5ILVA

Uninhibited etv5
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
92
structure length
92
Chain Sequence
GSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords ETS translocation variant 5
publication title Structured and disordered regions cooperatively mediate DNA-binding autoinhibition of ETS factors ETV1, ETV4 and ETV5.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2016-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5ilvA00
2ZCWA 1HKQA 4ZYEA 1B9MA 4EJVA 1TW2A 2YX7A 3WODF 2V1XA 4R79A 1R1TA 4Y15A 2DLLA 3O6BB 2PN6A 1BIAA 5CJ9A 1BI0A 3BZ6A 4A5MA 3BY6A 5K5RA 2GA1A 3GFLA 4I7HA 1MKMA 4F7ZA 4CGZA 1G3WA 2CQKA 2CFXA 2K86A 5FO5A 2VOOA 4A5NA 3DP7A 2XROA 4UUVA 1GVJA 3ABTA 4N0BA 5ERIA 3ZN1A 2W57A 4HF2A 3WTTC 1RIOH 2DFIA 1S7OA 3SQNA 2ZMEB 3CLOA 3NEUA 2V6CA 3ZMSA 3SFZA 3F8MA 5J8CA 3C1DA 3G73A 1P4XA 3TKYA 1YS6A 2XRNA 3E5QA 4M9ZA 1PUEE 4MTDA 3KE2A 1ZRDA 2FBKA 3QOPA 1ONVA 1R5HA 1EH7A 4MEYF 2A6EF 1Z6RA 3L00A 4E70A 5A2QK 1FP2A 4MGRA 5HDGA 3MWMA 1D3YA 4HBLA 4EV0A 4XSXF 4B8XA 3HRSA 3FZVA 4D0PA 2STTA 1SMTA 4WK8F 1B6AA 1MD0A 1ZH5A 2E7XA 2R3SA 5LRRA 2HR3A 5E20A 2YU3A 4PCQA 4MHGA 4OIPF 1KQ0A 4UNOA 3D0SA 5DD8A 1MZBA 2VOPA 3LAJA 1H0MA 2V1DA 4HF0A 3DKWA 3ECHA 4OINF 3LQRA 3M1EA 4HLYA 3ELKA 4P9FA 4YFKF 5ICEA 2HYGD 5BS6A 4HX7A 1CF7A 1XGOA 5HDNA 4NQWA 1F5TA 2BGCA 4CYDA 4L0ZB 3IRRA 2FMLA 2OBPA 4FX0A 2GZWA 5BOXA 5BPIA 3CUOA 1IF1A 3EETA 4BYYA 2ZNZA 5DCFA 5BQTA 4KNYA 1SMYF 1LNWA 3CUQA 2DQLA 5CVIA 4KT5C 4ETSA 1YS7A 3E5UA 5LRSA 3S2WA 3GYHX 2IW5A 2LSOA 4UHTA 2NS0A 3M9AA 1KU9A 5HLIA 2YX4A 1S3JA 4EJOA 1Q1HA 3HTSB 4G7OF 5ICFA 2H94A 3BP8A 3I59B 4AIKA 5L3EA 1V4RA 5LGTA 3BDDA 1R23A 3F8BA 2MH9A 5IT9K 2Q0OA 4B09A 5L3DA 5D5UB 1SD5A 4IJAA 2A07F 2L4MA 3T1BA 3FHZA 2V79A 3GZ5A 2JTVA 1EH6A 2P7VB 1LDDA 3P7NA 4UXNA 3U1DA 3HRUA 3O2PE 2GXGA 5TJJA 1I27A 2RDPA 2E7WA 5CLSA 3GWZA 5DV5A 1JGSA 3K0LA 3U9GA 1FBQA 1FSHA 1BC8C 1P92A 1UHWA 4KMFA 5HVQC 3WU1B 1J0RA 2K4JA 4RGUA 1YFHA 5IT3A 3V4GA 1PDNC 4CO8A 1Y0UA 2M30A 2B0LA 5DUKA 2Z9OA 3TDZC 3WTYC 2PMUA 2V1UA 4Z2YA 4DNCA 1WWXA 4HV6A 4BXUA 4GO1A 4ESJA 2HDCA 1Z91A 2H6BA 1XD7A 5TRDA 2JPCA 2D45A 2EFNA 4RGRA 2VT2A 3KETA 2ZMEA 2PG4A 4P9UA 1BOAA 1SD7A 4WXDA 1TBXA 4ZZLA 1QPMA 3SHFA 1HW1A 3DV8A 4IRHA 5E1ZB 1OPCA 2UZKA 1K79A 2OAZA 2RNJA 3K1PA 1HQCA 1AOYA 4OMYA 2C6YA 1I6XA 2ZO4A 2XGXA 1ZG3A 2A6HF 2MC3A 3R0JA 4IHTA 5FD5A 4BHBA 4OIRF 4I09A 1ZGJA 5CVUA 3VEPA 1H9TA 4EM2A 3F23A 5HLHA 4JQFA 5DCMB 1ZHFA 4KIFA 3J81K 2AS5F 3JAMZ 4NHJA 1J2XA 4ZYGA 3WE3A 5FLXZ 1R22A 3CO6C 1GXQA 4XLPF 4U7BA 2IJLA 3J80Z 1O3TA 1C0WA 1K78B 2WV0A 5HOOA 2Y0MA 1P4WA 1DDNA 1FY7A 1FYMA 4BHCA 3SZPA 3HUGA 4HX4A 4GXOA 4A0ZA 4ZZDA 5J8FA 3EQLF 1W5SA 2IPQX 1IN5A 4P55A 2P4WA 3L2CA 4WXCA 1IAWA 3REOA 2FBHA 3B73A 4HQMA 2VBWA 3F8NA 2A69F 1EH8A 2VE9A 4OU0A 1A04A 1ON1A 4LJZF 4HLXA 1FPQA 3TOAA 4HA8A 3E6DA 2FEZA 1BJAA 3FF5A 2RQPA 2JZYA 2QENA 1D8JA 1RUOA 3ZPLA 4HDUA 4I01A 3L09A 3K2ZA 3OV8A 2PBIA 2X0LA 1W7PD 3M7GA 4LMYA 4HW0A 1ZN2A 3P9CA 3KP4A 1XMAA 2F2EA 3PQJA 1BI2A 2F5CA 3C18A 2QZ8A 2XAFA 3I59A 3K69A 3I71A 2M45A 4EGYA 5F6FA 2Z99A 1GXPA 5E8GA 4IHSA 2EA4A 1O7FA 4L9NA 2HQNA 3J7AO 5DD4A 2V9VA 3BOQA 4Y17A 2CG4A 4XRFA 3MEXA 4P96A 5LGUA 2BE5F 2E1NA 5LHIA 1DPRA 2IVMA 3GZ6A 1F9NA 2BYVE 4MEXF 4ZH4F 3L7WA 3ECOA 1F4KA 3FWEA 4BH9A 4M71A 1Z7UA 5L3GA 5FD6A 5EEGA 2XUBA 1EV7A 3NRVA 1BIBA 4L9TA 3LA3A 4NB5A 5LHHA 2CW0F 1U8RA 4AIHA 2HKXA 1LEAA 2MH2A 1S7AA 4EJTA 2XAJA 4OIOF 2L01A 3GUDA 1YW8A 3GFJA 1IRGA 4Y13A 2HYFA 4EJUA 3HYIA 3RYPA 4HQEA 3KEQA 3KZZA 2L4AA 1YO5C 1RUNA 3M8FA 4M73A 4ESBA 1T98A 1IXCA 2ESNA 1UCRA 3M8EA 3ROUA 1XB4A 2PEXA 2P5LC 2GWRA 2FF4A 2K4BA 1I1GA 2FBIA 2OU2A 4A0XA 3IHUA 1O3QA 1IXSB 1HSTA 4G8XA 4GGGA 1WKMA 1B4AA 2IT0A 3F6OA 4M6XA 3IKTA 4UV9A 2QQAA 4KA4A 4G9YA 5A2QZ 5DCMA 3TO7A 3ZP5A 4G7ZF 3RDIA 1E2XA 4O5VA 4JBAA 1BN5A 2O61A 2WWYA 3HSRA 2VXZA 5AONA 3F6VA 2DPUA 1G4DA 4UVCA 1QGPA 1K78A 3ERED 3HTUA 3DPTA 2RN7A 2LF8A 1T39A 2KJCA 2HKOA 3CUQC 2EV0A 1TQMA 1RZ4A 3CTAA 2DT5A 5D6EA 2RC4A 3KP2A 3QPTA 2PFBA 5K5QA 2DPDA 4HF1A 2XASA 1XN7A 2MLGA 1STZA 4M74A 4A6DA 1USSA 1ZAOA 1BI3A 5ICGA 1V3FA 2EFOA 2F5EA 3RJPA 1P6RA 1FP1D 1XGMA 4XBFA 1MJAA 1ZRFA 3W6JB 2DTRA 3GLXA 3EYYA 3TOBA 3NQOA 3WTWC 1MGTA 3IKVA 4IPAA 5E8IA 4I02A 3JTGA 3HSEA 2UXXA 4ESFA 5LGNA 4ZYDA 3GFMA 4ENMA 2GQQA 4XSZF 2G7HA 4LG0B 2KRFA 4MTEA 1OYWA 2UWMA 2ACJA 2RVCA 5DYMA 5HS8A 4RGSA 3I58A 3WTUC 1QZZA 1TLHB 3DQVC 1USTA 2P6TA 2O0YA 5BMZA 3R6SA 5DDGA 2VC0A 4ZYHA 1HXDA 1P4AA 1IZ1A 2HQRA 4M9XA 3K1MA 2ZXJA 4A2UA 1ZG1A 4WF2A 4O3MA 3D5LA 5IT9Z 3GXOA 2YPRA 3KP5A 4YIIA 2VBZA 4U7DA 1XMKA 4RS8A 3CJNA 2LKPA 3BPXA 1F1ZA 2O03A 1R7JA 3T8TA 2RGVA 3HHHA 2A5YB 3FM5A 4FHTA 3FXRA 1IW7F 1B9NA 3E6MA 2VC1A 4RAYA 1TW3A 1BI1A 1ZLJA 5E17F 3CO7C 4GCVA 5HS7A 1SFEA 1FBSA 3KP7A 3RI4A 3F3XA 4G6DA 4PGHA 4R8HA 3MAJA 3Q9VA 2Z33A 3DF8A 4P5OA 3R61A 2F5DA 2QM3A 1IXRC 5D4SA 5CVRA 4WCGA 3TGNA 4Q48A 3P9KA 3PFIA 2QBYB 1IN6A 2QVOA 3WTXC 1WRJA 3I5UA 1MDMB 2RV8A 2FNPA 4HAMA 2IA1A 3HIFA 3DXJF 1YLFA 5K1YA 1PP8F 2DK5A 1FLIA 2XKOA 4XLNF 4EJWA 3COAC 3CDHA 4I2OA 4RGXA 2A3SA 2KKOA 4KIGA 1T0FA 2QWWA 5LLQA 4KDPA 4RB0A 1UFMA 2XVCA 4N9IA 3E3VA 2OZ6A 1LJ9A 1JHFA 1SFXA 3KCCA 1XCVA 5KK1A 3IWFA 3LWFA 1X3UA 1U3EM 2ZFWA 4EMSA 4H0EA 1B1BA 5JVTA 2HFHA 4YIFA 2X4HA 3DFGA 1YTYA 3LA7A 1YIOA 3SXYA 5JHUA 3IL2A 1U2WA 1FYKA 1LDKB 2PMHA 3BJAA 1FT9A 3GW2A 4KIBA 1L0OC 1ZARA 5ED4A 1RI7A 1FNNA 2W85A 3VODA 1FWZA 4LLGF 3GF2A 1Z9CA 2F5FA 2QQBA 1W5TA 2DBBA 4GYIA 2KIUA 2XKPA 4RB3C 3E6CC 2GIVA 1SD6A 1OR7A 3KP6A 3RIRA 2OZUA 1D5VA 3RPQA 1T6SA 2DQRA 2FMYA 4LG0A 2RKHA 4MQ9F 2H09A 1ON2A 1MJ9A 2FSWA 4S05A 3DEUA 5H20A 3J80K 4YG2F 4L5JA 2M5WA 2CSOA 3N97A 2PLYA 4YFNF 3ZMVA 3KLNA 3HRTA 4WXHA 1BBYA 4EGZA 2JRTA 3I54A 1G6NA 5LEJA 3QPHA 2MD5A 3WG9A 5E1WA 4S04A 2FA5A 2TDXA 1IRFA 3I53A 3GVAA 2M1BA 5BPDA 3V7CA 4KYWA 2EB7A 4MNUA 3K1NA 3O3KA 1R00A 2EWNA 1FOKA 3FXQA 4LB6B 1LB2A 2ESHA 1UB9A 1TQIA 1ZGAA 3HOSA 2NAZA 2WTEA 2XAQA 2ZKZA 1QBJA 1NHAA 2UXNA 4HYEA 2OQRA 3E5XA 2LNBA 3WTSC 1R5GA 2D1VA 1FX7A 4KMUX 4HV5A 4CXFA 1L3LA 4ON0A 5EEHA 3LFKA 2W25A 1K7AA 4U88A 4UVAA 3MZYA 4N9HA 1LQ1A 5H6RA 3P9IA 5JI6A 1WQ2A 2M8EA 5DUIA 3C3WA 2P7CB 2BBYA 3KZYA 1HW2A 5ICCA 4UV8A 2FNAA 3FMQA 2QLZA 4BQAA 3C7JA 2QBYA 1KYZA 5LEKA 2HZTA 1MDMA 1OYYA 4BNCA 3I0TA 4ENJA 1KU2A 3TDUC 1XDSA 2P8TA 5FGMA 2ISYA 1G3TA 2DAOA 4HOBA 3GX4X 1LDJA 2HGCA 3B02A 3QP5A 4GYGA 3FMRA 3HRMA 2IA2A 1U78A 2J5OA 1ZRCA 2EFPA 1Z1DA 2O6GE 2OQGA 3K9TA 4OOIA 3BJ6A 1OMIA 3FMSA 3TQNA 3ZQ7A 2K27A 3U2RA 5HLGA 1TTYA 2DI3A 2K02A 1O7LA 1YYVA 2VBXA 1FZPB 1LVAA 3H92A 2D1HA 4U0VA 3IRQA 1W7PB 4KN4X 5LHGA 1JE8A 2IA0A 4LD5A 2K7LA 2PI0A 1I1SA 1J5YA 2NNYA 3R4KA 3T8RA 2IRFG 1HBXG 1WI9A 4ENKA 1S6LA 5JFRA 4PDKA 3VFZA 3VB2A 3RPUA 3BROA 1T38A 1YQAA 2LF7A 3RTRA 4PZJA 2EFWA 1SD4A 2ELHA 2DU9A 2Q2EA 2VT3A 5JR3A 2ADUA 3V7SA 6PAXA 4HX8A 1P2FA 4U0WA 2JSCA 3V8JA 4K2EA 2HWVA 3T0YA 3KLOA 2HS5A 1OKRA 4RB1A 2GAUA 4O6JA 3EDPA 4FX4A 2LDUA 3AAFA 3JSOA 3Q9SA 1VTNC 3ZN0A 2OD5A 2NYXA 1KQ8A 3E97A 1G3YA 4L0YB 3W6KB 3LQQA 4M9SA 4L18B 3RKXA 1LEBA 2A68F 2Q8KA 4MQVA 2ZNYA 2EJRA 1XSDA 2Y75A 4G94A 3FX3A 3R60A 2Z3YA 1WSUA 2EK5A 2Y48A 3V7RA 1D8KA 2DW4A 1T2KA 4AD9A 3WGHA 2O3FA 1ODDA 1JXSA 5AIQA 5D5XB 1QZYA 2CO5A 2VE8A 2CWEA 3GO5A 4HZFA 5FFXA 2DO7A 1KQ9A 2G7UA 1BM9A 5D8KB 3I64A 2CGPA 4WX9A 2MBFA 1KGSA 1J9IA 2IP2A 2FOKA 2XIGA 3IC7A 3WGIA 3BPVA 1Z6TA 4EQQA 1ZLKA 2YSRA 2EA2A 2ISZA 5L3FA 3F21A 3DPLC 1FSEA 2ZJ2A 4EVIA 3RKWA 3KFWX 2NNNA 3HOTA 1ZYRF 3WTVC 3ZMZA 1OYIA 2FE3A 2JPBA 2BEOA 3MQ0A 2EV5A 4KUMA 2H27A 1K6OA 3JTHA 4PGGA 1KU3A 1DP7P 1ZG5A 1PP7U 1IN8A 4I98B 2P5VA 2NRAC 4RAZA 5KVRA 2J5PA 4BHPA 3QP6A 3FXUA 2AXLA 4BAYA 4YFXF 2P6SA 4R1HA 3WU0A 1S8NA 2EV6A 1U5TB 3HHGA 1REPC 2JT1A 3WGGA 4CHUA 3HSFA 2OA4A 2GA2A 4LK1F 5DEQA 3ISPA 5ILSA 3JSPA 3EYIA 1O3SA 3MZHA 1KA8A 3F8FA 4AWXB 5L3BA 4WWCA 4G6QA 3QRFF 2FRHA 2EFQA 3JW4A 4LGWA 5F64A 3E6BA 4ASNA 1XGNA 1R1VA 2XAHA 2ZBKA 2KJBA 1SFUA 3BJOA 1YG2A 4IXAA 2VONA 3G3ZA 2M87A 4M6YA 1BC7C 4LK0F 3T5XA 1AWCA 4RB2C 4HDVA 3LSTA 2VODA 1DUXC 1O3RA 2MLKA 2VBYA 1W7PA 4A12A 1J75A 2YR2A 1JHHA 4AIJA 1S29A 1H9GA 2ETHA 3TO9A 3QU6A 1XGSA 5AIPA 5ILUA 2Z5UA 1ZREA 3MFKA 2FU4A 4U0YA 2L54A 1G3SA 5CVVA 3J81Z 3V8KA 2R7FA 4JK1X 1QQIA 4LB5A 3F22A 3V8LA 4ENNA 3WE2A 2L02A 3QU3A 3WTZA 2H6CA 2R7DA 4LFUA 4QLCU 1Z05A 4G7HF 5J6XA 3H3UA 4A0YA 4CDGA 2VN2A 5K5OA 1MJBA 1XSVA 3ZMTA 5FB2A 1J59A 1SAXA 1DPUA 1GHCA 4LLNA 1HW5A 3LAPA 3F72A 3MCZA 4CZZA 3SZTA 2DK8A 1E17A 1FC3A 2QQ9A 3EUHA 3ML6A 4OMZA 4QWQA 2FQ3A 4L9JA 3ULQB 3FM3A 2XAGA 1FBUA 4AVPA 1IN7A 3LA2A 1KYWA 2MA3A 4EM0B 5ILVA 2BV6A 3GFIA 3JAMK 2HEOA 3Q5FA 3F8CA 4IVNA 1R58A 3RKYA 2GXBA 5FLXK 1U5TC 3H3ZA 1FYLA 2HTJA 2PQ8A 4CICA 1HKSA 3IWZA 1J7KA 5HS9A 2XHKA 4IRIA 5D5WB 2L3DA 3BWGA 1TQPA 4KFCA 3N4MA 5E1XA 1IUYA 2XV4S 1TNSA 4L5IA 4EM1A 4L9VA 2CYYA 2QYOA 2WC2A 2KIFA 1HSJA 3QAHA 1CF7B 2HOEA 4FT8A 1IN4A 4Q4ZF 2HTSA 4M72A 5CYVA 5L3CA 2D2WA 2A61A 2STWA 5HDKA 1XSXA 4IF4A 1U6GA 1ULYA 5E18F 3L9FA 3CUQB 5CVJA 4LLLA 4KICA 4Q47A 3ABUA 4IRGA 5D6FA 1U5TA 3KP3A 1TNTA 1KU7A 4Q5SF 3I4PA 1QNTA 3ZMUA 3RYRA 3TO6A 1UHMA 1B59A 4I0BA 5D5VB 5D8LB 2KIMA 1R1UA 2COMA 3OOPA 2O8XA 3VOEA 2P5KA 1YW9A 1W4MA 2W24A 1RNLA 4TV7A 3R0AA 4I0AA 4UVBA 1R36A 1O57A 1XCBA 2G9WA 4DQ2A 1HKTA 4A6EA 3PQKA 1YW7A 4KN7X 2QUFA 1QO0D 1I5ZA 5FFZA 2E1CA 2PJPA 5LBQA 2W84A 5D4RA 3GEZA 5H6QA 5F1RA 3ZMDA 2FXAA 4OIQF 1XDUA 3KEOA 1CGPA
chains in the Genus database with same CATH superfamily
2ZCWA 3GZNB 1HKQA 2OTLI 1MH3A 1B9MA 4ZYEA 3CMAI 2DT7B 4EJVA 1TW2A 2YX7A 2KDZA 2BHZA 4ZYAA 3WODF 2V1XA 4R79A 1WVRA 1R1TA 4Y15A 1VQMI 2DLLA 2CS3A 3O6BB 2BXZA 2PN6A 1BIAA 5CJ9A 1X58A 4PUSA 1BI0A 1Y8QB 3JRAA 3M1CA 3BZ6A 4A5MA 3BY6A 4IL6C 1SAUA 2R7TA 5K5RA 2KL4A 1ZTRA 2VKDA 2BY1A 2GA1A 3GFLA 3RQ4A 4AUXA 4I7HA 1MKMA 4F7ZA 2P81A 1AKHA 3OOUA 2IS4A 4CGZA 2XF7A 3KPHA 1G3WA 2CQKA 4UB8C 2NVYJ 2CFXA 2K86A 4B43A 5FO5A 5HNHA 2VOOA 4A5NA 3DP7A 1VQPI 2E71A 1JTXA 2XROA 4UUVA 1GVJA 4NC7A 3ABTA 4N0BA 4J00A 5ERIA 2DTZA 5EEAA 3JRIA 4NBQA 1BOBA 3K70C 3FK6A 3ZN1A 2W57A 3OR1C 1LE8B 4HF2A 1SFOJ 5FLVA 1OCCH 3HOUJ 1P7JA 2Y0SA 3WTTC 4BXXJ 2R5YB 1RIOH 3BR6A 5GAGJ 2VQLA 2DFIA 1S7OA 3SQNA 2ZMEB 3CLOA 3NEUA 2V6CA 3Q0VA 1T95A 5B3SH 3ZMSA 3SFZA 3F8MA 5J8CA 3C1DA 3G73A 1P4XA 1ETQA 2GIZA 3TKYA 1YS6A 4GFBA 2Q1ZB 1AA7A 1E3HA 3TW6A 4Y7NJ 2XRNA 3M07A 4XR6A 5EG0A 3BTLA 3FKIJ 3E5QA 4M9ZA 1PUEE 4MTDA 2LY1A 3SJMA 1ETOA 3KE2A 3CESA 1ZRDA 2FBKA 3Q0WA 2GBYA 3QOPA 1FTZA 1ONVA 1R5HA 1MMNA 1EH7A 2A5WA 4MEYF 2A6EF 3MKWB 2KZGA 3I3LA 1YOVB 1Z6RA 3BZKA 3L00A 3RZDJ 4E70A 4IQJA 5A2QK 1FP2A 4MGRA 5IOYA 5HDGA 3MWMA 1D3YA 3WHBA 4HBLA 4EV0A 4XSXF 2JA2A 4B8XA 2M34A 3HRSA 3FZVA 5JLXA 2LK2A 4D0PA 2STTA 2YS9A 3H9GA 1SMTA 4WK8F 1B6AA 1MD0A 4M3BA 1ZH5A 2DJIA 2WY8Q 3K4NA 2E7XA 4B47A 2R3SA 4M6VA 4XOPA 1X1BA 5LRRA 2HR3A 1O4XA 1MBHA 1U9NA 1MMDA 5E20A 3OYIA 2ME0A 2YU3A 4PCQA 2XB0X 4MHGA 1U0JA 4OIPF 2CU7A 4RDUA 1KQ0A 1N75A 4UNOA 2XAUA 3D0SA 5DD8A 3ASOH 2VPRA 1Y0NA 1MZBA 2VOPA 3LAJA 1H0MA 5E3MA 2K5CA 3QWLA 1I39A 2ZJQF 2V1DA 4HF0A 4GDFA 3DKWA 3ECHA 5FKMA 4OINF 4BJ5C 3FXOA 4C2UA 3LQRA 3M1EA 4HLYA 3EUAA 3ELKA 2DOAA 2VB6A 1E3PA 4P9FA 4YFKF 5ICEA 1T33A 2HYGD 3SFIA 4HX7A 5BS6A 1CF7A 4C2TA 3HUGB 1MSFC 1MIJA 1XGOA 4NQWA 5HDNA 2QKLB 4YIRX 1FOWA 1F5TA 1A31A 2BGCA 4XK4A 4CYDA 3AG1H 4L0ZB 3IRRA 2E1OA 2FMLA 2OBPA 4FX0A 3OYNA 1Y6IA 5IYBJ 4CCLA 2ZXHA 1ERDA 2GZWA 4E7JA 5BOXA 5BPIA 3CUOA 1IF1A 3K6GA 1HCRA 3EETA 3S17J 4BYYA 2ZNZA 4BE1A 1BR1A 5DCFA 1VQ7I 3OYKA 3CF5F 4BY7J 2CJJA 1SVOA 5BQTA 4I99C 3ONQA 4KNYA 1SMYF 2NOJB 1ZQ3P 2M9HA 1LNWA 3CUQA 2DQLA 5CVIA 2HNHA 4MIMA 4KT5C 4ETSA 3BCBA 2CQQA 3HEFA 4XL9A 4F92B 4BEHA 1YS7A 3E5UA 2R5ZB 