1R7JA

Crystal structure of the dna-binding protein sso10a from sulfolobus solfataricus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
KKSKLEIIQAILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEGKQYMLTKKGEELLEDIRKFNEMRKNMDQLKEKINSVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Conserved hypothetical protein Sso10a
publication title The hyperthermophile protein Sso10a is a dimer of winged helix DNA-binding domains linked by an antiparallel coiled coil rod.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 35
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2003-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14947 HTH_45 Winged helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r7jA00
3HRTA 2IT0A 5FO5A 2VE8A 1S7OA 5D5VB 2DW4A 4HV6A 3BPVA 2VC1A 3LQQA 2WWYA 5BPDA 3IHUA 4BYYA 1EV7A 1U5TC 2NRAC 2KKOA 4BHPA 1XDSA 5BPIA 5LLQA 4NB5A 1IN7A 2BE5F 2DPUA 4EJUA 1IXSB 1J9IA 5DV5A 3HRMA 4IRGA 1IAWA 4OMZA 1D8JA 4Q4ZF 2P6TA 2XAHA 3EQLF 2LF8A 1U8RA 4CDGA 4G6DA 4MEXF 3I71A 3J7AO 1KA8A 2PQ8A 1T6SA 5HDGA 3LAPA 2HR3A 3CO6C 2ZMEA 2V1DA 4KIBA 2KIUA 1EH8A 4RB3C 2GA2A 4UVAA 2BV6A 3DV8A 2V6CA 3BP8A 2VC0A 3F8MA 1FYMA 4RGUA 2RVCA 4MHGA 3V4GA 2TDXA 1FBSA 4YFNF 1BN5A 1Z6TA 2L4MA 1LVAA 1S3JA 2L3DA 4IXAA 2UXXA 5EEGA 4G7ZF 4PDKA 2VT3A 1I27A 3TDZC 1ZRFA 3WU0A 4ZYEA 3M7GA 2ZXJA 1MDMA 1RI7A 1D5VA 2R3SA 4LB6B 4CGZA 2HFHA 2ZO4A 1LJ9A 2DT5A 2Z99A 5BQTA 1GHCA 1KQ0A 2YSRA 3R6SA 3GW2A 3GFIA 5KVRA 3ERED 1R5HA 1FYKA 3QU6A 4I0BA 1TW3A 3B73A 4EV0A 1O3RA 4CO8A 2M30A 3BPXA 4HLXA 3BJAA 2D1HA 3MZYA 3P9KA 3VEPA 5HS8A 2D1VA 4RGSA 1ZLKA 2OBPA 3WG9A 1B4AA 3RKWA 4PGHA 3K1NA 2COMA 3GZ5A 2DAOA 2BBYA 3LA2A 4A6EA 1K78B 5JR3A 4LMYA 1R7JA 3GYHX 2XV4S 4S05A 5CVJA 3K1MA 1ZG1A 2HTJA 3HYIA 1T0FA 3KEQA 3T8RA 4IRIA 4OIRF 3P7NA 2OQRA 3LFKA 3ZMTA 5ICFA 4I01A 3HSEA 3K0LA 3EYYA 1F5TA 4ON0A 2YR2A 3HSFA 4CHUA 4Q47A 3GF2A 3SZTA 3E6CC 2LNBA 3E5QA 1ULYA 3GWZA 4K2EA 4HZFA 1RIOH 2EA4A 2GAUA 3S2WA 3GUDA 1CF7A 3ROUA 4ZYDA 3JSPA 2CWEA 2FBIA 4WXDA 4L0ZB 3KZZA 1U6GA 2JSCA 2R7FA 2L02A 2XAFA 3CTAA 4P55A 1MD0A 2ZFWA 1FP1D 1SFXA 2ELHA 3BZ6A 3SFZA 4A5NA 4BH9A 1O3SA 2H6CA 1AWCA 2Q8KA 3WTSC 3PQJA 4CXFA 3I59B 4FX0A 2OU2A 4BQAA 3LQRA 1OYIA 4R8HA 3O2PE 3R0AA 5E8GA 3J80K 1U2WA 2RGVA 2DPDA 4P9FA 4ESBA 2BYVE 4WCGA 5DD8A 5JVTA 2HYGD 2W24A 4I02A 4OMYA 3WTTC 1I5ZA 4G9YA 2BEOA 4GCVA 1H0MA 2FEZA 1I6XA 1LNWA 2HEOA 3CLOA 2P8TA 1ODDA 2FNPA 3I4PA 3TGNA 5FLXK 2VBWA 3H92A 3Q5FA 2DBBA 2MH9A 3NEUA 4WXCA 4ZZLA 1R00A 2MBFA 3RYRA 3W6KB 1DPRA 2DO7A 3FM5A 1FT9A 1GXPA 4BXUA 4ENKA 5L3CA 2HGCA 1ZAOA 5H6QA 2ZNYA 1LDKB 3BJ6A 1FX7A 1YG2A 1XB4A 3F22A 4Y13A 1A04A 4EVIA 2EK5A 4ZYGA 1Z91A 5A2QZ 3IWFA 4U7BA 4Y17A 3MWMA 3V8LA 4M74A 5F1RA 1BC8C 3WTVC 4L9VA 3CJNA 2O6GE 2HYFA 3WE2A 2STTA 5E20A 4OU0A 3BOQA 5IT9Z 5ILSA 1ZGAA 4KT5C 2HS5A 2KIFA 4O3MA 2VBZA 4B09A 4A5MA 1MKMA 2Z33A 1R1VA 1OPCA 1UHMA 1XDUA 4OIPF 1DP7P 2A07F 2CYYA 3QP6A 1K78A 1W5TA 5L3BA 3REOA 4WX9A 1RZ4A 4JK1X 2JT1A 4Q5SF 4A6DA 4UV9A 4WK8F 4N0BA 2LF7A 3W6JB 4XRFA 3TO7A 3B02A 1GXQA 3QU3A 1V3FA 1I1SA 4GO1A 5DUIA 2BGCA 2IP2A 2HKXA 3K1PA 4HBLA 3ZMUA 2IA0A 2UXNA 2VT2A 5HVQC 3KCCA 4OINF 1B59A 4L5JA 3RI4A 2JRTA 2IPQX 3Q9SA 3DPLC 2VONA 1XCBA 1KU7A 2ESHA 1IN4A 3KLNA 4I2OA 2DLLA 4AWXB 3HOSA 3GEZA 2DQRA 2RQPA 3CO7C 2GA1A 3H3ZA 2ISZA 3KEOA 1ZG3A 3RDIA 3HIFA 2H27A 1SMTA 1EH7A 4ZYHA 3WTXC 3HSRA 1P2FA 3BY6A 1D8KA 3G73A 5J6XA 3RIRA 5D8LB 3I59A 1QZZA 3JSOA 2KRFA 1BOAA 3K69A 3CUQA 4Z2YA 2EWNA 3C1DA 5E1XA 2A6EF 1QNTA 4BAYA 2F5FA 1LQ1A 1HW2A 2XUBA 4KIFA 1YYVA 3RPUA 1Z6RA 1YW9A 1BI3A 3EDPA 1HW1A 3QRFF 3NRVA 3MFKA 1R5GA 4KICA 1SAXA 3LA3A 1W5SA 1TNTA 2D45A 3J81Z 2P5LC 1B1BA 2DQLA 3RPQA 5BMZA 5FB2A 2Z5UA 2L4AA 2O8XA 3Q9VA 1G6NA 2NNNA 3TQNA 2FNAA 3KZYA 2PEXA 4U88A 3FMSA 4YG2F 1QO0D 1XSDA 2VOOA 3KP5A 4XSZF 3WE3A 4A12A 1K79A 4YFKF 2MD5A 5HOOA 3GFLA 4HDUA 5H20A 1PP8F 2YX7A 4AVPA 3V7CA 2VN2A 3C3WA 3M1EA 5E18F 1ON1A 1S7AA 4PZJA 3V7RA 2EFNA 1O3TA 4HF1A 3KE2A 1HW5A 5DD4A 1FZPB 4LFUA 5TJJA 1S29A 4ENNA 4CYDA 2DI3A 1XMKA 1C0WA 1HXDA 2R7DA 1Z1DA 2DTRA 3FHZA 1T98A 1O3QA 4KFCA 5HDKA 2KJCA 2HWVA 1BC7C 2B0LA 2JPBA 3CDHA 1XSXA 2VBYA 1KQ9A 1LDJA 2M87A 1R58A 4MQVA 1KQ8A 3DKWA 3ZPLA 1SD6A 1RUOA 2VOPA 2QM3A 3F23A 4G8XA 4UNOA 3IRRA 1FC3A 1YLFA 3IKTA 1K7AA 4HX7A 5ICCA 5TRDA 2X4HA 1BI2A 2QYOA 4MGRA 1TQMA 1QZYA 4KIGA 4UV8A 2RNJA 2ADUA 4KN7X 4IRHA 1U5TA 2OQGA 1YIOA 1HSTA 1KYZA 4EJTA 5K5RA 2MA3A 3E6MA 2V1UA 3QPHA 2VODA 2EA2A 3JW4A 4A0ZA 3F21A 4KYWA 4YIFA 2PN6A 1XCVA 2FF4A 2PG4A 2JPCA 3FXRA 4LGWA 3KP6A 2E1NA 2IJLA 3FF5A 4AIJA 3L9FA 2XVCA 4RAYA 3TDUC 3WTWC 2OA4A 3N4MA 1T2KA 1EH6A 1ZARA 4M6YA 3H3UA 1G4DA 4S04A 1P92A 1OYWA 5D5WB 2P5VA 1BI0A 5IT3A 1G3WA 5FFZA 3GLXA 4LB5A 4UUVA 2FA5A 4JQFA 3RJPA 3BDDA 5FD6A 4HX8A 1XD7A 5JFRA 2STWA 3WGGA 2OD5A 2EFQA 4O6JA 2Y48A 4FX4A 3JTGA 2F5EA 5CJ9A 1B6AA 2QENA 4ENJA 2QZ8A 2EV0A 4H0EA 1X3UA 4HA8A 2XAGA 2Q0OA 3LSTA 3T8TA 5L3FA 3WTYC 4LLGF 2K4BA 4EGZA 5ILVA 3ZMVA 3D5LA 3V8KA 4QLCU 4GXOA 3I58A 5LHGA 4ASNA 4A0XA 2ZJ2A 1DUXC 4HOBA 3F72A 4MNUA 2ACJA 1Z9CA 1PP7U 2P4WA 1O7LA 3LAJA 1UHWA 2XGXA 2H09A 4Y15A 1XMAA 4P96A 3WTUC 4G7OF 1R1TA 5ILUA 4RB0A 4OOIA 3WGIA 1P6RA 5D6EA 1YW7A 1BI1A 2NYXA 1UFMA 2VBXA 5D4RA 2PMHA 1BIAA 3ULQB 3P9IA 2UZKA 3F8CA 2PI0A 2MLGA 2E7WA 4IHSA 4PCQA 2EV5A 5LHHA 4L18B 4HAMA 1KGSA 1OYYA 4MTEA 4XLNF 5CLSA 1SD5A 1S8NA 4M72A 2L01A 3TKYA 3F8FA 4F7ZA 4NQWA 4OIOF 5FD5A 2Z9OA 2GWRA 3ZMDA 4LLNA 2EJRA 3ECOA 2HKOA 3HUGA 3MQ0A 3RKYA 3HTUA 2GIVA 4BHBA 3COAC 1YTYA 1QQIA 3GZ6A 5HLHA 4E70A 3WODF 5A2QK 2PLYA 3GX4X 1ZN2A 3TOAA 3M8FA 2CQKA 3F8BA 3DP7A 2IRFG 1BBYA 2QQAA 2K02A 5LGNA 3R4KA 2M45A 5DUKA 3MZHA 1FWZA 4D0PA 2O3FA 4M71A 2JZYA 5IT9K 3DEUA 1HKQA 2ZKZA 3ML6A 1GVJA 4A2UA 2NS0A 2O61A 2FQ3A 4EJVA 3LA7A 2FE3A 2P7VB 2H6BA 3QPTA 1U78A 4MQ9F 3KP3A 4N9HA 4ETSA 1YQAA 2OAZA 4YIIA 5JHUA 4LG0B 2GXBA 4GGGA 4IVNA 1SD4A 3GXOA 2HZTA 3M9AA 4EJWA 2ESNA 4G7HF 4L0YB 1J5YA 1J75A 2MH2A 4HYEA 3JAMZ 1G3YA 5J8FA 2G9WA 3L7WA 2VE9A 1TLHB 1T39A 2Z3YA 1IN6A 1V4RA 4RS8A 1W7PD 1IW7F 4U0WA 5LGTA 1H9GA 3P9CA 2NNYA 4YFXF 3FZVA 1WWXA 4HF2A 3D0SA 2LKPA 3ISPA 4LK1F 3DF8A 1TQPA 2GXGA 4IJAA 2YPRA 1HSJA 2A68F 2QQ9A 2CFXA 1KU2A 3QOPA 4WF2A 3U9GA 4FHTA 1S6LA 2MC3A 4EM2A 1YFHA 3TOBA 1DDNA 4Q48A 2C6YA 4HV5A 1HBXG 3K2ZA 1AOYA 1ZRDA 2WTEA 4EM1A 4P9UA 2WC2A 3TO9A 3MAJA 2YU3A 5LRSA 5K1YA 4NHJA 1HKSA 5J8CA 6PAXA 2M5WA 5LRRA 3KP4A 5D5XB 3GO5A 2E7XA 5DCFA 5DYMA 2LSOA 1I1GA 3IWZA 2CSOA 3BJOA 4G6QA 4RB1A 1CGPA 1U3EM 3ELKA 2UWMA 1IF1A 1TNSA 4XBFA 2F5DA 5EEHA 1B9NA 2RDPA 2FSWA 1K6OA 4KNYA 5D5UB 5LGUA 1JHFA 2A6HF 2FBHA 4ENMA 5ICGA 3ZN1A 5K5QA 1STZA 1MGTA 2QQBA 2EFPA 4AIHA 3F6OA 1IRGA 5LBQA 1Z05A 4KMUX 5HDNA 1VTNC 1CF7B 4IHTA 4HDVA 2EFOA 4HX4A 4A0YA 3KETA 2Y75A 3WU1B 1F4KA 3E6BA 3DXJF 2Q2EA 1IXRC 3QAHA 2P7CB 2O03A 4XLPF 2A61A 1SFEA 1LEBA 1G3SA 1KYWA 4B8XA 1QBJA 2ZCWA 1ZH5A 1J7KA 1TTYA 1ZREA 2PFBA 3BWGA 1J59A 2XRNA 1KU3A 3WGHA 3F6VA 5L3DA 2EB7A 5FFXA 2DK5A 4LLLA 3I5UA 1J0RA 1IUYA 5AIPA 5LHIA 4LG0A 4IF4A 1BIBA 2W57A 2EV6A 5L3EA 3VOEA 1SD7A 2XKPA 3HRSA 3JTHA 4LJZF 4DNCA 3IRQA 4PGGA 4XSXF 1HQCA 3RKXA 2D2WA 2OZ6A 2XROA 4RB2C 3GVAA 2PBIA 4L5IA 4UVBA 1USSA 1YW8A 2JTVA 5E1ZB 3C18A 5E8IA 2QLZA 4DQ2A 2ZNZA 5DCMB 1FSHA 1DPUA 1YS7A 3DFGA 3R60A 5D8KB 5CVVA 1B9MA 3L2CA 5LEKA 4I0AA 2CW0F 3FWEA 1XGNA 3PQKA 3C7JA 1FBQA 2P6SA 1F9NA 1W7PB 4UHTA 2FRHA 1ZGJA 1P4WA 4RAZA 4AIKA 5JI6A 4U0YA 5BOXA 3FMQA 3K9TA 4EM0B 1OKRA 3ABUA 2XAJA 2QBYB 3EUHA 5F6FA 4HW0A 1WI9A 4G94A 1KU9A 4QWQA 2DFIA 4P5OA 3DQVC 2L54A 4L9JA 4M73A 4AD9A 3O6BB 4O5VA 1IN8A 3SZPA 3O3KA 2AS5F 1R1UA 1R22A 1WRJA 5BS6A 1JE8A 5D4SA 4ZH4F 4ESJA 1FSEA 1W4MA 1H9TA 2CGPA 1ZLJA 4EGYA 3OOPA 2AXLA 2GQQA 1WKMA 5FGMA 3ABTA 4LK0F 1OR7A 4KMFA 2G7UA 3I0TA 4UVCA 2YX4A 1WSUA 5AONA 1RUNA 4N9IA 1SFUA 3SQNA 1QPMA 5DEQA 3SHFA 2O0YA 5E17F 2E1CA 3E3VA 1R36A 2HTSA 1NHAA 3QP5A 3KP7A 1JXSA 2HDCA 5DDGA 1ZG5A 1HKTA 2H94A 1E2XA 1LB2A 3I54A 1MZBA 3TO6A 1FP2A 1JGSA 1FYLA 1G3TA 3ZMSA 5HS9A 2VXZA 1RNLA 4ZZDA 1BM9A 4MEYF 2W85A 4HQEA 2QWWA 1ZRCA 1PUEE 2RKHA 3L09A 1E17A 5CVIA 1FY7A 3CUQB 3J80Z 3GFMA 2G7HA 5KK1A 4KA4A 4OIQF 2RN7A 2A69F 4I7HA 1D3YA 1YS6A 3VB2A 4M9ZA 3F8NA 3HRUA 1OMIA 2HOEA 4KDPA 1Z7UA 5FLXZ 5HS7A 1LEAA 1QGPA 5HLIA 2IVMA 3KFWX 4I09A 3G3ZA 3FX3A 2LDUA 2K4JA 2PMUA 2XASA 5HLGA 3PFIA 3N97A 3GFJA 1XN7A 3VFZA 2NAZA 4L9NA 2W25A 2X0LA 1FNNA 4CICA 5CYVA 5DCMA 4GYGA 3HTSB 3KLOA 1IN5A 1ON2A 4UXNA 4BHCA 3MCZA 4IPAA 2CO5A 2V9VA 3R61A 3R0JA 4EQQA 5L3GA 1FLIA 3HOTA 1MJBA 5CVRA 3E97A 1W7PA 1T38A 3FXQA 3HHHA 2IA2A 2XHKA 4U7DA 2IW5A 2DK8A 3OV8A 3U1DA 4L9TA 4RGXA 2WV0A 3IC7A 3L00A 2QBYA 3ZP5A 1FPQA 3ZN0A 2K7LA 5LEJA 3T5XA 1ZYRF 4HF0A 3I53A 2ZMEB 3AAFA 5H6RA 3V7SA 3I64A 4TV7A 1O57A 2A3SA 3FMRA 4KUMA 1XSVA 1XGOA 4GYIA 1UB9A 3ZMZA 1TBXA 3CUQC 3BROA 3U2RA 1BJAA 4EJOA 4M6XA 4EMSA 2FBKA 2QVOA 2K27A 2F2EA 5ERIA 4U0VA 1MJAA 1REPC 1SMYF 5F64A 2GZWA 4R79A 2XAQA 3SXYA 2PJPA 3VODA 2V1XA 2KJBA 2FOKA 1MDMB 3JAMK 3RTRA 3M8EA 2A5YB 4HLYA 4M9XA 2HQRA 5D6FA 4KN4X 2J5PA 4JBAA 2KIMA 3NQOA 1YO5C 1PDNC 3CUOA 3HHGA 1IXCA 1IZ1A 3F3XA 1TW2A 4RGRA 4M9SA 1U5TB 3V8JA 3LWFA 1Q1HA 1UCRA 5AIQA 2FXAA 2EFWA 3FXUA 4LD5A 2F5CA 1WQ2A 4HQMA 4I98B 2FMYA 2ZBKA 1USTA 3EETA 1L3LA 1FOKA 2W84A 2XIGA 1XGMA 2MLKA 1JHHA 1IRFA 1MJ9A 5ED4A 2Y0MA 3DPTA 2QUFA 2FU4A 4CZZA 3EYIA 1TQIA 3WTZA 4R1HA 1FBUA 1O7FA 2DU9A 3RYPA 2ISYA 2J5OA 4FT8A 2ETHA 2FMLA 2IA1A 3E6DA 5ICEA 3IL2A 4WWCA 2HQNA 2OZUA 3E5XA 1F1ZA 4BNCA 3J81K 3KP2A 5E1WA 1P4AA 1Y0UA 3FM3A 3T1BA 1ONVA 1LDDA 2P5KA 3IKVA 1XGSA 4WXHA 1ZHFA 1R23A 2RV8A 1L0OC 2V79A 3T0YA 2M1BA 3E5UA 4MTDA 5CVUA 1J2XA 2M8EA 2XKOA 2K86A 3MEXA 3ECHA 4ESFA 5K5OA 3ZQ7A 2CG4A 1P4XA 2RC4A
chains in the Genus database with same CATH superfamily
3HRTA 2IT0A 1Z21A 4OAZA 2JN6A 1BOBA 5FO5A 2VE8A 1S7OA 5D5VB 4FQGA 2L9NA 5IP9J 2DW4A 4HV6A 2EH3A 3J7AY 3BPVA 1DU6A 3ABMH 1DP3A 2VC1A 3LQQA 3K4JA 2A6TA 3BTLA 2WWYA 3BG3A 3HOVJ 3CCMI 5BPDA 3SFIA 2CQNA 3IHUA 4BYYA 1EV7A 1QRYA 1U5TC 2NRAC 1LUJB 2KKOA 4BHPA 1A6QA 1XDSA 4B47A 5M3MJ 2E2HJ 5BPIA 1N77A 3BLYA 4DW6A 4EEFG 2X1EA 3NWTA 2QKLB 5LLQA 3RCOA 2JJ7A 4NB5A 4CYCB 2JRMA 1IN7A 2BE5F 1Y8QB 3FHNA 1X2MA 4EJUA 5F0HA 1IXSB 1K4SA 2DPUA 2L9VA 1J9IA 5DV5A 3HRMA 4IRGA 1IAWA 4OMZA 1D8JA 3OOUA 2VI6A 2P6TA 2XAHA 4Q4ZF 1Z7LA 3EQLF 2LF8A 2DA5A 2I10A 4U87A 1U8RA 4CDGA 4G6DA 3RPUD 4CUGA 1JKRC 4MEXF 3PSIA 3I71A 3J7AO 1KA8A 1FOXA 2PQ8A 4X1EA 1T6SA 5HDGA 3LAPA 2HR3A 3CO6C 3L2WA 2ZMEA 4XKWA 2VLAA 4E7HA 1NK2P 1RPWA 1HC8A 2V1DA 3KIOA 2DMTA 4C30A 1V5EA 4KIBA 4A3GJ 1WPKA 3HOZJ 2X9DA 3I56I 4UUSB 5FKKA 5EDNA 2KRHA 2KIUA 4NC7A 5M5XJ 1EH8A 1QVTA 4RB3C 2GA2A 4RLQA 4UVAA 2BV6A 4AUXA 3DV8A 2V6CA 3BP8A 1MBFA 2VC0A 1MW7A 3F8MA 1IG7A 1FYMA 4RGUA 3H9GA 2X6XA 2RVCA 3PUBA 4MHGA 3AL0B 3V4GA 4F55A 2TDXA 1FBSA 4YFNF 5J4VA 1T33A 1BN5A 3BR2A 2HXIA 2RNGA 2F6CA 3RZDJ 1Z6TA 3E0JB 3NARA 2L4MA 1LVAA 1RETA 1S3JA 2L3DA 4IXAA 2UXXA 5EEGA 4QPQA 3QPLA 4PDKA 2VT3A 4G7ZF 2F4OB 1Q1VA 1I27A 3TDZC 2LY1A 3OYKA 1ZRFA 1BR2A 3WU0A 4ZYEA 3HG9A 1OCCH 2ZXJA 3M7GA 1MDMA 1RI7A 4ABZA 1D5VA 1MH4A 2R3SA 3M07A 3ZQHA 3L1PA 3N05A 1Z67A 4XRSG 4LB6B 1WI3A 4CGZA 2HFHA 2Y0SN 2VIXA 4M3GA 4B43A 3S2DJ 2ZO4A 1LJ9A 2LLKA 3FXJA 2DT5A 2Z99A 4FTHA 2VKEA 5BQTA 1GHCA 1KQ0A 3DTEA 2ICWG 2YSRA 1X58A 3A02A 1MMDA 3R6SA 3GW2A 3G1OA 2NOGA 3GFIA 5KVRA 4A3IJ 3TP0A 3ERED 1R5HA 1FYKA 3QU6A 1I3QJ 1TW3A 4I0BA 2GIZA 3B73A 4M3DA 4DGWB 4EV0A 1TWAJ 3SEQA 2DCEA 2R7SA 2LY2A 1O3RA 3JRIA 2IS4A 3ZQFA 3JRDA 4CO8A 1SVLA 2HVQA 3AG4H 2M30A 2KT0A 3BPXA 5HNFA 1YI2I 4A3BJ 4HLXA 3BJAA 1TWHJ 2D1HA 3MZYA 3P9KA 2QEXI 3VEPA 3BCBA 1T95A 4II3A 5HS8A 2R92J 2YUSA 2D1VA 1XX5A 4ZDLA 2LVSA 4RGSA 3RKQA 1ZLKA 4BDYA 4B48A 3H36A 2OBPA 3WG9A 2PJRB 