3M8EA

Protein structure of type iii plasmid segregation tubr
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
101
Chain Sequence
HHHHFYTLNIAEIAERIGNDDCAYQVLMAFINENGEAQMLNKTAVAEMIQLSKPTVFATVNSFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKAMEMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From the Cover: Plasmid protein TubR uses a distinct mode of HTH-DNA binding and recruits the prokaryotic tubulin homolog TubZ to effect DNA partition.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Dna binding protein
molecule keywords Putative DNA-binding protein
total genus 28
structure length 101
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3m8eA00
2P4WA 1BM9A 3DFGA 5ICFA 5DCFA 2A69F 2O8XA 4RAYA 2A68F 2FQ3A 5LHGA 2LSOA 4E70A 3FHZA 1H9TA 2DQLA 3CLOA 3BWGA 3SZTA 3I59A 3NQOA 1IXSB 1LEBA 4L0ZB 2CWEA 5KVRA 1U5TB 2FMYA 2OAZA 4M6YA 2FBKA 1YW9A 1T98A 4HW0A 2HQNA 2O61A 4OOIA 1IN6A 3IWFA 1YW8A 5HDGA 2KIUA 4OIOF 3N4MA 4YIFA 5DEQA 1FY7A 3WE2A 2VXZA 1ZLJA 1S6LA 3GVAA 2PMHA 1RI7A 1XN7A 3T0YA 2PBIA 1P4WA 5D5XB 2H6BA 1OYIA 2M1BA 5DV5A 1IZ1A 2XRNA 5E8GA 4RGRA 3H92A 2ISYA 1QZZA 4EM2A 1S7OA 2BBYA 2ESHA 2Y0MA 3RDIA 1Z6TA 5L3FA 4N9HA 2XV4S 2G9WA 3WGGA 2DQRA 1BC7C 5FLXK 3ZMSA 2FA5A 2MA3A 2DK8A 4U7BA 4A6DA 3WTXC 4MTDA 1YYVA 3LA3A 1ZH5A 2LNBA 4HQEA 4WWCA 4B8XA 1PUEE 2V1UA 5JFRA 1F1ZA 1B4AA 6PAXA 1Z9CA 2L01A 4PZJA 2CG4A 4HX4A 1ZYRF 3P7NA 4P55A 1J0RA 1KU7A 3GX4X 4HV6A 1JXSA 5D5UB 4M74A 3LQRA 1FNNA 1XGMA 1V3FA 4L5IA 4YFXF 5FFZA 4IRIA 1HSJA 4ESBA 5LEJA 2VBXA 1ZG3A 2QENA 4GGGA 4Q4ZF 4GXOA 3M9AA 3QU3A 2EFQA 2H94A 5TJJA 3FM3A 2YU3A 1JE8A 2F5EA 3FM5A 4U0VA 2IPQX 1LB2A 3SZPA 4YIIA 3ZMDA 4ENNA 3GF2A 3D0SA 4KIBA 5ILSA 2M30A 5JR3A 1FYLA 1NHAA 3FXUA 2JT1A 3RPQA 4EM0B 2ZO4A 1F9NA 3HTUA 3F6OA 2MBFA 3L9FA 2L4AA 2GIVA 2IJLA 5J8CA 4CYDA 1J2XA 4ENKA 1JHFA 1TW3A 2P5VA 4WX9A 5F1RA 5LLQA 1GXPA 2IA2A 1W5SA 2M5WA 4R79A 1SFXA 1TW2A 3T8TA 3KP7A 1WRJA 3WG9A 2QVOA 1FLIA 1YIOA 4EJTA 4G6QA 4CDGA 1QQIA 3HYIA 3WTZA 2P7CB 2AS5F 2CQKA 1ONVA 2VT3A 1B9NA 2ETHA 1S29A 3WU0A 3CO6C 3AAFA 5FB2A 2LKPA 2DO7A 2VBYA 4Q5SF 3WE3A 3CUQB 3W6KB 1O3RA 3TOBA 5ICCA 3KP6A 1L3LA 5HOOA 2HWVA 3T8RA 4EMSA 2EK5A 3DQVC 3J81K 3GWZA 3R0JA 4CGZA 2ZNYA 4JBAA 4QLCU 5DCMB 1DDNA 4AIKA 2R7FA 1XDSA 1T39A 3NEUA 2XVCA 2XASA 4LLLA 2OD5A 2B0LA 2OZ6A 1BJAA 3GW2A 3F8CA 3KP3A 4Z2YA 2IA1A 1I1SA 1QGPA 1U2WA 1TQIA 4HYEA 5L3DA 4EVIA 2PJPA 2ZKZA 1ON1A 2VBZA 2ZMEA 2G7UA 3FMSA 4OMYA 3BZ6A 3R4KA 1SMYF 1R1UA 3EUHA 2W25A 3ECHA 3KCCA 1LQ1A 3P9CA 4FX0A 2K86A 2VE8A 1K7AA 1PDNC 5D4RA 2VOOA 3N97A 4G9YA 4HF2A 4KMUX 1MD0A 3JTHA 4G94A 5AIPA 1I1GA 2EA2A 3GUDA 2QQ9A 1YQAA 2VT2A 3B73A 1I6XA 2XAFA 1G3TA 4RB2C 4H0EA 4U0YA 5L3EA 4A5NA 4I01A 2IW5A 2ZFWA 4ENJA 1FC3A 4KUMA 4S05A 4AD9A 5DYMA 3KETA 3TO7A 4EJUA 4RB0A 3V8LA 1SAXA 1TTYA 1L0OC 4CXFA 4LJZF 3EYYA 2IP2A 2HS5A 2XGXA 1P4XA 5H6RA 4PGHA 4KICA 1P2FA 3HTSB 3M8FA 2EV0A 1KA8A 3E6CC 2CYYA 4FX4A 5JI6A 3I71A 5ILUA 4R8HA 2RDPA 1OMIA 1W7PA 3HSEA 5E20A 5EEHA 4RB1A 4GYGA 3K1PA 2DAOA 3GZ6A 5F6FA 3HOSA 1IN4A 4ESJA 1DPUA 3ZN0A 5E1XA 4ASNA 5LBQA 1B9MA 1O57A 4OINF 2OQRA 2QQAA 4Y17A 2STTA 1HW2A 1LJ9A 3BROA 1P4AA 2CGPA 2Z5UA 4HOBA 2YX4A 2K4BA 1FZPB 1OYYA 1IN8A 1SD5A 4EV0A 2ZBKA 4XSXF 3WTSC 2EA4A 4I0BA 1QZYA 2DLLA 3O2PE 1G6NA 1G4DA 5L3GA 1LEAA 2H6CA 5DCMA 2H09A 1FP1D 5BOXA 3BP8A 2G7HA 2FBIA 1XSXA 1E17A 1R5GA 3IL2A 3CDHA 2CSOA 5A2QK 4IRHA 4UVCA 4K2EA 5IT9Z 2XROA 2C6YA 3E5XA 2ACJA 1CF7B 2GQQA 3Q9SA 3EETA 4N0BA 3GFIA 4Q48A 2DFIA 1U3EM 1STZA 1ZHFA 2ZMEB 2Y48A 3KP4A 1FBQA 3RKXA 2EV6A 3C18A 5HVQC 4HZFA 1Y0UA 1KU2A 2VONA 2NAZA 4IHSA 2JZYA 3HUGA 4GCVA 3I54A 2L3DA 5DDGA 3ZMVA 3E3VA 3GYHX 3K1MA 5BQTA 1O3TA 4L9NA 4L9TA 3IKVA 3SXYA 4MQ9F 2OQGA 1P92A 3ZQ7A 3G3ZA 2A5YB 4WXDA 5KK1A 3BJ6A 3O6BB 4UXNA 2QBYA 1XDUA 3IC7A 1RIOH 1KU3A 1HXDA 1LNWA 2P6TA 2M45A 1F5TA 2NS0A 2RQPA 2TDXA 4QWQA 1XCVA 1YTYA 3U2RA 5CYVA 3I64A 2GXBA 1Q1HA 3RI4A 5D6EA 2HTJA 3HHGA 2Y75A 4IXAA 3JTGA 3ZPLA 1HKSA 1Z6RA 1TQMA 4U0WA 4LGWA 2FU4A 1USSA 1CF7A 3FZVA 4BXUA 4KN4X 3KFWX 2QWWA 2V9VA 5H6QA 3F6VA 5ICGA 1ZGAA 3L2CA 4MTEA 4AWXB 3TO6A 3F8NA 4KT5C 3HRTA 1U5TC 5DUIA 3R60A 2GXGA 3K0LA 2QLZA 4ZYGA 2Q0OA 1IXRC 2RVCA 2KRFA 3MZHA 1K78B 4P9UA 1HSTA 3LAJA 5D5WB 3JAMK 5K1YA 1IAWA 2FNAA 4EJWA 3SFZA 1O7FA 2UWMA 2OU2A 3OV8A 2EFWA 1IF1A 1B59A 3F22A 4RGXA 2RC4A 2HOEA 5JHUA 2DU9A 2W85A 2A6HF 2PMUA 3RKYA 5BMZA 3LAPA 2JPBA 1R22A 1B1BA 2WC2A 4XBFA 1FYMA 3ZMZA 5CVJA 2QYOA 1PP7U 1XMKA 4L5JA 3COAC 3R0AA 3EYIA 4XRFA 4U7DA 1QBJA 4A0YA 2STWA 2R3SA 4I0AA 1Z91A 3GLXA 4HQMA 1KQ8A 2HR3A 3F8MA 1KGSA 1S8NA 3ZN1A 4O6JA 3WGHA 2D1HA 2Z99A 1ZG1A 3H3UA 2R7DA 2K27A 3FWEA 5E18F 4KIFA 1KU9A 2JPCA 2PLYA 2AXLA 3F72A 2XAGA 3JSPA 3IKTA 1FBUA 4ZYDA 4I7HA 4M72A 2H27A 3HRSA 1R5HA 2EFNA 4UV8A 4IHTA 3SHFA 2FNPA 2KJCA 2V1XA 1SFEA 5HS9A 3E6MA 1KYZA 4EGZA 4MEYF 5JVTA 1TQPA 1R58A 1K78A 2BEOA 3ML6A 5FD5A 2JTVA 4G8XA 2GA2A 3I5UA 3GO5A 2ZNZA 4ETSA 5CVVA 4NQWA 1USTA 2KIFA 2HGCA 4HV5A 4RGUA 2FEZA 3CUOA 4JQFA 3FMRA 3DV8A 2NYXA 3KZYA 3RTRA 3K1NA 1ZN2A 2D2WA 3I0TA 3ULQB 3ZMTA 1HW1A 4I02A 2A07F 3JW4A 4KDPA 2WWYA 1UB9A 1R1VA 3V7CA 3L09A 1GVJA 2K7LA 3MZYA 4LD5A 1R00A 5HS8A 2HKXA 1F4KA 4M9XA 3MWMA 3HHHA 5IT3A 3MAJA 1O3QA 2CO5A 4O5VA 2EFPA 1FP2A 3CJNA 2DTRA 2O6GE 3F3XA 4BHCA 3V8JA 1G3YA 4PCQA 4S04A 1LDKB 1W4MA 1FWZA 2FMLA 2XKOA 4HF0A 1D8JA 2P6SA 3FMQA 3HIFA 3ECOA 1SMTA 1HBXG 1XB4A 2J5OA 5LHIA 5LGNA 5AIQA 4UVBA 4CICA 1D5VA 2VE9A 2MH9A 2PQ8A 3RYPA 4BQAA 1YS7A 2K4JA 3RYRA 5D4SA 3J80K 3RKWA 2IRFG 4WXCA 2YR2A 3I53A 1MDMA 2VBWA 1MJAA 1J59A 2DPUA 1KQ0A 3WTVC 4CO8A 4HX7A 3S2WA 4ZYHA 2XIGA 3GFMA 3QP6A 4BH9A 2WV0A 1ZLKA 1W7PB 3BDDA 3L7WA 1RNLA 3E97A 2FSWA 5A2QZ 3HRMA 5J8FA 5IT9K 3O3KA 2HEOA 1W5TA 3IHUA 2QZ8A 5BS6A 3MCZA 4Y13A 1LVAA 2YX7A 2VODA 3U1DA 2MLGA 1ZRFA 4ZH4F 2JRTA 5K5RA 5F64A 2KKOA 1B6AA 4L9JA 4HBLA 1G3SA 1FT9A 5E17F 1SD6A 2K02A 3FXRA 2JSCA 4EM1A 5LRRA 1IN7A 1DUXC 3J7AO 2BV6A 1C0WA 3PFIA 3DKWA 2YSRA 3VOEA 2O03A 2FBHA 4KA4A 4ENMA 2EV5A 1QNTA 1XGOA 4YG2F 1FSHA 4G7OF 2VOPA 1KYWA 4GYIA 2PN6A 4ZZLA 2HZTA 5D6FA 3T5XA 1SFUA 1BI3A 1EV7A 2D45A 4HLYA 1WWXA 3TGNA 5L3CA 3PQKA 5BPIA 3KP2A 2XAHA 5E1WA 4L18B 4WK8F 4GO1A 2LDUA 2BE5F 3QU6A 4BAYA 3GXOA 1TNSA 1OPCA 2P8TA 4HLXA 4BHBA 2Z9OA 3P9KA 2Z33A 1IUYA 1HKTA 1ZAOA 2FOKA 1BI1A 2XKPA 3LQQA 1QPMA 3V8KA 3FXQA 1TLHB 1REPC 5CLSA 3IWZA 4OIRF 1RZ4A 4LK0F 2HTSA 4I09A 2DI3A 3VEPA 1UHMA 4OU0A 3TOAA 1H0MA 3QPHA 4A0XA 1DPRA 1EH8A 3EQLF 3BJAA 1LDDA 1R36A 5HLGA 4I98B 2UXNA 4IPAA 3DEUA 3QRFF 1O3SA 1MZBA 3IRRA 2LF8A 1ZRDA 1PP8F 1FOKA 4WF2A 2IT0A 2QBYB 1YO5C 3F21A 3L00A 3CO7C 4P5OA 2ESNA 1MGTA 5CVUA 4M73A 4G7HF 3KZZA 2MLKA 3JAMZ 1J75A 2X4HA 5ICEA 2P7VB 4LMYA 4Y15A 1IXCA 5TRDA 4FHTA 1HW5A 2QQBA 2P5KA 3K69A 1GXQA 3GZ5A 4MNUA 1FX7A 3V7RA 3I58A 3TDUC 3WTYC 5HDKA 1MKMA 3LFKA 4AIHA 3MFKA 2VC0A 2ZJ2A 3I59B 3ISPA 1U5TA 2E1CA 2HKOA 3C7JA 3V4GA 2DK5A 3KE2A 1WSUA 3F23A 4LLGF 1ZARA 2V79A 3KLNA 3QPTA 1JHHA 5FLXZ 3WU1B 1I5ZA 5K5OA 4RS8A 2IVMA 1O7LA 5E8IA 2EFOA 3BY6A 3R61A 3ELKA 5L3BA 2E1NA 4UV9A 2CW0F 3DPLC 4EJOA 1JGSA 1FSEA 1XSDA 4A12A 4NHJA 3U9GA 4MHGA 3TO9A 4OMZA 3WTWC 3QAHA 3WTUC 4G7ZF 1J9IA 1D3YA 1Z05A 1G3WA 1U6GA 2Q8KA 1FYKA 2RV8A 3RJPA 4F7ZA 2NNNA 2COMA 2XHKA 4KYWA 3MQ0A 4UVAA 4O3MA 3K2ZA 1IRFA 3HSRA 1IN5A 2HYGD 3CTAA 1OKRA 5HDNA 2F5DA 4EGYA 1QO0D 3M7GA 4CZZA 2A6EF 2EJRA 2BGCA 5CVRA 1WKMA 4HA8A 2A61A 4CHUA 4A2UA 4KMFA 3T1BA 1IRGA 1DP7P 3ERED 4BNCA 1MJ9A 5AONA 5FGMA 5CVIA 2MC3A 4MGRA 5FD6A 3ZMUA 3G73A 1FBSA 3TKYA 3B02A 2FXAA 4AVPA 2BYVE 3W6JB 2GZWA 1BN5A 5FFXA 1YS6A 3I4PA 4HF1A 3WTTC 2PG4A 2J5PA 4AIJA 2MD5A 4M9SA 1R1TA 3M1EA 3GFLA 4IVNA 4B09A 3OOPA 2EB7A 2E7XA 4MQVA 2GAUA 2W84A 4LB5A 2O0YA 1E2XA 4LLNA 2L02A 1OYWA 4HX8A 4NB5A 2ELHA 3REOA 2F2EA 1D8KA 3E6DA 3LSTA 3V7SA 5E1ZB 4LFUA 4WCGA 1GHCA 4EJVA 5LGUA 2DPDA 5DUKA 2PI0A 1H9GA 1BIBA 4WXHA 4HDVA 5D8KB 1FPQA 3BPVA 1SD4A 4HAMA 2F5FA 1VTNC 1ZGJA 1S7AA 4PGGA 4U88A 3VB2A 2XAJA 5HLHA 2QUFA 4TV7A 5DD4A 1MDMB 5BPDA 2KJBA 3K9TA 3ABUA 1CGPA 3J80Z 3BOQA 3TQNA 1UFMA 3J81Z 2L4MA 4IF4A 5LRSA 5ED4A 1XCBA 2VN2A 5D5VB 1YLFA 1S3JA 2ZCWA 1X3UA 3R6SA 3LA2A 1I27A 2D1VA 1ULYA 1WI9A 1ODDA 2Z3YA 1Z1DA 3KEQA 2HFHA 4RAZA 2DW4A 2DBBA 1U78A 3CUQA 3C1DA 3Q9VA 4LG0B 3D5LA 1XGSA 4UNOA 1V4RA 2Q2EA 1IW7F 3SQNA 1YFHA 1A04A 4XSZF 1ZRCA 3E5UA 3DP7A 3JSOA 1XD7A 1OR7A 2OA4A 5H20A 2RN7A 2HYFA 2RNJA 2L54A 4UHTA 3KEOA 4EQQA 1ZREA 3H3ZA 1UCRA 4Q47A 2W57A 1ON2A 2V1DA 5ERIA 3Q5FA 1RUOA 3GFJA 4N9IA 3VFZA 2PEXA 1KQ9A 2O3FA 2DT5A 1BIAA 3TDZC 3IRQA 1BI2A 2MH2A 5CJ9A 3RPUA 3DXJF 3PQJA 1XSVA 4RGSA 3HOTA 4LB6B 2XUBA 3P9IA 1TBXA 5HS7A 4KFCA 4RB3C 1EH7A 2W24A 5J6XA 4UUVA 4A0ZA 4OIQF 1R7JA 5DD8A 2KIMA 2YPRA 4LK1F 1T6SA 1HQCA 4ZZDA 2GA1A 3KLOA 3VODA 1AOYA 4BYYA 3MEXA 1AWCA 3QP5A 2LF7A 3CUQC 3RIRA 2HDCA 1T2KA 3WGIA 1HKQA 2OBPA 5LHHA 1TNTA 4IJAA 2NRAC 3KP5A 4A6EA 4P9FA 1K79A 5HLIA 1W7PD 3E6BA 3M8EA 2QM3A 4ZYEA 4L0YB 3ABTA 4KNYA 2IA0A 2UZKA 4M6XA 4XLNF 4M71A 3C3WA 2A3SA 1UHWA 1BBYA 1K6OA 2ISZA 1MJBA 5ILVA 3GEZA 2EWNA 2X0LA 3BPXA 3LWFA 2V6CA 1BOAA 5LGTA 5FO5A 2FF4A 4DNCA 1BC8C 4IRGA 4P96A 4JK1X 1T0FA 2UXXA 2M87A 4D0PA 4L9VA 1YG2A 3DF8A 2ADUA 2M8EA 3QOPA 4A5MA 4ON0A 3E5QA 3FF5A 4KN7X 3ROUA 2ZXJA 1ZG5A 3HSFA 4KIGA 1RUNA 4OIPF 3HRUA 4BHPA 2WTEA 4XLPF 2F5CA 5D8LB 2FRHA 4PDKA 2GWRA 2RGVA 2P5LC 1SD7A 2HQRA 4R1HA 1J7KA 2E7WA 1WQ2A 3DPTA 3F8BA 1BI0A 2NNYA 3EDPA 4ESFA 4LG0A 5K5QA 3NRVA 5EEGA 1T38A 1XGNA 4FT8A 4YFNF 1YW7A 4MEXF 5LEKA 2PFBA 1LDJA 1J5YA 1Z7UA 1XMAA 4I2OA 4YFKF 4G6DA 3WODF 3FX3A 2OZUA 3F8FA 1U8RA 2FE3A 3ZP5A 3LA7A 4HDUA 2VC1A 1P6RA 4M9ZA 1EH6A 2RKHA 2CFXA 1R23A 4DQ2A 3BJOA 2XAQA
chains in the Genus database with same CATH superfamily
2P4WA 1BM9A 2R5ZB 3DFGA 2CQXA 5ICFA 5DCFA 1Z0XA 2AQEA 3DTKA 5K7ZA 2A69F 1TL8A 2O8XA 4RAYA 2A68F 2FQ3A 5LHGA 2CUJA 2LSOA 4E70A 3FHZA 3QWLA 5GAHJ 2DQLA 1H9TA 3CLOA 1UHSA 3OYAA 3BWGA 3SZTA 3I59A 3NQOA 1IXSB 1LEBA 4L0ZB 2IGKA 5F1JA 1RKTA 2CWEA 1HCRA 2R7XA 5KVRA 1U5TB 2FMYA 2JN6A 2HOAA 5M3MJ 2OAZA 1D0ZA 2E60A 2X85A 4M6YA 2FBKA 4D1QA 1T98A 1YW9A 1X2MA 4PK4A 2DOEA 2BHYA 4HW0A 2HQNA 2R7ZJ 2O61A 4ZDOA 3K2AA 4OOIA 4DYRA 1IN6A 1IO2A 3IWFA 3ZQIA 3DCFA 4BL0B 4CSWA 3RZDJ 1YW8A 5HDGA 5J1YA 2KIUA 3D5SC 1ZLKA 4OIOF 3N4MA 4YIFA 5DEQA 2ID6A 1FY7A 3WE2A 4E7LA 2E5ZA 1AA7A 4XOTA 2VXZA 1ZLJA 3CF5F 1OISA 1S6LA 3GVAA 4RDUA 1Z21A 2PMHA 2CJJA 1RI7A 1XN7A 3P5JA 3T0YA 4RAGA 1B72A 1PJRA 3BTLA 9ANTA 4FQGA 2PBIA 1P4WA 1A6IA 5C44J 5D5XB 2CV2A 2BW3A 1OYIA 2H6BA 4I6ZA 2M1BA 3HEFA 5DV5A 1IZ1A 2XRNA 5E8GA 2EZKA 3CDIA 4II2A 4RGRA 2O8KA 5JVGF 3H92A 2ZXWH 1FIAA 3O8HA 2ISYA 1QZZA 4M3GA 4EM2A 3MKYB 1S7OA 2BBYA 3ZQQA 1TC3C 2DFHA 2ESHA 2Y0MA 3RDIA 1Z6TA 5L3FA 4N9HA 4B4CA 2XV4S 2G9WA 3BZCA 3S32A 3WGGA 4D9JA 5KAIC 4IQ4A 5IP7J 1R6RA 1UG0A 2DQRA 1W0TA 1BC7C 1MSFC 2ZFUA 5FLXK 3ZMSA 2FA5A 2MA3A 2DK8A 4U7BA 4A6DA 3MKWB 1MIJA 3WTXC 2NOGA 3RZOJ 2R92J 4MTDA 4XK4A 3ASOH 1YYVA 3LA3A 1UAAA 3DU5A 1X3WB 1Q1VA 3SEZA 1IGNA 1ZH5A 3WHBA 4DIQA 2LNBA 3CCQI 4HQEA 4WWCA 4B8XA 1PUEE 2V1UA 4XLHA 5JFRA 3HG9A 3K4LA 1F1ZA 3SYTA 4C3IJ 1B4AA 6PAXA 4H4KC 4E7IA 3RKQA 3H0DA 4XLAA 1Z9CA 2LRDA 2L01A 4PZJA 3HOYJ 3FDYA 2CG4A 4HX4A 3FBIB 2LY2A 1ZYRF 3P7NA 4P55A 3A02A 1J0RA 1KU7A 3GX4X 3OL4A 4HV6A 1WJAA 1JXSA 5D5UB 4M74A 5F0CA 2GIZA 3LQRA 1FNNA 1XGMA 1V3FA 4L5IA 2WY7Q 4YFXF 3SJMA 2WA0A 5FFZA 4IRIA 1HSJA 2HVQA 4ESBA 5LEJA 1VQ6I 2VBXA 2R4GA 1SFOJ 1ZG3A 2QENA 3L2WA 4GGGA 4Q4ZF 3L2UA 4CCLA 1ZGWA 3CDLA 4GXOA 3LSJA 4XOPA 1X1PA 2VKHA 4PSXA 1IJWC 2F6CA 1JJ8C 3M9AA 3L2QA 3W3CA 3QU3A 4QPQA 4F93B 2EFQA 2H94A 5TJJA 3FM3A 4AYBA 4ZDLA 2YU3A 3PFYA 1JE8A 2F5EA 4XNFA 3OYGA 3S17J 1MSEC 3FM5A 4U0VA 2IPQX 2LBFB 1LB2A 3SZPA 3BR1A 4YIIA 3ZMDA 2L7KA 4ENNA 