2YR2A

Crystal structure of the hypothetical regulator from sulfolobus tokodaii
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
142
structure length
142
Chain Sequence
NENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords 146aa long hypothetical transcriptional regulator
publication title Crystal Structure of the Hypothetical regulator from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
total genus 60
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2yr2A00
4L9TA 4ZYEA 2EFWA 3F8CA 2FF4A 3EUHA 4OINF 2FBHA 2IPQX 1EH6A 3F72A 3RKXA 3SZPA 1HQCA 2FXAA 1SD6A 1XMKA 2EA2A 5J6XA 2E1CA 4G7OF 3E5UA 3JAMK 1BIBA 1U5TC 2YX7A 3HTUA 3GYHX 2L02A 1TW2A 4WX9A 2K02A 4ESJA 3MZHA 4F7ZA 4KT5C 3DEUA 5CVIA 2H6BA 3HHHA 4XSXF 5DCMA 4RB0A 2EV6A 3DF8A 4R1HA 5HS7A 3V7SA 3RYRA 2EB7A 2VBWA 4N0BA 1R22A 4EGYA 3J80Z 1IXCA 3WTUC 4PGHA 4CO8A 3F6OA 1HW2A 3QU6A 1FOKA 3ERED 5DCMB 4S04A 3ULQB 5CLSA 1BN5A 2A07F 1K78B 2G7HA 2D1HA 5K1YA 2KJCA 5FB2A 2XVCA 2EV5A 1SAXA 2YR2A 5JFRA 1XD7A 5FLXZ 2QBYB 2HFHA 4RGXA 5A2QZ 2YU3A 2QQBA 2PI0A 3DQVC 3RJPA 2XV4S 4ENNA 1MKMA 1ZHFA 1IN7A 2XAJA 2UXXA 3IWFA 3OOPA 1SD5A 1ZLKA 1QPMA 1TNTA 2XKPA 5DV5A 1GXPA 4PDKA 1V4RA 4B8XA 3FMSA 1P2FA 1BC7C 2FSWA 4HDUA 4KUMA 4BHCA 3BJAA 5K5QA 3PQKA 3GLXA 1GVJA 1SD7A 3KEOA 2AS5F 3DPTA 3M1EA 2ZXJA 4HV6A 5HOOA 5BOXA 3RPUA 4P9UA 2QZ8A 3WTTC 3E3VA 1DUXC 3WTYC 3SFZA 1Q1HA 3WTVC 3L00A 2OQRA 1R5HA 1J0RA 3KP2A 2VBXA 1B9NA 3ZMTA 2VN2A 3KP3A 2IW5A 3CTAA 4Q5SF 5ILSA 5CVRA 1K7AA 4HV5A 3AAFA 1LB2A 4A0ZA 4MGRA 2P5VA 3DXJF 3K0LA 4A6DA 2ESNA 1F9NA 5LHHA 3ABUA 1PUEE 4MTEA 1XSDA 4HF1A 3E6DA 3VFZA 3SHFA 4WCGA 1O7FA 2DQLA 4UVBA 4WXDA 4ZYGA 3GX4X 4U7BA 2DQRA 5LGUA 1T98A 5LHIA 4P55A 1JHHA 5J8FA 2MBFA 1OYWA 1KA8A 3OV8A 2XKOA 4P96A 4P5OA 4RGSA 2HQRA 3I0TA 4AD9A 3WGGA 1MJBA 4KN4X 2PFBA 2GIVA 4RB3C 3DPLC 4UV8A 3BZ6A 4BHBA 2LF7A 3GFMA 3HOTA 2L01A 4AVPA 5L3EA 2HQNA 2PMHA 5D5VB 2Z5UA 2FRHA 3C18A 3V8KA 4XSZF 5ERIA 2HOEA 3HRMA 4L9NA 5KK1A 2XHKA 3N4MA 1USSA 2RVCA 1UB9A 1SMTA 1BC8C 5K5RA 4LG0A 4Y13A 1R58A 3R0JA 2K4BA 1OYYA 5D6FA 1YQAA 2W25A 1RUNA 1IRFA 2EWNA 2YX4A 2H94A 4LG0B 4G7HF 1UHMA 2P6TA 1B6AA 1UCRA 2VBZA 2A61A 1A04A 2OBPA 2LSOA 3F8FA 3COAC 2X0LA 4XBFA 2V79A 3IHUA 5FGMA 4WWCA 3Q5FA 1RUOA 1QZZA 1YFHA 3CO6C 2CO5A 4IRHA 4A0XA 2P5KA 2ZJ2A 2V1DA 3RI4A 4XLNF 2A69F 4CICA 2XAGA 1U2WA 2KJBA 4PGGA 1E17A 2IA0A 3V7RA 3IC7A 3KP5A 1FYMA 5L3DA 5HLGA 1R1VA 4UV9A 1LEAA 3EDPA 2VC0A 2IRFG 5F6FA 2ISZA 5E18F 3BROA 3GFLA 1OKRA 3KFWX 3G3ZA 5LRRA 2NS0A 5ICCA 2A6HF 5LGTA 3PQJA 1XCBA 4G6DA 4P9FA 3BJ6A 2MC3A 3WU0A 4KMUX 1FBUA 3CO7C 2IVMA 1LVAA 2O61A 4FX0A 1KU2A 4LLGF 4CDGA 3BP8A 1SMYF 1IN6A 1FSEA 2IJLA 3WG9A 2G9WA 4YFXF 3HUGA 4NHJA 1D8KA 3JTHA 1I6XA 4OIOF 1R23A 3F6VA 2OU2A 2F5DA 2EFNA 2ZCWA 4N9IA 2P5LC 1W7PD 1TQMA 2MH2A 3TQNA 4HYEA 3V7CA 4IXAA 5L3FA 1BM9A 3T0YA 2K86A 1MDMB 5LBQA 4I98B 1ZYRF 4EJVA 2GZWA 1XMAA 1MJ9A 4HAMA 4S05A 1I5ZA 3JSPA 1FT9A 4ASNA 3BOQA 2CSOA 5D4RA 2E7XA 4KDPA 5FO5A 2HKOA 3I53A 1Z91A 2EV0A 1YYVA 1S8NA 3HSFA 2ZNYA 1LNWA 2L54A 2FNPA 3JTGA 4WF2A 2EA4A 3FF5A 3FM3A 1WI9A 1QO0D 2OZ6A 2XIGA 1O3RA 4WXHA 4RB2C 1H9GA 2VBYA 3KP6A 4CYDA 5AIPA 1RNLA 4HF2A 4HW0A 3F8MA 4KMFA 2JSCA 4HZFA 2ELHA 4WXCA 1AWCA 4Q48A 5IT9Z 2P7CB 1YW9A 3O6BB 5HDKA 3KCCA 3RIRA 1D5VA 2A5YB 3WODF 1W4MA 2BE5F 3M8FA 1HKTA 3BPXA 1ODDA 3K69A 3WTZA 4EGZA 1IN8A 2PEXA 3ELKA 1STZA 1ZG1A 3GFJA 3U9GA 4YFNF 2LF8A 4U88A 3R6SA 2QUFA 4ENJA 2COMA 3B73A 4TV7A 3PFIA 2CW0F 4KFCA 2VOPA 2QWWA 5LLQA 4EJOA 5E8IA 4HA8A 2QENA 4U7DA 4NB5A 4L5IA 4LK0F 3S2WA 2BYVE 1U8RA 2XROA 1IN4A 4ZZDA 4EQQA 5F64A 2VONA 3HRTA 2PBIA 1WRJA 2W57A 1BI0A 3KEQA 1YIOA 5CVJA 3LFKA 2BV6A 3REOA 1SFEA 2CG4A 3D0SA 2F5EA 2GXGA 3RKWA 2RNJA 1L3LA 1IXSB 1IZ1A 1K78A 1U6GA 2FBIA 3M9AA 3IRRA 1DPUA 3U1DA 4BNCA 1HKSA 1GHCA 2PJPA 2VE9A 3MWMA 3I64A 1ZREA 1J75A 3E5QA 1CGPA 3QRFF 2QBYA 2JT1A 2Y48A 1IAWA 1KQ8A 4G8XA 1S7OA 2ZKZA 4R79A 1PP8F 2MH9A 2X4HA 4KIBA 2O8XA 4I09A 3MCZA 2DBBA 2GA2A 3TDZC 4O6JA 4M72A 2FQ3A 4GXOA 3CDHA 5HS8A 3FXQA 4YG2F 4LD5A 2M8EA 3J80K 3QAHA 1MZBA 2OZUA 2QYOA 4IHTA 1VTNC 1P92A 4ESFA 2VC1A 3BDDA 4EV0A 5LEJA 2LKPA 5DUIA 2H27A 3R60A 2B0LA 5DEQA 4EMSA 5FLXK 3WGHA 4ENKA 4MQVA 2FEZA 2QQAA 1ZGJA 5A2QK 3SZTA 3GUDA 2NAZA 4M9ZA 1KU9A 4IRIA 2ZFWA 2J5OA 3I59A 5L3GA 5CYVA 1BJAA 2WWYA 3EQLF 2H6CA 2W24A 3GZ6A 1JGSA 4LJZF 4M6YA 5JVTA 3SQNA 3W6KB 2CWEA 2LNBA 3I59B 4EJTA 3J7AO 3FM5A 1MGTA 1G3YA 2JPBA 2CQKA 4OMZA 1UFMA 2O3FA 3F23A 3LAJA 1TNSA 3MAJA 4EJUA 2OD5A 1RI7A 2A3SA 5JHUA 2AXLA 3K9TA 4OMYA 5J8CA 2HDCA 4YIIA 4EM2A 2IA2A 1FX7A 4GYGA 1PP7U 5FD6A 1TW3A 1FWZA 5BPIA 2GA1A 1BBYA 2CFXA 2DK8A 1Z6TA 2M1BA 5HDGA 3HSEA 3EYYA 1G6NA 3N97A 5BQTA 1Z05A 1F5TA 2VT3A 2J5PA 4L9JA 4CXFA 1YS6A 3E97A 3KE2A 3F8NA 4U0YA 2IA1A 2BGCA 4BQAA 4CZZA 1S29A 1Z1DA 5ICFA 2RC4A 1P4AA 1FZPB 3KZYA 4HX8A 3MFKA 2FBKA 1FNNA 2XAFA 3CUQA 4YIFA 5ICEA 4ETSA 4ZH4F 1ZG3A 2L3DA 3R61A 3Q9SA 5LHGA 3J81Z 5CVUA 4MEXF 1LDKB 1F1ZA 4I02A 2HWVA 4Y15A 2RGVA 3RDIA 3CUQB 5D8KB 5H6RA 1T6SA 4HBLA 1B59A 2PG4A 3H92A 4G94A 4OIRF 2Z9OA 3ROUA 1QNTA 1JE8A 4D0PA 4U0WA 4RAZA 1J9IA 2FMYA 3DKWA 3WU1B 4ESBA 3ZPLA 3ZN1A 2D2WA 1O3QA 2HYFA 4LLLA 3RYPA 4L0ZB 1YS7A 2RQPA 1ZRDA 3ZN0A 3RTRA 1X3UA 1BI1A 2STWA 3V4GA 3WE3A 4JBAA 2WTEA 3ZMZA 1KGSA 1QBJA 3K1MA 1OYIA 1HW5A 5BMZA 3H3ZA 2STTA 3WTWC 4HQEA 2IP2A 1Z7UA 1JXSA 2ZBKA 2GAUA 2PN6A 5D5WB 3Q9VA 1BI2A 1FPQA 4Y17A 2JPCA 1ZH5A 2D1VA 4JQFA 1DP7P 4LGWA 4A6EA 4XRFA 3L7WA 3M8EA 3DV8A 1HSTA 1IW7F 4RS8A 1R36A 4UHTA 1P6RA 1PDNC 4MHGA 1XGOA 2ZNZA 4OIPF 1YW8A 4L5JA 3GFIA 4H0EA 1MDMA 1V3FA 5L3CA 2G7UA 4Z2YA 1K6OA 3ZP5A 3BJOA 3MEXA 5E1XA 4BHPA 3I5UA 2FNAA 1E2XA 4NQWA 3GF2A 2L4AA 3SXYA 3NRVA 2O0YA 2K4JA 1LDJA 3P9IA 1FC3A 2JZYA 4ON0A 4GO1A 4HLXA 3MQ0A 4RGRA 3GXOA 2BBYA 2QQ9A 1B4AA 4O5VA 1NHAA 4L9VA 4R8HA 4FX4A 1IN5A 1WSUA 5ILVA 1ULYA 3HTSB 2FA5A 2XAQA 5DYMA 4Q47A 1YW7A 2CYYA 3TO7A 1O57A 3FWEA 3BWGA 3F8BA 2DTRA 2NNYA 4G6QA 5LGNA 1RZ4A 4YFKF 2RKHA 2KKOA 3T8RA 2RV8A 4RAYA 1O7LA 3LSTA 4ZYHA 3GEZA 3DP7A 3GVAA 1T0FA 5TRDA 2Y75A 1FP2A 1ZLJA 1G3TA 2K27A 4KIGA 2W84A 3QPTA 5AONA 3HRSA 1W7PB 5ED4A 2HKXA 3D5LA 2EFOA 3G73A 2WC2A 1S3JA 4PCQA 5AIQA 2XAHA 2HZTA 1FLIA 3T8TA 2P7VB 4QWQA 3HRUA 2H09A 5TJJA 4IJAA 2UZKA 4KIFA 4GGGA 3ECOA 3IRQA 4I01A 3ABTA 4LMYA 2UXNA 2M87A 3O2PE 3V8JA 1LEBA 4KNYA 5FFZA 1Z6RA 4M73A 4A0YA 1J7KA 3I4PA 3JAMZ 2K7LA 4BH9A 4BYYA 1O3SA 1BI3A 4E70A 2C6YA 4RGUA 2M45A 2ACJA 2GWRA 1KYWA 1D3YA 3QPHA 1DDNA 4FHTA 3F21A 1QQIA 2DI3A 5E1ZB 1SD4A 2Q0OA 3KP7A 5IT9K 1XCVA 3P9CA 3TGNA 3KLOA 1KQ9A 1FBSA 5HDNA 4M74A 5DUKA 3MZYA 4CGZA 5F1RA 3KLNA 3WGIA 2VT2A 4OU0A 1B1BA 5D5UB 1KU3A 3JW4A 5HLIA 5LRSA 4KA4A 2NNNA 3LAPA 2V1UA 3CUQC 1WWXA 1XSXA 5L3BA 1XSVA 4Q4ZF 1ZRCA 3EYIA 2ISYA 3R0AA 2ZMEA 2VODA 3GZ5A 3TDUC 1YG2A 5BPDA 2HR3A 1YTYA 1OR7A 1BOAA 3B02A 5FFXA 2PMUA 3K1PA 3WTSC 3HSRA 3LWFA 4WK8F 1EV7A 4U0VA 2ZMEB 5HLHA 2OQGA 2TDXA 2HGCA 2MLKA 1RIOH 1T39A 4K2EA 3V8LA 3GWZA 1IXRC 3LQRA 3RKYA 4IPAA 3QU3A 1LDDA 5H20A 1ONVA 5E1WA 4ENMA 1I27A 3E5XA 4OIQF 3BY6A 1WQ2A 2M5WA 2Z33A 2A6EF 1O3TA 3IKVA 1R1UA 4HX7A 3IWZA 2Z3YA 5H6QA 5HS9A 2XASA 1HBXG 3K1NA 1MD0A 3KP4A 3ECHA 1W5TA 5DD8A 1Z9CA 2VE8A 4FT8A 5E8GA 2WV0A 3ZMDA 1BIAA 4HDVA 3E6CC 2KIFA 3HOSA 3P9KA 1FSHA 3L09A 3E6BA 3U2RA 1J59A 1B9MA 3TKYA 4AWXB 1ZN2A 3ISPA 1HKQA 1I1GA 1R5GA 4UNOA 2PQ8A 1C0WA 2HTSA 2DO7A 2IT0A 2RDPA 3VODA 4M9SA 2EFPA 1REPC 4EVIA 3NQOA 1XB4A 3TO9A 4I0BA 1OMIA 2V1XA 2DFIA 2MLGA 2ESHA 4CHUA 2ADUA 4AIJA 4JK1X 3QP6A 3FHZA 4I2OA 1DPRA 4MEYF 1R1TA 2P6SA 2Q8KA 4A2UA 1HW1A 1F4KA 4HQMA 1JHFA 2F5FA 4AIHA 2QVOA 3ZMVA 1CF7A 3NEUA 1QZYA 2MD5A 2Z99A 2E7WA 2JTVA 1FYKA 5IT3A 3F22A 1P4WA 5JI6A 4UVAA 3QP5A 1ON2A 4N9HA 4M6XA 4A12A 3T5XA 3I71A 2VXZA 4BXUA 1CF7B 1XGMA 2Y0MA 4UUVA 3GO5A 4KN7X 4EM0B 3TOAA 1FYLA 1J5YA 2DK5A 4M9XA 2R7FA 3P7NA 1T2KA 1ON1A 1HXDA 2FOKA 2L4MA 3ZQ7A 1R00A 2ETHA 3LA3A 3TO6A 2ZO4A 2DPDA 4MNUA 2YPRA 1H9TA 2LDUA 4LB5A 4LK1F 4DQ2A 4LLNA 4PZJA 3R4KA 4BAYA 4EM1A 4KICA 4HLYA 3HIFA 2UWMA 2JRTA 4IRGA 3I58A 3K2ZA 2EK5A 6PAXA 3C1DA 2OA4A 2V9VA 3JSOA 1TBXA 3E6MA 1AOYA 5D6EA 1U5TA 5ILUA 4M71A 2MA3A 1HSJA 5DDGA 5CJ9A 3QOPA 2OAZA 3O3KA 1U78A 1SFUA 2V6CA 1U5TB 3CLOA 1TLHB 3CJNA 5ICGA 3RPQA 1FP1D 3W6JB 1G3SA 4UVCA 2F5CA 2P4WA 5JR3A 3L9FA 2NRAC 2YSRA 3DFGA 1SFXA 2XUBA 1XDSA 2HTJA 3HHGA 3KETA 2HYGD 2FU4A 2DW4A 4LFUA 1KU7A 2NYXA 1J2XA 2Q2EA 1S7AA 1W5SA 2GQQA 5D5XB 3J81K 3FXUA 4A5MA 2FMLA 3F3XA 3HYIA 4I0AA 3VB2A 4IF4A 1ZG5A 2DAOA 1U3EM 4I7HA 3TOBA 2VOOA 3ZMUA 5BS6A 3GW2A 4DNCA 1YO5C 1WKMA 1D8JA 4ZYDA 5EEGA 3FZVA 1YLFA 2HEOA 2QLZA 3WE2A 4QLCU 1ZARA 3ZMSA 1ZGAA 2A68F 1T38A 1GXQA 2R3SA 3VOEA 4OOIA 1IRGA 4IVNA 2HS5A 1L0OC 4L0YB 1TQIA 1TQPA 2KIMA 1I1SA 1EH8A 3ML6A 4EJWA 3KZZA 1IUYA 4AIKA 3M7GA 2DPUA 2E1NA 1LJ9A 2QM3A 4GYIA 3EETA 4LB6B 1USTA 5CVVA 5K5OA 4HOBA 2KIUA 2F2EA 1UHWA 3C7JA 4G7ZF 1G3WA 1S6LA 5DCFA 4KYWA 3I54A 1EH7A 3H3UA 1XN7A 2O6GE 2GXBA 4O3MA 5D4SA 3IL2A 2FE3A 3C3WA 5HVQC 2R7DA 2CGPA 1FY7A 3FMQA 1OPCA 2P8TA 4UXNA 1ZRFA 3IKTA 1MJAA 4XLPF 4ZZLA 3WTXC 1XGNA 5E17F 3L2CA 1Y0UA 5E20A 4RB1A 1KYZA 1ZAOA 4IHSA 1W7PA 3LA2A 2XRNA 2BEOA 4GCVA 1QGPA 2W85A 1P4XA 2DU9A 4L18B 1H0MA 1TTYA 5EEHA 1R7JA 2XGXA 2EJRA 3VEPA 2DT5A 4MQ9F 4G9YA 2RN7A 2M30A 3LA7A 3T1BA 5KVRA 1G4DA 3FX3A 2KRFA 4HX4A 5LEKA 5DD4A 3BPVA 1XGSA 2EFQA 4B09A 5FD5A 2DLLA 3FMRA 5D8LB 4HF0A 1KQ0A 2PLYA 2D45A 3FXRA 3CUOA 1IF1A 1LQ1A 4MTDA 1FBQA 4A5NA 1K79A 1XDUA 2O03A 3LQQA
chains in the Genus database with same CATH superfamily
4L9TA 2F6CA 2PJRA 1FIPA 2IS1A 3L2QA 4ZYEA 3BTLA 2HNHA 5KAIC 2EFWA 2OV7A 3F8CA 2FF4A 3EUHA 3ZXSA 2JVHA 4BE0A 5H2FC 2DT6A 3Q0WA 5DS9A 4OINF 2FBHA 2RAEA 2IPQX 3HOZJ 1EH6A 2VPRA 3WU2C 5J40A 4YIRX 2Z16A 4BS9A 1ZGWA 3F72A 2KZVA 3FK7A 3RKXA 3SZPA 1E3PA 1LVKA 3ZQLA 2VJ4A 3CMAI 1HQCA 2FXAA 1AKHB 1DGRM 4GRIA 1SD6A 1XMKA 4F55A 3EPZA 2EA2A 5J6XA 2W00A 1TP4A 1VQ5I 2KHMA 1G2HA 2B7EA 3NWTA 2V6EA 3PL8A 2E1CA 4A3KJ 1YRNB 3MKYB 4G7OF 3E5UA 2UV1A 3ESWB 3JAMK 5BNGA 4BXXJ 1BIBA 4IOAF 4D7MA 4IX7A 1U5TC 4JX5A 2YX7A 3HTUA 1OCCH 2HXOA 3GYHX 2L02A 1TW2A 4WX9A 2K02A 4ESJA 3MZHA 4F7ZA 4W97A 4KT5C 1ZKGA 3DEUA 4DYCA 1QRYA 5CVIA 4J01A 2H6BA 3PJRA 3HHHA 1WVRA 4XSXF 2WY7Q 4A3IJ 2KLOA 2AHQA 5J1YA 5DCMA 4RB0A 2EV6A 2XC7A 1D1BA 2WY8Q 1XC5A 3DWLE 2O8KA 3DF8A 4R1HA 4M3EA 1IC8A 5HS7A 1H89C 3V7SA 2F4MB 2FUG2 3RYRA 5LD2C 2EB7A 2VBWA 1H8AC 4N0BA 2FQ4A 1R22A 4EGYA 3RZOJ 3J80Z 2K9SA 2O7OA 3OYMA 1IXCA 1PYVA 3BG5A 3WTUC 4PGHA 1MW7A 4IHWA 2E5NA 4CO8A 3F6OA 1HW2A 3HGYA 3QU6A 4Z6YA 3H5AA 1FOKA 3ERED 5DCMB 2WA0A 5B3SH 4S04A 1OLTA 2LMDA 1YJNI 3ULQB 1Z21A 2DFFA 5CLSA 3BR1A 3H36A 1BN5A 2A07F 1SVLA 1K78B 2R7RA 2G7HA 3FISA 2D1HA 2HPIA 5K1YA 2KJCA 5FB2A 2XVCA 2EV5A 5CQGA 3BR0A 1LE8B 1TWAJ 3QWLA 2NOJB 1SAXA 2YR2A 5JFRA 4ZTJA 1XD7A 5FLXZ 4M3BA 5GTIC 4ZYAA 3HZJA 3GZNB 4BEHA 4ZDOA 2QBYB 2EBIA 2HFHA 4RGXA 5A2QZ 2YU3A 3DTEA 2QQBA 2NVQJ 2L9RA 2MABA 2PI0A 2GOXB 3DQVC 3TP0A 3RJPA 2XV4S 4ENNA 1RKWA 1MKMA 1ZHFA 1IN7A 2XAJA 2UXXA 3S2HJ 2ME6A 2RREA 3IWFA 2HVQA 3OOPA 1N77A 2DOEA 1SD5A 1ZLKA 1QPMA 1TNTA 2XKPA 4BEHB 4UUSB 2WB1N 2ECCA 5DV5A 2X1EA 3CMEI 5M3FJ 2L9SA 3M1CA 1GXPA 4PDKA 1V4RA 4B8XA 3FMSA 1JTYA 1P2FA 2X1CA 1BC7C 1Q1VA 3KIOA 2HVSA 2FSWA 1IUFA 4HDUA 2V4JC 1IRZA 2ZFUA 3SZGA 4KUMA 4OAZA 2KISA 4BHCA 4QPOA 1T56A 2DYSH 3BJAA 5K5QA 3PQKA 3GLXA 1JGGA 1GVJA 1SD7A 3KEOA 2AS5F 3DPTA 1T95A 3M1EA 1TL8A 2ZXJA 4HV6A 3ASOH 5E79C 5HOOA 4BY1J 5FRMA 5BOXA 3GTQJ 3RPUA 4P9UA 4FETA 2QZ8A 4A3FJ 3WTTC 1RKTA 2QQ8A 3E3VA 1DUXC 3WTYC 3SFZA 1Q1HA 3WTVC 3L00A 1TWFJ 2OQRA 3J7ZI 1R5HA 3DBHB 1J0RA 3KP2A 1VQNI 4II2A 2VBXA 1B9NA 3ZMTA 2VN2A 2X48A 3KP3A 2IW5A 3TBIA 5FLMJ 3CTAA 5F0CA 3K70D 4FASD 4Q5SF 5ILSA 4LG3A 