4MQVA

Crystal complex of rpa32c and smarcal1 n-terminus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
GLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Replication protein A 32 kDa subunit
publication title Structure of RPA32 bound to the N-terminus of SMARCAL1 redefines the binding interface between RPA32 and its interacting proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 65
sequence length 65
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4mqvA00
2G7UA 3I64A 2OQRA 4JQFA 1FYMA 3FWEA 4A6EA 4G7OF 4HBLA 3SQNA 1YFHA 2LNBA 2XAHA 2KIFA 3H92A 3F21A 1LEAA 5DYMA 2HFHA 3L00A 3J80K 2PBIA 1U78A 3WGGA 1B6AA 1OYYA 1KGSA 1FNNA 4CICA 2DBBA 2JZYA 1T38A 2W84A 1HW1A 2XKPA 5ICCA 2FRHA 2RQPA 5L3EA 3WGHA 1ZYRF 2L54A 1R36A 2MBFA 2STWA 1SD4A 5F6FA 3O2PE 1XSXA 3LA2A 1XGOA 2M30A 1XMKA 3R60A 1I1GA 2YSRA 3I5UA 5DCMB 3V7SA 2UWMA 2IJLA 2YU3A 2M87A 1IZ1A 2FXAA 4LK1F 4M6YA 2L01A 3ZMTA 4N0BA 4U88A 2Q2EA 3I71A 3SZTA 1BI2A 4LK0F 1T0FA 3GFMA 2MLKA 3HOSA 2ZO4A 5HS8A 4GYGA 4M71A 1ZGJA 3C1DA 1IN4A 4MEXF 4L0YB 4MNUA 1F9NA 4ENNA 5CVIA 5LEKA 1I6XA 4JBAA 3WTTC 1YQAA 4XLNF 2K86A 1SMTA 4KT5C 4CDGA 3HTSB 1ZRCA 3T5XA 2P7VB 2P4WA 5BPDA 4UVCA 4P96A 5EEGA 3M8FA 5LRRA 5E1ZB 3CUQB 3KFWX 1REPC 2NYXA 3F8NA 4G6QA 1YW9A 1FBUA 3AAFA 4MQVA 3BPXA 2EJRA 1MJAA 2RC4A 3VFZA 1U8RA 3L09A 1TQPA 2DQLA 2GWRA 5LRSA 1HSJA 5H6QA 2XROA 5LGTA 3T8TA 4BYYA 1ZG1A 2KKOA 2CW0F 2IT0A 2FBHA 3G3ZA 4G8XA 3GXOA 2V1XA 5FB2A 4BNCA 4CYDA 4KNYA 1YYVA 2BGCA 5DV5A 3RKYA 4A5MA 1HKSA 2HWVA 4HX7A 2O6GE 5DDGA 1W7PA 1ZHFA 2QQAA 4EM0B 2A3SA 2Y48A 4G6DA 4GXOA 1WSUA 3ELKA 3GFIA 3MCZA 2VBYA 1P4AA 2IRFG 2IA1A 2YR2A 2FSWA 2B0LA 1D3YA 3RKWA 1FP2A 3KZZA 5LHHA 4ESFA 1FT9A 5A2QK 4P9UA 3DKWA 5KK1A 4Q47A 1H0MA 3F8BA 2ESNA 1QZZA 4IHSA 2ZXJA 2PI0A 2XHKA 1BIAA 4L9NA 5E17F 5ICFA 1T98A 3E6DA 3W6KB 1XB4A 2BEOA 2DK5A 4XSXF 4K2EA 5D4RA 1R1TA 4GO1A 5HS9A 2HTJA 5J6XA 3ZMUA 3LAJA 1QQIA 3VB2A 1TLHB 3DV8A 5KVRA 2ZBKA 1WRJA 2O3FA 4HF2A 2DQRA 1BC7C 2FE3A 3JAMZ 2LF7A 4RGSA 3KCCA 3C3WA 4EV0A 4HX4A 2VE9A 4LD5A 3QP5A 2ZJ2A 1UCRA 3GZ5A 5DUKA 5FFXA 4R1HA 3R0AA 4N9HA 3E97A 3W6JB 3I58A 3K1NA 3KP3A 2P5VA 3FZVA 3V4GA 1RNLA 1FP1D 4FHTA 2ZNZA 3WG9A 2KIUA 3QRFF 1QGPA 2FBIA 2RDPA 1G3SA 4KDPA 2OA4A 1MKMA 4LJZF 2CO5A 5FD5A 4O3MA 2R7DA 3ZN1A 5AONA 2NNYA 2XV4S 4I2OA 4S05A 1QBJA 3WU0A 2H09A 4EQQA 1WI9A 4G94A 1LDJA 1FWZA 2P5KA 2EWNA 4I0AA 4UHTA 5D5XB 5CVUA 2A69F 3EQLF 4I0BA 3K1MA 4ZYGA 1J7KA 5LHIA 1OKRA 4YFXF 5TRDA 1T2KA 1LNWA 1KA8A 3O6BB 1KU9A 1FC3A 2VBZA 1ZAOA 2QQ9A 3IRQA 2DK8A 2WV0A 2HYFA 4L5JA 3V7CA 4I98B 4WF2A 1HBXG 1IXSB 2JPCA 5DCFA 2XRNA 4I09A 1Z9CA 1RUNA 2HS5A 2R7FA 2ZKZA 5LLQA 1A04A 2Z9OA 2EFQA 4IVNA 1TBXA 1K6OA 5K5OA 5HDGA 2NS0A 1SFXA 3KLOA 2K4JA 2IA0A 1CF7A 5IT9K 3FMRA 4GCVA 4OMYA 4IPAA 3LQRA 3F22A 4O6JA 3K2ZA 5FLXZ 2F5DA 1U5TB 3J81Z 3TO9A 4NB5A 1YS6A 1BM9A 3O3KA 4QLCU 4HW0A 1IW7F 3CDHA 2RVCA 4P5OA 5HLHA 1IRFA 2IA2A 4HV6A 3Q5FA 1ZGAA 1ZRDA 1W7PD 3TOBA 1O7FA 3FMSA 3RKXA 2ZMEB 3SXYA 2HYGD 3U1DA 2XVCA 3PQJA 4OIRF 4M73A 4EVIA 4ZH4F 3RI4A 2HZTA 1R00A 2Z99A 2O8XA 2OD5A 3E5XA 5FGMA 2DU9A 1LVAA 1RIOH 3E6BA 1T6SA 3JTGA 5ERIA 1BC8C 3HYIA 3C18A 3S2WA 5FO5A 4LG0B 4OIOF 4L9TA 1LJ9A 2XAQA 5L3GA 3ZMSA 2GQQA 3FXUA 4OOIA 4DQ2A 2EA4A 1YO5C 3TGNA 2DW4A 2AXLA 1QZYA 4S04A 3HRSA 4HF1A 3H3ZA 3N4MA 3ZP5A 1YLFA 4BHCA 4OMZA 3I59B 3DP7A 2D45A 4RAZA 2MH2A 2Q8KA 4Q5SF 2H6BA 3DEUA 2CGPA 2R3SA 1YTYA 1ODDA 4FX0A 4LB5A 3FX3A 2O61A 2OQGA 3D5LA 4L5IA 2HEOA 4ASNA 1KQ9A 1C0WA 4HV5A 3HOTA 1FSEA 3IL2A 5ILVA 2JRTA 2YPRA 3HIFA 1XSDA 2L3DA 1YS7A 5K5RA 3KP7A 3CO7C 3L9FA 5E8GA 4CXFA 2IW5A 2EA2A 5FFZA 2D1VA 2QWWA 5E8IA 3CLOA 3LQQA 2UXXA 3TQNA 4XBFA 3F23A 3M8EA 1FPQA 5L3DA 2EV6A 2RKHA 3E6MA 1FBSA 2WWYA 2XASA 4LB6B 5TJJA 3CTAA 5E20A 2E1CA 1KU2A 2QQBA 4JK1X 2Y75A 4RB3C 3HTUA 2K7LA 1YG2A 3BP8A 2BV6A 4WWCA 2UZKA 2VT2A 2MLGA 4WXHA 3P9IA 1O57A 5D4SA 3TO6A 1KU7A 1TTYA 1ON2A 1Z6RA 3T1BA 2XKOA 1STZA 3I0TA 1UHWA 2DAOA 3ULQB 3DF8A 3VODA 4G9YA 5K5QA 3I4PA 3R0JA 3K69A 4RGXA 1HW5A 4ESBA 2COMA 4ZYHA 5J8FA 1D8KA 1PDNC 1R58A 4A2UA 2A6EF 2M8EA 2GA2A 2FQ3A 1O3QA 3GWZA 1Z7UA 4DNCA 1ZG5A 3IKVA 3SHFA 3QPHA 4R8HA 2RV8A 4HA8A 1EH7A 3RDIA 3RIRA 2QENA 3HHGA 2EFPA 2A6HF 4D0PA 2M1BA 4RB1A 3DPLC 1BI1A 1FBQA 1TQIA 3LAPA 4OINF 1XGMA 2JSCA 3NRVA 3BJAA 4RB2C 2M45A 4L0ZB 3GZ6A 2F5FA 4RGRA 2Z33A 3K1PA 1W5TA 5HOOA 4P9FA 3E5UA 4PGGA 1MGTA 5BOXA 1ZLKA 3CJNA 3ZPLA 3P9CA 3EETA 1TW3A 3SFZA 3QAHA 3WTWC 1O3TA 3FHZA 3GF2A 2E1NA 1W7PB 2PJPA 4I01A 3DXJF 5DEQA 1IN8A 3GEZA 4LFUA 4HLXA 1WKMA 3M9AA 2X4HA 1IF1A 1B59A 4UUVA 2HQRA 1IAWA 4P55A 3SZPA 3EYYA 1ZARA 3EUHA 2NAZA 3RTRA 2YX4A 4PGHA 4WCGA 2LDUA 2Y0MA 2P6SA 2RGVA 2UXNA 3QP6A 1F5TA 5CJ9A 4UVBA 3C7JA 2KIMA 4CO8A 3OV8A 3I53A 5CLSA 1H9TA 3VEPA 3M1EA 2P6TA 3L2CA 4Y13A 3HSRA 4LLLA 3ROUA 2PEXA 1SFUA 2YX7A 3RYPA 4IHTA 4CZZA 1E2XA 3KEQA 4EGZA 1OYWA 1RI7A 2KJCA 2ZFWA 1USTA 1P92A 3Q9SA 2VONA 2NNNA 1HW2A 1G3WA 1S3JA 1BI3A 2VOOA 4FX4A 3FXQA 4IXAA 1GXPA 4WXDA 4XSZF 2LSOA 2VC0A 1UFMA 3GUDA 3N97A 1XCVA 3DQVC 4U0WA 2TDXA 3QU3A 4L9VA 2PG4A 3LA7A 3KEOA 5CVVA 2HQNA 2PFBA 4MHGA 1J75A 3ECOA 4Q48A 3R6SA 3JAMK 1G4DA 1KU3A 2W24A 2RN7A 3JSOA 2A68F 1S8NA 6PAXA 4UV8A 5HDKA 3IHUA 1BJAA 5JHUA 3F6VA 1MDMA 2O0YA 2QZ8A 1X3UA 5CVJA 2FBKA 4KN7X 2A61A 4HQMA 2VOPA 2L02A 2V1UA 2V9VA 1TQMA 5HLGA 2J5OA 4M74A 3HSFA 4EMSA 4B8XA 3HRMA 2GXGA 2F5CA 1IRGA 1SD7A 1XCBA 1G3TA 4HF0A 3D0SA 5L3CA 5H20A 4HAMA 4UV9A 3FM3A 4BH9A 1XMAA 2H27A 4AWXB 4Q4ZF 4ENJA 1V4RA 4ZYEA 5ICGA 4N9IA 2X0LA 1HKTA 1SD6A 5LBQA 4EJTA 1HKQA 1QO0D 2O03A 2XUBA 3F6OA 3P7NA 2EV5A 4L18B 1CF7B 5JI6A 5ILUA 1H9GA 4QWQA 2LF8A 2ISZA 3ABUA 4NHJA 3NEUA 5JFRA 1Z1DA 2P8TA 4AIJA 2IPQX 2ADUA 4LMYA 1JGSA 4KMUX 1ZREA 4HYEA 2IP2A 1F4KA 4ESJA 2PMUA 1GHCA 4RB0A 1O3RA 5K1YA 1UHMA 3KZYA 5AIPA 4IRGA 3FXRA 3LA3A 3KP2A 5HLIA 3T8RA 2MC3A 3WTUC 5FLXK 1U5TA 3T0YA 1S6LA 2Z5UA 2ELHA 2VBXA 3BDDA 1XDSA 1XSVA 3ABTA 3B73A 2QBYA 2D2WA 1L0OC 4HQEA 5CVRA 1AWCA 1BN5A 4RGUA 5LGNA 1FX7A 4PZJA 3E3VA 3WTXC 5D5WB 3HHHA 2XGXA 4AIHA 3BPVA 4YIFA 4A0YA 5L3BA 1LDKB 4HDUA 1P4XA 2V1DA 1J5YA 4M6XA 3WE2A 4EGYA 2OU2A 2J5PA 3F72A 3EDPA 1G6NA 5DD8A 3KP5A 1IXRC 1JHFA 2IVMA 3ZN0A 5D8KB 4F7ZA 2KRFA 3JW4A 3QPTA 1K78A 1Z6TA 4ZZDA 2DO7A 2K27A 4EM2A 4R79A 1U3EM 2PN6A 1SAXA 5J8CA 1P4WA 3ECHA 2FF4A 3OOPA 3PFIA 1QNTA 5D6EA 5JVTA 2QVOA 1IN5A 4KIFA 4Y15A 2K4BA 4U7DA 3KE2A 4WXCA 2EFOA 2JTVA 1NHAA 1FOKA 2CYYA 2RNJA 1ZRFA 1MD0A 4I02A 4CHUA 1VTNC 3CUOA 1V3FA 3RJPA 2L4MA 1W4MA 3REOA 2ISYA 2CSOA 4A0XA 2DPUA 1USSA 4G7ZF 3J80Z 4IRIA 1G3YA 4KA4A 2A07F 2VC1A 4A12A 5LGUA 2GZWA 2VXZA 1CGPA 1DPUA 3LFKA 1O3SA 3DFGA 1YW7A 5LHGA 2C6YA 5ICEA 5E1XA 1XGNA 3P9KA 1FLIA 2QM3A 1JHHA 1HQCA 2Z3YA 1JE8A 2OZ6A 3DPTA 4HLYA 1XN7A 1U2WA 5AIQA 3IC7A 3KLNA 3JTHA 4IRHA 5CYVA 1J9IA 3KP4A 1U5TC 4E70A 5H6RA 1P6RA 4EJOA 1XGSA 2XAJA 5DD4A 3E6CC 2DT5A 2HGCA 3RYRA 5F64A 3TDUC 4ZZLA 1TW2A 2OBPA 2BYVE 1RUOA 3K9TA 3WGIA 2WC2A 2G7HA 2VE8A 3MZYA 3L7WA 1FY7A 3TKYA 5DUIA 5EEHA 1I5ZA 2MD5A 1OR7A 1Y0UA 3E5QA 3RPUA 4WX9A 4OIQF 3NQOA 2K02A 5DCMA 1GVJA 5ED4A 2CG4A 2FMYA 3QU6A 3ZMVA 1ZH5A 4EM1A 1EH8A 3MEXA 1PUEE 4PDKA 3VOEA 4PCQA 2V6CA 4KICA 3GO5A 4KMFA 1F1ZA 5BPIA 4UNOA 2GXBA 2BBYA 3EYIA 3CO6C 1R5GA 3H3UA 3WTYC 1LQ1A 3V8LA 3WTVC 4HZFA 4IF4A 2CFXA 3Q9VA 2DPDA 3M7GA 1B9MA 1R7JA 4Z2YA 4HX8A 5D5VB 4RS8A 1J0RA 2FA5A 2QUFA 1B1BA 4NQWA 5E18F 4G7HF 2FEZA 1S7AA 3KP6A 2EV0A 4XRFA 3FMQA 1FYKA 3CUQA 3PQKA 1UB9A 3BJ6A 1S29A 2XIGA 4CGZA 4M9ZA 1ZLJA 3WTSC 3BROA 3BZ6A 1XDUA 1OYIA 4BQAA 1I1SA 2QLZA 3GYHX 1Z91A 4KIGA 2HKOA 2OZUA 2ACJA 1RZ4A 1IN7A 4MGRA 4RAYA 1JXSA 3BY6A 3R61A 5HDNA 2M5WA 2HR3A 4AIKA 2VBWA 1MJBA 4LLNA 4WK8F 5A2QZ 1O7LA 1WQ2A 2BE5F 1EH6A 3MZHA 1W5SA 1OMIA 2P5LC 1ON1A 2W85A 2PQ8A 3K0LA 3GFLA 3U2RA 3HSEA 3BWGA 4EJWA 4ON0A 1BBYA 1HSTA 2P7CB 3F8FA 3V7RA 3JSPA 2V79A 3KETA 4HDVA 4EJUA 1LB2A 4Y17A 1J59A 4MTEA 4KIBA 5LEJA 1DPRA 3MWMA 1XD7A 4U0VA 3HUGA 1R1VA 3QOPA 5D6FA 2JT1A 3IWZA 2ESHA 3TDZC 4U7BA 2XAGA 1IUYA 2PMHA 1R22A 4ENKA 2VODA 1HXDA 2E7XA 1J2XA 1I27A 1PP8F 2EK5A 3IKTA 1TNTA 2ETHA 2GAUA 3V8JA 5BS6A 1QPMA 4KYWA 3COAC 4M9SA 1D8JA 3GW2A 2VN2A 2D1HA 3CUQC 3LWFA 4YG2F 3WODF 3ZQ7A 1P2FA 4BHBA 4M72A 2DTRA 4YFKF 2GA1A 1MDMB 5E1WA 3WU1B 2MH9A 4BHPA 3MQ0A 2EFWA 1T39A 1IXCA 2AS5F 2A5YB 4A5NA 1BIBA 1R23A 1WWXA 1L3LA 4GGGA 1FZPB 2L4AA 2EFNA 1K79A 2HOEA 3B02A 3IRRA 4TV7A 4KFCA 1E17A 4XLPF 2W25A 3FM5A 2E7WA 4OU0A 5ILSA 1U6GA 3GLXA 2CQKA 2F5EA 3TOAA 4A6DA 1DDNA 4UXNA 1IN6A 4KUMA 1ZN2A 2EB7A 5L3FA 5IT3A 1SMYF 3WTZA 4A0ZA 1PP7U 4H0EA 4AD9A 3GFJA 1DUXC 4IJAA 1OPCA 5FD6A 3F3XA 3F8MA 1KQ0A 3LSTA 1S7OA 4KN4X 5IT9Z 1EV7A 2WTEA 1ZG3A 2FOKA 1BOAA 2HDCA 3J7AO 2MA3A 3BJOA 4L9JA 2FNAA 1FSHA 4I7HA 1GXQA 4UVAA 3IWFA 4ETSA 1YIOA 3ERED 3GX4X 1KQ8A 4LGWA 3WE3A 5D8LB 2PLYA 1B4AA 4O5VA 1SFEA 1TNSA 5D5UB 4HOBA 3GVAA 2LKPA 2QBYB 1FYLA 2DI3A 3R4KA 4M9XA 4MEYF 1YW8A 4FT8A 2Q0OA 2GIVA 3J81K 2HKXA 2JPBA 4ENMA 3MAJA 1MZBA 3MFKA 1K7AA 3FF5A 2HTSA 1B9NA 3HRUA 2FMLA 5JR3A 2ZNYA 1MJ9A 3RPQA 1KYWA 4BAYA 2ZMEA 1BI0A 1LDDA 2XAFA 1ULYA 2QYOA 3BOQA 3I54A 2DFIA 2FU4A 5BMZA 4GYIA 3V8KA 3F8CA 4AVPA 5BQTA 2G9WA 1Z05A 2KJBA 1K78B 5F1RA 4BXUA 4ZYDA 2CWEA 2H6CA 2NRAC 2W57A 4YFNF 3ZMDA 4LG0A 5HS7A 1DP7P 1ONVA 1R5HA 1KYZA 3HRTA 1AOYA 4EJVA 4B09A 4MTDA 2F2EA 2VT3A 4LLGF 4U0YA 2ZCWA 3U9GA 4MQ9F 3ML6A 1R1UA 2FNPA 3ZMZA 3ISPA 3I59A 1LEBA 2OAZA 2DLLA 1D5VA 4YIIA 3TO7A 1SD5A 2H94A 5HVQC 1Q1HA 3G73A 2STTA 4OIPF
chains in the Genus database with same CATH superfamily
1IUFA 2G7UA 1TWHJ 1M1EB 2DT6A 3I64A 2OQRA 4CH7A 3A02A 1A5JA 2L9VA 2EIMH 4JQFA 1FYMA 4YELA 1S9HA 4E7IA 3FWEA 2ICWG 1MNEA 4A6EA 1IGNA 4G7OF 1FTTA 3VYSB 3A01A 4HBLA 3DU5A 3SQNA 4BGDA 1YFHA 1MNMC 2LNBA 2XAHA 1VQOI 1YX5A 2KIFA 3H92A 5J3LA 3F21A 1P7IA 3QWLA 1W1WE 4ZTJA 1A6QA 1LEAA 5DYMA 2HFHA 3L00A 2R93J 3J80K 3GTJJ 2PBIA 1U78A 5GPAA 2V9KA 3WGGA 1B6AA 1OYYA 1KGSA 5GAEJ 1J09A 1FOXA 1FNNA 4D1QA 1EJ9A 4CICA 2H8RA 2DBBA 4CCNA 2JZYA 2F6CA 3PIOF 1T38A 2R7QA 2W84A 3CMMA 1HW1A 3LFUA 2XKPA 5ICCA 1OCRH 2ELJA 2FRHA 2RQPA 2L9SA 4BQQA 1NK3P 5L3EA 3WGHA 1ZYRF 2K3FA 2L54A 2OCEA 2W7NA 4IHVA 1R36A 2MBFA 2Z2SB 4AUXA 2STWA 2CFOA 1SD4A 3MKYB 1D1CA 5F6FA 1HF0A 3DLAA 4LITA 1HLVA 4DW6A 1S7EA 3O2PE 1TWCJ 1MMDA 1XSXA 3LA2A 4BU2A 2QF7A 1QU3A 1XGOA 4I6ZA 2M30A 1XMKA 3R60A 2ZMEC 4G12A 2F4OB 1I1GA 4V2GA 2YSRA 3I5UA 3FXLA 5DCMB 2W82A 3V7SA 2UWMA 2IJLA 2YU3A 4AIDA 3LSJA 2M87A 4FISA 1IZ1A 3RSNA 5EZGA 1POGA 3SEZA 1GV2A 2FXAA 3MKWB 3K4JA 4XORA 2M7BA 3DBHB 4A3BJ 3GTMJ 5K7ZA 2L2OA 2E19A 4LK1F 4M6YA 2L01A 1N75A 3ZMTA 3FBIB 4N0BA 4PSXA 1B8IA 2MD0A 2Z16A 4U88A 2LFBA 4QSHA 2LC2A 2Q2EA 1WJEA 3I71A 3SZTA 1BI2A 4LK0F 1T0FA 1IRZA 4PJJA 1OJLA 3GFMA 2MLKA 5IP7J 3D1NI 4RM2A 2DT7B 3HOSA 2ZO4A 5HS8A 4GYGA 3SJMA 2VPLA 2N8GA 3CCYA 4XRMA 3G2BA 4M71A 1E0EA 1ZGJA 3C1DA 1IN4A 4MEXF 2WBMA 4L0YB 4MNUA 2Y69H 1F9NA 1OCTC 4ENNA 5CVIA 1JJ6C 1GLNA 5LEKA 1I6XA 3MKZA 4JBAA 1IJWC 3BCAA 3VDXA 5GP9A 3WTTC 1YQAA 3M07A 4XLNF 3F0CA 1F43A 1A36A 2K86A 1SMTA 3BG7A 4KT5C 1Z7LA 4BEHA 2X6OA 3NAUA 3Q0VA 4CDGA 4A93J 1Z67A 3HTSB 1MSEC 2LY9A 4PFPA 3ZQFA 1ZRCA 3BTIA 3CMEI 2GXAA 3T5XA 4CA0A 2P7VB 2P4WA 4HNVA 5E3NA 2EZHA 1RETA 5BPDA 4UVCA 4P96A 5EEGA 1FEXA 3M8FA 3PUFA 1OCOH 2OUMA 5LRRA 5E1ZB 3CUQB 3KFWX 2X6XA 5EG0A 4B44A 1R9TJ 4IOAF 1REPC 2NYXA 1KONA 5LD2C 5K7FA 3F8NA 2HYJA 2L7MP 4G6QA 1R49A 1YW9A 1VFCA 1FIAA 1FBUA 3AAFA 4MQVA 3BPXA 2EJRA 3GTLJ 1MJAA 2RC4A 3VFZA 4V2FA 1U8RA 3L09A 1TQPA 4XOTA 2DQLA 2GWRA 5B1AH 5LRSA 4FCYA 3S3NA 5E3MA 1HSJA 3DTIA 1FIPA 5H6QA 3OSFA 2XROA 2EIKH 2KQRA 1WJFA 5LGTA 3CDIA 2BVMA 4FE7A 3T8TA 4BYYA 2KKOA 1ZG1A 4M3DA 1PUFB 2CW0F 2IT0A 2XPVA 2FBHA 3G3ZA 4G8XA 3HBLA 3GXOA 4D5CA 2A05A 2V1XA 