3GF2A 3D0SA 4KIBA 1JI8A 2HXIA 5ILSA 2DXIA 2M30A 2HPIA 2ZJPF 2LOOA 5JR3A 1FYLA 2CQNA 3H0GJ 1NHAA 3FXUA 2JT1A 3RPQA 4EM0B 1I3QJ 2ZO4A 1F9NA 3HTUA 2IEKA 1VQ5I 3F6OA 3GCMA 2JA8J 3FK7A 2MBFA 3PNVA 1N75A 1YOVB 3IAM2 3L9FA 2L4AA 1EKEA 3Q3SA 3K4BA 2ZXHA 1BR2A 4IZZA 2GIVA 2IJLA 5J8CA 2WAQA 4CYDA 1WJCA 1IV8A 1J2XA 3FHNA 4C2MJ 4ENKA 5EDNA 5E3MA 3O8GA 3K10A 1JHFA 2H8WA 1N78A 1TW3A 3ABKH 5EGOB 2R5ZA 4XIDA 3GTLJ 2P5VA 4XN3A 4WX9A 5F1RA 5LLQA 2E34A 3H5AA 1GXPA 2IA2A 1W5SA 2QSHX 2M5WA 4R79A 1GUUA 2VL8A 2V1NA 1V5GA 3J7ZI 1ETXA 1SFXA 2KIQA 3CMAI 1VQLI 1TW2A 2M0MA 3T8TA 5EF6A 3KP7A 1WRJA 1ETKA 3WG9A 2CS3A 2EQRA 3BLYA 1TWFJ 2QVOA 1FLIA 1YIOA 2DA7A 3ASNH 4G6QA 2DA5A 4EJTA 2PJRA 4CDGA 1QQIA 5E79C 3HYIA 3WTZA 2P7CB 2AS5F 2CQKA 1RETA 1ONVA 1X19A 4NC7A 4GRIA 1ZR2A 2XGDA 2BW3B 2VT3A 2XF7A 1B9NA 2CV0A 3QOEA 2ETHA 1S29A 3WU0A 3CO6C 3AAFA 5FB2A 2LKPA 3AG2H 5FLVA 2DO7A 2XPUA 3PSIA 3PSFA 4JYKA 2FQ4A 2VBYA 3OYJA 3BQZA 4OAZA 5GP9A 4Q5SF 1MBJA 3H1CA 3WE3A 3CUQB 4FISA 2KRCA 3W6KB 1OCZH 1X1BA 2L9RA 4FASD 1O3RA 4A3LJ 4LIVA 3BR3A 2V26A 3TOBA 4BS9A 2EZHA 5ICCA 1ENHA 5F0FA 4CUGA 2ELJA 3KP6A 2N8GA 4HSTA 1L3LA 2NVYJ 2QKLB 4NBQA 5HOOA 2KQRA 2HWVA 3T8RA 5K7HA 4CCNA 2LH9A 4EMSA 2EK5A 3DQVC 2F5VA 4OAYA 3J81K 3GWZA 3R0JA 4CGZA 2ZNYA 2H1LA 4JBAA 4JX6A 1JTXA 4QLCU 5DCMB 1DDNA 4AIKA 2R7FA 1XDSA 4YEJA 4W97A 3NEUA 2XSDC 2XVCA 1T39A 2XASA 4LLLA 2OD5A 1YJNI 2B0LA 2OZ6A 1F43A 1BJAA 3GW2A 1OCPA 2AQFA 3FXLA 4AYBN 4J19A 3S1NJ 3SZGA 3ZQCA 3W6VA 3F8CA 1JJ6C 2HZDA 2K9SA 2XF5A 5CQGA 2Y31A 3KP3A 4Z2YA 3QYFA 2IA1A 1I1SA 1QGPA 1U2WA 5M5WJ 1TQIA 4HYEA 3DWLE 5L3DA 3A01A 4EVIA 3RQ4A 4FETA 2PJPA 2ZKZA 4BU2A 2FX0A 1ON1A 4RBOA 2WV1A 2VBZA 3CCLI 3HGYA 4BY1J 2ZMEA 2G7UA 1WI3A 3FMSA 3KZIC 4BQOA 4OMYA 1E3HA 2XPVA 3BZ6A 1ZK8A 2HYJA 3R4KA 4XN0A 1SMYF 4XLCA 4IX7A 1R1UA 2VXDA 5M5YJ 5B66C 3EUHA 1R4NB 2WB1A 2W25A 2X1CA 3ECHA 3KCCA 2HXOA 2WAQN 1LQ1A 3I4MJ 3BR2A 3P9CA 4FX0A 3UR3C 3H3VK 2K86A 2VE8A 1K7AA 2V6EA 2AXTC 3S8PA 1PDNC 5D4RA 1AU7A 2VOOA 4ITVA 3G1MA 4G9YA 3N97A 1LUJB 4HF2A 2WBMA 1MD0A 4KMUX 3MD2A 3JTHA 4G94A 4J01A 5AIPA 5M5XJ 1I1GA 4DJAA 2DYRH 2EA2A 5KAFC 3GUDA 2QQ9A 1YQAA 2VT2A 3B73A 4Y4RA 1GV5A 4NUBA 1I6XA 2XAFA 1G3TA 4RB2C 1FOYA 4H0EA 4U0YA 3G2BA 5L3EA 4PSWA 4A5NA 2OPTA 3KX2A 3S3OA 4I01A 2DMPA 2IW5A 3PNYA 3DTIA 2ZFWA 2CW7A 5J1RA 4ENJA 1FC3A 2UUZA 4KUMA 4S05A 4AD9A 1FOWA 5DYMA 4BDZA 2XB5A 3KETA 4XKBA 3IAS2 3TO7A 4EJUA 1UZCA 1Z7LA 2NVXJ 3CJQB 4RB0A 3V8LA 1SAXA 1F36A 1TTYA 3BCAA 5F08A 1MNEA 1L0OC 2O5RA 1X3ZB 4CXFA 4LJZF 1SANA 4A3BJ 3EYYA 2IP2A 2HS5A 2YS9A 2XGXA 3ZQHA 2DFFA 3HOZJ 1P4XA 5IYBJ 3QPLA 4PGHA 5H6RA 4KICA 1P2FA 4NC6A 3HTSB 5J4VA 3M8FA 2EV0A 1KA8A 4BDYA 2XC7A 3E6CC 5EGOA 4XKCA 1K4TA 2CYYA 3DLLF 2BY1A 4FX4A 1ETQA 1PVEA 3S1RJ 5JI6A 3H9GA 5KCMA 3WHCA 3EPZA 3I71A 5ILUA 4R8HA 1PUFA 2PMZN 2RDPA 1OMIA 2BY3A 3CCVI 1W7PA 3HSEA 5E20A 4LOCA 5EEHA 2JVGA 3NWSA 1Z3XA 4RB1A 1VQ8I 4GYGA 4F3QA 4RAFA 4NDLA 4PJNA 3K1PA 1AHDP 2A5WA 2DAOA 2Z2SB 3GZ6A 1MH4A 4DBQA 2R93J 3CC2I 1VQMI 5F6FA 3HOSA 1IN4A 4ESJA 3GTGJ 2DMNA 1DPUA 3ZN0A 5E1XA 4ASNA 3A01B 5LBQA 1B9MA 2Y69H 1O57A 3D1NI 4OINF 1R4MB 2OQRA 2QQAA 1POGA 3AG4H 1H88C 1A5JA 2XRLA 1RC9A 2JA6J 4Y17A 2STTA 1HW2A 1LJ9A 1OCOH 3GTKJ 3RCOA 1MBHA 4Y7NJ 2CUFA 3ZGKA 1WCMJ 3BT9A 3BROA 1P4AA 2CGPA 2IS2A 2Z5UA 4HOBA 4FTHA 1X1DA 2E35A 2YX4A 2X6YA 4S0HB 2K4BA 3MMYB 4XONA 1FZPB 1OYYA 5GAGJ 3SDBA 1IN8A 1SD5A 2DA2A 3LL7A 4EV0A 1U8BA 2ZBKA 4XSXF 3WTSC 3GTOJ 2EA4A 4I0BA 1QZYA 2DLLA 3F9KA 3O2PE 1G6NA 2EBIA 4FE4A 2HOSA 4IQJA 4EATA 5DTDA 3ZCOA 3EUKL 1G4DA 1A36A 2E71A 5L3GA 4N4NB 4XMYA 1LEAA 4BUPA 2R7OA 2H6CA 3A1YA 3DBLB 2BOLA 4EEFG 5DCMA 2OCCH 2H09A 1FP1D 5IPAA 2MFZA 3BP8A 5BOXA 2G7HA 2HOTA 2EIJH 2FBIA 1XSXA 4BACA 2DN0A 1E17A 1R5GA 1MBFA 3IL2A 3CDHA 2E19A 2CSOA 2JRMA 5A2QK 4IRHA 4UVCA 4K2EA 5IT9Z 5JHFA 2XROA 2C6YA 2LY1A 2YU9J 2R7TA 3E5XA 4M6VA 1YITI 3BTIA 2ACJA 3WG7H 1CF7B 2QQ8A 2GQQA 3Q9SA 1UJ8A 2EZIA 2VKVA 3EETA 4N0BA 3GFIA 4Q48A 2M4GA 2DFIA 2JJ7A 4XORA 4AIDA 2CUEA 1NK2P 2ID3A 1U3EM 1STZA 1ZHFA 1FJLA 2ZMEB 2Y48A 1MMNA 3KP4A 1HDPA 1FBQA 1Z77A 3RKXA 2ZSIB 2EV6A 5FRNA 3C18A 5HVQC 4HZFA 1Y0UA 1KU2A 4XKVA 1YIJI 2VONA 2NAZA 4IHSA 3CCYA 3ZR8X 2JZYA 1OFCX 4B3XA 1TT0A 3K70D 2QKMB 3HUGA 3JREA 3S15J 3OY9A 2E2JJ 3V42A 4GCVA 2DOFA 3VYTB 3LSHA 3I54A 4ZDPA 5F27A 2L3DA 3GTPJ 2DA1A 5DDGA 1ITYA 3ZMVA 3E3VA 2I8DA 3GYHX 2X48A 3K1MA 5BQTA 5JLWA 4A3MJ 1O3TA 4DZJA 4L9NA 4L9TA 3IKVA 1NG6A 3F0CA 5C4XJ 4PJ0C 3FIWA 3SXYA 1KONA 1D5YA 3CESA 5IOYA 4XRSA 1TT5B 4MQ9F 2OQGA 2JUGA 5CKTA 3JRFA 1P92A 2KT0A 3ZQ7A 3G3ZA 2A5YB 4WXDA 2BY0A 5KK1A 1T08B 3PIPF 3JRHA 3BJ6A 3O6BB 3S16J 2Y0SA 4UXNA 3S3NA 2QBYA 2HQAA 1XDUA 4HNVA 3IC7A 1RIOH 2MD0A 1KU3A 1HXDA 2K9MA 2XB0X 1LNWA 2P6TA 2M45A 1F5TA 2NS0A 2RQPA 2TDXA 4QWQA 1XCVA 1YTYA 3BG9A 4YIRX 5DM7F 2WADA 2CW8A 3U2RA 3KYLA 5CYVA 4BEHB 3I64A 2GXBA 4PFPA 1ORKA 2KDZA 1Q1HA 4AM3A 3RI4A 3B6CA 3K4KA 5D6EA 2OTJI 2HTJA 3HHGA 2Y75A 3JCUC 4MO7A 3SDGA 4IXAA 3JTGA 1XMXA 4JX5A 3S3MA 4PJJA 3ZPLA 2R7SA 3IH2A 1HKSA 1VQPI 1Z6RA 1TQMA 1TWCJ 4U0WA 4LGWA 5FKKA 4A69C 2FU4A 2X1EA 1USSA 3PO2J 2X6WA 1CF7A 3FZVA 5B5EC 4BXUA 5J3LA 2K9LA 4KN4X 3KFWX 2QWWA 2VUMJ 3FKIJ 2L5QA 2V9VA 3HGGA 3PUBA 5H6QA 3F6VA 2L0KA 5ICGA 1ZGAA 3ESWB 1IRXA 3L2CA 3OYHA 4W1UA 4MTEA 4AWXB 2O7OA 3TO6A 3F8NA 2AHQA 4KT5C 3HRTA 4B1RA 2EIMH 1YX5A 1D1CA 4PJMA 1U5TC 4HEA2 1VQNI 4V19K 5DUIA 4J00A 3R60A 2GLOA 2TCTA 2Y30A 3QYBA 3SEQA 5EG0B 2G0EA 3ZOBA 2B9SA 4CCMA 3A4CA 4B3AA 2GXGA 3K0LA 2OJED 3OR1C 1SVOA 2QLZA 1SVMA 1T33A 4E7JA 4ZYGA 5IOZA 2WAFA 2Q0OA 3GTMJ 1WGXA 1IXRC 2RVCA 2KRFA 3MZHA 1K78B 1S7EA 4L5EA 5HNFA 4P9UA 1HSTA 1X58A 1S9HA 3LSGA 3LAJA 5D5WB 3JAMK 2KP6A 2BXZA 5C4JJ 3OMYA 5K1YA 1D1AA 2KLOA 2FNAA 4XLFA 3SFZA 1O7FA 4EJWA 1IAWA 3CMMA 2QA4I 5B3SH 2UWMA 5GAEJ 1V5EA 2OU2A 3HKZA 1JUPA 3OV8A 2EFWA 1LE8B 3HM5A 3M07A 1IF1A 1B59A 3F22A 4RGXA 2RC4A 3CCRI 2HOEA 4UB6C 5JHUA 2DU9A 3VDXA 2W85A 2A6HF 2MG4A 2PMUA 5GADJ 1W1WE 3PNTA 2MSYA 3RKYA 1VQ7I 5E3LA 5BMZA 2X1DA 3LAPA 1MH3A 5HNHA 1B8IA 2JPBA 5EJCA 3CCEI 1R22A 2VQLA 2DMQA 1B1BA 3N05A 2WC2A 4XBFA 3IV5A 1FYMA 3ZMZA 5CVJA 4UB8C 3DKYA 2QYOA 1PP7U 3OWTA 1XMKA 1O4XA 1J09A 4LIUA 2VPRA 3QPSA 2R7RA 4L5JA 4G12A 1ETOA 2VPLA 3COAC 2K3FA 4E7ZA 1MBGA 2K9NA 2V7FA 3R0AA 2VKEA 3EYIA 1TWGJ 2ZXIA 3PIOF 4XRFA 1ZQ3P 4ZTJA 2PJRB 3HUGB 2KL4A 4U7DA 1QBJA 3DBRB 3K6GA 4BJ6C 2MW8A 4A0YA 2A05A 3A03A 4II3A 2STWA 5M3FJ 3LSIA 2R3SA 1E3PA 1JKRC 4I0AA 2KZGA 1Z91A 1HLVA 3GLXA 2M34A 4HQMA 2VI6A 2KMUA 3UNGC 1KQ8A 2HR3A 2W1OA 3F8MA 1KGSA 1S8NA 3ZN1A 4MFEA 4O6JA 3WGHA 2IGMA 5J47A 2D1HA 2Z99A 3FBNB 3NAUA 1ZG1A 2LVSA 2ZJRF 4BKXA 3H3UA 2R7DA 3BCBA 2K27A 3FWEA 5E18F 4KIFA 1KU9A 2JPCA 3L1PA 2PLYA 1FTZA 2AXLA 3F72A 2FOWA 3ONQA 4LITA 3QYEA 3SFIA 2HU9A 1S72I 2XAGA 3JSPA 3IKTA 1FBUA 4ZYDA 1MNMC 4C2TA 1AKHB 4I7HA 3A2KA 1KZHA 3W2WA 4M72A 1ETVA 3HRSA 1R5HA 2H27A 2EFNA 4UV8A 4IHTA 2LK2A 1UELB 3SHFA 2FNPA 2KJCA 2V1XA 1SFEA 5HS9A 3E6MA 1KYZA 2KRHA 4EGZA 3BG6A 1WJDA 4A3IJ 3HDDA 4MEYF 3OYLA 1VQOI 1RR7A 5JVTA 1TQPA 2EIKH 3OYNA 2DMTA 2HDDA 3GLLA 1R58A 5B1BH 1K78A 4QTRA 2BEOA 4M3DA 2CQ7A 3ML6A 3AKZA 5FD5A 2JTVA 4CCKA 4G8XA 2GA2A 4XQFA 1BA5A 3I5UA 3GO5A 1SVLA 2ZNZA 4ETSA 5CVVA 4NQWA 1LE8A 5KHDA 4BEHA 1USTA 2KIFA 1WJBA 2HGCA 1YRNB 4HV5A 4RGUA 2FEZA 3CUOA 2QEXI 1YJWI 4JQFA 1GDTA 3FMRA 3DV8A 3LOCA 4UUTA 2NYXA 3KPHA 3OS0A 3KZYA 3RTRA 1V54H 3K1NA 1ZN2A 1OCCH 2D2WA 3I0TA 1TP4A 3C2GA 3FISA 4BQQA 4IO9F 3ULQB 1E3OC 3ZMTA 2LR8A 3DKXA 2W00A 2PMZA 1HW1A 3VSLA 1RESA 4ANJA 1K4SA 4I02A 2ECBA 2A07F 3FXMA 3JW4A 4KDPA 3CCMI 2WWYA 3JRIA 1UB9A 2TRTA 1R1VA 1OQYA 3V7CA 2ICWG 3L09A 1JKPC 1GVJA 2K7LA 2W48A 1X4OA 3HOUJ 2Y0SN 3MZYA 4LD5A 1R00A 1OR7C 5HS8A 2HKXA 3G71I 1EJ9A 2BZTA 3VWBA 1F4KA 1VQKI 4M9XA 3MWMA 3HHHA 5IT3A 3MAJA 1O3QA 5F0HA 2CO5A 4O5VA 4BBSJ 2EFPA 1FP2A 3CJNA 2DTRA 3OL3A 2O6GE 3F3XA 4BHCA 1Y39A 4E4HA 3K4JA 3V8JA 1G3YA 2HI3A 4PCQA 4S04A 4C3JJ 1LDKB 1SC7A 4BGDA 1W4MA 5EEAA 1FWZA 1I6HJ 1WVRA 2FMLA 2XKOA 4HF0A 3OIPA 1D8JA 1QHGA 2P6SA 3FMQA 3WU2C 2IS4A 3HIFA 3ECOA 5DM6F 2WY8Q 3CZ6A 1SMTA 1A35A 1HBXG 1B8IB 1P9QC 1XB4A 2J5OA 4G6TB 3W2VA 1YHQI 5LHIA 3S1MJ 2R5YB 2JK3A 3TL4X 4DZPA 5AIQA 3BTCA 4UVBA 5LGNA 3PUFA 4CICA 5GTIC 3OYIA 3RSNA 1D5VA 2VE9A 2MH9A 2PQ8A 3RYPA 4BQAA 2WB1N 3J7YJ 2KFDA 1YS7A 3OYCA 3LSPA 2K4JA 3RYRA 1X4PA 3TW7A 5D4SA 3J80K 1OLTA 3HC7A 1LKXA 3RKWA 2IRFG 4WXCA 5FROA 2VIXA 2YR2A 4XR6A 3G4SI 3HOWJ 3NARA 3I53A 1MDMA 1HF0A 1NK3P 4IHYA 2EINH 2VBWA 2OC6A 1MJAA 1J59A 2DPUA 3Q0UA 5KNLA 4IOAF 1KQ0A 1R9TJ 2MC4A 4DGWB 3WTVC 2FJ1A 4CO8A 2BVLA 2MABA 4HX7A 3S2WA 2PX9A 4ZYHA 2XIGA 3GFMA 2VLAA 3QP6A 2R7QA 4C2UA 2I10A 4DOZA 3G1OA 4BH9A 2DA3A 2WV0A 1W7PB 1Z3YA 3BDDA 3L7WA 4QSHA 1RNLA 5GPAA 3E97A 3CJTB 3ERMA 2FSWA 1QPIA 5A2QZ 3CCUI 3HRMA 5J8FA 4X6AJ 5IT9K 3O3KA 2HEOA 3H9QA 3CC4I 1FTTA 1Z67A 2M9HA 2MYSA 1W5TA 4RLFA 1JTYA 1SFKA 5FRMA 3IHUA 2QZ8A 2GBYA 5BS6A 4IOCF 1NTCA 3MCZA 4B47A 4Y13A 1LVAA 2ME0A 2KISA 2X6OA 1QVTA 4DYQA 2QSGX 2YX7A 2VODA 2DDBA 3U1DA 2MLGA 1ZRFA 3ZRGA 4ZH4F 2JRTA 3ABLH 5EYRA 2M2EA 5IP9J 1W0UA 1DP3A 5JLXA 5H2FC 5K5RA 5F64A 2KKOA 1B6AA 2DFEA 4L9JA 4HBLA 1G3SA 1APLC 1FT9A 5E17F 1P7IA 1UG2A 1SD6A 2K02A 3FXRA 2JSCA 4EM1A 4KT6A 2BVMA 5LRRA 1IN7A 2L7ZA 2KDOA 3HZJA 4PUSA 1N77A 2LBFA 1MMDA 1JKQC 1DUXC 3J7AO 4OWRB 2CQQA 2BV6A 4V2FA 3I55I 1R49A 1C0WA 3PFIA 3DKWA 2YSRA 3VOEA 4B43A 2O03A 3HPGA 4CH7A 3CMYA 3VPRA 2FBHA 2XGEA 1HA8A 4DBRA 4KA4A 4ENMA 2EV5A 2YUSA 1QNTA 5TGTA 3OYDA 1XGOA 4YG2F 1FSHA 4G7OF 2VOPA 1FMWA 1KYWA 4GYIA 3G6EI 2PN6A 4QPOA 4ZZLA 1WJEA 3CP8A 4BJ5C 2HZTA 5D6FA 1A6QA 4F91B 2E1MB 3T5XA 5FKMA 2K3PA 1SFUA 4A3EJ 1BI3A 4BQNA 5C3EJ 1EV7A 2D45A 2JA7J 1SEUA 4HLYA 2D5VA 1WWXA 3TGNA 1T8IA 4CYCB 3IP4B 5L3CA 3H5NA 3PQKA 5BPIA 3KP2A 1W5CC 4GFBA 2XAHA 5E1WA 5HODA 4V2GA 1TWAJ 4JOMA 2FD5A 2NXNB 2ZMEC 3I56I 3HOVJ 2R7WA 4L18B 1GLNA 4WK8F 2L9VA 4GO1A 1GVDA 3KIOA 3BG7A 2L2OA 2LDUA 1MBEA 2IS6A 2BE5F 3QU6A 3GBGA 3GXOA 4BAYA 3BZKA 2RQQA 3I4NJ 1DGRM 1TNSA 2IXSA 3A0BC 1OPCA 3CLQA 2P8TA 4XL9A 1YJ9I 5HLTA 4XLEA 4C30A 4HLXA 4BHBA 4C9YA 2EZLA 2M4KA 3FXOA 2DA4A 4I99C 4LG3A 3P9KA 4YRVA 2Z33A 2Z9OA 1IUYA 1HKTA 3MN2A 1BW5A 3KEYA 2NVQJ 1GT0C 1ZAOA 4A3DJ 2CRGA 3DTEA 3C2BA 2FOKA 5IYDJ 1E0EA 1BI1A 2XKPA 3LQQA 1DGWY 1QPMA 2DJNA 2V9PA 2WAEA 4B48A 3V8KA 3FXQA 1VQ4I 1TLHB 1IG7A 1WH7A 3M3YJ 1FOXA 1REPC 1HC8A 2KHMA 5CLSA 3IWZA 5FKLA 4OIRF 2QF7A 1RZ4A 5K7FA 3TEDA 4LK0F 3ZQLA 4BE2A 2HTSA 4I09A 2DI3A 3CF2A 3VEPA 1UHMA 2Y9YA 4OU0A 2CU7A 3TOAA 4DW6A 3OYBA 1H0MA 3QPHA 3LSMA 4A0XA 2F4MB 1DPRA 4MFDA 1EH8A 3EQLF 2DYSH 1YI2I 2HVRA 1Y6IA 3BJAA 1LDDA 3QODA 3IUOA 1R36A 5HLGA 5FLMJ 1Y1VJ 2R5YA 4I98B 2UXNA 4IPAA 2B63J 1ZELA 3OYEA 5E3OA 3DEUA 2JMWA 3QRFF 1O3SA 1MZBA 4JP0A 2JQ7A 3CC7I 3IRRA 2LF8A 1ZRDA 1PP8F 1FOKA 4WF2A 2IT0A 2QBYB 1YO5C 1VNDA 3F21A 2DJIA 3L00A 3J7AY 3E0JB 3CO7C 4P5OA 2ESNA 1MGTA 5CVUA 4M73A 3JRBA 4G7HF 3KZZA 2MLKA 3JAMZ 1J75A 1JGGA 2DA6A 2X4HA 3JRAA 2LKSA 4RM2A 5ICEA 1XTAA 3G1LA 1IRZA 2P7VB 4LMYA 1LPQA 2Y2ZA 4Y15A 1IXCA 5TRDA 1EA3A 4FHTA 4AC0A 3HOXJ 4BE0A 2H8RA 3S1QJ 3CQZJ 1HW5A 2QQBA 2P5KA 1VI0A 3JR9A 1HDDC 3K69A 1GXQA 2ZSHB 3GZ5A 3LSKA 4MNUA 5E3NA 1FX7A 2P0WA 1Y1WJ 4UUSA 1WJ5A 2L7FP 3V7RA 3I58A 2W7NA 3MKLA 3TDUC 3WTYC 5J1UA 1BR4A 4KITB 5HDKA 1MKMA 3LFKA 2LTPA 3OOUA 4AIHA 3MFKA 2VC0A 1W36D 2ZJ2A 1JUMA 4XKWA 3I59B 3ISPA 1U5TA 2HKOA 3C7JA 3V4GA 2E1CA 2DK5A 3KE2A 2MGQA 4E7HA 1WSUA 1MMAA 3F23A 2NOJB 4LLGF 1ZARA 3UKGA 1WPKA 4F52A 2V79A 3KLNA 4E7SA 3QPTA 4HG2A 1JHHA 1N25A 5FLXZ 2VJ5A 3WU1B 5B1AH 1I5ZA 5K5OA 4RS8A 3HKZN 2IVMA 3H35A 2XGCA 1G59A 1O7LA 4M3EA 5E8IA 1UMQA 2EFOA 1BOBA 3IH4A 3BY6A 2CH0A 3R61A 1NG7A 3Q0VA 3OSGA 3ELKA 5L3BA 4P1WA 3FXKA 3DU6A 3K4CA 2E1NA 4UV9A 2CW0F 3DPLC 5FJ8J 2EH3A 2QGUA 