4MQVA

Crystal complex of rpa32c and smarcal1 n-terminus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
GLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of RPA32 bound to the N-terminus of SMARCAL1 redefines the binding interface between RPA32 and its interacting proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Replication protein A 32 kDa subunit
total genus 20
structure length 65
sequence length 65
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4mqvA00
3TO7A 1RIOH 1R58A 2IA2A 3F22A 1TLHB 3KP4A 4U0YA 2KIFA 4IF4A 4YIIA 3DPTA 2KKOA 4A0ZA 2O3FA 1F5TA 2Z99A 4XLPF 2QQAA 1ZGAA 4M9ZA 2ISZA 3BWGA 2UZKA 1IN8A 2GA1A 2RKHA 1O3SA 1LEBA 4G94A 4BHBA 1QGPA 2OZUA 3BJOA 5L3DA 5TJJA 4KIGA 4UNOA 2JTVA 3E6MA 1U5TC 1B59A 4Q47A 4HF2A 1YFHA 4MQVA 2D1VA 2MBFA 3COAC 3DV8A 5HVQC 2F2EA 5DUKA 2FF4A 4KDPA 1T6SA 4KMUX 2YX7A 4GYGA 2RQPA 2DLLA 1PP8F 2W25A 3RKYA 5IT3A 1QNTA 4LMYA 2R3SA 3M7GA 1ON1A 3Q9VA 4M72A 4ASNA 3U2RA 3KEOA 1R36A 3ZPLA 3JAMZ 2P5KA 4L5JA 4HAMA 1XDUA 1JE8A 4N9HA 2D2WA 4RB3C 4RAYA 2HFHA 3QP5A 4HW0A 1YS6A 3KZYA 2DFIA 4LG0B 2VC1A 2MLKA 2MH2A 2VONA 5FGMA 1QBJA 3CUQC 5FLXK 1GVJA 1S6LA 3D5LA 4M9XA 1H0MA 1K6OA 1FPQA 2KIUA 4CZZA 4P9FA 5HS8A 1DPRA 2QWWA 5HLHA 2L4MA 2FSWA 3F8FA 4KIBA 4RAZA 3KLOA 4PGGA 3FXQA 1T38A 5F6FA 2JRTA 4KT5C 3RTRA 1B6AA 4BHPA 2HOEA 4A0XA 3ZMVA 4A2UA 3R6SA 3EYYA 1ULYA 4MEXF 2MH9A 5A2QZ 1YW9A 4FX4A 1TNSA 2FNAA 2FBKA 4AIJA 4KICA 3FHZA 2F5DA 3HRTA 1D8KA 1ZH5A 1Z05A 2M1BA 4EM0B 3GFJA 4R79A 1YS7A 5LBQA 3I54A 2E7WA 2DK5A 1GHCA 2HKXA 4WXDA 2HGCA 4OIQF 3VEPA 2GZWA 4XLNF 1IW7F 1ZGJA 3WODF 2LDUA 2CGPA 5L3CA 4R8HA 3ERED 1HBXG 1S3JA 4M6YA 2VXZA 3JW4A 1P4WA 1FWZA 5KVRA 3SZPA 5H20A 1HXDA 3F21A 2B0LA 3ZP5A 5D4RA 4EVIA 2LSOA 4ESFA 1SD5A 1FSHA 3F6VA 2L01A 3ELKA 4ZH4F 4KN4X 1AWCA 2Y48A 3F6OA 4RGXA 4G7OF 3GW2A 1BJAA 2Z33A 3GYHX 4F7ZA 2LF8A 2HWVA 3RYRA 3C1DA 4ZZDA 3HSRA 3PQJA 3K1NA 4PGHA 4OIRF 5DEQA 2PEXA 1YO5C 1SFUA 1EH7A 3ZMUA 2DI3A 4HF0A 4D0PA 1I6XA 3DXJF 1BOAA 4HX7A 4KYWA 3H3ZA 4IHSA 1B9MA 1O7FA 3ZN0A 5J8CA 1HKQA 3O6BB 3U1DA 1REPC 3J7AO 3LAJA 5J6XA 2H6CA 5BS6A 3M8FA 5H6QA 3E5XA 2G9WA 2V9VA 2XAGA 3BP8A 3JSPA 1LDKB 1LEAA 1TBXA 5CLSA 2FNPA 2NS0A 3QOPA 2DBBA 2FMLA 2IJLA 2VODA 1MJBA 5J8FA 2VE8A 1IN6A 1YYVA 2IA1A 4G8XA 4HF1A 4Z2YA 2D45A 1DUXC 4EM1A 3P9CA 1UFMA 2RNJA 3WTWC 2Y0MA 3BY6A 1W7PA 4IRHA 5D5UB 3ZMTA 1SD4A 2PMHA 3T8RA 5HDKA 2P8TA 4CICA 1XGNA 3HHHA 5A2QK 5BQTA 2RGVA 1ZAOA 3CDHA 3HTUA 2EV5A 2NAZA 2VBWA 3VOEA 2CSOA 4MTEA 5CVVA 1STZA 2PLYA 2Z5UA 3IHUA 3V4GA 1FYKA 4EV0A 3ABUA 1T98A 1P92A 3L00A 1TQMA 2K02A 1P2FA 3EYIA 5DD8A 3P9IA 1LDJA 1OMIA 4OIPF 1FP1D 5LHHA 2EB7A 4HLXA 3T0YA 1FOKA 3HOSA 1S29A 2XRNA 1J2XA 1BC7C 3HRUA 5HDNA 4MEYF 2ZBKA 3RKXA 1ODDA 3GFLA 1JGSA 1XCBA 3HYIA 4QLCU 4LK0F 1B1BA 2PMUA 2WWYA 3I4PA 4ENMA 1BIAA 4ZZLA 1LB2A 1D8JA 2RV8A 3KFWX 4XSZF 2XIGA 3HTSB 3V7CA 4I09A 2H27A 1D5VA 4KUMA 3DPLC 3FWEA 4HV6A 4Q48A 3FMRA 4I0BA 2DQRA 2NRAC 2WTEA 4G6DA 2ADUA 3CUQA 3WU1B 4RB2C 1IRFA 2HQRA 1GXPA 1IAWA 1BI2A 3V8JA 2P6TA 1R23A 4HLYA 1UHMA 4O6JA 3H3UA 5ILVA 4KIFA 2HDCA 4CGZA 4HDVA 3E97A 1W7PB 3BJAA 3I71A 1TQIA 5EEGA 2PI0A 2EJRA 2ZNZA 3NRVA 3R0JA 2FXAA 2L3DA 2KRFA 1ZRDA 3J81Z 4LLGF 3ECOA 1J75A 1R5GA 1B9NA 1KA8A 2VE9A 4GCVA 3RPUA 3WE2A 4WX9A 2J5OA 2PBIA 4BQAA 3HRSA 1G4DA 5LHIA 2DPDA 4DQ2A 1FBQA 2FA5A 2P6SA 3DQVC 1U5TA 1J7KA 1G3SA 4S04A 5DCMA 1V3FA 5LGNA 1FY7A 2VBZA 3CO6C 4ENKA 2COMA 2G7HA 1IXSB 1F4KA 1OYIA 5D5VB 1RNLA 2QQ9A 3HOTA 2P7VB 4ZYHA 3HSFA 5FB2A 3WTSC 5DCMB 2E7XA 1PP7U 4A6DA 2OQRA 1FP2A 2JPBA 4I01A 2EK5A 5HS7A 1ZHFA 3Q9SA 3VB2A 1T2KA 2BBYA 2V1XA 3K1PA 4YG2F 4P96A 2ZO4A 2YU3A 3IC7A 1FNNA 1LJ9A 5AIQA 2ZNYA 3WGIA 1O7LA 3NEUA 1F1ZA 2CYYA 1LVAA 1Y0UA 5LEJA 4G9YA 3RI4A 1YW7A 2HZTA 3ABTA 3SZTA 2STWA 2VC0A 2Q0OA 2ZMEA 3BOQA 2DPUA 3CJNA 5E1WA 1SFEA 4EM2A 3KP5A 1QPMA 1W5TA 5AIPA 1I27A 3ZMSA 2FMYA 3MZYA 3R61A 1O3TA 3FF5A 4Y15A 2FQ3A 3BROA 4HX4A 3WE3A 4RGSA 2R7FA 5K5RA 3FMQA 2HR3A 2STTA 2F5CA 2AS5F 2E1CA 4IHTA 1FC3A 2PG4A 1Z9CA 1FZPB 2AXLA 4JK1X 2Z9OA 2W24A 5LGTA 1MJAA 2QQBA 1IXRC 2VBYA 1R22A 3WTVC 4UUVA 3MWMA 3E6DA 4U7BA 4CYDA 4EGZA 1XB4A 3L9FA 5FFZA 3JAMK 3C3WA 3RIRA 4E70A 2O6GE 2K7LA 2X0LA 2XKOA 1WI9A 4CHUA 5D6FA 4UV9A 3ISPA 1Q1HA 5E20A 2VN2A 5ILSA 3IRRA 4PZJA 1HKTA 3EETA 5CVIA 3PFIA 1Z7UA 3SQNA 2M5WA 1KQ8A 1BIBA 1RZ4A 4M9SA 2X4HA 1IN5A 1T39A 2RVCA 1RUNA 3IWZA 2P5VA 4OINF 4B8XA 1G3WA 1U5TB 4XSXF 5D5WB 2OQGA 3E5QA 2C6YA 4LK1F 2QVOA 3M9AA 2EFNA 3WU0A 2DAOA 3MAJA 3KP3A 4CDGA 4ENJA 2M30A 2P7CB 3O2PE 3JSOA 1DPUA 5L3BA 1U3EM 4GYIA 3HSEA 3DFGA 1NHAA 4LB6B 3FXUA 4L9VA 1HSTA 4L9NA 5DDGA 2VBXA 2HTSA 3GFIA 4A0YA 1ZREA 4WF2A 2F5FA 5ILUA 2GQQA 3J80Z 1KYWA 3KLNA 2IT0A 3E3VA 5E8GA 2O03A 1RUOA 3HHGA 4GGGA 1IRGA 1U78A 2O0YA 4LFUA 4IVNA 3QPTA 1P4AA 4MNUA 4Y13A 4ENNA 5ICGA 1XGMA 4IPAA 4Q5SF 3QAHA 3KP7A 1O3QA 4RGRA 1JHHA 1ZG3A 2PJPA 1BM9A 2CFXA 4MTDA 1K79A 2UXXA 2XVCA 1G3TA 3J80K 2WC2A 3U9GA 4EJOA 3TOAA 3AAFA 1W4MA 2OBPA 1Z6TA 3TKYA 2LF7A 1UCRA 1WQ2A 3MQ0A 3GO5A 4RB0A 2PQ8A 3D0SA 1KU3A 3MZHA 2J5PA 3LA3A 4BNCA 4K2EA 2TDXA 5IT9Z 1IN4A 2VT2A 1T0FA 2XAHA 5K1YA 4I7HA 3MCZA 1P6RA 2GXGA 1J9IA 3I5UA 1EH6A 2A3SA 3ULQB 4HQMA 3GEZA 3OOPA 4FX0A 2L4AA 4IJAA 4I98B 3TQNA 4WWCA 1BI1A 1X3UA 5ED4A 3SHFA 3E6BA 3QU3A 3B73A 4RGUA 1RI7A 1R7JA 1QO0D 3RKWA 2ZXJA 5AONA 4EJWA 1SMTA 3OV8A 2YR2A 3BZ6A 3K69A 4EJTA 3KE2A 1ZYRF 2K4BA 1MDMB 4OU0A 1XDSA 4NB5A 2KJBA 3BDDA 5LHGA 3LWFA 3P7NA 3LA7A 3R60A 1IF1A 4L9TA 2FEZA 1KGSA 3ECHA 1L3LA 3KEQA 5DUIA 2ZKZA 2P4WA 3QU6A 1PDNC 1U2WA 1TW3A 4ZYGA 1YG2A 5FD6A 3GFMA 1TNTA 4KFCA 1LQ1A 4UVBA 1HKSA 5JHUA 3Q5FA 4R1HA 4YFXF 4B09A 5DCFA 5E1ZB 3I0TA 1O57A 4AVPA 4KMFA 3TOBA 4L9JA 5L3EA 3GLXA 3FMSA 1F9NA 3CO7C 5EEHA 1I1SA 5LLQA 2IRFG 2F5EA 3V8KA 1SFXA 2CWEA 1U8RA 4HOBA 2EA2A 2DU9A 3GF2A 1YTYA 1TTYA 1IXCA 5HS9A 2V1DA 5E17F 4MQ9F 5FO5A 2XAQA 2IW5A 2DW4A 2EV0A 4N9IA 3EDPA 3BPXA 1FLIA 2KIMA 1KU7A 2P5LC 1BI0A 4OMZA 2A61A 4RB1A 2D1HA 2QENA 5DD4A 1MGTA 2EWNA 2WV0A 3T8TA 3JTHA 5ICCA 2HS5A 3F8MA 2BV6A 3CUOA 4AWXB 3VODA 1HQCA 4HYEA 1V4RA 3V7RA 5JVTA 3GZ6A 2Y75A 2KJCA 4LLLA 1B4AA 2XASA 2UWMA 5CVJA 2A07F 3VFZA 2XROA 1R1UA 5CYVA 2DQLA 2OD5A 4MHGA 2XHKA 1WRJA 2JPCA 4I02A 5HOOA 2ESHA 2IA0A 1SD6A 4O3MA 2XV4S 1UHWA 2FOKA 3N97A 5HDGA 2VOOA 1J0RA 1WSUA 1K78A 2Z3YA 3F8NA 4WCGA 1Z1DA 5D8KB 1K7AA 1XMKA 2EV6A 1AOYA 2CG4A 5F1RA 2JT1A 4HV5A 4FT8A 4LJZF 3ZMZA 3G73A 2L54A 3K9TA 4P5OA 1XSDA 1TW2A 2V79A 3T1BA 3RYPA 1E17A 3R4KA 1DP7P 5FLXZ 5JR3A 2H6BA 5CVRA 2FE3A 5E8IA 2A6HF 5DYMA 5CJ9A 2ZFWA 4EJVA 2ELHA 1EV7A 2RN7A 2G7UA 1OYYA 5HLGA 2ZMEB 4NQWA 1XGOA 5JFRA 3SXYA 3F8BA 2XUBA 4LLNA 4A5NA 3K2ZA 3FM3A 3RJPA 5BPDA 3KP6A 3DEUA 1H9TA 2MD5A 2M45A 4O5VA 3EUHA 1YW8A 2CW0F 5L3FA 3HUGA 2R7DA 2BGCA 1FSEA 1USTA 2OAZA 4OIOF 4KN7X 4LG0A 4BXUA 3QRFF 1XMAA 3RPQA 3KETA 2QBYB 3O3KA 5FD5A 4EGYA 2M8EA 1Z91A 5CVUA 4OMYA 1YQAA 3JTGA 3J81K 4AIHA 2HEOA 3E5UA 1LNWA 5K5OA 2GAUA 3GUDA 3MEXA 5KK1A 3ROUA 1ZRCA 4EQQA 3S2WA 1QZYA 2K27A 2YPRA 2LKPA 3LSTA 4L5IA 1QQIA 3N4MA 3L09A 4L0ZB 3I59B 1YIOA 1L0OC 2BYVE 1USSA 1XN7A 3DF8A 2UXNA 2V1UA 4CXFA 1MD0A 1HW1A 5LRRA 4LB5A 4XBFA 4RS8A 4BAYA 2ACJA 2MA3A 2E1NA 3LQQA 1R5HA 4BYYA 3WG9A 3FXRA 1EH8A 2EFOA 2QM3A 1ZG1A 4I2OA 4EMSA 3KP2A 2IP2A 4NHJA 4LD5A 3WTZA 3R0AA 3GXOA 3TDUC 2K86A 3SFZA 1I5ZA 4M73A 2GWRA 1I1GA 3W6JB 2FU4A 4HX8A 5D8LB 1H9GA 1XSVA 6PAXA 2EFQA 4LGWA 3V8LA 1OR7A 1ZG5A 1J5YA 2MLGA 1S7AA 3FM5A 5FFXA 5F64A 3E6CC 1SAXA 1JHFA 5D5XB 1FX7A 3EQLF 2JZYA 1Z6RA 3NQOA 4JBAA 1FYMA 2JSCA 4ESJA 2QLZA 1YLFA 3F23A 1KYZA 3IRQA 3V7SA 4L0YB 4L18B 4ESBA 3I53A 4M6XA 2XAFA 1ONVA 5D6EA 5IT9K 4UXNA 4TV7A 2EFWA 4UVCA 3ZQ7A 3C18A 3IKVA 1SMYF 3CLOA 4IRGA 1IN7A 4A6EA 3B02A 3DP7A 1G6NA 4A5MA 1ZLJA 1FYLA 3TO9A 1UB9A 3WTXC 4HA8A 2QBYA 1TQPA 4N0BA 2ISYA 2ESNA 4ON0A 2XKPA 5E1XA 2O61A 3FX3A 3H92A 4UV8A 3PQKA 3G3ZA 2NNNA 1OYWA 2GXBA 4QWQA 2CO5A 3WGHA 4YFNF 3GX4X 2OZ6A 1BC8C 3HRMA 5DV5A 3M8EA 2OU2A 3L2CA 4IXAA 2A5YB 4KNYA 4XRFA 1MJ9A 1PUEE 4BHCA 4HQEA 3GVAA 3M1EA 3K0LA 3TDZC 1MZBA 3ZMDA 3QPHA 3T5XA 3C7JA 4G7HF 2YX4A 3IL2A 2HQNA 1D3YA 2W85A 2FBHA 1GXQA 4EJUA 1W7PD 2QYOA 1KU2A 1LDDA 3BPVA 1FBSA 1IUYA 1S7OA 2DTRA 1R1TA 2M87A 3LAPA 1XD7A 4A12A 2CQKA 1KQ9A 5BMZA 4YIFA 3KZZA 4AIKA 5TRDA 4G6QA 1BI3A 1QZZA 1BBYA 3TGNA 3REOA 3QP6A 1O3RA 1ZRFA 3I58A 1HW5A 2HYGD 3HIFA 2VT3A 5LRSA 1XSXA 1IZ1A 4WXCA 4P55A 1KU9A 2O8XA 3WTUC 4I0AA 4GXOA 1FT9A 1OPCA 2Q2EA 3FZVA 2RDPA 3KCCA 1R00A 3WTTC 3IKTA 5JI6A 2VOPA 2ZJ2A 2EA4A 5BPIA 4IRIA 2H09A 1HW2A 2A68F 1JXSA 4U0WA 4H0EA 1WKMA 3W6KB 1ZARA 4M71A 2XGXA 5ICEA 5K5QA 2H94A 5LEKA 4HBLA 1SD7A 3GZ5A 2ETHA 1BN5A 4PCQA 3F8CA 2OA4A 1W5SA 4GO1A 4HDUA 2HKOA 1XGSA 4CO8A 4PDKA 3MFKA 2W84A 4WXHA 5L3GA 1CGPA 2HYFA 1P4XA 1K78B 2NNYA 1OKRA 4JQFA 3CTAA 4G7ZF 3WTYC 4Y17A 1G3YA 1XCVA 4KA4A 4FHTA 4ETSA 3F3XA 5BOXA 5D4SA 2DK8A 3TO6A 4P9UA 3ML6A 4UHTA 4S05A 1WWXA 1R1VA 2BEOA 2GIVA 2A6EF 1C0WA 3K1MA 5E18F 2V6CA 2MC3A 4DNCA 3L7WA 2DT5A 4U7DA 4ZYDA 1FBUA 3F72A 3BJ6A 3I59A 4Q4ZF 1ZN2A 4U88A 5LGUA 2W57A 2HTJA 3P9KA 3RDIA 3WGGA 5ICFA 2PN6A 1VTNC 1S8NA 4OOIA 3GWZA 2ZCWA 2K4JA 2BE5F 1MKMA 4MGRA 1J59A 4ZYEA 2EFPA 2QUFA 3LFKA 4BH9A 2YSRA 2PFBA 2RC4A 5HLIA 2GA2A 1KQ0A 1CF7A 2FBIA 2NYXA 2Q8KA 4YFKF 1ZLKA 1MDMA 3I64A 2L02A 4WK8F 4HZFA 4UVAA 3LA2A 5ERIA 2IVMA 1A04A 2LNBA 2FRHA 3DKWA 5H6RA 1DDNA 2DO7A 4U0VA 2A69F 2XAJA 1U6GA 1HSJA 1CF7B 2IPQX 1ON2A 3IWFA 4AD9A 3LQRA 3ZN1A 2QZ8A 4M74A 1E2XA 3CUQB
chains in the Genus database with same CATH superfamily
3CJRB 2ICWG 3LFUA 3M8JA 3TO7A 3OWTA 1YJ9I 1RIOH 3S1MJ 3GTPJ 1R58A 1TC3C 2IA2A 3F22A 1TLHB 4A3FJ 4QSHA 3ZOBA 2WB1A 3KP4A 1XTAA 4U0YA 2M0CA 1Z0XA 2KIFA 4IF4A 2MD0A 4HEA2 2CUEA 2DT7B 3L2UA 2LG4A 4YIIA 5F0CA 4XNFA 2M7BA 2R7UA 3D5RC 3DPTA 2VQGA 2KKOA 1POGA 1GUUA 3ASOH 4IO9F 4I76A 4A0ZA 2O3FA 3HOVJ 1F5TA 2Z99A 4XLPF 2QQAA 1ZGAA 2Z1DA 4M9ZA 2ZC2A 2ISZA 3W2VA 2E5NA 1X1BA 3BWGA 2UZKA 2FUG2 3I9V2 1IN8A 2GA1A 1OCCH 5J40A 2RKHA 1O3SA 1LEBA 4G94A 3MN2A 4BHBA 1QGPA 1UG2A 2OZUA 3BJOA 1VQ7I 4XL9A 4DGWB 3BG9A 5L3DA 4KIGA 5TJJA 4UNOA 4DW6A 1BA5A 3GLLA 2JTVA 1B72B 3E6MA 3OR1C 1U5TC 2R0QC 1B59A 4Q47A 2IBDA 4ITVA 2DOAA 3VDXA 3RQ4A 4HF2A 2E60A 2ZJPF 3MKLA 3ZQFA 2X9DA 4XORA 1YFHA 4MQVA 2D1VA 3IH3A 2MBFA 3COAC 3DV8A 4BJ5C 5HVQC 3CCRI 4PJ0C 2BHYA 2F2EA 4EATA 5DUKA 3CMAI 2F5VA 3S3NA 2FF4A 2W1OA 4KDPA 1T6SA 2L7KA 4KMUX 2YX7A 4GYGA 2RQPA 3LSIA 2DLLA 1PP8F 2W25A 3B6CA 1PYVA 3AFHA 3PSIA 3RKYA 3GCMA 5IT3A 2ZJQF 1QNTA 1ENHA 2R3SA 4LMYA 3M7GA 1ON1A 3Q9VA 5K7ZA 4BY7J 4M72A 4ASNA 2MYSA 1HA8A 1RESA 2B9SA 3ZRGA 3U2RA 3OYFA 3KEOA 4OAYA 1R36A 4BACA 4E7LA 3CDIA 3ZPLA 3JAMZ 2P5KA 4L5JA 4HAMA 2NVTJ 1R4NB 1XDUA 1JE8A 4N9HA 2D2WA 4C3HJ 5J1RA 4RB3C 1T08B 4RAYA 2HFHA 3QP5A 4HW0A 4IHVA 1YS6A 3KZYA 2DFIA 1BJZA 4LG0B 2VC1A 2M34A 2MLKA 2MH2A 2VONA 5FGMA 1QBJA 4KISA 3CUQC 2LH9A 1VI0A 2HOTA 5FLXK 1YJWI 1SAUA 1GVJA 1S6LA 2R5YB 3D5LA 1K83J 4M9XA 1H0MA 2LLKA 2FX0A 1K6OA 1PJRA 2XB0X 1FPQA 2MABA 2KIUA 4CZZA 4P9FA 5HS8A 1DPRA 2F4MB 4B48A 2QWWA 5HLHA 4P1WA 2X6YA 3B6AA 1V5FA 2M0MA 2QA4I 2L4MA 2FSWA 3F8FA 4KIBA 4PJJA 4RAZA 3KLOA 4PGGA 3FXQA 2KDZA 1T38A 3K4BA 5F6FA 1YJNI 1MBFA 1TT0A 2JRTA 4KT5C 3RTRA 1B6AA 3IAM2 4BHPA 2HOEA 4A0XA 2CU7A 1YIJI 3ZMVA 1D1AA 4A2UA 3R6SA 2QQ8A 4RMNA 3EYYA 4I99C 2LR8A 1ULYA 3HGYA 4MEXF 2MH9A 5A2QZ 4XR6A 1YW9A 4FX4A 2R7QA 3RPUD 1TNSA 2FNAA 2FBKA 4AIJA 5FKKA 4KICA 1VQ4I 1MBEA 3FHZA 2F5DA 3HRTA 4NC6A 1D8KA 4PFPA 1ZH5A 1Z05A 2M1BA 4EM0B 3GFJA 2VIXA 4R79A 1YS7A 3IAS2 4XLHA 5LBQA 3LSHA 2ZB9A 3I54A 1AKHB 3TBIA 5KNLA 2E7WA 1X2MA 2QSHX 4V2GA 2DK5A 3JRCA 3K70C 1GHCA 2HKXA 4WXDA 2NVXJ 5M3MJ 1GV5A 1S5LC 4XLFA 2HGCA 1OCRH 2X1DA 1I39A 4IOCF 4OIQF 2CH0A 2WAFA 3VEPA 