3F6VA

Crystal structure of possible transcriptional regulator for arsenical resistance
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
96
structure length
96
Chain Sequence
VLDQLEVAAEPTRRRLVQLLTSGEQTVNNLAAHFPASRSAISQHLRVLTEAGLVTPRKDGRFRYYRLDPQGLAQLRALFDSFWIDELDRLVADATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Possible transcriptional regulator, ArsR family protein
publication title Crystal structure of Possible transcriptional regulator for arsenical resistance from Rhodococcus sp.
rcsb
source organism Rhodococcus sp. rha1
total genus 32
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f6vA00
2EJRA 2EA2A 1P92A 4CGZA 3EYIA 5ED4A 1SFUA 3CJNA 3K2ZA 3E3VA 4MTEA 5ILSA 1USSA 1R23A 1FYKA 1J5YA 2VBXA 4OIRF 5H20A 3N4MA 3GWZA 2R3SA 3JSPA 2ZJ2A 4A2UA 5AIQA 4LLLA 3WGIA 2HTJA 2IVMA 4CICA 5CLSA 1ULYA 1Z6RA 1R5GA 4LLGF 2XHKA 5L3CA 1Y0UA 5CYVA 4LFUA 4KMUX 1DPRA 2A07F 2Y0MA 3TKYA 3B02A 5FLXZ 2ZCWA 5L3DA 2X0LA 1O3SA 2HEOA 1T39A 4BXUA 2DO7A 3SFZA 1T2KA 1RIOH 2V1DA 2QQAA 3OV8A 1ZAOA 5H6QA 4KN4X 1ON1A 2DI3A 3QAHA 1GXPA 2EFOA 3L2CA 2BEOA 3M7GA 3LSTA 1ZN2A 1ON2A 2YSRA 5JHUA 3E6BA 2A68F 1CGPA 1XGSA 3BOQA 2K7LA 1F4KA 4I2OA 3F22A 3W6KB 1Z6TA 5HDGA 3BPXA 3DQVC 3EDPA 5A2QZ 2PMHA 4XSXF 1EV7A 4ZYGA 3G73A 4OU0A 3E5UA 1R5HA 2PEXA 4MQ9F 2GZWA 2LF7A 3ZPLA 3K1MA 4I09A 1AWCA 2DU9A 3WTUC 3R4KA 1G3YA 5CVIA 1RUNA 3S2WA 3GW2A 1SD4A 2A3SA 3LAJA 1K6OA 4EV0A 1OYWA 1P6RA 1ZRCA 1Z05A 2KRFA 4XBFA 2QM3A 1STZA 4OMYA 1X3UA 2W25A 2XVCA 3WTYC 1I1SA 4ZH4F 1OKRA 3V7CA 5JVTA 3Q5FA 1UB9A 1MJAA 3RIRA 3RPQA 1O3TA 4EGZA 5ICFA 3GFMA 1ZG1A 1D5VA 1FBSA 4MEXF 4MNUA 1MGTA 2RVCA 4FX0A 1S3JA 4U0WA 3F23A 3QP6A 4M6XA 4NB5A 2D45A 1WQ2A 4EJVA 4RB3C 3KP5A 5ICCA 4KYWA 1DPUA 2ADUA 2EA4A 2V9VA 3H92A 5ILVA 3KLNA 1SMYF 3LQQA 3B73A 4RAZA 4GYGA 2XAFA 4FT8A 1YS7A 4HQEA 1MDMA 3EUHA 1XMAA 3IHUA 3NQOA 2GA2A 3ECHA 3WTSC 1SFEA 4RAYA 1TNSA 1OMIA 5J8FA 5BQTA 3M9AA 1K78A 1KQ0A 5E1WA 3BJAA 3LA7A 1LEAA 1BN5A 2FQ3A 4L5IA 5LBQA 4JBAA 2ETHA 2PLYA 4G7HF 1U6GA 4IRHA 4OINF 4Y13A 1QNTA 2BV6A 5D6EA 5D8LB 2QBYB 2QENA 4HLYA 1EH8A 2AS5F 5LGUA 5HLIA 1FYMA 2TDXA 1FC3A 5D5WB 2BE5F 1UHWA 2HTSA 1WI9A 1ZREA 2F5DA 2V1XA 4U7BA 3TGNA 3U1DA 3FM5A 2V6CA 5JFRA 2WV0A 1XCVA 2DTRA 1JXSA 5D5VB 3K1PA 2L4AA 2DQLA 3WU1B 2FOKA 1IW7F 2ZMEB 2DBBA 1YLFA 3LQRA 1R22A 5LHIA 2FF4A 4AIHA 5F64A 1J2XA 2OZUA 3RPUA 3IWZA 2XAGA 3K1NA 4Z2YA 4LG0B 4WF2A 3BP8A 1W5SA 3M8EA 2W84A 5L3FA 4BAYA 1IRGA 1T98A 4WXDA 3F8FA 4KIFA 5D6FA 5DUKA 3BY6A 3ABUA 4KICA 4ESBA 3WGGA 3RKXA 1XGNA 3HSFA 1O3RA 1D8KA 4ASNA 1HKSA 2AXLA 2FNAA 4M74A 3GZ5A 3HRSA 2DPDA 3HHHA 4KIGA 1IZ1A 1G4DA 2ESNA 1XGMA 2R7DA 3KZYA 1V4RA 1XDUA 3GO5A 1USTA 2KJCA 4IPAA 3KEQA 3EQLF 3CO7C 5D5UB 1TQMA 2R7FA 2H6CA 4R8HA 1TQIA 5LRSA 2Q8KA 3ZMZA 4P9FA 2WTEA 3P9CA 3ECOA 2Q2EA 1ZGAA 2P6SA 4L9TA 5EEHA 4FHTA 2FSWA 2PJPA 4BQAA 4EJWA 4OIOF 5E1XA 2FMYA 2STWA 5FFXA 3HUGA 3RJPA 4IVNA 5FLXK 1IAWA 3C1DA 2D1VA 3IWFA 3Q9SA 2DQRA 3QU6A 5H6RA 4IF4A 4M6YA 2IT0A 3I5UA 4G7OF 4LD5A 4RB0A 1MZBA 2ZXJA 5DCMB 4L5JA 2HOEA 3GYHX 2KIFA 3LA2A 2M87A 1RI7A 3GZ6A 4XRFA 1S6LA 4UV8A 1U8RA 3F8NA 5A2QK 5BPDA 4HX8A 1HXDA 4BH9A 5E18F 1RUOA 1SD7A 4S04A 1EH6A 5J6XA 4R1HA 3GFJA 1RNLA 3HIFA 3E6CC 4YIFA 4WCGA 4KDPA 2HWVA 3SZPA 5E1ZB 4G7ZF 4EQQA 4HF0A 1ZRFA 1FP1D 4M72A 1P4WA 2XAHA 3HSEA 3P9IA 3TDUC 2COMA 3HHGA 1XSXA 3SXYA 4A12A 1R7JA 3F6VA 3SHFA 3QRFF 3HYIA 4O6JA 4KT5C 1QPMA 5LHHA 1FLIA 2EFQA 1ONVA 4AIJA 2O3FA 3FHZA 3KP6A 3D0SA 2W57A 4O3MA 1W7PD 1U78A 4Q5SF 3KP2A 1ZRDA 1UCRA 3PQKA 2UZKA 3ZN1A 3ISPA 3FX3A 1BI0A 2BYVE 1YW9A 3T5XA 3ZQ7A 3I54A 4HDVA 1B9NA 4ZYEA 4Q4ZF 3HOTA 2CO5A 2EFWA 5IT9K 3RYPA 1FBQA 3KP7A 5HDNA 5ICGA 1IXRC 2HKXA 1FOKA 4D0PA 4EMSA 4HYEA 1TW3A 3LFKA 1K79A 4KNYA 1W5TA 2K27A 4I0BA 2DK5A 4HBLA 3HTSB 5ICEA 4QLCU 2M45A 1H0MA 1B6AA 2MLKA 2O03A 2H94A 3ZP5A 1BBYA 4Y17A 1QZZA 4M9SA 1HW5A 2ZKZA 2V1UA 1D8JA 5K5QA 3RDIA 4FX4A 2VOPA 3DV8A 1BI2A 3I4PA 2X4HA 1KA8A 2XKOA 5KK1A 3J81K 2VONA 1BM9A 3PQJA 3ABTA 4OMZA 3IRQA 1G3TA 1PP8F 2M30A 5DYMA 2HZTA 5CVVA 3ROUA 1ODDA 5LRRA 4MQVA 4CHUA 4I0AA 2XAQA 4IHSA 4EGYA 2FE3A 2YU3A 2G9WA 4HDUA 5D5XB 2CQKA 1IN5A 2V79A 1XD7A 1FBUA 1TW2A 3HRTA 2GIVA 3V4GA 4EVIA 3VB2A 4MHGA 3JTGA 4AIKA 2FA5A 2MH9A 1FWZA 1IRFA 2EFPA 4ENKA 2P7VB 4P55A 2A69F 1W7PB 5CJ9A 6PAXA 3MZHA 2WC2A 4RGXA 1U5TB 5JR3A 1B1BA 3WE2A 4YFKF 3T8TA 4LK0F 3KFWX 4LLNA 1XCBA 2M5WA 1YW8A 4BHBA 4E70A 5DEQA 4MTDA 2P7CB 2F5EA 1PUEE 4I98B 1FNNA 5DV5A 2RKHA 3R0AA 3GLXA 3IKTA 4UVAA 2RQPA 3O6BB 2ISZA 1SAXA 4Q47A 2L4MA 2H09A 1L0OC 1ZGJA 1FY7A 1R58A 4KFCA 3KZZA 4IRGA 2KKOA 3CDHA 3I71A 3TDZC 3QP5A 1WKMA 1KU7A 1VTNC 3CLOA 1XSDA 4RB2C 3BPVA 3DPTA 3E5QA 1FYLA 2HQRA 1IN8A 2OA4A 2PG4A 3MFKA 3E97A 3BZ6A 4L9NA 3WGHA 1SD5A 1WWXA 3HOSA 1XSVA 2A6EF 2QLZA 1P4AA 3NEUA 1KYZA 1REPC 4LMYA 4NQWA 2E7XA 1ZH5A 4EJTA 2EK5A 3DF8A 2ACJA 5IT9Z 2VXZA 1ZG5A 5K1YA 3FWEA 3T1BA 4HX7A 4U0VA 1L3LA 3D5LA 4EM0B 2L3DA 3LWFA 1G6NA 2GXGA 1ZLKA 1HW2A 1CF7A 3WTXC 1DUXC 5LLQA 1BI3A 2VBYA 1I5ZA 5HLHA 1MDMB 3C3WA 1TBXA 2M8EA 2F2EA 1QGPA 1O7LA 4G8XA 2QBYA 2BGCA 5HS9A 3AAFA 5HVQC 4OIQF 3CUQB 2EWNA 4YIIA 3I59A 2GXBA 2EV5A 5CVUA 3J81Z 2HDCA 4AD9A 1S7OA 5LGTA 4WX9A 1LB2A 1IN6A 4UXNA 4YG2F 2VN2A 3RKYA 3JAMK 1C0WA 4B09A 3JTHA 4ZYHA 1IXCA 2CW0F 3P9KA 2B0LA 2A5YB 3JW4A 3BROA 2M1BA 2DFIA 1MJ9A 4CO8A 4HW0A 3R6SA 4QWQA 2XRNA 1A04A 3BWGA 2CSOA 3I58A 1XDSA 3ZMVA 1YYVA 4G6DA 3FF5A 2MD5A 2FRHA 4BHPA 2EV0A 1UFMA 2YX7A 2EFNA 1E17A 2E1NA 3ML6A 4LG0A 1J59A 2DK8A 1BIAA 1HSJA 4PGHA 4EJUA 3F8MA 2XROA 2XIGA 4N9IA 3BJ6A 2DW4A 3K9TA 1S29A 1R1VA 2K4JA 2Z3YA 3REOA 1I27A 4AVPA 2IP2A 3F72A 4KUMA 5FGMA 1I6XA 2GQQA 3FXUA 2QVOA 4DNCA 2O61A 4A0XA 5BPIA 4BHCA 1I1GA 5IT3A 2Q0OA 3BDDA 3GF2A 4IJAA 2P5VA 4ENJA 2JTVA 3O2PE 4AWXB 4BYYA 3FMRA 2STTA 5LEKA 4RGUA 1EH7A 2L01A 4IXAA 3IC7A 2PQ8A 4B8XA 3MWMA 2YPRA 3WU0A 3WTZA 4KMFA 5L3BA 2IA2A 1LDJA 4LK1F 4KA4A 5TJJA 4ZZDA 5L3GA 1XMKA 3C18A 5HS8A 4EJOA 3L00A 5DDGA 1JE8A 1PP7U 1YTYA 1SD6A 1J0RA 4H0EA 2UXNA 4MGRA 4HF1A 2PBIA 3IL2A 4TV7A 3DEUA 4F7ZA 2OZ6A 2OQGA 4L9JA 1GXQA 3GXOA 2HR3A 2PMUA 4HV6A 3V8KA 4A5MA 4M9ZA 2UWMA 4G6QA 2K86A 1V3FA 4G94A 2A6HF 1MJBA 2K4BA 3GFIA 5DCMA 2RV8A 2FEZA 2YX4A 4EM1A 5DCFA 4U7DA 3DP7A 4HQMA 2ISYA 1R1TA 2KIMA 2FU4A 1O7FA 1LJ9A 2QZ8A 1S7AA 2K02A 4I7HA 2LKPA 1FZPB 2Z9OA 2OU2A 4I01A 3MQ0A 2FMLA 3CO6C 2KIUA 2F5FA 2IA1A 3ZMUA 5KVRA 1QZYA 3J7AO 2P5KA 2EV6A 2NRAC 2ESHA 1R36A 1HKTA 2QWWA 1MKMA 4UHTA 5FD5A 5DD8A 4RS8A 3H3UA 2RC4A 2UXXA 3WTTC 1B9MA 4UVBA 2MLGA 5CVJA 2PI0A 3VEPA 2OAZA 3JAMZ 3K69A 1JHFA 5BS6A 5D4RA 2ZFWA 4OIPF 1F5TA 3L9FA 2JSCA 2PN6A 1BIBA 1BI1A 3U2RA 1GHCA 2FNPA 4CDGA 3W6JB 1ZHFA 4A6DA 1QBJA 1KU3A 3JSOA 5TRDA 2JRTA 5DD4A 5FFZA 4GYIA 2D1HA 3MZYA 2P5LC 3TOBA 1O3QA 1B4AA 1BC7C 2C6YA 1FPQA 2ZNYA 2E7WA 4PZJA 3DPLC 4P5OA 3RKWA 4A0ZA 3QOPA 4GXOA 5HS7A 1LDDA 1W4MA 1P4XA 3GVAA 5D8KB 3F8BA 2CFXA 4N0BA 5LHGA 3FXQA 5J8CA 1BOAA 2YR2A 1NHAA 2CYYA 3TOAA 3VOEA 1KQ8A 2NYXA 3SQNA 3ERED 4L0ZB 4RGSA 2NS0A 1RZ4A 3LA3A 3J80K 4CXFA 1IN4A 4WXCA 4HV5A 3KEOA 1BJAA 1KU9A 1SFXA 3GX4X 1GVJA 2XKPA 1FP2A 3R61A 2QQBA 3WODF 2DAOA 4UUVA 3ZN0A 3NRVA 3E5XA 5HLGA 5K5RA 4CZZA 4ENMA 2EB7A 2LF8A 4RGRA 4LJZF 2Y48A 1AOYA 1XN7A 1J7KA 2CWEA 2Z33A 2HFHA 3KLOA 3M8FA 1O57A 3HSRA 4HLXA 4ETSA 4U0YA 2LNBA 2E1CA 2OBPA 1FX7A 2WWYA 1LVAA 3VFZA 4LGWA 4M71A 3F6OA 1JHHA 3EETA 2Z99A 1ZARA 4LB5A 3T0YA 2GWRA 1P2FA 1W7PA 3V7SA 2HKOA 4HA8A 3FXRA 1HSTA 1KGSA 1U5TA 2JZYA 2W85A 3RI4A 1G3WA 3KETA 4R79A 2XV4S 3BJOA 3CUQC 3U9GA 2VE9A 2O8XA 2P6TA 2ZNZA 2MBFA 4L18B 4BNCA 3FM3A 3RYRA 4WWCA 4PGGA 4ESFA 1JGSA 2J5OA 1BC8C 4UVCA 3Q9VA 3GUDA 4L9VA 3T8RA 1DP7P 1YQAA 1YS6A 1SMTA 3L7WA 4MEYF 3FMQA 4GCVA 1FSEA 3ZMSA 2J5PA 2G7UA 1OPCA 4IRIA 4A5NA 4XSZF 3V8LA 4WK8F 1TNTA 2NAZA 2FBHA 3CUOA 1T38A 4JK1X 2L02A 1YW7A 4HZFA 3VODA 3I0TA 2Y75A 1YO5C 4P9UA 1H9GA 3KCCA 1DDNA 5ILUA 1TQPA 2FBIA 3L09A 4S05A 4O5VA 3EYYA 3HTUA 3QU3A 4UNOA 4U88A 2XUBA 2NNYA 1Z7UA 3J80Z 1S8NA 4RB1A 1B59A 4ON0A 2VT3A 3TO6A 4YFNF 3MCZA 4EM2A 5JI6A 4M73A 3M1EA 2IRFG 3CUQA 3WG9A 3R60A 5LEJA 1KYWA 1TTYA 3F21A 1CF7B 3I53A 3FZVA 2P4WA 2IW5A 4WXHA 5E8IA 4Q48A 1K78B 3QPTA 1J9IA 1E2XA 4A6EA 1F1ZA 3R0JA 3V8JA 1T6SA 4N9HA 5FD6A 1J75A 2W24A 2HGCA 2HS5A 4G9YA 3E6MA 4LB6B 3I59B 3K0LA 3ZMTA 2LDUA 3G3ZA 4NHJA 2ZMEA 4PDKA 4GGGA 1K7AA 2QYOA 2ELHA 3HRUA 3IRRA 1T0FA 4PCQA 5L3EA 1PDNC 4KIBA 3CTAA 1LQ1A 4CYDA 2LSOA 4UV9A 3COAC 3DFGA 3KE2A 2OD5A 2D2WA 2RN7A 1HKQA 2QUFA 2H27A 2DPUA 3HRMA 5EEGA 2HYGD 1UHMA 2RGVA 4DQ2A 3O3KA 1ZYRF 5LGNA 2JPBA 3IKVA 1U3EM 4HF2A 3C7JA 4ZZLA 2DLLA 3F3XA 4ZYDA 3FMSA 2OQRA 4ENNA 3E6DA 3QPHA 2CGPA 4GO1A 2IJLA 2XAJA 5F6FA 3H3ZA 3ELKA 5BMZA 4L0YB 4P96A 4M9XA 5FB2A 2NNNA 3TQNA 3SZTA 2VE8A 1H9TA 5AIPA 2IPQX 3I64A 3MAJA 3N97A 5CVRA 2FBKA 2CG4A 1IUYA 2MH2A 3OOPA 1FT9A 2HQNA 3P7NA 1U2WA 1XGOA 3DXJF 2DT5A 2VC0A 1OYYA 4YFXF 2O6GE 2VBZA 1KU2A 3WTVC 1HBXG 3RTRA 1LNWA 2KJBA 2A61A 4HOBA 5K5OA 4KN7X 4JQFA 3F8CA 1WRJA 5DUIA 3V7RA 3GFLA 1IF1A 3LAPA 4HAMA 3WTWC 2G7HA 3DKWA 5D4SA 3PFIA 1ZLJA 3KP4A 2XGXA 1LEBA 5AONA 2IA0A 5FO5A 1D3YA 2JT1A 2QQ9A 2RNJA 1LDKB 3TO9A 1Z9CA 1F9NA 1IXSB 2O0YA 2GA1A 1G3SA 1QQIA 2Z5UA 2VBWA 3TO7A 2BBYA 2RDPA 2P8TA 2VODA 1Q1HA 2ZBKA 1XB4A 3ZMDA 2VOOA 2H6BA 1R00A 1HW1A 3WE3A 1ZG3A 1OYIA 3GEZA 2HYFA 1YG2A 5HOOA 1YIOA 4XLNF 3KP3A 2XASA 5BOXA 2VT2A 4ESJA 3MEXA 2F5CA 2PFBA 1KQ9A 2L54A 2GAUA 1U5TC 1Z91A 3ULQB 1TLHB 1Z1DA 2JPCA 2MC3A 1IN7A 2VC1A 4A0YA 4HX4A 4Y15A 2MA3A 4I02A 5F1RA 1MD0A 1FSHA 4K2EA 1R1UA 5E20A 2ZO4A 5E17F 2FXAA 5HDKA 4XLPF 1YFHA 1WSUA 5E8GA 5ERIA 4IHTA 1HQCA 1OR7A 1QO0D 4OOIA
