3F6VA

Crystal structure of possible transcriptional regulator for arsenical resistance
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
96
structure length
96
Chain Sequence
VLDQLEVAAEPTRRRLVQLLTSGEQTVNNLAAHFPASRSAISQHLRVLTEAGLVTPRKDGRFRYYRLDPQGLAQLRALFDSFWIDELDRLVADATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Possible transcriptional regulator for arsenical resistance from Rhodococcus sp.
rcsb
source organism Rhodococcus sp. rha1
molecule tags Transcription regulator
molecule keywords Possible transcriptional regulator, ArsR family protein
total genus 32
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f6vA00
4L9NA 4KFCA 3F8FA 1KU2A 4I2OA 1PP7U 1JXSA 2CQKA 5ED4A 1ZG1A 3BJOA 1O7LA 2EJRA 2STWA 2HFHA 1CF7A 4FT8A 1ZGAA 4B09A 3ERED 4U0WA 1ZG3A 1ODDA 4AIJA 5L3BA 5A2QZ 3P7NA 3K1PA 5FLXZ 1HKSA 1OYIA 2ESHA 1S3JA 3BDDA 4MQ9F 1U5TB 5H20A 1OKRA 5FD6A 5J8FA 2O3FA 2FNAA 1XCVA 5DD4A 1NHAA 3IWFA 1FP2A 5CVJA 1UHMA 1BN5A 1ZREA 3PFIA 1F5TA 1Z6RA 3IKVA 4KN7X 5L3CA 1ZRDA 5JFRA 4I98B 4UNOA 2QENA 5E1WA 3PQJA 2H94A 1O3TA 1K79A 3GEZA 2D45A 1OYYA 2ETHA 3OOPA 4FX4A 5FB2A 1KU9A 4AD9A 3VEPA 2O0YA 2L54A 4S04A 4KYWA 3KFWX 2JTVA 5J6XA 4CGZA 4RS8A 1XGNA 1A04A 3KP3A 1KA8A 4KMFA 2BYVE 3R0AA 2XKPA 1IRFA 1D8KA 4O6JA 5H6QA 2RVCA 3Q5FA 4P96A 5K5QA 3E97A 1K7AA 3HRTA 3H92A 2ZNYA 1XDSA 3HUGA 5HOOA 1HKTA 5HDGA 4ENMA 3WODF 5LGTA 3VFZA 4RB2C 2D1VA 1YG2A 5L3DA 4IHSA 4LG0A 3T8RA 4IRIA 3N4MA 2K27A 3ZN0A 2HEOA 3HTUA 2V1DA 3KP7A 3Q9VA 5LHHA 2PLYA 3EQLF 4EM0B 4ETSA 1I1GA 2HKOA 4WXHA 2MH9A 1WQ2A 5D5UB 1LDDA 2IJLA 5CVVA 1F4KA 5ILSA 3TGNA 1BC7C 2A07F 4OINF 1FYLA 2XHKA 2E7WA 5LGNA 2YX4A 3JTHA 3LFKA 1HKQA 3FXRA 2VBXA 1T38A 3TO6A 1X3UA 2MA3A 4OIOF 1ZARA 5HLIA 1MJ9A 3B02A 1TQPA 1BM9A 4YFXF 1U2WA 4XBFA 4RGSA 1QO0D 1B1BA 2EK5A 4IVNA 5HDKA 2DO7A 3DQVC 3I59B 3K9TA 3V7RA 4NHJA 4M6YA 4HX4A 2QUFA 3T1BA 2Z3YA 2ZMEA 2DU9A 2L02A 2P7CB 3C7JA 4IHTA 1P92A 3LSTA 1FX7A 3REOA 5K5RA 2VC1A 3KEOA 2VBZA 3VB2A 3BJ6A 2DAOA 4UV9A 4EQQA 1GXQA 3NEUA 2FF4A 1FWZA 3H3ZA 1SMTA 1WWXA 3WG9A 1XCBA 1WI9A 5J8CA 2ISZA 2M45A 5KK1A 3WE3A 2RGVA 5HLGA 5A2QK 1R22A 3O2PE 2QLZA 1OPCA 1J59A 2RQPA 2UXXA 3R61A 1D5VA 1YQAA 4G9YA 2FOKA 4WF2A 3T5XA 1XSDA 4ENJA 1EH6A 3RYRA 2JRTA 1FY7A 2PMUA 3L09A 2OU2A 2DPDA 1K78A 2K7LA 1O3SA 2DTRA 2Z33A 4L0YB 1SD5A 2PI0A 2Q2EA 1IN6A 5HLHA 2BV6A 3Q9SA 5D4RA 3I59A 3I0TA 4I7HA 2ZMEB 3FX3A 4A6EA 3D0SA 2Z99A 4NB5A 4OIQF 4KUMA 3ZMDA 1FBUA 1BI3A 2RV8A 4RGXA 2BBYA 5CYVA 5LHIA 4ESJA 2GIVA 2FMYA 2X4HA 4EJVA 1MZBA 3FF5A 2HWVA 2IA1A 5TJJA 4A0YA 2WV0A 1SMYF 1P4XA 3KE2A 2GZWA 2M8EA 3ELKA 4Y15A 3E5QA 3L00A 4U7DA 4ZYHA 3QPTA 4EV0A 2QBYB 1R58A 3U1DA 1MD0A 5D5WB 1U8RA 3WTUC 1P4AA 4RAYA 2HKXA 1SD4A 4D0PA 1RIOH 1KU7A 3ZMVA 2KKOA 1STZA 3GFMA 2NNNA 2GWRA 3L7WA 3RDIA 2HYFA 2YX7A 1G3TA 4HLXA 2A5YB 1LDKB 5KVRA 3GXOA 2KRFA 4MTEA 2OZ6A 4LGWA 1XD7A 2HZTA 1PP8F 3LA7A 4CZZA 4R8HA 4WXCA 5ICCA 4HA8A 4KDPA 2O03A 3CUQA 1P2FA 1XSXA 2XKOA 4HX8A 2W57A 1T6SA 3HRMA 3F8MA 4YFNF 1YW7A 1IAWA 3QOPA 3I4PA 3K0LA 2A61A 4OU0A 5D5XB 3JSOA 3TQNA 3LQRA 5HVQC 1BBYA 4HZFA 1J2XA 2K86A 1KYZA 3P9CA 4KNYA 4BAYA 3MCZA 3BY6A 3FZVA 2OAZA 3V8LA 3DF8A 2A6HF 1WSUA 3NRVA 4M71A 1ZRCA 1IRGA 2PJPA 2EA4A 4LLGF 2PFBA 5BOXA 1YW8A 4WCGA 2UWMA 4ZYDA 4XLNF 2QWWA 5D8KB 1XB4A 3MZHA 2XUBA 1W5SA 3I53A 5K5OA 3MQ0A 1BJAA 3KZYA 2GQQA 2VE9A 4GYGA 2PBIA 1MKMA 3EETA 1J75A 5F6FA 1KYWA 5AONA 1D3YA 3E6MA 1T0FA 5BPIA 4K2EA 1ZH5A 2EV6A 4M9SA 2Y75A 3I5UA 2EV5A 2ZBKA 3KP5A 4Z2YA 2OBPA 1K78B 3G3ZA 4XSXF 5LBQA 3F72A 2XGXA 2VOPA 3GZ5A 1K6OA 6PAXA 2RN7A 5D6EA 4MGRA 4L18B 5LRRA 2LF8A 1IXRC 4ZYGA 3TO9A 3CDHA 1EV7A 1ZYRF 3IKTA 2ELHA 2G9WA 2W25A 5DCMA 2EFWA 2O61A 2FBIA 3GO5A 2P8TA 3FM3A 4LD5A 4A12A 1MGTA 1CF7B 3QU6A 3CLOA 1R1TA 1DDNA 4BHBA 4JQFA 2EFNA 1USTA 1ZLJA 2KJCA 2XAJA 1G3WA 5FFXA 4HV5A 2OQRA 2VN2A 4LLLA 5ILUA 3JAMZ 3FXQA 1YLFA 1SFXA 1XGMA 3P9IA 1ULYA 4Q48A 5LHGA 1AWCA 2H6BA 5JVTA 2P6TA 4I09A 1UCRA 3CO6C 4HW0A 2LDUA 4XSZF 1TTYA 5E20A 4EGYA 1QZZA 3RIRA 1QNTA 2EA2A 3P9KA 1IN8A 1MJBA 3AAFA 3JAMK 3R4KA 4N0BA 2D1HA 4UHTA 4BXUA 1TLHB 4ESFA 3JTGA 4IJAA 3BJAA 1U5TA 5CVRA 2FXAA 5D6FA 2HDCA 2KIUA 2OD5A 3E6CC 2HGCA 1U78A 3E3VA 5HS7A 3EYIA 4ENNA 2WTEA 4G94A 3B73A 4HV6A 2H6CA 1L3LA 2PEXA 2QZ8A 1W7PB 2IRFG 4KIFA 2JSCA 2MBFA 1XN7A 5E18F 5E1ZB 2EV0A 3LA2A 4WX9A 4YFKF 2NRAC 5H6RA 1O57A 4BHPA 2QYOA 3FMSA 1PUEE 2CFXA 2ESNA 4I0BA 1U6GA 1B9MA 5LEJA 2P5KA 2Q0OA 4A0XA 1J0RA 4MEXF 3ZMSA 3M9AA 4ZH4F 1EH8A 2VOOA 1Z1DA 1T98A 3KCCA 2Z9OA 5HS8A 2H09A 1Z05A 1BIAA 3T0YA 2VT2A 1BC8C 4HQEA 1OR7A 2M30A 1ZN2A 3N97A 1J7KA 3RPUA 2NS0A 1S6LA 2V6CA 1FLIA 4RGUA 4U0YA 2HOEA 4AIKA 3V8JA 4I02A 2WC2A 3RYPA 3IHUA 1IXCA 1TW3A 1WKMA 2DT5A 4GXOA 2XAFA 1FT9A 3SZPA 4M6XA 5CVIA 1OYWA 4R79A 1B4AA 3ABTA 5FGMA 2H27A 1XDUA 3TO7A 3J80Z 3F22A 2EWNA 2XROA 3HSFA 2G7HA 3WGGA 4HQMA 2GAUA 5DCMB 5FO5A 2MD5A 1KQ8A 2L01A 1DP7P 3M8FA 2K02A 5AIQA 1YTYA 4GO1A 3DPTA 3V7SA 4EJOA 3F8NA 3T8TA 1IF1A 3FMRA 1XSVA 5E8IA 2YSRA 5FFZA 2F5EA 4BYYA 4CXFA 2O8XA 3V4GA 4N9IA 4R1HA 1R00A 2LNBA 3ABUA 3IRRA 4UUVA 4G7ZF 3LAJA 3OV8A 1TBXA 2W85A 3HSRA 3QRFF 1IN7A 2OZUA 2Y0MA 2PN6A 3FWEA 3ECHA 3HHGA 3J81Z 3KEQA 3HRSA 5CJ9A 1LDJA 1ZHFA 1KQ0A 3BZ6A 2XVCA 3FXUA 4HX7A 2E1CA 2L4MA 1TNSA 3EUHA 3SQNA 4HF1A 1SD6A 2QBYA 2XAGA 3ZMTA 4HAMA 3DP7A 2BE5F 4Y13A 2FU4A 2E7XA 1SFUA 1KGSA 4LK0F 3J81K 2E1NA 3R60A 4LFUA 2F5FA 1H9TA 2VC0A 4KICA 4EJUA 2NYXA 1VTNC 3GF2A 2Q8KA 4LMYA 3QAHA 3PQKA 1HSTA 2CWEA 2DQRA 3E5XA 4I01A 4KIBA 1FZPB 3HOSA 3RJPA 1HW2A 5TRDA 2Y48A 1W5TA 5F64A 5ICFA 5IT9Z 5DD8A 3VODA 1XGSA 2XV4S 1HSJA 3JSPA 1R5GA 4UVBA 5LGUA 1QPMA 1HBXG 5DYMA 3QPHA 2HYGD 2COMA 4EJWA 2LSOA 1S7OA 2K4JA 4O5VA 4G6DA 3F23A 1FBSA 3I64A 1BIBA 1R1VA 2F2EA 4LG0B 3ZMUA 2O6GE 2GA1A 1RNLA 2A3SA 2R7DA 1YS7A 4OMYA 2HTJA 1D8JA 1SD7A 2JZYA 3E6DA 2CG4A 4A2UA 2V1XA 4L5JA 2R7FA 1L0OC 3GWZA 2AS5F 2GXGA 2DQLA 1KU3A 3WU0A 1W7PD 3ML6A 3M8EA 5CLSA 1TW2A 2CYYA 1T39A 5LEKA 4TV7A 4MTDA 1TNTA 5IT9K 1IZ1A 4IRGA 2LKPA 2HQRA 1ZLKA 1TQMA 2IA0A 2DW4A 4MHGA 2ZJ2A 3IL2A 2UXNA 2ZNZA 1FNNA 2X0LA 3MEXA 4L9TA 3HSEA 5JI6A 2VBWA 4U88A 2VE8A 4YIFA 3QU3A 5DEQA 3W6JB 4G7HF 2L4AA 3IWZA 2AXLA 2OA4A 2R3SA 2FRHA 4G7OF 2ACJA 2ZXJA 4HBLA 1BI2A 4WWCA 1GHCA 2B0LA 5DV5A 1PDNC 2GA2A 2P5LC 2C6YA 2BGCA 4E70A 2ADUA 4JBAA 4HDUA 2A69F 2KIFA 3ISPA 2DBBA 3DFGA 5DCFA 3EDPA 2XIGA 5D4SA 1WRJA 2DK5A 4M9ZA 3F3XA 4ENKA 1UHWA 1SFEA 2JPBA 2MLKA 4L9JA 2IP2A 4XLPF 3V7CA 3E5UA 4P9FA 3BPVA 4WK8F 2ZO4A 3W6KB 4BQAA 1G3SA 3IC7A 4CHUA 1XMKA 4CYDA 4UXNA 1HQCA 5BQTA 1IW7F 2MH2A 5EEGA 1C0WA 1ZGJA 4IF4A 1F1ZA 2TDXA 4LLNA 1LNWA 4EGZA 3GLXA 1R23A 2JPCA 1R5HA 5BMZA 1E2XA 1BI0A 2W84A 1S7AA 5DDGA 4LJZF 1GVJA 5ILVA 1FPQA 3K2ZA 4ON0A 4Q47A 2F5CA 3BWGA 2P5VA 4RB1A 3L9FA 2JT1A 2F5DA 4CO8A 1GXPA 3F21A 3WGIA 1BOAA 1V4RA 2V1UA 4IRHA 4BHCA 4HF0A 2FNPA 3SFZA 1SAXA 2CGPA 5JR3A 1UFMA 2P7VB 4Q5SF 4S05A 3M7GA 1LEBA 3WTSC 2FBHA 1U5TC 3KLNA 5HS9A 2DFIA 1B9NA 2K4BA 2WWYA 1RUOA 2IT0A 1IXSB 3HHHA 3MFKA 2VODA 3RI4A 1G6NA 4P55A 2KJBA 2QQ9A 2KIMA 2HS5A 4Y17A 3U2RA 1ZRFA 3HYIA 5D5VB 3H3UA 3TKYA 2MLGA 4AVPA 1O3RA 4CDGA 4NQWA 1USSA 3SHFA 4LB5A 1Q1HA 4LB6B 4RAZA 1F9NA 2BEOA 3ZQ7A 4JK1X 4RGRA 1XMAA 3KZZA 1R1UA 3DKWA 2VXZA 1DUXC 2VONA 3WTXC 1E17A 2YU3A 1DPUA 3GZ6A 5BS6A 1P6RA 3F6OA 4FX0A 2FQ3A 3J7AO 3L2CA 3VOEA 2DPUA 2G7UA 2PG4A 5FD5A 3TDUC 1DPRA 1JGSA 1AOYA 1BI1A 1J9IA 3ECOA 5BPDA 3RKYA 3EYYA 3KP2A 3GX4X 3I54A 2D2WA 4OOIA 3GFIA 4A0ZA 4BNCA 4MEYF 1B59A 3CUQB 3R6SA 3GFJA 4M74A 2NAZA 1XGOA 4ASNA 3WTVC 1QZYA 1RZ4A 4L9VA 1IN4A 2V9VA 2QQBA 2FEZA 2CW0F 4OIRF 2DK8A 1Z91A 1CGPA 4UVCA 4DQ2A 4G8XA 4M72A 1LB2A 3F8CA 3MWMA 3HOTA 2VBYA 5L3EA 3SZTA 1LEAA 3KP4A 1JHHA 3LAPA 1KQ9A 3MAJA 3F8BA 4M73A 1I27A 2PQ8A 1QQIA 1W4MA 3GW2A 2RNJA 1FSHA 3CUOA 1P4WA 4HOBA 3V8KA 5AIPA 4KMUX 2W24A 1LJ9A 2ZFWA 2IW5A 2XAQA 1HW1A 5DUIA 4IXAA 1IN5A 1I6XA 2V79A 1UB9A 1V3FA 1REPC 1TQIA 1OMIA 1JE8A 5HDNA 4EJTA 4A5MA 4MQVA 3GVAA 2IA2A 3SXYA 2OQGA 1YS6A 3DV8A 2Z5UA 4EM2A 3RPQA 1S8NA 1YW9A 1H0MA 2UZKA 2IVMA 3RTRA 3BP8A 1ZG5A 4BH9A 1ZAOA 3WTTC 1FYMA 3CUQC 4A5NA 4P5OA 3R0JA 2NNYA 1FOKA 3C18A 1I1SA 4AIHA 4ZZDA 2EFQA 2ZKZA 2STTA 3TDZC 3GFLA 3QP5A 3BROA 3QP6A 1QBJA 1LVAA 4DNCA 2M5WA 5ERIA 4L0ZB 3FHZA 1ON1A 1T2KA 4GYIA 1O7FA 1Z7UA 1J5YA 4PDKA 4L5IA 4CICA 1MJAA 1O3QA 4HYEA 3K1NA 1ONVA 4MNUA 4QWQA 1ON2A 2GXBA 2XASA 2IPQX 3CJNA 4U0VA 4RB0A 4RB3C 3K1MA 3RKXA 3I71A 3M1EA 5D8LB 5E8GA 4HLYA 3E6BA 5K1YA 2A68F 2DI3A 3J80K 2J5OA 2M1BA 4OMZA 2DLLA 4PGGA 2HR3A 3WTYC 1W7PA 3WGHA 3WTWC 3ZP5A 4O3MA 3HIFA 2FMLA 3DEUA 3HRUA 1Z6TA 3BOQA 4KN4X 3BPXA 4PCQA 1HXDA 4ZZLA 2FE3A 1MDMA 5E17F 2L3DA 4FHTA 2LF7A 3LA3A 1YYVA 1IUYA 1FC3A 3IRQA 1JHFA 4KT5C 3JW4A 1FBQA 5F1RA 5IT3A 4B8XA 5ICGA 1LQ1A 3NQOA 4EVIA 2QQAA 2XAHA 2VT3A 4PZJA 2P4WA 3DXJF 3ROUA 1S29A 3HTSB 3COAC 4KA4A 3I58A 4WXDA 3ULQB 4IPAA 1Z9CA 2M87A 4Q4ZF 2QM3A 3KP6A 3O3KA 4ESBA 4A6DA 2MC3A 1HW5A 4QLCU 2CSOA 3F6VA 4GCVA 2ZCWA 3WE2A 4UVAA 1I5ZA 1R7JA 2ISYA 4EMSA 4LK1F 2EFPA 3KLOA 3GUDA 4M9XA 5L3GA 2EB7A 3ZMZA 3U9GA 1YIOA 1FSEA 3G73A 3MZYA 5EEHA 1QGPA 1YFHA 2EFOA 5E1XA 1Y0UA 2PMHA 4PGHA 3RKWA 2RDPA 3LQQA 1FYKA 1RUNA 4F7ZA 3C1DA 3ZPLA 3DPLC 2XRNA 4G6QA 2RC4A 1G4DA 2QVOA 5CVUA 2FBKA 1R36A 5JHUA 4KIGA 1G3YA 3C3WA 3FMQA 2J5PA 2FA5A 3CO7C 3TOAA 2CO5A 2FSWA 3WTZA 3KETA 1U3EM 4AWXB 4ZYEA 4YG2F 4YIIA 2A6EF 2HTSA 3D5LA 1RI7A 2YPRA 5LLQA 4GGGA 5LRSA 3O6BB 4N9HA 3K69A 4I0AA 1H9GA 1B6AA 3TOBA 4P9UA 4H0EA 4HF2A 3LWFA 3GYHX 3S2WA 4U7BA 3WU1B 4OIPF 5L3FA 4EM1A 1FP1D 2RKHA 5DUKA 1MDMB 4HDVA 5FLXK 5ICEA 1YO5C 3CTAA 3FM5A 4XRFA 4UV8A 2P6SA 2HQNA 3ZN1A 1EH7A 2YR2A
chains in the Genus database with same CATH superfamily
4L9NA 4KFCA 4HG2A 3F8FA 2I5UA 1KU2A 4I2OA 2MSYA 3BR5A 1PP7U 4Z6YA 2QF7A 1JXSA 4XLFA 5CQGA 2CQKA 5ED4A 4PUSA 2VLAA 1ZG1A 3DBHB 3BJOA 2V7FA 1O7LA 3FHNA 4IZZA 2EJRA 2JWTA 1RETA 4A3KJ 2STWA 2HFHA 3FKJA 4FT8A 1CF7A 1ZGAA 4B09A 3ERED 3LSJA 4BL0B 2BW3B 4BE2A 2NS7A 4U0WA 1ZG3A 2JRMA 1ODDA 4XKBA 5L3BA 4AIJA 4KISA 3HKZN 5A2QZ 2OUMA 3P7NA 3S14J 3K1PA 4BJ5C 5FLXZ 2EQRA 4QSHA 4II3A 1HKSA 1OYIA 2ESHA 5HNHA 1S3JA 1UHSA 3BDDA 4MQ9F 5BNGA 2R5YA 1U5TB 2NVQJ 5H20A 4ZDLA 1OKRA 5FD6A 1B72A 3ZQCA 1X3ZB 3U1KA 5J8FA 2O3FA 2FNAA 1XCVA 5DD4A 5E79C 3S15J 1NHAA 1N75A 1FP2A 2E1MC 3IWFA 5CVJA 1UHMA 3CCEI 2NOGA 1BN5A 1ZREA 3PFIA 1A31A 3DTIA 2IAIA 2IBDA 2F4IA 4HSTA 1F5TA 1Z6RA 3IKVA 4KN7X 3ASNH 4DJAA 5L3CA 1I3AA 1ZRDA 5JFRA 4I98B 4UNOA 2QENA 2R7UA 2E2IJ 5E1WA 3PQJA 2H94A 1O3TA 3S16J 3DLLF 1T56A 4IHYA 3BZCA 1K79A 3VWBA 3GEZA 2ZJPF 2K40A 2D45A 1OYYA 2ETHA 3OOPA 4FX4A 5FB2A 1KU9A 5K7ZA 4AD9A 3K4JA 3VEPA 2O0YA 2WY8Q 1POGA 4GFBA 1R4MB 2L54A 1UG2A 4S04A 4KYWA 2V9PA 3KFWX 1SANA 2JTVA 4XM3A 5J6XA 1BR4A 3SZGA 4CGZA 2F5VA 2WB1A 4RS8A 1HLVA 2Z16A 1XGNA 4IX7A 1MBJA 3MMYB 3ZR8X 2DN0A 3S1RJ 2VUMJ 1JUSA 1A04A 3KP3A 1TP4A 1KA8A 4DYCA 2Y69H 4KMFA 2B63J 4RLQA 2XF6A 4KITB 2BYVE 3R0AA 4EEFG 1NH3A 2IEKA 3KIOA 2XKPA 1IRFA 1D8KA 2DA1A 2KRCA 4BACA 3OIQA 4O6JA 5J4VA 1EJ9A 5H6QA 2RVCA 2DJIA 3IH2A 3Q5FA 4P96A 1D0YA 5K5QA 2BOLA 3E97A 1K7AA 2E2HJ 3CCYA 3HRTA 3H92A 2ZNYA 1XDSA 3HUGA 4C3JJ 5HOOA 4AC0A 1BL0A 1W0TA 1HKTA 1YOVB 4OWRB 5HDGA 3WODF 4ENMA 5LGTA 3VFZA 4RB2C 2R5YB 1GV2A 2QSFX 2R7WA 2D1VA 1YG2A 5L3DA 4IHSA 2UV1A 4LG0A 1QZEA 1XG1A 1B72B 3T8RA 4IRIA 4XMYA 4BU2A 3N4MA 1MBFA 2K27A 1MNDA 4C2UA 3ZN0A 2HEOA 2CUEA 3HTUA 2V1DA 2LP0A 4L5EA 1JTYA 3KP7A 3Q9VA 3D5RC 2KP6A 5LHHA 4FE4A 2PLYA 3EQLF 4EM0B 2EZLA 4ETSA 1I1GA 3B6AA 2HKOA 4WXHA 5IP7J 2MH9A 5J1UA 5LD2C 1WQ2A 5D5UB 4IHVA 1LDDA 2IJLA 2R7OA 2Y30A 4PJ0C 2ZXWH 2CUFA 5CVVA 1TWFJ 1MMGA 3CCLI 2CH0A 4E7JA 1F4KA 1HA8A 1EKEA 5ILSA 3TGNA 2E2JJ 1BC7C 2A07F 3QOEA 4OINF 4BXFA 4ZJZA 1YX3A 1ETYA 2LG4A 1FYLA 2XHKA 