2YR2A

Crystal structure of the hypothetical regulator from sulfolobus tokodaii
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
142
structure length
142
Chain Sequence
NENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title Crystal Structure of the Hypothetical regulator from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription regulator
total genus 60
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2yr2A00
3DEUA 3M7GA 3BP8A 4DNCA 3JSOA 2FBHA 5JFRA 1FC3A 2ZNZA 2QLZA 3QU6A 1O7LA 1XMKA 4G7ZF 3HHHA 4BYYA 2LDUA 4HF1A 5L3BA 1IN8A 5LGNA 1LQ1A 1LDKB 3EDPA 1Z6TA 1MJAA 2MBFA 2P5LC 2BYVE 2WV0A 1ZRDA 1JE8A 3LSTA 3GXOA 2XAQA 3ERED 4M9SA 3RPUA 3LA3A 3P9KA 3BY6A 4CICA 2F5EA 4RAYA 3RDIA 4S05A 5LGUA 4WX9A 1G4DA 3F8MA 3RKWA 4HF0A 3FXQA 2R3SA 5E18F 4OIOF 1U2WA 2GZWA 3WE3A 4UV8A 5D5XB 5ILVA 1TTYA 2ZCWA 3K1PA 2NNYA 4M9XA 1FY7A 1I5ZA 3I53A 1LJ9A 2DPDA 1QNTA 2YU3A 5E1ZB 2MD5A 1ZG1A 1KU3A 2QUFA 3FHZA 4ZYDA 3ZMUA 2MLKA 4GO1A 5BMZA 2YPRA 3BPXA 2W25A 5ED4A 1JXSA 5BOXA 4A2UA 2Z33A 1ODDA 2P6TA 1YO5C 4IJAA 2K86A 4M73A 5LBQA 1CF7B 5E17F 3W6KB 3FWEA 2PEXA 3R6SA 1RI7A 4OIQF 2EFPA 4UV9A 3TDUC 1BM9A 2KJCA 4P9FA 3T0YA 5D5UB 1EV7A 3O6BB 2HS5A 3KP6A 1W4MA 4I09A 3DF8A 3IWZA 4CO8A 1QGPA 3L7WA 1WSUA 3RIRA 1UHWA 1MD0A 1ONVA 3HTSB 2VBWA 5HS8A 3HSFA 4A6DA 2A07F 5TJJA 5FFXA 5IT3A 3WGGA 5JVTA 1UFMA 2UZKA 4PCQA 3J7AO 3MEXA 4UUVA 4OINF 3JAMZ 2ACJA 3M8EA 4BAYA 1S3JA 4KIBA 3Q9SA 4G6QA 2FNPA 2HQRA 2O6GE 4FX4A 4UVBA 4BQAA 4MQ9F 4ESJA 2QWWA 3JSPA 3DFGA 1ON1A 1SD5A 4MEXF 2QM3A 1YS7A 1FLIA 2XROA 3WTVC 2KJBA 2W57A 1EH8A 2CO5A 2VBXA 5E8IA 3JAMK 3VODA 1P6RA 1I1SA 2NS0A 1IN4A 3DPTA 1W7PA 2JTVA 2YSRA 3H3ZA 4HAMA 2O61A 3T8TA 5D4RA 2EK5A 4EVIA 4GXOA 1IN6A 1DDNA 1ZARA 4QWQA 1YTYA 1ZAOA 3P7NA 4MNUA 2XVCA 4L0YB 4K2EA 1D3YA 3GZ6A 3IKTA 2FNAA 4EJTA 2W84A 2XHKA 3SZTA 1S8NA 2K4BA 1S6LA 2ZXJA 1HW1A 4WCGA 1FYLA 1OYIA 1YS6A 3R0AA 1SFEA 4RGSA 2K02A 3F21A 2XV4S 2O0YA 1OYYA 2KIMA 4AWXB 2E7XA 1P92A 2VT2A 4EM0B 1RUOA 1R22A 3Q5FA 3WTZA 4OU0A 2XAJA 2XAFA 5L3GA 4M9ZA 1W5TA 2WWYA 3VFZA 1OPCA 1LEBA 2RKHA 2Q8KA 4CHUA 4P9UA 3I4PA 3TO7A 1IF1A 3IRRA 1UCRA 4RGRA 1PP8F 3KZZA 1BI1A 3P9CA 4QLCU 3V8JA 5D5VB 2XAGA 1YG2A 4HV5A 4Q48A 3H3UA 1PDNC 1KQ9A 3KP2A 2IA1A 3H92A 2LKPA 4L9VA 4HQMA 3CO6C 3R61A 2Y0MA 2DW4A 1OMIA 2NRAC 5J8CA 4YIFA 3ISPA 1CF7A 1MKMA 2PQ8A 4IHSA 3HTUA 1STZA 5ERIA 3ELKA 5J6XA 1T0FA 1HXDA 2JZYA 4PGHA 3V7RA 3FMSA 2DAOA 2K27A 4ESFA 5AIQA 4I2OA 1W7PD 3WODF 1XSVA 4E70A 3O2PE 2UXXA 2GAUA 2IT0A 2EWNA 2MLGA 1MDMB 4A5NA 4KT5C 2RN7A 3E5XA 3WTYC 3NQOA 2HYGD 5D6EA 2FOKA 4HBLA 3NEUA 4Q47A 4U0YA 3QOPA 1XD7A 4EV0A 1DPUA 4CYDA 2HWVA 3J81Z 4EJOA 2V9VA 4HX4A 1CGPA 1A04A 3K1NA 3EQLF 2BGCA 5H6RA 2MA3A 3KFWX 1DPRA 2HR3A 1G3YA 4KYWA 5HVQC 4MTEA 2IP2A 2PBIA 2VN2A 2FEZA 3F22A 4MTDA 2RNJA 1K6OA 2EV0A 4I7HA 4BNCA 1LDJA 1X3UA 3J81K 4AIJA 5AIPA 5AONA 4XLPF 4IRGA 1JHFA 1J0RA 4JQFA 2AXLA 2L01A 2QQ9A 3MFKA 1IXCA 3CTAA 2UXNA 3L09A 1G3WA 2JPBA 1F5TA 1U5TC 1T2KA 3TKYA 4I0BA 1H0MA 3ZN0A 1O3RA 3QP6A 2NAZA 2PLYA 1UB9A 2COMA 1ZN2A 4U7DA 3KCCA 2Z3YA 1B4AA 4CXFA 3I0TA 2DU9A 1HSJA 2FA5A 1KU9A 2HKOA 1G3SA 1BI3A 2OD5A 2G7UA 1QO0D 1IN7A 3MAJA 4EM1A 1R1TA 1T39A 2ZMEB 3KP3A 5HDNA 5FLXZ 3IRQA 5L3EA 1FX7A 1XDSA 3KZYA 2P7VB 1J5YA 1IRGA 3F6OA 3RTRA 2DQLA 2V1XA 3KLNA 5D5WB 1L3LA 2EJRA 1IRFA 3R0JA 2E7WA 1TQIA 4KIGA 3HIFA 2GIVA 5FLXK 2HZTA 1F1ZA 3U1DA 1KGSA 3HRTA 5HLGA 3O3KA 4UNOA 1J9IA 2BEOA 2IRFG 1Z7UA 2DTRA 3PQJA 4ENKA 3I71A 3PQKA 1FWZA 3CUQC 4HDUA 4EJWA 4M74A 1FOKA 5FD5A 3KEOA 4XSZF 1HW5A 4HF2A 3G3ZA 2A69F 4KNYA 3VEPA 1HBXG 4Y17A 2ISZA 1EH7A 4G94A 1XN7A 3ROUA 2ETHA 3DXJF 1R1UA 5J8FA 1O7FA 4BHCA 2EFNA 4D0PA 2CW0F 3F8CA 2DLLA 4LGWA 1YQAA 3E5QA 4P96A 1D5VA 2XUBA 4IVNA 2KRFA 5JI6A 1SMYF 3R4KA 2B0LA 3T8RA 2HOEA 5CLSA 1MGTA 1MJ9A 1REPC 5DCMB 4FHTA 1GXPA 2VBZA 5CVVA 3REOA 1MDMA 4M71A 3E5UA 3IHUA 1J59A 1K7AA 1GXQA 3TOBA 4A0XA 1S29A 5DCFA 1XGNA 1U5TB 3NRVA 3M9AA 3B73A 3C3WA 5K5OA 3S2WA 4ON0A 4U7BA 2TDXA 4YFXF 4GGGA 1TNTA 4O5VA 4BH9A 2PFBA 1QZZA 4Q5SF 2R7DA 3L9FA 2R7FA 2K4JA 3J80Z 4HQEA 3IL2A 1QBJA 5D4SA 2VE9A 2HFHA 3V8KA 4B09A 5FB2A 1DP7P 2FBIA 4F7ZA 1HKTA 2ESNA 3FM3A 1RUNA 1ON2A 3WTXC 1BC7C 5LGTA 1SMTA 4LB5A 1EH6A 2CSOA 1V4RA 3T1BA 1FNNA 4DQ2A 3WE2A 2HEOA 2H09A 3J80K 2XAHA 1ZGAA 2FMYA 1DUXC 2D45A 3ECHA 1FZPB 2CYYA 3BZ6A 2MH2A 3E3VA 1K78B 5L3CA 4A0YA 1P4AA 3L2CA 2K7LA 4OMYA 4LLGF 3HRUA 3CDHA 3CUQB 1ZG5A 5ICFA 3TGNA 2FMLA 1XGSA 2YX4A 4N9IA 4RB1A 2VT3A 2A6HF 2ZMEA 1BOAA 2OZ6A 4UXNA 1AOYA 3JTHA 2Y75A 1IAWA 1USSA 4KN7X 4JBAA 3DQVC 4HX7A 1BN5A 2GXGA 2BBYA 5E1XA 4O6JA 2H94A 4BXUA 5HOOA 1FP1D 5DV5A 1BI2A 2QQBA 3B02A 3CO7C 2MH9A 1XDUA 2V6CA 1G6NA 5HDKA 5ICEA 1ZLJA 1JGSA 3LAJA 2CWEA 1B9MA 2Z9OA 2RC4A 3OV8A 4LK0F 5F64A 2DBBA 4P5OA 3HOTA 1RNLA 2ADUA 1J2XA 1BJAA 4I02A 4IHTA 5HLHA 5DYMA 3F8BA 2JT1A 3GF2A 4RB0A 5ILSA 4EQQA 3M8FA 2EA2A 1U78A 4L18B 4I01A 3KLOA 4EMSA 2IPQX 4OIPF 4EJVA 4KIFA 2YX7A 3GFMA 3BJOA 3GEZA 2RGVA 3KETA 2A5YB 2RDPA 5CYVA 4KFCA 5BPDA 2FQ3A 1ZG3A 3OOPA 1WWXA 4N9HA 4OIRF 5DCMA 4YFKF 2VOOA 4LLLA 2NNNA 3FMRA 1FBQA 3JTGA 5DD4A 3GO5A 3WU1B 2VE8A 1RIOH 1U5TA 3C18A 3SXYA 3HUGA 2JRTA 4KDPA 1T38A 2M45A 2FU4A 3F23A 2QYOA 2J5PA 3MWMA 5K1YA 2P5KA 4ZH4F 2Z5UA 4G7OF 1D8JA 2D1HA 1KYWA 1Y0UA 2L4AA 1I1GA 4WK8F 3LWFA 3RI4A 3HSRA 5KVRA 1YW9A 5IT9Z 3RKYA 4Y13A 1GHCA 1HKSA 1LEAA 4MQVA 2VOPA 3FF5A 1ZYRF 1J75A 3SFZA 3FX3A 2CGPA 1FSHA 2XKPA 3JW4A 5LEKA 1XSDA 1SFXA 1TW2A 3IKVA 3GUDA 3ZMVA 4ZYGA 2L4MA 5CVJA 3GX4X 5IT9K 1SAXA 2L54A 1HKQA 3ZQ7A 3QPHA 3KE2A 1ZGJA 4CDGA 2D2WA 1K78A 2D1VA 1XGMA 1QPMA 3GLXA 4MEYF 3DPLC 4G6DA 3U9GA 1K79A 2A6EF 3CUQA 3K2ZA 2ISYA 3DP7A 2QVOA 1JHHA 3TOAA 2DT5A 4RS8A 2DPUA 1KA8A 2V79A 3ABTA 2O3FA 2P8TA 2VODA 2QENA 2F2EA 3R60A 5K5QA 3TDZC 1OKRA 1R23A 1TQMA 2Q0OA 2A3SA 2PMHA 4PZJA 4A5MA 1B1BA 1BC8C 1GVJA 2MC3A 3LQQA 2PI0A 1V3FA 3WU0A 1BIBA 4HX8A 4LLNA 3I64A 4NQWA 3E97A 1G3TA 4AIHA 2XKOA 2A61A 2V1DA 2O03A 1QQIA 2HYFA 3RPQA 2VONA 5L3DA 1SD6A 4IPAA 1P4XA 2A68F 1I6XA 1SD4A 3ZMSA 1KQ0A 5H20A 3ABUA 3V4GA 2HQNA 2P4WA 4MHGA 3QU3A 1F4KA 4KN4X 1WQ2A 5FO5A 2RVCA 3RJPA 2OQGA 4RB2C 4KMUX 4R8HA 4EM2A 3LA2A 4CZZA 3LAPA 3EUHA 3EYIA 2GQQA 5LLQA 1Z05A 1R00A 2VC0A 5L3FA 4CGZA 3DKWA 3WTUC 3I59B 3D0SA 1LVAA 4JK1X 5E8GA 2OAZA 5D6FA 3QPTA 1FYMA 1R7JA 5FD6A 2PN6A 2RQPA 5DDGA 1BI0A 5KK1A 2H6BA 2M87A 1H9GA 2X0LA 4GCVA 4LD5A 2G9WA 1XB4A 5CJ9A 1SFUA 1IXRC 2G7HA 4KICA 2H6CA 3DV8A 5DUKA 4Q4ZF 2HDCA 3BJ6A 2RV8A 1AWCA 4Y15A 3C7JA 5DEQA 5F1RA 4UHTA 1Z9CA 4EGYA 4HLXA 1KQ8A 4MGRA 3K0LA 4LG0A 2PMUA 4UVCA 2QBYA 4M72A 2OA4A 2QZ8A 3P9IA 1P4WA 4N0BA 3U2RA 3TQNA 2DK5A 1KU2A 1F9NA 2ZKZA 4G7HF 3F72A 3FXRA 2V1UA 2HTJA 3GFJA 1ZLKA 3FMQA 1Z6RA 4HA8A 2FBKA 4XRFA 4KMFA 3ZMTA 4P55A 4HOBA 4ETSA 2WC2A 3ULQB 4RB3C 5LRRA 4XSXF 3AAFA 3MZHA 5EEGA 4HV6A 3GZ5A 4IXAA 2UWMA 4L9JA 1OR7A 3COAC 5E20A 1WRJA 2YR2A 4ZZLA 3BPVA 4M6XA 2VBYA 4R79A 4OOIA 3WG9A 4LFUA 3V8LA 5E1WA 4BHPA 1UHMA 2W24A 2ZFWA 3ZMDA 3TO6A 2DQRA 3SZPA 5LHHA 3CUOA 5D8LB 3WGIA 4R1HA 1E2XA 4IRIA 1D8KA 5FFZA 3EYYA 1O57A 4BHBA 1FPQA 4NHJA 5DD8A 4EJUA 3E6BA 1VTNC 1HSTA 4RGXA 4LJZF 4WWCA 1R58A 2FSWA 5BPIA 2LF8A 2P7CB 4H0EA 3VB2A 2GXBA 3HHGA 4L5JA 1FT9A 1O3TA 2HGCA 1L0OC 2EV5A 3PFIA 2P5VA 1T98A 3WGHA 5CVIA 3N97A 1ZRCA 2P6SA 4WXHA 1U3EM 1OYWA 1B6AA 4EGZA 3KP4A 3CLOA 3I59A 1IZ1A 2CQKA 4A0ZA 1R5HA 3ML6A 5H6QA 3T5XA 1HW2A 1H9TA 3SHFA 2GA1A 5JHUA 5LHIA 5LRSA 3I5UA 3WTWC 2BE5F 1FP2A 2FF4A 4KUMA 3F8NA 2IA2A 1XMAA 3WTTC 4ZYHA 4YG2F 1MJBA 2CG4A 4GYIA 5A2QZ 2DFIA 2GA2A 5ICCA 1R1VA 4LMYA 4YFNF 4I98B 2X4HA 3RYPA 2L02A 1E17A 5HS7A 2FXAA 4WXCA 1FSEA 3F3XA 2M1BA 1XSXA 2ELHA 2M8EA 5A2QK 3Q9VA 2KIFA 4B8XA 2NYXA 2FRHA 1TQPA 3I54A 3K1MA 1ZREA 2HKXA 1BIAA 5BQTA 3TO9A 3HRSA 1C0WA 4U88A 2PJPA 2EB7A 2OZUA 4HDVA 1QZYA 3KEQA 2XRNA 3BROA 3KP5A 2DO7A 1ULYA 2IVMA 3BJAA 1Z1DA 2IW5A 3HYIA 3ZMZA 5D8KB 2F5FA 3IWFA 2O8XA 2E1NA 2WTEA 3G73A 1XCBA 5ICGA 2Q2EA 1RZ4A 1LDDA 4PGGA 4ZZDA 1ZHFA 2VC1A 3K9TA 3MZYA 4U0VA 3HSEA 4WF2A 2STWA 1TW3A 3W6JB 5K5RA 2L3DA 2BV6A 1YW7A 2QQAA 4ASNA 4L9TA 5FGMA 5BS6A 1B59A 2IA0A 2LSOA 2ZBKA 4M6YA 3SQNA 1S7AA 2C6YA 2ZNYA 3KP7A 3FXUA 1S7OA 3VOEA 2ESHA 2LF7A 2PG4A 1O3SA 4LG0B 2QBYB 5EEHA 3E6MA 1R36A 1O3QA 2F5DA 4G8XA 1HQCA 1B9NA 3FZVA 1FYKA 2AS5F 1LB2A 2H27A 3I58A 1USTA 1KYZA 4NB5A 3GW2A 2STTA 1ZH5A 3F6VA 1YIOA 1LNWA 4GYGA 1TBXA 4L0ZB 1W5SA 3EETA 2EFOA 2KKOA 3GVAA 5HS9A 4LK1F 1KU7A 1I27A 4L5IA 2EFWA 2EFQA 1XCVA 4XLNF 1IUYA 1J7KA 2OBPA 1TNSA 1WI9A 4HW0A 2W85A 2GWRA 3CJNA 1TLHB 4AD9A 2CFXA 4I0AA 3ZPLA 3GWZA 4RAZA 3V7CA 1U8RA 4AVPA 1MZBA 3GYHX 3LQRA 4A12A 2HTSA 4FT8A 1IXSB 4FX0A 3QAHA 1PUEE 5JR3A 2Z99A 3FM5A 4U0WA 1ZRFA 4HZFA 2XIGA 3WTSC 3ZN1A 3HRMA 1IN5A 5LEJA 4UVAA 5TRDA 2KIUA 6PAXA 2JSCA 3D5LA 1YLFA 4G9YA 2OU2A 4ENNA 4TV7A 1IW7F 3N4MA 2F5CA 3BOQA 3V7SA 1FBUA 3RKXA 2M30A 2M5WA 1NHAA 3E6DA 1XGOA 2OQRA 3C1DA 4OMZA 5ILUA 3BDDA 3LFKA 1U6GA 3MCZA 4IRHA 5HDGA 3F8FA 2ZO4A 3ECOA 3LA7A 1Q1HA 2Y48A 3QRFF 2E1CA 4HLYA 1SD7A 2XGXA 3BWGA 2DK8A 5CVRA 4ESBA 4KA4A 4L9NA 1YYVA 4YIIA 5HLIA 3ZP5A 4IF4A 1WKMA 4WXDA 3GFLA 2J5OA 3GFIA 2JPCA 2XASA 3QP5A 5LHGA 1R5GA 4AIKA 1T6SA 4Z2YA 3M1EA 4XBFA 3K69A 2DI3A 1FBSA 2EA4A 2EV6A 3HOSA 2FE3A 3L00A 1YFHA 2ZJ2A 4PDKA 5CVUA 2IJLA 4S04A 5F6FA 4ZYEA 1P2FA 4HYEA 3RYRA 2LNBA 4A6EA 1Z91A 4ENJA 3MQ0A 3E6CC 1YW8A 1PP7U 3IC7A 1BBYA 4ENMA 4LB6B 4O3MA 4RGUA 5DUIA 1W7PB 2VXZA
chains in the Genus database with same CATH superfamily
3DEUA 3M7GA 3BP8A 4DNCA 3SZGA 3JSOA 2FBHA 5JFRA 1FC3A 2ZNZA 4OWRB 2QLZA 3QU6A 1O7LA 1VQ7I 1XMKA 4G7ZF 3OYDA 4QTRA 3HHHA 1A6QA 4BYYA 3RQIA 2LDUA 4HF1A 5L3BA 1VQOI 1ETVA 3S2HJ 3G1MA 2WV1A 1IN8A 4A3DJ 4ZC3A 4BXFA 1Z21A 5LGNA 1LQ1A 3NWTA 1LDKB 4UUSB 3CCRI 3EDPA 2ZXHA 2KT0A 3TBIA 5K7HA 1Z6TA 1VQ6I 1MJAA 3PNTA 2MBFA 2P5LC 3ZQLA 2BYVE 2WV0A 4PK4A 1ZRDA 1JE8A 3LSTA 2K40A 3MKWB 3DWLE 3GXOA 3OY9A 2E36A 2XAQA 2NS7A 3C2BA 4M9SA 3ERED 2M3AA 1FOWA 4XL9A 3LA3A 3RPUA 3P9KA 3BY6A 2Y0SA 4CICA 4A3KJ 1SFOJ 2F5EA 4RAYA 1JT0A 3S2DJ 1FJLA 2LOOA 3RDIA 3B6CA 2ID6A 3BG7A 4IOAF 3ASNH 5LGUA 4S05A 4WX9A 1XG1A 3PIOF 3LNQA 1G4DA 1I39A 1WJAA 2XB0X 2E71A 3F8MA 3ZGKA 2PX9A 3RKWA 4DBRA 4HF0A 3FXQA 2R3SA 5E18F 2V1NA 4OIOF 2FJ1A 1U2WA 2GZWA 3PM1A 4UV8A 3WE3A 5D5XB 5EG0B 2LK2A 5ILVA 1TTYA 4J01A 2ZCWA 3K1PA 2NNYA 3AL0C 1PUFB 2R0QC 2Q2EB 4I6ZA 1X19A 4JX6A 4M9XA 2LBFA 1H8AC 2V4JC 1FY7A 1I5ZA 2NVUB 3I53A 1LJ9A 2DPDA 1QNTA 2K9LA 2YU3A 5E1ZB 2JA7J 2MD5A 2EIMH 3HBLA 4HSRA 1ZG1A 1KU3A 2QUFA 4Z6YA 1D0YA 2HI3A 3DTIA 3FHZA 4D9JA 4IZZA 4ZYDA 2XPVA 4XLFA 3ZMUA 1RKTA 2EIJH 1YX3A 4J19A 2MLKA 4GO1A 5BMZA 2L9VA 4DYCA 1W0UA 2YPRA 3BPXA 2W25A 5ED4A 1LE8B 1JXSA 5BOXA 4A2UA 2Z33A 3PL8A 3HGGA 3SJMA 3FDYA 3HB9A 3OIOA 4C2MJ 2CV1A 2CW7A 4DIQA 3ZRGA 1ODDA 1MBKA 2R7WA 2P6TA 1A36A 1YO5C 4IJAA 2K86A 5HNFA 2O7OA 2R7OA 2WY7Q 4M73A 1ZTRA 2A6TA 5LBQA 1CF7B 2Q1ZB 5IP6A 1VQKI 5E17F 5KAFC 3FISA 3W6KB 1E3OC 3FWEA 3EPZA 2DN0A 1MBJA 3PJRA 2PEXA 3R6SA 3PSFA 1RI7A 1QPIA 2F4IA 4OIQF 2EFPA 4UV9A 1QVUA 5E3OA 4JX5A 3TDUC 1BM9A 2KJCA 3QWLA 4P9FA 2VLAA 1B8IB 3T0YA 3RZDJ 5D5UB 3WG7H 1EV7A 3CCYA 1YE9A 3O6BB 2A05A 2HS5A 3J7ZI 3DEEA 1W4MA 2DYSH 3KP6A 4I09A 3DF8A 3HKZN 3IWZA 2BXYA 5F08A 4CO8A 1QGPA 4F55A 2XDVA 3L7WA 1WSUA 3RIRA 5IYCJ 1W36D 1UHWA 1MD0A 1UG0A 2M2EA 2VQCA 2VJJA 1ONVA 4BU2A 3HTSB 2VBWA 5HS8A 3LOCA 2KP6A 3HSFA 4A6DA 1LUJB 5J1YA 2A07F 1IJWC 4RAFA 5TJJA 5FFXA 5IT3A 1POGA 3WGGA 1UFMA 5JVTA 3CLQA 4PCQA 2UZKA 5EF6A 3J7AO 3MEXA 4UUVA 4OINF 1HOMA 4F93B 3JAMZ 2ACJA 3M8EA 4BAYA 1S3JA 4KIBA 5K7FA 1IGNA 3N05A 3Q9SA 2FNPA 2HQRA 4G6QA 4XKBA 5E3NA 4FX4A 2O6GE 4UVBA 4BQAA 2BY2A 3JRCA 4MQ9F 1V5EA 4PJJA 4ESJA 3AG2H 2QWWA 4XIDA 3RPUD 3JSPA 4B4CA 3DFGA 1FTTA 