1B4AA 1OCPA 4CZCA 3RKWA 4PGHA 3K1NA 2COMA 3GZ5A 2CUFA 2DAOA 4J19A 2BBYA 3JCUC 3LA2A 2L5QA 5JLWA 4A6EA 4A3FJ 3K2AA 2DMPA 3SEZA 1K78B 1G8XA 1R9TJ 1Y1WJ 4XLHA 5JR3A 1VQMI 4LMYA 3I4NJ 4ANJA 1OQYA 1R7JA 3GYHX 1FJLA 1OCZH 2XV4S 1TC3C 1T8IA 3PNYA 4S05A 4JX5A 5CVJA 2LBFA 3K1MA 1ZG1A 1ZGWA 2HTJA 4BQNA 3HYIA 2R93J 1T0FA 3G71I 1LFUP 3KEQA 3CMAI 4IZZA 3T8RA 4IRIA 1I6HJ 4OIRF 5EF6A 3P7NA 1UG0A 4CSWA 2OQRA 4BE0A 3LFKA 3HGYA 3ZMTA 5EYRA 3CCEI 3K4NA 5ICFA 4I01A 3HSEA 3K0LA 2H8RA 2YU9J 3EYYA 1F5TA 4E6KG 4ON0A 1I3AA 2YR2A 3HSFA 4Q47A 3GF2A 3SZTA 5K7FA 3E6CC 4CHUA 3AL0C 3ZR8X 3KX2A 4XLFA 2LNBA 3E5QA 3LSIA 3MN2A 4XLEA 1ETYA 1ULYA 2EILH 3GWZA 3IV5A 3GTJJ 4K2EA 4HZFA 4YELA 1RIOH 2EA4A 2GAUA 1Y6IA 2WB1N 3HKZN 3GUDA 3S2WA 3K70D 2BHZA 1CF7A 1DU0A 2DFEA 2DODA 2DDBA 5IOYA 2LREA 1ETQA 1BW6A 1X1CA 3WHBA 2PMZN 4XKBA 3ROUA 4CH7A 5IP7J 4ZYDA 3JSPA 2NVXJ 2LH9A 2CWEA 2FBIA 3BZKA 4I76A 4WXDA 4L0ZB 2WV1A 3KZZA 2L7MP 1U6GA 2JSCA 2R7FA 2L02A 2XAFA 3LSPA 3CTAA 1WGXA 1DQUA 4P55A 1MD0A 2ZFWA 3GTLJ 1FP1D 4AYBN 1ZQ3P 1ETWA 1SFXA 2ELHA 3BZ6A 3RQ4A 3SFZA 3SZGA 4A5NA 4BH9A 2CU7A 4IEJA 1O3SA 2NVTJ 4CYCA 1V5FA 2X85A 2H6CA 1AHDP 1AWCA 3GTMJ 5CQEA 2Q8KA 3CF5F 3WTSC 3PQJA 4XQFA 1G59A 3S32A 4CCJA 2KIQA 4CXFA 2HYJA 1RR7A 3I59B 3Q0VA 2VB6A 5HODA 1HCRA 2HDWA 2LP0A 2XGCA 4FX0A 2OU2A 2AHQA 3ESWB 4BQAA 4JOMA 5DM6F 3LQRA 3FXKA 1OYIA 4R8HA 3O2PE 4C2MJ 3S2HJ 3R0AA 2E19A 3DKXA 5E8GA 3CCLI 4OWRB 4A69C 3J80K 1U2WA 2RGVA 3HC7A 2KDOA 2DPDA 4P9FA 4ESBA 2CV2A 4A3LJ 2VXDA 4G6TB 2BYVE 4UUSA 1ORKA 3QPSA 4WCGA 5DD8A 1P7JA 5JVTA 1WJBA 3MZ8A 2HYGD 2W24A 1UMQA 4I02A 4OMYA 2DA6A 1I5ZA 3WTTC 4G9YA 1P7IA 2VJ5A 2BEOA 2ID3A 1Y56A 4GCVA 3VYUB 1D5YA 1H0MA 2BXYA 1I6XA 1LNWA 2FEZA 3BR3A 2HEOA 2HZDA 3CLOA 2P8TA 3HGGA 1ODDA 2FNPA 1VZ0A 3I4PA 4GFBA 4PJLA 5F04A 3TGNA 1NTCA 1R4MB 5FLXK 2VBWA 3H92A 3NEUA 2DBBA 2MH9A 4WXCA 4ZZLA 3Q5FA 4BY1J 1R00A 3S1RJ 2MBFA 1LE8B 3E1SA 2E2JJ 3RYRA 3W6KB 3HOUJ 1DPRA 2DO7A 4PSWA 2FJ1A 3FM5A 1FT9A 2XF5A 1GXPA 4BXUA 1LVKA 4ENKA 1MMNA 5L3CA 2HGCA 4IL6C 4M3BA 1ZAOA 5H6QA 2ZNYA 1AU7A 1LDKB 2X1CA 2R7WA 3BJ6A 1FX7A 1YG2A 1XB4A 5DM7F 3F22A 4Y13A 1A04A 3BTJA 4EVIA 3G4SI 2EK5A 2JMWA 1R49A 4ZYGA 3CF2A 1W36C 1Z91A 1HDPA 5A2QZ 1A31A 2Y31A 3IWFA 4Y17A 4U7BA 3MWMA 3G2BA 2KRCA 3V8LA 4M74A 5F1RA 1BC8C 1XC5A 4A3JJ 4YIRX 3WTVC 5C4XJ 1QHGA 4HNTA 4L9VA 3UKGA 3CJNA 3MKLA 3CMEI 2O6GE 3HPGA 4Y33A 2HYFA 3Q3SA 1JUPA 2HU9A 3VYTB 3WE2A 2STTA 5E20A 5IY5H 1PVEA 4OU0A 3BOQA 5K7ZA 4G12A 1YX3A 5ILSA 5IT9Z 1ZGAA 4KT5C 3U21A 2AO9A 2MW8A 1GVDA 2HS5A 2KIFA 1YHQI 4O3MA 2VBZA 4B09A 4A5MA 1MKMA 2Z33A 3QQAA 2K85A 3MKYB 1R1VA 5E3MA 3BR1A 5KAIC 2NS8A 1OPCA 1UHMA 1XDUA 2LRDA 1SC7A 3CC7I 5FLVA 2HI3A 4DZPA 5EZGA 2PJRA 4OIPF 4HG2A 1DP7P 1FMVA 1IO2A 2F5VA 2A07F 2DT6A 2NOJB 2CYYA 3QP6A 2HVRA 2BY2A 3PO2J 3K4CA 1K78A 4LIUA 1W5TA 1GUUA 2EPFA 5L3BA 4PK4A 3REOA 2Y9YA 4AU7A 4WX9A 2W7NA 1RZ4A 4JK1X 1HLVA 5KAFC 2JT1A 3I3LA 4Q5SF 1IRXA 3BQZA 4PJMA 4A6DA 2X6OA 4UV9A 2ECCA 3DEWA 4WK8F 4N0BA 2LF7A 3W6JB 1JKPC 4H4KC 1IUFA 4OAYA 4XRFA 2G0EA 3TO7A 3B02A 1GXQA 3QU3A 1B8IB 1A36A 1V3FA 1I1SA 4GO1A 2ID6A 5DUIA 2VKHA 1GV2A 2BGCA 1UELB 2WY7Q 3IH3A 3ZQCA 3LSRA 2IP2A 2HKXA 2AXTC 1BA5A 2CMPA 1SEUA 3K1PA 5BNGA 1OISA 4HBLA 4N4OB 3ZMUA 4BEHB 2OV7A 3OYHA 2IA0A 3EUAA 2UXNA 2VT2A 5HVQC 3KCCA 4OINF 3MKWB 1B59A 4L5JA 2DOFA 4IOAF 3RI4A 2JRTA 1SVMA 2IPQX 3Q9SA 3DPLC 3CJTB 3K4LA 1K4TA 2VONA 1XCBA 4AIDA 3CCUI 1E3OC 3RZOJ 1KU7A 2ESHA 1XG1A 1BR1A 5EG0B 1IN4A 4HSRA 2E71A 1EKEA 3KLNA 4I2OA 2DLLA 2F4MB 4AWXB 3HOSA 4BU2A 4NC8A 2DT7B 3GEZA 1NG7A 2DQRA 2RQPA 3CO7C 4IHVA 2GA1A 4RLFA 3H3ZA 2ISZA 2M4KA 3KEOA 4BY7J 2OTJI 2F48A 1ZG3A 3RDIA 3ZRGA 3HIFA 2R7RA 1ZK8A 4FETA 1D0XA 2H27A 3OYCA 1SMTA 1EH7A 4ZYHA 5KCMA 2EZLA 3HXLA 3HSRA 1P2FA 3FDYA 3WTXC 5FRNA 2NVYJ 1VQ9I 3BY6A 1D8KA 3G73A 3BG6A 4CCKA 5J6XA 2CUZA 2HNHA 2W00A 4BGDA 3M8JA 2DMQA 3RIRA 2CH0A 2DFFA 5D8LB 3I59A 1QZZA 1ITYA 2M7BA 3JSOA 3ZQIA 1I39A 5B3SH 1PYVA 2B63J 2KRFA 3OYDA 4AVZA 1BOAA 3K69A 3CUQA 3LSKA 2E34A 4Z2YA 2EZHA 2EWNA 3S15J 3C1DA 5E1XA 2CQQA 2LC2A 2A6EF 1QNTA 4BAYA 2F5FA 5FLMJ 1X19A 2KMUA 3GTPJ 2LG4A 1LQ1A 1HW2A 2XUBA 4KIFA 2X6WA 3JRHA 1YYVA 4HNVA 3CP8A 3RPUA 4BUPA 4A3EJ 1Z6RA 4BS9A 1SVOA 3A03A 1YW9A 1BI3A 3EDPA 1HW1A 3QRFF 3NRVA 3MFKA 1R5GA 2X1DA 4KICA 3PJRA 2CQ7A 3H5NA 3OL3A 4B44A 5IYDJ 1SAXA 3MVPA 2KHMA 3LA3A 1W5SA 1TNTA 2D45A 3J81Z 2P5LC 4AC0A 2OF7A 1B1BA 4L5EA 1A6IA 2ZXWH 2DQLA 5E79C 3RPQA 4PJJA 5BMZA 5FB2A 3L2UA 2Z5UA 1W36D 2L4AA 1X1PA 3S16J 2O8XA 4HRIA 4MLOA 3Q9VA 1G6NA 2NNNA 3TQNA 1QVUA 5GAHJ 2FNAA 3KZYA 3DU5A 2DA3A 1X3ZB 2PEXA 3HOYJ 4HPQA 4U88A 1EF4A 1LE8A 3FMSA 1U9NA 4YG2F 2NVQJ 2YS9A 1TP4A 1QO0D 2OC6A 2VPRA 1XSDA 3JRBA 2VOOA 3KP5A 4XSZF 3WE3A 4A12A 1K79A 4YFKF 2XC7A 2MD5A 5HOOA 3GFLA 3OYGA 5GPCA 3CCSI 1ZR2A 4HDUA 4BDZA 2DA4A 3IH4A 3OYLA 4CCOA 4GRIA 3VSLA 1TL8A 1ERDA 5H20A 1PP8F 2YX7A 2DFHA 4DBQA 4AVPA 3V7CA 4E7KA 2VN2A 3C3WA 4XIDA 3M1EA 4NNJA 5E18F 1ON1A 5B1BH 1S7AA 4PZJA 3V7RA 2EFNA 1CQTA 1O3TA 4HF1A 3CC4I 4XKVA 2Y0SA 3KE2A 1HW5A 5DD4A 3K70C 3BG7A 2CW8A 1IC8A 1FZPB 4LFUA 1OCTC 3LOCA 1HF0A 1EJ9A 5TJJA 1IGNA 1S29A 2OCEA 4ENNA 2DXIA 4CYDA 2DI3A 2OJED 1MBKA 1HA8A 1XMKA 1C0WA 5FKLA 2LFBA 2R7UA 1HXDA 1IJWC 3VPRA 1D0ZA 2R7DA 1Z1DA 2DTRA 3FHZA 1VQPI 3DCFA 1GT0C 2XSDC 1T98A 2L7FP 1O3QA 1G2HA 3K4BA 3ZQGA 3CCQI 1LKXA 2R7OA 2OUMA 2Y69H 4DJAA 1VQKI 2B7EA 4KFCA 2MABA 5HDKA 2KJCA 1YITI 2HWVA 1BC7C 1RESA 2TCTA 2B0LA 2JPBA 3CDHA 4XK4A 1WJEA 1XSXA 1PUFB 3LSHA 3BG9A 2VBYA 4RDUA 1KQ9A 3OYIA 1LDJA 2M87A 1R58A 3I9V2 2LKSA 4ZTFA 2NXNB 3SYTA 4MQVA 5CPRB 1KQ8A 3DKWA 3ZPLA 2WADA 4XRSA 1SD6A 1RUOA 2VOPA 2QM3A 3F23A 1O4XA 4G8XA 4UNOA 2M4GA 5TGTA 2MYSA 3HM5A 1S5LC 3IRRA 2WY8Q 2EZKA 1FC3A 2W1OA 3BTCA 1YLFA 2MGQA 3IKTA 1K7AA 2CS3A 4HX7A 2HPIA 4XMYA 1NK3P 4UY8I 5ICCA 5TRDA 2X4HA 2Z16A 1BI2A 2QYOA 4MGRA 1TQMA 4NQWB 1QZYA 3D1NI 1FOYA 4KIGA 4UV8A 4BEHA 1Y39A 1KZHA 2ME0A 2RNJA 1APLC 2ADUA 4KN7X 4IRHA 1U5TA 2EQRA 5JVGF 2OQGA 1F36A 3HUGB 4IO9F 1YIOA 1VQ8I 1HSTA 1KYZA 2BW3A 1YRNB 4RM3A 3W3CA 4I6ZA 2GXAA 4EJTA 2O7OA 4DIQA 5K5RA 1EA3A 2MG4A 1MNMC 4A3CJ 5FKMA 2MA3A 3E6MA 1OR7C 2V1UA 1IDZA 3QPHA 1Z0XA 3MKZA 2VODA 2EA2A 3JW4A 3DLLF 4A0ZA 2VQCA 2WB1A 3HKZA 3F21A 4KYWA 3VDXA 4YIFA 3HB9A 2PN6A 2E36A 3OR1C 3P5JA 4V19K 1XCVA 4A3MJ 3S93A 2JK3A 2FF4A 5J47A 2PG4A 2JPCA 3LL7A 1Z3YA 2L0KA 3FXRA 1FIAA 4LGWA 2PMZA 3KP6A 2E1NA 3CZ6A 2IJLA 3FF5A 1QPIA 1UAAA 1TT5B 4AIJA 2R5ZB 1WHUA 3L9FA 2JQ7A 2XVCA 1YOVB 4RAYA 3BT9A 3TDUC 3S1NJ 3H5RA 3WTWC 2OA4A 2A05A 3N4MA 1DGRM 4AYBA 1T2KA 1EH6A 1ZARA 4UB8C 2V9PA 1Y0NA 4M6YA 3H3UA 1G4DA 2VUMJ 1KONA 1JTYA 2DYSH 4S04A 1P92A 5JHFA 1OYWA 3A0HC 5D5WB 2KP6A 2P5VA 3E7LA 3WG7H 4XL9A 1BI0A 5IT3A 2BHYA 1G3WA 4XICA 5FFZA 3GLXA 4LB5A 3VYSB 2ZB9A 4UUVA 5CQGA 2FA5A 4JQFA 3RJPA 3BDDA 5FD6A 2M0CA 4HX8A 1XD7A 5JFRA 2STWA 3WGGA 2OD5A 3PSFA 3DBHB 2EFQA 4O6JA 1T56A 2Y48A 4FX4A 3JTGA 3OYAA 3FXOA 4RBOA 2F5EA 5CJ9A 1B6AA 4BBRJ 3CDLA 2QENA 4ENJA 1X4OA 2QZ8A 2EV0A 3DKYA 1X3UA 2AQEA 2ZJPF 4H0EA 4HA8A 3W6VA 3QYEA 5IYBJ 3GTGJ 2XAGA 2Q0OA 3LSTA 1WJDA 3T8TA 4PJ0C 2XF7A 5L3FA 3WTYC 4LLGF 1TZLA 2EINH 1MNDA 3HOXJ 2K4BA 4EGZA 5ILVA 2P81A 3G1LA 1LPQA 3MD2A 4LG3A 3ZMVA 3D5LA 2LKXA 3BR5A 3V8KA 4QLCU 2WA0A 4GXOA 3I58A 4J00A 5LHGA 1FEXA 4ASNA 4A0XA 2KDZA 2ZJ2A 1DUXC 2Z2SB 2VL8A 2MD0A 4HOBA 4KITB 3F72A 2JUGA 2TRTA 4MNUA 4C3JJ 4W97A 1P9QC 1XTAA 2ACJA 1Z9CA 1PP7U 2P4WA 1O7LA 3LAJA 1UHWA 2XGXA 3TL4X 2A5WA 3BR6A 2H09A 1N78A 4Y15A 1XMAA 4P96A 5K7HA 1VQ6I 1WH5A 2M3AA 3WTUC 3CMYA 4G7OF 3HOWJ 4IHXA 2DDAA 2L9SA 1MBJA 1R1TA 2CUJA 5ILUA 4RB0A 3CP2A 4OOIA 3WGIA 1P6RA 5D6EA 4GDFA 1SFKA 1YW7A 1BI1A 2NYXA 4F92B 1UFMA 2VBXA 2GOMA 3ZXSA 5D4RA 2PMHA 1MSEC 1BIAA 4V2FA 1MMAA 3ULQB 2HXOA 3P9IA 3F8CA 4N4NB 5LFAA 2UZKA 5C4JJ 2IGMA 3GBGA 2PI0A 3H9QA 2F4IA 2MLGA 2FQ4A 1JUMA 2E7WA 2M0MA 1PUFA 3CCJI 5GAEJ 4IHSA 1FMWA 4PCQA 2EV5A 5LHHA 4IX7A 4L18B 4HAMA 1K61A 1MBEA 1KGSA 1VQ5I 3L2VA 1TWCJ 3A0BC 1JGGA 5E3OA 3GTQJ 2CQXA 3QOEA 1OYYA 4M6VA 3GMEA 4LIVA 4BL0B 4BKXA 4MTEA 1M1EB 2ZSIB 2MSYA 3DWLE 1OCRH 4XLNF 5CLSA 2X48A 2LTPA 2IXSA 1SD5A 4RM2A 3AKZA 1S8NA 4M72A 5GTHC 2L01A 3TKYA 3F8FA 4F7ZA 4NQWA 2DMNA 4OIOF 5FD5A 2Z9OA 1V54H 2M8GX 2GWRA 3ZMDA 3OSGA 4LLNA 4BJ6C 5J1RA 2EJRA 2LMDA 3ECOA 2HKOA 3HUGA 3G6EI 3MQ0A 3RKYA 3HTUA 2GIVA 4BHBA 3COAC 1R6RA 1YTYA 1XPXA 1YRNA 1QQIA 2IGNA 2ELJA 3GZ6A 4BQOA 3OYEA 5HLHA 3U1KA 4E70A 2R5YB 3WODF 1JJ6C 5A2QK 4F3QA 1WJFA 2PLYA 3GX4X 1ZN2A 3TOAA 3M8FA 2CQKA 3F8BA 3DP7A 2IRFG 1BBYA 2QQAA 2K02A 5LGNA 3R4KA 1WZ2A 2M45A 3FK7A 5DUKA 4FE7A 3MZHA 1FWZA 2QKMB 2VJ4A 4D0PA 2Q2EB 2NVUB 2DTZA 5IOZA 2O3FA 3O8HA 4M71A 3VSKA 2JZYA 3CESA 5IT9K 2L9RA 3DEUA 1HKQA 2ZKZA 5F0FA 3ML6A 3UNGC 1GVJA 4BJTA 4A2UA 2NS0A 2O61A 1VQLI 4A3DJ 3H1CA 2FQ3A 4EJVA 3LA7A 2M9HA 2JA2A 2FE3A 2IS2A 2VASA 2ELKA 2P7VB 4IQ4A 2H6BA 1MMGA 3KYCB 1E3PA 1JT0A 4LITA 3OSFA 2W48A 3QPTA 4XR6A 4M3FA 1U78A 4MQ9F 3KP3A 3LSGA 1S9HA 2DJNA 1QZEA 4N9HA 4ETSA 4C9YA 1YQAA 2QF7A 2OAZA 4YIIA 3C2BA 2H8WA 3BQYA 1RKTA 5JHUA 4LG0B 2BY3A 2GXBA 2D5VA 4Z6YA 4GGGA 4IVNA 1SD4A 1ETKA 3CLQA 3KEYA 5FROA 5C3EJ 1NH3A 3FXLA 3NAUA 4DYRA 2GBYA 2KISA 2R7VA 1MNEA 3HJEA 4MO7A 2V1NA 4KT6A 3GXOA 3DTKA 3L2RA 3UR3C 3CD6I 3JRGA 4XONA 2HZTA 3M9AA 4EJWA 4CCLA 3TBIA 1LFBA 3S3OA 2XGEA 4D7MA 3G1MA 1AA7A 3FBNB 2H1KA 1VNDA 1GV5A 3LSJA 1VQNI 2HOSA 2ESNA 4G7HF 4L0YB 1J5YA 3SDGA 4XN3A 1H88C 1J75A 2MH2A 4HYEA 3JAMZ 1G3YA 5J8FA 5GADJ 2G9WA 3L7WA 2VE9A 1TLHB 1FTZA 2LYCA 3LNQA 1T39A 2Z3YA 3BR0A 2CUEA 1R4NB 1IN6A 1V4RA 4RS8A 4RAFA 5DTDA 3S3NA 1W7PD 4F52A 1IW7F 1GLNA 3DU6A 4U0WA 5LGTA 4E7JA 3OYJA 1H9GA 2UV1A 3P9CA 1RR8C 2CFOA 2NNYA 4YFXF 4W1UA 3FZVA 2EIJH 1WWXA 4HF2A 3D0SA 2GM4A 2LKPA 3ISPA 4LK1F 1U9OA 3HDDA 2E1MC 3KYLA 3BC8A 3DF8A 4RA2A 1TQPA 2HPMA 1MBGA 1N75A 2GXGA 3GZNB 2QA4I 4IJAA 2JSPA 2YPRA 2KPMA 1HSJA 2A68F 2QQ9A 2CFXA 2CRGA 4MFDA 4QIWN 1ZKGA 4YEJA 1KU2A 3QOPA 4WF2A 2W82A 3U9GA 4FHTA 1S6LA 2MC3A 2VPLA 4EM2A 1POGA 1YFHA 3TOBA 1DDNA 4Q48A 3IP4B 4HEA2 2CW7A 3S8PA 2C6YA 4HV5A 1HBXG 2V9KA 2LR8A 3K2ZA 1AOYA 1ZRDA 3K10A 3PIPF 2WTEA 4ZYAA 1TT0A 2VQHA 4EM1A 4P9UA 2WC2A 3TO9A 1X1DA 3DTIA 1S72I 4D9JA 3C2HA 3IH2A 2E5NA 3TW6A 1TWFJ 3MAJA 2YU3A 1T08B 5LRSA 4Y52J 5K1YA 4NHJA 2BXZA 4I99C 3CCRI 3PNTA 1HKSA 2R0QC 5J8CA 6PAXA 1PJRA 2M5WA 5LRRA 2R7QA 3KP4A 4B1RA 5D5XB 3GO5A 2E7XA 5DCFA 5DYMA 2DMUA 2ZMEC 4RMNA 2LSOA 1I1GA 3IWZA 2E35A 2CSOA 4RAGA 1WVRA 4XLAA 3BJOA 4G6QA 4RB1A 3FIWA 1CGPA 1U3EM 2V26A 2CV0A 3ELKA 2UWMA 1IF1A 1IDYA 1TNSA 2BZTA 4XBFA 2F5DA 2HQAA 2ZC2A 5EEHA 1B9NA 4CCMA 5F27A 2RDPA 1JTXA 2FSWA 1K6OA 4KNYA 5D5UB 5LGUA 1OLTA 2XDVA 2DJIA 1JHFA 4PUSA 2A6HF 4YRVA 4BXFA 2FBHA 5J3LA 4ENMA 4XRMA 5ICGA 3ZN1A 1ZELA 5K5QA 5B1AH 3PFYA 1STZA 1MGTA 2QQBA 5M5YJ 3BTIA 2EFPA 2WAQN 1ACIA 4AIHA 2FX0A 2Y30A 3SJMA 3F6OA 2B9SA 1FTTA 1IRGA 3J7ZI 2ZFUA 5LBQA 3K4MA 1Z05A 4KMUX 1VQ7I 5HDNA 4F93B 3QODA 3HPHA 1VTNC 1CF7B 4IHTA 5DS9A 4HDVA 2IEKA 2R5YA 3CQZJ 2EFOA 5M5WJ 3RSNA 1Y8RB 4C2UA 2L2OA 4HX4A 1Y1VJ 4A0YA 3PNVA 3KETA 3IAM2 1OFCX 3TEDA 2VKVA 2Y75A 5F0CA 4BJ5C 2OPTA 2JVGA 3WU1B 1F4KA 3CMMA 3E6BA 3DXJF 2NS7A 2Q2EA 2HOTA 1IXRC 3QAHA 2P7CB 2O03A 4XLPF 2A61A 1SFEA 2XAUA 1VI0A 1AKHB 4C3IJ 2LY9A 4IKFA 1LEBA 1G3SA 3GTKJ 1KYWA 4B8XA 1QBJA 2ZCWA 5J40A 1ZH5A 5M3FJ 3AFHA 1J7KA 1TTYA 1SANA 4XORA 4FASD 1ZREA 2PFBA 2WAFA 4M3EA 3BWGA 1J59A 2XRNA 1KU3A 2IBDA 3WGHA 3F6VA 4IHYA 5L3DA 2EB7A 3JRCA 5FFXA 2LOOA 2DK5A 4LLLA 4ZDOA 3KPHA 3I5UA 1QHHD 1J0RA 1BR4A 2K3FA 2R7ZJ 3BCAA 1IUYA 3H0GJ 5AIPA 3EUHC 5LHIA 4LG0A 4CCNA 2IS6A 4DYCA 4IF4A 1BIBA 3EUKL 1VQOI 2W57A 3OYNA 1MBHA 2EV6A 2HQ5A 4DBRA 5L3EA 1B72B 3W2WA 3VOEA 4UB6C 1JKQC 1SD7A 2XKPA 2DA1A 3HRSA 3JTHA 3H9JA 3BG5A 4LJZF 4DNCA 2N8GA 3IRQA 2IAIA 3OIQA 1B8IA 