4MQVA

Crystal complex of rpa32c and smarcal1 n-terminus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
GLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Replication protein A 32 kDa subunit
publication title Structure of RPA32 bound to the N-terminus of SMARCAL1 redefines the binding interface between RPA32 and its interacting proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 65
sequence length 65
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4mqvA00
2KKOA 1TNTA 2WC2A 4L0ZB 2Z5UA 4IVNA 2IA0A 4LFUA 3DF8A 2EA2A 4Y15A 1I1GA 3GO5A 3F72A 2MC3A 4EJUA 2GWRA 4EV0A 1Y0UA 5LGNA 4HLYA 4MQ9F 2OBPA 5E1ZB 4AWXB 4BXUA 1LJ9A 3ERED 4GYIA 4IJAA 4CGZA 2KIFA 3QPHA 5E20A 3U2RA 2H27A 5JVTA 1KGSA 1WWXA 1LDJA 4A0ZA 3RKYA 1ODDA 4KYWA 4EJVA 3BJOA 2UZKA 2KIMA 4JK1X 1F9NA 3SZPA 5BQTA 2PG4A 4NHJA 1B9NA 4M9XA 1R22A 3HHHA 3F8MA 1R1TA 4WF2A 3KETA 2F5DA 2QVOA 3F8FA 3V8KA 1SFUA 3TQNA 5LEJA 1MJ9A 3J81K 1WSUA 5TRDA 3FMQA 1QGPA 2JZYA 2YU3A 2P8TA 4RB1A 1LEAA 3NQOA 1IRFA 4G6DA 1O3QA 4RGUA 5HLIA 3ROUA 4O3MA 3I59A 3LWFA 3ZPLA 4PCQA 1U8RA 1R58A 1U78A 5DD8A 2HZTA 3H3ZA 4M6YA 2Q8KA 3TO6A 2M8EA 3HRSA 3JTHA 2M30A 1SFEA 4IXAA 5AONA 3MWMA 2QWWA 3Q9VA 3IWZA 2HKXA 5HLGA 1YFHA 3GX4X 1LDKB 3KP6A 1T39A 3TOAA 4DNCA 2DQRA 1OYIA 2K02A 4I98B 5IT9Z 5HDGA 2Y0MA 3V8JA 1R5HA 2DTRA 3E3VA 3F6OA 4YFNF 1F4KA 1U5TA 3P7NA 2H94A 2CQKA 1R1UA 1I5ZA 1GVJA 5JFRA 1IW7F 3B73A 3G73A 4H0EA 3EUHA 1KQ8A 4ENMA 2GZWA 4KDPA 2FMYA 2VODA 2F5EA 2IP2A 1XN7A 3R4KA 5LGTA 2V6CA 3F8NA 3K1MA 1LQ1A 1K78A 5BPDA 4WXCA 2ELHA 3I5UA 3HUGA 2ETHA 5E17F 5E1XA 1IN4A 1MJBA 1O3TA 1MJAA 1W7PA 2PMHA 1YS7A 1NHAA 1XSDA 2J5PA 3FM5A 2QENA 3BPXA 3MAJA 5BMZA 5LHGA 2VE9A 2QUFA 2BEOA 1B1BA 1Z1DA 1ZGAA 3KP5A 3GF2A 5FLXK 3V7CA 3VOEA 2M5WA 4UHTA 5HS7A 5J8CA 1ZAOA 4XLNF 4ZZLA 4HF2A 1FY7A 3HSRA 3EYIA 1DPRA 3KEQA 2ZXJA 3WGIA 1SD7A 3RJPA 5FFZA 2FEZA 5AIPA 5CVIA 1PDNC 5L3CA 5E8GA 3I59B 3EDPA 2GXBA 1BI3A 4PGHA 5EEHA 2NS0A 2VN2A 3WE2A 4TV7A 3QRFF 2Y48A 4L9TA 4RB0A 2DBBA 3FXRA 3HRUA 3DPLC 3COAC 4LD5A 3AAFA 4EGYA 4A6EA 1BIBA 4I7HA 5K5RA 4I01A 3RPUA 2DFIA 1RUOA 1WRJA 2LNBA 4KNYA 1FC3A 4KMUX 1FOKA 2EV6A 4LGWA 1LDDA 2A3SA 1U5TB 3HIFA 2O8XA 4BHPA 4LJZF 1XGOA 2DQLA 4UVAA 3G3ZA 1XB4A 2IW5A 4S04A 4ZZDA 1YO5C 1O7LA 4R8HA 5LHHA 4WWCA 2MD5A 2VC0A 1SMYF 4HLXA 1RI7A 2XGXA 1K78B 3CO6C 2PQ8A 3V4GA 4XSXF 3O3KA 1L3LA 1FYLA 4N9HA 1FBUA 1W7PB 4BH9A 3F23A 2W85A 3DFGA 3BZ6A 1YW8A 4LG0A 2ZKZA 1IRGA 2DO7A 4HBLA 2XUBA 1I1SA 2KRFA 2DK5A 1EH8A 2EJRA 3WTSC 1TW3A 4HV6A 2KJBA 1MDMA 4ESJA 2R3SA 2FE3A 1F5TA 1P4XA 1HQCA 1S7AA 4BAYA 4GCVA 1ULYA 4HOBA 4UXNA 3I58A 5IT9K 1KYZA 1BJAA 5ILUA 2VXZA 3JW4A 4HDUA 1G6NA 1KQ9A 5BOXA 3KP4A 5HOOA 3GUDA 4P5OA 1DP7P 5ERIA 4R79A 4O6JA 1HKQA 4HW0A 2MA3A 2RN7A 4EM0B 3DEUA 3TKYA 4ENKA 3J80Z 1GXPA 3Q9SA 5DCMB 4EM2A 1ZG1A 1OR7A 1X3UA 3M8EA 1WQ2A 1YTYA 3PQKA 4EMSA 1JHHA 1IN8A 2K27A 2RQPA 3GVAA 2K7LA 1FYKA 2Z3YA 2H6CA 2E7WA 4OINF 5H6RA 4I0BA 3TGNA 1B4AA 3O6BB 1KA8A 1TW2A 3F6VA 4EVIA 2V9VA 4A2UA 3RTRA 3EQLF 1AOYA 2HYGD 3ISPA 3MEXA 2HFHA 4YIFA 1ON2A 4HX4A 1EV7A 3GZ6A 3P9IA 2H6BA 5HDNA 3LQQA 5FD5A 2EFQA 3KP3A 1QZYA 1BI0A 4WK8F 3ZMDA 3L7WA 3CUQC 4WXHA 3WG9A 1TQPA 2R7FA 2VOOA 2HDCA 1ZREA 1HKTA 4MTDA 4OIPF 2BV6A 4LG0B 3WTYC 5FD6A 3OV8A 2FF4A 3K1NA 3DP7A 2QQ9A 4KUMA 2W84A 3DV8A 4OIOF 3ECHA 1IF1A 1MDMB 2OAZA 2O6GE 4L0YB 3P9CA 3K1PA 3E5QA 1G3WA 2IPQX 4WX9A 4EQQA 3VB2A 2ISZA 4HZFA 4Z2YA 1O3RA 1P92A 4UVCA 3FWEA 4G6QA 3RDIA 1BC8C 4Y17A 1G4DA 4M73A 5IT3A 1BC7C 3CDHA 5LRRA 4OIRF 2NRAC 3T8RA 1K79A 2L4MA 2M87A 3WGGA 3IRRA 2P5VA 3I0TA 1T6SA 3QU3A 3KZYA 4XSZF 3V7RA 1FP2A 3KFWX 3FM3A 2LDUA 5D8LB 3ABUA 4HV5A 1ZRCA 3F21A 4OU0A 2G7HA 5EEGA 2NNYA 1XDUA 1YW7A 1DPUA 3WTZA 1BBYA 1J59A 1H9TA 4I09A 4FT8A 2V79A 1OYYA 3JAMZ 4O5VA 4IRGA 5D5UB 4KN4X 2XAGA 3N4MA 3MCZA 2FRHA 4WXDA 4P9FA 3WTVC 4MHGA 1ZG5A 4ZYDA 1GXQA 3S2WA 4HF1A 1FYMA 1H9GA 4ZYEA 4RB3C 2L02A 4B09A 3PFIA 1FSHA 4NQWA 1V3FA 5DUKA 4HX7A 2FU4A 3M8FA 4M71A 3T0YA 4I2OA 1ONVA 2E1NA 4Q4ZF 1B59A 3K2ZA 4M9ZA 3D0SA 1G3SA 3WTXC 1S7OA 4U0WA 2FBHA 3NEUA 5D5VB 1REPC 5CJ9A 2ZBKA 4KA4A 4LK0F 3J80K 4LB5A 5ICEA 1K7AA 3ZMTA 4KIGA 2KIUA 5J6XA 2HS5A 4RGXA 1S3JA 4CYDA 3SXYA 3ZN0A 1FPQA 4CO8A 3TDUC 3IL2A 4OMYA 5LRSA 3DQVC 2DPDA 1Z9CA 4N0BA 2XAFA 2NAZA 4OMZA 5J8FA 2D1HA 4MQVA 2V1UA 2YX4A 3ELKA 2VT2A 5LEKA 2BYVE 4IPAA 4RAYA 4Q47A 5D6FA 5FO5A 2RC4A 1FP1D 3BROA 1QBJA 1OPCA 2IRFG 2V1DA 4R1HA 3F22A 1J0RA 3GFMA 4JQFA 1FZPB 4PZJA 2E7XA 2P4WA 1HKSA 5HVQC 3KP2A 3R0AA 3ULQB 4UNOA 3BY6A 2YSRA 3GXOA 2CO5A 4Q5SF 1SD6A 3K69A 2BGCA 3REOA 1B9MA 2X0LA 4OOIA 1AWCA 4I02A 2Z33A 1YYVA 4HQEA 4MEXF 1P4AA 1KU7A 1EH6A 3HYIA 4CZZA 3E6CC 4CDGA 3E6MA 2JTVA 3HSFA 2P7CB 1HXDA 2Y75A 4LLGF 1DDNA 3WU1B 3VEPA 5DV5A 2YX7A 1MD0A 1ZRFA 4L18B 2OZ6A 2PMUA 3NRVA 2XKPA 2ESNA 5DD4A 5LLQA 1R5GA 3H92A 2ISYA 2EV0A 5L3EA 2CWEA 4XLPF 4L9JA 2DPUA 2A61A 4G7OF 5DUIA 3CTAA 3WTUC 1TBXA 3LAPA 4RB2C 3ZMSA 4I0AA 5JR3A 1O57A 1FBSA 4GYGA 3ZP5A 1S29A 2PFBA 1FNNA 5DCMA 3GFIA 4ESBA 1C0WA 4EGZA 4A12A 5E18F 3HTUA 2QBYB 3ML6A 3E6BA 3EETA 4RGSA 2NNNA 3GEZA 4A0YA 4GXOA 1ZH5A 1I27A 2XIGA 3KE2A 3U1DA 2PJPA 4LB6B 4F7ZA 1R00A 3FHZA 2LSOA 3CJNA 3JAMK 3GZ5A 4YFXF 2EFWA 2L4AA 3MZYA 1G3YA 4RGRA 2FQ3A 2EFOA 2RGVA 3T5XA 2FBKA 5D5XB 2FBIA 3BP8A 4L9NA 2ACJA 3KP7A 4AVPA 2UXXA 1Z05A 4P9UA 4U88A 4HDVA 4U0VA 2BE5F 4CICA 2HWVA 2A07F 1T98A 2M45A 5D6EA 4ZYHA 3ZMUA 1UCRA 2HOEA 2ZNZA 2FXAA 1BOAA 5HS8A 4HX8A 3EYYA 4BHCA 2ESHA 3D5LA 2D1VA 3C18A 2JPCA 3E97A 1LNWA 1JHFA 4ENJA 2XKOA 3DXJF 1W5TA 5ILSA 1SFXA 3I53A 1J2XA 4PDKA 4KT5C 5FFXA 4UV9A 4L9VA 5CVRA 2IT0A 2H09A 3Q5FA 3R60A 2HTJA 4CHUA 5DEQA 4IF4A 2O0YA 3WTWC 2WWYA 2GIVA 3DPTA 4KICA 1LB2A 1XGSA 3WTTC 4HA8A 5LHIA 1Z7UA 3C3WA 2A5YB 5D4RA 1YLFA 2L01A 1PP7U 2K86A 3K9TA 4CXFA 3RIRA 2AXLA 2B0LA 4KIBA 2LKPA 4G7ZF 1TNSA 2RDPA 3MZHA 4K2EA 4LMYA 5DCFA 4YIIA 3GFLA 2STTA 1UB9A 3GLXA 1QPMA 4U0YA 1R23A 2ZMEB 3V7SA 2YR2A 3QP6A 2ADUA 3B02A 4G8XA 4KFCA 4LLLA 3BJ6A 3JSPA 5K1YA 3M7GA 3VODA 2D2WA 1HW1A 1TLHB 1L0OC 1SD5A 2UXNA 5FB2A 1W4MA 5K5OA 2GA2A 2HYFA 2STWA 4WCGA 2QYOA 3IHUA 1HW2A 2FNPA 2VT3A 2XRNA 2QQBA 1T0FA 1D8JA 5KVRA 1T2KA 4M9SA 2K4JA 1BI2A 1ZGJA 3DKWA 4QLCU 2AS5F 3E5XA 2A6EF 2VOPA 3KCCA 4L5IA 1XD7A 1YW9A 4A0XA 5FGMA 1H0MA 2JPBA 4A6DA 2RVCA 1IXSB 1J5YA 3QOPA 2EFNA 2FMLA 3R61A 4MNUA 3LSTA 5CVVA 4EJTA 1A04A 4PGGA 3LA2A 1TQIA 2COMA 5CYVA 4ESFA 1IN6A 2JRTA 2OQGA 2VE8A 3FXQA 3GWZA 4Q48A 1ON1A 1BM9A 2JSCA 2FNAA 2A68F 4HAMA 4P96A 1O7FA 2PI0A 2HKOA 4XBFA 5D5WB 1D5VA 2VBXA 4NB5A 1QQIA 3I4PA 1SD4A 1YQAA 4ZH4F 1O3SA 3L2CA 4ASNA 2VC1A 1ZRDA 1R36A 2CW0F 3TO7A 3FMSA 1ZARA 2HEOA 1ZYRF 3F8BA 4AIHA 1USSA 4BHBA 4EJOA 3F8CA 1E2XA 3LA7A 2VONA 5ICFA 3L09A 2QQAA 4S05A 1DUXC 1J7KA 3WGHA 5A2QZ 3E6DA 3IKVA 5CVJA 1KYWA 3L00A 4ZYGA 1J75A 4OIQF 2L54A 5D4SA 1S6LA 1U2WA 2XVCA 2IA1A 1GHCA 4HYEA 1ZHFA 3RYRA 4KN7X 1Z6RA 3RPQA 3RYPA 2DU9A 2LF7A 2CGPA 3LAJA 1CF7A 3IWFA 3CUQA 1TTYA 1STZA 2XROA 3FMRA 3ZQ7A 4M74A 1LVAA 1CGPA 3OOPA 3VFZA 3ABTA 2LF8A 4EM1A 2QBYA 3I54A 1ZG3A 2CG4A 3PQJA 3KEOA 3N97A 2GAUA 1EH7A 2RNJA 3QP5A 3ZMZA 2DW4A 2ZO4A 2O3FA 2QM3A 1VTNC 1R1VA 4KMFA 3KZZA 1ZN2A 4Y13A 3TOBA 2D45A 1FWZA 3RI4A 2PLYA 1UHMA 5BS6A 4IHSA 2XAQA 4FHTA 4HF0A 2RV8A 3QAHA 6PAXA 1I6XA 2W25A 3GFJA 3KLNA 2CSOA 1OMIA 3T1BA 1PP8F 2FOKA 5H6QA 3LFKA 1FX7A 3BJAA 1PUEE 2R7DA 2HQNA 4BQAA 3TDZC 1MKMA 5DYMA 1IUYA 1JGSA 1JXSA 1P4WA 1WKMA 4L5JA 1P6RA 2Z99A 3M1EA 3ZMVA 1HSJA 1BN5A 3HRMA 1IZ1A 1B6AA 4XRFA 4UVBA 4FX0A 1QZZA 2P6SA 2IVMA 2ZNYA 2DAOA 2IJLA 1MZBA 2HR3A 1XDSA 5CVUA 2EFPA 3LQRA 3W6JB 4IRHA 2NYXA 2UWMA 2P5KA 2DT5A 4KIFA 3TO9A 2PBIA 3CO7C 3V8LA 5BPIA 3HTSB 5L3FA 2OA4A 4LLNA 4RS8A 3QPTA 1IN7A 2V1XA 2W24A 1CF7B 2A69F 2A6HF 2EV5A 4ENNA 4IRIA 2ZFWA 3CUQB 2M1BA 4ON0A 3R0JA 1F1ZA 3H3UA 3HOTA 2IA2A 5DDGA 5HS9A 3FF5A 1KU9A 2W57A 5K5QA 4UUVA 1RIOH 1QO0D 4IHTA 2XAJA 1D8KA 1YS6A 3RKXA 2VBYA 4A5NA 1XMKA 3I64A 3FXUA 1U6GA 5KK1A 3M9AA 1XSVA 2JT1A 2XV4S 2HGCA 1LEBA 2QLZA 3U9GA 2EB7A 1HW5A 2CYYA 2Q0OA 2XAHA 3ECOA 1KQ0A 5F1RA 2WV0A 1FLIA 2PEXA 2VBWA 3O2PE 1P2FA 2EWNA 5H20A 5LGUA 1SMTA 2DLLA 4GGGA 5A2QK 1ZLKA 2ZMEA 4N9IA 4G94A 1V4RA 5L3DA 3BPVA 4G7HF 1Z91A 1XMAA 1IN5A 1D3YA 4A5MA 2L3DA 1BI1A 5JI6A 4QWQA 4RAZA 1FSEA 2MH9A 2P6TA 4GO1A 5ILVA 5D8KB 4E70A 1XGNA 1YIOA 3HRTA 1IXRC 4UV8A 1T38A 2FA5A 2TDXA 2O61A 3HOSA 2K4BA 5L3GA 2CFXA 4MGRA 4P55A 1Z6TA 2G7UA 3F3XA 3GW2A 2J5OA 2FSWA 3GYHX 1HBXG 3BOQA 5TJJA 3J81Z 4DQ2A 3MFKA 5F6FA 1OKRA 5L3BA 3R6SA 4AIKA 2YPRA 3J7AO 1Q1HA 2OZUA 4HQMA 1USTA 3L9FA 2MLGA 2DK8A 5CLSA 5HDKA 4JBAA 3SFZA 3KLOA 1XGMA 2HQRA 1UHWA 1R7JA 2OQRA 3IC7A 3LA3A 2EK5A 3CUOA 1SAXA 3IKTA 3CLOA 3W6KB 4EJWA 4MEYF 3JSOA 2G9WA 2WTEA 3FX3A 2O03A 3HHGA 4ETSA 3BWGA 2XASA 1BIAA 1IXCA 2GQQA 2RKHA 1WI9A 5LBQA 5E1WA 1RUNA 2GXGA 3I71A 5ICCA 2C6YA 4YFKF 1KU3A 1YG2A 4FX4A 1J9IA 4M6XA 3WU0A 3WE3A 2EA4A 3FZVA 1RZ4A 1HSTA 4D0PA 3P9KA 4U7DA 5HLHA 2F5FA 3IRQA 2MH2A 1FBQA 3RKWA 1W5SA 2GA1A 1ZLJA 1MGTA 3E5UA 2MBFA 1UFMA 2P7VB 4MTEA 2BBYA 2F5CA 2F2EA 4BYYA 2MLKA 5AIQA 1XCBA 3BDDA 4AIJA 5ICGA 5ED4A 2Q2EA 1TQMA 2P5LC 3K0LA 3SZTA 1KU2A 2OU2A 3WODF 2VBZA 4LK1F 3QU6A 1S8NA 2ZCWA 1W7PD 1FT9A 2ZJ2A 2XHKA 3SHFA 1XCVA 4BNCA 5FLXZ 3SQNA 2KJCA 4G9YA 3T8TA 4U7BA 3HSEA 4YG2F 1JE8A 1OYWA 1QNTA 3MQ0A 5JHUA 3JTGA 4AD9A 1U5TC 2QZ8A 1RNLA 2HTSA 1K6OA 1E17A 2Z9OA 3C7JA 2E1CA 5F64A 1G3TA 2PN6A 3C1DA 1IAWA 3ZN1A 5E8IA 2DI3A 1XSXA 4M72A 2X4HA 4B8XA 2OD5A 1U3EM
chains in the Genus database with same CATH superfamily
1AKHA 3Q0VA 4UB8C 2KKOA 1TNTA 2MSYA 3K4MA 1WH5A 2JA7J 2WC2A 1RKWA 1QHHD 4L0ZB 2Z5UA 4IVNA 2IA0A 4LFUA 4XN3A 4XOPA 1ETOA 3DF8A 2EA2A 2XPUA 4Y15A 1I1GA 1X4PA 3GO5A 3F72A 1LVKA 3F0CA 1MSFC 2MC3A 4EJUA 2GWRA 3CCQI 4EV0A 1Y0UA 5LGNA 3CJQB 4HLYA 4MQ9F 2OBPA 5E1ZB 4AWXB 4BXUA 3S2HJ 1LJ9A 2K9LA 5IP7J 3ERED 4GYIA 4IJAA 2VLAA 1IC8A 4CGZA 2KIFA 2YUSA 5KNLA 5EDNA 3QPHA 4B43A 3BTIA 2CV1A 2Z2SB 3BQYA 5E20A 3U2RA 3RPUD 3W2WA 2H27A 5JVTA 4BBSJ 1KGSA 3OY9A 1WWXA 1LDJA 4A0ZA 3RKYA 1ODDA 5E3OA 4KYWA 4EJVA 3BJOA 2UZKA 2KIMA 4QSHA 4JK1X 1F9NA 3SZPA 5BQTA 2PG4A 4BXFA 4IHYA 1OCRH 4NHJA 1B9NA 4M9XA 1R22A 3HHHA 5DM7F 2LD5A 2BY1A 4DZPA 5CPRB 3F8MA 3OYLA 4OAYA 2QKLB 3LSIA 1R1TA 4WF2A 4BBRJ 2IGKA 5K7FA 3KETA 2F5DA 4FQGA 2QVOA 2VASA 4BGDA 3F8FA 3V8KA 1SFUA 3AG1H 2LLKA 1HC8A 1QHGA 2K3PA 3MD2A 3TQNA 3GTJJ 4F92B 1LFPA 5LEJA 3MKYB 2LBFB 1MJ9A 3J81K 3I56I 1WSUA 1VQKI 5TRDA 2DXIA 3FMQA 4BQNA 1QGPA 2JZYA 2YU3A 1QPIA 2P8TA 4RB1A 1LEAA 3PNYA 2Q2EB 3NQOA 1ETVA 1IRFA 3NWSA 1Y56A 4G6DA 1O3QA 4RGUA 5HLIA 3ROUA 4O3MA 3J7YJ 2NS7A 2VIXA 3I59A 3L2RA 3LWFA 3ZPLA 4PCQA 1RETA 4XONA 3SYTA 2NOJB 1SAUA 4V2FA 1M1EB 3O8GA 1U8RA 2CJJA 1R58A 5HNHA 1U78A 2DTZA 2HXIA 3OR1C 3UNGC 5E3MA 5DD8A 2HZTA 3OYBA 3H3ZA 3CESA 4M6YA 2Q8KA 3CF2A 4QIWN 1MBKA 2F4MB 1YRNB 2K9QA 1MBFA 3TO6A 5M3FJ 2M8EA 3HRSA 5GADJ 1OQYA 2CV2A 3I3LA 3H0GJ 3JTHA 4BJ6C 1H8AC 2M30A 5GTHC 2AQEA 2CUFA 1SFEA 3HOVJ 4IXAA 5J47A 1Z21A 3HKZN 5AONA 3MWMA 2QWWA 2LVSA 3Q9VA 3IWZA 3TP3A 2HKXA 5E3LA 4D7MA 1N25A 1W5CC 3GTQJ 5HLGA 2EZLA 2QEXI 1YFHA 2DA2A 3TL4X 3GX4X 1LDKB 3KP6A 1AKHB 1T39A 3TOAA 4DNCA 2DQRA 1OYIA 2K02A 2VJ4A 1NTCA 4I98B 1TT5B 5F0FA 1W0TA 5IT9Z 3LL7A 4C3IJ 5HDGA 2Y0MA 3V8JA 1R5HA 2DTRA 4DYQA 1K4SA 2MW8A 3E3VA 3F6OA 4YFNF 1F4KA 1U5TA 3A01A 3P7NA 2H94A 2CQKA 1OLTA 4RBOA 1R1UA 1I5ZA 1GVJA 3D5SC 4D7NA 5JFRA 4V2GA 1IW7F 3B73A 3G73A 4H0EA 3EUHA 1DP3A 1KQ8A 1TZLA 2KHMA 4ENMA 1OCZH 2GZWA 4KDPA 5FLMJ 2FMYA 2VODA 3VYTB 3ZQFA 4XRMA 2F5EA 4OAZA 3PUBA 4I99C 2FJ1A 4XORA 2IP2A 1XN7A 4V19K 3R4KA 5LGTA 4L5EA 1Y0NA 2V6CA 3F8NA 3K1MA 1LQ1A 1K78A 5BPDA 4WXCA 2ELHA 1BOBA 3I55I 5B1BH 3FBIB 2VJ5A 4NNJA 3I5UA 3HUGA 1XG1A 2ETHA 5E17F 5E1XA 