chains in the Genus database with same CATH superfamily
4I99C 2EJRA 3RKQA 2EA2A 2Y9ZA 2JN6A 1P92A 2CV1A 2EIKH 4CGZA 1ETXA 2QF7A 3EYIA 5ED4A 1SFUA 3CJNA 2R0QC 2Y0SN 1IGNA 3K2ZA 3E3VA 4MTEA 2OTJI 2MD0A 5GAGJ 3MD2A 5ILSA 1USSA 1V54H 2ZFUA 1R23A 3KYCB 5B1AH 2ELKA 1FYKA 1J5YA 2VBXA 1V55H 4OIRF 5H20A 3CDLA 2CW8A 3N4MA 4ZTFA 1G59A 4IHYA 3GWZA 2L9RA 2R3SA 3JSPA 2ZJ2A 4A2UA 5AIQA 3ESWB 4LLLA 3WGIA 3S1NJ 2W48A 2HTJA 2IVMA 4CICA 5CLSA 1ULYA 1Z6RA 1R5GA 1WJ5A 2XHKA 4LLGF 5L3CA 3H0DA 1V5EA 1Y0UA 5CYVA 3GTJJ 3Q0WA 3M8JA 3MMYB 4LFUA 1QA6A 3E1SA 1R4NB 1YOVB 4KMUX 1DPRA 3FXJA 3DBHB 3BR5A 2A07F 2Y0MA 3ERMA 3TKYA 3MZ8A 2WAQN 3B02A 5K7FA 4U87A 4F55A 2HDWA 5FLXZ 3HKZN 2ZCWA 2YUSA 5L3DA 2X0LA 2HXOA 2XPUA 4AUXA 3MKWB 1O3SA 4F91B 4QSHA 2HEOA 1T39A 4BXUA 2DO7A 2M4GA 3ZQIA 3SFZA 1RRJA 4HRIA 5FKLA 1T2KA 1RIOH 3CC7I 3Q0VA 2V1DA 2QQAA 3MVPA 1ZAOA 3OV8A 5H6QA 5EDNA 4KN4X 1ON1A 2DI3A 3QAHA 5E3MA 2CU7A 2XGEA 1GXPA 2V9PA 1BW5A 2EFOA 3L2CA 2BEOA 3HOXJ 3EUHC 3M7GA 2IS6A 3LSTA 1ZKGA 1ZN2A 5JLWA 1ON2A 2YSRA 5JHUA 3OIQA 3E6BA 2A68F 1CGPA 3JREA 1XGSA 3BOQA 4XKWA 5M5WJ 1JTYA 2I5UA 2K7LA 1F4KA 4I2OA 3F22A 3W6KB 1FTZA 1Z6TA 4PFPA 5HDGA 2H8WA 3BPXA 1SVLA 3DQVC 3VYSB 3EDPA 5A2QZ 2PMHA 3GMEA 4XSXF 4RLFA 3QYBA 1EV7A 2Y69H 5J1UA 4ZYGA 3DTIA 2H1LA 3G73A 4OU0A 3SDBA 3E5UA 5DM7F 1NH3A 1R5HA 2PEXA 4MQ9F 2GZWA 2LF7A 3ZPLA 1POGA 3K1MA 4HNVA 4I09A 1AWCA 2DU9A 3WTUC 3CCEI 1VI0A 3OR2C 4ABZA 3R4KA 3TW6A 1G3YA 5CVIA 1RUNA 3JRCA 1PJRA 3S2WA 3GW2A 3EUKL 1SD4A 3GTLJ 2MABA 1MMDA 2NS7A 1N77A 2A3SA 2DOFA 2HU9A 3OIPA 5EZGA 3KIOA 3A02A 3LAJA 2CQ7A 1K6OA 3PO2J 4EV0A 2RNGA 4BJ6C 3NWTA 1OYWA 3K10A 1P6RA 1ZRCA 2X51A 3ZXSA 1Z05A 3JRFA 2GOXB 4PJNA 2KRFA 1ITYA 1OCCH 4IQJA 4XBFA 2BXZA 2QM3A 1STZA 2NVXJ 1X3UA 4OMYA 2W25A 3H5AA 2X6XA 1Z21A 4XLFA 2XVCA 2CMPA 2K85A 4FISA 3WTYC 3X2QH 1I1SA 3ZQQA 2DDAA 4ZH4F 1OKRA 3V7CA 4DJAA 2XGCA 3M07A 5JVTA 3Q5FA 3E7LA 1UB9A 1E0EA 3HOVJ 1MJAA 3RIRA 1ETWA 3RPQA 1O3TA 4YELA 3L2WA 4EGZA 2LK2A 5ICFA 3WG7H 2HYJA 3GFMA 1ZG1A 4KISA 2W00A 1D5VA 1FBSA 4MEXF 2K9SA 4MNUA 1MGTA 2RVCA 4FX0A 1S3JA 3PUFA 5EF6A 2IS1A 4U0WA 3F23A 3QP6A 4M6XA 3HJEA 2M7AA 4NB5A 2D45A 1WQ2A 4EJVA 4RB3C 2ID3A 3KP5A 5ICCA 4KYWA 1DPUA 1LE8A 4HNUA 2ADUA 2EA4A 2V9VA 3CP8A 3PM1A 3TP0A 3H92A 1R5ID 5ILVA 3KLNA 4A3IJ 3HOYJ 1SMYF 2QKLB 1PUFA 4II2A 4RA2A 3LQQA 1Q1VA 3B73A 4RAZA 4ANJA 4GYGA 2WBMA 2XAFA 4NQWB 4FT8A 2EZLA 4BXXJ 4D9JA 1YS7A 4XN3A 4HQEA 3OIOA 3OR1C 1MDMA 3EUHA 2JK3A 1XMAA 2MFZA 1ENHA 4KJZA 2XF5A 3IHUA 2E5NA 4G12A 3NQOA 2JA2A 3JRBA 2HVSA 4BGDA 2GA2A 3C2GA 1N78A 3ECHA 3WTSC 1SFEA 2FQ4A 4RAYA 3OL3A 1TNSA 1OMIA 1WJBA 2A5WA 5J8FA 5BQTA 4IO9F 3M9AA 1K78A 1KQ0A 5E1WA 3LL7A 3BJAA 3LA7A 1LEAA 1BN5A 2FQ3A 2BW3A 4L5IA 1A35A 1K83J 5LBQA 1LKXA 1ORKA 4JBAA 1BR2A 2DT7B 3OYIA 3AL0C 2ETHA 3J7AY 2PLYA 4G7HF 1QVUA 1U6GA 2L9NA 4OAYA 4IRHA 4OINF 1NK2P 2HQAA 2QSFX 5D6EA 1QNTA 1UELB 2BV6A 3BTJA 5D8LB 4Y13A 2QENA 2QBYB 4IQ4A 4GFBA 1HOMA 4HLYA 2V4JC 4C2MJ 4PJ0C 2VASA 3ZQFA 4ITVA 1EH8A 2AS5F 5LGUA 1SC7A 4ZC3A 5HLIA 3CJQB 1FYMA 2TDXA 1LFUP 1MMAA 1AKHA 1FC3A 5D5WB 3BG9A 2BE5F 4XORA 1UHWA 2R5YB 2HTSA 3MN2A 4RMNA 2MSYA 3F9KA 1A31A 5FROA 3K4BA 5IP6A 2K3PA 1WI9A 3IAS2 1ZREA 3S14J 2HDDA 2F5DA 5M5XJ 4MFDA 2CV0A 2V1XA 2DJIA 4U7BA 1MMSA 3TGNA 5FJ8J 5E3LA 3U1DA 3FM5A 2V6CA 5JFRA 3KEYA 1VNDA 2WY7Q 1VQ8I 2R7VA 2WV0A 2M2EA 2R7SA 1XCVA 2DTRA 1JXSA 1VQPI 5D5VB 3K1PA 2L4AA 2DQLA 3WU1B 2FOKA 2A05A 1IW7F 2ZMEB 2DBBA 5HNFA 3JR9A 1YLFA 3FXMA 3LQRA 3PFYA 1R22A 5LHIA 2FF4A 5KNLA 3K70D 3LSHA 4AIHA 5F64A 1J2XA 4BACA 1TWHJ 4DBRA 2OZUA 3RPUA 2DN0A 3IWZA 4UB8C 2XAGA 4C9YA 3QYFA 3K1NA 2EBIA 4Z2YA 2DA7A 4LG0B 1S5LC 4WF2A 3BP8A 2KLOA 2X48A 2VIXA 1W5SA 3M8EA 2W84A 1Y8RB 4PJMA 5C44J 5L3FA 3OYGA 4BAYA 2L9VA 3S8PA 1IRGA 1T98A 4WXDA 2JRMA 3F8FA 1I6HJ 2BVLA 4KIFA 5D6FA 5DUKA 5HNHA 3HEFA 1Z0XA 3ABUA 3BY6A 4KICA 4ESBA 2BY1A 3WGGA 2Y0SA 3RKXA 2G0EA 1XGNA 3HSFA 1O3RA 2K9QA 3HL2A 4XLAA 1D8KA 1E3PA 3JRGA 4ASNA 1HKSA 2AXLA 2FNAA 1UAAA 4M74A 2AQFA 3GZ5A 2FD5A 3HRSA 2DPDA 2QSGX 4C3HJ 3HHHA 4KIGA 3S3NA 1IZ1A 1G4DA 1D0YA 2ESNA 1XGMA 4B1RA 2R7DA 3KZYA 1LPQA 1U8BA 3HG9A 1V4RA 3CC2I 2VJ5A 1XDUA 3GO5A 3K4KA 1SANA 1USTA 2E35A 2M7BA 2KJCA 4IPAA 3KEQA 3EQLF 4D7NA 4J19A 3CO7C 4NUBA 3VYTB 3VPRA 5D5UB 3ABMH 1NG6A 1TQMA 2R7FA 2H6CA 2XSDC 2E1MC 2K3FA 1S7EA 4R8HA 1TQIA 5LRSA 3OYBA 2DJNA 2Q8KA 3ZMZA 4P9FA 2WTEA 3P9CA 3ECOA 2Q2EA 3SYTA 4J00A 2HQ5A 1ZGAA 2WAQA 1I3AA 2P6SA 1G2HA 3HKZA 4L9TA 1JI8A 1EKEA 2NOGA 2BY0A 5EEHA 2LBFB 4X0GA 1FEXA 4FHTA 1UG2A 1OQYA 2FSWA 4P1WA 4QPOA 3G1MA 4EJWA 4BE2A 4BQAA 4OIOF 2PJPA 5GADJ 2RQQA 4B48A 5E1XA 2V7FA 3M1CA 2X6WA 2FMYA 2STWA 5FFXA 3HUGA 3RJPA 4E7HA 4IVNA 5FLXK 1IAWA 3C1DA 2D1VA 3IWFA 1HC8A 4F93B 5GP9A 3Q9SA 1WCMJ 3FXLA 2DQRA 3QU6A 1CQTA 5IYCJ 5H6RA 4IF4A 2R7OA 4HG2A 4M6YA 2IT0A 2TRTA 2IS4A 2CUEA 3I5UA 2LG4A 2E2JJ 4G7OF 4LD5A 4RB0A 4BXFA 3RQIA 1MZBA 2F5VA 2ZXJA 1W5CC 4Y52J 5J1RA 1VQLI 5DCMB 4L5JA 3H0GJ 2HOEA 3GYHX 2NVTJ 2KIFA 3LA2A 4FQGA 2M87A 1RI7A 3TP3A 2LD5A 3GZ6A 4NDLA 5FKMA 4XRFA 2F6CA 1S6LA 4UV8A 1U8RA 1MBJA 2ZC2A 3I4MJ 3F8NA 5A2QK 5BPDA 4HX8A 1OCPA 1TL8A 1HXDA 1TWFJ 2CFOA 4ZDPA 4BH9A 5E18F 1RUOA 1SD7A 4S04A 1EH6A 5HODA 5J6XA 4R1HA 3EPZA 3GFJA 2LKSA 1RNLA 3AFHA 3HIFA 3E6CC 4YIFA 2VB6A 5DS9A 4WCGA 3OYNA 4KDPA 2HWVA 3SZPA 3CF5F 5E1ZB 4G7ZF 2QQ8A 5EGOB 4EQQA 2X1EA 4B3AA 2KDZA 4HF0A 2KMUA 1ZRFA 5EG0B 2K9NA 2L0KA 1FP1D 3DCFA 3FDYA 4M72A 1P4WA 3FK6A 5BNGA 1N75A 2XAHA 2DMQA 1FJLA 3HSEA 1X1AA 4AC0A 4Y33A 2V26A 3P9IA 2VI6A 2KPMA 2MG4A 1AHDP 3TDUC 2COMA 3HHGA 4YIRX 1XSXA 4IOCF 1K4TA 3SXYA 4A12A 1TWAJ 1R7JA 2ZJPF 3F6VA 1JUSA 4A3FJ 3SHFA 1JGGA 3QRFF 3TEDA 3S16J 1WJCA 3HYIA 4O6JA 2L5QA 5F0FA 2EZHA 2P0WA 4KT5C 2EQRA 4M3BA 1MNMC 3HDDA 4J01A 3VYUB 2V6EA 3SZGA 1QPMA 5LHHA 2PJRB 1FLIA 2OUMA 2EFQA 3PO3J 3I3LA 1ONVA 1I50J 4AIJA 1WJAA 2KDOA 2O3FA 3FHZA 1HDPA 3OS2A 3KP6A 1EA3A 1ERDA 3OY9A 3D0SA 2W57A 4O3MA 1W7PD 1U78A 4Q5SF 3CD6I 3KP2A 4E7LA 1ZRDA 1W36D 1UCRA 3B6AA 3PQKA 2UZKA 3ZN1A 3H35A 3MKLA 3ISPA 3FX3A 3HM5A 3IH4A 3LSMA 1BI0A 2BYVE 3PNYA 1YW9A 1GVDA 3T5XA 1R49A 4A93J 2R5ZA 1F43A 3ZQ7A 3I54A 4BQQA 4HDVA 1B9NA 4ZYEA 1OISA 4Q4ZF 1X2MA 3HOTA 3CCUI 2CO5A 2EFWA 5IT9K 1YX3A 3BC8A 2GOMA 4NBQA 1QU3A 4ZDLA 3BTCA 3RYPA 3SEZA 1FBQA 3KP7A 5HDNA 1IDZA 4OAZA 5ICGA 1IXRC 5E3NA 2DMNA 4V2GA 2HKXA 1H88C 1FOKA 2JUCA 4D0PA 4EMSA 4HYEA 1Z3XA 3S2HJ 4FASD 3A03A 1TW3A 2DYSH 3LFKA 2MW8A 1K79A 2HVQA 1WJFA 2DOEA 4KNYA 1W5TA 2K27A 4CYCB 3KYLA 4I0BA 1WZ2A 2DK5A 4HBLA 3HTSB 5ICEA 1S72I 4IL6C 4QLCU 1HCRA 1IRZA 2M45A 2W82A 4NC6A 1H0MA 1B6AA 1BR4A 5DTDA 2H8RA 4C3JJ 3BG5A 4BEHB 2MLKA 2O03A 2DA4A 2H94A 3ZP5A 4XLCA 1BBYA 4Y17A 1IV8A 1QZZA 5E79C 3GZNB 4M9SA 3I56I 1HW5A 1RETA 3QODA 4W1UA 5FKKA 5TGTA 1Z3YA 2ZKZA 1YJ9I 2V1UA 1D8JA 3CCYA 5K5QA 3RDIA 4FX4A 2VOPA 3G6EI 3DV8A 1BI2A 1FOWA 3I4PA 2X4HA 1KA8A 2R7XA 1DGRM 2XKOA 5KK1A 3J81K 4CH7A 2VONA 3WHCA 3BR6A 3IH3A 5B1BH 2JJ7A 4BBSJ 4F3QA 1BM9A 1QHHD 3PQJA 3ABTA 4LITA 4OMZA 3CESA 3IRQA 4UUTA 3CLQA 1G3TA 2OCEA 1PP8F 3S1MJ 2P81A 2M30A 5DYMA 2HZTA 3BZCA 2UUZA 5CVVA 3ROUA 1AU7A 4IHXA 1ODDA 3RQ4A 5LRRA 4MQVA 3H3VK 3L2VA 1Z7LA 5E3OA 2OTLI 4CHUA 2K9MA 4I0AA 4D5CA 1UMQA 1YX5A 2XAQA 3A01B 4IHSA 4EGYA 2FE3A 1MH4A 4A3LJ 2YU3A 2G9WA 4HDUA 4E4HA 5D5XB 3E0JB 2A6TA 5GAHJ 2CQKA 1IN5A 2DMPA 1J09A 2L2OA 2V79A 5FRNA 3VWBA 1XD7A 3ZGKA 1FBUA 1X1CA 4C30A 1TW2A 3LOCA 3HRTA 2RAEA 2GIVA 5F0CA 3DEEA 3NWSA 3V4GA 4EVIA 3VB2A 4MHGA 1D0XA 3FKIJ 1VF9A 3JTGA 4AIKA 2FA5A 3GLLA 2MH9A 1FWZA 2GIZA 2B63J 1IRFA 2EFPA 3GBGA 4ENKA 2P7VB 4P55A 3ASNH 2A69F 1DP3A 1W7PB 4V19K 3H9GA 5CJ9A 2BY3A 6PAXA 3MZHA 1ETKA 1WH5A 2NXNB 3LMMA 4NC7A 4XRSA 2WC2A 4RGXA 1U5TB 2VKVA 1OCTC 5JR3A 3K4NA 1B1BA 2JVGA 2KIQA 1LFBA 3BR3A 3WE2A 2ME6A 4YFKF 3T8TA 1MBGA 2HPMA 4LK0F 3KFWX 4LLNA 1XCBA 2VLAA 2WA0A 2XAUA 4D5FA 2M5WA 1YW8A 5M5YJ 3UR3C 3OMYA 2JA8J 3G1LA 4BHBA 4E70A 5DEQA 