3M8EA

Protein structure of type iii plasmid segregation tubr
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
101
Chain Sequence
HHHHFYTLNIAEIAERIGNDDCAYQVLMAFINENGEAQMLNKTAVAEMIQLSKPTVFATVNSFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKAMEMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From the Cover: Plasmid protein TubR uses a distinct mode of HTH-DNA binding and recruits the prokaryotic tubulin homolog TubZ to effect DNA partition.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Dna binding protein
molecule keywords Putative DNA-binding protein
total genus 28
structure length 101
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3m8eA00
2JPCA 1H0MA 4LGWA 4P55A 4I7HA 4MNUA 4ENMA 3ECOA 3HUGA 3N4MA 4UV9A 2IA1A 5FLXK 1OMIA 5LEKA 5H6QA 6PAXA 5LEJA 4WXDA 2VXZA 3I59A 2Q8KA 4IRGA 1E2XA 2BGCA 4F7ZA 1R5HA 5H20A 2ZKZA 2P4WA 1KU7A 2DFIA 1P6RA 4NQWA 2FMLA 1J59A 3V8LA 1X3UA 1IXCA 1TW2A 2MH9A 5LHIA 3GFJA 1U8RA 1Z9CA 2DTRA 2VC0A 2RDPA 4HX8A 4KA4A 3VB2A 2O03A 1U2WA 5ED4A 3NRVA 3GLXA 3P9IA 3M1EA 4A0YA 4OMYA 1W7PB 2ZNZA 3FMQA 1R58A 2XKPA 1F4KA 1D8JA 2QM3A 4HV6A 5BPIA 2HEOA 1T38A 3F8FA 4LFUA 1IXRC 2HFHA 4MTEA 1SFXA 1IAWA 3BPXA 5JI6A 3HRMA 1FSHA 1P4WA 3C7JA 2CYYA 2VN2A 5HDNA 1DPUA 1PP8F 4HF2A 2FQ3A 2KJCA 2XVCA 1MJ9A 3ZMTA 4U0YA 2D2WA 1LJ9A 4ZZDA 5LBQA 1FC3A 1J0RA 5E1XA 3HRUA 3RDIA 1TQMA 2Y0MA 2QQ9A 3VEPA 1USSA 2OAZA 2P5KA 4LMYA 5ERIA 3V7CA 2CQKA 5KK1A 3BZ6A 3CUQC 2DBBA 3ZMZA 3U2RA 4UVBA 2RC4A 2WWYA 4HV5A 2HWVA 3J81Z 3LAPA 1XDUA 3QU3A 4YFNF 4HDVA 1B4AA 5A2QK 2IW5A 5ICCA 2DU9A 2KIUA 1P92A 1TBXA 1LDDA 4KUMA 3ZN0A 3FF5A 3HTUA 1BIAA 3I59B 5ILVA 5DUIA 4JQFA 2H09A 1CGPA 1U5TA 1UCRA 1F9NA 4OOIA 3T0YA 3HYIA 1IRFA 4IHTA 3ZMDA 2L4MA 1WRJA 1FBQA 4WCGA 1SAXA 4HW0A 4EVIA 5LLQA 3CO7C 2MLKA 3COAC 2RQPA 4AVPA 1OYWA 3OV8A 3WE2A 2Z5UA 4XRFA 1K79A 1J2XA 5DEQA 3F21A 3ISPA 2OBPA 5LGUA 3RIRA 2NNYA 1Z05A 3WTSC 4KNYA 3L2CA 4R8HA 3W6JB 1SD7A 2O3FA 4EJVA 1YFHA 2EV5A 1FOKA 3DF8A 1O7FA 4LLNA 1O3SA 2XAQA 2MA3A 3O6BB 3CJNA 2V1XA 5D5VB 2HS5A 2ZBKA 4GCVA 3R4KA 1JE8A 1P4XA 2IA0A 3DKWA 3KLNA 2BBYA 2CW0F 2KKOA 1FT9A 2X4HA 4HA8A 3F23A 4RAYA 3WTZA 1R22A 4Y13A 2O8XA 4IRHA 5A2QZ 3ROUA 1Q1HA 4ZYDA 5IT9Z 2TDXA 4HLXA 3ZMUA 4PGHA 2VE9A 3KP5A 3KP6A 4WK8F 1FYKA 1B9NA 1IN7A 3O3KA 4Z2YA 3HHGA 4TV7A 1D5VA 5JFRA 3GZ6A 5CVVA 3K1MA 4EV0A 1BM9A 3WTWC 3WTVC 3C3WA 2YR2A 1R1VA 2XIGA 4I09A 4L5IA 1HKTA 1JXSA 2IA2A 5HLHA 2VBYA 1O3TA 3J7AO 1KYWA 4A12A 2ZFWA 4BAYA 4EGYA 4EGZA 3BY6A 3P9KA 4LB5A 5HLIA 1D3YA 1W7PA 1KGSA 2MH2A 4QLCU 3DP7A 3DXJF 2DK8A 4A0ZA 1MD0A 4XLPF 5FD6A 2EV0A 1BI3A 3E97A 3G73A 1IN6A 3LAJA 2PJPA 3TKYA 3F6VA 1T39A 5F6FA 1I27A 3WU1B 4O5VA 1FWZA 5CVIA 5K5QA 1W5TA 5TRDA 1O57A 1XSXA 5LHGA 4HQMA 1XGOA 5LHHA 4JK1X 4EJTA 4IJAA 1OR7A 2IJLA 4G8XA 3ZMSA 1ZYRF 3GFIA 2ZNYA 4LK0F 1XSVA 2KJBA 2VBXA 2E1CA 2A61A 3KP2A 4KN4X 4LB6B 1I1SA 1USTA 1MDMB 3CUOA 3GFMA 4RB0A 2XASA 3ZQ7A 1QQIA 2VT3A 4LK1F 2XHKA 2EFOA 2WC2A 3TDZC 2E7WA 3DV8A 4M9ZA 3FXRA 3RKWA 2DQLA 1ON2A 3VFZA 5FLXZ 2OA4A 3WGGA 3GWZA 5D6EA 2ELHA 4AWXB 4MEXF 1V3FA 2UWMA 4CDGA 1FP2A 1Z91A 2A69F 1BI1A 4KT5C 2MLGA 1QNTA 1U5TB 4ESJA 1FY7A 1T98A 3V8JA 2L02A 1MDMA 3MCZA 4FT8A 5E18F 5BS6A 2BE5F 4OIOF 3Q9VA 4ENKA 1YTYA 3TQNA 1S7OA 3GFLA 3RTRA 4EQQA 1I1GA 2FBIA 3I58A 1UHWA 2K4BA 1WKMA 2GIVA 4CHUA 5E8IA 2VT2A 2DQRA 2BYVE 4OIRF 2DW4A 5ICGA 4ZYGA 1HW1A 1OYIA 2CG4A 2XAFA 1DDNA 2FU4A 3ULQB 1W4MA 1TLHB 4HF1A 2ETHA 3I64A 3L00A 4GO1A 3SZTA 3DQVC 1IN8A 3P7NA 1XMKA 1STZA 1RNLA 2GWRA 3QP5A 4MHGA 1XB4A 1YIOA 2PI0A 2RN7A 3KZZA 4P9UA 4DNCA 4YFKF 2FOKA 2F5FA 1HBXG 4G7ZF 3R60A 3KP4A 1U3EM 4L5JA 2JT1A 4YFXF 5HOOA 2HGCA 2VC1A 2EFWA 1WI9A 3H3ZA 4U7BA 3KEQA 3ZP5A 1J75A 5LGNA 4UXNA 1FBUA 4A5MA 3T8RA 4FX4A 2LSOA 2HYGD 1SMTA 5D5XB 1R23A 1S7AA 2HR3A 5DV5A 4ESBA 5BOXA 3M7GA 2F2EA 3FM3A 1B1BA 3CDHA 2XV4S 4BYYA 4AIKA 3J81K 2YU3A 3BPVA 1IRGA 1SD5A 1DP7P 3JW4A 2RVCA 3GW2A 1ZAOA 3E3VA 1ZRCA 4A0XA 2ZJ2A 4HYEA 5DYMA 3QRFF 2FBKA 2B0LA 2CGPA 1KU3A 1ZHFA 5DDGA 1JHFA 1R5GA 1HXDA 4K2EA 1IN4A 3QPHA 4HOBA 1ZRDA 1OPCA 1QGPA 1G3TA 4GYIA 3R0AA 3L09A 2COMA 3LFKA 4KDPA 3WTYC 5E17F 4WX9A 2O0YA 4L9JA 1YW8A 2FBHA 1CF7A 3GUDA 3IRQA 5LRRA 2DAOA 3FXUA 2RV8A 4FHTA 3QOPA 1U6GA 4L9VA 3JSOA 1TQPA 2HQRA 2QUFA 3REOA 5ILSA 4G7HF 4BQAA 3IL2A 5DCMA 4ZYHA 4A5NA 2L01A 1KQ9A 4ETSA 1S29A 4MEYF 5HLGA 3ABUA 3E6BA 4GGGA 4M73A 2HKXA 2OD5A 1K78B 2KRFA 2YPRA 3CUQB 3FMRA 4O3MA 4XLNF 1FYLA 1IF1A 4LLLA 4I0BA 3FZVA 1HW5A 5D4SA 4G94A 2XAHA 2AS5F 3RYRA 1XDSA 3WTUC 5D5UB 2P7VB 2J5PA 2XAJA 3TGNA 5D5WB 4BHCA 1OYYA 3LQQA 2NNNA 3MQ0A 1L3LA 1FNNA 1QO0D 2OQRA 4HX4A 1BC8C 4N9IA 1ONVA 1O7LA 3DEUA 4RGRA 4EM0B 5CVJA 1I6XA 1AOYA 3TO7A 3GO5A 5HS7A 4EJUA 2UXXA 2GXBA 1T0FA 2W24A 4KFCA 5IT9K 2L4AA 3F22A 4KICA 4PGGA 4PDKA 3WE3A 4Q48A 3M8FA 5EEHA 3LWFA 2D1VA 2QYOA 3FXQA 5ICFA 1MGTA 3U1DA 4HF0A 1BJAA 2EJRA 3I4PA 2A6EF 4P5OA 1Z6TA 1U5TC 3BJOA 2QENA 3BROA 4HQEA 2EB7A 2M87A 2PFBA 2Z3YA 1SFEA 2V6CA 4N0BA 3MAJA 4ASNA 2Z9OA 1B6AA 2FE3A 2VE8A 1BI2A 3WGIA 3T8TA 3NEUA 4ENNA 2EA4A 4DQ2A 2EWNA 1GHCA 4ON0A 1YLFA 4Y15A 3QP6A 4GYGA 4A6EA 4EM1A 4G6DA 2L54A 1UB9A 2JSCA 1R1UA 3PFIA 4EJWA 4Q47A 1D8KA 3K1PA 3K0LA 1YG2A 3K9TA 3TOAA 4S04A 1TQIA 2M5WA 3BDDA 1G3SA 4S05A 3CUQA 4BH9A 1HKSA 3F72A 3E5XA 4RAZA 3V7SA 1IW7F 4ESFA 1REPC 2QWWA 4KIBA 2GZWA 3HRSA 4KN7X 2QBYB 2P7CB 4B09A 4QWQA 1T2KA 3IKTA 2ZMEB 1TNSA 3K2ZA 2CSOA 2Y75A 3E6MA 2LF8A 1LEAA 4UVAA 3EUHA 1FPQA 4U7DA 2ESHA 5K5OA 1R00A 1ZARA 3C1DA 1R1TA 3K1NA 5HDKA 3JTGA 5K1YA 2NRAC 4M72A 4NHJA 3TDUC 1WQ2A 2QBYA 2EFQA 3PQJA 1FSEA 4RB2C 4A6DA 1AWCA 2FRHA 2EV6A 3E5QA 2GXGA 1OKRA 5HDGA 3EDPA 2P8TA 1PP7U 2STWA 4GXOA 3V8KA 4P96A 3GZ5A 4N9HA 3RI4A 1YYVA 2Q0OA 4XSXF 2V1UA 4KMUX 4CICA 3P9CA 3HSEA 3RKXA 2HYFA 2EA2A 1Z7UA 3BOQA 3MWMA 1RUNA 3ECHA 3L9FA 3EYYA 3E6DA 1LDJA 1YS7A 2QQAA 1PDNC 2VONA 2JPBA 5F64A 3CLOA 3HOSA 5D8LB 1J7KA 2RNJA 1GXPA 1F5TA 3BJ6A 2FNAA 1PUEE 3QPTA 2YSRA 3KCCA 2DK5A 4YG2F 5AONA 1MZBA 2M30A 3FMSA 3GEZA 5FB2A 4RS8A 4U88A 3IRRA 2ISZA 2ESNA 2R7DA 3R0JA 2FNPA 5JVTA 2RGVA 1RI7A 3KP7A 1G3YA 5L3EA 2F5CA 1RIOH 3ERED 1HKQA 4OINF 4YIIA 2MD5A 2H27A 4AIHA 2QZ8A 3DPLC 3IC7A 4BXUA 2W85A 1J9IA 3V7RA 4LG0A 2XROA 2PMHA 2X0LA 1BC7C 5L3FA 5E1WA 3BJAA 3HTSB 3PQKA 1ODDA 1TNTA 3IWZA 3WU0A 2FMYA 5H6RA 4BHPA 2R7FA 4I2OA 1FZPB 1SD4A 3F8MA 2ACJA 2H6CA 3F6OA 2Y48A 4HZFA 1HQCA 1KU9A 1L0OC 3R61A 5IT3A 4HBLA 2ZXJA 2PBIA 4KMFA 5BMZA 2MBFA 2GA1A 1BIBA 2GQQA 5HS9A 3RJPA 4B8XA 2PLYA 2AXLA 5CYVA 1GVJA 3F8BA 1W5SA 1LB2A 2RKHA 1WSUA 3VODA 4MGRA 3RPUA 4XSZF 4AIJA 1BBYA 4LJZF 2IRFG 1XN7A 1QPMA 2DLLA 3IHUA 4HX7A 2K86A 5E20A 3LQRA 4IHSA 5CVRA 3F3XA 1CF7B 2V79A 3NQOA 4RB1A 1TTYA 3L7WA 1ZLJA 3O2PE 1IZ1A 3D0SA 2Z99A 1QZYA 1LNWA 2M8EA 5HVQC 3AAFA 1QBJA 4G7OF 4ZYEA 3IWFA 4UHTA 3C18A 4HAMA 3I54A 5DCMB 2HOEA 2BEOA 3ABTA 5DD8A 4OMZA 3MZHA 1XD7A 2ZMEA 4MQVA 2A68F 4Y17A 2Z33A 4M6YA 3T5XA 5F1RA 4UUVA 3CO6C 1G3WA 5LGTA 1ZG1A 1NHAA 3Q5FA 1YW9A 2P6TA 5JR3A 2HTJA 4L0YB 3MEXA 4IRIA 2D1HA 4R1HA 5ILUA 1J5YA 1XMAA 4L18B 1I5ZA 3QU6A 2O61A 1BOAA 3SQNA 4I02A 4JBAA 5DCFA 3F8NA 2FSWA 3FX3A 3JTHA 3E6CC 2UZKA 2JRTA 5FD5A 4HDUA 4LD5A 1YS6A 2ZCWA 3T1BA 1MJAA 4M9XA 1IXSB 2IPQX 3SFZA 2UXNA 1UHMA 2D45A 2L3DA 2VOOA 5HS8A 3VOEA 2XRNA 4L9TA 2LNBA 3CTAA 3DPTA 3FM5A 3Q9SA 2M45A 2P5LC 1S3JA 4A2UA 5L3CA 4IF4A 2H94A 1ZREA 4KYWA 4CYDA 2OZUA 3WTTC 1V4RA 2KIFA 1IN5A 2MC3A 3GX4X 1EH6A 3ELKA 1U78A 5CVUA 3JSPA 4UNOA 5L3DA 2W57A 3HHHA 4UVCA 3RYPA 5JHUA 1Y0UA 2OZ6A 2CFXA 3W6KB 5AIQA 5D6FA 3WG9A 1FYMA 3JAMZ 2A3SA 2EFNA 4FX0A 5K5RA 1RZ4A 2NS0A 5DD4A 5LRSA 3I5UA 4MQ9F 2XKOA 2CO5A 2Q2EA 3I53A 2EK5A 2ZO4A 3M9AA 4PCQA 3U9GA 2VBWA 2A6HF 2J5OA 2LDUA 5FGMA 3BP8A 1K6OA 1O3RA 1XGMA 1LVAA 4KIFA 5J8CA 1IUYA 4RGUA 3BWGA 1JGSA 1S8NA 3EETA 1K7AA 1KYZA 3GVAA 2YX4A 1ZRFA 3LA7A 4AD9A 5E8GA 1SFUA 2FEZA 1LQ1A 5D4RA 1T6SA 4M74A 2OQGA 1XGNA 4XBFA 1ZH5A 2QVOA 2M1BA 4RGXA 3ZPLA 5AIPA 4Q5SF 5L3GA 4M71A 1MKMA 2HTSA 2E1NA 2EFPA 4CGZA 2YX7A 4IPAA 3MFKA 2A07F 2G7HA 1Z6RA 4YIFA 1GXQA 2PMUA 3E5UA 3RPQA 2IP2A 3JAMK 2JTVA 4E70A 1YQAA 4CO8A 2PG4A 2P6SA 2F5EA 4RB3C 1QZZA 3SHFA 2F5DA 2G7UA 2OU2A 3SXYA 4ZH4F 1TW3A 3GXOA 4U0VA 4O6JA 3SZPA 2FXAA 3MZYA 1E17A 2JZYA 1S6LA 1ON1A 3F8CA 3EYIA 2HQNA 4WWCA 5FO5A 3GYHX 2XAGA 4BHBA 4I98B 2W84A 3TO9A 4OIPF 3G3ZA 3GF2A 1ZG5A 3KZYA 1FBSA 4HLYA 1Z1DA 2VBZA 1KQ0A 2ISYA 2H6BA 3WODF 5TJJA 4M9SA 2NYXA 1KA8A 4R79A 1BN5A 1KU2A 1LDKB 5DUKA 3N97A 2P5VA 2K27A 3LSTA 2O6GE 4UV8A 5L3BA 3EQLF 2IT0A 5BPDA 1UFMA 3H92A 1P2FA 4WXCA 2QQBA 5BQTA 1A04A 3HOTA 1HW2A 1ULYA 1HSJA 4Q4ZF 4I01A 2K7LA 3S2WA 1R36A 1EH7A 1DPRA 2E7XA 4G6QA 1ZGJA 3ZMVA 2FF4A 1YO5C 4RGSA 2PN6A 3J80K 1DUXC 4ENJA 1ZLKA 3B02A 2QLZA 2WV0A 2HKOA 4P9FA 1EV7A 2CWEA 3R6SA 3M8EA 3RKYA 1B59A 4I0AA 1VTNC 2DPDA 3HSRA 1XCVA 1C0WA 3V4GA 2XGXA 5ICEA 2VODA 2DI3A 5D8KB 3I71A 2GA2A 3KETA 3LA2A 1FLIA 1XCBA 4IVNA 3HIFA 1FX7A 4EMSA 2XUBA 1RUOA 4MTDA 1B9MA 2V1DA 4L9NA 3KP3A 3WTXC 4G9YA 3QAHA 2G9WA 4KIGA 3KEOA 4OU0A 3TOBA 2BV6A 5CJ9A 5EEGA 1H9GA 1G4DA 1WWXA 1EH8A 1XGSA 1MJBA 2FA5A 4NB5A 2NAZA 2R3SA 3I0TA 5FFXA 2KIMA 1SMYF 2W25A 2IVMA 5E1ZB 1BI0A 1XSDA 1JHHA 3LA3A 4H0EA 4WF2A 2C6YA 1SD6A 5J8FA 2V9VA 2PQ8A 3B73A 2WTEA 4U0WA 5J6XA 1H9TA 4CXFA 3ZN1A 2ADUA 5FFZA 1R7JA 2DT5A 1P4AA 3J80Z 2STTA 3K69A 1YW7A 4WXHA 3D5LA 2PEXA 3IKVA 4OIQF 1KQ8A 1W7PD 3H3UA 4EM2A 2HZTA 2K02A 1ZGAA 5CLSA 3KLOA 1ZN2A 1LEBA 1G6NA 3OOPA 2DO7A 3DFGA 2LKPA 4D0PA 2LF7A 5KVRA 2GAUA 1F1ZA 4LLGF 3ML6A 1FP1D 2HDCA 2K4JA 4M6XA 3WGHA 2DPUA 1ZG3A 4ZZLA 2A5YB 3HSFA 4IXAA 3HRTA 1K78A 4BNCA 1HSTA 3FHZA 3KE2A 4EJOA 4CZZA 3FWEA 2VOPA 4LG0B 3TO6A 1O3QA 3KFWX 4PZJA 4L0ZB
chains in the Genus database with same CATH superfamily
1ZGWA 4DGWB 5HNHA 2OTLI 2JPCA 1H0MA 4LGWA 4P55A 4I7HA 4PUSA 1T0FC 4MNUA 4B3XA 4ENMA 4IO9F 3DBRB 3ECOA 3HUGA 3CC7I 3N4MA 1WJCA 4UV9A 3JRDA 2IA1A 5FLXK 1OMIA 4XKBA 2GLOA 1VQKI 5JHFA 2LKSA 3K4CA 3BTLA 4RBOA 1YRNA 3BTIA 5LEKA 5H6QA 6PAXA 5LEJA 4XLHA 4E7ZA 4WXDA 2I5UA 2PMZN 2LK2A 2VXZA 3I59A 2Q8KA 4IRGA 3OMYA 1E2XA 3FKJA 2OJED 1EA3A 4M3DA 2BGCA 2XPVA 4F7ZA 1R5HA 5GADJ 5H20A 2ZKZA 2P4WA 1VQMI 1KU7A 1IRZA 3OYIA 3I4MJ 3I3LA 2DFIA 1P6RA 4NQWA 2FMLA 1V5GA 2K9MA 1J59A 3V8LA 1X3UA 1IXCA 4A3KJ 1ITYA 5J47A 5FLVA 1TW2A 2MH9A 1F43A 3K2AA 4DW6A 5LHIA 4XOPA 3S2HJ 3MD2A 1GUUA 3GFJA 5GAGJ 2CRGA 1U8RA 1AHDP 1Z9CA 1FOWA 2DTRA 2VC0A 4IHYA 3CCMI 2RDPA 4HX8A 4I76A 3CCQI 4B44A 4KA4A 2R5YB 1X4PA 3VB2A 2KMUA 2O03A 1U2WA 3RPUD 4I6ZA 3CMEI 5FRNA 2HQ5A 5ED4A 3NRVA 2YU9J 3GLXA 3P9IA 3M1EA 4A0YA 1K4TA 4OMYA 1RKTA 1W7PB 1WH7A 2ZNZA 3FMQA 1R58A 2XKPA 1F4KA 1D8JA 2QM3A 3OSGA 5FLMJ 4HV6A 3OYGA 2FQ4A 2OF7A 4CSWA 1YIJI 2F5VA 3JRHA 5BPIA 2HEOA 1T38A 3F8FA 3MMYB 1YX5A 1QVUA 2VXDA 4LFUA 3RZOJ 2HYJA 1IXRC 2K3PA 2HFHA 4A3DJ 3TL4X 2Q1ZB 3OIQA 1SFXA 4MTEA 1IAWA 3BPXA 3OYBA 5JI6A 3HRMA 1FSHA 1P4WA 3C7JA 2CYYA 2VN2A 5HDNA 5M5YJ 2E1OA 4XKCA 1W0UA 1PP8F 3A0HC 1B8IA 1DPUA 2BY2A 4HF2A 2CV0A 2FQ3A 2JWTA 2LBFA 1Y0NA 2OPTA 2KJCA 2DMPA 2XVCA 3D1NI 3OS2A 3H9GA 1MJ9A 3ZMTA 4U0YA 1GV2A 2D2WA 1QPIA 4D1QA 4MFDA 3K4MA 4CUGA 2W4SA 2NOJB 1LJ9A 2CUFA 1P9QC 4ZZDA 5LBQA 1UG2A 2GBYA 1FC3A 1V54H 4V19K 3S15J 1DGRM 1H88C 1J0RA 5E1XA 2AXTC 3HRUA 3RDIA 1Y6IA 1TQMA 1A5JA 2Y0MA 2QQ9A 4X0GA 3VEPA 1LFUP 1USSA 2OAZA 2P5KA 4LMYA 3DTKA 5ERIA 3V7CA 2LY1A 2CQKA 5IYCJ 4BE0A 5KK1A 3BZ6A 3CUQC 3VWBA 2DBBA 2VKVA 3MVPA 3P5JA 4BS9A 3ZMZA 3U2RA 4BE2A 4UVBA 3OYDA 2RC4A 1H89C 4D7MA 2WWYA 4HV5A 1SANA 2HWVA 5E3MA 3J81Z 3LAPA 1XDUA 3AG2H 3HJEA 4DIQA 3CCVI 1VFCA 3QU3A 4XMYA 4YFNF 3MKZA 4Y7NJ 1N77A 3H3VK 3CD6I 5F0HA 4HDVA 1B4AA 5A2QK 3M07A 3CMYA 2IW5A 5ICCA 1VI0A 1DU6A 5HNFA 3M8JA 2DU9A 3FK6A 4HSRA 2KIUA 5LFAA 1P92A 5EF6A 1TBXA 3QYEA 1LDDA 1MMDA 