4EJOA 1JGSA 1FSEA 1XSDA 4A12A 4NHJA 3QQAA 4CA0A 2W82A 1ZTRA 3U9GA 4MHGA 2XF6A 1S5LC 1Y0NA 3TO9A 2Y9ZA 4OMZA 3WTWC 2R7UA 1M1EB 1IDYA 3QAHA 1D0XA 4HSRA 3WTUC 3L2VA 2ZC2A 4G7ZF 1J9IA 1D3YA 1G3WA 1U6GA 1Z05A 2Q8KA 3DEWA 1FYKA 2RV8A 1H89C 2K40A 3RJPA 4F7ZA 1DQUA 2NNNA 2COMA 2XHKA 4KYWA 2M3AA 2JUCA 3MQ0A 2LLKA 4UVAA 4O3MA 3PO3J 3K2ZA 1IRFA 1ERDA 3S93A 2RNGA 4MLOA 1RRJA 3HSRA 1I39A 2DT7B 2GM4A 1IN5A 2HYGD 3CTAA 1OKRA 5HDNA 2F5DA 3K4MA 2M7AA 1QO0D 3M7GA 4EGYA 4CZZA 2HVSA 2CMPA 2A6EF 2EJRA 2BGCA 3BR5A 4A3JJ 1QHHD 5CVRA 1WKMA 3D5RC 2A61A 4HA8A 1JUSA 3E1SA 4CHUA 3K70C 4A2UA 4ABZA 1G8XA 4KMFA 2XDVA 3VYSB 1R5ID 1D0YA 3T1BA 3K7AJ 1IRGA 5TISC 1DP7P 3ERED 4BNCA 2K85A 1JKOC 1MJ9A 1T95A 1WJFA 5AONA 1XPXA 5FGMA 5J4YA 1YE9A 4NQWB 1X1AA 5LFAA 5CVIA 2MC3A 4CZCA 2VKDA 1QA6A 4MGRA 2GOXB 2XPWA 2DDAA 5FD6A 3ZMUA 3G73A 1FBSA 3TKYA 2ZB9A 5EZGA 2AO9A 3ZQFA 3B02A 2VJ4A 2FXAA 1K83J 2BYVE 4AVPA 3W6JB 2GZWA 1BN5A 3I4PA 1YS6A 3AG1H 5FFXA 4HF1A 5IP6A 1XX5A 1ETYA 2Q1ZB 2COBA 2HDWA 4UUSB 3WTTC 2PG4A 2J5PA 4AIJA 2MD5A 4M9SA 1B72B 2E2IJ 1R1TA 3M1EA 3GFLA 4IVNA 4B09A 3OOPA 3AFHA 4M3BA 2EB7A 4BXFA 2E7XA 2H1KA 2M8GX 5FKOA 2M0CA 4PFOA 3M1CA 1XC5A 1YX3A 3BC8A 1BW6A 2ECCA 2LKXA 3TP0A 2K5CA 4MQVA 2GAUA 2IGOA 4A3CJ 1U9OA 1RPWA 1VF9A 2W84A 1XS9A 4X0GA 4I76A 2R0QC 3JRGA 4LB5A 2O0YA 1NH3A 2BHZA 4ZC3A 4Y33A 1E2XA 4D5CA 4LLNA 3GZNB 2L02A 1V5FA 4XRMA 1OYWA 3I9V2 4HX8A 4NB5A 3ZXSA 2ELHA 3REOA 1WHUA 2F2EA 1D8KA 4IHXA 3E6DA 2ZJQF 1FEXA 5DS9A 2L9SA 1HOMA 3LSTA 3U21A 2FUG2 3V7SA 5IYCJ 4E7KA 5E1ZB 4LFUA 5BNGA 3LMMA 4WCGA 1GHCA 4EJVA 5LGUA 4BY7J 2DPDA 5DUKA 1BR1A 1H9GA 2IAIA 1BIBA 2QSFX 2PI0A 4D5FA 2VASA 2E1MC 1Y56A 3GMEA 2JA2A 4U87A 3HB9A 1W36C 4WXHA 4BJTA 3TP3A 4QIWN 4HDVA 5D8KB 1FPQA 3BPVA 2CV1A 1SD4A 2CUZA 3BR0A 4HAMA 3MVPA 2F5FA 1VTNC 1ZGJA 3LSRA 1S7AA 4PGGA 4U88A 3VB2A 2XAJA 3PM1A 4BXXJ 4RMNA 5HLHA 3FK6A 2QUFA 3H5RA 1LFPA 4TV7A 5DD4A 1WH5A 2OF7A 3M8JA 3TW6A 5BPDA 2KJBA 1MDMB 4F92B 4ZYAA 3K9TA 3ABUA 1RKWA 1K61A 1CGPA 3J80Z 1D1BA 3RQIA 3BOQA 3TQNA 2KPMA 1UFMA 3J81Z 3Q0WA 2L4MA 4IF4A 5LRSA 4BE1A 5ED4A 1MMSA 4D7NA 4B44A 1XCBA 2VN2A 5D5VB 1YLFA 2LREA 2KZVA 2LYCA 2E5NA 2BXYA 3C2HA 5EZHA 1S3JA 2ZCWA 1X3UA 3R6SA 3LA2A 1I27A 3I3LA 2D1VA 3CP2A 1QU3A 2X9DA 3H9JA 3U1KA 1ULYA 3M4OJ 3EUAA 1WI9A 1ODDA 2Z3YA 1Z1DA 3KEQA 2HFHA 4RAZA 3JRCA 2DW4A 2DBBA 2DT6A 3DPUA 1U78A 3OS2A 3H36A 2GOMA 1QRYA 1SAUA 3CUQA 2A6TA 3C1DA 3Q9VA 1OJLA 4LG0B 3D5LA 1XGSA 3NWTA 4FCYA 2B7EA 4UNOA 3VYUB 1V4RA 1WFXA 4HNTA 1QVUA 2Q2EA 2QCOA 1WZ2A 4A3FJ 3DBHB 1IW7F 1QZEA 3SQNA 1MBKA 1A04A 5IY5H 1YFHA 4XSZF 1ZRCA 3E5UA 2VQCA 3CJRB 3DP7A 3JSOA 1XD7A 2L9NA 1OR7A 2OA4A 5H20A 2RN7A 3BG3A 1GV2A 1TWHJ 2LFBA 2M7BA 1DU0A 2HYFA 2RNJA 2L54A 3K4NA 2OUMA 4UHTA 3KEOA 2XAUA 4EQQA 3L2RA 1ZREA 3H3ZA 2XSJC 1UCRA 2IS1A 4Q47A 4RM3A 5J40A 2OCEA 4DYCA 3HJEA 2W57A 4M3FA 1ON2A 2V1DA 5ERIA 3Q5FA 2NVUB 4YELA 1RUOA 3GFJA 2LP0A 5FKNA 2VJJA 4N9IA 3VFZA 3CCJI 1IV6A 2PEXA 1Y8QB 1ACIA 1MNDA 1KQ9A 2O3FA 1U9NA 3A0HC 3HXLA 2DT5A 1BIAA 3TDZC 3IRQA 3CD6I 3CCSI 1BI2A 1ZR4A 2MH2A 5CJ9A 3RPUA 3DXJF 3TBIA 3PQJA 1XSVA 1LFUP 4IHWA 2HNHA 2LY9A 1IUFA 4ZJZA 3AG3H 4XICA 4RGSA 3HOTA 4LB6B 2XUBA 1FIPA 3TMOA 1R71A 3OYKA 3P9IA 1TBXA 3KYCB 4HPQA 5HS7A 4E6KG 4KFCA 2LD5A 4RB3C 4IKFA 1EH7A 3DEEA 2V4JC 5GPCA 3BG5A 2W24A 5J6XA 2Z16A 2OTLI 4UUVA 2DTZA 4N4OB 4A0ZA 4OIQF 1R7JA 5DD8A 2VQGA 3EUHC 2KIMA 2YPRA 2V9KA 2HQ5A 1X1CA 4LK1F 1RR8C 3FKJA 1T6SA 3RPUD 3VSKA 2IGNA 1HQCA 4ZZDA 2GA1A 3KLOA 3VODA 4NC8A 2VJIA 1OCRH 1TZLA 4RA2A 1IC8A 2JSPA 1V55H 5EG0A 2EILH 1AOYA 4BYYA 3MEXA 1AWCA 3QP5A 2VB6A 2ELKA 1P7JA 2LF7A 2DOAA 3E7LA 3CUQC 4NNJA 3RIRA 4XM3A 2HDCA 3W2AA 3AL0C 1T2KA 3WGIA 4HRIA 1HKQA 2OBPA 3ABMH 5LHHA 1TNTA 2E1OA 4IEJA 4KJZA 1LVKA 3PL8A 4IJAA 2HPMA 1VQ9I 2NRAC 3KP5A 2P81A 3KYDB 4A6EA 1K6YA 2X6XA 1I50J 1IDZA 1JT0A 4P9FA 1K79A 5HLIA 1W7PD 3E6BA 3M8EA 2QM3A 4ZYEA 4L0YB 1ETWA 3ABTA 4KNYA 1U0JA 2IA0A 3OYFA 2L7MP 1PYVA 2UZKA 3OIOA 4M6XA 4XLNF 1VZ0A 4M71A 2IBDA 2NS7A 3C3WA 2E36A 2R7VA 2A3SA 4FE7A 2F4IA 2GXAA 1UHWA 4JX4A 4CCOA 3PJRA 1BBYA 2OV7A 2VQHA 3DLAA 1K6OA 2ISZA 4CCJA 1MJBA 5ILVA 3GEZA 2EWNA 4Y3OA 1EF4A 2X0LA 3VYRB 3BPXA 3LWFA 2V6CA 1BOAA 4IHVA 5LGTA 3HPHA 5FO5A 2FF4A 4DNCA 1BC8C 2I5UA 1LFBA 4IRGA 4IL6C 3CMEI 4CYCA 2LMDA 2RAEA 5CQEA 1BJZA 1H8AC 4P96A 4JK1X 1OCTC 2O9LA 1T0FA 2JWTA 2UXXA 3IH3A 2M87A 4D0PA 3GTJJ 4L9VA 1YG2A 2LC2A 3DF8A 4C3HJ 2ADUA 1I3AA 1FMVA 3LFUA 1T0FC 2M8EA 3QOPA 4A5MA 4ON0A 3AL0B 3GTQJ 3MZ8A 3OSFA 2X51A 3E5QA 3FF5A 4KN7X 3ROUA 4Z6YA 2NVTJ 2ZXJA 3MKZA 2UV1A 1ZG5A 4PJLA 1ZKGA 2CFOA 2DCEA 3OYMA 3HSFA 2F48A 4KIGA 4AVZA 5LD2C 1RUNA 4UY8I 4OIPF 4Y52J 1DU6A 2F4OB 3HRUA 4BHPA 2WTEA 4XLPF 2F5CA 3HBLA 2EPFA 2JVHA 1T56A 4BBRJ 5D8LB 4RLQA 3HL2A 4A3KJ 2FRHA 2Q2EB 4PDKA 2GWRA 2RGVA 2P5LC 1SD7A 2HQRA 1J7KA 4R1HA 2W4SA 2E7WA 3OS1A 1WQ2A 4GDFA 4F55A 2ME6A 2Z1DA 3DPTA 3F8BA 1BI0A 2NNYA 2JA5J 3EDPA 4ESFA 4AUXA 3LNQA 4LG0A 2LG4A 3NRVA 5K5QA 3OIQA 5EEGA 1XGNA 1T38A 1AKHA 4FT8A 4X1EA 4YFNF 1YW7A 4MIMA 1BL0A 4MEXF 1CQTA 4A3GJ 2RREA 5LEKA 2NS8A 2PFBA 1VFCA 1LDJA 4XRSG 5F04A 1J5YA 2DODA 3JRDA 1Z7UA 1XMAA 3FXJA 4I2OA 1XG1A 1A31A 4YFKF 4G6DA 1JT6A 3WODF 3FX3A 4ZTFA 2OZUA 1G2HA 3F8FA 1Y8RB 3S14J 4KISA 4A93J 1U8RA 2FE3A 3B6AA 5CPRB 3ZP5A 3LA7A 4HDUA 1X2NA 2DMUA 2VC1A 1PUFB 2E2HJ 3ZQGA 4AU7A 1P6RA 4M9ZA 1EH6A 3BTJA 4HNUA 3X2QH 3S2HJ 5GTHC 2RKHA 3BR6A 1MMGA 2CFXA 1R23A 2K9QA 2BY2A 3S2DJ 1YRNA 4D7MA 4DQ2A 3BQYA 1MW7A 3BJOA 3OR2C 2XAQA
chains in the Genus database with same CATH topology
2P4WA 1BM9A 3DFGA 5ICFA 5DCFA 2A69F 2O8XA 4RAYA 2A68F 2FQ3A 5LHGA 2LSOA 4E70A 3FHZA 1H9TA 2DQLA 3CLOA 3BWGA 3SZTA 3I59A 3NQOA 1IXSB 1LEBA 4L0ZB 2CWEA 5KVRA 1U5TB 2FMYA 2OAZA 4M6YA 2FBKA 1YW9A 1T98A 4HW0A 2HQNA 2O61A 4OOIA 1IN6A 3IWFA 1YW8A 5HDGA 2KIUA 4OIOF 3N4MA 4YIFA 5DEQA 1FY7A 3WE2A 2VXZA 1ZLJA 1S6LA 3GVAA 2PMHA 1RI7A 1XN7A 3T0YA 2PBIA 1P4WA 5D5XB 2H6BA 1OYIA 2M1BA 5DV5A 1IZ1A 2XRNA 5E8GA 4RGRA 3H92A 2ISYA 1QZZA 4EM2A 1S7OA 2BBYA 2ESHA 2Y0MA 3RDIA 1Z6TA 5L3FA 4N9HA 2XV4S 2G9WA 3WGGA 2DQRA 1BC7C 5FLXK 3ZMSA 2FA5A 2MA3A 2DK8A 4U7BA 4A6DA 3WTXC 4MTDA 1YYVA 3LA3A 1ZH5A 2LNBA 4HQEA 4WWCA 4B8XA 1PUEE 2V1UA 5JFRA 1F1ZA 1B4AA 6PAXA 1Z9CA 2L01A 4PZJA 2CG4A 4HX4A 1ZYRF 3P7NA 4P55A 1J0RA 1KU7A 3GX4X 4HV6A 1JXSA 5D5UB 4M74A 3LQRA 1FNNA 1XGMA 1V3FA 4L5IA 4YFXF 5FFZA 4IRIA 1HSJA 4ESBA 5LEJA 2VBXA 1ZG3A 2QENA 4GGGA 4Q4ZF 4GXOA 3M9AA 3QU3A 2EFQA 2H94A 5TJJA 3FM3A 2YU3A 1JE8A 2F5EA 3FM5A 4U0VA 2IPQX 1LB2A 3SZPA 4YIIA 3ZMDA 4ENNA 3GF2A 3D0SA 4KIBA 5ILSA 2M30A 5JR3A 1FYLA 1NHAA 3FXUA 2JT1A 3RPQA 4EM0B 2ZO4A 1F9NA 3HTUA 3F6OA 2MBFA 3L9FA 2L4AA 2GIVA 2IJLA 5J8CA 4CYDA 1J2XA 4ENKA 1JHFA 1TW3A 2P5VA 4WX9A 5F1RA 5LLQA 1GXPA 2IA2A 1W5SA 2M5WA 4R79A 1SFXA 1TW2A 3T8TA 3KP7A 1WRJA 3WG9A 2QVOA 1FLIA 1YIOA 4EJTA 4G6QA 4CDGA 1QQIA 3HYIA 3WTZA 2P7CB 2AS5F 2CQKA 1ONVA 2VT3A 1B9NA 2ETHA 1S29A 3WU0A 3CO6C 3AAFA 5FB2A 2LKPA 2DO7A 2VBYA 4Q5SF 3WE3A 3CUQB 3W6KB 1O3RA 3TOBA 5ICCA 3KP6A 1L3LA 5HOOA 2HWVA 3T8RA 4EMSA 2EK5A 3DQVC 3J81K 3GWZA 3R0JA 4CGZA 2ZNYA 4JBAA 4QLCU 5DCMB 1DDNA 4AIKA 2R7FA 1XDSA 1T39A 3NEUA 2XVCA 2XASA 4LLLA 2OD5A 2B0LA 2OZ6A 1BJAA 3GW2A 3F8CA 3KP3A 4Z2YA 2IA1A 1I1SA 1QGPA 1U2WA 1TQIA 4HYEA 5L3DA 4EVIA 2PJPA 2ZKZA 1ON1A 2VBZA 2ZMEA 2G7UA 3FMSA 4OMYA 3BZ6A 3R4KA 1SMYF 1R1UA 3EUHA 2W25A 3ECHA 3KCCA 1LQ1A 3P9CA 4FX0A 2K86A 2VE8A 1K7AA 1PDNC 5D4RA 2VOOA 3N97A 4G9YA 4HF2A 4KMUX 1MD0A 3JTHA 4G94A 5AIPA 1I1GA 2EA2A 3GUDA 2QQ9A 1YQAA 2VT2A 3B73A 1I6XA 2XAFA 1G3TA 4RB2C 4H0EA 4U0YA 5L3EA 4A5NA 4I01A 2IW5A 2ZFWA 4ENJA 1FC3A 4KUMA 4S05A 4AD9A 5DYMA 3KETA 3TO7A 4EJUA 4RB0A 3V8LA 1SAXA 1TTYA 1L0OC 4CXFA 4LJZF 3EYYA 2IP2A 2HS5A 2XGXA 1P4XA 5H6RA 4PGHA 4KICA 1P2FA 3HTSB 3M8FA 2EV0A 1KA8A 3E6CC 2CYYA 4FX4A 5JI6A 3I71A 5ILUA 4R8HA 2RDPA 1OMIA 1W7PA 3HSEA 5E20A 5EEHA 4RB1A 4GYGA 3K1PA 2DAOA 3GZ6A 5F6FA 3HOSA 1IN4A 4ESJA 1DPUA 3ZN0A 5E1XA 4ASNA 5LBQA 1B9MA 1O57A 4OINF 2OQRA 2QQAA 4Y17A 2STTA 1HW2A 1LJ9A 3BROA 1P4AA 2CGPA 2Z5UA 4HOBA 2YX4A 2K4BA 1FZPB 1OYYA 1IN8A 1SD5A 4EV0A 2ZBKA 4XSXF 3WTSC 2EA4A 4I0BA 1QZYA 2DLLA 3O2PE 1G6NA 1G4DA 5L3GA 1LEAA 2H6CA 5DCMA 2H09A 1FP1D 5BOXA 3BP8A 2G7HA 2FBIA 1XSXA 1E17A 1R5GA 3IL2A 3CDHA 2CSOA 5A2QK 4IRHA 4UVCA 4K2EA 5IT9Z 2XROA 2C6YA 3E5XA 2ACJA 1CF7B 2GQQA 3Q9SA 3EETA 4N0BA 3GFIA 4Q48A 2DFIA 1U3EM 1STZA 1ZHFA 2ZMEB 2Y48A 3KP4A 1FBQA 3RKXA 2EV6A 3C18A 5HVQC 4HZFA 1Y0UA 1KU2A 2VONA 2NAZA 4IHSA 2JZYA 3HUGA 4GCVA 3I54A 2L3DA 5DDGA 3ZMVA 3E3VA 3GYHX 3K1MA 5BQTA 1O3TA 4L9NA 4L9TA 3IKVA 3SXYA 4MQ9F 2OQGA 1P92A 3ZQ7A 3G3ZA 2A5YB 4WXDA 5KK1A 3BJ6A 3O6BB 4UXNA 2QBYA 1XDUA 3IC7A 1RIOH 1KU3A 1HXDA 1LNWA 2P6TA 2M45A 1F5TA 2NS0A 2RQPA 2TDXA 4QWQA 1XCVA 1YTYA 3U2RA 5CYVA 3I64A 2GXBA 1Q1HA 3RI4A 5D6EA 2HTJA 3HHGA 2Y75A 4IXAA 3JTGA 3ZPLA 1HKSA 1Z6RA 1TQMA 4U0WA 4LGWA 2FU4A 1USSA 1CF7A 3FZVA 4BXUA 4KN4X 3KFWX 2QWWA 2V9VA 5H6QA 3F6VA 5ICGA 1ZGAA 3L2CA 4MTEA 4AWXB 3TO6A 3F8NA 4KT5C 3HRTA 1U5TC 5DUIA 3R60A 2GXGA 3K0LA 2QLZA 4ZYGA 2Q0OA 1IXRC 2RVCA 2KRFA 3MZHA 1K78B 4P9UA 1HSTA 3LAJA 5D5WB 3JAMK 5K1YA 1IAWA 2FNAA 4EJWA 3SFZA 1O7FA 2UWMA 2OU2A 3OV8A 2EFWA 1IF1A 1B59A 3F22A 4RGXA 2RC4A 2HOEA 5JHUA 2DU9A 2W85A 2A6HF 2PMUA 3RKYA 5BMZA 3LAPA 2JPBA 1R22A 1B1BA 2WC2A 4XBFA 1FYMA 3ZMZA 5CVJA 2QYOA 1PP7U 1XMKA 4L5JA 3COAC 3R0AA 3EYIA 4XRFA 4U7DA 1QBJA 4A0YA 2STWA 2R3SA 4I0AA 1Z91A 3GLXA 4HQMA 1KQ8A 2HR3A 3F8MA 1KGSA 1S8NA 3ZN1A 4O6JA 3WGHA 2D1HA 2Z99A 1ZG1A 3H3UA 2R7DA 2K27A 3FWEA 5E18F 4KIFA 1KU9A 2JPCA 2PLYA 2AXLA 3F72A 2XAGA 3JSPA 3IKTA 1FBUA 4ZYDA 4I7HA 4M72A 2H27A 3HRSA 1R5HA 2EFNA 4UV8A 4IHTA 3SHFA 2FNPA 2KJCA 2V1XA 1SFEA 5HS9A 3E6MA 1KYZA 4EGZA 4MEYF 5JVTA 1TQPA 1R58A 1K78A 2BEOA 3ML6A 5FD5A 2JTVA 4G8XA 2GA2A 3I5UA 3GO5A 2ZNZA 4ETSA 5CVVA 4NQWA 1USTA 2KIFA 2HGCA 4HV5A 4RGUA 2FEZA 3CUOA 4JQFA 3FMRA 3DV8A 2NYXA 3KZYA 3RTRA 3K1NA 1ZN2A 2D2WA 3I0TA 3ULQB 3ZMTA 1HW1A 4I02A 2A07F 3JW4A 4KDPA 2WWYA 1UB9A 1R1VA 3V7CA 3L09A 1GVJA 2K7LA 3MZYA 4LD5A 1R00A 5HS8A 2HKXA 1F4KA 4M9XA 3MWMA 3HHHA 5IT3A 3MAJA 1O3QA 2CO5A 4O5VA 2EFPA 1FP2A 3CJNA 2DTRA 2O6GE 3F3XA 4BHCA 3V8JA 1G3YA 4PCQA 4S04A 1LDKB 1W4MA 1FWZA 2FMLA 2XKOA 4HF0A 1D8JA 2P6SA 3FMQA 3HIFA 3ECOA 1SMTA 1HBXG 1XB4A 2J5OA 5LHIA 5LGNA 5AIQA 4UVBA 4CICA 1D5VA 2VE9A 2MH9A 2PQ8A 3RYPA 4BQAA 1YS7A 2K4JA 3RYRA 5D4SA 3J80K 3RKWA 2IRFG 4WXCA 2YR2A 3I53A 1MDMA 2VBWA 1MJAA 1J59A 2DPUA 1KQ0A 3WTVC 4CO8A 4HX7A 3S2WA 4ZYHA 2XIGA 3GFMA 3QP6A 4BH9A 2WV0A 1ZLKA 1W7PB 3BDDA 3L7WA 1RNLA 3E97A 2FSWA 5A2QZ 3HRMA 5J8FA 5IT9K 3O3KA 2HEOA 1W5TA 3IHUA 2QZ8A 5BS6A 3MCZA 4Y13A 1LVAA 2YX7A 2VODA 3U1DA 2MLGA 1ZRFA 4ZH4F 2JRTA 5K5RA 5F64A 2KKOA 1B6AA 4L9JA 4HBLA 1G3SA 1FT9A 5E17F 1SD6A 2K02A 3FXRA 2JSCA 4EM1A 5LRRA 1IN7A 1DUXC 3J7AO 2BV6A 1C0WA 3PFIA 3DKWA 2YSRA 3VOEA 2O03A 2FBHA 4KA4A 4ENMA 2EV5A 1QNTA 1XGOA 4YG2F 1FSHA 4G7OF 2VOPA 1KYWA 4GYIA 2PN6A 4ZZLA 2HZTA 5D6FA 3T5XA 1SFUA 1BI3A 1EV7A 2D45A 4HLYA 1WWXA 3TGNA 5L3CA 3PQKA 5BPIA 3KP2A 2XAHA 5E1WA 4L18B 4WK8F 4GO1A 2LDUA 2BE5F 3QU6A 4BAYA 3GXOA 1TNSA 1OPCA 2P8TA 4HLXA 4BHBA 2Z9OA 3P9KA 2Z33A 1IUYA 1HKTA 1ZAOA 2FOKA 1BI1A 2XKPA 3LQQA 1QPMA 3V8KA 3FXQA 1TLHB 1REPC 5CLSA 3IWZA 4OIRF 1RZ4A 4LK0F 2HTSA 4I09A 2DI3A 3VEPA 1UHMA 4OU0A 3TOAA 1H0MA 3QPHA 4A0XA 1DPRA 1EH8A 3EQLF 3BJAA 1LDDA 1R36A 5HLGA 4I98B 2UXNA 4IPAA 3DEUA 3QRFF 1O3SA 1MZBA 3IRRA 2LF8A 1ZRDA 1PP8F 1FOKA 4WF2A 2IT0A 2QBYB 1YO5C 3F21A 3L00A 3CO7C 4P5OA 2ESNA 1MGTA 5CVUA 4M73A 4G7HF 3KZZA 2MLKA 3JAMZ 1J75A 2X4HA 5ICEA 2P7VB 4LMYA 4Y15A 1IXCA 5TRDA 4FHTA 1HW5A 2QQBA 2P5KA 3K69A 1GXQA 3GZ5A 4MNUA 1FX7A 3V7RA 3I58A 3TDUC 3WTYC 5HDKA 1MKMA 3LFKA 4AIHA 3MFKA 2VC0A 2ZJ2A 3I59B 3ISPA 1U5TA 2E1CA 2HKOA 