2VXDA 1ON1A 3A01B 1SD5A 1I3AA 1MBGA 3SEZA 3I56I 4BBSJ 2FX0A 4MEXF 2QM3A 1YS7A 4BJTA 1FLIA 3A2KA 2Y69H 2XROA 4CSWA 3WTVC 3G4SI 1VNDA 2KJBA 2W57A 1OCRH 4A3BJ 4D1QA 3CQZJ 1IG7A 1EH8A 1HCRA 4E7LA 2CO5A 1V5FA 2VBXA 3VPRA 2ELJA 5IP7J 4A3EJ 5E8IA 3JAMK 3LFUA 2X48A 4XLCA 2QQ8A 3VODA 1P6RA 2MYSA 1I1SA 2NS0A 2KHMA 4E7ZA 1IN4A 2LTPA 3DPTA 2XF7A 1RETA 1W7PA 4HRIA 2JTVA 2YSRA 3H3ZA 4HAMA 2O61A 3T8TA 3MMYB 2L9SA 5J4VA 1EJ9A 5D4RA 2LRDA 4QPQA 2EK5A 2YU9J 1PVEA 4EVIA 4GXOA 2DDBA 3S1RJ 2Y31A 1IN6A 2X9DA 2IEKA 3FKIJ 1WJEA 2ZFUA 2DA4A 1DDNA 1ZARA 4QWQA 1YTYA 1TT5B 3FXOA 1JGGA 1ZAOA 3P7NA 4I76A 4MNUA 2XVCA 1ETWA 4L0YB 4K2EA 1D3YA 2F4OB 2QCOA 2JA8J 3GZ6A 3HGYA 3IKTA 2FNAA 4EJTA 2W84A 4DYRA 1Y8QB 1ERDA 3LSJA 4RM3A 2XHKA 2OTJI 3SZTA 1S8NA 2K4BA 3A4CA 3E1SA 3BG6A 1AKHB 5KCMA 3ZQGA 2ZXJA 2RREA 1S6LA 3G1LA 1HW1A 1UMQA 4WCGA 1FYLA 3I4MJ 1OYIA 3HPGA 3BTIA 4CCLA 3CC2I 4XONA 4KISA 1YS6A 3R0AA 1SFEA 3A0BC 2K02A 4RGSA 3PSIA 4C9YA 5J47A 1DP3A 3F21A 2XV4S 2O0YA 1OYYA 2ICWG 2KIMA 2HVRA 4AWXB 1XS9A 2E7XA 1P92A 2VJ5A 2VT2A 4EM0B 4MFEA 1RUOA 5M5YJ 2EZKA 1TT0A 1R22A 3Q5FA 3WTZA 2F4MB 3AG1H 4A3GJ 4IOCF 4OU0A 3OYGA 1Z3YA 3MZ8A 5EG0A 3H0GJ 2XAJA 3I55I 3ABKH 2XAFA 3BT9A 1ETKA 5L3GA 4M9ZA 1PUFA 1W5TA 2WWYA 3VFZA 2EZIA 1OPCA 1LEBA 4V2FA 5JVGF 4BBRJ 1AU7A 4MO7A 2RKHA 2Q8KA 4CHUA 3EUKL 2DT6A 4P9UA 2H8RA 3HOVJ 3DEWA 2VJ4A 3I4PA 1JKRC 3ZQCA 3TO7A 1IF1A 3IRRA 1UCRA 4ZYAA 4RGRA 1PP8F 3KZZA 4NBQA 5E79C 1BI1A 3P9CA 1TWAJ 4QLCU 5EDNA 3V8JA 5D5VB 2Y9ZA 3QYEA 2XAGA 2LVSA 1YG2A 3JCUC 4HV5A 4Q48A 4RLQA 3H3UA 4AU7A 1PDNC 1KQ9A 1LE8A 1H89C 3JRIA 3KP2A 3VWBA 2IA1A 3H92A 3L2UA 2LKPA 2WA0A 2XGDA 2L0KA 2KRHA 4L9VA 1QA6A 4HQMA 3CO6C 5E3MA 5GADJ 3R61A 2DA1A 2Y0MA 1I50J 2BW3A 1OMIA 2DW4A 2NRAC 2I8DA 5J8CA 4YIFA 3ISPA 1CF7A 3OS2A 1MKMA 2PQ8A 4PSXA 1TZLA 4IHSA 3HTUA 1STZA 5ERIA 4CYCB 3EUAA 3ELKA 1U9OA 2DDAA 5J6XA 1T0FA 2IGNA 1HXDA 2JZYA 2ZXWH 4PGHA 3ERMA 5TGTA 3V7RA 4MLOA 3FMSA 2DAOA 2K27A 3Q3SA 3O8GA 3E7LA 4ESFA 5AIQA 1QHHD 4I2OA 1W7PD 3WODF 2R7SA 2GXAA 3OOUA 1XSVA 2MG4A 4E70A 3O2PE 1OCZH 2HQ5A 5HNHA 3HKZA 1B72B 1VF9A 2L9NA 2COBA 2GAUA 2KRCA 2UXXA 2IT0A 2EWNA 2MLGA 4IO9F 3FK6A 1MDMB 4A5NA 3SDGA 4V19K 4M3EA 2R5YB 1OJLA 3CMYA 2O9LA 3JRHA 1YITI 1UHSA 4KT5C 2DYRH 2RN7A 3BLYA 3BZCA 3E5XA 5M3MJ 3WTYC 4CUGA 2JUGA 3NQOA 2HYGD 3H5AA 1LFBA 5D6EA 1MMGA 2FOKA 4HBLA 3NEUA 2KPMA 2LBFB 1BOBA 4Q47A 4U0YA 5BNGA 2JK3A 1Y6IA 3QOPA 1LFPA 1XD7A 4S0HB 1VQMI 2B63J 4EV0A 1DPUA 2XGCA 4CYDA 3TMOA 1OCPA 3HC7A 1SVMA 2HWVA 1WHUA 2KLOA 3J81Z 1YOVB 4EJOA 2V9VA 4HX4A 2CJJA 1CGPA 1XX5A 1A04A 3A01A 3K1NA 3EQLF 2BGCA 1G59A 5H6RA 2MA3A 3KFWX 4XN3A 3CCLI 1DPRA 2HR3A 1G3YA 2OJED 4BJ6C 4MTEA 5HVQC 1LVKA 2K9MA 4A3IJ 4B48A 4KYWA 2IP2A 2PBIA 2VN2A 2FEZA 3F22A 4MTDA 2RNJA 3JR9A 4BGDA 1K6OA 4B44A 2EV0A 1Y1WJ 4I7HA 2JUCA 2LREA 2QSHX 2LY1A 4BNCA 1LDJA 1X3UA 3J81K 4AIJA 5M5XJ 2K3FA 5AIPA 2AQFA 1ETXA 3L1PA 2V9PA 2HOTA 2X1CA 5AONA 1BR4A 4XLPF 4IRGA 1JHFA 1J0RA 4XR6A 4JQFA 2AXLA 2L01A 2QQ9A 3MFKA 1IXCA 3CTAA 3M1CA 4C2TA 2UXNA 1TWGJ 1MIJA 3BG3A 3L09A 3IH4A 1G3WA 1WJFA 1SANA 3OYEA 4PFPA 2BZTA 2JPBA 3MD2A 1F5TA 1U5TC 5GPCA 1HDPA 1RR8C 2XSDC 3OYJA 1X4OA 1N25A 1T2KA 3TKYA 4I0BA 1EKEA 3J7YJ 1H0MA 3ZN0A 1V5GA 2VASA 4BY7J 3BR2A 3CC4I 4CCNA 2P81A 1O3RA 2F6CA 3ZCOA 3QP6A 2NAZA 2VQGA 2PLYA 1UB9A 2COMA 1ZN2A 2KDOA 3LSMA 2OPTA 1ZELA 1D0ZA 1U0JA 4JYKA 4M3GA 4U7DA 2X6YA 3KCCA 2Z3YA 2NOGA 1B4AA 4CXFA 5DM6F 2R7UA 3I0TA 5FRNA 2DU9A 2M0MA 3CP2A 1HSJA 2VPRA 4UB6C 3ZOBA 5C4JJ 2FA5A 1KU9A 3VDXA 2HKOA 1G3SA 1BI3A 2OD5A 1AKHA 1FEXA 2G7UA 1QO0D 3BR5A 1IN7A 3MAJA 2HDWA 3AG4H 4EM1A 1UJ8A 1R1TA 4ANJA 1T39A 2ZMEB 3KP3A 4A93J 4II2A 3G71I 5HDNA 5FLXZ 2E19A 1R4MB 1RKWA 3IRQA 5L3EA 3ZQFA 1FX7A 1XDSA 2DFFA 2HQAA 2OCEA 2P7VB 2TRTA 3KZYA 3A0HC 1DU0A 1J5YA 4G6TB 1IRGA 3F6OA 3H5RA 1MH4A 3AKZA 3RTRA 4PUSA 2DQLA 2V1XA 3KLNA 1HC8A 2OUMA 3I3LA 5D5WB 1L3LA 3CC7I 2EJRA 1K6YA 1IRFA 3R0JA 4FCYA 4NNJA 2E7WA 1TQIA 4HPQA 4KIGA 1Z7LA 2QGUA 3HIFA 2GIVA 5FLXK 2HZTA 1F1ZA 4AM3A 3U1DA 1KGSA 3HRTA 5HLGA 3O3KA 3CJTB 1PJRA 2BEOA 4UNOA 1J9IA 2IRFG 1Z7UA 2DTRA 2NVQJ 3PQJA 4ENKA 2P0WA 3I71A 2WY8Q 3GBGA 5B1AH 3PQKA 5CQGA 1FWZA 2CUEA 1MH3A 3CUQC 3CDLA 2R7RA 4HDUA 1T95A 3KZIC 4EJWA 4M74A 1IC8A 3DPUA 5FD5A 3OYKA 1MBEA 2ELKA 3KEOA 4XSZF 4BE1A 1FOKA 1HW5A 4HF2A 3G3ZA 2IGKA 2A69F 3LSKA 4KNYA 4Y4RA 3VEPA 2ECCA 4DJAA 1HBXG 4Y17A 2ISZA 3CMMA 1EH7A 4PFOA 1FTZA 4G94A 1XN7A 3ROUA 2CU7A 3KYLA 2AQEA 2ETHA 2G0EA 1R1UA 3DXJF 4OAZA 3W2AA 2K5CA 3D5SC 5J8FA 1O7FA 4BHCA 2DA2A 4CYCA 4C3HJ 3S32A 3BC8A 2EFNA 4BQNA 4D0PA 2CW0F 2KISA 4FE7A 3H9QA 3GZNB 4ZTFA 4GRIA 3F8CA 2DLLA 1K4SA 4LGWA 2IS1A 1YQAA 3E5QA 4P96A 1D5VA 2HZDA 2XUBA 3HM5A 4IVNA 2MC4A 2KRFA 5JI6A 1SMYF 3R4KA 2X1EA 5GTHC 2BY0A 2NVXJ 1T08B 1Y8RB 2B0LA 4PJMA 2ME6A 3T8RA 2HOEA 3OIPA 3BR6A 5CLSA 1MGTA 1B72A 1MJ9A 1REPC 5DCMB 2HPIA 4FHTA 1GXPA 2LY2A 1O4XA 2VBZA 5CVVA 3REOA 4FTHA 1MDMA 4M71A 1S7EA 4ABZA 3HL2A 3E5UA 2V9KA 3IHUA 2R5YA 1J59A 1IRZA 1K7AA 1GXQA 2JMWA 2R93J 4GDFA 3TOBA 3K4JA 4A0XA 1T33A 1S29A 5DCFA 1XGNA 4Y7NJ 1U5TB 3NRVA 3M9AA 3B73A 4HNVA 2L9RA 3KEYA 1NH3A 2GOXB 3C3WA 1APLC 3HUGB 5K5OA 4ZDPA 1VQPI 2E5NA 3NWSA 1F36A 2LKXA 3S2WA 4ON0A 4U7BA 3OYBA 2TDXA 4YFXF 5IYDJ 4GGGA 1TNTA 2EINH 4C30A 5FKKA 2LKSA 4O5VA 2PMZN 4BH9A 2PFBA 1QZZA 4AUXA 4Q5SF 4FE4A 3BG9A 3BZKA 3HJEA 3IP4B 4E7SA 4IQ4A 2R7DA 3L9FA 2R7FA 3M3YJ 2K4JA 2BVLA 1Y1VJ 3J80Z 4HQEA 1HA8A 4XMYA 3IL2A 1R49A 2D5VA 2MW8A 1QBJA 5D4SA 2VE9A 1MBFA 2HFHA 3V8KA 4B09A 5FB2A 1DP7P 2FBIA 4F7ZA 1W0TA 1HKTA 3FKJA 2BW3B 2ESNA 3EUHC 3FM3A 1RUNA 1ON2A 3WTXC 1U8BA 2E2HJ 3I4NJ 1BC7C 3VYSB 5LGTA 1EF4A 1W5CC 1SMTA 4LB5A 1EH6A 2CSOA 1V4RA 4BEHB 3T1BA 1FNNA 3A02A 4DQ2A 3WE2A 2HEOA 4D5CA 2H09A 4HNUA 3J80K 2XAHA 1MMDA 2MFZA 1ZGAA 2FMYA 1DUXC 3K10A 1KZHA 1YJWI 4AVZA 5GAHJ 2D45A 3ECHA 1JKPC 3G6EI 1FZPB 2CYYA 3BZ6A 2IS4A 1ETYA 2HVQA 2VKDA 4CH7A 2MH2A 1P7IA 2W00A 4HEA2 3D1NI 4CZCA 3E3VA 3BR3A 1N78A 3HDDA 1K78B 4BDZA 3X2QH 5L3CA 3GTMJ 4A0YA 1RR7A 1LFUP 5FKLA 3DU5A 1P4AA 3L2CA 2ZJQF 2K7LA 3F9KA 4OMYA 2CUFA 3HRUA 4LLGF 3CDHA 3CUQB 1ZG5A 5ICFA 3TGNA 1NG6A 3H3VK 2M4KA 2M4GA 2FMLA 1XGSA 2CUZA 2YX4A 4N9IA 2VKVA 4DOZA 4RB1A 2VT3A 4UUTA 1X1PA 2A6HF 2XF5A 2ZMEA 1BOAA 3CCQI 2XPUA 4Y3OA 3RSNA 2OZ6A 4UXNA 4E7IA 1AOYA 3JTHA 2Y75A 2CV0A 1IAWA 5FRMA 3HOZJ 3DBHB 3CCSI 4XKVA 4CCKA 3OYIA 3D5RC 2LMDA 5FJ8J 4RBOA 1OFCX 1USSA 4KN7X 1W36C 4JBAA 3DQVC 4B1RA 4HX7A 5J1UA 2XRLA 1BN5A 2GXGA 2BBYA 4XM3A 1YI2I 5E1XA 4O6JA 2H94A 4BXUA 5HOOA 1FP1D 5DV5A 4RMNA 1BI2A 1QU3A 4QPOA 2QEXI 2QQBA 3B02A 3CO7C 2MH9A 1DQUA 1XDUA 2V6CA 1G6NA 2DJNA 5HDKA 5ICEA 1ZLJA 4A69C 4NQWB 1JGSA 2RNGA 2Y30A 5FKNA 3LAJA 2BHZA 2X6XA 2CWEA 1JI8A 1B9MA 2Z9OA 2RC4A 3IAM2 3OV8A 4M3DA 3AL0B 4LK0F 5F64A 2O8KA 2DBBA 4P5OA 3HOTA 1NTCA 1RNLA 2ADUA 1J2XA 4XLEA 4LG3A 1BJAA 3BR0A 4I02A 4IHTA 3TEDA 5HLHA 2ZSIB 2K9NA 5DYMA 3F8BA 3BG5A 2JA5J 3TW7A 4ZDLA 2JT1A 2WBMA 3GF2A 4RB0A 5ILSA 1WCMJ 1MNEA 4EQQA 4JOMA 4KT6A 4II3A 3O8HA 3M8FA 2EA2A 3P5JA 3FBIB 1OR7C 1U78A 4L18B 2ZJPF 4I01A 2ZJRF 1BW6A 3KLOA 4XORA 3UNGC 1SFKA 4EMSA 3DBLB 3GTPJ 2DXIA 2DA6A 2HPMA 2IPQX 1E0EA 4OIPF 2GOMA 2K3PA 5JLXA 4EJVA 4KIFA 3W2WA 2YX7A 1V54H 3GFMA 3BJOA 3GEZA 1IRXA 2RGVA 3CZ6A 3KETA 2A5YB 2RDPA 5CYVA 3W2VA 5BPDA 4KFCA 3QOEA 2FQ3A 2R7XA 3BCBA 1ZG3A 3OOPA 1U9NA 1WWXA 1SVOA 4N9HA 4C3IJ 4OIRF 5DCMA 2OTLI 1AA7A 3WU2C 4YFKF 2OC6A 4Y33A 4JP0A 2ID3A 5TISC 3GTQJ 1BL0A 2VOOA 1OCTC 3FXLA 4ZTJA 2LH9A 4A3MJ 1IDYA 4LLLA 2NNNA 3FMRA 2JA2A 1FBQA 3MKYB 2QKLB 3OSFA 3JTGA 5DD4A 3FXKA 3GO5A 1JKOC 1WH5A 3DLAA 4LITA 2LLKA 4FASD 2VE8A 3WU1B 3JRFA 1ITYA 1RIOH 1U5TA 1H88C 3C18A 3CESA 1WH7A 3SXYA 2R7ZJ 1BR1A 2CQNA 3HUGA 4E4HA 2JRTA 4KDPA 1T38A 2M45A 1QHGA 1P9QC 2FU4A 2BVMA 2M34A 3F23A 2QYOA 2J5PA 2VI6A 3MWMA 5K1YA 2P5KA 1ORKA 3Q0VA 4XNFA 4AYBN 4PSWA 4ZH4F 2Z5UA 5EYRA 4G7OF 3AFHA 2KQRA 2PMZA 3S1QJ 5GAEJ 2L7KA 1D8JA 2D1HA 1KYWA 2LR8A 1Y0UA 2L4AA 1OCOH 1I1GA 3PIPF 4WK8F 3LWFA 3RI4A 3HSRA 5KVRA 1YW9A 5IT9Z 2ZB9A 3RKYA 3K2AA 4Y13A 2W7NA 1GHCA 1HKSA 1LEAA 4MQVA 2VOPA 1T56A 3A1YA 3FF5A 3QODA 1ZYRF 1J75A 4IQJA 5IY5H 3SFZA 3Q0UA 1D0XA 2WAQN 3FX3A 5B3SH 2CGPA 1ETOA 1FSHA 2XKPA 3JW4A 5LEKA 1XSDA 2X6OA 2H1KA 1TC3C 1SFXA 1TW2A 3RZOJ 4KITB 4BEHA 3IKVA 1VFCA 3GUDA 3ZMVA 2W48A 4ZYGA 2MGQA 4Y52J 2L4MA 5CVJA 3ZQHA 3GX4X 1VQ5I 1UZCA 5IT9K 1JJ6C 1WJCA 2E1MC 3LSRA 1SAXA 3GTGJ 2L54A 2DMPA 1HKQA 3OR2C 3ZQ7A 2DA7A 2DOFA 4OAYA 3QPHA 2JSPA 3ZQIA 3QQAA 4XLHA 2AO9A 2R7TA 1XTAA 2FD5A 2CMPA 2CQ7A 3BTJA 3S93A 3KE2A 1ZGWA 2FQ4A 1ZGJA 1I3QJ 2JJ7A 2K9SA 4CDGA 2D2WA 4EEFG 2XB5A 1K78A 2D1VA 2XF6A 1XGMA 3QYBA 3GTKJ 1QPMA 3GLXA 1S72I 3RCOA 4MEYF 3DPLC 4G6DA 3U9GA 1K79A 2EZLA 2A6EF 3CUQA 3K2ZA 1TL8A 2ISYA 1OCCH 2DOAA 2QVOA 3DP7A 1GDTA 1R9TJ 1FOYA 2DFHA 2N8GA 1BW5A 1JHHA 2EBIA 4HG2A 3TOAA 4NC8A 3F0CA 5B1BH 5EEAA 2DT5A 2ECBA 4RS8A 4XQFA 2DPUA 3VSKA 4DZPA 1KA8A 2V79A 3ABTA 2O3FA 2P8TA 2VODA 3ONQA 3M4OJ 2XSJC 2QENA 1JUPA 2F2EA 4YIRX 3IV5A 2DMUA 2IS6A 3R60A 5K5QA 3CMEI 1V55H 3TDZC 2FUG2 2M9HA 3CF2A 5IP9J 4BXXJ 3HPHA 3BQZA 2BY3A 1OKRA 3MN2A 1R23A 2E5ZA 3J7AY 1TQMA 2Q0OA 2A3SA 3OL4A 4RA2A 2PMHA 5M3FJ 1K4TA 1VQLI 4PJ0C 2WADA 1BR2A 1WI3A 4PZJA 3FHNA 3WHCA 1B1BA 3SEQA 4A5MA 1BC8C 3CCUI 1GVJA 2MC3A 3L2RA 3LQQA 1X1CA 2PI0A 4FQGA 2O5RA 1V3FA 3FK7A 3WU0A 2L7MP 1BIBA 1A6IA 1HLVA 2PJRB 1JTXA 4HX8A 4LLNA 3I64A 2LG4A 4LOCA 4UB8C 2BHYA 4NQWA 2GM4A 1LKXA 3E97A 3CCVI 1G3TA 4AIHA 2XKOA 4A3LJ 4BKXA 2X85A 1F43A 2A61A 2H8WA 2KZVA 2V1DA 2O03A 4HNTA 2XC7A 1QQIA 2HYFA 4W1UA 3RPQA 2CUJA 2VONA 4ZJZA 5L3DA 2HVSA 3S3NA 1SD6A 4IEJA 3S1MJ 3KIOA 1ACIA 4IPAA 1P4XA 2A68F 3FXJA 4A3JJ 1I6XA 1SD4A 3ZMSA 1SVLA 1KQ0A 4V2GA 5H20A 1JTYA 3ABUA 3DU6A 3K70C 2YUSA 3V4GA 2HQNA 3K4MA 5H2FC 4E7KA 2P4WA 3KYDB 3KYCB 4MHGA 3QU3A 1F4KA 4KN4X 4DW6A 1WQ2A 3S3OA 5FO5A 5CQEA 2DT7B 3HEFA 2A5WA 2IAIA 2RVCA 2E2JJ 5EZHA 2EPFA 3RJPA 4A3CJ 2OQGA 2BXZA 3K7AJ 1MW7A 1FMWA 4RB2C 1UAAA 2E60A 4L5EA 2HXIA 3OIQA 4KMUX 5J3LA 3BR1A 1Z3XA 3BTCA 4R8HA 3TL4X 1DGRM 4EM2A 2QSGX 4KJZA 3LA2A 4YRVA 4CZZA 2KFDA 3LAPA 3EUHA 2ZXIA 3EYIA 1Z67A 2GQQA 5LLQA 3QPSA 1Z05A 1LPQA 1R00A 3OWTA 2VC0A 3LL7A 4BL0B 5L3FA 1WVRA 5DTDA 4CGZA 4AC0A 3H0DA 3DKWA 3WTUC 4NDLA 2E1MB 3I59B 3D0SA 2IS2A 3W3CA 1LVAA 3K4LA 4JK1X 5EZGA 3WHBA 5E8GA 5F04A 5M5WJ 2HNHA 2OAZA 5D6FA 3QPTA 3RQ4A 2V26A 1MMNA 3JRBA 1R7JA 1FYMA 2KMUA 5FD6A 2PN6A 3AG3H 2IBDA 2RQPA 1HF0A 4PJNA 5DDGA 1BI0A 5J4YA 3U21A 3GMEA 2H6BA 5KK1A 2M87A 1H9GA 2X0LA 4GCVA 4LD5A 1GT0C 2G9WA 3HOWJ 1XB4A 2X51A 4F3QA 4J00A 5GP9A 3DKXA 3JRAA 5CJ9A 2OCCH 1SFUA 1IXRC 2G7HA 2EILH 2X6WA 4KICA 3GCMA 1WJ5A 2H6CA 3S8PA 3CCMI 5C4XJ 3DV8A 3FXMA 3OS1A 1TWHJ 5DUKA 4Q4ZF 5GAGJ 2HDCA 3BJ6A 2RV8A 4P1WA 1AWCA 1BJZA 2DMQA 4Y15A 2RAEA 3C7JA 3H1CA 5DEQA 1I6HJ 2WAQA 1R6RA 1VI0A 3HOYJ 1R4NB 2DODA 1OQYA 5F1RA 2OF7A 4UHTA 1Z9CA 1Y39A 4EGYA 4HLXA 4N4OB 1KQ8A 2E2IJ 4MGRA 3OYAA 3K0LA 2NS8A 2NXNB 2V7FA 1ETQA 4IHXA 2R92J 4XRMA 4LG0A 2PMUA 4UVCA 2M7BA 2QBYA 4M72A 4BE2A 2OA4A 2QZ8A 5FLMJ 3P9IA 2NOJB 1P4WA 4N0BA 3U2RA 3MVPA 3TQNA 2DK5A 1CQTA 1KU2A 1F9NA 1E3PA 2HOAA 3HG9A 2ZKZA 4G7HF 2VB6A 3F72A 3FXRA 3ZXSA 2V1UA 1X2MA 1IO2A 3LSPA 2HTJA 3GFJA 1ZLKA 3FMQA 1Z6RA 3A03A 4HA8A 2Z1DA 2FBKA 4XRFA 3GTJJ 3ASOH 4KMFA 3LSIA 3ZMTA 4P55A 4HOBA 5HLTA 4ETSA 1MMAA 2JVGA 2WC2A 1MSEC 1NK2P 3ULQB 1Y56A 4RB3C 2OV7A 3E0JB 5LRRA 5KHDA 4XSXF 4BQOA 3AAFA 3MZHA 5EEGA 4HV6A 1IV6A 2M8GX 3GZ5A 2EQRA 2YS9A 2DA5A 1N77A 4IXAA 1TWFJ 2KDZA 2UWMA 4XN0A 4F52A 1KONA 2MSYA 1JUSA 1MBHA 2EZHA 4L9JA 1OR7A 3UKGA 3COAC 3LSGA 2HDDA 2LFBA 5E20A 1PYVA 1WRJA 4D7NA 1MSFC 1X1AA 3PFYA 2YR2A 2AXTC 4IHVA 1WJDA 3JREA 4M3BA 4JX4A 4ZZLA 3LSHA 3BPVA 4M6XA 3Q0WA 3H35A 2VBYA 1RESA 4R79A 4OOIA 