5CVRA 3QYEA 4HV5A 3IV5A 3AAFA 1D1CA 1K7AA 3B6CA 3Q0VA 1LB2A 2DT7B 2ECBA 1MH3A 4A0ZA 5EZHA 4MGRA 2P5VA 3DXJF 3K0LA 4A6DA 3ZQQA 2ESNA 1D0ZA 4RAGA 1F9NA 2XDVA 5LHHA 4G6TB 3ABUA 1PUEE 1ZELA 4MTEA 2LKSA 4NDLA 5LFAA 1XSDA 3LSRA 4HF1A 4E7ZA 2OCCH 2CUJA 3E6DA 2KPMA 4XQFA 3VFZA 3SHFA 4WCGA 3LSKA 2FX0A 1O7FA 3ZQGA 2DQLA 4UVBA 4WXDA 2HDDA 4ZYGA 3GX4X 4U7BA 3FK6A 1WJFA 2DQRA 5LGUA 1T98A 5LHIA 4P55A 1JHHA 5J8FA 2MBFA 3X2QH 1OYWA 1KA8A 3OV8A 2XKOA 1WJDA 4P96A 4P5OA 2IGOA 3S14J 3VSLA 2F4IA 4RGSA 1X1BA 1TWGJ 2HQRA 3I0TA 4AD9A 2CQ7A 3WGGA 2XPWA 3ZQFA 1MJBA 4KN4X 1B72B 2PFBA 2DA5A 2GIVA 2VQCA 2L9VA 4RB3C 2IS2A 1NG6A 3HC7A 2KIQA 2DMUA 3DPLC 3BZ6A 4UV8A 2LF7A 4BHBA 2LKXA 3GFMA 3HOTA 3JREA 2JK3A 2L01A 4AVPA 1ACIA 5L3EA 1JT6A 1TT0A 2HQNA 2Y2ZA 2PMHA 5D5VB 2Z5UA 3OSFA 3S1RJ 2FRHA 3AG2H 5JVGF 2GM4A 3C18A 3V8KA 4XRMA 4XSZF 5ERIA 2HOEA 3G71I 3HRMA 4JX4A 1YOVB 2M4GA 4CSWA 4L9NA 5KK1A 2XHKA 4KT6A 4NC8A 3N4MA 1USSA 2RVCA 1UB9A 1SMTA 1YITI 1ETKA 1M1EB 1R49A 1BC8C 5K5RA 2IBDA 4LG0A 4Y13A 1ORKA 4B47A 2LRDA 2XF6A 1R58A 1VQ9I 2BHYA 2NVXJ 3R0JA 2K4BA 1OYYA 2KRHA 1P7JA 5D6FA 1YQAA 2JSPA 2JJ7A 2W25A 1UELB 4A3CJ 3HOYJ 4IKFA 1RUNA 4PJNA 1IRFA 2EWNA 2YX4A 2DYRH 4IQJA 2GOMA 1KONA 2LREA 5KNLA 2H94A 1RC9A 4LG0B 4G7HF 1MH4A 1UHMA 2P6TA 1B6AA 3MZ8A 3DKYA 1Z77A 3AG4H 2VLAA 4NC7A 4IO9F 1UCRA 2VBZA 2A61A 1A04A 3TL4X 2BY1A 1T33A 2OBPA 2LSOA 3GCMA 3F8FA 3COAC 2WADA 2X0LA 4BJ5C 1W36C 4XBFA 3EUHC 1Y6IA 3HPGA 1VQOI 2L7KA 2E19A 2V79A 2WB1A 3IHUA 5FGMA 1MSFC 4WWCA 2WV1A 3FBNB 3Q5FA 1X4PA 1QZZA 1YFHA 1RUOA 3C2BA 3CCQI 2X85A 3CO6C 2CO5A 2X6XA 3NWSA 3BLYA 4HSTA 4IRHA 4A0XA 3A4CA 3OYGA 4C3IJ 4HPQA 2P5KA 1DP3A 2ZJ2A 1S5LC 2V1DA 4C2TA 3RI4A 5C3EJ 4XLNF 1BL0A 2DTZA 3AL0B 2A69F 4CICA 2XAGA 1U2WA 2BZTA 2CW8A 3K4BA 2KJBA 4W1UA 4RA2A 2HDWA 3H35A 4PGGA 1E17A 2IA0A 1ENHA 3IC7A 2LBFA 3KP5A 5L3DA 3V7RA 1FYMA 4CCOA 2CW7A 5FKOA 5HLGA 2KMUA 1R1VA 4UV9A 2ZB9A 1LEAA 3EDPA 2VC0A 3S17J 3PFYA 2IRFG 5F6FA 2NS8A 1X1AA 4CUGA 4DZPA 5HLTA 4CCNA 2ISZA 5E18F 3BROA 2DJNA 3GFLA 1MMGA 1OKRA 3KFWX 4XLEA 2LLKA 3G3ZA 5LRRA 2E35A 2NS0A 4A3DJ 5ICCA 1N25A 3JRBA 1NH3A 2A6HF 5LGTA 3PQJA 1XCBA 1MSEC 4G6DA 4Y3OA 4P9FA 3BJ6A 3CF2A 2M2EA 2MC3A 1Z3YA 2VASA 3WU0A 4KMUX 1FBUA 3CCSI 3G1MA 3CO7C 1GV5A 1MIJA 2BHZA 2IVMA 1LVAA 5F0FA 2FD5A 4FX0A 2O61A 4FQGA 3GBGA 3FXJA 4E7HA 1KU2A 4LLGF 5IP7J 4CDGA 4BE1A 1EKEA 3BP8A 4A3BJ 1YJ9I 1LFBA 3UR3C 1X58A 4B3XA 1SMYF 1IN6A 1FSEA 2IJLA 3DBRB 3CCMI 3WG9A 1SVOA 2G9WA 4YFXF 3HUGA 4JX6A 9ANTA 3M8JA 2ICWG 3OYKA 2LC2A 4NHJA 1PUFA 1NG7A 1D8KA 4NC6A 3KEYA 3JTHA 1Z67A 4IQ4A 1I6XA 4OIOF 1R23A 3F6VA 1HC8A 2OU2A 2F5DA 2EFNA 2ZCWA 1ERDA 3A1YA 3ASNH 3H0DA 3MKLA 4N9IA 2P5LC 2NS7A 1W7PD 1TQMA 2MH2A 2VL8A 1OQYA 2DMTA 3OIPA 5B1BH 2AXTC 4BQOA 3A02A 4Y33A 3TQNA 4BXFA 2YS9A 1SFKA 2VXDA 4HYEA 3V7CA 4F93B 2AQFA 4IXAA 5L3FA 1BM9A 3T0YA 2K86A 3F0CA 1MDMB 5CPRB 2K9MA 4AVZA 5LBQA 4DBQA 4I98B 1ZYRF 4EJVA 2GZWA 1XMAA 1MJ9A 1MMDA 4HAMA 4S05A 1I5ZA 4PSXA 2CQQA 3HM5A 3JSPA 3CC7I 1FT9A 4ASNA 1FOXA 1HOMA 3BOQA 2CSOA 5IPAA 5D4RA 3K6GA 2E7XA 2L7MP 3W6VA 4A3GJ 4CCJA 1P7IA 5FO5A 1IGNA 4KDPA 2HKOA 3I53A 4AUXA 3S16J 1Z91A 3L2RA 4PJMA 1A31A 4NBQA 2ZXWH 2EV0A 1YYVA 3S1NJ 1S8NA 2DMNA 3BG7A 2N8GA 3HSFA 3OL3A 2K40A 4EATA 2ZNYA 1LNWA 2L54A 2FNPA 3JTGA 2NOGA 4WF2A 3CLQA 1TZLA 2EA4A 3LSJA 3FF5A 3OIOA 3FM3A 2QKLB 5FKMA 2EIKH 1WI9A 1OCPA 4IHXA 1QO0D 2OZ6A 2XIGA 3OYFA 1O3RA 1LPQA 3CP2A 4PUSA 4WXHA 4RB2C 5EDNA 2AO9A 1H9GA 2M9HA 3HGGA 2BW3B 2VBYA 3DTIA 3MD2A 5EGOA 3PUFA 2OJED 3KP6A 3S2DJ 1CQTA 3FBIB 1WI3A 4CYDA 5AIPA 3O8HA 4XOPA 1RNLA 4HF2A 4HW0A 3F8MA 3GTPJ 4KMFA 3D1NI 1DU0A 2JSCA 4BKXA 4HZFA 1JJ8C 2HU9A 3FHNA 2DA1A 4GDFA 2KT0A 4RLQA 5GP9A 2ELHA 4WXCA 1AWCA 4Q48A 5IT9Z 4D9JA 3OL4A 2W82A 2LK2A 1Y1WJ 2P7CB 2R7XA 1YW9A 4PSWA 3O6BB 3RIRA 3KCCA 5EJCA 5HDKA 2A5YB 2CH0A 3HPHA 5J1RA 1D5VA 3WODF 1W4MA 1RPWA 1VQ7I 2BE5F 3M8FA 1HKTA 3BPXA 1ODDA 3K69A 3WTZA 4EGZA 1IN8A 2PEXA 3ELKA 1STZA 5IY5H 1K83J 3GFJA 1ZG1A 3U9GA 1AKHA 4PFPA 4YFNF 4XM3A 3FIWA 3Q0UA 2KZGA 2LF8A 3DU6A 4IZZA 4U88A 3R6SA 3U1KA 2QUFA 4ENJA 3KX2A 1YRNA 2COMA 4B1RA 4DYRA 5IP9J 2EZKA 3B73A 3K7AJ 4TV7A 1APLC 2R7UA 3PFIA 2CW0F 3LSGA 4KFCA 2M0CA 2VOPA 1GV2A 3KYDB 2V26A 2W1OA 4ZJZA 3M07A 2KQRA 3LMMA 1GVDA 2QWWA 2ZSHB 5LLQA 4EJOA 5E8IA 4HA8A 3PO3J 2QENA 4U7DA 4NB5A 4E7LA 3CMMA 3VYSB 4RM3A 4L5IA 4LK0F 3S2WA 2BYVE 2KDZA 1U8RA 2XROA 3ONQA 2E2IJ 1IN4A 4BDYA 4ZZDA 2LYCA 2TRTA 2VQLA 4EQQA 5F64A 2P81A 1FEXA 2VONA 3HRTA 4AC0A 2PBIA 1WRJA 3WG7H 2W57A 1BI0A 2M0MA 3KEQA 1YIOA 5CVJA 1DU6A 2JN6A 2ZSIB 3LFKA 1ETWA 2KDOA 3I9V2 2BV6A 2JRMA 3REOA 2V1NA 1SFEA 2CG4A 4X6AJ 3D0SA 2V9PA 2F5EA 5FROA 4XRSG 2GXGA 2A5WA 3DEEA 3RKWA 2RNJA 1RR8C 4ANJA 1L3LA 1IXSB 1IZ1A 1BR4A 1K78A 1U6GA 1IJWC 1N78A 2FBIA 1X2MA 3M9AA 3IRRA 1DPUA 2XGDA 3U1DA 4M3FA 3OYAA 4BNCA 1HKSA 1GHCA 2PJPA 2VE9A 3MWMA 4PJJA 4RMNA 3I64A 4V2FA 1ZREA 2IS6A 1LE8A 4XN0A 1MNMC 1J75A 2FOWA 1OCZH 4IHYA 1WH5A 2EZLA 1Y0NA 3E5QA 2X6OA 1CGPA 1WPKA 3QRFF 1TT5B 1O4XA 2QBYA 4JP0A 1FJLA 2JT1A 5GPAA 2Y48A 3AL0C 2XRLA 3CJRB 1IAWA 1KQ8A 2GBYA 4G8XA 1OFCX 1S7OA 1WHUA 2QSGX 2ZKZA 3NARA 4XKBA 4R79A 1F36A 2VKEA 3G1OA 2R0QC 2E2JJ 1PP8F 3PNYA 2MH9A 2X4HA 4A69C 4KIBA 2O8XA 1EJ9A 3IH4A 4J00A 1X2NA 4I09A 1VNDA 1X1DA 2JWTA 3C2GA 3MCZA 2DBBA 3FKJA 3OR1C 4UUSA 4IHVA 2GA2A 3VWBA 1QU3A 3TDZC 3RZDJ 1YX5A 2F48A 4XORA 2O9LA 1WCMJ 4M72A 4O6JA 2ELKA 2KL4A 2FQ3A 3ABLH 4IOCF 2D5VA 1HF0A 2DMQA 1FIAA 2L5QA 2Z1DA 4GXOA 4BJTA 1YI2I 3CDHA 3RPUD 5HS8A 2IS4A 3FXQA 4YG2F 5IP6A 1ZQ3P 4LD5A 4YEJA 2M8EA 3LL7A 3ZOBA 3J80K 2BOLA 2EZIA 3LSIA 3QAHA 1RESA 1MZBA 4NUBA 4AIDA 2RQQA 3CZ6A 3OYHA 3BG3A 1JUSA 3BC8A 2OZUA 2QYOA 4IHTA 1VTNC 4BE2A 4OWRB 3SEQA 1P92A 4ESFA 2VC1A 3PSFA 3TW7A 2H1LA 3BDDA 3K4MA 4EV0A 5LEJA 2VUMJ 2LKPA 5DUIA 5F1JA 2H27A 3R60A 1D5YA 4XLFA 4XKWA 3CJTB 4ABZA 2B0LA 2LTPA 5DEQA 4EMSA 1RETA 1YHQI 5TISC 4FCYA 2E5ZA 3GTJJ 2R7ZJ 2R7TA 4BDZA 2COBA 2PMZN 3CCUI 5FLXK 2G0EA 1Z7LA 3WGHA 5FKNA 4ENKA 4MQVA 2FEZA 2QQAA 2R7WA 2OTJI 1DQUA 1ZGJA 3QYFA 5A2QK 2DA6A 3SJMA 4IEJA 3SZTA 3GUDA 2HI3A 4AM3A 2NAZA 2XAUA 4M9ZA 1KU9A 3I3LA 1AA7A 1NTCA 1V5EA 2GIZA 2I10A 2ID3A 4IRIA 1YE9A 2ZFWA 2J5OA 3ABMH 3I59A 5L3GA 2LFBA 5CYVA 1BJAA 2WWYA 3EQLF 2H6CA 2W24A 1JJ6C 3GZ6A 1JGSA 4LJZF 4XK4A 4M6YA 4I99C 3SQNA 3W6KB 5JVTA 1BJZA 1U8BA 5EEAA 1JKPC 2CWEA 4HSRA 3OYNA 2F5VA 2LNBA 1LFUP 2L2OA 3I59B 4EJTA 3J7AO 3FM5A 1MGTA 1G3YA 2JPBA 2CQKA 4OMZA 1UFMA 2CS3A 4U87A 1A36A 4BUPA 1UZCA 3BQYA 2O3FA 2XGEA 3F23A 2HZDA 1WFXA 1BR2A 3LAJA 2MG4A 1TNSA 3MAJA 4D7NA 4EJUA 3G6EI 2DJIA 2OD5A 1RI7A 1S7EA 2A3SA 4PK4A 3D5RC 1B72A 5JHUA 5DM6F 1U9OA 2AXLA 3K9TA 4OMYA 1FOWA 1ZR4A 1QPIA 5J8CA 1I3QJ 1QHGA 2HDCA 4YIIA 4EM2A 4J19A 2IA2A 1GUUA 5M5WJ 1I3AA 2E2HJ 1XPXA 1FX7A 4XIDA 3TMOA 4GYGA 1PP7U 2DA7A 5FD6A 4KISA 1TW3A 5C44J 1ETOA 1FWZA 5BPIA 4F91B 2GA1A 4XRSA 2CV2A 3OYIA 4H4KC 4DZJA 1BBYA 2CFXA 2DK8A 4XLAA 1Z6TA 2M1BA 5HDGA 3HSEA 3FXMA 3EYYA 1FOYA 1G6NA 3N97A 3DPUA 3PNVA 5BQTA 3V42A 4QPQA 1Z05A 1F5TA 1R5ID 2VT3A 2J5PA 4LIUA 2XF7A 4L9JA 2L7ZA 4XNFA 4CXFA 1YS6A 3RQIA 3BR3A 2M7BA 3E97A 3I55I 2HPMA 3KE2A 3F8NA 1UJ8A 4U0YA 2IA1A 2LVSA 2BGCA 1PVEA 3S32A 4BQAA 4CZZA 4I6ZA 1S29A 1Z1DA 5ICFA 2RC4A 1P4AA 1FZPB 5C4JJ 2CUFA 3BR2A 3KZYA 4HX8A 3MFKA 2FBKA 5IYDJ 1FNNA 1WJ5A 1X4OA 1Y8RB 2EPFA 3RQ4A 2XAFA 3CUQA 4YIFA 4HRIA 5ICEA 4M6VA 5FKKA 3I4NJ 4ETSA 3SYTA 5FLVA 4ZH4F 1ZG3A 2L3DA 3PUBA 3R61A 3Q9SA 5LHGA 3J81Z 5CVUA 3P5JA 2OF7A 3J7AY 4MEXF 1LDKB 1F1ZA 4I02A 3I4MJ 2HWVA 4Y15A 3A0BC 1X3ZB 3ZCOA 2LR8A 2RGVA 3RDIA 4C2UA 3CUQB 5D8KB 4A93J 1JTXA 5H6RA 1T6SA 1QVUA 4HBLA 3ZGKA 1B59A 2CU7A 5IYCJ 4DBRA 2PG4A 4D1QA 2M3AA 3H92A 4G94A 4OIRF 2Z9OA 2CMPA 3ROUA 1QVTA 2LOOA 4A3MJ 1QNTA 4C3HJ 1JE8A 2DDAA 4D0PA 4U0WA 4A3LJ 3FXOA 2K9LA 4IL6C 1WJBA 4RAZA 3PSIA 1J9IA 2NVUB 1ETQA 1JKQC 4DIQA 4C3JJ 2LH9A 2FMYA 3DKWA 3WU1B 2QGUA 4ESBA 4D5CA 5CKTA 1V5FA 3ZPLA 3GMEA 3ZN1A 1DGWY 2D2WA 1O3QA 1VF9A 3L2VA 3BCAA 2EIMH 2HYFA 4LLLA 3RYPA 4PJ0C 4L0ZB 1ETVA 2XPVA 1Y39A 4XLCA 1GDTA 3CC2I 1S9HA 3BG6A 1YS7A 2RQPA 1ZRDA 1OCOH 2E36A 3H9QA 3TW6A 3W2VA 1MBKA 3RTRA 3ZN0A 1X3UA 2M4KA 1QA6A 1BI1A 2STWA 2WAQN 4BBSJ 3V4GA 3CD6I 1ZK8A 5EYRA 3WE3A 2Q2EB 2Y0SN 4JBAA 2WTEA 3ZMZA 1KGSA 4KJZA 1FTTA 4LITA 1QBJA 2MSYA 5GADJ 1BW5A 3K1MA 4E7IA 5E3MA 3FKIJ 4BGDA 1OYIA 3QPLA 1HW5A 5BMZA 1ZTRA 3H3ZA 1HLVA 2STTA 1TWCJ 3WTWC 3PM1A 4HQEA 4CCKA 3JRIA 4XN3A 2IP2A 2W7NA 2DODA 4BY7J 1R71A 1Z7UA 1JXSA 2ZXHA 1N75A 2ZBKA 2GAUA 2PN6A 1IG7A 5D5WB 2VB6A 3M4OJ 1MBEA 2CQXA 3Q9VA 5F08A 1BI2A 1KZHA 3I56I 2NXNB 1JUPA 1FPQA 2JUGA 4Y17A 2JPCA 1ZH5A 2D1VA 4JQFA 2QA4I 1VFCA 1DP7P 3JCUC 4LGWA 4Y7NJ 2MD0A 2ZJRF 4A6EA 2I8DA 4XRFA 3L7WA 3M8EA 2CQNA 3DV8A 3W2WA 1HSTA 1IW7F 3LSPA 4RS8A 1R36A 4RM2A 4EEFG 4UHTA 1P6RA 2K9QA 1PDNC 4MIMA 4MHGA 1XGOA 1I50J 2ZNZA 1YW8A 4OIPF 4L5JA 3GFIA 4H0EA 2AQEA 2BY3A 1MDMA 1V3FA 5L3CA 2VPLA 4UB8C 2G7UA 2DMPA 3HXLA 4Z2YA 1K6OA 3H5RA 3CCLI 2DA4A 3IH2A 3ZP5A 1XS9A 3BJOA 3MEXA 1W1WE 2JA5J 5E1XA 4BHPA 3I5UA 2Y9YA 2FNAA 1E2XA 2E60A 4NQWA 3GF2A 1HCRA 2L4AA 3SXYA 4I76A 3NRVA 4BL0B 1UAAA 2O0YA 2K4JA 2HOTA 1IDZA 1LDJA 3P9IA 1FC3A 2JZYA 4ON0A 1VQMI 4GO1A 4HLXA 1H88C 4Y52J 3MQ0A 4RGRA 3GXOA 2BBYA 2OUMA 2IXSA 2K5CA 1B4AA 2QQ9A 3CESA 4O5VA 1NHAA 4L9VA 4R8HA 4XL9A 1IN5A 2EQRA 3ZR8X 5ILVA 4FX4A 1WSUA 1V55H 2DDBA 2M7AA 1BA5A 3H9JA 1ULYA 2QKMB 3HTSB 5FJ8J 2FA5A 2XAQA 2CFOA 5DYMA 4Q47A 4NQWB 2PX9A 1J09A 1YW7A 2CYYA 4MFEA 3A0HC 2XB5A 3TO7A 1O57A 3FWEA 3BWGA 3F8BA 2DTRA 1A6QA 2NNYA 2CV0A 1R6RA 2OPTA 4G6QA 5KAFC 1U0JA 2R7OA 2VKDA 5M3MJ 5LGNA 4RDUA 1RZ4A 3W3CA 1GLNA 2BW3A 2KRCA 2Q1ZB 4YFKF 1Y8QB 2RKHA 2WBMA 2KKOA 1LKXA 3T8RA 2RV8A 3DTKA 1O7LA 3LSTA 4RAYA 4ZYHA 4CYCA 1I6HJ 3GEZA 1HDPA 1MBHA 3DP7A 3GVAA 3E0JB 1T0FA 5TRDA 2Y75A 5M5YJ 1FP2A 1ZLJA 4HNTA 1G3TA 2K27A 2E71A 2ID6A 3ZQHA 4KIGA 2Y30A 4DGWB 4YELA 4UB6C 3CQZJ 3CDLA 5GPCA 2W84A 1W36D 1BOBA 2DA2A 1VQ4I 4CYCB 3CF5F 3QPTA 4BBRJ 1WZ2A 5AONA 3HRSA 1W7PB 5ED4A 2HKXA 3D5LA 2EFOA 3G73A 1EF4A 2WC2A 2IGNA 4FE4A 2DOFA 1S3JA 4PCQA 5AIQA 2XAHA 3DCFA 5E3LA 3GTMJ 2HZTA 1FLIA 4C30A 3C2HA 1E3OC 3KZIC 3T8TA 2P7VB 4QWQA 3HRUA 2H09A 5TJJA 3ERMA 4IJAA 2CRGA 3GLLA 3IAS2 2JVGA 5K7FA 2UZKA 1IRXA 4KIFA 2V7FA 3OIQA 4RAFA 4GGGA 3ECOA 4I01A 3IRQA 4E7JA 3ABTA 4LMYA 4DJAA 2UXNA 2M87A 5JHFA 2EIJH 3O2PE 3V8JA 1LEBA 4KNYA 5FFZA 1Z6RA 3MVPA 2EINH 4M73A 4A0YA 1XG1A 2DFHA 2X51A 1J7KA 3I4PA 3JAMZ 3FXLA 5K7HA 2K7LA 5E3OA 4BH9A 4BYYA 2R5YA 3DEWA 2WAQA 5CQEA 1O3SA 2BVLA 2XB0X 1VQ8I 1BI3A 4E70A 2Y0SA 2BXYA 3OYLA 2C6YA 4XLHA 4RGUA 4LOCA 2M45A 5KCMA 2ACJA 1D1AA 3VSKA 2GWRA 4HNUA 2QSHX 1KYWA 1D3YA 5IOZA 3K70C 3QPHA 2JMWA 5IOYA 2X9DA 1DDNA 4FHTA 4B44A 3K4NA 3F21A 2R5YB 1UMQA 3CMYA 4UY8I 1QQIA 2IEKA 2DI3A 5E1ZB 1SD4A 1WGXA 2PJRB 1TC3C 2Q0OA 3KP7A 5IT9K 1XCVA 3P9CA 3TGNA 3KLOA 4ZTFA 2WAFA 1KQ9A 3HDDA 1VQ6I 1W0TA 1FBSA 4XONA 3E1SA 5HDNA 4DYQA 4M74A 3BR5A 1JI8A 5DUKA 3HKZN 3MZYA 4CGZA 3DU5A 5F1RA 3KLNA 2LG4A 3WGIA 2VT2A 3K4LA 3OYJA 4OU0A 1B1BA 5D5UB 4UUTA 3ABKH 3K4CA 1KU3A 4X0GA 3JW4A 5HLIA 5LRSA 4KA4A 5IYBJ 1NK3P 2LY9A 2NNNA 2IAIA 3LAPA 2V1UA 3DBLB 3CUQC 1WWXA 1XSXA 5L3BA 1XSVA 4Q4ZF 1ZRCA 3EYIA 1D0YA 2ISYA 3R0AA 2ZMEA 2VODA 3GZ5A 5J4VA 1K61A 3DLLF 3TDUC 2HVRA 1YG2A 2MFZA 5BPDA 2HR3A 1YTYA 2GXAA 1OR7A 1BOAA 3JRDA 3B02A 4F3QA 3SDBA 3BCBA 5FFXA 3KYLA 2PMUA 3K1PA 3WTSC 3HSRA 3LWFA 4WK8F 4HEA2 1EV7A 4U0VA 4FTHA 3JRFA 2ZMEB 5HLHA 3M3YJ 2OC6A 2OQGA 2TDXA 3HL2A 1XX5A 1W5CC 2HGCA 2MLKA 3G4SI 3WHCA 1RIOH 1T39A 4K2EA 5JLXA 3S15J 3V8LA 3S1MJ 2DCEA 3PNTA 5GAGJ 3GWZA 2CJJA 2DN0A 3SEZA 3VYTB 3TEDA 1IXRC 3LQRA 3RKYA 4F52A 3MKZA 3PIPF 4IPAA 3G1LA 3Q3SA 4AYBN 3GTOJ 3EUKL 3QU3A 1NK2P 1LDDA 5H20A 1ONVA 2K3FA 3PO2J 5E1WA 1YJWI 