5LRSA 4PJMA 1WI3A 3M8JA 3S2WA 3ESWB 2DA5A 3GYHX 3ZQHA 3D1NI 3E0JB 2IW5A 2F5VA 1WH7A 2LSOA 4UHTA 2NS0A 3VSKA 3M9AA 4C3IJ 3HPGA 4OAZA 5EJCA 4E7HA 1KU9A 1PJRA 1RESA 4PJ0C 5HLIA 2R7RA 1LFUP 2YX4A 1TWGJ 3BG6A 5C4XJ 1S3JA 4CCMA 2I10A 2EIJH 4PJJA 4EJOA 1RPWA 2NVXJ 1Q1HA 4CCOA 3HTSB 4PSXA 4G7OF 2QSFX 1MBKA 2FOWA 3OWTA 3FISA 2E60A 5ICFA 2H94A 4QTRA 2LG4A 2R7UA 3BP8A 3I59B 2IXSA 3PO2J 4AIKA 3CCUI 5L3EA 4F3QA 1V4RA 5LGTA 1BW5A 3BDDA 1R23A 2QF7A 3F8BA 2A6TA 2IGMA 2MH9A 1AHDP 4GRIA 1LUJB 5IT9K 5F27A 2GOMA 2Q0OA 4B09A 5L3DA 5D5UB 2ZMEC 9ANTA 1SD5A 4IJAA 2XB5A 2A07F 2L4MA 4RAGA 3T1BA 1EA3A 5J1RA 3FHZA 2V79A 3GZ5A 2KDOA 2JTVA 1EH6A 2P7VB 1LDDA 5FKNA 3P7NA 4UXNA 3U1DA 3VYRB 1FIPA 3HRUA 2JA7J 2DOEA 3O2PE 3MN2A 4X1EA 2GXGA 3IH3A 5TJJA 3OR2C 3CCEI 1I27A 2RDPA 3A03A 3ZOBA 2E7WA 5CLSA 3GWZA 5DV5A 1JGSA 4MFDA 3K0LA 3U9GA 1FBQA 1FSHA 2EBIA 3BTCA 4LITA 3CLQA 2F4OB 3OYLA 1G59A 1BC8C 1MSEC 3S15J 1P92A 1UHWA 4PJNA 2IAIA 2CFOA 4KMFA 1YJ9I 4FETA 5HVQC 5E3LA 1N78A 1IRZA 3WU1B 1J0RA 3ZQCA 2K4JA 2RQQA 1HDDC 4J01A 4RGUA 4B44A 1X1PA 1YFHA 5IT3A 2LOOA 3GCMA 4XMYA 3V4GA 1PDNC 3A4CA 2AXTC 4JOMA 5GTHC 4CO8A 1Y0UA 2M30A 2B0LA 1D0XA 5DUKA 2R0QC 3TDZC 2Z9OA 3WTYC 2PMUA 2V1UA 4XOTA 4Z2YA 4DNCA 1WWXA 4HRIA 3ZQQA 3ZQLA 4HV6A 4BXUA 4HSRA 2AQFA 4GO1A 4ESJA 2HDCA 1Z91A 2H6BA 2NVQJ 1LE8A 3L2WA 3LMMA 1XD7A 1U9OA 1X2NA 5TRDA 2JPCA 2R5YA 2EZHA 2D45A 1K4TA 2EFNA 2X6OA 2R7QA 2V4JC 4RGRA 1GLNA 2VT2A 5TGTA 2ZMEA 3KETA 3VWBA 2PG4A 3DEEA 2CV1A 4P9UA 1XX5A 3BT9A 1BOAA 1SD7A 1X1CA 4WXDA 1TBXA 4ZZLA 2X1EA 1PVEA 1QPMA 3SHFA 2GM4A 1HW1A 3DV8A 4IRHA 4XLCA 5E1ZB 3S32A 1D1CA 1OPCA 2UZKA 4QPQA 1K79A 4E4HA 2OAZA 4M3EA 2RNJA 3K1PA 3U1KA 1HQCA 2YUSA 4XLHA 1YX5A 2H8WA 4XKBA 1AOYA 2BY3A 4OMYA 4JP0A 2C6YA 1H8AC 1I6XA 2ZO4A 5DM7F 1PYVA 3HB9A 2XGXA 1ZG3A 4B4CA 1YITI 2K9NA 3A02A 1IO2A 4C9YA 2A6HF 2MC3A 3R0JA 4A3CJ 3BR1A 5B66C 2DOFA 4LIUA 4IHTA 1K61A 4RBOA 5FD5A 2HVSA 3PNYA 2OC6A 4BHBA 4OIRF 4I09A 3QPLA 1ZGJA 1NH3A 5CVUA 2E5NA 2LY2A 2K85A 3G1OA 3VEPA 2R4GA 1H89C 1H9TA 2VJJA 4EM2A 3F23A 3SEQA 5HLHA 2L7KA 1JGGA 1D1BA 1MBGA 2K9LA 1RR8C 4JQFA 5DCMB 3FXJA 1ZHFA 4KIFA 1XMXA 1ZR4A 3J81K 2AS5F 3JAMZ 4NHJA 1J2XA 4ZYGA 3GTPJ 3AG3H 1WGXA 2X9DA 3WE3A 5FLXZ 1MNDA 2NVTJ 1R22A 3CO6C 5DS9A 1GXQA 4XLPF 1ACIA 4U7BA 2IJLA 3J80Z 3A0HC 1VQKI 1X19A 2EH3A 1O3TA 3NWTA 1C0WA 2B63J 1K78B 1APLC 2WV0A 5HOOA 2Y69H 2Y0MA 2F6CA 4PJLA 1P4WA 2CW8A 1DDNA 1RETA 1FY7A 1UAAA 1FYMA 4BHCA 3SZPA 3I55I 2BY2A 3HUGA 4HX4A 4OWRB 4GXOA 2DYRH 4A0ZA 2KZVA 3F0CA 3S1MJ 4ZZDA 2CQNA 1MBJA 2NVUB 5J8FA 3EQLF 2W48A 1W5SA 3O8GA 4RM3A 2IPQX 1IN5A 4PFPA 5CQGA 4P55A 2P4WA 3L2CA 5IP6A 4BE2A 4WXCA 1MMSA 1IAWA 3REOA 2FBHA 4BGDA 3LOCA 2M8GX 3B73A 4HQMA 2EZLA 3BCAA 2VBWA 2AHQA 3F8NA 2CQ7A 3PIOF 2A69F 3KX2A 1EH8A 2VE9A 2ZJPF 3C2BA 1WFXA 4OU0A 3CMEI 1A04A 1YE9A 1VQ4I 4XLEA 1ON1A 4LJZF 4BL0B 3H1CA 4HLXA 1FPQA 2R5ZA 3TOAA 4HA8A 1I50J 3E6DA 1DP3A 2FEZA 1BJAA 3FF5A 4DJAA 2RQPA 2JZYA 4BQOA 2ID3A 2QENA 1D8JA 1RUOA 2DA7A 5H2FC 3ZPLA 4HDUA 4I01A 3L09A 2EPFA 3E7LA 1IDZA 3CF2A 3OL4A 3K2ZA 3OV8A 2PBIA 2Y2ZA 2X0LA 1W7PD 3M7GA 4LMYA 4HW0A 2W00A 3RCOA 5K7FA 1A35A 1ZN2A 1WJBA 3OS0A 3P9CA 3KP4A 1XMAA 2F2EA 3PQJA 1BI2A 3Q3SA 3ZQGA 4C30A 4DIQA 2F5CA 3C18A 2LYCA 2QZ8A 2XAFA 4JX4A 4NUBA 2OCEA 1NTCA 4B48A 4E7LA 2HQ5A 3I59A 3K69A 3I71A 2EILH 2KFDA 3GBGA 1A5JA 4AYBA 2M45A 4EGYA 1NG7A 5F6FA 2Z99A 1GXPA 5E8GA 4G6TB 3HZJA 4M3DA 5J1YA 5HODA 4IHSA 2WAQA 2EA4A 1O7FA 4L9NA 1QHHD 2HQNA 3J7AO 4A93J 5DD4A 2V9VA 3KYCB 3BOQA 4Y17A 1FOXA 1W5CC 2CG4A 2JWTA 4HPQA 4LOCA 4XRFA 3MEXA 1QVTA 4P96A 5LGUA 4ANJA 2BE5F 4OAYA 3S93A 2E1NA 5KAIC 5LHIA 1DPRA 2IVMA 3GZ6A 1F9NA 4BDYA 3BTIA 2BYVE 4MEXF 4ZH4F 1OJLA 1GUUA 3DCFA 1LFBA 3L7WA 1PUFB 3ECOA 1F4KA 1GV5A 4Y4RA 4A3FJ 1VZ0A 3FWEA 4BH9A 4M71A 1Z7UA 2OUMA 3OYBA 1IDYA 5L3GA 4P1WA 2M4KA 4AU7A 2LP0A 5FD6A 4RLQA 2OPTA 1ETXA 5EEGA 4A3IJ 2KPMA 1A36A 1MBFA 2XUBA 5C3EJ 1EV7A 3CJRB 1JJ6C 3NRVA 1BIBA 4L9TA 4IHVA 3EUKL 3LA3A 4NB5A 1HF0A 5LHHA 2CW0F 4UUSA 1QRYA 1U8RA 5F0FA 2AQEA 4AIHA 3K2AA 2HKXA 1LEAA 1EF4A 2MH2A 4QPOA 4DBQA 1S7AA 1X2MA 3CCVI 2BVMA 4EJTA 2XAJA 4IKFA 2L01A 4OIOF 3OIPA 3GUDA 1RC9A 1YW8A 3GFJA 1IRGA 2L9NA 4Y13A 1YJWI 2DMQA 4YRVA 2HYFA 1TWHJ 3ZXSA 2MW8A 2ECCA 1SANA 4HG2A 4EJUA 3GTJJ 3GTMJ 1X3WB 3HGYA 1TWFJ 3VYTB 3HYIA 2LC2A 3RYPA 4HQEA 5B1AH 3CZ6A 3KEQA 5LFAA 3L2QA 3KZZA 1FTTA 3L2UA 2L4AA 4HNTA 5J4YA 1YO5C 1RUNA 3M8FA 2W4SA 1W0UA 4M73A 2DMUA 4ESBA 2K3PA 2WY7Q 2ZXWH 3V42A 1T98A 3ABLH 5EZHA 1IXCA 2DMNA 2ESNA 2UUZA 3IH2A 2KRHA 1UCRA 3ZQIA 3M8EA 3CP8A 3G4SI 2A05A 3ROUA 4Z6YA 2HPIA 2DDBA 2XRLA 3H5AA 3H5RA 4FASD 3LSPA 1XB4A 2PEXA 3S8PA 2O7OA 4XLFA 2P5LC 2GWRA 2FF4A 2K4BA 4BQNA 1I1GA 2FBIA 3ERMA 4PK4A 2OU2A 3BG9A 3VDXA 2W7NA 4IHWA 1JI8A 3WHCA 3CDIA 3FXLA 4XN0A 4A0XA 3IHUA 5E79C 1O3QA 2F4IA 1IXSB 2Z16A 1HSTA 1Z0XA 4G8XA 4GGGA 1WKMA 1B4AA 3CCSI 2IT0A 1W36D 2XSJC 3F6OA 4M6XA 3JRGA 3IKTA 4XKWA 3FKJA 4UV9A 3MVPA 2QQAA 4D1QA 4KA4A 1WCMJ 4AM3A 4G9YA 5A2QZ 5DCMA 3OYMA 3TO7A 5FJ8J 3TP0A 3ZP5A 4G7ZF 2IS2A 2MC4A 3BR3A 3RDIA 2BHYA 1E2XA 4O5VA 2H1LA 2JA8J 2K9SA 2RREA 1YHQI 4JBAA 1BN5A 2O61A 2HOAA 2WWYA 3HSRA 2R7OA 2Y31A 2VXZA 3L2VA 5AONA 4AC0A 3F6VA 4D5FA 2DPUA 3BG3A 1IUFA 1XC5A 1G4DA 4UVCA 5F04A 1QGPA 1K78A 3ERED 3HTUA 1BA5A 3KYDB 1HLVA 3MKZA 3DPTA 2ZSIB 4V2FA 2RN7A 1S7EA 2LF8A 1TT0A 1T39A 3VSLA 2LBFB 2M2EA 2KJCA 1ZK8A 2HKOA 2MFZA 2RNGA 2L9VA 3CUQC 1VNDA 2EV0A 2E2IJ 1TQMA 3BR0A 1RZ4A 2NOGA 4RA2A 3RSNA 5IOZA 3CTAA 2DT5A 2COBA 5D6EA 2RC4A 5J40A 1J09A 3KP2A 3QPTA 5F0HA 2EQRA 2PFBA 5K5QA 1DQUA 4XONA 2DPDA 5CKTA 4HF1A 2XASA 1XN7A 2BZTA 2MLGA 4V2GA 1STZA 4M74A 1R71A 2QQ8A 3BQZA 4A6DA 1USSA 1ZAOA 1BI3A 2RAEA 5ICGA 3JRFA 1V3FA 2EFOA 2F5EA 4NC8A 3RJPA 1P6RA 5GADJ 4FE7A 3QQAA 1FP1D 4F91B 5F0CA 1XGMA 1OQYA 4XBFA 1MJAA 1ZGWA 4RMNA 3CJTB 1X3ZB 1ZRFA 4BXFA 2VLAA 3FXKA 2KT0A 2JUCA 3W6JB 2NS7A 2DTRA 3GLXA 3EYYA 3N05A 3TOBA 1OCPA 2HDDA 2E2HJ 3NQOA 3IKVA 1MGTA 4IPAA 4D9JA 2L9SA 3WTWC 3OSGA 4EEFG 5E8IA 1R5ID 4I02A 3JTGA 1FIAA 2CQXA 3HSEA 3MKYB 2UXXA 2LFBA 4ESFA 1N77A 5LGNA 4ZYDA 3GFMA 4ENMA 3BC8A 4ZDLA 2GQQA 2QEXI 2IGNA 4XSZF 2G7HA 1V5EA 1SFKA 4II3A 4LG0B 3HM5A 1YRNB 5J1UA 2KRFA 3DBRB 3H3VK 1IGNA 4MTEA 1OYWA 2M4GA 2CUFA 4ITVA 2UWMA 1QU3A 4CCJA 2RVCA 5DYMA 5HS8A 4RGSA 4F55A 2ACJA 3I58A 3J7YJ 3WTUC 3G71I 1QZZA 1TLHB 3IV5A 3PIPF 3DQVC 1USTA 2DN0A 5CQEA 2XGEA 3FBNB 3S1RJ 2P6TA 2O0YA 5BMZA 2L2OA 3R6SA 1U8BA 3J7AY 5DDGA 2VC0A 4ZYHA 1HXDA 1IRXA 1P4AA 1LVKA 4CH7A 3H35A 3L2RA 1IZ1A 3AG4H 2HQRA 4M9XA 2X1DA 3K1MA 2ZXJA 4A2UA 1ZG1A 4RAFA 1HC8A 2VQGA 1GDTA 4WF2A 3JREA 4O3MA 3D5LA 5IT9Z 2LVSA 3GXOA 2XF6A 2YPRA 5EZGA 4HSTA 3KP5A 3CMMA 1VF9A 4YIIA 2VBZA 5HLTA 4U7DA 1PUFA 1XMKA 4RS8A 3DKXA 3CJNA 5GPCA 2LKPA 4UUTA 3DWLE 1JKPC 2IS1A 1V5FA 3BPXA 1F1ZA 3VYUB 2O03A 1R7JA 3T8TA 1WJEA 3RPUD 4RLFA 4DOZA 1ETKA 3KZIC 2RGVA 1EKEA 1F36A 2CRGA 3HHHA 3S3MA 2A5YB 1ETWA 1JUSA 3FM5A 4FHTA 3OYCA 3FXRA 4CUGA 3BZCA 1WPKA 2VKEA 1IW7F 1B9NA 3OL3A 5TISC 1JUMA 2VC1A 3E6MA 4RAYA 4AIDA 1TW3A 2HI3A 1VFCA 1BI1A 1ZLJA 5E17F 3CO7C 1S9HA 3A01B 2FQ4A 2O8KA 4GCVA 3EPZA 5HS7A 2ICWG 1SFEA 1FBSA 4IZZA 3SDGA 1SVLA 3KP7A 4MFEA 3RI4A 3DBHB 3F3XA 1RKWA 3QYFA 4G6DA 4I76A 4PGHA 4R8HA 2QCOA 2JQ7A 3G2BA 3MAJA 1K83J 3Q9VA 2Z33A 3DF8A 2YU9J 3HPHA 4P5OA 3R61A 2CUJA 3IUOA 2VI6A 4ZDOA 4BJTA 3LSMA 3TEDA 2F5DA 2QM3A 3FBIB 3DTEA 1IXRC 3UR3C 3UNGC 3TBIA 5D4SA 5CVRA 4WCGA 1X4PA 3HDDA 3BLYA 1Y8RB 4Q48A 3FHNA 3TGNA 4UUSB 4CA0A 4Y3OA 4Y33A 1Z77A 3P9KA 1ENHA 2X85A 3PFIA 2QBYB 2Y9YA 1IN6A 2QVOA 3DU6A 3WTXC 2Z2SB 5B1BH 2KIQA 4F52A 1WRJA 3I5UA 4X0GA 1MDMB 3G1LA 1B8IB 1ETYA 2RV8A 4N4OB 2FNPA 3KIOA 5EF6A 4HAMA 2IA1A 3ZCOA 2LH9A 3SEZA 3HIFA 3CDLA 3DXJF 1YLFA 4AYBN 5K1YA 2DK5A 1PP8F 1FLIA 2XKOA 4XLNF 4EATA 4EJWA 3COAC 3LSJA 2VKHA 2WAQN 2DCEA 5FKLA 3CDHA 4I2OA 3I56I 2WAFA 4RGXA 2A3SA 2KKOA 4KIGA 4BUPA 5J4VA 2K9QA 2LTPA 2ZSHB 2V7FA 5F08A 1QVUA 2ECBA 5FRNA 2DMTA 2E1MB 1T0FA 1OR7C 2QWWA 5LLQA 4KDPA 1JKQC 4RB0A 1UFMA 2XVCA 3HBLA 1OCOH 1P9QC 4XLAA 4N9IA 3E3VA 4B3XA 1TC3C 3LL7A 2OZ6A 1TWAJ 2HXIA 1LJ9A 3BQYA 1JHFA 1SFXA 3KCCA 1XCVA 5KK1A 3IWFA 4DZJA 3A1YA 3LWFA 1V5GA 1X3UA 4XKCA 3KYLA 1U3EM 2ZFWA 2L9RA 1BR2A 2OJED 4W97A 4EMSA 4H0EA 1B1BA 2LBFA 3CCMI 2LR8A 2HFHA 5JVTA 4QSHA 4YIFA 2X4HA 2W82A 2X6XA 2X6WA 3DFGA 5E3OA 1YTYA 3M4OJ 1RR7A 3LA7A 1YIOA 3QODA 3SXYA 3BG7A 5DM6F 5JHUA 3BR5A 2DFEA 3IL2A 2HOSA 4KT6A 1U2WA 4BBRJ 1CQTA 4DGWB 1N25A 1FYKA 4HNUA 1I3AA 1LDKB 2PMHA 2BY0A 3LSKA 3BJAA 1FT9A 4II2A 4DYCA 2EZKA 3GW2A 1OCZH 4KIBA 2KLOA 4UB6C 1L0OC 1ZARA 3SDBA 5ED4A 1VQLI 1RI7A 1FNNA 3CJQB 3CMYA 2W85A 3HOVJ 1XG1A 2OF7A 3VODA 1FWZA 3JCUC 4A3MJ 4LLGF 2DA1A 1XS9A 2KRCA 3RQIA 2P0WA 3GF2A 4RM2A 1Z9CA 2F5FA 2QQBA 2NS8A 1W5TA 2DBBA 4GYIA 1W36C 3TL4X 1Z7LA 2Q2EB 2KIUA 2XKPA 4IO9F 4RB3C 3E6CC 4ZTFA 2V6EA 2GIVA 1SD6A 1OR7A 2O5RA 3L1PA 3KP6A 3RIRA 2OZUA 1V54H 1D5VA 3RPQA 2PJRB 1T6SA 2B9SA 2DFFA 3DLLF 2DQRA 2ID6A 4A69C 2FMYA 1IJWC 4LG0A 2RKHA 4MQ9F 2QGUA 4XIDA 4YEJA 2H09A 1YRNA 4BJ6C 1ON2A 1K6YA 1MJ9A 1WH5A 2FSWA 3OIOA 4S05A 4BQQA 3PNTA 3DEUA 2UV1A 1BR4A 3OIQA 5H20A 3G6EI 1UMQA 3ZQFA 3J80K 4YG2F 4L5JA 2M5WA 2CW7A 3QYBA 2BW3B 1WJFA 4D5CA 2MSYA 2JJ7A 3OYEA 2CSOA 5F1JA 3N97A 2R7ZJ 4E7ZA 2PLYA 3H0GJ 4YFNF 3ZMVA 3KLNA 3HRTA 2F4MB 4YELA 2XSDC 3IH4A 4WXHA 1BBYA 4EGZA 4CYCB 3HJEA 2JRTA 2VXDA 2LLKA 3I54A 1G6NA 1ZR2A 2VL8A 2R7SA 2EZIA 5LEJA 3QPHA 5KCMA 1GT0C 5EYRA 3OS2A 2MD5A 4IEJA 2HVRA 3QYEA 3WG9A 5E1WA 4S04A 3VPRA 3AKZA 2FA5A 2TDXA 1IRFA 3I53A 3GVAA 3QPSA 2M1BA 5BPDA 2XF5A 5GPAA 2MGQA 3V7CA 2ZB9A 5M5YJ 4KYWA 3GTOJ 2EB7A 4MNUA 3K1NA 3O3KA 4XQFA 2AO9A 2MG4A 3IP4B 5IP7J 1R00A 2EWNA 1YJNI 1FOKA 3FXQA 1WHUA 4LB6B 2BXYA 2VJ4A 1LB2A 2ESHA 4KJZA 1UB9A 1TQIA 1ZGAA 1GV2A 3HOSA 2NAZA 3Q0UA 2WTEA 2XAQA 2ZKZA 3HC7A 1QBJA 1NHAA 2M0MA 2UXNA 4HYEA 3H5NA 2OQRA 3E5XA 2ELKA 2LNBA 3WTSC 1R5GA 2D1VA 2WAEA 1VQOI 3A01A 1FX7A 4KMUX 4HV5A 4CXFA 2E1MC 3ASNH 1L3LA 2JRMA 1MW7A 2DFHA 1A6IA 1Y56A 4ON0A 2DA2A 5EEHA 4LG3A 3LFKA 2M3AA 2W25A 1K7AA 2X48A 3A0BC 4U88A 2G0EA 4UVAA 2LREA 3MZYA 4A3GJ 4N9HA 1LQ1A 2L7MP 5H6RA 2GOXB 2LRDA 1D0ZA 3GTKJ 3P9IA 5JI6A 1JTYA 3MMYB 1WQ2A 2M8EA 5DUIA 1DU0A 4CCNA 1QZEA 3C3WA 4XKVA 3FDYA 4X6AJ 2P7CB 2BBYA 3KZYA 2R92J 1HW2A 5ICCA 1M1EB 4UV8A 3HKZN 2FNAA 3FMQA 2QLZA 2XPUA 4BQAA 3C7JA 2EIKH 1JJ8C 3CC7I 4E7IA 2JVHA 4C3HJ 2QBYA 3OYAA 3PM1A 1Y1VJ 4XORA 1KYZA 5LEKA 2HZTA 1MDMA 1OYYA 4H4KC 2QKMB 4DW6A 1B8IA 4BNCA 3I0TA 4ENJA 1KU2A 3TDUC 1XDSA 3K10A 1Y39A 2P8TA 5FGMA 1TWCJ 2ISYA 1G3TA 3CC4I 1Q1VA 2I5UA 2DAOA 2PMZA 4HOBA 2EINH 3ZGKA 1IG7A 3GX4X 4FQGA 5FLMJ 1LDJA 4CSWA 2HGCA 3P5JA 3LFUA 3B02A 3QP5A 4J19A 4GYGA 4JYKA 3FMRA 3HRMA 2IA2A 2QA4I 1U78A 2NXNB 2J5OA 1ZRCA 3LSIA 2EFPA 3O8HA 2E5ZA 1Z1DA 2O6GE 2OQGA 3K9TA 3PO3J 4BY1J 3PUFA 4CZCA 1WJAA 4OOIA 3BJ6A 5GAHJ 2ZJRF 5J3LA 1OMIA 2GXAA 1K4SA 3FMSA 3TQNA 1UHSA 4XRMA 3FXMA 3ZQ7A 1LFPA 2HOTA 2K27A 3U2RA 5HLGA 1TTYA 2DI3A 2VUMJ 2DMPA 2K02A 3LSRA 1O7LA 5EGOB 1H88C 4FCYA 2V1NA 1YYVA 4D7NA 2VBXA 2E2JJ 1SVMA 1FZPB 1LVAA 3H92A 2HYJA 3DKYA 3GLLA 1D0YA 2D1HA 2K9MA 4U0VA 4V19K 5C4JJ 1F43A 1I6HJ 2X6YA 1WZ2A 2IEKA 3HL2A 4XM3A 3IRQA 1W7PB 3S1QJ 4KN4X 2WA0A 5LHGA 1JE8A 2IA0A 4LD5A 2K7LA 1MMGA 1EJ9A 2PI0A 1I1SA 3A2KA 1J5YA 2NNYA 2W1OA 3CP2A 3R4KA 1QPIA 2TRTA 4FISA 3T8RA 2IRFG 1HBXG 1WI9A 2IS6A 4ENKA 1S6LA 5JFRA 4PDKA 3VFZA 4ZDPA 3VB2A 3OY9A 1FMVA 4PSWA 3RPUA 3BROA 1T38A 1YQAA 2LF7A 2XGCA 3RTRA 4PZJA 2EFWA 1JKRC 2QSGX 1X1DA 1SD4A 2ELHA 5M5WJ 2DU9A 3QOEA 1HOMA 2Q2EA 2VT3A 1UG0A 5JR3A 2HZDA 4JX5A 2FUG2 2ADUA 3V7SA 2X1CA 6PAXA 3C2HA 4HX8A 3BG5A 1P2FA 4U0WA 2E35A 1TL8A 2JSCA 3V8JA 2HU9A 4K2EA 2HWVA 3T0YA 3KLOA 4HNVA 5IYCJ 2HS5A 2IGOA 1B72B 1OKRA 2PJRA 2JMWA 