2X85A 2XGEA 5FB2A 3ZQLA 4X1EA 4BNCA 3VYTB 3OIPA 4CYDA 4KNYA 1YYVA 3I4NJ 2BGCA 2VJ5A 3PUBA 3HOVJ 5DV5A 1SC7A 4B3XA 3K4CA 3RKYA 1VQPI 1LE8A 2IS4A 2DFEA 2K9MA 3A1YA 3D5SC 2NVUB 2JVGA 5C4XJ 3DTEA 2DMQA 2HOSA 2XRLA 3FXKA 4A5MA 4HNTA 1HKSA 2HWVA 4PFOA 4HX7A 4N4OB 2O6GE 5DDGA 1W7PA 4X6AJ 4UB8C 1EKEA 2JUGA 1ZHFA 2QQAA 1PYVA 2V1NA 3K2AA 2M34A 4A3CJ 4EM0B 2A3SA 2Y48A 4G6DA 3I56I 4GXOA 1WSUA 3ELKA 3OYNA 3GFIA 3ZQGA 3HOZJ 3MCZA 2VKVA 2EILH 4AC0A 3S1QJ 2QSHX 1WGXA 2VBYA 4DBQA 4A3MJ 1P4AA 2IRFG 1VI0A 2IA1A 2BW3B 2YR2A 2FSWA 2B0LA 1D3YA 1Z3YA 4CCMA 3OYMA 3RKWA 1FP2A 3ASOH 4UY8I 3KZZA 1TT0A 5LHHA 4ESFA 2NOJB 1FT9A 5A2QK 1VQLI 4P9UA 1Y39A 3H0GJ 3DKWA 5KK1A 2R7SA 1X1BA 4Q47A 1H0MA 4BUPA 2JA2A 3F8BA 2ESNA 1JKQC 1DGRM 3S14J 3P5JA 1T0FC 2R5YB 1QZZA 4XNFA 4IHSA 2E71A 2R7TA 2ZXJA 2PI0A 2LBFA 2XHKA 2MSYA 3FKJA 2VASA 2KDZA 2KMUA 2WAFA 1BIAA 4L9NA 5E17F 3M3YJ 5ICFA 1T98A 3E6DA 2L5QA 3C2BA 5KAIC 3GLLA 3W6KB 4BBRJ 1XB4A 2G0EA 2BEOA 2M8GX 1JT6A 4S0HB 2DK5A 4XSXF 3H3VK 4K2EA 5D4RA 1R1TA 3CJRB 4JX4A 3H5RA 2QGUA 4GO1A 1BW6A 1MSFC 5HS9A 2HTJA 5J6XA 3DEEA 3ZMUA 2HOTA 1B72B 3CCEI 2VIXA 3LAJA 2R5ZB 3S32A 1QQIA 4GFBA 1E3PA 3TMOA 3KYCB 3VB2A 1TLHB 3DV8A 2Y9YA 3W2AA 5KVRA 2ZBKA 1DGWY 1WRJA 2O3FA 4HF2A 3MMYB 1ORKA 2DQRA 2HOAA 1YI2I 2JA5J 3H35A 2MABA 2FE3A 1BC7C 3JAMZ 2LF7A 4RGSA 2VLAA 4DGWB 3KCCA 3C3WA 5F08A 4EV0A 1QHGA 4HX4A 1LUJB 4DZJA 2VE9A 4LD5A 1W0UA 3QP5A 2ZJ2A 1UCRA 3GZ5A 5DUKA 5FFXA 4QTRA 1LPQA 4R1HA 1IDZA 3R0AA 4N9HA 4RAGA 3E97A 3W6JB 3I58A 1IC8A 3JRDA 1ZTRA 1LFPA 3K1NA 3KP3A 4CCKA 2P5VA 5GAHJ 2CQNA 3FZVA 1RNLA 1FP1D 2M7AA 3V4GA 4FHTA 3AL0B 2VKDA 2ZNZA 3WG9A 3PNTA 3GTOJ 2KIUA 3FXJA 4EEFG 2W48A 2CS3A 1QGPA 3H5AA 3QRFF 2IS1A 2FBIA 2RDPA 1G3SA 4KDPA 2OA4A 1MKMA 4LJZF 2CO5A 3JREA 1HC8A 1Z21A 5FD5A 3K7AJ 2YU9J 3H0DA 3FXOA 1X1PA 4O3MA 2R7DA 2VQGA 3ZN1A 5AONA 2ZXHA 1VQMI 1GT0C 2NNYA 2XV4S 3H36A 4I2OA 1JJ8C 4S05A 5JVGF 1YIJI 1QBJA 3A2KA 3WU0A 2H09A 2QEXI 4XKCA 4EQQA 1WI9A 4G94A 1LDJA 1FWZA 2P5KA 4C3IJ 2VJJA 1MMNA 2EWNA 2FOWA 4I0AA 1G8XA 4UHTA 5B1BH 3KX2A 2OJED 5CVUA 5D5XB 2A69F 3EQLF 3OYHA 1H88C 4I0BA 3K1MA 2CQQA 1J7KA 4ZYGA 4F55A 5CQGA 5LHIA 3CESA 1OKRA 4BACA 2VUMJ 1WHUA 3EUHC 4BJ6C 3BR1A 4YFXF 5TRDA 1T2KA 4KISA 1LNWA 2XB5A 5KCMA 1KA8A 3O6BB 5E3OA 5FKLA 5B3SH 1KU9A 4A3GJ 1YITI 4IHXA 1FC3A 2VBZA 3M1CA 3QQAA 2LREA 1ZAOA 2QQ9A 4HEA2 2DK8A 2WV0A 3IRQA 2HYFA 4L5JA 3V7CA 4I98B 1JKPC 4WF2A 4XLHA 3UR3C 1IXSB 2JPCA 1HBXG 2PJRA 4FE4A 5DCFA 2XRNA 5IY5H 2LVSA 4I09A 2DODA 2I5UA 2KHMA 3FHNA 1Z9CA 1RUNA 3BQYA 2HS5A 2R7FA 2ZKZA 5LLQA 2VQLA 3OSGA 1A04A 1W5CC 2DOEA 2EFQA 4IVNA 1FJLA 2Z9OA 1TBXA 3TBIA 4CYCA 1K6OA 3ONQA 5K5OA 5HDGA 3OS2A 1IO2A 4XK4A 3CQZJ 1R5ID 2NS0A 2K9SA 1SFXA 4E6KG 1ERDA 3KLOA 2K4JA 3G1MA 2IA0A 1CF7A 5IT9K 3FMRA 3AG2H 4GCVA 1QPIA 4B4CA 4OMYA 4IPAA 2M4KA 4QIWN 1VQNI 3LQRA 3F22A 4O6JA 3K2ZA 5FLXZ 2F5DA 1U5TB 4LIUA 3J81Z 3CCSI 3TO9A 4NNJA 2EZIA 4NB5A 1YS6A 1BM9A 3O3KA 4QLCU 1TWFJ 4NDLA 2ZJQF 4HW0A 3HGGA 3LMMA 1IW7F 2KZGA 3CDHA 2CV0A 2RVCA 4P5OA 3HGYA 5HLHA 1IRFA 2IA2A 4HV6A 4QPOA 4BY1J 1TWAJ 4B47A 3Q5FA 1ZGAA 1ZRDA 4IHYA 1W7PD 1HA8A 3PO2J 3CCQI 3TOBA 2R92J 1O7FA 3FMSA 2Z1DA 3RKXA 2M0CA 4BQOA 2ZMEB 3SXYA 3O8HA 3SFIA 2HYGD 1T08B 3U1DA 3PNYA 4E7KA 2RQQA 2WB1A 3KEYA 2XVCA 1D0ZA 1ENHA 3JRAA 3PQJA 2LK2A 4OIRF 4M73A 2LKSA 2DXIA 3A0HC 4EVIA 4ZH4F 3RI4A 1VZ0A 2R7OA 1Z77A 1BOBA 2HZTA 1R00A 2Z99A 3ZQCA 2O8XA 2EH3A 3C2HA 1MBJA 1SAUA 3S2HJ 2OD5A 3E5XA 2L7FP 1YE9A 5FGMA 2DU9A 1LVAA 1RIOH 1AKHB 3E6BA 1T6SA 4Y7NJ 3JTGA 3CF5F 5ERIA 1BC8C 2DTZA 3HYIA 1TT5B 5HLTA 3OIOA 3C18A 3S2WA 3W2WA 5FO5A 4LG0B 4OIOF 4L9TA 3SZGA 1LJ9A 2XAQA 3NARA 3AG1H 5L3GA 3ZMSA 4B43A 4BJTA 2GQQA 2LY2A 3OYGA 1E3OC 2EBIA 2E35A 2WY8Q 2MYSA 3FXUA 2ZSHB 5EDNA 5FKOA 2V4JC 1EF4A 4OOIA 4DQ2A 2XSJC 2EA4A 2PMZA 4PSWA 3HJEA 1TP4A 4NC6A 1X1DA 4BKXA 3KYDB 1YO5C 3BZKA 3TGNA 2AQEA 2DW4A 2AXLA 1QZYA 2JA7J 2BVLA 2H1LA 3W6VA 1I39A 2VKHA 4S04A 3HRSA 2ELKA 3I9V2 4C2MJ 2CUJA 4HF1A 1I3QJ 3H3ZA 3HPGA 1MH4A 4IOCF 2KZVA 3N4MA 3ZP5A 3H5NA 1YLFA 4BHCA 4OMZA 3I59B 5FJ8J 3DP7A 2D45A 1X58A 2QA4I 3IP4B 5FKMA 2CV1A 3QYBA 4RAZA 3NWTA 2BXZA 2HPMA 1JTXA 2MH2A 2Q8KA 1JKRC 3HDDA 4Q5SF 2DN0A 2H6BA 3DEUA 2CGPA 5IPAA 2R3SA 1RR7A 1ODDA 4FX0A 1YTYA 4LB5A 3FX3A 2O61A 2OQGA 3D5LA 4L5IA 3HC7A 2HEOA 2WAQA 1LVKA 4ASNA 4NC8A 1KQ9A 3A01B 2CUZA 1C0WA 2DYSH 4HV5A 4C30A 3TEDA 2DOFA 3HOTA 1FSEA 1VQ5I 2NS7A 1SVOA 3RZOJ 5LFAA 3QODA 1WH5A 5ILVA 2LOOA 3IL2A 3FKIJ 4D9JA 5EGOA 2JRTA 2YPRA 3HIFA 1XSDA 2R7XA 3CJTB 2L3DA 5IYCJ 1YS7A 5K5RA 3KP7A 3CO7C 3L9FA 5E8GA 1Z0XA 2E34A 4CXFA 2IW5A 4Y52J 5FLVA 2EA2A 1LFUP 2CUEA 2KIQA 5FFZA 2D1VA 2QWWA 5E8IA 1XTAA 2HXOA 3CLOA 3LQQA 3Q0UA 1N78A 1QVTA 3GTGJ 2UXXA 4HG2A 2ZSIB 3CMAI 3TQNA 2PX9A 2ZC2A 3G1LA 4OWRB 4XBFA 1QRYA 3IAM2 1X2MA 3F23A 3M8EA 3WHCA 2KFDA 1FPQA 5L3DA 3LSKA 2EV6A 2RKHA 3E6MA 3CCMI 3SDBA 3ESWB 1FBSA 4XRSA 2WWYA 2XASA 3CC4I 4LB6B 3OYKA 1WJ5A 2KRHA 4C2TA 5TJJA 3CTAA 2HQAA 5E20A 2E1CA 1KU2A 2IGOA 1HCRA 2QQBA 4JK1X 1UELB 2Y75A 4RB3C 1A35A 4BDYA 1OCPA 3HTUA 3UNGC 1B8IB 2K7LA 1YG2A 2Q2EB 3BP8A 5FROA 2BV6A 4WWCA 2UZKA 1YX3A 2KL4A 1WJCA 3M8JA 1LKXA 2VT2A 2ECBA 2HNHA 2MLGA 3UKGA 2XF7A 4WXHA 2UV1A 3P9IA 3BR3A 4RLQA 1O57A 2OF7A 5B66C 4KITB 5D4SA 3TO6A 1KU7A 2HVSA 5IP6A 1TTYA 1ON2A 3IH2A 1NK2P 3HXLA 1Z6RA 3DEWA 3T1BA 3GCMA 2DFHA 2XKOA 1STZA 3I0TA 4KJZA 1UHWA 1Y1VJ 2DAOA 1WCMJ 1D1AA 3ULQB 5IOYA 3EUKL 4II2A 3DF8A 3VODA 4C3HJ 4G9YA 5K5QA 3PSFA 4MFEA 4BEHB 1SVLA 4XKWA 3I4PA 1WFXA 3R0JA 4AM3A 5F0CA 2CUFA 3K69A 5J4VA 1JT0A 4RGXA 1HW5A 1U9OA 3PFYA 3VYUB 1WH7A 4ESBA 2COMA 4ZYHA 5J8FA 1D8KA 1PDNC 1R58A 5IYDJ 3BLYA 4ZJZA 4A2UA 2A6EF 4DYRA 2M8EA 4IL6C 2GA2A 5F0HA 2FQ3A 2OV7A 1O3QA 3GWZA 1Z7UA 4NQWB 4DNCA 5JHFA 1D5YA 1ZG5A 3LOCA 4A69C 3IKVA 5EG0B 3SHFA 1BR2A 1A6IA 3QPHA 4R8HA 2RV8A 4HA8A 1Y0NA 1EH7A 3RDIA 2CV2A 3RIRA 2DYRH 2EIJH 2QENA 5FRNA 3HHGA 2EFPA 3HPHA 1MMSA 3CCLI 2A6HF 4IKFA 4D0PA 2M1BA 1Q1VA 3FBNB 4RB1A 3DPLC 1BI1A 2R7WA 1QA6A 2HXIA 4CCLA 1FBQA 3S1NJ 2EPFA 2OTJI 4X0GA 5H2FC 1TQIA 3LAPA 1WVRA 1D0YA 2B7EA 4OINF 1XGMA 1MW7A 1OCCH 2IGNA 2JSCA 3NRVA 1XG1A 4C3JJ 3BJAA 1X1AA 4RB2C 3PNVA 2ZXWH 2M45A 1D0XA 2O9LA 1ETWA 1ZELA 4L0ZB 5EJCA 3GZ6A 2IS6A 2F5FA 3CLQA 1K6YA 3S16J 2M4GA 2X9DA 4RGRA 1OFCX 2Z33A 3K1PA 2B9SA 1W5TA 5CKTA 5HOOA 1FOWA 4P9FA 2E2JJ 3E5UA 4PGGA 3PO3J 1MGTA 5BOXA 1ZLKA 3CJNA 4BE1A 3ZPLA 3P9CA 3EETA 2DJNA 1TW3A 3SFZA 4IQ4A 3QAHA 3RQIA 3WTWC 1O3TA 4Y4RA 3DPUA 4OAYA 3ASNH 3FHZA 3GF2A 2E1NA 3BTLA 3ABLH 3QPSA 1W7PB 2PJPA 4I01A 3J7ZI 3DXJF 5DEQA 1IN8A 2JWTA 4BL0B 3GEZA 4LFUA 4HLXA 1TL8A 1WKMA 3M9AA 2X4HA 4E7SA 3E1SA 3L2VA 1X3WB 1IF1A 4C2UA 2O8KA 2XGCA 1B59A 3G4SI 3PIPF 4JP0A 2M2EA 4RM3A 4UUVA 2MW8A 2HQRA 1IAWA 2P81A 4P55A 3SZPA 3EYYA 1ZARA 3EUHA 3L2WA 3MN2A 4JOMA 3E0JB 1WPKA 3OR2C 2NAZA 3H9GA 3RTRA 3HL2A 1N25A 5TISC 4RLFA 2YX4A 4PGHA 2R7UA 4WCGA 4E7LA 3QOEA 2LDUA 4H4KC 1KZHA 4IQJA 2E1MC 2Y0MA 2P6SA 4JYKA 2LBFB 2RGVA 2UXNA 3QP6A 3S17J 3MKLA 1ZK8A 1F5TA 3HB9A 3J7YJ 5CJ9A 4UVBA 5F04A 3C7JA 2KIMA 3DBLB 3VWBA 4CO8A 3OV8A 3I53A 3HUGB 5CLSA 1H9TA 4HNUA 3G1OA 3VEPA 1NH3A 3LNQA 1RPWA 3DWLE 3M1EA 2JK3A 2P6TA 2ZJRF 3L2CA 1V55H 3HSRA 4Y13A 3H9QA 4LLLA 3ROUA 2PEXA 1SFUA 2HDWA 2YX7A 3RYPA 4G6TB 4DIQA 4IHTA 4XONA 5K7HA 4CZZA 2O5RA 1E2XA 3KEQA 4EGZA 1R4NB 1F36A 1OYWA 1RI7A 3K4NA 3W3CA 2KJCA 3PM1A 3CMYA 2ZFWA 2OCCH 1SANA 1USTA 4ZDLA 1P92A 3Q9SA 3KYLA 2VONA 3AFHA 1UG0A 4RA2A 2V6EA 5HNHA 2K9LA 3BZCA 1T56A 2BZTA 1P9QC 2NNNA 1JUPA 2DJIA 3MVPA 3DLLF 1HW2A 1G3WA 4UUTA 1S3JA 1BI3A 4BS9A 2VOOA 2HVRA 4FX4A 3GMEA 3FXQA 4UUSA 4IXAA 1GXPA 4WXDA 1IV6A 4XSZF 2LSOA 1OISA 2VC0A 1UFMA 4GDFA 3GUDA 3H9JA 4J00A 1XCVA 3N97A 2IEKA 2JRMA 3DQVC 4U0WA 2TDXA 2FD5A 5C44J 3OYIA 2ID3A 3QU3A 3RCOA 5KHDA 1ZGWA 3JRGA 4L9VA 2PG4A 3LA7A 3KEOA 1R4MB 2ZB9A 1RRJA 5CVVA 2L9NA 2HQNA 2PFBA 4MHGA 3BCBA 2HDDA 1J75A 3ECOA 4Q48A 4M3BA 4A3DJ 3R6SA 3JAMK 3VYRB 4XMYA 1G4DA 2LD5A 1KU3A 2W24A 2RN7A 3JSOA 2A68F 1UAAA 1S8NA 6PAXA 2WA0A 4UV8A 5HDKA 3IHUA 2DA5A 3OYCA 1BJAA 5JHUA 1X3ZB 3F6VA 3OYBA 4N4NB 5IOZA 1MDMA 2O0YA 4OAZA 2P0WA 2QZ8A 1X3UA 5FRMA 2Y31A 3ABKH 1W36C 2D5VA 3GZNB 5CVJA 2FBKA 2R0QC 4U87A 4B3AA 3HOWJ 3NWSA 4KN7X 5IP9J 3HOYJ 2DDBA 2A61A 4HQMA 2VOPA 2L02A 3U21A 2V1UA 3BR6A 1MBEA 2V9VA 4MO7A 1TQMA 5HLGA 2J5OA 2QCOA 4M74A 3HSFA 2KT0A 3EUAA 4EMSA 1APLC 4B8XA 1NTCA 3HRMA 2W1OA 3S93A 2GXGA 2XDVA 4DOZA 4EATA 2F5CA 2E5ZA 1IRGA 1SD7A 1XCBA 2GBYA 1G3TA 4HF0A 4DZPA 1ZQ3P 1OQYA 3D0SA 5L3CA 5H20A 2V9PA 1WI3A 3RQ4A 4HAMA 5J1UA 5B5EC 1SFOJ 1YRNA 2DA2A 4UV9A 4PK4A 3FM3A 3LSMA 4BH9A 1XMAA 2DOAA 2PJRB 2H27A 1OCZH 4AWXB 2OTLI 5KNLA 4Q4ZF 3ZR8X 4ENJA 3OMYA 2R7ZJ 1V4RA 4ZYEA 5ICGA 1TZLA 4N9IA 2GOMA 2X0LA 2NVTJ 3LSIA 1HKTA 2IS2A 1SD6A 5LBQA 4L5EA 4CYCB 4EJTA 1HKQA 1QO0D 1U8BA 3KIOA 2O03A 1V5GA 2XUBA 3F6OA 3P7NA 3ZXSA 2Q1ZB 2EV5A 4L18B 1CF7B 2DA3A 5JI6A 5ILUA 5E3LA 1H9GA 4QWQA 5M5WJ 1ZR4A 2LF8A 2ISZA 3ABUA 4NHJA 3NEUA 2L0KA 5JFRA 3ZOBA 1GV5A 1Z1DA 2AQFA 2F5VA 2P8TA 2IGKA 4AIJA 2IPQX 3A0BC 2ADUA 3BR0A 4LMYA 1JGSA 2K40A 4KMUX 4HSRA 1JGGA 3HKZN 1ZREA 4HYEA 2IP2A 3J7AY 4BXFA 1W36D 1F4KA 3SEQA 4ESJA 2WAEA 3K10A 3SDGA 2QKLB 4B1RA 2F4IA 2PMUA 2NVXJ 1GHCA 4RB0A 3HG9A 1O3RA 3S3OA 5K1YA 3HKZA 1UHMA 2LTPA 3KZYA 2L9RA 5AIPA 1XX5A 4IRGA 1MBGA 1A31A 3FXRA 4DBRA 4Z6YA 3A4CA 3KP2A 3LA3A 5HLIA 2MC3A 1WJAA 3T8RA 5HNFA 1U5TA 3WTUC 5FLXK 3T0YA 1S6LA 1SFKA 2Z5UA 2ELHA 2VBXA 3BDDA 4W1UA 1W0TA 1XDSA 1XSVA 2DDAA 2EZKA 3ABTA 3B73A 3BC8A 3PSIA 2H1KA 2QBYA 3S1MJ 2D2WA 1L0OC 4HQEA 4E7HA 5CVRA 1AWCA 1BN5A 4RGUA 5LGNA 3K4BA 3FK7A 1VQKI 1FX7A 1X4OA 3BR5A 4PZJA 3E3VA 2CH0A 3WTXC 2NVYJ 2CJJA 5D5WB 3HHHA 4FETA 1DU6A 2XGXA 4AIHA 1PVEA 2Y0SN 1MMAA 5F27A 3BPVA 1JUMA 4YIFA 4A0YA 1VQ9I 5L3BA 1LDKB 2BOLA 4HDUA 2BY2A 1P4XA 4LIVA 5J1RA 4ABZA 2V1DA 3BT9A 1J5YA 4M6XA 3WE2A 4XR6A 4XRSG 2Y0SA 4YRVA 3QYEA 2OU2A 4EGYA 2J5PA 5EYRA 1H89C 3F72A 3EDPA 1G6NA 5DD8A 3KP5A 1IXRC 4IX7A 5J47A 1JHFA 2IVMA 3ZN0A 5D8KB 4F7ZA 2KRFA 3JW4A 2EQRA 3S2DJ 3QPTA 1K78A 1Z6TA 4ZZDA 2DO7A 3HOUJ 1X19A 2K27A 3OIQA 3BTCA 4EM2A 1MNDA 1AHDP 1JUSA 4R79A 4A3FJ 1U3EM 2E1OA 4D7NA 2XF5A 4MLOA 2LR8A 2X1EA 4CCJA 2PN6A 1SAXA 5J8CA 1WZ2A 4M3FA 1P4WA 3ECHA 2K9QA 2FF4A 3OOPA 4RAFA 3PFIA 1DU0A 1QNTA 4RDUA 5D6EA 5JVTA 2QVOA 1ETYA 1IN5A 4KIFA 4Y15A 2K4BA 3JR9A 4U7DA 3KE2A 4WXCA 2EFOA 4AYBN 2KP6A 2JTVA 1NHAA 2X1DA 1FOKA 2GOXB 2CYYA 2RNJA 2CRGA 1RKTA 5GADJ 1ZRFA 2DMUA 1MD0A 2FUG2 4I02A 3E7LA 3ZRGA 4CHUA 4AYBA 4D5FA 3CUOA 1VTNC 3TL4X 1V3FA 3RJPA 2L4MA 1JKOC 4ZC3A 4E7ZA 1W4MA 3REOA 2ISYA 2DA1A 2CSOA 3QPLA 2DMTA 4A0XA 2DPUA 1MBKA 3S8PA 3VSKA 2FJ1A 1USSA 2A6TA 5EGOB 2VPRA 3OYFA 4J19A 4G7ZF 2L7KA 3J80Z 4IRIA 2HZDA 3BG3A 3DCFA 1Y8QB 4F91B 1G3YA 3AG4H 4KA4A 3WHBA 2WV1A 3C2GA 4HRIA 2A07F 2ECCA 2VC1A 4MFDA 4A12A 3CC7I 5LGUA 5FKNA 3K4KA 1OLTA 2GZWA 2VXZA 3KZIC 1X4PA 2RREA 1CGPA 1FMVA 3OL3A 2M3AA 1HOMA 1DPUA 3LFKA 3ZCOA 1O3SA 3DFGA 2VB6A 1YW7A 5LHGA 3BTJA 5M5YJ 3FK6A 2IBDA 2K85A 2HU9A 2C6YA 4DYQA 5ICEA 2X48A 3OR1C 5E1XA 3I55I 1XGNA 3L1PA 3P9KA 3CZ6A 2KRCA 1ITYA 1FLIA 4PJLA 2QM3A 1JHHA 1HQCA 2Z3YA 4A3IJ 2VQHA 1JE8A 4XN0A 2OZ6A 3DPTA 3DU6A 4HLYA 4BE0A 1XN7A 1U2WA 2X51A 1U0JA 2OC6A 5AIQA 3IC7A 3KLNA 3JTHA 4IRHA 2AO9A 4V19K 3OY9A 1BJZA 2XPUA 1BR1A 5GAGJ 2XPWA 5CYVA 3OYJA 1J9IA 1RKWA 3KP4A 5GTHC 3JRBA 1U5TC 4E70A 5H6RA 1P6RA 2LMDA 5E79C 4EJOA 1XGSA 1MBHA 3ERMA 2XAJA 3D5RC 1WJBA 5DD4A 3E6CC 2DT5A 2HGCA 2KISA 3RYRA 2DA4A 5F64A 3TDUC 4ZZLA 1TW2A 2OBPA 5DS9A 1K83J 2BYVE 1RUOA 3RKQA 3K9TA 2A5WA 3WGIA 2L7ZA 2WC2A 2H8WA 2G7HA 3FDYA 2E1MB 2VE8A 4ANJA 3MZYA 4IO9F 3BG6A 1FY7A 3L7WA 3TKYA 5DUIA 2VJ4A 4CUGA 5EEHA 2ME6A 1I5ZA 2MD5A 1OR7A 2R7VA 1Y0UA 3E5QA 3RPUA 4FTHA 3OS1A 4D7MA 4BDZA 