3WG9A 1D1BA 4LFUA 3V8LA 1NK3P 5E1WA 5CPRB 2ZSHB 4BHPA 3GTOJ 1UHMA 2W24A 2GBYA 2BY1A 4QIWN 2ZFWA 3K4CA 3ABLH 3ZMDA 3TO6A 1XPXA 2DQRA 3SZPA 4DBQA 2JA6J 5LHHA 3CUOA 5D8LB 3PO3J 2UUZA 2VQLA 4CCJA 3WGIA 2NVYJ 4F91B 2PJRA 1K83J 4R1HA 3H36A 2F5VA 3QYFA 1X3WB 3K4NA 1E2XA 4B47A 2XAUA 2BOLA 1YJNI 4IRIA 3HXLA 2QA4I 2TCTA 1D8KA 5FFZA 2CRGA 3EYYA 5K7ZA 3OL3A 1Y0NA 3DBRB 3CF5F 2R5ZB 2HXOA 1O57A 4BHBA 5DM7F 1FPQA 4M6VA 4NHJA 5IOYA 1YJ9I 3G1OA 5DD8A 5F0FA 5HODA 2E34A 4EJUA 2GLOA 3E6BA 1VTNC 1JUMA 2DA3A 4IL6C 1HSTA 4RGXA 4LJZF 4WWCA 4BDYA 1R58A 1WGXA 3HZJA 5FLVA 2FSWA 3L2VA 5EJCA 3CJRB 1WZ2A 2DTZA 1RPWA 5BPIA 2LF8A 4XOTA 3OS0A 4BJ5C 5F0HA 2IGMA 2P7CB 2VUMJ 3IUOA 5KAIC 3TP3A 4H0EA 3VB2A 2QF7A 4H4KC 4MIMA 2GXBA 3HHGA 4L5JA 1GLNA 4IKFA 1FT9A 3RKQA 1O3TA 3OYFA 1FOXA 5F1JA 3PNYA 2HGCA 1L0OC 2VKEA 2EV5A 3VYRB 1SAUA 3PFIA 2P5VA 3SDBA 1T98A 3WGHA 5CVIA 3N97A 1ZRCA 2P6SA 1RC9A 4WXHA 3UR3C 1U3EM 2K85A 1OYWA 1MMSA 4RM2A 1B6AA 3ZR8X 4EGZA 3KP4A 2CV2A 2NVTJ 1QVTA 3CLOA 5J1RA 1YRNB 3I59A 3CCJI 1T8IA 1IZ1A 2CW8A 2CQKA 1ENHA 2CQQA 9ANTA 4A0ZA 4C3JJ 1R5HA 4B43A 3ML6A 3S15J 4FETA 3DLLF 5H6QA 1YHQI 1GVDA 3T5XA 1HW2A 1GV2A 3JRGA 1H9TA 3SHFA 2GA1A 5JHUA 3GLLA 2LYCA 2M7AA 5LHIA 4X1EA 5FKOA 5LRSA 2ZC2A 3I5UA 1R71A 5J40A 4RAGA 1D1AA 3WTWC 4EATA 3PNVA 2BE5F 1FP2A 1RRJA 1S9HA 2FF4A 4KUMA 2WAEA 3F8NA 1X4PA 4BY1J 2IA2A 1XMAA 4X6AJ 3WTTC 1QRYA 5GPAA 4ZYHA 4YG2F 1MJBA 2CG4A 4GYIA 3H9GA 3OR1C 5A2QZ 2DFIA 2GA2A 5ICCA 2DMNA 1R1VA 2I10A 3K6GA 3L2WA 1A31A 4LMYA 2WB1N 4YFNF 3FBNB 1X58A 4I98B 2X4HA 2H1LA 3RYPA 1Q1VA 2L02A 1E17A 4BS9A 1X1BA 2CQXA 4MFDA 5HS7A 2FXAA 2ME0A 4WXCA 1FSEA 5EGOB 3F3XA 2M1BA 3L2QA 4AIDA 1XSXA 1YIJI 4E7JA 3S3MA 1JT6A 5B66C 1W1WE 1JJ8C 3MKZA 2ELHA 2M8EA 5A2QK 4X0GA 1OLTA 3Q9VA 4UUSA 2KIFA 4B8XA 2CH0A 2NYXA 2FRHA 1X1DA 5IOZA 3S14J 1TQPA 1ZKGA 2L2OA 3ESWB 3V42A 3VYUB 2VIXA 3I54A 3K1MA 3DCFA 3U1KA 1IDZA 3CDIA 1ZREA 2HKXA 4UY8I 3C2GA 1BIAA 5C44J 5BQTA 2F48A 3TO9A 3HRSA 3DTKA 1C0WA 3BCAA 3CP8A 4U88A 2PJPA 2EB7A 2OZUA 3DKYA 2E1OA 4HDVA 2VQHA 1QZYA 1D5YA 3KEQA 3S17J 1X3ZB 2XRNA 3BROA 3KP5A 3KPHA 2DO7A 1IUFA 2MD0A 1ULYA 4RLFA 2IVMA 1GV5A 3BJAA 2HU9A 1Z1DA 2IW5A 3HYIA 3NARA 3ZMZA 5D8KB 4DZJA 2F5FA 3IWFA 4LIUA 3CD6I 3ZQQA 2O8XA 1R5ID 3VSLA 2HYJA 2E1NA 2WTEA 2KZGA 3G73A 1XCBA 5ICGA 2Q2EA 1ZR4A 1RZ4A 1LDDA 4XLAA 4PGGA 4ZZDA 1ZHFA 2CFOA 2VC1A 3K9TA 3MZYA 3HSEA 4U0VA 4WF2A 3CMAI 2STWA 1TW3A 4FISA 3W6JB 5K5RA 2DFEA 2L3DA 1TP4A 1WPKA 4B3XA 1FIPA 2BV6A 1YW7A 4I99C 2QQAA 2JQ7A 4ASNA 4L9TA 4BUPA 1ZQ3P 1DGWY 5FGMA 3K4BA 5BS6A 1B59A 2IA0A 2LSOA 2ZBKA 4M6YA 3SQNA 1S7AA 3TP0A 1SC7A 1G2HA 3S16J 2C6YA 2ZNYA 3KP7A 2R4GA 3FXUA 1S7OA 2GIZA 3VOEA 4E7HA 2ESHA 1D1CA 2LF7A 2PG4A 3SFIA 1O3SA 1X2NA 4HSTA 4LG0B 1S5LC 2AHQA 2QBYB 5EEHA 4DYQA 4XKCA 3E6MA 4W97A 2QSFX 1R36A 1O3QA 2F5DA 4G8XA 1HQCA 3K4KA 1B9NA 4XK4A 1Z0XA 2R7VA 4YEJA 3FZVA 2ZMEC 3SYTA 2Z2SB 1G8XA 1P7JA 1FYKA 3OSGA 2AS5F 5JHFA 5IPAA 1LB2A 2H27A 3I58A 4N4NB 1DU6A 5F0CA 4XRSA 1USTA 1KYZA 2R5ZA 4NB5A 2JN6A 5C3EJ 3GW2A 2STTA 1ZH5A 3F6VA 1YIOA 1LNWA 2W82A 1IV8A 4GYGA 2XGEA 1TBXA 4CCOA 4L0ZB 1W5SA 3EETA 2DJIA 3C2HA 1B8IA 2EFOA 2B7EA 2M0CA 4PJLA 2KKOA 5FROA 2Y0SN 3GVAA 4F92B 5KNLA 5HS9A 1J09A 3PUFA 1E3HA 3H9JA 4LK1F 1KU7A 3LMMA 4IHWA 1I27A 4XRSG 4L5IA 4IHYA 3OYMA 2Y9YA 2EFWA 2EFQA 3OYCA 1XCVA 4XLNF 1VQ8I 1IUYA 1J7KA 2OBPA 1TNSA 4XICA 1WI9A 1Z77A 4NUBA 4HW0A 2W85A 4LIVA 2GWRA 3CJNA 1TLHB 4AD9A 2B9SA 2CFXA 4I0AA 2E35A 3GWZA 3ZPLA 4RAZA 4NC7A 3V7CA 1U8RA 3IH2A 4AVPA 1EA3A 3ABMH 2R7QA 4ITVA 1MZBA 1OISA 3PO2J 3GYHX 2EIKH 3LQRA 5E3LA 4BACA 3PUBA 2HTSA 4A12A 4FT8A 2UV1A 2WAFA 3NAUA 1IXSB 4NC6A 4C2UA 4FX0A 1N75A 2DMTA 1YRNA 3HOUJ 3QAHA 3HOXJ 5JR3A 1PUEE 4BQQA 2Z99A 3FM5A 4U0WA 1ZRFA 4HZFA 1NG7A 2XIGA 5B5EC 2I5UA 4XOPA 3WTSC 4CA0A 3ZN1A 3HRMA 3S1NJ 4ZDOA 1IN5A 5GTIC 1TWCJ 5LEJA 4UVAA 3BQYA 2IXSA 4QSHA 5TRDA 2KIUA 1AHDP 6PAXA 1YX5A 2JSCA 1FIAA 4A3FJ 1VQ4I 3K70D 3D5LA 1YLFA 4D5FA 4G9YA 3FIWA 2OU2A 4XKWA 5CKTA 5JLWA 4ENNA 2HOSA 4TV7A 1A35A 1WFXA 1HDDC 4D7MA 1IW7F 1QZEA 1BA5A 2W4SA 3N4MA 1VQNI 1M1EB 5DS9A 2VPLA 2XPWA 2F5CA 3KX2A 3BOQA 2KIQA 3V7SA 1FBUA 2WB1A 3CCEI 3CJQB 3RKXA 4GFBA 2M30A 2M5WA 1NHAA 3E6DA 5FKMA 4BE0A 1SEUA 3I9V2 1JKQC 4DGWB 1XGOA 2CS3A 2OQRA 2L7ZA 3C1DA 3M07A 3OYNA 1MNMC 4B3AA 4OMZA 5ILUA 2V6EA 3BDDA 2DOEA 5F27A 3MKLA 3LFKA 1U6GA 3MCZA 4IRHA 5HDGA 5EGOA 3F8FA 3W6VA 2Z16A 2ZO4A 3ECOA 2LC2A 3VYTB 3LA7A 2LP0A 3QPLA 1Q1HA 1UELB 2Y48A 1XC5A 1UG2A 2K9QA 3QRFF 2VJIA 3G2BA 1VQ9I 2E1CA 3IH3A 4G12A 3BTLA 4HLYA 1SD7A 2XGXA 3BWGA 2DK8A 5CVRA 4ESBA 4KA4A 4L9NA 1YYVA 2X1DA 4YIIA 2LY9A 5HLIA 3M8JA 3ZP5A 5LD2C 1ZR2A 4CCMA 4IF4A 1WKMA 3H5NA 4WXDA 3GFLA 2J5OA 1GUUA 3GFIA 1WJBA 2JPCA 1K61A 2XASA 2JVHA 3QP5A 1XMXA 1R5GA 5LHGA 4AIKA 1T6SA 4IX7A 2Y2ZA 4Z2YA 3M1EA 4XBFA 4YELA 3K69A 4U87A 2RQQA 2DI3A 2EH3A 2VL8A 3IAS2 1FBSA 2EA4A 1FMVA 2KL4A 2EV6A 3OYHA 1T0FC 3HOSA 4AYBA 2FE3A 3OMYA 3L00A 1YFHA 2ZJ2A 2FOWA 4PDKA 5CVUA 4E6KG 2L5QA 3JRDA 2IJLA 4S04A 2QKMB 4RDUA 5F6FA 2JRMA 1VZ0A 3B6AA 4ZYEA 2IGOA 1A5JA 1P2FA 3DTEA 4HYEA 3RYRA 4M3FA 5IYBJ 2LNBA 4A6EA 5LFAA 1Z91A 3OYLA 2LD5A 4ENJA 3MQ0A 2JWTA 2MABA 3E6CC 2VKHA 1YW8A 1PP7U 3IC7A 1BBYA 4ENMA 4LB6B 2DCEA 4O3MA 3GTLJ 3TW6A 4RGUA 5DUIA 1W7PB 1ZK8A 2L7FP 2W1OA 1MNDA 2VXZA
chains in the Genus database with same CATH topology
3DEUA 3M7GA 3BP8A 4DNCA 3JSOA 2FBHA 5JFRA 1FC3A 2ZNZA 2QLZA 3QU6A 1O7LA 1XMKA 4G7ZF 3HHHA 4BYYA 2LDUA 4HF1A 5L3BA 1IN8A 5LGNA 1LQ1A 1LDKB 3EDPA 1Z6TA 1MJAA 2MBFA 2P5LC 2BYVE 2WV0A 1ZRDA 1JE8A 3LSTA 3GXOA 2XAQA 3ERED 4M9SA 3RPUA 3LA3A 3P9KA 3BY6A 4CICA 2F5EA 4RAYA 3RDIA 4S05A 5LGUA 4WX9A 1G4DA 3F8MA 3RKWA 4HF0A 3FXQA 2R3SA 5E18F 4OIOF 1U2WA 2GZWA 3WE3A 4UV8A 5D5XB 5ILVA 1TTYA 2ZCWA 3K1PA 2NNYA 4M9XA 1FY7A 1I5ZA 3I53A 1LJ9A 2DPDA 1QNTA 2YU3A 5E1ZB 2MD5A 1ZG1A 1KU3A 2QUFA 3FHZA 4ZYDA 3ZMUA 2MLKA 4GO1A 5BMZA 2YPRA 3BPXA 2W25A 5ED4A 1JXSA 5BOXA 4A2UA 2Z33A 1ODDA 2P6TA 1YO5C 4IJAA 2K86A 4M73A 5LBQA 1CF7B 5E17F 3W6KB 3FWEA 2PEXA 3R6SA 1RI7A 4OIQF 2EFPA 4UV9A 3TDUC 1BM9A 2KJCA 4P9FA 3T0YA 5D5UB 1EV7A 3O6BB 2HS5A 3KP6A 1W4MA 4I09A 3DF8A 3IWZA 4CO8A 1QGPA 3L7WA 1WSUA 3RIRA 1UHWA 1MD0A 1ONVA 3HTSB 2VBWA 5HS8A 3HSFA 4A6DA 2A07F 5TJJA 5FFXA 5IT3A 3WGGA 5JVTA 1UFMA 2UZKA 4PCQA 3J7AO 3MEXA 4UUVA 4OINF 3JAMZ 2ACJA 3M8EA 4BAYA 1S3JA 4KIBA 3Q9SA 4G6QA 2FNPA 2HQRA 2O6GE 4FX4A 4UVBA 4BQAA 4MQ9F 4ESJA 2QWWA 3JSPA 3DFGA 1ON1A 1SD5A 4MEXF 2QM3A 1YS7A 1FLIA 2XROA 3WTVC 2KJBA 2W57A 1EH8A 2CO5A 2VBXA 5E8IA 3JAMK 3VODA 1P6RA 1I1SA 2NS0A 1IN4A 3DPTA 1W7PA 2JTVA 2YSRA 3H3ZA 4HAMA 2O61A 3T8TA 5D4RA 2EK5A 4EVIA 4GXOA 1IN6A 1DDNA 1ZARA 4QWQA 1YTYA 1ZAOA 3P7NA 4MNUA 2XVCA 4L0YB 4K2EA 1D3YA 3GZ6A 3IKTA 2FNAA 4EJTA 2W84A 2XHKA 3SZTA 1S8NA 2K4BA 1S6LA 2ZXJA 1HW1A 4WCGA 1FYLA 1OYIA 1YS6A 3R0AA 1SFEA 4RGSA 2K02A 3F21A 2XV4S 2O0YA 1OYYA 2KIMA 4AWXB 2E7XA 1P92A 2VT2A 4EM0B 1RUOA 1R22A 3Q5FA 3WTZA 4OU0A 2XAJA 2XAFA 5L3GA 4M9ZA 1W5TA 2WWYA 3VFZA 1OPCA 1LEBA 2RKHA 2Q8KA 4CHUA 4P9UA 3I4PA 3TO7A 1IF1A 3IRRA 1UCRA 4RGRA 1PP8F 3KZZA 1BI1A 3P9CA 4QLCU 3V8JA 5D5VB 2XAGA 1YG2A 4HV5A 4Q48A 3H3UA 1PDNC 1KQ9A 3KP2A 2IA1A 3H92A 2LKPA 4L9VA 4HQMA 3CO6C 3R61A 2Y0MA 2DW4A 1OMIA 2NRAC 5J8CA 4YIFA 3ISPA 1CF7A 1MKMA 2PQ8A 4IHSA 3HTUA 1STZA 5ERIA 3ELKA 5J6XA 1T0FA 1HXDA 2JZYA 4PGHA 3V7RA 3FMSA 2DAOA 2K27A 4ESFA 5AIQA 4I2OA 1W7PD 3WODF 1XSVA 4E70A 3O2PE 2UXXA 2GAUA 2IT0A 2EWNA 2MLGA 1MDMB 4A5NA 4KT5C 2RN7A 3E5XA 3WTYC 3NQOA 2HYGD 5D6EA 2FOKA 4HBLA 3NEUA 4Q47A 4U0YA 3QOPA 1XD7A 4EV0A 1DPUA 4CYDA 2HWVA 3J81Z 4EJOA 2V9VA 4HX4A 1CGPA 1A04A 3K1NA 3EQLF 2BGCA 5H6RA 2MA3A 3KFWX 1DPRA 2HR3A 1G3YA 4KYWA 5HVQC 4MTEA 2IP2A 2PBIA 2VN2A 2FEZA 3F22A 4MTDA 2RNJA 1K6OA 2EV0A 4I7HA 4BNCA 1LDJA 1X3UA 3J81K 4AIJA 5AIPA 5AONA 4XLPF 4IRGA 1JHFA 1J0RA 4JQFA 2AXLA 2L01A 2QQ9A 3MFKA 1IXCA 3CTAA 2UXNA 3L09A 1G3WA 2JPBA 1F5TA 1U5TC 1T2KA 3TKYA 4I0BA 1H0MA 3ZN0A 1O3RA 3QP6A 2NAZA 2PLYA 1UB9A 2COMA 1ZN2A 4U7DA 3KCCA 2Z3YA 1B4AA 4CXFA 3I0TA 2DU9A 1HSJA 2FA5A 1KU9A 2HKOA 1G3SA 1BI3A 2OD5A 2G7UA 1QO0D 1IN7A 3MAJA 4EM1A 1R1TA 1T39A 2ZMEB 3KP3A 5HDNA 5FLXZ 3IRQA 5L3EA 1FX7A 1XDSA 3KZYA 2P7VB 1J5YA 1IRGA 3F6OA 3RTRA 2DQLA 2V1XA 3KLNA 5D5WB 1L3LA 2EJRA 1IRFA 3R0JA 2E7WA 1TQIA 4KIGA 3HIFA 2GIVA 5FLXK 2HZTA 1F1ZA 3U1DA 1KGSA 3HRTA 5HLGA 3O3KA 4UNOA 1J9IA 2BEOA 2IRFG 1Z7UA 2DTRA 3PQJA 4ENKA 3I71A 3PQKA 1FWZA 3CUQC 4HDUA 4EJWA 4M74A 1FOKA 5FD5A 3KEOA 4XSZF 1HW5A 4HF2A 3G3ZA 2A69F 4KNYA 3VEPA 1HBXG 4Y17A 2ISZA 1EH7A 4G94A 1XN7A 3ROUA 2ETHA 3DXJF 1R1UA 5J8FA 1O7FA 4BHCA 2EFNA 4D0PA 2CW0F 3F8CA 2DLLA 4LGWA 1YQAA 3E5QA 4P96A 1D5VA 2XUBA 4IVNA 2KRFA 5JI6A 1SMYF 3R4KA 2B0LA 3T8RA 2HOEA 5CLSA 1MGTA 1MJ9A 1REPC 5DCMB 4FHTA 1GXPA 2VBZA 5CVVA 3REOA 1MDMA 4M71A 3E5UA 3IHUA 1J59A 1K7AA 1GXQA 3TOBA 4A0XA 1S29A 5DCFA 1XGNA 1U5TB 3NRVA 3M9AA 3B73A 3C3WA 5K5OA 3S2WA 4ON0A 4U7BA 2TDXA 4YFXF 4GGGA 1TNTA 4O5VA 4BH9A 2PFBA 1QZZA 4Q5SF 2R7DA 3L9FA 2R7FA 2K4JA 3J80Z 4HQEA 3IL2A 1QBJA 5D4SA 2VE9A 2HFHA 3V8KA 4B09A 5FB2A 1DP7P 2FBIA 4F7ZA 1HKTA 2ESNA 3FM3A 1RUNA 1ON2A 3WTXC 1BC7C 5LGTA 1SMTA 4LB5A 1EH6A 2CSOA 1V4RA 3T1BA 1FNNA 4DQ2A 3WE2A 2HEOA 2H09A 3J80K 2XAHA 1ZGAA 2FMYA 1DUXC 2D45A 3ECHA 1FZPB 2CYYA 3BZ6A 2MH2A 3E3VA 1K78B 5L3CA 4A0YA 1P4AA 3L2CA 2K7LA 4OMYA 4LLGF 3HRUA 3CDHA 3CUQB 1ZG5A 5ICFA 3TGNA 2FMLA 1XGSA 2YX4A 4N9IA 4RB1A 2VT3A 2A6HF 2ZMEA 1BOAA 2OZ6A 4UXNA 1AOYA 3JTHA 2Y75A 1IAWA 1USSA 4KN7X 4JBAA 3DQVC 4HX7A 1BN5A 2GXGA 2BBYA 5E1XA 4O6JA 2H94A 4BXUA 5HOOA 1FP1D 5DV5A 1BI2A 2QQBA 3B02A 3CO7C 2MH9A 1XDUA 2V6CA 1G6NA 5HDKA 5ICEA 1ZLJA 1JGSA 3LAJA 2CWEA 1B9MA 2Z9OA 2RC4A 3OV8A 4LK0F 5F64A 2DBBA 4P5OA 3HOTA 1RNLA 2ADUA 1J2XA 1BJAA 4I02A 4IHTA 5HLHA 5DYMA 3F8BA 2JT1A 3GF2A 4RB0A 5ILSA 4EQQA 3M8FA 2EA2A 1U78A 4L18B 4I01A 3KLOA 4EMSA 2IPQX 4OIPF 4EJVA 4KIFA 2YX7A 3GFMA 3BJOA 3GEZA 2RGVA 3KETA 2A5YB 2RDPA 5CYVA 4KFCA 5BPDA 2FQ3A 1ZG3A 3OOPA 1WWXA 4N9HA 4OIRF 5DCMA 4YFKF 2VOOA 4LLLA 2NNNA 3FMRA 1FBQA 3JTGA 5DD4A 3GO5A 3WU1B 2VE8A 1RIOH 1U5TA 3C18A 3SXYA 3HUGA 2JRTA 4KDPA 1T38A 2M45A 2FU4A 3F23A 2QYOA 2J5PA 3MWMA 5K1YA 2P5KA 4ZH4F 2Z5UA 4G7OF 1D8JA 2D1HA 1KYWA 1Y0UA 2L4AA 1I1GA 4WK8F 3LWFA 3RI4A 3HSRA 5KVRA 1YW9A 5IT9Z 3RKYA 4Y13A 1GHCA 1HKSA 1LEAA 4MQVA 2VOPA 3FF5A 1ZYRF 1J75A 3SFZA 3FX3A 2CGPA 1FSHA 2XKPA 3JW4A 5LEKA 1XSDA 1SFXA 1TW2A 3IKVA 3GUDA 3ZMVA 4ZYGA 2L4MA 5CVJA 3GX4X 5IT9K 1SAXA 2L54A 1HKQA 3ZQ7A 3QPHA 3KE2A 1ZGJA 4CDGA 2D2WA 1K78A 2D1VA 1XGMA 1QPMA 3GLXA 4MEYF 3DPLC 4G6DA 3U9GA 1K79A 2A6EF 3CUQA 3K2ZA 2ISYA 3DP7A 2QVOA 1JHHA 3TOAA 2DT5A 4RS8A 2DPUA 1KA8A 2V79A 3ABTA 2O3FA 2P8TA 2VODA 2QENA 2F2EA 3R60A 5K5QA 3TDZC 1OKRA 1R23A 1TQMA 2Q0OA 2A3SA 2PMHA 4PZJA 4A5MA 1B1BA 1BC8C 1GVJA 2MC3A 3LQQA 2PI0A 1V3FA 3WU0A 1BIBA 4HX8A 4LLNA 3I64A 4NQWA 3E97A 1G3TA 4AIHA 2XKOA 2A61A 2V1DA 2O03A 1QQIA 2HYFA 3RPQA 2VONA 5L3DA 1SD6A 4IPAA 1P4XA 2A68F 1I6XA 1SD4A 3ZMSA 1KQ0A 5H20A 3ABUA 3V4GA 2HQNA 2P4WA 4MHGA 3QU3A 1F4KA 4KN4X 1WQ2A 5FO5A 2RVCA 3RJPA 2OQGA 4RB2C 4KMUX 4R8HA 4EM2A 3LA2A 4CZZA 3LAPA 3EUHA 3EYIA 2GQQA 5LLQA 1Z05A 1R00A 2VC0A 5L3FA 4CGZA 3DKWA 3WTUC 3I59B 3D0SA 1LVAA 4JK1X 5E8GA 2OAZA 5D6FA 3QPTA 1FYMA 1R7JA 5FD6A 2PN6A 2RQPA 5DDGA 1BI0A 5KK1A 2H6BA 2M87A 1H9GA 2X0LA 4GCVA 4LD5A 2G9WA 1XB4A 5CJ9A 1SFUA 1IXRC 2G7HA 4KICA 2H6CA 3DV8A 5DUKA 4Q4ZF 2HDCA 3BJ6A 2RV8A 1AWCA 4Y15A 3C7JA 5DEQA 5F1RA 4UHTA 1Z9CA 4EGYA 4HLXA 1KQ8A 4MGRA 3K0LA 4LG0A 2PMUA 4UVCA 2QBYA 4M72A 2OA4A 2QZ8A 3P9IA 1P4WA 4N0BA 3U2RA 3TQNA 2DK5A 1KU2A 1F9NA 2ZKZA 4G7HF 3F72A 3FXRA 2V1UA 2HTJA 3GFJA 1ZLKA 3FMQA 1Z6RA 4HA8A 2FBKA 4XRFA 4KMFA 3ZMTA 4P55A 4HOBA 4ETSA 2WC2A 3ULQB 4RB3C 5LRRA 4XSXF 