4RB1A 2GAUA 3CCJI 4BE0A 2XC7A 4O6JA 3EDPA 4FX4A 4B3AA 2LDUA 1DGRM 3AAFA 2CV2A 5IP9J 1R9TJ 3JSOA 2L5QA 3Q9SA 4L5EA 1T8IA 3IAS2 1VTNC 3S14J 3ZN0A 2OD5A 2NYXA 1W1WE 1KQ8A 3E97A 1G3YA 4L0YB 3W6KB 1WJDA 1BJZA 2E36A 3LQQA 4M9SA 4E7KA 4L18B 3RKXA 1LEBA 2BW3A 2A68F 2BVLA 1JT6A 2Q8KA 4MQVA 2ZNYA 2EJRA 1XSDA 2ME6A 3CD6I 3RZOJ 2Y75A 4G94A 2XPVA 2LY9A 3FX3A 2Z3YA 2EIMH 3R60A 4XICA 1WSUA 4A3LJ 4CYCA 1ZELA 2EK5A 3HKZA 2Y48A 1D8KA 2DW4A 3V7RA 1T2KA 2KP6A 2L7ZA 3CCRI 1TT5B 4AD9A 2Y30A 3WGHA 2HQAA 1XPXA 3PFYA 2O3FA 3H0DA 4IHYA 1ODDA 1JXSA 1DGWY 5AIQA 1Y1WJ 5D5XB 2DODA 3S2DJ 3TW7A 1QZYA 2CO5A 5JLWA 3AFHA 3CC2I 2VE8A 2CWEA 2LKXA 3GO5A 4HZFA 2V9KA 4BACA 3SYTA 5FFXA 2DJNA 1MBEA 3D5SC 2DO7A 1KQ9A 2G7UA 3NAUA 3K4MA 4A3BJ 4B1RA 4DBRA 4NDLA 1BM9A 5D8KB 2OTJI 3I64A 3I4NJ 2CGPA 3H9JA 2VKVA 4WX9A 2MBFA 5EDNA 1KGSA 1J9IA 2IP2A 3K4CA 2FOKA 2XIGA 3IC7A 1UG2A 3WGIA 3BPVA 1Z6TA 2PX9A 3WG7H 3PSFA 5HNFA 4EQQA 1ZLKA 2YSRA 2EA2A 2ISZA 2CV0A 1ZKGA 5L3FA 3FIWA 3F21A 3DPLC 3BR2A 1FSEA 2ZJ2A 4EVIA 3RKWA 1JUPA 3KFWX 2NNNA 5M3FJ 2M7BA 4G12A 3HOTA 1ZYRF 3WTVC 3ZMZA 1OYIA 2FE3A 3GTQJ 2JPBA 2BEOA 3MQ0A 4DYRA 3PUBA 2EV5A 2CUZA 5BNGA 4KUMA 2H27A 1K6OA 3JTHA 4I6ZA 4PGGA 1GVDA 1KU3A 1R4MB 5JHFA 1DP7P 1ZG5A 1PP7U 1IN8A 5CPRB 3K4LA 3LSGA 4E6KG 1NK3P 4I98B 2P5VA 4F93B 3OYJA 4MO7A 2NRAC 2E19A 4RAZA 1VQ9I 5KVRA 4ZC3A 5K7HA 2DDAA 2J5PA 2L7FP 4BHPA 2OV7A 4A3DJ 3QP6A 3AL0B 3OYFA 5IPAA 3FXUA 3HOWJ 2R7WA 2AXLA 3PL8A 4BAYA 4YFXF 2P6SA 4R1HA 3B6CA 3WU0A 1D1AA 1WJ5A 2CUEA 2WV1A 1S8NA 3W3CA 2EV6A 1TZLA 3DEWA 1U5TB 3HHGA 4ABZA 4C2MJ 2R93J 1REPC 2JT1A 1T0FC 3GMEA 3WGGA 4CHUA 2R7XA 3HSFA 3G1MA 2OA4A 2GA2A 3DTKA 4LK1F 5DEQA 3ISPA 2VJ5A 5ILSA 2DXIA 1FOYA 3JSPA 3EYIA 1O3SA 1T56A 3MZHA 3S2HJ 1JKOC 2LD5A 1NG6A 4U87A 1XTAA 3ABMH 1KA8A 3F8FA 2DA6A 4AWXB 1KONA 2CMPA 5L3BA 4WWCA 2IBDA 4G6QA 3DTIA 3W2VA 3QRFF 2FRHA 2XPWA 2EFQA 1P7IA 2K3FA 3JW4A 3X2QH 3S1NJ 4LGWA 5F64A 3E6BA 5KHDA 4ASNA 1XGNA 2WADA 4BU2A 1R1VA 3JR9A 2XAHA 3K70D 2DA3A 3WU2C 2ZBKA 2KJBA 1SFUA 3JRCA 3BJOA 1YG2A 3K4KA 2DA4A 2VJIA 1SC7A 3DU5A 3HG9A 1IV8A 3MZ8A 4IXAA 4XRSA 2VONA 3FK7A 2HVQA 2M87A 3G3ZA 4M6YA 1IC8A 2VASA 1BC7C 4LK0F 3T5XA 1AWCA 5B5EC 3H36A 5KAFC 1QHGA 4QIWN 4RB2C 4HDVA 3LSTA 1R4NB 5EGOA 2VODA 1DUXC 3MKLA 1O3RA 1Z3XA 2MLKA 2KMUA 5KNLA 1YI2I 2F48A 2VBYA 1W7PA 4N4NB 4M3FA 4A12A 1J75A 1BW6A 4JX6A 3VYSB 2YR2A 1MNEA 1JHHA 4AIJA 1S29A 2LMDA 1Z21A 3HOYJ 4ZTJA 1H9GA 2ETHA 1UELB 3TO9A 3QU6A 1XGSA 3EUHC 2WB1N 5AIPA 5ILUA 1Z67A 2Z5UA 1ZREA 3S3NA 3MFKA 3D5RC 3U21A 2FU4A 1BL0A 1RKTA 3ZRGA 4U0YA 2L54A 1G3SA 5CVVA 3J81Z 3V8KA 1OCRH 3HOXJ 3JRBA 2R7FA 4JK1X 1QQIA 4M3GA 2JUGA 4LB5A 3F22A 3V8LA 1AKHB 4ENNA 2VPLA 4LIVA 2B7EA 3WE2A 1OLTA 3OYDA 5E3NA 2L02A 3QU3A 3WTZA 2H6CA 2R7DA 1VQ5I 2WBMA 4LFUA 4QLCU 1Z05A 3S3OA 1B72A 4G7HF 4ZJZA 1D5YA 5FKKA 4NNJA 5J6XA 3H3UA 4A0YA 3NARA 4CDGA 5FRMA 2MYSA 2R7VA 1AU7A 2KISA 1HA8A 3S16J 2VN2A 5M3MJ 4FTHA 4DZPA 3SZGA 1TP4A 5K5OA 1MJBA 2Z1DA 1XSVA 3F9KA 3ZMTA 5FB2A 1J59A 4XN3A 1SAXA 1DPUA 1GHCA 2ZFUA 1HW5A 4LLNA 3LAPA 3CCLI 2V9PA 4KITB 1Z3YA 3F72A 3HOZJ 1POGA 3MCZA 4CCKA 3BTJA 4DYQA 2PMZN 5EG0B 4CZZA 3SZTA 2DK8A 2ZXIA 1HDPA 1E17A 1FC3A 3TMOA 2QQ9A 1FEXA 3EUHA 4A3EJ 2JA5J 3NWSA 2M7AA 3ML6A 4OMZA 3PJRA 4QWQA 2FQ3A 4L9JA 3ULQB 3FM3A 2XAGA 1RRJA 1FBUA 2KQRA 1WJCA 4AVPA 3MD2A 3M3YJ 1IN7A 3LA2A 1KYWA 2MA3A 4EM0B 5ILVA 1R6RA 2BV6A 2HPMA 1VQ6I 4C3JJ 3AL0C 3GFIA 5IY5H 1MMAA 1W0TA 3JAMK 2HEOA 3Q5FA 4IHXA 3F8CA 2N8GA 4IVNA 1R58A 3RKYA 2Y9ZA 2GXBA 5FLXK 2L0KA 1U5TC 1X4OA 2VQHA 3H3ZA 4PFOA 1FYLA 4Y52J 4IQ4A 1R49A 2GLOA 2HTJA 2PQ8A 3ZR8X 4CICA 3HXLA 1HKSA 1S72I 2MABA 3IWZA 1J7KA 2JA6J 2H1KA 5HS9A 3LNQA 2XHKA 4IRIA 5D5WB 4IX7A 2L3DA 2CH0A 3BWGA 1TQPA 3I9V2 4KFCA 2VIXA 3N4MA 5E1XA 1IUYA 3JRHA 1ITYA 2XV4S 1TNSA 4L5IA 2JSPA 4BBSJ 5DTDA 2X51A 1MH4A 1UZCA 2XGDA 3TP3A 3UKGA 3K4BA 4EM1A 2Y0SN 2V26A 4L9VA 2CYYA 2QYOA 2WC2A 2KIFA 1HSJA 3QAHA 3K4JA 4BDZA 2QSHX 1CF7B 2HOEA 3OMYA 4IOAF 3AG2H 4NQWB 4FT8A 1QA6A 1X1AA 1IN4A 1VQ8I 1FMWA 4Q4ZF 2HTSA 4M72A 5CYVA 1OFCX 5L3CA 1IV6A 3KEYA 2DYSH 2D2WA 3HGGA 2A61A 3ABKH 4BS9A 5GAEJ 2STWA 2JVGA 3B6AA 5HDKA 3CCQI 4D7MA 4A3KJ 1XSXA 4IF4A 1S5LC 3PSIA 1VI0A 1U6GA 4XNFA 5GP9A 3H9QA 1ULYA 1OCTC 2KHMA 4NC6A 5JVGF 1ETVA 2WB1A 5FKOA 5E18F 1G2HA 2K40A 4E7SA 1MNMC 3L9FA 3CUQB 5CVJA 4LLLA 1T08B 4KICA 4Q47A 3W2WA 3ABUA 2DT6A 4IRGA 5D6FA 4BEHB 1U5TA 2ZC2A 3KP3A 1TNTA 5LD2C 4A3JJ 2HXOA 2MD0A 1KU7A 4Q5SF 2E34A 3I4PA 1V55H 3DLAA 1QNTA 3ZMUA 3RYRA 3OYHA 1UJ8A 2JN6A 3TO6A 5FROA 1UHMA 2BOLA 4UY8I 1B59A 4I0BA 5D5VB 3E1SA 4AVZA 3PNVA 5D8LB 3DBLB 2KIMA 4BKXA 1R1UA 4MLOA 2COMA 3IAM2 3OOPA 2O8XA 5K7ZA 1FJLA 2TCTA 3CQZJ 3VOEA 2P5KA 5GTIC 1YW9A 2D5VA 2FD5A 1ORKA 3C2GA 1W4MA 2HDWA 1E0EA 2JK3A 2W24A 1RNLA 4TV7A 3R0AA 1SEUA 3K7AJ 4I0AA 3RKQA 4UVBA 4IOCF 1NK2P 1VQNI 2H8RA 2IGKA 2LKSA 1R36A 1O57A 1XCBA 2FJ1A 2G9WA 4DQ2A 4HEA2 5C44J 2XDVA 1DU6A 3I4MJ 1HKTA 1I3QJ 4A6EA 3GTLJ 3DPUA 3PQKA 2I8DA 3J7ZI 1YW7A 3OS1A 4S0HB 4KN7X 2QUFA 1OISA 1A6QA 3OYGA 1QO0D 2M0CA 5M5XJ 1YX3A 1I5ZA 2ELJA 5FFZA 1KZHA 2E1CA 2PJPA 2OCCH 5LBQA 3W6VA 2W84A 3OSFA 4XRSG 5D4RA 3GEZA 1JT0A 3GTGJ 2FX0A 5H6QA 3CCYA 5F1RA 5J47A 1E3OC 3ZMDA 3LSHA 2O9LA 4KISA 2FXAA 4OIQF 1YIJI 4FE4A 4W1UA 1XDUA 3JRDA 1G8XA 3KEOA 1LPQA 1CGPA 2VQCA 3W2AA 5IYDJ 1LKXA
chains in the Genus database with same CATH topology
2ZCWA 1HKQA 4ZYEA 1B9MA 4EJVA 1TW2A 2YX7A 3WODF 2V1XA 4R79A 1R1TA 4Y15A 2DLLA 3O6BB 2PN6A 1BIAA 5CJ9A 1BI0A 3BZ6A 4A5MA 3BY6A 5K5RA 2GA1A 3GFLA 4I7HA 1MKMA 4F7ZA 4CGZA 1G3WA 2CQKA 2CFXA 2K86A 5FO5A 2VOOA 4A5NA 3DP7A 2XROA 4UUVA 1GVJA 3ABTA 4N0BA 5ERIA 3ZN1A 2W57A 4HF2A 3WTTC 1RIOH 2DFIA 1S7OA 3SQNA 2ZMEB 3CLOA 3NEUA 2V6CA 3ZMSA 3SFZA 3F8MA 5J8CA 3C1DA 3G73A 1P4XA 3TKYA 1YS6A 2XRNA 3E5QA 4M9ZA 1PUEE 4MTDA 3KE2A 1ZRDA 2FBKA 3QOPA 1ONVA 1R5HA 1EH7A 4MEYF 2A6EF 1Z6RA 3L00A 4E70A 5A2QK 1FP2A 4MGRA 5HDGA 3MWMA 1D3YA 4HBLA 4EV0A 4XSXF 4B8XA 3HRSA 3FZVA 4D0PA 2STTA 1SMTA 4WK8F 1B6AA 1MD0A 1ZH5A 2E7XA 2R3SA 5LRRA 2HR3A 5E20A 2YU3A 4PCQA 4MHGA 4OIPF 1KQ0A 4UNOA 3D0SA 5DD8A 1MZBA 2VOPA 3LAJA 1H0MA 2V1DA 4HF0A 3DKWA 3ECHA 4OINF 3LQRA 3M1EA 4HLYA 3ELKA 4P9FA 4YFKF 5ICEA 2HYGD 5BS6A 4HX7A 1CF7A 1XGOA 5HDNA 4NQWA 1F5TA 2BGCA 4CYDA 4L0ZB 3IRRA 2FMLA 2OBPA 4FX0A 2GZWA 5BOXA 5BPIA 3CUOA 1IF1A 3EETA 4BYYA 2ZNZA 5DCFA 5BQTA 4KNYA 1SMYF 1LNWA 3CUQA 2DQLA 5CVIA 4KT5C 4ETSA 1YS7A 3E5UA 5LRSA 3S2WA 3GYHX 2IW5A 2LSOA 4UHTA 2NS0A 3M9AA 1KU9A 5HLIA 2YX4A 1S3JA 4EJOA 1Q1HA 3HTSB 4G7OF 5ICFA 2H94A 3BP8A 3I59B 4AIKA 5L3EA 1V4RA 5LGTA 3BDDA 1R23A 3F8BA 2MH9A 5IT9K 2Q0OA 4B09A 5L3DA 5D5UB 1SD5A 4IJAA 2A07F 2L4MA 3T1BA 3FHZA 2V79A 3GZ5A 2JTVA 1EH6A 2P7VB 1LDDA 3P7NA 4UXNA 3U1DA 3HRUA 3O2PE 2GXGA 5TJJA 1I27A 2RDPA 2E7WA 5CLSA 3GWZA 5DV5A 1JGSA 3K0LA 3U9GA 1FBQA 1FSHA 1BC8C 1P92A 1UHWA 4KMFA 5HVQC 3WU1B 1J0RA 2K4JA 4RGUA 1YFHA 5IT3A 3V4GA 1PDNC 4CO8A 1Y0UA 2M30A 2B0LA 5DUKA 2Z9OA 3TDZC 3WTYC 2PMUA 2V1UA 4Z2YA 4DNCA 1WWXA 4HV6A 4BXUA 4GO1A 4ESJA 2HDCA 1Z91A 2H6BA 1XD7A 5TRDA 2JPCA 2D45A 2EFNA 4RGRA 2VT2A 3KETA 2ZMEA 2PG4A 4P9UA 1BOAA 1SD7A 4WXDA 1TBXA 4ZZLA 1QPMA 3SHFA 1HW1A 3DV8A 4IRHA 5E1ZB 1OPCA 2UZKA 1K79A 2OAZA 2RNJA 3K1PA 1HQCA 1AOYA 4OMYA 2C6YA 1I6XA 2ZO4A 2XGXA 1ZG3A 2A6HF 2MC3A 3R0JA 4IHTA 5FD5A 4BHBA 4OIRF 4I09A 1ZGJA 5CVUA 3VEPA 1H9TA 4EM2A 3F23A 5HLHA 4JQFA 5DCMB 1ZHFA 4KIFA 3J81K 2AS5F 3JAMZ 4NHJA 1J2XA 4ZYGA 3WE3A 5FLXZ 1R22A 3CO6C 1GXQA 4XLPF 4U7BA 2IJLA 3J80Z 1O3TA 1C0WA 1K78B 2WV0A 5HOOA 2Y0MA 1P4WA 1DDNA 1FY7A 1FYMA 4BHCA 3SZPA 3HUGA 4HX4A 4GXOA 4A0ZA 4ZZDA 5J8FA 3EQLF 1W5SA 2IPQX 1IN5A 4P55A 2P4WA 3L2CA 4WXCA 1IAWA 3REOA 2FBHA 3B73A 4HQMA 2VBWA 3F8NA 2A69F 1EH8A 2VE9A 4OU0A 1A04A 1ON1A 4LJZF 4HLXA 1FPQA 3TOAA 4HA8A 3E6DA 2FEZA 1BJAA 3FF5A 2RQPA 2JZYA 2QENA 1D8JA 1RUOA 3ZPLA 4HDUA 4I01A 3L09A 3K2ZA 3OV8A 2PBIA 2X0LA 1W7PD 3M7GA 4LMYA 4HW0A 1ZN2A 3P9CA 3KP4A 1XMAA 2F2EA 3PQJA 1BI2A 2F5CA 3C18A 2QZ8A 2XAFA 3I59A 3K69A 3I71A 2M45A 4EGYA 5F6FA 2Z99A 1GXPA 5E8GA 4IHSA 2EA4A 1O7FA 4L9NA 2HQNA 3J7AO 5DD4A 2V9VA 3BOQA 4Y17A 2CG4A 4XRFA 3MEXA 4P96A 5LGUA 2BE5F 2E1NA 5LHIA 1DPRA 2IVMA 3GZ6A 1F9NA 2BYVE 4MEXF 4ZH4F 3L7WA 3ECOA 1F4KA 3FWEA 4BH9A 4M71A 1Z7UA 5L3GA 5FD6A 5EEGA 2XUBA 1EV7A 3NRVA 1BIBA 4L9TA 3LA3A 4NB5A 5LHHA 2CW0F 1U8RA 4AIHA 2HKXA 1LEAA 2MH2A 1S7AA 4EJTA 2XAJA 4OIOF 2L01A 3GUDA 1YW8A 3GFJA 1IRGA 4Y13A 2HYFA 4EJUA 3HYIA 3RYPA 4HQEA 3KEQA 3KZZA 2L4AA 1YO5C 1RUNA 3M8FA 4M73A 4ESBA 1T98A 1IXCA 2ESNA 1UCRA 3M8EA 3ROUA 1XB4A 2PEXA 2P5LC 2GWRA 2FF4A 2K4BA 1I1GA 2FBIA 2OU2A 4A0XA 3IHUA 1O3QA 1IXSB 1HSTA 4G8XA 4GGGA 1WKMA 1B4AA 2IT0A 3F6OA 4M6XA 3IKTA 4UV9A 2QQAA 4KA4A 4G9YA 5A2QZ 5DCMA 3TO7A 3ZP5A 4G7ZF 3RDIA 1E2XA 4O5VA 4JBAA 1BN5A 2O61A 2WWYA 3HSRA 2VXZA 5AONA 3F6VA 2DPUA 1G4DA 4UVCA 1QGPA 1K78A 3ERED 3HTUA 3DPTA 2RN7A 2LF8A 1T39A 2KJCA 2HKOA 3CUQC 2EV0A 1TQMA 1RZ4A 3CTAA 2DT5A 5D6EA 2RC4A 3KP2A 3QPTA 2PFBA 5K5QA 2DPDA 4HF1A 2XASA 1XN7A 2MLGA 1STZA 4M74A 4A6DA 1USSA 1ZAOA 1BI3A 5ICGA 1V3FA 2EFOA 2F5EA 3RJPA 1P6RA 1FP1D 1XGMA 4XBFA 1MJAA 1ZRFA 3W6JB 2DTRA 3GLXA 3EYYA 3TOBA 3NQOA 3WTWC 1MGTA 3IKVA 4IPAA 5E8IA 4I02A 3JTGA 3HSEA 2UXXA 4ESFA 5LGNA 4ZYDA 3GFMA 4ENMA 2GQQA 4XSZF 2G7HA 4LG0B 2KRFA 4MTEA 1OYWA 2UWMA 2ACJA 2RVCA 5DYMA 5HS8A 4RGSA 3I58A 3WTUC 1QZZA 1TLHB 3DQVC 1USTA 2P6TA 2O0YA 5BMZA 3R6SA 5DDGA 2VC0A 4ZYHA 1HXDA 1P4AA 1IZ1A 2HQRA 4M9XA 3K1MA 2ZXJA 4A2UA 1ZG1A 4WF2A 4O3MA 3D5LA 5IT9Z 3GXOA 2YPRA 3KP5A 4YIIA 2VBZA 4U7DA 1XMKA 4RS8A 3CJNA 2LKPA 3BPXA 1F1ZA 2O03A 1R7JA 3T8TA 2RGVA 3HHHA 2A5YB 3FM5A 4FHTA 3FXRA 1IW7F 1B9NA 3E6MA 2VC1A 4RAYA 1TW3A 1BI1A 1ZLJA 5E17F 3CO7C 4GCVA 5HS7A 1SFEA 1FBSA 3KP7A 3RI4A 3F3XA 4G6DA 4PGHA 4R8HA 3MAJA 3Q9VA 2Z33A 3DF8A 4P5OA 3R61A 2F5DA 2QM3A 1IXRC 5D4SA 5CVRA 4WCGA 3TGNA 4Q48A 3P9KA 3PFIA 2QBYB 1IN6A 2QVOA 3WTXC 1WRJA 3I5UA 1MDMB 2RV8A 2FNPA 4HAMA 2IA1A 3HIFA 3DXJF 1YLFA 5K1YA 1PP8F 2DK5A 1FLIA 2XKOA 4XLNF 4EJWA 3COAC 3CDHA 4I2OA 4RGXA 2A3SA 2KKOA 4KIGA 1T0FA 2QWWA 5LLQA 4KDPA 4RB0A 1UFMA 2XVCA 4N9IA 3E3VA 2OZ6A 1LJ9A 1JHFA 1SFXA 3KCCA 1XCVA 5KK1A 3IWFA 3LWFA 1X3UA 1U3EM 2ZFWA 4EMSA 4H0EA 1B1BA 5JVTA 2HFHA 4YIFA 2X4HA 3DFGA 1YTYA 3LA7A 1YIOA 3SXYA 5JHUA 3IL2A 1U2WA 1FYKA 1LDKB 2PMHA 3BJAA 1FT9A 3GW2A 4KIBA 1L0OC 1ZARA 5ED4A 1RI7A 1FNNA 2W85A 3VODA 1FWZA 4LLGF 3GF2A 1Z9CA 2F5FA 2QQBA 1W5TA 2DBBA 4GYIA 2KIUA 2XKPA 4RB3C 3E6CC 2GIVA 1SD6A 1OR7A 3KP6A 3RIRA 2OZUA 1D5VA 3RPQA 1T6SA 2DQRA 2FMYA 4LG0A 2RKHA 4MQ9F 2H09A 1ON2A 1MJ9A 2FSWA 4S05A 3DEUA 5H20A 3J80K 4YG2F 4L5JA 2M5WA 2CSOA 3N97A 2PLYA 4YFNF 3ZMVA 3KLNA 3HRTA 4WXHA 1BBYA 4EGZA 2JRTA 3I54A 1G6NA 5LEJA 3QPHA 2MD5A 3WG9A 5E1WA 4S04A 2FA5A 2TDXA 1IRFA 3I53A 3GVAA 2M1BA 5BPDA 3V7CA 4KYWA 2EB7A 4MNUA 3K1NA 3O3KA 1R00A 2EWNA 1FOKA 3FXQA 4LB6B 1LB2A 2ESHA 1UB9A 1TQIA 1ZGAA 3HOSA 2NAZA 2WTEA 2XAQA 2ZKZA 1QBJA 1NHAA 2UXNA 4HYEA 2OQRA 3E5XA 2LNBA 3WTSC 1R5GA 2D1VA 1FX7A 4KMUX 4HV5A 4CXFA 1L3LA 4ON0A 5EEHA 3LFKA 2W25A 1K7AA 4U88A 4UVAA 3MZYA 4N9HA 1LQ1A 5H6RA 3P9IA 5JI6A 1WQ2A 2M8EA 5DUIA 3C3WA 2P7CB 2BBYA 3KZYA 1HW2A 5ICCA 4UV8A 2FNAA 3FMQA 2QLZA 4BQAA 3C7JA 2QBYA 1KYZA 5LEKA 2HZTA 1MDMA 1OYYA 4BNCA 3I0TA 4ENJA 1KU2A 3TDUC 1XDSA 2P8TA 5FGMA 2ISYA 1G3TA 2DAOA 4HOBA 3GX4X 1LDJA 2HGCA 3B02A 3QP5A 4GYGA 3FMRA 3HRMA 2IA2A 1U78A 2J5OA 1ZRCA 2EFPA 1Z1DA 2O6GE 2OQGA 3K9TA 4OOIA 3BJ6A 1OMIA 3FMSA 3TQNA 3ZQ7A 2K27A 3U2RA 5HLGA 1TTYA 2DI3A 2K02A 1O7LA 1YYVA 2VBXA 1FZPB 1LVAA 3H92A 2D1HA 4U0VA 3IRQA 1W7PB 4KN4X 5LHGA 1JE8A 2IA0A 4LD5A 2K7LA 2PI0A 1I1SA 1J5YA 2NNYA 3R4KA 3T8RA 2IRFG 1HBXG 1WI9A 4ENKA 1S6LA 5JFRA 4PDKA 3VFZA 3VB2A 3RPUA 3BROA 1T38A 1YQAA 2LF7A 3RTRA 4PZJA 2EFWA 1SD4A 