1Z3XA 4WX9A 4OIQF 4II3A 3NQOA 2K02A 5DCMA 1GVJA 5ED4A 1ACIA 5BNGA 2CG4A 1GUUA 2NOGA 2QQ8A 5J40A 1I50J 4E7JA 2ZXIA 2FMYA 5FKKA 1GVDA 3Q3SA 3QU6A 2HVQA 2AHQA 2JJ7A 3CF2A 3ZMVA 4XKVA 3JRFA 1ZH5A 3JRCA 3EPZA 4PJ0C 4EM1A 4IEJA 1EH8A 2LH9A 4MIMA 3MEXA 3TP3A 2ZFUA 1PUEE 4PDKA 2NS8A 3VOEA 1FMWA 1UHSA 4PCQA 3LSHA 2NXNB 2V6CA 3AG3H 3TW7A 4KICA 4LOCA 2M9HA 1ZKGA 4HSTA 3GO5A 4BJ5C 1MBFA 5DM6F 4KMFA 2LLKA 1F1ZA 5BPIA 4UNOA 2GXBA 1DP3A 3CD6I 3V42A 4BE2A 2BBYA 4CCOA 1YJNI 3FXMA 3EYIA 3CO6C 1R5GA 3OYLA 3H3UA 3OS0A 4E4HA 3WTYC 4IZZA 2WADA 2GM4A 1LQ1A 3V8LA 1UMQA 3WTVC 2GLOA 2KPMA 4A3LJ 2MGQA 4HZFA 3IV5A 4IF4A 2CFXA 3Q9VA 2DPDA 3U1KA 3M7GA 3IH3A 1B9MA 1R7JA 1Y8RB 1XMXA 4Z2YA 4HX8A 5D5VB 4RS8A 1J0RA 4BY7J 1FTZA 3L2QA 2FA5A 2QUFA 1B1BA 4NQWA 2M0MA 3B6CA 5E18F 4G7HF 5EEAA 2FEZA 1S7AA 3KP6A 2EV0A 4XRFA 3FMQA 5J4YA 1IV8A 1FYKA 3CUQA 3PQKA 1ZR2A 5EZHA 1UB9A 4NBQA 3BJ6A 4AU7A 1S29A 1SVMA 2XIGA 4CGZA 2EZLA 1BR4A 4M9ZA 2JUCA 1ZLJA 1ETQA 1VQ7I 2BY0A 3WTSC 4I76A 3BROA 3BZ6A 1LFBA 2IXSA 4W97A 1XDUA 3PL8A 1IDYA 1LE8B 1OYIA 4BQAA 3ZQQA 1I1SA 4DYCA 2QLZA 3GYHX 4J01A 4UB6C 2R7RA 4F93B 1Z91A 4KIGA 2IAIA 2VJIA 2HKOA 2OZUA 2QSGX 4B48A 5C3EJ 2ACJA 1RZ4A 3I4MJ 2XF6A 1WJDA 1IN7A 1UZCA 2I8DA 4MGRA 2W00A 5M3MJ 4M3GA 1PUFA 3JCUC 4XLFA 3W2VA 4RAYA 3FISA 3WU2C 2MG4A 2TRTA 4XN3A 4HPQA 3IUOA 5CPRB 3BY6A 1JXSA 2RNGA 3R61A 4XIDA 2HQ5A 4F52A 3BG5A 5HDNA 2M5WA 2HR3A 2W4SA 3G6EI 2MFZA 2DA6A 4AIKA 1ETVA 2VBWA 1MJBA 1V54H 2CW7A 4LLNA 2DA7A 3GTKJ 4WK8F 5A2QZ 5J1YA 1O7LA 1WQ2A 2BE5F 4A3KJ 1EH6A 5C4JJ 3MZHA 1W5SA 2IGMA 2V26A 1OMIA 1XC5A 2P5LC 1ON1A 2W85A 1E3HA 3DBRB 1HDDC 4BBSJ 3K70C 2PQ8A 3K0LA 1G2HA 3GFLA 3G71I 2XSDC 1OR7C 1VF9A 3U2RA 3HSEA 3MD2A 3BWGA 2BHYA 2R4GA 2HPIA 4PJMA 4EJWA 1R6RA 3BR2A 2FX0A 4ON0A 1BBYA 4A3JJ 1HSTA 1DQUA 4XOPA 1K61A 2P7CB 2BW3A 3F8FA 2UUZA 3V7RA 3JSPA 2V79A 3KETA 4HDVA 2BY1A 2YUSA 4P1WA 2LRDA 4EJUA 5F1JA 5KAFC 5M3FJ 3A03A 1X1CA 1UG2A 1ETXA 4PJNA 2LY1A 1LB2A 2GIZA 2JSPA 4YEJA 4Y17A 3CCJI 1J59A 3K4LA 4KIBA 4MTEA 5LEJA 4XQFA 5EF6A 1K4TA 1DPRA 1V5EA 2QKMB 1T33A 3BQZA 3MWMA 2R5YA 3CDLA 3TP0A 3F9KA 1XD7A 3OWTA 4U0VA 2DFFA 3HM5A 3HUGA 1S72I 1BA5A 2JN6A 1R1VA 2TCTA 3QOPA 3HEFA 5D6FA 3AKZA 4AVZA 4UUSB 4ITVA 1MIJA 4Y3OA 2JT1A 2JA6J 2YS9A 3IWZA 2ESHA 4YIRX 1N77A 3TDZC 2DCEA 2XAGA 4CSWA 2PMHA 5HODA 4U7BA 1IUYA 2AXTC 4FQGA 1R22A 5JLXA 3VSLA 2KLOA 4ENKA 2VODA 4CZCA 4F3QA 1HXDA 1Y6IA 2E7XA 2V7FA 1B72A 3DKXA 1J2XA 1I27A 2R5ZA 1PP8F 1TC3C 2EK5A 1G59A 3ZQIA 1NG6A 3IKTA 1QHHD 1S5LC 1IRXA 1TNTA 2ETHA 2GAUA 2X6YA 3V8JA 5BS6A 1QPMA 1RR8C 2DMPA 4KYWA 3COAC 4M9SA 1D8JA 3ABMH 1JTYA 1BW5A 2KDOA 3GW2A 2VI6A 3CC2I 1NG7A 2VN2A 3LSGA 1JI8A 3LL7A 3JRHA 2D1HA 3CUQC 3LWFA 4YG2F 3WODF 3K70D 5JLWA 1RC9A 3DTKA 4M6VA 3RPUD 3ZQ7A 1P2FA 4BHBA 4M72A 4FASD 3CCVI 3IAS2 2DTRA 4YFKF 2GA1A 2LYCA 3CCRI 3ZQHA 1MDMB 3GBGA 2VQCA 5E1WA 2X6WA 3WU1B 2MH9A 4BHPA 3MQ0A 2EFWA 1T39A 2Y2ZA 1IXCA 2AS5F 3B6AA 3GTPJ 2A5YB 2EINH 2F4MB 4A5NA 4C9YA 1BIBA 1R23A 1WWXA 1ETOA 1L3LA 1YHQI 4GGGA 1FZPB 3CP2A 2L4AA 1I6HJ 2EFNA 1K79A 2HOEA 3B02A 3IRRA 4TV7A 2CQ7A 4KFCA 2XAUA 2CQXA 1E17A 3S15J 1D1BA 4LG3A 2ID6A 4XLPF 2W25A 2DMNA 2HI3A 3FM5A 2E7WA 4OU0A 5ILSA 1U6GA 3GLXA 2CQKA 3OOUA 2F5EA 3TOAA 4A6DA 1DDNA 4UXNA 1IN6A 2ME0A 3OL4A 4KUMA 1TWGJ 2K9NA 1ZN2A 2EB7A 1VQ8I 4I99C 1MH3A 2I10A 5L3FA 2VKEA 5IT3A 3K4MA 1SMYF 1YRNB 3WTZA 2ZJPF 2JQ7A 4ZDOA 4A0ZA 1T8IA 1PP7U 3JRIA 2COBA 4H0EA 2BHZA 3HZJA 2WY7Q 2K3PA 4BXXJ 2QSFX 4AD9A 3GFJA 1DUXC 4QPQA 1U9NA 4IJAA 2JVHA 1OPCA 1RESA 5FD6A 1AU7A 3I3LA 2BXYA 3N05A 3F3XA 2Y30A 3GTQJ 3F8MA 1KQ0A 1UJ8A 3LSTA 1Y1WJ 1S7OA 1QVUA 4KN4X 3SYTA 2X1CA 5IT9Z 1EV7A 1T95A 2WTEA 3ZGKA 1ZG3A 2FOKA 1VQ6I 1BOAA 5GTIC 2HDCA 2E36A 3CCUI 1EA3A 1YOVB 3J7AO 2MA3A 3BJOA 4L9JA 2FNAA 1FSHA 3S1RJ 4I7HA 4ZDPA 1GXQA 4F92B 4UVAA 3DKYA 3IWFA 4ETSA 1YIOA 3ERED 5FLMJ 3GX4X 1KQ8A 4LGWA 1R71A 1MMGA 2B63J 3WE3A 5D8LB 1ETKA 2PLYA 4A3EJ 4XM3A 1B4AA 4O5VA 4NC7A 3OYAA 2E2HJ 1SFEA 1TNSA 3VPRA 1QZEA 5CQEA 1FOYA 5D5UB 2E5NA 4HOBA 3GVAA 2LKPA 5F0FA 2LKXA 2QBYB 5M5XJ 1FYLA 2DI3A 3K6GA 3R4KA 4M9XA 4MEYF 1YW8A 4FT8A 2Q0OA 2GIVA 3J81K 1K4SA 1H8AC 2CW8A 5DM7F 2HKXA 2JPBA 4ENMA 4RBOA 2CMPA 1MZBA 3MAJA 1VQ4I 5DTDA 3OYEA 2WB1N 3MFKA 1K7AA 2LP0A 3TW6A 3FF5A 2HTSA 1B9NA 3CJQB 3HRUA 2FMLA 5JR3A 5TGTA 2ZNYA 1MJ9A 3RPQA 1YJ9I 1O4XA 1KYWA 4BAYA 2ZMEA 4GRIA 1BI0A 1LDDA 4BQNA 2NVQJ 2XAFA 3M4OJ 1ULYA 2VXDA 4JX6A 2QYOA 4XLCA 4XICA 3BOQA 1VNDA 3I54A 2E2IJ 1HDPA 2DFIA 1X2NA 2FU4A 5BMZA 2RAEA 2F48A 4GYIA 4KT6A 3V8KA 2JA8J 3F8CA 4AVPA 5GPCA 5BQTA 1XS9A 4DJAA 1SEUA 2OPTA 2G9WA 1Z05A 2KJBA 1K78B 3Q0WA 4XLEA 5F1RA 3L2UA 1AKHA 3AL0C 4BXUA 3OYDA 3QYFA 4ZYDA 2CWEA 9ANTA 3X2QH 1IG7A 1AA7A 2H6CA 2PMZN 2NRAC 4ZYAA 2JMWA 3RZDJ 2FQ4A 1GDTA 2W57A 4YFNF 1Y56A 1CQTA 3ZMDA 4LG0A 3S3MA 5HS7A 4ZTFA 1DP7P 1ONVA 3H1CA 3O8GA 1R5HA 3KPHA 1KYZA 3HRTA 3HOXJ 1AOYA 3L2RA 4EJVA 4PUSA 2E60A 4B09A 4MTDA 1PJRA 1BL0A 2F2EA 4IHWA 3WG7H 3PJRA 1I3AA 2VT3A 4Y33A 4LLGF 4XL9A 2BY3A 4U0YA 2MC4A 2XGDA 2ZCWA 3U9GA 4MQ9F 3FIWA 3BG9A 4JX5A 3ML6A 3CP8A 1R1UA 5IYBJ 3LSRA 4XLAA 2FNPA 3IH4A 2XC7A 3ZMZA 2XB0X 3ISPA 4RMNA 1YJWI 3MZ8A 4M3EA 2CU7A 4NUBA 3I59A 1XPXA 3LSPA 1LEBA 2OAZA 2DLLA 4XKBA 1D5VA 2O7OA 2LG4A 2WAQN 2K5CA 4YIIA 3TO7A 1P7JA 1SD5A 1V5FA 2H94A 5HVQC 2VL8A 1Q1HA 3G73A 2STTA 4OIPF 2Y9ZA
chains in the Genus database with same CATH topology
2G7UA 3I64A 2OQRA 4JQFA 1FYMA 3FWEA 4A6EA 4G7OF 4HBLA 3SQNA 1YFHA 2LNBA 2XAHA 2KIFA 3H92A 3F21A 1LEAA 5DYMA 2HFHA 3L00A 3J80K 2PBIA 1U78A 3WGGA 1B6AA 1OYYA 1KGSA 1FNNA 4CICA 2DBBA 2JZYA 1T38A 2W84A 1HW1A 2XKPA 5ICCA 2FRHA 2RQPA 5L3EA 3WGHA 1ZYRF 2L54A 1R36A 2MBFA 2STWA 1SD4A 5F6FA 3O2PE 1XSXA 3LA2A 1XGOA 2M30A 1XMKA 3R60A 1I1GA 2YSRA 3I5UA 5DCMB 3V7SA 2UWMA 2IJLA 2YU3A 2M87A 1IZ1A 2FXAA 4LK1F 4M6YA 2L01A 3ZMTA 4N0BA 4U88A 2Q2EA 3I71A 3SZTA 1BI2A 4LK0F 1T0FA 3GFMA 2MLKA 3HOSA 2ZO4A 5HS8A 4GYGA 4M71A 1ZGJA 3C1DA 1IN4A 4MEXF 4L0YB 4MNUA 1F9NA 4ENNA 5CVIA 5LEKA 1I6XA 4JBAA 3WTTC 1YQAA 4XLNF 2K86A 1SMTA 4KT5C 4CDGA 3HTSB 1ZRCA 3T5XA 2P7VB 2P4WA 5BPDA 4UVCA 4P96A 5EEGA 3M8FA 5LRRA 5E1ZB 3CUQB 3KFWX 1REPC 2NYXA 3F8NA 4G6QA 1YW9A 1FBUA 3AAFA 4MQVA 3BPXA 2EJRA 1MJAA 2RC4A 3VFZA 1U8RA 3L09A 1TQPA 2DQLA 2GWRA 5LRSA 1HSJA 5H6QA 2XROA 5LGTA 3T8TA 4BYYA 1ZG1A 2KKOA 2CW0F 2IT0A 2FBHA 3G3ZA 4G8XA 3GXOA 2V1XA 5FB2A 4BNCA 4CYDA 4KNYA 1YYVA 2BGCA 5DV5A 3RKYA 4A5MA 1HKSA 2HWVA 4HX7A 2O6GE 5DDGA 1W7PA 1ZHFA 2QQAA 4EM0B 2A3SA 2Y48A 4G6DA 4GXOA 1WSUA 3ELKA 3GFIA 3MCZA 2VBYA 1P4AA 2IRFG 2IA1A 2YR2A 2FSWA 2B0LA 1D3YA 3RKWA 1FP2A 3KZZA 5LHHA 4ESFA 1FT9A 5A2QK 4P9UA 3DKWA 5KK1A 4Q47A 1H0MA 3F8BA 2ESNA 1QZZA 4IHSA 2ZXJA 2PI0A 2XHKA 1BIAA 4L9NA 5E17F 5ICFA 1T98A 3E6DA 3W6KB 1XB4A 2BEOA 2DK5A 4XSXF 4K2EA 5D4RA 1R1TA 4GO1A 5HS9A 2HTJA 5J6XA 3ZMUA 3LAJA 1QQIA 3VB2A 1TLHB 3DV8A 5KVRA 2ZBKA 1WRJA 2O3FA 4HF2A 2DQRA 1BC7C 2FE3A 3JAMZ 2LF7A 4RGSA 3KCCA 3C3WA 4EV0A 4HX4A 2VE9A 4LD5A 3QP5A 2ZJ2A 1UCRA 3GZ5A 5DUKA 5FFXA 4R1HA 3R0AA 4N9HA 3E97A 3W6JB 3I58A 3K1NA 3KP3A 2P5VA 3FZVA 3V4GA 1RNLA 1FP1D 4FHTA 2ZNZA 3WG9A 2KIUA 3QRFF 1QGPA 2FBIA 2RDPA 1G3SA 4KDPA 2OA4A 1MKMA 4LJZF 2CO5A 5FD5A 4O3MA 2R7DA 3ZN1A 5AONA 2NNYA 2XV4S 4I2OA 4S05A 1QBJA 3WU0A 2H09A 4EQQA 1WI9A 4G94A 1LDJA 1FWZA 2P5KA 2EWNA 4I0AA 4UHTA 5D5XB 5CVUA 2A69F 3EQLF 4I0BA 3K1MA 4ZYGA 1J7KA 5LHIA 1OKRA 4YFXF 5TRDA 1T2KA 1LNWA 1KA8A 3O6BB 1KU9A 1FC3A 2VBZA 1ZAOA 2QQ9A 3IRQA 2DK8A 2WV0A 2HYFA 4L5JA 3V7CA 4I98B 4WF2A 1HBXG 1IXSB 2JPCA 5DCFA 2XRNA 4I09A 1Z9CA 1RUNA 2HS5A 2R7FA 2ZKZA 5LLQA 1A04A 2Z9OA 2EFQA 4IVNA 1TBXA 1K6OA 5K5OA 5HDGA 2NS0A 1SFXA 3KLOA 2K4JA 2IA0A 1CF7A 5IT9K 3FMRA 4GCVA 4OMYA 4IPAA 3LQRA 3F22A 4O6JA 3K2ZA 5FLXZ 2F5DA 1U5TB 3J81Z 3TO9A 4NB5A 1YS6A 1BM9A 3O3KA 4QLCU 4HW0A 1IW7F 3CDHA 2RVCA 4P5OA 5HLHA 1IRFA 2IA2A 4HV6A 3Q5FA 1ZGAA 1ZRDA 1W7PD 3TOBA 1O7FA 3FMSA 3RKXA 2ZMEB 3SXYA 2HYGD 3U1DA 2XVCA 3PQJA 4OIRF 4M73A 4EVIA 4ZH4F 3RI4A 2HZTA 1R00A 2Z99A 2O8XA 2OD5A 3E5XA 5FGMA 2DU9A 1LVAA 1RIOH 3E6BA 1T6SA 3JTGA 5ERIA 1BC8C 3HYIA 3C18A 3S2WA 5FO5A 4LG0B 4OIOF 4L9TA 1LJ9A 2XAQA 5L3GA 3ZMSA 2GQQA 3FXUA 4OOIA 4DQ2A 2EA4A 1YO5C 3TGNA 2DW4A 2AXLA 1QZYA 4S04A 3HRSA 4HF1A 3H3ZA 3N4MA 3ZP5A 1YLFA 4BHCA 4OMZA 3I59B 3DP7A 2D45A 4RAZA 2MH2A 2Q8KA 4Q5SF 2H6BA 3DEUA 2CGPA 2R3SA 1YTYA 1ODDA 4FX0A 4LB5A 3FX3A 2O61A 2OQGA 3D5LA 4L5IA 2HEOA 4ASNA 1KQ9A 1C0WA 4HV5A 3HOTA 1FSEA 3IL2A 5ILVA 2JRTA 2YPRA 3HIFA 1XSDA 2L3DA 1YS7A 5K5RA 3KP7A 3CO7C 3L9FA 5E8GA 4CXFA 2IW5A 2EA2A 5FFZA 2D1VA 2QWWA 5E8IA 3CLOA 3LQQA 2UXXA 3TQNA 4XBFA 3F23A 3M8EA 1FPQA 5L3DA 2EV6A 2RKHA 3E6MA 1FBSA 2WWYA 2XASA 4LB6B 5TJJA 3CTAA 5E20A 2E1CA 1KU2A 2QQBA 4JK1X 2Y75A 4RB3C 3HTUA 2K7LA 1YG2A 3BP8A 2BV6A 4WWCA 2UZKA 2VT2A 2MLGA 4WXHA 3P9IA 1O57A 5D4SA 3TO6A 1KU7A 1TTYA 1ON2A 1Z6RA 3T1BA 2XKOA 1STZA 3I0TA 1UHWA 2DAOA 3ULQB 3DF8A 3VODA 4G9YA 5K5QA 3I4PA 3R0JA 3K69A 4RGXA 1HW5A 4ESBA 2COMA 4ZYHA 5J8FA 1D8KA 1PDNC 1R58A 4A2UA 2A6EF 2M8EA 2GA2A 2FQ3A 1O3QA 3GWZA 1Z7UA 4DNCA 1ZG5A 3IKVA 3SHFA 3QPHA 4R8HA 2RV8A 4HA8A 1EH7A 3RDIA 3RIRA 2QENA 3HHGA 2EFPA 2A6HF 4D0PA 2M1BA 4RB1A 3DPLC 1BI1A 1FBQA 1TQIA 3LAPA 4OINF 1XGMA 2JSCA 3NRVA 3BJAA 4RB2C 2M45A 4L0ZB 3GZ6A 2F5FA 4RGRA 2Z33A 3K1PA 1W5TA 5HOOA 4P9FA 3E5UA 4PGGA 1MGTA 5BOXA 1ZLKA 3CJNA 3ZPLA 3P9CA 3EETA 1TW3A 3SFZA 3QAHA 3WTWC 1O3TA 3FHZA 3GF2A 2E1NA 1W7PB 2PJPA 4I01A 3DXJF 5DEQA 1IN8A 3GEZA 4LFUA 4HLXA 1WKMA 3M9AA 2X4HA 1IF1A 1B59A 4UUVA 2HQRA 1IAWA 4P55A 3SZPA 3EYYA 1ZARA 3EUHA 2NAZA 3RTRA 2YX4A 4PGHA 4WCGA 2LDUA 2Y0MA 2P6SA 2RGVA 2UXNA 3QP6A 1F5TA 5CJ9A 4UVBA 3C7JA 2KIMA 4CO8A 3OV8A 3I53A 5CLSA 1H9TA 3VEPA 3M1EA 2P6TA 3L2CA 4Y13A 3HSRA 4LLLA 3ROUA 2PEXA 1SFUA 2YX7A 3RYPA 4IHTA 4CZZA 1E2XA 3KEQA 4EGZA 1OYWA 1RI7A 2KJCA 2ZFWA 1USTA 1P92A 3Q9SA 2VONA 2NNNA 1HW2A 1G3WA 1S3JA 1BI3A 2VOOA 4FX4A 3FXQA 4IXAA 1GXPA 4WXDA 4XSZF 2LSOA 2VC0A 1UFMA 3GUDA 3N97A 1XCVA 3DQVC 4U0WA 2TDXA 3QU3A 4L9VA 2PG4A 3LA7A 3KEOA 5CVVA 2HQNA 2PFBA 4MHGA 1J75A 3ECOA 4Q48A 3R6SA 3JAMK 1G4DA 1KU3A 2W24A 2RN7A 3JSOA 2A68F 1S8NA 6PAXA 4UV8A 5HDKA 3IHUA 1BJAA 5JHUA 3F6VA 1MDMA 2O0YA 2QZ8A 1X3UA 5CVJA 2FBKA 4KN7X 2A61A 4HQMA 2VOPA 2L02A 2V1UA 2V9VA 1TQMA 5HLGA 2J5OA 4M74A 3HSFA 4EMSA 4B8XA 3HRMA 2GXGA 2F5CA 1IRGA 1SD7A 1XCBA 1G3TA 4HF0A 3D0SA 5L3CA 5H20A 4HAMA 4UV9A 3FM3A 4BH9A 1XMAA 2H27A 4AWXB 4Q4ZF 4ENJA 1V4RA 4ZYEA 5ICGA 4N9IA 2X0LA 1HKTA 1SD6A 5LBQA 4EJTA 1HKQA 1QO0D 2O03A 2XUBA 3F6OA 3P7NA 2EV5A 4L18B 1CF7B 5JI6A 5ILUA 1H9GA 4QWQA 2LF8A 2ISZA 3ABUA 4NHJA 3NEUA 5JFRA 1Z1DA 2P8TA 4AIJA 2IPQX 2ADUA 4LMYA 1JGSA 4KMUX 1ZREA 4HYEA 2IP2A 1F4KA 4ESJA 2PMUA 1GHCA 4RB0A 1O3RA 5K1YA 1UHMA 3KZYA 5AIPA 4IRGA 3FXRA 3LA3A 3KP2A 5HLIA 3T8RA 2MC3A 3WTUC 5FLXK 1U5TA 3T0YA 1S6LA 2Z5UA 2ELHA 2VBXA 3BDDA 1XDSA 1XSVA 3ABTA 3B73A 2QBYA 2D2WA 1L0OC 4HQEA 5CVRA 1AWCA 1BN5A 4RGUA 5LGNA 1FX7A 4PZJA 3E3VA 3WTXC 5D5WB 3HHHA 2XGXA 4AIHA 3BPVA 4YIFA 4A0YA 5L3BA 1LDKB 4HDUA 1P4XA 2V1DA 1J5YA 4M6XA 3WE2A 4EGYA 2OU2A 2J5PA 3F72A 3EDPA 1G6NA 5DD8A 3KP5A 1IXRC 1JHFA 2IVMA 3ZN0A 5D8KB 4F7ZA 2KRFA 3JW4A 3QPTA 1K78A 1Z6TA 4ZZDA 2DO7A 2K27A 4EM2A 4R79A 1U3EM 2PN6A 1SAXA 5J8CA 1P4WA 3ECHA 2FF4A 3OOPA 3PFIA 1QNTA 5D6EA 5JVTA 2QVOA 1IN5A 4KIFA 4Y15A 2K4BA 4U7DA 3KE2A 4WXCA 2EFOA 2JTVA 1NHAA 1FOKA 2CYYA 2RNJA 1ZRFA 1MD0A 4I02A 4CHUA 1VTNC 3CUOA 1V3FA 3RJPA 2L4MA 1W4MA 3REOA 2ISYA 2CSOA 4A0XA 2DPUA 1USSA 4G7ZF 3J80Z 4IRIA 1G3YA 4KA4A 2A07F 2VC1A 4A12A 5LGUA 2GZWA 2VXZA 1CGPA 1DPUA 3LFKA 1O3SA 3DFGA 1YW7A 5LHGA 2C6YA 5ICEA 5E1XA 1XGNA 3P9KA 1FLIA 2QM3A 1JHHA 1HQCA 2Z3YA 1JE8A 2OZ6A 3DPTA 4HLYA 1XN7A 1U2WA 5AIQA 3IC7A 3KLNA 3JTHA 4IRHA 5CYVA 1J9IA 3KP4A 1U5TC 4E70A 5H6RA 