4E7ZA 4PGGA 1HDDC 1X1BA 2GLOA 4XSXF 3S1QJ 1HQCA 2XPVA 3RKXA 1D1AA 2FD5A 1ENHA 3A4CA 4JX4A 5C44J 2D2WA 2VKDA 2OZ6A 1NG6A 2O5RA 4E4HA 2XROA 3DBRB 4RB2C 1UZCA 4DYQA 3GVAA 1T0FC 2PBIA 5LD2C 2HVSA 3PO3J 4L5IA 4UVBA 1USSA 1YW8A 2JTVA 1MH3A 5E1ZB 1JKOC 3C18A 5E8IA 1V5GA 2DOEA 2QLZA 5EG0A 4DQ2A 2ZNZA 2X51A 5DCMB 1FSHA 2KZGA 1DPUA 1YS7A 2X6YA 3DFGA 5J1YA 3R60A 5D8KB 5CVVA 1B9MA 3MMYB 5F1JA 3L2CA 5LEKA 3IAS2 3A1YA 4I0AA 2CW0F 3FWEA 3ERMA 2JA7J 1XGNA 3PQKA 2VQGA 4D5CA 4BBSJ 2OCCH 3JREA 1OCOH 2VJJA 3C7JA 1FBQA 3DBLB 2P6SA 4CA0A 1F9NA 3CCYA 4P1WA 3HEFA 1W7PB 1Z3XA 2XRLA 4UHTA 5FRMA 2FRHA 1D0YA 1ZGJA 2E60A 2AQFA 1IV6A 1P4WA 4RAZA 4XN0A 4AIKA 5JI6A 1MMSA 3J7YJ 4IHWA 5H2FC 2KL4A 1A5JA 1IV8A 4U0YA 5BOXA 5JLXA 2W4SA 3FMQA 3FXMA 4ZC3A 3K9TA 4EM0B 1OKRA 3ABUA 2XAJA 2QBYB 4Y7NJ 3BZCA 3EUHA 5F6FA 3OWTA 4HW0A 3DPUA 1WI9A 4G94A 5FJ8J 3L2QA 1BJZA 3ASNH 1DGWY 1KU9A 4QWQA 5FKOA 2DFIA 1FIPA 4FE4A 1X1AA 3DQVC 4P5OA 4XOTA 1V55H 3QYBA 3CJRB 2L54A 4L9JA 3WU2C 2ZXIA 4M73A 1ZTRA 4AD9A 3O6BB 4O5VA 4HNUA 1WFXA 1IN8A 3SZPA 3O3KA 2AS5F 1R1UA 5IPAA 1R22A 1WRJA 4Y4RA 5BS6A 4Y3OA 3OMYA 1JE8A 5D4SA 4ZH4F 5J4YA 4ESJA 2FOWA 3K4KA 1FSEA 1W4MA 5EEAA 1UHSA 2R4GA 1H9TA 2CGPA 2XPUA 4DZJA 1ZLJA 4EGYA 3IUOA 3OOPA 3OY9A 2AXLA 2QSFX 2GQQA 1ETVA 2QGUA 1WKMA 2M2EA 5FGMA 3ABTA 3NWSA 2JA6J 5B66C 4D1QA 5HNHA 3SDBA 4LK0F 3JRFA 1OR7A 4KMFA 3D5RC 4IOCF 2G7UA 3I0TA 3A2KA 4V2GA 1HOMA 4UVCA 4JX6A 2YX4A 2BY1A 1WSUA 3OS0A 5AONA 1RUNA 4N9IA 2K5CA 1X3WB 2JUCA 1SFUA 5EGOB 3SQNA 1QPMA 5DEQA 3SHFA 2O0YA 5B5EC 4QTRA 3S3MA 5E17F 2E1CA 1U0JA 4AM3A 3E3VA 1R36A 1K6YA 3H35A 2HTSA 2L7ZA 1J09A 1NHAA 3QP5A 5KHDA 1D1CA 3KP7A 1U8BA 1UG2A 2K40A 1JXSA 2HDCA 5DDGA 1ZG5A 1HKTA 3HZJA 2H94A 2ZJQF 1E2XA 1LB2A 3VWBA 3I54A 3ZOBA 1MZBA 3TO6A 1FP2A 1JGSA 1FYLA 4E7LA 2E1OA 3OS1A 3JR9A 3Q0UA 1G3TA 3ZMSA 3AG2H 5HS9A 1AKHA 3PIOF 2VXZA 4JP0A 2V4JC 1RNLA 4ZZDA 1BM9A 1F43A 4S0HB 4MEYF 2W85A 3ZCOA 4HQEA 1WH7A 2QWWA 1ZRCA 1PUEE 4J01A 1YIJI 4ITVA 2H1LA 2RKHA 2K3PA 2BVLA 3L09A 5FKNA 1E17A 5CVIA 1ZR4A 1FY7A 3CUQB 4C2TA 2M7AA 3OYFA 4NUBA 3J80Z 1WJ5A 2LD5A 5EZHA 3A01B 3GFMA 2G7HA 3M1CA 5KK1A 3GLLA 2O8KA 2ECBA 4KA4A 2Z1DA 1B72A 2KQRA 4OIQF 2Y9ZA 2K9NA 1ETOA 2RQQA 2E2IJ 5GPAA 2BOLA 2RN7A 2A69F 4I7HA 3ZQQA 1D3YA 1FOWA 1YS6A 4LOCA 3VB2A 4M9ZA 2R7XA 3F8NA 4JYKA 3HRUA 1OMIA 2HOEA 3B6CA 1S7EA 2COBA 1W1WE 2ZSHB 4KDPA 1Z7UA 4A93J 5FLXZ 4IQJA 4XNFA 3H5AA 3EPZA 5HS7A 1YJNI 1LEAA 3FK6A 1Z77A 1QGPA 5HLIA 2IVMA 3KFWX 3HL2A 4I09A 3KYDB 3RQIA 3G3ZA 3F9KA 4QPOA 3FX3A 2LDUA 4XM3A 1X2NA 3O8GA 3QYFA 2K4JA 2PMUA 2XASA 5HLGA 3S14J 3PFIA 3JRAA 3N97A 3GFJA 1XN7A 2BVMA 3VFZA 2DA7A 2NAZA 2XB0X 2W25A 4L9NA 1R71A 3F0CA 2X0LA 1FNNA 4CICA 2E1MB 2QCOA 5CYVA 2K9LA 4GYGA 5DCMA 3ASOH 4F91B 1XS9A 3W2VA 3HTSB 4MFEA 3KLOA 1MSFC 2WBMA 1IN5A 1VF9A 1D1BA 1ON2A 4UXNA 3LMMA 4BHCA 4ZJZA 3MCZA 2IGOA 3ABLH 5GP9A 2JA8J 4IPAA 2CO5A 4NC6A 3OYBA 4X6AJ 2V9VA 3AG1H 5CKTA 3R61A 4EATA 3R0JA 4EQQA 5L3GA 3GCMA 1FLIA 3HOTA 1MJBA 3H3VK 1N25A 5CVRA 1YJWI 3E97A 1W7PA 2DYRH 1T38A 1W0UA 2EZIA 2OTLI 2IGKA 4DOZA 4FCYA 3FXQA 3HHHA 1QA6A 2XB5A 2HDDA 1X4PA 2IA2A 2XHKA 4U7DA 3FKIJ 4KISA 2IW5A 2DK8A 3DEEA 1WCMJ 3OV8A 3U1DA 4ZTJA 4II2A 2MC4A 3CC2I 5IP6A 3S1MJ 4L9TA 2R5ZA 4RGXA 1JJ8C 5HLTA 2DA2A 2WV0A 5GTIC 2CJJA 1TWGJ 2ZJRF 2VJIA 3IC7A 2EIKH 3L00A 4PFOA 3VYRB 1RKWA 2QBYA 1QU3A 2QQ8A 4C3HJ 3ZP5A 1FPQA 2XGDA 5IYCJ 1IRZA 3ZN0A 3ONQA 4E7SA 1MIJA 2K7LA 2Y2ZA 4XOPA 2WAEA 1R5ID 5LEJA 4E7IA 1A35A 5GAGJ 3WHCA 3T5XA 1ZYRF 4HF0A 3I53A 2ZMEB 4ZDPA 4B3AA 3AAFA 1E0EA 5H6RA 3QWLA 3V7SA 3I64A 4TV7A 1O57A 4B3XA 2A3SA 3FMRA 2R7TA 3FISA 2IS1A 4BQQA 4KUMA 1XSVA 3V42A 2HOAA 1XGOA 4GYIA 1UB9A 3ZMZA 1TBXA 2QSHX 1I50J 1YE9A 2DOAA 3CUQC 3HBLA 3OIPA 1VFCA 3BROA 3U2RA 4NBQA 1BJAA 1K83J 3K6GA 4EJOA 2JA5J 4M6XA 4EMSA 2FBKA 2M34A 2QVOA 2K27A 4PSXA 2DN0A 3Q0WA 2F2EA 5ERIA 4U0VA 1H8AC 1MJAA 3OYMA 5EJCA 1REPC 3K7AJ 9ANTA 1ETXA 1SMYF 5F64A 4KJZA 2GZWA 4R79A 2EIMH 4HSTA 2XAQA 3OS2A 3ZQLA 2EBIA 3SXYA 2PJPA 3VODA 4NDLA 3OL4A 2V1XA 2RAEA 1WJAA 2KJBA 1BL0A 2FOKA 1JUSA 2P0WA 1OJLA 3LFUA 4PFPA 1MDMB 3JAMK 3B6AA 3KZIC 3RTRA 3M8EA 4BE1A 3M4OJ 2A5YB 3FKJA 4HLYA 4M9XA 1RC9A 2HQRA 2VQLA 5D6FA 4KN4X 2J5PA 5F08A 4UUTA 4JBAA 3ZGKA 4B4CA 2KIMA 3NQOA 1YO5C 2K9MA 2BY0A 1PDNC 3CUOA 3HHGA 1IXCA 1IZ1A 3PUFA 1RRJA 3F3XA 1TW2A 3DLAA 4RGRA 4M9SA 1U5TB 1YJ9I 3V8JA 3LWFA 1YX5A 1Q1HA 2JWTA 1UCRA 5EGOA 2GOXB 3CCVI 2BW3B 5AIQA 2FXAA 2EFWA 3FXUA 4LD5A 2F5CA 2ZXHA 4MIMA 4A3KJ 1SAUA 2XF6A 1WQ2A 4HQMA 4I98B 3TW7A 2FMYA 2WAQA 2ZBKA 1USTA 2V7FA 3M3YJ 3EETA 1L3LA 3I4MJ 1W0TA 1FOKA 2W84A 2XPWA 2XIGA 1XGMA 2MLKA 3FBIB 1JHHA 1XMXA 1IRFA 1MJ9A 5ED4A 2PX9A 2K9QA 3AG3H 2Y0MA 3DPTA 4PJNA 2QUFA 4BACA 3TMOA 2L7KA 3ABKH 2E5ZA 1W5CC 2FU4A 4CZZA 2I5UA 3EYIA 1TQIA 3PL8A 1GDTA 2ME6A 3WTZA 2KFDA 1VQ4I 4R1HA 1FBUA 1O7FA 2DU9A 2FUG2 5E3LA 2UUZA 2ISYA 2J5OA 4FT8A 3RYPA 1H89C 4BE2A 2ETHA 5E3NA 2FMLA 2K9SA 2KZVA 2Q1ZB 2MFZA 3A01A 3W2AA 3CDIA 2IA1A 1BW5A 3GTOJ 4QSHA 3E6DA 4XKCA 5ICEA 2KLOA 3IL2A 4WWCA 2HQNA 1LFPA 2OZUA 3E5XA 3H0DA 4FISA 1F1ZA 4BNCA 1JI8A 3J81K 3KP2A 4D5FA 5E1WA 1WJCA 1P4AA 1Y0UA 3FM3A 3OIOA 3I55I 2LBFB 3X2QH 3T1BA 1ONVA 1LDDA 2P5KA 3C2GA 3IKVA 1UJ8A 2I8DA 1XGSA 3PM1A 4D7NA 4X0GA 3S17J 4WXHA 1ZHFA 4XLCA 1R23A 1JT6A 2JVHA 2RV8A 1L0OC 3D5SC 5J1UA 3TP3A 2V79A 3T0YA 2M1BA 3E5UA 4MTDA 2XSJC 1SFOJ 3LSMA 4BXXJ 5CVUA 1J2XA 2M8EA 2XKOA 2K86A 3MEXA 3CJQB 3ECHA 3OR2C 4ESFA 5TISC 5K5OA 2O9LA 2V6EA 3ZQ7A 1E3HA 2LK2A 2CV1A 5KNLA 2CG4A 2RREA 1P4XA 2RC4A 2QSGX
chains in the Genus database with same CATH topology
3HRTA 2IT0A 5FO5A 2VE8A 1S7OA 5D5VB 2DW4A 4HV6A 3BPVA 2VC1A 3LQQA 2WWYA 5BPDA 3IHUA 4BYYA 1EV7A 1U5TC 2NRAC 2KKOA 4BHPA 1XDSA 5BPIA 5LLQA 4NB5A 1IN7A 2BE5F 2DPUA 4EJUA 1IXSB 1J9IA 5DV5A 3HRMA 4IRGA 1IAWA 4OMZA 1D8JA 4Q4ZF 2P6TA 2XAHA 3EQLF 2LF8A 1U8RA 4CDGA 4G6DA 4MEXF 3I71A 3J7AO 1KA8A 2PQ8A 1T6SA 5HDGA 3LAPA 2HR3A 3CO6C 2ZMEA 2V1DA 4KIBA 2KIUA 1EH8A 4RB3C 2GA2A 4UVAA 2BV6A 3DV8A 2V6CA 3BP8A 2VC0A 3F8MA 1FYMA 4RGUA 2RVCA 4MHGA 3V4GA 2TDXA 1FBSA 4YFNF 1BN5A 1Z6TA 2L4MA 1LVAA 1S3JA 2L3DA 4IXAA 2UXXA 5EEGA 4G7ZF 4PDKA 2VT3A 1I27A 3TDZC 1ZRFA 3WU0A 4ZYEA 3M7GA 2ZXJA 1MDMA 1RI7A 1D5VA 2R3SA 4LB6B 4CGZA 2HFHA 2ZO4A 1LJ9A 2DT5A 2Z99A 5BQTA 1GHCA 1KQ0A 2YSRA 3R6SA 3GW2A 3GFIA 5KVRA 3ERED 1R5HA 1FYKA 3QU6A 4I0BA 1TW3A 3B73A 4EV0A 1O3RA 4CO8A 2M30A 3BPXA 4HLXA 3BJAA 2D1HA 3MZYA 3P9KA 3VEPA 5HS8A 2D1VA 4RGSA 1ZLKA 2OBPA 3WG9A 1B4AA 3RKWA 4PGHA 3K1NA 2COMA 3GZ5A 2DAOA 2BBYA 3LA2A 4A6EA 1K78B 5JR3A 4LMYA 1R7JA 3GYHX 2XV4S 4S05A 5CVJA 3K1MA 1ZG1A 2HTJA 3HYIA 1T0FA 3KEQA 3T8RA 4IRIA 4OIRF 3P7NA 2OQRA 3LFKA 3ZMTA 5ICFA 4I01A 3HSEA 3K0LA 3EYYA 1F5TA 4ON0A 2YR2A 3HSFA 4CHUA 4Q47A 3GF2A 3SZTA 3E6CC 2LNBA 3E5QA 1ULYA 3GWZA 4K2EA 4HZFA 1RIOH 2EA4A 2GAUA 3S2WA 3GUDA 1CF7A 3ROUA 4ZYDA 3JSPA 2CWEA 2FBIA 4WXDA 4L0ZB 3KZZA 1U6GA 2JSCA 2R7FA 2L02A 2XAFA 3CTAA 4P55A 1MD0A 2ZFWA 1FP1D 1SFXA 2ELHA 3BZ6A 3SFZA 4A5NA 4BH9A 1O3SA 2H6CA 1AWCA 2Q8KA 3WTSC 3PQJA 4CXFA 3I59B 4FX0A 2OU2A 4BQAA 3LQRA 1OYIA 4R8HA 3O2PE 3R0AA 5E8GA 3J80K 1U2WA 2RGVA 2DPDA 4P9FA 4ESBA 2BYVE 4WCGA 5DD8A 5JVTA 2HYGD 2W24A 4I02A 4OMYA 3WTTC 1I5ZA 4G9YA 2BEOA 4GCVA 1H0MA 2FEZA 1I6XA 1LNWA 2HEOA 3CLOA 2P8TA 1ODDA 2FNPA 3I4PA 3TGNA 5FLXK 2VBWA 3H92A 3Q5FA 2DBBA 2MH9A 3NEUA 4WXCA 4ZZLA 1R00A 2MBFA 3RYRA 3W6KB 1DPRA 2DO7A 3FM5A 1FT9A 1GXPA 4BXUA 4ENKA 5L3CA 2HGCA 1ZAOA 5H6QA 2ZNYA 1LDKB 3BJ6A 1FX7A 1YG2A 1XB4A 3F22A 4Y13A 1A04A 4EVIA 2EK5A 4ZYGA 1Z91A 5A2QZ 3IWFA 4U7BA 4Y17A 3MWMA 3V8LA 4M74A 5F1RA 1BC8C 3WTVC 4L9VA 3CJNA 2O6GE 2HYFA 3WE2A 2STTA 5E20A 4OU0A 3BOQA 5IT9Z 5ILSA 1ZGAA 4KT5C 2HS5A 2KIFA 4O3MA 2VBZA 4B09A 4A5MA 1MKMA 2Z33A 1R1VA 1OPCA 1UHMA 1XDUA 4OIPF 1DP7P 2A07F 2CYYA 3QP6A 1K78A 1W5TA 5L3BA 3REOA 4WX9A 1RZ4A 4JK1X 2JT1A 4Q5SF 4A6DA 4UV9A 4WK8F 4N0BA 2LF7A 3W6JB 4XRFA 3TO7A 3B02A 1GXQA 3QU3A 1V3FA 1I1SA 4GO1A 5DUIA 2BGCA 2IP2A 2HKXA 3K1PA 4HBLA 3ZMUA 2IA0A 2UXNA 2VT2A 5HVQC 3KCCA 4OINF 1B59A 4L5JA 3RI4A 2JRTA 2IPQX 3Q9SA 3DPLC 2VONA 1XCBA 1KU7A 2ESHA 1IN4A 3KLNA 4I2OA 2DLLA 4AWXB 3HOSA 3GEZA 2DQRA 2RQPA 3CO7C 2GA1A 3H3ZA 2ISZA 3KEOA 1ZG3A 3RDIA 3HIFA 2H27A 1SMTA 1EH7A 4ZYHA 3WTXC 3HSRA 1P2FA 3BY6A 1D8KA 3G73A 5J6XA 3RIRA 5D8LB 3I59A 1QZZA 3JSOA 2KRFA 1BOAA 3K69A 3CUQA 4Z2YA 2EWNA 3C1DA 5E1XA 2A6EF 1QNTA 4BAYA 2F5FA 1LQ1A 1HW2A 2XUBA 4KIFA 1YYVA 3RPUA 1Z6RA 1YW9A 1BI3A 3EDPA 1HW1A 3QRFF 3NRVA 3MFKA 1R5GA 4KICA 1SAXA 3LA3A 1W5SA 1TNTA 2D45A 3J81Z 2P5LC 1B1BA 2DQLA 3RPQA 5BMZA 5FB2A 2Z5UA 2L4AA 2O8XA 3Q9VA 1G6NA 2NNNA 3TQNA 2FNAA 3KZYA 2PEXA 4U88A 3FMSA 4YG2F 1QO0D 1XSDA 2VOOA 3KP5A 4XSZF 3WE3A 4A12A 1K79A 4YFKF 2MD5A 5HOOA 3GFLA 4HDUA 5H20A 1PP8F 2YX7A 4AVPA 3V7CA 2VN2A 3C3WA 3M1EA 5E18F 1ON1A 1S7AA 4PZJA 3V7RA 2EFNA 1O3TA 4HF1A 3KE2A 1HW5A 5DD4A 1FZPB 4LFUA 5TJJA 1S29A 4ENNA 4CYDA 2DI3A 1XMKA 1C0WA 1HXDA 2R7DA 1Z1DA 2DTRA 3FHZA 1T98A 1O3QA 4KFCA 5HDKA 2KJCA 2HWVA 1BC7C 2B0LA 2JPBA 3CDHA 1XSXA 2VBYA 1KQ9A 1LDJA 2M87A 1R58A 4MQVA 1KQ8A 3DKWA 3ZPLA 1SD6A 1RUOA 2VOPA 2QM3A 3F23A 4G8XA 4UNOA 3IRRA 1FC3A 1YLFA 3IKTA 1K7AA 4HX7A 5ICCA 5TRDA 2X4HA 1BI2A 2QYOA 4MGRA 1TQMA 1QZYA 4KIGA 4UV8A 2RNJA 2ADUA 4KN7X 4IRHA 1U5TA 2OQGA 1YIOA 1HSTA 1KYZA 4EJTA 5K5RA 2MA3A 3E6MA 2V1UA 3QPHA 2VODA 2EA2A 3JW4A 4A0ZA 3F21A 4KYWA 4YIFA 2PN6A 1XCVA 2FF4A 2PG4A 2JPCA 3FXRA 4LGWA 3KP6A 2E1NA 2IJLA 3FF5A 4AIJA 3L9FA 2XVCA 4RAYA 3TDUC 3WTWC 2OA4A 3N4MA 1T2KA 1EH6A 1ZARA 4M6YA 3H3UA 1G4DA 4S04A 1P92A 1OYWA 5D5WB 2P5VA 1BI0A 5IT3A 1G3WA 5FFZA 3GLXA 4LB5A 4UUVA 2FA5A 4JQFA 3RJPA 3BDDA 5FD6A 4HX8A 1XD7A 5JFRA 2STWA 3WGGA 2OD5A 2EFQA 4O6JA 2Y48A 4FX4A 3JTGA 2F5EA 5CJ9A 1B6AA 2QENA 4ENJA 2QZ8A 2EV0A 4H0EA 1X3UA 4HA8A 2XAGA 2Q0OA 3LSTA 3T8TA 5L3FA 3WTYC 4LLGF 2K4BA 4EGZA 5ILVA 3ZMVA 3D5LA 3V8KA 4QLCU 4GXOA 3I58A 5LHGA 4ASNA 4A0XA 2ZJ2A 1DUXC 4HOBA 3F72A 4MNUA 2ACJA 1Z9CA 1PP7U 2P4WA 1O7LA 3LAJA 1UHWA 2XGXA 2H09A 4Y15A 1XMAA 4P96A 3WTUC 4G7OF 1R1TA 5ILUA 4RB0A 4OOIA 3WGIA 1P6RA 5D6EA 1YW7A 1BI1A 2NYXA 1UFMA 2VBXA 5D4RA 2PMHA 1BIAA 3ULQB 3P9IA 2UZKA 3F8CA 2PI0A 2MLGA 2E7WA 4IHSA 4PCQA 2EV5A 5LHHA 4L18B 4HAMA 1KGSA 1OYYA 4MTEA 4XLNF 5CLSA 1SD5A 1S8NA 4M72A 2L01A 3TKYA 3F8FA 4F7ZA 4NQWA 4OIOF 5FD5A 2Z9OA 2GWRA 3ZMDA 4LLNA 2EJRA 3ECOA 2HKOA 3HUGA 3MQ0A 3RKYA 3HTUA 2GIVA 4BHBA 3COAC 1YTYA 1QQIA 3GZ6A 5HLHA 4E70A 3WODF 5A2QK 2PLYA 3GX4X 1ZN2A 3TOAA 3M8FA 2CQKA 3F8BA 3DP7A 2IRFG 1BBYA 2QQAA 2K02A 5LGNA 3R4KA 2M45A 5DUKA 3MZHA 1FWZA 4D0PA 2O3FA 4M71A 2JZYA 5IT9K 3DEUA 1HKQA 2ZKZA 3ML6A 1GVJA 4A2UA 2NS0A 2O61A 2FQ3A 4EJVA 3LA7A 2FE3A 2P7VB 2H6BA 3QPTA 1U78A 4MQ9F 3KP3A 4N9HA 4ETSA 1YQAA 2OAZA 4YIIA 5JHUA 4LG0B 2GXBA 4GGGA 4IVNA 1SD4A 3GXOA 2HZTA 3M9AA 4EJWA 2ESNA 4G7HF 4L0YB 1J5YA 1J75A 2MH2A 4HYEA 3JAMZ 1G3YA 5J8FA 2G9WA 3L7WA 2VE9A 1TLHB 1T39A 2Z3YA 1IN6A 1V4RA 4RS8A 1W7PD 1IW7F 4U0WA 5LGTA 1H9GA 3P9CA 2NNYA 4YFXF 3FZVA 1WWXA 4HF2A 3D0SA 2LKPA 3ISPA 4LK1F 3DF8A 1TQPA 2GXGA 4IJAA 2YPRA 1HSJA 2A68F 2QQ9A 2CFXA 1KU2A 3QOPA 4WF2A 3U9GA 4FHTA 1S6LA 2MC3A 4EM2A 1YFHA 3TOBA 1DDNA 4Q48A 2C6YA 4HV5A 1HBXG 3K2ZA 1AOYA 1ZRDA 2WTEA 4EM1A 4P9UA 2WC2A 3TO9A 3MAJA 2YU3A 5LRSA 5K1YA 4NHJA 1HKSA 5J8CA 6PAXA 2M5WA 5LRRA 3KP4A 5D5XB 3GO5A 2E7XA 5DCFA 5DYMA 2LSOA 1I1GA 3IWZA 2CSOA 3BJOA 4G6QA 4RB1A 1CGPA 1U3EM 3ELKA 2UWMA 1IF1A 1TNSA 4XBFA 2F5DA 5EEHA 1B9NA 2RDPA 2FSWA 1K6OA 4KNYA 5D5UB 5LGUA 1JHFA 2A6HF 2FBHA 4ENMA 5ICGA 3ZN1A 5K5QA 1STZA 1MGTA 2QQBA 2EFPA 4AIHA 3F6OA 1IRGA 5LBQA 1Z05A 4KMUX 5HDNA 1VTNC 1CF7B 4IHTA 4HDVA 2EFOA 4HX4A 4A0YA 3KETA 2Y75A 3WU1B 1F4KA 3E6BA 3DXJF 2Q2EA 1IXRC 3QAHA 2P7CB 2O03A 4XLPF 2A61A 1SFEA 1LEBA 1G3SA 1KYWA 4B8XA 1QBJA 2ZCWA 1ZH5A 1J7KA 1TTYA 1ZREA 