3M8EA

Protein structure of type iii plasmid segregation tubr
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
101
Chain Sequence
HHHHFYTLNIAEIAERIGNDDCAYQVLMAFINENGEAQMLNKTAVAEMIQLSKPTVFATVNSFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKAMEMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative DNA-binding protein
publication title From the Cover: Plasmid protein TubR uses a distinct mode of HTH-DNA binding and recruits the prokaryotic tubulin homolog TubZ to effect DNA partition.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Dna binding protein
total genus 28
structure length 101
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3m8eA00
2MBFA 3REOA 3F21A 1SD4A 2QVOA 4L9JA 4MTDA 2RVCA 4O6JA 1XCBA 4KA4A 2KRFA 2QM3A 3MZHA 3T8RA 1ZLKA 2RDPA 3C18A 3HOTA 2W57A 5K1YA 4ETSA 4LB5A 3BY6A 5AIPA 4IRGA 4WCGA 4EM2A 5DD8A 3MZYA 2Z9OA 3Q9VA 5J8CA 3TOAA 1G6NA 2HEOA 1D3YA 1ULYA 2DQLA 4KICA 4OIQF 4CDGA 3DQVC 4N9IA 4A0YA 1B59A 3IRQA 2B0LA 4LLNA 1R5GA 2XKPA 3R4KA 3MFKA 2L3DA 1PDNC 1BC7C 1TTYA 3HUGA 1YW7A 3U9GA 4L0ZB 5DUKA 5AIQA 4RGSA 1MDMB 4MQVA 4ZH4F 5BPIA 2HKXA 3VB2A 2ACJA 1SMTA 2STWA 4CO8A 3NQOA 3HYIA 1SD5A 5CVJA 4P5OA 4B8XA 1FP1D 2ZNZA 1RNLA 5DDGA 4ON0A 2RNJA 2RGVA 3WTTC 2H27A 1BIAA 4LG0B 5DV5A 4LK1F 1JE8A 2ZO4A 3LQQA 4HAMA 1G3YA 4DQ2A 2H94A 2E1NA 3DEUA 3P9CA 5F6FA 1MZBA 1KA8A 4AIHA 1MJAA 1ZYRF 2GA2A 2GXGA 2VE9A 2J5OA 1L0OC 2FBIA 4GCVA 4UVBA 2Z3YA 1S29A 2ESNA 1FP2A 3HSEA 4WF2A 2MD5A 3FWEA 2PMUA 3LA7A 4PZJA 1S7OA 4M9ZA 3KLOA 3HSFA 2XROA 3QPTA 1FBSA 1XSVA 2BBYA 2UXNA 4RB0A 4Y17A 4OIRF 4IPAA 3KETA 4RGUA 2VXZA 1GXPA 3FMSA 4CHUA 3P9KA 3PFIA 2HKOA 3COAC 2ZKZA 1LJ9A 2RQPA 5E17F 3IKTA 4M74A 2G7UA 2JPBA 4IXAA 5L3GA 1J2XA 1J5YA 2L4MA 5LLQA 3FF5A 1U8RA 2FEZA 3NRVA 3L09A 1FYLA 2PLYA 3PQJA 4XLNF 1FLIA 3FM3A 3H3UA 4WXCA 3H92A 3KP4A 4I98B 2OZ6A 3LQRA 1DP7P 3I53A 4IF4A 3ECOA 3GW2A 2Q8KA 5ILUA 1R1UA 4KYWA 2XVCA 2EFPA 4HF1A 3GLXA 4BYYA 4U0YA 2DFIA 4G94A 2R7DA 2X4HA 4Q48A 3E6CC 4DNCA 3KCCA 1SMYF 4UXNA 1HKTA 2L54A 3EYIA 4G6QA 1FSHA 4I0AA 1I6XA 2EFQA 5DEQA 2EV5A 3ZMUA 3JAMZ 5HS9A 1W5SA 5LHIA 1IAWA 2BE5F 1BIBA 1XSXA 1UFMA 3QU6A 1BI3A 3AAFA 5DCFA 1ZRDA 1FT9A 4WK8F 2M1BA 3R61A 2QQ9A 3VOEA 4EJUA 1DPUA 1X3UA 1F5TA 1YIOA 3MAJA 1G3WA 5A2QZ 3N97A 4ASNA 2CW0F 1O7FA 1D8JA 1KU9A 3F8CA 3H3ZA 1XDSA 2M5WA 1K6OA 4M6XA 1T6SA 1HKSA 2EA2A 4HQMA 4A0ZA 3LWFA 2ISZA 1BI1A 4XBFA 3IHUA 3CUOA 2O3FA 4WWCA 3QOPA 2K27A 4G9YA 3I58A 4PGHA 1KGSA 3KFWX 2OZUA 2OBPA 3W6KB 1FOKA 4D0PA 2XUBA 2K02A 3HRUA 3GFLA 4N0BA 1MJBA 3F6VA 2IP2A 1S8NA 1PP8F 3IWFA 5LHHA 4G7HF 1KQ0A 1TNSA 1O7LA 5AONA 1KU3A 3WTSC 4ZYGA 1R5HA 3EETA 3I0TA 1LDDA 1SFEA 4ZYDA 3LFKA 2RV8A 1ZN2A 1R23A 5FLXK 3BPVA 1J75A 4HDVA 1SFXA 1BJAA 1P6RA 4KMUX 3DPTA 5K5QA 1HW2A 2FF4A 3Q9SA 4EGYA 2FBHA 5HLGA 1WRJA 3T1BA 1Z9CA 2UXXA 2PFBA 4RGXA 3J80Z 3OOPA 3QRFF 2G9WA 1O3SA 3ERED 4A12A 1I1SA 2IJLA 1R22A 2QLZA 2IT0A 2KKOA 5D6FA 3V8KA 1IN5A 3QP6A 3E6MA 1Z7UA 3KZYA 4LLGF 5E1ZB 1QQIA 1YW8A 1BBYA 4BHPA 1MJ9A 3RPQA 2VN2A 3ISPA 1STZA 5CVVA 3V8LA 2QWWA 1MGTA 3MWMA 3V8JA 4BXUA 4L0YB 3O6BB 1MD0A 1FYMA 4AIKA 4U7BA 4EVIA 1IN7A 4EV0A 1OPCA 5D4RA 2XAQA 4CICA 2WV0A 1W7PD 2XRNA 5DYMA 2VODA 2W24A 4PCQA 5TJJA 4MGRA 4PDKA 5DD4A 2DAOA 3SZTA 2QZ8A 4UV9A 3CO6C 2L02A 5F64A 3QU3A 1RUOA 2JSCA 3FZVA 4LMYA 2FOKA 3RIRA 4G6DA 4KN4X 1TLHB 1OYIA 1EH6A 2QYOA 1YG2A 2EA4A 2F5FA 5JFRA 4P55A 1XMAA 2V6CA 4ZYHA 5IT9K 1HBXG 1F4KA 5LGNA 1HSJA 2P6SA 2EV0A 3ZMSA 3L2CA 1SD7A 4HF2A 1V3FA 5EEHA 3L9FA 1ON2A 1LDKB 2EJRA 1XDUA 3F3XA 3HRSA 2LF8A 1OYWA 3GO5A 1R58A 1IUYA 4HX8A 3VODA 2OD5A 1BC8C 1BOAA 4YFXF 1EH8A 3WGIA 3DF8A 2P4WA 1W7PB 1IRGA 2MLKA 3KP2A 3HTUA 3DPLC 3RYPA 2RN7A 1IF1A 4BQAA 4G8XA 3T5XA 4S04A 3VFZA 1Q1HA 3V7CA 2FMLA 4ZZLA 4OMZA 1CF7A 1O3RA 3CLOA 5LBQA 1Z1DA 1H9GA 5CVRA 4P9FA 2M45A 2QBYB 1QBJA 4PGGA 5FD6A 5H6QA 2BV6A 4A6EA 5ICGA 1KYWA 1QGPA 1U3EM 5BPDA 4MEYF 1O3TA 2NAZA 3SZPA 1LB2A 2FBKA 2Q0OA 1IZ1A 2JZYA 2WC2A 1HW1A 4HLYA 3TO7A 2QENA 2MLGA 1F1ZA 3DXJF 2K4BA 2AS5F 5KVRA 4FHTA 1XGSA 1TQPA 5FO5A 4TV7A 2V79A 5D5WB 1JHFA 3J81K 4EJVA 3N4MA 1XGMA 5ED4A 2FNPA 2KIUA 2LSOA 1XN7A 2OU2A 5ERIA 1HSTA 4GO1A 2O6GE 2GXBA 1L3LA 2HQNA 5ILSA 2HTSA 2PEXA 4M71A 3E5XA 1OMIA 2KJBA 2NYXA 4CZZA 2NNNA 1LEBA 2EFNA 2P5KA 1KQ8A 3F6OA 3MCZA 1PUEE 4YG2F 3FXUA 3T0YA 1UB9A 5HDGA 2Q2EA 2M30A 1GHCA 2A3SA 1QZYA 3DFGA 1ZHFA 1DUXC 2VBWA 4EJTA 2HGCA 2GAUA 4YIIA 1ZG1A 5DUIA 5BS6A 1B1BA 4IJAA 2VE8A 3R60A 4LB6B 2ELHA 1OYYA 5L3EA 4RB2C 4G7OF 1YYVA 3FMRA 3K69A 2P5VA 1I5ZA 2A61A 3CUQB 3ML6A 5KK1A 2XKOA 2UWMA 1GVJA 4HBLA 4M9XA 1W5TA 4EMSA 2HZTA 3JSOA 2VBZA 5HDNA 5FFZA 3C3WA 1OKRA 1FBUA 2OQGA 2QUFA 2HR3A 1FYKA 3GVAA 1H9TA 4I01A 1FZPB 3GEZA 2BGCA 2QQBA 2Z99A 5FB2A 3HTSB 1U5TB 2BYVE 3F8MA 3SHFA 5D5UB 1ONVA 3M1EA 2A68F 2RKHA 3G73A 1QNTA 3CDHA 3D0SA 2W25A 5DCMB 1QZZA 2TDXA 4I7HA 2VOPA 3DV8A 2P6TA 4LJZF 2DU9A 2K86A 5D8LB 4ENNA 2VT3A 1ZG5A 1KYZA 1LVAA 1MDMA 4HLXA 5E1WA 1ZRCA 1IRFA 5CJ9A 1S6LA 2Z33A 3E3VA 3FX3A 1Z05A 1GXQA 2IW5A 4RB3C 1HW5A 3RTRA 1DDNA 2FXAA 1BI0A 4WX9A 4Q47A 2ZMEB 4LG0A 1A04A 4EM1A 4I09A 1IN8A 2M8EA 2QQAA 4KIBA 3RPUA 2VC0A 5A2QK 3EDPA 1SFUA 4UUVA 1RUNA 3O2PE 2GA1A 3BP8A 2G7HA 3PQKA 4EJOA 1XD7A 2YX4A 1P2FA 1P92A 2FA5A 2DK8A 3BJ6A 4U88A 4EJWA 5L3CA 2PMHA 4AVPA 2ZJ2A 2KIMA 4A2UA 2W84A 5K5OA 3WTXC 4KDPA 3NEUA 1O57A 4BHBA 1DPRA 3JW4A 5CVIA 4F7ZA 1I27A 1UCRA 3GYHX 3CUQA 2Y48A 4U0WA 4OMYA 1G3SA 1KU7A 3BOQA 4MEXF 1E2XA 1U6GA 2A5YB 4HV6A 2GQQA 2IPQX 1IN6A 2D45A 4M9SA 2HYGD 1U78A 5LGTA 2AXLA 1J9IA 1P4AA 2XIGA 2GIVA 2EFOA 3FMQA 1ZLJA 4E70A 1I1GA 2V9VA 2XAGA 2BEOA 2H09A 2FE3A 1NHAA 3E6BA 1WKMA 2MH2A 1R00A 2HYFA 3J7AO 3VEPA 3KLNA 1YLFA 3GFIA 4GGGA 1KU2A 1K79A 4Q4ZF 1U5TA 2CSOA 2YSRA 4U0VA 3IKVA 2ZCWA 5DCMA 1ZREA 1LDJA 3K1PA 2F5DA 1HXDA 2PG4A 2GWRA 5CYVA 3BROA 1Z6RA 2LDUA 4ENMA 4IRHA 3MQ0A 4AD9A 1TQMA 3P9IA 4YFNF 1T98A 2XGXA 3ABTA 3HRMA 4S05A 1WWXA 2RC4A 2R7FA 2OAZA 3B02A 2E1CA 3ZMVA 2NS0A 1FSEA 1BM9A 1KQ9A 5LEJA 3FXQA 4M72A 5J6XA 4HF0A 2DBBA 3U2RA 2MA3A 3E6DA 3B73A 3OV8A 1VTNC 3T8TA 5FLXZ 4BH9A 4MNUA 2P8TA 3RKYA 4R8HA 5D6EA 3ROUA 4M73A 1Z91A 1LNWA 3ZP5A 3LA3A 1AOYA 2D1VA 2V1DA 1B9MA 1S7AA 4HX7A 3SQNA 5H6RA 5HOOA 4HQEA 4KIGA 1JHHA 2K4JA 2MH9A 4RAYA 4I2OA 2XASA 3KE2A 2YPRA 2EV6A 4R1HA 4IHTA 2HOEA 1Y0UA 4LGWA 2X0LA 1R36A 2XAHA 1IXRC 4N9HA 2O61A 4IHSA 3W6JB 5HS7A 5HS8A 2HTJA 1HKQA 3M9AA 4A5NA 3TGNA 3WGGA 1J59A 3HIFA 2XHKA 1YO5C 3CUQC 1XSDA 3WTYC 3G3ZA 4A5MA 1LEAA 1MKMA 5D5VB 3IWZA 3U1DA 4G7ZF 5D4SA 3GF2A 1P4WA 4A6DA 5CLSA 4OU0A 3E5UA 4FT8A 2NRAC 2CGPA 5IT9Z 3R0JA 1G3TA 4HA8A 5LEKA 4OIOF 2OA4A 4AIJA 1OR7A 3I54A 2FQ3A 1U5TC 1USSA 3WE2A 2IVMA 3HHHA 1WQ2A 1D5VA 3F8BA 3WTUC 2ETHA 5D8KB 4Q5SF 1BI2A 5IT3A 4ESJA 2XV4S 4EM0B 2CG4A 1U2WA 3ABUA 1K78B 4GYIA 3TQNA 1FNNA 2E7XA 2ZNYA 2PQ8A 4UVCA 3GUDA 4LK0F 4UHTA 2V1UA 3WTWC 4EQQA 2DTRA 2DQRA 3WU0A 3ZPLA 1JXSA 2VBXA 4JQFA 3K0LA 4FX4A 3EYYA 1IW7F 1RI7A 2HFHA 4ESFA 1T0FA 5J8FA 3LSTA 4XLPF 5E1XA 3SXYA 4P9UA 3RDIA 2DT5A 2PI0A 3QPHA 5LRRA 5JHUA 5H20A 4RS8A 2CYYA 4K2EA 2YU3A 3SFZA 3TDZC 1Z6TA 4GYGA 4LLLA 2FRHA 2FU4A 4L9NA 2HWVA 5JR3A 1XMKA 1USTA 2JTVA 4HV5A 5L3DA 4XSZF 4MHGA 3ZQ7A 3KZZA 2VC1A 5LGUA 1K7AA 3TO9A 4HZFA 1FY7A 1JGSA 4YIFA 4I02A 2DO7A 3J81Z 2VBYA 3BPXA 3GZ5A 4RGRA 4UNOA 2XAJA 4LFUA 3V4GA 4U7DA 4L5IA 2DW4A 1SD6A 3BDDA 3I64A 4CYDA 2ZFWA 3M7GA 1H0MA 3GX4X 2HDCA 2ZBKA 3JTHA 4QWQA 5ILVA 2V1XA 2DI3A 2F2EA 1FX7A 2JRTA 4KIFA 5HLIA 4MTEA 4QLCU 2CFXA 2WTEA 2P5LC 2E7WA 1W7PA 5HDKA 1PP7U 2IA1A 4O5VA 2XAFA 2ISYA 4ENKA 1YFHA 1LQ1A 2A6EF 3JSPA 2H6BA 5TRDA 1ZRFA 3ECHA 3CO7C 3F22A 3K1NA 3WODF 3BWGA 3KP3A 2MC3A 2QBYA 3TO6A 4JBAA 4XSXF 4ZZDA 1ZG3A 2YX7A 3GFJA 1TQIA 1S3JA 1K78A 3WTZA 4AWXB 1YS7A 1ZARA 3GWZA 2FSWA 3I59B 1ZH5A 1ODDA 3WTVC 4Y15A 4KFCA 2ADUA 4I0BA 3RKXA 3O3KA 1B4AA 1F9NA 1ZGJA 3F72A 3I4PA 4YFKF 3M8EA 3P7NA 5JI6A 2M87A 4KUMA 5HLHA 3V7RA 4KNYA 2JT1A 4KN7X 3GFMA 5L3FA 5E8GA 4L9TA 2DPUA 4MQ9F 4BHCA 3RYRA 4WXDA 1V4RA 5L3BA 5ICCA 2A69F 2COMA 2WWYA 3JAMK 3K1MA 2VT2A 3S2WA 2EFWA 4GXOA 3QP5A 3DP7A 3ZN0A 3Q5FA 5BQTA 4OIPF 1R1VA 2HS5A 4HW0A 2W85A 3TOBA 4CGZA 3I5UA 4L9VA 2EB7A 5FGMA 4B09A 1WSUA 3C1DA 2P7VB 3TKYA 5E18F 4XRFA 3GZ6A 3LAJA 3ZMTA 1IXSB 4LD5A 1HQCA 2PJPA 1G4DA 2A07F 2LKPA 4WXHA 1J0RA 3V7SA 4IVNA 1TW3A 1T39A 1XGNA 2CO5A 3C7JA 3JTGA 2IA2A 3KP6A 4Z2YA 2IRFG 4UVAA 1T2KA 3ELKA 3D5LA 2PN6A 4Y13A 3BJOA 3QAHA 1RZ4A 4NQWA 1XGOA 1C0WA 2STTA 2O03A 5F1RA 1UHMA 4OINF 1CGPA 2Y0MA 5HVQC 1E17A 1J7KA 2Z5UA 3F8NA 3KP5A 3I59A 3RKWA 1W4MA 3BJAA 1XB4A 2D1HA 4HYEA 3HRTA 2D2WA 1O3QA 4ENJA 4ZYEA 3WE3A 2OQRA 3TDUC 2H6CA 2FNAA 4M6YA 3FHZA 1ZAOA 1BN5A 1WI9A 3J80K 2C6YA 3F23A 5E8IA 5LRSA 5FD5A 3L00A 2YR2A 1P4XA 4L5JA 4CXFA 6PAXA 3HSRA 4R79A 4ESBA 2Y75A 2UZKA 1RIOH 3CJNA 3K9TA 1SAXA 3HHGA 3IRRA 2NNYA 4HDUA 4A0XA 1AWCA 1YS6A 2A6HF 4RAZA 3R0AA 1REPC 1XCVA 1CF7B 2EK5A 4KT5C 1YTYA 2O0YA 5BOXA 2ZMEA 2LF7A 4EGZA 1QPMA 2DPDA 1ZGAA 3KEOA 3L7WA 2VONA 5D5XB 3IL2A 2L4AA 3HOSA 3LA2A 2FMYA 1EH7A 3WU1B 4NHJA 2CWEA 2R3SA 2CQKA 2HQRA 3RJPA 1B9NA 3FM5A 5K5RA 3FXRA 2VOOA 1QO0D 1FWZA 5FFXA 3ULQB 4BNCA 1YW9A 3I71A 3KEQA 3M8FA 4HOBA 3E97A 4H0EA 3IC7A 3E5QA 5ICFA 2IA0A 1FC3A 3WG9A 4FX0A 1ON1A 2GZWA 3MEXA 2F5EA 1D8KA 5EEGA 3DKWA 2P7CB 4UV8A 3KP7A 2PBIA 4P96A 1YQAA 5CVUA 3LAPA 1UHWA 2K7LA 3ZMZA 4L18B 3R6SA 4RB1A 5JVTA 1FPQA 1R1TA 2J5PA 3GXOA 1IXCA 4OOIA 1R7JA 1IN4A 2O8XA 4HX4A 2EWNA 5E20A 3WGHA 4JK1X 1FBQA 1TBXA 2KIFA 4KMFA 4BAYA 4O3MA 2KJCA 2ZXJA 4IRIA 2DK5A 2LNBA 3EQLF 1TW2A 5BMZA 2JPCA 3BZ6A 5LHGA 1EV7A 2ESHA 3RI4A 5ICEA 3CTAA 3EUHA 1TNTA 3K2ZA 2L01A 1T38A 4NB5A 2F5CA 3ZN1A 3F8FA 1B6AA 2DLLA 3ZMDA
chains in the Genus database with same CATH superfamily
1WFXA 4C2UA 4A3MJ 2MBFA 3REOA 1JUSA 3F21A 1SD4A 3KYCB 3LSMA 5K7HA 1JJ8C 3FKIJ 2QVOA 2A05A 3VDXA 4L9JA 1MMAA 2KLOA 3CCMI 4MTDA 2R93J 2RVCA 4O6JA 1XCBA 4KA4A 2KRFA 2QM3A 3LMMA 3MZHA 3T8RA 1LFBA 2DJNA 1ZLKA 2RDPA 5GAGJ 3C18A 3HOTA 3J7YJ 1X58A 2R7OA 3BR6A 2AQEA 2W57A 2HOSA 1Q1VA 5K1YA 3L2RA 4LIVA 2FQ4A 3ZCOA 2YS9A 2LTPA 4ETSA 4LB5A 5FRMA 2LKXA 3BY6A 4V19K 3IUOA 5AIPA 3DBHB 4IRGA 4WCGA 4EM2A 5J40A 5DD8A 3MZYA 2Z9OA 3CQZJ 1MNDA 3OS0A 3Q9VA 5J8CA 5E3OA 3TOAA 1G6NA 1JT6A 2HEOA 1D3YA 2DOFA 1ULYA 1Y8RB 3MKWB 2DQLA 2XSDC 4KICA 1A6QA 4NC8A 4OIQF 2X6XA 4CDGA 3DQVC 3GTGJ 5KAFC 4N9IA 4A0YA 2L9SA 3S2HJ 1B59A 3IRQA 1JUMA 2B0LA 4LLNA 1R5GA 3K10A 2XKPA 2IGMA 1LE8B 3R4KA 3MFKA 2IS6A 2L3DA 1PDNC 1BC7C 1MMGA 1TTYA 3RZOJ 1DU6A 4PFOA 5EEAA 2DMUA 4J01A 1WJCA 4N4OB 3HUGA 1RKTA 1YW7A 3U9GA 4L0ZB 4BE0A 5DUKA 5AIQA 4M3EA 2HXOA 2ZSHB 4MQVA 4RGSA 5F0CA 4ZH4F 5BPIA 1MDMB 2HKXA 3VB2A 2ACJA 1SMTA 4XLHA 3CMYA 2STWA 1WPKA 5FKKA 3NQOA 3ZOBA 4CO8A 1ZGWA 3HYIA 1SD5A 5M3FJ 1XPXA 1BW6A 5CVJA 4P5OA 2K9SA 4B8XA 1FP1D 5JHFA 2ZNZA 1RNLA 4D5FA 5DDGA 5FJ8J 3AL0C 4ON0A 1IO2A 4E7JA 2HVSA 2RNJA 2VJ4A 1RC9A 2RGVA 3WTTC 2H27A 2X9DA 1F43A 1BIAA 4LG0B 3A4CA 1UG0A 5DV5A 2W7NA 4LK1F 1JE8A 2ZO4A 1J09A 3LQQA 4HAMA 4NBQA 3CLQA 2V4JC 1G3YA 2WY7Q 4DQ2A 2H94A 1XMXA 2E1NA 3DEUA 3P9CA 3E7LA 5J1RA 4DIQA 5F6FA 3P5JA 1MZBA 4BDZA 1KA8A 5EZGA 1KONA 4AIHA 1MJAA 1ZYRF 5GP9A 1X1DA 2GA2A 3HGYA 2GXGA 2VE9A 5JVGF 2J5OA 3S32A 4PJ0C 3V42A 1L0OC 2FBIA 5C44J 3G2BA 1YJWI 4GCVA 4UVBA 2Z3YA 1S29A 1T95A 2V1NA 2ESNA 1FP2A 3HSEA 4WF2A 1XG1A 1Y1VJ 2MD5A 4XKBA 3ZRGA 3LSPA 3IH3A 3FWEA 2PMUA 3LA7A 2MSYA 2M7BA 4PZJA 2IEKA 2LR8A 1S7OA 4M9ZA 2XPUA 3KLOA 3H5RA 3L2WA 2WADA 3HSFA 5M5YJ 2XROA 3QPTA 1FBSA 1XSVA 2BBYA 1E3PA 3D5RC 2UXNA 5C3EJ 4RB0A 2E1MC 3QPLA 3DTIA 4XOPA 4Y17A 4FASD 4OIRF 4IPAA 4G12A 3KETA 4RGUA 2Y9ZA 3IH4A 2VXZA 1GXPA 3FMSA 1Y1WJ 1VQ9I 4CHUA 2M3AA 1P9QC 3QODA 2CFOA 4IOAF 3P9KA 3OR2C 3PFIA 2HKOA 5JLXA 5FRNA 4YIRX 3COAC 2ZKZA 3L2QA 1LJ9A 