1HOMA 1IN4A 1WPKA 1MJBA 1O3TA 1MJAA 1W7PA 1YE9A 2PMHA 1YS7A 3GCMA 2R5ZA 2E1MB 1NHAA 2XDVA 1XSDA 2J5PA 2WB1N 3FM5A 2L7MP 1P7JA 2BHYA 3JRFA 2QENA 1ERDA 4II3A 3BPXA 2DDBA 2KIQA 3MAJA 5BMZA 5LHGA 2VE9A 2QUFA 3K6GA 2KRHA 2BEOA 1B1BA 1JUSA 1Z1DA 1ZGAA 4C3HJ 3KP5A 3LSMA 3L2WA 2VPLA 3GF2A 5FLXK 2LR8A 1ZGWA 2K40A 3V7CA 3VOEA 2DA3A 2M5WA 1QU3A 4UHTA 5HS7A 5J8CA 3S3OA 1ZAOA 3CMMA 2QA4I 3PSFA 4XLNF 4ZZLA 2RREA 3FK6A 4HF2A 1MBHA 1FY7A 3HSRA 3MN2A 1DPRA 3KEQA 3EYIA 2ZXJA 3WGIA 1SD7A 3KPHA 3RJPA 1XC5A 5FFZA 4BY1J 3NAUA 1Y8RB 2FEZA 2M9HA 5AIPA 5J4YA 5CVIA 4A69C 1PDNC 5L3CA 5E8GA 4A3EJ 1MSEC 3I59B 4B47A 3V42A 3EDPA 2GXBA 1BI3A 4PGHA 1X4OA 2WAEA 5EEHA 2NS0A 3I9V2 1FIPA 1ITYA 2VN2A 4C9YA 1IUFA 3S2DJ 3WE2A 3GBGA 4TV7A 4A3KJ 3QRFF 2VKHA 2CQNA 2Y48A 4L9TA 4RB0A 5J1RA 2V26A 3SEZA 2LMDA 3DWLE 4ZYAA 4F3QA 2ID6A 4KJZA 2DBBA 3FXRA 3VYRB 1B72A 3S14J 4BE0A 3AL0B 3HRUA 3ASNH 3ZXSA 4YELA 3DPLC 2WAFA 3COAC 4E7HA 5JLWA 4LD5A 3AAFA 2JWTA 4EGYA 1SEUA 4A6EA 3JRCA 1BIBA 4I7HA 4DBRA 4M3GA 1YJ9I 5K5RA 4I01A 3RPUA 1NG7A 2D5VA 3LSPA 2E60A 2DFIA 1FEXA 1RUOA 3BG5A 4NDLA 1BR4A 3ASOH 1WRJA 2LNBA 3WG7H 4BDZA 1IGNA 3K2AA 4KNYA 3L2QA 1FC3A 3OL3A 4KMUX 3IH2A 1FOKA 2EV6A 1WHUA 1LDDA 4LGWA 2A3SA 3HKZA 1U5TB 3A01B 1ZELA 3HIFA 2CH0A 2O8XA 2E5NA 2AHQA 4BHPA 4LJZF 1YI2I 1XGOA 2R7ZJ 1XX5A 2FOWA 1MBJA 2DQLA 4UVAA 3G3ZA 1XB4A 3HPGA 2LK2A 2IW5A 4S04A 3PL8A 4ZZDA 1YO5C 4E7LA 1O7LA 4BDYA 4II2A 4R8HA 2GM4A 5LHHA 2R7VA 2OCEA 4WWCA 2MD5A 5FKMA 3VSLA 2VC0A 4XLAA 1SMYF 4HLXA 3BZKA 3S1RJ 3G2BA 1RI7A 2XGXA 1K78B 3CO6C 1X1CA 2PQ8A 1TWGJ 3V4GA 1A6QA 2L5QA 1YJWI 4XSXF 3O3KA 1A35A 2EILH 3JRIA 3CC4I 2IS1A 1L3LA 1ORKA 1FYLA 4RAFA 4A3CJ 4N9HA 4A3BJ 1FBUA 5F27A 1W7PB 4BH9A 2R5ZB 2JN6A 4IHWA 3PM1A 3F23A 2W85A 2XB0X 2JA5J 3BZCA 3K4CA 2LKSA 2X1DA 1W0UA 2AQFA 3DFGA 3BZ6A 1OISA 1S72I 3HG9A 1YW8A 3DTEA 4A3DJ 4LG0A 1W36C 2ZKZA 1IRGA 2DO7A 3A1YA 4HBLA 4X1EA 4JP0A 2LOOA 4FASD 3GTLJ 2DT6A 3FXLA 2XUBA 2K3FA 2CS3A 1WJDA 2KRFA 4DIQA 2DK5A 4XM3A 1I1SA 1G8XA 2RQQA 3ABLH 3OYDA 2KFDA 3ZQIA 1EH8A 2V1NA 2EJRA 3WTSC 1TW3A 1VQ7I 3S1QJ 3KX2A 3L2UA 4HV6A 3PNVA 2KJBA 2QKMB 1MDMA 4ESJA 2R3SA 2FE3A 4C2TA 5B5EC 3MKZA 1F5TA 1WFXA 3OL4A 4XKCA 1V5EA 1P4XA 1APLC 1HQCA 4NC8A 2E2JJ 1S7AA 2MG4A 4BAYA 4GCVA 1ULYA 1D1CA 3HGYA 4HOBA 2QGUA 3DBHB 4UXNA 3I58A 3JRHA 1VQ9I 1WJBA 4EEFG 3OS1A 5JLXA 5IT9K 1R9TJ 1KYZA 1BJAA 5ILUA 2CQQA 2VXZA 3JW4A 3ZOBA 1QA6A 4HDUA 1HLVA 1G6NA 4FE4A 2DYSH 4BS9A 3OYHA 1KQ9A 3QYFA 2X6WA 4JYKA 4FCYA 1B72B 5BOXA 4IKFA 2JRMA 4XQFA 1KZHA 2ZSHB 3KP4A 5HOOA 3GUDA 3FDYA 4P5OA 1DP7P 5ERIA 3JRDA 2DOEA 4R79A 4O6JA 1HKQA 2K9NA 2CQ7A 4HW0A 2KT0A 2MA3A 2RN7A 4EM0B 3DEUA 3TKYA 3VDXA 4ENKA 3J80Z 4E7SA 5IYBJ 1GXPA 2CMPA 3Q9SA 5DCMB 4EM2A 2F5VA 3LSHA 3M1CA 1ZG1A 3QQAA 1SVLA 1OR7A 1X3UA 5B1AH 2E71A 2DOFA 1I6HJ 1R4MB 3M8EA 1WQ2A 1YTYA 3DBRB 5B3SH 3RKQA 4U87A 3PQKA 3BR5A 1FJLA 2DA7A 1VI0A 4EMSA 1JHHA 1IN8A 3K4BA 1JI8A 2K27A 2RQPA 1W1WE 3GVAA 3DU6A 4Y7NJ 2COBA 3MKWB 3HXLA 2G0EA 1E3PA 4BEHA 3G1OA 2K7LA 3C2HA 2Z3YA 1FYKA 4Y52J 1K83J 1WI3A 1WJ5A 2KP6A 2H6CA 2Z16A 1Y1VJ 2E7WA 1WH7A 4OINF 3H3VK 5CKTA 1QRYA 5H6RA 4I0BA 3TGNA 1X3ZB 1B4AA 1ZQ3P 3Q3SA 3O6BB 1KA8A 1TW2A 3F6VA 4EVIA 2V9VA 2JJ7A 2OTLI 2VKDA 4A2UA 3RTRA 3EQLF 1AOYA 2WY7Q 2LTPA 4UY8I 2HYGD 2V9KA 3ISPA 3MEXA 2HFHA 4DYRA 4YIFA 1ON2A 5M3MJ 5EGOA 4HX4A 2AO9A 5J3LA 2UV1A 1EV7A 3BR6A 3GZ6A 3P9IA 2H6BA 3ABMH 5HDNA 3LQQA 2GOXB 1YX5A 2L2OA 5FD5A 4A3IJ 2LBFA 2XRLA 5GTIC 2CU7A 2CFOA 2DFFA 2O7OA 2EFQA 5GP9A 3KP3A 1QZYA 1BI0A 5EJCA 4WK8F 4FETA 1MBGA 2OPTA 3ZMDA 2WAQN 3L7WA 1AU7A 1OJLA 2BY2A 3CUQC 4WXHA 3WG9A 2X9DA 1TQPA 1X19A 2R7FA 4E7JA 4XK4A 3SEQA 3OYKA 2VOOA 3E0JB 2HDCA 1ZREA 1HKTA 4MTDA 4OIPF 2BV6A 3BTJA 2XC7A 3EUKL 3IV5A 4LG0B 3WTYC 5FD6A 3OV8A 2EIKH 5H2FC 2FF4A 4C2UA 5GAEJ 4LIVA 3K1NA 1ETXA 3DP7A 2QQ9A 4M3DA 4IX7A 2HYJA 2CUEA 4KUMA 2W84A 1ETWA 1VNDA 1J09A 3DV8A 4OIOF 3ECHA 3FXKA 3AKZA 5J1UA 1IF1A 2R7OA 1MIJA 1MDMB 2OAZA 1YRNA 3ESWB 2O6GE 4L0YB 3P9CA 1PVEA 3K1PA 3E5QA 3ZQCA 1G3WA 1RKTA 2IPQX 1OCTC 4WX9A 3LNQA 2L9RA 4BE1A 2GOMA 4EQQA 2CUZA 2ME6A 1JUPA 3VB2A 2EZKA 2IGMA 2ISZA 5DS9A 4HZFA 4Z2YA 1O3RA 1P92A 2DA4A 4UVCA 3FWEA 3CZ6A 4G6QA 2MD0A 3RDIA 1BC8C 4W1UA 3IP4B 4Y17A 3GTOJ 1XMXA 1G4DA 3LSGA 4M73A 5IT3A 1BC7C 3CDHA 5LRRA 4OIRF 2NRAC 2KL4A 3T8RA 1LFUP 1K79A 2L4MA 2M87A 1YJNI 3ONQA 3WGGA 2H1KA 3IRRA 3FISA 2P5VA 4M3BA 3H5NA 4AU7A 3AG4H 4EATA 4HRIA 3I0TA 1I3AA 1T6SA 2XAUA 3AG2H 3QU3A 3KZYA 2HXOA 1H88C 4XSZF 3V7RA 1FP2A 3KFWX 1Z67A 3FM3A 3K70D 2LDUA 2VUMJ 2IEKA 4NC7A 3TP0A 5D8LB 3ABUA 4HV5A 3BQZA 3L1PA 4NUBA 1ZRCA 5GPAA 3L2VA 3F21A 4BEHB 2EIMH 4OU0A 5CQGA 3GTGJ 2W1OA 2G7HA 4M3EA 5EEGA 2NNYA 2F6CA 1XDUA 1YW7A 2LFBA 4XRSG 1SC7A 1DPUA 2X48A 2DA6A 4BL0B 3WTZA 1BBYA 4YIRX 1VQMI 4XR6A 1MMDA 1J59A 1H9TA 4I09A 4CCMA 3B6AA 2MFZA 2VQCA 2M2EA 2BY0A 3H5RA 4FT8A 3S17J 2V79A 2OV7A 1OYYA 2Q1ZB 3JAMZ 5EGOB 4O5VA 4IRGA 5D5UB 4KN4X 3OYNA 2XAGA 3N4MA 3MCZA 4D5FA 2FRHA 3BG9A 4DGWB 4WXDA 5M5XJ 2KPMA 4P9FA 3WTVC 3H1CA 4MHGA 1ZG5A 2VQHA 3A0HC 3BCBA 5EZGA 4ZYDA 2ZXWH 1MH3A 4MFEA 4QPQA 1GXQA 2XF7A 1VQ6I 5E3NA 1MH4A 3S2WA 4HF1A 1FYMA 1XPXA 1IJWC 1FTTA 3ERMA 2MGQA 1H9GA 4ZYEA 4F93B 4RB3C 4W97A 2L02A 4B09A 3K70C 1LKXA 3HOXJ 4B1RA 3ZQGA 3PFIA 1FSHA 1P7IA 2ZC2A 3DEWA 4NQWA 1V3FA 2LY9A 1HDDC 5DUKA 5F1JA 2X6XA 4HX7A 2FU4A 4D9JA 3CCSI 3M8FA 4M71A 2DT7B 3T0YA 4I2OA 1ONVA 2R93J 2WAQA 3DKYA 1Z3XA 3HGGA 2E1NA 2R7RA 4Q4ZF 3HBLA 1B59A 3K2ZA 1A31A 4M9ZA 3D0SA 1G3SA 3WTXC 1S7OA 3AG3H 4U0WA 2FBHA 3G1LA 3NEUA 5D5VB 4HSRA 1REPC 1HA8A 2QSFX 2JK3A 3PO3J 4DOZA 5CJ9A 2ZBKA 4KA4A 4LK0F 2HZDA 3J80K 4LB5A 5ICEA 1K7AA 1U9NA 4IQJA 3ZMTA 4KIGA 2KIUA 1RR8C 1T33A 5J6XA 2HS5A 4RGXA 5J40A 3RSNA 1S3JA 4CYDA 3SXYA 3ZN0A 3SFIA 1FPQA 4CO8A 2E34A 3TDUC 5K7ZA 4AM3A 2EINH 4AVZA 1IO2A 5IOZA 3IL2A 4KISA 4OMYA 3S15J 1VQ4I 1BR2A 5LRSA 2OUMA 3DQVC 1X3WB 2DPDA 1Z9CA 4N0BA 1JTYA 2XAFA 2NAZA 4OMZA 1T95A 5J8FA 2D1HA 3ZGKA 2V7FA 4MQVA 1X1PA 4C2MJ 4N4OB 2V1UA 2YX4A 4IQ4A 2Y69H 1E0EA 3ELKA 2VT2A 3IAM2 3FIWA 1XTAA 1MW7A 2ZMEC 2DJIA 5IP9J 5LEKA 2BYVE 2VJJA 3WU2C 1U8BA 4IEJA 2HOTA 2Y30A 4IPAA 4RAYA 4Q47A 5D6FA 3DTIA 1Z3YA 2RC4A 5FO5A 1FP1D 3BROA 3OIQA 2NVQJ 3SJMA 5DM6F 2CUJA 2KQRA 1QBJA 1OPCA 2R5YA 2IRFG 2V1DA 4R1HA 3JR9A 3F22A 1J0RA 3KYCB 3GFMA 5CQEA 2ECCA 4JQFA 4PSXA 1FZPB 1D0ZA 4ABZA 4PZJA 2IGOA 1FIAA 2E7XA 2HQAA 3SDGA 2P4WA 1HKSA 4Y3OA 5HVQC 3S1NJ 3KP2A 3R0AA 3ULQB 4UNOA 3BY6A 2HQ5A 2YSRA 1QVTA 2R4GA 3GXOA 4CH7A 3M3YJ 2CO5A 2R92J 4Q5SF 1F36A 2R7WA 1SD6A 3K69A 2BGCA 3DLLF 4F52A 1UMQA 3REOA 1JKQC 3GZNB 1MMGA 2MYSA 1B9MA 4J01A 2X0LA 1GT0C 3H9JA 4OOIA 1AWCA 1OCPA 2HDDA 5F08A 1WVRA 3KYLA 4I02A 3TBIA 2Z33A 4DJAA 1YYVA 2NVYJ 4HQEA 4MEXF 3JCUC 1P4AA 1KU7A 1Z0XA 1EH6A 2HNHA 3HYIA 4CZZA 1JJ6C 3E6CC 4CDGA 1K6YA 1SVMA 1R71A 3E6MA 2E36A 2JTVA 2JUGA 1RESA 5FJ8J 4FTHA 1TC3C 3HSFA 4RLQA 2P7CB 1HXDA 2Y75A 3M07A 3RQIA 4LLGF 1DDNA 3WU1B 1UG2A 3VEPA 5DV5A 3TMOA 4NQWB 1ZR2A 5EYRA 2YX7A 3CCRI 1HCRA 5IYDJ 1MD0A 1VQLI 1ZRFA 4L18B 2DDAA 2OZ6A 1BA5A 2PMUA 2WV1A 1BR1A 2NVTJ 3NRVA 2XKPA 4DBQA 3CD6I 2ESNA 5DD4A 1UG0A 2FX0A 5LLQA 1R5GA 3H92A 2KZGA 2M3AA 3HB9A 2ISYA 2KZVA 2EV0A 3TW6A 5L3EA 2CWEA 3GMEA 4XLPF 4DYCA 2DFHA 4RM2A 4S0HB 4L9JA 4RM3A 4CCKA 2DPUA 2A61A 4G7OF 3QODA 2LREA 2LG4A 4B3XA 5DUIA 3CTAA 3WTUC 1TBXA 3CCUI 3LAPA 3PSIA 4RB2C 3ZMSA 4I0AA 4KITB 5JR3A 1O57A 4PUSA 1FBSA 2IBDA 2N8GA 2XPVA 4GYGA 3ZP5A 3HDDA 4QTRA 1S29A 2PFBA 1FNNA 2VL8A 1JKRC 5DCMA 2L7ZA 4CYCA 4A93J 3GFIA 4ESBA 1XS9A 1C0WA 3H9QA 2QF7A 2V4JC 3OYMA 4EGZA 4A12A 5E18F 3HTUA 1D0YA 2QBYB 3ML6A 4PJLA 2O5RA 1UELB 3E6BA 3A2KA 3EETA 4RGSA 3OYEA 3E1SA 2I10A 5IY5H 2NNNA 2BY3A 3GEZA 1OFCX 1W36D 4A0YA 4GXOA 1S9HA 1IRZA 4LIUA 1Z77A 3BG6A 2ECBA 1ZH5A 2IAIA 1I27A 5K7HA 2XIGA 3KE2A 3HC7A 1ZKGA 5IP6A 2M8GX 1DGRM 3U1DA 2PJPA 2DJNA 4LB6B 4F7ZA 1AA7A 1R00A 3DPUA 3FHZA 1HDPA 3QPLA 5JVGF 2VXDA 2LSOA 4AYBN 4CUGA 3HOZJ 3CJNA 3JAMK 2R5YB 1QVUA 4Z6YA 1VFCA 4XKWA 1CQTA 3GZ5A 4YFXF 4XRSA 2EFWA 2L4AA 3MZYA 4KT6A 4PJ0C 4XN0A 3RCOA 1G3YA 5C4XJ 4RGRA 2FQ3A 2EFOA 3K4NA 2RGVA 3KYDB 3T5XA 1G2HA 2FBKA 2X6OA 5J4VA 3ABKH 5D5XB 3OYFA 3LSKA 2FBIA 3BP8A 3HZJA 2XGDA 4L9NA 1R49A 4BUPA 2ACJA 3FXJA 2ZFUA 3KP7A 4AVPA 4XLHA 4B48A 1K4TA 2BVMA 3H0DA 3CF5F 2HVRA 2UXXA 1Z05A 1WJFA 2E5ZA 3GTMJ 5C4JJ 4P9UA 3N05A 4U88A 2FD5A 1ETYA 4HDVA 1Y1WJ 4U0VA 2BE5F 4CICA 1D5YA 2H1LA 2HWVA 1LUJB 2A07F 1T98A 2M45A 1T0FC 5D6EA 4ZYHA 3HOWJ 1WJAA 2IS2A 3ZMUA 1UCRA 2HOEA 2ZNZA 2FXAA 1BOAA 3EUAA 3CCYA 5HS8A 4HX8A 3EYYA 3SZGA 4BHCA 2ESHA 3D5LA 2WB1A 2WY8Q 2LP0A 3I4MJ 2D1VA 2B63J 2JA6J 4UB6C 2EQRA 2I5UA 3C18A 3MZ8A 1IDYA 2JPCA 3E97A 1LNWA 1JHFA 2EZHA 3DTKA 4ENJA 1SFOJ 2XKOA 3DXJF 1W5TA 5ILSA 3PIOF 1SFXA 2UUZA 3Q0WA 1WGXA 5F0CA 3JRGA 3I53A 1J2XA 2HOSA 4PDKA 4KT5C 3BTCA 3HJEA 5FFXA 4PJNA 3CCEI 1X2NA 4BXXJ 4HEA2 4UV9A 3FKJA 3OYAA 4L9VA 5CVRA 2XSJC 1DU6A 4XIDA 2A5WA 3MMYB 5J1YA 2IT0A 2XF6A 3DEEA 2H09A 3Q5FA 3R60A 2HTJA 1T8IA 1RR7A 3P5JA 4CHUA 5DEQA 5HNFA 5E79C 3X2QH 2LY2A 1EKEA 2RAEA 4IF4A 2O0YA 3WTWC 2WWYA 2KRCA 2GIVA 3DPTA 4KICA 3K4KA 5LFAA 5M5WJ 4CYCB 1LB2A 5FKNA 3BLYA 1XGSA 3K4LA 2GLOA 5EG0B 3BCAA 3Q0UA 3WTTC 4HA8A 5LHIA 1Z7UA 2DODA 3BR0A 3C3WA 1MNMC 2A5YB 2ZSIB 5D4RA 3EPZA 1YLFA 2L01A 2NVUB 3FK7A 4HNTA 1PP7U 2K86A 3GLLA 3K9TA 3J7ZI 4PJMA 4CXFA 3RIRA 2EZIA 2AXLA 1R4NB 2B0LA 4IHXA 4KIBA 2K5CA 2LKPA 3CCJI 1HF0A 2BZTA 3RZOJ 1FOWA 4G7ZF 1TWFJ 1TNSA 1H89C 4XLEA 2RDPA 1ZK8A 1MMAA 3M8JA 3MZHA 1JUMA 4XKVA 4A3JJ 4K2EA 2W00A 4LMYA 5DCFA 3BR3A 4YIIA 3GFLA 2STTA 2VJIA 2Y9YA 1UB9A 2HDWA 3A02A 4BJ5C 2I8DA 1N75A 3GLXA 1QPMA 4U0YA 4AYBA 1R23A 2ZMEB 2DA5A 2B7EA 2CW7A 3ZCOA 3V7SA 2YR2A 1GDTA 4DZJA 4B3AA 4J19A 5LD2C 3QP6A 2TRTA 4A3GJ 2ADUA 5M5YJ 3I4NJ 3PJRA 1NH3A 4CCOA 2M4KA 4Y33A 3B02A 4G8XA 3DCFA 1K61A 2IS4A 2M7AA 4MLOA 4KFCA 3BTLA 1E3HA 1QZEA 3FBNB 4LLLA 1YHQI 3BJ6A 2QQ8A 4RAGA 1G59A 3JSPA 3AL0C 5K1YA 4E7ZA 3M7GA 3VODA 2D2WA 1HW1A 1TLHB 1L0OC 1SD5A 2UXNA 5GAHJ 5FB2A 2CV0A 1W4MA 4CCJA 5K5OA 4PFOA 2GA2A 2ID3A 5HLTA 2HYFA 2HOAA 4PJJA 2DMPA 2R0QC 1JKPC 2V6EA 2BOLA 2STWA 1JGGA 4WCGA 1FTZA 2QYOA 3IHUA 4AC0A 1HW2A 3CCVI 2FNPA 2VT3A 2XRNA 5GPCA 3CDIA 3D1NI 4XNFA 2QQBA 1T0FA 5KAIC 1D8JA 1VQOI 5KVRA 1T2KA 4M9SA 1YIJI 2FUG2 1FMWA 2K4JA 1BI2A 1ZGJA 3DKWA 1A6IA 4QLCU 2AS5F 3E7LA 3MVPA 1DGWY 3E5XA 2A6EF 3KZIC 5EZHA 2VOPA 3KCCA 4L5IA 1XD7A 2OJED 1YW9A 4NBQA 4A0XA 3EUHC 2YU9J 5EF6A 1O4XA 5FGMA 2DFEA 1MNDA 2CRGA 1H0MA 1PJRA 5TISC 2JPBA 4G6TB 4A6DA 2NXNB 2RVCA 1IXSB 1J5YA 3QYBA 3QOPA 2EFNA 1RC9A 5F04A 2FMLA 3R61A 2MABA 4MNUA 2EH3A 2ELJA 3WHBA 2VKEA 3AFHA 3LSTA 5CVVA 1VQ8I 1F43A 4EJTA 1A04A 4PGGA 3W2VA 2VKVA 2VB6A 3IAS2 4M3FA 3LA2A 1TQIA 4A3MJ 2COMA 5CYVA 2X1EA 4ESFA 1IN6A 2JRTA 1UHSA 2OQGA 3QWLA 2VE8A 3FXQA 3GWZA 4Q48A 1JT6A 4XMYA 1ON1A 2FQ4A 2PX9A 2WBMA 3O8HA 1BM9A 2JSCA 2FNAA 3OYJA 5BNGA 2A68F 4HAMA 4P96A 1O7FA 2PI0A 3K10A 2HKOA 3OS2A 3OOUA 1OCCH 2DMTA 4XBFA 5JHFA 2F48A 5D5WB 1D5VA 2VBXA 4NB5A 3BT9A 1P9QC 1QQIA 2XF5A 2ELKA 1SD4A 1YQAA 3C2GA 3I4PA 4FISA 4ZH4F 1O3SA 1DU0A 2M0MA 3CP8A 3L2CA 3GTKJ 4ASNA 2BW3A 1YX3A 2VC1A 1ZRDA 1R36A 2CW0F 3TO7A 3LOCA 3FMSA 3H36A 3PIPF 1ZARA 2HEOA 2KISA 1ZYRF 3F8BA 4AIHA 1USSA 4BHBA 4EJOA 1PYVA 1E2XA 2L0KA 3F8CA 3LA7A 2VONA 1X58A 3TW7A 3H5AA 2IS6A 3QOEA 5ICFA 1Y39A 1R6RA 3L09A 4BE2A 4PSWA 2ZB9A 1LFBA 2Y2ZA 2VQLA 4HPQA 2L7FP 2QQAA 4AIDA 4S05A 1IRXA 1DUXC 1J7KA 3CC7I 2LKXA 3WGHA 5A2QZ 3E6DA 3IKVA 1DQUA 5CVJA 3OYGA 4ZTJA 2R7UA 3BR2A 4ZDLA 1KYWA 4CZCA 3L00A 4ZYGA 1J75A 3D5RC 4OIQF 2O9LA 4HSTA 1X1DA 2L54A 5D4SA 1TWCJ 1S6LA 1U2WA 2XVCA 3VYUB 2IA1A 3W6VA 1GHCA 4HYEA 2JA8J 1ZHFA 3NARA 3RYRA 4KN7X 1T08B 1Z6RA 2GIZA 3OSFA 3RPQA 4C3JJ 4I76A 1B8IA 3RYPA 4BACA 2Y9ZA 