2PFBA 3BWGA 1J59A 2XRNA 1KU3A 3WGHA 3F6VA 5L3DA 2EB7A 5FFXA 2DK5A 4LLLA 3I5UA 1J0RA 1IUYA 5AIPA 5LHIA 4LG0A 4IF4A 1BIBA 2W57A 2EV6A 5L3EA 3VOEA 1SD7A 2XKPA 3HRSA 3JTHA 4LJZF 4DNCA 3IRQA 4PGGA 4XSXF 1HQCA 3RKXA 2D2WA 2OZ6A 2XROA 4RB2C 3GVAA 2PBIA 4L5IA 4UVBA 1USSA 1YW8A 2JTVA 5E1ZB 3C18A 5E8IA 2QLZA 4DQ2A 2ZNZA 5DCMB 1FSHA 1DPUA 1YS7A 3DFGA 3R60A 5D8KB 5CVVA 1B9MA 3L2CA 5LEKA 4I0AA 2CW0F 3FWEA 1XGNA 3PQKA 3C7JA 1FBQA 2P6SA 1F9NA 1W7PB 4UHTA 2FRHA 1ZGJA 1P4WA 4RAZA 4AIKA 5JI6A 4U0YA 5BOXA 3FMQA 3K9TA 4EM0B 1OKRA 3ABUA 2XAJA 2QBYB 3EUHA 5F6FA 4HW0A 1WI9A 4G94A 1KU9A 4QWQA 2DFIA 4P5OA 3DQVC 2L54A 4L9JA 4M73A 4AD9A 3O6BB 4O5VA 1IN8A 3SZPA 3O3KA 2AS5F 1R1UA 1R22A 1WRJA 5BS6A 1JE8A 5D4SA 4ZH4F 4ESJA 1FSEA 1W4MA 1H9TA 2CGPA 1ZLJA 4EGYA 3OOPA 2AXLA 2GQQA 1WKMA 5FGMA 3ABTA 4LK0F 1OR7A 4KMFA 2G7UA 3I0TA 4UVCA 2YX4A 1WSUA 5AONA 1RUNA 4N9IA 1SFUA 3SQNA 1QPMA 5DEQA 3SHFA 2O0YA 5E17F 2E1CA 3E3VA 1R36A 2HTSA 1NHAA 3QP5A 3KP7A 1JXSA 2HDCA 5DDGA 1ZG5A 1HKTA 2H94A 1E2XA 1LB2A 3I54A 1MZBA 3TO6A 1FP2A 1JGSA 1FYLA 1G3TA 3ZMSA 5HS9A 2VXZA 1RNLA 4ZZDA 1BM9A 4MEYF 2W85A 4HQEA 2QWWA 1ZRCA 1PUEE 2RKHA 3L09A 1E17A 5CVIA 1FY7A 3CUQB 3J80Z 3GFMA 2G7HA 5KK1A 4KA4A 4OIQF 2RN7A 2A69F 4I7HA 1D3YA 1YS6A 3VB2A 4M9ZA 3F8NA 3HRUA 1OMIA 2HOEA 4KDPA 1Z7UA 5FLXZ 5HS7A 1LEAA 1QGPA 5HLIA 2IVMA 3KFWX 4I09A 3G3ZA 3FX3A 2LDUA 2K4JA 2PMUA 2XASA 5HLGA 3PFIA 3N97A 3GFJA 1XN7A 3VFZA 2NAZA 4L9NA 2W25A 2X0LA 1FNNA 4CICA 5CYVA 5DCMA 4GYGA 3HTSB 3KLOA 1IN5A 1ON2A 4UXNA 4BHCA 3MCZA 4IPAA 2CO5A 2V9VA 3R61A 3R0JA 4EQQA 5L3GA 1FLIA 3HOTA 1MJBA 5CVRA 3E97A 1W7PA 1T38A 3FXQA 3HHHA 2IA2A 2XHKA 4U7DA 2IW5A 2DK8A 3OV8A 3U1DA 4L9TA 4RGXA 2WV0A 3IC7A 3L00A 2QBYA 3ZP5A 1FPQA 3ZN0A 2K7LA 5LEJA 3T5XA 1ZYRF 4HF0A 3I53A 2ZMEB 3AAFA 5H6RA 3V7SA 3I64A 4TV7A 1O57A 2A3SA 3FMRA 4KUMA 1XSVA 1XGOA 4GYIA 1UB9A 3ZMZA 1TBXA 3CUQC 3BROA 3U2RA 1BJAA 4EJOA 4M6XA 4EMSA 2FBKA 2QVOA 2K27A 2F2EA 5ERIA 4U0VA 1MJAA 1REPC 1SMYF 5F64A 2GZWA 4R79A 2XAQA 3SXYA 2PJPA 3VODA 2V1XA 2KJBA 2FOKA 1MDMB 3JAMK 3RTRA 3M8EA 2A5YB 4HLYA 4M9XA 2HQRA 5D6FA 4KN4X 2J5PA 4JBAA 2KIMA 3NQOA 1YO5C 1PDNC 3CUOA 3HHGA 1IXCA 1IZ1A 3F3XA 1TW2A 4RGRA 4M9SA 1U5TB 3V8JA 3LWFA 1Q1HA 1UCRA 5AIQA 2FXAA 2EFWA 3FXUA 4LD5A 2F5CA 1WQ2A 4HQMA 4I98B 2FMYA 2ZBKA 1USTA 3EETA 1L3LA 1FOKA 2W84A 2XIGA 1XGMA 2MLKA 1JHHA 1IRFA 1MJ9A 5ED4A 2Y0MA 3DPTA 2QUFA 2FU4A 4CZZA 3EYIA 1TQIA 3WTZA 4R1HA 1FBUA 1O7FA 2DU9A 3RYPA 2ISYA 2J5OA 4FT8A 2ETHA 2FMLA 2IA1A 3E6DA 5ICEA 3IL2A 4WWCA 2HQNA 2OZUA 3E5XA 1F1ZA 4BNCA 3J81K 3KP2A 5E1WA 1P4AA 1Y0UA 3FM3A 3T1BA 1ONVA 1LDDA 2P5KA 3IKVA 1XGSA 4WXHA 1ZHFA 1R23A 2RV8A 1L0OC 2V79A 3T0YA 2M1BA 3E5UA 4MTDA 5CVUA 1J2XA 2M8EA 2XKOA 2K86A 3MEXA 3ECHA 4ESFA 5K5OA 3ZQ7A 2CG4A 1P4XA 2RC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRT A;  2IT0 A;  5FO5 A;  2VE8 A;  1S7O A;  5D5V B;  2DW4 A;  4HV6 A;  3BPV A;  2VC1 A;  3LQQ A;  2WWY A;  5BPD A;  3IHU A;  4BYY A;  1EV7 A;  1U5T C;  2NRA C;  2KKO A;  4BHP A;  1XDS A;  5BPI A;  5LLQ A;  4NB5 A;  1IN7 A;  2BE5 F;  2DPU A;  4EJU A;  1IXS B;  1J9I A;  5DV5 A;  3HRM A;  4IRG A;  1IAW A;  4OMZ A;  1D8J A;  4Q4Z F;  2P6T A;  2XAH A;  3EQL F;  2LF8 A;  1U8R A;  4CDG A;  4G6D A;  4MEX F;  3I71 A;  3J7A O;  1KA8 A;  2PQ8 A;  1T6S A;  5HDG A;  3LAP A;  2HR3 A;  3CO6 C;  2ZME A;  2V1D A;  4KIB A;  2KIU A;  1EH8 A;  4RB3 C;  2GA2 A;  4UVA A;  2BV6 A;  3DV8 A;  2V6C A;  3BP8 A;  2VC0 A;  3F8M A;  1FYM A;  4RGU A;  2RVC A;  4MHG A;  3V4G A;  2TDX A;  1FBS A;  4YFN F;  1BN5 A;  1Z6T A;  2L4M A;  1LVA A;  1S3J A;  2L3D A;  4IXA A;  2UXX A;  5EEG A;  4G7Z F;  4PDK A;  2VT3 A;  1I27 A;  3TDZ C;  1ZRF A;  3WU0 A;  4ZYE A;  3M7G A;  2ZXJ A;  1MDM A;  1RI7 A;  1D5V A;  2R3S A;  4LB6 B;  4CGZ A;  2HFH A;  2ZO4 A;  1LJ9 A;  2DT5 A;  2Z99 A;  5BQT A;  1GHC A;  1KQ0 A;  2YSR A;  3R6S A;  3GW2 A;  3GFI A;  5KVR A;  3ERE D;  1R5H A;  1FYK A;  3QU6 A;  4I0B A;  1TW3 A;  3B73 A;  4EV0 A;  1O3R A;  4CO8 A;  2M30 A;  3BPX A;  4HLX A;  3BJA A;  2D1H A;  3MZY A;  3P9K A;  3VEP A;  5HS8 A;  2D1V A;  4RGS A;  1ZLK A;  2OBP A;  3WG9 A;  1B4A A;  3RKW A;  4PGH A;  3K1N A;  2COM A;  3GZ5 A;  2DAO A;  2BBY A;  3LA2 A;  4A6E A;  1K78 B;  5JR3 A;  4LMY A;  1R7J A;  3GYH X;  2XV4 S;  4S05 A;  5CVJ A;  3K1M A;  1ZG1 A;  2HTJ A;  3HYI A;  1T0F A;  3KEQ A;  3T8R A;  4IRI A;  4OIR F;  3P7N A;  2OQR A;  3LFK A;  3ZMT A;  5ICF A;  4I01 A;  3HSE A;  3K0L A;  3EYY A;  1F5T A;  4ON0 A;  2YR2 A;  3HSF A;  4CHU A;  4Q47 A;  3GF2 A;  3SZT A;  3E6C C;  2LNB A;  3E5Q A;  1ULY A;  3GWZ A;  4K2E A;  4HZF A;  1RIO H;  2EA4 A;  2GAU A;  3S2W A;  3GUD A;  1CF7 A;  3ROU A;  4ZYD A;  3JSP A;  2CWE A;  2FBI A;  4WXD A;  4L0Z B;  3KZZ A;  1U6G A;  2JSC A;  2R7F A;  2L02 A;  2XAF A;  3CTA A;  4P55 A;  1MD0 A;  2ZFW A;  1FP1 D;  1SFX A;  2ELH A;  3BZ6 A;  3SFZ A;  4A5N A;  4BH9 A;  1O3S A;  2H6C A;  1AWC A;  2Q8K A;  3WTS C;  3PQJ A;  4CXF A;  3I59 B;  4FX0 A;  2OU2 A;  4BQA A;  3LQR A;  1OYI A;  4R8H A;  3O2P E;  3R0A A;  5E8G A;  3J80 K;  1U2W A;  2RGV A;  2DPD A;  4P9F A;  4ESB A;  2BYV E;  4WCG A;  5DD8 A;  5JVT A;  2HYG D;  2W24 A;  4I02 A;  4OMY A;  3WTT C;  1I5Z A;  4G9Y A;  2BEO A;  4GCV A;  1H0M A;  2FEZ A;  1I6X A;  1LNW A;  2HEO A;  3CLO A;  2P8T A;  1ODD A;  2FNP A;  3I4P A;  3TGN A;  5FLX K;  2VBW A;  3H92 A;  3Q5F A;  2DBB A;  2MH9 A;  3NEU A;  4WXC A;  4ZZL A;  1R00 A;  2MBF A;  3RYR A;  3W6K B;  1DPR A;  2DO7 A;  3FM5 A;  1FT9 A;  1GXP A;  4BXU A;  4ENK A;  5L3C A;  2HGC A;  1ZAO A;  5H6Q A;  2ZNY A;  1LDK B;  3BJ6 A;  1FX7 A;  1YG2 A;  1XB4 A;  3F22 A;  4Y13 A;  1A04 A;  4EVI A;  2EK5 A;  4ZYG A;  1Z91 A;  5A2Q Z;  3IWF A;  4U7B A;  4Y17 A;  3MWM A;  3V8L A;  4M74 A;  5F1R A;  1BC8 C;  3WTV C;  4L9V A;  3CJN A;  2O6G E;  2HYF A;  3WE2 A;  2STT A;  5E20 A;  4OU0 A;  3BOQ A;  5IT9 Z;  5ILS A;  1ZGA A;  4KT5 C;  2HS5 A;  2KIF A;  4O3M A;  2VBZ A;  4B09 A;  4A5M A;  1MKM A;  2Z33 A;  1R1V A;  1OPC A;  1UHM A;  1XDU A;  4OIP F;  1DP7 P;  2A07 F;  2CYY A;  3QP6 A;  1K78 A;  1W5T A;  5L3B A;  3REO A;  4WX9 A;  1RZ4 A;  4JK1 X;  2JT1 A;  4Q5S F;  4A6D A;  4UV9 A;  4WK8 F;  4N0B A;  2LF7 A;  3W6J B;  4XRF A;  3TO7 A;  3B02 A;  1GXQ A;  3QU3 A;  1V3F A;  1I1S A;  4GO1 A;  5DUI A;  2BGC A;  2IP2 A;  2HKX A;  3K1P A;  4HBL A;  3ZMU A;  2IA0 A;  2UXN A;  2VT2 A;  5HVQ C;  3KCC A;  4OIN F;  1B59 A;  4L5J A;  3RI4 A;  2JRT A;  2IPQ X;  3Q9S A;  3DPL C;  2VON A;  1XCB A;  1KU7 A;  2ESH A;  1IN4 A;  3KLN A;  4I2O A;  2DLL A;  4AWX B;  3HOS A;  3GEZ A;  2DQR A;  2RQP A;  3CO7 C;  2GA1 A;  3H3Z A;  2ISZ A;  3KEO A;  1ZG3 A;  3RDI A;  3HIF A;  2H27 A;  1SMT A;  1EH7 A;  4ZYH A;  3WTX C;  3HSR A;  1P2F A;  3BY6 A;  1D8K A;  3G73 A;  5J6X A;  3RIR A;  5D8L B;  3I59 A;  1QZZ A;  3JSO A;  2KRF A;  1BOA A;  3K69 A;  3CUQ A;  4Z2Y A;  2EWN A;  3C1D A;  5E1X A;  2A6E F;  1QNT A;  4BAY A;  2F5F A;  1LQ1 A;  1HW2 A;  2XUB A;  4KIF A;  1YYV A;  3RPU A;  1Z6R A;  1YW9 A;  1BI3 A;  3EDP A;  1HW1 A;  3QRF F;  3NRV A;  3MFK A;  1R5G A;  4KIC A;  1SAX A;  3LA3 A;  1W5S A;  1TNT A;  2D45 A;  3J81 Z;  2P5L C;  1B1B A;  2DQL A;  3RPQ A;  5BMZ A;  5FB2 A;  2Z5U A;  2L4A A;  2O8X A;  3Q9V A;  1G6N A;  2NNN A;  3TQN A;  2FNA A;  3KZY A;  2PEX A;  4U88 A;  3FMS A;  4YG2 F;  1QO0 D;  1XSD A;  2VOO A;  3KP5 A;  4XSZ F;  3WE3 A;  4A12 A;  1K79 A;  4YFK F;  2MD5 A;  5HOO A;  3GFL A;  4HDU A;  5H20 A;  1PP8 F;  2YX7 A;  4AVP A;  3V7C A;  2VN2 A;  3C3W A;  3M1E A;  5E18 F;  1ON1 A;  1S7A A;  4PZJ A;  3V7R A;  2EFN A;  1O3T A;  4HF1 A;  3KE2 A;  1HW5 A;  5DD4 A;  1FZP B;  4LFU A;  5TJJ A;  1S29 A;  4ENN A;  4CYD A;  2DI3 A;  1XMK A;  1C0W A;  1HXD A;  2R7D A;  1Z1D A;  2DTR A;  3FHZ A;  1T98 A;  1O3Q A;  4KFC A;  5HDK A;  2KJC A;  2HWV A;  1BC7 C;  2B0L A;  2JPB A;  3CDH A;  1XSX A;  2VBY A;  1KQ9 A;  1LDJ A;  2M87 A;  1R58 A;  4MQV A;  1KQ8 A;  3DKW A;  3ZPL A;  1SD6 A;  1RUO A;  2VOP A;  2QM3 A;  3F23 A;  4G8X A;  4UNO A;  3IRR A;  1FC3 A;  1YLF A;  3IKT A;  1K7A A;  4HX7 A;  5ICC A;  5TRD A;  2X4H A;  1BI2 A;  2QYO A;  4MGR A;  1TQM A;  1QZY A;  4KIG A;  4UV8 A;  2RNJ A;  2ADU A;  4KN7 X;  4IRH A;  1U5T A;  2OQG A;  1YIO A;  1HST A;  1KYZ A;  4EJT A;  5K5R A;  2MA3 A;  3E6M A;  2V1U A;  3QPH A;  2VOD A;  2EA2 A;  3JW4 A;  4A0Z A;  3F21 A;  4KYW A;  4YIF A;  2PN6 A;  1XCV A;  2FF4 A;  2PG4 A;  2JPC A;  3FXR A;  4LGW A;  3KP6 A;  2E1N A;  2IJL A;  3FF5 A;  4AIJ A;  3L9F A;  2XVC A;  4RAY A;  3TDU C;  3WTW C;  2OA4 A;  3N4M A;  1T2K A;  1EH6 A;  1ZAR A;  4M6Y A;  3H3U A;  1G4D A;  4S04 A;  1P92 A;  1OYW A;  5D5W B;  2P5V A;  1BI0 A;  5IT3 A;  1G3W A;  5FFZ A;  3GLX A;  4LB5 A;  4UUV A;  2FA5 A;  4JQF A;  3RJP A;  3BDD A;  5FD6 A;  4HX8 A;  1XD7 A;  5JFR A;  2STW A;  3WGG A;  2OD5 A;  2EFQ A;  4O6J A;  2Y48 A;  4FX4 A;  3JTG A;  2F5E A;  5CJ9 A;  1B6A A;  2QEN A;  4ENJ A;  2QZ8 A;  2EV0 A;  4H0E A;  1X3U A;  4HA8 A;  2XAG A;  2Q0O A;  3LST A;  3T8T A;  5L3F A;  3WTY C;  4LLG F;  2K4B A;  4EGZ A;  5ILV A;  3ZMV A;  3D5L A;  3V8K A;  4QLC U;  4GXO A;  3I58 A;  5LHG A;  4ASN A;  4A0X A;  2ZJ2 A;  1DUX C;  4HOB A;  3F72 A;  4MNU A;  2ACJ A;  1Z9C A;  1PP7 U;  2P4W A;  1O7L A;  3LAJ A;  1UHW A;  2XGX A;  2H09 A;  4Y15 A;  1XMA A;  4P96 A;  3WTU C;  4G7O F;  1R1T A;  5ILU A;  4RB0 A;  4OOI A;  3WGI A;  1P6R A;  5D6E A;  1YW7 A;  1BI1 A;  2NYX A;  1UFM A;  2VBX A;  5D4R A;  2PMH A;  1BIA A;  3ULQ B;  3P9I A;  2UZK A;  3F8C A;  2PI0 A;  2MLG A;  2E7W A;  4IHS A;  4PCQ A;  2EV5 A;  5LHH A;  4L18 B;  4HAM A;  1KGS A;  1OYY A;  4MTE A;  4XLN F;  5CLS A;  1SD5 A;  1S8N A;  4M72 A;  2L01 A;  3TKY A;  3F8F A;  4F7Z A;  4NQW A;  4OIO F;  5FD5 A;  2Z9O A;  2GWR A;  3ZMD A;  4LLN A;  2EJR A;  3ECO A;  2HKO A;  3HUG A;  3MQ0 A;  3RKY A;  3HTU A;  2GIV A;  4BHB A;  3COA C;  1YTY A;  1QQI A;  3GZ6 A;  5HLH A;  4E70 A;  3WOD F;  5A2Q K;  2PLY A;  3GX4 X;  1ZN2 A;  3TOA A;  3M8F A;  2CQK A;  3F8B A;  3DP7 A;  2IRF G;  1BBY A;  2QQA A;  2K02 A;  5LGN A;  3R4K A;  2M45 A;  5DUK A;  3MZH A;  1FWZ A;  4D0P A;  2O3F A;  4M71 A;  2JZY A;  5IT9 K;  3DEU A;  1HKQ A;  2ZKZ A;  3ML6 A;  1GVJ A;  4A2U A;  2NS0 A;  2O61 A;  2FQ3 A;  4EJV A;  3LA7 A;  2FE3 A;  2P7V B;  2H6B A;  3QPT A;  1U78 A;  4MQ9 F;  3KP3 A;  4N9H A;  4ETS A;  1YQA A;  2OAZ A;  4YII A;  5JHU A;  4LG0 B;  2GXB A;  4GGG A;  4IVN A;  1SD4 A;  3GXO A;  2HZT A;  3M9A A;  4EJW A;  2ESN A;  4G7H F;  4L0Y B;  1J5Y A;  1J75 A;  2MH2 A;  4HYE A;  3JAM Z;  1G3Y A;  5J8F A;  2G9W A;  3L7W A;  2VE9 A;  1TLH B;  1T39 A;  2Z3Y A;  1IN6 A;  1V4R A;  4RS8 A;  1W7P D;  1IW7 F;  4U0W A;  5LGT A;  1H9G A;  3P9C A;  2NNY A;  4YFX F;  3FZV A;  1WWX A;  4HF2 A;  3D0S A;  2LKP A;  3ISP A;  4LK1 F;  3DF8 A;  1TQP A;  2GXG A;  4IJA A;  2YPR A;  1HSJ A;  2A68 F;  2QQ9 A;  2CFX A;  1KU2 A;  3QOP A;  4WF2 A;  3U9G A;  4FHT A;  1S6L A;  2MC3 A;  4EM2 A;  1YFH A;  3TOB A;  1DDN A;  4Q48 A;  2C6Y A;  4HV5 A;  1HBX G;  3K2Z A;  1AOY A;  1ZRD A;  2WTE A;  4EM1 A;  4P9U A;  2WC2 A;  3TO9 A;  3MAJ A;  2YU3 A;  5LRS A;  5K1Y A;  4NHJ A;  1HKS A;  5J8C A;  6PAX A;  2M5W A;  5LRR A;  3KP4 A;  5D5X B;  3GO5 A;  2E7X A;  5DCF A;  5DYM A;  2LSO A;  1I1G A;  3IWZ A;  2CSO A;  3BJO A;  4G6Q A;  4RB1 A;  1CGP A;  1U3E M;  3ELK A;  2UWM A;  1IF1 A;  1TNS A;  4XBF A;  2F5D A;  5EEH A;  1B9N A;  2RDP A;  2FSW A;  1K6O A;  4KNY A;  5D5U B;  5LGU A;  1JHF A;  2A6H F;  2FBH A;  4ENM A;  5ICG A;  3ZN1 A;  5K5Q A;  1STZ A;  1MGT A;  2QQB A;  2EFP A;  4AIH A;  3F6O A;  1IRG A;  5LBQ A;  1Z05 A;  4KMU X;  5HDN A;  1VTN C;  1CF7 B;  4IHT A;  4HDV A;  2EFO A;  4HX4 A;  4A0Y A;  3KET A;  2Y75 A;  3WU1 B;  1F4K A;  3E6B A;  3DXJ F;  2Q2E A;  1IXR C;  3QAH A;  2P7C B;  2O03 A;  4XLP F;  2A61 A;  1SFE A;  1LEB A;  1G3S A;  1KYW A;  4B8X A;  1QBJ A;  2ZCW A;  1ZH5 A;  1J7K A;  1TTY A;  1ZRE A;  2PFB A;  3BWG A;  1J59 A;  2XRN A;  1KU3 A;  3WGH A;  3F6V A;  5L3D A;  2EB7 A;  5FFX A;  2DK5 A;  4LLL A;  3I5U A;  1J0R A;  1IUY A;  5AIP A;  5LHI A;  4LG0 A;  4IF4 A;  1BIB A;  2W57 A;  2EV6 A;  5L3E A;  3VOE A;  1SD7 A;  2XKP A;  3HRS A;  3JTH A;  4LJZ F;  4DNC A;  3IRQ A;  4PGG A;  4XSX F;  1HQC A;  3RKX A;  2D2W A;  2OZ6 A;  2XRO A;  4RB2 C;  3GVA A;  2PBI A;  4L5I A;  4UVB A;  1USS A;  1YW8 A;  2JTV A;  5E1Z B;  3C18 A;  5E8I A;  2QLZ A;  4DQ2 A;  2ZNZ A;  5DCM B;  1FSH A;  1DPU A;  1YS7 A;  3DFG A;  3R60 A;  5D8K B;  5CVV A;  1B9M A;  3L2C A;  5LEK A;  4I0A A;  2CW0 F;  3FWE A;  1XGN A;  3PQK A;  3C7J A;  1FBQ A;  2P6S A;  1F9N A;  1W7P B;  4UHT A;  2FRH A;  1ZGJ A;  1P4W A;  4RAZ A;  4AIK A;  5JI6 A;  4U0Y A;  5BOX A;  3FMQ A;  3K9T A;  4EM0 B;  1OKR A;  3ABU A;  2XAJ A;  2QBY B;  3EUH A;  5F6F A;  4HW0 A;  1WI9 A;  4G94 A;  1KU9 A;  4QWQ A;  2DFI A;  4P5O A;  3DQV C;  2L54 A;  4L9J A;  4M73 A;  4AD9 A;  3O6B B;  4O5V A;  1IN8 A;  3SZP A;  3O3K A;  2AS5 F;  1R1U A;  1R22 A;  1WRJ A;  5BS6 A;  1JE8 A;  5D4S A;  4ZH4 F;  4ESJ A;  1FSE A;  1W4M A;  1H9T A;  2CGP A;  1ZLJ A;  4EGY A;  3OOP A;  2AXL A;  2GQQ A;  1WKM A;  5FGM A;  3ABT A;  4LK0 F;  1OR7 A;  4KMF A;  2G7U A;  3I0T A;  4UVC A;  2YX4 A;  1WSU A;  5AON A;  1RUN A;  4N9I A;  1SFU A;  3SQN A;  1QPM A;  5DEQ A;  3SHF A;  2O0Y A;  5E17 F;  2E1C A;  3E3V A;  1R36 A;  2HTS A;  1NHA A;  3QP5 A;  3KP7 A;  1JXS A;  2HDC A;  5DDG A;  1ZG5 A;  1HKT A;  2H94 A;  1E2X A;  1LB2 A;  3I54 A;  1MZB A;  3TO6 A;  1FP2 A;  1JGS A;  1FYL A;  1G3T A;  3ZMS A;  5HS9 A;  2VXZ A;  1RNL A;  4ZZD A;  1BM9 A;  4MEY F;  2W85 A;  4HQE A;  2QWW A;  1ZRC A;  1PUE E;  2RKH A;  3L09 A;  1E17 A;  5CVI A;  1FY7 A;  3CUQ B;  3J80 Z;  3GFM A;  2G7H A;  5KK1 A;  4KA4 A;  4OIQ F;  2RN7 A;  2A69 F;  4I7H A;  1D3Y A;  1YS6 A;  3VB2 A;  4M9Z A;  3F8N A;  3HRU A;  1OMI A;  2HOE A;  4KDP A;  1Z7U A;  5FLX Z;  5HS7 A;  1LEA A;  1QGP A;  5HLI A;  2IVM A;  3KFW X;  4I09 A;  3G3Z A;  3FX3 A;  2LDU A;  2K4J A;  2PMU A;  2XAS A;  5HLG A;  3PFI A;  3N97 A;  3GFJ A;  1XN7 A;  3VFZ A;  2NAZ A;  4L9N A;  2W25 A;  2X0L A;  1FNN A;  4CIC A;  5CYV A;  5DCM A;  4GYG A;  3HTS B;  3KLO A;  1IN5 A;  1ON2 A;  4UXN A;  4BHC A;  3MCZ A;  4IPA A;  2CO5 A;  2V9V A;  3R61 A;  3R0J A;  4EQQ A;  5L3G A;  1FLI A;  3HOT A;  1MJB A;  5CVR A;  3E97 A;  1W7P A;  1T38 A;  3FXQ A;  3HHH A;  2IA2 A;  2XHK A;  4U7D A;  2IW5 A;  2DK8 A;  3OV8 A;  3U1D A;  4L9T A;  4RGX A;  2WV0 A;  3IC7 A;  3L00 A;  2QBY A;  3ZP5 A;  1FPQ A;  3ZN0 A;  2K7L A;  5LEJ A;  3T5X A;  1ZYR F;  4HF0 A;  3I53 A;  2ZME B;  3AAF A;  5H6R A;  3V7S A;  3I64 A;  4TV7 A;  1O57 A;  2A3S A;  3FMR A;  4KUM A;  1XSV A;  1XGO A;  4GYI A;  1UB9 A;  3ZMZ A;  1TBX A;  3CUQ C;  3BRO A;  3U2R A;  1BJA A;  4EJO A;  4M6X A;  4EMS A;  2FBK A;  2QVO A;  2K27 A;  2F2E A;  5ERI A;  4U0V A;  1MJA A;  1REP C;  1SMY F;  5F64 A;  2GZW A;  4R79 A;  2XAQ A;  3SXY A;  2PJP A;  3VOD A;  2V1X A;  2KJB A;  2FOK A;  1MDM B;  3JAM K;  3RTR A;  3M8E A;  2A5Y B;  4HLY A;  4M9X A;  2HQR A;  5D6F A;  4KN4 X;  2J5P A;  4JBA A;  2KIM A;  3NQO A;  1YO5 C;  1PDN C;  3CUO A;  3HHG A;  1IXC A;  1IZ1 A;  3F3X A;  1TW2 A;  4RGR A;  4M9S A;  1U5T B;  3V8J A;  3LWF A;  1Q1H A;  1UCR A;  5AIQ A;  2FXA A;  2EFW A;  3FXU A;  4LD5 A;  2F5C A;  1WQ2 A;  4HQM A;  4I98 B;  2FMY A;  2ZBK A;  1UST A;  3EET A;  1L3L A;  1FOK A;  2W84 A;  2XIG A;  1XGM A;  2MLK A;  1JHH A;  1IRF A;  1MJ9 A;  5ED4 A;  2Y0M A;  3DPT A;  2QUF A;  2FU4 A;  4CZZ A;  3EYI A;  1TQI A;  3WTZ A;  4R1H A;  1FBU A;  1O7F A;  2DU9 A;  3RYP A;  2ISY A;  2J5O A;  4FT8 A;  2ETH A;  2FML A;  2IA1 A;  3E6D A;  5ICE A;  3IL2 A;  4WWC A;  2HQN A;  2OZU A;  3E5X A;  1F1Z A;  4BNC A;  3J81 K;  3KP2 A;  5E1W A;  1P4A A;  1Y0U A;  3FM3 A;  3T1B A;  1ONV A;  1LDD A;  2P5K A;  3IKV A;  1XGS A;  4WXH A;  1ZHF A;  1R23 A;  2RV8 A;  1L0O C;  2V79 A;  3T0Y A;  2M1B A;  3E5U A;  4MTD A;  5CVU A;  1J2X A;  2M8E A;  2XKO A;  2K86 A;  3MEX A;  3ECH A;  4ESF A;  5K5O A;  3ZQ7 A;  2CG4 A;  1P4X A;  2RC4 A; 
#chains in the Genus database with same CATH topology
 3HRT A;  2IT0 A;  1Z21 A;  4OAZ A;  2JN6 A;  1BOB A;  5FO5 A;  2VE8 A;  1S7O A;  5D5V B;  4FQG A;  2L9N A;  5IP9 J;  2DW4 A;  4HV6 A;  2EH3 A;  3J7A Y;  3BPV A;  1DU6 A;  3ABM H;  1DP3 A;  2VC1 A;  3LQQ A;  3K4J A;  2A6T A;  3BTL A;  2WWY A;  3BG3 A;  3HOV J;  3CCM I;  5BPD A;  3SFI A;  2CQN A;  3IHU A;  4BYY A;  1EV7 A;  1QRY A;  1U5T C;  2NRA C;  1LUJ B;  2KKO A;  4BHP A;  1A6Q A;  1XDS A;  4B47 A;  5M3M J;  2E2H J;  5BPI A;  1N77 A;  3BLY A;  4DW6 A;  4EEF G;  2X1E A;  3NWT A;  2QKL B;  5LLQ A;  3RCO A;  2JJ7 A;  4NB5 A;  4CYC B;  2JRM A;  1IN7 A;  2BE5 F;  1Y8Q B;  3FHN A;  1X2M A;  4EJU A;  5F0H A;  1IXS B;  1K4S A;  2DPU A;  2L9V A;  1J9I A;  5DV5 A;  3HRM A;  4IRG A;  1IAW A;  4OMZ A;  1D8J A;  3OOU A;  2VI6 A;  2P6T A;  2XAH A;  4Q4Z F;  1Z7L A;  3EQL F;  2LF8 A;  2DA5 A;  2I10 A;  4U87 A;  1U8R A;  4CDG A;  4G6D A;  3RPU D;  4CUG A;  1JKR C;  4MEX F;  3PSI A;  3I71 A;  3J7A O;  1KA8 A;  1FOX A;  2PQ8 A;  4X1E A;  1T6S A;  5HDG A;  3LAP A;  2HR3 A;  3CO6 C;  3L2W A;  2ZME A;  4XKW A;  2VLA A;  4E7H A;  1NK2 P;  1RPW A;  1HC8 A;  2V1D A;  3KIO A;  2DMT A;  4C30 A;  1V5E A;  4KIB A;  4A3G J;  1WPK A;  3HOZ J;  2X9D A;  3I56 I;  4UUS B;  5FKK A;  5EDN A;  2KRH A;  2KIU A;  4NC7 A;  5M5X J;  1EH8 A;  1QVT A;  4RB3 C;  2GA2 A;  4RLQ A;  4UVA A;  2BV6 A;  4AUX A;  3DV8 A;  2V6C A;  3BP8 A;  1MBF A;  2VC0 A;  1MW7 A;  3F8M A;  1IG7 A;  1FYM A;  4RGU A;  3H9G A;  2X6X A;  2RVC A;  3PUB A;  4MHG A;  3AL0 B;  3V4G A;  4F55 A;  2TDX A;  1FBS A;  4YFN F;  5J4V A;  1T33 A;  1BN5 A;  3BR2 A;  2HXI A;  2RNG A;  2F6C A;  3RZD J;  1Z6T A;  3E0J B;  3NAR A;  2L4M A;  1LVA A;  1RET A;  1S3J A;  2L3D A;  4IXA A;  2UXX A;  5EEG A;  4QPQ A;  3QPL A;  4PDK A;  2VT3 A;  4G7Z F;  2F4O B;  1Q1V A;  1I27 A;  3TDZ C;  2LY1 A;  3OYK A;  1ZRF A;  1BR2 A;  3WU0 A;  4ZYE A;  3HG9 A;  1OCC H;  2ZXJ A;  3M7G A;  1MDM A;  1RI7 A;  4ABZ A;  1D5V A;  1MH4 A;  2R3S A;  3M07 A;  3ZQH A;  3L1P A;  3N05 A;  1Z67 A;  4XRS G;  4LB6 B;  1WI3 A;  4CGZ A;  2HFH A;  2Y0S N;  2VIX A;  4M3G A;  4B43 A;  3S2D J;  2ZO4 A;  1LJ9 A;  2LLK A;  3FXJ A;  2DT5 A;  2Z99 A;  4FTH A;  2VKE A;  5BQT A;  1GHC A;  1KQ0 A;  3DTE A;  2ICW G;  2YSR A;  1X58 A;  3A02 A;  1MMD A;  3R6S A;  3GW2 A;  3G1O A;  2NOG A;  3GFI A;  5KVR A;  4A3I J;  3TP0 A;  3ERE D;  1R5H A;  1FYK A;  3QU6 A;  1I3Q J;  1TW3 A;  4I0B A;  2GIZ A;  3B73 A;  4M3D A;  4DGW B;  4EV0 A;  1TWA J;  3SEQ A;  2DCE A;  2R7S A;  2LY2 A;  1O3R A;  3JRI A;  2IS4 A;  3ZQF A;  3JRD A;  4CO8 A;  1SVL A;  2HVQ A;  3AG4 H;  2M30 A;  2KT0 A;  3BPX A;  5HNF A;  1YI2 I;  4A3B J;  4HLX A;  3BJA A;  1TWH J;  2D1H A;  3MZY A;  3P9K A;  2QEX I;  3VEP A;  3BCB A;  1T95 A;  4II3 A;  5HS8 A;  2R92 J;  2YUS A;  2D1V A;  1XX5 A;  4ZDL A;  2LVS A;  4RGS A;  3RKQ A;  1ZLK A;  4BDY A;  4B48 A;  3H36 A;  2OBP A;  3WG9 A;  2PJR B;  1B4A A;  1OCP A;  4CZC A;  3RKW A;  4PGH A;  3K1N A;  2COM A;  3GZ5 A;  2CUF A;  2DAO A;  4J19 A;  2BBY A;  3JCU C;  3LA2 A;  2L5Q A;  5JLW A;  4A6E A;  4A3F J;  3K2A A;  2DMP A;  3SEZ A;  1K78 B;  1G8X A;  1R9T J;  1Y1W J;  4XLH A;  5JR3 A;  1VQM I;  4LMY A;  3I4N J;  4ANJ A;  1OQY A;  1R7J A;  3GYH X;  1FJL A;  1OCZ H;  2XV4 S;  1TC3 C;  1T8I A;  3PNY A;  4S05 A;  4JX5 A;  5CVJ A;  2LBF A;  3K1M A;  1ZG1 A;  1ZGW A;  2HTJ A;  4BQN A;  3HYI A;  2R93 J;  1T0F A;  3G71 I;  1LFU P;  3KEQ A;  3CMA I;  4IZZ A;  3T8R A;  4IRI A;  1I6H J;  4OIR F;  5EF6 A;  3P7N A;  1UG0 A;  4CSW A;  2OQR A;  4BE0 A;  3LFK A;  3HGY A;  3ZMT A;  5EYR A;  3CCE I;  3K4N A;  5ICF A;  4I01 A;  3HSE A;  3K0L A;  2H8R A;  2YU9 J;  3EYY A;  1F5T A;  4E6K G;  4ON0 A;  1I3A A;  2YR2 A;  3HSF A;  4Q47 A;  3GF2 A;  3SZT A;  5K7F A;  3E6C C;  4CHU A;  3AL0 C;  3ZR8 X;  3KX2 A;  4XLF A;  2LNB A;  3E5Q A;  3LSI A;  3MN2 A;  4XLE A;  1ETY A;  1ULY A;  2EIL H;  3GWZ A;  3IV5 A;  3GTJ J;  4K2E A;  4HZF A;  4YEL A;  1RIO H;  2EA4 A;  2GAU A;  1Y6I A;  2WB1 N;  3HKZ N;  3GUD A;  3S2W A;  3K70 D;  2BHZ A;  1CF7 A;  1DU0 A;  2DFE A;  2DOD A;  2DDB A;  5IOY A;  2LRE A;  1ETQ A;  1BW6 A;  1X1C A;  3WHB A;  2PMZ N;  4XKB A;  3ROU A;  4CH7 A;  5IP7 J;  4ZYD A;  3JSP A;  2NVX J;  2LH9 A;  2CWE A;  2FBI A;  3BZK A;  4I76 A;  4WXD A;  4L0Z B;  2WV1 A;  3KZZ A;  2L7M P;  1U6G A;  2JSC A;  2R7F A;  2L02 A;  2XAF A;  3LSP A;  3CTA A;  1WGX A;  1DQU A;  4P55 A;  1MD0 A;  2ZFW A;  3GTL J;  1FP1 D;  4AYB N;  1ZQ3 P;  1ETW A;  1SFX A;  2ELH A;  3BZ6 A;  3RQ4 A;  3SFZ A;  3SZG A;  4A5N A;  4BH9 A;  2CU7 A;  4IEJ A;  1O3S A;  2NVT J;  4CYC A;  1V5F A;  2X85 A;  2H6C A;  1AHD P;  1AWC A;  3GTM J;  5CQE A;  2Q8K A;  3CF5 F;  3WTS C;  3PQJ A;  4XQF A;  1G59 A;  3S32 A;  4CCJ A;  2KIQ A;  4CXF A;  2HYJ A;  1RR7 A;  3I59 B;  3Q0V A;  2VB6 A;  5HOD A;  1HCR A;  2HDW A;  2LP0 A;  2XGC A;  4FX0 A;  2OU2 A;  2AHQ A;  3ESW B;  4BQA A;  4JOM A;  5DM6 F;  3LQR A;  3FXK A;  1OYI A;  4R8H A;  3O2P E;  4C2M J;  3S2H J;  3R0A A;  2E19 A;  3DKX A;  5E8G A;  3CCL I;  4OWR B;  4A69 C;  3J80 K;  1U2W A;  2RGV A;  3HC7 A;  2KDO A;  2DPD A;  4P9F A;  4ESB A;  2CV2 A;  4A3L J;  2VXD A;  4G6T B;  2BYV E;  4UUS A;  1ORK A;  3QPS A;  4WCG A;  5DD8 A;  1P7J A;  5JVT A;  1WJB A;  3MZ8 A;  2HYG D;  2W24 A;  1UMQ A;  4I02 A;  4OMY A;  2DA6 A;  1I5Z A;  3WTT C;  4G9Y A;  1P7I A;  2VJ5 A;  2BEO A;  2ID3 A;  1Y56 A;  4GCV A;  3VYU B;  1D5Y A;  1H0M A;  2BXY A;  1I6X A;  1LNW A;  2FEZ A;  3BR3 A;  2HEO A;  2HZD A;  3CLO A;  2P8T A;  3HGG A;  1ODD A;  2FNP A;  1VZ0 A;  3I4P A;  4GFB A;  4PJL A;  5F04 A;  3TGN A;  1NTC A;  1R4M B;  5FLX K;  2VBW A;  3H92 A;  3NEU A;  2DBB A;  2MH9 A;  4WXC A;  4ZZL A;  3Q5F A;  4BY1 J;  1R00 A;  3S1R J;  2MBF A;  1LE8 B;  3E1S A;  2E2J J;  3RYR A;  3W6K B;  3HOU J;  1DPR A;  2DO7 A;  4PSW A;  2FJ1 A;  3FM5 A;  1FT9 A;  2XF5 A;  1GXP A;  4BXU A;  1LVK A;  4ENK A;  1MMN A;  5L3C A;  2HGC A;  4IL6 C;  4M3B A;  1ZAO A;  5H6Q A;  2ZNY A;  1AU7 A;  1LDK B;  2X1C A;  2R7W A;  3BJ6 A;  1FX7 A;  1YG2 A;  1XB4 A;  5DM7 F;  3F22 A;  4Y13 A;  1A04 A;  3BTJ A;  4EVI A;  3G4S I;  2EK5 A;  2JMW A;  1R49 A;  4ZYG A;  3CF2 A;  1W36 C;  1Z91 A;  1HDP A;  5A2Q Z;  1A31 A;  2Y31 A;  3IWF A;  4Y17 A;  4U7B A;  3MWM A;  3G2B A;  2KRC A;  3V8L A;  4M74 A;  5F1R A;  1BC8 C;  1XC5 A;  4A3J J;  4YIR X;  3WTV C;  5C4X J;  1QHG A;  4HNT A;  4L9V A;  3UKG A;  3CJN A;  3MKL A;  3CME I;  2O6G E;  3HPG A;  4Y33 A;  2HYF A;  3Q3S A;  1JUP A;  2HU9 A;  3VYT B;  3WE2 A;  2STT A;  5E20 A;  5IY5 H;  1PVE A;  4OU0 A;  3BOQ A;  5K7Z A;  4G12 A;  1YX3 A;  5ILS A;  5IT9 Z;  1ZGA A;  4KT5 C;  3U21 A;  2AO9 A;  2MW8 A;  1GVD A;  2HS5 A;  2KIF A;  1YHQ I;  4O3M A;  2VBZ A;  4B09 A;  4A5M A;  1MKM A;  2Z33 A;  3QQA A;  2K85 A;  3MKY B;  1R1V A;  5E3M A;  3BR1 A;  5KAI C;  2NS8 A;  1OPC A;  1UHM A;  1XDU A;  2LRD A;  1SC7 A;  3CC7 I;  5FLV A;  2HI3 A;  4DZP A;  5EZG A;  2PJR A;  4OIP F;  4HG2 A;  1DP7 P;  1FMV A;  1IO2 A;  2F5V A;  2A07 F;  2DT6 A;  2NOJ B;  2CYY A;  3QP6 A;  2HVR A;  2BY2 