3AAFA 3MZHA 5EEGA 4HV6A 3GZ5A 4IXAA 2UWMA 4L9JA 1OR7A 3COAC 5E20A 1WRJA 2YR2A 4ZZLA 3BPVA 4M6XA 2VBYA 4R79A 4OOIA 3WG9A 4LFUA 3V8LA 5E1WA 4BHPA 1UHMA 2W24A 2ZFWA 3ZMDA 3TO6A 2DQRA 3SZPA 5LHHA 3CUOA 5D8LB 3WGIA 4R1HA 1E2XA 4IRIA 1D8KA 5FFZA 3EYYA 1O57A 4BHBA 1FPQA 4NHJA 5DD8A 4EJUA 3E6BA 1VTNC 1HSTA 4RGXA 4LJZF 4WWCA 1R58A 2FSWA 5BPIA 2LF8A 2P7CB 4H0EA 3VB2A 2GXBA 3HHGA 4L5JA 1FT9A 1O3TA 2HGCA 1L0OC 2EV5A 3PFIA 2P5VA 1T98A 3WGHA 5CVIA 3N97A 1ZRCA 2P6SA 4WXHA 1U3EM 1OYWA 1B6AA 4EGZA 3KP4A 3CLOA 3I59A 1IZ1A 2CQKA 4A0ZA 1R5HA 3ML6A 5H6QA 3T5XA 1HW2A 1H9TA 3SHFA 2GA1A 5JHUA 5LHIA 5LRSA 3I5UA 3WTWC 2BE5F 1FP2A 2FF4A 4KUMA 3F8NA 2IA2A 1XMAA 3WTTC 4ZYHA 4YG2F 1MJBA 2CG4A 4GYIA 5A2QZ 2DFIA 2GA2A 5ICCA 1R1VA 4LMYA 4YFNF 4I98B 2X4HA 3RYPA 2L02A 1E17A 5HS7A 2FXAA 4WXCA 1FSEA 3F3XA 2M1BA 1XSXA 2ELHA 2M8EA 5A2QK 3Q9VA 2KIFA 4B8XA 2NYXA 2FRHA 1TQPA 3I54A 3K1MA 1ZREA 2HKXA 1BIAA 5BQTA 3TO9A 3HRSA 1C0WA 4U88A 2PJPA 2EB7A 2OZUA 4HDVA 1QZYA 3KEQA 2XRNA 3BROA 3KP5A 2DO7A 1ULYA 2IVMA 3BJAA 1Z1DA 2IW5A 3HYIA 3ZMZA 5D8KB 2F5FA 3IWFA 2O8XA 2E1NA 2WTEA 3G73A 1XCBA 5ICGA 2Q2EA 1RZ4A 1LDDA 4PGGA 4ZZDA 1ZHFA 2VC1A 3K9TA 3MZYA 4U0VA 3HSEA 4WF2A 2STWA 1TW3A 3W6JB 5K5RA 2L3DA 2BV6A 1YW7A 2QQAA 4ASNA 4L9TA 5FGMA 5BS6A 1B59A 2IA0A 2LSOA 2ZBKA 4M6YA 3SQNA 1S7AA 2C6YA 2ZNYA 3KP7A 3FXUA 1S7OA 3VOEA 2ESHA 2LF7A 2PG4A 1O3SA 4LG0B 2QBYB 5EEHA 3E6MA 1R36A 1O3QA 2F5DA 4G8XA 1HQCA 1B9NA 3FZVA 1FYKA 2AS5F 1LB2A 2H27A 3I58A 1USTA 1KYZA 4NB5A 3GW2A 2STTA 1ZH5A 3F6VA 1YIOA 1LNWA 4GYGA 1TBXA 4L0ZB 1W5SA 3EETA 2EFOA 2KKOA 3GVAA 5HS9A 4LK1F 1KU7A 1I27A 4L5IA 2EFWA 2EFQA 1XCVA 4XLNF 1IUYA 1J7KA 2OBPA 1TNSA 1WI9A 4HW0A 2W85A 2GWRA 3CJNA 1TLHB 4AD9A 2CFXA 4I0AA 3ZPLA 3GWZA 4RAZA 3V7CA 1U8RA 4AVPA 1MZBA 3GYHX 3LQRA 4A12A 2HTSA 4FT8A 1IXSB 4FX0A 3QAHA 1PUEE 5JR3A 2Z99A 3FM5A 4U0WA 1ZRFA 4HZFA 2XIGA 3WTSC 3ZN1A 3HRMA 1IN5A 5LEJA 4UVAA 5TRDA 2KIUA 6PAXA 2JSCA 3D5LA 1YLFA 4G9YA 2OU2A 4ENNA 4TV7A 1IW7F 3N4MA 2F5CA 3BOQA 3V7SA 1FBUA 3RKXA 2M30A 2M5WA 1NHAA 3E6DA 1XGOA 2OQRA 3C1DA 4OMZA 5ILUA 3BDDA 3LFKA 1U6GA 3MCZA 4IRHA 5HDGA 3F8FA 2ZO4A 3ECOA 3LA7A 1Q1HA 2Y48A 3QRFF 2E1CA 4HLYA 1SD7A 2XGXA 3BWGA 2DK8A 5CVRA 4ESBA 4KA4A 4L9NA 1YYVA 4YIIA 5HLIA 3ZP5A 4IF4A 1WKMA 4WXDA 3GFLA 2J5OA 3GFIA 2JPCA 2XASA 3QP5A 5LHGA 1R5GA 4AIKA 1T6SA 4Z2YA 3M1EA 4XBFA 3K69A 2DI3A 1FBSA 2EA4A 2EV6A 3HOSA 2FE3A 3L00A 1YFHA 2ZJ2A 4PDKA 5CVUA 2IJLA 4S04A 5F6FA 4ZYEA 1P2FA 4HYEA 3RYRA 2LNBA 4A6EA 1Z91A 4ENJA 3MQ0A 3E6CC 1YW8A 1PP7U 3IC7A 1BBYA 4ENMA 4LB6B 4O3MA 4RGUA 5DUIA 1W7PB 2VXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEU A;  3M7G A;  3BP8 A;  4DNC A;  3JSO A;  2FBH A;  5JFR A;  1FC3 A;  2ZNZ A;  2QLZ A;  3QU6 A;  1O7L A;  1XMK A;  4G7Z F;  3HHH A;  4BYY A;  2LDU A;  4HF1 A;  5L3B A;  1IN8 A;  5LGN A;  1LQ1 A;  1LDK B;  3EDP A;  1Z6T A;  1MJA A;  2MBF A;  2P5L C;  2BYV E;  2WV0 A;  1ZRD A;  1JE8 A;  3LST A;  3GXO A;  2XAQ A;  3ERE D;  4M9S A;  3RPU A;  3LA3 A;  3P9K A;  3BY6 A;  4CIC A;  2F5E A;  4RAY A;  3RDI A;  4S05 A;  5LGU A;  4WX9 A;  1G4D A;  3F8M A;  3RKW A;  4HF0 A;  3FXQ A;  2R3S A;  5E18 F;  4OIO F;  1U2W A;  2GZW A;  3WE3 A;  4UV8 A;  5D5X B;  5ILV A;  1TTY A;  2ZCW A;  3K1P A;  2NNY A;  4M9X A;  1FY7 A;  1I5Z A;  3I53 A;  1LJ9 A;  2DPD A;  1QNT A;  2YU3 A;  5E1Z B;  2MD5 A;  1ZG1 A;  1KU3 A;  2QUF A;  3FHZ A;  4ZYD A;  3ZMU A;  2MLK A;  4GO1 A;  5BMZ A;  2YPR A;  3BPX A;  2W25 A;  5ED4 A;  1JXS A;  5BOX A;  4A2U A;  2Z33 A;  1ODD A;  2P6T A;  1YO5 C;  4IJA A;  2K86 A;  4M73 A;  5LBQ A;  1CF7 B;  5E17 F;  3W6K B;  3FWE A;  2PEX A;  3R6S A;  1RI7 A;  4OIQ F;  2EFP A;  4UV9 A;  3TDU C;  1BM9 A;  2KJC A;  4P9F A;  3T0Y A;  5D5U B;  1EV7 A;  3O6B B;  2HS5 A;  3KP6 A;  1W4M A;  4I09 A;  3DF8 A;  3IWZ A;  4CO8 A;  1QGP A;  3L7W A;  1WSU A;  3RIR A;  1UHW A;  1MD0 A;  1ONV A;  3HTS B;  2VBW A;  5HS8 A;  3HSF A;  4A6D A;  2A07 F;  5TJJ A;  5FFX A;  5IT3 A;  3WGG A;  5JVT A;  1UFM A;  2UZK A;  4PCQ A;  3J7A O;  3MEX A;  4UUV A;  4OIN F;  3JAM Z;  2ACJ A;  3M8E A;  4BAY A;  1S3J A;  4KIB A;  3Q9S A;  4G6Q A;  2FNP A;  2HQR A;  2O6G E;  4FX4 A;  4UVB A;  4BQA A;  4MQ9 F;  4ESJ A;  2QWW A;  3JSP A;  3DFG A;  1ON1 A;  1SD5 A;  4MEX F;  2QM3 A;  1YS7 A;  1FLI A;  2XRO A;  3WTV C;  2KJB A;  2W57 A;  1EH8 A;  2CO5 A;  2VBX A;  5E8I A;  3JAM K;  3VOD A;  1P6R A;  1I1S A;  2NS0 A;  1IN4 A;  3DPT A;  1W7P A;  2JTV A;  2YSR A;  3H3Z A;  4HAM A;  2O61 A;  3T8T A;  5D4R A;  2EK5 A;  4EVI A;  4GXO A;  1IN6 A;  1DDN A;  1ZAR A;  4QWQ A;  1YTY A;  1ZAO A;  3P7N A;  4MNU A;  2XVC A;  4L0Y B;  4K2E A;  1D3Y A;  3GZ6 A;  3IKT A;  2FNA A;  4EJT A;  2W84 A;  2XHK A;  3SZT A;  1S8N A;  2K4B A;  1S6L A;  2ZXJ A;  1HW1 A;  4WCG A;  1FYL A;  1OYI A;  1YS6 A;  3R0A A;  1SFE A;  4RGS A;  2K02 A;  3F21 A;  2XV4 S;  2O0Y A;  1OYY A;  2KIM A;  4AWX B;  2E7X A;  1P92 A;  2VT2 A;  4EM0 B;  1RUO A;  1R22 A;  3Q5F A;  3WTZ A;  4OU0 A;  2XAJ A;  2XAF A;  5L3G A;  4M9Z A;  1W5T A;  2WWY A;  3VFZ A;  1OPC A;  1LEB A;  2RKH A;  2Q8K A;  4CHU A;  4P9U A;  3I4P A;  3TO7 A;  1IF1 A;  3IRR A;  1UCR A;  4RGR A;  1PP8 F;  3KZZ A;  1BI1 A;  3P9C A;  4QLC U;  3V8J A;  5D5V B;  2XAG A;  1YG2 A;  4HV5 A;  4Q48 A;  3H3U A;  1PDN C;  1KQ9 A;  3KP2 A;  2IA1 A;  3H92 A;  2LKP A;  4L9V A;  4HQM A;  3CO6 C;  3R61 A;  2Y0M A;  2DW4 A;  1OMI A;  2NRA C;  5J8C A;  4YIF A;  3ISP A;  1CF7 A;  1MKM A;  2PQ8 A;  4IHS A;  3HTU A;  1STZ A;  5ERI A;  3ELK A;  5J6X A;  1T0F A;  1HXD A;  2JZY A;  4PGH A;  3V7R A;  3FMS A;  2DAO A;  2K27 A;  4ESF A;  5AIQ A;  4I2O A;  1W7P D;  3WOD F;  1XSV A;  4E70 A;  3O2P E;  2UXX A;  2GAU A;  2IT0 A;  2EWN A;  2MLG A;  1MDM B;  4A5N A;  4KT5 C;  2RN7 A;  3E5X A;  3WTY C;  3NQO A;  2HYG D;  5D6E A;  2FOK A;  4HBL A;  3NEU A;  4Q47 A;  4U0Y A;  3QOP A;  1XD7 A;  4EV0 A;  1DPU A;  4CYD A;  2HWV A;  3J81 Z;  4EJO A;  2V9V A;  4HX4 A;  1CGP A;  1A04 A;  3K1N A;  3EQL F;  2BGC A;  5H6R A;  2MA3 A;  3KFW X;  1DPR A;  2HR3 A;  1G3Y A;  4KYW A;  5HVQ C;  4MTE A;  2IP2 A;  2PBI A;  2VN2 A;  2FEZ A;  3F22 A;  4MTD A;  2RNJ A;  1K6O A;  2EV0 A;  4I7H A;  4BNC A;  1LDJ A;  1X3U A;  3J81 K;  4AIJ A;  5AIP A;  5AON A;  4XLP F;  4IRG A;  1JHF A;  1J0R A;  4JQF A;  2AXL A;  2L01 A;  2QQ9 A;  3MFK A;  1IXC A;  3CTA A;  2UXN A;  3L09 A;  1G3W A;  2JPB A;  1F5T A;  1U5T C;  1T2K A;  3TKY A;  4I0B A;  1H0M A;  3ZN0 A;  1O3R A;  3QP6 A;  2NAZ A;  2PLY A;  1UB9 A;  2COM A;  1ZN2 A;  4U7D A;  3KCC A;  2Z3Y A;  1B4A A;  4CXF A;  3I0T A;  2DU9 A;  1HSJ A;  2FA5 A;  1KU9 A;  2HKO A;  1G3S A;  1BI3 A;  2OD5 A;  2G7U A;  1QO0 D;  1IN7 A;  3MAJ A;  4EM1 A;  1R1T A;  1T39 A;  2ZME B;  3KP3 A;  5HDN A;  5FLX Z;  3IRQ A;  5L3E A;  1FX7 A;  1XDS A;  3KZY A;  2P7V B;  1J5Y A;  1IRG A;  3F6O A;  3RTR A;  2DQL A;  2V1X A;  3KLN A;  5D5W B;  1L3L A;  2EJR A;  1IRF A;  3R0J A;  2E7W A;  1TQI A;  4KIG A;  3HIF A;  2GIV A;  5FLX K;  2HZT A;  1F1Z A;  3U1D A;  1KGS A;  3HRT A;  5HLG A;  3O3K A;  4UNO A;  1J9I A;  2BEO A;  2IRF G;  1Z7U A;  2DTR A;  3PQJ A;  4ENK A;  3I71 A;  3PQK A;  1FWZ A;  3CUQ C;  4HDU A;  4EJW A;  4M74 A;  1FOK A;  5FD5 A;  3KEO A;  4XSZ F;  1HW5 A;  4HF2 A;  3G3Z A;  2A69 F;  4KNY A;  3VEP A;  1HBX G;  4Y17 A;  2ISZ A;  1EH7 A;  4G94 A;  1XN7 A;  3ROU A;  2ETH A;  3DXJ F;  1R1U A;  5J8F A;  1O7F A;  4BHC A;  2EFN A;  4D0P A;  2CW0 F;  3F8C A;  2DLL A;  4LGW A;  1YQA A;  3E5Q A;  4P96 A;  1D5V A;  2XUB A;  4IVN A;  2KRF A;  5JI6 A;  1SMY F;  3R4K A;  2B0L A;  3T8R A;  2HOE A;  5CLS A;  1MGT A;  1MJ9 A;  1REP C;  5DCM B;  4FHT A;  1GXP A;  2VBZ A;  5CVV A;  3REO A;  1MDM A;  4M71 A;  3E5U A;  3IHU A;  1J59 A;  1K7A A;  1GXQ A;  3TOB A;  4A0X A;  1S29 A;  5DCF A;  1XGN A;  1U5T B;  3NRV A;  3M9A A;  3B73 A;  3C3W A;  5K5O A;  3S2W A;  4ON0 A;  4U7B A;  2TDX A;  4YFX F;  4GGG A;  1TNT A;  4O5V A;  4BH9 A;  2PFB A;  1QZZ A;  4Q5S F;  2R7D A;  3L9F A;  2R7F A;  2K4J A;  3J80 Z;  4HQE A;  3IL2 A;  1QBJ A;  5D4S A;  2VE9 A;  2HFH A;  3V8K A;  4B09 A;  5FB2 A;  1DP7 P;  2FBI A;  4F7Z A;  1HKT A;  2ESN A;  3FM3 A;  1RUN A;  1ON2 A;  3WTX C;  1BC7 C;  5LGT A;  1SMT A;  4LB5 A;  1EH6 A;  2CSO A;  1V4R A;  3T1B A;  1FNN A;  4DQ2 A;  3WE2 A;  2HEO A;  2H09 A;  3J80 K;  2XAH A;  1ZGA A;  2FMY A;  1DUX C;  2D45 A;  3ECH A;  1FZP B;  2CYY A;  3BZ6 A;  2MH2 A;  3E3V A;  1K78 B;  5L3C A;  4A0Y A;  1P4A A;  3L2C A;  2K7L A;  4OMY A;  4LLG F;  3HRU A;  3CDH A;  3CUQ B;  1ZG5 A;  5ICF A;  3TGN A;  2FML A;  1XGS A;  2YX4 A;  4N9I A;  4RB1 A;  2VT3 A;  2A6H F;  2ZME A;  1BOA A;  2OZ6 A;  4UXN A;  1AOY A;  3JTH A;  2Y75 A;  1IAW A;  1USS A;  4KN7 X;  4JBA A;  3DQV C;  4HX7 A;  1BN5 A;  2GXG A;  2BBY A;  5E1X A;  4O6J A;  2H94 A;  4BXU A;  5HOO A;  1FP1 D;  5DV5 A;  1BI2 A;  2QQB A;  3B02 A;  3CO7 C;  2MH9 A;  1XDU A;  2V6C A;  1G6N A;  5HDK A;  5ICE A;  1ZLJ A;  1JGS A;  3LAJ A;  2CWE A;  1B9M A;  2Z9O A;  2RC4 A;  3OV8 A;  4LK0 F;  5F64 A;  2DBB A;  4P5O A;  3HOT A;  1RNL A;  2ADU A;  1J2X A;  1BJA A;  4I02 A;  4IHT A;  5HLH A;  5DYM A;  3F8B A;  2JT1 A;  3GF2 A;  4RB0 A;  5ILS A;  4EQQ A;  3M8F A;  2EA2 A;  1U78 A;  4L18 B;  4I01 A;  3KLO A;  4EMS A;  2IPQ X;  4OIP F;  4EJV A;  4KIF A;  2YX7 A;  3GFM A;  3BJO A;  3GEZ A;  2RGV A;  3KET A;  2A5Y B;  2RDP A;  5CYV A;  4KFC A;  5BPD A;  2FQ3 A;  1ZG3 A;  3OOP A;  1WWX A;  4N9H A;  4OIR F;  5DCM A;  4YFK F;  2VOO A;  4LLL A;  2NNN A;  3FMR A;  1FBQ A;  3JTG A;  5DD4 A;  3GO5 A;  3WU1 B;  2VE8 A;  1RIO H;  1U5T A;  3C18 A;  3SXY A;  3HUG A;  2JRT A;  4KDP A;  1T38 A;  2M45 A;  2FU4 A;  3F23 A;  2QYO A;  2J5P A;  3MWM A;  5K1Y A;  2P5K A;  4ZH4 F;  2Z5U A;  4G7O F;  1D8J A;  2D1H A;  1KYW A;  1Y0U A;  2L4A A;  1I1G A;  4WK8 F;  3LWF A;  3RI4 A;  3HSR A;  5KVR A;  1YW9 A;  5IT9 Z;  3RKY A;  4Y13 A;  1GHC A;  1HKS A;  1LEA A;  4MQV A;  2VOP A;  3FF5 A;  1ZYR F;  1J75 A;  3SFZ A;  3FX3 A;  2CGP A;  1FSH A;  2XKP A;  3JW4 A;  5LEK A;  1XSD A;  1SFX A;  1TW2 A;  3IKV A;  3GUD A;  3ZMV A;  4ZYG A;  2L4M A;  5CVJ A;  3GX4 X;  5IT9 K;  1SAX A;  2L54 A;  1HKQ A;  3ZQ7 A;  3QPH A;  3KE2 A;  1ZGJ A;  4CDG A;  2D2W A;  1K78 A;  2D1V A;  1XGM A;  1QPM A;  3GLX A;  4MEY F;  3DPL C;  4G6D A;  3U9G A;  1K79 A;  2A6E F;  3CUQ A;  3K2Z A;  2ISY A;  3DP7 A;  2QVO A;  1JHH A;  3TOA A;  2DT5 A;  4RS8 A;  2DPU A;  1KA8 A;  2V79 A;  3ABT A;  2O3F A;  2P8T A;  2VOD A;  2QEN A;  2F2E A;  3R60 A;  5K5Q A;  3TDZ C;  1OKR A;  1R23 A;  1TQM A;  2Q0O A;  2A3S A;  2PMH A;  4PZJ A;  4A5M A;  1B1B A;  1BC8 C;  1GVJ A;  2MC3 A;  3LQQ A;  2PI0 A;  1V3F A;  3WU0 A;  1BIB A;  4HX8 A;  4LLN A;  3I64 A;  4NQW A;  3E97 A;  1G3T A;  4AIH A;  2XKO A;  2A61 A;  2V1D A;  2O03 A;  1QQI A;  2HYF A;  3RPQ A;  2VON A;  5L3D A;  1SD6 A;  4IPA A;  1P4X A;  2A68 F;  1I6X A;  1SD4 A;  3ZMS A;  1KQ0 A;  5H20 A;  3ABU A;  3V4G A;  2HQN A;  2P4W A;  4MHG A;  3QU3 A;  1F4K A;  4KN4 X;  1WQ2 A;  5FO5 A;  2RVC A;  3RJP A;  2OQG A;  4RB2 C;  4KMU X;  4R8H A;  4EM2 A;  3LA2 A;  4CZZ A;  3LAP A;  3EUH A;  3EYI A;  2GQQ A;  5LLQ A;  1Z05 A;  1R00 A;  2VC0 A;  5L3F A;  4CGZ A;  3DKW A;  3WTU C;  3I59 B;  3D0S A;  1LVA A;  4JK1 X;  5E8G A;  2OAZ A;  5D6F A;  3QPT A;  1FYM A;  1R7J A;  5FD6 A;  2PN6 A;  2RQP A;  5DDG A;  1BI0 A;  5KK1 A;  2H6B A;  2M87 A;  1H9G A;  2X0L A;  4GCV A;  4LD5 A;  2G9W A;  1XB4 A;  5CJ9 A;  1SFU A;  1IXR C;  2G7H A;  4KIC A;  2H6C A;  3DV8 A;  5DUK A;  4Q4Z F;  2HDC A;  3BJ6 A;  2RV8 A;  1AWC A;  4Y15 A;  