2YR2A

Crystal structure of the hypothetical regulator from sulfolobus tokodaii
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
142
structure length
142
Chain Sequence
NENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Hypothetical regulator from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription regulator
molecule keywords 146aa long hypothetical transcriptional regulator
total genus 60
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2yr2A00
2RGVA 2FBIA 1O3SA 3F8CA 3T8RA 2HKOA 1PP7U 4L9TA 2A5YB 3RKXA 1OYIA 1IXCA 5HDKA 5HS9A 2VN2A 4LGWA 4FX0A 2EFQA 2O8XA 1S7OA 1PUEE 2EFOA 1IZ1A 3LAJA 4AWXB 1OMIA 4M9SA 4LD5A 1ZG1A 2XAHA 1IF1A 2CO5A 2L4MA 4IRHA 4HZFA 1U78A 2O6GE 1CF7A 2LDUA 2FMLA 4G94A 4M72A 3N97A 2C6YA 4I2OA 1Z6RA 3REOA 3R60A 3RYRA 1W5SA 2EFWA 3CUQC 4RB2C 4KUMA 3TDZC 4G8XA 3OOPA 2BBYA 4Q48A 1EH6A 4CZZA 3E6MA 1SFXA 2M5WA 3HUGA 4KIGA 1RIOH 3RDIA 5CJ9A 3O3KA 1IN8A 4IJAA 4HBLA 3U2RA 2FBKA 4MHGA 1HSTA 1MJ9A 1LEAA 4Q5SF 1QPMA 1R1TA 5LGUA 2YX7A 5F1RA 2OZUA 4GYGA 3CO7C 2ZNYA 5ILVA 3C18A 4Y13A 3HIFA 5ERIA 5BQTA 5DUKA 4EGYA 2BE5F 2A3SA 4ETSA 1ONVA 2AS5F 4KN7X 1P4AA 3GFLA 1B9MA 2MA3A 4BYYA 4XSZF 3CUQB 2MH2A 3LA2A 1OPCA 1YIOA 3WG9A 4BHPA 1D8KA 2ZNZA 4RAYA 3NEUA 3R6SA 1TTYA 2H6BA 1KU2A 3E6DA 4G6QA 5LLQA 1P4WA 3RYPA 1G4DA 3WE2A 1K78B 5K5OA 4WF2A 2HQNA 4U0WA 2MLGA 1ZREA 4M6YA 3GZ5A 3FWEA 2CSOA 5CVIA 5ICFA 2MBFA 4XLNF 4ENNA 2HFHA 1MGTA 1FNNA 1HSJA 3GVAA 1Q1HA 3R0JA 2OA4A 1LDDA 3ZMSA 2RDPA 4EM2A 3C3WA 4YIFA 4OOIA 2HOEA 4ZYHA 4HAMA 1FSEA 5BPIA 2VT3A 3FM5A 3FZVA 1O7LA 2L01A 3WTWC 1QZZA 4YFXF 4ON0A 3K2ZA 5LEJA 3GX4X 4A2UA 1KA8A 1W7PA 1QQIA 1W7PD 1QGPA 1KU9A 1FYKA 3IC7A 1TW3A 3B73A 3K9TA 4A5MA 1QBJA 3RKWA 5FGMA 3C1DA 2LF8A 4L9JA 5D4RA 3ZPLA 4S04A 2DBBA 4O6JA 1F1ZA 3QU6A 2Q0OA 4A6DA 2L02A 1T98A 3E3VA 2F5CA 2ZBKA 3RPUA 3RJPA 3K1PA 5FB2A 4G6DA 5K5QA 2F5DA 3QU3A 3T5XA 2V1UA 1H0MA 3FM3A 2STWA 2K4BA 4A0ZA 2M87A 2HYGD 2UXXA 3DQVC 1FPQA 2DK5A 4RS8A 3F8MA 1SFUA 1J59A 1FYMA 1XDUA 4TV7A 2GWRA 2FXAA 3LWFA 2E7XA 1SMTA 2HS5A 3KEOA 3E5UA 3GEZA 3E5XA 2H6CA 4G7HF 1FT9A 4IVNA 1HXDA 4I0AA 3KCCA 4LMYA 5HS8A 4GCVA 2XAFA 2IRFG 1OKRA 3QP6A 1MD0A 4ESJA 4ESBA 2E1NA 2ETHA 1PP8F 5IT9Z 3L7WA 4HV5A 3HOSA 2UWMA 3KFWX 1LVAA 4MEYF 1E17A 2OD5A 2P4WA 3ZQ7A 3MZHA 2A07F 4IHSA 2KJCA 1U6GA 4EJWA 3JSOA 4HDUA 3T1BA 3J7AO 3ERED 5KK1A 5CVUA 3C7JA 2L54A 1XGNA 1WKMA 2ADUA 1SD5A 5F6FA 4I01A 5TJJA 3N4MA 4WXCA 3QPHA 2HWVA 3CUQA 1S6LA 3I71A 2IPQX 4EM0B 1TNSA 3JW4A 3KP3A 2YPRA 1U8RA 2IW5A 3ECOA 4UV9A 2UXNA 4Y17A 1USSA 4HOBA 2H27A 4KFCA 3HOTA 3IHUA 2E1CA 3HRTA 2LSOA 4HQEA 2JZYA 4KT5C 4HF2A 2EFNA 5J6XA 4EQQA 5CVVA 3IKVA 2MD5A 5LGNA 2PEXA 2EJRA 1DPRA 2JT1A 1BM9A 4L9VA 3ZMUA 1I5ZA 5FD6A 4I7HA 2OQRA 1Z1DA 1CGPA 3CDHA 3Q5FA 5HS7A 2VC1A 3Q9SA 4KA4A 2ZFWA 3V7CA 1ZGAA 1KU7A 2QQBA 2M30A 3ABUA 4GYIA 2HR3A 5E20A 4A5NA 3GFJA 5H6RA 2X0LA 4LK0F 4Q4ZF 1B4AA 5LBQA 3DXJF 2ZXJA 4A12A 5JR3A 1USTA 1D3YA 1BBYA 5J8FA 1MDMA 2Q8KA 1G3YA 1FBSA 1KQ0A 1BI2A 4M73A 1JGSA 3U9GA 1LB2A 2PFBA 1ZHFA 2RN7A 4PCQA 3VB2A 3VEPA 1OR7A 3WGGA 3WTYC 4MTDA 2FE3A 2FQ3A 3WGIA 4BQAA 4G7OF 1S29A 1MJBA 2NYXA 4GGGA 2Z9OA 4UVBA 1R7JA 3ZMDA 1LEBA 2VOPA 2HTJA 2KIMA 1FP1D 2WC2A 1AOYA 3L9FA 1KU3A 1DUXC 3K1MA 2XROA 1XMAA 1O7FA 4MNUA 3ULQB 2RKHA 3I64A 3G3ZA 1B1BA 2YX4A 1I27A 4OIPF 2BEOA 2PBIA 1LQ1A 3IRRA 1Z7UA 5E1WA 3J80K 1P2FA 2NAZA 4OIRF 1EH7A 1T6SA 3F72A 3TGNA 1FLIA 1O3TA 2GXBA 1IRGA 1OYYA 4LG0B 3LQQA 4Y15A 3IRQA 1J5YA 1XSXA 2VOOA 1MJAA 1CF7B 1B59A 1O3QA 4P55A 3ML6A 3EYYA 1J75A 2XKOA 1R00A 1X3UA 3V7RA 4BAYA 2ISYA 1FWZA 4HQMA 3RKYA 4N9IA 2DTRA 2QBYA 2PQ8A 2QLZA 1H9TA 1JHFA 5AIPA 4IRGA 4RB0A 3J81Z 5J8CA 1BN5A 4HW0A 2J5PA 3I0TA 5AIQA 1KQ9A 3F23A 3VOEA 2FBHA 3R4KA 4ASNA 3F6OA 2OZ6A 5FFZA 5H20A 5LGTA 2D1HA 2LKPA 3V8JA 1R5GA 1K79A 3KEQA 4MQ9F 1YFHA 4QWQA 2RV8A 4JK1X 1XGMA 1BI1A 2K7LA 4LJZF 4CO8A 3WTUC 1KYZA 5D5WB 1C0WA 2V79A 2R3SA 1HKSA 2DQLA 3I53A 1ON2A 2JPBA 2P8TA 2G7HA 2NNYA 2R7FA 3L09A 2QWWA 1P6RA 2P5VA 5D4SA 1Z91A 1K78A 1REPC 3GYHX 1FBQA 4BHCA 2PMHA 1J0RA 3P9CA 1WRJA 2P7VB 2VBXA 3K0LA 3DPTA 3DEUA 3CO6C 3FHZA 4EGZA 4UVCA 3LAPA 3BWGA 4BH9A 5L3DA 3PQKA 3BJOA 1H9GA 4U0VA 4P9UA 2VBZA 3I54A 4KIBA 1BIBA 2RC4A 3KZYA 1RNLA 3BPXA 2P6TA 3T8TA 1A04A 1YLFA 4UV8A 1ON1A 1W7PB 3TO9A 3FMRA 3E6BA 5E18F 5EEHA 4CICA 1R5HA 4DNCA 1SD4A 5DUIA 4I0BA 2EB7A 2V1DA 4HLYA 1TLHB 1HKTA 5IT9K 1JXSA 3IWFA 4RGUA 3IL2A 4FHTA 2E7WA 1BI0A 1BC8C 2A68F 5ILSA 4P5OA 5LHHA 2A69F 2HKXA 1DDNA 4M9ZA 3QPTA 2H09A 4K2EA 4YFKF 2KJBA 3L00A 4EV0A 2F2EA 2DFIA 2VE8A 3FXQA 1G3WA 3COAC 1UHWA 3U1DA 2X4HA 3SFZA 4A0XA 4RGSA 2FNPA 3TKYA 4HV6A 3FMQA 1YS6A 3TO7A 4LLLA 1U3EM 2CW0F 1ZARA 2QBYB 3GFMA 3I58A 2EV0A 1I1GA 3Q9VA 3B02A 1U5TA 4YG2F 1ZG5A 3ELKA 3P9IA 5D8KB 4A0YA 3EYIA 1BI3A 3EUHA 5DV5A 1U2WA 2GA2A 1XMKA 1YG2A 2FA5A 3D0SA 3KP4A 2CQKA 4YIIA 4XLPF 4HF0A 4ENMA 2VBYA 3E6CC 2EA2A 1O57A 1HKQA 1FP2A 4ENKA 2FMYA 3TOAA 1QNTA 2BGCA 1NHAA 1S3JA 2DPUA 2BYVE 1GHCA 1G3TA 5EEGA 3ISPA 3MCZA 2XASA 3W6KB 4AVPA 5DCMA 1ZH5A 5CVRA 2ZJ2A 2HZTA 5JVTA 3O6BB 1MDMB 3KP2A 4XBFA 4BHBA 4Q47A 3WU1B 1P4XA 2K4JA 5LRSA 2PG4A 3O2PE 3ZMTA 1YW9A 2MH9A 2ZMEA 2HEOA 4AD9A 2Y75A 1R23A 1R1UA 5E1ZB 4NHJA 1D5VA 3ROUA 1UFMA 4HX7A 5ICCA 3JAMZ 4KNYA 2ESHA 1XD7A 1XCBA 3RIRA 1T38A 3QOPA 1O3RA 4N0BA 4ZYDA 3V8LA 1GXQA 2W24A 2HYFA 2K27A 3WTSC 1ZLJA 2L3DA 5E8GA 3SQNA 1W5TA 3BP8A 4I98B 1ZN2A 1IN7A 3K1NA 4ESFA 3LQRA 3FX3A 4U7DA 2Z5UA 2DQRA 2A6EF 3WTTC 1RUNA 5FFXA 3ZMVA 2Z99A 4MEXF 1ZRCA 3CUOA 4XRFA 3V4GA 2V1XA 4RB1A 1YTYA 2V9VA 3J81K 1T39A 1ZG3A 1YS7A 2QQ9A 1QO0D 2NRAC 2XUBA 4PGGA 5L3FA 1I6XA 1E2XA 2DT5A 1V3FA 4S05A 2VONA 3HRMA 3KZZA 1K7AA 4CDGA 2GIVA 5FLXK 1S7AA 3BJAA 5D5UB 1R58A 3SHFA 2MC3A 1Z05A 1LNWA 5K1YA 1VTNC 5D5XB 4G7ZF 1TW2A 3F8BA 3F8NA 2FU4A 4LB5A 2IT0A 2CFXA 2KKOA 2PI0A 1IXSB 2IA2A 2D2WA 1AWCA 2G9WA 3WGHA 1Z6TA 1LDJA 3JTGA 4IXAA 3V8KA 3J80Z 3CTAA 5D6EA 1IAWA 4UXNA 3M1EA 5JI6A 3AAFA 4WXDA 5KVRA 1J7KA 2VODA 1HW5A 2GQQA 4ZZLA 2Y48A 2O03A 2XHKA 3K69A 3ZN1A 3CLOA 3LFKA 4RAZA 2OU2A 4E70A 3GFIA 4FX4A 3GO5A 1MZBA 4WCGA 2GZWA 3W6JB 2B0LA 4UUVA 2F5EA 2P7CB 3ZN0A 3WU0A 2Z33A 3M8FA 1IXRC 4KMFA 4WXHA 2DO7A 4R79A 2DAOA 1V4RA 3HYIA 1XSVA 3PQJA 4KIFA 4FT8A 2HTSA 4CYDA 3R0AA 4YFNF 1ZRFA 3MEXA 5DCMB 2VE9A 1ZLKA 4L0YB 3F3XA 2JPCA 2PJPA 2DU9A 3SZTA 3F8FA 3QAHA 4IHTA 1BOAA 2D1VA 1R1VA 1BJAA 3FXUA 2XAJA 4R1HA 3DV8A 3KETA 4L5IA 1R36A 2VC0A 1ZAOA 4BXUA 4CGZA 1F4KA 3QRFF 4LG0A 3WTZA 1IN4A 1MKMA 4HDVA 2O61A 5BPDA 2G7UA 2ESNA 4EMSA 2JTVA 2K86A 5IT3A 3E5QA 4AIJA 4L18B 4MQVA 5HLHA 1YQAA 1YYVA 2QVOA 3M9AA 4UVAA 2RQPA 4H0EA 1LJ9A 3HTSB 2RVCA 2ZKZA 2COMA 1D8JA 1B6AA 5HLIA 2QENA 5DD4A 4KN4X 5BS6A 2XAQA 5HDNA 1FYLA 3L2CA 3JAMK 2F5FA 1B9NA 3BJ6A 1GXPA 1IN5A 1I1SA 3KE2A 3P7NA 4LK1F 2GAUA 1FY7A 3MAJA 2TDXA 2XVCA 1SAXA 5BMZA 4EJUA 2M8EA 4RB3C 5LEKA 5CYVA 3OV8A 4M74A 1FBUA 4CHUA 2WV0A 4WK8F 3HRUA 4KICA 3HRSA 3F6VA 1F9NA 3R61A 4P9FA 3DP7A 3DF8A 1T2KA 5DD8A 1GVJA 2M1BA 4MGRA 1PDNC 1OYWA 1BC7C 3I59B 3GUDA 3WTVC 3IKTA 2FOKA 3ABTA 2YSRA 1HBXG 2GA1A 1K6OA 2NNNA 5ED4A 5BOXA 3FMSA 4N9HA 2KIFA 3LSTA 1Y0UA 3JTHA 4AIKA 4OU0A 2XAGA 1L3LA 3BOQA 4O3MA 2BV6A 4IPAA 1BIAA 3G73A 1YW7A 3I4PA 4I09A 4OINF 2XRNA 2W84A 5FO5A 3DFGA 3P9KA 5H6QA 1KYWA 3QP5A 1UCRA 4L5JA 3LA7A 3NQOA 4RGRA 2FF4A 2WWYA 2DI3A 2ZMEB 1FZPB 4O5VA 2JSCA 5DYMA 2AXLA 4L0ZB 3KP5A 2EV5A 2O3FA 4F7ZA 5F64A 2Q2EA 3HHHA 4EM1A 2QQAA 4HX8A 3GW2A 2R7DA 5E8IA 3BROA 4OIQF 2VXZA 2WTEA 2MLKA 1TQMA 2FSWA 1HQCA 2V6CA 3F21A 1DP7P 3ECHA 3SZPA 1ZRDA 3FXRA 4LFUA 2EK5A 2Z3YA 3DPLC 4HA8A 4A6EA 2DK8A 1SD6A 3GF2A 3EQLF 5FD5A 5JFRA 6PAXA 3I5UA 1QZYA 3TDUC 2QUFA 3PFIA 3BY6A 1LDKB 1J2XA 2EA4A 3SXYA 1U5TB 2VBWA 4WWCA 5E1XA 4ZZDA 1TNTA 1WWXA 2HDCA 2FRHA 1SFEA 3RPQA 3WE3A 2EFPA 1IN6A 2YU3A 1XCVA 2QYOA 2O0YA 5ICEA 1XSDA 3DKWA 1RUOA 2K02A 3RI4A 3VFZA 4Z2YA 1XN7A 3ZMZA 4HLXA 3WODF 2IA0A 4M9XA 3HTUA 2Y0MA 4PGHA 5HOOA 3EETA 4R8HA 1IW7F 1S8NA 1U5TC 4B09A 2FEZA 2M45A 5ICGA 5L3EA 1UB9A 3CJNA 1YW8A 2A61A 1G6NA 1R22A 3KLOA 3KP7A 5L3BA 3BPVA 1DPUA 1YO5C 5DEQA 2DPDA 3HSFA 1KQ8A 4PDKA 2CG4A 5TRDA 4ZH4F 5FLXZ 4NQWA 5DDGA 4EVIA 3I59A 3ZP5A 5K5RA 1RI7A 1STZA 3RTRA 2OBPA 4U88A 5L3GA 5HDGA 5D8LB 1XB4A 3FF5A 2LNBA 5LHGA 4WX9A 1UHMA 4GO1A 4KMUX 4M71A 5LRRA 2W85A 3WTXC 4IF4A 4HF1A 2KRFA 2ZO4A 5D5VB 1RZ4A 2DW4A 2LF7A 1KGSA 3TO6A 4KYWA 2A6HF 2IJLA 2CWEA 4U7BA 4AIHA 3GXOA 4OMZA 2RNJA 3GWZA 1ODDA 4RGXA 4HX4A 2DLLA 4DQ2A 2ZCWA 4BNCA 2CGPA 4GXOA 2W57A 4LLNA 1JHHA 1WQ2A 4PZJA 2W25A 5CLSA 2CYYA 2P6SA 3HHGA 1XGSA 2STTA 3MFKA 1L0OC 1JE8A 4CXFA 3IWZA 1HW1A 4NB5A 2UZKA 4OMYA 1J9IA 3H92A 5HLGA 2HGCA 3MWMA 2QM3A 4UNOA 1G3SA 1EH8A 3LA3A 1WI9A 2OQGA 4B8XA 3T0YA 3NRVA 4EJTA 2PN6A 1W4MA 3MQ0A 2ACJA 1XDSA 3GZ6A 1F5TA 3BZ6A 2D45A 2XV4S 1WSUA 2XGXA 2IVMA 1ZYRF 3V7SA 3HSEA 3D5LA 2EV6A 1FSHA 4ZYEA 1TBXA 2QZ8A 4L9NA 2VT2A 1Z9CA 5CVJA 1ULYA 2XIGA 1SD7A 2ELHA 2ISZA 3VODA 3M7GA 3E97A 3M8EA 3H3UA 1EV7A 4XSXF 3KP6A 2GXGA 3H3ZA 4I02A 4G9YA 1IUYA 2HQRA 3BDDA 1FOKA 2YR2A 2J5OA 2XKPA 5A2QZ 4UHTA 4LB6B 5A2QK 5E17F 2OAZA 4QLCU 3EDPA 2H94A 2P5LC 5DCFA 5LHIA 3S2WA 5ILUA 1ZGJA 2IP2A 1IRFA 2JRTA 3GLXA 5JHUA 4EJVA 1SMYF 4MTEA 2PMUA 2EWNA 1T0FA 3TOBA 1FC3A 1XGOA 3F22A 1P92A 2L4AA 4ENJA 3JSPA 2KIUA 4IRIA 5HVQC 4HYEA 3HSRA 5AONA 1HW2A 1TQIA 3TQNA 3MZYA 4JBAA 4M6XA 1FX7A 2FNAA 2NS0A 2P5KA 4LLGF 1TQPA 5L3CA 4JQFA 4U0YA 4OIOF 2PLYA 2IA1A 3KLNA 5D6FA 4ZYGA 4D0PA 4EJOA 4KDPA 4P96A
chains in the Genus database with same CATH superfamily
2JA2A 1FOWA 5FLMJ 3ABMH 3I4NJ 4LOCA 5K7HA 2RGVA 2V6EA 1HDPA 3FKIJ 3TW6A 1H8AC 2FBIA 3BTIA 4NC7A 1O3SA 3K4MA 3F8CA 4IQ4A 3VWBA 1R4NB 5M5XJ 1ORKA 3T8RA 2HKOA 5FKMA 4UY8I 1PP7U 4X0GA 4YEJA 4L9TA 3OYBA 3DLLF 2Y31A 3CCVI 1AHDP 3ZXSA 2A5YB 2WA0A 3RKXA 1OYIA 2R5ZB 4XL9A 1PJRA 1IXCA 1XC5A 2V26A 5HDKA 5HS9A 2VN2A 1JUSA 4LGWA 3M4OJ 2M4GA 1ETQA 4FX0A 2EFQA 2O8XA 3EUHC 1S7OA 3MZ8A 1PUEE 4IHYA 3GTMJ 2EFOA 2KT0A 5LD2C 4F92B 1IZ1A 3LAJA 4PJJA 2VQGA 4AWXB 4C3HJ 1OMIA 3H36A 2KISA 4M9SA 1VF9A 4LD5A 1ZG1A 2IAIA 2XAHA 4YELA 1MNEA 1IF1A 3TEDA 2KMUA 1E0EA 2ZJRF 2CO5A 1UMQA 2L4MA 4IRHA 2E35A 4HZFA 3E7LA 2MD0A 2WAEA 1U78A 2O6GE 1CF7A 4XLFA 2LDUA 2FMLA 3LNQA 4G94A 4M72A 5EZHA 3N97A 1A31A 3ESWB 2C6YA 1XMXA 4I2OA 1Z6RA 4ZJZA 4ZDOA 3E0JB 3REOA 3R60A 1VQ8I 3RYRA 1W5SA 4B3XA 5C4JJ 2EFWA 1YJNI 3CUQC 1GV5A 3TDZC 4KUMA 4RB2C 4G8XA 3OOPA 4XNFA 4G12A 1YJ9I 2BBYA 4Q48A 1EH6A 3K10A 3E6MA 4CZZA 1SFXA 2M5WA 3HUGA 2YU9J 4KIGA 3H0GJ 2NS8A 3RDIA 1RIOH 5CJ9A 2BY3A 3O3KA 1IN8A 4IJAA 1SVLA 3RSNA 2L7KA 1UELB 4HBLA 4RLFA 1Y0NA 3GTOJ 4BJ5C 3U2RA 2FBKA 3JREA 4MHGA 4E7LA 1XS9A 1I6HJ 1HSTA 2F4MB 2A05A 4PK4A 1JUPA 2WBMA 1MJ9A 3CP8A 1POGA 2I5UA 1LEAA 4Q5SF 1QPMA 1R1TA 5LGUA 4ANJA 1LFPA 2YX7A 5F1RA 2OZUA 4GYGA 3CO7C 3WHBA 1GV2A 1P7JA 2ZNYA 5ILVA 2HOAA 2CS3A 2Z1DA 3C18A 2NVUB 3BG9A 1VQKI 2QCOA 4Y13A 3HIFA 5ERIA 1QRYA 5BQTA 5DUKA 2EZIA 4EGYA 3CCUI 2BE5F 2A3SA 3G1OA 4ETSA 3LSHA 2Y9ZA 1ONVA 2AS5F 4KN7X 1P4AA 2PX9A 2OUMA 3GFLA 1B9MA 3H1CA 2MA3A 4BYYA 1IDYA 4XSZF 3CUQB 2MH2A 3OS0A 3LA2A 1OPCA 1YIOA 4PFPA 3WG9A 4BHPA 3JCUC 3HOXJ 1D8KA 1KONA 2ZNZA 4NUBA 1B8IA 1QVTA 3A02A 4RAYA 3NEUA 3R6SA 1TTYA 5EGOB 2E1MB 2K85A 4A3BJ 3LFUA 1OCCH 3QQAA 2JMWA 2H6BA 1KU2A 3E6DA 3SDBA 4DYCA 4G6QA 5LLQA 1P4WA 1AU7A 3RYPA 1G4DA 2EIMH 5E3MA 3WE2A 2IS2A 2PJRB 2LKSA 1K78B 1T33A 5K5OA 4WF2A 2HQNA 2K3FA 2QSFX 1BL0A 1WI3A 4U0WA 4DOZA 2MLGA 1ZREA 2HPMA 4M6YA 4JX5A 3GZ5A 2K40A 1JTYA 3PUFA 3FWEA 2M0CA 2CSOA 1DP3A 5CVIA 5DS9A 5F1JA 1YIJI 3CF2A 3OYEA 1J09A 5CKTA 2L7MP 2JA5J 5KCMA 5ICFA 2MBFA 4XLNF 4ENNA 1GVDA 2GIZA 2HFHA 1MGTA 1FNNA 1ZGWA 1HSJA 1Z67A 1WJCA 3GVAA 3QYEA 3DTEA 4FTHA 2OV7A 1Q1HA 3R0JA 3PUBA 2OA4A 1LDDA 4FISA 