A;  3PO2 J;  3K4C A;  1K78 A;  4LIU A;  1W5T A;  1GUU A;  2EPF A;  5L3B A;  4PK4 A;  3REO A;  2Y9Y A;  4AU7 A;  4WX9 A;  2W7N A;  1RZ4 A;  4JK1 X;  1HLV A;  5KAF C;  2JT1 A;  3I3L A;  4Q5S F;  1IRX A;  3BQZ A;  4PJM A;  4A6D A;  2X6O A;  4UV9 A;  2ECC A;  3DEW A;  4WK8 F;  4N0B A;  2LF7 A;  3W6J B;  1JKP C;  4H4K C;  1IUF A;  4OAY A;  4XRF A;  2G0E A;  3TO7 A;  3B02 A;  1GXQ A;  3QU3 A;  1B8I B;  1A36 A;  1V3F A;  1I1S A;  4GO1 A;  2ID6 A;  5DUI A;  2VKH A;  1GV2 A;  2BGC A;  1UEL B;  2WY7 Q;  3IH3 A;  3ZQC A;  3LSR A;  2IP2 A;  2HKX A;  2AXT C;  1BA5 A;  2CMP A;  1SEU A;  3K1P A;  5BNG A;  1OIS A;  4HBL A;  4N4O B;  3ZMU A;  4BEH B;  2OV7 A;  3OYH A;  2IA0 A;  3EUA A;  2UXN A;  2VT2 A;  5HVQ C;  3KCC A;  4OIN F;  3MKW B;  1B59 A;  4L5J A;  2DOF A;  4IOA F;  3RI4 A;  2JRT A;  1SVM A;  2IPQ X;  3Q9S A;  3DPL C;  3CJT B;  3K4L A;  1K4T A;  2VON A;  1XCB A;  4AID A;  3CCU I;  1E3O C;  3RZO J;  1KU7 A;  2ESH A;  1XG1 A;  1BR1 A;  5EG0 B;  1IN4 A;  4HSR A;  2E71 A;  1EKE A;  3KLN A;  4I2O A;  2DLL A;  2F4M B;  4AWX B;  3HOS A;  4BU2 A;  4NC8 A;  2DT7 B;  3GEZ A;  1NG7 A;  2DQR A;  2RQP A;  3CO7 C;  4IHV A;  2GA1 A;  4RLF A;  3H3Z A;  2ISZ A;  2M4K A;  3KEO A;  4BY7 J;  2OTJ I;  2F48 A;  1ZG3 A;  3RDI A;  3ZRG A;  3HIF A;  2R7R A;  1ZK8 A;  4FET A;  1D0X A;  2H27 A;  3OYC A;  1SMT A;  1EH7 A;  4ZYH A;  5KCM A;  2EZL A;  3HXL A;  3HSR A;  1P2F A;  3FDY A;  3WTX C;  5FRN A;  2NVY J;  1VQ9 I;  3BY6 A;  1D8K A;  3G73 A;  3BG6 A;  4CCK A;  5J6X A;  2CUZ A;  2HNH A;  2W00 A;  4BGD A;  3M8J A;  2DMQ A;  3RIR A;  2CH0 A;  2DFF A;  5D8L B;  3I59 A;  1QZZ A;  1ITY A;  2M7B A;  3JSO A;  3ZQI A;  1I39 A;  5B3S H;  1PYV A;  2B63 J;  2KRF A;  3OYD A;  4AVZ A;  1BOA A;  3K69 A;  3CUQ A;  3LSK A;  2E34 A;  4Z2Y A;  2EZH A;  2EWN A;  3S15 J;  3C1D A;  5E1X A;  2CQQ A;  2LC2 A;  2A6E F;  1QNT A;  4BAY A;  2F5F A;  5FLM J;  1X19 A;  2KMU A;  3GTP J;  2LG4 A;  1LQ1 A;  1HW2 A;  2XUB A;  4KIF A;  2X6W A;  3JRH A;  1YYV A;  4HNV A;  3CP8 A;  3RPU A;  4BUP A;  4A3E J;  1Z6R A;  4BS9 A;  1SVO A;  3A03 A;  1YW9 A;  1BI3 A;  3EDP A;  1HW1 A;  3QRF F;  3NRV A;  3MFK A;  1R5G A;  2X1D A;  4KIC A;  3PJR A;  2CQ7 A;  3H5N A;  3OL3 A;  4B44 A;  5IYD J;  1SAX A;  3MVP A;  2KHM A;  3LA3 A;  1W5S A;  1TNT A;  2D45 A;  3J81 Z;  2P5L C;  4AC0 A;  2OF7 A;  1B1B A;  4L5E A;  1A6I A;  2ZXW H;  2DQL A;  5E79 C;  3RPQ A;  4PJJ A;  5BMZ A;  5FB2 A;  3L2U A;  2Z5U A;  1W36 D;  2L4A A;  1X1P A;  3S16 J;  2O8X A;  4HRI A;  4MLO A;  3Q9V A;  1G6N A;  2NNN A;  3TQN A;  1QVU A;  5GAH J;  2FNA A;  3KZY A;  3DU5 A;  2DA3 A;  1X3Z B;  2PEX A;  3HOY J;  4HPQ A;  4U88 A;  1EF4 A;  1LE8 A;  3FMS A;  1U9N A;  4YG2 F;  2NVQ J;  2YS9 A;  1TP4 A;  1QO0 D;  2OC6 A;  2VPR A;  1XSD A;  3JRB A;  2VOO A;  3KP5 A;  4XSZ F;  3WE3 A;  4A12 A;  1K79 A;  4YFK F;  2XC7 A;  2MD5 A;  5HOO A;  3GFL A;  3OYG A;  5GPC A;  3CCS I;  1ZR2 A;  4HDU A;  4BDZ A;  2DA4 A;  3IH4 A;  3OYL A;  4CCO A;  4GRI A;  3VSL A;  1TL8 A;  1ERD A;  5H20 A;  1PP8 F;  2YX7 A;  2DFH A;  4DBQ A;  4AVP A;  3V7C A;  4E7K A;  2VN2 A;  3C3W A;  4XID A;  3M1E A;  4NNJ A;  5E18 F;  1ON1 A;  5B1B H;  1S7A A;  4PZJ A;  3V7R A;  2EFN A;  1CQT A;  1O3T A;  4HF1 A;  3CC4 I;  4XKV A;  2Y0S A;  3KE2 A;  1HW5 A;  5DD4 A;  3K70 C;  3BG7 A;  2CW8 A;  1IC8 A;  1FZP B;  4LFU A;  1OCT C;  3LOC A;  1HF0 A;  1EJ9 A;  5TJJ A;  1IGN A;  1S29 A;  2OCE A;  4ENN A;  2DXI A;  4CYD A;  2DI3 A;  2OJE D;  1MBK A;  1HA8 A;  1XMK A;  1C0W A;  5FKL A;  2LFB A;  2R7U A;  1HXD A;  1IJW C;  3VPR A;  1D0Z A;  2R7D A;  1Z1D A;  2DTR A;  3FHZ A;  1VQP I;  3DCF A;  1GT0 C;  2XSD C;  1T98 A;  2L7F P;  1O3Q A;  1G2H A;  3K4B A;  3ZQG A;  3CCQ I;  1LKX A;  2R7O A;  2OUM A;  2Y69 H;  4DJA A;  1VQK I;  2B7E A;  4KFC A;  2MAB A;  5HDK A;  2KJC A;  1YIT I;  2HWV A;  1BC7 C;  1RES A;  2TCT A;  2B0L A;  2JPB A;  3CDH A;  4XK4 A;  1WJE A;  1XSX A;  1PUF B;  3LSH A;  3BG9 A;  2VBY A;  4RDU A;  1KQ9 A;  3OYI A;  1LDJ A;  2M87 A;  1R58 A;  3I9V 2;  2LKS A;  4ZTF A;  2NXN B;  3SYT A;  4MQV A;  5CPR B;  1KQ8 A;  3DKW A;  3ZPL A;  2WAD A;  4XRS A;  1SD6 A;  1RUO A;  2VOP A;  2QM3 A;  3F23 A;  1O4X A;  4G8X A;  4UNO A;  2M4G A;  5TGT A;  2MYS A;  3HM5 A;  1S5L C;  3IRR A;  2WY8 Q;  2EZK A;  1FC3 A;  2W1O A;  3BTC A;  1YLF A;  2MGQ A;  3IKT A;  1K7A A;  2CS3 A;  4HX7 A;  2HPI A;  4XMY A;  1NK3 P;  4UY8 I;  5ICC A;  5TRD A;  2X4H A;  2Z16 A;  1BI2 A;  2QYO A;  4MGR A;  1TQM A;  4NQW B;  1QZY A;  3D1N I;  1FOY A;  4KIG A;  4UV8 A;  4BEH A;  1Y39 A;  1KZH A;  2ME0 A;  2RNJ A;  1APL C;  2ADU A;  4KN7 X;  4IRH A;  1U5T A;  2EQR A;  5JVG F;  2OQG A;  1F36 A;  3HUG B;  4IO9 F;  1YIO A;  1VQ8 I;  1HST A;  1KYZ A;  2BW3 A;  1YRN B;  4RM3 A;  3W3C A;  4I6Z A;  2GXA A;  4EJT A;  2O7O A;  4DIQ A;  5K5R A;  1EA3 A;  2MG4 A;  1MNM C;  4A3C J;  5FKM A;  2MA3 A;  3E6M A;  1OR7 C;  2V1U A;  1IDZ A;  3QPH A;  1Z0X A;  3MKZ A;  2VOD A;  2EA2 A;  3JW4 A;  3DLL F;  4A0Z A;  2VQC A;  2WB1 A;  3HKZ A;  3F21 A;  4KYW A;  3VDX A;  4YIF A;  3HB9 A;  2PN6 A;  2E36 A;  3OR1 C;  3P5J A;  4V19 K;  1XCV A;  4A3M J;  3S93 A;  2JK3 A;  2FF4 A;  5J47 A;  2PG4 A;  2JPC A;  3LL7 A;  1Z3Y A;  2L0K A;  3FXR A;  1FIA A;  4LGW A;  2PMZ A;  3KP6 A;  2E1N A;  3CZ6 A;  2IJL A;  3FF5 A;  1QPI A;  1UAA A;  1TT5 B;  4AIJ A;  2R5Z B;  1WHU A;  3L9F A;  2JQ7 A;  2XVC A;  1YOV B;  4RAY A;  3BT9 A;  3TDU C;  3S1N J;  3H5R A;  3WTW C;  2OA4 A;  2A05 A;  3N4M A;  1DGR M;  4AYB A;  1T2K A;  1EH6 A;  1ZAR A;  4UB8 C;  2V9P A;  1Y0N A;  4M6Y A;  3H3U A;  1G4D A;  2VUM J;  1KON A;  1JTY A;  2DYS H;  4S04 A;  1P92 A;  5JHF A;  1OYW A;  3A0H C;  5D5W B;  2KP6 A;  2P5V A;  3E7L A;  3WG7 H;  4XL9 A;  1BI0 A;  5IT3 A;  2BHY A;  1G3W A;  4XIC A;  5FFZ A;  3GLX A;  4LB5 A;  3VYS B;  2ZB9 A;  4UUV A;  5CQG A;  2FA5 A;  4JQF A;  3RJP A;  3BDD A;  5FD6 A;  2M0C A;  4HX8 A;  1XD7 A;  5JFR A;  2STW A;  3WGG A;  2OD5 A;  3PSF A;  3DBH B;  2EFQ A;  4O6J A;  1T56 A;  2Y48 A;  4FX4 A;  3JTG A;  3OYA A;  3FXO A;  4RBO A;  2F5E A;  5CJ9 A;  1B6A A;  4BBR J;  3CDL A;  2QEN A;  4ENJ A;  1X4O A;  2QZ8 A;  2EV0 A;  3DKY A;  1X3U A;  2AQE A;  2ZJP F;  4H0E A;  4HA8 A;  3W6V A;  3QYE A;  5IYB J;  3GTG J;  2XAG A;  2Q0O A;  3LST A;  1WJD A;  3T8T A;  4PJ0 C;  2XF7 A;  5L3F A;  3WTY C;  4LLG F;  1TZL A;  2EIN H;  1MND A;  3HOX J;  2K4B A;  4EGZ A;  5ILV A;  2P81 A;  3G1L A;  1LPQ A;  3MD2 A;  4LG3 A;  3ZMV A;  3D5L A;  2LKX A;  3BR5 A;  3V8K A;  4QLC U;  2WA0 A;  4GXO A;  3I58 A;  4J00 A;  5LHG A;  1FEX A;  4ASN A;  4A0X A;  2KDZ A;  2ZJ2 A;  1DUX C;  2Z2S B;  2VL8 A;  2MD0 A;  4HOB A;  4KIT B;  3F72 A;  2JUG A;  2TRT A;  4MNU A;  4C3J J;  4W97 A;  1P9Q C;  1XTA A;  2ACJ A;  1Z9C A;  1PP7 U;  2P4W A;  1O7L A;  3LAJ A;  1UHW A;  2XGX A;  3TL4 X;  2A5W A;  3BR6 A;  2H09 A;  1N78 A;  4Y15 A;  1XMA A;  4P96 A;  5K7H A;  1VQ6 I;  1WH5 A;  2M3A A;  3WTU C;  3CMY A;  4G7O F;  3HOW J;  4IHX A;  2DDA A;  2L9S A;  1MBJ A;  1R1T A;  2CUJ A;  5ILU A;  4RB0 A;  3CP2 A;  4OOI A;  3WGI A;  1P6R A;  5D6E A;  4GDF A;  1SFK A;  1YW7 A;  1BI1 A;  2NYX A;  4F92 B;  1UFM A;  2VBX A;  2GOM A;  3ZXS A;  5D4R A;  2PMH A;  1MSE C;  1BIA A;  4V2F A;  1MMA A;  3ULQ B;  2HXO A;  3P9I A;  3F8C A;  4N4N B;  5LFA A;  2UZK A;  5C4J J;  2IGM A;  3GBG A;  2PI0 A;  3H9Q A;  2F4I A;  2MLG A;  2FQ4 A;  1JUM A;  2E7W A;  2M0M A;  1PUF A;  3CCJ I;  5GAE J;  4IHS A;  1FMW A;  4PCQ A;  2EV5 A;  5LHH A;  4IX7 A;  4L18 B;  4HAM A;  1K61 A;  1MBE A;  1KGS A;  1VQ5 I;  3L2V A;  1TWC J;  3A0B C;  1JGG A;  5E3O A;  3GTQ J;  2CQX A;  3QOE A;  1OYY A;  4M6V A;  3GME A;  4LIV A;  4BL0 B;  4BKX A;  4MTE A;  1M1E B;  2ZSI B;  2MSY A;  3DWL E;  1OCR H;  4XLN F;  5CLS A;  2X48 A;  2LTP A;  2IXS A;  1SD5 A;  4RM2 A;  3AKZ A;  1S8N A;  4M72 A;  5GTH C;  2L01 A;  3TKY A;  3F8F A;  4F7Z A;  4NQW A;  2DMN A;  4OIO F;  5FD5 A;  2Z9O A;  1V54 H;  2M8G X;  2GWR A;  3ZMD A;  3OSG A;  4LLN A;  4BJ6 C;  5J1R A;  2EJR A;  2LMD A;  3ECO A;  2HKO A;  3HUG A;  3G6E I;  3MQ0 A;  3RKY A;  3HTU A;  2GIV A;  4BHB A;  3COA C;  1R6R A;  1YTY A;  1XPX A;  1YRN A;  1QQI A;  2IGN A;  2ELJ A;  3GZ6 A;  4BQO A;  3OYE A;  5HLH A;  3U1K A;  4E70 A;  2R5Y B;  3WOD F;  1JJ6 C;  5A2Q K;  4F3Q A;  1WJF A;  2PLY A;  3GX4 X;  1ZN2 A;  3TOA A;  3M8F A;  2CQK A;  3F8B A;  3DP7 A;  2IRF G;  1BBY A;  2QQA A;  2K02 A;  5LGN A;  3R4K A;  1WZ2 A;  2M45 A;  3FK7 A;  5DUK A;  4FE7 A;  3MZH A;  1FWZ A;  2QKM B;  2VJ4 A;  4D0P A;  2Q2E B;  2NVU B;  2DTZ A;  5IOZ A;  2O3F A;  3O8H A;  4M71 A;  3VSK A;  2JZY A;  3CES A;  5IT9 K;  2L9R A;  3DEU A;  1HKQ A;  2ZKZ A;  5F0F A;  3ML6 A;  3UNG C;  1GVJ A;  4BJT A;  4A2U A;  2NS0 A;  2O61 A;  1VQL I;  4A3D J;  3H1C A;  2FQ3 A;  4EJV A;  3LA7 A;  2M9H A;  2JA2 A;  2FE3 A;  2IS2 A;  2VAS A;  2ELK A;  2P7V B;  4IQ4 A;  2H6B A;  1MMG A;  3KYC B;  1E3P A;  1JT0 A;  4LIT A;  3OSF A;  2W48 A;  3QPT A;  4XR6 A;  4M3F A;  1U78 A;  4MQ9 F;  3KP3 A;  3LSG A;  1S9H A;  2DJN A;  1QZE A;  4N9H A;  4ETS A;  4C9Y A;  1YQA A;  2QF7 A;  2OAZ A;  4YII A;  3C2B A;  2H8W A;  3BQY A;  1RKT A;  5JHU A;  4LG0 B;  2BY3 A;  2GXB A;  2D5V A;  4Z6Y A;  4GGG A;  4IVN A;  1SD4 A;  1ETK A;  3CLQ A;  3KEY A;  5FRO A;  5C3E J;  1NH3 A;  3FXL A;  3NAU A;  4DYR A;  2GBY A;  2KIS A;  2R7V A;  1MNE A;  3HJE A;  4MO7 A;  2V1N A;  4KT6 A;  3GXO A;  3DTK A;  3L2R A;  3UR3 C;  3CD6 I;  3JRG A;  4XON A;  2HZT A;  3M9A A;  4EJW A;  4CCL A;  3TBI A;  1LFB A;  3S3O A;  2XGE A;  4D7M A;  3G1M A;  1AA7 A;  3FBN B;  2H1K A;  1VND A;  1GV5 A;  3LSJ A;  1VQN I;  2HOS A;  2ESN A;  4G7H F;  4L0Y B;  1J5Y A;  3SDG A;  4XN3 A;  1H88 C;  1J75 A;  2MH2 A;  4HYE A;  3JAM Z;  1G3Y A;  5J8F A;  5GAD J;  2G9W A;  3L7W A;  2VE9 A;  1TLH B;  1FTZ A;  2LYC A;  3LNQ A;  1T39 A;  2Z3Y A;  3BR0 A;  2CUE A;  1R4N B;  1IN6 A;  1V4R A;  4RS8 A;  4RAF A;  5DTD A;  3S3N A;  1W7P D;  4F52 A;  1IW7 F;  1GLN A;  3DU6 A;  4U0W A;  5LGT A;  4E7J A;  3OYJ A;  1H9G A;  2UV1 A;  3P9C A;  1RR8 C;  2CFO A;  2NNY A;  4YFX F;  4W1U A;  3FZV A;  2EIJ H;  1WWX A;  4HF2 A;  3D0S A;  2GM4 A;  2LKP A;  3ISP A;  4LK1 F;  1U9O A;  3HDD A;  2E1M C;  3KYL A;  3BC8 A;  3DF8 A;  4RA2 A;  1TQP A;  2HPM A;  1MBG A;  1N75 A;  2GXG A;  3GZN B;  2QA4 I;  4IJA A;  2JSP A;  2YPR A;  2KPM A;  1HSJ A;  2A68 F;  2QQ9 A;  2CFX A;  2CRG A;  4MFD A;  4QIW N;  1ZKG A;  4YEJ A;  1KU2 A;  3QOP A;  4WF2 A;  2W82 A;  3U9G A;  4FHT A;  1S6L A;  2MC3 A;  2VPL A;  4EM2 A;  1POG A;  1YFH A;  3TOB A;  1DDN A;  4Q48 A;  3IP4 B;  4HEA 2;  2CW7 A;  3S8P A;  2C6Y A;  4HV5 A;  1HBX G;  2V9K A;  2LR8 A;  3K2Z A;  1AOY A;  1ZRD A;  3K10 A;  3PIP F;  2WTE A;  4ZYA A;  1TT0 A;  2VQH A;  4EM1 A;  4P9U A;  2WC2 A;  3TO9 A;  1X1D A;  3DTI A;  1S72 I;  4D9J A;  3C2H A;  3IH2 A;  2E5N A;  3TW6 A;  1TWF J;  3MAJ A;  2YU3 A;  1T08 B;  5LRS A;  4Y52 J;  5K1Y A;  4NHJ A;  2BXZ A;  4I99 C;  3CCR I;  3PNT A;  1HKS A;  2R0Q C;  5J8C A;  6PAX A;  1PJR A;  2M5W A;  5LRR A;  2R7Q A;  3KP4 A;  4B1R A;  5D5X B;  3GO5 A;  2E7X A;  5DCF A;  5DYM A;  2DMU A;  2ZME C;  4RMN A;  2LSO A;  1I1G A;  3IWZ A;  2E35 A;  2CSO A;  4RAG A;  1WVR A;  4XLA A;  3BJO A;  4G6Q A;  4RB1 A;  3FIW A;  1CGP A;  1U3E M;  2V26 A;  2CV0 A;  3ELK A;  2UWM A;  1IF1 A;  1IDY A;  1TNS A;  2BZT A;  4XBF A;  2F5D A;  2HQA A;  2ZC2 A;  5EEH A;  1B9N A;  4CCM A;  5F27 A;  2RDP A;  1JTX A;  2FSW A;  1K6O A;  4KNY A;  5D5U B;  5LGU A;  1OLT A;  2XDV A;  2DJI A;  1JHF A;  4PUS A;  