3VYTB 3H35A 4KUMA 3ZN0A 4CCMA 4G12A 2MSYA 3FF5A 4PJNA 3HTUA 1BIAA 3I59B 4BKXA 1HF0A 3LSRA 2LR8A 1MH4A 5ILVA 1SVMA 5DUIA 4JQFA 2H09A 1CGPA 2MC4A 3CDLA 1U5TA 1UCRA 1F9NA 4OOIA 2ZXWH 4A69C 3T0YA 3HYIA 2ID6A 2XGEA 1IRFA 5H2FC 4IHTA 3ZMDA 2L4MA 3SYTA 1WRJA 1FBQA 4WCGA 2WBMA 1TWAJ 2L0KA 1SAXA 2QGUA 5FKLA 4HW0A 4EVIA 5LLQA 3CO7C 2MLKA 3COAC 2DA3A 2E1MC 2RQPA 4PJ0C 1JI8A 4AVPA 1OYWA 3OV8A 2VI6A 3WE2A 2Z5UA 4XRFA 5JVGF 3FBNB 2R5ZB 1K79A 2DDAA 4N4NB 3H1CA 1J2XA 5DEQA 3F21A 2R5YA 3ISPA 2OBPA 5LGUA 1RR8C 3RIRA 2NNYA 2B7EA 1Z05A 3WTSC 5EYRA 2HXOA 1FOYA 2VJJA 4KNYA 1Y1VJ 3L2CA 4A3EJ 3HKZA 4R8HA 1WJEA 2DA4A 3W6JB 1SD7A 2LVSA 2O3FA 3M1CA 4EJVA 2EV5A 1YFHA 2W7NA 3K4BA 1MMGA 1FOKA 3DF8A 1O7FA 4LLNA 5HLTA 1O3SA 4XONA 2XAQA 3E0JB 2MA3A 4HRIA 3HKZN 3GMEA 2XDVA 3PM1A 3O6BB 3CJNA 1UZCA 3DBLB 2V1XA 5D5VB 2HS5A 2ZBKA 4GCVA 3R4KA 3H9JA 1JE8A 1G2HA 1P4XA 1X2MA 2IA0A 2KLOA 3DKWA 3KLNA 2BBYA 4MIMA 2CW0F 2KKOA 3FDYA 1FT9A 2GOMA 2X4HA 2WV1A 4HA8A 4RMNA 4IQJA 3F23A 3MKYB 4RAYA 4E6KG 3WTZA 3S1NJ 4QIWN 4M3FA 1R22A 2O8KA 4Y13A 2O8XA 5K7FA 4IRHA 3K6GA 5A2QZ 4JX6A 4LITA 3EUAA 4NC8A 1Q1HA 3ROUA 2DTZA 4BGDA 4ZYDA 5IT9Z 2TDXA 4HLXA 2DA5A 3ZMUA 4PGHA 3IAS2 3KYLA 2FX0A 2VE9A 1Z3XA 3JR9A 3KP5A 2JN6A 3KP6A 1G8XA 2Y30A 4WK8F 1FYKA 3CC4I 2L5QA 1B9NA 1UG0A 1IN7A 3O3KA 3K70D 3G1OA 4CYCB 4Z2YA 2AQEA 3HHGA 4E7SA 4IL6C 4TV7A 2DA1A 1D5VA 5JFRA 4DBQA 3GZ6A 5CVVA 4AUXA 1WJ5A 3K1MA 2K5CA 2JRMA 4EV0A 1BM9A 2Y31A 3WTWC 3WTVC 1R9TJ 1D0XA 3C3WA 4BQNA 1TZLA 2DMNA 2YR2A 4B4CA 2BY0A 3RCOA 1R1VA 2XGDA 2XIGA 5F0FA 4I09A 1E3PA 4L5IA 4DYCA 1HKTA 1JXSA 1OQYA 2MFZA 1TWGJ 3KPHA 2IA2A 5HLHA 2VBYA 3FK7A 1O3TA 3GTOJ 3J7AO 1TT0A 1KYWA 3DBHB 4BDZA 4A12A 1EJ9A 2ZFWA 4BAYA 4EGYA 2LLKA 4EGZA 1QRYA 1Y8QB 3LFUA 4II3A 1JGGA 1S5LC 3BY6A 1OJLA 3P9KA 4LB5A 1W36D 3SFIA 3CCRI 5HLIA 4A3MJ 1D3YA 1W7PA 3A4CA 4QSHA 1KGSA 2MH2A 1KZHA 4QLCU 4HEA2 2K40A 5F04A 3DP7A 2NVQJ 2UUZA 2Y2ZA 3DXJF 2DK8A 2KISA 4Y33A 4A0ZA 1MD0A 4XLPF 1YHQI 5FD6A 3FHNA 4UUSB 3AFHA 2EV0A 1BI3A 3E97A 4A3IJ 1IV8A 1A35A 4RDUA 3G73A 1R49A 3ZQGA 3OS1A 1IN6A 3FBIB 3LAJA 1OR7C 1E3OC 1B8IB 2PJPA 3TKYA 4KISA 3F6VA 1T39A 3Q3SA 5F6FA 1MH3A 3HG9A 1ETVA 1I27A 3WU1B 4O5VA 1FWZA 1HLVA 4BJTA 1RKWA 2EIMH 5CVIA 5K5QA 4J19A 3K4LA 5HODA 3SEQA 2NS8A 2DODA 4NNJA 1W5TA 5TRDA 3DWLE 1O57A 2F4OB 1XSXA 4CCOA 1ERDA 2IEKA 5LHGA 4XRSA 4HQMA 1XGOA 2VIXA 1RR7A 4JK1X 3QYFA 5LHHA 2AQFA 4IJAA 1SC7A 4EJTA 1OR7A 2IJLA 2E34A 4G8XA 3ZMSA 1ZYRF 3S17J 3W3CA 3GFIA 3CLQA 2ZNYA 2LY2A 3BC8A 4LK0F 3IH3A 1XSVA 2JUCA 1LE8B 2KJBA 2VBXA 2A61A 4KN4X 1MBJA 3KP2A 2E1CA 3S1MJ 4LB6B 4BJ6C 2BY1A 1I1SA 4NC7A 3CCLI 2X48A 1USTA 2HOAA 2DYRH 1MDMB 4E7KA 3CUOA 3GFMA 4RB0A 2XASA 3ZQ7A 3BTJA 1QQIA 2VT3A 3ERMA 4LK1F 4IOAF 2XHKA 4BUPA 2BHZA 2EFOA 2WC2A 1LVKA 3TDZC 3JRFA 3KZIC 2E7WA 3DV8A 4HPQA 2E5ZA 3TW7A 2L7ZA 3CQZJ 4M9ZA 3FXRA 3RKWA 1RC9A 2DQLA 1ON2A 3B6CA 2IGMA 3HDDA 3VFZA 5FLXZ 2R7SA 2OA4A 3WGGA 3I55I 3GWZA 2XF7A 1AKHB 4E7JA 2R7VA 5D6EA 2WB1A 3E1SA 3HPHA 3CZ6A 2ELHA 4AWXB 4MEXF 1ETXA 1V3FA 2UWMA 4CDGA 1FP2A 4IZZA 1YOVB 1Z91A 3D5SC 2A69F 1BI1A 4KT5C 2MLGA 1QNTA 1U5TB 3IP4B 2XAUA 4ESJA 2RREA 1FY7A 1T98A 2IGKA 3V8JA 2L02A 1MDMA 3A03A 4IEJA 2DXIA 1U9OA 2HQAA 3MCZA 3JRGA 2BOLA 3A2KA 1MMSA 4FT8A 5IOZA 5E18F 2GM4A 5BS6A 2BE5F 3WU2C 4OIOF 4QPOA 3Q9VA 2LFBA 4ENKA 3AL0B 1YTYA 3PJRA 3FXLA 3TQNA 1S7OA 3GFLA 1E0EA 3RTRA 3BCAA 2R93J 1ENHA 3GTPJ 5J1YA 4EQQA 1ORKA 1I1GA 1BOBA 3U1KA 2FBIA 2F4MB 3BR6A 3I58A 1IUFA 1Z67A 1UHWA 2K4BA 3CMAI 1PYVA 1WKMA 2GIVA 5E8IA 4CHUA 2VT2A 2DQRA 2BYVE 2P81A 4OIRF 3GTKJ 1K6YA 2MYSA 2GXAA 2DW4A 1X2NA 1NK3P 1YJWI 5ICGA 4OWRB 3M4OJ 1FTZA 3CCSI 1Y56A 4JYKA 4ZYGA 3S1RJ 1HW1A 2XF5A 1OYIA 2CG4A 2XAFA 2X6OA 3ABLH 4A3JJ 1DDNA 2FU4A 3ULQB 1W4MA 4IX7A 3HXLA 2LTPA 1H8AC 2B63J 1TLHB 4X1EA 1HDPA 2LREA 4UUSA 4HF1A 2ETHA 3I64A 3IAM2 3L00A 4GO1A 3SZTA 3S1QJ 3QWLA 3DQVC 1IN8A 3P7NA 1XMKA 1STZA 4XICA 1RNLA 2GWRA 3KEYA 4XRMA 4DZPA 3QP5A 4MHGA 2W1OA 3W2WA 1XB4A 1YIOA 4PSWA 2PI0A 2RN7A 2I10A 3KZZA 4P9UA 2R7UA 1SFOJ 4DNCA 3AG1H 2NVTJ 1TC3C 4M3BA 4YFKF 2FOKA 2F5FA 3BG3A 1HBXG 3DPUA 4G7ZF 4JX5A 3L2WA 3DLLF 3CCYA 1SFKA 3R60A 4Y3OA 3BQZA 4DJAA 3KP4A 1U3EM 4L5JA 2F48A 2JT1A 4YFXF 5HOOA 3A0BC 2EZIA 2HGCA 2VC1A 3EUHC 2EFWA 1WI9A 3H3ZA 4U7BA 3KEQA 3ZP5A 4CYCA 3W2AA 5GAEJ 1V55H 3HGGA 1J75A 3CJQB 5LGNA 2CQ7A 2VJ4A 4UXNA 1FBUA 2ZJQF 2W00A 4BY7J 2ZXHA 2KT0A 3T8RA 4A5MA 3K70C 4FX4A 3FKIJ 3ZGKA 1I50J 2LSOA 2JA5J 2HYGD 1SMTA 2QQ8A 5D5XB 2E2JJ 3KIOA 2XF6A 2VQGA 1R23A 2Y0SN 5KAIC 1S7AA 4BACA 2Y69H 4A3FJ 2HR3A 3H5RA 5DV5A 4ESBA 4XQFA 5BOXA 3M7GA 2LH9A 1WGXA 2F2EA 3FM3A 3RQ4A 1B1BA 3BR0A 2HNHA 1YITI 3CDHA 4CH7A 1OCOH 2DYSH 2XV4S 4BYYA 4IOCF 1TT5B 4PSXA 4AIKA 3J81K 2YU3A 3BPVA 1IRGA 1SD5A 2EILH 1DP7P 2KRHA 3JW4A 1NH3A 2RVCA 3GW2A 1ZAOA 4BY1J 5FKKA 3E3VA 1ZRCA 4A0XA 2V9PA 2ZJ2A 2JSPA 3PFYA 4HYEA 2TCTA 5DYMA 2HOSA 2PJRB 2CW7A 3QRFF 2FBKA 3PUFA 1K83J 2B0LA 2CGPA 1KU3A 1ZHFA 1JKOC 5DDGA 2N8GA 2QKMB 1JHFA 1K61A 3PUBA 4ZDOA 4G6TB 1MBFA 1R5GA 1FEXA 1NG6A 1HXDA 2HDWA 4K2EA 4DZJA 2AO9A 1IN4A 3QPHA 5F27A 2DOFA 4HOBA 1ZRDA 1G59A 2R7XA 3H5NA 3CMMA 5EEAA 1OPCA 4IKFA 4E7HA 3S3NA 2QSGX 1QGPA 1G3TA 3RZDJ 5EDNA 5IYBJ 3BG7A 4GYIA 2I8DA 2XPUA 2NOGA 3R0AA 2L7MP 3L09A 2COMA 3LFKA 3VYSB 4KDPA 3WTYC 4NBQA 2ZMEC 5E17F 2DA6A 4WX9A 3PIOF 1BR1A 1JKRC 1R5ID 2O0YA 3CJRB 3JCUC 1V5EA 2CU7A 4L9JA 2X1CA 1YW8A 2FBHA 1CF7A 4II2A 1DP3A 3GUDA 3IRQA 5LRRA 2ZSIB 2DAOA 3FXUA 3ZRGA 4PFOA 3A01A 2IS4A 4IHWA 3ESWB 2O5RA 2RV8A 5J1UA 4FHTA 1SVLA 2OCEA 3QOPA 2VJ5A 1U6GA 4L9VA 3JSOA 1TQPA 2HQRA 2QUFA 5EGOA 3ZQLA 3REOA 5ILSA 4G7HF 5DM7F 4BQAA 3LSHA 1BL0A 3IL2A 5DCMA 2COBA 2BZTA 3O8HA 1I3AA 4ZYHA 1W1WE 2JA2A 4A5NA 4JP0A 2H1LA 4ZTFA 3I4NJ 2L01A 1OCCH 2BXZA 1DU0A 2BHYA 1KQ9A 4ETSA 1S29A 2M34A 2NVUB 4MEYF 4F91B 5HLGA 4NC6A 3ABUA 3E6BA 4GGGA 4M73A 1WZ2A 2HKXA 5EJCA 2QEXI 1VQ7I 2OD5A 2KZVA 3HOUJ 2WB1N 1X1AA 2VJIA 2ME0A 3QQAA 3TMOA 1PUFA 2UV1A 1K78B 2KRFA 1D1BA 2YPRA 1GLNA 3CUQB 3FMRA 3GLLA 4O3MA 4XLNF 2JJ7A 1FYLA 2A05A 1IF1A 1X58A 5M3FJ 4LLLA 4I0BA 1DQUA 3FZVA 1HW5A 5D4SA 3A1YA 4G94A 2R7RA 2XAHA 2AS5F 3RYRA 2HVRA 1QVTA 1A31A 1XDSA 1FIPA 3WTUC 3W2VA 5D5UB 1HDDC 1MNMC 2CFOA 2P7VB 2PX9A 3CDIA 2WAQN 2J5PA 2XAJA 3BR5A 4N4OB 1YI2I 3TGNA 5D5WB 3CC2I 4BHCA 4DYQA 3PNYA 1OYYA 3LQQA 2NNNA 2CUZA 4C3JJ 3MQ0A 1L3LA 3CJTB 1FNNA 3G1LA 5B3SH 1QO0D 2OQRA 1B72B 4HX4A 3PSIA 5C3EJ 1BC8C 4N9IA 1EF4A 1ONVA 2H8RA 3AG3H 3WHCA 4S0HB 1O7LA 3DEUA 4RGRA 1ETKA 4EM0B 5CVJA 1FIAA 2EZKA 2X85A 1I6XA 2VASA 2M9HA 1AOYA 2E19A 2WY7Q 1CQTA 3TO7A 3GBGA 3GO5A 1M1EB 1TWHJ 3VYRB 5HS7A 4EJUA 4AVZA 2UXXA 3SJMA 2GXBA 1T0FA 2W24A 4KFCA 5IT9K 2L4AA 4CCJA 3F22A 3ZQFA 3KYDB 4KICA 4PGGA 4LG3A 3ZXSA 5FRMA 4PDKA 3WE3A 4Q48A 3M8FA 5TISC 5EEHA 4YELA 1MNEA 2CQNA 3LWFA 2D1VA 2QYOA 3BLYA 5C44J 2BW3B 4KITB 3FXQA 1MIJA 5J1RA 2KDOA 3ZQCA 5ICFA 1MGTA 3U1DA 3WG7H 1LFBA 4HF0A 1BJAA 2WAEA 2EJRA 1Z0XA 2NVYJ 2PMZA 3I4PA 3FIWA 2A6EF 3PNVA 1J09A 3S2DJ 2KHMA 1T56A 4P5OA 2QA4I 2QSHX 1Z6TA 3NARA 2JUGA 1U5TC 3BJOA 2QENA 3BROA 2EB7A 2M87A 3I9V2 4PJJA 4HQEA 3HB9A 2PFBA 2JQ7A 2Z3YA 1SFEA 4RM3A 2V6CA 4N0BA 3MAJA 4ASNA 1VQPI 2Z9OA 1B6AA 2FE3A 1S9HA 2VE8A 2MGQA 3C2GA 1BI2A 1QHGA 1XC5A 3RSNA 3WGIA 2E35A 3T8TA 3NEUA 4ENNA 3OYJA 2EA4A 2DT7B 2KPMA 2EWNA 4DQ2A 1GHCA 3IV5A 5FROA 4CZCA 4ON0A 2O7OA 1YLFA 1HA8A 4Y15A 4HSTA 1IGNA 3QP6A 4GYGA 2BW3A 2DA2A 4A6EA 4BDYA 4EM1A 2R4GA 2LD5A 4G6DA 2L54A 4PJLA 4B1RA 3MKLA 1UB9A 2JSCA 1R1UA 2VL8A 3PFIA 1D8KA 3K1PA 4Q47A 4EJWA 3K0LA 1YG2A 3K9TA 2XRLA 3OYNA 4RLFA 1Y8RB 4BU2A 3TOAA 3G4SI 1X1PA 4S04A 1TQIA 1T33A 2F6CA 2M5WA 3BDDA 1G3SA 1UELB 4S05A 3CUQA 2FOWA 4BH9A 2EZHA 1HKSA 4E4HA 3F72A 3E5XA 3DTIA 4RAZA 2EIJH 3V7SA 2HPMA 1UAAA 1IW7F 5IP6A 1X1DA 4ESFA 4OAYA 3PO3J 3DU5A 4YEJA 3CCUI 1REPC 1VQ9I 1AU7A 2QWWA 4KIBA 2DA7A 5E79C 5GPCA 2GZWA 3HRSA 4KN7X 2QBYB 2P7CB 4B09A 2ZSHB 4QWQA 2CUEA 2IS6A 1T2KA 3S93A 4XN0A 3IKTA 1P7IA 2ZMEB 2RQQA 1TNSA 3K2ZA 1WVRA 2CSOA 1OCTC 2KIQA 3W6VA 2Y75A 3E6MA 2LF8A 1LEAA 3IH4A 4UVAA 3EUHA 1FPQA 1Y1WJ 4U7DA 3GTJJ 2ESHA 3LNQA 5K5OA 4C3IJ 2DJIA 1R00A 1ZARA 1ETQA 3C1DA 4QPQA 2DMQA 1N75A 3HM5A 1LKXA 1RPWA 3NAUA 1R1TA 5IYDJ 3K1NA 5HDKA 3JTGA 5K1YA 2ZB9A 4ZJZA 4M72A 2NRAC 3E7LA 4NHJA 1OISA 3TDUC 1WQ2A 2CQXA 4A3CJ 5EGOB 1XMXA 2LYCA 3J7ZI 2QBYA 2EFQA 3BG9A 3PQJA 2IS2A 2R92J 1FSEA 2HZDA 4A6DA 4RB2C 1AWCA 5DTDA 1GDTA 2FRHA 2VKDA 1QU3A 2EV6A 3E5QA 2ECCA 4J01A 1N78A 2GXGA 1OKRA 5HDGA 3VPRA 3EDPA 2P8TA 2GOXB 1PP7U 2STWA 2HPIA 4GXOA 4UY8I 3DU6A 3V8KA 2DFEA 2JA7J 2KRCA 4P96A 3LSPA 3CF5F 2KDZA 3FISA 3GZ5A 4N9HA 3GTLJ 3LSIA 1D0ZA 3RI4A 1XX5A 1YYVA 2H1KA 2Q0OA 4XSXF 3EUKL 5IP9J 2V1UA 4KMUX 4UUTA 1UMQA 1SVOA 3NWSA 4CICA 4D7NA 3P9CA 3DLAA 3HSEA 4XLAA 3RKXA 2HYFA 4QTRA 1TL8A 2EA2A 1Z7UA 3DEWA 3BOQA 3MWMA 4PJMA 3S16J 1SAUA 1RUNA 3CP8A 3ECHA 1LFPA 5M3MJ 3L9FA 3EYYA 3KX2A 1T8IA 3E6DA 2E2IJ 3RKQA 4XKWA 1LDJA 1YS7A 1WJBA 2Z1DA 3ASNH 5IP7J 2QQAA 2CJJA 1PDNC 4DOZA 2VONA 4F52A 2JPBA 5F64A 5K7ZA 1HCRA 3CLOA 3HOSA 4A3BJ 5D8LB 1J7KA 1LE8A 2RNJA 1GXPA 4KT6A 1WH5A 3BJ6A 1APLC 1F5TA 2FNAA 1B72A 2QF7A 1PUEE 2KFDA 2IAIA 5J4YA 2A6TA 4P1WA 1W36C 3QPTA 2YSRA 4D5FA 4B47A 3KCCA 3ZQQA 3HL2A 3TW6A 2DK5A 2QCOA 2ZXIA 4YG2F 1XTAA 5AONA 1MZBA 2M30A 3FMSA 3GEZA 5EZGA 1GV5A 5FB2A 4RS8A 2NS7A 4U88A 3IRRA 2ISZA 2ESNA 2L7FP 2R7OA 2R7DA 5J3LA 3R0JA 1VQLI 2FNPA 1WJFA 5CQGA 2RGVA 1RI7A 5JVTA 3KP7A 3HUGB 4B3AA 1WPKA 2DN0A 3J7YJ 1G3YA 5L3EA 2F5CA 1WJDA 4A93J 1LPQA 1RIOH 3ERED 1HKQA 2VQHA 4OINF 1POGA 3TP3A 4YIIA 1YRNB 1TWFJ 4XKVA 3IUOA 3LOCA 2MD5A 2H27A 4AIHA 2QZ8A 3DPLC 2L9SA 3IC7A 1X3ZB 4V2GA 2OTJI 9ANTA 4BXUA 2W85A 1J9IA 3V7RA 4HNUA 4LG0A 2RNGA 2XROA 2PMHA 2X0LA 1BC7C 5L3FA 5E1WA 4HNTA 3BJAA 3K4NA 3HTSB 2X6YA 4FE4A 2Q2EB 3JREA 3PQKA 1ODDA 1TNTA 2FD5A 2M8GX 4MLOA 2X9DA 1YX3A 2EBIA 2FJ1A 3IWZA 3WU0A 2FMYA 5H6RA 4BHPA 2ID3A 4FQGA 2R7FA 4I2OA 1FZPB 1Q1VA 2DDBA 5TGTA 1SD4A 3K7AJ 3AG4H 3F8MA 1E3HA 2ACJA 1XPXA 2KL4A 2H6CA 3F6OA 2Y48A 1IG7A 4HZFA 1HQCA 1KU9A 1L0OC 3R61A 3MN2A 5IT3A 1BJZA 4HBLA 2LP0A 3VSKA 1U0JA 2ZXJA 3ABKH 4XR6A 5E3NA 2D5VA 2PBIA 4KMFA 4ZTJA 5M5WJ 1MMAA 2MBFA 3SZGA 5BMZA 2PJRA 2GA1A 4UB6C 2XB5A 3FXMA 3ASOH 2BXYA 1BIBA 2GQQA 5HS9A 3M3YJ 5KCMA 3RJPA 2DMUA 4B8XA 2PLYA 2AXLA 3S8PA 1R4NB 5CYVA 4DBRA 1GVJA 3F8BA 3UR3C 1W5SA 1VZ0A 2VUMJ 1LB2A 1X3WB 2RKHA 3ZQIA 3VODA 1WSUA 4MGRA 2FUG2 5LD2C 3RPUA 4LIVA 4XSZF 3ZOBA 3KYCB 4AIJA 1BBYA 4LJZF 2IRFG 1BW6A 2L9VA 2R0QC 1XN7A 2P0WA 3BCBA 3VSLA 3V42A 1IDZA 2HVQA 2DFHA 1QPMA 2DLLA 3IHUA 4HX7A 3BR2A 2K86A 5E20A 3OOUA 3LQRA 4IHSA 5CVRA 3F0CA 5FJ8J 3F3XA 3UNGC 1PVEA 4GFBA 4UB8C 1CF7B 2VKHA 2E2HJ 2V79A 3NQOA 2V6EA 4XN3A 5EG0A 4RB1A 1TTYA 3QOEA 3L7WA 1AKHA 1ZLJA 3BR1A 3O2PE 1IZ1A 2RAEA 3D0SA 2Z99A 1VQ4I 2JVHA 1QZYA 2HU9A 2VLAA 2VB6A 1LNWA 2A5WA 2M8EA 2YS9A 5HVQC 4NDLA 3AAFA 2BY3A 1QBJA 4G7OF 2X1EA 4ZYEA 4D5CA 3IWFA 1OCZH 4UHTA 3C18A 4HAMA 2ZFUA 4OAZA 4XORA 3I54A 3OR2C 2DJNA 5DCMB 5FKNA 2VQCA 2WAQA 5CKTA 2HOEA 3VYUB 2BEOA 3ABTA 2AHQA 5DD8A 4OMZA 1TWCJ 3MZHA 1XD7A 1X4OA 4CCLA 2CUJA 4BQQA 3J7AY 2ZMEA 4MQVA 2A68F 1WJAA 4Y17A 2Z33A 2E60A 3BT9A 4M6YA 3T5XA 4W1UA 3JRBA 2XPWA 5F1RA 4UUVA 5F1JA 4ANJA 3CO6C 2KP6A 1VQ5I 1G3WA 5LGTA 1ZG1A 1NHAA 2JVGA 2K9LA 4FISA 3Q5FA 1YW9A 2P6TA 1N25A 5JR3A 2HTJA 4JOMA 4BE1A 4L0YB 3MEXA 4ZDLA 5FKMA 1Z21A 4IRIA 2D1HA 4R1HA 2X1DA 5ILUA 2LC2A 2CMPA 1J5YA 1S7EA 5F0CA 4RAFA 4BL0B 1O4XA 3JRIA 2M0CA 1ZELA 2BVLA 3TBIA 1I6HJ 1XMAA 4L18B 2ZC2A 5B66C 2OV7A 4XLFA 1MSEC 3C2HA 1I5ZA 4F55A 1GT0C 3QU6A 2O61A 1BOAA 3SQNA 1JTYA 4I02A 2Y9ZA 4JBAA 4C2UA 2ELKA 4ZYAA 5DCFA 5B1BH 3F8NA 1BR2A 3FXOA 2FSWA 3FX3A 3JTHA 1W5CC 1JKPC 2L9NA 3E6CC 2UZKA 2JRTA 1OFCX 2M7AA 1FMVA 2WA0A 5FD5A 4C3HJ 4HDUA 2R5ZA 2DCEA 3ABMH 4LD5A 