3C7J A;  5DEQ A;  5F1R A;  4UHT A;  1Z9C A;  4EGY A;  4HLX A;  1KQ8 A;  4MGR A;  3K0L A;  4LG0 A;  2PMU A;  4UVC A;  2QBY A;  4M72 A;  2OA4 A;  2QZ8 A;  3P9I A;  1P4W A;  4N0B A;  3U2R A;  3TQN A;  2DK5 A;  1KU2 A;  1F9N A;  2ZKZ A;  4G7H F;  3F72 A;  3FXR A;  2V1U A;  2HTJ A;  3GFJ A;  1ZLK A;  3FMQ A;  1Z6R A;  4HA8 A;  2FBK A;  4XRF A;  4KMF A;  3ZMT A;  4P55 A;  4HOB A;  4ETS A;  2WC2 A;  3ULQ B;  4RB3 C;  5LRR A;  4XSX F;  3AAF A;  3MZH A;  5EEG A;  4HV6 A;  3GZ5 A;  4IXA A;  2UWM A;  4L9J A;  1OR7 A;  3COA C;  5E20 A;  1WRJ A;  2YR2 A;  4ZZL A;  3BPV A;  4M6X A;  2VBY A;  4R79 A;  4OOI A;  3WG9 A;  4LFU A;  3V8L A;  5E1W A;  4BHP A;  1UHM A;  2W24 A;  2ZFW A;  3ZMD A;  3TO6 A;  2DQR A;  3SZP A;  5LHH A;  3CUO A;  5D8L B;  3WGI A;  4R1H A;  1E2X A;  4IRI A;  1D8K A;  5FFZ A;  3EYY A;  1O57 A;  4BHB A;  1FPQ A;  4NHJ A;  5DD8 A;  4EJU A;  3E6B A;  1VTN C;  1HST A;  4RGX A;  4LJZ F;  4WWC A;  1R58 A;  2FSW A;  5BPI A;  2LF8 A;  2P7C B;  4H0E A;  3VB2 A;  2GXB A;  3HHG A;  4L5J A;  1FT9 A;  1O3T A;  2HGC A;  1L0O C;  2EV5 A;  3PFI A;  2P5V A;  1T98 A;  3WGH A;  5CVI A;  3N97 A;  1ZRC A;  2P6S A;  4WXH A;  1U3E M;  1OYW A;  1B6A A;  4EGZ A;  3KP4 A;  3CLO A;  3I59 A;  1IZ1 A;  2CQK A;  4A0Z A;  1R5H A;  3ML6 A;  5H6Q A;  3T5X A;  1HW2 A;  1H9T A;  3SHF A;  2GA1 A;  5JHU A;  5LHI A;  5LRS A;  3I5U A;  3WTW C;  2BE5 F;  1FP2 A;  2FF4 A;  4KUM A;  3F8N A;  2IA2 A;  1XMA A;  3WTT C;  4ZYH A;  4YG2 F;  1MJB A;  2CG4 A;  4GYI A;  5A2Q Z;  2DFI A;  2GA2 A;  5ICC A;  1R1V A;  4LMY A;  4YFN F;  4I98 B;  2X4H A;  3RYP A;  2L02 A;  1E17 A;  5HS7 A;  2FXA A;  4WXC A;  1FSE A;  3F3X A;  2M1B A;  1XSX A;  2ELH A;  2M8E A;  5A2Q K;  3Q9V A;  2KIF A;  4B8X A;  2NYX A;  2FRH A;  1TQP A;  3I54 A;  3K1M A;  1ZRE A;  2HKX A;  1BIA A;  5BQT A;  3TO9 A;  3HRS A;  1C0W A;  4U88 A;  2PJP A;  2EB7 A;  2OZU A;  4HDV A;  1QZY A;  3KEQ A;  2XRN A;  3BRO A;  3KP5 A;  2DO7 A;  1ULY A;  2IVM A;  3BJA A;  1Z1D A;  2IW5 A;  3HYI A;  3ZMZ A;  5D8K B;  2F5F A;  3IWF A;  2O8X A;  2E1N A;  2WTE A;  3G73 A;  1XCB A;  5ICG A;  2Q2E A;  1RZ4 A;  1LDD A;  4PGG A;  4ZZD A;  1ZHF A;  2VC1 A;  3K9T A;  3MZY A;  4U0V A;  3HSE A;  4WF2 A;  2STW A;  1TW3 A;  3W6J B;  5K5R A;  2L3D A;  2BV6 A;  1YW7 A;  2QQA A;  4ASN A;  4L9T A;  5FGM A;  5BS6 A;  1B59 A;  2IA0 A;  2LSO A;  2ZBK A;  4M6Y A;  3SQN A;  1S7A A;  2C6Y A;  2ZNY A;  3KP7 A;  3FXU A;  1S7O A;  3VOE A;  2ESH A;  2LF7 A;  2PG4 A;  1O3S A;  4LG0 B;  2QBY B;  5EEH A;  3E6M A;  1R36 A;  1O3Q A;  2F5D A;  4G8X A;  1HQC A;  1B9N A;  3FZV A;  1FYK A;  2AS5 F;  1LB2 A;  2H27 A;  3I58 A;  1UST A;  1KYZ A;  4NB5 A;  3GW2 A;  2STT A;  1ZH5 A;  3F6V A;  1YIO A;  1LNW A;  4GYG A;  1TBX A;  4L0Z B;  1W5S A;  3EET A;  2EFO A;  2KKO A;  3GVA A;  5HS9 A;  4LK1 F;  1KU7 A;  1I27 A;  4L5I A;  2EFW A;  2EFQ A;  1XCV A;  4XLN F;  1IUY A;  1J7K A;  2OBP A;  1TNS A;  1WI9 A;  4HW0 A;  2W85 A;  2GWR A;  3CJN A;  1TLH B;  4AD9 A;  2CFX A;  4I0A A;  3ZPL A;  3GWZ A;  4RAZ A;  3V7C A;  1U8R A;  4AVP A;  1MZB A;  3GYH X;  3LQR A;  4A12 A;  2HTS A;  4FT8 A;  1IXS B;  4FX0 A;  3QAH A;  1PUE E;  5JR3 A;  2Z99 A;  3FM5 A;  4U0W A;  1ZRF A;  4HZF A;  2XIG A;  3WTS C;  3ZN1 A;  3HRM A;  1IN5 A;  5LEJ A;  4UVA A;  5TRD A;  2KIU A;  6PAX A;  2JSC A;  3D5L A;  1YLF A;  4G9Y A;  2OU2 A;  4ENN A;  4TV7 A;  1IW7 F;  3N4M A;  2F5C A;  3BOQ A;  3V7S A;  1FBU A;  3RKX A;  2M30 A;  2M5W A;  1NHA A;  3E6D A;  1XGO A;  2OQR A;  3C1D A;  4OMZ A;  5ILU A;  3BDD A;  3LFK A;  1U6G A;  3MCZ A;  4IRH A;  5HDG A;  3F8F A;  2ZO4 A;  3ECO A;  3LA7 A;  1Q1H A;  2Y48 A;  3QRF F;  2E1C A;  4HLY A;  1SD7 A;  2XGX A;  3BWG A;  2DK8 A;  5CVR A;  4ESB A;  4KA4 A;  4L9N A;  1YYV A;  4YII A;  5HLI A;  3ZP5 A;  4IF4 A;  1WKM A;  4WXD A;  3GFL A;  2J5O A;  3GFI A;  2JPC A;  2XAS A;  3QP5 A;  5LHG A;  1R5G A;  4AIK A;  1T6S A;  4Z2Y A;  3M1E A;  4XBF A;  3K69 A;  2DI3 A;  1FBS A;  2EA4 A;  2EV6 A;  3HOS A;  2FE3 A;  3L00 A;  1YFH A;  2ZJ2 A;  4PDK A;  5CVU A;  2IJL A;  4S04 A;  5F6F A;  4ZYE A;  1P2F A;  4HYE A;  3RYR A;  2LNB A;  4A6E A;  1Z91 A;  4ENJ A;  3MQ0 A;  3E6C C;  1YW8 A;  1PP7 U;  3IC7 A;  1BBY A;  4ENM A;  4LB6 B;  4O3M A;  4RGU A;  5DUI A;  1W7P B;  2VXZ A; 
#chains in the Genus database with same CATH topology
 3DEU A;  3M7G A;  3BP8 A;  4DNC A;  3SZG A;  3JSO A;  2FBH A;  5JFR A;  1FC3 A;  2ZNZ A;  4OWR B;  2QLZ A;  3QU6 A;  1O7L A;  1VQ7 I;  1XMK A;  4G7Z F;  3OYD A;  4QTR A;  3HHH A;  1A6Q A;  4BYY A;  3RQI A;  2LDU A;  4HF1 A;  5L3B A;  1VQO I;  1ETV A;  3S2H J;  3G1M A;  2WV1 A;  1IN8 A;  4A3D J;  4ZC3 A;  4BXF A;  1Z21 A;  5LGN A;  1LQ1 A;  3NWT A;  1LDK B;  4UUS B;  3CCR I;  3EDP A;  2ZXH A;  2KT0 A;  3TBI A;  5K7H A;  1Z6T A;  1VQ6 I;  1MJA A;  3PNT A;  2MBF A;  2P5L C;  3ZQL A;  2BYV E;  2WV0 A;  4PK4 A;  1ZRD A;  1JE8 A;  3LST A;  2K40 A;  3MKW B;  3DWL E;  3GXO A;  3OY9 A;  2E36 A;  2XAQ A;  2NS7 A;  3C2B A;  4M9S A;  3ERE D;  2M3A A;  1FOW A;  4XL9 A;  3LA3 A;  3RPU A;  3P9K A;  3BY6 A;  2Y0S A;  4CIC A;  4A3K J;  1SFO J;  2F5E A;  4RAY A;  1JT0 A;  3S2D J;  1FJL A;  2LOO A;  3RDI A;  3B6C A;  2ID6 A;  3BG7 A;  4IOA F;  3ASN H;  5LGU A;  4S05 A;  4WX9 A;  1XG1 A;  3PIO F;  3LNQ A;  1G4D A;  1I39 A;  1WJA A;  2XB0 X;  2E71 A;  3F8M A;  3ZGK A;  2PX9 A;  3RKW A;  4DBR A;  4HF0 A;  3FXQ A;  2R3S A;  5E18 F;  2V1N A;  4OIO F;  2FJ1 A;  1U2W A;  2GZW A;  3PM1 A;  4UV8 A;  3WE3 A;  5D5X B;  5EG0 B;  2LK2 A;  5ILV A;  1TTY A;  4J01 A;  2ZCW A;  3K1P A;  2NNY A;  3AL0 C;  1PUF B;  2R0Q C;  2Q2E B;  4I6Z A;  1X19 A;  4JX6 A;  4M9X A;  2LBF A;  1H8A C;  2V4J C;  1FY7 A;  1I5Z A;  2NVU B;  3I53 A;  1LJ9 A;  2DPD A;  1QNT A;  2K9L A;  2YU3 A;  5E1Z B;  2JA7 J;  2MD5 A;  2EIM H;  3HBL A;  4HSR A;  1ZG1 A;  1KU3 A;  2QUF A;  4Z6Y A;  1D0Y A;  2HI3 A;  3DTI A;  3FHZ A;  4D9J A;  4IZZ A;  4ZYD A;  2XPV A;  4XLF A;  3ZMU A;  1RKT A;  2EIJ H;  1YX3 A;  4J19 A;  2MLK A;  4GO1 A;  5BMZ A;  2L9V A;  4DYC A;  1W0U A;  2YPR A;  3BPX A;  2W25 A;  5ED4 A;  1LE8 B;  1JXS A;  5BOX A;  4A2U A;  2Z33 A;  3PL8 A;  3HGG A;  3SJM A;  3FDY A;  3HB9 A;  3OIO A;  4C2M J;  2CV1 A;  2CW7 A;  4DIQ A;  3ZRG A;  1ODD A;  1MBK A;  2R7W A;  2P6T A;  1A36 A;  1YO5 C;  4IJA A;  2K86 A;  5HNF A;  2O7O A;  2R7O A;  2WY7 Q;  4M73 A;  1ZTR A;  2A6T A;  5LBQ A;  1CF7 B;  2Q1Z B;  5IP6 A;  1VQK I;  5E17 F;  5KAF C;  3FIS A;  3W6K B;  1E3O C;  3FWE A;  3EPZ A;  2DN0 A;  1MBJ A;  3PJR A;  2PEX A;  3R6S A;  3PSF A;  1RI7 A;  1QPI A;  2F4I A;  4OIQ F;  2EFP A;  4UV9 A;  1QVU A;  5E3O A;  4JX5 A;  3TDU C;  1BM9 A;  2KJC A;  3QWL A;  4P9F A;  2VLA A;  1B8I B;  3T0Y A;  3RZD J;  5D5U B;  3WG7 H;  1EV7 A;  3CCY A;  1YE9 A;  3O6B B;  2A05 A;  2HS5 A;  3J7Z I;  3DEE A;  1W4M A;  2DYS H;  3KP6 A;  4I09 A;  3DF8 A;  3HKZ N;  3IWZ A;  2BXY A;  5F08 A;  4CO8 A;  1QGP A;  4F55 A;  2XDV A;  3L7W A;  1WSU A;  3RIR A;  5IYC J;  1W36 D;  1UHW A;  1MD0 A;  1UG0 A;  2M2E A;  2VQC A;  2VJJ A;  1ONV A;  4BU2 A;  3HTS B;  2VBW A;  5HS8 A;  3LOC A;  2KP6 A;  3HSF A;  4A6D A;  1LUJ B;  5J1Y A;  2A07 F;  1IJW C;  4RAF A;  5TJJ A;  5FFX A;  5IT3 A;  1POG A;  3WGG A;  1UFM A;  5JVT A;  3CLQ A;  4PCQ A;  2UZK A;  5EF6 A;  3J7A O;  3MEX A;  4UUV A;  4OIN F;  1HOM A;  4F93 B;  3JAM Z;  2ACJ A;  3M8E A;  4BAY A;  1S3J A;  4KIB A;  5K7F A;  1IGN A;  3N05 A;  3Q9S A;  2FNP A;  2HQR A;  4G6Q A;  4XKB A;  5E3N A;  4FX4 A;  2O6G E;  4UVB A;  4BQA A;  2BY2 A;  3JRC A;  4MQ9 F;  1V5E A;  4PJJ A;  4ESJ A;  3AG2 H;  2QWW A;  4XID A;  3RPU D;  3JSP A;  4B4C A;  3DFG A;  1FTT A;  2VXD A;  1ON1 A;  3A01 B;  1SD5 A;  1I3A A;  1MBG A;  3SEZ A;  3I56 I;  4BBS J;  2FX0 A;  4MEX F;  2QM3 A;  1YS7 A;  4BJT A;  1FLI A;  3A2K A;  2Y69 H;  2XRO A;  4CSW A;  3WTV C;  3G4S I;  1VND A;  2KJB A;  2W57 A;  1OCR H;  4A3B J;  4D1Q A;  3CQZ J;  1IG7 A;  1EH8 A;  1HCR A;  4E7L A;  2CO5 A;  1V5F A;  2VBX A;  3VPR A;  2ELJ A;  5IP7 J;  4A3E J;  5E8I A;  3JAM K;  3LFU A;  2X48 A;  4XLC A;  2QQ8 A;  3VOD A;  1P6R A;  2MYS A;  1I1S A;  2NS0 A;  2KHM A;  4E7Z A;  1IN4 A;  2LTP A;  3DPT A;  2XF7 A;  1RET A;  1W7P A;  4HRI A;  2JTV A;  2YSR A;  3H3Z A;  4HAM A;  2O61 A;  3T8T A;  3MMY B;  2L9S A;  5J4V A;  1EJ9 A;  5D4R A;  2LRD A;  4QPQ A;  2EK5 A;  2YU9 J;  1PVE A;  4EVI A;  4GXO A;  2DDB A;  3S1R J;  2Y31 A;  1IN6 A;  2X9D A;  2IEK A;  3FKI J;  1WJE A;  2ZFU A;  2DA4 A;  1DDN A;  1ZAR A;  4QWQ A;  1YTY A;  1TT5 B;  3FXO A;  1JGG A;  1ZAO A;  3P7N A;  4I76 A;  4MNU A;  2XVC A;  1ETW A;  4L0Y B;  4K2E A;  1D3Y A;  2F4O B;  2QCO A;  2JA8 J;  3GZ6 A;  3HGY A;  3IKT A;  2FNA A;  4EJT A;  2W84 A;  4DYR A;  1Y8Q B;  1ERD A;  3LSJ A;  4RM3 A;  2XHK A;  2OTJ I;  3SZT A;  1S8N A;  2K4B A;  3A4C A;  3E1S A;  3BG6 A;  1AKH B;  5KCM A;  3ZQG A;  2ZXJ A;  2RRE A;  1S6L A;  3G1L A;  1HW1 A;  1UMQ A;  4WCG A;  1FYL A;  3I4M J;  1OYI A;  3HPG A;  3BTI A;  4CCL A;  3CC2 I;  4XON A;  4KIS A;  1YS6 A;  3R0A A;  1SFE A;  3A0B C;  2K02 A;  4RGS A;  3PSI A;  4C9Y A;  5J47 A;  1DP3 A;  3F21 A;  2XV4 S;  2O0Y A;  1OYY A;  2ICW G;  2KIM A;  2HVR A;  4AWX B;  1XS9 A;  2E7X A;  1P92 A;  2VJ5 A;  2VT2 A;  4EM0 B;  4MFE A;  1RUO A;  5M5Y J;  2EZK A;  1TT0 A;  1R22 A;  3Q5F A;  3WTZ A;  2F4M B;  3AG1 H;  4A3G J;  4IOC F;  4OU0 A;  3OYG A;  1Z3Y A;  3MZ8 A;  5EG0 A;  3H0G J;  2XAJ A;  3I55 I;  3ABK H;  2XAF A;  3BT9 A;  1ETK A;  5L3G A;  4M9Z A;  1PUF A;  1W5T A;  2WWY A;  3VFZ A;  2EZI A;  1OPC A;  1LEB A;  4V2F A;  5JVG F;  4BBR J;  1AU7 A;  4MO7 A;  2RKH A;  2Q8K A;  4CHU A;  3EUK L;  2DT6 A;  4P9U A;  2H8R A;  3HOV J;  3DEW A;  2VJ4 A;  3I4P A;  1JKR C;  3ZQC A;  3TO7 A;  1IF1 A;  3IRR A;  1UCR A;  4ZYA A;  4RGR A;  1PP8 F;  3KZZ A;  4NBQ A;  5E79 C;  1BI1 A;  3P9C A;  1TWA J;  4QLC U;  5EDN A;  3V8J A;  5D5V B;  2Y9Z A;  3QYE A;  2XAG A;  2LVS A;  1YG2 A;  3JCU C;  4HV5 A;  4Q48 A;  4RLQ A;  3H3U A;  4AU7 A;  1PDN C;  1KQ9 A;  1LE8 A;  1H89 C;  3JRI A;  3KP2 A;  3VWB A;  2IA1 A;  3H92 A;  3L2U A;  2LKP A;  2WA0 A;  2XGD A;  2L0K A;  2KRH A;  4L9V A;  1QA6 A;  4HQM A;  3CO6 C;  5E3M A;  5GAD J;  3R61 A;  2DA1 A;  2Y0M A;  1I50 J;  2BW3 A;  1OMI A;  2DW4 A;  2NRA C;  2I8D A;  5J8C A;  4YIF A;  3ISP A;  1CF7 A;  3OS2 A;  1MKM A;  2PQ8 A;  4PSX A;  1TZL A;  4IHS A;  3HTU A;  1STZ A;  5ERI A;  4CYC B;  3EUA A;  3ELK A;  1U9O A;  2DDA A;  5J6X A;  1T0F A;  2IGN A;  1HXD A;  2JZY A;  2ZXW H;  4PGH A;  3ERM A;  5TGT A;  3V7R A;  4MLO A;  3FMS A;  2DAO A;  2K27 A;  3Q3S A;  3O8G A;  3E7L A;  4ESF A;  5AIQ A;  1QHH D;  4I2O A;  1W7P D;  3WOD F;  2R7S A;  2GXA A;  3OOU A;  1XSV A;  2MG4 A;  4E70 A;  3O2P E;  1OCZ H;  2HQ5 A;  5HNH A;  3HKZ A;  1B72 B;  1VF9 A;  2L9N A;  2COB A;  2GAU A;  2KRC A;  2UXX A;  2IT0 A;  2EWN A;  2MLG A;  4IO9 F;  3FK6 A;  1MDM B;  4A5N A;  3SDG A;  4V19 K;  4M3E A;  2R5Y B;  1OJL A;  3CMY A;  2O9L A;  3JRH A;  1YIT I;  1UHS A;  4KT5 C;  2DYR H;  2RN7 A;  3BLY A;  3BZC A;  3E5X A;  5M3M J;  3WTY C;  4CUG A;  2JUG A;  3NQO A;  2HYG D;  3H5A A;  1LFB A;  5D6E A;  1MMG A;  2FOK A;  4HBL A;  3NEU A;  2KPM A;  2LBF B;  1BOB A;  4Q47 A;  4U0Y A;  5BNG A;  2JK3 A;  1Y6I A;  3QOP A;  1LFP A;  1XD7 A;  4S0H B;  1VQM I;  2B63 J;  4EV0 A;  1DPU A;  2XGC A;  4CYD A;  3TMO A;  1OCP A;  3HC7 A;  1SVM A;  2HWV A;  1WHU A;  2KLO A;  3J81 Z;  1YOV B;  4EJO A;  2V9V A;  4HX4 A;  2CJJ A;  1CGP A;  1XX5 A;  1A04 A;  3A01 A;  3K1N A;  3EQL F;  