5FKLA 4ENMA 5F0HA 5C4XJ 2BY2A 1I27A 3MN2A 3MKWB 2VKVA 3E5XA 3PIOF 4OIQF 3BY6A 4B43A 1WQ2A 2M5WA 3LSMA 2QF7A 2VI6A 1K6YA 3ZQCA 2V9KA 2A6EF 3JRCA 2Z33A 4QSHA 1O3TA 3HOVJ 3IKVA 1R1UA 5J47A 4HX7A 3IWZA 2Z3YA 5H6QA 5HS9A 2XASA 1HBXG 3S93A 2DFEA 3VYRB 3K1NA 3CC4I 1MD0A 1IO2A 1MNDA 3KP4A 4LIVA 3ECHA 3BTIA 1W5TA 3DLAA 5DD8A 2M34A 2Y69H 3HOXJ 2VE8A 4FT8A 5E8GA 2R7QA 4XICA 2WV0A 3IUOA 3ZMDA 2HOSA 2W4SA 3DKXA 2BXZA 1BIAA 4HDVA 2JUCA 3E6CC 2KIFA 2JQ7A 4DW6A 3HOSA 3P9KA 3HEFA 4DOZA 2H8WA 1FSHA 1SVMA 1R9TJ 3L09A 3E6BA 3JRHA 3U2RA 4RBOA 1J59A 3A01A 2DXIA 1B9MA 3IH3A 3TKYA 2LY2A 4AWXB 4HG2A 5GTHC 1RRJA 4GFBA 3HOWJ 1IV8A 1ZN2A 2IGKA 1Y1VJ 2A05A 3ISPA 1HKQA 1I1GA 1R5GA 4BACA 4UNOA 2PQ8A 1C0WA 4XKVA 2HTSA 5KHDA 2DO7A 2IT0A 1FMWA 1Z3XA 3CJQB 2XSJC 3S3MA 2WAEA 2RDPA 3L2WA 3A01B 3OOUA 1R4NB 5B66C 3HOUJ 3VODA 4M9SA 2EFPA 3AFHA 2I5UA 1REPC 4EVIA 1Z9CA 3NQOA 1XB4A 3TO9A 5J4YA 1JKRC 4I0BA 1OMIA 2V1XA 1SANA 1EA3A 2DFIA 1JUMA 2MLGA 2NVTJ 2ESHA 4CHUA 2YU9J 4M3DA 2NVYJ 5J3LA 3HB9A 2ADUA 1W0UA 2HXIA 2CUZA 4AIJA 4JK1X 3QP6A 3FHZA 4I2OA 4II3A 3AG3H 3AKZA 1FTZA 1SFOJ 1DPRA 4MEYF 4CCMA 3L1PA 1R1TA 2BY0A 2P6SA 2Q8KA 4A2UA 1HW1A 3KPHA 1F4KA 2JA8J 2Z2SB 4HQMA 1JHFA 2F5FA 4AIHA 2H8RA 2RNGA 4M3GA 2QVOA 3ZMVA 1CF7A 3NEUA 1QZYA 2MD5A 3QOEA 2Z99A 2E1MB 3A2KA 2E7WA 2GLOA 1WJEA 2JTVA 1FYKA 2X6YA 5IT3A 3F22A 1P4WA 5JI6A 1D0XA 4UVAA 3OS1A 1VQLI 3QP5A 3HKZA 1ON2A 4N9HA 1X19A 4M6XA 2YUSA 3OR2C 4A12A 3T5XA 3I71A 2Y31A 3BTJA 2VXZA 2M8GX 4BXUA 3HG9A 4A3JJ 4XMYA 1CF7B 1T08B 2L9NA 2X1DA 3BT9A 3OSGA 1XGMA 4AU7A 3JRGA 2Y0MA 1G59A 3G2BA 3CCJI 4UUVA 3GO5A 1U9NA 4KN7X 4EM0B 3EUAA 3TOAA 1F43A 2E1OA 1FYLA 1J5YA 2DK5A 4QTRA 2QSFX 3E7LA 4M9XA 2R7FA 2QEXI 4FE7A 3P7NA 1ZR2A 1T2KA 2IGMA 3QQAA 3NAUA 4CCLA 1ON1A 2BVMA 3MMYB 1X3WB 3W2AA 1HXDA 1UG0A 2FOKA 1T0FC 2L4MA 3QYBA 1MMAA 2P0WA 3H9GA 3GTLJ 5B5EC 3ZQ7A 1X1CA 1R00A 2ETHA 3LA3A 3TO6A 4E6KG 3IAM2 5EZGA 2ZO4A 2TCTA 2DPDA 4E7KA 4MNUA 4E4HA 2R92J 2YPRA 1H9TA 2LDUA 4LB5A 4LK1F 4DQ2A 3OYEA 2JA6J 4LLNA 4PZJA 1IDYA 3R4KA 3RSNA 4BAYA 4EM1A 1YIJI 4KICA 2VJJA 4HLYA 3ZRGA 3HIFA 2UWMA 2JRTA 4IRGA 3BTCA 3UKGA 2O5RA 1UHSA 2E34A 3I58A 3K2ZA 1SEUA 2EK5A 6PAXA 3C1DA 2OA4A 2V9VA 3JSOA 1TBXA 3U21A 3E6MA 3FXKA 5D6EA 3CCRI 1U5TA 5ILUA 4CH7A 2Y9ZA 4M71A 2MA3A 2LD5A 1HSJA 5DDGA 5CJ9A 1JT0A 4AYBA 3QOPA 4A3EJ 2OAZA 3O3KA 3VPRA 3WHBA 1U78A 4XOTA 3S3OA 1MNEA 1SFUA 2R7VA 5J1UA 3S1QJ 2V6CA 3OWTA 2EH3A 1XMXA 2K3PA 1U5TB 2R93J 3BQZA 3CLOA 1GT0C 2H1KA 1AHDP 3OMYA 1TLHB 3CJNA 2MYSA 4ZDLA 5ICGA 2VQHA 3RPQA 1FP1D 1LFPA 1OJLA 3W6JB 1MBJA 2XGCA 3CP8A 4V2GA 2VQGA 1G3SA 4UVCA 2F5CA 2KFDA 2JA2A 1X1PA 3CCYA 2P4WA 5JR3A 3L9FA 2NRAC 5JLWA 2YSRA 3DFGA 3JR9A 4C2MJ 3OY9A 3SDGA 1SFXA 2XUBA 1XDSA 2HTJA 3BR6A 3HHGA 1MBFA 1A35A 3KETA 2HYGD 3H0GJ 1IV6A 2HOAA 1OISA 2FU4A 2DW4A 4XKCA 1BW6A 2PMZA 3LOCA 3FDYA 3S3NA 4LFUA 1KU7A 2NYXA 1J2XA 2Q2EA 1S7AA 1VQKI 1YX3A 1W5SA 1ITYA 1QHHD 4Y4RA 2GQQA 4MO7A 5D5XB 3J81K 3FXUA 4A5MA 5HODA 4N4NB 2FMLA 3F3XA 3HYIA 1Y56A 4I0AA 1MMNA 3BZCA 4YRVA 4B3AA 1LUJB 3VB2A 1MMSA 2MGQA 4IF4A 4L5EA 3JRAA 4BU2A 3OYBA 3AG1H 2ZC2A 1ZG5A 2DAOA 1U3EM 4I7HA 4X1EA 3TOBA 3OS2A 2VOOA 1SAUA 1E0EA 1HA8A 1A6IA 4D5FA 3ZMUA 4QIWN 5BS6A 2EILH 2CV1A 2ZMEC 1I39A 3GW2A 4DNCA 1QZEA 5F27A 1YO5C 1WKMA 2XF5A 2B63J 3OS0A 2ZJPF 1OR7C 2LY1A 4JOMA 1D8JA 4ZYDA 2HQ5A 2LBFB 3TP3A 5EEGA 3FZVA 5E3NA 4MLOA 4BJ6C 1YLFA 3H5NA 1K4SA 2HEOA 2QLZA 1RR7A 3WE2A 3K4JA 3J7YJ 2DOAA 4N4OB 1ZARA 4QLCU 1OCTC 5FRNA 2JA7J 3ZMSA 1ZGAA 1A5JA 5GAEJ 2A68F 2L7FP 1T38A 1GXQA 2OCEA 2R3SA 3VOEA 3IP4B 4CZCA 2QCOA 4OOIA 2R7SA 1IRGA 4IVNA 1OCRH 2HS5A 1L0OC 3QODA 1S72I 4L0YB 1TQIA 1TQPA 2KIMA 1I1SA 1EH8A 3ML6A 4EJWA 3OYCA 3KZZA 3BG9A 1IUYA 2ZJQF 4AIKA 3H1CA 3M7GA 3K4KA 2DPUA 1VI0A 2E1NA 2VJ5A 1LJ9A 2QM3A 2ELJA 2OTLI 4GYIA 3EETA 1K4TA 1BR1A 4LB6B 1USTA 3CCEI 2ME0A 2XPUA 4OAYA 3B6AA 4C9YA 5CVVA 5K5OA 3VYUB 1ETXA 2F4OB 4HOBA 2KIUA 5GAHJ 4RLFA 4ITVA 2F2EA 1UHWA 1WJCA 3H3VK 1V54H 3QPSA 3C7JA 3OYDA 4G7ZF 2L0KA 1FMVA 1G3WA 4NNJA 1S6LA 5DCFA 4KYWA 3I54A 1EH7A 3CDIA 3KYCB 4XR6A 3H3UA 5F04A 3HUGB 1XN7A 2O6GE 4KITB 4CA0A 1MBGA 4O3MA 1PUFB 2GXBA 5D4SA 5M5XJ 3IL2A 3K10A 2X6WA 2FE3A 3SFIA 3C3WA 5HVQC 2R7DA 4V19K 2KP6A 2CGPA 1FY7A 2HQAA 3FMQA 1OPCA 2P8TA 4UXNA 1ETYA 1ZRFA 3IKTA 3GTKJ 2MC4A 1MJAA 1HDDC 1TWHJ 2FJ1A 3K2AA 4XLPF 4ZZLA 3WTXC 1AU7A 1XGNA 2R5ZA 5HNFA 5E17F 3L2CA 2K9NA 1Z0XA 3LSHA 1Y0UA 3LFUA 5E20A 2LP0A 1JKOC 1XTAA 1AOYA 4HNVA 4BQQA 4RB1A 2XSDC 1KYZA 1ZAOA 4IHSA 1E3HA 1W7PA 1WJAA 4G12A 3LA2A 5K7ZA 2UUZA 2XRNA 3F9KA 3L2UA 4B48A 2BEOA 4GCVA 1QGPA 2W85A 2R5ZB 1P4XA 2DU9A 4L18B 1H0MA 1TTYA 4E7SA 4F92B 2B9SA 5EEHA 5HNHA 3S8PA 1B8IA 3RKQA 1R7JA 2XGXA 3GTGJ 2EJRA 4B4CA 5DM7F 5EF6A 4JYKA 4ZC3A 3VEPA 2VIXA 3BZKA 1VQPI 3LNQA 2DT5A 1VZ0A 4MFDA 2W48A 5DTDA 3UNGC 4BQNA 4PJLA 3A03A 3CCVI 4MQ9F 4G9YA 2RN7A 1POGA 2M30A 2E1MC 5EG0A 3LA7A 3T1BA 5KVRA 1G4DA 3FX3A 4PFOA 2KRFA 4HX4A 3HBLA 5B1AH 1B8IB 1WH7A 3ZQIA 5LEKA 5DD4A 1UG2A 2VJIA 3O8GA 3BPVA 1XGSA 4P1WA 4ZDPA 2CUEA 3RCOA 2R4GA 2EFQA 4B09A 2EZHA 5FD5A 2DLLA 3FMRA 5D8LB 4HF0A 3N05A 1KQ0A 2PLYA 2D45A 5EG0B 3FXRA 3CUOA 1IF1A 1G8XA 1LQ1A 1V5GA 4FISA 5EGOB 1PJRA 3VDXA 4MTDA 1R4MB 4S0HB 2K85A 1T8IA 1FBQA 1SC7A 2ZXIA 3D5SC 3HJEA 1XDUA 2MW8A 4A5NA 1K79A 2A6TA 5TGTA 2VKHA 2DA3A 2O03A 1P9QC 2HYJA 3LQQA
chains in the Genus database with same CATH topology
4L9TA 4ZYEA 2EFWA 3F8CA 2FF4A 3EUHA 4OINF 2FBHA 2IPQX 1EH6A 3F72A 3RKXA 3SZPA 1HQCA 2FXAA 1SD6A 1XMKA 2EA2A 5J6XA 2E1CA 4G7OF 3E5UA 3JAMK 1BIBA 1U5TC 2YX7A 3HTUA 3GYHX 2L02A 1TW2A 4WX9A 2K02A 4ESJA 3MZHA 4F7ZA 4KT5C 3DEUA 5CVIA 2H6BA 3HHHA 4XSXF 5DCMA 4RB0A 2EV6A 3DF8A 4R1HA 5HS7A 3V7SA 3RYRA 2EB7A 2VBWA 4N0BA 1R22A 4EGYA 3J80Z 1IXCA 3WTUC 4PGHA 4CO8A 3F6OA 1HW2A 3QU6A 1FOKA 3ERED 5DCMB 4S04A 3ULQB 5CLSA 1BN5A 2A07F 1K78B 2G7HA 2D1HA 5K1YA 2KJCA 5FB2A 2XVCA 2EV5A 1SAXA 2YR2A 5JFRA 1XD7A 5FLXZ 2QBYB 2HFHA 4RGXA 5A2QZ 2YU3A 2QQBA 2PI0A 3DQVC 3RJPA 2XV4S 4ENNA 1MKMA 1ZHFA 1IN7A 2XAJA 2UXXA 3IWFA 3OOPA 1SD5A 1ZLKA 1QPMA 1TNTA 2XKPA 5DV5A 1GXPA 4PDKA 1V4RA 4B8XA 3FMSA 1P2FA 1BC7C 2FSWA 4HDUA 4KUMA 4BHCA 3BJAA 5K5QA 3PQKA 3GLXA 1GVJA 1SD7A 3KEOA 2AS5F 3DPTA 3M1EA 2ZXJA 4HV6A 5HOOA 5BOXA 3RPUA 4P9UA 2QZ8A 3WTTC 3E3VA 1DUXC 3WTYC 3SFZA 1Q1HA 3WTVC 3L00A 2OQRA 1R5HA 1J0RA 3KP2A 2VBXA 1B9NA 3ZMTA 2VN2A 3KP3A 2IW5A 3CTAA 4Q5SF 5ILSA 5CVRA 1K7AA 4HV5A 3AAFA 1LB2A 4A0ZA 4MGRA 2P5VA 3DXJF 3K0LA 4A6DA 2ESNA 1F9NA 5LHHA 3ABUA 1PUEE 4MTEA 1XSDA 4HF1A 3E6DA 3VFZA 3SHFA 4WCGA 1O7FA 2DQLA 4UVBA 4WXDA 4ZYGA 3GX4X 4U7BA 2DQRA 5LGUA 1T98A 5LHIA 4P55A 1JHHA 5J8FA 2MBFA 1OYWA 1KA8A 3OV8A 2XKOA 4P96A 4P5OA 4RGSA 2HQRA 3I0TA 4AD9A 3WGGA 1MJBA 4KN4X 2PFBA 2GIVA 4RB3C 3DPLC 4UV8A 3BZ6A 4BHBA 2LF7A 3GFMA 3HOTA 2L01A 4AVPA 5L3EA 2HQNA 2PMHA 5D5VB 2Z5UA 2FRHA 3C18A 3V8KA 4XSZF 5ERIA 2HOEA 3HRMA 4L9NA 5KK1A 2XHKA 3N4MA 1USSA 2RVCA 1UB9A 1SMTA 1BC8C 5K5RA 4LG0A 4Y13A 1R58A 3R0JA 2K4BA 1OYYA 5D6FA 1YQAA 2W25A 1RUNA 1IRFA 2EWNA 2YX4A 2H94A 4LG0B 4G7HF 1UHMA 2P6TA 1B6AA 1UCRA 2VBZA 2A61A 1A04A 2OBPA 2LSOA 3F8FA 3COAC 2X0LA 4XBFA 2V79A 3IHUA 5FGMA 4WWCA 3Q5FA 1RUOA 1QZZA 1YFHA 3CO6C 2CO5A 4IRHA 4A0XA 2P5KA 2ZJ2A 2V1DA 3RI4A 4XLNF 2A69F 4CICA 2XAGA 1U2WA 2KJBA 4PGGA 1E17A 2IA0A 3V7RA 3IC7A 3KP5A 1FYMA 5L3DA 5HLGA 1R1VA 4UV9A 1LEAA 3EDPA 2VC0A 2IRFG 5F6FA 2ISZA 5E18F 3BROA 3GFLA 1OKRA 3KFWX 3G3ZA 5LRRA 2NS0A 5ICCA 2A6HF 5LGTA 3PQJA 1XCBA 4G6DA 4P9FA 3BJ6A 2MC3A 3WU0A 4KMUX 1FBUA 3CO7C 2IVMA 1LVAA 2O61A 4FX0A 1KU2A 4LLGF 4CDGA 3BP8A 1SMYF 1IN6A 1FSEA 2IJLA 3WG9A 2G9WA 4YFXF 3HUGA 4NHJA 1D8KA 3JTHA 1I6XA 4OIOF 1R23A 3F6VA 2OU2A 2F5DA 2EFNA 2ZCWA 4N9IA 2P5LC 1W7PD 1TQMA 2MH2A 3TQNA 4HYEA 3V7CA 4IXAA 5L3FA 1BM9A 3T0YA 2K86A 1MDMB 5LBQA 4I98B 1ZYRF 4EJVA 2GZWA 1XMAA 1MJ9A 4HAMA 4S05A 1I5ZA 3JSPA 1FT9A 4ASNA 3BOQA 2CSOA 5D4RA 2E7XA 4KDPA 5FO5A 2HKOA 3I53A 1Z91A 2EV0A 1YYVA 1S8NA 3HSFA 2ZNYA 1LNWA 2L54A 2FNPA 3JTGA 4WF2A 2EA4A 3FF5A 3FM3A 1WI9A 1QO0D 2OZ6A 2XIGA 1O3RA 4WXHA 4RB2C 1H9GA 2VBYA 3KP6A 4CYDA 5AIPA 1RNLA 4HF2A 4HW0A 3F8MA 4KMFA 2JSCA 4HZFA 2ELHA 4WXCA 1AWCA 4Q48A 5IT9Z 2P7CB 1YW9A 3O6BB 5HDKA 3KCCA 3RIRA 1D5VA 2A5YB 3WODF 1W4MA 2BE5F 3M8FA 1HKTA 3BPXA 1ODDA 3K69A 3WTZA 4EGZA 1IN8A 2PEXA 3ELKA 1STZA 1ZG1A 3GFJA 3U9GA 4YFNF 2LF8A 4U88A 3R6SA 2QUFA 4ENJA 2COMA 3B73A 4TV7A 3PFIA 2CW0F 4KFCA 2VOPA 2QWWA 5LLQA 4EJOA 5E8IA 4HA8A 2QENA 4U7DA 4NB5A 4L5IA 4LK0F 3S2WA 2BYVE 1U8RA 2XROA 1IN4A 4ZZDA 4EQQA 5F64A 2VONA 3HRTA 2PBIA 1WRJA 2W57A 1BI0A 3KEQA 1YIOA 5CVJA 3LFKA 2BV6A 3REOA 1SFEA 2CG4A 3D0SA 2F5EA 2GXGA 3RKWA 2RNJA 1L3LA 1IXSB 1IZ1A 1K78A 1U6GA 2FBIA 3M9AA 3IRRA 1DPUA 3U1DA 4BNCA 1HKSA 1GHCA 2PJPA 2VE9A 3MWMA 3I64A 1ZREA 1J75A 3E5QA 1CGPA 3QRFF 2QBYA 2JT1A 2Y48A 1IAWA 1KQ8A 4G8XA 1S7OA 2ZKZA 4R79A 1PP8F 2MH9A 2X4HA 4KIBA 2O8XA 4I09A 3MCZA 2DBBA 2GA2A 3TDZC 4O6JA 4M72A 2FQ3A 4GXOA 3CDHA 5HS8A 3FXQA 4YG2F 4LD5A 2M8EA 3J80K 3QAHA 1MZBA 2OZUA 2QYOA 4IHTA 1VTNC 1P92A 4ESFA 2VC1A 3BDDA 4EV0A 5LEJA 2LKPA 5DUIA 2H27A 3R60A 2B0LA 5DEQA 4EMSA 5FLXK 3WGHA 4ENKA 4MQVA 2FEZA 2QQAA 1ZGJA 5A2QK 3SZTA 3GUDA 2NAZA 4M9ZA 1KU9A 4IRIA 2ZFWA 2J5OA 3I59A 5L3GA 5CYVA 1BJAA 2WWYA 3EQLF 2H6CA 2W24A 3GZ6A 1JGSA 4LJZF 4M6YA 5JVTA 3SQNA 3W6KB 2CWEA 2LNBA 3I59B 4EJTA 3J7AO 3FM5A 1MGTA 1G3YA 2JPBA 2CQKA 4OMZA 1UFMA 2O3FA 3F23A 3LAJA 1TNSA 3MAJA 4EJUA 2OD5A 1RI7A 2A3SA 5JHUA 2AXLA 3K9TA 4OMYA 5J8CA 2HDCA 4YIIA 4EM2A 2IA2A 1FX7A 4GYGA 1PP7U 5FD6A 1TW3A 1FWZA 5BPIA 2GA1A 1BBYA 2CFXA 2DK8A 1Z6TA 2M1BA 5HDGA 3HSEA 3EYYA 1G6NA 3N97A 5BQTA 1Z05A 1F5TA 2VT3A 2J5PA 4L9JA 4CXFA 1YS6A 3E97A 3KE2A 3F8NA 4U0YA 2IA1A 2BGCA 4BQAA 4CZZA 1S29A 1Z1DA 5ICFA 2RC4A 1P4AA 1FZPB 3KZYA 4HX8A 3MFKA 2FBKA 1FNNA 2XAFA 3CUQA 4YIFA 5ICEA 4ETSA 4ZH4F 1ZG3A 2L3DA 3R61A 3Q9SA 5LHGA 3J81Z 5CVUA 4MEXF 1LDKB 1F1ZA 4I02A 2HWVA 4Y15A 2RGVA 3RDIA 3CUQB 5D8KB 5H6RA 1T6SA 4HBLA 1B59A 2PG4A 3H92A 4G94A 4OIRF 2Z9OA 3ROUA 1QNTA 1JE8A 4D0PA 4U0WA 4RAZA 1J9IA 2FMYA 3DKWA 3WU1B 4ESBA 3ZPLA 3ZN1A 2D2WA 1O3QA 2HYFA 4LLLA 3RYPA 4L0ZB 1YS7A 2RQPA 1ZRDA 3ZN0A 3RTRA 1X3UA 1BI1A 2STWA 3V4GA 3WE3A 4JBAA 2WTEA 3ZMZA 1KGSA 1QBJA 3K1MA 1OYIA 1HW5A 5BMZA 3H3ZA 2STTA 3WTWC 4HQEA 2IP2A 1Z7UA 1JXSA 2ZBKA 2GAUA 2PN6A 5D5WB 3Q9VA 1BI2A 1FPQA 4Y17A 2JPCA 1ZH5A 2D1VA 4JQFA 1DP7P 4LGWA 4A6EA 4XRFA 3L7WA 3M8EA 3DV8A 1HSTA 1IW7F 4RS8A 1R36A 4UHTA 1P6RA 1PDNC 4MHGA 1XGOA 2ZNZA 4OIPF 1YW8A 4L5JA 3GFIA 4H0EA 1MDMA 1V3FA 5L3CA 2G7UA 4Z2YA 1K6OA 3ZP5A 3BJOA 3MEXA 5E1XA 4BHPA 3I5UA 2FNAA 1E2XA 4NQWA 3GF2A 2L4AA 3SXYA 3NRVA 2O0YA 2K4JA 1LDJA 3P9IA 1FC3A 2JZYA 4ON0A 4GO1A 4HLXA 3MQ0A 4RGRA 3GXOA 2BBYA 2QQ9A 1B4AA 4O5VA 1NHAA 4L9VA 4R8HA 4FX4A 1IN5A 1WSUA 5ILVA 1ULYA 3HTSB 2FA5A 2XAQA 5DYMA 4Q47A 1YW7A 2CYYA 3TO7A 1O57A 3FWEA 3BWGA 3F8BA 2DTRA 2NNYA 4G6QA 5LGNA 1RZ4A 4YFKF 2RKHA 2KKOA 3T8RA 2RV8A 4RAYA 1O7LA 3LSTA 4ZYHA 3GEZA 3DP7A 3GVAA 1T0FA 5TRDA 2Y75A 1FP2A 1ZLJA 1G3TA 2K27A 4KIGA 2W84A 3QPTA 5AONA 3HRSA 1W7PB 5ED4A 2HKXA 3D5LA 2EFOA 3G73A 2WC2A 1S3JA 4PCQA 5AIQA 2XAHA 2HZTA 1FLIA 3T8TA 2P7VB 4QWQA 3HRUA 2H09A 5TJJA 4IJAA 2UZKA 4KIFA 4GGGA 3ECOA 3IRQA 4I01A 3ABTA 4LMYA 2UXNA 2M87A 3O2PE 3V8JA 1LEBA 4KNYA 5FFZA 1Z6RA 4M73A 4A0YA 1J7KA 3I4PA 3JAMZ 2K7LA 4BH9A 4BYYA 1O3SA 1BI3A 4E70A 2C6YA 4RGUA 2M45A 2ACJA 2GWRA 1KYWA 1D3YA 3QPHA 1DDNA 4FHTA 3F21A 1QQIA 2DI3A 5E1ZB 1SD4A 2Q0OA 3KP7A 5IT9K 1XCVA 3P9CA 3TGNA 3KLOA 1KQ9A 1FBSA 5HDNA 4M74A 5DUKA 3MZYA 4CGZA 5F1RA 3KLNA 3WGIA 2VT2A 4OU0A 1B1BA 5D5UB 1KU3A 3JW4A 5HLIA 5LRSA 4KA4A 2NNNA 3LAPA 2V1UA 3CUQC 1WWXA 1XSXA 5L3BA 1XSVA 4Q4ZF 1ZRCA 3EYIA 2ISYA 3R0AA 2ZMEA 2VODA 3GZ5A 3TDUC 1YG2A 5BPDA 2HR3A 1YTYA 1OR7A 