5B5EC 1N25A 4MTDA 1IJWC 3I4NJ 2LY1A 2P7CB 2F5EA 3VDXA 1PUEE 4I98B 3L1PA 4XL9A 1FNNA 4XICA 5DV5A 2RKHA 3R0AA 1GV5A 2CQQA 3PNTA 3GLXA 4XRMA 3IKTA 2ME0A 3DU6A 4XNFA 4UVAA 2RQPA 5F0HA 3O6BB 2ISZA 2KZGA 2M8GX 1SAXA 4Q47A 3AKZA 2L4MA 3PUBA 2H09A 1L0OC 1ZGJA 5J47A 1FY7A 3LSKA 1R58A 4KFCA 2QSHX 2OCCH 2DA6A 3M4OJ 1Z67A 3KZZA 4IRGA 4Z6YA 1G8XA 2DXIA 2KKOA 3Q3SA 3S1QJ 3CDHA 3I71A 2E71A 3TDZC 3QP5A 4HNTA 3JRHA 1WKMA 1X1BA 3CMMA 5KHDA 1KU7A 2K9LA 2XRLA 4PFOA 5F1JA 1VTNC 3CLOA 1BA5A 1XSDA 5TISC 3GTKJ 4RB2C 3BPVA 1EF4A 1LVKA 4BQNA 3DPTA 2R7UA 4EEFG 3E5QA 1FYLA 2HQRA 1IN8A 2OA4A 3CCLI 2Z16A 2PG4A 3LSJA 2L7KA 3MFKA 3E97A 3BZ6A 3BLYA 4L9NA 3S15J 3WGHA 1DGWY 1KONA 4ZYAA 4GRIA 1SD5A 4XR6A 2ZSIB 2IXSA 5J4YA 1WWXA 3HOSA 2KFDA 1XSVA 2A6EF 2QLZA 2GXAA 1P4AA 3HPHA 3NEUA 5J40A 1KYZA 4V2FA 1REPC 4LMYA 4MFEA 4NQWA 2E7XA 1ZH5A 5LD2C 4EJTA 2EK5A 5JHFA 2Y9YA 4LG3A 5GAEJ 3DF8A 3A2KA 2OC6A 4Y7NJ 2ACJA 5IT9Z 2VXZA 1KZHA 5EYRA 1S9HA 3FBNB 4CCNA 1ZG5A 1P7IA 3FWEA 3T1BA 2KZVA 5K1YA 4IZZA 3TW7A 1ZTRA 4HX7A 2DA2A 4U0VA 5HLTA 1B8IA 1L3LA 1ACIA 4X6AJ 3KZIC 3D5LA 3FKJA 4EM0B 2L3DA 2JSPA 4RM3A 4EATA 5FLMJ 4UUSB 3LWFA 1WFXA 1G6NA 1UHSA 3RZDJ 2OF7A 2E5ZA 4H4KC 2GXGA 2EIMH 1ZLKA 1HW2A 2XSJC 1B72B 1CF7A 3WTXC 1DUXC 5LLQA 1AA7A 2E60A 3CJRB 1BI3A 2VBYA 3TL4X 1I5ZA 1W0UA 3HGGA 5HLHA 1WHUA 1DU6A 2O7OA 1X3WB 1MDMB 2Q1ZB 3C3WA 4A3CJ 1TBXA 4B3XA 1WGXA 2M8EA 3DU5A 4QPQA 2F2EA 2BZTA 1QGPA 2CJJA 1O7LA 4G8XA 2QBYA 2BGCA 5HS9A 3AAFA 2H1KA 5HVQC 4OWRB 4OIQF 2LFBA 1MBKA 3W2WA 2VJIA 3G2BA 1SFOJ 3CUQB 2EZKA 2EWNA 1NG7A 4YIIA 3I59A 2GXBA 4AYBN 2EV5A 5CVUA 3DWLE 3J81Z 2HDCA 4FETA 4AD9A 1X4OA 1JTXA 1S7OA 5LGTA 3ZOBA 4WX9A 1LB2A 1YJNI 1IN6A 2ECBA 2FJ1A 4UXNA 4YG2F 3FIWA 2RREA 2VN2A 3CJTB 3RKYA 4CCLA 3JAMK 1C0WA 5M3MJ 1X4PA 4B09A 3JTHA 5GTHC 3HOWJ 4ZYHA 1IXCA 2CW0F 3P9KA 4BY1J 2B0LA 2JUGA 2A5YB 3JW4A 2DFEA 3BROA 3LSRA 2LYCA 1DQUA 2M1BA 1TWGJ 2DFIA 1MJ9A 4CO8A 1VQOI 4HW0A 2NOJB 3R6SA 3LSGA 4QWQA 3OYKA 2XRNA 1A04A 5C3EJ 4BJTA 2XB0X 2Y2ZA 3BWGA 4XLEA 4GDFA 2LREA 4DBQA 1FMVA 2CSOA 3I58A 1XDSA 3ZMVA 3SDGA 1YYVA 4G6DA 3FF5A 2MD5A 4M3EA 2X85A 2FOWA 2V9KA 4KITB 2FRHA 3QQAA 4BHPA 2O5RA 2EV0A 3CMEI 1UFMA 1MBHA 2EFNA 2YX7A 1E17A 2E1NA 3ML6A 4LG0A 4D1QA 1J59A 2DK8A 1BIAA 4A69C 2VJ4A 1HSJA 2L7FP 1W0TA 4PGHA 4EJUA 3OOUA 1Y1WJ 5FKNA 3F8MA 3GTOJ 2XROA 1IDYA 5B66C 3ZQHA 3QPLA 4XN0A 1VQ4I 3DLLF 1D1BA 2XIGA 1I39A 4N9IA 3BJ6A 2DW4A 2R7QA 3K9TA 2L7ZA 3ZQLA 1ETVA 2JQ7A 1JKRC 1S29A 1R1VA 2B7EA 2K4JA 2Z3YA 1I27A 3REOA 4AVPA 2IP2A 1RC9A 3F72A 4KUMA 5FGMA 2HPIA 1I6XA 3C2BA 3IV5A 1QVTA 2GQQA 3FXUA 2QVOA 4DNCA 3BZKA 3CC4I 2O61A 1HLVA 4C2TA 5JLXA 4A0XA 3ABLH 5BPIA 4BHCA 1I1GA 5IT3A 2IAIA 2Q0OA 2K5CA 4CCJA 1K6YA 3BDDA 3GF2A 4IJAA 4B43A 2P5VA 1NK3P 4ENJA 1MSEC 2DDBA 2HZDA 2JTVA 4QIWN 3O2PE 4AWXB 4BYYA 3FMRA 2STTA 3BTIA 5LEKA 4RGUA 2W1OA 1MNDA 1EH7A 2NVQJ 3GTPJ 2L01A 4IXAA 3IC7A 2PQ8A 4B8XA 3MWMA 2YPRA 3WU0A 3WTZA 4KMFA 5L3BA 2IA2A 2X6YA 4CZCA 1JKQC 4XOTA 3LSIA 1LDJA 4LK1F 4KA4A 5TJJA 4AVZA 4UB6C 4ZZDA 1RR7A 1XMKA 5L3GA 3L2QA 1SEUA 3C18A 5HS8A 1R71A 2LBFA 4DZPA 2LTPA 3S3MA 4EJOA 3L00A 5DDGA 4ZTJA 2Y31A 3BG7A 1JE8A 1RESA 1PP7U 1YTYA 1SD6A 1J0RA 4PJJA 3UNGC 2UXNA 4H0EA 4MGRA 2ZXIA 1X58A 4HF1A 2PBIA 1XX5A 1LUJB 3G71I 3I9V2 3IL2A 4JP0A 4TV7A 3DEUA 1T08B 4NC8A 2OZ6A 2OQGA 2COBA 4F7ZA 1ZQ3P 4L9JA 2LLKA 1GXQA 3ASOH 5EZHA 1OLTA 3GXOA 2HR3A 3AG3H 2PMUA 4HV6A 2DMUA 2L7MP 1Y1VJ 3V8KA 4A5MA 1IC8A 2GLOA 4G6TB 2BY2A 4M9ZA 2UWMA 4LIVA 4G6QA 3S93A 2B9SA 2LP0A 1OCZH 2K86A 1V3FA 4G94A 2A6HF 1MJBA 5LFAA 2K4BA 3GFIA 4BDZA 5DCMA 4BL0B 1YRNA 2RV8A 2FEZA 2F48A 3DTEA 2YX4A 4EM1A 5DCFA 4U7DA 3DP7A 4B44A 4HQMA 2CQNA 2ISYA 3HUGB 2PMZN 1R1TA 3IAM2 1GDTA 3LFUA 1JUPA 2KIMA 2FU4A 4M6VA 1O7FA 1LJ9A 1WH7A 1X19A 2QZ8A 1S7AA 3OYFA 2K02A 4I7HA 4D7MA 2R93J 2LKPA 1FZPB 2Z9OA 2Z2SB 3DKYA 2CS3A 3CQZJ 2OU2A 4A3BJ 4I01A 3MQ0A 2ELJA 2F4OB 2ECCA 2FMLA 3HBLA 3CO6C 5IOZA 2KIUA 3CMAI 1R6RA 4F52A 2F5FA 2IA1A 1ZR2A 2NVYJ 3ZMUA 5KVRA 1QZYA 4BDYA 3J7AO 1JUMA 1OFCX 2EV6A 2P5KA 3IP4B 3NARA 4YEJA 2NRAC 2ESHA 1R36A 3H9JA 1HKTA 2QWWA 5CQEA 1GV2A 3QPSA 1MKMA 3Q0UA 4UHTA 1X1PA 3OYLA 5FD5A 4JX4A 5GPAA 4A3GJ 5DD8A 4CCMA 4RS8A 3TMOA 1R4MB 1RR8C 2HXIA 5EGOA 4YRVA 3H3UA 2RC4A 3A0HC 2XPVA 2UXXA 3WTTC 1B9MA 3BR2A 1OCOH 2GBYA 4UVBA 3OS1A 2MLGA 5CVJA 1XTAA 3KPHA 2PI0A 3VEPA 2OAZA 4A3MJ 2YU9J 2GM4A 4E7ZA 4JX5A 3JAMZ 3K69A 1JHFA 5BS6A 5D4RA 2ZFWA 4OIPF 1F5TA 3L9FA 2KQRA 2JSCA 3IH2A 1YHQI 4A3JJ 2MGQA 1BIBA 2PN6A 1BI1A 3ZR8X 3U2RA 1GHCA 3F0CA 3FK7A 5FRMA 2FNPA 4CDGA 2DYRH 3W6JB 2IGMA 1ZHFA 1JJ8C 2DCEA 4A6DA 1QBJA 3CCJI 1KU3A 2VL8A 4C3IJ 3HOUJ 3JSOA 3BG6A 5TRDA 2PJRA 2JRTA 3P5JA 1JT6A 5DD4A 2I10A 4BJ5C 5FFZA 1TT0A 3OYCA 4XMYA 4GYIA 2D1HA 1T95A 3DBLB 3PSIA 2MC4A 1P7JA 4NNJA 3MZYA 1P9QC 2P5LC 2LH9A 2EPFA 3TOBA 1O3QA 3CDIA 2HOTA 2HVRA 2ZJRF 1B4AA 3ZQCA 1BC7C 2C6YA 3K4MA 3CF2A 3I55I 1FPQA 1QPIA 2JVHA 2ZNYA 4A3KJ 2E7WA 1WJEA 4PZJA 3DPLC 4P5OA 3U1KA 2E19A 3RKWA 4A0ZA 3QOPA 3NAUA 4GXOA 5HS7A 2DA5A 1LDDA 1W4MA 3GTMJ 3L2RA 1P4XA 3GVAA 1BW6A 5D8KB 2X9DA 3JRAA 3F8BA 1GT0C 2E2IJ 2CFXA 5GTIC 4N0BA 4A3EJ 4C2UA 5LHGA 2R92J 3S1RJ 3FXQA 5J8CA 1BOAA 4BS9A 1PVEA 1Y0NA 2YR2A 1NHAA 2CYYA 3TOAA 3VOEA 1KQ8A 2NYXA 3SQNA 3ZRGA 3ERED 2VJJA 2R5ZB 4L0ZB 3RZOJ 2QGUA 4RGSA 5IOYA 4HSTA 2NS0A 1RZ4A 3LA3A 4BEHA 1A36A 3J80K 4CXFA 1IN4A 2EZIA 4WXCA 1W1WE 4HV5A 2ZB9A 5GPCA 1T8IA 3KEOA 1PYVA 1BJAA 3ONQA 3HZJA 3ZQGA 2VPRA 4AYBA 3OYMA 1KU9A 4IOAF 2MYSA 4N4NB 1SFXA 2VQHA 2VXDA 4BE1A 2CUZA 3N05A 3DBRB 4LIUA 3GX4X 2LR8A 3GTGJ 1GVJA 5J3LA 2L9SA 1DU0A 2XKPA 1FP2A 2ZXWH 2LY2A 3R61A 2QQBA 2FUG2 1A6QA 2WV1A 3WODF 2DAOA 4UUVA 4BU2A 4I6ZA 2DOAA 1ZGWA 3ZN0A 3NRVA 3E5XA 3U21A 1D0ZA 2JMWA 5HLGA 3DTKA 5K5RA 4CZZA 2M3AA 3QWLA 4ENMA 2EB7A 2LF8A 5F27A 4RGRA 4DZJA 4LJZF 2M34A 3AG1H 2Y48A 1JJ6C 1AOYA 2KRHA 2X6OA 1XN7A 1J7KA 2CWEA 2Z33A 2YS9A 2HFHA 1RPWA 3KLOA 3M8FA 2JA5J 5F08A 2EIJH 3DKXA 1O57A 3HSRA 4HLXA 4ETSA 4U0YA 3A01A 3S2DJ 4A3DJ 2DFFA 2ZSHB 2LNBA 2E1CA 2OBPA 3G1OA 1FX7A 2M0MA 2WWYA 1LVAA 1WJDA 2BHZA 1MW7A 1E3HA 3K7AJ 3VFZA 4LGWA 4M3GA 5IP9J 3MKZA 1MBEA 4M71A 4DW6A 3F6OA 3CCRI 4E7SA 1JHHA 4XOPA 3EETA 2HNHA 2WB1N 1FIAA 2EH3A 4S0HB 4ZJZA 1K4SA 5M3FJ 1IV6A 2Z99A 1ZARA 4LB5A 3H5NA 2GWRA 3T0YA 1P2FA 2CRGA 3C2HA 3CCQI 2QKMB 1QRYA 2N8GA 1W7PA 1FMWA 3V7SA 2QEXI 1BJZA 2HKOA 4N4OB 4HA8A 3FXRA 5F04A 1HSTA 1KGSA 1U5TA 4AM3A 2JZYA 2W85A 3RI4A 3BTLA 1G3WA 2XF7A 3OYHA 3KETA 1SVOA 4R79A 4BQOA 2XV4S 3BR1A 2AO9A 3BJOA 1SAUA 5EJCA 3OS0A 2E2HJ 3CUQC 3U9GA 3J7YJ 2VE9A 2OV7A 1MH3A 4JX6A 3OWTA 3W2AA 4I76A 2KHMA 2O8XA 2P6TA 3W2VA 2ZNZA 2MBFA 3VYRB 1SVMA 2CH0A 4BKXA 1UZCA 2LVSA 3RCOA 4HSRA 4L18B 4BNCA 2XC7A 3FM3A 3RYRA 4WWCA 4PGGA 4ESFA 3OYEA 1JGSA 1RKTA 2J5OA 4XM3A 1BC8C 4UVCA 3Q9VA 1XPXA 3BR0A 3LSPA 3GUDA 4BUPA 1T33A 4L9VA 3T8RA 4XQFA 3A1YA 4XKVA 1DP7P 2VQGA 1LFPA 1YQAA 1GUUA 1ZK8A 5IYBJ 2IGOA 1XMXA 4DYRA 3OYJA 1Y8QB 3BQZA 4IHWA 1YS6A 2R7ZJ 1SMTA 3PNVA 4HEA2 2DFHA 2UV1A 3L7WA 1QHGA 4MEYF 4XRSG 3FMQA 4E7KA 1MNEA 2KL4A 3KX2A 4GCVA 1FSEA 3ZMSA 1HF0A 2ZMEC 3JRIA 2J5PA 2G7UA 2WY8Q 1OPCA 4IRIA 4A5NA 4XSZF 4JYKA 3V8LA 4WK8F 3BQYA 3OYAA 2DA1A 3CMYA 2IEKA 1T0FC 2FX0A 2XB5A 2VQCA 3J7ZI 1TNTA 2NAZA 2FBHA 3CCSI 1FOYA 3W6VA 3CUOA 1U9OA 1T38A 4PJLA 4JK1X 2L02A 3PL8A 3H9QA 4BY7J 2R7TA 5C4XJ 1EJ9A 1YW7A 5IYDJ 4HZFA 2W7NA 3KYDB 1IO2A 5CPRB 3BG3A 3VODA 3I0TA 1IUFA 4XLHA 4DOZA 4DYQA 4BE0A 4IKFA 2Y75A 5JVGF 1YO5C 3SJMA 4PSWA 5KAIC 4P9UA 1H9GA 3KCCA 1DDNA 5ILUA 3H5RA 4RM2A 1TQPA 2FBIA 2X1DA 3L09A 4S05A 3MKYB 2M0CA 2PMZA 5H2FC 4CSWA 3RPUD 2O8KA 4O5VA 4IHVA 3EYYA 3SFIA 2IBDA 5J1YA 4UUSA 3HTUA 1K61A 1D5YA 3SEQA 3QU3A 1B72A 3RSNA 4UNOA 1HDDC 1LE8B 4U88A 3FBIB 2XUBA 1PUFB 4RBOA 2NNYA 1Z7UA 1TC3C 3J80Z 1NTCA 1MMNA 1S8NA 3VSKA 4RB1A 1B59A 2ZJQF 3PIPF 4ON0A 1D1CA 2VT3A 1B8IB 4AU7A 1T56A 3TO6A 1X1DA 3MCZA 4EM2A 4YFNF 4F92B 5JI6A 3B6CA 4M73A 2DMTA 2DT6A 1U9NA 3M1EA 3CUQA 2IRFG 3WG9A 3R60A 2W4SA 5LEJA 5FLVA 1KYWA 1TTYA 4M3FA 2HI3A 3PSFA 3F21A 4JOMA 4AIDA 4XKBA 1CF7B 3I53A 4M3DA 3TBIA 3FZVA 1ZR4A 2P4WA 1OJLA 2IW5A 1QZEA 4WXHA 4FE4A 5E8IA 4Q48A 1K78B 3QPTA 1J9IA 2F4MB 9ANTA 3HXLA 2R5YA 1VQ5I 1VQ9I 1TT5B 3AG4H 1E2XA 2VKEA 2BW3B 3HOZJ 1F1ZA 4A6EA 3R0JA 2BXYA 1ZELA 3V8JA 4FTHA 1T6SA 2XDVA 4N9HA 5FD6A 3GTQJ 1J75A 2W24A 2HGCA 2HS5A 1ETQA 2Z1DA 1BOBA 3E6MA 4G9YA 5KAFC 1IRXA 4LB6B 3D1NI 2KT0A 2EINH 3I59B 2M4KA 3K0LA 3ZMTA 2LDUA 1RKWA 2WAEA 3VSLA 4W97A 3OSFA 3G3ZA 4IEJA 2R4GA 2CUJA 1MSFC 4NHJA 3FHNA 2ZMEA 4PDKA 1VQMI 4GGGA 1ETOA 3AG2H 1K7AA 1AKHB 2QYOA 2ELHA 3HRUA 3K70C 3IRRA 1T0FA 4PCQA 5L3EA 4DIQA 1PDNC 4KIBA 4MO7A 1H8AC 2TCTA 3ZCOA 1V5GA 3CTAA 1LQ1A 2JWTA 4Y3OA 5IP7J 4CYDA 2LSOA 1JKPC 3OL4A 4UV9A 2VPLA 1MIJA 2ZXHA 3HPGA 5B3SH 3COAC 1X3ZB 