2ZXHA 2DU9A 2LF7A 2CGPA 3LAJA 4BU2A 3HOUJ 1CF7A 3IWFA 3BR1A 4XOTA 2DMUA 3CUQA 2OTJI 5KHDA 1PUFA 1TTYA 1STZA 2XROA 4QPOA 3DKXA 3FMRA 4XL9A 3W3CA 3S3MA 2GXAA 4G12A 3ZQ7A 1VQNI 5HODA 2EIJH 2MC4A 4M74A 4PK4A 1LVAA 4A3FJ 1IDZA 4AUXA 1CGPA 2B9SA 3OOPA 2OCCH 3VFZA 4M6VA 2GBYA 3ABTA 2LF8A 4EM1A 2QBYA 3CMEI 3I54A 1ZG3A 2CG4A 2KDOA 3PQJA 3CMAI 3KEOA 4E7KA 3N97A 2GAUA 2XSDC 1Y8QB 3KEYA 1EH7A 2RNJA 3QP5A 1X1BA 2IXSA 2KLOA 3ZMZA 4BKXA 1NK2P 2CQXA 2DW4A 1JT0A 3S1MJ 1RRJA 2HU9A 3HEFA 2ZO4A 4CA0A 2O3FA 4RDUA 3GTPJ 2QM3A 1VTNC 1R1VA 1IV6A 2JSPA 3RZDJ 4KMFA 3KZZA 1ZN2A 2IGNA 4Y13A 2H8WA 2W82A 3RQ4A 3TOBA 1IV8A 3OS0A 2YS9A 2D45A 3BC8A 1FWZA 3RI4A 2PLYA 4IZZA 2H8RA 2NVXJ 1UHMA 5BS6A 4IHSA 3CJRB 2XAQA 4FHTA 4HF0A 2QSHX 1BW6A 1POGA 2RV8A 3QAHA 4E6KG 6PAXA 1I6XA 5IYCJ 2W25A 3GFJA 2A6TA 3PFYA 4BY7J 1FOXA 1BW5A 3KLNA 4J00A 2JVHA 2CSOA 1BL0A 4XLCA 2LH9A 1OMIA 2K85A 3T1BA 1PP8F 2FOKA 3IUOA 2ZJPF 4A3LJ 4PFPA 2M7BA 2BW3B 5H6QA 2DOAA 3LFKA 1FX7A 3BJAA 4ITVA 1PUEE 2R7DA 2HQNA 3QPSA 2HVSA 4BQAA 3TDZC 1MKMA 5DYMA 2W48A 1VQ5I 1ZR4A 1OCOH 1FMVA 1IUYA 1JGSA 1JXSA 2LYCA 1P4WA 1WKMA 4L5JA 1P6RA 1S7EA 2Z99A 4IL6C 4P1WA 3S16J 4HNVA 2WADA 3G6EI 3M1EA 3ZMVA 1BN5A 1HSJA 3HRMA 2P0WA 3VPRA 2DYRH 2EPFA 1IZ1A 3LMMA 1B6AA 4XRFA 1WZ2A 4UVBA 1Y6IA 4FX0A 1QZZA 2P6SA 2IVMA 2ZNYA 2DAOA 1LPQA 2M34A 2IJLA 1MZBA 2HR3A 3HOYJ 1XDSA 5CVUA 2EFPA 1KONA 1TWHJ 1D1BA 3LQRA 3W6JB 1N77A 4IRHA 2NYXA 2UWMA 1AHDP 2P5KA 3OWTA 2DT5A 4IOCF 4KIFA 1MBEA 3CCLI 3TO9A 2PBIA 3H35A 3H9GA 1LE8A 3CO7C 4JX4A 2L7KA 3V8LA 3JRBA 3G1MA 5BPIA 3HTSB 1B8IB 1JTXA 5L3FA 3CDLA 5F0HA 2OA4A 4LLNA 4RS8A 3QPTA 1IN7A 3VWBA 1TWAJ 2RNGA 4MO7A 2V1XA 2KMUA 2W24A 1ACIA 1CF7B 2A69F 4N4NB 2A6HF 2EV5A 2TCTA 4ENNA 1TT0A 3BG3A 4IRIA 4UUSA 2ZFWA 3CUQB 1PUFB 3ZQLA 1OR7C 4E7IA 4DW6A 1T56A 2M1BA 4ON0A 2W7NA 3R0JA 1JJ8C 4JX6A 1F1ZA 1MMSA 3H3UA 5EEAA 1MNEA 2NS8A 3HOTA 2L9NA 2IA2A 3M4OJ 5DDGA 2BXYA 4LITA 5EG0A 5HS9A 1R5ID 3FF5A 4ZDOA 1KU9A 2OC6A 2W57A 1ENHA 5K5QA 2DMNA 4UUVA 1RIOH 1QO0D 1GLNA 4IHTA 1GV5A 2L9VA 5C44J 1Q1VA 2XAJA 1D8KA 1YS6A 2K9SA 2LY1A 4MFDA 1V5FA 2VBYA 3MKLA 4JOMA 3RKXA 3BG7A 4A5NA 1XMKA 4CSWA 3I64A 3FXUA 1WJEA 1X2MA 5KAFC 1U6GA 5KK1A 4ZTFA 1ETKA 3M9AA 3JRAA 1XSVA 2JT1A 2XV4S 4OWRB 2VI6A 2HGCA 1LEBA 2QLZA 4XICA 3U9GA 3HL2A 2EB7A 1HW5A 2CYYA 2DCEA 2Q0OA 1NK3P 4H4KC 2XAHA 4Y4RA 1GVDA 1TP4A 4XLFA 3ECOA 2KDZA 1KQ0A 5F1RA 2BHZA 1A5JA 2WV0A 2E19A 3A03A 1N78A 1FLIA 2PEXA 2VBWA 3O2PE 3CQZJ 2A05A 1P2FA 2DMQA 1WJCA 2EWNA 4D1QA 1SANA 3OYIA 5H20A 5LGUA 4D5CA 3G4SI 3QYEA 4ZC3A 1UAAA 1I3QJ 1SMTA 1Z7LA 2DLLA 3UR3C 1X1AA 2M4GA 5B66C 3W2AA 4GGGA 5A2QK 1ZLKA 2HPIA 2VPRA 2ZMEA 1SFKA 1SVOA 3C2BA 1VZ0A 1EA3A 2LRDA 1ZTRA 2PJRA 4N9IA 4G94A 1V4RA 3J7AY 5L3DA 3S93A 2F4IA 1V5GA 2W4SA 3BPVA 2L9SA 4G7HF 1Z91A 1XMAA 1UZCA 2AXTC 4RMNA 1IN5A 4RLFA 1D3YA 1EF4A 3PUFA 3HUGB 4A5MA 2L3DA 4ZJZA 4LOCA 2Y0SN 2ZXIA 1BI1A 2XGCA 2JQ7A 3ZRGA 5JI6A 4RA2A 2R7TA 4QWQA 4RAZA 4IO9F 1ETQA 1FSEA 2MH9A 2P6TA 3OR2C 4B4CA 4GO1A 5ILVA 3KIOA 2ZJQF 5D8KB 4E70A 4GDFA 1XGNA 1YIOA 3FXMA 3HRTA 1IXRC 4UV8A 4MIMA 1T38A 2PMZN 2JVGA 3NWTA 2FA5A 2TDXA 4FE7A 3U1KA 3ZQQA 3HOSA 2K4BA 4XKBA 2O61A 5L3GA 2CFXA 4MGRA 2X85A 4P55A 3CLQA 2NOGA 1Z6TA 2G7UA 3F3XA 3GW2A 2J5OA 2FSWA 4IOAF 4HNUA 3GYHX 3WHCA 1LE8B 1HBXG 3BOQA 5TJJA 5FRNA 3J81Z 4DQ2A 1BJZA 2E2HJ 4IHVA 3K7AJ 3IH4A 3LFUA 3MFKA 2JUCA 5F6FA 5KCMA 1OKRA 4HG2A 5L3BA 3R6SA 2O8KA 4AIKA 1A36A 2CW8A 2YPRA 3A0BC 2P81A 4YEJA 1Q1HA 2OZUA 3J7AO 2JA2A 4HQMA 4UUSB 2R7XA 3ZQHA 2Y31A 1USTA 3L9FA 3HPHA 2MLGA 2DK8A 5CLSA 3OIPA 1YITI 5HDKA 3JREA 4JBAA 2QCOA 2X1CA 3SFZA 1IG7A 3KLOA 2BXZA 2XPWA 1XGMA 2HQRA 4BQOA 2BVLA 1UHWA 1D1AA 1R7JA 2JMWA 2F4OB 2OQRA 3IC7A 3LA3A 1I50J 5DTDA 2EK5A 3LSJA 3CUOA 5FLVA 1SAXA 3ZR8X 3IKTA 3CLOA 2E2IJ 1WCMJ 3W6KB 4EJWA 5GAGJ 2E1MC 4MEYF 4F55A 2Z1DA 5FKKA 3JSOA 2G9WA 2WTEA 1TL8A 2E1OA 2XGEA 3FX3A 2O03A 3HHGA 1RPWA 4BQQA 4ETSA 2X51A 3G71I 3BWGA 2XASA 1BIAA 3IH3A 1IXCA 3OYCA 1GUUA 2GQQA 2RKHA 1WI9A 3PO2J 5LBQA 5E1WA 1RUNA 2GXGA 3I71A 3A4CA 3U21A 5ICCA 4I6ZA 2QSGX 2C6YA 1MMNA 2XB5A 4YFKF 4GRIA 4CCNA 4ZDPA 3S3NA 4F91B 1KU3A 3DLAA 1NG6A 1YG2A 5FROA 4FX4A 1J9IA 4GFBA 4M6XA 3WU0A 1U9OA 3DU5A 3WE3A 2EA4A 3FZVA 4B44A 4YRVA 2V9PA 1RZ4A 1HSTA 4D0PA 3P9KA 4U7DA 4X6AJ 5HLHA 4C30A 4UUTA 2F5FA 3IRQA 3TEDA 2PJRB 1FOYA 1JKOC 2EBIA 2MH2A 1FBQA 3RKWA 3FKIJ 1W5SA 2GA1A 3LSRA 1ZLJA 3VYSB 1MGTA 2LC2A 3E5UA 2VQGA 2MBFA 1UFMA 1UJ8A 2OF7A 2DA1A 1GV2A 4BJTA 5IPAA 5C3EJ 2P7VB 4MTEA 2BBYA 3F9KA 2ME0A 1V55H 2F5CA 2F2EA 5FKOA 2K9MA 2ICWG 3OMYA 2MLKA 4BYYA 2DN0A 5AIQA 1XCBA 3BDDA 4AIJA 3UKGA 5ICGA 5ED4A 5FKLA 2Q2EA 2R7SA 5IOYA 1TQMA 2P5LC 3K0LA 3SZTA 4CCLA 1KU2A 2OU2A 3WODF 3CC2I 3FXOA 2VBZA 1I39A 2WA0A 3HM5A 2HVQA 1S5LC 4LK1F 4X0GA 3QU6A 1S8NA 4NC6A 3SDBA 1E3OC 2M0CA 2ZCWA 3PNTA 1V54H 1W7PD 1EJ9A 2Y0SA 1U0JA 2HPMA 1FT9A 2ZJ2A 3CP2A 5TGTA 2XHKA 3SHFA 1XCVA 4BNCA 2ZJRF 2X6YA 5FLXZ 3CMYA 3SQNA 2KJCA 4E4HA 4G9YA 3T8TA 1YOVB 4U7BA 1D0XA 1VQPI 3FHNA 3HSEA 4LG3A 4YG2F 1JE8A 1OYWA 1QNTA 3MQ0A 5JHUA 3JTGA 4AD9A 1U5TC 2HI3A 2QZ8A 3K4JA 1RNLA 2PMZA 2HTSA 1K6OA 3VSKA 1E17A 9ANTA 2Z9OA 3DBLB 3C7JA 2E1CA 5F64A 2E35A 3OIOA 1G3TA 2PN6A 3C1DA 4ANJA 2R7QA 3OSGA 3S32A 1IAWA 3CCMI 3CJTB 4JX5A 3ZN1A 1VF9A 5E8IA 5FRMA 2DI3A 1XSXA 4M72A 2X4HA 4B8XA 2OD5A 1U3EM 3S8PA 3B6CA
chains in the Genus database with same CATH topology
2KKOA 1TNTA 2WC2A 4L0ZB 2Z5UA 4IVNA 2IA0A 4LFUA 3DF8A 2EA2A 4Y15A 1I1GA 3GO5A 3F72A 2MC3A 4EJUA 2GWRA 4EV0A 1Y0UA 5LGNA 4HLYA 4MQ9F 2OBPA 5E1ZB 4AWXB 4BXUA 1LJ9A 3ERED 4GYIA 4IJAA 4CGZA 2KIFA 3QPHA 5E20A 3U2RA 2H27A 5JVTA 1KGSA 1WWXA 1LDJA 4A0ZA 3RKYA 1ODDA 4KYWA 4EJVA 3BJOA 2UZKA 2KIMA 4JK1X 1F9NA 3SZPA 5BQTA 2PG4A 4NHJA 1B9NA 4M9XA 1R22A 3HHHA 3F8MA 1R1TA 4WF2A 3KETA 2F5DA 2QVOA 3F8FA 3V8KA 1SFUA 3TQNA 5LEJA 1MJ9A 3J81K 1WSUA 5TRDA 3FMQA 1QGPA 2JZYA 2YU3A 2P8TA 4RB1A 1LEAA 3NQOA 1IRFA 4G6DA 1O3QA 4RGUA 5HLIA 3ROUA 4O3MA 3I59A 3LWFA 3ZPLA 4PCQA 1U8RA 1R58A 1U78A 5DD8A 2HZTA 3H3ZA 4M6YA 2Q8KA 3TO6A 2M8EA 3HRSA 3JTHA 2M30A 1SFEA 4IXAA 5AONA 3MWMA 2QWWA 3Q9VA 3IWZA 2HKXA 5HLGA 1YFHA 3GX4X 1LDKB 3KP6A 1T39A 3TOAA 4DNCA 2DQRA 1OYIA 2K02A 4I98B 5IT9Z 5HDGA 2Y0MA 3V8JA 1R5HA 2DTRA 3E3VA 3F6OA 4YFNF 1F4KA 1U5TA 3P7NA 2H94A 2CQKA 1R1UA 1I5ZA 1GVJA 5JFRA 1IW7F 3B73A 3G73A 4H0EA 3EUHA 1KQ8A 4ENMA 2GZWA 4KDPA 2FMYA 2VODA 2F5EA 2IP2A 1XN7A 3R4KA 5LGTA 2V6CA 3F8NA 3K1MA 1LQ1A 1K78A 5BPDA 4WXCA 2ELHA 3I5UA 3HUGA 2ETHA 5E17F 5E1XA 1IN4A 1MJBA 1O3TA 1MJAA 1W7PA 2PMHA 1YS7A 1NHAA 1XSDA 2J5PA 3FM5A 2QENA 3BPXA 3MAJA 5BMZA 5LHGA 2VE9A 2QUFA 2BEOA 1B1BA 1Z1DA 1ZGAA 3KP5A 3GF2A 5FLXK 3V7CA 3VOEA 2M5WA 4UHTA 5HS7A 5J8CA 1ZAOA 4XLNF 4ZZLA 4HF2A 1FY7A 3HSRA 3EYIA 1DPRA 3KEQA 2ZXJA 3WGIA 1SD7A 3RJPA 5FFZA 2FEZA 5AIPA 5CVIA 1PDNC 5L3CA 5E8GA 3I59B 3EDPA 2GXBA 1BI3A 4PGHA 5EEHA 2NS0A 2VN2A 3WE2A 4TV7A 3QRFF 2Y48A 4L9TA 4RB0A 2DBBA 3FXRA 3HRUA 3DPLC 3COAC 4LD5A 3AAFA 4EGYA 4A6EA 1BIBA 4I7HA 5K5RA 4I01A 3RPUA 2DFIA 1RUOA 1WRJA 2LNBA 4KNYA 1FC3A 4KMUX 1FOKA 2EV6A 4LGWA 1LDDA 2A3SA 1U5TB 3HIFA 2O8XA 4BHPA 4LJZF 1XGOA 2DQLA 4UVAA 3G3ZA 1XB4A 2IW5A 4S04A 4ZZDA 1YO5C 1O7LA 4R8HA 5LHHA 4WWCA 2MD5A 2VC0A 1SMYF 4HLXA 1RI7A 2XGXA 1K78B 3CO6C 2PQ8A 3V4GA 4XSXF 3O3KA 1L3LA 1FYLA 4N9HA 1FBUA 1W7PB 4BH9A 3F23A 2W85A 3DFGA 3BZ6A 1YW8A 4LG0A 2ZKZA 1IRGA 2DO7A 4HBLA 2XUBA 1I1SA 2KRFA 2DK5A 1EH8A 2EJRA 3WTSC 1TW3A 4HV6A 2KJBA 1MDMA 4ESJA 2R3SA 2FE3A 1F5TA 1P4XA 1HQCA 1S7AA 4BAYA 4GCVA 1ULYA 4HOBA 4UXNA 3I58A 5IT9K 1KYZA 1BJAA 5ILUA 2VXZA 3JW4A 4HDUA 1G6NA 1KQ9A 5BOXA 3KP4A 5HOOA 3GUDA 4P5OA 1DP7P 5ERIA 4R79A 4O6JA 1HKQA 4HW0A 2MA3A 2RN7A 4EM0B 3DEUA 3TKYA 4ENKA 3J80Z 1GXPA 3Q9SA 5DCMB 4EM2A 1ZG1A 1OR7A 1X3UA 3M8EA 1WQ2A 1YTYA 3PQKA 4EMSA 1JHHA 1IN8A 2K27A 2RQPA 3GVAA 2K7LA 1FYKA 2Z3YA 2H6CA 2E7WA 4OINF 5H6RA 4I0BA 3TGNA 1B4AA 3O6BB 1KA8A 1TW2A 3F6VA 4EVIA 2V9VA 4A2UA 3RTRA 3EQLF 1AOYA 2HYGD 3ISPA 3MEXA 2HFHA 4YIFA 1ON2A 4HX4A 1EV7A 3GZ6A 3P9IA 2H6BA 5HDNA 3LQQA 5FD5A 2EFQA 3KP3A 1QZYA 1BI0A 4WK8F 3ZMDA 3L7WA 3CUQC 4WXHA 3WG9A 1TQPA 2R7FA 2VOOA 2HDCA 1ZREA 1HKTA 4MTDA 4OIPF 2BV6A 4LG0B 3WTYC 5FD6A 3OV8A 2FF4A 3K1NA 3DP7A 2QQ9A 4KUMA 2W84A 3DV8A 4OIOF 3ECHA 1IF1A 1MDMB 2OAZA 2O6GE 4L0YB 3P9CA 3K1PA 3E5QA 1G3WA 2IPQX 4WX9A 4EQQA 3VB2A 2ISZA 4HZFA 4Z2YA 1O3RA 1P92A 4UVCA 3FWEA 4G6QA 3RDIA 1BC8C 4Y17A 1G4DA 4M73A 5IT3A 1BC7C 3CDHA 5LRRA 4OIRF 2NRAC 3T8RA 1K79A 2L4MA 2M87A 3WGGA 3IRRA 2P5VA 3I0TA 1T6SA 3QU3A 3KZYA 4XSZF 3V7RA 1FP2A 3KFWX 3FM3A 2LDUA 5D8LB 3ABUA 4HV5A 1ZRCA 3F21A 4OU0A 2G7HA 5EEGA 2NNYA 1XDUA 1YW7A 1DPUA 3WTZA 1BBYA 1J59A 1H9TA 4I09A 4FT8A 2V79A 1OYYA 3JAMZ 4O5VA 4IRGA 5D5UB 4KN4X 2XAGA 3N4MA 3MCZA 2FRHA 4WXDA 4P9FA 3WTVC 4MHGA 1ZG5A 4ZYDA 1GXQA 3S2WA 4HF1A 1FYMA 1H9GA 4ZYEA 4RB3C 2L02A 4B09A 3PFIA 1FSHA 4NQWA 1V3FA 5DUKA 4HX7A 2FU4A 3M8FA 4M71A 3T0YA 4I2OA 1ONVA 2E1NA 4Q4ZF 1B59A 3K2ZA 4M9ZA 3D0SA 1G3SA 3WTXC 1S7OA 4U0WA 2FBHA 3NEUA 5D5VB 1REPC 5CJ9A 2ZBKA 4KA4A 4LK0F 3J80K 4LB5A 5ICEA 1K7AA 3ZMTA 4KIGA 2KIUA 5J6XA 2HS5A 4RGXA 1S3JA 4CYDA 3SXYA 3ZN0A 1FPQA 4CO8A 3TDUC 3IL2A 4OMYA 5LRSA 3DQVC 2DPDA 1Z9CA 4N0BA 2XAFA 2NAZA 4OMZA 5J8FA 2D1HA 4MQVA 2V1UA 2YX4A 3ELKA 2VT2A 5LEKA 2BYVE 4IPAA 4RAYA 4Q47A 5D6FA 5FO5A 2RC4A 1FP1D 3BROA 1QBJA 1OPCA 2IRFG 2V1DA 4R1HA 3F22A 1J0RA 3GFMA 4JQFA 1FZPB 4PZJA 2E7XA 2P4WA 1HKSA 5HVQC 3KP2A 3R0AA 3ULQB 4UNOA 3BY6A 2YSRA 3GXOA 2CO5A 4Q5SF 1SD6A 3K69A 2BGCA 3REOA 1B9MA 2X0LA 4OOIA 1AWCA 4I02A 2Z33A 1YYVA 4HQEA 4MEXF 1P4AA 1KU7A 1EH6A 3HYIA 4CZZA 3E6CC 4CDGA 3E6MA 2JTVA 3HSFA 2P7CB 1HXDA 2Y75A 4LLGF 1DDNA 3WU1B 3VEPA 5DV5A 2YX7A 1MD0A 1ZRFA 4L18B 2OZ6A 2PMUA 3NRVA 2XKPA 2ESNA 5DD4A 5LLQA 1R5GA 3H92A 2ISYA 2EV0A 5L3EA 2CWEA 4XLPF 4L9JA 2DPUA 2A61A 4G7OF 5DUIA 3CTAA 3WTUC 1TBXA 3LAPA 4RB2C 3ZMSA 4I0AA 5JR3A 1O57A 1FBSA 4GYGA 3ZP5A 1S29A 2PFBA 1FNNA 5DCMA 3GFIA 4ESBA 1C0WA 4EGZA 4A12A 5E18F 3HTUA 2QBYB 3ML6A 3E6BA 3EETA 4RGSA 2NNNA 3GEZA 4A0YA 4GXOA 1ZH5A 1I27A 2XIGA 3KE2A 3U1DA 2PJPA 4LB6B 4F7ZA 1R00A 3FHZA 2LSOA 3CJNA 3JAMK 3GZ5A 4YFXF 2EFWA 2L4AA 3MZYA 1G3YA 4RGRA 2FQ3A 2EFOA 2RGVA 3T5XA 2FBKA 5D5XB 2FBIA 3BP8A 4L9NA 2ACJA 3KP7A 4AVPA 2UXXA 1Z05A 4P9UA 4U88A 4HDVA 4U0VA 2BE5F 4CICA 2HWVA 2A07F 1T98A 2M45A 5D6EA 4ZYHA 3ZMUA 1UCRA 2HOEA 2ZNZA 2FXAA 1BOAA 5HS8A 4HX8A 3EYYA 4BHCA 2ESHA 3D5LA 2D1VA 3C18A 2JPCA 3E97A 1LNWA 1JHFA 4ENJA 2XKOA 3DXJF 1W5TA 5ILSA 1SFXA 3I53A 1J2XA 4PDKA 4KT5C 5FFXA 4UV9A 4L9VA 5CVRA 2IT0A 2H09A 3Q5FA 3R60A 2HTJA 4CHUA 5DEQA 4IF4A 2O0YA 3WTWC 2WWYA 2GIVA 3DPTA 4KICA 1LB2A 1XGSA 3WTTC 4HA8A 5LHIA 1Z7UA 3C3WA 2A5YB 5D4RA 1YLFA 2L01A 1PP7U 2K86A 3K9TA 4CXFA 3RIRA 2AXLA 2B0LA 4KIBA 2LKPA 4G7ZF 1TNSA 2RDPA 3MZHA 4K2EA 4LMYA 5DCFA 4YIIA 3GFLA 2STTA 1UB9A 3GLXA 1QPMA 4U0YA 1R23A 2ZMEB 3V7SA 2YR2A 3QP6A 2ADUA 3B02A 4G8XA 4KFCA 4LLLA 3BJ6A 3JSPA 5K1YA 3M7GA 3VODA 2D2WA 1HW1A 1TLHB 1L0OC 1SD5A 2UXNA 5FB2A 1W4MA 5K5OA 2GA2A 2HYFA 2STWA 4WCGA 2QYOA 3IHUA 1HW2A 2FNPA 2VT3A 2XRNA 2QQBA 1T0FA 1D8JA 5KVRA 1T2KA 4M9SA 2K4JA 1BI2A 1ZGJA 3DKWA 4QLCU 2AS5F 3E5XA 2A6EF 2VOPA 3KCCA 4L5IA 1XD7A 1YW9A 4A0XA 5FGMA 1H0MA 2JPBA 4A6DA 2RVCA 1IXSB 1J5YA 3QOPA 2EFNA 2FMLA 3R61A 4MNUA 3LSTA 5CVVA 4EJTA 1A04A 4PGGA 3LA2A 1TQIA 2COMA 5CYVA 4ESFA 1IN6A 2JRTA 2OQGA 2VE8A 3FXQA 3GWZA 4Q48A 1ON1A 1BM9A 2JSCA 2FNAA 2A68F 4HAMA 4P96A 1O7FA 2PI0A 2HKOA 4XBFA 5D5WB 1D5VA 2VBXA 4NB5A 1QQIA 3I4PA 1SD4A 1YQAA 4ZH4F 1O3SA 3L2CA 4ASNA 2VC1A 1ZRDA 1R36A 2CW0F 3TO7A 3FMSA 1ZARA 2HEOA 1ZYRF 3F8BA 4AIHA 1USSA 4BHBA 4EJOA 3F8CA 1E2XA 3LA7A 2VONA 5ICFA 3L09A 2QQAA 4S05A 1DUXC 1J7KA 3WGHA 5A2QZ 3E6DA 3IKVA 5CVJA 1KYWA 3L00A 4ZYGA 1J75A 4OIQF 2L54A 5D4SA 