2GZWA 4XLNF 4CCMA 4DBQA 1IW7F 3W3CA 1NTCA 1YOVB 3PM1A 5TGTA 2Y69H 1NK2P 1WH5A 1A5JA 2DJIA 4QPOA 1ZGJA 3WODF 2LDUA 3LSRA 2GXAA 2CGPA 5L3CA 2WBMA 3K4NA 4CCOA 4R8HA 2DA4A 3ERED 2PX9A 1S3JA 1HBXG 3M1CA 4M6YA 2VXZA 3JW4A 1P4WA 3HKZA 4FE4A 3PSFA 2QCOA 2X85A 1FWZA 3MZ8A 5KVRA 3SZPA 3AKZA 2A05A 1TZLA 3S3MA 1ZELA 3K4MA 4NQWB 5H20A 2XC7A 3OOUA 1HXDA 3F21A 2B0LA 2NS7A 3ZP5A 4BQNA 5D4RA 3O8GA 1ZKGA 4XOPA 1VF9A 4EVIA 3GBGA 4BDZA 1W36C 2LSOA 4ESFA 1SD5A 3OSFA 1FSHA 2R7TA 1VZ0A 3F6VA 4OAZA 2L01A 3ELKA 4ZH4F 4KN4X 1AWCA 2Y48A 1Y8QB 3F6OA 1V5GA 4RGXA 2PMZN 4G7OF 3S17J 3PO2J 5EG0B 3OMYA 3S15J 3GW2A 1BJAA 1BW5A 2VQHA 4X6AJ 3JRAA 2Z33A 3GYHX 4F7ZA 2LF8A 2HWVA 3RYRA 3C1DA 4ZZDA 5EGOA 2CQQA 5GP9A 1D0YA 3BT9A 5KAIC 5FROA 3HSRA 2KL4A 4XK4A 5M5WJ 3PQJA 2JUGA 3K1NA 4PGHA 4OIRF 5DEQA 3VYTB 2PEXA 1YO5C 2HPIA 4G12A 1SFUA 3NWSA 1ETOA 2OPTA 4XN3A 1EH7A 4QIWN 3BG7A 3PNTA 4JOMA 1NK3P 3ZMUA 5HNFA 4MLOA 4RLQA 2DI3A 3CQZJ 4HF0A 4XOTA 1QRYA 4B4CA 2VJIA 3G6EI 4D0PA 1TWCJ 1I6XA 3DXJF 1BOAA 4HX7A 4KYWA 3M3YJ 3H3ZA 5GTIC 3L2QA 1ETVA 1QU3A 1U9OA 5E79C 4A69C 2E2HJ 4IHSA 2K9LA 1Z21A 3ZQIA 4CCNA 1B9MA 1EA3A 4BE2A 4D9JA 3OYNA 1O7FA 3ZN0A 5J8CA 1HKQA 3O6BB 3U1DA 2R4GA 4IHXA 1REPC 1HDPA 3BG6A 2COBA 3J7AO 3LAJA 4M3BA 5J6XA 1I3AA 3ZGKA 2H6CA 2VKHA 5BS6A 1Y8RB 3LSKA 3OYAA 1MMAA 4BE1A 3HJEA 2JA7J 1X4OA 2I8DA 3M8FA 5H6QA 3E5XA 1MMSA 2G9WA 3ESWB 2V9VA 3MKYB 2XAGA 5C4JJ 3BP8A 3OYDA 3JSPA 1LDKB 1LEAA 1TBXA 5CLSA 3FXOA 2DA6A 5HNHA 5BNGA 2FNPA 3WHBA 2NS0A 3Q3SA 2DA2A 2UV1A 3QOPA 2DBBA 2FMLA 2IJLA 2VODA 1MJBA 5J8FA 3DCFA 2VE8A 1IN6A 1JKPC 1YYVA 4I6ZA 2OTLI 2IA1A 3EUHC 3IH4A 2AXTC 2HDWA 4G8XA 1VQOI 4HF1A 4LITA 4Z2YA 3H5AA 1G59A 2D45A 3OSGA 1GT0C 2KDOA 3S14J 2E1MC 3RZDJ 1DUXC 3PNYA 3RSNA 3P9CA 4EM1A 1UFMA 1YX5A 2RNJA 3HOWJ 5CQGA 3WTWC 2Y0MA 3BY6A 1W7PA 4IRHA 5D5UB 3ZMTA 1SD4A 1IGNA 2PMHA 3T8RA 5HDKA 2P8TA 2PJRA 1SANA 2OTJI 4CICA 1XGNA 3HHHA 1WH7A 5A2QK 5BQTA 2RGVA 4UUSB 1ZAOA 3CDHA 5DTDA 3HPHA 2DMPA 5J47A 3HTUA 2EV5A 4XKBA 1ZQ3P 2DODA 2F4IA 3ABLH 2NAZA 1SVLA 2VBWA 3SZGA 3VOEA 4FQGA 2CSOA 4MTEA 5CVVA 1STZA 3SDGA 3DWLE 2PLYA 2Z5UA 2NOGA 3H9GA 3IHUA 3V4GA 1FYKA 4XONA 2WADA 1JUMA 1Y0NA 4EV0A 2ECCA 3ABUA 3BR3A 3I55I 2Y0SN 2BXYA 1T98A 2EBIA 5EF6A 1P92A 2E1MB 3L00A 2X6XA 1TQMA 2K02A 5IYDJ 1JT0A 1P2FA 1WJEA 3EYIA 5DD8A 3P9IA 1LDJA 1OMIA 2LREA 2HOSA 4BKXA 4OIPF 1MMDA 3BTLA 2L9NA 1FP1D 5LHHA 2CQ7A 2EB7A 4HLXA 2CV0A 3CDLA 3T0YA 1FOKA 5E3NA 1X19A 3M07A 2KPMA 3HOSA 2O8KA 1JJ6C 2BY0A 1S29A 2XRNA 1X2NA 1J2XA 3CF2A 1BC7C 3HRUA 5J1UA 5HDNA 4D5FA 4MEYF 1FEXA 2DA3A 4IQ4A 2ZBKA 1K61A 1ODDA 3K4LA 3GFLA 3RKXA 1FTZA 1JGSA 1XCBA 2O9LA 3HYIA 3EPZA 3OYKA 4LOCA 2JA2A 1MH3A 2JJ7A 1N25A 4QLCU 3PUFA 1U8BA 4LK0F 1B1BA 1B72A 2YUSA 5M3FJ 2PMUA 2WWYA 3I4PA 4CZCA 4ENMA 3HBLA 1BIAA 3H35A 2CMPA 1ZR2A 4ZZLA 2F6CA 4BJTA 3BTCA 3TP3A 1LB2A 1D8JA 3J7ZI 3JR9A 2RV8A 1YRNB 4FASD 2B7EA 1D0XA 1OLTA 3DKXA 3KFWX 5FLVA 2W48A 4XSZF 5F04A 4EEFG 2XIGA 1W1WE 3HTSB 1MSFC 3PJRA 3V7CA 3LMMA 4I09A 3SEQA 2H27A 1D5VA 4BUPA 5KCMA 3CMYA 4YRVA 3FISA 4KUMA 2XRLA 3DPLC 1QHHD 3FWEA 4HV6A 4Q48A 3FMRA 3H36A 4I0BA 2DQRA 2NRAC 2WTEA 4G6DA 2ADUA 3CUQA 5FLMJ 3WU1B 4RB2C 1VQ6I 1IRFA 2HQRA 2DMTA 1GXPA 1T33A 2V26A 1IAWA 1BI2A 3V8JA 1A31A 2O5RA 2P6TA 1R23A 4HLYA 1UHMA 2VJ4A 1N78A 4O6JA 1RR8C 3H3UA 3CD6I 4UB6C 5ILVA 1X1CA 4KIFA 2DMQA 2HDCA 2H8RA 4CGZA 4HDVA 3E97A 3I4MJ 1W7PB 4DYRA 1W0UA 3BJAA 3I71A 3A2KA 1IDZA 1RKWA 4B43A 3D1NI 1TQIA 5EEGA 3EUAA 2X51A 4XKVA 4X1EA 2PI0A 2EJRA 2ZNZA 3NRVA 4ZJZA 1KZHA 1LKXA 3R0JA 2FXAA 4DIQA 5JHFA 2L3DA 2KRFA 3ASNH 1ZRDA 2M4KA 3J81Z 4LLGF 3ECOA 4AYBA 1ZTRA 1XC5A 3DLAA 1J75A 1R5GA 1B9NA 1KA8A 4CCKA 2VE9A 2KRCA 4GCVA 3RPUA 3WE2A 4WX9A 2J5OA 2K40A 2PBIA 4BQAA 3IV5A 3HRSA 1G4DA 3OYMA 5LHIA 2DPDA 2HYJA 4DQ2A 3S1RJ 1FBQA 3BQZA 3LSJA 5CPRB 3GTQJ 1GLNA 2FA5A 2P6SA 3DQVC 4HSRA 1U5TA 5IP9J 2GLOA 1J7KA 1G3SA 3OS1A 3S2DJ 2DYRH 4S04A 5DCMA 1DGWY 4M3GA 1ITYA 2KP6A 1XS9A 1V3FA 4A3EJ 5LGNA 4B3XA 1FY7A 2V9PA 2Q2EB 2VBZA 3CO6C 4ENKA 1S72I 2COMA 2G7HA 3DU5A 3JRGA 4RDUA 4FTHA 1VQ9I 1IXSB 1F4KA 2DJNA 1OYIA 2VI6A 3BR6A 5C44J 2V4JC 1MMGA 5D5VB 2M9HA 1RNLA 1H89C 1QZEA 2DFHA 5B5EC 2QQ9A 1MNEA 3HOTA 2QSFX 2P7VB 1NG7A 3HSFA 4ZYHA 5FB2A 4YELA 3WTSC 5DCMB 1T56A 2E7XA 1PP7U 4XIDA 4A6DA 5EZHA 3PIOF 2OQRA 1FP2A 2JPBA 2QKMB 4I01A 2X6OA 1N75A 4IOAF 2GOMA 2EK5A 5HS7A 3OYHA 1ZHFA 3Q9SA 3VB2A 3DEEA 2BBYA 1T2KA 2V1XA 3K1PA 4YG2F 4IQJA 4P96A 2ZO4A 2QKLB 2YU3A 2O7OA 4XLAA 4E7ZA 3IC7A 1FNNA 1LJ9A 5AIQA 3HOXJ 2VUMJ 2ZNYA 4ZDOA 1SEUA 4A3LJ 3OYIA 1T8IA 3WGIA 2EIJH 4HG2A 1O7LA 3UKGA 3NEUA 1F1ZA 4BL0B 3CC7I 2BZTA 2CYYA 1A35A 1LVAA 1Y0UA 5LEJA 4A3KJ 4G9YA 3RI4A 1GVDA 1WZ2A 1YW7A 5CQEA 4C2TA 4IL6C 3WHCA 2KISA 2HZTA 2EZHA 4BJ6C 2DMUA 3VPRA 3JRHA 1YE9A 3ABTA 1P7JA 2HU9A 1OCZH 3SZTA 3BLYA 1YI2I 2STWA 2UUZA 1OFCX 1RPWA 2VC0A 4HSTA 2Q0OA 2ZMEA 3BOQA 1NH3A 2L0KA 5F27A 4C9YA 3WG7H 3CJNA 2DPUA 5E1WA 1QHGA 1SFEA 3L2WA 1LFUP 4BBRJ 1F36A 4EM2A 1WJ5A 3C2BA 1D1BA 1ZK8A 2VXDA 5EZGA 3KP5A 4JX5A 1QPMA 1WJAA 2DMNA 5E3MA 1VQKI 3HOZJ 1IO2A 1W5TA 5AIPA 1I27A 3ZMSA 2FMYA 3MZYA 2AHQA 3VSLA 4BBSJ 3R61A 3NAUA 3HOYJ 1O3TA 1ZR4A 3FF5A 4Y15A 3SEZA 1X4PA 2FQ3A 3CP2A 2DA1A 3BR5A 3BROA 5CKTA 4A3MJ 3A0BC 4HX4A 3FXKA 3S8PA 3WE3A 3ZQCA 3ZXSA 4RGSA 1OR7C 2R7FA 3FK6A 5K5RA 3FMQA 2HR3A 2MFZA 1E3OC 3HM5A 2STTA 2F5CA 3LL7A 5J4VA 2AS5F 2E1CA 3S16J 4IHTA 1FC3A 2PG4A 4Y3OA 1LE8B 1Z9CA 1FZPB 2AXLA 5B66C 4JK1X 2K9QA 2Z9OA 2DFFA 4DJAA 4E7SA 2W24A 3HOUJ 5LGTA 4HNVA 3LNQA 1MJAA 2HI3A 2QQBA 1IXRC 2VBYA 1R22A 4XLCA 3WTVC 4KJZA 4UUVA 3MWMA 2JA8J 3E6DA 4F91B 4U7BA 3VYUB 4CYDA 4EGZA 1XB4A 3L9FA 5FFZA 3GTGJ 3JAMK 3C3WA 3RIRA 1W5CC 4D7NA 4E70A 2O6GE 1IV6A 1BR1A 2K7LA 3I56I 4RBOA 2X0LA 2XKOA 1WI9A 4CHUA 2L7ZA 5D6FA 4UV9A 3ISPA 3QYEA 3PFYA 1Q1HA 5IP6A 2D5VA 5E20A 3DBLB 2VN2A 5ILSA 1UZCA 3IRRA 3MVPA 4ZYAA 4PZJA 1W36D 3BTJA 3EETA 3F9KA 3PFIA 1BR2A 1Z7UA 5CVIA 2NS8A 3SQNA 1HKTA 2M5WA 2V9KA 3HUGB 1BIBA 1RZ4A 5DS9A 1KQ8A 3GZNB 2VKEA 1LFPA 4M9SA 2X4HA 1IN5A 2W00A 3KYCB 1T39A 2RVCA 1RUNA 3OL3A 2CQXA 2P5VA 3IWZA 4UB8C 2E2JJ 1NG6A 4OINF 1S9HA 1OCTC 3FBNB 4MFDA 1IV8A 4E7HA 3M4OJ 4B8XA 1DU6A 1G3WA 2IAIA 1U5TB 3BR1A 4V19K 4CCJA 1BOBA 2F48A 2R5YA 2XF5A 3AG4H 4E6KG 2ZXIA 4XSXF 2HXOA 2V1NA 5D5WB 1P7IA 2OQGA 3E5QA 4C3JJ 2MC4A 2C6YA 4B47A 2WY7Q 4LK1F 3OR2C 1R9TJ 2QVOA 3M9AA 1UJ8A 5JVGF 3GTOJ 4NDLA 2EFNA 3WU0A 2TCTA 2DAOA 3PUBA 1IC8A 1UHSA 1Y1VJ 1W0TA 1WJBA 3MAJA 3TP0A 3KP3A 4CDGA 4ENJA 2M30A 1VQMI 4DYQA 2P7CB 3O2PE 3JSOA 1DPUA 1D1CA 2XGEA 3I4NJ 2R7XA 3BZCA 2CV2A 4HPQA 2IEKA 5L3BA 1U3EM 4DOZA 4GYIA 3S3OA 3G2BA 3HSEA 2JK3A 3DFGA 1NHAA 2X1CA 4LB6B 5E3LA 1AU7A 3BC8A 2Y31A 4A3CJ 3AL0B 1SFKA 3FXUA 4L9VA 1HSTA 2E2IJ 2G0EA 1LPQA 3SJMA 2WAQN 4BEHA 1JTYA 4JP0A 4L9NA 4F93B 1AA7A 5DDGA 2VBXA 2EPFA 2HTSA 3GFIA 4LG3A 4A0YA 2BW3B 3KYDB 2ELJA 3DTEA 3K4CA 1ZREA 4WF2A 2F5FA 5ILUA 5B3SH 2GQQA 3J80Z 1KYWA 3KLNA 2IT0A 1V5EA 2ZMEC 2XSDC 1MBJA 3E3VA 2KFDA 2P81A 1R71A 2RREA 5E8GA 3OS2A 3EUKL 3RCOA 1XMXA 2O03A 4Y4RA 1RUOA 4DZPA 3U21A 3HHGA 2E19A 1JGGA 4GGGA 3UNGC 1P9QC 1IRGA 2R93J 1U78A 1YITI 2O0YA 4LFUA 3VYSB 1E0EA 4IVNA 3QPTA 1P4AA 4MNUA 4Y13A 4ENNA 4E4HA 5ICGA 2Y2ZA 3OYGA 3TW7A 1XGMA 4IPAA 4Q5SF 3QAHA 3KP7A 2XPUA 1HF0A 1O3QA 4RGRA 3J7AY 1JHHA 1ZG3A 2PJPA 5LFAA 4Z6YA 3DTKA 1BM9A 2CFXA 4BXFA 4RA2A 3DBHB 3I3LA 4MTDA 2LP0A 1K79A 2UXXA 4AC0A 2XVCA 1G3TA 3J80K 2WC2A 5EYRA 3U9GA 4EJOA 1MNDA 2K85A 2LBFB 3CF5F 2BOLA 5FKLA 2XPVA 5GAHJ 2VLAA 2VPLA 3TOAA 4BE0A 3AAFA 1W4MA 2OBPA 1Z6TA 2Q1ZB 3FK7A 2K3FA 3OL4A 4JYKA 3TKYA 1APLC 2LF7A 1UCRA 1WQ2A 3MQ0A 3GO5A 4JX6A 2IGKA 1VQNI 4RB0A 1TP4A 2PQ8A 4NC8A 4RLFA 3CZ6A 3D0SA 3BR2A 2W7NA 1KU3A 2DT6A 3MZHA 2J5PA 2CW7A 3LA3A 4BNCA 4XRSA 4A3JJ 5JLWA 2M4GA 3G1OA 3OYBA 1AHDP 3V42A 2Z16A 3J7YJ 4K2EA 2TDXA 5IT9Z 3QWLA 1VQLI 1IN4A 1OCPA 2VT2A 1T0FA 2R7VA 2XAHA 5K1YA 4XLEA 2DOFA 4I7HA 3MCZA 4II3A 1P6RA 2GXGA 1J9IA 3I5UA 1EH6A 4BXXJ 1VQPI 2A3SA 1ETQA 1FMVA 3ULQB 4HQMA 2K3PA 3GEZA 2BY1A 3OOPA 4NUBA 4FX0A 4AU7A 2L4AA 4IJAA 1FJLA 3SDBA 1K4TA 3HEFA 4S0HB 4I98B 5IYBJ 3TQNA 4WWCA 1BI1A 3C2GA 2GM4A 2H1KA 1X3UA 4IHYA 5ED4A 3C2HA 3SHFA 3E6BA 4XQFA 1ERDA 4UUSA 4G6TB 3QU3A 1OCOH 4A3IJ 2IGNA 2KQRA 3B73A 1K4SA 4RGUA 1S7EA 1IJWC 3TMOA 1RI7A 1R7JA 1QO0D 3RKWA 2ZXJA 2QGUA 5AONA 4EJWA 1SMTA 3OV8A 3K4JA 2CUJA 2YR2A 2DFEA 3BZ6A 2KMUA 1RKTA 3K69A 4EJTA 3S2HJ 5FKNA 3KE2A 4XRMA 1ZYRF 2K4BA 1LVKA 2PMZA 4J01A 1MDMB 1Y6IA 4OU0A 1XDSA 4NB5A 2IGMA 2KJBA 3BDDA 3LWFA 5LHGA 3P7NA 3LA7A 3R60A 2JA6J 3JRDA 2K9NA 4L9TA 1IF1A 3FKJA 2FEZA 1KGSA 2DOEA 3ECHA 1L3LA 2EZKA 2L2OA 3GTLJ 3KEQA 2Y9ZA 3K4KA 2E5ZA 5DUIA 1MSEC 1IRXA 2ZKZA 2P4WA 3QU6A 4FISA 3K6GA 1PDNC 1U2WA 3ZR8X 1TW3A 1JKQC 1UAAA 2VB6A 4F52A 1H88C 4ZYGA 1YG2A 5FD6A 3GFMA 1TNTA 4KFCA 3A0HC 2L9SA 1TL8A 1LQ1A 3LOCA 4UVBA 3W2WA 3ABMH 1ETWA 1HKSA 5JHUA 3Q5FA 4BGDA 4R1HA 4YFXF 4B09A 3OYEA 2KZVA 5DCFA 1UG0A 1V55H 4IEJA 3CCJI 1E3PA 4MO7A 1JT6A 5E1ZB 3I0TA 3O8HA 1O57A 4AVPA 4KMFA 3TOBA 4XMYA 4MIMA 4B3AA 4L9JA 2WAEA 5FJ8J 5L3EA 4HRIA 3GLXA 2HOAA 2MG4A 3BG5A 5IPAA 3FMSA 1MNMC 2AQFA 1F9NA 3CO7C 5EEHA 1I1SA 3A01B 5B1BH 3CJTB 1Q1VA 5LLQA 4BS9A 2IRFG 1WHUA 2F5EA 4MFEA 3V8KA 2JWTA 1SFXA 2XAUA 2CWEA 1U8RA 4HOBA 2EA2A 2ID6A 2DU9A 1DGRM 1Y39A 3HKZN 3GF2A 2HXIA 4HNUA 1OJLA 1YTYA 4C30A 3H5NA 3PNVA 1TTYA 3E7LA 3MMYB 1IXCA 3NWTA 5HS9A 2V1DA 2QSGX 4BY1J 4MQ9F 5FO5A 5E17F 2ZXWH 2XAQA 2IW5A 2DW4A 2EV0A 4N9IA 4F3QA 3EDPA 2X6WA 3BPXA 2CV1A 2N8GA 4D1QA 1FLIA 2KIMA 1KU7A 2P5LC 1BI0A 4OMZA 2A61A 4RB1A 4PJNA 2CFOA 2D1HA 2QENA 1MBGA 4M6VA 5DD4A 1QA6A 1MGTA 2EWNA 2WV0A 4XRSG 2EH3A 4CH7A 3T8TA 4HNTA 3JTHA 5ICCA 2HS5A 1TT5B 4B44A 3F8MA 2BV6A 2V7FA 1PUFB 1EF4A 3CUOA 5LD2C 2R7WA 2QF7A 2LBFA 1IRZA 2ME0A 4AWXB 3VODA 1HQCA 2DYSH 3CMEI 4J00A 4HYEA 5IOZA 1V4RA 1N77A 3HDDA 2HQ5A 3V7RA 2LTPA 5JVTA 4AM3A 3GZ6A 3S32A 2NVUB 1MBHA 2Y75A 2KJCA 3QPSA 4LLLA 2IS4A 2KZGA 2DXIA 1B4AA 2XASA 2E34A 2UWMA 2E71A 2VQCA 1RR7A 4ZC3A 5CVJA 3FXJA 5EDNA 2A07F 3VFZA 4FE7A 3CLQA 4J19A 2XROA 1R1UA 2XB5A 4PSXA 5K7FA 5CYVA 3KEYA 2DQLA 2OD5A 1D0ZA 2OCCH 3CCQI 4MHGA 1VQ5I 2XHKA 1WRJA 2ZSHB 2JPCA 4I02A 5J4YA 4KITB 5HOOA 3KYLA 2ESHA 2IA0A 1SD6A 4O3MA 1PVEA 2JRMA 2XV4S 1UHWA 2FOKA 3N97A 5HDGA 2VOOA 1J0RA 3CCLI 1WSUA 1K78A 5B1AH 1SC7A 2WY8Q 1SVOA 5EG0A 2Z3YA 3F8NA 3BTIA 4WCGA 1Z1DA 5D8KB 2GBYA 1K7AA 2R7OA 1XMKA 2EV6A 1AOYA 2CG4A 2JT1A 4HV5A 4LJZF 4FT8A 3ZMZA 5F1RA 1PUFA 3G73A 3VYRB 2L54A 3K9TA 4P5OA 4ANJA 1XSDA 1TW2A 3GTKJ 3ERMA 1FOXA 2V79A 3T1BA 2LKSA 5FKMA 3RYPA 5HLTA 2XGDA 1HOMA 1EJ9A 1E17A 2XSJC 3R4KA 3DKYA 1DP7P 4A3BJ 5FLXZ 1ORKA 5JR3A 2MGQA 3DLLF 2H6BA 2LYCA 5CVRA 4GDFA 2VL8A 2FE3A 5E8IA 1J09A 2FQ4A 1X1AA 1YX3A 3W2AA 2A6HF 1VNDA 5CJ9A 5DYMA 2ZFWA 4A3GJ 1R4MB 4EJVA 2ELHA 2KT0A 1EV7A 3H9JA 2FD5A 4W1UA 1I6HJ 2RN7A 4XICA 2G7UA 1OYYA 5HLGA 3G4SI 2ZMEB 4NQWA 3L2RA 1XGOA 5JFRA 3SXYA 3F8BA 2XUBA 1IG7A 4LLNA 4A5NA 3K2ZA 5GPAA 4DYCA 4QPQA 1U9NA 3FM3A 3RJPA 3PO3J 4NNJA 1I50J 5BPDA 3KP6A 3A01A 3CCVI 1GV2A 3DEUA 1H9TA 2MD5A 5FKOA 2M8GX 4FCYA 3K2AA 2ZSIB 2M45A 4O5VA 2R5ZB 3EUHA 1YW8A 3QQAA 3S1QJ 1BR4A 2CW0F 5L3FA 3QPLA 1A6IA 2L7MP 3HUGA 1MMNA 2R7DA 2I5UA 2BGCA 1FSEA 1USTA 2BY2A 2OAZA 4OIOF 4KN7X 4LG0A 3BR0A 1FOWA 2JQ7A 2HVSA 3LSPA 4N4NB 4BXUA 2WA0A 3JRIA 1XMAA 3QRFF 3RPQA 3KETA 3JCUC 4D7MA 2MSYA 5M5XJ 4ZTJA 2QBYB 3O3KA 3HC7A 3DEWA 5FD5A 4EGYA 4IHWA 2JSPA 2M8EA 3QOEA 1Z91A 5CVUA 1DU0A 4OMYA 1YQAA 3WU2C 3JTGA 1AKHA 5K7HA 2L5QA 5IOYA 2KHMA 3J81K 2FJ1A 4CYCA 4AIHA 2HEOA 3E5UA 1LNWA 3HGGA 4L5EA 5K5OA 3AG3H 2GAUA 5KAFC 3GUDA 3MEXA 4Y33A 4OWRB 5KK1A 3ROUA 3L1PA 1ZRCA 4EQQA 2CUZA 3S2WA 1QZYA 2K27A 2YPRA 2LKPA 3LSTA 4L5IA 2NVYJ 1QQIA 4Y7NJ 3N4MA 3W6VA 1QPIA 3ZCOA 3QODA 1JJ8C 3L09A 