3DFGA 3KE2A 4CUGA 2OD5A 2D2WA 2RN7A 1HKQA 2IS2A 4LOCA 2QUFA 1YE9A 2H27A 4MIMA 3HGYA 2DPUA 1WVRA 2CW7A 3HRMA 5EEGA 2HYGD 1UHMA 2RGVA 4HPQA 1VFCA 4DQ2A 3O3KA 1ZYRF 5LGNA 2JPBA 2F4IA 3IKVA 2R7RA 3S32A 4B4CA 2LRDA 4B47A 1U3EM 4HF2A 5EEAA 3UKGA 3C7JA 3BCBA 4ZZLA 3DLAA 1Y6IA 2DLLA 4IX7A 3OSGA 3F3XA 3S3OA 3CZ6A 4ZYDA 2NVUB 2V1NA 3FMSA 1VQ6I 2VKHA 1A6IA 4FCYA 2OQRA 2E34A 4ENNA 3E6DA 5CKTA 1OCRH 2JA7J 3QPHA 4MLOA 2LC2A 2CGPA 4GO1A 2IJLA 1XC5A 2D5VA 4PK4A 2XAJA 1MMGA 1MBFA 1Z77A 5F6FA 2QCOA 5C4JJ 4E7JA 1YITI 3JCUC 1WPKA 4UY8I 2WAFA 3H3ZA 3ELKA 2OPTA 2XF6A 2XPWA 5BMZA 3HC7A 4RLQA 4L0YB 4P96A 2K40A 4M9XA 1IG7A 2JA6J 2R7WA 4RAFA 2VKDA 5FB2A 3A4CA 2Y30A 2NNNA 3TQNA 1VQKI 3SZTA 2VE8A 1D1AA 1H9TA 5AIPA 2IPQX 3K4CA 1XG1A 1H89C 3I64A 3MAJA 3N97A 5CVRA 1SFKA 2FBKA 5IPAA 2CG4A 1IUYA 2XGDA 4PSXA 1A5JA 2MH2A 3OOPA 1I3QJ 2LKXA 1FT9A 2HQNA 3P7NA 3CP2A 2IGNA 3AL0B 1U2WA 2Q2EB 1APLC 3L2UA 3HB9A 1XGOA 3DXJF 2DT5A 1GLNA 2VC0A 1OYYA 4YFXF 2CV2A 4E6KG 5K7ZA 2AHQA 1Y39A 2O6GE 2WB1A 2VBZA 4DYCA 1V5FA 5FKOA 1TZLA 1VQNI 1KU2A 1F36A 3WTVC 1E3OC 1HBXG 3DEWA 5DM6F 3RTRA 2LY9A 1LNWA 4ZDOA 3FXKA 2KJBA 3K6GA 2A61A 4XKCA 2VQLA 1OR7C 4HOBA 3K4JA 4KN7X 5K5OA 4JQFA 3F8CA 1WRJA 3EUAA 2KP6A 2O9LA 3ABKH 4KT6A 5DUIA 1YRNB 3DPUA 3V7RA 3GFLA 1IF1A 4X1EA 3LAPA 1X2NA 2CUFA 4HAMA 2QA4I 2HOAA 3WTWC 5J4VA 2G7HA 3S17J 3JRDA 3DKWA 5D4SA 3PFIA 1ETYA 4XIDA 3QOEA 2KISA 1ZLJA 3KP4A 1JKOC 2XGXA 2CQXA 4DGWB 4BBRJ 1WI3A 1LEBA 5AONA 3V42A 3M3YJ 2WADA 2AQEA 5EG0A 2IA0A 5FO5A 2PX9A 3WHBA 1D3YA 1UG0A 2X1CA 3PIOF 2JT1A 2QQ9A 2RNJA 1LDKB 3O8HA 3TO9A 4PUSA 3BCAA 4RAGA 5IY5H 1Z9CA 1F9NA 1U0JA 3D5SC 1IXSB 4CCOA 4E7IA 2O0YA 2GA1A 1G3SA 1QQIA 2Z5UA 3LNQA 3GCMA 2VBWA 3TO7A 1YI2I 2BBYA 3OYDA 2RDPA 1M1EB 2P8TA 2VODA 1Q1HA 2I8DA 1XB4A 1Y56A 2ZBKA 4L5EA 3WU2C 3ZMDA 4XK4A 2VOOA 1FOXA 3H1CA 3O8GA 2H6BA 4RDUA 3H36A 4Y4RA 3PJRA 1R00A 3A0BC 1HW1A 2LMDA 2EILH 1XS9A 1R9TJ 3WE3A 1FIPA 4FE7A 1ZG3A 3G4SI 1OYIA 2IGKA 3GEZA 3K2AA 1TWCJ 2HYFA 5KCMA 1YG2A 2M9HA 3QYEA 5HOOA 3CCVI 1YIOA 2NS8A 4CCKA 2HOSA 4XLNF 1YIJI 3KP3A 2XASA 5BOXA 1UJ8A 3D5RC 2E1MB 2VT2A 1JT0A 4ESJA 2BVMA 3MEXA 2DODA 2ICWG 2F5CA 2OJED 2PFBA 1W36C 1KQ9A 3FISA 2BHYA 2L54A 2GAUA 1U5TC 1Z91A 4CA0A 1TP4A 3ULQB 2BOLA 3FXOA 1TLHB 1Z1DA 5K7HA 2JPCA 1BL0A 2MC3A 1IN7A 1BR1A 1O4XA 2E36A 2VC1A 2ID6A 1VQ7I 2DTZA 4A0YA 4HX4A 4XONA 3K4LA 4Y15A 2AXTC 2E1OA 2MA3A 3BT9A 4I02A 1VZ0A 3W3CA 1YJWI 5F1RA 1MD0A 1FSHA 4K2EA 1R1UA 4QTRA 5E20A 2ZO4A 5E17F 2FXAA 5HDKA 2DA3A 4II3A 3CCMI 4XLPF 1YFHA 1WSUA 5E8GA 1HA8A 3IUOA 5ERIA 4IHTA 5CQGA 2LOOA 4CYCA 1HQCA 1OR7A 1QO0D 4OOIA 2KRCA 1FTTA 2VUMJ
chains in the Genus database with same CATH topology
2EJRA 2EA2A 1P92A 4CGZA 3EYIA 5ED4A 1SFUA 3CJNA 3K2ZA 3E3VA 4MTEA 5ILSA 1USSA 1R23A 1FYKA 1J5YA 2VBXA 4OIRF 5H20A 3N4MA 3GWZA 2R3SA 3JSPA 2ZJ2A 4A2UA 5AIQA 4LLLA 3WGIA 2HTJA 2IVMA 4CICA 5CLSA 1ULYA 1Z6RA 1R5GA 4LLGF 2XHKA 5L3CA 1Y0UA 5CYVA 4LFUA 4KMUX 1DPRA 2A07F 2Y0MA 3TKYA 3B02A 5FLXZ 2ZCWA 5L3DA 2X0LA 1O3SA 2HEOA 1T39A 4BXUA 2DO7A 3SFZA 1T2KA 1RIOH 2V1DA 2QQAA 3OV8A 1ZAOA 5H6QA 4KN4X 1ON1A 2DI3A 3QAHA 1GXPA 2EFOA 3L2CA 2BEOA 3M7GA 3LSTA 1ZN2A 1ON2A 2YSRA 5JHUA 3E6BA 2A68F 1CGPA 1XGSA 3BOQA 2K7LA 1F4KA 4I2OA 3F22A 3W6KB 1Z6TA 5HDGA 3BPXA 3DQVC 3EDPA 5A2QZ 2PMHA 4XSXF 1EV7A 4ZYGA 3G73A 4OU0A 3E5UA 1R5HA 2PEXA 4MQ9F 2GZWA 2LF7A 3ZPLA 3K1MA 4I09A 1AWCA 2DU9A 3WTUC 3R4KA 1G3YA 5CVIA 1RUNA 3S2WA 3GW2A 1SD4A 2A3SA 3LAJA 1K6OA 4EV0A 1OYWA 1P6RA 1ZRCA 1Z05A 2KRFA 4XBFA 2QM3A 1STZA 4OMYA 1X3UA 2W25A 2XVCA 3WTYC 1I1SA 4ZH4F 1OKRA 3V7CA 5JVTA 3Q5FA 1UB9A 1MJAA 3RIRA 3RPQA 1O3TA 4EGZA 5ICFA 3GFMA 1ZG1A 1D5VA 1FBSA 4MEXF 4MNUA 1MGTA 2RVCA 4FX0A 1S3JA 4U0WA 3F23A 3QP6A 4M6XA 4NB5A 2D45A 1WQ2A 4EJVA 4RB3C 3KP5A 5ICCA 4KYWA 1DPUA 2ADUA 2EA4A 2V9VA 3H92A 5ILVA 3KLNA 1SMYF 3LQQA 3B73A 4RAZA 4GYGA 2XAFA 4FT8A 1YS7A 4HQEA 1MDMA 3EUHA 1XMAA 3IHUA 3NQOA 2GA2A 3ECHA 3WTSC 1SFEA 4RAYA 1TNSA 1OMIA 5J8FA 5BQTA 3M9AA 1K78A 1KQ0A 5E1WA 3BJAA 3LA7A 1LEAA 1BN5A 2FQ3A 4L5IA 5LBQA 4JBAA 2ETHA 2PLYA 4G7HF 1U6GA 4IRHA 4OINF 4Y13A 1QNTA 2BV6A 5D6EA 5D8LB 2QBYB 2QENA 4HLYA 1EH8A 2AS5F 5LGUA 5HLIA 1FYMA 2TDXA 1FC3A 5D5WB 2BE5F 1UHWA 2HTSA 1WI9A 1ZREA 2F5DA 2V1XA 4U7BA 3TGNA 3U1DA 3FM5A 2V6CA 5JFRA 2WV0A 1XCVA 2DTRA 1JXSA 5D5VB 3K1PA 2L4AA 2DQLA 3WU1B 2FOKA 1IW7F 2ZMEB 2DBBA 1YLFA 3LQRA 1R22A 5LHIA 2FF4A 4AIHA 5F64A 1J2XA 2OZUA 3RPUA 3IWZA 2XAGA 3K1NA 4Z2YA 4LG0B 4WF2A 3BP8A 1W5SA 3M8EA 2W84A 5L3FA 4BAYA 1IRGA 1T98A 4WXDA 3F8FA 4KIFA 5D6FA 5DUKA 3BY6A 3ABUA 4KICA 4ESBA 3WGGA 3RKXA 1XGNA 3HSFA 1O3RA 1D8KA 4ASNA 1HKSA 2AXLA 2FNAA 4M74A 3GZ5A 3HRSA 2DPDA 3HHHA 4KIGA 1IZ1A 1G4DA 2ESNA 1XGMA 2R7DA 3KZYA 1V4RA 1XDUA 3GO5A 1USTA 2KJCA 4IPAA 3KEQA 3EQLF 3CO7C 5D5UB 1TQMA 2R7FA 2H6CA 4R8HA 1TQIA 5LRSA 2Q8KA 3ZMZA 4P9FA 2WTEA 3P9CA 3ECOA 2Q2EA 1ZGAA 2P6SA 4L9TA 5EEHA 4FHTA 2FSWA 2PJPA 4BQAA 4EJWA 4OIOF 5E1XA 2FMYA 2STWA 5FFXA 3HUGA 3RJPA 4IVNA 5FLXK 1IAWA 3C1DA 2D1VA 3IWFA 3Q9SA 2DQRA 3QU6A 5H6RA 4IF4A 4M6YA 2IT0A 3I5UA 4G7OF 4LD5A 4RB0A 1MZBA 2ZXJA 5DCMB 4L5JA 2HOEA 3GYHX 2KIFA 3LA2A 2M87A 1RI7A 3GZ6A 4XRFA 1S6LA 4UV8A 1U8RA 3F8NA 5A2QK 5BPDA 4HX8A 1HXDA 4BH9A 5E18F 1RUOA 1SD7A 4S04A 1EH6A 5J6XA 4R1HA 3GFJA 1RNLA 3HIFA 3E6CC 4YIFA 4WCGA 4KDPA 2HWVA 3SZPA 5E1ZB 4G7ZF 4EQQA 4HF0A 1ZRFA 1FP1D 4M72A 1P4WA 2XAHA 3HSEA 3P9IA 3TDUC 2COMA 3HHGA 1XSXA 3SXYA 4A12A 1R7JA 3F6VA 3SHFA 3QRFF 3HYIA 4O6JA 4KT5C 1QPMA 5LHHA 1FLIA 2EFQA 1ONVA 4AIJA 2O3FA 3FHZA 3KP6A 3D0SA 2W57A 4O3MA 1W7PD 1U78A 4Q5SF 3KP2A 1ZRDA 1UCRA 3PQKA 2UZKA 3ZN1A 3ISPA 3FX3A 1BI0A 2BYVE 1YW9A 3T5XA 3ZQ7A 3I54A 4HDVA 1B9NA 4ZYEA 4Q4ZF 3HOTA 2CO5A 2EFWA 5IT9K 3RYPA 1FBQA 3KP7A 5HDNA 5ICGA 1IXRC 2HKXA 1FOKA 4D0PA 4EMSA 4HYEA 1TW3A 3LFKA 1K79A 4KNYA 1W5TA 2K27A 4I0BA 2DK5A 4HBLA 3HTSB 5ICEA 4QLCU 2M45A 1H0MA 1B6AA 2MLKA 2O03A 2H94A 3ZP5A 1BBYA 4Y17A 1QZZA 4M9SA 1HW5A 2ZKZA 2V1UA 1D8JA 5K5QA 3RDIA 4FX4A 2VOPA 3DV8A 1BI2A 3I4PA 2X4HA 1KA8A 2XKOA 5KK1A 3J81K 2VONA 1BM9A 3PQJA 3ABTA 4OMZA 3IRQA 1G3TA 1PP8F 2M30A 5DYMA 2HZTA 5CVVA 3ROUA 1ODDA 5LRRA 4MQVA 4CHUA 4I0AA 2XAQA 4IHSA 4EGYA 2FE3A 2YU3A 2G9WA 4HDUA 5D5XB 2CQKA 1IN5A 2V79A 1XD7A 1FBUA 1TW2A 3HRTA 2GIVA 3V4GA 4EVIA 3VB2A 4MHGA 3JTGA 4AIKA 2FA5A 2MH9A 1FWZA 1IRFA 2EFPA 4ENKA 2P7VB 4P55A 2A69F 1W7PB 5CJ9A 6PAXA 3MZHA 2WC2A 4RGXA 1U5TB 5JR3A 1B1BA 3WE2A 4YFKF 3T8TA 4LK0F 3KFWX 4LLNA 1XCBA 2M5WA 1YW8A 4BHBA 4E70A 5DEQA 4MTDA 2P7CB 2F5EA 1PUEE 4I98B 1FNNA 5DV5A 2RKHA 3R0AA 3GLXA 3IKTA 4UVAA 2RQPA 3O6BB 2ISZA 1SAXA 4Q47A 2L4MA 2H09A 1L0OC 1ZGJA 1FY7A 1R58A 4KFCA 3KZZA 4IRGA 2KKOA 3CDHA 3I71A 3TDZC 3QP5A 1WKMA 1KU7A 1VTNC 3CLOA 1XSDA 4RB2C 3BPVA 3DPTA 3E5QA 1FYLA 2HQRA 1IN8A 2OA4A 2PG4A 3MFKA 3E97A 3BZ6A 4L9NA 3WGHA 1SD5A 1WWXA 3HOSA 1XSVA 2A6EF 2QLZA 1P4AA 3NEUA 1KYZA 1REPC 4LMYA 4NQWA 2E7XA 1ZH5A 4EJTA 2EK5A 3DF8A 2ACJA 5IT9Z 2VXZA 1ZG5A 5K1YA 3FWEA 3T1BA 4HX7A 4U0VA 1L3LA 3D5LA 4EM0B 2L3DA 3LWFA 1G6NA 2GXGA 1ZLKA 1HW2A 1CF7A 3WTXC 1DUXC 5LLQA 1BI3A 2VBYA 1I5ZA 5HLHA 1MDMB 3C3WA 1TBXA 2M8EA 2F2EA 1QGPA 1O7LA 4G8XA 2QBYA 2BGCA 5HS9A 3AAFA 5HVQC 4OIQF 3CUQB 2EWNA 4YIIA 3I59A 2GXBA 2EV5A 5CVUA 3J81Z 2HDCA 4AD9A 1S7OA 5LGTA 4WX9A 1LB2A 1IN6A 4UXNA 4YG2F 2VN2A 3RKYA 3JAMK 1C0WA 4B09A 3JTHA 4ZYHA 1IXCA 2CW0F 3P9KA 2B0LA 2A5YB 3JW4A 3BROA 2M1BA 2DFIA 1MJ9A 4CO8A 4HW0A 3R6SA 4QWQA 2XRNA 1A04A 3BWGA 2CSOA 3I58A 1XDSA 3ZMVA 1YYVA 4G6DA 3FF5A 2MD5A 2FRHA 4BHPA 2EV0A 1UFMA 2YX7A 2EFNA 1E17A 2E1NA 3ML6A 4LG0A 1J59A 2DK8A 1BIAA 1HSJA 4PGHA 4EJUA 3F8MA 2XROA 2XIGA 4N9IA 3BJ6A 2DW4A 3K9TA 1S29A 1R1VA 2K4JA 2Z3YA 3REOA 1I27A 4AVPA 2IP2A 3F72A 4KUMA 5FGMA 1I6XA 2GQQA 3FXUA 2QVOA 4DNCA 2O61A 4A0XA 5BPIA 4BHCA 1I1GA 5IT3A 2Q0OA 3BDDA 3GF2A 4IJAA 2P5VA 4ENJA 2JTVA 3O2PE 4AWXB 4BYYA 3FMRA 2STTA 5LEKA 4RGUA 1EH7A 2L01A 4IXAA 3IC7A 2PQ8A 4B8XA 3MWMA 2YPRA 3WU0A 3WTZA 4KMFA 5L3BA 2IA2A 1LDJA 4LK1F 4KA4A 5TJJA 4ZZDA 5L3GA 1XMKA 3C18A 5HS8A 4EJOA 3L00A 5DDGA 1JE8A 1PP7U 1YTYA 1SD6A 1J0RA 4H0EA 2UXNA 4MGRA 4HF1A 2PBIA 3IL2A 4TV7A 3DEUA 4F7ZA 2OZ6A 2OQGA 4L9JA 1GXQA 3GXOA 2HR3A 2PMUA 4HV6A 3V8KA 4A5MA 4M9ZA 2UWMA 4G6QA 2K86A 1V3FA 4G94A 2A6HF 1MJBA 2K4BA 3GFIA 5DCMA 2RV8A 2FEZA 2YX4A 4EM1A 5DCFA 4U7DA 3DP7A 4HQMA 2ISYA 1R1TA 2KIMA 2FU4A 1O7FA 1LJ9A 2QZ8A 1S7AA 2K02A 4I7HA 2LKPA 1FZPB 2Z9OA 2OU2A 4I01A 3MQ0A 2FMLA 3CO6C 2KIUA 2F5FA 2IA1A 3ZMUA 5KVRA 1QZYA 3J7AO 2P5KA 2EV6A 2NRAC 2ESHA 1R36A 1HKTA 2QWWA 1MKMA 4UHTA 5FD5A 5DD8A 4RS8A 3H3UA 2RC4A 2UXXA 3WTTC 1B9MA 4UVBA 2MLGA 5CVJA 2PI0A 3VEPA 2OAZA 3JAMZ 3K69A 1JHFA 5BS6A 5D4RA 2ZFWA 4OIPF 1F5TA 3L9FA 2JSCA 2PN6A 1BIBA 1BI1A 3U2RA 1GHCA 2FNPA 4CDGA 3W6JB 1ZHFA 4A6DA 1QBJA 1KU3A 3JSOA 5TRDA 2JRTA 