5ILVA

Uninhibited etv5
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
92
structure length
92
Chain Sequence
b'GSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ETS translocation variant 5
publication title Structured and disordered regions cooperatively mediate DNA-binding autoinhibition of ETS factors ETV1, ETV4 and ETV5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 29
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2016-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5ilvA00
3HRTA 1W4MA 4FHTA 1XSXA 3HOSA 2ZKZA 2DT5A 3V7SA 1DPRA 3VB2A 4ZYDA 2PEXA 1XDSA 2FU4A 2NS0A 3F22A 1FBQA 3VEPA 5E8IA 1EH8A 1MZBA 2GA2A 2J5PA 4G6QA 1T39A 4O6JA 4I01A 2FA5A 3Q9VA 4LK0F 2ZNYA 3HIFA 2HS5A 3FZVA 3V4GA 4A12A 2STTA 4ENMA 1SMTA 5TJJA 4ZH4F 2WWYA 1SD4A 3OOPA 4GYGA 5K5RA 3BJAA 1R58A 1KA8A 3R60A 3SHFA 2L4MA 1PP8F 2OAZA 2PMHA 1J59A 2A69F 4OINF 3J81K 3K1PA 1YYVA 4HX4A 5IT9Z 1U5TC 1FNNA 1I1GA 3ZQ7A 2JPBA 2F2EA 3F8NA 1TW3A 3I59B 3I5UA 4R1HA 1FZPB 5JR3A 3I53A 3RTRA 5DEQA 3GZ6A 2CO5A 5CVRA 4CDGA 1Z6RA 1FOKA 3VFZA 3Q9SA 2R7DA 5LRRA 3DFGA 4G7HF 2AXLA 1RI7A 1R1UA 3K1MA 1UHMA 2STWA 5BOXA 1LB2A 3QPTA 3BY6A 2ZO4A 1IN4A 2DI3A 3BDDA 4Q48A 3T5XA 1OR7A 5DV5A 2A5YB 3GLXA 2O61A 1R1VA 4LG0A 4A2UA 3GFLA 1ODDA 5DCMB 1KQ9A 4HAMA 5BPIA 1S6LA 2CGPA 1YW9A 1HSJA 3QAHA 1FT9A 5FFXA 1EH6A 1SAXA 4EJTA 2PBIA 2W24A 4RB3C 1ZRCA 2HDCA 2MC3A 4HLXA 2DPDA 1K6OA 2FEZA 3RJPA 2P6TA 3NEUA 4ZZDA 3IWZA 4ESFA 3E3VA 1IXSB 2GXGA 1F1ZA 1FC3A 5A2QZ 3N97A 4OMYA 4AIKA 3GWZA 3HRMA 2ZNZA 2CG4A 1DUXC 2O0YA 2KIUA 3WGHA 2Y75A 3KLOA 3JSOA 5L3CA 3QRFF 3JTGA 5FO5A 1GXQA 2FF4A 1TLHB 3BWGA 2D45A 2IRFG 2OD5A 2O03A 1HBXG 2OQRA 1XCBA 3BROA 3F8BA 2P7CB 4EQQA 2BGCA 1XN7A 2HR3A 3R0AA 2M45A 2PMUA 5F1RA 3WTWC 3GVAA 4RB1A 3WTYC 1RIOH 5E17F 2DW4A 2VBYA 4KFCA 1T98A 5JHUA 2P6SA 2A68F 1OYWA 2GA1A 4G8XA 4YG2F 3BOQA 2PQ8A 2PLYA 2Z99A 1MJBA 3GFIA 2VE9A 3E97A 4YFNF 3O2PE 4ZYHA 2K86A 3G73A 3PQKA 2DQLA 2F5EA 1ZARA 4MGRA 5J8CA 3JSPA 2UWMA 2FNPA 4A0XA 1R23A 3C3WA 5HLIA 3KP5A 3HTSB 4AVPA 1T6SA 3OV8A 4RB2C 3GW2A 4YFXF 1QO0D 2IT0A 2G9WA 2VOPA 2DU9A 5FD5A 2FSWA 1IW7F 1SFXA 1R36A 2R7FA 4L9VA 2L3DA 4DNCA 3EETA 1JHHA 2KIFA 2MLKA 5HOOA 1XMAA 3HUGA 2HTJA 4OIQF 1TBXA 2X4HA 3JAMZ 1SD6A 2DAOA 1V4RA 2H6BA 1TNSA 1LDDA 4LMYA 1L0OC 2P7VB 1LQ1A 4Y17A 3WTUC 1A04A 4ZYGA 1BI2A 4XLNF 5BS6A 4HV5A 4L0ZB 1ZRFA 1BOAA 1U6GA 2XHKA 3C18A 2LSOA 4XSXF 2Z9OA 1YIOA 4U7DA 1T2KA 3FMQA 3RPUA 2YX4A 3LA2A 4LLGF 4ENNA 3N4MA 2HKOA 3TOBA 5HLHA 1FP2A 5LBQA 3KE2A 4G6DA 1WWXA 1MDMB 1LEBA 4MEXF 5JI6A 3RYRA 2IJLA 1USTA 1ZGJA 2XVCA 2XV4S 1XB4A 4F7ZA 3J81Z 2IVMA 4GCVA 5FFZA 1FBSA 4KIBA 4NHJA 5TRDA 5F64A 4ESJA 4PZJA 4LB5A 1MJAA 3ZMVA 3E6BA 5BMZA 2IA0A 2EV6A 2YSRA 3J80K 1WQ2A 2OA4A 3GUDA 5BQTA 3FMRA 4WX9A 1FBUA 3DF8A 2HQRA 1MKMA 4MTDA 1XSDA 3CUQC 2HEOA 3M1EA 3KP2A 2E7XA 1ZHFA 4RAYA 2W57A 2M30A 2K7LA 4ENJA 4AIHA 1ON2A 4BYYA 1QBJA 1LJ9A 3DPLC 5D5UB 3O3KA 2H94A 3V8LA 2LNBA 2QM3A 2LF7A 1XMKA 1LNWA 3F21A 1FY7A 1KU3A 1YW7A 3RIRA 4L9NA 1HW5A 3MQ0A 5BPDA 4HDVA 2QQBA 2MH2A 2IP2A 3BJOA 4ETSA 4FX0A 3M7GA 3JTHA 2HTSA 2VBWA 3ECHA 3NRVA 4RGSA 4ASNA 1XGSA 3HSEA 4IF4A 3BJ6A 1SFEA 5CVVA 2A07F 1D3YA 1IN7A 1KYWA 2NAZA 2YPRA 4MQVA 5AONA 1WKMA 2FQ3A 1KU7A 3ABTA 2VBXA 2VODA 2P5LC 4MEYF 4DQ2A 3U1DA 2RC4A 5D4RA 4YIIA 4L18B 4IJAA 2VN2A 2CQKA 2KJBA 4M73A 1P4XA 3DKWA 2W85A 3ECOA 2ZMEA 2NNNA 1I1SA 4Z2YA 5LHHA 1FLIA 2QVOA 3MCZA 2E1NA 1CF7A 3S2WA 2IPQX 1V3FA 1W7PA 4YFKF 2F5FA 4HX8A 2CWEA 4XBFA 2FRHA 4JBAA 2M87A 4A0ZA 3AAFA 3P7NA 1DDNA 4IRGA 3IWFA 1S7AA 2Q2EA 2EV5A 2EWNA 4QLCU 3M8FA 5DDGA 2QQ9A 3BZ6A 3KZYA 4BAYA 2EA2A 5L3GA 5D6EA 5D8KB 3BP8A 2ESNA 3GO5A 1TQPA 4BHBA 2DQRA 1S3JA 4N0BA 3LQRA 4N9IA 5ILSA 4RGRA 4OIRF 3I71A 4EVIA 1HKSA 1KGSA 4WK8F 1HW2A 4BH9A 1HSTA 4U88A 1ZG3A 2TDXA 1YO5C 2EA4A 1R5GA 4ESBA 2BEOA 1WRJA 5E18F 3CJNA 1J5YA 1XSVA 1H9TA 3TO9A 3SQNA 1QZYA 3GFJA 1HKQA 3QP6A 5D8LB 1PP7U 3MAJA 3I0TA 4MNUA 1YLFA 1OKRA 4BHCA 2KRFA 2D1HA 2FNAA 2PN6A 1E2XA 1DPUA 1Z9CA 1BC8C 2WV0A 1ZH5A 3L7WA 3I59A 4I0AA 4A6EA 1BM9A 2PFBA 1IRFA 5HDGA 2DTRA 4O5VA 2GZWA 4EMSA 1XGNA 1Z91A 4KIGA 4Q4ZF 1ON1A 1JXSA 5LEKA 2WC2A 5FLXK 2RN7A 1R00A 1ZRDA 2PI0A 6PAXA 4IVNA 3WODF 4I98B 2E7WA 4KYWA 4AWXB 3QP5A 1G3TA 2P5VA 2JPCA 4HOBA 2UXNA 3U9GA 1B9MA 2YU3A 2EV0A 3QOPA 4NB5A 5E8GA 2OZUA 3FWEA 4B8XA 4M9XA 5JFRA 4Q5SF 4TV7A 3COAC 2RGVA 4I2OA 3J80Z 4P5OA 2J5OA 1G3SA 4UVCA 1Z1DA 1OYIA 1QQIA 2L54A 2OU2A 2XRNA 1IN5A 2RKHA 1RUOA 2XKOA 2CFXA 2XAFA 2FMYA 2COMA 1PUEE 3DPTA 4M9ZA 2WTEA 4P9UA 3WE3A 3EDPA 2W25A 2M1BA 3ISPA 3DP7A 2JTVA 2V1UA 4AD9A 3TGNA 4U0VA 2NNYA 4UV8A 3IL2A 4NQWA 1G3YA 4UV9A 1ULYA 2L02A 4PGHA 3V7RA 2A61A 3HSFA 1J0RA 3ELKA 4CO8A 2HGCA 2XASA 4KA4A 1GHCA 1HKTA 1B59A 3EYYA 3H3UA 2QWWA 5LGUA 1S8NA 2C6YA 1MGTA 4OMZA 3FHZA 1D8KA 3LQQA 5HS8A 5ERIA 2EFQA 4IHSA 3WU1B 4HLYA 3ABUA 2BV6A 3FM3A 4I7HA 5J6XA 4PGGA 4G7OF 1OPCA 4RAZA 5DCFA 3RYPA 3SZPA 4U0YA 2KKOA 2X0LA 4KDPA 4RGUA 2ISYA 3LAPA 1Z7UA 3HOTA 4CZZA 4PCQA 3E6DA 1UHWA 4HF2A 3QPHA 5FD6A 4MTEA 3L09A 1IXCA 1AWCA 3BPVA 3KEQA 5CVUA 3E5UA 1OMIA 1IN6A 4KIFA 5ED4A 1HXDA 1REPC 2L01A 1NHAA 4EJVA 5CVJA 2O3FA 1W5TA 1FYLA 2XAGA 3P9IA 3GX4X 1IN8A 1SD7A 3DV8A 1FYKA 3KP7A 1USSA 1YW8A 3IKTA 3TO7A 1BIAA 4GGGA 2DFIA 4L0YB 3R61A 2OQGA 1WSUA 1YS7A 3LA7A 2EB7A 3CUQA 2QUFA 4L5IA 3F72A 2V6CA 3LWFA 4G94A 5L3FA 2EFNA 4UVAA 3PFIA 2A6HF 4ZZLA 4AIJA 3Q5FA 1KQ0A 1U8RA 3F6OA 3HSRA 1YFHA 1O3RA 4GXOA 2QLZA 3V8KA 2M8EA 1O57A 5D6FA 4CHUA 5L3DA 1FPQA 5HDNA 3IRRA 3KCCA 2DK8A 1D8JA 1GVJA 1RZ4A 2NYXA 3F8FA 1MDMA 4OIOF 1BIBA 1IZ1A 1SD5A 2GQQA 1YTYA 1HW1A 2MBFA 2FBKA 4OU0A 1W5SA 4HQMA 2K4BA 1KU9A 1Y0UA 2YR2A 4WXHA 3P9CA 3FX3A 3GEZA 5HS9A 1E17A 5LLQA 4U7BA 3HRUA 4GO1A 3MFKA 3TQNA 3D5LA 1W7PD 3GF2A 4KMUX 3ZMDA 3LAJA 2FBIA 1MJ9A 4L5JA 1ZYRF 4HA8A 1ZAOA 2ZCWA 2RVCA 5FLXZ 1O3QA 3WTZA 5DUKA 5KVRA 5LGNA 2JZYA 1Z6TA 2ELHA 4LLLA 4EM0B 1EH7A 3WE2A 2Q0OA 1QZZA 3TDZC 1IF1A 4CXFA 1GXPA 2H6CA 4FT8A 1P4AA 1F9NA 4K2EA 3ZMTA 4ENKA 3KP6A 4WXCA 2FE3A 1FYMA 1TTYA 4EGZA 2R3SA 3WTXC 3G3ZA 5L3BA 3M8EA 5K1YA 5K5QA 3FXRA 4A5MA 2G7UA 2EFOA 2HQNA 4MHGA 1K78A 2H27A 3WGGA 3R0JA 1BI1A 5KK1A 4YIFA 3CO7C 2KJCA 4RS8A 1SMYF 1P4WA 3EQLF 3ZMSA 2BYVE 3F6VA 1JHFA 1J2XA 4E70A 2QBYA 4HV6A 1K7AA 5HS7A 3EUHA 2RQPA 2BBYA 1R7JA 1YG2A 5DD4A 2DO7A 5DD8A 3IC7A 3ZPLA 2CYYA 2ZMEB 2HYFA 4U0WA 2G7HA 1U5TA 3MEXA 1I6XA 4OOIA 1FSHA 4LGWA 3IKVA 2FBHA 1ZN2A 5D4SA 4HX7A 4HDUA 4CGZA 2M5WA 1CF7B 4BXUA 5ICCA 1IUYA 3LA3A 3CDHA 1W7PB 4EGYA 1H0MA 1K79A 3HYIA 4O3MA 2W84A 4I09A 5ICFA 2HYGD 3KFWX 3KZZA 4KMFA 1X3UA 2K27A 2EJRA 1U2WA 3FF5A 2O8XA 2V79A 1TQMA 2Y48A 4HBLA 3K0LA 2LDUA 1KU2A 2RNJA 4Y13A 1XD7A 1BI0A 1QGPA 3JAMK 3K69A 2GXBA 3RKWA 1BN5A 4KT5C 2DBBA 2Q8KA 1B1BA 5H20A 4CICA 4FX4A 4LJZF 3REOA 3ZMZA 3TOAA 1P6RA 4S04A 4UUVA 5EEHA 4LFUA 4WWCA 1AOYA 3WG9A 1TW2A 2RDPA 4HF0A 5H6RA 2UXXA 4RB0A 1BI3A 2B0LA 1RNLA 3TDUC 1P92A 5CJ9A 3ZN1A 3IRQA 4S05A 2LF8A 4KUMA 3E6CC 3L00A 3H3ZA 2ZJ2A 5E20A 2GIVA 2ZFWA 1LEAA 4R79A 3CTAA 3C7JA 2DK5A 2CSOA 3F8CA 4IHTA 1ZG5A 1U3EM 5E1XA 4P96A 1XGMA 3QU6A 2YX7A 3U2RA 2VC1A 2HFHA 4R8HA 4HW0A 1J7KA 4BHPA 2NRAC 2PJPA 2V1XA 3ROUA 2QENA 4LG0B 3ULQB 1T0FA 2FXAA 3C1DA 4LB6B 4KN7X 3DQVC 1TNTA 2UZKA 3GZ5A 1R5HA 4QWQA 3KP3A 4EJWA 1R22A 5DCMA 4XRFA 4HQEA 1BC7C 4M6YA 3T8RA 1G6NA 2OBPA 1TQIA 2XAHA 3ZMUA 2PG4A 4EM2A 4EJUA 3K9TA 2A6EF 3KEOA 4M74A 1ZLJA 3HHHA 3ML6A 2VONA 3LFKA 4LD5A 1FX7A 1Q1HA 5ICGA 2JRTA 1KYZA 1PDNC 3K2ZA 4L9TA 3D0SA 2HWVA 1UB9A 3CLOA 5AIPA 4UNOA 3TKYA 3CO6C 2MD5A 3E6MA 1WI9A 3KP4A 3F23A 4ZYEA 4G9YA 1G3WA 3FXUA 3MZYA 4IRHA 4KICA 2Z5UA 3R6SA 2VC0A 1ONVA 1QPMA 2ZXJA 5JVTA 1I5ZA 3M9AA 5HDKA 2HKXA 3MWMA 4N9HA 4MQ9F 1S29A 4D0PA 4Y15A 5J8FA 5CYVA 3V7CA 3RPQA 5LEJA 4LK1F 2EK5A 1D5VA 4LLNA 2IA2A 2ISZA 5E1WA 3ZN0A 1BBYA 1B4AA 2D1VA 3HHGA 2VE8A 4WCGA 4CYDA 2JSCA 4BNCA 1O3SA 1XCVA 1DP7P 1VTNC 4HF1A 5DYMA 1J9IA 5ICEA 5ILUA 1B6AA 3WU0A 3ZP5A 2P8TA 3V8JA 2EFPA 2VT2A 5HVQC 1LDKB 2GAUA 1XDUA 2IA1A 3IHUA 3WGIA 5F6FA 1XGOA 4HYEA 2Y0MA 4M72A 4PDKA 5LRSA 1C0WA 4JQFA 4M9SA 3O6BB 1Z05A 2D2WA 2VT3A 3CUQB 1ZGAA 1ZG1A 3HRSA 4G7ZF 2AS5F 2LKPA 3RI4A 4OIPF 1F5TA 4P55A 2MLGA 5HLGA 3SXYA 4A0YA 5FGMA 3NQOA 2DLLA 1ZREA 5IT9K 1L3LA 1O7LA 2HZTA 4BQAA 3CUOA 2JT1A 3I58A 2K4JA 4M71A 3L9FA 4Q47A 3FM5A 3GYHX 3P9KA 2O6GE 2GWRA 3GXOA 5IT3A 3SZTA 3F3XA 5AIQA 3L2CA 3I64A 1QNTA 2FMLA 3JW4A 4I02A 4I0BA 3BPXA 4XSZF 3T8TA 5LHGA 2OZ6A 3T0YA 2CW0F 5ILVA 3LSTA 3KETA 3WTVC 3B02A 1HQCA 3I4PA 1J75A 1O7FA 4P9FA 5K5OA 3WTTC 4ON0A 3I54A 2IW5A 3QU3A 1T38A 1JE8A 2F5DA 3EYIA 3FMSA 2BE5F 2P4WA 2Z33A 3TO6A 2XUBA 3PQJA 5FB2A 1O3TA 1IAWA 3DEUA 2V9VA 4A6DA 1EV7A 3W6KB 1U78A 4EM1A 5D5WB 5EEGA 4KNYA 2A3SA 3MZHA 4HZFA 1BJAA 4IRIA 4A5NA 2QZ8A 3B73A 2E1CA 4UVBA 3J7AO 2MA3A 2XIGA 2F5CA 1OYYA 4H0EA 5A2QK 2HOEA 5CLSA 2MH9A 1P2FA 3FXQA 3T1BA 2VXZA 4IXAA 4WF2A 4JK1X 3E5XA 4EJOA 2L4AA 1CGPA 2QYOA 3H92A 4KN4X 3HTUA 2ACJA 1MD0A 2K02A 1B9NA 3RKXA 1UCRA 2EFWA 2XKPA 1I27A 1YQAA 2V1DA 3ERED 3VODA 5DUIA 4RGXA 1K78B 1S7OA 4B09A 5E1ZB 1JGSA 1H9GA 3RDIA 2QBYB 4EV0A 1STZA 4L9JA 3KLNA 2ADUA 1G4DA 1KQ8A 3SFZA 2H09A 2ZBKA 2DPUA 3DXJF 3RKYA 1R1TA 5LGTA 3GFMA 2VBZA 1F4KA 3W6JB 2XAJA 4WXDA 2XROA 1U5TB 2QQAA 5H6QA 2XAQA 4XLPF 3VOEA 5L3EA 2P5KA 4GYIA 1LDJA 2Z3YA 5D5VB 1FWZA 2KIMA 1UFMA 5CVIA 2ESHA 2FOKA 3WTSC 5LHIA 4UHTA 2XGXA 1ZLKA 1IXRC 1LVAA 1SFUA 4UXNA 4IPAA 1FP1D 2RV8A 3K1NA 1FSEA 3F8MA 3R4KA 1IRGA 1YS6A 2ETHA 4M6XA 2VOOA 1RUNA 3E5QA 5D5XB
chains in the Genus database with same CATH superfamily
3HRTA 4JX5A 4RM3A 1JUSA 3M8JA 2R7OA 3DWLE 1W4MA 4FHTA 1XSXA 3HOSA 2ZJQF 2ZKZA 2DT5A 3ZGKA 3V7SA 1DPRA 3VB2A 4ZYDA 3CC2I 3OIOA 2PEXA 1XDSA 2FU4A 5J3LA 2PMZA 2NS0A 3F22A 1FBQA 5J1YA 4H4KC 1OCOH 3VEPA 5E8IA 2PJRB 1EH8A 1MZBA 4XL9A 2GA2A 2J5PA 2N8GA 4G6QA 1T39A 1FMVA 5GTIC 4O6JA 4I01A 4C3HJ 2FA5A 3Q9VA 4LK0F 2ZNYA 3IH4A 3HIFA 2HS5A 4DJAA 3OS1A 2NVYJ 3FZVA 3V4GA 4A12A 2QSFX 2STTA 4ENMA 1SMTA 5TJJA 1Y0NA 1YJWI 2EILH 4ZH4F 2KZVA 3ZQHA 4M3GA 2WWYA 1SD4A 3OOPA 4GYGA 5K5RA 3BJAA 1R58A 1XG1A 2LP0A 4P1WA 1KA8A 3R60A 4MFDA 2VASA 3DBLB 3GCMA 4BQOA 3SHFA 2L4MA 1DP3A 2H1LA 1PP8F 3S1RJ 3MKLA 2OAZA 2PMHA 5CPRB 3CESA 1J59A 3HOWJ 2A69F 1SANA 2MSYA 4OINF 4C9YA 4BJTA 3J81K 1GV5A 3K1PA 1YYVA 4HX4A 4Y7NJ 5IT9Z 1U5TC 1FNNA 2MYSA 1B8IA 1I1GA 3ZQ7A 2JPBA 2F2EA 3F8NA 4RDUA 1TW3A 3I59B 2K9NA 3I5UA 4R1HA 5IP7J 1ACIA 3OYGA 3K4MA 1FZPB 2XB5A 5JR3A 1JTXA 3G4SI 3I53A 2CH0A 2X1DA 3RTRA 4XKWA 5DEQA 3GZ6A 2CO5A 5CVRA 1OFCX 4CDGA 2CUZA 1Z6RA 1FOKA 3PSIA 3VFZA 3HPGA 3AG4H 3F9KA 2R7DA 3Q9SA 1D1CA 2WB1A 5LRRA 3DFGA 4IO9F 4G7HF 2AXLA 3U1KA 2GLOA 2KRCA 1RI7A 1R1UA 4A3EJ 3QPSA 3K1MA 1UHMA 3JRIA 2STWA 5BOXA 1LB2A 3QPTA 1VQ7I 4FTHA 4E6KG 3BY6A 4CZCA 2ZO4A 5FKKA 1IN4A 3BG6A 2JWTA 1GT0C 1ETKA 2DI3A 3BDDA 4Q48A 3T5XA 1OR7A 1RR8C 5DV5A 5JLXA 1WFXA 2IGMA 1EA3A 3K4CA 1ZKGA 2GM4A 4XLCA 2A5YB 3OR1C 3GLXA 3PO3J 2O61A 1R1VA 4DBQA 4LG0A 4D7MA 1QRYA 3BTJA 4A2UA 5LD2C 3GFLA 3GTJJ 1ODDA 5DCMB 1KQ9A 4HAMA 2HVQA 5BPIA 1S6LA 3B6CA 2HOAA 2CGPA 1YW9A 2GBYA 1YRNB 1HSJA 1T08B 3QAHA 2CV2A 3K4BA 1FT9A 3ABLH 5FFXA 2JVHA 4CYCB 2BY2A 5C4JJ 4QPQA 4BY7J 3DEEA 1EH6A 1SAXA 2DODA 4EJTA 4XLHA 2DOEA 2PBIA 3FK6A 2W24A 1X58A 2XB0X 2O7OA 4RB3C 2ID3A 1ZRCA 2F4MB 3K7AJ 4BE2A 1RKWA 4PSWA 2V4JC 2HDCA 2MC3A 4HLXA 3KX2A 3KYLA 2DPDA 2IBDA 3M07A 4IQJA 4CUGA 2VKVA 1K6OA 2FEZA 4DW6A 1A31A 2X48A 3RJPA 1PUFB 1W36D 2P6TA 3UNGC 3NEUA 3BCBA 4ZZDA 3IWZA 5K7ZA 2E60A 4ESFA 3E3VA 1IXSB 2GXGA 1F1ZA 1FC3A 1YHQI 4C2UA 2HXOA 2XGCA 4BQNA 5A2QZ 2R7UA 3N97A 2YS9A 4OMYA 4AIKA 3GWZA 1PVEA 3HRMA 2ZNZA 2CG4A 4DZPA 1DUXC 2O0YA 2KIUA 3WHCA 2CMPA 2E36A 3WGHA 2Y75A 2CUFA 2CU7A 3KLOA 3QYFA 1FOWA 3C2HA 1MH4A 