1MSFC 4A3GJ 1YS6A 2ZCWA 2EQRA 5M5XJ 1JKQC 3CF2A 3T1BA 1MJAA 4BEHA 4M9XA 1R71A 3LMMA 1IXSB 3G6EI 2IPQX 3SFZA 4HG2A 2UXNA 3A01B 1UHMA 2D45A 3S14J 2LKXA 3K10A 3LSMA 3I56I 2L3DA 2VOOA 3AKZA 4DYRA 5HS8A 1HC8A 3VOEA 3H0DA 2HVSA 4IHVA 4B43A 4BBSJ 1FMWA 2XRNA 4M3EA 2M4KA 2LNBA 4L9TA 3CTAA 3OR1C 3CESA 3DPTA 3FM5A 2CW8A 3Q9SA 2M45A 2P5LC 1S3JA 4X6AJ 4A2UA 2VPLA 3CP2A 1UHSA 5L3CA 4IF4A 1HOMA 2H94A 1ZREA 4KYWA 2QSFX 4CYDA 1A6IA 2OZUA 4XRSG 2Y9YA 1JUPA 3WTTC 1V4RA 1IC8A 2KIFA 2EINH 1D1AA 1IN5A 2MC3A 3GX4X 1EH6A 3ELKA 1U78A 4XOTA 1SEUA 5B1AH 5IOYA 5CVUA 3JSPA 4UNOA 2DOEA 5L3DA 4BXFA 2W57A 1PJRA 3HHHA 4UVCA 2OC6A 3RYPA 5JHUA 2M2EA 2ZJRF 1MBKA 3S3OA 1Y0UA 2OZ6A 2CFXA 4NQWB 2HOTA 3EPZA 4PK4A 1OCPA 3W6KB 5AIQA 2EZLA 4YRVA 3OYMA 2E71A 5D6FA 2VKEA 1D1CA 4FE7A 3WG9A 3L1PA 1FYMA 3JAMZ 2A3SA 5CPRB 2EFNA 2CH0A 5GAHJ 4FX0A 5K5RA 1RZ4A 2NS0A 1JT0A 4J00A 5DD4A 4EEFG 5LRSA 3I5UA 2KQRA 4MQ9F 3TP0A 2XKOA 2CO5A 2Q2EA 3B6AA 3I53A 2IGNA 3BG5A 1JJ6C 2EK5A 1ZTRA 2ZO4A 3M9AA 1V5FA 4PCQA 3WHBA 1IDYA 4XIDA 5B5EC 3U9GA 2MW8A 4RAGA 2TRTA 1NG7A 1I3QJ 4PFPA 2VBWA 2A6HF 2J5OA 2LDUA 5FGMA 1A6QA 3BP8A 2ICWG 2Z16A 4FTHA 1K6OA 1BA5A 1O3RA 4E7IA 1XGMA 5C4XJ 1LVAA 4KIFA 5J8CA 1IUYA 2WAFA 4MO7A 4RGUA 3BWGA 1JGSA 1S8NA 3EETA 1K7AA 1KYZA 1FOXA 3GVAA 5GPAA 3AL0C 2M7BA 2YX4A 1ZRFA 3LA7A 4AD9A 5E8GA 1SFUA 2WY8Q 2FEZA 2W48A 1LQ1A 5D4RA 1T6SA 4M74A 2OQGA 3LSJA 1XGNA 4XBFA 1ZH5A 2QVOA 1EKEA 3HZJA 2ECBA 2M1BA 4RGXA 1QZEA 5C4JJ 3ZR8X 3ZPLA 3PSFA 3OYCA 2B9SA 5AIPA 4Y52J 4BBRJ 4Q5SF 5L3GA 4M71A 1MKMA 2HTSA 1WFXA 3IH2A 2K3FA 2ZJPF 2E1NA 3HOWJ 2EFPA 3OIOA 4CGZA 2QKLB 2R7WA 3UKGA 3N05A 2YX7A 4IPAA 3MFKA 2A07F 2G7HA 4JX4A 2EIKH 1F36A 1Z6RA 1QHHD 4YIFA 1GXQA 1MBGA 2PMUA 3OL4A 1ACIA 2IBDA 2LY9A 3L2VA 3GTMJ 3E5UA 4FASD 2CV2A 3HOXJ 2R7ZJ 4MFEA 3RPQA 2IP2A 3JAMK 2JTVA 2K9SA 4E70A 1YQAA 3S32A 3QODA 5FKOA 4CO8A 2PG4A 2P6SA 3HEFA 5EG0B 2F5EA 4AIDA 4RB3C 1QZZA 3OIPA 3SHFA 2F5DA 2G7UA 3K4JA 4XLCA 2L2OA 2OU2A 2MABA 3SXYA 1A36A 1MBEA 2O9LA 5J40A 4H4KC 4LIUA 4ZH4F 1TW3A 3GXOA 1T95A 3D5RC 4U0VA 2NVXJ 4O6JA 3RQIA 1WCMJ 3SZPA 3OWTA 1RETA 1X1BA 2FXAA 3A02A 3MZYA 1E17A 2DT6A 2JZYA 5KHDA 2R7QA 1S6LA 4F92B 2IXSA 1JJ8C 2LG4A 3SEZA 1ON1A 1RESA 3F8CA 1K4SA 3EYIA 3NWTA 2HQNA 3HBLA 4WWCA 5FO5A 3GYHX 4XL9A 4ZC3A 4AYBA 2XAGA 3HC7A 4BHBA 4I98B 1IV6A 2W84A 5CQEA 3HOVJ 3TO9A 4OIPF 3G3ZA 5JLXA 3GF2A 3QPSA 3BQYA 2XSDC 1ZG5A 2W82A 3KZYA 1FBSA 2JK3A 4HLYA 1Z1DA 5BNGA 1S72I 2JA6J 2VBZA 1KQ0A 2ISYA 4C2TA 2EH3A 2H6BA 4F3QA 1FJLA 3WODF 1ZQ3P 3LL7A 5TJJA 1ZR2A 2Z2SB 2XC7A 1Y39A 4ITVA 3LSKA 3PL8A 4M9SA 2NYXA 3OYHA 4LOCA 1KA8A 4R79A 1BN5A 1KU2A 1LDKB 1D5YA 5DUKA 4CCKA 3Q0VA 1UJ8A 3N97A 2K9NA 2P5VA 2EPFA 2K27A 5GTIC 4ZDPA 3LSTA 2O6GE 1WHUA 5GTHC 1VQOI 1VF9A 4UV8A 5L3BA 4E7LA 4AC0A 2E5NA 3H9QA 3K4KA 3EQLF 2IT0A 5J4VA 5BPDA 1UFMA 3H92A 1P2FA 4WXCA 2QQBA 4BXXJ 5BQTA 1A04A 3BZCA 4NUBA 3JRCA 5IPAA 3QPLA 3HOTA 1ULYA 1HSJA 1HW2A 4Q4ZF 4AYBN 4I01A 4GDFA 2K7LA 3FXJA 3S2WA 2GIZA 4C2MJ 3G71I 5KNLA 4RLQA 3HOYJ 1R36A 1EH7A 3OYAA 4BEHB 2CV1A 1DPRA 1YJNI 4IHXA 1T08B 2E7XA 4L5EA 3OYEA 1W0TA 3G2BA 4G6QA 1VQNI 3L2UA 1ZGJA 3ZMVA 3S3MA 2ME6A 2FF4A 1JT6A 2CS3A 3BTCA 4FETA 4RA2A 3FXKA 3HPGA 4HNVA 1YO5C 4RGSA 2PN6A 3ZCOA 3L2QA 3J80K 1DUXC 4ENJA 1ZLKA 2CQQA 3B02A 2QLZA 3BZKA 2WV0A 1KONA 2HKOA 1BR4A 4P9FA 2DMTA 1EV7A 3H36A 3OYFA 3MZ8A 4FCYA 3DEEA 3X2QH 2CWEA 4A3LJ 3R6SA 3M8EA 2V1NA 3RKYA 1TP4A 4U87A 3C2BA 1P7JA 1QA6A 2VPRA 1Z77A 1B59A 2V9KA 4I0AA 2JMWA 4ABZA 1ZR4A 1DGWY 4GRIA 2V26A 1VTNC 4I99C 2DPDA 4BJ5C 3HSRA 1XCVA 4M3GA 4RM2A 1C0WA 3V4GA 2XGXA 5ICEA 2VODA 2DI3A 1MBHA 5D8KB 3I71A 2GA2A 3KETA 3GTGJ 4EATA 4XK4A 4XM3A 1IJWC 5DM6F 3H0GJ 3QYBA 3LA2A 1I39A 1FLIA 2X51A 1XCBA 2XB0X 3SDBA 2L9RA 4IVNA 4V2FA 3HIFA 1FX7A 1VNDA 4KJZA 4EMSA 3DCFA 2XUBA 2LBFB 1RUOA 4MTDA 1X19A 1B9MA 3OYLA 1JUSA 2E1MB 2V1DA 1GVDA 4L9NA 3VDXA 3KP3A 1R6RA 3WTXC 4G9YA 1X1CA 3QAHA 5IY5H 2G9WA 4KIGA 2XGCA 3KEOA 4OU0A 3TOBA 4D9JA 2BV6A 2MG4A 5CJ9A 5EEGA 4W97A 1H9GA 1G4DA 5GP9A 1WWXA 2E36A 3DKXA 1EH8A 1D0YA 4AU7A 1XGSA 1RRJA 2R7TA 3Q0UA 1U8BA 2ELJA 2YUSA 1MJBA 1AA7A 1ETOA 1NTCA 2X6WA 4Y4RA 2NXNB 5EZHA 2FA5A 2M3AA 4NB5A 2F4IA 2NAZA 2R3SA 3OY9A 1ETWA 3I0TA 3DTEA 2K85A 2KIMA 5FFXA 1MMNA 1SMYF 2W25A 1BW5A 3OYKA 2WADA 2IVMA 5E1ZB 1BI0A 1XSDA 1JHHA 1IO2A 3LA3A 2G0EA 4H0EA 1YE9A 4M6VA 3OS0A 1IRXA 2OCCH 3PO2J 4WF2A 1Z3YA 2C6YA 1ZK8A 1SD6A 2M0MA 1JTXA 1R4MB 5J8FA 2V9VA 4B48A 2PQ8A 3B73A 2WTEA 3GCMA 2XSJC 3GZNB 4U0WA 3U21A 5J6XA 1H9TA 2L7KA 4F93B 4CXFA 3MKWB 3ZN1A 3HOZJ 4BQOA 2ADUA 5FFZA 1R7JA 1XG1A 2Y0SA 2DT5A 5DS9A 1P4AA 3J80Z 3PIPF 3CCEI 2STTA 3SDGA 3K69A 1YW7A 4WXHA 3ONQA 4XLEA 2KZGA 1MW7A 3D5LA 3LSGA 3O8GA 1OCRH 2IS1A 5K7HA 3TEDA 1XS9A 2JA8J 3PNTA 2VQLA 2PEXA 3ZQHA 3IKVA 1OLTA 4OIQF 1KQ8A 1W7PD 2V7FA 1Z7LA 2H8WA 4CCNA 5JLWA 1LUJB 1NK2P 4YIRX 2M4GA 3H3UA 2BVMA 4C30A 5KAFC 4EM2A 2HZTA 3OL3A 2K02A 1ZGAA 5CLSA 1JUMA 3KLOA 2V4JC 1ZN2A 1LEBA 1G6NA 3OOPA 4CA0A 2DO7A 1YJ9I 3DFGA 2LKPA 2K9QA 3BR3A 4D0PA 3GTQJ 2LF7A 5F08A 2LMDA 3OSFA 4C9YA 5KVRA 2GAUA 1F1ZA 4LLGF 3ML6A 1FP1D 2IGOA 3HGYA 2DFFA 2HDCA 2HDDA 2K4JA 4M6XA 5E3OA 1ETYA 2OUMA 5E3LA 4Z6YA 3WGHA 2DPUA 1WI3A 4XNFA 2HXIA 2DOAA 1VQ6I 1ZG3A 4IQ4A 3CCJI 4ZZLA 2A5YB 3HSFA 2LRDA 3DKYA 2X6XA 4IXAA 1U9NA 3HRTA 3Q0WA 1PUFB 3L2RA 1K78A 4BNCA 1HSTA 3F9KA 2MD0A 3FHZA 3KE2A 3G1MA 3H5AA 1MNDA 2HI3A 4EJOA 3JRAA 4CZZA 3FWEA 4AM3A 2VOPA 4LG0B 2LOOA 1FTTA 3BG6A 3TO6A 1ZKGA 1VQ8I 1O3QA 3KFWX 4PZJA 4L0ZB
chains in the Genus database with same CATH topology
2JPCA 1H0MA 4LGWA 4P55A 4I7HA 4MNUA 4ENMA 3ECOA 3HUGA 3N4MA 4UV9A 2IA1A 5FLXK 1OMIA 5LEKA 5H6QA 6PAXA 5LEJA 4WXDA 2VXZA 3I59A 2Q8KA 4IRGA 1E2XA 2BGCA 4F7ZA 1R5HA 5H20A 2ZKZA 2P4WA 1KU7A 2DFIA 1P6RA 4NQWA 2FMLA 1J59A 3V8LA 1X3UA 1IXCA 1TW2A 2MH9A 5LHIA 3GFJA 1U8RA 1Z9CA 2DTRA 2VC0A 2RDPA 4HX8A 4KA4A 3VB2A 2O03A 1U2WA 5ED4A 3NRVA 3GLXA 3P9IA 3M1EA 4A0YA 4OMYA 1W7PB 2ZNZA 3FMQA 1R58A 2XKPA 1F4KA 1D8JA 2QM3A 4HV6A 5BPIA 2HEOA 1T38A 3F8FA 4LFUA 1IXRC 2HFHA 4MTEA 1SFXA 1IAWA 3BPXA 5JI6A 3HRMA 1FSHA 1P4WA 3C7JA 2CYYA 2VN2A 5HDNA 1DPUA 1PP8F 4HF2A 2FQ3A 2KJCA 2XVCA 1MJ9A 3ZMTA 4U0YA 2D2WA 1LJ9A 4ZZDA 5LBQA 1FC3A 1J0RA 5E1XA 3HRUA 3RDIA 1TQMA 2Y0MA 2QQ9A 3VEPA 1USSA 2OAZA 2P5KA 4LMYA 5ERIA 3V7CA 2CQKA 5KK1A 3BZ6A 3CUQC 2DBBA 3ZMZA 3U2RA 4UVBA 2RC4A 2WWYA 4HV5A 2HWVA 3J81Z 3LAPA 1XDUA 3QU3A 4YFNF 4HDVA 1B4AA 5A2QK 2IW5A 5ICCA 2DU9A 2KIUA 1P92A 1TBXA 1LDDA 4KUMA 3ZN0A 3FF5A 3HTUA 1BIAA 3I59B 5ILVA 5DUIA 4JQFA 2H09A 1CGPA 1U5TA 1UCRA 1F9NA 4OOIA 3T0YA 3HYIA 1IRFA 4IHTA 3ZMDA 2L4MA 1WRJA 1FBQA 4WCGA 1SAXA 4HW0A 4EVIA 5LLQA 3CO7C 2MLKA 3COAC 2RQPA 4AVPA 1OYWA 3OV8A 3WE2A 2Z5UA 4XRFA 1K79A 1J2XA 5DEQA 3F21A 3ISPA 2OBPA 5LGUA 3RIRA 2NNYA 1Z05A 3WTSC 4KNYA 3L2CA 4R8HA 3W6JB 1SD7A 2O3FA 4EJVA 1YFHA 2EV5A 1FOKA 3DF8A 1O7FA 4LLNA 1O3SA 2XAQA 2MA3A 3O6BB 3CJNA 2V1XA 5D5VB 2HS5A 2ZBKA 4GCVA 3R4KA 1JE8A 1P4XA 2IA0A 3DKWA 3KLNA 2BBYA 2CW0F 2KKOA 1FT9A 2X4HA 4HA8A 3F23A 4RAYA 3WTZA 1R22A 4Y13A 2O8XA 4IRHA 5A2QZ 3ROUA 1Q1HA 4ZYDA 5IT9Z 2TDXA 4HLXA 3ZMUA 4PGHA 2VE9A 3KP5A 3KP6A 4WK8F 1FYKA 1B9NA 1IN7A 3O3KA 4Z2YA 3HHGA 4TV7A 1D5VA 5JFRA 3GZ6A 5CVVA 3K1MA 4EV0A 1BM9A 3WTWC 3WTVC 3C3WA 2YR2A 1R1VA 2XIGA 4I09A 4L5IA 1HKTA 1JXSA 2IA2A 5HLHA 2VBYA 1O3TA 3J7AO 1KYWA 4A12A 2ZFWA 4BAYA 4EGYA 4EGZA 3BY6A 3P9KA 4LB5A 5HLIA 1D3YA 1W7PA 1KGSA 2MH2A 4QLCU 3DP7A 3DXJF 2DK8A 4A0ZA 1MD0A 4XLPF 5FD6A 2EV0A 1BI3A 3E97A 3G73A 1IN6A 3LAJA 2PJPA 3TKYA 3F6VA 1T39A 5F6FA 1I27A 3WU1B 4O5VA 1FWZA 5CVIA 5K5QA 1W5TA 5TRDA 1O57A 1XSXA 5LHGA 4HQMA 1XGOA 5LHHA 4JK1X 4EJTA 4IJAA 1OR7A 2IJLA 4G8XA 3ZMSA 1ZYRF 3GFIA 2ZNYA 4LK0F 1XSVA 2KJBA 2VBXA 2E1CA 2A61A 3KP2A 4KN4X 4LB6B 1I1SA 1USTA 1MDMB 3CUOA 3GFMA 4RB0A 2XASA 3ZQ7A 1QQIA 2VT3A 4LK1F 2XHKA 2EFOA 2WC2A 3TDZC 2E7WA 3DV8A 4M9ZA 3FXRA 3RKWA 2DQLA 1ON2A 3VFZA 5FLXZ 2OA4A 3WGGA 3GWZA 5D6EA 2ELHA 4AWXB 4MEXF 1V3FA 2UWMA 4CDGA 1FP2A 1Z91A 2A69F 1BI1A 4KT5C 2MLGA 1QNTA 1U5TB 4ESJA 1FY7A 1T98A 3V8JA 2L02A 1MDMA 3MCZA 4FT8A 5E18F 5BS6A 2BE5F 4OIOF 3Q9VA 4ENKA 1YTYA 3TQNA 1S7OA 3GFLA 3RTRA 4EQQA 1I1GA 2FBIA 3I58A 1UHWA 2K4BA 1WKMA 2GIVA 4CHUA 5E8IA 2VT2A 2DQRA 2BYVE 4OIRF 2DW4A 5ICGA 4ZYGA 1HW1A 1OYIA 2CG4A 2XAFA 1DDNA 2FU4A 3ULQB 1W4MA 1TLHB 4HF1A 2ETHA 3I64A 3L00A 4GO1A 3SZTA 3DQVC 1IN8A 3P7NA 1XMKA 1STZA 1RNLA 2GWRA 3QP5A 4MHGA 1XB4A 1YIOA 2PI0A 2RN7A 3KZZA 4P9UA 4DNCA 4YFKF 2FOKA 2F5FA 1HBXG 4G7ZF 3R60A 3KP4A 1U3EM 4L5JA 2JT1A 4YFXF 5HOOA 2HGCA 2VC1A 2EFWA 1WI9A 3H3ZA 4U7BA 3KEQA 3ZP5A 1J75A 5LGNA 4UXNA 1FBUA 4A5MA 3T8RA 4FX4A 2LSOA 2HYGD 1SMTA 5D5XB 1R23A 1S7AA 2HR3A 5DV5A 4ESBA 5BOXA 3M7GA 2F2EA 3FM3A 1B1BA 3CDHA 2XV4S 4BYYA 4AIKA 3J81K 2YU3A 3BPVA 1IRGA 1SD5A 1DP7P 3JW4A 2RVCA 3GW2A 1ZAOA 3E3VA 1ZRCA 4A0XA 2ZJ2A 4HYEA 5DYMA 3QRFF 2FBKA 2B0LA 2CGPA 1KU3A 1ZHFA 5DDGA 1JHFA 1R5GA 1HXDA 4K2EA 1IN4A 3QPHA 4HOBA 1ZRDA 1OPCA 1QGPA 1G3TA 4GYIA 3R0AA 3L09A 2COMA 3LFKA 4KDPA 3WTYC 5E17F 4WX9A 2O0YA 4L9JA 1YW8A 2FBHA 1CF7A 3GUDA 3IRQA 5LRRA 2DAOA 3FXUA 2RV8A 4FHTA 3QOPA 1U6GA 4L9VA 3JSOA 1TQPA 2HQRA 2QUFA 3REOA 5ILSA 4G7HF 4BQAA 3IL2A 5DCMA 4ZYHA 4A5NA 2L01A 1KQ9A 4ETSA 1S29A 4MEYF 5HLGA 3ABUA 3E6BA 4GGGA 4M73A 2HKXA 2OD5A 1K78B 2KRFA 2YPRA 3CUQB 3FMRA 4O3MA 4XLNF 1FYLA 1IF1A 4LLLA 4I0BA 3FZVA 1HW5A 5D4SA 4G94A 2XAHA 2AS5F 3RYRA 1XDSA 3WTUC 5D5UB 2P7VB 2J5PA 2XAJA 3TGNA 5D5WB 4BHCA 1OYYA 3LQQA 2NNNA 3MQ0A 1L3LA 1FNNA 1QO0D 2OQRA 4HX4A 1BC8C 4N9IA 1ONVA 1O7LA 3DEUA 4RGRA 4EM0B 5CVJA 1I6XA 1AOYA 3TO7A 3GO5A 5HS7A 4EJUA 2UXXA 2GXBA 1T0FA 2W24A 4KFCA 5IT9K 2L4AA 3F22A 4KICA 4PGGA 4PDKA 3WE3A 4Q48A 3M8FA 5EEHA 3LWFA 2D1VA 2QYOA 3FXQA 5ICFA 1MGTA 3U1DA 4HF0A 1BJAA 2EJRA 3I4PA 2A6EF 4P5OA 1Z6TA 1U5TC 3BJOA 2QENA 3BROA 4HQEA 2EB7A 2M87A 2PFBA 2Z3YA 1SFEA 2V6CA 4N0BA 3MAJA 4ASNA 2Z9OA 1B6AA 2FE3A 2VE8A 1BI2A 3WGIA 3T8TA 3NEUA 4ENNA 2EA4A 4DQ2A 2EWNA 1GHCA 4ON0A 1YLFA 4Y15A 3QP6A 4GYGA 4A6EA 4EM1A 4G6DA 2L54A 1UB9A 2JSCA 1R1UA 3PFIA 4EJWA 4Q47A 1D8KA 3K1PA 3K0LA 1YG2A 3K9TA 3TOAA 4S04A 1TQIA 2M5WA 3BDDA 1G3SA 4S05A 3CUQA 4BH9A 1HKSA 3F72A 3E5XA 4RAZA 3V7SA 1IW7F 4ESFA 1REPC 2QWWA 4KIBA 2GZWA 3HRSA 4KN7X 2QBYB 2P7CB 4B09A 4QWQA 1T2KA 3IKTA 2ZMEB 1TNSA 3K2ZA 2CSOA 2Y75A 3E6MA 2LF8A 1LEAA 4UVAA 3EUHA 1FPQA 4U7DA 2ESHA 5K5OA 1R00A 1ZARA 3C1DA 1R1TA 3K1NA 5HDKA 3JTGA 5K1YA 2NRAC 4M72A 4NHJA 3TDUC 1WQ2A 2QBYA 2EFQA 3PQJA 1FSEA 4RB2C 4A6DA 1AWCA 2FRHA 2EV6A 3E5QA 2GXGA 1OKRA 5HDGA 3EDPA 2P8TA 1PP7U 2STWA 4GXOA 3V8KA 4P96A 3GZ5A 4N9HA 3RI4A 1YYVA 2Q0OA 4XSXF 2V1UA 4KMUX 4CICA 3P9CA 3HSEA 3RKXA 2HYFA 2EA2A 1Z7UA 3BOQA 3MWMA 1RUNA 3ECHA 3L9FA 3EYYA 3E6DA 1LDJA 1YS7A 2QQAA 1PDNC 2VONA 2JPBA 5F64A 3CLOA 3HOSA 5D8LB 1J7KA 2RNJA 1GXPA 1F5TA 3BJ6A 2FNAA 1PUEE 3QPTA 2YSRA 3KCCA 2DK5A 4YG2F 5AONA 1MZBA 2M30A 3FMSA 3GEZA 5FB2A 4RS8A 4U88A 3IRRA 2ISZA 2ESNA 2R7DA 3R0JA 2FNPA 5JVTA 2RGVA 1RI7A 3KP7A 1G3YA 5L3EA 2F5CA 1RIOH 3ERED 1HKQA 4OINF 4YIIA 2MD5A 2H27A 4AIHA 2QZ8A 3DPLC 3IC7A 4BXUA 2W85A 1J9IA 3V7RA 4LG0A 2XROA 2PMHA 2X0LA 1BC7C 5L3FA 5E1WA 3BJAA 3HTSB 3PQKA 1ODDA 1TNTA 3IWZA 3WU0A 2FMYA 5H6RA 4BHPA 2R7FA 4I2OA 1FZPB 1SD4A 3F8MA 2ACJA 2H6CA 3F6OA 2Y48A 4HZFA 1HQCA 1KU9A 1L0OC 3R61A 5IT3A 4HBLA 2ZXJA 2PBIA 4KMFA 5BMZA 2MBFA 2GA1A 1BIBA 2GQQA 5HS9A 3RJPA 4B8XA 2PLYA 2AXLA 5CYVA 1GVJA 3F8BA 1W5SA 1LB2A 2RKHA 1WSUA 3VODA 4MGRA 3RPUA 4XSZF 4AIJA 1BBYA 4LJZF 2IRFG 1XN7A 1QPMA 2DLLA 3IHUA 4HX7A 2K86A 5E20A 3LQRA 4IHSA 5CVRA 3F3XA 1CF7B 2V79A 3NQOA 4RB1A 1TTYA 3L7WA 1ZLJA 3O2PE 1IZ1A 3D0SA 2Z99A 1QZYA 1LNWA 2M8EA 5HVQC 3AAFA 1QBJA 4G7OF 4ZYEA 3IWFA 4UHTA 3C18A 4HAMA 3I54A 5DCMB 2HOEA 2BEOA 3ABTA 5DD8A 4OMZA 3MZHA 1XD7A 2ZMEA 4MQVA 2A68F 4Y17A 