2BGC A;  1G59 A;  5H6R A;  2MA3 A;  3KFW X;  4XN3 A;  3CCL I;  1DPR A;  2HR3 A;  1G3Y A;  2OJE D;  4BJ6 C;  4MTE A;  5HVQ C;  1LVK A;  2K9M A;  4A3I J;  4B48 A;  4KYW A;  2IP2 A;  2PBI A;  2VN2 A;  2FEZ A;  3F22 A;  4MTD A;  2RNJ A;  3JR9 A;  4BGD A;  1K6O A;  4B44 A;  2EV0 A;  1Y1W J;  4I7H A;  2JUC A;  2LRE A;  2QSH X;  2LY1 A;  4BNC A;  1LDJ A;  1X3U A;  3J81 K;  4AIJ A;  5M5X J;  2K3F A;  5AIP A;  2AQF A;  1ETX A;  3L1P A;  2V9P A;  2HOT A;  2X1C A;  5AON A;  1BR4 A;  4XLP F;  4IRG A;  1JHF A;  1J0R A;  4XR6 A;  4JQF A;  2AXL A;  2L01 A;  2QQ9 A;  3MFK A;  1IXC A;  3CTA A;  3M1C A;  4C2T A;  2UXN A;  1TWG J;  1MIJ A;  3BG3 A;  3L09 A;  3IH4 A;  1G3W A;  1WJF A;  1SAN A;  3OYE A;  4PFP A;  2BZT A;  2JPB A;  3MD2 A;  1F5T A;  1U5T C;  5GPC A;  1HDP A;  1RR8 C;  2XSD C;  3OYJ A;  1X4O A;  1N25 A;  1T2K A;  3TKY A;  4I0B A;  1EKE A;  3J7Y J;  1H0M A;  3ZN0 A;  1V5G A;  2VAS A;  4BY7 J;  3BR2 A;  3CC4 I;  4CCN A;  2P81 A;  1O3R A;  2F6C A;  3ZCO A;  3QP6 A;  2NAZ A;  2VQG A;  2PLY A;  1UB9 A;  2COM A;  1ZN2 A;  2KDO A;  3LSM A;  2OPT A;  1ZEL A;  1D0Z A;  1U0J A;  4JYK A;  4M3G A;  4U7D A;  2X6Y A;  3KCC A;  2Z3Y A;  2NOG A;  1B4A A;  4CXF A;  5DM6 F;  2R7U A;  3I0T A;  5FRN A;  2DU9 A;  2M0M A;  3CP2 A;  1HSJ A;  2VPR A;  4UB6 C;  3ZOB A;  5C4J J;  2FA5 A;  1KU9 A;  3VDX A;  2HKO A;  1G3S A;  1BI3 A;  2OD5 A;  1AKH A;  1FEX A;  2G7U A;  1QO0 D;  3BR5 A;  1IN7 A;  3MAJ A;  2HDW A;  3AG4 H;  4EM1 A;  1UJ8 A;  1R1T A;  4ANJ A;  1T39 A;  2ZME B;  3KP3 A;  4A93 J;  4II2 A;  3G71 I;  5HDN A;  5FLX Z;  2E19 A;  1R4M B;  1RKW A;  3IRQ A;  5L3E A;  3ZQF A;  1FX7 A;  1XDS A;  2DFF A;  2HQA A;  2OCE A;  2P7V B;  2TRT A;  3KZY A;  3A0H C;  1DU0 A;  1J5Y A;  4G6T B;  1IRG A;  3F6O A;  3H5R A;  1MH4 A;  3AKZ A;  3RTR A;  4PUS A;  2DQL A;  2V1X A;  3KLN A;  1HC8 A;  2OUM A;  3I3L A;  5D5W B;  1L3L A;  3CC7 I;  2EJR A;  1K6Y A;  1IRF A;  3R0J A;  4FCY A;  4NNJ A;  2E7W A;  1TQI A;  4HPQ A;  4KIG A;  1Z7L A;  2QGU A;  3HIF A;  2GIV A;  5FLX K;  2HZT A;  1F1Z A;  4AM3 A;  3U1D A;  1KGS A;  3HRT A;  5HLG A;  3O3K A;  3CJT B;  1PJR A;  2BEO A;  4UNO A;  1J9I A;  2IRF G;  1Z7U A;  2DTR A;  2NVQ J;  3PQJ A;  4ENK A;  2P0W A;  3I71 A;  2WY8 Q;  3GBG A;  5B1A H;  3PQK A;  5CQG A;  1FWZ A;  2CUE A;  1MH3 A;  3CUQ C;  3CDL A;  2R7R A;  4HDU A;  1T95 A;  3KZI C;  4EJW A;  4M74 A;  1IC8 A;  3DPU A;  5FD5 A;  3OYK A;  1MBE A;  2ELK A;  3KEO A;  4XSZ F;  4BE1 A;  1FOK A;  1HW5 A;  4HF2 A;  3G3Z A;  2IGK A;  2A69 F;  3LSK A;  4KNY A;  4Y4R A;  3VEP A;  2ECC A;  4DJA A;  1HBX G;  4Y17 A;  2ISZ A;  3CMM A;  1EH7 A;  4PFO A;  1FTZ A;  4G94 A;  1XN7 A;  3ROU A;  2CU7 A;  3KYL A;  2AQE A;  2ETH A;  2G0E A;  1R1U A;  3DXJ F;  4OAZ A;  3W2A A;  2K5C A;  3D5S C;  5J8F A;  1O7F A;  4BHC A;  2DA2 A;  4CYC A;  4C3H J;  3S32 A;  3BC8 A;  2EFN A;  4BQN A;  4D0P A;  2CW0 F;  2KIS A;  4FE7 A;  3H9Q A;  3GZN B;  4ZTF A;  4GRI A;  3F8C A;  2DLL A;  1K4S A;  4LGW A;  2IS1 A;  1YQA A;  3E5Q A;  4P96 A;  1D5V A;  2HZD A;  2XUB A;  3HM5 A;  4IVN A;  2MC4 A;  2KRF A;  5JI6 A;  1SMY F;  3R4K A;  2X1E A;  5GTH C;  2BY0 A;  2NVX J;  1T08 B;  1Y8R B;  2B0L A;  4PJM A;  2ME6 A;  3T8R A;  2HOE A;  3OIP A;  3BR6 A;  5CLS A;  1MGT A;  1B72 A;  1MJ9 A;  1REP C;  5DCM B;  2HPI A;  4FHT A;  1GXP A;  2LY2 A;  1O4X A;  2VBZ A;  5CVV A;  3REO A;  4FTH A;  1MDM A;  4M71 A;  1S7E A;  4ABZ A;  3HL2 A;  3E5U A;  2V9K A;  3IHU A;  2R5Y A;  1J59 A;  1IRZ A;  1K7A A;  1GXQ A;  2JMW A;  2R93 J;  4GDF A;  3TOB A;  3K4J A;  4A0X A;  1T33 A;  1S29 A;  5DCF A;  1XGN A;  4Y7N J;  1U5T B;  3NRV A;  3M9A A;  3B73 A;  4HNV A;  2L9R A;  3KEY A;  1NH3 A;  2GOX B;  3C3W A;  1APL C;  3HUG B;  5K5O A;  4ZDP A;  1VQP I;  2E5N A;  3NWS A;  1F36 A;  2LKX A;  3S2W A;  4ON0 A;  4U7B A;  3OYB A;  2TDX A;  4YFX F;  5IYD J;  4GGG A;  1TNT A;  2EIN H;  4C30 A;  5FKK A;  2LKS A;  4O5V A;  2PMZ N;  4BH9 A;  2PFB A;  1QZZ A;  4AUX A;  4Q5S F;  4FE4 A;  3BG9 A;  3BZK A;  3HJE A;  3IP4 B;  4E7S A;  4IQ4 A;  2R7D A;  3L9F A;  2R7F A;  3M3Y J;  2K4J A;  2BVL A;  1Y1V J;  3J80 Z;  4HQE A;  1HA8 A;  4XMY A;  3IL2 A;  1R49 A;  2D5V A;  2MW8 A;  1QBJ A;  5D4S A;  2VE9 A;  1MBF A;  2HFH A;  3V8K A;  4B09 A;  5FB2 A;  1DP7 P;  2FBI A;  4F7Z A;  1W0T A;  1HKT A;  3FKJ A;  2BW3 B;  2ESN A;  3EUH C;  3FM3 A;  1RUN A;  1ON2 A;  3WTX C;  1U8B A;  2E2H J;  3I4N J;  1BC7 C;  3VYS B;  5LGT A;  1EF4 A;  1W5C C;  1SMT A;  4LB5 A;  1EH6 A;  2CSO A;  1V4R A;  4BEH B;  3T1B A;  1FNN A;  3A02 A;  4DQ2 A;  3WE2 A;  2HEO A;  4D5C A;  2H09 A;  4HNU A;  3J80 K;  2XAH A;  1MMD A;  2MFZ A;  1ZGA A;  2FMY A;  1DUX C;  3K10 A;  1KZH A;  1YJW I;  4AVZ A;  5GAH J;  2D45 A;  3ECH A;  1JKP C;  3G6E I;  1FZP B;  2CYY A;  3BZ6 A;  2IS4 A;  1ETY A;  2HVQ A;  2VKD A;  4CH7 A;  2MH2 A;  1P7I A;  2W00 A;  4HEA 2;  3D1N I;  4CZC A;  3E3V A;  3BR3 A;  1N78 A;  3HDD A;  1K78 B;  4BDZ A;  3X2Q H;  5L3C A;  3GTM J;  4A0Y A;  1RR7 A;  1LFU P;  5FKL A;  3DU5 A;  1P4A A;  3L2C A;  2ZJQ F;  2K7L A;  3F9K A;  4OMY A;  2CUF A;  3HRU A;  4LLG F;  3CDH A;  3CUQ B;  1ZG5 A;  5ICF A;  3TGN A;  1NG6 A;  3H3V K;  2M4K A;  2M4G A;  2FML A;  1XGS A;  2CUZ A;  2YX4 A;  4N9I A;  2VKV A;  4DOZ A;  4RB1 A;  2VT3 A;  4UUT A;  1X1P A;  2A6H F;  2XF5 A;  2ZME A;  1BOA A;  3CCQ I;  2XPU A;  4Y3O A;  3RSN A;  2OZ6 A;  4UXN A;  4E7I A;  1AOY A;  3JTH A;  2Y75 A;  2CV0 A;  1IAW A;  5FRM A;  3HOZ J;  3DBH B;  3CCS I;  4XKV A;  4CCK A;  3OYI A;  3D5R C;  2LMD A;  5FJ8 J;  4RBO A;  1OFC X;  1USS A;  4KN7 X;  1W36 C;  4JBA A;  3DQV C;  4B1R A;  4HX7 A;  5J1U A;  2XRL A;  1BN5 A;  2GXG A;  2BBY A;  4XM3 A;  1YI2 I;  5E1X A;  4O6J A;  2H94 A;  4BXU A;  5HOO A;  1FP1 D;  5DV5 A;  4RMN A;  1BI2 A;  1QU3 A;  4QPO A;  2QEX I;  2QQB A;  3B02 A;  3CO7 C;  2MH9 A;  1DQU A;  1XDU A;  2V6C A;  1G6N A;  2DJN A;  5HDK A;  5ICE A;  1ZLJ A;  4A69 C;  4NQW B;  1JGS A;  2RNG A;  2Y30 A;  5FKN A;  3LAJ A;  2BHZ A;  2X6X A;  2CWE A;  1JI8 A;  1B9M A;  2Z9O A;  2RC4 A;  3IAM 2;  3OV8 A;  4M3D A;  3AL0 B;  4LK0 F;  5F64 A;  2O8K A;  2DBB A;  4P5O A;  3HOT A;  1NTC A;  1RNL A;  2ADU A;  1J2X A;  4XLE A;  4LG3 A;  1BJA A;  3BR0 A;  4I02 A;  4IHT A;  3TED A;  5HLH A;  2ZSI B;  2K9N A;  5DYM A;  3F8B A;  3BG5 A;  2JA5 J;  3TW7 A;  4ZDL A;  2JT1 A;  2WBM A;  3GF2 A;  4RB0 A;  5ILS A;  1WCM J;  1MNE A;  4EQQ A;  4JOM A;  4KT6 A;  4II3 A;  3O8H A;  3M8F A;  2EA2 A;  3P5J A;  3FBI B;  1OR7 C;  1U78 A;  4L18 B;  2ZJP F;  4I01 A;  2ZJR F;  1BW6 A;  3KLO A;  4XOR A;  3UNG C;  1SFK A;  4EMS A;  3DBL B;  3GTP J;  2DXI A;  2DA6 A;  2HPM A;  2IPQ X;  1E0E A;  4OIP F;  2GOM A;  2K3P A;  5JLX A;  4EJV A;  4KIF A;  3W2W A;  2YX7 A;  1V54 H;  3GFM A;  3BJO A;  3GEZ A;  1IRX A;  2RGV A;  3CZ6 A;  3KET A;  2A5Y B;  2RDP A;  5CYV A;  3W2V A;  5BPD A;  4KFC A;  3QOE A;  2FQ3 A;  2R7X A;  3BCB A;  1ZG3 A;  3OOP A;  1U9N A;  1WWX A;  1SVO A;  4N9H A;  4C3I J;  4OIR F;  5DCM A;  2OTL I;  1AA7 A;  3WU2 C;  4YFK F;  2OC6 A;  4Y33 A;  4JP0 A;  2ID3 A;  5TIS C;  3GTQ J;  1BL0 A;  2VOO A;  1OCT C;  3FXL A;  4ZTJ A;  2LH9 A;  4A3M J;  1IDY A;  4LLL A;  2NNN A;  3FMR A;  2JA2 A;  1FBQ A;  3MKY B;  2QKL B;  3OSF A;  3JTG A;  5DD4 A;  3FXK A;  3GO5 A;  1JKO C;  1WH5 A;  3DLA A;  4LIT A;  2LLK A;  4FAS D;  2VE8 A;  3WU1 B;  3JRF A;  1ITY A;  1RIO H;  1U5T A;  1H88 C;  3C18 A;  3CES A;  1WH7 A;  3SXY A;  2R7Z J;  1BR1 A;  2CQN A;  3HUG A;  4E4H A;  2JRT A;  4KDP A;  1T38 A;  2M45 A;  1QHG A;  1P9Q C;  2FU4 A;  2BVM A;  2M34 A;  3F23 A;  2QYO A;  2J5P A;  2VI6 A;  3MWM A;  5K1Y A;  2P5K A;  1ORK A;  3Q0V A;  4XNF A;  4AYB N;  4PSW A;  4ZH4 F;  2Z5U A;  5EYR A;  4G7O F;  3AFH A;  2KQR A;  2PMZ A;  3S1Q J;  5GAE J;  2L7K A;  1D8J A;  2D1H A;  1KYW A;  2LR8 A;  1Y0U A;  2L4A A;  1OCO H;  1I1G A;  3PIP F;  4WK8 F;  3LWF A;  3RI4 A;  3HSR A;  5KVR A;  1YW9 A;  5IT9 Z;  2ZB9 A;  3RKY A;  3K2A A;  4Y13 A;  2W7N A;  1GHC A;  1HKS A;  1LEA A;  4MQV A;  2VOP A;  1T56 A;  3A1Y A;  3FF5 A;  3QOD A;  1ZYR F;  1J75 A;  4IQJ A;  5IY5 H;  3SFZ A;  3Q0U A;  1D0X A;  2WAQ N;  3FX3 A;  5B3S H;  2CGP A;  1ETO A;  1FSH A;  2XKP A;  3JW4 A;  5LEK A;  1XSD A;  2X6O A;  2H1K A;  1TC3 C;  1SFX A;  1TW2 A;  3RZO J;  4KIT B;  4BEH A;  3IKV A;  1VFC A;  3GUD A;  3ZMV A;  2W48 A;  4ZYG A;  2MGQ A;  4Y52 J;  2L4M A;  5CVJ A;  3ZQH A;  3GX4 X;  1VQ5 I;  1UZC A;  5IT9 K;  1JJ6 C;  1WJC A;  2E1M C;  3LSR A;  1SAX A;  3GTG J;  2L54 A;  2DMP A;  1HKQ A;  3OR2 C;  3ZQ7 A;  2DA7 A;  2DOF A;  4OAY A;  3QPH A;  2JSP A;  3ZQI A;  3QQA A;  4XLH A;  2AO9 A;  2R7T A;  1XTA A;  2FD5 A;  2CMP A;  2CQ7 A;  3BTJ A;  3S93 A;  3KE2 A;  1ZGW A;  2FQ4 A;  1ZGJ A;  1I3Q J;  2JJ7 A;  2K9S A;  4CDG A;  2D2W A;  4EEF G;  2XB5 A;  1K78 A;  2D1V A;  2XF6 A;  1XGM A;  3QYB A;  3GTK J;  1QPM A;  3GLX A;  1S72 I;  3RCO A;  4MEY F;  3DPL C;  4G6D A;  3U9G A;  1K79 A;  2EZL A;  2A6E F;  3CUQ A;  3K2Z A;  1TL8 A;  2ISY A;  1OCC H;  2DOA A;  2QVO A;  3DP7 A;  1GDT A;  1R9T J;  1FOY A;  2DFH A;  2N8G A;  1BW5 A;  1JHH A;  2EBI A;  4HG2 A;  3TOA A;  4NC8 A;  3F0C A;  5B1B H;  5EEA A;  2DT5 A;  2ECB A;  4RS8 A;  4XQF A;  2DPU A;  3VSK A;  4DZP A;  1KA8 A;  2V79 A;  3ABT A;  2O3F A;  2P8T A;  2VOD A;  3ONQ A;  3M4O J;  2XSJ C;  2QEN A;  1JUP A;  2F2E A;  4YIR X;  3IV5 A;  2DMU A;  2IS6 A;  3R60 A;  5K5Q A;  3CME I;  1V55 H;  3TDZ C;  2FUG 2;  2M9H A;  3CF2 A;  5IP9 J;  4BXX J;  3HPH A;  3BQZ A;  2BY3 A;  1OKR A;  3MN2 A;  1R23 A;  2E5Z A;  3J7A Y;  1TQM A;  2Q0O A;  2A3S A;  3OL4 A;  4RA2 A;  2PMH A;  5M3F J;  1K4T A;  1VQL I;  4PJ0 C;  2WAD A;  1BR2 A;  1WI3 A;  4PZJ A;  3FHN A;  3WHC A;  1B1B A;  3SEQ A;  4A5M A;  1BC8 C;  3CCU I;  1GVJ A;  2MC3 A;  3L2R A;  3LQQ A;  1X1C A;  2PI0 A;  4FQG A;  2O5R A;  1V3F A;  3FK7 A;  3WU0 A;  2L7M P;  1BIB A;  1A6I A;  1HLV A;  2PJR B;  1JTX A;  4HX8 A;  4LLN A;  3I64 A;  2LG4 A;  4LOC A;  4UB8 C;  2BHY A;  4NQW A;  2GM4 A;  1LKX A;  3E97 A;  3CCV I;  1G3T A;  4AIH A;  2XKO A;  4A3L J;  4BKX A;  2X85 A;  1F43 A;  2A61 A;  2H8W A;  2KZV A;  2V1D A;  2O03 A;  4HNT A;  2XC7 A;  1QQI A;  2HYF A;  4W1U A;  3RPQ A;  2CUJ A;  2VON A;  4ZJZ A;  5L3D A;  2HVS A;  3S3N A;  1SD6 A;  4IEJ A;  3S1M J;  3KIO A;  1ACI A;  4IPA A;  1P4X A;  2A68 F;  3FXJ A;  4A3J J;  1I6X A;  1SD4 A;  3ZMS A;  1SVL A;  1KQ0 A;  4V2G A;  5H20 A;  1JTY A;  3ABU A;  3DU6 A;  3K70 C;  2YUS A;  3V4G A;  2HQN A;  3K4M A;  5H2F C;  4E7K A;  2P4W A;  3KYD B;  3KYC B;  4MHG A;  3QU3 A;  1F4K A;  4KN4 X;  4DW6 A;  1WQ2 A;  3S3O A;  5FO5 A;  5CQE A;  2DT7 B;  3HEF A;  2A5W A;  2IAI A;  2RVC A;  2E2J J;  5EZH A;  2EPF A;  3RJP A;  4A3C J;  2OQG A;  2BXZ A;  3K7A J;  1MW7 A;  1FMW A;  4RB2 C;  1UAA A;  2E60 A;  4L5E A;  2HXI A;  3OIQ A;  4KMU X;  5J3L A;  3BR1 A;  1Z3X A;  3BTC A;  4R8H A;  3TL4 X;  1DGR M;  4EM2 A;  2QSG X;  4KJZ A;  3LA2 A;  4YRV A;  4CZZ A;  2KFD A;  3LAP A;  3EUH A;  2ZXI A;  3EYI A;  1Z67 A;  2GQQ A;  5LLQ A;  3QPS A;  1Z05 A;  1LPQ A;  1R00 A;  3OWT A;  2VC0 A;  3LL7 A;  4BL0 B;  5L3F A;  1WVR A;  5DTD A;  4CGZ A;  4AC0 A;  3H0D A;  3DKW A;  3WTU C;  4NDL A;  2E1M B;  3I59 B;  3D0S A;  2IS2 A;  3W3C A;  1LVA A;  3K4L A;  4JK1 X;  5EZG A;  3WHB A;  5E8G A;  5F04 A;  5M5W J;  2HNH A;  2OAZ A;  5D6F A;  3QPT A;  3RQ4 A;  2V26 A;  1MMN A;  3JRB A;  1R7J A;  1FYM A;  2KMU A;  5FD6 A;  2PN6 A;  3AG3 H;  2IBD A;  2RQP A;  1HF0 A;  4PJN A;  5DDG A;  1BI0 A;  