1BOAA 3B02A 5FFXA 2PMUA 3K1PA 3WTSC 3HSRA 3LWFA 4WK8F 1EV7A 4U0VA 2ZMEB 5HLHA 2OQGA 2TDXA 2HGCA 2MLKA 1RIOH 1T39A 4K2EA 3V8LA 3GWZA 1IXRC 3LQRA 3RKYA 4IPAA 3QU3A 1LDDA 5H20A 1ONVA 5E1WA 4ENMA 1I27A 3E5XA 4OIQF 3BY6A 1WQ2A 2M5WA 2Z33A 2A6EF 1O3TA 3IKVA 1R1UA 4HX7A 3IWZA 2Z3YA 5H6QA 5HS9A 2XASA 1HBXG 3K1NA 1MD0A 3KP4A 3ECHA 1W5TA 5DD8A 1Z9CA 2VE8A 4FT8A 5E8GA 2WV0A 3ZMDA 1BIAA 4HDVA 3E6CC 2KIFA 3HOSA 3P9KA 1FSHA 3L09A 3E6BA 3U2RA 1J59A 1B9MA 3TKYA 4AWXB 1ZN2A 3ISPA 1HKQA 1I1GA 1R5GA 4UNOA 2PQ8A 1C0WA 2HTSA 2DO7A 2IT0A 2RDPA 3VODA 4M9SA 2EFPA 1REPC 4EVIA 3NQOA 1XB4A 3TO9A 4I0BA 1OMIA 2V1XA 2DFIA 2MLGA 2ESHA 4CHUA 2ADUA 4AIJA 4JK1X 3QP6A 3FHZA 4I2OA 1DPRA 4MEYF 1R1TA 2P6SA 2Q8KA 4A2UA 1HW1A 1F4KA 4HQMA 1JHFA 2F5FA 4AIHA 2QVOA 3ZMVA 1CF7A 3NEUA 1QZYA 2MD5A 2Z99A 2E7WA 2JTVA 1FYKA 5IT3A 3F22A 1P4WA 5JI6A 4UVAA 3QP5A 1ON2A 4N9HA 4M6XA 4A12A 3T5XA 3I71A 2VXZA 4BXUA 1CF7B 1XGMA 2Y0MA 4UUVA 3GO5A 4KN7X 4EM0B 3TOAA 1FYLA 1J5YA 2DK5A 4M9XA 2R7FA 3P7NA 1T2KA 1ON1A 1HXDA 2FOKA 2L4MA 3ZQ7A 1R00A 2ETHA 3LA3A 3TO6A 2ZO4A 2DPDA 4MNUA 2YPRA 1H9TA 2LDUA 4LB5A 4LK1F 4DQ2A 4LLNA 4PZJA 3R4KA 4BAYA 4EM1A 4KICA 4HLYA 3HIFA 2UWMA 2JRTA 4IRGA 3I58A 3K2ZA 2EK5A 6PAXA 3C1DA 2OA4A 2V9VA 3JSOA 1TBXA 3E6MA 1AOYA 5D6EA 1U5TA 5ILUA 4M71A 2MA3A 1HSJA 5DDGA 5CJ9A 3QOPA 2OAZA 3O3KA 1U78A 1SFUA 2V6CA 1U5TB 3CLOA 1TLHB 3CJNA 5ICGA 3RPQA 1FP1D 3W6JB 1G3SA 4UVCA 2F5CA 2P4WA 5JR3A 3L9FA 2NRAC 2YSRA 3DFGA 1SFXA 2XUBA 1XDSA 2HTJA 3HHGA 3KETA 2HYGD 2FU4A 2DW4A 4LFUA 1KU7A 2NYXA 1J2XA 2Q2EA 1S7AA 1W5SA 2GQQA 5D5XB 3J81K 3FXUA 4A5MA 2FMLA 3F3XA 3HYIA 4I0AA 3VB2A 4IF4A 1ZG5A 2DAOA 1U3EM 4I7HA 3TOBA 2VOOA 3ZMUA 5BS6A 3GW2A 4DNCA 1YO5C 1WKMA 1D8JA 4ZYDA 5EEGA 3FZVA 1YLFA 2HEOA 2QLZA 3WE2A 4QLCU 1ZARA 3ZMSA 1ZGAA 2A68F 1T38A 1GXQA 2R3SA 3VOEA 4OOIA 1IRGA 4IVNA 2HS5A 1L0OC 4L0YB 1TQIA 1TQPA 2KIMA 1I1SA 1EH8A 3ML6A 4EJWA 3KZZA 1IUYA 4AIKA 3M7GA 2DPUA 2E1NA 1LJ9A 2QM3A 4GYIA 3EETA 4LB6B 1USTA 5CVVA 5K5OA 4HOBA 2KIUA 2F2EA 1UHWA 3C7JA 4G7ZF 1G3WA 1S6LA 5DCFA 4KYWA 3I54A 1EH7A 3H3UA 1XN7A 2O6GE 2GXBA 4O3MA 5D4SA 3IL2A 2FE3A 3C3WA 5HVQC 2R7DA 2CGPA 1FY7A 3FMQA 1OPCA 2P8TA 4UXNA 1ZRFA 3IKTA 1MJAA 4XLPF 4ZZLA 3WTXC 1XGNA 5E17F 3L2CA 1Y0UA 5E20A 4RB1A 1KYZA 1ZAOA 4IHSA 1W7PA 3LA2A 2XRNA 2BEOA 4GCVA 1QGPA 2W85A 1P4XA 2DU9A 4L18B 1H0MA 1TTYA 5EEHA 1R7JA 2XGXA 2EJRA 3VEPA 2DT5A 4MQ9F 4G9YA 2RN7A 2M30A 3LA7A 3T1BA 5KVRA 1G4DA 3FX3A 2KRFA 4HX4A 5LEKA 5DD4A 3BPVA 1XGSA 2EFQA 4B09A 5FD5A 2DLLA 3FMRA 5D8LB 4HF0A 1KQ0A 2PLYA 2D45A 3FXRA 3CUOA 1IF1A 1LQ1A 4MTDA 1FBQA 4A5NA 1K79A 1XDUA 2O03A 3LQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9T A;  4ZYE A;  2EFW A;  3F8C A;  2FF4 A;  3EUH A;  4OIN F;  2FBH A;  2IPQ X;  1EH6 A;  3F72 A;  3RKX A;  3SZP A;  1HQC A;  2FXA A;  1SD6 A;  1XMK A;  2EA2 A;  5J6X A;  2E1C A;  4G7O F;  3E5U A;  3JAM K;  1BIB A;  1U5T C;  2YX7 A;  3HTU A;  3GYH X;  2L02 A;  1TW2 A;  4WX9 A;  2K02 A;  4ESJ A;  3MZH A;  4F7Z A;  4KT5 C;  3DEU A;  5CVI A;  2H6B A;  3HHH A;  4XSX F;  5DCM A;  4RB0 A;  2EV6 A;  3DF8 A;  4R1H A;  5HS7 A;  3V7S A;  3RYR A;  2EB7 A;  2VBW A;  4N0B A;  1R22 A;  4EGY A;  3J80 Z;  1IXC A;  3WTU C;  4PGH A;  4CO8 A;  3F6O A;  1HW2 A;  3QU6 A;  1FOK A;  3ERE D;  5DCM B;  4S04 A;  3ULQ B;  5CLS A;  1BN5 A;  2A07 F;  1K78 B;  2G7H A;  2D1H A;  5K1Y A;  2KJC A;  5FB2 A;  2XVC A;  2EV5 A;  1SAX A;  2YR2 A;  5JFR A;  1XD7 A;  5FLX Z;  2QBY B;  2HFH A;  4RGX A;  5A2Q Z;  2YU3 A;  2QQB A;  2PI0 A;  3DQV C;  3RJP A;  2XV4 S;  4ENN A;  1MKM A;  1ZHF A;  1IN7 A;  2XAJ A;  2UXX A;  3IWF A;  3OOP A;  1SD5 A;  1ZLK A;  1QPM A;  1TNT A;  2XKP A;  5DV5 A;  1GXP A;  4PDK A;  1V4R A;  4B8X A;  3FMS A;  1P2F A;  1BC7 C;  2FSW A;  4HDU A;  4KUM A;  4BHC A;  3BJA A;  5K5Q A;  3PQK A;  3GLX A;  1GVJ A;  1SD7 A;  3KEO A;  2AS5 F;  3DPT A;  3M1E A;  2ZXJ A;  4HV6 A;  5HOO A;  5BOX A;  3RPU A;  4P9U A;  2QZ8 A;  3WTT C;  3E3V A;  1DUX C;  3WTY C;  3SFZ A;  1Q1H A;  3WTV C;  3L00 A;  2OQR A;  1R5H A;  1J0R A;  3KP2 A;  2VBX A;  1B9N A;  3ZMT A;  2VN2 A;  3KP3 A;  2IW5 A;  3CTA A;  4Q5S F;  5ILS A;  5CVR A;  1K7A A;  4HV5 A;  3AAF A;  1LB2 A;  4A0Z A;  4MGR A;  2P5V A;  3DXJ F;  3K0L A;  4A6D A;  2ESN A;  1F9N A;  5LHH A;  3ABU A;  1PUE E;  4MTE A;  1XSD A;  4HF1 A;  3E6D A;  3VFZ A;  3SHF A;  4WCG A;  1O7F A;  2DQL A;  4UVB A;  4WXD A;  4ZYG A;  3GX4 X;  4U7B A;  2DQR A;  5LGU A;  1T98 A;  5LHI A;  4P55 A;  1JHH A;  5J8F A;  2MBF A;  1OYW A;  1KA8 A;  3OV8 A;  2XKO A;  4P96 A;  4P5O A;  4RGS A;  2HQR A;  3I0T A;  4AD9 A;  3WGG A;  1MJB A;  4KN4 X;  2PFB A;  2GIV A;  4RB3 C;  3DPL C;  4UV8 A;  3BZ6 A;  4BHB A;  2LF7 A;  3GFM A;  3HOT A;  2L01 A;  4AVP A;  5L3E A;  2HQN A;  2PMH A;  5D5V B;  2Z5U A;  2FRH A;  3C18 A;  3V8K A;  4XSZ F;  5ERI A;  2HOE A;  3HRM A;  4L9N A;  5KK1 A;  2XHK A;  3N4M A;  1USS A;  2RVC A;  1UB9 A;  1SMT A;  1BC8 C;  5K5R A;  4LG0 A;  4Y13 A;  1R58 A;  3R0J A;  2K4B A;  1OYY A;  5D6F A;  1YQA A;  2W25 A;  1RUN A;  1IRF A;  2EWN A;  2YX4 A;  2H94 A;  4LG0 B;  4G7H F;  1UHM A;  2P6T A;  1B6A A;  1UCR A;  2VBZ A;  2A61 A;  1A04 A;  2OBP A;  2LSO A;  3F8F A;  3COA C;  2X0L A;  4XBF A;  2V79 A;  3IHU A;  5FGM A;  4WWC A;  3Q5F A;  1RUO A;  1QZZ A;  1YFH A;  3CO6 C;  2CO5 A;  4IRH A;  4A0X A;  2P5K A;  2ZJ2 A;  2V1D A;  3RI4 A;  4XLN F;  2A69 F;  4CIC A;  2XAG A;  1U2W A;  2KJB A;  4PGG A;  1E17 A;  2IA0 A;  3V7R A;  3IC7 A;  3KP5 A;  1FYM A;  5L3D A;  5HLG A;  1R1V A;  4UV9 A;  1LEA A;  3EDP A;  2VC0 A;  2IRF G;  5F6F A;  2ISZ A;  5E18 F;  3BRO A;  3GFL A;  1OKR A;  3KFW X;  3G3Z A;  5LRR A;  2NS0 A;  5ICC A;  2A6H F;  5LGT A;  3PQJ A;  1XCB A;  4G6D A;  4P9F A;  3BJ6 A;  2MC3 A;  3WU0 A;  4KMU X;  1FBU A;  3CO7 C;  2IVM A;  1LVA A;  2O61 A;  4FX0 A;  1KU2 A;  4LLG F;  4CDG A;  3BP8 A;  1SMY F;  1IN6 A;  1FSE A;  2IJL A;  3WG9 A;  2G9W A;  4YFX F;  3HUG A;  4NHJ A;  1D8K A;  3JTH A;  1I6X A;  4OIO F;  1R23 A;  3F6V A;  2OU2 A;  2F5D A;  2EFN A;  2ZCW A;  4N9I A;  2P5L C;  1W7P D;  1TQM A;  2MH2 A;  3TQN A;  4HYE A;  3V7C A;  4IXA A;  5L3F A;  1BM9 A;  3T0Y A;  2K86 A;  1MDM B;  5LBQ A;  4I98 B;  1ZYR F;  4EJV A;  2GZW A;  1XMA A;  1MJ9 A;  4HAM A;  4S05 A;  1I5Z A;  3JSP A;  1FT9 A;  4ASN A;  3BOQ A;  2CSO A;  5D4R A;  2E7X A;  4KDP A;  5FO5 A;  2HKO A;  3I53 A;  1Z91 A;  2EV0 A;  1YYV A;  1S8N A;  3HSF A;  2ZNY A;  1LNW A;  2L54 A;  2FNP A;  3JTG A;  4WF2 A;  2EA4 A;  3FF5 A;  3FM3 A;  1WI9 A;  1QO0 D;  2OZ6 A;  2XIG A;  1O3R A;  4WXH A;  4RB2 C;  1H9G A;  2VBY A;  3KP6 A;  4CYD A;  5AIP A;  1RNL A;  4HF2 A;  4HW0 A;  3F8M A;  4KMF A;  2JSC A;  4HZF A;  2ELH A;  4WXC A;  1AWC A;  4Q48 A;  5IT9 Z;  2P7C B;  1YW9 A;  3O6B B;  5HDK A;  3KCC A;  3RIR A;  1D5V A;  2A5Y B;  3WOD F;  1W4M A;  2BE5 F;  3M8F A;  1HKT A;  3BPX A;  1ODD A;  3K69 A;  3WTZ A;  4EGZ A;  1IN8 A;  2PEX A;  3ELK A;  1STZ A;  1ZG1 A;  3GFJ A;  3U9G A;  4YFN F;  2LF8 A;  4U88 A;  3R6S A;  2QUF A;  4ENJ A;  2COM A;  3B73 A;  4TV7 A;  3PFI A;  2CW0 F;  4KFC A;  2VOP A;  2QWW A;  5LLQ A;  4EJO A;  5E8I A;  4HA8 A;  2QEN A;  4U7D A;  4NB5 A;  4L5I A;  4LK0 F;  3S2W A;  2BYV E;  1U8R A;  2XRO A;  1IN4 A;  4ZZD A;  4EQQ A;  5F64 A;  2VON A;  3HRT A;  2PBI A;  1WRJ A;  2W57 A;  1BI0 A;  3KEQ A;  1YIO A;  5CVJ A;  3LFK A;  2BV6 A;  3REO A;  1SFE A;  2CG4 A;  3D0S A;  2F5E A;  2GXG A;  3RKW A;  2RNJ A;  1L3L A;  1IXS B;  1IZ1 A;  1K78 A;  1U6G A;  2FBI A;  3M9A A;  3IRR A;  1DPU A;  3U1D A;  4BNC A;  1HKS A;  1GHC A;  2PJP A;  2VE9 A;  3MWM A;  3I64 A;  1ZRE A;  1J75 A;  3E5Q A;  1CGP A;  3QRF F;  2QBY A;  2JT1 A;  2Y48 A;  1IAW A;  1KQ8 A;  4G8X A;  1S7O A;  2ZKZ A;  4R79 A;  1PP8 F;  2MH9 A;  2X4H A;  4KIB A;  2O8X A;  4I09 A;  3MCZ A;  2DBB A;  2GA2 A;  3TDZ C;  4O6J A;  4M72 A;  2FQ3 A;  4GXO A;  3CDH A;  5HS8 A;  3FXQ A;  4YG2 F;  4LD5 A;  2M8E A;  3J80 K;  3QAH A;  1MZB A;  2OZU A;  2QYO A;  4IHT A;  1VTN C;  1P92 A;  4ESF A;  2VC1 A;  3BDD A;  4EV0 A;  5LEJ A;  2LKP A;  5DUI A;  2H27 A;  3R60 A;  2B0L A;  5DEQ A;  4EMS A;  5FLX K;  3WGH A;  4ENK A;  4MQV A;  2FEZ A;  2QQA A;  1ZGJ A;  5A2Q K;  3SZT A;  3GUD A;  2NAZ A;  4M9Z A;  1KU9 A;  4IRI A;  2ZFW A;  2J5O A;  3I59 A;  5L3G A;  5CYV A;  1BJA A;  2WWY A;  3EQL F;  2H6C A;  2W24 A;  3GZ6 A;  1JGS A;  4LJZ F;  4M6Y A;  5JVT A;  3SQN A;  3W6K B;  2CWE A;  2LNB A;  3I59 B;  4EJT A;  3J7A O;  3FM5 A;  1MGT A;  1G3Y A;  2JPB A;  2CQK A;  4OMZ A;  1UFM A;  2O3F A;  3F23 A;  3LAJ A;  1TNS A;  3MAJ A;  4EJU A;  2OD5 A;  1RI7 A;  2A3S A;  5JHU A;  2AXL A;  3K9T A;  4OMY A;  5J8C A;  2HDC A;  4YII A;  4EM2 A;  2IA2 A;  1FX7 A;  4GYG A;  1PP7 U;  5FD6 A;  1TW3 A;  1FWZ A;  5BPI A;  2GA1 A;  1BBY A;  2CFX A;  2DK8 A;  1Z6T A;  2M1B A;  5HDG A;  3HSE A;  3EYY A;  1G6N A;  3N97 A;  5BQT A;  1Z05 A;  1F5T A;  2VT3 A;  2J5P A;  4L9J A;  4CXF A;  1YS6 A;  3E97 A;  3KE2 A;  3F8N A;  4U0Y A;  2IA1 A;  2BGC A;  4BQA A;  4CZZ A;  1S29 A;  1Z1D A;  5ICF A;  2RC4 A;  1P4A A;  1FZP B;  3KZY A;  4HX8 A;  3MFK A;  2FBK A;  1FNN A;  2XAF A;  3CUQ A;  4YIF A;  5ICE A;  4ETS A;  4ZH4 F;  1ZG3 A;  2L3D A;  3R61 A;  3Q9S A;  5LHG A;  3J81 Z;  5CVU A;  4MEX F;  1LDK B;  1F1Z A;  4I02 A;  2HWV A;  4Y15 A;  2RGV A;  3RDI A;  3CUQ B;  5D8K B;  5H6R A;  1T6S A;  4HBL A;  1B59 A;  2PG4 A;  3H92 A;  4G94 A;  4OIR F;  2Z9O A;  3ROU A;  1QNT A;  1JE8 A;  4D0P A;  4U0W A;  4RAZ A;  1J9I A;  2FMY A;  3DKW A;  3WU1 B;  4ESB A;  3ZPL A;  3ZN1 A;  2D2W A;  1O3Q A;  2HYF A;  4LLL A;  3RYP A;  4L0Z B;  1YS7 A;  2RQP A;  1ZRD A;  3ZN0 A;  3RTR A;  1X3U A;  1BI1 A;  2STW A;  3V4G A;  3WE3 A;  4JBA A;  2WTE A;  3ZMZ A;  1KGS A;  1QBJ A;  3K1M A;  1OYI A;  1HW5 A;  5BMZ A;  3H3Z A;  2STT A;  3WTW C;  4HQE A;  2IP2 A;  1Z7U A;  1JXS A;  2ZBK A;  2GAU A;  2PN6 A;  5D5W B;  3Q9V A;  1BI2 A;  1FPQ A;  4Y17 A;  2JPC A;  1ZH5 A;  2D1V A;  4JQF A;  1DP7 P;  4LGW A;  4A6E A;  4XRF A;  3L7W A;  3M8E A;  3DV8 A;  1HST A;  1IW7 F;  4RS8 A;  1R36 A;  4UHT A;  1P6R A;  1PDN C;  4MHG A;  1XGO A;  2ZNZ A;  4OIP F;  1YW8 A;  4L5J A;  3GFI A;  4H0E A;  1MDM A;  1V3F A;  5L3C A;  2G7U A;  4Z2Y A;  1K6O A;  3ZP5 A;  3BJO A;  3MEX A;  5E1X A;  4BHP A;  3I5U A;  2FNA A;  1E2X A;  4NQW A;  3GF2 A;  2L4A A;  3SXY A;  3NRV A;  2O0Y A;  2K4J A;  1LDJ A;  3P9I A;  1FC3 A;  2JZY A;  4ON0 A;  4GO1 A;  4HLX A;  3MQ0 A;  4RGR A;  3GXO A;  2BBY A;  2QQ9 A;  1B4A A;  4O5V A;  1NHA A;  4L9V A;  4R8H A;  4FX4 A;  1IN5 A;  1WSU A;  5ILV A;  1ULY A;  3HTS B;  2FA5 A;  2XAQ A;  5DYM A;  4Q47 A;  1YW7 A;  2CYY A;  3TO7 A;  1O57 A;  3FWE A;  3BWG A;  3F8B A;  2DTR A;  2NNY A;  4G6Q A;  5LGN A;  1RZ4 A;  4YFK F;  2RKH A;  2KKO A;  3T8R A;  2RV8 A;  4RAY A;  1O7L A;  3LST A;  4ZYH A;  3GEZ A;  3DP7 A;  3GVA A;  1T0F A;  5TRD A;  2Y75 A;  1FP2 A;  1ZLJ A;  1G3T A;  2K27 A;  4KIG A;  2W84 A;  3QPT A;  5AON A;  3HRS A;  1W7P B;  5ED4 A;  2HKX A;  3D5L A;  2EFO A;  3G73 A;  2WC2 A;  1S3J A;  4PCQ A;  5AIQ A;  2XAH A;  2HZT A;  1FLI A;  3T8T A;  2P7V B;  4QWQ A;  3HRU A;  2H09 A;  5TJJ A;  4IJA A;  2UZK A;  4KIF A;  4GGG A;  3ECO A;  3IRQ A;  4I01 A;  3ABT A;  4LMY A;  2UXN A;  2M87 A;  3O2P E;  3V8J A;  1LEB A;  4KNY A;  5FFZ A;  1Z6R A;  4M73 A;  4A0Y A;  1J7K A;  3I4P A;  3JAM Z;  2K7L A;  4BH9 A;  4BYY A;  1O3S A;  1BI3 A;  4E70 A;  2C6Y A;  4RGU A;  2M45 A;  2ACJ A;  2GWR A;  1KYW A;  1D3Y A;  3QPH A;  1DDN A;  4FHT A;  3F21 A;  1QQI A;  2DI3 A;  5E1Z B;  1SD4 A;  2Q0O A;  3KP7 A;  