2Z33A 4M6YA 3T5XA 5F1RA 4UUVA 3CO6C 1G3WA 5LGTA 1ZG1A 1NHAA 3Q5FA 1YW9A 2P6TA 5JR3A 2HTJA 4L0YB 3MEXA 4IRIA 2D1HA 4R1HA 5ILUA 1J5YA 1XMAA 4L18B 1I5ZA 3QU6A 2O61A 1BOAA 3SQNA 4I02A 4JBAA 5DCFA 3F8NA 2FSWA 3FX3A 3JTHA 3E6CC 2UZKA 2JRTA 5FD5A 4HDUA 4LD5A 1YS6A 2ZCWA 3T1BA 1MJAA 4M9XA 1IXSB 2IPQX 3SFZA 2UXNA 1UHMA 2D45A 2L3DA 2VOOA 5HS8A 3VOEA 2XRNA 4L9TA 2LNBA 3CTAA 3DPTA 3FM5A 3Q9SA 2M45A 2P5LC 1S3JA 4A2UA 5L3CA 4IF4A 2H94A 1ZREA 4KYWA 4CYDA 2OZUA 3WTTC 1V4RA 2KIFA 1IN5A 2MC3A 3GX4X 1EH6A 3ELKA 1U78A 5CVUA 3JSPA 4UNOA 5L3DA 2W57A 3HHHA 4UVCA 3RYPA 5JHUA 1Y0UA 2OZ6A 2CFXA 3W6KB 5AIQA 5D6FA 3WG9A 1FYMA 3JAMZ 2A3SA 2EFNA 4FX0A 5K5RA 1RZ4A 2NS0A 5DD4A 5LRSA 3I5UA 4MQ9F 2XKOA 2CO5A 2Q2EA 3I53A 2EK5A 2ZO4A 3M9AA 4PCQA 3U9GA 2VBWA 2A6HF 2J5OA 2LDUA 5FGMA 3BP8A 1K6OA 1O3RA 1XGMA 1LVAA 4KIFA 5J8CA 1IUYA 4RGUA 3BWGA 1JGSA 1S8NA 3EETA 1K7AA 1KYZA 3GVAA 2YX4A 1ZRFA 3LA7A 4AD9A 5E8GA 1SFUA 2FEZA 1LQ1A 5D4RA 1T6SA 4M74A 2OQGA 1XGNA 4XBFA 1ZH5A 2QVOA 2M1BA 4RGXA 3ZPLA 5AIPA 4Q5SF 5L3GA 4M71A 1MKMA 2HTSA 2E1NA 2EFPA 4CGZA 2YX7A 4IPAA 3MFKA 2A07F 2G7HA 1Z6RA 4YIFA 1GXQA 2PMUA 3E5UA 3RPQA 2IP2A 3JAMK 2JTVA 4E70A 1YQAA 4CO8A 2PG4A 2P6SA 2F5EA 4RB3C 1QZZA 3SHFA 2F5DA 2G7UA 2OU2A 3SXYA 4ZH4F 1TW3A 3GXOA 4U0VA 4O6JA 3SZPA 2FXAA 3MZYA 1E17A 2JZYA 1S6LA 1ON1A 3F8CA 3EYIA 2HQNA 4WWCA 5FO5A 3GYHX 2XAGA 4BHBA 4I98B 2W84A 3TO9A 4OIPF 3G3ZA 3GF2A 1ZG5A 3KZYA 1FBSA 4HLYA 1Z1DA 2VBZA 1KQ0A 2ISYA 2H6BA 3WODF 5TJJA 4M9SA 2NYXA 1KA8A 4R79A 1BN5A 1KU2A 1LDKB 5DUKA 3N97A 2P5VA 2K27A 3LSTA 2O6GE 4UV8A 5L3BA 3EQLF 2IT0A 5BPDA 1UFMA 3H92A 1P2FA 4WXCA 2QQBA 5BQTA 1A04A 3HOTA 1HW2A 1ULYA 1HSJA 4Q4ZF 4I01A 2K7LA 3S2WA 1R36A 1EH7A 1DPRA 2E7XA 4G6QA 1ZGJA 3ZMVA 2FF4A 1YO5C 4RGSA 2PN6A 3J80K 1DUXC 4ENJA 1ZLKA 3B02A 2QLZA 2WV0A 2HKOA 4P9FA 1EV7A 2CWEA 3R6SA 3M8EA 3RKYA 1B59A 4I0AA 1VTNC 2DPDA 3HSRA 1XCVA 1C0WA 3V4GA 2XGXA 5ICEA 2VODA 2DI3A 5D8KB 3I71A 2GA2A 3KETA 3LA2A 1FLIA 1XCBA 4IVNA 3HIFA 1FX7A 4EMSA 2XUBA 1RUOA 4MTDA 1B9MA 2V1DA 4L9NA 3KP3A 3WTXC 4G9YA 3QAHA 2G9WA 4KIGA 3KEOA 4OU0A 3TOBA 2BV6A 5CJ9A 5EEGA 1H9GA 1G4DA 1WWXA 1EH8A 1XGSA 1MJBA 2FA5A 4NB5A 2NAZA 2R3SA 3I0TA 5FFXA 2KIMA 1SMYF 2W25A 2IVMA 5E1ZB 1BI0A 1XSDA 1JHHA 3LA3A 4H0EA 4WF2A 2C6YA 1SD6A 5J8FA 2V9VA 2PQ8A 3B73A 2WTEA 4U0WA 5J6XA 1H9TA 4CXFA 3ZN1A 2ADUA 5FFZA 1R7JA 2DT5A 1P4AA 3J80Z 2STTA 3K69A 1YW7A 4WXHA 3D5LA 2PEXA 3IKVA 4OIQF 1KQ8A 1W7PD 3H3UA 4EM2A 2HZTA 2K02A 1ZGAA 5CLSA 3KLOA 1ZN2A 1LEBA 1G6NA 3OOPA 2DO7A 3DFGA 2LKPA 4D0PA 2LF7A 5KVRA 2GAUA 1F1ZA 4LLGF 3ML6A 1FP1D 2HDCA 2K4JA 4M6XA 3WGHA 2DPUA 1ZG3A 4ZZLA 2A5YB 3HSFA 4IXAA 3HRTA 1K78A 4BNCA 1HSTA 3FHZA 3KE2A 4EJOA 4CZZA 3FWEA 2VOPA 4LG0B 3TO6A 1O3QA 3KFWX 4PZJA 4L0ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPC A;  1H0M A;  4LGW A;  4P55 A;  4I7H A;  4MNU A;  4ENM A;  3ECO A;  3HUG A;  3N4M A;  4UV9 A;  2IA1 A;  5FLX K;  1OMI A;  5LEK A;  5H6Q A;  6PAX A;  5LEJ A;  4WXD A;  2VXZ A;  3I59 A;  2Q8K A;  4IRG A;  1E2X A;  2BGC A;  4F7Z A;  1R5H A;  5H20 A;  2ZKZ A;  2P4W A;  1KU7 A;  2DFI A;  1P6R A;  4NQW A;  2FML A;  1J59 A;  3V8L A;  1X3U A;  1IXC A;  1TW2 A;  2MH9 A;  5LHI A;  3GFJ A;  1U8R A;  1Z9C A;  2DTR A;  2VC0 A;  2RDP A;  4HX8 A;  4KA4 A;  3VB2 A;  2O03 A;  1U2W A;  5ED4 A;  3NRV A;  3GLX A;  3P9I A;  3M1E A;  4A0Y A;  4OMY A;  1W7P B;  2ZNZ A;  3FMQ A;  1R58 A;  2XKP A;  1F4K A;  1D8J A;  2QM3 A;  4HV6 A;  5BPI A;  2HEO A;  1T38 A;  3F8F A;  4LFU A;  1IXR C;  2HFH A;  4MTE A;  1SFX A;  1IAW A;  3BPX A;  5JI6 A;  3HRM A;  1FSH A;  1P4W A;  3C7J A;  2CYY A;  2VN2 A;  5HDN A;  1DPU A;  1PP8 F;  4HF2 A;  2FQ3 A;  2KJC A;  2XVC A;  1MJ9 A;  3ZMT A;  4U0Y A;  2D2W A;  1LJ9 A;  4ZZD A;  5LBQ A;  1FC3 A;  1J0R A;  5E1X A;  3HRU A;  3RDI A;  1TQM A;  2Y0M A;  2QQ9 A;  3VEP A;  1USS A;  2OAZ A;  2P5K A;  4LMY A;  5ERI A;  3V7C A;  2CQK A;  5KK1 A;  3BZ6 A;  3CUQ C;  2DBB A;  3ZMZ A;  3U2R A;  4UVB A;  2RC4 A;  2WWY A;  4HV5 A;  2HWV A;  3J81 Z;  3LAP A;  1XDU A;  3QU3 A;  4YFN F;  4HDV A;  1B4A A;  5A2Q K;  2IW5 A;  5ICC A;  2DU9 A;  2KIU A;  1P92 A;  1TBX A;  1LDD A;  4KUM A;  3ZN0 A;  3FF5 A;  3HTU A;  1BIA A;  3I59 B;  5ILV A;  5DUI A;  4JQF A;  2H09 A;  1CGP A;  1U5T A;  1UCR A;  1F9N A;  4OOI A;  3T0Y A;  3HYI A;  1IRF A;  4IHT A;  3ZMD A;  2L4M A;  1WRJ A;  1FBQ A;  4WCG A;  1SAX A;  4HW0 A;  4EVI A;  5LLQ A;  3CO7 C;  2MLK A;  3COA C;  2RQP A;  4AVP A;  1OYW A;  3OV8 A;  3WE2 A;  2Z5U A;  4XRF A;  1K79 A;  1J2X A;  5DEQ A;  3F21 A;  3ISP A;  2OBP A;  5LGU A;  3RIR A;  2NNY A;  1Z05 A;  3WTS C;  4KNY A;  3L2C A;  4R8H A;  3W6J B;  1SD7 A;  2O3F A;  4EJV A;  1YFH A;  2EV5 A;  1FOK A;  3DF8 A;  1O7F A;  4LLN A;  1O3S A;  2XAQ A;  2MA3 A;  3O6B B;  3CJN A;  2V1X A;  5D5V B;  2HS5 A;  2ZBK A;  4GCV A;  3R4K A;  1JE8 A;  1P4X A;  2IA0 A;  3DKW A;  3KLN A;  2BBY A;  2CW0 F;  2KKO A;  1FT9 A;  2X4H A;  4HA8 A;  3F23 A;  4RAY A;  3WTZ A;  1R22 A;  4Y13 A;  2O8X A;  4IRH A;  5A2Q Z;  3ROU A;  1Q1H A;  4ZYD A;  5IT9 Z;  2TDX A;  4HLX A;  3ZMU A;  4PGH A;  2VE9 A;  3KP5 A;  3KP6 A;  4WK8 F;  1FYK A;  1B9N A;  1IN7 A;  3O3K A;  4Z2Y A;  3HHG A;  4TV7 A;  1D5V A;  5JFR A;  3GZ6 A;  5CVV A;  3K1M A;  4EV0 A;  1BM9 A;  3WTW C;  3WTV C;  3C3W A;  2YR2 A;  1R1V A;  2XIG A;  4I09 A;  4L5I A;  1HKT A;  1JXS A;  2IA2 A;  5HLH A;  2VBY A;  1O3T A;  3J7A O;  1KYW A;  4A12 A;  2ZFW A;  4BAY A;  4EGY A;  4EGZ A;  3BY6 A;  3P9K A;  4LB5 A;  5HLI A;  1D3Y A;  1W7P A;  1KGS A;  2MH2 A;  4QLC U;  3DP7 A;  3DXJ F;  2DK8 A;  4A0Z A;  1MD0 A;  4XLP F;  5FD6 A;  2EV0 A;  1BI3 A;  3E97 A;  3G73 A;  1IN6 A;  3LAJ A;  2PJP A;  3TKY A;  3F6V A;  1T39 A;  5F6F A;  1I27 A;  3WU1 B;  4O5V A;  1FWZ A;  5CVI A;  5K5Q A;  1W5T A;  5TRD A;  1O57 A;  1XSX A;  5LHG A;  4HQM A;  1XGO A;  5LHH A;  4JK1 X;  4EJT A;  4IJA A;  1OR7 A;  2IJL A;  4G8X A;  3ZMS A;  1ZYR F;  3GFI A;  2ZNY A;  4LK0 F;  1XSV A;  2KJB A;  2VBX A;  2E1C A;  2A61 A;  3KP2 A;  4KN4 X;  4LB6 B;  1I1S A;  1UST A;  1MDM B;  3CUO A;  3GFM A;  4RB0 A;  2XAS A;  3ZQ7 A;  1QQI A;  2VT3 A;  4LK1 F;  2XHK A;  2EFO A;  2WC2 A;  3TDZ C;  2E7W A;  3DV8 A;  4M9Z A;  3FXR A;  3RKW A;  2DQL A;  1ON2 A;  3VFZ A;  5FLX Z;  2OA4 A;  3WGG A;  3GWZ A;  5D6E A;  2ELH A;  4AWX B;  4MEX F;  1V3F A;  2UWM A;  4CDG A;  1FP2 A;  1Z91 A;  2A69 F;  1BI1 A;  4KT5 C;  2MLG A;  1QNT A;  1U5T B;  4ESJ A;  1FY7 A;  1T98 A;  3V8J A;  2L02 A;  1MDM A;  3MCZ A;  4FT8 A;  5E18 F;  5BS6 A;  2BE5 F;  4OIO F;  3Q9V A;  4ENK A;  1YTY A;  3TQN A;  1S7O A;  3GFL A;  3RTR A;  4EQQ A;  1I1G A;  2FBI A;  3I58 A;  1UHW A;  2K4B A;  1WKM A;  2GIV A;  4CHU A;  5E8I A;  2VT2 A;  2DQR A;  2BYV E;  4OIR F;  2DW4 A;  5ICG A;  4ZYG A;  1HW1 A;  1OYI A;  2CG4 A;  2XAF A;  1DDN A;  2FU4 A;  3ULQ B;  1W4M A;  1TLH B;  4HF1 A;  2ETH A;  3I64 A;  3L00 A;  4GO1 A;  3SZT A;  3DQV C;  1IN8 A;  3P7N A;  1XMK A;  1STZ A;  1RNL A;  2GWR A;  3QP5 A;  4MHG A;  1XB4 A;  1YIO A;  2PI0 A;  2RN7 A;  3KZZ A;  4P9U A;  4DNC A;  4YFK F;  2FOK A;  2F5F A;  1HBX G;  4G7Z F;  3R60 A;  3KP4 A;  1U3E M;  4L5J A;  2JT1 A;  4YFX F;  5HOO A;  2HGC A;  2VC1 A;  2EFW A;  1WI9 A;  3H3Z A;  4U7B A;  3KEQ A;  3ZP5 A;  1J75 A;  5LGN A;  4UXN A;  1FBU A;  4A5M A;  3T8R A;  4FX4 A;  2LSO A;  2HYG D;  1SMT A;  5D5X B;  1R23 A;  1S7A A;  2HR3 A;  5DV5 A;  4ESB A;  5BOX A;  3M7G A;  2F2E A;  3FM3 A;  1B1B A;  3CDH A;  2XV4 S;  4BYY A;  4AIK A;  3J81 K;  2YU3 A;  3BPV A;  1IRG A;  1SD5 A;  1DP7 P;  3JW4 A;  2RVC A;  3GW2 A;  1ZAO A;  3E3V A;  1ZRC A;  4A0X A;  2ZJ2 A;  4HYE A;  5DYM A;  3QRF F;  2FBK A;  2B0L A;  2CGP A;  1KU3 A;  1ZHF A;  5DDG A;  1JHF A;  1R5G A;  1HXD A;  4K2E A;  1IN4 A;  3QPH A;  4HOB A;  1ZRD A;  1OPC A;  1QGP A;  1G3T A;  4GYI A;  3R0A A;  3L09 A;  2COM A;  3LFK A;  4KDP A;  3WTY C;  5E17 F;  4WX9 A;  2O0Y A;  4L9J A;  1YW8 A;  2FBH A;  1CF7 A;  3GUD A;  3IRQ A;  5LRR A;  2DAO A;  3FXU A;  2RV8 A;  4FHT A;  3QOP A;  1U6G A;  4L9V A;  3JSO A;  1TQP A;  2HQR A;  2QUF A;  3REO A;  5ILS A;  4G7H F;  4BQA A;  3IL2 A;  5DCM A;  4ZYH A;  4A5N A;  2L01 A;  1KQ9 A;  4ETS A;  1S29 A;  4MEY F;  5HLG A;  3ABU A;  3E6B A;  4GGG A;  4M73 A;  2HKX A;  2OD5 A;  1K78 B;  2KRF A;  2YPR A;  3CUQ B;  3FMR A;  4O3M A;  4XLN F;  1FYL A;  1IF1 A;  4LLL A;  4I0B A;  3FZV A;  1HW5 A;  5D4S A;  4G94 A;  2XAH A;  2AS5 F;  3RYR A;  1XDS A;  3WTU C;  5D5U B;  2P7V B;  2J5P A;  2XAJ A;  3TGN A;  5D5W B;  4BHC A;  1OYY A;  3LQQ A;  2NNN A;  3MQ0 A;  1L3L A;  1FNN A;  1QO0 D;  2OQR A;  4HX4 A;  1BC8 C;  4N9I A;  1ONV A;  1O7L A;  3DEU A;  4RGR A;  4EM0 B;  5CVJ A;  1I6X A;  1AOY A;  3TO7 A;  3GO5 A;  5HS7 A;  4EJU A;  2UXX A;  2GXB A;  1T0F A;  2W24 A;  4KFC A;  5IT9 K;  2L4A A;  3F22 A;  4KIC A;  4PGG A;  4PDK A;  3WE3 A;  4Q48 A;  3M8F A;  5EEH A;  3LWF A;  2D1V A;  2QYO A;  3FXQ A;  5ICF A;  1MGT A;  3U1D A;  4HF0 A;  1BJA A;  2EJR A;  3I4P A;  2A6E F;  4P5O A;  1Z6T A;  1U5T C;  3BJO A;  2QEN A;  3BRO A;  4HQE A;  2EB7 A;  2M87 A;  2PFB A;  2Z3Y A;  1SFE A;  2V6C A;  4N0B A;  3MAJ A;  4ASN A;  2Z9O A;  1B6A A;  2FE3 A;  2VE8 A;  1BI2 A;  3WGI A;  3T8T A;  3NEU A;  4ENN A;  2EA4 A;  4DQ2 A;  2EWN A;  1GHC A;  4ON0 A;  1YLF A;  4Y15 A;  3QP6 A;  4GYG A;  4A6E A;  4EM1 A;  4G6D A;  2L54 A;  1UB9 A;  2JSC A;  1R1U A;  3PFI A;  4EJW A;  4Q47 A;  1D8K A;  3K1P A;  3K0L A;  1YG2 A;  3K9T A;  3TOA A;  4S04 A;  1TQI A;  2M5W A;  3BDD A;  1G3S A;  4S05 A;  3CUQ A;  4BH9 A;  1HKS A;  3F72 A;  3E5X A;  4RAZ A;  3V7S A;  1IW7 F;  4ESF A;  1REP C;  2QWW A;  4KIB A;  2GZW A;  3HRS A;  4KN7 X;  2QBY B;  2P7C B;  4B09 A;  4QWQ A;  1T2K A;  3IKT A;  2ZME B;  1TNS A;  3K2Z A;  2CSO A;  2Y75 A;  3E6M A;  2LF8 A;  1LEA A;  4UVA A;  3EUH A;  1FPQ A;  4U7D A;  2ESH A;  5K5O A;  1R00 A;  1ZAR A;  3C1D A;  1R1T A;  3K1N A;  5HDK A;  3JTG A;  5K1Y A;  2NRA C;  4M72 A;  4NHJ A;  3TDU C;  1WQ2 A;  2QBY A;  2EFQ A;  3PQJ A;  1FSE A;  4RB2 C;  4A6D A;  1AWC A;  2FRH A;  2EV6 A;  3E5Q A;  2GXG A;  1OKR A;  5HDG A;  3EDP A;  2P8T A;  1PP7 U;  2STW A;  4GXO A;  3V8K A;  4P96 A;  3GZ5 A;  4N9H A;  3RI4 A;  1YYV A;  2Q0O A;  4XSX F;  2V1U A;  4KMU X;  4CIC A;  3P9C A;  3HSE A;  3RKX A;  2HYF A;  2EA2 A;  1Z7U A;  3BOQ A;  3MWM A;  1RUN A;  3ECH A;  3L9F A;  3EYY A;  3E6D A;  1LDJ A;  1YS7 A;  2QQA A;  1PDN C;  2VON A;  2JPB A;  5F64 A;  3CLO A;  3HOS A;  5D8L B;  1J7K A;  2RNJ A;  1GXP A;  1F5T A;  3BJ6 A;  2FNA A;  1PUE E;  3QPT A;  2YSR A;  3KCC A;  2DK5 A;  4YG2 F;  5AON A;  1MZB A;  2M30 A;  3FMS A;  3GEZ A;  5FB2 A;  4RS8 A;  4U88 A;  3IRR A;  2ISZ A;  2ESN A;  2R7D A;  3R0J A;  2FNP A;  5JVT A;  2RGV A;  1RI7 A;  3KP7 A;  1G3Y A;  5L3E A;  2F5C A;  1RIO H;  3ERE D;  1HKQ A;  4OIN F;  4YII A;  2MD5 A;  2H27 A;  4AIH A;  2QZ8 A;  3DPL C;  3IC7 A;  4BXU A;  2W85 A;  1J9I A;  3V7R A;  4LG0 A;  2XRO A;  2PMH A;  2X0L A;  1BC7 C;  5L3F A;  5E1W A;  3BJA A;  3HTS B;  3PQK A;  1ODD A;  1TNT A;  3IWZ A;  3WU0 A;  2FMY A;  5H6R A;  4BHP A;  2R7F A;  4I2O A;  1FZP B;  1SD4 A;  3F8M A;  2ACJ A;  2H6C A;  3F6O A;  2Y48 A;  4HZF A;  1HQC A;  1KU9 A;  1L0O C;  3R61 A;  5IT3 A;  4HBL A;  2ZXJ A;  2PBI A;  4KMF A;  5BMZ A;  2MBF A;  2GA1 A;  1BIB A;  2GQQ A;  5HS9 A;  3RJP A;  4B8X A;  2PLY A;  2AXL A;  5CYV A;  1GVJ A;  3F8B A;  1W5S A;  1LB2 A;  2RKH A;  1WSU A;  3VOD A;  4MGR A;  3RPU A;  4XSZ F;  4AIJ A;  1BBY A;  4LJZ F;  2IRF G;  1XN7 A;  1QPM A;  2DLL A;  3IHU A;  4HX7 A;  2K86 A;  5E20 A;  3LQR A;  4IHS A;  5CVR A;  3F3X