5DD4A 5FFZA 4GYIA 2D1HA 3MZYA 2P5LC 3TOBA 1O3QA 1B4AA 1BC7C 2C6YA 1FPQA 2ZNYA 2E7WA 4PZJA 3DPLC 4P5OA 3RKWA 4A0ZA 3QOPA 4GXOA 5HS7A 1LDDA 1W4MA 1P4XA 3GVAA 5D8KB 3F8BA 2CFXA 4N0BA 5LHGA 3FXQA 5J8CA 1BOAA 2YR2A 1NHAA 2CYYA 3TOAA 3VOEA 1KQ8A 2NYXA 3SQNA 3ERED 4L0ZB 4RGSA 2NS0A 1RZ4A 3LA3A 3J80K 4CXFA 1IN4A 4WXCA 4HV5A 3KEOA 1BJAA 1KU9A 1SFXA 3GX4X 1GVJA 2XKPA 1FP2A 3R61A 2QQBA 3WODF 2DAOA 4UUVA 3ZN0A 3NRVA 3E5XA 5HLGA 5K5RA 4CZZA 4ENMA 2EB7A 2LF8A 4RGRA 4LJZF 2Y48A 1AOYA 1XN7A 1J7KA 2CWEA 2Z33A 2HFHA 3KLOA 3M8FA 1O57A 3HSRA 4HLXA 4ETSA 4U0YA 2LNBA 2E1CA 2OBPA 1FX7A 2WWYA 1LVAA 3VFZA 4LGWA 4M71A 3F6OA 1JHHA 3EETA 2Z99A 1ZARA 4LB5A 3T0YA 2GWRA 1P2FA 1W7PA 3V7SA 2HKOA 4HA8A 3FXRA 1HSTA 1KGSA 1U5TA 2JZYA 2W85A 3RI4A 1G3WA 3KETA 4R79A 2XV4S 3BJOA 3CUQC 3U9GA 2VE9A 2O8XA 2P6TA 2ZNZA 2MBFA 4L18B 4BNCA 3FM3A 3RYRA 4WWCA 4PGGA 4ESFA 1JGSA 2J5OA 1BC8C 4UVCA 3Q9VA 3GUDA 4L9VA 3T8RA 1DP7P 1YQAA 1YS6A 1SMTA 3L7WA 4MEYF 3FMQA 4GCVA 1FSEA 3ZMSA 2J5PA 2G7UA 1OPCA 4IRIA 4A5NA 4XSZF 3V8LA 4WK8F 1TNTA 2NAZA 2FBHA 3CUOA 1T38A 4JK1X 2L02A 1YW7A 4HZFA 3VODA 3I0TA 2Y75A 1YO5C 4P9UA 1H9GA 3KCCA 1DDNA 5ILUA 1TQPA 2FBIA 3L09A 4S05A 4O5VA 3EYYA 3HTUA 3QU3A 4UNOA 4U88A 2XUBA 2NNYA 1Z7UA 3J80Z 1S8NA 4RB1A 1B59A 4ON0A 2VT3A 3TO6A 4YFNF 3MCZA 4EM2A 5JI6A 4M73A 3M1EA 2IRFG 3CUQA 3WG9A 3R60A 5LEJA 1KYWA 1TTYA 3F21A 1CF7B 3I53A 3FZVA 2P4WA 2IW5A 4WXHA 5E8IA 4Q48A 1K78B 3QPTA 1J9IA 1E2XA 4A6EA 1F1ZA 3R0JA 3V8JA 1T6SA 4N9HA 5FD6A 1J75A 2W24A 2HGCA 2HS5A 4G9YA 3E6MA 4LB6B 3I59B 3K0LA 3ZMTA 2LDUA 3G3ZA 4NHJA 2ZMEA 4PDKA 4GGGA 1K7AA 2QYOA 2ELHA 3HRUA 3IRRA 1T0FA 4PCQA 5L3EA 1PDNC 4KIBA 3CTAA 1LQ1A 4CYDA 2LSOA 4UV9A 3COAC 3DFGA 3KE2A 2OD5A 2D2WA 2RN7A 1HKQA 2QUFA 2H27A 2DPUA 3HRMA 5EEGA 2HYGD 1UHMA 2RGVA 4DQ2A 3O3KA 1ZYRF 5LGNA 2JPBA 3IKVA 1U3EM 4HF2A 3C7JA 4ZZLA 2DLLA 3F3XA 4ZYDA 3FMSA 2OQRA 4ENNA 3E6DA 3QPHA 2CGPA 4GO1A 2IJLA 2XAJA 5F6FA 3H3ZA 3ELKA 5BMZA 4L0YB 4P96A 4M9XA 5FB2A 2NNNA 3TQNA 3SZTA 2VE8A 1H9TA 5AIPA 2IPQX 3I64A 3MAJA 3N97A 5CVRA 2FBKA 2CG4A 1IUYA 2MH2A 3OOPA 1FT9A 2HQNA 3P7NA 1U2WA 1XGOA 3DXJF 2DT5A 2VC0A 1OYYA 4YFXF 2O6GE 2VBZA 1KU2A 3WTVC 1HBXG 3RTRA 1LNWA 2KJBA 2A61A 4HOBA 5K5OA 4KN7X 4JQFA 3F8CA 1WRJA 5DUIA 3V7RA 3GFLA 1IF1A 3LAPA 4HAMA 3WTWC 2G7HA 3DKWA 5D4SA 3PFIA 1ZLJA 3KP4A 2XGXA 1LEBA 5AONA 2IA0A 5FO5A 1D3YA 2JT1A 2QQ9A 2RNJA 1LDKB 3TO9A 1Z9CA 1F9NA 1IXSB 2O0YA 2GA1A 1G3SA 1QQIA 2Z5UA 2VBWA 3TO7A 2BBYA 2RDPA 2P8TA 2VODA 1Q1HA 2ZBKA 1XB4A 3ZMDA 2VOOA 2H6BA 1R00A 1HW1A 3WE3A 1ZG3A 1OYIA 3GEZA 2HYFA 1YG2A 5HOOA 1YIOA 4XLNF 3KP3A 2XASA 5BOXA 2VT2A 4ESJA 3MEXA 2F5CA 2PFBA 1KQ9A 2L54A 2GAUA 1U5TC 1Z91A 3ULQB 1TLHB 1Z1DA 2JPCA 2MC3A 1IN7A 2VC1A 4A0YA 4HX4A 4Y15A 2MA3A 4I02A 5F1RA 1MD0A 1FSHA 4K2EA 1R1UA 5E20A 2ZO4A 5E17F 2FXAA 5HDKA 4XLPF 1YFHA 1WSUA 5E8GA 5ERIA 4IHTA 1HQCA 1OR7A 1QO0D 4OOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJR A;  2EA2 A;  1P92 A;  4CGZ A;  3EYI A;  5ED4 A;  1SFU A;  3CJN A;  3K2Z A;  3E3V A;  4MTE A;  5ILS A;  1USS A;  1R23 A;  1FYK A;  1J5Y A;  2VBX A;  4OIR F;  5H20 A;  3N4M A;  3GWZ A;  2R3S A;  3JSP A;  2ZJ2 A;  4A2U A;  5AIQ A;  4LLL A;  3WGI A;  2HTJ A;  2IVM A;  4CIC A;  5CLS A;  1ULY A;  1Z6R A;  1R5G A;  4LLG F;  2XHK A;  5L3C A;  1Y0U A;  5CYV A;  4LFU A;  4KMU X;  1DPR A;  2A07 F;  2Y0M A;  3TKY A;  3B02 A;  5FLX Z;  2ZCW A;  5L3D A;  2X0L A;  1O3S A;  2HEO A;  1T39 A;  4BXU A;  2DO7 A;  3SFZ A;  1T2K A;  1RIO H;  2V1D A;  2QQA A;  3OV8 A;  1ZAO A;  5H6Q A;  4KN4 X;  1ON1 A;  2DI3 A;  3QAH A;  1GXP A;  2EFO A;  3L2C A;  2BEO A;  3M7G A;  3LST A;  1ZN2 A;  1ON2 A;  2YSR A;  5JHU A;  3E6B A;  2A68 F;  1CGP A;  1XGS A;  3BOQ A;  2K7L A;  1F4K A;  4I2O A;  3F22 A;  3W6K B;  1Z6T A;  5HDG A;  3BPX A;  3DQV C;  3EDP A;  5A2Q Z;  2PMH A;  4XSX F;  1EV7 A;  4ZYG A;  3G73 A;  4OU0 A;  3E5U A;  1R5H A;  2PEX A;  4MQ9 F;  2GZW A;  2LF7 A;  3ZPL A;  3K1M A;  4I09 A;  1AWC A;  2DU9 A;  3WTU C;  3R4K A;  1G3Y A;  5CVI A;  1RUN A;  3S2W A;  3GW2 A;  1SD4 A;  2A3S A;  3LAJ A;  1K6O A;  4EV0 A;  1OYW A;  1P6R A;  1ZRC A;  1Z05 A;  2KRF A;  4XBF A;  2QM3 A;  1STZ A;  4OMY A;  1X3U A;  2W25 A;  2XVC A;  3WTY C;  1I1S A;  4ZH4 F;  1OKR A;  3V7C A;  5JVT A;  3Q5F A;  1UB9 A;  1MJA A;  3RIR A;  3RPQ A;  1O3T A;  4EGZ A;  5ICF A;  3GFM A;  1ZG1 A;  1D5V A;  1FBS A;  4MEX F;  4MNU A;  1MGT A;  2RVC A;  4FX0 A;  1S3J A;  4U0W A;  3F23 A;  3QP6 A;  4M6X A;  4NB5 A;  2D45 A;  1WQ2 A;  4EJV A;  4RB3 C;  3KP5 A;  5ICC A;  4KYW A;  1DPU A;  2ADU A;  2EA4 A;  2V9V A;  3H92 A;  5ILV A;  3KLN A;  1SMY F;  3LQQ A;  3B73 A;  4RAZ A;  4GYG A;  2XAF A;  4FT8 A;  1YS7 A;  4HQE A;  1MDM A;  3EUH A;  1XMA A;  3IHU A;  3NQO A;  2GA2 A;  3ECH A;  3WTS C;  1SFE A;  4RAY A;  1TNS A;  1OMI A;  5J8F A;  5BQT A;  3M9A A;  1K78 A;  1KQ0 A;  5E1W A;  3BJA A;  3LA7 A;  1LEA A;  1BN5 A;  2FQ3 A;  4L5I A;  5LBQ A;  4JBA A;  2ETH A;  2PLY A;  4G7H F;  1U6G A;  4IRH A;  4OIN F;  4Y13 A;  1QNT A;  2BV6 A;  5D6E A;  5D8L B;  2QBY B;  2QEN A;  4HLY A;  1EH8 A;  2AS5 F;  5LGU A;  5HLI A;  1FYM A;  2TDX A;  1FC3 A;  5D5W B;  2BE5 F;  1UHW A;  2HTS A;  1WI9 A;  1ZRE A;  2F5D A;  2V1X A;  4U7B A;  3TGN A;  3U1D A;  3FM5 A;  2V6C A;  5JFR A;  2WV0 A;  1XCV A;  2DTR A;  1JXS A;  5D5V B;  3K1P A;  2L4A A;  2DQL A;  3WU1 B;  2FOK A;  1IW7 F;  2ZME B;  2DBB A;  1YLF A;  3LQR A;  1R22 A;  5LHI A;  2FF4 A;  4AIH A;  5F64 A;  1J2X A;  2OZU A;  3RPU A;  3IWZ A;  2XAG A;  3K1N A;  4Z2Y A;  4LG0 B;  4WF2 A;  3BP8 A;  1W5S A;  3M8E A;  2W84 A;  5L3F A;  4BAY A;  1IRG A;  1T98 A;  4WXD A;  3F8F A;  4KIF A;  5D6F A;  5DUK A;  3BY6 A;  3ABU A;  4KIC A;  4ESB A;  3WGG A;  3RKX A;  1XGN A;  3HSF A;  1O3R A;  1D8K A;  4ASN A;  1HKS A;  2AXL A;  2FNA A;  4M74 A;  3GZ5 A;  3HRS A;  2DPD A;  3HHH A;  4KIG A;  1IZ1 A;  1G4D A;  2ESN A;  1XGM A;  2R7D A;  3KZY A;  1V4R A;  1XDU A;  3GO5 A;  1UST A;  2KJC A;  4IPA A;  3KEQ A;  3EQL F;  3CO7 C;  5D5U B;  1TQM A;  2R7F A;  2H6C A;  4R8H A;  1TQI A;  5LRS A;  2Q8K A;  3ZMZ A;  4P9F A;  2WTE A;  3P9C A;  3ECO A;  2Q2E A;  1ZGA A;  2P6S A;  4L9T A;  5EEH A;  4FHT A;  2FSW A;  2PJP A;  4BQA A;  4EJW A;  4OIO F;  5E1X A;  2FMY A;  2STW A;  5FFX A;  3HUG A;  3RJP A;  4IVN A;  5FLX K;  1IAW A;  3C1D A;  2D1V A;  3IWF A;  3Q9S A;  2DQR A;  3QU6 A;  5H6R A;  4IF4 A;  4M6Y A;  2IT0 A;  3I5U A;  4G7O F;  4LD5 A;  4RB0 A;  1MZB A;  2ZXJ A;  5DCM B;  4L5J A;  2HOE A;  3GYH X;  2KIF A;  3LA2 A;  2M87 A;  1RI7 A;  3GZ6 A;  4XRF A;  1S6L A;  4UV8 A;  1U8R A;  3F8N A;  5A2Q K;  5BPD A;  4HX8 A;  1HXD A;  4BH9 A;  5E18 F;  1RUO A;  1SD7 A;  4S04 A;  1EH6 A;  5J6X A;  4R1H A;  3GFJ A;  1RNL A;  3HIF A;  3E6C C;  4YIF A;  4WCG A;  4KDP A;  2HWV A;  3SZP A;  5E1Z B;  4G7Z F;  4EQQ A;  4HF0 A;  1ZRF A;  1FP1 D;  4M72 A;  1P4W A;  2XAH A;  3HSE A;  3P9I A;  3TDU C;  2COM A;  3HHG A;  1XSX A;  3SXY A;  4A12 A;  1R7J A;  3F6V A;  3SHF A;  3QRF F;  3HYI A;  4O6J A;  4KT5 C;  1QPM A;  5LHH A;  1FLI A;  2EFQ A;  1ONV A;  4AIJ A;  2O3F A;  3FHZ A;  3KP6 A;  3D0S A;  2W57 A;  4O3M A;  1W7P D;  1U78 A;  4Q5S F;  3KP2 A;  1ZRD A;  1UCR A;  3PQK A;  2UZK A;  3ZN1 A;  3ISP A;  3FX3 A;  1BI0 A;  2BYV E;  1YW9 A;  3T5X A;  3ZQ7 A;  3I54 A;  4HDV A;  1B9N A;  4ZYE A;  4Q4Z F;  3HOT A;  2CO5 A;  2EFW A;  5IT9 K;  3RYP A;  1FBQ A;  3KP7 A;  5HDN A;  5ICG A;  1IXR C;  2HKX A;  1FOK A;  4D0P A;  4EMS A;  4HYE A;  1TW3 A;  3LFK A;  1K79 A;  4KNY A;  1W5T A;  2K27 A;  4I0B A;  2DK5 A;  4HBL A;  3HTS B;  5ICE A;  4QLC U;  2M45 A;  1H0M A;  1B6A A;  2MLK A;  2O03 A;  2H94 A;  3ZP5 A;  1BBY A;  4Y17 A;  1QZZ A;  4M9S A;  1HW5 A;  2ZKZ A;  2V1U A;  1D8J A;  5K5Q A;  3RDI A;  4FX4 A;  2VOP A;  3DV8 A;  1BI2 A;  3I4P A;  2X4H A;  1KA8 A;  2XKO A;  5KK1 A;  3J81 K;  2VON A;  1BM9 A;  3PQJ A;  3ABT A;  4OMZ A;  3IRQ A;  1G3T A;  1PP8 F;  2M30 A;  5DYM A;  2HZT A;  5CVV A;  3ROU A;  1ODD A;  5LRR A;  4MQV A;  4CHU A;  4I0A A;  2XAQ A;  4IHS A;  4EGY A;  2FE3 A;  2YU3 A;  2G9W A;  4HDU A;  5D5X B;  2CQK A;  1IN5 A;  2V79 A;  1XD7 A;  1FBU A;  1TW2 A;  3HRT A;  2GIV A;  3V4G A;  4EVI A;  3VB2 A;  4MHG A;  3JTG A;  4AIK A;  2FA5 A;  2MH9 A;  1FWZ A;  1IRF A;  2EFP A;  4ENK A;  2P7V B;  4P55 A;  2A69 F;  1W7P B;  5CJ9 A;  6PAX A;  3MZH A;  2WC2 A;  4RGX A;  1U5T B;  5JR3 A;  1B1B A;  3WE2 A;  4YFK F;  3T8T A;  4LK0 F;  3KFW X;  4LLN A;  1XCB A;  2M5W A;  1YW8 A;  4BHB A;  4E70 A;  5DEQ A;  4MTD A;  2P7C B;  2F5E A;  1PUE E;  4I98 B;  1FNN A;  5DV5 A;  2RKH A;  3R0A A;  3GLX A;  3IKT A;  4UVA A;  2RQP A;  3O6B B;  2ISZ A;  