3ZMSA 3AL0B 2XF5A 2RDPA 4EM2A 1WJFA 4XORA 3C3WA 2QA4I 4YIFA 4W97A 4OOIA 2BY1A 2HOEA 1OCZH 4ZYHA 4HAMA 1FSEA 5BPIA 2VT3A 4Y33A 1LE8B 3FM5A 1YX3A 3FBIB 3FZVA 1O7LA 1WH5A 1R4MB 1SFOJ 2L01A 3WTWC 1QZZA 4ZDLA 4YFXF 4ON0A 3K2ZA 5LEJA 3GX4X 4A2UA 1KA8A 5TGTA 3CJRB 1W7PA 2LC2A 1QQIA 2IBDA 1W7PD 2ZXWH 1FMVA 4YIRX 1QGPA 2O8KA 3NWTA 1KU9A 1FYKA 3IC7A 3L1PA 4RLQA 3V42A 1BW5A 1TW3A 3B73A 2LP0A 4KJZA 2YUSA 1PUFB 3K9TA 4A5MA 1QBJA 3RKWA 1BA5A 3ZGKA 5FGMA 4AVZA 3C1DA 2LF8A 4L9JA 5D4RA 3ZPLA 4S04A 3VDXA 3OOUA 2DBBA 4O6JA 1F1ZA 3ZQIA 3QU6A 5IYDJ 2B9SA 4FE7A 1TWAJ 4A3EJ 1WCMJ 2Q0OA 4E7IA 2OCCH 2L02A 1T98A 2F5VA 2F5CA 3E3VA 4A6DA 4CCNA 1W0TA 3BTLA 2ZBKA 2JVHA 4IO9F 3RPUA 5FKLA 2BVMA 3K1PA 3RJPA 5FB2A 2DA3A 2M34A 3H5AA 4G6DA 5K5QA 3HOWJ 2F5DA 3QU3A 4II2A 4BBRJ 3T5XA 3HL2A 1WJBA 2L0KA 2P81A 3S3MA 2V1UA 3GTGJ 1H0MA 1X2MA 2IS4A 3OL3A 3FM3A 2V9PA 3ASOH 4X1EA 2STWA 1QHHD 1TT0A 3OYIA 2K4BA 4A0ZA 2M87A 2HYGD 2FX0A 2UXXA 2VQLA 3DQVC 1FPQA 4LIVA 2DK5A 4RS8A 3F8MA 2LTPA 3JRHA 1SFUA 1J59A 1FYMA 1XDUA 4TV7A 4E7KA 1JKQC 2GWRA 2GBYA 1T8IA 2BHZA 1JT0A 2XPUA 5B1BH 2R5YA 3MVPA 4BQOA 4FQGA 2FXAA 3LWFA 3Q0VA 5C44J 2E7XA 3JRAA 1SMTA 2HS5A 3KEOA 4AIDA 3E5UA 3GEZA 3E5XA 4M3FA 2H6CA 4G7HF 1FT9A 4IVNA 1HXDA 4I0AA 4AM3A 2CW8A 5GAGJ 2LD5A 1SVOA 3ONQA 2QQ8A 4QSHA 3KCCA 4LMYA 1WH7A 5CPRB 5HS8A 4GCVA 2XAFA 2IRFG 1OKRA 3QP6A 1MD0A 2VPRA 4ESJA 4ESBA 3J7AY 2E1NA 2ETHA 3K4JA 1BR4A 3L7WA 1PP8F 5IT9Z 2QEXI 4HV5A 3LOCA 3HOSA 2UWMA 3KFWX 4B47A 3BR6A 2HVRA 2KP6A 3S3NA 4Y52J 3G4SI 2GXAA 4IHXA 1LVAA 2O5RA 3H35A 4MEYF 3DLAA 4BL0B 4BE0A 2RNGA 3QOEA 1E17A 3DU6A 2OD5A 2P4WA 3ZQ7A 3MZHA 3TP0A 4J01A 2A07F 4IHSA 2KJCA 1U6GA 4NBQA 1OJLA 2VL8A 2KL4A 4EJWA 3JSOA 4HDUA 3T1BA 3J7AO 3ERED 4JP0A 2V4JC 3SJMA 5KK1A 5CVUA 1XG1A 2HXOA 3C7JA 1U0JA 3CCSI 2L54A 4C9YA 1EKEA 1W1WE 2R7WA 1XGNA 1WKMA 2ADUA 1QU3A 1SD5A 5F6FA 4I01A 1JT6A 5TJJA 4D1QA 3N4MA 4WXCA 2F4OB 3S8PA 2DXIA 3QPHA 2D5VA 3SEQA 5E3OA 3OL4A 5J40A 2HWVA 2DMQA 3CUQA 3RQ4A 2UUZA 4G6TB 2CQQA 1S6LA 3I71A 1K61A 2IPQX 4EM0B 1TNSA 2MYSA 3CMMA 3IAM2 2R7SA 3LSJA 3JW4A 1O4XA 1FTZA 3KIOA 3KP3A 2YPRA 2K9LA 1U8RA 2IW5A 3ECOA 4U87A 4UV9A 2UXNA 4DYQA 4Y17A 1RR8C 1UG2A 1USSA 4HOBA 4II3A 2H27A 3PJRA 1S7EA 3IAS2 4KFCA 4BEHB 5DM7F 3HOTA 4BJTA 3B6AA 1M1EB 3IHUA 2E1CA 3HRTA 3L2RA 2LSOA 4HQEA 1YOVB 2JZYA 3A2KA 4KT5C 2IXSA 4HF2A 2EFNA 2IGMA 5J6XA 4EQQA 4XICA 4XLCA 5CVVA 3IKVA 1JJ6C 2MD5A 3PSIA 2IEKA 1W5CC 5LGNA 2PEXA 1DPRA 2EJRA 2JT1A 1VQMI 1BM9A 4L9VA 1LFBA 4AYBA 4MO7A 4BE2A 2XPVA 3ZMUA 2EIKH 1I5ZA 5FD6A 4HNTA 1K4SA 4XMYA 4I7HA 3AG2H 2OQRA 4UB8C 3H9GA 2N8GA 3C2HA 3PIPF 2NOJB 4A69C 4XQFA 4F91B 1Z1DA 1MMGA 3NWSA 1ERDA 1CGPA 3CDHA 5F0CA 3Q5FA 3PNTA 2OJED 2ICWG 5HS7A 2JQ7A 2VC1A 1VQOI 3OIQA 3Q9SA 4KA4A 2ZFWA 4MFDA 5E3NA 2BY0A 3V7CA 1ZGAA 3PM1A 1WFXA 1KU7A 2NXNB 2QQBA 2M30A 3ABUA 3BG7A 3BLYA 1LUJB 2HR3A 4GYIA 3A01A 5E20A 4A5NA 3GFJA 3VYUB 3PSFA 3NARA 5H6RA 2X0LA 4LK0F 4HSRA 4Q4ZF 1B4AA 5LBQA 3DXJF 2LRDA 2ZXJA 1I3QJ 2XB0X 4A12A 5JR3A 1USTA 4BY7J 2H1KA 1D3YA 1BBYA 5J8FA 2R7UA 2R7QA 1MDMA 3TBIA 2Q8KA 1G3YA 1JGGA 2VIXA 2F6CA 2V7FA 1FBSA 1KQ0A 1Y8QB 3A4CA 1JKPC 1BI2A 4DJAA 4M73A 4BXXJ 2MW8A 4F93B 1JGSA 3LL7A 4FE4A 3U9GA 1HOMA 1LB2A 3CMYA 2PFBA 1ZHFA 2RN7A 2JA8J 4PCQA 1R6RA 3VB2A 3VEPA 5DM6F 1OR7A 2XF7A 2WB1A 3WGGA 2AHQA 3WTYC 4MTDA 2ZC2A 2FE3A 2HQ5A 2FQ3A 3WGIA 4BQAA 4G7OF 1NTCA 1S29A 1MJBA 2NYXA 3K4LA 4GGGA 2ECCA 5J1UA 2Z9OA 4UVBA 3PO2J 1QZEA 1D0ZA 1R7JA 3ZRGA 2MFZA 2W1OA 3L2VA 3ZMDA 1LEBA 2VOPA 4BQQA 4Z6YA 1MBKA 2HTJA 2KIMA 3ZR8X 1FP1D 5J1YA 4I6ZA 3QWLA 2WC2A 1AOYA 3L9FA 1KU3A 4XONA 3FK7A 1R5ID 2WY8Q 3IUOA 1DUXC 1X1DA 4IHWA 3HUGB 1G59A 3K1MA 2XROA 2DT7B 1XMAA 1O7FA 2HYJA 4MNUA 2HU9A 4RM2A 3M3YJ 3ULQB 2RKHA 2X51A 3I64A 3G3ZA 2L9RA 2ZB9A 3U1KA 1EF4A 2LMDA 1B1BA 2YX4A 3OYCA 1I27A 2X6YA 2DFFA 2MC4A 2BEOA 4OIPF 1YITI 4PJLA 3GTJJ 2PBIA 4E7SA 3LSKA 4CH7A 3JRFA 3IRRA 1LQ1A 1Z7UA 5E1WA 3J80K 2VQHA 1P2FA 1UJ8A 4N4NB 3DTIA 2JUCA 4AUXA 2NAZA 2Z16A 3LSMA 1DU6A 3HM5A 4OIRF 1EH7A 5GP9A 3N05A 3DBHB 1TWHJ 3OR2C 3S16J 3FIWA 3DWLE 1T6SA 3F72A 4D9JA 2CV2A 3H9JA 3TGNA 2JA6J 1FLIA 1O3TA 2VQCA 2GXBA 1IRGA 1OYYA 4BDZA 1S9HA 4V2FA 2F4IA 1UHSA 4LG0B 1D1CA 3LQQA 4Y15A 1XX5A 1P7IA 3IRQA 4XR6A 2XSJC 1QVUA 3CCQI 1J5YA 2L9NA 1XSXA 2VOOA 4CSWA 2JVGA 1D0YA 1ETXA 4CA0A 2XPWA 1RPWA 4C2TA 1KZHA 1VQ4I 1MJAA 2KDZA 5EGOA 1CF7B 2XGCA 3D5SC 1B59A 1O3QA 4P55A 3OS2A 3VYRB 3ML6A 4A3IJ 2VKVA 3EYYA 2NVXJ 1J75A 3K70C 2XKOA 1G8XA 1R00A 1X3UA 1OCTC 2OTLI 1N78A 2R7XA 4S0HB 3V7RA 2ZXIA 1V5FA 2DA4A 4BAYA 2ISYA 3X2QH 1FWZA 4HQMA 4XN3A 3FXKA 4GFBA 3AG1H 4N9IA 3RKYA 1IV8A 2DTRA 2QBYA 2PQ8A 2QLZA 1H9TA 1FIAA 1JHFA 3BG3A 5AIPA 2R92J 4IRGA 4P1WA 4RB0A 2ELJA 3J81Z 5J8CA 1BN5A 1MMNA 4HW0A 4C2UA 5EEAA 3BR0A 3M07A 2J5PA 3K4CA 4FCYA 3I0TA 1X4OA 2MGQA 1KQ9A 5AIQA 5JHFA 2NVQJ 3K70D 3OYGA 2IGKA 3F23A 3VOEA 4XRSG 1ETKA 2FBHA 1ZK8A 3R4KA 4ASNA 3F6OA 1S72I 2OZ6A 5FFZA 3DKXA 5H20A 5LGTA 2D1HA 1OCOH 2LKPA 3V8JA 1R5GA 2XB5A 4XLHA 2HXIA 1K79A 3KEQA 2Z2SB 3KYDB 4MQ9F 1LVKA 1YFHA 2PMZN 4QWQA 1A6IA 3CCEI 2RV8A 4JK1X 4PSXA 2CUFA 2DJIA 1XGMA 1BI1A 3GLLA 1H88C 3OSGA 1ETOA 2K7LA 5IYCJ 4LJZF 3VSKA 4CO8A 3WTUC 1KYZA 5D5WB 3W2VA 1C0WA 2Y30A 3UR3C 5EF6A 2V79A 3M8JA 2R3SA 1HKSA 4D5CA 2CQXA 2DQLA 4EATA 2X1EA 3I53A 1ON2A 2JPBA 3BC8A 2P8TA 2G7HA 2NNYA 2R7FA 3QYBA 5HNHA 3PIOF 3L09A 4E7JA 1ETYA 2DA5A 2QWWA 1P6RA 1R49A 2CUEA 2P5VA 5D4SA 1Z91A 1K78A 3CDLA 3OY9A 3EPZA 2CRGA 1WGXA 3K7AJ 1REPC 3GYHX 2KPMA 3ASNH 1FBQA 2JJ7A 4BHCA 2R7VA 2KRCA 2PMHA 1F36A 1J0RA 4HPQA 5B5EC 3EUKL 3P9CA 1WRJA 2P7VB 2VBXA 3UNGC 3K0LA 2H8RA 3DPTA 3DEUA 5J1RA 4C2MJ 3CO6C 2NVTJ 1ACIA 3FHZA 3BQZA 4EGZA 4UVCA 3LAPA 1HCRA 3BWGA 4BH9A 5L3DA 2NVYJ 2CMPA 2VASA 3PQKA 2OC6A 1H9GA 3BJOA 3HPGA 2HPIA 3HJEA 4U0VA 4P9UA 4KISA 2HOSA 2VBZA 3AKZA 4CCKA 2E2HJ 3F9KA 3I54A 3F0CA 4KIBA 3PO3J 2ME0A 2BW3B 2LLKA 2LR8A 1BIBA 1QHGA 4LIUA 2RC4A 5FKKA 3O8HA 3ZQQA 1VQNI 3KZYA 1RNLA 3A1YA 1JJ8C 3BPXA 2P6TA 1YLFA 1A04A 4UV8A 3T8TA 1ZELA 5K7FA 1ON1A 3TL4X 1W7PB 3TO9A 3FMRA 3E6BA 4XRMA 1R9TJ 3Q0WA 3JRCA 2VLAA 1Z3XA 5E18F 2QF7A 3BZKA 5EEHA 1QA6A 3DU5A 2BXZA 4CICA 5C3EJ 2K9NA 2BOLA 1IG7A 1R5HA 4DNCA 3OYDA 4DBRA 2WAQA 1SD4A 1Z3YA 5DUIA 2M2EA 1MW7A 4I0BA 1U8BA 4DW6A 2EB7A 2V1DA 2M7AA 4HLYA 1D5YA 1TWCJ 1TLHB 1HKTA 2IGOA 5IT9K 1JXSA 2E36A 3IWFA 5KAFC 4M3DA 4RGUA 3IL2A 1ZTRA 3GMEA 2XDVA 4FHTA 3BR1A 2E7WA 1BI0A 2X1CA 1BC8C 1G2HA 2A68F 1SVMA 1OISA 3IH4A 4P5OA 5ILSA 5LHHA 3ZQCA 2A69F 2M4KA 4A3GJ 4CYCA 2OCEA 5F08A 4JX4A 1LPQA 2HKXA 1H89C 1B72B 1DDNA 3BTCA 4M9ZA 3QPTA 1IJWC 1EJ9A 3S17J 2H09A 4K2EA 2ID3A 4YFKF 4A3KJ 2KJBA 3L00A 3BR2A 4EV0A 2F2EA 3LSRA 2DFIA 2BVLA 2DN0A 4IZZA 3HZJA 2VE8A 3FXQA 1MMSA 1G3WA 3COAC 1UHWA 3U1DA 1YRNA 3DBRB 2DMTA 5KNLA 2VPLA 2X4HA 2DYRH 3SFZA 3VYSB 2M9HA 4A0XA 1ZQ3P 1JTXA 4RGSA 2FNPA 3QODA 5FROA 3BT9A 1LKXA 2RREA 3TKYA 3PFYA 4HV6A 3G6EI 4XK4A 2ZJPF 3FMQA 1YS6A 3TO7A 4LLLA 1U3EM 2CW0F 3QPLA 1ZARA 3K4KA 1FJLA 2QBYB 3GFMA 3I58A 2EV0A 1I1GA 4BKXA 2MSYA 2FOWA 5E79C 1MBHA 5GTHC 3Q9VA 3B02A 2CFOA 3MKYB 1DU0A 1U5TA 4D7MA 4YG2F 1ZG5A 3ELKA 1TP4A 3S32A 3MKWB 4D7NA 3P9IA 3H3VK 2FJ1A 5D8KB 4A0YA 2L5QA 1E3HA 3EYIA 3W6VA 1MNDA 1BI3A 3EUHA 4OAZA 5DV5A 3ZQGA 3CQZJ 3SEZA 1U2WA 1F43A 3MD2A 2GA2A 1XMKA 4ITVA 1YG2A 3KPHA 2FA5A 2VI6A 3D0SA 3KP4A 2CQKA 4YIIA 2R7RA 4XLPF 4HF0A 4ENMA 2VBYA 4XKWA 1FOYA 2EA2A 3E6CC 1S5LC 4YRVA 1O57A 1HKQA 1FP2A 2FMYA 4ENKA 4XLAA 2V9KA 3A01B 4OWRB 3CD6I 3TOAA 1RESA 2TRTA 1QNTA 2BGCA 1NHAA 1V5EA 1S3JA 2VXDA 1NK3P 2DYSH 5B3SH 2DPUA 2BYVE 1GHCA 2X6WA 1G3TA 5EEGA 3ISPA 3WG7H 3MCZA 2XASA 3W6KB 4AVPA 5DCMA 2GOXB 1ZH5A 3MMYB 1XTAA 5CVRA 2ZJ2A 2HZTA 5JVTA 3O6BB 1MDMB 3KP2A 4UB6C 3AFHA 4XBFA 3S93A 4BHBA 2KZVA 1R71A 4Q47A 1TT5B 3WU1B 1P4XA 2K4JA 3IV5A 1X1CA 5LRSA 2XSDC 4AU7A 2PG4A 1RKWA 3O2PE 2ZSHB 4V19K 3Q0UA 4XKVA 3ZMTA 1YW9A 2MH9A 2ZMEA 4Y4RA 1HDDC 1A36A 2QSGX 3SYTA 4ZTJA 3JRDA 2HEOA 1V5GA 1RKTA 4AD9A 2Y75A 1R23A 4LG3A 1R1UA 1BW6A 5E1ZB 2HOTA 1VQPI 4NHJA 1D5VA 3CJTB 3HPHA 3ROUA 2LBFB 2ZJQF 1UFMA 4A93J 5GPAA 2VB6A 3ZOBA 4HX7A 3FDYA 5ICCA 3L2UA 3JAMZ 3GTQJ 4KNYA 5FJ8J 2ESHA 1XD7A 2MABA 1XCBA 3RIRA 4DYRA 4RM3A 1T38A 4XM3A 1Z21A 2DJNA 3QOPA 1X1AA 5IYBJ 5IPAA 4N0BA 4ZYDA 1O3RA 2LREA 2HDWA 3S15J 4A3LJ 3V8LA 1GXQA 2W24A 2HYFA 2K27A 2VJJA 3WTSC 4IQJA 1ZLJA 2CW7A 2L3DA 5E8GA 3SQNA 2ECBA 1W5TA 3BP8A 4I98B 3L2QA 1ZN2A 3OS1A 1IN7A 3K1NA 4ESFA 3LQRA 2LH9A 3FX3A 4U7DA 2Z5UA 2DQRA 2A6EF 4C3IJ 3WTTC 1RUNA 5FFXA 2M3AA 1ZKGA 3ZMVA 2Z99A 4MEXF 1ZRCA 3CUOA 3SFIA 4XRFA 2CH0A 1T08B 2V1XA 3V4GA 4RB1A 1YTYA 2VUMJ 3J7ZI 2V9VA 2ELKA 3CCRI 2RAEA 3J81K 4BE1A 2GOMA 1T39A 3BCBA 1ZG3A 1HA8A 1ZR4A 4L5EA 1YS7A 1TZLA 2QQ9A 3FBNB 4A3CJ 3HOZJ 2LOOA 3CC7I 1X1PA 3OYNA 3RQIA 5HODA 1QO0D 1V54H 3FISA 1ETWA 4NC8A 2E1MC 2NRAC 3LSIA 2XUBA 4PGGA 5L3FA 3H0DA 4XLEA 1I6XA 1E2XA 2JWTA 4QIWN 2DT5A 1V3FA 4S05A 2VONA 4V2GA 3A03A 3HRMA 3JR9A 2BZTA 3KZZA 1K7AA 2OF7A 4CDGA 4CYCB 2GIVA 2E1OA 5FLXK 1S7AA 4E7HA 3BJAA 1ETVA 5D5UB 4BGDA 1R58A 2AO9A 2MC3A 1D1AA 2DFEA 5F27A 3SHFA 4DZJA 2JK3A 1Z05A 4MFEA 1LNWA 2EINH 5K1YA 3S1NJ 2IS6A 3CZ6A 2CUZA 5D5XB 1VTNC 1JKOC 4G7ZF 3DEEA 4NNJA 2E2IJ 2EBIA 1TW2A 3F8BA 1N75A 3CCMI 3F8NA 2FU4A 4LB5A 2IT0A 4B4CA 2CFXA 2L7FP 2HVQA 5TISC 1IC8A 2AQFA 2FQ4A 2KKOA 3TP3A 5IOYA 1VZ0A 2PI0A 2XGDA 1IXSB 1BOBA 2D2WA 2IA2A 4M6VA 3RCOA 1AWCA 2G9WA 3WGHA 3BCAA 1Z6TA 1LDJA 3JTGA 2BXYA 2A5WA 4IXAA 3V8KA 1MH3A 3J80Z 3CTAA 5D6EA 1IAWA 4UXNA 4M3EA 3M1EA 4XRSA 5JI6A 3AAFA 4WXDA 2CQNA 5KVRA 4NQWB 5EG0A 1J7KA 1MIJA 4IL6C 1YI2I 2VODA 1HW5A 2VKDA 3H5RA 2GQQA 4ZZLA 3FXOA 4PUSA 2Y48A 2O03A 3D1NI 2XHKA 3K69A 3ZN1A 3CLOA 1MMAA 2L7ZA 3LFKA 3FHNA 5E3LA 2DA1A 4RAZA 4BDYA 2OU2A 4E70A 3GFIA 4FX4A 1I39A 3GO5A 2IGNA 1MZBA 4WCGA 2GZWA 3W6JB 2O7OA 4XOPA 2B0LA 4UUVA 2F5EA 3A0HC 2W82A 2P7CB 3ZN0A 3WU0A 3CC2I 2Z33A 1K83J 2ZXHA 3PL8A 1PYVA 3M8FA 1HC8A 2XRLA 1IXRC 4KMFA 4FASD 3OYJA 4WXHA 2WB1N 2DO7A 4R79A 2DAOA 1V4RA 3HYIA 1XSVA 4A3FJ 3W2WA 1D1BA 3K2AA 3PQJA 5B1AH 2OTJI 4KIFA 3G71I 4FT8A 2HTSA 4CYDA 3R0AA 4YFNF 2GM4A 3CMEI 1ZRFA 4DBQA 4NDLA 5GTIC 3K6GA 3MEXA 5DCMB 2DOAA 3PNYA 2VE9A 3RKQA 1YJWI 1ZLKA 4L0YB 3F3XA 4XOTA 2F48A 3OR1C 2JPCA 2X1DA 2PJPA 2DU9A 2K3PA 1IRXA 3SZTA 3F8FA 3QAHA 1A35A 4IHTA 2V1NA 2DDAA 2Q1ZB 1W36D 4IEJA 3HB9A 5J47A 1BOAA 2D1VA 1R1VA 3DCFA 1WJEA 2AQEA 4A3JJ 1BJAA 3JRGA 2DA6A 3I4MJ 3FXUA 2XAJA 4R1HA 1ENHA 1K6YA 3DV8A 4IOCF 3KETA 1AKHB 1WJAA 2Q2EB 2JN6A 1R36A 4L5IA 4AC0A 1NH3A 4HNVA 2LBFA 3AL0C 2VC0A 1ZAOA 4ZDPA 4BXUA 4CGZA 3BZCA 3G1MA 3P5JA 4LG0A 3WTZA 4C3JJ 3QRFF 1F4KA 1IN4A 2ZFUA 1OQYA 2R93J 1MKMA 4UUTA 2HZDA 4HDVA 1XPXA 5HNFA 5BPDA 2FUG2 2G7UA 5FRMA 2O61A 2ESNA 4HEA2 2EIJH 3AG3H 3KEYA 2JA7J 3BQYA 4EMSA 2JTVA 2K86A 5IT3A 3E5QA 3OYKA 4AIJA 4L18B 2L2OA 4MQVA 2EZKA 3KZIC 5HLHA 2BW3A 3H9QA 1PVEA 1YQAA 1YYVA 2W48A 2QVOA 2FD5A 3M9AA 1X58A 4UVAA 4NC6A 2RQPA 4H0EA 1LJ9A 1MSEC 2EPFA 3HTSB 2RVCA 2ZKZA 2COMA 1D8JA 2Y0SN 2KDOA 1B6AA 5HLIA 2QENA 5M3MJ 5DD4A 3QYFA 3O8GA 4KN4X 2NS7A 5BS6A 1MNMC 1EA3A 2DOFA 2XAQA 1MMDA 2VKEA 5HDNA 1FYLA 4MIMA 3L2CA 2CU7A 3LSGA 3JAMK 3RZDJ 2F5FA 1B9NA 3BJ6A 1GXPA 1IN5A 4B43A 1Y8RB 1I1SA 3KE2A 3ZQFA 2E60A 3I3LA 2QKMB 3P7NA 4RA2A 4LK1F 2E2JJ 2GAUA 1FY7A 3MAJA 5K7ZA 1YE9A 2TDXA 2XVCA 1BR1A 1SAXA 5BMZA 4EJUA 2M8EA 4RB3C 5LEKA 5CYVA 3OV8A 4M74A 2K5CA 4PSWA 4X6AJ 1FBUA 4A3MJ 3GTLJ 4B1RA 4D5FA 4E7ZA 3HDDA 2A6TA 2Y69H 4CHUA 2WV0A 2E19A 1Y1VJ 3JRBA 4WK8F 3HRUA 2QGUA 3IH2A 2ID6A 2OPTA 1OFCX 3DBLB 4GDFA 4KICA 3HRSA 3F6VA 1F9NA 3R61A 4P9FA 2RQQA 3DP7A 4E4HA 2H1LA 3DF8A 5EZGA 1T2KA 1VQLI 1AA7A 2DMPA 2DFHA 5DD8A 4UUSB 1DGRM 1GVJA 2M1BA 2DODA 4MGRA 1PDNC 1W0UA 1OYWA 3HBLA 1BC7C 4IOAF 2LY2A 1MSFC 4BU2A 4PJNA 