3C7JA 3V4GA 2DK5A 3KE2A 1WSUA 3F23A 4LLGF 1ZARA 2V79A 3KLNA 3QPTA 1JHHA 5FLXZ 3WU1B 1I5ZA 5K5OA 4RS8A 2IVMA 1O7LA 5E8IA 2EFOA 3BY6A 3R61A 3ELKA 5L3BA 2E1NA 4UV9A 2CW0F 3DPLC 4EJOA 1JGSA 1FSEA 1XSDA 4A12A 4NHJA 3U9GA 4MHGA 3TO9A 4OMZA 3WTWC 3QAHA 3WTUC 4G7ZF 1J9IA 1D3YA 1Z05A 1G3WA 1U6GA 2Q8KA 1FYKA 2RV8A 3RJPA 4F7ZA 2NNNA 2COMA 2XHKA 4KYWA 3MQ0A 4UVAA 4O3MA 3K2ZA 1IRFA 3HSRA 1IN5A 2HYGD 3CTAA 1OKRA 5HDNA 2F5DA 4EGYA 1QO0D 3M7GA 4CZZA 2A6EF 2EJRA 2BGCA 5CVRA 1WKMA 4HA8A 2A61A 4CHUA 4A2UA 4KMFA 3T1BA 1IRGA 1DP7P 3ERED 4BNCA 1MJ9A 5AONA 5FGMA 5CVIA 2MC3A 4MGRA 5FD6A 3ZMUA 3G73A 1FBSA 3TKYA 3B02A 2FXAA 4AVPA 2BYVE 3W6JB 2GZWA 1BN5A 5FFXA 1YS6A 3I4PA 4HF1A 3WTTC 2PG4A 2J5PA 4AIJA 2MD5A 4M9SA 1R1TA 3M1EA 3GFLA 4IVNA 4B09A 3OOPA 2EB7A 2E7XA 4MQVA 2GAUA 2W84A 4LB5A 2O0YA 1E2XA 4LLNA 2L02A 1OYWA 4HX8A 4NB5A 2ELHA 3REOA 2F2EA 1D8KA 3E6DA 3LSTA 3V7SA 5E1ZB 4LFUA 4WCGA 1GHCA 4EJVA 5LGUA 2DPDA 5DUKA 2PI0A 1H9GA 1BIBA 4WXHA 4HDVA 5D8KB 1FPQA 3BPVA 1SD4A 4HAMA 2F5FA 1VTNC 1ZGJA 1S7AA 4PGGA 4U88A 3VB2A 2XAJA 5HLHA 2QUFA 4TV7A 5DD4A 1MDMB 5BPDA 2KJBA 3K9TA 3ABUA 1CGPA 3J80Z 3BOQA 3TQNA 1UFMA 3J81Z 2L4MA 4IF4A 5LRSA 5ED4A 1XCBA 2VN2A 5D5VB 1YLFA 1S3JA 2ZCWA 1X3UA 3R6SA 3LA2A 1I27A 2D1VA 1ULYA 1WI9A 1ODDA 2Z3YA 1Z1DA 3KEQA 2HFHA 4RAZA 2DW4A 2DBBA 1U78A 3CUQA 3C1DA 3Q9VA 4LG0B 3D5LA 1XGSA 4UNOA 1V4RA 2Q2EA 1IW7F 3SQNA 1YFHA 1A04A 4XSZF 1ZRCA 3E5UA 3DP7A 3JSOA 1XD7A 1OR7A 2OA4A 5H20A 2RN7A 2HYFA 2RNJA 2L54A 4UHTA 3KEOA 4EQQA 1ZREA 3H3ZA 1UCRA 4Q47A 2W57A 1ON2A 2V1DA 5ERIA 3Q5FA 1RUOA 3GFJA 4N9IA 3VFZA 2PEXA 1KQ9A 2O3FA 2DT5A 1BIAA 3TDZC 3IRQA 1BI2A 2MH2A 5CJ9A 3RPUA 3DXJF 3PQJA 1XSVA 4RGSA 3HOTA 4LB6B 2XUBA 3P9IA 1TBXA 5HS7A 4KFCA 4RB3C 1EH7A 2W24A 5J6XA 4UUVA 4A0ZA 4OIQF 1R7JA 5DD8A 2KIMA 2YPRA 4LK1F 1T6SA 1HQCA 4ZZDA 2GA1A 3KLOA 3VODA 1AOYA 4BYYA 3MEXA 1AWCA 3QP5A 2LF7A 3CUQC 3RIRA 2HDCA 1T2KA 3WGIA 1HKQA 2OBPA 5LHHA 1TNTA 4IJAA 2NRAC 3KP5A 4A6EA 4P9FA 1K79A 5HLIA 1W7PD 3E6BA 3M8EA 2QM3A 4ZYEA 4L0YB 3ABTA 4KNYA 2IA0A 2UZKA 4M6XA 4XLNF 4M71A 3C3WA 2A3SA 1UHWA 1BBYA 1K6OA 2ISZA 1MJBA 5ILVA 3GEZA 2EWNA 2X0LA 3BPXA 3LWFA 2V6CA 1BOAA 5LGTA 5FO5A 2FF4A 4DNCA 1BC8C 4IRGA 4P96A 4JK1X 1T0FA 2UXXA 2M87A 4D0PA 4L9VA 1YG2A 3DF8A 2ADUA 2M8EA 3QOPA 4A5MA 4ON0A 3E5QA 3FF5A 4KN7X 3ROUA 2ZXJA 1ZG5A 3HSFA 4KIGA 1RUNA 4OIPF 3HRUA 4BHPA 2WTEA 4XLPF 2F5CA 5D8LB 2FRHA 4PDKA 2GWRA 2RGVA 2P5LC 1SD7A 2HQRA 4R1HA 1J7KA 2E7WA 1WQ2A 3DPTA 3F8BA 1BI0A 2NNYA 3EDPA 4ESFA 4LG0A 5K5QA 3NRVA 5EEGA 1T38A 1XGNA 4FT8A 4YFNF 1YW7A 4MEXF 5LEKA 2PFBA 1LDJA 1J5YA 1Z7UA 1XMAA 4I2OA 4YFKF 4G6DA 3WODF 3FX3A 2OZUA 3F8FA 1U8RA 2FE3A 3ZP5A 3LA7A 4HDUA 2VC1A 1P6RA 4M9ZA 1EH6A 2RKHA 2CFXA 1R23A 4DQ2A 3BJOA 2XAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P4W A;  1BM9 A;  3DFG A;  5ICF A;  5DCF A;  2A69 F;  2O8X A;  4RAY A;  2A68 F;  2FQ3 A;  5LHG A;  2LSO A;  4E70 A;  3FHZ A;  1H9T A;  2DQL A;  3CLO A;  3BWG A;  3SZT A;  3I59 A;  3NQO A;  1IXS B;  1LEB A;  4L0Z B;  2CWE A;  5KVR A;  1U5T B;  2FMY A;  2OAZ A;  4M6Y A;  2FBK A;  1YW9 A;  1T98 A;  4HW0 A;  2HQN A;  2O61 A;  4OOI A;  1IN6 A;  3IWF A;  1YW8 A;  5HDG A;  2KIU A;  4OIO F;  3N4M A;  4YIF A;  5DEQ A;  1FY7 A;  3WE2 A;  2VXZ A;  1ZLJ A;  1S6L A;  3GVA A;  2PMH A;  1RI7 A;  1XN7 A;  3T0Y A;  2PBI A;  1P4W A;  5D5X B;  2H6B A;  1OYI A;  2M1B A;  5DV5 A;  1IZ1 A;  2XRN A;  5E8G A;  4RGR A;  3H92 A;  2ISY A;  1QZZ A;  4EM2 A;  1S7O A;  2BBY A;  2ESH A;  2Y0M A;  3RDI A;  1Z6T A;  5L3F A;  4N9H A;  2XV4 S;  2G9W A;  3WGG A;  2DQR A;  1BC7 C;  5FLX K;  3ZMS A;  2FA5 A;  2MA3 A;  2DK8 A;  4U7B A;  4A6D A;  3WTX C;  4MTD A;  1YYV A;  3LA3 A;  1ZH5 A;  2LNB A;  4HQE A;  4WWC A;  4B8X A;  1PUE E;  2V1U A;  5JFR A;  1F1Z A;  1B4A A;  6PAX A;  1Z9C A;  2L01 A;  4PZJ A;  2CG4 A;  4HX4 A;  1ZYR F;  3P7N A;  4P55 A;  1J0R A;  1KU7 A;  3GX4 X;  4HV6 A;  1JXS A;  5D5U B;  4M74 A;  3LQR A;  1FNN A;  1XGM A;  1V3F A;  4L5I A;  4YFX F;  5FFZ A;  4IRI A;  1HSJ A;  4ESB A;  5LEJ A;  2VBX A;  1ZG3 A;  2QEN A;  4GGG A;  4Q4Z F;  4GXO A;  3M9A A;  3QU3 A;  2EFQ A;  2H94 A;  5TJJ A;  3FM3 A;  2YU3 A;  1JE8 A;  2F5E A;  3FM5 A;  4U0V A;  2IPQ X;  1LB2 A;  3SZP A;  4YII A;  3ZMD A;  4ENN A;  3GF2 A;  3D0S A;  4KIB A;  5ILS A;  2M30 A;  5JR3 A;  1FYL A;  1NHA A;  3FXU A;  2JT1 A;  3RPQ A;  4EM0 B;  2ZO4 A;  1F9N A;  3HTU A;  3F6O A;  2MBF A;  3L9F A;  2L4A A;  2GIV A;  2IJL A;  5J8C A;  4CYD A;  1J2X A;  4ENK A;  1JHF A;  1TW3 A;  2P5V A;  4WX9 A;  5F1R A;  5LLQ A;  1GXP A;  2IA2 A;  1W5S A;  2M5W A;  4R79 A;  1SFX A;  1TW2 A;  3T8T A;  3KP7 A;  1WRJ A;  3WG9 A;  2QVO A;  1FLI A;  1YIO A;  4EJT A;  4G6Q A;  4CDG A;  1QQI A;  3HYI A;  3WTZ A;  2P7C B;  2AS5 F;  2CQK A;  1ONV A;  2VT3 A;  1B9N A;  2ETH A;  1S29 A;  3WU0 A;  3CO6 C;  3AAF A;  5FB2 A;  2LKP A;  2DO7 A;  2VBY A;  4Q5S F;  3WE3 A;  3CUQ B;  3W6K B;  1O3R A;  3TOB A;  5ICC A;  3KP6 A;  1L3L A;  5HOO A;  2HWV A;  3T8R A;  4EMS A;  2EK5 A;  3DQV C;  3J81 K;  3GWZ A;  3R0J A;  4CGZ A;  2ZNY A;  4JBA A;  4QLC U;  5DCM B;  1DDN A;  4AIK A;  2R7F A;  1XDS A;  1T39 A;  3NEU A;  2XVC A;  2XAS A;  4LLL A;  2OD5 A;  2B0L A;  2OZ6 A;  1BJA A;  3GW2 A;  3F8C A;  3KP3 A;  4Z2Y A;  2IA1 A;  1I1S A;  1QGP A;  1U2W A;  1TQI A;  4HYE A;  5L3D A;  4EVI A;  2PJP A;  2ZKZ A;  1ON1 A;  2VBZ A;  2ZME A;  2G7U A;  3FMS A;  4OMY A;  3BZ6 A;  3R4K A;  1SMY F;  1R1U A;  3EUH A;  2W25 A;  3ECH A;  3KCC A;  1LQ1 A;  3P9C A;  4FX0 A;  2K86 A;  2VE8 A;  1K7A A;  1PDN C;  5D4R A;  2VOO A;  3N97 A;  4G9Y A;  4HF2 A;  4KMU X;  1MD0 A;  3JTH A;  4G94 A;  5AIP A;  1I1G A;  2EA2 A;  3GUD A;  2QQ9 A;  1YQA A;  2VT2 A;  3B73 A;  1I6X A;  2XAF A;  1G3T A;  4RB2 C;  4H0E A;  4U0Y A;  5L3E A;  4A5N A;  4I01 A;  2IW5 A;  2ZFW A;  4ENJ A;  1FC3 A;  4KUM A;  4S05 A;  4AD9 A;  5DYM A;  3KET A;  3TO7 A;  4EJU A;  4RB0 A;  3V8L A;  1SAX A;  1TTY A;  1L0O C;  4CXF A;  4LJZ F;  3EYY A;  2IP2 A;  2HS5 A;  2XGX A;  1P4X A;  5H6R A;  4PGH A;  4KIC A;  1P2F A;  3HTS B;  3M8F A;  2EV0 A;  1KA8 A;  3E6C C;  2CYY A;  4FX4 A;  5JI6 A;  3I71 A;  5ILU A;  4R8H A;  2RDP A;  1OMI A;  1W7P A;  3HSE A;  5E20 A;  5EEH A;  4RB1 A;  4GYG A;  3K1P A;  2DAO A;  3GZ6 A;  5F6F A;  3HOS A;  1IN4 A;  4ESJ A;  1DPU A;  3ZN0 A;  5E1X A;  4ASN A;  5LBQ A;  1B9M A;  1O57 A;  4OIN F;  2OQR A;  2QQA A;  4Y17 A;  2STT A;  1HW2 A;  1LJ9 A;  3BRO A;  1P4A A;  2CGP A;  2Z5U A;  4HOB A;  2YX4 A;  2K4B A;  1FZP B;  1OYY A;  1IN8 A;  1SD5 A;  4EV0 A;  2ZBK A;  4XSX F;  3WTS C;  2EA4 A;  4I0B A;  1QZY A;  2DLL A;  3O2P E;  1G6N A;  1G4D A;  5L3G A;  1LEA A;  2H6C A;  5DCM A;  2H09 A;  1FP1 D;  5BOX A;  3BP8 A;  2G7H A;  2FBI A;  1XSX A;  1E17 A;  1R5G A;  3IL2 A;  3CDH A;  2CSO A;  5A2Q K;  4IRH A;  4UVC A;  4K2E A;  5IT9 Z;  2XRO A;  2C6Y A;  3E5X A;  2ACJ A;  1CF7 B;  2GQQ A;  3Q9S A;  3EET A;  4N0B A;  3GFI A;  4Q48 A;  2DFI A;  1U3E M;  1STZ A;  1ZHF A;  2ZME B;  2Y48 A;  3KP4 A;  1FBQ A;  3RKX A;  2EV6 A;  3C18 A;  5HVQ C;  4HZF A;  1Y0U A;  1KU2 A;  2VON A;  2NAZ A;  4IHS A;  2JZY A;  3HUG A;  4GCV A;  3I54 A;  2L3D A;  5DDG A;  3ZMV A;  3E3V A;  3GYH X;  3K1M A;  5BQT A;  1O3T A;  4L9N A;  4L9T A;  3IKV A;  3SXY A;  4MQ9 F;  2OQG A;  1P92 A;  3ZQ7 A;  3G3Z A;  2A5Y B;  4WXD A;  5KK1 A;  3BJ6 A;  3O6B B;  4UXN A;  2QBY A;  1XDU A;  3IC7 A;  1RIO H;  1KU3 A;  1HXD A;  1LNW A;  2P6T A;  2M45 A;  1F5T A;  2NS0 A;  2RQP A;  2TDX A;  4QWQ A;  1XCV A;  1YTY A;  3U2R A;  5CYV A;  3I64 A;  2GXB A;  1Q1H A;  3RI4 A;  5D6E A;  2HTJ A;  3HHG A;  2Y75 A;  4IXA A;  3JTG A;  3ZPL A;  1HKS A;  1Z6R A;  1TQM A;  4U0W A;  4LGW A;  2FU4 A;  1USS A;  1CF7 A;  3FZV A;  4BXU A;  4KN4 X;  3KFW X;  2QWW A;  2V9V A;  5H6Q A;  3F6V A;  5ICG A;  1ZGA A;  3L2C A;  4MTE A;  4AWX B;  3TO6 A;  3F8N A;  4KT5 C;  3HRT A;  1U5T C;  5DUI A;  3R60 A;  2GXG A;  3K0L A;  2QLZ A;  4ZYG A;  2Q0O A;  1IXR C;  2RVC A;  2KRF A;  3MZH A;  1K78 B;  4P9U A;  1HST A;  3LAJ A;  5D5W B;  3JAM K;  5K1Y A;  1IAW A;  2FNA A;  4EJW A;  3SFZ A;  1O7F A;  2UWM A;  2OU2 A;  3OV8 A;  2EFW A;  1IF1 A;  1B59 A;  3F22 A;  4RGX A;  2RC4 A;  2HOE A;  5JHU A;  2DU9 A;  2W85 A;  2A6H F;  2PMU A;  3RKY A;  5BMZ A;  3LAP A;  2JPB A;  1R22 A;  1B1B A;  2WC2 A;  4XBF A;  1FYM A;  3ZMZ A;  5CVJ A;  2QYO A;  1PP7 U;  1XMK A;  4L5J A;  3COA C;  3R0A A;  3EYI A;  4XRF A;  4U7D A;  1QBJ A;  4A0Y A;  2STW A;  2R3S A;  4I0A A;  1Z91 A;  3GLX A;  4HQM A;  1KQ8 A;  2HR3 A;  3F8M A;  1KGS A;  1S8N A;  3ZN1 A;  4O6J A;  3WGH A;  2D1H A;  2Z99 A;  1ZG1 A;  3H3U A;  2R7D A;  2K27 A;  3FWE A;  5E18 F;  4KIF A;  1KU9 A;  2JPC A;  2PLY A;  2AXL A;  3F72 A;  2XAG A;  3JSP A;  3IKT A;  1FBU A;  4ZYD A;  4I7H A;  4M72 A;  2H27 A;  3HRS A;  1R5H A;  2EFN A;  4UV8 A;  4IHT A;  3SHF A;  2FNP A;  2KJC A;  2V1X A;  1SFE A;  5HS9 A;  3E6M A;  1KYZ A;  4EGZ A;  4MEY F;  5JVT A;  1TQP A;  1R58 A;  1K78 A;  2BEO A;  3ML6 A;  5FD5 A;  2JTV A;  4G8X A;  2GA2 A;  3I5U A;  3GO5 A;  2ZNZ A;  4ETS A;  5CVV A;  4NQW A;  1UST A;  2KIF A;  2HGC A;  4HV5 A;  4RGU A;  2FEZ A;  3CUO A;  4JQF A;  3FMR A;  3DV8 A;  2NYX A;  3KZY A;  3RTR A;  3K1N A;  1ZN2 A;  2D2W A;  3I0T A;  3ULQ B;  3ZMT A;  1HW1 A;  4I02 A;  2A07 F;  3JW4 A;  4KDP A;  2WWY A;  1UB9 A;  1R1V A;  3V7C A;  3L09 A;  1GVJ A;  2K7L A;  3MZY A;  4LD5 A;  1R00 A;  5HS8 A;  2HKX A;  1F4K A;  4M9X A;  3MWM A;  3HHH A;  5IT3 A;  3MAJ A;  1O3Q A;  2CO5 A;  4O5V A;  2EFP A;  1FP2 A;  3CJN A;  2DTR A;  2O6G E;  3F3X A;  4BHC A;  3V8J A;  1G3Y A;  4PCQ A;  4S04 A;  1LDK B;  1W4M A;  1FWZ A;  2FML A;  2XKO A;  4HF0 A;  1D8J A;  2P6S A;  3FMQ A;  3HIF A;  3ECO A;  1SMT A;  1HBX G;  1XB4 A;  2J5O A;  5LHI A;  5LGN A;  5AIQ A;  4UVB A;  4CIC A;  1D5V A;  2VE9 A;  2MH9 A;  2PQ8 A;  3RYP A;  4BQA A;  1YS7 A;  2K4J A;  3RYR A;  5D4S A;  3J80 K;  3RKW A;  2IRF G;  4WXC A;  2YR2 A;  3I53 A;  1MDM A;  2VBW A;  1MJA A;  1J59 A;  2DPU A;  1KQ0 A;  3WTV C;  4CO8 A;  4HX7 A;  3S2W A;  4ZYH A;  2XIG A;  3GFM A;  3QP6 A;  4BH9 A;  2WV0 A;  1ZLK A;  1W7P B;  3BDD A;  3L7W A;  1RNL A;  3E97 A;  2FSW A;  5A2Q Z;  3HRM A;  5J8F A;  5IT9 K;  3O3K A;  2HEO A;  1W5T A;  3IHU A;  2QZ8 A;  5BS6 A;  3MCZ A;  4Y13 A;  1LVA A;  2YX7 A;  2VOD A;  3U1D A;  2MLG A;  1ZRF A;  4ZH4 F;  2JRT A;  5K5R A;  5F64 A;  2KKO A;  1B6A A;  4L9J A;  4HBL A;  1G3S A;  1FT9 A;  5E17 F;  1SD6 A;  2K02 A;  3FXR A;  2JSC A;  4EM1 A;  5LRR A;  1IN7 A;  1DUX C;  3J7A O;  2BV6 A;  1C0W A;  3PFI A;  3DKW A;  2YSR A;  3VOE A;  2O03 A;  2FBH A;  4KA4 A;  4ENM A;  2EV5 A;  1QNT A;  1XGO A;  4YG2 F;  1FSH A;  4G7O F;  2VOP A;  1KYW A;  4GYI A;  2PN6 A;  4ZZL A;  2HZT A;  5D6F A;  3T5X A;  1SFU A;  1BI3 A;  1EV7 A;  2D45 A;  4HLY A;  1WWX A;  3TGN A;  5L3C A;  3PQK A;  5BPI A;  3KP2 A;  2XAH A;  5E1W A;  4L18 B;  4WK8 F;  4GO1 A;  2LDU A;  2BE5 F;  3QU6 A;  4BAY A;  3GXO A;  1TNS A;  1OPC A;  2P8T A;  4HLX A;  4BHB A;  2Z9O A;  3P9K A;  2Z33 A;  1IUY A;  1HKT A;  1ZAO A;  2FOK A;  1BI1 A;  2XKP A;  3LQQ A;  1QPM A;  3V8K A;  3FXQ A;  1TLH B;  1REP C;  5CLS A;  3IWZ A;  4OIR F;  1RZ4 A;  4LK0 F;  2HTS A;  4I09 A;  2DI3 A;  3VEP A;  1UHM A;  4OU0 A;  3TOA A;  1H0M A;  3QPH A;  4A0X A;  1DPR A;  1EH8 A;  3EQL F;  3BJA A;  1LDD A;  1R36 A;  5HLG A;  4I98 B;  2UXN A;  4IPA A;  3DEU A;  3QRF F;  1O3S A;  1MZB A;  3IRR A;  2LF8 A;  1ZRD A;  1PP8 F;  1FOK A;  4WF2 A;  2IT0 A;  2QBY B;  1YO5 C;  3F21 A;  3L00 A;  3CO7 C;  4P5O A;  2ESN A;  1MGT A;  5CVU A;  4M73 A;  4G7H