5IT9 K;  1XCV A;  3P9C A;  3TGN A;  3KLO A;  1KQ9 A;  1FBS A;  5HDN A;  4M74 A;  5DUK A;  3MZY A;  4CGZ A;  5F1R A;  3KLN A;  3WGI A;  2VT2 A;  4OU0 A;  1B1B A;  5D5U B;  1KU3 A;  3JW4 A;  5HLI A;  5LRS A;  4KA4 A;  2NNN A;  3LAP A;  2V1U A;  3CUQ C;  1WWX A;  1XSX A;  5L3B A;  1XSV A;  4Q4Z F;  1ZRC A;  3EYI A;  2ISY A;  3R0A A;  2ZME A;  2VOD A;  3GZ5 A;  3TDU C;  1YG2 A;  5BPD A;  2HR3 A;  1YTY A;  1OR7 A;  1BOA A;  3B02 A;  5FFX A;  2PMU A;  3K1P A;  3WTS C;  3HSR A;  3LWF A;  4WK8 F;  1EV7 A;  4U0V A;  2ZME B;  5HLH A;  2OQG A;  2TDX A;  2HGC A;  2MLK A;  1RIO H;  1T39 A;  4K2E A;  3V8L A;  3GWZ A;  1IXR C;  3LQR A;  3RKY A;  4IPA A;  3QU3 A;  1LDD A;  5H20 A;  1ONV A;  5E1W A;  4ENM A;  1I27 A;  3E5X A;  4OIQ F;  3BY6 A;  1WQ2 A;  2M5W A;  2Z33 A;  2A6E F;  1O3T A;  3IKV A;  1R1U A;  4HX7 A;  3IWZ A;  2Z3Y A;  5H6Q A;  5HS9 A;  2XAS A;  1HBX G;  3K1N A;  1MD0 A;  3KP4 A;  3ECH A;  1W5T A;  5DD8 A;  1Z9C A;  2VE8 A;  4FT8 A;  5E8G A;  2WV0 A;  3ZMD A;  1BIA A;  4HDV A;  3E6C C;  2KIF A;  3HOS A;  3P9K A;  1FSH A;  3L09 A;  3E6B A;  3U2R A;  1J59 A;  1B9M A;  3TKY A;  4AWX B;  1ZN2 A;  3ISP A;  1HKQ A;  1I1G A;  1R5G A;  4UNO A;  2PQ8 A;  1C0W A;  2HTS A;  2DO7 A;  2IT0 A;  2RDP A;  3VOD A;  4M9S A;  2EFP A;  1REP C;  4EVI A;  3NQO A;  1XB4 A;  3TO9 A;  4I0B A;  1OMI A;  2V1X A;  2DFI A;  2MLG A;  2ESH A;  4CHU A;  2ADU A;  4AIJ A;  4JK1 X;  3QP6 A;  3FHZ A;  4I2O A;  1DPR A;  4MEY F;  1R1T A;  2P6S A;  2Q8K A;  4A2U A;  1HW1 A;  1F4K A;  4HQM A;  1JHF A;  2F5F A;  4AIH A;  2QVO A;  3ZMV A;  1CF7 A;  3NEU A;  1QZY A;  2MD5 A;  2Z99 A;  2E7W A;  2JTV A;  1FYK A;  5IT3 A;  3F22 A;  1P4W A;  5JI6 A;  4UVA A;  3QP5 A;  1ON2 A;  4N9H A;  4M6X A;  4A12 A;  3T5X A;  3I71 A;  2VXZ A;  4BXU A;  1CF7 B;  1XGM A;  2Y0M A;  4UUV A;  3GO5 A;  4KN7 X;  4EM0 B;  3TOA A;  1FYL A;  1J5Y A;  2DK5 A;  4M9X A;  2R7F A;  3P7N A;  1T2K A;  1ON1 A;  1HXD A;  2FOK A;  2L4M A;  3ZQ7 A;  1R00 A;  2ETH A;  3LA3 A;  3TO6 A;  2ZO4 A;  2DPD A;  4MNU A;  2YPR A;  1H9T A;  2LDU A;  4LB5 A;  4LK1 F;  4DQ2 A;  4LLN A;  4PZJ A;  3R4K A;  4BAY A;  4EM1 A;  4KIC A;  4HLY A;  3HIF A;  2UWM A;  2JRT A;  4IRG A;  3I58 A;  3K2Z A;  2EK5 A;  6PAX A;  3C1D A;  2OA4 A;  2V9V A;  3JSO A;  1TBX A;  3E6M A;  1AOY A;  5D6E A;  1U5T A;  5ILU A;  4M71 A;  2MA3 A;  1HSJ A;  5DDG A;  5CJ9 A;  3QOP A;  2OAZ A;  3O3K A;  1U78 A;  1SFU A;  2V6C A;  1U5T B;  3CLO A;  1TLH B;  3CJN A;  5ICG A;  3RPQ A;  1FP1 D;  3W6J B;  1G3S A;  4UVC A;  2F5C A;  2P4W A;  5JR3 A;  3L9F A;  2NRA C;  2YSR A;  3DFG A;  1SFX A;  2XUB A;  1XDS A;  2HTJ A;  3HHG A;  3KET A;  2HYG D;  2FU4 A;  2DW4 A;  4LFU A;  1KU7 A;  2NYX A;  1J2X A;  2Q2E A;  1S7A A;  1W5S A;  2GQQ A;  5D5X B;  3J81 K;  3FXU A;  4A5M A;  2FML A;  3F3X A;  3HYI A;  4I0A A;  3VB2 A;  4IF4 A;  1ZG5 A;  2DAO A;  1U3E M;  4I7H A;  3TOB A;  2VOO A;  3ZMU A;  5BS6 A;  3GW2 A;  4DNC A;  1YO5 C;  1WKM A;  1D8J A;  4ZYD A;  5EEG A;  3FZV A;  1YLF A;  2HEO A;  2QLZ A;  3WE2 A;  4QLC U;  1ZAR A;  3ZMS A;  1ZGA A;  2A68 F;  1T38 A;  1GXQ A;  2R3S A;  3VOE A;  4OOI A;  1IRG A;  4IVN A;  2HS5 A;  1L0O C;  4L0Y B;  1TQI A;  1TQP A;  2KIM A;  1I1S A;  1EH8 A;  3ML6 A;  4EJW A;  3KZZ A;  1IUY A;  4AIK A;  3M7G A;  2DPU A;  2E1N A;  1LJ9 A;  2QM3 A;  4GYI A;  3EET A;  4LB6 B;  1UST A;  5CVV A;  5K5O A;  4HOB A;  2KIU A;  2F2E A;  1UHW A;  3C7J A;  4G7Z F;  1G3W A;  1S6L A;  5DCF A;  4KYW A;  3I54 A;  1EH7 A;  3H3U A;  1XN7 A;  2O6G E;  2GXB A;  4O3M A;  5D4S A;  3IL2 A;  2FE3 A;  3C3W A;  5HVQ C;  2R7D A;  2CGP A;  1FY7 A;  3FMQ A;  1OPC A;  2P8T A;  4UXN A;  1ZRF A;  3IKT A;  1MJA A;  4XLP F;  4ZZL A;  3WTX C;  1XGN A;  5E17 F;  3L2C A;  1Y0U A;  5E20 A;  4RB1 A;  1KYZ A;  1ZAO A;  4IHS A;  1W7P A;  3LA2 A;  2XRN A;  2BEO A;  4GCV A;  1QGP A;  2W85 A;  1P4X A;  2DU9 A;  4L18 B;  1H0M A;  1TTY A;  5EEH A;  1R7J A;  2XGX A;  2EJR A;  3VEP A;  2DT5 A;  4MQ9 F;  4G9Y A;  2RN7 A;  2M30 A;  3LA7 A;  3T1B A;  5KVR A;  1G4D A;  3FX3 A;  2KRF A;  4HX4 A;  5LEK A;  5DD4 A;  3BPV A;  1XGS A;  2EFQ A;  4B09 A;  5FD5 A;  2DLL A;  3FMR A;  5D8L B;  4HF0 A;  1KQ0 A;  2PLY A;  2D45 A;  3FXR A;  3CUO A;  1IF1 A;  1LQ1 A;  4MTD A;  1FBQ A;  4A5N A;  1K79 A;  1XDU A;  2O03 A;  3LQQ A; 
#chains in the Genus database with same CATH topology
 4L9T A;  2F6C A;  2PJR A;  1FIP A;  2IS1 A;  3L2Q A;  4ZYE A;  3BTL A;  2HNH A;  5KAI C;  2EFW A;  2OV7 A;  3F8C A;  2FF4 A;  3EUH A;  3ZXS A;  2JVH A;  4BE0 A;  5H2F C;  2DT6 A;  3Q0W A;  5DS9 A;  4OIN F;  2FBH A;  2RAE A;  2IPQ X;  3HOZ J;  1EH6 A;  2VPR A;  3WU2 C;  5J40 A;  4YIR X;  2Z16 A;  4BS9 A;  1ZGW A;  3F72 A;  2KZV A;  3FK7 A;  3RKX A;  3SZP A;  1E3P A;  1LVK A;  3ZQL A;  2VJ4 A;  3CMA I;  1HQC A;  2FXA A;  1AKH B;  1DGR M;  4GRI A;  1SD6 A;  1XMK A;  4F55 A;  3EPZ A;  2EA2 A;  5J6X A;  2W00 A;  1TP4 A;  1VQ5 I;  2KHM A;  1G2H A;  2B7E A;  3NWT A;  2V6E A;  3PL8 A;  2E1C A;  4A3K J;  1YRN B;  3MKY B;  4G7O F;  3E5U A;  2UV1 A;  3ESW B;  3JAM K;  5BNG A;  4BXX J;  1BIB A;  4IOA F;  4D7M A;  4IX7 A;  1U5T C;  4JX5 A;  2YX7 A;  3HTU A;  1OCC H;  2HXO A;  3GYH X;  2L02 A;  1TW2 A;  4WX9 A;  2K02 A;  4ESJ A;  3MZH A;  4F7Z A;  4W97 A;  4KT5 C;  1ZKG A;  3DEU A;  4DYC A;  1QRY A;  5CVI A;  4J01 A;  2H6B A;  3PJR A;  3HHH A;  1WVR A;  4XSX F;  2WY7 Q;  4A3I J;  2KLO A;  2AHQ A;  5J1Y A;  5DCM A;  4RB0 A;  2EV6 A;  2XC7 A;  1D1B A;  2WY8 Q;  1XC5 A;  3DWL E;  2O8K A;  3DF8 A;  4R1H A;  4M3E A;  1IC8 A;  5HS7 A;  1H89 C;  3V7S A;  2F4M B;  2FUG 2;  3RYR A;  5LD2 C;  2EB7 A;  2VBW A;  1H8A C;  4N0B A;  2FQ4 A;  1R22 A;  4EGY A;  3RZO J;  3J80 Z;  2K9S A;  2O7O A;  3OYM A;  1IXC A;  1PYV A;  3BG5 A;  3WTU C;  4PGH A;  1MW7 A;  4IHW A;  2E5N A;  4CO8 A;  3F6O A;  1HW2 A;  3HGY A;  3QU6 A;  4Z6Y A;  3H5A A;  1FOK A;  3ERE D;  5DCM B;  2WA0 A;  5B3S H;  4S04 A;  1OLT A;  2LMD A;  1YJN I;  3ULQ B;  1Z21 A;  2DFF A;  5CLS A;  3BR1 A;  3H36 A;  1BN5 A;  2A07 F;  1SVL A;  1K78 B;  2R7R A;  2G7H A;  3FIS A;  2D1H A;  2HPI A;  5K1Y A;  2KJC A;  5FB2 A;  2XVC A;  2EV5 A;  5CQG A;  3BR0 A;  1LE8 B;  1TWA J;  3QWL A;  2NOJ B;  1SAX A;  2YR2 A;  5JFR A;  4ZTJ A;  1XD7 A;  5FLX Z;  4M3B A;  5GTI C;  4ZYA A;  3HZJ A;  3GZN B;  4BEH A;  4ZDO A;  2QBY B;  2EBI A;  2HFH A;  4RGX A;  5A2Q Z;  2YU3 A;  3DTE A;  2QQB A;  2NVQ J;  2L9R A;  2MAB A;  2PI0 A;  2GOX B;  3DQV C;  3TP0 A;  3RJP A;  2XV4 S;  4ENN A;  1RKW A;  1MKM A;  1ZHF A;  1IN7 A;  2XAJ A;  2UXX A;  3S2H J;  2ME6 A;  2RRE A;  3IWF A;  2HVQ A;  3OOP A;  1N77 A;  2DOE A;  1SD5 A;  1ZLK A;  1QPM A;  1TNT A;  2XKP A;  4BEH B;  4UUS B;  2WB1 N;  2ECC A;  5DV5 A;  2X1E A;  3CME I;  5M3F J;  2L9S A;  3M1C A;  1GXP A;  4PDK A;  1V4R A;  4B8X A;  3FMS A;  1JTY A;  1P2F A;  2X1C A;  1BC7 C;  1Q1V A;  3KIO A;  2HVS A;  2FSW A;  1IUF A;  4HDU A;  2V4J C;  1IRZ A;  2ZFU A;  3SZG A;  4KUM A;  4OAZ A;  2KIS A;  4BHC A;  4QPO A;  1T56 A;  2DYS H;  3BJA A;  5K5Q A;  3PQK A;  3GLX A;  1JGG A;  1GVJ A;  1SD7 A;  3KEO A;  2AS5 F;  3DPT A;  1T95 A;  3M1E A;  1TL8 A;  2ZXJ A;  4HV6 A;  3ASO H;  5E79 C;  5HOO A;  4BY1 J;  5FRM A;  5BOX A;  3GTQ J;  3RPU A;  4P9U A;  4FET A;  2QZ8 A;  4A3F J;  3WTT C;  1RKT A;  2QQ8 A;  3E3V A;  1DUX C;  3WTY C;  3SFZ A;  1Q1H A;  3WTV C;  3L00 A;  1TWF J;  2OQR A;  3J7Z I;  1R5H A;  3DBH B;  1J0R A;  3KP2 A;  1VQN I;  4II2 A;  2VBX A;  1B9N A;  3ZMT A;  2VN2 A;  2X48 A;  3KP3 A;  2IW5 A;  3TBI A;  5FLM J;  3CTA A;  5F0C A;  3K70 D;  4FAS D;  4Q5S F;  5ILS A;  4LG3 A;  5CVR A;  3QYE A;  4HV5 A;  3IV5 A;  3AAF A;  1D1C A;  1K7A A;  3B6C A;  3Q0V A;  1LB2 A;  2DT7 B;  2ECB A;  1MH3 A;  4A0Z A;  5EZH A;  4MGR A;  2P5V A;  3DXJ F;  3K0L A;  4A6D A;  3ZQQ A;  2ESN A;  1D0Z A;  4RAG A;  1F9N A;  2XDV A;  5LHH A;  4G6T B;  3ABU A;  1PUE E;  1ZEL A;  4MTE A;  2LKS A;  4NDL A;  5LFA A;  1XSD A;  3LSR A;  4HF1 A;  4E7Z A;  2OCC H;  2CUJ A;  3E6D A;  2KPM A;  4XQF A;  3VFZ A;  3SHF A;  4WCG A;  3LSK A;  2FX0 A;  1O7F A;  3ZQG A;  2DQL A;  4UVB A;  4WXD A;  2HDD A;  4ZYG A;  3GX4 X;  4U7B A;  3FK6 A;  1WJF A;  2DQR A;  5LGU A;  1T98 A;  5LHI A;  4P55 A;  1JHH A;  5J8F A;  2MBF A;  3X2Q H;  1OYW A;  1KA8 A;  3OV8 A;  2XKO A;  1WJD A;  4P96 A;  4P5O A;  2IGO A;  3S14 J;  3VSL A;  2F4I A;  4RGS A;  1X1B A;  1TWG J;  2HQR A;  3I0T A;  4AD9 A;  2CQ7 A;  3WGG A;  2XPW A;  3ZQF A;  1MJB A;  4KN4 X;  1B72 B;  2PFB A;  2DA5 A;  2GIV A;  2VQC A;  2L9V A;  4RB3 C;  2IS2 A;  1NG6 A;  3HC7 A;  2KIQ A;  2DMU A;  3DPL C;  3BZ6 A;  4UV8 A;  2LF7 A;  4BHB A;  2LKX A;  3GFM A;  3HOT A;  3JRE A;  2JK3 A;  2L01 A;  4AVP A;  1ACI A;  5L3E A;  1JT6 A;  1TT0 A;  2HQN A;  2Y2Z A;  2PMH A;  5D5V B;  2Z5U A;  3OSF A;  3S1R J;  2FRH A;  3AG2 H;  5JVG F;  2GM4 A;  3C18 A;  3V8K A;  4XRM A;  4XSZ F;  5ERI A;  2HOE A;  3G71 I;  3HRM A;  4JX4 A;  1YOV B;  2M4G A;  4CSW A;  4L9N A;  5KK1 A;  2XHK A;  4KT6 A;  4NC8 A;  3N4M A;  1USS A;  2RVC A;  1UB9 A;  1SMT A;  1YIT I;  1ETK A;  1M1E B;  1R49 A;  1BC8 C;  5K5R A;  2IBD A;  4LG0 A;  4Y13 A;  1ORK A;  4B47 A;  2LRD A;  2XF6 A;  1R58 A;  1VQ9 I;  2BHY A;  2NVX J;  3R0J A;  2K4B A;  1OYY A;  2KRH A;  1P7J A;  5D6F A;  1YQA A;  2JSP A;  2JJ7 A;  2W25 A;  1UEL B;  4A3C J;  3HOY J;  4IKF A;  1RUN A;  4PJN A;  1IRF A;  2EWN A;  2YX4 A;  2DYR H;  4IQJ A;  2GOM A;  1KON A;  2LRE A;  5KNL A;  2H94 A;  1RC9 A;  4LG0 B;  4G7H F;  1MH4 A;  1UHM A;  2P6T A;  1B6A A;  3MZ8 A;  3DKY A;  1Z77 A;  3AG4 H;  2VLA A;  4NC7 A;  4IO9 F;  1UCR A;  2VBZ A;  2A61 A;  1A04 A;  3TL4 X;  2BY1 A;  1T33 A;  2OBP A;  2LSO A;  3GCM A;  3F8F A;  3COA C;  2WAD A;  2X0L A;  4BJ5 C;  1W36 C;  4XBF A;  3EUH C;  1Y6I A;  3HPG A;  1VQO I;  2L7K A;  2E19 A;  2V79 A;  2WB1 A;  3IHU A;  5FGM A;  1MSF C;  4WWC A;  2WV1 A;  3FBN B;  3Q5F A;  1X4P A;  1QZZ A;  1YFH A;  1RUO A;  3C2B A;  3CCQ I;  2X85 A;  3CO6 C;  2CO5 A;  2X6X A;  3NWS A;  3BLY A;  4HST A;  4IRH A;  4A0X A;  3A4C A;  3OYG A;  4C3I J;  4HPQ A;  2P5K A;  1DP3 A;  2ZJ2 A;  1S5L C;  2V1D A;  4C2T A;  3RI4 A;  5C3E J;  4XLN F;  1BL0 A;  2DTZ A;  3AL0 B;  2A69 F;  4CIC A;  2XAG A;  1U2W A;  2BZT A;  2CW8 A;  3K4B A;  2KJB A;  4W1U A;  4RA2 A;  2HDW A;  3H35 A;  4PGG A;  1E17 A;  2IA0 A;  1ENH A;  3IC7 A;  2LBF A;  3KP5 A;  5L3D A;  3V7R A;  1FYM A;  4CCO A;  2CW7 A;  5FKO A;  5HLG A;  2KMU A;  1R1V A;  4UV9 A;  2ZB9 A;  1LEA A;  3EDP A;  2VC0 A;  3S17 J;  3PFY A;  2IRF G;  5F6F A;  2NS8 A;  1X1A A;  4CUG A;  4DZP A;  5HLT A;  4CCN A;  2ISZ A;  5E18 F;  3BRO A;  2DJN A;  3GFL A;  1MMG A;  1OKR A;  3KFW X;  4XLE A;  2LLK A;  3G3Z A;  5LRR A;  2E35 A;  2NS0 A;  4A3D J;  5ICC A;  1N25 A;  3JRB A;  1NH3 A;  2A6H F;  5LGT A;  3PQJ A;  1XCB A;  1MSE C;  4G6D A;  4Y3O A;  4P9F A;  3BJ6 A;  3CF2 A;  2M2E A;  2MC3 A;  1Z3Y A;  2VAS A;  3WU0 A;  4KMU X;  1FBU A;  3CCS I;  3G1M A;  3CO7 C;  1GV5 A;  1MIJ A;  2BHZ A;  2IVM A;  1LVA A;  5F0F A;  2FD5 A;  4FX0 A;  2O61 A;  4FQG A;  3GBG A;  3FXJ A;  4E7H A;  1KU2 A;  4LLG F;  5IP7 J;  4CDG A;  4BE1 A;  1EKE A;  3BP8 A;  4A3B J;  1YJ9 I;  1LFB A;  3UR3 C;  1X58 A;  4B3X A;  1SMY F;  1IN6 A;  1FSE A;  2IJL A;  3DBR B;  3CCM I;  3WG9 A;  1SVO A;  2G9W A;  4YFX F;  3HUG A;  4JX6 A;  9ANT A;  3M8J A;  2ICW G;  3OYK A;  2LC2 A;  4NHJ A;  1PUF A;  1NG7 A;  1D8K A;  4NC6 A;  3KEY A;  3JTH A;  1Z67 A;  4IQ4 A;  1I6X A;  4OIO F;  1R23 A;  3F6V A;  1HC8 A;  2OU2 A;  2F5D A;  2EFN A;  