1P6RA 4EJOA 1XGSA 2XAJA 5DD4A 3E6CC 2DT5A 2HGCA 3RYRA 5F64A 3TDUC 4ZZLA 1TW2A 2OBPA 2BYVE 1RUOA 3K9TA 3WGIA 2WC2A 2G7HA 2VE8A 3MZYA 3L7WA 1FY7A 3TKYA 5DUIA 5EEHA 1I5ZA 2MD5A 1OR7A 1Y0UA 3E5QA 3RPUA 4WX9A 4OIQF 3NQOA 2K02A 5DCMA 1GVJA 5ED4A 2CG4A 2FMYA 3QU6A 3ZMVA 1ZH5A 4EM1A 1EH8A 3MEXA 1PUEE 4PDKA 3VOEA 4PCQA 2V6CA 4KICA 3GO5A 4KMFA 1F1ZA 5BPIA 4UNOA 2GXBA 2BBYA 3EYIA 3CO6C 1R5GA 3H3UA 3WTYC 1LQ1A 3V8LA 3WTVC 4HZFA 4IF4A 2CFXA 3Q9VA 2DPDA 3M7GA 1B9MA 1R7JA 4Z2YA 4HX8A 5D5VB 4RS8A 1J0RA 2FA5A 2QUFA 1B1BA 4NQWA 5E18F 4G7HF 2FEZA 1S7AA 3KP6A 2EV0A 4XRFA 3FMQA 1FYKA 3CUQA 3PQKA 1UB9A 3BJ6A 1S29A 2XIGA 4CGZA 4M9ZA 1ZLJA 3WTSC 3BROA 3BZ6A 1XDUA 1OYIA 4BQAA 1I1SA 2QLZA 3GYHX 1Z91A 4KIGA 2HKOA 2OZUA 2ACJA 1RZ4A 1IN7A 4MGRA 4RAYA 1JXSA 3BY6A 3R61A 5HDNA 2M5WA 2HR3A 4AIKA 2VBWA 1MJBA 4LLNA 4WK8F 5A2QZ 1O7LA 1WQ2A 2BE5F 1EH6A 3MZHA 1W5SA 1OMIA 2P5LC 1ON1A 2W85A 2PQ8A 3K0LA 3GFLA 3U2RA 3HSEA 3BWGA 4EJWA 4ON0A 1BBYA 1HSTA 2P7CB 3F8FA 3V7RA 3JSPA 2V79A 3KETA 4HDVA 4EJUA 1LB2A 4Y17A 1J59A 4MTEA 4KIBA 5LEJA 1DPRA 3MWMA 1XD7A 4U0VA 3HUGA 1R1VA 3QOPA 5D6FA 2JT1A 3IWZA 2ESHA 3TDZC 4U7BA 2XAGA 1IUYA 2PMHA 1R22A 4ENKA 2VODA 1HXDA 2E7XA 1J2XA 1I27A 1PP8F 2EK5A 3IKTA 1TNTA 2ETHA 2GAUA 3V8JA 5BS6A 1QPMA 4KYWA 3COAC 4M9SA 1D8JA 3GW2A 2VN2A 2D1HA 3CUQC 3LWFA 4YG2F 3WODF 3ZQ7A 1P2FA 4BHBA 4M72A 2DTRA 4YFKF 2GA1A 1MDMB 5E1WA 3WU1B 2MH9A 4BHPA 3MQ0A 2EFWA 1T39A 1IXCA 2AS5F 2A5YB 4A5NA 1BIBA 1R23A 1WWXA 1L3LA 4GGGA 1FZPB 2L4AA 2EFNA 1K79A 2HOEA 3B02A 3IRRA 4TV7A 4KFCA 1E17A 4XLPF 2W25A 3FM5A 2E7WA 4OU0A 5ILSA 1U6GA 3GLXA 2CQKA 2F5EA 3TOAA 4A6DA 1DDNA 4UXNA 1IN6A 4KUMA 1ZN2A 2EB7A 5L3FA 5IT3A 1SMYF 3WTZA 4A0ZA 1PP7U 4H0EA 4AD9A 3GFJA 1DUXC 4IJAA 1OPCA 5FD6A 3F3XA 3F8MA 1KQ0A 3LSTA 1S7OA 4KN4X 5IT9Z 1EV7A 2WTEA 1ZG3A 2FOKA 1BOAA 2HDCA 3J7AO 2MA3A 3BJOA 4L9JA 2FNAA 1FSHA 4I7HA 1GXQA 4UVAA 3IWFA 4ETSA 1YIOA 3ERED 3GX4X 1KQ8A 4LGWA 3WE3A 5D8LB 2PLYA 1B4AA 4O5VA 1SFEA 1TNSA 5D5UB 4HOBA 3GVAA 2LKPA 2QBYB 1FYLA 2DI3A 3R4KA 4M9XA 4MEYF 1YW8A 4FT8A 2Q0OA 2GIVA 3J81K 2HKXA 2JPBA 4ENMA 3MAJA 1MZBA 3MFKA 1K7AA 3FF5A 2HTSA 1B9NA 3HRUA 2FMLA 5JR3A 2ZNYA 1MJ9A 3RPQA 1KYWA 4BAYA 2ZMEA 1BI0A 1LDDA 2XAFA 1ULYA 2QYOA 3BOQA 3I54A 2DFIA 2FU4A 5BMZA 4GYIA 3V8KA 3F8CA 4AVPA 5BQTA 2G9WA 1Z05A 2KJBA 1K78B 5F1RA 4BXUA 4ZYDA 2CWEA 2H6CA 2NRAC 2W57A 4YFNF 3ZMDA 4LG0A 5HS7A 1DP7P 1ONVA 1R5HA 1KYZA 3HRTA 1AOYA 4EJVA 4B09A 4MTDA 2F2EA 2VT3A 4LLGF 4U0YA 2ZCWA 3U9GA 4MQ9F 3ML6A 1R1UA 2FNPA 3ZMZA 3ISPA 3I59A 1LEBA 2OAZA 2DLLA 1D5VA 4YIIA 3TO7A 1SD5A 2H94A 5HVQC 1Q1HA 3G73A 2STTA 4OIPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G7U A;  3I64 A;  2OQR A;  4JQF A;  1FYM A;  3FWE A;  4A6E A;  4G7O F;  4HBL A;  3SQN A;  1YFH A;  2LNB A;  2XAH A;  2KIF A;  3H92 A;  3F21 A;  1LEA A;  5DYM A;  2HFH A;  3L00 A;  3J80 K;  2PBI A;  1U78 A;  3WGG A;  1B6A A;  1OYY A;  1KGS A;  1FNN A;  4CIC A;  2DBB A;  2JZY A;  1T38 A;  2W84 A;  1HW1 A;  2XKP A;  5ICC A;  2FRH A;  2RQP A;  5L3E A;  3WGH A;  1ZYR F;  2L54 A;  1R36 A;  2MBF A;  2STW A;  1SD4 A;  5F6F A;  3O2P E;  1XSX A;  3LA2 A;  1XGO A;  2M30 A;  1XMK A;  3R60 A;  1I1G A;  2YSR A;  3I5U A;  5DCM B;  3V7S A;  2UWM A;  2IJL A;  2YU3 A;  2M87 A;  1IZ1 A;  2FXA A;  4LK1 F;  4M6Y A;  2L01 A;  3ZMT A;  4N0B A;  4U88 A;  2Q2E A;  3I71 A;  3SZT A;  1BI2 A;  4LK0 F;  1T0F A;  3GFM A;  2MLK A;  3HOS A;  2ZO4 A;  5HS8 A;  4GYG A;  4M71 A;  1ZGJ A;  3C1D A;  1IN4 A;  4MEX F;  4L0Y B;  4MNU A;  1F9N A;  4ENN A;  5CVI A;  5LEK A;  1I6X A;  4JBA A;  3WTT C;  1YQA A;  4XLN F;  2K86 A;  1SMT A;  4KT5 C;  4CDG A;  3HTS B;  1ZRC A;  3T5X A;  2P7V B;  2P4W A;  5BPD A;  4UVC A;  4P96 A;  5EEG A;  3M8F A;  5LRR A;  5E1Z B;  3CUQ B;  3KFW X;  1REP C;  2NYX A;  3F8N A;  4G6Q A;  1YW9 A;  1FBU A;  3AAF A;  4MQV A;  3BPX A;  2EJR A;  1MJA A;  2RC4 A;  3VFZ A;  1U8R A;  3L09 A;  1TQP A;  2DQL A;  2GWR A;  5LRS A;  1HSJ A;  5H6Q A;  2XRO A;  5LGT A;  3T8T A;  4BYY A;  1ZG1 A;  2KKO A;  2CW0 F;  2IT0 A;  2FBH A;  3G3Z A;  4G8X A;  3GXO A;  2V1X A;  5FB2 A;  4BNC A;  4CYD A;  4KNY A;  1YYV A;  2BGC A;  5DV5 A;  3RKY A;  4A5M A;  1HKS A;  2HWV A;  4HX7 A;  2O6G E;  5DDG A;  1W7P A;  1ZHF A;  2QQA A;  4EM0 B;  2A3S A;  2Y48 A;  4G6D A;  4GXO A;  1WSU A;  3ELK A;  3GFI A;  3MCZ A;  2VBY A;  1P4A A;  2IRF G;  2IA1 A;  2YR2 A;  2FSW A;  2B0L A;  1D3Y A;  3RKW A;  1FP2 A;  3KZZ A;  5LHH A;  4ESF A;  1FT9 A;  5A2Q K;  4P9U A;  3DKW A;  5KK1 A;  4Q47 A;  1H0M A;  3F8B A;  2ESN A;  1QZZ A;  4IHS A;  2ZXJ A;  2PI0 A;  2XHK A;  1BIA A;  4L9N A;  5E17 F;  5ICF A;  1T98 A;  3E6D A;  3W6K B;  1XB4 A;  2BEO A;  2DK5 A;  4XSX F;  4K2E A;  5D4R A;  1R1T A;  4GO1 A;  5HS9 A;  2HTJ A;  5J6X A;  3ZMU A;  3LAJ A;  1QQI A;  3VB2 A;  1TLH B;  3DV8 A;  5KVR A;  2ZBK A;  1WRJ A;  2O3F A;  4HF2 A;  2DQR A;  1BC7 C;  2FE3 A;  3JAM Z;  2LF7 A;  4RGS A;  3KCC A;  3C3W A;  4EV0 A;  4HX4 A;  2VE9 A;  4LD5 A;  3QP5 A;  2ZJ2 A;  1UCR A;  3GZ5 A;  5DUK A;  5FFX A;  4R1H A;  3R0A A;  4N9H A;  3E97 A;  3W6J B;  3I58 A;  3K1N A;  3KP3 A;  2P5V A;  3FZV A;  3V4G A;  1RNL A;  1FP1 D;  4FHT A;  2ZNZ A;  3WG9 A;  2KIU A;  3QRF F;  1QGP A;  2FBI A;  2RDP A;  1G3S A;  4KDP A;  2OA4 A;  1MKM A;  4LJZ F;  2CO5 A;  5FD5 A;  4O3M A;  2R7D A;  3ZN1 A;  5AON A;  2NNY A;  2XV4 S;  4I2O A;  4S05 A;  1QBJ A;  3WU0 A;  2H09 A;  4EQQ A;  1WI9 A;  4G94 A;  1LDJ A;  1FWZ A;  2P5K A;  2EWN A;  4I0A A;  4UHT A;  5D5X B;  5CVU A;  2A69 F;  3EQL F;  4I0B A;  3K1M A;  4ZYG A;  1J7K A;  5LHI A;  1OKR A;  4YFX F;  5TRD A;  1T2K A;  1LNW A;  1KA8 A;  3O6B B;  1KU9 A;  1FC3 A;  2VBZ A;  1ZAO A;  2QQ9 A;  3IRQ A;  2DK8 A;  2WV0 A;  2HYF A;  4L5J A;  3V7C A;  4I98 B;  4WF2 A;  1HBX G;  1IXS B;  2JPC A;  5DCF A;  2XRN A;  4I09 A;  1Z9C A;  1RUN A;  2HS5 A;  2R7F A;  2ZKZ A;  5LLQ A;  1A04 A;  2Z9O A;  2EFQ A;  4IVN A;  1TBX A;  1K6O A;  5K5O A;  5HDG A;  2NS0 A;  1SFX A;  3KLO A;  2K4J A;  2IA0 A;  1CF7 A;  5IT9 K;  3FMR A;  4GCV A;  4OMY A;  4IPA A;  3LQR A;  3F22 A;  4O6J A;  3K2Z A;  5FLX Z;  2F5D A;  1U5T B;  3J81 Z;  3TO9 A;  4NB5 A;  1YS6 A;  1BM9 A;  3O3K A;  4QLC U;  4HW0 A;  1IW7 F;  3CDH A;  2RVC A;  4P5O A;  5HLH A;  1IRF A;  2IA2 A;  4HV6 A;  3Q5F A;  1ZGA A;  1ZRD A;  1W7P D;  3TOB A;  1O7F A;  3FMS A;  3RKX A;  2ZME B;  3SXY A;  2HYG D;  3U1D A;  2XVC A;  3PQJ A;  4OIR F;  4M73 A;  4EVI A;  4ZH4 F;  3RI4 A;  2HZT A;  1R00 A;  2Z99 A;  2O8X A;  2OD5 A;  3E5X A;  5FGM A;  2DU9 A;  1LVA A;  1RIO H;  3E6B A;  1T6S A;  3JTG A;  5ERI A;  1BC8 C;  3HYI A;  3C18 A;  3S2W A;  5FO5 A;  4LG0 B;  4OIO F;  4L9T A;  1LJ9 A;  2XAQ A;  5L3G A;  3ZMS A;  2GQQ A;  3FXU A;  4OOI A;  4DQ2 A;  2EA4 A;  1YO5 C;  3TGN A;  2DW4 A;  2AXL A;  1QZY A;  4S04 A;  3HRS A;  4HF1 A;  3H3Z A;  3N4M A;  3ZP5 A;  1YLF A;  4BHC A;  4OMZ A;  3I59 B;  3DP7 A;  2D45 A;  4RAZ A;  2MH2 A;  2Q8K A;  4Q5S F;  2H6B A;  3DEU A;  2CGP A;  2R3S A;  1YTY A;  1ODD A;  4FX0 A;  4LB5 A;  3FX3 A;  2O61 A;  2OQG A;  3D5L A;  4L5I A;  2HEO A;  4ASN A;  1KQ9 A;  1C0W A;  4HV5 A;  3HOT A;  1FSE A;  3IL2 A;  5ILV A;  2JRT A;  2YPR A;  3HIF A;  1XSD A;  2L3D A;  1YS7 A;  5K5R A;  3KP7 A;  3CO7 C;  3L9F A;  5E8G A;  4CXF A;  2IW5 A;  2EA2 A;  5FFZ A;  2D1V A;  2QWW A;  5E8I A;  3CLO A;  3LQQ A;  2UXX A;  3TQN A;  4XBF A;  3F23 A;  3M8E A;  1FPQ A;  5L3D A;  2EV6 A;  2RKH A;  3E6M A;  1FBS A;  2WWY A;  2XAS A;  4LB6 B;  5TJJ A;  3CTA A;  5E20 A;  2E1C A;  1KU2 A;  2QQB A;  4JK1 X;  2Y75 A;  4RB3 C;  3HTU A;  2K7L A;  1YG2 A;  3BP8 A;  2BV6 A;  4WWC A;  2UZK A;  2VT2 A;  2MLG A;  4WXH A;  3P9I A;  1O57 A;  5D4S A;  3TO6 A;  1KU7 A;  1TTY A;  1ON2 A;  1Z6R A;  3T1B A;  2XKO A;  1STZ A;  3I0T A;  1UHW A;  2DAO A;  3ULQ B;  3DF8 A;  3VOD A;  4G9Y A;  5K5Q A;  3I4P A;  3R0J A;  3K69 A;  4RGX A;  1HW5 A;  4ESB A;  2COM A;  4ZYH A;  5J8F A;  1D8K A;  1PDN C;  1R58 A;  4A2U A;  2A6E F;  2M8E A;  2GA2 A;  2FQ3 A;  1O3Q A;  3GWZ A;  1Z7U A;  4DNC A;  1ZG5 A;  3IKV A;  3SHF A;  3QPH A;  4R8H A;  2RV8 A;  4HA8 A;  1EH7 A;  3RDI A;  3RIR A;  2QEN A;  3HHG A;  2EFP A;  2A6H F;  4D0P A;  2M1B A;  4RB1 A;  3DPL C;  1BI1 A;  1FBQ A;  1TQI A;  3LAP A;  4OIN F;  1XGM A;  2JSC A;  3NRV A;  3BJA A;  4RB2 C;  2M45 A;  4L0Z B;  3GZ6 A;  2F5F A;  4RGR A;  2Z33 A;  3K1P A;  1W5T A;  5HOO A;  4P9F A;  3E5U A;  4PGG A;  1MGT A;  5BOX A;  1ZLK A;  3CJN A;  3ZPL A;  3P9C A;  3EET A;  1TW3 A;  3SFZ A;  3QAH A;  3WTW C;  1O3T A;  3FHZ A;  3GF2 A;  2E1N A;  1W7P B;  2PJP A;  4I01 A;  3DXJ F;  5DEQ A;  1IN8 A;  3GEZ A;  4LFU A;  4HLX A;  1WKM A;  3M9A A;  2X4H A;  1IF1 A;  1B59 A;  4UUV A;  2HQR A;  1IAW A;  4P55 A;  3SZP A;  3EYY A;  1ZAR A;  3EUH A;  2NAZ A;  3RTR A;  2YX4 A;  4PGH A;  4WCG A;  2LDU A;  2Y0M A;  2P6S A;  2RGV A;  2UXN A;  3QP6 A;  1F5T A;  5CJ9 A;  4UVB A;  3C7J A;  2KIM A;  4CO8 A;  3OV8 A;  3I53 A;  5CLS A;  1H9T A;  3VEP A;  3M1E A;  2P6T A;  3L2C A;  4Y13 A;  3HSR A;  4LLL A;  3ROU A;  2PEX A;  1SFU A;  2YX7 A;  3RYP A;  4IHT A;  4CZZ A;  1E2X A;  3KEQ A;  4EGZ A;  1OYW A;  1RI7 A;  2KJC A;  2ZFW A;  1UST A;  1P92 A;  3Q9S A;  2VON A;  2NNN A;  1HW2 A;  1G3W A;  1S3J A;  1BI3 A;  2VOO A;  4FX4 A;  3FXQ A;  4IXA A;  1GXP A;  4WXD A;  4XSZ F;  2LSO A;  2VC0 A;  1UFM A;  3GUD A;  3N97 A;  1XCV A;  3DQV C;  4U0W A;  2TDX A;  3QU3 A;  4L9V A;  2PG4 A;  3LA7 A;  3KEO A;  5CVV A;  2HQN A;  2PFB A;  4MHG A;  1J75 A;  3ECO A;  4Q48 A;  3R6S A;  3JAM K;  1G4D A;  1KU3 A;  2W24 A;  2RN7 A;  3JSO A;  2A68 F;  1S8N A;  6PAX A;  4UV8 A;  5HDK A;  3IHU A;  1BJA A;  5JHU A;  3F6V A;  1MDM A;  2O0Y A;  2QZ8 A;  1X3U A;  5CVJ A;  2FBK A;  4KN7 X;  2A61 A;  4HQM A;  2VOP A;  2L02 A;  2V1U A;  2V9V A;  1TQM A;  5HLG A;  2J5O A;  4M74 A;  3HSF A;  4EMS A;  4B8X A;  3HRM A;  2GXG A;  2F5C A;  1IRG A;  1SD7 A;  1XCB A;  1G3T A;  4HF0 A;  3D0S A;  5L3C A;  5H20 A;  4HAM A;  4UV9 A;  3FM3 A;  4BH9 A;  1XMA A;  2H27 A;  4AWX B;  4Q4Z F;  4ENJ A;  1V4R A;  4ZYE A;  5ICG A;  4N9I A;  2X0L A;  1HKT A;  1SD6 A;  5LBQ A;  4EJT A;  1HKQ A;  1QO0 D;  2O03 A;  2XUB A;  3F6O A;  3P7N A;  2EV5 A;  4L18 B;  1CF7 B;  5JI6 A;  5ILU A;  1H9G A;  4QWQ A;  2LF8 A;  2ISZ A;  3ABU A;  4NHJ A;  3NEU A;  5JFR A;  1Z1D A;  2P8T A;  4AIJ A;  2IPQ X;  2ADU A;  4LMY A;  1JGS A;  4KMU X;  1ZRE A;  4HYE A;  2IP2 A;  1F4K A;  4ESJ A;  2PMU A;  1GHC A;  4RB0 A;  1O3R A;  5K1Y A;  1UHM A;  3KZY A;  5AIP A;  4IRG A;  3FXR A;  3LA3 A;  3KP2 A;  5HLI A;  3T8R A;  2MC3 A;  3WTU C;  5FLX K;  1U5T A;  3T0Y A;  1S6L A;  2Z5U A;  2ELH A;  2VBX A;  3BDD A;  1XDS A;  1XSV A;  3ABT A;  3B73 A;  2QBY A;  2D2W A;  1L0O C;  4HQE A;  5CVR A;  1AWC A;  1BN5 A;  4RGU A;  5LGN A;  1FX7 A;  4PZJ A;  3E3V A;  3WTX C;  5D5W B;  3HHH A;  2XGX A;  4AIH A;  3BPV A;  4YIF A;  4A0Y A;  5L3B A;  1LDK B;  4HDU A;  1P4X A;  2V1D A;  1J5Y A;  4M6X A;  3WE2 A;  4EGY A;  2OU2 A;  2J5P A;  3F72 A;  3EDP A;  1G6N A;  5DD8 A;  3KP5 A;  1IXR C;  1JHF A;  2IVM A;  3ZN0 A;  5D8K B;  4F7Z A;  2KRF A;  3JW4 A;  3QPT A;  1K78 A;  1Z6T A;  4ZZD A;  2DO7 A;  2K27 A;  4EM2 A;  4R79 A;  1U3E M;  2PN6 A;  1SAX A;  5J8C A;  1P4W A;  3ECH A;  2FF4 A;  3OOP A;  3PFI A;  1QNT A;  5D6E A;  5JVT A;  2QVO A;  1IN5 A;  4KIF A;  4Y15 A;  2K4B A;  4U7D A;  3KE2 A;  4WXC A;  2EFO A;  2JTV A;  1NHA A;  1FOK A;  2CYY A;  2RNJ A;  1ZRF A;  1MD0 A;  4I02 A;  4CHU A;  1VTN C;  3CUO A;  1V3F A;  3RJP A;  2L4M A;  1W4M A;  3REO A;  2ISY A;  2CSO A;  4A0X A;  