2ELHA 2DU9A 2Q2EA 2VT3A 5JR3A 2ADUA 3V7SA 6PAXA 4HX8A 1P2FA 4U0WA 2JSCA 3V8JA 4K2EA 2HWVA 3T0YA 3KLOA 2HS5A 1OKRA 4RB1A 2GAUA 4O6JA 3EDPA 4FX4A 2LDUA 3AAFA 3JSOA 3Q9SA 1VTNC 3ZN0A 2OD5A 2NYXA 1KQ8A 3E97A 1G3YA 4L0YB 3W6KB 3LQQA 4M9SA 4L18B 3RKXA 1LEBA 2A68F 2Q8KA 4MQVA 2ZNYA 2EJRA 1XSDA 2Y75A 4G94A 3FX3A 3R60A 2Z3YA 1WSUA 2EK5A 2Y48A 3V7RA 1D8KA 2DW4A 1T2KA 4AD9A 3WGHA 2O3FA 1ODDA 1JXSA 5AIQA 5D5XB 1QZYA 2CO5A 2VE8A 2CWEA 3GO5A 4HZFA 5FFXA 2DO7A 1KQ9A 2G7UA 1BM9A 5D8KB 3I64A 2CGPA 4WX9A 2MBFA 1KGSA 1J9IA 2IP2A 2FOKA 2XIGA 3IC7A 3WGIA 3BPVA 1Z6TA 4EQQA 1ZLKA 2YSRA 2EA2A 2ISZA 5L3FA 3F21A 3DPLC 1FSEA 2ZJ2A 4EVIA 3RKWA 3KFWX 2NNNA 3HOTA 1ZYRF 3WTVC 3ZMZA 1OYIA 2FE3A 2JPBA 2BEOA 3MQ0A 2EV5A 4KUMA 2H27A 1K6OA 3JTHA 4PGGA 1KU3A 1DP7P 1ZG5A 1PP7U 1IN8A 4I98B 2P5VA 2NRAC 4RAZA 5KVRA 2J5PA 4BHPA 3QP6A 3FXUA 2AXLA 4BAYA 4YFXF 2P6SA 4R1HA 3WU0A 1S8NA 2EV6A 1U5TB 3HHGA 1REPC 2JT1A 3WGGA 4CHUA 3HSFA 2OA4A 2GA2A 4LK1F 5DEQA 3ISPA 5ILSA 3JSPA 3EYIA 1O3SA 3MZHA 1KA8A 3F8FA 4AWXB 5L3BA 4WWCA 4G6QA 3QRFF 2FRHA 2EFQA 3JW4A 4LGWA 5F64A 3E6BA 4ASNA 1XGNA 1R1VA 2XAHA 2ZBKA 2KJBA 1SFUA 3BJOA 1YG2A 4IXAA 2VONA 3G3ZA 2M87A 4M6YA 1BC7C 4LK0F 3T5XA 1AWCA 4RB2C 4HDVA 3LSTA 2VODA 1DUXC 1O3RA 2MLKA 2VBYA 1W7PA 4A12A 1J75A 2YR2A 1JHHA 4AIJA 1S29A 1H9GA 2ETHA 3TO9A 3QU6A 1XGSA 5AIPA 5ILUA 2Z5UA 1ZREA 3MFKA 2FU4A 4U0YA 2L54A 1G3SA 5CVVA 3J81Z 3V8KA 2R7FA 4JK1X 1QQIA 4LB5A 3F22A 3V8LA 4ENNA 3WE2A 2L02A 3QU3A 3WTZA 2H6CA 2R7DA 4LFUA 4QLCU 1Z05A 4G7HF 5J6XA 3H3UA 4A0YA 4CDGA 2VN2A 5K5OA 1MJBA 1XSVA 3ZMTA 5FB2A 1J59A 1SAXA 1DPUA 1GHCA 4LLNA 1HW5A 3LAPA 3F72A 3MCZA 4CZZA 3SZTA 2DK8A 1E17A 1FC3A 2QQ9A 3EUHA 3ML6A 4OMZA 4QWQA 2FQ3A 4L9JA 3ULQB 3FM3A 2XAGA 1FBUA 4AVPA 1IN7A 3LA2A 1KYWA 2MA3A 4EM0B 5ILVA 2BV6A 3GFIA 3JAMK 2HEOA 3Q5FA 3F8CA 4IVNA 1R58A 3RKYA 2GXBA 5FLXK 1U5TC 3H3ZA 1FYLA 2HTJA 2PQ8A 4CICA 1HKSA 3IWZA 1J7KA 5HS9A 2XHKA 4IRIA 5D5WB 2L3DA 3BWGA 1TQPA 4KFCA 3N4MA 5E1XA 1IUYA 2XV4S 1TNSA 4L5IA 4EM1A 4L9VA 2CYYA 2QYOA 2WC2A 2KIFA 1HSJA 3QAHA 1CF7B 2HOEA 4FT8A 1IN4A 4Q4ZF 2HTSA 4M72A 5CYVA 5L3CA 2D2WA 2A61A 2STWA 5HDKA 1XSXA 4IF4A 1U6GA 1ULYA 5E18F 3L9FA 3CUQB 5CVJA 4LLLA 4KICA 4Q47A 3ABUA 4IRGA 5D6FA 1U5TA 3KP3A 1TNTA 1KU7A 4Q5SF 3I4PA 1QNTA 3ZMUA 3RYRA 3TO6A 1UHMA 1B59A 4I0BA 5D5VB 5D8LB 2KIMA 1R1UA 2COMA 3OOPA 2O8XA 3VOEA 2P5KA 1YW9A 1W4MA 2W24A 1RNLA 4TV7A 3R0AA 4I0AA 4UVBA 1R36A 1O57A 1XCBA 2G9WA 4DQ2A 1HKTA 4A6EA 3PQKA 1YW7A 4KN7X 2QUFA 1QO0D 1I5ZA 5FFZA 2E1CA 2PJPA 5LBQA 2W84A 5D4RA 3GEZA 5H6QA 5F1RA 3ZMDA 2FXAA 4OIQF 1XDUA 3KEOA 1CGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCW A;  1HKQ A;  4ZYE A;  1B9M A;  4EJV A;  1TW2 A;  2YX7 A;  3WOD F;  2V1X A;  4R79 A;  1R1T A;  4Y15 A;  2DLL A;  3O6B B;  2PN6 A;  1BIA A;  5CJ9 A;  1BI0 A;  3BZ6 A;  4A5M A;  3BY6 A;  5K5R A;  2GA1 A;  3GFL A;  4I7H A;  1MKM A;  4F7Z A;  4CGZ A;  1G3W A;  2CQK A;  2CFX A;  2K86 A;  5FO5 A;  2VOO A;  4A5N A;  3DP7 A;  2XRO A;  4UUV A;  1GVJ A;  3ABT A;  4N0B A;  5ERI A;  3ZN1 A;  2W57 A;  4HF2 A;  3WTT C;  1RIO H;  2DFI A;  1S7O A;  3SQN A;  2ZME B;  3CLO A;  3NEU A;  2V6C A;  3ZMS A;  3SFZ A;  3F8M A;  5J8C A;  3C1D A;  3G73 A;  1P4X A;  3TKY A;  1YS6 A;  2XRN A;  3E5Q A;  4M9Z A;  1PUE E;  4MTD A;  3KE2 A;  1ZRD A;  2FBK A;  3QOP A;  1ONV A;  1R5H A;  1EH7 A;  4MEY F;  2A6E F;  1Z6R A;  3L00 A;  4E70 A;  5A2Q K;  1FP2 A;  4MGR A;  5HDG A;  3MWM A;  1D3Y A;  4HBL A;  4EV0 A;  4XSX F;  4B8X A;  3HRS A;  3FZV A;  4D0P A;  2STT A;  1SMT A;  4WK8 F;  1B6A A;  1MD0 A;  1ZH5 A;  2E7X A;  2R3S A;  5LRR A;  2HR3 A;  5E20 A;  2YU3 A;  4PCQ A;  4MHG A;  4OIP F;  1KQ0 A;  4UNO A;  3D0S A;  5DD8 A;  1MZB A;  2VOP A;  3LAJ A;  1H0M A;  2V1D A;  4HF0 A;  3DKW A;  3ECH A;  4OIN F;  3LQR A;  3M1E A;  4HLY A;  3ELK A;  4P9F A;  4YFK F;  5ICE A;  2HYG D;  5BS6 A;  4HX7 A;  1CF7 A;  1XGO A;  5HDN A;  4NQW A;  1F5T A;  2BGC A;  4CYD A;  4L0Z B;  3IRR A;  2FML A;  2OBP A;  4FX0 A;  2GZW A;  5BOX A;  5BPI A;  3CUO A;  1IF1 A;  3EET A;  4BYY A;  2ZNZ A;  5DCF A;  5BQT A;  4KNY A;  1SMY F;  1LNW A;  3CUQ A;  2DQL A;  5CVI A;  4KT5 C;  4ETS A;  1YS7 A;  3E5U A;  5LRS A;  3S2W A;  3GYH X;  2IW5 A;  2LSO A;  4UHT A;  2NS0 A;  3M9A A;  1KU9 A;  5HLI A;  2YX4 A;  1S3J A;  4EJO A;  1Q1H A;  3HTS B;  4G7O F;  5ICF A;  2H94 A;  3BP8 A;  3I59 B;  4AIK A;  5L3E A;  1V4R A;  5LGT A;  3BDD A;  1R23 A;  3F8B A;  2MH9 A;  5IT9 K;  2Q0O A;  4B09 A;  5L3D A;  5D5U B;  1SD5 A;  4IJA A;  2A07 F;  2L4M A;  3T1B A;  3FHZ A;  2V79 A;  3GZ5 A;  2JTV A;  1EH6 A;  2P7V B;  1LDD A;  3P7N A;  4UXN A;  3U1D A;  3HRU A;  3O2P E;  2GXG A;  5TJJ A;  1I27 A;  2RDP A;  2E7W A;  5CLS A;  3GWZ A;  5DV5 A;  1JGS A;  3K0L A;  3U9G A;  1FBQ A;  1FSH A;  1BC8 C;  1P92 A;  1UHW A;  4KMF A;  5HVQ C;  3WU1 B;  1J0R A;  2K4J A;  4RGU A;  1YFH A;  5IT3 A;  3V4G A;  1PDN C;  4CO8 A;  1Y0U A;  2M30 A;  2B0L A;  5DUK A;  2Z9O A;  3TDZ C;  3WTY C;  2PMU A;  2V1U A;  4Z2Y A;  4DNC A;  1WWX A;  4HV6 A;  4BXU A;  4GO1 A;  4ESJ A;  2HDC A;  1Z91 A;  2H6B A;  1XD7 A;  5TRD A;  2JPC A;  2D45 A;  2EFN A;  4RGR A;  2VT2 A;  3KET A;  2ZME A;  2PG4 A;  4P9U A;  1BOA A;  1SD7 A;  4WXD A;  1TBX A;  4ZZL A;  1QPM A;  3SHF A;  1HW1 A;  3DV8 A;  4IRH A;  5E1Z B;  1OPC A;  2UZK A;  1K79 A;  2OAZ A;  2RNJ A;  3K1P A;  1HQC A;  1AOY A;  4OMY A;  2C6Y A;  1I6X A;  2ZO4 A;  2XGX A;  1ZG3 A;  2A6H F;  2MC3 A;  3R0J A;  4IHT A;  5FD5 A;  4BHB A;  4OIR F;  4I09 A;  1ZGJ A;  5CVU A;  3VEP A;  1H9T A;  4EM2 A;  3F23 A;  5HLH A;  4JQF A;  5DCM B;  1ZHF A;  4KIF A;  3J81 K;  2AS5 F;  3JAM Z;  4NHJ A;  1J2X A;  4ZYG A;  3WE3 A;  5FLX Z;  1R22 A;  3CO6 C;  1GXQ A;  4XLP F;  4U7B A;  2IJL A;  3J80 Z;  1O3T A;  1C0W A;  1K78 B;  2WV0 A;  5HOO A;  2Y0M A;  1P4W A;  1DDN A;  1FY7 A;  1FYM A;  4BHC A;  3SZP A;  3HUG A;  4HX4 A;  4GXO A;  4A0Z A;  4ZZD A;  5J8F A;  3EQL F;  1W5S A;  2IPQ X;  1IN5 A;  4P55 A;  2P4W A;  3L2C A;  4WXC A;  1IAW A;  3REO A;  2FBH A;  3B73 A;  4HQM A;  2VBW A;  3F8N A;  2A69 F;  1EH8 A;  2VE9 A;  4OU0 A;  1A04 A;  1ON1 A;  4LJZ F;  4HLX A;  1FPQ A;  3TOA A;  4HA8 A;  3E6D A;  2FEZ A;  1BJA A;  3FF5 A;  2RQP A;  2JZY A;  2QEN A;  1D8J A;  1RUO A;  3ZPL A;  4HDU A;  4I01 A;  3L09 A;  3K2Z A;  3OV8 A;  2PBI A;  2X0L A;  1W7P D;  3M7G A;  4LMY A;  4HW0 A;  1ZN2 A;  3P9C A;  3KP4 A;  1XMA A;  2F2E A;  3PQJ A;  1BI2 A;  2F5C A;  3C18 A;  2QZ8 A;  2XAF A;  3I59 A;  3K69 A;  3I71 A;  2M45 A;  4EGY A;  5F6F A;  2Z99 A;  1GXP A;  5E8G A;  4IHS A;  2EA4 A;  1O7F A;  4L9N A;  2HQN A;  3J7A O;  5DD4 A;  2V9V A;  3BOQ A;  4Y17 A;  2CG4 A;  4XRF A;  3MEX A;  4P96 A;  5LGU A;  2BE5 F;  2E1N A;  5LHI A;  1DPR A;  2IVM A;  3GZ6 A;  1F9N A;  2BYV E;  4MEX F;  4ZH4 F;  3L7W A;  3ECO A;  1F4K A;  3FWE A;  4BH9 A;  4M71 A;  1Z7U A;  5L3G A;  5FD6 A;  5EEG A;  2XUB A;  1EV7 A;  3NRV A;  1BIB A;  4L9T A;  3LA3 A;  4NB5 A;  5LHH A;  2CW0 F;  1U8R A;  4AIH A;  2HKX A;  1LEA A;  2MH2 A;  1S7A A;  4EJT A;  2XAJ A;  4OIO F;  2L01 A;  3GUD A;  1YW8 A;  3GFJ A;  1IRG A;  4Y13 A;  2HYF A;  4EJU A;  3HYI A;  3RYP A;  4HQE A;  3KEQ A;  3KZZ A;  2L4A A;  1YO5 C;  1RUN A;  3M8F A;  4M73 A;  4ESB A;  1T98 A;  1IXC A;  2ESN A;  1UCR A;  3M8E A;  3ROU A;  1XB4 A;  2PEX A;  2P5L C;  2GWR A;  2FF4 A;  2K4B A;  1I1G A;  2FBI A;  2OU2 A;  4A0X A;  3IHU A;  1O3Q A;  1IXS B;  1HST A;  4G8X A;  4GGG A;  1WKM A;  1B4A A;  2IT0 A;  3F6O A;  4M6X A;  3IKT A;  4UV9 A;  2QQA A;  4KA4 A;  4G9Y A;  5A2Q Z;  5DCM A;  3TO7 A;  3ZP5 A;  4G7Z F;  3RDI A;  1E2X A;  4O5V A;  4JBA A;  1BN5 A;  2O61 A;  2WWY A;  3HSR A;  2VXZ A;  5AON A;  3F6V A;  2DPU A;  1G4D A;  4UVC A;  1QGP A;  1K78 A;  3ERE D;  3HTU A;  3DPT A;  2RN7 A;  2LF8 A;  1T39 A;  2KJC A;  2HKO A;  3CUQ C;  2EV0 A;  1TQM A;  1RZ4 A;  3CTA A;  2DT5 A;  5D6E A;  2RC4 A;  3KP2 A;  3QPT A;  2PFB A;  5K5Q A;  2DPD A;  4HF1 A;  2XAS A;  1XN7 A;  2MLG A;  1STZ A;  4M74 A;  4A6D A;  1USS A;  1ZAO A;  1BI3 A;  5ICG A;  1V3F A;  2EFO A;  2F5E A;  3RJP A;  1P6R A;  1FP1 D;  1XGM A;  4XBF A;  1MJA A;  1ZRF A;  3W6J B;  2DTR A;  3GLX A;  3EYY A;  3TOB A;  3NQO A;  3WTW C;  1MGT A;  3IKV A;  4IPA A;  5E8I A;  4I02 A;  3JTG A;  3HSE A;  2UXX A;  4ESF A;  5LGN A;  4ZYD A;  3GFM A;  4ENM A;  2GQQ A;  4XSZ F;  2G7H A;  4LG0 B;  2KRF A;  4MTE A;  1OYW A;  2UWM A;  2ACJ A;  2RVC A;  5DYM A;  5HS8 A;  4RGS A;  3I58 A;  3WTU C;  1QZZ A;  1TLH B;  3DQV C;  1UST A;  2P6T A;  2O0Y A;  5BMZ A;  3R6S A;  5DDG A;  2VC0 A;  4ZYH A;  1HXD A;  1P4A A;  1IZ1 A;  2HQR A;  4M9X A;  3K1M A;  2ZXJ A;  4A2U A;  1ZG1 A;  4WF2 A;  4O3M A;  3D5L A;  5IT9 Z;  3GXO A;  2YPR A;  3KP5 A;  4YII A;  2VBZ A;  4U7D A;  1XMK A;  4RS8 A;  3CJN A;  2LKP A;  3BPX A;  1F1Z A;  2O03 A;  1R7J A;  3T8T A;  2RGV A;  3HHH A;  2A5Y B;  3FM5 A;  4FHT A;  3FXR A;  1IW7 F;  1B9N A;  3E6M A;  2VC1 A;  4RAY A;  1TW3 A;  1BI1 A;  1ZLJ A;  5E17 F;  3CO7 C;  4GCV A;  5HS7 A;  1SFE A;  1FBS A;  3KP7 A;  3RI4 A;  3F3X A;  4G6D A;  4PGH A;  4R8H A;  3MAJ A;  3Q9V A;  2Z33 A;  3DF8 A;  4P5O A;  3R61 A;  2F5D A;  2QM3 A;  1IXR C;  5D4S A;  5CVR A;  4WCG A;  3TGN A;  4Q48 A;  3P9K A;  3PFI A;  2QBY B;  1IN6 A;  2QVO A;  3WTX C;  1WRJ A;  3I5U A;  1MDM B;  2RV8 A;  2FNP A;  4HAM A;  2IA1 A;  3HIF A;  3DXJ F;  1YLF A;  5K1Y A;  1PP8 F;  2DK5 A;  1FLI A;  2XKO A;  4XLN F;  4EJW A;  3COA C;  3CDH A;  4I2O A;  4RGX A;  2A3S A;  2KKO A;  4KIG A;  1T0F A;  2QWW A;  5LLQ A;  4KDP A;  4RB0 A;  1UFM A;  2XVC A;  4N9I A;  3E3V A;  2OZ6 A;  1LJ9 A;  1JHF A;  1SFX A;  3KCC A;  1XCV A;  5KK1 A;  3IWF A;  3LWF A;  1X3U A;  1U3E M;  2ZFW A;  4EMS A;  4H0E A;  1B1B A;  5JVT A;  2HFH A;  4YIF A;  2X4H A;  3DFG A;  1YTY A;  3LA7 A;  1YIO A;  3SXY A;  5JHU A;  3IL2 A;  1U2W A;  1FYK A;  1LDK B;  2PMH A;  3BJA A;  1FT9 A;  3GW2 A;  4KIB A;  1L0O C;  1ZAR A;  5ED4 A;  1RI7 A;  1FNN A;  2W85 A;  3VOD A;  1FWZ A;  4LLG F;  3GF2 A;  1Z9C A;  2F5F A;  2QQB A;  1W5T A;  2DBB A;  4GYI A;  2KIU A;  2XKP A;  4RB3 C;  3E6C C;  2GIV A;  1SD6 A;  1OR7 A;  3KP6 A;  3RIR A;  2OZU A;  1D5V A;  3RPQ A;  1T6S A;  2DQR A;  2FMY A;  4LG0 A;  2RKH A;  4MQ9 F;  2H09 A;  1ON2 A;  1MJ9 A;  2FSW A;  4S05 A;  3DEU A;  5H20 A;  3J80 K;  4YG2 F;  4L5J A;  2M5W A;  2CSO A;  3N97 A;  2PLY A;  4YFN F;  3ZMV A;  3KLN A;  3HRT A;  4WXH A;  1BBY A;  4EGZ A;  2JRT A;  3I54 A;  1G6N A;  5LEJ A;  3QPH A;  2MD5 A;  3WG9 A;  5E1W A;  4S04 A;  2FA5 A;  2TDX A;  1IRF A;  3I53 A;  3GVA A;  2M1B A;  5BPD A;  3V7C A;  4KYW A;  2EB7 A;  4MNU A;  3K1N A;  3O3K A;  1R00 A;  2EWN A;  1FOK A;  3FXQ A;  4LB6 B;  1LB2 A;  2ESH A;  1UB9 A;  1TQI A;  1ZGA A;  3HOS A;  2NAZ A;  2WTE A;  2XAQ A;  2ZKZ A;  1QBJ A;  1NHA A;  2UXN A;  4HYE A;  2OQR A;  3E5X A;  2LNB A;  3WTS C;  1R5G A;  2D1V A;  1FX7 A;  4KMU X;  4HV5 A;  4CXF A;  1L3L A;  4ON0 A;  5EEH A;  3LFK A;  2W25 A;  1K7A A;  4U88 A;  4UVA A;  3MZY A;  4N9H A;  1LQ1 A;  5H6R A;  3P9I A;  5JI6 A;  1WQ2 A;  2M8E A;  5DUI A;  3C3W A;  2P7C B;  2BBY A;  3KZY A;  1HW2 A;  5ICC A;  4UV8 A;  2FNA A;  3FMQ A;  2QLZ A;  4BQA A;  3C7J A;  2QBY A;  1KYZ A;  5LEK A;  2HZT A;  1MDM A;  1OYY A;  4BNC A;  3I0T A;  4ENJ A;  1KU2 A;  3TDU C;  1XDS A;  2P8T A;  5FGM A;  2ISY A;  1G3T A;  2DAO A;  4HOB A;  3GX4 X;  1LDJ A;  2HGC A;  3B02 A;  3QP5 A;  4GYG A;  3FMR A;  3HRM A;  2IA2 A;  1U78 A;  2J5O A;  1ZRC A;  2EFP A;  1Z1D A;  2O6G E;  2OQG A;  3K9T A;  4OOI A;  3BJ6 A;  1OMI A;  3FMS A;  3TQN