4L0ZB 3I59B 1YIOA 3VSKA 1L0OC 4JX4A 5FRNA 2BYVE 2XGCA 3FKIJ 1FIPA 1DP3A 2ZFUA 1USSA 3CCMI 3JREA 4GRIA 1XN7A 3FDYA 2BW3A 3DF8A 2HZDA 2UXNA 1U0JA 2V1UA 4UY8I 4CXFA 2HVRA 1MD0A 1HW1A 2DDAA 5GAGJ 5LRRA 2HVQA 1QVTA 1IUFA 2KRHA 3E1SA 3GMEA 4N4OB 2PJRB 4LB5A 4XBFA 4RS8A 4BAYA 2ACJA 4A93J 4IX7A 2MA3A 2E1NA 2VASA 2VQLA 3LQQA 3ONQA 1R5HA 1HCRA 4BYYA 2AO9A 1WJDA 1Z3YA 1WCMJ 2R7SA 3WG9A 3H5RA 5EEAA 3FXRA 4CA0A 1EH8A 2EFOA 2QM3A 4A3DJ 2RQQA 1ZG1A 4I2OA 1SFOJ 4EMSA 3KP2A 2IP2A 4NHJA 4LD5A 2VJJA 2R92J 3WTZA 2EQRA 5M5YJ 2CQNA 2HDDA 3R0AA 4CSWA 2BHZA 2H1LA 3GXOA 4D5CA 3TDUC 2K86A 2LKXA 3SFZA 1I5ZA 4M73A 2GWRA 1I1GA 2DCEA 3W6JB 4PK4A 2FU4A 4HX8A 5D8LB 1H9GA 2BVLA 1XSVA 3KX2A 6PAXA 3TL4X 2EFQA 3PL8A 2GIZA 4LGWA 4B1RA 1ACIA 3V8LA 1FIAA 2JVHA 1A36A 1OR7A 1X58A 3S93A 4M3EA 1ZG5A 1J5YA 2MLGA 1S7AA 3FM5A 1XX5A 2RAEA 2ID3A 5FFXA 2NOJB 5F64A 1IDYA 3E6CC 3FBIB 4H4KC 5J3LA 1SAXA 1JHFA 2X1EA 2JA5J 1HC8A 1X3WB 5D5XB 3HG9A 2X48A 3BCBA 5F1JA 1FX7A 3EQLF 3H0GJ 2JZYA 1Z6RA 2E1OA 3NQOA 1FOYA 1JKRC 4JBAA 4ZDPA 1FYMA 2JSCA 5F08A 4ESJA 2QLZA 2IXSA 1YLFA 3F23A 1KYZA 3IRQA 3V7SA 4L0YB 4L18B 4ESBA 3I53A 4M6XA 1R6RA 3Q0VA 3LSMA 2XAFA 1MW7A 1ONVA 5IYCJ 2CRGA 3U1KA 1B8IA 2K5CA 5GADJ 5D6EA 5IT9K 2IS6A 1XPXA 2LC2A 4UXNA 1X3ZB 4TV7A 4PSWA 2EFWA 2V6EA 4BQOA 2RNGA 1JI8A 2P0WA 4UVCA 2CUFA 3ZQ7A 3N05A 3A1YA 3C18A 3FHNA 3A02A 3IKVA 2W4SA 1Z77A 1SMYF 4DZJA 1GDTA 3CLOA 4LIVA 4IRGA 4PFOA 1IN7A 2LFBA 3Q0WA 2HNHA 5EGOB 2YU9J 4A6EA 1LE8A 4IKFA 1TWHJ 4II2A 3B02A 4CYCB 3DP7A 4E7IA 4NC7A 1G6NA 3SYTA 1Z7LA 3K70D 4A5MA 1ZLJA 1FYLA 5HODA 4E7JA 3TO9A 1UB9A 2YS9A 3WTXC 4IZZA 3BG3A 4HA8A 2DA5A 3DPUA 2QBYA 3FXMA 1HDDC 1X1DA 1TQPA 4N0BA 4PUSA 1ZGWA 1E3HA 2OF7A 3OIOA 5F0FA 2ISYA 1R5ID 2ESNA 2XKPA 4ON0A 5GTHC 5E1XA 5GPCA 2O61A 3FX3A 5E3OA 3H92A 2I10A 2OV7A 2R5ZA 4UV8A 3PQKA 5JLXA 3G3ZA 2NNNA 2LD5A 2IS2A 1OYWA 4LIUA 2HPMA 2GXBA 4QWQA 4AVZA 1OQYA 4PJMA 1DQUA 2JN6A 5IY5H 3F0CA 2CO5A 1EKEA 5TISC 3WGHA 4YFNF 3GX4X 2OZ6A 1BC8C 3HRMA 3JRFA 5DV5A 3CJQB 2WV1A 1MBKA 2ZXHA 3M8EA 2E36A 2OU2A 3L2CA 3CESA 3L2VA 3RZOJ 4IXAA 3LSGA 2IS1A 2CS3A 2A5YB 4DBRA 3KPHA 4KNYA 3CCSI 4XRFA 1MJ9A 1PUEE 3H1CA 1WGXA 3K7AJ 4BHCA 4HQEA 3GVAA 4M3FA 3M1EA 3K0LA 3TDZC 1MZBA 1WI3A 3DU6A 3ZMDA 3QPHA 2LVSA 3T5XA 3UR3C 2DDBA 3C7JA 3BCAA 4G7HF 4F92B 2YX4A 3IL2A 2XF7A 1QVUA 2HQNA 4RM3A 1D3YA 2W85A 4U87A 2FBHA 3HZJA 1GXQA 4EJUA 1W7PD 1F43A 3GTJJ 1TWGJ 2QYOA 1JKOC 1KU2A 1LDDA 2LMDA 3BPVA 3K10A 1UMQA 1FBSA 3G1MA 1IUYA 1S7OA 2DTRA 5GAEJ 1R1TA 2M87A 2Y0SA 2XPWA 3RQIA 3OIPA 4F55A 1O4XA 3LAPA 1XD7A 3OY9A 4A12A 2CQKA 2JVGA 4PJLA 1KQ9A 3OYCA 4YIFA 2JUCA 3BQYA 3KZZA 4AIKA 5TRDA 2DTZA 5BMZA 2FOWA 3QYFA 2LRDA 4G6QA 2KLOA 5C3EJ 1BI3A 4W97A 4XKCA 1QZZA 2CJJA 1BBYA 3FXLA 4M3DA 3TGNA 2H8WA 3REOA 1YRNA 2ELKA 3CCYA 3OIQA 3QP6A 1O3RA 1ZRFA 3I58A 3SFIA 4ZTFA 4XKWA 4NBQA 1HW5A 2HYGD 1Z67A 3HIFA 2VT3A 5LRSA 1XSXA 1IZ1A 4WXCA 4P55A 1KU9A 2O8XA 2QEXI 2VJ5A 2TRTA 2BVMA 3WTUC 4I0AA 5IP7J 4GXOA 1FT9A 1OPCA 3CC4I 2Q2EA 3FZVA 3TEDA 2RDPA 3KCCA 2E35A 1I3QJ 1R00A 2OUMA 5F0HA 3WTTC 3IKTA 3OYLA 2L7FP 9ANTA 2MW8A 1TWAJ 4V2FA 5JI6A 2VOPA 3JRBA 2ZJ2A 4QTRA 1VFCA 2EA4A 5BPIA 4IRIA 2H09A 4Y52J 2OJED 1HW2A 1BW6A 2A68F 5DM7F 1JXSA 4U0WA 2M7AA 4RM2A 1ETKA 2XF6A 4H0EA 3OYJA 1WKMA 4AUXA 2A6TA 5J1YA 1T95A 3W6KB 1ZARA 4M71A 2XGXA 2M2EA 4C3IJ 5ICEA 3X2QH 5K5QA 2H94A 1Z3XA 5LEKA 4HBLA 1SD7A 1K6YA 3GZ5A 2ETHA 1BN5A 3H9QA 3NARA 2K9MA 4PCQA 3F8CA 2AQEA 2OA4A 2ME6A 4X0GA 1MH4A 1MIJA 1W5SA 1Y56A 3CCEI 4YEJA 3AL0C 2LY9A 4GO1A 4HDUA 2KIQA 1T0FC 4RAFA 4UUTA 2HKOA 3CCUI 3H0DA 1LUJB 1XGSA 1SVMA 2VKDA 1OISA 4CO8A 4PDKA 3MFKA 2HQAA 2W84A 2Y30A 3MKWB 1TWFJ 4WXHA 5L3GA 3ZQHA 1V54H 1CGPA 2HYFA 4KT6A 1P4XA 1K78B 2NNYA 5EJCA 1OKRA 4JQFA 3CTAA 1ETYA 3AG1H 4G7ZF 3WTYC 4Y17A 3G71I 3HL2A 1G3YA 2B63J 1XCVA 4XN0A 4KA4A 4FHTA 4ETSA 3GTMJ 3F3XA 2LOOA 3CMMA 1WFXA 5BOXA 5D4SA 2R7ZJ 3D5SC 2DK8A 2Y9YA 3TO6A 4P9UA 1RRJA 3ML6A 4UHTA 1HLVA 1D5YA 4S05A 1X1PA 1WWXA 1R1VA 3ABKH 5DM6F 2BEOA 2GIVA 1JUSA 2A6EF 1C0WA 3K1MA 4GFBA 3FIWA 5E18F 1WJFA 3AG2H 3MKZA 3ZQGA 2F4OB 2JMWA 2V6CA 2MC3A 4AYBN 4DNCA 4BDYA 3L7WA 1R49A 3PIPF 2DT5A 2LK2A 4U7DA 4ZDLA 4ZYDA 1FBUA 3F72A 3CC2I 3BJ6A 3I59A 4Q4ZF 1KONA 1ZN2A 1WJCA 1WPKA 2LY2A 4U88A 5LGUA 2W57A 2WB1N 3HB9A 2DN0A 4RAGA 3IP4B 2HTJA 3G1LA 3P9KA 3RDIA 3WGGA 2ZJRF 4BEHB 3E0JB 3BZKA 1H8AC 3P5JA 5ICFA 2PN6A 2L9VA 2VKVA 1VTNC 3DTIA 1S8NA 2EINH 2CW8A 3ZQLA 3HXLA 3TW6A 2EZIA 4OOIA 3GWZA 1Y1WJ 2LY1A 5FRMA 2ZCWA 2K4JA 2BE5F 2NVQJ 4BQQA 1MKMA 3HPGA 4AIDA 2XDVA 4C2UA 1JUPA 4MGRA 1CQTA 2ECBA 1J59A 3H3VK 4ZYEA 2OCEA 2EFPA 5H2FC 2GOXB 2QUFA 3LFKA 4BH9A 4YIRX 2EILH 2YSRA 1RC9A 4BU2A 2WAQA 2PFBA 1LFBA 3KZIC 2RC4A 4C2MJ 2A5WA 3Q0UA 5HLIA 2GA2A 1KQ0A 3A4CA 4E7KA 2FBIA 1CF7A 3RKQA 2NYXA 2Q8KA 4ABZA 4YFKF 2EIMH 1A6QA 1XG1A 1ZLKA 1FTTA 1WVRA 3KIOA 1MDMA 4CCLA 2K9SA 2R7RA 3I64A 2NXNB 2L02A 4WK8F 2EIKH 4HZFA 4UVAA 3LA2A 3IUOA 1B8IB 5ERIA 2IVMA 1A04A 2IGOA 2LNBA 2FRHA 5C4XJ 2L9RA 3DKWA 5KHDA 3ZQQA 2W82A 2BXZA 1G8XA 5H6RA 1DDNA 1FMWA 3DBRB 2DO7A 4U0VA 1ETXA 2OC6A 2VPRA 1G2HA 3QYBA 1JTXA 2A69F 1UELB 3MD2A 1YHQI 3IH2A 1M1EB 3A03A 2XAJA 1U6GA 3OS0A 1HSJA 1CF7B 2IPQX 2BY3A 4CUGA 1ON2A 3CP8A 2EZLA 3IWFA 4XM3A 4AD9A 3LQRA 1RETA 1BL0A 3ZN1A 2QZ8A 4M74A 4FETA 1E2XA 3VWBA 3S1NJ 2M3AA 2DA7A 2Z2SB 1VQ8I 3CUQB
chains in the Genus database with same CATH topology
3TO7A 1RIOH 1R58A 2IA2A 3F22A 1TLHB 3KP4A 4U0YA 2KIFA 4IF4A 4YIIA 3DPTA 2KKOA 4A0ZA 2O3FA 1F5TA 2Z99A 4XLPF 2QQAA 1ZGAA 4M9ZA 2ISZA 3BWGA 2UZKA 1IN8A 2GA1A 2RKHA 1O3SA 1LEBA 4G94A 4BHBA 1QGPA 2OZUA 3BJOA 5L3DA 5TJJA 4KIGA 4UNOA 2JTVA 3E6MA 1U5TC 1B59A 4Q47A 4HF2A 1YFHA 4MQVA 2D1VA 2MBFA 3COAC 3DV8A 5HVQC 2F2EA 5DUKA 2FF4A 4KDPA 1T6SA 4KMUX 2YX7A 4GYGA 2RQPA 2DLLA 1PP8F 2W25A 3RKYA 5IT3A 1QNTA 4LMYA 2R3SA 3M7GA 1ON1A 3Q9VA 4M72A 4ASNA 3U2RA 3KEOA 1R36A 3ZPLA 3JAMZ 2P5KA 4L5JA 4HAMA 1XDUA 1JE8A 4N9HA 2D2WA 4RB3C 4RAYA 2HFHA 3QP5A 4HW0A 1YS6A 3KZYA 2DFIA 4LG0B 2VC1A 2MLKA 2MH2A 2VONA 5FGMA 1QBJA 3CUQC 5FLXK 1GVJA 1S6LA 3D5LA 4M9XA 1H0MA 1K6OA 1FPQA 2KIUA 4CZZA 4P9FA 5HS8A 1DPRA 2QWWA 5HLHA 2L4MA 2FSWA 3F8FA 4KIBA 4RAZA 3KLOA 4PGGA 3FXQA 1T38A 5F6FA 2JRTA 4KT5C 3RTRA 1B6AA 4BHPA 2HOEA 4A0XA 3ZMVA 4A2UA 3R6SA 3EYYA 1ULYA 4MEXF 2MH9A 5A2QZ 1YW9A 4FX4A 1TNSA 2FNAA 2FBKA 4AIJA 4KICA 3FHZA 2F5DA 3HRTA 1D8KA 1ZH5A 1Z05A 2M1BA 4EM0B 3GFJA 4R79A 1YS7A 5LBQA 3I54A 2E7WA 2DK5A 1GHCA 2HKXA 4WXDA 2HGCA 4OIQF 3VEPA 2GZWA 4XLNF 1IW7F 1ZGJA 3WODF 2LDUA 2CGPA 5L3CA 4R8HA 3ERED 1HBXG 1S3JA 4M6YA 2VXZA 3JW4A 1P4WA 1FWZA 5KVRA 3SZPA 5H20A 1HXDA 3F21A 2B0LA 3ZP5A 5D4RA 4EVIA 2LSOA 4ESFA 1SD5A 1FSHA 3F6VA 2L01A 3ELKA 4ZH4F 4KN4X 1AWCA 2Y48A 3F6OA 4RGXA 4G7OF 3GW2A 1BJAA 2Z33A 3GYHX 4F7ZA 2LF8A 2HWVA 3RYRA 3C1DA 4ZZDA 3HSRA 3PQJA 3K1NA 4PGHA 4OIRF 5DEQA 2PEXA 1YO5C 1SFUA 1EH7A 3ZMUA 2DI3A 4HF0A 4D0PA 1I6XA 3DXJF 1BOAA 4HX7A 4KYWA 3H3ZA 4IHSA 1B9MA 1O7FA 3ZN0A 5J8CA 1HKQA 3O6BB 3U1DA 1REPC 3J7AO 3LAJA 5J6XA 2H6CA 5BS6A 3M8FA 5H6QA 3E5XA 2G9WA 2V9VA 2XAGA 3BP8A 3JSPA 1LDKB 1LEAA 1TBXA 5CLSA 2FNPA 2NS0A 3QOPA 2DBBA 2FMLA 2IJLA 2VODA 1MJBA 5J8FA 2VE8A 1IN6A 1YYVA 2IA1A 4G8XA 4HF1A 4Z2YA 2D45A 1DUXC 4EM1A 3P9CA 1UFMA 2RNJA 3WTWC 2Y0MA 3BY6A 1W7PA 4IRHA 5D5UB 3ZMTA 1SD4A 2PMHA 3T8RA 5HDKA 2P8TA 4CICA 1XGNA 3HHHA 5A2QK 5BQTA 2RGVA 1ZAOA 3CDHA 3HTUA 2EV5A 2NAZA 2VBWA 3VOEA 2CSOA 4MTEA 5CVVA 1STZA 2PLYA 2Z5UA 3IHUA 3V4GA 1FYKA 4EV0A 3ABUA 1T98A 1P92A 3L00A 1TQMA 2K02A 1P2FA 3EYIA 5DD8A 3P9IA 1LDJA 1OMIA 4OIPF 1FP1D 5LHHA 2EB7A 4HLXA 3T0YA 1FOKA 3HOSA 1S29A 2XRNA 1J2XA 1BC7C 3HRUA 5HDNA 4MEYF 2ZBKA 3RKXA 1ODDA 3GFLA 1JGSA 1XCBA 3HYIA 4QLCU 4LK0F 1B1BA 2PMUA 2WWYA 3I4PA 4ENMA 1BIAA 4ZZLA 1LB2A 1D8JA 2RV8A 3KFWX 4XSZF 2XIGA 3HTSB 3V7CA 4I09A 2H27A 1D5VA 4KUMA 3DPLC 3FWEA 4HV6A 4Q48A 3FMRA 4I0BA 2DQRA 2NRAC 2WTEA 4G6DA 2ADUA 3CUQA 3WU1B 4RB2C 1IRFA 2HQRA 1GXPA 1IAWA 1BI2A 3V8JA 2P6TA 1R23A 4HLYA 1UHMA 4O6JA 3H3UA 5ILVA 4KIFA 2HDCA 4CGZA 4HDVA 3E97A 1W7PB 3BJAA 3I71A 1TQIA 5EEGA 2PI0A 2EJRA 2ZNZA 3NRVA 3R0JA 2FXAA 2L3DA 2KRFA 1ZRDA 3J81Z 4LLGF 3ECOA 1J75A 1R5GA 1B9NA 1KA8A 2VE9A 4GCVA 3RPUA 3WE2A 4WX9A 2J5OA 2PBIA 4BQAA 3HRSA 1G4DA 5LHIA 2DPDA 4DQ2A 1FBQA 2FA5A 2P6SA 3DQVC 1U5TA 1J7KA 1G3SA 4S04A 5DCMA 1V3FA 5LGNA 1FY7A 2VBZA 3CO6C 4ENKA 2COMA 2G7HA 1IXSB 1F4KA 1OYIA 5D5VB 1RNLA 2QQ9A 3HOTA 2P7VB 4ZYHA 3HSFA 5FB2A 3WTSC 5DCMB 2E7XA 1PP7U 4A6DA 2OQRA 1FP2A 2JPBA 4I01A 2EK5A 5HS7A 1ZHFA 3Q9SA 3VB2A 1T2KA 2BBYA 2V1XA 3K1PA 4YG2F 4P96A 2ZO4A 2YU3A 3IC7A 1FNNA 1LJ9A 5AIQA 2ZNYA 3WGIA 1O7LA 3NEUA 1F1ZA 2CYYA 1LVAA 1Y0UA 5LEJA 4G9YA 3RI4A 1YW7A 2HZTA 3ABTA 3SZTA 2STWA 2VC0A 2Q0OA 2ZMEA 3BOQA 2DPUA 3CJNA 5E1WA 1SFEA 4EM2A 3KP5A 1QPMA 1W5TA 5AIPA 1I27A 3ZMSA 2FMYA 3MZYA 3R61A 1O3TA 3FF5A 4Y15A 2FQ3A 3BROA 4HX4A 3WE3A 4RGSA 2R7FA 5K5RA 3FMQA 2HR3A 2STTA 2F5CA 2AS5F 2E1CA 4IHTA 1FC3A 2PG4A 1Z9CA 1FZPB 2AXLA 4JK1X 2Z9OA 2W24A 5LGTA 1MJAA 2QQBA 1IXRC 2VBYA 1R22A 3WTVC 4UUVA 3MWMA 3E6DA 4U7BA 4CYDA 4EGZA 1XB4A 3L9FA 5FFZA 3JAMK 3C3WA 3RIRA 4E70A 2O6GE 2K7LA 2X0LA 2XKOA 1WI9A 4CHUA 5D6FA 4UV9A 3ISPA 1Q1HA 5E20A 2VN2A 5ILSA 3IRRA 4PZJA 1HKTA 3EETA 5CVIA 3PFIA 1Z7UA 3SQNA 2M5WA 1KQ8A 1BIBA 1RZ4A 4M9SA 2X4HA 1IN5A 1T39A 2RVCA 1RUNA 3IWZA 2P5VA 4OINF 4B8XA 1G3WA 1U5TB 4XSXF 5D5WB 2OQGA 3E5QA 2C6YA 4LK1F 2QVOA 3M9AA 2EFNA 3WU0A 2DAOA 3MAJA 3KP3A 4CDGA 4ENJA 2M30A 2P7CB 3O2PE 3JSOA 1DPUA 5L3BA 1U3EM 4GYIA 3HSEA 3DFGA 1NHAA 4LB6B 3FXUA 4L9VA 1HSTA 4L9NA 5DDGA 2VBXA 2HTSA 3GFIA 4A0YA 1ZREA 4WF2A 2F5FA 5ILUA 2GQQA 3J80Z 1KYWA 3KLNA 2IT0A 3E3VA 5E8GA 2O03A 1RUOA 3HHGA 4GGGA 1IRGA 1U78A 2O0YA 4LFUA 4IVNA 3QPTA 1P4AA 4MNUA 4Y13A 4ENNA 5ICGA 1XGMA 4IPAA 4Q5SF 3QAHA 3KP7A 1O3QA 4RGRA 1JHHA 1ZG3A 2PJPA 1BM9A 2CFXA 4MTDA 1K79A 2UXXA 2XVCA 1G3TA 3J80K 2WC2A 3U9GA 4EJOA 3TOAA 3AAFA 1W4MA 2OBPA 1Z6TA 3TKYA 2LF7A 1UCRA 1WQ2A 3MQ0A 3GO5A 4RB0A 2PQ8A 3D0SA 1KU3A 3MZHA 2J5PA 3LA3A 4BNCA 4K2EA 2TDXA 5IT9Z 1IN4A 2VT2A 1T0FA 2XAHA 5K1YA 4I7HA 3MCZA 1P6RA 2GXGA 1J9IA 3I5UA 1EH6A 2A3SA 3ULQB 4HQMA 3GEZA 3OOPA 4FX0A 2L4AA 4IJAA 4I98B 3TQNA 4WWCA 1BI1A 1X3UA 5ED4A 3SHFA 3E6BA 3QU3A 3B73A 4RGUA 1RI7A 1R7JA 1QO0D 3RKWA 2ZXJA 5AONA 4EJWA 1SMTA 3OV8A 2YR2A 3BZ6A 3K69A 4EJTA 3KE2A 1ZYRF 2K4BA 1MDMB 4OU0A 1XDSA 4NB5A 2KJBA 3BDDA 5LHGA 3LWFA 3P7NA 3LA7A 3R60A 1IF1A 4L9TA 2FEZA 1KGSA 3ECHA 1L3LA 3KEQA 5DUIA 2ZKZA 2P4WA 3QU6A 1PDNC 1U2WA 1TW3A 4ZYGA 1YG2A 5FD6A 3GFMA 1TNTA 4KFCA 1LQ1A 4UVBA 1HKSA 5JHUA 3Q5FA 4R1HA 4YFXF 4B09A 5DCFA 5E1ZB 3I0TA 1O57A 4AVPA 4KMFA 3TOBA 4L9JA 5L3EA 3GLXA 3FMSA 1F9NA 3CO7C 5EEHA 1I1SA 5LLQA 2IRFG 2F5EA 3V8KA 1SFXA 2CWEA 1U8RA 4HOBA 2EA2A 2DU9A 3GF2A 1YTYA 1TTYA 1IXCA 5HS9A 2V1DA 5E17F 4MQ9F 5FO5A 2XAQA 2IW5A 2DW4A 2EV0A 4N9IA 3EDPA 3BPXA 1FLIA 2KIMA 1KU7A 2P5LC 1BI0A 4OMZA 2A61A 4RB1A 2D1HA 2QENA 5DD4A 1MGTA 2EWNA 2WV0A 3T8TA 3JTHA 5ICCA 2HS5A 3F8MA 2BV6A 3CUOA 4AWXB 3VODA 1HQCA 4HYEA 1V4RA 3V7RA 5JVTA 3GZ6A 2Y75A 2KJCA 4LLLA 1B4AA 2XASA 2UWMA 5CVJA 2A07F 3VFZA 2XROA 1R1UA 5CYVA 2DQLA 2OD5A 4MHGA 2XHKA 1WRJA 2JPCA 4I02A 5HOOA 2ESHA 2IA0A 1SD6A 4O3MA 2XV4S 1UHWA 2FOKA 3N97A 5HDGA 2VOOA 1J0RA 1WSUA 1K78A 2Z3YA 3F8NA 4WCGA 1Z1DA 5D8KB 1K7AA 1XMKA 2EV6A 1AOYA 2CG4A 5F1RA 2JT1A 4HV5A 4FT8A 4LJZF 3ZMZA 3G73A 2L54A 3K9TA 4P5OA 1XSDA 1TW2A 2V79A 3T1BA 3RYPA 1E17A 3R4KA 1DP7P 5FLXZ 5JR3A 2H6BA 5CVRA 2FE3A 5E8IA 2A6HF 5DYMA 5CJ9A 2ZFWA 4EJVA 2ELHA 1EV7A 2RN7A 2G7UA 1OYYA 5HLGA 2ZMEB 4NQWA 1XGOA 5JFRA 3SXYA 3F8BA 2XUBA 4LLNA 4A5NA 3K2ZA 3FM3A 3RJPA 5BPDA 3KP6A 3DEUA 1H9TA 2MD5A 2M45A 4O5VA 3EUHA 1YW8A 2CW0F 5L3FA 3HUGA 2R7DA 2BGCA 1FSEA 1USTA 2OAZA 4OIOF 4KN7X 4LG0A 4BXUA 3QRFF 1XMAA 