2E7WA 2ME6A 5LGNA 2YX4A 3JTHA 2JVGA 4V2FA 3OYHA 2LBFB 4CCNA 3FDYA 3BLYA 3LFKA 1HKQA 2VPLA 1Z7LA 3PUFA 3DEEA 3X2QH 3DKYA 1DQUA 3FXRA 1DU0A 1NG6A 2VBXA 2DJNA 1VQLI 1T38A 3TO6A 1VQ8I 4GDFA 1X3UA 2R93J 1MBHA 3K7AJ 1IV8A 1R4NB 2CUJA 2MA3A 2ZXIA 4OIOF 4E4HA 3CF2A 1Z0XA 1Y39A 1ZARA 5HLIA 1MJ9A 1WGXA 1TQPA 3B02A 3Q3SA 2LY9A 1BM9A 2BXYA 4YFXF 1U2WA 4XBFA 1KZHA 2E34A 3L2QA 2K9MA 3DU6A 2JSPA 1X4OA 4RGSA 1QO0D 1B1BA 2EK5A 3BR6A 4IVNA 5HDKA 1OCRH 1XC5A 3CMEI 4OAYA 3HUGB 2DO7A 3DQVC 3I59B 3K9TA 3V7RA 4FASD 4NHJA 5FLMJ 4M6YA 4HX4A 5KCMA 5JLWA 2QUFA 5KNLA 3C2GA 3T1BA 2Z3YA 2ZMEA 2ZJRF 4IEJA 2DU9A 2L02A 2VKHA 4UB8C 2P7CB 2CU7A 3C7JA 1W36C 1WJBA 4IHTA 2EIKH 1ORKA 4CH7A 1P92A 3LSTA 1FX7A 3REOA 3W2AA 3OWTA 2XSJC 5K5RA 2VC1A 3OYBA 2E71A 3KEOA 4IOAF 2VBZA 4NC8A 4XL9A 3VB2A 3BJ6A 2DAOA 3RQIA 3ABMH 4LITA 4UV9A 4CCMA 5FLVA 4EQQA 3CMYA 2ZB9A 1A6IA 1GXQA 2WAFA 2HDDA 3NEUA 4B1RA 4RM2A 3SDBA 2FF4A 3CJQB 4RLFA 1FWZA 3H3ZA 4ANJA 2XDVA 3S2DJ 1SMTA 4N4OB 1WWXA 3WG9A 1XCBA 1WI9A 5J8CA 2ISZA 2M45A 4E7ZA 5KK1A 3WE3A 4Y7NJ 3PSFA 4A3JJ 2RGVA 2ZSHB 3TP3A 1I3QJ 2DA5A 1JKOC 5HLGA 1DGWY 5A2QK 1QRYA 1R22A 2HU9A 2IGKA 1IC8A 2Y2ZA 3O2PE 2K5CA 2QLZA 1HCRA 1OPCA 1J59A 2VKEA 2RQPA 2UXXA 3I9V2 3R61A 5HODA 1D5VA 3HOWJ 1YQAA 4BBRJ 4G9YA 3OYEA 2FOKA 4WF2A 5IYDJ 3T5XA 1XSDA 4H4KC 2KFDA 3DWLE 1EH6A 3RYRA 4ENJA 3HEFA 2JRTA 1FOWA 1FY7A 2PMUA 1Y8RB 3L09A 4A3LJ 2OU2A 1MIJA 1ETVA 1GLNA 2VPRA 2DPDA 2O9LA 1K78A 2K7LA 1O3SA 2DTRA 2Z33A 4L0YB 4XORA 1SD5A 2PI0A 2EILH 5DM7F 2Q2EA 3LSHA 1X3WB 2DT6A 1IN6A 2O8KA 5HLHA 9ANTA 2BV6A 2A6TA 3GLLA 4MIMA 3Q9SA 3S1MJ 3PUBA 3K4NA 5D4RA 1GUUA 2V1NA 2EH3A 3I59A 3I0TA 2K9SA 3JRFA 4I7HA 1X2MA 3LNQA 3K70D 4E6KG 3PNVA 1MBGA 2ZMEB 3FX3A 4A6EA 2HPMA 2P0WA 3PFYA 2VQLA 3CCUI 3D0SA 2Z99A 4AM3A 2V26A 2ZC2A 3KZIC 4NB5A 1QVUA 4CA0A 1OQYA 4B48A 4OIQF 4KUMA 3ZMDA 4DYRA 1FBUA 1BI3A 2RV8A 4RGXA 3HOZJ 2VASA 5E3NA 1V55H 1JKQC 2BBYA 3RSNA 2MW8A 5CYVA 5LHIA 4ESJA 2GIVA 3UR3C 3Q0UA 2FMYA 2X4HA 4EJVA 1MZBA 3FF5A 2HWVA 2IA1A 5TJJA 4E7HA 3A1YA 1YRNA 3L2RA 4FE7A 4XOPA 3OL4A 4BDZA 2W7NA 3TMOA 4A0YA 2WV0A 1SMYF 1FMWA 1N78A 1P4XA 3KE2A 1S5LC 2GZWA 1MSEC 2ECCA 2QQ8A 2M8EA 4B4CA 3ELKA 3E0JB 4Y15A 3E5QA 3L00A 4U7DA 2R7TA 4ZYHA 3QPTA 5H2FC 3ABLH 1IRXA 4EV0A 2H1KA 2QBYB 1R58A 1Y0NA 3U1DA 4DGWB 1MD0A 4DZJA 1T8IA 1WJDA 5D5WB 3VYRB 1VFCA 3WTUC 1U8RA 3OYLA 1P4AA 2MFZA 4RAYA 3G6EI 2HKXA 1SD4A 2MD0A 4D0PA 1RIOH 1KU7A 3ZMVA 4XR6A 5DTDA 2KKOA 1STZA 3GFMA 2ID3A 1VQ9I 2NNNA 2GWRA 1JTXA 3L7WA 3RDIA 2HYFA 2YX7A 2PX9A 1G3TA 4HLXA 2A5YB 2WADA 1LDKB 3RCOA 2X6YA 3A01A 5KVRA 2P81A 4D7MA 1WJFA 3GXOA 2KRFA 5E3LA 1DGRM 2H8RA 4MTEA 2OZ6A 2K85A 1XD7A 4LGWA 4D9JA 2HZTA 4CCLA 1PP8F 3LA7A 2HZDA 4DBRA 4CZZA 4R8HA 4WXCA 5ICCA 3KYDB 3M4OJ 4HA8A 2D5VA 4B47A 4KDPA 1ACIA 3ESWB 2O03A 3CUQA 1P2FA 1XSXA 2XKOA 4CYCB 4HX8A 2XSDC 1G8XA 2O5RA 3I4NJ 4BJTA 2W57A 1VQ6I 1T6SA 3HRMA 2IXSA 3F8MA 4YFNF 1YW7A 1IAWA 3RKQA 3QOPA 3I4PA 4QTRA 2VJ4A 1W5CC 1BR2A 3K0LA 2A61A 2WV1A 1H88C 2X1EA 3WHBA 2IGMA 4JP0A 4E7LA 4OU0A 5D5XB 3JSOA 4BXXJ 3TQNA 3LQRA 2DMNA 1BBYA 3K6GA 4M6VA 4P1WA 5HVQC 4ITVA 4HZFA 1RESA 4IHXA 3JRAA 1J2XA 2K86A 1KYZA 2XB0X 3RZOJ 2WA0A 4UUSB 4AIDA 2HQ5A 4JYKA 5GTHC 3P9CA 1T0FC 2Z2SB 4KNYA 4BAYA 2H1LA 1BR1A 3S32A 2TCTA 3MCZA 3BY6A 3FZVA 2OAZA 4XK4A 2VQHA 3V8LA 3DF8A 2A6HF 1TT0A 1WSUA 3NRVA 4RMNA 4BEHB 4YIRX 4M71A 1YHQI 1ZRCA 1K4TA 3V42A 1IRGA 1IDYA 1YJ9I 2PJPA 4MLOA 3SEZA 1UELB 5GAGJ 3OS2A 1PUFB 2EA4A 1RR7A 4LLGF 2PFBA 4I99C 1OFCX 3CDIA 2R5ZA 2A05A 5BOXA 1YW8A 1YI2I 4WCGA 2UWMA 4IHWA 4ZYDA 4XLNF 1TWAJ 2QWWA 5D8KB 1AHDP 3E1SA 1XB4A 3MZHA 2XUBA 1S72I 1W5SA 3I53A 4D5FA 2L9NA 3MQ0A 2WAQN 5K5OA 2XB5A 1MH4A 3OYCA 1BJAA 3KZYA 2GQQA 3H5RA 4RAGA 5FRMA 2VE9A 4GYGA 2KQRA 2PBIA 1MKMA 3TEDA 3EETA 1J75A 5F6FA 1ENHA 1DP3A 1KYWA 5AONA 2BVMA 1D3YA 3BZKA 3OYGA 4M3BA 1FIPA 3OYKA 3G2BA 4W97A 3E6MA 1T0FA 1OCTC 5BPIA 4K2EA 1ZH5A 2EV6A 2KHMA 2X1DA 4UUTA 4M9SA 2Y75A 4I6ZA 3I5UA 1APLC 1JUPA 1O4XA 2EV5A 2ZBKA 3FK7A 3D1NI 1IJWC 4BS9A 5IY5H 3KP5A 4Z2YA 2DOFA 3H36A 1ZKGA 2OBPA 1K78B 2QSGX 3NARA 3G3ZA 4XSXF 3GZNB 2XGCA 5LBQA 3F72A 2JMWA 2CUZA 2HYJA 2XGXA 2VOPA 3GZ5A 5FROA 1K6OA 2M34A 3BR3A 6PAXA 4QPOA 2RN7A 5D6EA 4MGRA 4L18B 5LRRA 3S17J 2BHYA 2LF8A 1IXRC 4UUSA 4UB6C 3P5JA 5J3LA 4ZYGA 3TO9A 3CDHA 1NTCA 2MC4A 1EV7A 1ZYRF 1A5JA 3IKTA 2ELHA 2G9WA 2W25A 3OIOA 5DCMA 2EFWA 2O61A 4GRIA 2FBIA 3GO5A 3H0DA 2P8TA 3FM3A 3HJEA 1JKPC 4BEHA 4LD5A 2AHQA 3PIOF 1MGTA 4A12A 1AKHA 1NK2P 5EDNA 2R7QA 3QU6A 1CF7B 2CQQA 2ICWG 2LK2A 3CLOA 4AU7A 1R1TA 1DDNA 4BHBA 4JQFA 3CC7I 2EFNA 5C4XJ 1USTA 3AG3H 2XPWA 1ZLJA 2KJCA 5EJCA 3HBLA 2K3FA 3H9GA 2XAJA 1G3WA 3G4SI 2COBA 4U87A 1QA6A 5FFXA 4HV5A 2OQRA 2VN2A 4LLLA 5ILUA 4BY7J 3JAMZ 3S3OA 1U9OA 3FXQA 3BTIA 3DEWA 4Y3OA 3SYTA 5C3EJ 1R71A 3WHCA 1SFXA 1XGMA 1YLFA 3P9IA 1ULYA 4Q48A 1FJLA 5GP9A 5LHGA 1AWCA 2ZMEC 2MGQA 3QQAA 4BQQA 2H6BA 5DM6F 1TT5B 3AG4H 5JVTA 3FBNB 1QU3A 2P6TA 4I09A 5E3MA 1UCRA 3CO6C 4HW0A 2LDUA 4XSZF 4V19K 1W36D 1RR8C 3PL8A 3CCJI 1HDPA 1U0JA 1TTYA 4DBQA 5E20A 2L7FP 4EGYA 5EF6A 4A3BJ 1QZZA 4XONA 2KZVA 2JA5J 3RIRA 1QNTA 1EF4A 1FEXA 3JRDA 1OR7C 2EA2A 5C4JJ 3P9KA 3LOCA 3AG2H 1YITI 1IN8A 1MJBA 3AAFA 5F1JA 3JAMK 3R4KA 4J19A 4N0BA 2D1HA 2HOSA 4UHTA 3ZQHA 1TLHB 3H35A 4BXUA 4ESFA 3JTGA 4IJAA 3BJAA 1U5TA 5CVRA 2CQ7A 3BG9A 2CS3A 2FXAA 5D6FA 1ETKA 2NVYJ 2HDCA 4BY1J 2KIUA 4PFPA 2KDOA 1X58A 1V5EA 2HGCA 2OD5A 2W4SA 3E6CC 2IGOA 1U78A 4BUPA 4I76A 2KZGA 3K4KA 3E3VA 1GV5A 5HS7A 3EYIA 2M7AA 4A93J 1ETWA 4ENNA 2WTEA 4G94A 3K10A 4II2A 2BZTA 1WJCA 3B73A 4HV6A 3ONQA 4PJJA 2H6CA 1L3LA 2PEXA 2QZ8A 2LBFA 2OCCH 1W7PB 3VYUB 2IRFG 2ZJQF 2IS2A 1ZQ3P 4KIFA 2JSCA 1JI8A 2MBFA 4X0GA 1TWGJ 1XN7A 5E18F 5E1ZB 2EV0A 3LA2A 4NQWB 4WX9A 1E0EA 1JT6A 4YFKF 2XF7A 2OTJI 4B44A 2NRAC 2OC6A 5H6RA 3MKZA 3LSKA 1H89C 1O57A 5GADJ 3AKZA 2VI6A 4BHPA 4BE1A 4XICA 2JA7J 2QSHX 1R6RA 2QYOA 3FMSA 2IGNA 4C2MJ 1KONA 1PUEE 1MNMC 3W2VA 2BY2A 2CFXA 4NDLA 2ESNA 3ZQGA 5F04A 4PJLA 2LH9A 2LR8A 4XLEA 4I0BA 1U6GA 2E1OA 1B9MA 2DYRH 5LEJA 2F4OB 2P5KA 4QIWN 3JCUC 5K7FA 2Q0OA 4A0XA 1J0RA 2R4GA 4MEXF 1F43A 2XC7A 3AG1H 4XRMA 4XLAA 2JA2A 3PNTA 3ZQIA 2NXNB 3ZMSA 3M9AA 2ELJA 4M3EA 2Z1DA 2EBIA 2FOWA 5GPAA 4JX4A 4ZH4F 1EH8A 3JRGA 3LFUA 1P9QC 2VOOA 1ZTRA 1Z1DA 3ZQLA 3LSIA 4C3HJ 1T98A 4Y4RA 3KCCA 2M0MA 2X51A 3LL7A 2Z9OA 5HS8A 2H09A 1Z05A 3L2UA 1BIAA 1Y56A 3DPUA 3A0HC 3T0YA 2VT2A 4HQEA 1BC8C 2L7KA 1OR7A 2M30A 3BR0A 1K4SA 1ZN2A 3N97A 4NNJA 1J7KA 3RPUA 2NS0A 1S6LA 2V6CA 3TP0A 1FLIA 3BQYA 3ABKH 4RGUA 3CJRB 5GTIC 4U0YA 2HOEA 4AIKA 3V8JA 4I02A 1K6YA 1Y1VJ 3OYAA 2WC2A 3RYPA 3IHUA 1IXCA 3H9QA 1TW3A 1WKMA 2DT5A 3HGGA 4GXOA 2PMZA 4BKXA 2XAFA 5EYRA 2L5QA 3FXLA 5FKOA 1FT9A 3SZPA 2DA2A 4M6XA 5CVIA 1WPKA 1OYWA 4MO7A 1MMAA 4R79A 3OY9A 1B4AA 3ABTA 4ZYAA 5FGMA 5IPAA 2H27A 3GTMJ 3OYMA 1XDUA 2HQAA 4BQOA 3TO7A 2LLKA 3J80Z 3DBLB 1Y8QB 2HXIA 2E19A 3F22A 2EWNA 2XROA 3HSFA 3U21A 2G7HA 3WGGA 4HQMA 3TL4X 2GAUA 4RAFA 2VL8A 5DCMB 5FO5A 2AO9A 2VKDA 2CFOA 3PNYA 2VKVA 1F36A 2MD5A 3OR1C 1KQ8A 2L01A 2M4GA 1AKHB 1DP7P 3HPHA 3LSPA 3IUOA 3M8FA 1WCMJ 2K02A 3AFHA 5AIQA 1YTYA 4NBQA 3ZGKA 4GO1A 3DPTA 3V7SA 2JA6J 5IOYA 2R7XA 1JUMA 4EJOA 4A3DJ 3TW7A 3F8NA 3T8TA 3CJTB 4XRSA 5J4YA 3FMRA 1IF1A 2X1CA 1XSVA 5E8IA 1PJRA 2YSRA 4A3GJ 1K61A 4M3GA 2M7BA 4E7SA 5FFZA 2F5EA 1ZR2A 4BDYA 1M1EB 1V5FA 5KHDA 2M9HA 4BYYA 4CXFA 2O8XA 3V4GA 4N9IA 4R1HA 5M5YJ 1R00A 2LNBA 3ABUA 3IRRA 4IKFA 1WZ2A 2CQNA 4UUVA 4G7ZF 3G1MA 3LAJA 5CPRB 1T08B 2ME0A 3OV8A 1TBXA 2O7OA 4A69C 2W85A 3ZOBA 5FKKA 2BXZA 3OSGA 4LIVA 2RREA 3HSRA 2X48A 3QRFF 1HOMA 4LG3A 3IV5A 1IN7A 1YX5A 2OZUA 2Y0MA 2PN6A 1D5YA 1B8IA 3HGYA 3HHGA 3ECHA 3FWEA 2Q1ZB 1AA7A 2MG4A 3J81Z 4RBOA 3KEQA 3NAUA 4XQFA 4FETA 2ECBA 3HRSA 5CJ9A 1LDJA 1TL8A 1ZHFA 3H1CA 3CMMA 3GTOJ 1KQ0A 2M2EA 3BZ6A 5IYCJ 3CCVI 2XVCA 3FXUA 2VQCA 4HX7A 2LY2A 4A3CJ 2E1CA 2L4MA 1TNSA 3EUHA 3SQNA 4HF1A 1SD6A 2QBYA 2XAGA 5GAEJ 1OISA 2X85A 3ZMTA 4HAMA 2FJ1A 2BE5F 3DP7A 1SVLA 1D1AA 2X9DA 3BG3A 4Y52J 4Y13A 1MH3A 1UG0A 3G71I 2FU4A 2RQQA 3PJRA 2E7XA 2OV7A 2JUCA 5IP9J 3S93A 1VI0A 4FTHA 1D1BA 2BY3A 1SFUA 2BVLA 1KGSA 4LK0F 3J81K 2IS6A 2E1NA 2AXTC 3EUKL 3A03A 3R60A 5J40A 3OL3A 4LFUA 2F5FA 5KAFC 1H9TA 4F55A 1X1CA 2VC0A 1NG7A 1WVRA 5M3FJ 2QKMB 4KICA 3PM1A 4EJUA 2NYXA 2KRHA 1VTNC 1YRNB 3GF2A 2Q8KA 2YU9J 4LMYA 4FQGA 3QAHA 4ZDPA 5F27A 3PQKA 2F6CA 1HSTA 1LFUP 2DDBA 2DYSH 1JGGA 1Z77A 2CWEA 3PIPF 2DQRA 5J1YA 3E5XA 4I01A 4KIBA 1FZPB 3HOSA 3RJPA 1HW2A 5TRDA 2Y48A 2MABA 1LVKA 1W5TA 4V2GA 5F64A 5ICFA 1TC3C 5IT9Z 1VQ4I 5DD8A 3VODA 1XGSA 2XV4S 1HSJA 4BJ6C 1WH7A 2L7ZA 4HPQA 1R5ID 3JSPA 1X1BA 1R5GA 4UVBA 2XGDA 3KYCB 5IP6A 5EGOB 2TRTA 2GOXB 5LGUA 2CJJA 2PMZN 2DXIA 2I8DA 1DU6A 4JOMA 1QPMA 5M3MJ 1HBXG 1OLTA 3LSMA 2F4MB 5DYMA 2EZKA 3QPHA 4DOZA 2HYGD 2COMA 4EJWA 2LSOA 3HKZA 3A02A 1S7OA 2BY0A 3PO2J 2K4JA 1OCZH 2EPFA 4O5VA 3VSLA 4G6DA 3F23A 2LTPA 1FBSA 3I64A 1BIBA 1R1VA 1Z3XA 2F2EA 1A36A 2CV2A 3JRCA 4X1EA 3ZMUA 2O6GE 4LG0B 2V6EA 1N25A 2GA1A 3L1PA 4DIQA 4BE0A 1R9TJ 3JRHA 1RNLA 2A3SA 2R7DA 1YS7A 4OMYA 2HTJA 2GIZA 3PO3J 1D8JA 1FOXA 3CESA 2WAQA 3W6VA 4PJNA 2QEXI 3VYTB 3OOUA 2VQGA 1VQOI 1SD7A 2VJ5A 4ZTFA 2JZYA 3E6DA 3HOYJ 2CG4A 3KPHA 4A2UA 3DLAA 4XNFA 2V1XA 4L5JA 4FCYA 2AQFA 5JLXA 4G6TB 4A3MJ 2R7FA 3G1LA 2PJRA 2DA6A 1L0OC 2K9LA 3DCFA 4AYBA 2Y9YA 1J09A 3GCMA 3FXKA 1HF0A 1Z67A 4HNVA 3GWZA 2AS5F 2GXGA 2DQLA 1KU3A 2EIJH 2KPMA 3K4MA 3WU0A 1W7PD 2OTLI 3DU5A 3N05A 3ML6A 3M8EA 4NUBA 5CLSA 1QHGA 4F92B 1TW2A 1S7EA 2CYYA 1T39A 5LEKA 4TV7A 4MTDA 1TNTA 5IT9K 3JR9A 1IZ1A 2IS4A 2JJ7A 4PK4A 1B8IB 4IRGA 1E3PA 2LKPA 2HQRA 1ZLKA 1TQMA 5B1BH 3SFIA 2IA0A 2DW4A 4MHGA 2ZJ2A 3IL2A 3MVPA 2UXNA 3K2AA 2ZNZA 1FNNA 2X0LA 3MEXA 4L9TA 1G59A 3HSEA 5JI6A 2VBWA 4U88A 1IGNA 1W0UA 2VE8A 4OAZA 4YIFA 3QU3A 5DEQA 3W6JB 2L4AA 4G7HF 3IWZA 3VYSB 2AXLA 1H8AC 2OA4A 2R3SA 3F0CA 2FRHA 2HVSA 4XRSG 1CQTA 2CMPA 3BCAA 4G7OF 3QYBA 2R7VA 2ACJA 2ZXJA 3H5AA 5TISC 4HBLA 1BI2A 3A4CA 3Q0VA 1LE8A 1FTZA 1Y6IA 4WWCA 1GHCA 2B0LA 1LFPA 5DV5A 1PDNC 3L2WA 2GA2A 2X6XA 2P5LC 3OS1A 2C6YA 2BGCA 4E70A 2ADUA 2HXOA 4JBAA 4HDUA 4AVZA 4UY8I 1TWHJ 5CKTA 2A69F 2DFFA 3FXJA 3GTQJ 3HOVJ 4KT6A 2KIFA 2Y9ZA 3ISPA 2DBBA 4M3DA 3DFGA 2X6WA 4B43A 4A3IJ 5DCFA 1RKTA 3EDPA 4F52A 2XIGA 4XKVA 5D4SA 1WRJA 2DK5A 4M9ZA 3F3XA 3CCQI 4ENKA 4F3QA 1UHWA 1SFEA 2JPBA 2MLKA 3GBGA 4L9JA 2KMUA 2IP2A 4XLPF 2M3AA 3V7CA 3E5UA 4P9FA 2HPIA 3BPVA 4WK8F 3TW6A 2ZO4A 3W6KB 4BQAA 1G3SA 3IC7A 2R5ZB 1ETXA 4CHUA 1XMKA 4CYDA 1QVTA 4UXNA 1HQCA 1LPQA 3IAM2 5FKNA 5BQTA 2QKLB 1IW7F 2M0CA 2LREA 2MH2A 5EEGA 1I39A 5FKLA 1C0WA 1ZGJA 4YRVA 4IF4A 2XPUA 2DDAA 2E5NA 1F1ZA 2TDXA 3J7AY 3GTGJ 4LLNA 3KEYA 5TGTA 3BQZA 2BW3A 5EZGA 1LNWA 4DYQA 4EGZA 4KJZA 5B5EC 3BCBA 1VQNI 3CCMI 3LMMA 3GLXA 1R23A 2WY7Q 2JPCA 3I56I 1XMXA 3CZ6A 1U9NA 4E7IA 1R5HA 5BMZA 3ZXSA 1E2XA 1BI0A 2W84A 1IDZA 2LYCA 5CQEA 1S7AA 5DDGA 4LJZF 3GTJJ 1GVJA 5ILVA 1FPQA 3K2ZA 4AUXA 4ON0A 1WH5A 4Q47A 4XLCA 1I6HJ 2F5CA 3BWGA 2QGUA 2P5VA 5FJ8J 4RB1A 4F93B 3W2WA 2DCEA 3L9FA 1D1CA 2CW8A 2N8GA 3IH4A 2NVUB 2JT1A 1A35A 2DFHA 2F5DA 4CO8A 1GXPA 2DT7B 1OJLA 3F21A 2GLOA 3AL0C 2EINH 2DODA 2VXDA 3UKGA 3WGIA 1BOAA 1V4RA 4HSRA 4HNUA 1SVMA 2W82A 2V1UA 5EGOA 4IRHA 2KIQA 3IAS2 4HF0A 4BHCA 2FNPA 1BW6A 3SFZA 1SAXA 4IQ4A 3JRBA 5M5XJ 3A2KA 3S8PA 2CGPA 1WJ5A 3OYFA 5JR3A 3K4BA 1XPXA 2X6OA 2CV1A 1UFMA 2P7VB 2Q2EB 4Q5SF 3B6CA 4S05A 2LKXA 2E36A 1ZR4A 3M7GA 1Z21A 1MMDA 3MKYB 1LEBA 1MNEA 3WTSC 2W48A 2XF5A 2FBHA 1SFKA 1U5TC 3KLNA 5HS9A 3C2HA 3OYDA 3CLQA 2DFIA 1B9NA 3M8JA 4MFEA 2K4BA 3CMAI 2WWYA 1RUOA 2IT0A 1VQ5I 1IXSB 1FOYA 2EZIA 3HHHA 2EZHA 1IRZA 3MFKA 2VODA 3FIWA 2DTZA 3RI4A 1G6NA 3DKXA 2LOOA 4P55A 2KJBA 2QQ9A 2KIMA 2HS5A 4Y17A 3U2RA 2DA7A 3MZ8A 1ZRFA 2L9VA 2WB1N 3HYIA 