3JSOA 3QOEA 5L3CA 2CJJA 4E7IA 4PJNA 1MMGA 3QRFF 3JTGA 5FO5A 2Y2ZA 1WZ2A 1GXQA 2FF4A 4G12A 2LTPA 2R7XA 2Y31A 2OV7A 1TLHB 3BWGA 2QKLB 2D45A 2IRFG 4XRSA 2MC4A 2OD5A 2O03A 1HBXG 2OQRA 1XCBA 4ZTJA 1BOBA 1LE8A 2XF5A 3BROA 2XGEA 2LBFA 3F8BA 2P7CB 3HOUJ 4EQQA 2BGCA 3LMMA 3S2HJ 4HSTA 1XN7A 5B1BH 1OCRH 2HR3A 3R0AA 2M45A 2PMUA 1SVOA 1MBFA 5F1RA 3WTWC 4BXXJ 1MNEA 3GVAA 4RB1A 3WTYC 2M4GA 2DW4A 4ZJZA 2VBYA 1RIOH 2K40A 4KFCA 5E17F 2EZIA 1T98A 5GP9A 4IHWA 3ZR8X 4B3AA 5JHUA 2F4IA 2P6SA 3BR3A 2A68F 4ZC3A 2HDWA 1OYWA 2GA1A 4G8XA 2HNHA 1NTCA 2IAIA 1IDZA 4YG2F 2JVGA 3H0GJ 3BOQA 2PQ8A 2V9KA 2PLYA 2Z99A 1MJBA 3SJMA 3CP2A 1A6QA 4BDZA 5C4XJ 4AUXA 1IRXA 3GFIA 4DYQA 2VE9A 1B72A 4PJ0C 3E97A 1JKOC 5CKTA 4YFNF 5EGOA 1RESA 3O2PE 4ZYHA 3GTPJ 2K86A 2VIXA 2E2JJ 4BACA 1MMAA 3G73A 1FTTA 3PQKA 3A0BC 5DS9A 2OCEA 3A01A 2DQLA 2F5EA 1ZARA 1X4OA 5F27A 4MGRA 5J8CA 2I10A 2E5NA 2E71A 3JSPA 2UWMA 2XSDC 2FNPA 2LOOA 3CMEI 1X1PA 2DA4A 4A0XA 1R23A 3CCVI 4QSHA 4A3KJ 3C3WA 4YEJA 1Y39A 1TL8A 5HLIA 4ZDOA 5FJ8J 3KP5A 4FE4A 2M4KA 3HTSB 2JUGA 4AVPA 2XGDA 3PUFA 1T6SA 3OYJA 3OV8A 4RB2C 3GW2A 3CJQB 5FKLA 5M3FJ 4YFXF 1QO0D 2IT0A 2G9WA 2VOPA 2GIZA 2DJNA 2DU9A 4XLAA 3S1NJ 4NDLA 2FSWA 5FD5A 1IW7F 1YX3A 2X6OA 1SFXA 1R36A 2R7FA 3CCEI 4L9VA 2L3DA 4DNCA 3CDLA 3EETA 1JHHA 4XORA 3WU2C 2KIFA 5F08A 3I4NJ 3IAS2 2MLKA 5HOOA 1XMAA 3HKZN 3HUGA 4XKBA 2HTJA 3LSMA 4OIQF 1TBXA 2CFOA 2X4HA 1WJEA 3JAMZ 3L2WA 1BL0A 1SD6A 2DAOA 4W1UA 2HPIA 1V4RA 1MMSA 2H6BA 1VFCA 1TNSA 1IRZA 1LDDA 1QPIA 1VQ9I 4DIQA 2VJJA 1HLVA 4LMYA 1L0OC 2P7VB 3A03A 4B4CA 1LQ1A 4Y17A 3WTUC 3GTMJ 1A04A 4ZYGA 1BI2A 4XLNF 3L1PA 5BS6A 4HV5A 4L0ZB 5F0HA 1ZRFA 3S2DJ 1BOAA 1U6GA 2KZGA 1XMXA 2R93J 2XHKA 3C18A 2LSOA 2K9MA 4XSXF 3MMYB 2Z9OA 1YIOA 3ZOBA 4U7DA 1LFUP 1T2KA 1D0YA 3SYTA 3FMQA 3RPUA 2YX4A 3LA2A 4XNFA 4LLGF 4ENNA 3N4MA 2HKOA 3TOBA 2NVQJ 5HLHA 4RBOA 1W1WE 2V26A 1AU7A 1FP2A 2KDOA 3HOVJ 5LBQA 3KE2A 1FOYA 2JA2A 4G6DA 1BR2A 1WWXA 1MDMB 2NS7A 1IG7A 5KHDA 3TP3A 1LEBA 2IS6A 1OCTC 4UB6C 4Y33A 4MEXF 1KONA 5JI6A 1ORKA 3RYRA 1Y1WJ 2IJLA 1USTA 1ZGJA 2XVCA 2XV4S 1XB4A 2V9PA 3OR2C 4F7ZA 4M6VA 3J81Z 2E19A 3MZ8A 2IVMA 4GCVA 1TWCJ 2FX0A 5FFZA 2KT0A 4PJLA 1FBSA 4KIBA 4NHJA 4B43A 3P5JA 5TRDA 3K4NA 2RREA 5F64A 1Z0XA 4DGWB 1IV6A 1BJZA 2F5VA 2EQRA 2XF7A 4ESJA 4IOAF 4PZJA 2LVSA 4LB5A 1MJAA 2HVRA 3ZMVA 3E6BA 1YX5A 1Z3YA 4ITVA 5BMZA 2IA0A 3M4OJ 2EV6A 2YSRA 3O8HA 5EZGA 3J80K 1WQ2A 4HRIA 2OA4A 2JRMA 3D5SC 3GUDA 5BQTA 3FMRA 5EG0B 4OAYA 2DMNA 1FBUA 4WX9A 1S9HA 3DF8A 1ZGWA 2HQRA 2ZXIA 1MKMA 3PO2J 1EKEA 4MTDA 1XSDA 3BTIA 3CUQC 4JOMA 2HEOA 3M1EA 3KP2A 3H9GA 3GTQJ 2E7XA 1ZHFA 1S7EA 2L0KA 4RAYA 2E34A 1W36C 2DA3A 3VSKA 2W57A 2M30A 4RAFA 2K7LA 2Z2SB 4ENJA 4AIHA 1X2NA 1ON2A 4BYYA 1QBJA 2ZB9A 3DBHB 1RKTA 3PIOF 3OSFA 4BGDA 1LJ9A 2KMUA 3DPLC 3SFIA 2OUMA 5D5UB 2LRDA 2DN0A 3O3KA 4CH7A 4ANJA 2H94A 4II3A 3PM1A 1JUMA 3V8LA 4XM3A 1D1BA 2LNBA 1R6RA 5JVGF 2QM3A 3AKZA 2LF7A 1U9NA 1XMKA 4E7SA 3LNQA 1IUFA 1LNWA 3F21A 1FY7A 5JHFA 3ZQGA 1KU3A 1YW7A 3KEYA 1IDYA 3RIRA 3V42A 2Y9YA 5FLVA 4L9NA 5J1UA 2DMTA 5C44J 1HW5A 2EIKH 3MQ0A 3Q0VA 4AYBN 4HDVA 2LY2A 5BPDA 2QQBA 2MH2A 4IHXA 2BW3A 2IP2A 3BJOA 2BY1A 2VQGA 2X6XA 4ETSA 4FX0A 3M7GA 2EZKA 3JTHA 2HTSA 1R4NB 3W3CA 3H35A 2VBWA 3PSFA 3ECHA 3NRVA 1MH3A 4RGSA 2NOJB 4ASNA 2LD5A 3LSHA 1XGSA 4BQQA 3HSEA 4A3GJ 4IF4A 3BJ6A 1SFEA 5CVVA 4J00A 1D0ZA 2A07F 1V5EA 1D3YA 3HZJA 1IN7A 1KYWA 2NAZA 2YPRA 2X51A 4MQVA 5AONA 1TWHJ 2P81A 2AHQA 1WKMA 2FQ3A 1QZEA 5GADJ 1KU7A 2XDVA 3ABTA 2VBXA 2VODA 2P5LC 2ELKA 4D5CA 1U9OA 2DA7A 4MEYF 3U1DA 4DQ2A 2RC4A 3OYMA 4XMYA 2LC2A 5D4RA 4YIIA 4L18B 1K4SA 4IJAA 3HPHA 2DFFA 2VN2A 2CQKA 2KJBA 4M73A 4BBSJ 1P4XA 2XAUA 3DKWA 2W85A 4XOTA 3ECOA 2ZMEA 2NNNA 1VQ4I 5FKNA 1FIAA 1WCMJ 5F0CA 5FLMJ 1I1SA 4Z2YA 5LHHA 4YELA 2W4SA 1FLIA 3DCFA 2CRGA 1XX5A 3RCOA 3O8GA 2QVOA 3MCZA 2A5WA 3PNVA 1MBHA 1UG0A 2E1NA 2O5RA 1WI3A 2VPLA 1POGA 1ENHA 1CF7A 2Y0SN 3S2WA 2IPQX 1V3FA 1W7PA 3OYLA 2VKEA 4YFKF 4IL6C 2F5FA 4HX8A 2CWEA 3TEDA 4XBFA 2FRHA 4JBAA 2M87A 5IYBJ 4A0ZA 2R5YA 1E3OC 3AAFA 3P7NA 1UAAA 1DDNA 3AL0C 3S17J 3FXJA 4IRGA 3IH2A 3IWFA 1S7AA 2Q2EA 2X1EA 2EV5A 3CC7I 5B5EC 2EWNA 4QLCU 4YRVA 2L5QA 3A02A 3M8FA 2XF6A 5DDGA 2DMUA 4I76A 3BR1A 2QQ9A 3BZ6A 1Z7LA 3KZYA 4BAYA 2EA2A 4A3CJ 3SDBA 5D6EA 5D8KB 3BP8A 5L3GA 2ESNA 3H0DA 4M3BA 3GO5A 2DTZA 4A3MJ 1TQPA 4BHBA 2DQRA 1V54H 1F36A 1S3JA 4N0BA 3LQRA 4N9IA 5ILSA 1RPWA 4RGRA 4OIRF 3I71A 4EVIA 3LSGA 1HKSA 4BBRJ 1KGSA 1U8BA 1A35A 4WK8F 1HW2A 2Q1ZB 4BH9A 3ZXSA 1HSTA 4U88A 4LITA 1SFOJ 1ZG3A 4BEHB 1IC8A 2TDXA 1YO5C 2EA4A 1H8AC 1R5GA 2E1MC 4ESBA 2WAQN 3AG3H 3OMYA 4HNTA 2BEOA 3FKIJ 4FISA 1WRJA 5E18F 3M3YJ 3HOYJ 3CJNA 2HOTA 1TC3C 1J5YA 3EUHC 1XSVA 2BY0A 2JA6J 2VJIA 2JJ7A 1H9TA 3E7LA 4QTRA 3CF5F 3S1QJ 3TO9A 3C2GA 2DFEA 2L9NA 3SQNA 4PK4A 1QZYA 2X9DA 1HKQA 3GFJA 3QP6A 3C2BA 5D8LB 3MAJA 1PP7U 1HC8A 3ESWB 3ERMA 3I0TA 5B3SH 4MNUA 1ZTRA 1VQOI 1YLFA 3K4KA 1Y8QB 3BTLA 1OKRA 3WHBA 3FXOA 3S3MA 4BHCA 2KRFA 3F0CA 2D1HA 4MLOA 5M5WJ 2FNAA 4JX6A 5F0FA 1JKQC 2PN6A 1B8IB 2L7KA 1E2XA 3SEQA 3DEWA 1DPUA 1S72I 1Z9CA 3CCQI 1BC8C 2TCTA 3VSLA 2WV0A 4F3QA 2LG4A 1ZH5A 2Y69H 4RAGA 3W2VA 4XONA 3L7WA 1HA8A 3I59A 4I0AA 4A6EA 2X85A 3BCAA 2HQ5A 3OYKA 1BM9A 2PFBA 1IRFA 5HDGA 4F55A 2DTRA 4AVZA 4O5VA 2BHYA 2GZWA 4EMSA 1HF0A 2W00A 1XGNA 1Z91A 1JI8A 2UV1A 1P9QC 3AFHA 4KIGA 4Q4ZF 2NVUB 1ON1A 1JXSA 3FIWA 3TBIA 5LEKA 1YJ9I 3TL4X 2WC2A 5FLXK 2RN7A 1R00A 1ZRDA 3W2AA 5E79C 2PI0A 3LSKA 3OIPA 6PAXA 4IVNA 3WODF 1OJLA 2CQXA 4I98B 2E7WA 4KYWA 2X6WA 4AWXB 3PNYA 3KZIC 3QP5A 3JRFA 1N78A 1G3TA 1JT6A 3RZDJ 2I5UA 2M3AA 2P5VA 1YIJI 3ASNH 5GAHJ 2JPCA 4HOBA 4XLFA 2UXNA 1I50J 1SFKA 3U9GA 1B9MA 1WH5A 2YU3A 3BR6A 2EV0A 2DA1A 2KP6A 3QOPA 1QA6A 2IS2A 4NB5A 2R4GA 5E8GA 2OZUA 2DT6A 5GPAA 3EUKL 4KJZA 2PMZN 3CCMI 3FWEA 2Z1DA 4B8XA 4LIUA 4M9XA 5JFRA 2GXAA 2VL8A 3IP4B 4Q5SF 4TV7A 1P7IA 2JUCA 2RGVA 3N05A 4DZJA 3COAC 2B9SA 4I2OA 5BNGA 3J80Z 4P5OA 2J5OA 3DPUA 2KQRA 1JKPC 2LKSA 1RC9A 1JJ8C 2M2EA 2WY7Q 1G3SA 4UVCA 1G2HA 1Z1DA 1OYIA 3FK7A 1QQIA 2L54A 2OTLI 2OU2A 2XRNA 2V7FA 2IS4A 2COBA 1IN5A 2RKHA 2Y9ZA 1RUOA 2XKOA 2CFXA 3A4CA 5J47A 1MBEA 2XAFA 2FMYA 4CCMA 2COMA 1PUEE 2R7VA 4ZDLA 3DPTA 4M9ZA 4UY8I 5KNLA 2WTEA 4P9UA 3WE3A 2K9QA 1WPKA 3OY9A 4B3XA 3EDPA 3VYTB 4LIVA 2W25A 2M1BA 4AIDA 3H3VK 3ISPA 5K7HA 3DP7A 2NS8A 2JTVA 2V1UA 4AD9A 1FOXA 1AA7A 3TGNA 4U0VA 3JRGA 2E35A 3K10A 2NNYA 4UV8A 5CQEA 3IL2A 4NQWA 1G3YA 4UV9A 3CD6I 2KL4A 4HPQA 1ULYA 4CSWA 2L02A 4N4NB 5E3LA 5HNHA 3RZOJ 1MBJA 4PGHA 3V7RA 4RMNA 1GLNA 5H2FC 2M8GX 2A61A 3HSFA 3QYEA 1J0RA 5EZHA 1BA5A 3ELKA 4CO8A 2HGCA 2XASA 4KA4A 4XK4A 1GHCA 4ZTFA 1HKTA 3ZQCA 1B59A 3EYYA 3BQZA 3H3UA 2QWWA 5LGUA 1S8NA 2WA0A 2EIJH 4XQFA 1DGRM 2C6YA 1MGTA 4IQ4A 4OMZA 3FHZA 1D8KA 3X2QH 1FMWA 3LQQA 2LBFB 5IP9J 2WB1N 5HS8A 5ERIA 2EFQA 5GPCA 2BVLA 3KPHA 3HC7A 5FKOA 1JGGA 4IHSA 4F52A 3WU1B 4HLYA 3ABUA 2BV6A 3FM3A 3KIOA 4FE7A 5F04A 3DU5A 9ANTA 1H89C 2TRTA 1T0FC 4I7HA 1AHDP 5J6XA 4GDFA 4PGGA 3S14J 1OPCA 4RAZA 4G7OF 3QQAA 5DCFA 1Z3XA 2AO9A 3RYPA 1UELB 3SZPA 1XC5A 4U0YA 2KKOA 3IAM2 2X0LA 4KDPA 4RGUA 2NOGA 2ME6A 2ISYA 3LAPA 2JQ7A 1Z7UA 3HOTA 2VQCA 4CZZA 4PCQA 3E6DA 1UHWA 5EEAA 5KCMA 5C3EJ 3DTEA 4HF2A 1Y6IA 2CW7A 3GLLA 1ETXA 2AQEA 3ZQFA 1WJ5A 2NVTJ 4D9JA 2ZSHB 2DXIA 3QPHA 5FD6A 1B72B 2LFBA 1JKRC 4MTEA 3L2RA 1NG6A 3L09A 3G6EI 1IXCA 2BZTA 1AWCA 3BPVA 3KEQA 5CVUA 3KYDB 4UUSB 3E5UA 3A01B 1OMIA 1IN6A 1UMQA 1S5LC 1WJAA 4KIFA 2CQQA 1OCZH 5ED4A 1HXDA 1REPC 1Z77A 1TT5B 2L01A 1NHAA 4EJVA 3OL3A 2H8WA 5CVJA 2O3FA 3L2VA 1SVMA 2WAEA 1W5TA 1FYLA 2XAGA 3OIQA 3P9IA 3GX4X 1IN8A 1SD7A 3DV8A 1FYKA 4CCLA 1W0TA 3VDXA 3KP7A 1USSA 1YW8A 2X1CA 2V1NA 3IKTA 1T33A 3E1SA 3TO7A 1BIAA 3FKJA 2QSGX 1K61A 4GGGA 2DFIA 2FUG2 4PFOA 4L0YB 3R61A 1ZK8A 2OQGA 1WSUA 2R92J 1YS7A 1X3WB 1Y56A 2DDAA 3LA7A 1R9TJ 1BW5A 3EUAA 1A5JA 3LOCA 2LK2A 3U21A 3CC4I 2EB7A 2KHMA 3CUQA 1ETOA 2QUFA 4L5IA 4MFEA 3F72A 3TP0A 3GBGA 1YITI 2V6CA 1R4MB 3OS2A 3HUGB 4Z6YA 4OWRB 1OQYA 5KAFC 4PJMA 3LWFA 5IOZA 2R7SA 2KFDA 4G94A 4PSXA 5L3FA 1JJ6C 1R49A 1D5YA 1UG2A 3MVPA 2EFNA 4UVAA 3PFIA 2EIMH 4HSRA 2A6HF 4BY1J 2P0WA 2KISA 3ABMH 4ZZLA 4AIJA 4A93J 3Q5FA 1TP4A 1KQ0A 4JP0A 1U8RA 3F6OA 3HSRA 2JMWA 2W48A 1YFHA 1O3RA 1LKXA 1ZELA 4GXOA 2R7RA 2O9LA 2QLZA 5FROA 3V8KA 2M7AA 1V5GA 2M8EA 2R5ZA 1O57A 2QQ8A 2B7EA 4HEA2 5D6FA 4CHUA 5E3NA 2DDBA 5L3DA 2OJED 1VQMI 1FPQA 4XIDA 2A6TA 1FJLA 3SEZA 4AC0A 5HDNA 4BE0A 1DU6A 4BKXA 3IRRA 2O8KA 4D1QA 3PJRA 3KCCA 2DK8A 2NXNB 1D8JA 1GVJA 1RZ4A 2EZHA 2NYXA 2M7BA 4UUTA 3F8FA 4IKFA 4Y3OA 1MDMA 4BU2A 4CCKA 4OIOF 1BIBA 3VWBA 1IZ1A 3BR5A 1SD5A 2GQQA 1XS9A 1YTYA 4ZDPA 1HW1A 2KPMA 2MBFA 2FBKA 2LYCA 3HB9A 2BXZA 4OU0A 1W5SA 4HQMA 4AM3A 2LY9A 1AKHA 3FDYA 2K4BA 1OLTA 1KU9A 1Y0UA 5B66C 2ID6A 1ETQA 2YR2A 3GMEA 4WXHA 4KISA 4X0GA 3P9CA 3FXKA 3OYHA 3FX3A 3GEZA 5HS9A 1E17A 2JA7J 2ECBA 4RLFA 3JRCA 5LLQA 3D1NI 4U7BA 5HODA 3HRUA 3KYCB 4GO1A 3A0HC 3MFKA 1R5ID 3E0JB 3TQNA 3D5LA 1W7PD 3GF2A 1DQUA 4KMUX 5IPAA 3BC8A 3ZMDA 5JLWA 3LAJA 2FBIA 1MJ9A 3PIPF 5EDNA 4L5JA 1ZYRF 1W0UA 3G2BA 4HA8A 2M0CA 1MSEC 1ZAOA 4A3LJ 3VYRB 2ZCWA 2R7WA 1TWAJ 1EF4A 5EG0A 2RVCA 4XKVA 5FLXZ 2LLKA 1O3QA 1VI0A 3WTZA 5DUKA 5KVRA 3QWLA 1I3QJ 4CCJA 3J7AY 5LGNA 4XICA 2JZYA 1FEXA 1Z6TA 2ELHA 4M3EA 4BJ5C 2XPVA 4LLLA 5IP6A 3MD2A 2VJ4A 1X1DA 4EM0B 1EH7A 3ABKH 3WE2A 1SEUA 2Q0OA 3A2KA 1ERDA 1QZZA 3TDZC 4LOCA 2AXTC 2YUSA 4M3FA 1JTYA 1SAUA 1XPXA 1IF1A 4RM2A 1VQNI 1HOMA 4HG2A 4V2GA 3HOZJ 2EINH 2WY8Q 1GDTA 4CXFA 1GXPA 2H6CA 4FT8A 1P4AA 3JRBA 1F9NA 3FBIB 4K2EA 3ZMTA 2E1OA 4ENKA 2WV1A 3KP6A 1TWFJ 4WXCA 5M5YJ 2LMDA 1WJFA 2FE3A 1FYMA 1TTYA 3J7ZI 4EGZA 1MMDA 2R3SA 3WTXC 1Y8RB 3G3ZA 4ZYAA 4IX7A 5L3BA 3DKXA 3M8EA 5K1YA 5K5QA 3FXRA 4A5MA 3MN2A 5EF6A 1QVTA 2BW3B 2G7UA 2EFOA 2HQNA 4D7NA 4MHGA 3VYUB 3CCRI 3RQIA 1K78A 2H27A 3WGGA 3R0JA 1BI1A 4PJJA 3OYCA 3I9V2 5KK1A 5DTDA 4YIFA 2VQHA 3CO7C 3PNTA 2KJCA 4I6ZA 2OF7A 4B44A 4RS8A 1SMYF 1P4WA 2KDZA 4A3IJ 3EQLF 3ZQQA 2DMQA 4Y4RA 3ZMSA 2XC7A 2BYVE 3F6VA 2EZLA 4BUPA 1JHFA 1M1EB 1PYVA 1J2XA 1XTAA 4E70A 1E0EA 2QBYA 4HV6A 3I56I 5HS7A 1K7AA 5J40A 2BXYA 4PUSA 3EUHA 1VQKI 2RQPA 2DYRH 2DYSH 2BBYA 3BLYA 1R7JA 1YG2A 5DD4A 2ZFUA 1HDDC 1K6YA 2DO7A 2RAEA 3LL7A 2DOAA 5DD8A 3IC7A 3ZPLA 2CYYA 2ZMEB 2HYFA 2CUJA 3HJEA 4U0WA 4B47A 2G7HA 1U5TA 3CMYA 3MEXA 2OC6A 2WBMA 1I6XA 4OOIA 2KLOA 1FSHA 1X19A 3SDGA 2VLAA 4LGWA 3UKGA 2IXSA 3IKVA 4IOCF 2FBHA 2DA5A 1ZN2A 3H5AA 5D4SA 4HX7A 3CZ6A 4AU7A 4HDUA 2QA4I 4CGZA 1VF9A 2M5WA 3CCYA 1CF7B 4BXUA 5ICCA 1IUYA 5IOYA 3LA3A 3CDHA 1W7PB 4EGYA 3JRHA 2M9HA 1H0MA 3K4JA 1K79A 2VXDA 2UUZA 2IEKA 1UHSA 2M34A 4BJ6C 3HYIA 2VPRA 4FASD 2ZJPF 4O3MA 1HDPA 1T95A 3IH3A 2W84A 4DOZA 2CQ7A 3FISA 4I09A 3HEFA 4FETA 4RA2A 5ICFA 2R5YB 2HYGD 3PFYA 1D1AA 3KFWX 3HXLA 3KZZA 4KMFA 1X3UA 2Q2EB 5IYDJ 4DBRA 3TW6A 2K27A 4XN0A 2EJRA 1JUPA 1U2WA 3FF5A 1IGNA 2O8XA 2V79A 1TQMA 2Y48A 4HBLA 2JA5J 2G0EA 3K0LA 2LDUA 1KU2A 4A3BJ 3K4LA 2RNJA 3DU6A 4Y13A 3ZQLA 5FRNA 1XD7A 1BI0A 3BZCA 1QGPA 3ZCOA 3EPZA 3OYNA 3JAMK 3K69A 1U0JA 2GXBA 3RKWA 1BN5A 1ITYA 4KT5C 2FQ4A 2L2OA 5TGTA 2DBBA 3MKYB 2Q8KA 2PJRA 1B1BA 5H20A 3NARA 5B1AH 3SZGA 4CICA 3S3NA 3PUBA 2DOFA 4FX4A 3Q0WA 3S32A 4BEHA 5HNFA 1VQ8I 4LJZF 4OAZA 3REOA 3ZMZA 2L9RA 3TOAA 2R0QC 2LY1A 2XPUA 1P6RA 4S04A 2LR8A 1YJNI 3VYSB 1MBKA 4UUVA 5EEHA 4LFUA 2QEXI 4WWCA 1AOYA 5GAGJ 2HQAA 3WG9A 1TW2A 2RDPA 4FQGA 3Q0UA 4HF0A 2FJ1A 2UXXA 5H6RA 3S15J 4RB0A 3L2UA 3FBNB 2QKMB 1BI3A 1YE9A 2B0LA 1RNLA 3TDUC 2L7ZA 4BDYA 3TW7A 1P92A 5CJ9A 1MBGA 3ZN1A 3IRQA 4S05A 2BOLA 4A69C 3LSRA 4G6TB 2DJIA 3G1OA 1VQ5I 2A05A 2LF8A 4KUMA 3E6CC 1RRJA 2ZMEC 3L00A 3H3ZA 2ZJ2A 1WJBA 2L7FP 1WVRA 3DLAA 2YU9J 5F1JA 5E20A 5J4VA 2GIVA 4X1EA 2ZFWA 1LEAA 2RQQA 4BXFA 5IY5H 4R79A 3CTAA 