1SAX A;  4Q47 A;  2L4M A;  2H09 A;  1L0O C;  1ZGJ A;  1FY7 A;  1R58 A;  4KFC A;  3KZZ A;  4IRG A;  2KKO A;  3CDH A;  3I71 A;  3TDZ C;  3QP5 A;  1WKM A;  1KU7 A;  1VTN C;  3CLO A;  1XSD A;  4RB2 C;  3BPV A;  3DPT A;  3E5Q A;  1FYL A;  2HQR A;  1IN8 A;  2OA4 A;  2PG4 A;  3MFK A;  3E97 A;  3BZ6 A;  4L9N A;  3WGH A;  1SD5 A;  1WWX A;  3HOS A;  1XSV A;  2A6E F;  2QLZ A;  1P4A A;  3NEU A;  1KYZ A;  1REP C;  4LMY A;  4NQW A;  2E7X A;  1ZH5 A;  4EJT A;  2EK5 A;  3DF8 A;  2ACJ A;  5IT9 Z;  2VXZ A;  1ZG5 A;  5K1Y A;  3FWE A;  3T1B A;  4HX7 A;  4U0V A;  1L3L A;  3D5L A;  4EM0 B;  2L3D A;  3LWF A;  1G6N A;  2GXG A;  1ZLK A;  1HW2 A;  1CF7 A;  3WTX C;  1DUX C;  5LLQ A;  1BI3 A;  2VBY A;  1I5Z A;  5HLH A;  1MDM B;  3C3W A;  1TBX A;  2M8E A;  2F2E A;  1QGP A;  1O7L A;  4G8X A;  2QBY A;  2BGC A;  5HS9 A;  3AAF A;  5HVQ C;  4OIQ F;  3CUQ B;  2EWN A;  4YII A;  3I59 A;  2GXB A;  2EV5 A;  5CVU A;  3J81 Z;  2HDC A;  4AD9 A;  1S7O A;  5LGT A;  4WX9 A;  1LB2 A;  1IN6 A;  4UXN A;  4YG2 F;  2VN2 A;  3RKY A;  3JAM K;  1C0W A;  4B09 A;  3JTH A;  4ZYH A;  1IXC A;  2CW0 F;  3P9K A;  2B0L A;  2A5Y B;  3JW4 A;  3BRO A;  2M1B A;  2DFI A;  1MJ9 A;  4CO8 A;  4HW0 A;  3R6S A;  4QWQ A;  2XRN A;  1A04 A;  3BWG A;  2CSO A;  3I58 A;  1XDS A;  3ZMV A;  1YYV A;  4G6D A;  3FF5 A;  2MD5 A;  2FRH A;  4BHP A;  2EV0 A;  1UFM A;  2YX7 A;  2EFN A;  1E17 A;  2E1N A;  3ML6 A;  4LG0 A;  1J59 A;  2DK8 A;  1BIA A;  1HSJ A;  4PGH A;  4EJU A;  3F8M A;  2XRO A;  2XIG A;  4N9I A;  3BJ6 A;  2DW4 A;  3K9T A;  1S29 A;  1R1V A;  2K4J A;  2Z3Y A;  3REO A;  1I27 A;  4AVP A;  2IP2 A;  3F72 A;  4KUM A;  5FGM A;  1I6X A;  2GQQ A;  3FXU A;  2QVO A;  4DNC A;  2O61 A;  4A0X A;  5BPI A;  4BHC A;  1I1G A;  5IT3 A;  2Q0O A;  3BDD A;  3GF2 A;  4IJA A;  2P5V A;  4ENJ A;  2JTV A;  3O2P E;  4AWX B;  4BYY A;  3FMR A;  2STT A;  5LEK A;  4RGU A;  1EH7 A;  2L01 A;  4IXA A;  3IC7 A;  2PQ8 A;  4B8X A;  3MWM A;  2YPR A;  3WU0 A;  3WTZ A;  4KMF A;  5L3B A;  2IA2 A;  1LDJ A;  4LK1 F;  4KA4 A;  5TJJ A;  4ZZD A;  5L3G A;  1XMK A;  3C18 A;  5HS8 A;  4EJO A;  3L00 A;  5DDG A;  1JE8 A;  1PP7 U;  1YTY A;  1SD6 A;  1J0R A;  4H0E A;  2UXN A;  4MGR A;  4HF1 A;  2PBI A;  3IL2 A;  4TV7 A;  3DEU A;  4F7Z A;  2OZ6 A;  2OQG A;  4L9J A;  1GXQ A;  3GXO A;  2HR3 A;  2PMU A;  4HV6 A;  3V8K A;  4A5M A;  4M9Z A;  2UWM A;  4G6Q A;  2K86 A;  1V3F A;  4G94 A;  2A6H F;  1MJB A;  2K4B A;  3GFI A;  5DCM A;  2RV8 A;  2FEZ A;  2YX4 A;  4EM1 A;  5DCF A;  4U7D A;  3DP7 A;  4HQM A;  2ISY A;  1R1T A;  2KIM A;  2FU4 A;  1O7F A;  1LJ9 A;  2QZ8 A;  1S7A A;  2K02 A;  4I7H A;  2LKP A;  1FZP B;  2Z9O A;  2OU2 A;  4I01 A;  3MQ0 A;  2FML A;  3CO6 C;  2KIU A;  2F5F A;  2IA1 A;  3ZMU A;  5KVR A;  1QZY A;  3J7A O;  2P5K A;  2EV6 A;  2NRA C;  2ESH A;  1R36 A;  1HKT A;  2QWW A;  1MKM A;  4UHT A;  5FD5 A;  5DD8 A;  4RS8 A;  3H3U A;  2RC4 A;  2UXX A;  3WTT C;  1B9M A;  4UVB A;  2MLG A;  5CVJ A;  2PI0 A;  3VEP A;  2OAZ A;  3JAM Z;  3K69 A;  1JHF A;  5BS6 A;  5D4R A;  2ZFW A;  4OIP F;  1F5T A;  3L9F A;  2JSC A;  2PN6 A;  1BIB A;  1BI1 A;  3U2R A;  1GHC A;  2FNP A;  4CDG A;  3W6J B;  1ZHF A;  4A6D A;  1QBJ A;  1KU3 A;  3JSO A;  5TRD A;  2JRT A;  5DD4 A;  5FFZ A;  4GYI A;  2D1H A;  3MZY A;  2P5L C;  3TOB A;  1O3Q A;  1B4A A;  1BC7 C;  2C6Y A;  1FPQ A;  2ZNY A;  2E7W A;  4PZJ A;  3DPL C;  4P5O A;  3RKW A;  4A0Z A;  3QOP A;  4GXO A;  5HS7 A;  1LDD A;  1W4M A;  1P4X A;  3GVA A;  5D8K B;  3F8B A;  2CFX A;  4N0B A;  5LHG A;  3FXQ A;  5J8C A;  1BOA A;  2YR2 A;  1NHA A;  2CYY A;  3TOA A;  3VOE A;  1KQ8 A;  2NYX A;  3SQN A;  3ERE D;  4L0Z B;  4RGS A;  2NS0 A;  1RZ4 A;  3LA3 A;  3J80 K;  4CXF A;  1IN4 A;  4WXC A;  4HV5 A;  3KEO A;  1BJA A;  1KU9 A;  1SFX A;  3GX4 X;  1GVJ A;  2XKP A;  1FP2 A;  3R61 A;  2QQB A;  3WOD F;  2DAO A;  4UUV A;  3ZN0 A;  3NRV A;  3E5X A;  5HLG A;  5K5R A;  4CZZ A;  4ENM A;  2EB7 A;  2LF8 A;  4RGR A;  4LJZ F;  2Y48 A;  1AOY A;  1XN7 A;  1J7K A;  2CWE A;  2Z33 A;  2HFH A;  3KLO A;  3M8F A;  1O57 A;  3HSR A;  4HLX A;  4ETS A;  4U0Y A;  2LNB A;  2E1C A;  2OBP A;  1FX7 A;  2WWY A;  1LVA A;  3VFZ A;  4LGW A;  4M71 A;  3F6O A;  1JHH A;  3EET A;  2Z99 A;  1ZAR A;  4LB5 A;  3T0Y A;  2GWR A;  1P2F A;  1W7P A;  3V7S A;  2HKO A;  4HA8 A;  3FXR A;  1HST A;  1KGS A;  1U5T A;  2JZY A;  2W85 A;  3RI4 A;  1G3W A;  3KET A;  4R79 A;  2XV4 S;  3BJO A;  3CUQ C;  3U9G A;  2VE9 A;  2O8X A;  2P6T A;  2ZNZ A;  2MBF A;  4L18 B;  4BNC A;  3FM3 A;  3RYR A;  4WWC A;  4PGG A;  4ESF A;  1JGS A;  2J5O A;  1BC8 C;  4UVC A;  3Q9V A;  3GUD A;  4L9V A;  3T8R A;  1DP7 P;  1YQA A;  1YS6 A;  1SMT A;  3L7W A;  4MEY F;  3FMQ A;  4GCV A;  1FSE A;  3ZMS A;  2J5P A;  2G7U A;  1OPC A;  4IRI A;  4A5N A;  4XSZ F;  3V8L A;  4WK8 F;  1TNT A;  2NAZ A;  2FBH A;  3CUO A;  1T38 A;  4JK1 X;  2L02 A;  1YW7 A;  4HZF A;  3VOD A;  3I0T A;  2Y75 A;  1YO5 C;  4P9U A;  1H9G A;  3KCC A;  1DDN A;  5ILU A;  1TQP A;  2FBI A;  3L09 A;  4S05 A;  4O5V A;  3EYY A;  3HTU A;  3QU3 A;  4UNO A;  4U88 A;  2XUB A;  2NNY A;  1Z7U A;  3J80 Z;  1S8N A;  4RB1 A;  1B59 A;  4ON0 A;  2VT3 A;  3TO6 A;  4YFN F;  3MCZ A;  4EM2 A;  5JI6 A;  4M73 A;  3M1E A;  2IRF G;  3CUQ A;  3WG9 A;  3R60 A;  5LEJ A;  1KYW A;  1TTY A;  3F21 A;  1CF7 B;  3I53 A;  3FZV A;  2P4W A;  2IW5 A;  4WXH A;  5E8I A;  4Q48 A;  1K78 B;  3QPT A;  1J9I A;  1E2X A;  4A6E A;  1F1Z A;  3R0J A;  3V8J A;  1T6S A;  4N9H A;  5FD6 A;  1J75 A;  2W24 A;  2HGC A;  2HS5 A;  4G9Y A;  3E6M A;  4LB6 B;  3I59 B;  3K0L A;  3ZMT A;  2LDU A;  3G3Z A;  4NHJ A;  2ZME A;  4PDK A;  4GGG A;  1K7A A;  2QYO A;  2ELH A;  3HRU A;  3IRR A;  1T0F A;  4PCQ A;  5L3E A;  1PDN C;  4KIB A;  3CTA A;  1LQ1 A;  4CYD A;  2LSO A;  4UV9 A;  3COA C;  3DFG A;  3KE2 A;  2OD5 A;  2D2W A;  2RN7 A;  1HKQ A;  2QUF A;  2H27 A;  2DPU A;  3HRM A;  5EEG A;  2HYG D;  1UHM A;  2RGV A;  4DQ2 A;  3O3K A;  1ZYR F;  5LGN A;  2JPB A;  3IKV A;  1U3E M;  4HF2 A;  3C7J A;  4ZZL A;  2DLL A;  3F3X A;  4ZYD A;  3FMS A;  2OQR A;  4ENN A;  3E6D A;  3QPH A;  2CGP A;  4GO1 A;  2IJL A;  2XAJ A;  5F6F A;  3H3Z A;  3ELK A;  5BMZ A;  4L0Y B;  4P96 A;  4M9X A;  5FB2 A;  2NNN A;  3TQN A;  3SZT A;  2VE8 A;  1H9T A;  5AIP A;  2IPQ X;  3I64 A;  3MAJ A;  3N97 A;  5CVR A;  2FBK A;  2CG4 A;  1IUY A;  2MH2 A;  3OOP A;  1FT9 A;  2HQN A;  3P7N A;  1U2W A;  1XGO A;  3DXJ F;  2DT5 A;  2VC0 A;  1OYY A;  4YFX F;  2O6G E;  2VBZ A;  1KU2 A;  3WTV C;  1HBX G;  3RTR A;  1LNW A;  2KJB A;  2A61 A;  4HOB A;  5K5O A;  4KN7 X;  4JQF A;  3F8C A;  1WRJ A;  5DUI A;  3V7R A;  3GFL A;  1IF1 A;  3LAP A;  4HAM A;  3WTW C;  2G7H A;  3DKW A;  5D4S A;  3PFI A;  1ZLJ A;  3KP4 A;  2XGX A;  1LEB A;  5AON A;  2IA0 A;  5FO5 A;  1D3Y A;  2JT1 A;  2QQ9 A;  2RNJ A;  1LDK B;  3TO9 A;  1Z9C A;  1F9N A;  1IXS B;  2O0Y A;  2GA1 A;  1G3S A;  1QQI A;  2Z5U A;  2VBW A;  3TO7 A;  2BBY A;  2RDP A;  2P8T A;  2VOD A;  1Q1H A;  2ZBK A;  1XB4 A;  3ZMD A;  2VOO A;  2H6B A;  1R00 A;  1HW1 A;  3WE3 A;  1ZG3 A;  1OYI A;  3GEZ A;  2HYF A;  1YG2 A;  5HOO A;  1YIO A;  4XLN F;  3KP3 A;  2XAS A;  5BOX A;  2VT2 A;  4ESJ A;  3MEX A;  2F5C A;  2PFB A;  1KQ9 A;  2L54 A;  2GAU A;  1U5T C;  1Z91 A;  3ULQ B;  1TLH B;  1Z1D A;  2JPC A;  2MC3 A;  1IN7 A;  2VC1 A;  4A0Y A;  4HX4 A;  4Y15 A;  2MA3 A;  4I02 A;  5F1R A;  1MD0 A;  1FSH A;  4K2E A;  1R1U A;  5E20 A;  2ZO4 A;  5E17 F;  2FXA A;  5HDK A;  4XLP F;  1YFH A;  1WSU A;  5E8G A;  5ERI A;  4IHT A;  1HQC A;  1OR7 A;  1QO0 D;  4OOI A; 
#chains in the Genus database with same CATH topology