2ZCW A;  1ERD A;  3A1Y A;  3ASN H;  3H0D A;  3MKL A;  4N9I A;  2P5L C;  2NS7 A;  1W7P D;  1TQM A;  2MH2 A;  2VL8 A;  1OQY A;  2DMT A;  3OIP A;  5B1B H;  2AXT C;  4BQO A;  3A02 A;  4Y33 A;  3TQN A;  4BXF A;  2YS9 A;  1SFK A;  2VXD A;  4HYE A;  3V7C A;  4F93 B;  2AQF A;  4IXA A;  5L3F A;  1BM9 A;  3T0Y A;  2K86 A;  3F0C A;  1MDM B;  5CPR B;  2K9M A;  4AVZ A;  5LBQ A;  4DBQ A;  4I98 B;  1ZYR F;  4EJV A;  2GZW A;  1XMA A;  1MJ9 A;  1MMD A;  4HAM A;  4S05 A;  1I5Z A;  4PSX A;  2CQQ A;  3HM5 A;  3JSP A;  3CC7 I;  1FT9 A;  4ASN A;  1FOX A;  1HOM A;  3BOQ A;  2CSO A;  5IPA A;  5D4R A;  3K6G A;  2E7X A;  2L7M P;  3W6V A;  4A3G J;  4CCJ A;  1P7I A;  5FO5 A;  1IGN A;  4KDP A;  2HKO A;  3I53 A;  4AUX A;  3S16 J;  1Z91 A;  3L2R A;  4PJM A;  1A31 A;  4NBQ A;  2ZXW H;  2EV0 A;  1YYV A;  3S1N J;  1S8N A;  2DMN A;  3BG7 A;  2N8G A;  3HSF A;  3OL3 A;  2K40 A;  4EAT A;  2ZNY A;  1LNW A;  2L54 A;  2FNP A;  3JTG A;  2NOG A;  4WF2 A;  3CLQ A;  1TZL A;  2EA4 A;  3LSJ A;  3FF5 A;  3OIO A;  3FM3 A;  2QKL B;  5FKM A;  2EIK H;  1WI9 A;  1OCP A;  4IHX A;  1QO0 D;  2OZ6 A;  2XIG A;  3OYF A;  1O3R A;  1LPQ A;  3CP2 A;  4PUS A;  4WXH A;  4RB2 C;  5EDN A;  2AO9 A;  1H9G A;  2M9H A;  3HGG A;  2BW3 B;  2VBY A;  3DTI A;  3MD2 A;  5EGO A;  3PUF A;  2OJE D;  3KP6 A;  3S2D J;  1CQT A;  3FBI B;  1WI3 A;  4CYD A;  5AIP A;  3O8H A;  4XOP A;  1RNL A;  4HF2 A;  4HW0 A;  3F8M A;  3GTP J;  4KMF A;  3D1N I;  1DU0 A;  2JSC A;  4BKX A;  4HZF A;  1JJ8 C;  2HU9 A;  3FHN A;  2DA1 A;  4GDF A;  2KT0 A;  4RLQ A;  5GP9 A;  2ELH A;  4WXC A;  1AWC A;  4Q48 A;  5IT9 Z;  4D9J A;  3OL4 A;  2W82 A;  2LK2 A;  1Y1W J;  2P7C B;  2R7X A;  1YW9 A;  4PSW A;  3O6B B;  3RIR A;  3KCC A;  5EJC A;  5HDK A;  2A5Y B;  2CH0 A;  3HPH A;  5J1R A;  1D5V A;  3WOD F;  1W4M A;  1RPW A;  1VQ7 I;  2BE5 F;  3M8F A;  1HKT A;  3BPX A;  1ODD A;  3K69 A;  3WTZ A;  4EGZ A;  1IN8 A;  2PEX A;  3ELK A;  1STZ A;  5IY5 H;  1K83 J;  3GFJ A;  1ZG1 A;  3U9G A;  1AKH A;  4PFP A;  4YFN F;  4XM3 A;  3FIW A;  3Q0U A;  2KZG A;  2LF8 A;  3DU6 A;  4IZZ A;  4U88 A;  3R6S A;  3U1K A;  2QUF A;  4ENJ A;  3KX2 A;  1YRN A;  2COM A;  4B1R A;  4DYR A;  5IP9 J;  2EZK A;  3B73 A;  3K7A J;  4TV7 A;  1APL C;  2R7U A;  3PFI A;  2CW0 F;  3LSG A;  4KFC A;  2M0C A;  2VOP A;  1GV2 A;  3KYD B;  2V26 A;  2W1O A;  4ZJZ A;  3M07 A;  2KQR A;  3LMM A;  1GVD A;  2QWW A;  2ZSH B;  5LLQ A;  4EJO A;  5E8I A;  4HA8 A;  3PO3 J;  2QEN A;  4U7D A;  4NB5 A;  4E7L A;  3CMM A;  3VYS B;  4RM3 A;  4L5I A;  4LK0 F;  3S2W A;  2BYV E;  2KDZ A;  1U8R A;  2XRO A;  3ONQ A;  2E2I J;  1IN4 A;  4BDY A;  4ZZD A;  2LYC A;  2TRT A;  2VQL A;  4EQQ A;  5F64 A;  2P81 A;  1FEX A;  2VON A;  3HRT A;  4AC0 A;  2PBI A;  1WRJ A;  3WG7 H;  2W57 A;  1BI0 A;  2M0M A;  3KEQ A;  1YIO A;  5CVJ A;  1DU6 A;  2JN6 A;  2ZSI B;  3LFK A;  1ETW A;  2KDO A;  3I9V 2;  2BV6 A;  2JRM A;  3REO A;  2V1N A;  1SFE A;  2CG4 A;  4X6A J;  3D0S A;  2V9P A;  2F5E A;  5FRO A;  4XRS G;  2GXG A;  2A5W A;  3DEE A;  3RKW A;  2RNJ A;  1RR8 C;  4ANJ A;  1L3L A;  1IXS B;  1IZ1 A;  1BR4 A;  1K78 A;  1U6G A;  1IJW C;  1N78 A;  2FBI A;  1X2M A;  3M9A A;  3IRR A;  1DPU A;  2XGD A;  3U1D A;  4M3F A;  3OYA A;  4BNC A;  1HKS A;  1GHC A;  2PJP A;  2VE9 A;  3MWM A;  4PJJ A;  4RMN A;  3I64 A;  4V2F A;  1ZRE A;  2IS6 A;  1LE8 A;  4XN0 A;  1MNM C;  1J75 A;  2FOW A;  1OCZ H;  4IHY A;  1WH5 A;  2EZL A;  1Y0N A;  3E5Q A;  2X6O A;  1CGP A;  1WPK A;  3QRF F;  1TT5 B;  1O4X A;  2QBY A;  4JP0 A;  1FJL A;  2JT1 A;  5GPA A;  2Y48 A;  3AL0 C;  2XRL A;  3CJR B;  1IAW A;  1KQ8 A;  2GBY A;  4G8X A;  1OFC X;  1S7O A;  1WHU A;  2QSG X;  2ZKZ A;  3NAR A;  4XKB A;  4R79 A;  1F36 A;  2VKE A;  3G1O A;  2R0Q C;  2E2J J;  1PP8 F;  3PNY A;  2MH9 A;  2X4H A;  4A69 C;  4KIB A;  2O8X A;  1EJ9 A;  3IH4 A;  4J00 A;  1X2N A;  4I09 A;  1VND A;  1X1D A;  2JWT A;  3C2G A;  3MCZ A;  2DBB A;  3FKJ A;  3OR1 C;  4UUS A;  4IHV A;  2GA2 A;  3VWB A;  1QU3 A;  3TDZ C;  3RZD J;  1YX5 A;  2F48 A;  4XOR A;  2O9L A;  1WCM J;  4M72 A;  4O6J A;  2ELK A;  2KL4 A;  2FQ3 A;  3ABL H;  4IOC F;  2D5V A;  1HF0 A;  2DMQ A;  1FIA A;  2L5Q A;  2Z1D A;  4GXO A;  4BJT A;  1YI2 I;  3CDH A;  3RPU D;  5HS8 A;  2IS4 A;  3FXQ A;  4YG2 F;  5IP6 A;  1ZQ3 P;  4LD5 A;  4YEJ A;  2M8E A;  3LL7 A;  3ZOB A;  3J80 K;  2BOL A;  2EZI A;  3LSI A;  3QAH A;  1RES A;  1MZB A;  4NUB A;  4AID A;  2RQQ A;  3CZ6 A;  3OYH A;  3BG3 A;  1JUS A;  3BC8 A;  2OZU A;  2QYO A;  4IHT A;  1VTN C;  4BE2 A;  4OWR B;  3SEQ A;  1P92 A;  4ESF A;  2VC1 A;  3PSF A;  3TW7 A;  2H1L A;  3BDD A;  3K4M A;  4EV0 A;  5LEJ A;  2VUM J;  2LKP A;  5DUI A;  5F1J A;  2H27 A;  3R60 A;  1D5Y A;  4XLF A;  4XKW A;  3CJT B;  4ABZ A;  2B0L A;  2LTP A;  5DEQ A;  4EMS A;  1RET A;  1YHQ I;  5TIS C;  4FCY A;  2E5Z A;  3GTJ J;  2R7Z J;  2R7T A;  4BDZ A;  2COB A;  2PMZ N;  3CCU I;  5FLX K;  2G0E A;  1Z7L A;  3WGH A;  5FKN A;  4ENK A;  4MQV A;  2FEZ A;  2QQA A;  2R7W A;  2OTJ I;  1DQU A;  1ZGJ A;  3QYF A;  5A2Q K;  2DA6 A;  3SJM A;  4IEJ A;  3SZT A;  3GUD A;  2HI3 A;  4AM3 A;  2NAZ A;  2XAU A;  4M9Z A;  1KU9 A;  3I3L A;  1AA7 A;  1NTC A;  1V5E A;  2GIZ A;  2I10 A;  2ID3 A;  4IRI A;  1YE9 A;  2ZFW A;  2J5O A;  3ABM H;  3I59 A;  5L3G A;  2LFB A;  5CYV A;  1BJA A;  2WWY A;  3EQL F;  2H6C A;  2W24 A;  1JJ6 C;  3GZ6 A;  1JGS A;  4LJZ F;  4XK4 A;  4M6Y A;  4I99 C;  3SQN A;  3W6K B;  5JVT A;  1BJZ A;  1U8B A;  5EEA A;  1JKP C;  2CWE A;  4HSR A;  3OYN A;  2F5V A;  2LNB A;  1LFU P;  2L2O A;  3I59 B;  4EJT A;  3J7A O;  3FM5 A;  1MGT A;  1G3Y A;  2JPB A;  2CQK A;  4OMZ A;  1UFM A;  2CS3 A;  4U87 A;  1A36 A;  4BUP A;  1UZC A;  3BQY A;  2O3F A;  2XGE A;  3F23 A;  2HZD A;  1WFX A;  1BR2 A;  3LAJ A;  2MG4 A;  1TNS A;  3MAJ A;  4D7N A;  4EJU A;  3G6E I;  2DJI A;  2OD5 A;  1RI7 A;  1S7E A;  2A3S A;  4PK4 A;  3D5R C;  1B72 A;  5JHU A;  5DM6 F;  1U9O A;  2AXL A;  3K9T A;  4OMY A;  1FOW A;  1ZR4 A;  1QPI A;  5J8C A;  1I3Q J;  1QHG A;  2HDC A;  4YII A;  4EM2 A;  4J19 A;  2IA2 A;  1GUU A;  5M5W J;  1I3A A;  2E2H J;  1XPX A;  1FX7 A;  4XID A;  3TMO A;  4GYG A;  1PP7 U;  2DA7 A;  5FD6 A;  4KIS A;  1TW3 A;  5C44 J;  1ETO A;  1FWZ A;  5BPI A;  4F91 B;  2GA1 A;  4XRS A;  2CV2 A;  3OYI A;  4H4K C;  4DZJ A;  1BBY A;  2CFX A;  2DK8 A;  4XLA A;  1Z6T A;  2M1B A;  5HDG A;  3HSE A;  3FXM A;  3EYY A;  1FOY A;  1G6N A;  3N97 A;  3DPU A;  3PNV A;  5BQT A;  3V42 A;  4QPQ A;  1Z05 A;  1F5T A;  1R5I D;  2VT3 A;  2J5P A;  4LIU A;  2XF7 A;  4L9J A;  2L7Z A;  4XNF A;  4CXF A;  1YS6 A;  3RQI A;  3BR3 A;  2M7B A;  3E97 A;  3I55 I;  2HPM A;  3KE2 A;  3F8N A;  1UJ8 A;  4U0Y A;  2IA1 A;  2LVS A;  2BGC A;  1PVE A;  3S32 A;  4BQA A;  4CZZ A;  4I6Z A;  1S29 A;  1Z1D A;  5ICF A;  2RC4 A;  1P4A A;  1FZP B;  5C4J J;  2CUF A;  3BR2 A;  3KZY A;  4HX8 A;  3MFK A;  2FBK A;  5IYD J;  1FNN A;  1WJ5 A;  1X4O A;  1Y8R B;  2EPF A;  3RQ4 A;  2XAF A;  3CUQ A;  4YIF A;  4HRI A;  5ICE A;  4M6V A;  5FKK A;  3I4N J;  4ETS A;  3SYT A;  5FLV A;  4ZH4 F;  1ZG3 A;  2L3D A;  3PUB A;  3R61 A;  3Q9S A;  5LHG A;  3J81 Z;  5CVU A;  3P5J A;  2OF7 A;  3J7A Y;  4MEX F;  1LDK B;  1F1Z A;  4I02 A;  3I4M J;  2HWV A;  4Y15 A;  3A0B C;  1X3Z B;  3ZCO A;  2LR8 A;  2RGV A;  3RDI A;  4C2U A;  3CUQ B;  5D8K B;  4A93 J;  1JTX A;  5H6R A;  1T6S A;  1QVU A;  4HBL A;  3ZGK A;  1B59 A;  2CU7 A;  5IYC J;  4DBR A;  2PG4 A;  4D1Q A;  2M3A A;  3H92 A;  4G94 A;  4OIR F;  2Z9O A;  2CMP A;  3ROU A;  1QVT A;  2LOO A;  4A3M J;  1QNT A;  4C3H J;  1JE8 A;  2DDA A;  4D0P A;  4U0W A;  4A3L J;  3FXO A;  2K9L A;  4IL6 C;  1WJB A;  4RAZ A;  3PSI A;  1J9I A;  2NVU B;  1ETQ A;  1JKQ C;  4DIQ A;  4C3J J;  2LH9 A;  2FMY A;  3DKW A;  3WU1 B;  2QGU A;  4ESB A;  4D5C A;  5CKT A;  1V5F A;  3ZPL A;  3GME A;  3ZN1 A;  1DGW Y;  2D2W A;  1O3Q A;  1VF9 A;  3L2V A;  3BCA A;  2EIM H;  2HYF A;  4LLL A;  3RYP A;  4PJ0 C;  4L0Z B;  1ETV A;  2XPV A;  1Y39 A;  4XLC A;  1GDT A;  3CC2 I;  1S9H A;  3BG6 A;  1YS7 A;  2RQP A;  1ZRD A;  1OCO H;  2E36 A;  3H9Q A;  3TW6 A;  3W2V A;  1MBK A;  3RTR A;  3ZN0 A;  1X3U A;  2M4K A;  1QA6 A;  1BI1 A;  2STW A;  2WAQ N;  4BBS J;  3V4G A;  3CD6 I;  1ZK8 A;  5EYR A;  3WE3 A;  2Q2E B;  2Y0S N;  4JBA A;  2WTE A;  3ZMZ A;  1KGS A;  4KJZ A;  1FTT A;  4LIT A;  1QBJ A;  2MSY A;  5GAD J;  1BW5 A;  3K1M A;  4E7I A;  5E3M A;  3FKI J;  4BGD A;  1OYI A;  3QPL A;  1HW5 A;  5BMZ A;  1ZTR A;  3H3Z A;  1HLV A;  2STT A;  1TWC J;  3WTW C;  3PM1 A;  4HQE A;  4CCK A;  3JRI A;  4XN3 A;  2IP2 A;  2W7N A;  2DOD A;  4BY7 J;  1R71 A;  1Z7U A;  1JXS A;  2ZXH A;  1N75 A;  2ZBK A;  2GAU A;  2PN6 A;  1IG7 A;  5D5W B;  2VB6 A;  3M4O J;  1MBE A;  2CQX A;  3Q9V A;  5F08 A;  1BI2 A;  1KZH A;  3I56 I;  2NXN B;  1JUP A;  1FPQ A;  2JUG A;  4Y17 A;  2JPC A;  1ZH5 A;  2D1V A;  4JQF A;  2QA4 I;  1VFC A;  1DP7 P;  3JCU C;  4LGW A;  4Y7N J;  2MD0 A;  2ZJR F;  4A6E A;  2I8D A;  4XRF A;  3L7W A;  3M8E A;  2CQN A;  3DV8 A;  3W2W A;  1HST A;  1IW7 F;  3LSP A;  4RS8 A;  1R36 A;  4RM2 A;  4EEF G;  4UHT A;  1P6R A;  2K9Q A;  1PDN C;  4MIM A;  4MHG A;  1XGO A;  1I50 J;  2ZNZ A;  1YW8 A;  4OIP F;  4L5J A;  3GFI A;  4H0E A;  2AQE A;  2BY3 A;  1MDM A;  1V3F A;  5L3C A;  2VPL A;  4UB8 C;  2G7U A;  2DMP A;  3HXL A;  4Z2Y A;  1K6O A;  3H5R A;  3CCL I;  2DA4 A;  3IH2 A;  3ZP5 A;  1XS9 A;  3BJO A;  3MEX A;  1W1W E;  2JA5 J;  5E1X A;  4BHP A;  3I5U A;  2Y9Y A;  2FNA A;  1E2X A;  2E60 A;  4NQW A;  3GF2 A;  1HCR A;  2L4A A;  3SXY A;  4I76 A;  3NRV A;  4BL0 B;  1UAA A;  2O0Y A;  2K4J A;  2HOT A;  1IDZ A;  1LDJ A;  3P9I A;  1FC3 A;  2JZY A;  4ON0 A;  1VQM I;  4GO1 A;  4HLX A;  1H88 C;  4Y52 J;  3MQ0 A;  4RGR A;  3GXO A;  2BBY A;  2OUM A;  2IXS A;  2K5C A;  1B4A A;  2QQ9 A;  3CES A;  4O5V A;  1NHA A;  4L9V A;  4R8H A;  4XL9 A;  1IN5 A;  2EQR A;  3ZR8 X;  5ILV A;  4FX4 A;  1WSU A;  1V55 H;  2DDB A;  2M7A A;  1BA5 A;  3H9J A;  1ULY A;  2QKM B;  3HTS B;  5FJ8 J;  2FA5 A;  2XAQ A;  2CFO A;  5DYM A;  4Q47 A;  4NQW B;  2PX9 A;  1J09 A;  1YW7 A;  2CYY A;  4MFE A;  3A0H C;  2XB5 A;  3TO7 A;  1O57 A;  3FWE A;  3BWG A;  3F8B A;  2DTR A;  1A6Q A;  2NNY A;  2CV0 A;  1R6R A;  2OPT A;  4G6Q A;  5KAF C;  1U0J A;  2R7O A;  2VKD A;  5M3M J;  5LGN A;  4RDU A;  1RZ4 A;  3W3C A;  1GLN A;  2BW3 A;  2KRC A;  2Q1Z B;  4YFK F;  1Y8Q B;  2RKH A;  2WBM A;  2KKO A;  1LKX A;  3T8R A;  2RV8 A;  3DTK A;  1O7L A;  3LST A;  4RAY A;  4ZYH A;  4CYC A;  1I6H J;  3GEZ A;  1HDP A;  1MBH A;  3DP7 A;  3GVA A;  3E0J B;  1T0F A;  5TRD A;  2Y75 A;  5M5Y J;  1FP2 A;  1ZLJ A;  4HNT A;  1G3T A;  2K27 A;  2E71 A;  2ID6 A;  3ZQH A;  4KIG A;  2Y30 A;  4DGW B;  4YEL A;  4UB6 C;  3CQZ J;  3CDL A;  5GPC A;  2W84 A;  1W36 D;  1BOB A;  2DA2 A;  1VQ4 I;  4CYC B;  3CF5 F;  3QPT A;  4BBR J;  1WZ2 A;  5AON A;  3HRS A;  1W7P B;  5ED4 A;  2HKX A;  3D5L A;  2EFO A;  3G73 A;  1EF4 A;  2WC2 A;  2IGN A;  4FE4 A;  2DOF A;  1S3J A;  4PCQ A;  5AIQ A;  2XAH A;  3DCF A;  5E3L A;  3GTM J;  2HZT A;  1FLI A;  4C30 A;  3C2H A;  1E3O C;  3KZI C;  3T8T A;  2P7V B;  4QWQ A;  3HRU A;  2H09 A;  5TJJ A;  3ERM A;  4IJA A;  2CRG A;  3GLL A;  3IAS 2;  2JVG A;  5K7F A;  2UZK A;  1IRX A;  4KIF A;  2V7F A;  3OIQ A;  4RAF A;  4GGG A;  3ECO A;  4I01 A;  3IRQ A;  4E7J A;  3ABT A;  4LMY A;  4DJA A;  2UXN A;  2M87 A;  5JHF A;  2EIJ H;  3O2P E;  3V8J A;  1LEB A;  4KNY A;  5FFZ A;  1Z6R A;  3MVP A;  2EIN H;  4M73 A;  4A0Y A;  1XG1 A;  2DFH A;  2X51 A;  1J7K A;  3I4P A;  3JAM Z;  3FXL A;  5K7H A;  2K7L A;  5E3O A;  4BH9 A;  4BYY A;  2R5Y A;  3DEW A;  