3RPQA 3KETA 2QBYB 3O3KA 5FD5A 4EGYA 2M8EA 1Z91A 5CVUA 4OMYA 1YQAA 3JTGA 3J81K 4AIHA 2HEOA 3E5UA 1LNWA 5K5OA 2GAUA 3GUDA 3MEXA 5KK1A 3ROUA 1ZRCA 4EQQA 3S2WA 1QZYA 2K27A 2YPRA 2LKPA 3LSTA 4L5IA 1QQIA 3N4MA 3L09A 4L0ZB 3I59B 1YIOA 1L0OC 2BYVE 1USSA 1XN7A 3DF8A 2UXNA 2V1UA 4CXFA 1MD0A 1HW1A 5LRRA 4LB5A 4XBFA 4RS8A 4BAYA 2ACJA 2MA3A 2E1NA 3LQQA 1R5HA 4BYYA 3WG9A 3FXRA 1EH8A 2EFOA 2QM3A 1ZG1A 4I2OA 4EMSA 3KP2A 2IP2A 4NHJA 4LD5A 3WTZA 3R0AA 3GXOA 3TDUC 2K86A 3SFZA 1I5ZA 4M73A 2GWRA 1I1GA 3W6JB 2FU4A 4HX8A 5D8LB 1H9GA 1XSVA 6PAXA 2EFQA 4LGWA 3V8LA 1OR7A 1ZG5A 1J5YA 2MLGA 1S7AA 3FM5A 5FFXA 5F64A 3E6CC 1SAXA 1JHFA 5D5XB 1FX7A 3EQLF 2JZYA 1Z6RA 3NQOA 4JBAA 1FYMA 2JSCA 4ESJA 2QLZA 1YLFA 3F23A 1KYZA 3IRQA 3V7SA 4L0YB 4L18B 4ESBA 3I53A 4M6XA 2XAFA 1ONVA 5D6EA 5IT9K 4UXNA 4TV7A 2EFWA 4UVCA 3ZQ7A 3C18A 3IKVA 1SMYF 3CLOA 4IRGA 1IN7A 4A6EA 3B02A 3DP7A 1G6NA 4A5MA 1ZLJA 1FYLA 3TO9A 1UB9A 3WTXC 4HA8A 2QBYA 1TQPA 4N0BA 2ISYA 2ESNA 4ON0A 2XKPA 5E1XA 2O61A 3FX3A 3H92A 4UV8A 3PQKA 3G3ZA 2NNNA 1OYWA 2GXBA 4QWQA 2CO5A 3WGHA 4YFNF 3GX4X 2OZ6A 1BC8C 3HRMA 5DV5A 3M8EA 2OU2A 3L2CA 4IXAA 2A5YB 4KNYA 4XRFA 1MJ9A 1PUEE 4BHCA 4HQEA 3GVAA 3M1EA 3K0LA 3TDZC 1MZBA 3ZMDA 3QPHA 3T5XA 3C7JA 4G7HF 2YX4A 3IL2A 2HQNA 1D3YA 2W85A 2FBHA 1GXQA 4EJUA 1W7PD 2QYOA 1KU2A 1LDDA 3BPVA 1FBSA 1IUYA 1S7OA 2DTRA 1R1TA 2M87A 3LAPA 1XD7A 4A12A 2CQKA 1KQ9A 5BMZA 4YIFA 3KZZA 4AIKA 5TRDA 4G6QA 1BI3A 1QZZA 1BBYA 3TGNA 3REOA 3QP6A 1O3RA 1ZRFA 3I58A 1HW5A 2HYGD 3HIFA 2VT3A 5LRSA 1XSXA 1IZ1A 4WXCA 4P55A 1KU9A 2O8XA 3WTUC 4I0AA 4GXOA 1FT9A 1OPCA 2Q2EA 3FZVA 2RDPA 3KCCA 1R00A 3WTTC 3IKTA 5JI6A 2VOPA 2ZJ2A 2EA4A 5BPIA 4IRIA 2H09A 1HW2A 2A68F 1JXSA 4U0WA 4H0EA 1WKMA 3W6KB 1ZARA 4M71A 2XGXA 5ICEA 5K5QA 2H94A 5LEKA 4HBLA 1SD7A 3GZ5A 2ETHA 1BN5A 4PCQA 3F8CA 2OA4A 1W5SA 4GO1A 4HDUA 2HKOA 1XGSA 4CO8A 4PDKA 3MFKA 2W84A 4WXHA 5L3GA 1CGPA 2HYFA 1P4XA 1K78B 2NNYA 1OKRA 4JQFA 3CTAA 4G7ZF 3WTYC 4Y17A 1G3YA 1XCVA 4KA4A 4FHTA 4ETSA 3F3XA 5BOXA 5D4SA 2DK8A 3TO6A 4P9UA 3ML6A 4UHTA 4S05A 1WWXA 1R1VA 2BEOA 2GIVA 2A6EF 1C0WA 3K1MA 5E18F 2V6CA 2MC3A 4DNCA 3L7WA 2DT5A 4U7DA 4ZYDA 1FBUA 3F72A 3BJ6A 3I59A 4Q4ZF 1ZN2A 4U88A 5LGUA 2W57A 2HTJA 3P9KA 3RDIA 3WGGA 5ICFA 2PN6A 1VTNC 1S8NA 4OOIA 3GWZA 2ZCWA 2K4JA 2BE5F 1MKMA 4MGRA 1J59A 4ZYEA 2EFPA 2QUFA 3LFKA 4BH9A 2YSRA 2PFBA 2RC4A 5HLIA 2GA2A 1KQ0A 1CF7A 2FBIA 2NYXA 2Q8KA 4YFKF 1ZLKA 1MDMA 3I64A 2L02A 4WK8F 4HZFA 4UVAA 3LA2A 5ERIA 2IVMA 1A04A 2LNBA 2FRHA 3DKWA 5H6RA 1DDNA 2DO7A 4U0VA 2A69F 2XAJA 1U6GA 1HSJA 1CF7B 2IPQX 1ON2A 3IWFA 4AD9A 3LQRA 3ZN1A 2QZ8A 4M74A 1E2XA 3CUQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TO7 A;  1RIO H;  1R58 A;  2IA2 A;  3F22 A;  1TLH B;  3KP4 A;  4U0Y A;  2KIF A;  4IF4 A;  4YII A;  3DPT A;  2KKO A;  4A0Z A;  2O3F A;  1F5T A;  2Z99 A;  4XLP F;  2QQA A;  1ZGA A;  4M9Z A;  2ISZ A;  3BWG A;  2UZK A;  1IN8 A;  2GA1 A;  2RKH A;  1O3S A;  1LEB A;  4G94 A;  4BHB A;  1QGP A;  2OZU A;  3BJO A;  5L3D A;  5TJJ A;  4KIG A;  4UNO A;  2JTV A;  3E6M A;  1U5T C;  1B59 A;  4Q47 A;  4HF2 A;  1YFH A;  4MQV A;  2D1V A;  2MBF A;  3COA C;  3DV8 A;  5HVQ C;  2F2E A;  5DUK A;  2FF4 A;  4KDP A;  1T6S A;  4KMU X;  2YX7 A;  4GYG A;  2RQP A;  2DLL A;  1PP8 F;  2W25 A;  3RKY A;  5IT3 A;  1QNT A;  4LMY A;  2R3S A;  3M7G A;  1ON1 A;  3Q9V A;  4M72 A;  4ASN A;  3U2R A;  3KEO A;  1R36 A;  3ZPL A;  3JAM Z;  2P5K A;  4L5J A;  4HAM A;  1XDU A;  1JE8 A;  4N9H A;  2D2W A;  4RB3 C;  4RAY A;  2HFH A;  3QP5 A;  4HW0 A;  1YS6 A;  3KZY A;  2DFI A;  4LG0 B;  2VC1 A;  2MLK A;  2MH2 A;  2VON A;  5FGM A;  1QBJ A;  3CUQ C;  5FLX K;  1GVJ A;  1S6L A;  3D5L A;  4M9X A;  1H0M A;  1K6O A;  1FPQ A;  2KIU A;  4CZZ A;  4P9F A;  5HS8 A;  1DPR A;  2QWW A;  5HLH A;  2L4M A;  2FSW A;  3F8F A;  4KIB A;  4RAZ A;  3KLO A;  4PGG A;  3FXQ A;  1T38 A;  5F6F A;  2JRT A;  4KT5 C;  3RTR A;  1B6A A;  4BHP A;  2HOE A;  4A0X A;  3ZMV A;  4A2U A;  3R6S A;  3EYY A;  1ULY A;  4MEX F;  2MH9 A;  5A2Q Z;  1YW9 A;  4FX4 A;  1TNS A;  2FNA A;  2FBK A;  4AIJ A;  4KIC A;  3FHZ A;  2F5D A;  3HRT A;  1D8K A;  1ZH5 A;  1Z05 A;  2M1B A;  4EM0 B;  3GFJ A;  4R79 A;  1YS7 A;  5LBQ A;  3I54 A;  2E7W A;  2DK5 A;  1GHC A;  2HKX A;  4WXD A;  2HGC A;  4OIQ F;  3VEP A;  2GZW A;  4XLN F;  1IW7 F;  1ZGJ A;  3WOD F;  2LDU A;  2CGP A;  5L3C A;  4R8H A;  3ERE D;  1HBX G;  1S3J A;  4M6Y A;  2VXZ A;  3JW4 A;  1P4W A;  1FWZ A;  5KVR A;  3SZP A;  5H20 A;  1HXD A;  3F21 A;  2B0L A;  3ZP5 A;  5D4R A;  4EVI A;  2LSO A;  4ESF A;  1SD5 A;  1FSH A;  3F6V A;  2L01 A;  3ELK A;  4ZH4 F;  4KN4 X;  1AWC A;  2Y48 A;  3F6O A;  4RGX A;  4G7O F;  3GW2 A;  1BJA A;  2Z33 A;  3GYH X;  4F7Z A;  2LF8 A;  2HWV A;  3RYR A;  3C1D A;  4ZZD A;  3HSR A;  3PQJ A;  3K1N A;  4PGH A;  4OIR F;  5DEQ A;  2PEX A;  1YO5 C;  1SFU A;  1EH7 A;  3ZMU A;  2DI3 A;  4HF0 A;  4D0P A;  1I6X A;  3DXJ F;  1BOA A;  4HX7 A;  4KYW A;  3H3Z A;  4IHS A;  1B9M A;  1O7F A;  3ZN0 A;  5J8C A;  1HKQ A;  3O6B B;  3U1D A;  1REP C;  3J7A O;  3LAJ A;  5J6X A;  2H6C A;  5BS6 A;  3M8F A;  5H6Q A;  3E5X A;  2G9W A;  2V9V A;  2XAG A;  3BP8 A;  3JSP A;  1LDK B;  1LEA A;  1TBX A;  5CLS A;  2FNP A;  2NS0 A;  3QOP A;  2DBB A;  2FML A;  2IJL A;  2VOD A;  1MJB A;  5J8F A;  2VE8 A;  1IN6 A;  1YYV A;  2IA1 A;  4G8X A;  4HF1 A;  4Z2Y A;  2D45 A;  1DUX C;  4EM1 A;  3P9C A;  1UFM A;  2RNJ A;  3WTW C;  2Y0M A;  3BY6 A;  1W7P A;  4IRH A;  5D5U B;  3ZMT A;  1SD4 A;  2PMH A;  3T8R A;  5HDK A;  2P8T A;  4CIC A;  1XGN A;  3HHH A;  5A2Q K;  5BQT A;  2RGV A;  1ZAO A;  3CDH A;  3HTU A;  2EV5 A;  2NAZ A;  2VBW A;  3VOE A;  2CSO A;  4MTE A;  5CVV A;  1STZ A;  2PLY A;  2Z5U A;  3IHU A;  3V4G A;  1FYK A;  4EV0 A;  3ABU A;  1T98 A;  1P92 A;  3L00 A;  1TQM A;  2K02 A;  1P2F A;  3EYI A;  5DD8 A;  3P9I A;  1LDJ A;  1OMI A;  4OIP F;  1FP1 D;  5LHH A;  2EB7 A;  4HLX A;  3T0Y A;  1FOK A;  3HOS A;  1S29 A;  2XRN A;  1J2X A;  1BC7 C;  3HRU A;  5HDN A;  4MEY F;  2ZBK A;  3RKX A;  1ODD A;  3GFL A;  1JGS A;  1XCB A;  3HYI A;  4QLC U;  4LK0 F;  1B1B A;  2PMU A;  2WWY A;  3I4P A;  4ENM A;  1BIA A;  4ZZL A;  1LB2 A;  1D8J A;  2RV8 A;  3KFW X;  4XSZ F;  2XIG A;  3HTS B;  3V7C A;  4I09 A;  2H27 A;  1D5V A;  4KUM A;  3DPL C;  3FWE A;  4HV6 A;  4Q48 A;  3FMR A;  4I0B A;  2DQR A;  2NRA C;  2WTE A;  4G6D A;  2ADU A;  3CUQ A;  3WU1 B;  4RB2 C;  1IRF A;  2HQR A;  1GXP A;  1IAW A;  1BI2 A;  3V8J A;  2P6T A;  1R23 A;  4HLY A;  1UHM A;  4O6J A;  3H3U A;  5ILV A;  4KIF A;  2HDC A;  4CGZ A;  4HDV A;  3E97 A;  1W7P B;  3BJA A;  3I71 A;  1TQI A;  5EEG A;  2PI0 A;  2EJR A;  2ZNZ A;  3NRV A;  3R0J A;  2FXA A;  2L3D A;  2KRF A;  1ZRD A;  3J81 Z;  4LLG F;  3ECO A;  1J75 A;  1R5G A;  1B9N A;  1KA8 A;  2VE9 A;  4GCV A;  3RPU A;  3WE2 A;  4WX9 A;  2J5O A;  2PBI A;  4BQA A;  3HRS A;  1G4D A;  5LHI A;  2DPD A;  4DQ2 A;  1FBQ A;  2FA5 A;  2P6S A;  3DQV C;  1U5T A;  1J7K A;  1G3S A;  4S04 A;  5DCM A;  1V3F A;  5LGN A;  1FY7 A;  2VBZ A;  3CO6 C;  4ENK A;  2COM A;  2G7H A;  1IXS B;  1F4K A;  1OYI A;  5D5V B;  1RNL A;  2QQ9 A;  3HOT A;  2P7V B;  4ZYH A;  3HSF A;  5FB2 A;  3WTS C;  5DCM B;  2E7X A;  1PP7 U;  4A6D A;  2OQR A;  1FP2 A;  2JPB A;  4I01 A;  2EK5 A;  5HS7 A;  1ZHF A;  3Q9S A;  3VB2 A;  1T2K A;  2BBY A;  2V1X A;  3K1P A;  4YG2 F;  4P96 A;  2ZO4 A;  2YU3 A;  3IC7 A;  1FNN A;  1LJ9 A;  5AIQ A;  2ZNY A;  3WGI A;  1O7L A;  3NEU A;  1F1Z A;  2CYY A;  1LVA A;  1Y0U A;  5LEJ A;  4G9Y A;  3RI4 A;  1YW7 A;  2HZT A;  3ABT A;  3SZT A;  2STW A;  2VC0 A;  2Q0O A;  2ZME A;  3BOQ A;  2DPU A;  3CJN A;  5E1W A;  1SFE A;  4EM2 A;  3KP5 A;  1QPM A;  1W5T A;  5AIP A;  1I27 A;  3ZMS A;  2FMY A;  3MZY A;  3R61 A;  1O3T A;  3FF5 A;  4Y15 A;  2FQ3 A;  3BRO A;  4HX4 A;  3WE3 A;  4RGS A;  2R7F A;  5K5R A;  3FMQ A;  2HR3 A;  2STT A;  2F5C A;  2AS5 F;  2E1C A;  4IHT A;  1FC3 A;  2PG4 A;  1Z9C A;  1FZP B;  2AXL A;  4JK1 X;  2Z9O A;  2W24 A;  5LGT A;  1MJA A;  2QQB A;  1IXR C;  2VBY A;  1R22 A;  3WTV C;  4UUV A;  3MWM A;  3E6D A;  4U7B A;  4CYD A;  4EGZ A;  1XB4 A;  3L9F A;  5FFZ A;  3JAM K;  3C3W A;  3RIR A;  4E70 A;  2O6G E;  2K7L A;  2X0L A;  2XKO A;  1WI9 A;  4CHU A;  5D6F A;  4UV9 A;  3ISP A;  1Q1H A;  5E20 A;  2VN2 A;  5ILS A;  3IRR A;  4PZJ A;  1HKT A;  3EET A;  5CVI A;  3PFI A;  1Z7U A;  3SQN A;  2M5W A;  1KQ8 A;  1BIB A;  1RZ4 A;  4M9S A;  2X4H A;  1IN5 A;  1T39 A;  2RVC A;  1RUN A;  3IWZ A;  2P5V A;  4OIN F;  4B8X A;  1G3W A;  1U5T B;  4XSX F;  5D5W B;  2OQG A;  3E5Q A;  2C6Y A;  4LK1 F;  2QVO A;  3M9A A;  2EFN A;  3WU0 A;  2DAO A;  3MAJ A;  3KP3 A;  4CDG A;  4ENJ A;  2M30 A;  2P7C B;  3O2P E;  3JSO A;  1DPU A;  5L3B A;  1U3E M;  4GYI A;  3HSE A;  3DFG A;  1NHA A;  4LB6 B;  3FXU A;  4L9V A;  1HST A;  4L9N A;  5DDG A;  2VBX A;  2HTS A;  3GFI A;  4A0Y A;  1ZRE A;  4WF2 A;  2F5F A;  5ILU A;  2GQQ A;  3J80 Z;  1KYW A;  3KLN A;  2IT0 A;  3E3V A;  5E8G A;  2O03 A;  1RUO A;  3HHG A;  4GGG A;  1IRG A;  1U78 A;  2O0Y A;  4LFU A;  4IVN A;  3QPT A;  1P4A A;  4MNU A;  4Y13 A;  4ENN A;  5ICG A;  1XGM A;  4IPA A;  4Q5S F;  3QAH A;  3KP7 A;  1O3Q A;  4RGR A;  1JHH A;  1ZG3 A;  2PJP A;  1BM9 A;  2CFX A;  4MTD A;  1K79 A;  2UXX A;  2XVC A;  1G3T A;  3J80 K;  2WC2 A;  3U9G A;  4EJO A;  3TOA A;  3AAF A;  1W4M A;  2OBP A;  1Z6T A;  3TKY A;  2LF7 A;  1UCR A;  1WQ2 A;  3MQ0 A;  3GO5 A;  4RB0 A;  2PQ8 A;  3D0S A;  1KU3 A;  3MZH A;  2J5P A;  3LA3 A;  4BNC A;  4K2E A;  2TDX A;  5IT9 Z;  1IN4 A;  2VT2 A;  1T0F A;  2XAH A;  5K1Y A;  4I7H A;  3MCZ A;  1P6R A;  2GXG A;  1J9I A;  3I5U A;  1EH6 A;  2A3S A;  3ULQ B;  4HQM A;  3GEZ A;  3OOP A;  4FX0 A;  2L4A A;  4IJA A;  4I98 B;  3TQN A;  4WWC A;  1BI1 A;  1X3U A;  5ED4 A;  3SHF A;  3E6B A;  3QU3 A;  3B73 A;  4RGU A;  1RI7 A;  1R7J A;  1QO0 D;  3RKW A;  2ZXJ A;  5AON A;  4EJW A;  1SMT A;  3OV8 A;  2YR2 A;  3BZ6 A;  3K69 A;  4EJT A;  3KE2 A;  1ZYR F;  2K4B A;  1MDM B;  4OU0 A;  1XDS A;  4NB5 A;  2KJB A;  3BDD A;  5LHG A;  3LWF A;  3P7N A;  3LA7 A;  3R60 A;  1IF1 A;  4L9T A;  2FEZ A;  1KGS A;  3ECH A;  1L3L A;  3KEQ A;  5DUI A;  2ZKZ A;  2P4W A;  3QU6 A;  1PDN C;  1U2W A;  1TW3 A;  4ZYG A;  1YG2 A;  5FD6 A;  3GFM A;  1TNT A;  4KFC A;  1LQ1 A;  4UVB A;  1HKS A;  5JHU A;  3Q5F A;  4R1H A;  4YFX F;  4B09 A;  5DCF A;  5E1Z B;  3I0T A;  1O57 A;  4AVP A;  4KMF A;  3TOB A;  4L9J A;  5L3E A;  3GLX A;  3FMS A;  1F9N A;  3CO7 C;  5EEH A;  1I1S A;  5LLQ A;  2IRF G;  2F5E A;  3V8K A;  1SFX A;  2CWE A;  1U8R A;  4HOB A;  2EA2 A;  2DU9 A;  3GF2 A;  1YTY A;  1TTY A;  1IXC A;  5HS9 A;  2V1D A;  5E17 F;  4MQ9 F;  5FO5 A;  2XAQ A;  2IW5 A;  2DW4 A;  2EV0 A;  4N9I A;  3EDP A;  3BPX A;  1FLI A;  2KIM A;  1KU7 A;  2P5L C;  1BI0 A;  4OMZ A;  2A61 A;  4RB1 A;  2D1H A;  2QEN A;  5DD4 A;  1MGT A;  2EWN A;  2WV0 A;  3T8T A;  3JTH A;  5ICC A;  2HS5 A;  3F8M A;  2BV6 A;  3CUO A;  4AWX B;  3VOD A;  1HQC A;  4HYE A;  1V4R A;  3V7R A;  5JVT A;  3GZ6 A;  2Y75 A;  2KJC A;  4LLL A;  1B4A A;  2XAS A;  2UWM A;  5CVJ A;  2A07 F;  3VFZ A;  2XRO A;  1R1U A;  5CYV A;  2DQL A;  2OD5 A;  4MHG A;  2XHK A;  1WRJ A;  2JPC A;  4I02 A;  5HOO A;  2ESH A;  2IA0 A;  1SD6 A;  4O3M A;  2XV4 S;  1UHW A;  2FOK A;  3N97 A;  5HDG A;  2VOO A;  1J0R A;  1WSU A;  1K78 A;  2Z3Y A;  3F8N A;  4WCG A;  1Z1D A;  5D8K B;  1K7A A;  1XMK A;  2EV6 A;  1AOY A;  2CG4 A;  5F1R A;  2JT1 A;  4HV5 A;  4FT8 A;  4LJZ F;  3ZMZ A;  3G73 A;  2L54 A;  3K9T A;  4P5O A;  1XSD A;  1TW2 A;  2V79 A;  3T1B A;  3RYP A;  1E17 A;  3R4K A;  1DP7 P;  5FLX Z;  5JR3 A;  2H6B A;  5CVR A;  2FE3 A;  5E8I A;  