3H36A 4A3FJ 3HOXJ 1V5FA 2VJ5A 3C7JA 4IHVA 2DK5A 3GTOJ 2CSOA 3F8CA 4IHTA 1ZG5A 2HXIA 4BE1A 1U3EM 3OYEA 1E3HA 2VQLA 4YIRX 5E1XA 4P96A 1XGMA 3QU6A 3BR2A 4BS9A 3S93A 4IHYA 2YX7A 3U2RA 5LFAA 2VC1A 2EBIA 1VQLI 2HFHA 2DT7B 4R8HA 5KAIC 3CJRB 3DKYA 4HW0A 3OYBA 3LSPA 1J7KA 4BHPA 1ZR4A 5HLTA 3GZNB 3CJTB 1A36A 2E2IJ 2NRAC 2V1XA 3W6VA 1BR4A 2PJPA 1R71A 3ROUA 3OL4A 1K4TA 2QENA 3HM5A 4XLEA 1VNDA 3D5RC 4E7JA 4LG0B 3ULQB 1T0FA 2FXAA 3C1DA 4LB6B 4KN7X 4A3DJ 3DQVC 1TNTA 4M3DA 4BL0B 2UZKA 3GZ5A 5GAEJ 1QHGA 1R5HA 1I3AA 4QWQA 3HGYA 3KP3A 4EJWA 1R22A 5DCMA 3TMOA 2DMPA 2R7ZJ 4L5EA 4XRFA 1YRNA 3S1MJ 4HQEA 1BC7C 4M6YA 3T8RA 1G6NA 2OBPA 1TQIA 2XAHA 4QIWN 2R7TA 3ZMUA 3OYIA 1ETVA 1LFPA 4CYCA 3QODA 2PG4A 2F48A 4EM2A 1LVKA 2ELJA 3M1CA 4EJUA 1O4XA 3K9TA 2A6EF 3KEOA 4M74A 1ZLJA 2WADA 3HHHA 3ML6A 2VONA 3LFKA 2DCEA 2XSJC 4LD5A 1FX7A 2K9LA 1Q1HA 1RR7A 5ICGA 2I8DA 2PX9A 4KT6A 2JRTA 3RQ4A 1BR1A 1KYZA 2AQFA 3A1YA 1PDNC 3K2ZA 4L9TA 4C3IJ 3D0SA 1ZR2A 1PUFA 1E3PA 1MMNA 4NBQA 2LREA 5TISC 2HWVA 1UB9A 3CLOA 5AIPA 4UNOA 3H1CA 2ECCA 3DTKA 1X2MA 2IGKA 1NK3P 1X1CA 3CLQA 3TKYA 2CV0A 4C30A 5DM6F 3CP8A 3CF2A 3CO6C 2MD5A 2MW8A 3QYBA 3QPLA 3E6MA 1WI9A 3KP4A 3LSIA 3UR3C 5J1RA 4ZYEA 3F23A 4G9YA 1G3WA 3FXUA 4HNUA 4NQWB 1FIPA 2MGQA 3MZYA 4IRHA 3JR9A 2BVMA 3HKZA 4KICA 2Z5UA 3DBRB 1X4PA 2VC0A 3R6SA 1ONVA 1QPMA 5EJCA 2JSPA 4IEJA 1ZQ3P 2ZXJA 3JREA 3RPUD 5JVTA 1I5ZA 3M9AA 1IJWC 5HDKA 2HKXA 3MWMA 4N9HA 4NNJA 1LE8B 2V6EA 4CCNA 1Z21A 2K3PA 1G8XA 4MQ9F 1S29A 2ZSIB 4RLQA 4D0PA 4Y15A 5J8FA 1MIJA 2L7MP 3B6AA 4QPOA 5CYVA 1RETA 1LUJB 4NUBA 3V7CA 3RPQA 5LEJA 4LK1F 2B63J 5E3MA 2CW8A 2EK5A 1BW6A 5E3OA 1D5VA 3JCUC 1OR7C 4LLNA 2IA2A 2Y30A 3GTKJ 2ISZA 1X1AA 5E1WA 3ZN0A 1BBYA 1B4AA 2D1VA 1DU0A 5J4YA 3HHGA 2VE8A 4WCGA 4CYDA 3CCJI 2JSCA 1X3ZB 4E7HA 2HU9A 4BNCA 1D0XA 3CDIA 1ETWA 4EEFG 1IO2A 1X1BA 1O3SA 1NK2P 1XCVA 4ABZA 1DP7P 3CQZJ 1VTNC 5EGOB 2HYJA 4JYKA 1MSFC 3K70D 4HF1A 5DYMA 4CCOA 1J9IA 5ICEA 1T8IA 1T56A 2F6CA 5ILUA 1B6AA 3BQYA 3WG7H 3L2QA 2MFZA 3WU0A 3ZP5A 1NH3A 2P8TA 2EH3A 3V8JA 2EFPA 2VT2A 4I99C 5HVQC 4UUSA 2QSHX 1LDKB 2GAUA 1XDUA 2IA1A 3IHUA 2IGOA 4XOPA 3WGIA 5F6FA 1XGOA 2L9SA 3S16J 3H9JA 3OYDA 1N77A 4IZZA 2QF7A 2BHZA 4KITB 4HYEA 2Y0MA 4M72A 4PDKA 2ZXWH 5LRSA 1C0WA 1TT0A 2KIQA 4JQFA 3IV5A 1WGXA 3BG3A 4M9SA 4LG3A 4HNVA 1UZCA 3O6BB 2VI6A 1Z05A 2NVXJ 1NG7A 2FOWA 2D2WA 4DYRA 2CS3A 1APLC 2VT3A 3NWTA 3CUQB 1VQPI 1ZGAA 1QU3A 4F93B 1KZHA 1ZG1A 3HG9A 1YOVB 4XN3A 1YI2I 3HRSA 4G7ZF 2AS5F 2CV1A 4E7ZA 2LKPA 5IYCJ 3RI4A 4OIPF 3FXLA 3HBLA 1F5TA 3H5NA 2OPTA 4P55A 1PJRA 2MLGA 5HLGA 3SXYA 2DFHA 4A0YA 5FGMA 3NQOA 2DLLA 2W1OA 1Y1VJ 2X6YA 3FHNA 1ZREA 5IT9K 2W7NA 4EATA 5EYRA 1A6IA 1L3LA 2JK3A 1O7LA 2HI3A 2HZTA 4U87A 4BQAA 3CUOA 4NC7A 2JT1A 3I58A 5M3MJ 2K4JA 3GTLJ 2XPWA 1MNDA 4M71A 3L9FA 4Q47A 3ZQIA 4PFPA 1IV8A 3FM5A 2R5ZB 1ETYA 3GYHX 4AYBA 4XR6A 2XRLA 3P9KA 2O6GE 2GWRA 1DGWY 3GXOA 5IT3A 2FD5A 3SZTA 1OCCH 2HZDA 3F3XA 2H1KA 5AIQA 3L2CA 3I64A 2HVSA 1QNTA 2FMLA 4V2FA 3JW4A 4I02A 3VPRA 4I0BA 3BPXA 4XSZF 3I3LA 1GV2A 3T8TA 3J7YJ 3MKZA 5LHGA 1VQ6I 2OZ6A 1OCPA 3T0YA 2CW0F 5ILVA 3LSTA 3KETA 3WTVC 1WJCA 3B02A 1HQCA 2HOSA 3K6GA 3PL8A 3I4PA 1J75A 1O7FA 4D5FA 4P9FA 5K5OA 4X6AJ 1AKHB 3NWSA 4B48A 3WTTC 4ON0A 3CMAI 5FKMA 3JRDA 2DA2A 3I54A 2IW5A 3QU3A 3ASOH 2JN6A 2LH9A 1T38A 1JE8A 2F5DA 3EYIA 2RNGA 3MKWB 1WJDA 3FMSA 2BE5F 2P4WA 2Z33A 3TO6A 2XUBA 3PQJA 5FB2A 1O3TA 3I55I 1JT0A 3AG1H 4S0HB 2K3FA 1IAWA 2D5VA 4XKCA 4B1RA 3BR0A 1Z67A 2V9VA 3DEUA 1EV7A 3W6KB 4A6DA 1W5CC 1GUUA 2MG4A 1U78A 2CUEA 2GOXB 4EM1A 5D5WB 5EEGA 4KNYA 2Y0SA 2A3SA 1QHHD 4Y52J 3MZHA 4HZFA 1BJAA 4IRIA 2MABA 1VZ0A 3BZKA 4A5NA 3HGGA 2QZ8A 3B73A 3I4MJ 1N25A 3LFUA 2E1CA 4UVBA 3J7AO 1LFBA 4F92B 3OYAA 2MA3A 4XRMA 2XIGA 1HCRA 3AG2H 2F5CA 1OYYA 2KRHA 4H0EA 2CQNA 5A2QK 1UJ8A 1TWGJ 2HOEA 2EPFA 5CLSA 2JA8J 2MH9A 1P2FA 3FXQA 5CQGA 2W82A 3T1BA 3HL2A 3AL0B 2VXZA 4IXAA 4WF2A 2Z16A 3BG5A 2VKDA 1H88C 4JK1X 3RSNA 2IGNA 4NC8A 3DTIA 3E5XA 4II2A 4EJOA 2L4AA 3CCLI 4A3JJ 1CGPA 2QYOA 2K9SA 3H92A 1I39A 4KN4X 4J01A 3HTUA 2ACJA 1MD0A 3K2AA 2E5ZA 2K02A 1B9NA 4XRSG 4GFBA 2F4OB 3CCUI 3RKXA 1J09A 1UCRA 2EFWA 2XKPA 1I27A 4C2TA 1YQAA 2V1DA 4C2MJ 1V55H 3ERED 2R7QA 1MNMC 2VUMJ 3VODA 3BT9A 5DUIA 1F43A 3DLLF 1I6HJ 4RGXA 4FCYA 2ZC2A 1K78B 4C3JJ 1SVLA 2WAQA 3NAUA 2H8RA 1S7OA 4B09A 4N4OB 3ONQA 3G1LA 2E1MB 2ICWG 5FRMA 5E1ZB 4UB8C 1JGSA 2OTJI 1P7JA 3S3OA 3HDDA 1H9GA 4E7KA 3G1MA 3RDIA 2ZXHA 5K7FA 2QBYB 3BG9A 4EV0A 3LSJA 1STZA 4E4HA 5GTHC 4L9JA 2QGUA 2E2HJ 3RKQA 3KLNA 2ADUA 3G71I 1G4DA 1EJ9A 3SFZA 1KQ8A 2H09A 1Q1VA 2ZBKA 2DA6A 3BG7A 4V19K 1OISA 2DPUA 3DXJF 3OYFA 2ME0A 4F91B 4JX4A 2QCOA 3RKYA 3W2WA 1R1TA 3CCSI 1TZLA 5LGTA 3K70C 3GTGJ 2VKHA 3GFMA 2VBZA 2GOMA 3W6JB 1F4KA 4MO7A 2XAJA 1SC7A 3BTCA 4WXDA 1U5TB 2XROA 2QQAA 2VB6A 4GRIA 1FTZA 5H6QA 1N75A 2XAQA 4XLPF 2HPMA 2ZJRF 1K83J 3FXMA 2HDDA 3VOEA 5L3EA 3OWTA 5DM7F 2P5KA 3H5RA 4GYIA 1QVUA 4MIMA 2M0MA 1LDJA 2Z3YA 3ZRGA 3OS0A 4E7LA 5D5VB 4CA0A 1FWZA 2KIMA 1UFMA 5CVIA 2K85A 2LKXA 2ESHA 2BY3A 2FOKA 3WTSC 2K5CA 5LHIA 4UHTA 2XGXA 1CQTA 1ZLKA 1IXRC 4J19A 1LPQA 1LVAA 3OOUA 1SFUA 1WH7A 2MD0A 3OSGA 4UXNA 3S8PA 4IPAA 3JRAA 1FP1D 3Q3SA 2OCCH 2IS1A 2RV8A 2WAFA 3K1NA 4NC6A 3H9QA 1MW7A 1FSEA 3F8MA 3IUOA 3R4KA 1IRGA 1GVDA 1YS6A 2ETHA 4M6XA 1WHUA 3CMMA 2VOOA 5M5XJ 1G59A 4W97A 1RUNA 4DYCA 3E5QA 5D5XB 2L9VA
chains in the Genus database with same CATH topology
3HRTA 1W4MA 4FHTA 1XSXA 3HOSA 2ZKZA 2DT5A 3V7SA 1DPRA 3VB2A 4ZYDA 2PEXA 1XDSA 2FU4A 2NS0A 3F22A 1FBQA 3VEPA 5E8IA 1EH8A 1MZBA 2GA2A 2J5PA 4G6QA 1T39A 4O6JA 4I01A 2FA5A 3Q9VA 4LK0F 2ZNYA 3HIFA 2HS5A 3FZVA 3V4GA 4A12A 2STTA 4ENMA 1SMTA 5TJJA 4ZH4F 2WWYA 1SD4A 3OOPA 4GYGA 5K5RA 3BJAA 1R58A 1KA8A 3R60A 3SHFA 2L4MA 1PP8F 2OAZA 2PMHA 1J59A 2A69F 4OINF 3J81K 3K1PA 1YYVA 4HX4A 5IT9Z 1U5TC 1FNNA 1I1GA 3ZQ7A 2JPBA 2F2EA 3F8NA 1TW3A 3I59B 3I5UA 4R1HA 1FZPB 5JR3A 3I53A 3RTRA 5DEQA 3GZ6A 2CO5A 5CVRA 4CDGA 1Z6RA 1FOKA 3VFZA 3Q9SA 2R7DA 5LRRA 3DFGA 4G7HF 2AXLA 1RI7A 1R1UA 3K1MA 1UHMA 2STWA 5BOXA 1LB2A 3QPTA 3BY6A 2ZO4A 1IN4A 2DI3A 3BDDA 4Q48A 3T5XA 1OR7A 5DV5A 2A5YB 3GLXA 2O61A 1R1VA 4LG0A 4A2UA 3GFLA 1ODDA 5DCMB 1KQ9A 4HAMA 5BPIA 1S6LA 2CGPA 1YW9A 1HSJA 3QAHA 1FT9A 5FFXA 1EH6A 1SAXA 4EJTA 2PBIA 2W24A 4RB3C 1ZRCA 2HDCA 2MC3A 4HLXA 2DPDA 1K6OA 2FEZA 3RJPA 2P6TA 3NEUA 4ZZDA 3IWZA 4ESFA 3E3VA 1IXSB 2GXGA 1F1ZA 1FC3A 5A2QZ 3N97A 4OMYA 4AIKA 3GWZA 3HRMA 2ZNZA 2CG4A 1DUXC 2O0YA 2KIUA 3WGHA 2Y75A 3KLOA 3JSOA 5L3CA 3QRFF 3JTGA 5FO5A 1GXQA 2FF4A 1TLHB 3BWGA 2D45A 2IRFG 2OD5A 2O03A 1HBXG 2OQRA 1XCBA 3BROA 3F8BA 2P7CB 4EQQA 2BGCA 1XN7A 2HR3A 3R0AA 2M45A 2PMUA 5F1RA 3WTWC 3GVAA 4RB1A 3WTYC 1RIOH 5E17F 2DW4A 2VBYA 4KFCA 1T98A 5JHUA 2P6SA 2A68F 1OYWA 2GA1A 4G8XA 4YG2F 3BOQA 2PQ8A 2PLYA 2Z99A 1MJBA 3GFIA 2VE9A 3E97A 4YFNF 3O2PE 4ZYHA 2K86A 3G73A 3PQKA 2DQLA 2F5EA 1ZARA 4MGRA 5J8CA 3JSPA 2UWMA 2FNPA 4A0XA 1R23A 3C3WA 5HLIA 3KP5A 3HTSB 4AVPA 1T6SA 3OV8A 4RB2C 3GW2A 4YFXF 1QO0D 2IT0A 2G9WA 2VOPA 2DU9A 5FD5A 2FSWA 1IW7F 1SFXA 1R36A 2R7FA 4L9VA 2L3DA 4DNCA 3EETA 1JHHA 2KIFA 2MLKA 5HOOA 1XMAA 3HUGA 2HTJA 4OIQF 1TBXA 2X4HA 3JAMZ 1SD6A 2DAOA 1V4RA 2H6BA 1TNSA 1LDDA 4LMYA 1L0OC 2P7VB 1LQ1A 4Y17A 3WTUC 1A04A 4ZYGA 1BI2A 4XLNF 5BS6A 4HV5A 4L0ZB 1ZRFA 1BOAA 1U6GA 2XHKA 3C18A 2LSOA 4XSXF 2Z9OA 1YIOA 4U7DA 1T2KA 3FMQA 3RPUA 2YX4A 3LA2A 4LLGF 4ENNA 3N4MA 2HKOA 3TOBA 5HLHA 1FP2A 5LBQA 3KE2A 4G6DA 1WWXA 1MDMB 1LEBA 4MEXF 5JI6A 3RYRA 2IJLA 1USTA 1ZGJA 2XVCA 2XV4S 1XB4A 4F7ZA 3J81Z 2IVMA 4GCVA 5FFZA 1FBSA 4KIBA 4NHJA 5TRDA 5F64A 4ESJA 4PZJA 4LB5A 1MJAA 3ZMVA 3E6BA 5BMZA 2IA0A 2EV6A 2YSRA 3J80K 1WQ2A 2OA4A 3GUDA 5BQTA 3FMRA 4WX9A 1FBUA 3DF8A 2HQRA 1MKMA 4MTDA 1XSDA 3CUQC 2HEOA 3M1EA 3KP2A 2E7XA 1ZHFA 4RAYA 2W57A 2M30A 2K7LA 4ENJA 4AIHA 1ON2A 4BYYA 1QBJA 1LJ9A 3DPLC 5D5UB 3O3KA 2H94A 3V8LA 2LNBA 2QM3A 2LF7A 1XMKA 1LNWA 3F21A 1FY7A 1KU3A 1YW7A 3RIRA 4L9NA 1HW5A 3MQ0A 5BPDA 4HDVA 2QQBA 2MH2A 2IP2A 3BJOA 4ETSA 4FX0A 3M7GA 3JTHA 2HTSA 2VBWA 3ECHA 3NRVA 4RGSA 4ASNA 1XGSA 3HSEA 4IF4A 3BJ6A 1SFEA 5CVVA 2A07F 1D3YA 1IN7A 1KYWA 2NAZA 2YPRA 4MQVA 5AONA 1WKMA 2FQ3A 1KU7A 3ABTA 2VBXA 2VODA 2P5LC 4MEYF 4DQ2A 3U1DA 2RC4A 5D4RA 4YIIA 4L18B 4IJAA 2VN2A 2CQKA 2KJBA 4M73A 1P4XA 3DKWA 2W85A 3ECOA 2ZMEA 2NNNA 1I1SA 4Z2YA 5LHHA 1FLIA 2QVOA 3MCZA 2E1NA 1CF7A 3S2WA 2IPQX 1V3FA 1W7PA 4YFKF 2F5FA 4HX8A 2CWEA 4XBFA 2FRHA 4JBAA 2M87A 4A0ZA 3AAFA 3P7NA 1DDNA 4IRGA 3IWFA 1S7AA 2Q2EA 2EV5A 2EWNA 4QLCU 3M8FA 5DDGA 2QQ9A 3BZ6A 3KZYA 4BAYA 2EA2A 5L3GA 5D6EA 5D8KB 3BP8A 2ESNA 3GO5A 1TQPA 4BHBA 2DQRA 1S3JA 4N0BA 3LQRA 4N9IA 5ILSA 4RGRA 4OIRF 3I71A 4EVIA 1HKSA 1KGSA 4WK8F 1HW2A 4BH9A 1HSTA 4U88A 1ZG3A 2TDXA 1YO5C 2EA4A 1R5GA 4ESBA 2BEOA 1WRJA 5E18F 3CJNA 1J5YA 1XSVA 1H9TA 3TO9A 3SQNA 1QZYA 3GFJA 1HKQA 3QP6A 5D8LB 1PP7U 3MAJA 3I0TA 4MNUA 1YLFA 1OKRA 4BHCA 2KRFA 2D1HA 2FNAA 2PN6A 1E2XA 1DPUA 1Z9CA 1BC8C 2WV0A 1ZH5A 3L7WA 3I59A 4I0AA 4A6EA 1BM9A 2PFBA 1IRFA 5HDGA 2DTRA 4O5VA 2GZWA 4EMSA 1XGNA 1Z91A 4KIGA 4Q4ZF 1ON1A 1JXSA 5LEKA 2WC2A 5FLXK 2RN7A 1R00A 1ZRDA 2PI0A 6PAXA 4IVNA 3WODF 4I98B 2E7WA 4KYWA 4AWXB 3QP5A 1G3TA 2P5VA 2JPCA 4HOBA 2UXNA 3U9GA 1B9MA 2YU3A 2EV0A 3QOPA 4NB5A 5E8GA 2OZUA 3FWEA 4B8XA 4M9XA 5JFRA 4Q5SF 4TV7A 3COAC 2RGVA 4I2OA 3J80Z 4P5OA 2J5OA 1G3SA 4UVCA 1Z1DA 1OYIA 1QQIA 2L54A 2OU2A 2XRNA 1IN5A 2RKHA 1RUOA 2XKOA 2CFXA 2XAFA 2FMYA 2COMA 1PUEE 3DPTA 4M9ZA 2WTEA 4P9UA 3WE3A 3EDPA 2W25A 2M1BA 3ISPA 3DP7A 2JTVA 2V1UA 4AD9A 3TGNA 4U0VA 2NNYA 4UV8A 3IL2A 4NQWA 1G3YA 4UV9A 1ULYA 2L02A 4PGHA 3V7RA 2A61A 3HSFA 1J0RA 3ELKA 4CO8A 2HGCA 2XASA 4KA4A 1GHCA 1HKTA 1B59A 3EYYA 3H3UA 2QWWA 5LGUA 1S8NA 2C6YA 1MGTA 4OMZA 3FHZA 1D8KA 3LQQA 5HS8A 5ERIA 2EFQA 4IHSA 3WU1B 4HLYA 3ABUA 2BV6A 3FM3A 4I7HA 5J6XA 4PGGA 4G7OF 1OPCA 4RAZA 5DCFA 3RYPA 3SZPA 4U0YA 2KKOA 2X0LA 4KDPA 4RGUA 2ISYA 3LAPA 1Z7UA 3HOTA 4CZZA 4PCQA 3E6DA 1UHWA 4HF2A 3QPHA 5FD6A 4MTEA 3L09A 1IXCA 1AWCA 3BPVA 3KEQA 5CVUA 3E5UA 1OMIA 1IN6A 4KIFA 5ED4A 1HXDA 1REPC 2L01A 1NHAA 4EJVA 5CVJA 2O3FA 1W5TA 1FYLA 2XAGA 3P9IA 3GX4X 1IN8A 1SD7A 3DV8A 1FYKA 3KP7A 1USSA 1YW8A 3IKTA 3TO7A 1BIAA 4GGGA 2DFIA 4L0YB 3R61A 2OQGA 1WSUA 1YS7A 3LA7A 2EB7A 3CUQA 2QUFA 4L5IA 3F72A 2V6CA 3LWFA 4G94A 5L3FA 2EFNA 4UVAA 3PFIA 2A6HF 4ZZLA 4AIJA 3Q5FA 1KQ0A 1U8RA 3F6OA 3HSRA 1YFHA 1O3RA 4GXOA 2QLZA 3V8KA 2M8EA 1O57A 5D6FA 4CHUA 5L3DA 1FPQA 5HDNA 3IRRA 3KCCA 2DK8A 1D8JA 1GVJA 1RZ4A 2NYXA 3F8FA 1MDMA 4OIOF 1BIBA 1IZ1A 1SD5A 2GQQA 1YTYA 1HW1A 2MBFA 2FBKA 4OU0A 1W5SA 4HQMA 2K4BA 1KU9A 1Y0UA 2YR2A 4WXHA 3P9CA 3FX3A 3GEZA 5HS9A 1E17A 5LLQA 4U7BA 3HRUA 4GO1A 3MFKA 3TQNA 3D5LA 1W7PD 3GF2A 4KMUX 3ZMDA 3LAJA 2FBIA 1MJ9A 4L5JA 1ZYRF 4HA8A 1ZAOA 2ZCWA 2RVCA 5FLXZ 1O3QA 3WTZA 5DUKA 5KVRA 5LGNA 2JZYA 1Z6TA 2ELHA 4LLLA 4EM0B 1EH7A 3WE2A 2Q0OA 1QZZA 3TDZC 1IF1A 4CXFA 1GXPA 2H6CA 4FT8A 1P4AA 1F9NA 4K2EA 3ZMTA 4ENKA 3KP6A 4WXCA 2FE3A 1FYMA 1TTYA 4EGZA 2R3SA 3WTXC 3G3ZA 5L3BA 3M8EA 5K1YA 5K5QA 3FXRA 4A5MA 2G7UA 2EFOA 2HQNA 4MHGA 1K78A 2H27A 3WGGA 3R0JA 1BI1A 5KK1A 4YIFA 3CO7C 2KJCA 4RS8A 1SMYF 1P4WA 3EQLF 3ZMSA 2BYVE 3F6VA 1JHFA 1J2XA 4E70A 2QBYA 4HV6A 1K7AA 5HS7A 3EUHA 2RQPA 2BBYA 1R7JA 1YG2A 5DD4A 2DO7A 5DD8A 3IC7A 3ZPLA 2CYYA 2ZMEB 2HYFA 4U0WA 2G7HA 1U5TA 3MEXA 1I6XA 4OOIA 1FSHA 4LGWA 3IKVA 2FBHA 1ZN2A 5D4SA 4HX7A 4HDUA 4CGZA 2M5WA 1CF7B 4BXUA 5ICCA 1IUYA 3LA3A 3CDHA 1W7PB 4EGYA 1H0MA 1K79A 3HYIA 4O3MA 2W84A 4I09A 5ICFA 2HYGD 3KFWX 3KZZA 4KMFA 1X3UA 2K27A 2EJRA 1U2WA 3FF5A 2O8XA 2V79A 1TQMA 2Y48A 4HBLA 3K0LA 2LDUA 1KU2A 2RNJA 4Y13A 1XD7A 1BI0A 1QGPA 3JAMK 3K69A 2GXBA 3RKWA 1BN5A 4KT5C 2DBBA 2Q8KA 1B1BA 5H20A 4CICA 4FX4A 4LJZF 3REOA 3ZMZA 3TOAA 1P6RA 4S04A 4UUVA 5EEHA 4LFUA 