  4ENK A;  1YW9 A;  1KYW A;  3H3U A;  1BI3 A;  3F8C A;  3WU1 B;  1SFX A;  3BPV A;  3FMR A;  1BI2 A;  2R3S A;  3RKY A;  2IA2 A;  5ILV A;  2HS5 A;  3E3V A;  1HBX G;  4EM0 B;  4CDG A;  1D8J A;  2ETH A;  5TJJ A;  3KP7 A;  2EFN A;  1ZGA A;  1QZZ A;  1SMT A;  4AVP A;  4U7D A;  1TNT A;  3P9C A;  1TQP A;  1JE8 A;  3J81 K;  1R22 A;  1REP C;  2NNN A;  4I2O A;  3WTZ A;  1ZRE A;  2IT0 A;  6PAX A;  4RGX A;  2KKO A;  1WSU A;  3GF2 A;  2G7U A;  4PGH A;  2FXA A;  5EEG A;  2VBX A;  2OZU A;  1LJ9 A;  3V8J A;  3W6K B;  3EYI A;  4MNU A;  1XB4 A;  3IWF A;  2NRA C;  3HRS A;  1FYM A;  4KYW A;  2FBK A;  1PUE E;  1J75 A;  5CVR A;  2FRH A;  4YIF A;  2VOD A;  3BJ6 A;  1W5T A;  2HWV A;  2M8E A;  1FSH A;  4OIO F;  3RTR A;  4LG0 B;  1R1U A;  1QQI A;  3T1B A;  1RUO A;  3KZY A;  1R1V A;  3DF8 A;  4I0A A;  3FM3 A;  4HDU A;  2EFO A;  1H9T A;  1ZLJ A;  1B6A A;  2IA0 A;  5CJ9 A;  2UXN A;  4M73 A;  4IRH A;  1XGN A;  4D0P A;  2EB7 A;  3K1M A;  3QP6 A;  2XV4 S;  2BYV E;  2DI3 A;  1STZ A;  2MLK A;  1P6R A;  1FYL A;  3FMQ A;  1MJB A;  4IXA A;  3ISP A;  4UV8 A;  4ENN A;  5LEJ A;  4JBA A;  1QBJ A;  2VC1 A;  1FSE A;  3P7N A;  3WE3 A;  3O6B B;  3CUQ A;  2XGX A;  3VOD A;  2ZCW A;  5F6F A;  3BRO A;  4R8H A;  1G4D A;  1D3Y A;  2BE5 F;  4EGY A;  2QQA A;  3VB2 A;  2B0L A;  3COA C;  1ZYR F;  3WG9 A;  2FE3 A;  3R61 A;  4UNO A;  3ZMT A;  4LJZ F;  2STT A;  2DU9 A;  2PQ8 A;  4RB2 C;  5L3E A;  2XHK A;  2JTV A;  2RKH A;  1S3J A;  2KJB A;  2GXG A;  2ZME B;  4NQW A;  4KNY A;  2XIG A;  2YSR A;  5DDG A;  1LNW A;  5DV5 A;  2PBI A;  4WX9 A;  1G6N A;  3CO6 C;  1WWX A;  4A2U A;  4I01 A;  4A0X A;  5D5W B;  4IRG A;  3U2R A;  4ON0 A;  3V7C A;  3J80 K;  1ZGJ A;  4KIF A;  2CGP A;  2O03 A;  2DO7 A;  1TBX A;  1ZN2 A;  4LMY A;  2PJP A;  3IC7 A;  3KLN A;  2VBZ A;  3MZH A;  1H9G A;  5FD6 A;  3ECO A;  3MWM A;  1XCB A;  1U5T A;  1Z6T A;  3HHG A;  3V8L A;  3GLX A;  2VE9 A;  2ESH A;  2W57 A;  5E8G A;  4U0W A;  4BAY A;  4AWX B;  4GO1 A;  1U6G A;  4MQV A;  1ZHF A;  2P7C B;  5LEK A;  1BI0 A;  2ADU A;  3WU0 A;  4AIK A;  1XGM A;  5AIQ A;  5E17 F;  5ICC A;  1AOY A;  1TTY A;  2IPQ X;  3D5L A;  2PI0 A;  3BWG A;  2MH9 A;  4Q4Z F;  1FX7 A;  2KIM A;  2VBY A;  2XAQ A;  2XUB A;  4KUM A;  2K4B A;  2H94 A;  1LVA A;  2HQN A;  4O6J A;  3F6O A;  1YO5 C;  4MTE A;  1ZRF A;  5A2Q K;  2YX7 A;  3CO7 C;  4KT5 C;  1JHF A;  5HS8 A;  4OMZ A;  3WTV C;  3J81 Z;  1IN4 A;  4HDV A;  2FNP A;  4MHG A;  3ZMD A;  2GA2 A;  2QUF A;  1S7A A;  2CWE A;  1EV7 A;  2NS0 A;  5HLG A;  4M9X