2DPU A;  1USS A;  4G7Z F;  3J80 Z;  4IRI A;  1G3Y A;  4KA4 A;  2A07 F;  2VC1 A;  4A12 A;  5LGU A;  2GZW A;  2VXZ A;  1CGP A;  1DPU A;  3LFK A;  1O3S A;  3DFG A;  1YW7 A;  5LHG A;  2C6Y A;  5ICE A;  5E1X A;  1XGN A;  3P9K A;  1FLI A;  2QM3 A;  1JHH A;  1HQC A;  2Z3Y A;  1JE8 A;  2OZ6 A;  3DPT A;  4HLY A;  1XN7 A;  1U2W A;  5AIQ A;  3IC7 A;  3KLN A;  3JTH A;  4IRH A;  5CYV A;  1J9I A;  3KP4 A;  1U5T C;  4E70 A;  5H6R A;  1P6R A;  4EJO A;  1XGS A;  2XAJ A;  5DD4 A;  3E6C C;  2DT5 A;  2HGC A;  3RYR A;  5F64 A;  3TDU C;  4ZZL A;  1TW2 A;  2OBP A;  2BYV E;  1RUO A;  3K9T A;  3WGI A;  2WC2 A;  2G7H A;  2VE8 A;  3MZY A;  3L7W A;  1FY7 A;  3TKY A;  5DUI A;  5EEH A;  1I5Z A;  2MD5 A;  1OR7 A;  1Y0U A;  3E5Q A;  3RPU A;  4WX9 A;  4OIQ F;  3NQO A;  2K02 A;  5DCM A;  1GVJ A;  5ED4 A;  2CG4 A;  2FMY A;  3QU6 A;  3ZMV A;  1ZH5 A;  4EM1 A;  1EH8 A;  3MEX A;  1PUE E;  4PDK A;  3VOE A;  4PCQ A;  2V6C A;  4KIC A;  3GO5 A;  4KMF A;  1F1Z A;  5BPI A;  4UNO A;  2GXB A;  2BBY A;  3EYI A;  3CO6 C;  1R5G A;  3H3U A;  3WTY C;  1LQ1 A;  3V8L A;  3WTV C;  4HZF A;  4IF4 A;  2CFX A;  3Q9V A;  2DPD A;  3M7G A;  1B9M A;  1R7J A;  4Z2Y A;  4HX8 A;  5D5V B;  4RS8 A;  1J0R A;  2FA5 A;  2QUF A;  1B1B A;  4NQW A;  5E18 F;  4G7H F;  2FEZ A;  1S7A A;  3KP6 A;  2EV0 A;  4XRF A;  3FMQ A;  1FYK A;  3CUQ A;  3PQK A;  1UB9 A;  3BJ6 A;  1S29 A;  2XIG A;  4CGZ A;  4M9Z A;  1ZLJ A;  3WTS C;  3BRO A;  3BZ6 A;  1XDU A;  1OYI A;  4BQA A;  1I1S A;  2QLZ A;  3GYH X;  1Z91 A;  4KIG A;  2HKO A;  2OZU A;  2ACJ A;  1RZ4 A;  1IN7 A;  4MGR A;  4RAY A;  1JXS A;  3BY6 A;  3R61 A;  5HDN A;  2M5W A;  2HR3 A;  4AIK A;  2VBW A;  1MJB A;  4LLN A;  4WK8 F;  5A2Q Z;  1O7L A;  1WQ2 A;  2BE5 F;  1EH6 A;  3MZH A;  1W5S A;  1OMI A;  2P5L C;  1ON1 A;  2W85 A;  2PQ8 A;  3K0L A;  3GFL A;  3U2R A;  3HSE A;  3BWG A;  4EJW A;  4ON0 A;  1BBY A;  1HST A;  2P7C B;  3F8F A;  3V7R A;  3JSP A;  2V79 A;  3KET A;  4HDV A;  4EJU A;  1LB2 A;  4Y17 A;  1J59 A;  4MTE A;  4KIB A;  5LEJ A;  1DPR A;  3MWM A;  1XD7 A;  4U0V A;  3HUG A;  1R1V A;  3QOP A;  5D6F A;  2JT1 A;  3IWZ A;  2ESH A;  3TDZ C;  4U7B A;  2XAG A;  1IUY A;  2PMH A;  1R22 A;  4ENK A;  2VOD A;  1HXD A;  2E7X A;  1J2X A;  1I27 A;  1PP8 F;  2EK5 A;  3IKT A;  1TNT A;  2ETH A;  2GAU A;  3V8J A;  5BS6 A;  1QPM A;  4KYW A;  3COA C;  4M9S A;  1D8J A;  3GW2 A;  2VN2 A;  2D1H A;  3CUQ C;  3LWF A;  4YG2 F;  3WOD F;  3ZQ7 A;  1P2F A;  4BHB A;  4M72 A;  2DTR A;  4YFK F;  2GA1 A;  1MDM B;  5E1W A;  3WU1 B;  2MH9 A;  4BHP A;  3MQ0 A;  2EFW A;  1T39 A;  1IXC A;  2AS5 F;  2A5Y B;  4A5N A;  1BIB A;  1R23 A;  1WWX A;  1L3L A;  4GGG A;  1FZP B;  2L4A A;  2EFN A;  1K79 A;  2HOE A;  3B02 A;  3IRR A;  4TV7 A;  4KFC A;  1E17 A;  4XLP F;  2W25 A;  3FM5 A;  2E7W A;  4OU0 A;  5ILS A;  1U6G A;  3GLX A;  2CQK A;  2F5E A;  3TOA A;  4A6D A;  1DDN A;  4UXN A;  1IN6 A;  4KUM A;  1ZN2 A;  2EB7 A;  5L3F A;  5IT3 A;  1SMY F;  3WTZ A;  4A0Z A;  1PP7 U;  4H0E A;  4AD9 A;  3GFJ A;  1DUX C;  4IJA A;  1OPC A;  5FD6 A;  3F3X A;  3F8M A;  1KQ0 A;  3LST A;  1S7O A;  4KN4 X;  5IT9 Z;  1EV7 A;  2WTE A;  1ZG3 A;  2FOK A;  1BOA A;  2HDC A;  3J7A O;  2MA3 A;  3BJO A;  4L9J A;  2FNA A;  1FSH A;  4I7H A;  1GXQ A;  4UVA A;  3IWF A;  4ETS A;  1YIO A;  3ERE D;  3GX4 X;  1KQ8 A;  4LGW A;  3WE3 A;  5D8L B;  2PLY A;  1B4A A;  4O5V A;  1SFE A;  1TNS A;  5D5U B;  4HOB A;  3GVA A;  2LKP A;  2QBY B;  1FYL A;  2DI3 A;  3R4K A;  4M9X A;  4MEY F;  1YW8 A;  4FT8 A;  2Q0O A;  2GIV A;  3J81 K;  2HKX A;  2JPB A;  4ENM A;  3MAJ A;  1MZB A;  3MFK A;  1K7A A;  3FF5 A;  2HTS A;  1B9N A;  3HRU A;  2FML A;  5JR3 A;  2ZNY A;  1MJ9 A;  3RPQ A;  1KYW A;  4BAY A;  2ZME A;  1BI0 A;  1LDD A;  2XAF A;  1ULY A;  2QYO A;  3BOQ A;  3I54 A;  2DFI A;  2FU4 A;  5BMZ A;  4GYI A;  3V8K A;  3F8C A;  4AVP A;  5BQT A;  2G9W A;  1Z05 A;  2KJB A;  1K78 B;  5F1R A;  4BXU A;  4ZYD A;  2CWE A;  2H6C A;  2NRA C;  2W57 A;  4YFN F;  3ZMD A;  4LG0 A;  5HS7 A;  1DP7 P;  1ONV A;  1R5H A;  1KYZ A;  3HRT A;  1AOY A;  4EJV A;  4B09 A;  4MTD A;  2F2E A;  2VT3 A;  4LLG F;  4U0Y A;  2ZCW A;  3U9G A;  4MQ9 F;  3ML6 A;  1R1U A;  2FNP A;  3ZMZ A;  3ISP A;  3I59 A;  1LEB A;  2OAZ A;  2DLL A;  1D5V A;  4YII A;  3TO7 A;  1SD5 A;  2H94 A;  5HVQ C;  1Q1H A;  3G73 A;  2STT A;  4OIP F; 
#chains in the Genus database with same CATH topology
 1IUF A;  2G7U A;  1TWH J;  1M1E B;  2DT6 A;  3I64 A;  2OQR A;  4CH7 A;  3A02 A;  1A5J A;  2L9V A;  2EIM H;  4JQF A;  1FYM A;  4YEL A;  1S9H A;  4E7I A;  3FWE A;  2ICW G;  1MNE A;  4A6E A;  1IGN A;  4G7O F;  1FTT A;  3VYS B;  3A01 A;  4HBL A;  3DU5 A;  3SQN A;  4BGD A;  1YFH A;  1MNM C;  2LNB A;  2XAH A;  1VQO I;  1YX5 A;  2KIF A;  3H92 A;  5J3L A;  3F21 A;  1P7I A;  3QWL A;  1W1W E;  4ZTJ A;  1A6Q A;  1LEA A;  5DYM A;  2HFH A;  3L00 A;  2R93 J;  3J80 K;  3GTJ J;  2PBI A;  1U78 A;  5GPA A;  2V9K A;  3WGG A;  1B6A A;  1OYY A;  1KGS A;  5GAE J;  1J09 A;  1FOX A;  1FNN A;  4D1Q A;  1EJ9 A;  4CIC A;  2H8R A;  2DBB A;  4CCN A;  2JZY A;  2F6C A;  3PIO F;  1T38 A;  2R7Q A;  2W84 A;  3CMM A;  1HW1 A;  3LFU A;  2XKP A;  5ICC A;  1OCR H;  2ELJ A;  2FRH A;  2RQP A;  2L9S A;  4BQQ A;  1NK3 P;  5L3E A;  3WGH A;  1ZYR F;  2K3F A;  2L54 A;  2OCE A;  2W7N A;  4IHV A;  1R36 A;  2MBF A;  2Z2S B;  4AUX A;  2STW A;  2CFO A;  1SD4 A;  3MKY B;  1D1C A;  5F6F A;  1HF0 A;  3DLA A;  4LIT A;  1HLV A;  4DW6 A;  1S7E A;  3O2P E;  1TWC J;  1MMD A;  1XSX A;  3LA2 A;  4BU2 A;  2QF7 A;  1QU3 A;  1XGO A;  4I6Z A;  2M30 A;  1XMK A;  3R60 A;  2ZME C;  4G12 A;  2F4O B;  1I1G A;  4V2G A;  2YSR A;  3I5U A;  3FXL A;  5DCM B;  2W82 A;  3V7S A;  2UWM A;  2IJL A;  2YU3 A;  4AID A;  3LSJ A;  2M87 A;  4FIS A;  1IZ1 A;  3RSN A;  5EZG A;  1POG A;  3SEZ A;  1GV2 A;  2FXA A;  3MKW B;  3K4J A;  4XOR A;  2M7B A;  3DBH B;  4A3B J;  3GTM J;  5K7Z A;  2L2O A;  2E19 A;  4LK1 F;  4M6Y A;  2L01 A;  1N75 A;  3ZMT A;  3FBI B;  4N0B A;  4PSX A;  1B8I A;  2MD0 A;  2Z16 A;  4U88 A;  2LFB A;  4QSH A;  2LC2 A;  2Q2E A;  1WJE A;  3I71 A;  3SZT A;  1BI2 A;  4LK0 F;  1T0F A;  1IRZ A;  4PJJ A;  1OJL A;  3GFM A;  2MLK A;  5IP7 J;  3D1N I;  4RM2 A;  2DT7 B;  3HOS A;  2ZO4 A;  5HS8 A;  4GYG A;  3SJM A;  2VPL A;  2N8G A;  3CCY A;  4XRM A;  3G2B A;  4M71 A;  1E0E A;  1ZGJ A;  3C1D A;  1IN4 A;  4MEX F;  2WBM A;  4L0Y B;  4MNU A;  2Y69 H;  1F9N A;  1OCT C;  4ENN A;  5CVI A;  1JJ6 C;  1GLN A;  5LEK A;  1I6X A;  3MKZ A;  4JBA A;  1IJW C;  3BCA A;  3VDX A;  5GP9 A;  3WTT C;  1YQA A;  3M07 A;  4XLN F;  3F0C A;  1F43 A;  1A36 A;  2K86 A;  1SMT A;  3BG7 A;  4KT5 C;  1Z7L A;  4BEH A;  2X6O A;  3NAU A;  3Q0V A;  4CDG A;  4A93 J;  1Z67 A;  3HTS B;  1MSE C;  2LY9 A;  4PFP A;  3ZQF A;  1ZRC A;  3BTI A;  3CME I;  2GXA A;  3T5X A;  4CA0 A;  2P7V B;  2P4W A;  4HNV A;  5E3N A;  2EZH A;  1RET A;  5BPD A;  4UVC A;  4P96 A;  5EEG A;  1FEX A;  3M8F A;  3PUF A;  1OCO H;  2OUM A;  5LRR A;  5E1Z B;  3CUQ B;  3KFW X;  2X6X A;  5EG0 A;  4B44 A;  1R9T J;  4IOA F;  1REP C;  2NYX A;  1KON A;  5LD2 C;  5K7F A;  3F8N A;  2HYJ A;  2L7M P;  4G6Q A;  1R49 A;  1YW9 A;  1VFC A;  1FIA A;  1FBU A;  3AAF A;  4MQV A;  3BPX A;  2EJR A;  3GTL J;  1MJA A;  2RC4 A;  3VFZ A;  4V2F A;  1U8R A;  3L09 A;  1TQP A;  4XOT A;  2DQL A;  2GWR A;  5B1A H;  5LRS A;  4FCY A;  3S3N A;  5E3M A;  1HSJ A;  3DTI A;  1FIP A;  5H6Q A;  3OSF A;  2XRO A;  2EIK H;  2KQR A;  1WJF A;  5LGT A;  3CDI A;  2BVM A;  4FE7 A;  3T8T A;  4BYY A;  2KKO A;  1ZG1 A;  4M3D A;  1PUF B;  2CW0 F;  2IT0 A;  2XPV A;  2FBH A;  3G3Z A;  4G8X A;  3HBL A;  3GXO A;  4D5C A;  2A05 A;  2V1X A;  2X85 A;  2XGE A;  5FB2 A;  3ZQL A;  4X1E A;  4BNC A;  3VYT B;  3OIP A;  4CYD A;  4KNY A;  1YYV A;  3I4N J;  2BGC A;  2VJ5 A;  3PUB A;  3HOV J;  5DV5 A;  1SC7 A;  4B3X A;  3K4C A;  3RKY A;  1VQP I;  1LE8 A;  2IS4 A;  2DFE A;  2K9M A;  3A1Y A;  3D5S C;  2NVU B;  2JVG A;  5C4X J;  3DTE A;  2DMQ A;  2HOS A;  2XRL A;  3FXK A;  4A5M A;  4HNT A;  1HKS A;  2HWV A;  4PFO A;  4HX7 A;  4N4O B;  2O6G E;  5DDG A;  1W7P A;  4X6A J;  4UB8 C;  1EKE A;  2JUG A;  1ZHF A;  2QQA A;  1PYV A;  2V1N A;  3K2A A;  2M34 A;  4A3C J;  4EM0 B;  2A3S A;  2Y48 A;  4G6D A;  3I56 I;  4GXO A;  1WSU A;  3ELK A;  3OYN A;  3GFI A;  3ZQG A;  3HOZ J;  3MCZ A;  2VKV A;  2EIL H;  4AC0 A;  3S1Q J;  2QSH X;  1WGX A;  2VBY A;  4DBQ A;  4A3M J;  1P4A A;  2IRF G;  1VI0 A;  2IA1 A;  2BW3 B;  2YR2 A;  2FSW A;  2B0L A;  1D3Y A;  1Z3Y A;  4CCM A;  3OYM A;  3RKW A;  1FP2 A;  3ASO H;  4UY8 I;  3KZZ A;  1TT0 A;  5LHH A;  4ESF A;  2NOJ B;  1FT9 A;  5A2Q K;  1VQL I;  4P9U A;  1Y39 A;  3H0G J;  3DKW A;  5KK1 A;  2R7S A;  1X1B A;  4Q47 A;  1H0M A;  4BUP A;  2JA2 A;  3F8B A;  2ESN A;  1JKQ C;  1DGR M;  3S14 J;  3P5J A;  1T0F C;  2R5Y B;  1QZZ A;  4XNF A;  4IHS A;  2E71 A;  2R7T A;  2ZXJ A;  2PI0 A;  2LBF A;  2XHK A;  2MSY A;  3FKJ A;  2VAS A;  2KDZ A;  2KMU A;  2WAF A;  1BIA A;  4L9N A;  5E17 F;  3M3Y J;  5ICF A;  1T98 A;  3E6D A;  2L5Q A;  3C2B A;  5KAI C;  3GLL A;  3W6K B;  4BBR J;  1XB4 A;  2G0E A;  2BEO A;  2M8G X;  1JT6 A;  4S0H B;  2DK5 A;  4XSX F;  3H3V K;  4K2E A;  5D4R A;  1R1T A;  3CJR B;  4JX4 A;  3H5R A;  2QGU A;  4GO1 A;  1BW6 A;  1MSF C;  5HS9 A;  2HTJ A;  5J6X A;  3DEE A;  3ZMU A;  2HOT A;  1B72 B;  3CCE I;  2VIX A;  3LAJ A;  2R5Z B;  3S32 A;  1QQI A;  4GFB A;  1E3P A;  3TMO A;  3KYC B;  3VB2 A;  1TLH B;  3DV8 A;  2Y9Y A;  3W2A A;  5KVR A;  2ZBK A;  1DGW Y;  1WRJ A;  2O3F A;  4HF2 A;  3MMY B;  1ORK A;  2DQR A;  2HOA A;  1YI2 I;  2JA5 J;  3H35 A;  2MAB A;  2FE3 A;  1BC7 C;  3JAM Z;  2LF7 A;  4RGS A;  2VLA A;  4DGW B;  3KCC A;  3C3W A;  5F08 A;  4EV0 A;  1QHG A;  4HX4 A;  1LUJ B;  4DZJ A;  2VE9 A;  4LD5 A;  1W0U A;  3QP5 A;  2ZJ2 A;  1UCR A;  3GZ5 A;  5DUK A;  5FFX A;  4QTR A;  1LPQ A;  4R1H A;  1IDZ A;  3R0A A;  4N9H A;  4RAG A;  3E97 A;  3W6J B;  3I58 A;  1IC8 A;  3JRD A;  1ZTR A;  1LFP A;  3K1N A;  3KP3 A;  4CCK A;  2P5V A;  5GAH J;  2CQN A;  3FZV A;  1RNL A;  1FP1 D;  2M7A A;  3V4G A;  4FHT A;  3AL0 B;  2VKD A;  2ZNZ A;  3WG9 A;  3PNT A;  3GTO J;  2KIU A;  3FXJ A;  4EEF G;  2W48 A;  2CS3 A;  1QGP A;  3H5A A;  3QRF F;  2IS1 A;  2FBI A;  2RDP A;  1G3S A;  4KDP A;  2OA4 A;  1MKM A;  4LJZ F;  2CO5 A;  3JRE A;  1HC8 A;  1Z21 A;  5FD5 A;  3K7A J;  2YU9 J;  3H0D A;  3FXO A;  1X1P A;  4O3M A;  2R7D A;  2VQG A;  3ZN1 A;  5AON A;  2ZXH A;  1VQM I;  1GT0 C;  2NNY A;  2XV4 S;  3H36 A;  4I2O A;  1JJ8 C;  4S05 A;  5JVG F;  1YIJ I;  1QBJ A;  3A2K A;  3WU0 A;  2H09 A;  2QEX I;  4XKC A;  4EQQ A;  1WI9 A;  4G94 A;  1LDJ A;  1FWZ A;  2P5K A;  4C3I J;  2VJJ A;  1MMN A;  2EWN A;  2FOW A;  4I0A A;  1G8X A;  4UHT A;  5B1B H;  3KX2 A;  2OJE D;  5CVU A;  5D5X B;  2A69 F;  3EQL F;  3OYH A;  1H88 C;  4I0B A;  3K1M A;  2CQQ A;  1J7K A;  4ZYG A;  4F55 A;  5CQG A;  5LHI A;  3CES A;  1OKR A;  4BAC A;  2VUM J;  1WHU A;  3EUH C;  4BJ6 C;  3BR1 A;  4YFX F;  5TRD A;  1T2K A;  4KIS A;  1LNW A;  2XB5 A;  5KCM A;  1KA8 A;  3O6B B;  5E3O A;  5FKL A;  5B3S H;  1KU9 A;  4A3G J;  1YIT I;  4IHX A;  1FC3 A;  2VBZ A;  3M1C A;  3QQA A;  2LRE A;  1ZAO A;  2QQ9 A;  4HEA 2;  2DK8 A;  2WV0 A;  3IRQ A;  2HYF A;  4L5J A;  3V7C A;  4I98 B;  1JKP C;  4WF2 A;  4XLH A;  3UR3 C;  1IXS B;  2JPC A;  1HBX G;  2PJR A;  4FE4 A;  5DCF A;  2XRN A;  5IY5 H;  2LVS A;  4I09 A;  2DOD A;  2I5U A;  2KHM A;  3FHN A;  1Z9C A;  1RUN A;  3BQY A;  2HS5 A;  2R7F A;  2ZKZ A;  5LLQ A;  2VQL A;  3OSG A;  1A04 A;  1W5C C;  2DOE A;  2EFQ A;  4IVN A;  1FJL A;  2Z9O A;  1TBX A;  