F;  3KZZ A;  2MLK A;  3JAM Z;  1J75 A;  2X4H A;  5ICE A;  2P7V B;  4LMY A;  4Y15 A;  1IXC A;  5TRD A;  4FHT A;  1HW5 A;  2QQB A;  2P5K A;  3K69 A;  1GXQ A;  3GZ5 A;  4MNU A;  1FX7 A;  3V7R A;  3I58 A;  3TDU C;  3WTY C;  5HDK A;  1MKM A;  3LFK A;  4AIH A;  3MFK A;  2VC0 A;  2ZJ2 A;  3I59 B;  3ISP A;  1U5T A;  2E1C A;  2HKO A;  3C7J A;  3V4G A;  2DK5 A;  3KE2 A;  1WSU A;  3F23 A;  4LLG F;  1ZAR A;  2V79 A;  3KLN A;  3QPT A;  1JHH A;  5FLX Z;  3WU1 B;  1I5Z A;  5K5O A;  4RS8 A;  2IVM A;  1O7L A;  5E8I A;  2EFO A;  3BY6 A;  3R61 A;  3ELK A;  5L3B A;  2E1N A;  4UV9 A;  2CW0 F;  3DPL C;  4EJO A;  1JGS A;  1FSE A;  1XSD A;  4A12 A;  4NHJ A;  3U9G A;  4MHG A;  3TO9 A;  4OMZ A;  3WTW C;  3QAH A;  3WTU C;  4G7Z F;  1J9I A;  1D3Y A;  1Z05 A;  1G3W A;  1U6G A;  2Q8K A;  1FYK A;  2RV8 A;  3RJP A;  4F7Z A;  2NNN A;  2COM A;  2XHK A;  4KYW A;  3MQ0 A;  4UVA A;  4O3M A;  3K2Z A;  1IRF A;  3HSR A;  1IN5 A;  2HYG D;  3CTA A;  1OKR A;  5HDN A;  2F5D A;  4EGY A;  1QO0 D;  3M7G A;  4CZZ A;  2A6E F;  2EJR A;  2BGC A;  5CVR A;  1WKM A;  4HA8 A;  2A61 A;  4CHU A;  4A2U A;  4KMF A;  3T1B A;  1IRG A;  1DP7 P;  3ERE D;  4BNC A;  1MJ9 A;  5AON A;  5FGM A;  5CVI A;  2MC3 A;  4MGR A;  5FD6 A;  3ZMU A;  3G73 A;  1FBS A;  3TKY A;  3B02 A;  2FXA A;  4AVP A;  2BYV E;  3W6J B;  2GZW A;  1BN5 A;  5FFX A;  1YS6 A;  3I4P A;  4HF1 A;  3WTT C;  2PG4 A;  2J5P A;  4AIJ A;  2MD5 A;  4M9S A;  1R1T A;  3M1E A;  3GFL A;  4IVN A;  4B09 A;  3OOP A;  2EB7 A;  2E7X A;  4MQV A;  2GAU A;  2W84 A;  4LB5 A;  2O0Y A;  1E2X A;  4LLN A;  2L02 A;  1OYW A;  4HX8 A;  4NB5 A;  2ELH A;  3REO A;  2F2E A;  1D8K A;  3E6D A;  3LST A;  3V7S A;  5E1Z B;  4LFU A;  4WCG A;  1GHC A;  4EJV A;  5LGU A;  2DPD A;  5DUK A;  2PI0 A;  1H9G A;  1BIB A;  4WXH A;  4HDV A;  5D8K B;  1FPQ A;  3BPV A;  1SD4 A;  4HAM A;  2F5F A;  1VTN C;  1ZGJ A;  1S7A A;  4PGG A;  4U88 A;  3VB2 A;  2XAJ A;  5HLH A;  2QUF A;  4TV7 A;  5DD4 A;  1MDM B;  5BPD A;  2KJB A;  3K9T A;  3ABU A;  1CGP A;  3J80 Z;  3BOQ A;  3TQN A;  1UFM A;  3J81 Z;  2L4M A;  4IF4 A;  5LRS A;  5ED4 A;  1XCB A;  2VN2 A;  5D5V B;  1YLF A;  1S3J A;  2ZCW A;  1X3U A;  3R6S A;  3LA2 A;  1I27 A;  2D1V A;  1ULY A;  1WI9 A;  1ODD A;  2Z3Y A;  1Z1D A;  3KEQ A;  2HFH A;  4RAZ A;  2DW4 A;  2DBB A;  1U78 A;  3CUQ A;  3C1D A;  3Q9V A;  4LG0 B;  3D5L A;  1XGS A;  4UNO A;  1V4R A;  2Q2E A;  1IW7 F;  3SQN A;  1YFH A;  1A04 A;  4XSZ F;  1ZRC A;  3E5U A;  3DP7 A;  3JSO A;  1XD7 A;  1OR7 A;  2OA4 A;  5H20 A;  2RN7 A;  2HYF A;  2RNJ A;  2L54 A;  4UHT A;  3KEO A;  4EQQ A;  1ZRE A;  3H3Z A;  1UCR A;  4Q47 A;  2W57 A;  1ON2 A;  2V1D A;  5ERI A;  3Q5F A;  1RUO A;  3GFJ A;  4N9I A;  3VFZ A;  2PEX A;  1KQ9 A;  2O3F A;  2DT5 A;  1BIA A;  3TDZ C;  3IRQ A;  1BI2 A;  2MH2 A;  5CJ9 A;  3RPU A;  3DXJ F;  3PQJ A;  1XSV A;  4RGS A;  3HOT A;  4LB6 B;  2XUB A;  3P9I A;  1TBX A;  5HS7 A;  4KFC A;  4RB3 C;  1EH7 A;  2W24 A;  5J6X A;  4UUV A;  4A0Z A;  4OIQ F;  1R7J A;  5DD8 A;  2KIM A;  2YPR A;  4LK1 F;  1T6S A;  1HQC A;  4ZZD A;  2GA1 A;  3KLO A;  3VOD A;  1AOY A;  4BYY A;  3MEX A;  1AWC A;  3QP5 A;  2LF7 A;  3CUQ C;  3RIR A;  2HDC A;  1T2K A;  3WGI A;  1HKQ A;  2OBP A;  5LHH A;  1TNT A;  4IJA A;  2NRA C;  3KP5 A;  4A6E A;  4P9F A;  1K79 A;  5HLI A;  1W7P D;  3E6B A;  3M8E A;  2QM3 A;  4ZYE A;  4L0Y B;  3ABT A;  4KNY A;  2IA0 A;  2UZK A;  4M6X A;  4XLN F;  4M71 A;  3C3W A;  2A3S A;  1UHW A;  1BBY A;  1K6O A;  2ISZ A;  1MJB A;  5ILV A;  3GEZ A;  2EWN A;  2X0L A;  3BPX A;  3LWF A;  2V6C A;  1BOA A;  5LGT A;  5FO5 A;  2FF4 A;  4DNC A;  1BC8 C;  4IRG A;  4P96 A;  4JK1 X;  1T0F A;  2UXX A;  2M87 A;  4D0P A;  4L9V A;  1YG2 A;  3DF8 A;  2ADU A;  2M8E A;  3QOP A;  4A5M A;  4ON0 A;  3E5Q A;  3FF5 A;  4KN7 X;  3ROU A;  2ZXJ A;  1ZG5 A;  3HSF A;  4KIG A;  1RUN A;  4OIP F;  3HRU A;  4BHP A;  2WTE A;  4XLP F;  2F5C A;  5D8L B;  2FRH A;  4PDK A;  2GWR A;  2RGV A;  2P5L C;  1SD7 A;  2HQR A;  4R1H A;  1J7K A;  2E7W A;  1WQ2 A;  3DPT A;  3F8B A;  1BI0 A;  2NNY A;  3EDP A;  4ESF A;  4LG0 A;  5K5Q A;  3NRV A;  5EEG A;  1T38 A;  1XGN A;  4FT8 A;  4YFN F;  1YW7 A;  4MEX F;  5LEK A;  2PFB A;  1LDJ A;  1J5Y A;  1Z7U A;  1XMA A;  4I2O A;  4YFK F;  4G6D A;  3WOD F;  3FX3 A;  2OZU A;  3F8F A;  1U8R A;  2FE3 A;  3ZP5 A;  3LA7 A;  4HDU A;  2VC1 A;  1P6R A;  4M9Z A;  1EH6 A;  2RKH A;  2CFX A;  1R23 A;  4DQ2 A;  3BJO A;  2XAQ A; 
#chains in the Genus database with same CATH topology
 2P4W A;  1BM9 A;  2R5Z B;  3DFG A;  2CQX A;  5ICF A;  5DCF A;  1Z0X A;  2AQE A;  3DTK A;  5K7Z A;  2A69 F;  1TL8 A;  2O8X A;  4RAY A;  2A68 F;  2FQ3 A;  5LHG A;  2CUJ A;  2LSO A;  4E70 A;  3FHZ A;  3QWL A;  5GAH J;  2DQL A;  1H9T A;  3CLO A;  1UHS A;  3OYA A;  3BWG A;  3SZT A;  3I59 A;  3NQO A;  1IXS B;  1LEB A;  4L0Z B;  2IGK A;  5F1J A;  1RKT A;  2CWE A;  1HCR A;  2R7X A;  5KVR A;  1U5T B;  2FMY A;  2JN6 A;  2HOA A;  5M3M J;  2OAZ A;  1D0Z A;  2E60 A;  2X85 A;  4M6Y A;  2FBK A;  4D1Q A;  1T98 A;  1YW9 A;  1X2M A;  4PK4 A;  2DOE A;  2BHY A;  4HW0 A;  2HQN A;  2R7Z J;  2O61 A;  4ZDO A;  3K2A A;  4OOI A;  4DYR A;  1IN6 A;  1IO2 A;  3IWF A;  3ZQI A;  3DCF A;  4BL0 B;  4CSW A;  3RZD J;  1YW8 A;  5HDG A;  5J1Y A;  2KIU A;  3D5S C;  1ZLK A;  4OIO F;  3N4M A;  4YIF A;  5DEQ A;  2ID6 A;  1FY7 A;  3WE2 A;  4E7L A;  2E5Z A;  1AA7 A;  4XOT A;  2VXZ A;  1ZLJ A;  3CF5 F;  1OIS A;  1S6L A;  3GVA A;  4RDU A;  1Z21 A;  2PMH A;  2CJJ A;  1RI7 A;  1XN7 A;  3P5J A;  3T0Y A;  4RAG A;  1B72 A;  1PJR A;  3BTL A;  9ANT A;  4FQG A;  2PBI A;  1P4W A;  1A6I A;  5C44 J;  5D5X B;  2CV2 A;  2BW3 A;  1OYI A;  2H6B A;  4I6Z A;  2M1B A;  3HEF A;  5DV5 A;  1IZ1 A;  2XRN A;  5E8G A;  2EZK A;  3CDI A;  4II2 A;  4RGR A;  2O8K A;  5JVG F;  3H92 A;  2ZXW H;  1FIA A;  3O8H A;  2ISY A;  1QZZ A;  4M3G A;  4EM2 A;  3MKY B;  1S7O A;  2BBY A;  3ZQQ A;  1TC3 C;  2DFH A;  2ESH A;  2Y0M A;  3RDI A;  1Z6T A;  5L3F A;  4N9H A;  4B4C A;  2XV4 S;  2G9W A;  3BZC A;  3S32 A;  3WGG A;  4D9J A;  5KAI C;  4IQ4 A;  5IP7 J;  1R6R A;  1UG0 A;  2DQR A;  1W0T A;  1BC7 C;  1MSF C;  2ZFU A;  5FLX K;  3ZMS A;  2FA5 A;  2MA3 A;  2DK8 A;  4U7B A;  4A6D A;  3MKW B;  1MIJ A;  3WTX C;  2NOG A;  3RZO J;  2R92 J;  4MTD A;  4XK4 A;  3ASO H;  1YYV A;  3LA3 A;  1UAA A;  3DU5 A;  1X3W B;  1Q1V A;  3SEZ A;  1IGN A;  1ZH5 A;  3WHB A;  4DIQ A;  2LNB A;  3CCQ I;  4HQE A;  4WWC A;  4B8X A;  1PUE E;  2V1U A;  4XLH A;  5JFR A;  3HG9 A;  3K4L A;  1F1Z A;  3SYT A;  4C3I J;  1B4A A;  6PAX A;  4H4K C;  4E7I A;  3RKQ A;  3H0D A;  4XLA A;  1Z9C A;  2LRD A;  2L01 A;  4PZJ A;  3HOY J;  3FDY A;  2CG4 A;  4HX4 A;  3FBI B;  2LY2 A;  1ZYR F;  3P7N A;  4P55 A;  3A02 A;  1J0R A;  1KU7 A;  3GX4 X;  3OL4 A;  4HV6 A;  1WJA A;  1JXS A;  5D5U B;  4M74 A;  5F0C A;  2GIZ A;  3LQR A;  1FNN A;  1XGM A;  1V3F A;  4L5I A;  2WY7 Q;  4YFX F;  3SJM A;  2WA0 A;  5FFZ A;  4IRI A;  1HSJ A;  2HVQ A;  4ESB A;  5LEJ A;  1VQ6 I;  2VBX A;  2R4G A;  1SFO J;  1ZG3 A;  2QEN A;  3L2W A;  4GGG A;  4Q4Z F;  3L2U A;  4CCL A;  1ZGW A;  3CDL A;  4GXO A;  3LSJ A;  4XOP A;  1X1P A;  2VKH A;  4PSX A;  1IJW C;  2F6C A;  1JJ8 C;  3M9A A;  3L2Q A;  3W3C A;  3QU3 A;  4QPQ A;  4F93 B;  2EFQ A;  2H94 A;  5TJJ A;  3FM3 A;  4AYB A;  4ZDL A;  2YU3 A;  3PFY A;  1JE8 A;  2F5E A;  4XNF A;  3OYG A;  3S17 J;  1MSE C;  3FM5 A;  4U0V A;  2IPQ X;  2LBF B;  1LB2 A;  3SZP A;  3BR1 A;  4YII A;  3ZMD A;  2L7K A;  4ENN A;  3GF2 A;  3D0S A;  4KIB A;  1JI8 A;  2HXI A;  5ILS A;  2DXI A;  2M30 A;  2HPI A;  2ZJP F;  2LOO A;  5JR3 A;  1FYL A;  2CQN A;  3H0G J;  1NHA A;  3FXU A;  2JT1 A;  3RPQ A;  4EM0 B;  1I3Q J;  2ZO4 A;  1F9N A;  3HTU A;  2IEK A;  1VQ5 I;  3F6O A;  3GCM A;  2JA8 J;  3FK7 A;  2MBF A;  3PNV A;  1N75 A;  1YOV B;  3IAM 2;  3L9F A;  2L4A A;  1EKE A;  3Q3S A;  3K4B A;  2ZXH A;  1BR2 A;  4IZZ A;  2GIV A;  2IJL A;  5J8C A;  2WAQ A;  4CYD A;  1WJC A;  1IV8 A;  1J2X A;  3FHN A;  4C2M J;  4ENK A;  5EDN A;  5E3M A;  3O8G A;  3K10 A;  1JHF A;  2H8W A;  1N78 A;  1TW3 A;  3ABK H;  5EGO B;  2R5Z A;  4XID A;  3GTL J;  2P5V A;  4XN3 A;  4WX9 A;  5F1R A;  5LLQ A;  2E34 A;  3H5A A;  1GXP A;  2IA2 A;  1W5S A;  2QSH X;  2M5W A;  4R79 A;  1GUU A;  2VL8 A;  2V1N A;  1V5G A;  3J7Z I;  1ETX A;  1SFX A;  2KIQ A;  3CMA I;  1VQL I;  1TW2 A;  2M0M A;  3T8T A;  5EF6 A;  3KP7 A;  1WRJ A;  1ETK A;  3WG9 A;  2CS3 A;  2EQR A;  3BLY A;  1TWF J;  2QVO A;  1FLI A;  1YIO A;  2DA7 A;  3ASN H;  4G6Q A;  2DA5 A;  4EJT A;  2PJR A;  4CDG A;  1QQI A;  5E79 C;  3HYI A;  3WTZ A;  2P7C B;  2AS5 F;  2CQK A;  1RET A;  1ONV A;  1X19 A;  4NC7 A;  4GRI A;  1ZR2 A;  2XGD A;  2BW3 B;  2VT3 A;  2XF7 A;  1B9N A;  2CV0 A;  3QOE A;  2ETH A;  1S29 A;  3WU0 A;  3CO6 C;  3AAF A;  5FB2 A;  2LKP A;  3AG2 H;  5FLV A;  2DO7 A;  2XPU A;  3PSI A;  3PSF A;  4JYK A;  2FQ4 A;  2VBY A;  3OYJ A;  3BQZ A;  4OAZ A;  5GP9 A;  4Q5S F;  1MBJ A;  3H1C A;  3WE3 A;  3CUQ B;  4FIS A;  2KRC A;  3W6K B;  1OCZ H;  1X1B A;  2L9R A;  4FAS D;  1O3R A;  4A3L J;  4LIV A;  3BR3 A;  2V26 A;  3TOB A;  4BS9 A;  2EZH A;  5ICC A;  1ENH A;  5F0F A;  4CUG A;  2ELJ A;  3KP6 A;  2N8G A;  4HST A;  1L3L A;  2NVY J;  2QKL B;  4NBQ A;  5HOO A;  2KQR A;  2HWV A;  3T8R A;  5K7H A;  4CCN A;  2LH9 A;  4EMS A;  2EK5 A;  3DQV C;  2F5V A;  4OAY A;  3J81 K;  3GWZ A;  3R0J A;  4CGZ A;  2ZNY A;  2H1L A;  4JBA A;  4JX6 A;  1JTX A;  4QLC U;  5DCM B;  1DDN A;  4AIK A;  2R7F A;  1XDS A;  4YEJ A;  4W97 A;  3NEU A;  2XSD C;  2XVC A;  1T39 A;  2XAS A;  4LLL A;  2OD5 A;  1YJN I;  2B0L A;  2OZ6 A;  1F43 A;  1BJA A;  3GW2 A;  1OCP A;  2AQF A;  3FXL A;  4AYB N;  4J19 A;  3S1N J;  3SZG A;  3ZQC A;  3W6V A;  3F8C A;  1JJ6 C;  2HZD A;  2K9S A;  2XF5 A;  5CQG A;  2Y31 A;  3KP3 A;  4Z2Y A;  3QYF A;  2IA1 A;  1I1S A;  1QGP A;  1U2W A;  5M5W J;  1TQI A;  4HYE A;  3DWL E;  5L3D A;  3A01 A;  4EVI A;  3RQ4 A;  4FET A;  2PJP A;  2ZKZ A;  4BU2 A;  2FX0 A;  1ON1 A;  4RBO A;  2WV1 A;  2VBZ A;  3CCL I;  3HGY A;  4BY1 J;  2ZME A;  2G7U A;  1WI3 A;  3FMS A;  3KZI C;  4BQO A;  4OMY A;  1E3H A;  2XPV A;  3BZ6 A;  1ZK8 A;  2HYJ A;  3R4K A;  4XN0 A;  1SMY F;  4XLC A;  4IX7 A;  1R1U A;  2VXD A;  5M5Y J;  5B66 C;  3EUH A;  1R4N B;  2WB1 A;  2W25 A;  2X1C A;  3ECH A;  3KCC A;  2HXO A;  2WAQ N;  1LQ1 A;  3I4M J;  3BR2 A;  3P9C A;  4FX0 A;  3UR3 C;  3H3V K;  2K86 A;  2VE8 A;  1K7A A;  2V6E A;  2AXT C;  3S8P A;  1PDN C;  5D4R A;  1AU7 A;  2VOO A;  4ITV A;  3G1M A;  4G9Y A;  3N97 A;  1LUJ B;  4HF2 A;  2WBM A;  1MD0 A;  4KMU X;  3MD2 A;  3JTH A;  4G94 A;  4J01 A;  5AIP A;  5M5X J;  1I1G A;  4DJA A;  2DYR H;  2EA2 A;  5KAF C;  3GUD A;  2QQ9 A;  1YQA A;  2VT2 A;  3B73 A;  4Y4R A;  1GV5 A;  4NUB A;  1I6X A;  2XAF A;  1G3T A;  4RB2 C;  1FOY A;  4H0E A;  4U0Y A;  3G2B A;  5L3E A;  4PSW A;  4A5N A;  2OPT A;  3KX2 A;  3S3O A;  4I01 A;  2DMP A;  2IW5 A;  3PNY A;  3DTI A;  2ZFW A;  2CW7 A;  5J1R A;  4ENJ A;  1FC3 A;  2UUZ A;  4KUM A;  4S05 A;  4AD9 A;  1FOW A;  5DYM A;  4BDZ A;  2XB5 A;  3KET A;  4XKB A;  3IAS 2;  3TO7 A;  4EJU A;  1UZC A;  1Z7L A;  2NVX J;  3CJQ B;  4RB0 A;  3V8L A;  1SAX A;  1F36 A;  1TTY A;  3BCA A;  5F08 A;  1MNE A;  1L0O C;  2O5R A;  1X3Z B;  4CXF A;  4LJZ F;  1SAN A;  4A3B J;  3EYY A;  2IP2 A;  2HS5 A;  2YS9 A;  2XGX A;  3ZQH A;  2DFF A;  3HOZ J;  1P4X A;  5IYB J;  3QPL A;  4PGH A;  5H6R A;  4KIC A;  1P2F A;  4NC6 A;  3HTS B;  5J4V A;  3M8F A;  2EV0 A;  1KA8 A;  4BDY A;  2XC7 A;  3E6C C;  5EGO A;  4XKC A;  1K4T A;  2CYY A;  3DLL F;  2BY1 A;  4FX4 A;  1ETQ A;  1PVE A;  3S1R J;  5JI6 A;  