3I59B 3CMAI 4HG2A 3GUDA 3OMYA 3WTVC 3IKTA 2FOKA 4W1UA 1I3AA 3ABTA 1APLC 2YSRA 1HBXG 4KITB 2O9LA 4IKFA 2GA1A 2X6XA 1JKRC 2EH3A 3B6CA 1E3OC 1IV6A 1X1BA 2E71A 4HSTA 1K6OA 1VQ7I 2COBA 2NNNA 3W3CA 5JLWA 3GTPJ 5J3LA 3VYTB 5ED4A 5BOXA 2R7TA 3FMSA 4N9HA 3JRIA 2KIFA 3LSTA 5F0FA 1Y0UA 5FKOA 3JTHA 3SDGA 1UG0A 4QTRA 4AIKA 4OU0A 3HKZA 4DGWB 2KRHA 2XAGA 3CCLI 3DPUA 1VNDA 3CCJI 1ZR2A 1OLTA 1L3LA 2XC7A 4ZTFA 3BOQA 3KX2A 3HG9A 4O3MA 2BV6A 2ZSIB 4IPAA 1BIAA 4M3GA 3OSFA 4MLOA 3G73A 1YW7A 4H4KC 2X48A 3ZCOA 3I4PA 3S1QJ 4I09A 1DGWY 2Y2ZA 4OINF 2XRNA 2PMZA 3HGYA 2W84A 3W2AA 5FO5A 3DFGA 3P9KA 1JUMA 1RR7A 5H6QA 3OIOA 1U9NA 1KYWA 3QP5A 2XF6A 3PNVA 1UCRA 3G2BA 4F52A 4L5JA 1I50J 3GCMA 3LA7A 4J19A 2H8WA 2XAUA 3NQOA 4RGRA 2EQRA 2FF4A 3KYLA 1X19A 2WWYA 2R7ZJ 1TL8A 1MH4A 2DI3A 4OAYA 2ZMEB 4KT6A 4XN0A 3C2BA 5J4VA 2KZGA 4FETA 3L2WA 2KIQA 1FZPB 4O5VA 2GLOA 3DEWA 2JSCA 3FXJA 5DYMA 1MBFA 2AXLA 4L0ZB 5KAIC 3GBGA 1NG7A 5M5WJ 3KP5A 1WPKA 4BBSJ 2M8GX 2EV5A 1T56A 2O3FA 4F7ZA 5F64A 2DMNA 1AKHA 3VPRA 2Q2EA 3G1LA 3HHHA 4EM1A 5FRNA 2QQAA 1B72A 4HX8A 2R4GA 2E5NA 1DQUA 9ANTA 1CQTA 1IO2A 3GW2A 3LMMA 2R7DA 5E8IA 2X6OA 3BROA 4OIQF 4JX6A 2VXZA 5FLVA 2WTEA 1WVRA 2MLKA 2VJ5A 1TQMA 2FSWA 1HQCA 1OCRH 2V6CA 4ZYAA 5J4YA 1VQ5I 2LKXA 3F21A 4A3DJ 1DP7P 5F04A 1GT0C 2KFDA 2WAQN 3SZGA 4XKBA 1YRNB 2R7OA 3ECHA 3C2GA 2ZMEC 3SZPA 1LE8A 3FXMA 1ZRDA 2BHYA 3FXRA 4LFUA 2BY2A 2EK5A 1FIPA 2Z3YA 3DPLC 4HA8A 4A6EA 2DK8A 2CV0A 3E1SA 1SD6A 3GF2A 3CF5F 1IRZA 1A6QA 2HVSA 3BR5A 1Y39A 3EQLF 4JYKA 4ZC3A 2B63J 2KHMA 5FD5A 5EDNA 5JFRA 3M1CA 6PAXA 1UAAA 3I5UA 3RPUD 2HQAA 3EUAA 1QZYA 2KQRA 2QUFA 3DKYA 3PFIA 3TDUC 3BY6A 3WHCA 1UZCA 4RAFA 3S14J 1LDKB 1J2XA 3S2DJ 2HNHA 2EA4A 2I8DA 3SXYA 3CLQA 2LG4A 2LYCA 1U5TB 2VBWA 4WWCA 2K9SA 3S1MJ 1MBGA 5F0HA 3BTJA 5E1XA 4ZZDA 1TNTA 2EZLA 3TW7A 1WWXA 2HDCA 1SFEA 2FRHA 3RPQA 4PFOA 3WE3A 2EFPA 1RC9A 1IN6A 2YU3A 2P0WA 1XCVA 2AXTC 2KLOA 2O0YA 2QYOA 5ICEA 2X9DA 1XSDA 3DKWA 1RUOA 2HDDA 2K02A 2VJIA 3RI4A 3VFZA 4Z2YA 1XN7A 3ZMZA 4LITA 1SFKA 2LY9A 2XGEA 3KYCB 4HLXA 2E34A 1T0FC 3WODF 1K4TA 2IA0A 2WADA 4M9XA 1LFUP 3HTUA 2Y0MA 4PGHA 5HOOA 2HI3A 3EETA 4CZCA 4R8HA 1SANA 1IW7F 1S8NA 1U5TC 2WAFA 4B09A 3OYLA 2FEZA 3HC7A 2M45A 5ICGA 2VJ4A 3GZNB 4IHVA 5JVGF 5L3EA 1UB9A 3OIPA 1FTTA 2EILH 3CJNA 2LK2A 1YW8A 5DTDA 2NOGA 1YHQI 4XKCA 2R5YB 2A61A 1G6NA 1R22A 4BY1J 1Q1VA 3KLOA 2WY7Q 3KP7A 5L3BA 3BPVA 1DPUA 2UV1A 1YO5C 5DEQA 2ME6A 2DPDA 1X4PA 2I10A 4UUSA 4E6KG 3HSFA 2M7BA 1KQ8A 4PDKA 1X3WB 2CG4A 5TRDA 4ZH4F 5FLXZ 4BACA 2L9VA 2QSHX 4Y7NJ 4NQWA 5EG0B 5DDGA 3HKZN 4EVIA 3I59A 3ZP5A 5K5RA 1RI7A 1STZA 3RTRA 2OBPA 2WV1A 4U88A 2DDBA 5HDGA 1N25A 5D8LB 5L3GA 1XB4A 3FF5A 2LNBA 2VKHA 4B44A 5LHGA 1IGNA 4WX9A 4RBOA 1UHMA 4GO1A 1WHUA 2CQ7A 4PJ0C 4KMUX 1HF0A 4M71A 5LRRA 3HEFA 2W85A 3WTXC 1FEXA 4IF4A 2KRFA 2ZO4A 5D5VB 4HF1A 1U9OA 4JOMA 1RZ4A 2DW4A 2LF7A 5GPCA 3LSPA 1KGSA 4HNUA 1MBJA 3TO6A 4KYWA 2A6HF 1BJZA 2IJLA 2CWEA 3U21A 2W4SA 4U7BA 4AIHA 1FMWA 3ZQLA 3WU2C 3GXOA 4OMZA 4F55A 1BR2A 2RNJA 3UKGA 3GWZA 3MN2A 2CUJA 1ODDA 1OR7C 4RGXA 5GADJ 4HX4A 1QPIA 1PUFA 2LY1A 2QKLB 2DLLA 4IX7A 3FXLA 5H2FC 2L9SA 4QPQA 1ITYA 5B66C 1HLVA 4DQ2A 3A0BC 2ZCWA 2CJJA 2JUGA 4BNCA 2CGPA 4GXOA 2W57A 1MBEA 2E5ZA 3QPSA 4LLNA 5FKNA 5M3FJ 2R5ZA 4PJMA 2M0MA 1JHHA 1WQ2A 4PZJA 2W25A 3HXLA 5CLSA 4I99C 1RRJA 3D5RC 2DT6A 2MG4A 2CYYA 2P6SA 3HHGA 1XGSA 3FKJA 5IY5H 2DMUA 1IDZA 3S3OA 2STTA 4Y3OA 3MFKA 1WJ5A 1L0OC 1JE8A 4CXFA 3IWZA 5GAHJ 3RZOJ 1HW1A 4NB5A 2UZKA 3NAUA 4OMYA 1Z77A 1J9IA 3CCYA 3H92A 1SC7A 3BG5A 5HLGA 1Y6IA 2HGCA 3MWMA 2QM3A 4XIDA 4UNOA 4J00A 1G3SA 1EH8A 3LA3A 1WI9A 2OQGA 1TWFJ 1YX5A 4B8XA 5C4XJ 2EZHA 3T0YA 1JI8A 3NRVA 4QPOA 3HOYJ 4EJTA 2PN6A 4CCOA 1W4MA 2DTZA 2LVSA 5GAEJ 3MQ0A 2R0QC 3OYAA 3I55I 1GDTA 2W00A 2ACJA 1XDSA 3S1RJ 3GZ6A 3CESA 2B7EA 1F5TA 3BZ6A 1SEUA 5EJCA 1FOXA 2D45A 2XV4S 1WSUA 2XGXA 3BR3A 2IVMA 2Y9YA 1ZYRF 1T95A 3V7SA 5M5YJ 3HSEA 3GTKJ 3D5LA 2EV6A 1FSHA 4ZYEA 1TBXA 2K9MA 1Y1WJ 2QZ8A 4L9NA 2VT2A 4CCMA 1Z9CA 5CVJA 3Q3SA 2DA7A 1ULYA 2XIGA 1SD7A 1V55H 2ELHA 1VQ9I 1Z0XA 2JRMA 2ISZA 1WJDA 3VODA 2Y0SA 5CQEA 3M7GA 3E97A 2X85A 1TWGJ 3CDIA 2K9QA 2TCTA 5HLTA 3M8EA 3H3UA 3K4NA 3OYMA 3AG4H 1Y56A 1EV7A 4XSXF 4CCJA 2DA2A 1Z7LA 1N77A 4BXFA 3HOVJ 3KP6A 1W36C 3BG6A 2GXGA 2LFBA 3H3ZA 3VSLA 4CUGA 4I02A 4G9YA 4BQNA 3CP2A 4RMNA 1X2NA 3HOUJ 1IUYA 3OYHA 1IUFA 3H5NA 3K4BA 2HQRA 3BDDA 4M3BA 2IS1A 2YR2A 2W7NA 1FOKA 1VFCA 2J5OA 3IH3A 2XKPA 5KHDA 5A2QZ 4UHTA 4LB6B 4CCLA 1E3PA 1GLNA 5A2QK 5E17F 2OAZA 1RETA 4QLCU 3EDPA 2H94A 1OCPA 2P5LC 5DCFA 1B8IB 5LHIA 2DCEA 4ABZA 3ABLH 3S2WA 5ILUA 1P9QC 1ZGJA 2IP2A 1IRFA 4DZPA 5LFAA 2JRTA 4RAGA 3GLXA 5JHUA 4EJVA 3OYFA 1SMYF 4MTEA 4HRIA 5JLXA 2PMUA 2EWNA 4GRIA 4B48A 4DIQA 1T0FA 3I9V2 2PJRA 3MKZA 3TOBA 1FC3A 1XGOA 2YS9A 3IP4B 3F22A 1VQ6I 3ZQHA 4BEHA 5EYRA 1P92A 3S2HJ 2L4AA 5BNGA 1VI0A 4ENJA 4BUPA 2CV1A 1NG6A 3OWTA 5IP6A 1GUUA 4N4OB 3JSPA 2KIUA 4IRIA 5HVQC 4HYEA 3HSRA 3J7YJ 4BS9A 5AONA 4B3AA 1HW2A 1TQIA 3TQNA 3MZYA 3MKLA 3ERMA 1WZ2A 3I56I 4RDUA 1D0XA 4JBAA 5IP9J 4M6XA 1FX7A 2G0EA 2FNAA 2NS0A 2P5KA 1TC3C 4LLGF 1SAUA 3FK6A 2JSPA 1TQPA 4C30A 4AYBN 5L3CA 1NK2P 4JQFA 4U0YA 4OIOF 2PLYA 4EEFG 2IA1A 3HGGA 4BJ6C 3KLNA 5IP7J 3CC4I 3ABKH 5CQGA 1X3ZB 3CJQB 4F3QA 3TMOA 5D6FA 4ZYGA 4I76A 4D0PA 4EJOA 2DOEA 4KDPA 4P96A 5IOZA 3DTKA 1A5JA
chains in the Genus database with same CATH topology
2RGVA 2FBIA 1O3SA 3F8CA 3T8RA 2HKOA 1PP7U 4L9TA 2A5YB 3RKXA 1OYIA 1IXCA 5HDKA 5HS9A 2VN2A 4LGWA 4FX0A 2EFQA 2O8XA 1S7OA 1PUEE 2EFOA 1IZ1A 3LAJA 4AWXB 1OMIA 4M9SA 4LD5A 1ZG1A 2XAHA 1IF1A 2CO5A 2L4MA 4IRHA 4HZFA 1U78A 2O6GE 1CF7A 2LDUA 2FMLA 4G94A 4M72A 3N97A 2C6YA 4I2OA 1Z6RA 3REOA 3R60A 3RYRA 1W5SA 2EFWA 3CUQC 4RB2C 4KUMA 3TDZC 4G8XA 3OOPA 2BBYA 4Q48A 1EH6A 4CZZA 3E6MA 1SFXA 2M5WA 3HUGA 4KIGA 1RIOH 3RDIA 5CJ9A 3O3KA 1IN8A 4IJAA 4HBLA 3U2RA 2FBKA 4MHGA 1HSTA 1MJ9A 1LEAA 4Q5SF 1QPMA 1R1TA 5LGUA 2YX7A 5F1RA 2OZUA 4GYGA 3CO7C 2ZNYA 5ILVA 3C18A 4Y13A 3HIFA 5ERIA 5BQTA 5DUKA 4EGYA 2BE5F 2A3SA 4ETSA 1ONVA 2AS5F 4KN7X 1P4AA 3GFLA 1B9MA 2MA3A 4BYYA 4XSZF 3CUQB 2MH2A 3LA2A 1OPCA 1YIOA 3WG9A 4BHPA 1D8KA 2ZNZA 4RAYA 3NEUA 3R6SA 1TTYA 2H6BA 1KU2A 3E6DA 4G6QA 5LLQA 1P4WA 3RYPA 1G4DA 3WE2A 1K78B 5K5OA 4WF2A 2HQNA 4U0WA 2MLGA 1ZREA 4M6YA 3GZ5A 3FWEA 2CSOA 5CVIA 5ICFA 2MBFA 4XLNF 4ENNA 2HFHA 1MGTA 1FNNA 1HSJA 3GVAA 1Q1HA 3R0JA 2OA4A 1LDDA 3ZMSA 2RDPA 4EM2A 3C3WA 4YIFA 4OOIA 2HOEA 4ZYHA 4HAMA 1FSEA 5BPIA 2VT3A 3FM5A 3FZVA 1O7LA 2L01A 3WTWC 1QZZA 4YFXF 4ON0A 3K2ZA 5LEJA 3GX4X 4A2UA 1KA8A 1W7PA 1QQIA 1W7PD 1QGPA 1KU9A 1FYKA 3IC7A 1TW3A 3B73A 3K9TA 4A5MA 1QBJA 3RKWA 5FGMA 3C1DA 2LF8A 4L9JA 5D4RA 3ZPLA 4S04A 2DBBA 4O6JA 1F1ZA 3QU6A 2Q0OA 4A6DA 2L02A 1T98A 3E3VA 2F5CA 2ZBKA 3RPUA 3RJPA 3K1PA 5FB2A 4G6DA 5K5QA 2F5DA 3QU3A 3T5XA 2V1UA 1H0MA 3FM3A 2STWA 2K4BA 4A0ZA 2M87A 2HYGD 2UXXA 3DQVC 1FPQA 2DK5A 4RS8A 3F8MA 1SFUA 1J59A 1FYMA 1XDUA 4TV7A 2GWRA 2FXAA 3LWFA 2E7XA 1SMTA 2HS5A 3KEOA 3E5UA 3GEZA 3E5XA 2H6CA 4G7HF 1FT9A 4IVNA 1HXDA 4I0AA 3KCCA 4LMYA 5HS8A 4GCVA 2XAFA 2IRFG 1OKRA 3QP6A 1MD0A 4ESJA 4ESBA 2E1NA 2ETHA 1PP8F 5IT9Z 3L7WA 4HV5A 3HOSA 2UWMA 3KFWX 1LVAA 4MEYF 1E17A 2OD5A 2P4WA 3ZQ7A 3MZHA 2A07F 4IHSA 2KJCA 1U6GA 4EJWA 3JSOA 4HDUA 3T1BA 3J7AO 3ERED 5KK1A 5CVUA 3C7JA 2L54A 1XGNA 1WKMA 2ADUA 1SD5A 5F6FA 4I01A 5TJJA 3N4MA 4WXCA 3QPHA 2HWVA 3CUQA 1S6LA 3I71A 2IPQX 4EM0B 1TNSA 3JW4A 3KP3A 2YPRA 1U8RA 2IW5A 3ECOA 4UV9A 2UXNA 4Y17A 1USSA 4HOBA 2H27A 4KFCA 3HOTA 3IHUA 2E1CA 3HRTA 2LSOA 4HQEA 2JZYA 4KT5C 4HF2A 2EFNA 5J6XA 4EQQA 5CVVA 3IKVA 2MD5A 5LGNA 2PEXA 2EJRA 1DPRA 2JT1A 1BM9A 4L9VA 3ZMUA 1I5ZA 5FD6A 4I7HA 2OQRA 1Z1DA 1CGPA 3CDHA 3Q5FA 5HS7A 2VC1A 3Q9SA 4KA4A 2ZFWA 3V7CA 1ZGAA 1KU7A 2QQBA 2M30A 3ABUA 4GYIA 2HR3A 5E20A 4A5NA 3GFJA 5H6RA 2X0LA 4LK0F 4Q4ZF 1B4AA 5LBQA 3DXJF 2ZXJA 4A12A 5JR3A 1USTA 1D3YA 1BBYA 5J8FA 1MDMA 2Q8KA 1G3YA 1FBSA 1KQ0A 1BI2A 4M73A 1JGSA 3U9GA 1LB2A 2PFBA 1ZHFA 2RN7A 4PCQA 3VB2A 3VEPA 1OR7A 3WGGA 3WTYC 4MTDA 2FE3A 2FQ3A 3WGIA 4BQAA 4G7OF 1S29A 1MJBA 2NYXA 4GGGA 2Z9OA 4UVBA 1R7JA 3ZMDA 1LEBA 2VOPA 2HTJA 2KIMA 1FP1D 2WC2A 1AOYA 3L9FA 1KU3A 1DUXC 3K1MA 2XROA 1XMAA 1O7FA 4MNUA 3ULQB 2RKHA 3I64A 3G3ZA 1B1BA 2YX4A 1I27A 4OIPF 2BEOA 2PBIA 1LQ1A 3IRRA 1Z7UA 5E1WA 3J80K 1P2FA 2NAZA 4OIRF 1EH7A 1T6SA 3F72A 3TGNA 1FLIA 1O3TA 2GXBA 1IRGA 1OYYA 4LG0B 3LQQA 4Y15A 3IRQA 1J5YA 1XSXA 2VOOA 1MJAA 1CF7B 1B59A 1O3QA 4P55A 3ML6A 3EYYA 1J75A 2XKOA 1R00A 1X3UA 3V7RA 4BAYA 2ISYA 1FWZA 4HQMA 3RKYA 4N9IA 2DTRA 2QBYA 2PQ8A 2QLZA 1H9TA 1JHFA 5AIPA 4IRGA 4RB0A 3J81Z 5J8CA 1BN5A 4HW0A 2J5PA 3I0TA 5AIQA 1KQ9A 3F23A 3VOEA 2FBHA 3R4KA 4ASNA 3F6OA 2OZ6A 5FFZA 5H20A 5LGTA 2D1HA 2LKPA 3V8JA 1R5GA 1K79A 3KEQA 4MQ9F 1YFHA 4QWQA 2RV8A 4JK1X 1XGMA 1BI1A 2K7LA 4LJZF 4CO8A 3WTUC 1KYZA 5D5WB 1C0WA 2V79A 2R3SA 1HKSA 2DQLA 3I53A 1ON2A 2JPBA 2P8TA 2G7HA 2NNYA 2R7FA 3L09A 2QWWA 1P6RA 2P5VA 5D4SA 1Z91A 1K78A 1REPC 3GYHX 1FBQA 4BHCA 2PMHA 1J0RA 3P9CA 1WRJA 2P7VB 2VBXA 3K0LA 3DPTA 3DEUA 3CO6C 3FHZA 4EGZA 4UVCA 3LAPA 3BWGA 4BH9A 5L3DA 3PQKA 3BJOA 1H9GA 4U0VA 4P9UA 2VBZA 3I54A 4KIBA 1BIBA 2RC4A 3KZYA 1RNLA 3BPXA 2P6TA 3T8TA 1A04A 1YLFA 4UV8A 1ON1A 1W7PB 3TO9A 3FMRA 3E6BA 5E18F 5EEHA 4CICA 1R5HA 4DNCA 1SD4A 5DUIA 4I0BA 2EB7A 2V1DA 4HLYA 1TLHB 1HKTA 5IT9K 1JXSA 3IWFA 4RGUA 3IL2A 4FHTA 2E7WA 1BI0A 1BC8C 2A68F 5ILSA 4P5OA 5LHHA 2A69F 2HKXA 1DDNA 4M9ZA 3QPTA 2H09A 4K2EA 4YFKF 2KJBA 3L00A 4EV0A 2F2EA 2DFIA 2VE8A 3FXQA 1G3WA 3COAC 1UHWA 3U1DA 2X4HA 3SFZA 4A0XA 4RGSA 2FNPA 3TKYA 4HV6A 3FMQA 1YS6A 3TO7A 4LLLA 1U3EM 2CW0F 1ZARA 2QBYB 3GFMA 3I58A 2EV0A 1I1GA 3Q9VA 3B02A 1U5TA 4YG2F 1ZG5A 3ELKA 3P9IA 5D8KB 4A0YA 3EYIA 1BI3A 3EUHA 5DV5A 1U2WA 2GA2A 1XMKA 1YG2A 2FA5A 3D0SA 3KP4A 2CQKA 4YIIA 4XLPF 4HF0A 4ENMA 2VBYA 3E6CC 2EA2A 1O57A 1HKQA 1FP2A 4ENKA 2FMYA 3TOAA 1QNTA 2BGCA 1NHAA 1S3JA 2DPUA 2BYVE 1GHCA 1G3TA 5EEGA 3ISPA 3MCZA 2XASA 3W6KB 4AVPA 5DCMA 1ZH5A 5CVRA 2ZJ2A 2HZTA 5JVTA 3O6BB 1MDMB 3KP2A 4XBFA 4BHBA 4Q47A 3WU1B 1P4XA 2K4JA 5LRSA 2PG4A 3O2PE 3ZMTA 1YW9A 2MH9A 2ZMEA 2HEOA 4AD9A 2Y75A 1R23A 1R1UA 5E1ZB 4NHJA 1D5VA 3ROUA 1UFMA 4HX7A 5ICCA 3JAMZ 4KNYA 2ESHA 1XD7A 1XCBA 3RIRA 1T38A 3QOPA 1O3RA 4N0BA 4ZYDA 3V8LA 1GXQA 2W24A 2HYFA 2K27A 3WTSC 1ZLJA 2L3DA 5E8GA 3SQNA 1W5TA 3BP8A 4I98B 1ZN2A 1IN7A 3K1NA 4ESFA 3LQRA 3FX3A 4U7DA 2Z5UA 2DQRA 2A6EF 3WTTC 1RUNA 5FFXA 3ZMVA 2Z99A 4MEXF 1ZRCA 3CUOA 4XRFA 3V4GA 2V1XA 4RB1A 1YTYA 2V9VA 3J81K 1T39A 1ZG3A 1YS7A 2QQ9A 1QO0D 2NRAC 2XUBA 4PGGA 5L3FA 1I6XA 1E2XA 2DT5A 1V3FA 4S05A 2VONA 3HRMA 3KZZA 1K7AA 4CDGA 2GIVA 5FLXK 1S7AA 3BJAA 5D5UB 1R58A 3SHFA 2MC3A 1Z05A 1LNWA 5K1YA 1VTNC 5D5XB 4G7ZF 1TW2A 3F8BA 3F8NA 2FU4A 4LB5A 2IT0A 2CFXA 2KKOA 2PI0A 1IXSB 2IA2A 2D2WA 1AWCA 2G9WA 3WGHA 1Z6TA 1LDJA 3JTGA 4IXAA 3V8KA 3J80Z 3CTAA 5D6EA 1IAWA 4UXNA 3M1EA 5JI6A 3AAFA 4WXDA 5KVRA 1J7KA 2VODA 1HW5A 2GQQA 4ZZLA 2Y48A 2O03A 2XHKA 3K69A 3ZN1A 3CLOA 3LFKA 4RAZA 2OU2A 4E70A 3GFIA 4FX4A 3GO5A 1MZBA 4WCGA 2GZWA 3W6JB 2B0LA 4UUVA 2F5EA 2P7CB 3ZN0A 3WU0A 2Z33A 3M8FA 1IXRC 4KMFA 4WXHA 2DO7A 4R79A 2DAOA 1V4RA 3HYIA 1XSVA 3PQJA 4KIFA 4FT8A 2HTSA 4CYDA 3R0AA 4YFNF 1ZRFA 3MEXA 5DCMB 2VE9A 1ZLKA 4L0YB 3F3XA 2JPCA 2PJPA 2DU9A 3SZTA 3F8FA 3QAHA 4IHTA 1BOAA 2D1VA 1R1VA 1BJAA 3FXUA 2XAJA 4R1HA 3DV8A 3KETA 4L5IA 1R36A 2VC0A 1ZAOA 4BXUA 4CGZA 1F4KA 3QRFF 4LG0A 3WTZA 1IN4A 1MKMA 4HDVA 2O61A 5BPDA 2G7UA 2ESNA 4EMSA 2JTVA 2K86A 5IT3A 3E5QA 4AIJA 4L18B 4MQVA 5HLHA 1YQAA 1YYVA 2QVOA 3M9AA 4UVAA 2RQPA 4H0EA 1LJ9A 3HTSB 2RVCA 2ZKZA 2COMA 1D8JA 1B6AA 5HLIA 2QENA 5DD4A 4KN4X 5BS6A 2XAQA 5HDNA 1FYLA 3L2CA 3JAMK 2F5FA 1B9NA 3BJ6A 1GXPA 1IN5A 1I1SA 3KE2A 3P7NA 4LK1F 2GAUA 1FY7A 3MAJA 2TDXA 2XVCA 1SAXA 