 4I99 C;  2EJR A;  3RKQ A;  2EA2 A;  2Y9Z A;  2JN6 A;  1P92 A;  2CV1 A;  2EIK H;  4CGZ A;  1ETX A;  2QF7 A;  3EYI A;  5ED4 A;  1SFU A;  3CJN A;  2R0Q C;  2Y0S N;  1IGN A;  3K2Z A;  3E3V A;  4MTE A;  2OTJ I;  2MD0 A;  5GAG J;  3MD2 A;  5ILS A;  1USS A;  1V54 H;  2ZFU A;  1R23 A;  3KYC B;  5B1A H;  2ELK A;  1FYK A;  1J5Y A;  2VBX A;  1V55 H;  4OIR F;  5H20 A;  3CDL A;  2CW8 A;  3N4M A;  4ZTF A;  1G59 A;  4IHY A;  3GWZ A;  2L9R A;  2R3S A;  3JSP A;  2ZJ2 A;  4A2U A;  5AIQ A;  3ESW B;  4LLL A;  3WGI A;  3S1N J;  2W48 A;  2HTJ A;  2IVM A;  4CIC A;  5CLS A;  1ULY A;  1Z6R A;  1R5G A;  1WJ5 A;  2XHK A;  4LLG F;  5L3C A;  3H0D A;  1V5E A;  1Y0U A;  5CYV A;  3GTJ J;  3Q0W A;  3M8J A;  3MMY B;  4LFU A;  1QA6 A;  3E1S A;  1R4N B;  1YOV B;  4KMU X;  1DPR A;  3FXJ A;  3DBH B;  3BR5 A;  2A07 F;  2Y0M A;  3ERM A;  3TKY A;  3MZ8 A;  2WAQ N;  3B02 A;  5K7F A;  4U87 A;  4F55 A;  2HDW A;  5FLX Z;  3HKZ N;  2ZCW A;  2YUS A;  5L3D A;  2X0L A;  2HXO A;  2XPU A;  4AUX A;  3MKW B;  1O3S A;  4F91 B;  4QSH A;  2HEO A;  1T39 A;  4BXU A;  2DO7 A;  2M4G A;  3ZQI A;  3SFZ A;  1RRJ A;  4HRI A;  5FKL A;  1T2K A;  1RIO H;  3CC7 I;  3Q0V A;  2V1D A;  2QQA A;  3MVP A;  1ZAO A;  3OV8 A;  5H6Q A;  5EDN A;  4KN4 X;  1ON1 A;  2DI3 A;  3QAH A;  5E3M A;  2CU7 A;  2XGE A;  1GXP A;  2V9P A;  1BW5 A;  2EFO A;  3L2C A;  2BEO A;  3HOX J;  3EUH C;  3M7G A;  2IS6 A;  3LST A;  1ZKG A;  1ZN2 A;  5JLW A;  1ON2 A;  2YSR A;  5JHU A;  3OIQ A;  3E6B A;  2A68 F;  1CGP A;  3JRE A;  1XGS A;  3BOQ A;  4XKW A;  5M5W J;  1JTY A;  2I5U A;  2K7L A;  1F4K A;  4I2O A;  3F22 A;  3W6K B;  1FTZ A;  1Z6T A;  4PFP A;  5HDG A;  2H8W A;  3BPX A;  1SVL A;  3DQV C;  3VYS B;  3EDP A;  5A2Q Z;  2PMH A;  3GME A;  4XSX F;  4RLF A;  3QYB A;  1EV7 A;  2Y69 H;  5J1U A;  4ZYG A;  3DTI A;  2H1L A;  3G73 A;  4OU0 A;  3SDB A;  3E5U A;  5DM7 F;  1NH3 A;  1R5H A;  2PEX A;  4MQ9 F;  2GZW A;  2LF7 A;  3ZPL A;  1POG A;  3K1M A;  4HNV A;  4I09 A;  1AWC A;  2DU9 A;  3WTU C;  3CCE I;  1VI0 A;  3OR2 C;  4ABZ A;  3R4K A;  3TW6 A;  1G3Y A;  5CVI A;  1RUN A;  3JRC A;  1PJR A;  3S2W A;  3GW2 A;  3EUK L;  1SD4 A;  3GTL J;  2MAB A;  1MMD A;  2NS7 A;  1N77 A;  2A3S A;  2DOF A;  2HU9 A;  3OIP A;  5EZG A;  3KIO A;  3A02 A;  3LAJ A;  2CQ7 A;  1K6O A;  3PO2 J;  4EV0 A;  2RNG A;  4BJ6 C;  3NWT A;  1OYW A;  3K10 A;  1P6R A;  1ZRC A;  2X51 A;  3ZXS A;  1Z05 A;  3JRF A;  2GOX B;  4PJN A;  2KRF A;  1ITY A;  1OCC H;  4IQJ A;  4XBF A;  2BXZ A;  2QM3 A;  1STZ A;  2NVX J;  1X3U A;  4OMY A;  2W25 A;  3H5A A;  2X6X A;  1Z21 A;  4XLF A;  2XVC A;  2CMP A;  2K85 A;  4FIS A;  3WTY C;  3X2Q H;  1I1S A;  3ZQQ A;  2DDA A;  4ZH4 F;  1OKR A;  3V7C A;  4DJA A;  2XGC A;  3M07 A;  5JVT A;  3Q5F A;  3E7L A;  1UB9 A;  1E0E A;  3HOV J;  1MJA A;  3RIR A;  1ETW A;  3RPQ A;  1O3T A;  4YEL A;  3L2W A;  4EGZ A;  2LK2 A;  5ICF A;  3WG7 H;  2HYJ A;  3GFM A;  1ZG1 A;  4KIS A;  2W00 A;  1D5V A;  1FBS A;  4MEX F;  2K9S A;  4MNU A;  1MGT A;  2RVC A;  4FX0 A;  1S3J A;  3PUF A;  5EF6 A;  2IS1 A;  4U0W A;  3F23 A;  3QP6 A;  4M6X A;  3HJE A;  2M7A A;  4NB5 A;  2D45 A;  1WQ2 A;  4EJV A;  4RB3 C;  2ID3 A;  3KP5 A;  5ICC A;  4KYW A;  1DPU A;  1LE8 A;  4HNU A;  2ADU A;  2EA4 A;  2V9V A;  3CP8 A;  3PM1 A;  3TP0 A;  3H92 A;  1R5I D;  5ILV A;  3KLN A;  4A3I J;  3HOY J;  1SMY F;  2QKL B;  1PUF A;  4II2 A;  4RA2 A;  3LQQ A;  1Q1V A;  3B73 A;  4RAZ A;  4ANJ A;  4GYG A;  2WBM A;  2XAF A;  4NQW B;  4FT8 A;  2EZL A;  4BXX J;  4D9J A;  1YS7 A;  4XN3 A;  4HQE A;  3OIO A;  3OR1 C;  1MDM A;  3EUH A;  2JK3 A;  1XMA A;  2MFZ A;  1ENH A;  4KJZ A;  2XF5 A;  3IHU A;  2E5N A;  4G12 A;  3NQO A;  2JA2 A;  3JRB A;  2HVS A;  4BGD A;  2GA2 A;  3C2G A;  1N78 A;  3ECH A;  3WTS C;  1SFE A;  2FQ4 A;  4RAY A;  3OL3 A;  1TNS A;  1OMI A;  1WJB A;  2A5W A;  5J8F A;  5BQT A;  4IO9 F;  3M9A A;  1K78 A;  1KQ0 A;  5E1W A;  3LL7 A;  3BJA A;  3LA7 A;  1LEA A;  1BN5 A;  2FQ3 A;  2BW3 A;  4L5I A;  1A35 A;  1K83 J;  5LBQ A;  1LKX A;  1ORK A;  4JBA A;  1BR2 A;  2DT7 B;  3OYI A;  3AL0 C;  2ETH A;  3J7A Y;  2PLY A;  4G7H F;  1QVU A;  1U6G A;  2L9N A;  4OAY A;  4IRH A;  4OIN F;  1NK2 P;  2HQA A;  2QSF X;  5D6E A;  1QNT A;  1UEL B;  2BV6 A;  3BTJ A;  5D8L B;  4Y13 A;  2QEN A;  2QBY B;  4IQ4 A;  4GFB A;  1HOM A;  4HLY A;  2V4J C;  4C2M J;  4PJ0 C;  2VAS A;  3ZQF A;  4ITV A;  1EH8 A;  2AS5 F;  5LGU A;  1SC7 A;  4ZC3 A;  5HLI A;  3CJQ B;  1FYM A;  2TDX A;  1LFU P;  1MMA A;  1AKH A;  1FC3 A;  5D5W B;  3BG9 A;  2BE5 F;  4XOR A;  1UHW A;  2R5Y B;  2HTS A;  3MN2 A;  4RMN A;  2MSY A;  3F9K A;  1A31 A;  5FRO A;  3K4B A;  5IP6 A;  2K3P A;  1WI9 A;  3IAS 2;  1ZRE A;  3S14 J;  2HDD A;  2F5D A;  5M5X J;  4MFD A;  2CV0 A;  2V1X A;  2DJI A;  4U7B A;  1MMS A;  3TGN A;  5FJ8 J;  5E3L A;  3U1D A;  3FM5 A;  2V6C A;  5JFR A;  3KEY A;  1VND A;  2WY7 Q;  1VQ8 I;  2R7V A;  2WV0 A;  2M2E A;  2R7S A;  1XCV A;  2DTR A;  1JXS A;  1VQP I;  5D5V B;  3K1P A;  2L4A A;  2DQL A;  3WU1 B;  2FOK A;  2A05 A;  1IW7 F;  2ZME B;  2DBB A;  5HNF A;  3JR9 A;  1YLF A;  3FXM A;  3LQR A;  3PFY A;  1R22 A;  5LHI A;  2FF4 A;  5KNL A;  3K70 D;  3LSH A;  4AIH A;  5F64 A;  1J2X A;  4BAC A;  1TWH J;  4DBR A;  2OZU A;  3RPU A;  2DN0 A;  3IWZ A;  4UB8 C;  2XAG A;  4C9Y A;  3QYF A;  3K1N A;  2EBI A;  4Z2Y A;  2DA7 A;  4LG0 B;  1S5L C;  4WF2 A;  3BP8 A;  2KLO A;  2X48 A;  2VIX A;  1W5S A;  3M8E A;  2W84 A;  1Y8R B;  4PJM A;  5C44 J;  5L3F A;  3OYG A;  4BAY A;  2L9V A;  3S8P A;  1IRG A;  1T98 A;  4WXD A;  2JRM A;  3F8F A;  1I6H J;  2BVL A;  4KIF A;  5D6F A;  5DUK A;  5HNH A;  3HEF A;  1Z0X A;  3ABU A;  3BY6 A;  4KIC A;  4ESB A;  2BY1 A;  3WGG A;  2Y0S A;  3RKX A;  2G0E A;  1XGN A;  3HSF A;  1O3R A;  2K9Q A;  3HL2 A;  4XLA A;  1D8K A;  1E3P A;  3JRG A;  4ASN A;  1HKS A;  2AXL A;  2FNA A;  1UAA A;  4M74 A;  2AQF A;  3GZ5 A;  2FD5 A;  3HRS A;  2DPD A;  2QSG X;  4C3H J;  3HHH A;  4KIG A;  3S3N A;  1IZ1 A;  1G4D A;  1D0Y A;  2ESN A;  1XGM A;  4B1R A;  2R7D A;  3KZY A;  1LPQ A;  1U8B A;  3HG9 A;  1V4R A;  3CC2 I;  2VJ5 A;  1XDU A;  3GO5 A;  3K4K A;  1SAN A;  1UST A;  2E35 A;  2M7B A;  2KJC A;  4IPA A;  3KEQ A;  3EQL F;  4D7N A;  4J19 A;  3CO7 C;  4NUB A;  3VYT B;  3VPR A;  5D5U B;  3ABM H;  1NG6 A;  1TQM A;  2R7F A;  2H6C A;  2XSD C;  2E1M C;  2K3F A;  1S7E A;  4R8H A;  1TQI A;  5LRS A;  3OYB A;  2DJN A;  2Q8K A;  3ZMZ A;  4P9F A;  2WTE A;  3P9C A;  3ECO A;  2Q2E A;  3SYT A;  4J00 A;  2HQ5 A;  1ZGA A;  2WAQ A;  1I3A A;  2P6S A;  1G2H A;  3HKZ A;  4L9T A;  1JI8 A;  1EKE A;  2NOG A;  2BY0 A;  5EEH A;  2LBF B;  4X0G A;  1FEX A;  4FHT A;  1UG2 A;  1OQY A;  2FSW A;  4P1W A;  4QPO A;  3G1M A;  4EJW A;  4BE2 A;  4BQA A;  4OIO F;  2PJP A;  5GAD J;  2RQQ A;  4B48 A;  5E1X A;  2V7F A;  3M1C A;  2X6W A;  2FMY A;  2STW A;  5FFX A;  3HUG A;  3RJP A;  4E7H A;  4IVN A;  5FLX K;  1IAW A;  3C1D A;  2D1V A;  3IWF A;  1HC8 A;  4F93 B;  5GP9 A;  3Q9S A;  1WCM J;  3FXL A;  2DQR A;  3QU6 A;  1CQT A;  5IYC J;  5H6R A;  4IF4 A;  2R7O A;  4HG2 A;  4M6Y A;  2IT0 A;  2TRT A;  2IS4 A;  2CUE A;  3I5U A;  2LG4 A;  2E2J J;  4G7O F;  4LD5 A;  4RB0 A;  4BXF A;  3RQI A;  1MZB A;  2F5V A;  2ZXJ A;  1W5C C;  4Y52 J;  5J1R A;  1VQL I;  5DCM B;  4L5J A;  3H0G J;  2HOE A;  3GYH X;  2NVT J;  2KIF A;  3LA2 A;  4FQG A;  2M87 A;  1RI7 A;  3TP3 A;  2LD5 A;  3GZ6 A;  4NDL A;  5FKM A;  4XRF A;  2F6C A;  1S6L A;  4UV8 A;  1U8R A;  1MBJ A;  2ZC2 A;  3I4M J;  3F8N A;  5A2Q K;  5BPD A;  4HX8 A;  1OCP A;  1TL8 A;  1HXD A;  1TWF J;  2CFO A;  4ZDP A;  4BH9 A;  5E18 F;  1RUO A;  1SD7 A;  4S04 A;  1EH6 A;  5HOD A;  5J6X A;  4R1H A;  3EPZ A;  3GFJ A;  2LKS A;  1RNL A;  3AFH A;  3HIF A;  3E6C C;  4YIF A;  2VB6 A;  5DS9 A;  4WCG A;  3OYN A;  4KDP A;  2HWV A;  3SZP A;  3CF5 F;  5E1Z B;  4G7Z F;  2QQ8 A;  5EGO B;  4EQQ A;  2X1E A;  4B3A A;  2KDZ A;  4HF0 A;  2KMU A;  1ZRF A;  5EG0 B;  2K9N A;  2L0K A;  1FP1 D;  3DCF A;  3FDY A;  4M72 A;  1P4W A;  3FK6 A;  5BNG A;  1N75 A;  2XAH A;  2DMQ A;  1FJL A;  3HSE A;  1X1A A;  4AC0 A;  4Y33 A;  2V26 A;  3P9I A;  2VI6 A;  2KPM A;  2MG4 A;  1AHD P;  3TDU C;  2COM A;  3HHG A;  4YIR X;  1XSX A;  4IOC F;  1K4T A;  3SXY A;  4A12 A;  1TWA J;  1R7J A;  2ZJP F;  3F6V A;  1JUS A;  4A3F J;  3SHF A;  1JGG A;  3QRF F;  3TED A;  3S16 J;  1WJC A;  3HYI A;  4O6J A;  2L5Q A;  5F0F A;  2EZH A;  2P0W A;  4KT5 C;  2EQR A;  4M3B A;  1MNM C;  3HDD A;  4J01 A;  3VYU B;  2V6E A;  3SZG A;  1QPM A;  5LHH A;  2PJR B;  1FLI A;  2OUM A;  2EFQ A;  3PO3 J;  3I3L A;  1ONV A;  1I50 J;  4AIJ A;  1WJA A;  2KDO A;  2O3F A;  3FHZ A;  1HDP A;  3OS2 A;  3KP6 A;  1EA3 A;  1ERD A;  3OY9 A;  3D0S A;  2W57 A;  4O3M A;  1W7P D;  1U78 A;  4Q5S F;  3CD6 I;  3KP2 A;  4E7L A;  1ZRD A;  1W36 D;  1UCR A;  3B6A A;  3PQK A;  2UZK A;  3ZN1 A;  3H35 A;  3MKL A;  3ISP A;  3FX3 A;  3HM5 A;  3IH4 A;  3LSM A;  1BI0 A;  2BYV E;  3PNY A;  1YW9 A;  1GVD A;  3T5X A;  1R49 A;  4A93 J;  2R5Z A;  1F43 A;  3ZQ7 A;  3I54 A;  4BQQ A;  4HDV A;  1B9N A;  4ZYE A;  1OIS A;  4Q4Z F;  1X2M A;  3HOT A;  3CCU I;  2CO5 A;  2EFW A;  5IT9 K;  1YX3 A;  3BC8 A;  2GOM A;  4NBQ A;  1QU3 A;  4ZDL A;  3BTC A;  3RYP A;  3SEZ A;  1FBQ A;  3KP7 A;  5HDN A;  1IDZ A;  4OAZ A;  5ICG A;  1IXR C;  5E3N A;  2DMN A;  4V2G A;  2HKX A;  1H88 C;  1FOK A;  2JUC A;  4D0P A;  4EMS A;  4HYE A;  1Z3X A;  3S2H J;  4FAS D;  3A03 A;  1TW3 A;  2DYS H;  3LFK A;  2MW8 A;  1K79 A;  2HVQ A;  1WJF A;  2DOE A;  4KNY A;  1W5T A;  2K27 A;  4CYC B;  3KYL A;  4I0B A;  1WZ2 A;  2DK5 A;  4HBL A;  3HTS B;  5ICE A;  1S72 I;  4IL6 C;  4QLC U;  1HCR A;  1IRZ A;  2M45 A;  2W82 A;  4NC6 A;  1H0M A;  1B6A A;  1BR4 A;  5DTD A;  2H8R A;  4C3J J;  3BG5 