3LSKA 2DYSH 2O8KA 3MZ8A 2RQPA 4RM2A 2QA4I 5C4JJ 5E17F 3IKTA 3LSIA 2G7UA 4M74A 2JPBA 3JRGA 4IXAA 5L3GA 1J2XA 4P1WA 1J5YA 2IS4A 1FOYA 2CV1A 2L4MA 3BTCA 2EPFA 5LLQA 3FF5A 3DCFA 1U8RA 2FEZA 3UKGA 5CQEA 1QVUA 3NRVA 3L09A 1JKQC 3RCOA 2KDZA 4BJ6C 5KCMA 1FYLA 2PLYA 3PQJA 4XLNF 1FLIA 4PJMA 3FM3A 2Q1ZB 2XB0X 4OAYA 2HYJA 4F91B 4MO7A 3H3UA 1Z3YA 4HPQA 2X1EA 4WXCA 3H92A 3KP4A 4I98B 2OZ6A 3QYEA 3C2HA 2L5QA 5F0FA 1ZELA 2HZDA 3LQRA 3OR1C 2LBFB 4D5CA 1DP7P 3BG9A 4XM3A 2KISA 3DPUA 3OS1A 3I53A 1Z3XA 4IF4A 3KYDB 3ECOA 2WAQA 3GW2A 2Q8KA 5ILUA 4ZDLA 1R1UA 3PSFA 3OYNA 3JRAA 4KYWA 4XRMA 4ZTJA 2XVCA 3ASNH 2E5ZA 4S0HB 2ZJQF 2EFPA 4HF1A 2KRCA 2WAQN 3GLXA 4BYYA 4U0YA 4B1RA 4RMNA 2DFIA 4G94A 2R7DA 2X4HA 4Q48A 5FKLA 3E6CC 1R71A 3C2GA 4DNCA 3KCCA 4IOCF 1SMYF 4UXNA 1HKTA 3CCUI 2L54A 4AC0A 3BT9A 3EYIA 2VPRA 4G6QA 1FSHA 5EG0B 1EKEA 2BOLA 4MIMA 3JRIA 3A0HC 4I0AA 1WZ2A 1X3WB 3HL2A 1MBFA 1I6XA 3UR3C 2EFQA 3W2VA 5JLWA 5DEQA 3ZGKA 2DA3A 2EV5A 3ZMUA 3JAMZ 3CMMA 4N4NB 5HS9A 1W5SA 5LHIA 1IAWA 3TL4X 2Y9YA 2BE5F 1BIBA 1XSXA 1WJ5A 1UFMA 2GBYA 3DBLB 4CUGA 4G6TB 4CYCA 3I9V2 1X1AA 3K4JA 3QU6A 1BI3A 2JVGA 2X51A 3AAFA 5DCFA 1ZRDA 1FT9A 4CSWA 4BS9A 2DN0A 3AG2H 4WK8F 2M1BA 2WB1A 2PJRB 3R61A 2QQ9A 3VOEA 4EJUA 1DPUA 2JSPA 4IZZA 1X3UA 1F5TA 1YIOA 3MAJA 1G3WA 3S16J 5A2QZ 1WGXA 1TWFJ 4HEA2 3N97A 5LFAA 4ASNA 2WB1N 2CW0F 4I76A 5CPRB 2ID3A 4LIUA 1O7FA 1D8JA 5F04A 1KU9A 3F8CA 3H3ZA 3PNVA 1XDSA 3MMYB 2M5WA 4NDLA 2R4GA 1K6OA 4M6XA 1T6SA 2JA5J 1HKSA 1IG7A 3CDIA 2EA2A 3A02A 1GV5A 3CCRI 2AO9A 2L7ZA 4HQMA 2XF5A 4A0ZA 3MKYB 3LWFA 2ISZA 1BI1A 4XBFA 2R7QA 2XF7A 3IHUA 3CUOA 1TT5B 2O3FA 2WV1A 4XNFA 4WWCA 3QOPA 1UZCA 2K27A 4G9YA 3I58A 4PGHA 1KGSA 4BL0B 3Q3SA 2DFEA 1NG7A 3KFWX 4B44A 4CCLA 2OZUA 3FXMA 2OBPA 3W6KB 1FOKA 4PK4A 1O4XA 3GBGA 2EILH 4D0PA 1WH7A 2JUGA 4II2A 4M3GA 2XUBA 3SEQA 2K02A 3HRUA 3GFLA 2WY8Q 4N0BA 1T8IA 1W0UA 1FIPA 1FMWA 1MJBA 3HXLA 3FKJA 4CH7A 3F6VA 2IP2A 1S8NA 1BJZA 3BTLA 1PP8F 2FD5A 2H8WA 3IWFA 1JI8A 5LHHA 2HI3A 4A3KJ 4G7HF 1KQ0A 1TNSA 3I4MJ 1O7LA 4MFDA 3FXKA 5AONA 4B47A 1KU3A 4D7MA 3WTSC 2QSGX 4ZYGA 3HM5A 3OY9A 1R5HA 3EETA 3I0TA 5TISC 4X0GA 3BR2A 2DT7B 2CQNA 5F08A 4FCYA 3SDGA 1LDDA 1SFEA 3HKZA 3I3LA 4ZYDA 4UB6C 4QTRA 4W1UA 3LFKA 2UUZA 3ZQLA 2NS7A 2RV8A 1ZN2A 1R23A 5FLXK 1G59A 3M4OJ 3H0DA 3VYSB 1MBEA 3BPVA 1J75A 3A1YA 1BL0A 4HDVA 1SFXA 3HKZN 1BJAA 2K9LA 1P6RA 1ZKGA 1I3AA 4KMUX 3ZQQA 3PNYA 1D1AA 3DPTA 3G4SI 3I4NJ 1LKXA 1OLTA 1R4NB 1X4PA 4PUSA 5K5QA 1HW2A 2FF4A 1R5ID 3Q9SA 4EGYA 2VPLA 2FBHA 3OIPA 5HLGA 2H1LA 2DA6A 1WRJA 2LY1A 3T1BA 1Z9CA 4A3CJ 5B5EC 1P7JA 2LMDA 2UXXA 1MMSA 2PFBA 4RGXA 4D7NA 3J80Z 4KISA 2KL4A 3OOPA 1TP4A 5IP6A 4PSXA 5HODA 3M07A 3QYFA 3QRFF 3AKZA 2W4SA 4DYCA 2G9WA 1O3SA 3ERED 4A12A 2KRHA 1I1SA 2IJLA 1R22A 2QLZA 2IT0A 2KKOA 5D6FA 3V8KA 1IN5A 3E6MA 1Z7UA 3QP6A 3KZYA 4LLGF 5E1ZB 1QQIA 1YW8A 2LVSA 1BBYA 4BHPA 1ETKA 1JTXA 2R7XA 1MBJA 1MJ9A 3RPQA 2F48A 2VN2A 3CCSI 2BZTA 3ISPA 1STZA 3AFHA 5CVVA 3V8LA 2QWWA 1MGTA 3S14J 3MWMA 3V8JA 1OISA 4DYQA 9ANTA 3VSKA 4BXUA 4L0YB 2VASA 5GTIC 2R7VA 2EH3A 1LVKA 2DMPA 3O6BB 1MD0A 2LLKA 1FYMA 3HPHA 4AIKA 4IHXA 4U7BA 3OYFA 4EVIA 1IN7A 4EV0A 1OPCA 3GTQJ 4C2MJ 2XAQA 4CICA 5D4RA 3GTMJ 4XLFA 3K70D 2WV0A 2OF7A 1W7PD 4JX4A 2XRNA 5IP9J 3G1OA 5DYMA 2KHMA 3H1CA 1FTTA 2Y2ZA 3WG7H 1W0TA 3CF2A 2CUZA 2VODA 2XGCA 2W24A 4PCQA 3BTIA 2E34A 4A93J 1S9HA 4ANJA 1T08B 1K6YA 5TJJA 4MGRA 3JRCA 3OYGA 4PDKA 3FXOA 1YE9A 5DD4A 3ABLH 2DAOA 3SZTA 2QZ8A 4UV9A 3CO6C 2L02A 1YI2I 2ZFUA 3G71I 1I39A 5F64A 4BU2A 1IDZA 3QU3A 3K7AJ 1B8IB 4ABZA 1RUOA 2JSCA 3FZVA 1BR4A 4LMYA 4RAGA 3OS2A 1Z21A 2GOXB 1IV6A 1QHHD 1U9NA 2FOKA 3RIRA 2ZB9A 3MN2A 4G6DA 2XPVA 4KN4X 1TLHB 1OYIA 3HB9A 1EH6A 2QYOA 1EJ9A 1YG2A 2EA4A 2R5ZB 2F5FA 5JFRA 1IDYA 4P55A 2DDAA 1XMAA 2V6CA 4ZYHA 5IT9K 4ZDPA 1HBXG 1F4KA 1N75A 2CV2A 3FDYA 5LGNA 5CQGA 1HSJA 1ZR4A 4IQ4A 1JJ6C 2P6SA 2B63J 2EV0A 3ZMSA 4XMYA 2K9QA 2VKEA 2Y30A 1X1BA 3L2CA 3OSGA 1SD7A 3JREA 4HF2A 3S2DJ 1V3FA 5EEHA 3L9FA 1ON2A 1LDKB 2EJRA 1P7IA 1XDUA 2ME6A 4E7ZA 3GZNB 2R7WA 2CRGA 3F3XA 3K4MA 3CC7I 3HRSA 2LF8A 4XN3A 1OYWA 3GO5A 1R58A 1MNEA 5J4VA 1IUYA 1Z7LA 4HX8A 3VODA 2OD5A 1BC8C 1BOAA 4MFEA 1RR7A 4YFXF 2KP6A 2BVMA 2P81A 3RKQA 1EH8A 2EQRA 3HDDA 3WGIA 3DF8A 2K9MA 4IL6C 2P4WA 1W7PB 2M8GX 4Z6YA 1VI0A 2M34A 2CQQA 3DLAA 4A3IJ 1IRGA 2K5CA 3OYMA 2MLKA 3KP2A 3QWLA 5IYDJ 1WJFA 3HTUA 3DPLC 3RYPA 1Y56A 2RN7A 1IF1A 4BQAA 4G8XA 3T5XA 4S04A 3VFZA 1Q1HA 3V7CA 2FMLA 3OOUA 2L9RA 3GTKJ 4ZZLA 4E7SA 2YU9J 2O5RA 4OMZA 1CF7A 1EF4A 1O3RA 3CLOA 5EDNA 5LBQA 1H88C 1Z1DA 1H9GA 2R0QC 5CVRA 2IGNA 3BZKA 3BLYA 5E79C 4P9FA 5KAIC 4XL9A 2M45A 2PMZA 1D1CA 2QBYB 1QBJA 4PGGA 4B3XA 2ECBA 4XKCA 4XRSA 4BXFA 3OSFA 3JRFA 5FD6A 5J1UA 5H6QA 1UAAA 4XORA 2R7TA 1XS9A 1TWAJ 2BV6A 3F0CA 1VNDA 4BQNA 2O9LA 2L7KA 4A6EA 5ICGA 1KYWA 1QGPA 2PMZN 1U3EM 5BPDA 3O8GA 4MEYF 1O3TA 2EBIA 2NAZA 3SZPA 1LB2A 5HLTA 2XRLA 2FBKA 4BQOA 1PYVA 3BG7A 3HBLA 2Q0OA 1IZ1A 4E7IA 2JZYA 2O7OA 2WC2A 1HW1A 3KPHA 4HLYA 1RR8C 4A3LJ 3TO7A 3JCUC 3U1KA 2QENA 4E7HA 2MLGA 1F1ZA 1ENHA 3DXJF 3H5NA 2K4BA 2AS5F 2OUMA 5KVRA 5M5XJ 2DYRH 4C9YA 4FHTA 1SAUA 1XGSA 4CZCA 1TQPA 2Z16A 4RAFA 1JKRC 4F93B 2E1OA 5FO5A 3JR9A 3DU5A 1UG2A 4TV7A 1D5YA 1N25A 2V79A 5D5WB 1JHFA 3GTJJ 4PFPA 2DFHA 1YX3A 3J81K 1V5GA 4EJVA 3N4MA 1XGMA 5ED4A 2FNPA 4A3JJ 2JA7J 2X6YA 2KIUA 2LSOA 1BR2A 1XN7A 3OYHA 1IJWC 2OU2A 2TCTA 3LSJA 5ERIA 3DWLE 3HC7A 1HSTA 3PJRA 4GO1A 1AA7A 4BGDA 2O6GE 2GXBA 1L3LA 1B8IA 3LSGA 3PNTA 1E3HA 2HQNA 2V9KA 5ILSA 2OJED 4C30A 2HTSA 2PEXA 4M71A 5GADJ 2W48A 1OMIA 3E5XA 1RESA 4BE1A 2KJBA 2NYXA 3OYCA 2D5VA 4DYRA 2VIXA 4CZZA 2DA7A 1MBHA 2NNNA 1LEBA 4FISA 3S1RJ 3EUKL 2HQAA 2EFNA 2P5KA 3OYJA 1KQ8A 3F6OA 3MCZA 1PUEE 4AU7A 3K4KA 4B48A 3ZQFA 3FXUA 4YG2F 1MBGA 5HNHA 3ABKH 3T0YA 1UB9A 5HDGA 1NH3A 3BTJA 2Q2EA 3AG4H 2MYSA 1ZR2A 2M30A 1NK3P 1GHCA 2X1CA 5EF6A 1VQ4I 1VQNI 3QYBA 1DP3A 1LPQA 2A3SA 1QZYA 3DFGA 1ZHFA 1DUXC 2VBWA 4EJTA 2HGCA 3PFYA 1GVDA 2GAUA 4YIIA 4AUXA 4CA0A 2BXZA 1ZG1A 1POGA 5DUIA 1UELB 5BS6A 3OYDA 1B1BA 2MD0A 2CQ7A 3CDLA 1VQMI 4IJAA 3CC4I 1WJBA 4BEHB 2KZVA 2VE8A 3DEWA 3R60A 4LB6B 3W6VA 4OAZA 2ELHA 1W1WE 1OYYA 2CW7A 2EIJH 5B1BH 2DFFA 5L3EA 4RB2C 4G7OF 1YYVA 3FMRA 4E6KG 3K69A 4ZDOA 3LOCA 3RQIA 2P5VA 1W36C 5BNGA 1I5ZA 2M9HA 2A61A 3CUQB 4AVZA 1JKPC 1QZEA 5GAEJ 2KDOA 3ML6A 5KK1A 2XKOA 2E2HJ 2UWMA 2Y0SN 1GVJA 4HBLA 4M9XA 4F55A 1W5TA 4EMSA 2HZTA 1TWCJ 3JSOA 4NQWB 2KT0A 2VBZA 2BVLA 5HDNA 3TP0A 5FFZA 1HOMA 4HNVA 3MKLA 3C3WA 1OKRA 2LOOA 3E0JB 1FBUA 3CMAI 4RA2A 5DM7F 2ELKA 3CP2A 2OQGA 2QUFA 2HR3A 4Y7NJ 1FYKA 4XRSG 3GVAA 2R7RA 1YHQI 2ZC2A 4XLCA 1PVEA 1H9TA 3Q0WA 4I01A 2GM4A 2XSJC 3VPRA 1FZPB 3GEZA 4M3BA 2HDWA 1OR7C 2F5VA 2BGCA 1FIAA 2JMWA 5GAHJ 2QQBA 1E3OC 1FJLA 2Z99A 5FB2A 2NXNB 3HTSB 2HU9A 1U5TB 2BYVE 3F8MA 3SHFA 5D5UB 1ONVA 3M1EA 4D9JA 2A68F 2RKHA 3LSHA 1QNTA 3CDHA 3G73A 3D0SA 1ITYA 1TWGJ 1SVMA 2W25A 5DCMB 2LY2A 3BZCA 2NVUB 2HNHA 3CCLI 1JKOC 1LE8A 1QZZA 2TDXA 4I7HA 4NC7A 2VOPA 4BJTA 1Z67A 3DV8A 2P6TA 2A6TA 2ME0A 4LJZF 4OWRB 3H35A 2DU9A 1BOBA 2K86A 5D8LB 4ENNA 1ZTRA 2VT3A 3DBRB 4LOCA 1APLC 1ZG5A 1KYZA 1LVAA 2EIKH 1MDMA 4HLXA 5E1WA 2CUFA 2VKVA 1ZRCA 1IRFA 5GPCA 3SDBA 5CJ9A 1S6LA 1SEUA 2Z33A 2L0KA 3E3VA 4X6AJ 3A01B 3FX3A 2Y31A 2NS8A 1T0FC 2BY3A 2XGDA 2VQCA 1Z05A 2H8RA 2COBA 1GXQA 2JJ7A 1Z77A 2E35A 2IW5A 4RB3C 1HW5A 2Z1DA 3RTRA 2M2EA 2QEXI 1DDNA 3BCBA 2FXAA 1VFCA 1AKHB 1BI0A 4WX9A 2DMQA 2ZMEB 4Q47A 4LG0A 1A04A 4ZTFA 4EM1A 4I09A 5FROA 1IN8A 2M8EA 2QQAA 3BG5A 4KIBA 3GTPJ 2LK2A 3RPUA 4BXXJ 4JYKA 2VC0A 3J7ZI 5A2QK 3EDPA 1SFUA 2DTZA 2L9NA 1H8AC 4UUVA 1RUNA 3SYTA 3O2PE 2OCCH 2LY9A 4H4KC 1VQLI 2M0CA 2EIMH 4M3DA 2GA1A 3BP8A 2G7HA 1ZK8A 2KMUA 3PQKA 4EJOA 3ASOH 2IGOA 2CQXA 4DOZA 1XD7A 2VL8A 1K83J 1GV2A 2YX4A 1P2FA 1P92A 2FA5A 3PM1A 2DK8A 3BJ6A 4XIDA 4U88A 4BEHA 4EJWA 1D0ZA 5L3CA 2PMHA 4AVPA 2W00A 2ZJ2A 2X1DA 2KIMA 2F6CA 3FXJA 4A2UA 2W84A 5K5OA 3WTXC 2JK3A 3RSNA 4KDPA 3NEUA 3TMOA 5J1YA 1O57A 4BHBA 1RRJA 1DPRA 3H36A 3JW4A 5CVIA 4F7ZA 5E3MA 2CUEA 1I27A 1UCRA 3GYHX 3FBNB 3CUQA 4E7LA 5IOYA 2Y48A 3MVPA 4U0WA 4DZJA 4OMYA 1G3SA 1KU7A 3JRHA 1NK2P 3BOQA 4MEXF 2AHQA 1Y6IA 1E2XA 1U6GA 3W2WA 2A5YB 5IYCJ 3ABMH 2IS1A 4HV6A 3VYRB 2GQQA 2IPQX 1F36A 1IN6A 2D45A 4M9SA 2HYGD 1U78A 1FMVA 5LGTA 4M6VA 2AXLA 4V2FA 4C3JJ 4UY8I 4KT6A 1J9IA 1P4AA 2XIGA 2GIVA 2EFOA 3FMQA 3GLLA 1ZLJA 1I3QJ 4E70A 1I1GA 2V9VA 2XAGA 1CQTA 2WAEA 2BEOA 2H09A 2FE3A 1NHAA 2BW3B 2VI6A 3E6BA 1WKMA 2MH2A 2R5YB 1VQKI 3N05A 1R00A 5DS9A 2HYFA 3J7AO 4L5EA 3VEPA 3FBIB 3CF5F 2LYCA 3KLNA 1YLFA 1Y8QB 3GFIA 4LG3A 5EYRA 5J4YA 2DODA 4GGGA 1T56A 2F4OB 1KU2A 4DJAA 1K79A 4Q4ZF 2IAIA 1GDTA 1BW5A 2VB6A 1U5TA 2DJIA 2CSOA 2YSRA 3VWBA 1V5FA 2DA2A 1B72B 1SANA 4U0VA 2HVRA 1H89C 3CZ6A 3IKVA 4BACA 2ZCWA 4DBRA 5DCMA 1ZREA 1MMDA 3L1PA 3BCAA 5J3LA 1LDJA 3K1PA 2F5DA 1HXDA 3QOEA 4BJ5C 2PG4A 4F52A 2GWRA 1HCRA 4IKFA 2IXSA 1QRYA 2JVHA 2EZLA 5CYVA 4KITB 3IH2A 3BROA 2IGKA 1Z6RA 4B43A 2LDUA 4ENMA 4IRHA 3MQ0A 4AD9A 1TQMA 3P9IA 3ZMDA 4YFNF 2XGXA 2K40A 2LBFA 1XTAA 2KIQA 3ABTA 1IUFA 3HRMA 4JP0A 1UHSA 2YUSA 3PO2J 3SEZA 2VQGA 4S05A 1WWXA 2RC4A 3PUFA 2R7FA 2OAZA 3B02A 2MABA 2Y69H 2EZIA 4M3FA 5EGOB 1LFUP 2E1CA 1S5LC 3G1MA 3ZMVA 2NS0A 1FSEA 1BM9A 1KQ9A 3A01A 3S8PA 3A0BC 1R6RA 1ETXA 5LEJA 3FXQA 4M72A 5J6XA 4HF0A 2R92J 2DBBA 1YIJI 1WJEA 3U2RA 2MA3A 2I5UA 3E6DA 3B73A 3OV8A 1VTNC 1AKHA 5EG0A 3T8TA 2JN6A 4QIWN 5FLXZ 3OWTA 4BH9A 4MNUA 1R9TJ 1V54H 2P8TA 2MC4A 1QPIA 3BR1A 3RKYA 2QKMB 4R8HA 5D6EA 3CC2I 2G0EA 3ROUA 4XK4A 4M73A 1Z91A 1LNWA 3ZP5A 1SFOJ 3LA3A 1AOYA 2D1VA 3IP4B 2V1DA 2FOWA 4RLFA 2IS2A 1B9MA 3B6CA 1ETYA 1S7AA 2EZKA 3ERMA 1YRNB 1V5EA 4HX7A 5H6RA 3SQNA 5HOOA 3LNQA 4HQEA 1MMNA 4KIGA 4XKVA 3AG1H 1JHHA 2PJRA 2K4JA 1TZLA 3C2BA 2MH9A 4AYBN 2XC7A 2CUJA 2H1KA 1QU3A 3JRBA 4RAYA 4HSRA 3JRDA 4I2OA 2XASA 3KE2A 2YPRA 5IYBJ 2EV6A 4R1HA 4IHTA 1X3ZB 2HOEA 4BUPA 3KEYA 4NC6A 2KFDA 1Y0UA 2QGUA 4LGWA 2X0LA 3Q0UA 3HEFA 2E36A 1R36A 2XAHA 1VQ6I 1IXRC 5E3LA 4N9HA 3ONQA 2BHYA 3LL7A 2O61A 5B3SH 2JQ7A 3BR0A 3H9GA 3OMYA 4IHSA 3WHCA 3W6JB 3HZJA 3HUGB 5HS7A 3SJMA 5HS8A 3H5AA 2HTJA 1HKQA 3M9AA 4A5NA 3TGNA 2I10A 2ZSIB 3K4BA 4XONA 3WGGA 3L2UA 3EUAA 1J59A 2BW3A 3OYLA 4DW6A 2R5YA 3HIFA 2XHKA 4FETA 1YO5C 3OIOA 3CUQC 1XSDA 5EZHA 3CMEI 3WTYC 1FTZA 3G3ZA 3QQAA 4KJZA 4A5MA 1LEAA 3HOXJ 1B72A 5K7ZA 3ZQIA 1MKMA 3DKYA 5D5VB 3BQZA 3IWZA 3U1DA 2DT6A 1JTYA 5D4SA 4G7ZF 3BR3A 3GF2A 2DXIA 3S1MJ 1P4WA 4A6DA 2JA6J 5CLSA 4OU0A 4XN0A 3E5UA 4FT8A 2X6WA 2ELJA 3S1QJ 1GUUA 2OPTA 2NRAC 2HQ5A 2CGPA 1X19A 5IT9Z 3ZXSA 4I6ZA 4GDFA 4I99C 3R0JA 1G3TA 4FQGA 4HA8A 5LEKA 4OIOF 1HC8A 1MSFC 1LUJB 2OA4A 4AIJA 3FK6A 1OR7A 3I54A 2FQ3A 3PUBA 3NAUA 1U5TC 3DTEA 2XAUA 3H9JA 1USSA 5EGOA 3WE2A 2AXTC 1MH3A 3ZR8X 3S3OA 2IVMA 3HHHA 1WQ2A 1FOWA 3HGGA 1D5VA 3F8BA 4AM3A 4Y4RA 3WTUC 2ETHA 2HVQA 4XR6A 5D8KB 3FK7A 1SVOA 4BDYA 4Q5SF 1BI2A 1E0EA 4DGWB 5IT3A 4ESJA 1N78A 1G8XA 2HXIA 2XV4S 4EM0B 2CG4A 1U2WA 4MLOA 3ABUA 2ID6A 5IP7J 1K78B 4GYIA 1OCCH 3TQNA 3J7AY 1FNNA 2E7XA 1OCOH 1AHDP 4F3QA 5FLVA 2ZNYA 3I56I 2PQ8A 2XB5A 4UVCA 1MBKA 2PX9A 3GUDA 4LK0F 4UHTA 2JA2A 2V1UA 3WTWC 1IC8A 2LG4A 4EQQA 2DTRA 4NUBA 2DQRA 3WU0A 4ZJZA 4XICA 3ZPLA 1JXSA 2VBXA 3AG3H 3K4NA 3FIWA 4JQFA 3K0LA 4JX5A 3RPUD 3EYYA 3SZGA 4FX4A 2LREA 4QPQA 1VQPI 4RBOA 1IW7F 1RI7A 2HFHA 2GXAA 4ESFA 1T0FA 5M5WJ 5J8FA 4PJJA 3TEDA 4C3HJ 1YRNA 3LSTA 1SFKA 1IRXA 1PJRA 4XLPF 5E1XA 1A5JA 2ZMEC 3E1SA 3SXYA 1NG6A 4P9UA 3D5SC 3RDIA 2DT5A 3CD6I 2PI0A 1ETQA 3QPHA 1DU0A 2CS3A 5LRRA 4F92B 5JHUA 4BKXA 2M0MA 5F0HA 5C4XJ 5IY5H 5H20A 4RS8A 3CCEI 3S93A 3M3YJ 2X85A 2CYYA 4K2EA 2YU3A 3SFZA 1OFCX 2DOEA 3TDZC 1Z6TA 4GYGA 4LLLA 2FRHA 1OJLA 2FU4A 4L9NA 2HWVA 5JR3A 4E7KA 1XMKA 1USTA 2JTVA 4HV5A 4C3IJ 2VJ5A 4QPOA 2MW8A 1K4TA 