3M8EA

Protein structure of type iii plasmid segregation tubr
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
101
Chain Sequence
HHHHFYTLNIAEIAERIGNDDCAYQVLMAFINENGEAQMLNKTAVAEMIQLSKPTVFATVNSFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKAMEMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Putative DNA-binding protein
publication title From the Cover: Plasmid protein TubR uses a distinct mode of HTH-DNA binding and recruits the prokaryotic tubulin homolog TubZ to effect DNA partition.
pubmed doi rcsb
source organism Bacillus thuringiensis
total genus 28
structure length 101
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3m8eA00
5L3FA 2HTSA 3ULQB 4UV9A 2G9WA 1O3TA 5BS6A 1R58A 1XCBA 3MFKA 4YIFA 2CQKA 3CUQB 4XRFA 4UV8A 5HDKA 5CYVA 4RS8A 1B9MA 3N97A 3I5UA 2BYVE 2M45A 1UHMA 3HIFA 2M87A 3GFMA 3E6BA 3FXRA 3S2WA 5K1YA 3GFIA 4DNCA 2KJBA 2VT2A 3VFZA 3U1DA 2P5VA 5DUIA 3G73A 4BNCA 1A04A 3J7AO 4GYIA 1ZLJA 1HW1A 2L54A 4HV5A 4U7BA 4WCGA 4ZZDA 3RIRA 2IA0A 2XAFA 3GO5A 1IRGA 2XUBA 4I02A 4B09A 4KUMA 2RV8A 1ON2A 4O5VA 1BC7C 2EFNA 1IXRC 3WTYC 4FHTA 4OINF 1JHFA 2HTJA 2UXXA 2G7HA 2QLZA 3CO7C 3BZ6A 2F5FA 2JRTA 2M1BA 1G3SA 4OMZA 1Q1HA 1XB4A 1V4RA 3J80Z 5ILSA 2STWA 2XAQA 3E97A 4D0PA 3F23A 2DK8A 4EM2A 2HKOA 2RDPA 3ZMZA 1MJ9A 5DCMA 2PFBA 1P4XA 1TLHB 4MEYF 1BI2A 5DEQA 4G6QA 5D5WB 3ML6A 4LD5A 1O7FA 4BYYA 3CLOA 1ZRFA 3ELKA 3WU1B 1ODDA 4M72A 4HX4A 4FX4A 4NQWA 3H92A 4PDKA 2FXAA 2K4BA 1ZYRF 3ZN0A 2HYGD 2DW4A 1HQCA 1ZARA 3CO6C 3VODA 5DCMB 4YFXF 3ZQ7A 3IRRA 5ILUA 2A6HF 3BPXA 3FX3A 1IF1A 1YTYA 1USTA 2Z3YA 4O6JA 1R36A 4LLNA 2QM3A 1K79A 1XSXA 3F3XA 4A6DA 1FX7A 1U6GA 5DV5A 3KP2A 5JR3A 2LF7A 3ECHA 2P5LC 1TTYA 1ZLKA 1DP7P 3T8RA 3WGHA 2EV0A 2R3SA 1KQ0A 4Q4ZF 2XHKA 2FA5A 2V1XA 3ZMVA 4EV0A 1J59A 1QZZA 2CWEA 5FD6A 4CO8A 4UNOA 2XAJA 2ZNZA 2ZBKA 2FNAA 5LGNA 3HRSA 3JAMK 1R5GA 3GVAA 2GWRA 1JE8A 5JHUA 3AAFA 2X4HA 1F9NA 1ZRCA 3R0AA 3IHUA 2FMLA 3P9IA 1ULYA 2A68F 4PCQA 5E1XA 2WWYA 2D1VA 5D4SA 1DUXC 1NHAA 2GQQA 2VE8A 2Y75A 3BJ6A 1LB2A 3JSPA 3I53A 1ZRDA 1E17A 2NRAC 1Z91A 1MJAA 3FMQA 2ESHA 5JI6A 5DD4A 4LB6B 1XD7A 2ZKZA 2YSRA 3WE3A 4UUVA 2ESNA 4HW0A 2DT5A 1O3SA 1W4MA 3WTZA 4B8XA 3WGGA 3MAJA 5IT9Z 2R7DA 4EJOA 3FHZA 4S05A 2RN7A 4PZJA 1YYVA 4KICA 4RGUA 4MEXF 1BN5A 3BP8A 1SD5A 2FBKA 2HR3A 3Q5FA 5AIPA 2VOPA 3OOPA 3DEUA 3HSRA 2IPQX 3KFWX 2TDXA 5D5UB 2E1CA 1YQAA 2O03A 2MBFA 1FNNA 2DI3A 5LHHA 2ZNYA 3L00A 5CJ9A 3H3UA 2O8XA 3JW4A 4OIOF 2MLKA 5IT9K 4F7ZA 1LVAA 3RTRA 3F8MA 2VN2A 4HDUA 5AIQA 2L01A 4IHSA 2IVMA 5HVQC 3JTGA 5ED4A 2HDCA 3DKWA 5K5QA 2FRHA 5BPDA 4JQFA 1YFHA 2ACJA 4XLNF 1W5TA 5FLXK 4KDPA 3Q9SA 4R8HA 5AONA 1PP8F 2GA1A 5LEKA 1XSVA 3KP7A 3QAHA 2BE5F 4A0XA 4HQEA 3RYPA 4ENJA 2ZFWA 3CDHA 2VBXA 2VONA 3T1BA 1FYLA 2XKOA 1D5VA 3R0JA 1EH8A 1ZREA 4Y13A 4Q47A 4RB1A 1OR7A 4U88A 4GO1A 5HLHA 3HTSB 3M8FA 4KN4X 1T39A 1TQIA 4LLGF 4CZZA 3RYRA 1HBXG 2FF4A 2W84A 3CUOA 4AWXB 4Y17A 1XGMA 1IN8A 2O0YA 2C6YA 5HDGA 4IJAA 1XGSA 1SFXA 1XGOA 2RQPA 5ICFA 3LAJA 4KMFA 2D2WA 3FXQA 3O6BB 1UFMA 3F8CA 3MZHA 1Z6TA 1MD0A 1BIBA 4HX8A 3D5LA 4YFNF 2EFWA 2CGPA 2EV6A 4CXFA 4G9YA 3FMSA 4RGSA 3E5QA 3L09A 4EQQA 4U0YA 1QPMA 1RZ4A 3WTXC 2NNYA 3GWZA 1TNTA 3BROA 2EA2A 2E7WA 1LEBA 4MTEA 2W24A 2ISZA 5D4RA 3HSEA 2VBWA 4R79A 3LSTA 5E8IA 1SFEA 1FWZA 3R6SA 4RB2C 2VXZA 3I59A 4WF2A 4CHUA 1L3LA 4A0YA 4UHTA 2H09A 4G7OF 3MZYA 3L7WA 1WSUA 3QPTA 3WU0A 1W7PD 2EWNA 2CYYA 4KA4A 1QNTA 3M1EA 3RKXA 4K2EA 1GXPA 1U3EM 2IP2A 4MNUA 1TQMA 2OD5A 3MWMA 3W6JB 2EFPA 2Y48A 4IRGA 4U0WA 1XN7A 1YO5C 3I59B 3ABTA 4ZZLA 4ZYDA 1TW3A 1IN5A 3V7CA 1S29A 5TJJA 2NS0A 2P6TA 1J5YA 2J5PA 1VTNC 1OKRA 4ESJA 2P8TA 3V4GA 1PDNC 4PGHA 3E5XA 3QP6A 4WX9A 1BBYA 3QU6A 3IKVA 3ISPA 1R5HA 2B0LA 1IZ1A 4KN7X 5LGUA 5CVUA 1RNLA 4KMUX 3I54A 2F2EA 3K69A 1H0MA 3KP4A 2FNPA 5CVIA 4KT5C 1YS6A 2E7XA 4IRIA 3TO9A 3JTHA 2W85A 5H20A 4HLXA 3HHHA 3J81Z 1Z6RA 4CGZA 4Z2YA 3P7NA 4WWCA 4N0BA 3TO7A 5ICGA 1TNSA 3T0YA 1B9NA 3V8KA 3HHGA 2GAUA 3ABUA 2RVCA 3TO6A 5F1RA 3E5UA 3TOBA 4EVIA 1CF7A 1WRJA 3PFIA 3W6KB 1KQ9A 2KJCA 3RDIA 4G94A 2HYFA 3ZMTA 5LLQA 3TQNA 1FP2A 3TKYA 1YG2A 4KIGA 4HLYA 3F72A 4CDGA 1P6RA 3HRTA 3Q9VA 1R1TA 1Y0UA 4NB5A 1T38A 4EM1A 1FBSA 4L5JA 2V6CA 1JXSA 1OMIA 2YX7A 1G3WA 3J81K 3K9TA 4BAYA 4NHJA 2IW5A 2RC4A 2P5KA 4LK0F 2XIGA 1J0RA 2HS5A 3ECOA 4Q48A 2QZ8A 5LHIA 3VOEA 1S7AA 1CF7B 3DPTA 4YIIA 2DQLA 2DO7A 1B4AA 5LHGA 3C1DA 4KIFA 3SQNA 1R1UA 2HOEA 3D0SA 2LSOA 2CO5A 4AD9A 2HKXA 3LA2A 4RAZA 3HSFA 4RGXA 2L02A 1SD6A 3K1MA 1RIOH 2DPUA 1XDSA 3J80K 1FYKA 4MTDA 2JPCA 1MDMA 4A6EA 3SZTA 1B59A 3FM3A 3I64A 4BHPA 2V79A 5ERIA 1W5SA 2PMHA 2AS5F 2K7LA 1JGSA 2DBBA 2EK5A 2RGVA 4LFUA 3F8FA 2XROA 4MGRA 1J2XA 4AVPA 5ILVA 1J75A 5DD8A 1FYMA 4ON0A 1R22A 1YW8A 5DCFA 4KFCA 1E2XA 2ISYA 1XSDA 1U2WA 2Q2EA 4G8XA 4GYGA 3E6CC 3JSOA 4OMYA 1MDMB 4ASNA 3IWZA 3OV8A 2P4WA 4QWQA 3HYIA 1I1SA 3LQQA 1GVJA 3LWFA 5IT3A 2L3DA 2QQBA 3WG9A 2L4MA 2QQ9A 4ENNA 2PBIA 3C18A 2EFOA 3TDUC 1G6NA 2Q0OA 3T5XA 3LA3A 2PJPA 5FGMA 2W25A 3FF5A 4P5OA 1EV7A 1Z9CA 1WI9A 3RKWA 1Z7UA 4BQAA 1HSJA 1XGNA 2XRNA 3K1NA 2YX4A 4N9HA 3HUGA 1XMKA 2XGXA 4EGZA 2ELHA 2JPBA 2NNNA 2KKOA 1BI1A 1D8JA 3GX4X 2HZTA 4IXAA 5KK1A 4N9IA 1U5TC 3F6VA 1MJBA 3DV8A 1K6OA 3BWGA 3EUHA 2FU4A 4A0ZA 1S3JA 4OIQF 3BJOA 1KYZA 2BEOA 2JT1A 4A5MA 4G7HF 2OU2A 3WTWC 2CG4A 4EMSA 2F5DA 3R60A 2R7FA 1YW9A 5F64A 4L5IA 1IN4A 3IKTA 1FBUA 2PG4A 4KNYA 1BIAA 3RI4A 1MZBA 4M74A 5FD5A 5L3DA 2CFXA 1HW5A 2HWVA 4RB3C 3PQKA 1G4DA 3KLNA 5HS9A 3EDPA 2F5EA 2Y0MA 3F22A 2IRFG 1FLIA 1BM9A 2H27A 3R61A 1EH6A 1HKQA 4OIPF 3I0TA 1GHCA 3MEXA 3GLXA 5L3EA 2PN6A 4ENMA 4GXOA 1QQIA 5LEJA 4IPAA 2OZ6A 4ESFA 1KU9A 1KA8A 4L9JA 2BBYA 4M9XA 3M7GA 1DPRA 2PQ8A 3LQRA 4MQ9F 3KP6A 4M9SA 5CVVA 2F5CA 3O2PE 5E1ZB 2A07F 2KIUA 1X3UA 1U8RA 1I5ZA 2MH9A 1ZN2A 1TBXA 1WQ2A 2LKPA 4KYWA 1SMTA 4M73A 2ADUA 4I01A 2YR2A 1XMAA 3GF2A 1YS7A 1L0OC 5CVJA 3ZN1A 1ZGAA 2W57A 2RNJA 1LJ9A 2M30A 2BGCA 2FEZA 2M5WA 1ZH5A 2H6BA 4AIJA 1SMYF 4ZH4F 5D8LB 4ZYHA 2Z9OA 3C3WA 4DQ2A 6PAXA 2K4JA 4HF0A 4LJZF 1LDDA 4UVBA 2ZXJA 5BPIA 3G3ZA 2DTRA 2HEOA 3DXJF 1IN6A 5FFZA 3F8BA 2PMUA 5TRDA 4ZYEA 2ZJ2A 5HLGA 1R7JA 3ERED 4WK8F 1SD7A 1T6SA 4XBFA 4L18B 4A2UA 2FE3A 2LDUA 1ZAOA 1H9GA 2VOOA 2D45A 5JFRA 4M9ZA 1FPQA 3ZPLA 3CTAA 1FC3A 1Z1DA 3FM5A 1STZA 5FFXA 5H6RA 4QLCU 4EJVA 4Q5SF 3RJPA 4U7DA 4KIBA 2GXGA 5A2QZ 5HS8A 2VBYA 3U2RA 1O3RA 4UXNA 3GYHX 4P9FA 1YW7A 5LRSA 4M6YA 4HZFA 5E8GA 5J8CA 2V1UA 1BI0A 1IRFA 3EQLF 1R1VA 4MQVA 3V7SA 2AXLA 3K2ZA 1ZG1A 2WC2A 2XKPA 4EM0B 4I09A 3GXOA 3PQJA 1UCRA 2ETHA 4RB0A 3DF8A 2P7VB 3QU3A 2G7UA 5E17F 2HFHA 2O3FA 2Q8KA 4HV6A 1XCVA 3L2CA 1O3QA 5D8KB 2EA4A 3SXYA 4GGGA 1FOKA 2XVCA 5ICEA 1PP7U 3EYIA 3EETA 5LGTA 4AIKA 4YFKF 3P9CA 4LLLA 3TGNA 3HRUA 3P9KA 3LFKA 2MA3A 4G7ZF 2DQRA 4LMYA 3T8TA 4FT8A 4IF4A 3LAPA 3DPLC 4WXCA 3KP5A 3V7RA 1OYIA 1F1ZA 4LB5A 1ZGJA 4XSXF 1OPCA 1QO0D 1LNWA 2OZUA 2OQRA 2EFQA 2LF8A 3HRMA 2LNBA 1IW7F 1SFUA 1KYWA 1FZPB 2O6GE 2VBZA 1HKTA 5D5VB 2QUFA 3H3ZA 3KETA 3KLOA 2DAOA 3KE2A 3TDZC 4L0YB 3CUQC 3NQOA 4GCVA 1WKMA 2A5YB 5LBQA 3GZ5A 3QP5A 3VB2A 5BQTA 2VC1A 4M6XA 1FBQA 1BOAA 3WTVC 1I27A 3KEQA 2VE9A 4L0ZB 3KZYA 1T2KA 4BHCA 3GZ6A 5HOOA 2IA2A 2CW0F 3RPUA 2OA4A 2P7CB 3GFLA 1GXQA 1FT9A 1UB9A 1FSEA 1D8KA 1R23A 1JHHA 3V8JA 1LQ1A 1Z05A 3KZZA 5L3CA 4HAMA 2DFIA 5EEGA 2UXNA 3DQVC 2H94A 2QWWA 1J9IA 2K86A 3REOA 2X0LA 2Z33A 3SZPA 1EH7A 3ZMUA 2DK5A 5DUKA 4A5NA 5E20A 4L9TA 2RKHA 1PUEE 4H0EA 2H6CA 4EJTA 5DYMA 1WWXA 3FZVA 4YG2F 3BOQA 1V3FA 1FY7A 5F6FA 3I58A 1IXCA 1KQ8A 3RKYA 4L9NA 1ZHFA 2GZWA 1C0WA 4BXUA 1K78A 3B02A 2MD5A 2WTEA 2PLYA 3COAC 3GEZA 2QVOA 2IA1A 4I98B 4XSZF 2FQ3A 1J7KA 3M8EA 2FBHA 3O3KA 3FMRA 2O61A 2KIFA 3E3VA 4L9VA 4G6DA 1TQPA 3V8LA 2D1HA 4HYEA 1U5TA 2QYOA 3NRVA 3IC7A 5E18F 2UZKA 1K78B 4E70A 1LDJA 3KP3A 3JAMZ 2YPRA 2VC0A 1KGSA 4TV7A 2A6EF 4R1HA 3QRFF 3CJNA 1HSTA 1CGPA 4CICA 5D6EA 4OU0A 1BI3A 3MCZA 4P96A 1B6AA 4MHGA 1P92A 5JVTA 4OIRF 2HQNA 1ZG3A 4IHTA 3TOAA 4RGRA 1LDKB 1U5TB 1YLFA 1B1BA 5L3BA 5BMZA 5DDGA 1BC8C 1KU3A 2DPDA 5J8FA 5ICCA 1IXSB 3BY6A 1FSHA 2EJRA 3I4PA 1G3YA 4CYDA 1R00A 2COMA 3I71A 4OOIA 1KU7A 3ZP5A 3IWFA 3MQ0A 4HDVA 2STTA 4IRHA 1IAWA 3LA7A 2IJLA 3BPVA 3FXUA 2Z5UA 1MGTA 1HW2A 2KIMA 4I0BA 1REPC 3E6MA 3FWEA 4HOBA 3SHFA 3ZMSA 4UVCA 5LRRA 1HXDA 2PI0A 5CLSA 3BJAA 4I7HA 2V9VA 3SFZA 4S04A 3EYYA 1P4AA 2GXBA 1P2FA 3L9FA 2QQAA 4M71A 2FBIA 2XAGA 5EEHA 4EGYA 5D6FA 1XDUA 3F6OA 1F5TA 4LK1F 2OBPA 3WTSC 2PEXA 3M9AA 2FMYA 2K27A 2EB7A 3ZMDA 4P9UA 3DFGA 2IT0A 2VODA 4WXDA 3QOPA 2EV5A 3HTUA 4BHBA 1YIOA 4WXHA 1OYYA 5FLXZ 4EJWA 2P6SA 1ON1A 3U9GA 4HF2A 2WV0A 4JK1X 4U0VA 1RUOA 1UHWA 5HS7A 5K5OA 2L4AA 3DP7A 2HQRA 2QENA 1DPUA 4LG0A 5H6QA 2QBYA 3VEPA 2A3SA 1O57A 2XAHA 2OAZA 2FSWA 4LGWA 1S6LA 4ESBA 1KU2A 3HOSA 1D3YA 2XASA 1USSA 1P4WA 4UVAA 5D5XB 5HLIA 2UWMA 4XLPF 2J5OA 3IRQA 1QZYA 1W7PA 1FP1D 5FO5A 5KVRA 4ZYGA 1H9TA 4HF1A 2MLGA 1I1GA 4LG0B 1HKSA 1IN7A 2QBYB 2A69F 1MKMA 4A12A 2XV4S 3BDDA 3GFJA 5K5RA 1LEAA 1SD4A 1QGPA 4RAYA 1K7AA 2K02A 4O3MA 2GA2A 3K0LA 3K1PA 2NAZA 3C7JA 2KRFA 1T0FA 2CSOA 1ZG5A 3WODF 1W7PB 3KCCA 1U78A 2NYXA 5CVRA 1T98A 3WTTC 1RUNA 2DLLA 5BOXA 2GIVA 3WGIA 2ZO4A 2DU9A 4FX0A 3F8NA 4ETSA 1O7LA 3B73A 1IUYA 1AOYA 3WTUC 3GUDA 4EJUA 4PGGA 4IVNA 3KEOA 5E1WA 2JTVA 1BJAA 1I6XA 4HA8A 4HBLA 2MH2A 5J6XA 1DDNA 2ZCWA 4HQMA 2V1DA 1S7OA 2YU3A 3F21A 3NEUA 5L3GA 1G3TA 2ZMEA 2E1NA 5FB2A 3WE2A 3E6DA 4JBAA 5HDNA 2HGCA 4HX7A 2JSCA 3IL2A 2BV6A 3HOTA 4AIHA 3QPHA 2A61A 1S8NA 1SAXA 2OQGA 2M8EA 1AWCA 1TW2A 5A2QK 1RI7A 2JZYA 3RPQA 2VT3A 3CUQA 4P55A 2FOKA 1OYWA 1F4KA 1QBJA 4ENKA 3N4MA 2MC3A 2Z99A 4I2OA 2ZMEB 3R4KA 4I0AA 4BH9A 1ONVA 3ROUA 3GW2A 4Y15A
chains in the Genus database with same CATH superfamily
1FOYA 4CYCB 4BL0B 2F6CA 5L3FA 2HVQA 3IH3A 4BJ5C 1ITYA 2HTSA 3ULQB 3U21A 4S0HB 1WJCA 3K4KA 4UV9A 2HDDA 2G9WA 3GTMJ 1O3TA 3GLLA 2EPFA 2RQQA 2Y0SA 5BS6A 3H0DA 1R58A 4NBQA 2ZJRF 1Y0NA 1Z3XA 1DGRM 3GTPJ 1XCBA 3MFKA 3BR6A 4MLOA 4YIFA 2QEXI 3CCUI 3BR0A 2CQKA 3CUQB 2DT6A 4UV8A 4XRFA 5HDKA 5CYVA 2N8GA 3S1NJ 4LIVA 4RS8A 1B9MA 4CCJA 3N97A 1EJ9A 3K4LA 3I5UA 3MKWB 2BYVE 1H8AC 2M45A 1UHMA 3HIFA 2M87A 2HU9A 3BR3A 3GFMA 2ID3A 3PUBA 1W0UA 3MVPA 4Y52J 3E6BA 3FXRA 3A02A 3S2WA 5K1YA 2B9SA 2XF7A 3D1NI 4CUGA 2JA5J 3KPHA 2HOTA 3GFIA 2MFZA 4DNCA 2KJBA 3QPSA 1YX3A 2VT2A 3VFZA 3U1DA 2P5VA 2L0KA 5DUIA 2JA8J 3G73A 3OSFA 4BNCA 1B8IA 1A04A 2QCOA 3J7AO 1I3AA 4GYIA 1ZLJA 1HW1A 2L54A 2NOGA 2KZVA 3LFUA 3PIPF 4HV5A 4FISA 4U7BA 1R4MB 2L9RA 4WCGA 4ZZDA 1DU0A 3RIRA 2IA0A 2XAFA 2DA5A 4IOAF 3GO5A 2Y9YA 1IRGA 2XUBA 4I02A 4B09A 3LL7A 4KUMA 2RV8A 1ON2A 4O5VA 1I3QJ 3S16J 2NXNB 2E71A 1BC7C 2EFNA 2F5VA 2BHZA 1IXRC 3WTYC 4FHTA 2Y31A 1FMWA 4OINF 3DKXA 3ZCOA 1JHFA 5EGOA 2HTJA 4AU7A 4RDUA 3W2AA 2UXXA 1UZCA 2G7HA 2QLZA 3CF2A 2K3PA 1DU6A 3CO7C 3BZ6A 3DTEA 2F5FA 2JRTA 2YU9J 2DODA 4CCNA 1JT0A 3CCLI 2M1BA 4ITVA 1B8IB 1G3SA 4OMZA 1Q1HA 1XB4A 5JLXA 1S5LC 1V4RA 3J80Z 5ILSA 2STWA 2XAQA 3AG1H 3E97A 2WY8Q 4D0PA 3F23A 2R7RA 2DK8A 4EM2A 2HKOA 2RDPA 4I76A 3ZMZA 1X4PA 1S7EA 3HJEA 1OCTC 4FCYA 2Z16A 1G59A 2O5RA 1MJ9A 5DCMA 1YHQI 1QU3A 2PFBA 3M3YJ 1OCZH 4E4HA 1P4XA 3SEQA 1TLHB 4BQQA 5EGOB 4MEYF 3C2BA 5FKLA 1BI2A 2A05A 5DEQA 2WBMA 2R7QA 4G6QA 5D5WB 4BE0A 5EYRA 3BQYA 3ML6A 3BR5A 4HRIA 4LD5A 1O7FA 4YIRX 3CMEI 1W36C 3RCOA 4BYYA 1OCCH 3CLOA 1ZRFA 2W00A 2K9QA 3ELKA 3OL4A 3HPGA 1NK3P 3WU1B 1V55H 3FXMA 1ODDA 1WH5A 4M72A 3ROUA 2O9LA 1R6RA 4ZDOA 4HX4A 2ZJPF 4FX4A 4NQWA 3H92A 3JREA 1YRNA 3TP3A 4PDKA 2FXAA 4BJ6C 2QQ8A 3L2UA 5H2FC 2K4BA 1ZYRF 1I39A 1WHUA 5K7FA 1NH3A 1IJWC 1HDDC 4XONA 3ZN0A 2HYGD 2WA0A 4D7MA 5IP7J 2DW4A 2R5YB 1HQCA 1ZARA 3CO6C 3VODA 3G4SI 2DA2A 4KISA 5DCMB 3WHBA 4YFXF 3RZDJ 3ZQ7A 3IRRA 5ILUA 2A6HF 1ETOA 5KHDA 4ABZA 3BPXA 3DBLB 3FX3A 