3TBI A;  4CYC A;  1K6O A;  3ONQ A;  5K5O A;  5HDG A;  3OS2 A;  1IO2 A;  4XK4 A;  3CQZ J;  1R5I D;  2NS0 A;  2K9S A;  1SFX A;  4E6K G;  1ERD A;  3KLO A;  2K4J A;  3G1M A;  2IA0 A;  1CF7 A;  5IT9 K;  3FMR A;  3AG2 H;  4GCV A;  1QPI A;  4B4C A;  4OMY A;  4IPA A;  2M4K A;  4QIW N;  1VQN I;  3LQR A;  3F22 A;  4O6J A;  3K2Z A;  5FLX Z;  2F5D A;  1U5T B;  4LIU A;  3J81 Z;  3CCS I;  3TO9 A;  4NNJ A;  2EZI A;  4NB5 A;  1YS6 A;  1BM9 A;  3O3K A;  4QLC U;  1TWF J;  4NDL A;  2ZJQ F;  4HW0 A;  3HGG A;  3LMM A;  1IW7 F;  2KZG A;  3CDH A;  2CV0 A;  2RVC A;  4P5O A;  3HGY A;  5HLH A;  1IRF A;  2IA2 A;  4HV6 A;  4QPO A;  4BY1 J;  1TWA J;  4B47 A;  3Q5F A;  1ZGA A;  1ZRD A;  4IHY A;  1W7P D;  1HA8 A;  3PO2 J;  3CCQ I;  3TOB A;  2R92 J;  1O7F A;  3FMS A;  2Z1D A;  3RKX A;  2M0C A;  4BQO A;  2ZME B;  3SXY A;  3O8H A;  3SFI A;  2HYG D;  1T08 B;  3U1D A;  3PNY A;  4E7K A;  2RQQ A;  2WB1 A;  3KEY A;  2XVC A;  1D0Z A;  1ENH A;  3JRA A;  3PQJ A;  2LK2 A;  4OIR F;  4M73 A;  2LKS A;  2DXI A;  3A0H C;  4EVI A;  4ZH4 F;  3RI4 A;  1VZ0 A;  2R7O A;  1Z77 A;  1BOB A;  2HZT A;  1R00 A;  2Z99 A;  3ZQC A;  2O8X A;  2EH3 A;  3C2H A;  1MBJ A;  1SAU A;  3S2H J;  2OD5 A;  3E5X A;  2L7F P;  1YE9 A;  5FGM A;  2DU9 A;  1LVA A;  1RIO H;  1AKH B;  3E6B A;  1T6S A;  4Y7N J;  3JTG A;  3CF5 F;  5ERI A;  1BC8 C;  2DTZ A;  3HYI A;  1TT5 B;  5HLT A;  3OIO A;  3C18 A;  3S2W A;  3W2W A;  5FO5 A;  4LG0 B;  4OIO F;  4L9T A;  3SZG A;  1LJ9 A;  2XAQ A;  3NAR A;  3AG1 H;  5L3G A;  3ZMS A;  4B43 A;  4BJT A;  2GQQ A;  2LY2 A;  3OYG A;  1E3O C;  2EBI A;  2E35 A;  2WY8 Q;  2MYS A;  3FXU A;  2ZSH B;  5EDN A;  5FKO A;  2V4J C;  1EF4 A;  4OOI A;  4DQ2 A;  2XSJ C;  2EA4 A;  2PMZ A;  4PSW A;  3HJE A;  1TP4 A;  4NC6 A;  1X1D A;  4BKX A;  3KYD B;  1YO5 C;  3BZK A;  3TGN A;  2AQE A;  2DW4 A;  2AXL A;  1QZY A;  2JA7 J;  2BVL A;  2H1L A;  3W6V A;  1I39 A;  2VKH A;  4S04 A;  3HRS A;  2ELK A;  3I9V 2;  4C2M J;  2CUJ A;  4HF1 A;  1I3Q J;  3H3Z A;  3HPG A;  1MH4 A;  4IOC F;  2KZV A;  3N4M A;  3ZP5 A;  3H5N A;  1YLF A;  4BHC A;  4OMZ A;  3I59 B;  5FJ8 J;  3DP7 A;  2D45 A;  1X58 A;  2QA4 I;  3IP4 B;  5FKM A;  2CV1 A;  3QYB A;  4RAZ A;  3NWT A;  2BXZ A;  2HPM A;  1JTX A;  2MH2 A;  2Q8K A;  1JKR C;  3HDD A;  4Q5S F;  2DN0 A;  2H6B A;  3DEU A;  2CGP A;  5IPA A;  2R3S A;  1RR7 A;  1ODD A;  4FX0 A;  1YTY A;  4LB5 A;  3FX3 A;  2O61 A;  2OQG A;  3D5L A;  4L5I A;  3HC7 A;  2HEO A;  2WAQ A;  1LVK A;  4ASN A;  4NC8 A;  1KQ9 A;  3A01 B;  2CUZ A;  1C0W A;  2DYS H;  4HV5 A;  4C30 A;  3TED A;  2DOF A;  3HOT A;  1FSE A;  1VQ5 I;  2NS7 A;  1SVO A;  3RZO J;  5LFA A;  3QOD A;  1WH5 A;  5ILV A;  2LOO A;  3IL2 A;  3FKI J;  4D9J A;  5EGO A;  2JRT A;  2YPR A;  3HIF A;  1XSD A;  2R7X A;  3CJT B;  2L3D A;  5IYC J;  1YS7 A;  5K5R A;  3KP7 A;  3CO7 C;  3L9F A;  5E8G A;  1Z0X A;  2E34 A;  4CXF A;  2IW5 A;  4Y52 J;  5FLV A;  2EA2 A;  1LFU P;  2CUE A;  2KIQ A;  5FFZ A;  2D1V A;  2QWW A;  5E8I A;  1XTA A;  2HXO A;  3CLO A;  3LQQ A;  3Q0U A;  1N78 A;  1QVT A;  3GTG J;  2UXX A;  4HG2 A;  2ZSI B;  3CMA I;  3TQN A;  2PX9 A;  2ZC2 A;  3G1L A;  4OWR B;  4XBF A;  1QRY A;  3IAM 2;  1X2M A;  3F23 A;  3M8E A;  3WHC A;  2KFD A;  1FPQ A;  5L3D A;  3LSK A;  2EV6 A;  2RKH A;  3E6M A;  3CCM I;  3SDB A;  3ESW B;  1FBS A;  4XRS A;  2WWY A;  2XAS A;  3CC4 I;  4LB6 B;  3OYK A;  1WJ5 A;  2KRH A;  4C2T A;  5TJJ A;  3CTA A;  2HQA A;  5E20 A;  2E1C A;  1KU2 A;  2IGO A;  1HCR A;  2QQB A;  4JK1 X;  1UEL B;  2Y75 A;  4RB3 C;  1A35 A;  4BDY A;  1OCP A;  3HTU A;  3UNG C;  1B8I B;  2K7L A;  1YG2 A;  2Q2E B;  3BP8 A;  5FRO A;  2BV6 A;  4WWC A;  2UZK A;  1YX3 A;  2KL4 A;  1WJC A;  3M8J A;  1LKX A;  2VT2 A;  2ECB A;  2HNH A;  2MLG A;  3UKG A;  2XF7 A;  4WXH A;  2UV1 A;  3P9I A;  3BR3 A;  4RLQ A;  1O57 A;  2OF7 A;  5B66 C;  4KIT B;  5D4S A;  3TO6 A;  1KU7 A;  2HVS A;  5IP6 A;  1TTY A;  1ON2 A;  3IH2 A;  1NK2 P;  3HXL A;  1Z6R A;  3DEW A;  3T1B A;  3GCM A;  2DFH A;  2XKO A;  1STZ A;  3I0T A;  4KJZ A;  1UHW A;  1Y1V J;  2DAO A;  1WCM J;  1D1A A;  3ULQ B;  5IOY A;  3EUK L;  4II2 A;  3DF8 A;  3VOD A;  4C3H J;  4G9Y A;  5K5Q A;  3PSF A;  4MFE A;  4BEH B;  1SVL A;  4XKW A;  3I4P A;  1WFX A;  3R0J A;  4AM3 A;  5F0C A;  2CUF A;  3K69 A;  5J4V A;  1JT0 A;  4RGX A;  1HW5 A;  1U9O A;  3PFY A;  3VYU B;  1WH7 A;  4ESB A;  2COM A;  4ZYH A;  5J8F A;  1D8K A;  1PDN C;  1R58 A;  5IYD J;  3BLY A;  4ZJZ A;  4A2U A;  2A6E F;  4DYR A;  2M8E A;  4IL6 C;  2GA2 A;  5F0H A;  2FQ3 A;  2OV7 A;  1O3Q A;  3GWZ A;  1Z7U A;  4NQW B;  4DNC A;  5JHF A;  1D5Y A;  1ZG5 A;  3LOC A;  4A69 C;  3IKV A;  5EG0 B;  3SHF A;  1BR2 A;  1A6I A;  3QPH A;  4R8H A;  2RV8 A;  4HA8 A;  1Y0N A;  1EH7 A;  3RDI A;  2CV2 A;  3RIR A;  2DYR H;  2EIJ H;  2QEN A;  5FRN A;  3HHG A;  2EFP A;  3HPH A;  1MMS A;  3CCL I;  2A6H F;  4IKF A;  4D0P A;  2M1B A;  1Q1V A;  3FBN B;  4RB1 A;  3DPL C;  1BI1 A;  2R7W A;  1QA6 A;  2HXI A;  4CCL A;  1FBQ A;  3S1N J;  2EPF A;  2OTJ I;  4X0G A;  5H2F C;  1TQI A;  3LAP A;  1WVR A;  1D0Y A;  2B7E A;  4OIN F;  1XGM A;  1MW7 A;  1OCC H;  2IGN A;  2JSC A;  3NRV A;  1XG1 A;  4C3J J;  3BJA A;  1X1A A;  4RB2 C;  3PNV A;  2ZXW H;  2M45 A;  1D0X A;  2O9L A;  1ETW A;  1ZEL A;  4L0Z B;  5EJC A;  3GZ6 A;  2IS6 A;  2F5F A;  3CLQ A;  1K6Y A;  3S16 J;  2M4G A;  2X9D A;  4RGR A;  1OFC X;  2Z33 A;  3K1P A;  2B9S A;  1W5T A;  5CKT A;  5HOO A;  1FOW A;  4P9F A;  2E2J J;  3E5U A;  4PGG A;  3PO3 J;  1MGT A;  5BOX A;  1ZLK A;  3CJN A;  4BE1 A;  3ZPL A;  3P9C A;  3EET A;  2DJN A;  1TW3 A;  3SFZ A;  4IQ4 A;  3QAH A;  3RQI A;  3WTW C;  1O3T A;  4Y4R A;  3DPU A;  4OAY A;  3ASN H;  3FHZ A;  3GF2 A;  2E1N A;  3BTL A;  3ABL H;  3QPS A;  1W7P B;  2PJP A;  4I01 A;  3J7Z I;  3DXJ F;  5DEQ A;  1IN8 A;  2JWT A;  4BL0 B;  3GEZ A;  4LFU A;  4HLX A;  1TL8 A;  1WKM A;  3M9A A;  2X4H A;  4E7S A;  3E1S A;  3L2V A;  1X3W B;  1IF1 A;  4C2U A;  2O8K A;  2XGC A;  1B59 A;  3G4S I;  3PIP F;  4JP0 A;  2M2E A;  4RM3 A;  4UUV A;  2MW8 A;  2HQR A;  1IAW A;  2P81 A;  4P55 A;  3SZP A;  3EYY A;  1ZAR A;  3EUH A;  3L2W A;  3MN2 A;  4JOM A;  3E0J B;  1WPK A;  3OR2 C;  2NAZ A;  3H9G A;  3RTR A;  3HL2 A;  1N25 A;  5TIS C;  4RLF A;  2YX4 A;  4PGH A;  2R7U A;  4WCG A;  4E7L A;  3QOE A;  2LDU A;  4H4K C;  1KZH A;  4IQJ A;  2E1M C;  2Y0M A;  2P6S A;  4JYK A;  2LBF B;  2RGV A;  2UXN A;  3QP6 A;  3S17 J;  3MKL A;  1ZK8 A;  1F5T A;  3HB9 A;  3J7Y J;  5CJ9 A;  4UVB A;  5F04 A;  3C7J A;  2KIM A;  3DBL B;  3VWB A;  4CO8 A;  3OV8 A;  3I53 A;  3HUG B;  5CLS A;  1H9T A;  4HNU A;  3G1O A;  3VEP A;  1NH3 A;  3LNQ A;  1RPW A;  3DWL E;  3M1E A;  2JK3 A;  2P6T A;  2ZJR F;  3L2C A;  1V55 H;  3HSR A;  4Y13 A;  3H9Q A;  4LLL A;  3ROU A;  2PEX A;  1SFU A;  2HDW A;  2YX7 A;  3RYP A;  4G6T B;  4DIQ A;  4IHT A;  4XON A;  5K7H A;  4CZZ A;  2O5R A;  1E2X A;  3KEQ A;  4EGZ A;  1R4N B;  1F36 A;  1OYW A;  1RI7 A;  3K4N A;  3W3C A;  2KJC A;  3PM1 A;  3CMY A;  2ZFW A;  2OCC H;  1SAN A;  1UST A;  4ZDL A;  1P92 A;  3Q9S A;  3KYL A;  2VON A;  3AFH A;  1UG0 A;  4RA2 A;  2V6E A;  5HNH A;  2K9L A;  3BZC A;  1T56 A;  2BZT A;  1P9Q C;  2NNN A;  1JUP A;  2DJI A;  3MVP A;  3DLL F;  1HW2 A;  1G3W A;  4UUT A;  1S3J A;  1BI3 A;  4BS9 A;  2VOO A;  2HVR A;  4FX4 A;  3GME A;  3FXQ A;  4UUS A;  4IXA A;  1GXP A;  4WXD A;  1IV6 A;  4XSZ F;  2LSO A;  1OIS A;  2VC0 A;  1UFM A;  4GDF A;  3GUD A;  3H9J A;  4J00 A;  1XCV A;  3N97 A;  2IEK A;  2JRM A;  3DQV C;  4U0W A;  2TDX A;  2FD5 A;  5C44 J;  3OYI A;  2ID3 A;  3QU3 A;  3RCO A;  5KHD A;  1ZGW A;  3JRG A;  4L9V A;  2PG4 A;  3LA7 A;  3KEO A;  1R4M B;  2ZB9 A;  1RRJ A;  5CVV A;  2L9N A;  2HQN A;  2PFB A;  4MHG A;  3BCB A;  2HDD A;  1J75 A;  3ECO A;  4Q48 A;  4M3B A;  4A3D J;  3R6S A;  3JAM K;  3VYR B;  4XMY A;  1G4D A;  2LD5 A;  1KU3 A;  2W24 A;  2RN7 A;  3JSO A;  2A68 F;  1UAA A;  1S8N A;  6PAX A;  2WA0 A;  4UV8 A;  5HDK A;  3IHU A;  2DA5 A;  3OYC A;  1BJA A;  5JHU A;  1X3Z B;  3F6V A;  3OYB A;  4N4N B;  5IOZ A;  1MDM A;  2O0Y A;  4OAZ A;  2P0W A;  2QZ8 A;  1X3U A;  5FRM A;  2Y31 A;  3ABK H;  1W36 C;  2D5V A;  3GZN B;  5CVJ A;  2FBK A;  2R0Q C;  4U87 A;  4B3A A;  3HOW J;  3NWS A;  4KN7 X;  5IP9 J;  3HOY J;  2DDB A;  2A61 A;  4HQM A;  2VOP A;  2L02 A;  3U21 A;  2V1U A;  3BR6 A;  1MBE A;  2V9V A;  4MO7 A;  1TQM A;  5HLG A;  2J5O A;  2QCO A;  4M74 A;  3HSF A;  2KT0 A;  3EUA A;  4EMS A;  1APL C;  4B8X A;  1NTC A;  3HRM A;  2W1O A;  3S93 A;  2GXG A;  2XDV A;  4DOZ A;  4EAT A;  2F5C A;  2E5Z A;  1IRG A;  1SD7 A;  1XCB A;  2GBY A;  1G3T A;  4HF0 A;  4DZP A;  1ZQ3 P;  1OQY A;  3D0S A;  5L3C A;  5H20 A;  2V9P A;  1WI3 A;  3RQ4 A;  4HAM A;  5J1U A;  5B5E C;  1SFO J;  1YRN A;  2DA2 A;  4UV9 A;  4PK4 A;  3FM3 A;  3LSM A;  4BH9 A;  1XMA A;  2DOA A;  2PJR B;  2H27 A;  1OCZ H;  4AWX B;  2OTL I;  5KNL A;  4Q4Z F;  3ZR8 X;  4ENJ A;  3OMY A;  2R7Z J;  1V4R A;  4ZYE A;  5ICG A;  1TZL A;  4N9I A;  2GOM A;  2X0L A;  2NVT J;  3LSI A;  1HKT A;  2IS2 A;  1SD6 A;  5LBQ A;  4L5E A;  4CYC B;  4EJT A;  1HKQ A;  1QO0 D;  1U8B A;  3KIO A;  2O03 A;  1V5G A;  2XUB A;  3F6O A;  3P7N A;  3ZXS A;  2Q1Z B;  2EV5 A;  4L18 B;  1CF7 B;  2DA3 A;  5JI6 A;  5ILU A;  5E3L A;  1H9G A;  4QWQ A;  5M5W J;  1ZR4 A;  2LF8 A;  2ISZ A;  3ABU A;  4NHJ A;  3NEU A;  2L0K A;  5JFR A;  3ZOB A;  1GV5 A;  1Z1D A;  2AQF A;  2F5V A;  2P8T A;  2IGK A;  4AIJ A;  2IPQ X;  3A0B C;  2ADU A;  3BR0 A;  4LMY A;  1JGS A;  2K40 A;  4KMU X;  4HSR A;  1JGG A;  3HKZ N;  1ZRE A;  4HYE A;  2IP2 A;  3J7A Y;  4BXF A;  1W36 D;  1F4K A;  3SEQ A;  4ESJ A;  2WAE A;  3K10 A;  3SDG A;  2QKL B;  4B1R A;  2F4I A;  2PMU A;  2NVX J;  1GHC A;  4RB0 A;  3HG9 A;  1O3R A;  3S3O A;  5K1Y A;  3HKZ A;  1UHM A;  2LTP A;  3KZY A;  2L9R A;  5AIP A;  1XX5 A;  4IRG A;  1MBG A;  1A31 A;  3FXR A;  4DBR A;  4Z6Y A;  3A4C A;  3KP2 A;  3LA3 A;  5HLI A;  2MC3 A;  1WJA A;  3T8R A;  5HNF A;  1U5T A;  3WTU C;  5FLX K;  3T0Y A;  1S6L A;  1SFK A;  2Z5U A;  2ELH A;  2VBX A;  3BDD A;  4W1U A;  1W0T A;  1XDS A;  1XSV A;  2DDA A;  2EZK A;  3ABT A;  3B73 A;  3BC8 A;  3PSI A;  2H1K A;  2QBY A;  3S1M J;  2D2W A;  1L0O C;  4HQE A;  4E7H A;  5CVR A;  1AWC A;  1BN5 A;  4RGU A;  5LGN A;  3K4B A;  3FK7 A;  1VQK I;  1FX7 A;  1X4O A;  3BR5 A;  4PZJ A;  3E3V A;  2CH0 A;  3WTX C;  2NVY J;  2CJJ A;  5D5W B;  3HHH A;  4FET A;  1DU6 A;  2XGX A;  4AIH A;  1PVE A;  2Y0S N;  1MMA A;  5F27 A;  3BPV A;  1JUM A;  4YIF A;  4A0Y A;  1VQ9 I;  5L3B A;  1LDK B;  2BOL A;  4HDU A;  2BY2 A;  1P4X A;  4LIV A;  5J1R A;  4ABZ A;  2V1D A;  3BT9 A;  1J5Y A;  4M6X A;  3WE2 A;  4XR6 A;  4XRS G;  2Y0S A;  4YRV A;  3QYE A;  2OU2 A;  4EGY A;  2J5P A;  5EYR A;  1H89 C;  3F72 A;  3EDP A;  1G6N A;  5DD8 A;  3KP5 A;  1IXR C;  4IX7 A;  5J47 A;  1JHF A;  2IVM A;  3ZN0 A;  5D8K B;  4F7Z A;  2KRF A;  3JW4 A;  2EQR A;  3S2D J;  3QPT A;  1K78 A;  1Z6T A;  4ZZD A;  2DO7 A;  3HOU J;  1X19 A;  2K27 A;  3OIQ A;  3BTC A;  4EM2 A;  1MND A;  1AHD P;  1JUS A;  4R79 A;  4A3F J;  1U3E M;  2E1O A;  4D7N A;  2XF5 A;  4MLO A;  2LR8 A;  2X1E A;  4CCJ A;  2PN6 A;  1SAX A;  5J8C A;  1WZ2 A;  4M3F A;  1P4W A;  3ECH A;  2K9Q A;  2FF4 A;  3OOP A;  4RAF A;  3PFI A;  1DU0 A;  1QNT A;  4RDU A;  5D6E A;  5JVT A;  2QVO A;  1ETY A;  1IN5 A;  4KIF A;  4Y15 A;  2K4B A;  3JR9 A;  4U7D A;  3KE2 A;  4WXC A;  2EFO A;  4AYB N;  2KP6 A;  2JTV A;  1NHA A;  2X1D A;  1FOK A;  2GOX B;  2CYY A;  2RNJ A;  2CRG A;  1RKT A;  5GAD J;  1ZRF A;  2DMU A;  1MD0 A;  2FUG 2;  4I02 A;  3E7L A;  3ZRG A;  4CHU A;  