1S6LA 1U2WA 2XVCA 2IA1A 1GHCA 4HYEA 1ZHFA 3RYRA 4KN7X 1Z6RA 3RPQA 3RYPA 2DU9A 2LF7A 2CGPA 3LAJA 1CF7A 3IWFA 3CUQA 1TTYA 1STZA 2XROA 3FMRA 3ZQ7A 4M74A 1LVAA 1CGPA 3OOPA 3VFZA 3ABTA 2LF8A 4EM1A 2QBYA 3I54A 1ZG3A 2CG4A 3PQJA 3KEOA 3N97A 2GAUA 1EH7A 2RNJA 3QP5A 3ZMZA 2DW4A 2ZO4A 2O3FA 2QM3A 1VTNC 1R1VA 4KMFA 3KZZA 1ZN2A 4Y13A 3TOBA 2D45A 1FWZA 3RI4A 2PLYA 1UHMA 5BS6A 4IHSA 2XAQA 4FHTA 4HF0A 2RV8A 3QAHA 6PAXA 1I6XA 2W25A 3GFJA 3KLNA 2CSOA 1OMIA 3T1BA 1PP8F 2FOKA 5H6QA 3LFKA 1FX7A 3BJAA 1PUEE 2R7DA 2HQNA 4BQAA 3TDZC 1MKMA 5DYMA 1IUYA 1JGSA 1JXSA 1P4WA 1WKMA 4L5JA 1P6RA 2Z99A 3M1EA 3ZMVA 1HSJA 1BN5A 3HRMA 1IZ1A 1B6AA 4XRFA 4UVBA 4FX0A 1QZZA 2P6SA 2IVMA 2ZNYA 2DAOA 2IJLA 1MZBA 2HR3A 1XDSA 5CVUA 2EFPA 3LQRA 3W6JB 4IRHA 2NYXA 2UWMA 2P5KA 2DT5A 4KIFA 3TO9A 2PBIA 3CO7C 3V8LA 5BPIA 3HTSB 5L3FA 2OA4A 4LLNA 4RS8A 3QPTA 1IN7A 2V1XA 2W24A 1CF7B 2A69F 2A6HF 2EV5A 4ENNA 4IRIA 2ZFWA 3CUQB 2M1BA 4ON0A 3R0JA 1F1ZA 3H3UA 3HOTA 2IA2A 5DDGA 5HS9A 3FF5A 1KU9A 2W57A 5K5QA 4UUVA 1RIOH 1QO0D 4IHTA 2XAJA 1D8KA 1YS6A 3RKXA 2VBYA 4A5NA 1XMKA 3I64A 3FXUA 1U6GA 5KK1A 3M9AA 1XSVA 2JT1A 2XV4S 2HGCA 1LEBA 2QLZA 3U9GA 2EB7A 1HW5A 2CYYA 2Q0OA 2XAHA 3ECOA 1KQ0A 5F1RA 2WV0A 1FLIA 2PEXA 2VBWA 3O2PE 1P2FA 2EWNA 5H20A 5LGUA 1SMTA 2DLLA 4GGGA 5A2QK 1ZLKA 2ZMEA 4N9IA 4G94A 1V4RA 5L3DA 3BPVA 4G7HF 1Z91A 1XMAA 1IN5A 1D3YA 4A5MA 2L3DA 1BI1A 5JI6A 4QWQA 4RAZA 1FSEA 2MH9A 2P6TA 4GO1A 5ILVA 5D8KB 4E70A 1XGNA 1YIOA 3HRTA 1IXRC 4UV8A 1T38A 2FA5A 2TDXA 2O61A 3HOSA 2K4BA 5L3GA 2CFXA 4MGRA 4P55A 1Z6TA 2G7UA 3F3XA 3GW2A 2J5OA 2FSWA 3GYHX 1HBXG 3BOQA 5TJJA 3J81Z 4DQ2A 3MFKA 5F6FA 1OKRA 5L3BA 3R6SA 4AIKA 2YPRA 3J7AO 1Q1HA 2OZUA 4HQMA 1USTA 3L9FA 2MLGA 2DK8A 5CLSA 5HDKA 4JBAA 3SFZA 3KLOA 1XGMA 2HQRA 1UHWA 1R7JA 2OQRA 3IC7A 3LA3A 2EK5A 3CUOA 1SAXA 3IKTA 3CLOA 3W6KB 4EJWA 4MEYF 3JSOA 2G9WA 2WTEA 3FX3A 2O03A 3HHGA 4ETSA 3BWGA 2XASA 1BIAA 1IXCA 2GQQA 2RKHA 1WI9A 5LBQA 5E1WA 1RUNA 2GXGA 3I71A 5ICCA 2C6YA 4YFKF 1KU3A 1YG2A 4FX4A 1J9IA 4M6XA 3WU0A 3WE3A 2EA4A 3FZVA 1RZ4A 1HSTA 4D0PA 3P9KA 4U7DA 5HLHA 2F5FA 3IRQA 2MH2A 1FBQA 3RKWA 1W5SA 2GA1A 1ZLJA 1MGTA 3E5UA 2MBFA 1UFMA 2P7VB 4MTEA 2BBYA 2F5CA 2F2EA 4BYYA 2MLKA 5AIQA 1XCBA 3BDDA 4AIJA 5ICGA 5ED4A 2Q2EA 1TQMA 2P5LC 3K0LA 3SZTA 1KU2A 2OU2A 3WODF 2VBZA 4LK1F 3QU6A 1S8NA 2ZCWA 1W7PD 1FT9A 2ZJ2A 2XHKA 3SHFA 1XCVA 4BNCA 5FLXZ 3SQNA 2KJCA 4G9YA 3T8TA 4U7BA 3HSEA 4YG2F 1JE8A 1OYWA 1QNTA 3MQ0A 5JHUA 3JTGA 4AD9A 1U5TC 2QZ8A 1RNLA 2HTSA 1K6OA 1E17A 2Z9OA 3C7JA 2E1CA 5F64A 1G3TA 2PN6A 3C1DA 1IAWA 3ZN1A 5E8IA 2DI3A 1XSXA 4M72A 2X4HA 4B8XA 2OD5A 1U3EM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KKO A;  1TNT A;  2WC2 A;  4L0Z B;  2Z5U A;  4IVN A;  2IA0 A;  4LFU A;  3DF8 A;  2EA2 A;  4Y15 A;  1I1G A;  3GO5 A;  3F72 A;  2MC3 A;  4EJU A;  2GWR A;  4EV0 A;  1Y0U A;  5LGN A;  4HLY A;  4MQ9 F;  2OBP A;  5E1Z B;  4AWX B;  4BXU A;  1LJ9 A;  3ERE D;  4GYI A;  4IJA A;  4CGZ A;  2KIF A;  3QPH A;  5E20 A;  3U2R A;  2H27 A;  5JVT A;  1KGS A;  1WWX A;  1LDJ A;  4A0Z A;  3RKY A;  1ODD A;  4KYW A;  4EJV A;  3BJO A;  2UZK A;  2KIM A;  4JK1 X;  1F9N A;  3SZP A;  5BQT A;  2PG4 A;  4NHJ A;  1B9N A;  4M9X A;  1R22 A;  3HHH A;  3F8M A;  1R1T A;  4WF2 A;  3KET A;  2F5D A;  2QVO A;  3F8F A;  3V8K A;  1SFU A;  3TQN A;  5LEJ A;  1MJ9 A;  3J81 K;  1WSU A;  5TRD A;  3FMQ A;  1QGP A;  2JZY A;  2YU3 A;  2P8T A;  4RB1 A;  1LEA A;  3NQO A;  1IRF A;  4G6D A;  1O3Q A;  4RGU A;  5HLI A;  3ROU A;  4O3M A;  3I59 A;  3LWF A;  3ZPL A;  4PCQ A;  1U8R A;  1R58 A;  1U78 A;  5DD8 A;  2HZT A;  3H3Z A;  4M6Y A;  2Q8K A;  3TO6 A;  2M8E A;  3HRS A;  3JTH A;  2M30 A;  1SFE A;  4IXA A;  5AON A;  3MWM A;  2QWW A;  3Q9V A;  3IWZ A;  2HKX A;  5HLG A;  1YFH A;  3GX4 X;  1LDK B;  3KP6 A;  1T39 A;  3TOA A;  4DNC A;  2DQR A;  1OYI A;  2K02 A;  4I98 B;  5IT9 Z;  5HDG A;  2Y0M A;  3V8J A;  1R5H A;  2DTR A;  3E3V A;  3F6O A;  4YFN F;  1F4K A;  1U5T A;  3P7N A;  2H94 A;  2CQK A;  1R1U A;  1I5Z A;  1GVJ A;  5JFR A;  1IW7 F;  3B73 A;  3G73 A;  4H0E A;  3EUH A;  1KQ8 A;  4ENM A;  2GZW A;  4KDP A;  2FMY A;  2VOD A;  2F5E A;  2IP2 A;  1XN7 A;  3R4K A;  5LGT A;  2V6C A;  3F8N A;  3K1M A;  1LQ1 A;  1K78 A;  5BPD A;  4WXC A;  2ELH A;  3I5U A;  3HUG A;  2ETH A;  5E17 F;  5E1X A;  1IN4 A;  1MJB A;  1O3T A;  1MJA A;  1W7P A;  2PMH A;  1YS7 A;  1NHA A;  1XSD A;  2J5P A;  3FM5 A;  2QEN A;  3BPX A;  3MAJ A;  5BMZ A;  5LHG A;  2VE9 A;  2QUF A;  2BEO A;  1B1B A;  1Z1D A;  1ZGA A;  3KP5 A;  3GF2 A;  5FLX K;  3V7C A;  3VOE A;  2M5W A;  4UHT A;  5HS7 A;  5J8C A;  1ZAO A;  4XLN F;  4ZZL A;  4HF2 A;  1FY7 A;  3HSR A;  3EYI A;  1DPR A;  3KEQ A;  2ZXJ A;  3WGI A;  1SD7 A;  3RJP A;  5FFZ A;  2FEZ A;  5AIP A;  5CVI A;  1PDN C;  5L3C A;  5E8G A;  3I59 B;  3EDP A;  2GXB A;  1BI3 A;  4PGH A;  5EEH A;  2NS0 A;  2VN2 A;  3WE2 A;  4TV7 A;  3QRF F;  2Y48 A;  4L9T A;  4RB0 A;  2DBB A;  3FXR A;  3HRU A;  3DPL C;  3COA C;  4LD5 A;  3AAF A;  4EGY A;  4A6E A;  1BIB A;  4I7H A;  5K5R A;  4I01 A;  3RPU A;  2DFI A;  1RUO A;  1WRJ A;  2LNB A;  4KNY A;  1FC3 A;  4KMU X;  1FOK A;  2EV6 A;  4LGW A;  1LDD A;  2A3S A;  1U5T B;  3HIF A;  2O8X A;  4BHP A;  4LJZ F;  1XGO A;  2DQL A;  4UVA A;  3G3Z A;  1XB4 A;  2IW5 A;  4S04 A;  4ZZD A;  1YO5 C;  1O7L A;  4R8H A;  5LHH A;  4WWC A;  2MD5 A;  2VC0 A;  1SMY F;  4HLX A;  1RI7 A;  2XGX A;  1K78 B;  3CO6 C;  2PQ8 A;  3V4G A;  4XSX F;  3O3K A;  1L3L A;  1FYL A;  4N9H A;  1FBU A;  1W7P B;  4BH9 A;  3F23 A;  2W85 A;  3DFG A;  3BZ6 A;  1YW8 A;  4LG0 A;  2ZKZ A;  1IRG A;  2DO7 A;  4HBL A;  2XUB A;  1I1S A;  2KRF A;  2DK5 A;  1EH8 A;  2EJR A;  3WTS C;  1TW3 A;  4HV6 A;  2KJB A;  1MDM A;  4ESJ A;  2R3S A;  2FE3 A;  1F5T A;  1P4X A;  1HQC A;  1S7A A;  4BAY A;  4GCV A;  1ULY A;  4HOB A;  4UXN A;  3I58 A;  5IT9 K;  1KYZ A;  1BJA A;  5ILU A;  2VXZ A;  3JW4 A;  4HDU A;  1G6N A;  1KQ9 A;  5BOX A;  3KP4 A;  5HOO A;  3GUD A;  4P5O A;  1DP7 P;  5ERI A;  4R79 A;  4O6J A;  1HKQ A;  4HW0 A;  2MA3 A;  2RN7 A;  4EM0 B;  3DEU A;  3TKY A;  4ENK A;  3J80 Z;  1GXP A;  3Q9S A;  5DCM B;  4EM2 A;  1ZG1 A;  1OR7 A;  1X3U A;  3M8E A;  1WQ2 A;  1YTY A;  3PQK A;  4EMS A;  1JHH A;  1IN8 A;  2K27 A;  2RQP A;  3GVA A;  2K7L A;  1FYK A;  2Z3Y A;  2H6C A;  2E7W A;  4OIN F;  5H6R A;  4I0B A;  3TGN A;  1B4A A;  3O6B B;  1KA8 A;  1TW2 A;  3F6V A;  4EVI A;  2V9V A;  4A2U A;  3RTR A;  3EQL F;  1AOY A;  2HYG D;  3ISP A;  3MEX A;  2HFH A;  4YIF A;  1ON2 A;  4HX4 A;  1EV7 A;  3GZ6 A;  3P9I A;  2H6B A;  5HDN A;  3LQQ A;  5FD5 A;  2EFQ A;  3KP3 A;  1QZY A;  1BI0 A;  4WK8 F;  3ZMD A;  3L7W A;  3CUQ C;  4WXH A;  3WG9 A;  1TQP A;  2R7F A;  2VOO A;  2HDC A;  1ZRE A;  1HKT A;  4MTD A;  4OIP F;  2BV6 A;  4LG0 B;  3WTY C;  5FD6 A;  3OV8 A;  2FF4 A;  3K1N A;  3DP7 A;  2QQ9 A;  4KUM A;  2W84 A;  3DV8 A;  4OIO F;  3ECH A;  1IF1 A;  1MDM B;  2OAZ A;  2O6G E;  4L0Y B;  3P9C A;  3K1P A;  3E5Q A;  1G3W A;  2IPQ X;  4WX9 A;  4EQQ A;  3VB2 A;  2ISZ A;  4HZF A;  4Z2Y A;  1O3R A;  1P92 A;  4UVC A;  3FWE A;  4G6Q A;  3RDI A;  1BC8 C;  4Y17 A;  1G4D A;  4M73 A;  5IT3 A;  1BC7 C;  3CDH A;  5LRR A;  4OIR F;  2NRA C;  3T8R A;  1K79 A;  2L4M A;  2M87 A;  3WGG A;  3IRR A;  2P5V A;  3I0T A;  1T6S A;  3QU3 A;  3KZY A;  4XSZ F;  3V7R A;  1FP2 A;  3KFW X;  3FM3 A;  2LDU A;  5D8L B;  3ABU A;  4HV5 A;  1ZRC A;  3F21 A;  4OU0 A;  2G7H A;  5EEG A;  2NNY A;  1XDU A;  1YW7 A;  1DPU A;  3WTZ A;  1BBY A;  1J59 A;  1H9T A;  4I09 A;  4FT8 A;  2V79 A;  1OYY A;  3JAM Z;  4O5V A;  4IRG A;  5D5U B;  4KN4 X;  2XAG A;  3N4M A;  3MCZ A;  2FRH A;  4WXD A;  4P9F A;  3WTV C;  4MHG A;  1ZG5 A;  4ZYD A;  1GXQ A;  3S2W A;  4HF1 A;  1FYM A;  1H9G A;  4ZYE A;  4RB3 C;  2L02 A;  4B09 A;  3PFI A;  1FSH A;  4NQW A;  1V3F A;  5DUK A;  4HX7 A;  2FU4 A;  3M8F A;  4M71 A;  3T0Y A;  4I2O A;  1ONV A;  2E1N A;  4Q4Z F;  1B59 A;  3K2Z A;  4M9Z A;  3D0S A;  1G3S A;  3WTX C;  1S7O A;  4U0W A;  2FBH A;  3NEU A;  5D5V B;  1REP C;  5CJ9 A;  2ZBK A;  4KA4 A;  4LK0 F;  3J80 K;  4LB5 A;  5ICE A;  1K7A A;  3ZMT A;  4KIG A;  2KIU A;  5J6X A;  2HS5 A;  4RGX A;  1S3J A;  4CYD A;  3SXY A;  3ZN0 A;  1FPQ A;  4CO8 A;  3TDU C;  3IL2 A;  4OMY A;  5LRS A;  3DQV C;  2DPD A;  1Z9C A;  4N0B A;  2XAF A;  2NAZ A;  4OMZ A;  5J8F A;  2D1H A;  4MQV A;  2V1U A;  2YX4 A;  3ELK A;  2VT2 A;  5LEK A;  2BYV E;  4IPA A;  4RAY A;  4Q47 A;  5D6F A;  5FO5 A;  2RC4 A;  1FP1 D;  3BRO A;  1QBJ A;  1OPC A;  2IRF G;  2V1D A;  4R1H A;  3F22 A;  1J0R A;  3GFM A;  4JQF A;  1FZP B;  4PZJ A;  2E7X A;  2P4W A;  1HKS A;  5HVQ C;  3KP2 A;  3R0A A;  3ULQ B;  4UNO A;  3BY6 A;  2YSR A;  3GXO A;  2CO5 A;  4Q5S F;  1SD6 A;  3K69 A;  2BGC A;  3REO A;  1B9M A;  2X0L A;  4OOI A;  1AWC A;  4I02 A;  2Z33 A;  1YYV A;  4HQE A;  4MEX F;  1P4A A;  1KU7 A;  1EH6 A;  3HYI A;  4CZZ A;  3E6C C;  4CDG A;  3E6M A;  2JTV A;  3HSF A;  2P7C B;  1HXD A;  2Y75 A;  4LLG F;  1DDN A;  3WU1 B;  3VEP A;  5DV5 A;  2YX7 A;  1MD0 A;  1ZRF A;  4L18 B;  2OZ6 A;  2PMU A;  3NRV A;  2XKP A;  2ESN A;  5DD4 A;  5LLQ A;  1R5G A;  3H92 A;  2ISY A;  2EV0 A;  5L3E A;  2CWE A;  4XLP F;  4L9J A;  2DPU A;  2A61 A;  4G7O F;  5DUI A;  3CTA A;  3WTU C;  1TBX A;  3LAP A;  4RB2 C;  3ZMS A;  4I0A A;  5JR3 A;  1O57 A;  1FBS A;  4GYG A;  3ZP5 A;  1S29 A;  2PFB A;  1FNN A;  5DCM A;  3GFI A;  4ESB A;  1C0W A;  4EGZ A;  4A12 A;  5E18 F;  3HTU A;  2QBY B;  3ML6 A;  3E6B A;  3EET A;  4RGS A;  2NNN A;  3GEZ A;  4A0Y A;  4GXO A;  1ZH5 A;  1I27 A;  2XIG A;  3KE2 A;  3U1D A;  2PJP A;  4LB6 B;  4F7Z A;  1R00 A;  3FHZ A;  2LSO A;  3CJN A;  3JAM K;  3GZ5 A;  4YFX F;  2EFW A;  2L4A A;  3MZY A;  1G3Y A;  4RGR A;  2FQ3 A;  2EFO A;  2RGV A;  3T5X A;  2FBK A;  5D5X B;  2FBI A;  3BP8 A;  4L9N A;  2ACJ A;  3KP7 A;  4AVP A;  2UXX A;  1Z05 A;  4P9U A;  4U88 A;  4HDV A;  4U0V A;  2BE5 F;  4CIC A;  2HWV A;  2A07 F;  1T98 A;  2M45 A;  5D6E A;  4ZYH A;  3ZMU A;  1UCR A;  2HOE A;  2ZNZ A;  2FXA A;  1BOA A;  5HS8 A;  4HX8 A;  3EYY A;  4BHC A;  2ESH A;  3D5L A;  2D1V A;  3C18 A;  2JPC A;  3E97 A;  1LNW A;  1JHF A;  4ENJ A;  2XKO A;  3DXJ F;  1W5T A;  5ILS A;  1SFX A;  3I53 A;  1J2X A;  4PDK A;  4KT5 C;  5FFX A;  4UV9 A;  4L9V A;  5CVR A;  2IT0 A;  2H09 A;  3Q5F A;  3R60 A;  2HTJ A;  4CHU A;  5DEQ A;  4IF4 A;  2O0Y A;  3WTW C;  2WWY A;  2GIV A;  3DPT A;  4KIC A;  1LB2 A;  1XGS A;  3WTT C;  4HA8 A;  5LHI A;  1Z7U A;  3C3W A;  2A5Y B;  5D4R A;  1YLF A;  2L01 A;  1PP7 U;  2K86 A;  3K9T A;  4CXF A;  3RIR A;  2AXL A;  2B0L A;  4KIB A;  2LKP A;  4G7Z F;  1TNS A;  2RDP A;  3MZH A;  4K2E A;  4LMY A;  5DCF A;  4YII A;  3GFL A;  2STT A;  1UB9 A;  3GLX A;  1QPM A;  4U0Y A;  1R23 A;  2ZME B;  3V7S A;  2YR2 A;  3QP6 A;  2ADU A;  3B02 A;  4G8X A;  4KFC A;  4LLL A;  3BJ6 A;  3JSP A;  5K1Y A;  3M7G A;  3VOD A;  2D2W A;  1HW1 A;  1TLH B;  1L0O C;  1SD5 A;  2UXN A;  5FB2 A;  1W4M A;  5K5O A;  2GA2 A;  2HYF A;  2STW A;  4WCG A;  2QYO A;  3IHU A;  1HW2 A;  2FNP A;  2VT3 A;  2XRN A;  2QQB A;  1T0F A;  1D8J A;  5KVR A;  1T2K A;  4M9S A;  2K4J A;  1BI2 A;  1ZGJ A;  3DKW A;  4QLC U;  2AS5 F;  3E5X A;  2A6E F;  2VOP A;  3KCC A;  4L5I A;  1XD7 A;  1YW9 A;  4A0X A;  5FGM A;  1H0M A;  2JPB A;  4A6D A;  2RVC A;  1IXS B;  1J5Y A;  3QOP A;  2EFN A;  2FML A;  3R61 A;  4MNU A;  3LST A;  5CVV A;  4EJT A;  1A04 A;  4PGG A;  3LA2 A;  1TQI A;  2COM A;  5CYV A;  4ESF A;  1IN6 A;  2JRT A;  2OQG A;  2VE8 A;  3FXQ A;  3GWZ A;  4Q48 A;  1ON1 A;  1BM9 A;  2JSC A;  2FNA A;  2A68 F;  4HAM A;  4P96 A;  1O7F A;  2PI0 A;  2HKO A;  4XBF A;  5D5W B;  