1A35A 1RESA 2W1OA 1W36D 1IF1A 1YTYA 1USTA 2Z3YA 1V5FA 4O6JA 1R36A 2W7NA 2XRLA 4LLNA 3PNTA 2QM3A 2X6OA 2DOAA 1K79A 1XSXA 3F3XA 3OYFA 4HNVA 5M5XJ 4M3FA 1MNMC 4MFEA 4A6DA 2K9NA 2K9SA 1FX7A 1TP4A 1U6GA 1MNDA 4NQWB 1YRNB 5M5YJ 5DV5A 3IH4A 3KP2A 4F91B 1LUJB 5JR3A 1VQNI 2V26A 3UKGA 2LF7A 3ECHA 2AQFA 2P5LC 2HPIA 1TTYA 2KIQA 3NWSA 1ZLKA 1DP7P 2LKXA 1A36A 3T8RA 3WGHA 1ZQ3P 4DIQA 2EV0A 2R7OA 1D0YA 3OYGA 1EF4A 4BUPA 2R3SA 2LD5A 1Y56A 4N4NB 2ICWG 1KQ0A 2X85A 4Q4ZF 2XC7A 3S14J 3PO3J 4E7SA 3S2DJ 2GIZA 2XHKA 2FA5A 2QSGX 2BY2A 2V1XA 3ZMVA 4EV0A 4HNTA 2KHMA 3DPUA 1J59A 1WZ2A 1QZZA 2CWEA 5FD6A 3HKZA 2KQRA 3RQIA 1MMGA 3CF5F 1X2MA 4C2MJ 3H5RA 3ASOH 4CO8A 3H9QA 4UNOA 1AU7A 2NOJB 1O4XA 2XAJA 2ZNZA 2ZBKA 2FNAA 1Y39A 5LGNA 4M3GA 1YJNI 1OCRH 3HRSA 3JAMK 2ZXHA 2H8RA 1R5GA 3GVAA 2GWRA 2NVXJ 3K4JA 1JE8A 5JHUA 3AAFA 2X4HA 1F9NA 1ZRCA 4IHYA 3R0AA 3IHUA 2FMLA 1RKWA 3P9IA 2CU7A 4ZYAA 1ULYA 2QSHX 3CJTB 2VIXA 2A68F 4PCQA 2M34A 5E1XA 2WWYA 2E19A 4MFDA 5LFAA 2XSDC 2D1VA 5D4SA 4E7HA 5CPRB 3PIOF 1V54H 1DUXC 1NHAA 2GQQA 1W5CC 4M3DA 2DA3A 4UY8I 3LSKA 4P1WA 2VE8A 2Y75A 3BJ6A 4LIUA 4HSTA 3I53A 3JSPA 1LB2A 1ZRDA 2XSJC 1E17A 2NRAC 1IO2A 1Z91A 1NTCA 2MABA 3I9V2 1MJAA 3FXOA 5J1RA 2HOSA 1J09A 3FMQA 2XF6A 3DBHB 2L2OA 4IKFA 2ESHA 2KDOA 5JI6A 2M4KA 5DD4A 4LB6B 3HM5A 1XD7A 2ZKZA 3QYFA 2YSRA 2UUZA 1GUUA 2IXSA 3WE3A 4UUVA 3ESWB 2ESNA 4HW0A 3L2QA 3PSIA 2DT5A 1O3SA 3H1CA 2M2EA 1W4MA 3WTZA 4B8XA 3WGGA 4BQNA 3MAJA 5IT9Z 1GV5A 1T95A 3MN2A 2R7DA 3H0GJ 1ORKA 2JA2A 4EJOA 2EQRA 3FHZA 4S05A 2DT7B 2RN7A 4PZJA 2LFBA 1YYVA 2DJIA 4KICA 4RGUA 4MEXF 1BN5A 3BP8A 4XMYA 5F27A 1SD5A 2FBKA 2HR3A 3Q5FA 5AIPA 5IYCJ 2VOPA 3CP2A 3LSIA 3OOPA 3DEUA 2HNHA 3HSRA 2IPQX 3KFWX 2TDXA 1F36A 2CQ7A 5D5UB 2E1CA 1YQAA 2EZIA 2MGQA 2M7AA 2MBFA 2O03A 1FNNA 2DI3A 3G1OA 5LHHA 3H9JA 2ZNYA 3EUHC 1LFUP 1RC9A 4BE2A 4XLCA 3L00A 1SAUA 3PM1A 3VSLA 5JLWA 2X51A 4PSWA 2DYRH 3WHCA 1V5EA 2VASA 2DOEA 5CJ9A 2FQ4A 3G71I 3H3UA 3AL0B 2O8XA 2I5UA 1Z21A 1OQYA 2XF5A 3JW4A 4OIOF 3VYRB 2MLKA 4FQGA 4FETA 5HNHA 3SEZA 4KITB 2R93J 1FIPA 5IT9K 4F7ZA 1LVAA 3RTRA 3F8MA 1NK2P 2VN2A 2OCEA 4HDUA 5AIQA 3PSFA 3NWTA 3S2HJ 2L01A 4IHSA 1MIJA 2IVMA 2WB1A 5HVQC 1UG2A 2L7FP 3ZR8X 5ED4A 3JTGA 2HDCA 4E7KA 3DKWA 3HOWJ 3S3MA 5K5QA 2FRHA 5BPDA 4JQFA 2X6WA 5C3EJ 1YFHA 2ACJA 2E5ZA 4CH7A 2W48A 4XLNF 3A03A 1K6YA 3KZIC 2M7BA 1W5TA 5FLXK 2VUMJ 2K5CA 2I8DA 3CESA 3JR9A 3PNYA 1D1BA 4KDPA 3Q9SA 4R8HA 5AONA 4BY7J 1PP8F 2GA1A 2KRCA 1XSVA 3KP7A 5LEKA 3TW6A 1FTZA 2DMTA 3GCMA 3QAHA 5IYBJ 1EA3A 2BE5F 5J4VA 4A0XA 4HQEA 3RYPA 4ENJA 2OC6A 2ZFWA 3CDHA 2VBXA 2ZXWH 2VONA 3T1BA 1FYLA 2XKOA 1JKOC 4B47A 4AVZA 1D5VA 1MBEA 3J7YJ 4F92B 3R0JA 2V1NA 1EH8A 1KONA 3DU6A 1ZREA 4GDFA 4H4KC 1A5JA 5CKTA 4Y13A 4Q47A 4RB1A 1N25A 3OYNA 1OR7A 4U88A 4GO1A 5HLHA 3GMEA 5DS9A 3HTSB 2KP6A 3M8FA 1JJ8C 4W1UA 4KN4X 1T39A 1TQIA 3EUKL 4LLGF 4CZZA 4A3GJ 3BG6A 3RYRA 1HBXG 2CQXA 2FF4A 5E3OA 2FUG2 1VQKI 2ZJQF 2W84A 3OR1C 3CUOA 4LOCA 2HDWA 4DYQA 1B72A 4AWXB 3K2AA 4Y17A 1XGMA 1IN8A 4XKBA 2O0YA 2C6YA 5HDGA 3Q3SA 1OJLA 4IJAA 1XGSA 3OMYA 1SFXA 1XGOA 2V7FA 5EJCA 2RQPA 5ICFA 1W1WE 2CV2A 3LAJA 4KMFA 4A3CJ 2D2WA 3FXQA 1ERDA 4HNUA 4IX7A 3O6BB 1UFMA 3F8CA 3MZHA 1Z6TA 2GOXB 1MD0A 1BIBA 4HX8A 2WV1A 3D5LA 2MSYA 2AHQA 2NS7A 4YFNF 3I55I 2EFWA 3I3LA 2CGPA 2EV6A 1Z67A 3ZQCA 3IP4B 4CXFA 4G9YA 3MD2A 2BY3A 2GOMA 3FMSA 3JRIA 3CJRB 4RGSA 3S15J 2LBFA 3E5QA 3L09A 3SDBA 4EQQA 3CP8A 4U0YA 2E1MB 1QPMA 4OAYA 3OIOA 1RZ4A 2LG4A 3WTXC 2NNYA 3GWZA 2AO9A 4J19A 2K9MA 1TNTA 3BROA 2EA2A 1K61A 2E7WA 1LEBA 1Q1VA 1XC5A 2NVQJ 4MTEA 2L7MP 2W24A 3HG9A 1B72B 2V6EA 2LMDA 1JKQC 2ISZA 3HSEA 5D4RA 4B43A 2P0WA 2VBWA 4MO7A 2DMPA 2DFHA 4B48A 3LSTA 4B44A 1Y6IA 4R79A 1VQMI 2VPLA 5E8IA 1SFEA 4Y4RA 1FWZA 4E7JA 4MIMA 3R6SA 3S8PA 4RB2C 1JJ6C 4HG2A 2VXZA 5BNGA 3I59A 4WF2A 4A3BJ 3A1YA 4XORA 3BCAA 3BR1A 4CHUA 1HDPA 1L3LA 4A0YA 4X6AJ 4UHTA 1T0FC 2H09A 3PUFA 4G7OF 3OYKA 3DCFA 3MZYA 3L7WA 1WSUA 3QPTA 2VQHA 3WU0A 1W7PD 2EWNA 2CYYA 4KA4A 2LBFB 3HOYJ 1QNTA 3DLLF 2QGUA 4NNJA 3M1EA 5HNFA 3RKXA 1VQ6I 4K2EA 3IAM2 1IRXA 1SVLA 1GXPA 1DQUA 1U3EM 3ZQIA 2IP2A 5FKMA 3EUAA 3K6GA 4MNUA 2V9PA 1TQMA 2OD5A 3CCVI 4RLFA 3MWMA 3W6JB 2EFPA 2Y48A 3KYCB 4IRGA 3ERMA 2CMPA 1VNDA 2R0QC 1RPWA 2YS9A 5E3MA 3FXKA 1RRJA 4U0WA 2E2JJ 3BG3A 2ELJA 3BTCA 5C4JJ 2JWTA 4ZTFA 1XN7A 1YO5C 3I59B 3ABTA 4ZZLA 4ZYDA 1TW3A 1IN5A 3V7CA 1S29A 2DJNA 3OWTA 3IH2A 1XG1A 4NC6A 1OCOH 1KZHA 5TJJA 2NS0A 3EPZA 1RR8C 5F1JA 3TMOA 1NG6A 1WJBA 1J5YA 2J5PA 2P6TA 1XMXA 4XN3A 1VTNC 1OKRA 4ESJA 2P8TA 3I4MJ 4HPQA 3V4GA 4DW6A 1PDNC 4PGHA 3VPRA 3E5XA 3QP6A 3CQZJ 3FKJA 3HOZJ 1TWFJ 4E7IA 5IOYA 3HPHA 4WX9A 1BBYA 3IV5A 3QU6A 4BJTA 3IKVA 3L2RA 3ISPA 4B4CA 1I50J 1R5HA 3BTLA 5M3MJ 2B0LA 3ZOBA 1IZ1A 4KN7X 5LGUA 5CVUA 1RNLA 2LY9A 1HC8A 3DBRB 4IHVA 2L7ZA 4Z6YA 3CCEI 2DOFA 1WGXA 3I54A 4KMUX 2F2EA 3CC2I 3K69A 1H0MA 3HOUJ 3KP4A 2FNPA 4I99C 5CVIA 4KT5C 1YS6A 2E7XA 5CQEA 1MW7A 1X4OA 4OAZA 4IRIA 3TO9A 3JTHA 2Z1DA 5EEAA 2W85A 4Y33A 2WAQN 2BY0A 2K3FA 4HLXA 5H20A 3JCUC 3HHHA 4XKCA 5K7ZA 1X1AA 3J81Z 1MMDA 1Z6RA 3CZ6A 4CGZA 4Z2YA 3P7NA 2DFEA 1HA8A 4WWCA 2DA6A 4N0BA 4BXFA 1BL0A 3TO7A 1UMQA 3ABKH 4XRSA 5ICGA 1TNSA 3T0YA 1B9NA 2LREA 1UHSA 3V8KA 3HHGA 3TL4X 3WU2C 2GAUA 3ABUA 2H1LA 2RVCA 3TO6A 1VQ8I 5F1RA 5C44J 4BE1A 1XS9A 2NVTJ 2IAIA 3E5UA 3TOBA 2BOLA 4EVIA 1CF7A 1WRJA 3PFIA 1WJ5A 1H88C 3ZQFA 2LK2A 5J1UA 1MBGA 3W6KB 1WCMJ 4ZC3A 1KQ9A 2ECBA 3LMMA 3HBLA 2KJCA 5TISC 3RDIA 2CW7A 4G94A 2HYFA 2MD0A 4QTRA 4KJZA 2E36A 3ZMTA 3JRFA 2VLAA 5LLQA 3Q0UA 3TQNA 5KCMA 1FP2A 2FD5A 1YG2A 2XGEA 4KIGA 3TKYA 3ZRGA 5J47A 4HLYA 1IGNA 3F72A 3TW7A 1P6RA 3FK7A 3HRTA 3Q9VA 4CDGA 3LSGA 5GTHC 1R1TA 1Y0UA 4NB5A 1T38A 4EM1A 4J01A 1FBSA 4L5JA 4DZJA 1PYVA 2V6CA 1JXSA 1OMIA 1IC8A 2YX7A 1JUPA 3GTOJ 1G3WA 3J81K 1T33A 3K9TA 4BAYA 4NHJA 2IW5A 2RC4A 2M8GX 1PJRA 2P5KA 3M07A 4LK0F 3LSPA 1SANA 2XIGA 1J0RA 2WAEA 2HS5A 1A31A 3ECOA 4Q48A 5GAGJ 3OS2A 4M3EA 2QZ8A 5LHIA 3VOEA 1S7AA 1CF7B 4JX6A 3DPTA 1D5YA 4YIIA 3DTKA 2DQLA 1D1AA 2AXTC 2EH3A 2IS4A 2DYSH 2DO7A 3ZQLA 1B4AA 5LHGA 1VI0A 4F93B 3C1DA 4KIFA 3C2HA 3SQNA 1R1UA 2E60A 2HOEA 3D0SA 2EZHA 2EZKA 4XR6A 2LSOA 2CO5A 4AD9A 4DBRA 5IP9J 2HKXA 3LA2A 4BEHA 3BG7A 4RAZA 3HSFA 1K4TA 4RGXA 2L02A 1SD6A 3K1MA 1RIOH 4RAGA 2PJRA 2DPUA 2HYJA 2OCCH 3OY9A 1XDSA 2JJ7A 1DP3A 4LITA 3J80K 2QF7A 1FYKA 1WJDA 4MTDA 2JPCA 4RM2A 1YIJI 1MDMA 2V4JC 3H9GA 3K4CA 4A6EA 3SZTA 5KAIC 1B59A 3FM3A 1Z0XA 3I64A 4A3EJ 4BHPA 4BXXJ 2V79A 5ERIA 1W5SA 2PMHA 2AS5F 1MBFA 4YEJA 4X0GA 3ONQA 2B7EA 2K7LA 1JGSA 2DBBA 1LPQA 1N78A 2EK5A 4A3LJ 5JHFA 2RGVA 2A6TA 5B5EC 3HOXJ 4U87A 3GTQJ 1SVMA 4LFUA 3F8FA 2KLOA 2ME6A 3OYBA 2E5NA 3H5AA 2XROA 4MGRA 1J2XA 4D7NA 2KISA 4AVPA 5ILVA 3DEWA 1J75A 3A4CA 5DD8A 1FYMA 3K70C 4ON0A 1R22A 2L7KA 1YW8A 2L9NA 2W82A 2E2HJ 5DCFA 4XIDA 4KFCA 4BEHB 2QA4I 1E2XA 2PJRB 4II2A 2ISYA 3RPUD 2JRMA 1XSDA 1U2WA 2Q2EA 2O7OA 4G8XA 4GYGA 3E6CC 3JSOA 3S1RJ 1ETXA 4OMYA 1MDMB 3IWZA 3OV8A 4ASNA 2P4WA 4QWQA 3HYIA 2VL8A 1I1SA 1JT6A 3LQQA 1GVJA 3E0JB 3LWFA 5IT3A 2F4IA 2L3DA 2QQBA 3WG9A 2H1KA 2L4MA 2VXDA 2QQ9A 2IS1A 1MSEC 4ENNA 4L5EA 2PBIA 3C18A 4C30A 5IOZA 2CW8A 2EFOA 2L9VA 1Y8QB 3TDUC 1G6NA 2Q0OA 2R7ZJ 3T5XA 2KMUA 3LA3A 2PJPA 4A93J 2LP0A 5FGMA 3M1CA 2W25A 3K70D 3FF5A 2EILH 4P5OA 1EV7A 1WVRA 1Z9CA 1WI9A 1PUFA 3RKWA 1LFBA 1XTAA 4XICA 1Z7UA 4BQAA 1FTTA 1HSJA 1XGNA 4YRVA 2XRNA 3K1NA 2JA6J 3FBIB 2YX4A 3FDYA 4N9HA 3HUGA 1XMKA 5FJ8J 2Q2EB 2XGXA 1QA6A 3H3VK 2LOOA 4EGZA 3BT9A 2ELHA 2JPBA 2NNNA 5FKNA 2KKOA 5B66C 1BI1A 1D8JA 4PJLA 2F4OB 2JN6A 3GX4X 3PO2J 2HZTA 4IXAA 2XAUA 4UUSA 2CH0A 5KK1A 4N9IA 4W97A 3A01A 2M0MA 1U5TC 3F6VA 4UB6C 3OYIA 1YITI 3VWBA 1MJBA 5DTDA 2BXYA 1X1DA 2EIKH 2EIMH 3A0HC 3DV8A 3RZOJ 1K6OA 3TP0A 4JOMA 1TWAJ 3BWGA 3EUHA 2FU4A 1NG7A 4A0ZA 1S3JA 4OIQF 4G6TB 1PUFB 3BQZA 2R7XA 3BJOA 1KYZA 1T56A 2BEOA 2JT1A 3ZQQA 4A5MA 4G7HF 1LVKA 3HGGA 2OU2A 3WTWC 2CG4A 2K40A 4EMSA 2DA1A 3CMAI 1RR7A 2F5DA 3TEDA 3R60A 2GBYA 3HUGB 2R7FA 1YW9A 5F64A 4L5IA 5FKKA 1IN4A 2E34A 5M3FJ 3IKTA 1FBUA 1QHHD 2PG4A 5FROA 4FTHA 1JKPC 4KNYA 1BIAA 3RI4A 4UUSB 1MZBA 1M1EB 4M74A 4B3XA 2VPRA 5FD5A 5KAFC 3A01B 2M0CA 5L3DA 2CFXA 3X2QH 1HW5A 2HWVA 4RB3C 3PQKA 2LLKA 1G4DA 3KLNA 5HS9A 3EDPA 4D1QA 2F5EA 2Y0MA 3F22A 2K9LA 3DTIA 3OL3A 2IRFG 2KFDA 1FLIA 1BM9A 2H27A 3R61A 4BBRJ 1EH6A 1G8XA 3RKQA 2PMZN 2VQLA 5J1YA 3UR3C 1HKQA 1WI3A 4EEFG 4OIPF 3I0TA 3ZGKA 1GHCA 2CJJA 2HZDA 3MEXA 3GLXA 2GXAA 5L3EA 3C2GA 1A6QA 2R7VA 2LVSA 2PN6A 1MMAA 4ENMA 2OTJI 4GXOA 3ZQHA 4B1RA 4F3QA 1QQIA 3F0CA 4PJMA 3CMYA 5LEJA 4C2UA 2KDZA 3SZGA 4IPAA 3JRAA 2OZ6A 3AG4H 4PJJA 4ESFA 1KU9A 4IQ4A 1X1BA 1KA8A 2F48A 4L9JA 2BBYA 4M9XA 5EDNA 1YJWI 2Q1ZB 3M7GA 4C9YA 4IOCF 1DPRA 3HKZN 2PQ8A 3LQRA 4MQ9F 3KP6A 2HVRA 1FIAA 2ECCA 4M9SA 3U1KA 4G12A 5CVVA 2F5CA 3O2PE 5E1ZB 2R7WA 4M6VA 2A07F 2KIUA 3BC8A 3GTJJ 1X3UA 1U8RA 1I5ZA 3PFYA 2MH9A 1ZN2A 2Y9ZA 1TBXA 1WQ2A 5GTIC 2LKPA 2VJ5A 4KYWA 4HEA2 1SMTA 1E3PA 3GTLJ 2XB0X 2ID6A 4M73A 4BS9A 1VFCA 5GPAA 5CQGA 2ADUA 4I01A 2QKMB 2EINH 2YR2A 1ETKA 3CJQB 1XMAA 4IQJA 4RBOA 3GF2A 1YS7A 2ZC2A 1MBHA 1L0OC 3IAS2 4BY1J 5CVJA 1HOMA 2LYCA 5F04A 4JX5A 1ZGAA 3ZN1A 3OS0A 1X3ZB 3LSRA 2W57A 2RNJA 1LJ9A 2IS2A 3CCYA 1Y1WJ 2CV0A 2M30A 2BGCA 2FEZA 2IGKA 2M5WA 1ZH5A 3DKYA 2H6BA 2OUMA 3G1LA 3LSMA 3OYJA 2DDAA 4PFOA 4AIJA 3DWLE 2RREA 2DXIA 3LSJA 3AG2H 3KIOA 3OIPA 1SMYF 4ZH4F 3GZNB 5D8LB 3S17J 4ZYHA 4IHXA 1SFKA 2Z9OA 5F08A 2AQEA 3C3WA 4DQ2A 4Y3OA 6PAXA 2LY1A 2YUSA 2Z2SB 3CDLA 2K4JA 1BR4A 4HF0A 4LJZF 1LDDA 1V5GA 4UVBA 1BA5A 2ZXJA 5BPIA 3G3ZA 3HGYA 1F43A 4AYBN 3Q0WA 2DTRA 2HEOA 3DXJF 4A3IJ 1IN6A 1QPIA 4PSXA 5FFZA 1Z3YA 3F8BA 2PMUA 2E1OA 3KYLA 4ZYEA 3WG7H 4NDLA 2ZJ2A 5TRDA 2WADA 1R7JA 5HLGA 3ERED 4XRMA 1AA7A 2EBIA 3GBGA 5EF6A 4WK8F 1QVUA 3OIQA 1SD7A 2R4GA 1T6SA 4XBFA 5IYDJ 4L18B 4A2UA 2FE3A 2LR8A 2MC4A 1BR2A 2LDUA 1ZAOA 1JUSA 1JGGA 1H9GA 3B6AA 2VOOA 2D45A 5JFRA 2DFFA 3LSHA 4M9ZA 1FPQA 3CCRI 3ZPLA 3CTAA 1CQTA 1ZGWA 4QPOA 3BR2A 1FC3A 3W3CA 1Z1DA 3FM5A 1STZA 5FFXA 5H6RA 4QLCU 4A3KJ 4EJVA 4Q5SF 3RJPA 4KT6A 4U7DA 4KIBA 2OTLI 2GXGA 2QKLB 5A2QZ 3CC4I 5HS8A 2VBYA 3U2RA 1O3RA 3CCSI 4UXNA 3GYHX 4P9FA 1T08B 2L9SA 5JVGF 1YW7A 5LRSA 3H35A 4M6YA 4HZFA 1TWHJ 5E8GA 5J8CA 3CMMA 2V1UA 4BBSJ 1P7JA 1BI0A 2WAQA 1IRFA 3EQLF 2XPWA 4DBQA 1R1VA 4MQVA 3FHNA 3DLAA 3V7SA 2ME0A 2AXLA 3OYLA 3K2ZA 4QIWN 1ZG1A 2WC2A 2XKPA 3BTJA 4EM0B 4I09A 3ZQGA 3GXOA 3PQJA 3HDDA 4DYRA 1BW5A 4CCMA 1POGA 1IV8A 1UCRA 3PJRA 2XPUA 3K4BA 3K4MA 2XDVA 4V2GA 2ETHA 4RB0A 2COBA 3DF8A 2P7VB 3QU3A 2G7UA 5E17F 2EIJH 2HFHA 2O3FA 1FOWA 2Q8KA 1ZTRA 3OR2C 4HV6A 1XCVA 1E3OC 3L2CA 1O3QA 1BR1A 5IY5H 2F4MB 1H89C 5D8KB 2EA4A 3SXYA 2E2IJ 4GGGA 1FOKA 2ZXIA 3VYTB 2XVCA 5ICEA 2R5ZA 2D5VA 2O8KA 2VJ4A 1BOBA 1PP7U 3EYIA 3EETA 3E1SA 5LGTA 4AIKA 4YFKF 3FXLA 3P9CA 1Y1VJ 4LLLA 2GM4A 3TGNA 4XKVA 4EATA 5IPAA 3HRUA 1GDTA 3P9KA 5B1BH 3J7AY 2Y30A 3LFKA 2MA3A 4G7ZF 2RNGA 2LY2A 4D5FA 5DM7F 2BHYA 2DQRA 2HI3A 3O8GA 4LMYA 3T8TA 4FT8A 4IF4A 4BQOA 1GV2A 3HXLA 3LAPA 3DPLC 5LD2C 4RMNA 4UB8C 3PL8A 1MBKA 4WXCA 3KP5A 3V7RA 1S9HA 2CQNA 2JUCA 1QVTA 3OS1A 1OYIA 1UELB 4N4OB 3S32A 3KYDB 1F1ZA 3H5NA 4LB5A 1ZGJA 2BVLA 4XSXF 1OPCA 1QO0D 2LTPA 1LNWA 2OZUA 3S1QJ 2XB5A 1JUMA 2OQRA 4GFBA 3JRBA 1BW6A 2EFQA 2R5ZB 2LF8A 3FIWA 3HRMA 1X2NA 2LNBA 1U9OA 2M4GA 1WJAA 2ZMEC 1IW7F 4V2FA 1SFUA 2DCEA 1R5ID 1KYWA 2MG4A 1X3WB 1FZPB 2O6GE 2WAFA 2VBZA 1HKTA 9ANTA 5D5VB 1U9NA 4PK4A 3MZ8A 1TT0A 3VDXA 2QUFA 3NARA 2JVHA 1K83J 3H3ZA 3KETA 1YX5A 3KLOA 1RETA 2W4SA 2DAOA 1X1CA 4JYKA 3BCBA 3KE2A 3TDZC 4L0YB 2A5WA 3UNGC 4JP0A 2XGCA 2DMUA 3A0BC 1QRYA 3CUQC 4IL6C 3NQOA 4GCVA 1WKMA 2A5YB 5LBQA 3P5JA 3ABMH 3GZ5A 1X1PA 2ELKA 3QP5A 3L2VA 3VB2A 5BQTA 4C2TA 1FMVA 2VC1A 4CCLA 4M6XA 1FBQA 1HCRA 1BOAA 1IDYA 1APLC 4NUBA 