A;  3ZQ7 A;  2K27 A;  3U2R A;  5HLG A;  1TTY A;  2DI3 A;  2K02 A;  1O7L A;  1YYV A;  2VBX A;  1FZP B;  1LVA A;  3H92 A;  2D1H A;  4U0V A;  3IRQ A;  1W7P B;  4KN4 X;  5LHG A;  1JE8 A;  2IA0 A;  4LD5 A;  2K7L A;  2PI0 A;  1I1S A;  1J5Y A;  2NNY A;  3R4K A;  3T8R A;  2IRF G;  1HBX G;  1WI9 A;  4ENK A;  1S6L A;  5JFR A;  4PDK A;  3VFZ A;  3VB2 A;  3RPU A;  3BRO A;  1T38 A;  1YQA A;  2LF7 A;  3RTR A;  4PZJ A;  2EFW A;  1SD4 A;  2ELH A;  2DU9 A;  2Q2E A;  2VT3 A;  5JR3 A;  2ADU A;  3V7S A;  6PAX A;  4HX8 A;  1P2F A;  4U0W A;  2JSC A;  3V8J A;  4K2E A;  2HWV A;  3T0Y A;  3KLO A;  2HS5 A;  1OKR A;  4RB1 A;  2GAU A;  4O6J A;  3EDP A;  4FX4 A;  2LDU A;  3AAF A;  3JSO A;  3Q9S A;  1VTN C;  3ZN0 A;  2OD5 A;  2NYX A;  1KQ8 A;  3E97 A;  1G3Y A;  4L0Y B;  3W6K B;  3LQQ A;  4M9S A;  4L18 B;  3RKX A;  1LEB A;  2A68 F;  2Q8K A;  4MQV A;  2ZNY A;  2EJR A;  1XSD A;  2Y75 A;  4G94 A;  3FX3 A;  3R60 A;  2Z3Y A;  1WSU A;  2EK5 A;  2Y48 A;  3V7R A;  1D8K A;  2DW4 A;  1T2K A;  4AD9 A;  3WGH A;  2O3F A;  1ODD A;  1JXS A;  5AIQ A;  5D5X B;  1QZY A;  2CO5 A;  2VE8 A;  2CWE A;  3GO5 A;  4HZF A;  5FFX A;  2DO7 A;  1KQ9 A;  2G7U A;  1BM9 A;  5D8K B;  3I64 A;  2CGP A;  4WX9 A;  2MBF A;  1KGS A;  1J9I A;  2IP2 A;  2FOK A;  2XIG A;  3IC7 A;  3WGI A;  3BPV A;  1Z6T A;  4EQQ A;  1ZLK A;  2YSR A;  2EA2 A;  2ISZ A;  5L3F A;  3F21 A;  3DPL C;  1FSE A;  2ZJ2 A;  4EVI A;  3RKW A;  3KFW X;  2NNN A;  3HOT A;  1ZYR F;  3WTV C;  3ZMZ A;  1OYI A;  2FE3 A;  2JPB A;  2BEO A;  3MQ0 A;  2EV5 A;  4KUM A;  2H27 A;  1K6O A;  3JTH A;  4PGG A;  1KU3 A;  1DP7 P;  1ZG5 A;  1PP7 U;  1IN8 A;  4I98 B;  2P5V A;  2NRA C;  4RAZ A;  5KVR A;  2J5P A;  4BHP A;  3QP6 A;  3FXU A;  2AXL A;  4BAY A;  4YFX F;  2P6S A;  4R1H A;  3WU0 A;  1S8N A;  2EV6 A;  1U5T B;  3HHG A;  1REP C;  2JT1 A;  3WGG A;  4CHU A;  3HSF A;  2OA4 A;  2GA2 A;  4LK1 F;  5DEQ A;  3ISP A;  5ILS A;  3JSP A;  3EYI A;  1O3S A;  3MZH A;  1KA8 A;  3F8F A;  4AWX B;  5L3B A;  4WWC A;  4G6Q A;  3QRF F;  2FRH A;  2EFQ A;  3JW4 A;  4LGW A;  5F64 A;  3E6B A;  4ASN A;  1XGN A;  1R1V A;  2XAH A;  2ZBK A;  2KJB A;  1SFU A;  3BJO A;  1YG2 A;  4IXA A;  2VON A;  3G3Z A;  2M87 A;  4M6Y A;  1BC7 C;  4LK0 F;  3T5X A;  1AWC A;  4RB2 C;  4HDV A;  3LST A;  2VOD A;  1DUX C;  1O3R A;  2MLK A;  2VBY A;  1W7P A;  4A12 A;  1J75 A;  2YR2 A;  1JHH A;  4AIJ A;  1S29 A;  1H9G A;  2ETH A;  3TO9 A;  3QU6 A;  1XGS A;  5AIP A;  5ILU A;  2Z5U A;  1ZRE A;  3MFK A;  2FU4 A;  4U0Y A;  2L54 A;  1G3S A;  5CVV A;  3J81 Z;  3V8K A;  2R7F A;  4JK1 X;  1QQI A;  4LB5 A;  3F22 A;  3V8L A;  4ENN A;  3WE2 A;  2L02 A;  3QU3 A;  3WTZ A;  2H6C A;  2R7D A;  4LFU A;  4QLC U;  1Z05 A;  4G7H F;  5J6X A;  3H3U A;  4A0Y A;  4CDG A;  2VN2 A;  5K5O A;  1MJB A;  1XSV A;  3ZMT A;  5FB2 A;  1J59 A;  1SAX A;  1DPU A;  1GHC A;  4LLN A;  1HW5 A;  3LAP A;  3F72 A;  3MCZ A;  4CZZ A;  3SZT A;  2DK8 A;  1E17 A;  1FC3 A;  2QQ9 A;  3EUH A;  3ML6 A;  4OMZ A;  4QWQ A;  2FQ3 A;  4L9J A;  3ULQ B;  3FM3 A;  2XAG A;  1FBU A;  4AVP A;  1IN7 A;  3LA2 A;  1KYW A;  2MA3 A;  4EM0 B;  5ILV A;  2BV6 A;  3GFI A;  3JAM K;  2HEO A;  3Q5F A;  3F8C A;  4IVN A;  1R58 A;  3RKY A;  2GXB A;  5FLX K;  1U5T C;  3H3Z A;  1FYL A;  2HTJ A;  2PQ8 A;  4CIC A;  1HKS A;  3IWZ A;  1J7K A;  5HS9 A;  2XHK A;  4IRI A;  5D5W B;  2L3D A;  3BWG A;  1TQP A;  4KFC A;  3N4M A;  5E1X A;  1IUY A;  2XV4 S;  1TNS A;  4L5I A;  4EM1 A;  4L9V A;  2CYY A;  2QYO A;  2WC2 A;  2KIF A;  1HSJ A;  3QAH A;  1CF7 B;  2HOE A;  4FT8 A;  1IN4 A;  4Q4Z F;  2HTS A;  4M72 A;  5CYV A;  5L3C A;  2D2W A;  2A61 A;  2STW A;  5HDK A;  1XSX A;  4IF4 A;  1U6G A;  1ULY A;  5E18 F;  3L9F A;  3CUQ B;  5CVJ A;  4LLL A;  4KIC A;  4Q47 A;  3ABU A;  4IRG A;  5D6F A;  1U5T A;  3KP3 A;  1TNT A;  1KU7 A;  4Q5S F;  3I4P A;  1QNT A;  3ZMU A;  3RYR A;  3TO6 A;  1UHM A;  1B59 A;  4I0B A;  5D5V B;  5D8L B;  2KIM A;  1R1U A;  2COM A;  3OOP A;  2O8X A;  3VOE A;  2P5K A;  1YW9 A;  1W4M A;  2W24 A;  1RNL A;  4TV7 A;  3R0A A;  4I0A A;  4UVB A;  1R36 A;  1O57 A;  1XCB A;  2G9W A;  4DQ2 A;  1HKT A;  4A6E A;  3PQK A;  1YW7 A;  4KN7 X;  2QUF A;  1QO0 D;  1I5Z A;  5FFZ A;  2E1C A;  2PJP A;  5LBQ A;  2W84 A;  5D4R A;  3GEZ A;  5H6Q A;  5F1R A;  3ZMD A;  2FXA A;  4OIQ F;  1XDU A;  3KEO A;  1CGP A; 
#chains in the Genus database with same CATH topology
 2ZCW A;  3GZN B;  1HKQ A;  2OTL I;  1MH3 A;  1B9M A;  4ZYE A;  3CMA I;  2DT7 B;  4EJV A;  1TW2 A;  2YX7 A;  2KDZ A;  2BHZ A;  4ZYA A;  3WOD F;  2V1X A;  4R79 A;  1WVR A;  1R1T A;  4Y15 A;  1VQM I;  2DLL A;  2CS3 A;  3O6B B;  2BXZ A;  2PN6 A;  1BIA A;  5CJ9 A;  1X58 A;  4PUS A;  1BI0 A;  1Y8Q B;  3JRA A;  3M1C A;  3BZ6 A;  4A5M A;  3BY6 A;  4IL6 C;  1SAU A;  2R7T A;  5K5R A;  2KL4 A;  1ZTR A;  2VKD A;  2BY1 A;  2GA1 A;  3GFL A;  3RQ4 A;  4AUX A;  4I7H A;  1MKM A;  4F7Z A;  2P81 A;  1AKH A;  3OOU A;  2IS4 A;  4CGZ A;  2XF7 A;  3KPH A;  1G3W A;  2CQK A;  4UB8 C;  2NVY J;  2CFX A;  2K86 A;  4B43 A;  5FO5 A;  5HNH A;  2VOO A;  4A5N A;  3DP7 A;  1VQP I;  2E71 A;  1JTX A;  2XRO A;  4UUV A;  1GVJ A;  4NC7 A;  3ABT A;  4N0B A;  4J00 A;  5ERI A;  2DTZ A;  5EEA A;  3JRI A;  4NBQ A;  1BOB A;  3K70 C;  3FK6 A;  3ZN1 A;  2W57 A;  3OR1 C;  1LE8 B;  4HF2 A;  1SFO J;  5FLV A;  1OCC H;  3HOU J;  1P7J A;  2Y0S A;  3WTT C;  4BXX J;  2R5Y B;  1RIO H;  3BR6 A;  5GAG J;  2VQL A;  2DFI A;  1S7O A;  3SQN A;  2ZME B;  3CLO A;  3NEU A;  2V6C A;  3Q0V A;  1T95 A;  5B3S H;  3ZMS A;  3SFZ A;  3F8M A;  5J8C A;  3C1D A;  3G73 A;  1P4X A;  1ETQ A;  2GIZ A;  3TKY A;  1YS6 A;  4GFB A;  2Q1Z B;  1AA7 A;  1E3H A;  3TW6 A;  4Y7N J;  2XRN A;  3M07 A;  4XR6 A;  5EG0 A;  3BTL A;  3FKI J;  3E5Q A;  4M9Z A;  1PUE E;  4MTD A;  2LY1 A;  3SJM A;  1ETO A;  3KE2 A;  3CES A;  1ZRD A;  2FBK A;  3Q0W A;  2GBY A;  3QOP A;  1FTZ A;  1ONV A;  1R5H A;  1MMN A;  1EH7 A;  2A5W A;  4MEY F;  2A6E F;  3MKW B;  2KZG A;  3I3L A;  1YOV B;  1Z6R A;  3BZK A;  3L00 A;  3RZD J;  4E70 A;  4IQJ A;  5A2Q K;  1FP2 A;  4MGR A;  5IOY A;  5HDG A;  3MWM A;  1D3Y A;  3WHB A;  4HBL A;  4EV0 A;  4XSX F;  2JA2 A;  4B8X A;  2M34 A;  3HRS A;  3FZV A;  5JLX A;  2LK2 A;  4D0P A;  2STT A;  2YS9 A;  3H9G A;  1SMT A;  4WK8 F;  1B6A A;  1MD0 A;  4M3B A;  1ZH5 A;  2DJI A;  2WY8 Q;  3K4N A;  2E7X A;  4B47 A;  2R3S A;  4M6V A;  4XOP A;  1X1B A;  5LRR A;  2HR3 A;  1O4X A;  1MBH A;  1U9N A;  1MMD A;  5E20 A;  3OYI A;  2ME0 A;  2YU3 A;  4PCQ A;  2XB0 X;  4MHG A;  1U0J A;  4OIP F;  2CU7 A;  4RDU A;  1KQ0 A;  1N75 A;  4UNO A;  2XAU A;  3D0S A;  5DD8 A;  3ASO H;  2VPR A;  1Y0N A;  1MZB A;  2VOP A;  3LAJ A;  1H0M A;  5E3M A;  2K5C A;  3QWL A;  1I39 A;  2ZJQ F;  2V1D A;  4HF0 A;  4GDF A;  3DKW A;  3ECH A;  5FKM A;  4OIN F;  4BJ5 C;  3FXO A;  4C2U A;  3LQR A;  3M1E A;  4HLY A;  3EUA A;  3ELK A;  2DOA A;  2VB6 A;  1E3P A;  4P9F A;  4YFK F;  5ICE A;  1T33 A;  2HYG D;  3SFI A;  4HX7 A;  5BS6 A;  1CF7 A;  4C2T A;  3HUG B;  1MSF C;  1MIJ A;  1XGO A;  4NQW A;  5HDN A;  2QKL B;  4YIR X;  1FOW A;  1F5T A;  1A31 A;  2BGC A;  4XK4 A;  4CYD A;  3AG1 H;  4L0Z B;  3IRR A;  2E1O A;  2FML A;  2OBP A;  4FX0 A;  3OYN A;  1Y6I A;  5IYB J;  4CCL A;  2ZXH A;  1ERD A;  2GZW A;  4E7J A;  5BOX A;  5BPI A;  3CUO A;  1IF1 A;  3K6G A;  1HCR A;  3EET A;  3S17 J;  4BYY A;  2ZNZ A;  4BE1 A;  1BR1 A;  5DCF A;  1VQ7 I;  3OYK A;  3CF5 F;  4BY7 J;  2CJJ A;  1SVO A;  5BQT A;  4I99 C;  3ONQ A;  4KNY A;  1SMY F;  2NOJ B;  1ZQ3 P;  2M9H A;  1LNW A;  3CUQ A;  2DQL A;  5CVI A;  2HNH A;  4MIM A;  4KT5 C;  4ETS A;  3BCB A;  2CQQ A;  3HEF A;  4XL9 A;  4F92 B;  4BEH A;  1YS7 A;  3E5U A;  2R5Z B;  5LRS A;  4PJM A;  1WI3 A;  3M8J A;  3S2W A;  3ESW B;  2DA5 A;  3GYH X;  3ZQH A;  3D1N I;  3E0J B;  2IW5 A;  2F5V A;  1WH7 A;  2LSO A;  4UHT A;  2NS0 A;  3VSK A;  3M9A A;  4C3I J;  3HPG A;  4OAZ A;  5EJC A;  4E7H A;  1KU9 A;  1PJR A;  1RES A;  4PJ0 C;  5HLI A;  2R7R A;  1LFU P;  2YX4 A;  1TWG J;  3BG6 A;  5C4X J;  1S3J A;  4CCM A;  2I10 A;  2EIJ H;  4PJJ A;  4EJO A;  1RPW A;  2NVX J;  1Q1H A;  4CCO A;  3HTS B;  4PSX A;  4G7O F;  2QSF X;  1MBK A;  2FOW A;  3OWT A;  3FIS A;  2E60 A;  5ICF A;  2H94 A;  4QTR A;  2LG4 A;  2R7U A;  3BP8 A;  3I59 B;  2IXS A;  3PO2 J;  4AIK A;  3CCU I;  5L3E A;  4F3Q A;  1V4R A;  5LGT A;  1BW5 A;  3BDD A;  1R23 A;  2QF7 A;  3F8B A;  2A6T A;  2IGM A;  2MH9 A;  1AHD P;  4GRI A;  1LUJ B;  5IT9 K;  5F27 A;  2GOM A;  2Q0O A;  4B09 A;  5L3D A;  5D5U B;  2ZME C;  9ANT A;  1SD5 A;  4IJA A;  2XB5 A;  2A07 F;  2L4M A;  4RAG A;  3T1B A;  1EA3 A;  5J1R A;  3FHZ A;  2V79 A;  3GZ5 A;  2KDO A;  2JTV A;  1EH6 A;  2P7V B;  1LDD A;  5FKN A;  3P7N A;  4UXN A;  3U1D A;  3VYR B;  1FIP A;  3HRU A;  2JA7 J;  2DOE A;  3O2P E;  3MN2 A;  4X1E A;  2GXG A;  3IH3 A;  5TJJ A;  3OR2 C;  3CCE I;  1I27 A;  2RDP A;  3A03 A;  3ZOB A;  2E7W A;  5CLS A;  3GWZ A;  5DV5 A;  1JGS A;  4MFD A;  3K0L A;  3U9G A;  1FBQ A;  1FSH A;  2EBI A;  3BTC A;  4LIT A;  3CLQ A;  2F4O B;  3OYL A;  1G59 A;  1BC8 C;  1MSE C;  3S15 J;  1P92 A;  1UHW A;  4PJN A;  2IAI A;  2CFO A;  4KMF A;  1YJ9 I;  4FET A;  5HVQ C;  5E3L A;  1N78 A;  1IRZ A;  3WU1 B;  1J0R A;  3ZQC A;  2K4J A;  2RQQ A;  1HDD C;  4J01 A;  4RGU A;  4B44 A;  1X1P A;  1YFH A;  5IT3 A;  2LOO A;  3GCM A;  4XMY A;  3V4G A;  1PDN C;  3A4C A;  2AXT C;  4JOM A;  5GTH C;  4CO8 A;  1Y0U A;  2M30 A;  2B0L A;  1D0X A;  5DUK A;  2R0Q C;  3TDZ C;  2Z9O A;  3WTY C;  2PMU A;  2V1U A;  4XOT A;  4Z2Y A;  4DNC A;  1WWX A;  4HRI A;  3ZQQ A;  3ZQL A;  4HV6 A;  4BXU A;  4HSR A;  2AQF A;  4GO1 A;  4ESJ A;  2HDC A;  1Z91 A;  2H6B A;  2NVQ J;  1LE8 A;  3L2W A;  3LMM A;  1XD7 A;  1U9O A;  1X2N A;  5TRD A;  2JPC A;  2R5Y A;  2EZH A;  2D45 A;  1K4T A;  2EFN A;  2X6O A;  2R7Q A;  2V4J C;  4RGR A;  1GLN A;  2VT2 A;  5TGT A;  2ZME A;  3KET A;  3VWB A;  2PG4 A;  3DEE A;  2CV1 A;  4P9U A;  1XX5 A;  3BT9 A;  1BOA A;  1SD7 A;  1X1C A;  4WXD A;  1TBX A;  4ZZL A;  2X1E A;  1PVE A;  1QPM A;  3SHF A;  2GM4 A;  1HW1 A;  3DV8 A;  4IRH A;  4XLC A;  5E1Z B;  3S32 A;  1D1C A;  1OPC A;  2UZK A;  4QPQ A;  1K79 A;  4E4H A;  2OAZ A;  4M3E A;  2RNJ A;  3K1P A;  3U1K A;  1HQC A;  2YUS A;  4XLH A;  1YX5 A;  2H8W A;  4XKB A;  1AOY A;  2BY3 A;  4OMY A;  4JP0 A;  2C6Y A;  1H8A C;  1I6X A;  2ZO4 A;  5DM7 F;  1PYV A;  3HB9 A;  2XGX A;  1ZG3 A;  4B4C A;  1YIT I;  2K9N A;  3A02 A;  1IO2 A;  4C9Y A;  2A6H F;  2MC3 A;  3R0J A;  4A3C J;  3BR1 A;  5B66 C;  2DOF A;  4LIU A;  4IHT A;  1K61 A;  4RBO A;  5FD5 A;  2HVS A;  3PNY A;  2OC6 A;  4BHB A;  4OIR F;  4I09 A;  3QPL A;  1ZGJ A;  1NH3 A;  5CVU A;  2E5N A;  2LY2 A;  2K85 A;  3G1O A;  3VEP A;  2R4G A;  1H89 C;  1H9T A;  2VJJ A;  4EM2 A;  3F23 A;  3SEQ A;  5HLH A;  2L7K A;  1JGG A;  1D1B A;  1MBG A;  2K9L A;  1RR8 C;  4JQF A;  5DCM B;  3FXJ A;  1ZHF A;  4KIF A;  1XMX A;  1ZR4 A;  3J81 K;  2AS5 F;  3JAM Z;  4NHJ A;  1J2X A;  4ZYG A;  3GTP J;  3AG3 H;  1WGX A;  2X9D A;  3WE3 A;  5FLX Z;  1MND A;  2NVT J;  1R22 A;  3CO6 C;  5DS9 A;  1GXQ A;  4XLP F;  1ACI A;  4U7B A;  2IJL A;  3J80 Z;  3A0H C;  1VQK I;  1X19 A;  2EH3 A;  1O3T A;  3NWT A;  1C0W A;  2B63 J;  1K78 B;  1APL C;  2WV0 A;  5HOO A;  2Y69 H;  2Y0M A;  2F6C A;  4PJL A;  1P4W A;  2CW8 A;  1DDN A;  1RET A;  1FY7 A;  1UAA A;  1FYM A;  4BHC A;  3SZP A;  3I55 I;  2BY2 A;  3HUG A;  4HX4 A;  4OWR B;  4GXO A;  2DYR H;  4A0Z A;  2KZV A;  3F0C A;  3S1M J;  4ZZD A;  2CQN A;  1MBJ A;  2NVU B;  5J8F A;  3EQL F;  2W48 A;  1W5S A;  3O8G A;  4RM3 A;  2IPQ X;  1IN5 A;  4PFP A;  5CQG A;  