5J4Y A;  3U21 A;  3GME A;  2H6B A;  5KK1 A;  2M87 A;  1H9G A;  2X0L A;  4GCV A;  4LD5 A;  1GT0 C;  2G9W A;  3HOW J;  1XB4 A;  2X51 A;  4F3Q A;  4J00 A;  5GP9 A;  3DKX A;  3JRA A;  5CJ9 A;  2OCC H;  1SFU A;  1IXR C;  2G7H A;  2EIL H;  2X6W A;  4KIC A;  3GCM A;  1WJ5 A;  2H6C A;  3S8P A;  3CCM I;  5C4X J;  3DV8 A;  3FXM A;  3OS1 A;  1TWH J;  5DUK A;  4Q4Z F;  5GAG J;  2HDC A;  3BJ6 A;  2RV8 A;  4P1W A;  1AWC A;  1BJZ A;  2DMQ A;  4Y15 A;  2RAE A;  3C7J A;  3H1C A;  5DEQ A;  1I6H J;  2WAQ A;  1R6R A;  1VI0 A;  3HOY J;  1R4N B;  2DOD A;  1OQY A;  5F1R A;  2OF7 A;  4UHT A;  1Z9C A;  1Y39 A;  4EGY A;  4HLX A;  4N4O B;  1KQ8 A;  2E2I J;  4MGR A;  3OYA A;  3K0L A;  2NS8 A;  2NXN B;  2V7F A;  1ETQ A;  4IHX A;  2R92 J;  4XRM A;  4LG0 A;  2PMU A;  4UVC A;  2M7B A;  2QBY A;  4M72 A;  4BE2 A;  2OA4 A;  2QZ8 A;  5FLM J;  3P9I A;  2NOJ B;  1P4W A;  4N0B A;  3U2R A;  3MVP A;  3TQN A;  2DK5 A;  1CQT A;  1KU2 A;  1F9N A;  1E3P A;  2HOA A;  3HG9 A;  2ZKZ A;  4G7H F;  2VB6 A;  3F72 A;  3FXR A;  3ZXS A;  2V1U A;  1X2M A;  1IO2 A;  3LSP A;  2HTJ A;  3GFJ A;  1ZLK A;  3FMQ A;  1Z6R A;  3A03 A;  4HA8 A;  2Z1D A;  2FBK A;  4XRF A;  3GTJ J;  3ASO H;  4KMF A;  3LSI A;  3ZMT A;  4P55 A;  4HOB A;  5HLT A;  4ETS A;  1MMA A;  2JVG A;  2WC2 A;  1MSE C;  1NK2 P;  3ULQ B;  1Y56 A;  4RB3 C;  2OV7 A;  3E0J B;  5LRR A;  5KHD A;  4XSX F;  4BQO A;  3AAF A;  3MZH A;  5EEG A;  4HV6 A;  1IV6 A;  2M8G X;  3GZ5 A;  2EQR A;  2YS9 A;  2DA5 A;  1N77 A;  4IXA A;  1TWF J;  2KDZ A;  2UWM A;  4XN0 A;  4F52 A;  1KON A;  2MSY A;  1JUS A;  1MBH A;  2EZH A;  4L9J A;  1OR7 A;  3UKG A;  3COA C;  3LSG A;  2HDD A;  2LFB A;  5E20 A;  1PYV A;  1WRJ A;  4D7N A;  1MSF C;  1X1A A;  3PFY A;  2YR2 A;  2AXT C;  4IHV A;  1WJD A;  3JRE A;  4M3B A;  4JX4 A;  4ZZL A;  3LSH A;  3BPV A;  4M6X A;  3Q0W A;  3H35 A;  2VBY A;  1RES A;  4R79 A;  4OOI A;  3WG9 A;  1D1B A;  4LFU A;  3V8L A;  1NK3 P;  5E1W A;  5CPR B;  2ZSH B;  4BHP A;  3GTO J;  1UHM A;  2W24 A;  2GBY A;  2BY1 A;  4QIW N;  2ZFW A;  3K4C A;  3ABL H;  3ZMD A;  3TO6 A;  1XPX A;  2DQR A;  3SZP A;  4DBQ A;  2JA6 J;  5LHH A;  3CUO A;  5D8L B;  3PO3 J;  2UUZ A;  2VQL A;  4CCJ A;  3WGI A;  2NVY J;  4F91 B;  2PJR A;  1K83 J;  4R1H A;  3H36 A;  2F5V A;  3QYF A;  1X3W B;  3K4N A;  1E2X A;  4B47 A;  2XAU A;  2BOL A;  1YJN I;  4IRI A;  3HXL A;  2QA4 I;  2TCT A;  1D8K A;  5FFZ A;  2CRG A;  3EYY A;  5K7Z A;  3OL3 A;  1Y0N A;  3DBR B;  3CF5 F;  2R5Z B;  2HXO A;  1O57 A;  4BHB A;  5DM7 F;  1FPQ A;  4M6V A;  4NHJ A;  5IOY A;  1YJ9 I;  3G1O A;  5DD8 A;  5F0F A;  5HOD A;  2E34 A;  4EJU A;  2GLO A;  3E6B A;  1VTN C;  1JUM A;  2DA3 A;  4IL6 C;  1HST A;  4RGX A;  4LJZ F;  4WWC A;  4BDY A;  1R58 A;  1WGX A;  3HZJ A;  5FLV A;  2FSW A;  3L2V A;  5EJC A;  3CJR B;  1WZ2 A;  2DTZ A;  1RPW A;  5BPI A;  2LF8 A;  4XOT A;  3OS0 A;  4BJ5 C;  5F0H A;  2IGM A;  2P7C B;  2VUM J;  3IUO A;  5KAI C;  3TP3 A;  4H0E A;  3VB2 A;  2QF7 A;  4H4K C;  4MIM A;  2GXB A;  3HHG A;  4L5J A;  1GLN A;  4IKF A;  1FT9 A;  3RKQ A;  1O3T A;  3OYF A;  1FOX A;  5F1J A;  3PNY A;  2HGC A;  1L0O C;  2VKE A;  2EV5 A;  3VYR B;  1SAU A;  3PFI A;  2P5V A;  3SDB A;  1T98 A;  3WGH A;  5CVI A;  3N97 A;  1ZRC A;  2P6S A;  1RC9 A;  4WXH A;  3UR3 C;  1U3E M;  2K85 A;  1OYW A;  1MMS A;  4RM2 A;  1B6A A;  3ZR8 X;  4EGZ A;  3KP4 A;  2CV2 A;  2NVT J;  1QVT A;  3CLO A;  5J1R A;  1YRN B;  3I59 A;  3CCJ I;  1T8I A;  1IZ1 A;  2CW8 A;  2CQK A;  1ENH A;  2CQQ A;  9ANT A;  4A0Z A;  4C3J J;  1R5H A;  4B43 A;  3ML6 A;  3S15 J;  4FET A;  3DLL F;  5H6Q A;  1YHQ I;  1GVD A;  3T5X A;  1HW2 A;  1GV2 A;  3JRG A;  1H9T A;  3SHF A;  2GA1 A;  5JHU A;  3GLL A;  2LYC A;  2M7A A;  5LHI A;  4X1E A;  5FKO A;  5LRS A;  2ZC2 A;  3I5U A;  1R71 A;  5J40 A;  4RAG A;  1D1A A;  3WTW C;  4EAT A;  3PNV A;  2BE5 F;  1FP2 A;  1RRJ A;  1S9H A;  2FF4 A;  4KUM A;  2WAE A;  3F8N A;  1X4P A;  4BY1 J;  2IA2 A;  1XMA A;  4X6A J;  3WTT C;  1QRY A;  5GPA A;  4ZYH A;  4YG2 F;  1MJB A;  2CG4 A;  4GYI A;  3H9G A;  3OR1 C;  5A2Q Z;  2DFI A;  2GA2 A;  5ICC A;  2DMN A;  1R1V A;  2I10 A;  3K6G A;  3L2W A;  1A31 A;  4LMY A;  2WB1 N;  4YFN F;  3FBN B;  1X58 A;  4I98 B;  2X4H A;  2H1L A;  3RYP A;  1Q1V A;  2L02 A;  1E17 A;  4BS9 A;  1X1B A;  2CQX A;  4MFD A;  5HS7 A;  2FXA A;  2ME0 A;  4WXC A;  1FSE A;  5EGO B;  3F3X A;  2M1B A;  3L2Q A;  4AID A;  1XSX A;  1YIJ I;  4E7J A;  3S3M A;  1JT6 A;  5B66 C;  1W1W E;  1JJ8 C;  3MKZ A;  2ELH A;  2M8E A;  5A2Q K;  4X0G A;  1OLT A;  3Q9V A;  4UUS A;  2KIF A;  4B8X A;  2CH0 A;  2NYX A;  2FRH A;  1X1D A;  5IOZ A;  3S14 J;  1TQP A;  1ZKG A;  2L2O A;  3ESW B;  3V42 A;  3VYU B;  2VIX A;  3I54 A;  3K1M A;  3DCF A;  3U1K A;  1IDZ A;  3CDI A;  1ZRE A;  2HKX A;  4UY8 I;  3C2G A;  1BIA A;  5C44 J;  5BQT A;  2F48 A;  3TO9 A;  3HRS A;  3DTK A;  1C0W A;  3BCA A;  3CP8 A;  4U88 A;  2PJP A;  2EB7 A;  2OZU A;  3DKY A;  2E1O A;  4HDV A;  2VQH A;  1QZY A;  1D5Y A;  3KEQ A;  3S17 J;  1X3Z B;  2XRN A;  3BRO A;  3KP5 A;  3KPH A;  2DO7 A;  1IUF A;  2MD0 A;  1ULY A;  4RLF A;  2IVM A;  1GV5 A;  3BJA A;  2HU9 A;  1Z1D A;  2IW5 A;  3HYI A;  3NAR A;  3ZMZ A;  5D8K B;  4DZJ A;  2F5F A;  3IWF A;  4LIU A;  3CD6 I;  3ZQQ A;  2O8X A;  1R5I D;  3VSL A;  2HYJ A;  2E1N A;  2WTE A;  2KZG A;  3G73 A;  1XCB A;  5ICG A;  2Q2E A;  1ZR4 A;  1RZ4 A;  1LDD A;  4XLA A;  4PGG A;  4ZZD A;  1ZHF A;  2CFO A;  2VC1 A;  3K9T A;  3MZY A;  3HSE A;  4U0V A;  4WF2 A;  3CMA I;  2STW A;  1TW3 A;  4FIS A;  3W6J B;  5K5R A;  2DFE A;  2L3D A;  1TP4 A;  1WPK A;  4B3X A;  1FIP A;  2BV6 A;  1YW7 A;  4I99 C;  2QQA A;  2JQ7 A;  4ASN A;  4L9T A;  4BUP A;  1ZQ3 P;  1DGW Y;  5FGM A;  3K4B A;  5BS6 A;  1B59 A;  2IA0 A;  2LSO A;  2ZBK A;  4M6Y A;  3SQN A;  1S7A A;  3TP0 A;  1SC7 A;  1G2H A;  3S16 J;  2C6Y A;  2ZNY A;  3KP7 A;  2R4G A;  3FXU A;  1S7O A;  2GIZ A;  3VOE A;  4E7H A;  2ESH A;  1D1C A;  2LF7 A;  2PG4 A;  3SFI A;  1O3S A;  1X2N A;  4HST A;  4LG0 B;  1S5L C;  2AHQ A;  2QBY B;  5EEH A;  4DYQ A;  4XKC A;  3E6M A;  4W97 A;  2QSF X;  1R36 A;  1O3Q A;  2F5D A;  4G8X A;  1HQC A;  3K4K A;  1B9N A;  4XK4 A;  1Z0X A;  2R7V A;  4YEJ A;  3FZV A;  2ZME C;  3SYT A;  2Z2S B;  1G8X A;  1P7J A;  1FYK A;  3OSG A;  2AS5 F;  5JHF A;  5IPA A;  1LB2 A;  2H27 A;  3I58 A;  4N4N B;  1DU6 A;  5F0C A;  4XRS A;  1UST A;  1KYZ A;  2R5Z A;  4NB5 A;  2JN6 A;  5C3E J;  3GW2 A;  2STT A;  1ZH5 A;  3F6V A;  1YIO A;  1LNW A;  2W82 A;  1IV8 A;  4GYG A;  2XGE A;  1TBX A;  4CCO A;  4L0Z B;  1W5S A;  3EET A;  2DJI A;  3C2H A;  1B8I A;  2EFO A;  2B7E A;  2M0C A;  4PJL A;  2KKO A;  5FRO A;  2Y0S N;  3GVA A;  4F92 B;  5KNL A;  5HS9 A;  1J09 A;  3PUF A;  1E3H A;  3H9J A;  4LK1 F;  1KU7 A;  3LMM A;  4IHW A;  1I27 A;  4XRS G;  4L5I A;  4IHY A;  3OYM A;  2Y9Y A;  2EFW A;  2EFQ A;  3OYC A;  1XCV A;  4XLN F;  1VQ8 I;  1IUY A;  1J7K A;  2OBP A;  1TNS A;  4XIC A;  1WI9 A;  1Z77 A;  4NUB A;  4HW0 A;  2W85 A;  4LIV A;  2GWR A;  3CJN A;  1TLH B;  4AD9 A;  2B9S A;  2CFX A;  4I0A A;  2E35 A;  3GWZ A;  3ZPL A;  4RAZ A;  4NC7 A;  3V7C A;  1U8R A;  3IH2 A;  4AVP A;  1EA3 A;  3ABM H;  2R7Q A;  4ITV A;  1MZB A;  1OIS A;  3PO2 J;  3GYH X;  2EIK H;  3LQR A;  5E3L A;  4BAC A;  3PUB A;  2HTS A;  4A12 A;  4FT8 A;  2UV1 A;  2WAF A;  3NAU A;  1IXS B;  4NC6 A;  4C2U A;  4FX0 A;  1N75 A;  2DMT A;  1YRN A;  3HOU J;  3QAH A;  3HOX J;  5JR3 A;  1PUE E;  4BQQ A;  2Z99 A;  3FM5 A;  4U0W A;  1ZRF A;  4HZF A;  1NG7 A;  2XIG A;  5B5E C;  2I5U A;  4XOP A;  3WTS C;  4CA0 A;  3ZN1 A;  3HRM A;  3S1N J;  4ZDO A;  1IN5 A;  5GTI C;  1TWC J;  5LEJ A;  4UVA A;  3BQY A;  2IXS A;  4QSH A;  5TRD A;  2KIU A;  1AHD P;  6PAX A;  1YX5 A;  2JSC A;  1FIA A;  4A3F J;  1VQ4 I;  3K70 D;  3D5L A;  1YLF A;  4D5F A;  4G9Y A;  3FIW A;  2OU2 A;  4XKW A;  5CKT A;  5JLW A;  4ENN A;  2HOS A;  4TV7 A;  1A35 A;  1WFX A;  1HDD C;  4D7M A;  1IW7 F;  1QZE A;  1BA5 A;  2W4S A;  3N4M A;  1VQN I;  1M1E B;  5DS9 A;  2VPL A;  2XPW A;  2F5C A;  3KX2 A;  3BOQ A;  2KIQ A;  3V7S A;  1FBU A;  2WB1 A;  3CCE I;  3CJQ B;  3RKX A;  4GFB A;  2M30 A;  2M5W A;  1NHA A;  3E6D A;  5FKM A;  4BE0 A;  1SEU A;  3I9V 2;  1JKQ C;  4DGW B;  1XGO A;  2CS3 A;  2OQR A;  2L7Z A;  3C1D A;  3M07 A;  3OYN A;  1MNM C;  4B3A A;  4OMZ A;  5ILU A;  2V6E A;  3BDD A;  2DOE A;  5F27 A;  3MKL A;  3LFK A;  1U6G A;  3MCZ A;  4IRH A;  5HDG A;  5EGO A;  3F8F A;  3W6V A;  2Z16 A;  2ZO4 A;  3ECO A;  2LC2 A;  3VYT B;  3LA7 A;  2LP0 A;  3QPL A;  1Q1H A;  1UEL B;  2Y48 A;  1XC5 A;  1UG2 A;  2K9Q A;  3QRF F;  2VJI A;  3G2B A;  1VQ9 I;  2E1C A;  3IH3 A;  4G12 A;  3BTL A;  4HLY A;  1SD7 A;  2XGX A;  3BWG A;  2DK8 A;  5CVR A;  4ESB A;  4KA4 A;  4L9N A;  1YYV A;  2X1D A;  4YII A;  2LY9 A;  5HLI A;  3M8J A;  3ZP5 A;  5LD2 C;  1ZR2 A;  4CCM A;  4IF4 A;  1WKM A;  3H5N A;  4WXD A;  3GFL A;  2J5O A;  1GUU A;  3GFI A;  1WJB A;  2JPC A;  1K61 A;  2XAS A;  2JVH A;  3QP5 A;  1XMX A;  1R5G A;  5LHG A;  4AIK A;  1T6S A;  4IX7 A;  2Y2Z A;  4Z2Y A;  3M1E A;  4XBF A;  4YEL A;  3K69 A;  4U87 A;  2RQQ A;  2DI3 A;  2EH3 A;  2VL8 A;  3IAS 2;  1FBS A;  2EA4 A;  1FMV A;  2KL4 A;  2EV6 A;  3OYH A;  1T0F C;  3HOS A;  4AYB A;  2FE3 A;  3OMY A;  3L00 A;  1YFH A;  2ZJ2 A;  2FOW A;  4PDK A;  5CVU A;  4E6K G;  2L5Q A;  3JRD A;  2IJL A;  4S04 A;  2QKM B;  4RDU A;  5F6F A;  2JRM A;  1VZ0 A;  3B6A A;  4ZYE A;  2IGO A;  1A5J A;  1P2F A;  3DTE A;  4HYE A;  3RYR A;  4M3F A;  5IYB J;  2LNB A;  4A6E A;  5LFA A;  1Z91 A;  3OYL A;  2LD5 A;  4ENJ A;  3MQ0 A;  2JWT A;  2MAB A;  3E6C C;  2VKH A;  1YW8 A;  1PP7 U;  3IC7 A;  1BBY A;  4ENM A;  4LB6 B;  2DCE A;  4O3M A;  3GTL J;  3TW6 A;  4RGU A;  5DUI A;  1W7P B;  1ZK8 A;  2L7F P;  2W1O A;  1MND A;  2VXZ A; 
#chains in the Genus database with same CATH homology
 3DEU A;  3M7G A;  3BP8 A;  4DNC A;  3JSO A;  2FBH A;  5JFR A;  1FC3 A;  2ZNZ A;  2QLZ A;  3QU6 A;  1O7L A;  1XMK A;  4G7Z F;  3HHH A;  4BYY A;  2LDU A;  4HF1 A;  5L3B A;  1IN8 A;  5LGN A;  1LQ1 A;  1LDK B;  3EDP A;  1Z6T A;  1MJA A;  2MBF A;  2P5L C;  2BYV E;  2WV0 A;  1ZRD A;  1JE8 A;  3LST A;  3GXO A;  2XAQ A;  3ERE D;  4M9S A;  3RPU A;  3LA3 A;  3P9K A;  3BY6 A;  4CIC A;  2F5E A;  4RAY A;  3RDI A;  4S05 A;  5LGU A;  4WX9 A;  1G4D A;  3F8M A;  3RKW A;  4HF0 A;  3FXQ A;  2R3S A;  5E18 F;  4OIO F;  1U2W A;  2GZW A;  3WE3 A;  4UV8 A;  5D5X B;  5ILV A;  1TTY A;  2ZCW A;  3K1P A;  2NNY A;  4M9X A;  1FY7 A;  1I5Z A;  3I53 A;  1LJ9 A;  2DPD A;  1QNT A;  2YU3 A;  5E1Z B;  2MD5 A;  1ZG1 A;  1KU3 A;  2QUF A;  3FHZ A;  4ZYD A;  3ZMU A;  2MLK A;  4GO1 A;  5BMZ A;  2YPR A;  3BPX A;  2W25 A;  5ED4 A;  1JXS A;  5BOX A;  4A2U A;  2Z33 A;  1ODD A;  2P6T A;  1YO5 C;  4IJA A;  2K86 A;  4M73 A;  5LBQ A;  1CF7 B;  5E17 F;  3W6K B;  3FWE A;  2PEX A;  3R6S A;  1RI7 A;  4OIQ F;  2EFP A;  4UV9 A;  3TDU C;  1BM9 A;  2KJC A;  4P9F A;  3T0Y A;  5D5U B;  1EV7 A;  3O6B B;  2HS5 A;  3KP6 A;  1W4M A;  4I09 A;  3DF8 A;  3IWZ A;  4CO8 A;  1QGP A;  3L7W A;  1WSU A;  3RIR A;  1UHW A;  1MD0 A;  1ONV A;  3HTS B;  2VBW A;  5HS8 A;  3HSF A;  4A6D A;  2A07 F;  5TJJ A;  5FFX A;  5IT3 A;  3WGG A;  5JVT A;  1UFM A;  2UZK A;  4PCQ A;  3J7A O;  3MEX A;  4UUV A;  4OIN F;  3JAM Z;  2ACJ A;  3M8E A;  4BAY A;  1S3J A;  4KIB A;  3Q9S A;  4G6Q A;  2FNP A;  2HQR A;  2O6G E;  4FX4 A;  4UVB A;  4BQA A;  4MQ9 F;  4ESJ A;  2QWW A;  3JSP A;  3DFG A;  1ON1 A;  1SD5 A;  4MEX F;  2QM3 A;  1YS7 A;  1FLI A;  2XRO A;  3WTV C;  2KJB A;  2W57 A;  1EH8 A;  2CO5 A;  2VBX A;  5E8I A;  3JAM K;  3VOD