A;  1CF7 B;  2V79 A;  3NQO A;  4RB1 A;  1TTY A;  3L7W A;  1ZLJ A;  3O2P E;  1IZ1 A;  3D0S A;  2Z99 A;  1QZY A;  1LNW A;  2M8E A;  5HVQ C;  3AAF A;  1QBJ A;  4G7O F;  4ZYE A;  3IWF A;  4UHT A;  3C18 A;  4HAM A;  3I54 A;  5DCM B;  2HOE A;  2BEO A;  3ABT A;  5DD8 A;  4OMZ A;  3MZH A;  1XD7 A;  2ZME A;  4MQV A;  2A68 F;  4Y17 A;  2Z33 A;  4M6Y A;  3T5X A;  5F1R A;  4UUV A;  3CO6 C;  1G3W A;  5LGT A;  1ZG1 A;  1NHA A;  3Q5F A;  1YW9 A;  2P6T A;  5JR3 A;  2HTJ A;  4L0Y B;  3MEX A;  4IRI A;  2D1H A;  4R1H A;  5ILU A;  1J5Y A;  1XMA A;  4L18 B;  1I5Z A;  3QU6 A;  2O61 A;  1BOA A;  3SQN A;  4I02 A;  4JBA A;  5DCF A;  3F8N A;  2FSW A;  3FX3 A;  3JTH A;  3E6C C;  2UZK A;  2JRT A;  5FD5 A;  4HDU A;  4LD5 A;  1YS6 A;  2ZCW A;  3T1B A;  1MJA A;  4M9X A;  1IXS B;  2IPQ X;  3SFZ A;  2UXN A;  1UHM A;  2D45 A;  2L3D A;  2VOO A;  5HS8 A;  3VOE A;  2XRN A;  4L9T A;  2LNB A;  3CTA A;  3DPT A;  3FM5 A;  3Q9S A;  2M45 A;  2P5L C;  1S3J A;  4A2U A;  5L3C A;  4IF4 A;  2H94 A;  1ZRE A;  4KYW A;  4CYD A;  2OZU A;  3WTT C;  1V4R A;  2KIF A;  1IN5 A;  2MC3 A;  3GX4 X;  1EH6 A;  3ELK A;  1U78 A;  5CVU A;  3JSP A;  4UNO A;  5L3D A;  2W57 A;  3HHH A;  4UVC A;  3RYP A;  5JHU A;  1Y0U A;  2OZ6 A;  2CFX A;  3W6K B;  5AIQ A;  5D6F A;  3WG9 A;  1FYM A;  3JAM Z;  2A3S A;  2EFN A;  4FX0 A;  5K5R A;  1RZ4 A;  2NS0 A;  5DD4 A;  5LRS A;  3I5U A;  4MQ9 F;  2XKO A;  2CO5 A;  2Q2E A;  3I53 A;  2EK5 A;  2ZO4 A;  3M9A A;  4PCQ A;  3U9G A;  2VBW A;  2A6H F;  2J5O A;  2LDU A;  5FGM A;  3BP8 A;  1K6O A;  1O3R A;  1XGM A;  1LVA A;  4KIF A;  5J8C A;  1IUY A;  4RGU A;  3BWG A;  1JGS A;  1S8N A;  3EET A;  1K7A A;  1KYZ A;  3GVA A;  2YX4 A;  1ZRF A;  3LA7 A;  4AD9 A;  5E8G A;  1SFU A;  2FEZ A;  1LQ1 A;  5D4R A;  1T6S A;  4M74 A;  2OQG A;  1XGN A;  4XBF A;  1ZH5 A;  2QVO A;  2M1B A;  4RGX A;  3ZPL A;  5AIP A;  4Q5S F;  5L3G A;  4M71 A;  1MKM A;  2HTS A;  2E1N A;  2EFP A;  4CGZ A;  2YX7 A;  4IPA A;  3MFK A;  2A07 F;  2G7H A;  1Z6R A;  4YIF A;  1GXQ A;  2PMU A;  3E5U A;  3RPQ A;  2IP2 A;  3JAM K;  2JTV A;  4E70 A;  1YQA A;  4CO8 A;  2PG4 A;  2P6S A;  2F5E A;  4RB3 C;  1QZZ A;  3SHF A;  2F5D A;  2G7U A;  2OU2 A;  3SXY A;  4ZH4 F;  1TW3 A;  3GXO A;  4U0V A;  4O6J A;  3SZP A;  2FXA A;  3MZY A;  1E17 A;  2JZY A;  1S6L A;  1ON1 A;  3F8C A;  3EYI A;  2HQN A;  4WWC A;  5FO5 A;  3GYH X;  2XAG A;  4BHB A;  4I98 B;  2W84 A;  3TO9 A;  4OIP F;  3G3Z A;  3GF2 A;  1ZG5 A;  3KZY A;  1FBS A;  4HLY A;  1Z1D A;  2VBZ A;  1KQ0 A;  2ISY A;  2H6B A;  3WOD F;  5TJJ A;  4M9S A;  2NYX A;  1KA8 A;  4R79 A;  1BN5 A;  1KU2 A;  1LDK B;  5DUK A;  3N97 A;  2P5V A;  2K27 A;  3LST A;  2O6G E;  4UV8 A;  5L3B A;  3EQL F;  2IT0 A;  5BPD A;  1UFM A;  3H92 A;  1P2F A;  4WXC A;  2QQB A;  5BQT A;  1A04 A;  3HOT A;  1HW2 A;  1ULY A;  1HSJ A;  4Q4Z F;  4I01 A;  2K7L A;  3S2W A;  1R36 A;  1EH7 A;  1DPR A;  2E7X A;  4G6Q A;  1ZGJ A;  3ZMV A;  2FF4 A;  1YO5 C;  4RGS A;  2PN6 A;  3J80 K;  1DUX C;  4ENJ A;  1ZLK A;  3B02 A;  2QLZ A;  2WV0 A;  2HKO A;  4P9F A;  1EV7 A;  2CWE A;  3R6S A;  3M8E A;  3RKY A;  1B59 A;  4I0A A;  1VTN C;  2DPD A;  3HSR A;  1XCV A;  1C0W A;  3V4G A;  2XGX A;  5ICE A;  2VOD A;  2DI3 A;  5D8K B;  3I71 A;  2GA2 A;  3KET A;  3LA2 A;  1FLI A;  1XCB A;  4IVN A;  3HIF A;  1FX7 A;  4EMS A;  2XUB A;  1RUO A;  4MTD A;  1B9M A;  2V1D A;  4L9N A;  3KP3 A;  3WTX C;  4G9Y A;  3QAH A;  2G9W A;  4KIG A;  3KEO A;  4OU0 A;  3TOB A;  2BV6 A;  5CJ9 A;  5EEG A;  1H9G A;  1G4D A;  1WWX A;  1EH8 A;  1XGS A;  1MJB A;  2FA5 A;  4NB5 A;  2NAZ A;  2R3S A;  3I0T A;  5FFX A;  2KIM A;  1SMY F;  2W25 A;  2IVM A;  5E1Z B;  1BI0 A;  1XSD A;  1JHH A;  3LA3 A;  4H0E A;  4WF2 A;  2C6Y A;  1SD6 A;  5J8F A;  2V9V A;  2PQ8 A;  3B73 A;  2WTE A;  4U0W A;  5J6X A;  1H9T A;  4CXF A;  3ZN1 A;  2ADU A;  5FFZ A;  1R7J A;  2DT5 A;  1P4A A;  3J80 Z;  2STT A;  3K69 A;  1YW7 A;  4WXH A;  3D5L A;  2PEX A;  3IKV A;  4OIQ F;  1KQ8 A;  1W7P D;  3H3U A;  4EM2 A;  2HZT A;  2K02 A;  1ZGA A;  5CLS A;  3KLO A;  1ZN2 A;  1LEB A;  1G6N A;  3OOP A;  2DO7 A;  3DFG A;  2LKP A;  4D0P A;  2LF7 A;  5KVR A;  2GAU A;  1F1Z A;  4LLG F;  3ML6 A;  1FP1 D;  2HDC A;  2K4J A;  4M6X A;  3WGH A;  2DPU A;  1ZG3 A;  4ZZL A;  2A5Y B;  3HSF A;  4IXA A;  3HRT A;  1K78 A;  4BNC A;  1HST A;  3FHZ A;  3KE2 A;  4EJO A;  4CZZ A;  3FWE A;  2VOP A;  4LG0 B;  3TO6 A;  1O3Q A;  3KFW X;  4PZJ A;  4L0Z B; 
#chains in the Genus database with same CATH topology
 1ZGW A;  4DGW B;  5HNH A;  2OTL I;  2JPC A;  1H0M A;  4LGW A;  4P55 A;  4I7H A;  4PUS A;  1T0F C;  4MNU A;  4B3X A;  4ENM A;  4IO9 F;  3DBR B;  3ECO A;  3HUG A;  3CC7 I;  3N4M A;  1WJC A;  4UV9 A;  3JRD A;  2IA1 A;  5FLX K;  1OMI A;  4XKB A;  2GLO A;  1VQK I;  5JHF A;  2LKS A;  3K4C A;  3BTL A;  4RBO A;  1YRN A;  3BTI A;  5LEK A;  5H6Q A;  6PAX A;  5LEJ A;  4XLH A;  4E7Z A;  4WXD A;  2I5U A;  2PMZ N;  2LK2 A;  2VXZ A;  3I59 A;  2Q8K A;  4IRG A;  3OMY A;  1E2X A;  3FKJ A;  2OJE D;  1EA3 A;  4M3D A;  2BGC A;  2XPV A;  4F7Z A;  1R5H A;  5GAD J;  5H20 A;  2ZKZ A;  2P4W A;  1VQM I;  1KU7 A;  1IRZ A;  3OYI A;  3I4M J;  3I3L A;  2DFI A;  1P6R A;  4NQW A;  2FML A;  1V5G A;  2K9M A;  1J59 A;  3V8L A;  1X3U A;  1IXC A;  4A3K J;  1ITY A;  5J47 A;  5FLV A;  1TW2 A;  2MH9 A;  1F43 A;  3K2A A;  4DW6 A;  5LHI A;  4XOP A;  3S2H J;  3MD2 A;  1GUU A;  3GFJ A;  5GAG J;  2CRG A;  1U8R A;  1AHD P;  1Z9C A;  1FOW A;  2DTR A;  2VC0 A;  4IHY A;  3CCM I;  2RDP A;  4HX8 A;  4I76 A;  3CCQ I;  4B44 A;  4KA4 A;  2R5Y B;  1X4P A;  3VB2 A;  2KMU A;  2O03 A;  1U2W A;  3RPU D;  4I6Z A;  3CME I;  5FRN A;  2HQ5 A;  5ED4 A;  3NRV A;  2YU9 J;  3GLX A;  3P9I A;  3M1E A;  4A0Y A;  1K4T A;  4OMY A;  1RKT A;  1W7P B;  1WH7 A;  2ZNZ A;  3FMQ A;  1R58 A;  2XKP A;  1F4K A;  1D8J A;  2QM3 A;  3OSG A;  5FLM J;  4HV6 A;  3OYG A;  2FQ4 A;  2OF7 A;  4CSW A;  1YIJ I;  2F5V A;  3JRH A;  5BPI A;  2HEO A;  1T38 A;  3F8F A;  3MMY B;  1YX5 A;  1QVU A;  2VXD A;  4LFU A;  3RZO J;  2HYJ A;  1IXR C;  2K3P A;  2HFH A;  4A3D J;  3TL4 X;  2Q1Z B;  3OIQ A;  1SFX A;  4MTE A;  1IAW A;  3BPX A;  3OYB A;  5JI6 A;  3HRM A;  1FSH A;  1P4W A;  3C7J A;  2CYY A;  2VN2 A;  5HDN A;  5M5Y J;  2E1O A;  4XKC A;  1W0U A;  1PP8 F;  3A0H C;  1B8I A;  1DPU A;  2BY2 A;  4HF2 A;  2CV0 A;  2FQ3 A;  2JWT A;  2LBF A;  1Y0N A;  2OPT A;  2KJC A;  2DMP A;  2XVC A;  3D1N I;  3OS2 A;  3H9G A;  1MJ9 A;  3ZMT A;  4U0Y A;  1GV2 A;  2D2W A;  1QPI A;  4D1Q A;  4MFD A;  3K4M A;  4CUG A;  2W4S A;  2NOJ B;  1LJ9 A;  2CUF A;  1P9Q C;  4ZZD A;  5LBQ A;  1UG2 A;  2GBY A;  1FC3 A;  1V54 H;  4V19 K;  3S15 J;  1DGR M;  1H88 C;  1J0R A;  5E1X A;  2AXT C;  3HRU A;  3RDI A;  1Y6I A;  1TQM A;  1A5J A;  2Y0M A;  2QQ9 A;  4X0G A;  3VEP A;  1LFU P;  1USS A;  2OAZ A;  2P5K A;  4LMY A;  3DTK A;  5ERI A;  3V7C A;  2LY1 A;  2CQK A;  5IYC J;  4BE0 A;  5KK1 A;  3BZ6 A;  3CUQ C;  3VWB A;  2DBB A;  2VKV A;  3MVP A;  3P5J A;  4BS9 A;  3ZMZ A;  3U2R A;  4BE2 A;  4UVB A;  3OYD A;  2RC4 A;  1H89 C;  4D7M A;  2WWY A;  4HV5 A;  1SAN A;  2HWV A;  5E3M A;  3J81 Z;  3LAP A;  1XDU A;  3AG2 H;  3HJE A;  4DIQ A;  3CCV I;  1VFC A;  3QU3 A;  4XMY A;  4YFN F;  3MKZ A;  4Y7N J;  1N77 A;  3H3V K;  3CD6 I;  5F0H A;  4HDV A;  1B4A A;  5A2Q K;  3M07 A;  3CMY A;  2IW5 A;  5ICC A;  1VI0 A;  1DU6 A;  5HNF A;  3M8J A;  2DU9 A;  3FK6 A;  4HSR A;  2KIU A;  5LFA A;  1P92 A;  5EF6 A;  1TBX A;  3QYE A;  1LDD A;  1MMD A;  3VYT B;  3H35 A;  4KUM A;  3ZN0 A;  4CCM A;  4G12 A;  2MSY A;  3FF5 A;  4PJN A;  3HTU A;  1BIA A;  3I59 B;  4BKX A;  1HF0 A;  3LSR A;  2LR8 A;  1MH4 A;  5ILV A;  1SVM A;  5DUI A;  4JQF A;  2H09 A;  1CGP A;  2MC4 A;  3CDL A;  1U5T A;  1UCR A;  1F9N A;  4OOI A;  2ZXW H;  4A69 C;  3T0Y A;  3HYI A;  2ID6 A;  2XGE A;  1IRF A;  5H2F C;  4IHT A;  3ZMD A;  2L4M A;  3SYT A;  1WRJ A;  1FBQ A;  4WCG A;  2WBM A;  1TWA J;  2L0K A;  1SAX A;  2QGU A;  5FKL A;  4HW0 A;  4EVI A;  5LLQ A;  3CO7 C;  2MLK A;  3COA C;  2DA3 A;  2E1M C;  2RQP A;  4PJ0 C;  1JI8 A;  4AVP A;  1OYW A;  3OV8 A;  2VI6 A;  3WE2 A;  2Z5U A;  4XRF A;  5JVG F;  3FBN B;  2R5Z B;  1K79 A;  2DDA A;  4N4N B;  3H1C A;  1J2X A;  5DEQ A;  3F21 A;  2R5Y A;  3ISP A;  2OBP A;  5LGU A;  1RR8 C;  3RIR A;  2NNY A;  2B7E A;  1Z05 A;  3WTS C;  5EYR A;  2HXO A;  1FOY A;  2VJJ A;  4KNY A;  1Y1V J;  3L2C A;  4A3E J;  3HKZ A;  4R8H A;  1WJE A;  2DA4 A;  3W6J B;  1SD7 A;  2LVS A;  2O3F A;  3M1C A;  4EJV A;  2EV5 A;  1YFH A;  2W7N A;  3K4B A;  1MMG A;  1FOK A;  3DF8 A;  1O7F A;  4LLN A;  5HLT A;  1O3S A;  4XON A;  2XAQ A;  3E0J B;  2MA3 A;  4HRI A;  3HKZ N;  3GME A;  2XDV A;  3PM1 A;  3O6B B;  3CJN A;  1UZC A;  3DBL B;  2V1X A;  5D5V B;  2HS5 A;  2ZBK A;  4GCV A;  3R4K A;  3H9J A;  1JE8 A;  1G2H A;  1P4X A;  1X2M A;  2IA0 A;  2KLO A;  3DKW A;  3KLN A;  2BBY A;  4MIM A;  2CW0 F;  2KKO A;  3FDY A;  1FT9 A;  2GOM A;  2X4H A;  2WV1 A;  4HA8 A;  4RMN A;  4IQJ A;  3F23 A;  3MKY B;  4RAY A;  4E6K G;  3WTZ A;  3S1N J;  4QIW N;  4M3F A;  1R22 A;  2O8K A;  4Y13 A;  2O8X A;  5K7F A;  4IRH A;  3K6G A;  5A2Q Z;  4JX6 A;  4LIT A;  3EUA A;  4NC8 A;  1Q1H A;  3ROU A;  2DTZ A;  4BGD A;  4ZYD A;  5IT9 Z;  2TDX A;  4HLX A;  2DA5 A;  3ZMU A;  4PGH A;  3IAS 2;  3KYL A;  2FX0 A;  2VE9 A;  1Z3X A;  3JR9 A;  3KP5 A;  2JN6 A;  3KP6 A;  1G8X A;  2Y30 A;  4WK8 F;  1FYK A;  3CC4 I;  2L5Q A;  1B9N A;  1UG0 A;  1IN7 A;  3O3K A;  3K70 D;  3G1O A;  4CYC B;  4Z2Y A;  2AQE A;  3HHG A;  4E7S A;  4IL6 C;  4TV7 A;  2DA1 A;  1D5V A;  5JFR A;  4DBQ A;  3GZ6 A;  5CVV A;  4AUX A;  1WJ5 A;  3K1M A;  2K5C A;  2JRM A;  4EV0 A;  1BM9 A;  2Y31 A;  3WTW C;  3WTV C;  1R9T J;  1D0X A;  3C3W A;  4BQN A;  1TZL A;  2DMN A;  2YR2 A;  4B4C A;  2BY0 A;  3RCO A;  1R1V A;  2XGD A;  2XIG A;  5F0F A;  4I09 A;  1E3P A;  4L5I A;  4DYC A;  1HKT A;  1JXS A;  1OQY A;  2MFZ A;  1TWG J;  3KPH A;  2IA2 A;  5HLH A;  2VBY A;  3FK7 A;  1O3T A;  3GTO J;  3J7A O;  1TT0 A;  1KYW A;  3DBH B;  4BDZ A;  4A12 A;  1EJ9 A;  2ZFW A;  4BAY A;  4EGY A;  2LLK A;  4EGZ A;  1QRY A;  1Y8Q B;  3LFU A;  4II3 A;  1JGG A;  1S5L C;  3BY6 A;  1OJL A;  3P9K A;  4LB5 A;  1W36 D;  3SFI A;  3CCR I;  5HLI A;  4A3M J;  1D3Y A;  1W7P A;  3A4C A;  4QSH A;  1KGS A;  2MH2 A;  1KZH A;  4QLC U;  4HEA 2;  2K40 A;  5F04 A;  3DP7 A;  2NVQ J;  2UUZ A;  2Y2Z A;  3DXJ F;  2DK8 A;  2KIS A;  4Y33 A;  4A0Z A;  1MD0 A;  4XLP F;  1YHQ I;  5FD6 A;  3FHN A;  4UUS B;  3AFH A;  2EV0 A;  1BI3 A;  3E97 A;  4A3I J;  1IV8 A;  1A35 A;  4RDU A;  3G73 A;  1R49 A;  3ZQG A;  3OS1 A;  1IN6 A;  3FBI B;  3LAJ A;  1OR7 C;  1E3O C;  1B8I B;  2PJP A;  3TKY A;  4KIS A;  3F6V A;  1T39 A;  3Q3S A;  5F6F A;  1MH3 A;  3HG9 A;  1ETV A;  1I27 A;  3WU1 B;  4O5V A;  1FWZ A;  1HLV A;  4BJT A;  1RKW A;  2EIM H;  5CVI A;  5K5Q A;  4J19 A;  3K4L A;  5HOD A;  3SEQ A;  2NS8 A;  2DOD A;  4NNJ A;  1W5T A;  5TRD A;  3DWL E;  1O57 A;  2F4O B;  1XSX A;  4CCO A;  1ERD A;  2IEK A;  5LHG A;  4XRS A;  4HQM A;  1XGO A;  2VIX A;  1RR7 A;  4JK1 X;  3QYF A;  5LHH A;  2AQF A;  4IJA A;  1SC7 A;  4EJT A;  1OR7 A;  2IJL A;  2E34 A;  4G8X A;  3ZMS A;  1ZYR F;  3S17 J;  3W3C A;  3GFI A;  3CLQ A;  2ZNY A;  2LY2 A;  3BC8 A;  4LK0 F;  3IH3 A;  1XSV A;  2JUC A;  1LE8 B;  2KJB A;  2VBX A;  2A61 A;  4KN4 X;  1MBJ A;  3KP2 A;  2E1C A;  3S1M J;  4LB6 B;  4BJ6 C;  2BY1 A;  1I1S A;  4NC7 A;  3CCL I;  2X48 A;  1UST A;  2HOA A;  2DYR H;  1MDM B;  4E7K A;  3CUO A;  3GFM A;  4RB0 A;  2XAS A;  3ZQ7 A;  3BTJ A;  1QQI A;  2VT3 A;  3ERM A;  4LK1 F;  4IOA F;  2XHK A;  4BUP A;  2BHZ A;  2EFO A;  