4WWCA 1AOYA 3WG9A 1TW2A 2RDPA 4HF0A 5H6RA 2UXXA 4RB0A 1BI3A 2B0LA 1RNLA 3TDUC 1P92A 5CJ9A 3ZN1A 3IRQA 4S05A 2LF8A 4KUMA 3E6CC 3L00A 3H3ZA 2ZJ2A 5E20A 2GIVA 2ZFWA 1LEAA 4R79A 3CTAA 3C7JA 2DK5A 2CSOA 3F8CA 4IHTA 1ZG5A 1U3EM 5E1XA 4P96A 1XGMA 3QU6A 2YX7A 3U2RA 2VC1A 2HFHA 4R8HA 4HW0A 1J7KA 4BHPA 2NRAC 2PJPA 2V1XA 3ROUA 2QENA 4LG0B 3ULQB 1T0FA 2FXAA 3C1DA 4LB6B 4KN7X 3DQVC 1TNTA 2UZKA 3GZ5A 1R5HA 4QWQA 3KP3A 4EJWA 1R22A 5DCMA 4XRFA 4HQEA 1BC7C 4M6YA 3T8RA 1G6NA 2OBPA 1TQIA 2XAHA 3ZMUA 2PG4A 4EM2A 4EJUA 3K9TA 2A6EF 3KEOA 4M74A 1ZLJA 3HHHA 3ML6A 2VONA 3LFKA 4LD5A 1FX7A 1Q1HA 5ICGA 2JRTA 1KYZA 1PDNC 3K2ZA 4L9TA 3D0SA 2HWVA 1UB9A 3CLOA 5AIPA 4UNOA 3TKYA 3CO6C 2MD5A 3E6MA 1WI9A 3KP4A 3F23A 4ZYEA 4G9YA 1G3WA 3FXUA 3MZYA 4IRHA 4KICA 2Z5UA 3R6SA 2VC0A 1ONVA 1QPMA 2ZXJA 5JVTA 1I5ZA 3M9AA 5HDKA 2HKXA 3MWMA 4N9HA 4MQ9F 1S29A 4D0PA 4Y15A 5J8FA 5CYVA 3V7CA 3RPQA 5LEJA 4LK1F 2EK5A 1D5VA 4LLNA 2IA2A 2ISZA 5E1WA 3ZN0A 1BBYA 1B4AA 2D1VA 3HHGA 2VE8A 4WCGA 4CYDA 2JSCA 4BNCA 1O3SA 1XCVA 1DP7P 1VTNC 4HF1A 5DYMA 1J9IA 5ICEA 5ILUA 1B6AA 3WU0A 3ZP5A 2P8TA 3V8JA 2EFPA 2VT2A 5HVQC 1LDKB 2GAUA 1XDUA 2IA1A 3IHUA 3WGIA 5F6FA 1XGOA 4HYEA 2Y0MA 4M72A 4PDKA 5LRSA 1C0WA 4JQFA 4M9SA 3O6BB 1Z05A 2D2WA 2VT3A 3CUQB 1ZGAA 1ZG1A 3HRSA 4G7ZF 2AS5F 2LKPA 3RI4A 4OIPF 1F5TA 4P55A 2MLGA 5HLGA 3SXYA 4A0YA 5FGMA 3NQOA 2DLLA 1ZREA 5IT9K 1L3LA 1O7LA 2HZTA 4BQAA 3CUOA 2JT1A 3I58A 2K4JA 4M71A 3L9FA 4Q47A 3FM5A 3GYHX 3P9KA 2O6GE 2GWRA 3GXOA 5IT3A 3SZTA 3F3XA 5AIQA 3L2CA 3I64A 1QNTA 2FMLA 3JW4A 4I02A 4I0BA 3BPXA 4XSZF 3T8TA 5LHGA 2OZ6A 3T0YA 2CW0F 5ILVA 3LSTA 3KETA 3WTVC 3B02A 1HQCA 3I4PA 1J75A 1O7FA 4P9FA 5K5OA 3WTTC 4ON0A 3I54A 2IW5A 3QU3A 1T38A 1JE8A 2F5DA 3EYIA 3FMSA 2BE5F 2P4WA 2Z33A 3TO6A 2XUBA 3PQJA 5FB2A 1O3TA 1IAWA 3DEUA 2V9VA 4A6DA 1EV7A 3W6KB 1U78A 4EM1A 5D5WB 5EEGA 4KNYA 2A3SA 3MZHA 4HZFA 1BJAA 4IRIA 4A5NA 2QZ8A 3B73A 2E1CA 4UVBA 3J7AO 2MA3A 2XIGA 2F5CA 1OYYA 4H0EA 5A2QK 2HOEA 5CLSA 2MH9A 1P2FA 3FXQA 3T1BA 2VXZA 4IXAA 4WF2A 4JK1X 3E5XA 4EJOA 2L4AA 1CGPA 2QYOA 3H92A 4KN4X 3HTUA 2ACJA 1MD0A 2K02A 1B9NA 3RKXA 1UCRA 2EFWA 2XKPA 1I27A 1YQAA 2V1DA 3ERED 3VODA 5DUIA 4RGXA 1K78B 1S7OA 4B09A 5E1ZB 1JGSA 1H9GA 3RDIA 2QBYB 4EV0A 1STZA 4L9JA 3KLNA 2ADUA 1G4DA 1KQ8A 3SFZA 2H09A 2ZBKA 2DPUA 3DXJF 3RKYA 1R1TA 5LGTA 3GFMA 2VBZA 1F4KA 3W6JB 2XAJA 4WXDA 2XROA 1U5TB 2QQAA 5H6QA 2XAQA 4XLPF 3VOEA 5L3EA 2P5KA 4GYIA 1LDJA 2Z3YA 5D5VB 1FWZA 2KIMA 1UFMA 5CVIA 2ESHA 2FOKA 3WTSC 5LHIA 4UHTA 2XGXA 1ZLKA 1IXRC 1LVAA 1SFUA 4UXNA 4IPAA 1FP1D 2RV8A 3K1NA 1FSEA 3F8MA 3R4KA 1IRGA 1YS6A 2ETHA 4M6XA 2VOOA 1RUNA 3E5QA 5D5XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRT A;  1W4M A;  4FHT A;  1XSX A;  3HOS A;  2ZKZ A;  2DT5 A;  3V7S A;  1DPR A;  3VB2 A;  4ZYD A;  2PEX A;  1XDS A;  2FU4 A;  2NS0 A;  3F22 A;  1FBQ A;  3VEP A;  5E8I A;  1EH8 A;  1MZB A;  2GA2 A;  2J5P A;  4G6Q A;  1T39 A;  4O6J A;  4I01 A;  2FA5 A;  3Q9V A;  4LK0 F;  2ZNY A;  3HIF A;  2HS5 A;  3FZV A;  3V4G A;  4A12 A;  2STT A;  4ENM A;  1SMT A;  5TJJ A;  4ZH4 F;  2WWY A;  1SD4 A;  3OOP A;  4GYG A;  5K5R A;  3BJA A;  1R58 A;  1KA8 A;  3R60 A;  3SHF A;  2L4M A;  1PP8 F;  2OAZ A;  2PMH A;  1J59 A;  2A69 F;  4OIN F;  3J81 K;  3K1P A;  1YYV A;  4HX4 A;  5IT9 Z;  1U5T C;  1FNN A;  1I1G A;  3ZQ7 A;  2JPB A;  2F2E A;  3F8N A;  1TW3 A;  3I59 B;  3I5U A;  4R1H A;  1FZP B;  5JR3 A;  3I53 A;  3RTR A;  5DEQ A;  3GZ6 A;  2CO5 A;  5CVR A;  4CDG A;  1Z6R A;  1FOK A;  3VFZ A;  3Q9S A;  2R7D A;  5LRR A;  3DFG A;  4G7H F;  2AXL A;  1RI7 A;  1R1U A;  3K1M A;  1UHM A;  2STW A;  5BOX A;  1LB2 A;  3QPT A;  3BY6 A;  2ZO4 A;  1IN4 A;  2DI3 A;  3BDD A;  4Q48 A;  3T5X A;  1OR7 A;  5DV5 A;  2A5Y B;  3GLX A;  2O61 A;  1R1V A;  4LG0 A;  4A2U A;  3GFL A;  1ODD A;  5DCM B;  1KQ9 A;  4HAM A;  5BPI A;  1S6L A;  2CGP A;  1YW9 A;  1HSJ A;  3QAH A;  1FT9 A;  5FFX A;  1EH6 A;  1SAX A;  4EJT A;  2PBI A;  2W24 A;  4RB3 C;  1ZRC A;  2HDC A;  2MC3 A;  4HLX A;  2DPD A;  1K6O A;  2FEZ A;  3RJP A;  2P6T A;  3NEU A;  4ZZD A;  3IWZ A;  4ESF A;  3E3V A;  1IXS B;  2GXG A;  1F1Z A;  1FC3 A;  5A2Q Z;  3N97 A;  4OMY A;  4AIK A;  3GWZ A;  3HRM A;  2ZNZ A;  2CG4 A;  1DUX C;  2O0Y A;  2KIU A;  3WGH A;  2Y75 A;  3KLO A;  3JSO A;  5L3C A;  3QRF F;  3JTG A;  5FO5 A;  1GXQ A;  2FF4 A;  1TLH B;  3BWG A;  2D45 A;  2IRF G;  2OD5 A;  2O03 A;  1HBX G;  2OQR A;  1XCB A;  3BRO A;  3F8B A;  2P7C B;  4EQQ A;  2BGC A;  1XN7 A;  2HR3 A;  3R0A A;  2M45 A;  2PMU A;  5F1R A;  3WTW C;  3GVA A;  4RB1 A;  3WTY C;  1RIO H;  5E17 F;  2DW4 A;  2VBY A;  4KFC A;  1T98 A;  5JHU A;  2P6S A;  2A68 F;  1OYW A;  2GA1 A;  4G8X A;  4YG2 F;  3BOQ A;  2PQ8 A;  2PLY A;  2Z99 A;  1MJB A;  3GFI A;  2VE9 A;  3E97 A;  4YFN F;  3O2P E;  4ZYH A;  2K86 A;  3G73 A;  3PQK A;  2DQL A;  2F5E A;  1ZAR A;  4MGR A;  5J8C A;  3JSP A;  2UWM A;  2FNP A;  4A0X A;  1R23 A;  3C3W A;  5HLI A;  3KP5 A;  3HTS B;  4AVP A;  1T6S A;  3OV8 A;  4RB2 C;  3GW2 A;  4YFX F;  1QO0 D;  2IT0 A;  2G9W A;  2VOP A;  2DU9 A;  5FD5 A;  2FSW A;  1IW7 F;  1SFX A;  1R36 A;  2R7F A;  4L9V A;  2L3D A;  4DNC A;  3EET A;  1JHH A;  2KIF A;  2MLK A;  5HOO A;  1XMA A;  3HUG A;  2HTJ A;  4OIQ F;  1TBX A;  2X4H A;  3JAM Z;  1SD6 A;  2DAO A;  1V4R A;  2H6B A;  1TNS A;  1LDD A;  4LMY A;  1L0O C;  2P7V B;  1LQ1 A;  4Y17 A;  3WTU C;  1A04 A;  4ZYG A;  1BI2 A;  4XLN F;  5BS6 A;  4HV5 A;  4L0Z B;  1ZRF A;  1BOA A;  1U6G A;  2XHK A;  3C18 A;  2LSO A;  4XSX F;  2Z9O A;  1YIO A;  4U7D A;  1T2K A;  3FMQ A;  3RPU A;  2YX4 A;  3LA2 A;  4LLG F;  4ENN A;  3N4M A;  2HKO A;  3TOB A;  5HLH A;  1FP2 A;  5LBQ A;  3KE2 A;  4G6D A;  1WWX A;  1MDM B;  1LEB A;  4MEX F;  5JI6 A;  3RYR A;  2IJL A;  1UST A;  1ZGJ A;  2XVC A;  2XV4 S;  1XB4 A;  4F7Z A;  3J81 Z;  2IVM A;  4GCV A;  5FFZ A;  1FBS A;  4KIB A;  4NHJ A;  5TRD A;  5F64 A;  4ESJ A;  4PZJ A;  4LB5 A;  1MJA A;  3ZMV A;  3E6B A;  5BMZ A;  2IA0 A;  2EV6 A;  2YSR A;  3J80 K;  1WQ2 A;  2OA4 A;  3GUD A;  5BQT A;  3FMR A;  4WX9 A;  1FBU A;  3DF8 A;  2HQR A;  1MKM A;  4MTD A;  1XSD A;  3CUQ C;  2HEO A;  3M1E A;  3KP2 A;  2E7X A;  1ZHF A;  4RAY A;  2W57 A;  2M30 A;  2K7L A;  4ENJ A;  4AIH A;  1ON2 A;  4BYY A;  1QBJ A;  1LJ9 A;  3DPL C;  5D5U B;  3O3K A;  2H94 A;  3V8L A;  2LNB A;  2QM3 A;  2LF7 A;  1XMK A;  1LNW A;  3F21 A;  1FY7 A;  1KU3 A;  1YW7 A;  3RIR A;  4L9N A;  1HW5 A;  3MQ0 A;  5BPD A;  4HDV A;  2QQB A;  2MH2 A;  2IP2 A;  3BJO A;  4ETS A;  4FX0 A;  3M7G A;  3JTH A;  2HTS A;  2VBW A;  3ECH A;  3NRV A;  4RGS A;  4ASN A;  1XGS A;  3HSE A;  4IF4 A;  3BJ6 A;  1SFE A;  5CVV A;  2A07 F;  1D3Y A;  1IN7 A;  1KYW A;  2NAZ A;  2YPR A;  4MQV A;  5AON A;  1WKM A;  2FQ3 A;  1KU7 A;  3ABT A;  2VBX A;  2VOD A;  2P5L C;  4MEY F;  4DQ2 A;  3U1D A;  2RC4 A;  5D4R A;  4YII A;  4L18 B;  4IJA A;  2VN2 A;  2CQK A;  2KJB A;  4M73 A;  1P4X A;  3DKW A;  2W85 A;  3ECO A;  2ZME A;  2NNN A;  1I1S A;  4Z2Y A;  5LHH A;  1FLI A;  2QVO A;  3MCZ A;  2E1N A;  1CF7 A;  3S2W A;  2IPQ X;  1V3F A;  1W7P A;  4YFK F;  2F5F A;  4HX8 A;  2CWE A;  4XBF A;  2FRH A;  4JBA A;  2M87 A;  4A0Z A;  3AAF A;  3P7N A;  1DDN A;  4IRG A;  3IWF A;  1S7A A;  2Q2E A;  2EV5 A;  2EWN A;  4QLC U;  3M8F A;  5DDG A;  2QQ9 A;  3BZ6 A;  3KZY A;  4BAY A;  2EA2 A;  5L3G A;  5D6E A;  5D8K B;  3BP8 A;  2ESN A;  3GO5 A;  1TQP A;  4BHB A;  2DQR A;  1S3J A;  4N0B A;  3LQR A;  4N9I A;  5ILS A;  4RGR A;  4OIR F;  3I71 A;  4EVI A;  1HKS A;  1KGS A;  4WK8 F;  1HW2 A;  4BH9 A;  1HST A;  4U88 A;  1ZG3 A;  2TDX A;  1YO5 C;  2EA4 A;  1R5G A;  4ESB A;  2BEO A;  1WRJ A;  5E18 F;  3CJN A;  1J5Y A;  1XSV A;  1H9T A;  3TO9 A;  3SQN A;  1QZY A;  3GFJ A;  1HKQ A;  3QP6 A;  5D8L B;  1PP7 U;  3MAJ A;  3I0T A;  4MNU A;  1YLF A;  1OKR A;  4BHC A;  2KRF A;  2D1H A;  2FNA A;  2PN6 A;  1E2X A;  1DPU A;  1Z9C A;  1BC8 C;  2WV0 A;  1ZH5 A;  3L7W A;  3I59 A;  4I0A A;  4A6E A;  1BM9 A;  2PFB A;  1IRF A;  5HDG A;  2DTR A;  4O5V A;  2GZW A;  4EMS A;  1XGN A;  1Z91 A;  4KIG A;  4Q4Z F;  1ON1 A;  1JXS A;  5LEK A;  2WC2 A;  5FLX K;  2RN7 A;  1R00 A;  1ZRD A;  2PI0 A;  6PAX A;  4IVN A;  3WOD F;  4I98 B;  2E7W A;  4KYW A;  4AWX B;  3QP5 A;  1G3T A;  2P5V A;  2JPC A;  4HOB A;  2UXN A;  3U9G A;  1B9M A;  2YU3 A;  2EV0 A;  3QOP A;  4NB5 A;  5E8G A;  2OZU A;  3FWE A;  4B8X A;  4M9X A;  5JFR A;  4Q5S F;  4TV7 A;  3COA C;  2RGV A;  4I2O A;  3J80 Z;  4P5O A;  2J5O A;  1G3S A;  4UVC A;  1Z1D A;  1OYI A;  1QQI A;  2L54 A;  2OU2 A;  2XRN A;  1IN5 A;  2RKH A;  1RUO A;  2XKO A;  2CFX A;  2XAF A;  2FMY A;  2COM A;  1PUE E;  3DPT A;  4M9Z A;  2WTE A;  4P9U A;  3WE3 A;  3EDP A;  2W25 A;  2M1B A;  3ISP A;  3DP7 A;  2JTV A;  2V1U A;  4AD9 A;  3TGN A;  4U0V A;  2NNY A;  4UV8 A;  3IL2 A;  4NQW A;  1G3Y A;  4UV9 A;  1ULY A;  2L02 A;  4PGH A;  3V7R A;  2A61 A;  3HSF A;  1J0R A;  3ELK A;  4CO8 A;  2HGC A;  2XAS A;  4KA4 A;  1GHC A;  1HKT A;  1B59 A;  3EYY A;  3H3U A;  2QWW A;  5LGU A;  1S8N A;  2C6Y A;  1MGT A;  4OMZ A;  3FHZ A;  1D8K A;  3LQQ A;  5HS8 A;  5ERI A;  2EFQ A;  4IHS A;  3WU1 B;  4HLY A;  3ABU A;  2BV6 A;  3FM3 A;  4I7H A;  5J6X A;  4PGG A;  4G7O F;  1OPC A;  4RAZ A;  5DCF A;  3RYP A;  3SZP A;  4U0Y A;  2KKO A;  2X0L A;  4KDP A;  4RGU A;  2ISY A;  3LAP A;  1Z7U A;  3HOT A;  4CZZ A;  4PCQ A;  3E6D A;  1UHW A;  4HF2 A;  3QPH A;  5FD6 A;  4MTE A;  3L09 A;  1IXC A;  1AWC A;  3BPV A;  3KEQ A;  5CVU A;  3E5U A;  1OMI A;  1IN6 A;  4KIF A;  5ED4 A;  1HXD A;  1REP C;  2L01 A;  1NHA A;  4EJV A;  5CVJ A;  2O3F A;  1W5T A;  1FYL A;  2XAG A;  3P9I A;  3GX4 X;  1IN8 A;  1SD7 A;  3DV8 A;  1FYK A;  3KP7 A;  1USS A;  1YW8 A;  3IKT A;  3TO7 A;  1BIA A;  4GGG A;  2DFI A;  4L0Y B;  3R61 A;  2OQG A;  1WSU A;  1YS7 A;  3LA7 A;  2EB7 A;  3CUQ A;  2QUF A;  4L5I A;  3F72 A;  2V6C A;  3LWF A;  4G94 A;  5L3F A;  2EFN A;  4UVA A;  3PFI A;  2A6H F;  4ZZL A;  4AIJ A;  3Q5F A;  1KQ0 A;  1U8R A;  3F6O A;  3HSR A;  1YFH A;  1O3R A;  4GXO A;  2QLZ A;  3V8K A;  2M8E A;  1O57 A;  5D6F A;  4CHU A;  5L3D A;  1FPQ A;  5HDN A;  3IRR A;  3KCC A;  2DK8 A;  1D8J A;  1GVJ A;  1RZ4 A;  2NYX A;  3F8F A;  1MDM A;  4OIO F;  1BIB A;  1IZ1 A;  1SD5 A;  2GQQ A;  1YTY A;  1HW1 A;  2MBF A;  2FBK A;  4OU0 A;  1W5S A;  4HQM A;  2K4B A;  1KU9 A;  1Y0U A;  2YR2 A;  4WXH A;  3P9C A;  3FX3 A;  3GEZ A;  5HS9 A;  1E17 A;  5LLQ A;  4U7B A;  3HRU A;  4GO1 A;  3MFK A;  3TQN A;  3D5L A;  1W7P D;  3GF2 A;  4KMU X;  3ZMD A;  3LAJ A;  2FBI A;  1MJ9 A;  4L5J A;  1ZYR F;  4HA8 A;  1ZAO A;  2ZCW A;  2RVC A;  5FLX Z;  1O3Q A;  3WTZ A;  5DUK A;  5KVR A;  5LGN A;  2JZY A;  1Z6T A;  2ELH A;  4LLL A;  4EM0 B;  1EH7 A;  3WE2 A;  2Q0O A;  1QZZ A;  3TDZ C;  1IF1 A;  4CXF A;  1GXP A;  2H6C A;  4FT8 A;  1P4A A;  1F9N A;  4K2E A;  3ZMT A;  4ENK A;  3KP6 A;  4WXC A;  2FE3 A;  1FYM A;  1TTY A;  4EGZ A;  2R3S A;  3WTX C;  3G3Z A;  5L3B A;  3M8E A;  5K1Y A;  5K5Q A;  3FXR A;  4A5M A;  2G7U A;  2EFO A;  2HQN A;  4MHG A;  1K78 A;  2H27 A;  3WGG A;  3R0J A;  1BI1 A;  5KK1 A;  4YIF A;  3CO7 C;  2KJC A;  4RS8 A;  1SMY F;  1P4W A;  3EQL F;  3ZMS A;  2BYV E;  3F6V A;  1JHF A;  1J2X A;  4E70 A;  2QBY A;  4HV6 A;  1K7A A;  5HS7 A;  3EUH A;  2RQP A;  2BBY A;  1R7J A;  1YG2 A;  5DD4 A;  2DO7 A;  5DD8 A;  3IC7 A;  3ZPL A;  2CYY A;  2ZME B;  2HYF A;  4U0W A;  2G7H A;  1U5T A;  3MEX A;  1I6X A;  4OOI A;  1FSH A;  4LGW A;  3IKV A;  2FBH A;  1ZN2 A;  5D4S A;  4HX7 A;  4HDU A;  4CGZ A;  2M5W A;  1CF7 B;  4BXU A;  5ICC A;  1IUY A;  3LA3 A;  3CDH A;  1W7P B;  4EGY A;  1H0M A;  1K79 A;  3HYI A;  4O3M A;  2W84 A;  4I09 