3S3NA 1HDDC 2HOAA 2R5ZA 1TT0A 1DGWY 2HDDA 2X6OA 5L3DA 4XSZF 4Y52J 4IX7A 4MHGA 3ZQ7A 3KZZA 2VC1A 5LGUA 1K7AA 2XDVA 4RDUA 2K3PA 2RAEA 3TO9A 4HZFA 1IGNA 1FY7A 1JGSA 2VJIA 4IEJA 4ZYAA 4YIFA 1WCMJ 4I02A 2DO7A 3NWSA 3J81Z 2VBYA 2GLOA 3CCYA 3BPXA 3GZ5A 4RGRA 1U8BA 4UNOA 2XAJA 4LFUA 3V4GA 4U7DA 4L5IA 2DW4A 1SD6A 3BDDA 3HG9A 4AIDA 3I64A 4CYDA 2ZFWA 3M7GA 3HOUJ 2OTLI 3O8HA 1H0MA 3GX4X 1D0YA 4A3EJ 1JGGA 2HDCA 2ZBKA 3JTHA 4QWQA 2ZXHA 5ILVA 2V1XA 4BBRJ 5B66C 2DI3A 3GTLJ 2F2EA 5CKTA 3PIPF 4XLAA 1FX7A 2JRTA 4KIFA 5HLIA 4MTEA 4QLCU 5DM6F 2CFXA 2WTEA 2P5LC 2E7WA 1W7PA 5HDKA 4V2GA 1PP7U 2IA1A 4CYCB 4O5VA 2XAFA 4XQFA 1JUPA 3LFUA 4CCOA 2CH0A 2ISYA 2Y0SA 3RQ4A 4ENKA 1YFHA 4LITA 2R7UA 1A31A 3OL3A 1SVLA 1LQ1A 2A6EF 3JSPA 1Z0XA 5J47A 2H6BA 2L7FP 3TBIA 1ZQ3P 4PJNA 5TRDA 1M1EB 1ZRFA 2KPMA 2R7SA 3ECHA 3CO7C 1MNMC 3F22A 2VUMJ 2K85A 4Y33A 3K1NA 2X48A 3WODF 3BWGA 3KP3A 1W5CC 3DKXA 2B7EA 2MC3A 2QBYA 4JOMA 3TO6A 2M4GA 2DA1A 4JBAA 2V9PA 4XSXF 3BC8A 4FTHA 4ZZDA 3CCVI 3OIQA 2OC6A 5FKNA 4X1EA 2E19A 1ZG3A 3CESA 2YX7A 3GFJA 1NTCA 1TQIA 1S3JA 1K78A 3WTZA 4AWXB 1YS7A 1ZARA 3GWZA 1QA6A 1Y0NA 2FSWA 3I59B 2HOTA 2P0WA 1ZH5A 2BY2A 1ODDA 4BQQA 3EUHC 3WTVC 1BA5A 4Y15A 4KFCA 2ADUA 1EA3A 1VF9A 3UNGC 1GLNA 1OCRH 4I0BA 4XKWA 1A6IA 2E5NA 3RKXA 1TL8A 3O3KA 4J19A 1XX5A 4BY1J 1TWHJ 3VYTB 1B4AA 3ZQGA 1F9NA 1U9OA 2R7ZJ 1ZGJA 3F72A 3I4PA 3RZDJ 4HRIA 4DZPA 4YFKF 2VQLA 3M8EA 2DA5A 3P7NA 5JI6A 3WHBA 2M87A 4KUMA 5HLHA 1T33A 3V7RA 4KNYA 2FX0A 2JT1A 1ORKA 3ZQHA 4KN7X 2LRDA 4IHWA 3GFMA 5L3FA 2E2IJ 3OYBA 1ETWA 5E8GA 4L9TA 4QSHA 1WJAA 2NVTJ 2DPUA 4MQ9F 4BHCA 3RYRA 4WXDA 1V4RA 3CCQI 2JUCA 2WBMA 5L3BA 3M8JA 5ICCA 5F1JA 2A69F 2COMA 5FKOA 2WWYA 1QVTA 3JAMK 3PIOF 4IQJA 3A03A 3DEEA 3K1MA 4YELA 3BQYA 1HLVA 2VT2A 3L2VA 3S2WA 2EFWA 4GXOA 2UV1A 4YRVA 2AQFA 3QP5A 1HF0A 2NVYJ 3DP7A 3HOYJ 3S3MA 2VXDA 4FE4A 2L9VA 1R4MB 3ZN0A 2ICWG 3Q5FA 5BQTA 2EINH 3G1LA 3K4CA 4HG2A 4OIPF 1R1VA 2HS5A 4HW0A 2W85A 3TOBA 4CGZA 3VSLA 3I5UA 2L2OA 2M7AA 4L9VA 2EB7A 5FGMA 4B09A 2OV7A 2NVXJ 1WSUA 3C1DA 1ERDA 2ZXIA 2QF7A 2P7VB 1JT0A 1A36A 3H3VK 3TKYA 4GFBA 3VYUB 5E18F 4XRFA 3GZ6A 4ITVA 3LAJA 1ACIA 3FXLA 3ZMTA 2F4IA 1IXSB 4LD5A 1W36D 1HQCA 2PJPA 1G4DA 1WVRA 1VQ5I 3HOWJ 3MD2A 2A07F 2LKPA 4WXHA 2LP0A 1N77A 1J0RA 3V7SA 4IVNA 1AU7A 1TW3A 2BY1A 4EEFG 1T39A 4II3A 1V55H 1VZ0A 1XGNA 2CO5A 5FLMJ 4RLQA 2WAFA 3C7JA 2E60A 1I50J 3JTGA 1S72I 2VLAA 2IA2A 3HOVJ 3KP6A 2RREA 4B3AA 1X2MA 4ZC3A 4Z2YA 2IRFG 1X4OA 4UVAA 1T2KA 2TRTA 2W1OA 3ELKA 2QKLB 3D5LA 2PN6A 5F27A 3AL0B 3EPZA 3FHNA 3K6GA 4Y13A 3BJOA 1RPWA 2ZJRF 3QAHA 5HNFA 3NARA 1ETVA 3Q0VA 1D0XA 3TP3A 2OTJI 1PUFB 1RZ4A 4IHVA 3K2AA 4NQWA 1ETOA 3SFIA 1YITI 3G6EI 3CJRB 2MG4A 1VQOI 2IBDA 3KYLA 1MH4A 1XGOA 4CCJA 3K70C 1C0WA 2O03A 3OYAA 2STTA 5F1RA 1UHMA 4OINF 1CGPA 2Y0MA 3TW6A 1MSEC 5HVQC 2V6EA 2ZJPF 1E17A 5LD2C 1J7KA 2Z5UA 2VKHA 3F8NA 3KP5A 5IPAA 2QSHX 5FKMA 1RKWA 3I59A 3RKWA 3DLLF 3BJAA 1W4MA 1XB4A 2D1HA 4HYEA 3HRTA 2VJJA 4HSTA 5E3NA 2D2WA 1HA8A 1O3QA 4ENJA 1UMQA 2JRMA 3S15J 4ZYEA 2DMNA 4CCNA 2QSFX 4BY7J 3WE3A 2OQRA 3TDUC 2CW8A 1TC3C 3WU2C 3S17J 1IRZA 2H6CA 4GRIA 2F4MB 1FOXA 5DTDA 3IAM2 2FNAA 5K7FA 4C2TA 4M6YA 3FHZA 1ZAOA 5KHDA 1BN5A 1WI9A 2E71A 1R49A 3HPGA 3J80K 1IV8A 2C6YA 2CU7A 4Y3OA 3F23A 4XLEA 2KZGA 5E8IA 5LRSA 2GIZA 5FD5A 3L00A 2E1MB 3S1NJ 2YR2A 3ZQCA 1P4XA 4L5JA 4CXFA 6PAXA 3HSRA 5GTHC 4R79A 4ESBA 2Y75A 2UZKA 1RIOH 4U87A 2ZXWH 3CJNA 3K9TA 1SAXA 3HHGA 3CCJI 1OCPA 2XF6A 2N8GA 3IRRA 1XC5A 3M1CA 2NNYA 4HDUA 4A0XA 1AWCA 2ECCA 2JA8J 4NNJA 1FEXA 1YS6A 3FISA 4JX6A 2A6HF 3KZIC 4RAZA 2Z2SB 2LD5A 3R0AA 1S7EA 4UUSB 1REPC 5KNLA 1XCVA 3A2KA 2NVQJ 4UUTA 4BBSJ 1CF7B 2EK5A 3CJTB 4KT5C 5EJCA 2O0YA 2BXYA 1YTYA 1YX5A 5BOXA 2ZMEA 2LF7A 2DMTA 3IV5A 2BHZA 4EGZA 1QPMA 3LSRA 3GCMA 2K9NA 2DPDA 1ZGAA 4PJLA 3KEOA 3IAS2 4DBQA 2NOJB 1Y39A 3L7WA 5TGTA 4BE2A 2VONA 2V26A 3BG3A 2OCEA 1X1PA 5D5XB 2RQQA 4XOTA 4E4HA 3IL2A 1DQUA 2L4AA 2FJ1A 2GOMA 3GTOJ 3HOSA 3LA2A 1WH5A 2FMYA 3W3CA 1EH7A 1BR1A 4A3GJ 3WU1B 3QPSA 4AYBA 2CWEA 2R3SA 3F9KA 4NHJA 1LFPA 2CQKA 2HQRA 4B4CA 3RJPA 3B6AA 5H2FC 1B9NA 3FM5A 5K5RA 2XGEA 2LC2A 3FXRA 3HJEA 1G2HA 2NOGA 2VOOA 1QO0D 1FWZA 3K4LA 1I6HJ 5FFXA 2KQRA 1DGRM 3ULQB 3D1NI 4BNCA 1YW9A 3H0GJ 3I71A 2MGQA 3KEQA 3M8FA 1OCZH 4CCKA 5M3MJ 4A69C 4HOBA 2QQ8A 3KX2A 3PL8A 3HOZJ 3E97A 1QHGA 1OCTC 2BY0A 4H0EA 1KZHA 3IC7A 3E5QA 5ICFA 1U0JA 2B9SA 2IA0A 4HNTA 1FC3A 3WG9A 4FX0A 1ON1A 2GZWA 2LKSA 2CJJA 4W97A 3MEXA 3DU6A 2W82A 2QCOA 4EATA 2F5EA 2WA0A 3I55I 1D8KA 2CV0A 1UJ8A 4PSWA 5EEGA 3DKWA 1RETA 1PUFA 5GPAA 2DCEA 2P7CB 1D1BA 4UV8A 3KP7A 3U21A 2PBIA 5B1AH 1MW7A 1WI3A 4P96A 1YQAA 5CVUA 3LAPA 1X2NA 4RM3A 1YJNI 5IOZA 1UHWA 2DDBA 2K3FA 4J00A 2K7LA 3ZMZA 1K61A 4L18B 3BG6A 2FUG2 3R6SA 3BR5A 3OYEA 3OYKA 1VQ8I 4IO9F 2M4KA 2DOAA 4YEJA 4RB1A 3MKZA 5JVTA 1FPQA 1R1TA 2J5PA 3GXOA 1IXCA 2L7MP 4OOIA 2MFZA 1A35A 1SC7A 1R7JA 1K4SA 3OYIA 1IN4A 2O8XA 3H9QA 2A5WA 4HX4A 2EWNA 2I8DA 4UB8C 3ESWB 2E2JJ 5E20A 1MIJA 2Q2EB 3WGHA 4JK1X 1FBQA 1YJ9I 1OQYA 3GMEA 1TBXA 1WHUA 2KIFA 4BAYA 2HPMA 2LFBA 4KMFA 4O3MA 3CJQB 4HNUA 1HDPA 2KJCA 3X2QH 4A3DJ 2ZXJA 4IRIA 2DK5A 2LNBA 3EQLF 1TW2A 5BMZA 2JPCA 3DTKA 3BZ6A 2VKDA 5LHGA 4D1QA 3NWTA 4IHYA 2JWTA 1EV7A 1X1CA 1GT0C 3PO3J 2ESHA 2LH9A 4A3FJ 3RI4A 2RNGA 5ICEA 3CTAA 2DA4A 1VQ7I 3EUHA 3KIOA 1TNTA 2CMPA 3K2ZA 2L01A 3CP8A 2HPIA 2VQHA 4FE7A 3W2AA 1T38A 2EZHA 4NB5A 2F5CA 4CCMA 1YOVB 3ZN1A 3TW7A 1WJDA 2XPWA 3PSIA 3F8FA 1B6AA 4A3BJ 2V7FA 4UUSA 3OL4A 2DLLA 1T98A
chains in the Genus database with same CATH topology
2MBFA 3REOA 3F21A 1SD4A 2QVOA 4L9JA 4MTDA 2RVCA 4O6JA 1XCBA 4KA4A 2KRFA 2QM3A 3MZHA 3T8RA 1ZLKA 2RDPA 3C18A 3HOTA 2W57A 5K1YA 4ETSA 4LB5A 3BY6A 5AIPA 4IRGA 4WCGA 4EM2A 5DD8A 3MZYA 2Z9OA 3Q9VA 5J8CA 3TOAA 1G6NA 2HEOA 1D3YA 1ULYA 2DQLA 4KICA 4OIQF 4CDGA 3DQVC 4N9IA 4A0YA 1B59A 3IRQA 2B0LA 4LLNA 1R5GA 2XKPA 3R4KA 3MFKA 2L3DA 1PDNC 1BC7C 1TTYA 3HUGA 1YW7A 3U9GA 4L0ZB 5DUKA 5AIQA 4RGSA 1MDMB 4MQVA 4ZH4F 5BPIA 2HKXA 3VB2A 2ACJA 1SMTA 2STWA 4CO8A 3NQOA 3HYIA 1SD5A 5CVJA 4P5OA 4B8XA 1FP1D 2ZNZA 1RNLA 5DDGA 4ON0A 2RNJA 2RGVA 3WTTC 2H27A 1BIAA 4LG0B 5DV5A 4LK1F 1JE8A 2ZO4A 3LQQA 4HAMA 1G3YA 4DQ2A 2H94A 2E1NA 3DEUA 3P9CA 5F6FA 1MZBA 1KA8A 4AIHA 1MJAA 1ZYRF 2GA2A 2GXGA 2VE9A 2J5OA 1L0OC 2FBIA 4GCVA 4UVBA 2Z3YA 1S29A 2ESNA 1FP2A 3HSEA 4WF2A 2MD5A 3FWEA 2PMUA 3LA7A 4PZJA 1S7OA 4M9ZA 3KLOA 3HSFA 2XROA 3QPTA 1FBSA 1XSVA 2BBYA 2UXNA 4RB0A 4Y17A 4OIRF 4IPAA 3KETA 4RGUA 2VXZA 1GXPA 3FMSA 4CHUA 3P9KA 3PFIA 2HKOA 3COAC 2ZKZA 1LJ9A 2RQPA 5E17F 3IKTA 4M74A 2G7UA 2JPBA 4IXAA 5L3GA 1J2XA 1J5YA 2L4MA 5LLQA 3FF5A 1U8RA 2FEZA 3NRVA 3L09A 1FYLA 2PLYA 3PQJA 4XLNF 1FLIA 3FM3A 3H3UA 4WXCA 3H92A 3KP4A 4I98B 2OZ6A 3LQRA 1DP7P 3I53A 4IF4A 3ECOA 3GW2A 2Q8KA 5ILUA 1R1UA 4KYWA 2XVCA 2EFPA 4HF1A 3GLXA 4BYYA 4U0YA 2DFIA 4G94A 2R7DA 2X4HA 4Q48A 3E6CC 4DNCA 3KCCA 1SMYF 4UXNA 1HKTA 2L54A 3EYIA 4G6QA 1FSHA 4I0AA 1I6XA 2EFQA 5DEQA 2EV5A 3ZMUA 3JAMZ 5HS9A 1W5SA 5LHIA 1IAWA 2BE5F 1BIBA 1XSXA 1UFMA 3QU6A 1BI3A 3AAFA 5DCFA 1ZRDA 1FT9A 4WK8F 2M1BA 3R61A 2QQ9A 3VOEA 4EJUA 1DPUA 1X3UA 1F5TA 1YIOA 3MAJA 1G3WA 5A2QZ 3N97A 4ASNA 2CW0F 1O7FA 1D8JA 1KU9A 3F8CA 3H3ZA 1XDSA 2M5WA 1K6OA 4M6XA 1T6SA 1HKSA 2EA2A 4HQMA 4A0ZA 3LWFA 2ISZA 1BI1A 4XBFA 3IHUA 3CUOA 2O3FA 4WWCA 3QOPA 2K27A 4G9YA 3I58A 4PGHA 1KGSA 3KFWX 2OZUA 2OBPA 3W6KB 1FOKA 4D0PA 2XUBA 2K02A 3HRUA 3GFLA 4N0BA 1MJBA 3F6VA 2IP2A 1S8NA 1PP8F 3IWFA 5LHHA 4G7HF 1KQ0A 1TNSA 1O7LA 5AONA 1KU3A 3WTSC 4ZYGA 1R5HA 3EETA 3I0TA 1LDDA 1SFEA 4ZYDA 3LFKA 2RV8A 1ZN2A 1R23A 5FLXK 3BPVA 1J75A 4HDVA 1SFXA 1BJAA 1P6RA 4KMUX 3DPTA 5K5QA 1HW2A 2FF4A 3Q9SA 4EGYA 2FBHA 5HLGA 1WRJA 3T1BA 1Z9CA 2UXXA 2PFBA 4RGXA 3J80Z 3OOPA 3QRFF 2G9WA 1O3SA 3ERED 4A12A 1I1SA 2IJLA 1R22A 2QLZA 2IT0A 2KKOA 5D6FA 3V8KA 1IN5A 3QP6A 3E6MA 1Z7UA 3KZYA 4LLGF 5E1ZB 1QQIA 1YW8A 1BBYA 4BHPA 1MJ9A 3RPQA 2VN2A 3ISPA 1STZA 5CVVA 3V8LA 2QWWA 1MGTA 3MWMA 3V8JA 4BXUA 4L0YB 3O6BB 1MD0A 1FYMA 4AIKA 4U7BA 4EVIA 1IN7A 4EV0A 1OPCA 5D4RA 2XAQA 4CICA 2WV0A 1W7PD 2XRNA 5DYMA 2VODA 2W24A 4PCQA 5TJJA 4MGRA 4PDKA 5DD4A 2DAOA 3SZTA 2QZ8A 4UV9A 3CO6C 2L02A 5F64A 3QU3A 1RUOA 2JSCA 3FZVA 4LMYA 2FOKA 3RIRA 4G6DA 4KN4X 1TLHB 1OYIA 1EH6A 2QYOA 1YG2A 2EA4A 2F5FA 5JFRA 4P55A 1XMAA 2V6CA 4ZYHA 5IT9K 1HBXG 1F4KA 5LGNA 1HSJA 2P6SA 2EV0A 3ZMSA 3L2CA 1SD7A 4HF2A 1V3FA 5EEHA 3L9FA 1ON2A 1LDKB 2EJRA 1XDUA 3F3XA 3HRSA 2LF8A 1OYWA 3GO5A 1R58A 1IUYA 4HX8A 3VODA 2OD5A 1BC8C 1BOAA 4YFXF 1EH8A 3WGIA 3DF8A 2P4WA 1W7PB 1IRGA 2MLKA 3KP2A 3HTUA 3DPLC 3RYPA 2RN7A 1IF1A 4BQAA 4G8XA 3T5XA 4S04A 3VFZA 1Q1HA 3V7CA 2FMLA 4ZZLA 4OMZA 1CF7A 1O3RA 3CLOA 5LBQA 1Z1DA 1H9GA 5CVRA 4P9FA 2M45A 2QBYB 1QBJA 4PGGA 5FD6A 5H6QA 2BV6A 4A6EA 5ICGA 1KYWA 1QGPA 1U3EM 5BPDA 4MEYF 1O3TA 2NAZA 3SZPA 1LB2A 2FBKA 2Q0OA 1IZ1A 2JZYA 2WC2A 1HW1A 4HLYA 3TO7A 2QENA 2MLGA 1F1ZA 3DXJF 2K4BA 2AS5F 5KVRA 4FHTA 1XGSA 1TQPA 5FO5A 4TV7A 2V79A 5D5WB 1JHFA 3J81K 4EJVA 3N4MA 1XGMA 5ED4A 2FNPA 2KIUA 2LSOA 1XN7A 2OU2A 5ERIA 1HSTA 4GO1A 2O6GE 2GXBA 1L3LA 2HQNA 5ILSA 2HTSA 2PEXA 4M71A 3E5XA 1OMIA 2KJBA 2NYXA 4CZZA 2NNNA 1LEBA 2EFNA 2P5KA 1KQ8A 3F6OA 3MCZA 1PUEE 4YG2F 3FXUA 3T0YA 1UB9A 5HDGA 2Q2EA 2M30A 1GHCA 2A3SA 1QZYA 3DFGA 1ZHFA 1DUXC 2VBWA 4EJTA 2HGCA 2GAUA 4YIIA 1ZG1A 5DUIA 5BS6A 1B1BA 4IJAA 2VE8A 3R60A 4LB6B 2ELHA 1OYYA 5L3EA 4RB2C 4G7OF 1YYVA 3FMRA 3K69A 2P5VA 1I5ZA 2A61A 3CUQB 3ML6A 5KK1A 2XKOA 2UWMA 1GVJA 4HBLA 4M9XA 1W5TA 4EMSA 2HZTA 3JSOA 2VBZA 5HDNA 5FFZA 3C3WA 1OKRA 1FBUA 2OQGA 2QUFA 2HR3A 1FYKA 3GVAA 1H9TA 4I01A 1FZPB 3GEZA 2BGCA 2QQBA 2Z99A 5FB2A 3HTSB 1U5TB 2BYVE 3F8MA 3SHFA 5D5UB 1ONVA 3M1EA 2A68F 2RKHA 3G73A 1QNTA 3CDHA 3D0SA 2W25A 5DCMB 1QZZA 2TDXA 4I7HA 2VOPA 3DV8A 2P6TA 4LJZF 2DU9A 2K86A 5D8LB 4ENNA 2VT3A 1ZG5A 1KYZA 1LVAA 1MDMA 4HLXA 5E1WA 1ZRCA 1IRFA 5CJ9A 1S6LA 2Z33A 3E3VA 3FX3A 1Z05A 1GXQA 2IW5A 4RB3C 1HW5A 3RTRA 1DDNA 2FXAA 1BI0A 4WX9A 4Q47A 2ZMEB 4LG0A 1A04A 4EM1A 4I09A 1IN8A 2M8EA 2QQAA 4KIBA 3RPUA 2VC0A 5A2QK 3EDPA 1SFUA 4UUVA 1RUNA 3O2PE 2GA1A 3BP8A 2G7HA 3PQKA 4EJOA 1XD7A 2YX4A 1P2FA 1P92A 2FA5A 2DK8A 3BJ6A 4U88A 4EJWA 5L3CA 2PMHA 4AVPA 2ZJ2A 2KIMA 4A2UA 2W84A 5K5OA 3WTXC 4KDPA 3NEUA 1O57A 4BHBA 1DPRA 3JW4A 5CVIA 4F7ZA 1I27A 1UCRA 3GYHX 3CUQA 2Y48A 4U0WA 4OMYA 1G3SA 1KU7A 3BOQA 4MEXF 1E2XA 1U6GA 2A5YB 4HV6A 2GQQA 2IPQX 1IN6A 2D45A 4M9SA 2HYGD 1U78A 5LGTA 2AXLA 1J9IA 1P4AA 2XIGA 2GIVA 2EFOA 3FMQA 1ZLJA 4E70A 1I1GA 2V9VA 2XAGA 2BEOA 2H09A 2FE3A 1NHAA 3E6BA 1WKMA 2MH2A 1R00A 2HYFA 3J7AO 3VEPA 3KLNA 1YLFA 3GFIA 4GGGA 1KU2A 1K79A 4Q4ZF 1U5TA 2CSOA 2YSRA 4U0VA 3IKVA 2ZCWA 5DCMA 1ZREA 1LDJA 3K1PA 2F5DA 1HXDA 2PG4A 2GWRA 5CYVA 3BROA 1Z6RA 2LDUA 4ENMA 4IRHA 3MQ0A 4AD9A 1TQMA 3P9IA 4YFNF 1T98A 2XGXA 3ABTA 3HRMA 4S05A 1WWXA 2RC4A 2R7FA 2OAZA 3B02A 2E1CA 3ZMVA 2NS0A 1FSEA 1BM9A 1KQ9A 5LEJA 3FXQA 4M72A 5J6XA 4HF0A 2DBBA 3U2RA 2MA3A 3E6DA 3B73A 3OV8A 1VTNC 3T8TA 5FLXZ 4BH9A 4MNUA 2P8TA 3RKYA 4R8HA 5D6EA 3ROUA 4M73A 1Z91A 1LNWA 3ZP5A 3LA3A 1AOYA 2D1VA 2V1DA 1B9MA 1S7AA 4HX7A 3SQNA 5H6RA 5HOOA 4HQEA 4KIGA 1JHHA 2K4JA 2MH9A 4RAYA 4I2OA 2XASA 3KE2A 2YPRA 2EV6A 4R1HA 4IHTA 2HOEA 1Y0UA 4LGWA 2X0LA 1R36A 2XAHA 1IXRC 4N9HA 2O61A 4IHSA 3W6JB 5HS7A 5HS8A 2HTJA 1HKQA 3M9AA 4A5NA 3TGNA 3WGGA 1J59A 3HIFA 2XHKA 1YO5C 3CUQC 1XSDA 3WTYC 3G3ZA 4A5MA 1LEAA 1MKMA 5D5VB 3IWZA 3U1DA 4G7ZF 5D4SA 3GF2A 1P4WA 4A6DA 5CLSA 4OU0A 3E5UA 4FT8A 2NRAC 2CGPA 5IT9Z 3R0JA 1G3TA 4HA8A 5LEKA 4OIOF 2OA4A 4AIJA 1OR7A 3I54A 2FQ3A 1U5TC 1USSA 3WE2A 2IVMA 3HHHA 1WQ2A 1D5VA 3F8BA 3WTUC 2ETHA 5D8KB 4Q5SF 1BI2A 5IT3A 4ESJA 2XV4S 4EM0B 2CG4A 1U2WA 3ABUA 1K78B 4GYIA 3TQNA 1FNNA 2E7XA 2ZNYA 2PQ8A 4UVCA 3GUDA 4LK0F 4UHTA 2V1UA 3WTWC 4EQQA 2DTRA 2DQRA 3WU0A 3ZPLA 