5BMZA 4EJUA 2M8EA 4RB3C 5LEKA 5CYVA 3OV8A 4M74A 1FBUA 4CHUA 2WV0A 4WK8F 3HRUA 4KICA 3HRSA 3F6VA 1F9NA 3R61A 4P9FA 3DP7A 3DF8A 1T2KA 5DD8A 1GVJA 2M1BA 4MGRA 1PDNC 1OYWA 1BC7C 3I59B 3GUDA 3WTVC 3IKTA 2FOKA 3ABTA 2YSRA 1HBXG 2GA1A 1K6OA 2NNNA 5ED4A 5BOXA 3FMSA 4N9HA 2KIFA 3LSTA 1Y0UA 3JTHA 4AIKA 4OU0A 2XAGA 1L3LA 3BOQA 4O3MA 2BV6A 4IPAA 1BIAA 3G73A 1YW7A 3I4PA 4I09A 4OINF 2XRNA 2W84A 5FO5A 3DFGA 3P9KA 5H6QA 1KYWA 3QP5A 1UCRA 4L5JA 3LA7A 3NQOA 4RGRA 2FF4A 2WWYA 2DI3A 2ZMEB 1FZPB 4O5VA 2JSCA 5DYMA 2AXLA 4L0ZB 3KP5A 2EV5A 2O3FA 4F7ZA 5F64A 2Q2EA 3HHHA 4EM1A 2QQAA 4HX8A 3GW2A 2R7DA 5E8IA 3BROA 4OIQF 2VXZA 2WTEA 2MLKA 1TQMA 2FSWA 1HQCA 2V6CA 3F21A 1DP7P 3ECHA 3SZPA 1ZRDA 3FXRA 4LFUA 2EK5A 2Z3YA 3DPLC 4HA8A 4A6EA 2DK8A 1SD6A 3GF2A 3EQLF 5FD5A 5JFRA 6PAXA 3I5UA 1QZYA 3TDUC 2QUFA 3PFIA 3BY6A 1LDKB 1J2XA 2EA4A 3SXYA 1U5TB 2VBWA 4WWCA 5E1XA 4ZZDA 1TNTA 1WWXA 2HDCA 2FRHA 1SFEA 3RPQA 3WE3A 2EFPA 1IN6A 2YU3A 1XCVA 2QYOA 2O0YA 5ICEA 1XSDA 3DKWA 1RUOA 2K02A 3RI4A 3VFZA 4Z2YA 1XN7A 3ZMZA 4HLXA 3WODF 2IA0A 4M9XA 3HTUA 2Y0MA 4PGHA 5HOOA 3EETA 4R8HA 1IW7F 1S8NA 1U5TC 4B09A 2FEZA 2M45A 5ICGA 5L3EA 1UB9A 3CJNA 1YW8A 2A61A 1G6NA 1R22A 3KLOA 3KP7A 5L3BA 3BPVA 1DPUA 1YO5C 5DEQA 2DPDA 3HSFA 1KQ8A 4PDKA 2CG4A 5TRDA 4ZH4F 5FLXZ 4NQWA 5DDGA 4EVIA 3I59A 3ZP5A 5K5RA 1RI7A 1STZA 3RTRA 2OBPA 4U88A 5L3GA 5HDGA 5D8LB 1XB4A 3FF5A 2LNBA 5LHGA 4WX9A 1UHMA 4GO1A 4KMUX 4M71A 5LRRA 2W85A 3WTXC 4IF4A 4HF1A 2KRFA 2ZO4A 5D5VB 1RZ4A 2DW4A 2LF7A 1KGSA 3TO6A 4KYWA 2A6HF 2IJLA 2CWEA 4U7BA 4AIHA 3GXOA 4OMZA 2RNJA 3GWZA 1ODDA 4RGXA 4HX4A 2DLLA 4DQ2A 2ZCWA 4BNCA 2CGPA 4GXOA 2W57A 4LLNA 1JHHA 1WQ2A 4PZJA 2W25A 5CLSA 2CYYA 2P6SA 3HHGA 1XGSA 2STTA 3MFKA 1L0OC 1JE8A 4CXFA 3IWZA 1HW1A 4NB5A 2UZKA 4OMYA 1J9IA 3H92A 5HLGA 2HGCA 3MWMA 2QM3A 4UNOA 1G3SA 1EH8A 3LA3A 1WI9A 2OQGA 4B8XA 3T0YA 3NRVA 4EJTA 2PN6A 1W4MA 3MQ0A 2ACJA 1XDSA 3GZ6A 1F5TA 3BZ6A 2D45A 2XV4S 1WSUA 2XGXA 2IVMA 1ZYRF 3V7SA 3HSEA 3D5LA 2EV6A 1FSHA 4ZYEA 1TBXA 2QZ8A 4L9NA 2VT2A 1Z9CA 5CVJA 1ULYA 2XIGA 1SD7A 2ELHA 2ISZA 3VODA 3M7GA 3E97A 3M8EA 3H3UA 1EV7A 4XSXF 3KP6A 2GXGA 3H3ZA 4I02A 4G9YA 1IUYA 2HQRA 3BDDA 1FOKA 2YR2A 2J5OA 2XKPA 5A2QZ 4UHTA 4LB6B 5A2QK 5E17F 2OAZA 4QLCU 3EDPA 2H94A 2P5LC 5DCFA 5LHIA 3S2WA 5ILUA 1ZGJA 2IP2A 1IRFA 2JRTA 3GLXA 5JHUA 4EJVA 1SMYF 4MTEA 2PMUA 2EWNA 1T0FA 3TOBA 1FC3A 1XGOA 3F22A 1P92A 2L4AA 4ENJA 3JSPA 2KIUA 4IRIA 5HVQC 4HYEA 3HSRA 5AONA 1HW2A 1TQIA 3TQNA 3MZYA 4JBAA 4M6XA 1FX7A 2FNAA 2NS0A 2P5KA 4LLGF 1TQPA 5L3CA 4JQFA 4U0YA 4OIOF 2PLYA 2IA1A 3KLNA 5D6FA 4ZYGA 4D0PA 4EJOA 4KDPA 4P96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RGV A;  2FBI A;  1O3S A;  3F8C A;  3T8R A;  2HKO A;  1PP7 U;  4L9T A;  2A5Y B;  3RKX A;  1OYI A;  1IXC A;  5HDK A;  5HS9 A;  2VN2 A;  4LGW A;  4FX0 A;  2EFQ A;  2O8X A;  1S7O A;  1PUE E;  2EFO A;  1IZ1 A;  3LAJ A;  4AWX B;  1OMI A;  4M9S A;  4LD5 A;  1ZG1 A;  2XAH A;  1IF1 A;  2CO5 A;  2L4M A;  4IRH A;  4HZF A;  1U78 A;  2O6G E;  1CF7 A;  2LDU A;  2FML A;  4G94 A;  4M72 A;  3N97 A;  2C6Y A;  4I2O A;  1Z6R A;  3REO A;  3R60 A;  3RYR A;  1W5S A;  2EFW A;  3CUQ C;  4RB2 C;  4KUM A;  3TDZ C;  4G8X A;  3OOP A;  2BBY A;  4Q48 A;  1EH6 A;  4CZZ A;  3E6M A;  1SFX A;  2M5W A;  3HUG A;  4KIG A;  1RIO H;  3RDI A;  5CJ9 A;  3O3K A;  1IN8 A;  4IJA A;  4HBL A;  3U2R A;  2FBK A;  4MHG A;  1HST A;  1MJ9 A;  1LEA A;  4Q5S F;  1QPM A;  1R1T A;  5LGU A;  2YX7 A;  5F1R A;  2OZU A;  4GYG A;  3CO7 C;  2ZNY A;  5ILV A;  3C18 A;  4Y13 A;  3HIF A;  5ERI A;  5BQT A;  5DUK A;  4EGY A;  2BE5 F;  2A3S A;  4ETS A;  1ONV A;  2AS5 F;  4KN7 X;  1P4A A;  3GFL A;  1B9M A;  2MA3 A;  4BYY A;  4XSZ F;  3CUQ B;  2MH2 A;  3LA2 A;  1OPC A;  1YIO A;  3WG9 A;  4BHP A;  1D8K A;  2ZNZ A;  4RAY A;  3NEU A;  3R6S A;  1TTY A;  2H6B A;  1KU2 A;  3E6D A;  4G6Q A;  5LLQ A;  1P4W A;  3RYP A;  1G4D A;  3WE2 A;  1K78 B;  5K5O A;  4WF2 A;  2HQN A;  4U0W A;  2MLG A;  1ZRE A;  4M6Y A;  3GZ5 A;  3FWE A;  2CSO A;  5CVI A;  5ICF A;  2MBF A;  4XLN F;  4ENN A;  2HFH A;  1MGT A;  1FNN A;  1HSJ A;  3GVA A;  1Q1H A;  3R0J A;  2OA4 A;  1LDD A;  3ZMS A;  2RDP A;  4EM2 A;  3C3W A;  4YIF A;  4OOI A;  2HOE A;  4ZYH A;  4HAM A;  1FSE A;  5BPI A;  2VT3 A;  3FM5 A;  3FZV A;  1O7L A;  2L01 A;  3WTW C;  1QZZ A;  4YFX F;  4ON0 A;  3K2Z A;  5LEJ A;  3GX4 X;  4A2U A;  1KA8 A;  1W7P A;  1QQI A;  1W7P D;  1QGP A;  1KU9 A;  1FYK A;  3IC7 A;  1TW3 A;  3B73 A;  3K9T A;  4A5M A;  1QBJ A;  3RKW A;  5FGM A;  3C1D A;  2LF8 A;  4L9J A;  5D4R A;  3ZPL A;  4S04 A;  2DBB A;  4O6J A;  1F1Z A;  3QU6 A;  2Q0O A;  4A6D A;  2L02 A;  1T98 A;  3E3V A;  2F5C A;  2ZBK A;  3RPU A;  3RJP A;  3K1P A;  5FB2 A;  4G6D A;  5K5Q A;  2F5D A;  3QU3 A;  3T5X A;  2V1U A;  1H0M A;  3FM3 A;  2STW A;  2K4B A;  4A0Z A;  2M87 A;  2HYG D;  2UXX A;  3DQV C;  1FPQ A;  2DK5 A;  4RS8 A;  3F8M A;  1SFU A;  1J59 A;  1FYM A;  1XDU A;  4TV7 A;  2GWR A;  2FXA A;  3LWF A;  2E7X A;  1SMT A;  2HS5 A;  3KEO A;  3E5U A;  3GEZ A;  3E5X A;  2H6C A;  4G7H F;  1FT9 A;  4IVN A;  1HXD A;  4I0A A;  3KCC A;  4LMY A;  5HS8 A;  4GCV A;  2XAF A;  2IRF G;  1OKR A;  3QP6 A;  1MD0 A;  4ESJ A;  4ESB A;  2E1N A;  2ETH A;  1PP8 F;  5IT9 Z;  3L7W A;  4HV5 A;  3HOS A;  2UWM A;  3KFW X;  1LVA A;  4MEY F;  1E17 A;  2OD5 A;  2P4W A;  3ZQ7 A;  3MZH A;  2A07 F;  4IHS A;  2KJC A;  1U6G A;  4EJW A;  3JSO A;  4HDU A;  3T1B A;  3J7A O;  3ERE D;  5KK1 A;  5CVU A;  3C7J A;  2L54 A;  1XGN A;  1WKM A;  2ADU A;  1SD5 A;  5F6F A;  4I01 A;  5TJJ A;  3N4M A;  4WXC A;  3QPH A;  2HWV A;  3CUQ A;  1S6L A;  3I71 A;  2IPQ X;  4EM0 B;  1TNS A;  3JW4 A;  3KP3 A;  2YPR A;  1U8R A;  2IW5 A;  3ECO A;  4UV9 A;  2UXN A;  4Y17 A;  1USS A;  4HOB A;  2H27 A;  4KFC A;  3HOT A;  3IHU A;  2E1C A;  3HRT A;  2LSO A;  4HQE A;  2JZY A;  4KT5 C;  4HF2 A;  2EFN A;  5J6X A;  4EQQ A;  5CVV A;  3IKV A;  2MD5 A;  5LGN A;  2PEX A;  2EJR A;  1DPR A;  2JT1 A;  1BM9 A;  4L9V A;  3ZMU A;  1I5Z A;  5FD6 A;  4I7H A;  2OQR A;  1Z1D A;  1CGP A;  3CDH A;  3Q5F A;  5HS7 A;  2VC1 A;  3Q9S A;  4KA4 A;  2ZFW A;  3V7C A;  1ZGA A;  1KU7 A;  2QQB A;  2M30 A;  3ABU A;  4GYI A;  2HR3 A;  5E20 A;  4A5N A;  3GFJ A;  5H6R A;  2X0L A;  4LK0 F;  4Q4Z F;  1B4A A;  5LBQ A;  3DXJ F;  2ZXJ A;  4A12 A;  5JR3 A;  1UST A;  1D3Y A;  1BBY A;  5J8F A;  1MDM A;  2Q8K A;  1G3Y A;  1FBS A;  1KQ0 A;  1BI2 A;  4M73 A;  1JGS A;  3U9G A;  1LB2 A;  2PFB A;  1ZHF A;  2RN7 A;  4PCQ A;  3VB2 A;  3VEP A;  1OR7 A;  3WGG A;  3WTY C;  4MTD A;  2FE3 A;  2FQ3 A;  3WGI A;  4BQA A;  4G7O F;  1S29 A;  1MJB A;  2NYX A;  4GGG A;  2Z9O A;  4UVB A;  1R7J A;  3ZMD A;  1LEB A;  2VOP A;  2HTJ A;  2KIM A;  1FP1 D;  2WC2 A;  1AOY A;  3L9F A;  1KU3 A;  1DUX C;  3K1M A;  2XRO A;  1XMA A;  1O7F A;  4MNU A;  3ULQ B;  2RKH A;  3I64 A;  3G3Z A;  1B1B A;  2YX4 A;  1I27 A;  4OIP F;  2BEO A;  2PBI A;  1LQ1 A;  3IRR A;  1Z7U A;  5E1W A;  3J80 K;  1P2F A;  2NAZ A;  4OIR F;  1EH7 A;  1T6S A;  3F72 A;  3TGN A;  1FLI A;  1O3T A;  2GXB A;  1IRG A;  1OYY A;  4LG0 B;  3LQQ A;  4Y15 A;  3IRQ A;  1J5Y A;  1XSX A;  2VOO A;  1MJA A;  1CF7 B;  1B59 A;  1O3Q A;  4P55 A;  3ML6 A;  3EYY A;  1J75 A;  2XKO A;  1R00 A;  1X3U A;  3V7R A;  4BAY A;  2ISY A;  1FWZ A;  4HQM A;  3RKY A;  4N9I A;  2DTR A;  2QBY A;  2PQ8 A;  2QLZ A;  1H9T A;  1JHF A;  5AIP A;  4IRG A;  4RB0 A;  3J81 Z;  5J8C A;  1BN5 A;  4HW0 A;  2J5P A;  3I0T A;  5AIQ A;  1KQ9 A;  3F23 A;  3VOE A;  2FBH A;  3R4K A;  4ASN A;  3F6O A;  2OZ6 A;  5FFZ A;  5H20 A;  5LGT A;  2D1H A;  2LKP A;  3V8J A;  1R5G A;  1K79 A;  3KEQ A;  4MQ9 F;  1YFH A;  4QWQ A;  2RV8 A;  4JK1 X;  1XGM A;  1BI1 A;  2K7L A;  4LJZ F;  4CO8 A;  3WTU C;  1KYZ A;  5D5W B;  1C0W A;  2V79 A;  2R3S A;  1HKS A;  2DQL A;  3I53 A;  1ON2 A;  2JPB A;  2P8T A;  2G7H A;  2NNY A;  2R7F A;  3L09 A;  2QWW A;  1P6R A;  2P5V A;  5D4S A;  1Z91 A;  1K78 A;  1REP C;  3GYH X;  1FBQ A;  4BHC A;  2PMH A;  1J0R A;  3P9C A;  1WRJ A;  2P7V B;  2VBX A;  3K0L A;  3DPT A;  3DEU A;  3CO6 C;  3FHZ A;  4EGZ A;  4UVC A;  3LAP A;  3BWG A;  4BH9 A;  5L3D A;  3PQK A;  3BJO A;  1H9G A;  4U0V A;  4P9U A;  2VBZ A;  3I54 A;  4KIB A;  1BIB A;  2RC4 A;  3KZY A;  1RNL A;  3BPX A;  2P6T A;  3T8T A;  1A04 A;  1YLF A;  4UV8 A;  1ON1 A;  1W7P B;  3TO9 A;  3FMR A;  3E6B A;  5E18 F;  5EEH A;  4CIC A;  1R5H A;  4DNC A;  1SD4 A;  5DUI A;  4I0B A;  2EB7 A;  2V1D A;  4HLY A;  1TLH B;  1HKT A;  5IT9 K;  1JXS A;  3IWF A;  4RGU A;  3IL2 A;  4FHT A;  2E7W A;  1BI0 A;  1BC8 C;  2A68 F;  5ILS A;  4P5O A;  5LHH A;  2A69 F;  2HKX A;  1DDN A;  4M9Z A;  3QPT A;  2H09 A;  4K2E A;  4YFK F;  2KJB A;  3L00 A;  4EV0 A;  2F2E A;  2DFI A;  2VE8 A;  3FXQ A;  1G3W A;  3COA C;  1UHW A;  3U1D A;  2X4H A;  3SFZ A;  4A0X A;  4RGS A;  2FNP A;  3TKY A;  4HV6 A;  3FMQ A;  1YS6 A;  3TO7 A;  4LLL A;  1U3E M;  2CW0 F;  1ZAR A;  2QBY B;  3GFM A;  3I58 A;  2EV0 A;  1I1G A;  3Q9V A;  3B02 A;  1U5T A;  4YG2 F;  1ZG5 A;  3ELK A;  3P9I A;  5D8K B;  4A0Y A;  3EYI A;  1BI3 A;  3EUH A;  5DV5 A;  1U2W A;  2GA2 A;  1XMK A;  1YG2 A;  2FA5 A;  3D0S A;  3KP4 A;  2CQK A;  4YII A;  4XLP F;  4HF0 A;  4ENM A;  2VBY A;  3E6C C;  2EA2 A;  1O57 A;  1HKQ A;  1FP2 A;  4ENK A;  2FMY A;  3TOA A;  1QNT A;  2BGC A;  1NHA A;  1S3J A;  2DPU A;  2BYV E;  1GHC A;  1G3T A;  5EEG A;  3ISP A;  3MCZ A;  2XAS A;  3W6K B;  4AVP A;  5DCM A;  1ZH5 A;  5CVR A;  2ZJ2 A;  2HZT A;  5JVT A;  3O6B B;  1MDM B;  3KP2 A;  4XBF A;  4BHB A;  4Q47 A;  3WU1 B;  1P4X A;  2K4J A;  5LRS A;  2PG4 A;  3O2P E;  3ZMT A;  1YW9 A;  2MH9 A;  2ZME A;  2HEO A;  4AD9 A;  2Y75 A;  1R23 A;  1R1U A;  5E1Z B;  4NHJ A;  1D5V A;  3ROU A;  1UFM A;  4HX7 A;  5ICC A;  3JAM Z;  4KNY A;  2ESH A;  1XD7 A;  1XCB A;  3RIR A;  1T38 A;  3QOP A;  1O3R A;  4N0B A;  4ZYD A;  3V8L A;  1GXQ A;  2W24 A;  2HYF A;  2K27 A;  3WTS C;  1ZLJ A;  2L3D A;  5E8G A;  3SQN A;  1W5T A;  3BP8 A;  4I98 B;  1ZN2 A;  1IN7 A;  3K1N A;  4ESF A;  3LQR A;  3FX3 A;  4U7D A;  2Z5U A;  2DQR A;  2A6E F;  3WTT C;  1RUN A;  5FFX A;  3ZMV A;  2Z99 A;  4MEX F;  1ZRC A;  3CUO A;  4XRF A;  3V4G A;  2V1X A;  4RB1 A;  1YTY A;  2V9V A;  3J81 K;  1T39 A;  1ZG3 A;  1YS7 A;  2QQ9 A;  1QO0 D;  2NRA C;  2XUB A;  4PGG A;  5L3F A;  1I6X A;  1E2X A;  2DT5 A;  1V3F A;  4S05 A;  2VON A;  3HRM A;  3KZZ A;  1K7A A;  4CDG A;  2GIV A;  5FLX K;  1S7A A;  3BJA A;  5D5U B;  1R58 A;  3SHF A;  2MC3 A;  1Z05 A;  1LNW A;  5K1Y A;  1VTN C;  5D5X B;  4G7Z F;  1TW2 A;  3F8B A;  3F8N A;  2FU4 A;  4LB5 A;  2IT0 A;  2CFX A;  2KKO A;  2PI0 A;  1IXS B;  2IA2 A;  2D2W A;  1AWC A;  2G9W A;  3WGH A;  1Z6T A;  1LDJ A;  3JTG A;  4IXA A;  3V8K A;  3J80 Z;  3CTA A;  5D6E A;  1IAW A;  4UXN A;  3M1E A;  5JI6 A;  3AAF A;  4WXD A;  5KVR A;  1J7K A;  2VOD A;  1HW5 A;  2GQQ A;  4ZZL A;  2Y48 A;  2O03 A;  2XHK A;  3K69 A;  3ZN1 A;  3CLO A;  3LFK A;  4RAZ A;  2OU2 A;  4E70 A;  3GFI A;  4FX4 A;  3GO5 A;  1MZB A;  4WCG A;  2GZW A;  3W6J B;  2B0L A;  4UUV A;  2F5E A;  2P7C B;  3ZN0 A;  3WU0 A;  2Z33 A;  3M8F A;  1IXR C;  4KMF A;  4WXH A;  2DO7 A;  4R79 A;  2DAO A;  1V4R A;  3HYI A;  1XSV A;  3PQJ A;  4KIF A;  4FT8 A;  2HTS A;  4CYD A;  3R0A A;  4YFN F;  1ZRF A;  3MEX A;  5DCM B;  2VE9 A;  1ZLK A;  4L0Y B;  3F3X A;  2JPC A;  2PJP A;  2DU9 A;  3SZT A;  3F8F A;  3QAH A;  4IHT A;  1BOA A;  2D1V A;  1R1V A;  1BJA A;  3FXU A;  2XAJ A;  4R1H A;  3DV8 A;  3KET A;  4L5I A;  1R36 A;  2VC0 A;  1ZAO A;  4BXU A;  4CGZ A;  1F4K A;  3QRF F;  4LG0 A;  3WTZ A;  1IN4 A;  1MKM A;  4HDV A;  2O61 A;  5BPD A;  2G7U A;  2ESN A;  4EMS