5D5VB 3H3UA 3L2VA 3TKYA 2MLGA 1HC8A 4AVPA 1O3RA 4CDGA 4NQWA 3RQ4A 1USSA 3SHFA 1XX5A 4LB5A 3CC2I 2L7MP 1Q1HA 4LB6B 4J00A 3ZQFA 4F91B 1ZK8A 4RAZA 1F9NA 5EEAA 2BEOA 3OR2C 3ZQ7A 3EUHC 4JK1X 4RGRA 4HNTA 1XMAA 3KZZA 1R1UA 3DKWA 1JJ6C 2VXZA 1MBEA 4ZTJA 1YJNI 1ETOA 3MN2A 1DUXC 2HOTA 2VONA 3QODA 3WTXC 3VPRA 2JN6A 3EUAA 1E17A 2YU3A 1DPUA 3GZ6A 3ZRGA 5BS6A 1P6RA 2W00A 2WAEA 3F6OA 4FX0A 1VQPI 2FQ3A 3ZCOA 1WJEA 2NVXJ 3D5SC 1FTTA 1BA5A 3J7AO 4PJMA 3L2CA 3VOEA 1VQ7I 4DZPA 5FRNA 2DPUA 2G7UA 2PG4A 5FD5A 3QYEA 3TDUC 5F08A 2LRDA 4RA2A 1DPRA 1JGSA 3OS0A 1AOYA 1BI1A 1J9IA 2K3PA 4Y33A 3ECOA 2GM4A 3AL0B 5BPDA 2DMTA 2ELKA 4IOCF 5KAIC 3RKYA 3OYNA 4XIDA 3EYYA 3KP2A 5HNFA 3MD2A 3GX4X 3I54A 2D2WA 2CQXA 4NC6A 2GXAA 4OOIA 2UUZA 3LSGA 4LIUA 3GFIA 4CCKA 1WI3A 4A0ZA 4BNCA 1MBKA 4MEYF 1B59A 3CUQB 3R6SA 2MYSA 3GFJA 4M74A 3M3YJ 2NAZA 1RRJA 1XGOA 4ASNA 5B66C 3WTVC 1QZYA 1RZ4A 1T33A 4L9VA 3BG6A 1IN4A 3TBIA 3ERMA 2V9VA 2QQBA 3M07A 2FEZA 5F0CA 2CW0F 4OIRF 2K9NA 2JUGA 1TWCJ 3ZQQA 3GTPJ 2DK8A 1MSFC 1PUFA 1Z91A 4CSWA 1GVDA 2DMQA 1CGPA 4UVCA 4DQ2A 4G8XA 4M72A 2V4JC 1IV6A 1LB2A 3F8CA 3MWMA 3HOTA 1IG7A 2VBYA 3BT9A 5L3EA 3SZTA 4NC7A 2E5ZA 3BG5A 2IS1A 2L2OA 1IO2A 1SFOJ 5FKMA 4HEA2 1LEAA 3IH3A 1V5GA 3GTLJ 1SC7A 1X19A 3KP4A 3E7LA 1JHHA 5K7HA 4M3FA 3CCSI 5JVGF 3A0BC 3LAPA 3CC4I 1KQ9A 3KX2A 1VNDA 3MAJA 1Y1WJ 1P7IA 4XOTA 3F8BA 4M73A 2FX0A 1X1PA 2HVQA 3CDLA 1EA3A 1I27A 2HDWA 2PQ8A 2VIXA 1QQIA 1UMQA 3LSRA 1W4MA 3OYJA 2OPTA 3GW2A 4HRIA 3HPGA 2WBMA 1ITYA 2M4KA 2OCEA 3BR2A 2H8WA 3Q0WA 1D0ZA 2RNJA 1A6QA 1FSHA 3CUOA 4D5CA 1QPIA 3S1QJ 1P4WA 4HOBA 4PSXA 3V8KA 5AIPA 2JQ7A 4KMUX 3FISA 3JRIA 1TZLA 2W24A 1LJ9A 2E1MB 2ZFWA 2IW5A 4FISA 2XAQA 1HW1A 5DUIA 2QA4I 4IXAA 1IN5A 1I6XA 1BJZA 5LFAA 2V79A 1UB9A 2GOMA 1V3FA 5DS9A 2DOEA 1REPC 1TQIA 1OMIA 1JE8A 5HDNA 4DW6A 4X6AJ 2OF7A 3W3CA 1SAUA 3K4CA 4A5MA 4EJTA 4MQVA 3FBIB 3GVAA 2VJJA 1NK3P 2IA2A 3SXYA 2OQGA 1YS6A 1OCPA 3DV8A 2B7EA 2Z5UA 3UNGC 1BOBA 1WJAA 2HNHA 2DMUA 1MW7A 4D7NA 3RPQA 4EM2A 2OJED 4ZC3A 1S8NA 1YW9A 1H0MA 2UZKA 3CCRI 3K4LA 2IVMA 3RTRA 2KDZA 3BP8A 1ZG5A 1U8BA 1JJ8C 4BH9A 1ZAOA 3WTTC 1X4PA 2DOAA 5F0FA 1FYMA 2KT0A 3CUQC 4A5NA 2LKSA 4P5OA 3R0JA 4CCOA 2NNYA 1FOKA 3C18A 1Q1VA 3OMYA 1I1SA 4B3XA 1Z3YA 1MMNA 2VJIA 4AIHA 2JA8J 4ZZDA 2EFQA 2CRGA 2LFBA 5J47A 3WU2C 1ZELA 2ZKZA 2STTA 1E3OC 3TDZC 5IYBJ 3SJMA 3PSIA 3H9JA 3GFLA 3QP5A 1QHHD 3FKIJ 4C9YA 1FIAA 2NS8A 2NOJB 4EATA 3BROA 3QP6A 1QBJA 1LVAA 1GDTA 4C3IJ 4DNCA 2LD5A 5B1AH 2M5WA 3DTKA 5ERIA 4L0ZB 1VF9A 3FHZA 3HZJA 1ON1A 3QPSA 1T2KA 4GYIA 1O7FA 1Z7UA 1J5YA 3HB9A 4PDKA 1R49A 2I10A 2E35A 2ID6A 4L5IA 4CICA 3GTKJ 1MJAA 1O3QA 2YUSA 3HG9A 3VSKA 3CP8A 4AYBN 4HYEA 3K1NA 1ONVA 3CF5F 4MNUA 2HI3A 4N4NB 4QWQA 1ON2A 2GXBA 2XASA 2JK3A 4QPQA 2YS9A 2IPQX 3CJNA 3NWTA 4U0VA 3WG7H 3OIPA 4RB0A 3IP4B 4RB3C 1LUJB 2PJRB 4CZCA 1SVOA 3K1MA 3RKXA 3I71A 3M1EA 5EG0B 2Y0SN 5D8LB 5E8GA 1YE9A 4HLYA 2KLOA 2BY1A 3BR1A 2HOAA 4A3EJ 3E6BA 5K1YA 2A68F 3CQZJ 4BBSJ 3FXMA 3GMEA 2DI3A 4BQNA 2CW7A 2JVHA 4YELA 2RAEA 3J80K 2AQEA 3S3NA 3O8GA 4IL6C 2J5OA 2M1BA 4OMZA 5GAHJ 2DLLA 4PGGA 3RPUD 2HR3A 1XTAA 3WTYC 3H5NA 1W7PA 3G1OA 4XLHA 4XKWA 3WGHA 1E3HA 3WTWC 1RC9A 3ZP5A 4O3MA 3HIFA 2FMLA 2ZXHA 3OSFA 3EPZA 3DEUA 2V9KA 2HVRA 3HRUA 3HXLA 1Z6TA 3SEQA 3BOQA 1WHUA 3QYFA 5IOZA 2LVSA 3I4MJ 4KN4X 3BPXA 2RNGA 3HDDA 4PCQA 3H0GJ 1HXDA 4A3FJ 2XPVA 2CV0A 4XKCA 3BC8A 4MFDA 2DA4A 2XAUA 4CCJA 4C30A 1OCOH 2FE3A 4ZZLA 1MDMA 2L3DA 5E17F 4FHTA 1LE8B 3S3MA 2LF7A 3LA3A 1YYVA 3HOXJ 1FMVA 1IUYA 1FC3A 3M1CA 4CUGA 1JHFA 4KT5C 1X2NA 3IRQA 3JW4A 5JHFA 1FBQA 3S2HJ 1X1AA 4BGDA 4XN3A 5F1RA 2M8GX 4J01A 5IT3A 3DBRB 1RKWA 4B8XA 5ICGA 1LQ1A 3NQOA 4EVIA 2QQAA 2XAHA 2VT3A 3O8HA 4PZJA 4RDUA 2P4WA 4RM3A 5B3SH 2L9SA 3DXJF 3DTEA 5GPCA 3BTJA 1I50J 1YIJI 1T95A 3ROUA 2L0KA 1S29A 1VQKI 1IUFA 3HTSB 3COAC 2A5WA 3ASOH 3A01B 4KA4A 3I58A 4WXDA 3ULQB 1UJ8A 4IPAA 1Z9CA 2M87A 3FXOA 1LFBA 3S1NJ 4Q4ZF 2QM3A 3KP6A 3O3KA 2FQ4A 2L9RA 4ESBA 1S9HA 4A6DA 3BTLA 2MC3A 2EIMH 1LKXA 3F9KA 4YEJA 4CYCA 1HW5A 2QCOA 4QLCU 1UAAA 2W1OA 2CSOA 3F6VA 1OCCH 4GCVA 5E3OA 1GT0C 2ZCWA 3WE2A 4UVAA 1I5ZA 2DA3A 2R92J 4IO9F 1R7JA 4PFOA 2ISYA 4G12A 2R7SA 5EZHA 4EMSA 4LK1F 2EFPA 1UZCA 1K83J 2E60A 3KLOA 3RZDJ 2NVTJ 2LY1A 3GUDA 4M9XA 5L3GA 3OYIA 2EB7A 1WFXA 3ZMZA 3U9GA 5J1RA 1YJWI 1YIOA 1VZ0A 2F48A 4E7KA 1PYVA 1FSEA 2FD5A 4JX5A 3G73A 3MZYA 2GBYA 1HDDC 2G0EA 5EEHA 3NWSA 1D0XA 1QGPA 1YFHA 2EFOA 5E1XA 1Y0UA 2KISA 2PMHA 1VQMI 4PGHA 2K9QA 3RKWA 1G2HA 2RDPA 2BHZA 3FK6A 3LQQA 3MKLA 5M5WJ 1FYKA 1RUNA 4F7ZA 3C1DA 3ZPLA 4S0HB 3DPLC 2XRNA 4G6QA 4C2TA 2RC4A 1G4DA 1SEUA 2QVOA 5CVUA 2B9SA 2FBKA 1W1WE 1R36A 3HC7A 4LOCA 5JHUA 4KIGA 1G3YA 3C3WA 3FMQA 1V54H 2J5PA 2LC2A 2FA5A 3CO7C 3TOAA 4ABZA 2CO5A 5EG0A 2FSWA 3WTZA 4IQJA 2XRLA 3KETA 5F0HA 1U3EM 1BW5A 4AWXB 4ZYEA 4YG2F 3K70C 1N77A 4YIIA 3I3LA 3QPLA 2A6EF 2HTSA 3D5LA 1RI7A 2YPRA 5LLQA 4GGGA 5LRSA 4PSWA 2DMPA 3O6BB 4N9HA 2Y31A 3K69A 4I0AA 1H9GA 1B6AA 1P7JA 1RPWA 3TOBA 4P9UA 2ZSIB 3I55I 3H3VK 3JREA 1ZGWA 1AU7A 4H0EA 3HOUJ 4HF2A 1MMSA 3MKWB 3LWFA 3J7YJ 5C44J 3HL2A 1ETQA 3GYHX 1JKRC 3VDXA 2DFEA 2VB6A 4B3AA 2LMDA 2R0QC 3BG7A 4ZDOA 2KL4A 3S2WA 3CD6I 4U7BA 3WU1B 3CP2A 4OIPF 3SDGA 5L3FA 4EM1A 1FP1D 5HLTA 1JT0A 4XN0A 1ERDA 2RKHA 4W1UA 5DUKA 1MDMB 1PVEA 4HDVA 2FUG2 1XS9A 5FLXK 5ICEA 2XGEA 2Y0SA 1YO5C 2R7ZJ 3HM5A 3CTAA 3FM5A 4XRFA 2R7RA 4UV8A 3KYLA 2P6SA 2HQNA 3ZN1A 3QWLA 3C2BA 3BTCA 4D1QA 2ZFUA 1EH7A 4JX6A 3J7ZI 2YR2A 1X1DA
chains in the Genus database with same CATH topology
4L9NA 4KFCA 3F8FA 1KU2A 4I2OA 1PP7U 1JXSA 2CQKA 5ED4A 1ZG1A 3BJOA 1O7LA 2EJRA 2STWA 2HFHA 1CF7A 4FT8A 1ZGAA 4B09A 3ERED 4U0WA 1ZG3A 1ODDA 4AIJA 5L3BA 5A2QZ 3P7NA 3K1PA 5FLXZ 1HKSA 1OYIA 2ESHA 1S3JA 3BDDA 4MQ9F 1U5TB 5H20A 1OKRA 5FD6A 5J8FA 2O3FA 2FNAA 1XCVA 5DD4A 1NHAA 3IWFA 1FP2A 5CVJA 1UHMA 1BN5A 1ZREA 3PFIA 1F5TA 1Z6RA 3IKVA 4KN7X 5L3CA 1ZRDA 5JFRA 4I98B 4UNOA 2QENA 5E1WA 3PQJA 2H94A 1O3TA 1K79A 3GEZA 2D45A 1OYYA 2ETHA 3OOPA 4FX4A 5FB2A 1KU9A 4AD9A 3VEPA 2O0YA 2L54A 4S04A 4KYWA 3KFWX 2JTVA 5J6XA 4CGZA 4RS8A 1XGNA 1A04A 3KP3A 1KA8A 4KMFA 2BYVE 3R0AA 2XKPA 1IRFA 1D8KA 4O6JA 5H6QA 2RVCA 3Q5FA 4P96A 5K5QA 3E97A 1K7AA 3HRTA 3H92A 2ZNYA 1XDSA 3HUGA 5HOOA 1HKTA 5HDGA 4ENMA 3WODF 5LGTA 3VFZA 4RB2C 2D1VA 1YG2A 5L3DA 4IHSA 4LG0A 3T8RA 4IRIA 3N4MA 2K27A 3ZN0A 2HEOA 3HTUA 2V1DA 3KP7A 3Q9VA 5LHHA 2PLYA 3EQLF 4EM0B 4ETSA 1I1GA 2HKOA 4WXHA 2MH9A 1WQ2A 5D5UB 1LDDA 2IJLA 5CVVA 1F4KA 5ILSA 3TGNA 1BC7C 2A07F 4OINF 1FYLA 2XHKA 2E7WA 5LGNA 2YX4A 3JTHA 3LFKA 1HKQA 3FXRA 2VBXA 1T38A 3TO6A 1X3UA 2MA3A 4OIOF 1ZARA 5HLIA 1MJ9A 3B02A 1TQPA 1BM9A 4YFXF 1U2WA 4XBFA 4RGSA 1QO0D 1B1BA 2EK5A 4IVNA 5HDKA 2DO7A 3DQVC 3I59B 3K9TA 3V7RA 4NHJA 4M6YA 4HX4A 2QUFA 3T1BA 2Z3YA 2ZMEA 2DU9A 2L02A 2P7CB 3C7JA 4IHTA 1P92A 3LSTA 1FX7A 3REOA 5K5RA 2VC1A 3KEOA 2VBZA 3VB2A 3BJ6A 2DAOA 4UV9A 4EQQA 1GXQA 3NEUA 2FF4A 1FWZA 3H3ZA 1SMTA 1WWXA 3WG9A 1XCBA 1WI9A 5J8CA 2ISZA 2M45A 5KK1A 3WE3A 2RGVA 5HLGA 5A2QK 1R22A 3O2PE 2QLZA 1OPCA 1J59A 2RQPA 2UXXA 3R61A 1D5VA 1YQAA 4G9YA 2FOKA 4WF2A 3T5XA 1XSDA 4ENJA 1EH6A 3RYRA 2JRTA 1FY7A 2PMUA 3L09A 2OU2A 2DPDA 1K78A 2K7LA 1O3SA 2DTRA 2Z33A 4L0YB 1SD5A 2PI0A 2Q2EA 1IN6A 5HLHA 2BV6A 3Q9SA 5D4RA 3I59A 3I0TA 4I7HA 2ZMEB 3FX3A 4A6EA 3D0SA 2Z99A 4NB5A 4OIQF 4KUMA 3ZMDA 1FBUA 1BI3A 2RV8A 4RGXA 2BBYA 5CYVA 5LHIA 4ESJA 2GIVA 2FMYA 2X4HA 4EJVA 1MZBA 3FF5A 2HWVA 2IA1A 5TJJA 4A0YA 2WV0A 1SMYF 1P4XA 3KE2A 2GZWA 2M8EA 3ELKA 4Y15A 3E5QA 3L00A 4U7DA 4ZYHA 3QPTA 4EV0A 2QBYB 1R58A 3U1DA 1MD0A 5D5WB 1U8RA 3WTUC 1P4AA 4RAYA 2HKXA 1SD4A 4D0PA 1RIOH 1KU7A 3ZMVA 2KKOA 1STZA 3GFMA 2NNNA 2GWRA 3L7WA 3RDIA 2HYFA 2YX7A 1G3TA 4HLXA 2A5YB 1LDKB 5KVRA 3GXOA 2KRFA 4MTEA 2OZ6A 4LGWA 1XD7A 2HZTA 1PP8F 3LA7A 4CZZA 4R8HA 4WXCA 5ICCA 4HA8A 4KDPA 2O03A 3CUQA 1P2FA 1XSXA 2XKOA 4HX8A 2W57A 1T6SA 3HRMA 3F8MA 4YFNF 1YW7A 1IAWA 3QOPA 3I4PA 3K0LA 2A61A 4OU0A 5D5XB 3JSOA 3TQNA 3LQRA 5HVQC 1BBYA 4HZFA 1J2XA 2K86A 1KYZA 3P9CA 4KNYA 4BAYA 3MCZA 3BY6A 3FZVA 2OAZA 3V8LA 3DF8A 2A6HF 1WSUA 3NRVA 4M71A 1ZRCA 1IRGA 2PJPA 2EA4A 4LLGF 2PFBA 5BOXA 1YW8A 4WCGA 2UWMA 4ZYDA 4XLNF 2QWWA 5D8KB 1XB4A 3MZHA 2XUBA 1W5SA 3I53A 5K5OA 3MQ0A 1BJAA 3KZYA 2GQQA 2VE9A 4GYGA 2PBIA 1MKMA 3EETA 1J75A 5F6FA 1KYWA 5AONA 1D3YA 3E6MA 1T0FA 5BPIA 4K2EA 1ZH5A 2EV6A 4M9SA 2Y75A 3I5UA 2EV5A 2ZBKA 3KP5A 4Z2YA 2OBPA 1K78B 3G3ZA 4XSXF 5LBQA 3F72A 2XGXA 2VOPA 3GZ5A 1K6OA 6PAXA 2RN7A 5D6EA 4MGRA 4L18B 5LRRA 2LF8A 1IXRC 4ZYGA 3TO9A 3CDHA 1EV7A 1ZYRF 3IKTA 2ELHA 2G9WA 2W25A 5DCMA 2EFWA 2O61A 2FBIA 3GO5A 2P8TA 3FM3A 4LD5A 4A12A 1MGTA 1CF7B 3QU6A 3CLOA 1R1TA 1DDNA 4BHBA 4JQFA 2EFNA 1USTA 1ZLJA 2KJCA 2XAJA 1G3WA 5FFXA 4HV5A 2OQRA 2VN2A 4LLLA 5ILUA 3JAMZ 3FXQA 1YLFA 1SFXA 1XGMA 3P9IA 1ULYA 4Q48A 5LHGA 1AWCA 2H6BA 5JVTA 2P6TA 4I09A 1UCRA 3CO6C 4HW0A 2LDUA 4XSZF 1TTYA 5E20A 4EGYA 1QZZA 3RIRA 1QNTA 2EA2A 3P9KA 1IN8A 1MJBA 3AAFA 3JAMK 3R4KA 4N0BA 2D1HA 4UHTA 4BXUA 1TLHB 4ESFA 3JTGA 4IJAA 3BJAA 1U5TA 5CVRA 2FXAA 5D6FA 2HDCA 2KIUA 2OD5A 3E6CC 2HGCA 1U78A 3E3VA 5HS7A 3EYIA 4ENNA 2WTEA 4G94A 3B73A 4HV6A 2H6CA 1L3LA 2PEXA 2QZ8A 1W7PB 2IRFG 4KIFA 2JSCA 2MBFA 1XN7A 5E18F 5E1ZB 2EV0A 3LA2A 4WX9A 4YFKF 2NRAC 5H6RA 1O57A 4BHPA 2QYOA 3FMSA 1PUEE 2CFXA 2ESNA 4I0BA 1U6GA 1B9MA 5LEJA 2P5KA 2Q0OA 4A0XA 1J0RA 4MEXF 3ZMSA 3M9AA 4ZH4F 1EH8A 2VOOA 1Z1DA 1T98A 3KCCA 2Z9OA 5HS8A 2H09A 1Z05A 1BIAA 3T0YA 2VT2A 1BC8C 4HQEA 1OR7A 2M30A 1ZN2A 3N97A 1J7KA 3RPUA 2NS0A 1S6LA 2V6CA 1FLIA 4RGUA 4U0YA 2HOEA 4AIKA 3V8JA 4I02A 2WC2A 3RYPA 3IHUA 1IXCA 1TW3A 1WKMA 2DT5A 4GXOA 2XAFA 1FT9A 3SZPA 4M6XA 5CVIA 1OYWA 4R79A 1B4AA 3ABTA 5FGMA 2H27A 1XDUA 3TO7A 3J80Z 3F22A 2EWNA 2XROA 3HSFA 2G7HA 3WGGA 4HQMA 2GAUA 5DCMB 5FO5A 2MD5A 1KQ8A 2L01A 1DP7P 3M8FA 2K02A 5AIQA 1YTYA 4GO1A 3DPTA 3V7SA 4EJOA 3F8NA 3T8TA 1IF1A 3FMRA 1XSVA 5E8IA 2YSRA 5FFZA 2F5EA 4BYYA 4CXFA 2O8XA 3V4GA 4N9IA 4R1HA 1R00A 2LNBA 3ABUA 3IRRA 4UUVA 4G7ZF 3LAJA 3OV8A 1TBXA 2W85A 3HSRA 3QRFF 1IN7A 2OZUA 2Y0MA 2PN6A 3FWEA 3ECHA 3HHGA 3J81Z 3KEQA 3HRSA 5CJ9A 1LDJA 1ZHFA 1KQ0A 3BZ6A 2XVCA 3FXUA 4HX7A 2E1CA 2L4MA 1TNSA 3EUHA 3SQNA 4HF1A 1SD6A 2QBYA 2XAGA 3ZMTA 4HAMA 3DP7A 2BE5F 4Y13A 2FU4A 2E7XA 1SFUA 1KGSA 4LK0F 3J81K 2E1NA 3R60A 4LFUA 2F5FA 1H9TA 2VC0A 4KICA 4EJUA 2NYXA 1VTNC 3GF2A 2Q8KA 4LMYA 3QAHA 3PQKA 1HSTA 2CWEA 2DQRA 3E5XA 4I01A 4KIBA 1FZPB 3HOSA 3RJPA 1HW2A 5TRDA 2Y48A 1W5TA 5F64A 5ICFA 5IT9Z 5DD8A 3VODA 1XGSA 2XV4S 1HSJA 3JSPA 1R5GA 4UVBA 5LGUA 1QPMA 1HBXG 5DYMA 3QPHA 2HYGD 2COMA 4EJWA 2LSOA 1S7OA 2K4JA 4O5VA 4G6DA 3F23A 1FBSA 3I64A 1BIBA 1R1VA 2F2EA 4LG0B 3ZMUA 2O6GE 2GA1A 1RNLA 2A3SA 2R7DA 1YS7A 4OMYA 2HTJA 1D8JA 1SD7A 2JZYA 3E6DA 2CG4A 4A2UA 2V1XA 4L5JA 2R7FA 1L0OC 3GWZA 2AS5F 2GXGA 2DQLA 1KU3A 3WU0A 1W7PD 3ML6A 3M8EA 5CLSA 1TW2A 2CYYA 1T39A 5LEKA 4TV7A 4MTDA 1TNTA 5IT9K 1IZ1A 4IRGA 2LKPA 2HQRA 1ZLKA 1TQMA 2IA0A 2DW4A 4MHGA 2ZJ2A 3IL2A 2UXNA 2ZNZA 1FNNA 2X0LA 3MEXA 4L9TA 3HSEA 5JI6A 2VBWA 4U88A 2VE8A 4YIFA 3QU3A 5DEQA 3W6JB 4G7HF 2L4AA 3IWZA 2AXLA 2OA4A 2R3SA 2FRHA 4G7OF 2ACJA 2ZXJA 4HBLA 1BI2A 4WWCA 1GHCA 2B0LA 5DV5A 1PDNC 2GA2A 2P5LC 2C6YA 2BGCA 4E70A 2ADUA 4JBAA 4HDUA 2A69F 2KIFA 3ISPA 2DBBA 3DFGA 5DCFA 3EDPA 2XIGA 5D4SA 1WRJA 2DK5A 4M9ZA 3F3XA 4ENKA 1UHWA 1SFEA 2JPBA 2MLKA 4L9JA 2IP2A 4XLPF 3V7CA 3E5UA 4P9FA 3BPVA 4WK8F 2ZO4A 3W6KB 4BQAA 1G3SA 3IC7A 4CHUA 1XMKA 4CYDA 4UXNA 1HQCA 5BQTA 1IW7F 2MH2A 5EEGA 1C0WA 1ZGJA 4IF4A 1F1ZA 2TDXA 4LLNA 1LNWA 4EGZA 3GLXA 1R23A 2JPCA 1R5HA 5BMZA 1E2XA 1BI0A 2W84A 1S7AA 5DDGA 4LJZF 1GVJA 5ILVA 1FPQA 3K2ZA 4ON0A 4Q47A 2F5CA 3BWGA 2P5VA 4RB1A 3L9FA 2JT1A 2F5DA 4CO8A 1GXPA 3F21A 3WGIA 1BOAA 1V4RA 2V1UA 4IRHA 4BHCA 4HF0A 2FNPA 3SFZA 1SAXA 2CGPA 5JR3A 1UFMA 2P7VB 