4P55 A;  2P4W A;  3L2C A;  5IP6 A;  4BE2 A;  4WXC A;  1MMS A;  1IAW A;  3REO A;  2FBH A;  4BGD A;  3LOC A;  2M8G X;  3B73 A;  4HQM A;  2EZL A;  3BCA A;  2VBW A;  2AHQ A;  3F8N A;  2CQ7 A;  3PIO F;  2A69 F;  3KX2 A;  1EH8 A;  2VE9 A;  2ZJP F;  3C2B A;  1WFX A;  4OU0 A;  3CME I;  1A04 A;  1YE9 A;  1VQ4 I;  4XLE A;  1ON1 A;  4LJZ F;  4BL0 B;  3H1C A;  4HLX A;  1FPQ A;  2R5Z A;  3TOA A;  4HA8 A;  1I50 J;  3E6D A;  1DP3 A;  2FEZ A;  1BJA A;  3FF5 A;  4DJA A;  2RQP A;  2JZY A;  4BQO A;  2ID3 A;  2QEN A;  1D8J A;  1RUO A;  2DA7 A;  5H2F C;  3ZPL A;  4HDU A;  4I01 A;  3L09 A;  2EPF A;  3E7L A;  1IDZ A;  3CF2 A;  3OL4 A;  3K2Z A;  3OV8 A;  2PBI A;  2Y2Z A;  2X0L A;  1W7P D;  3M7G A;  4LMY A;  4HW0 A;  2W00 A;  3RCO A;  5K7F A;  1A35 A;  1ZN2 A;  1WJB A;  3OS0 A;  3P9C A;  3KP4 A;  1XMA A;  2F2E A;  3PQJ A;  1BI2 A;  3Q3S A;  3ZQG A;  4C30 A;  4DIQ A;  2F5C A;  3C18 A;  2LYC A;  2QZ8 A;  2XAF A;  4JX4 A;  4NUB A;  2OCE A;  1NTC A;  4B48 A;  4E7L A;  2HQ5 A;  3I59 A;  3K69 A;  3I71 A;  2EIL H;  2KFD A;  3GBG A;  1A5J A;  4AYB A;  2M45 A;  4EGY A;  1NG7 A;  5F6F A;  2Z99 A;  1GXP A;  5E8G A;  4G6T B;  3HZJ A;  4M3D A;  5J1Y A;  5HOD A;  4IHS A;  2WAQ A;  2EA4 A;  1O7F A;  4L9N A;  1QHH D;  2HQN A;  3J7A O;  4A93 J;  5DD4 A;  2V9V A;  3KYC B;  3BOQ A;  4Y17 A;  1FOX A;  1W5C C;  2CG4 A;  2JWT A;  4HPQ A;  4LOC A;  4XRF A;  3MEX A;  1QVT A;  4P96 A;  5LGU A;  4ANJ A;  2BE5 F;  4OAY A;  3S93 A;  2E1N A;  5KAI C;  5LHI A;  1DPR A;  2IVM A;  3GZ6 A;  1F9N A;  4BDY A;  3BTI A;  2BYV E;  4MEX F;  4ZH4 F;  1OJL A;  1GUU A;  3DCF A;  1LFB A;  3L7W A;  1PUF B;  3ECO A;  1F4K A;  1GV5 A;  4Y4R A;  4A3F J;  1VZ0 A;  3FWE A;  4BH9 A;  4M71 A;  1Z7U A;  2OUM A;  3OYB A;  1IDY A;  5L3G A;  4P1W A;  2M4K A;  4AU7 A;  2LP0 A;  5FD6 A;  4RLQ A;  2OPT A;  1ETX A;  5EEG A;  4A3I J;  2KPM A;  1A36 A;  1MBF A;  2XUB A;  5C3E J;  1EV7 A;  3CJR B;  1JJ6 C;  3NRV A;  1BIB A;  4L9T A;  4IHV A;  3EUK L;  3LA3 A;  4NB5 A;  1HF0 A;  5LHH A;  2CW0 F;  4UUS A;  1QRY A;  1U8R A;  5F0F A;  2AQE A;  4AIH A;  3K2A A;  2HKX A;  1LEA A;  1EF4 A;  2MH2 A;  4QPO A;  4DBQ A;  1S7A A;  1X2M A;  3CCV I;  2BVM A;  4EJT A;  2XAJ A;  4IKF A;  2L01 A;  4OIO F;  3OIP A;  3GUD A;  1RC9 A;  1YW8 A;  3GFJ A;  1IRG A;  2L9N A;  4Y13 A;  1YJW I;  2DMQ A;  4YRV A;  2HYF A;  1TWH J;  3ZXS A;  2MW8 A;  2ECC A;  1SAN A;  4HG2 A;  4EJU A;  3GTJ J;  3GTM J;  1X3W B;  3HGY A;  1TWF J;  3VYT B;  3HYI A;  2LC2 A;  3RYP A;  4HQE A;  5B1A H;  3CZ6 A;  3KEQ A;  5LFA A;  3L2Q A;  3KZZ A;  1FTT A;  3L2U A;  2L4A A;  4HNT A;  5J4Y A;  1YO5 C;  1RUN A;  3M8F A;  2W4S A;  1W0U A;  4M73 A;  2DMU A;  4ESB A;  2K3P A;  2WY7 Q;  2ZXW H;  3V42 A;  1T98 A;  3ABL H;  5EZH A;  1IXC A;  2DMN A;  2ESN A;  2UUZ A;  3IH2 A;  2KRH A;  1UCR A;  3ZQI A;  3M8E A;  3CP8 A;  3G4S I;  2A05 A;  3ROU A;  4Z6Y A;  2HPI A;  2DDB A;  2XRL A;  3H5A A;  3H5R A;  4FAS D;  3LSP A;  1XB4 A;  2PEX A;  3S8P A;  2O7O A;  4XLF A;  2P5L C;  2GWR A;  2FF4 A;  2K4B A;  4BQN A;  1I1G A;  2FBI A;  3ERM A;  4PK4 A;  2OU2 A;  3BG9 A;  3VDX A;  2W7N A;  4IHW A;  1JI8 A;  3WHC A;  3CDI A;  3FXL A;  4XN0 A;  4A0X A;  3IHU A;  5E79 C;  1O3Q A;  2F4I A;  1IXS B;  2Z16 A;  1HST A;  1Z0X A;  4G8X A;  4GGG A;  1WKM A;  1B4A A;  3CCS I;  2IT0 A;  1W36 D;  2XSJ C;  3F6O A;  4M6X A;  3JRG A;  3IKT A;  4XKW A;  3FKJ A;  4UV9 A;  3MVP A;  2QQA A;  4D1Q A;  4KA4 A;  1WCM J;  4AM3 A;  4G9Y A;  5A2Q Z;  5DCM A;  3OYM A;  3TO7 A;  5FJ8 J;  3TP0 A;  3ZP5 A;  4G7Z F;  2IS2 A;  2MC4 A;  3BR3 A;  3RDI A;  2BHY A;  1E2X A;  4O5V A;  2H1L A;  2JA8 J;  2K9S A;  2RRE A;  1YHQ I;  4JBA A;  1BN5 A;  2O61 A;  2HOA A;  2WWY A;  3HSR A;  2R7O A;  2Y31 A;  2VXZ A;  3L2V A;  5AON A;  4AC0 A;  3F6V A;  4D5F A;  2DPU A;  3BG3 A;  1IUF A;  1XC5 A;  1G4D A;  4UVC A;  5F04 A;  1QGP A;  1K78 A;  3ERE D;  3HTU A;  1BA5 A;  3KYD B;  1HLV A;  3MKZ A;  3DPT A;  2ZSI B;  4V2F A;  2RN7 A;  1S7E A;  2LF8 A;  1TT0 A;  1T39 A;  3VSL A;  2LBF B;  2M2E A;  2KJC A;  1ZK8 A;  2HKO A;  2MFZ A;  2RNG A;  2L9V A;  3CUQ C;  1VND A;  2EV0 A;  2E2I J;  1TQM A;  3BR0 A;  1RZ4 A;  2NOG A;  4RA2 A;  3RSN A;  5IOZ A;  3CTA A;  2DT5 A;  2COB A;  5D6E A;  2RC4 A;  5J40 A;  1J09 A;  3KP2 A;  3QPT A;  5F0H A;  2EQR A;  2PFB A;  5K5Q A;  1DQU A;  4XON A;  2DPD A;  5CKT A;  4HF1 A;  2XAS A;  1XN7 A;  2BZT A;  2MLG A;  4V2G A;  1STZ A;  4M74 A;  1R71 A;  2QQ8 A;  3BQZ A;  4A6D A;  1USS A;  1ZAO A;  1BI3 A;  2RAE A;  5ICG A;  3JRF A;  1V3F A;  2EFO A;  2F5E A;  4NC8 A;  3RJP A;  1P6R A;  5GAD J;  4FE7 A;  3QQA A;  1FP1 D;  4F91 B;  5F0C A;  1XGM A;  1OQY A;  4XBF A;  1MJA A;  1ZGW A;  4RMN A;  3CJT B;  1X3Z B;  1ZRF A;  4BXF A;  2VLA A;  3FXK A;  2KT0 A;  2JUC A;  3W6J B;  2NS7 A;  2DTR A;  3GLX A;  3EYY A;  3N05 A;  3TOB A;  1OCP A;  2HDD A;  2E2H J;  3NQO A;  3IKV A;  1MGT A;  4IPA A;  4D9J A;  2L9S A;  3WTW C;  3OSG A;  4EEF G;  5E8I A;  1R5I D;  4I02 A;  3JTG A;  1FIA A;  2CQX A;  3HSE A;  3MKY B;  2UXX A;  2LFB A;  4ESF A;  1N77 A;  5LGN A;  4ZYD A;  3GFM A;  4ENM A;  3BC8 A;  4ZDL A;  2GQQ A;  2QEX I;  2IGN A;  4XSZ F;  2G7H A;  1V5E A;  1SFK A;  4II3 A;  4LG0 B;  3HM5 A;  1YRN B;  5J1U A;  2KRF A;  3DBR B;  3H3V K;  1IGN A;  4MTE A;  1OYW A;  2M4G A;  2CUF A;  4ITV A;  2UWM A;  1QU3 A;  4CCJ A;  2RVC A;  5DYM A;  5HS8 A;  4RGS A;  4F55 A;  2ACJ A;  3I58 A;  3J7Y J;  3WTU C;  3G71 I;  1QZZ A;  1TLH B;  3IV5 A;  3PIP F;  3DQV C;  1UST A;  2DN0 A;  5CQE A;  2XGE A;  3FBN B;  3S1R J;  2P6T A;  2O0Y A;  5BMZ A;  2L2O A;  3R6S A;  1U8B A;  3J7A Y;  5DDG A;  2VC0 A;  4ZYH A;  1HXD A;  1IRX A;  1P4A A;  1LVK A;  4CH7 A;  3H35 A;  3L2R A;  1IZ1 A;  3AG4 H;  2HQR A;  4M9X A;  2X1D A;  3K1M A;  2ZXJ A;  4A2U A;  1ZG1 A;  4RAF A;  1HC8 A;  2VQG A;  1GDT A;  4WF2 A;  3JRE A;  4O3M A;  3D5L A;  5IT9 Z;  2LVS A;  3GXO A;  2XF6 A;  2YPR A;  5EZG A;  4HST A;  3KP5 A;  3CMM A;  1VF9 A;  4YII A;  2VBZ A;  5HLT A;  4U7D A;  1PUF A;  1XMK A;  4RS8 A;  3DKX A;  3CJN A;  5GPC A;  2LKP A;  4UUT A;  3DWL E;  1JKP C;  2IS1 A;  1V5F A;  3BPX A;  1F1Z A;  3VYU B;  2O03 A;  1R7J A;  3T8T A;  1WJE A;  3RPU D;  4RLF A;  4DOZ A;  1ETK A;  3KZI C;  2RGV A;  1EKE A;  1F36 A;  2CRG A;  3HHH A;  3S3M A;  2A5Y B;  1ETW A;  1JUS A;  3FM5 A;  4FHT A;  3OYC A;  3FXR A;  4CUG A;  3BZC A;  1WPK A;  2VKE A;  1IW7 F;  1B9N A;  3OL3 A;  5TIS C;  1JUM A;  2VC1 A;  3E6M A;  4RAY A;  4AID A;  1TW3 A;  2HI3 A;  1VFC A;  1BI1 A;  1ZLJ A;  5E17 F;  3CO7 C;  1S9H A;  3A01 B;  2FQ4 A;  2O8K A;  4GCV A;  3EPZ A;  5HS7 A;  2ICW G;  1SFE A;  1FBS A;  4IZZ A;  3SDG A;  1SVL A;  3KP7 A;  4MFE A;  3RI4 A;  3DBH B;  3F3X A;  1RKW A;  3QYF A;  4G6D A;  4I76 A;  4PGH A;  4R8H A;  2QCO A;  2JQ7 A;  3G2B A;  3MAJ A;  1K83 J;  3Q9V A;  2Z33 A;  3DF8 A;  2YU9 J;  3HPH A;  4P5O A;  3R61 A;  2CUJ A;  3IUO A;  2VI6 A;  4ZDO A;  4BJT A;  3LSM A;  3TED A;  2F5D A;  2QM3 A;  3FBI B;  3DTE A;  1IXR C;  3UR3 C;  3UNG C;  3TBI A;  5D4S A;  5CVR A;  4WCG A;  1X4P A;  3HDD A;  3BLY A;  1Y8R B;  4Q48 A;  3FHN A;  3TGN A;  4UUS B;  4CA0 A;  4Y3O A;  4Y33 A;  1Z77 A;  3P9K A;  1ENH A;  2X85 A;  3PFI A;  2QBY B;  2Y9Y A;  1IN6 A;  2QVO A;  3DU6 A;  3WTX C;  2Z2S B;  5B1B H;  2KIQ A;  4F52 A;  1WRJ A;  3I5U A;  4X0G A;  1MDM B;  3G1L A;  1B8I B;  1ETY A;  2RV8 A;  4N4O B;  2FNP A;  3KIO A;  5EF6 A;  4HAM A;  2IA1 A;  3ZCO A;  2LH9 A;  3SEZ A;  3HIF A;  3CDL A;  3DXJ F;  1YLF A;  4AYB N;  5K1Y A;  2DK5 A;  1PP8 F;  1FLI A;  2XKO A;  4XLN F;  4EAT A;  4EJW A;  3COA C;  3LSJ A;  2VKH A;  2WAQ N;  2DCE A;  5FKL A;  3CDH A;  4I2O A;  3I56 I;  2WAF A;  4RGX A;  2A3S A;  2KKO A;  4KIG A;  4BUP A;  5J4V A;  2K9Q A;  2LTP A;  2ZSH B;  2V7F A;  5F08 A;  1QVU A;  2ECB A;  5FRN A;  2DMT A;  2E1M B;  1T0F A;  1OR7 C;  2QWW A;  5LLQ A;  4KDP A;  1JKQ C;  4RB0 A;  1UFM A;  2XVC A;  3HBL A;  1OCO H;  1P9Q C;  4XLA A;  4N9I A;  3E3V A;  4B3X A;  1TC3 C;  3LL7 A;  2OZ6 A;  1TWA J;  2HXI A;  1LJ9 A;  3BQY A;  1JHF A;  1SFX A;  3KCC A;  1XCV A;  5KK1 A;  3IWF A;  4DZJ A;  3A1Y A;  3LWF A;  1V5G A;  1X3U A;  4XKC A;  3KYL A;  1U3E M;  2ZFW A;  2L9R A;  1BR2 A;  2OJE D;  4W97 A;  4EMS A;  4H0E A;  1B1B A;  2LBF A;  3CCM I;  2LR8 A;  2HFH A;  5JVT A;  4QSH A;  4YIF A;  2X4H A;  2W82 A;  2X6X A;  2X6W A;  3DFG A;  5E3O A;  1YTY A;  3M4O J;  1RR7 A;  3LA7 A;  1YIO A;  3QOD A;  3SXY A;  3BG7 A;  5DM6 F;  5JHU A;  3BR5 A;  2DFE A;  3IL2 A;  2HOS A;  4KT6 A;  1U2W A;  4BBR J;  1CQT A;  4DGW B;  1N25 A;  1FYK A;  4HNU A;  1I3A A;  1LDK B;  2PMH A;  2BY0 A;  3LSK A;  3BJA A;  1FT9 A;  4II2 A;  4DYC A;  2EZK A;  3GW2 A;  1OCZ H;  4KIB A;  2KLO A;  4UB6 C;  1L0O C;  1ZAR A;  3SDB A;  5ED4 A;  1VQL I;  1RI7 A;  1FNN A;  3CJQ B;  3CMY A;  2W85 A;  3HOV J;  1XG1 A;  2OF7 A;  3VOD A;  1FWZ A;  3JCU C;  4A3M J;  4LLG F;  2DA1 A;  1XS9 A;  2KRC A;  3RQI A;  2P0W A;  3GF2 A;  4RM2 A;  1Z9C A;  2F5F A;  2QQB A;  2NS8 A;  1W5T A;  2DBB A;  4GYI A;  1W36 C;  3TL4 X;  1Z7L A;  2Q2E B;  2KIU A;  2XKP A;  4IO9 F;  4RB3 C;  3E6C C;  4ZTF A;  2V6E A;  2GIV A;  1SD6 A;  1OR7 A;  2O5R A;  3L1P A;  3KP6 A;  3RIR A;  2OZU A;  1V54 H;  1D5V A;  3RPQ A;  2PJR B;  1T6S A;  2B9S A;  2DFF A;  3DLL F;  2DQR A;  2ID6 A;  4A69 C;  2FMY A;  1IJW C;  4LG0 A;  2RKH A;  4MQ9 F;  2QGU A;  4XID A;  4YEJ A;  2H09 A;  1YRN A;  4BJ6 C;  1ON2 A;  1K6Y A;  1MJ9 A;  1WH5 A;  2FSW A;  3OIO A;  4S05 A;  4BQQ A;  3PNT A;  3DEU A;  2UV1 A;  1BR4 A;  3OIQ A;  5H20 A;  3G6E I;  1UMQ A;  3ZQF A;  3J80 K;  4YG2 F;  4L5J A;  2M5W A;  2CW7 A;  3QYB A;  2BW3 B;  1WJF A;  4D5C A;  2MSY A;  2JJ7 A;  3OYE A;  2CSO A;  5F1J A;  3N97 A;  2R7Z J;  4E7Z A;  2PLY A;  3H0G J;  4YFN F;  3ZMV A;  3KLN A;  3HRT A;  2F4M B;  4YEL A;  2XSD C;  3IH4 A;  4WXH A;  1BBY A;  4EGZ A;  4CYC B;  3HJE A;  2JRT A;  2VXD A;  2LLK A;  3I54 A;  1G6N A;  1ZR2 A;  2VL8 A;  2R7S A;  2EZI A;  5LEJ A;  3QPH A;  5KCM A;  1GT0 C;  5EYR A;  3OS2 A;  2MD5 A;  4IEJ A;  2HVR A;  3QYE A;  3WG9 A;  5E1W A;  4S04 A;  3VPR A;  3AKZ A;  2FA5 A;  2TDX A;  1IRF A;  3I53 A;  3GVA A;  3QPS A;  2M1B A;  5BPD A;  2XF5 A;  5GPA A;  2MGQ A;  3V7C A;  2ZB9 A;  5M5Y J;  4KYW A;  3GTO J;  2EB7 A;  4MNU A;  3K1N A;  3O3K A;  4XQF A;  2AO9 A;  2MG4 A;  3IP4 B;  5IP7 J;  1R00 A;  2EWN A;  1YJN I;  1FOK A;  3FXQ A;  1WHU A;  4LB6 B;  2BXY A;  2VJ4 A;  1LB2 A;  2ESH A;  4KJZ A;  1UB9 A;  1TQI A;  1ZGA A;  1GV2 A;  3HOS A;  2NAZ A;  3Q0U A;  2WTE A;  2XAQ A;  2ZKZ A;  3HC7 A;  1QBJ A;  1NHA A;  2M0M A;  2UXN A;  4HYE A;  3H5N A;  2OQR A;  3E5X A;  2ELK A;  2LNB A;  3WTS C;  1R5G A;  2D1V A;  2WAE A;  1VQO I;  3A01 A;  1FX7 A;  4KMU X;  4HV5 A;  4CXF A;  2E1M C;  3ASN H;  1L3L A;  2JRM A;  1MW7 A;  2DFH A;  1A6I A;  1Y56 A;  4ON0 A;  2DA2 A;  5EEH A;  4LG3 A;  3LFK A;  2M3A A;  2W25 A;  1K7A A;  2X48 A;  3A0B C;  4U88 A;  2G0E A;  4UVA A;  2LRE A;  3MZY A;  4A3G J;  4N9H A;  1LQ1 A;  2L7M P;  5H6R A;  2GOX B;  2LRD A;  1D0Z A;  3GTK J;  3P9I A;  5JI6 A;  1JTY A;  3MMY B;  1WQ2 A;  2M8E A;  5DUI A;  1DU0 A;  4CCN A;  1QZE A;  3C3W A;  4XKV A;  3FDY A;  4X6A J;  2P7C B;  2BBY A;  3KZY A;  2R92 J;  1HW2 A;  5ICC A;  1M1E B;  4UV8 A;  3HKZ N;  2FNA A;  3FMQ A;  2QLZ A;  2XPU A;  4BQA A;  3C7J A;  2EIK H;  1JJ8 C;  3CC7 I;  4E7I A;  2JVH A;  4C3H J;  2QBY A;  3OYA A;  3PM1 A;  1Y1V J;  4XOR A;  1KYZ A;  5LEK A;  2HZT A;  1MDM A;  1OYY A;  4H4K C;  2QKM B;  4DW6 A;  1B8I A;  4BNC