2QSFX 5HLTA 3WTVC 3H36A 1AKHA 1I27A 3KEQA 2VE9A 4L0ZB 5EZGA 3RQ4A 3KZYA 1T2KA 4BHCA 3GZ6A 4II3A 5HOOA 4BDZA 4GRIA 2IA2A 2CW0F 4XLHA 3RPUA 2OA4A 2Y69H 2P7CB 5GAHJ 3GFLA 1GXQA 1FT9A 1ZR4A 1ETYA 1UB9A 1FSEA 4BDYA 1IV6A 1D8KA 1BJZA 3JRCA 4M3BA 1R23A 5GPCA 1JHHA 3V8JA 1LQ1A 1Z05A 3KZZA 5L3CA 4HAMA 4E6KG 2X1DA 4RA2A 2JSPA 4XKWA 1SFOJ 1I6HJ 2DFIA 1E3HA 5EEGA 4ZDPA 2UXNA 3DQVC 2H94A 4CZCA 1HLVA 3N05A 2QWWA 1J9IA 1R4NB 2K86A 3KX2A 3REOA 2X0LA 2Z33A 2X6YA 1HF0A 3SZPA 1EH7A 3ZMUA 1OFCX 2DK5A 2TRTA 5E3NA 5DUKA 4A5NA 5E20A 3QPLA 4JX4A 4L9TA 3QYBA 3HZJA 2RKHA 1AKHB 1X58A 1ETWA 1N75A 2KL4A 1PUEE 4H0EA 3FBNB 3G2BA 3I4NJ 2H6CA 4RLQA 2R5YA 3K10A 4EJTA 5DYMA 2XPVA 2Y0SN 3FISA 3S3NA 5DM6F 3CC7I 2VJJA 1WWXA 3NAUA 2FJ1A 3FZVA 4YG2F 3BOQA 3CCQI 1V3FA 1FY7A 5F6FA 3A2KA 3I58A 3S93A 1IXCA 2DDBA 1KQ8A 3RKYA 1TL8A 2HPMA 1VQLI 1UAAA 4L9NA 1ZHFA 2GZWA 1C0WA 1ZK8A 4BXUA 1K78A 3B02A 2MD5A 2WTEA 2TCTA 2PLYA 2CRGA 3COAC 2VQCA 3D5SC 3GEZA 2QVOA 2RAEA 2IA1A 2VKDA 4I98B 2CS3A 1N77A 4XSZF 2OPTA 2CV1A 3BZKA 4XNFA 2FQ3A 1J7KA 3M8EA 3O8HA 2FBHA 3I56I 3O3KA 1VQ9I 2JQ7A 3RSNA 3FMRA 2O61A 2BW3A 2KIFA 3JRGA 3E3VA 1ENHA 1RKTA 4L9VA 3HC7A 4G6DA 1YJ9I 3J7ZI 2ZSHB 1TQPA 1TT5B 3V8LA 1VQOI 1WH7A 2D1HA 1SVOA 4HYEA 1U5TA 2QYOA 3NRVA 3IC7A 2BXZA 1U8BA 5E18F 2UZKA 1K78B 4E70A 1LDJA 2VKVA 3L2WA 3VYUB 3KP3A 2V9KA 3JAMZ 2YPRA 4AC0A 2VC0A 3HL2A 1KGSA 4TV7A 4D5CA 2A6EF 2VKHA 4R1HA 1JI8A 3QRFF 2PMZA 2H8WA 3CJNA 3D5RC 1HSTA 4I6ZA 1CGPA 4CICA 5D6EA 4OU0A 1BI3A 4OWRB 3MCZA 4P96A 1B6AA 4MHGA 1P92A 2X9DA 5JVTA 4OIRF 2HQNA 2BW3B 1ZG3A 4IHTA 4AM3A 1MMSA 2LRDA 3TOAA 3QODA 5F0HA 2IGMA 4RGRA 3QQAA 1UJ8A 5FKOA 1LDKB 3SYTA 1U5TB 1YLFA 1B1BA 3M4OJ 3OOUA 5L3BA 1LE8A 5BMZA 5DDGA 1BC8C 2IBDA 3BTIA 1KU3A 3QOEA 4CSWA 4A3JJ 2DPDA 5J8FA 2VKEA 2K85A 5ICCA 1P7IA 2CUEA 1IXSB 3BY6A 2ZB9A 3AFHA 1S72I 1FSHA 2EJRA 3I4PA 1G3YA 2X1EA 4CYDA 3W2VA 5HODA 4ZJZA 3AKZA 4J00A 1WJFA 1R00A 4PJNA 1UG0A 4XOTA 2COMA 1ACIA 4V19K 4BKXA 3I71A 4OOIA 2DN0A 1IUFA 3HB9A 1KU7A 1VZ0A 3ZP5A 3IWFA 3MQ0A 4HDVA 1XX5A 3ABLH 2STTA 4IRHA 1IAWA 3DU5A 3LA7A 4FE7A 1VQPI 2IJLA 5FLVA 1GVDA 3BPVA 3FXUA 2M3AA 2Z5UA 4A69C 1MGTA 4BACA 1HW2A 1YOVB 2KT0A 3CDIA 2KIMA 4I0BA 1TZLA 2LC2A 4BU2A 1REPC 1X19A 3BLYA 3E6MA 3FWEA 4HOBA 4IHWA 3SHFA 1LE8B 2OJED 3ZMSA 4UVCA 5LRRA 1HXDA 4C3IJ 2PI0A 5CLSA 2DMNA 4XN0A 1W0TA 3BJAA 4I7HA 2V9VA 3SFZA 4S04A 1E0EA 4A3MJ 3MMYB 4ANJA 3EYYA 1P4AA 3G1MA 3QYEA 2B63J 3TBIA 4E7LA 2GXBA 2M9HA 4F52A 3CD6I 4CA0A 4DOZA 1P2FA 4DJAA 5F0CA 1P9QC 3L9FA 3L1PA 2QQAA 3BZCA 4M71A 4B3AA 5IP6A 2FBIA 2XAGA 5EEHA 4EGYA 5D6FA 3ZXSA 4E7ZA 3S1MJ 2DMQA 1XDUA 4AYBA 4IEJA 4BGDA 3F6OA 1OISA 2IS6A 2DTZA 1F5TA 4LK1F 2NVUB 1R49A 5FLMJ 3M8JA 2KPMA 1PVEA 2OBPA 2EZLA 4PFPA 4XLFA 4AIDA 3WTSC 2PEXA 3M9AA 4A3DJ 2FMYA 4CCKA 4XQFA 3OYHA 1SC7A 1A6IA 2K27A 4XK4A 2EB7A 3ZMDA 2X1CA 1FJLA 2R7SA 2GLOA 4AUXA 4P9UA 3KEYA 1XPXA 1MBJA 3FXJA 3DFGA 3JRHA 2IGOA 3MKZA 2IT0A 2VODA 1IRZA 1FEXA 3SDGA 4WXDA 2LKSA 3QOPA 3VSKA 2EV5A 3HTUA 5E79C 4BHBA 1VQ7I 1YIOA 4WXHA 3ASNH 3SJMA 1OYYA 5FLXZ 2XGDA 2L5QA 4FASD 1TC3C 2PX9A 2HXIA 3PNVA 5GAEJ 3FKIJ 3LNQA 2JA7J 2G0EA 4EJWA 2P6SA 5GP9A 1ON1A 3U9GA 4HF2A 1QZEA 1IG7A 2JVGA 2WV0A 4JK1X 4U0VA 1SEUA 3QWLA 2R92J 2OV7A 1RUOA 1UHWA 5HS7A 5K5OA 2BY1A 2L4AA 3DP7A 2HQRA 2QENA 5FRMA 2JUGA 3AG3H 1DPUA 3CCJI 4LG0A 2UV1A 3BG5A 5H6QA 2FX0A 3OYEA 2QBYA 3VEPA 2A3SA 3HEFA 1O57A 2XAHA 2MYSA 2OAZA 4UUTA 2FSWA 2VI6A 4RM3A 4LGWA 1S6LA 4D9JA 3FK6A 2E35A 1DGWY 4ESBA 4CCOA 4ZTJA 1KU2A 3GTKJ 4A3FJ 3HOSA 3AL0C 1YE9A 1D3YA 3BG9A 2XASA 1USSA 5FRNA 3IUOA 1P4WA 4UVAA 1GT0C 5D5XB 5HLIA 1Y8RB 4XLEA 4Y7NJ 2UWMA 5B1AH 4XLPF 2J5OA 5EG0A 3IRQA 3K7AJ 4F55A 1QZYA 1AHDP 1W7PA 1FP1D 5FO5A 5KVRA 2Y2ZA 4ZYGA 1H9TA 3OYMA 4HF1A 2BVMA 2CUZA 3W6VA 1MH4A 2MLGA 1I1GA 2IGNA 2CQQA 1MMNA 5K7HA 4LG0B 1WJEA 3CLQA 1HKSA 4QSHA 2X48A 1U0JA 1K4SA 1IN7A 1EKEA 2QBYB 2A69F 4PUSA 1MKMA 4NC8A 1D1CA 2P81A 4DGWB 5B3SH 2CUFA 4A12A 2XV4S 3BDDA 4IO9F 2VB6A 3GFJA 5K5RA 1LEAA 1SD4A 1QGPA 4RAYA 5M5WJ 2K02A 2CFOA 2GA2A 1K7AA 4O3MA 2R7TA 3K0LA 3K1PA 4FE4A 5J3LA 2NAZA 3C7JA 2X6XA 4DYCA 1TWGJ 2CUJA 2KRFA 1T0FA 2IEKA 1LKXA 2I10A 4NC7A 5J40A 4DZPA 4XLAA 2CSOA 3DEEA 4ZDLA 1ZG5A 5C4XJ 5EG0B 1YI2I 3WODF 1W7PB 3KCCA 1VF9A 1U78A 5EZHA 1JKRC 2NYXA 5CVRA 1T98A 1WPKA 1OLTA 2VJIA 3WTTC 1QHGA 1RUNA 3G6EI 3OYCA 1ZR2A 1GLNA 2DLLA 5BOXA 2GIVA 3WGIA 2BZTA 2ZO4A 3HOVJ 2DU9A 4FX0A 3F8NA 4ETSA 1O7LA 3B73A 5GADJ 1IUYA 3CCMI 4PJ0C 2DA7A 1G2HA 3V42A 1IDZA 2LH9A 2HOAA 1AOYA 2FOWA 3WTUC 2R7UA 2KRHA 3GUDA 1WFXA 2MW8A 4XL9A 1ZELA 4EJUA 4C3HJ 4XOPA 4PGGA 4IVNA 3KEOA 1T8IA 5E1WA 3SFIA 5E3LA 2JTVA 1FOXA 1BJAA 1D0XA 1TWCJ 3MKYB 1I6XA 4HA8A 4X1EA 1JTYA 1LFPA 4HBLA 2MH2A 4YELA 2VQGA 5J6XA 1DDNA 2ZCWA 3LOCA 1Z77A 4HQMA 2V1DA 3S3OA 1S7OA 1R9TJ 2NS8A 2YU3A 3B6CA 3F21A 1R71A 4C3JJ 3NEUA 4XM3A 4XRSG 1G3TA 5L3GA 5F0FA 5J4YA 2ZMEA 2WB1N 2E1NA 1ETQA 1OCPA 5FB2A 4HSRA 5TGTA 2HQ5A 1MSFC 2WY7Q 4CYCA 2KZGA 2ZFUA 3OYAA 3E6DA 3WE2A 4JBAA 5HDNA 2HGCA 1OR7C 3W2WA 5KNLA 4HX7A 2JSCA 3IL2A 2BV6A 3MKLA 3HOTA 4IZZA 4AIHA 1D0ZA 2E1MC 3QPHA 2A61A 2HQAA 1S8NA 2HXOA 4RAFA 3JRDA 2ZSIB 1SAXA 2OQGA 2M8EA 1AWCA 1TW2A 5A2QK 2HVSA 1ZKGA 2DA4A 1RI7A 1VQ5I 2JZYA 3GTGJ 3RPQA 1ETVA 2VT3A 3Q0VA 3CUQA 1MH3A 2OF7A 4P55A 2FOKA 3E7LA 3VYSB 1OYWA 4QPQA 1VQ4I 3F9KA 1MNEA 1F4KA 1QBJA 1Z7LA 2JMWA 2JK3A 4ENKA 3N4MA 2MC3A 2Z99A 4I2OA 3OSGA 2ZMEB 3R4KA 3OYDA 4I0AA 4LG3A 4BH9A 1JTXA 1ONVA 3K4NA 2NVYJ 3GW2A 4Y15A
chains in the Genus database with same CATH topology
5L3FA 2HTSA 3ULQB 4UV9A 2G9WA 1O3TA 5BS6A 1R58A 1XCBA 3MFKA 4YIFA 2CQKA 3CUQB 4XRFA 4UV8A 5HDKA 5CYVA 4RS8A 1B9MA 3N97A 3I5UA 2BYVE 2M45A 1UHMA 3HIFA 2M87A 3GFMA 3E6BA 3FXRA 3S2WA 5K1YA 3GFIA 4DNCA 2KJBA 2VT2A 3VFZA 3U1DA 2P5VA 5DUIA 3G73A 4BNCA 1A04A 3J7AO 4GYIA 1ZLJA 1HW1A 2L54A 4HV5A 4U7BA 4WCGA 4ZZDA 3RIRA 2IA0A 2XAFA 3GO5A 1IRGA 2XUBA 4I02A 4B09A 4KUMA 2RV8A 1ON2A 4O5VA 1BC7C 2EFNA 1IXRC 3WTYC 4FHTA 4OINF 1JHFA 2HTJA 2UXXA 2G7HA 2QLZA 3CO7C 3BZ6A 2F5FA 2JRTA 2M1BA 1G3SA 4OMZA 1Q1HA 1XB4A 1V4RA 3J80Z 5ILSA 2STWA 2XAQA 3E97A 4D0PA 3F23A 2DK8A 4EM2A 2HKOA 2RDPA 3ZMZA 1MJ9A 5DCMA 2PFBA 1P4XA 1TLHB 4MEYF 1BI2A 5DEQA 4G6QA 5D5WB 3ML6A 4LD5A 1O7FA 4BYYA 3CLOA 1ZRFA 3ELKA 3WU1B 1ODDA 4M72A 4HX4A 4FX4A 4NQWA 3H92A 4PDKA 2FXAA 2K4BA 1ZYRF 3ZN0A 2HYGD 2DW4A 1HQCA 1ZARA 3CO6C 3VODA 5DCMB 4YFXF 3ZQ7A 3IRRA 5ILUA 2A6HF 3BPXA 3FX3A 1IF1A 1YTYA 1USTA 2Z3YA 4O6JA 1R36A 4LLNA 2QM3A 1K79A 1XSXA 3F3XA 4A6DA 1FX7A 1U6GA 5DV5A 3KP2A 5JR3A 2LF7A 3ECHA 2P5LC 1TTYA 1ZLKA 1DP7P 3T8RA 3WGHA 2EV0A 2R3SA 1KQ0A 4Q4ZF 2XHKA 2FA5A 2V1XA 3ZMVA 4EV0A 1J59A 1QZZA 2CWEA 5FD6A 4CO8A 4UNOA 2XAJA 2ZNZA 2ZBKA 2FNAA 5LGNA 3HRSA 3JAMK 1R5GA 3GVAA 2GWRA 1JE8A 5JHUA 3AAFA 2X4HA 1F9NA 1ZRCA 3R0AA 3IHUA 2FMLA 3P9IA 1ULYA 2A68F 4PCQA 5E1XA 2WWYA 2D1VA 5D4SA 1DUXC 1NHAA 2GQQA 2VE8A 2Y75A 3BJ6A 1LB2A 3JSPA 3I53A 1ZRDA 1E17A 2NRAC 1Z91A 1MJAA 3FMQA 2ESHA 5JI6A 5DD4A 4LB6B 1XD7A 2ZKZA 2YSRA 3WE3A 4UUVA 2ESNA 4HW0A 2DT5A 1O3SA 1W4MA 3WTZA 4B8XA 3WGGA 3MAJA 5IT9Z 2R7DA 4EJOA 3FHZA 4S05A 2RN7A 4PZJA 1YYVA 4KICA 4RGUA 4MEXF 1BN5A 3BP8A 1SD5A 2FBKA 2HR3A 3Q5FA 5AIPA 2VOPA 3OOPA 3DEUA 3HSRA 2IPQX 3KFWX 2TDXA 5D5UB 2E1CA 1YQAA 2O03A 2MBFA 1FNNA 2DI3A 5LHHA 2ZNYA 3L00A 5CJ9A 3H3UA 2O8XA 3JW4A 4OIOF 2MLKA 5IT9K 4F7ZA 1LVAA 3RTRA 3F8MA 2VN2A 4HDUA 5AIQA 2L01A 4IHSA 2IVMA 5HVQC 3JTGA 5ED4A 2HDCA 3DKWA 5K5QA 2FRHA 5BPDA 4JQFA 1YFHA 2ACJA 4XLNF 1W5TA 5FLXK 4KDPA 3Q9SA 4R8HA 5AONA 1PP8F 2GA1A 5LEKA 1XSVA 3KP7A 3QAHA 2BE5F 4A0XA 4HQEA 3RYPA 4ENJA 2ZFWA 3CDHA 2VBXA 2VONA 3T1BA 1FYLA 2XKOA 1D5VA 3R0JA 1EH8A 1ZREA 4Y13A 4Q47A 4RB1A 1OR7A 4U88A 4GO1A 5HLHA 3HTSB 3M8FA 4KN4X 1T39A 1TQIA 4LLGF 4CZZA 3RYRA 1HBXG 2FF4A 2W84A 3CUOA 4AWXB 4Y17A 1XGMA 1IN8A 2O0YA 2C6YA 5HDGA 4IJAA 1XGSA 1SFXA 1XGOA 2RQPA 5ICFA 3LAJA 4KMFA 2D2WA 3FXQA 3O6BB 1UFMA 3F8CA 3MZHA 1Z6TA 1MD0A 1BIBA 4HX8A 3D5LA 4YFNF 2EFWA 2CGPA 2EV6A 4CXFA 4G9YA 3FMSA 4RGSA 3E5QA 3L09A 4EQQA 4U0YA 1QPMA 1RZ4A 3WTXC 2NNYA 3GWZA 1TNTA 3BROA 2EA2A 2E7WA 1LEBA 4MTEA 2W24A 2ISZA 5D4RA 3HSEA 2VBWA 4R79A 3LSTA 5E8IA 1SFEA 1FWZA 3R6SA 4RB2C 2VXZA 3I59A 4WF2A 4CHUA 1L3LA 4A0YA 4UHTA 2H09A 4G7OF 3MZYA 3L7WA 1WSUA 3QPTA 3WU0A 1W7PD 2EWNA 2CYYA 4KA4A 1QNTA 3M1EA 3RKXA 4K2EA 1GXPA 1U3EM 2IP2A 4MNUA 1TQMA 2OD5A 3MWMA 3W6JB 2EFPA 2Y48A 4IRGA 4U0WA 1XN7A 1YO5C 3I59B 3ABTA 4ZZLA 4ZYDA 1TW3A 1IN5A 3V7CA 1S29A 5TJJA 2NS0A 2P6TA 1J5YA 2J5PA 1VTNC 1OKRA 4ESJA 2P8TA 3V4GA 1PDNC 4PGHA 3E5XA 3QP6A 4WX9A 1BBYA 3QU6A 3IKVA 3ISPA 1R5HA 2B0LA 1IZ1A 4KN7X 5LGUA 5CVUA 1RNLA 4KMUX 3I54A 2F2EA 3K69A 1H0MA 3KP4A 2FNPA 5CVIA 4KT5C 1YS6A 2E7XA 4IRIA 3TO9A 3JTHA 2W85A 5H20A 4HLXA 3HHHA 3J81Z 1Z6RA 4CGZA 4Z2YA 3P7NA 4WWCA 4N0BA 3TO7A 5ICGA 1TNSA 3T0YA 1B9NA 3V8KA 3HHGA 2GAUA 3ABUA 2RVCA 3TO6A 5F1RA 3E5UA 3TOBA 4EVIA 1CF7A 1WRJA 3PFIA 3W6KB 1KQ9A 2KJCA 3RDIA 4G94A 2HYFA 3ZMTA 5LLQA 3TQNA 1FP2A 3TKYA 1YG2A 4KIGA 4HLYA 3F72A 4CDGA 1P6RA 3HRTA 3Q9VA 1R1TA 1Y0UA 4NB5A 1T38A 4EM1A 1FBSA 4L5JA 2V6CA 1JXSA 1OMIA 2YX7A 1G3WA 3J81K 3K9TA 4BAYA 4NHJA 2IW5A 2RC4A 2P5KA 4LK0F 2XIGA 1J0RA 2HS5A 3ECOA 4Q48A 2QZ8A 5LHIA 3VOEA 1S7AA 1CF7B 3DPTA 4YIIA 2DQLA 2DO7A 1B4AA 5LHGA 3C1DA 4KIFA 3SQNA 1R1UA 2HOEA 3D0SA 2LSOA 2CO5A 4AD9A 2HKXA 3LA2A 4RAZA 3HSFA 4RGXA 2L02A 1SD6A 3K1MA 1RIOH 2DPUA 1XDSA 3J80K 1FYKA 4MTDA 2JPCA 1MDMA 4A6EA 3SZTA 1B59A 3FM3A 3I64A 4BHPA 2V79A 5ERIA 1W5SA 2PMHA 2AS5F 2K7LA 1JGSA 2DBBA 2EK5A 2RGVA 4LFUA 3F8FA 2XROA 4MGRA 1J2XA 4AVPA 5ILVA 1J75A 5DD8A 1FYMA 4ON0A 1R22A 1YW8A 5DCFA 4KFCA 1E2XA 2ISYA 1XSDA 1U2WA 2Q2EA 4G8XA 4GYGA 3E6CC 3JSOA 4OMYA 1MDMB 4ASNA 3IWZA 3OV8A 2P4WA 4QWQA 3HYIA 1I1SA 3LQQA 1GVJA 3LWFA 5IT3A 2L3DA 2QQBA 3WG9A 2L4MA 2QQ9A 4ENNA 2PBIA 3C18A 2EFOA 3TDUC 1G6NA 2Q0OA 3T5XA 3LA3A 2PJPA 5FGMA 2W25A 3FF5A 4P5OA 1EV7A 1Z9CA 1WI9A 3RKWA 1Z7UA 4BQAA 1HSJA 1XGNA 2XRNA 3K1NA 2YX4A 4N9HA 3HUGA 1XMKA 2XGXA 4EGZA 2ELHA 2JPBA 2NNNA 2KKOA 1BI1A 1D8JA 3GX4X 2HZTA 4IXAA 5KK1A 4N9IA 1U5TC 3F6VA 1MJBA 3DV8A 1K6OA 3BWGA 3EUHA 2FU4A 4A0ZA 1S3JA 4OIQF 3BJOA 1KYZA 2BEOA 2JT1A 4A5MA 4G7HF 2OU2A 3WTWC 2CG4A 4EMSA 2F5DA 3R60A 2R7FA 1YW9A 5F64A 4L5IA 1IN4A 3IKTA 1FBUA 2PG4A 4KNYA 1BIAA 3RI4A 1MZBA 4M74A 5FD5A 5L3DA 2CFXA 1HW5A 2HWVA 4RB3C 3PQKA 1G4DA 3KLNA 5HS9A 3EDPA 2F5EA 2Y0MA 3F22A 2IRFG 1FLIA 1BM9A 2H27A 3R61A 1EH6A 1HKQA 4OIPF 3I0TA 1GHCA 3MEXA 3GLXA 5L3EA 2PN6A 4ENMA 4GXOA 1QQIA 5LEJA 4IPAA 2OZ6A 4ESFA 1KU9A 1KA8A 4L9JA 2BBYA 4M9XA 3M7GA 1DPRA 2PQ8A 3LQRA 4MQ9F 3KP6A 4M9SA 5CVVA 2F5CA 3O2PE 5E1ZB 2A07F 2KIUA 1X3UA 1U8RA 1I5ZA 2MH9A 1ZN2A 1TBXA 1WQ2A 2LKPA 4KYWA 1SMTA 4M73A 2ADUA 4I01A 2YR2A 1XMAA 3GF2A 1YS7A 1L0OC 5CVJA 3ZN1A 1ZGAA 2W57A 2RNJA 1LJ9A 2M30A 2BGCA 2FEZA 2M5WA 1ZH5A 2H6BA 4AIJA 1SMYF 4ZH4F 5D8LB 4ZYHA 2Z9OA 3C3WA 4DQ2A 6PAXA 2K4JA 4HF0A 4LJZF 1LDDA 4UVBA 2ZXJA 5BPIA 3G3ZA 2DTRA 2HEOA 3DXJF 1IN6A 5FFZA 3F8BA 2PMUA 5TRDA 4ZYEA 2ZJ2A 5HLGA 1R7JA 3ERED 4WK8F 1SD7A 1T6SA 4XBFA 4L18B 4A2UA 2FE3A 2LDUA 1ZAOA 1H9GA 2VOOA 2D45A 5JFRA 4M9ZA 1FPQA 3ZPLA 3CTAA 1FC3A 1Z1DA 3FM5A 1STZA 5FFXA 5H6RA 4QLCU 4EJVA 4Q5SF 3RJPA 4U7DA 4KIBA 2GXGA 5A2QZ 5HS8A 2VBYA 3U2RA 1O3RA 4UXNA 3GYHX 4P9FA 1YW7A 5LRSA 4M6YA 4HZFA 5E8GA 5J8CA 2V1UA 1BI0A 1IRFA 3EQLF 1R1VA 4MQVA 3V7SA 2AXLA 3K2ZA 1ZG1A 2WC2A 2XKPA 4EM0B 4I09A 3GXOA 3PQJA 1UCRA 2ETHA 4RB0A 3DF8A 2P7VB 3QU3A 2G7UA 5E17F 2HFHA 2O3FA 2Q8KA 4HV6A 1XCVA 3L2CA 1O3QA 5D8KB 2EA4A 3SXYA 4GGGA 1FOKA 2XVCA 5ICEA 1PP7U 3EYIA 3EETA 5LGTA 4AIKA 4YFKF 3P9CA 4LLLA 3TGNA 3HRUA 3P9KA 3LFKA 2MA3A 4G7ZF 2DQRA 4LMYA 3T8TA 4FT8A 4IF4A 3LAPA 3DPLC 4WXCA 3KP5A 3V7RA 1OYIA 1F1ZA 4LB5A 1ZGJA 4XSXF 1OPCA 1QO0D 1LNWA 2OZUA 2OQRA 2EFQA 