A;  5ICF A;  2HYG D;  3KFW X;  3KZZ A;  4KMF A;  1X3U A;  2K27 A;  2EJR A;  1U2W A;  3FF5 A;  2O8X A;  2V79 A;  1TQM A;  2Y48 A;  4HBL A;  3K0L A;  2LDU A;  1KU2 A;  2RNJ A;  4Y13 A;  1XD7 A;  1BI0 A;  1QGP A;  3JAM K;  3K69 A;  2GXB A;  3RKW A;  1BN5 A;  4KT5 C;  2DBB A;  2Q8K A;  1B1B A;  5H20 A;  4CIC A;  4FX4 A;  4LJZ F;  3REO A;  3ZMZ A;  3TOA A;  1P6R A;  4S04 A;  4UUV A;  5EEH A;  4LFU A;  4WWC A;  1AOY A;  3WG9 A;  1TW2 A;  2RDP A;  4HF0 A;  5H6R A;  2UXX A;  4RB0 A;  1BI3 A;  2B0L A;  1RNL A;  3TDU C;  1P92 A;  5CJ9 A;  3ZN1 A;  3IRQ A;  4S05 A;  2LF8 A;  4KUM A;  3E6C C;  3L00 A;  3H3Z A;  2ZJ2 A;  5E20 A;  2GIV A;  2ZFW A;  1LEA A;  4R79 A;  3CTA A;  3C7J A;  2DK5 A;  2CSO A;  3F8C A;  4IHT A;  1ZG5 A;  1U3E M;  5E1X A;  4P96 A;  1XGM A;  3QU6 A;  2YX7 A;  3U2R A;  2VC1 A;  2HFH A;  4R8H A;  4HW0 A;  1J7K A;  4BHP A;  2NRA C;  2PJP A;  2V1X A;  3ROU A;  2QEN A;  4LG0 B;  3ULQ B;  1T0F A;  2FXA A;  3C1D A;  4LB6 B;  4KN7 X;  3DQV C;  1TNT A;  2UZK A;  3GZ5 A;  1R5H A;  4QWQ A;  3KP3 A;  4EJW A;  1R22 A;  5DCM A;  4XRF A;  4HQE A;  1BC7 C;  4M6Y A;  3T8R A;  1G6N A;  2OBP A;  1TQI A;  2XAH A;  3ZMU A;  2PG4 A;  4EM2 A;  4EJU A;  3K9T A;  2A6E F;  3KEO A;  4M74 A;  1ZLJ A;  3HHH A;  3ML6 A;  2VON A;  3LFK A;  4LD5 A;  1FX7 A;  1Q1H A;  5ICG A;  2JRT A;  1KYZ A;  1PDN C;  3K2Z A;  4L9T A;  3D0S A;  2HWV A;  1UB9 A;  3CLO A;  5AIP A;  4UNO A;  3TKY A;  3CO6 C;  2MD5 A;  3E6M A;  1WI9 A;  3KP4 A;  3F23 A;  4ZYE A;  4G9Y A;  1G3W A;  3FXU A;  3MZY A;  4IRH A;  4KIC A;  2Z5U A;  3R6S A;  2VC0 A;  1ONV A;  1QPM A;  2ZXJ A;  5JVT A;  1I5Z A;  3M9A A;  5HDK A;  2HKX A;  3MWM A;  4N9H A;  4MQ9 F;  1S29 A;  4D0P A;  4Y15 A;  5J8F A;  5CYV A;  3V7C A;  3RPQ A;  5LEJ A;  4LK1 F;  2EK5 A;  1D5V A;  4LLN A;  2IA2 A;  2ISZ A;  5E1W A;  3ZN0 A;  1BBY A;  1B4A A;  2D1V A;  3HHG A;  2VE8 A;  4WCG A;  4CYD A;  2JSC A;  4BNC A;  1O3S A;  1XCV A;  1DP7 P;  1VTN C;  4HF1 A;  5DYM A;  1J9I A;  5ICE A;  5ILU A;  1B6A A;  3WU0 A;  3ZP5 A;  2P8T A;  3V8J A;  2EFP A;  2VT2 A;  5HVQ C;  1LDK B;  2GAU A;  1XDU A;  2IA1 A;  3IHU A;  3WGI A;  5F6F A;  1XGO A;  4HYE A;  2Y0M A;  4M72 A;  4PDK A;  5LRS A;  1C0W A;  4JQF A;  4M9S A;  3O6B B;  1Z05 A;  2D2W A;  2VT3 A;  3CUQ B;  1ZGA A;  1ZG1 A;  3HRS A;  4G7Z F;  2AS5 F;  2LKP A;  3RI4 A;  4OIP F;  1F5T A;  4P55 A;  2MLG A;  5HLG A;  3SXY A;  4A0Y A;  5FGM A;  3NQO A;  2DLL A;  1ZRE A;  5IT9 K;  1L3L A;  1O7L A;  2HZT A;  4BQA A;  3CUO A;  2JT1 A;  3I58 A;  2K4J A;  4M71 A;  3L9F A;  4Q47 A;  3FM5 A;  3GYH X;  3P9K A;  2O6G E;  2GWR A;  3GXO A;  5IT3 A;  3SZT A;  3F3X A;  5AIQ A;  3L2C A;  3I64 A;  1QNT A;  2FML A;  3JW4 A;  4I02 A;  4I0B A;  3BPX A;  4XSZ F;  3T8T A;  5LHG A;  2OZ6 A;  3T0Y A;  2CW0 F;  5ILV A;  3LST A;  3KET A;  3WTV C;  3B02 A;  1HQC A;  3I4P A;  1J75 A;  1O7F A;  4P9F A;  5K5O A;  3WTT C;  4ON0 A;  3I54 A;  2IW5 A;  3QU3 A;  1T38 A;  1JE8 A;  2F5D A;  3EYI A;  3FMS A;  2BE5 F;  2P4W A;  2Z33 A;  3TO6 A;  2XUB A;  3PQJ A;  5FB2 A;  1O3T A;  1IAW A;  3DEU A;  2V9V A;  4A6D A;  1EV7 A;  3W6K B;  1U78 A;  4EM1 A;  5D5W B;  5EEG A;  4KNY A;  2A3S A;  3MZH A;  4HZF A;  1BJA A;  4IRI A;  4A5N A;  2QZ8 A;  3B73 A;  2E1C A;  4UVB A;  3J7A O;  2MA3 A;  2XIG A;  2F5C A;  1OYY A;  4H0E A;  5A2Q K;  2HOE A;  5CLS A;  2MH9 A;  1P2F A;  3FXQ A;  3T1B A;  2VXZ A;  4IXA A;  4WF2 A;  4JK1 X;  3E5X A;  4EJO A;  2L4A A;  1CGP A;  2QYO A;  3H92 A;  4KN4 X;  3HTU A;  2ACJ A;  1MD0 A;  2K02 A;  1B9N A;  3RKX A;  1UCR A;  2EFW A;  2XKP A;  1I27 A;  1YQA A;  2V1D A;  3ERE D;  3VOD A;  5DUI A;  4RGX A;  1K78 B;  1S7O A;  4B09 A;  5E1Z B;  1JGS A;  1H9G A;  3RDI A;  2QBY B;  4EV0 A;  1STZ A;  4L9J A;  3KLN A;  2ADU A;  1G4D A;  1KQ8 A;  3SFZ A;  2H09 A;  2ZBK A;  2DPU A;  3DXJ F;  3RKY A;  1R1T A;  5LGT A;  3GFM A;  2VBZ A;  1F4K A;  3W6J B;  2XAJ A;  4WXD A;  2XRO A;  1U5T B;  2QQA A;  5H6Q A;  2XAQ A;  4XLP F;  3VOE A;  5L3E A;  2P5K A;  4GYI A;  1LDJ A;  2Z3Y A;  5D5V B;  1FWZ A;  2KIM A;  1UFM A;  5CVI A;  2ESH A;  2FOK A;  3WTS C;  5LHI A;  4UHT A;  2XGX A;  1ZLK A;  1IXR C;  1LVA A;  1SFU A;  4UXN A;  4IPA A;  1FP1 D;  2RV8 A;  3K1N A;  1FSE A;  3F8M A;  3R4K A;  1IRG A;  1YS6 A;  2ETH A;  4M6X A;  2VOO A;  1RUN A;  3E5Q A;  5D5X B; 
#chains in the Genus database with same CATH topology
 3HRT A;  4JX5 A;  4RM3 A;  1JUS A;  3M8J A;  2R7O A;  3DWL E;  1W4M A;  4FHT A;  1XSX A;  3HOS A;  2ZJQ F;  2ZKZ A;  2DT5 A;  3ZGK A;  3V7S A;  1DPR A;  3VB2 A;  4ZYD A;  3CC2 I;  3OIO A;  2PEX A;  1XDS A;  2FU4 A;  5J3L A;  2PMZ A;  2NS0 A;  3F22 A;  1FBQ A;  5J1Y A;  4H4K C;  1OCO H;  3VEP A;  5E8I A;  2PJR B;  1EH8 A;  1MZB A;  4XL9 A;  2GA2 A;  2J5P A;  2N8G A;  4G6Q A;  1T39 A;  1FMV A;  5GTI C;  4O6J A;  4I01 A;  4C3H J;  2FA5 A;  3Q9V A;  4LK0 F;  2ZNY A;  3IH4 A;  3HIF A;  2HS5 A;  4DJA A;  3OS1 A;  2NVY J;  3FZV A;  3V4G A;  4A12 A;  2QSF X;  2STT A;  4ENM A;  1SMT A;  5TJJ A;  1Y0N A;  1YJW I;  2EIL H;  4ZH4 F;  2KZV A;  3ZQH A;  4M3G A;  2WWY A;  1SD4 A;  3OOP A;  4GYG A;  5K5R A;  3BJA A;  1R58 A;  1XG1 A;  2LP0 A;  4P1W A;  1KA8 A;  3R60 A;  4MFD A;  2VAS A;  3DBL B;  3GCM A;  4BQO A;  3SHF A;  2L4M A;  1DP3 A;  2H1L A;  1PP8 F;  3S1R J;  3MKL A;  2OAZ A;  2PMH A;  5CPR B;  3CES A;  1J59 A;  3HOW J;  2A69 F;  1SAN A;  2MSY A;  4OIN F;  4C9Y A;  4BJT A;  3J81 K;  1GV5 A;  3K1P A;  1YYV A;  4HX4 A;  4Y7N J;  5IT9 Z;  1U5T C;  1FNN A;  2MYS A;  1B8I A;  1I1G A;  3ZQ7 A;  2JPB A;  2F2E A;  3F8N A;  4RDU A;  1TW3 A;  3I59 B;  2K9N A;  3I5U A;  4R1H A;  5IP7 J;  1ACI A;  3OYG A;  3K4M A;  1FZP B;  2XB5 A;  5JR3 A;  1JTX A;  3G4S I;  3I53 A;  2CH0 A;  2X1D A;  3RTR A;  4XKW A;  5DEQ A;  3GZ6 A;  2CO5 A;  5CVR A;  1OFC X;  4CDG A;  2CUZ A;  1Z6R A;  1FOK A;  3PSI A;  3VFZ A;  3HPG A;  3AG4 H;  3F9K A;  2R7D A;  3Q9S A;  1D1C A;  2WB1 A;  5LRR A;  3DFG A;  4IO9 F;  4G7H F;  2AXL A;  3U1K A;  2GLO A;  2KRC A;  1RI7 A;  1R1U A;  4A3E J;  3QPS A;  3K1M A;  1UHM A;  3JRI A;  2STW A;  5BOX A;  1LB2 A;  3QPT A;  1VQ7 I;  4FTH A;  4E6K G;  3BY6 A;  4CZC A;  2ZO4 A;  5FKK A;  1IN4 A;  3BG6 A;  2JWT A;  1GT0 C;  1ETK A;  2DI3 A;  3BDD A;  4Q48 A;  3T5X A;  1OR7 A;  1RR8 C;  5DV5 A;  5JLX A;  1WFX A;  2IGM A;  1EA3 A;  3K4C A;  1ZKG A;  2GM4 A;  4XLC A;  2A5Y B;  3OR1 C;  3GLX A;  3PO3 J;  2O61 A;  1R1V A;  4DBQ A;  4LG0 A;  4D7M A;  1QRY A;  3BTJ A;  4A2U A;  5LD2 C;  3GFL A;  3GTJ J;  1ODD A;  5DCM B;  1KQ9 A;  4HAM A;  2HVQ A;  5BPI A;  1S6L A;  3B6C A;  2HOA A;  2CGP A;  1YW9 A;  2GBY A;  1YRN B;  1HSJ A;  1T08 B;  3QAH A;  2CV2 A;  3K4B A;  1FT9 A;  3ABL H;  5FFX A;  2JVH A;  4CYC B;  2BY2 A;  5C4J J;  4QPQ A;  4BY7 J;  3DEE A;  1EH6 A;  1SAX A;  2DOD A;  4EJT A;  4XLH A;  2DOE A;  2PBI A;  3FK6 A;  2W24 A;  1X58 A;  2XB0 X;  2O7O A;  4RB3 C;  2ID3 A;  1ZRC A;  2F4M B;  3K7A J;  4BE2 A;  1RKW A;  4PSW A;  2V4J C;  2HDC A;  2MC3 A;  4HLX A;  3KX2 A;  3KYL A;  2DPD A;  2IBD A;  3M07 A;  4IQJ A;  4CUG A;  2VKV A;  1K6O A;  2FEZ A;  4DW6 A;  1A31 A;  2X48 A;  3RJP A;  1PUF B;  1W36 D;  2P6T A;  3UNG C;  3NEU A;  3BCB A;  4ZZD A;  3IWZ A;  5K7Z A;  2E60 A;  4ESF A;  3E3V A;  1IXS B;  2GXG A;  1F1Z A;  1FC3 A;  1YHQ I;  4C2U A;  2HXO A;  2XGC A;  4BQN A;  5A2Q Z;  2R7U A;  3N97 A;  2YS9 A;  4OMY A;  4AIK A;  3GWZ A;  1PVE A;  3HRM A;  2ZNZ A;  2CG4 A;  4DZP A;  1DUX C;  2O0Y A;  2KIU A;  3WHC A;  2CMP A;  2E36 A;  3WGH A;  2Y75 A;  2CUF A;  2CU7 A;  3KLO A;  3QYF A;  1FOW A;  3C2H A;  1MH4 A;  3JSO A;  3QOE A;  5L3C A;  2CJJ A;  4E7I A;  4PJN A;  1MMG A;  3QRF F;  3JTG A;  5FO5 A;  2Y2Z A;  1WZ2 A;  1GXQ A;  2FF4 A;  4G12 A;  2LTP A;  2R7X A;  2Y31 A;  2OV7 A;  1TLH B;  3BWG A;  2QKL B;  2D45 A;  2IRF G;  4XRS A;  2MC4 A;  2OD5 A;  2O03 A;  1HBX G;  2OQR A;  1XCB A;  4ZTJ A;  1BOB A;  1LE8 A;  2XF5 A;  3BRO A;  2XGE A;  2LBF A;  3F8B A;  2P7C B;  3HOU J;  4EQQ A;  2BGC A;  3LMM A;  3S2H J;  4HST A;  1XN7 A;  5B1B H;  1OCR H;  2HR3 A;  3R0A A;  2M45 A;  2PMU A;  1SVO A;  1MBF A;  5F1R A;  3WTW C;  4BXX J;  1MNE A;  3GVA A;  4RB1 A;  3WTY C;  2M4G A;  2DW4 A;  4ZJZ A;  2VBY A;  1RIO H;  2K40 A;  4KFC A;  5E17 F;  2EZI A;  1T98 A;  5GP9 A;  4IHW A;  3ZR8 X;  4B3A A;  5JHU A;  2F4I A;  2P6S A;  3BR3 A;  2A68 F;  4ZC3 A;  2HDW A;  1OYW A;  2GA1 A;  4G8X A;  2HNH A;  1NTC A;  2IAI A;  1IDZ A;  4YG2 F;  2JVG A;  3H0G J;  3BOQ A;  2PQ8 A;  2V9K A;  2PLY A;  2Z99 A;  1MJB A;  3SJM A;  3CP2 A;  1A6Q A;  4BDZ A;  5C4X J;  4AUX A;  1IRX A;  3GFI A;  4DYQ A;  2VE9 A;  1B72 A;  4PJ0 C;  3E97 A;  1JKO C;  5CKT A;  4YFN F;  5EGO A;  1RES A;  3O2P E;  4ZYH A;  3GTP J;  2K86 A;  2VIX A;  2E2J J;  4BAC A;  1MMA A;  3G73 A;  1FTT A;  3PQK A;  3A0B C;  5DS9 A;  2OCE A;  3A01 A;  2DQL A;  2F5E A;  1ZAR A;  1X4O A;  5F27 A;  4MGR A;  5J8C A;  2I10 A;  2E5N A;  2E71 A;  3JSP A;  2UWM A;  2XSD C;  2FNP A;  2LOO A;  3CME I;  1X1P A;  2DA4 A;  4A0X A;  1R23 A;  3CCV I;  4QSH A;  4A3K J;  3C3W A;  4YEJ A;  1Y39 A;  1TL8 A;  5HLI A;  4ZDO A;  5FJ8 J;  3KP5 A;  4FE4 A;  2M4K A;  3HTS B;  2JUG A;  4AVP A;  2XGD A;  3PUF A;  1T6S A;  3OYJ A;  3OV8 A;  4RB2 C;  3GW2 A;  3CJQ B;  5FKL A;  5M3F J;  4YFX F;  1QO0 D;  2IT0 A;  2G9W A;  2VOP A;  2GIZ A;  2DJN A;  2DU9 A;  4XLA A;  3S1N J;  4NDL A;  2FSW A;  5FD5 A;  1IW7 F;  1YX3 A;  2X6O A;  1SFX A;  1R36 A;  2R7F A;  3CCE I;  4L9V A;  2L3D A;  4DNC A;  3CDL A;  3EET A;  1JHH A;  4XOR A;  3WU2 C;  2KIF A;  5F08 A;  3I4N J;  3IAS 2;  2MLK A;  5HOO A;  1XMA A;  3HKZ N;  3HUG A;  4XKB A;  2HTJ A;  3LSM A;  4OIQ F;  1TBX A;  2CFO A;  2X4H A;  1WJE A;  3JAM Z;  3L2W A;  1BL0 A;  1SD6 A;  2DAO A;  4W1U A;  2HPI A;  1V4R A;  1MMS A;  2H6B A;  1VFC A;  1TNS A;  1IRZ A;  1LDD A;  1QPI A;  1VQ9 I;  4DIQ A;  2VJJ A;  1HLV A;  4LMY A;  1L0O C;  2P7V B;  3A03 A;  4B4C A;  1LQ1 A;  4Y17 A;  3WTU C;  3GTM J;  1A04 A;  4ZYG A;  1BI2 A;  4XLN F;  3L1P A;  5BS6 A;  4HV5 A;  4L0Z B;  5F0H A;  1ZRF A;  3S2D J;  1BOA A;  1U6G A;  2KZG A;  1XMX A;  2R93 J;  2XHK A;  3C18 A;  2LSO A;  2K9M A;  4XSX F;  3MMY B;  2Z9O A;  1YIO A;  3ZOB A;  4U7D A;  1LFU P;  1T2K A;  1D0Y A;  3SYT A;  3FMQ A;  3RPU A;  2YX4 A;  3LA2 A;  4XNF A;  4LLG F;  4ENN A;  3N4M A;  2HKO A;  3TOB A;  2NVQ J;  5HLH A;  4RBO A;  1W1W E;  2V26 A;  1AU7 A;  1FP2 A;  2KDO A;  3HOV J;  5LBQ A;  3KE2 A;  1FOY A;  2JA2 A;  4G6D A;  1BR2 A;  1WWX A;  1MDM B;  2NS7 A;  1IG7 A;  5KHD A;  3TP3 A;  1LEB A;  2IS6 A;  1OCT C;  4UB6 C;  4Y33 A;  4MEX F;  1KON A;  5JI6 A;  1ORK A;  3RYR A;  1Y1W J;  2IJL A;  1UST A;  1ZGJ A;  2XVC A;  2XV4 S;  1XB4 A;  2V9P A;  3OR2 C;  4F7Z A;  4M6V A;  3J81 Z;  2E19 A;  3MZ8 A;  2IVM A;  4GCV A;  1TWC J;  2FX0 A;  5FFZ A;  2KT0 A;  4PJL A;  1FBS A;  4KIB A;  4NHJ A;  4B43 A;  3P5J A;  5TRD A;  3K4N A;  2RRE A;  5F64 A;  1Z0X A;  4DGW B;  1IV6 A;  1BJZ A;  2F5V A;  2EQR A;  2XF7 A;  4ESJ A;  4IOA F;  4PZJ A;  2LVS A;  4LB5 A;  1MJA A;  2HVR A;  3ZMV A;  3E6B A;  1YX5 A;  1Z3Y A;  4ITV A;  5BMZ A;  2IA0 A;  3M4O J;  2EV6 A;  2YSR A;  3O8H A;  5EZG A;  3J80 K;  1WQ2 A;  4HRI A;  2OA4 A;  2JRM A;  3D5S C;  3GUD A;  5BQT A;  3FMR A;  5EG0 B;  4OAY A;  2DMN A;  1FBU A;  4WX9 A;  1S9H A;  3DF8 A;  1ZGW A;  2HQR A;  2ZXI A;  1MKM A;  3PO2 J;  1EKE A;  4MTD A;  1XSD A;  3BTI A;  3CUQ C;  4JOM A;  2HEO A;  3M1E A;  3KP2 A;  3H9G A;  3GTQ J;  2E7X A;  1ZHF A;  1S7E A;  2L0K A;  4RAY A;  2E34 A;  1W36 C;  2DA3 