A;  3I0T A;  4ENJ A;  1KU2 A;  3TDU C;  1XDS A;  3K10 A;  1Y39 A;  2P8T A;  5FGM A;  1TWC J;  2ISY A;  1G3T A;  3CC4 I;  1Q1V A;  2I5U A;  2DAO A;  2PMZ A;  4HOB A;  2EIN H;  3ZGK A;  1IG7 A;  3GX4 X;  4FQG A;  5FLM J;  1LDJ A;  4CSW A;  2HGC A;  3P5J A;  3LFU A;  3B02 A;  3QP5 A;  4J19 A;  4GYG A;  4JYK A;  3FMR A;  3HRM A;  2IA2 A;  2QA4 I;  1U78 A;  2NXN B;  2J5O A;  1ZRC A;  3LSI A;  2EFP A;  3O8H A;  2E5Z A;  1Z1D A;  2O6G E;  2OQG A;  3K9T A;  3PO3 J;  4BY1 J;  3PUF A;  4CZC A;  1WJA A;  4OOI A;  3BJ6 A;  5GAH J;  2ZJR F;  5J3L A;  1OMI A;  2GXA A;  1K4S A;  3FMS A;  3TQN A;  1UHS A;  4XRM A;  3FXM A;  3ZQ7 A;  1LFP A;  2HOT A;  2K27 A;  3U2R A;  5HLG A;  1TTY A;  2DI3 A;  2VUM J;  2DMP A;  2K02 A;  3LSR A;  1O7L A;  5EGO B;  1H88 C;  4FCY A;  2V1N A;  1YYV A;  4D7N A;  2VBX A;  2E2J J;  1SVM A;  1FZP B;  1LVA A;  3H92 A;  2HYJ A;  3DKY A;  3GLL A;  1D0Y A;  2D1H A;  2K9M A;  4U0V A;  4V19 K;  5C4J J;  1F43 A;  1I6H J;  2X6Y A;  1WZ2 A;  2IEK A;  3HL2 A;  4XM3 A;  3IRQ A;  1W7P B;  3S1Q J;  4KN4 X;  2WA0 A;  5LHG A;  1JE8 A;  2IA0 A;  4LD5 A;  2K7L A;  1MMG A;  1EJ9 A;  2PI0 A;  1I1S A;  3A2K A;  1J5Y A;  2NNY A;  2W1O A;  3CP2 A;  3R4K A;  1QPI A;  2TRT A;  4FIS A;  3T8R A;  2IRF G;  1HBX G;  1WI9 A;  2IS6 A;  4ENK A;  1S6L A;  5JFR A;  4PDK A;  3VFZ A;  4ZDP A;  3VB2 A;  3OY9 A;  1FMV A;  4PSW A;  3RPU A;  3BRO A;  1T38 A;  1YQA A;  2LF7 A;  2XGC A;  3RTR A;  4PZJ A;  2EFW A;  1JKR C;  2QSG X;  1X1D A;  1SD4 A;  2ELH A;  5M5W J;  2DU9 A;  3QOE A;  1HOM A;  2Q2E A;  2VT3 A;  1UG0 A;  5JR3 A;  2HZD A;  4JX5 A;  2FUG 2;  2ADU A;  3V7S A;  2X1C A;  6PAX A;  3C2H A;  4HX8 A;  3BG5 A;  1P2F A;  4U0W A;  2E35 A;  1TL8 A;  2JSC A;  3V8J A;  2HU9 A;  4K2E A;  2HWV A;  3T0Y A;  3KLO A;  4HNV A;  5IYC J;  2HS5 A;  2IGO A;  1B72 B;  1OKR A;  2PJR A;  2JMW A;  4RB1 A;  2GAU A;  3CCJ I;  4BE0 A;  2XC7 A;  4O6J A;  3EDP A;  4FX4 A;  4B3A A;  2LDU A;  1DGR M;  3AAF A;  2CV2 A;  5IP9 J;  1R9T J;  3JSO A;  2L5Q A;  3Q9S A;  4L5E A;  1T8I A;  3IAS 2;  1VTN C;  3S14 J;  3ZN0 A;  2OD5 A;  2NYX A;  1W1W E;  1KQ8 A;  3E97 A;  1G3Y A;  4L0Y B;  3W6K B;  1WJD A;  1BJZ A;  2E36 A;  3LQQ A;  4M9S A;  4E7K A;  4L18 B;  3RKX A;  1LEB A;  2BW3 A;  2A68 F;  2BVL A;  1JT6 A;  2Q8K A;  4MQV A;  2ZNY A;  2EJR A;  1XSD A;  2ME6 A;  3CD6 I;  3RZO J;  2Y75 A;  4G94 A;  2XPV A;  2LY9 A;  3FX3 A;  2Z3Y A;  2EIM H;  3R60 A;  4XIC A;  1WSU A;  4A3L J;  4CYC A;  1ZEL A;  2EK5 A;  3HKZ A;  2Y48 A;  1D8K A;  2DW4 A;  3V7R A;  1T2K A;  2KP6 A;  2L7Z A;  3CCR I;  1TT5 B;  4AD9 A;  2Y30 A;  3WGH A;  2HQA A;  1XPX A;  3PFY A;  2O3F A;  3H0D A;  4IHY A;  1ODD A;  1JXS A;  1DGW Y;  5AIQ A;  1Y1W J;  5D5X B;  2DOD A;  3S2D J;  3TW7 A;  1QZY A;  2CO5 A;  5JLW A;  3AFH A;  3CC2 I;  2VE8 A;  2CWE A;  2LKX A;  3GO5 A;  4HZF A;  2V9K A;  4BAC A;  3SYT A;  5FFX A;  2DJN A;  1MBE A;  3D5S C;  2DO7 A;  1KQ9 A;  2G7U A;  3NAU A;  3K4M A;  4A3B J;  4B1R A;  4DBR A;  4NDL A;  1BM9 A;  5D8K B;  2OTJ I;  3I64 A;  3I4N J;  2CGP A;  3H9J A;  2VKV A;  4WX9 A;  2MBF A;  5EDN A;  1KGS A;  1J9I A;  2IP2 A;  3K4C A;  2FOK A;  2XIG A;  3IC7 A;  1UG2 A;  3WGI A;  3BPV A;  1Z6T A;  2PX9 A;  3WG7 H;  3PSF A;  5HNF A;  4EQQ A;  1ZLK A;  2YSR A;  2EA2 A;  2ISZ A;  2CV0 A;  1ZKG A;  5L3F A;  3FIW A;  3F21 A;  3DPL C;  3BR2 A;  1FSE A;  2ZJ2 A;  4EVI A;  3RKW A;  1JUP A;  3KFW X;  2NNN A;  5M3F J;  2M7B A;  4G12 A;  3HOT A;  1ZYR F;  3WTV C;  3ZMZ A;  1OYI A;  2FE3 A;  3GTQ J;  2JPB A;  2BEO A;  3MQ0 A;  4DYR A;  3PUB A;  2EV5 A;  2CUZ A;  5BNG A;  4KUM A;  2H27 A;  1K6O A;  3JTH A;  4I6Z A;  4PGG A;  1GVD A;  1KU3 A;  1R4M B;  5JHF A;  1DP7 P;  1ZG5 A;  1PP7 U;  1IN8 A;  5CPR B;  3K4L A;  3LSG A;  4E6K G;  1NK3 P;  4I98 B;  2P5V A;  4F93 B;  3OYJ A;  4MO7 A;  2NRA C;  2E19 A;  4RAZ A;  1VQ9 I;  5KVR A;  4ZC3 A;  5K7H A;  2DDA A;  2J5P A;  2L7F P;  4BHP A;  2OV7 A;  4A3D J;  3QP6 A;  3AL0 B;  3OYF A;  5IPA A;  3FXU A;  3HOW J;  2R7W A;  2AXL A;  3PL8 A;  4BAY A;  4YFX F;  2P6S A;  4R1H A;  3B6C A;  3WU0 A;  1D1A A;  1WJ5 A;  2CUE A;  2WV1 A;  1S8N A;  3W3C A;  2EV6 A;  1TZL A;  3DEW A;  1U5T B;  3HHG A;  4ABZ A;  4C2M J;  2R93 J;  1REP C;  2JT1 A;  1T0F C;  3GME A;  3WGG A;  4CHU A;  2R7X A;  3HSF A;  3G1M A;  2OA4 A;  2GA2 A;  3DTK A;  4LK1 F;  5DEQ A;  3ISP A;  2VJ5 A;  5ILS A;  2DXI A;  1FOY A;  3JSP A;  3EYI A;  1O3S A;  1T56 A;  3MZH A;  3S2H J;  1JKO C;  2LD5 A;  1NG6 A;  4U87 A;  1XTA A;  3ABM H;  1KA8 A;  3F8F A;  2DA6 A;  4AWX B;  1KON A;  2CMP A;  5L3B A;  4WWC A;  2IBD A;  4G6Q A;  3DTI A;  3W2V A;  3QRF F;  2FRH A;  2XPW A;  2EFQ A;  1P7I A;  2K3F A;  3JW4 A;  3X2Q H;  3S1N J;  4LGW A;  5F64 A;  3E6B A;  5KHD A;  4ASN A;  1XGN A;  2WAD A;  4BU2 A;  1R1V A;  3JR9 A;  2XAH A;  3K70 D;  2DA3 A;  3WU2 C;  2ZBK A;  2KJB A;  1SFU A;  3JRC A;  3BJO A;  1YG2 A;  3K4K A;  2DA4 A;  2VJI A;  1SC7 A;  3DU5 A;  3HG9 A;  1IV8 A;  3MZ8 A;  4IXA A;  4XRS A;  2VON A;  3FK7 A;  2HVQ A;  2M87 A;  3G3Z A;  4M6Y A;  1IC8 A;  2VAS A;  1BC7 C;  4LK0 F;  3T5X A;  1AWC A;  5B5E C;  3H36 A;  5KAF C;  1QHG A;  4QIW N;  4RB2 C;  4HDV A;  3LST A;  1R4N B;  5EGO A;  2VOD A;  1DUX C;  3MKL A;  1O3R A;  1Z3X A;  2MLK A;  2KMU A;  5KNL A;  1YI2 I;  2F48 A;  2VBY A;  1W7P A;  4N4N B;  4M3F A;  4A12 A;  1J75 A;  1BW6 A;  4JX6 A;  3VYS B;  2YR2 A;  1MNE A;  1JHH A;  4AIJ A;  1S29 A;  2LMD A;  1Z21 A;  3HOY J;  4ZTJ A;  1H9G A;  2ETH A;  1UEL B;  3TO9 A;  3QU6 A;  1XGS A;  3EUH C;  2WB1 N;  5AIP A;  5ILU A;  1Z67 A;  2Z5U A;  1ZRE A;  3S3N A;  3MFK A;  3D5R C;  3U21 A;  2FU4 A;  1BL0 A;  1RKT A;  3ZRG A;  4U0Y A;  2L54 A;  1G3S A;  5CVV A;  3J81 Z;  3V8K A;  1OCR H;  3HOX J;  3JRB A;  2R7F A;  4JK1 X;  1QQI A;  4M3G A;  2JUG A;  4LB5 A;  3F22 A;  3V8L A;  1AKH B;  4ENN A;  2VPL A;  4LIV A;  2B7E A;  3WE2 A;  1OLT A;  3OYD A;  5E3N A;  2L02 A;  3QU3 A;  3WTZ A;  2H6C A;  2R7D A;  1VQ5 I;  2WBM A;  4LFU A;  4QLC U;  1Z05 A;  3S3O A;  1B72 A;  4G7H F;  4ZJZ A;  1D5Y A;  5FKK A;  4NNJ A;  5J6X A;  3H3U A;  4A0Y A;  3NAR A;  4CDG A;  5FRM A;  2MYS A;  2R7V A;  1AU7 A;  2KIS A;  1HA8 A;  3S16 J;  2VN2 A;  5M3M J;  4FTH A;  4DZP A;  3SZG A;  1TP4 A;  5K5O A;  1MJB A;  2Z1D A;  1XSV A;  3F9K A;  3ZMT A;  5FB2 A;  1J59 A;  4XN3 A;  1SAX A;  1DPU A;  1GHC A;  2ZFU A;  1HW5 A;  4LLN A;  3LAP A;  3CCL I;  2V9P A;  4KIT B;  1Z3Y A;  3F72 A;  3HOZ J;  1POG A;  3MCZ A;  4CCK A;  3BTJ A;  4DYQ A;  2PMZ N;  5EG0 B;  4CZZ A;  3SZT A;  2DK8 A;  2ZXI A;  1HDP A;  1E17 A;  1FC3 A;  3TMO A;  2QQ9 A;  1FEX A;  3EUH A;  4A3E J;  2JA5 J;  3NWS A;  2M7A A;  3ML6 A;  4OMZ A;  3PJR A;  4QWQ A;  2FQ3 A;  4L9J A;  3ULQ B;  3FM3 A;  2XAG A;  1RRJ A;  1FBU A;  2KQR A;  1WJC A;  4AVP A;  3MD2 A;  3M3Y J;  1IN7 A;  3LA2 A;  1KYW A;  2MA3 A;  4EM0 B;  5ILV A;  1R6R A;  2BV6 A;  2HPM A;  1VQ6 I;  4C3J J;  3AL0 C;  3GFI A;  5IY5 H;  1MMA A;  1W0T A;  3JAM K;  2HEO A;  3Q5F A;  4IHX A;  3F8C A;  2N8G A;  4IVN A;  1R58 A;  3RKY A;  2Y9Z A;  2GXB A;  5FLX K;  2L0K A;  1U5T C;  1X4O A;  2VQH A;  3H3Z A;  4PFO A;  1FYL A;  4Y52 J;  4IQ4 A;  1R49 A;  2GLO A;  2HTJ A;  2PQ8 A;  3ZR8 X;  4CIC A;  3HXL A;  1HKS A;  1S72 I;  2MAB A;  3IWZ A;  1J7K A;  2JA6 J;  2H1K A;  5HS9 A;  3LNQ A;  2XHK A;  4IRI A;  5D5W B;  4IX7 A;  2L3D A;  2CH0 A;  3BWG A;  1TQP A;  3I9V 2;  4KFC A;  2VIX A;  3N4M A;  5E1X A;  1IUY A;  3JRH A;  1ITY A;  2XV4 S;  1TNS A;  4L5I A;  2JSP A;  4BBS J;  5DTD A;  2X51 A;  1MH4 A;  1UZC A;  2XGD A;  3TP3 A;  3UKG A;  3K4B A;  4EM1 A;  2Y0S N;  2V26 A;  4L9V A;  2CYY A;  2QYO A;  2WC2 A;  2KIF A;  1HSJ A;  3QAH A;  3K4J A;  4BDZ A;  2QSH X;  1CF7 B;  2HOE A;  3OMY A;  4IOA F;  3AG2 H;  4NQW B;  4FT8 A;  1QA6 A;  1X1A A;  1IN4 A;  1VQ8 I;  1FMW A;  4Q4Z F;  2HTS A;  4M72 A;  5CYV A;  1OFC X;  5L3C A;  1IV6 A;  3KEY A;  2DYS H;  2D2W A;  3HGG A;  2A61 A;  3ABK H;  4BS9 A;  5GAE J;  2STW A;  2JVG A;  3B6A A;  5HDK A;  3CCQ I;  4D7M A;  4A3K J;  1XSX A;  4IF4 A;  1S5L C;  3PSI A;  1VI0 A;  1U6G A;  4XNF A;  5GP9 A;  3H9Q A;  1ULY A;  1OCT C;  2KHM A;  4NC6 A;  5JVG F;  1ETV A;  2WB1 A;  5FKO A;  5E18 F;  1G2H A;  2K40 A;  4E7S A;  1MNM C;  3L9F A;  3CUQ B;  5CVJ A;  4LLL A;  1T08 B;  4KIC A;  4Q47 A;  3W2W A;  3ABU A;  2DT6 A;  4IRG A;  5D6F A;  4BEH B;  1U5T A;  2ZC2 A;  3KP3 A;  1TNT A;  5LD2 C;  4A3J J;  2HXO A;  2MD0 A;  1KU7 A;  4Q5S F;  2E34 A;  3I4P A;  1V55 H;  3DLA A;  1QNT A;  3ZMU A;  3RYR A;  3OYH A;  1UJ8 A;  2JN6 A;  3TO6 A;  5FRO A;  1UHM A;  2BOL A;  4UY8 I;  1B59 A;  4I0B A;  5D5V B;  3E1S A;  4AVZ A;  3PNV A;  5D8L B;  3DBL B;  2KIM A;  4BKX A;  1R1U A;  4MLO A;  2COM A;  3IAM 2;  3OOP A;  2O8X A;  5K7Z A;  1FJL A;  2TCT A;  3CQZ J;  3VOE A;  2P5K A;  5GTI C;  1YW9 A;  2D5V A;  2FD5 A;  1ORK A;  3C2G A;  1W4M A;  2HDW A;  1E0E A;  2JK3 A;  2W24 A;  1RNL A;  4TV7 A;  3R0A A;  1SEU A;  3K7A J;  4I0A A;  3RKQ A;  4UVB A;  4IOC F;  1NK2 P;  1VQN I;  2H8R A;  2IGK A;  2LKS A;  1R36 A;  1O57 A;  1XCB A;  2FJ1 A;  2G9W A;  4DQ2 A;  4HEA 2;  5C44 J;  2XDV A;  1DU6 A;  3I4M J;  1HKT A;  1I3Q J;  4A6E A;  3GTL J;  3DPU A;  3PQK A;  2I8D A;  3J7Z I;  1YW7 A;  3OS1 A;  4S0H B;  4KN7 X;  2QUF A;  1OIS A;  1A6Q A;  3OYG A;  1QO0 D;  2M0C A;  5M5X J;  1YX3 A;  1I5Z A;  2ELJ A;  5FFZ A;  1KZH A;  2E1C A;  2PJP A;  2OCC H;  5LBQ A;  3W6V A;  2W84 A;  3OSF A;  4XRS G;  5D4R A;  3GEZ A;  1JT0 A;  3GTG J;  2FX0 A;  5H6Q A;  3CCY A;  5F1R A;  5J47 A;  1E3O C;  3ZMD A;  3LSH A;  2O9L A;  4KIS A;  2FXA A;  4OIQ F;  1YIJ I;  4FE4 A;  4W1U A;  1XDU A;  3JRD A;  1G8X A;  3KEO A;  1LPQ A;  1CGP A;  2VQC A;  3W2A A;  5IYD J;  1LKX A; 
#chains in the Genus database with same CATH homology
 2ZCW A;  1HKQ A;  4ZYE A;  1B9M A;  4EJV A;  1TW2 A;  2YX7 A;  3WOD F;  2V1X A;  4R79 A;  1R1T A;  4Y15 A;  2DLL A;  3O6B B;  2PN6 A;  1BIA A;  5CJ9 A;  1BI0 A;  3BZ6 A;  4A5M A;  3BY6 A;  5K5R A;  2GA1 A;  3GFL A;  4I7H A;  1MKM A;  4F7Z A;  4CGZ A;  1G3W A;  2CQK A;  2CFX A;  2K86 A;  5FO5 A;  2VOO A;  4A5N A;  3DP7 A;  2XRO A;  4UUV A;  1GVJ A;  3ABT A;  4N0B A;  5ERI A;  3ZN1 A;  2W57 A;  4HF2 A;  3WTT C;  1RIO H;  2DFI A;  1S7O A;  3SQN A;  2ZME B;  3CLO A;  3NEU A;  2V6C A;  3ZMS A;  3SFZ A;  3F8M A;  5J8C A;  3C1D A;  3G73 A;  1P4X A;  3TKY A;  1YS6 A;  2XRN A;  3E5Q A;  4M9Z A;  1PUE E;  4MTD A;  3KE2 A;  1ZRD A;  2FBK A;  3QOP A;  1ONV A;  1R5H A;  1EH7 A;  4MEY F;  2A6E F;  1Z6R A;  3L00 A;  4E70 A;  5A2Q K;  1FP2 A;  4MGR A;  5HDG A;  3MWM A;  1D3Y A;  4HBL A;  4EV0 A;  4XSX F;  4B8X A;  3HRS A;  3FZV A;  4D0P A;  2STT A;  1SMT A;  4WK8 F;  1B6A A;  1MD0 A;  1ZH5 A;  2E7X A;  2R3S A;  5LRR A;  2HR3 A;  5E20 A;  2YU3 A;  4PCQ A;  4MHG A;  4OIP F;  1KQ0 A;  4UNO A;  3D0S A;  5DD8 A;  1MZB A;  2VOP A;  3LAJ A;  1H0M A;  2V1D A;  4HF0 A;  3DKW A;  3ECH A;  4OIN F;  3LQR A;  3M1E A;  4HLY A;  3ELK A;  4P9F A;  4YFK F;  5ICE A;  2HYG D;  5BS6 A;  4HX7 A;  1CF7 A;  1XGO A;  5HDN A;  4NQW A;  1F5T A;  2BGC A;  4CYD A;  4L0Z B;  3IRR A;  2FML A;  2OBP A;  4FX0 A;  2GZW A;  5BOX A;  5BPI A;  3CUO A;  1IF1 A;  3EET A;  4BYY A;  2ZNZ A;  5DCF A;  5BQT A;  4KNY A;  1SMY F;  1LNW A;  3CUQ A;  2DQL A;  5CVI A;  4KT5 C;  4ETS A;  1YS7 A;  3E5U A;  5LRS A;  3S2W A;  3GYH X;  2IW5 A;  2LSO A;  4UHT A;  2NS0 A;  3M9A A;  1KU9 A;  5HLI A;  2YX4 A;  1S3J A;  4EJO A;  1Q1H A;  3HTS B;  4G7O F;  5ICF A;  2H94 A;  3BP8 A;  3I59 B;  4AIK A;  