2A6H F;  4YRV A;  4BXF A;  2FBH A;  5J3L A;  4ENM A;  4XRM A;  5ICG A;  3ZN1 A;  1ZEL A;  5K5Q A;  5B1A H;  3PFY A;  1STZ A;  1MGT A;  2QQB A;  5M5Y J;  3BTI A;  2EFP A;  2WAQ N;  1ACI A;  4AIH A;  2FX0 A;  2Y30 A;  3SJM A;  3F6O A;  2B9S A;  1FTT A;  1IRG A;  3J7Z I;  2ZFU A;  5LBQ A;  3K4M A;  1Z05 A;  4KMU X;  1VQ7 I;  5HDN A;  4F93 B;  3QOD A;  3HPH A;  1VTN C;  1CF7 B;  4IHT A;  5DS9 A;  4HDV A;  2IEK A;  2R5Y A;  3CQZ J;  2EFO A;  5M5W J;  3RSN A;  1Y8R B;  4C2U A;  2L2O A;  4HX4 A;  1Y1V J;  4A0Y A;  3PNV A;  3KET A;  3IAM 2;  1OFC X;  3TED A;  2VKV A;  2Y75 A;  5F0C A;  4BJ5 C;  2OPT A;  2JVG A;  3WU1 B;  1F4K A;  3CMM A;  3E6B A;  3DXJ F;  2NS7 A;  2Q2E A;  2HOT A;  1IXR C;  3QAH A;  2P7C B;  2O03 A;  4XLP F;  2A61 A;  1SFE A;  2XAU A;  1VI0 A;  1AKH B;  4C3I J;  2LY9 A;  4IKF A;  1LEB A;  1G3S A;  3GTK J;  1KYW A;  4B8X A;  1QBJ A;  2ZCW A;  5J40 A;  1ZH5 A;  5M3F J;  3AFH A;  1J7K A;  1TTY A;  1SAN A;  4XOR A;  4FAS D;  1ZRE A;  2PFB A;  2WAF A;  4M3E A;  3BWG A;  1J59 A;  2XRN A;  1KU3 A;  2IBD A;  3WGH A;  3F6V A;  4IHY A;  5L3D A;  2EB7 A;  3JRC A;  5FFX A;  2LOO A;  2DK5 A;  4LLL A;  4ZDO A;  3KPH A;  3I5U A;  1QHH D;  1J0R A;  1BR4 A;  2K3F A;  2R7Z J;  3BCA A;  1IUY A;  3H0G J;  5AIP A;  3EUH C;  5LHI A;  4LG0 A;  4CCN A;  2IS6 A;  4DYC A;  4IF4 A;  1BIB A;  3EUK L;  1VQO I;  2W57 A;  3OYN A;  1MBH A;  2EV6 A;  2HQ5 A;  4DBR A;  5L3E A;  1B72 B;  3W2W A;  3VOE A;  4UB6 C;  1JKQ C;  1SD7 A;  2XKP A;  2DA1 A;  3HRS A;  3JTH A;  3H9J A;  3BG5 A;  4LJZ F;  4DNC A;  2N8G A;  3IRQ A;  2IAI A;  3OIQ A;  1B8I A;  4E7Z A;  4PGG A;  1HDD C;  1X1B A;  2GLO A;  4XSX F;  3S1Q J;  1HQC A;  2XPV A;  3RKX A;  1D1A A;  2FD5 A;  1ENH A;  3A4C A;  4JX4 A;  5C44 J;  2D2W A;  2VKD A;  2OZ6 A;  1NG6 A;  2O5R A;  4E4H A;  2XRO A;  3DBR B;  4RB2 C;  1UZC A;  4DYQ A;  3GVA A;  1T0F C;  2PBI A;  5LD2 C;  2HVS A;  3PO3 J;  4L5I A;  4UVB A;  1USS A;  1YW8 A;  2JTV A;  1MH3 A;  5E1Z B;  1JKO C;  3C18 A;  5E8I A;  1V5G A;  2DOE A;  2QLZ A;  5EG0 A;  4DQ2 A;  2ZNZ A;  2X51 A;  5DCM B;  1FSH A;  2KZG A;  1DPU A;  1YS7 A;  2X6Y A;  3DFG A;  5J1Y A;  3R60 A;  5D8K B;  5CVV A;  1B9M A;  3MMY B;  5F1J A;  3L2C A;  5LEK A;  3IAS 2;  3A1Y A;  4I0A A;  2CW0 F;  3FWE A;  3ERM A;  2JA7 J;  1XGN A;  3PQK A;  2VQG A;  4D5C A;  4BBS J;  2OCC H;  3JRE A;  1OCO H;  2VJJ A;  3C7J A;  1FBQ A;  3DBL B;  2P6S A;  4CA0 A;  1F9N A;  3CCY A;  4P1W A;  3HEF A;  1W7P B;  1Z3X A;  2XRL A;  4UHT A;  5FRM A;  2FRH A;  1D0Y A;  1ZGJ A;  2E60 A;  2AQF A;  1IV6 A;  1P4W A;  4RAZ A;  4XN0 A;  4AIK A;  5JI6 A;  1MMS A;  3J7Y J;  4IHW A;  5H2F C;  2KL4 A;  1A5J A;  1IV8 A;  4U0Y A;  5BOX A;  5JLX A;  2W4S A;  3FMQ A;  3FXM A;  4ZC3 A;  3K9T A;  4EM0 B;  1OKR A;  3ABU A;  2XAJ A;  2QBY B;  4Y7N J;  3BZC A;  3EUH A;  5F6F A;  3OWT A;  4HW0 A;  3DPU A;  1WI9 A;  4G94 A;  5FJ8 J;  3L2Q A;  1BJZ A;  3ASN H;  1DGW Y;  1KU9 A;  4QWQ A;  5FKO A;  2DFI A;  1FIP A;  4FE4 A;  1X1A A;  3DQV C;  4P5O A;  4XOT A;  1V55 H;  3QYB A;  3CJR B;  2L54 A;  4L9J A;  3WU2 C;  2ZXI A;  4M73 A;  1ZTR A;  4AD9 A;  3O6B B;  4O5V A;  4HNU A;  1WFX A;  1IN8 A;  3SZP A;  3O3K A;  2AS5 F;  1R1U A;  5IPA A;  1R22 A;  1WRJ A;  4Y4R A;  5BS6 A;  4Y3O A;  3OMY A;  1JE8 A;  5D4S A;  4ZH4 F;  5J4Y A;  4ESJ A;  2FOW A;  3K4K A;  1FSE A;  1W4M A;  5EEA A;  1UHS A;  2R4G A;  1H9T A;  2CGP A;  2XPU A;  4DZJ A;  1ZLJ A;  4EGY A;  3IUO A;  3OOP A;  3OY9 A;  2AXL A;  2QSF X;  2GQQ A;  1ETV A;  2QGU A;  1WKM A;  2M2E A;  5FGM A;  3ABT A;  3NWS A;  2JA6 J;  5B66 C;  4D1Q A;  5HNH A;  3SDB A;  4LK0 F;  3JRF A;  1OR7 A;  4KMF A;  3D5R C;  4IOC F;  2G7U A;  3I0T A;  3A2K A;  4V2G A;  1HOM A;  4UVC A;  4JX6 A;  2YX4 A;  2BY1 A;  1WSU A;  3OS0 A;  5AON A;  1RUN A;  4N9I A;  2K5C A;  1X3W B;  2JUC A;  1SFU A;  5EGO B;  3SQN A;  1QPM A;  5DEQ A;  3SHF A;  2O0Y A;  5B5E C;  4QTR A;  3S3M A;  5E17 F;  2E1C A;  1U0J A;  4AM3 A;  3E3V A;  1R36 A;  1K6Y A;  3H35 A;  2HTS A;  2L7Z A;  1J09 A;  1NHA A;  3QP5 A;  5KHD A;  1D1C A;  3KP7 A;  1U8B A;  1UG2 A;  2K40 A;  1JXS A;  2HDC A;  5DDG A;  1ZG5 A;  1HKT A;  3HZJ A;  2H94 A;  2ZJQ F;  1E2X A;  1LB2 A;  3VWB A;  3I54 A;  3ZOB A;  1MZB A;  3TO6 A;  1FP2 A;  1JGS A;  1FYL A;  4E7L A;  2E1O A;  3OS1 A;  3JR9 A;  3Q0U A;  1G3T A;  3ZMS A;  3AG2 H;  5HS9 A;  1AKH A;  3PIO F;  2VXZ A;  4JP0 A;  2V4J C;  1RNL A;  4ZZD A;  1BM9 A;  1F43 A;  4S0H B;  4MEY F;  2W85 A;  3ZCO A;  4HQE A;  1WH7 A;  2QWW A;  1ZRC A;  1PUE E;  4J01 A;  1YIJ I;  4ITV A;  2H1L A;  2RKH A;  2K3P A;  2BVL A;  3L09 A;  5FKN A;  1E17 A;  5CVI A;  1ZR4 A;  1FY7 A;  3CUQ B;  4C2T A;  2M7A A;  3OYF A;  4NUB A;  3J80 Z;  1WJ5 A;  2LD5 A;  5EZH A;  3A01 B;  3GFM A;  2G7H A;  3M1C A;  5KK1 A;  3GLL A;  2O8K A;  2ECB A;  4KA4 A;  2Z1D A;  1B72 A;  2KQR A;  4OIQ F;  2Y9Z A;  2K9N A;  1ETO A;  2RQQ A;  2E2I J;  5GPA A;  2BOL A;  2RN7 A;  2A69 F;  4I7H A;  3ZQQ A;  1D3Y A;  1FOW A;  1YS6 A;  4LOC A;  3VB2 A;  4M9Z A;  2R7X A;  3F8N A;  4JYK A;  3HRU A;  1OMI A;  2HOE A;  3B6C A;  1S7E A;  2COB A;  1W1W E;  2ZSH B;  4KDP A;  1Z7U A;  4A93 J;  5FLX Z;  4IQJ A;  4XNF A;  3H5A A;  3EPZ A;  5HS7 A;  1YJN I;  1LEA A;  3FK6 A;  1Z77 A;  1QGP A;  5HLI A;  2IVM A;  3KFW X;  3HL2 A;  4I09 A;  3KYD B;  3RQI A;  3G3Z A;  3F9K A;  4QPO A;  3FX3 A;  2LDU A;  4XM3 A;  1X2N A;  3O8G A;  3QYF A;  2K4J A;  2PMU A;  2XAS A;  5HLG A;  3S14 J;  3PFI A;  3JRA A;  3N97 A;  3GFJ A;  1XN7 A;  2BVM A;  3VFZ A;  2DA7 A;  2NAZ A;  2XB0 X;  2W25 A;  4L9N A;  1R71 A;  3F0C A;  2X0L A;  1FNN A;  4CIC A;  2E1M B;  2QCO A;  5CYV A;  2K9L A;  4GYG A;  5DCM A;  3ASO H;  4F91 B;  1XS9 A;  3W2V A;  3HTS B;  4MFE A;  3KLO A;  1MSF C;  2WBM A;  1IN5 A;  1VF9 A;  1D1B A;  1ON2 A;  4UXN A;  3LMM A;  4BHC A;  4ZJZ A;  3MCZ A;  2IGO A;  3ABL H;  5GP9 A;  2JA8 J;  4IPA A;  2CO5 A;  4NC6 A;  3OYB A;  4X6A J;  2V9V A;  3AG1 H;  5CKT A;  3R61 A;  4EAT A;  3R0J A;  4EQQ A;  5L3G A;  3GCM A;  1FLI A;  3HOT A;  1MJB A;  3H3V K;  1N25 A;  5CVR A;  1YJW I;  3E97 A;  1W7P A;  2DYR H;  1T38 A;  1W0U A;  2EZI A;  2OTL I;  2IGK A;  4DOZ A;  4FCY A;  3FXQ A;  3HHH A;  1QA6 A;  2XB5 A;  2HDD A;  1X4P A;  2IA2 A;  2XHK A;  4U7D A;  3FKI J;  4KIS A;  2IW5 A;  2DK8 A;  3DEE A;  1WCM J;  3OV8 A;  3U1D A;  4ZTJ A;  4II2 A;  2MC4 A;  3CC2 I;  5IP6 A;  3S1M J;  4L9T A;  2R5Z A;  4RGX A;  1JJ8 C;  5HLT A;  2DA2 A;  2WV0 A;  5GTI C;  2CJJ A;  1TWG J;  2ZJR F;  2VJI A;  3IC7 A;  2EIK H;  3L00 A;  4PFO A;  3VYR B;  1RKW A;  2QBY A;  1QU3 A;  2QQ8 A;  4C3H J;  3ZP5 A;  1FPQ A;  2XGD A;  5IYC J;  1IRZ A;  3ZN0 A;  3ONQ A;  4E7S A;  1MIJ A;  2K7L A;  2Y2Z A;  4XOP A;  2WAE A;  1R5I D;  5LEJ A;  4E7I A;  1A35 A;  5GAG J;  3WHC A;  3T5X A;  1ZYR F;  4HF0 A;  3I53 A;  2ZME B;  4ZDP A;  4B3A A;  3AAF A;  1E0E A;  5H6R A;  3QWL A;  3V7S A;  3I64 A;  4TV7 A;  1O57 A;  4B3X A;  2A3S A;  3FMR A;  2R7T A;  3FIS A;  2IS1 A;  4BQQ A;  4KUM A;  1XSV A;  3V42 A;  2HOA A;  1XGO A;  4GYI A;  1UB9 A;  3ZMZ A;  1TBX A;  2QSH X;  1I50 J;  1YE9 A;  2DOA A;  3CUQ C;  3HBL A;  3OIP A;  1VFC A;  3BRO A;  3U2R A;  4NBQ A;  1BJA A;  1K83 J;  3K6G A;  4EJO A;  2JA5 J;  4M6X A;  4EMS A;  2FBK A;  2M34 A;  2QVO A;  2K27 A;  4PSX A;  2DN0 A;  3Q0W A;  2F2E A;  5ERI A;  4U0V A;  1H8A C;  1MJA A;  3OYM A;  5EJC A;  1REP C;  3K7A J;  9ANT A;  1ETX A;  1SMY F;  5F64 A;  4KJZ A;  2GZW A;  4R79 A;  2EIM H;  4HST A;  2XAQ A;  3OS2 A;  3ZQL A;  2EBI A;  3SXY A;  2PJP A;  3VOD A;  4NDL A;  3OL4 A;  2V1X A;  2RAE A;  1WJA A;  2KJB A;  1BL0 A;  2FOK A;  1JUS A;  2P0W A;  1OJL A;  3LFU A;  4PFP A;  1MDM B;  3JAM K;  3B6A A;  3KZI C;  3RTR A;  3M8E A;  4BE1 A;  3M4O J;  2A5Y B;  3FKJ A;  4HLY A;  4M9X A;  1RC9 A;  2HQR A;  2VQL A;  5D6F A;  4KN4 X;  2J5P A;  5F08 A;  4UUT A;  4JBA A;  3ZGK A;  4B4C A;  2KIM A;  3NQO A;  1YO5 C;  2K9M A;  2BY0 A;  1PDN C;  3CUO A;  3HHG A;  1IXC A;  1IZ1 A;  3PUF A;  1RRJ A;  3F3X A;  1TW2 A;  3DLA A;  4RGR A;  4M9S A;  1U5T B;  1YJ9 I;  3V8J A;  3LWF A;  1YX5 A;  1Q1H A;  2JWT A;  1UCR A;  5EGO A;  2GOX B;  3CCV I;  2BW3 B;  5AIQ A;  2FXA A;  2EFW A;  3FXU A;  4LD5 A;  2F5C A;  2ZXH A;  4MIM A;  4A3K J;  1SAU A;  2XF6 A;  1WQ2 A;  4HQM A;  4I98 B;  3TW7 A;  2FMY A;  2WAQ A;  2ZBK A;  1UST A;  2V7F A;  3M3Y J;  3EET A;  1L3L A;  3I4M J;  1W0T A;  1FOK A;  2W84 A;  2XPW A;  2XIG A;  1XGM A;  2MLK A;  3FBI B;  1JHH A;  1XMX A;  1IRF A;  1MJ9 A;  5ED4 A;  2PX9 A;  2K9Q A;  3AG3 H;  2Y0M A;  3DPT A;  4PJN A;  2QUF A;  4BAC A;  3TMO A;  2L7K A;  3ABK H;  2E5Z A;  1W5C C;  2FU4 A;  4CZZ A;  2I5U A;  3EYI A;  1TQI A;  3PL8 A;  1GDT A;  2ME6 A;  3WTZ A;  2KFD A;  1VQ4 I;  4R1H A;  1FBU A;  1O7F A;  2DU9 A;  2FUG 2;  5E3L A;  2UUZ A;  2ISY A;  2J5O A;  4FT8 A;  3RYP A;  1H89 C;  4BE2 A;  2ETH A;  5E3N A;  2FML A;  2K9S A;  2KZV A;  2Q1Z B;  2MFZ A;  3A01 A;  3W2A A;  3CDI A;  2IA1 A;  1BW5 A;  3GTO J;  4QSH A;  3E6D A;  4XKC A;  5ICE A;  2KLO A;  3IL2 A;  4WWC A;  2HQN A;  1LFP A;  2OZU A;  3E5X A;  3H0D A;  4FIS A;  1F1Z A;  4BNC A;  1JI8 A;  3J81 K;  3KP2 A;  4D5F A;  5E1W A;  1WJC A;  1P4A A;  1Y0U A;  3FM3 A;  3OIO A;  3I55 I;  2LBF B;  3X2Q H;  3T1B A;  1ONV A;  1LDD A;  2P5K A;  3C2G A;  3IKV A;  1UJ8 A;  2I8D A;  1XGS A;  3PM1 A;  4D7N A;  4X0G A;  3S17 J;  4WXH A;  1ZHF A;  4XLC A;  1R23 A;  1JT6 A;  2JVH A;  2RV8 A;  1L0O C;  3D5S C;  5J1U A;  3TP3 A;  2V79 A;  3T0Y A;  2M1B A;  3E5U A;  4MTD A;  2XSJ C;  1SFO J;  3LSM A;  4BXX J;  5CVU A;  1J2X A;  2M8E A;  2XKO A;  2K86 A;  3MEX A;  3CJQ B;  3ECH A;  3OR2 C;  4ESF A;  5TIS C;  5K5O A;  2O9L A;  2V6E A;  3ZQ7 A;  1E3H A;  2LK2 A;  2CV1 A;  5KNL A;  2CG4 A;  2RRE A;  1P4X A;  2RC4 A;  2QSG X; 
#chains in the Genus database with same CATH homology