2WC2 A;  1LVK A;  3TDZ C;  3JRF A;  3KZI C;  2E7W A;  3DV8 A;  4HPQ A;  2E5Z A;  3TW7 A;  2L7Z A;  3CQZ J;  4M9Z A;  3FXR A;  3RKW A;  1RC9 A;  2DQL A;  1ON2 A;  3B6C A;  2IGM A;  3HDD A;  3VFZ A;  5FLX Z;  2R7S A;  2OA4 A;  3WGG A;  3I55 I;  3GWZ A;  2XF7 A;  1AKH B;  4E7J A;  2R7V A;  5D6E A;  2WB1 A;  3E1S A;  3HPH A;  3CZ6 A;  2ELH A;  4AWX B;  4MEX F;  1ETX A;  1V3F A;  2UWM A;  4CDG A;  1FP2 A;  4IZZ A;  1YOV B;  1Z91 A;  3D5S C;  2A69 F;  1BI1 A;  4KT5 C;  2MLG A;  1QNT A;  1U5T B;  3IP4 B;  2XAU A;  4ESJ A;  2RRE A;  1FY7 A;  1T98 A;  2IGK A;  3V8J A;  2L02 A;  1MDM A;  3A03 A;  4IEJ A;  2DXI A;  1U9O A;  2HQA A;  3MCZ A;  3JRG A;  2BOL A;  3A2K A;  1MMS A;  4FT8 A;  5IOZ A;  5E18 F;  2GM4 A;  5BS6 A;  2BE5 F;  3WU2 C;  4OIO F;  4QPO A;  3Q9V A;  2LFB A;  4ENK A;  3AL0 B;  1YTY A;  3PJR A;  3FXL A;  3TQN A;  1S7O A;  3GFL A;  1E0E A;  3RTR A;  3BCA A;  2R93 J;  1ENH A;  3GTP J;  5J1Y A;  4EQQ A;  1ORK A;  1I1G A;  1BOB A;  3U1K A;  2FBI A;  2F4M B;  3BR6 A;  3I58 A;  1IUF A;  1Z67 A;  1UHW A;  2K4B A;  3CMA I;  1PYV A;  1WKM A;  2GIV A;  5E8I A;  4CHU A;  2VT2 A;  2DQR A;  2BYV E;  2P81 A;  4OIR F;  3GTK J;  1K6Y A;  2MYS A;  2GXA A;  2DW4 A;  1X2N A;  1NK3 P;  1YJW I;  5ICG A;  4OWR B;  3M4O J;  1FTZ A;  3CCS I;  1Y56 A;  4JYK A;  4ZYG A;  3S1R J;  1HW1 A;  2XF5 A;  1OYI A;  2CG4 A;  2XAF A;  2X6O A;  3ABL H;  4A3J J;  1DDN A;  2FU4 A;  3ULQ B;  1W4M A;  4IX7 A;  3HXL A;  2LTP A;  1H8A C;  2B63 J;  1TLH B;  4X1E A;  1HDP A;  2LRE A;  4UUS A;  4HF1 A;  2ETH A;  3I64 A;  3IAM 2;  3L00 A;  4GO1 A;  3SZT A;  3S1Q J;  3QWL A;  3DQV C;  1IN8 A;  3P7N A;  1XMK A;  1STZ A;  4XIC A;  1RNL A;  2GWR A;  3KEY A;  4XRM A;  4DZP A;  3QP5 A;  4MHG A;  2W1O A;  3W2W A;  1XB4 A;  1YIO A;  4PSW A;  2PI0 A;  2RN7 A;  2I10 A;  3KZZ A;  4P9U A;  2R7U A;  1SFO J;  4DNC A;  3AG1 H;  2NVT J;  1TC3 C;  4M3B A;  4YFK F;  2FOK A;  2F5F A;  3BG3 A;  1HBX G;  3DPU A;  4G7Z F;  4JX5 A;  3L2W A;  3DLL F;  3CCY A;  1SFK A;  3R60 A;  4Y3O A;  3BQZ A;  4DJA A;  3KP4 A;  1U3E M;  4L5J A;  2F48 A;  2JT1 A;  4YFX F;  5HOO A;  3A0B C;  2EZI A;  2HGC A;  2VC1 A;  3EUH C;  2EFW A;  1WI9 A;  3H3Z A;  4U7B A;  3KEQ A;  3ZP5 A;  4CYC A;  3W2A A;  5GAE J;  1V55 H;  3HGG A;  1J75 A;  3CJQ B;  5LGN A;  2CQ7 A;  2VJ4 A;  4UXN A;  1FBU A;  2ZJQ F;  2W00 A;  4BY7 J;  2ZXH A;  2KT0 A;  3T8R A;  4A5M A;  3K70 C;  4FX4 A;  3FKI J;  3ZGK A;  1I50 J;  2LSO A;  2JA5 J;  2HYG D;  1SMT A;  2QQ8 A;  5D5X B;  2E2J J;  3KIO A;  2XF6 A;  2VQG A;  1R23 A;  2Y0S N;  5KAI C;  1S7A A;  4BAC A;  2Y69 H;  4A3F J;  2HR3 A;  3H5R A;  5DV5 A;  4ESB A;  4XQF A;  5BOX A;  3M7G A;  2LH9 A;  1WGX A;  2F2E A;  3FM3 A;  3RQ4 A;  1B1B A;  3BR0 A;  2HNH A;  1YIT I;  3CDH A;  4CH7 A;  1OCO H;  2DYS H;  2XV4 S;  4BYY A;  4IOC F;  1TT5 B;  4PSX A;  4AIK A;  3J81 K;  2YU3 A;  3BPV A;  1IRG A;  1SD5 A;  2EIL H;  1DP7 P;  2KRH A;  3JW4 A;  1NH3 A;  2RVC A;  3GW2 A;  1ZAO A;  4BY1 J;  5FKK A;  3E3V A;  1ZRC A;  4A0X A;  2V9P A;  2ZJ2 A;  2JSP A;  3PFY A;  4HYE A;  2TCT A;  5DYM A;  2HOS A;  2PJR B;  2CW7 A;  3QRF F;  2FBK A;  3PUF A;  1K83 J;  2B0L A;  2CGP A;  1KU3 A;  1ZHF A;  1JKO C;  5DDG A;  2N8G A;  2QKM B;  1JHF A;  1K61 A;  3PUB A;  4ZDO A;  4G6T B;  1MBF A;  1R5G A;  1FEX A;  1NG6 A;  1HXD A;  2HDW A;  4K2E A;  4DZJ A;  2AO9 A;  1IN4 A;  3QPH A;  5F27 A;  2DOF A;  4HOB A;  1ZRD A;  1G59 A;  2R7X A;  3H5N A;  3CMM A;  5EEA A;  1OPC A;  4IKF A;  4E7H A;  3S3N A;  2QSG X;  1QGP A;  1G3T A;  3RZD J;  5EDN A;  5IYB J;  3BG7 A;  4GYI A;  2I8D A;  2XPU A;  2NOG A;  3R0A A;  2L7M P;  3L09 A;  2COM A;  3LFK A;  3VYS B;  4KDP A;  3WTY C;  4NBQ A;  2ZME C;  5E17 F;  2DA6 A;  4WX9 A;  3PIO F;  1BR1 A;  1JKR C;  1R5I D;  2O0Y A;  3CJR B;  3JCU C;  1V5E A;  2CU7 A;  4L9J A;  2X1C A;  1YW8 A;  2FBH A;  1CF7 A;  4II2 A;  1DP3 A;  3GUD A;  3IRQ A;  5LRR A;  2ZSI B;  2DAO A;  3FXU A;  3ZRG A;  4PFO A;  3A01 A;  2IS4 A;  4IHW A;  3ESW B;  2O5R A;  2RV8 A;  5J1U A;  4FHT A;  1SVL A;  2OCE A;  3QOP A;  2VJ5 A;  1U6G A;  4L9V A;  3JSO A;  1TQP A;  2HQR A;  2QUF A;  5EGO A;  3ZQL A;  3REO A;  5ILS A;  4G7H F;  5DM7 F;  4BQA A;  3LSH A;  1BL0 A;  3IL2 A;  5DCM A;  2COB A;  2BZT A;  3O8H A;  1I3A A;  4ZYH A;  1W1W E;  2JA2 A;  4A5N A;  4JP0 A;  2H1L A;  4ZTF A;  3I4N J;  2L01 A;  1OCC H;  2BXZ A;  1DU0 A;  2BHY A;  1KQ9 A;  4ETS A;  1S29 A;  2M34 A;  2NVU B;  4MEY F;  4F91 B;  5HLG A;  4NC6 A;  3ABU A;  3E6B A;  4GGG A;  4M73 A;  1WZ2 A;  2HKX A;  5EJC A;  2QEX I;  1VQ7 I;  2OD5 A;  2KZV A;  3HOU J;  2WB1 N;  1X1A A;  2VJI A;  2ME0 A;  3QQA A;  3TMO A;  1PUF A;  2UV1 A;  1K78 B;  2KRF A;  1D1B A;  2YPR A;  1GLN A;  3CUQ B;  3FMR A;  3GLL A;  4O3M A;  4XLN F;  2JJ7 A;  1FYL A;  2A05 A;  1IF1 A;  1X58 A;  5M3F J;  4LLL A;  4I0B A;  1DQU A;  3FZV A;  1HW5 A;  5D4S A;  3A1Y A;  4G94 A;  2R7R A;  2XAH A;  2AS5 F;  3RYR A;  2HVR A;  1QVT A;  1A31 A;  1XDS A;  1FIP A;  3WTU C;  3W2V A;  5D5U B;  1HDD C;  1MNM C;  2CFO A;  2P7V B;  2PX9 A;  3CDI A;  2WAQ N;  2J5P A;  2XAJ A;  3BR5 A;  4N4O B;  1YI2 I;  3TGN A;  5D5W B;  3CC2 I;  4BHC A;  4DYQ A;  3PNY A;  1OYY A;  3LQQ A;  2NNN A;  2CUZ A;  4C3J J;  3MQ0 A;  1L3L A;  3CJT B;  1FNN A;  3G1L A;  5B3S H;  1QO0 D;  2OQR A;  1B72 B;  4HX4 A;  3PSI A;  5C3E J;  1BC8 C;  4N9I A;  1EF4 A;  1ONV A;  2H8R A;  3AG3 H;  3WHC A;  4S0H B;  1O7L A;  3DEU A;  4RGR A;  1ETK A;  4EM0 B;  5CVJ A;  1FIA A;  2EZK A;  2X85 A;  1I6X A;  2VAS A;  2M9H A;  1AOY A;  2E19 A;  2WY7 Q;  1CQT A;  3TO7 A;  3GBG A;  3GO5 A;  1M1E B;  1TWH J;  3VYR B;  5HS7 A;  4EJU A;  4AVZ A;  2UXX A;  3SJM A;  2GXB A;  1T0F A;  2W24 A;  4KFC A;  5IT9 K;  2L4A A;  4CCJ A;  3F22 A;  3ZQF A;  3KYD B;  4KIC A;  4PGG A;  4LG3 A;  3ZXS A;  5FRM A;  4PDK A;  3WE3 A;  4Q48 A;  3M8F A;  5TIS C;  5EEH A;  4YEL A;  1MNE A;  2CQN A;  3LWF A;  2D1V A;  2QYO A;  3BLY A;  5C44 J;  2BW3 B;  4KIT B;  3FXQ A;  1MIJ A;  5J1R A;  2KDO A;  3ZQC A;  5ICF A;  1MGT A;  3U1D A;  3WG7 H;  1LFB A;  4HF0 A;  1BJA A;  2WAE A;  2EJR A;  1Z0X A;  2NVY J;  2PMZ A;  3I4P A;  3FIW A;  2A6E F;  3PNV A;  1J09 A;  3S2D J;  2KHM A;  1T56 A;  4P5O A;  2QA4 I;  2QSH X;  1Z6T A;  3NAR A;  2JUG A;  1U5T C;  3BJO A;  2QEN A;  3BRO A;  2EB7 A;  2M87 A;  3I9V 2;  4PJJ A;  4HQE A;  3HB9 A;  2PFB A;  2JQ7 A;  2Z3Y A;  1SFE A;  4RM3 A;  2V6C A;  4N0B A;  3MAJ A;  4ASN A;  1VQP I;  2Z9O A;  1B6A A;  2FE3 A;  1S9H A;  2VE8 A;  2MGQ A;  3C2G A;  1BI2 A;  1QHG A;  1XC5 A;  3RSN A;  3WGI A;  2E35 A;  3T8T A;  3NEU A;  4ENN A;  3OYJ A;  2EA4 A;  2DT7 B;  2KPM A;  2EWN A;  4DQ2 A;  1GHC A;  3IV5 A;  5FRO A;  4CZC A;  4ON0 A;  2O7O A;  1YLF A;  1HA8 A;  4Y15 A;  4HST A;  1IGN A;  3QP6 A;  4GYG A;  2BW3 A;  2DA2 A;  4A6E A;  4BDY A;  4EM1 A;  2R4G A;  2LD5 A;  4G6D A;  2L54 A;  4PJL A;  4B1R A;  3MKL A;  1UB9 A;  2JSC A;  1R1U A;  2VL8 A;  3PFI A;  1D8K A;  3K1P A;  4Q47 A;  4EJW A;  3K0L A;  1YG2 A;  3K9T A;  2XRL A;  3OYN A;  4RLF A;  1Y8R B;  4BU2 A;  3TOA A;  3G4S I;  1X1P A;  4S04 A;  1TQI A;  1T33 A;  2F6C A;  2M5W A;  3BDD A;  1G3S A;  1UEL B;  4S05 A;  3CUQ A;  2FOW A;  4BH9 A;  2EZH A;  1HKS A;  4E4H A;  3F72 A;  3E5X A;  3DTI A;  4RAZ A;  2EIJ H;  3V7S A;  2HPM A;  1UAA A;  1IW7 F;  5IP6 A;  1X1D A;  4ESF A;  4OAY A;  3PO3 J;  3DU5 A;  4YEJ A;  3CCU I;  1REP C;  1VQ9 I;  1AU7 A;  2QWW A;  4KIB A;  2DA7 A;  5E79 C;  5GPC A;  2GZW A;  3HRS A;  4KN7 X;  2QBY B;  2P7C B;  4B09 A;  2ZSH B;  4QWQ A;  2CUE A;  2IS6 A;  1T2K A;  3S93 A;  4XN0 A;  3IKT A;  1P7I A;  2ZME B;  2RQQ A;  1TNS A;  3K2Z A;  1WVR A;  2CSO A;  1OCT C;  2KIQ A;  3W6V A;  2Y75 A;  3E6M A;  2LF8 A;  1LEA A;  3IH4 A;  4UVA A;  3EUH A;  1FPQ A;  1Y1W J;  4U7D A;  3GTJ J;  2ESH A;  3LNQ A;  5K5O A;  4C3I J;  2DJI A;  1R00 A;  1ZAR A;  1ETQ A;  3C1D A;  4QPQ A;  2DMQ A;  1N75 A;  3HM5 A;  1LKX A;  1RPW A;  3NAU A;  1R1T A;  5IYD J;  3K1N A;  5HDK A;  3JTG A;  5K1Y A;  2ZB9 A;  4ZJZ A;  4M72 A;  2NRA C;  3E7L A;  4NHJ A;  1OIS A;  3TDU C;  1WQ2 A;  2CQX A;  4A3C J;  5EGO B;  1XMX A;  2LYC A;  3J7Z I;  2QBY A;  2EFQ A;  3BG9 A;  3PQJ A;  2IS2 A;  2R92 J;  1FSE A;  2HZD A;  4A6D A;  4RB2 C;  1AWC A;  5DTD A;  1GDT A;  2FRH A;  2VKD A;  1QU3 A;  2EV6 A;  3E5Q A;  2ECC A;  4J01 A;  1N78 A;  2GXG A;  1OKR A;  5HDG A;  3VPR A;  3EDP A;  2P8T A;  2GOX B;  1PP7 U;  2STW A;  2HPI A;  4GXO A;  4UY8 I;  3DU6 A;  3V8K A;  2DFE A;  2JA7 J;  2KRC A;  4P96 A;  3LSP A;  3CF5 F;  2KDZ A;  3FIS A;  3GZ5 A;  4N9H A;  3GTL J;  3LSI A;  1D0Z A;  3RI4 A;  1XX5 A;  1YYV A;  2H1K A;  2Q0O A;  4XSX F;  3EUK L;  5IP9 J;  2V1U A;  4KMU X;  4UUT A;  1UMQ A;  1SVO A;  3NWS A;  4CIC A;  4D7N A;  3P9C A;  3DLA A;  3HSE A;  4XLA A;  3RKX A;  2HYF A;  4QTR A;  1TL8 A;  2EA2 A;  1Z7U A;  3DEW A;  3BOQ A;  3MWM A;  4PJM A;  3S16 J;  1SAU A;  1RUN A;  3CP8 A;  3ECH A;  1LFP A;  5M3M J;  3L9F A;  3EYY A;  3KX2 A;  1T8I A;  3E6D A;  2E2I J;  3RKQ A;  4XKW A;  1LDJ A;  1YS7 A;  1WJB A;  2Z1D A;  3ASN H;  5IP7 J;  2QQA A;  2CJJ A;  1PDN C;  4DOZ A;  2VON A;  4F52 A;  2JPB A;  5F64 A;  5K7Z A;  1HCR A;  3CLO A;  3HOS A;  4A3B J;  5D8L B;  1J7K A;  1LE8 A;  2RNJ A;  1GXP A;  4KT6 A;  1WH5 A;  3BJ6 A;  1APL C;  1F5T A;  2FNA A;  1B72 A;  2QF7 A;  1PUE E;  2KFD A;  2IAI A;  5J4Y A;  2A6T A;  4P1W A;  1W36 C;  3QPT A;  2YSR A;  4D5F A;  4B47 A;  3KCC A;  3ZQQ A;  3HL2 A;  3TW6 A;  2DK5 A;  2QCO A;  2ZXI A;  4YG2 F;  1XTA A;  5AON A;  1MZB A;  2M30 A;  3FMS A;  3GEZ A;  5EZG A;  1GV5 A;  5FB2 A;  4RS8 A;  2NS7 A;  4U88 A;  3IRR A;  2ISZ A;  2ESN A;  2L7F P;  2R7O A;  2R7D A;  5J3L A;  3R0J A;  1VQL I;  2FNP A;  1WJF A;  5CQG A;  2RGV A;  1RI7 A;  5JVT A;  3KP7 A;  3HUG B;  4B3A A;  1WPK A;  2DN0 A;  3J7Y J;  1G3Y A;  5L3E A;  2F5C A;  1WJD A;  4A93 J;  1LPQ A;  1RIO H;  3ERE D;  1HKQ A;  2VQH A;  4OIN F;  1POG A;  3TP3 A;  4YII A;  1YRN B;  1TWF J;  4XKV A;  3IUO A;  3LOC A;  2MD5 A;  2H27 A;  4AIH A;  2QZ8 A;  3DPL C;  2L9S A;  3IC7 A;  1X3Z B;  4V2G A;  2OTJ I;  9ANT A;  4BXU A;  2W85 A;  1J9I A;  3V7R A;  4HNU A;  4LG0 A;  2RNG A;  2XRO A;  2PMH A;  2X0L A;  1BC7 C;  5L3F A;  5E1W A;  4HNT A;  3BJA A;  3K4N A;  3HTS B;  2X6Y A;  4FE4 A;  2Q2E B;  3JRE A;  3PQK A;  1ODD A;  1TNT A;  2FD5 A;  2M8G X;  4MLO A;  2X9D A;  1YX3 A;  2EBI A;  2FJ1 A;  3IWZ A;  3WU0 A;  2FMY A;  5H6R A;  4BHP A;  2ID3 A;  4FQG A;  2R7F A;  4I2O A;  1FZP B;  1Q1V A;  2DDB A;  5TGT A;  1SD4 A;  3K7A J;  3AG4 H;  3F8M A;  1E3H A;  2ACJ A;  1XPX A;  2KL4 A;  2H6C A;  3F6O A;  2Y48 A;  1IG7 A;  4HZF A;  1HQC A;  1KU9 A;  1L0O C;  3R61 A;  3MN2 A;  5IT3 A;  1BJZ A;  4HBL A;  2LP0 A;  3VSK A;  1U0J A;  2ZXJ A;  3ABK H;  4XR6 A;  5E3N A;  2D5V A;  2PBI A;  4KMF A;  4ZTJ A;  5M5W J;  1MMA A;  2MBF A;  3SZG A;  5BMZ A;  2PJR A;  2GA1 A;  4UB6 C;  2XB5 A;  3FXM A;  3ASO H;  2BXY A;  1BIB A;  2GQQ A;  5HS9 A;  3M3Y J;  5KCM A;  3RJP A;  2DMU A;  4B8X A;  2PLY A;  2AXL A;  3S8P A;  1R4N B;  5CYV A;  4DBR A;  1GVJ A;  3F8B A;  3UR3 C;  1W5S A;  1VZ0 A;  2VUM J;  1LB2 A;  1X3W B;  2RKH A;  3ZQI A;  3VOD A;  1WSU A;  4MGR A;  2FUG 2;  5LD2 C;  3RPU A;  4LIV A;  4XSZ F;  3ZOB A;  3KYC B;  4AIJ A;  1BBY A;  4LJZ F;  2IRF G;  1BW6 A;  2L9V A;  2R0Q C;  1XN7 A;  2P0W A;  3BCB A;  3VSL A;  3V42 A;  1IDZ A;  2HVQ A;  2DFH A;  1QPM A;  2DLL A;  3IHU A;  4HX7 A;  3BR2 A;  2K86 A;  5E20 A;  3OOU A;  3LQR A;  4IHS A;  5CVR A;  3F0C A;  5FJ8 J;  3F3X A;  3UNG C;  1PVE A;  4GFB