A;  2JTV A;  2K86 A;  5IT3 A;  3E5Q A;  4AIJ A;  4L18 B;  4MQV A;  5HLH A;  1YQA A;  1YYV A;  2QVO A;  3M9A A;  4UVA A;  2RQP A;  4H0E A;  1LJ9 A;  3HTS B;  2RVC A;  2ZKZ A;  2COM A;  1D8J A;  1B6A A;  5HLI A;  2QEN A;  5DD4 A;  4KN4 X;  5BS6 A;  2XAQ A;  5HDN A;  1FYL A;  3L2C A;  3JAM K;  2F5F A;  1B9N A;  3BJ6 A;  1GXP A;  1IN5 A;  1I1S A;  3KE2 A;  3P7N A;  4LK1 F;  2GAU A;  1FY7 A;  3MAJ A;  2TDX A;  2XVC A;  1SAX A;  5BMZ A;  4EJU A;  2M8E A;  4RB3 C;  5LEK A;  5CYV A;  3OV8 A;  4M74 A;  1FBU A;  4CHU A;  2WV0 A;  4WK8 F;  3HRU A;  4KIC A;  3HRS A;  3F6V A;  1F9N A;  3R61 A;  4P9F A;  3DP7 A;  3DF8 A;  1T2K A;  5DD8 A;  1GVJ A;  2M1B A;  4MGR A;  1PDN C;  1OYW A;  1BC7 C;  3I59 B;  3GUD A;  3WTV C;  3IKT A;  2FOK A;  3ABT A;  2YSR A;  1HBX G;  2GA1 A;  1K6O A;  2NNN A;  5ED4 A;  5BOX A;  3FMS A;  4N9H A;  2KIF A;  3LST A;  1Y0U A;  3JTH A;  4AIK A;  4OU0 A;  2XAG A;  1L3L A;  3BOQ A;  4O3M A;  2BV6 A;  4IPA A;  1BIA A;  3G73 A;  1YW7 A;  3I4P A;  4I09 A;  4OIN F;  2XRN A;  2W84 A;  5FO5 A;  3DFG A;  3P9K A;  5H6Q A;  1KYW A;  3QP5 A;  1UCR A;  4L5J A;  3LA7 A;  3NQO A;  4RGR A;  2FF4 A;  2WWY A;  2DI3 A;  2ZME B;  1FZP B;  4O5V A;  2JSC A;  5DYM A;  2AXL A;  4L0Z B;  3KP5 A;  2EV5 A;  2O3F A;  4F7Z A;  5F64 A;  2Q2E A;  3HHH A;  4EM1 A;  2QQA A;  4HX8 A;  3GW2 A;  2R7D A;  5E8I A;  3BRO A;  4OIQ F;  2VXZ A;  2WTE A;  2MLK A;  1TQM A;  2FSW A;  1HQC A;  2V6C A;  3F21 A;  1DP7 P;  3ECH A;  3SZP A;  1ZRD A;  3FXR A;  4LFU A;  2EK5 A;  2Z3Y A;  3DPL C;  4HA8 A;  4A6E A;  2DK8 A;  1SD6 A;  3GF2 A;  3EQL F;  5FD5 A;  5JFR A;  6PAX A;  3I5U A;  1QZY A;  3TDU C;  2QUF A;  3PFI A;  3BY6 A;  1LDK B;  1J2X A;  2EA4 A;  3SXY A;  1U5T B;  2VBW A;  4WWC A;  5E1X A;  4ZZD A;  1TNT A;  1WWX A;  2HDC A;  2FRH A;  1SFE A;  3RPQ A;  3WE3 A;  2EFP A;  1IN6 A;  2YU3 A;  1XCV A;  2QYO A;  2O0Y A;  5ICE A;  1XSD A;  3DKW A;  1RUO A;  2K02 A;  3RI4 A;  3VFZ A;  4Z2Y A;  1XN7 A;  3ZMZ A;  4HLX A;  3WOD F;  2IA0 A;  4M9X A;  3HTU A;  2Y0M A;  4PGH A;  5HOO A;  3EET A;  4R8H A;  1IW7 F;  1S8N A;  1U5T C;  4B09 A;  2FEZ A;  2M45 A;  5ICG A;  5L3E A;  1UB9 A;  3CJN A;  1YW8 A;  2A61 A;  1G6N A;  1R22 A;  3KLO A;  3KP7 A;  5L3B A;  3BPV A;  1DPU A;  1YO5 C;  5DEQ A;  2DPD A;  3HSF A;  1KQ8 A;  4PDK A;  2CG4 A;  5TRD A;  4ZH4 F;  5FLX Z;  4NQW A;  5DDG A;  4EVI A;  3I59 A;  3ZP5 A;  5K5R A;  1RI7 A;  1STZ A;  3RTR A;  2OBP A;  4U88 A;  5L3G A;  5HDG A;  5D8L B;  1XB4 A;  3FF5 A;  2LNB A;  5LHG A;  4WX9 A;  1UHM A;  4GO1 A;  4KMU X;  4M71 A;  5LRR A;  2W85 A;  3WTX C;  4IF4 A;  4HF1 A;  2KRF A;  2ZO4 A;  5D5V B;  1RZ4 A;  2DW4 A;  2LF7 A;  1KGS A;  3TO6 A;  4KYW A;  2A6H F;  2IJL A;  2CWE A;  4U7B A;  4AIH A;  3GXO A;  4OMZ A;  2RNJ A;  3GWZ A;  1ODD A;  4RGX A;  4HX4 A;  2DLL A;  4DQ2 A;  2ZCW A;  4BNC A;  2CGP A;  4GXO A;  2W57 A;  4LLN A;  1JHH A;  1WQ2 A;  4PZJ A;  2W25 A;  5CLS A;  2CYY A;  2P6S A;  3HHG A;  1XGS A;  2STT A;  3MFK A;  1L0O C;  1JE8 A;  4CXF A;  3IWZ A;  1HW1 A;  4NB5 A;  2UZK A;  4OMY A;  1J9I A;  3H92 A;  5HLG A;  2HGC A;  3MWM A;  2QM3 A;  4UNO A;  1G3S A;  1EH8 A;  3LA3 A;  1WI9 A;  2OQG A;  4B8X A;  3T0Y A;  3NRV A;  4EJT A;  2PN6 A;  1W4M A;  3MQ0 A;  2ACJ A;  1XDS A;  3GZ6 A;  1F5T A;  3BZ6 A;  2D45 A;  2XV4 S;  1WSU A;  2XGX A;  2IVM A;  1ZYR F;  3V7S A;  3HSE A;  3D5L A;  2EV6 A;  1FSH A;  4ZYE A;  1TBX A;  2QZ8 A;  4L9N A;  2VT2 A;  1Z9C A;  5CVJ A;  1ULY A;  2XIG A;  1SD7 A;  2ELH A;  2ISZ A;  3VOD A;  3M7G A;  3E97 A;  3M8E A;  3H3U A;  1EV7 A;  4XSX F;  3KP6 A;  2GXG A;  3H3Z A;  4I02 A;  4G9Y A;  1IUY A;  2HQR A;  3BDD A;  1FOK A;  2YR2 A;  2J5O A;  2XKP A;  5A2Q Z;  4UHT A;  4LB6 B;  5A2Q K;  5E17 F;  2OAZ A;  4QLC U;  3EDP A;  2H94 A;  2P5L C;  5DCF A;  5LHI A;  3S2W A;  5ILU A;  1ZGJ A;  2IP2 A;  1IRF A;  2JRT A;  3GLX A;  5JHU A;  4EJV A;  1SMY F;  4MTE A;  2PMU A;  2EWN A;  1T0F A;  3TOB A;  1FC3 A;  1XGO A;  3F22 A;  1P92 A;  2L4A A;  4ENJ A;  3JSP A;  2KIU A;  4IRI A;  5HVQ C;  4HYE A;  3HSR A;  5AON A;  1HW2 A;  1TQI A;  3TQN A;  3MZY A;  4JBA A;  4M6X A;  1FX7 A;  2FNA A;  2NS0 A;  2P5K A;  4LLG F;  1TQP A;  5L3C A;  4JQF A;  4U0Y A;  4OIO F;  2PLY A;  2IA1 A;  3KLN A;  5D6F A;  4ZYG A;  4D0P A;  4EJO A;  4KDP A;  4P96 A; 
#chains in the Genus database with same CATH topology
 2JA2 A;  1FOW A;  5FLM J;  3ABM H;  3I4N J;  4LOC A;  5K7H A;  2RGV A;  2V6E A;  1HDP A;  3FKI J;  3TW6 A;  1H8A C;  2FBI A;  3BTI A;  4NC7 A;  1O3S A;  3K4M A;  3F8C A;  4IQ4 A;  3VWB A;  1R4N B;  5M5X J;  1ORK A;  3T8R A;  2HKO A;  5FKM A;  4UY8 I;  1PP7 U;  4X0G A;  4YEJ A;  4L9T A;  3OYB A;  3DLL F;  2Y31 A;  3CCV I;  1AHD P;  3ZXS A;  2A5Y B;  2WA0 A;  3RKX A;  1OYI A;  2R5Z B;  4XL9 A;  1PJR A;  1IXC A;  1XC5 A;  2V26 A;  5HDK A;  5HS9 A;  2VN2 A;  1JUS A;  4LGW A;  3M4O J;  2M4G A;  1ETQ A;  4FX0 A;  2EFQ A;  2O8X A;  3EUH C;  1S7O A;  3MZ8 A;  1PUE E;  4IHY A;  3GTM J;  2EFO A;  2KT0 A;  5LD2 C;  4F92 B;  1IZ1 A;  3LAJ A;  4PJJ A;  2VQG A;  4AWX B;  4C3H J;  1OMI A;  3H36 A;  2KIS A;  4M9S A;  1VF9 A;  4LD5 A;  1ZG1 A;  2IAI A;  2XAH A;  4YEL A;  1MNE A;  1IF1 A;  3TED A;  2KMU A;  1E0E A;  2ZJR F;  2CO5 A;  1UMQ A;  2L4M A;  4IRH A;  2E35 A;  4HZF A;  3E7L A;  2MD0 A;  2WAE A;  1U78 A;  2O6G E;  1CF7 A;  4XLF A;  2LDU A;  2FML A;  3LNQ A;  4G94 A;  4M72 A;  5EZH A;  3N97 A;  1A31 A;  3ESW B;  2C6Y A;  1XMX A;  4I2O A;  1Z6R A;  4ZJZ A;  4ZDO A;  3E0J B;  3REO A;  3R60 A;  1VQ8 I;  3RYR A;  1W5S A;  4B3X A;  5C4J J;  2EFW A;  1YJN I;  3CUQ C;  1GV5 A;  3TDZ C;  4KUM A;  4RB2 C;  4G8X A;  3OOP A;  4XNF A;  4G12 A;  1YJ9 I;  2BBY A;  4Q48 A;  1EH6 A;  3K10 A;  3E6M A;  4CZZ A;  1SFX A;  2M5W A;  3HUG A;  2YU9 J;  4KIG A;  3H0G J;  2NS8 A;  3RDI A;  1RIO H;  5CJ9 A;  2BY3 A;  3O3K A;  1IN8 A;  4IJA A;  1SVL A;  3RSN A;  2L7K A;  1UEL B;  4HBL A;  4RLF A;  1Y0N A;  3GTO J;  4BJ5 C;  3U2R A;  2FBK A;  3JRE A;  4MHG A;  4E7L A;  1XS9 A;  1I6H J;  1HST A;  2F4M B;  2A05 A;  4PK4 A;  1JUP A;  2WBM A;  1MJ9 A;  3CP8 A;  1POG A;  2I5U A;  1LEA A;  4Q5S F;  1QPM A;  1R1T A;  5LGU A;  4ANJ A;  1LFP A;  2YX7 A;  5F1R A;  2OZU A;  4GYG A;  3CO7 C;  3WHB A;  1GV2 A;  1P7J A;  2ZNY A;  5ILV A;  2HOA A;  2CS3 A;  2Z1D A;  3C18 A;  2NVU B;  3BG9 A;  1VQK I;  2QCO A;  4Y13 A;  3HIF A;  5ERI A;  1QRY A;  5BQT A;  5DUK A;  2EZI A;  4EGY A;  3CCU I;  2BE5 F;  2A3S A;  3G1O A;  4ETS A;  3LSH A;  2Y9Z A;  1ONV A;  2AS5 F;  4KN7 X;  1P4A A;  2PX9 A;  2OUM A;  3GFL A;  1B9M A;  3H1C A;  2MA3 A;  4BYY A;  1IDY A;  4XSZ F;  3CUQ B;  2MH2 A;  3OS0 A;  3LA2 A;  1OPC A;  1YIO A;  4PFP A;  3WG9 A;  4BHP A;  3JCU C;  3HOX J;  1D8K A;  1KON A;  2ZNZ A;  4NUB A;  1B8I A;  1QVT A;  3A02 A;  4RAY A;  3NEU A;  3R6S A;  1TTY A;  5EGO B;  2E1M B;  2K85 A;  4A3B J;  3LFU A;  1OCC H;  3QQA A;  2JMW A;  2H6B A;  1KU2 A;  3E6D A;  3SDB A;  4DYC A;  4G6Q A;  5LLQ A;  1P4W A;  1AU7 A;  3RYP A;  1G4D A;  2EIM H;  5E3M A;  3WE2 A;  2IS2 A;  2PJR B;  2LKS A;  1K78 B;  1T33 A;  5K5O A;  4WF2 A;  2HQN A;  2K3F A;  2QSF X;  1BL0 A;  1WI3 A;  4U0W A;  4DOZ A;  2MLG A;  1ZRE A;  2HPM A;  4M6Y A;  4JX5 A;  3GZ5 A;  2K40 A;  1JTY A;  3PUF A;  3FWE A;  2M0C A;  2CSO A;  1DP3 A;  5CVI A;  5DS9 A;  5F1J A;  1YIJ I;  3CF2 A;  3OYE A;  1J09 A;  5CKT A;  2L7M P;  2JA5 J;  5KCM A;  5ICF A;  2MBF A;  4XLN F;  4ENN A;  1GVD A;  2GIZ A;  2HFH A;  1MGT A;  1FNN A;  1ZGW A;  1HSJ A;  1Z67 A;  1WJC A;  3GVA A;  3QYE A;  3DTE A;  4FTH A;  2OV7 A;  1Q1H A;  3R0J A;  3PUB A;  2OA4 A;  1LDD A;  4FIS A;  3ZMS A;  3AL0 B;  2XF5 A;  2RDP A;  4EM2 A;  1WJF A;  4XOR A;  3C3W A;  2QA4 I;  4YIF A;  4W97 A;  4OOI A;  2BY1 A;  2HOE A;  1OCZ H;  4ZYH A;  4HAM A;  1FSE A;  5BPI A;  2VT3 A;  4Y33 A;  1LE8 B;  3FM5 A;  1YX3 A;  3FBI B;  3FZV A;  1O7L A;  1WH5 A;  1R4M B;  1SFO J;  2L01 A;  3WTW C;  1QZZ A;  4ZDL A;  4YFX F;  4ON0 A;  3K2Z A;  5LEJ A;  3GX4 X;  4A2U A;  1KA8 A;  5TGT A;  3CJR B;  1W7P A;  2LC2 A;  1QQI A;  2IBD A;  1W7P D;  2ZXW H;  1FMV A;  4YIR X;  1QGP A;  2O8K A;  3NWT A;  1KU9 A;  1FYK A;  3IC7 A;  3L1P A;  4RLQ A;  3V42 A;  1BW5 A;  1TW3 A;  3B73 A;  2LP0 A;  4KJZ A;  2YUS A;  1PUF B;  3K9T A;  4A5M A;  1QBJ A;  3RKW A;  1BA5 A;  3ZGK A;  5FGM A;  4AVZ A;  3C1D A;  2LF8 A;  4L9J A;  5D4R A;  3ZPL A;  4S04 A;  3VDX A;  3OOU A;  2DBB A;  4O6J A;  1F1Z A;  3ZQI A;  3QU6 A;  5IYD J;  2B9S A;  4FE7 A;  1TWA J;  4A3E J;  1WCM J;  2Q0O A;  4E7I A;  2OCC H;  2L02 A;  1T98 A;  2F5V A;  2F5C A;  3E3V A;  4A6D A;  4CCN A;  1W0T A;  3BTL A;  2ZBK A;  2JVH A;  4IO9 F;  3RPU A;  5FKL A;  2BVM A;  3K1P A;  3RJP A;  5FB2 A;  2DA3 A;  2M34 A;  3H5A A;  4G6D A;  5K5Q A;  3HOW J;  2F5D A;  3QU3 A;  4II2 A;  4BBR J;  3T5X A;  3HL2 A;  1WJB A;  2L0K A;  2P81 A;  3S3M A;  2V1U A;  3GTG J;  1H0M A;  1X2M A;  2IS4 A;  3OL3 A;  3FM3 A;  2V9P A;  3ASO H;  4X1E A;  2STW A;  1QHH D;  1TT0 A;  3OYI A;  2K4B A;  4A0Z A;  2M87 A;  2HYG D;  2FX0 A;  2UXX A;  2VQL A;  3DQV C;  1FPQ A;  4LIV A;  2DK5 A;  4RS8 A;  3F8M A;  2LTP A;  3JRH A;  1SFU A;  1J59 A;  1FYM A;  1XDU A;  4TV7 A;  4E7K A;  1JKQ C;  2GWR A;  2GBY A;  1T8I A;  2BHZ A;  1JT0 A;  2XPU A;  5B1B H;  2R5Y A;  3MVP A;  4BQO A;  4FQG A;  2FXA A;  3LWF A;  3Q0V A;  5C44 J;  2E7X A;  3JRA A;  1SMT A;  2HS5 A;  3KEO A;  4AID A;  3E5U A;  3GEZ A;  3E5X A;  4M3F A;  2H6C A;  4G7H F;  1FT9 A;  4IVN A;  1HXD A;  4I0A A;  4AM3 A;  2CW8 A;  5GAG J;  2LD5 A;  1SVO A;  3ONQ A;  2QQ8 A;  4QSH A;  3KCC A;  4LMY A;  1WH7 A;  5CPR B;  5HS8 A;  4GCV A;  2XAF A;  2IRF G;  1OKR A;  3QP6 A;  1MD0 A;  2VPR A;  4ESJ A;  4ESB A;  3J7A Y;  2E1N A;  2ETH A;  3K4J A;  1BR4 A;  3L7W A;  1PP8 F;  5IT9 Z;  2QEX I;  4HV5 A;  3LOC A;  3HOS A;  2UWM A;  3KFW X;  4B47 A;  3BR6 A;  2HVR A;  2KP6 A;  3S3N A;  4Y52 J;  3G4S I;  2GXA A;  4IHX A;  1LVA A;  2O5R A;  3H35 A;  4MEY F;  3DLA A;  4BL0 B;  4BE0 A;  2RNG A;  3QOE A;  1E17 A;  3DU6 A;  2OD5 A;  2P4W A;  3ZQ7 A;  3MZH A;  3TP0 A;  4J01 A;  2A07 F;  4IHS A;  2KJC A;  1U6G A;  4NBQ A;  1OJL A;  2VL8 A;  2KL4 A;  4EJW A;  3JSO A;  4HDU A;  3T1B A;  3J7A O;  3ERE D;  4JP0 A;  2V4J C;  3SJM A;  5KK1 A;  5CVU A;  1XG1 A;  2HXO A;  3C7J A;  1U0J A;  3CCS I;  2L54 A;  4C9Y A;  1EKE A;  1W1W E;  2R7W A;  1XGN A;  1WKM A;  2ADU A;  1QU3 A;  1SD5 A;  5F6F A;  4I01 A;  1JT6 A;  5TJJ A;  4D1Q A;  3N4M A;  4WXC A;  2F4O B;  3S8P A;  2DXI A;  3QPH A;  2D5V A;  3SEQ A;  5E3O A;  3OL4 A;  5J40 A;  2HWV A;  2DMQ A;  3CUQ A;  3RQ4 A;  2UUZ A;  4G6T B;  2CQQ A;  1S6L A;  3I71 A;  1K61 A;  2IPQ X;  4EM0 B;  1TNS A;  2MYS A;  3CMM A;  3IAM 2;  2R7S A;  3LSJ A;  3JW4 A;  1O4X A;  1FTZ A;  3KIO A;  3KP3 A;  2YPR A;  2K9L A;  1U8R A;  2IW5 A;  3ECO A;  4U87 A;  4UV9 A;  2UXN A;  4DYQ A;  4Y17 A;  1RR8 C;  1UG2 A;  1USS A;  4HOB A;  4II3 A;  2H27 A;  3PJR A;  1S7E A;  3IAS 2;  4KFC A;  4BEH B;  5DM7 F;  3HOT A;  4BJT A;  3B6A A;  1M1E B;  3IHU A;  2E1C A;  3HRT A;  3L2R A;  2LSO A;  4HQE A;  1YOV B;  2JZY A;  3A2K A;  4KT5 C;  2IXS A;  4HF2 A;  2EFN A;  2IGM A;  5J6X A;  4EQQ A;  4XIC A;  4XLC A;  5CVV A;  3IKV A;  1JJ6 C;  2MD5 A;  3PSI A;  2IEK A;  1W5C C;  5LGN A;  2PEX A;  1DPR A;  2EJR A;  2JT1 A;  1VQM I;  1BM9 A;  4L9V A;  1LFB A;  4AYB A;  4MO7 A;  4BE2 A;  2XPV A;  3ZMU A;  2EIK H;  1I5Z A;  5FD6 A;  4HNT A;  1K4S A;  4XMY A;  4I7H A;  3AG2 H;  2OQR A;  4UB8 C;  3H9G A;  2N8G A;  3C2H A;  3PIP F;  2NOJ B;  4A69 