1D5V A;  2VBX A;  4NB5 A;  1QQI A;  3I4P A;  1SD4 A;  1YQA A;  4ZH4 F;  1O3S A;  3L2C A;  4ASN A;  2VC1 A;  1ZRD A;  1R36 A;  2CW0 F;  3TO7 A;  3FMS A;  1ZAR A;  2HEO A;  1ZYR F;  3F8B A;  4AIH A;  1USS A;  4BHB A;  4EJO A;  3F8C A;  1E2X A;  3LA7 A;  2VON A;  5ICF A;  3L09 A;  2QQA A;  4S05 A;  1DUX C;  1J7K A;  3WGH A;  5A2Q Z;  3E6D A;  3IKV A;  5CVJ A;  1KYW A;  3L00 A;  4ZYG A;  1J75 A;  4OIQ F;  2L54 A;  5D4S A;  1S6L A;  1U2W A;  2XVC A;  2IA1 A;  1GHC A;  4HYE A;  1ZHF A;  3RYR A;  4KN7 X;  1Z6R A;  3RPQ A;  3RYP A;  2DU9 A;  2LF7 A;  2CGP A;  3LAJ A;  1CF7 A;  3IWF A;  3CUQ A;  1TTY A;  1STZ A;  2XRO A;  3FMR A;  3ZQ7 A;  4M74 A;  1LVA A;  1CGP A;  3OOP A;  3VFZ A;  3ABT A;  2LF8 A;  4EM1 A;  2QBY A;  3I54 A;  1ZG3 A;  2CG4 A;  3PQJ A;  3KEO A;  3N97 A;  2GAU A;  1EH7 A;  2RNJ A;  3QP5 A;  3ZMZ A;  2DW4 A;  2ZO4 A;  2O3F A;  2QM3 A;  1VTN C;  1R1V A;  4KMF A;  3KZZ A;  1ZN2 A;  4Y13 A;  3TOB A;  2D45 A;  1FWZ A;  3RI4 A;  2PLY A;  1UHM A;  5BS6 A;  4IHS A;  2XAQ A;  4FHT A;  4HF0 A;  2RV8 A;  3QAH A;  6PAX A;  1I6X A;  2W25 A;  3GFJ A;  3KLN A;  2CSO A;  1OMI A;  3T1B A;  1PP8 F;  2FOK A;  5H6Q A;  3LFK A;  1FX7 A;  3BJA A;  1PUE E;  2R7D A;  2HQN A;  4BQA A;  3TDZ C;  1MKM A;  5DYM A;  1IUY A;  1JGS A;  1JXS A;  1P4W A;  1WKM A;  4L5J A;  1P6R A;  2Z99 A;  3M1E A;  3ZMV A;  1HSJ A;  1BN5 A;  3HRM A;  1IZ1 A;  1B6A A;  4XRF A;  4UVB A;  4FX0 A;  1QZZ A;  2P6S A;  2IVM A;  2ZNY A;  2DAO A;  2IJL A;  1MZB A;  2HR3 A;  1XDS A;  5CVU A;  2EFP A;  3LQR A;  3W6J B;  4IRH A;  2NYX A;  2UWM A;  2P5K A;  2DT5 A;  4KIF A;  3TO9 A;  2PBI A;  3CO7 C;  3V8L A;  5BPI A;  3HTS B;  5L3F A;  2OA4 A;  4LLN A;  4RS8 A;  3QPT A;  1IN7 A;  2V1X A;  2W24 A;  1CF7 B;  2A69 F;  2A6H F;  2EV5 A;  4ENN A;  4IRI A;  2ZFW A;  3CUQ B;  2M1B A;  4ON0 A;  3R0J A;  1F1Z A;  3H3U A;  3HOT A;  2IA2 A;  5DDG A;  5HS9 A;  3FF5 A;  1KU9 A;  2W57 A;  5K5Q A;  4UUV A;  1RIO H;  1QO0 D;  4IHT A;  2XAJ A;  1D8K A;  1YS6 A;  3RKX A;  2VBY A;  4A5N A;  1XMK A;  3I64 A;  3FXU A;  1U6G A;  5KK1 A;  3M9A A;  1XSV A;  2JT1 A;  2XV4 S;  2HGC A;  1LEB A;  2QLZ A;  3U9G A;  2EB7 A;  1HW5 A;  2CYY A;  2Q0O A;  2XAH A;  3ECO A;  1KQ0 A;  5F1R A;  2WV0 A;  1FLI A;  2PEX A;  2VBW A;  3O2P E;  1P2F A;  2EWN A;  5H20 A;  5LGU A;  1SMT A;  2DLL A;  4GGG A;  5A2Q K;  1ZLK A;  2ZME A;  4N9I A;  4G94 A;  1V4R A;  5L3D A;  3BPV A;  4G7H F;  1Z91 A;  1XMA A;  1IN5 A;  1D3Y A;  4A5M A;  2L3D A;  1BI1 A;  5JI6 A;  4QWQ A;  4RAZ A;  1FSE A;  2MH9 A;  2P6T A;  4GO1 A;  5ILV A;  5D8K B;  4E70 A;  1XGN A;  1YIO A;  3HRT A;  1IXR C;  4UV8 A;  1T38 A;  2FA5 A;  2TDX A;  2O61 A;  3HOS A;  2K4B A;  5L3G A;  2CFX A;  4MGR A;  4P55 A;  1Z6T A;  2G7U A;  3F3X A;  3GW2 A;  2J5O A;  2FSW A;  3GYH X;  1HBX G;  3BOQ A;  5TJJ A;  3J81 Z;  4DQ2 A;  3MFK A;  5F6F A;  1OKR A;  5L3B A;  3R6S A;  4AIK A;  2YPR A;  3J7A O;  1Q1H A;  2OZU A;  4HQM A;  1UST A;  3L9F A;  2MLG A;  2DK8 A;  5CLS A;  5HDK A;  4JBA A;  3SFZ A;  3KLO A;  1XGM A;  2HQR A;  1UHW A;  1R7J A;  2OQR A;  3IC7 A;  3LA3 A;  2EK5 A;  3CUO A;  1SAX A;  3IKT A;  3CLO A;  3W6K B;  4EJW A;  4MEY F;  3JSO A;  2G9W A;  2WTE A;  3FX3 A;  2O03 A;  3HHG A;  4ETS A;  3BWG A;  2XAS A;  1BIA A;  1IXC A;  2GQQ A;  2RKH A;  1WI9 A;  5LBQ A;  5E1W A;  1RUN A;  2GXG A;  3I71 A;  5ICC A;  2C6Y A;  4YFK F;  1KU3 A;  1YG2 A;  4FX4 A;  1J9I A;  4M6X A;  3WU0 A;  3WE3 A;  2EA4 A;  3FZV A;  1RZ4 A;  1HST A;  4D0P A;  3P9K A;  4U7D A;  5HLH A;  2F5F A;  3IRQ A;  2MH2 A;  1FBQ A;  3RKW A;  1W5S A;  2GA1 A;  1ZLJ A;  1MGT A;  3E5U A;  2MBF A;  1UFM A;  2P7V B;  4MTE A;  2BBY A;  2F5C A;  2F2E A;  4BYY A;  2MLK A;  5AIQ A;  1XCB A;  3BDD A;  4AIJ A;  5ICG A;  5ED4 A;  2Q2E A;  1TQM A;  2P5L C;  3K0L A;  3SZT A;  1KU2 A;  2OU2 A;  3WOD F;  2VBZ A;  4LK1 F;  3QU6 A;  1S8N A;  2ZCW A;  1W7P D;  1FT9 A;  2ZJ2 A;  2XHK A;  3SHF A;  1XCV A;  4BNC A;  5FLX Z;  3SQN A;  2KJC A;  4G9Y A;  3T8T A;  4U7B A;  3HSE A;  4YG2 F;  1JE8 A;  1OYW A;  1QNT A;  3MQ0 A;  5JHU A;  3JTG A;  4AD9 A;  1U5T C;  2QZ8 A;  1RNL A;  2HTS A;  1K6O A;  1E17 A;  2Z9O A;  3C7J A;  2E1C A;  5F64 A;  1G3T A;  2PN6 A;  3C1D A;  1IAW A;  3ZN1 A;  5E8I A;  2DI3 A;  1XSX A;  4M72 A;  2X4H A;  4B8X A;  2OD5 A;  1U3E M; 
#chains in the Genus database with same CATH topology
 1AKH A;  3Q0V A;  4UB8 C;  2KKO A;  1TNT A;  2MSY A;  3K4M A;  1WH5 A;  2JA7 J;  2WC2 A;  1RKW A;  1QHH D;  4L0Z B;  2Z5U A;  4IVN A;  2IA0 A;  4LFU A;  4XN3 A;  4XOP A;  1ETO A;  3DF8 A;  2EA2 A;  2XPU A;  4Y15 A;  1I1G A;  1X4P A;  3GO5 A;  3F72 A;  1LVK A;  3F0C A;  1MSF C;  2MC3 A;  4EJU A;  2GWR A;  3CCQ I;  4EV0 A;  1Y0U A;  5LGN A;  3CJQ B;  4HLY A;  4MQ9 F;  2OBP A;  5E1Z B;  4AWX B;  4BXU A;  3S2H J;  1LJ9 A;  2K9L A;  5IP7 J;  3ERE D;  4GYI A;  4IJA A;  2VLA A;  1IC8 A;  4CGZ A;  2KIF A;  2YUS A;  5KNL A;  5EDN A;  3QPH A;  4B43 A;  3BTI A;  2CV1 A;  2Z2S B;  3BQY A;  5E20 A;  3U2R A;  3RPU D;  3W2W A;  2H27 A;  5JVT A;  4BBS J;  1KGS A;  3OY9 A;  1WWX A;  1LDJ A;  4A0Z A;  3RKY A;  1ODD A;  5E3O A;  4KYW A;  4EJV A;  3BJO A;  2UZK A;  2KIM A;  4QSH A;  4JK1 X;  1F9N A;  3SZP A;  5BQT A;  2PG4 A;  4BXF A;  4IHY A;  1OCR H;  4NHJ A;  1B9N A;  4M9X A;  1R22 A;  3HHH A;  5DM7 F;  2LD5 A;  2BY1 A;  4DZP A;  5CPR B;  3F8M A;  3OYL A;  4OAY A;  2QKL B;  3LSI A;  1R1T A;  4WF2 A;  4BBR J;  2IGK A;  5K7F A;  3KET A;  2F5D A;  4FQG A;  2QVO A;  2VAS A;  4BGD A;  3F8F A;  3V8K A;  1SFU A;  3AG1 H;  2LLK A;  1HC8 A;  1QHG A;  2K3P A;  3MD2 A;  3TQN A;  3GTJ J;  4F92 B;  1LFP A;  5LEJ A;  3MKY B;  2LBF B;  1MJ9 A;  3J81 K;  3I56 I;  1WSU A;  1VQK I;  5TRD A;  2DXI A;  3FMQ A;  4BQN A;  1QGP A;  2JZY A;  2YU3 A;  1QPI A;  2P8T A;  4RB1 A;  1LEA A;  3PNY A;  2Q2E B;  3NQO A;  1ETV A;  1IRF A;  3NWS A;  1Y56 A;  4G6D A;  1O3Q A;  4RGU A;  5HLI A;  3ROU A;  4O3M A;  3J7Y J;  2NS7 A;  2VIX A;  3I59 A;  3L2R A;  3LWF A;  3ZPL A;  4PCQ A;  1RET A;  4XON A;  3SYT A;  2NOJ B;  1SAU A;  4V2F A;  1M1E B;  3O8G A;  1U8R A;  2CJJ A;  1R58 A;  5HNH A;  1U78 A;  2DTZ A;  2HXI A;  3OR1 C;  3UNG C;  5E3M A;  5DD8 A;  2HZT A;  3OYB A;  3H3Z A;  3CES A;  4M6Y A;  2Q8K A;  3CF2 A;  4QIW N;  1MBK A;  2F4M B;  1YRN B;  2K9Q A;  1MBF A;  3TO6 A;  5M3F J;  2M8E A;  3HRS A;  5GAD J;  1OQY A;  2CV2 A;  3I3L A;  3H0G J;  3JTH A;  4BJ6 C;  1H8A C;  2M30 A;  5GTH C;  2AQE A;  2CUF A;  1SFE A;  3HOV J;  4IXA A;  5J47 A;  1Z21 A;  3HKZ N;  5AON A;  3MWM A;  2QWW A;  2LVS A;  3Q9V A;  3IWZ A;  3TP3 A;  2HKX A;  5E3L A;  4D7M A;  1N25 A;  1W5C C;  3GTQ J;  5HLG A;  2EZL A;  2QEX I;  1YFH A;  2DA2 A;  3TL4 X;  3GX4 X;  1LDK B;  3KP6 A;  1AKH B;  1T39 A;  3TOA A;  4DNC A;  2DQR A;  1OYI A;  2K02 A;  2VJ4 A;  1NTC A;  4I98 B;  1TT5 B;  5F0F A;  1W0T A;  5IT9 Z;  3LL7 A;  4C3I J;  5HDG A;  2Y0M A;  3V8J A;  1R5H A;  2DTR A;  4DYQ A;  1K4S A;  2MW8 A;  3E3V A;  3F6O A;  4YFN F;  1F4K A;  1U5T A;  3A01 A;  3P7N A;  2H94 A;  2CQK A;  1OLT A;  4RBO A;  1R1U A;  1I5Z A;  1GVJ A;  3D5S C;  4D7N A;  5JFR A;  4V2G A;  1IW7 F;  3B73 A;  3G73 A;  4H0E A;  3EUH A;  1DP3 A;  1KQ8 A;  1TZL A;  2KHM A;  4ENM A;  1OCZ H;  2GZW A;  4KDP A;  5FLM J;  2FMY A;  2VOD A;  3VYT B;  3ZQF A;  4XRM A;  2F5E A;  4OAZ A;  3PUB A;  4I99 C;  2FJ1 A;  4XOR A;  2IP2 A;  1XN7 A;  4V19 K;  3R4K A;  5LGT A;  4L5E A;  1Y0N A;  2V6C A;  3F8N A;  3K1M A;  1LQ1 A;  1K78 A;  5BPD A;  4WXC A;  2ELH A;  1BOB A;  3I55 I;  5B1B H;  3FBI B;  2VJ5 A;  4NNJ A;  3I5U A;  3HUG A;  1XG1 A;  2ETH A;  5E17 F;  5E1X A;  1HOM A;  1IN4 A;  1WPK A;  1MJB A;  1O3T A;  1MJA A;  1W7P A;  1YE9 A;  2PMH A;  1YS7 A;  3GCM A;  2R5Z A;  2E1M B;  1NHA A;  2XDV A;  1XSD A;  2J5P A;  2WB1 N;  3FM5 A;  2L7M P;  1P7J A;  2BHY A;  3JRF A;  2QEN A;  1ERD A;  4II3 A;  3BPX A;  2DDB A;  2KIQ A;  3MAJ A;  5BMZ A;  5LHG A;  2VE9 A;  2QUF A;  3K6G A;  2KRH A;  2BEO A;  1B1B A;  1JUS A;  1Z1D A;  1ZGA A;  4C3H J;  3KP5 A;  3LSM A;  3L2W A;  2VPL A;  3GF2 A;  5FLX K;  2LR8 A;  1ZGW A;  2K40 A;  3V7C A;  3VOE A;  2DA3 A;  2M5W A;  1QU3 A;  4UHT A;  5HS7 A;  5J8C A;  3S3O A;  1ZAO A;  3CMM A;  2QA4 I;  3PSF A;  4XLN F;  4ZZL A;  2RRE A;  3FK6 A;  4HF2 A;  1MBH A;  1FY7 A;  3HSR A;  3MN2 A;  1DPR A;  3KEQ A;  3EYI A;  2ZXJ A;  3WGI A;  1SD7 A;  3KPH A;  3RJP A;  1XC5 A;  5FFZ A;  4BY1 J;  3NAU A;  1Y8R B;  2FEZ A;  2M9H A;  5AIP A;  5J4Y A;  5CVI A;  4A69 C;  1PDN C;  5L3C A;  5E8G A;  4A3E J;  1MSE C;  3I59 B;  4B47 A;  3V42 A;  3EDP A;  2GXB A;  1BI3 A;  4PGH A;  1X4O A;  2WAE A;  5EEH A;  2NS0 A;  3I9V 2;  1FIP A;  1ITY A;  2VN2 A;  4C9Y A;  1IUF A;  3S2D J;  3WE2 A;  3GBG A;  4TV7 A;  4A3K J;  3QRF F;  2VKH A;  2CQN A;  2Y48 A;  4L9T A;  4RB0 A;  5J1R A;  2V26 A;  3SEZ A;  2LMD A;  3DWL E;  4ZYA A;  4F3Q A;  2ID6 A;  4KJZ A;  2DBB A;  3FXR A;  3VYR B;  1B72 A;  3S14 J;  4BE0 A;  3AL0 B;  3HRU A;  3ASN H;  3ZXS A;  4YEL A;  3DPL C;  2WAF A;  3COA C;  4E7H A;  5JLW A;  4LD5 A;  3AAF A;  2JWT A;  4EGY A;  1SEU A;  4A6E A;  3JRC A;  1BIB A;  4I7H A;  4DBR A;  4M3G A;  1YJ9 I;  5K5R A;  4I01 A;  3RPU A;  1NG7 A;  2D5V A;  3LSP A;  2E60 A;  2DFI A;  1FEX A;  1RUO A;  3BG5 A;  4NDL A;  1BR4 A;  3ASO H;  1WRJ A;  2LNB A;  3WG7 H;  4BDZ A;  1IGN A;  3K2A A;  4KNY A;  3L2Q A;  1FC3 A;  3OL3 A;  4KMU X;  3IH2 A;  1FOK A;  2EV6 A;  1WHU A;  1LDD A;  4LGW A;  2A3S A;  3HKZ A;  1U5T B;  3A01 B;  1ZEL A;  3HIF A;  2CH0 A;  2O8X A;  2E5N A;  2AHQ A;  4BHP A;  4LJZ F;  1YI2 I;  1XGO A;  2R7Z J;  1XX5 A;  2FOW A;  1MBJ A;  2DQL A;  4UVA A;  3G3Z A;  1XB4 A;  3HPG A;  2LK2 A;  2IW5 A;  4S04 A;  3PL8 A;  4ZZD A;  1YO5 C;  4E7L A;  1O7L A;  4BDY A;  4II2 A;  4R8H A;  2GM4 A;  5LHH A;  2R7V A;  2OCE A;  4WWC A;  2MD5 A;  5FKM A;  3VSL A;  2VC0 A;  4XLA A;  1SMY F;  4HLX A;  3BZK A;  3S1R J;  3G2B A;  1RI7 A;  2XGX A;  1K78 B;  3CO6 C;  1X1C A;  2PQ8 A;  1TWG J;  3V4G A;  1A6Q A;  2L5Q A;  1YJW I;  4XSX F;  3O3K A;  1A35 A;  2EIL H;  3JRI A;  3CC4 I;  2IS1 A;  1L3L A;  1ORK A;  1FYL A;  4RAF A;  4A3C J;  4N9H A;  4A3B J;  1FBU A;  5F27 A;  1W7P B;  4BH9 A;  2R5Z B;  2JN6 A;  4IHW A;  3PM1 A;  3F23 A;  2W85 A;  2XB0 X;  2JA5 J;  3BZC A;  3K4C A;  2LKS A;  2X1D A;  1W0U A;  2AQF A;  3DFG A;  3BZ6 A;  1OIS A;  1S72 I;  3HG9 A;  1YW8 A;  3DTE A;  4A3D J;  4LG0 A;  1W36 C;  2ZKZ A;  1IRG A;  2DO7 A;  3A1Y A;  4HBL A;  4X1E A;  4JP0 A;  2LOO A;  4FAS D;  3GTL J;  2DT6 A;  3FXL A;  2XUB A;  2K3F A;  2CS3 A;  1WJD A;  2KRF A;  4DIQ A;  2DK5 A;  4XM3 A;  1I1S A;  1G8X A;  2RQQ A;  3ABL H;  3OYD A;  2KFD A;  3ZQI A;  1EH8 A;  2V1N A;  2EJR A;  3WTS C;  1TW3 A;  1VQ7 I;  3S1Q J;  3KX2 A;  3L2U A;  4HV6 A;  3PNV A;  2KJB A;  2QKM B;  1MDM A;  4ESJ A;  2R3S A;  2FE3 A;  4C2T A;  5B5E C;  3MKZ A;  1F5T A;  1WFX A;  3OL4 A;  4XKC A;  1V5E A;  1P4X A;  1APL C;  1HQC A;  4NC8 A;  2E2J J;  1S7A A;  2MG4 A;  4BAY A;  4GCV A;  1ULY A;  1D1C A;  3HGY A;  4HOB A;  2QGU A;  3DBH B;  4UXN A;  3I58 A;  3JRH A;  1VQ9 I;  1WJB A;  4EEF G;  3OS1 A;  5JLX A;  5IT9 K;  1R9T J;  1KYZ A;  1BJA A;  5ILU A;  2CQQ A;  2VXZ A;  3JW4 A;  3ZOB A;  1QA6 A;  4HDU A;  1HLV A;  1G6N A;  4FE4 A;  2DYS H;  4BS9 A;  3OYH A;  1KQ9 A;  3QYF A;  2X6W A;  4JYK A;  4FCY A;  1B72 B;  5BOX A;  4IKF A;  2JRM A;  4XQF A;  1KZH A;  2ZSH B;  3KP4 A;  5HOO A;  3GUD A;  3FDY A;  4P5O A;  1DP7 P;  5ERI A;  3JRD A;  2DOE A;  4R79 A;  4O6J A;  1HKQ A;  2K9N A;  2CQ7 A;  4HW0 A;  