A;  4ENM A;  3BJA A;  4ESF A;  5E1X A;  4KMF A;  1HKQ A;  1D8K A;  1IRG A;  4XSZ F;  1OR7 A;  3MCZ A;  2MC3 A;  2A6E F;  5CVV A;  2P8T A;  4L0Z B;  2L3D A;  4P9F A;  4XBF A;  3REO A;  1Z1D A;  2VBW A;  1OYW A;  4ESJ A;  1T98 A;  1LQ1 A;  5IT3 A;  3F8F A;  3I5U A;  1S6L A;  3JSP A;  2TDX A;  4LLL A;  4UV9 A;  4F7Z A;  2WC2 A;  2C6Y A;  2DW4 A;  5LGU A;  3QPT A;  1MDM A;  4KN7 X;  1FOK A;  3C1D A;  1YIO A;  1FLI A;  1A04 A;  4EM2 A;  3GFM A;  4RB3 C;  2A69 F;  1Q1H A;  3I53 A;  2CW0 F;  1PDN C;  1TW2 A;  3FXU A;  3G73 A;  2GAU A;  5ICF A;  2HGC A;  1FBS A;  1ZAR A;  3HTS B;  2QYO A;  2L4M A;  4UHT A;  3GXO A;  2JPC A;  1DUX C;  3KFW X;  1R5H A;  1UB9 A;  5BS6 A;  2NYX A;  3DKW A;  2H27 A;  2HEO A;  4AIH A;  2J5O A;  4HW0 A;  4S04 A;  2RDP A;  1IUY A;  3BY6 A;  2ZNY A;  2DT5 A;  5JI6 A;  1YW8 A;  4N0B A;  4Z2Y A;  1I5Z A;  2M1B A;  2PN6 A;  1JHH A;  2ACJ A;  3SQN A;  1RI7 A;  3ZMZ A;  1BJA A;  3W6J B;  3EDP A;  2EV6 A;  1FNN A;  2O0Y A;  3ELK A;  4RGU A;  4BNC A;  3CUO A;  3L00 A;  5E8I A;  3I64 A;  2HTS A;  3E5U A;  1ZG1 A;  2A68 F;  2LNB A;  3J80 Z;  2EWN A;  1ON1 A;  2E7X A;  1OKR A;  3M9A A;  1FY7 A;  1WQ2 A;  3V8K A;  2GZW A;  2EV5 A;  4L9N A;  5D5U B;  2OQR A;  4ZZL A;  4ZH4 F;  3LFK A;  2QBY B;  2ZKZ A;  3GZ6 A;  5D8K B;  4FT8 A;  2HKO A;  4O3M A;  2EFP A;  4YFN F;  5LHI A;  4JQF A;  5D6E A;  3D0S A;  1YLF A;  2QM3 A;  3MEX A;  4P5O A;  2Z5U A;  5D5X B;  4I98 B;  5HS7 A;  4WWC A;  3T5X A;  2HTJ A;  5D6F A;  1Z7U A;  2QVO A;  1RIO H;  5CVI A;  1KYZ A;  2HZT A;  3E97 A;  5DEQ A;  1K6O A;  4A6D A;  4A6E A;  2VXZ A;  5LGT A;  4MTD A;  4TV7 A;  1Z91 A;  3CJN A;  1FC3 A;  2QQB A;  2PG4 A;  4LFU A;  1MGT A;  1RNL A;  4PZJ A;  4HV6 A;  5A2Q Z;  4KIC A;  1F1Z A;  3B02 A;  1KGS A;  2LSO A;  3S2W A;  1VTN C;  1EH8 A;  2M30 A;  5H20 A;  2IRF G;  4OIQ F;  3ZPL A;  2GQQ A;  2BEO A;  2ZME A;  1BM9 A;  5L3C A;  1QZY A;  3H92 A;  2DQL A;  2ZO4 A;  1IN6 A;  1W7P B;  5HOO A;  2MD5 A;  2XRN A;  3IRR A;  2WWY A;  5E20 A;  3Q5F A;  3I58 A;  1E2X A;  1ODD A;  2MH2 A;  4KIB A;  3ZMU A;  5ERI A;  4G7Z F;  2H09 A;  3T8R A;  4GYG A;  3KEO A;  1O3S A;  4RB1 A;  1PP7 U;  2OA4 A;  4LD5 A;  2GXB A;  1O7L A;  4G6D A;  5ILS A;  2HR3 A;  3TO7 A;  3HSE A;  3VEP A;  3IHU A;  4ESB A;  4R1H A;  1YS6 A;  5LGN A;  1HSJ A;  5FLX K;  3ML6 A;  5DYM A;  3MAJ A;  4OOI A;  3C7J A;  1G3W A;  5DUI A;  1U2W A;  3QU3 A;  2WV0 A;  1F9N A;  1IAW A;  1YG2 A;  2ZFW A;  1YS7 A;  2D1H A;  1L3L A;  2AS5 F;  4G9Y A;  