A;  4UB8 C;  1CF7 B;  2VKH A;  2E2H J;  2V79 A;  3NQO A;  2V6E A;  4XN3 A;  5EG0 A;  4RB1 A;  1TTY A;  3QOE A;  3L7W A;  1AKH A;  1ZLJ A;  3BR1 A;  3O2P E;  1IZ1 A;  2RAE A;  3D0S A;  2Z99 A;  1VQ4 I;  2JVH A;  1QZY A;  2HU9 A;  2VLA A;  2VB6 A;  1LNW A;  2A5W A;  2M8E A;  2YS9 A;  5HVQ C;  4NDL A;  3AAF A;  2BY3 A;  1QBJ A;  4G7O F;  2X1E A;  4ZYE A;  4D5C A;  3IWF A;  1OCZ H;  4UHT A;  3C18 A;  4HAM A;  2ZFU A;  4OAZ A;  4XOR A;  3I54 A;  3OR2 C;  2DJN A;  5DCM B;  5FKN A;  2VQC A;  2WAQ A;  5CKT A;  2HOE A;  3VYU B;  2BEO A;  3ABT A;  2AHQ A;  5DD8 A;  4OMZ A;  1TWC J;  3MZH A;  1XD7 A;  1X4O A;  4CCL A;  2CUJ A;  4BQQ A;  3J7A Y;  2ZME A;  4MQV A;  2A68 F;  1WJA A;  4Y17 A;  2Z33 A;  2E60 A;  3BT9 A;  4M6Y A;  3T5X A;  4W1U A;  3JRB A;  2XPW A;  5F1R A;  4UUV A;  5F1J A;  4ANJ A;  3CO6 C;  2KP6 A;  1VQ5 I;  1G3W A;  5LGT A;  1ZG1 A;  1NHA A;  2JVG A;  2K9L A;  4FIS A;  3Q5F A;  1YW9 A;  2P6T A;  1N25 A;  5JR3 A;  2HTJ A;  4JOM A;  4BE1 A;  4L0Y B;  3MEX A;  4ZDL A;  5FKM A;  1Z21 A;  4IRI A;  2D1H A;  4R1H A;  2X1D A;  5ILU A;  2LC2 A;  2CMP A;  1J5Y A;  1S7E A;  5F0C A;  4RAF A;  4BL0 B;  1O4X A;  3JRI A;  2M0C A;  1ZEL A;  2BVL A;  3TBI A;  1I6H J;  1XMA A;  4L18 B;  2ZC2 A;  5B66 C;  2OV7 A;  4XLF A;  1MSE C;  3C2H A;  1I5Z A;  4F55 A;  1GT0 C;  3QU6 A;  2O61 A;  1BOA A;  3SQN A;  1JTY A;  4I02 A;  2Y9Z A;  4JBA A;  4C2U A;  2ELK A;  4ZYA A;  5DCF A;  5B1B H;  3F8N A;  1BR2 A;  3FXO A;  2FSW A;  3FX3 A;  3JTH A;  1W5C C;  1JKP C;  2L9N A;  3E6C C;  2UZK A;  2JRT A;  1OFC X;  2M7A A;  1FMV A;  2WA0 A;  5FD5 A;  4C3H J;  4HDU A;  2R5Z A;  2DCE A;  3ABM H;  4LD5 A;  1MSF C;  4A3G J;  1YS6 A;  2ZCW A;  2EQR A;  5M5X J;  1JKQ C;  3CF2 A;  3T1B A;  1MJA A;  4BEH A;  4M9X A;  1R71 A;  3LMM A;  1IXS B;  3G6E I;  2IPQ X;  3SFZ A;  4HG2 A;  2UXN A;  3A01 B;  1UHM A;  2D45 A;  3S14 J;  2LKX A;  3K10 A;  3LSM A;  3I56 I;  2L3D A;  2VOO A;  3AKZ A;  4DYR A;  5HS8 A;  1HC8 A;  3VOE A;  3H0D A;  2HVS A;  4IHV A;  4B43 A;  4BBS J;  1FMW A;  2XRN A;  4M3E A;  2M4K A;  2LNB A;  4L9T A;  3CTA A;  3OR1 C;  3CES A;  3DPT A;  3FM5 A;  2CW8 A;  3Q9S A;  2M45 A;  2P5L C;  1S3J A;  4X6A J;  4A2U A;  2VPL A;  3CP2 A;  1UHS A;  5L3C A;  4IF4 A;  1HOM A;  2H94 A;  1ZRE A;  4KYW A;  2QSF X;  4CYD A;  1A6I A;  2OZU A;  4XRS G;  2Y9Y A;  1JUP A;  3WTT C;  1V4R A;  1IC8 A;  2KIF A;  2EIN H;  1D1A A;  1IN5 A;  2MC3 A;  3GX4 X;  1EH6 A;  3ELK A;  1U78 A;  4XOT A;  1SEU A;  5B1A H;  5IOY A;  5CVU A;  3JSP A;  4UNO A;  2DOE A;  5L3D A;  4BXF A;  2W57 A;  1PJR A;  3HHH A;  4UVC A;  2OC6 A;  3RYP A;  5JHU A;  2M2E A;  2ZJR F;  1MBK A;  3S3O A;  1Y0U A;  2OZ6 A;  2CFX A;  4NQW B;  2HOT A;  3EPZ A;  4PK4 A;  1OCP A;  3W6K B;  5AIQ A;  2EZL A;  4YRV A;  3OYM A;  2E71 A;  5D6F A;  2VKE A;  1D1C A;  4FE7 A;  3WG9 A;  3L1P A;  1FYM A;  3JAM Z;  2A3S A;  5CPR B;  2EFN A;  2CH0 A;  5GAH J;  4FX0 A;  5K5R A;  1RZ4 A;  2NS0 A;  1JT0 A;  4J00 A;  5DD4 A;  4EEF G;  5LRS A;  3I5U A;  2KQR A;  4MQ9 F;  3TP0 A;  2XKO A;  2CO5 A;  2Q2E A;  3B6A A;  3I53 A;  2IGN A;  3BG5 A;  1JJ6 C;  2EK5 A;  1ZTR A;  2ZO4 A;  3M9A A;  1V5F A;  4PCQ A;  3WHB A;  1IDY A;  4XID A;  5B5E C;  3U9G A;  2MW8 A;  4RAG A;  2TRT A;  1NG7 A;  1I3Q J;  4PFP A;  2VBW A;  2A6H F;  2J5O A;  2LDU A;  5FGM A;  1A6Q A;  3BP8 A;  2ICW G;  2Z16 A;  4FTH A;  1K6O A;  1BA5 A;  1O3R A;  4E7I A;  1XGM A;  5C4X J;  1LVA A;  4KIF A;  5J8C A;  1IUY A;  2WAF A;  4MO7 A;  4RGU A;  3BWG A;  1JGS A;  1S8N A;  3EET A;  1K7A A;  1KYZ A;  1FOX A;  3GVA A;  5GPA A;  3AL0 C;  2M7B A;  2YX4 A;  1ZRF A;  3LA7 A;  4AD9 A;  5E8G A;  1SFU A;  2WY8 Q;  2FEZ A;  2W48 A;  1LQ1 A;  5D4R A;  1T6S A;  4M74 A;  2OQG A;  3LSJ A;  1XGN A;  4XBF A;  1ZH5 A;  2QVO A;  1EKE A;  3HZJ A;  2ECB A;  2M1B A;  4RGX A;  1QZE A;  5C4J J;  3ZR8 X;  3ZPL A;  3PSF A;  3OYC A;  2B9S A;  5AIP A;  4Y52 J;  4BBR J;  4Q5S F;  5L3G A;  4M71 A;  1MKM A;  2HTS A;  1WFX A;  3IH2 A;  2K3F A;  2ZJP F;  2E1N A;  3HOW J;  2EFP A;  3OIO A;  4CGZ A;  2QKL B;  2R7W A;  3UKG A;  3N05 A;  2YX7 A;  4IPA A;  3MFK A;  2A07 F;  2G7H A;  4JX4 A;  2EIK H;  1F36 A;  1Z6R A;  1QHH D;  4YIF A;  1GXQ A;  1MBG A;  2PMU A;  3OL4 A;  1ACI A;  2IBD A;  2LY9 A;  3L2V A;  3GTM J;  3E5U A;  4FAS D;  2CV2 A;  3HOX J;  2R7Z J;  4MFE A;  3RPQ A;  2IP2 A;  3JAM K;  2JTV A;  2K9S A;  4E70 A;  1YQA A;  3S32 A;  3QOD A;  5FKO A;  4CO8 A;  2PG4 A;  2P6S A;  3HEF A;  5EG0 B;  2F5E A;  4AID A;  4RB3 C;  1QZZ A;  3OIP A;  3SHF A;  2F5D A;  2G7U A;  3K4J A;  4XLC A;  2L2O A;  2OU2 A;  2MAB A;  3SXY A;  1A36 A;  1MBE A;  2O9L A;  5J40 A;  4H4K C;  4LIU A;  4ZH4 F;  1TW3 A;  3GXO A;  1T95 A;  3D5R C;  4U0V A;  2NVX J;  4O6J A;  3RQI A;  1WCM J;  3SZP A;  3OWT A;  1RET A;  1X1B A;  2FXA A;  3A02 A;  3MZY A;  1E17 A;  2DT6 A;  2JZY A;  5KHD A;  2R7Q A;  1S6L A;  4F92 B;  2IXS A;  1JJ8 C;  2LG4 A;  3SEZ A;  1ON1 A;  1RES A;  3F8C A;  1K4S A;  3EYI A;  3NWT A;  2HQN A;  3HBL A;  4WWC A;  5FO5 A;  3GYH X;  4XL9 A;  4ZC3 A;  4AYB A;  2XAG A;  3HC7 A;  4BHB A;  4I98 B;  1IV6 A;  2W84 A;  5CQE A;  3HOV J;  3TO9 A;  4OIP F;  3G3Z A;  5JLX A;  3GF2 A;  3QPS A;  3BQY A;  2XSD C;  1ZG5 A;  2W82 A;  3KZY A;  1FBS A;  2JK3 A;  4HLY A;  1Z1D A;  5BNG A;  1S72 I;  2JA6 J;  2VBZ A;  1KQ0 A;  2ISY A;  4C2T A;  2EH3 A;  2H6B A;  4F3Q A;  1FJL A;  3WOD F;  1ZQ3 P;  3LL7 A;  5TJJ A;  1ZR2 A;  2Z2S B;  2XC7 A;  1Y39 A;  4ITV A;  3LSK A;  3PL8 A;  4M9S A;  2NYX A;  3OYH A;  4LOC A;  1KA8 A;  4R79 A;  1BN5 A;  1KU2 A;  1LDK B;  1D5Y A;  5DUK A;  4CCK A;  3Q0V A;  1UJ8 A;  3N97 A;  2K9N A;  2P5V A;  2EPF A;  2K27 A;  5GTI C;  4ZDP A;  3LST A;  2O6G E;  1WHU A;  5GTH C;  1VQO I;  1VF9 A;  4UV8 A;  5L3B A;  4E7L A;  4AC0 A;  2E5N A;  3H9Q A;  3K4K A;  3EQL F;  2IT0 A;  5J4V A;  5BPD A;  1UFM A;  3H92 A;  1P2F A;  4WXC A;  2QQB A;  4BXX J;  5BQT A;  1A04 A;  3BZC A;  4NUB A;  3JRC A;  5IPA A;  3QPL A;  3HOT A;  1ULY A;  1HSJ A;  1HW2 A;  4Q4Z F;  4AYB N;  4I01 A;  4GDF A;  2K7L A;  3FXJ A;  3S2W A;  2GIZ A;  4C2M J;  3G71 I;  5KNL A;  4RLQ A;  3HOY J;  1R36 A;  1EH7 A;  3OYA A;  4BEH B;  2CV1 A;  1DPR A;  1YJN I;  4IHX A;  1T08 B;  2E7X A;  4L5E A;  3OYE A;  1W0T A;  3G2B A;  4G6Q A;  1VQN I;  3L2U A;  1ZGJ A;  3ZMV A;  3S3M A;  2ME6 A;  2FF4 A;  1JT6 A;  2CS3 A;  3BTC A;  4FET A;  4RA2 A;  3FXK A;  3HPG A;  4HNV A;  1YO5 C;  4RGS A;  2PN6 A;  3ZCO A;  3L2Q A;  3J80 K;  1DUX C;  4ENJ A;  1ZLK A;  2CQQ A;  3B02 A;  2QLZ A;  3BZK A;  2WV0 A;  1KON A;  2HKO A;  1BR4 A;  4P9F A;  2DMT A;  1EV7 A;  3H36 A;  3OYF A;  3MZ8 A;  4FCY A;  3DEE A;  3X2Q H;  2CWE A;  4A3L J;  3R6S A;  3M8E A;  2V1N A;  3RKY A;  1TP4 A;  4U87 A;  3C2B A;  1P7J A;  1QA6 A;  2VPR A;  1Z77 A;  1B59 A;  2V9K A;  4I0A A;  2JMW A;  4ABZ A;  1ZR4 A;  1DGW Y;  4GRI A;  2V26 A;  1VTN C;  4I99 C;  2DPD A;  4BJ5 C;  3HSR A;  1XCV A;  4M3G A;  4RM2 A;  1C0W A;  3V4G A;  2XGX A;  5ICE A;  2VOD A;  2DI3 A;  1MBH A;  5D8K B;  3I71 A;  2GA2 A;  3KET A;  3GTG J;  4EAT A;  4XK4 A;  4XM3 A;  1IJW C;  5DM6 F;  3H0G J;  3QYB A;  3LA2 A;  1I39 A;  1FLI A;  2X51 A;  1XCB A;  2XB0 X;  3SDB A;  2L9R A;  4IVN A;  4V2F A;  3HIF A;  1FX7 A;  1VND A;  4KJZ A;  4EMS A;  3DCF A;  2XUB A;  2LBF B;  1RUO A;  4MTD A;  1X19 A;  1B9M A;  3OYL A;  1JUS A;  2E1M B;  2V1D A;  1GVD A;  4L9N A;  3VDX A;  3KP3 A;  1R6R A;  3WTX C;  4G9Y A;  1X1C A;  3QAH A;  5IY5 H;  2G9W A;  4KIG A;  2XGC A;  3KEO A;  4OU0 A;  3TOB A;  4D9J A;  2BV6 A;  2MG4 A;  5CJ9 A;  5EEG A;  4W97 A;  1H9G A;  1G4D A;  5GP9 A;  1WWX A;  2E36 A;  3DKX A;  1EH8 A;  1D0Y A;  4AU7 A;  1XGS A;  1RRJ A;  2R7T A;  3Q0U A;  1U8B A;  2ELJ A;  2YUS A;  1MJB A;  1AA7 A;  1ETO A;  1NTC A;  2X6W A;  4Y4R A;  2NXN B;  5EZH A;  2FA5 A;  2M3A A;  4NB5 A;  2F4I A;  2NAZ A;  2R3S A;  3OY9 A;  1ETW A;  3I0T A;  3DTE A;  2K85 A;  2KIM A;  5FFX A;  1MMN A;  1SMY F;  2W25 A;  1BW5 A;  3OYK A;  2WAD A;  2IVM A;  5E1Z B;  1BI0 A;  1XSD A;  1JHH A;  1IO2 A;  3LA3 A;  2G0E A;  4H0E A;  1YE9 A;  4M6V A;  3OS0 A;  1IRX A;  2OCC H;  3PO2 J;  4WF2 A;  1Z3Y A;  2C6Y A;  1ZK8 A;  1SD6 A;  2M0M A;  1JTX A;  1R4M B;  5J8F A;  2V9V A;  4B48 A;  2PQ8 A;  3B73 A;  2WTE A;  3GCM A;  2XSJ C;  3GZN B;  4U0W A;  3U21 A;  5J6X A;  1H9T A;  2L7K A;  4F93 B;  4CXF A;  3MKW B;  3ZN1 A;  3HOZ J;  4BQO A;  2ADU A;  5FFZ A;  1R7J A;  1XG1 A;  2Y0S A;  2DT5 A;  5DS9 A;  1P4A A;  3J80 Z;  3PIP F;  3CCE I;  2STT A;  3SDG A;  3K69 A;  1YW7 A;  4WXH A;  3ONQ A;  4XLE A;  2KZG A;  1MW7 A;  3D5L A;  3LSG A;  3O8G A;  1OCR H;  2IS1 A;  5K7H A;  3TED A;  1XS9 A;  2JA8 J;  3PNT A;  2VQL A;  2PEX A;  3ZQH A;  3IKV A;  1OLT A;  4OIQ F;  1KQ8 A;  1W7P D;  2V7F A;  1Z7L A;  2H8W A;  4CCN A;  5JLW A;  1LUJ B;  1NK2 P;  4YIR X;  2M4G A;  3H3U A;  2BVM A;  4C30 A;  5KAF C;  4EM2 A;  2HZT A;  3OL3 A;  2K02 A;  1ZGA A;  5CLS A;  1JUM A;  3KLO A;  2V4J C;  1ZN2 A;  1LEB A;  1G6N A;  3OOP A;  4CA0 A;  2DO7 A;  1YJ9 I;  3DFG A;  2LKP A;  2K9Q A;  3BR3 A;  4D0P A;  3GTQ J;  2LF7 A;  5F08 A;  2LMD A;  3OSF A;  4C9Y A;  5KVR A;  2GAU A;  1F1Z A;  4LLG F;  3ML6 A;  1FP1 D;  2IGO A;  3HGY A;  2DFF A;  2HDC A;  2HDD A;  2K4J A;  4M6X A;  5E3O A;  1ETY A;  2OUM A;  5E3L A;  4Z6Y A;  3WGH A;  2DPU A;  1WI3 A;  4XNF A;  2HXI A;  2DOA A;  1VQ6 I;  1ZG3 A;  4IQ4 A;  3CCJ I;  4ZZL A;  2A5Y B;  3HSF A;  2LRD A;  3DKY A;  2X6X A;  4IXA A;  1U9N A;  3HRT A;  3Q0W A;  1PUF B;  3L2R A;  1K78 A;  4BNC A;  1HST A;  3F9K A;  2MD0 A;  3FHZ A;  3KE2 A;  3G1M A;  3H5A A;  1MND A;  2HI3 A;  4EJO A;  3JRA A;  4CZZ A;  3FWE A;  4AM3 A;  2VOP A;  4LG0 B;  2LOO A;  1FTT A;  3BG6 A;  3TO6 A;  1ZKG A;  1VQ8 I;  1O3Q A;  3KFW X;  4PZJ A;  4L0Z B; 
#chains in the Genus database with same CATH homology