2A6H F;  5DYM A;  5CJ9 A;  2ZFW A;  4EJV A;  2ELH A;  1EV7 A;  2RN7 A;  2G7U A;  1OYY A;  5HLG A;  2ZME B;  4NQW A;  1XGO A;  5JFR A;  3SXY A;  3F8B A;  2XUB A;  4LLN A;  4A5N A;  3K2Z A;  3FM3 A;  3RJP A;  5BPD A;  3KP6 A;  3DEU A;  1H9T A;  2MD5 A;  2M45 A;  4O5V A;  3EUH A;  1YW8 A;  2CW0 F;  5L3F A;  3HUG A;  2R7D A;  2BGC A;  1FSE A;  1UST A;  2OAZ A;  4OIO F;  4KN7 X;  4LG0 A;  4BXU A;  3QRF F;  1XMA A;  3RPQ A;  3KET A;  2QBY B;  3O3K A;  5FD5 A;  4EGY A;  2M8E A;  1Z91 A;  5CVU A;  4OMY A;  1YQA A;  3JTG A;  3J81 K;  4AIH A;  2HEO A;  3E5U A;  1LNW A;  5K5O A;  2GAU A;  3GUD A;  3MEX A;  5KK1 A;  3ROU A;  1ZRC A;  4EQQ A;  3S2W A;  1QZY A;  2K27 A;  2YPR A;  2LKP A;  3LST A;  4L5I A;  1QQI A;  3N4M A;  3L09 A;  4L0Z B;  3I59 B;  1YIO A;  1L0O C;  2BYV E;  1USS A;  1XN7 A;  3DF8 A;  2UXN A;  2V1U A;  4CXF A;  1MD0 A;  1HW1 A;  5LRR A;  4LB5 A;  4XBF A;  4RS8 A;  4BAY A;  2ACJ A;  2MA3 A;  2E1N A;  3LQQ A;  1R5H A;  4BYY A;  3WG9 A;  3FXR A;  1EH8 A;  2EFO A;  2QM3 A;  1ZG1 A;  4I2O A;  4EMS A;  3KP2 A;  2IP2 A;  4NHJ A;  4LD5 A;  3WTZ A;  3R0A A;  3GXO A;  3TDU C;  2K86 A;  3SFZ A;  1I5Z A;  4M73 A;  2GWR A;  1I1G A;  3W6J B;  2FU4 A;  4HX8 A;  5D8L B;  1H9G A;  1XSV A;  6PAX A;  2EFQ A;  4LGW A;  3V8L A;  1OR7 A;  1ZG5 A;  1J5Y A;  2MLG A;  1S7A A;  3FM5 A;  5FFX A;  5F64 A;  3E6C C;  1SAX A;  1JHF A;  5D5X B;  1FX7 A;  3EQL F;  2JZY A;  1Z6R A;  3NQO A;  4JBA A;  1FYM A;  2JSC A;  4ESJ A;  2QLZ A;  1YLF A;  3F23 A;  1KYZ A;  3IRQ A;  3V7S A;  4L0Y B;  4L18 B;  4ESB A;  3I53 A;  4M6X A;  2XAF A;  1ONV A;  5D6E A;  5IT9 K;  4UXN A;  4TV7 A;  2EFW A;  4UVC A;  3ZQ7 A;  3C18 A;  3IKV A;  1SMY F;  3CLO A;  4IRG A;  1IN7 A;  4A6E A;  3B02 A;  3DP7 A;  1G6N A;  4A5M A;  1ZLJ A;  1FYL A;  3TO9 A;  1UB9 A;  3WTX C;  4HA8 A;  2QBY A;  1TQP A;  4N0B A;  2ISY A;  2ESN A;  4ON0 A;  2XKP A;  5E1X A;  2O61 A;  3FX3 A;  3H92 A;  4UV8 A;  3PQK A;  3G3Z A;  2NNN A;  1OYW A;  2GXB A;  4QWQ A;  2CO5 A;  3WGH A;  4YFN F;  3GX4 X;  2OZ6 A;  1BC8 C;  3HRM A;  5DV5 A;  3M8E A;  2OU2 A;  3L2C A;  4IXA A;  2A5Y B;  4KNY A;  4XRF A;  1MJ9 A;  1PUE E;  4BHC A;  4HQE A;  3GVA A;  3M1E A;  3K0L A;  3TDZ C;  1MZB A;  3ZMD A;  3QPH A;  3T5X A;  3C7J A;  4G7H F;  2YX4 A;  3IL2 A;  2HQN A;  1D3Y A;  2W85 A;  2FBH A;  1GXQ A;  4EJU A;  1W7P D;  2QYO A;  1KU2 A;  1LDD A;  3BPV A;  1FBS A;  1IUY A;  1S7O A;  2DTR A;  1R1T A;  2M87 A;  3LAP A;  1XD7 A;  4A12 A;  2CQK A;  1KQ9 A;  5BMZ A;  4YIF A;  3KZZ A;  4AIK A;  5TRD A;  4G6Q A;  1BI3 A;  1QZZ A;  1BBY A;  3TGN A;  3REO A;  3QP6 A;  1O3R A;  1ZRF A;  3I58 A;  1HW5 A;  2HYG D;  3HIF A;  2VT3 A;  5LRS A;  1XSX A;  1IZ1 A;  4WXC A;  4P55 A;  1KU9 A;  2O8X A;  3WTU C;  4I0A A;  4GXO A;  1FT9 A;  1OPC A;  2Q2E A;  3FZV A;  2RDP A;  3KCC A;  1R00 A;  3WTT C;  3IKT A;  5JI6 A;  2VOP A;  2ZJ2 A;  2EA4 A;  5BPI A;  4IRI A;  2H09 A;  1HW2 A;  2A68 F;  1JXS A;  4U0W A;  4H0E A;  1WKM A;  3W6K B;  1ZAR A;  4M71 A;  2XGX A;  5ICE A;  5K5Q A;  2H94 A;  5LEK A;  4HBL A;  1SD7 A;  3GZ5 A;  2ETH A;  1BN5 A;  4PCQ A;  3F8C A;  2OA4 A;  1W5S A;  4GO1 A;  4HDU A;  2HKO A;  1XGS A;  4CO8 A;  4PDK A;  3MFK A;  2W84 A;  4WXH A;  5L3G A;  1CGP A;  2HYF A;  1P4X A;  1K78 B;  2NNY A;  1OKR A;  4JQF A;  3CTA A;  4G7Z F;  3WTY C;  4Y17 A;  1G3Y A;  1XCV A;  4KA4 A;  4FHT A;  4ETS A;  3F3X A;  5BOX A;  5D4S A;  2DK8 A;  3TO6 A;  4P9U A;  3ML6 A;  4UHT A;  4S05 A;  1WWX A;  1R1V A;  2BEO A;  2GIV A;  2A6E F;  1C0W A;  3K1M A;  5E18 F;  2V6C A;  2MC3 A;  4DNC A;  3L7W A;  2DT5 A;  4U7D A;  4ZYD A;  1FBU A;  3F72 A;  3BJ6 A;  3I59 A;  4Q4Z F;  1ZN2 A;  4U88 A;  5LGU A;  2W57 A;  2HTJ A;  3P9K A;  3RDI A;  3WGG A;  5ICF A;  2PN6 A;  1VTN C;  1S8N A;  4OOI A;  3GWZ A;  2ZCW A;  2K4J A;  2BE5 F;  1MKM A;  4MGR A;  1J59 A;  4ZYE A;  2EFP A;  2QUF A;  3LFK A;  4BH9 A;  2YSR A;  2PFB A;  2RC4 A;  5HLI A;  2GA2 A;  1KQ0 A;  1CF7 A;  2FBI A;  2NYX A;  2Q8K A;  4YFK F;  1ZLK A;  1MDM A;  3I64 A;  2L02 A;  4WK8 F;  4HZF A;  4UVA A;  3LA2 A;  5ERI A;  2IVM A;  1A04 A;  2LNB A;  2FRH A;  3DKW A;  5H6R A;  1DDN A;  2DO7 A;  4U0V A;  2A69 F;  2XAJ A;  1U6G A;  1HSJ A;  1CF7 B;  2IPQ X;  1ON2 A;  3IWF A;  4AD9 A;  3LQR A;  3ZN1 A;  2QZ8 A;  4M74 A;  1E2X A;  3CUQ B; 
#chains in the Genus database with same CATH topology
 3CJR B;  2ICW G;  3LFU A;  3M8J A;  3TO7 A;  3OWT A;  1YJ9 I;  1RIO H;  3S1M J;  3GTP J;  1R58 A;  1TC3 C;  2IA2 A;  3F22 A;  1TLH B;  4A3F J;  4QSH A;  3ZOB A;  2WB1 A;  3KP4 A;  1XTA A;  4U0Y A;  2M0C A;  1Z0X A;  2KIF A;  4IF4 A;  2MD0 A;  4HEA 2;  2CUE A;  2DT7 B;  3L2U A;  2LG4 A;  4YII A;  5F0C A;  4XNF A;  2M7B A;  2R7U A;  3D5R C;  3DPT A;  2VQG A;  2KKO A;  1POG A;  1GUU A;  3ASO H;  4IO9 F;  4I76 A;  4A0Z A;  2O3F A;  3HOV J;  1F5T A;  2Z99 A;  4XLP F;  2QQA A;  1ZGA A;  2Z1D A;  4M9Z A;  2ZC2 A;  2ISZ A;  3W2V A;  2E5N A;  1X1B A;  3BWG A;  2UZK A;  2FUG 2;  3I9V 2;  1IN8 A;  2GA1 A;  1OCC H;  5J40 A;  2RKH A;  1O3S A;  1LEB A;  4G94 A;  3MN2 A;  4BHB A;  1QGP A;  1UG2 A;  2OZU A;  3BJO A;  1VQ7 I;  4XL9 A;  4DGW B;  3BG9 A;  5L3D A;  4KIG A;  5TJJ A;  4UNO A;  4DW6 A;  1BA5 A;  3GLL A;  2JTV A;  1B72 B;  3E6M A;  3OR1 C;  1U5T C;  2R0Q C;  1B59 A;  4Q47 A;  2IBD A;  4ITV A;  2DOA A;  3VDX A;  3RQ4 A;  4HF2 A;  2E60 A;  2ZJP F;  3MKL A;  3ZQF A;  2X9D A;  4XOR A;  1YFH A;  4MQV A;  2D1V A;  3IH3 A;  2MBF A;  3COA C;  3DV8 A;  4BJ5 C;  5HVQ C;  3CCR I;  4PJ0 C;  2BHY A;  2F2E A;  4EAT A;  5DUK A;  3CMA I;  2F5V A;  3S3N A;  2FF4 A;  2W1O A;  4KDP A;  1T6S A;  2L7K A;  4KMU X;  2YX7 A;  4GYG A;  2RQP A;  3LSI A;  2DLL A;  1PP8 F;  2W25 A;  3B6C A;  1PYV A;  3AFH A;  3PSI A;  3RKY A;  3GCM A;  5IT3 A;  2ZJQ F;  1QNT A;  1ENH A;  2R3S A;  4LMY A;  3M7G A;  1ON1 A;  3Q9V A;  5K7Z A;  4BY7 J;  4M72 A;  4ASN A;  2MYS A;  1HA8 A;  1RES A;  2B9S A;  3ZRG A;  3U2R A;  3OYF A;  3KEO A;  4OAY A;  1R36 A;  4BAC A;  4E7L A;  3CDI A;  3ZPL A;  3JAM Z;  2P5K A;  4L5J A;  4HAM A;  2NVT J;  1R4N B;  1XDU A;  1JE8 A;  4N9H A;  2D2W A;  4C3H J;  5J1R A;  4RB3 C;  1T08 B;  4RAY A;  2HFH A;  3QP5 A;  4HW0 A;  4IHV A;  1YS6 A;  3KZY A;  2DFI A;  1BJZ A;  4LG0 B;  2VC1 A;  2M34 A;  2MLK A;  2MH2 A;  2VON A;  5FGM A;  1QBJ A;  4KIS A;  3CUQ C;  2LH9 A;  1VI0 A;  2HOT A;  5FLX K;  1YJW I;  1SAU A;  1GVJ A;  1S6L A;  2R5Y B;  3D5L A;  1K83 J;  4M9X A;  1H0M A;  2LLK A;  2FX0 A;  1K6O A;  1PJR A;  2XB0 X;  1FPQ A;  2MAB A;  2KIU A;  4CZZ A;  4P9F A;  5HS8 A;  1DPR A;  2F4M B;  4B48 A;  2QWW A;  5HLH A;  4P1W A;  2X6Y A;  3B6A A;  1V5F A;  2M0M A;  2QA4 I;  2L4M A;  2FSW A;  3F8F A;  4KIB A;  4PJJ A;  4RAZ A;  3KLO A;  4PGG A;  3FXQ A;  2KDZ A;  1T38 A;  3K4B A;  5F6F A;  1YJN I;  1MBF A;  1TT0 A;  2JRT A;  4KT5 C;  3RTR A;  1B6A A;  3IAM 2;  4BHP A;  2HOE A;  4A0X A;  2CU7 A;  1YIJ I;  3ZMV A;  1D1A A;  4A2U A;  3R6S A;  2QQ8 A;  4RMN A;  3EYY A;  4I99 C;  2LR8 A;  1ULY A;  3HGY A;  4MEX F;  2MH9 A;  5A2Q Z;  4XR6 A;  1YW9 A;  4FX4 A;  2R7Q A;  3RPU D;  1TNS A;  2FNA A;  2FBK A;  4AIJ A;  5FKK A;  4KIC A;  1VQ4 I;  1MBE A;  3FHZ A;  2F5D A;  3HRT A;  4NC6 A;  1D8K A;  4PFP A;  1ZH5 A;  1Z05 A;  2M1B A;  4EM0 B;  3GFJ A;  2VIX A;  4R79 A;  1YS7 A;  3IAS 2;  4XLH A;  5LBQ A;  3LSH A;  2ZB9 A;  3I54 A;  1AKH B;  3TBI A;  5KNL A;  2E7W A;  1X2M A;  2QSH X;  4V2G A;  2DK5 A;  3JRC A;  3K70 C;  1GHC A;  2HKX A;  4WXD A;  2NVX J;  5M3M J;  1GV5 A;  1S5L C;  4XLF A;  2HGC A;  1OCR H;  2X1D A;  1I39 A;  4IOC F;  4OIQ F;  2CH0 A;  2WAF A;  3VEP A;  2GZW A;  4XLN F;  4CCM A;  4DBQ A;  1IW7 F;  3W3C A;  1NTC A;  1YOV B;  3PM1 A;  5TGT A;  2Y69 H;  1NK2 P;  1WH5 A;  1A5J A;  2DJI A;  4QPO A;  1ZGJ A;  3WOD F;  2LDU A;  3LSR A;  2GXA A;  2CGP A;  5L3C A;  2WBM A;  3K4N A;  4CCO A;  4R8H A;  2DA4 A;  3ERE D;  2PX9 A;  1S3J A;  1HBX G;  3M1C A;  4M6Y A;  2VXZ A;  3JW4 A;  1P4W A;  3HKZ A;  4FE4 A;  3PSF A;  2QCO A;  2X85 A;  1FWZ A;  3MZ8 A;  5KVR A;  3SZP A;  3AKZ A;  2A05 A;  1TZL A;  3S3M A;  1ZEL A;  3K4M A;  4NQW B;  5H20 A;  2XC7 A;  3OOU A;  1HXD A;  3F21 A;  2B0L A;  2NS7 A;  3ZP5 A;  4BQN A;  5D4R A;  3O8G A;  1ZKG A;  4XOP A;  1VF9 A;  4EVI A;  3GBG A;  4BDZ A;  1W36 C;  2LSO A;  4ESF A;  1SD5 A;  3OSF A;  1FSH A;  2R7T A;  1VZ0 A;  3F6V A;  4OAZ A;  2L01 A;  3ELK A;  4ZH4 F;  4KN4 X;  1AWC A;  2Y48 A;  1Y8Q B;  3F6O A;  1V5G A;  4RGX A;  2PMZ N;  4G7O F;  3S17 J;  3PO2 J;  5EG0 B;  3OMY A;  3S15 J;  3GW2 A;  1BJA A;  1BW5 A;  2VQH A;  4X6A J;  3JRA A;  2Z33 A;  3GYH X;  4F7Z A;  2LF8 A;  2HWV A;  3RYR A;  3C1D A;  4ZZD A;  5EGO A;  2CQQ A;  5GP9 A;  1D0Y A;  3BT9 A;  5KAI C;  5FRO A;  3HSR A;  2KL4 A;  4XK4 A;  5M5W J;  3PQJ A;  2JUG A;  3K1N A;  4PGH A;  4OIR F;  5DEQ A;  3VYT B;  2PEX A;  1YO5 C;  2HPI A;  4G12 A;  1SFU A;  3NWS A;  1ETO A;  2OPT A;  4XN3 A;  1EH7 A;  4QIW N;  3BG7 A;  3PNT A;  4JOM A;  1NK3 P;  3ZMU A;  5HNF A;  4MLO A;  4RLQ A;  2DI3 A;  3CQZ J;  4HF0 A;  4XOT A;  1QRY A;  4B4C A;  2VJI A;  3G6E I;  4D0P A;  1TWC J;  1I6X A;  3DXJ F;  1BOA A;  4HX7 A;  4KYW A;  3M3Y J;  3H3Z A;  5GTI C;  3L2Q A;  1ETV A;  1QU3 A;  1U9O A;  5E79 C;  4A69 C;  2E2H J;  4IHS A;  2K9L A;  1Z21 A;  3ZQI A;  4CCN A;  1B9M A;  1EA3 A;  4BE2 A;  4D9J A;  3OYN A;  1O7F A;  3ZN0 A;  5J8C A;  1HKQ A;  3O6B B;  3U1D A;  2R4G A;  4IHX A;  1REP C;  1HDP A;  3BG6 A;  2COB A;  3J7A O;  3LAJ A;  4M3B A;  5J6X A;  1I3A A;  3ZGK A;  2H6C A;  2VKH A;  5BS6 A;  1Y8R B;  3LSK A;  3OYA A;  1MMA A;  4BE1 A;  3HJE A;  2JA7 J;  1X4O A;  2I8D A;  3M8F A;  5H6Q A;  3E5X A;  1MMS A;  2G9W A;  3ESW B;  2V9V A;  3MKY B;  2XAG A;  5C4J J;  3BP8 A;  3OYD A;  3JSP A;  1LDK B;  1LEA A;  1TBX A;  5CLS A;  3FXO A;  2DA6 A;  5HNH A;  5BNG A;  2FNP A;  3WHB A;  2NS0 A;  3Q3S A;  2DA2 A;  2UV1 A;  3QOP A;  2DBB A;  2FML A;  2IJL A;  2VOD A;  1MJB A;  5J8F A;  3DCF A;  2VE8 A;  1IN6 A;  1JKP C;  1YYV A;  4I6Z A;  2OTL I;  2IA1 A;  3EUH C;  3IH4 A;  2AXT C;  2HDW A;  4G8X A;  1VQO I;  4HF1 A;  4LIT A;  4Z2Y A;  3H5A A;  1G59 A;  2D45 A;  3OSG A;  1GT0 C;  2KDO A;  3S14 J;  2E1M C;  3RZD J;  1DUX C;  3PNY A;  3RSN A;  3P9C A;  4EM1 A;  1UFM A;  1YX5 A;  2RNJ A;  3HOW J;  5CQG A;  3WTW C;  2Y0M A;  3BY6 A;  1W7P A;  4IRH A;  5D5U B;  3ZMT A;  1SD4 A;  1IGN A;  2PMH A;  3T8R A;  5HDK A;  2P8T A;  2PJR A;  1SAN A;  2OTJ I;  4CIC A;  1XGN A;  3HHH A;  1WH7 A;  5A2Q K;  5BQT A;  2RGV A;  4UUS B;  1ZAO A;  3CDH A;  5DTD A;  3HPH A;  2DMP A;  5J47 A;  3HTU A;  2EV5 A;  4XKB A;  1ZQ3 P;  2DOD A;  2F4I A;  3ABL H;  2NAZ A;  1SVL A;  2VBW A;  3SZG A;  3VOE A;  4FQG A;  2CSO A;  4MTE A;  5CVV A;  1STZ A;  3SDG A;  3DWL E;  2PLY A;  2Z5U A;  2NOG A;  3H9G A;  3IHU A;  3V4G A;  1FYK A;  4XON A;  2WAD A;  1JUM A;  1Y0N A;  4EV0 A;  2ECC A;  3ABU A;  3BR3 A;  3I55 I;  2Y0S N;  2BXY A;  1T98 A;  2EBI A;  5EF6 A;  1P92 A;  2E1M B;  3L00 A;  2X6X A;  1TQM A;  2K02 A;  5IYD J;  1JT0 A;  1P2F A;  1WJE A;  3EYI A;  5DD8 A;  3P9I A;  1LDJ A;  1OMI A;  2LRE A;  2HOS A;  4BKX A;  4OIP F;  1MMD A;  3BTL A;  2L9N A;  1FP1 D;  5LHH A;  2CQ7 A;  2EB7 A;  4HLX A;  2CV0 A;  3CDL A;  3T0Y A;  1FOK A;  5E3N A;  1X19 A;  3M07 A;  2KPM A;  3HOS A;  2O8K A;  1JJ6 C;  2BY0 A;  1S29 A;  2XRN A;  1X2N A;  1J2X A;  3CF2 A;  1BC7 C;  3HRU A;  5J1U A;  5HDN A;  4D5F A;  4MEY F;  1FEX A;  2DA3 A;  4IQ4 A;  2ZBK A;  1K61 A;  1ODD A;  3K4L A;  3GFL A;  3RKX A;  1FTZ A;  1JGS A;  1XCB A;  