2KT0 A;  2MA3 A;  2RN7 A;  4EM0 B;  3DEU A;  3TKY A;  3VDX A;  4ENK A;  3J80 Z;  4E7S A;  5IYB J;  1GXP A;  2CMP A;  3Q9S A;  5DCM B;  4EM2 A;  2F5V A;  3LSH A;  3M1C A;  1ZG1 A;  3QQA A;  1SVL A;  1OR7 A;  1X3U A;  5B1A H;  2E71 A;  2DOF A;  1I6H J;  1R4M B;  3M8E A;  1WQ2 A;  1YTY A;  3DBR B;  5B3S H;  3RKQ A;  4U87 A;  3PQK A;  3BR5 A;  1FJL A;  2DA7 A;  1VI0 A;  4EMS A;  1JHH A;  1IN8 A;  3K4B A;  1JI8 A;  2K27 A;  2RQP A;  1W1W E;  3GVA A;  3DU6 A;  4Y7N J;  2COB A;  3MKW B;  3HXL A;  2G0E A;  1E3P A;  4BEH A;  3G1O A;  2K7L A;  3C2H A;  2Z3Y A;  1FYK A;  4Y52 J;  1K83 J;  1WI3 A;  1WJ5 A;  2KP6 A;  2H6C A;  2Z16 A;  1Y1V J;  2E7W A;  1WH7 A;  4OIN F;  3H3V K;  5CKT A;  1QRY A;  5H6R A;  4I0B A;  3TGN A;  1X3Z B;  1B4A A;  1ZQ3 P;  3Q3S A;  3O6B B;  1KA8 A;  1TW2 A;  3F6V A;  4EVI A;  2V9V A;  2JJ7 A;  2OTL I;  2VKD A;  4A2U A;  3RTR A;  3EQL F;  1AOY A;  2WY7 Q;  2LTP A;  4UY8 I;  2HYG D;  2V9K A;  3ISP A;  3MEX A;  2HFH A;  4DYR A;  4YIF A;  1ON2 A;  5M3M J;  5EGO A;  4HX4 A;  2AO9 A;  5J3L A;  2UV1 A;  1EV7 A;  3BR6 A;  3GZ6 A;  3P9I A;  2H6B A;  3ABM H;  5HDN A;  3LQQ A;  2GOX B;  1YX5 A;  2L2O A;  5FD5 A;  4A3I J;  2LBF A;  2XRL A;  5GTI C;  2CU7 A;  2CFO A;  2DFF A;  2O7O A;  2EFQ A;  5GP9 A;  3KP3 A;  1QZY A;  1BI0 A;  5EJC A;  4WK8 F;  4FET A;  1MBG A;  2OPT A;  3ZMD A;  2WAQ N;  3L7W A;  1AU7 A;  1OJL A;  2BY2 A;  3CUQ C;  4WXH A;  3WG9 A;  2X9D A;  1TQP A;  1X19 A;  2R7F A;  4E7J A;  4XK4 A;  3SEQ A;  3OYK A;  2VOO A;  3E0J B;  2HDC A;  1ZRE A;  1HKT A;  4MTD A;  4OIP F;  2BV6 A;  3BTJ A;  2XC7 A;  3EUK L;  3IV5 A;  4LG0 B;  3WTY C;  5FD6 A;  3OV8 A;  2EIK H;  5H2F C;  2FF4 A;  4C2U A;  5GAE J;  4LIV A;  3K1N A;  1ETX A;  3DP7 A;  2QQ9 A;  4M3D A;  4IX7 A;  2HYJ A;  2CUE A;  4KUM A;  2W84 A;  1ETW A;  1VND A;  1J09 A;  3DV8 A;  4OIO F;  3ECH A;  3FXK A;  3AKZ A;  5J1U A;  1IF1 A;  2R7O A;  1MIJ A;  1MDM B;  2OAZ A;  1YRN A;  3ESW B;  2O6G E;  4L0Y B;  3P9C A;  1PVE A;  3K1P A;  3E5Q A;  3ZQC A;  1G3W A;  1RKT A;  2IPQ X;  1OCT C;  4WX9 A;  3LNQ A;  2L9R A;  4BE1 A;  2GOM A;  4EQQ A;  2CUZ A;  2ME6 A;  1JUP A;  3VB2 A;  2EZK A;  2IGM A;  2ISZ A;  5DS9 A;  4HZF A;  4Z2Y A;  1O3R A;  1P92 A;  2DA4 A;  4UVC A;  3FWE A;  3CZ6 A;  4G6Q A;  2MD0 A;  3RDI A;  1BC8 C;  4W1U A;  3IP4 B;  4Y17 A;  3GTO J;  1XMX A;  1G4D A;  3LSG A;  4M73 A;  5IT3 A;  1BC7 C;  3CDH A;  5LRR A;  4OIR F;  2NRA C;  2KL4 A;  3T8R A;  1LFU P;  1K79 A;  2L4M A;  2M87 A;  1YJN I;  3ONQ A;  3WGG A;  2H1K A;  3IRR A;  3FIS A;  2P5V A;  4M3B A;  3H5N A;  4AU7 A;  3AG4 H;  4EAT A;  4HRI A;  3I0T A;  1I3A A;  1T6S A;  2XAU A;  3AG2 H;  3QU3 A;  3KZY A;  2HXO A;  1H88 C;  4XSZ F;  3V7R A;  1FP2 A;  3KFW X;  1Z67 A;  3FM3 A;  3K70 D;  2LDU A;  2VUM J;  2IEK A;  4NC7 A;  3TP0 A;  5D8L B;  3ABU A;  4HV5 A;  3BQZ A;  3L1P A;  4NUB A;  1ZRC A;  5GPA A;  3L2V A;  3F21 A;  4BEH B;  2EIM H;  4OU0 A;  5CQG A;  3GTG J;  2W1O A;  2G7H A;  4M3E A;  5EEG A;  2NNY A;  2F6C A;  1XDU A;  1YW7 A;  2LFB A;  4XRS G;  1SC7 A;  1DPU A;  2X48 A;  2DA6 A;  4BL0 B;  3WTZ A;  1BBY A;  4YIR X;  1VQM I;  4XR6 A;  1MMD A;  1J59 A;  1H9T A;  4I09 A;  4CCM A;  3B6A A;  2MFZ A;  2VQC A;  2M2E A;  2BY0 A;  3H5R A;  4FT8 A;  3S17 J;  2V79 A;  2OV7 A;  1OYY A;  2Q1Z B;  3JAM Z;  5EGO B;  4O5V A;  4IRG A;  5D5U B;  4KN4 X;  3OYN A;  2XAG A;  3N4M A;  3MCZ A;  4D5F A;  2FRH A;  3BG9 A;  4DGW B;  4WXD A;  5M5X J;  2KPM A;  4P9F A;  3WTV C;  3H1C A;  4MHG A;  1ZG5 A;  2VQH A;  3A0H C;  3BCB A;  5EZG A;  4ZYD A;  2ZXW H;  1MH3 A;  4MFE A;  4QPQ A;  1GXQ A;  2XF7 A;  1VQ6 I;  5E3N A;  1MH4 A;  3S2W A;  4HF1 A;  1FYM A;  1XPX A;  1IJW C;  1FTT A;  3ERM A;  2MGQ A;  1H9G A;  4ZYE A;  4F93 B;  4RB3 C;  4W97 A;  2L02 A;  4B09 A;  3K70 C;  1LKX A;  3HOX J;  4B1R A;  3ZQG A;  3PFI A;  1FSH A;  1P7I A;  2ZC2 A;  3DEW A;  4NQW A;  1V3F A;  2LY9 A;  1HDD C;  5DUK A;  5F1J A;  2X6X A;  4HX7 A;  2FU4 A;  4D9J A;  3CCS I;  3M8F A;  4M71 A;  2DT7 B;  3T0Y A;  4I2O A;  1ONV A;  2R93 J;  2WAQ A;  3DKY A;  1Z3X A;  3HGG A;  2E1N A;  2R7R A;  4Q4Z F;  3HBL A;  1B59 A;  3K2Z A;  1A31 A;  4M9Z A;  3D0S A;  1G3S A;  3WTX C;  1S7O A;  3AG3 H;  4U0W A;  2FBH A;  3G1L A;  3NEU A;  5D5V B;  4HSR A;  1REP C;  1HA8 A;  2QSF X;  2JK3 A;  3PO3 J;  4DOZ A;  5CJ9 A;  2ZBK A;  4KA4 A;  4LK0 F;  2HZD A;  3J80 K;  4LB5 A;  5ICE A;  1K7A A;  1U9N A;  4IQJ A;  3ZMT A;  4KIG A;  2KIU A;  1RR8 C;  1T33 A;  5J6X A;  2HS5 A;  4RGX A;  5J40 A;  3RSN A;  1S3J A;  4CYD A;  3SXY A;  3ZN0 A;  3SFI A;  1FPQ A;  4CO8 A;  2E34 A;  3TDU C;  5K7Z A;  4AM3 A;  2EIN H;  4AVZ A;  1IO2 A;  5IOZ A;  3IL2 A;  4KIS A;  4OMY A;  3S15 J;  1VQ4 I;  1BR2 A;  5LRS A;  2OUM A;  3DQV C;  1X3W B;  2DPD A;  1Z9C A;  4N0B A;  1JTY A;  2XAF A;  2NAZ A;  4OMZ A;  1T95 A;  5J8F A;  2D1H A;  3ZGK A;  2V7F A;  4MQV A;  1X1P A;  4C2M J;  4N4O B;  2V1U A;  2YX4 A;  4IQ4 A;  2Y69 H;  1E0E A;  3ELK A;  2VT2 A;  3IAM 2;  3FIW A;  1XTA A;  1MW7 A;  2ZME C;  2DJI A;  5IP9 J;  5LEK A;  2BYV E;  2VJJ A;  3WU2 C;  1U8B A;  4IEJ A;  2HOT A;  2Y30 A;  4IPA A;  4RAY A;  4Q47 A;  5D6F A;  3DTI A;  1Z3Y A;  2RC4 A;  5FO5 A;  1FP1 D;  3BRO A;  3OIQ A;  2NVQ J;  3SJM A;  5DM6 F;  2CUJ A;  2KQR A;  1QBJ A;  1OPC A;  2R5Y A;  2IRF G;  2V1D A;  4R1H A;  3JR9 A;  3F22 A;  1J0R A;  3KYC B;  3GFM A;  5CQE A;  2ECC A;  4JQF A;  4PSX A;  1FZP B;  1D0Z A;  4ABZ A;  4PZJ A;  2IGO A;  1FIA A;  2E7X A;  2HQA A;  3SDG A;  2P4W A;  1HKS A;  4Y3O A;  5HVQ C;  3S1N J;  3KP2 A;  3R0A A;  3ULQ B;  4UNO A;  3BY6 A;  2HQ5 A;  2YSR A;  1QVT A;  2R4G A;  3GXO A;  4CH7 A;  3M3Y J;  2CO5 A;  2R92 J;  4Q5S F;  1F36 A;  2R7W A;  1SD6 A;  3K69 A;  2BGC A;  3DLL F;  4F52 A;  1UMQ A;  3REO A;  1JKQ C;  3GZN B;  1MMG A;  2MYS A;  1B9M A;  4J01 A;  2X0L A;  1GT0 C;  3H9J A;  4OOI A;  1AWC A;  1OCP A;  2HDD A;  5F08 A;  1WVR A;  3KYL A;  4I02 A;  3TBI A;  2Z33 A;  4DJA A;  1YYV A;  2NVY J;  4HQE A;  4MEX F;  3JCU C;  1P4A A;  1KU7 A;  1Z0X A;  1EH6 A;  2HNH A;  3HYI A;  4CZZ A;  1JJ6 C;  3E6C C;  4CDG A;  1K6Y A;  1SVM A;  1R71 A;  3E6M A;  2E36 A;  2JTV A;  2JUG A;  1RES A;  5FJ8 J;  4FTH A;  1TC3 C;  3HSF A;  4RLQ A;  2P7C B;  1HXD A;  2Y75 A;  3M07 A;  3RQI A;  4LLG F;  1DDN A;  3WU1 B;  1UG2 A;  3VEP A;  5DV5 A;  3TMO A;  4NQW B;  1ZR2 A;  5EYR A;  2YX7 A;  3CCR I;  1HCR A;  5IYD J;  1MD0 A;  1VQL I;  1ZRF A;  4L18 B;  2DDA A;  2OZ6 A;  1BA5 A;  2PMU A;  2WV1 A;  1BR1 A;  2NVT J;  3NRV A;  2XKP A;  4DBQ A;  3CD6 I;  2ESN A;  5DD4 A;  1UG0 A;  2FX0 A;  5LLQ A;  1R5G A;  3H92 A;  2KZG A;  2M3A A;  3HB9 A;  2ISY A;  2KZV A;  2EV0 A;  3TW6 A;  5L3E A;  2CWE A;  3GME A;  4XLP F;  4DYC A;  2DFH A;  4RM2 A;  4S0H B;  4L9J A;  4RM3 A;  4CCK A;  2DPU A;  2A61 A;  4G7O F;  3QOD A;  2LRE A;  2LG4 A;  4B3X A;  5DUI A;  3CTA A;  3WTU C;  1TBX A;  3CCU I;  3LAP A;  3PSI A;  4RB2 C;  3ZMS A;  4I0A A;  4KIT B;  5JR3 A;  1O57 A;  4PUS A;  1FBS A;  2IBD A;  2N8G A;  2XPV A;  4GYG A;  3ZP5 A;  3HDD A;  4QTR A;  1S29 A;  2PFB A;  1FNN A;  2VL8 A;  1JKR C;  5DCM A;  2L7Z A;  4CYC A;  4A93 J;  3GFI A;  4ESB A;  1XS9 A;  1C0W A;  3H9Q A;  2QF7 A;  2V4J C;  3OYM A;  4EGZ A;  4A12 A;  5E18 F;  3HTU A;  1D0Y A;  2QBY B;  3ML6 A;  4PJL A;  2O5R A;  1UEL B;  3E6B A;  3A2K A;  3EET A;  4RGS A;  3OYE A;  3E1S A;  2I10 A;  5IY5 H;  2NNN A;  2BY3 A;  3GEZ A;  1OFC X;  1W36 D;  4A0Y A;  4GXO A;  1S9H A;  1IRZ A;  4LIU A;  1Z77 A;  3BG6 A;  2ECB A;  1ZH5 A;  2IAI A;  1I27 A;  5K7H A;  2XIG A;  3KE2 A;  3HC7 A;  1ZKG A;  5IP6 A;  2M8G X;  1DGR M;  3U1D A;  2PJP A;  2DJN A;  4LB6 B;  4F7Z A;  1AA7 A;  1R00 A;  3DPU A;  3FHZ A;  1HDP A;  3QPL A;  5JVG F;  2VXD A;  2LSO A;  4AYB N;  4CUG A;  3HOZ J;  3CJN A;  3JAM K;  2R5Y B;  1QVU A;  4Z6Y A;  1VFC A;  4XKW A;  1CQT A;  3GZ5 A;  4YFX F;  4XRS A;  2EFW A;  2L4A A;  3MZY A;  4KT6 A;  4PJ0 C;  4XN0 A;  3RCO A;  1G3Y A;  5C4X J;  4RGR A;  2FQ3 A;  2EFO A;  3K4N A;  2RGV A;  3KYD B;  3T5X A;  1G2H A;  2FBK A;  2X6O A;  5J4V A;  3ABK H;  5D5X B;  3OYF A;  3LSK A;  2FBI A;  3BP8 A;  3HZJ A;  2XGD A;  4L9N A;  1R49 A;  4BUP A;  2ACJ A;  3FXJ A;  2ZFU A;  3KP7 A;  4AVP A;  4XLH A;  4B48 A;  1K4T A;  2BVM A;  3H0D A;  3CF5 F;  2HVR A;  2UXX A;  1Z05 A;  1WJF A;  2E5Z A;  3GTM J;  5C4J J;  4P9U A;  3N05 A;  4U88 A;  2FD5 A;  1ETY A;  4HDV A;  1Y1W J;  4U0V A;  2BE5 F;  4CIC A;  1D5Y A;  2H1L A;  2HWV A;  1LUJ B;  2A07 F;  1T98 A;  2M45 A;  1T0F C;  5D6E A;  4ZYH A;  3HOW J;  1WJA A;  2IS2 A;  3ZMU A;  1UCR A;  2HOE A;  2ZNZ A;  2FXA A;  1BOA A;  3EUA A;  3CCY A;  5HS8 A;  4HX8 A;  3EYY A;  3SZG A;  4BHC A;  2ESH A;  3D5L A;  2WB1 A;  2WY8 Q;  2LP0 A;  3I4M J;  2D1V A;  2B63 J;  2JA6 J;  4UB6 C;  2EQR A;  2I5U A;  3C18 A;  3MZ8 A;  1IDY A;  2JPC A;  3E97 A;  1LNW A;  1JHF A;  2EZH A;  3DTK A;  4ENJ A;  1SFO J;  2XKO A;  3DXJ F;  1W5T A;  5ILS A;  3PIO F;  1SFX A;  2UUZ A;  3Q0W A;  1WGX A;  5F0C A;  3JRG A;  3I53 A;  1J2X A;  2HOS A;  4PDK A;  4KT5 C;  3BTC A;  3HJE A;  5FFX A;  4PJN A;  3CCE I;  1X2N A;  4BXX J;  4HEA 2;  4UV9 A;  3FKJ A;  3OYA A;  4L9V A;  5CVR A;  2XSJ C;  1DU6 A;  4XID A;  2A5W A;  3MMY B;  5J1Y A;  2IT0 A;  2XF6 A;  3DEE A;  2H09 A;  3Q5F A;  3R60 A;  2HTJ A;  1T8I A;  1RR7 A;  3P5J A;  4CHU A;  5DEQ A;  5HNF A;  5E79 C;  3X2Q H;  2LY2 A;  1EKE A;  2RAE A;  4IF4 A;  2O0Y A;  3WTW C;  2WWY A;  2KRC A;  2GIV A;  3DPT A;  4KIC A;  3K4K A;  5LFA A;  5M5W J;  4CYC B;  1LB2 A;  5FKN A;  3BLY A;  1XGS A;  3K4L A;  2GLO A;  5EG0 B;  3BCA A;  3Q0U A;  3WTT C;  4HA8 A;  5LHI A;  1Z7U A;  2DOD A;  3BR0 A;  3C3W A;  1MNM C;  2A5Y B;  2ZSI B;  5D4R A;  3EPZ A;  1YLF A;  2L01 A;  2NVU B;  3FK7 A;  4HNT A;  1PP7 U;  2K86 A;  3GLL A;  3K9T A;  3J7Z I;  4PJM A;  4CXF A;  3RIR A;  2EZI A;  2AXL A;  1R4N B;  2B0L A;  4IHX A;  4KIB A;  2K5C A;  2LKP A;  3CCJ I;  1HF0 A;  2BZT A;  3RZO J;  1FOW A;  4G7Z F;  1TWF J;  1TNS A;  1H89 C;  4XLE A;  2RDP A;  1ZK8 A;  1MMA A;  3M8J A;  3MZH A;  1JUM A;  4XKV A;  4A3J J;  4K2E A;  2W00 A;  4LMY A;  5DCF A;  3BR3 A;  4YII A;  3GFL A;  2STT A;  2VJI A;  2Y9Y A;  1UB9 A;  2HDW A;  3A02 A;  4BJ5 C;  2I8D A;  1N75 A;  3GLX A;  1QPM A;  4U0Y A;  4AYB A;  1R23 A;  2ZME B;  2DA5 A;  2B7E A;  2CW7 A;  3ZCO A;  3V7S A;  2YR2 A;  1GDT A;  4DZJ A;  4B3A A;  4J19 A;  5LD2 C;  3QP6 A;  2TRT A;  4A3G J;  2ADU A;  5M5Y J;  3I4N J;  3PJR A;  1NH3 A;  4CCO A;  2M4K A;  4Y33 A;  3B02 A;  4G8X A;  3DCF A;  1K61 A;  2IS4 A;  2M7A A;  4MLO A;  4KFC A;  3BTL A;  1E3H A;  1QZE A;  3FBN B;  4LLL A;  1YHQ I;  3BJ6 A;  2QQ8 A;  4RAG A;  1G59 A;  3JSP A;  3AL0 C;  5K1Y A;  4E7Z A;  3M7G A;  3VOD A;  2D2W A;  1HW1 A;  1TLH B;  1L0O C;  1SD5 A;  2UXN A;  5GAH J;  5FB2 A;  2CV0 A;  1W4M A;  4CCJ A;  5K5O A;  4PFO A;  2GA2 A;  2ID3 A;  5HLT A;  2HYF A;  2HOA A;  4PJJ A;  2DMP A;  2R0Q C;  1JKP C;  2V6E A;  2BOL A;  2STW A;  1JGG A;  4WCG A;  1FTZ A;  2QYO A;  3IHU A;  4AC0 A;  1HW2 A;  3CCV I;  2FNP A;  2VT3 A;  2XRN A;  5GPC A;  3CDI A;  3D1N I;  4XNF A;  2QQB A;  1T0F A;  5KAI C;  1D8J A;  1VQO I;  5KVR A;  1T2K A;  4M9S A;  1YIJ I;  2FUG 2;  1FMW A;  2K4J A;  1BI2 A;  1ZGJ A;  3DKW A;  1A6I A;  4QLC U;  2AS5 F;  3E7L A;  3MVP A;  1DGW Y;  3E5X A;  2A6E F;  3KZI C;  5EZH A;  2VOP A;  3KCC A;  4L5I A;  1XD7 A;  2OJE D;  1YW9 A;  4NBQ A;  4A0X A;  3EUH C;  2YU9 J;  5EF6 A;  1O4X A;  5FGM A;  2DFE A;  1MND A;  2CRG A;  1H0M A;  1PJR A;  5TIS C;  