2WAQ A;  5CQE A;  1O3S A;  2BVL A;  2XB0 X;  1VQ8 I;  1BI3 A;  4E70 A;  2Y0S A;  2BXY A;  3OYL A;  2C6Y A;  4XLH A;  4RGU A;  4LOC A;  2M45 A;  5KCM A;  2ACJ A;  1D1A A;  3VSK A;  2GWR A;  4HNU A;  2QSH X;  1KYW A;  1D3Y A;  5IOZ A;  3K70 C;  3QPH A;  2JMW A;  5IOY A;  2X9D A;  1DDN A;  4FHT A;  4B44 A;  3K4N A;  3F21 A;  2R5Y B;  1UMQ A;  3CMY A;  4UY8 I;  1QQI A;  2IEK A;  2DI3 A;  5E1Z B;  1SD4 A;  1WGX A;  2PJR B;  1TC3 C;  2Q0O A;  3KP7 A;  5IT9 K;  1XCV A;  3P9C A;  3TGN A;  3KLO A;  4ZTF A;  2WAF A;  1KQ9 A;  3HDD A;  1VQ6 I;  1W0T A;  1FBS A;  4XON A;  3E1S A;  5HDN A;  4DYQ A;  4M74 A;  3BR5 A;  1JI8 A;  5DUK A;  3HKZ N;  3MZY A;  4CGZ A;  3DU5 A;  5F1R A;  3KLN A;  2LG4 A;  3WGI A;  2VT2 A;  3K4L A;  3OYJ A;  4OU0 A;  1B1B A;  5D5U B;  4UUT A;  3ABK H;  3K4C A;  1KU3 A;  4X0G A;  3JW4 A;  5HLI A;  5LRS A;  4KA4 A;  5IYB J;  1NK3 P;  2LY9 A;  2NNN A;  2IAI A;  3LAP A;  2V1U A;  3DBL B;  3CUQ C;  1WWX A;  1XSX A;  5L3B A;  1XSV A;  4Q4Z F;  1ZRC A;  3EYI A;  1D0Y A;  2ISY A;  3R0A A;  2ZME A;  2VOD A;  3GZ5 A;  5J4V A;  1K61 A;  3DLL F;  3TDU C;  2HVR A;  1YG2 A;  2MFZ A;  5BPD A;  2HR3 A;  1YTY A;  2GXA A;  1OR7 A;  1BOA A;  3JRD A;  3B02 A;  4F3Q A;  3SDB A;  3BCB A;  5FFX A;  3KYL A;  2PMU A;  3K1P A;  3WTS C;  3HSR A;  3LWF A;  4WK8 F;  4HEA 2;  1EV7 A;  4U0V A;  4FTH A;  3JRF A;  2ZME B;  5HLH A;  3M3Y J;  2OC6 A;  2OQG A;  2TDX A;  3HL2 A;  1XX5 A;  1W5C C;  2HGC A;  2MLK A;  3G4S I;  3WHC A;  1RIO H;  1T39 A;  4K2E A;  5JLX A;  3S15 J;  3V8L A;  3S1M J;  2DCE A;  3PNT A;  5GAG J;  3GWZ A;  2CJJ A;  2DN0 A;  3SEZ A;  3VYT B;  3TED A;  1IXR C;  3LQR A;  3RKY A;  4F52 A;  3MKZ A;  3PIP F;  4IPA A;  3G1L A;  3Q3S A;  4AYB N;  3GTO J;  3EUK L;  3QU3 A;  1NK2 P;  1LDD A;  5H20 A;  1ONV A;  2K3F A;  3PO2 J;  5E1W A;  1YJW I;  5FKL A;  4ENM A;  5F0H A;  5C4X J;  2BY2 A;  1I27 A;  3MN2 A;  3MKW B;  2VKV A;  3E5X A;  3PIO F;  4OIQ F;  3BY6 A;  4B43 A;  1WQ2 A;  2M5W A;  3LSM A;  2QF7 A;  2VI6 A;  1K6Y A;  3ZQC A;  2V9K A;  2A6E F;  3JRC A;  2Z33 A;  4QSH A;  1O3T A;  3HOV J;  3IKV A;  1R1U A;  5J47 A;  4HX7 A;  3IWZ A;  2Z3Y A;  5H6Q A;  5HS9 A;  2XAS A;  1HBX G;  3S93 A;  2DFE A;  3VYR B;  3K1N A;  3CC4 I;  1MD0 A;  1IO2 A;  1MND A;  3KP4 A;  4LIV A;  3ECH A;  3BTI A;  1W5T A;  3DLA A;  5DD8 A;  2M34 A;  2Y69 H;  3HOX J;  2VE8 A;  4FT8 A;  5E8G A;  2R7Q A;  4XIC A;  2WV0 A;  3IUO A;  3ZMD A;  2HOS A;  2W4S A;  3DKX A;  2BXZ A;  1BIA A;  4HDV A;  2JUC A;  3E6C C;  2KIF A;  2JQ7 A;  4DW6 A;  3HOS A;  3P9K A;  3HEF A;  4DOZ A;  2H8W A;  1FSH A;  1SVM A;  1R9T J;  3L09 A;  3E6B A;  3JRH A;  3U2R A;  4RBO A;  1J59 A;  3A01 A;  2DXI A;  1B9M A;  3IH3 A;  3TKY A;  2LY2 A;  4AWX B;  4HG2 A;  5GTH C;  1RRJ A;  4GFB A;  3HOW J;  1IV8 A;  1ZN2 A;  2IGK A;  1Y1V J;  2A05 A;  3ISP A;  1HKQ A;  1I1G A;  1R5G A;  4BAC A;  4UNO A;  2PQ8 A;  1C0W A;  4XKV A;  2HTS A;  5KHD A;  2DO7 A;  2IT0 A;  1FMW A;  1Z3X A;  3CJQ B;  2XSJ C;  3S3M A;  2WAE A;  2RDP A;  3L2W A;  3A01 B;  3OOU A;  1R4N B;  5B66 C;  3HOU J;  3VOD A;  4M9S A;  2EFP A;  3AFH A;  2I5U A;  1REP C;  4EVI A;  1Z9C A;  3NQO A;  1XB4 A;  3TO9 A;  5J4Y A;  1JKR C;  4I0B A;  1OMI A;  2V1X A;  1SAN A;  1EA3 A;  2DFI A;  1JUM A;  2MLG A;  2NVT J;  2ESH A;  4CHU A;  2YU9 J;  4M3D A;  2NVY J;  5J3L A;  3HB9 A;  2ADU A;  1W0U A;  2HXI A;  2CUZ A;  4AIJ A;  4JK1 X;  3QP6 A;  3FHZ A;  4I2O A;  4II3 A;  3AG3 H;  3AKZ A;  1FTZ A;  1SFO J;  1DPR A;  4MEY F;  4CCM A;  3L1P A;  1R1T A;  2BY0 A;  2P6S A;  2Q8K A;  4A2U A;  1HW1 A;  3KPH A;  1F4K A;  2JA8 J;  2Z2S B;  4HQM A;  1JHF A;  2F5F A;  4AIH A;  2H8R A;  2RNG A;  4M3G A;  2QVO A;  3ZMV A;  1CF7 A;  3NEU A;  1QZY A;  2MD5 A;  3QOE A;  2Z99 A;  2E1M B;  3A2K A;  2E7W A;  2GLO A;  1WJE A;  2JTV A;  1FYK A;  2X6Y A;  5IT3 A;  3F22 A;  1P4W A;  5JI6 A;  1D0X A;  4UVA A;  3OS1 A;  1VQL I;  3QP5 A;  3HKZ A;  1ON2 A;  4N9H A;  1X19 A;  4M6X A;  2YUS A;  3OR2 C;  4A12 A;  3T5X A;  3I71 A;  2Y31 A;  3BTJ A;  2VXZ A;  2M8G X;  4BXU A;  3HG9 A;  4A3J J;  4XMY A;  1CF7 B;  1T08 B;  2L9N A;  2X1D A;  3BT9 A;  3OSG A;  1XGM A;  4AU7 A;  3JRG A;  2Y0M A;  1G59 A;  3G2B A;  3CCJ I;  4UUV A;  3GO5 A;  1U9N A;  4KN7 X;  4EM0 B;  3EUA A;  3TOA A;  1F43 A;  2E1O A;  1FYL A;  1J5Y A;  2DK5 A;  4QTR A;  2QSF X;  3E7L A;  4M9X A;  2R7F A;  2QEX I;  4FE7 A;  3P7N A;  1ZR2 A;  1T2K A;  2IGM A;  3QQA A;  3NAU A;  4CCL A;  1ON1 A;  2BVM A;  3MMY B;  1X3W B;  3W2A A;  1HXD A;  1UG0 A;  2FOK A;  1T0F C;  2L4M A;  3QYB A;  1MMA A;  2P0W A;  3H9G A;  3GTL J;  5B5E C;  3ZQ7 A;  1X1C A;  1R00 A;  2ETH A;  3LA3 A;  3TO6 A;  4E6K G;  3IAM 2;  5EZG A;  2ZO4 A;  2TCT A;  2DPD A;  4E7K A;  4MNU A;  4E4H A;  2R92 J;  2YPR A;  1H9T A;  2LDU A;  4LB5 A;  4LK1 F;  4DQ2 A;  3OYE A;  2JA6 J;  4LLN A;  4PZJ A;  1IDY A;  3R4K A;  3RSN A;  4BAY A;  4EM1 A;  1YIJ I;  4KIC A;  2VJJ A;  4HLY A;  3ZRG A;  3HIF A;  2UWM A;  2JRT A;  4IRG A;  3BTC A;  3UKG A;  2O5R A;  1UHS A;  2E34 A;  3I58 A;  3K2Z A;  1SEU A;  2EK5 A;  6PAX A;  3C1D A;  2OA4 A;  2V9V A;  3JSO A;  1TBX A;  3U21 A;  3E6M A;  3FXK A;  5D6E A;  3CCR I;  1U5T A;  5ILU A;  4CH7 A;  2Y9Z A;  4M71 A;  2MA3 A;  2LD5 A;  1HSJ A;  5DDG A;  5CJ9 A;  1JT0 A;  4AYB A;  3QOP A;  4A3E J;  2OAZ A;  3O3K A;  3VPR A;  3WHB A;  1U78 A;  4XOT A;  3S3O A;  1MNE A;  1SFU A;  2R7V A;  5J1U A;  3S1Q J;  2V6C A;  3OWT A;  2EH3 A;  1XMX A;  2K3P A;  1U5T B;  2R93 J;  3BQZ A;  3CLO A;  1GT0 C;  2H1K A;  1AHD P;  3OMY A;  1TLH B;  3CJN A;  2MYS A;  4ZDL A;  5ICG A;  2VQH A;  3RPQ A;  1FP1 D;  1LFP A;  1OJL A;  3W6J B;  1MBJ A;  2XGC A;  3CP8 A;  4V2G A;  2VQG A;  1G3S A;  4UVC A;  2F5C A;  2KFD A;  2JA2 A;  1X1P A;  3CCY A;  2P4W A;  5JR3 A;  3L9F A;  2NRA C;  5JLW A;  2YSR A;  3DFG A;  3JR9 A;  4C2M J;  3OY9 A;  3SDG A;  1SFX A;  2XUB A;  1XDS A;  2HTJ A;  3BR6 A;  3HHG A;  1MBF A;  1A35 A;  3KET A;  2HYG D;  3H0G J;  1IV6 A;  2HOA A;  1OIS A;  2FU4 A;  2DW4 A;  4XKC A;  1BW6 A;  2PMZ A;  3LOC A;  3FDY A;  3S3N A;  4LFU A;  1KU7 A;  2NYX A;  1J2X A;  2Q2E A;  1S7A A;  1VQK I;  1YX3 A;  1W5S A;  1ITY A;  1QHH D;  4Y4R A;  2GQQ A;  4MO7 A;  5D5X B;  3J81 K;  3FXU A;  4A5M A;  5HOD A;  4N4N B;  2FML A;  3F3X A;  3HYI A;  1Y56 A;  4I0A A;  1MMN A;  3BZC A;  4YRV A;  4B3A A;  1LUJ B;  3VB2 A;  1MMS A;  2MGQ A;  4IF4 A;  4L5E A;  3JRA A;  4BU2 A;  3OYB A;  3AG1 H;  2ZC2 A;  1ZG5 A;  2DAO A;  1U3E M;  4I7H A;  4X1E A;  3TOB A;  3OS2 A;  2VOO A;  1SAU A;  1E0E A;  1HA8 A;  1A6I A;  4D5F A;  3ZMU A;  4QIW N;  5BS6 A;  2EIL H;  2CV1 A;  2ZME C;  1I39 A;  3GW2 A;  4DNC A;  1QZE A;  5F27 A;  1YO5 C;  1WKM A;  2XF5 A;  2B63 J;  3OS0 A;  2ZJP F;  1OR7 C;  2LY1 A;  4JOM A;  1D8J A;  4ZYD A;  2HQ5 A;  2LBF B;  3TP3 A;  5EEG A;  3FZV A;  5E3N A;  4MLO A;  4BJ6 C;  1YLF A;  3H5N A;  1K4S A;  2HEO A;  2QLZ A;  1RR7 A;  3WE2 A;  3K4J A;  3J7Y J;  2DOA A;  4N4O B;  1ZAR A;  4QLC U;  1OCT C;  5FRN A;  2JA7 J;  3ZMS A;  1ZGA A;  1A5J A;  5GAE J;  2A68 F;  2L7F P;  1T38 A;  1GXQ A;  2OCE A;  2R3S A;  3VOE A;  3IP4 B;  4CZC A;  2QCO A;  4OOI A;  2R7S A;  1IRG A;  4IVN A;  1OCR H;  2HS5 A;  1L0O C;  3QOD A;  1S72 I;  4L0Y B;  1TQI A;  1TQP A;  2KIM A;  1I1S A;  1EH8 A;  3ML6 A;  4EJW A;  3OYC A;  3KZZ A;  3BG9 A;  1IUY A;  2ZJQ F;  4AIK A;  3H1C A;  3M7G A;  3K4K A;  2DPU A;  1VI0 A;  2E1N A;  2VJ5 A;  1LJ9 A;  2QM3 A;  2ELJ A;  2OTL I;  4GYI A;  3EET A;  1K4T A;  1BR1 A;  4LB6 B;  1UST A;  3CCE I;  2ME0 A;  2XPU A;  4OAY A;  3B6A A;  4C9Y A;  5CVV A;  5K5O A;  3VYU B;  1ETX A;  2F4O B;  4HOB A;  2KIU A;  5GAH J;  4RLF A;  4ITV A;  2F2E A;  1UHW A;  1WJC A;  3H3V K;  1V54 H;  3QPS A;  3C7J A;  3OYD A;  4G7Z F;  2L0K A;  1FMV A;  1G3W A;  4NNJ A;  1S6L A;  5DCF A;  4KYW A;  3I54 A;  1EH7 A;  3CDI A;  3KYC B;  4XR6 A;  3H3U A;  5F04 A;  3HUG B;  1XN7 A;  2O6G E;  4KIT B;  4CA0 A;  1MBG A;  4O3M A;  1PUF B;  2GXB A;  5D4S A;  5M5X J;  3IL2 A;  3K10 A;  2X6W A;  2FE3 A;  3SFI A;  3C3W A;  5HVQ C;  2R7D A;  4V19 K;  2KP6 A;  2CGP A;  1FY7 A;  2HQA A;  3FMQ A;  1OPC A;  2P8T A;  4UXN A;  1ETY A;  1ZRF A;  3IKT A;  3GTK J;  2MC4 A;  1MJA A;  1HDD C;  1TWH J;  2FJ1 A;  3K2A A;  4XLP F;  4ZZL A;  3WTX C;  1AU7 A;  1XGN A;  2R5Z A;  5HNF A;  5E17 F;  3L2C A;  2K9N A;  1Z0X A;  3LSH A;  1Y0U A;  3LFU A;  5E20 A;  2LP0 A;  1JKO C;  1XTA A;  1AOY A;  4HNV A;  4BQQ A;  4RB1 A;  2XSD C;  1KYZ A;  1ZAO A;  4IHS A;  1E3H A;  1W7P A;  1WJA A;  4G12 A;  3LA2 A;  5K7Z A;  2UUZ A;  2XRN A;  3F9K A;  3L2U A;  4B48 A;  2BEO A;  4GCV A;  1QGP A;  2W85 A;  2R5Z B;  1P4X A;  2DU9 A;  4L18 B;  1H0M A;  1TTY A;  4E7S A;  4F92 B;  2B9S A;  5EEH A;  5HNH A;  3S8P A;  1B8I A;  3RKQ A;  1R7J A;  2XGX A;  3GTG J;  2EJR A;  4B4C A;  5DM7 F;  5EF6 A;  4JYK A;  4ZC3 A;  3VEP A;  2VIX A;  3BZK A;  1VQP I;  3LNQ A;  2DT5 A;  1VZ0 A;  4MFD A;  2W48 A;  5DTD A;  3UNG C;  4BQN A;  4PJL A;  3A03 A;  3CCV I;  4MQ9 F;  4G9Y A;  2RN7 A;  1POG A;  2M30 A;  2E1M C;  5EG0 A;  3LA7 A;  3T1B A;  5KVR A;  1G4D A;  3FX3 A;  4PFO A;  2KRF A;  4HX4 A;  3HBL A;  5B1A H;  1B8I B;  1WH7 A;  3ZQI A;  5LEK A;  5DD4 A;  1UG2 A;  2VJI A;  3O8G A;  3BPV A;  1XGS A;  4P1W A;  4ZDP A;  2CUE A;  3RCO A;  2R4G A;  2EFQ A;  4B09 A;  2EZH A;  5FD5 A;  2DLL A;  3FMR A;  5D8L B;  4HF0 A;  3N05 A;  1KQ0 A;  2PLY A;  2D45 A;  5EG0 B;  3FXR A;  3CUO A;  1IF1 A;  1G8X A;  1LQ1 A;  1V5G A;  4FIS A;  5EGO B;  1PJR A;  3VDX A;  4MTD A;  1R4M B;  4S0H B;  2K85 A;  1T8I A;  1FBQ A;  1SC7 A;  2ZXI A;  3D5S C;  3HJE A;  1XDU A;  2MW8 A;  4A5N A;  1K79 A;  2A6T A;  5TGT A;  2VKH A;  2DA3 A;  2O03 A;  1P9Q C;  2HYJ A;  3LQQ A; 
#chains in the Genus database with same CATH homology
 4L9T A;  4ZYE A;  2EFW A;  3F8C A;  2FF4 A;  3EUH A;  4OIN F;  2FBH A;  2IPQ X;  1EH6 A;  3F72 A;  3RKX A;  3SZP A;  1HQC A;  2FXA A;  1SD6 A;  1XMK A;  2EA2 A;  5J6X A;  2E1C A;  4G7O F;  3E5U A;  3JAM K;  1BIB A;  1U5T C;  2YX7 A;  3HTU A;  3GYH X;  2L02 A;  1TW2 A;  4WX9 A;  2K02 A;  4ESJ A;  3MZH A;  4F7Z A;  4KT5 C;  3DEU A;  5CVI A;  2H6B A;  3HHH A;  4XSX F;  5DCM A;  4RB0 A;  2EV6 A;  3DF8 A;  4R1H A;  5HS7 A;  3V7S A;  3RYR A;  2EB7 A;  2VBW A;  4N0B A;  1R22 A;  4EGY A;  3J80 Z;  1IXC A;  3WTU C;  4PGH A;  4CO8 A;  3F6O A;  1HW2 A;  3QU6 A;  1FOK A;  3ERE D;  5DCM B;  4S04 A;  3ULQ B;  5CLS A;  1BN5 A;  2A07 F;  1K78 B;  2G7H A;  2D1H A;  5K1Y A;  2KJC A;  5FB2 A;  2XVC A;  2EV5 A;  1SAX A;  2YR2 A;  5JFR A;  1XD7 A;  5FLX Z;  2QBY B;  2HFH A;  4RGX A;  5A2Q Z;  2YU3 A;  2QQB A;  2PI0 A;  3DQV C;  3RJP A;  2XV4 S;  4ENN A;  1MKM A;  1ZHF A;  1IN7 A;  2XAJ A;  2UXX A;  3IWF A;  3OOP A;  1SD5 A;  1ZLK A;  1QPM A;  1TNT A;  2XKP A;  5DV5 A;  1GXP A;  4PDK A;  1V4R A;  4B8X A;  3FMS A;  1P2F A;  1BC7 C;  2FSW A;  4HDU A;  4KUM A;  4BHC A;  3BJA A;  5K5Q A;  3PQK A;  3GLX A;  1GVJ A;  1SD7 A;  3KEO A;  2AS5 F;  3DPT A;  3M1E A;  2ZXJ A;  4HV6 A;  5HOO A;  5BOX A;  3RPU A;  4P9U A;  2QZ8 A;  3WTT C;  3E3V A;  1DUX C;  3WTY C;  3SFZ A;  1Q1H A;  3WTV C;  3L00 A;  2OQR A;  1R5H A;  1J0R A;  3KP2 A;  2VBX A;  1B9N A;  3ZMT A;  2VN2 A;  3KP3 A;  2IW5 A;  3CTA A;  4Q5S F;  5ILS A;  5CVR A;  1K7A A;  4HV5 A;  3AAF A;  1LB2 A;  4A0Z A;  4MGR A;  2P5V A;  3DXJ F;  3K0L A;  4A6D A;  2ESN A;  1F9N A;  5LHH A;  3ABU A;  1PUE E;  4MTE A;  1XSD A;  4HF1 A;  3E6D A;  3VFZ A;  3SHF A;  4WCG A;  1O7F A;  2DQL A;  4UVB A;  4WXD A;  4ZYG