4AYB A;  4D5F A;  3CUO A;  1VTN C;  3TL4 X;  1V3F A;  3RJP A;  2L4M A;  1JKO C;  4ZC3 A;  4E7Z A;  1W4M A;  3REO A;  2ISY A;  2DA1 A;  2CSO A;  3QPL A;  2DMT A;  4A0X A;  2DPU A;  1MBK A;  3S8P A;  3VSK A;  2FJ1 A;  1USS A;  2A6T A;  5EGO B;  2VPR A;  3OYF A;  4J19 A;  4G7Z F;  2L7K A;  3J80 Z;  4IRI A;  2HZD A;  3BG3 A;  3DCF A;  1Y8Q B;  4F91 B;  1G3Y A;  3AG4 H;  4KA4 A;  3WHB A;  2WV1 A;  3C2G A;  4HRI A;  2A07 F;  2ECC A;  2VC1 A;  4MFD A;  4A12 A;  3CC7 I;  5LGU A;  5FKN A;  3K4K A;  1OLT A;  2GZW A;  2VXZ A;  3KZI C;  1X4P A;  2RRE A;  1CGP A;  1FMV A;  3OL3 A;  2M3A A;  1HOM A;  1DPU A;  3LFK A;  3ZCO A;  1O3S A;  3DFG A;  2VB6 A;  1YW7 A;  5LHG A;  3BTJ A;  5M5Y J;  3FK6 A;  2IBD A;  2K85 A;  2HU9 A;  2C6Y A;  4DYQ A;  5ICE A;  2X48 A;  3OR1 C;  5E1X A;  3I55 I;  1XGN A;  3L1P A;  3P9K A;  3CZ6 A;  2KRC A;  1ITY A;  1FLI A;  4PJL A;  2QM3 A;  1JHH A;  1HQC A;  2Z3Y A;  4A3I J;  2VQH A;  1JE8 A;  4XN0 A;  2OZ6 A;  3DPT A;  3DU6 A;  4HLY A;  4BE0 A;  1XN7 A;  1U2W A;  2X51 A;  1U0J A;  2OC6 A;  5AIQ A;  3IC7 A;  3KLN A;  3JTH A;  4IRH A;  2AO9 A;  4V19 K;  3OY9 A;  1BJZ A;  2XPU A;  1BR1 A;  5GAG J;  2XPW A;  5CYV A;  3OYJ A;  1J9I A;  1RKW A;  3KP4 A;  5GTH C;  3JRB A;  1U5T C;  4E70 A;  5H6R A;  1P6R A;  2LMD A;  5E79 C;  4EJO A;  1XGS A;  1MBH A;  3ERM A;  2XAJ A;  3D5R C;  1WJB A;  5DD4 A;  3E6C C;  2DT5 A;  2HGC A;  2KIS A;  3RYR A;  2DA4 A;  5F64 A;  3TDU C;  4ZZL A;  1TW2 A;  2OBP A;  5DS9 A;  1K83 J;  2BYV E;  1RUO A;  3RKQ A;  3K9T A;  2A5W A;  3WGI A;  2L7Z A;  2WC2 A;  2H8W A;  2G7H A;  3FDY A;  2E1M B;  2VE8 A;  4ANJ A;  3MZY A;  4IO9 F;  3BG6 A;  1FY7 A;  3L7W A;  3TKY A;  5DUI A;  2VJ4 A;  4CUG A;  5EEH A;  2ME6 A;  1I5Z A;  2MD5 A;  1OR7 A;  2R7V A;  1Y0U A;  3E5Q A;  3RPU A;  4FTH A;  3OS1 A;  4D7M A;  4BDZ A;  1Z3X A;  4WX9 A;  4OIQ F;  4II3 A;  3NQO A;  2K02 A;  5DCM A;  1GVJ A;  5ED4 A;  1ACI A;  5BNG A;  2CG4 A;  1GUU A;  2NOG A;  2QQ8 A;  5J40 A;  1I50 J;  4E7J A;  2ZXI A;  2FMY A;  5FKK A;  1GVD A;  3Q3S A;  3QU6 A;  2HVQ A;  2AHQ A;  2JJ7 A;  3CF2 A;  3ZMV A;  4XKV A;  3JRF A;  1ZH5 A;  3JRC A;  3EPZ A;  4PJ0 C;  4EM1 A;  4IEJ A;  1EH8 A;  2LH9 A;  4MIM A;  3MEX A;  3TP3 A;  2ZFU A;  1PUE E;  4PDK A;  2NS8 A;  3VOE A;  1FMW A;  1UHS A;  4PCQ A;  3LSH A;  2NXN B;  2V6C A;  3AG3 H;  3TW7 A;  4KIC A;  4LOC A;  2M9H A;  1ZKG A;  4HST A;  3GO5 A;  4BJ5 C;  1MBF A;  5DM6 F;  4KMF A;  2LLK A;  1F1Z A;  5BPI A;  4UNO A;  2GXB A;  1DP3 A;  3CD6 I;  3V42 A;  4BE2 A;  2BBY A;  4CCO A;  1YJN I;  3FXM A;  3EYI A;  3CO6 C;  1R5G A;  3OYL A;  3H3U A;  3OS0 A;  4E4H A;  3WTY C;  4IZZ A;  2WAD A;  2GM4 A;  1LQ1 A;  3V8L A;  1UMQ A;  3WTV C;  2GLO A;  2KPM A;  4A3L J;  2MGQ A;  4HZF A;  3IV5 A;  4IF4 A;  2CFX A;  3Q9V A;  2DPD A;  3U1K A;  3M7G A;  3IH3 A;  1B9M A;  1R7J A;  1Y8R B;  1XMX A;  4Z2Y A;  4HX8 A;  5D5V B;  4RS8 A;  1J0R A;  4BY7 J;  1FTZ A;  3L2Q A;  2FA5 A;  2QUF A;  1B1B A;  4NQW A;  2M0M A;  3B6C A;  5E18 F;  4G7H F;  5EEA A;  2FEZ A;  1S7A A;  3KP6 A;  2EV0 A;  4XRF A;  3FMQ A;  5J4Y A;  1IV8 A;  1FYK A;  3CUQ A;  3PQK A;  1ZR2 A;  5EZH A;  1UB9 A;  4NBQ A;  3BJ6 A;  4AU7 A;  1S29 A;  1SVM A;  2XIG A;  4CGZ A;  2EZL A;  1BR4 A;  4M9Z A;  2JUC A;  1ZLJ A;  1ETQ A;  1VQ7 I;  2BY0 A;  3WTS C;  4I76 A;  3BRO A;  3BZ6 A;  1LFB A;  2IXS A;  4W97 A;  1XDU A;  3PL8 A;  1IDY A;  1LE8 B;  1OYI A;  4BQA A;  3ZQQ A;  1I1S A;  4DYC A;  2QLZ A;  3GYH X;  4J01 A;  4UB6 C;  2R7R A;  4F93 B;  1Z91 A;  4KIG A;  2IAI A;  2VJI A;  2HKO A;  2OZU A;  2QSG X;  4B48 A;  5C3E J;  2ACJ A;  1RZ4 A;  3I4M J;  2XF6 A;  1WJD A;  1IN7 A;  1UZC A;  2I8D A;  4MGR A;  2W00 A;  5M3M J;  4M3G A;  1PUF A;  3JCU C;  4XLF A;  3W2V A;  4RAY A;  3FIS A;  3WU2 C;  2MG4 A;  2TRT A;  4XN3 A;  4HPQ A;  3IUO A;  5CPR B;  3BY6 A;  1JXS A;  2RNG A;  3R61 A;  4XID A;  2HQ5 A;  4F52 A;  3BG5 A;  5HDN A;  2M5W A;  2HR3 A;  2W4S A;  3G6E I;  2MFZ A;  2DA6 A;  4AIK A;  1ETV A;  2VBW A;  1MJB A;  1V54 H;  2CW7 A;  4LLN A;  2DA7 A;  3GTK J;  4WK8 F;  5A2Q Z;  5J1Y A;  1O7L A;  1WQ2 A;  2BE5 F;  4A3K J;  1EH6 A;  5C4J J;  3MZH A;  1W5S A;  2IGM A;  2V26 A;  1OMI A;  1XC5 A;  2P5L C;  1ON1 A;  2W85 A;  1E3H A;  3DBR B;  1HDD C;  4BBS J;  3K70 C;  2PQ8 A;  3K0L A;  1G2H A;  3GFL A;  3G71 I;  2XSD C;  1OR7 C;  1VF9 A;  3U2R A;  3HSE A;  3MD2 A;  3BWG A;  2BHY A;  2R4G A;  2HPI A;  4PJM A;  4EJW A;  1R6R A;  3BR2 A;  2FX0 A;  4ON0 A;  1BBY A;  4A3J J;  1HST A;  1DQU A;  4XOP A;  1K61 A;  2P7C B;  2BW3 A;  3F8F A;  2UUZ A;  3V7R A;  3JSP A;  2V79 A;  3KET A;  4HDV A;  2BY1 A;  2YUS A;  4P1W A;  2LRD A;  4EJU A;  5F1J A;  5KAF C;  5M3F J;  3A03 A;  1X1C A;  1UG2 A;  1ETX A;  4PJN A;  2LY1 A;  1LB2 A;  2GIZ A;  2JSP A;  4YEJ A;  4Y17 A;  3CCJ I;  1J59 A;  3K4L A;  4KIB A;  4MTE A;  5LEJ A;  4XQF A;  5EF6 A;  1K4T A;  1DPR A;  1V5E A;  2QKM B;  1T33 A;  3BQZ A;  3MWM A;  2R5Y A;  3CDL A;  3TP0 A;  3F9K A;  1XD7 A;  3OWT A;  4U0V A;  2DFF A;  3HM5 A;  3HUG A;  1S72 I;  1BA5 A;  2JN6 A;  1R1V A;  2TCT A;  3QOP A;  3HEF A;  5D6F A;  3AKZ A;  4AVZ A;  4UUS B;  4ITV A;  1MIJ A;  4Y3O A;  2JT1 A;  2JA6 J;  2YS9 A;  3IWZ A;  2ESH A;  4YIR X;  1N77 A;  3TDZ C;  2DCE A;  2XAG A;  4CSW A;  2PMH A;  5HOD A;  4U7B A;  1IUY A;  2AXT C;  4FQG A;  1R22 A;  5JLX A;  3VSL A;  2KLO A;  4ENK A;  2VOD A;  4CZC A;  4F3Q A;  1HXD A;  1Y6I A;  2E7X A;  2V7F A;  1B72 A;  3DKX A;  1J2X A;  1I27 A;  2R5Z A;  1PP8 F;  1TC3 C;  2EK5 A;  1G59 A;  3ZQI A;  1NG6 A;  3IKT A;  1QHH D;  1S5L C;  1IRX A;  1TNT A;  2ETH A;  2GAU A;  2X6Y A;  3V8J A;  5BS6 A;  1QPM A;  1RR8 C;  2DMP A;  4KYW A;  3COA C;  4M9S A;  1D8J A;  3ABM H;  1JTY A;  1BW5 A;  2KDO A;  3GW2 A;  2VI6 A;  3CC2 I;  1NG7 A;  2VN2 A;  3LSG A;  1JI8 A;  3LL7 A;  3JRH A;  2D1H A;  3CUQ C;  3LWF A;  4YG2 F;  3WOD F;  3K70 D;  5JLW A;  1RC9 A;  3DTK A;  4M6V A;  3RPU D;  3ZQ7 A;  1P2F A;  4BHB A;  4M72 A;  4FAS D;  3CCV I;  3IAS 2;  2DTR A;  4YFK F;  2GA1 A;  2LYC A;  3CCR I;  3ZQH A;  1MDM B;  3GBG A;  2VQC A;  5E1W A;  2X6W A;  3WU1 B;  2MH9 A;  4BHP A;  3MQ0 A;  2EFW A;  1T39 A;  2Y2Z A;  1IXC A;  2AS5 F;  3B6A A;  3GTP J;  2A5Y B;  2EIN H;  2F4M B;  4A5N A;  4C9Y A;  1BIB A;  1R23 A;  1WWX A;  1ETO A;  1L3L A;  1YHQ I;  4GGG A;  1FZP B;  3CP2 A;  2L4A A;  1I6H J;  2EFN A;  1K79 A;  2HOE A;  3B02 A;  3IRR A;  4TV7 A;  2CQ7 A;  4KFC A;  2XAU A;  2CQX A;  1E17 A;  3S15 J;  1D1B A;  4LG3 A;  2ID6 A;  4XLP F;  2W25 A;  2DMN A;  2HI3 A;  3FM5 A;  2E7W A;  4OU0 A;  5ILS A;  1U6G A;  3GLX A;  2CQK A;  3OOU A;  2F5E A;  3TOA A;  4A6D A;  1DDN A;  4UXN A;  1IN6 A;  2ME0 A;  3OL4 A;  4KUM A;  1TWG J;  2K9N A;  1ZN2 A;  2EB7 A;  1VQ8 I;  4I99 C;  1MH3 A;  2I10 A;  5L3F A;  2VKE A;  5IT3 A;  3K4M A;  1SMY F;  1YRN B;  3WTZ A;  2ZJP F;  2JQ7 A;  4ZDO A;  4A0Z A;  1T8I A;  1PP7 U;  3JRI A;  2COB A;  4H0E A;  2BHZ A;  3HZJ A;  2WY7 Q;  2K3P A;  4BXX J;  2QSF X;  4AD9 A;  3GFJ A;  1DUX C;  4QPQ A;  1U9N A;  4IJA A;  2JVH A;  1OPC A;  1RES A;  5FD6 A;  1AU7 A;  3I3L A;  2BXY A;  3N05 A;  3F3X A;  2Y30 A;  3GTQ J;  3F8M A;  1KQ0 A;  1UJ8 A;  3LST A;  1Y1W J;  1S7O A;  1QVU A;  4KN4 X;  3SYT A;  2X1C A;  5IT9 Z;  1EV7 A;  1T95 A;  2WTE A;  3ZGK A;  1ZG3 A;  2FOK A;  1VQ6 I;  1BOA A;  5GTI C;  2HDC A;  2E36 A;  3CCU I;  1EA3 A;  1YOV B;  3J7A O;  2MA3 A;  3BJO A;  4L9J A;  2FNA A;  1FSH A;  3S1R J;  4I7H A;  4ZDP A;  1GXQ A;  4F92 B;  4UVA A;  3DKY A;  3IWF A;  4ETS A;  1YIO A;  3ERE D;  5FLM J;  3GX4 X;  1KQ8 A;  4LGW A;  1R71 A;  1MMG A;  2B63 J;  3WE3 A;  5D8L B;  1ETK A;  2PLY A;  4A3E J;  4XM3 A;  1B4A A;  4O5V A;  4NC7 A;  3OYA A;  2E2H J;  1SFE A;  1TNS A;  3VPR A;  1QZE A;  5CQE A;  1FOY A;  5D5U B;  2E5N A;  4HOB A;  3GVA A;  2LKP A;  5F0F A;  2LKX A;  2QBY B;  5M5X J;  1FYL A;  2DI3 A;  3K6G A;  3R4K A;  4M9X A;  4MEY F;  1YW8 A;  4FT8 A;  2Q0O A;  2GIV A;  3J81 K;  1K4S A;  1H8A C;  2CW8 A;  5DM7 F;  2HKX A;  2JPB A;  4ENM A;  4RBO A;  2CMP A;  1MZB A;  3MAJ A;  1VQ4 I;  5DTD A;  3OYE A;  2WB1 N;  3MFK A;  1K7A A;  2LP0 A;  3TW6 A;  3FF5 A;  2HTS A;  1B9N A;  3CJQ B;  3HRU A;  2FML A;  5JR3 A;  5TGT A;  2ZNY A;  1MJ9 A;  3RPQ A;  1YJ9 I;  1O4X A;  1KYW A;  4BAY A;  2ZME A;  4GRI A;  1BI0 A;  1LDD A;  4BQN A;  2NVQ J;  2XAF A;  3M4O J;  1ULY A;  2VXD A;  4JX6 A;  2QYO A;  4XLC A;  4XIC A;  3BOQ A;  1VND A;  3I54 A;  2E2I J;  1HDP A;  2DFI A;  1X2N A;  2FU4 A;  5BMZ A;  2RAE A;  2F48 A;  4GYI A;  4KT6 A;  3V8K A;  2JA8 J;  3F8C A;  4AVP A;  5GPC A;  5BQT A;  1XS9 A;  4DJA A;  1SEU A;  2OPT A;  2G9W A;  1Z05 A;  2KJB A;  1K78 B;  3Q0W A;  4XLE A;  5F1R A;  3L2U A;  1AKH A;  3AL0 C;  4BXU A;  3OYD A;  3QYF A;  4ZYD A;  2CWE A;  9ANT A;  3X2Q H;  1IG7 A;  1AA7 A;  2H6C A;  2PMZ N;  2NRA C;  4ZYA A;  2JMW A;  3RZD J;  2FQ4 A;  1GDT A;  2W57 A;  4YFN F;  1Y56 A;  1CQT A;  3ZMD A;  4LG0 A;  3S3M A;  5HS7 A;  4ZTF A;  1DP7 P;  1ONV A;  3H1C A;  3O8G A;  1R5H A;  3KPH A;  1KYZ A;  3HRT A;  3HOX J;  1AOY A;  3L2R A;  4EJV A;  4PUS A;  2E60 A;  4B09 A;  4MTD A;  1PJR A;  1BL0 A;  2F2E A;  4IHW A;  3WG7 H;  3PJR A;  1I3A A;  2VT3 A;  4Y33 A;  4LLG F;  4XL9 A;  2BY3 A;  4U0Y A;  2MC4 A;  2XGD A;  2ZCW A;  3U9G A;  4MQ9 F;  3FIW A;  3BG9 A;  4JX5 A;  3ML6 A;  3CP8 A;  1R1U A;  5IYB J;  3LSR A;  4XLA A;  2FNP A;  3IH4 A;  2XC7 A;  3ZMZ A;  2XB0 X;  3ISP A;  4RMN A;  1YJW I;  3MZ8 A;  4M3E A;  2CU7 A;  4NUB A;  3I59 A;  1XPX A;  3LSP A;  1LEB A;  2OAZ A;  2DLL A;  4XKB A;  1D5V A;  2O7O A;  2LG4 A;  2WAQ N;  2K5C A;  4YII A;  3TO7 A;  1P7J A;  1SD5 A;  1V5F A;  2H94 A;  5HVQ C;  2VL8 A;  1Q1H A;  3G73 A;  2STT A;  4OIP F;  2Y9Z A; 
#chains in the Genus database with same CATH homology
 2G7U A;  3I64 A;  2OQR A;  4JQF A;  1FYM A;  3FWE A;  4A6E A;  4G7O F;  4HBL A;  3SQN A;  1YFH A;  2LNB A;  2XAH A;  2KIF A;  3H92 A;  3F21 A;  1LEA A;  5DYM A;  2HFH A;  3L00 A;  3J80 K;  2PBI A;  1U78 A;  3WGG A;  1B6A A;  1OYY A;  1KGS A;  1FNN A;  4CIC A;  2DBB A;  2JZY A;  1T38 A;  2W84 A;  1HW1 A;  2XKP A;  5ICC A;  2FRH A;  2RQP A;  5L3E A;  3WGH A;  1ZYR F;  2L54 A;  1R36 A;  2MBF A;  2STW A;  1SD4 A;  5F6F A;  3O2P E;  1XSX A;  3LA2 A;  1XGO A;  2M30 A;  1XMK A;  3R60 A;  1I1G A;  2YSR A;  3I5U A;  5DCM B;  3V7S A;  2UWM A;  2IJL A;  2YU3 A;  2M87 A;  1IZ1 A;  2FXA A;  4LK1 F;  4M6Y A;  2L01 A;  3ZMT A;  4N0B A;  4U88 A;  2Q2E A;  3I71 A;  3SZT A;  1BI2 A;  4LK0 F;  1T0F A;  3GFM A;  2MLK A;  3HOS A;  2ZO4 A;  5HS8 A;  4GYG A;  4M71 A;  1ZGJ A;  3C1D A;  1IN4 A;  4MEX F;  4L0Y B;  4MNU A;  1F9N A;  4ENN A;  5CVI A;  5LEK A;  1I6X A;  4JBA A;  3WTT C;  1YQA A;  4XLN F;  2K86 A;  1SMT A;  4KT5 C;  4CDG A;  3HTS B;  1ZRC A;  3T5X A;  2P7V B;  2P4W A;  5BPD A;  4UVC A;  4P96 A;  5EEG A;  3M8F A;  5LRR A;  5E1Z B;  3CUQ B;  3KFW X;  1REP C;  2NYX A;  3F8N A;  4G6Q A;  1YW9 A;  1FBU A;  3AAF A;  4MQV A;  3BPX A;  2EJR A;  1MJA A;  2RC4 A;  3VFZ A;  1U8R A;  3L09 A;  1TQP A;  2DQL A;  2GWR A;  5LRS A;  1HSJ A;  5H6Q A;  2XRO A;  5LGT A;  3T8T A;  4BYY A;  1ZG1 A;  2KKO A;  2CW0 F;  2IT0 A;  2FBH A;  3G3Z A;  4G8X A;  3GXO A;  2V1X A;  5FB2 A;  4BNC A;  4CYD A;  4KNY A;  1YYV A;  2BGC A;  5DV5 A;  3RKY A;  4A5M A;  1HKS A;  2HWV A;  4HX7 A;  2O6G E;  5DDG A;  1W7P A;  1ZHF A;  2QQA A;  4EM0 B;  2A3S A;  2Y48 A;  4G6D A;  4GXO A;  1WSU A;  3ELK A;  3GFI A;  3MCZ A;  2VBY A;  1P4A A;  2IRF G;  2IA1 A;  2YR2 A;  2FSW A;  2B0L