4Q5SF 4S05A 3M7GA 1LEBA 3WTSC 2FBHA 1U5TC 3KLNA 5HS9A 2DFIA 1B9NA 2K4BA 2WWYA 1RUOA 2IT0A 1IXSB 3HHHA 3MFKA 2VODA 3RI4A 1G6NA 4P55A 2KJBA 2QQ9A 2KIMA 2HS5A 4Y17A 3U2RA 1ZRFA 3HYIA 5D5VB 3H3UA 3TKYA 2MLGA 4AVPA 1O3RA 4CDGA 4NQWA 1USSA 3SHFA 4LB5A 1Q1HA 4LB6B 4RAZA 1F9NA 2BEOA 3ZQ7A 4JK1X 4RGRA 1XMAA 3KZZA 1R1UA 3DKWA 2VXZA 1DUXC 2VONA 3WTXC 1E17A 2YU3A 1DPUA 3GZ6A 5BS6A 1P6RA 3F6OA 4FX0A 2FQ3A 3J7AO 3L2CA 3VOEA 2DPUA 2G7UA 2PG4A 5FD5A 3TDUC 1DPRA 1JGSA 1AOYA 1BI1A 1J9IA 3ECOA 5BPDA 3RKYA 3EYYA 3KP2A 3GX4X 3I54A 2D2WA 4OOIA 3GFIA 4A0ZA 4BNCA 4MEYF 1B59A 3CUQB 3R6SA 3GFJA 4M74A 2NAZA 1XGOA 4ASNA 3WTVC 1QZYA 1RZ4A 4L9VA 1IN4A 2V9VA 2QQBA 2FEZA 2CW0F 4OIRF 2DK8A 1Z91A 1CGPA 4UVCA 4DQ2A 4G8XA 4M72A 1LB2A 3F8CA 3MWMA 3HOTA 2VBYA 5L3EA 3SZTA 1LEAA 3KP4A 1JHHA 3LAPA 1KQ9A 3MAJA 3F8BA 4M73A 1I27A 2PQ8A 1QQIA 1W4MA 3GW2A 2RNJA 1FSHA 3CUOA 1P4WA 4HOBA 3V8KA 5AIPA 4KMUX 2W24A 1LJ9A 2ZFWA 2IW5A 2XAQA 1HW1A 5DUIA 4IXAA 1IN5A 1I6XA 2V79A 1UB9A 1V3FA 1REPC 1TQIA 1OMIA 1JE8A 5HDNA 4EJTA 4A5MA 4MQVA 3GVAA 2IA2A 3SXYA 2OQGA 1YS6A 3DV8A 2Z5UA 4EM2A 3RPQA 1S8NA 1YW9A 1H0MA 2UZKA 2IVMA 3RTRA 3BP8A 1ZG5A 4BH9A 1ZAOA 3WTTC 1FYMA 3CUQC 4A5NA 4P5OA 3R0JA 2NNYA 1FOKA 3C18A 1I1SA 4AIHA 4ZZDA 2EFQA 2ZKZA 2STTA 3TDZC 3GFLA 3QP5A 3BROA 3QP6A 1QBJA 1LVAA 4DNCA 2M5WA 5ERIA 4L0ZB 3FHZA 1ON1A 1T2KA 4GYIA 1O7FA 1Z7UA 1J5YA 4PDKA 4L5IA 4CICA 1MJAA 1O3QA 4HYEA 3K1NA 1ONVA 4MNUA 4QWQA 1ON2A 2GXBA 2XASA 2IPQX 3CJNA 4U0VA 4RB0A 4RB3C 3K1MA 3RKXA 3I71A 3M1EA 5D8LB 5E8GA 4HLYA 3E6BA 5K1YA 2A68F 2DI3A 3J80K 2J5OA 2M1BA 4OMZA 2DLLA 4PGGA 2HR3A 3WTYC 1W7PA 3WGHA 3WTWC 3ZP5A 4O3MA 3HIFA 2FMLA 3DEUA 3HRUA 1Z6TA 3BOQA 4KN4X 3BPXA 4PCQA 1HXDA 4ZZLA 2FE3A 1MDMA 5E17F 2L3DA 4FHTA 2LF7A 3LA3A 1YYVA 1IUYA 1FC3A 3IRQA 1JHFA 4KT5C 3JW4A 1FBQA 5F1RA 5IT3A 4B8XA 5ICGA 1LQ1A 3NQOA 4EVIA 2QQAA 2XAHA 2VT3A 4PZJA 2P4WA 3DXJF 3ROUA 1S29A 3HTSB 3COAC 4KA4A 3I58A 4WXDA 3ULQB 4IPAA 1Z9CA 2M87A 4Q4ZF 2QM3A 3KP6A 3O3KA 4ESBA 4A6DA 2MC3A 1HW5A 4QLCU 2CSOA 3F6VA 4GCVA 2ZCWA 3WE2A 4UVAA 1I5ZA 1R7JA 2ISYA 4EMSA 4LK1F 2EFPA 3KLOA 3GUDA 4M9XA 5L3GA 2EB7A 3ZMZA 3U9GA 1YIOA 1FSEA 3G73A 3MZYA 5EEHA 1QGPA 1YFHA 2EFOA 5E1XA 1Y0UA 2PMHA 4PGHA 3RKWA 2RDPA 3LQQA 1FYKA 1RUNA 4F7ZA 3C1DA 3ZPLA 3DPLC 2XRNA 4G6QA 2RC4A 1G4DA 2QVOA 5CVUA 2FBKA 1R36A 5JHUA 4KIGA 1G3YA 3C3WA 3FMQA 2J5PA 2FA5A 3CO7C 3TOAA 2CO5A 2FSWA 3WTZA 3KETA 1U3EM 4AWXB 4ZYEA 4YG2F 4YIIA 2A6EF 2HTSA 3D5LA 1RI7A 2YPRA 5LLQA 4GGGA 5LRSA 3O6BB 4N9HA 3K69A 4I0AA 1H9GA 1B6AA 3TOBA 4P9UA 4H0EA 4HF2A 3LWFA 3GYHX 3S2WA 4U7BA 3WU1B 4OIPF 5L3FA 4EM1A 1FP1D 2RKHA 5DUKA 1MDMB 4HDVA 5FLXK 5ICEA 1YO5C 3CTAA 3FM5A 4XRFA 4UV8A 2P6SA 2HQNA 3ZN1A 1EH7A 2YR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9N A;  4KFC A;  3F8F A;  1KU2 A;  4I2O A;  1PP7 U;  1JXS A;  2CQK A;  5ED4 A;  1ZG1 A;  3BJO A;  1O7L A;  2EJR A;  2STW A;  2HFH A;  1CF7 A;  4FT8 A;  1ZGA A;  4B09 A;  3ERE D;  4U0W A;  1ZG3 A;  1ODD A;  4AIJ A;  5L3B A;  5A2Q Z;  3P7N A;  3K1P A;  5FLX Z;  1HKS A;  1OYI A;  2ESH A;  1S3J A;  3BDD A;  4MQ9 F;  1U5T B;  5H20 A;  1OKR A;  5FD6 A;  5J8F A;  2O3F A;  2FNA A;  1XCV A;  5DD4 A;  1NHA A;  3IWF A;  1FP2 A;  5CVJ A;  1UHM A;  1BN5 A;  1ZRE A;  3PFI A;  1F5T A;  1Z6R A;  3IKV A;  4KN7 X;  5L3C A;  1ZRD A;  5JFR A;  4I98 B;  4UNO A;  2QEN A;  5E1W A;  3PQJ A;  2H94 A;  1O3T A;  1K79 A;  3GEZ A;  2D45 A;  1OYY A;  2ETH A;  3OOP A;  4FX4 A;  5FB2 A;  1KU9 A;  4AD9 A;  3VEP A;  2O0Y A;  2L54 A;  4S04 A;  4KYW A;  3KFW X;  2JTV A;  5J6X A;  4CGZ A;  4RS8 A;  1XGN A;  1A04 A;  3KP3 A;  1KA8 A;  4KMF A;  2BYV E;  3R0A A;  2XKP A;  1IRF A;  1D8K A;  4O6J A;  5H6Q A;  2RVC A;  3Q5F A;  4P96 A;  5K5Q A;  3E97 A;  1K7A A;  3HRT A;  3H92 A;  2ZNY A;  1XDS A;  3HUG A;  5HOO A;  1HKT A;  5HDG A;  4ENM A;  3WOD F;  5LGT A;  3VFZ A;  4RB2 C;  2D1V A;  1YG2 A;  5L3D A;  4IHS A;  4LG0 A;  3T8R A;  4IRI A;  3N4M A;  2K27 A;  3ZN0 A;  2HEO A;  3HTU A;  2V1D A;  3KP7 A;  3Q9V A;  5LHH A;  2PLY A;  3EQL F;  4EM0 B;  4ETS A;  1I1G A;  2HKO A;  4WXH A;  2MH9 A;  1WQ2 A;  5D5U B;  1LDD A;  2IJL A;  5CVV A;  1F4K A;  5ILS A;  3TGN A;  1BC7 C;  2A07 F;  4OIN F;  1FYL A;  2XHK A;  2E7W A;  5LGN A;  2YX4 A;  3JTH A;  3LFK A;  1HKQ A;  3FXR A;  2VBX A;  1T38 A;  3TO6 A;  1X3U A;  2MA3 A;  4OIO F;  1ZAR A;  5HLI A;  1MJ9 A;  3B02 A;  1TQP A;  1BM9 A;  4YFX F;  1U2W A;  4XBF A;  4RGS A;  1QO0 D;  1B1B A;  2EK5 A;  4IVN A;  5HDK A;  2DO7 A;  3DQV C;  3I59 B;  3K9T A;  3V7R A;  4NHJ A;  4M6Y A;  4HX4 A;  2QUF A;  3T1B A;  2Z3Y A;  2ZME A;  2DU9 A;  2L02 A;  2P7C B;  3C7J A;  4IHT A;  1P92 A;  3LST A;  1FX7 A;  3REO A;  5K5R A;  2VC1 A;  3KEO A;  2VBZ A;  3VB2 A;  3BJ6 A;  2DAO A;  4UV9 A;  4EQQ A;  1GXQ A;  3NEU A;  2FF4 A;  1FWZ A;  3H3Z A;  1SMT A;  1WWX A;  3WG9 A;  1XCB A;  1WI9 A;  5J8C A;  2ISZ A;  2M45 A;  5KK1 A;  3WE3 A;  2RGV A;  5HLG A;  5A2Q K;  1R22 A;  3O2P E;  2QLZ A;  1OPC A;  1J59 A;  2RQP A;  2UXX A;  3R61 A;  1D5V A;  1YQA A;  4G9Y A;  2FOK A;  4WF2 A;  3T5X A;  1XSD A;  4ENJ A;  1EH6 A;  3RYR A;  2JRT A;  1FY7 A;  2PMU A;  3L09 A;  2OU2 A;  2DPD A;  1K78 A;  2K7L A;  1O3S A;  2DTR A;  2Z33 A;  4L0Y B;  1SD5 A;  2PI0 A;  2Q2E A;  1IN6 A;  5HLH A;  2BV6 A;  3Q9S A;  5D4R A;  3I59 A;  3I0T A;  4I7H A;  2ZME B;  3FX3 A;  4A6E A;  3D0S A;  2Z99 A;  4NB5 A;  4OIQ F;  4KUM A;  3ZMD A;  1FBU A;  1BI3 A;  2RV8 A;  4RGX A;  2BBY A;  5CYV A;  5LHI A;  4ESJ A;  2GIV A;  2FMY A;  2X4H A;  4EJV A;  1MZB A;  3FF5 A;  2HWV A;  2IA1 A;  5TJJ A;  4A0Y A;  2WV0 A;  1SMY F;  1P4X A;  3KE2 A;  2GZW A;  2M8E A;  3ELK A;  4Y15 A;  3E5Q A;  3L00 A;  4U7D A;  4ZYH A;  3QPT A;  4EV0 A;  2QBY B;  1R58 A;  3U1D A;  1MD0 A;  5D5W B;  1U8R A;  3WTU C;  1P4A A;  4RAY A;  2HKX A;  1SD4 A;  4D0P A;  1RIO H;  1KU7 A;  3ZMV A;  2KKO A;  1STZ A;  3GFM A;  2NNN A;  2GWR A;  3L7W A;  3RDI A;  2HYF A;  2YX7 A;  1G3T A;  4HLX A;  2A5Y B;  1LDK B;  5KVR A;  3GXO A;  2KRF A;  4MTE A;  2OZ6 A;  4LGW A;  1XD7 A;  2HZT A;  1PP8 F;  3LA7 A;  4CZZ A;  4R8H A;  4WXC A;  5ICC A;  4HA8 A;  4KDP A;  2O03 A;  3CUQ A;  1P2F A;  1XSX A;  2XKO A;  4HX8 A;  2W57 A;  1T6S A;  3HRM A;  3F8M A;  4YFN F;  1YW7 A;  1IAW A;  3QOP A;  3I4P A;  3K0L A;  2A61 A;  4OU0 A;  5D5X B;  3JSO A;  3TQN A;  3LQR A;  5HVQ C;  1BBY A;  4HZF A;  1J2X A;  2K86 A;  1KYZ A;  3P9C A;  4KNY A;  4BAY A;  3MCZ A;  3BY6 A;  3FZV A;  2OAZ A;  3V8L A;  3DF8 A;  2A6H F;  1WSU A;  3NRV A;  4M71 A;  1ZRC A;  1IRG A;  2PJP A;  2EA4 A;  4LLG F;  2PFB A;  5BOX A;  1YW8 A;  4WCG A;  2UWM A;  4ZYD A;  4XLN F;  2QWW A;  5D8K B;  1XB4 A;  3MZH A;  2XUB A;  1W5S A;  3I53 A;  5K5O A;  3MQ0 A;  1BJA A;  3KZY A;  2GQQ A;  2VE9 A;  4GYG A;  2PBI A;  1MKM A;  3EET A;  1J75 A;  5F6F A;  1KYW A;  5AON A;  1D3Y A;  3E6M A;  1T0F A;  5BPI A;  4K2E A;  1ZH5 A;  2EV6 A;  4M9S A;  2Y75 A;  3I5U A;  2EV5 A;  2ZBK A;  3KP5 A;  4Z2Y A;  2OBP A;  1K78 B;  3G3Z A;  4XSX F;  5LBQ A;  3F72 A;  2XGX A;  2VOP A;  3GZ5 A;  1K6O A;  6PAX A;  2RN7 A;  5D6E A;  4MGR A;  4L18 B;  5LRR A;  2LF8 A;  1IXR C;  4ZYG A;  3TO9 A;  3CDH A;  1EV7 A;  1ZYR F;  3IKT A;  2ELH A;  2G9W A;  2W25 A;  5DCM A;  2EFW A;  2O61 A;  2FBI A;  3GO5 A;  2P8T A;  3FM3 A;  4LD5 A;  4A12 A;  1MGT A;  1CF7 B;  3QU6 A;  3CLO A;  1R1T A;  1DDN A;  4BHB A;  4JQF A;  2EFN A;  1UST A;  1ZLJ A;  2KJC A;  2XAJ A;  1G3W A;  5FFX A;  4HV5 A;  2OQR A;  2VN2 A;  4LLL A;  5ILU A;  3JAM Z;  3FXQ A;  1YLF A;  1SFX A;  1XGM A;  3P9I A;  1ULY A;  4Q48 A;  5LHG A;  1AWC A;  2H6B A;  5JVT A;  2P6T A;  4I09 A;  1UCR A;  3CO6 C;  4HW0 A;  2LDU A;  4XSZ F;  1TTY A;  5E20 A;  4EGY A;  1QZZ A;  3RIR A;  1QNT A;  2EA2 A;  3P9K A;  1IN8 A;  1MJB A;  3AAF A;  3JAM K;  3R4K A;  4N0B A;  2D1H A;  4UHT A;  4BXU A;  1TLH B;  4ESF A;  3JTG A;  4IJA A;  3BJA A;  1U5T A;  5CVR A;  2FXA A;  5D6F A;  2HDC A;  2KIU A;  2OD5 A;  3E6C C;  2HGC A;  1U78 A;  3E3V A;  5HS7 A;  3EYI A;  4ENN A;  2WTE A;  4G94 A;  3B73 A;  4HV6 A;  2H6C A;  1L3L A;  2PEX A;  2QZ8 A;  1W7P B;  2IRF G;  4KIF A;  2JSC A;  2MBF A;  1XN7 A;  5E18 F;  5E1Z B;  2EV0 A;  3LA2 A;  4WX9 A;  4YFK F;  2NRA C;  5H6R A;  1O57 A;  4BHP A;  2QYO A;  3FMS A;  1PUE E;  2CFX A;  2ESN A;  4I0B A;  1U6G A;  1B9M A;  5LEJ A;  2P5K A;  2Q0O A;  4A0X A;  1J0R A;  4MEX F;  3ZMS A;  3M9A A;  4ZH4 F;  1EH8 A;  2VOO A;  1Z1D A;  1T98 A;  3KCC A;  2Z9O A;  5HS8 A;  2H09 A;  1Z05 A;  1BIA A;  3T0Y A;  2VT2 A;  1BC8 C;  4HQE A;  1OR7 A;  2M30 A;  1ZN2 A;  3N97 A;  1J7K A;  3RPU A;  2NS0 A;  1S6L A;  2V6C A;  1FLI A;  4RGU A;  4U0Y A;  2HOE A;  4AIK A;  3V8J A;  4I02 A;  2WC2 A;  3RYP A;  3IHU A;  1IXC A;  1TW3 A;  1WKM A;  2DT5 A;  4GXO A;  2XAF A;  1FT9 A;  3SZP A;  4M6X A;  5CVI A;  1OYW A;  4R79 A;  1B4A A;  3ABT A;  5FGM A;  2H27 A;  1XDU A;  3TO7 A;  3J80 Z;  3F22 A;  2EWN A;  2XRO A;  3HSF A;  2G7H A;  3WGG A;  4HQM A;  2GAU A;  5DCM B;  5FO5 A;  2MD5 A;  1KQ8 A;  2L01 A;  1DP7 P;  3M8F A;  2K02 A;  5AIQ A;  1YTY A;  4GO1 A;  3DPT A;  3V7S A;  4EJO A;  3F8N A;  3T8T A;  1IF1 A;  3FMR A;  1XSV A;  5E8I A;  2YSR A;  5FFZ A;  2F5E A;  4BYY A;  4CXF A;  2O8X A;  3V4G A;  4N9I A;  4R1H A;  1R00 A;  2LNB A;  3ABU A;  3IRR A;  4UUV A;  4G7Z F;  3LAJ A;  3OV8 A;  1TBX A;  2W85 A;  3HSR A;  3QRF F;  1IN7 A;  2OZU A;  2Y0M A;  2PN6 A;  3FWE A;  3ECH A;  3HHG A;  3J81 Z;  3KEQ A;  3HRS A;  5CJ9 A;  1LDJ A;  1ZHF A;  1KQ0 A;  3BZ6 A;  2XVC A;  3FXU A;  4HX7 A;  2E1C A;  2L4M A;  1TNS A;  3EUH A;  3SQN A;  4HF1 A;  1SD6 A;  2QBY A;  2XAG A;  3ZMT A;  4HAM A;  3DP7 A;  2BE5 F;  4Y13 A;  2FU4 A;  2E7X A;  1SFU A;  1KGS A;  4LK0 F;  3J81 K;  2E1N A;  3R60 A;  4LFU A;  2F5F A;  1H9T A;  2VC0 A;  4KIC A;  4EJU A;  2NYX A;  1VTN C;  3GF2 A;  2Q8K A;  4LMY A;  3QAH A;  3PQK A;  1HST A;  2CWE A;  2DQR A;  3E5X A;  4I01 A;  4KIB A;  1FZP B;  3HOS A;  3RJP A;  1HW2 A;  5TRD A;  2Y48 A;  1W5T A;  5F64 A;  5ICF A;  5IT9 Z;  5DD8 A;  3VOD A;  1XGS A;  2XV4 S;  1HSJ A;  3JSP A;  1R5G A;  4UVB A;  5LGU A;  1QPM A;  1HBX G;  5DYM A;  3QPH A;  2HYG D;  2COM A;  4EJW A;  2LSO A;  1S7O A;  2K4J A;  4O5V A;  4G6D A;  3F23 A;  1FBS A;  3I64 A;  1BIB A;  1R1V A;  2F2E A;  4LG0 B;  3ZMU A;  2O6G E;  2GA1 A;  1RNL A;  2A3S A;  2R7D A;  1YS7 A;  4OMY A;  2HTJ A;  1D8J A;  1SD7 A;  2JZY A;  3E6D A;  2CG4 A;  4A2U A;  2V1X A;  4L5J A;  2R7F A;  1L0O C;  3GWZ A;  2AS5 F;  2GXG A;  2DQL A;  1KU3 A;  3WU0 A;  1W7P D;  3ML6 A;  3M8E A;  5CLS A;  1TW2 A;  2CYY A;  1T39 A;  5LEK A;  4TV7 A;  4MTD A;  1TNT A;  5IT9 K;  1IZ1 A;  4IRG A;  2LKP A;  2HQR A;  1ZLK A;  1TQM A;  2IA0 A;  2DW4 A;  4MHG A;  2ZJ2 A;  3IL2 A;  2UXN A;  2ZNZ A;  1FNN A;  2X0L A;  3MEX A;  4L9T A;  3HSE A;  5JI6 A;  2VBW A;  4U88 A;  2VE8 A;  4YIF A;  3QU3 A;  5DEQ A;  3W6J B;  4G7H F;  2L4A A;  3IWZ A;  2AXL A;  2OA4 A;  2R3S A;  2FRH A;  4G7O F;  2ACJ A;  2ZXJ A;  4HBL A;  1BI2 A;  4WWC A;  1GHC A;  2B0L A;  5DV5 A;  1PDN C;  2GA2 A;  2P5L C;  2C6Y A;  2BGC A;  4E70 A;  2ADU A;  4JBA A;  4HDU A;  2A69 F;  2KIF A;  3ISP A;  2DBB A;  3DFG A;  5DCF A;  3EDP A;  2XIG A;  5D4S A;  1WRJ A;  2DK5 A;  4M9Z A;  3F3X A;  4ENK A;  1UHW A;  1SFE A;  2JPB A;  2MLK A;  4L9J A;  2IP2 A;  4XLP F;  3V7C A;  3E5U A;  4P9F A;  3BPV A;  4WK8 F;  2ZO4 A;  3W6K B;  4BQA A;  1G3S A;  3IC7 A;  4CHU A;  1XMK A;  4CYD A;  4UXN A;  1HQC A;  5BQT A;  1IW7 F;  2MH2 A;  5EEG A;  1C0W A;  1ZGJ A;  4IF4 A;  1F1Z A;  2TDX A;  4LLN A;  1LNW A;  4EGZ A;  3GLX A;  1R23 A;  2JPC