2O9L A;  3HYI A;  3EPZ A;  3OYK A;  4LOC A;  2JA2 A;  1MH3 A;  2JJ7 A;  1N25 A;  4QLC U;  3PUF A;  1U8B A;  4LK0 F;  1B1B A;  1B72 A;  2YUS A;  5M3F J;  2PMU A;  2WWY A;  3I4P A;  4CZC A;  4ENM A;  3HBL A;  1BIA A;  3H35 A;  2CMP A;  1ZR2 A;  4ZZL A;  2F6C A;  4BJT A;  3BTC A;  3TP3 A;  1LB2 A;  1D8J A;  3J7Z I;  3JR9 A;  2RV8 A;  1YRN B;  4FAS D;  2B7E A;  1D0X A;  1OLT A;  3DKX A;  3KFW X;  5FLV A;  2W48 A;  4XSZ F;  5F04 A;  4EEF G;  2XIG A;  1W1W E;  3HTS B;  1MSF C;  3PJR A;  3V7C A;  3LMM A;  4I09 A;  3SEQ A;  2H27 A;  1D5V A;  4BUP A;  5KCM A;  3CMY A;  4YRV A;  3FIS A;  4KUM A;  2XRL A;  3DPL C;  1QHH D;  3FWE A;  4HV6 A;  4Q48 A;  3FMR A;  3H36 A;  4I0B A;  2DQR A;  2NRA C;  2WTE A;  4G6D A;  2ADU A;  3CUQ A;  5FLM J;  3WU1 B;  4RB2 C;  1VQ6 I;  1IRF A;  2HQR A;  2DMT A;  1GXP A;  1T33 A;  2V26 A;  1IAW A;  1BI2 A;  3V8J A;  1A31 A;  2O5R A;  2P6T A;  1R23 A;  4HLY A;  1UHM A;  2VJ4 A;  1N78 A;  4O6J A;  1RR8 C;  3H3U A;  3CD6 I;  4UB6 C;  5ILV A;  1X1C A;  4KIF A;  2DMQ A;  2HDC A;  2H8R A;  4CGZ A;  4HDV A;  3E97 A;  3I4M J;  1W7P B;  4DYR A;  1W0U A;  3BJA A;  3I71 A;  3A2K A;  1IDZ A;  1RKW A;  4B43 A;  3D1N I;  1TQI A;  5EEG A;  3EUA A;  2X51 A;  4XKV A;  4X1E A;  2PI0 A;  2EJR A;  2ZNZ A;  3NRV A;  4ZJZ A;  1KZH A;  1LKX A;  3R0J A;  2FXA A;  4DIQ A;  5JHF A;  2L3D A;  2KRF A;  3ASN H;  1ZRD A;  2M4K A;  3J81 Z;  4LLG F;  3ECO A;  4AYB A;  1ZTR A;  1XC5 A;  3DLA A;  1J75 A;  1R5G A;  1B9N A;  1KA8 A;  4CCK A;  2VE9 A;  2KRC A;  4GCV A;  3RPU A;  3WE2 A;  4WX9 A;  2J5O A;  2K40 A;  2PBI A;  4BQA A;  3IV5 A;  3HRS A;  1G4D A;  3OYM A;  5LHI A;  2DPD A;  2HYJ A;  4DQ2 A;  3S1R J;  1FBQ A;  3BQZ A;  3LSJ A;  5CPR B;  3GTQ J;  1GLN A;  2FA5 A;  2P6S A;  3DQV C;  4HSR A;  1U5T A;  5IP9 J;  2GLO A;  1J7K A;  1G3S A;  3OS1 A;  3S2D J;  2DYR H;  4S04 A;  5DCM A;  1DGW Y;  4M3G A;  1ITY A;  2KP6 A;  1XS9 A;  1V3F A;  4A3E J;  5LGN A;  4B3X A;  1FY7 A;  2V9P A;  2Q2E B;  2VBZ A;  3CO6 C;  4ENK A;  1S72 I;  2COM A;  2G7H A;  3DU5 A;  3JRG A;  4RDU A;  4FTH A;  1VQ9 I;  1IXS B;  1F4K A;  2DJN A;  1OYI A;  2VI6 A;  3BR6 A;  5C44 J;  2V4J C;  1MMG A;  5D5V B;  2M9H A;  1RNL A;  1H89 C;  1QZE A;  2DFH A;  5B5E C;  2QQ9 A;  1MNE A;  3HOT A;  2QSF X;  2P7V B;  1NG7 A;  3HSF A;  4ZYH A;  5FB2 A;  4YEL A;  3WTS C;  5DCM B;  1T56 A;  2E7X A;  1PP7 U;  4XID A;  4A6D A;  5EZH A;  3PIO F;  2OQR A;  1FP2 A;  2JPB A;  2QKM B;  4I01 A;  2X6O A;  1N75 A;  4IOA F;  2GOM A;  2EK5 A;  5HS7 A;  3OYH A;  1ZHF A;  3Q9S A;  3VB2 A;  3DEE A;  2BBY A;  1T2K A;  2V1X A;  3K1P A;  4YG2 F;  4IQJ A;  4P96 A;  2ZO4 A;  2QKL B;  2YU3 A;  2O7O A;  4XLA A;  4E7Z A;  3IC7 A;  1FNN A;  1LJ9 A;  5AIQ A;  3HOX J;  2VUM J;  2ZNY A;  4ZDO A;  1SEU A;  4A3L J;  3OYI A;  1T8I A;  3WGI A;  2EIJ H;  4HG2 A;  1O7L A;  3UKG A;  3NEU A;  1F1Z A;  4BL0 B;  3CC7 I;  2BZT A;  2CYY A;  1A35 A;  1LVA A;  1Y0U A;  5LEJ A;  4A3K J;  4G9Y A;  3RI4 A;  1GVD A;  1WZ2 A;  1YW7 A;  5CQE A;  4C2T A;  4IL6 C;  3WHC A;  2KIS A;  2HZT A;  2EZH A;  4BJ6 C;  2DMU A;  3VPR A;  3JRH A;  1YE9 A;  3ABT A;  1P7J A;  2HU9 A;  1OCZ H;  3SZT A;  3BLY A;  1YI2 I;  2STW A;  2UUZ A;  1OFC X;  1RPW A;  2VC0 A;  4HST A;  2Q0O A;  2ZME A;  3BOQ A;  1NH3 A;  2L0K A;  5F27 A;  4C9Y A;  3WG7 H;  3CJN A;  2DPU A;  5E1W A;  1QHG A;  1SFE A;  3L2W A;  1LFU P;  4BBR J;  1F36 A;  4EM2 A;  1WJ5 A;  3C2B A;  1D1B A;  1ZK8 A;  2VXD A;  5EZG A;  3KP5 A;  4JX5 A;  1QPM A;  1WJA A;  2DMN A;  5E3M A;  1VQK I;  3HOZ J;  1IO2 A;  1W5T A;  5AIP A;  1I27 A;  3ZMS A;  2FMY A;  3MZY A;  2AHQ A;  3VSL A;  4BBS J;  3R61 A;  3NAU A;  3HOY J;  1O3T A;  1ZR4 A;  3FF5 A;  4Y15 A;  3SEZ A;  1X4P A;  2FQ3 A;  3CP2 A;  2DA1 A;  3BR5 A;  3BRO A;  5CKT A;  4A3M J;  3A0B C;  4HX4 A;  3FXK A;  3S8P A;  3WE3 A;  3ZQC A;  3ZXS A;  4RGS A;  1OR7 C;  2R7F A;  3FK6 A;  5K5R A;  3FMQ A;  2HR3 A;  2MFZ A;  1E3O C;  3HM5 A;  2STT A;  2F5C A;  3LL7 A;  5J4V A;  2AS5 F;  2E1C A;  3S16 J;  4IHT A;  1FC3 A;  2PG4 A;  4Y3O A;  1LE8 B;  1Z9C A;  1FZP B;  2AXL A;  5B66 C;  4JK1 X;  2K9Q A;  2Z9O A;  2DFF A;  4DJA A;  4E7S A;  2W24 A;  3HOU J;  5LGT A;  4HNV A;  3LNQ A;  1MJA A;  2HI3 A;  2QQB A;  1IXR C;  2VBY A;  1R22 A;  4XLC A;  3WTV C;  4KJZ A;  4UUV A;  3MWM A;  2JA8 J;  3E6D A;  4F91 B;  4U7B A;  3VYU B;  4CYD A;  4EGZ A;  1XB4 A;  3L9F A;  5FFZ A;  3GTG J;  3JAM K;  3C3W A;  3RIR A;  1W5C C;  4D7N A;  4E70 A;  2O6G E;  1IV6 A;  1BR1 A;  2K7L A;  3I56 I;  4RBO A;  2X0L A;  2XKO A;  1WI9 A;  4CHU A;  2L7Z A;  5D6F A;  4UV9 A;  3ISP A;  3QYE A;  3PFY A;  1Q1H A;  5IP6 A;  2D5V A;  5E20 A;  3DBL B;  2VN2 A;  5ILS A;  1UZC A;  3IRR A;  3MVP A;  4ZYA A;  4PZJ A;  1W36 D;  3BTJ A;  3EET A;  3F9K A;  3PFI A;  1BR2 A;  1Z7U A;  5CVI A;  2NS8 A;  3SQN A;  1HKT A;  2M5W A;  2V9K A;  3HUG B;  1BIB A;  1RZ4 A;  5DS9 A;  1KQ8 A;  3GZN B;  2VKE A;  1LFP A;  4M9S A;  2X4H A;  1IN5 A;  2W00 A;  3KYC B;  1T39 A;  2RVC A;  1RUN A;  3OL3 A;  2CQX A;  2P5V A;  3IWZ A;  4UB8 C;  2E2J J;  1NG6 A;  4OIN F;  1S9H A;  1OCT C;  3FBN B;  4MFD A;  1IV8 A;  4E7H A;  3M4O J;  4B8X A;  1DU6 A;  1G3W A;  2IAI A;  1U5T B;  3BR1 A;  4V19 K;  4CCJ A;  1BOB A;  2F48 A;  2R5Y A;  2XF5 A;  3AG4 H;  4E6K G;  2ZXI A;  4XSX F;  2HXO A;  2V1N A;  5D5W B;  1P7I A;  2OQG A;  3E5Q A;  4C3J J;  2MC4 A;  2C6Y A;  4B47 A;  2WY7 Q;  4LK1 F;  3OR2 C;  1R9T J;  2QVO A;  3M9A A;  1UJ8 A;  5JVG F;  3GTO J;  4NDL A;  2EFN A;  3WU0 A;  2TCT A;  2DAO A;  3PUB A;  1IC8 A;  1UHS A;  1Y1V J;  1W0T A;  1WJB A;  3MAJ A;  3TP0 A;  3KP3 A;  4CDG A;  4ENJ A;  2M30 A;  1VQM I;  4DYQ A;  2P7C B;  3O2P E;  3JSO A;  1DPU A;  1D1C A;  2XGE A;  3I4N J;  2R7X A;  3BZC A;  2CV2 A;  4HPQ A;  2IEK A;  5L3B A;  1U3E M;  4DOZ A;  4GYI A;  3S3O A;  3G2B A;  3HSE A;  2JK3 A;  3DFG A;  1NHA A;  2X1C A;  4LB6 B;  5E3L A;  1AU7 A;  3BC8 A;  2Y31 A;  4A3C J;  3AL0 B;  1SFK A;  3FXU A;  4L9V A;  1HST A;  2E2I J;  2G0E A;  1LPQ A;  3SJM A;  2WAQ N;  4BEH A;  1JTY A;  4JP0 A;  4L9N A;  4F93 B;  1AA7 A;  5DDG A;  2VBX A;  2EPF A;  2HTS A;  3GFI A;  4LG3 A;  4A0Y A;  2BW3 B;  3KYD B;  2ELJ A;  3DTE A;  3K4C A;  1ZRE A;  4WF2 A;  2F5F A;  5ILU A;  5B3S H;  2GQQ A;  3J80 Z;  1KYW A;  3KLN A;  2IT0 A;  1V5E A;  2ZME C;  2XSD C;  1MBJ A;  3E3V A;  2KFD A;  2P81 A;  1R71 A;  2RRE A;  5E8G A;  3OS2 A;  3EUK L;  3RCO A;  1XMX A;  2O03 A;  4Y4R A;  1RUO A;  4DZP A;  3U21 A;  3HHG A;  2E19 A;  1JGG A;  4GGG A;  3UNG C;  1P9Q C;  1IRG A;  2R93 J;  1U78 A;  1YIT I;  2O0Y A;  4LFU A;  3VYS B;  1E0E A;  4IVN A;  3QPT A;  1P4A A;  4MNU A;  4Y13 A;  4ENN A;  4E4H A;  5ICG A;  2Y2Z A;  3OYG A;  3TW7 A;  1XGM A;  4IPA A;  4Q5S F;  3QAH A;  3KP7 A;  2XPU A;  1HF0 A;  1O3Q A;  4RGR A;  3J7A Y;  1JHH A;  1ZG3 A;  2PJP A;  5LFA A;  4Z6Y A;  3DTK A;  1BM9 A;  2CFX A;  4BXF A;  4RA2 A;  3DBH B;  3I3L A;  4MTD A;  2LP0 A;  1K79 A;  2UXX A;  4AC0 A;  2XVC A;  1G3T A;  3J80 K;  2WC2 A;  5EYR A;  3U9G A;  4EJO A;  1MND A;  2K85 A;  2LBF B;  3CF5 F;  2BOL A;  5FKL A;  2XPV A;  5GAH J;  2VLA A;  2VPL A;  3TOA A;  4BE0 A;  3AAF A;  1W4M A;  2OBP A;  1Z6T A;  2Q1Z B;  3FK7 A;  2K3F A;  3OL4 A;  4JYK A;  3TKY A;  1APL C;  2LF7 A;  1UCR A;  1WQ2 A;  3MQ0 A;  3GO5 A;  4JX6 A;  2IGK A;  1VQN I;  4RB0 A;  1TP4 A;  2PQ8 A;  4NC8 A;  4RLF A;  3CZ6 A;  3D0S A;  3BR2 A;  2W7N A;  1KU3 A;  2DT6 A;  3MZH A;  2J5P A;  2CW7 A;  3LA3 A;  4BNC A;  4XRS A;  4A3J J;  5JLW A;  2M4G A;  3G1O A;  3OYB A;  1AHD P;  3V42 A;  2Z16 A;  3J7Y J;  4K2E A;  2TDX A;  5IT9 Z;  3QWL A;  1VQL I;  1IN4 A;  1OCP A;  2VT2 A;  1T0F A;  2R7V A;  2XAH A;  5K1Y A;  4XLE A;  2DOF A;  4I7H A;  3MCZ A;  4II3 A;  1P6R A;  2GXG A;  1J9I A;  3I5U A;  1EH6 A;  4BXX J;  1VQP I;  2A3S A;  1ETQ A;  1FMV A;  3ULQ B;  4HQM A;  2K3P A;  3GEZ A;  2BY1 A;  3OOP A;  4NUB A;  4FX0 A;  4AU7 A;  2L4A A;  4IJA A;  1FJL A;  3SDB A;  1K4T A;  3HEF A;  4S0H B;  4I98 B;  5IYB J;  3TQN A;  4WWC A;  1BI1 A;  3C2G A;  2GM4 A;  2H1K A;  1X3U A;  4IHY A;  5ED4 A;  3C2H A;  3SHF A;  3E6B A;  4XQF A;  1ERD A;  4UUS A;  4G6T B;  3QU3 A;  1OCO H;  4A3I J;  2IGN A;  2KQR A;  3B73 A;  1K4S A;  4RGU A;  1S7E A;  1IJW C;  3TMO A;  1RI7 A;  1R7J A;  1QO0 D;  3RKW A;  2ZXJ A;  2QGU A;  5AON A;  4EJW A;  1SMT A;  3OV8 A;  3K4J A;  2CUJ A;  2YR2 A;  2DFE A;  3BZ6 A;  2KMU A;  1RKT A;  3K69 A;  4EJT A;  3S2H J;  5FKN A;  3KE2 A;  4XRM A;  1ZYR F;  2K4B A;  1LVK A;  2PMZ A;  4J01 A;  1MDM B;  1Y6I A;  4OU0 A;  1XDS A;  4NB5 A;  2IGM A;  2KJB A;  3BDD A;  3LWF A;  5LHG A;  3P7N A;  3LA7 A;  3R60 A;  2JA6 J;  3JRD A;  2K9N A;  4L9T A;  1IF1 A;  3FKJ A;  2FEZ A;  1KGS A;  2DOE A;  3ECH A;  1L3L A;  2EZK A;  2L2O A;  3GTL J;  3KEQ A;  2Y9Z A;  3K4K A;  2E5Z A;  5DUI A;  1MSE C;  1IRX A;  2ZKZ A;  2P4W A;  3QU6 A;  4FIS A;  3K6G A;  1PDN C;  1U2W A;  3ZR8 X;  1TW3 A;  1JKQ C;  1UAA A;  2VB6 A;  4F52 A;  1H88 C;  4ZYG A;  1YG2 A;  5FD6 A;  3GFM A;  1TNT A;  4KFC A;  3A0H C;  2L9S A;  1TL8 A;  1LQ1 A;  3LOC A;  4UVB A;  3W2W A;  3ABM H;  1ETW A;  1HKS A;  5JHU A;  3Q5F A;  4BGD A;  4R1H A;  4YFX F;  4B09 A;  3OYE A;  2KZV A;  5DCF A;  1UG0 A;  1V55 H;  4IEJ A;  3CCJ I;  1E3P A;  4MO7 A;  1JT6 A;  5E1Z B;  3I0T A;  3O8H A;  1O57 A;  4AVP A;  4KMF A;  3TOB A;  4XMY A;  4MIM A;  4B3A A;  4L9J A;  2WAE A;  5FJ8 J;  5L3E A;  4HRI A;  3GLX A;  2HOA A;  2MG4 A;  3BG5 A;  5IPA A;  3FMS A;  1MNM C;  2AQF A;  1F9N A;  3CO7 C;  5EEH A;  1I1S A;  3A01 B;  5B1B H;  3CJT B;  1Q1V A;  5LLQ A;  4BS9 A;  2IRF G;  1WHU A;  2F5E A;  4MFE A;  3V8K A;  2JWT A;  1SFX A;  2XAU A;  2CWE A;  1U8R A;  4HOB A;  2EA2 A;  2ID6 A;  2DU9 A;  1DGR M;  1Y39 A;  3HKZ N;  3GF2 A;  2HXI A;  4HNU A;  1OJL A;  1YTY A;  4C30 A;  3H5N A;  3PNV A;  1TTY A;  3E7L A;  3MMY B;  1IXC A;  3NWT A;  5HS9 A;  2V1D A;  2QSG X;  4BY1 J;  4MQ9 F;  5FO5 A;  5E17 F;  2ZXW H;  2XAQ A;  2IW5 A;  2DW4 A;  2EV0 A;  4N9I A;  4F3Q A;  3EDP A;  2X6W A;  3BPX A;  2CV1 A;  2N8G A;  4D1Q A;  1FLI A;  2KIM A;  1KU7 A;  2P5L C;  1BI0 A;  4OMZ A;  2A61 A;  4RB1 A;  4PJN A;  2CFO A;  2D1H A;  2QEN A;  1MBG A;  4M6V A;  5DD4 A;  1QA6 A;  1MGT A;  2EWN A;  2WV0 A;  4XRS G;  2EH3 A;  4CH7 A;  3T8T A;  4HNT A;  3JTH A;  5ICC A;  2HS5 A;  1TT5 B;  4B44 A;  3F8M A;  2BV6 A;  2V7F A;  1PUF B;  1EF4 A;  3CUO A;  5LD2 C;  2R7W A;  2QF7 A;  2LBF A;  1IRZ A;  2ME0 A;  4AWX B;  3VOD A;  1HQC A;  2DYS H;  3CME I;  4J00 A;  4HYE A;  5IOZ A;  1V4R A;  1N77 A;  3HDD A;  2HQ5 A;  3V7R A;  2LTP A;  5JVT A;  4AM3 A;  3GZ6 A;  3S32 A;  2NVU B;  1MBH A;  2Y75 A;  2KJC A;  3QPS A;  4LLL A;  2IS4 A;  2KZG A;  2DXI A;  1B4A A;  2XAS A;  2E34 A;  2UWM A;  2E71 A;  2VQC A;  1RR7 A;  4ZC3 A;  5CVJ A;  3FXJ A;  5EDN A;  2A07 F;  3VFZ A;  4FE7 A;  3CLQ A;  4J19 A;  2XRO A;  1R1U A;  2XB5 A;  4PSX A;  5K7F A;  5CYV A;  3KEY A;  2DQL A;  2OD5 A;  1D0Z A;  2OCC H;  3CCQ I;  4MHG A;  1VQ5 I;  2XHK A;  1WRJ A;  2ZSH B;  2JPC A;  4I02 A;  5J4Y A;  4KIT B;  5HOO A;  3KYL A;  2ESH A;  2IA0 A;  1SD6 A;  4O3M A;  1PVE A;  2JRM A;  2XV4 S;  1UHW A;  2FOK A;  3N97 A;  5HDG A;  2VOO A;  1J0R A;  3CCL I;  1WSU A;  1K78 A;  5B1A H;  1SC7 A;  2WY8 Q;  1SVO A;  5EG0 A;  2Z3Y A;  3F8N A;  3BTI A;  4WCG A;  1Z1D A;  5D8K B;  2GBY A;  1K7A A;  2R7O A;  1XMK A;  2EV6 A;  1AOY A;  2CG4 A;  2JT1 A;  4HV5 A;  4LJZ F;  4FT8 A;  3ZMZ A;  5F1R A;  1PUF A;  3G73 A;  3VYR B;  2L54 A;  3K9T A;  4P5O A;  4ANJ A;  1XSD A;  