3H9G A;  5KCM A;  3WHC A;  3EPZ A;  3I71 A;  5ILU A;  4R8H A;  1PUF A;  2PMZ N;  2RDP A;  1OMI A;  2BY3 A;  3CCV I;  1W7P A;  3HSE A;  5E20 A;  4LOC A;  5EEH A;  2JVG A;  3NWS A;  1Z3X A;  4RB1 A;  1VQ8 I;  4GYG A;  4F3Q A;  4RAF A;  4NDL A;  4PJN A;  3K1P A;  1AHD P;  2A5W A;  2DAO A;  2Z2S B;  3GZ6 A;  1MH4 A;  4DBQ A;  2R93 J;  3CC2 I;  1VQM I;  5F6F A;  3HOS A;  1IN4 A;  4ESJ A;  3GTG J;  2DMN A;  1DPU A;  3ZN0 A;  5E1X A;  4ASN A;  3A01 B;  5LBQ A;  1B9M A;  2Y69 H;  1O57 A;  3D1N I;  4OIN F;  1R4M B;  2OQR A;  2QQA A;  1POG A;  3AG4 H;  1H88 C;  1A5J A;  2XRL A;  1RC9 A;  2JA6 J;  4Y17 A;  2STT A;  1HW2 A;  1LJ9 A;  1OCO H;  3GTK J;  3RCO A;  1MBH A;  4Y7N J;  2CUF A;  3ZGK A;  1WCM J;  3BT9 A;  3BRO A;  1P4A A;  2CGP A;  2IS2 A;  2Z5U A;  4HOB A;  4FTH A;  1X1D A;  2E35 A;  2YX4 A;  2X6Y A;  4S0H B;  2K4B A;  3MMY B;  4XON A;  1FZP B;  1OYY A;  5GAG J;  3SDB A;  1IN8 A;  1SD5 A;  2DA2 A;  3LL7 A;  4EV0 A;  1U8B A;  2ZBK A;  4XSX F;  3WTS C;  3GTO J;  2EA4 A;  4I0B A;  1QZY A;  2DLL A;  3F9K A;  3O2P E;  1G6N A;  2EBI A;  4FE4 A;  2HOS A;  4IQJ A;  4EAT A;  5DTD A;  3ZCO A;  3EUK L;  1G4D A;  1A36 A;  2E71 A;  5L3G A;  4N4N B;  4XMY A;  1LEA A;  4BUP A;  2R7O A;  2H6C A;  3A1Y A;  3DBL B;  2BOL A;  4EEF G;  5DCM A;  2OCC H;  2H09 A;  1FP1 D;  5IPA A;  2MFZ A;  3BP8 A;  5BOX A;  2G7H A;  2HOT A;  2EIJ H;  2FBI A;  1XSX A;  4BAC A;  2DN0 A;  1E17 A;  1R5G A;  1MBF A;  3IL2 A;  3CDH A;  2E19 A;  2CSO A;  2JRM A;  5A2Q K;  4IRH A;  4UVC A;  4K2E A;  5IT9 Z;  5JHF A;  2XRO A;  2C6Y A;  2LY1 A;  2YU9 J;  2R7T A;  3E5X A;  4M6V A;  1YIT I;  3BTI A;  2ACJ A;  3WG7 H;  1CF7 B;  2QQ8 A;  2GQQ A;  3Q9S A;  1UJ8 A;  2EZI A;  2VKV A;  3EET A;  4N0B A;  3GFI A;  4Q48 A;  2M4G A;  2DFI A;  2JJ7 A;  4XOR A;  4AID A;  2CUE A;  1NK2 P;  2ID3 A;  1U3E M;  1STZ A;  1ZHF A;  1FJL A;  2ZME B;  2Y48 A;  1MMN A;  3KP4 A;  1HDP A;  1FBQ A;  1Z77 A;  3RKX A;  2ZSI B;  2EV6 A;  5FRN A;  3C18 A;  5HVQ C;  4HZF A;  1Y0U A;  1KU2 A;  4XKV A;  1YIJ I;  2VON A;  2NAZ A;  4IHS A;  3CCY A;  3ZR8 X;  2JZY A;  1OFC X;  4B3X A;  1TT0 A;  3K70 D;  2QKM B;  3HUG A;  3JRE A;  3S15 J;  3OY9 A;  2E2J J;  3V42 A;  4GCV A;  2DOF A;  3VYT B;  3LSH A;  3I54 A;  4ZDP A;  5F27 A;  2L3D A;  3GTP J;  2DA1 A;  5DDG A;  1ITY A;  3ZMV A;  3E3V A;  2I8D A;  3GYH X;  2X48 A;  3K1M A;  5BQT A;  5JLW A;  4A3M J;  1O3T A;  4DZJ A;  4L9N A;  4L9T A;  3IKV A;  1NG6 A;  3F0C A;  5C4X J;  4PJ0 C;  3FIW A;  3SXY A;  1KON A;  1D5Y A;  3CES A;  5IOY A;  4XRS A;  1TT5 B;  4MQ9 F;  2OQG A;  2JUG A;  5CKT A;  3JRF A;  1P92 A;  2KT0 A;  3ZQ7 A;  3G3Z A;  2A5Y B;  4WXD A;  2BY0 A;  5KK1 A;  1T08 B;  3PIP F;  3JRH A;  3BJ6 A;  3O6B B;  3S16 J;  2Y0S A;  4UXN A;  3S3N A;  2QBY A;  2HQA A;  1XDU A;  4HNV A;  3IC7 A;  1RIO H;  2MD0 A;  1KU3 A;  1HXD A;  2K9M A;  2XB0 X;  1LNW A;  2P6T A;  2M45 A;  1F5T A;  2NS0 A;  2RQP A;  2TDX A;  4QWQ A;  1XCV A;  1YTY A;  3BG9 A;  4YIR X;  5DM7 F;  2WAD A;  2CW8 A;  3U2R A;  3KYL A;  5CYV A;  4BEH B;  3I64 A;  2GXB A;  4PFP A;  1ORK A;  2KDZ A;  1Q1H A;  4AM3 A;  3RI4 A;  3B6C A;  3K4K A;  5D6E A;  2OTJ I;  2HTJ A;  3HHG A;  2Y75 A;  3JCU C;  4MO7 A;  3SDG A;  4IXA A;  3JTG A;  1XMX A;  4JX5 A;  3S3M A;  4PJJ A;  3ZPL A;  2R7S A;  3IH2 A;  1HKS A;  1VQP I;  1Z6R A;  1TQM A;  1TWC J;  4U0W A;  4LGW A;  5FKK A;  4A69 C;  2FU4 A;  2X1E A;  1USS A;  3PO2 J;  2X6W A;  1CF7 A;  3FZV A;  5B5E C;  4BXU A;  5J3L A;  2K9L A;  4KN4 X;  3KFW X;  2QWW A;  2VUM J;  3FKI J;  2L5Q A;  2V9V A;  3HGG A;  3PUB A;  5H6Q A;  3F6V A;  2L0K A;  5ICG A;  1ZGA A;  3ESW B;  1IRX A;  3L2C A;  3OYH A;  4W1U A;  4MTE A;  4AWX B;  2O7O A;  3TO6 A;  3F8N A;  2AHQ A;  4KT5 C;  3HRT A;  4B1R A;  2EIM H;  1YX5 A;  1D1C A;  4PJM A;  1U5T C;  4HEA 2;  1VQN I;  4V19 K;  5DUI A;  4J00 A;  3R60 A;  2GLO A;  2TCT A;  2Y30 A;  3QYB A;  3SEQ A;  5EG0 B;  2G0E A;  3ZOB A;  2B9S A;  4CCM A;  3A4C A;  4B3A A;  2GXG A;  3K0L A;  2OJE D;  3OR1 C;  1SVO A;  2QLZ A;  1SVM A;  1T33 A;  4E7J A;  4ZYG A;  5IOZ A;  2WAF A;  2Q0O A;  3GTM J;  1WGX A;  1IXR C;  2RVC A;  2KRF A;  3MZH A;  1K78 B;  1S7E A;  4L5E A;  5HNF A;  4P9U A;  1HST A;  1X58 A;  1S9H A;  3LSG A;  3LAJ A;  5D5W B;  3JAM K;  2KP6 A;  2BXZ A;  5C4J J;  3OMY A;  5K1Y A;  1D1A A;  2KLO A;  2FNA A;  4XLF A;  3SFZ A;  1O7F A;  4EJW A;  1IAW A;  3CMM A;  2QA4 I;  5B3S H;  2UWM A;  5GAE J;  1V5E A;  2OU2 A;  3HKZ A;  1JUP A;  3OV8 A;  2EFW A;  1LE8 B;  3HM5 A;  3M07 A;  1IF1 A;  1B59 A;  3F22 A;  4RGX A;  2RC4 A;  3CCR I;  2HOE A;  4UB6 C;  5JHU A;  2DU9 A;  3VDX A;  2W85 A;  2A6H F;  2MG4 A;  2PMU A;  5GAD J;  1W1W E;  3PNT A;  2MSY A;  3RKY A;  1VQ7 I;  5E3L A;  5BMZ A;  2X1D A;  3LAP A;  1MH3 A;  5HNH A;  1B8I A;  2JPB A;  5EJC A;  3CCE I;  1R22 A;  2VQL A;  2DMQ A;  1B1B A;  3N05 A;  2WC2 A;  4XBF A;  3IV5 A;  1FYM A;  3ZMZ A;  5CVJ A;  4UB8 C;  3DKY A;  2QYO A;  1PP7 U;  3OWT A;  1XMK A;  1O4X A;  1J09 A;  4LIU A;  2VPR A;  3QPS A;  2R7R A;  4L5J A;  4G12 A;  1ETO A;  2VPL A;  3COA C;  2K3F A;  4E7Z A;  1MBG A;  2K9N A;  2V7F A;  3R0A A;  2VKE A;  3EYI A;  1TWG J;  2ZXI A;  3PIO F;  4XRF A;  1ZQ3 P;  4ZTJ A;  2PJR B;  3HUG B;  2KL4 A;  4U7D A;  1QBJ A;  3DBR B;  3K6G A;  4BJ6 C;  2MW8 A;  4A0Y A;  2A05 A;  3A03 A;  4II3 A;  2STW A;  5M3F J;  3LSI A;  2R3S A;  1E3P A;  1JKR C;  4I0A A;  2KZG A;  1Z91 A;  1HLV A;  3GLX A;  2M34 A;  4HQM A;  2VI6 A;  2KMU A;  3UNG C;  1KQ8 A;  2HR3 A;  2W1O A;  3F8M A;  1KGS A;  1S8N A;  3ZN1 A;  4MFE A;  4O6J A;  3WGH A;  2IGM A;  5J47 A;  2D1H A;  2Z99 A;  3FBN B;  3NAU A;  1ZG1 A;  2LVS A;  2ZJR F;  4BKX A;  3H3U A;  2R7D A;  3BCB A;  2K27 A;  3FWE A;  5E18 F;  4KIF A;  1KU9 A;  2JPC A;  3L1P A;  2PLY A;  1FTZ A;  2AXL A;  3F72 A;  2FOW A;  3ONQ A;  4LIT A;  3QYE A;  3SFI A;  2HU9 A;  1S72 I;  2XAG A;  3JSP A;  3IKT A;  1FBU A;  4ZYD A;  1MNM C;  4C2T A;  1AKH B;  4I7H A;  3A2K A;  1KZH A;  3W2W A;  4M72 A;  1ETV A;  3HRS A;  1R5H A;  2H27 A;  2EFN A;  4UV8 A;  4IHT A;  2LK2 A;  1UEL B;  3SHF A;  2FNP A;  2KJC A;  2V1X A;  1SFE A;  5HS9 A;  3E6M A;  1KYZ A;  2KRH A;  4EGZ A;  3BG6 A;  1WJD A;  4A3I J;  3HDD A;  4MEY F;  3OYL A;  1VQO I;  1RR7 A;  5JVT A;  1TQP A;  2EIK H;  3OYN A;  2DMT A;  2HDD A;  3GLL A;  1R58 A;  5B1B H;  1K78 A;  4QTR A;  2BEO A;  4M3D A;  2CQ7 A;  3ML6 A;  3AKZ A;  5FD5 A;  2JTV A;  4CCK A;  4G8X A;  2GA2 A;  4XQF A;  1BA5 A;  3I5U A;  3GO5 A;  1SVL A;  2ZNZ A;  4ETS A;  5CVV A;  4NQW A;  1LE8 A;  5KHD A;  4BEH A;  1UST A;  2KIF A;  1WJB A;  2HGC A;  1YRN B;  4HV5 A;  4RGU A;  2FEZ A;  3CUO A;  2QEX I;  1YJW I;  4JQF A;  1GDT A;  3FMR A;  3DV8 A;  3LOC A;  4UUT A;  2NYX A;  3KPH A;  3OS0 A;  3KZY A;  3RTR A;  1V54 H;  3K1N A;  1ZN2 A;  1OCC H;  2D2W A;  3I0T A;  1TP4 A;  3C2G A;  3FIS A;  4BQQ A;  4IO9 F;  3ULQ B;  1E3O C;  3ZMT A;  2LR8 A;  3DKX A;  2W00 A;  2PMZ A;  1HW1 A;  3VSL A;  1RES A;  4ANJ A;  1K4S A;  4I02 A;  2ECB A;  2A07 F;  3FXM A;  3JW4 A;  4KDP A;  3CCM I;  2WWY A;  3JRI A;  1UB9 A;  2TRT A;  1R1V A;  1OQY A;  3V7C A;  2ICW G;  3L09 A;  1JKP C;  1GVJ A;  2K7L A;  2W48 A;  1X4O A;  3HOU J;  2Y0S N;  3MZY A;  4LD5 A;  1R00 A;  1OR7 C;  5HS8 A;  2HKX A;  3G71 I;  1EJ9 A;  2BZT A;  3VWB A;  1F4K A;  1VQK I;  4M9X A;  3MWM A;  3HHH A;  5IT3 A;  3MAJ A;  1O3Q A;  5F0H A;  2CO5 A;  4O5V A;  4BBS J;  2EFP A;  1FP2 A;  3CJN A;  2DTR A;  3OL3 A;  2O6G E;  3F3X A;  4BHC A;  1Y39 A;  4E4H A;  3K4J A;  3V8J A;  1G3Y A;  2HI3 A;  4PCQ A;  4S04 A;  4C3J J;  1LDK B;  1SC7 A;  4BGD A;  1W4M A;  5EEA A;  1FWZ A;  1I6H J;  1WVR A;  2FML A;  2XKO A;  4HF0 A;  3OIP A;  1D8J A;  1QHG A;  2P6S A;  3FMQ A;  3WU2 C;  2IS4 A;  3HIF A;  3ECO A;  5DM6 F;  2WY8 Q;  3CZ6 A;  1SMT A;  1A35 A;  1HBX G;  1B8I B;  1P9Q C;  1XB4 A;  2J5O A;  4G6T B;  3W2V A;  1YHQ I;  5LHI A;  3S1M J;  2R5Y B;  2JK3 A;  3TL4 X;  4DZP A;  5AIQ A;  3BTC A;  4UVB A;  5LGN A;  3PUF A;  4CIC A;  5GTI C;  3OYI A;  3RSN A;  1D5V A;  2VE9 A;  2MH9 A;  2PQ8 A;  3RYP A;  4BQA A;  2WB1 N;  3J7Y J;  2KFD A;  1YS7 A;  3OYC A;  3LSP A;  2K4J A;  3RYR A;  1X4P A;  3TW7 A;  5D4S A;  3J80 K;  1OLT A;  3HC7 A;  1LKX A;  3RKW A;  2IRF G;  4WXC A;  5FRO A;  2VIX A;  2YR2 A;  4XR6 A;  3G4S I;  3HOW J;  3NAR A;  3I53 A;  1MDM A;  1HF0 A;  1NK3 P;  4IHY A;  2EIN H;  2VBW A;  2OC6 A;  1MJA A;  1J59 A;  2DPU A;  3Q0U A;  5KNL A;  4IOA F;  1KQ0 A;  1R9T J;  2MC4 A;  4DGW B;  3WTV C;  2FJ1 A;  4CO8 A;  2BVL A;  2MAB A;  4HX7 A;  3S2W A;  2PX9 A;  4ZYH A;  2XIG A;  3GFM A;  2VLA A;  3QP6 A;  2R7Q A;  4C2U A;  2I10 A;  4DOZ A;  3G1O A;  4BH9 A;  2DA3 A;  2WV0 A;  1W7P B;  1Z3Y A;  3BDD A;  3L7W A;  4QSH A;  1RNL A;  5GPA A;  3E97 A;  3CJT B;  3ERM A;  2FSW A;  1QPI A;  5A2Q Z;  3CCU I;  3HRM A;  5J8F A;  4X6A J;  5IT9 K;  3O3K A;  2HEO A;  3H9Q A;  3CC4 I;  1FTT A;  1Z67 A;  2M9H A;  2MYS A;  1W5T A;  4RLF A;  1JTY A;  1SFK A;  5FRM A;  3IHU A;  2QZ8 A;  2GBY A;  5BS6 A;  4IOC F;  1NTC A;  3MCZ A;  4B47 A;  4Y13 A;  1LVA A;  2ME0 A;  2KIS A;  2X6O A;  1QVT A;  4DYQ A;  2QSG X;  2YX7 A;  2VOD A;  2DDB A;  3U1D A;  2MLG A;  1ZRF A;  3ZRG A;  4ZH4 F;  2JRT A;  3ABL H;  5EYR A;  2M2E A;  5IP9 J;  1W0U A;  1DP3 A;  5JLX A;  5H2F C;  5K5R A;  5F64 A;  2KKO A;  1B6A A;  2DFE A;  4L9J A;  4HBL A;  1G3S A;  1APL C;  1FT9 A;  5E17 F;  1P7I A;  1UG2 A;  1SD6 A;  2K02 A;  3FXR A;  2JSC A;  4EM1 A;  4KT6 A;  2BVM A;  5LRR A;  1IN7 A;  2L7Z A;  2KDO A;  3HZJ A;  4PUS A;  1N77 A;  2LBF A;  1MMD A;  1JKQ C;  1DUX C;  3J7A O;  4OWR B;  2CQQ A;  2BV6 A;  4V2F A;  3I55 I;  1R49 A;  1C0W A;  3PFI A;  3DKW A;  2YSR A;  3VOE A;  4B43 A;  2O03 A;  3HPG A;  4CH7 A;  3CMY A;  3VPR A;  2FBH A;  2XGE A;  1HA8 A;  4DBR A;  4KA4 A;  4ENM A;  2EV5 A;  2YUS A;  1QNT A;  5TGT A;  3OYD A;  1XGO A;  4YG2 F;  1FSH A;  4G7O F;  2VOP A;  1FMW A;  1KYW A;  4GYI A;  3G6E I;  2PN6 A;  4QPO A;  4ZZL A;  1WJE A;  3CP8 A;  4BJ5 C;  2HZT A;  5D6F A;  1A6Q A;  4F91 B;  2E1M B;  3T5X A;  5FKM A;  2K3P A;  1SFU A;  4A3E J;  1BI3 A;  4BQN A;  5C3E J;  1EV7 A;  2D45 A;  2JA7 J;  1SEU A;  4HLY A;  2D5V A;  1WWX A;  3TGN A;  1T8I A;  4CYC B;  3IP4 B;  5L3C A;  3H5N A;  3PQK A;  5BPI A;  3KP2 A;  1W5C C;  4GFB A;  2XAH A;  5E1W A;  5HOD A;  4V2G A;  1TWA J;  4JOM A;  2FD5 A;  2NXN B;  2ZME C;  3I56 I;  3HOV J;  2R7W A;  4L18 B;  1GLN A;  4WK8 F;  2L9V A;  4GO1 A;  1GVD A;  3KIO A;  3BG7 A;  2L2O A;  2LDU A;  1MBE A;  2IS6 A;  2BE5 F;  3QU6 A;  3GBG A;  3GXO A;  4BAY A;  3BZK A;  2RQQ A;  3I4N J;  1DGR M;  1TNS A;  2IXS A;  3A0B C;  1OPC A;  3CLQ A;  2P8T A;  4XL9 A;  1YJ9 I;  5HLT A;  4XLE A;  4C30 A;  4HLX A;  4BHB A;  4C9Y A;  2EZL A;  2M4K A;  3FXO A;  2DA4 A;  4I99 C;  4LG3 A;  3P9K A;  4YRV A;  2Z33 A;  2Z9O A;  1IUY A;  1HKT A;  3MN2 A;  1BW5 A;  3KEY A;  2NVQ J;  1GT0 C;  1ZAO A;  4A3D J;  2CRG A;  3DTE A;  3C2B A;  2FOK A;  5IYD J;  1E0E A;  1BI1 A;  2XKP A;  3LQQ A;  1DGW Y;  1QPM A;  2DJN A;  2V9P A;  2WAE A;  4B48 A;  3V8K A;  3FXQ A;  1VQ4 I;  1TLH B;  1IG7 A;  1WH7 A;  3M3Y J;  1FOX A;  1REP C;  1HC8 A;  2KHM A;  5CLS A;  3IWZ A;  5FKL A;  4OIR F;  2QF7 A;  1RZ4 A;  5K7F A;  3TED A;  4LK0 F;  3ZQL A;  4BE2 A;  2HTS A;  4I09 A;  2DI3 A;  3CF2 A;  3VEP A;  1UHM A;  2Y9Y A;  4OU0 A;  2CU7 A;  3TOA A;  4DW6 A;  3OYB A;  1H0M A;  3QPH A;  3LSM A;  4A0X A;  2F4M B;  1DPR A;  4MFD A;  1EH8 A;  3EQL F;  2DYS H;  1YI2 I;  2HVR A;  1Y6I A;  3BJA A;  1LDD A;  3QOD A;  3IUO