2LF8A 3HRMA 2LNBA 1IW7F 1SFUA 1KYWA 1FZPB 2O6GE 2VBZA 1HKTA 5D5VB 2QUFA 3H3ZA 3KETA 3KLOA 2DAOA 3KE2A 3TDZC 4L0YB 3CUQC 3NQOA 4GCVA 1WKMA 2A5YB 5LBQA 3GZ5A 3QP5A 3VB2A 5BQTA 2VC1A 4M6XA 1FBQA 1BOAA 3WTVC 1I27A 3KEQA 2VE9A 4L0ZB 3KZYA 1T2KA 4BHCA 3GZ6A 5HOOA 2IA2A 2CW0F 3RPUA 2OA4A 2P7CB 3GFLA 1GXQA 1FT9A 1UB9A 1FSEA 1D8KA 1R23A 1JHHA 3V8JA 1LQ1A 1Z05A 3KZZA 5L3CA 4HAMA 2DFIA 5EEGA 2UXNA 3DQVC 2H94A 2QWWA 1J9IA 2K86A 3REOA 2X0LA 2Z33A 3SZPA 1EH7A 3ZMUA 2DK5A 5DUKA 4A5NA 5E20A 4L9TA 2RKHA 1PUEE 4H0EA 2H6CA 4EJTA 5DYMA 1WWXA 3FZVA 4YG2F 3BOQA 1V3FA 1FY7A 5F6FA 3I58A 1IXCA 1KQ8A 3RKYA 4L9NA 1ZHFA 2GZWA 1C0WA 4BXUA 1K78A 3B02A 2MD5A 2WTEA 2PLYA 3COAC 3GEZA 2QVOA 2IA1A 4I98B 4XSZF 2FQ3A 1J7KA 3M8EA 2FBHA 3O3KA 3FMRA 2O61A 2KIFA 3E3VA 4L9VA 4G6DA 1TQPA 3V8LA 2D1HA 4HYEA 1U5TA 2QYOA 3NRVA 3IC7A 5E18F 2UZKA 1K78B 4E70A 1LDJA 3KP3A 3JAMZ 2YPRA 2VC0A 1KGSA 4TV7A 2A6EF 4R1HA 3QRFF 3CJNA 1HSTA 1CGPA 4CICA 5D6EA 4OU0A 1BI3A 3MCZA 4P96A 1B6AA 4MHGA 1P92A 5JVTA 4OIRF 2HQNA 1ZG3A 4IHTA 3TOAA 4RGRA 1LDKB 1U5TB 1YLFA 1B1BA 5L3BA 5BMZA 5DDGA 1BC8C 1KU3A 2DPDA 5J8FA 5ICCA 1IXSB 3BY6A 1FSHA 2EJRA 3I4PA 1G3YA 4CYDA 1R00A 2COMA 3I71A 4OOIA 1KU7A 3ZP5A 3IWFA 3MQ0A 4HDVA 2STTA 4IRHA 1IAWA 3LA7A 2IJLA 3BPVA 3FXUA 2Z5UA 1MGTA 1HW2A 2KIMA 4I0BA 1REPC 3E6MA 3FWEA 4HOBA 3SHFA 3ZMSA 4UVCA 5LRRA 1HXDA 2PI0A 5CLSA 3BJAA 4I7HA 2V9VA 3SFZA 4S04A 3EYYA 1P4AA 2GXBA 1P2FA 3L9FA 2QQAA 4M71A 2FBIA 2XAGA 5EEHA 4EGYA 5D6FA 1XDUA 3F6OA 1F5TA 4LK1F 2OBPA 3WTSC 2PEXA 3M9AA 2FMYA 2K27A 2EB7A 3ZMDA 4P9UA 3DFGA 2IT0A 2VODA 4WXDA 3QOPA 2EV5A 3HTUA 4BHBA 1YIOA 4WXHA 1OYYA 5FLXZ 4EJWA 2P6SA 1ON1A 3U9GA 4HF2A 2WV0A 4JK1X 4U0VA 1RUOA 1UHWA 5HS7A 5K5OA 2L4AA 3DP7A 2HQRA 2QENA 1DPUA 4LG0A 5H6QA 2QBYA 3VEPA 2A3SA 1O57A 2XAHA 2OAZA 2FSWA 4LGWA 1S6LA 4ESBA 1KU2A 3HOSA 1D3YA 2XASA 1USSA 1P4WA 4UVAA 5D5XB 5HLIA 2UWMA 4XLPF 2J5OA 3IRQA 1QZYA 1W7PA 1FP1D 5FO5A 5KVRA 4ZYGA 1H9TA 4HF1A 2MLGA 1I1GA 4LG0B 1HKSA 1IN7A 2QBYB 2A69F 1MKMA 4A12A 2XV4S 3BDDA 3GFJA 5K5RA 1LEAA 1SD4A 1QGPA 4RAYA 1K7AA 2K02A 4O3MA 2GA2A 3K0LA 3K1PA 2NAZA 3C7JA 2KRFA 1T0FA 2CSOA 1ZG5A 3WODF 1W7PB 3KCCA 1U78A 2NYXA 5CVRA 1T98A 3WTTC 1RUNA 2DLLA 5BOXA 2GIVA 3WGIA 2ZO4A 2DU9A 4FX0A 3F8NA 4ETSA 1O7LA 3B73A 1IUYA 1AOYA 3WTUC 3GUDA 4EJUA 4PGGA 4IVNA 3KEOA 5E1WA 2JTVA 1BJAA 1I6XA 4HA8A 4HBLA 2MH2A 5J6XA 1DDNA 2ZCWA 4HQMA 2V1DA 1S7OA 2YU3A 3F21A 3NEUA 5L3GA 1G3TA 2ZMEA 2E1NA 5FB2A 3WE2A 3E6DA 4JBAA 5HDNA 2HGCA 4HX7A 2JSCA 3IL2A 2BV6A 3HOTA 4AIHA 3QPHA 2A61A 1S8NA 1SAXA 2OQGA 2M8EA 1AWCA 1TW2A 5A2QK 1RI7A 2JZYA 3RPQA 2VT3A 3CUQA 4P55A 2FOKA 1OYWA 1F4KA 1QBJA 4ENKA 3N4MA 2MC3A 2Z99A 4I2OA 2ZMEB 3R4KA 4I0AA 4BH9A 1ONVA 3ROUA 3GW2A 4Y15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L3F A;  2HTS A;  3ULQ B;  4UV9 A;  2G9W A;  1O3T A;  5BS6 A;  1R58 A;  1XCB A;  3MFK A;  4YIF A;  2CQK A;  3CUQ B;  4XRF A;  4UV8 A;  5HDK A;  5CYV A;  4RS8 A;  1B9M A;  3N97 A;  3I5U A;  2BYV E;  2M45 A;  1UHM A;  3HIF A;  2M87 A;  3GFM A;  3E6B A;  3FXR A;  3S2W A;  5K1Y A;  3GFI A;  4DNC A;  2KJB A;  2VT2 A;  3VFZ A;  3U1D A;  2P5V A;  5DUI A;  3G73 A;  4BNC A;  1A04 A;  3J7A O;  4GYI A;  1ZLJ A;  1HW1 A;  2L54 A;  4HV5 A;  4U7B A;  4WCG A;  4ZZD A;  3RIR A;  2IA0 A;  2XAF A;  3GO5 A;  1IRG A;  2XUB A;  4I02 A;  4B09 A;  4KUM A;  2RV8 A;  1ON2 A;  4O5V A;  1BC7 C;  2EFN A;  1IXR C;  3WTY C;  4FHT A;  4OIN F;  1JHF A;  2HTJ A;  2UXX A;  2G7H A;  2QLZ A;  3CO7 C;  3BZ6 A;  2F5F A;  2JRT A;  2M1B A;  1G3S A;  4OMZ A;  1Q1H A;  1XB4 A;  1V4R A;  3J80 Z;  5ILS A;  2STW A;  2XAQ A;  3E97 A;  4D0P A;  3F23 A;  2DK8 A;  4EM2 A;  2HKO A;  2RDP A;  3ZMZ A;  1MJ9 A;  5DCM A;  2PFB A;  1P4X A;  1TLH B;  4MEY F;  1BI2 A;  5DEQ A;  4G6Q A;  5D5W B;  3ML6 A;  4LD5 A;  1O7F A;  4BYY A;  3CLO A;  1ZRF A;  3ELK A;  3WU1 B;  1ODD A;  4M72 A;  4HX4 A;  4FX4 A;  4NQW A;  3H92 A;  4PDK A;  2FXA A;  2K4B A;  1ZYR F;  3ZN0 A;  2HYG D;  2DW4 A;  1HQC A;  1ZAR A;  3CO6 C;  3VOD A;  5DCM B;  4YFX F;  3ZQ7 A;  3IRR A;  5ILU A;  2A6H F;  3BPX A;  3FX3 A;  1IF1 A;  1YTY A;  1UST A;  2Z3Y A;  4O6J A;  1R36 A;  4LLN A;  2QM3 A;  1K79 A;  1XSX A;  3F3X A;  4A6D A;  1FX7 A;  1U6G A;  5DV5 A;  3KP2 A;  5JR3 A;  2LF7 A;  3ECH A;  2P5L C;  1TTY A;  1ZLK A;  1DP7 P;  3T8R A;  3WGH A;  2EV0 A;  2R3S A;  1KQ0 A;  4Q4Z F;  2XHK A;  2FA5 A;  2V1X A;  3ZMV A;  4EV0 A;  1J59 A;  1QZZ A;  2CWE A;  5FD6 A;  4CO8 A;  4UNO A;  2XAJ A;  2ZNZ A;  2ZBK A;  2FNA A;  5LGN A;  3HRS A;  3JAM K;  1R5G A;  3GVA A;  2GWR A;  1JE8 A;  5JHU A;  3AAF A;  2X4H A;  1F9N A;  1ZRC A;  3R0A A;  3IHU A;  2FML A;  3P9I A;  1ULY A;  2A68 F;  4PCQ A;  5E1X A;  2WWY A;  2D1V A;  5D4S A;  1DUX C;  1NHA A;  2GQQ A;  2VE8 A;  2Y75 A;  3BJ6 A;  1LB2 A;  3JSP A;  3I53 A;  1ZRD A;  1E17 A;  2NRA C;  1Z91 A;  1MJA A;  3FMQ A;  2ESH A;  5JI6 A;  5DD4 A;  4LB6 B;  1XD7 A;  2ZKZ A;  2YSR A;  3WE3 A;  4UUV A;  2ESN A;  4HW0 A;  2DT5 A;  1O3S A;  1W4M A;  3WTZ A;  4B8X A;  3WGG A;  3MAJ A;  5IT9 Z;  2R7D A;  4EJO A;  3FHZ A;  4S05 A;  2RN7 A;  4PZJ A;  1YYV A;  4KIC A;  4RGU A;  4MEX F;  1BN5 A;  3BP8 A;  1SD5 A;  2FBK A;  2HR3 A;  3Q5F A;  5AIP A;  2VOP A;  3OOP A;  3DEU A;  3HSR A;  2IPQ X;  3KFW X;  2TDX A;  5D5U B;  2E1C A;  1YQA A;  2O03 A;  2MBF A;  1FNN A;  2DI3 A;  5LHH A;  2ZNY A;  3L00 A;  5CJ9 A;  3H3U A;  2O8X A;  3JW4 A;  4OIO F;  2MLK A;  5IT9 K;  4F7Z A;  1LVA A;  3RTR A;  3F8M A;  2VN2 A;  4HDU A;  5AIQ A;  2L01 A;  4IHS A;  2IVM A;  5HVQ C;  3JTG A;  5ED4 A;  2HDC A;  3DKW A;  5K5Q A;  2FRH A;  5BPD A;  4JQF A;  1YFH A;  2ACJ A;  4XLN F;  1W5T A;  5FLX K;  4KDP A;  3Q9S A;  4R8H A;  5AON A;  1PP8 F;  2GA1 A;  5LEK A;  1XSV A;  3KP7 A;  3QAH A;  2BE5 F;  4A0X A;  4HQE A;  3RYP A;  4ENJ A;  2ZFW A;  3CDH A;  2VBX A;  2VON A;  3T1B A;  1FYL A;  2XKO A;  1D5V A;  3R0J A;  1EH8 A;  1ZRE A;  4Y13 A;  4Q47 A;  4RB1 A;  1OR7 A;  4U88 A;  4GO1 A;  5HLH A;  3HTS B;  3M8F A;  4KN4 X;  1T39 A;  1TQI A;  4LLG F;  4CZZ A;  3RYR A;  1HBX G;  2FF4 A;  2W84 A;  3CUO A;  4AWX B;  4Y17 A;  1XGM A;  1IN8 A;  2O0Y A;  2C6Y A;  5HDG A;  4IJA A;  1XGS A;  1SFX A;  1XGO A;  2RQP A;  5ICF A;  3LAJ A;  4KMF A;  2D2W A;  3FXQ A;  3O6B B;  1UFM A;  3F8C A;  3MZH A;  1Z6T A;  1MD0 A;  1BIB A;  4HX8 A;  3D5L A;  4YFN F;  2EFW A;  2CGP A;  2EV6 A;  4CXF A;  4G9Y A;  3FMS A;  4RGS A;  3E5Q A;  3L09 A;  4EQQ A;  4U0Y A;  1QPM A;  1RZ4 A;  3WTX C;  2NNY A;  3GWZ A;  1TNT A;  3BRO A;  2EA2 A;  2E7W A;  1LEB A;  4MTE A;  2W24 A;  2ISZ A;  5D4R A;  3HSE A;  2VBW A;  4R79 A;  3LST A;  5E8I A;  1SFE A;  1FWZ A;  3R6S A;  4RB2 C;  2VXZ A;  3I59 A;  4WF2 A;  4CHU A;  1L3L A;  4A0Y A;  4UHT A;  2H09 A;  4G7O F;  3MZY A;  3L7W A;  1WSU A;  3QPT A;  3WU0 A;  1W7P D;  2EWN A;  2CYY A;  4KA4 A;  1QNT A;  3M1E A;  3RKX A;  4K2E A;  1GXP A;  1U3E M;  2IP2 A;  4MNU A;  1TQM A;  2OD5 A;  3MWM A;  3W6J B;  2EFP A;  2Y48 A;  4IRG A;  4U0W A;  1XN7 A;  1YO5 C;  3I59 B;  3ABT A;  4ZZL A;  4ZYD A;  1TW3 A;  1IN5 A;  3V7C A;  1S29 A;  5TJJ A;  2NS0 A;  2P6T A;  1J5Y A;  2J5P A;  1VTN C;  1OKR A;  4ESJ A;  2P8T A;  3V4G A;  1PDN C;  4PGH A;  3E5X A;  3QP6 A;  4WX9 A;  1BBY A;  3QU6 A;  3IKV A;  3ISP A;  1R5H A;  2B0L A;  1IZ1 A;  4KN7 X;  5LGU A;  5CVU A;  1RNL A;  4KMU X;  3I54 A;  2F2E A;  3K69 A;  1H0M A;  3KP4 A;  2FNP A;  5CVI A;  4KT5 C;  1YS6 A;  2E7X A;  4IRI A;  3TO9 A;  3JTH A;  2W85 A;  5H20 A;  4HLX A;  3HHH A;  3J81 Z;  1Z6R A;  4CGZ A;  4Z2Y A;  3P7N A;  4WWC A;  4N0B A;  3TO7 A;  5ICG A;  1TNS A;  3T0Y A;  1B9N A;  3V8K A;  3HHG A;  2GAU A;  3ABU A;  2RVC A;  3TO6 A;  5F1R A;  3E5U A;  3TOB A;  4EVI A;  1CF7 A;  1WRJ A;  3PFI A;  3W6K B;  1KQ9 A;  2KJC A;  3RDI A;  4G94 A;  2HYF A;  3ZMT A;  5LLQ A;  3TQN A;  1FP2 A;  3TKY A;  1YG2 A;  4KIG A;  4HLY A;  3F72 A;  4CDG A;  1P6R A;  3HRT A;  3Q9V A;  1R1T A;  1Y0U A;  4NB5 A;  1T38 A;  4EM1 A;  1FBS A;  4L5J A;  2V6C A;  1JXS A;  1OMI A;  2YX7 A;  1G3W A;  3J81 K;  3K9T A;  4BAY A;  4NHJ A;  2IW5 A;  2RC4 A;  2P5K A;  4LK0 F;  2XIG A;  1J0R A;  2HS5 A;  3ECO A;  4Q48 A;  2QZ8 A;  5LHI A;  3VOE A;  1S7A A;  1CF7 B;  3DPT A;  4YII A;  2DQL A;  2DO7 A;  1B4A A;  5LHG A;  3C1D A;  4KIF A;  3SQN A;  1R1U A;  2HOE A;  3D0S A;  2LSO A;  2CO5 A;  4AD9 A;  2HKX A;  3LA2 A;  4RAZ A;  3HSF A;  4RGX A;  2L02 A;  1SD6 A;  3K1M A;  1RIO H;  2DPU A;  1XDS A;  3J80 K;  1FYK A;  4MTD A;  2JPC A;  1MDM A;  4A6E A;  3SZT A;  1B59 A;  3FM3 A;  3I64 A;  4BHP A;  2V79 A;  5ERI A;  1W5S A;  2PMH A;  2AS5 F;  2K7L A;  1JGS A;  2DBB A;  2EK5 A;  2RGV A;  4LFU A;  3F8F A;  2XRO A;  4MGR A;  1J2X A;  4AVP A;  5ILV A;  1J75 A;  5DD8 A;  1FYM A;  4ON0 A;  1R22 A;  1YW8 A;  5DCF A;  4KFC A;  1E2X A;  2ISY A;  1XSD A;  1U2W A;  2Q2E A;  4G8X A;  4GYG A;  3E6C C;  3JSO A;  4OMY A;  1MDM B;  4ASN A;  3IWZ A;  3OV8 A;  2P4W A;  4QWQ A;  3HYI A;  1I1S A;  3LQQ A;  1GVJ A;  3LWF A;  5IT3 A;  2L3D A;  2QQB A;  3WG9 A;  2L4M A;  2QQ9 A;  4ENN A;  2PBI A;  3C18 A;  2EFO A;  3TDU C;  1G6N A;  2Q0O A;  3T5X A;  3LA3 A;  2PJP A;  5FGM A;  2W25 A;  3FF5 A;  4P5O A;  1EV7 A;  1Z9C A;  1WI9 A;  3RKW A;  1Z7U A;  4BQA A;  1HSJ A;  1XGN A;  2XRN A;  3K1N A;  2YX4 A;  4N9H A;  3HUG A;  1XMK A;  2XGX A;  4EGZ A;  2ELH A;  2JPB A;  2NNN A;  2KKO A;  1BI1 A;  1D8J A;  3GX4 X;  2HZT A;  4IXA A;  5KK1 A;  4N9I A;  1U5T C;  3F6V A;  1MJB A;  3DV8 A;  1K6O A;  3BWG A;  3EUH A;  2FU4 A;  4A0Z A;  1S3J A;  4OIQ F;  3BJO A;  1KYZ A;  2BEO A;  2JT1 A;  4A5M A;  4G7H F;  2OU2 A;  3WTW C;  2CG4 A;  4EMS A;  2F5D A;  3R60 A;  2R7F A;  1YW9 A;  5F64 A;  4L5I A;  1IN4 A;  3IKT A;  1FBU A;  2PG4 A;  4KNY A;  1BIA A;  3RI4 A;  1MZB A;  4M74 A;  5FD5 A;  5L3D A;  2CFX A;  1HW5 A;  2HWV A;  4RB3 C;  3PQK A;  1G4D A;  3KLN A;  5HS9 A;  3EDP A;  2F5E A;  2Y0M A;  3F22 A;  2IRF G;  1FLI A;  1BM9 A;  2H27 A;  3R61 A;  1EH6 A;  1HKQ A;  4OIP F;  3I0T A;  1GHC A;  3MEX A;  3GLX A;  5L3E A;  2PN6 A;  4ENM A;  4GXO A;  1QQI A;  5LEJ A;  4IPA A;  2OZ6 A;  4ESF A;  1KU9 A;  1KA8 A;  4L9J A;  2BBY A;  4M9X A;  3M7G A;  1DPR A;  2PQ8 A;  3LQR A;  4MQ9 F;  3KP6 A;  4M9S A;  5CVV A;  2F5C A;  3O2P E;  5E1Z B;  2A07 F;  2KIU A;  1X3U A;  1U8R A;  1I5Z A;  2MH9 A;  1ZN2 A;  1TBX A;  1WQ2 A;  2LKP A;  4KYW A;  1SMT A;  4M73 A;  2ADU A;  4I01 A;  2YR2 A;  1XMA A;  3GF2 A;  1YS7 A;  1L0O C;  5CVJ A;  3ZN1 A;  1ZGA A;  2W57 A;  2RNJ A;  1LJ9 A;  2M30 A;  2BGC A;  2FEZ A;  2M5W A;  1ZH5 A;  2H6B A;  4AIJ A;  1SMY F;  4ZH4 F;  5D8L B;  4ZYH A;  2Z9O A;  3C3W A;  4DQ2 A;  6PAX A;  2K4J A;  4HF0 A;  4LJZ F;  1LDD A;  4UVB A;  2ZXJ A;  5BPI A;  3G3Z A;  2DTR A;  2HEO A;  3DXJ F;  1IN6 A;  5FFZ A;  3F8B A;  2PMU A;  5TRD A;  4ZYE A;  2ZJ2 A;  5HLG A;  1R7J A;  3ERE D;  4WK8 F;  1SD7 A;  1T6S A;  4XBF A;  4L18 B;  4A2U A;  2FE3 A;  2LDU A;  1ZAO A;  1H9G A;  2VOO A;  2D45 A;  5JFR A;  4M9Z A;  1FPQ A;  3ZPL A;  3CTA A;  1FC3 A;  1Z1D A;  3FM5 A;  1STZ A;  5FFX A;  5H6R A;  4QLC U;  4EJV A;  4Q5S F;  3RJP A;  4U7D A;  4KIB A;  2GXG A;  5A2Q Z;  5HS8 A;  2VBY A;  3U2R A;  1O3R A;  4UXN A;  3GYH X;  4P9F A;  1YW7 A;  5LRS A;  4M6Y A;  4HZF A;  5E8G A;  5J8C A;  2V1U A;  1BI0 A;  1IRF A;  3EQL F;  1R1V A;  4MQV A;  3V7S A;  2AXL A;  3K2Z A;  1ZG1 A;  2WC2 A;  2XKP A;  4EM0 B;  4I09 A;  3GXO A;  3PQJ A;  1UCR A;  2ETH A;  4RB0 A;  3DF8 A;  2P7V B;  3QU3 A;  2G7U A;  5E17 F;  2HFH A;  2O3F A;  2Q8K A;  4HV6 A;  1XCV A;  3L2C A;  1O3Q A;  5D8K B;  2EA4 A;  3SXY A;  4GGG A;  