1TW2 A;  3GTK J;  3ERM A;  1FOX A;  2V79 A;  3T1B A;  2LKS A;  5FKM A;  3RYP A;  5HLT A;  2XGD A;  1HOM A;  1EJ9 A;  1E17 A;  2XSJ C;  3R4K A;  3DKY A;  1DP7 P;  4A3B J;  5FLX Z;  1ORK A;  5JR3 A;  2MGQ A;  3DLL F;  2H6B A;  2LYC A;  5CVR A;  4GDF A;  2VL8 A;  2FE3 A;  5E8I A;  1J09 A;  2FQ4 A;  1X1A A;  1YX3 A;  3W2A A;  2A6H F;  1VND A;  5CJ9 A;  5DYM A;  2ZFW A;  4A3G J;  1R4M B;  4EJV A;  2ELH A;  2KT0 A;  1EV7 A;  3H9J A;  2FD5 A;  4W1U A;  1I6H J;  2RN7 A;  4XIC A;  2G7U A;  1OYY A;  5HLG A;  3G4S I;  2ZME B;  4NQW A;  3L2R A;  1XGO A;  5JFR A;  3SXY A;  3F8B A;  2XUB A;  1IG7 A;  4LLN A;  4A5N A;  3K2Z A;  5GPA A;  4DYC A;  4QPQ A;  1U9N A;  3FM3 A;  3RJP A;  3PO3 J;  4NNJ A;  1I50 J;  5BPD A;  3KP6 A;  3A01 A;  3CCV I;  1GV2 A;  3DEU A;  1H9T A;  2MD5 A;  5FKO A;  2M8G X;  4FCY A;  3K2A A;  2ZSI B;  2M45 A;  4O5V A;  2R5Z B;  3EUH A;  1YW8 A;  3QQA A;  3S1Q J;  1BR4 A;  2CW0 F;  5L3F A;  3QPL A;  1A6I A;  2L7M P;  3HUG A;  1MMN A;  2R7D A;  2I5U A;  2BGC A;  1FSE A;  1UST A;  2BY2 A;  2OAZ A;  4OIO F;  4KN7 X;  4LG0 A;  3BR0 A;  1FOW A;  2JQ7 A;  2HVS A;  3LSP A;  4N4N B;  4BXU A;  2WA0 A;  3JRI A;  1XMA A;  3QRF F;  3RPQ A;  3KET A;  3JCU C;  4D7M A;  2MSY A;  5M5X J;  4ZTJ A;  2QBY B;  3O3K A;  3HC7 A;  3DEW A;  5FD5 A;  4EGY A;  4IHW A;  2JSP A;  2M8E A;  3QOE A;  1Z91 A;  5CVU A;  1DU0 A;  4OMY A;  1YQA A;  3WU2 C;  3JTG A;  1AKH A;  5K7H A;  2L5Q A;  5IOY A;  2KHM A;  3J81 K;  2FJ1 A;  4CYC A;  4AIH A;  2HEO A;  3E5U A;  1LNW A;  3HGG A;  4L5E A;  5K5O A;  3AG3 H;  2GAU A;  5KAF C;  3GUD A;  3MEX A;  4Y33 A;  4OWR B;  5KK1 A;  3ROU A;  3L1P A;  1ZRC A;  4EQQ A;  2CUZ A;  3S2W A;  1QZY A;  2K27 A;  2YPR A;  2LKP A;  3LST A;  4L5I A;  2NVY J;  1QQI A;  4Y7N J;  3N4M A;  3W6V A;  1QPI A;  3ZCO A;  3QOD A;  1JJ8 C;  3L09 A;  4L0Z B;  3I59 B;  1YIO A;  3VSK A;  1L0O C;  4JX4 A;  5FRN A;  2BYV E;  2XGC A;  3FKI J;  1FIP A;  1DP3 A;  2ZFU A;  1USS A;  3CCM I;  3JRE A;  4GRI A;  1XN7 A;  3FDY A;  2BW3 A;  3DF8 A;  2HZD A;  2UXN A;  1U0J A;  2V1U A;  4UY8 I;  4CXF A;  2HVR A;  1MD0 A;  1HW1 A;  2DDA A;  5GAG J;  5LRR A;  2HVQ A;  1QVT A;  1IUF A;  2KRH A;  3E1S A;  3GME A;  4N4O B;  2PJR B;  4LB5 A;  4XBF A;  4RS8 A;  4BAY A;  2ACJ A;  4A93 J;  4IX7 A;  2MA3 A;  2E1N A;  2VAS A;  2VQL A;  3LQQ A;  3ONQ A;  1R5H A;  1HCR A;  4BYY A;  2AO9 A;  1WJD A;  1Z3Y A;  1WCM J;  2R7S A;  3WG9 A;  3H5R A;  5EEA A;  3FXR A;  4CA0 A;  1EH8 A;  2EFO A;  2QM3 A;  4A3D J;  2RQQ A;  1ZG1 A;  4I2O A;  1SFO J;  4EMS A;  3KP2 A;  2IP2 A;  4NHJ A;  4LD5 A;  2VJJ A;  2R92 J;  3WTZ A;  2EQR A;  5M5Y J;  2CQN A;  2HDD A;  3R0A A;  4CSW A;  2BHZ A;  2H1L A;  3GXO A;  4D5C A;  3TDU C;  2K86 A;  2LKX A;  3SFZ A;  1I5Z A;  4M73 A;  2GWR A;  1I1G A;  2DCE A;  3W6J B;  4PK4 A;  2FU4 A;  4HX8 A;  5D8L B;  1H9G A;  2BVL A;  1XSV A;  3KX2 A;  6PAX A;  3TL4 X;  2EFQ A;  3PL8 A;  2GIZ A;  4LGW A;  4B1R A;  1ACI A;  3V8L A;  1FIA A;  2JVH A;  1A36 A;  1OR7 A;  1X58 A;  3S93 A;  4M3E A;  1ZG5 A;  1J5Y A;  2MLG A;  1S7A A;  3FM5 A;  1XX5 A;  2RAE A;  2ID3 A;  5FFX A;  2NOJ B;  5F64 A;  1IDY A;  3E6C C;  3FBI B;  4H4K C;  5J3L A;  1SAX A;  1JHF A;  2X1E A;  2JA5 J;  1HC8 A;  1X3W B;  5D5X B;  3HG9 A;  2X48 A;  3BCB A;  5F1J A;  1FX7 A;  3EQL F;  3H0G J;  2JZY A;  1Z6R A;  2E1O A;  3NQO A;  1FOY A;  1JKR C;  4JBA A;  4ZDP A;  1FYM A;  2JSC A;  5F08 A;  4ESJ A;  2QLZ A;  2IXS A;  1YLF A;  3F23 A;  1KYZ A;  3IRQ A;  3V7S A;  4L0Y B;  4L18 B;  4ESB A;  3I53 A;  4M6X A;  1R6R A;  3Q0V A;  3LSM A;  2XAF A;  1MW7 A;  1ONV A;  5IYC J;  2CRG A;  3U1K A;  1B8I A;  2K5C A;  5GAD J;  5D6E A;  5IT9 K;  2IS6 A;  1XPX A;  2LC2 A;  4UXN A;  1X3Z B;  4TV7 A;  4PSW A;  2EFW A;  2V6E A;  4BQO A;  2RNG A;  1JI8 A;  2P0W A;  4UVC A;  2CUF A;  3ZQ7 A;  3N05 A;  3A1Y A;  3C18 A;  3FHN A;  3A02 A;  3IKV A;  2W4S A;  1Z77 A;  1SMY F;  4DZJ A;  1GDT A;  3CLO A;  4LIV A;  4IRG A;  4PFO A;  1IN7 A;  2LFB A;  3Q0W A;  2HNH A;  5EGO B;  2YU9 J;  4A6E A;  1LE8 A;  4IKF A;  1TWH J;  4II2 A;  3B02 A;  4CYC B;  3DP7 A;  4E7I A;  4NC7 A;  1G6N A;  3SYT A;  1Z7L A;  3K70 D;  4A5M A;  1ZLJ A;  1FYL A;  5HOD A;  4E7J A;  3TO9 A;  1UB9 A;  2YS9 A;  3WTX C;  4IZZ A;  3BG3 A;  4HA8 A;  2DA5 A;  3DPU A;  2QBY A;  3FXM A;  1HDD C;  1X1D A;  1TQP A;  4N0B A;  4PUS A;  1ZGW A;  1E3H A;  2OF7 A;  3OIO A;  5F0F A;  2ISY A;  1R5I D;  2ESN A;  2XKP A;  4ON0 A;  5GTH C;  5E1X A;  5GPC A;  2O61 A;  3FX3 A;  5E3O A;  3H92 A;  2I10 A;  2OV7 A;  2R5Z A;  4UV8 A;  3PQK A;  5JLX A;  3G3Z A;  2NNN A;  2LD5 A;  2IS2 A;  1OYW A;  4LIU A;  2HPM A;  2GXB A;  4QWQ A;  4AVZ A;  1OQY A;  4PJM A;  1DQU A;  2JN6 A;  5IY5 H;  3F0C A;  2CO5 A;  1EKE A;  5TIS C;  3WGH A;  4YFN F;  3GX4 X;  2OZ6 A;  1BC8 C;  3HRM A;  3JRF A;  5DV5 A;  3CJQ B;  2WV1 A;  1MBK A;  2ZXH A;  3M8E A;  2E36 A;  2OU2 A;  3L2C A;  3CES A;  3L2V A;  3RZO J;  4IXA A;  3LSG A;  2IS1 A;  2CS3 A;  2A5Y B;  4DBR A;  3KPH A;  4KNY A;  3CCS I;  4XRF A;  1MJ9 A;  1PUE E;  3H1C A;  1WGX A;  3K7A J;  4BHC A;  4HQE A;  3GVA A;  4M3F A;  3M1E A;  3K0L A;  3TDZ C;  1MZB A;  1WI3 A;  3DU6 A;  3ZMD A;  3QPH A;  2LVS A;  3T5X A;  3UR3 C;  2DDB A;  3C7J A;  3BCA A;  4G7H F;  4F92 B;  2YX4 A;  3IL2 A;  2XF7 A;  1QVU A;  2HQN A;  4RM3 A;  1D3Y A;  2W85 A;  4U87 A;  2FBH A;  3HZJ A;  1GXQ A;  4EJU A;  1W7P D;  1F43 A;  3GTJ J;  1TWG J;  2QYO A;  1JKO C;  1KU2 A;  1LDD A;  2LMD A;  3BPV A;  3K10 A;  1UMQ A;  1FBS A;  3G1M A;  1IUY A;  1S7O A;  2DTR A;  5GAE J;  1R1T A;  2M87 A;  2Y0S A;  2XPW A;  3RQI A;  3OIP A;  4F55 A;  1O4X A;  3LAP A;  1XD7 A;  3OY9 A;  4A12 A;  2CQK A;  2JVG A;  4PJL A;  1KQ9 A;  3OYC A;  4YIF A;  2JUC A;  3BQY A;  3KZZ A;  4AIK A;  5TRD A;  2DTZ A;  5BMZ A;  2FOW A;  3QYF A;  2LRD A;  4G6Q A;  2KLO A;  5C3E J;  1BI3 A;  4W97 A;  4XKC A;  1QZZ A;  2CJJ A;  1BBY A;  3FXL A;  4M3D A;  3TGN A;  2H8W A;  3REO A;  1YRN A;  2ELK A;  3CCY A;  3OIQ A;  3QP6 A;  1O3R A;  1ZRF A;  3I58 A;  3SFI A;  4ZTF A;  4XKW A;  4NBQ A;  1HW5 A;  2HYG D;  1Z67 A;  3HIF A;  2VT3 A;  5LRS A;  1XSX A;  1IZ1 A;  4WXC A;  4P55 A;  1KU9 A;  2O8X A;  2QEX I;  2VJ5 A;  2TRT A;  2BVM A;  3WTU C;  4I0A A;  5IP7 J;  4GXO A;  1FT9 A;  1OPC A;  3CC4 I;  2Q2E A;  3FZV A;  3TED A;  2RDP A;  3KCC A;  2E35 A;  1I3Q J;  1R00 A;  2OUM A;  5F0H A;  3WTT C;  3IKT A;  3OYL A;  2L7F P;  9ANT A;  2MW8 A;  1TWA J;  4V2F A;  5JI6 A;  2VOP A;  3JRB A;  2ZJ2 A;  4QTR A;  1VFC A;  2EA4 A;  5BPI A;  4IRI A;  2H09 A;  4Y52 J;  2OJE D;  1HW2 A;  1BW6 A;  2A68 F;  5DM7 F;  1JXS A;  4U0W A;  2M7A A;  4RM2 A;  1ETK A;  2XF6 A;  4H0E A;  3OYJ A;  1WKM A;  4AUX A;  2A6T A;  5J1Y A;  1T95 A;  3W6K B;  1ZAR A;  4M71 A;  2XGX A;  2M2E A;  4C3I J;  5ICE A;  3X2Q H;  5K5Q A;  2H94 A;  1Z3X A;  5LEK A;  4HBL A;  1SD7 A;  1K6Y A;  3GZ5 A;  2ETH A;  1BN5 A;  3H9Q A;  3NAR A;  2K9M A;  4PCQ A;  3F8C A;  2AQE A;  2OA4 A;  2ME6 A;  4X0G A;  1MH4 A;  1MIJ A;  1W5S A;  1Y56 A;  3CCE I;  4YEJ A;  3AL0 C;  2LY9 A;  4GO1 A;  4HDU A;  2KIQ A;  1T0F C;  4RAF A;  4UUT A;  2HKO A;  3CCU I;  3H0D A;  1LUJ B;  1XGS A;  1SVM A;  2VKD A;  1OIS A;  4CO8 A;  4PDK A;  3MFK A;  2HQA A;  2W84 A;  2Y30 A;  3MKW B;  1TWF J;  4WXH A;  5L3G A;  3ZQH A;  1V54 H;  1CGP A;  2HYF A;  4KT6 A;  1P4X A;  1K78 B;  2NNY A;  5EJC A;  1OKR A;  4JQF A;  3CTA A;  1ETY A;  3AG1 H;  4G7Z F;  3WTY C;  4Y17 A;  3G71 I;  3HL2 A;  1G3Y A;  2B63 J;  1XCV A;  4XN0 A;  4KA4 A;  4FHT A;  4ETS A;  3GTM J;  3F3X A;  2LOO A;  3CMM A;  1WFX A;  5BOX A;  5D4S A;  2R7Z J;  3D5S C;  2DK8 A;  2Y9Y A;  3TO6 A;  4P9U A;  1RRJ A;  3ML6 A;  4UHT A;  1HLV A;  1D5Y A;  4S05 A;  1X1P A;  1WWX A;  1R1V A;  3ABK H;  5DM6 F;  2BEO A;  2GIV A;  1JUS A;  2A6E F;  1C0W A;  3K1M A;  4GFB A;  3FIW A;  5E18 F;  1WJF A;  3AG2 H;  3MKZ A;  3ZQG A;  2F4O B;  2JMW A;  2V6C A;  2MC3 A;  4AYB N;  4DNC A;  4BDY A;  3L7W A;  1R49 A;  3PIP F;  2DT5 A;  2LK2 A;  4U7D A;  4ZDL A;  4ZYD A;  1FBU A;  3F72 A;  3CC2 I;  3BJ6 A;  3I59 A;  4Q4Z F;  1KON A;  1ZN2 A;  1WJC A;  1WPK A;  2LY2 A;  4U88 A;  5LGU A;  2W57 A;  2WB1 N;  3HB9 A;  2DN0 A;  4RAG A;  3IP4 B;  2HTJ A;  3G1L A;  3P9K A;  3RDI A;  3WGG A;  2ZJR F;  4BEH B;  3E0J B;  3BZK A;  1H8A C;  3P5J A;  5ICF A;  2PN6 A;  2L9V A;  2VKV A;  1VTN C;  3DTI A;  1S8N A;  2EIN H;  2CW8 A;  3ZQL A;  3HXL A;  3TW6 A;  2EZI A;  4OOI A;  3GWZ A;  1Y1W J;  2LY1 A;  5FRM A;  2ZCW A;  2K4J A;  2BE5 F;  2NVQ J;  4BQQ A;  1MKM A;  3HPG A;  4AID A;  2XDV A;  4C2U A;  1JUP A;  4MGR A;  1CQT A;  2ECB A;  1J59 A;  3H3V K;  4ZYE A;  2OCE A;  2EFP A;  5H2F C;  2GOX B;  2QUF A;  3LFK A;  4BH9 A;  4YIR X;  2EIL H;  2YSR A;  1RC9 A;  4BU2 A;  2WAQ A;  2PFB A;  1LFB A;  3KZI C;  2RC4 A;  4C2M J;  2A5W A;  3Q0U A;  5HLI A;  2GA2 A;  1KQ0 A;  3A4C A;  4E7K A;  2FBI A;  1CF7 A;  3RKQ A;  2NYX A;  2Q8K A;  4ABZ A;  4YFK F;  2EIM H;  1A6Q A;  1XG1 A;  1ZLK A;  1FTT A;  1WVR A;  3KIO A;  1MDM A;  4CCL A;  2K9S A;  2R7R A;  3I64 A;  2NXN B;  2L02 A;  4WK8 F;  2EIK H;  4HZF A;  4UVA A;  3LA2 A;  3IUO A;  1B8I B;  5ERI A;  2IVM A;  1A04 A;  2IGO A;  2LNB A;  2FRH A;  5C4X J;  2L9R A;  3DKW A;  5KHD A;  3ZQQ A;  2W82 A;  2BXZ A;  1G8X A;  5H6R A;  1DDN A;  1FMW A;  3DBR B;  2DO7 A;  4U0V A;  1ETX A;  2OC6 A;  2VPR A;  1G2H A;  3QYB A;  1JTX A;  2A69 F;  1UEL B;  3MD2 A;  1YHQ I;  3IH2 A;  1M1E B;  3A03 A;  2XAJ A;  1U6G A;  3OS0 A;  1HSJ A;  1CF7 B;  2IPQ X;  2BY3 A;  4CUG A;  1ON2 A;  3CP8 A;  2EZL A;  3IWF A;  4XM3 A;  4AD9 A;  3LQR A;  1RET A;  1BL0 A;  3ZN1 A;  2QZ8 A;  4M74 A;  4FET A;  1E2X A;  3VWB A;  3S1N J;  2M3A A;  2DA7 A;  2Z2S B;  1VQ8 I;  3CUQ B; 
#chains in the Genus database with same CATH homology
 3TO7 A;  1RIO H;  1R58 A;  2IA2 A;  3F22 A;  1TLH B;  3KP4 A;  4U0Y A;  2KIF A;  4IF4 A;  4YII A;  3DPT A;  2KKO A;  4A0Z A;  2O3F A;  1F5T A;  2Z99 A;  4XLP F;  2QQA A;  1ZGA A;  4M9Z A;  2ISZ A;  3BWG A;  2UZK A;  1IN8 A;  2GA1 A;  2RKH A;  1O3S A;  1LEB A;  4G94 A;  4BHB A;  1QGP A;  2OZU A;  3BJO A;  5L3D A;  5TJJ A;  4KIG A;  4UNO A;  2JTV A;  3E6M A;  1U5T C;  1B59 A;  4Q47 A;  4HF2 A;  1YFH A;  4MQV A;  2D1V A;  2MBF A;  3COA C;  3DV8 A;  5HVQ C;  2F2E A;  5DUK A;  2FF4 A;  4KDP A;  1T6S A;  4KMU X;  2YX7 A;  4GYG A;  2RQP A;  2DLL A;  1PP8 F;  2W25 A;  3RKY A;  5IT3 A;  1QNT A;  4LMY A;  2R3S A;  3M7G A;  1ON1 A;  3Q9V A;  4M72 A;  4ASN A;  3U2R A;  3KEO A;  1R36 A;  3ZPL A;  3JAM Z;  2P5K A;  4L5J A;  4HAM A;  1XDU A;  1JE8 A;  4N9H A;  2D2W A;  4RB3 C;  4RAY A;  2HFH A;  3QP5 A;  4HW0 A;  1YS6 A;  3KZY A;  2DFI A;  4LG0 B;  2VC1 A;  2MLK A;  2MH2 A;  2VON A;  5FGM A;  1QBJ A;  3CUQ C;  5FLX K;  1GVJ A;  1S6L A;  3D5L A;  4M9X A;  1H0M A;  1K6O A;  1FPQ A;  2KIU A;  4CZZ A;  4P9F A;  5HS8 A;  1DPR A;  2QWW A;  5HLH A;  2L4M A;  2FSW A;  3F8F A;  4KIB A;  4RAZ A;  3KLO A;  4PGG A;  3FXQ A;  1T38 A;  5F6F A;  2JRT A;  4KT5 C;  3RTR A;  1B6A A;  4BHP A;  2HOE A;  4A0X A;  3ZMV A;  4A2U A;  3R6S A;  3EYY A;  1ULY A;  4MEX F;  2MH9 A;  5A2Q Z;  1YW9 A;  4FX4 A;  1TNS A;  2FNA A;  2FBK A;  4AIJ A;  4KIC A;  3FHZ A;  2F5D A;  3HRT A;  1D8K A;  1ZH5 A;  1Z05 A;  2M1B A;  4EM0 B;  3GFJ A;  4R79 A;  1YS7 A;  5LBQ A;  3I54 A;  2E7W A;  2DK5 A;  1GHC A;  2HKX A;  4WXD A;  2HGC A;  4OIQ F;  3VEP A;  2GZW A;  4XLN F;  1IW7 F;  1ZGJ A;  3WOD F;  2LDU A;  2CGP A;  5L3C A;  4R8H A;  3ERE D;  1HBX G;  1S3J A;  4M6Y A;  2VXZ A;  3JW4 