A;  1R36 A;  5HLG A;  5FLM J;  1Y1V J;  2R5Y A;  4I98 B;  2UXN A;  4IPA A;  2B63 J;  1ZEL A;  3OYE A;  5E3O A;  3DEU A;  2JMW A;  3QRF F;  1O3S A;  1MZB A;  4JP0 A;  2JQ7 A;  3CC7 I;  3IRR A;  2LF8 A;  1ZRD A;  1PP8 F;  1FOK A;  4WF2 A;  2IT0 A;  2QBY B;  1YO5 C;  1VND A;  3F21 A;  2DJI A;  3L00 A;  3J7A Y;  3E0J B;  3CO7 C;  4P5O A;  2ESN A;  1MGT A;  5CVU A;  4M73 A;  3JRB A;  4G7H F;  3KZZ A;  2MLK A;  3JAM Z;  1J75 A;  1JGG A;  2DA6 A;  2X4H A;  3JRA A;  2LKS A;  4RM2 A;  5ICE A;  1XTA A;  3G1L A;  1IRZ A;  2P7V B;  4LMY A;  1LPQ A;  2Y2Z A;  4Y15 A;  1IXC A;  5TRD A;  1EA3 A;  4FHT A;  4AC0 A;  3HOX J;  4BE0 A;  2H8R A;  3S1Q J;  3CQZ J;  1HW5 A;  2QQB A;  2P5K A;  1VI0 A;  3JR9 A;  1HDD C;  3K69 A;  1GXQ A;  2ZSH B;  3GZ5 A;  3LSK A;  4MNU A;  5E3N A;  1FX7 A;  2P0W A;  1Y1W J;  4UUS A;  1WJ5 A;  2L7F P;  3V7R A;  3I58 A;  2W7N A;  3MKL A;  3TDU C;  3WTY C;  5J1U A;  1BR4 A;  4KIT B;  5HDK A;  1MKM A;  3LFK A;  2LTP A;  3OOU A;  4AIH A;  3MFK A;  2VC0 A;  1W36 D;  2ZJ2 A;  1JUM A;  4XKW A;  3I59 B;  3ISP A;  1U5T A;  2HKO A;  3C7J A;  3V4G A;  2E1C A;  2DK5 A;  3KE2 A;  2MGQ A;  4E7H A;  1WSU A;  1MMA A;  3F23 A;  2NOJ B;  4LLG F;  1ZAR A;  3UKG A;  1WPK A;  4F52 A;  2V79 A;  3KLN A;  4E7S A;  3QPT A;  4HG2 A;  1JHH A;  1N25 A;  5FLX Z;  2VJ5 A;  3WU1 B;  5B1A H;  1I5Z A;  5K5O A;  4RS8 A;  3HKZ N;  2IVM A;  3H35 A;  2XGC A;  1G59 A;  1O7L A;  4M3E A;  5E8I A;  1UMQ A;  2EFO A;  1BOB A;  3IH4 A;  3BY6 A;  2CH0 A;  3R61 A;  1NG7 A;  3Q0V A;  3OSG A;  3ELK A;  5L3B A;  4P1W A;  3FXK A;  3DU6 A;  3K4C A;  2E1N A;  4UV9 A;  2CW0 F;  3DPL C;  5FJ8 J;  2EH3 A;  2QGU A;  4EJO A;  1JGS A;  1FSE A;  1XSD A;  4A12 A;  4NHJ A;  3QQA A;  4CA0 A;  2W82 A;  1ZTR A;  3U9G A;  4MHG A;  2XF6 A;  1S5L C;  1Y0N A;  3TO9 A;  2Y9Z A;  4OMZ A;  3WTW C;  2R7U A;  1M1E B;  1IDY A;  3QAH A;  1D0X A;  4HSR A;  3WTU C;  3L2V A;  2ZC2 A;  4G7Z F;  1J9I A;  1D3Y A;  1G3W A;  1U6G A;  1Z05 A;  2Q8K A;  3DEW A;  1FYK A;  2RV8 A;  1H89 C;  2K40 A;  3RJP A;  4F7Z A;  1DQU A;  2NNN A;  2COM A;  2XHK A;  4KYW A;  2M3A A;  2JUC A;  3MQ0 A;  2LLK A;  4UVA A;  4O3M A;  3PO3 J;  3K2Z A;  1IRF A;  1ERD A;  3S93 A;  2RNG A;  4MLO A;  1RRJ A;  3HSR A;  1I39 A;  2DT7 B;  2GM4 A;  1IN5 A;  2HYG D;  3CTA A;  1OKR A;  5HDN A;  2F5D A;  3K4M A;  2M7A A;  1QO0 D;  3M7G A;  4EGY A;  4CZZ A;  2HVS A;  2CMP A;  2A6E F;  2EJR A;  2BGC A;  3BR5 A;  4A3J J;  1QHH D;  5CVR A;  1WKM A;  3D5R C;  2A61 A;  4HA8 A;  1JUS A;  3E1S A;  4CHU A;  3K70 C;  4A2U A;  4ABZ A;  1G8X A;  4KMF A;  2XDV A;  3VYS B;  1R5I D;  1D0Y A;  3T1B A;  3K7A J;  1IRG A;  5TIS C;  1DP7 P;  3ERE D;  4BNC A;  2K85 A;  1JKO C;  1MJ9 A;  1T95 A;  1WJF A;  5AON A;  1XPX A;  5FGM A;  5J4Y A;  1YE9 A;  4NQW B;  1X1A A;  5LFA A;  5CVI A;  2MC3 A;  4CZC A;  2VKD A;  1QA6 A;  4MGR A;  2GOX B;  2XPW A;  2DDA A;  5FD6 A;  3ZMU A;  3G73 A;  1FBS A;  3TKY A;  2ZB9 A;  5EZG A;  2AO9 A;  3ZQF A;  3B02 A;  2VJ4 A;  2FXA A;  1K83 J;  2BYV E;  4AVP A;  3W6J B;  2GZW A;  1BN5 A;  3I4P A;  1YS6 A;  3AG1 H;  5FFX A;  4HF1 A;  5IP6 A;  1XX5 A;  1ETY A;  2Q1Z B;  2COB A;  2HDW A;  4UUS B;  3WTT C;  2PG4 A;  2J5P A;  4AIJ A;  2MD5 A;  4M9S A;  1B72 B;  2E2I J;  1R1T A;  3M1E A;  3GFL A;  4IVN A;  4B09 A;  3OOP A;  3AFH A;  4M3B A;  2EB7 A;  4BXF A;  2E7X A;  2H1K A;  2M8G X;  5FKO A;  2M0C A;  4PFO A;  3M1C A;  1XC5 A;  1YX3 A;  3BC8 A;  1BW6 A;  2ECC A;  2LKX A;  3TP0 A;  2K5C A;  4MQV A;  2GAU A;  2IGO A;  4A3C J;  1U9O A;  1RPW A;  1VF9 A;  2W84 A;  1XS9 A;  4X0G A;  4I76 A;  2R0Q C;  3JRG A;  4LB5 A;  2O0Y A;  1NH3 A;  2BHZ A;  4ZC3 A;  4Y33 A;  1E2X A;  4D5C A;  4LLN A;  3GZN B;  2L02 A;  1V5F A;  4XRM A;  1OYW A;  3I9V 2;  4HX8 A;  4NB5 A;  3ZXS A;  2ELH A;  3REO A;  1WHU A;  2F2E A;  1D8K A;  4IHX A;  3E6D A;  2ZJQ F;  1FEX A;  5DS9 A;  2L9S A;  1HOM A;  3LST A;  3U21 A;  2FUG 2;  3V7S A;  5IYC J;  4E7K A;  5E1Z B;  4LFU A;  5BNG A;  3LMM A;  4WCG A;  1GHC A;  4EJV A;  5LGU A;  4BY7 J;  2DPD A;  5DUK A;  1BR1 A;  1H9G A;  2IAI A;  1BIB A;  2QSF X;  2PI0 A;  4D5F A;  2VAS A;  2E1M C;  1Y56 A;  3GME A;  2JA2 A;  4U87 A;  3HB9 A;  1W36 C;  4WXH A;  4BJT A;  3TP3 A;  4QIW N;  4HDV A;  5D8K B;  1FPQ A;  3BPV A;  2CV1 A;  1SD4 A;  2CUZ A;  3BR0 A;  4HAM A;  3MVP A;  2F5F A;  1VTN C;  1ZGJ A;  3LSR A;  1S7A A;  4PGG A;  4U88 A;  3VB2 A;  2XAJ A;  3PM1 A;  4BXX J;  4RMN A;  5HLH A;  3FK6 A;  2QUF A;  3H5R A;  1LFP A;  4TV7 A;  5DD4 A;  1WH5 A;  2OF7 A;  3M8J A;  3TW6 A;  5BPD A;  2KJB A;  1MDM B;  4F92 B;  4ZYA A;  3K9T A;  3ABU A;  1RKW A;  1K61 A;  1CGP A;  3J80 Z;  1D1B A;  3RQI A;  3BOQ A;  3TQN A;  2KPM A;  1UFM A;  3J81 Z;  3Q0W A;  2L4M A;  4IF4 A;  5LRS A;  4BE1 A;  5ED4 A;  1MMS A;  4D7N A;  4B44 A;  1XCB A;  2VN2 A;  5D5V B;  1YLF A;  2LRE A;  2KZV A;  2LYC A;  2E5N A;  2BXY A;  3C2H A;  5EZH A;  1S3J A;  2ZCW A;  1X3U A;  3R6S A;  3LA2 A;  1I27 A;  3I3L A;  2D1V A;  3CP2 A;  1QU3 A;  2X9D A;  3H9J A;  3U1K A;  1ULY A;  3M4O J;  3EUA A;  1WI9 A;  1ODD A;  2Z3Y A;  1Z1D A;  3KEQ A;  2HFH A;  4RAZ A;  3JRC A;  2DW4 A;  2DBB A;  2DT6 A;  3DPU A;  1U78 A;  3OS2 A;  3H36 A;  2GOM A;  1QRY A;  1SAU A;  3CUQ A;  2A6T A;  3C1D A;  3Q9V A;  1OJL A;  4LG0 B;  3D5L A;  1XGS A;  3NWT A;  4FCY A;  2B7E A;  4UNO A;  3VYU B;  1V4R A;  1WFX A;  4HNT A;  1QVU A;  2Q2E A;  2QCO A;  1WZ2 A;  4A3F J;  3DBH B;  1IW7 F;  1QZE A;  3SQN A;  1MBK A;  1A04 A;  5IY5 H;  1YFH A;  4XSZ F;  1ZRC A;  3E5U A;  2VQC A;  3CJR B;  3DP7 A;  3JSO A;  1XD7 A;  2L9N A;  1OR7 A;  2OA4 A;  5H20 A;  2RN7 A;  3BG3 A;  1GV2 A;  1TWH J;  2LFB A;  2M7B A;  1DU0 A;  2HYF A;  2RNJ A;  2L54 A;  3K4N A;  2OUM A;  4UHT A;  3KEO A;  2XAU A;  4EQQ A;  3L2R A;  1ZRE A;  3H3Z A;  2XSJ C;  1UCR A;  2IS1 A;  4Q47 A;  4RM3 A;  5J40 A;  2OCE A;  4DYC A;  3HJE A;  2W57 A;  4M3F A;  1ON2 A;  2V1D A;  5ERI A;  3Q5F A;  2NVU B;  4YEL A;  1RUO A;  3GFJ A;  2LP0 A;  5FKN A;  2VJJ A;  4N9I A;  3VFZ A;  3CCJ I;  1IV6 A;  2PEX A;  1Y8Q B;  1ACI A;  1MND A;  1KQ9 A;  2O3F A;  1U9N A;  3A0H C;  3HXL A;  2DT5 A;  1BIA A;  3TDZ C;  3IRQ A;  3CD6 I;  3CCS I;  1BI2 A;  1ZR4 A;  2MH2 A;  5CJ9 A;  3RPU A;  3DXJ F;  3TBI A;  3PQJ A;  1XSV A;  1LFU P;  4IHW A;  2HNH A;  2LY9 A;  1IUF A;  4ZJZ A;  3AG3 H;  4XIC A;  4RGS A;  3HOT A;  4LB6 B;  2XUB A;  1FIP A;  3TMO A;  1R71 A;  3OYK A;  3P9I A;  1TBX A;  3KYC B;  4HPQ A;  5HS7 A;  4E6K G;  4KFC A;  2LD5 A;  4RB3 C;  4IKF A;  1EH7 A;  3DEE A;  2V4J C;  5GPC A;  3BG5 A;  2W24 A;  5J6X A;  2Z16 A;  2OTL I;  4UUV A;  2DTZ A;  4N4O B;  4A0Z A;  4OIQ F;  1R7J A;  5DD8 A;  2VQG A;  3EUH C;  2KIM A;  2YPR A;  2V9K A;  2HQ5 A;  1X1C A;  4LK1 F;  1RR8 C;  3FKJ A;  1T6S A;  3RPU D;  3VSK A;  2IGN A;  1HQC A;  4ZZD A;  2GA1 A;  3KLO A;  3VOD A;  4NC8 A;  2VJI A;  1OCR H;  1TZL A;  4RA2 A;  1IC8 A;  2JSP A;  1V55 H;  5EG0 A;  2EIL H;  1AOY A;  4BYY A;  3MEX A;  1AWC A;  3QP5 A;  2VB6 A;  2ELK A;  1P7J A;  2LF7 A;  2DOA A;  3E7L A;  3CUQ C;  4NNJ A;  3RIR A;  4XM3 A;  2HDC A;  3W2A A;  3AL0 C;  1T2K A;  3WGI A;  4HRI A;  1HKQ A;  2OBP A;  3ABM H;  5LHH A;  1TNT A;  2E1O A;  4IEJ A;  4KJZ A;  1LVK A;  3PL8 A;  4IJA A;  2HPM A;  1VQ9 I;  2NRA C;  3KP5 A;  2P81 A;  3KYD B;  4A6E A;  1K6Y A;  2X6X A;  1I50 J;  1IDZ A;  1JT0 A;  4P9F A;  1K79 A;  5HLI A;  1W7P D;  3E6B A;  3M8E A;  2QM3 A;  4ZYE A;  4L0Y B;  1ETW A;  3ABT A;  4KNY A;  1U0J A;  2IA0 A;  3OYF A;  2L7M P;  1PYV A;  2UZK A;  3OIO A;  4M6X A;  4XLN F;  1VZ0 A;  4M71 A;  2IBD A;  2NS7 A;  3C3W A;  2E36 A;  2R7V A;  2A3S A;  4FE7 A;  2F4I A;  2GXA A;  1UHW A;  4JX4 A;  4CCO A;  3PJR A;  1BBY A;  2OV7 A;  2VQH A;  3DLA A;  1K6O A;  2ISZ A;  4CCJ A;  1MJB A;  5ILV A;  3GEZ A;  2EWN A;  4Y3O A;  1EF4 A;  2X0L A;  3VYR B;  3BPX A;  3LWF A;  2V6C A;  1BOA A;  4IHV A;  5LGT A;  3HPH A;  5FO5 A;  2FF4 A;  4DNC A;  1BC8 C;  2I5U A;  1LFB A;  4IRG A;  4IL6 C;  3CME I;  4CYC A;  2LMD A;  2RAE A;  5CQE A;  1BJZ A;  1H8A C;  4P96 A;  4JK1 X;  1OCT C;  2O9L A;  1T0F A;  2JWT A;  2UXX A;  3IH3 A;  2M87 A;  4D0P A;  3GTJ J;  4L9V A;  1YG2 A;  2LC2 A;  3DF8 A;  4C3H J;  2ADU A;  1I3A A;  1FMV A;  3LFU A;  1T0F C;  2M8E A;  3QOP A;  4A5M A;  4ON0 A;  3AL0 B;  3GTQ J;  3MZ8 A;  3OSF A;  2X51 A;  3E5Q A;  3FF5 A;  4KN7 X;  3ROU A;  4Z6Y A;  2NVT J;  2ZXJ A;  3MKZ A;  2UV1 A;  1ZG5 A;  4PJL A;  1ZKG A;  2CFO A;  2DCE A;  3OYM A;  3HSF A;  2F48 A;  4KIG A;  4AVZ A;  5LD2 C;  1RUN A;  4UY8 I;  4OIP F;  4Y52 J;  1DU6 A;  2F4O B;  3HRU A;  4BHP A;  2WTE A;  4XLP F;  2F5C A;  3HBL A;  2EPF A;  2JVH A;  1T56 A;  4BBR J;  5D8L B;  4RLQ A;  3HL2 A;  4A3K J;  2FRH A;  2Q2E B;  4PDK A;  2GWR A;  2RGV A;  2P5L C;  1SD7 A;  2HQR A;  1J7K A;  4R1H A;  2W4S A;  2E7W A;  3OS1 A;  1WQ2 A;  4GDF A;  4F55 A;  2ME6 A;  2Z1D A;  3DPT A;  3F8B A;  1BI0 A;  2NNY A;  2JA5 J;  3EDP A;  4ESF A;  4AUX A;  3LNQ A;  4LG0 A;  2LG4 A;  3NRV A;  5K5Q A;  3OIQ A;  5EEG A;  1XGN A;  1T38 A;  1AKH A;  4FT8 A;  4X1E A;  4YFN F;  1YW7 A;  4MIM A;  1BL0 A;  4MEX F;  1CQT A;  4A3G J;  2RRE A;  5LEK A;  2NS8 A;  2PFB A;  1VFC A;  1LDJ A;  4XRS G;  5F04 A;  1J5Y A;  2DOD A;  3JRD A;  1Z7U A;  1XMA A;  3FXJ A;  4I2O A;  1XG1 A;  1A31 A;  4YFK F;  4G6D A;  1JT6 A;  3WOD F;  3FX3 A;  4ZTF A;  2OZU A;  1G2H A;  3F8F A;  1Y8R B;  3S14 J;  4KIS A;  4A93 J;  1U8R A;  2FE3 A;  3B6A A;  5CPR B;  3ZP5 A;  3LA7 A;  4HDU A;  1X2N A;  2DMU A;  2VC1 A;  1PUF B;  2E2H J;  3ZQG A;  4AU7 A;  1P6R A;  4M9Z A;  1EH6 A;  3BTJ A;  4HNU A;  3X2Q H;  3S2H J;  5GTH C;  2RKH A;  3BR6 A;  1MMG A;  2CFX A;  1R23 A;  2K9Q A;  2BY2 A;  3S2D J;  1YRN A;  4D7M A;  4DQ2 A;  3BQY A;  1MW7 A;  3BJO A;  3OR2 C;  2XAQ A; 
#chains in the Genus database with same CATH homology