2JPB A;  4G6T B;  4A6D A;  2NXN B;  2RVC A;  1IXS B;  1J5Y A;  3QYB A;  3QOP A;  2EFN A;  1RC9 A;  5F04 A;  2FML A;  3R61 A;  2MAB A;  4MNU A;  2EH3 A;  2ELJ A;  3WHB A;  2VKE A;  3AFH A;  3LST A;  5CVV A;  1VQ8 I;  1F43 A;  4EJT A;  1A04 A;  4PGG A;  3W2V A;  2VKV A;  2VB6 A;  3IAS 2;  4M3F A;  3LA2 A;  1TQI A;  4A3M J;  2COM A;  5CYV A;  2X1E A;  4ESF A;  1IN6 A;  2JRT A;  1UHS A;  2OQG A;  3QWL A;  2VE8 A;  3FXQ A;  3GWZ A;  4Q48 A;  1JT6 A;  4XMY A;  1ON1 A;  2FQ4 A;  2PX9 A;  2WBM A;  3O8H A;  1BM9 A;  2JSC A;  2FNA A;  3OYJ A;  5BNG A;  2A68 F;  4HAM A;  4P96 A;  1O7F A;  2PI0 A;  3K10 A;  2HKO A;  3OS2 A;  3OOU A;  1OCC H;  2DMT A;  4XBF A;  5JHF A;  2F48 A;  5D5W B;  1D5V A;  2VBX A;  4NB5 A;  3BT9 A;  1P9Q C;  1QQI A;  2XF5 A;  2ELK A;  1SD4 A;  1YQA A;  3C2G A;  3I4P A;  4FIS A;  4ZH4 F;  1O3S A;  1DU0 A;  2M0M A;  3CP8 A;  3L2C A;  3GTK J;  4ASN A;  2BW3 A;  1YX3 A;  2VC1 A;  1ZRD A;  1R36 A;  2CW0 F;  3TO7 A;  3LOC A;  3FMS A;  3H36 A;  3PIP F;  1ZAR A;  2HEO A;  2KIS A;  1ZYR F;  3F8B A;  4AIH A;  1USS A;  4BHB A;  4EJO A;  1PYV A;  1E2X A;  2L0K A;  3F8C A;  3LA7 A;  2VON A;  1X58 A;  3TW7 A;  3H5A A;  2IS6 A;  3QOE A;  5ICF A;  1Y39 A;  1R6R A;  3L09 A;  4BE2 A;  4PSW A;  2ZB9 A;  1LFB A;  2Y2Z A;  2VQL A;  4HPQ A;  2L7F P;  2QQA A;  4AID A;  4S05 A;  1IRX A;  1DUX C;  1J7K A;  3CC7 I;  2LKX A;  3WGH A;  5A2Q Z;  3E6D A;  3IKV A;  1DQU A;  5CVJ A;  3OYG A;  4ZTJ A;  2R7U A;  3BR2 A;  4ZDL A;  1KYW A;  4CZC A;  3L00 A;  4ZYG A;  1J75 A;  3D5R C;  4OIQ F;  2O9L A;  4HST A;  1X1D A;  2L54 A;  5D4S A;  1TWC J;  1S6L A;  1U2W A;  2XVC A;  3VYU B;  2IA1 A;  3W6V A;  1GHC A;  4HYE A;  2JA8 J;  1ZHF A;  3NAR A;  3RYR A;  4KN7 X;  1T08 B;  1Z6R A;  2GIZ A;  3OSF A;  3RPQ A;  4C3J J;  4I76 A;  1B8I A;  3RYP A;  4BAC A;  2Y9Z A;  2ZXH A;  2DU9 A;  2LF7 A;  2CGP A;  3LAJ A;  4BU2 A;  3HOU J;  1CF7 A;  3IWF A;  3BR1 A;  4XOT A;  2DMU A;  3CUQ A;  2OTJ I;  5KHD A;  1PUF A;  1TTY A;  1STZ A;  2XRO A;  4QPO A;  3DKX A;  3FMR A;  4XL9 A;  3W3C A;  3S3M A;  2GXA A;  4G12 A;  3ZQ7 A;  1VQN I;  5HOD A;  2EIJ H;  2MC4 A;  4M74 A;  4PK4 A;  1LVA A;  4A3F J;  1IDZ A;  4AUX A;  1CGP A;  2B9S A;  3OOP A;  2OCC H;  3VFZ A;  4M6V A;  2GBY A;  3ABT A;  2LF8 A;  4EM1 A;  2QBY A;  3CME I;  3I54 A;  1ZG3 A;  2CG4 A;  2KDO A;  3PQJ A;  3CMA I;  3KEO A;  4E7K A;  3N97 A;  2GAU A;  2XSD C;  1Y8Q B;  3KEY A;  1EH7 A;  2RNJ A;  3QP5 A;  1X1B A;  2IXS A;  2KLO A;  3ZMZ A;  4BKX A;  1NK2 P;  2CQX A;  2DW4 A;  1JT0 A;  3S1M J;  1RRJ A;  2HU9 A;  3HEF A;  2ZO4 A;  4CA0 A;  2O3F A;  4RDU A;  3GTP J;  2QM3 A;  1VTN C;  1R1V A;  1IV6 A;  2JSP A;  3RZD J;  4KMF A;  3KZZ A;  1ZN2 A;  2IGN A;  4Y13 A;  2H8W A;  2W82 A;  3RQ4 A;  3TOB A;  1IV8 A;  3OS0 A;  2YS9 A;  2D45 A;  3BC8 A;  1FWZ A;  3RI4 A;  2PLY A;  4IZZ A;  2H8R A;  2NVX J;  1UHM A;  5BS6 A;  4IHS A;  3CJR B;  2XAQ A;  4FHT A;  4HF0 A;  2QSH X;  1BW6 A;  1POG A;  2RV8 A;  3QAH A;  4E6K G;  6PAX A;  1I6X A;  5IYC J;  2W25 A;  3GFJ A;  2A6T A;  3PFY A;  4BY7 J;  1FOX A;  1BW5 A;  3KLN A;  4J00 A;  2JVH A;  2CSO A;  1BL0 A;  4XLC A;  2LH9 A;  1OMI A;  2K85 A;  3T1B A;  1PP8 F;  2FOK A;  3IUO A;  2ZJP F;  4A3L J;  4PFP A;  2M7B A;  2BW3 B;  5H6Q A;  2DOA A;  3LFK A;  1FX7 A;  3BJA A;  4ITV A;  1PUE E;  2R7D A;  2HQN A;  3QPS A;  2HVS A;  4BQA A;  3TDZ C;  1MKM A;  5DYM A;  2W48 A;  1VQ5 I;  1ZR4 A;  1OCO H;  1FMV A;  1IUY A;  1JGS A;  1JXS A;  2LYC A;  1P4W A;  1WKM A;  4L5J A;  1P6R A;  1S7E A;  2Z99 A;  4IL6 C;  4P1W A;  3S16 J;  4HNV A;  2WAD A;  3G6E I;  3M1E A;  3ZMV A;  1BN5 A;  1HSJ A;  3HRM A;  2P0W A;  3VPR A;  2DYR H;  2EPF A;  1IZ1 A;  3LMM A;  1B6A A;  4XRF A;  1WZ2 A;  4UVB A;  1Y6I A;  4FX0 A;  1QZZ A;  2P6S A;  2IVM A;  2ZNY A;  2DAO A;  1LPQ A;  2M34 A;  2IJL A;  1MZB A;  2HR3 A;  3HOY J;  1XDS A;  5CVU A;  2EFP A;  1KON A;  1TWH J;  1D1B A;  3LQR A;  3W6J B;  1N77 A;  4IRH A;  2NYX A;  2UWM A;  1AHD P;  2P5K A;  3OWT A;  2DT5 A;  4IOC F;  4KIF A;  1MBE A;  3CCL I;  3TO9 A;  2PBI A;  3H35 A;  3H9G A;  1LE8 A;  3CO7 C;  4JX4 A;  2L7K A;  3V8L A;  3JRB A;  3G1M A;  5BPI A;  3HTS B;  1B8I B;  1JTX A;  5L3F A;  3CDL A;  5F0H A;  2OA4 A;  4LLN A;  4RS8 A;  3QPT A;  1IN7 A;  3VWB A;  1TWA J;  2RNG A;  4MO7 A;  2V1X A;  2KMU A;  2W24 A;  1ACI A;  1CF7 B;  2A69 F;  4N4N B;  2A6H F;  2EV5 A;  2TCT A;  4ENN A;  1TT0 A;  3BG3 A;  4IRI A;  4UUS A;  2ZFW A;  3CUQ B;  1PUF B;  3ZQL A;  1OR7 C;  4E7I A;  4DW6 A;  1T56 A;  2M1B A;  4ON0 A;  2W7N A;  3R0J A;  1JJ8 C;  4JX6 A;  1F1Z A;  1MMS A;  3H3U A;  5EEA A;  1MNE A;  2NS8 A;  3HOT A;  2L9N A;  2IA2 A;  3M4O J;  5DDG A;  2BXY A;  4LIT A;  5EG0 A;  5HS9 A;  1R5I D;  3FF5 A;  4ZDO A;  1KU9 A;  2OC6 A;  2W57 A;  1ENH A;  5K5Q A;  2DMN A;  4UUV A;  1RIO H;  1QO0 D;  1GLN A;  4IHT A;  1GV5 A;  2L9V A;  5C44 J;  1Q1V A;  2XAJ A;  1D8K A;  1YS6 A;  2K9S A;  2LY1 A;  4MFD A;  1V5F A;  2VBY A;  3MKL A;  4JOM A;  3RKX A;  3BG7 A;  4A5N A;  1XMK A;  4CSW A;  3I64 A;  3FXU A;  1WJE A;  1X2M A;  5KAF C;  1U6G A;  5KK1 A;  4ZTF A;  1ETK A;  3M9A A;  3JRA A;  1XSV A;  2JT1 A;  2XV4 S;  4OWR B;  2VI6 A;  2HGC A;  1LEB A;  2QLZ A;  4XIC A;  3U9G A;  3HL2 A;  2EB7 A;  1HW5 A;  2CYY A;  2DCE A;  2Q0O A;  1NK3 P;  4H4K C;  2XAH A;  4Y4R A;  1GVD A;  1TP4 A;  4XLF A;  3ECO A;  2KDZ A;  1KQ0 A;  5F1R A;  2BHZ A;  1A5J A;  2WV0 A;  2E19 A;  3A03 A;  1N78 A;  1FLI A;  2PEX A;  2VBW A;  3O2P E;  3CQZ J;  2A05 A;  1P2F A;  2DMQ A;  1WJC A;  2EWN A;  4D1Q A;  1SAN A;  3OYI A;  5H20 A;  5LGU A;  4D5C A;  3G4S I;  3QYE A;  4ZC3 A;  1UAA A;  1I3Q J;  1SMT A;  1Z7L A;  2DLL A;  3UR3 C;  1X1A A;  2M4G A;  5B66 C;  3W2A A;  4GGG A;  5A2Q K;  1ZLK A;  2HPI A;  2VPR A;  2ZME A;  1SFK A;  1SVO A;  3C2B A;  1VZ0 A;  1EA3 A;  2LRD A;  1ZTR A;  2PJR A;  4N9I A;  4G94 A;  1V4R A;  3J7A Y;  5L3D A;  3S93 A;  2F4I A;  1V5G A;  2W4S A;  3BPV A;  2L9S A;  4G7H F;  1Z91 A;  1XMA A;  1UZC A;  2AXT C;  4RMN A;  1IN5 A;  4RLF A;  1D3Y A;  1EF4 A;  3PUF A;  3HUG B;  4A5M A;  2L3D A;  4ZJZ A;  4LOC A;  2Y0S N;  2ZXI A;  1BI1 A;  2XGC A;  2JQ7 A;  3ZRG A;  5JI6 A;  4RA2 A;  2R7T A;  4QWQ A;  4RAZ A;  4IO9 F;  1ETQ A;  1FSE A;  2MH9 A;  2P6T A;  3OR2 C;  4B4C A;  4GO1 A;  5ILV A;  3KIO A;  2ZJQ F;  5D8K B;  4E70 A;  4GDF A;  1XGN A;  1YIO A;  3FXM A;  3HRT A;  1IXR C;  4UV8 A;  4MIM A;  1T38 A;  2PMZ N;  2JVG A;  3NWT A;  2FA5 A;  2TDX A;  4FE7 A;  3U1K A;  3ZQQ A;  3HOS A;  2K4B A;  4XKB A;  2O61 A;  5L3G A;  2CFX A;  4MGR A;  2X85 A;  4P55 A;  3CLQ A;  2NOG A;  1Z6T A;  2G7U A;  3F3X A;  3GW2 A;  2J5O A;  2FSW A;  4IOA F;  4HNU A;  3GYH X;  3WHC A;  1LE8 B;  1HBX G;  3BOQ A;  5TJJ A;  5FRN A;  3J81 Z;  4DQ2 A;  1BJZ A;  2E2H J;  4IHV A;  3K7A J;  3IH4 A;  3LFU A;  3MFK A;  2JUC A;  5F6F A;  5KCM A;  1OKR A;  4HG2 A;  5L3B A;  3R6S A;  2O8K A;  4AIK A;  1A36 A;  2CW8 A;  2YPR A;  3A0B C;  2P81 A;  4YEJ A;  1Q1H A;  2OZU A;  3J7A O;  2JA2 A;  4HQM A;  4UUS B;  2R7X A;  3ZQH A;  2Y31 A;  1UST A;  3L9F A;  3HPH A;  2MLG A;  2DK8 A;  5CLS A;  3OIP A;  1YIT I;  5HDK A;  3JRE A;  4JBA A;  2QCO A;  2X1C A;  3SFZ A;  1IG7 A;  3KLO A;  2BXZ A;  2XPW A;  1XGM A;  2HQR A;  4BQO A;  2BVL A;  1UHW A;  1D1A A;  1R7J A;  2JMW A;  2F4O B;  2OQR A;  3IC7 A;  3LA3 A;  1I50 J;  5DTD A;  2EK5 A;  3LSJ A;  3CUO A;  5FLV A;  1SAX A;  3ZR8 X;  3IKT A;  3CLO A;  2E2I J;  1WCM J;  3W6K B;  4EJW A;  5GAG J;  2E1M C;  4MEY F;  4F55 A;  2Z1D A;  5FKK A;  3JSO A;  2G9W A;  2WTE A;  1TL8 A;  2E1O A;  2XGE A;  3FX3 A;  2O03 A;  3HHG A;  1RPW A;  4BQQ A;  4ETS A;  2X51 A;  3G71 I;  3BWG A;  2XAS A;  1BIA A;  3IH3 A;  1IXC A;  3OYC A;  1GUU A;  2GQQ A;  2RKH A;  1WI9 A;  3PO2 J;  5LBQ A;  5E1W A;  1RUN A;  2GXG A;  3I71 A;  3A4C A;  3U21 A;  5ICC A;  4I6Z A;  2QSG X;  2C6Y A;  1MMN A;  2XB5 A;  4YFK F;  4GRI A;  4CCN A;  4ZDP A;  3S3N A;  4F91 B;  1KU3 A;  3DLA A;  1NG6 A;  1YG2 A;  5FRO A;  4FX4 A;  1J9I A;  4GFB A;  4M6X A;  3WU0 A;  1U9O A;  3DU5 A;  3WE3 A;  2EA4 A;  3FZV A;  4B44 A;  4YRV A;  2V9P A;  1RZ4 A;  1HST A;  4D0P A;  3P9K A;  4U7D A;  4X6A J;  5HLH A;  4C30 A;  4UUT A;  2F5F A;  3IRQ A;  3TED A;  2PJR B;  1FOY A;  1JKO C;  2EBI A;  2MH2 A;  1FBQ A;  3RKW A;  3FKI J;  1W5S A;  2GA1 A;  3LSR A;  1ZLJ A;  3VYS B;  1MGT A;  2LC2 A;  3E5U A;  2VQG A;  2MBF A;  1UFM A;  1UJ8 A;  2OF7 A;  2DA1 A;  1GV2 A;  4BJT A;  5IPA A;  5C3E J;  2P7V B;  4MTE A;  2BBY A;  3F9K A;  2ME0 A;  1V55 H;  2F5C A;  2F2E A;  5FKO A;  2K9M A;  2ICW G;  3OMY A;  2MLK A;  4BYY A;  2DN0 A;  5AIQ A;  1XCB A;  3BDD A;  4AIJ A;  3UKG A;  5ICG A;  5ED4 A;  5FKL A;  2Q2E A;  2R7S A;  5IOY A;  1TQM A;  2P5L C;  3K0L A;  3SZT A;  4CCL A;  1KU2 A;  2OU2 A;  3WOD F;  3CC2 I;  3FXO A;  2VBZ A;  1I39 A;  2WA0 A;  3HM5 A;  2HVQ A;  1S5L C;  4LK1 F;  4X0G A;  3QU6 A;  1S8N A;  4NC6 A;  3SDB A;  1E3O C;  2M0C A;  2ZCW A;  3PNT A;  1V54 H;  1W7P D;  1EJ9 A;  2Y0S A;  1U0J A;  2HPM A;  1FT9 A;  2ZJ2 A;  3CP2 A;  5TGT A;  2XHK A;  3SHF A;  1XCV A;  4BNC A;  2ZJR F;  2X6Y A;  5FLX Z;  3CMY A;  3SQN A;  2KJC A;  4E4H A;  4G9Y A;  3T8T A;  1YOV B;  4U7B A;  1D0X A;  1VQP I;  3FHN A;  3HSE A;  4LG3 A;  4YG2 F;  1JE8 A;  1OYW A;  1QNT A;  3MQ0 A;  5JHU A;  3JTG A;  4AD9 A;  1U5T C;  2HI3 A;  2QZ8 A;  3K4J A;  1RNL A;  2PMZ A;  2HTS A;  1K6O A;  3VSK A;  1E17 A;  9ANT A;  2Z9O A;  3DBL B;  3C7J A;  2E1C A;  5F64 A;  2E35 A;  3OIO A;  1G3T A;  2PN6 A;  3C1D A;  4ANJ A;  2R7Q A;  3OSG A;  3S32 A;  1IAW A;  3CCM I;  3CJT B;  4JX5 A;  3ZN1 A;  1VF9 A;  5E8I A;  5FRM A;  2DI3 A;  1XSX A;  4M72 A;  2X4H A;  4B8X A;  2OD5 A;  1U3E M;  3S8P A;  3B6C A; 
#chains in the Genus database with same CATH homology
 2KKO A;  1TNT A;  2WC2 A;  4L0Z B;  2Z5U A;  4IVN A;  2IA0 A;  4LFU A;  3DF8 A;  2EA2 A;  4Y15 A;  1I1G A;  3GO5 A;  3F72 A;  2MC3 A;  4EJU A;  2GWR A;  4EV0 A;  1Y0U A;  5LGN A;  4HLY A;  4MQ9 F;  2OBP A;  5E1Z B;  4AWX B;  4BXU A;  1LJ9 A;  3ERE D;  4GYI A;  4IJA A;  4CGZ A;  2KIF A;  3QPH A;  5E20 A;  3U2R A;  2H27 A;  5JVT A;  1KGS A;  1WWX A;  1LDJ A;  4A0Z A;  3RKY A;  1ODD A;  4KYW A;  4EJV A;  3BJO A;  2UZK A;  2KIM A;  4JK1 X;  1F9N A;  3SZP A;  5BQT A;  2PG4 A;  4NHJ A;  1B9N A;  4M9X A;  1R22 A;  3HHH A;  3F8M A;  1R1T A;  4WF2 A;  3KET A;  2F5D A;  2QVO A;  3F8F A;  3V8K A;  1SFU A;  3TQN A;  5LEJ A;  1MJ9 A;  3J81 K;  1WSU A;  5TRD A;  3FMQ A;  1QGP A;  2JZY A;  2YU3 A;  2P8T A;  4RB1 A;  1LEA A;  3NQO A;  1IRF A;  4G6D A;  1O3Q A;  4RGU A;  5HLI A;  3ROU A;  4O3M A;  3I59 A;  3LWF A;  3ZPL A;  4PCQ A;  1U8R A;  1R58 A;  1U78 A;  5DD8 A;  2HZT A;  3H3Z A;  4M6Y A;  2Q8K A;  3TO6 A;  2M8E A;  3HRS A;  3JTH A;  2M30 A;  1SFE A;  4IXA A;  5AON A;  3MWM A;  2QWW A;  3Q9V A;  3IWZ A;  2HKX A;  5HLG A;  1YFH A;  3GX4 X;  1LDK B;  3KP6 A;  1T39 A;  3TOA A;  4DNC A;  2DQR A;  1OYI A;  2K02 A;  4I98 B;  5IT9 Z;  5HDG A;  2Y0M A;  3V8J A;  1R5H A;  2DTR A;  3E3V A;  3F6O A;  4YFN F;  1F4K A;  1U5T A;  3P7N A;  2H94 A;  2CQK A;  1R1U A;  1I5Z A;  1GVJ A;  5JFR A;  1IW7 F;  3B73 A;  3G73 A;  4H0E A;  3EUH A;  1KQ8 A;  4ENM A;  2GZW A;  4KDP A;  2FMY A;  2VOD A;  2F5E A;  2IP2 A;  1XN7 A;  3R4K A;  5LGT A;  2V6C A;  3F8N A;  3K1M A;  1LQ1 A;  1K78 A;  5BPD A;  4WXC A;  2ELH A;  3I5U A;  3HUG A;  2ETH A;  5E17 F;  5E1X A;  1IN4 A;  1MJB A;  1O3T A;  1MJA A;  1W7P A;  2PMH A;  1YS7 A;  1NHA A;  1XSD A;  2J5P A;  3FM5 A;  2QEN A;  