3K0L A;  3BPX A;  4Q5S F;  3KET A;  1B59 A;  4OIP F;  5ICE A;  3SZT A;  1L0O C;  3DPL C;  4PCQ A;  2E7W A;  4MEY F;  2P6S A;  5L3F A;  3LA7 A;  4M72 A;  2V1U A;  1HXD A;  1T0F A;  2K02 A;  2HOE A;  1P4X A;  4ETS A;  3ABT A;  1J59 A;  3KCC A;  2XRO A;  4IHS A;  3RKX A;  1OPC A;  2W25 A;  2Y0M A;  1GHC A;  1IF1 A;  3EQL F;  1IN7 A;  3LWF A;  1NHA A;  1XDU A;  2RN7 A;  3KP4 A;  3ECH A;  3U1D A;  1ONV A;  2DPU A;  1JGS A;  1BBY A;  3FX3 A;  5H6R A;  3EET A;  2NNY A;  5HVQ C;  3F72 A;  3L09 A;  1XGO A;  1SFU A;  2UWM A;  2RQP A;  2E1N A;  1KU2 A;  2YR2 A;  1O3Q A;  4YG2 F;  4LLN A;  2O61 A;  4HX4 A;  2DTR A;  2LDU A;  3L2C A;  3ABU A;  3R4K A;  1Z9C A;  1PP8 F;  2F5C A;  1ZLK A;  4U0Y A;  1K78 B;  4EJV A;  1CF7 B;  1O3R A;  1G3Y A;  1GVJ A;  4FX4 A;  3SXY A;  4XSX F;  1R7J A;  2GIV A;  3HSF A;  3RDI A;  5F1R A;  3R60 A;  1B9M A;  3KP5 A;  2COM A;  3F8N A;  4A5N A;  4LB5 A;  2IJL A;  2M5W A;  3HIF A;  2JZY A;  3BP8 A;  4UVC A;  3I0T A;  4UVA A;  3GX4 X;  4M9S A;  1HQC A;  1P2F A;  2IW5 A;  2HYF A;  3FXR A;  2HKX A;  3F8M A;  3LAJ A;  3F23 A;  1G3T A;  3FHZ A;  3IKT A;  5KVR A;  4S05 A;  5L3D A;  4G8X A;  5CVJ A;  4MEX F;  5FFX A;  3ERE D;  3TDZ C;  5LHH A;  2ESN A;  3JTG A;  1I1S A;  1S29 A;  2L01 A;  5ILU A;  1EH6 A;  3WTY C;  2STW A;  4L5I A;  4XLP F;  2L02 A;  2FSW A;  5BOX A;  5D4S A;  1TW3 A;  3HUG A;  4HX8 A;  1IRF A;  4IVN A;  5DCF A;  3F22 A;  1XMA A;  4OIR F;  3T0Y A;  1XD7 A;  4IF4 A;  1XGS A;  3RPQ A;  1H0M A;  3LAP A;  1AWC A;  5DD8 A;  5BQT A;  2FMY A;  2Y75 A;  2FBH A;  2KJC A;  3HRU A;  3GO5 A;  5K5O A;  5AIP A;  4P55 A;  4EQQ A;  4IRI A;  3U9G A;  2K7L A;  3LQR A;  4RGS A;  3E6B A;  1YQA A;  1SD6 A;  5K1Y A;  3F8B A;  3K69 A;  2CSO A;  2DK5 A;  3VOE A;  3WGH A;  4OMY A;  3V7S A;  4HZF A;  3GFL A;  1TLH B;  2O3F A;  2V1X A;  5E18 F;  1IXS B;  3M7G A;  3O3K A;  3OV8 A;  3VFZ A;  5HLH A;  1HKT A;  3FZV A;  3CDH A;  4HX7 A;  5J6X A;  1HW1 A;  4P9U A;  4IJA A;  5FLX Z;  3I71 A;  2HDC A;  4CGZ A;  4ZYE A;  1W5S A;  5LRS A;  3I59 A;  4U88 A;  4B8X A;  4MGR A;  1BC7 C;  3LST A;  2FA5 A;  1XCV A;  4LK0 F;  4FX0 A;  3F3X A;  2P5K A;  3C3W A;  5D8L B;  1SAX A;  3JTH A;  4GCV A;  1DPU A;  5FB2 A;  2RGV A;  2E1C A;  3PQJ A;  1LDK B;  4HQE A;  1UHM A;  4Y15 A;  1R1T A;  3DXJ F;  1GXQ A;  2F5F A;  3DPT A;  2ZBK A;  1HW2 A;  2OZ6 A;  3HOT A;  3SHF A;  3OOP A;  4N9H A;  3TOB A;  2A3S A;  2DAO A;  1GXP A;  4A5M A;  3KLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...