C;  4XQF A;  4F91 B;  1Z1D A;  1MMG A;  3NWS A;  1ERD A;  1CGP A;  3CDH A;  5F0C A;  3Q5F A;  3PNT A;  2OJE D;  2ICW G;  5HS7 A;  2JQ7 A;  2VC1 A;  1VQO I;  3OIQ A;  3Q9S A;  4KA4 A;  2ZFW A;  4MFD A;  5E3N A;  2BY0 A;  3V7C A;  1ZGA A;  3PM1 A;  1WFX A;  1KU7 A;  2NXN B;  2QQB A;  2M30 A;  3ABU A;  3BG7 A;  3BLY A;  1LUJ B;  2HR3 A;  4GYI A;  3A01 A;  5E20 A;  4A5N A;  3GFJ A;  3VYU B;  3PSF A;  3NAR A;  5H6R A;  2X0L A;  4LK0 F;  4HSR A;  4Q4Z F;  1B4A A;  5LBQ A;  3DXJ F;  2LRD A;  2ZXJ A;  1I3Q J;  2XB0 X;  4A12 A;  5JR3 A;  1UST A;  4BY7 J;  2H1K A;  1D3Y A;  1BBY A;  5J8F A;  2R7U A;  2R7Q A;  1MDM A;  3TBI A;  2Q8K A;  1G3Y A;  1JGG A;  2VIX A;  2F6C A;  2V7F A;  1FBS A;  1KQ0 A;  1Y8Q B;  3A4C A;  1JKP C;  1BI2 A;  4DJA A;  4M73 A;  4BXX J;  2MW8 A;  4F93 B;  1JGS A;  3LL7 A;  4FE4 A;  3U9G A;  1HOM A;  1LB2 A;  3CMY A;  2PFB A;  1ZHF A;  2RN7 A;  2JA8 J;  4PCQ A;  1R6R A;  3VB2 A;  3VEP A;  5DM6 F;  1OR7 A;  2XF7 A;  2WB1 A;  3WGG A;  2AHQ A;  3WTY C;  4MTD A;  2ZC2 A;  2FE3 A;  2HQ5 A;  2FQ3 A;  3WGI A;  4BQA A;  4G7O F;  1NTC A;  1S29 A;  1MJB A;  2NYX A;  3K4L A;  4GGG A;  2ECC A;  5J1U A;  2Z9O A;  4UVB A;  3PO2 J;  1QZE A;  1D0Z A;  1R7J A;  3ZRG A;  2MFZ A;  2W1O A;  3L2V A;  3ZMD A;  1LEB A;  2VOP A;  4BQQ A;  4Z6Y A;  1MBK A;  2HTJ A;  2KIM A;  3ZR8 X;  1FP1 D;  5J1Y A;  4I6Z A;  3QWL A;  2WC2 A;  1AOY A;  3L9F A;  1KU3 A;  4XON A;  3FK7 A;  1R5I D;  2WY8 Q;  3IUO A;  1DUX C;  1X1D A;  4IHW A;  3HUG B;  1G59 A;  3K1M A;  2XRO A;  2DT7 B;  1XMA A;  1O7F A;  2HYJ A;  4MNU A;  2HU9 A;  4RM2 A;  3M3Y J;  3ULQ B;  2RKH A;  2X51 A;  3I64 A;  3G3Z A;  2L9R A;  2ZB9 A;  3U1K A;  1EF4 A;  2LMD A;  1B1B A;  2YX4 A;  3OYC A;  1I27 A;  2X6Y A;  2DFF A;  2MC4 A;  2BEO A;  4OIP F;  1YIT I;  4PJL A;  3GTJ J;  2PBI A;  4E7S A;  3LSK A;  4CH7 A;  3JRF A;  3IRR A;  1LQ1 A;  1Z7U A;  5E1W A;  3J80 K;  2VQH A;  1P2F A;  1UJ8 A;  4N4N B;  3DTI A;  2JUC A;  4AUX A;  2NAZ A;  2Z16 A;  3LSM A;  1DU6 A;  3HM5 A;  4OIR F;  1EH7 A;  5GP9 A;  3N05 A;  3DBH B;  1TWH J;  3OR2 C;  3S16 J;  3FIW A;  3DWL E;  1T6S A;  3F72 A;  4D9J A;  2CV2 A;  3H9J A;  3TGN A;  2JA6 J;  1FLI A;  1O3T A;  2VQC A;  2GXB A;  1IRG A;  1OYY A;  4BDZ A;  1S9H A;  4V2F A;  2F4I A;  1UHS A;  4LG0 B;  1D1C A;  3LQQ A;  4Y15 A;  1XX5 A;  1P7I A;  3IRQ A;  4XR6 A;  2XSJ C;  1QVU A;  3CCQ I;  1J5Y A;  2L9N A;  1XSX A;  2VOO A;  4CSW A;  2JVG A;  1D0Y A;  1ETX A;  4CA0 A;  2XPW A;  1RPW A;  4C2T A;  1KZH A;  1VQ4 I;  1MJA A;  2KDZ A;  5EGO A;  1CF7 B;  2XGC A;  3D5S C;  1B59 A;  1O3Q A;  4P55 A;  3OS2 A;  3VYR B;  3ML6 A;  4A3I J;  2VKV A;  3EYY A;  2NVX J;  1J75 A;  3K70 C;  2XKO A;  1G8X A;  1R00 A;  1X3U A;  1OCT C;  2OTL I;  1N78 A;  2R7X A;  4S0H B;  3V7R A;  2ZXI A;  1V5F A;  2DA4 A;  4BAY A;  2ISY A;  3X2Q H;  1FWZ A;  4HQM A;  4XN3 A;  3FXK A;  4GFB A;  3AG1 H;  4N9I A;  3RKY A;  1IV8 A;  2DTR A;  2QBY A;  2PQ8 A;  2QLZ A;  1H9T A;  1FIA A;  1JHF A;  3BG3 A;  5AIP A;  2R92 J;  4IRG A;  4P1W A;  4RB0 A;  2ELJ A;  3J81 Z;  5J8C A;  1BN5 A;  1MMN A;  4HW0 A;  4C2U A;  5EEA A;  3BR0 A;  3M07 A;  2J5P A;  3K4C A;  4FCY A;  3I0T A;  1X4O A;  2MGQ A;  1KQ9 A;  5AIQ A;  5JHF A;  2NVQ J;  3K70 D;  3OYG A;  2IGK A;  3F23 A;  3VOE A;  4XRS G;  1ETK A;  2FBH A;  1ZK8 A;  3R4K A;  4ASN A;  3F6O A;  1S72 I;  2OZ6 A;  5FFZ A;  3DKX A;  5H20 A;  5LGT A;  2D1H A;  1OCO H;  2LKP A;  3V8J A;  1R5G A;  2XB5 A;  4XLH A;  2HXI A;  1K79 A;  3KEQ A;  2Z2S B;  3KYD B;  4MQ9 F;  1LVK A;  1YFH A;  2PMZ N;  4QWQ A;  1A6I A;  3CCE I;  2RV8 A;  4JK1 X;  4PSX A;  2CUF A;  2DJI A;  1XGM A;  1BI1 A;  3GLL A;  1H88 C;  3OSG A;  1ETO A;  2K7L A;  5IYC J;  4LJZ F;  3VSK A;  4CO8 A;  3WTU C;  1KYZ A;  5D5W B;  3W2V A;  1C0W A;  2Y30 A;  3UR3 C;  5EF6 A;  2V79 A;  3M8J A;  2R3S A;  1HKS A;  4D5C A;  2CQX A;  2DQL A;  4EAT A;  2X1E A;  3I53 A;  1ON2 A;  2JPB A;  3BC8 A;  2P8T A;  2G7H A;  2NNY A;  2R7F A;  3QYB A;  5HNH A;  3PIO F;  3L09 A;  4E7J A;  1ETY A;  2DA5 A;  2QWW A;  1P6R A;  1R49 A;  2CUE A;  2P5V A;  5D4S A;  1Z91 A;  1K78 A;  3CDL A;  3OY9 A;  3EPZ A;  2CRG A;  1WGX A;  3K7A J;  1REP C;  3GYH X;  2KPM A;  3ASN H;  1FBQ A;  2JJ7 A;  4BHC A;  2R7V A;  2KRC A;  2PMH A;  1F36 A;  1J0R A;  4HPQ A;  5B5E C;  3EUK L;  3P9C A;  1WRJ A;  2P7V B;  2VBX A;  3UNG C;  3K0L A;  2H8R A;  3DPT A;  3DEU A;  5J1R A;  4C2M J;  3CO6 C;  2NVT J;  1ACI A;  3FHZ A;  3BQZ A;  4EGZ A;  4UVC A;  3LAP A;  1HCR A;  3BWG A;  4BH9 A;  5L3D A;  2NVY J;  2CMP A;  2VAS A;  3PQK A;  2OC6 A;  1H9G A;  3BJO A;  3HPG A;  2HPI A;  3HJE A;  4U0V A;  4P9U A;  4KIS A;  2HOS A;  2VBZ A;  3AKZ A;  4CCK A;  2E2H J;  3F9K A;  3I54 A;  3F0C A;  4KIB A;  3PO3 J;  2ME0 A;  2BW3 B;  2LLK A;  2LR8 A;  1BIB A;  1QHG A;  4LIU A;  2RC4 A;  5FKK A;  3O8H A;  3ZQQ A;  1VQN I;  3KZY A;  1RNL A;  3A1Y A;  1JJ8 C;  3BPX A;  2P6T A;  1YLF A;  1A04 A;  4UV8 A;  3T8T A;  1ZEL A;  5K7F A;  1ON1 A;  3TL4 X;  1W7P B;  3TO9 A;  3FMR A;  3E6B A;  4XRM A;  1R9T J;  3Q0W A;  3JRC A;  2VLA A;  1Z3X A;  5E18 F;  2QF7 A;  3BZK A;  5EEH A;  1QA6 A;  3DU5 A;  2BXZ A;  4CIC A;  5C3E J;  2K9N A;  2BOL A;  1IG7 A;  1R5H A;  4DNC A;  3OYD A;  4DBR A;  2WAQ A;  1SD4 A;  1Z3Y A;  5DUI A;  2M2E A;  1MW7 A;  4I0B A;  1U8B A;  4DW6 A;  2EB7 A;  2V1D A;  2M7A A;  4HLY A;  1D5Y A;  1TWC J;  1TLH B;  1HKT A;  2IGO A;  5IT9 K;  1JXS A;  2E36 A;  3IWF A;  5KAF C;  4M3D A;  4RGU A;  3IL2 A;  1ZTR A;  3GME A;  2XDV A;  4FHT A;  3BR1 A;  2E7W A;  1BI0 A;  2X1C A;  1BC8 C;  1G2H A;  2A68 F;  1SVM A;  1OIS A;  3IH4 A;  4P5O A;  5ILS A;  5LHH A;  3ZQC A;  2A69 F;  2M4K A;  4A3G J;  4CYC A;  2OCE A;  5F08 A;  4JX4 A;  1LPQ A;  2HKX A;  1H89 C;  1B72 B;  1DDN A;  3BTC A;  4M9Z A;  3QPT A;  1IJW C;  1EJ9 A;  3S17 J;  2H09 A;  4K2E A;  2ID3 A;  4YFK F;  4A3K J;  2KJB A;  3L00 A;  3BR2 A;  4EV0 A;  2F2E A;  3LSR A;  2DFI A;  2BVL A;  2DN0 A;  4IZZ A;  3HZJ A;  2VE8 A;  3FXQ A;  1MMS A;  1G3W A;  3COA C;  1UHW A;  3U1D A;  1YRN A;  3DBR B;  2DMT A;  5KNL A;  2VPL A;  2X4H A;  2DYR H;  3SFZ A;  3VYS B;  2M9H A;  4A0X A;  1ZQ3 P;  1JTX A;  4RGS A;  2FNP A;  3QOD A;  5FRO A;  3BT9 A;  1LKX A;  2RRE A;  3TKY A;  3PFY A;  4HV6 A;  3G6E I;  4XK4 A;  2ZJP F;  3FMQ A;  1YS6 A;  3TO7 A;  4LLL A;  1U3E M;  2CW0 F;  3QPL A;  1ZAR A;  3K4K A;  1FJL A;  2QBY B;  3GFM A;  3I58 A;  2EV0 A;  1I1G A;  4BKX A;  2MSY A;  2FOW A;  5E79 C;  1MBH A;  5GTH C;  3Q9V A;  3B02 A;  2CFO A;  3MKY B;  1DU0 A;  1U5T A;  4D7M A;  4YG2 F;  1ZG5 A;  3ELK A;  1TP4 A;  3S32 A;  3MKW B;  4D7N A;  3P9I A;  3H3V K;  2FJ1 A;  5D8K B;  4A0Y A;  2L5Q A;  1E3H A;  3EYI A;  3W6V A;  1MND A;  1BI3 A;  3EUH A;  4OAZ A;  5DV5 A;  3ZQG A;  3CQZ J;  3SEZ A;  1U2W A;  1F43 A;  3MD2 A;  2GA2 A;  1XMK A;  4ITV A;  1YG2 A;  3KPH A;  2FA5 A;  2VI6 A;  3D0S A;  3KP4 A;  2CQK A;  4YII A;  2R7R A;  4XLP F;  4HF0 A;  4ENM A;  2VBY A;  4XKW A;  1FOY A;  2EA2 A;  3E6C C;  1S5L C;  4YRV A;  1O57 A;  1HKQ A;  1FP2 A;  2FMY A;  4ENK A;  4XLA A;  2V9K A;  3A01 B;  4OWR B;  3CD6 I;  3TOA A;  1RES A;  2TRT A;  1QNT A;  2BGC A;  1NHA A;  1V5E A;  1S3J A;  2VXD A;  1NK3 P;  2DYS H;  5B3S H;  2DPU A;  2BYV E;  1GHC A;  2X6W A;  1G3T A;  5EEG A;  3ISP A;  3WG7 H;  3MCZ A;  2XAS A;  3W6K B;  4AVP A;  5DCM A;  2GOX B;  1ZH5 A;  3MMY B;  1XTA A;  5CVR A;  2ZJ2 A;  2HZT A;  5JVT A;  3O6B B;  1MDM B;  3KP2 A;  4UB6 C;  3AFH A;  4XBF A;  3S93 A;  4BHB A;  2KZV A;  1R71 A;  4Q47 A;  1TT5 B;  3WU1 B;  1P4X A;  2K4J A;  3IV5 A;  1X1C A;  5LRS A;  2XSD C;  4AU7 A;  2PG4 A;  1RKW A;  3O2P E;  2ZSH B;  4V19 K;  3Q0U A;  4XKV A;  3ZMT A;  1YW9 A;  2MH9 A;  2ZME A;  4Y4R A;  1HDD C;  1A36 A;  2QSG X;  3SYT A;  4ZTJ A;  3JRD A;  2HEO A;  1V5G A;  1RKT A;  4AD9 A;  2Y75 A;  1R23 A;  4LG3 A;  1R1U A;  1BW6 A;  5E1Z B;  2HOT A;  1VQP I;  4NHJ A;  1D5V A;  3CJT B;  3HPH A;  3ROU A;  2LBF B;  2ZJQ F;  1UFM A;  4A93 J;  5GPA A;  2VB6 A;  3ZOB A;  4HX7 A;  3FDY A;  5ICC A;  3L2U A;  3JAM Z;  3GTQ J;  4KNY A;  5FJ8 J;  2ESH A;  1XD7 A;  2MAB A;  1XCB A;  3RIR A;  4DYR A;  4RM3 A;  1T38 A;  4XM3 A;  1Z21 A;  2DJN A;  3QOP A;  1X1A A;  5IYB J;  5IPA A;  4N0B A;  4ZYD A;  1O3R A;  2LRE A;  2HDW A;  3S15 J;  4A3L J;  3V8L A;  1GXQ A;  2W24 A;  2HYF A;  2K27 A;  2VJJ A;  3WTS C;  4IQJ A;  1ZLJ A;  2CW7 A;  2L3D A;  5E8G A;  3SQN A;  2ECB A;  1W5T A;  3BP8 A;  4I98 B;  3L2Q A;  1ZN2 A;  3OS1 A;  1IN7 A;  3K1N A;  4ESF A;  3LQR A;  2LH9 A;  3FX3 A;  4U7D A;  2Z5U A;  2DQR A;  2A6E F;  4C3I J;  3WTT C;  1RUN A;  5FFX A;  2M3A A;  1ZKG A;  3ZMV A;  2Z99 A;  4MEX F;  1ZRC A;  3CUO A;  3SFI A;  4XRF A;  2CH0 A;  1T08 B;  2V1X A;  3V4G A;  4RB1 A;  1YTY A;  2VUM J;  3J7Z I;  2V9V A;  2ELK A;  3CCR I;  2RAE A;  3J81 K;  4BE1 A;  2GOM A;  1T39 A;  3BCB A;  1ZG3 A;  1HA8 A;  1ZR4 A;  4L5E A;  1YS7 A;  1TZL A;  2QQ9 A;  3FBN B;  4A3C J;  3HOZ J;  2LOO A;  3CC7 I;  1X1P A;  3OYN A;  3RQI A;  5HOD A;  1QO0 D;  1V54 H;  3FIS A;  1ETW A;  4NC8 A;  2E1M C;  2NRA C;  3LSI A;  2XUB A;  4PGG A;  5L3F A;  3H0D A;  4XLE A;  1I6X A;  1E2X A;  2JWT A;  4QIW N;  2DT5 A;  1V3F A;  4S05 A;  2VON A;  4V2G A;  3A03 A;  3HRM A;  3JR9 A;  2BZT A;  3KZZ A;  1K7A A;  2OF7 A;  4CDG A;  4CYC B;  2GIV A;  2E1O A;  5FLX K;  1S7A A;  4E7H A;  3BJA A;  1ETV A;  5D5U B;  4BGD A;  1R58 A;  2AO9 A;  2MC3 A;  1D1A A;  2DFE A;  5F27 A;  3SHF A;  4DZJ A;  2JK3 A;  1Z05 A;  4MFE A;  1LNW A;  2EIN H;  5K1Y A;  3S1N J;  2IS6 A;  3CZ6 A;  2CUZ A;  5D5X B;  1VTN C;  1JKO C;  4G7Z F;  3DEE A;  4NNJ A;  2E2I J;  2EBI A;  1TW2 A;  3F8B A;  1N75 A;  3CCM I;  3F8N A;  2FU4 A;  4LB5 A;  2IT0 A;  4B4C A;  2CFX A;  2L7F P;  2HVQ A;  5TIS C;  1IC8 A;  2AQF A;  2FQ4 A;  2KKO A;  3TP3 A;  5IOY A;  1VZ0 A;  2PI0 A;  2XGD A;  1IXS B;  1BOB A;  2D2W A;  2IA2 A;  4M6V A;  3RCO A;  1AWC A;  2G9W A;  3WGH A;  3BCA A;  1Z6T A;  1LDJ A;  3JTG A;  2BXY A;  2A5W A;  4IXA A;  3V8K A;  1MH3 A;  3J80 Z;  3CTA A;  5D6E A;  1IAW A;  4UXN A;  4M3E A;  3M1E A;  4XRS A;  5JI6 A;  3AAF A;  4WXD A;  2CQN A;  5KVR A;  4NQW B;  5EG0 A;  1J7K A;  1MIJ A;  4IL6 C;  1YI2 I;  2VOD A;  1HW5 A;  2VKD A;  3H5R A;  2GQQ A;  4ZZL A;  3FXO A;  4PUS A;  2Y48 A;  2O03 A;  3D1N I;  2XHK A;  3K69 A;  3ZN1 A;  3CLO A;  1MMA A;  2L7Z A;  3LFK A;  3FHN A;  5E3L A;  2DA1 A;  4RAZ A;  4BDY A;  2OU2 A;  4E70 A;  3GFI A;  4FX4 A;  1I39 A;  3GO5 A;  2IGN A;  1MZB A;  4WCG A;  2GZW A;  3W6J B;  2O7O A;  4XOP A;  2B0L A;  4UUV A;  2F5E A;  3A0H C;  2W82 A;  2P7C B;  3ZN0 A;  3WU0 A;  3CC2 I;  2Z33 A;  1K83 J;  2ZXH A;  3PL8 A;  1PYV A;  3M8F A;  1HC8 A;  2XRL A;  1IXR C;  4KMF A;  4FAS D;  3OYJ A;  4WXH A;  2WB1 N;  2DO7 A;  4R79 A;  2DAO A;  1V4R A;  3HYI A;  1XSV A;  4A3F J;  3W2W A;  1D1B A;  3K2A A;  3PQJ A;  5B1A H;  2OTJ I;  4KIF A;  3G71 I;  4FT8 A;  2HTS A;  4CYD A;  3R0A A;  4YFN F;  2GM4 A;  3CME I;  1ZRF A;  4DBQ A;  4NDL A;  5GTI C;  3K6G A;  3MEX A;  5DCM B;  2DOA A;  3PNY A;  2VE9 A;  3RKQ A;  1YJW I;  1ZLK A;  4L0Y B;  3F3X A;  4XOT A;  2F48 A;  3OR1 C;  2JPC A;  2X1D A;  2PJP A;  2DU9 A;  2K3P A;  1IRX A;  3SZT A;  3F8F A;  3QAH A;  1A35 A;  4IHT A;  2V1N A;  2DDA A;  2Q1Z B;  1W36 D;  4IEJ A;  3HB9 A;  5J47 A;  1BOA A;  2D1V A;  1R1V A;  3DCF A;  1WJE A;  2AQE A;  4A3J J;  1BJA A;  3JRG A;  2DA6 A;  3I4M J;  3FXU A;  2XAJ A;  4R1H A;  1ENH A;  1K6Y A;  3DV8 A;  4IOC F;  3KET A;  1AKH B;  1WJA A;  2Q2E B;  2JN6 A;  