1JXSA 2VBXA 4JQFA 3K0LA 4FX4A 3EYYA 1IW7F 1RI7A 2HFHA 4ESFA 1T0FA 5J8FA 3LSTA 4XLPF 5E1XA 3SXYA 4P9UA 3RDIA 2DT5A 2PI0A 3QPHA 5LRRA 5JHUA 5H20A 4RS8A 2CYYA 4K2EA 2YU3A 3SFZA 3TDZC 1Z6TA 4GYGA 4LLLA 2FRHA 2FU4A 4L9NA 2HWVA 5JR3A 1XMKA 1USTA 2JTVA 4HV5A 5L3DA 4XSZF 4MHGA 3ZQ7A 3KZZA 2VC1A 5LGUA 1K7AA 3TO9A 4HZFA 1FY7A 1JGSA 4YIFA 4I02A 2DO7A 3J81Z 2VBYA 3BPXA 3GZ5A 4RGRA 4UNOA 2XAJA 4LFUA 3V4GA 4U7DA 4L5IA 2DW4A 1SD6A 3BDDA 3I64A 4CYDA 2ZFWA 3M7GA 1H0MA 3GX4X 2HDCA 2ZBKA 3JTHA 4QWQA 5ILVA 2V1XA 2DI3A 2F2EA 1FX7A 2JRTA 4KIFA 5HLIA 4MTEA 4QLCU 2CFXA 2WTEA 2P5LC 2E7WA 1W7PA 5HDKA 1PP7U 2IA1A 4O5VA 2XAFA 2ISYA 4ENKA 1YFHA 1LQ1A 2A6EF 3JSPA 2H6BA 5TRDA 1ZRFA 3ECHA 3CO7C 3F22A 3K1NA 3WODF 3BWGA 3KP3A 2MC3A 2QBYA 3TO6A 4JBAA 4XSXF 4ZZDA 1ZG3A 2YX7A 3GFJA 1TQIA 1S3JA 1K78A 3WTZA 4AWXB 1YS7A 1ZARA 3GWZA 2FSWA 3I59B 1ZH5A 1ODDA 3WTVC 4Y15A 4KFCA 2ADUA 4I0BA 3RKXA 3O3KA 1B4AA 1F9NA 1ZGJA 3F72A 3I4PA 4YFKF 3M8EA 3P7NA 5JI6A 2M87A 4KUMA 5HLHA 3V7RA 4KNYA 2JT1A 4KN7X 3GFMA 5L3FA 5E8GA 4L9TA 2DPUA 4MQ9F 4BHCA 3RYRA 4WXDA 1V4RA 5L3BA 5ICCA 2A69F 2COMA 2WWYA 3JAMK 3K1MA 2VT2A 3S2WA 2EFWA 4GXOA 3QP5A 3DP7A 3ZN0A 3Q5FA 5BQTA 4OIPF 1R1VA 2HS5A 4HW0A 2W85A 3TOBA 4CGZA 3I5UA 4L9VA 2EB7A 5FGMA 4B09A 1WSUA 3C1DA 2P7VB 3TKYA 5E18F 4XRFA 3GZ6A 3LAJA 3ZMTA 1IXSB 4LD5A 1HQCA 2PJPA 1G4DA 2A07F 2LKPA 4WXHA 1J0RA 3V7SA 4IVNA 1TW3A 1T39A 1XGNA 2CO5A 3C7JA 3JTGA 2IA2A 3KP6A 4Z2YA 2IRFG 4UVAA 1T2KA 3ELKA 3D5LA 2PN6A 4Y13A 3BJOA 3QAHA 1RZ4A 4NQWA 1XGOA 1C0WA 2STTA 2O03A 5F1RA 1UHMA 4OINF 1CGPA 2Y0MA 5HVQC 1E17A 1J7KA 2Z5UA 3F8NA 3KP5A 3I59A 3RKWA 1W4MA 3BJAA 1XB4A 2D1HA 4HYEA 3HRTA 2D2WA 1O3QA 4ENJA 4ZYEA 3WE3A 2OQRA 3TDUC 2H6CA 2FNAA 4M6YA 3FHZA 1ZAOA 1BN5A 1WI9A 3J80K 2C6YA 3F23A 5E8IA 5LRSA 5FD5A 3L00A 2YR2A 1P4XA 4L5JA 4CXFA 6PAXA 3HSRA 4R79A 4ESBA 2Y75A 2UZKA 1RIOH 3CJNA 3K9TA 1SAXA 3HHGA 3IRRA 2NNYA 4HDUA 4A0XA 1AWCA 1YS6A 2A6HF 4RAZA 3R0AA 1REPC 1XCVA 1CF7B 2EK5A 4KT5C 1YTYA 2O0YA 5BOXA 2ZMEA 2LF7A 4EGZA 1QPMA 2DPDA 1ZGAA 3KEOA 3L7WA 2VONA 5D5XB 3IL2A 2L4AA 3HOSA 3LA2A 2FMYA 1EH7A 3WU1B 4NHJA 2CWEA 2R3SA 2CQKA 2HQRA 3RJPA 1B9NA 3FM5A 5K5RA 3FXRA 2VOOA 1QO0D 1FWZA 5FFXA 3ULQB 4BNCA 1YW9A 3I71A 3KEQA 3M8FA 4HOBA 3E97A 4H0EA 3IC7A 3E5QA 5ICFA 2IA0A 1FC3A 3WG9A 4FX0A 1ON1A 2GZWA 3MEXA 2F5EA 1D8KA 5EEGA 3DKWA 2P7CB 4UV8A 3KP7A 2PBIA 4P96A 1YQAA 5CVUA 3LAPA 1UHWA 2K7LA 3ZMZA 4L18B 3R6SA 4RB1A 5JVTA 1FPQA 1R1TA 2J5PA 3GXOA 1IXCA 4OOIA 1R7JA 1IN4A 2O8XA 4HX4A 2EWNA 5E20A 3WGHA 4JK1X 1FBQA 1TBXA 2KIFA 4KMFA 4BAYA 4O3MA 2KJCA 2ZXJA 4IRIA 2DK5A 2LNBA 3EQLF 1TW2A 5BMZA 2JPCA 3BZ6A 5LHGA 1EV7A 2ESHA 3RI4A 5ICEA 3CTAA 3EUHA 1TNTA 3K2ZA 2L01A 1T38A 4NB5A 2F5CA 3ZN1A 3F8FA 1B6AA 2DLLA 3ZMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBF A;  3REO A;  3F21 A;  1SD4 A;  2QVO A;  4L9J A;  4MTD A;  2RVC A;  4O6J A;  1XCB A;  4KA4 A;  2KRF A;  2QM3 A;  3MZH A;  3T8R A;  1ZLK A;  2RDP A;  3C18 A;  3HOT A;  2W57 A;  5K1Y A;  4ETS A;  4LB5 A;  3BY6 A;  5AIP A;  4IRG A;  4WCG A;  4EM2 A;  5DD8 A;  3MZY A;  2Z9O A;  3Q9V A;  5J8C A;  3TOA A;  1G6N A;  2HEO A;  1D3Y A;  1ULY A;  2DQL A;  4KIC A;  4OIQ F;  4CDG A;  3DQV C;  4N9I A;  4A0Y A;  1B59 A;  3IRQ A;  2B0L A;  4LLN A;  1R5G A;  2XKP A;  3R4K A;  3MFK A;  2L3D A;  1PDN C;  1BC7 C;  1TTY A;  3HUG A;  1YW7 A;  3U9G A;  4L0Z B;  5DUK A;  5AIQ A;  4RGS A;  1MDM B;  4MQV A;  4ZH4 F;  5BPI A;  2HKX A;  3VB2 A;  2ACJ A;  1SMT A;  2STW A;  4CO8 A;  3NQO A;  3HYI A;  1SD5 A;  5CVJ A;  4P5O A;  4B8X A;  1FP1 D;  2ZNZ A;  1RNL A;  5DDG A;  4ON0 A;  2RNJ A;  2RGV A;  3WTT C;  2H27 A;  1BIA A;  4LG0 B;  5DV5 A;  4LK1 F;  1JE8 A;  2ZO4 A;  3LQQ A;  4HAM A;  1G3Y A;  4DQ2 A;  2H94 A;  2E1N A;  3DEU A;  3P9C A;  5F6F A;  1MZB A;  1KA8 A;  4AIH A;  1MJA A;  1ZYR F;  2GA2 A;  2GXG A;  2VE9 A;  2J5O A;  1L0O C;  2FBI A;  4GCV A;  4UVB A;  2Z3Y A;  1S29 A;  2ESN A;  1FP2 A;  3HSE A;  4WF2 A;  2MD5 A;  3FWE A;  2PMU A;  3LA7 A;  4PZJ A;  1S7O A;  4M9Z A;  3KLO A;  3HSF A;  2XRO A;  3QPT A;  1FBS A;  1XSV A;  2BBY A;  2UXN A;  4RB0 A;  4Y17 A;  4OIR F;  4IPA A;  3KET A;  4RGU A;  2VXZ A;  1GXP A;  3FMS A;  4CHU A;  3P9K A;  3PFI A;  2HKO A;  3COA C;  2ZKZ A;  1LJ9 A;  2RQP A;  5E17 F;  3IKT A;  4M74 A;  2G7U A;  2JPB A;  4IXA A;  5L3G A;  1J2X A;  1J5Y A;  2L4M A;  5LLQ A;  3FF5 A;  1U8R A;  2FEZ A;  3NRV A;  3L09 A;  1FYL A;  2PLY A;  3PQJ A;  4XLN F;  1FLI A;  3FM3 A;  3H3U A;  4WXC A;  3H92 A;  3KP4 A;  4I98 B;  2OZ6 A;  3LQR A;  1DP7 P;  3I53 A;  4IF4 A;  3ECO A;  3GW2 A;  2Q8K A;  5ILU A;  1R1U A;  4KYW A;  2XVC A;  2EFP A;  4HF1 A;  3GLX A;  4BYY A;  4U0Y A;  2DFI A;  4G94 A;  2R7D A;  2X4H A;  4Q48 A;  3E6C C;  4DNC A;  3KCC A;  1SMY F;  4UXN A;  1HKT A;  2L54 A;  3EYI A;  4G6Q A;  1FSH A;  4I0A A;  1I6X A;  2EFQ A;  5DEQ A;  2EV5 A;  3ZMU A;  3JAM Z;  5HS9 A;  1W5S A;  5LHI A;  1IAW A;  2BE5 F;  1BIB A;  1XSX A;  1UFM A;  3QU6 A;  1BI3 A;  3AAF A;  5DCF A;  1ZRD A;  1FT9 A;  4WK8 F;  2M1B A;  3R61 A;  2QQ9 A;  3VOE A;  4EJU A;  1DPU A;  1X3U A;  1F5T A;  1YIO A;  3MAJ A;  1G3W A;  5A2Q Z;  3N97 A;  4ASN A;  2CW0 F;  1O7F A;  1D8J A;  1KU9 A;  3F8C A;  3H3Z A;  1XDS A;  2M5W A;  1K6O A;  4M6X A;  1T6S A;  1HKS A;  2EA2 A;  4HQM A;  4A0Z A;  3LWF A;  2ISZ A;  1BI1 A;  4XBF A;  3IHU A;  3CUO A;  2O3F A;  4WWC A;  3QOP A;  2K27 A;  4G9Y A;  3I58 A;  4PGH A;  1KGS A;  3KFW X;  2OZU A;  2OBP A;  3W6K B;  1FOK A;  4D0P A;  2XUB A;  2K02 A;  3HRU A;  3GFL A;  4N0B A;  1MJB A;  3F6V A;  2IP2 A;  1S8N A;  1PP8 F;  3IWF A;  5LHH A;  4G7H F;  1KQ0 A;  1TNS A;  1O7L A;  5AON A;  1KU3 A;  3WTS C;  4ZYG A;  1R5H A;  3EET A;  3I0T A;  1LDD A;  1SFE A;  4ZYD A;  3LFK A;  2RV8 A;  1ZN2 A;  1R23 A;  5FLX K;  3BPV A;  1J75 A;  4HDV A;  1SFX A;  1BJA A;  1P6R A;  4KMU X;  3DPT A;  5K5Q A;  1HW2 A;  2FF4 A;  3Q9S A;  4EGY A;  2FBH A;  5HLG A;  1WRJ A;  3T1B A;  1Z9C A;  2UXX A;  2PFB A;  4RGX A;  3J80 Z;  3OOP A;  3QRF F;  2G9W A;  1O3S A;  3ERE D;  4A12 A;  1I1S A;  2IJL A;  1R22 A;  2QLZ A;  2IT0 A;  2KKO A;  5D6F A;  3V8K A;  1IN5 A;  3QP6 A;  3E6M A;  1Z7U A;  3KZY A;  4LLG F;  5E1Z B;  1QQI A;  1YW8 A;  1BBY A;  4BHP A;  1MJ9 A;  3RPQ A;  2VN2 A;  3ISP A;  1STZ A;  5CVV A;  3V8L A;  2QWW A;  1MGT A;  3MWM A;  3V8J A;  4BXU A;  4L0Y B;  3O6B B;  1MD0 A;  1FYM A;  4AIK A;  4U7B A;  4EVI A;  1IN7 A;  4EV0 A;  1OPC A;  5D4R A;  2XAQ A;  4CIC A;  2WV0 A;  1W7P D;  2XRN A;  5DYM A;  2VOD A;  2W24 A;  4PCQ A;  5TJJ A;  4MGR A;  4PDK A;  5DD4 A;  2DAO A;  3SZT A;  2QZ8 A;  4UV9 A;  3CO6 C;  2L02 A;  5F64 A;  3QU3 A;  1RUO A;  2JSC A;  3FZV A;  4LMY A;  2FOK A;  3RIR A;  4G6D A;  4KN4 X;  1TLH B;  1OYI A;  1EH6 A;  2QYO A;  1YG2 A;  2EA4 A;  2F5F A;  5JFR A;  4P55 A;  1XMA A;  2V6C A;  4ZYH A;  5IT9 K;  1HBX G;  1F4K A;  5LGN A;  1HSJ A;  2P6S A;  2EV0 A;  3ZMS A;  3L2C A;  1SD7 A;  4HF2 A;  1V3F A;  5EEH A;  3L9F A;  1ON2 A;  1LDK B;  2EJR A;  1XDU A;  3F3X A;  3HRS A;  2LF8 A;  1OYW A;  3GO5 A;  1R58 A;  1IUY A;  4HX8 A;  3VOD A;  2OD5 A;  1BC8 C;  1BOA A;  4YFX F;  1EH8 A;  3WGI A;  3DF8 A;  2P4W A;  1W7P B;  1IRG A;  2MLK A;  3KP2 A;  3HTU A;  3DPL C;  3RYP A;  2RN7 A;  1IF1 A;  4BQA A;  4G8X A;  3T5X A;  4S04 A;  3VFZ A;  1Q1H A;  3V7C A;  2FML A;  4ZZL A;  4OMZ A;  1CF7 A;  1O3R A;  3CLO A;  5LBQ A;  1Z1D A;  1H9G A;  5CVR A;  4P9F A;  2M45 A;  2QBY B;  1QBJ A;  4PGG A;  5FD6 A;  5H6Q A;  2BV6 A;  4A6E A;  5ICG A;  1KYW A;  1QGP A;  1U3E M;  5BPD A;  4MEY F;  1O3T A;  2NAZ A;  3SZP A;  1LB2 A;  2FBK A;  2Q0O A;  1IZ1 A;  2JZY A;  2WC2 A;  1HW1 A;  4HLY A;  3TO7 A;  2QEN A;  2MLG A;  1F1Z A;  3DXJ F;  2K4B A;  2AS5 F;  5KVR A;  4FHT A;  1XGS A;  1TQP A;  5FO5 A;  4TV7 A;  2V79 A;  5D5W B;  1JHF A;  3J81 K;  4EJV A;  3N4M A;  1XGM A;  5ED4 A;  2FNP A;  2KIU A;  2LSO A;  1XN7 A;  2OU2 A;  5ERI A;  1HST A;  4GO1 A;  2O6G E;  2GXB A;  1L3L A;  2HQN A;  5ILS A;  2HTS A;  2PEX A;  4M71 A;  3E5X A;  1OMI A;  2KJB A;  2NYX A;  4CZZ A;  2NNN A;  1LEB A;  2EFN A;  2P5K A;  1KQ8 A;  3F6O A;  3MCZ A;  1PUE E;  4YG2 F;  3FXU A;  3T0Y A;  1UB9 A;  5HDG A;  2Q2E A;  2M30 A;  1GHC A;  2A3S A;  1QZY A;  3DFG A;  1ZHF A;  1DUX C;  2VBW A;  4EJT A;  2HGC A;  2GAU A;  4YII A;  1ZG1 A;  5DUI A;  5BS6 A;  1B1B A;  4IJA A;  2VE8 A;  3R60 A;  4LB6 B;  2ELH A;  1OYY A;  5L3E A;  4RB2 C;  4G7O F;  1YYV A;  3FMR A;  3K69 A;  2P5V A;  1I5Z A;  2A61 A;  3CUQ B;  3ML6 A;  5KK1 A;  2XKO A;  2UWM A;  1GVJ A;  4HBL A;  4M9X A;  1W5T A;  4EMS A;  2HZT A;  3JSO A;  2VBZ A;  5HDN A;  5FFZ A;  3C3W A;  1OKR A;  1FBU A;  2OQG A;  2QUF A;  2HR3 A;  1FYK A;  3GVA A;  1H9T A;  4I01 A;  1FZP B;  3GEZ A;  2BGC A;  2QQB A;  2Z99 A;  5FB2 A;  3HTS B;  1U5T B;  2BYV E;  3F8M A;  3SHF A;  5D5U B;  1ONV A;  3M1E A;  2A68 F;  2RKH A;  3G73 A;  1QNT A;  3CDH A;  3D0S A;  2W25 A;  5DCM B;  1QZZ A;  2TDX A;  4I7H A;  2VOP A;  3DV8 A;  2P6T A;  4LJZ F;  2DU9 A;  2K86 A;  5D8L B;  4ENN A;  2VT3 A;  1ZG5 A;  1KYZ A;  1LVA A;  1MDM A;  4HLX A;  5E1W A;  1ZRC A;  1IRF A;  5CJ9 A;  1S6L A;  2Z33 A;  3E3V A;  3FX3 A;  1Z05 A;  1GXQ A;  2IW5 A;  4RB3 C;  1HW5 A;  3RTR A;  1DDN A;  2FXA A;  1BI0 A;  4WX9 A;  4Q47 A;  2ZME B;  4LG0 A;  1A04 A;  4EM1 A;  4I09 A;  1IN8 A;  2M8E A;  2QQA A;  4KIB A;  3RPU A;  2VC0 A;  5A2Q K;  3EDP A;  1SFU A;  4UUV A;  1RUN A;  3O2P E;  2GA1 A;  3BP8 A;  2G7H A;  3PQK A;  4EJO A;  1XD7 A;  2YX4 A;  1P2F A;  1P92 A;  2FA5 A;  2DK8 A;  3BJ6 A;  4U88 A;  4EJW A;  5L3C A;  2PMH A;  4AVP A;  2ZJ2 A;  2KIM A;  4A2U A;  2W84 A;  5K5O A;  3WTX C;  4KDP A;  3NEU A;  1O57 A;  4BHB A;  1DPR A;  3JW4 A;  5CVI A;  4F7Z A;  1I27 A;  1UCR A;  3GYH X;  3CUQ A;  2Y48 A;  4U0W A;  4OMY A;  1G3S A;  1KU7 A;  3BOQ A;  4MEX F;  1E2X A;  1U6G A;  2A5Y B;  4HV6 A;  2GQQ A;  2IPQ X;  1IN6 A;  2D45 A;  4M9S A;  2HYG D;  1U78 A;  5LGT A;  2AXL A;  1J9I A;  1P4A A;  2XIG A;  2GIV A;  2EFO A;  3FMQ A;  1ZLJ A;  4E70 A;  1I1G A;  2V9V A;  2XAG A;  2BEO A;  2H09 A;  2FE3 A;  1NHA A;  3E6B A;  1WKM A;  2MH2 A;  1R00 A;  2HYF A;  3J7A O;  3VEP A;  3KLN A;  1YLF A;  3GFI A;  4GGG A;  1KU2 A;  1K79 A;  4Q4Z F;  1U5T A;  2CSO A;  2YSR A;  4U0V A;  3IKV A;  2ZCW A;  5DCM A;  1ZRE A;  1LDJ A;  3K1P A;  2F5D A;  1HXD A;  2PG4 A;  2GWR A;  5CYV A;  3BRO A;  1Z6R A;  2LDU A;  4ENM A;  4IRH A;  3MQ0 A;  4AD9 A;  1TQM A;  3P9I A;  4YFN F;  1T98 A;  2XGX A;  3ABT A;  3HRM A;  4S05 A;  1WWX A;  2RC4 A;  2R7F A;  2OAZ A;  3B02 A;  2E1C A;  3ZMV A;  2NS0 A;  1FSE A;  1BM9 A;  1KQ9 A;  5LEJ A;  3FXQ A;  4M72 A;  5J6X A;  4HF0 A;  2DBB A;  3U2R A;  2MA3 A;  3E6D A;  3B73 A;  3OV8 A;  1VTN C;  3T8T A;  5FLX Z;  4BH9 A;  4MNU A;  2P8T A;  3RKY A;  4R8H A;  5D6E A;  3ROU A;  4M73 A;  1Z91 A;  1LNW A;  3ZP5 A;  3LA3 A;  1AOY A;  2D1V A;  2V1D A;  1B9M A;  1S7A A;  4HX7 A;  3SQN A;  5H6R A;  5HOO A;  4HQE A;  4KIG A;  1JHH A;  2K4J A;  2MH9 A;  4RAY A;  4I2O A;  2XAS A;  3KE2 A;  2YPR A;  2EV6 A;  4R1H A;  4IHT A;  2HOE A;  1Y0U A;  4LGW A;  2X0L A;  1R36 A;  2XAH A;  1IXR C;  4N9H A;  2O61 A;  4IHS A;  3W6J B;  5HS7 A;  5HS8 A;  2HTJ A;  1HKQ A;  3M9A A;  4A5N A;  3TGN A;  3WGG A;  1J59 A;  3HIF A;  2XHK A;  1YO5 C;  3CUQ C;  1XSD A;  3WTY C;  3G3Z A;  4A5M A;  1LEA A;  1MKM A;  5D5V B;  3IWZ A;  3U1D A;  4G7Z F;  5D4S A;  3GF2 A;  1P4W A;  4A6D A;  5CLS A;  4OU0 A;  3E5U A;  4FT8 A;  2NRA C;  2CGP A;  5IT9 Z;  3R0J A;  1G3T A;  4HA8 A;  5LEK A;  4OIO F;  2OA4 A;  4AIJ A;  1OR7 A;  3I54 A;  2FQ3 A;  1U5T C;  1USS