A;  3VSK A;  2W57 A;  2M30 A;  4RAF A;  2K7L A;  2Z2S B;  4ENJ A;  4AIH A;  1X2N A;  1ON2 A;  4BYY A;  1QBJ A;  2ZB9 A;  3DBH B;  1RKT A;  3PIO F;  3OSF A;  4BGD A;  1LJ9 A;  2KMU A;  3DPL C;  3SFI A;  2OUM A;  5D5U B;  2LRD A;  2DN0 A;  3O3K A;  4CH7 A;  4ANJ A;  2H94 A;  4II3 A;  3PM1 A;  1JUM A;  3V8L A;  4XM3 A;  1D1B A;  2LNB A;  1R6R A;  5JVG F;  2QM3 A;  3AKZ A;  2LF7 A;  1U9N A;  1XMK A;  4E7S A;  3LNQ A;  1IUF A;  1LNW A;  3F21 A;  1FY7 A;  5JHF A;  3ZQG A;  1KU3 A;  1YW7 A;  3KEY A;  1IDY A;  3RIR A;  3V42 A;  2Y9Y A;  5FLV A;  4L9N A;  5J1U A;  2DMT A;  5C44 J;  1HW5 A;  2EIK H;  3MQ0 A;  3Q0V A;  4AYB N;  4HDV A;  2LY2 A;  5BPD A;  2QQB A;  2MH2 A;  4IHX A;  2BW3 A;  2IP2 A;  3BJO A;  2BY1 A;  2VQG A;  2X6X A;  4ETS A;  4FX0 A;  3M7G A;  2EZK A;  3JTH A;  2HTS A;  1R4N B;  3W3C A;  3H35 A;  2VBW A;  3PSF A;  3ECH A;  3NRV A;  1MH3 A;  4RGS A;  2NOJ B;  4ASN A;  2LD5 A;  3LSH A;  1XGS A;  4BQQ A;  3HSE A;  4A3G J;  4IF4 A;  3BJ6 A;  1SFE A;  5CVV A;  4J00 A;  1D0Z A;  2A07 F;  1V5E A;  1D3Y A;  3HZJ A;  1IN7 A;  1KYW A;  2NAZ A;  2YPR A;  2X51 A;  4MQV A;  5AON A;  1TWH J;  2P81 A;  2AHQ A;  1WKM A;  2FQ3 A;  1QZE A;  5GAD J;  1KU7 A;  2XDV A;  3ABT A;  2VBX A;  2VOD A;  2P5L C;  2ELK A;  4D5C A;  1U9O A;  2DA7 A;  4MEY F;  3U1D A;  4DQ2 A;  2RC4 A;  3OYM A;  4XMY A;  2LC2 A;  5D4R A;  4YII A;  4L18 B;  1K4S A;  4IJA A;  3HPH A;  2DFF A;  2VN2 A;  2CQK A;  2KJB A;  4M73 A;  4BBS J;  1P4X A;  2XAU A;  3DKW A;  2W85 A;  4XOT A;  3ECO A;  2ZME A;  2NNN A;  1VQ4 I;  5FKN A;  1FIA A;  1WCM J;  5F0C A;  5FLM J;  1I1S A;  4Z2Y A;  5LHH A;  4YEL A;  2W4S A;  1FLI A;  3DCF A;  2CRG A;  1XX5 A;  3RCO A;  3O8G A;  2QVO A;  3MCZ A;  2A5W A;  3PNV A;  1MBH A;  1UG0 A;  2E1N A;  2O5R A;  1WI3 A;  2VPL A;  1POG A;  1ENH A;  1CF7 A;  2Y0S N;  3S2W A;  2IPQ X;  1V3F A;  1W7P A;  3OYL A;  2VKE A;  4YFK F;  4IL6 C;  2F5F A;  4HX8 A;  2CWE A;  3TED A;  4XBF A;  2FRH A;  4JBA A;  2M87 A;  5IYB J;  4A0Z A;  2R5Y A;  1E3O C;  3AAF A;  3P7N A;  1UAA A;  1DDN A;  3AL0 C;  3S17 J;  3FXJ A;  4IRG A;  3IH2 A;  3IWF A;  1S7A A;  2Q2E A;  2X1E A;  2EV5 A;  3CC7 I;  5B5E C;  2EWN A;  4QLC U;  4YRV A;  2L5Q A;  3A02 A;  3M8F A;  2XF6 A;  5DDG A;  2DMU A;  4I76 A;  3BR1 A;  2QQ9 A;  3BZ6 A;  1Z7L A;  3KZY A;  4BAY A;  2EA2 A;  4A3C J;  3SDB A;  5D6E A;  5D8K B;  3BP8 A;  5L3G A;  2ESN A;  3H0D A;  4M3B A;  3GO5 A;  2DTZ A;  4A3M J;  1TQP A;  4BHB A;  2DQR A;  1V54 H;  1F36 A;  1S3J A;  4N0B A;  3LQR A;  4N9I A;  5ILS A;  1RPW A;  4RGR A;  4OIR F;  3I71 A;  4EVI A;  3LSG A;  1HKS A;  4BBR J;  1KGS A;  1U8B A;  1A35 A;  4WK8 F;  1HW2 A;  2Q1Z B;  4BH9 A;  3ZXS A;  1HST A;  4U88 A;  4LIT A;  1SFO J;  1ZG3 A;  4BEH B;  1IC8 A;  2TDX A;  1YO5 C;  2EA4 A;  1H8A C;  1R5G A;  2E1M C;  4ESB A;  2WAQ N;  3AG3 H;  3OMY A;  4HNT A;  2BEO A;  3FKI J;  4FIS A;  1WRJ A;  5E18 F;  3M3Y J;  3HOY J;  3CJN A;  2HOT A;  1TC3 C;  1J5Y A;  3EUH C;  1XSV A;  2BY0 A;  2JA6 J;  2VJI A;  2JJ7 A;  1H9T A;  3E7L A;  4QTR A;  3CF5 F;  3S1Q J;  3TO9 A;  3C2G A;  2DFE A;  2L9N A;  3SQN A;  4PK4 A;  1QZY A;  2X9D A;  1HKQ A;  3GFJ A;  3QP6 A;  3C2B A;  5D8L B;  3MAJ A;  1PP7 U;  1HC8 A;  3ESW B;  3ERM A;  3I0T A;  5B3S H;  4MNU A;  1ZTR A;  1VQO I;  1YLF A;  3K4K A;  1Y8Q B;  3BTL A;  1OKR A;  3WHB A;  3FXO A;  3S3M A;  4BHC A;  2KRF A;  3F0C A;  2D1H A;  4MLO A;  5M5W J;  2FNA A;  4JX6 A;  5F0F A;  1JKQ C;  2PN6 A;  1B8I B;  2L7K A;  1E2X A;  3SEQ A;  3DEW A;  1DPU A;  1S72 I;  1Z9C A;  3CCQ I;  1BC8 C;  2TCT A;  3VSL A;  2WV0 A;  4F3Q A;  2LG4 A;  1ZH5 A;  2Y69 H;  4RAG A;  3W2V A;  4XON A;  3L7W A;  1HA8 A;  3I59 A;  4I0A A;  4A6E A;  2X85 A;  3BCA A;  2HQ5 A;  3OYK A;  1BM9 A;  2PFB A;  1IRF A;  5HDG A;  4F55 A;  2DTR A;  4AVZ A;  4O5V A;  2BHY A;  2GZW A;  4EMS A;  1HF0 A;  2W00 A;  1XGN A;  1Z91 A;  1JI8 A;  2UV1 A;  1P9Q C;  3AFH A;  4KIG A;  4Q4Z F;  2NVU B;  1ON1 A;  1JXS A;  3FIW A;  3TBI A;  5LEK A;  1YJ9 I;  3TL4 X;  2WC2 A;  5FLX K;  2RN7 A;  1R00 A;  1ZRD A;  3W2A A;  5E79 C;  2PI0 A;  3LSK A;  3OIP A;  6PAX A;  4IVN A;  3WOD F;  1OJL A;  2CQX A;  4I98 B;  2E7W A;  4KYW A;  2X6W A;  4AWX B;  3PNY A;  3KZI C;  3QP5 A;  3JRF A;  1N78 A;  1G3T A;  1JT6 A;  3RZD J;  2I5U A;  2M3A A;  2P5V A;  1YIJ I;  3ASN H;  5GAH J;  2JPC A;  4HOB A;  4XLF A;  2UXN A;  1I50 J;  1SFK A;  3U9G A;  1B9M A;  1WH5 A;  2YU3 A;  3BR6 A;  2EV0 A;  2DA1 A;  2KP6 A;  3QOP A;  1QA6 A;  2IS2 A;  4NB5 A;  2R4G A;  5E8G A;  2OZU A;  2DT6 A;  5GPA A;  3EUK L;  4KJZ A;  2PMZ N;  3CCM I;  3FWE A;  2Z1D A;  4B8X A;  4LIU A;  4M9X A;  5JFR A;  2GXA A;  2VL8 A;  3IP4 B;  4Q5S F;  4TV7 A;  1P7I A;  2JUC A;  2RGV A;  3N05 A;  4DZJ A;  3COA C;  2B9S A;  4I2O A;  5BNG A;  3J80 Z;  4P5O A;  2J5O A;  3DPU A;  2KQR A;  1JKP C;  2LKS A;  1RC9 A;  1JJ8 C;  2M2E A;  2WY7 Q;  1G3S A;  4UVC A;  1G2H A;  1Z1D A;  1OYI A;  3FK7 A;  1QQI A;  2L54 A;  2OTL I;  2OU2 A;  2XRN A;  2V7F A;  2IS4 A;  2COB A;  1IN5 A;  2RKH A;  2Y9Z A;  1RUO A;  2XKO A;  2CFX A;  3A4C A;  5J47 A;  1MBE A;  2XAF A;  2FMY A;  4CCM A;  2COM A;  1PUE E;  2R7V A;  4ZDL A;  3DPT A;  4M9Z A;  4UY8 I;  5KNL A;  2WTE A;  4P9U A;  3WE3 A;  2K9Q A;  1WPK A;  3OY9 A;  4B3X A;  3EDP A;  3VYT B;  4LIV A;  2W25 A;  2M1B A;  4AID A;  3H3V K;  3ISP A;  5K7H A;  3DP7 A;  2NS8 A;  2JTV A;  2V1U A;  4AD9 A;  1FOX A;  1AA7 A;  3TGN A;  4U0V A;  3JRG A;  2E35 A;  3K10 A;  2NNY A;  4UV8 A;  5CQE A;  3IL2 A;  4NQW A;  1G3Y A;  4UV9 A;  3CD6 I;  2KL4 A;  4HPQ A;  1ULY A;  4CSW A;  2L02 A;  4N4N B;  5E3L A;  5HNH A;  3RZO J;  1MBJ A;  4PGH A;  3V7R A;  4RMN A;  1GLN A;  5H2F C;  2M8G X;  2A61 A;  3HSF A;  3QYE A;  1J0R A;  5EZH A;  1BA5 A;  3ELK A;  4CO8 A;  2HGC A;  2XAS A;  4KA4 A;  4XK4 A;  1GHC A;  4ZTF A;  1HKT A;  3ZQC A;  1B59 A;  3EYY A;  3BQZ A;  3H3U A;  2QWW A;  5LGU A;  1S8N A;  2WA0 A;  2EIJ H;  4XQF A;  1DGR M;  2C6Y A;  1MGT A;  4IQ4 A;  4OMZ A;  3FHZ A;  1D8K A;  3X2Q H;  1FMW A;  3LQQ A;  2LBF B;  5IP9 J;  2WB1 N;  5HS8 A;  5ERI A;  2EFQ A;  5GPC A;  2BVL A;  3KPH A;  3HC7 A;  5FKO A;  1JGG A;  4IHS A;  4F52 A;  3WU1 B;  4HLY A;  3ABU A;  2BV6 A;  3FM3 A;  3KIO A;  4FE7 A;  5F04 A;  3DU5 A;  9ANT A;  1H89 C;  2TRT A;  1T0F C;  4I7H A;  1AHD P;  5J6X A;  4GDF A;  4PGG A;  3S14 J;  1OPC A;  4RAZ A;  4G7O F;  3QQA A;  5DCF A;  1Z3X A;  2AO9 A;  3RYP A;  1UEL B;  3SZP A;  1XC5 A;  4U0Y A;  2KKO A;  3IAM 2;  2X0L A;  4KDP A;  4RGU A;  2NOG A;  2ME6 A;  2ISY A;  3LAP A;  2JQ7 A;  1Z7U A;  3HOT A;  2VQC A;  4CZZ A;  4PCQ A;  3E6D A;  1UHW A;  5EEA A;  5KCM A;  5C3E J;  3DTE A;  4HF2 A;  1Y6I A;  2CW7 A;  3GLL A;  1ETX A;  2AQE A;  3ZQF A;  1WJ5 A;  2NVT J;  4D9J A;  2ZSH B;  2DXI A;  3QPH A;  5FD6 A;  1B72 B;  2LFB A;  1JKR C;  4MTE A;  3L2R A;  1NG6 A;  3L09 A;  3G6E I;  1IXC A;  2BZT A;  1AWC A;  3BPV A;  3KEQ A;  5CVU A;  3KYD B;  4UUS B;  3E5U A;  3A01 B;  1OMI A;  1IN6 A;  1UMQ A;  1S5L C;  1WJA A;  4KIF A;  2CQQ A;  1OCZ H;  5ED4 A;  1HXD A;  1REP C;  1Z77 A;  1TT5 B;  2L01 A;  1NHA A;  4EJV A;  3OL3 A;  2H8W A;  5CVJ A;  2O3F A;  3L2V A;  1SVM A;  2WAE A;  1W5T A;  1FYL A;  2XAG A;  3OIQ A;  3P9I A;  3GX4 X;  1IN8 A;  1SD7 A;  3DV8 A;  1FYK A;  4CCL A;  1W0T A;  3VDX A;  3KP7 A;  1USS A;  1YW8 A;  2X1C A;  2V1N A;  3IKT A;  1T33 A;  3E1S A;  3TO7 A;  1BIA A;  3FKJ A;  2QSG X;  1K61 A;  4GGG A;  2DFI A;  2FUG 2;  4PFO A;  4L0Y B;  3R61 A;  1ZK8 A;  2OQG A;  1WSU A;  2R92 J;  1YS7 A;  1X3W B;  1Y56 A;  2DDA A;  3LA7 A;  1R9T J;  1BW5 A;  3EUA A;  1A5J A;  3LOC A;  2LK2 A;  3U21 A;  3CC4 I;  2EB7 A;  2KHM A;  3CUQ A;  1ETO A;  2QUF A;  4L5I A;  4MFE A;  3F72 A;  3TP0 A;  3GBG A;  1YIT I;  2V6C A;  1R4M B;  3OS2 A;  3HUG B;  4Z6Y A;  4OWR B;  1OQY A;  5KAF C;  4PJM A;  3LWF A;  5IOZ A;  2R7S A;  2KFD A;  4G94 A;  4PSX A;  5L3F A;  1JJ6 C;  1R49 A;  1D5Y A;  1UG2 A;  3MVP A;  2EFN A;  4UVA A;  3PFI A;  2EIM H;  4HSR A;  2A6H F;  4BY1 J;  2P0W A;  2KIS A;  3ABM H;  4ZZL A;  4AIJ A;  4A93 J;  3Q5F A;  1TP4 A;  1KQ0 A;  4JP0 A;  1U8R A;  3F6O A;  3HSR A;  2JMW A;  2W48 A;  1YFH A;  1O3R A;  1LKX A;  1ZEL A;  4GXO A;  2R7R A;  2O9L A;  2QLZ A;  5FRO A;  3V8K A;  2M7A A;  1V5G A;  2M8E A;  2R5Z A;  1O57 A;  2QQ8 A;  2B7E A;  4HEA 2;  5D6F A;  4CHU A;  5E3N A;  2DDB A;  5L3D A;  2OJE D;  1VQM I;  1FPQ A;  4XID A;  2A6T A;  1FJL A;  3SEZ A;  4AC0 A;  5HDN A;  4BE0 A;  1DU6 A;  4BKX A;  3IRR A;  2O8K A;  4D1Q A;  3PJR A;  3KCC A;  2DK8 A;  2NXN B;  1D8J A;  1GVJ A;  1RZ4 A;  2EZH A;  2NYX A;  2M7B A;  4UUT A;  3F8F A;  4IKF A;  4Y3O A;  1MDM A;  4BU2 A;  4CCK A;  4OIO F;  1BIB A;  3VWB A;  1IZ1 A;  3BR5 A;  1SD5 A;  2GQQ A;  1XS9 A;  1YTY A;  4ZDP A;  1HW1 A;  2KPM A;  2MBF A;  2FBK A;  2LYC A;  3HB9 A;  2BXZ A;  4OU0 A;  1W5S A;  4HQM A;  4AM3 A;  2LY9 A;  1AKH A;  3FDY A;  2K4B A;  1OLT A;  1KU9 A;  1Y0U A;  5B66 C;  2ID6 A;  1ETQ A;  2YR2 A;  3GME A;  4WXH A;  4KIS A;  4X0G A;  3P9C A;  3FXK A;  3OYH A;  3FX3 A;  3GEZ A;  5HS9 A;  1E17 A;  2JA7 J;  2ECB A;  4RLF A;  3JRC A;  5LLQ A;  3D1N I;  4U7B A;  5HOD A;  3HRU A;  3KYC B;  4GO1 A;  3A0H C;  3MFK A;  1R5I D;  3E0J B;  3TQN A;  3D5L A;  1W7P D;  3GF2 A;  1DQU A;  4KMU X;  5IPA A;  3BC8 A;  3ZMD A;  5JLW A;  3LAJ A;  2FBI A;  1MJ9 A;  3PIP F;  5EDN A;  4L5J A;  1ZYR F;  1W0U A;  3G2B A;  4HA8 A;  2M0C A;  1MSE C;  1ZAO A;  4A3L J;  3VYR B;  2ZCW A;  2R7W A;  1TWA J;  1EF4 A;  5EG0 A;  2RVC A;  4XKV A;  5FLX Z;  2LLK A;  1O3Q A;  1VI0 A;  3WTZ A;  5DUK A;  5KVR A;  3QWL A;  1I3Q J;  4CCJ A;  3J7A Y;  5LGN A;  4XIC A;  2JZY A;  1FEX A;  1Z6T A;  2ELH A;  4M3E A;  4BJ5 C;  2XPV A;  4LLL A;  5IP6 A;  3MD2 A;  2VJ4 A;  1X1D A;  4EM0 B;  1EH7 A;  3ABK H;  3WE2 A;  1SEU A;  2Q0O A;  3A2K A;  1ERD A;  1QZZ A;  3TDZ C;  4LOC A;  2AXT C;  2YUS A;  4M3F A;  1JTY A;  1SAU A;  1XPX A;  1IF1 A;  4RM2 A;  1VQN I;  1HOM A;  4HG2 A;  4V2G A;  3HOZ J;  2EIN H;  2WY8 Q;  1GDT A;  4CXF A;  1GXP A;  2H6C A;  4FT8 A;  1P4A A;  3JRB A;  1F9N A;  3FBI B;  4K2E A;  3ZMT A;  2E1O A;  4ENK A;  2WV1 A;  3KP6 A;  1TWF J;  4WXC A;  5M5Y J;  2LMD A;  1WJF A;  2FE3 A;  1FYM A;  1TTY A;  3J7Z I;  4EGZ A;  1MMD A;  2R3S A;  3WTX C;  1Y8R B;  3G3Z A;  4ZYA A;  4IX7 A;  5L3B A;  3DKX A;  3M8E A;  5K1Y A;  5K5Q A;  3FXR A;  4A5M A;  3MN2 A;  5EF6 A;  1QVT A;  2BW3 B;  2G7U A;  2EFO A;  2HQN A;  4D7N A;  4MHG A;  3VYU B;  3CCR I;  3RQI A;  1K78 A;  2H27 A;  3WGG A;  3R0J A;  1BI1 A;  4PJJ A;  3OYC A;  3I9V 2;  5KK1 A;  5DTD A;  4YIF A;  2VQH A;  3CO7 C;  3PNT A;  2KJC A;  4I6Z A;  2OF7 A;  4B44 A;  4RS8 A;  1SMY F;  1P4W A;  2KDZ A;  4A3I J;  3EQL F;  3ZQQ A;  2DMQ A;  4Y4R A;  3ZMS A;  2XC7 A;  2BYV E;  3F6V A;  2EZL A;  4BUP A;  1JHF A;  1M1E B;  1PYV A;  1J2X A;  1XTA A;  4E70 A;  1E0E A;  2QBY A;  4HV6 A;  3I56 I;  5HS7 A;  1K7A A;  5J40 A;  2BXY A;  4PUS A;  3EUH A;  1VQK I;  2RQP A;  2DYR H;  2DYS H;  2BBY A;  3BLY A;  1R7J A;  1YG2 A;  5DD4 A;  2ZFU A;  1HDD C;  1K6Y A;  2DO7 A;  2RAE A;  3LL7 A;  2DOA A;  5DD8 A;  3IC7 A;  3ZPL A;  2CYY A;  2ZME B;  2HYF A;  2CUJ A;  3HJE A;  4U0W A;  4B47 A;  2G7H A;  1U5T A;  3CMY A;  3MEX A;  2OC6 A;  2WBM A;  1I6X A;  4OOI A;  2KLO A;  1FSH A;  1X19 A;  3SDG A;  2VLA A;  4LGW A;  3UKG A;  2IXS A;  3IKV A;  4IOC F;  2FBH A;  2DA5 A;  1ZN2 A;  3H5A A;  5D4S A;  4HX7 A;  3CZ6 A;  4AU7 A;  4HDU A;  2QA4 I;  4CGZ A;  1VF9 A;  2M5W A;  3CCY A;  1CF7 B;  4BXU A;  