1R36 A;  4L5I A;  4AC0 A;  1NH3 A;  4HNV A;  2LBF A;  3AL0 C;  2VC0 A;  1ZAO A;  4ZDP A;  4BXU A;  4CGZ A;  3BZC A;  3G1M A;  3P5J A;  4LG0 A;  3WTZ A;  4C3J J;  3QRF F;  1F4K A;  1IN4 A;  2ZFU A;  1OQY A;  2R93 J;  1MKM A;  4UUT A;  2HZD A;  4HDV A;  1XPX A;  5HNF A;  5BPD A;  2FUG 2;  2G7U A;  5FRM A;  2O61 A;  2ESN A;  4HEA 2;  2EIJ H;  3AG3 H;  3KEY A;  2JA7 J;  3BQY A;  4EMS A;  2JTV A;  2K86 A;  5IT3 A;  3E5Q A;  3OYK A;  4AIJ A;  4L18 B;  2L2O A;  4MQV A;  2EZK A;  3KZI C;  5HLH A;  2BW3 A;  3H9Q A;  1PVE A;  1YQA A;  1YYV A;  2W48 A;  2QVO A;  2FD5 A;  3M9A A;  1X58 A;  4UVA A;  4NC6 A;  2RQP A;  4H0E A;  1LJ9 A;  1MSE C;  2EPF A;  3HTS B;  2RVC A;  2ZKZ A;  2COM A;  1D8J A;  2Y0S N;  2KDO A;  1B6A A;  5HLI A;  2QEN A;  5M3M J;  5DD4 A;  3QYF A;  3O8G A;  4KN4 X;  2NS7 A;  5BS6 A;  1MNM C;  1EA3 A;  2DOF A;  2XAQ A;  1MMD A;  2VKE A;  5HDN A;  1FYL A;  4MIM A;  3L2C A;  2CU7 A;  3LSG A;  3JAM K;  3RZD J;  2F5F A;  1B9N A;  3BJ6 A;  1GXP A;  1IN5 A;  4B43 A;  1Y8R B;  1I1S A;  3KE2 A;  3ZQF A;  2E60 A;  3I3L A;  2QKM B;  3P7N A;  4RA2 A;  4LK1 F;  2E2J J;  2GAU A;  1FY7 A;  3MAJ A;  5K7Z A;  1YE9 A;  2TDX A;  2XVC A;  1BR1 A;  1SAX A;  5BMZ A;  4EJU A;  2M8E A;  4RB3 C;  5LEK A;  5CYV A;  3OV8 A;  4M74 A;  2K5C A;  4PSW A;  4X6A J;  1FBU A;  4A3M J;  3GTL J;  4B1R A;  4D5F A;  4E7Z A;  3HDD A;  2A6T A;  2Y69 H;  4CHU A;  2WV0 A;  2E19 A;  1Y1V J;  3JRB A;  4WK8 F;  3HRU A;  2QGU A;  3IH2 A;  2ID6 A;  2OPT A;  1OFC X;  3DBL B;  4GDF A;  4KIC A;  3HRS A;  3F6V A;  1F9N A;  3R61 A;  4P9F A;  2RQQ A;  3DP7 A;  4E4H A;  2H1L A;  3DF8 A;  5EZG A;  1T2K A;  1VQL I;  1AA7 A;  2DMP A;  2DFH A;  5DD8 A;  4UUS B;  1DGR M;  1GVJ A;  2M1B A;  2DOD A;  4MGR A;  1PDN C;  1W0U A;  1OYW A;  3HBL A;  1BC7 C;  4IOA F;  2LY2 A;  1MSF C;  4BU2 A;  4PJN A;  3I59 B;  3CMA I;  4HG2 A;  3GUD A;  3OMY A;  3WTV C;  3IKT A;  2FOK A;  4W1U A;  1I3A A;  3ABT A;  1APL C;  2YSR A;  1HBX G;  4KIT B;  2O9L A;  4IKF A;  2GA1 A;  2X6X A;  1JKR C;  2EH3 A;  3B6C A;  1E3O C;  1IV6 A;  1X1B A;  2E71 A;  4HST A;  1K6O A;  1VQ7 I;  2COB A;  2NNN A;  3W3C A;  5JLW A;  3GTP J;  5J3L A;  3VYT B;  5ED4 A;  5BOX A;  2R7T A;  3FMS A;  4N9H A;  3JRI A;  2KIF A;  3LST A;  5F0F A;  1Y0U A;  5FKO A;  3JTH A;  3SDG A;  1UG0 A;  4QTR A;  4AIK A;  4OU0 A;  3HKZ A;  4DGW B;  2KRH A;  2XAG A;  3CCL I;  3DPU A;  1VND A;  3CCJ I;  1ZR2 A;  1OLT A;  1L3L A;  2XC7 A;  4ZTF A;  3BOQ A;  3KX2 A;  3HG9 A;  4O3M A;  2BV6 A;  2ZSI B;  4IPA A;  1BIA A;  4M3G A;  3OSF A;  4MLO A;  3G73 A;  1YW7 A;  4H4K C;  2X48 A;  3ZCO A;  3I4P A;  3S1Q J;  4I09 A;  1DGW Y;  2Y2Z A;  4OIN F;  2XRN A;  2PMZ A;  3HGY A;  2W84 A;  3W2A A;  5FO5 A;  3DFG A;  3P9K A;  1JUM A;  1RR7 A;  5H6Q A;  3OIO A;  1U9N A;  1KYW A;  3QP5 A;  2XF6 A;  3PNV A;  1UCR A;  3G2B A;  4F52 A;  4L5J A;  1I50 J;  3GCM A;  3LA7 A;  4J19 A;  2H8W A;  2XAU A;  3NQO A;  4RGR A;  2EQR A;  2FF4 A;  3KYL A;  1X19 A;  2WWY A;  2R7Z J;  1TL8 A;  1MH4 A;  2DI3 A;  4OAY A;  2ZME B;  4KT6 A;  4XN0 A;  3C2B A;  5J4V A;  2KZG A;  4FET A;  3L2W A;  2KIQ A;  1FZP B;  4O5V A;  2GLO A;  3DEW A;  2JSC A;  3FXJ A;  5DYM A;  1MBF A;  2AXL A;  4L0Z B;  5KAI C;  3GBG A;  1NG7 A;  5M5W J;  3KP5 A;  1WPK A;  4BBS J;  2M8G X;  2EV5 A;  1T56 A;  2O3F A;  4F7Z A;  5F64 A;  2DMN A;  1AKH A;  3VPR A;  2Q2E A;  3G1L A;  3HHH A;  4EM1 A;  5FRN A;  2QQA A;  1B72 A;  4HX8 A;  2R4G A;  2E5N A;  1DQU A;  9ANT A;  1CQT A;  1IO2 A;  3GW2 A;  3LMM A;  2R7D A;  5E8I A;  2X6O A;  3BRO A;  4OIQ F;  4JX6 A;  2VXZ A;  5FLV A;  2WTE A;  1WVR A;  2MLK A;  2VJ5 A;  1TQM A;  2FSW A;  1HQC A;  1OCR H;  2V6C A;  4ZYA A;  5J4Y A;  1VQ5 I;  2LKX A;  3F21 A;  4A3D J;  1DP7 P;  5F04 A;  1GT0 C;  2KFD A;  2WAQ N;  3SZG A;  4XKB A;  1YRN B;  2R7O A;  3ECH A;  3C2G A;  2ZME C;  3SZP A;  1LE8 A;  3FXM A;  1ZRD A;  2BHY A;  3FXR A;  4LFU A;  2BY2 A;  2EK5 A;  1FIP A;  2Z3Y A;  3DPL C;  4HA8 A;  4A6E A;  2DK8 A;  2CV0 A;  3E1S A;  1SD6 A;  3GF2 A;  3CF5 F;  1IRZ A;  1A6Q A;  2HVS A;  3BR5 A;  1Y39 A;  3EQL F;  4JYK A;  4ZC3 A;  2B63 J;  2KHM A;  5FD5 A;  5EDN A;  5JFR A;  3M1C A;  6PAX A;  1UAA A;  3I5U A;  3RPU D;  2HQA A;  3EUA A;  1QZY A;  2KQR A;  2QUF A;  3DKY A;  3PFI A;  3TDU C;  3BY6 A;  3WHC A;  1UZC A;  4RAF A;  3S14 J;  1LDK B;  1J2X A;  3S2D J;  2HNH A;  2EA4 A;  2I8D A;  3SXY A;  3CLQ A;  2LG4 A;  2LYC A;  1U5T B;  2VBW A;  4WWC A;  2K9S A;  3S1M J;  1MBG A;  5F0H A;  3BTJ A;  5E1X A;  4ZZD A;  1TNT A;  2EZL A;  3TW7 A;  1WWX A;  2HDC A;  1SFE A;  2FRH A;  3RPQ A;  4PFO A;  3WE3 A;  2EFP A;  1RC9 A;  1IN6 A;  2YU3 A;  2P0W A;  1XCV A;  2AXT C;  2KLO A;  2O0Y A;  2QYO A;  5ICE A;  2X9D A;  1XSD A;  3DKW A;  1RUO A;  2HDD A;  2K02 A;  2VJI A;  3RI4 A;  3VFZ A;  4Z2Y A;  1XN7 A;  3ZMZ A;  4LIT A;  1SFK A;  2LY9 A;  2XGE A;  3KYC B;  4HLX A;  2E34 A;  1T0F C;  3WOD F;  1K4T A;  2IA0 A;  2WAD A;  4M9X A;  1LFU P;  3HTU A;  2Y0M A;  4PGH A;  5HOO A;  2HI3 A;  3EET A;  4CZC A;  4R8H A;  1SAN A;  1IW7 F;  1S8N A;  1U5T C;  2WAF A;  4B09 A;  3OYL A;  2FEZ A;  3HC7 A;  2M45 A;  5ICG A;  2VJ4 A;  3GZN B;  4IHV A;  5JVG F;  5L3E A;  1UB9 A;  3OIP A;  1FTT A;  2EIL H;  3CJN A;  2LK2 A;  1YW8 A;  5DTD A;  2NOG A;  1YHQ I;  4XKC A;  2R5Y B;  2A61 A;  1G6N A;  1R22 A;  4BY1 J;  1Q1V A;  3KLO A;  2WY7 Q;  3KP7 A;  5L3B A;  3BPV A;  1DPU A;  2UV1 A;  1YO5 C;  5DEQ A;  2ME6 A;  2DPD A;  1X4P A;  2I10 A;  4UUS A;  4E6K G;  3HSF A;  2M7B A;  1KQ8 A;  4PDK A;  1X3W B;  2CG4 A;  5TRD A;  4ZH4 F;  5FLX Z;  4BAC A;  2L9V A;  2QSH X;  4Y7N J;  4NQW A;  5EG0 B;  5DDG A;  3HKZ N;  4EVI A;  3I59 A;  3ZP5 A;  5K5R A;  1RI7 A;  1STZ A;  3RTR A;  2OBP A;  2WV1 A;  4U88 A;  2DDB A;  5HDG A;  1N25 A;  5D8L B;  5L3G A;  1XB4 A;  3FF5 A;  2LNB A;  2VKH A;  4B44 A;  5LHG A;  1IGN A;  4WX9 A;  4RBO A;  1UHM A;  4GO1 A;  1WHU A;  2CQ7 A;  4PJ0 C;  4KMU X;  1HF0 A;  4M71 A;  5LRR A;  3HEF A;  2W85 A;  3WTX C;  1FEX A;  4IF4 A;  2KRF A;  2ZO4 A;  5D5V B;  4HF1 A;  1U9O A;  4JOM A;  1RZ4 A;  2DW4 A;  2LF7 A;  5GPC A;  3LSP A;  1KGS A;  4HNU A;  1MBJ A;  3TO6 A;  4KYW A;  2A6H F;  1BJZ A;  2IJL A;  2CWE A;  3U21 A;  2W4S A;  4U7B A;  4AIH A;  1FMW A;  3ZQL A;  3WU2 C;  3GXO A;  4OMZ A;  4F55 A;  1BR2 A;  2RNJ A;  3UKG A;  3GWZ A;  3MN2 A;  2CUJ A;  1ODD A;  1OR7 C;  4RGX A;  5GAD J;  4HX4 A;  1QPI A;  1PUF A;  2LY1 A;  2QKL B;  2DLL A;  4IX7 A;  3FXL A;  5H2F C;  2L9S A;  4QPQ A;  1ITY A;  5B66 C;  1HLV A;  4DQ2 A;  3A0B C;  2ZCW A;  2CJJ A;  2JUG A;  4BNC A;  2CGP A;  4GXO A;  2W57 A;  1MBE A;  2E5Z A;  3QPS A;  4LLN A;  5FKN A;  5M3F J;  2R5Z A;  4PJM A;  2M0M A;  1JHH A;  1WQ2 A;  4PZJ A;  2W25 A;  3HXL A;  5CLS A;  4I99 C;  1RRJ A;  3D5R C;  2DT6 A;  2MG4 A;  2CYY A;  2P6S A;  3HHG A;  1XGS A;  3FKJ A;  5IY5 H;  2DMU A;  1IDZ A;  3S3O A;  2STT A;  4Y3O A;  3MFK A;  1WJ5 A;  1L0O C;  1JE8 A;  4CXF A;  3IWZ A;  5GAH J;  3RZO J;  1HW1 A;  4NB5 A;  2UZK A;  3NAU A;  4OMY A;  1Z77 A;  1J9I A;  3CCY A;  3H92 A;  1SC7 A;  3BG5 A;  5HLG A;  1Y6I A;  2HGC A;  3MWM A;  2QM3 A;  4XID A;  4UNO A;  4J00 A;  1G3S A;  1EH8 A;  3LA3 A;  1WI9 A;  2OQG A;  1TWF J;  1YX5 A;  4B8X A;  5C4X J;  2EZH A;  3T0Y A;  1JI8 A;  3NRV A;  4QPO A;  3HOY J;  4EJT A;  2PN6 A;  4CCO A;  1W4M A;  2DTZ A;  2LVS A;  5GAE J;  3MQ0 A;  2R0Q C;  3OYA A;  3I55 I;  1GDT A;  2W00 A;  2ACJ A;  1XDS A;  3S1R J;  3GZ6 A;  3CES A;  2B7E A;  1F5T A;  3BZ6 A;  1SEU A;  5EJC A;  1FOX A;  2D45 A;  2XV4 S;  1WSU A;  2XGX A;  3BR3 A;  2IVM A;  2Y9Y A;  1ZYR F;  1T95 A;  3V7S A;  5M5Y J;  3HSE A;  3GTK J;  3D5L A;  2EV6 A;  1FSH A;  4ZYE A;  1TBX A;  2K9M A;  1Y1W J;  2QZ8 A;  4L9N A;  2VT2 A;  4CCM A;  1Z9C A;  5CVJ A;  3Q3S A;  2DA7 A;  1ULY A;  2XIG A;  1SD7 A;  1V55 H;  2ELH A;  1VQ9 I;  1Z0X A;  2JRM A;  2ISZ A;  1WJD A;  3VOD A;  2Y0S A;  5CQE A;  3M7G A;  3E97 A;  2X85 A;  1TWG J;  3CDI A;  2K9Q A;  2TCT A;  5HLT A;  3M8E A;  3H3U A;  3K4N A;  3OYM A;  3AG4 H;  1Y56 A;  1EV7 A;  4XSX F;  4CCJ A;  2DA2 A;  1Z7L A;  1N77 A;  4BXF A;  3HOV J;  3KP6 A;  1W36 C;  3BG6 A;  2GXG A;  2LFB A;  3H3Z A;  3VSL A;  4CUG A;  4I02 A;  4G9Y A;  4BQN A;  3CP2 A;  4RMN A;  1X2N A;  3HOU J;  1IUY A;  3OYH A;  1IUF A;  3H5N A;  3K4B A;  2HQR A;  3BDD A;  4M3B A;  2IS1 A;  2YR2 A;  2W7N A;  1FOK A;  1VFC A;  2J5O A;  3IH3 A;  2XKP A;  5KHD A;  5A2Q Z;  4UHT A;  4LB6 B;  4CCL A;  1E3P A;  1GLN A;  5A2Q K;  5E17 F;  2OAZ A;  1RET A;  4QLC U;  3EDP A;  2H94 A;  1OCP A;  2P5L C;  5DCF A;  1B8I B;  5LHI A;  2DCE A;  4ABZ A;  3ABL H;  3S2W A;  5ILU A;  1P9Q C;  1ZGJ A;  2IP2 A;  1IRF A;  4DZP A;  5LFA A;  2JRT A;  4RAG A;  3GLX A;  5JHU A;  4EJV A;  3OYF A;  1SMY F;  4MTE A;  4HRI A;  5JLX A;  2PMU A;  2EWN A;  4GRI A;  4B48 A;  4DIQ A;  1T0F A;  3I9V 2;  2PJR A;  3MKZ A;  3TOB A;  1FC3 A;  1XGO A;  2YS9 A;  3IP4 B;  3F22 A;  1VQ6 I;  3ZQH A;  4BEH A;  5EYR A;  1P92 A;  3S2H J;  2L4A A;  5BNG A;  1VI0 A;  4ENJ A;  4BUP A;  2CV1 A;  1NG6 A;  3OWT A;  5IP6 A;  1GUU A;  4N4O B;  3JSP A;  2KIU A;  4IRI A;  5HVQ C;  4HYE A;  3HSR A;  3J7Y J;  4BS9 A;  5AON A;  4B3A A;  1HW2 A;  1TQI A;  3TQN A;  3MZY A;  3MKL A;  3ERM A;  1WZ2 A;  3I56 I;  4RDU A;  1D0X A;  4JBA A;  5IP9 J;  4M6X A;  1FX7 A;  2G0E A;  2FNA A;  2NS0 A;  2P5K A;  1TC3 C;  4LLG F;  1SAU A;  3FK6 A;  2JSP A;  1TQP A;  4C30 A;  4AYB N;  5L3C A;  1NK2 P;  4JQF A;  4U0Y A;  4OIO F;  2PLY A;  4EEF G;  2IA1 A;  3HGG A;  4BJ6 C;  3KLN A;  5IP7 J;  3CC4 I;  3ABK H;  5CQG A;  1X3Z B;  3CJQ B;  4F3Q A;  3TMO A;  5D6F A;  4ZYG A;  4I76 A;  4D0P A;  4EJO A;  2DOE A;  4KDP A;  4P96 A;  5IOZ A;  3DTK A;  1A5J A; 
#chains in the Genus database with same CATH homology
 2RGV A;  2FBI A;  1O3S A;  3F8C A;  3T8R A;  2HKO A;  1PP7 U;  4L9T A;  2A5Y B;  3RKX A;  1OYI A;  1IXC A;  5HDK A;  5HS9 A;  2VN2 A;  4LGW A;  4FX0 A;  2EFQ A;  2O8X A;  1S7O A;  1PUE E;  2EFO A;  1IZ1 A;  3LAJ A;  4AWX B;  1OMI A;  4M9S A;  4LD5 A;  1ZG1 A;  2XAH A;  1IF1 A;  2CO5 A;  2L4M A;  4IRH A;  4HZF A;  1U78 A;  2O6G E;  1CF7 A;  2LDU A;  2FML A;  4G94 A;  4M72 A;  3N97 A;  2C6Y A;  4I2O A;  1Z6R A;  3REO A;  3R60 A;  3RYR A;  1W5S A;  2EFW A;  3CUQ C;  4RB2 C;  4KUM A;  3TDZ C;  4G8X A;  3OOP A;  2BBY A;  4Q48 A;  1EH6 A;  4CZZ A;  3E6M A;  1SFX A;  2M5W A;  3HUG A;  4KIG A;  1RIO H;  3RDI A;  5CJ9 A;  3O3K A;  1IN8 A;  4IJA A;  4HBL A;  3U2R A;  2FBK A;  4MHG A;  1HST A;  1MJ9 A;  1LEA A;  4Q5S F;  1QPM A;  1R1T A;  5LGU A;  2YX7 A;  5F1R A;  2OZU A;  4GYG A;  3CO7 C;  2ZNY A;  5ILV A;  3C18 A;  4Y13 A;  3HIF A;  5ERI A;  5BQT A;  5DUK A;  4EGY A;  2BE5 F;  2A3S A;  4ETS A;  1ONV A;  2AS5 F;  4KN7 X;  1P4A A;  3GFL A;  1B9M A;  2MA3 A;  4BYY A;  4XSZ F;  3CUQ B;  2MH2 A;  3LA2 A;  1OPC A;  1YIO A;  3WG9 A;  4BHP A;  1D8K A;  2ZNZ A;  4RAY A;  3NEU A;  3R6S A;  1TTY A;  2H6B A;  1KU2 A;  3E6D A;  4G6Q A;  5LLQ A;  1P4W A;  3RYP A;  1G4D A;  3WE2 A;  1K78 B;  5K5O A;  4WF2 A;  2HQN A;  4U0W A;  2MLG A;  1ZRE A;  4M6Y A;  3GZ5 A;  3FWE A;  2CSO A;  5CVI A;  5ICF A;  2MBF A;  4XLN F;  4ENN A;  2HFH A;  1MGT A;  1FNN A;  1HSJ A;  3GVA A;  1Q1H A;  3R0J A;  2OA4 A;  1LDD A;  3ZMS A;  2RDP A;  4EM2 A;  3C3W A;  4YIF A;  4OOI A;  2HOE A;  4ZYH A;  4HAM A;  1FSE A;  5BPI A;  2VT3 A;  3FM5 A;  3FZV A;  1O7L A;  2L01 A;  3WTW C;  1QZZ A;  4YFX F;  4ON0 A;  3K2Z A;  5LEJ A;  3GX4 X;  4A2U A;  1KA8 A;  1W7P A;  1QQI A;  1W7P D;  