 2JPC A;  1H0M A;  4LGW A;  4P55 A;  4I7H A;  4MNU A;  4ENM A;  3ECO A;  3HUG A;  3N4M A;  4UV9 A;  2IA1 A;  5FLX K;  1OMI A;  5LEK A;  5H6Q A;  6PAX A;  5LEJ A;  4WXD A;  2VXZ A;  3I59 A;  2Q8K A;  4IRG A;  1E2X A;  2BGC A;  4F7Z A;  1R5H A;  5H20 A;  2ZKZ A;  2P4W A;  1KU7 A;  2DFI A;  1P6R A;  4NQW A;  2FML A;  1J59 A;  3V8L A;  1X3U A;  1IXC A;  1TW2 A;  2MH9 A;  5LHI A;  3GFJ A;  1U8R A;  1Z9C A;  2DTR A;  2VC0 A;  2RDP A;  4HX8 A;  4KA4 A;  3VB2 A;  2O03 A;  1U2W A;  5ED4 A;  3NRV A;  3GLX A;  3P9I A;  3M1E A;  4A0Y A;  4OMY A;  1W7P B;  2ZNZ A;  3FMQ A;  1R58 A;  2XKP A;  1F4K A;  1D8J A;  2QM3 A;  4HV6 A;  5BPI A;  2HEO A;  1T38 A;  3F8F A;  4LFU A;  1IXR C;  2HFH A;  4MTE A;  1SFX A;  1IAW A;  3BPX A;  5JI6 A;  3HRM A;  1FSH A;  1P4W A;  3C7J A;  2CYY A;  2VN2 A;  5HDN A;  1DPU A;  1PP8 F;  4HF2 A;  2FQ3 A;  2KJC A;  2XVC A;  1MJ9 A;  3ZMT A;  4U0Y A;  2D2W A;  1LJ9 A;  4ZZD A;  5LBQ A;  1FC3 A;  1J0R A;  5E1X A;  3HRU A;  3RDI A;  1TQM A;  2Y0M A;  2QQ9 A;  3VEP A;  1USS A;  2OAZ A;  2P5K A;  4LMY A;  5ERI A;  3V7C A;  2CQK A;  5KK1 A;  3BZ6 A;  3CUQ C;  2DBB A;  3ZMZ A;  3U2R A;  4UVB A;  2RC4 A;  2WWY A;  4HV5 A;  2HWV A;  3J81 Z;  3LAP A;  1XDU A;  3QU3 A;  4YFN F;  4HDV A;  1B4A A;  5A2Q K;  2IW5 A;  5ICC A;  2DU9 A;  2KIU A;  1P92 A;  1TBX A;  1LDD A;  4KUM A;  3ZN0 A;  3FF5 A;  3HTU A;  1BIA A;  3I59 B;  5ILV A;  5DUI A;  4JQF A;  2H09 A;  1CGP A;  1U5T A;  1UCR A;  1F9N A;  4OOI A;  3T0Y A;  3HYI A;  1IRF A;  4IHT A;  3ZMD A;  2L4M A;  1WRJ A;  1FBQ A;  4WCG A;  1SAX A;  4HW0 A;  4EVI A;  5LLQ A;  3CO7 C;  2MLK A;  3COA C;  2RQP A;  4AVP A;  1OYW A;  3OV8 A;  3WE2 A;  2Z5U A;  4XRF A;  1K79 A;  1J2X A;  5DEQ A;  3F21 A;  3ISP A;  2OBP A;  5LGU A;  3RIR A;  2NNY A;  1Z05 A;  3WTS C;  4KNY A;  3L2C A;  4R8H A;  3W6J B;  1SD7 A;  2O3F A;  4EJV A;  1YFH A;  2EV5 A;  1FOK A;  3DF8 A;  1O7F A;  4LLN A;  1O3S A;  2XAQ A;  2MA3 A;  3O6B B;  3CJN A;  2V1X A;  5D5V B;  2HS5 A;  2ZBK A;  4GCV A;  3R4K A;  1JE8 A;  1P4X A;  2IA0 A;  3DKW A;  3KLN A;  2BBY A;  2CW0 F;  2KKO A;  1FT9 A;  2X4H A;  4HA8 A;  3F23 A;  4RAY A;  3WTZ A;  1R22 A;  4Y13 A;  2O8X A;  4IRH A;  5A2Q Z;  3ROU A;  1Q1H A;  4ZYD A;  5IT9 Z;  2TDX A;  4HLX A;  3ZMU A;  4PGH A;  2VE9 A;  3KP5 A;  3KP6 A;  4WK8 F;  1FYK A;  1B9N A;  1IN7 A;  3O3K A;  4Z2Y A;  3HHG A;  4TV7 A;  1D5V A;  5JFR A;  3GZ6 A;  5CVV A;  3K1M A;  4EV0 A;  1BM9 A;  3WTW C;  3WTV C;  3C3W A;  2YR2 A;  1R1V A;  2XIG A;  4I09 A;  4L5I A;  1HKT A;  1JXS A;  2IA2 A;  5HLH A;  2VBY A;  1O3T A;  3J7A O;  1KYW A;  4A12 A;  2ZFW A;  4BAY A;  4EGY A;  4EGZ A;  3BY6 A;  3P9K A;  4LB5 A;  5HLI A;  1D3Y A;  1W7P A;  1KGS A;  2MH2 A;  4QLC U;  3DP7 A;  3DXJ F;  2DK8 A;  4A0Z A;  1MD0 A;  4XLP F;  5FD6 A;  2EV0 A;  1BI3 A;  3E97 A;  3G73 A;  1IN6 A;  3LAJ A;  2PJP A;  3TKY A;  3F6V A;  1T39 A;  5F6F A;  1I27 A;  3WU1 B;  4O5V A;  1FWZ A;  5CVI A;  5K5Q A;  1W5T A;  5TRD A;  1O57 A;  1XSX A;  5LHG A;  4HQM A;  1XGO A;  5LHH A;  4JK1 X;  4EJT A;  4IJA A;  1OR7 A;  2IJL A;  4G8X A;  3ZMS A;  1ZYR F;  3GFI A;  2ZNY A;  4LK0 F;  1XSV A;  2KJB A;  2VBX A;  2E1C A;  2A61 A;  3KP2 A;  4KN4 X;  4LB6 B;  1I1S A;  1UST A;  1MDM B;  3CUO A;  3GFM A;  4RB0 A;  2XAS A;  3ZQ7 A;  1QQI A;  2VT3 A;  4LK1 F;  2XHK A;  2EFO A;  2WC2 A;  3TDZ C;  2E7W A;  3DV8 A;  4M9Z A;  3FXR A;  3RKW A;  2DQL A;  1ON2 A;  3VFZ A;  5FLX Z;  2OA4 A;  3WGG A;  3GWZ A;  5D6E A;  2ELH A;  4AWX B;  4MEX F;  1V3F A;  2UWM A;  4CDG A;  1FP2 A;  1Z91 A;  2A69 F;  1BI1 A;  4KT5 C;  2MLG A;  1QNT A;  1U5T B;  4ESJ A;  1FY7 A;  1T98 A;  3V8J A;  2L02 A;  1MDM A;  3MCZ A;  4FT8 A;  5E18 F;  5BS6 A;  2BE5 F;  4OIO F;  3Q9V A;  4ENK A;  1YTY A;  3TQN A;  1S7O A;  3GFL A;  3RTR A;  4EQQ A;  1I1G A;  2FBI A;  3I58 A;  1UHW A;  2K4B A;  1WKM A;  2GIV A;  4CHU A;  5E8I A;  2VT2 A;  2DQR A;  2BYV E;  4OIR F;  2DW4 A;  5ICG A;  4ZYG A;  1HW1 A;  1OYI A;  2CG4 A;  2XAF A;  1DDN A;  2FU4 A;  3ULQ B;  1W4M A;  1TLH B;  4HF1 A;  2ETH A;  3I64 A;  3L00 A;  4GO1 A;  3SZT A;  3DQV C;  1IN8 A;  3P7N A;  1XMK A;  1STZ A;  1RNL A;  2GWR A;  3QP5 A;  4MHG A;  1XB4 A;  1YIO A;  2PI0 A;  2RN7 A;  3KZZ A;  4P9U A;  4DNC A;  4YFK F;  2FOK A;  2F5F A;  1HBX G;  4G7Z F;  3R60 A;  3KP4 A;  1U3E M;  4L5J A;  2JT1 A;  4YFX F;  5HOO A;  2HGC A;  2VC1 A;  2EFW A;  1WI9 A;  3H3Z A;  4U7B A;  3KEQ A;  3ZP5 A;  1J75 A;  5LGN A;  4UXN A;  1FBU A;  4A5M A;  3T8R A;  4FX4 A;  2LSO A;  2HYG D;  1SMT A;  5D5X B;  1R23 A;  1S7A A;  2HR3 A;  5DV5 A;  4ESB A;  5BOX A;  3M7G A;  2F2E A;  3FM3 A;  1B1B A;  3CDH A;  2XV4 S;  4BYY A;  4AIK A;  3J81 K;  2YU3 A;  3BPV A;  1IRG A;  1SD5 A;  1DP7 P;  3JW4 A;  2RVC A;  3GW2 A;  1ZAO A;  3E3V A;  1ZRC A;  4A0X A;  2ZJ2 A;  4HYE A;  5DYM A;  3QRF F;  2FBK A;  2B0L A;  2CGP A;  1KU3 A;  1ZHF A;  5DDG A;  1JHF A;  1R5G A;  1HXD A;  4K2E A;  1IN4 A;  3QPH A;  4HOB A;  1ZRD A;  1OPC A;  1QGP A;  1G3T A;  4GYI A;  3R0A A;  3L09 A;  2COM A;  3LFK A;  4KDP A;  3WTY C;  5E17 F;  4WX9 A;  2O0Y A;  4L9J A;  1YW8 A;  2FBH A;  1CF7 A;  3GUD A;  3IRQ A;  5LRR A;  2DAO A;  3FXU A;  2RV8 A;  4FHT A;  3QOP A;  1U6G A;  4L9V A;  3JSO A;  1TQP A;  2HQR A;  2QUF A;  3REO A;  5ILS A;  4G7H F;  4BQA A;  3IL2 A;  5DCM A;  4ZYH A;  4A5N A;  2L01 A;  1KQ9 A;  4ETS A;  1S29 A;  4MEY F;  5HLG A;  3ABU A;  3E6B A;  4GGG A;  4M73 A;  2HKX A;  2OD5 A;  1K78 B;  2KRF A;  2YPR A;  3CUQ B;  3FMR A;  4O3M A;  4XLN F;  1FYL A;  1IF1 A;  4LLL A;  4I0B A;  3FZV A;  1HW5 A;  5D4S A;  4G94 A;  2XAH A;  2AS5 F;  3RYR A;  1XDS A;  3WTU C;  5D5U B;  2P7V B;  2J5P A;  2XAJ A;  3TGN A;  5D5W B;  4BHC A;  1OYY A;  3LQQ A;  2NNN A;  3MQ0 A;  1L3L A;  1FNN A;  1QO0 D;  2OQR A;  4HX4 A;  1BC8 C;  4N9I A;  1ONV A;  1O7L A;  3DEU A;  4RGR A;  4EM0 B;  5CVJ A;  1I6X A;  1AOY A;  3TO7 A;  3GO5 A;  5HS7 A;  4EJU A;  2UXX A;  2GXB A;  1T0F A;  2W24 A;  4KFC A;  5IT9 K;  2L4A A;  3F22 A;  4KIC A;  4PGG A;  4PDK A;  3WE3 A;  4Q48 A;  3M8F A;  5EEH A;  3LWF A;  2D1V A;  2QYO A;  3FXQ A;  5ICF A;  1MGT A;  3U1D A;  4HF0 A;  1BJA A;  2EJR A;  3I4P A;  2A6E F;  4P5O A;  1Z6T A;  1U5T C;  3BJO A;  2QEN A;  3BRO A;  4HQE A;  2EB7 A;  2M87 A;  2PFB A;  2Z3Y A;  1SFE A;  2V6C A;  4N0B A;  3MAJ A;  4ASN A;  2Z9O A;  1B6A A;  2FE3 A;  2VE8 A;  1BI2 A;  3WGI A;  3T8T A;  3NEU A;  4ENN A;  2EA4 A;  4DQ2 A;  2EWN A;  1GHC A;  4ON0 A;  1YLF A;  4Y15 A;  3QP6 A;  4GYG A;  4A6E A;  4EM1 A;  4G6D A;  2L54 A;  1UB9 A;  2JSC A;  1R1U A;  3PFI A;  4EJW A;  4Q47 A;  1D8K A;  3K1P A;  3K0L A;  1YG2 A;  3K9T A;  3TOA A;  4S04 A;  1TQI A;  2M5W A;  3BDD A;  1G3S A;  4S05 A;  3CUQ A;  4BH9 A;  1HKS A;  3F72 A;  3E5X A;  4RAZ A;  3V7S A;  1IW7 F;  4ESF A;  1REP C;  2QWW A;  4KIB A;  2GZW A;  3HRS A;  4KN7 X;  2QBY B;  2P7C B;  4B09 A;  4QWQ A;  1T2K A;  3IKT A;  2ZME B;  1TNS A;  3K2Z A;  2CSO A;  2Y75 A;  3E6M A;  2LF8 A;  1LEA A;  4UVA A;  3EUH A;  1FPQ A;  4U7D A;  2ESH A;  5K5O A;  1R00 A;  1ZAR A;  3C1D A;  1R1T A;  3K1N A;  5HDK A;  3JTG A;  5K1Y A;  2NRA C;  4M72 A;  4NHJ A;  3TDU C;  1WQ2 A;  2QBY A;  2EFQ A;  3PQJ A;  1FSE A;  4RB2 C;  4A6D A;  1AWC A;  2FRH A;  2EV6 A;  3E5Q A;  2GXG A;  1OKR A;  5HDG A;  3EDP A;  2P8T A;  1PP7 U;  2STW A;  4GXO A;  3V8K A;  4P96 A;  3GZ5 A;  4N9H A;  3RI4 A;  1YYV A;  2Q0O A;  4XSX F;  2V1U A;  4KMU X;  4CIC A;  3P9C A;  3HSE A;  3RKX A;  2HYF A;  2EA2 A;  1Z7U A;  3BOQ A;  3MWM A;  1RUN A;  3ECH A;  3L9F A;  3EYY A;  3E6D A;  1LDJ A;  1YS7 A;  2QQA A;  1PDN C;  2VON A;  2JPB A;  5F64 A;  3CLO A;  3HOS A;  5D8L B;  1J7K A;  2RNJ A;  1GXP A;  1F5T A;  3BJ6 A;  2FNA A;  1PUE E;  3QPT A;  2YSR A;  3KCC A;  2DK5 A;  4YG2 F;  5AON A;  1MZB A;  2M30 A;  3FMS A;  3GEZ A;  5FB2 A;  4RS8 A;  4U88 A;  3IRR A;  2ISZ A;  2ESN A;  2R7D A;  3R0J A;  2FNP A;  5JVT A;  2RGV A;  1RI7 A;  3KP7 A;  1G3Y A;  5L3E A;  2F5C A;  1RIO H;  3ERE D;  1HKQ A;  4OIN F;  4YII A;  2MD5 A;  2H27 A;  4AIH A;  2QZ8 A;  3DPL C;  3IC7 A;  4BXU A;  2W85 A;  1J9I A;  3V7R A;  4LG0 A;  2XRO A;  2PMH A;  2X0L A;  1BC7 C;  5L3F A;  5E1W A;  3BJA A;  3HTS B;  3PQK A;  1ODD A;  1TNT A;  3IWZ A;  3WU0 A;  2FMY A;  5H6R A;  4BHP A;  2R7F A;  4I2O A;  1FZP B;  1SD4 A;  3F8M A;  2ACJ A;  2H6C A;  3F6O A;  2Y48 A;  4HZF A;  1HQC A;  1KU9 A;  1L0O C;  3R61 A;  5IT3 A;  4HBL A;  2ZXJ A;  2PBI A;  4KMF A;  5BMZ A;  2MBF A;  2GA1 A;  1BIB A;  2GQQ A;  5HS9 A;  3RJP A;  4B8X A;  2PLY A;  2AXL A;  5CYV A;  1GVJ A;  3F8B A;  1W5S A;  1LB2 A;  2RKH A;  1WSU A;  3VOD A;  4MGR A;  3RPU A;  4XSZ F;  4AIJ A;  1BBY A;  4LJZ F;  2IRF G;  1XN7 A;  1QPM A;  2DLL A;  3IHU A;  4HX7 A;  2K86 A;  5E20 A;  3LQR A;  4IHS A;  5CVR A;  3F3X A;  1CF7 B;  2V79 A;  3NQO A;  4RB1 A;  1TTY A;  3L7W A;  1ZLJ A;  3O2P E;  1IZ1 A;  3D0S A;  2Z99 A;  1QZY A;  1LNW A;  2M8E A;  5HVQ C;  3AAF A;  1QBJ A;  4G7O F;  4ZYE A;  3IWF A;  4UHT A;  3C18 A;  4HAM A;  3I54 A;  5DCM B;  2HOE A;  2BEO A;  3ABT A;  5DD8 A;  4OMZ A;  3MZH A;  1XD7 A;  2ZME A;  4MQV A;  2A68 F;  4Y17 A;  2Z33 A;  4M6Y A;  3T5X A;  5F1R A;  4UUV A;  3CO6 C;  1G3W A;  5LGT A;  1ZG1 A;  1NHA A;  3Q5F A;  1YW9 A;  2P6T A;  5JR3 A;  2HTJ A;  4L0Y B;  3MEX A;  4IRI A;  2D1H A;  4R1H A;  5ILU A;  1J5Y A;  1XMA A;  4L18 B;  1I5Z A;  3QU6 A;  2O61 A;  1BOA A;  3SQN A;  4I02 A;  4JBA A;  5DCF A;  3F8N A;  2FSW A;  3FX3 A;  3JTH A;  3E6C C;  2UZK A;  2JRT A;  5FD5 A;  4HDU A;  4LD5 A;  1YS6 A;  2ZCW A;  3T1B A;  1MJA A;  4M9X A;  1IXS B;  2IPQ X;  3SFZ A;  2UXN A;  1UHM A;  2D45 A;  2L3D A;  2VOO A;  5HS8 A;  3VOE A;  2XRN A;  4L9T A;  2LNB A;  3CTA A;  3DPT A;  3FM5 A;  3Q9S A;  2M45 A;  2P5L C;  1S3J A;  4A2U A;  5L3C A;  4IF4 A;  2H94 A;  1ZRE A;  4KYW A;  4CYD A;  2OZU A;  3WTT C;  1V4R A;  2KIF A;  1IN5 A;  2MC3 A;  3GX4 X;  1EH6 A;  3ELK A;  1U78 A;  5CVU A;  3JSP A;  4UNO A;  5L3D A;  2W57 A;  3HHH A;  4UVC A;  3RYP A;  5JHU A;  1Y0U A;  2OZ6 A;  2CFX A;  3W6K B;  5AIQ A;  5D6F A;  3WG9 A;  1FYM A;  3JAM Z;  2A3S A;  2EFN A;  4FX0 A;  5K5R A;  1RZ4 A;  2NS0 A;  5DD4 A;  5LRS A;  3I5U A;  4MQ9 F;  2XKO A;  2CO5 A;  2Q2E A;  3I53 A;  2EK5 A;  2ZO4 A;  3M9A A;  4PCQ A;  3U9G A;  2VBW A;  2A6H F;  2J5O A;  2LDU A;  5FGM A;  3BP8 A;  1K6O A;  1O3R A;  1XGM A;  1LVA A;  4KIF A;  5J8C A;  1IUY A;  4RGU A;  3BWG A;  1JGS A;  1S8N A;  3EET A;  1K7A A;  1KYZ A;  3GVA A;  2YX4 A;  1ZRF A;  3LA7 A;  4AD9 A;  5E8G A;  1SFU A;  2FEZ A;  1LQ1 A;  5D4R A;  1T6S A;  4M74 A;  2OQG A;  1XGN A;  4XBF A;  1ZH5 A;  2QVO A;  2M1B A;  4RGX A;  3ZPL A;  5AIP A;  4Q5S F;  5L3G A;  4M71 A;  1MKM A;  2HTS A;  2E1N A;  2EFP A;  4CGZ A;  2YX7 A;  4IPA A;  3MFK A;  2A07 F;  2G7H A;  1Z6R A;  4YIF A;  1GXQ A;  2PMU A;  3E5U A;  3RPQ A;  2IP2 A;  3JAM K;  2JTV A;  4E70 A;  1YQA A;  4CO8 A;  2PG4 A;  2P6S A;  2F5E A;  4RB3 C;  1QZZ A;  3SHF A;  2F5D A;  2G7U A;  2OU2 A;  3SXY A;  4ZH4 F;  1TW3 A;  3GXO A;  4U0V A;  4O6J A;  3SZP A;  2FXA A;  3MZY A;  1E17 A;  2JZY A;  1S6L A;  1ON1 A;  3F8C A;  3EYI A;  2HQN A;  4WWC A;  5FO5 A;  3GYH X;  2XAG A;  4BHB A;  4I98 B;  2W84 A;  3TO9 A;  4OIP F;  3G3Z A;  3GF2 A;  1ZG5 A;  3KZY A;  1FBS A;  4HLY A;  1Z1D A;  2VBZ A;  1KQ0 A;  2ISY A;  2H6B A;  3WOD F;  5TJJ A;  4M9S A;  2NYX A;  1KA8 A;  4R79 A;  1BN5 A;  1KU2 A;  1LDK B;  5DUK A;  3N97 A;  2P5V A;  2K27 A;  3LST A;  2O6G E;  4UV8 A;  5L3B A;  3EQL F;  2IT0 A;  5BPD A;  1UFM A;  3H92 A;  1P2F A;  4WXC A;  2QQB A;  5BQT A;  1A04 A;  3HOT A;  1HW2 A;  1ULY A;  1HSJ A;  4Q4Z F;  4I01 A;  2K7L A;  3S2W A;  1R36 A;  1EH7 A;  1DPR A;  2E7X A;  4G6Q A;  1ZGJ A;  3ZMV A;  2FF4 A;  1YO5 C;  4RGS A;  2PN6 A;  3J80 K;  1DUX C;  4ENJ A;  1ZLK A;  3B02 A;  2QLZ A;  2WV0 A;  2HKO A;  4P9F A;  1EV7 A;  2CWE A;  3R6S A;  3M8E A;  3RKY A;  1B59 A;  4I0A A;  1VTN C;  2DPD A;  3HSR A;  1XCV A;  1C0W A;  3V4G A;  2XGX A;  5ICE A;  2VOD A;  2DI3 A;  5D8K B;  3I71 A;  2GA2 A;  3KET A;  3LA2 A;  1FLI A;  1XCB A;  4IVN A;  3HIF A;  1FX7 A;  4EMS A;  2XUB A;  1RUO A;  4MTD A;  1B9M A;  2V1D A;  4L9N A;  3KP3 A;  3WTX C;  4G9Y A;  3QAH A;  2G9W A;  4KIG A;  3KEO A;  4OU0 A;  3TOB A;  2BV6 A;  5CJ9 A;  5EEG A;  1H9G A;  1G4D A;  1WWX A;  1EH8 A;  1XGS A;  1MJB A;  2FA5 A;  4NB5 A;  2NAZ A;  2R3S A;  3I0T A;  5FFX A;  2KIM A;  1SMY F;  2W25 A;  2IVM A;  5E1Z B;  1BI0 A;  1XSD A;  1JHH A;  3LA3 A;  4H0E A;  4WF2 A;  2C6Y A;  1SD6 A;  5J8F A;  2V9V A;  2PQ8 A;  3B73 A;  2WTE A;  4U0W A;  5J6X A;  1H9T A;  4CXF A;  3ZN1 A;  2ADU A;  5FFZ A;  1R7J A;  2DT5 A;  1P4A A;  3J80 Z;  2STT A;  3K69 A;  1YW7 A;  4WXH A;  3D5L A;  2PEX A;  3IKV A;  4OIQ F;  1KQ8 A;  1W7P D;  3H3U A;  4EM2 A;  2HZT A;  2K02 A;  1ZGA A;  5CLS A;  3KLO A;  1ZN2 A;  1LEB A;  1G6N A;  3OOP A;  2DO7 A;  3DFG A;  2LKP A;  4D0P A;  2LF7 A;  5KVR A;  2GAU A;  1F1Z A;  4LLG F;  3ML6 A;  1FP1 D;  2HDC A;  2K4J A;  4M6X A;  3WGH A;  2DPU A;  1ZG3 A;  4ZZL A;  2A5Y B;  3HSF A;  4IXA A;  3HRT A;  1K78 A;  4BNC A;  1HST A;  3FHZ A;  3KE2 A;  4EJO A;  4CZZ A;  3FWE A;  2VOP A;  4LG0 B;  3TO6 A;  1O3Q A;  3KFW X;  4PZJ A;  4L0Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...