A;  1R5H A;  5BMZ A;  1E2X A;  1BI0 A;  2W84 A;  1S7A A;  5DDG A;  4LJZ F;  1GVJ A;  5ILV A;  1FPQ A;  3K2Z A;  4ON0 A;  4Q47 A;  2F5C A;  3BWG A;  2P5V A;  4RB1 A;  3L9F A;  2JT1 A;  2F5D A;  4CO8 A;  1GXP A;  3F21 A;  3WGI A;  1BOA A;  1V4R A;  2V1U A;  4IRH A;  4BHC A;  4HF0 A;  2FNP A;  3SFZ A;  1SAX A;  2CGP A;  5JR3 A;  1UFM A;  2P7V B;  4Q5S F;  4S05 A;  3M7G A;  1LEB A;  3WTS C;  2FBH A;  1U5T C;  3KLN A;  5HS9 A;  2DFI A;  1B9N A;  2K4B A;  2WWY A;  1RUO A;  2IT0 A;  1IXS B;  3HHH A;  3MFK A;  2VOD A;  3RI4 A;  1G6N A;  4P55 A;  2KJB A;  2QQ9 A;  2KIM A;  2HS5 A;  4Y17 A;  3U2R A;  1ZRF A;  3HYI A;  5D5V B;  3H3U A;  3TKY A;  2MLG A;  4AVP A;  1O3R A;  4CDG A;  4NQW A;  1USS A;  3SHF A;  4LB5 A;  1Q1H A;  4LB6 B;  4RAZ A;  1F9N A;  2BEO A;  3ZQ7 A;  4JK1 X;  4RGR A;  1XMA A;  3KZZ A;  1R1U A;  3DKW A;  2VXZ A;  1DUX C;  2VON A;  3WTX C;  1E17 A;  2YU3 A;  1DPU A;  3GZ6 A;  5BS6 A;  1P6R A;  3F6O A;  4FX0 A;  2FQ3 A;  3J7A O;  3L2C A;  3VOE A;  2DPU A;  2G7U A;  2PG4 A;  5FD5 A;  3TDU C;  1DPR A;  1JGS A;  1AOY A;  1BI1 A;  1J9I A;  3ECO A;  5BPD A;  3RKY A;  3EYY A;  3KP2 A;  3GX4 X;  3I54 A;  2D2W A;  4OOI A;  3GFI A;  4A0Z A;  4BNC A;  4MEY F;  1B59 A;  3CUQ B;  3R6S A;  3GFJ A;  4M74 A;  2NAZ A;  1XGO A;  4ASN A;  3WTV C;  1QZY A;  1RZ4 A;  4L9V A;  1IN4 A;  2V9V A;  2QQB A;  2FEZ A;  2CW0 F;  4OIR F;  2DK8 A;  1Z91 A;  1CGP A;  4UVC A;  4DQ2 A;  4G8X A;  4M72 A;  1LB2 A;  3F8C A;  3MWM A;  3HOT A;  2VBY A;  5L3E A;  3SZT A;  1LEA A;  3KP4 A;  1JHH A;  3LAP A;  1KQ9 A;  3MAJ A;  3F8B A;  4M73 A;  1I27 A;  2PQ8 A;  1QQI A;  1W4M A;  3GW2 A;  2RNJ A;  1FSH A;  3CUO A;  1P4W A;  4HOB A;  3V8K A;  5AIP A;  4KMU X;  2W24 A;  1LJ9 A;  2ZFW A;  2IW5 A;  2XAQ A;  1HW1 A;  5DUI A;  4IXA A;  1IN5 A;  1I6X A;  2V79 A;  1UB9 A;  1V3F A;  1REP C;  1TQI A;  1OMI A;  1JE8 A;  5HDN A;  4EJT A;  4A5M A;  4MQV A;  3GVA A;  2IA2 A;  3SXY A;  2OQG A;  1YS6 A;  3DV8 A;  2Z5U A;  4EM2 A;  3RPQ A;  1S8N A;  1YW9 A;  1H0M A;  2UZK A;  2IVM A;  3RTR A;  3BP8 A;  1ZG5 A;  4BH9 A;  1ZAO A;  3WTT C;  1FYM A;  3CUQ C;  4A5N A;  4P5O A;  3R0J A;  2NNY A;  1FOK A;  3C18 A;  1I1S A;  4AIH A;  4ZZD A;  2EFQ A;  2ZKZ A;  2STT A;  3TDZ C;  3GFL A;  3QP5 A;  3BRO A;  3QP6 A;  1QBJ A;  1LVA A;  4DNC A;  2M5W A;  5ERI A;  4L0Z B;  3FHZ A;  1ON1 A;  1T2K A;  4GYI A;  1O7F A;  1Z7U A;  1J5Y A;  4PDK A;  4L5I A;  4CIC A;  1MJA A;  1O3Q A;  4HYE A;  3K1N A;  1ONV A;  4MNU A;  4QWQ A;  1ON2 A;  2GXB A;  2XAS A;  2IPQ X;  3CJN A;  4U0V A;  4RB0 A;  4RB3 C;  3K1M A;  3RKX A;  3I71 A;  3M1E A;  5D8L B;  5E8G A;  4HLY A;  3E6B A;  5K1Y A;  2A68 F;  2DI3 A;  3J80 K;  2J5O A;  2M1B A;  4OMZ A;  2DLL A;  4PGG A;  2HR3 A;  3WTY C;  1W7P A;  3WGH A;  3WTW C;  3ZP5 A;  4O3M A;  3HIF A;  2FML A;  3DEU A;  3HRU A;  1Z6T A;  3BOQ A;  4KN4 X;  3BPX A;  4PCQ A;  1HXD A;  4ZZL A;  2FE3 A;  1MDM A;  5E17 F;  2L3D A;  4FHT A;  2LF7 A;  3LA3 A;  1YYV A;  1IUY A;  1FC3 A;  3IRQ A;  1JHF A;  4KT5 C;  3JW4 A;  1FBQ A;  5F1R A;  5IT3 A;  4B8X A;  5ICG A;  1LQ1 A;  3NQO A;  4EVI A;  2QQA A;  2XAH A;  2VT3 A;  4PZJ A;  2P4W A;  3DXJ F;  3ROU A;  1S29 A;  3HTS B;  3COA C;  4KA4 A;  3I58 A;  4WXD A;  3ULQ B;  4IPA A;  1Z9C A;  2M87 A;  4Q4Z F;  2QM3 A;  3KP6 A;  3O3K A;  4ESB A;  4A6D A;  2MC3 A;  1HW5 A;  4QLC U;  2CSO A;  3F6V A;  4GCV A;  2ZCW A;  3WE2 A;  4UVA A;  1I5Z A;  1R7J A;  2ISY A;  4EMS A;  4LK1 F;  2EFP A;  3KLO A;  3GUD A;  4M9X A;  5L3G A;  2EB7 A;  3ZMZ A;  3U9G A;  1YIO A;  1FSE A;  3G73 A;  3MZY A;  5EEH A;  1QGP A;  1YFH A;  2EFO A;  5E1X A;  1Y0U A;  2PMH A;  4PGH A;  3RKW A;  2RDP A;  3LQQ A;  1FYK A;  1RUN A;  4F7Z A;  3C1D A;  3ZPL A;  3DPL C;  2XRN A;  4G6Q A;  2RC4 A;  1G4D A;  2QVO A;  5CVU A;  2FBK A;  1R36 A;  5JHU A;  4KIG A;  1G3Y A;  3C3W A;  3FMQ A;  2J5P A;  2FA5 A;  3CO7 C;  3TOA A;  2CO5 A;  2FSW A;  3WTZ A;  3KET A;  1U3E M;  4AWX B;  4ZYE A;  4YG2 F;  4YII A;  2A6E F;  2HTS A;  3D5L A;  1RI7 A;  2YPR A;  5LLQ A;  4GGG A;  5LRS A;  3O6B B;  4N9H A;  3K69 A;  4I0A A;  1H9G A;  1B6A A;  3TOB A;  4P9U A;  4H0E A;  4HF2 A;  3LWF A;  3GYH X;  3S2W A;  4U7B A;  3WU1 B;  4OIP F;  5L3F A;  4EM1 A;  1FP1 D;  2RKH A;  5DUK A;  1MDM B;  4HDV A;  5FLX K;  5ICE A;  1YO5 C;  3CTA A;  3FM5 A;  4XRF A;  4UV8 A;  2P6S A;  2HQN A;  3ZN1 A;  1EH7 A;  2YR2 A; 
#chains in the Genus database with same CATH topology
 4L9N A;  4KFC A;  4HG2 A;  3F8F A;  2I5U A;  1KU2 A;  4I2O A;  2MSY A;  3BR5 A;  1PP7 U;  4Z6Y A;  2QF7 A;  1JXS A;  4XLF A;  5CQG A;  2CQK A;  5ED4 A;  4PUS A;  2VLA A;  1ZG1 A;  3DBH B;  3BJO A;  2V7F A;  1O7L A;  3FHN A;  4IZZ A;  2EJR A;  2JWT A;  1RET A;  4A3K J;  2STW A;  2HFH A;  3FKJ A;  4FT8 A;  1CF7 A;  1ZGA A;  4B09 A;  3ERE D;  3LSJ A;  4BL0 B;  2BW3 B;  4BE2 A;  2NS7 A;  4U0W A;  1ZG3 A;  2JRM A;  1ODD A;  4XKB A;  5L3B A;  4AIJ A;  4KIS A;  3HKZ N;  5A2Q Z;  2OUM A;  3P7N A;  3S14 J;  3K1P A;  4BJ5 C;  5FLX Z;  2EQR A;  4QSH A;  4II3 A;  1HKS A;  1OYI A;  2ESH A;  5HNH A;  1S3J A;  1UHS A;  3BDD A;  4MQ9 F;  5BNG A;  2R5Y A;  1U5T B;  2NVQ J;  5H20 A;  4ZDL A;  1OKR A;  5FD6 A;  1B72 A;  3ZQC A;  1X3Z B;  3U1K A;  5J8F A;  2O3F A;  2FNA A;  1XCV A;  5DD4 A;  5E79 C;  3S15 J;  1NHA A;  1N75 A;  1FP2 A;  2E1M C;  3IWF A;  5CVJ A;  1UHM A;  3CCE I;  2NOG A;  1BN5 A;  1ZRE A;  3PFI A;  1A31 A;  3DTI A;  2IAI A;  2IBD A;  2F4I A;  4HST A;  1F5T A;  1Z6R A;  3IKV A;  4KN7 X;  3ASN H;  4DJA A;  5L3C A;  1I3A A;  1ZRD A;  5JFR A;  4I98 B;  4UNO A;  2QEN A;  2R7U A;  2E2I J;  5E1W A;  3PQJ A;  2H94 A;  1O3T A;  3S16 J;  3DLL F;  1T56 A;  4IHY A;  3BZC A;  1K79 A;  3VWB A;  3GEZ A;  2ZJP F;  2K40 A;  2D45 A;  1OYY A;  2ETH A;  3OOP A;  4FX4 A;  5FB2 A;  1KU9 A;  5K7Z A;  4AD9 A;  3K4J A;  3VEP A;  2O0Y A;  2WY8 Q;  1POG A;  4GFB A;  1R4M B;  2L54 A;  1UG2 A;  4S04 A;  4KYW A;  2V9P A;  3KFW X;  1SAN A;  2JTV A;  4XM3 A;  5J6X A;  1BR4 A;  3SZG A;  4CGZ A;  2F5V A;  2WB1 A;  4RS8 A;  1HLV A;  2Z16 A;  1XGN A;  4IX7 A;  1MBJ A;  3MMY B;  3ZR8 X;  2DN0 A;  3S1R J;  2VUM J;  1JUS A;  1A04 A;  3KP3 A;  1TP4 A;  1KA8 A;  4DYC A;  2Y69 H;  4KMF A;  2B63 J;  4RLQ A;  2XF6 A;  4KIT B;  2BYV E;  3R0A A;  4EEF G;  1NH3 A;  2IEK A;  3KIO A;  2XKP A;  1IRF A;  1D8K A;  2DA1 A;  2KRC A;  4BAC A;  3OIQ A;  4O6J A;  5J4V A;  1EJ9 A;  5H6Q A;  2RVC A;  2DJI A;  3IH2 A;  3Q5F A;  4P96 A;  1D0Y A;  5K5Q A;  2BOL A;  3E97 A;  1K7A A;  2E2H J;  3CCY A;  3HRT A;  3H92 A;  2ZNY A;  1XDS A;  3HUG A;  4C3J J;  5HOO A;  4AC0 A;  1BL0 A;  1W0T A;  1HKT A;  1YOV B;  4OWR B;  5HDG A;  3WOD F;  4ENM A;  5LGT A;  3VFZ A;  4RB2 C;  2R5Y B;  1GV2 A;  2QSF X;  2R7W A;  2D1V A;  1YG2 A;  5L3D A;  4IHS A;  2UV1 A;  4LG0 A;  1QZE A;  1XG1 A;  1B72 B;  3T8R A;  4IRI A;  4XMY A;  4BU2 A;  3N4M A;  1MBF A;  2K27 A;  1MND A;  4C2U A;  3ZN0 A;  2HEO A;  2CUE A;  3HTU A;  2V1D A;  2LP0 A;  4L5E A;  1JTY A;  3KP7 A;  3Q9V A;  3D5R C;  2KP6 A;  5LHH A;  4FE4 A;  2PLY A;  3EQL F;  4EM0 B;  2EZL A;  4ETS A;  1I1G A;  3B6A A;  2HKO A;  4WXH A;  5IP7 J;  2MH9 A;  5J1U A;  5LD2 C;  1WQ2 A;  5D5U B;  4IHV A;  1LDD A;  2IJL A;  2R7O A;  2Y30 A;  4PJ0 C;  2ZXW H;  2CUF A;  5CVV A;  1TWF J;  1MMG A;  3CCL I;  2CH0 A;  4E7J A;  1F4K A;  1HA8 A;  1EKE A;  5ILS A;  3TGN A;  2E2J J;  1BC7 C;  2A07 F;  3QOE A;  4OIN F;  4BXF A;  4ZJZ A;  1YX3 A;  1ETY A;  2LG4 A;  1FYL A;  2XHK A;  2E7W A;  2ME6 A;  5LGN A;  2YX4 A;  3JTH A;  2JVG A;  4V2F A;  3OYH A;  2LBF B;  4CCN A;  3FDY A;  3BLY A;  3LFK A;  1HKQ A;  2VPL A;  1Z7L A;  3PUF A;  3DEE A;  3X2Q H;  3DKY A;  1DQU A;  3FXR A;  1DU0 A;  1NG6 A;  2VBX A;  2DJN A;  1VQL I;  1T38 A;  3TO6 A;  1VQ8 I;  4GDF A;  1X3U A;  2R93 J;  1MBH A;  3K7A J;  1IV8 A;  1R4N B;  2CUJ A;  2MA3 A;  2ZXI A;  4OIO F;  4E4H A;  3CF2 A;  1Z0X A;  1Y39 A;  1ZAR A;  5HLI A;  1MJ9 A;  1WGX A;  1TQP A;  3B02 A;  3Q3S A;  2LY9 A;  1BM9 A;  2BXY A;  4YFX F;  1U2W A;  4XBF A;  1KZH A;  2E34 A;  3L2Q A;  2K9M A;  3DU6 A;  2JSP A;  1X4O A;  4RGS A;  1QO0 D;  1B1B A;  2EK5 A;  3BR6 A;  4IVN A;  5HDK A;  1OCR H;  1XC5 A;  3CME I;  4OAY A;  3HUG B;  2DO7 A;  3DQV C;  3I59 B;  3K9T A;  3V7R A;  4FAS D;  4NHJ A;  5FLM J;  4M6Y A;  4HX4 A;  5KCM A;  5JLW A;  2QUF A;  5KNL A;  3C2G A;  3T1B A;  2Z3Y A;  2ZME A;  2ZJR F;  4IEJ A;  2DU9 A;  2L02 A;  2VKH A;  4UB8 C;  2P7C B;  2CU7 A;  3C7J A;  1W36 C;  1WJB A;  4IHT A;  2EIK H;  1ORK A;  4CH7 A;  1P92 A;  3LST A;  1FX7 A;  3REO A;  3W2A A;  3OWT A;  2XSJ C;  5K5R A;  2VC1 A;  3OYB A;  2E71 A;  3KEO A;  4IOA F;  2VBZ A;  4NC8 A;  4XL9 A;  3VB2 A;  3BJ6 A;  2DAO A;  3RQI A;  3ABM H;  4LIT A;  4UV9 A;  4CCM A;  5FLV A;  4EQQ A;  3CMY A;  2ZB9 A;  1A6I A;  1GXQ A;  2WAF A;  2HDD A;  3NEU A;  4B1R A;  4RM2 A;  3SDB A;  2FF4 A;  3CJQ B;  4RLF A;  1FWZ A;  3H3Z A;  4ANJ A;  2XDV A;  3S2D J;  1SMT A;  4N4O B;  1WWX A;  3WG9 A;  1XCB A;  1WI9 A;  5J8C A;  2ISZ A;  2M45 A;  4E7Z A;  5KK1 A;  3WE3 A;  4Y7N J;  3PSF A;  4A3J J;  2RGV A;  2ZSH B;  3TP3 A;  1I3Q J;  2DA5 A;  1JKO C;  5HLG A;  1DGW Y;  5A2Q K;  1QRY A;  1R22 A;  2HU9 A;  2IGK A;  1IC8 A;  2Y2Z A;  3O2P E;  2K5C A;  2QLZ A;  1HCR A;  1OPC A;  1J59 A;  2VKE A;  2RQP A;  2UXX A;  3I9V 2;  3R61 A;  5HOD A;  1D5V A;  3HOW J;  1YQA A;  4BBR J;  4G9Y A;  3OYE A;  2FOK A;  4WF2 A;  5IYD J;  3T5X A;  1XSD A;  4H4K C;  2KFD A;  3DWL E;  1EH6 A;  3RYR A;  4ENJ A;  3HEF A;  2JRT A;  1FOW A;  1FY7 A;  2PMU A;  1Y8R B;  3L09 A;  4A3L J;  2OU2 A;  1MIJ A;  1ETV A;  1GLN A;  2VPR A;  2DPD A;  2O9L A;  1K78 A;  2K7L A;  1O3S A;  2DTR A;  2Z33 A;  4L0Y B;  4XOR A;  1SD5 A;  2PI0 A;  2EIL H;  5DM7 F;  2Q2E A;  3LSH A;  1X3W B;  2DT6 A;  1IN6 A;  2O8K A;  5HLH A;  9ANT A;  2BV6 A;  2A6T A;  3GLL A;  4MIM A;  3Q9S A;  3S1M J;  3PUB A;  3K4N A;  5D4R A;  1GUU A;  2V1N A;  2EH3 A;  3I59 A;  3I0T A;  2K9S A;  3JRF A;  4I7H A;  1X2M A;  3LNQ A;  3K70 D;  4E6K G;  3PNV A;  1MBG A;  2ZME B;  3FX3 A;  4A6E A;  2HPM A;  2P0W A;  3PFY A;  2VQL A;  3CCU I;  3D0S A;  2Z99 A;  4AM3 A;  2V26 A;  2ZC2 A;  3KZI C;  4NB5 A;  1QVU A;  4CA0 A;  1OQY A;  4B48 A;  4OIQ F;  4KUM A;  3ZMD A;  4DYR A;  1FBU A;  1BI3 A;  2RV8 A;  4RGX A;  3HOZ J;  2VAS A;  5E3N A;  1V55 H;  1JKQ C;  2BBY A;  3RSN A;  2MW8 A;  5CYV A;  5LHI A;  4ESJ A;  2GIV A;  3UR3 C;  3Q0U A;  2FMY A;  2X4H A;  4EJV A;  1MZB A;  3FF5 A;  2HWV A;  2IA1 A;  5TJJ A;  4E7H A;  3A1Y A;  1YRN A;  3L2R A;  4FE7 A;  4XOP A;  3OL4 A;  4BDZ A;  2W7N A;  3TMO A;  4A0Y A;  2WV0 A;  1SMY F;  1FMW A;  1N78 A;  1P4X A;  3KE2 A;  1S5L C;  2GZW A;  1MSE C;  2ECC A;  2QQ8 A;  2M8E A;  4B4C A;  3ELK A;  3E0J B;  4Y15 A;  3E5Q A;  3L00 A;  4U7D A;  2R7T A;  4ZYH A;  3QPT A;  5H2F C;  3ABL H;  1IRX A;  4EV0 A;  2H1K A;  2QBY B;  1R58 A;  1Y0N A;  3U1D A;  4DGW B;  1MD0 A;  4DZJ A;  1T8I A;  1WJD A;  5D5W B;  3VYR B;  1VFC A;  3WTU C;  1U8R A;  3OYL A;  1P4A A;  2MFZ A;  4RAY A;  3G6E I;  2HKX A;  1SD4 A;  2MD0 A;  4D0P A;  1RIO H;  1KU7 A;  3ZMV A;  4XR6 A;  5DTD A;  2KKO A;  1STZ A;  3GFM A;  2ID3 A;  1VQ9 I;  2NNN A;  2GWR A;  1JTX A;  3L7W A;  3RDI A;  2HYF A;  2YX7 A;  2PX9 A;  1G3T A;  4HLX A;  2A5Y B;  2WAD A;  1LDK B;  3RCO A;  2X6Y A;  3A01 A;  5KVR A;  2P81 A;  4D7M A;  1WJF A;  3GXO A;  2KRF A;  5E3L A;  1DGR M;  2H8R A;  4MTE A;  2OZ6 A;  2K85 A;  1XD7 A;  4LGW A;  4D9J A;  2HZT A;  4CCL A;  1PP8 F;  3LA7 A;  2HZD A;  4DBR A;  4CZZ A;  4R8H A;  4WXC A;  5ICC