A;  3WE2 A;  2IVM A;  3HHH A;  1WQ2 A;  1D5V A;  3F8B A;  3WTU C;  2ETH A;  5D8K B;  4Q5S F;  1BI2 A;  5IT3 A;  4ESJ A;  2XV4 S;  4EM0 B;  2CG4 A;  1U2W A;  3ABU A;  1K78 B;  4GYI A;  3TQN A;  1FNN A;  2E7X A;  2ZNY A;  2PQ8 A;  4UVC A;  3GUD A;  4LK0 F;  4UHT A;  2V1U A;  3WTW C;  4EQQ A;  2DTR A;  2DQR A;  3WU0 A;  3ZPL A;  1JXS A;  2VBX A;  4JQF A;  3K0L A;  4FX4 A;  3EYY A;  1IW7 F;  1RI7 A;  2HFH A;  4ESF A;  1T0F A;  5J8F A;  3LST A;  4XLP F;  5E1X A;  3SXY A;  4P9U A;  3RDI A;  2DT5 A;  2PI0 A;  3QPH A;  5LRR A;  5JHU A;  5H20 A;  4RS8 A;  2CYY A;  4K2E A;  2YU3 A;  3SFZ A;  3TDZ C;  1Z6T A;  4GYG A;  4LLL A;  2FRH A;  2FU4 A;  4L9N A;  2HWV A;  5JR3 A;  1XMK A;  1UST A;  2JTV A;  4HV5 A;  5L3D A;  4XSZ F;  4MHG A;  3ZQ7 A;  3KZZ A;  2VC1 A;  5LGU A;  1K7A A;  3TO9 A;  4HZF A;  1FY7 A;  1JGS A;  4YIF A;  4I02 A;  2DO7 A;  3J81 Z;  2VBY A;  3BPX A;  3GZ5 A;  4RGR A;  4UNO A;  2XAJ A;  4LFU A;  3V4G A;  4U7D A;  4L5I A;  2DW4 A;  1SD6 A;  3BDD A;  3I64 A;  4CYD A;  2ZFW A;  3M7G A;  1H0M A;  3GX4 X;  2HDC A;  2ZBK A;  3JTH A;  4QWQ A;  5ILV A;  2V1X A;  2DI3 A;  2F2E A;  1FX7 A;  2JRT A;  4KIF A;  5HLI A;  4MTE A;  4QLC U;  2CFX A;  2WTE A;  2P5L C;  2E7W A;  1W7P A;  5HDK A;  1PP7 U;  2IA1 A;  4O5V A;  2XAF A;  2ISY A;  4ENK A;  1YFH A;  1LQ1 A;  2A6E F;  3JSP A;  2H6B A;  5TRD A;  1ZRF A;  3ECH A;  3CO7 C;  3F22 A;  3K1N A;  3WOD F;  3BWG A;  3KP3 A;  2MC3 A;  2QBY A;  3TO6 A;  4JBA A;  4XSX F;  4ZZD A;  1ZG3 A;  2YX7 A;  3GFJ A;  1TQI A;  1S3J A;  1K78 A;  3WTZ A;  4AWX B;  1YS7 A;  1ZAR A;  3GWZ A;  2FSW A;  3I59 B;  1ZH5 A;  1ODD A;  3WTV C;  4Y15 A;  4KFC A;  2ADU A;  4I0B A;  3RKX A;  3O3K A;  1B4A A;  1F9N A;  1ZGJ A;  3F72 A;  3I4P A;  4YFK F;  3M8E A;  3P7N A;  5JI6 A;  2M87 A;  4KUM A;  5HLH A;  3V7R A;  4KNY A;  2JT1 A;  4KN7 X;  3GFM A;  5L3F A;  5E8G A;  4L9T A;  2DPU A;  4MQ9 F;  4BHC A;  3RYR A;  4WXD A;  1V4R A;  5L3B A;  5ICC A;  2A69 F;  2COM A;  2WWY A;  3JAM K;  3K1M A;  2VT2 A;  3S2W A;  2EFW A;  4GXO A;  3QP5 A;  3DP7 A;  3ZN0 A;  3Q5F A;  5BQT A;  4OIP F;  1R1V A;  2HS5 A;  4HW0 A;  2W85 A;  3TOB A;  4CGZ A;  3I5U A;  4L9V A;  2EB7 A;  5FGM A;  4B09 A;  1WSU A;  3C1D A;  2P7V B;  3TKY A;  5E18 F;  4XRF A;  3GZ6 A;  3LAJ A;  3ZMT A;  1IXS B;  4LD5 A;  1HQC A;  2PJP A;  1G4D A;  2A07 F;  2LKP A;  4WXH A;  1J0R A;  3V7S A;  4IVN A;  1TW3 A;  1T39 A;  1XGN A;  2CO5 A;  3C7J A;  3JTG A;  2IA2 A;  3KP6 A;  4Z2Y A;  2IRF G;  4UVA A;  1T2K A;  3ELK A;  3D5L A;  2PN6 A;  4Y13 A;  3BJO A;  3QAH A;  1RZ4 A;  4NQW A;  1XGO A;  1C0W A;  2STT A;  2O03 A;  5F1R A;  1UHM A;  4OIN F;  1CGP A;  2Y0M A;  5HVQ C;  1E17 A;  1J7K A;  2Z5U A;  3F8N A;  3KP5 A;  3I59 A;  3RKW A;  1W4M A;  3BJA A;  1XB4 A;  2D1H A;  4HYE A;  3HRT A;  2D2W A;  1O3Q A;  4ENJ A;  4ZYE A;  3WE3 A;  2OQR A;  3TDU C;  2H6C A;  2FNA A;  4M6Y A;  3FHZ A;  1ZAO A;  1BN5 A;  1WI9 A;  3J80 K;  2C6Y A;  3F23 A;  5E8I A;  5LRS A;  5FD5 A;  3L00 A;  2YR2 A;  1P4X A;  4L5J A;  4CXF A;  6PAX A;  3HSR A;  4R79 A;  4ESB A;  2Y75 A;  2UZK A;  1RIO H;  3CJN A;  3K9T A;  1SAX A;  3HHG A;  3IRR A;  2NNY A;  4HDU A;  4A0X A;  1AWC A;  1YS6 A;  2A6H F;  4RAZ A;  3R0A A;  1REP C;  1XCV A;  1CF7 B;  2EK5 A;  4KT5 C;  1YTY A;  2O0Y A;  5BOX A;  2ZME A;  2LF7 A;  4EGZ A;  1QPM A;  2DPD A;  1ZGA A;  3KEO A;  3L7W A;  2VON A;  5D5X B;  3IL2 A;  2L4A A;  3HOS A;  3LA2 A;  2FMY A;  1EH7 A;  3WU1 B;  4NHJ A;  2CWE A;  2R3S A;  2CQK A;  2HQR A;  3RJP A;  1B9N A;  3FM5 A;  5K5R A;  3FXR A;  2VOO A;  1QO0 D;  1FWZ A;  5FFX A;  3ULQ B;  4BNC A;  1YW9 A;  3I71 A;  3KEQ A;  3M8F A;  4HOB A;  3E97 A;  4H0E A;  3IC7 A;  3E5Q A;  5ICF A;  2IA0 A;  1FC3 A;  3WG9 A;  4FX0 A;  1ON1 A;  2GZW A;  3MEX A;  2F5E A;  1D8K A;  5EEG A;  3DKW A;  2P7C B;  4UV8 A;  3KP7 A;  2PBI A;  4P96 A;  1YQA A;  5CVU A;  3LAP A;  1UHW A;  2K7L A;  3ZMZ A;  4L18 B;  3R6S A;  4RB1 A;  5JVT A;  1FPQ A;  1R1T A;  2J5P A;  3GXO A;  1IXC A;  4OOI A;  1R7J A;  1IN4 A;  2O8X A;  4HX4 A;  2EWN A;  5E20 A;  3WGH A;  4JK1 X;  1FBQ A;  1TBX A;  2KIF A;  4KMF A;  4BAY A;  4O3M A;  2KJC A;  2ZXJ A;  4IRI A;  2DK5 A;  2LNB A;  3EQL F;  1TW2 A;  5BMZ A;  2JPC A;  3BZ6 A;  5LHG A;  1EV7 A;  2ESH A;  3RI4 A;  5ICE A;  3CTA A;  3EUH A;  1TNT A;  3K2Z A;  2L01 A;  1T38 A;  4NB5 A;  2F5C A;  3ZN1 A;  3F8F A;  1B6A A;  2DLL A;  3ZMD A; 
#chains in the Genus database with same CATH topology
 1WFX A;  4C2U A;  4A3M J;  2MBF A;  3REO A;  1JUS A;  3F21 A;  1SD4 A;  3KYC B;  3LSM A;  5K7H A;  1JJ8 C;  3FKI J;  2QVO A;  2A05 A;  3VDX A;  4L9J A;  1MMA A;  2KLO A;  3CCM I;  4MTD A;  2R93 J;  2RVC A;  4O6J A;  1XCB A;  4KA4 A;  2KRF A;  2QM3 A;  3LMM A;  3MZH A;  3T8R A;  1LFB A;  2DJN A;  1ZLK A;  2RDP A;  5GAG J;  3C18 A;  3HOT A;  3J7Y J;  1X58 A;  2R7O A;  3BR6 A;  2AQE A;  2W57 A;  2HOS A;  1Q1V A;  5K1Y A;  3L2R A;  4LIV A;  2FQ4 A;  3ZCO A;  2YS9 A;  2LTP A;  4ETS A;  4LB5 A;  5FRM A;  2LKX A;  3BY6 A;  4V19 K;  3IUO A;  5AIP A;  3DBH B;  4IRG A;  4WCG A;  4EM2 A;  5J40 A;  5DD8 A;  3MZY A;  2Z9O A;  3CQZ J;  1MND A;  3OS0 A;  3Q9V A;  5J8C A;  5E3O A;  3TOA A;  1G6N A;  1JT6 A;  2HEO A;  1D3Y A;  2DOF A;  1ULY A;  1Y8R B;  3MKW B;  2DQL A;  2XSD C;  4KIC A;  1A6Q A;  4NC8 A;  4OIQ F;  2X6X A;  4CDG A;  3DQV C;  3GTG J;  5KAF C;  4N9I A;  4A0Y A;  2L9S A;  3S2H J;  1B59 A;  3IRQ A;  1JUM A;  2B0L A;  4LLN A;  1R5G A;  3K10 A;  2XKP A;  2IGM A;  1LE8 B;  3R4K A;  3MFK A;  2IS6 A;  2L3D A;  1PDN C;  1BC7 C;  1MMG A;  1TTY A;  3RZO J;  1DU6 A;  4PFO A;  5EEA A;  2DMU A;  4J01 A;  1WJC A;  4N4O B;  3HUG A;  1RKT A;  1YW7 A;  3U9G A;  4L0Z B;  4BE0 A;  5DUK A;  5AIQ A;  4M3E A;  2HXO A;  2ZSH B;  4MQV A;  4RGS A;  5F0C A;  4ZH4 F;  5BPI A;  1MDM B;  2HKX A;  3VB2 A;  2ACJ A;  1SMT A;  4XLH A;  3CMY A;  2STW A;  1WPK A;  5FKK A;  3NQO A;  3ZOB A;  4CO8 A;  1ZGW A;  3HYI A;  1SD5 A;  5M3F J;  1XPX A;  1BW6 A;  5CVJ A;  4P5O A;  2K9S A;  4B8X A;  1FP1 D;  5JHF A;  2ZNZ A;  1RNL A;  4D5F A;  5DDG A;  5FJ8 J;  3AL0 C;  4ON0 A;  1IO2 A;  4E7J A;  2HVS A;  2RNJ A;  2VJ4 A;  1RC9 A;  2RGV A;  3WTT C;  2H27 A;  2X9D A;  1F43 A;  1BIA A;  4LG0 B;  3A4C A;  1UG0 A;  5DV5 A;  2W7N A;  4LK1 F;  1JE8 A;  2ZO4 A;  1J09 A;  3LQQ A;  4HAM A;  4NBQ A;  3CLQ A;  2V4J C;  1G3Y A;  2WY7 Q;  4DQ2 A;  2H94 A;  1XMX A;  2E1N A;  3DEU A;  3P9C A;  3E7L A;  5J1R A;  4DIQ A;  5F6F A;  3P5J A;  1MZB A;  4BDZ A;  1KA8 A;  5EZG A;  1KON A;  4AIH A;  1MJA A;  1ZYR F;  5GP9 A;  1X1D A;  2GA2 A;  3HGY A;  2GXG A;  2VE9 A;  5JVG F;  2J5O A;  3S32 A;  4PJ0 C;  3V42 A;  1L0O C;  2FBI A;  5C44 J;  3G2B A;  1YJW I;  4GCV A;  4UVB A;  2Z3Y A;  1S29 A;  1T95 A;  2V1N A;  2ESN A;  1FP2 A;  3HSE A;  4WF2 A;  1XG1 A;  1Y1V J;  2MD5 A;  4XKB A;  3ZRG A;  3LSP A;  3IH3 A;  3FWE A;  2PMU A;  3LA7 A;  2MSY A;  2M7B A;  4PZJ A;  2IEK A;  2LR8 A;  1S7O A;  4M9Z A;  2XPU A;  3KLO A;  3H5R A;  3L2W A;  2WAD A;  3HSF A;  5M5Y J;  2XRO A;  3QPT A;  1FBS A;  1XSV A;  2BBY A;  1E3P A;  3D5R C;  2UXN A;  5C3E J;  4RB0 A;  2E1M C;  3QPL A;  3DTI A;  4XOP A;  4Y17 A;  4FAS D;  4OIR F;  4IPA A;  4G12 A;  3KET A;  4RGU A;  2Y9Z A;  3IH4 A;  2VXZ A;  1GXP A;  3FMS A;  1Y1W J;  1VQ9 I;  4CHU A;  2M3A A;  1P9Q C;  3QOD A;  2CFO A;  4IOA F;  3P9K A;  3OR2 C;  3PFI A;  2HKO A;  5JLX A;  5FRN A;  4YIR X;  3COA C;  2ZKZ A;  3L2Q A;  1LJ9 A;  3LSK A;  2DYS H;  2O8K A;  3MZ8 A;  2RQP A;  4RM2 A;  2QA4 I;  5C4J J;  5E17 F;  3IKT A;  3LSI A;  2G7U A;  4M74 A;  2JPB A;  3JRG A;  4IXA A;  5L3G A;  1J2X A;  4P1W A;  1J5Y A;  2IS4 A;  1FOY A;  2CV1 A;  2L4M A;  3BTC A;  2EPF A;  5LLQ A;  3FF5 A;  3DCF A;  1U8R A;  2FEZ A;  3UKG A;  5CQE A;  1QVU A;  3NRV A;  3L09 A;  1JKQ C;  3RCO A;  2KDZ A;  4BJ6 C;  5KCM A;  1FYL A;  2PLY A;  3PQJ A;  4XLN F;  1FLI A;  4PJM A;  3FM3 A;  2Q1Z B;  2XB0 X;  4OAY A;  2HYJ A;  4F91 B;  4MO7 A;  3H3U A;  1Z3Y A;  4HPQ A;  2X1E A;  4WXC A;  3H92 A;  3KP4 A;  4I98 B;  2OZ6 A;  3QYE A;  3C2H A;  2L5Q A;  5F0F A;  1ZEL A;  2HZD A;  3LQR A;  3OR1 C;  2LBF B;  4D5C A;  1DP7 P;  3BG9 A;  4XM3 A;  2KIS A;  3DPU A;  3OS1 A;  3I53 A;  1Z3X A;  4IF4 A;  3KYD B;  3ECO A;  2WAQ A;  3GW2 A;  2Q8K A;  5ILU A;  4ZDL A;  1R1U A;  3PSF A;  3OYN A;  3JRA A;  4KYW A;  4XRM A;  4ZTJ A;  2XVC A;  3ASN H;  2E5Z A;  4S0H B;  2ZJQ F;  2EFP A;  4HF1 A;  2KRC A;  2WAQ N;  3GLX A;  4BYY A;  4U0Y A;  4B1R A;  4RMN A;  2DFI A;  4G94 A;  2R7D A;  2X4H A;  4Q48 A;  5FKL A;  3E6C C;  1R71 A;  3C2G A;  4DNC A;  3KCC A;  4IOC F;  1SMY F;  4UXN A;  1HKT A;  3CCU I;  2L54 A;  4AC0 A;  3BT9 A;  3EYI A;  2VPR A;  4G6Q A;  1FSH A;  5EG0 B;  1EKE A;  2BOL A;  4MIM A;  3JRI A;  3A0H C;  4I0A A;  1WZ2 A;  1X3W B;  3HL2 A;  1MBF A;  1I6X A;  3UR3 C;  2EFQ A;  3W2V A;  5JLW A;  5DEQ A;  3ZGK A;  2DA3 A;  2EV5 A;  3ZMU A;  3JAM Z;  3CMM A;  4N4N B;  5HS9 A;  1W5S A;  5LHI A;  1IAW A;  3TL4 X;  2Y9Y A;  2BE5 F;  1BIB A;  1XSX A;  1WJ5 A;  1UFM A;  2GBY A;  3DBL B;  4CUG A;  4G6T B;  4CYC A;  3I9V 2;  1X1A A;  3K4J A;  3QU6 A;  1BI3 A;  2JVG A;  2X51 A;  3AAF A;  5DCF A;  1ZRD A;  1FT9 A;  4CSW A;  4BS9 A;  2DN0 A;  3AG2 H;  4WK8 F;  2M1B A;  2WB1 A;  2PJR B;  3R61 A;  2QQ9 A;  3VOE A;  4EJU A;  1DPU A;  2JSP A;  4IZZ A;  1X3U A;  1F5T A;  1YIO A;  3MAJ A;  1G3W A;  3S16 J;  5A2Q Z;  1WGX A;  1TWF J;  4HEA 2;  3N97 A;  5LFA A;  4ASN A;  2WB1 N;  2CW0 F;  4I76 A;  5CPR B;  2ID3 A;  4LIU A;  1O7F A;  1D8J A;  5F04 A;  1KU9 A;  3F8C A;  3H3Z A;  3PNV A;  1XDS A;  3MMY B;  2M5W A;  4NDL A;  2R4G A;  1K6O A;  4M6X A;  1T6S A;  2JA5 J;  1HKS A;  1IG7 A;  3CDI A;  2EA2 A;  3A02 A;  1GV5 A;  3CCR I;  2AO9 A;  2L7Z A;  4HQM A;  2XF5 A;  4A0Z A;  3MKY B;  3LWF A;  2ISZ A;  1BI1 A;  4XBF A;  2R7Q A;  2XF7 A;  3IHU A;  3CUO A;  1TT5 B;  2O3F A;  2WV1 A;  4XNF A;  4WWC A;  3QOP A;  1UZC A;  2K27 A;  4G9Y A;  3I58 A;  4PGH A;  1KGS A;  4BL0 B;  3Q3S A;  2DFE A;  1NG7 A;  3KFW X;  4B44 A;  4CCL A;  2OZU A;  3FXM A;  2OBP A;  3W6K B;  1FOK A;  4PK4 A;  1O4X A;  3GBG A;  2EIL H;  4D0P A;  1WH7 A;  2JUG A;  4II2 A;  4M3G A;  2XUB A;  3SEQ A;  2K02 A;  3HRU A;  3GFL A;  2WY8 Q;  4N0B A;  1T8I A;  1W0U A;  1FIP A;  1FMW A;  1MJB A;  3HXL A;  3FKJ A;  4CH7 A;  3F6V A;  2IP2 A;  1S8N A;  1BJZ A;  3BTL A;  1PP8 F;  2FD5 A;  2H8W A;  3IWF A;  1JI8 A;  5LHH A;  2HI3 A;  4A3K J;  4G7H F;  1KQ0 A;  1TNS A;  3I4M J;  1O7L A;  4MFD A;  3FXK A;  5AON A;  4B47 A;  1KU3 A;  4D7M A;  3WTS C;  2QSG X;  4ZYG A;  3HM5 A;  3OY9 A;  1R5H A;  3EET A;  3I0T A;  5TIS C;  4X0G A;  3BR2 A;  2DT7 B;  2CQN A;  5F08 A;  4FCY A;  3SDG A;  1LDD A;  1SFE A;  3HKZ A;  3I3L A;  4ZYD A;  4UB6 C;  4QTR A;  4W1U A;  3LFK A;  2UUZ A;  3ZQL A;  2NS7 A;  2RV8 A;  1ZN2 A;  1R23 A;  5FLX K;  1G59 A;  3M4O J;  3H0D A;  3VYS B;  1MBE A;  3BPV A;  1J75 A;  3A1Y A;  1BL0 A;  4HDV A;  1SFX A;  3HKZ N;  1BJA A;  2K9L A;  1P6R A;  1ZKG A;  1I3A A;  4KMU X;  3ZQQ A;  3PNY A;  1D1A A;  3DPT A;  3G4S I;  3I4N J;  1LKX A;  1OLT A;  1R4N B;  1X4P A;  4PUS A;  5K5Q A;  1HW2 A;  2FF4 A;  1R5I D;  3Q9S A;  4EGY A;  2VPL A;  2FBH A;  3OIP A;  5HLG A;  2H1L A;  2DA6 A;  1WRJ A;  2LY1 A;  3T1B A;  1Z9C A;  4A3C J;  5B5E C;  1P7J A;  2LMD A;  2UXX A;  1MMS A;  2PFB A;  4RGX A;  4D7N A;  3J80 Z;  4KIS A;  2KL4 A;  3OOP A;  1TP4 A;  5IP6 A;  4PSX A;  5HOD A;  3M07 A;  3QYF A;  3QRF F;  3AKZ A;  2W4S A;  4DYC A;  2G9W A;  1O3S A;  3ERE D;  4A12 A;  2KRH A;  1I1S A;  2IJL A;  1R22 A;  2QLZ A;  2IT0 A;  2KKO A;  5D6F A;  3V8K A;  1IN5 A;  3E6M A;  1Z7U A;  3QP6 A;  3KZY A;  4LLG F;  5E1Z B;  1QQI A;  1YW8 A;  2LVS A;  1BBY A;  4BHP A;  1ETK A;  1JTX A;  2R7X A;  1MBJ A;  1MJ9 A;  3RPQ A;  2F48 A;  2VN2 A;  3CCS I;  2BZT A;  3ISP A;  1STZ A;  3AFH A;  5CVV A;  3V8L A;  2QWW A;  1MGT A;  3S14 J;  3MWM A;  3V8J A;  1OIS A;  4DYQ A;  9ANT A;  3VSK A;  4BXU A;  4L0Y B;  2VAS A;  5GTI C;  2R7V A;  2EH3 A;  1LVK A;  2DMP A;  3O6B B;  1MD0 A;  2LLK A;  1FYM A;  3HPH A;  4AIK A;  4IHX A;  4U7B A;  3OYF A;  4EVI A;  1IN7 A;  4EV0 A;  1OPC A;  3GTQ J;  4C2M J;  2XAQ A;  4CIC A;  5D4R A;  3GTM J;  4XLF A;  3K70 D;  2WV0 A;  2OF7 A;  1W7P D;  4JX4 A;  2XRN A;  5IP9 J;  3G1O A;  5DYM A;  2KHM A;  3H1C A;  1FTT A;  2Y2Z A;  3WG7 H;  1W0T A;  3CF2 A;  2CUZ A;  2VOD A;  2XGC A;  2W24 A;  4PCQ A;  3BTI A;  2E34 A;  4A93 J;  1S9H A;  4ANJ A;  1T08 B;  1K6Y A;  5TJJ A;  4MGR A;  3JRC A;  3OYG A;  4PDK A;  3FXO A;  1YE9 A;  5DD4 A;  3ABL H;  2DAO A;  3SZT A;  2QZ8 A;  4UV9 A;  3CO6 C;  2L02 A;  1YI2 I;  2ZFU A;  3G71 I;  1I39 A;  5F64 A;  4BU2 A;  1IDZ A;  3QU3 A;  3K7A J;  1B8I B;  4ABZ A;  1RUO A;  2JSC A;  3FZV A;  1BR4 A;  4LMY A;  4RAG A;  3OS2 A;  1Z21 A;  2GOX B;  1IV6 A;  1QHH D;  1U9N A;  2FOK A;  3RIR A;  2ZB9 A;  3MN2 A;  4G6D A;  2XPV A;  4KN4 X;  1TLH B;  1OYI A;  3HB9 A;  1EH6 A;  2QYO A;  1EJ9 A;  1YG2 A;  2EA4 A;  2R5Z B;  2F5F A;  5JFR A;  1IDY A;  4P55 A;  2DDA A;  1XMA A;  2V6C A;  4ZYH A;  5IT9 K;  4ZDP A;  1HBX G;  1F4K A;  1N75 A;  2CV2 A;  3FDY A;  5LGN A;  5CQG A;  1HSJ A;  1ZR4 A;  4IQ4 A;  1JJ6 C;  2P6S A;  2B63 J;  2EV0 A;  3ZMS A;  4XMY A;  2K9Q A;  2VKE A;  2Y30 A;  1X1B A;  3L2C A;  3OSG A;  1SD7 A;  3JRE A;  4HF2 A;  3S2D J;  1V3F A;  5EEH A;  3L9F A;  1ON2 A;  1LDK B;  2EJR A;  1P7I A;  1XDU A;  2ME6 A;  4E7Z A;  3GZN B;  2R7W A;  2CRG A;  3F3X A;  3K4M A;  3CC7 I;  3HRS A;  2LF8 A;  4XN3 A;  1OYW A;  3GO5 A;  1R58 A;  1MNE A;  5J4V A;  1IUY A;  1Z7L A;  4HX8 A;  3VOD A;  2OD5 A;  1BC8 C;  1BOA A;  4MFE A;  1RR7 A;  4YFX F;  2KP6 A;  2BVM A;  2P81 A;  3RKQ A;  1EH8 A;  2EQR A;  3HDD A;  3WGI A;  3DF8 A;  2K9M A;  4IL6 C;  2P4W A;  1W7P B;  2M8G X;  4Z6Y A;  1VI0 A;  2M34 A;  2CQQ A;  3DLA A;  4A3I J;  1IRG A;  2K5C A;  3OYM A;  2MLK A;  3KP2 A;  3QWL A;  5IYD J;  1WJF A;  3HTU A;  3DPL C;  3RYP A;  1Y56 A;  2RN7 A;  1IF1 A;  4BQA A;  4G8X A;  3T5X A;  4S04 A;  3VFZ A;  1Q1H A;  3V7C A;  2FML A;  3OOU A;  2L9R A;  3GTK J;  4ZZL A;  4E7S A;  2YU9 J;  2O5R A;  4OMZ A;  1CF7 A;  1EF4 A;  1O3R A;  3CLO A;  5EDN A;  5LBQ A;  1H88 C;  1Z1D A;  1H9G A;  2R0Q C;  5CVR A;  2IGN A;  3BZK A;  3BLY A;  5E79 C;  4P9F A;  5KAI C;  4XL9 A;  2M45 A;  2PMZ A;  1D1C A;  2QBY B;  1QBJ A;  4PGG A;  4B3X A;  2ECB A;  4XKC A;  4XRS A;  4BXF A;  3OSF A;  3JRF A;  5FD6 A;  5J1U A;  5H6Q A;  1UAA A;  4XOR A;  2R7T A;  1XS9 A;  1TWA J;  2BV6 A;  3F0C A;  1VND A;  4BQN A;  2O9L A;  2L7K A;  4A6E A;  5ICG A;  1KYW A;  1QGP A;  2PMZ N;  1U3E M;  5BPD A;  3O8G A;  4MEY F;  1O3T A;  2EBI A;  2NAZ A;  3SZP A;  1LB2 A;  5HLT A;  2XRL A;  2FBK A;  4BQO A;  1PYV A;  3BG7 A;  3HBL A;  2Q0O A;  1IZ1 A;  4E7I A;  2JZY A;  2O7O A;  2WC2 A;  1HW1 A;  3KPH A;  4HLY A;  1RR8 C;  4A3L J;  3TO7 A;  3JCU C;  3U1K A;  2QEN A;  4E7H A;  2MLG A;  1F1Z A;  1ENH A;  3DXJ F;  3H5N A;  2K4B A;  2AS5 F;  2OUM A;  5KVR A;  5M5X J;  2DYR H;  4C9Y A;  4FHT A;  1SAU A;  1XGS A;  4CZC A;  1TQP A;  2Z16 A;  4RAF A;  1JKR C;  4F93 B;  2E1O A;  5FO5 A;  3JR9 A;  3DU5 A;  1UG2 A;  4TV7 A;  1D5Y A;  1N25 A;  2V79 A;  5D5W B;  1JHF A;  3GTJ J;  4PFP A;  2DFH A;  1YX3 A;  3J81 K;  1V5G A;  4EJV A;  3N4M A;  1XGM A;  5ED4 A;  2FNP A;  4A3J J;  2JA7 J;  2X6Y A;  2KIU A;  2LSO A;  1BR2 A;  1XN7 A;  3OYH A;  1IJW C;  2OU2 A;  2TCT A;  3LSJ A;  5ERI A;  3DWL E;  3HC7 A;  1HST A;  3PJR A;  4GO1 A;  1AA7 A;  4BGD A;  2O6G E;  2GXB A;  1L3L A;  1B8I A;  3LSG A;  3PNT A;  1E3H A;  2HQN A;  2V9K A;  5ILS A;  2OJE D;  4C30 A;  2HTS A;  2PEX A;  4M71 A;  5GAD J;  2W48 A;  1OMI A;  3E5X A;  1RES A;  4BE1 A;  2KJB A;  2NYX A;  3OYC A;  2D5V A;  4DYR A;  2VIX A;  4CZZ A;  2DA7 A;  1MBH A;  2NNN A;  1LEB A;  4FIS A;  3S1R J;  3EUK L;  2HQA A;  2EFN A;  2P5K A;  3OYJ A;  1KQ8 A;  3F6O A;  3MCZ A;  1PUE E;  4AU7 A;  3K4K A;  4B48 A;  3ZQF A;  3FXU A;  4YG2 F;  1MBG A;  5HNH A;  3ABK H;  3T0Y A;  1UB9 A;  5HDG A;  1NH3 A;  3BTJ A;  2Q2E A;  3AG4 H;  2MYS A;  1ZR2 A;  2M30 A;  1NK3 P;  1GHC A;  2X1C A;  5EF6 A;  1VQ4 I;  1VQN I;  3QYB A;  1DP3 A;  1LPQ A;  2A3S A;  1QZY A;  3DFG A;  1ZHF A;  1DUX C;  2VBW A;  4EJT A;  2HGC A;  3PFY A;  1GVD A;  2GAU A;  4YII A;  4AUX A;  4CA0 A;  2BXZ A;  1ZG1 A;  1POG A;  5DUI A;  1UEL B;  5BS6 A;  3OYD A;  1B1B A;  2MD0 A;  2CQ7 A;  3CDL A;  1VQM I;  4IJA A;  3CC4 I;  1WJB A;  4BEH B;  2KZV A;  2VE8 A;  3DEW A;  3R60 A;  4LB6 B;  3W6V A;  4OAZ A;  2ELH A;  1W1W E;  1OYY A;  2CW7 A;  2EIJ H;  5B1B H;  2DFF A;  5L3E A;  4RB2 C;  4G7O F;  1YYV A;  3FMR A;  4E6K G;  3K69 A;  4ZDO A;  3LOC A;  3RQI A;  2P5V A;  1W36 C;  5BNG A;  1I5Z A;  2M9H A;  2A61 A;  3CUQ B;  4AVZ A;  1JKP C;  1QZE A;  5GAE J;  2KDO A;  3ML6 A;  5KK1 A;  2XKO A;  2E2H J;  2UWM A;  2Y0S N;  1GVJ A;  4HBL A;  4M9X A;  4F55 A;  1W5T A;  4EMS A;  2HZT A;  1TWC J;  3JSO A;  4NQW B;  2KT0 A;  2VBZ A;  2BVL A;  5HDN A;  3TP0 A;  5FFZ A;  1HOM A;  4HNV A;  3MKL A;  3C3W A;  1OKR A;  2LOO A;  3E0J B;  1FBU A;  3CMA I;  4RA2 A;  5DM7 F;  2ELK A;  3CP2 A;  2OQG A;  2QUF A;  2HR3 A;  4Y7N J;  1FYK A;  4XRS G;  3GVA A;  2R7R A;  1YHQ I;  2ZC2 A;  4XLC A;  1PVE A;  1H9T A;  3Q0W A;  4I01 A;  2GM4 A;  2XSJ C;  3VPR A;  1FZP B;  3GEZ A;  4M3B A;  2HDW A;  1OR7 C;  2F5V A;  2BGC A;  1FIA A;  2JMW A;  5GAH J;  2QQB A;  1E3O C;  1FJL A;  2Z99 A;  5FB2 A;  2NXN B;  3HTS B;  2HU9 A;  1U5T B;  2BYV E;  3F8M A;  3SHF A;  5D5U B;  1ONV A;  3M1E A;  4D9J A;  2A68 F;  2RKH A;  3LSH A;  1QNT A;  3CDH A;  3G73 A;  3D0S A;  1ITY A;  1TWG J;  1SVM A;  2W25 A;  5DCM B;  2LY2 A;  3BZC A;  2NVU B;  2HNH A;  3CCL I;  1JKO C;  1LE8 A;  1QZZ A;  2TDX A;  4I7H A;  4NC7 A;  2VOP A;  4BJT A;  1Z67 A;  3DV8 A;  2P6T A;  2A6T A;  2ME0 A;  4LJZ F;  4OWR B;  3H35 A;  2DU9 A;  1BOB A;  2K86 A;  5D8L B;  4ENN A;  1ZTR A;  2VT3 A;  3DBR B;  4LOC A;  1APL C;  1ZG5 A;  1KYZ A;  1LVA A;  2EIK H;  1MDM A;  4HLX A;  5E1W A;  2CUF A;  2VKV A;  1ZRC A;  1IRF A;  5GPC A;  3SDB A;  5CJ9 A;  1S6L A;  1SEU A;  2Z33 A;  2L0K A;  3E3V A;  4X6A J;  3A01 B;  3FX3 A;  2Y31 A;  2NS8 A;  1T0F C;  2BY3 A;  2XGD A;  2VQC A;  1Z05 A;  2H8R A;  2COB A;  1GXQ A;  2JJ7 A;  1Z77 A;  2E35 A;  2IW5 A;  4RB3 C;  1HW5 A;  2Z1D A;  3RTR A;  2M2E A;  2QEX I;  1DDN A;  3BCB A;  2FXA A;  1VFC A;  1AKH B;  1BI0 A;  4WX9 A;  2DMQ A;  2ZME B;  4Q47 A;  4LG0 A;  1A04 A;  4ZTF A;  4EM1 A;  4I09 A;  5FRO A;  1IN8 A;  2M8E A;  2QQA A;  3BG5 A;  4KIB A;  3GTP J;  2LK2 A;  3RPU A;  4BXX J;  4JYK A;  2VC0 A;  3J7Z I;  5A2Q K;  3EDP A;  1SFU A;  2DTZ A;  2L9N A;  1H8A C;  4UUV A;  1RUN A;  3SYT A;  3O2P E;  2OCC H;  2LY9 A;  4H4K C;  1VQL I;  2M0C A;  2EIM H;  4M3D A;  2GA1 A;  3BP8 A;  2G7H A;  1ZK8 A;  2KMU A;  3PQK A;  4EJO A;  3ASO H;  2IGO A;  2CQX A;  4DOZ A;  1XD7 A;  2VL8 A;  1K83 J;  1GV2 A;  2YX4 A;  1P2F A;  1P92 A;  2FA5 A;  3PM1 A;  2DK8 A;  3BJ6 A;  4XID A;  4U88 A;  4BEH A;  4EJW A;  1D0Z A;  5L3C A;  2PMH A;  4AVP A;  2W00 A;  2ZJ2 A;  2X1D A;  2KIM A;  2F6C A;  3FXJ A;  4A2U A;  2W84 A;  5K5O A;  3WTX C;  2JK3 A;  3RSN A;  4KDP A;  3NEU A;  3TMO A;  5J1Y A;  1O57 A;  4BHB A;  1RRJ A;  1DPR A;  3H36 A;  3JW4 A;  5CVI A;  4F7Z A;  5E3M A;  2CUE A;  1I27 A;  1UCR A;  3GYH X;  3FBN B;  3CUQ A;  4E7L A;  5IOY A;  2Y48 A;  3MVP A;  4U0W A;  4DZJ A;  4OMY A;  1G3S A;  1KU7 A;  3JRH A;  1NK2 P;  3BOQ A;  4MEX F;  2AHQ A;  1Y6I A;  1E2X A;  1U6G A;  3W2W A;  2A5Y B;  5IYC J;  3ABM H;  2IS1 A;  4HV6 A;  3VYR B;  2GQQ A;  2IPQ X;  1F36 A;  1IN6 A;  2D45 A;  4M9S A;  2HYG D;  1U78 A;  1FMV A;  5LGT A;  4M6V A;  2AXL A;  4V2F A;  4C3J J;  4UY8 I;  4KT6 A;  1J9I A;  1P4A A;  2XIG A;  2GIV A;  2EFO A;  3FMQ A;  3GLL A;  1ZLJ A;  1I3Q J;  4E70 A;  1I1G A;  2V9V A;  2XAG A;  1CQT A;  2WAE A;  2BEO A;  2H09 A;  2FE3 A;  1NHA A;  2BW3 B;  2VI6 A;  3E6B A;  1WKM A;  2MH2 A;  2R5Y B;  1VQK I;  3N05 A;  1R00 A;  5DS9 A;  2HYF A;  3J7A O;  4L5E A;  3VEP A;  3FBI B;  3CF5 F;  2LYC A;  3KLN A;  1YLF A;  1Y8Q B;  3GFI A;  4LG3 A;  5EYR A;  5J4Y A;  2DOD A;  4GGG A;  1T56 A;  2F4O B;  1KU2 A;  4DJA A;  1K79 A;  4Q4Z F;  2IAI A;  1GDT A;  1BW5 A;  2VB6 A;  1U5T A;  2DJI A;  2CSO A;  2YSR A;  3VWB A;  1V5F A;  2DA2 A;  1B72 B;  1SAN A;  4U0V A;  2HVR A;  1H89 C;  3CZ6 A;  3IKV A;  4BAC A;  2ZCW A;  4DBR A;  5DCM A;  1ZRE A;  1MMD A;  3L1P A;  3BCA A;  5J3L A;  1LDJ A;  3K1P A;  2F5D A;  1HXD A;  3QOE A;  4BJ5 C;  2PG4 A;  4F52 A;  2GWR A;  1HCR A;  4IKF A;  2IXS A;  1QRY A;  2JVH A;  2EZL A;  5CYV A;  4KIT B;  3IH2 A;  3BRO A;  2IGK A;  1Z6R A;  4B43 A;  2LDU A;  4ENM A;  4IRH A;  3MQ0 A;  4AD9 A;  1TQM A;  3P9I A;  3ZMD A;  4YFN F;  2XGX A;  2K40 A;  2LBF A;  1XTA A;  2KIQ A;  3ABT A;  1IUF A;  3HRM A;  4JP0 A;  1UHS A;  2YUS A;  3PO2 J;  3SEZ A;  2VQG A;  4S05 A;  1WWX A;  2RC4 A;  3PUF A;  2R7F A;  2OAZ A;  3B02 A;  2MAB A;  2Y69 H;  2EZI A;  4M3F A;  5EGO B;  1LFU P;  2E1C A;  1S5L C;  3G1M A;  3ZMV A;  2NS0 A;  1FSE A;  1BM9 A;  1KQ9 A;  3A01 A;  3S8P A;  3A0B C;  1R6R A;  1ETX A;  5LEJ A;  3FXQ A;  4M72 A;  5J6X A;  4HF0 A;  2R92 J;  2DBB A;  1YIJ I;  1WJE A;  3U2R A;  2MA3 A;  2I5U A;  3E6D A;  3B73 A;  3OV8 A;  1VTN C;  1AKH A;  5EG0 A;  3T8T A;  2JN6 A;  4QIW N;  5FLX Z;  3OWT A;  4BH9 A;  4MNU A;  1R9T J;  1V54 H;  2P8T A;  2MC4 A;  1QPI A;  3BR1 A;  3RKY A;  2QKM B;  4R8H A;  5D6E A;  3CC2 I;  2G0E A;  3ROU A;  4XK4 A;  4M73 A;  1Z91 A;  1LNW A;  3ZP5 A;  1SFO J;  3LA3 A;  1AOY A;  2D1V A;  3IP4 B;  2V1D A;  2FOW A;  4RLF A;  2IS2 A;  1B9M A;  3B6C A;  1ETY A;  1S7A A;  2EZK A;  3ERM A;  1YRN B;  1V5E A;  4HX7 A;  5H6R A;  3SQN A;  5HOO A;  3LNQ A;  4HQE A;  1MMN A;  4KIG A;  4XKV A;  3AG1 H;  1JHH A;  2PJR A;  2K4J A;  1TZL A;  3C2B A;  2MH9 A;  4AYB N;  2XC7 A;  2CUJ A;  2H1K A;  1QU3 A;  3JRB A;  4RAY A;  4HSR A;  3JRD A;  4I2O A;  2XAS A;  3KE2 A;  2YPR A;  5IYB J;  2EV6 A;  4R1H A;  4IHT A;  1X3Z B;  2HOE A;  4BUP A;  3KEY A;  4NC6 A;  2KFD A;  1Y0U A;  2QGU A;  4LGW A;  2X0L A;  3Q0U A;  3HEF A;  2E36 A;  1R36 A;  2XAH A;  1VQ6 I;  1IXR C;  5E3L A;  4N9H A;  3ONQ A;  2BHY A;  3LL7 A;  2O61 A;  5B3S H;  2JQ7 A;  3BR0 A;  3H9G A;  3OMY A;  4IHS A;  3WHC A;  3W6J B;  3HZJ A;  3HUG B;  5HS7 A;  3SJM A;  5HS8 A;  3H5A A;  2HTJ A;  1HKQ A;  3M9A A;  4A5N A;  3TGN A;  2I10 A;  2ZSI B;  3K4B A;  4XON A;  3WGG A;  3L2U A;  3EUA A;  1J59 A;  2BW3 A;  3OYL A;  4DW6 A;  2R5Y A;  3HIF A;  2XHK A;  4FET A;  1YO5 C;  3OIO A;  3CUQ C;  1XSD A;  5EZH A;  3CME I;  3WTY C;  1FTZ A;  3G3Z A;  3QQA A;  4KJZ A;  4A5M A;  1LEA A;  3HOX J;  1B72 A;  5K7Z A;  3ZQI A;  1MKM A;  3DKY A;  5D5V B;  3BQZ A;  3IWZ A;  3U1D A;  2DT6 A;  1JTY A;  5D4S A;  4G7Z F;  3BR3 A;  3GF2 A;  2DXI A;  3S1M J;  1P4W A;  4A6D A;  2JA6 J;  5CLS A;  4OU0 A;  4XN0 A;  3E5U A;  4FT8 A;  2X6W A;  2ELJ A;  3S1Q J;  1GUU A;  2OPT A;  2NRA C;  2HQ5 A;  2CGP A;  1X19 A;  5IT9 Z;  3ZXS A;  4I6Z A;  4GDF A;  4I99 C;  3R0J A;  1G3T A;  4FQG A;  4HA8 A;  5LEK A;  4OIO F;  1HC8 A;  1MSF