A;  1P6R A;  1I1S A;  2NS0 A;  1IN4 A;  3DPT A;  1W7P A;  2JTV A;  2YSR A;  3H3Z A;  4HAM A;  2O61 A;  3T8T A;  5D4R A;  2EK5 A;  4EVI A;  4GXO A;  1IN6 A;  1DDN A;  1ZAR A;  4QWQ A;  1YTY A;  1ZAO A;  3P7N A;  4MNU A;  2XVC A;  4L0Y B;  4K2E A;  1D3Y A;  3GZ6 A;  3IKT A;  2FNA A;  4EJT A;  2W84 A;  2XHK A;  3SZT A;  1S8N A;  2K4B A;  1S6L A;  2ZXJ A;  1HW1 A;  4WCG A;  1FYL A;  1OYI A;  1YS6 A;  3R0A A;  1SFE A;  4RGS A;  2K02 A;  3F21 A;  2XV4 S;  2O0Y A;  1OYY A;  2KIM A;  4AWX B;  2E7X A;  1P92 A;  2VT2 A;  4EM0 B;  1RUO A;  1R22 A;  3Q5F A;  3WTZ A;  4OU0 A;  2XAJ A;  2XAF A;  5L3G A;  4M9Z A;  1W5T A;  2WWY A;  3VFZ A;  1OPC A;  1LEB A;  2RKH A;  2Q8K A;  4CHU A;  4P9U A;  3I4P A;  3TO7 A;  1IF1 A;  3IRR A;  1UCR A;  4RGR A;  1PP8 F;  3KZZ A;  1BI1 A;  3P9C A;  4QLC U;  3V8J A;  5D5V B;  2XAG A;  1YG2 A;  4HV5 A;  4Q48 A;  3H3U A;  1PDN C;  1KQ9 A;  3KP2 A;  2IA1 A;  3H92 A;  2LKP A;  4L9V A;  4HQM A;  3CO6 C;  3R61 A;  2Y0M A;  2DW4 A;  1OMI A;  2NRA C;  5J8C A;  4YIF A;  3ISP A;  1CF7 A;  1MKM A;  2PQ8 A;  4IHS A;  3HTU A;  1STZ A;  5ERI A;  3ELK A;  5J6X A;  1T0F A;  1HXD A;  2JZY A;  4PGH A;  3V7R A;  3FMS A;  2DAO A;  2K27 A;  4ESF A;  5AIQ A;  4I2O A;  1W7P D;  3WOD F;  1XSV A;  4E70 A;  3O2P E;  2UXX A;  2GAU A;  2IT0 A;  2EWN A;  2MLG A;  1MDM B;  4A5N A;  4KT5 C;  2RN7 A;  3E5X A;  3WTY C;  3NQO A;  2HYG D;  5D6E A;  2FOK A;  4HBL A;  3NEU A;  4Q47 A;  4U0Y A;  3QOP A;  1XD7 A;  4EV0 A;  1DPU A;  4CYD A;  2HWV A;  3J81 Z;  4EJO A;  2V9V A;  4HX4 A;  1CGP A;  1A04 A;  3K1N A;  3EQL F;  2BGC A;  5H6R A;  2MA3 A;  3KFW X;  1DPR A;  2HR3 A;  1G3Y A;  4KYW A;  5HVQ C;  4MTE A;  2IP2 A;  2PBI A;  2VN2 A;  2FEZ A;  3F22 A;  4MTD A;  2RNJ A;  1K6O A;  2EV0 A;  4I7H A;  4BNC A;  1LDJ A;  1X3U A;  3J81 K;  4AIJ A;  5AIP A;  5AON A;  4XLP F;  4IRG A;  1JHF A;  1J0R A;  4JQF A;  2AXL A;  2L01 A;  2QQ9 A;  3MFK A;  1IXC A;  3CTA A;  2UXN A;  3L09 A;  1G3W A;  2JPB A;  1F5T A;  1U5T C;  1T2K A;  3TKY A;  4I0B A;  1H0M A;  3ZN0 A;  1O3R A;  3QP6 A;  2NAZ A;  2PLY A;  1UB9 A;  2COM A;  1ZN2 A;  4U7D A;  3KCC A;  2Z3Y A;  1B4A A;  4CXF A;  3I0T A;  2DU9 A;  1HSJ A;  2FA5 A;  1KU9 A;  2HKO A;  1G3S A;  1BI3 A;  2OD5 A;  2G7U A;  1QO0 D;  1IN7 A;  3MAJ A;  4EM1 A;  1R1T A;  1T39 A;  2ZME B;  3KP3 A;  5HDN A;  5FLX Z;  3IRQ A;  5L3E A;  1FX7 A;  1XDS A;  3KZY A;  2P7V B;  1J5Y A;  1IRG A;  3F6O A;  3RTR A;  2DQL A;  2V1X A;  3KLN A;  5D5W B;  1L3L A;  2EJR A;  1IRF A;  3R0J A;  2E7W A;  1TQI A;  4KIG A;  3HIF A;  2GIV A;  5FLX K;  2HZT A;  1F1Z A;  3U1D A;  1KGS A;  3HRT A;  5HLG A;  3O3K A;  4UNO A;  1J9I A;  2BEO A;  2IRF G;  1Z7U A;  2DTR A;  3PQJ A;  4ENK A;  3I71 A;  3PQK A;  1FWZ A;  3CUQ C;  4HDU A;  4EJW A;  4M74 A;  1FOK A;  5FD5 A;  3KEO A;  4XSZ F;  1HW5 A;  4HF2 A;  3G3Z A;  2A69 F;  4KNY A;  3VEP A;  1HBX G;  4Y17 A;  2ISZ A;  1EH7 A;  4G94 A;  1XN7 A;  3ROU A;  2ETH A;  3DXJ F;  1R1U A;  5J8F A;  1O7F A;  4BHC A;  2EFN A;  4D0P A;  2CW0 F;  3F8C A;  2DLL A;  4LGW A;  1YQA A;  3E5Q A;  4P96 A;  1D5V A;  2XUB A;  4IVN A;  2KRF A;  5JI6 A;  1SMY F;  3R4K A;  2B0L A;  3T8R A;  2HOE A;  5CLS A;  1MGT A;  1MJ9 A;  1REP C;  5DCM B;  4FHT A;  1GXP A;  2VBZ A;  5CVV A;  3REO A;  1MDM A;  4M71 A;  3E5U A;  3IHU A;  1J59 A;  1K7A A;  1GXQ A;  3TOB A;  4A0X A;  1S29 A;  5DCF A;  1XGN A;  1U5T B;  3NRV A;  3M9A A;  3B73 A;  3C3W A;  5K5O A;  3S2W A;  4ON0 A;  4U7B A;  2TDX A;  4YFX F;  4GGG A;  1TNT A;  4O5V A;  4BH9 A;  2PFB A;  1QZZ A;  4Q5S F;  2R7D A;  3L9F A;  2R7F A;  2K4J A;  3J80 Z;  4HQE A;  3IL2 A;  1QBJ A;  5D4S A;  2VE9 A;  2HFH A;  3V8K A;  4B09 A;  5FB2 A;  1DP7 P;  2FBI A;  4F7Z A;  1HKT A;  2ESN A;  3FM3 A;  1RUN A;  1ON2 A;  3WTX C;  1BC7 C;  5LGT A;  1SMT A;  4LB5 A;  1EH6 A;  2CSO A;  1V4R A;  3T1B A;  1FNN A;  4DQ2 A;  3WE2 A;  2HEO A;  2H09 A;  3J80 K;  2XAH A;  1ZGA A;  2FMY A;  1DUX C;  2D45 A;  3ECH A;  1FZP B;  2CYY A;  3BZ6 A;  2MH2 A;  3E3V A;  1K78 B;  5L3C A;  4A0Y A;  1P4A A;  3L2C A;  2K7L A;  4OMY A;  4LLG F;  3HRU A;  3CDH A;  3CUQ B;  1ZG5 A;  5ICF A;  3TGN A;  2FML A;  1XGS A;  2YX4 A;  4N9I A;  4RB1 A;  2VT3 A;  2A6H F;  2ZME A;  1BOA A;  2OZ6 A;  4UXN A;  1AOY A;  3JTH A;  2Y75 A;  1IAW A;  1USS A;  4KN7 X;  4JBA A;  3DQV C;  4HX7 A;  1BN5 A;  2GXG A;  2BBY A;  5E1X A;  4O6J A;  2H94 A;  4BXU A;  5HOO A;  1FP1 D;  5DV5 A;  1BI2 A;  2QQB A;  3B02 A;  3CO7 C;  2MH9 A;  1XDU A;  2V6C A;  1G6N A;  5HDK A;  5ICE A;  1ZLJ A;  1JGS A;  3LAJ A;  2CWE A;  1B9M A;  2Z9O A;  2RC4 A;  3OV8 A;  4LK0 F;  5F64 A;  2DBB A;  4P5O A;  3HOT A;  1RNL A;  2ADU A;  1J2X A;  1BJA A;  4I02 A;  4IHT A;  5HLH A;  5DYM A;  3F8B A;  2JT1 A;  3GF2 A;  4RB0 A;  5ILS A;  4EQQ A;  3M8F A;  2EA2 A;  1U78 A;  4L18 B;  4I01 A;  3KLO A;  4EMS A;  2IPQ X;  4OIP F;  4EJV A;  4KIF A;  2YX7 A;  3GFM A;  3BJO A;  3GEZ A;  2RGV A;  3KET A;  2A5Y B;  2RDP A;  5CYV A;  4KFC A;  5BPD A;  2FQ3 A;  1ZG3 A;  3OOP A;  1WWX A;  4N9H A;  4OIR F;  5DCM A;  4YFK F;  2VOO A;  4LLL A;  2NNN A;  3FMR A;  1FBQ A;  3JTG A;  5DD4 A;  3GO5 A;  3WU1 B;  2VE8 A;  1RIO H;  1U5T A;  3C18 A;  3SXY A;  3HUG A;  2JRT A;  4KDP A;  1T38 A;  2M45 A;  2FU4 A;  3F23 A;  2QYO A;  2J5P A;  3MWM A;  5K1Y A;  2P5K A;  4ZH4 F;  2Z5U A;  4G7O F;  1D8J A;  2D1H A;  1KYW A;  1Y0U A;  2L4A A;  1I1G A;  4WK8 F;  3LWF A;  3RI4 A;  3HSR A;  5KVR A;  1YW9 A;  5IT9 Z;  3RKY A;  4Y13 A;  1GHC A;  1HKS A;  1LEA A;  4MQV A;  2VOP A;  3FF5 A;  1ZYR F;  1J75 A;  3SFZ A;  3FX3 A;  2CGP A;  1FSH A;  2XKP A;  3JW4 A;  5LEK A;  1XSD A;  1SFX A;  1TW2 A;  3IKV A;  3GUD A;  3ZMV A;  4ZYG A;  2L4M A;  5CVJ A;  3GX4 X;  5IT9 K;  1SAX A;  2L54 A;  1HKQ A;  3ZQ7 A;  3QPH A;  3KE2 A;  1ZGJ A;  4CDG A;  2D2W A;  1K78 A;  2D1V A;  1XGM A;  1QPM A;  3GLX A;  4MEY F;  3DPL C;  4G6D A;  3U9G A;  1K79 A;  2A6E F;  3CUQ A;  3K2Z A;  2ISY A;  3DP7 A;  2QVO A;  1JHH A;  3TOA A;  2DT5 A;  4RS8 A;  2DPU A;  1KA8 A;  2V79 A;  3ABT A;  2O3F A;  2P8T A;  2VOD A;  2QEN A;  2F2E A;  3R60 A;  5K5Q A;  3TDZ C;  1OKR A;  1R23 A;  1TQM A;  2Q0O A;  2A3S A;  2PMH A;  4PZJ A;  4A5M A;  1B1B A;  1BC8 C;  1GVJ A;  2MC3 A;  3LQQ A;  2PI0 A;  1V3F A;  3WU0 A;  1BIB A;  4HX8 A;  4LLN A;  3I64 A;  4NQW A;  3E97 A;  1G3T A;  4AIH A;  2XKO A;  2A61 A;  2V1D A;  2O03 A;  1QQI A;  2HYF A;  3RPQ A;  2VON A;  5L3D A;  1SD6 A;  4IPA A;  1P4X A;  2A68 F;  1I6X A;  1SD4 A;  3ZMS A;  1KQ0 A;  5H20 A;  3ABU A;  3V4G A;  2HQN A;  2P4W A;  4MHG A;  3QU3 A;  1F4K A;  4KN4 X;  1WQ2 A;  5FO5 A;  2RVC A;  3RJP A;  2OQG A;  4RB2 C;  4KMU X;  4R8H A;  4EM2 A;  3LA2 A;  4CZZ A;  3LAP A;  3EUH A;  3EYI A;  2GQQ A;  5LLQ A;  1Z05 A;  1R00 A;  2VC0 A;  5L3F A;  4CGZ A;  3DKW A;  3WTU C;  3I59 B;  3D0S A;  1LVA A;  4JK1 X;  5E8G A;  2OAZ A;  5D6F A;  3QPT A;  1FYM A;  1R7J A;  5FD6 A;  2PN6 A;  2RQP A;  5DDG A;  1BI0 A;  5KK1 A;  2H6B A;  2M87 A;  1H9G A;  2X0L A;  4GCV A;  4LD5 A;  2G9W A;  1XB4 A;  5CJ9 A;  1SFU A;  1IXR C;  2G7H A;  4KIC A;  2H6C A;  3DV8 A;  5DUK A;  4Q4Z F;  2HDC A;  3BJ6 A;  2RV8 A;  1AWC A;  4Y15 A;  3C7J A;  5DEQ A;  5F1R A;  4UHT A;  1Z9C A;  4EGY A;  4HLX A;  1KQ8 A;  4MGR A;  3K0L A;  4LG0 A;  2PMU A;  4UVC A;  2QBY A;  4M72 A;  2OA4 A;  2QZ8 A;  3P9I A;  1P4W A;  4N0B A;  3U2R A;  3TQN A;  2DK5 A;  1KU2 A;  1F9N A;  2ZKZ A;  4G7H F;  3F72 A;  3FXR A;  2V1U A;  2HTJ A;  3GFJ A;  1ZLK A;  3FMQ A;  1Z6R A;  4HA8 A;  2FBK A;  4XRF A;  4KMF A;  3ZMT A;  4P55 A;  4HOB A;  4ETS A;  2WC2 A;  3ULQ B;  4RB3 C;  5LRR A;  4XSX F;  3AAF A;  3MZH A;  5EEG A;  4HV6 A;  3GZ5 A;  4IXA A;  2UWM A;  4L9J A;  1OR7 A;  3COA C;  5E20 A;  1WRJ A;  2YR2 A;  4ZZL A;  3BPV A;  4M6X A;  2VBY A;  4R79 A;  4OOI A;  3WG9 A;  4LFU A;  3V8L A;  5E1W A;  4BHP A;  1UHM A;  2W24 A;  2ZFW A;  3ZMD A;  3TO6 A;  2DQR A;  3SZP A;  5LHH A;  3CUO A;  5D8L B;  3WGI A;  4R1H A;  1E2X A;  4IRI A;  1D8K A;  5FFZ A;  3EYY A;  1O57 A;  4BHB A;  1FPQ A;  4NHJ A;  5DD8 A;  4EJU A;  3E6B A;  1VTN C;  1HST A;  4RGX A;  4LJZ F;  4WWC A;  1R58 A;  2FSW A;  5BPI A;  2LF8 A;  2P7C B;  4H0E A;  3VB2 A;  2GXB A;  3HHG A;  4L5J A;  1FT9 A;  1O3T A;  2HGC A;  1L0O C;  2EV5 A;  3PFI A;  2P5V A;  1T98 A;  3WGH A;  5CVI A;  3N97 A;  1ZRC A;  2P6S A;  4WXH A;  1U3E M;  1OYW A;  1B6A A;  4EGZ A;  3KP4 A;  3CLO A;  3I59 A;  1IZ1 A;  2CQK A;  4A0Z A;  1R5H A;  3ML6 A;  5H6Q A;  3T5X A;  1HW2 A;  1H9T A;  3SHF A;  2GA1 A;  5JHU A;  5LHI A;  5LRS A;  3I5U A;  3WTW C;  2BE5 F;  1FP2 A;  2FF4 A;  4KUM A;  3F8N A;  2IA2 A;  1XMA A;  3WTT C;  4ZYH A;  4YG2 F;  1MJB A;  2CG4 A;  4GYI A;  5A2Q Z;  2DFI A;  2GA2 A;  5ICC A;  1R1V A;  4LMY A;  4YFN F;  4I98 B;  2X4H A;  3RYP A;  2L02 A;  1E17 A;  5HS7 A;  2FXA A;  4WXC A;  1FSE A;  3F3X A;  2M1B A;  1XSX A;  2ELH A;  2M8E A;  5A2Q K;  3Q9V A;  2KIF A;  4B8X A;  2NYX A;  2FRH A;  1TQP A;  3I54 A;  3K1M A;  1ZRE A;  2HKX A;  1BIA A;  5BQT A;  3TO9 A;  3HRS A;  1C0W A;  4U88 A;  2PJP A;  2EB7 A;  2OZU A;  4HDV A;  1QZY A;  3KEQ A;  2XRN A;  3BRO A;  3KP5 A;  2DO7 A;  1ULY A;  2IVM A;  3BJA A;  1Z1D A;  2IW5 A;  3HYI A;  3ZMZ A;  5D8K B;  2F5F A;  3IWF A;  2O8X A;  2E1N A;  2WTE A;  3G73 A;  1XCB A;  5ICG A;  2Q2E A;  1RZ4 A;  1LDD A;  4PGG A;  4ZZD A;  1ZHF A;  2VC1 A;  3K9T A;  3MZY A;  4U0V A;  3HSE A;  4WF2 A;  2STW A;  1TW3 A;  3W6J B;  5K5R A;  2L3D A;  2BV6 A;  1YW7 A;  2QQA A;  4ASN A;  4L9T A;  5FGM A;  5BS6 A;  1B59 A;  2IA0 A;  2LSO A;  2ZBK A;  4M6Y A;  3SQN A;  1S7A A;  2C6Y A;  2ZNY A;  3KP7 A;  3FXU A;  1S7O A;  3VOE A;  2ESH A;  2LF7 A;  2PG4 A;  1O3S A;  4LG0 B;  2QBY B;  5EEH A;  3E6M A;  1R36 A;  1O3Q A;  2F5D A;  4G8X A;  1HQC A;  1B9N A;  3FZV A;  1FYK A;  2AS5 F;  1LB2 A;  2H27 A;  3I58 A;  1UST A;  1KYZ A;  4NB5 A;  3GW2 A;  2STT A;  1ZH5 A;  3F6V A;  1YIO A;  1LNW A;  4GYG A;  1TBX A;  4L0Z B;  1W5S A;  3EET A;  2EFO A;  2KKO A;  3GVA A;  5HS9 A;  4LK1 F;  1KU7 A;  1I27 A;  4L5I A;  2EFW A;  2EFQ A;  1XCV A;  4XLN F;  1IUY A;  1J7K A;  2OBP A;  1TNS A;  1WI9 A;  4HW0 A;  2W85 A;  2GWR A;  3CJN A;  1TLH B;  4AD9 A;  2CFX A;  4I0A A;  3ZPL A;  3GWZ A;  4RAZ A;  3V7C A;  1U8R A;  4AVP A;  1MZB A;  3GYH X;  3LQR A;  4A12 A;  2HTS A;  4FT8 A;  1IXS B;  4FX0 A;  3QAH A;  1PUE E;  5JR3 A;  2Z99 A;  3FM5 A;  4U0W A;  1ZRF A;  4HZF A;  2XIG A;  3WTS C;  3ZN1 A;  3HRM A;  1IN5 A;  5LEJ A;  4UVA A;  5TRD A;  2KIU A;  6PAX A;  2JSC A;  3D5L A;  1YLF A;  4G9Y A;  2OU2 A;  4ENN A;  4TV7 A;  1IW7 F;  3N4M A;  2F5C A;  3BOQ A;  3V7S A;  1FBU A;  3RKX A;  2M30 A;  2M5W A;  1NHA A;  3E6D A;  1XGO A;  2OQR A;  3C1D A;  4OMZ A;  5ILU A;  3BDD A;  3LFK A;  1U6G A;  3MCZ A;  4IRH A;  5HDG A;  3F8F A;  2ZO4 A;  3ECO A;  3LA7 A;  1Q1H A;  2Y48 A;  3QRF F;  2E1C A;  4HLY A;  1SD7 A;  2XGX A;  3BWG A;  2DK8 A;  5CVR A;  4ESB A;  4KA4 A;  4L9N A;  1YYV A;  4YII A;  5HLI A;  3ZP5 A;  4IF4 A;  1WKM A;  4WXD A;  3GFL A;  2J5O A;  3GFI A;  2JPC A;  2XAS A;  3QP5 A;  5LHG A;  1R5G A;  4AIK A;  1T6S A;  4Z2Y A;  3M1E A;  4XBF A;  3K69 A;  2DI3 A;  1FBS A;  2EA4 A;  2EV6 A;  3HOS A;  2FE3 A;  3L00 A;  1YFH A;  2ZJ2 A;  4PDK A;  5CVU A;  2IJL A;  4S04 A;  5F6F A;  4ZYE A;  1P2F A;  4HYE A;  3RYR A;  2LNB A;  4A6E A;  1Z91 A;  4ENJ A;  3MQ0 A;  3E6C C;  1YW8 A;  1PP7 U;  3IC7 A;  1BBY A;  4ENM A;  4LB6 B;  4O3M A;  4RGU A;  5DUI A;  1W7P B;  2VXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...