5ICC A;  1IUY A;  5IOY A;  3LA3 A;  3CDH A;  1W7P B;  4EGY A;  3JRH A;  2M9H A;  1H0M A;  3K4J A;  1K79 A;  2VXD A;  2UUZ A;  2IEK A;  1UHS A;  2M34 A;  4BJ6 C;  3HYI A;  2VPR A;  4FAS D;  2ZJP F;  4O3M A;  1HDP A;  1T95 A;  3IH3 A;  2W84 A;  4DOZ A;  2CQ7 A;  3FIS A;  4I09 A;  3HEF A;  4FET A;  4RA2 A;  5ICF A;  2R5Y B;  2HYG D;  3PFY A;  1D1A A;  3KFW X;  3HXL A;  3KZZ A;  4KMF A;  1X3U A;  2Q2E B;  5IYD J;  4DBR A;  3TW6 A;  2K27 A;  4XN0 A;  2EJR A;  1JUP A;  1U2W A;  3FF5 A;  1IGN A;  2O8X A;  2V79 A;  1TQM A;  2Y48 A;  4HBL A;  2JA5 J;  2G0E A;  3K0L A;  2LDU A;  1KU2 A;  4A3B J;  3K4L A;  2RNJ A;  3DU6 A;  4Y13 A;  3ZQL A;  5FRN A;  1XD7 A;  1BI0 A;  3BZC A;  1QGP A;  3ZCO A;  3EPZ A;  3OYN A;  3JAM K;  3K69 A;  1U0J A;  2GXB A;  3RKW A;  1BN5 A;  1ITY A;  4KT5 C;  2FQ4 A;  2L2O A;  5TGT A;  2DBB A;  3MKY B;  2Q8K A;  2PJR A;  1B1B A;  5H20 A;  3NAR A;  5B1A H;  3SZG A;  4CIC A;  3S3N A;  3PUB A;  2DOF A;  4FX4 A;  3Q0W A;  3S32 A;  4BEH A;  5HNF A;  1VQ8 I;  4LJZ F;  4OAZ A;  3REO A;  3ZMZ A;  2L9R A;  3TOA A;  2R0Q C;  2LY1 A;  2XPU A;  1P6R A;  4S04 A;  2LR8 A;  1YJN I;  3VYS B;  1MBK A;  4UUV A;  5EEH A;  4LFU A;  2QEX I;  4WWC A;  1AOY A;  5GAG J;  2HQA A;  3WG9 A;  1TW2 A;  2RDP A;  4FQG A;  3Q0U A;  4HF0 A;  2FJ1 A;  2UXX A;  5H6R A;  3S15 J;  4RB0 A;  3L2U A;  3FBN B;  2QKM B;  1BI3 A;  1YE9 A;  2B0L A;  1RNL A;  3TDU C;  2L7Z A;  4BDY A;  3TW7 A;  1P92 A;  5CJ9 A;  1MBG A;  3ZN1 A;  3IRQ A;  4S05 A;  2BOL A;  4A69 C;  3LSR A;  4G6T B;  2DJI A;  3G1O A;  1VQ5 I;  2A05 A;  2LF8 A;  4KUM A;  3E6C C;  1RRJ A;  2ZME C;  3L00 A;  3H3Z A;  2ZJ2 A;  1WJB A;  2L7F P;  1WVR A;  3DLA A;  2YU9 J;  5F1J A;  5E20 A;  5J4V A;  2GIV A;  4X1E A;  2ZFW A;  1LEA A;  2RQQ A;  4BXF A;  5IY5 H;  4R79 A;  3CTA A;  3H36 A;  4A3F J;  3HOX J;  1V5F A;  2VJ5 A;  3C7J A;  4IHV A;  2DK5 A;  3GTO J;  2CSO A;  3F8C A;  4IHT A;  1ZG5 A;  2HXI A;  4BE1 A;  1U3E M;  3OYE A;  1E3H A;  2VQL A;  4YIR X;  5E1X A;  4P96 A;  1XGM A;  3QU6 A;  3BR2 A;  4BS9 A;  3S93 A;  4IHY A;  2YX7 A;  3U2R A;  5LFA A;  2VC1 A;  2EBI A;  1VQL I;  2HFH A;  2DT7 B;  4R8H A;  5KAI C;  3CJR B;  3DKY A;  4HW0 A;  3OYB A;  3LSP A;  1J7K A;  4BHP A;  1ZR4 A;  5HLT A;  3GZN B;  3CJT B;  1A36 A;  2E2I J;  2NRA C;  2V1X A;  3W6V A;  1BR4 A;  2PJP A;  1R71 A;  3ROU A;  3OL4 A;  1K4T A;  2QEN A;  3HM5 A;  4XLE A;  1VND A;  3D5R C;  4E7J A;  4LG0 B;  3ULQ B;  1T0F A;  2FXA A;  3C1D A;  4LB6 B;  4KN7 X;  4A3D J;  3DQV C;  1TNT A;  4M3D A;  4BL0 B;  2UZK A;  3GZ5 A;  5GAE J;  1QHG A;  1R5H A;  1I3A A;  4QWQ A;  3HGY A;  3KP3 A;  4EJW A;  1R22 A;  5DCM A;  3TMO A;  2DMP A;  2R7Z J;  4L5E A;  4XRF A;  1YRN A;  3S1M J;  4HQE A;  1BC7 C;  4M6Y A;  3T8R A;  1G6N A;  2OBP A;  1TQI A;  2XAH A;  4QIW N;  2R7T A;  3ZMU A;  3OYI A;  1ETV A;  1LFP A;  4CYC A;  3QOD A;  2PG4 A;  2F48 A;  4EM2 A;  1LVK A;  2ELJ A;  3M1C A;  4EJU A;  1O4X A;  3K9T A;  2A6E F;  3KEO A;  4M74 A;  1ZLJ A;  2WAD A;  3HHH A;  3ML6 A;  2VON A;  3LFK A;  2DCE A;  2XSJ C;  4LD5 A;  1FX7 A;  2K9L A;  1Q1H A;  1RR7 A;  5ICG A;  2I8D A;  2PX9 A;  4KT6 A;  2JRT A;  3RQ4 A;  1BR1 A;  1KYZ A;  2AQF A;  3A1Y A;  1PDN C;  3K2Z A;  4L9T A;  4C3I J;  3D0S A;  1ZR2 A;  1PUF A;  1E3P A;  1MMN A;  4NBQ A;  2LRE A;  5TIS C;  2HWV A;  1UB9 A;  3CLO A;  5AIP A;  4UNO A;  3H1C A;  2ECC A;  3DTK A;  1X2M A;  2IGK A;  1NK3 P;  1X1C A;  3CLQ A;  3TKY A;  2CV0 A;  4C30 A;  5DM6 F;  3CP8 A;  3CF2 A;  3CO6 C;  2MD5 A;  2MW8 A;  3QYB A;  3QPL A;  3E6M A;  1WI9 A;  3KP4 A;  3LSI A;  3UR3 C;  5J1R A;  4ZYE A;  3F23 A;  4G9Y A;  1G3W A;  3FXU A;  4HNU A;  4NQW B;  1FIP A;  2MGQ A;  3MZY A;  4IRH A;  3JR9 A;  2BVM A;  3HKZ A;  4KIC A;  2Z5U A;  3DBR B;  1X4P A;  2VC0 A;  3R6S A;  1ONV A;  1QPM A;  5EJC A;  2JSP A;  4IEJ A;  1ZQ3 P;  2ZXJ A;  3JRE A;  3RPU D;  5JVT A;  1I5Z A;  3M9A A;  1IJW C;  5HDK A;  2HKX A;  3MWM A;  4N9H A;  4NNJ A;  1LE8 B;  2V6E A;  4CCN A;  1Z21 A;  2K3P A;  1G8X A;  4MQ9 F;  1S29 A;  2ZSI B;  4RLQ A;  4D0P A;  4Y15 A;  5J8F A;  1MIJ A;  2L7M P;  3B6A A;  4QPO A;  5CYV A;  1RET A;  1LUJ B;  4NUB A;  3V7C A;  3RPQ A;  5LEJ A;  4LK1 F;  2B63 J;  5E3M A;  2CW8 A;  2EK5 A;  1BW6 A;  5E3O A;  1D5V A;  3JCU C;  1OR7 C;  4LLN A;  2IA2 A;  2Y30 A;  3GTK J;  2ISZ A;  1X1A A;  5E1W A;  3ZN0 A;  1BBY A;  1B4A A;  2D1V A;  1DU0 A;  5J4Y A;  3HHG A;  2VE8 A;  4WCG A;  4CYD A;  3CCJ I;  2JSC A;  1X3Z B;  4E7H A;  2HU9 A;  4BNC A;  1D0X A;  3CDI A;  1ETW A;  4EEF G;  1IO2 A;  1X1B A;  1O3S A;  1NK2 P;  1XCV A;  4ABZ A;  1DP7 P;  3CQZ J;  1VTN C;  5EGO B;  2HYJ A;  4JYK A;  1MSF C;  3K70 D;  4HF1 A;  5DYM A;  4CCO A;  1J9I A;  5ICE A;  1T8I A;  1T56 A;  2F6C A;  5ILU A;  1B6A A;  3BQY A;  3WG7 H;  3L2Q A;  2MFZ A;  3WU0 A;  3ZP5 A;  1NH3 A;  2P8T A;  2EH3 A;  3V8J A;  2EFP A;  2VT2 A;  4I99 C;  5HVQ C;  4UUS A;  2QSH X;  1LDK B;  2GAU A;  1XDU A;  2IA1 A;  3IHU A;  2IGO A;  4XOP A;  3WGI A;  5F6F A;  1XGO A;  2L9S A;  3S16 J;  3H9J A;  3OYD A;  1N77 A;  4IZZ A;  2QF7 A;  2BHZ A;  4KIT B;  4HYE A;  2Y0M A;  4M72 A;  4PDK A;  2ZXW H;  5LRS A;  1C0W A;  1TT0 A;  2KIQ A;  4JQF A;  3IV5 A;  1WGX A;  3BG3 A;  4M9S A;  4LG3 A;  4HNV A;  1UZC A;  3O6B B;  2VI6 A;  1Z05 A;  2NVX J;  1NG7 A;  2FOW A;  2D2W A;  4DYR A;  2CS3 A;  1APL C;  2VT3 A;  3NWT A;  3CUQ B;  1VQP I;  1ZGA A;  1QU3 A;  4F93 B;  1KZH A;  1ZG1 A;  3HG9 A;  1YOV B;  4XN3 A;  1YI2 I;  3HRS A;  4G7Z F;  2AS5 F;  2CV1 A;  4E7Z A;  2LKP A;  5IYC J;  3RI4 A;  4OIP F;  3FXL A;  3HBL A;  1F5T A;  3H5N A;  2OPT A;  4P55 A;  1PJR A;  2MLG A;  5HLG A;  3SXY A;  2DFH A;  4A0Y A;  5FGM A;  3NQO A;  2DLL A;  2W1O A;  1Y1V J;  2X6Y A;  3FHN A;  1ZRE A;  5IT9 K;  2W7N A;  4EAT A;  5EYR A;  1A6I A;  1L3L A;  2JK3 A;  1O7L A;  2HI3 A;  2HZT A;  4U87 A;  4BQA A;  3CUO A;  4NC7 A;  2JT1 A;  3I58 A;  5M3M J;  2K4J A;  3GTL J;  2XPW A;  1MND A;  4M71 A;  3L9F A;  4Q47 A;  3ZQI A;  4PFP A;  1IV8 A;  3FM5 A;  2R5Z B;  1ETY A;  3GYH X;  4AYB A;  4XR6 A;  2XRL A;  3P9K A;  2O6G E;  2GWR A;  1DGW Y;  3GXO A;  5IT3 A;  2FD5 A;  3SZT A;  1OCC H;  2HZD A;  3F3X A;  2H1K A;  5AIQ A;  3L2C A;  3I64 A;  2HVS A;  1QNT A;  2FML A;  4V2F A;  3JW4 A;  4I02 A;  3VPR A;  4I0B A;  3BPX A;  4XSZ F;  3I3L A;  1GV2 A;  3T8T A;  3J7Y J;  3MKZ A;  5LHG A;  1VQ6 I;  2OZ6 A;  1OCP A;  3T0Y A;  2CW0 F;  5ILV A;  3LST A;  3KET A;  3WTV C;  1WJC A;  3B02 A;  1HQC A;  2HOS A;  3K6G A;  3PL8 A;  3I4P A;  1J75 A;  1O7F A;  4D5F A;  4P9F A;  5K5O A;  4X6A J;  1AKH B;  3NWS A;  4B48 A;  3WTT C;  4ON0 A;  3CMA I;  5FKM A;  3JRD A;  2DA2 A;  3I54 A;  2IW5 A;  3QU3 A;  3ASO H;  2JN6 A;  2LH9 A;  1T38 A;  1JE8 A;  2F5D A;  3EYI A;  2RNG A;  3MKW B;  1WJD A;  3FMS A;  2BE5 F;  2P4W A;  2Z33 A;  3TO6 A;  2XUB A;  3PQJ A;  5FB2 A;  1O3T A;  3I55 I;  1JT0 A;  3AG1 H;  4S0H B;  2K3F A;  1IAW A;  2D5V A;  4XKC A;  4B1R A;  3BR0 A;  1Z67 A;  2V9V A;  3DEU A;  1EV7 A;  3W6K B;  4A6D A;  1W5C C;  1GUU A;  2MG4 A;  1U78 A;  2CUE A;  2GOX B;  4EM1 A;  5D5W B;  5EEG A;  4KNY A;  2Y0S A;  2A3S A;  1QHH D;  4Y52 J;  3MZH A;  4HZF A;  1BJA A;  4IRI A;  2MAB A;  1VZ0 A;  3BZK A;  4A5N A;  3HGG A;  2QZ8 A;  3B73 A;  3I4M J;  1N25 A;  3LFU A;  2E1C A;  4UVB A;  3J7A O;  1LFB A;  4F92 B;  3OYA A;  2MA3 A;  4XRM A;  2XIG A;  1HCR A;  3AG2 H;  2F5C A;  1OYY A;  2KRH A;  4H0E A;  2CQN A;  5A2Q K;  1UJ8 A;  1TWG J;  2HOE A;  2EPF A;  5CLS A;  2JA8 J;  2MH9 A;  1P2F A;  3FXQ A;  5CQG A;  2W82 A;  3T1B A;  3HL2 A;  3AL0 B;  2VXZ A;  4IXA A;  4WF2 A;  2Z16 A;  3BG5 A;  2VKD A;  1H88 C;  4JK1 X;  3RSN A;  2IGN A;  4NC8 A;  3DTI A;  3E5X A;  4II2 A;  4EJO A;  2L4A A;  3CCL I;  4A3J J;  1CGP A;  2QYO A;  2K9S A;  3H92 A;  1I39 A;  4KN4 X;  4J01 A;  3HTU A;  2ACJ A;  1MD0 A;  3K2A A;  2E5Z A;  2K02 A;  1B9N A;  4XRS G;  4GFB A;  2F4O B;  3CCU I;  3RKX A;  1J09 A;  1UCR A;  2EFW A;  2XKP A;  1I27 A;  4C2T A;  1YQA A;  2V1D A;  4C2M J;  1V55 H;  3ERE D;  2R7Q A;  1MNM C;  2VUM J;  3VOD A;  3BT9 A;  5DUI A;  1F43 A;  3DLL F;  1I6H J;  4RGX A;  4FCY A;  2ZC2 A;  1K78 B;  4C3J J;  1SVL A;  2WAQ A;  3NAU A;  2H8R A;  1S7O A;  4B09 A;  4N4O B;  3ONQ A;  3G1L A;  2E1M B;  2ICW G;  5FRM A;  5E1Z B;  4UB8 C;  1JGS A;  2OTJ I;  1P7J A;  3S3O A;  3HDD A;  1H9G A;  4E7K A;  3G1M A;  3RDI A;  2ZXH A;  5K7F A;  2QBY B;  3BG9 A;  4EV0 A;  3LSJ A;  1STZ A;  4E4H A;  5GTH C;  4L9J A;  2QGU A;  2E2H J;  3RKQ A;  3KLN A;  2ADU A;  3G71 I;  1G4D A;  1EJ9 A;  3SFZ A;  1KQ8 A;  2H09 A;  1Q1V A;  2ZBK A;  2DA6 A;  3BG7 A;  4V19 K;  1OIS A;  2DPU A;  3DXJ F;  3OYF A;  2ME0 A;  4F91 B;  4JX4 A;  2QCO A;  3RKY A;  3W2W A;  1R1T A;  3CCS I;  1TZL A;  5LGT A;  3K70 C;  3GTG J;  2VKH A;  3GFM A;  2VBZ A;  2GOM A;  3W6J B;  1F4K A;  4MO7 A;  2XAJ A;  1SC7 A;  3BTC A;  4WXD A;  1U5T B;  2XRO A;  2QQA A;  2VB6 A;  4GRI A;  1FTZ A;  5H6Q A;  1N75 A;  2XAQ A;  4XLP F;  2HPM A;  2ZJR F;  1K83 J;  3FXM A;  2HDD A;  3VOE A;  5L3E A;  3OWT A;  5DM7 F;  2P5K A;  3H5R A;  4GYI A;  1QVU A;  4MIM A;  2M0M A;  1LDJ A;  2Z3Y A;  3ZRG A;  3OS0 A;  4E7L A;  5D5V B;  4CA0 A;  1FWZ A;  2KIM A;  1UFM A;  5CVI A;  2K85 A;  2LKX A;  2ESH A;  2BY3 A;  2FOK A;  3WTS C;  2K5C A;  5LHI A;  4UHT A;  2XGX A;  1CQT A;  1ZLK A;  1IXR C;  4J19 A;  1LPQ A;  1LVA A;  3OOU A;  1SFU A;  1WH7 A;  2MD0 A;  3OSG A;  4UXN A;  3S8P A;  4IPA A;  3JRA A;  1FP1 D;  3Q3S A;  2OCC H;  2IS1 A;  2RV8 A;  2WAF A;  3K1N A;  4NC6 A;  3H9Q A;  1MW7 A;  1FSE A;  3F8M A;  3IUO A;  3R4K A;  1IRG A;  1GVD A;  1YS6 A;  2ETH A;  4M6X A;  1WHU A;  3CMM A;  2VOO A;  5M5X J;  1G59 A;  4W97 A;  1RUN A;  4DYC A;  3E5Q A;  5D5X B;  2L9V A; 
#chains in the Genus database with same CATH homology
 3HRT A;  1W4M A;  4FHT A;  1XSX A;  3HOS A;  2ZKZ A;  2DT5 A;  3V7S A;  1DPR A;  3VB2 A;  4ZYD A;  2PEX A;  1XDS A;  2FU4 A;  2NS0 A;  3F22 A;  1FBQ A;  3VEP A;  5E8I A;  1EH8 A;  1MZB A;  2GA2 A;  2J5P A;  4G6Q A;  1T39 A;  4O6J A;  4I01 A;  2FA5 A;  3Q9V A;  4LK0 F;  2ZNY A;  3HIF A;  2HS5 A;  3FZV A;  3V4G A;  4A12 A;  2STT A;  4ENM A;  1SMT A;  5TJJ A;  4ZH4 F;  2WWY A;  1SD4 A;  3OOP A;  4GYG A;  5K5R A;  3BJA A;  1R58 A;  1KA8 A;  3R60 A;  3SHF A;  2L4M A;  1PP8 F;  2OAZ A;  2PMH A;  1J59 A;  2A69 F;  4OIN F;  3J81 K;  3K1P A;  1YYV A;  4HX4 A;  5IT9 Z;  1U5T C;  1FNN A;  1I1G A;  3ZQ7 A;  2JPB A;  2F2E A;  3F8N A;  1TW3 A;  3I59 B;  3I5U A;  4R1H A;  1FZP B;  5JR3 A;  3I53 A;  3RTR A;  5DEQ A;  3GZ6 A;  2CO5 A;  5CVR A;  4CDG A;  1Z6R A;  1FOK A;  3VFZ A;  3Q9S A;  2R7D A;  5LRR A;  3DFG A;  4G7H F;  2AXL A;  1RI7 A;  1R1U A;  3K1M A;  1UHM A;  2STW A;  5BOX A;  1LB2 A;  3QPT A;  3BY6 A;  2ZO4 A;  1IN4 A;  2DI3 A;  3BDD A;  4Q48 A;  3T5X A;  1OR7 A;  5DV5 A;  2A5Y B;  3GLX A;  2O61 A;  1R1V A;  4LG0 A;  4A2U A;  3GFL A;  1ODD A;  5DCM B;  1KQ9 A;  4HAM A;  5BPI A;  1S6L A;  2CGP A;  1YW9 A;  1HSJ A;  3QAH A;  1FT9 A;  5FFX A;  1EH6 A;  1SAX A;  4EJT A;  2PBI A;  2W24 A;  4RB3 C;  1ZRC A;  2HDC A;  2MC3 A;  4HLX A;  2DPD A;  1K6O A;  2FEZ A;  3RJP A;  2P6T A;  3NEU A;  4ZZD A;  3IWZ A;  4ESF A;  3E3V A;  1IXS B;  2GXG A;  1F1Z A;  1FC3 A;  5A2Q Z;  3N97 A;  4OMY A;  4AIK A;  3GWZ A;  3HRM A;  2ZNZ A;  2CG4 A;  1DUX C;  2O0Y A;  2KIU A;  3WGH A;  2Y75 A;  3KLO A;  3JSO A;  5L3C A;  3QRF F;  3JTG A;  5FO5 A;  1GXQ A;  2FF4 A;  1TLH B;  3BWG A;  2D45 A;  2IRF G;  2OD5 A;  2O03 A;  1HBX G;  2OQR A;  1XCB A;  3BRO A;  3F8B