C;  1LUJ B;  2OA4 A;  4AIJ A;  3FK6 A;  1OR7 A;  3I54 A;  2FQ3 A;  3PUB A;  3NAU A;  1U5T C;  3DTE A;  2XAU A;  3H9J A;  1USS A;  5EGO A;  3WE2 A;  2AXT C;  1MH3 A;  3ZR8 X;  3S3O A;  2IVM A;  3HHH A;  1WQ2 A;  1FOW A;  3HGG A;  1D5V A;  3F8B A;  4AM3 A;  4Y4R A;  3WTU C;  2ETH A;  2HVQ A;  4XR6 A;  5D8K B;  3FK7 A;  1SVO A;  4BDY A;  4Q5S F;  1BI2 A;  1E0E A;  4DGW B;  5IT3 A;  4ESJ A;  1N78 A;  1G8X A;  2HXI A;  2XV4 S;  4EM0 B;  2CG4 A;  1U2W A;  4MLO A;  3ABU A;  2ID6 A;  5IP7 J;  1K78 B;  4GYI A;  1OCC H;  3TQN A;  3J7A Y;  1FNN A;  2E7X A;  1OCO H;  1AHD P;  4F3Q A;  5FLV A;  2ZNY A;  3I56 I;  2PQ8 A;  2XB5 A;  4UVC A;  1MBK A;  2PX9 A;  3GUD A;  4LK0 F;  4UHT A;  2JA2 A;  2V1U A;  3WTW C;  1IC8 A;  2LG4 A;  4EQQ A;  2DTR A;  4NUB A;  2DQR A;  3WU0 A;  4ZJZ A;  4XIC A;  3ZPL A;  1JXS A;  2VBX A;  3AG3 H;  3K4N A;  3FIW A;  4JQF A;  3K0L A;  4JX5 A;  3RPU D;  3EYY A;  3SZG A;  4FX4 A;  2LRE A;  4QPQ A;  1VQP I;  4RBO A;  1IW7 F;  1RI7 A;  2HFH A;  2GXA A;  4ESF A;  1T0F A;  5M5W J;  5J8F A;  4PJJ A;  3TED A;  4C3H J;  1YRN A;  3LST A;  1SFK A;  1IRX A;  1PJR A;  4XLP F;  5E1X A;  1A5J A;  2ZME C;  3E1S A;  3SXY A;  1NG6 A;  4P9U A;  3D5S C;  3RDI A;  2DT5 A;  3CD6 I;  2PI0 A;  1ETQ A;  3QPH A;  1DU0 A;  2CS3 A;  5LRR A;  4F92 B;  5JHU A;  4BKX A;  2M0M A;  5F0H A;  5C4X J;  5IY5 H;  5H20 A;  4RS8 A;  3CCE I;  3S93 A;  3M3Y J;  2X85 A;  2CYY A;  4K2E A;  2YU3 A;  3SFZ A;  1OFC X;  2DOE A;  3TDZ C;  1Z6T A;  4GYG A;  4LLL A;  2FRH A;  1OJL A;  2FU4 A;  4L9N A;  2HWV A;  5JR3 A;  4E7K A;  1XMK A;  1UST A;  2JTV A;  4HV5 A;  4C3I J;  2VJ5 A;  4QPO A;  2MW8 A;  1K4T A;  3S3N A;  1HDD C;  2HOA A;  2R5Z A;  1TT0 A;  1DGW Y;  2HDD A;  2X6O A;  5L3D A;  4XSZ F;  4Y52 J;  4IX7 A;  4MHG A;  3ZQ7 A;  3KZZ A;  2VC1 A;  5LGU A;  1K7A A;  2XDV A;  4RDU A;  2K3P A;  2RAE A;  3TO9 A;  4HZF A;  1IGN A;  1FY7 A;  1JGS A;  2VJI A;  4IEJ A;  4ZYA A;  4YIF A;  1WCM J;  4I02 A;  2DO7 A;  3NWS A;  3J81 Z;  2VBY A;  2GLO A;  3CCY A;  3BPX A;  3GZ5 A;  4RGR A;  1U8B A;  4UNO A;  2XAJ A;  4LFU A;  3V4G A;  4U7D A;  4L5I A;  2DW4 A;  1SD6 A;  3BDD A;  3HG9 A;  4AID A;  3I64 A;  4CYD A;  2ZFW A;  3M7G A;  3HOU J;  2OTL I;  3O8H A;  1H0M A;  3GX4 X;  1D0Y A;  4A3E J;  1JGG A;  2HDC A;  2ZBK A;  3JTH A;  4QWQ A;  2ZXH A;  5ILV A;  2V1X A;  4BBR J;  5B66 C;  2DI3 A;  3GTL J;  2F2E A;  5CKT A;  3PIP F;  4XLA A;  1FX7 A;  2JRT A;  4KIF A;  5HLI A;  4MTE A;  4QLC U;  5DM6 F;  2CFX A;  2WTE A;  2P5L C;  2E7W A;  1W7P A;  5HDK A;  4V2G A;  1PP7 U;  2IA1 A;  4CYC B;  4O5V A;  2XAF A;  4XQF A;  1JUP A;  3LFU A;  4CCO A;  2CH0 A;  2ISY A;  2Y0S A;  3RQ4 A;  4ENK A;  1YFH A;  4LIT A;  2R7U A;  1A31 A;  3OL3 A;  1SVL A;  1LQ1 A;  2A6E F;  3JSP A;  1Z0X A;  5J47 A;  2H6B A;  2L7F P;  3TBI A;  1ZQ3 P;  4PJN A;  5TRD A;  1M1E B;  1ZRF A;  2KPM A;  2R7S A;  3ECH A;  3CO7 C;  1MNM C;  3F22 A;  2VUM J;  2K85 A;  4Y33 A;  3K1N A;  2X48 A;  3WOD F;  3BWG A;  3KP3 A;  1W5C C;  3DKX A;  2B7E A;  2MC3 A;  2QBY A;  4JOM A;  3TO6 A;  2M4G A;  2DA1 A;  4JBA A;  2V9P A;  4XSX F;  3BC8 A;  4FTH A;  4ZZD A;  3CCV I;  3OIQ A;  2OC6 A;  5FKN A;  4X1E A;  2E19 A;  1ZG3 A;  3CES A;  2YX7 A;  3GFJ A;  1NTC A;  1TQI A;  1S3J A;  1K78 A;  3WTZ A;  4AWX B;  1YS7 A;  1ZAR A;  3GWZ A;  1QA6 A;  1Y0N A;  2FSW A;  3I59 B;  2HOT A;  2P0W A;  1ZH5 A;  2BY2 A;  1ODD A;  4BQQ A;  3EUH C;  3WTV C;  1BA5 A;  4Y15 A;  4KFC A;  2ADU A;  1EA3 A;  1VF9 A;  3UNG C;  1GLN A;  1OCR H;  4I0B A;  4XKW A;  1A6I A;  2E5N A;  3RKX A;  1TL8 A;  3O3K A;  4J19 A;  1XX5 A;  4BY1 J;  1TWH J;  3VYT B;  1B4A A;  3ZQG A;  1F9N A;  1U9O A;  2R7Z J;  1ZGJ A;  3F72 A;  3I4P A;  3RZD J;  4HRI A;  4DZP A;  4YFK F;  2VQL A;  3M8E A;  2DA5 A;  3P7N A;  5JI6 A;  3WHB A;  2M87 A;  4KUM A;  5HLH A;  1T33 A;  3V7R A;  4KNY A;  2FX0 A;  2JT1 A;  1ORK A;  3ZQH A;  4KN7 X;  2LRD A;  4IHW A;  3GFM A;  5L3F A;  2E2I J;  3OYB A;  1ETW A;  5E8G A;  4L9T A;  4QSH A;  1WJA A;  2NVT J;  2DPU A;  4MQ9 F;  4BHC A;  3RYR A;  4WXD A;  1V4R A;  3CCQ I;  2JUC A;  2WBM A;  5L3B A;  3M8J A;  5ICC A;  5F1J A;  2A69 F;  2COM A;  5FKO A;  2WWY A;  1QVT A;  3JAM K;  3PIO F;  4IQJ A;  3A03 A;  3DEE A;  3K1M A;  4YEL A;  3BQY A;  1HLV A;  2VT2 A;  3L2V A;  3S2W A;  2EFW A;  4GXO A;  2UV1 A;  4YRV A;  2AQF A;  3QP5 A;  1HF0 A;  2NVY J;  3DP7 A;  3HOY J;  3S3M A;  2VXD A;  4FE4 A;  2L9V A;  1R4M B;  3ZN0 A;  2ICW G;  3Q5F A;  5BQT A;  2EIN H;  3G1L A;  3K4C A;  4HG2 A;  4OIP F;  1R1V A;  2HS5 A;  4HW0 A;  2W85 A;  3TOB A;  4CGZ A;  3VSL A;  3I5U A;  2L2O A;  2M7A A;  4L9V A;  2EB7 A;  5FGM A;  4B09 A;  2OV7 A;  2NVX J;  1WSU A;  3C1D A;  1ERD A;  2ZXI A;  2QF7 A;  2P7V B;  1JT0 A;  1A36 A;  3H3V K;  3TKY A;  4GFB A;  3VYU B;  5E18 F;  4XRF A;  3GZ6 A;  4ITV A;  3LAJ A;  1ACI A;  3FXL A;  3ZMT A;  2F4I A;  1IXS B;  4LD5 A;  1W36 D;  1HQC A;  2PJP A;  1G4D A;  1WVR A;  1VQ5 I;  3HOW J;  3MD2 A;  2A07 F;  2LKP A;  4WXH A;  2LP0 A;  1N77 A;  1J0R A;  3V7S A;  4IVN A;  1AU7 A;  1TW3 A;  2BY1 A;  4EEF G;  1T39 A;  4II3 A;  1V55 H;  1VZ0 A;  1XGN A;  2CO5 A;  5FLM J;  4RLQ A;  2WAF A;  3C7J A;  2E60 A;  1I50 J;  3JTG A;  1S72 I;  2VLA A;  2IA2 A;  3HOV J;  3KP6 A;  2RRE A;  4B3A A;  1X2M A;  4ZC3 A;  4Z2Y A;  2IRF G;  1X4O A;  4UVA A;  1T2K A;  2TRT A;  2W1O A;  3ELK A;  2QKL B;  3D5L A;  2PN6 A;  5F27 A;  3AL0 B;  3EPZ A;  3FHN A;  3K6G A;  4Y13 A;  3BJO A;  1RPW A;  2ZJR F;  3QAH A;  5HNF A;  3NAR A;  1ETV A;  3Q0V A;  1D0X A;  3TP3 A;  2OTJ I;  1PUF B;  1RZ4 A;  4IHV A;  3K2A A;  4NQW A;  1ETO A;  3SFI A;  1YIT I;  3G6E I;  3CJR B;  2MG4 A;  1VQO I;  2IBD A;  3KYL A;  1MH4 A;  1XGO A;  4CCJ A;  3K70 C;  1C0W A;  2O03 A;  3OYA A;  2STT A;  5F1R A;  1UHM A;  4OIN F;  1CGP A;  2Y0M A;  3TW6 A;  1MSE C;  5HVQ C;  2V6E A;  2ZJP F;  1E17 A;  5LD2 C;  1J7K A;  2Z5U A;  2VKH A;  3F8N A;  3KP5 A;  5IPA A;  2QSH X;  5FKM A;  1RKW A;  3I59 A;  3RKW A;  3DLL F;  3BJA A;  1W4M A;  1XB4 A;  2D1H A;  4HYE A;  3HRT A;  2VJJ A;  4HST A;  5E3N A;  2D2W A;  1HA8 A;  1O3Q A;  4ENJ A;  1UMQ A;  2JRM A;  3S15 J;  4ZYE A;  2DMN A;  4CCN A;  2QSF X;  4BY7 J;  3WE3 A;  2OQR A;  3TDU C;  2CW8 A;  1TC3 C;  3WU2 C;  3S17 J;  1IRZ A;  2H6C A;  4GRI A;  2F4M B;  1FOX A;  5DTD A;  3IAM 2;  2FNA A;  5K7F A;  4C2T A;  4M6Y A;  3FHZ A;  1ZAO A;  5KHD A;  1BN5 A;  1WI9 A;  2E71 A;  1R49 A;  3HPG A;  3J80 K;  1IV8 A;  2C6Y A;  2CU7 A;  4Y3O A;  3F23 A;  4XLE A;  2KZG A;  5E8I A;  5LRS A;  2GIZ A;  5FD5 A;  3L00 A;  2E1M B;  3S1N J;  2YR2 A;  3ZQC A;  1P4X A;  4L5J A;  4CXF A;  6PAX A;  3HSR A;  5GTH C;  4R79 A;  4ESB A;  2Y75 A;  2UZK A;  1RIO H;  4U87 A;  2ZXW H;  3CJN A;  3K9T A;  1SAX A;  3HHG A;  3CCJ I;  1OCP A;  2XF6 A;  2N8G A;  3IRR A;  1XC5 A;  3M1C A;  2NNY A;  4HDU A;  4A0X A;  1AWC A;  2ECC A;  2JA8 J;  4NNJ A;  1FEX A;  1YS6 A;  3FIS A;  4JX6 A;  2A6H F;  3KZI C;  4RAZ A;  2Z2S B;  2LD5 A;  3R0A A;  1S7E A;  4UUS B;  1REP C;  5KNL A;  1XCV A;  3A2K A;  2NVQ J;  4UUT A;  4BBS J;  1CF7 B;  2EK5 A;  3CJT B;  4KT5 C;  5EJC A;  2O0Y A;  2BXY A;  1YTY A;  1YX5 A;  5BOX A;  2ZME A;  2LF7 A;  2DMT A;  3IV5 A;  2BHZ A;  4EGZ A;  1QPM A;  3LSR A;  3GCM A;  2K9N A;  2DPD A;  1ZGA A;  4PJL A;  3KEO A;  3IAS 2;  4DBQ A;  2NOJ B;  1Y39 A;  3L7W A;  5TGT A;  4BE2 A;  2VON A;  2V26 A;  3BG3 A;  2OCE A;  1X1P A;  5D5X B;  2RQQ A;  4XOT A;  4E4H A;  3IL2 A;  1DQU A;  2L4A A;  2FJ1 A;  2GOM A;  3GTO J;  3HOS A;  3LA2 A;  1WH5 A;  2FMY A;  3W3C A;  1EH7 A;  1BR1 A;  4A3G J;  3WU1 B;  3QPS A;  4AYB A;  2CWE A;  2R3S A;  3F9K A;  4NHJ A;  1LFP A;  2CQK A;  2HQR A;  4B4C A;  3RJP A;  3B6A A;  5H2F C;  1B9N A;  3FM5 A;  5K5R A;  2XGE A;  2LC2 A;  3FXR A;  3HJE A;  1G2H A;  2NOG A;  2VOO A;  1QO0 D;  1FWZ A;  3K4L A;  1I6H J;  5FFX A;  2KQR A;  1DGR M;  3ULQ B;  3D1N I;  4BNC A;  1YW9 A;  3H0G J;  3I71 A;  2MGQ A;  3KEQ A;  3M8F A;  1OCZ H;  4CCK A;  5M3M J;  4A69 C;  4HOB A;  2QQ8 A;  3KX2 A;  3PL8 A;  3HOZ J;  3E97 A;  1QHG A;  1OCT C;  2BY0 A;  4H0E A;  1KZH A;  3IC7 A;  3E5Q A;  5ICF A;  1U0J A;  2B9S A;  2IA0 A;  4HNT A;  1FC3 A;  3WG9 A;  4FX0 A;  1ON1 A;  2GZW A;  2LKS A;  2CJJ A;  4W97 A;  3MEX A;  3DU6 A;  2W82 A;  2QCO A;  4EAT A;  2F5E A;  2WA0 A;  3I55 I;  1D8K A;  2CV0 A;  1UJ8 A;  4PSW A;  5EEG A;  3DKW A;  1RET A;  1PUF A;  5GPA A;  2DCE A;  2P7C B;  1D1B A;  4UV8 A;  3KP7 A;  3U21 A;  2PBI A;  5B1A H;  1MW7 A;  1WI3 A;  4P96 A;  1YQA A;  5CVU A;  3LAP A;  1X2N A;  4RM3 A;  1YJN I;  5IOZ A;  1UHW A;  2DDB A;  2K3F A;  4J00 A;  2K7L A;  3ZMZ A;  1K61 A;  4L18 B;  3BG6 A;  2FUG 2;  3R6S A;  3BR5 A;  3OYE A;  3OYK A;  1VQ8 I;  4IO9 F;  2M4K A;  2DOA A;  4YEJ A;  4RB1 A;  3MKZ A;  5JVT A;  1FPQ A;  1R1T A;  2J5P A;  3GXO A;  1IXC A;  2L7M P;  4OOI A;  2MFZ A;  1A35 A;  1SC7 A;  1R7J A;  1K4S A;  3OYI A;  1IN4 A;  2O8X A;  3H9Q A;  2A5W A;  4HX4 A;  2EWN A;  2I8D A;  4UB8 C;  3ESW B;  2E2J J;  5E20 A;  1MIJ A;  2Q2E B;  3WGH A;  4JK1 X;  1FBQ A;  1YJ9 I;  1OQY A;  3GME A;  1TBX A;  1WHU A;  2KIF A;  4BAY A;  2HPM A;  2LFB A;  4KMF A;  4O3M A;  3CJQ B;  4HNU A;  1HDP A;  2KJC A;  3X2Q H;  4A3D J;  2ZXJ A;  4IRI A;  2DK5 A;  2LNB A;  3EQL F;  1TW2 A;  5BMZ A;  2JPC A;  3DTK A;  3BZ6 A;  2VKD A;  5LHG A;  4D1Q A;  3NWT A;  4IHY A;  2JWT A;  1EV7 A;  1X1C A;  1GT0 C;  3PO3 J;  2ESH A;  2LH9 A;  4A3F J;  3RI4 A;  2RNG A;  5ICE A;  3CTA A;  2DA4 A;  1VQ7 I;  3EUH A;  3KIO A;  1TNT A;  2CMP A;  3K2Z A;  2L01 A;  3CP8 A;  2HPI A;  2VQH A;  4FE7 A;  3W2A A;  1T38 A;  2EZH A;  4NB5 A;  2F5C A;  4CCM A;  1YOV B;  3ZN1 A;  3TW7 A;  1WJD A;  2XPW A;  3PSI A;  3F8F A;  1B6A A;  4A3B J;  2V7F A;  4UUS A;  3OL4 A;  2DLL A;  1T98 A; 
#chains in the Genus database with same CATH homology