1FOK A;  2XVC A;  5ICE A;  1PP7 U;  3EYI A;  3EET A;  5LGT A;  4AIK A;  4YFK F;  3P9C A;  4LLL A;  3TGN A;  3HRU A;  3P9K A;  3LFK A;  2MA3 A;  4G7Z F;  2DQR A;  4LMY A;  3T8T A;  4FT8 A;  4IF4 A;  3LAP A;  3DPL C;  4WXC A;  3KP5 A;  3V7R A;  1OYI A;  1F1Z A;  4LB5 A;  1ZGJ A;  4XSX F;  1OPC A;  1QO0 D;  1LNW A;  2OZU A;  2OQR A;  2EFQ A;  2LF8 A;  3HRM A;  2LNB A;  1IW7 F;  1SFU A;  1KYW A;  1FZP B;  2O6G E;  2VBZ A;  1HKT A;  5D5V B;  2QUF A;  3H3Z A;  3KET A;  3KLO A;  2DAO A;  3KE2 A;  3TDZ C;  4L0Y B;  3CUQ C;  3NQO A;  4GCV A;  1WKM A;  2A5Y B;  5LBQ A;  3GZ5 A;  3QP5 A;  3VB2 A;  5BQT A;  2VC1 A;  4M6X A;  1FBQ A;  1BOA A;  3WTV C;  1I27 A;  3KEQ A;  2VE9 A;  4L0Z B;  3KZY A;  1T2K A;  4BHC A;  3GZ6 A;  5HOO A;  2IA2 A;  2CW0 F;  3RPU A;  2OA4 A;  2P7C B;  3GFL A;  1GXQ A;  1FT9 A;  1UB9 A;  1FSE A;  1D8K A;  1R23 A;  1JHH A;  3V8J A;  1LQ1 A;  1Z05 A;  3KZZ A;  5L3C A;  4HAM A;  2DFI A;  5EEG A;  2UXN A;  3DQV C;  2H94 A;  2QWW A;  1J9I A;  2K86 A;  3REO A;  2X0L A;  2Z33 A;  3SZP A;  1EH7 A;  3ZMU A;  2DK5 A;  5DUK A;  4A5N A;  5E20 A;  4L9T A;  2RKH A;  1PUE E;  4H0E A;  2H6C A;  4EJT A;  5DYM A;  1WWX A;  3FZV A;  4YG2 F;  3BOQ A;  1V3F A;  1FY7 A;  5F6F A;  3I58 A;  1IXC A;  1KQ8 A;  3RKY A;  4L9N A;  1ZHF A;  2GZW A;  1C0W A;  4BXU A;  1K78 A;  3B02 A;  2MD5 A;  2WTE A;  2PLY A;  3COA C;  3GEZ A;  2QVO A;  2IA1 A;  4I98 B;  4XSZ F;  2FQ3 A;  1J7K A;  3M8E A;  2FBH A;  3O3K A;  3FMR A;  2O61 A;  2KIF A;  3E3V A;  4L9V A;  4G6D A;  1TQP A;  3V8L A;  2D1H A;  4HYE A;  1U5T A;  2QYO A;  3NRV A;  3IC7 A;  5E18 F;  2UZK A;  1K78 B;  4E70 A;  1LDJ A;  3KP3 A;  3JAM Z;  2YPR A;  2VC0 A;  1KGS A;  4TV7 A;  2A6E F;  4R1H A;  3QRF F;  3CJN A;  1HST A;  1CGP A;  4CIC A;  5D6E A;  4OU0 A;  1BI3 A;  3MCZ A;  4P96 A;  1B6A A;  4MHG A;  1P92 A;  5JVT A;  4OIR F;  2HQN A;  1ZG3 A;  4IHT A;  3TOA A;  4RGR A;  1LDK B;  1U5T B;  1YLF A;  1B1B A;  5L3B A;  5BMZ A;  5DDG A;  1BC8 C;  1KU3 A;  2DPD A;  5J8F A;  5ICC A;  1IXS B;  3BY6 A;  1FSH A;  2EJR A;  3I4P A;  1G3Y A;  4CYD A;  1R00 A;  2COM A;  3I71 A;  4OOI A;  1KU7 A;  3ZP5 A;  3IWF A;  3MQ0 A;  4HDV A;  2STT A;  4IRH A;  1IAW A;  3LA7 A;  2IJL A;  3BPV A;  3FXU A;  2Z5U A;  1MGT A;  1HW2 A;  2KIM A;  4I0B A;  1REP C;  3E6M A;  3FWE A;  4HOB A;  3SHF A;  3ZMS A;  4UVC A;  5LRR A;  1HXD A;  2PI0 A;  5CLS A;  3BJA A;  4I7H A;  2V9V A;  3SFZ A;  4S04 A;  3EYY A;  1P4A A;  2GXB A;  1P2F A;  3L9F A;  2QQA A;  4M71 A;  2FBI A;  2XAG A;  5EEH A;  4EGY A;  5D6F A;  1XDU A;  3F6O A;  1F5T A;  4LK1 F;  2OBP A;  3WTS C;  2PEX A;  3M9A A;  2FMY A;  2K27 A;  2EB7 A;  3ZMD A;  4P9U A;  3DFG A;  2IT0 A;  2VOD A;  4WXD A;  3QOP A;  2EV5 A;  3HTU A;  4BHB A;  1YIO A;  4WXH A;  1OYY A;  5FLX Z;  4EJW A;  2P6S A;  1ON1 A;  3U9G A;  4HF2 A;  2WV0 A;  4JK1 X;  4U0V A;  1RUO A;  1UHW A;  5HS7 A;  5K5O A;  2L4A A;  3DP7 A;  2HQR A;  2QEN A;  1DPU A;  4LG0 A;  5H6Q A;  2QBY A;  3VEP A;  2A3S A;  1O57 A;  2XAH A;  2OAZ A;  2FSW A;  4LGW A;  1S6L A;  4ESB A;  1KU2 A;  3HOS A;  1D3Y A;  2XAS A;  1USS A;  1P4W A;  4UVA A;  5D5X B;  5HLI A;  2UWM A;  4XLP F;  2J5O A;  3IRQ A;  1QZY A;  1W7P A;  1FP1 D;  5FO5 A;  5KVR A;  4ZYG A;  1H9T A;  4HF1 A;  2MLG A;  1I1G A;  4LG0 B;  1HKS A;  1IN7 A;  2QBY B;  2A69 F;  1MKM A;  4A12 A;  2XV4 S;  3BDD A;  3GFJ A;  5K5R A;  1LEA A;  1SD4 A;  1QGP A;  4RAY A;  1K7A A;  2K02 A;  4O3M A;  2GA2 A;  3K0L A;  3K1P A;  2NAZ A;  3C7J A;  2KRF A;  1T0F A;  2CSO A;  1ZG5 A;  3WOD F;  1W7P B;  3KCC A;  1U78 A;  2NYX A;  5CVR A;  1T98 A;  3WTT C;  1RUN A;  2DLL A;  5BOX A;  2GIV A;  3WGI A;  2ZO4 A;  2DU9 A;  4FX0 A;  3F8N A;  4ETS A;  1O7L A;  3B73 A;  1IUY A;  1AOY A;  3WTU C;  3GUD A;  4EJU A;  4PGG A;  4IVN A;  3KEO A;  5E1W A;  2JTV A;  1BJA A;  1I6X A;  4HA8 A;  4HBL A;  2MH2 A;  5J6X A;  1DDN A;  2ZCW A;  4HQM A;  2V1D A;  1S7O A;  2YU3 A;  3F21 A;  3NEU A;  5L3G A;  1G3T A;  2ZME A;  2E1N A;  5FB2 A;  3WE2 A;  3E6D A;  4JBA A;  5HDN A;  2HGC A;  4HX7 A;  2JSC A;  3IL2 A;  2BV6 A;  3HOT A;  4AIH A;  3QPH A;  2A61 A;  1S8N A;  1SAX A;  2OQG A;  2M8E A;  1AWC A;  1TW2 A;  5A2Q K;  1RI7 A;  2JZY A;  3RPQ A;  2VT3 A;  3CUQ A;  4P55 A;  2FOK A;  1OYW A;  1F4K A;  1QBJ A;  4ENK A;  3N4M A;  2MC3 A;  2Z99 A;  4I2O A;  2ZME B;  3R4K A;  4I0A A;  4BH9 A;  1ONV A;  3ROU A;  3GW2 A;  4Y15 A; 
#chains in the Genus database with same CATH topology
 1FOY A;  4CYC B;  4BL0 B;  2F6C A;  5L3F A;  2HVQ A;  3IH3 A;  4BJ5 C;  1ITY A;  2HTS A;  3ULQ B;  3U21 A;  4S0H B;  1WJC A;  3K4K A;  4UV9 A;  2HDD A;  2G9W A;  3GTM J;  1O3T A;  3GLL A;  2EPF A;  2RQQ A;  2Y0S A;  5BS6 A;  3H0D A;  1R58 A;  4NBQ A;  2ZJR F;  1Y0N A;  1Z3X A;  1DGR M;  3GTP J;  1XCB A;  3MFK A;  3BR6 A;  4MLO A;  4YIF A;  2QEX I;  3CCU I;  3BR0 A;  2CQK A;  3CUQ B;  2DT6 A;  4UV8 A;  4XRF A;  5HDK A;  5CYV A;  2N8G A;  3S1N J;  4LIV A;  4RS8 A;  1B9M A;  4CCJ A;  3N97 A;  1EJ9 A;  3K4L A;  3I5U A;  3MKW B;  2BYV E;  1H8A C;  2M45 A;  1UHM A;  3HIF A;  2M87 A;  2HU9 A;  3BR3 A;  3GFM A;  2ID3 A;  3PUB A;  1W0U A;  3MVP A;  4Y52 J;  3E6B A;  3FXR A;  3A02 A;  3S2W A;  5K1Y A;  2B9S A;  2XF7 A;  3D1N I;  4CUG A;  2JA5 J;  3KPH A;  2HOT A;  3GFI A;  2MFZ A;  4DNC A;  2KJB A;  3QPS A;  1YX3 A;  2VT2 A;  3VFZ A;  3U1D A;  2P5V A;  2L0K A;  5DUI A;  2JA8 J;  3G73 A;  3OSF A;  4BNC A;  1B8I A;  1A04 A;  2QCO A;  3J7A O;  1I3A A;  4GYI A;  1ZLJ A;  1HW1 A;  2L54 A;  2NOG A;  2KZV A;  3LFU A;  3PIP F;  4HV5 A;  4FIS A;  4U7B A;  1R4M B;  2L9R A;  4WCG A;  4ZZD A;  1DU0 A;  3RIR A;  2IA0 A;  2XAF A;  2DA5 A;  4IOA F;  3GO5 A;  2Y9Y A;  1IRG A;  2XUB A;  4I02 A;  4B09 A;  3LL7 A;  4KUM A;  2RV8 A;  1ON2 A;  4O5V A;  1I3Q J;  3S16 J;  2NXN B;  2E71 A;  1BC7 C;  2EFN A;  2F5V A;  2BHZ A;  1IXR C;  3WTY C;  4FHT A;  2Y31 A;  1FMW A;  4OIN F;  3DKX A;  3ZCO A;  1JHF A;  5EGO A;  2HTJ A;  4AU7 A;  4RDU A;  3W2A A;  2UXX A;  1UZC A;  2G7H A;  2QLZ A;  3CF2 A;  2K3P A;  1DU6 A;  3CO7 C;  3BZ6 A;  3DTE A;  2F5F A;  2JRT A;  2YU9 J;  2DOD A;  4CCN A;  1JT0 A;  3CCL I;  2M1B A;  4ITV A;  1B8I B;  1G3S A;  4OMZ A;  1Q1H A;  1XB4 A;  5JLX A;  1S5L C;  1V4R A;  3J80 Z;  5ILS A;  2STW A;  2XAQ A;  3AG1 H;  3E97 A;  2WY8 Q;  4D0P A;  3F23 A;  2R7R A;  2DK8 A;  4EM2 A;  2HKO A;  2RDP A;  4I76 A;  3ZMZ A;  1X4P A;  1S7E A;  3HJE A;  1OCT C;  4FCY A;  2Z16 A;  1G59 A;  2O5R A;  1MJ9 A;  5DCM A;  1YHQ I;  1QU3 A;  2PFB A;  3M3Y J;  1OCZ H;  4E4H A;  1P4X A;  3SEQ A;  1TLH B;  4BQQ A;  5EGO B;  4MEY F;  3C2B A;  5FKL A;  1BI2 A;  2A05 A;  5DEQ A;  2WBM A;  2R7Q A;  4G6Q A;  5D5W B;  4BE0 A;  5EYR A;  3BQY A;  3ML6 A;  3BR5 A;  4HRI A;  4LD5 A;  1O7F A;  4YIR X;  3CME I;  1W36 C;  3RCO A;  4BYY A;  1OCC H;  3CLO A;  1ZRF A;  2W00 A;  2K9Q A;  3ELK A;  3OL4 A;  3HPG A;  1NK3 P;  3WU1 B;  1V55 H;  3FXM A;  1ODD A;  1WH5 A;  4M72 A;  3ROU A;  2O9L A;  1R6R A;  4ZDO A;  4HX4 A;  2ZJP F;  4FX4 A;  4NQW A;  3H92 A;  3JRE A;  1YRN A;  3TP3 A;  4PDK A;  2FXA A;  4BJ6 C;  2QQ8 A;  3L2U A;  5H2F C;  2K4B A;  1ZYR F;  1I39 A;  1WHU A;  5K7F A;  1NH3 A;  1IJW C;  1HDD C;  4XON A;  3ZN0 A;  2HYG D;  2WA0 A;  4D7M A;  5IP7 J;  2DW4 A;  2R5Y B;  1HQC A;  1ZAR A;  3CO6 C;  3VOD A;  3G4S I;  2DA2 A;  4KIS A;  5DCM B;  3WHB A;  4YFX F;  3RZD J;  3ZQ7 A;  3IRR A;  5ILU A;  2A6H F;  1ETO A;  5KHD A;  4ABZ A;  3BPX A;  3DBL B;  3FX3 A;  1A35 A;  1RES A;  2W1O A;  1W36 D;  1IF1 A;  1YTY A;  1UST A;  2Z3Y A;  1V5F A;  4O6J A;  1R36 A;  2W7N A;  2XRL A;  4LLN A;  3PNT A;  2QM3 A;  2X6O A;  2DOA A;  1K79 A;  1XSX A;  3F3X A;  3OYF A;  4HNV A;  5M5X J;  4M3F A;  1MNM C;  4MFE A;  4A6D A;  2K9N A;  2K9S A;  1FX7 A;  1TP4 A;  1U6G A;  1MND A;  4NQW B;  1YRN B;  5M5Y J;  5DV5 A;  3IH4 A;  3KP2 A;  4F91 B;  1LUJ B;  5JR3 A;  1VQN I;  2V26 A;  3UKG A;  2LF7 A;  3ECH A;  2AQF A;  2P5L C;  2HPI A;  1TTY A;  2KIQ A;  3NWS A;  1ZLK A;  1DP7 P;  2LKX A;  1A36 A;  3T8R A;  3WGH A;  1ZQ3 P;  4DIQ A;  2EV0 A;  2R7O A;  1D0Y A;  3OYG A;  1EF4 A;  4BUP A;  2R3S A;  2LD5 A;  1Y56 A;  4N4N B;  2ICW G;  1KQ0 A;  2X85 A;  4Q4Z F;  2XC7 A;  3S14 J;  3PO3 J;  4E7S A;  3S2D J;  2GIZ A;  2XHK A;  2FA5 A;  2QSG X;  2BY2 A;  2V1X A;  3ZMV A;  4EV0 A;  4HNT A;  2KHM A;  3DPU A;  1J59 A;  1WZ2 A;  1QZZ A;  2CWE A;  5FD6 A;  3HKZ A;  2KQR A;  3RQI A;  1MMG A;  3CF5 F;  1X2M A;  4C2M J;  3H5R A;  3ASO H;  4CO8 A;  3H9Q A;  4UNO A;  1AU7 A;  2NOJ B;  1O4X A;  2XAJ A;  2ZNZ A;  2ZBK A;  2FNA A;  1Y39 A;  5LGN A;  4M3G A;  1YJN I;  1OCR H;  3HRS A;  3JAM K;  2ZXH A;  2H8R A;  1R5G A;  3GVA A;  2GWR A;  2NVX J;  3K4J A;  1JE8 A;  5JHU A;  3AAF A;  2X4H A;  1F9N A;  1ZRC A;  4IHY A;  3R0A A;  3IHU A;  2FML A;  1RKW A;  3P9I A;  2CU7 A;  4ZYA A;  1ULY A;  2QSH X;  3CJT B;  2VIX A;  2A68 F;  4PCQ A;  2M34 A;  5E1X A;  2WWY A;  2E19 A;  4MFD A;  5LFA A;  2XSD C;  2D1V A;  5D4S A;  4E7H A;  5CPR B;  3PIO F;  1V54 H;  1DUX C;  1NHA A;  2GQQ A;  1W5C C;  4M3D A;  2DA3 A;  4UY8 I;  3LSK A;  4P1W A;  2VE8 A;  2Y75 A;  3BJ6 A;  4LIU A;  4HST A;  3I53 A;  3JSP A;  1LB2 A;  1ZRD A;  2XSJ C;  1E17 A;  2NRA C;  1IO2 A;  1Z91 A;  1NTC A;  2MAB A;  3I9V 2;  1MJA A;  3FXO A;  5J1R A;  2HOS A;  1J09 A;  3FMQ A;  2XF6 A;  3DBH B;  2L2O A;  4IKF A;  2ESH A;  2KDO A;  5JI6 A;  2M4K A;  5DD4 A;  4LB6 B;  3HM5 A;  1XD7 A;  2ZKZ A;  3QYF A;  2YSR A;  2UUZ A;  1GUU A;  2IXS A;  3WE3 A;  4UUV A;  3ESW B;  2ESN A;  4HW0 A;  3L2Q A;  3PSI A;  2DT5 A;  1O3S A;  3H1C A;  2M2E A;  1W4M A;  3WTZ A;  4B8X A;  3WGG A;  4BQN A;  3MAJ A;  5IT9 Z;  1GV5 A;  1T95 A;  3MN2 A;  2R7D A;  3H0G J;  1ORK A;  2JA2 A;  4EJO A;  2EQR A;  3FHZ A;  4S05 A;  2DT7 B;  2RN7 A;  4PZJ A;  2LFB A;  1YYV A;  2DJI A;  4KIC A;  4RGU A;  4MEX F;  1BN5 A;  3BP8 A;  4XMY A;  5F27 A;  1SD5 A;  2FBK A;  2HR3 A;  3Q5F A;  5AIP A;  5IYC J;  2VOP A;  3CP2 A;  3LSI A;  3OOP A;  3DEU A;  2HNH A;  3HSR A;  2IPQ X;  3KFW X;  2TDX A;  1F36 A;  2CQ7 A;  5D5U B;  2E1C A;  1YQA A;  2EZI A;  2MGQ A;  2M7A A;  2MBF A;  2O03 A;  1FNN A;  2DI3 A;  3G1O A;  5LHH A;  3H9J A;  2ZNY A;  3EUH C;  1LFU P;  1RC9 A;  4BE2 A;  4XLC A;  3L00 A;  1SAU A;  3PM1 A;  3VSL A;  5JLW A;  2X51 A;  4PSW A;  2DYR H;  3WHC A;  1V5E A;  2VAS A;  2DOE A;  5CJ9 A;  2FQ4 A;  3G71 I;  3H3U A;  3AL0 B;  2O8X A;  2I5U A;  1Z21 A;  1OQY A;  2XF5 A;  3JW4 A;  4OIO F;  3VYR B;  2MLK A;  4FQG A;  4FET A;  5HNH A;  3SEZ A;  4KIT B;  2R93 J;  1FIP A;  5IT9 K;  4F7Z A;  1LVA A;  3RTR A;  3F8M A;  1NK2 P;  2VN2 A;  2OCE A;  4HDU A;  5AIQ A;  3PSF A;  3NWT A;  3S2H J;  2L01 A;  4IHS A;  1MIJ A;  2IVM A;  2WB1 A;  5HVQ C;  1UG2 A;  2L7F P;  3ZR8 X;  5ED4 A;  3JTG A;  2HDC A;  4E7K A;  3DKW A;  3HOW J;  3S3M A;  5K5Q A;  2FRH A;  5BPD A;  4JQF A;  2X6W A;  5C3E J;  1YFH A;  2ACJ A;  2E5Z A;  4CH7 A;  2W48 A;  4XLN F;  3A03 A;  1K6Y A;  3KZI C;  2M7B A;  1W5T A;  5FLX K;  2VUM J;  2K5C A;  2I8D A;  3CES A;  3JR9 A;  3PNY A;  1D1B A;  4KDP A;  3Q9S A;  4R8H A;  5AON A;  4BY7 J;  1PP8 F;  2GA1 A;  2KRC A;  1XSV A;  3KP7 A;  5LEK A;  3TW6 A;  1FTZ A;  2DMT A;  3GCM A;  3QAH A;  5IYB J;  1EA3 A;  2BE5 F;  5J4V A;  4A0X A;  4HQE A;  3RYP A;  4ENJ A;  2OC6 A;  2ZFW A;  3CDH A;  2VBX A;  2ZXW H;  2VON A;  3T1B A;  1FYL A;  2XKO A;  1JKO C;  4B47 A;  4AVZ A;  1D5V A;  1MBE A;  3J7Y J;  4F92 B;  3R0J A;  2V1N A;  1EH8 A;  1KON A;  3DU6 A;  1ZRE A;  4GDF A;  4H4K C;  1A5J A;  5CKT A;  4Y13 A;  4Q47 A;  4RB1 A;  1N25 