A;  2P7C B;  4EQQ A;  2BGC A;  1XN7 A;  2HR3 A;  3R0A A;  2M45 A;  2PMU A;  5F1R A;  3WTW C;  3GVA A;  4RB1 A;  3WTY C;  1RIO H;  5E17 F;  2DW4 A;  2VBY A;  4KFC A;  1T98 A;  5JHU A;  2P6S A;  2A68 F;  1OYW A;  2GA1 A;  4G8X A;  4YG2 F;  3BOQ A;  2PQ8 A;  2PLY A;  2Z99 A;  1MJB A;  3GFI A;  2VE9 A;  3E97 A;  4YFN F;  3O2P E;  4ZYH A;  2K86 A;  3G73 A;  3PQK A;  2DQL A;  2F5E A;  1ZAR A;  4MGR A;  5J8C A;  3JSP A;  2UWM A;  2FNP A;  4A0X A;  1R23 A;  3C3W A;  5HLI A;  3KP5 A;  3HTS B;  4AVP A;  1T6S A;  3OV8 A;  4RB2 C;  3GW2 A;  4YFX F;  1QO0 D;  2IT0 A;  2G9W A;  2VOP A;  2DU9 A;  5FD5 A;  2FSW A;  1IW7 F;  1SFX A;  1R36 A;  2R7F A;  4L9V A;  2L3D A;  4DNC A;  3EET A;  1JHH A;  2KIF A;  2MLK A;  5HOO A;  1XMA A;  3HUG A;  2HTJ A;  4OIQ F;  1TBX A;  2X4H A;  3JAM Z;  1SD6 A;  2DAO A;  1V4R A;  2H6B A;  1TNS A;  1LDD A;  4LMY A;  1L0O C;  2P7V B;  1LQ1 A;  4Y17 A;  3WTU C;  1A04 A;  4ZYG A;  1BI2 A;  4XLN F;  5BS6 A;  4HV5 A;  4L0Z B;  1ZRF A;  1BOA A;  1U6G A;  2XHK A;  3C18 A;  2LSO A;  4XSX F;  2Z9O A;  1YIO A;  4U7D A;  1T2K A;  3FMQ A;  3RPU A;  2YX4 A;  3LA2 A;  4LLG F;  4ENN A;  3N4M A;  2HKO A;  3TOB A;  5HLH A;  1FP2 A;  5LBQ A;  3KE2 A;  4G6D A;  1WWX A;  1MDM B;  1LEB A;  4MEX F;  5JI6 A;  3RYR A;  2IJL A;  1UST A;  1ZGJ A;  2XVC A;  2XV4 S;  1XB4 A;  4F7Z A;  3J81 Z;  2IVM A;  4GCV A;  5FFZ A;  1FBS A;  4KIB A;  4NHJ A;  5TRD A;  5F64 A;  4ESJ A;  4PZJ A;  4LB5 A;  1MJA A;  3ZMV A;  3E6B A;  5BMZ A;  2IA0 A;  2EV6 A;  2YSR A;  3J80 K;  1WQ2 A;  2OA4 A;  3GUD A;  5BQT A;  3FMR A;  4WX9 A;  1FBU A;  3DF8 A;  2HQR A;  1MKM A;  4MTD A;  1XSD A;  3CUQ C;  2HEO A;  3M1E A;  3KP2 A;  2E7X A;  1ZHF A;  4RAY A;  2W57 A;  2M30 A;  2K7L A;  4ENJ A;  4AIH A;  1ON2 A;  4BYY A;  1QBJ A;  1LJ9 A;  3DPL C;  5D5U B;  3O3K A;  2H94 A;  3V8L A;  2LNB A;  2QM3 A;  2LF7 A;  1XMK A;  1LNW A;  3F21 A;  1FY7 A;  1KU3 A;  1YW7 A;  3RIR A;  4L9N A;  1HW5 A;  3MQ0 A;  5BPD A;  4HDV A;  2QQB A;  2MH2 A;  2IP2 A;  3BJO A;  4ETS A;  4FX0 A;  3M7G A;  3JTH A;  2HTS A;  2VBW A;  3ECH A;  3NRV A;  4RGS A;  4ASN A;  1XGS A;  3HSE A;  4IF4 A;  3BJ6 A;  1SFE A;  5CVV A;  2A07 F;  1D3Y A;  1IN7 A;  1KYW A;  2NAZ A;  2YPR A;  4MQV A;  5AON A;  1WKM A;  2FQ3 A;  1KU7 A;  3ABT A;  2VBX A;  2VOD A;  2P5L C;  4MEY F;  4DQ2 A;  3U1D A;  2RC4 A;  5D4R A;  4YII A;  4L18 B;  4IJA A;  2VN2 A;  2CQK A;  2KJB A;  4M73 A;  1P4X A;  3DKW A;  2W85 A;  3ECO A;  2ZME A;  2NNN A;  1I1S A;  4Z2Y A;  5LHH A;  1FLI A;  2QVO A;  3MCZ A;  2E1N A;  1CF7 A;  3S2W A;  2IPQ X;  1V3F A;  1W7P A;  4YFK F;  2F5F A;  4HX8 A;  2CWE A;  4XBF A;  2FRH A;  4JBA A;  2M87 A;  4A0Z A;  3AAF A;  3P7N A;  1DDN A;  4IRG A;  3IWF A;  1S7A A;  2Q2E A;  2EV5 A;  2EWN A;  4QLC U;  3M8F A;  5DDG A;  2QQ9 A;  3BZ6 A;  3KZY A;  4BAY A;  2EA2 A;  5L3G A;  5D6E A;  5D8K B;  3BP8 A;  2ESN A;  3GO5 A;  1TQP A;  4BHB A;  2DQR A;  1S3J A;  4N0B A;  3LQR A;  4N9I A;  5ILS A;  4RGR A;  4OIR F;  3I71 A;  4EVI A;  1HKS A;  1KGS A;  4WK8 F;  1HW2 A;  4BH9 A;  1HST A;  4U88 A;  1ZG3 A;  2TDX A;  1YO5 C;  2EA4 A;  1R5G A;  4ESB A;  2BEO A;  1WRJ A;  5E18 F;  3CJN A;  1J5Y A;  1XSV A;  1H9T A;  3TO9 A;  3SQN A;  1QZY A;  3GFJ A;  1HKQ A;  3QP6 A;  5D8L B;  1PP7 U;  3MAJ A;  3I0T A;  4MNU A;  1YLF A;  1OKR A;  4BHC A;  2KRF A;  2D1H A;  2FNA A;  2PN6 A;  1E2X A;  1DPU A;  1Z9C A;  1BC8 C;  2WV0 A;  1ZH5 A;  3L7W A;  3I59 A;  4I0A A;  4A6E A;  1BM9 A;  2PFB A;  1IRF A;  5HDG A;  2DTR A;  4O5V A;  2GZW A;  4EMS A;  1XGN A;  1Z91 A;  4KIG A;  4Q4Z F;  1ON1 A;  1JXS A;  5LEK A;  2WC2 A;  5FLX K;  2RN7 A;  1R00 A;  1ZRD A;  2PI0 A;  6PAX A;  4IVN A;  3WOD F;  4I98 B;  2E7W A;  4KYW A;  4AWX B;  3QP5 A;  1G3T A;  2P5V A;  2JPC A;  4HOB A;  2UXN A;  3U9G A;  1B9M A;  2YU3 A;  2EV0 A;  3QOP A;  4NB5 A;  5E8G A;  2OZU A;  3FWE A;  4B8X A;  4M9X A;  5JFR A;  4Q5S F;  4TV7 A;  3COA C;  2RGV A;  4I2O A;  3J80 Z;  4P5O A;  2J5O A;  1G3S A;  4UVC A;  1Z1D A;  1OYI A;  1QQI A;  2L54 A;  2OU2 A;  2XRN A;  1IN5 A;  2RKH A;  1RUO A;  2XKO A;  2CFX A;  2XAF A;  2FMY A;  2COM A;  1PUE E;  3DPT A;  4M9Z A;  2WTE A;  4P9U A;  3WE3 A;  3EDP A;  2W25 A;  2M1B A;  3ISP A;  3DP7 A;  2JTV A;  2V1U A;  4AD9 A;  3TGN A;  4U0V A;  2NNY A;  4UV8 A;  3IL2 A;  4NQW A;  1G3Y A;  4UV9 A;  1ULY A;  2L02 A;  4PGH A;  3V7R A;  2A61 A;  3HSF A;  1J0R A;  3ELK A;  4CO8 A;  2HGC A;  2XAS A;  4KA4 A;  1GHC A;  1HKT A;  1B59 A;  3EYY A;  3H3U A;  2QWW A;  5LGU A;  1S8N A;  2C6Y A;  1MGT A;  4OMZ A;  3FHZ A;  1D8K A;  3LQQ A;  5HS8 A;  5ERI A;  2EFQ A;  4IHS A;  3WU1 B;  4HLY A;  3ABU A;  2BV6 A;  3FM3 A;  4I7H A;  5J6X A;  4PGG A;  4G7O F;  1OPC A;  4RAZ A;  5DCF A;  3RYP A;  3SZP A;  4U0Y A;  2KKO A;  2X0L A;  4KDP A;  4RGU A;  2ISY A;  3LAP A;  1Z7U A;  3HOT A;  4CZZ A;  4PCQ A;  3E6D A;  1UHW A;  4HF2 A;  3QPH A;  5FD6 A;  4MTE A;  3L09 A;  1IXC A;  1AWC A;  3BPV A;  3KEQ A;  5CVU A;  3E5U A;  1OMI A;  1IN6 A;  4KIF A;  5ED4 A;  1HXD A;  1REP C;  2L01 A;  1NHA A;  4EJV A;  5CVJ A;  2O3F A;  1W5T A;  1FYL A;  2XAG A;  3P9I A;  3GX4 X;  1IN8 A;  1SD7 A;  3DV8 A;  1FYK A;  3KP7 A;  1USS A;  1YW8 A;  3IKT A;  3TO7 A;  1BIA A;  4GGG A;  2DFI A;  4L0Y B;  3R61 A;  2OQG A;  1WSU A;  1YS7 A;  3LA7 A;  2EB7 A;  3CUQ A;  2QUF A;  4L5I A;  3F72 A;  2V6C A;  3LWF A;  4G94 A;  5L3F A;  2EFN A;  4UVA A;  3PFI A;  2A6H F;  4ZZL A;  4AIJ A;  3Q5F A;  1KQ0 A;  1U8R A;  3F6O A;  3HSR A;  1YFH A;  1O3R A;  4GXO A;  2QLZ A;  3V8K A;  2M8E A;  1O57 A;  5D6F A;  4CHU A;  5L3D A;  1FPQ A;  5HDN A;  3IRR A;  3KCC A;  2DK8 A;  1D8J A;  1GVJ A;  1RZ4 A;  2NYX A;  3F8F A;  1MDM A;  4OIO F;  1BIB A;  1IZ1 A;  1SD5 A;  2GQQ A;  1YTY A;  1HW1 A;  2MBF A;  2FBK A;  4OU0 A;  1W5S A;  4HQM A;  2K4B A;  1KU9 A;  1Y0U A;  2YR2 A;  4WXH A;  3P9C A;  3FX3 A;  3GEZ A;  5HS9 A;  1E17 A;  5LLQ A;  4U7B A;  3HRU A;  4GO1 A;  3MFK A;  3TQN A;  3D5L A;  1W7P D;  3GF2 A;  4KMU X;  3ZMD A;  3LAJ A;  2FBI A;  1MJ9 A;  4L5J A;  1ZYR F;  4HA8 A;  1ZAO A;  2ZCW A;  2RVC A;  5FLX Z;  1O3Q A;  3WTZ A;  5DUK A;  5KVR A;  5LGN A;  2JZY A;  1Z6T A;  2ELH A;  4LLL A;  4EM0 B;  1EH7 A;  3WE2 A;  2Q0O A;  1QZZ A;  3TDZ C;  1IF1 A;  4CXF A;  1GXP A;  2H6C A;  4FT8 A;  1P4A A;  1F9N A;  4K2E A;  3ZMT A;  4ENK A;  3KP6 A;  4WXC A;  2FE3 A;  1FYM A;  1TTY A;  4EGZ A;  2R3S A;  3WTX C;  3G3Z A;  5L3B A;  3M8E A;  5K1Y A;  5K5Q A;  3FXR A;  4A5M A;  2G7U A;  2EFO A;  2HQN A;  4MHG A;  1K78 A;  2H27 A;  3WGG A;  3R0J A;  1BI1 A;  5KK1 A;  4YIF A;  3CO7 C;  2KJC A;  4RS8 A;  1SMY F;  1P4W A;  3EQL F;  3ZMS A;  2BYV E;  3F6V A;  1JHF A;  1J2X A;  4E70 A;  2QBY A;  4HV6 A;  1K7A A;  5HS7 A;  3EUH A;  2RQP A;  2BBY A;  1R7J A;  1YG2 A;  5DD4 A;  2DO7 A;  5DD8 A;  3IC7 A;  3ZPL A;  2CYY A;  2ZME B;  2HYF A;  4U0W A;  2G7H A;  1U5T A;  3MEX A;  1I6X A;  4OOI A;  1FSH A;  4LGW A;  3IKV A;  2FBH A;  1ZN2 A;  5D4S A;  4HX7 A;  4HDU A;  4CGZ A;  2M5W A;  1CF7 B;  4BXU A;  5ICC A;  1IUY A;  3LA3 A;  3CDH A;  1W7P B;  4EGY A;  1H0M A;  1K79 A;  3HYI A;  4O3M A;  2W84 A;  4I09 A;  5ICF A;  2HYG D;  3KFW X;  3KZZ A;  4KMF A;  1X3U A;  2K27 A;  2EJR A;  1U2W A;  3FF5 A;  2O8X A;  2V79 A;  1TQM A;  2Y48 A;  4HBL A;  3K0L A;  2LDU A;  1KU2 A;  2RNJ A;  4Y13 A;  1XD7 A;  1BI0 A;  1QGP A;  3JAM K;  3K69 A;  2GXB A;  3RKW A;  1BN5 A;  4KT5 C;  2DBB A;  2Q8K A;  1B1B A;  5H20 A;  4CIC A;  4FX4 A;  4LJZ F;  3REO A;  3ZMZ A;  3TOA A;  1P6R A;  4S04 A;  4UUV A;  5EEH A;  4LFU A;  4WWC A;  1AOY A;  3WG9 A;  1TW2 A;  2RDP A;  4HF0 A;  5H6R A;  2UXX A;  4RB0 A;  1BI3 A;  2B0L A;  1RNL A;  3TDU C;  1P92 A;  5CJ9 A;  3ZN1 A;  3IRQ A;  4S05 A;  2LF8 A;  4KUM A;  3E6C C;  3L00 A;  3H3Z A;  2ZJ2 A;  5E20 A;  2GIV A;  2ZFW A;  1LEA A;  4R79 A;  3CTA A;  3C7J A;  2DK5 A;  2CSO A;  3F8C A;  4IHT A;  1ZG5 A;  1U3E M;  5E1X A;  4P96 A;  1XGM A;  3QU6 A;  2YX7 A;  3U2R A;  2VC1 A;  2HFH A;  4R8H A;  4HW0 A;  1J7K A;  4BHP A;  2NRA C;  2PJP A;  2V1X A;  3ROU A;  2QEN A;  4LG0 B;  3ULQ B;  1T0F A;  2FXA A;  3C1D A;  4LB6 B;  4KN7 X;  3DQV C;  1TNT A;  2UZK A;  3GZ5 A;  1R5H A;  4QWQ A;  3KP3 A;  4EJW A;  1R22 A;  5DCM A;  4XRF A;  4HQE A;  1BC7 C;  4M6Y A;  3T8R A;  1G6N A;  2OBP A;  1TQI A;  2XAH A;  3ZMU A;  2PG4 A;  4EM2 A;  4EJU A;  3K9T A;  2A6E F;  3KEO A;  4M74 A;  1ZLJ A;  3HHH A;  3ML6 A;  2VON A;  3LFK A;  4LD5 A;  1FX7 A;  1Q1H A;  5ICG A;  2JRT A;  1KYZ A;  1PDN C;  3K2Z A;  4L9T A;  3D0S A;  2HWV A;  1UB9 A;  3CLO A;  5AIP A;  4UNO A;  3TKY A;  3CO6 C;  2MD5 A;  3E6M A;  1WI9 A;  3KP4 A;  3F23 A;  4ZYE A;  4G9Y A;  1G3W A;  3FXU A;  3MZY A;  4IRH A;  4KIC A;  2Z5U A;  3R6S A;  2VC0 A;  1ONV A;  1QPM A;  2ZXJ A;  5JVT A;  1I5Z A;  3M9A A;  5HDK A;  2HKX A;  3MWM A;  4N9H A;  4MQ9 F;  1S29 A;  4D0P A;  4Y15 A;  5J8F A;  5CYV A;  3V7C A;  3RPQ A;  5LEJ A;  4LK1 F;  2EK5 A;  1D5V A;  4LLN A;  2IA2 A;  2ISZ A;  5E1W A;  3ZN0 A;  1BBY A;  1B4A A;  2D1V A;  3HHG A;  2VE8 A;  4WCG A;  4CYD A;  2JSC A;  4BNC A;  1O3S A;  1XCV A;  1DP7 P;  1VTN C;  4HF1 A;  5DYM A;  1J9I A;  5ICE A;  5ILU A;  1B6A A;  3WU0 A;  3ZP5 A;  2P8T A;  3V8J A;  2EFP A;  2VT2 A;  5HVQ C;  1LDK B;  2GAU A;  1XDU A;  2IA1 A;  3IHU A;  3WGI A;  5F6F A;  1XGO A;  4HYE A;  2Y0M A;  4M72 A;  4PDK A;  5LRS A;  1C0W A;  4JQF A;  4M9S A;  3O6B B;  1Z05 A;  2D2W A;  2VT3 A;  3CUQ B;  1ZGA A;  1ZG1 A;  3HRS A;  4G7Z F;  2AS5 F;  2LKP A;  3RI4 A;  4OIP F;  1F5T A;  4P55 A;  2MLG A;  5HLG A;  3SXY A;  4A0Y A;  5FGM A;  3NQO A;  2DLL A;  1ZRE A;  5IT9 K;  1L3L A;  1O7L A;  2HZT A;  4BQA A;  3CUO A;  2JT1 A;  3I58 A;  2K4J A;  4M71 A;  3L9F A;  4Q47 A;  3FM5 A;  3GYH X;  3P9K A;  2O6G E;  2GWR A;  3GXO A;  5IT3 A;  3SZT A;  3F3X A;  5AIQ A;  3L2C A;  3I64 A;  1QNT A;  2FML A;  3JW4 A;  4I02 A;  4I0B A;  3BPX A;  4XSZ F;  3T8T A;  5LHG A;  2OZ6 A;  3T0Y A;  2CW0 F;  5ILV A;  3LST A;  3KET A;  3WTV C;  3B02 A;  1HQC A;  3I4P A;  1J75 A;  1O7F A;  4P9F A;  5K5O A;  3WTT C;  4ON0 A;  3I54 A;  2IW5 A;  3QU3 A;  1T38 A;  1JE8 A;  2F5D A;  3EYI A;  3FMS A;  2BE5 F;  2P4W A;  2Z33 A;  3TO6 A;  2XUB A;  3PQJ A;  5FB2 A;  1O3T A;  1IAW A;  3DEU A;  2V9V A;  4A6D A;  1EV7 A;  3W6K B;  1U78 A;  4EM1 A;  5D5W B;  5EEG A;  4KNY A;  2A3S A;  3MZH A;  4HZF A;  1BJA A;  4IRI A;  4A5N A;  2QZ8 A;  3B73 A;  2E1C A;  4UVB A;  3J7A O;  2MA3 A;  2XIG A;  2F5C A;  1OYY A;  4H0E A;  5A2Q K;  2HOE A;  5CLS A;  2MH9 A;  1P2F A;  3FXQ A;  3T1B A;  2VXZ A;  4IXA A;  4WF2 A;  4JK1 X;  3E5X A;  4EJO A;  2L4A A;  1CGP A;  2QYO A;  3H92 A;  4KN4 X;  3HTU A;  2ACJ A;  1MD0 A;  2K02 A;  1B9N A;  3RKX A;  1UCR A;  2EFW A;  2XKP A;  1I27 A;  1YQA A;  2V1D A;  3ERE D;  3VOD A;  5DUI A;  4RGX A;  1K78 B;  1S7O A;  4B09 A;  5E1Z B;  1JGS A;  1H9G A;  3RDI A;  2QBY B;  4EV0 A;  1STZ A;  4L9J A;  3KLN A;  2ADU A;  1G4D A;  1KQ8 A;  3SFZ A;  2H09 A;  2ZBK A;  2DPU A;  3DXJ F;  3RKY A;  1R1T A;  5LGT A;  3GFM A;  2VBZ A;  1F4K A;  3W6J B;  2XAJ A;  4WXD A;  2XRO A;  1U5T B;  2QQA A;  5H6Q A;  2XAQ A;  4XLP F;  3VOE A;  5L3E A;  2P5K A;  4GYI A;  1LDJ A;  2Z3Y A;  5D5V B;  1FWZ A;  2KIM A;  1UFM A;  5CVI A;  2ESH A;  2FOK A;  3WTS C;  5LHI A;  4UHT A;  2XGX A;  1ZLK A;  1IXR C;  1LVA A;  1SFU A;  4UXN A;  4IPA A;  1FP1 D;  2RV8 A;  3K1N A;  1FSE A;  3F8M A;  3R4K A;  1IRG A;  1YS6 A;  2ETH A;  4M6X A;  2VOO A;  1RUN A;  3E5Q A;  5D5X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...