 2MBF A;  3REO A;  3F21 A;  1SD4 A;  2QVO A;  4L9J A;  4MTD A;  2RVC A;  4O6J A;  1XCB A;  4KA4 A;  2KRF A;  2QM3 A;  3MZH A;  3T8R A;  1ZLK A;  2RDP A;  3C18 A;  3HOT A;  2W57 A;  5K1Y A;  4ETS A;  4LB5 A;  3BY6 A;  5AIP A;  4IRG A;  4WCG A;  4EM2 A;  5DD8 A;  3MZY A;  2Z9O A;  3Q9V A;  5J8C A;  3TOA A;  1G6N A;  2HEO A;  1D3Y A;  1ULY A;  2DQL A;  4KIC A;  4OIQ F;  4CDG A;  3DQV C;  4N9I A;  4A0Y A;  1B59 A;  3IRQ A;  2B0L A;  4LLN A;  1R5G A;  2XKP A;  3R4K A;  3MFK A;  2L3D A;  1PDN C;  1BC7 C;  1TTY A;  3HUG A;  1YW7 A;  3U9G A;  4L0Z B;  5DUK A;  5AIQ A;  4RGS A;  1MDM B;  4MQV A;  4ZH4 F;  5BPI A;  2HKX A;  3VB2 A;  2ACJ A;  1SMT A;  2STW A;  4CO8 A;  3NQO A;  3HYI A;  1SD5 A;  5CVJ A;  4P5O A;  4B8X A;  1FP1 D;  2ZNZ A;  1RNL A;  5DDG A;  4ON0 A;  2RNJ A;  2RGV A;  3WTT C;  2H27 A;  1BIA A;  4LG0 B;  5DV5 A;  4LK1 F;  1JE8 A;  2ZO4 A;  3LQQ A;  4HAM A;  1G3Y A;  4DQ2 A;  2H94 A;  2E1N A;  3DEU A;  3P9C A;  5F6F A;  1MZB A;  1KA8 A;  4AIH A;  1MJA A;  1ZYR F;  2GA2 A;  2GXG A;  2VE9 A;  2J5O A;  1L0O C;  2FBI A;  4GCV A;  4UVB A;  2Z3Y A;  1S29 A;  2ESN A;  1FP2 A;  3HSE A;  4WF2 A;  2MD5 A;  3FWE A;  2PMU A;  3LA7 A;  4PZJ A;  1S7O A;  4M9Z A;  3KLO A;  3HSF A;  2XRO A;  3QPT A;  1FBS A;  1XSV A;  2BBY A;  2UXN A;  4RB0 A;  4Y17 A;  4OIR F;  4IPA A;  3KET A;  4RGU A;  2VXZ A;  1GXP A;  3FMS A;  4CHU A;  3P9K A;  3PFI A;  2HKO A;  3COA C;  2ZKZ A;  1LJ9 A;  2RQP A;  5E17 F;  3IKT A;  4M74 A;  2G7U A;  2JPB A;  4IXA A;  5L3G A;  1J2X A;  1J5Y A;  2L4M A;  5LLQ A;  3FF5 A;  1U8R A;  2FEZ A;  3NRV A;  3L09 A;  1FYL A;  2PLY A;  3PQJ A;  4XLN F;  1FLI A;  3FM3 A;  3H3U A;  4WXC A;  3H92 A;  3KP4 A;  4I98 B;  2OZ6 A;  3LQR A;  1DP7 P;  3I53 A;  4IF4 A;  3ECO A;  3GW2 A;  2Q8K A;  5ILU A;  1R1U A;  4KYW A;  2XVC A;  2EFP A;  4HF1 A;  3GLX A;  4BYY A;  4U0Y A;  2DFI A;  4G94 A;  2R7D A;  2X4H A;  4Q48 A;  3E6C C;  4DNC A;  3KCC A;  1SMY F;  4UXN A;  1HKT A;  2L54 A;  3EYI A;  4G6Q A;  1FSH A;  4I0A A;  1I6X A;  2EFQ A;  5DEQ A;  2EV5 A;  3ZMU A;  3JAM Z;  5HS9 A;  1W5S A;  5LHI A;  1IAW A;  2BE5 F;  1BIB A;  1XSX A;  1UFM A;  3QU6 A;  1BI3 A;  3AAF A;  5DCF A;  1ZRD A;  1FT9 A;  4WK8 F;  2M1B A;  3R61 A;  2QQ9 A;  3VOE A;  4EJU A;  1DPU A;  1X3U A;  1F5T A;  1YIO A;  3MAJ A;  1G3W A;  5A2Q Z;  3N97 A;  4ASN A;  2CW0 F;  1O7F A;  1D8J A;  1KU9 A;  3F8C A;  3H3Z A;  1XDS A;  2M5W A;  1K6O A;  4M6X A;  1T6S A;  1HKS A;  2EA2 A;  4HQM A;  4A0Z A;  3LWF A;  2ISZ A;  1BI1 A;  4XBF A;  3IHU A;  3CUO A;  2O3F A;  4WWC A;  3QOP A;  2K27 A;  4G9Y A;  3I58 A;  4PGH A;  1KGS A;  3KFW X;  2OZU A;  2OBP A;  3W6K B;  1FOK A;  4D0P A;  2XUB A;  2K02 A;  3HRU A;  3GFL A;  4N0B A;  1MJB A;  3F6V A;  2IP2 A;  1S8N A;  1PP8 F;  3IWF A;  5LHH A;  4G7H F;  1KQ0 A;  1TNS A;  1O7L A;  5AON A;  1KU3 A;  3WTS C;  4ZYG A;  1R5H A;  3EET A;  3I0T A;  1LDD A;  1SFE A;  4ZYD A;  3LFK A;  2RV8 A;  1ZN2 A;  1R23 A;  5FLX K;  3BPV A;  1J75 A;  4HDV A;  1SFX A;  1BJA A;  1P6R A;  4KMU X;  3DPT A;  5K5Q A;  1HW2 A;  2FF4 A;  3Q9S A;  4EGY A;  2FBH A;  5HLG A;  1WRJ A;  3T1B A;  1Z9C A;  2UXX A;  2PFB A;  4RGX A;  3J80 Z;  3OOP A;  3QRF F;  2G9W A;  1O3S A;  3ERE D;  4A12 A;  1I1S A;  2IJL A;  1R22 A;  2QLZ A;  2IT0 A;  2KKO A;  5D6F A;  3V8K A;  1IN5 A;  3QP6 A;  3E6M A;  1Z7U A;  3KZY A;  4LLG F;  5E1Z B;  1QQI A;  1YW8 A;  1BBY A;  4BHP A;  1MJ9 A;  3RPQ A;  2VN2 A;  3ISP A;  1STZ A;  5CVV A;  3V8L A;  2QWW A;  1MGT A;  3MWM A;  3V8J A;  4BXU A;  4L0Y B;  3O6B B;  1MD0 A;  1FYM A;  4AIK A;  4U7B A;  4EVI A;  1IN7 A;  4EV0 A;  1OPC A;  5D4R A;  2XAQ A;  4CIC A;  2WV0 A;  1W7P D;  2XRN A;  5DYM A;  2VOD A;  2W24 A;  4PCQ A;  5TJJ A;  4MGR A;  4PDK A;  5DD4 A;  2DAO A;  3SZT A;  2QZ8 A;  4UV9 A;  3CO6 C;  2L02 A;  5F64 A;  3QU3 A;  1RUO A;  2JSC A;  3FZV A;  4LMY A;  2FOK A;  3RIR A;  4G6D A;  4KN4 X;  1TLH B;  1OYI A;  1EH6 A;  2QYO A;  1YG2 A;  2EA4 A;  2F5F A;  5JFR A;  4P55 A;  1XMA A;  2V6C A;  4ZYH A;  5IT9 K;  1HBX G;  1F4K A;  5LGN A;  1HSJ A;  2P6S A;  2EV0 A;  3ZMS A;  3L2C A;  1SD7 A;  4HF2 A;  1V3F A;  5EEH A;  3L9F A;  1ON2 A;  1LDK B;  2EJR A;  1XDU A;  3F3X A;  3HRS A;  2LF8 A;  1OYW A;  3GO5 A;  1R58 A;  1IUY A;  4HX8 A;  3VOD A;  2OD5 A;  1BC8 C;  1BOA A;  4YFX F;  1EH8 A;  3WGI A;  3DF8 A;  2P4W A;  1W7P B;  1IRG A;  2MLK A;  3KP2 A;  3HTU A;  3DPL C;  3RYP A;  2RN7 A;  1IF1 A;  4BQA A;  4G8X A;  3T5X A;  4S04 A;  3VFZ A;  1Q1H A;  3V7C A;  2FML A;  4ZZL A;  4OMZ A;  1CF7 A;  1O3R A;  3CLO A;  5LBQ A;  1Z1D A;  1H9G A;  5CVR A;  4P9F A;  2M45 A;  2QBY B;  1QBJ A;  4PGG A;  5FD6 A;  5H6Q A;  2BV6 A;  4A6E A;  5ICG A;  1KYW A;  1QGP A;  1U3E M;  5BPD A;  4MEY F;  1O3T A;  2NAZ A;  3SZP A;  1LB2 A;  2FBK A;  2Q0O A;  1IZ1 A;  2JZY A;  2WC2 A;  1HW1 A;  4HLY A;  3TO7 A;  2QEN A;  2MLG A;  1F1Z A;  3DXJ F;  2K4B A;  2AS5 F;  5KVR A;  4FHT A;  1XGS A;  1TQP A;  5FO5 A;  4TV7 A;  2V79 A;  5D5W B;  1JHF A;  3J81 K;  4EJV A;  3N4M A;  1XGM A;  5ED4 A;  2FNP A;  2KIU A;  2LSO A;  1XN7 A;  2OU2 A;  5ERI A;  1HST A;  4GO1 A;  2O6G E;  2GXB A;  1L3L A;  2HQN A;  5ILS A;  2HTS A;  2PEX A;  4M71 A;  3E5X A;  1OMI A;  2KJB A;  2NYX A;  4CZZ A;  2NNN A;  1LEB A;  2EFN A;  2P5K A;  1KQ8 A;  3F6O A;  3MCZ A;  1PUE E;  4YG2 F;  3FXU A;  3T0Y A;  1UB9 A;  5HDG A;  2Q2E A;  2M30 A;  1GHC A;  2A3S A;  1QZY A;  3DFG A;  1ZHF A;  1DUX C;  2VBW A;  4EJT A;  2HGC A;  2GAU A;  4YII A;  1ZG1 A;  5DUI A;  5BS6 A;  1B1B A;  4IJA A;  2VE8 A;  3R60 A;  4LB6 B;  2ELH A;  1OYY A;  5L3E A;  4RB2 C;  4G7O F;  1YYV A;  3FMR A;  3K69 A;  2P5V A;  1I5Z A;  2A61 A;  3CUQ B;  3ML6 A;  5KK1 A;  2XKO A;  2UWM A;  1GVJ A;  4HBL A;  4M9X A;  1W5T A;  4EMS A;  2HZT A;  3JSO A;  2VBZ A;  5HDN A;  5FFZ A;  3C3W A;  1OKR A;  1FBU A;  2OQG A;  2QUF A;  2HR3 A;  1FYK A;  3GVA A;  1H9T A;  4I01 A;  1FZP B;  3GEZ A;  2BGC A;  2QQB A;  2Z99 A;  5FB2 A;  3HTS B;  1U5T B;  2BYV E;  3F8M A;  3SHF A;  5D5U B;  1ONV A;  3M1E A;  2A68 F;  2RKH A;  3G73 A;  1QNT A;  3CDH A;  3D0S A;  2W25 A;  5DCM B;  1QZZ A;  2TDX A;  4I7H A;  2VOP A;  3DV8 A;  2P6T A;  4LJZ F;  2DU9 A;  2K86 A;  5D8L B;  4ENN A;  2VT3 A;  1ZG5 A;  1KYZ A;  1LVA A;  1MDM A;  4HLX A;  5E1W A;  1ZRC A;  1IRF A;  5CJ9 A;  1S6L A;  2Z33 A;  3E3V A;  3FX3 A;  1Z05 A;  1GXQ A;  2IW5 A;  4RB3 C;  1HW5 A;  3RTR A;  1DDN A;  2FXA A;  1BI0 A;  4WX9 A;  4Q47 A;  2ZME B;  4LG0 A;  1A04 A;  4EM1 A;  4I09 A;  1IN8 A;  2M8E A;  2QQA A;  4KIB A;  3RPU A;  2VC0 A;  5A2Q K;  3EDP A;  1SFU A;  4UUV A;  1RUN A;  3O2P E;  2GA1 A;  3BP8 A;  2G7H A;  3PQK A;  4EJO A;  1XD7 A;  2YX4 A;  1P2F A;  1P92 A;  2FA5 A;  2DK8 A;  3BJ6 A;  4U88 A;  4EJW A;  5L3C A;  2PMH A;  4AVP A;  2ZJ2 A;  2KIM A;  4A2U A;  2W84 A;  5K5O A;  3WTX C;  4KDP A;  3NEU A;  1O57 A;  4BHB A;  1DPR A;  3JW4 A;  5CVI A;  4F7Z A;  1I27 A;  1UCR A;  3GYH X;  3CUQ A;  2Y48 A;  4U0W A;  4OMY A;  1G3S A;  1KU7 A;  3BOQ A;  4MEX F;  1E2X A;  1U6G A;  2A5Y B;  4HV6 A;  2GQQ A;  2IPQ X;  1IN6 A;  2D45 A;  4M9S A;  2HYG D;  1U78 A;  5LGT A;  2AXL A;  1J9I A;  1P4A A;  2XIG A;  2GIV A;  2EFO A;  3FMQ A;  1ZLJ A;  4E70 A;  1I1G A;  2V9V A;  2XAG A;  2BEO A;  2H09 A;  2FE3 A;  1NHA A;  3E6B A;  1WKM A;  2MH2 A;  1R00 A;  2HYF A;  3J7A O;  3VEP A;  3KLN A;  1YLF A;  3GFI A;  4GGG A;  1KU2 A;  1K79 A;  4Q4Z F;  1U5T A;  2CSO A;  2YSR A;  4U0V A;  3IKV A;  2ZCW A;  5DCM A;  1ZRE A;  1LDJ A;  3K1P A;  2F5D A;  1HXD A;  2PG4 A;  2GWR A;  5CYV A;  3BRO A;  1Z6R A;  2LDU A;  4ENM A;  4IRH A;  3MQ0 A;  4AD9 A;  1TQM A;  3P9I A;  4YFN F;  1T98 A;  2XGX A;  3ABT A;  3HRM A;  4S05 A;  1WWX A;  2RC4 A;  2R7F A;  2OAZ A;  3B02 A;  2E1C A;  3ZMV A;  2NS0 A;  1FSE A;  1BM9 A;  1KQ9 A;  5LEJ A;  3FXQ A;  4M72 A;  5J6X A;  4HF0 A;  2DBB A;  3U2R A;  2MA3 A;  3E6D A;  3B73 A;  3OV8 A;  1VTN C;  3T8T A;  5FLX Z;  4BH9 A;  4MNU A;  2P8T A;  3RKY A;  4R8H A;  5D6E A;  3ROU A;  4M73 A;  1Z91 A;  1LNW A;  3ZP5 A;  3LA3 A;  1AOY A;  2D1V A;  2V1D A;  1B9M A;  1S7A A;  4HX7 A;  3SQN A;  5H6R A;  5HOO A;  4HQE A;  4KIG A;  1JHH A;  2K4J A;  2MH9 A;  4RAY A;  4I2O A;  2XAS A;  3KE2 A;  2YPR A;  2EV6 A;  4R1H A;  4IHT A;  2HOE A;  1Y0U A;  4LGW A;  2X0L A;  1R36 A;  2XAH A;  1IXR C;  4N9H A;  2O61 A;  4IHS A;  3W6J B;  5HS7 A;  5HS8 A;  2HTJ A;  1HKQ A;  3M9A A;  4A5N A;  3TGN A;  3WGG A;  1J59 A;  3HIF A;  2XHK A;  1YO5 C;  3CUQ C;  1XSD A;  3WTY C;  3G3Z A;  4A5M A;  1LEA A;  1MKM A;  5D5V B;  3IWZ A;  3U1D A;  4G7Z F;  5D4S A;  3GF2 A;  1P4W A;  4A6D A;  5CLS A;  4OU0 A;  3E5U A;  4FT8 A;  2NRA C;  2CGP A;  5IT9 Z;  3R0J A;  1G3T A;  4HA8 A;  5LEK A;  4OIO F;  2OA4 A;  4AIJ A;  1OR7 A;  3I54 A;  2FQ3 A;  1U5T C;  1USS A;  3WE2 A;  2IVM A;  3HHH A;  1WQ2 A;  1D5V A;  3F8B A;  3WTU C;  2ETH A;  5D8K B;  4Q5S F;  1BI2 A;  5IT3 A;  4ESJ A;  2XV4 S;  4EM0 B;  2CG4 A;  1U2W A;  3ABU A;  1K78 B;  4GYI A;  3TQN A;  1FNN A;  2E7X A;  2ZNY A;  2PQ8 A;  4UVC A;  3GUD A;  4LK0 F;  4UHT A;  2V1U A;  3WTW C;  4EQQ A;  2DTR A;  2DQR A;  3WU0 A;  3ZPL A;  1JXS A;  2VBX A;  4JQF A;  3K0L A;  4FX4 A;  3EYY A;  1IW7 F;  1RI7 A;  2HFH A;  4ESF A;  1T0F A;  5J8F A;  3LST A;  4XLP F;  5E1X A;  3SXY A;  4P9U A;  3RDI A;  2DT5 A;  2PI0 A;  3QPH A;  5LRR A;  5JHU A;  5H20 A;  4RS8 A;  2CYY A;  4K2E A;  2YU3 A;  3SFZ A;  3TDZ C;  1Z6T A;  4GYG A;  4LLL A;  2FRH A;  2FU4 A;  4L9N A;  2HWV A;  5JR3 A;  1XMK A;  1UST A;  2JTV A;  4HV5 A;  5L3D A;  4XSZ F;  4MHG A;  3ZQ7 A;  3KZZ A;  2VC1 A;  5LGU A;  1K7A A;  3TO9 A;  4HZF A;  1FY7 A;  1JGS A;  4YIF A;  4I02 A;  2DO7 A;  3J81 Z;  2VBY A;  3BPX A;  3GZ5 A;  4RGR A;  4UNO A;  2XAJ A;  4LFU A;  3V4G A;  4U7D A;  4L5I A;  2DW4 A;  1SD6 A;  3BDD A;  3I64 A;  4CYD A;  2ZFW A;  3M7G A;  1H0M A;  3GX4 X;  2HDC A;  2ZBK A;  3JTH A;  4QWQ A;  5ILV A;  2V1X A;  2DI3 A;  2F2E A;  1FX7 A;  2JRT A;  4KIF A;  5HLI A;  4MTE A;  4QLC U;  2CFX A;  2WTE A;  2P5L C;  2E7W A;  1W7P A;  5HDK A;  1PP7 U;  2IA1 A;  4O5V A;  2XAF A;  2ISY A;  4ENK A;  1YFH A;  1LQ1 A;  2A6E F;  3JSP A;  2H6B A;  5TRD A;  1ZRF A;  3ECH A;  3CO7 C;  3F22 A;  3K1N A;  3WOD F;  3BWG A;  3KP3 A;  2MC3 A;  2QBY A;  3TO6 A;  4JBA A;  4XSX F;  4ZZD A;  1ZG3 A;  2YX7 A;  3GFJ A;  1TQI A;  1S3J A;  1K78 A;  3WTZ A;  4AWX B;  1YS7 A;  1ZAR A;  3GWZ A;  2FSW A;  3I59 B;  1ZH5 A;  1ODD A;  3WTV C;  4Y15 A;  4KFC A;  2ADU A;  4I0B A;  3RKX A;  3O3K A;  1B4A A;  1F9N A;  1ZGJ A;  3F72 A;  3I4P A;  4YFK F;  3M8E A;  3P7N A;  5JI6 A;  2M87 A;  4KUM A;  5HLH A;  3V7R A;  4KNY A;  2JT1 A;  4KN7 X;  3GFM A;  5L3F A;  5E8G A;  4L9T A;  2DPU A;  4MQ9 F;  4BHC A;  3RYR A;  4WXD A;  1V4R A;  5L3B A;  5ICC A;  2A69 F;  2COM A;  2WWY A;  3JAM K;  3K1M A;  2VT2 A;  3S2W A;  2EFW A;  4GXO A;  3QP5 A;  3DP7 A;  3ZN0 A;  3Q5F A;  5BQT A;  4OIP F;  1R1V A;  2HS5 A;  4HW0 A;  2W85 A;  3TOB A;  4CGZ A;  3I5U A;  4L9V A;  2EB7 A;  5FGM A;  4B09 A;  1WSU A;  3C1D A;  2P7V B;  3TKY A;  5E18 F;  4XRF A;  3GZ6 A;  3LAJ A;  3ZMT A;  1IXS B;  4LD5 A;  1HQC A;  2PJP A;  1G4D A;  2A07 F;  2LKP A;  4WXH A;  1J0R A;  3V7S A;  4IVN A;  1TW3 A;  1T39 A;  1XGN A;  2CO5 A;  3C7J A;  3JTG A;  2IA2 A;  3KP6 A;  4Z2Y A;  2IRF G;  4UVA A;  1T2K A;  3ELK A;  3D5L A;  2PN6 A;  4Y13 A;  3BJO A;  3QAH A;  1RZ4 A;  4NQW A;  1XGO A;  1C0W A;  2STT A;  2O03 A;  5F1R A;  1UHM A;  4OIN F;  1CGP A;  2Y0M A;  5HVQ C;  1E17 A;  1J7K A;  2Z5U A;  3F8N A;  3KP5 A;  3I59 A;  3RKW A;  1W4M A;  3BJA A;  1XB4 A;  2D1H A;  4HYE A;  3HRT A;  2D2W A;  1O3Q A;  4ENJ A;  4ZYE A;  3WE3 A;  2OQR A;  3TDU C;  2H6C A;  2FNA A;  4M6Y A;  3FHZ A;  1ZAO A;  1BN5 A;  1WI9 A;  3J80 K;  2C6Y A;  3F23 A;  5E8I A;  5LRS A;  5FD5 A;  3L00 A;  2YR2 A;  1P4X A;  4L5J A;  4CXF A;  6PAX A;  3HSR A;  4R79 A;  4ESB A;  2Y75 A;  2UZK A;  1RIO H;  3CJN A;  3K9T A;  1SAX A;  3HHG A;  3IRR A;  2NNY A;  4HDU A;  4A0X A;  1AWC A;  1YS6 A;  2A6H F;  4RAZ A;  3R0A A;  1REP C;  1XCV A;  1CF7 B;  2EK5 A;  4KT5 C;  1YTY A;  2O0Y A;  5BOX A;  2ZME A;  2LF7 A;  4EGZ A;  1QPM A;  2DPD A;  1ZGA A;  3KEO A;  3L7W A;  2VON A;  5D5X B;  3IL2 A;  2L4A A;  3HOS A;  3LA2 A;  2FMY A;  1EH7 A;  3WU1 B;  4NHJ A;  2CWE A;  2R3S A;  2CQK A;  2HQR A;  3RJP A;  1B9N A;  3FM5 A;  5K5R A;  3FXR A;  2VOO A;  1QO0 D;  1FWZ A;  5FFX A;  3ULQ B;  4BNC A;  1YW9 A;  3I71 A;  3KEQ A;  3M8F A;  4HOB A;  3E97 A;  4H0E A;  3IC7 A;  3E5Q A;  5ICF A;  2IA0 A;  1FC3 A;  3WG9 A;  4FX0 A;  1ON1 A;  2GZW A;  3MEX A;  2F5E A;  1D8K A;  5EEG A;  3DKW A;  2P7C B;  4UV8 A;  3KP7 A;  2PBI A;  4P96 A;  1YQA A;  5CVU A;  3LAP A;  1UHW A;  2K7L A;  3ZMZ A;  4L18 B;  3R6S A;  4RB1 A;  5JVT A;  1FPQ A;  1R1T A;  2J5P A;  3GXO A;  1IXC A;  4OOI A;  1R7J A;  1IN4 A;  2O8X A;  4HX4 A;  2EWN A;  5E20 A;  3WGH A;  4JK1 X;  1FBQ A;  1TBX A;  2KIF A;  4KMF A;  4BAY A;  4O3M A;  2KJC A;  2ZXJ A;  4IRI A;  2DK5 A;  2LNB A;  3EQL F;  1TW2 A;  5BMZ A;  2JPC A;  3BZ6 A;  5LHG A;  1EV7 A;  2ESH A;  3RI4 A;  5ICE A;  3CTA A;  3EUH A;  1TNT A;  3K2Z A;  2L01 A;  1T38 A;  4NB5 A;  2F5C A;  3ZN1 A;  3F8F A;  1B6A A;  2DLL A;  3ZMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...