1QGP A;  1KU9 A;  1FYK A;  3IC7 A;  1TW3 A;  3B73 A;  3K9T A;  4A5M A;  1QBJ A;  3RKW A;  5FGM A;  3C1D A;  2LF8 A;  4L9J A;  5D4R A;  3ZPL A;  4S04 A;  2DBB A;  4O6J A;  1F1Z A;  3QU6 A;  2Q0O A;  4A6D A;  2L02 A;  1T98 A;  3E3V A;  2F5C A;  2ZBK A;  3RPU A;  3RJP A;  3K1P A;  5FB2 A;  4G6D A;  5K5Q A;  2F5D A;  3QU3 A;  3T5X A;  2V1U A;  1H0M A;  3FM3 A;  2STW A;  2K4B A;  4A0Z A;  2M87 A;  2HYG D;  2UXX A;  3DQV C;  1FPQ A;  2DK5 A;  4RS8 A;  3F8M A;  1SFU A;  1J59 A;  1FYM A;  1XDU A;  4TV7 A;  2GWR A;  2FXA A;  3LWF A;  2E7X A;  1SMT A;  2HS5 A;  3KEO A;  3E5U A;  3GEZ A;  3E5X A;  2H6C A;  4G7H F;  1FT9 A;  4IVN A;  1HXD A;  4I0A A;  3KCC A;  4LMY A;  5HS8 A;  4GCV A;  2XAF A;  2IRF G;  1OKR A;  3QP6 A;  1MD0 A;  4ESJ A;  4ESB A;  2E1N A;  2ETH A;  1PP8 F;  5IT9 Z;  3L7W A;  4HV5 A;  3HOS A;  2UWM A;  3KFW X;  1LVA A;  4MEY F;  1E17 A;  2OD5 A;  2P4W A;  3ZQ7 A;  3MZH A;  2A07 F;  4IHS A;  2KJC A;  1U6G A;  4EJW A;  3JSO A;  4HDU A;  3T1B A;  3J7A O;  3ERE D;  5KK1 A;  5CVU A;  3C7J A;  2L54 A;  1XGN A;  1WKM A;  2ADU A;  1SD5 A;  5F6F A;  4I01 A;  5TJJ A;  3N4M A;  4WXC A;  3QPH A;  2HWV A;  3CUQ A;  1S6L A;  3I71 A;  2IPQ X;  4EM0 B;  1TNS A;  3JW4 A;  3KP3 A;  2YPR A;  1U8R A;  2IW5 A;  3ECO A;  4UV9 A;  2UXN A;  4Y17 A;  1USS A;  4HOB A;  2H27 A;  4KFC A;  3HOT A;  3IHU A;  2E1C A;  3HRT A;  2LSO A;  4HQE A;  2JZY A;  4KT5 C;  4HF2 A;  2EFN A;  5J6X A;  4EQQ A;  5CVV A;  3IKV A;  2MD5 A;  5LGN A;  2PEX A;  2EJR A;  1DPR A;  2JT1 A;  1BM9 A;  4L9V A;  3ZMU A;  1I5Z A;  5FD6 A;  4I7H A;  2OQR A;  1Z1D A;  1CGP A;  3CDH A;  3Q5F A;  5HS7 A;  2VC1 A;  3Q9S A;  4KA4 A;  2ZFW A;  3V7C A;  1ZGA A;  1KU7 A;  2QQB A;  2M30 A;  3ABU A;  4GYI A;  2HR3 A;  5E20 A;  4A5N A;  3GFJ A;  5H6R A;  2X0L A;  4LK0 F;  4Q4Z F;  1B4A A;  5LBQ A;  3DXJ F;  2ZXJ A;  4A12 A;  5JR3 A;  1UST A;  1D3Y A;  1BBY A;  5J8F A;  1MDM A;  2Q8K A;  1G3Y A;  1FBS A;  1KQ0 A;  1BI2 A;  4M73 A;  1JGS A;  3U9G A;  1LB2 A;  2PFB A;  1ZHF A;  2RN7 A;  4PCQ A;  3VB2 A;  3VEP A;  1OR7 A;  3WGG A;  3WTY C;  4MTD A;  2FE3 A;  2FQ3 A;  3WGI A;  4BQA A;  4G7O F;  1S29 A;  1MJB A;  2NYX A;  4GGG A;  2Z9O A;  4UVB A;  1R7J A;  3ZMD A;  1LEB A;  2VOP A;  2HTJ A;  2KIM A;  1FP1 D;  2WC2 A;  1AOY A;  3L9F A;  1KU3 A;  1DUX C;  3K1M A;  2XRO A;  1XMA A;  1O7F A;  4MNU A;  3ULQ B;  2RKH A;  3I64 A;  3G3Z A;  1B1B A;  2YX4 A;  1I27 A;  4OIP F;  2BEO A;  2PBI A;  1LQ1 A;  3IRR A;  1Z7U A;  5E1W A;  3J80 K;  1P2F A;  2NAZ A;  4OIR F;  1EH7 A;  1T6S A;  3F72 A;  3TGN A;  1FLI A;  1O3T A;  2GXB A;  1IRG A;  1OYY A;  4LG0 B;  3LQQ A;  4Y15 A;  3IRQ A;  1J5Y A;  1XSX A;  2VOO A;  1MJA A;  1CF7 B;  1B59 A;  1O3Q A;  4P55 A;  3ML6 A;  3EYY A;  1J75 A;  2XKO A;  1R00 A;  1X3U A;  3V7R A;  4BAY A;  2ISY A;  1FWZ A;  4HQM A;  3RKY A;  4N9I A;  2DTR A;  2QBY A;  2PQ8 A;  2QLZ A;  1H9T A;  1JHF A;  5AIP A;  4IRG A;  4RB0 A;  3J81 Z;  5J8C A;  1BN5 A;  4HW0 A;  2J5P A;  3I0T A;  5AIQ A;  1KQ9 A;  3F23 A;  3VOE A;  2FBH A;  3R4K A;  4ASN A;  3F6O A;  2OZ6 A;  5FFZ A;  5H20 A;  5LGT A;  2D1H A;  2LKP A;  3V8J A;  1R5G A;  1K79 A;  3KEQ A;  4MQ9 F;  1YFH A;  4QWQ A;  2RV8 A;  4JK1 X;  1XGM A;  1BI1 A;  2K7L A;  4LJZ F;  4CO8 A;  3WTU C;  1KYZ A;  5D5W B;  1C0W A;  2V79 A;  2R3S A;  1HKS A;  2DQL A;  3I53 A;  1ON2 A;  2JPB A;  2P8T A;  2G7H A;  2NNY A;  2R7F A;  3L09 A;  2QWW A;  1P6R A;  2P5V A;  5D4S A;  1Z91 A;  1K78 A;  1REP C;  3GYH X;  1FBQ A;  4BHC A;  2PMH A;  1J0R A;  3P9C A;  1WRJ A;  2P7V B;  2VBX A;  3K0L A;  3DPT A;  3DEU A;  3CO6 C;  3FHZ A;  4EGZ A;  4UVC A;  3LAP A;  3BWG A;  4BH9 A;  5L3D A;  3PQK A;  3BJO A;  1H9G A;  4U0V A;  4P9U A;  2VBZ A;  3I54 A;  4KIB A;  1BIB A;  2RC4 A;  3KZY A;  1RNL A;  3BPX A;  2P6T A;  3T8T A;  1A04 A;  1YLF A;  4UV8 A;  1ON1 A;  1W7P B;  3TO9 A;  3FMR A;  3E6B A;  5E18 F;  5EEH A;  4CIC A;  1R5H A;  4DNC A;  1SD4 A;  5DUI A;  4I0B A;  2EB7 A;  2V1D A;  4HLY A;  1TLH B;  1HKT A;  5IT9 K;  1JXS A;  3IWF A;  4RGU A;  3IL2 A;  4FHT A;  2E7W A;  1BI0 A;  1BC8 C;  2A68 F;  5ILS A;  4P5O A;  5LHH A;  2A69 F;  2HKX A;  1DDN A;  4M9Z A;  3QPT A;  2H09 A;  4K2E A;  4YFK F;  2KJB A;  3L00 A;  4EV0 A;  2F2E A;  2DFI A;  2VE8 A;  3FXQ A;  1G3W A;  3COA C;  1UHW A;  3U1D A;  2X4H A;  3SFZ A;  4A0X A;  4RGS A;  2FNP A;  3TKY A;  4HV6 A;  3FMQ A;  1YS6 A;  3TO7 A;  4LLL A;  1U3E M;  2CW0 F;  1ZAR A;  2QBY B;  3GFM A;  3I58 A;  2EV0 A;  1I1G A;  3Q9V A;  3B02 A;  1U5T A;  4YG2 F;  1ZG5 A;  3ELK A;  3P9I A;  5D8K B;  4A0Y A;  3EYI A;  1BI3 A;  3EUH A;  5DV5 A;  1U2W A;  2GA2 A;  1XMK A;  1YG2 A;  2FA5 A;  3D0S A;  3KP4 A;  2CQK A;  4YII A;  4XLP F;  4HF0 A;  4ENM A;  2VBY A;  3E6C C;  2EA2 A;  1O57 A;  1HKQ A;  1FP2 A;  4ENK A;  2FMY A;  3TOA A;  1QNT A;  2BGC A;  1NHA A;  1S3J A;  2DPU A;  2BYV E;  1GHC A;  1G3T A;  5EEG A;  3ISP A;  3MCZ A;  2XAS A;  3W6K B;  4AVP A;  5DCM A;  1ZH5 A;  5CVR A;  2ZJ2 A;  2HZT A;  5JVT A;  3O6B B;  1MDM B;  3KP2 A;  4XBF A;  4BHB A;  4Q47 A;  3WU1 B;  1P4X A;  2K4J A;  5LRS A;  2PG4 A;  3O2P E;  3ZMT A;  1YW9 A;  2MH9 A;  2ZME A;  2HEO A;  4AD9 A;  2Y75 A;  1R23 A;  1R1U A;  5E1Z B;  4NHJ A;  1D5V A;  3ROU A;  1UFM A;  4HX7 A;  5ICC A;  3JAM Z;  4KNY A;  2ESH A;  1XD7 A;  1XCB A;  3RIR A;  1T38 A;  3QOP A;  1O3R A;  4N0B A;  4ZYD A;  3V8L A;  1GXQ A;  2W24 A;  2HYF A;  2K27 A;  3WTS C;  1ZLJ A;  2L3D A;  5E8G A;  3SQN A;  1W5T A;  3BP8 A;  4I98 B;  1ZN2 A;  1IN7 A;  3K1N A;  4ESF A;  3LQR A;  3FX3 A;  4U7D A;  2Z5U A;  2DQR A;  2A6E F;  3WTT C;  1RUN A;  5FFX A;  3ZMV A;  2Z99 A;  4MEX F;  1ZRC A;  3CUO A;  4XRF A;  3V4G A;  2V1X A;  4RB1 A;  1YTY A;  2V9V A;  3J81 K;  1T39 A;  1ZG3 A;  1YS7 A;  2QQ9 A;  1QO0 D;  2NRA C;  2XUB A;  4PGG A;  5L3F A;  1I6X A;  1E2X A;  2DT5 A;  1V3F A;  4S05 A;  2VON A;  3HRM A;  3KZZ A;  1K7A A;  4CDG A;  2GIV A;  5FLX K;  1S7A A;  3BJA A;  5D5U B;  1R58 A;  3SHF A;  2MC3 A;  1Z05 A;  1LNW A;  5K1Y A;  1VTN C;  5D5X B;  4G7Z F;  1TW2 A;  3F8B A;  3F8N A;  2FU4 A;  4LB5 A;  2IT0 A;  2CFX A;  2KKO A;  2PI0 A;  1IXS B;  2IA2 A;  2D2W A;  1AWC A;  2G9W A;  3WGH A;  1Z6T A;  1LDJ A;  3JTG A;  4IXA A;  3V8K A;  3J80 Z;  3CTA A;  5D6E A;  1IAW A;  4UXN A;  3M1E A;  5JI6 A;  3AAF A;  4WXD A;  5KVR A;  1J7K A;  2VOD A;  1HW5 A;  2GQQ A;  4ZZL A;  2Y48 A;  2O03 A;  2XHK A;  3K69 A;  3ZN1 A;  3CLO A;  3LFK A;  4RAZ A;  2OU2 A;  4E70 A;  3GFI A;  4FX4 A;  3GO5 A;  1MZB A;  4WCG A;  2GZW A;  3W6J B;  2B0L A;  4UUV A;  2F5E A;  2P7C B;  3ZN0 A;  3WU0 A;  2Z33 A;  3M8F A;  1IXR C;  4KMF A;  4WXH A;  2DO7 A;  4R79 A;  2DAO A;  1V4R A;  3HYI A;  1XSV A;  3PQJ A;  4KIF A;  4FT8 A;  2HTS A;  4CYD A;  3R0A A;  4YFN F;  1ZRF A;  3MEX A;  5DCM B;  2VE9 A;  1ZLK A;  4L0Y B;  3F3X A;  2JPC A;  2PJP A;  2DU9 A;  3SZT A;  3F8F A;  3QAH A;  4IHT A;  1BOA A;  2D1V A;  1R1V A;  1BJA A;  3FXU A;  2XAJ A;  4R1H A;  3DV8 A;  3KET A;  4L5I A;  1R36 A;  2VC0 A;  1ZAO A;  4BXU A;  4CGZ A;  1F4K A;  3QRF F;  4LG0 A;  3WTZ A;  1IN4 A;  1MKM A;  4HDV A;  2O61 A;  5BPD A;  2G7U A;  2ESN A;  4EMS A;  2JTV A;  2K86 A;  5IT3 A;  3E5Q A;  4AIJ A;  4L18 B;  4MQV A;  5HLH A;  1YQA A;  1YYV A;  2QVO A;  3M9A A;  4UVA A;  2RQP A;  4H0E A;  1LJ9 A;  3HTS B;  2RVC A;  2ZKZ A;  2COM A;  1D8J A;  1B6A A;  5HLI A;  2QEN A;  5DD4 A;  4KN4 X;  5BS6 A;  2XAQ A;  5HDN A;  1FYL A;  3L2C A;  3JAM K;  2F5F A;  1B9N A;  3BJ6 A;  1GXP A;  1IN5 A;  1I1S A;  3KE2 A;  3P7N A;  4LK1 F;  2GAU A;  1FY7 A;  3MAJ A;  2TDX A;  2XVC A;  1SAX A;  5BMZ A;  4EJU A;  2M8E A;  4RB3 C;  5LEK A;  5CYV A;  3OV8 A;  4M74 A;  1FBU A;  4CHU A;  2WV0 A;  4WK8 F;  3HRU A;  4KIC A;  3HRS A;  3F6V A;  1F9N A;  3R61 A;  4P9F A;  3DP7 A;  3DF8 A;  1T2K A;  5DD8 A;  1GVJ A;  2M1B A;  4MGR A;  1PDN C;  1OYW A;  1BC7 C;  3I59 B;  3GUD A;  3WTV C;  3IKT A;  2FOK A;  3ABT A;  2YSR A;  1HBX G;  2GA1 A;  1K6O A;  2NNN A;  5ED4 A;  5BOX A;  3FMS A;  4N9H A;  2KIF A;  3LST A;  1Y0U A;  3JTH A;  4AIK A;  4OU0 A;  2XAG A;  1L3L A;  3BOQ A;  4O3M A;  2BV6 A;  4IPA A;  1BIA A;  3G73 A;  1YW7 A;  3I4P A;  4I09 A;  4OIN F;  2XRN A;  2W84 A;  5FO5 A;  3DFG A;  3P9K A;  5H6Q A;  1KYW A;  3QP5 A;  1UCR A;  4L5J A;  3LA7 A;  3NQO A;  4RGR A;  2FF4 A;  2WWY A;  2DI3 A;  2ZME B;  1FZP B;  4O5V A;  2JSC A;  5DYM A;  2AXL A;  4L0Z B;  3KP5 A;  2EV5 A;  2O3F A;  4F7Z A;  5F64 A;  2Q2E A;  3HHH A;  4EM1 A;  2QQA A;  4HX8 A;  3GW2 A;  2R7D A;  5E8I A;  3BRO A;  4OIQ F;  2VXZ A;  2WTE A;  2MLK A;  1TQM A;  2FSW A;  1HQC A;  2V6C A;  3F21 A;  1DP7 P;  3ECH A;  3SZP A;  1ZRD A;  3FXR A;  4LFU A;  2EK5 A;  2Z3Y A;  3DPL C;  4HA8 A;  4A6E A;  2DK8 A;  1SD6 A;  3GF2 A;  3EQL F;  5FD5 A;  5JFR A;  6PAX A;  3I5U A;  1QZY A;  3TDU C;  2QUF A;  3PFI A;  3BY6 A;  1LDK B;  1J2X A;  2EA4 A;  3SXY A;  1U5T B;  2VBW A;  4WWC A;  5E1X A;  4ZZD A;  1TNT A;  1WWX A;  2HDC A;  2FRH A;  1SFE A;  3RPQ A;  3WE3 A;  2EFP A;  1IN6 A;  2YU3 A;  1XCV A;  2QYO A;  2O0Y A;  5ICE A;  1XSD A;  3DKW A;  1RUO A;  2K02 A;  3RI4 A;  3VFZ A;  4Z2Y A;  1XN7 A;  3ZMZ A;  4HLX A;  3WOD F;  2IA0 A;  4M9X A;  3HTU A;  2Y0M A;  4PGH A;  5HOO A;  3EET A;  4R8H A;  1IW7 F;  1S8N A;  1U5T C;  4B09 A;  2FEZ A;  2M45 A;  5ICG A;  5L3E A;  1UB9 A;  3CJN A;  1YW8 A;  2A61 A;  1G6N A;  1R22 A;  3KLO A;  3KP7 A;  5L3B A;  3BPV A;  1DPU A;  1YO5 C;  5DEQ A;  2DPD A;  3HSF A;  1KQ8 A;  4PDK A;  2CG4 A;  5TRD A;  4ZH4 F;  5FLX Z;  4NQW A;  5DDG A;  4EVI A;  3I59 A;  3ZP5 A;  5K5R A;  1RI7 A;  1STZ A;  3RTR A;  2OBP A;  4U88 A;  5L3G A;  5HDG A;  5D8L B;  1XB4 A;  3FF5 A;  2LNB A;  5LHG A;  4WX9 A;  1UHM A;  4GO1 A;  4KMU X;  4M71 A;  5LRR A;  2W85 A;  3WTX C;  4IF4 A;  4HF1 A;  2KRF A;  2ZO4 A;  5D5V B;  1RZ4 A;  2DW4 A;  2LF7 A;  1KGS A;  3TO6 A;  4KYW A;  2A6H F;  2IJL A;  2CWE A;  4U7B A;  4AIH A;  3GXO A;  4OMZ A;  2RNJ A;  3GWZ A;  1ODD A;  4RGX A;  4HX4 A;  2DLL A;  4DQ2 A;  2ZCW A;  4BNC A;  2CGP A;  4GXO A;  2W57 A;  4LLN A;  1JHH A;  1WQ2 A;  4PZJ A;  2W25 A;  5CLS A;  2CYY A;  2P6S A;  3HHG A;  1XGS A;  2STT A;  3MFK A;  1L0O C;  1JE8 A;  4CXF A;  3IWZ A;  1HW1 A;  4NB5 A;  2UZK A;  4OMY A;  1J9I A;  3H92 A;  5HLG A;  2HGC A;  3MWM A;  2QM3 A;  4UNO A;  1G3S A;  1EH8 A;  3LA3 A;  1WI9 A;  2OQG A;  4B8X A;  3T0Y A;  3NRV A;  4EJT A;  2PN6 A;  1W4M A;  3MQ0 A;  2ACJ A;  1XDS A;  3GZ6 A;  1F5T A;  3BZ6 A;  2D45 A;  2XV4 S;  1WSU A;  2XGX A;  2IVM A;  1ZYR F;  3V7S A;  3HSE A;  3D5L A;  2EV6 A;  1FSH A;  4ZYE A;  1TBX A;  2QZ8 A;  4L9N A;  2VT2 A;  1Z9C A;  5CVJ A;  1ULY A;  2XIG A;  1SD7 A;  2ELH A;  2ISZ A;  3VOD A;  3M7G A;  3E97 A;  3M8E A;  3H3U A;  1EV7 A;  4XSX F;  3KP6 A;  2GXG A;  3H3Z A;  4I02 A;  4G9Y A;  1IUY A;  2HQR A;  3BDD A;  1FOK A;  2YR2 A;  2J5O A;  2XKP A;  5A2Q Z;  4UHT A;  4LB6 B;  5A2Q K;  5E17 F;  2OAZ A;  4QLC U;  3EDP A;  2H94 A;  2P5L C;  5DCF A;  5LHI A;  3S2W A;  5ILU A;  1ZGJ A;  2IP2 A;  1IRF A;  2JRT A;  3GLX A;  5JHU A;  4EJV A;  1SMY F;  4MTE A;  2PMU A;  2EWN A;  1T0F A;  3TOB A;  1FC3 A;  1XGO A;  3F22 A;  1P92 A;  2L4A A;  4ENJ A;  3JSP A;  2KIU A;  4IRI A;  5HVQ C;  4HYE A;  3HSR A;  5AON A;  1HW2 A;  1TQI A;  3TQN A;  3MZY A;  4JBA A;  4M6X A;  1FX7 A;  2FNA A;  2NS0 A;  2P5K A;  4LLG F;  1TQP A;  5L3C A;  4JQF A;  4U0Y A;  4OIO F;  2PLY A;  2IA1 A;  3KLN A;  5D6F A;  4ZYG A;  4D0P A;  4EJO A;  4KDP A;  4P96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...