5L3E A;  1V4R A;  5LGT A;  3BDD A;  1R23 A;  3F8B A;  2MH9 A;  5IT9 K;  2Q0O A;  4B09 A;  5L3D A;  5D5U B;  1SD5 A;  4IJA A;  2A07 F;  2L4M A;  3T1B A;  3FHZ A;  2V79 A;  3GZ5 A;  2JTV A;  1EH6 A;  2P7V B;  1LDD A;  3P7N A;  4UXN A;  3U1D A;  3HRU A;  3O2P E;  2GXG A;  5TJJ A;  1I27 A;  2RDP A;  2E7W A;  5CLS A;  3GWZ A;  5DV5 A;  1JGS A;  3K0L A;  3U9G A;  1FBQ A;  1FSH A;  1BC8 C;  1P92 A;  1UHW A;  4KMF A;  5HVQ C;  3WU1 B;  1J0R A;  2K4J A;  4RGU A;  1YFH A;  5IT3 A;  3V4G A;  1PDN C;  4CO8 A;  1Y0U A;  2M30 A;  2B0L A;  5DUK A;  2Z9O A;  3TDZ C;  3WTY C;  2PMU A;  2V1U A;  4Z2Y A;  4DNC A;  1WWX A;  4HV6 A;  4BXU A;  4GO1 A;  4ESJ A;  2HDC A;  1Z91 A;  2H6B A;  1XD7 A;  5TRD A;  2JPC A;  2D45 A;  2EFN A;  4RGR A;  2VT2 A;  3KET A;  2ZME A;  2PG4 A;  4P9U A;  1BOA A;  1SD7 A;  4WXD A;  1TBX A;  4ZZL A;  1QPM A;  3SHF A;  1HW1 A;  3DV8 A;  4IRH A;  5E1Z B;  1OPC A;  2UZK A;  1K79 A;  2OAZ A;  2RNJ A;  3K1P A;  1HQC A;  1AOY A;  4OMY A;  2C6Y A;  1I6X A;  2ZO4 A;  2XGX A;  1ZG3 A;  2A6H F;  2MC3 A;  3R0J A;  4IHT A;  5FD5 A;  4BHB A;  4OIR F;  4I09 A;  1ZGJ A;  5CVU A;  3VEP A;  1H9T A;  4EM2 A;  3F23 A;  5HLH A;  4JQF A;  5DCM B;  1ZHF A;  4KIF A;  3J81 K;  2AS5 F;  3JAM Z;  4NHJ A;  1J2X A;  4ZYG A;  3WE3 A;  5FLX Z;  1R22 A;  3CO6 C;  1GXQ A;  4XLP F;  4U7B A;  2IJL A;  3J80 Z;  1O3T A;  1C0W A;  1K78 B;  2WV0 A;  5HOO A;  2Y0M A;  1P4W A;  1DDN A;  1FY7 A;  1FYM A;  4BHC A;  3SZP A;  3HUG A;  4HX4 A;  4GXO A;  4A0Z A;  4ZZD A;  5J8F A;  3EQL F;  1W5S A;  2IPQ X;  1IN5 A;  4P55 A;  2P4W A;  3L2C A;  4WXC A;  1IAW A;  3REO A;  2FBH A;  3B73 A;  4HQM A;  2VBW A;  3F8N A;  2A69 F;  1EH8 A;  2VE9 A;  4OU0 A;  1A04 A;  1ON1 A;  4LJZ F;  4HLX A;  1FPQ A;  3TOA A;  4HA8 A;  3E6D A;  2FEZ A;  1BJA A;  3FF5 A;  2RQP A;  2JZY A;  2QEN A;  1D8J A;  1RUO A;  3ZPL A;  4HDU A;  4I01 A;  3L09 A;  3K2Z A;  3OV8 A;  2PBI A;  2X0L A;  1W7P D;  3M7G A;  4LMY A;  4HW0 A;  1ZN2 A;  3P9C A;  3KP4 A;  1XMA A;  2F2E A;  3PQJ A;  1BI2 A;  2F5C A;  3C18 A;  2QZ8 A;  2XAF A;  3I59 A;  3K69 A;  3I71 A;  2M45 A;  4EGY A;  5F6F A;  2Z99 A;  1GXP A;  5E8G A;  4IHS A;  2EA4 A;  1O7F A;  4L9N A;  2HQN A;  3J7A O;  5DD4 A;  2V9V A;  3BOQ A;  4Y17 A;  2CG4 A;  4XRF A;  3MEX A;  4P96 A;  5LGU A;  2BE5 F;  2E1N A;  5LHI A;  1DPR A;  2IVM A;  3GZ6 A;  1F9N A;  2BYV E;  4MEX F;  4ZH4 F;  3L7W A;  3ECO A;  1F4K A;  3FWE A;  4BH9 A;  4M71 A;  1Z7U A;  5L3G A;  5FD6 A;  5EEG A;  2XUB A;  1EV7 A;  3NRV A;  1BIB A;  4L9T A;  3LA3 A;  4NB5 A;  5LHH A;  2CW0 F;  1U8R A;  4AIH A;  2HKX A;  1LEA A;  2MH2 A;  1S7A A;  4EJT A;  2XAJ A;  4OIO F;  2L01 A;  3GUD A;  1YW8 A;  3GFJ A;  1IRG A;  4Y13 A;  2HYF A;  4EJU A;  3HYI A;  3RYP A;  4HQE A;  3KEQ A;  3KZZ A;  2L4A A;  1YO5 C;  1RUN A;  3M8F A;  4M73 A;  4ESB A;  1T98 A;  1IXC A;  2ESN A;  1UCR A;  3M8E A;  3ROU A;  1XB4 A;  2PEX A;  2P5L C;  2GWR A;  2FF4 A;  2K4B A;  1I1G A;  2FBI A;  2OU2 A;  4A0X A;  3IHU A;  1O3Q A;  1IXS B;  1HST A;  4G8X A;  4GGG A;  1WKM A;  1B4A A;  2IT0 A;  3F6O A;  4M6X A;  3IKT A;  4UV9 A;  2QQA A;  4KA4 A;  4G9Y A;  5A2Q Z;  5DCM A;  3TO7 A;  3ZP5 A;  4G7Z F;  3RDI A;  1E2X A;  4O5V A;  4JBA A;  1BN5 A;  2O61 A;  2WWY A;  3HSR A;  2VXZ A;  5AON A;  3F6V A;  2DPU A;  1G4D A;  4UVC A;  1QGP A;  1K78 A;  3ERE D;  3HTU A;  3DPT A;  2RN7 A;  2LF8 A;  1T39 A;  2KJC A;  2HKO A;  3CUQ C;  2EV0 A;  1TQM A;  1RZ4 A;  3CTA A;  2DT5 A;  5D6E A;  2RC4 A;  3KP2 A;  3QPT A;  2PFB A;  5K5Q A;  2DPD A;  4HF1 A;  2XAS A;  1XN7 A;  2MLG A;  1STZ A;  4M74 A;  4A6D A;  1USS A;  1ZAO A;  1BI3 A;  5ICG A;  1V3F A;  2EFO A;  2F5E A;  3RJP A;  1P6R A;  1FP1 D;  1XGM A;  4XBF A;  1MJA A;  1ZRF A;  3W6J B;  2DTR A;  3GLX A;  3EYY A;  3TOB A;  3NQO A;  3WTW C;  1MGT A;  3IKV A;  4IPA A;  5E8I A;  4I02 A;  3JTG A;  3HSE A;  2UXX A;  4ESF A;  5LGN A;  4ZYD A;  3GFM A;  4ENM A;  2GQQ A;  4XSZ F;  2G7H A;  4LG0 B;  2KRF A;  4MTE A;  1OYW A;  2UWM A;  2ACJ A;  2RVC A;  5DYM A;  5HS8 A;  4RGS A;  3I58 A;  3WTU C;  1QZZ A;  1TLH B;  3DQV C;  1UST A;  2P6T A;  2O0Y A;  5BMZ A;  3R6S A;  5DDG A;  2VC0 A;  4ZYH A;  1HXD A;  1P4A A;  1IZ1 A;  2HQR A;  4M9X A;  3K1M A;  2ZXJ A;  4A2U A;  1ZG1 A;  4WF2 A;  4O3M A;  3D5L A;  5IT9 Z;  3GXO A;  2YPR A;  3KP5 A;  4YII A;  2VBZ A;  4U7D A;  1XMK A;  4RS8 A;  3CJN A;  2LKP A;  3BPX A;  1F1Z A;  2O03 A;  1R7J A;  3T8T A;  2RGV A;  3HHH A;  2A5Y B;  3FM5 A;  4FHT A;  3FXR A;  1IW7 F;  1B9N A;  3E6M A;  2VC1 A;  4RAY A;  1TW3 A;  1BI1 A;  1ZLJ A;  5E17 F;  3CO7 C;  4GCV A;  5HS7 A;  1SFE A;  1FBS A;  3KP7 A;  3RI4 A;  3F3X A;  4G6D A;  4PGH A;  4R8H A;  3MAJ A;  3Q9V A;  2Z33 A;  3DF8 A;  4P5O A;  3R61 A;  2F5D A;  2QM3 A;  1IXR C;  5D4S A;  5CVR A;  4WCG A;  3TGN A;  4Q48 A;  3P9K A;  3PFI A;  2QBY B;  1IN6 A;  2QVO A;  3WTX C;  1WRJ A;  3I5U A;  1MDM B;  2RV8 A;  2FNP A;  4HAM A;  2IA1 A;  3HIF A;  3DXJ F;  1YLF A;  5K1Y A;  1PP8 F;  2DK5 A;  1FLI A;  2XKO A;  4XLN F;  4EJW A;  3COA C;  3CDH A;  4I2O A;  4RGX A;  2A3S A;  2KKO A;  4KIG A;  1T0F A;  2QWW A;  5LLQ A;  4KDP A;  4RB0 A;  1UFM A;  2XVC A;  4N9I A;  3E3V A;  2OZ6 A;  1LJ9 A;  1JHF A;  1SFX A;  3KCC A;  1XCV A;  5KK1 A;  3IWF A;  3LWF A;  1X3U A;  1U3E M;  2ZFW A;  4EMS A;  4H0E A;  1B1B A;  5JVT A;  2HFH A;  4YIF A;  2X4H A;  3DFG A;  1YTY A;  3LA7 A;  1YIO A;  3SXY A;  5JHU A;  3IL2 A;  1U2W A;  1FYK A;  1LDK B;  2PMH A;  3BJA A;  1FT9 A;  3GW2 A;  4KIB A;  1L0O C;  1ZAR A;  5ED4 A;  1RI7 A;  1FNN A;  2W85 A;  3VOD A;  1FWZ A;  4LLG F;  3GF2 A;  1Z9C A;  2F5F A;  2QQB A;  1W5T A;  2DBB A;  4GYI A;  2KIU A;  2XKP A;  4RB3 C;  3E6C C;  2GIV A;  1SD6 A;  1OR7 A;  3KP6 A;  3RIR A;  2OZU A;  1D5V A;  3RPQ A;  1T6S A;  2DQR A;  2FMY A;  4LG0 A;  2RKH A;  4MQ9 F;  2H09 A;  1ON2 A;  1MJ9 A;  2FSW A;  4S05 A;  3DEU A;  5H20 A;  3J80 K;  4YG2 F;  4L5J A;  2M5W A;  2CSO A;  3N97 A;  2PLY A;  4YFN F;  3ZMV A;  3KLN A;  3HRT A;  4WXH A;  1BBY A;  4EGZ A;  2JRT A;  3I54 A;  1G6N A;  5LEJ A;  3QPH A;  2MD5 A;  3WG9 A;  5E1W A;  4S04 A;  2FA5 A;  2TDX A;  1IRF A;  3I53 A;  3GVA A;  2M1B A;  5BPD A;  3V7C A;  4KYW A;  2EB7 A;  4MNU A;  3K1N A;  3O3K A;  1R00 A;  2EWN A;  1FOK A;  3FXQ A;  4LB6 B;  1LB2 A;  2ESH A;  1UB9 A;  1TQI A;  1ZGA A;  3HOS A;  2NAZ A;  2WTE A;  2XAQ A;  2ZKZ A;  1QBJ A;  1NHA A;  2UXN A;  4HYE A;  2OQR A;  3E5X A;  2LNB A;  3WTS C;  1R5G A;  2D1V A;  1FX7 A;  4KMU X;  4HV5 A;  4CXF A;  1L3L A;  4ON0 A;  5EEH A;  3LFK A;  2W25 A;  1K7A A;  4U88 A;  4UVA A;  3MZY A;  4N9H A;  1LQ1 A;  5H6R A;  3P9I A;  5JI6 A;  1WQ2 A;  2M8E A;  5DUI A;  3C3W A;  2P7C B;  2BBY A;  3KZY A;  1HW2 A;  5ICC A;  4UV8 A;  2FNA A;  3FMQ A;  2QLZ A;  4BQA A;  3C7J A;  2QBY A;  1KYZ A;  5LEK A;  2HZT A;  1MDM A;  1OYY A;  4BNC A;  3I0T A;  4ENJ A;  1KU2 A;  3TDU C;  1XDS A;  2P8T A;  5FGM A;  2ISY A;  1G3T A;  2DAO A;  4HOB A;  3GX4 X;  1LDJ A;  2HGC A;  3B02 A;  3QP5 A;  4GYG A;  3FMR A;  3HRM A;  2IA2 A;  1U78 A;  2J5O A;  1ZRC A;  2EFP A;  1Z1D A;  2O6G E;  2OQG A;  3K9T A;  4OOI A;  3BJ6 A;  1OMI A;  3FMS A;  3TQN A;  3ZQ7 A;  2K27 A;  3U2R A;  5HLG A;  1TTY A;  2DI3 A;  2K02 A;  1O7L A;  1YYV A;  2VBX A;  1FZP B;  1LVA A;  3H92 A;  2D1H A;  4U0V A;  3IRQ A;  1W7P B;  4KN4 X;  5LHG A;  1JE8 A;  2IA0 A;  4LD5 A;  2K7L A;  2PI0 A;  1I1S A;  1J5Y A;  2NNY A;  3R4K A;  3T8R A;  2IRF G;  1HBX G;  1WI9 A;  4ENK A;  1S6L A;  5JFR A;  4PDK A;  3VFZ A;  3VB2 A;  3RPU A;  3BRO A;  1T38 A;  1YQA A;  2LF7 A;  3RTR A;  4PZJ A;  2EFW A;  1SD4 A;  2ELH A;  2DU9 A;  2Q2E A;  2VT3 A;  5JR3 A;  2ADU A;  3V7S A;  6PAX A;  4HX8 A;  1P2F A;  4U0W A;  2JSC A;  3V8J A;  4K2E A;  2HWV A;  3T0Y A;  3KLO A;  2HS5 A;  1OKR A;  4RB1 A;  2GAU A;  4O6J A;  3EDP A;  4FX4 A;  2LDU A;  3AAF A;  3JSO A;  3Q9S A;  1VTN C;  3ZN0 A;  2OD5 A;  2NYX A;  1KQ8 A;  3E97 A;  1G3Y A;  4L0Y B;  3W6K B;  3LQQ A;  4M9S A;  4L18 B;  3RKX A;  1LEB A;  2A68 F;  2Q8K A;  4MQV A;  2ZNY A;  2EJR A;  1XSD A;  2Y75 A;  4G94 A;  3FX3 A;  3R60 A;  2Z3Y A;  1WSU A;  2EK5 A;  2Y48 A;  3V7R A;  1D8K A;  2DW4 A;  1T2K A;  4AD9 A;  3WGH A;  2O3F A;  1ODD A;  1JXS A;  5AIQ A;  5D5X B;  1QZY A;  2CO5 A;  2VE8 A;  2CWE A;  3GO5 A;  4HZF A;  5FFX A;  2DO7 A;  1KQ9 A;  2G7U A;  1BM9 A;  5D8K B;  3I64 A;  2CGP A;  4WX9 A;  2MBF A;  1KGS A;  1J9I A;  2IP2 A;  2FOK A;  2XIG A;  3IC7 A;  3WGI A;  3BPV A;  1Z6T A;  4EQQ A;  1ZLK A;  2YSR A;  2EA2 A;  2ISZ A;  5L3F A;  3F21 A;  3DPL C;  1FSE A;  2ZJ2 A;  4EVI A;  3RKW A;  3KFW X;  2NNN A;  3HOT A;  1ZYR F;  3WTV C;  3ZMZ A;  1OYI A;  2FE3 A;  2JPB A;  2BEO A;  3MQ0 A;  2EV5 A;  4KUM A;  2H27 A;  1K6O A;  3JTH A;  4PGG A;  1KU3 A;  1DP7 P;  1ZG5 A;  1PP7 U;  1IN8 A;  4I98 B;  2P5V A;  2NRA C;  4RAZ A;  5KVR A;  2J5P A;  4BHP A;  3QP6 A;  3FXU A;  2AXL A;  4BAY A;  4YFX F;  2P6S A;  4R1H A;  3WU0 A;  1S8N A;  2EV6 A;  1U5T B;  3HHG A;  1REP C;  2JT1 A;  3WGG A;  4CHU A;  3HSF A;  2OA4 A;  2GA2 A;  4LK1 F;  5DEQ A;  3ISP A;  5ILS A;  3JSP A;  3EYI A;  1O3S A;  3MZH A;  1KA8 A;  3F8F A;  4AWX B;  5L3B A;  4WWC A;  4G6Q A;  3QRF F;  2FRH A;  2EFQ A;  3JW4 A;  4LGW A;  5F64 A;  3E6B A;  4ASN A;  1XGN A;  1R1V A;  2XAH A;  2ZBK A;  2KJB A;  1SFU A;  3BJO A;  1YG2 A;  4IXA A;  2VON A;  3G3Z A;  2M87 A;  4M6Y A;  1BC7 C;  4LK0 F;  3T5X A;  1AWC A;  4RB2 C;  4HDV A;  3LST A;  2VOD A;  1DUX C;  1O3R A;  2MLK A;  2VBY A;  1W7P A;  4A12 A;  1J75 A;  2YR2 A;  1JHH A;  4AIJ A;  1S29 A;  1H9G A;  2ETH A;  3TO9 A;  3QU6 A;  1XGS A;  5AIP A;  5ILU A;  2Z5U A;  1ZRE A;  3MFK A;  2FU4 A;  4U0Y A;  2L54 A;  1G3S A;  5CVV A;  3J81 Z;  3V8K A;  2R7F A;  4JK1 X;  1QQI A;  4LB5 A;  3F22 A;  3V8L A;  4ENN A;  3WE2 A;  2L02 A;  3QU3 A;  3WTZ A;  2H6C A;  2R7D A;  4LFU A;  4QLC U;  1Z05 A;  4G7H F;  5J6X A;  3H3U A;  4A0Y A;  4CDG A;  2VN2 A;  5K5O A;  1MJB A;  1XSV A;  3ZMT A;  5FB2 A;  1J59 A;  1SAX A;  1DPU A;  1GHC A;  4LLN A;  1HW5 A;  3LAP A;  3F72 A;  3MCZ A;  4CZZ A;  3SZT A;  2DK8 A;  1E17 A;  1FC3 A;  2QQ9 A;  3EUH A;  3ML6 A;  4OMZ A;  4QWQ A;  2FQ3 A;  4L9J A;  3ULQ B;  3FM3 A;  2XAG A;  1FBU A;  4AVP A;  1IN7 A;  3LA2 A;  1KYW A;  2MA3 A;  4EM0 B;  5ILV A;  2BV6 A;  3GFI A;  3JAM K;  2HEO A;  3Q5F A;  3F8C A;  4IVN A;  1R58 A;  3RKY A;  2GXB A;  5FLX K;  1U5T C;  3H3Z A;  1FYL A;  2HTJ A;  2PQ8 A;  4CIC A;  1HKS A;  3IWZ A;  1J7K A;  5HS9 A;  2XHK A;  4IRI A;  5D5W B;  2L3D A;  3BWG A;  1TQP A;  4KFC A;  3N4M A;  5E1X A;  1IUY A;  2XV4 S;  1TNS A;  4L5I A;  4EM1 A;  4L9V A;  2CYY A;  2QYO A;  2WC2 A;  2KIF A;  1HSJ A;  3QAH A;  1CF7 B;  2HOE A;  4FT8 A;  1IN4 A;  4Q4Z F;  2HTS A;  4M72 A;  5CYV A;  5L3C A;  2D2W A;  2A61 A;  2STW A;  5HDK A;  1XSX A;  4IF4 A;  1U6G A;  1ULY A;  5E18 F;  3L9F A;  3CUQ B;  5CVJ A;  4LLL A;  4KIC A;  4Q47 A;  3ABU A;  4IRG A;  5D6F A;  1U5T A;  3KP3 A;  1TNT A;  1KU7 A;  4Q5S F;  3I4P A;  1QNT A;  3ZMU A;  3RYR A;  3TO6 A;  1UHM A;  1B59 A;  4I0B A;  5D5V B;  5D8L B;  2KIM A;  1R1U A;  2COM A;  3OOP A;  2O8X A;  3VOE A;  2P5K A;  1YW9 A;  1W4M A;  2W24 A;  1RNL A;  4TV7 A;  3R0A A;  4I0A A;  4UVB A;  1R36 A;  1O57 A;  1XCB A;  2G9W A;  4DQ2 A;  1HKT A;  4A6E A;  3PQK A;  1YW7 A;  4KN7 X;  2QUF A;  1QO0 D;  1I5Z A;  5FFZ A;  2E1C A;  2PJP A;  5LBQ A;  2W84 A;  5D4R A;  3GEZ A;  5H6Q A;  5F1R A;  3ZMD A;  2FXA A;  4OIQ F;  1XDU A;  3KEO A;  1CGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...