A;  3KYD B;  3M4O J;  4HA8 A;  2D5V A;  4B47 A;  4KDP A;  1ACI A;  3ESW B;  2O03 A;  3CUQ A;  1P2F A;  1XSX A;  2XKO A;  4CYC B;  4HX8 A;  2XSD C;  1G8X A;  2O5R A;  3I4N J;  4BJT A;  2W57 A;  1VQ6 I;  1T6S A;  3HRM A;  2IXS A;  3F8M A;  4YFN F;  1YW7 A;  1IAW A;  3RKQ A;  3QOP A;  3I4P A;  4QTR A;  2VJ4 A;  1W5C C;  1BR2 A;  3K0L A;  2A61 A;  2WV1 A;  1H88 C;  2X1E A;  3WHB A;  2IGM A;  4JP0 A;  4E7L A;  4OU0 A;  5D5X B;  3JSO A;  4BXX J;  3TQN A;  3LQR A;  2DMN A;  1BBY A;  3K6G A;  4M6V A;  4P1W A;  5HVQ C;  4ITV A;  4HZF A;  1RES A;  4IHX A;  3JRA A;  1J2X A;  2K86 A;  1KYZ A;  2XB0 X;  3RZO J;  2WA0 A;  4UUS B;  4AID A;  2HQ5 A;  4JYK A;  5GTH C;  3P9C A;  1T0F C;  2Z2S B;  4KNY A;  4BAY A;  2H1L A;  1BR1 A;  3S32 A;  2TCT A;  3MCZ A;  3BY6 A;  3FZV A;  2OAZ A;  4XK4 A;  2VQH A;  3V8L A;  3DF8 A;  2A6H F;  1TT0 A;  1WSU A;  3NRV A;  4RMN A;  4BEH B;  4YIR X;  4M71 A;  1YHQ I;  1ZRC A;  1K4T A;  3V42 A;  1IRG A;  1IDY A;  1YJ9 I;  2PJP A;  4MLO A;  3SEZ A;  1UEL B;  5GAG J;  3OS2 A;  1PUF B;  2EA4 A;  1RR7 A;  4LLG F;  2PFB A;  4I99 C;  1OFC X;  3CDI A;  2R5Z A;  2A05 A;  5BOX A;  1YW8 A;  1YI2 I;  4WCG A;  2UWM A;  4IHW A;  4ZYD A;  4XLN F;  1TWA J;  2QWW A;  5D8K B;  1AHD P;  3E1S A;  1XB4 A;  3MZH A;  2XUB A;  1S72 I;  1W5S A;  3I53 A;  4D5F A;  2L9N A;  3MQ0 A;  2WAQ N;  5K5O A;  2XB5 A;  1MH4 A;  3OYC A;  1BJA A;  3KZY A;  2GQQ A;  3H5R A;  4RAG A;  5FRM A;  2VE9 A;  4GYG A;  2KQR A;  2PBI A;  1MKM A;  3TED A;  3EET A;  1J75 A;  5F6F A;  1ENH A;  1DP3 A;  1KYW A;  5AON A;  2BVM A;  1D3Y A;  3BZK A;  3OYG A;  4M3B A;  1FIP A;  3OYK A;  3G2B A;  4W97 A;  3E6M A;  1T0F A;  1OCT C;  5BPI A;  4K2E A;  1ZH5 A;  2EV6 A;  2KHM A;  2X1D A;  4UUT A;  4M9S A;  2Y75 A;  4I6Z A;  3I5U A;  1APL C;  1JUP A;  1O4X A;  2EV5 A;  2ZBK A;  3FK7 A;  3D1N I;  1IJW C;  4BS9 A;  5IY5 H;  3KP5 A;  4Z2Y A;  2DOF A;  3H36 A;  1ZKG A;  2OBP A;  1K78 B;  2QSG X;  3NAR A;  3G3Z A;  4XSX F;  3GZN B;  2XGC A;  5LBQ A;  3F72 A;  2JMW A;  2CUZ A;  2HYJ A;  2XGX A;  2VOP A;  3GZ5 A;  5FRO A;  1K6O A;  2M34 A;  3BR3 A;  6PAX A;  4QPO A;  2RN7 A;  5D6E A;  4MGR A;  4L18 B;  5LRR A;  3S17 J;  2BHY A;  2LF8 A;  1IXR C;  4UUS A;  4UB6 C;  3P5J A;  5J3L A;  4ZYG A;  3TO9 A;  3CDH A;  1NTC A;  2MC4 A;  1EV7 A;  1ZYR F;  1A5J A;  3IKT A;  2ELH A;  2G9W A;  2W25 A;  3OIO A;  5DCM A;  2EFW A;  2O61 A;  4GRI A;  2FBI A;  3GO5 A;  3H0D A;  2P8T A;  3FM3 A;  3HJE A;  1JKP C;  4BEH A;  4LD5 A;  2AHQ A;  3PIO F;  1MGT A;  4A12 A;  1AKH A;  1NK2 P;  5EDN A;  2R7Q A;  3QU6 A;  1CF7 B;  2CQQ A;  2ICW G;  2LK2 A;  3CLO A;  4AU7 A;  1R1T A;  1DDN A;  4BHB A;  4JQF A;  3CC7 I;  2EFN A;  5C4X J;  1UST A;  3AG3 H;  2XPW A;  1ZLJ A;  2KJC A;  5EJC A;  3HBL A;  2K3F A;  3H9G A;  2XAJ A;  1G3W A;  3G4S I;  2COB A;  4U87 A;  1QA6 A;  5FFX A;  4HV5 A;  2OQR A;  2VN2 A;  4LLL A;  5ILU A;  4BY7 J;  3JAM Z;  3S3O A;  1U9O A;  3FXQ A;  3BTI A;  3DEW A;  4Y3O A;  3SYT A;  5C3E J;  1R71 A;  3WHC A;  1SFX A;  1XGM A;  1YLF A;  3P9I A;  1ULY A;  4Q48 A;  1FJL A;  5GP9 A;  5LHG A;  1AWC A;  2ZME C;  2MGQ A;  3QQA A;  4BQQ A;  2H6B A;  5DM6 F;  1TT5 B;  3AG4 H;  5JVT A;  3FBN B;  1QU3 A;  2P6T A;  4I09 A;  5E3M A;  1UCR A;  3CO6 C;  4HW0 A;  2LDU A;  4XSZ F;  4V19 K;  1W36 D;  1RR8 C;  3PL8 A;  3CCJ I;  1HDP A;  1U0J A;  1TTY A;  4DBQ A;  5E20 A;  2L7F P;  4EGY A;  5EF6 A;  4A3B J;  1QZZ A;  4XON A;  2KZV A;  2JA5 J;  3RIR A;  1QNT A;  1EF4 A;  1FEX A;  3JRD A;  1OR7 C;  2EA2 A;  5C4J J;  3P9K A;  3LOC A;  3AG2 H;  1YIT I;  1IN8 A;  1MJB A;  3AAF A;  5F1J A;  3JAM K;  3R4K A;  4J19 A;  4N0B A;  2D1H A;  2HOS A;  4UHT A;  3ZQH A;  1TLH B;  3H35 A;  4BXU A;  4ESF A;  3JTG A;  4IJA A;  3BJA A;  1U5T A;  5CVR A;  2CQ7 A;  3BG9 A;  2CS3 A;  2FXA A;  5D6F A;  1ETK A;  2NVY J;  2HDC A;  4BY1 J;  2KIU A;  4PFP A;  2KDO A;  1X58 A;  1V5E A;  2HGC A;  2OD5 A;  2W4S A;  3E6C C;  2IGO A;  1U78 A;  4BUP A;  4I76 A;  2KZG A;  3K4K A;  3E3V A;  1GV5 A;  5HS7 A;  3EYI A;  2M7A A;  4A93 J;  1ETW A;  4ENN A;  2WTE A;  4G94 A;  3K10 A;  4II2 A;  2BZT A;  1WJC A;  3B73 A;  4HV6 A;  3ONQ A;  4PJJ A;  2H6C A;  1L3L A;  2PEX A;  2QZ8 A;  2LBF A;  2OCC H;  1W7P B;  3VYU B;  2IRF G;  2ZJQ F;  2IS2 A;  1ZQ3 P;  4KIF A;  2JSC A;  1JI8 A;  2MBF A;  4X0G A;  1TWG J;  1XN7 A;  5E18 F;  5E1Z B;  2EV0 A;  3LA2 A;  4NQW B;  4WX9 A;  1E0E A;  1JT6 A;  4YFK F;  2XF7 A;  2OTJ I;  4B44 A;  2NRA C;  2OC6 A;  5H6R A;  3MKZ A;  3LSK A;  1H89 C;  1O57 A;  5GAD J;  3AKZ A;  2VI6 A;  4BHP A;  4BE1 A;  4XIC A;  2JA7 J;  2QSH X;  1R6R A;  2QYO A;  3FMS A;  2IGN A;  4C2M J;  1KON A;  1PUE E;  1MNM C;  3W2V A;  2BY2 A;  2CFX A;  4NDL A;  2ESN A;  3ZQG A;  5F04 A;  4PJL A;  2LH9 A;  2LR8 A;  4XLE A;  4I0B A;  1U6G A;  2E1O A;  1B9M A;  2DYR H;  5LEJ A;  2F4O B;  2P5K A;  4QIW N;  3JCU C;  5K7F A;  2Q0O A;  4A0X A;  1J0R A;  2R4G A;  4MEX F;  1F43 A;  2XC7 A;  3AG1 H;  4XRM A;  4XLA A;  2JA2 A;  3PNT A;  3ZQI A;  2NXN B;  3ZMS A;  3M9A A;  2ELJ A;  4M3E A;  2Z1D A;  2EBI A;  2FOW A;  5GPA A;  4JX4 A;  4ZH4 F;  1EH8 A;  3JRG A;  3LFU A;  1P9Q C;  2VOO A;  1ZTR A;  1Z1D A;  3ZQL A;  3LSI A;  4C3H J;  1T98 A;  4Y4R A;  3KCC A;  2M0M A;  2X51 A;  3LL7 A;  2Z9O A;  5HS8 A;  2H09 A;  1Z05 A;  3L2U A;  1BIA A;  1Y56 A;  3DPU A;  3A0H C;  3T0Y A;  2VT2 A;  4HQE A;  1BC8 C;  2L7K A;  1OR7 A;  2M30 A;  3BR0 A;  1K4S A;  1ZN2 A;  3N97 A;  4NNJ A;  1J7K A;  3RPU A;  2NS0 A;  1S6L A;  2V6C A;  3TP0 A;  1FLI A;  3BQY A;  3ABK H;  4RGU A;  3CJR B;  5GTI C;  4U0Y A;  2HOE A;  4AIK A;  3V8J A;  4I02 A;  1K6Y A;  1Y1V J;  3OYA A;  2WC2 A;  3RYP A;  3IHU A;  1IXC A;  3H9Q A;  1TW3 A;  1WKM A;  2DT5 A;  3HGG A;  4GXO A;  2PMZ A;  4BKX A;  2XAF A;  5EYR A;  2L5Q A;  3FXL A;  5FKO A;  1FT9 A;  3SZP A;  2DA2 A;  4M6X A;  5CVI A;  1WPK A;  1OYW A;  4MO7 A;  1MMA A;  4R79 A;  3OY9 A;  1B4A A;  3ABT A;  4ZYA A;  5FGM A;  5IPA A;  2H27 A;  3GTM J;  3OYM A;  1XDU A;  2HQA A;  4BQO A;  3TO7 A;  2LLK A;  3J80 Z;  3DBL B;  1Y8Q B;  2HXI A;  2E19 A;  3F22 A;  2EWN A;  2XRO A;  3HSF A;  3U21 A;  2G7H A;  3WGG A;  4HQM A;  3TL4 X;  2GAU A;  4RAF A;  2VL8 A;  5DCM B;  5FO5 A;  2AO9 A;  2VKD A;  2CFO A;  3PNY A;  2VKV A;  1F36 A;  2MD5 A;  3OR1 C;  1KQ8 A;  2L01 A;  2M4G A;  1AKH B;  1DP7 P;  3HPH A;  3LSP A;  3IUO A;  3M8F A;  1WCM J;  2K02 A;  3AFH A;  5AIQ A;  1YTY A;  4NBQ A;  3ZGK A;  4GO1 A;  3DPT A;  3V7S A;  2JA6 J;  5IOY A;  2R7X A;  1JUM A;  4EJO A;  4A3D J;  3TW7 A;  3F8N A;  3T8T A;  3CJT B;  4XRS A;  5J4Y A;  3FMR A;  1IF1 A;  2X1C A;  1XSV A;  5E8I A;  1PJR A;  2YSR A;  4A3G J;  1K61 A;  4M3G A;  2M7B A;  4E7S A;  5FFZ A;  2F5E A;  1ZR2 A;  4BDY A;  1M1E B;  1V5F A;  5KHD A;  2M9H A;  4BYY A;  4CXF A;  2O8X A;  3V4G A;  4N9I A;  4R1H A;  5M5Y J;  1R00 A;  2LNB A;  3ABU A;  3IRR A;  4IKF A;  1WZ2 A;  2CQN A;  4UUV A;  4G7Z F;  3G1M A;  3LAJ A;  5CPR B;  1T08 B;  2ME0 A;  3OV8 A;  1TBX A;  2O7O A;  4A69 C;  2W85 A;  3ZOB A;  5FKK A;  2BXZ A;  3OSG A;  4LIV A;  2RRE A;  3HSR A;  2X48 A;  3QRF F;  1HOM A;  4LG3 A;  3IV5 A;  1IN7 A;  1YX5 A;  2OZU A;  2Y0M A;  2PN6 A;  1D5Y A;  1B8I A;  3HGY A;  3HHG A;  3ECH A;  3FWE A;  2Q1Z B;  1AA7 A;  2MG4 A;  3J81 Z;  4RBO A;  3KEQ A;  3NAU A;  4XQF A;  4FET A;  2ECB A;  3HRS A;  5CJ9 A;  1LDJ A;  1TL8 A;  1ZHF A;  3H1C A;  3CMM A;  3GTO J;  1KQ0 A;  2M2E A;  3BZ6 A;  5IYC J;  3CCV I;  2XVC A;  3FXU A;  2VQC A;  4HX7 A;  2LY2 A;  4A3C J;  2E1C A;  2L4M A;  1TNS A;  3EUH A;  3SQN A;  4HF1 A;  1SD6 A;  2QBY A;  2XAG A;  5GAE J;  1OIS A;  2X85 A;  3ZMT A;  4HAM A;  2FJ1 A;  2BE5 F;  3DP7 A;  1SVL A;  1D1A A;  2X9D A;  3BG3 A;  4Y52 J;  4Y13 A;  1MH3 A;  1UG0 A;  3G71 I;  2FU4 A;  2RQQ A;  3PJR A;  2E7X A;  2OV7 A;  2JUC A;  5IP9 J;  3S93 A;  1VI0 A;  4FTH A;  1D1B A;  2BY3 A;  1SFU A;  2BVL A;  1KGS A;  4LK0 F;  3J81 K;  2IS6 A;  2E1N A;  2AXT C;  3EUK L;  3A03 A;  3R60 A;  5J40 A;  3OL3 A;  4LFU A;  2F5F A;  5KAF C;  1H9T A;  4F55 A;  1X1C A;  2VC0 A;  1NG7 A;  1WVR A;  5M3F J;  2QKM B;  4KIC A;  3PM1 A;  4EJU A;  2NYX A;  2KRH A;  1VTN C;  1YRN B;  3GF2 A;  2Q8K A;  2YU9 J;  4LMY A;  4FQG A;  3QAH A;  4ZDP A;  5F27 A;  3PQK A;  2F6C A;  1HST A;  1LFU P;  2DDB A;  2DYS H;  1JGG A;  1Z77 A;  2CWE A;  3PIP F;  2DQR A;  5J1Y A;  3E5X A;  4I01 A;  4KIB A;  1FZP B;  3HOS A;  3RJP A;  1HW2 A;  5TRD A;  2Y48 A;  2MAB A;  1LVK A;  1W5T A;  4V2G A;  5F64 A;  5ICF A;  1TC3 C;  5IT9 Z;  1VQ4 I;  5DD8 A;  3VOD A;  1XGS A;  2XV4 S;  1HSJ A;  4BJ6 C;  1WH7 A;  2L7Z A;  4HPQ A;  1R5I D;  3JSP A;  1X1B A;  1R5G A;  4UVB A;  2XGD A;  3KYC B;  5IP6 A;  5EGO B;  2TRT A;  2GOX B;  5LGU A;  2CJJ A;  2PMZ N;  2DXI A;  2I8D A;  1DU6 A;  4JOM A;  1QPM A;  5M3M J;  1HBX G;  1OLT A;  3LSM A;  2F4M B;  5DYM A;  2EZK A;  3QPH A;  4DOZ A;  2HYG D;  2COM A;  4EJW A;  2LSO A;  3HKZ A;  3A02 A;  1S7O A;  2BY0 A;  3PO2 J;  2K4J A;  1OCZ H;  2EPF A;  4O5V A;  3VSL A;  4G6D A;  3F23 A;  2LTP A;  1FBS A;  3I64 A;  1BIB A;  1R1V A;  1Z3X A;  2F2E A;  1A36 A;  2CV2 A;  3JRC A;  4X1E A;  3ZMU A;  2O6G E;  4LG0 B;  2V6E A;  1N25 A;  2GA1 A;  3L1P A;  4DIQ A;  4BE0 A;  1R9T J;  3JRH A;  1RNL A;  2A3S A;  2R7D A;  1YS7 A;  4OMY A;  2HTJ A;  2GIZ A;  3PO3 J;  1D8J A;  1FOX A;  3CES A;  2WAQ A;  3W6V A;  4PJN A;  2QEX I;  3VYT B;  3OOU A;  2VQG A;  1VQO I;  1SD7 A;  2VJ5 A;  4ZTF A;  2JZY A;  3E6D A;  3HOY J;  2CG4 A;  3KPH A;  4A2U A;  3DLA A;  4XNF A;  2V1X A;  4L5J A;  4FCY A;  2AQF A;  5JLX A;  4G6T B;  4A3M J;  2R7F A;  3G1L A;  2PJR A;  2DA6 A;  1L0O C;  2K9L A;  3DCF A;  4AYB A;  2Y9Y A;  1J09 A;  3GCM A;  3FXK A;  1HF0 A;  1Z67 A;  4HNV A;  3GWZ A;  2AS5 F;  2GXG A;  2DQL A;  1KU3 A;  2EIJ H;  2KPM A;  3K4M A;  3WU0 A;  1W7P D;  2OTL I;  3DU5 A;  3N05 A;  3ML6 A;  3M8E A;  4NUB A;  5CLS A;  1QHG A;  4F92 B;  1TW2 A;  1S7E A;  2CYY A;  1T39 A;  5LEK A;  4TV7 A;  4MTD A;  1TNT A;  5IT9 K;  3JR9 A;  1IZ1 A;  2IS4 A;  2JJ7 A;  4PK4 A;  1B8I B;  4IRG A;  1E3P A;  2LKP A;  2HQR A;  1ZLK A;  1TQM A;  5B1B H;  3SFI A;  2IA0 A;  2DW4 A;  4MHG A;  2ZJ2 A;  3IL2 A;  3MVP A;  2UXN A;  3K2A A;  2ZNZ A;  1FNN A;  2X0L A;  3MEX A;  4L9T A;  1G59 A;  3HSE A;  5JI6 A;  2VBW A;  4U88 A;  1IGN A;  1W0U A;  2VE8 A;  4OAZ A;  4YIF A;  3QU3 A;  5DEQ A;  3W6J B;  2L4A A;  4G7H F;  3IWZ A;  3VYS B;  2AXL A;  1H8A C;  2OA4 A;  2R3S A;  3F0C A;  2FRH A;  2HVS A;  4XRS G;  1CQT A;  2CMP A;  3BCA A;  4G7O F;  3QYB A;  2R7V A;  2ACJ A;  2ZXJ A;  3H5A A;  5TIS C;  4HBL A;  1BI2 A;  3A4C A;  3Q0V A;  1LE8 A;  1FTZ A;  1Y6I A;  4WWC A;  1GHC A;  2B0L A;  1LFP A;  5DV5 A;  1PDN C;  3L2W A;  2GA2 A;  2X6X A;  2P5L C;  3OS1 A;  2C6Y A;  2BGC A;  4E70 A;  2ADU A;  2HXO A;  4JBA A;  4HDU A;  4AVZ A;  4UY8 I;  1TWH J;  5CKT A;  2A69 F;  2DFF A;  3FXJ A;  3GTQ J;  3HOV J;  4KT6 A;  2KIF A;  2Y9Z A;  3ISP A;  2DBB A;  4M3D A;  3DFG A;  2X6W A;  4B43 A;  4A3I J;  5DCF A;  1RKT A;  3EDP A;  4F52 A;  2XIG A;  4XKV A;  5D4S A;  1WRJ A;  2DK5 A;  4M9Z A;  3F3X A;  3CCQ I;  4ENK A;  4F3Q A;  1UHW A;  1SFE A;  2JPB A;  2MLK A;  3GBG A;  4L9J A;  2KMU A;  2IP2 A;  4XLP F;  2M3A A;  3V7C A;  3E5U A;  4P9F A;  2HPI A;  3BPV A;  4WK8 F;  3TW6 A;  2ZO4 A;  3W6K B;  4BQA A;  1G3S A;  3IC7 A;  2R5Z B;  1ETX A;  4CHU A;  1XMK A;  4CYD A;  1QVT A;  4UXN A;  1HQC A;  1LPQ A;  3IAM 2;  5FKN A;  5BQT A;  2QKL B;  1IW7 F;  2M0C A;  2LRE A;  2MH2 A;  5EEG A;  1I39 A;  5FKL A;  1C0W A;  1ZGJ A;  4YRV A;  4IF4 A;  2XPU A;  2DDA A;  2E5N A;  1F1Z A;  2TDX A;  3J7A Y;  3GTG J;  4LLN A;  3KEY A;  5TGT A;  3BQZ A;  2BW3 A;  5EZG A;  1LNW A;  4DYQ A;  4EGZ A;  4KJZ A;  5B5E C;  3BCB A;  1VQN I;  3CCM I;  3LMM A;  3GLX A;  1R23 A;  2WY7 Q;  2JPC A;  3I56 I;  1XMX A;  3CZ6 A;  1U9N A;  4E7I A;  1R5H A;  5BMZ A;  3ZXS A;  1E2X A;  1BI0 A;  2W84 A;  1IDZ A;  2LYC A;  5CQE A;  1S7A A;  5DDG A;  4LJZ F;  3GTJ J;  1GVJ A;  5ILV A;  1FPQ A;  3K2Z A;  4AUX A;  4ON0 A;  1WH5 A;  4Q47 A;  4XLC A;  1I6H J;  2F5C A;  3BWG A;  2QGU A;  2P5V A;  5FJ8 J;  4RB1 A;  4F93 B;  3W2W A;  2DCE A;  3L9F A;  1D1C A;  2CW8 A;  2N8G A;  3IH4 A;  2NVU B;  2JT1 A;  1A35 A;  2DFH A;  2F5D A;  4CO8 A;  1GXP A;  2DT7 B;  1OJL A;  3F21 A;  2GLO A;  3AL0 C;  2EIN H;  2DOD A;  2VXD A;  3UKG A;  3WGI A;  1BOA A;  1V4R A;  4HSR A;  4HNU A;  1SVM A;  2W82 A;  2V1U A;  5EGO A;  4IRH A;  2KIQ A;  3IAS 2;  4HF0 A;  4BHC A;  2FNP A;  1BW6 A;  3SFZ A;  1SAX A;  4IQ4 A;  3JRB A;  5M5X J;  3A2K A;  3S8P A;  2CGP A;  1WJ5 A;  3OYF A;  5JR3 A;  3K4B A;  1XPX A;  2X6O A;  2CV1 A;  1UFM A;  2P7V B;  2Q2E B;  4Q5S F;  3B6C A;  4S05 A;  2LKX A;  2E36 A;  1ZR4 A;  3M7G A;  1Z21 A;  1MMD A;  3MKY B;  1LEB A;  1MNE A;  3WTS C;  2W48 A;  2XF5 A;  2FBH A;  1SFK A;  1U5T C;  3KLN A;  5HS9 A;  3C2H A;  3OYD A;  3CLQ A;  2DFI A;  1B9N A;  3M8J A;  4MFE A;  2K4B A;  3CMA I;  2WWY A;  1RUO A;  2IT0 A;  1VQ5 I;  1IXS B;  1FOY A;  2EZI A;  3HHH A;  2EZH A;  1IRZ A;  3MFK A;  2VOD A;  3FIW A;  2DTZ A;  3RI4 A;  1G6N A;  3DKX A;  2LOO A;  4P55 A;  2KJB A;  2QQ9 A;  2KIM A;  2HS5 A;  4Y17 A;  3U2R A;  2DA7 A;  3MZ8 A;  1ZRF A;  2L9V A;  2WB1 N;  3HYI A;  5D5V B;  3H3U A;  3L2V A;  3TKY A;  2MLG A;  1HC8 A;  4AVP A;  1O3R A;  4CDG A;  4NQW A;  3RQ4 A;  1USS A;  3SHF A;  1XX5 A;  4LB5 A;  3CC2 I;  2L7M P;  1Q1H A;  4LB6 B;  4J00 A;  3ZQF A;  4F91 B;  1ZK8 A;  4RAZ A;  1F9N A;  5EEA A;  2BEO A;  3OR2 C;  3ZQ7 A;  3EUH C;  4JK1 X;  4RGR A;  4HNT A;  1XMA A;  3KZZ A;  1R1U A;  3DKW A;  1JJ6 C;  2VXZ A;  1MBE A;  4ZTJ A;  1YJN I;  1ETO A;  3MN2 A;  1DUX C;  2HOT A;  2VON A;  3QOD A;  3WTX C;  3VPR A;  2JN6 A;  3EUA A;  1E17 A;  2YU3 A;  1DPU A;  3GZ6 A;  3ZRG A;  5BS6 A;  1P6R A;  2W00 A;  2WAE A;  3F6O A;  4FX0 A;  1VQP I;  2FQ3 A;  3ZCO A;  1WJE A;  2NVX J;  3D5S C;  1FTT A;  1BA5 A;  3J7A O;  4PJM A;  3L2C A;  3VOE A;  1VQ7 I;  4DZP A;  5FRN A;  2DPU A;  2G7U A;  2PG4 A;  5FD5 A;  3QYE A;  3TDU C;  5F08 A;  2LRD A;  4RA2 A;  1DPR A;  1JGS A;  3OS0 A;  1AOY A;  1BI1 A;  1J9I A;  2K3P A;  4Y33 A;  3ECO A;  2GM4 A;  3AL0 B;  5BPD A;  2DMT A;  2ELK A;  4IOC F;  5KAI C;  3RKY A;  3OYN A;  4XID A;  3EYY A;  3KP2 A;  5HNF A;  3MD2 A;  3GX4 X;  3I54 A;  2D2W A;  2CQX A;  4NC6 A;  2GXA A;  4OOI A;  2UUZ A;  3LSG A;  4LIU A;  3GFI A;  4CCK A;  1WI3 A;  4A0Z A;  4BNC A;  1MBK A;  4MEY F;  1B59 A;  3CUQ B;  3R6S A;  2MYS A;  3GFJ A;  4M74 A;  3M3Y J;  2NAZ A;  1RRJ A;  1XGO A;  4ASN A;  5B66 C;  3WTV C;  1QZY A;  1RZ4 A;  1T33 A;  4L9V A;  3BG6 A;  1IN4 A;  3TBI A;  3ERM A;  2V9V A;  2QQB A;  3M07 A;  2FEZ A;  5F0C A;  2CW0 F;  4OIR F;  2K9N A;  2JUG A;  1TWC J;  3ZQQ A;  3GTP J;  2DK8 A;  1MSF C;  1PUF A;  1Z91 A;  4CSW A;  1GVD A;  2DMQ A;  1CGP A;  4UVC A;  4DQ2 A;  4G8X A;  4M72 A;  2V4J C;  1IV6 A;  1LB2 A;  3F8C A;  3MWM A;  3HOT A;  1IG7 A;  2VBY A;  3BT9 A;  5L3E A;  3SZT A;  4NC7 A;  2E5Z A;  3BG5 A;  2IS1 A;  2L2O A;  1IO2 A;  1SFO J;  5FKM A;  4HEA 2;  1LEA A;  3IH3 A;  1V5G A;  3GTL J;  1SC7 A;  1X19 A;  3KP4 A;  3E7L A;  1JHH A;  5K7H A;  4M3F A;  3CCS I;  5JVG F;  3A0B C;  3LAP A;  3CC4 I;  1KQ9 A;  3KX2 A;  1VND A;  3MAJ A;  1Y1W J;  1P7I A;  4XOT A;  3F8B A;  4M73 A;  2FX0 A;  1X1P A;  2HVQ A;  3CDL A;  1EA3 A;  1I27 A;  2HDW A;  2PQ8 A;  2VIX A;  1QQI A;  1UMQ A;  3LSR A;  1W4M A;  3OYJ A;  2OPT A;  3GW2 A;  4HRI A;  3HPG A;  2WBM A;  1ITY A;  2M4K A;  2OCE A;  3BR2 A;  2H8W A;  3Q0W A;  1D0Z A;  2RNJ A;  1A6Q A;  1FSH A;  3CUO A;  4D5C A;  1QPI A;  3S1Q J;  1P4W A;  4HOB A;  4PSX A;  3V8K A;  5AIP A;  2JQ7 A;  4KMU X;  3FIS A;  3JRI A;  1TZL A;  2W24 A;  1LJ9 A;  2E1M B;  2ZFW A;  2IW5 A;  4FIS A;  2XAQ A;  1HW1 A;  5DUI A;  2QA4 I;  4IXA A;  1IN5 A;  1I6X A;  1BJZ A;  5LFA A;  2V79 A;  1UB9 A;  2GOM A;  1V3F A;  5DS9 A;  2DOE A;  1REP C;  1TQI A;  1OMI A;  1JE8 A;  5HDN A;  4DW6 A;  4X6A J;  2OF7 A;  3W3C A;  1SAU A;  3K4C A;  4A5M A;  4EJT A;  4MQV A;  3FBI B;  3GVA A;  2VJJ A;  1NK3 P;  2IA2 A;  3SXY A;  2OQG A;  1YS6 A;  1OCP A;  3DV8 A;  2B7E A;  2Z5U A;  3UNG C;  1BOB A;  1WJA A;  2HNH A;  2DMU A;  1MW7 A;  4D7N A;  3RPQ A;  4EM2 A;  2OJE D;  4ZC3 A;  1S8N A;  1YW9 A;  1H0M A;  2UZK A;  3CCR I;  3K4L A;  2IVM A;  3RTR A;  2KDZ A;  3BP8 A;  1ZG5 A;  1U8B A;  1JJ8 C;  4BH9 A;  1ZAO A;  3WTT C;  1X4P A;  2DOA A;  5F0F A;  1FYM A;  2KT0 A;  3CUQ C;  4A5N A;  2LKS A;  4P5O A;  3R0J A;  4CCO A;  2NNY A;  1FOK A;  3C18 A;  1Q1V A;  3OMY A;  1I1S A;  4B3X A;  1Z3Y A;  1MMN A;  2VJI A;  4AIH A;  2JA8 J;  4ZZD A;  2EFQ A;  2CRG A;  2LFB A;  5J47 A;  3WU2 C;  1ZEL A;  2ZKZ A;  2STT A;  1E3O C;  3TDZ C;  5IYB J;  3SJM A;  3PSI A;  3H9J A;  3GFL A;  3QP5 A;  1QHH D;  3FKI J;  4C9Y A;  1FIA A;  2NS8 A;  2NOJ B;  4EAT A;  3BRO A;  3QP6 A;  1QBJ A;  1LVA A;  1GDT A;  4C3I J;  4DNC A;  2LD5 A;  5B1A H;  2M5W A;  3DTK A;  5ERI A;  4L0Z B;  1VF9 A;  3FHZ A;  3HZJ A;  1ON1 A;  3QPS A;  1T2K A;  4GYI A;  1O7F A;  1Z7U A;  1J5Y A;  3HB9 A;  4PDK A;  1R49 A;  2I10 A;  2E35 A;  2ID6 A;  4L5I A;  4CIC A;  3GTK J;  1MJA A;  1O3Q A;  2YUS A;  3HG9 A;  3VSK A;  3CP8 A;  4AYB N;  4HYE A;  3K1N A;  1ONV A;  3CF5 F;  4MNU A;  2HI3 A;  4N4N B;  4QWQ A;  1ON2 A;  2GXB A;  2XAS A;  2JK3 A;  4QPQ A;  2YS9 A;  2IPQ X;  3CJN A;  3NWT A;  4U0V A;  3WG7 H;  3OIP A;  4RB0 A;  3IP4 B;  4RB3 C;  1LUJ B;  2PJR B;  4CZC A;  1SVO A;  3K1M A;  3RKX A;  3I71 A;  3M1E A;  5EG0 B;  2Y0S N;  5D8L B;  5E8G A;  1YE9 A;  4HLY A;  2KLO A;  2BY1 A;  3BR1 A;  2HOA A;  4A3E J;  3E6B A;  5K1Y A;  2A68 F;  3CQZ J;  4BBS J;  3FXM A;  3GME A;  2DI3 A;  4BQN A;  2CW7 A;  2JVH A;  4YEL A;  2RAE A;  3J80 K;  2AQE A;  3S3N A;  3O8G A;  4IL6 C;  2J5O A;  2M1B A;  4OMZ A;  5GAH J;  2DLL A;  4PGG A;  3RPU D;  2HR3 A;  1XTA A;  3WTY C;  3H5N A;  1W7P A;  3G1O A;  4XLH A;  4XKW A;  3WGH A;  1E3H A;  3WTW C;  1RC9 A;  3ZP5 A;  4O3M A;  3HIF A;  2FML A;  2ZXH A;  3OSF A;  3EPZ A;  3DEU A;  2V9K A;  2HVR A;  3HRU A;  3HXL A;  1Z6T A;  3SEQ A;  3BOQ A;  1WHU A;  3QYF A;  5IOZ A;  2LVS A;  3I4M J;  4KN4 X;  3BPX A;  2RNG A;  3HDD A;  4PCQ A;  3H0G J;  1HXD A;  4A3F J;  2XPV A;  2CV0 A;  4XKC A;  3BC8 A;  4MFD A;  2DA4 A;  2XAU A;  4CCJ A;  4C30 A;  1OCO H;  2FE3 A;  4ZZL A;  1MDM A;  2L3D A;  5E17 F;  4FHT A;  1LE8 B;  3S3M A;  2LF7 A;  3LA3 A;  1YYV A;  3HOX J;  1FMV A;  1IUY A;  1FC3 A;  3M1C A;  4CUG A;  1JHF A;  4KT5 C;  1X2N A;  3IRQ A;  3JW4 A;  5JHF A;  1FBQ A;  3S2H J;  1X1A A;  4BGD A;  4XN3 A;  5F1R A;  2M8G X;  4J01 A;  5IT3 A;  3DBR B;  1RKW A;  4B8X A;  5ICG A;  1LQ1 A;  3NQO A;  4EVI A;  2QQA A;  2XAH A;  2VT3 A;  3O8H A;  4PZJ A;  4RDU A;  2P4W A;  4RM3 A;  5B3S H;  2L9S A;  3DXJ F;  3DTE A;  5GPC A;  3BTJ A;  1I50 J;  1YIJ I;  1T95 A;  3ROU A;  2L0K A;  1S29 A;  1VQK I;  1IUF A;  3HTS B;  3COA C;  2A5W A;  3ASO H;  3A01 B;  4KA4 A;  3I58 A;  4WXD A;  3ULQ B;  1UJ8 A;  4IPA A;  1Z9C A;  2M87 A;  3FXO A;  1LFB A;  3S1N J;  4Q4Z F;  2QM3 A;  3KP6 A;  3O3K A;  2FQ4 A;  2L9R A;  4ESB A;  1S9H A;  4A6D A;  3BTL A;  2MC3 A;  2EIM H;  1LKX A;  3F9K A;  4YEJ A;  4CYC A;  1HW5 A;  2QCO A;  4QLC U;  1UAA A;  2W1O A;  2CSO A;  3F6V A;  1OCC H;  4GCV A;  5E3O A;  1GT0 C;  2ZCW A;  3WE2 A;  4UVA A;  1I5Z A;  2DA3 A;  2R92 J;  4IO9 F;  1R7J A;  4PFO A;  2ISY A;  4G12 A;  2R7S A;  5EZH A;  4EMS A;  4LK1 F;  2EFP A;  1UZC A;  1K83 J;  2E60 A;  3KLO A;  3RZD J;  2NVT J;  2LY1 A;  3GUD A;  4M9X A;  5L3G A;  3OYI A;  2EB7 A;  1WFX A;  3ZMZ A;  3U9G A;  5J1R A;  1YJW I;  1YIO A;  1VZ0 A;  2F48 A;  4E7K A;  1PYV A;  1FSE A;  2FD5 A;  4JX5 A;  3G73 A;  3MZY A;  2GBY A;  1HDD C;  2G0E A;  5EEH A;  3NWS A;  1D0X A;  1QGP A;  1YFH A;  2EFO A;  5E1X A;  1Y0U A;  2KIS A;  2PMH A;  1VQM I;  4PGH A;  2K9Q A;  3RKW A;  1G2H A;  2RDP A;  2BHZ A;  3FK6 A;  3LQQ A;  3MKL A;  5M5W J;  1FYK A;  1RUN A;  4F7Z A;  3C1D A;  3ZPL A;  4S0H B;  3DPL C;  2XRN A;  4G6Q A;  4C2T A;  2RC4 A;  1G4D A;  1SEU A;  2QVO A;  5CVU A;  2B9S A;  2FBK A;  1W1W E;  1R36 A;  3HC7 A;  4LOC A;  5JHU A;  4KIG A;  1G3Y A;  3C3W A;  3FMQ A;  1V54 H;  2J5P A;  2LC2 A;  2FA5 A;  3CO7 C;  3TOA A;  4ABZ A;  2CO5 A;  5EG0 A;  2FSW A;  3WTZ A;  4IQJ A;  2XRL A;  3KET A;  5F0H A;  1U3E M;  1BW5 A;  4AWX B;  4ZYE A;  4YG2 F;  3K70 C;  1N77 A;  4YII A;  3I3L A;  3QPL A;  2A6E F;  2HTS A;  3D5L A;  1RI7 A;  2YPR A;  5LLQ A;  4GGG A;  5LRS A;  4PSW A;  2DMP A;  3O6B B;  4N9H A;  2Y31 A;  3K69 A;  4I0A A;  1H9G A;  1B6A A;  1P7J A;  1RPW A;  3TOB A;  4P9U A;  2ZSI B;  3I55 I;  3H3V K;  3JRE A;  1ZGW A;  1AU7 A;  4H0E A;  3HOU J;  4HF2 A;  1MMS A;  3MKW B;  3LWF A;  3J7Y J;  5C44 J;  3HL2 A;  1ETQ A;  3GYH X;  1JKR C;  3VDX A;  2DFE A;  2VB6 A;  4B3A A;  2LMD A;  2R0Q C;  3BG7 A;  4ZDO A;  2KL4 A;  3S2W A;  3CD6 I;  4U7B A;  3WU1 B;  3CP2 A;  4OIP F;  3SDG A;  5L3F A;  4EM1 A;  1FP1 D;  5HLT A;  1JT0 A;  4XN0 A;  1ERD A;  2RKH A;  4W1U A;  5DUK A;  1MDM B;  1PVE A;  4HDV A;  2FUG 2;  1XS9 A;  5FLX K;  5ICE A;  2XGE A;  2Y0S A;  1YO5 C;  2R7Z J;  3HM5 A;  3CTA A;  3FM5 A;  4XRF A;  2R7R A;  4UV8 A;  3KYL A;  2P6S A;  2HQN A;  3ZN1 A;  3QWL A;  3C2B A;  3BTC A;  4D1Q A;  2ZFU A;  1EH7 A;  4JX6 A;  3J7Z I;  2YR2 A;  1X1D A; 
#chains in the Genus database with same CATH homology