A;  3GX4 X;  4U7B A;  2DQR A;  5LGU A;  1T98 A;  5LHI A;  4P55 A;  1JHH A;  5J8F A;  2MBF A;  1OYW A;  1KA8 A;  3OV8 A;  2XKO A;  4P96 A;  4P5O A;  4RGS A;  2HQR A;  3I0T A;  4AD9 A;  3WGG A;  1MJB A;  4KN4 X;  2PFB A;  2GIV A;  4RB3 C;  3DPL C;  4UV8 A;  3BZ6 A;  4BHB A;  2LF7 A;  3GFM A;  3HOT A;  2L01 A;  4AVP A;  5L3E A;  2HQN A;  2PMH A;  5D5V B;  2Z5U A;  2FRH A;  3C18 A;  3V8K A;  4XSZ F;  5ERI A;  2HOE A;  3HRM A;  4L9N A;  5KK1 A;  2XHK A;  3N4M A;  1USS A;  2RVC A;  1UB9 A;  1SMT A;  1BC8 C;  5K5R A;  4LG0 A;  4Y13 A;  1R58 A;  3R0J A;  2K4B A;  1OYY A;  5D6F A;  1YQA A;  2W25 A;  1RUN A;  1IRF A;  2EWN A;  2YX4 A;  2H94 A;  4LG0 B;  4G7H F;  1UHM A;  2P6T A;  1B6A A;  1UCR A;  2VBZ A;  2A61 A;  1A04 A;  2OBP A;  2LSO A;  3F8F A;  3COA C;  2X0L A;  4XBF A;  2V79 A;  3IHU A;  5FGM A;  4WWC A;  3Q5F A;  1RUO A;  1QZZ A;  1YFH A;  3CO6 C;  2CO5 A;  4IRH A;  4A0X A;  2P5K A;  2ZJ2 A;  2V1D A;  3RI4 A;  4XLN F;  2A69 F;  4CIC A;  2XAG A;  1U2W A;  2KJB A;  4PGG A;  1E17 A;  2IA0 A;  3V7R A;  3IC7 A;  3KP5 A;  1FYM A;  5L3D A;  5HLG A;  1R1V A;  4UV9 A;  1LEA A;  3EDP A;  2VC0 A;  2IRF G;  5F6F A;  2ISZ A;  5E18 F;  3BRO A;  3GFL A;  1OKR A;  3KFW X;  3G3Z A;  5LRR A;  2NS0 A;  5ICC A;  2A6H F;  5LGT A;  3PQJ A;  1XCB A;  4G6D A;  4P9F A;  3BJ6 A;  2MC3 A;  3WU0 A;  4KMU X;  1FBU A;  3CO7 C;  2IVM A;  1LVA A;  2O61 A;  4FX0 A;  1KU2 A;  4LLG F;  4CDG A;  3BP8 A;  1SMY F;  1IN6 A;  1FSE A;  2IJL A;  3WG9 A;  2G9W A;  4YFX F;  3HUG A;  4NHJ A;  1D8K A;  3JTH A;  1I6X A;  4OIO F;  1R23 A;  3F6V A;  2OU2 A;  2F5D A;  2EFN A;  2ZCW A;  4N9I A;  2P5L C;  1W7P D;  1TQM A;  2MH2 A;  3TQN A;  4HYE A;  3V7C A;  4IXA A;  5L3F A;  1BM9 A;  3T0Y A;  2K86 A;  1MDM B;  5LBQ A;  4I98 B;  1ZYR F;  4EJV A;  2GZW A;  1XMA A;  1MJ9 A;  4HAM A;  4S05 A;  1I5Z A;  3JSP A;  1FT9 A;  4ASN A;  3BOQ A;  2CSO A;  5D4R A;  2E7X A;  4KDP A;  5FO5 A;  2HKO A;  3I53 A;  1Z91 A;  2EV0 A;  1YYV A;  1S8N A;  3HSF A;  2ZNY A;  1LNW A;  2L54 A;  2FNP A;  3JTG A;  4WF2 A;  2EA4 A;  3FF5 A;  3FM3 A;  1WI9 A;  1QO0 D;  2OZ6 A;  2XIG A;  1O3R A;  4WXH A;  4RB2 C;  1H9G A;  2VBY A;  3KP6 A;  4CYD A;  5AIP A;  1RNL A;  4HF2 A;  4HW0 A;  3F8M A;  4KMF A;  2JSC A;  4HZF A;  2ELH A;  4WXC A;  1AWC A;  4Q48 A;  5IT9 Z;  2P7C B;  1YW9 A;  3O6B B;  5HDK A;  3KCC A;  3RIR A;  1D5V A;  2A5Y B;  3WOD F;  1W4M A;  2BE5 F;  3M8F A;  1HKT A;  3BPX A;  1ODD A;  3K69 A;  3WTZ A;  4EGZ A;  1IN8 A;  2PEX A;  3ELK A;  1STZ A;  1ZG1 A;  3GFJ A;  3U9G A;  4YFN F;  2LF8 A;  4U88 A;  3R6S A;  2QUF A;  4ENJ A;  2COM A;  3B73 A;  4TV7 A;  3PFI A;  2CW0 F;  4KFC A;  2VOP A;  2QWW A;  5LLQ A;  4EJO A;  5E8I A;  4HA8 A;  2QEN A;  4U7D A;  4NB5 A;  4L5I A;  4LK0 F;  3S2W A;  2BYV E;  1U8R A;  2XRO A;  1IN4 A;  4ZZD A;  4EQQ A;  5F64 A;  2VON A;  3HRT A;  2PBI A;  1WRJ A;  2W57 A;  1BI0 A;  3KEQ A;  1YIO A;  5CVJ A;  3LFK A;  2BV6 A;  3REO A;  1SFE A;  2CG4 A;  3D0S A;  2F5E A;  2GXG A;  3RKW A;  2RNJ A;  1L3L A;  1IXS B;  1IZ1 A;  1K78 A;  1U6G A;  2FBI A;  3M9A A;  3IRR A;  1DPU A;  3U1D A;  4BNC A;  1HKS A;  1GHC A;  2PJP A;  2VE9 A;  3MWM A;  3I64 A;  1ZRE A;  1J75 A;  3E5Q A;  1CGP A;  3QRF F;  2QBY A;  2JT1 A;  2Y48 A;  1IAW A;  1KQ8 A;  4G8X A;  1S7O A;  2ZKZ A;  4R79 A;  1PP8 F;  2MH9 A;  2X4H A;  4KIB A;  2O8X A;  4I09 A;  3MCZ A;  2DBB A;  2GA2 A;  3TDZ C;  4O6J A;  4M72 A;  2FQ3 A;  4GXO A;  3CDH A;  5HS8 A;  3FXQ A;  4YG2 F;  4LD5 A;  2M8E A;  3J80 K;  3QAH A;  1MZB A;  2OZU A;  2QYO A;  4IHT A;  1VTN C;  1P92 A;  4ESF A;  2VC1 A;  3BDD A;  4EV0 A;  5LEJ A;  2LKP A;  5DUI A;  2H27 A;  3R60 A;  2B0L A;  5DEQ A;  4EMS A;  5FLX K;  3WGH A;  4ENK A;  4MQV A;  2FEZ A;  2QQA A;  1ZGJ A;  5A2Q K;  3SZT A;  3GUD A;  2NAZ A;  4M9Z A;  1KU9 A;  4IRI A;  2ZFW A;  2J5O A;  3I59 A;  5L3G A;  5CYV A;  1BJA A;  2WWY A;  3EQL F;  2H6C A;  2W24 A;  3GZ6 A;  1JGS A;  4LJZ F;  4M6Y A;  5JVT A;  3SQN A;  3W6K B;  2CWE A;  2LNB A;  3I59 B;  4EJT A;  3J7A O;  3FM5 A;  1MGT A;  1G3Y A;  2JPB A;  2CQK A;  4OMZ A;  1UFM A;  2O3F A;  3F23 A;  3LAJ A;  1TNS A;  3MAJ A;  4EJU A;  2OD5 A;  1RI7 A;  2A3S A;  5JHU A;  2AXL A;  3K9T A;  4OMY A;  5J8C A;  2HDC A;  4YII A;  4EM2 A;  2IA2 A;  1FX7 A;  4GYG A;  1PP7 U;  5FD6 A;  1TW3 A;  1FWZ A;  5BPI A;  2GA1 A;  1BBY A;  2CFX A;  2DK8 A;  1Z6T A;  2M1B A;  5HDG A;  3HSE A;  3EYY A;  1G6N A;  3N97 A;  5BQT A;  1Z05 A;  1F5T A;  2VT3 A;  2J5P A;  4L9J A;  4CXF A;  1YS6 A;  3E97 A;  3KE2 A;  3F8N A;  4U0Y A;  2IA1 A;  2BGC A;  4BQA A;  4CZZ A;  1S29 A;  1Z1D A;  5ICF A;  2RC4 A;  1P4A A;  1FZP B;  3KZY A;  4HX8 A;  3MFK A;  2FBK A;  1FNN A;  2XAF A;  3CUQ A;  4YIF A;  5ICE A;  4ETS A;  4ZH4 F;  1ZG3 A;  2L3D A;  3R61 A;  3Q9S A;  5LHG A;  3J81 Z;  5CVU A;  4MEX F;  1LDK B;  1F1Z A;  4I02 A;  2HWV A;  4Y15 A;  2RGV A;  3RDI A;  3CUQ B;  5D8K B;  5H6R A;  1T6S A;  4HBL A;  1B59 A;  2PG4 A;  3H92 A;  4G94 A;  4OIR F;  2Z9O A;  3ROU A;  1QNT A;  1JE8 A;  4D0P A;  4U0W A;  4RAZ A;  1J9I A;  2FMY A;  3DKW A;  3WU1 B;  4ESB A;  3ZPL A;  3ZN1 A;  2D2W A;  1O3Q A;  2HYF A;  4LLL A;  3RYP A;  4L0Z B;  1YS7 A;  2RQP A;  1ZRD A;  3ZN0 A;  3RTR A;  1X3U A;  1BI1 A;  2STW A;  3V4G A;  3WE3 A;  4JBA A;  2WTE A;  3ZMZ A;  1KGS A;  1QBJ A;  3K1M A;  1OYI A;  1HW5 A;  5BMZ A;  3H3Z A;  2STT A;  3WTW C;  4HQE A;  2IP2 A;  1Z7U A;  1JXS A;  2ZBK A;  2GAU A;  2PN6 A;  5D5W B;  3Q9V A;  1BI2 A;  1FPQ A;  4Y17 A;  2JPC A;  1ZH5 A;  2D1V A;  4JQF A;  1DP7 P;  4LGW A;  4A6E A;  4XRF A;  3L7W A;  3M8E A;  3DV8 A;  1HST A;  1IW7 F;  4RS8 A;  1R36 A;  4UHT A;  1P6R A;  1PDN C;  4MHG A;  1XGO A;  2ZNZ A;  4OIP F;  1YW8 A;  4L5J A;  3GFI A;  4H0E A;  1MDM A;  1V3F A;  5L3C A;  2G7U A;  4Z2Y A;  1K6O A;  3ZP5 A;  3BJO A;  3MEX A;  5E1X A;  4BHP A;  3I5U A;  2FNA A;  1E2X A;  4NQW A;  3GF2 A;  2L4A A;  3SXY A;  3NRV A;  2O0Y A;  2K4J A;  1LDJ A;  3P9I A;  1FC3 A;  2JZY A;  4ON0 A;  4GO1 A;  4HLX A;  3MQ0 A;  4RGR A;  3GXO A;  2BBY A;  2QQ9 A;  1B4A A;  4O5V A;  1NHA A;  4L9V A;  4R8H A;  4FX4 A;  1IN5 A;  1WSU A;  5ILV A;  1ULY A;  3HTS B;  2FA5 A;  2XAQ A;  5DYM A;  4Q47 A;  1YW7 A;  2CYY A;  3TO7 A;  1O57 A;  3FWE A;  3BWG A;  3F8B A;  2DTR A;  2NNY A;  4G6Q A;  5LGN A;  1RZ4 A;  4YFK F;  2RKH A;  2KKO A;  3T8R A;  2RV8 A;  4RAY A;  1O7L A;  3LST A;  4ZYH A;  3GEZ A;  3DP7 A;  3GVA A;  1T0F A;  5TRD A;  2Y75 A;  1FP2 A;  1ZLJ A;  1G3T A;  2K27 A;  4KIG A;  2W84 A;  3QPT A;  5AON A;  3HRS A;  1W7P B;  5ED4 A;  2HKX A;  3D5L A;  2EFO A;  3G73 A;  2WC2 A;  1S3J A;  4PCQ A;  5AIQ A;  2XAH A;  2HZT A;  1FLI A;  3T8T A;  2P7V B;  4QWQ A;  3HRU A;  2H09 A;  5TJJ A;  4IJA A;  2UZK A;  4KIF A;  4GGG A;  3ECO A;  3IRQ A;  4I01 A;  3ABT A;  4LMY A;  2UXN A;  2M87 A;  3O2P E;  3V8J A;  1LEB A;  4KNY A;  5FFZ A;  1Z6R A;  4M73 A;  4A0Y A;  1J7K A;  3I4P A;  3JAM Z;  2K7L A;  4BH9 A;  4BYY A;  1O3S A;  1BI3 A;  4E70 A;  2C6Y A;  4RGU A;  2M45 A;  2ACJ A;  2GWR A;  1KYW A;  1D3Y A;  3QPH A;  1DDN A;  4FHT A;  3F21 A;  1QQI A;  2DI3 A;  5E1Z B;  1SD4 A;  2Q0O A;  3KP7 A;  5IT9 K;  1XCV A;  3P9C A;  3TGN A;  3KLO A;  1KQ9 A;  1FBS A;  5HDN A;  4M74 A;  5DUK A;  3MZY A;  4CGZ A;  5F1R A;  3KLN A;  3WGI A;  2VT2 A;  4OU0 A;  1B1B A;  5D5U B;  1KU3 A;  3JW4 A;  5HLI A;  5LRS A;  4KA4 A;  2NNN A;  3LAP A;  2V1U A;  3CUQ C;  1WWX A;  1XSX A;  5L3B A;  1XSV A;  4Q4Z F;  1ZRC A;  3EYI A;  2ISY A;  3R0A A;  2ZME A;  2VOD A;  3GZ5 A;  3TDU C;  1YG2 A;  5BPD A;  2HR3 A;  1YTY A;  1OR7 A;  1BOA A;  3B02 A;  5FFX A;  2PMU A;  3K1P A;  3WTS C;  3HSR A;  3LWF A;  4WK8 F;  1EV7 A;  4U0V A;  2ZME B;  5HLH A;  2OQG A;  2TDX A;  2HGC A;  2MLK A;  1RIO H;  1T39 A;  4K2E A;  3V8L A;  3GWZ A;  1IXR C;  3LQR A;  3RKY A;  4IPA A;  3QU3 A;  1LDD A;  5H20 A;  1ONV A;  5E1W A;  4ENM A;  1I27 A;  3E5X A;  4OIQ F;  3BY6 A;  1WQ2 A;  2M5W A;  2Z33 A;  2A6E F;  1O3T A;  3IKV A;  1R1U A;  4HX7 A;  3IWZ A;  2Z3Y A;  5H6Q A;  5HS9 A;  2XAS A;  1HBX G;  3K1N A;  1MD0 A;  3KP4 A;  3ECH A;  1W5T A;  5DD8 A;  1Z9C A;  2VE8 A;  4FT8 A;  5E8G A;  2WV0 A;  3ZMD A;  1BIA A;  4HDV A;  3E6C C;  2KIF A;  3HOS A;  3P9K A;  1FSH A;  3L09 A;  3E6B A;  3U2R A;  1J59 A;  1B9M A;  3TKY A;  4AWX B;  1ZN2 A;  3ISP A;  1HKQ A;  1I1G A;  1R5G A;  4UNO A;  2PQ8 A;  1C0W A;  2HTS A;  2DO7 A;  2IT0 A;  2RDP A;  3VOD A;  4M9S A;  2EFP A;  1REP C;  4EVI A;  3NQO A;  1XB4 A;  3TO9 A;  4I0B A;  1OMI A;  2V1X A;  2DFI A;  2MLG A;  2ESH A;  4CHU A;  2ADU A;  4AIJ A;  4JK1 X;  3QP6 A;  3FHZ A;  4I2O A;  1DPR A;  4MEY F;  1R1T A;  2P6S A;  2Q8K A;  4A2U A;  1HW1 A;  1F4K A;  4HQM A;  1JHF A;  2F5F A;  4AIH A;  2QVO A;  3ZMV A;  1CF7 A;  3NEU A;  1QZY A;  2MD5 A;  2Z99 A;  2E7W A;  2JTV A;  1FYK A;  5IT3 A;  3F22 A;  1P4W A;  5JI6 A;  4UVA A;  3QP5 A;  1ON2 A;  4N9H A;  4M6X A;  4A12 A;  3T5X A;  3I71 A;  2VXZ A;  4BXU A;  1CF7 B;  1XGM A;  2Y0M A;  4UUV A;  3GO5 A;  4KN7 X;  4EM0 B;  3TOA A;  1FYL A;  1J5Y A;  2DK5 A;  4M9X A;  2R7F A;  3P7N A;  1T2K A;  1ON1 A;  1HXD A;  2FOK A;  2L4M A;  3ZQ7 A;  1R00 A;  2ETH A;  3LA3 A;  3TO6 A;  2ZO4 A;  2DPD A;  4MNU A;  2YPR A;  1H9T A;  2LDU A;  4LB5 A;  4LK1 F;  4DQ2 A;  4LLN A;  4PZJ A;  3R4K A;  4BAY A;  4EM1 A;  4KIC A;  4HLY A;  3HIF A;  2UWM A;  2JRT A;  4IRG A;  3I58 A;  3K2Z A;  2EK5 A;  6PAX A;  3C1D A;  2OA4 A;  2V9V A;  3JSO A;  1TBX A;  3E6M A;  1AOY A;  5D6E A;  1U5T A;  5ILU A;  4M71 A;  2MA3 A;  1HSJ A;  5DDG A;  5CJ9 A;  3QOP A;  2OAZ A;  3O3K A;  1U78 A;  1SFU A;  2V6C A;  1U5T B;  3CLO A;  1TLH B;  3CJN A;  5ICG A;  3RPQ A;  1FP1 D;  3W6J B;  1G3S A;  4UVC A;  2F5C A;  2P4W A;  5JR3 A;  3L9F A;  2NRA C;  2YSR A;  3DFG A;  1SFX A;  2XUB A;  1XDS A;  2HTJ A;  3HHG A;  3KET A;  2HYG D;  2FU4 A;  2DW4 A;  4LFU A;  1KU7 A;  2NYX A;  1J2X A;  2Q2E A;  1S7A A;  1W5S A;  2GQQ A;  5D5X B;  3J81 K;  3FXU A;  4A5M A;  2FML A;  3F3X A;  3HYI A;  4I0A A;  3VB2 A;  4IF4 A;  1ZG5 A;  2DAO A;  1U3E M;  4I7H A;  3TOB A;  2VOO A;  3ZMU A;  5BS6 A;  3GW2 A;  4DNC A;  1YO5 C;  1WKM A;  1D8J A;  4ZYD A;  5EEG A;  3FZV A;  1YLF A;  2HEO A;  2QLZ A;  3WE2 A;  4QLC U;  1ZAR A;  3ZMS A;  1ZGA A;  2A68 F;  1T38 A;  1GXQ A;  2R3S A;  3VOE A;  4OOI A;  1IRG A;  4IVN A;  2HS5 A;  1L0O C;  4L0Y B;  1TQI A;  1TQP A;  2KIM A;  1I1S A;  1EH8 A;  3ML6 A;  4EJW A;  3KZZ A;  1IUY A;  4AIK A;  3M7G A;  2DPU A;  2E1N A;  1LJ9 A;  2QM3 A;  4GYI A;  3EET A;  4LB6 B;  1UST A;  5CVV A;  5K5O A;  4HOB A;  2KIU A;  2F2E A;  1UHW A;  3C7J A;  4G7Z F;  1G3W A;  1S6L A;  5DCF A;  4KYW A;  3I54 A;  1EH7 A;  3H3U A;  1XN7 A;  2O6G E;  2GXB A;  4O3M A;  5D4S A;  3IL2 A;  2FE3 A;  3C3W A;  5HVQ C;  2R7D A;  2CGP A;  1FY7 A;  3FMQ A;  1OPC A;  2P8T A;  4UXN A;  1ZRF A;  3IKT A;  1MJA A;  4XLP F;  4ZZL A;  3WTX C;  1XGN A;  5E17 F;  3L2C A;  1Y0U A;  5E20 A;  4RB1 A;  1KYZ A;  1ZAO A;  4IHS A;  1W7P A;  3LA2 A;  2XRN A;  2BEO A;  4GCV A;  1QGP A;  2W85 A;  1P4X A;  2DU9 A;  4L18 B;  1H0M A;  1TTY A;  5EEH A;  1R7J A;  2XGX A;  2EJR A;  3VEP A;  2DT5 A;  4MQ9 F;  4G9Y A;  2RN7 A;  2M30 A;  3LA7 A;  3T1B A;  5KVR A;  1G4D A;  3FX3 A;  2KRF A;  4HX4 A;  5LEK A;  5DD4 A;  3BPV A;  1XGS A;  2EFQ A;  4B09 A;  5FD5 A;  2DLL A;  3FMR A;  5D8L B;  4HF0 A;  1KQ0 A;  2PLY A;  2D45 A;  3FXR A;  3CUO A;  1IF1 A;  1LQ1 A;  4MTD A;  1FBQ A;  4A5N A;  1K79 A;  1XDU A;  2O03 A;  3LQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...