3BPX A;  3MAJ A;  5BMZ A;  5LHG A;  2VE9 A;  2QUF A;  2BEO A;  1B1B A;  1Z1D A;  1ZGA A;  3KP5 A;  3GF2 A;  5FLX K;  3V7C A;  3VOE A;  2M5W A;  4UHT A;  5HS7 A;  5J8C A;  1ZAO A;  4XLN F;  4ZZL A;  4HF2 A;  1FY7 A;  3HSR A;  3EYI A;  1DPR A;  3KEQ A;  2ZXJ A;  3WGI A;  1SD7 A;  3RJP A;  5FFZ A;  2FEZ A;  5AIP A;  5CVI A;  1PDN C;  5L3C A;  5E8G A;  3I59 B;  3EDP A;  2GXB A;  1BI3 A;  4PGH A;  5EEH A;  2NS0 A;  2VN2 A;  3WE2 A;  4TV7 A;  3QRF F;  2Y48 A;  4L9T A;  4RB0 A;  2DBB A;  3FXR A;  3HRU A;  3DPL C;  3COA C;  4LD5 A;  3AAF A;  4EGY A;  4A6E A;  1BIB A;  4I7H A;  5K5R A;  4I01 A;  3RPU A;  2DFI A;  1RUO A;  1WRJ A;  2LNB A;  4KNY A;  1FC3 A;  4KMU X;  1FOK A;  2EV6 A;  4LGW A;  1LDD A;  2A3S A;  1U5T B;  3HIF A;  2O8X A;  4BHP A;  4LJZ F;  1XGO A;  2DQL A;  4UVA A;  3G3Z A;  1XB4 A;  2IW5 A;  4S04 A;  4ZZD A;  1YO5 C;  1O7L A;  4R8H A;  5LHH A;  4WWC A;  2MD5 A;  2VC0 A;  1SMY F;  4HLX A;  1RI7 A;  2XGX A;  1K78 B;  3CO6 C;  2PQ8 A;  3V4G A;  4XSX F;  3O3K A;  1L3L A;  1FYL A;  4N9H A;  1FBU A;  1W7P B;  4BH9 A;  3F23 A;  2W85 A;  3DFG A;  3BZ6 A;  1YW8 A;  4LG0 A;  2ZKZ A;  1IRG A;  2DO7 A;  4HBL A;  2XUB A;  1I1S A;  2KRF A;  2DK5 A;  1EH8 A;  2EJR A;  3WTS C;  1TW3 A;  4HV6 A;  2KJB A;  1MDM A;  4ESJ A;  2R3S A;  2FE3 A;  1F5T A;  1P4X A;  1HQC A;  1S7A A;  4BAY A;  4GCV A;  1ULY A;  4HOB A;  4UXN A;  3I58 A;  5IT9 K;  1KYZ A;  1BJA A;  5ILU A;  2VXZ A;  3JW4 A;  4HDU A;  1G6N A;  1KQ9 A;  5BOX A;  3KP4 A;  5HOO A;  3GUD A;  4P5O A;  1DP7 P;  5ERI A;  4R79 A;  4O6J A;  1HKQ A;  4HW0 A;  2MA3 A;  2RN7 A;  4EM0 B;  3DEU A;  3TKY A;  4ENK A;  3J80 Z;  1GXP A;  3Q9S A;  5DCM B;  4EM2 A;  1ZG1 A;  1OR7 A;  1X3U A;  3M8E A;  1WQ2 A;  1YTY A;  3PQK A;  4EMS A;  1JHH A;  1IN8 A;  2K27 A;  2RQP A;  3GVA A;  2K7L A;  1FYK A;  2Z3Y A;  2H6C A;  2E7W A;  4OIN F;  5H6R A;  4I0B A;  3TGN A;  1B4A A;  3O6B B;  1KA8 A;  1TW2 A;  3F6V A;  4EVI A;  2V9V A;  4A2U A;  3RTR A;  3EQL F;  1AOY A;  2HYG D;  3ISP A;  3MEX A;  2HFH A;  4YIF A;  1ON2 A;  4HX4 A;  1EV7 A;  3GZ6 A;  3P9I A;  2H6B A;  5HDN A;  3LQQ A;  5FD5 A;  2EFQ A;  3KP3 A;  1QZY A;  1BI0 A;  4WK8 F;  3ZMD A;  3L7W A;  3CUQ C;  4WXH A;  3WG9 A;  1TQP A;  2R7F A;  2VOO A;  2HDC A;  1ZRE A;  1HKT A;  4MTD A;  4OIP F;  2BV6 A;  4LG0 B;  3WTY C;  5FD6 A;  3OV8 A;  2FF4 A;  3K1N A;  3DP7 A;  2QQ9 A;  4KUM A;  2W84 A;  3DV8 A;  4OIO F;  3ECH A;  1IF1 A;  1MDM B;  2OAZ A;  2O6G E;  4L0Y B;  3P9C A;  3K1P A;  3E5Q A;  1G3W A;  2IPQ X;  4WX9 A;  4EQQ A;  3VB2 A;  2ISZ A;  4HZF A;  4Z2Y A;  1O3R A;  1P92 A;  4UVC A;  3FWE A;  4G6Q A;  3RDI A;  1BC8 C;  4Y17 A;  1G4D A;  4M73 A;  5IT3 A;  1BC7 C;  3CDH A;  5LRR A;  4OIR F;  2NRA C;  3T8R A;  1K79 A;  2L4M A;  2M87 A;  3WGG A;  3IRR A;  2P5V A;  3I0T A;  1T6S A;  3QU3 A;  3KZY A;  4XSZ F;  3V7R A;  1FP2 A;  3KFW X;  3FM3 A;  2LDU A;  5D8L B;  3ABU A;  4HV5 A;  1ZRC A;  3F21 A;  4OU0 A;  2G7H A;  5EEG A;  2NNY A;  1XDU A;  1YW7 A;  1DPU A;  3WTZ A;  1BBY A;  1J59 A;  1H9T A;  4I09 A;  4FT8 A;  2V79 A;  1OYY A;  3JAM Z;  4O5V A;  4IRG A;  5D5U B;  4KN4 X;  2XAG A;  3N4M A;  3MCZ A;  2FRH A;  4WXD A;  4P9F A;  3WTV C;  4MHG A;  1ZG5 A;  4ZYD A;  1GXQ A;  3S2W A;  4HF1 A;  1FYM A;  1H9G A;  4ZYE A;  4RB3 C;  2L02 A;  4B09 A;  3PFI A;  1FSH A;  4NQW A;  1V3F A;  5DUK A;  4HX7 A;  2FU4 A;  3M8F A;  4M71 A;  3T0Y A;  4I2O A;  1ONV A;  2E1N A;  4Q4Z F;  1B59 A;  3K2Z A;  4M9Z A;  3D0S A;  1G3S A;  3WTX C;  1S7O A;  4U0W A;  2FBH A;  3NEU A;  5D5V B;  1REP C;  5CJ9 A;  2ZBK A;  4KA4 A;  4LK0 F;  3J80 K;  4LB5 A;  5ICE A;  1K7A A;  3ZMT A;  4KIG A;  2KIU A;  5J6X A;  2HS5 A;  4RGX A;  1S3J A;  4CYD A;  3SXY A;  3ZN0 A;  1FPQ A;  4CO8 A;  3TDU C;  3IL2 A;  4OMY A;  5LRS A;  3DQV C;  2DPD A;  1Z9C A;  4N0B A;  2XAF A;  2NAZ A;  4OMZ A;  5J8F A;  2D1H A;  4MQV A;  2V1U A;  2YX4 A;  3ELK A;  2VT2 A;  5LEK A;  2BYV E;  4IPA A;  4RAY A;  4Q47 A;  5D6F A;  5FO5 A;  2RC4 A;  1FP1 D;  3BRO A;  1QBJ A;  1OPC A;  2IRF G;  2V1D A;  4R1H A;  3F22 A;  1J0R A;  3GFM A;  4JQF A;  1FZP B;  4PZJ A;  2E7X A;  2P4W A;  1HKS A;  5HVQ C;  3KP2 A;  3R0A A;  3ULQ B;  4UNO A;  3BY6 A;  2YSR A;  3GXO A;  2CO5 A;  4Q5S F;  1SD6 A;  3K69 A;  2BGC A;  3REO A;  1B9M A;  2X0L A;  4OOI A;  1AWC A;  4I02 A;  2Z33 A;  1YYV A;  4HQE A;  4MEX F;  1P4A A;  1KU7 A;  1EH6 A;  3HYI A;  4CZZ A;  3E6C C;  4CDG A;  3E6M A;  2JTV A;  3HSF A;  2P7C B;  1HXD A;  2Y75 A;  4LLG F;  1DDN A;  3WU1 B;  3VEP A;  5DV5 A;  2YX7 A;  1MD0 A;  1ZRF A;  4L18 B;  2OZ6 A;  2PMU A;  3NRV A;  2XKP A;  2ESN A;  5DD4 A;  5LLQ A;  1R5G A;  3H92 A;  2ISY A;  2EV0 A;  5L3E A;  2CWE A;  4XLP F;  4L9J A;  2DPU A;  2A61 A;  4G7O F;  5DUI A;  3CTA A;  3WTU C;  1TBX A;  3LAP A;  4RB2 C;  3ZMS A;  4I0A A;  5JR3 A;  1O57 A;  1FBS A;  4GYG A;  3ZP5 A;  1S29 A;  2PFB A;  1FNN A;  5DCM A;  3GFI A;  4ESB A;  1C0W A;  4EGZ A;  4A12 A;  5E18 F;  3HTU A;  2QBY B;  3ML6 A;  3E6B A;  3EET A;  4RGS A;  2NNN A;  3GEZ A;  4A0Y A;  4GXO A;  1ZH5 A;  1I27 A;  2XIG A;  3KE2 A;  3U1D A;  2PJP A;  4LB6 B;  4F7Z A;  1R00 A;  3FHZ A;  2LSO A;  3CJN A;  3JAM K;  3GZ5 A;  4YFX F;  2EFW A;  2L4A A;  3MZY A;  1G3Y A;  4RGR A;  2FQ3 A;  2EFO A;  2RGV A;  3T5X A;  2FBK A;  5D5X B;  2FBI A;  3BP8 A;  4L9N A;  2ACJ A;  3KP7 A;  4AVP A;  2UXX A;  1Z05 A;  4P9U A;  4U88 A;  4HDV A;  4U0V A;  2BE5 F;  4CIC A;  2HWV A;  2A07 F;  1T98 A;  2M45 A;  5D6E A;  4ZYH A;  3ZMU A;  1UCR A;  2HOE A;  2ZNZ A;  2FXA A;  1BOA A;  5HS8 A;  4HX8 A;  3EYY A;  4BHC A;  2ESH A;  3D5L A;  2D1V A;  3C18 A;  2JPC A;  3E97 A;  1LNW A;  1JHF A;  4ENJ A;  2XKO A;  3DXJ F;  1W5T A;  5ILS A;  1SFX A;  3I53 A;  1J2X A;  4PDK A;  4KT5 C;  5FFX A;  4UV9 A;  4L9V A;  5CVR A;  2IT0 A;  2H09 A;  3Q5F A;  3R60 A;  2HTJ A;  4CHU A;  5DEQ A;  4IF4 A;  2O0Y A;  3WTW C;  2WWY A;  2GIV A;  3DPT A;  4KIC A;  1LB2 A;  1XGS A;  3WTT C;  4HA8 A;  5LHI A;  1Z7U A;  3C3W A;  2A5Y B;  5D4R A;  1YLF A;  2L01 A;  1PP7 U;  2K86 A;  3K9T A;  4CXF A;  3RIR A;  2AXL A;  2B0L A;  4KIB A;  2LKP A;  4G7Z F;  1TNS A;  2RDP A;  3MZH A;  4K2E A;  4LMY A;  5DCF A;  4YII A;  3GFL A;  2STT A;  1UB9 A;  3GLX A;  1QPM A;  4U0Y A;  1R23 A;  2ZME B;  3V7S A;  2YR2 A;  3QP6 A;  2ADU A;  3B02 A;  4G8X A;  4KFC A;  4LLL A;  3BJ6 A;  3JSP A;  5K1Y A;  3M7G A;  3VOD A;  2D2W A;  1HW1 A;  1TLH B;  1L0O C;  1SD5 A;  2UXN A;  5FB2 A;  1W4M A;  5K5O A;  2GA2 A;  2HYF A;  2STW A;  4WCG A;  2QYO A;  3IHU A;  1HW2 A;  2FNP A;  2VT3 A;  2XRN A;  2QQB A;  1T0F A;  1D8J A;  5KVR A;  1T2K A;  4M9S A;  2K4J A;  1BI2 A;  1ZGJ A;  3DKW A;  4QLC U;  2AS5 F;  3E5X A;  2A6E F;  2VOP A;  3KCC A;  4L5I A;  1XD7 A;  1YW9 A;  4A0X A;  5FGM A;  1H0M A;  2JPB A;  4A6D A;  2RVC A;  1IXS B;  1J5Y A;  3QOP A;  2EFN A;  2FML A;  3R61 A;  4MNU A;  3LST A;  5CVV A;  4EJT A;  1A04 A;  4PGG A;  3LA2 A;  1TQI A;  2COM A;  5CYV A;  4ESF A;  1IN6 A;  2JRT A;  2OQG A;  2VE8 A;  3FXQ A;  3GWZ A;  4Q48 A;  1ON1 A;  1BM9 A;  2JSC A;  2FNA A;  2A68 F;  4HAM A;  4P96 A;  1O7F A;  2PI0 A;  2HKO A;  4XBF A;  5D5W B;  1D5V A;  2VBX A;  4NB5 A;  1QQI A;  3I4P A;  1SD4 A;  1YQA A;  4ZH4 F;  1O3S A;  3L2C A;  4ASN A;  2VC1 A;  1ZRD A;  1R36 A;  2CW0 F;  3TO7 A;  3FMS A;  1ZAR A;  2HEO A;  1ZYR F;  3F8B A;  4AIH A;  1USS A;  4BHB A;  4EJO A;  3F8C A;  1E2X A;  3LA7 A;  2VON A;  5ICF A;  3L09 A;  2QQA A;  4S05 A;  1DUX C;  1J7K A;  3WGH A;  5A2Q Z;  3E6D A;  3IKV A;  5CVJ A;  1KYW A;  3L00 A;  4ZYG A;  1J75 A;  4OIQ F;  2L54 A;  5D4S A;  1S6L A;  1U2W A;  2XVC A;  2IA1 A;  1GHC A;  4HYE A;  1ZHF A;  3RYR A;  4KN7 X;  1Z6R A;  3RPQ A;  3RYP A;  2DU9 A;  2LF7 A;  2CGP A;  3LAJ A;  1CF7 A;  3IWF A;  3CUQ A;  1TTY A;  1STZ A;  2XRO A;  3FMR A;  3ZQ7 A;  4M74 A;  1LVA A;  1CGP A;  3OOP A;  3VFZ A;  3ABT A;  2LF8 A;  4EM1 A;  2QBY A;  3I54 A;  1ZG3 A;  2CG4 A;  3PQJ A;  3KEO A;  3N97 A;  2GAU A;  1EH7 A;  2RNJ A;  3QP5 A;  3ZMZ A;  2DW4 A;  2ZO4 A;  2O3F A;  2QM3 A;  1VTN C;  1R1V A;  4KMF A;  3KZZ A;  1ZN2 A;  4Y13 A;  3TOB A;  2D45 A;  1FWZ A;  3RI4 A;  2PLY A;  1UHM A;  5BS6 A;  4IHS A;  2XAQ A;  4FHT A;  4HF0 A;  2RV8 A;  3QAH A;  6PAX A;  1I6X A;  2W25 A;  3GFJ A;  3KLN A;  2CSO A;  1OMI A;  3T1B A;  1PP8 F;  2FOK A;  5H6Q A;  3LFK A;  1FX7 A;  3BJA A;  1PUE E;  2R7D A;  2HQN A;  4BQA A;  3TDZ C;  1MKM A;  5DYM A;  1IUY A;  1JGS A;  1JXS A;  1P4W A;  1WKM A;  4L5J A;  1P6R A;  2Z99 A;  3M1E A;  3ZMV A;  1HSJ A;  1BN5 A;  3HRM A;  1IZ1 A;  1B6A A;  4XRF A;  4UVB A;  4FX0 A;  1QZZ A;  2P6S A;  2IVM A;  2ZNY A;  2DAO A;  2IJL A;  1MZB A;  2HR3 A;  1XDS A;  5CVU A;  2EFP A;  3LQR A;  3W6J B;  4IRH A;  2NYX A;  2UWM A;  2P5K A;  2DT5 A;  4KIF A;  3TO9 A;  2PBI A;  3CO7 C;  3V8L A;  5BPI A;  3HTS B;  5L3F A;  2OA4 A;  4LLN A;  4RS8 A;  3QPT A;  1IN7 A;  2V1X A;  2W24 A;  1CF7 B;  2A69 F;  2A6H F;  2EV5 A;  4ENN A;  4IRI A;  2ZFW A;  3CUQ B;  2M1B A;  4ON0 A;  3R0J A;  1F1Z A;  3H3U A;  3HOT A;  2IA2 A;  5DDG A;  5HS9 A;  3FF5 A;  1KU9 A;  2W57 A;  5K5Q A;  4UUV A;  1RIO H;  1QO0 D;  4IHT A;  2XAJ A;  1D8K A;  1YS6 A;  3RKX A;  2VBY A;  4A5N A;  1XMK A;  3I64 A;  3FXU A;  1U6G A;  5KK1 A;  3M9A A;  1XSV A;  2JT1 A;  2XV4 S;  2HGC A;  1LEB A;  2QLZ A;  3U9G A;  2EB7 A;  1HW5 A;  2CYY A;  2Q0O A;  2XAH A;  3ECO A;  1KQ0 A;  5F1R A;  2WV0 A;  1FLI A;  2PEX A;  2VBW A;  3O2P E;  1P2F A;  2EWN A;  5H20 A;  5LGU A;  1SMT A;  2DLL A;  4GGG A;  5A2Q K;  1ZLK A;  2ZME A;  4N9I A;  4G94 A;  1V4R A;  5L3D A;  3BPV A;  4G7H F;  1Z91 A;  1XMA A;  1IN5 A;  1D3Y A;  4A5M A;  2L3D A;  1BI1 A;  5JI6 A;  4QWQ A;  4RAZ A;  1FSE A;  2MH9 A;  2P6T A;  4GO1 A;  5ILV A;  5D8K B;  4E70 A;  1XGN A;  1YIO A;  3HRT A;  1IXR C;  4UV8 A;  1T38 A;  2FA5 A;  2TDX A;  2O61 A;  3HOS A;  2K4B A;  5L3G A;  2CFX A;  4MGR A;  4P55 A;  1Z6T A;  2G7U A;  3F3X A;  3GW2 A;  2J5O A;  2FSW A;  3GYH X;  1HBX G;  3BOQ A;  5TJJ A;  3J81 Z;  4DQ2 A;  3MFK A;  5F6F A;  1OKR A;  5L3B A;  3R6S A;  4AIK A;  2YPR A;  3J7A O;  1Q1H A;  2OZU A;  4HQM A;  1UST A;  3L9F A;  2MLG A;  2DK8 A;  5CLS A;  5HDK A;  4JBA A;  3SFZ A;  3KLO A;  1XGM A;  2HQR A;  1UHW A;  1R7J A;  2OQR A;  3IC7 A;  3LA3 A;  2EK5 A;  3CUO A;  1SAX A;  3IKT A;  3CLO A;  3W6K B;  4EJW A;  4MEY F;  3JSO A;  2G9W A;  2WTE A;  3FX3 A;  2O03 A;  3HHG A;  4ETS A;  3BWG A;  2XAS A;  1BIA A;  1IXC A;  2GQQ A;  2RKH A;  1WI9 A;  5LBQ A;  5E1W A;  1RUN A;  2GXG A;  3I71 A;  5ICC A;  2C6Y A;  4YFK F;  1KU3 A;  1YG2 A;  4FX4 A;  1J9I A;  4M6X A;  3WU0 A;  3WE3 A;  2EA4 A;  3FZV A;  1RZ4 A;  1HST A;  4D0P A;  3P9K A;  4U7D A;  5HLH A;  2F5F A;  3IRQ A;  2MH2 A;  1FBQ A;  3RKW A;  1W5S A;  2GA1 A;  1ZLJ A;  1MGT A;  3E5U A;  2MBF A;  1UFM A;  2P7V B;  4MTE A;  2BBY A;  2F5C A;  2F2E A;  4BYY A;  2MLK A;  5AIQ A;  1XCB A;  3BDD A;  4AIJ A;  5ICG A;  5ED4 A;  2Q2E A;  1TQM A;  2P5L C;  3K0L A;  3SZT A;  1KU2 A;  2OU2 A;  3WOD F;  2VBZ A;  4LK1 F;  3QU6 A;  1S8N A;  2ZCW A;  1W7P D;  1FT9 A;  2ZJ2 A;  2XHK A;  3SHF A;  1XCV A;  4BNC A;  5FLX Z;  3SQN A;  2KJC A;  4G9Y A;  3T8T A;  4U7B A;  3HSE A;  4YG2 F;  1JE8 A;  1OYW A;  1QNT A;  3MQ0 A;  5JHU A;  3JTG A;  4AD9 A;  1U5T C;  2QZ8 A;  1RNL A;  2HTS A;  1K6O A;  1E17 A;  2Z9O A;  3C7J A;  2E1C A;  5F64 A;  1G3T A;  2PN6 A;  3C1D A;  1IAW A;  3ZN1 A;  5E8I A;  2DI3 A;  1XSX A;  4M72 A;  2X4H A;  4B8X A;  2OD5 A;  1U3E M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...