 4L9N A;  4KFC A;  3F8F A;  1KU2 A;  4I2O A;  1PP7 U;  1JXS A;  2CQK A;  5ED4 A;  1ZG1 A;  3BJO A;  1O7L A;  2EJR A;  2STW A;  2HFH A;  1CF7 A;  4FT8 A;  1ZGA A;  4B09 A;  3ERE D;  4U0W A;  1ZG3 A;  1ODD A;  4AIJ A;  5L3B A;  5A2Q Z;  3P7N A;  3K1P A;  5FLX Z;  1HKS A;  1OYI A;  2ESH A;  1S3J A;  3BDD A;  4MQ9 F;  1U5T B;  5H20 A;  1OKR A;  5FD6 A;  5J8F A;  2O3F A;  2FNA A;  1XCV A;  5DD4 A;  1NHA A;  3IWF A;  1FP2 A;  5CVJ A;  1UHM A;  1BN5 A;  1ZRE A;  3PFI A;  1F5T A;  1Z6R A;  3IKV A;  4KN7 X;  5L3C A;  1ZRD A;  5JFR A;  4I98 B;  4UNO A;  2QEN A;  5E1W A;  3PQJ A;  2H94 A;  1O3T A;  1K79 A;  3GEZ A;  2D45 A;  1OYY A;  2ETH A;  3OOP A;  4FX4 A;  5FB2 A;  1KU9 A;  4AD9 A;  3VEP A;  2O0Y A;  2L54 A;  4S04 A;  4KYW A;  3KFW X;  2JTV A;  5J6X A;  4CGZ A;  4RS8 A;  1XGN A;  1A04 A;  3KP3 A;  1KA8 A;  4KMF A;  2BYV E;  3R0A A;  2XKP A;  1IRF A;  1D8K A;  4O6J A;  5H6Q A;  2RVC A;  3Q5F A;  4P96 A;  5K5Q A;  3E97 A;  1K7A A;  3HRT A;  3H92 A;  2ZNY A;  1XDS A;  3HUG A;  5HOO A;  1HKT A;  5HDG A;  4ENM A;  3WOD F;  5LGT A;  3VFZ A;  4RB2 C;  2D1V A;  1YG2 A;  5L3D A;  4IHS A;  4LG0 A;  3T8R A;  4IRI A;  3N4M A;  2K27 A;  3ZN0 A;  2HEO A;  3HTU A;  2V1D A;  3KP7 A;  3Q9V A;  5LHH A;  2PLY A;  3EQL F;  4EM0 B;  4ETS A;  1I1G A;  2HKO A;  4WXH A;  2MH9 A;  1WQ2 A;  5D5U B;  1LDD A;  2IJL A;  5CVV A;  1F4K A;  5ILS A;  3TGN A;  1BC7 C;  2A07 F;  4OIN F;  1FYL A;  2XHK A;  2E7W A;  5LGN A;  2YX4 A;  3JTH A;  3LFK A;  1HKQ A;  3FXR A;  2VBX A;  1T38 A;  3TO6 A;  1X3U A;  2MA3 A;  4OIO F;  1ZAR A;  5HLI A;  1MJ9 A;  3B02 A;  1TQP A;  1BM9 A;  4YFX F;  1U2W A;  4XBF A;  4RGS A;  1QO0 D;  1B1B A;  2EK5 A;  4IVN A;  5HDK A;  2DO7 A;  3DQV C;  3I59 B;  3K9T A;  3V7R A;  4NHJ A;  4M6Y A;  4HX4 A;  2QUF A;  3T1B A;  2Z3Y A;  2ZME A;  2DU9 A;  2L02 A;  2P7C B;  3C7J A;  4IHT A;  1P92 A;  3LST A;  1FX7 A;  3REO A;  5K5R A;  2VC1 A;  3KEO A;  2VBZ A;  3VB2 A;  3BJ6 A;  2DAO A;  4UV9 A;  4EQQ A;  1GXQ A;  3NEU A;  2FF4 A;  1FWZ A;  3H3Z A;  1SMT A;  1WWX A;  3WG9 A;  1XCB A;  1WI9 A;  5J8C A;  2ISZ A;  2M45 A;  5KK1 A;  3WE3 A;  2RGV A;  5HLG A;  5A2Q K;  1R22 A;  3O2P E;  2QLZ A;  1OPC A;  1J59 A;  2RQP A;  2UXX A;  3R61 A;  1D5V A;  1YQA A;  4G9Y A;  2FOK A;  4WF2 A;  3T5X A;  1XSD A;  4ENJ A;  1EH6 A;  3RYR A;  2JRT A;  1FY7 A;  2PMU A;  3L09 A;  2OU2 A;  2DPD A;  1K78 A;  2K7L A;  1O3S A;  2DTR A;  2Z33 A;  4L0Y B;  1SD5 A;  2PI0 A;  2Q2E A;  1IN6 A;  5HLH A;  2BV6 A;  3Q9S A;  5D4R A;  3I59 A;  3I0T A;  4I7H A;  2ZME B;  3FX3 A;  4A6E A;  3D0S A;  2Z99 A;  4NB5 A;  4OIQ F;  4KUM A;  3ZMD A;  1FBU A;  1BI3 A;  2RV8 A;  4RGX A;  2BBY A;  5CYV A;  5LHI A;  4ESJ A;  2GIV A;  2FMY A;  2X4H A;  4EJV A;  1MZB A;  3FF5 A;  2HWV A;  2IA1 A;  5TJJ A;  4A0Y A;  2WV0 A;  1SMY F;  1P4X A;  3KE2 A;  2GZW A;  2M8E A;  3ELK A;  4Y15 A;  3E5Q A;  3L00 A;  4U7D A;  4ZYH A;  3QPT A;  4EV0 A;  2QBY B;  1R58 A;  3U1D A;  1MD0 A;  5D5W B;  1U8R A;  3WTU C;  1P4A A;  4RAY A;  2HKX A;  1SD4 A;  4D0P A;  1RIO H;  1KU7 A;  3ZMV A;  2KKO A;  1STZ A;  3GFM A;  2NNN A;  2GWR A;  3L7W A;  3RDI A;  2HYF A;  2YX7 A;  1G3T A;  4HLX A;  2A5Y B;  1LDK B;  5KVR A;  3GXO A;  2KRF A;  4MTE A;  2OZ6 A;  4LGW A;  1XD7 A;  2HZT A;  1PP8 F;  3LA7 A;  4CZZ A;  4R8H A;  4WXC A;  5ICC A;  4HA8 A;  4KDP A;  2O03 A;  3CUQ A;  1P2F A;  1XSX A;  2XKO A;  4HX8 A;  2W57 A;  1T6S A;  3HRM A;  3F8M A;  4YFN F;  1YW7 A;  1IAW A;  3QOP A;  3I4P A;  3K0L A;  2A61 A;  4OU0 A;  5D5X B;  3JSO A;  3TQN A;  3LQR A;  5HVQ C;  1BBY A;  4HZF A;  1J2X A;  2K86 A;  1KYZ A;  3P9C A;  4KNY A;  4BAY A;  3MCZ A;  3BY6 A;  3FZV A;  2OAZ A;  3V8L A;  3DF8 A;  2A6H F;  1WSU A;  3NRV A;  4M71 A;  1ZRC A;  1IRG A;  2PJP A;  2EA4 A;  4LLG F;  2PFB A;  5BOX A;  1YW8 A;  4WCG A;  2UWM A;  4ZYD A;  4XLN F;  2QWW A;  5D8K B;  1XB4 A;  3MZH A;  2XUB A;  1W5S A;  3I53 A;  5K5O A;  3MQ0 A;  1BJA A;  3KZY A;  2GQQ A;  2VE9 A;  4GYG A;  2PBI A;  1MKM A;  3EET A;  1J75 A;  5F6F A;  1KYW A;  5AON A;  1D3Y A;  3E6M A;  1T0F A;  5BPI A;  4K2E A;  1ZH5 A;  2EV6 A;  4M9S A;  2Y75 A;  3I5U A;  2EV5 A;  2ZBK A;  3KP5 A;  4Z2Y A;  2OBP A;  1K78 B;  3G3Z A;  4XSX F;  5LBQ A;  3F72 A;  2XGX A;  2VOP A;  3GZ5 A;  1K6O A;  6PAX A;  2RN7 A;  5D6E A;  4MGR A;  4L18 B;  5LRR A;  2LF8 A;  1IXR C;  4ZYG A;  3TO9 A;  3CDH A;  1EV7 A;  1ZYR F;  3IKT A;  2ELH A;  2G9W A;  2W25 A;  5DCM A;  2EFW A;  2O61 A;  2FBI A;  3GO5 A;  2P8T A;  3FM3 A;  4LD5 A;  4A12 A;  1MGT A;  1CF7 B;  3QU6 A;  3CLO A;  1R1T A;  1DDN A;  4BHB A;  4JQF A;  2EFN A;  1UST A;  1ZLJ A;  2KJC A;  2XAJ A;  1G3W A;  5FFX A;  4HV5 A;  2OQR A;  2VN2 A;  4LLL A;  5ILU A;  3JAM Z;  3FXQ A;  1YLF A;  1SFX A;  1XGM A;  3P9I A;  1ULY A;  4Q48 A;  5LHG A;  1AWC A;  2H6B A;  5JVT A;  2P6T A;  4I09 A;  1UCR A;  3CO6 C;  4HW0 A;  2LDU A;  4XSZ F;  1TTY A;  5E20 A;  4EGY A;  1QZZ A;  3RIR A;  1QNT A;  2EA2 A;  3P9K A;  1IN8 A;  1MJB A;  3AAF A;  3JAM K;  3R4K A;  4N0B A;  2D1H A;  4UHT A;  4BXU A;  1TLH B;  4ESF A;  3JTG A;  4IJA A;  3BJA A;  1U5T A;  5CVR A;  2FXA A;  5D6F A;  2HDC A;  2KIU A;  2OD5 A;  3E6C C;  2HGC A;  1U78 A;  3E3V A;  5HS7 A;  3EYI A;  4ENN A;  2WTE A;  4G94 A;  3B73 A;  4HV6 A;  2H6C A;  1L3L A;  2PEX A;  2QZ8 A;  1W7P B;  2IRF G;  4KIF A;  2JSC A;  2MBF A;  1XN7 A;  5E18 F;  5E1Z B;  2EV0 A;  3LA2 A;  4WX9 A;  4YFK F;  2NRA C;  5H6R A;  1O57 A;  4BHP A;  2QYO A;  3FMS A;  1PUE E;  2CFX A;  2ESN A;  4I0B A;  1U6G A;  1B9M A;  5LEJ A;  2P5K A;  2Q0O A;  4A0X A;  1J0R A;  4MEX F;  3ZMS A;  3M9A A;  4ZH4 F;  1EH8 A;  2VOO A;  1Z1D A;  1T98 A;  3KCC A;  2Z9O A;  5HS8 A;  2H09 A;  1Z05 A;  1BIA A;  3T0Y A;  2VT2 A;  1BC8 C;  4HQE A;  1OR7 A;  2M30 A;  1ZN2 A;  3N97 A;  1J7K A;  3RPU A;  2NS0 A;  1S6L A;  2V6C A;  1FLI A;  4RGU A;  4U0Y A;  2HOE A;  4AIK A;  3V8J A;  4I02 A;  2WC2 A;  3RYP A;  3IHU A;  1IXC A;  1TW3 A;  1WKM A;  2DT5 A;  4GXO A;  2XAF A;  1FT9 A;  3SZP A;  4M6X A;  5CVI A;  1OYW A;  4R79 A;  1B4A A;  3ABT A;  5FGM A;  2H27 A;  1XDU A;  3TO7 A;  3J80 Z;  3F22 A;  2EWN A;  2XRO A;  3HSF A;  2G7H A;  3WGG A;  4HQM A;  2GAU A;  5DCM B;  5FO5 A;  2MD5 A;  1KQ8 A;  2L01 A;  1DP7 P;  3M8F A;  2K02 A;  5AIQ A;  1YTY A;  4GO1 A;  3DPT A;  3V7S A;  4EJO A;  3F8N A;  3T8T A;  1IF1 A;  3FMR A;  1XSV A;  5E8I A;  2YSR A;  5FFZ A;  2F5E A;  4BYY A;  4CXF A;  2O8X A;  3V4G A;  4N9I A;  4R1H A;  1R00 A;  2LNB A;  3ABU A;  3IRR A;  4UUV A;  4G7Z F;  3LAJ A;  3OV8 A;  1TBX A;  2W85 A;  3HSR A;  3QRF F;  1IN7 A;  2OZU A;  2Y0M A;  2PN6 A;  3FWE A;  3ECH A;  3HHG A;  3J81 Z;  3KEQ A;  3HRS A;  5CJ9 A;  1LDJ A;  1ZHF A;  1KQ0 A;  3BZ6 A;  2XVC A;  3FXU A;  4HX7 A;  2E1C A;  2L4M A;  1TNS A;  3EUH A;  3SQN A;  4HF1 A;  1SD6 A;  2QBY A;  2XAG A;  3ZMT A;  4HAM A;  3DP7 A;  2BE5 F;  4Y13 A;  2FU4 A;  2E7X A;  1SFU A;  1KGS A;  4LK0 F;  3J81 K;  2E1N A;  3R60 A;  4LFU A;  2F5F A;  1H9T A;  2VC0 A;  4KIC A;  4EJU A;  2NYX A;  1VTN C;  3GF2 A;  2Q8K A;  4LMY A;  3QAH A;  3PQK A;  1HST A;  2CWE A;  2DQR A;  3E5X A;  4I01 A;  4KIB A;  1FZP B;  3HOS A;  3RJP A;  1HW2 A;  5TRD A;  2Y48 A;  1W5T A;  5F64 A;  5ICF A;  5IT9 Z;  5DD8 A;  3VOD A;  1XGS A;  2XV4 S;  1HSJ A;  3JSP A;  1R5G A;  4UVB A;  5LGU A;  1QPM A;  1HBX G;  5DYM A;  3QPH A;  2HYG D;  2COM A;  4EJW A;  2LSO A;  1S7O A;  2K4J A;  4O5V A;  4G6D A;  3F23 A;  1FBS A;  3I64 A;  1BIB A;  1R1V A;  2F2E A;  4LG0 B;  3ZMU A;  2O6G E;  2GA1 A;  1RNL A;  2A3S A;  2R7D A;  1YS7 A;  4OMY A;  2HTJ A;  1D8J A;  1SD7 A;  2JZY A;  3E6D A;  2CG4 A;  4A2U A;  2V1X A;  4L5J A;  2R7F A;  1L0O C;  3GWZ A;  2AS5 F;  2GXG A;  2DQL A;  1KU3 A;  3WU0 A;  1W7P D;  3ML6 A;  3M8E A;  5CLS A;  1TW2 A;  2CYY A;  1T39 A;  5LEK A;  4TV7 A;  4MTD A;  1TNT A;  5IT9 K;  1IZ1 A;  4IRG A;  2LKP A;  2HQR A;  1ZLK A;  1TQM A;  2IA0 A;  2DW4 A;  4MHG A;  2ZJ2 A;  3IL2 A;  2UXN A;  2ZNZ A;  1FNN A;  2X0L A;  3MEX A;  4L9T A;  3HSE A;  5JI6 A;  2VBW A;  4U88 A;  2VE8 A;  4YIF A;  3QU3 A;  5DEQ A;  3W6J B;  4G7H F;  2L4A A;  3IWZ A;  2AXL A;  2OA4 A;  2R3S A;  2FRH A;  4G7O F;  2ACJ A;  2ZXJ A;  4HBL A;  1BI2 A;  4WWC A;  1GHC A;  2B0L A;  5DV5 A;  1PDN C;  2GA2 A;  2P5L C;  2C6Y A;  2BGC A;  4E70 A;  2ADU A;  4JBA A;  4HDU A;  2A69 F;  2KIF A;  3ISP A;  2DBB A;  3DFG A;  5DCF A;  3EDP A;  2XIG A;  5D4S A;  1WRJ A;  2DK5 A;  4M9Z A;  3F3X A;  4ENK A;  1UHW A;  1SFE A;  2JPB A;  2MLK A;  4L9J A;  2IP2 A;  4XLP F;  3V7C A;  3E5U A;  4P9F A;  3BPV A;  4WK8 F;  2ZO4 A;  3W6K B;  4BQA A;  1G3S A;  3IC7 A;  4CHU A;  1XMK A;  4CYD A;  4UXN A;  1HQC A;  5BQT A;  1IW7 F;  2MH2 A;  5EEG A;  1C0W A;  1ZGJ A;  4IF4 A;  1F1Z A;  2TDX A;  4LLN A;  1LNW A;  4EGZ A;  3GLX A;  1R23 A;  2JPC A;  1R5H A;  5BMZ A;  1E2X A;  1BI0 A;  2W84 A;  1S7A A;  5DDG A;  4LJZ F;  1GVJ A;  5ILV A;  1FPQ A;  3K2Z A;  4ON0 A;  4Q47 A;  2F5C A;  3BWG A;  2P5V A;  4RB1 A;  3L9F A;  2JT1 A;  2F5D A;  4CO8 A;  1GXP A;  3F21 A;  3WGI A;  1BOA A;  1V4R A;  2V1U A;  4IRH A;  4BHC A;  4HF0 A;  2FNP A;  3SFZ A;  1SAX A;  2CGP A;  5JR3 A;  1UFM A;  2P7V B;  4Q5S F;  4S05 A;  3M7G A;  1LEB A;  3WTS C;  2FBH A;  1U5T C;  3KLN A;  5HS9 A;  2DFI A;  1B9N A;  2K4B A;  2WWY A;  1RUO A;  2IT0 A;  1IXS B;  3HHH A;  3MFK A;  2VOD A;  3RI4 A;  1G6N A;  4P55 A;  2KJB A;  2QQ9 A;  2KIM A;  2HS5 A;  4Y17 A;  3U2R A;  1ZRF A;  3HYI A;  5D5V B;  3H3U A;  3TKY A;  2MLG A;  4AVP A;  1O3R A;  4CDG A;  4NQW A;  1USS A;  3SHF A;  4LB5 A;  1Q1H A;  4LB6 B;  4RAZ A;  1F9N A;  2BEO A;  3ZQ7 A;  4JK1 X;  4RGR A;  1XMA A;  3KZZ A;  1R1U A;  3DKW A;  2VXZ A;  1DUX C;  2VON A;  3WTX C;  1E17 A;  2YU3 A;  1DPU A;  3GZ6 A;  5BS6 A;  1P6R A;  3F6O A;  4FX0 A;  2FQ3 A;  3J7A O;  3L2C A;  3VOE A;  2DPU A;  2G7U A;  2PG4 A;  5FD5 A;  3TDU C;  1DPR A;  1JGS A;  1AOY A;  1BI1 A;  1J9I A;  3ECO A;  5BPD A;  3RKY A;  3EYY A;  3KP2 A;  3GX4 X;  3I54 A;  2D2W A;  4OOI A;  3GFI A;  4A0Z A;  4BNC A;  4MEY F;  1B59 A;  3CUQ B;  3R6S A;  3GFJ A;  4M74 A;  2NAZ A;  1XGO A;  4ASN A;  3WTV C;  1QZY A;  1RZ4 A;  4L9V A;  1IN4 A;  2V9V A;  2QQB A;  2FEZ A;  2CW0 F;  4OIR F;  2DK8 A;  1Z91 A;  1CGP A;  4UVC A;  4DQ2 A;  4G8X A;  4M72 A;  1LB2 A;  3F8C A;  3MWM A;  3HOT A;  2VBY A;  5L3E A;  3SZT A;  1LEA A;  3KP4 A;  1JHH A;  3LAP A;  1KQ9 A;  3MAJ A;  3F8B A;  4M73 A;  1I27 A;  2PQ8 A;  1QQI A;  1W4M A;  3GW2 A;  2RNJ A;  1FSH A;  3CUO A;  1P4W A;  4HOB A;  3V8K A;  5AIP A;  4KMU X;  2W24 A;  1LJ9 A;  2ZFW A;  2IW5 A;  2XAQ A;  1HW1 A;  5DUI A;  4IXA A;  1IN5 A;  1I6X A;  2V79 A;  1UB9 A;  1V3F A;  1REP C;  1TQI A;  1OMI A;  1JE8 A;  5HDN A;  4EJT A;  4A5M A;  4MQV A;  3GVA A;  2IA2 A;  3SXY A;  2OQG A;  1YS6 A;  3DV8 A;  2Z5U A;  4EM2 A;  3RPQ A;  1S8N A;  1YW9 A;  1H0M A;  2UZK A;  2IVM A;  3RTR A;  3BP8 A;  1ZG5 A;  4BH9 A;  1ZAO A;  3WTT C;  1FYM A;  3CUQ C;  4A5N A;  4P5O A;  3R0J A;  2NNY A;  1FOK A;  3C18 A;  1I1S A;  4AIH A;  4ZZD A;  2EFQ A;  2ZKZ A;  2STT A;  3TDZ C;  3GFL A;  3QP5 A;  3BRO A;  3QP6 A;  1QBJ A;  1LVA A;  4DNC A;  2M5W A;  5ERI A;  4L0Z B;  3FHZ A;  1ON1 A;  1T2K A;  4GYI A;  1O7F A;  1Z7U A;  1J5Y A;  4PDK A;  4L5I A;  4CIC A;  1MJA A;  1O3Q A;  4HYE A;  3K1N A;  1ONV A;  4MNU A;  4QWQ A;  1ON2 A;  2GXB A;  2XAS A;  2IPQ X;  3CJN A;  4U0V A;  4RB0 A;  4RB3 C;  3K1M A;  3RKX A;  3I71 A;  3M1E A;  5D8L B;  5E8G A;  4HLY A;  3E6B A;  5K1Y A;  2A68 F;  2DI3 A;  3J80 K;  2J5O A;  2M1B A;  4OMZ A;  2DLL A;  4PGG A;  2HR3 A;  3WTY C;  1W7P A;  3WGH A;  3WTW C;  3ZP5 A;  4O3M A;  3HIF A;  2FML A;  3DEU A;  3HRU A;  1Z6T A;  3BOQ A;  4KN4 X;  3BPX A;  4PCQ A;  1HXD A;  4ZZL A;  2FE3 A;  1MDM A;  5E17 F;  2L3D A;  4FHT A;  2LF7 A;  3LA3 A;  1YYV A;  1IUY A;  1FC3 A;  3IRQ A;  1JHF A;  4KT5 C;  3JW4 A;  1FBQ A;  5F1R A;  5IT3 A;  4B8X A;  5ICG A;  1LQ1 A;  3NQO A;  4EVI A;  2QQA A;  2XAH A;  2VT3 A;  4PZJ A;  2P4W A;  3DXJ F;  3ROU A;  1S29 A;  3HTS B;  3COA C;  4KA4 A;  3I58 A;  4WXD A;  3ULQ B;  4IPA A;  1Z9C A;  2M87 A;  4Q4Z F;  2QM3 A;  3KP6 A;  3O3K A;  4ESB A;  4A6D A;  2MC3 A;  1HW5 A;  4QLC U;  2CSO A;  3F6V A;  4GCV A;  2ZCW A;  3WE2 A;  4UVA A;  1I5Z A;  1R7J A;  2ISY A;  4EMS A;  4LK1 F;  2EFP A;  3KLO A;  3GUD A;  4M9X A;  5L3G A;  2EB7 A;  3ZMZ A;  3U9G A;  1YIO A;  1FSE A;  3G73 A;  3MZY A;  5EEH A;  1QGP A;  1YFH A;  2EFO A;  5E1X A;  1Y0U A;  2PMH A;  4PGH A;  3RKW A;  2RDP A;  3LQQ A;  1FYK A;  1RUN A;  4F7Z A;  3C1D A;  3ZPL A;  3DPL C;  2XRN A;  4G6Q A;  2RC4 A;  1G4D A;  2QVO A;  5CVU A;  2FBK A;  1R36 A;  5JHU A;  4KIG A;  1G3Y A;  3C3W A;  3FMQ A;  2J5P A;  2FA5 A;  3CO7 C;  3TOA A;  2CO5 A;  2FSW A;  3WTZ A;  3KET A;  1U3E M;  4AWX B;  4ZYE A;  4YG2 F;  4YII A;  2A6E F;  2HTS A;  3D5L A;  1RI7 A;  2YPR A;  5LLQ A;  4GGG A;  5LRS A;  3O6B B;  4N9H A;  3K69 A;  4I0A A;  1H9G A;  1B6A A;  3TOB A;  4P9U A;  4H0E A;  4HF2 A;  3LWF A;  3GYH X;  3S2W A;  4U7B A;  3WU1 B;  4OIP F;  5L3F A;  4EM1 A;  1FP1 D;  2RKH A;  5DUK A;  1MDM B;  4HDV A;  5FLX K;  5ICE A;  1YO5 C;  3CTA A;  3FM5 A;  4XRF A;  4UV8 A;  2P6S A;  2HQN A;  3ZN1 A;  1EH7 A;  2YR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...