A;  1P4W A;  1FWZ A;  5KVR A;  3SZP A;  5H20 A;  1HXD A;  3F21 A;  2B0L A;  3ZP5 A;  5D4R A;  4EVI A;  2LSO A;  4ESF A;  1SD5 A;  1FSH A;  3F6V A;  2L01 A;  3ELK A;  4ZH4 F;  4KN4 X;  1AWC A;  2Y48 A;  3F6O A;  4RGX A;  4G7O F;  3GW2 A;  1BJA A;  2Z33 A;  3GYH X;  4F7Z A;  2LF8 A;  2HWV A;  3RYR A;  3C1D A;  4ZZD A;  3HSR A;  3PQJ A;  3K1N A;  4PGH A;  4OIR F;  5DEQ A;  2PEX A;  1YO5 C;  1SFU A;  1EH7 A;  3ZMU A;  2DI3 A;  4HF0 A;  4D0P A;  1I6X A;  3DXJ F;  1BOA A;  4HX7 A;  4KYW A;  3H3Z A;  4IHS A;  1B9M A;  1O7F A;  3ZN0 A;  5J8C A;  1HKQ A;  3O6B B;  3U1D A;  1REP C;  3J7A O;  3LAJ A;  5J6X A;  2H6C A;  5BS6 A;  3M8F A;  5H6Q A;  3E5X A;  2G9W A;  2V9V A;  2XAG A;  3BP8 A;  3JSP A;  1LDK B;  1LEA A;  1TBX A;  5CLS A;  2FNP A;  2NS0 A;  3QOP A;  2DBB A;  2FML A;  2IJL A;  2VOD A;  1MJB A;  5J8F A;  2VE8 A;  1IN6 A;  1YYV A;  2IA1 A;  4G8X A;  4HF1 A;  4Z2Y A;  2D45 A;  1DUX C;  4EM1 A;  3P9C A;  1UFM A;  2RNJ A;  3WTW C;  2Y0M A;  3BY6 A;  1W7P A;  4IRH A;  5D5U B;  3ZMT A;  1SD4 A;  2PMH A;  3T8R A;  5HDK A;  2P8T A;  4CIC A;  1XGN A;  3HHH A;  5A2Q K;  5BQT A;  2RGV A;  1ZAO A;  3CDH A;  3HTU A;  2EV5 A;  2NAZ A;  2VBW A;  3VOE A;  2CSO A;  4MTE A;  5CVV A;  1STZ A;  2PLY A;  2Z5U A;  3IHU A;  3V4G A;  1FYK A;  4EV0 A;  3ABU A;  1T98 A;  1P92 A;  3L00 A;  1TQM A;  2K02 A;  1P2F A;  3EYI A;  5DD8 A;  3P9I A;  1LDJ A;  1OMI A;  4OIP F;  1FP1 D;  5LHH A;  2EB7 A;  4HLX A;  3T0Y A;  1FOK A;  3HOS A;  1S29 A;  2XRN A;  1J2X A;  1BC7 C;  3HRU A;  5HDN A;  4MEY F;  2ZBK A;  3RKX A;  1ODD A;  3GFL A;  1JGS A;  1XCB A;  3HYI A;  4QLC U;  4LK0 F;  1B1B A;  2PMU A;  2WWY A;  3I4P A;  4ENM A;  1BIA A;  4ZZL A;  1LB2 A;  1D8J A;  2RV8 A;  3KFW X;  4XSZ F;  2XIG A;  3HTS B;  3V7C A;  4I09 A;  2H27 A;  1D5V A;  4KUM A;  3DPL C;  3FWE A;  4HV6 A;  4Q48 A;  3FMR A;  4I0B A;  2DQR A;  2NRA C;  2WTE A;  4G6D A;  2ADU A;  3CUQ A;  3WU1 B;  4RB2 C;  1IRF A;  2HQR A;  1GXP A;  1IAW A;  1BI2 A;  3V8J A;  2P6T A;  1R23 A;  4HLY A;  1UHM A;  4O6J A;  3H3U A;  5ILV A;  4KIF A;  2HDC A;  4CGZ A;  4HDV A;  3E97 A;  1W7P B;  3BJA A;  3I71 A;  1TQI A;  5EEG A;  2PI0 A;  2EJR A;  2ZNZ A;  3NRV A;  3R0J A;  2FXA A;  2L3D A;  2KRF A;  1ZRD A;  3J81 Z;  4LLG F;  3ECO A;  1J75 A;  1R5G A;  1B9N A;  1KA8 A;  2VE9 A;  4GCV A;  3RPU A;  3WE2 A;  4WX9 A;  2J5O A;  2PBI A;  4BQA A;  3HRS A;  1G4D A;  5LHI A;  2DPD A;  4DQ2 A;  1FBQ A;  2FA5 A;  2P6S A;  3DQV C;  1U5T A;  1J7K A;  1G3S A;  4S04 A;  5DCM A;  1V3F A;  5LGN A;  1FY7 A;  2VBZ A;  3CO6 C;  4ENK A;  2COM A;  2G7H A;  1IXS B;  1F4K A;  1OYI A;  5D5V B;  1RNL A;  2QQ9 A;  3HOT A;  2P7V B;  4ZYH A;  3HSF A;  5FB2 A;  3WTS C;  5DCM B;  2E7X A;  1PP7 U;  4A6D A;  2OQR A;  1FP2 A;  2JPB A;  4I01 A;  2EK5 A;  5HS7 A;  1ZHF A;  3Q9S A;  3VB2 A;  1T2K A;  2BBY A;  2V1X A;  3K1P A;  4YG2 F;  4P96 A;  2ZO4 A;  2YU3 A;  3IC7 A;  1FNN A;  1LJ9 A;  5AIQ A;  2ZNY A;  3WGI A;  1O7L A;  3NEU A;  1F1Z A;  2CYY A;  1LVA A;  1Y0U A;  5LEJ A;  4G9Y A;  3RI4 A;  1YW7 A;  2HZT A;  3ABT A;  3SZT A;  2STW A;  2VC0 A;  2Q0O A;  2ZME A;  3BOQ A;  2DPU A;  3CJN A;  5E1W A;  1SFE A;  4EM2 A;  3KP5 A;  1QPM A;  1W5T A;  5AIP A;  1I27 A;  3ZMS A;  2FMY A;  3MZY A;  3R61 A;  1O3T A;  3FF5 A;  4Y15 A;  2FQ3 A;  3BRO A;  4HX4 A;  3WE3 A;  4RGS A;  2R7F A;  5K5R A;  3FMQ A;  2HR3 A;  2STT A;  2F5C A;  2AS5 F;  2E1C A;  4IHT A;  1FC3 A;  2PG4 A;  1Z9C A;  1FZP B;  2AXL A;  4JK1 X;  2Z9O A;  2W24 A;  5LGT A;  1MJA A;  2QQB A;  1IXR C;  2VBY A;  1R22 A;  3WTV C;  4UUV A;  3MWM A;  3E6D A;  4U7B A;  4CYD A;  4EGZ A;  1XB4 A;  3L9F A;  5FFZ A;  3JAM K;  3C3W A;  3RIR A;  4E70 A;  2O6G E;  2K7L A;  2X0L A;  2XKO A;  1WI9 A;  4CHU A;  5D6F A;  4UV9 A;  3ISP A;  1Q1H A;  5E20 A;  2VN2 A;  5ILS A;  3IRR A;  4PZJ A;  1HKT A;  3EET A;  5CVI A;  3PFI A;  1Z7U A;  3SQN A;  2M5W A;  1KQ8 A;  1BIB A;  1RZ4 A;  4M9S A;  2X4H A;  1IN5 A;  1T39 A;  2RVC A;  1RUN A;  3IWZ A;  2P5V A;  4OIN F;  4B8X A;  1G3W A;  1U5T B;  4XSX F;  5D5W B;  2OQG A;  3E5Q A;  2C6Y A;  4LK1 F;  2QVO A;  3M9A A;  2EFN A;  3WU0 A;  2DAO A;  3MAJ A;  3KP3 A;  4CDG A;  4ENJ A;  2M30 A;  2P7C B;  3O2P E;  3JSO A;  1DPU A;  5L3B A;  1U3E M;  4GYI A;  3HSE A;  3DFG A;  1NHA A;  4LB6 B;  3FXU A;  4L9V A;  1HST A;  4L9N A;  5DDG A;  2VBX A;  2HTS A;  3GFI A;  4A0Y A;  1ZRE A;  4WF2 A;  2F5F A;  5ILU A;  2GQQ A;  3J80 Z;  1KYW A;  3KLN A;  2IT0 A;  3E3V A;  5E8G A;  2O03 A;  1RUO A;  3HHG A;  4GGG A;  1IRG A;  1U78 A;  2O0Y A;  4LFU A;  4IVN A;  3QPT A;  1P4A A;  4MNU A;  4Y13 A;  4ENN A;  5ICG A;  1XGM A;  4IPA A;  4Q5S F;  3QAH A;  3KP7 A;  1O3Q A;  4RGR A;  1JHH A;  1ZG3 A;  2PJP A;  1BM9 A;  2CFX A;  4MTD A;  1K79 A;  2UXX A;  2XVC A;  1G3T A;  3J80 K;  2WC2 A;  3U9G A;  4EJO A;  3TOA A;  3AAF A;  1W4M A;  2OBP A;  1Z6T A;  3TKY A;  2LF7 A;  1UCR A;  1WQ2 A;  3MQ0 A;  3GO5 A;  4RB0 A;  2PQ8 A;  3D0S A;  1KU3 A;  3MZH A;  2J5P A;  3LA3 A;  4BNC A;  4K2E A;  2TDX A;  5IT9 Z;  1IN4 A;  2VT2 A;  1T0F A;  2XAH A;  5K1Y A;  4I7H A;  3MCZ A;  1P6R A;  2GXG A;  1J9I A;  3I5U A;  1EH6 A;  2A3S A;  3ULQ B;  4HQM A;  3GEZ A;  3OOP A;  4FX0 A;  2L4A A;  4IJA A;  4I98 B;  3TQN A;  4WWC A;  1BI1 A;  1X3U A;  5ED4 A;  3SHF A;  3E6B A;  3QU3 A;  3B73 A;  4RGU A;  1RI7 A;  1R7J A;  1QO0 D;  3RKW A;  2ZXJ A;  5AON A;  4EJW A;  1SMT A;  3OV8 A;  2YR2 A;  3BZ6 A;  3K69 A;  4EJT A;  3KE2 A;  1ZYR F;  2K4B A;  1MDM B;  4OU0 A;  1XDS A;  4NB5 A;  2KJB A;  3BDD A;  5LHG A;  3LWF A;  3P7N A;  3LA7 A;  3R60 A;  1IF1 A;  4L9T A;  2FEZ A;  1KGS A;  3ECH A;  1L3L A;  3KEQ A;  5DUI A;  2ZKZ A;  2P4W A;  3QU6 A;  1PDN C;  1U2W A;  1TW3 A;  4ZYG A;  1YG2 A;  5FD6 A;  3GFM A;  1TNT A;  4KFC A;  1LQ1 A;  4UVB A;  1HKS A;  5JHU A;  3Q5F A;  4R1H A;  4YFX F;  4B09 A;  5DCF A;  5E1Z B;  3I0T A;  1O57 A;  4AVP A;  4KMF A;  3TOB A;  4L9J A;  5L3E A;  3GLX A;  3FMS A;  1F9N A;  3CO7 C;  5EEH A;  1I1S A;  5LLQ A;  2IRF G;  2F5E A;  3V8K A;  1SFX A;  2CWE A;  1U8R A;  4HOB A;  2EA2 A;  2DU9 A;  3GF2 A;  1YTY A;  1TTY A;  1IXC A;  5HS9 A;  2V1D A;  5E17 F;  4MQ9 F;  5FO5 A;  2XAQ A;  2IW5 A;  2DW4 A;  2EV0 A;  4N9I A;  3EDP A;  3BPX A;  1FLI A;  2KIM A;  1KU7 A;  2P5L C;  1BI0 A;  4OMZ A;  2A61 A;  4RB1 A;  2D1H A;  2QEN A;  5DD4 A;  1MGT A;  2EWN A;  2WV0 A;  3T8T A;  3JTH A;  5ICC A;  2HS5 A;  3F8M A;  2BV6 A;  3CUO A;  4AWX B;  3VOD A;  1HQC A;  4HYE A;  1V4R A;  3V7R A;  5JVT A;  3GZ6 A;  2Y75 A;  2KJC A;  4LLL A;  1B4A A;  2XAS A;  2UWM A;  5CVJ A;  2A07 F;  3VFZ A;  2XRO A;  1R1U A;  5CYV A;  2DQL A;  2OD5 A;  4MHG A;  2XHK A;  1WRJ A;  2JPC A;  4I02 A;  5HOO A;  2ESH A;  2IA0 A;  1SD6 A;  4O3M A;  2XV4 S;  1UHW A;  2FOK A;  3N97 A;  5HDG A;  2VOO A;  1J0R A;  1WSU A;  1K78 A;  2Z3Y A;  3F8N A;  4WCG A;  1Z1D A;  5D8K B;  1K7A A;  1XMK A;  2EV6 A;  1AOY A;  2CG4 A;  5F1R A;  2JT1 A;  4HV5 A;  4FT8 A;  4LJZ F;  3ZMZ A;  3G73 A;  2L54 A;  3K9T A;  4P5O A;  1XSD A;  1TW2 A;  2V79 A;  3T1B A;  3RYP A;  1E17 A;  3R4K A;  1DP7 P;  5FLX Z;  5JR3 A;  2H6B A;  5CVR A;  2FE3 A;  5E8I A;  2A6H F;  5DYM A;  5CJ9 A;  2ZFW A;  4EJV A;  2ELH A;  1EV7 A;  2RN7 A;  2G7U A;  1OYY A;  5HLG A;  2ZME B;  4NQW A;  1XGO A;  5JFR A;  3SXY A;  3F8B A;  2XUB A;  4LLN A;  4A5N A;  3K2Z A;  3FM3 A;  3RJP A;  5BPD A;  3KP6 A;  3DEU A;  1H9T A;  2MD5 A;  2M45 A;  4O5V A;  3EUH A;  1YW8 A;  2CW0 F;  5L3F A;  3HUG A;  2R7D A;  2BGC A;  1FSE A;  1UST A;  2OAZ A;  4OIO F;  4KN7 X;  4LG0 A;  4BXU A;  3QRF F;  1XMA A;  3RPQ A;  3KET A;  2QBY B;  3O3K A;  5FD5 A;  4EGY A;  2M8E A;  1Z91 A;  5CVU A;  4OMY A;  1YQA A;  3JTG A;  3J81 K;  4AIH A;  2HEO A;  3E5U A;  1LNW A;  5K5O A;  2GAU A;  3GUD A;  3MEX A;  5KK1 A;  3ROU A;  1ZRC A;  4EQQ A;  3S2W A;  1QZY A;  2K27 A;  2YPR A;  2LKP A;  3LST A;  4L5I A;  1QQI A;  3N4M A;  3L09 A;  4L0Z B;  3I59 B;  1YIO A;  1L0O C;  2BYV E;  1USS A;  1XN7 A;  3DF8 A;  2UXN A;  2V1U A;  4CXF A;  1MD0 A;  1HW1 A;  5LRR A;  4LB5 A;  4XBF A;  4RS8 A;  4BAY A;  2ACJ A;  2MA3 A;  2E1N A;  3LQQ A;  1R5H A;  4BYY A;  3WG9 A;  3FXR A;  1EH8 A;  2EFO A;  2QM3 A;  1ZG1 A;  4I2O A;  4EMS A;  3KP2 A;  2IP2 A;  4NHJ A;  4LD5 A;  3WTZ A;  3R0A A;  3GXO A;  3TDU C;  2K86 A;  3SFZ A;  1I5Z A;  4M73 A;  2GWR A;  1I1G A;  3W6J B;  2FU4 A;  4HX8 A;  5D8L B;  1H9G A;  1XSV A;  6PAX A;  2EFQ A;  4LGW A;  3V8L A;  1OR7 A;  1ZG5 A;  1J5Y A;  2MLG A;  1S7A A;  3FM5 A;  5FFX A;  5F64 A;  3E6C C;  1SAX A;  1JHF A;  5D5X B;  1FX7 A;  3EQL F;  2JZY A;  1Z6R A;  3NQO A;  4JBA A;  1FYM A;  2JSC A;  4ESJ A;  2QLZ A;  1YLF A;  3F23 A;  1KYZ A;  3IRQ A;  3V7S A;  4L0Y B;  4L18 B;  4ESB A;  3I53 A;  4M6X A;  2XAF A;  1ONV A;  5D6E A;  5IT9 K;  4UXN A;  4TV7 A;  2EFW A;  4UVC A;  3ZQ7 A;  3C18 A;  3IKV A;  1SMY F;  3CLO A;  4IRG A;  1IN7 A;  4A6E A;  3B02 A;  3DP7 A;  1G6N A;  4A5M A;  1ZLJ A;  1FYL A;  3TO9 A;  1UB9 A;  3WTX C;  4HA8 A;  2QBY A;  1TQP A;  4N0B A;  2ISY A;  2ESN A;  4ON0 A;  2XKP A;  5E1X A;  2O61 A;  3FX3 A;  3H92 A;  4UV8 A;  3PQK A;  3G3Z A;  2NNN A;  1OYW A;  2GXB A;  4QWQ A;  2CO5 A;  3WGH A;  4YFN F;  3GX4 X;  2OZ6 A;  1BC8 C;  3HRM A;  5DV5 A;  3M8E A;  2OU2 A;  3L2C A;  4IXA A;  2A5Y B;  4KNY A;  4XRF A;  1MJ9 A;  1PUE E;  4BHC A;  4HQE A;  3GVA A;  3M1E A;  3K0L A;  3TDZ C;  1MZB A;  3ZMD A;  3QPH A;  3T5X A;  3C7J A;  4G7H F;  2YX4 A;  3IL2 A;  2HQN A;  1D3Y A;  2W85 A;  2FBH A;  1GXQ A;  4EJU A;  1W7P D;  2QYO A;  1KU2 A;  1LDD A;  3BPV A;  1FBS A;  1IUY A;  1S7O A;  2DTR A;  1R1T A;  2M87 A;  3LAP A;  1XD7 A;  4A12 A;  2CQK A;  1KQ9 A;  5BMZ A;  4YIF A;  3KZZ A;  4AIK A;  5TRD A;  4G6Q A;  1BI3 A;  1QZZ A;  1BBY A;  3TGN A;  3REO A;  3QP6 A;  1O3R A;  1ZRF A;  3I58 A;  1HW5 A;  2HYG D;  3HIF A;  2VT3 A;  5LRS A;  1XSX A;  1IZ1 A;  4WXC A;  4P55 A;  1KU9 A;  2O8X A;  3WTU C;  4I0A A;  4GXO A;  1FT9 A;  1OPC A;  2Q2E A;  3FZV A;  2RDP A;  3KCC A;  1R00 A;  3WTT C;  3IKT A;  5JI6 A;  2VOP A;  2ZJ2 A;  2EA4 A;  5BPI A;  4IRI A;  2H09 A;  1HW2 A;  2A68 F;  1JXS A;  4U0W A;  4H0E A;  1WKM A;  3W6K B;  1ZAR A;  4M71 A;  2XGX A;  5ICE A;  5K5Q A;  2H94 A;  5LEK A;  4HBL A;  1SD7 A;  3GZ5 A;  2ETH A;  1BN5 A;  4PCQ A;  3F8C A;  2OA4 A;  1W5S A;  4GO1 A;  4HDU A;  2HKO A;  1XGS A;  4CO8 A;  4PDK A;  3MFK A;  2W84 A;  4WXH A;  5L3G A;  1CGP A;  2HYF A;  1P4X A;  1K78 B;  2NNY A;  1OKR A;  4JQF A;  3CTA A;  4G7Z F;  3WTY C;  4Y17 A;  1G3Y A;  1XCV A;  4KA4 A;  4FHT A;  4ETS A;  3F3X A;  5BOX A;  5D4S A;  2DK8 A;  3TO6 A;  4P9U A;  3ML6 A;  4UHT A;  4S05 A;  1WWX A;  1R1V A;  2BEO A;  2GIV A;  2A6E F;  1C0W A;  3K1M A;  5E18 F;  2V6C A;  2MC3 A;  4DNC A;  3L7W A;  2DT5 A;  4U7D A;  4ZYD A;  1FBU A;  3F72 A;  3BJ6 A;  3I59 A;  4Q4Z F;  1ZN2 A;  4U88 A;  5LGU A;  2W57 A;  2HTJ A;  3P9K A;  3RDI A;  3WGG A;  5ICF A;  2PN6 A;  1VTN C;  1S8N A;  4OOI A;  3GWZ A;  2ZCW A;  2K4J A;  2BE5 F;  1MKM A;  4MGR A;  1J59 A;  4ZYE A;  2EFP A;  2QUF A;  3LFK A;  4BH9 A;  2YSR A;  2PFB A;  2RC4 A;  5HLI A;  2GA2 A;  1KQ0 A;  1CF7 A;  2FBI A;  2NYX A;  2Q8K A;  4YFK F;  1ZLK A;  1MDM A;  3I64 A;  2L02 A;  4WK8 F;  4HZF A;  4UVA A;  3LA2 A;  5ERI A;  2IVM A;  1A04 A;  2LNB A;  2FRH A;  3DKW A;  5H6R A;  1DDN A;  2DO7 A;  4U0V A;  2A69 F;  2XAJ A;  1U6G A;  1HSJ A;  1CF7 B;  2IPQ X;  1ON2 A;  3IWF A;  4AD9 A;  3LQR A;  3ZN1 A;  2QZ8 A;  4M74 A;  1E2X A;  3CUQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...