A;  3OYN A;  1OR7 A;  4U88 A;  4GO1 A;  5HLH A;  3GME A;  5DS9 A;  3HTS B;  2KP6 A;  3M8F A;  1JJ8 C;  4W1U A;  4KN4 X;  1T39 A;  1TQI A;  3EUK L;  4LLG F;  4CZZ A;  4A3G J;  3BG6 A;  3RYR A;  1HBX G;  2CQX A;  2FF4 A;  5E3O A;  2FUG 2;  1VQK I;  2ZJQ F;  2W84 A;  3OR1 C;  3CUO A;  4LOC A;  2HDW A;  4DYQ A;  1B72 A;  4AWX B;  3K2A A;  4Y17 A;  1XGM A;  1IN8 A;  4XKB A;  2O0Y A;  2C6Y A;  5HDG A;  3Q3S A;  1OJL A;  4IJA A;  1XGS A;  3OMY A;  1SFX A;  1XGO A;  2V7F A;  5EJC A;  2RQP A;  5ICF A;  1W1W E;  2CV2 A;  3LAJ A;  4KMF A;  4A3C J;  2D2W A;  3FXQ A;  1ERD A;  4HNU A;  4IX7 A;  3O6B B;  1UFM A;  3F8C A;  3MZH A;  1Z6T A;  2GOX B;  1MD0 A;  1BIB A;  4HX8 A;  2WV1 A;  3D5L A;  2MSY A;  2AHQ A;  2NS7 A;  4YFN F;  3I55 I;  2EFW A;  3I3L A;  2CGP A;  2EV6 A;  1Z67 A;  3ZQC A;  3IP4 B;  4CXF A;  4G9Y A;  3MD2 A;  2BY3 A;  2GOM A;  3FMS A;  3JRI A;  3CJR B;  4RGS A;  3S15 J;  2LBF A;  3E5Q A;  3L09 A;  3SDB A;  4EQQ A;  3CP8 A;  4U0Y A;  2E1M B;  1QPM A;  4OAY A;  3OIO A;  1RZ4 A;  2LG4 A;  3WTX C;  2NNY A;  3GWZ A;  2AO9 A;  4J19 A;  2K9M A;  1TNT A;  3BRO A;  2EA2 A;  1K61 A;  2E7W A;  1LEB A;  1Q1V A;  1XC5 A;  2NVQ J;  4MTE A;  2L7M P;  2W24 A;  3HG9 A;  1B72 B;  2V6E A;  2LMD A;  1JKQ C;  2ISZ A;  3HSE A;  5D4R A;  4B43 A;  2P0W A;  2VBW A;  4MO7 A;  2DMP A;  2DFH A;  4B48 A;  3LST A;  4B44 A;  1Y6I A;  4R79 A;  1VQM I;  2VPL A;  5E8I A;  1SFE A;  4Y4R A;  1FWZ A;  4E7J A;  4MIM A;  3R6S A;  3S8P A;  4RB2 C;  1JJ6 C;  4HG2 A;  2VXZ A;  5BNG A;  3I59 A;  4WF2 A;  4A3B J;  3A1Y A;  4XOR A;  3BCA A;  3BR1 A;  4CHU A;  1HDP A;  1L3L A;  4A0Y A;  4X6A J;  4UHT A;  1T0F C;  2H09 A;  3PUF A;  4G7O F;  3OYK A;  3DCF A;  3MZY A;  3L7W A;  1WSU A;  3QPT A;  2VQH A;  3WU0 A;  1W7P D;  2EWN A;  2CYY A;  4KA4 A;  2LBF B;  3HOY J;  1QNT A;  3DLL F;  2QGU A;  4NNJ A;  3M1E A;  5HNF A;  3RKX A;  1VQ6 I;  4K2E A;  3IAM 2;  1IRX A;  1SVL A;  1GXP A;  1DQU A;  1U3E M;  3ZQI A;  2IP2 A;  5FKM A;  3EUA A;  3K6G A;  4MNU A;  2V9P A;  1TQM A;  2OD5 A;  3CCV I;  4RLF A;  3MWM A;  3W6J B;  2EFP A;  2Y48 A;  3KYC B;  4IRG A;  3ERM A;  2CMP A;  1VND A;  2R0Q C;  1RPW A;  2YS9 A;  5E3M A;  3FXK A;  1RRJ A;  4U0W A;  2E2J J;  3BG3 A;  2ELJ A;  3BTC A;  5C4J J;  2JWT A;  4ZTF A;  1XN7 A;  1YO5 C;  3I59 B;  3ABT A;  4ZZL A;  4ZYD A;  1TW3 A;  1IN5 A;  3V7C A;  1S29 A;  2DJN A;  3OWT A;  3IH2 A;  1XG1 A;  4NC6 A;  1OCO H;  1KZH A;  5TJJ A;  2NS0 A;  3EPZ A;  1RR8 C;  5F1J A;  3TMO A;  1NG6 A;  1WJB A;  1J5Y A;  2J5P A;  2P6T A;  1XMX A;  4XN3 A;  1VTN C;  1OKR A;  4ESJ A;  2P8T A;  3I4M J;  4HPQ A;  3V4G A;  4DW6 A;  1PDN C;  4PGH A;  3VPR A;  3E5X A;  3QP6 A;  3CQZ J;  3FKJ A;  3HOZ J;  1TWF J;  4E7I A;  5IOY A;  3HPH A;  4WX9 A;  1BBY A;  3IV5 A;  3QU6 A;  4BJT A;  3IKV A;  3L2R A;  3ISP A;  4B4C A;  1I50 J;  1R5H A;  3BTL A;  5M3M J;  2B0L A;  3ZOB A;  1IZ1 A;  4KN7 X;  5LGU A;  5CVU A;  1RNL A;  2LY9 A;  1HC8 A;  3DBR B;  4IHV A;  2L7Z A;  4Z6Y A;  3CCE I;  2DOF A;  1WGX A;  3I54 A;  4KMU X;  2F2E A;  3CC2 I;  3K69 A;  1H0M A;  3HOU J;  3KP4 A;  2FNP A;  4I99 C;  5CVI A;  4KT5 C;  1YS6 A;  2E7X A;  5CQE A;  1MW7 A;  1X4O A;  4OAZ A;  4IRI A;  3TO9 A;  3JTH A;  2Z1D A;  5EEA A;  2W85 A;  4Y33 A;  2WAQ N;  2BY0 A;  2K3F A;  4HLX A;  5H20 A;  3JCU C;  3HHH A;  4XKC A;  5K7Z A;  1X1A A;  3J81 Z;  1MMD A;  1Z6R A;  3CZ6 A;  4CGZ A;  4Z2Y A;  3P7N A;  2DFE A;  1HA8 A;  4WWC A;  2DA6 A;  4N0B A;  4BXF A;  1BL0 A;  3TO7 A;  1UMQ A;  3ABK H;  4XRS A;  5ICG A;  1TNS A;  3T0Y A;  1B9N A;  2LRE A;  1UHS A;  3V8K A;  3HHG A;  3TL4 X;  3WU2 C;  2GAU A;  3ABU A;  2H1L A;  2RVC A;  3TO6 A;  1VQ8 I;  5F1R A;  5C44 J;  4BE1 A;  1XS9 A;  2NVT J;  2IAI A;  3E5U A;  3TOB A;  2BOL A;  4EVI A;  1CF7 A;  1WRJ A;  3PFI A;  1WJ5 A;  1H88 C;  3ZQF A;  2LK2 A;  5J1U A;  1MBG A;  3W6K B;  1WCM J;  4ZC3 A;  1KQ9 A;  2ECB A;  3LMM A;  3HBL A;  2KJC A;  5TIS C;  3RDI A;  2CW7 A;  4G94 A;  2HYF A;  2MD0 A;  4QTR A;  4KJZ A;  2E36 A;  3ZMT A;  3JRF A;  2VLA A;  5LLQ A;  3Q0U A;  3TQN A;  5KCM A;  1FP2 A;  2FD5 A;  1YG2 A;  2XGE A;  4KIG A;  3TKY A;  3ZRG A;  5J47 A;  4HLY A;  1IGN A;  3F72 A;  3TW7 A;  1P6R A;  3FK7 A;  3HRT A;  3Q9V A;  4CDG A;  3LSG A;  5GTH C;  1R1T A;  1Y0U A;  4NB5 A;  1T38 A;  4EM1 A;  4J01 A;  1FBS A;  4L5J A;  4DZJ A;  1PYV A;  2V6C A;  1JXS A;  1OMI A;  1IC8 A;  2YX7 A;  1JUP A;  3GTO J;  1G3W A;  3J81 K;  1T33 A;  3K9T A;  4BAY A;  4NHJ A;  2IW5 A;  2RC4 A;  2M8G X;  1PJR A;  2P5K A;  3M07 A;  4LK0 F;  3LSP A;  1SAN A;  2XIG A;  1J0R A;  2WAE A;  2HS5 A;  1A31 A;  3ECO A;  4Q48 A;  5GAG J;  3OS2 A;  4M3E A;  2QZ8 A;  5LHI A;  3VOE A;  1S7A A;  1CF7 B;  4JX6 A;  3DPT A;  1D5Y A;  4YII A;  3DTK A;  2DQL A;  1D1A A;  2AXT C;  2EH3 A;  2IS4 A;  2DYS H;  2DO7 A;  3ZQL A;  1B4A A;  5LHG A;  1VI0 A;  4F93 B;  3C1D A;  4KIF A;  3C2H A;  3SQN A;  1R1U A;  2E60 A;  2HOE A;  3D0S A;  2EZH A;  2EZK A;  4XR6 A;  2LSO A;  2CO5 A;  4AD9 A;  4DBR A;  5IP9 J;  2HKX A;  3LA2 A;  4BEH A;  3BG7 A;  4RAZ A;  3HSF A;  1K4T A;  4RGX A;  2L02 A;  1SD6 A;  3K1M A;  1RIO H;  4RAG A;  2PJR A;  2DPU A;  2HYJ A;  2OCC H;  3OY9 A;  1XDS A;  2JJ7 A;  1DP3 A;  4LIT A;  3J80 K;  2QF7 A;  1FYK A;  1WJD A;  4MTD A;  2JPC A;  4RM2 A;  1YIJ I;  1MDM A;  2V4J C;  3H9G A;  3K4C A;  4A6E A;  3SZT A;  5KAI C;  1B59 A;  3FM3 A;  1Z0X A;  3I64 A;  4A3E J;  4BHP A;  4BXX J;  2V79 A;  5ERI A;  1W5S A;  2PMH A;  2AS5 F;  1MBF A;  4YEJ A;  4X0G A;  3ONQ A;  2B7E A;  2K7L A;  1JGS A;  2DBB A;  1LPQ A;  1N78 A;  2EK5 A;  4A3L J;  5JHF A;  2RGV A;  2A6T A;  5B5E C;  3HOX J;  4U87 A;  3GTQ J;  1SVM A;  4LFU A;  3F8F A;  2KLO A;  2ME6 A;  3OYB A;  2E5N A;  3H5A A;  2XRO A;  4MGR A;  1J2X A;  4D7N A;  2KIS A;  4AVP A;  5ILV A;  3DEW A;  1J75 A;  3A4C A;  5DD8 A;  1FYM A;  3K70 C;  4ON0 A;  1R22 A;  2L7K A;  1YW8 A;  2L9N A;  2W82 A;  2E2H J;  5DCF A;  4XID A;  4KFC A;  4BEH B;  2QA4 I;  1E2X A;  2PJR B;  4II2 A;  2ISY A;  3RPU D;  2JRM A;  1XSD A;  1U2W A;  2Q2E A;  2O7O A;  4G8X A;  4GYG A;  3E6C C;  3JSO A;  3S1R J;  1ETX A;  4OMY A;  1MDM B;  3IWZ A;  3OV8 A;  4ASN A;  2P4W A;  4QWQ A;  3HYI A;  2VL8 A;  1I1S A;  1JT6 A;  3LQQ A;  1GVJ A;  3E0J B;  3LWF A;  5IT3 A;  2F4I A;  2L3D A;  2QQB A;  3WG9 A;  2H1K A;  2L4M A;  2VXD A;  2QQ9 A;  2IS1 A;  1MSE C;  4ENN A;  4L5E A;  2PBI A;  3C18 A;  4C30 A;  5IOZ A;  2CW8 A;  2EFO A;  2L9V A;  1Y8Q B;  3TDU C;  1G6N A;  2Q0O A;  2R7Z J;  3T5X A;  2KMU A;  3LA3 A;  2PJP A;  4A93 J;  2LP0 A;  5FGM A;  3M1C A;  2W25 A;  3K70 D;  3FF5 A;  2EIL H;  4P5O A;  1EV7 A;  1WVR A;  1Z9C A;  1WI9 A;  1PUF A;  3RKW A;  1LFB A;  1XTA A;  4XIC A;  1Z7U A;  4BQA A;  1FTT A;  1HSJ A;  1XGN A;  4YRV A;  2XRN A;  3K1N A;  2JA6 J;  3FBI B;  2YX4 A;  3FDY A;  4N9H A;  3HUG A;  1XMK A;  5FJ8 J;  2Q2E B;  2XGX A;  1QA6 A;  3H3V K;  2LOO A;  4EGZ A;  3BT9 A;  2ELH A;  2JPB A;  2NNN A;  5FKN A;  2KKO A;  5B66 C;  1BI1 A;  1D8J A;  4PJL A;  2F4O B;  2JN6 A;  3GX4 X;  3PO2 J;  2HZT A;  4IXA A;  2XAU A;  4UUS A;  2CH0 A;  5KK1 A;  4N9I A;  4W97 A;  3A01 A;  2M0M A;  1U5T C;  3F6V A;  4UB6 C;  3OYI A;  1YIT I;  3VWB A;  1MJB A;  5DTD A;  2BXY A;  1X1D A;  2EIK H;  2EIM H;  3A0H C;  3DV8 A;  3RZO J;  1K6O A;  3TP0 A;  4JOM A;  1TWA J;  3BWG A;  3EUH A;  2FU4 A;  1NG7 A;  4A0Z A;  1S3J A;  4OIQ F;  4G6T B;  1PUF B;  3BQZ A;  2R7X A;  3BJO A;  1KYZ A;  1T56 A;  2BEO A;  2JT1 A;  3ZQQ A;  4A5M A;  4G7H F;  1LVK A;  3HGG A;  2OU2 A;  3WTW C;  2CG4 A;  2K40 A;  4EMS A;  2DA1 A;  3CMA I;  1RR7 A;  2F5D A;  3TED A;  3R60 A;  2GBY A;  3HUG B;  2R7F A;  1YW9 A;  5F64 A;  4L5I A;  5FKK A;  1IN4 A;  2E34 A;  5M3F J;  3IKT A;  1FBU A;  1QHH D;  2PG4 A;  5FRO A;  4FTH A;  1JKP C;  4KNY A;  1BIA A;  3RI4 A;  4UUS B;  1MZB A;  1M1E B;  4M74 A;  4B3X A;  2VPR A;  5FD5 A;  5KAF C;  3A01 B;  2M0C A;  5L3D A;  2CFX A;  3X2Q H;  1HW5 A;  2HWV A;  4RB3 C;  3PQK A;  2LLK A;  1G4D A;  3KLN A;  5HS9 A;  3EDP A;  4D1Q A;  2F5E A;  2Y0M A;  3F22 A;  2K9L A;  3DTI A;  3OL3 A;  2IRF G;  2KFD A;  1FLI A;  1BM9 A;  2H27 A;  3R61 A;  4BBR J;  1EH6 A;  1G8X A;  3RKQ A;  2PMZ N;  2VQL A;  5J1Y A;  3UR3 C;  1HKQ A;  1WI3 A;  4EEF G;  4OIP F;  3I0T A;  3ZGK A;  1GHC A;  2CJJ A;  2HZD A;  3MEX A;  3GLX A;  2GXA A;  5L3E A;  3C2G A;  1A6Q A;  2R7V A;  2LVS A;  2PN6 A;  1MMA A;  4ENM A;  2OTJ I;  4GXO A;  3ZQH A;  4B1R A;  4F3Q A;  1QQI A;  3F0C A;  4PJM A;  3CMY A;  5LEJ A;  4C2U A;  2KDZ A;  3SZG A;  4IPA A;  3JRA A;  2OZ6 A;  3AG4 H;  4PJJ A;  4ESF A;  1KU9 A;  4IQ4 A;  1X1B A;  1KA8 A;  2F48 A;  4L9J A;  2BBY A;  4M9X A;  5EDN A;  1YJW I;  2Q1Z B;  3M7G A;  4C9Y A;  4IOC F;  1DPR A;  3HKZ N;  2PQ8 A;  3LQR A;  4MQ9 F;  3KP6 A;  2HVR A;  1FIA A;  2ECC A;  4M9S A;  3U1K A;  4G12 A;  5CVV A;  2F5C A;  3O2P E;  5E1Z B;  2R7W A;  4M6V A;  2A07 F;  2KIU A;  3BC8 A;  3GTJ J;  1X3U A;  1U8R A;  1I5Z A;  3PFY A;  2MH9 A;  1ZN2 A;  2Y9Z A;  1TBX A;  1WQ2 A;  5GTI C;  2LKP A;  2VJ5 A;  4KYW A;  4HEA 2;  1SMT A;  1E3P A;  3GTL J;  2XB0 X;  2ID6 A;  4M73 A;  4BS9 A;  1VFC A;  5GPA A;  5CQG A;  2ADU A;  4I01 A;  2QKM B;  2EIN H;  2YR2 A;  1ETK A;  3CJQ B;  1XMA A;  4IQJ A;  4RBO A;  3GF2 A;  1YS7 A;  2ZC2 A;  1MBH A;  1L0O C;  3IAS 2;  4BY1 J;  5CVJ A;  1HOM A;  2LYC A;  5F04 A;  4JX5 A;  1ZGA A;  3ZN1 A;  3OS0 A;  1X3Z B;  3LSR A;  2W57 A;  2RNJ A;  1LJ9 A;  2IS2 A;  3CCY A;  1Y1W J;  2CV0 A;  2M30 A;  2BGC A;  2FEZ A;  2IGK A;  2M5W A;  1ZH5 A;  3DKY A;  2H6B A;  2OUM A;  3G1L A;  3LSM A;  3OYJ A;  2DDA A;  4PFO A;  4AIJ A;  3DWL E;  2RRE A;  2DXI A;  3LSJ A;  3AG2 H;  3KIO A;  3OIP A;  1SMY F;  4ZH4 F;  3GZN B;  5D8L B;  3S17 J;  4ZYH A;  4IHX A;  1SFK A;  2Z9O A;  5F08 A;  2AQE A;  3C3W A;  4DQ2 A;  4Y3O A;  6PAX A;  2LY1 A;  2YUS A;  2Z2S B;  3CDL A;  2K4J A;  1BR4 A;  4HF0 A;  4LJZ F;  1LDD A;  1V5G A;  4UVB A;  1BA5 A;  2ZXJ A;  5BPI A;  3G3Z A;  3HGY A;  1F43 A;  4AYB N;  3Q0W A;  2DTR A;  2HEO A;  3DXJ F;  4A3I J;  1IN6 A;  1QPI A;  4PSX A;  5FFZ A;  1Z3Y A;  3F8B A;  2PMU A;  2E1O A;  3KYL A;  4ZYE A;  3WG7 H;  4NDL A;  2ZJ2 A;  5TRD A;  2WAD A;  1R7J A;  5HLG A;  3ERE D;  4XRM A;  1AA7 A;  2EBI A;  3GBG A;  5EF6 A;  4WK8 F;  1QVU A;  3OIQ A;  1SD7 A;  2R4G A;  1T6S A;  4XBF A;  5IYD J;  4L18 B;  4A2U A;  2FE3 A;  2LR8 A;  2MC4 A;  1BR2 A;  2LDU A;  1ZAO A;  1JUS A;  1JGG A;  1H9G A;  3B6A A;  2VOO A;  2D45 A;  5JFR A;  2DFF A;  3LSH A;  4M9Z A;  1FPQ A;  3CCR I;  3ZPL A;  3CTA A;  1CQT A;  1ZGW A;  4QPO A;  3BR2 A;  1FC3 A;  3W3C A;  1Z1D A;  3FM5 A;  1STZ A;  5FFX A;  5H6R A;  4QLC U;  4A3K J;  4EJV A;  4Q5S F;  3RJP A;  4KT6 A;  4U7D A;  4KIB A;  2OTL I;  2GXG A;  2QKL B;  5A2Q Z;  3CC4 I;  5HS8 A;  2VBY A;  3U2R A;  1O3R A;  3CCS I;  4UXN A;  3GYH X;  4P9F A;  1T08 B;  2L9S A;  5JVG F;  1YW7 A;  5LRS A;  3H35 A;  4M6Y A;  4HZF A;  1TWH J;  5E8G A;  5J8C A;  3CMM A;  2V1U A;  4BBS J;  1P7J A;  1BI0 A;  2WAQ A;  1IRF A;  3EQL F;  2XPW A;  4DBQ A;  1R1V A;  4MQV A;  3FHN A;  3DLA A;  3V7S A;  2ME0 A;  2AXL A;  3OYL A;  3K2Z A;  4QIW N;  1ZG1 A;  2WC2 A;  2XKP A;  3BTJ A;  4EM0 B;  4I09 A;  3ZQG A;  3GXO A;  3PQJ A;  3HDD A;  4DYR A;  1BW5 A;  4CCM A;  1POG A;  1IV8 A;  1UCR A;  3PJR A;  2XPU A;  3K4B A;  3K4M A;  2XDV A;  4V2G A;  2ETH A;  4RB0 A;  2COB A;  3DF8 A;  2P7V B;  3QU3 A;  2G7U A;  5E17 F;  2EIJ H;  2HFH A;  2O3F A;  1FOW A;  2Q8K A;  1ZTR A;  3OR2 C;  4HV6 A;  1XCV A;  1E3O C;  3L2C A;  1O3Q A;  