 2P4W A;  1BM9 A;  3DFG A;  5ICF A;  5DCF A;  2A69 F;  2O8X A;  4RAY A;  2A68 F;  2FQ3 A;  5LHG A;  2LSO A;  4E70 A;  3FHZ A;  1H9T A;  2DQL A;  3CLO A;  3BWG A;  3SZT A;  3I59 A;  3NQO A;  1IXS B;  1LEB A;  4L0Z B;  2CWE A;  5KVR A;  1U5T B;  2FMY A;  2OAZ A;  4M6Y A;  2FBK A;  1YW9 A;  1T98 A;  4HW0 A;  2HQN A;  2O61 A;  4OOI A;  1IN6 A;  3IWF A;  1YW8 A;  5HDG A;  2KIU A;  4OIO F;  3N4M A;  4YIF A;  5DEQ A;  1FY7 A;  3WE2 A;  2VXZ A;  1ZLJ A;  1S6L A;  3GVA A;  2PMH A;  1RI7 A;  1XN7 A;  3T0Y A;  2PBI A;  1P4W A;  5D5X B;  2H6B A;  1OYI A;  2M1B A;  5DV5 A;  1IZ1 A;  2XRN A;  5E8G A;  4RGR A;  3H92 A;  2ISY A;  1QZZ A;  4EM2 A;  1S7O A;  2BBY A;  2ESH A;  2Y0M A;  3RDI A;  1Z6T A;  5L3F A;  4N9H A;  2XV4 S;  2G9W A;  3WGG A;  2DQR A;  1BC7 C;  5FLX K;  3ZMS A;  2FA5 A;  2MA3 A;  2DK8 A;  4U7B A;  4A6D A;  3WTX C;  4MTD A;  1YYV A;  3LA3 A;  1ZH5 A;  2LNB A;  4HQE A;  4WWC A;  4B8X A;  1PUE E;  2V1U A;  5JFR A;  1F1Z A;  1B4A A;  6PAX A;  1Z9C A;  2L01 A;  4PZJ A;  2CG4 A;  4HX4 A;  1ZYR F;  3P7N A;  4P55 A;  1J0R A;  1KU7 A;  3GX4 X;  4HV6 A;  1JXS A;  5D5U B;  4M74 A;  3LQR A;  1FNN A;  1XGM A;  1V3F A;  4L5I A;  4YFX F;  5FFZ A;  4IRI A;  1HSJ A;  4ESB A;  5LEJ A;  2VBX A;  1ZG3 A;  2QEN A;  4GGG A;  4Q4Z F;  4GXO A;  3M9A A;  3QU3 A;  2EFQ A;  2H94 A;  5TJJ A;  3FM3 A;  2YU3 A;  1JE8 A;  2F5E A;  3FM5 A;  4U0V A;  2IPQ X;  1LB2 A;  3SZP A;  4YII A;  3ZMD A;  4ENN A;  3GF2 A;  3D0S A;  4KIB A;  5ILS A;  2M30 A;  5JR3 A;  1FYL A;  1NHA A;  3FXU A;  2JT1 A;  3RPQ A;  4EM0 B;  2ZO4 A;  1F9N A;  3HTU A;  3F6O A;  2MBF A;  3L9F A;  2L4A A;  2GIV A;  2IJL A;  5J8C A;  4CYD A;  1J2X A;  4ENK A;  1JHF A;  1TW3 A;  2P5V A;  4WX9 A;  5F1R A;  5LLQ A;  1GXP A;  2IA2 A;  1W5S A;  2M5W A;  4R79 A;  1SFX A;  1TW2 A;  3T8T A;  3KP7 A;  1WRJ A;  3WG9 A;  2QVO A;  1FLI A;  1YIO A;  4EJT A;  4G6Q A;  4CDG A;  1QQI A;  3HYI A;  3WTZ A;  2P7C B;  2AS5 F;  2CQK A;  1ONV A;  2VT3 A;  1B9N A;  2ETH A;  1S29 A;  3WU0 A;  3CO6 C;  3AAF A;  5FB2 A;  2LKP A;  2DO7 A;  2VBY A;  4Q5S F;  3WE3 A;  3CUQ B;  3W6K B;  1O3R A;  3TOB A;  5ICC A;  3KP6 A;  1L3L A;  5HOO A;  2HWV A;  3T8R A;  4EMS A;  2EK5 A;  3DQV C;  3J81 K;  3GWZ A;  3R0J A;  4CGZ A;  2ZNY A;  4JBA A;  4QLC U;  5DCM B;  1DDN A;  4AIK A;  2R7F A;  1XDS A;  1T39 A;  3NEU A;  2XVC A;  2XAS A;  4LLL A;  2OD5 A;  2B0L A;  2OZ6 A;  1BJA A;  3GW2 A;  3F8C A;  3KP3 A;  4Z2Y A;  2IA1 A;  1I1S A;  1QGP A;  1U2W A;  1TQI A;  4HYE A;  5L3D A;  4EVI A;  2PJP A;  2ZKZ A;  1ON1 A;  2VBZ A;  2ZME A;  2G7U A;  3FMS A;  4OMY A;  3BZ6 A;  3R4K A;  1SMY F;  1R1U A;  3EUH A;  2W25 A;  3ECH A;  3KCC A;  1LQ1 A;  3P9C A;  4FX0 A;  2K86 A;  2VE8 A;  1K7A A;  1PDN C;  5D4R A;  2VOO A;  3N97 A;  4G9Y A;  4HF2 A;  4KMU X;  1MD0 A;  3JTH A;  4G94 A;  5AIP A;  1I1G A;  2EA2 A;  3GUD A;  2QQ9 A;  1YQA A;  2VT2 A;  3B73 A;  1I6X A;  2XAF A;  1G3T A;  4RB2 C;  4H0E A;  4U0Y A;  5L3E A;  4A5N A;  4I01 A;  2IW5 A;  2ZFW A;  4ENJ A;  1FC3 A;  4KUM A;  4S05 A;  4AD9 A;  5DYM A;  3KET A;  3TO7 A;  4EJU A;  4RB0 A;  3V8L A;  1SAX A;  1TTY A;  1L0O C;  4CXF A;  4LJZ F;  3EYY A;  2IP2 A;  2HS5 A;  2XGX A;  1P4X A;  5H6R A;  4PGH A;  4KIC A;  1P2F A;  3HTS B;  3M8F A;  2EV0 A;  1KA8 A;  3E6C C;  2CYY A;  4FX4 A;  5JI6 A;  3I71 A;  5ILU A;  4R8H A;  2RDP A;  1OMI A;  1W7P A;  3HSE A;  5E20 A;  5EEH A;  4RB1 A;  4GYG A;  3K1P A;  2DAO A;  3GZ6 A;  5F6F A;  3HOS A;  1IN4 A;  4ESJ A;  1DPU A;  3ZN0 A;  5E1X A;  4ASN A;  5LBQ A;  1B9M A;  1O57 A;  4OIN F;  2OQR A;  2QQA A;  4Y17 A;  2STT A;  1HW2 A;  1LJ9 A;  3BRO A;  1P4A A;  2CGP A;  2Z5U A;  4HOB A;  2YX4 A;  2K4B A;  1FZP B;  1OYY A;  1IN8 A;  1SD5 A;  4EV0 A;  2ZBK A;  4XSX F;  3WTS C;  2EA4 A;  4I0B A;  1QZY A;  2DLL A;  3O2P E;  1G6N A;  1G4D A;  5L3G A;  1LEA A;  2H6C A;  5DCM A;  2H09 A;  1FP1 D;  5BOX A;  3BP8 A;  2G7H A;  2FBI A;  1XSX A;  1E17 A;  1R5G A;  3IL2 A;  3CDH A;  2CSO A;  5A2Q K;  4IRH A;  4UVC A;  4K2E A;  5IT9 Z;  2XRO A;  2C6Y A;  3E5X A;  2ACJ A;  1CF7 B;  2GQQ A;  3Q9S A;  3EET A;  4N0B A;  3GFI A;  4Q48 A;  2DFI A;  1U3E M;  1STZ A;  1ZHF A;  2ZME B;  2Y48 A;  3KP4 A;  1FBQ A;  3RKX A;  2EV6 A;  3C18 A;  5HVQ C;  4HZF A;  1Y0U A;  1KU2 A;  2VON A;  2NAZ A;  4IHS A;  2JZY A;  3HUG A;  4GCV A;  3I54 A;  2L3D A;  5DDG A;  3ZMV A;  3E3V A;  3GYH X;  3K1M A;  5BQT A;  1O3T A;  4L9N A;  4L9T A;  3IKV A;  3SXY A;  4MQ9 F;  2OQG A;  1P92 A;  3ZQ7 A;  3G3Z A;  2A5Y B;  4WXD A;  5KK1 A;  3BJ6 A;  3O6B B;  4UXN A;  2QBY A;  1XDU A;  3IC7 A;  1RIO H;  1KU3 A;  1HXD A;  1LNW A;  2P6T A;  2M45 A;  1F5T A;  2NS0 A;  2RQP A;  2TDX A;  4QWQ A;  1XCV A;  1YTY A;  3U2R A;  5CYV A;  3I64 A;  2GXB A;  1Q1H A;  3RI4 A;  5D6E A;  2HTJ A;  3HHG A;  2Y75 A;  4IXA A;  3JTG A;  3ZPL A;  1HKS A;  1Z6R A;  1TQM A;  4U0W A;  4LGW A;  2FU4 A;  1USS A;  1CF7 A;  3FZV A;  4BXU A;  4KN4 X;  3KFW X;  2QWW A;  2V9V A;  5H6Q A;  3F6V A;  5ICG A;  1ZGA A;  3L2C A;  4MTE A;  4AWX B;  3TO6 A;  3F8N A;  4KT5 C;  3HRT A;  1U5T C;  5DUI A;  3R60 A;  2GXG A;  3K0L A;  2QLZ A;  4ZYG A;  2Q0O A;  1IXR C;  2RVC A;  2KRF A;  3MZH A;  1K78 B;  4P9U A;  1HST A;  3LAJ A;  5D5W B;  3JAM K;  5K1Y A;  1IAW A;  2FNA A;  4EJW A;  3SFZ A;  1O7F A;  2UWM A;  2OU2 A;  3OV8 A;  2EFW A;  1IF1 A;  1B59 A;  3F22 A;  4RGX A;  2RC4 A;  2HOE A;  5JHU A;  2DU9 A;  2W85 A;  2A6H F;  2PMU A;  3RKY A;  5BMZ A;  3LAP A;  2JPB A;  1R22 A;  1B1B A;  2WC2 A;  4XBF A;  1FYM A;  3ZMZ A;  5CVJ A;  2QYO A;  1PP7 U;  1XMK A;  4L5J A;  3COA C;  3R0A A;  3EYI A;  4XRF A;  4U7D A;  1QBJ A;  4A0Y A;  2STW A;  2R3S A;  4I0A A;  1Z91 A;  3GLX A;  4HQM A;  1KQ8 A;  2HR3 A;  3F8M A;  1KGS A;  1S8N A;  3ZN1 A;  4O6J A;  3WGH A;  2D1H A;  2Z99 A;  1ZG1 A;  3H3U A;  2R7D A;  2K27 A;  3FWE A;  5E18 F;  4KIF A;  1KU9 A;  2JPC A;  2PLY A;  2AXL A;  3F72 A;  2XAG A;  3JSP A;  3IKT A;  1FBU A;  4ZYD A;  4I7H A;  4M72 A;  2H27 A;  3HRS A;  1R5H A;  2EFN A;  4UV8 A;  4IHT A;  3SHF A;  2FNP A;  2KJC A;  2V1X A;  1SFE A;  5HS9 A;  3E6M A;  1KYZ A;  4EGZ A;  4MEY F;  5JVT A;  1TQP A;  1R58 A;  1K78 A;  2BEO A;  3ML6 A;  5FD5 A;  2JTV A;  4G8X A;  2GA2 A;  3I5U A;  3GO5 A;  2ZNZ A;  4ETS A;  5CVV A;  4NQW A;  1UST A;  2KIF A;  2HGC A;  4HV5 A;  4RGU A;  2FEZ A;  3CUO A;  4JQF A;  3FMR A;  3DV8 A;  2NYX A;  3KZY A;  3RTR A;  3K1N A;  1ZN2 A;  2D2W A;  3I0T A;  3ULQ B;  3ZMT A;  1HW1 A;  4I02 A;  2A07 F;  3JW4 A;  4KDP A;  2WWY A;  1UB9 A;  1R1V A;  3V7C A;  3L09 A;  1GVJ A;  2K7L A;  3MZY A;  4LD5 A;  1R00 A;  5HS8 A;  2HKX A;  1F4K A;  4M9X A;  3MWM A;  3HHH A;  5IT3 A;  3MAJ A;  1O3Q A;  2CO5 A;  4O5V A;  2EFP A;  1FP2 A;  3CJN A;  2DTR A;  2O6G E;  3F3X A;  4BHC A;  3V8J A;  1G3Y A;  4PCQ A;  4S04 A;  1LDK B;  1W4M A;  1FWZ A;  2FML A;  2XKO A;  4HF0 A;  1D8J A;  2P6S A;  3FMQ A;  3HIF A;  3ECO A;  1SMT A;  1HBX G;  1XB4 A;  2J5O A;  5LHI A;  5LGN A;  5AIQ A;  4UVB A;  4CIC A;  1D5V A;  2VE9 A;  2MH9 A;  2PQ8 A;  3RYP A;  4BQA A;  1YS7 A;  2K4J A;  3RYR A;  5D4S A;  3J80 K;  3RKW A;  2IRF G;  4WXC A;  2YR2 A;  3I53 A;  1MDM A;  2VBW A;  1MJA A;  1J59 A;  2DPU A;  1KQ0 A;  3WTV C;  4CO8 A;  4HX7 A;  3S2W A;  4ZYH A;  2XIG A;  3GFM A;  3QP6 A;  4BH9 A;  2WV0 A;  1ZLK A;  1W7P B;  3BDD A;  3L7W A;  1RNL A;  3E97 A;  2FSW A;  5A2Q Z;  3HRM A;  5J8F A;  5IT9 K;  3O3K A;  2HEO A;  1W5T A;  3IHU A;  2QZ8 A;  5BS6 A;  3MCZ A;  4Y13 A;  1LVA A;  2YX7 A;  2VOD A;  3U1D A;  2MLG A;  1ZRF A;  4ZH4 F;  2JRT A;  5K5R A;  5F64 A;  2KKO A;  1B6A A;  4L9J A;  4HBL A;  1G3S A;  1FT9 A;  5E17 F;  1SD6 A;  2K02 A;  3FXR A;  2JSC A;  4EM1 A;  5LRR A;  1IN7 A;  1DUX C;  3J7A O;  2BV6 A;  1C0W A;  3PFI A;  3DKW A;  2YSR A;  3VOE A;  2O03 A;  2FBH A;  4KA4 A;  4ENM A;  2EV5 A;  1QNT A;  1XGO A;  4YG2 F;  1FSH A;  4G7O F;  2VOP A;  1KYW A;  4GYI A;  2PN6 A;  4ZZL A;  2HZT A;  5D6F A;  3T5X A;  1SFU A;  1BI3 A;  1EV7 A;  2D45 A;  4HLY A;  1WWX A;  3TGN A;  5L3C A;  3PQK A;  5BPI A;  3KP2 A;  2XAH A;  5E1W A;  4L18 B;  4WK8 F;  4GO1 A;  2LDU A;  2BE5 F;  3QU6 A;  4BAY A;  3GXO A;  1TNS A;  1OPC A;  2P8T A;  4HLX A;  4BHB A;  2Z9O A;  3P9K A;  2Z33 A;  1IUY A;  1HKT A;  1ZAO A;  2FOK A;  1BI1 A;  2XKP A;  3LQQ A;  1QPM A;  3V8K A;  3FXQ A;  1TLH B;  1REP C;  5CLS A;  3IWZ A;  4OIR F;  1RZ4 A;  4LK0 F;  2HTS A;  4I09 A;  2DI3 A;  3VEP A;  1UHM A;  4OU0 A;  3TOA A;  1H0M A;  3QPH A;  4A0X A;  1DPR A;  1EH8 A;  3EQL F;  3BJA A;  1LDD A;  1R36 A;  5HLG A;  4I98 B;  2UXN A;  4IPA A;  3DEU A;  3QRF F;  1O3S A;  1MZB A;  3IRR A;  2LF8 A;  1ZRD A;  1PP8 F;  1FOK A;  4WF2 A;  2IT0 A;  2QBY B;  1YO5 C;  3F21 A;  3L00 A;  3CO7 C;  4P5O A;  2ESN A;  1MGT A;  5CVU A;  4M73 A;  4G7H F;  3KZZ A;  2MLK A;  3JAM Z;  1J75 A;  2X4H A;  5ICE A;  2P7V B;  4LMY A;  4Y15 A;  1IXC A;  5TRD A;  4FHT A;  1HW5 A;  2QQB A;  2P5K A;  3K69 A;  1GXQ A;  3GZ5 A;  4MNU A;  1FX7 A;  3V7R A;  3I58 A;  3TDU C;  3WTY C;  5HDK A;  1MKM A;  3LFK A;  4AIH A;  3MFK A;  2VC0 A;  2ZJ2 A;  3I59 B;  3ISP A;  1U5T A;  2E1C A;  2HKO A;  3C7J A;  3V4G A;  2DK5 A;  3KE2 A;  1WSU A;  3F23 A;  4LLG F;  1ZAR A;  2V79 A;  3KLN A;  3QPT A;  1JHH A;  5FLX Z;  3WU1 B;  1I5Z A;  5K5O A;  4RS8 A;  2IVM A;  1O7L A;  5E8I A;  2EFO A;  3BY6 A;  3R61 A;  3ELK A;  5L3B A;  2E1N A;  4UV9 A;  2CW0 F;  3DPL C;  4EJO A;  1JGS A;  1FSE A;  1XSD A;  4A12 A;  4NHJ A;  3U9G A;  4MHG A;  3TO9 A;  4OMZ A;  3WTW C;  3QAH A;  3WTU C;  4G7Z F;  1J9I A;  1D3Y A;  1Z05 A;  1G3W A;  1U6G A;  2Q8K A;  1FYK A;  2RV8 A;  3RJP A;  4F7Z A;  2NNN A;  2COM A;  2XHK A;  4KYW A;  3MQ0 A;  4UVA A;  4O3M A;  3K2Z A;  1IRF A;  3HSR A;  1IN5 A;  2HYG D;  3CTA A;  1OKR A;  5HDN A;  2F5D A;  4EGY A;  1QO0 D;  3M7G A;  4CZZ A;  2A6E F;  2EJR A;  2BGC A;  5CVR A;  1WKM A;  4HA8 A;  2A61 A;  4CHU A;  4A2U A;  4KMF A;  3T1B A;  1IRG A;  1DP7 P;  3ERE D;  4BNC A;  1MJ9 A;  5AON A;  5FGM A;  5CVI A;  2MC3 A;  4MGR A;  5FD6 A;  3ZMU A;  3G73 A;  1FBS A;  3TKY A;  3B02 A;  2FXA A;  4AVP A;  2BYV E;  3W6J B;  2GZW A;  1BN5 A;  5FFX A;  1YS6 A;  3I4P A;  4HF1 A;  3WTT C;  2PG4 A;  2J5P A;  4AIJ A;  2MD5 A;  4M9S A;  1R1T A;  3M1E A;  3GFL A;  4IVN A;  4B09 A;  3OOP A;  2EB7 A;  2E7X A;  4MQV A;  2GAU A;  2W84 A;  4LB5 A;  2O0Y A;  1E2X A;  4LLN A;  2L02 A;  1OYW A;  4HX8 A;  4NB5 A;  2ELH A;  3REO A;  2F2E A;  1D8K A;  3E6D A;  3LST A;  3V7S A;  5E1Z B;  4LFU A;  4WCG A;  1GHC A;  4EJV A;  5LGU A;  2DPD A;  5DUK A;  2PI0 A;  1H9G A;  1BIB A;  4WXH A;  4HDV A;  5D8K B;  1FPQ A;  3BPV A;  1SD4 A;  4HAM A;  2F5F A;  1VTN C;  1ZGJ A;  1S7A A;  4PGG A;  4U88 A;  3VB2 A;  2XAJ A;  5HLH A;  2QUF A;  4TV7 A;  5DD4 A;  1MDM B;  5BPD A;  2KJB A;  3K9T A;  3ABU A;  1CGP A;  3J80 Z;  3BOQ A;  3TQN A;  1UFM A;  3J81 Z;  2L4M A;  4IF4 A;  5LRS A;  5ED4 A;  1XCB A;  2VN2 A;  5D5V B;  1YLF A;  1S3J A;  2ZCW A;  1X3U A;  3R6S A;  3LA2 A;  1I27 A;  2D1V A;  1ULY A;  1WI9 A;  1ODD A;  2Z3Y A;  1Z1D A;  3KEQ A;  2HFH A;  4RAZ A;  2DW4 A;  2DBB A;  1U78 A;  3CUQ A;  3C1D A;  3Q9V A;  4LG0 B;  3D5L A;  1XGS A;  4UNO A;  1V4R A;  2Q2E A;  1IW7 F;  3SQN A;  1YFH A;  1A04 A;  4XSZ F;  1ZRC A;  3E5U A;  3DP7 A;  3JSO A;  1XD7 A;  1OR7 A;  2OA4 A;  5H20 A;  2RN7 A;  2HYF A;  2RNJ A;  2L54 A;  4UHT A;  3KEO A;  4EQQ A;  1ZRE A;  3H3Z A;  1UCR A;  4Q47 A;  2W57 A;  1ON2 A;  2V1D A;  5ERI A;  3Q5F A;  1RUO A;  3GFJ A;  4N9I A;  3VFZ A;  2PEX A;  1KQ9 A;  2O3F A;  2DT5 A;  1BIA A;  3TDZ C;  3IRQ A;  1BI2 A;  2MH2 A;  5CJ9 A;  3RPU A;  3DXJ F;  3PQJ A;  1XSV A;  4RGS A;  3HOT A;  4LB6 B;  2XUB A;  3P9I A;  1TBX A;  5HS7 A;  4KFC A;  4RB3 C;  1EH7 A;  2W24 A;  5J6X A;  4UUV A;  4A0Z A;  4OIQ F;  1R7J A;  5DD8 A;  2KIM A;  2YPR A;  4LK1 F;  1T6S A;  1HQC A;  4ZZD A;  2GA1 A;  3KLO A;  3VOD A;  1AOY A;  4BYY A;  3MEX A;  1AWC A;  3QP5 A;  2LF7 A;  3CUQ C;  3RIR A;  2HDC A;  1T2K A;  3WGI A;  1HKQ A;  2OBP A;  5LHH A;  1TNT A;  4IJA A;  2NRA C;  3KP5 A;  4A6E A;  4P9F A;  1K79 A;  5HLI A;  1W7P D;  3E6B A;  3M8E A;  2QM3 A;  4ZYE A;  4L0Y B;  3ABT A;  4KNY A;  2IA0 A;  2UZK A;  4M6X A;  4XLN F;  4M71 A;  3C3W A;  2A3S A;  1UHW A;  1BBY A;  1K6O A;  2ISZ A;  1MJB A;  5ILV A;  3GEZ A;  2EWN A;  2X0L A;  3BPX A;  3LWF A;  2V6C A;  1BOA A;  5LGT A;  5FO5 A;  2FF4 A;  4DNC A;  1BC8 C;  4IRG A;  4P96 A;  4JK1 X;  1T0F A;  2UXX A;  2M87 A;  4D0P A;  4L9V A;  1YG2 A;  3DF8 A;  2ADU A;  2M8E A;  3QOP A;  4A5M A;  4ON0 A;  3E5Q A;  3FF5 A;  4KN7 X;  3ROU A;  2ZXJ A;  1ZG5 A;  3HSF A;  4KIG A;  1RUN A;  4OIP F;  3HRU A;  4BHP A;  2WTE A;  4XLP F;  2F5C A;  5D8L B;  2FRH A;  4PDK A;  2GWR A;  2RGV A;  2P5L C;  1SD7 A;  2HQR A;  4R1H A;  1J7K A;  2E7W A;  1WQ2 A;  3DPT A;  3F8B A;  1BI0 A;  2NNY A;  3EDP A;  4ESF A;  4LG0 A;  5K5Q A;  3NRV A;  5EEG A;  1T38 A;  1XGN A;  4FT8 A;  4YFN F;  1YW7 A;  4MEX F;  5LEK A;  2PFB A;  1LDJ A;  1J5Y A;  1Z7U A;  1XMA A;  4I2O A;  4YFK F;  4G6D A;  3WOD F;  3FX3 A;  2OZU A;  3F8F A;  1U8R A;  2FE3 A;  3ZP5 A;  3LA7 A;  4HDU A;  2VC1 A;  1P6R A;  4M9Z A;  1EH6 A;  2RKH A;  2CFX A;  1R23 A;  4DQ2 A;  3BJO A;  2XAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...