A;  1D3Y A;  3RKW A;  1FP2 A;  3KZZ A;  5LHH A;  4ESF A;  1FT9 A;  5A2Q K;  4P9U A;  3DKW A;  5KK1 A;  4Q47 A;  1H0M A;  3F8B A;  2ESN A;  1QZZ A;  4IHS A;  2ZXJ A;  2PI0 A;  2XHK A;  1BIA A;  4L9N A;  5E17 F;  5ICF A;  1T98 A;  3E6D A;  3W6K B;  1XB4 A;  2BEO A;  2DK5 A;  4XSX F;  4K2E A;  5D4R A;  1R1T A;  4GO1 A;  5HS9 A;  2HTJ A;  5J6X A;  3ZMU A;  3LAJ A;  1QQI A;  3VB2 A;  1TLH B;  3DV8 A;  5KVR A;  2ZBK A;  1WRJ A;  2O3F A;  4HF2 A;  2DQR A;  1BC7 C;  2FE3 A;  3JAM Z;  2LF7 A;  4RGS A;  3KCC A;  3C3W A;  4EV0 A;  4HX4 A;  2VE9 A;  4LD5 A;  3QP5 A;  2ZJ2 A;  1UCR A;  3GZ5 A;  5DUK A;  5FFX A;  4R1H A;  3R0A A;  4N9H A;  3E97 A;  3W6J B;  3I58 A;  3K1N A;  3KP3 A;  2P5V A;  3FZV A;  3V4G A;  1RNL A;  1FP1 D;  4FHT A;  2ZNZ A;  3WG9 A;  2KIU A;  3QRF F;  1QGP A;  2FBI A;  2RDP A;  1G3S A;  4KDP A;  2OA4 A;  1MKM A;  4LJZ F;  2CO5 A;  5FD5 A;  4O3M A;  2R7D A;  3ZN1 A;  5AON A;  2NNY A;  2XV4 S;  4I2O A;  4S05 A;  1QBJ A;  3WU0 A;  2H09 A;  4EQQ A;  1WI9 A;  4G94 A;  1LDJ A;  1FWZ A;  2P5K A;  2EWN A;  4I0A A;  4UHT A;  5D5X B;  5CVU A;  2A69 F;  3EQL F;  4I0B A;  3K1M A;  4ZYG A;  1J7K A;  5LHI A;  1OKR A;  4YFX F;  5TRD A;  1T2K A;  1LNW A;  1KA8 A;  3O6B B;  1KU9 A;  1FC3 A;  2VBZ A;  1ZAO A;  2QQ9 A;  3IRQ A;  2DK8 A;  2WV0 A;  2HYF A;  4L5J A;  3V7C A;  4I98 B;  4WF2 A;  1HBX G;  1IXS B;  2JPC A;  5DCF A;  2XRN A;  4I09 A;  1Z9C A;  1RUN A;  2HS5 A;  2R7F A;  2ZKZ A;  5LLQ A;  1A04 A;  2Z9O A;  2EFQ A;  4IVN A;  1TBX A;  1K6O A;  5K5O A;  5HDG A;  2NS0 A;  1SFX A;  3KLO A;  2K4J A;  2IA0 A;  1CF7 A;  5IT9 K;  3FMR A;  4GCV A;  4OMY A;  4IPA A;  3LQR A;  3F22 A;  4O6J A;  3K2Z A;  5FLX Z;  2F5D A;  1U5T B;  3J81 Z;  3TO9 A;  4NB5 A;  1YS6 A;  1BM9 A;  3O3K A;  4QLC U;  4HW0 A;  1IW7 F;  3CDH A;  2RVC A;  4P5O A;  5HLH A;  1IRF A;  2IA2 A;  4HV6 A;  3Q5F A;  1ZGA A;  1ZRD A;  1W7P D;  3TOB A;  1O7F A;  3FMS A;  3RKX A;  2ZME B;  3SXY A;  2HYG D;  3U1D A;  2XVC A;  3PQJ A;  4OIR F;  4M73 A;  4EVI A;  4ZH4 F;  3RI4 A;  2HZT A;  1R00 A;  2Z99 A;  2O8X A;  2OD5 A;  3E5X A;  5FGM A;  2DU9 A;  1LVA A;  1RIO H;  3E6B A;  1T6S A;  3JTG A;  5ERI A;  1BC8 C;  3HYI A;  3C18 A;  3S2W A;  5FO5 A;  4LG0 B;  4OIO F;  4L9T A;  1LJ9 A;  2XAQ A;  5L3G A;  3ZMS A;  2GQQ A;  3FXU A;  4OOI A;  4DQ2 A;  2EA4 A;  1YO5 C;  3TGN A;  2DW4 A;  2AXL A;  1QZY A;  4S04 A;  3HRS A;  4HF1 A;  3H3Z A;  3N4M A;  3ZP5 A;  1YLF A;  4BHC A;  4OMZ A;  3I59 B;  3DP7 A;  2D45 A;  4RAZ A;  2MH2 A;  2Q8K A;  4Q5S F;  2H6B A;  3DEU A;  2CGP A;  2R3S A;  1YTY A;  1ODD A;  4FX0 A;  4LB5 A;  3FX3 A;  2O61 A;  2OQG A;  3D5L A;  4L5I A;  2HEO A;  4ASN A;  1KQ9 A;  1C0W A;  4HV5 A;  3HOT A;  1FSE A;  3IL2 A;  5ILV A;  2JRT A;  2YPR A;  3HIF A;  1XSD A;  2L3D A;  1YS7 A;  5K5R A;  3KP7 A;  3CO7 C;  3L9F A;  5E8G A;  4CXF A;  2IW5 A;  2EA2 A;  5FFZ A;  2D1V A;  2QWW A;  5E8I A;  3CLO A;  3LQQ A;  2UXX A;  3TQN A;  4XBF A;  3F23 A;  3M8E A;  1FPQ A;  5L3D A;  2EV6 A;  2RKH A;  3E6M A;  1FBS A;  2WWY A;  2XAS A;  4LB6 B;  5TJJ A;  3CTA A;  5E20 A;  2E1C A;  1KU2 A;  2QQB A;  4JK1 X;  2Y75 A;  4RB3 C;  3HTU A;  2K7L A;  1YG2 A;  3BP8 A;  2BV6 A;  4WWC A;  2UZK A;  2VT2 A;  2MLG A;  4WXH A;  3P9I A;  1O57 A;  5D4S A;  3TO6 A;  1KU7 A;  1TTY A;  1ON2 A;  1Z6R A;  3T1B A;  2XKO A;  1STZ A;  3I0T A;  1UHW A;  2DAO A;  3ULQ B;  3DF8 A;  3VOD A;  4G9Y A;  5K5Q A;  3I4P A;  3R0J A;  3K69 A;  4RGX A;  1HW5 A;  4ESB A;  2COM A;  4ZYH A;  5J8F A;  1D8K A;  1PDN C;  1R58 A;  4A2U A;  2A6E F;  2M8E A;  2GA2 A;  2FQ3 A;  1O3Q A;  3GWZ A;  1Z7U A;  4DNC A;  1ZG5 A;  3IKV A;  3SHF A;  3QPH A;  4R8H A;  2RV8 A;  4HA8 A;  1EH7 A;  3RDI A;  3RIR A;  2QEN A;  3HHG A;  2EFP A;  2A6H F;  4D0P A;  2M1B A;  4RB1 A;  3DPL C;  1BI1 A;  1FBQ A;  1TQI A;  3LAP A;  4OIN F;  1XGM A;  2JSC A;  3NRV A;  3BJA A;  4RB2 C;  2M45 A;  4L0Z B;  3GZ6 A;  2F5F A;  4RGR A;  2Z33 A;  3K1P A;  1W5T A;  5HOO A;  4P9F A;  3E5U A;  4PGG A;  1MGT A;  5BOX A;  1ZLK A;  3CJN A;  3ZPL A;  3P9C A;  3EET A;  1TW3 A;  3SFZ A;  3QAH A;  3WTW C;  1O3T A;  3FHZ A;  3GF2 A;  2E1N A;  1W7P B;  2PJP A;  4I01 A;  3DXJ F;  5DEQ A;  1IN8 A;  3GEZ A;  4LFU A;  4HLX A;  1WKM A;  3M9A A;  2X4H A;  1IF1 A;  1B59 A;  4UUV A;  2HQR A;  1IAW A;  4P55 A;  3SZP A;  3EYY A;  1ZAR A;  3EUH A;  2NAZ A;  3RTR A;  2YX4 A;  4PGH A;  4WCG A;  2LDU A;  2Y0M A;  2P6S A;  2RGV A;  2UXN A;  3QP6 A;  1F5T A;  5CJ9 A;  4UVB A;  3C7J A;  2KIM A;  4CO8 A;  3OV8 A;  3I53 A;  5CLS A;  1H9T A;  3VEP A;  3M1E A;  2P6T A;  3L2C A;  4Y13 A;  3HSR A;  4LLL A;  3ROU A;  2PEX A;  1SFU A;  2YX7 A;  3RYP A;  4IHT A;  4CZZ A;  1E2X A;  3KEQ A;  4EGZ A;  1OYW A;  1RI7 A;  2KJC A;  2ZFW A;  1UST A;  1P92 A;  3Q9S A;  2VON A;  2NNN A;  1HW2 A;  1G3W A;  1S3J A;  1BI3 A;  2VOO A;  4FX4 A;  3FXQ A;  4IXA A;  1GXP A;  4WXD A;  4XSZ F;  2LSO A;  2VC0 A;  1UFM A;  3GUD A;  3N97 A;  1XCV A;  3DQV C;  4U0W A;  2TDX A;  3QU3 A;  4L9V A;  2PG4 A;  3LA7 A;  3KEO A;  5CVV A;  2HQN A;  2PFB A;  4MHG A;  1J75 A;  3ECO A;  4Q48 A;  3R6S A;  3JAM K;  1G4D A;  1KU3 A;  2W24 A;  2RN7 A;  3JSO A;  2A68 F;  1S8N A;  6PAX A;  4UV8 A;  5HDK A;  3IHU A;  1BJA A;  5JHU A;  3F6V A;  1MDM A;  2O0Y A;  2QZ8 A;  1X3U A;  5CVJ A;  2FBK A;  4KN7 X;  2A61 A;  4HQM A;  2VOP A;  2L02 A;  2V1U A;  2V9V A;  1TQM A;  5HLG A;  2J5O A;  4M74 A;  3HSF A;  4EMS A;  4B8X A;  3HRM A;  2GXG A;  2F5C A;  1IRG A;  1SD7 A;  1XCB A;  1G3T A;  4HF0 A;  3D0S A;  5L3C A;  5H20 A;  4HAM A;  4UV9 A;  3FM3 A;  4BH9 A;  1XMA A;  2H27 A;  4AWX B;  4Q4Z F;  4ENJ A;  1V4R A;  4ZYE A;  5ICG A;  4N9I A;  2X0L A;  1HKT A;  1SD6 A;  5LBQ A;  4EJT A;  1HKQ A;  1QO0 D;  2O03 A;  2XUB A;  3F6O A;  3P7N A;  2EV5 A;  4L18 B;  1CF7 B;  5JI6 A;  5ILU A;  1H9G A;  4QWQ A;  2LF8 A;  2ISZ A;  3ABU A;  4NHJ A;  3NEU A;  5JFR A;  1Z1D A;  2P8T A;  4AIJ A;  2IPQ X;  2ADU A;  4LMY A;  1JGS A;  4KMU X;  1ZRE A;  4HYE A;  2IP2 A;  1F4K A;  4ESJ A;  2PMU A;  1GHC A;  4RB0 A;  1O3R A;  5K1Y A;  1UHM A;  3KZY A;  5AIP A;  4IRG A;  3FXR A;  3LA3 A;  3KP2 A;  5HLI A;  3T8R A;  2MC3 A;  3WTU C;  5FLX K;  1U5T A;  3T0Y A;  1S6L A;  2Z5U A;  2ELH A;  2VBX A;  3BDD A;  1XDS A;  1XSV A;  3ABT A;  3B73 A;  2QBY A;  2D2W A;  1L0O C;  4HQE A;  5CVR A;  1AWC A;  1BN5 A;  4RGU A;  5LGN A;  1FX7 A;  4PZJ A;  3E3V A;  3WTX C;  5D5W B;  3HHH A;  2XGX A;  4AIH A;  3BPV A;  4YIF A;  4A0Y A;  5L3B A;  1LDK B;  4HDU A;  1P4X A;  2V1D A;  1J5Y A;  4M6X A;  3WE2 A;  4EGY A;  2OU2 A;  2J5P A;  3F72 A;  3EDP A;  1G6N A;  5DD8 A;  3KP5 A;  1IXR C;  1JHF A;  2IVM A;  3ZN0 A;  5D8K B;  4F7Z A;  2KRF A;  3JW4 A;  3QPT A;  1K78 A;  1Z6T A;  4ZZD A;  2DO7 A;  2K27 A;  4EM2 A;  4R79 A;  1U3E M;  2PN6 A;  1SAX A;  5J8C A;  1P4W A;  3ECH A;  2FF4 A;  3OOP A;  3PFI A;  1QNT A;  5D6E A;  5JVT A;  2QVO A;  1IN5 A;  4KIF A;  4Y15 A;  2K4B A;  4U7D A;  3KE2 A;  4WXC A;  2EFO A;  2JTV A;  1NHA A;  1FOK A;  2CYY A;  2RNJ A;  1ZRF A;  1MD0 A;  4I02 A;  4CHU A;  1VTN C;  3CUO A;  1V3F A;  3RJP A;  2L4M A;  1W4M A;  3REO A;  2ISY A;  2CSO A;  4A0X A;  2DPU A;  1USS A;  4G7Z F;  3J80 Z;  4IRI A;  1G3Y A;  4KA4 A;  2A07 F;  2VC1 A;  4A12 A;  5LGU A;  2GZW A;  2VXZ A;  1CGP A;  1DPU A;  3LFK A;  1O3S A;  3DFG A;  1YW7 A;  5LHG A;  2C6Y A;  5ICE A;  5E1X A;  1XGN A;  3P9K A;  1FLI A;  2QM3 A;  1JHH A;  1HQC A;  2Z3Y A;  1JE8 A;  2OZ6 A;  3DPT A;  4HLY A;  1XN7 A;  1U2W A;  5AIQ A;  3IC7 A;  3KLN A;  3JTH A;  4IRH A;  5CYV A;  1J9I A;  3KP4 A;  1U5T C;  4E70 A;  5H6R A;  1P6R A;  4EJO A;  1XGS A;  2XAJ A;  5DD4 A;  3E6C C;  2DT5 A;  2HGC A;  3RYR A;  5F64 A;  3TDU C;  4ZZL A;  1TW2 A;  2OBP A;  2BYV E;  1RUO A;  3K9T A;  3WGI A;  2WC2 A;  2G7H A;  2VE8 A;  3MZY A;  3L7W A;  1FY7 A;  3TKY A;  5DUI A;  5EEH A;  1I5Z A;  2MD5 A;  1OR7 A;  1Y0U A;  3E5Q A;  3RPU A;  4WX9 A;  4OIQ F;  3NQO A;  2K02 A;  5DCM A;  1GVJ A;  5ED4 A;  2CG4 A;  2FMY A;  3QU6 A;  3ZMV A;  1ZH5 A;  4EM1 A;  1EH8 A;  3MEX A;  1PUE E;  4PDK A;  3VOE A;  4PCQ A;  2V6C A;  4KIC A;  3GO5 A;  4KMF A;  1F1Z A;  5BPI A;  4UNO A;  2GXB A;  2BBY A;  3EYI A;  3CO6 C;  1R5G A;  3H3U A;  3WTY C;  1LQ1 A;  3V8L A;  3WTV C;  4HZF A;  4IF4 A;  2CFX A;  3Q9V A;  2DPD A;  3M7G A;  1B9M A;  1R7J A;  4Z2Y A;  4HX8 A;  5D5V B;  4RS8 A;  1J0R A;  2FA5 A;  2QUF A;  1B1B A;  4NQW A;  5E18 F;  4G7H F;  2FEZ A;  1S7A A;  3KP6 A;  2EV0 A;  4XRF A;  3FMQ A;  1FYK A;  3CUQ A;  3PQK A;  1UB9 A;  3BJ6 A;  1S29 A;  2XIG A;  4CGZ A;  4M9Z A;  1ZLJ A;  3WTS C;  3BRO A;  3BZ6 A;  1XDU A;  1OYI A;  4BQA A;  1I1S A;  2QLZ A;  3GYH X;  1Z91 A;  4KIG A;  2HKO A;  2OZU A;  2ACJ A;  1RZ4 A;  1IN7 A;  4MGR A;  4RAY A;  1JXS A;  3BY6 A;  3R61 A;  5HDN A;  2M5W A;  2HR3 A;  4AIK A;  2VBW A;  1MJB A;  4LLN A;  4WK8 F;  5A2Q Z;  1O7L A;  1WQ2 A;  2BE5 F;  1EH6 A;  3MZH A;  1W5S A;  1OMI A;  2P5L C;  1ON1 A;  2W85 A;  2PQ8 A;  3K0L A;  3GFL A;  3U2R A;  3HSE A;  3BWG A;  4EJW A;  4ON0 A;  1BBY A;  1HST A;  2P7C B;  3F8F A;  3V7R A;  3JSP A;  2V79 A;  3KET A;  4HDV A;  4EJU A;  1LB2 A;  4Y17 A;  1J59 A;  4MTE A;  4KIB A;  5LEJ A;  1DPR A;  3MWM A;  1XD7 A;  4U0V A;  3HUG A;  1R1V A;  3QOP A;  5D6F A;  2JT1 A;  3IWZ A;  2ESH A;  3TDZ C;  4U7B A;  2XAG A;  1IUY A;  2PMH A;  1R22 A;  4ENK A;  2VOD A;  1HXD A;  2E7X A;  1J2X A;  1I27 A;  1PP8 F;  2EK5 A;  3IKT A;  1TNT A;  2ETH A;  2GAU A;  3V8J A;  5BS6 A;  1QPM A;  4KYW A;  3COA C;  4M9S A;  1D8J A;  3GW2 A;  2VN2 A;  2D1H A;  3CUQ C;  3LWF A;  4YG2 F;  3WOD F;  3ZQ7 A;  1P2F A;  4BHB A;  4M72 A;  2DTR A;  4YFK F;  2GA1 A;  1MDM B;  5E1W A;  3WU1 B;  2MH9 A;  4BHP A;  3MQ0 A;  2EFW A;  1T39 A;  1IXC A;  2AS5 F;  2A5Y B;  4A5N A;  1BIB A;  1R23 A;  1WWX A;  1L3L A;  4GGG A;  1FZP B;  2L4A A;  2EFN A;  1K79 A;  2HOE A;  3B02 A;  3IRR A;  4TV7 A;  4KFC A;  1E17 A;  4XLP F;  2W25 A;  3FM5 A;  2E7W A;  4OU0 A;  5ILS A;  1U6G A;  3GLX A;  2CQK A;  2F5E A;  3TOA A;  4A6D A;  1DDN A;  4UXN A;  1IN6 A;  4KUM A;  1ZN2 A;  2EB7 A;  5L3F A;  5IT3 A;  1SMY F;  3WTZ A;  4A0Z A;  1PP7 U;  4H0E A;  4AD9 A;  3GFJ A;  1DUX C;  4IJA A;  1OPC A;  5FD6 A;  3F3X A;  3F8M A;  1KQ0 A;  3LST A;  1S7O A;  4KN4 X;  5IT9 Z;  1EV7 A;  2WTE A;  1ZG3 A;  2FOK A;  1BOA A;  2HDC A;  3J7A O;  2MA3 A;  3BJO A;  4L9J A;  2FNA A;  1FSH A;  4I7H A;  1GXQ A;  4UVA A;  3IWF A;  4ETS A;  1YIO A;  3ERE D;  3GX4 X;  1KQ8 A;  4LGW A;  3WE3 A;  5D8L B;  2PLY A;  1B4A A;  4O5V A;  1SFE A;  1TNS A;  5D5U B;  4HOB A;  3GVA A;  2LKP A;  2QBY B;  1FYL A;  2DI3 A;  3R4K A;  4M9X A;  4MEY F;  1YW8 A;  4FT8 A;  2Q0O A;  2GIV A;  3J81 K;  2HKX A;  2JPB A;  4ENM A;  3MAJ A;  1MZB A;  3MFK A;  1K7A A;  3FF5 A;  2HTS A;  1B9N A;  3HRU A;  2FML A;  5JR3 A;  2ZNY A;  1MJ9 A;  3RPQ A;  1KYW A;  4BAY A;  2ZME A;  1BI0 A;  1LDD A;  2XAF A;  1ULY A;  2QYO A;  3BOQ A;  3I54 A;  2DFI A;  2FU4 A;  5BMZ A;  4GYI A;  3V8K A;  3F8C A;  4AVP A;  5BQT A;  2G9W A;  1Z05 A;  2KJB A;  1K78 B;  5F1R A;  4BXU A;  4ZYD A;  2CWE A;  2H6C A;  2NRA C;  2W57 A;  4YFN F;  3ZMD A;  4LG0 A;  5HS7 A;  1DP7 P;  1ONV A;  1R5H A;  1KYZ A;  3HRT A;  1AOY A;  4EJV A;  4B09 A;  4MTD A;  2F2E A;  2VT3 A;  4LLG F;  4U0Y A;  2ZCW A;  3U9G A;  4MQ9 F;  3ML6 A;  1R1U A;  2FNP A;  3ZMZ A;  3ISP A;  3I59 A;  1LEB A;  2OAZ A;  2DLL A;  1D5V A;  4YII A;  3TO7 A;  1SD5 A;  2H94 A;  5HVQ C;  1Q1H A;  3G73 A;  2STT A;  4OIP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...