 3HRT A;  2IT0 A;  5FO5 A;  2VE8 A;  1S7O A;  5D5V B;  2DW4 A;  4HV6 A;  3BPV A;  2VC1 A;  3LQQ A;  2WWY A;  5BPD A;  3IHU A;  4BYY A;  1EV7 A;  1U5T C;  2NRA C;  2KKO A;  4BHP A;  1XDS A;  5BPI A;  5LLQ A;  4NB5 A;  1IN7 A;  2BE5 F;  2DPU A;  4EJU A;  1IXS B;  1J9I A;  5DV5 A;  3HRM A;  4IRG A;  1IAW A;  4OMZ A;  1D8J A;  4Q4Z F;  2P6T A;  2XAH A;  3EQL F;  2LF8 A;  1U8R A;  4CDG A;  4G6D A;  4MEX F;  3I71 A;  3J7A O;  1KA8 A;  2PQ8 A;  1T6S A;  5HDG A;  3LAP A;  2HR3 A;  3CO6 C;  2ZME A;  2V1D A;  4KIB A;  2KIU A;  1EH8 A;  4RB3 C;  2GA2 A;  4UVA A;  2BV6 A;  3DV8 A;  2V6C A;  3BP8 A;  2VC0 A;  3F8M A;  1FYM A;  4RGU A;  2RVC A;  4MHG A;  3V4G A;  2TDX A;  1FBS A;  4YFN F;  1BN5 A;  1Z6T A;  2L4M A;  1LVA A;  1S3J A;  2L3D A;  4IXA A;  2UXX A;  5EEG A;  4G7Z F;  4PDK A;  2VT3 A;  1I27 A;  3TDZ C;  1ZRF A;  3WU0 A;  4ZYE A;  3M7G A;  2ZXJ A;  1MDM A;  1RI7 A;  1D5V A;  2R3S A;  4LB6 B;  4CGZ A;  2HFH A;  2ZO4 A;  1LJ9 A;  2DT5 A;  2Z99 A;  5BQT A;  1GHC A;  1KQ0 A;  2YSR A;  3R6S A;  3GW2 A;  3GFI A;  5KVR A;  3ERE D;  1R5H A;  1FYK A;  3QU6 A;  4I0B A;  1TW3 A;  3B73 A;  4EV0 A;  1O3R A;  4CO8 A;  2M30 A;  3BPX A;  4HLX A;  3BJA A;  2D1H A;  3MZY A;  3P9K A;  3VEP A;  5HS8 A;  2D1V A;  4RGS A;  1ZLK A;  2OBP A;  3WG9 A;  1B4A A;  3RKW A;  4PGH A;  3K1N A;  2COM A;  3GZ5 A;  2DAO A;  2BBY A;  3LA2 A;  4A6E A;  1K78 B;  5JR3 A;  4LMY A;  1R7J A;  3GYH X;  2XV4 S;  4S05 A;  5CVJ A;  3K1M A;  1ZG1 A;  2HTJ A;  3HYI A;  1T0F A;  3KEQ A;  3T8R A;  4IRI A;  4OIR F;  3P7N A;  2OQR A;  3LFK A;  3ZMT A;  5ICF A;  4I01 A;  3HSE A;  3K0L A;  3EYY A;  1F5T A;  4ON0 A;  2YR2 A;  3HSF A;  4CHU A;  4Q47 A;  3GF2 A;  3SZT A;  3E6C C;  2LNB A;  3E5Q A;  1ULY A;  3GWZ A;  4K2E A;  4HZF A;  1RIO H;  2EA4 A;  2GAU A;  3S2W A;  3GUD A;  1CF7 A;  3ROU A;  4ZYD A;  3JSP A;  2CWE A;  2FBI A;  4WXD A;  4L0Z B;  3KZZ A;  1U6G A;  2JSC A;  2R7F A;  2L02 A;  2XAF A;  3CTA A;  4P55 A;  1MD0 A;  2ZFW A;  1FP1 D;  1SFX A;  2ELH A;  3BZ6 A;  3SFZ A;  4A5N A;  4BH9 A;  1O3S A;  2H6C A;  1AWC A;  2Q8K A;  3WTS C;  3PQJ A;  4CXF A;  3I59 B;  4FX0 A;  2OU2 A;  4BQA A;  3LQR A;  1OYI A;  4R8H A;  3O2P E;  3R0A A;  5E8G A;  3J80 K;  1U2W A;  2RGV A;  2DPD A;  4P9F A;  4ESB A;  2BYV E;  4WCG A;  5DD8 A;  5JVT A;  2HYG D;  2W24 A;  4I02 A;  4OMY A;  3WTT C;  1I5Z A;  4G9Y A;  2BEO A;  4GCV A;  1H0M A;  2FEZ A;  1I6X A;  1LNW A;  2HEO A;  3CLO A;  2P8T A;  1ODD A;  2FNP A;  3I4P A;  3TGN A;  5FLX K;  2VBW A;  3H92 A;  3Q5F A;  2DBB A;  2MH9 A;  3NEU A;  4WXC A;  4ZZL A;  1R00 A;  2MBF A;  3RYR A;  3W6K B;  1DPR A;  2DO7 A;  3FM5 A;  1FT9 A;  1GXP A;  4BXU A;  4ENK A;  5L3C A;  2HGC A;  1ZAO A;  5H6Q A;  2ZNY A;  1LDK B;  3BJ6 A;  1FX7 A;  1YG2 A;  1XB4 A;  3F22 A;  4Y13 A;  1A04 A;  4EVI A;  2EK5 A;  4ZYG A;  1Z91 A;  5A2Q Z;  3IWF A;  4U7B A;  4Y17 A;  3MWM A;  3V8L A;  4M74 A;  5F1R A;  1BC8 C;  3WTV C;  4L9V A;  3CJN A;  2O6G E;  2HYF A;  3WE2 A;  2STT A;  5E20 A;  4OU0 A;  3BOQ A;  5IT9 Z;  5ILS A;  1ZGA A;  4KT5 C;  2HS5 A;  2KIF A;  4O3M A;  2VBZ A;  4B09 A;  4A5M A;  1MKM A;  2Z33 A;  1R1V A;  1OPC A;  1UHM A;  1XDU A;  4OIP F;  1DP7 P;  2A07 F;  2CYY A;  3QP6 A;  1K78 A;  1W5T A;  5L3B A;  3REO A;  4WX9 A;  1RZ4 A;  4JK1 X;  2JT1 A;  4Q5S F;  4A6D A;  4UV9 A;  4WK8 F;  4N0B A;  2LF7 A;  3W6J B;  4XRF A;  3TO7 A;  3B02 A;  1GXQ A;  3QU3 A;  1V3F A;  1I1S A;  4GO1 A;  5DUI A;  2BGC A;  2IP2 A;  2HKX A;  3K1P A;  4HBL A;  3ZMU A;  2IA0 A;  2UXN A;  2VT2 A;  5HVQ C;  3KCC A;  4OIN F;  1B59 A;  4L5J A;  3RI4 A;  2JRT A;  2IPQ X;  3Q9S A;  3DPL C;  2VON A;  1XCB A;  1KU7 A;  2ESH A;  1IN4 A;  3KLN A;  4I2O A;  2DLL A;  4AWX B;  3HOS A;  3GEZ A;  2DQR A;  2RQP A;  3CO7 C;  2GA1 A;  3H3Z A;  2ISZ A;  3KEO A;  1ZG3 A;  3RDI A;  3HIF A;  2H27 A;  1SMT A;  1EH7 A;  4ZYH A;  3WTX C;  3HSR A;  1P2F A;  3BY6 A;  1D8K A;  3G73 A;  5J6X A;  3RIR A;  5D8L B;  3I59 A;  1QZZ A;  3JSO A;  2KRF A;  1BOA A;  3K69 A;  3CUQ A;  4Z2Y A;  2EWN A;  3C1D A;  5E1X A;  2A6E F;  1QNT A;  4BAY A;  2F5F A;  1LQ1 A;  1HW2 A;  2XUB A;  4KIF A;  1YYV A;  3RPU A;  1Z6R A;  1YW9 A;  1BI3 A;  3EDP A;  1HW1 A;  3QRF F;  3NRV A;  3MFK A;  1R5G A;  4KIC A;  1SAX A;  3LA3 A;  1W5S A;  1TNT A;  2D45 A;  3J81 Z;  2P5L C;  1B1B A;  2DQL A;  3RPQ A;  5BMZ A;  5FB2 A;  2Z5U A;  2L4A A;  2O8X A;  3Q9V A;  1G6N A;  2NNN A;  3TQN A;  2FNA A;  3KZY A;  2PEX A;  4U88 A;  3FMS A;  4YG2 F;  1QO0 D;  1XSD A;  2VOO A;  3KP5 A;  4XSZ F;  3WE3 A;  4A12 A;  1K79 A;  4YFK F;  2MD5 A;  5HOO A;  3GFL A;  4HDU A;  5H20 A;  1PP8 F;  2YX7 A;  4AVP A;  3V7C A;  2VN2 A;  3C3W A;  3M1E A;  5E18 F;  1ON1 A;  1S7A A;  4PZJ A;  3V7R A;  2EFN A;  1O3T A;  4HF1 A;  3KE2 A;  1HW5 A;  5DD4 A;  1FZP B;  4LFU A;  5TJJ A;  1S29 A;  4ENN A;  4CYD A;  2DI3 A;  1XMK A;  1C0W A;  1HXD A;  2R7D A;  1Z1D A;  2DTR A;  3FHZ A;  1T98 A;  1O3Q A;  4KFC A;  5HDK A;  2KJC A;  2HWV A;  1BC7 C;  2B0L A;  2JPB A;  3CDH A;  1XSX A;  2VBY A;  1KQ9 A;  1LDJ A;  2M87 A;  1R58 A;  4MQV A;  1KQ8 A;  3DKW A;  3ZPL A;  1SD6 A;  1RUO A;  2VOP A;  2QM3 A;  3F23 A;  4G8X A;  4UNO A;  3IRR A;  1FC3 A;  1YLF A;  3IKT A;  1K7A A;  4HX7 A;  5ICC A;  5TRD A;  2X4H A;  1BI2 A;  2QYO A;  4MGR A;  1TQM A;  1QZY A;  4KIG A;  4UV8 A;  2RNJ A;  2ADU A;  4KN7 X;  4IRH A;  1U5T A;  2OQG A;  1YIO A;  1HST A;  1KYZ A;  4EJT A;  5K5R A;  2MA3 A;  3E6M A;  2V1U A;  3QPH A;  2VOD A;  2EA2 A;  3JW4 A;  4A0Z A;  3F21 A;  4KYW A;  4YIF A;  2PN6 A;  1XCV A;  2FF4 A;  2PG4 A;  2JPC A;  3FXR A;  4LGW A;  3KP6 A;  2E1N A;  2IJL A;  3FF5 A;  4AIJ A;  3L9F A;  2XVC A;  4RAY A;  3TDU C;  3WTW C;  2OA4 A;  3N4M A;  1T2K A;  1EH6 A;  1ZAR A;  4M6Y A;  3H3U A;  1G4D A;  4S04 A;  1P92 A;  1OYW A;  5D5W B;  2P5V A;  1BI0 A;  5IT3 A;  1G3W A;  5FFZ A;  3GLX A;  4LB5 A;  4UUV A;  2FA5 A;  4JQF A;  3RJP A;  3BDD A;  5FD6 A;  4HX8 A;  1XD7 A;  5JFR A;  2STW A;  3WGG A;  2OD5 A;  2EFQ A;  4O6J A;  2Y48 A;  4FX4 A;  3JTG A;  2F5E A;  5CJ9 A;  1B6A A;  2QEN A;  4ENJ A;  2QZ8 A;  2EV0 A;  4H0E A;  1X3U A;  4HA8 A;  2XAG A;  2Q0O A;  3LST A;  3T8T A;  5L3F A;  3WTY C;  4LLG F;  2K4B A;  4EGZ A;  5ILV A;  3ZMV A;  3D5L A;  3V8K A;  4QLC U;  4GXO A;  3I58 A;  5LHG A;  4ASN A;  4A0X A;  2ZJ2 A;  1DUX C;  4HOB A;  3F72 A;  4MNU A;  2ACJ A;  1Z9C A;  1PP7 U;  2P4W A;  1O7L A;  3LAJ A;  1UHW A;  2XGX A;  2H09 A;  4Y15 A;  1XMA A;  4P96 A;  3WTU C;  4G7O F;  1R1T A;  5ILU A;  4RB0 A;  4OOI A;  3WGI A;  1P6R A;  5D6E A;  1YW7 A;  1BI1 A;  2NYX A;  1UFM A;  2VBX A;  5D4R A;  2PMH A;  1BIA A;  3ULQ B;  3P9I A;  2UZK A;  3F8C A;  2PI0 A;  2MLG A;  2E7W A;  4IHS A;  4PCQ A;  2EV5 A;  5LHH A;  4L18 B;  4HAM A;  1KGS A;  1OYY A;  4MTE A;  4XLN F;  5CLS A;  1SD5 A;  1S8N A;  4M72 A;  2L01 A;  3TKY A;  3F8F A;  4F7Z A;  4NQW A;  4OIO F;  5FD5 A;  2Z9O A;  2GWR A;  3ZMD A;  4LLN A;  2EJR A;  3ECO A;  2HKO A;  3HUG A;  3MQ0 A;  3RKY A;  3HTU A;  2GIV A;  4BHB A;  3COA C;  1YTY A;  1QQI A;  3GZ6 A;  5HLH A;  4E70 A;  3WOD F;  5A2Q K;  2PLY A;  3GX4 X;  1ZN2 A;  3TOA A;  3M8F A;  2CQK A;  3F8B A;  3DP7 A;  2IRF G;  1BBY A;  2QQA A;  2K02 A;  5LGN A;  3R4K A;  2M45 A;  5DUK A;  3MZH A;  1FWZ A;  4D0P A;  2O3F A;  4M71 A;  2JZY A;  5IT9 K;  3DEU A;  1HKQ A;  2ZKZ A;  3ML6 A;  1GVJ A;  4A2U A;  2NS0 A;  2O61 A;  2FQ3 A;  4EJV A;  3LA7 A;  2FE3 A;  2P7V B;  2H6B A;  3QPT A;  1U78 A;  4MQ9 F;  3KP3 A;  4N9H A;  4ETS A;  1YQA A;  2OAZ A;  4YII A;  5JHU A;  4LG0 B;  2GXB A;  4GGG A;  4IVN A;  1SD4 A;  3GXO A;  2HZT A;  3M9A A;  4EJW A;  2ESN A;  4G7H F;  4L0Y B;  1J5Y A;  1J75 A;  2MH2 A;  4HYE A;  3JAM Z;  1G3Y A;  5J8F A;  2G9W A;  3L7W A;  2VE9 A;  1TLH B;  1T39 A;  2Z3Y A;  1IN6 A;  1V4R A;  4RS8 A;  1W7P D;  1IW7 F;  4U0W A;  5LGT A;  1H9G A;  3P9C A;  2NNY A;  4YFX F;  3FZV A;  1WWX A;  4HF2 A;  3D0S A;  2LKP A;  3ISP A;  4LK1 F;  3DF8 A;  1TQP A;  2GXG A;  4IJA A;  2YPR A;  1HSJ A;  2A68 F;  2QQ9 A;  2CFX A;  1KU2 A;  3QOP A;  4WF2 A;  3U9G A;  4FHT A;  1S6L A;  2MC3 A;  4EM2 A;  1YFH A;  3TOB A;  1DDN A;  4Q48 A;  2C6Y A;  4HV5 A;  1HBX G;  3K2Z A;  1AOY A;  1ZRD A;  2WTE A;  4EM1 A;  4P9U A;  2WC2 A;  3TO9 A;  3MAJ A;  2YU3 A;  5LRS A;  5K1Y A;  4NHJ A;  1HKS A;  5J8C A;  6PAX A;  2M5W A;  5LRR A;  3KP4 A;  5D5X B;  3GO5 A;  2E7X A;  5DCF A;  5DYM A;  2LSO A;  1I1G A;  3IWZ A;  2CSO A;  3BJO A;  4G6Q A;  4RB1 A;  1CGP A;  1U3E M;  3ELK A;  2UWM A;  1IF1 A;  1TNS A;  4XBF A;  2F5D A;  5EEH A;  1B9N A;  2RDP A;  2FSW A;  1K6O A;  4KNY A;  5D5U B;  5LGU A;  1JHF A;  2A6H F;  2FBH A;  4ENM A;  5ICG A;  3ZN1 A;  5K5Q A;  1STZ A;  1MGT A;  2QQB A;  2EFP A;  4AIH A;  3F6O A;  1IRG A;  5LBQ A;  1Z05 A;  4KMU X;  5HDN A;  1VTN C;  1CF7 B;  4IHT A;  4HDV A;  2EFO A;  4HX4 A;  4A0Y A;  3KET A;  2Y75 A;  3WU1 B;  1F4K A;  3E6B A;  3DXJ F;  2Q2E A;  1IXR C;  3QAH A;  2P7C B;  2O03 A;  4XLP F;  2A61 A;  1SFE A;  1LEB A;  1G3S A;  1KYW A;  4B8X A;  1QBJ A;  2ZCW A;  1ZH5 A;  1J7K A;  1TTY A;  1ZRE A;  2PFB A;  3BWG A;  1J59 A;  2XRN A;  1KU3 A;  3WGH A;  3F6V A;  5L3D A;  2EB7 A;  5FFX A;  2DK5 A;  4LLL A;  3I5U A;  1J0R A;  1IUY A;  5AIP A;  5LHI A;  4LG0 A;  4IF4 A;  1BIB A;  2W57 A;  2EV6 A;  5L3E A;  3VOE A;  1SD7 A;  2XKP A;  3HRS A;  3JTH A;  4LJZ F;  4DNC A;  3IRQ A;  4PGG A;  4XSX F;  1HQC A;  3RKX A;  2D2W A;  2OZ6 A;  2XRO A;  4RB2 C;  3GVA A;  2PBI A;  4L5I A;  4UVB A;  1USS A;  1YW8 A;  2JTV A;  5E1Z B;  3C18 A;  5E8I A;  2QLZ A;  4DQ2 A;  2ZNZ A;  5DCM B;  1FSH A;  1DPU A;  1YS7 A;  3DFG A;  3R60 A;  5D8K B;  5CVV A;  1B9M A;  3L2C A;  5LEK A;  4I0A A;  2CW0 F;  3FWE A;  1XGN A;  3PQK A;  3C7J A;  1FBQ A;  2P6S A;  1F9N A;  1W7P B;  4UHT A;  2FRH A;  1ZGJ A;  1P4W A;  4RAZ A;  4AIK A;  5JI6 A;  4U0Y A;  5BOX A;  3FMQ A;  3K9T A;  4EM0 B;  1OKR A;  3ABU A;  2XAJ A;  2QBY B;  3EUH A;  5F6F A;  4HW0 A;  1WI9 A;  4G94 A;  1KU9 A;  4QWQ A;  2DFI A;  4P5O A;  3DQV C;  2L54 A;  4L9J A;  4M73 A;  4AD9 A;  3O6B B;  4O5V A;  1IN8 A;  3SZP A;  3O3K A;  2AS5 F;  1R1U A;  1R22 A;  1WRJ A;  5BS6 A;  1JE8 A;  5D4S A;  4ZH4 F;  4ESJ A;  1FSE A;  1W4M A;  1H9T A;  2CGP A;  1ZLJ A;  4EGY A;  3OOP A;  2AXL A;  2GQQ A;  1WKM A;  5FGM A;  3ABT A;  4LK0 F;  1OR7 A;  4KMF A;  2G7U A;  3I0T A;  4UVC A;  2YX4 A;  1WSU A;  5AON A;  1RUN A;  4N9I A;  1SFU A;  3SQN A;  1QPM A;  5DEQ A;  3SHF A;  2O0Y A;  5E17 F;  2E1C A;  3E3V A;  1R36 A;  2HTS A;  1NHA A;  3QP5 A;  3KP7 A;  1JXS A;  2HDC A;  5DDG A;  1ZG5 A;  1HKT A;  2H94 A;  1E2X A;  1LB2 A;  3I54 A;  1MZB A;  3TO6 A;  1FP2 A;  1JGS A;  1FYL A;  1G3T A;  3ZMS A;  5HS9 A;  2VXZ A;  1RNL A;  4ZZD A;  1BM9 A;  4MEY F;  2W85 A;  4HQE A;  2QWW A;  1ZRC A;  1PUE E;  2RKH A;  3L09 A;  1E17 A;  5CVI A;  1FY7 A;  3CUQ B;  3J80 Z;  3GFM A;  2G7H A;  5KK1 A;  4KA4 A;  4OIQ F;  2RN7 A;  2A69 F;  4I7H A;  1D3Y A;  1YS6 A;  3VB2 A;  4M9Z A;  3F8N A;  3HRU A;  1OMI A;  2HOE A;  4KDP A;  1Z7U A;  5FLX Z;  5HS7 A;  1LEA A;  1QGP A;  5HLI A;  2IVM A;  3KFW X;  4I09 A;  3G3Z A;  3FX3 A;  2LDU A;  2K4J A;  2PMU A;  2XAS A;  5HLG A;  3PFI A;  3N97 A;  3GFJ A;  1XN7 A;  3VFZ A;  2NAZ A;  4L9N A;  2W25 A;  2X0L A;  1FNN A;  4CIC A;  5CYV A;  5DCM A;  4GYG A;  3HTS B;  3KLO A;  1IN5 A;  1ON2 A;  4UXN A;  4BHC A;  3MCZ A;  4IPA A;  2CO5 A;  2V9V A;  3R61 A;  3R0J A;  4EQQ A;  5L3G A;  1FLI A;  3HOT A;  1MJB A;  5CVR A;  3E97 A;  1W7P A;  1T38 A;  3FXQ A;  3HHH A;  2IA2 A;  2XHK A;  4U7D A;  2IW5 A;  2DK8 A;  3OV8 A;  3U1D A;  4L9T A;  4RGX A;  2WV0 A;  3IC7 A;  3L00 A;  2QBY A;  3ZP5 A;  1FPQ A;  3ZN0 A;  2K7L A;  5LEJ A;  3T5X A;  1ZYR F;  4HF0 A;  3I53 A;  2ZME B;  3AAF A;  5H6R A;  3V7S A;  3I64 A;  4TV7 A;  1O57 A;  2A3S A;  3FMR A;  4KUM A;  1XSV A;  1XGO A;  4GYI A;  1UB9 A;  3ZMZ A;  1TBX A;  3CUQ C;  3BRO A;  3U2R A;  1BJA A;  4EJO A;  4M6X A;  4EMS A;  2FBK A;  2QVO A;  2K27 A;  2F2E A;  5ERI A;  4U0V A;  1MJA A;  1REP C;  1SMY F;  5F64 A;  2GZW A;  4R79 A;  2XAQ A;  3SXY A;  2PJP A;  3VOD A;  2V1X A;  2KJB A;  2FOK A;  1MDM B;  3JAM K;  3RTR A;  3M8E A;  2A5Y B;  4HLY A;  4M9X A;  2HQR A;  5D6F A;  4KN4 X;  2J5P A;  4JBA A;  2KIM A;  3NQO A;  1YO5 C;  1PDN C;  3CUO A;  3HHG A;  1IXC A;  1IZ1 A;  3F3X A;  1TW2 A;  4RGR A;  4M9S A;  1U5T B;  3V8J A;  3LWF A;  1Q1H A;  1UCR A;  5AIQ A;  2FXA A;  2EFW A;  3FXU A;  4LD5 A;  2F5C A;  1WQ2 A;  4HQM A;  4I98 B;  2FMY A;  2ZBK A;  1UST A;  3EET A;  1L3L A;  1FOK A;  2W84 A;  2XIG A;  1XGM A;  2MLK A;  1JHH A;  1IRF A;  1MJ9 A;  5ED4 A;  2Y0M A;  3DPT A;  2QUF A;  2FU4 A;  4CZZ A;  3EYI A;  1TQI A;  3WTZ A;  4R1H A;  1FBU A;  1O7F A;  2DU9 A;  3RYP A;  2ISY A;  2J5O A;  4FT8 A;  2ETH A;  2FML A;  2IA1 A;  3E6D A;  5ICE A;  3IL2 A;  4WWC A;  2HQN A;  2OZU A;  3E5X A;  1F1Z A;  4BNC A;  3J81 K;  3KP2 A;  5E1W A;  1P4A A;  1Y0U A;  3FM3 A;  3T1B A;  1ONV A;  1LDD A;  2P5K A;  3IKV A;  1XGS A;  4WXH A;  1ZHF A;  1R23 A;  2RV8 A;  1L0O C;  2V79 A;  3T0Y A;  2M1B A;  3E5U A;  4MTD A;  5CVU A;  1J2X A;  2M8E A;  2XKO A;  2K86 A;  3MEX A;  3ECH A;  4ESF A;  5K5O A;  3ZQ7 A;  2CG4 A;  1P4X A;  2RC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...