1BR1 A;  5IY5 H;  2F4M B;  1H89 C;  5D8K B;  2EA4 A;  3SXY A;  2E2I J;  4GGG A;  1FOK A;  2ZXI A;  3VYT B;  2XVC A;  5ICE A;  2R5Z A;  2D5V A;  2O8K A;  2VJ4 A;  1BOB A;  1PP7 U;  3EYI A;  3EET A;  3E1S A;  5LGT A;  4AIK A;  4YFK F;  3FXL A;  3P9C A;  1Y1V J;  4LLL A;  2GM4 A;  3TGN A;  4XKV A;  4EAT A;  5IPA A;  3HRU A;  1GDT A;  3P9K A;  5B1B H;  3J7A Y;  2Y30 A;  3LFK A;  2MA3 A;  4G7Z F;  2RNG A;  2LY2 A;  4D5F A;  5DM7 F;  2BHY A;  2DQR A;  2HI3 A;  3O8G A;  4LMY A;  3T8T A;  4FT8 A;  4IF4 A;  4BQO A;  1GV2 A;  3HXL A;  3LAP A;  3DPL C;  5LD2 C;  4RMN A;  4UB8 C;  3PL8 A;  1MBK A;  4WXC A;  3KP5 A;  3V7R A;  1S9H A;  2CQN A;  2JUC A;  1QVT A;  3OS1 A;  1OYI A;  1UEL B;  4N4O B;  3S32 A;  3KYD B;  1F1Z A;  3H5N A;  4LB5 A;  1ZGJ A;  2BVL A;  4XSX F;  1OPC A;  1QO0 D;  2LTP A;  1LNW A;  2OZU A;  3S1Q J;  2XB5 A;  1JUM A;  2OQR A;  4GFB A;  3JRB A;  1BW6 A;  2EFQ A;  2R5Z B;  2LF8 A;  3FIW A;  3HRM A;  1X2N A;  2LNB A;  1U9O A;  2M4G A;  1WJA A;  2ZME C;  1IW7 F;  4V2F A;  1SFU A;  2DCE A;  1R5I D;  1KYW A;  2MG4 A;  1X3W B;  1FZP B;  2O6G E;  2WAF A;  2VBZ A;  1HKT A;  9ANT A;  5D5V B;  1U9N A;  4PK4 A;  3MZ8 A;  1TT0 A;  3VDX A;  2QUF A;  3NAR A;  2JVH A;  1K83 J;  3H3Z A;  3KET A;  1YX5 A;  3KLO A;  1RET A;  2W4S A;  2DAO A;  1X1C A;  4JYK A;  3BCB A;  3KE2 A;  3TDZ C;  4L0Y B;  2A5W A;  3UNG C;  4JP0 A;  2XGC A;  2DMU A;  3A0B C;  1QRY A;  3CUQ C;  4IL6 C;  3NQO A;  4GCV A;  1WKM A;  2A5Y B;  5LBQ A;  3P5J A;  3ABM H;  3GZ5 A;  1X1P A;  2ELK A;  3QP5 A;  3L2V A;  3VB2 A;  5BQT A;  4C2T A;  1FMV A;  2VC1 A;  4CCL A;  4M6X A;  1FBQ A;  1HCR A;  1BOA A;  1IDY A;  1APL C;  4NUB A;  2QSF X;  5HLT A;  3WTV C;  3H36 A;  1AKH A;  1I27 A;  3KEQ A;  2VE9 A;  4L0Z B;  5EZG A;  3RQ4 A;  3KZY A;  1T2K A;  4BHC A;  3GZ6 A;  4II3 A;  5HOO A;  4BDZ A;  4GRI A;  2IA2 A;  2CW0 F;  4XLH A;  3RPU A;  2OA4 A;  2Y69 H;  2P7C B;  5GAH J;  3GFL A;  1GXQ A;  1FT9 A;  1ZR4 A;  1ETY A;  1UB9 A;  1FSE A;  4BDY A;  1IV6 A;  1D8K A;  1BJZ A;  3JRC A;  4M3B A;  1R23 A;  5GPC A;  1JHH A;  3V8J A;  1LQ1 A;  1Z05 A;  3KZZ A;  5L3C A;  4HAM A;  4E6K G;  2X1D A;  4RA2 A;  2JSP A;  4XKW A;  1SFO J;  1I6H J;  2DFI A;  1E3H A;  5EEG A;  4ZDP A;  2UXN A;  3DQV C;  2H94 A;  4CZC A;  1HLV A;  3N05 A;  2QWW A;  1J9I A;  1R4N B;  2K86 A;  3KX2 A;  3REO A;  2X0L A;  2Z33 A;  2X6Y A;  1HF0 A;  3SZP A;  1EH7 A;  3ZMU A;  1OFC X;  2DK5 A;  2TRT A;  5E3N A;  5DUK A;  4A5N A;  5E20 A;  3QPL A;  4JX4 A;  4L9T A;  3QYB A;  3HZJ A;  2RKH A;  1AKH B;  1X58 A;  1ETW A;  1N75 A;  2KL4 A;  1PUE E;  4H0E A;  3FBN B;  3G2B A;  3I4N J;  2H6C A;  4RLQ A;  2R5Y A;  3K10 A;  4EJT A;  5DYM A;  2XPV A;  2Y0S N;  3FIS A;  3S3N A;  5DM6 F;  3CC7 I;  2VJJ A;  1WWX A;  3NAU A;  2FJ1 A;  3FZV A;  4YG2 F;  3BOQ A;  3CCQ I;  1V3F A;  1FY7 A;  5F6F A;  3A2K A;  3I58 A;  3S93 A;  1IXC A;  2DDB A;  1KQ8 A;  3RKY A;  1TL8 A;  2HPM A;  1VQL I;  1UAA A;  4L9N A;  1ZHF A;  2GZW A;  1C0W A;  1ZK8 A;  4BXU A;  1K78 A;  3B02 A;  2MD5 A;  2WTE A;  2TCT A;  2PLY A;  2CRG A;  3COA C;  2VQC A;  3D5S C;  3GEZ A;  2QVO A;  2RAE A;  2IA1 A;  2VKD A;  4I98 B;  2CS3 A;  1N77 A;  4XSZ F;  2OPT A;  2CV1 A;  3BZK A;  4XNF A;  2FQ3 A;  1J7K A;  3M8E A;  3O8H A;  2FBH A;  3I56 I;  3O3K A;  1VQ9 I;  2JQ7 A;  3RSN A;  3FMR A;  2O61 A;  2BW3 A;  2KIF A;  3JRG A;  3E3V A;  1ENH A;  1RKT A;  4L9V A;  3HC7 A;  4G6D A;  1YJ9 I;  3J7Z I;  2ZSH B;  1TQP A;  1TT5 B;  3V8L A;  1VQO I;  1WH7 A;  2D1H A;  1SVO A;  4HYE A;  1U5T A;  2QYO A;  3NRV A;  3IC7 A;  2BXZ A;  1U8B A;  5E18 F;  2UZK A;  1K78 B;  4E70 A;  1LDJ A;  2VKV A;  3L2W A;  3VYU B;  3KP3 A;  2V9K A;  3JAM Z;  2YPR A;  4AC0 A;  2VC0 A;  3HL2 A;  1KGS A;  4TV7 A;  4D5C A;  2A6E F;  2VKH A;  4R1H A;  1JI8 A;  3QRF F;  2PMZ A;  2H8W A;  3CJN A;  3D5R C;  1HST A;  4I6Z A;  1CGP A;  4CIC A;  5D6E A;  4OU0 A;  1BI3 A;  4OWR B;  3MCZ A;  4P96 A;  1B6A A;  4MHG A;  1P92 A;  2X9D A;  5JVT A;  4OIR F;  2HQN A;  2BW3 B;  1ZG3 A;  4IHT A;  4AM3 A;  1MMS A;  2LRD A;  3TOA A;  3QOD A;  5F0H A;  2IGM A;  4RGR A;  3QQA A;  1UJ8 A;  5FKO A;  1LDK B;  3SYT A;  1U5T B;  1YLF A;  1B1B A;  3M4O J;  3OOU A;  5L3B A;  1LE8 A;  5BMZ A;  5DDG A;  1BC8 C;  2IBD A;  3BTI A;  1KU3 A;  3QOE A;  4CSW A;  4A3J J;  2DPD A;  5J8F A;  2VKE A;  2K85 A;  5ICC A;  1P7I A;  2CUE A;  1IXS B;  3BY6 A;  2ZB9 A;  3AFH A;  1S72 I;  1FSH A;  2EJR A;  3I4P A;  1G3Y A;  2X1E A;  4CYD A;  3W2V A;  5HOD A;  4ZJZ A;  3AKZ A;  4J00 A;  1WJF A;  1R00 A;  4PJN A;  1UG0 A;  4XOT A;  2COM A;  1ACI A;  4V19 K;  4BKX A;  3I71 A;  4OOI A;  2DN0 A;  1IUF A;  3HB9 A;  1KU7 A;  1VZ0 A;  3ZP5 A;  3IWF A;  3MQ0 A;  4HDV A;  1XX5 A;  3ABL H;  2STT A;  4IRH A;  1IAW A;  3DU5 A;  3LA7 A;  4FE7 A;  1VQP I;  2IJL A;  5FLV A;  1GVD A;  3BPV A;  3FXU A;  2M3A A;  2Z5U A;  4A69 C;  1MGT A;  4BAC A;  1HW2 A;  1YOV B;  2KT0 A;  3CDI A;  2KIM A;  4I0B A;  1TZL A;  2LC2 A;  4BU2 A;  1REP C;  1X19 A;  3BLY A;  3E6M A;  3FWE A;  4HOB A;  4IHW A;  3SHF A;  1LE8 B;  2OJE D;  3ZMS A;  4UVC A;  5LRR A;  1HXD A;  4C3I J;  2PI0 A;  5CLS A;  2DMN A;  4XN0 A;  1W0T A;  3BJA A;  4I7H A;  2V9V A;  3SFZ A;  4S04 A;  1E0E A;  4A3M J;  3MMY B;  4ANJ A;  3EYY A;  1P4A A;  3G1M A;  3QYE A;  2B63 J;  3TBI A;  4E7L A;  2GXB A;  2M9H A;  4F52 A;  3CD6 I;  4CA0 A;  4DOZ A;  1P2F A;  4DJA A;  5F0C A;  1P9Q C;  3L9F A;  3L1P A;  2QQA A;  3BZC A;  4M71 A;  4B3A A;  5IP6 A;  2FBI A;  2XAG A;  5EEH A;  4EGY A;  5D6F A;  3ZXS A;  4E7Z A;  3S1M J;  2DMQ A;  1XDU A;  4AYB A;  4IEJ A;  4BGD A;  3F6O A;  1OIS A;  2IS6 A;  2DTZ A;  1F5T A;  4LK1 F;  2NVU B;  1R49 A;  5FLM J;  3M8J A;  2KPM A;  1PVE A;  2OBP A;  2EZL A;  4PFP A;  4XLF A;  4AID A;  3WTS C;  2PEX A;  3M9A A;  4A3D J;  2FMY A;  4CCK A;  4XQF A;  3OYH A;  1SC7 A;  1A6I A;  2K27 A;  4XK4 A;  2EB7 A;  3ZMD A;  2X1C A;  1FJL A;  2R7S A;  2GLO A;  4AUX A;  4P9U A;  3KEY A;  1XPX A;  1MBJ A;  3FXJ A;  3DFG A;  3JRH A;  2IGO A;  3MKZ A;  2IT0 A;  2VOD A;  1IRZ A;  1FEX A;  3SDG A;  4WXD A;  2LKS A;  3QOP A;  3VSK A;  2EV5 A;  3HTU A;  5E79 C;  4BHB A;  1VQ7 I;  1YIO A;  4WXH A;  3ASN H;  3SJM A;  1OYY A;  5FLX Z;  2XGD A;  2L5Q A;  4FAS D;  1TC3 C;  2PX9 A;  2HXI A;  3PNV A;  5GAE J;  3FKI J;  3LNQ A;  2JA7 J;  2G0E A;  4EJW A;  2P6S A;  5GP9 A;  1ON1 A;  3U9G A;  4HF2 A;  1QZE A;  1IG7 A;  2JVG A;  2WV0 A;  4JK1 X;  4U0V A;  1SEU A;  3QWL A;  2R92 J;  2OV7 A;  1RUO A;  1UHW A;  5HS7 A;  5K5O A;  2BY1 A;  2L4A A;  3DP7 A;  2HQR A;  2QEN A;  5FRM A;  2JUG A;  3AG3 H;  1DPU A;  3CCJ I;  4LG0 A;  2UV1 A;  3BG5 A;  5H6Q A;  2FX0 A;  3OYE A;  2QBY A;  3VEP A;  2A3S A;  3HEF A;  1O57 A;  2XAH A;  2MYS A;  2OAZ A;  4UUT A;  2FSW A;  2VI6 A;  4RM3 A;  4LGW A;  1S6L A;  4D9J A;  3FK6 A;  2E35 A;  1DGW Y;  4ESB A;  4CCO A;  4ZTJ A;  1KU2 A;  3GTK J;  4A3F J;  3HOS A;  3AL0 C;  1YE9 A;  1D3Y A;  3BG9 A;  2XAS A;  1USS A;  5FRN A;  3IUO A;  1P4W A;  4UVA A;  1GT0 C;  5D5X B;  5HLI A;  1Y8R B;  4XLE A;  4Y7N J;  2UWM A;  5B1A H;  4XLP F;  2J5O A;  5EG0 A;  3IRQ A;  3K7A J;  4F55 A;  1QZY A;  1AHD P;  1W7P A;  1FP1 D;  5FO5 A;  5KVR A;  2Y2Z A;  4ZYG A;  1H9T A;  3OYM A;  4HF1 A;  2BVM A;  2CUZ A;  3W6V A;  1MH4 A;  2MLG A;  1I1G A;  2IGN A;  2CQQ A;  1MMN A;  5K7H A;  4LG0 B;  1WJE A;  3CLQ A;  1HKS A;  4QSH A;  2X48 A;  1U0J A;  1K4S A;  1IN7 A;  1EKE A;  2QBY B;  2A69 F;  4PUS A;  1MKM A;  4NC8 A;  1D1C A;  2P81 A;  4DGW B;  5B3S H;  2CUF A;  4A12 A;  2XV4 S;  3BDD A;  4IO9 F;  2VB6 A;  3GFJ A;  5K5R A;  1LEA A;  1SD4 A;  1QGP A;  4RAY A;  5M5W J;  2K02 A;  2CFO A;  2GA2 A;  1K7A A;  4O3M A;  2R7T A;  3K0L A;  3K1P A;  4FE4 A;  5J3L A;  2NAZ A;  3C7J A;  2X6X A;  4DYC A;  1TWG J;  2CUJ A;  2KRF A;  1T0F A;  2IEK A;  1LKX A;  2I10 A;  4NC7 A;  5J40 A;  4DZP A;  4XLA A;  2CSO A;  3DEE A;  4ZDL A;  1ZG5 A;  5C4X J;  5EG0 B;  1YI2 I;  3WOD F;  1W7P B;  3KCC A;  1VF9 A;  1U78 A;  5EZH A;  1JKR C;  2NYX A;  5CVR A;  1T98 A;  1WPK A;  1OLT A;  2VJI A;  3WTT C;  1QHG A;  1RUN A;  3G6E I;  3OYC A;  1ZR2 A;  1GLN A;  2DLL A;  5BOX A;  2GIV A;  3WGI A;  2BZT A;  2ZO4 A;  3HOV J;  2DU9 A;  4FX0 A;  3F8N A;  4ETS A;  1O7L A;  3B73 A;  5GAD J;  1IUY A;  3CCM I;  4PJ0 C;  2DA7 A;  1G2H A;  3V42 A;  1IDZ A;  2LH9 A;  2HOA A;  1AOY A;  2FOW A;  3WTU C;  2R7U A;  2KRH A;  3GUD A;  1WFX A;  2MW8 A;  4XL9 A;  1ZEL A;  4EJU A;  4C3H J;  4XOP A;  4PGG A;  4IVN A;  3KEO A;  1T8I A;  5E1W A;  3SFI A;  5E3L A;  2JTV A;  1FOX A;  1BJA A;  1D0X A;  1TWC J;  3MKY B;  1I6X A;  4HA8 A;  4X1E A;  1JTY A;  1LFP A;  4HBL A;  2MH2 A;  4YEL A;  2VQG A;  5J6X A;  1DDN A;  2ZCW A;  3LOC A;  1Z77 A;  4HQM A;  2V1D A;  3S3O A;  1S7O A;  1R9T J;  2NS8 A;  2YU3 A;  3B6C A;  3F21 A;  1R71 A;  4C3J J;  3NEU A;  4XM3 A;  4XRS G;  1G3T A;  5L3G A;  5F0F A;  5J4Y A;  2ZME A;  2WB1 N;  2E1N A;  1ETQ A;  1OCP A;  5FB2 A;  4HSR A;  5TGT A;  2HQ5 A;  1MSF C;  2WY7 Q;  4CYC A;  2KZG A;  2ZFU A;  3OYA A;  3E6D A;  3WE2 A;  4JBA A;  5HDN A;  2HGC A;  1OR7 C;  3W2W A;  5KNL A;  4HX7 A;  2JSC A;  3IL2 A;  2BV6 A;  3MKL A;  3HOT A;  4IZZ A;  4AIH A;  1D0Z A;  2E1M C;  3QPH A;  2A61 A;  2HQA A;  1S8N A;  2HXO A;  4RAF A;  3JRD A;  2ZSI B;  1SAX A;  2OQG A;  2M8E A;  1AWC A;  1TW2 A;  5A2Q K;  2HVS A;  1ZKG A;  2DA4 A;  1RI7 A;  1VQ5 I;  2JZY A;  3GTG J;  3RPQ A;  1ETV A;  2VT3 A;  3Q0V A;  3CUQ A;  1MH3 A;  2OF7 A;  4P55 A;  2FOK A;  3E7L A;  3VYS B;  1OYW A;  4QPQ A;  1VQ4 I;  3F9K A;  1MNE A;  1F4K A;  1QBJ A;  1Z7L A;  2JMW A;  2JK3 A;  4ENK A;  3N4M A;  2MC3 A;  2Z99 A;  4I2O A;  3OSG A;  2ZME B;  3R4K A;  3OYD A;  4I0A A;  4LG3 A;  4BH9 A;  1JTX A;  1ONV A;  3K4N A;  2NVY J;  3GW2 A;  4Y15 A; 
#chains in the Genus database with same CATH homology
 5L3F A;  2HTS A;  3ULQ B;  4UV9 A;  2G9W A;  1O3T A;  5BS6 A;  1R58 A;  1XCB A;  3MFK A;  4YIF A;  2CQK A;  3CUQ B;  4XRF A;  4UV8 A;  5HDK A;  5CYV A;  4RS8 A;  1B9M A;  3N97 A;  3I5U A;  2BYV E;  2M45 A;  1UHM A;  3HIF A;  2M87 A;  3GFM A;  3E6B A;  3FXR A;  3S2W A;  5K1Y A;  3GFI A;  4DNC A;  2KJB A;  2VT2 A;  3VFZ A;  3U1D A;  2P5V A;  5DUI A;  3G73 A;  4BNC A;  1A04 A;  3J7A O;  4GYI A;  1ZLJ A;  1HW1 A;  2L54 A;  4HV5 A;  4U7B A;  4WCG A;  4ZZD A;  3RIR A;  2IA0 A;  2XAF A;  3GO5 A;  1IRG A;  2XUB A;  4I02 A;  4B09 A;  4KUM A;  2RV8 A;  1ON2 A;  4O5V A;  1BC7 C;  2EFN A;  1IXR C;  3WTY C;  4FHT A;  4OIN F;  1JHF A;  2HTJ A;  2UXX A;  2G7H A;  2QLZ A;  3CO7 C;  3BZ6 A;  2F5F A;  2JRT A;  2M1B A;  1G3S A;  4OMZ A;  1Q1H A;  1XB4 A;  1V4R A;  3J80 Z;  5ILS A;  2STW A;  2XAQ A;  3E97 A;  4D0P A;  3F23 A;  2DK8 A;  4EM2 A;  2HKO A;  2RDP A;  3ZMZ A;  1MJ9 A;  5DCM A;  2PFB A;  1P4X A;  1TLH B;  4MEY F;  1BI2 A;  5DEQ A;  4G6Q A;  5D5W B;  3ML6 A;  4LD5 A;  1O7F A;  4BYY A;  3CLO A;  1ZRF A;  3ELK A;  3WU1 B;  1ODD A;  4M72 A;  4HX4 A;  4FX4 A;  4NQW A;  3H92 A;  4PDK A;  2FXA A;  2K4B A;  1ZYR F;  3ZN0 A;  2HYG D;  2DW4 A;  1HQC A;  1ZAR A;  3CO6 C;  3VOD A;  5DCM B;  4YFX F;  3ZQ7 A;  3IRR A;  5ILU A;  2A6H F;  3BPX A;  3FX3 A;  1IF1 A;  1YTY A;  1UST A;  2Z3Y A;  4O6J A;  1R36 A;  4LLN A;  2QM3 A;  1K79 A;  1XSX A;  3F3X A;  4A6D A;  1FX7 A;  1U6G A;  5DV5 A;  3KP2 A;  5JR3 A;  2LF7 A;  3ECH A;  2P5L C;  1TTY A;  1ZLK A;  1DP7 P;  3T8R A;  3WGH A;  2EV0 A;  2R3S A;  1KQ0 A;  4Q4Z F;  2XHK A;  2FA5 A;  2V1X A;  3ZMV A;  4EV0 A;  1J59 A;  1QZZ A;  2CWE A;  5FD6 A;  4CO8 A;  4UNO A;  2XAJ A;  2ZNZ A;  2ZBK A;  2FNA A;  5LGN A;  3HRS A;  3JAM K;  1R5G A;  3GVA A;  2GWR A;  1JE8 A;  5JHU A;  3AAF A;  2X4H A;  1F9N A;  1ZRC A;  3R0A A;  3IHU A;  2FML A;  3P9I A;  1ULY A;  2A68 F;  4PCQ A;  5E1X A;  2WWY A;  2D1V A;  5D4S A;  1DUX C;  1NHA A;  2GQQ A;  2VE8 A;  2Y75 A;  3BJ6 A;  1LB2 A;  3JSP A;  3I53 A;  1ZRD A;  1E17 A;  2NRA C;  1Z91 A;  1MJA A;  3FMQ A;  2ESH A;  5JI6 A;  5DD4 A;  4LB6 B;  1XD7 A;  2ZKZ A;  2YSR A;  3WE3 A;  4UUV A;  2ESN A;  4HW0 A;  2DT5 A;  1O3S A;  1W4M A;  3WTZ A;  4B8X A;  3WGG A;  3MAJ A;  5IT9 Z;  2R7D A;  4EJO A;  3FHZ A;  4S05 A;  2RN7 A;  4PZJ A;  1YYV A;  4KIC A;  4RGU A;  4MEX F;  1BN5 A;  3BP8 A;  1SD5 A;  2FBK A;  2HR3 A;  3Q5F A;  5AIP A;  2VOP A;  3OOP A;  3DEU A;  3HSR A;  2IPQ X;  3KFW X;  2TDX A;  5D5U B;  2E1C A;  1YQA A;  2O03 A;  2MBF A;  1FNN A;  2DI3 A;  5LHH A;  2ZNY A;  3L00 A;  5CJ9 A;  3H3U A;  2O8X A;  3JW4 A;  4OIO F;  2MLK A;  5IT9 K;  4F7Z A;  1LVA A;  3RTR A;  3F8M A;  2VN2 A;  4HDU A;  5AIQ A;  2L01 A;  4IHS A;  2IVM A;  5HVQ C;  3JTG A;  5ED4 A;  2HDC A;  3DKW A;  5K5Q A;  2FRH A;  5BPD A;  4JQF A;  1YFH A;  2ACJ A;  4XLN F;  1W5T A;  5FLX K;  4KDP A;  3Q9S A;  4R8H A;  5AON A;  1PP8 F;  2GA1 A;  5LEK A;  1XSV A;  3KP7 A;  3QAH A;  2BE5 F;  4A0X A;  4HQE A;  3RYP A;  4ENJ A;  2ZFW A;  3CDH A;  2VBX A;  2VON A;  3T1B A;  1FYL A;  2XKO A;  1D5V A;  3R0J A;  1EH8 A;  1ZRE A;  4Y13 A;  4Q47 A;  4RB1 A;  1OR7 A;  4U88 A;  4GO1 A;  5HLH A;  3HTS B;  3M8F A;  4KN4 X;  1T39 A;  1TQI A;  4LLG F;  4CZZ A;  3RYR A;  1HBX G;  2FF4 A;  2W84 A;  3CUO A;  4AWX B;  4Y17 A;  1XGM A;  1IN8 A;  2O0Y A;  2C6Y A;  5HDG A;  4IJA A;  1XGS A;  1SFX A;  1XGO A;  2RQP A;  5ICF A;  3LAJ A;  4KMF A;  2D2W A;  3FXQ A;  3O6B B;  1UFM A;  3F8C A;  3MZH A;  1Z6T A;  1MD0 A;  1BIB A;  4HX8 A;  3D5L A;  4YFN F;  2EFW A;  2CGP A;  2EV6 A;  4CXF A;  4G9Y A;  3FMS A;  4RGS A;  3E5Q A;  3L09 A;  4EQQ A;  4U0Y A;  1QPM A;  1RZ4 A;  3WTX C;  2NNY A;  3GWZ A;  1TNT A;  3BRO A;  2EA2 A;  2E7W A;  1LEB A;  4MTE A;  2W24 A;  2ISZ A;  5D4R A;  3HSE A;  2VBW A;  4R79 A;  3LST A;  5E8I A;  1SFE A;  1FWZ A;  3R6S A;  4RB2 C;  2VXZ A;  3I59 A;  4WF2 A;  4CHU A;  1L3L A;  4A0Y A;  4UHT A;  2H09 A;  4G7O F;  3MZY A;  3L7W A;  1WSU A;  3QPT A;  3WU0 A;  1W7P D;  2EWN A;  2CYY A;  4KA4 A;  1QNT A;  3M1E A;  3RKX A;  4K2E A;  1GXP A;  1U3E M;  2IP2 A;  4MNU A;  1TQM A;  2OD5 A;  3MWM A;  3W6J B;  2EFP A;  2Y48 A;  4IRG A;  4U0W A;  1XN7 A;  1YO5 C;  3I59 B;  3ABT A;  4ZZL A;  4ZYD A;  1TW3 A;  1IN5 A;  3V7C A;  1S29 A;  5TJJ A;  2NS0 A;  2P6T A;  1J5Y A;  2J5P A;  1VTN C;  1OKR A;  4ESJ A;  2P8T A;  3V4G A;  1PDN C;  4PGH A;  3E5X A;  3QP6 A;  4WX9 A;  1BBY A;  3QU6 A;  3IKV A;  3ISP A;  1R5H A;  2B0L A;  1IZ1 A;  4KN7 X;  5LGU A;  5CVU A;  1RNL A;  4KMU X;  3I54 A;  2F2E A;  3K69 A;  1H0M A;  3KP4 A;  2FNP A;  5CVI A;  4KT5 C;  1YS6 A;  2E7X A;  4IRI A;  3TO9 A;  3JTH A;  2W85 A;  5H20 A;  4HLX A;  3HHH A;  3J81 Z;  1Z6R A;  4CGZ A;  4Z2Y A;  3P7N A;  4WWC A;  4N0B A;  3TO7 A;  5ICG A;  1TNS A;  3T0Y A;  1B9N A;  3V8K A;  3HHG A;  2GAU A;  3ABU A;  2RVC A;  3TO6 A;  5F1R A;  3E5U A;  3TOB A;  4EVI A;  1CF7 A;  1WRJ A;  3PFI A;  3W6K B;  1KQ9 A;  2KJC A;  3RDI A;  4G94 A;  2HYF A;  3ZMT A;  5LLQ A;  3TQN A;  1FP2 A;  3TKY A;  1YG2 A;  4KIG A;  4HLY A;  3F72 A;  4CDG A;  1P6R A;  3HRT A;  3Q9V A;  1R1T A;  1Y0U A;  4NB5 A;  1T38 A;  4EM1 A;  1FBS A;  4L5J A;  2V6C A;  1JXS A;  1OMI A;  2YX7 A;  1G3W A;  3J81 K;  3K9T A;  4BAY A;  4NHJ A;  2IW5 A;  2RC4 A;  2P5K A;  4LK0 F;  2XIG A;  1J0R A;  2HS5 A;  3ECO A;  4Q48 A;  2QZ8 A;  5LHI A;  3VOE A;  1S7A A;  1CF7 B;  3DPT A;  4YII A;  2DQL A;  2DO7 A;  1B4A A;  5LHG A;  3C1D A;  4KIF A;  3SQN A;  1R1U A;  2HOE A;  3D0S A;  2LSO A;  2CO5 A;  4AD9 A;  2HKX A;  3LA2 A;  4RAZ A;  3HSF A;  4RGX A;  2L02 A;  1SD6 A;  3K1M A;  1RIO H;  2DPU A;  1XDS A;  3J80 K;  1FYK A;  4MTD A;  2JPC A;  1MDM A;  4A6E A;  3SZT A;  1B59 A;  3FM3 A;  3I64 A;  4BHP A;  2V79 A;  5ERI A;  1W5S A;  2PMH A;  2AS5 F;  2K7L A;  1JGS A;  2DBB A;  2EK5 A;  2RGV A;  4LFU A;  3F8F A;  2XRO A;  4MGR A;  1J2X A;  4AVP A;  5ILV A;  1J75 A;  5DD8 A;  1FYM A;  4ON0 A;  1R22 A;  1YW8 A;  5DCF A;  4KFC A;  1E2X A;  2ISY A;  1XSD A;  1U2W A;  2Q2E A;  4G8X A;  4GYG A;  3E6C C;  3JSO A;  4OMY A;  1MDM B;  4ASN A;  3IWZ A;  3OV8 A;  2P4W A;  4QWQ A;  3HYI A;  1I1S A;  3LQQ A;  1GVJ A;  3LWF A;  5IT3 A;  2L3D A;  2QQB A;  3WG9 A;  2L4M A;  2QQ9 A;  4ENN A;  2PBI A;  3C18 A;  2EFO A;  3TDU C;  1G6N A;  2Q0O A;  3T5X A;  3LA3 A;  2PJP A;  5FGM A;  2W25 A;  3FF5 A;  4P5O A;  1EV7 A;  1Z9C A;  1WI9 A;  3RKW A;  1Z7U A;  4BQA A;  1HSJ A;  1XGN A;  2XRN A;  3K1N A;  2YX4 A;  4N9H A;  3HUG A;  1XMK A;  2XGX A;  4EGZ A;  2ELH A;  2JPB A;  2NNN A;  2KKO A;  1BI1 A;  1D8J A;  3GX4 X;  2HZT A;  4IXA A;  5KK1 A;  4N9I A;  1U5T C;  3F6V A;  1MJB A;  3DV8 A;  1K6O A;  3BWG A;  3EUH A;  2FU4 A;  4A0Z A;  1S3J A;  4OIQ F;  3BJO A;  1KYZ A;  2BEO A;  2JT1 A;  4A5M A;  4G7H F;  2OU2 A;  3WTW C;  2CG4 A;  4EMS A;  2F5D A;  3R60 A;  2R7F A;  1YW9 A;  5F64 A;  4L5I A;  1IN4 A;  3IKT A;  1FBU A;  2PG4 A;  4KNY A;  1BIA A;  3RI4 A;  1MZB A;  4M74 A;  5FD5 A;  5L3D A;  2CFX A;  1HW5 A;  2HWV A;  4RB3 C;  3PQK A;  1G4D A;  3KLN A;  5HS9 A;  3EDP A;  2F5E A;  2Y0M A;  3F22 A;  2IRF G;  1FLI A;  1BM9 A;  2H27 A;  3R61 A;  1EH6 A;  1HKQ A;  4OIP F;  3I0T A;  1GHC A;  3MEX A;  3GLX A;  5L3E A;  2PN6 A;  4ENM A;  4GXO A;  1QQI A;  5LEJ A;  4IPA A;  2OZ6 A;  4ESF A;  1KU9 A;  1KA8 A;  4L9J A;  2BBY A;  4M9X A;  3M7G A;  1DPR A;  2PQ8 A;  3LQR A;  4MQ9 F;  3KP6 A;  4M9S A;  5CVV A;  2F5C A;  3O2P E;  5E1Z B;  2A07 F;  2KIU A;  1X3U A;  1U8R A;  1I5Z A;  2MH9 A;  1ZN2 A;  1TBX A;  1WQ2 A;  2LKP A;  4KYW A;  1SMT A;  4M73 A;  2ADU A;  4I01 A;  2YR2 A;  1XMA A;  3GF2 A;  1YS7 A;  1L0O C;  5CVJ A;  3ZN1 A;  1ZGA A;  2W57 A;  2RNJ A;  1LJ9 A;  2M30 A;  2BGC A;  2FEZ A;  2M5W A;  1ZH5 A;  2H6B A;  4AIJ A;  1SMY F;  4ZH4 F;  5D8L B;  4ZYH A;  2Z9O A;  3C3W A;  4DQ2 A;  6PAX A;  2K4J A;  4HF0 A;  4LJZ F;  1LDD A;  4UVB A;  2ZXJ A;  5BPI A;  3G3Z A;  2DTR A;  2HEO A;  3DXJ F;  1IN6 A;  5FFZ A;  3F8B A;  2PMU A;  5TRD A;  4ZYE A;  2ZJ2 A;  5HLG A;  1R7J A;  3ERE D;  4WK8 F;  1SD7 A;  1T6S A;  4XBF A;  4L18 B;  4A2U A;  2FE3 A;  2LDU A;  1ZAO A;  1H9G A;  2VOO A;  2D45 A;  5JFR A;  4M9Z A;  1FPQ A;  3ZPL A;  3CTA A;  1FC3 A;  1Z1D A;  3FM5 A;  1STZ A;  5FFX A;  5H6R A;  4QLC U;  4EJV A;  4Q5S F;  3RJP A;  4U7D A;  4KIB A;  2GXG A;  5A2Q Z;  5HS8 A;  2VBY A;  3U2R A;  1O3R A;  4UXN A;  3GYH X;  4P9F A;  1YW7 A;  5LRS A;  4M6Y A;  4HZF A;  5E8G A;  5J8C A;  2V1U A;  1BI0 A;  1IRF A;  3EQL F;  1R1V A;  4MQV A;  3V7S A;  2AXL A;  3K2Z A;  1ZG1 A;  2WC2 A;  2XKP A;  4EM0 B;  4I09 A;  3GXO A;  3PQJ A;  1UCR A;  2ETH A;  4RB0 A;  3DF8 A;  2P7V B;  3QU3 A;  2G7U A;  5E17 F;  2HFH A;  2O3F A;  2Q8K A;  4HV6 A;  1XCV A;  3L2C A;  1O3Q A;  5D8K B;  2EA4 A;  3SXY A;  4GGG A;  1FOK A;  2XVC A;  5ICE A;  1PP7 U;  3EYI A;  3EET A;  5LGT A;  4AIK A;  4YFK F;  3P9C A;  4LLL A;  3TGN A;  3HRU A;  3P9K A;  3LFK A;  2MA3 A;  4G7Z F;  2DQR A;  4LMY A;  3T8T A;  4FT8 A;  4IF4 A;  3LAP A;  3DPL C;  4WXC A;  3KP5 A;  3V7R A;  1OYI A;  1F1Z A;  4LB5 A;  1ZGJ A;  4XSX F;  1OPC A;  1QO0 D;  1LNW A;  2OZU A;  2OQR A;  2EFQ A;  2LF8 A;  3HRM A;  2LNB A;  1IW7 F;  1SFU A;  1KYW A;  1FZP B;  2O6G E;  2VBZ A;  1HKT A;  5D5V B;  2QUF A;  3H3Z A;  3KET A;  3KLO A;  2DAO A;  3KE2 A;  3TDZ C;  4L0Y B;  3CUQ C;  3NQO A;  4GCV A;  1WKM A;  2A5Y B;  5LBQ A;  3GZ5 A;  3QP5 A;  3VB2 A;  5BQT A;  2VC1 A;  4M6X A;  1FBQ A;  1BOA A;  3WTV C;  1I27 A;  3KEQ A;  2VE9 A;  4L0Z B;  3KZY A;  1T2K A;  4BHC A;  3GZ6 A;  5HOO A;  2IA2 A;  2CW0 F;  3RPU A;  2OA4 A;  2P7C B;  3GFL A;  1GXQ A;  1FT9 A;  1UB9 A;  1FSE A;  1D8K A;  1R23 A;  1JHH A;  3V8J A;  1LQ1 A;  1Z05 A;  3KZZ A;  5L3C A;  4HAM A;  2DFI A;  5EEG A;  2UXN A;  3DQV C;  2H94 A;  2QWW A;  1J9I A;  2K86 A;  3REO A;  2X0L A;  2Z33 A;  3SZP A;  1EH7 A;  3ZMU A;  2DK5 A;  5DUK A;  4A5N A;  5E20 A;  4L9T A;  2RKH A;  1PUE E;  4H0E A;  2H6C A;  4EJT A;  5DYM A;  1WWX A;  3FZV A;  4YG2 F;  3BOQ A;  1V3F A;  1FY7 A;  5F6F A;  3I58 A;  1IXC A;  1KQ8 A;  3RKY A;  4L9N A;  1ZHF A;  2GZW A;  1C0W A;  4BXU A;  1K78 A;  3B02 A;  2MD5 A;  2WTE A;  2PLY A;  3COA C;  3GEZ A;  2QVO A;  2IA1 A;  4I98 B;  4XSZ F;  2FQ3 A;  1J7K A;  3M8E A;  2FBH A;  3O3K A;  3FMR A;  2O61 A;  2KIF A;  3E3V A;  4L9V A;  4G6D A;  1TQP A;  3V8L A;  2D1H A;  4HYE A;  1U5T A;  2QYO A;  3NRV A;  3IC7 A;  5E18 F;  2UZK A;  1K78 B;  4E70 A;  1LDJ A;  3KP3 A;  3JAM Z;  2YPR A;  2VC0 A;  1KGS A;  4TV7 A;  2A6E F;  4R1H A;  3QRF F;  3CJN A;  1HST A;  1CGP A;  4CIC A;  5D6E A;  4OU0 A;  1BI3 A;  3MCZ A;  4P96 A;  1B6A A;  4MHG A;  1P92 A;  5JVT A;  4OIR F;  2HQN A;  1ZG3 A;  4IHT A;  3TOA A;  4RGR A;  1LDK B;  1U5T B;  1YLF A;  1B1B A;  5L3B A;  5BMZ A;  5DDG A;  1BC8 C;  1KU3 A;  2DPD A;  5J8F A;  5ICC A;  1IXS B;  3BY6 A;  1FSH A;  2EJR A;  3I4P A;  1G3Y A;  4CYD A;  1R00 A;  2COM A;  3I71 A;  4OOI A;  1KU7 A;  3ZP5 A;  3IWF A;  3MQ0 A;  4HDV A;  2STT A;  4IRH A;  1IAW A;  3LA7 A;  2IJL A;  3BPV A;  3FXU A;  2Z5U A;  1MGT A;  1HW2 A;  2KIM A;  4I0B A;  1REP C;  3E6M A;  3FWE A;  4HOB A;  3SHF A;  3ZMS A;  4UVC A;  5LRR A;  1HXD A;  2PI0 A;  5CLS A;  3BJA A;  4I7H A;  2V9V A;  3SFZ A;  4S04 A;  3EYY A;  1P4A A;  2GXB A;  1P2F A;  3L9F A;  2QQA A;  4M71 A;  2FBI A;  2XAG A;  5EEH A;  4EGY A;  5D6F A;  1XDU A;  3F6O A;  1F5T A;  4LK1 F;  2OBP A;  3WTS C;  2PEX A;  3M9A A;  2FMY A;  2K27 A;  2EB7 A;  3ZMD A;  4P9U A;  3DFG A;  2IT0 A;  2VOD A;  4WXD A;  3QOP A;  2EV5 A;  3HTU A;  4BHB A;  1YIO A;  4WXH A;  1OYY A;  5FLX Z;  4EJW A;  2P6S A;  1ON1 A;  3U9G A;  4HF2 A;  2WV0 A;  4JK1 X;  4U0V A;  1RUO A;  1UHW A;  5HS7 A;  5K5O A;  2L4A A;  3DP7 A;  2HQR A;  2QEN A;  1DPU A;  4LG0 A;  5H6Q A;  2QBY A;  3VEP A;  2A3S A;  1O57 A;  2XAH A;  2OAZ A;  2FSW A;  4LGW A;  1S6L A;  4ESB A;  1KU2 A;  3HOS A;  1D3Y A;  2XAS A;  1USS A;  1P4W A;  4UVA A;  5D5X B;  5HLI A;  2UWM A;  4XLP F;  2J5O A;  3IRQ A;  1QZY A;  1W7P A;  1FP1 D;  5FO5 A;  5KVR A;  4ZYG A;  1H9T A;  4HF1 A;  2MLG A;  1I1G A;  4LG0 B;  1HKS A;  1IN7 A;  2QBY B;  2A69 F;  1MKM A;  4A12 A;  2XV4 S;  3BDD A;  3GFJ A;  5K5R A;  1LEA A;  1SD4 A;  1QGP A;  4RAY A;  1K7A A;  2K02 A;  4O3M A;  2GA2 A;  3K0L A;  3K1P A;  2NAZ A;  3C7J A;  2KRF A;  1T0F A;  2CSO A;  1ZG5 A;  3WOD F;  1W7P B;  3KCC A;  1U78 A;  2NYX A;  5CVR A;  1T98 A;  3WTT C;  1RUN A;  2DLL A;  5BOX A;  2GIV A;  3WGI A;  2ZO4 A;  2DU9 A;  4FX0 A;  3F8N A;  4ETS A;  1O7L A;  3B73 A;  1IUY A;  1AOY A;  3WTU C;  3GUD A;  4EJU A;  4PGG A;  4IVN A;  3KEO A;  5E1W A;  2JTV A;  1BJA A;  1I6X A;  4HA8 A;  4HBL A;  2MH2 A;  5J6X A;  1DDN A;  2ZCW A;  4HQM A;  2V1D A;  1S7O A;  2YU3 A;  3F21 A;  3NEU A;  5L3G A;  1G3T A;  2ZME A;  2E1N A;  5FB2 A;  3WE2 A;  3E6D A;  4JBA A;  5HDN A;  2HGC A;  4HX7 A;  2JSC A;  3IL2 A;  2BV6 A;  3HOT A;  4AIH A;  3QPH A;  2A61 A;  1S8N A;  1SAX A;  2OQG A;  2M8E A;  1AWC A;  1TW2 A;  5A2Q K;  1RI7 A;  2JZY A;  3RPQ A;  2VT3 A;  3CUQ A;  4P55 A;  2FOK A;  1OYW A;  1F4K A;  1QBJ A;  4ENK A;  3N4M A;  2MC3 A;  2Z99 A;  4I2O A;  2ZME B;  3R4K A;  4I0A A;  4BH9 A;  1ONV A;  3ROU A;  3GW2 A;  4Y15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...