A;  4BEH B;  2MLK A;  2O03 A;  2DA4 A;  2H94 A;  3ZP5 A;  4XLC A;  1BBY A;  4Y17 A;  1IV8 A;  1QZZ A;  5E79 C;  3GZN B;  4M9S A;  3I56 I;  1HW5 A;  1RET A;  3QOD A;  4W1U A;  5FKK A;  5TGT A;  1Z3Y A;  2ZKZ A;  1YJ9 I;  2V1U A;  1D8J A;  3CCY A;  5K5Q A;  3RDI A;  4FX4 A;  2VOP A;  3G6E I;  3DV8 A;  1BI2 A;  1FOW A;  3I4P A;  2X4H A;  1KA8 A;  2R7X A;  1DGR M;  2XKO A;  5KK1 A;  3J81 K;  4CH7 A;  2VON A;  3WHC A;  3BR6 A;  3IH3 A;  5B1B H;  2JJ7 A;  4BBS J;  4F3Q A;  1BM9 A;  1QHH D;  3PQJ A;  3ABT A;  4LIT A;  4OMZ A;  3CES A;  3IRQ A;  4UUT A;  3CLQ A;  1G3T A;  2OCE A;  1PP8 F;  3S1M J;  2P81 A;  2M30 A;  5DYM A;  2HZT A;  3BZC A;  2UUZ A;  5CVV A;  3ROU A;  1AU7 A;  4IHX A;  1ODD A;  3RQ4 A;  5LRR A;  4MQV A;  3H3V K;  3L2V A;  1Z7L A;  5E3O A;  2OTL I;  4CHU A;  2K9M A;  4I0A A;  4D5C A;  1UMQ A;  1YX5 A;  2XAQ A;  3A01 B;  4IHS A;  4EGY A;  2FE3 A;  1MH4 A;  4A3L J;  2YU3 A;  2G9W A;  4HDU A;  4E4H A;  5D5X B;  3E0J B;  2A6T A;  5GAH J;  2CQK A;  1IN5 A;  2DMP A;  1J09 A;  2L2O A;  2V79 A;  5FRN A;  3VWB A;  1XD7 A;  3ZGK A;  1FBU A;  1X1C A;  4C30 A;  1TW2 A;  3LOC A;  3HRT A;  2RAE A;  2GIV A;  5F0C A;  3DEE A;  3NWS A;  3V4G A;  4EVI A;  3VB2 A;  4MHG A;  1D0X A;  3FKI J;  1VF9 A;  3JTG A;  4AIK A;  2FA5 A;  3GLL A;  2MH9 A;  1FWZ A;  2GIZ A;  2B63 J;  1IRF A;  2EFP A;  3GBG A;  4ENK A;  2P7V B;  4P55 A;  3ASN H;  2A69 F;  1DP3 A;  1W7P B;  4V19 K;  3H9G A;  5CJ9 A;  2BY3 A;  6PAX A;  3MZH A;  1ETK A;  1WH5 A;  2NXN B;  3LMM A;  4NC7 A;  4XRS A;  2WC2 A;  4RGX A;  1U5T B;  2VKV A;  1OCT C;  5JR3 A;  3K4N A;  1B1B A;  2JVG A;  2KIQ A;  1LFB A;  3BR3 A;  3WE2 A;  2ME6 A;  4YFK F;  3T8T A;  1MBG A;  2HPM A;  4LK0 F;  3KFW X;  4LLN A;  1XCB A;  2VLA A;  2WA0 A;  2XAU A;  4D5F A;  2M5W A;  1YW8 A;  5M5Y J;  3UR3 C;  3OMY A;  2JA8 J;  3G1L A;  4BHB A;  4E70 A;  5DEQ A;  5B5E C;  1N25 A;  4MTD A;  1IJW C;  3I4N J;  2LY1 A;  2P7C B;  2F5E A;  3VDX A;  1PUE E;  4I98 B;  3L1P A;  4XL9 A;  1FNN A;  4XIC A;  5DV5 A;  2RKH A;  3R0A A;  1GV5 A;  2CQQ A;  3PNT A;  3GLX A;  4XRM A;  3IKT A;  2ME0 A;  3DU6 A;  4XNF A;  4UVA A;  2RQP A;  5F0H A;  3O6B B;  2ISZ A;  2KZG A;  2M8G X;  1SAX A;  4Q47 A;  3AKZ A;  2L4M A;  3PUB A;  2H09 A;  1L0O C;  1ZGJ A;  5J47 A;  1FY7 A;  3LSK A;  1R58 A;  4KFC A;  2QSH X;  2OCC H;  2DA6 A;  3M4O J;  1Z67 A;  3KZZ A;  4IRG A;  4Z6Y A;  1G8X A;  2DXI A;  2KKO A;  3Q3S A;  3S1Q J;  3CDH A;  3I71 A;  2E71 A;  3TDZ C;  3QP5 A;  4HNT A;  3JRH A;  1WKM A;  1X1B A;  3CMM A;  5KHD A;  1KU7 A;  2K9L A;  2XRL A;  4PFO A;  5F1J A;  1VTN C;  3CLO A;  1BA5 A;  1XSD A;  5TIS C;  3GTK J;  4RB2 C;  3BPV A;  1EF4 A;  1LVK A;  4BQN A;  3DPT A;  2R7U A;  4EEF G;  3E5Q A;  1FYL A;  2HQR A;  1IN8 A;  2OA4 A;  3CCL I;  2Z16 A;  2PG4 A;  3LSJ A;  2L7K A;  3MFK A;  3E97 A;  3BZ6 A;  3BLY A;  4L9N A;  3S15 J;  3WGH A;  1DGW Y;  1KON A;  4ZYA A;  4GRI A;  1SD5 A;  4XR6 A;  2ZSI B;  2IXS A;  5J4Y A;  1WWX A;  3HOS A;  2KFD A;  1XSV A;  2A6E F;  2QLZ A;  2GXA A;  1P4A A;  3HPH A;  3NEU A;  5J40 A;  1KYZ A;  4V2F A;  1REP C;  4LMY A;  4MFE A;  4NQW A;  2E7X A;  1ZH5 A;  5LD2 C;  4EJT A;  2EK5 A;  5JHF A;  2Y9Y A;  4LG3 A;  5GAE J;  3DF8 A;  3A2K A;  2OC6 A;  4Y7N J;  2ACJ A;  5IT9 Z;  2VXZ A;  1KZH A;  5EYR A;  1S9H A;  3FBN B;  4CCN A;  1ZG5 A;  1P7I A;  3FWE A;  3T1B A;  2KZV A;  5K1Y A;  4IZZ A;  3TW7 A;  1ZTR A;  4HX7 A;  2DA2 A;  4U0V A;  5HLT A;  1B8I A;  1L3L A;  1ACI A;  4X6A J;  3KZI C;  3D5L A;  3FKJ A;  4EM0 B;  2L3D A;  2JSP A;  4RM3 A;  4EAT A;  5FLM J;  4UUS B;  3LWF A;  1WFX A;  1G6N A;  1UHS A;  3RZD J;  2OF7 A;  2E5Z A;  4H4K C;  2GXG A;  2EIM H;  1ZLK A;  1HW2 A;  2XSJ C;  1B72 B;  1CF7 A;  3WTX C;  1DUX C;  5LLQ A;  1AA7 A;  2E60 A;  3CJR B;  1BI3 A;  2VBY A;  3TL4 X;  1I5Z A;  1W0U A;  3HGG A;  5HLH A;  1WHU A;  1DU6 A;  2O7O A;  1X3W B;  1MDM B;  2Q1Z B;  3C3W A;  4A3C J;  1TBX A;  4B3X A;  1WGX A;  2M8E A;  3DU5 A;  4QPQ A;  2F2E A;  2BZT A;  1QGP A;  2CJJ A;  1O7L A;  4G8X A;  2QBY A;  2BGC A;  5HS9 A;  3AAF A;  2H1K A;  5HVQ C;  4OWR B;  4OIQ F;  2LFB A;  1MBK A;  3W2W A;  2VJI A;  3G2B A;  1SFO J;  3CUQ B;  2EZK A;  2EWN A;  1NG7 A;  4YII A;  3I59 A;  2GXB A;  4AYB N;  2EV5 A;  5CVU A;  3DWL E;  3J81 Z;  2HDC A;  4FET A;  4AD9 A;  1X4O A;  1JTX A;  1S7O A;  5LGT A;  3ZOB A;  4WX9 A;  1LB2 A;  1YJN I;  1IN6 A;  2ECB A;  2FJ1 A;  4UXN A;  4YG2 F;  3FIW A;  2RRE A;  2VN2 A;  3CJT B;  3RKY A;  4CCL A;  3JAM K;  1C0W A;  5M3M J;  1X4P A;  4B09 A;  3JTH A;  5GTH C;  3HOW J;  4ZYH A;  1IXC A;  2CW0 F;  3P9K A;  4BY1 J;  2B0L A;  2JUG A;  2A5Y B;  3JW4 A;  2DFE A;  3BRO A;  3LSR A;  2LYC A;  1DQU A;  2M1B A;  1TWG J;  2DFI A;  1MJ9 A;  4CO8 A;  1VQO I;  4HW0 A;  2NOJ B;  3R6S A;  3LSG A;  4QWQ A;  3OYK A;  2XRN A;  1A04 A;  5C3E J;  4BJT A;  2XB0 X;  2Y2Z A;  3BWG A;  4XLE A;  4GDF A;  2LRE A;  4DBQ A;  1FMV A;  2CSO A;  3I58 A;  1XDS A;  3ZMV A;  3SDG A;  1YYV A;  4G6D A;  3FF5 A;  2MD5 A;  4M3E A;  2X85 A;  2FOW A;  2V9K A;  4KIT B;  2FRH A;  3QQA A;  4BHP A;  2O5R A;  2EV0 A;  3CME I;  1UFM A;  1MBH A;  2EFN A;  2YX7 A;  1E17 A;  2E1N A;  3ML6 A;  4LG0 A;  4D1Q A;  1J59 A;  2DK8 A;  1BIA A;  4A69 C;  2VJ4 A;  1HSJ A;  2L7F P;  1W0T A;  4PGH A;  4EJU A;  3OOU A;  1Y1W J;  5FKN A;  3F8M A;  3GTO J;  2XRO A;  1IDY A;  5B66 C;  3ZQH A;  3QPL A;  4XN0 A;  1VQ4 I;  3DLL F;  1D1B A;  2XIG A;  1I39 A;  4N9I A;  3BJ6 A;  2DW4 A;  2R7Q A;  3K9T A;  2L7Z A;  3ZQL A;  1ETV A;  2JQ7 A;  1JKR C;  1S29 A;  1R1V A;  2B7E A;  2K4J A;  2Z3Y A;  1I27 A;  3REO A;  4AVP A;  2IP2 A;  1RC9 A;  3F72 A;  4KUM A;  5FGM A;  2HPI A;  1I6X A;  3C2B A;  3IV5 A;  1QVT A;  2GQQ A;  3FXU A;  2QVO A;  4DNC A;  3BZK A;  3CC4 I;  2O61 A;  1HLV A;  4C2T A;  5JLX A;  4A0X A;  3ABL H;  5BPI A;  4BHC A;  1I1G A;  5IT3 A;  2IAI A;  2Q0O A;  2K5C A;  4CCJ A;  1K6Y A;  3BDD A;  3GF2 A;  4IJA A;  4B43 A;  2P5V A;  1NK3 P;  4ENJ A;  1MSE C;  2DDB A;  2HZD A;  2JTV A;  4QIW N;  3O2P E;  4AWX B;  4BYY A;  3FMR A;  2STT A;  3BTI A;  5LEK A;  4RGU A;  2W1O A;  1MND A;  1EH7 A;  2NVQ J;  3GTP J;  2L01 A;  4IXA A;  3IC7 A;  2PQ8 A;  4B8X A;  3MWM A;  2YPR A;  3WU0 A;  3WTZ A;  4KMF A;  5L3B A;  2IA2 A;  2X6Y A;  4CZC A;  1JKQ C;  4XOT A;  3LSI A;  1LDJ A;  4LK1 F;  4KA4 A;  5TJJ A;  4AVZ A;  4UB6 C;  4ZZD A;  1RR7 A;  1XMK A;  5L3G A;  3L2Q A;  1SEU A;  3C18 A;  5HS8 A;  1R71 A;  2LBF A;  4DZP A;  2LTP A;  3S3M A;  4EJO A;  3L00 A;  5DDG A;  4ZTJ A;  2Y31 A;  3BG7 A;  1JE8 A;  1RES A;  1PP7 U;  1YTY A;  1SD6 A;  1J0R A;  4PJJ A;  3UNG C;  2UXN A;  4H0E A;  4MGR A;  2ZXI A;  1X58 A;  4HF1 A;  2PBI A;  1XX5 A;  1LUJ B;  3G71 I;  3I9V 2;  3IL2 A;  4JP0 A;  4TV7 A;  3DEU A;  1T08 B;  4NC8 A;  2OZ6 A;  2OQG A;  2COB A;  4F7Z A;  1ZQ3 P;  4L9J A;  2LLK A;  1GXQ A;  3ASO H;  5EZH A;  1OLT A;  3GXO A;  2HR3 A;  3AG3 H;  2PMU A;  4HV6 A;  2DMU A;  2L7M P;  1Y1V J;  3V8K A;  4A5M A;  1IC8 A;  2GLO A;  4G6T B;  2BY2 A;  4M9Z A;  2UWM A;  4LIV A;  4G6Q A;  3S93 A;  2B9S A;  2LP0 A;  1OCZ H;  2K86 A;  1V3F A;  4G94 A;  2A6H F;  1MJB A;  5LFA A;  2K4B A;  3GFI A;  4BDZ A;  5DCM A;  4BL0 B;  1YRN A;  2RV8 A;  2FEZ A;  2F48 A;  3DTE A;  2YX4 A;  4EM1 A;  5DCF A;  4U7D A;  3DP7 A;  4B44 A;  4HQM A;  2CQN A;  2ISY A;  3HUG B;  2PMZ N;  1R1T A;  3IAM 2;  1GDT A;  3LFU A;  1JUP A;  2KIM A;  2FU4 A;  4M6V A;  1O7F A;  1LJ9 A;  1WH7 A;  1X19 A;  2QZ8 A;  1S7A A;  3OYF A;  2K02 A;  4I7H A;  4D7M A;  2R93 J;  2LKP A;  1FZP B;  2Z9O A;  2Z2S B;  3DKY A;  2CS3 A;  3CQZ J;  2OU2 A;  4A3B J;  4I01 A;  3MQ0 A;  2ELJ A;  2F4O B;  2ECC A;  2FML A;  3HBL A;  3CO6 C;  5IOZ A;  2KIU A;  3CMA I;  1R6R A;  4F52 A;  2F5F A;  2IA1 A;  1ZR2 A;  2NVY J;  3ZMU A;  5KVR A;  1QZY A;  4BDY A;  3J7A O;  1JUM A;  1OFC X;  2EV6 A;  2P5K A;  3IP4 B;  3NAR A;  4YEJ A;  2NRA C;  2ESH A;  1R36 A;  3H9J A;  1HKT A;  2QWW A;  5CQE A;  1GV2 A;  3QPS A;  1MKM A;  3Q0U A;  4UHT A;  1X1P A;  3OYL A;  5FD5 A;  4JX4 A;  5GPA A;  4A3G J;  5DD8 A;  4CCM A;  4RS8 A;  3TMO A;  1R4M B;  1RR8 C;  2HXI A;  5EGO A;  4YRV A;  3H3U A;  2RC4 A;  3A0H C;  2XPV A;  2UXX A;  3WTT C;  1B9M A;  3BR2 A;  1OCO H;  2GBY A;  4UVB A;  3OS1 A;  2MLG A;  5CVJ A;  1XTA A;  3KPH A;  2PI0 A;  3VEP A;  2OAZ A;  4A3M J;  2YU9 J;  2GM4 A;  4E7Z A;  4JX5 A;  3JAM Z;  3K69 A;  1JHF A;  5BS6 A;  5D4R A;  2ZFW A;  4OIP F;  1F5T A;  3L9F A;  2KQR A;  2JSC A;  3IH2 A;  1YHQ I;  4A3J J;  2MGQ A;  1BIB A;  2PN6 A;  1BI1 A;  3ZR8 X;  3U2R A;  1GHC A;  3F0C A;  3FK7 A;  5FRM A;  2FNP A;  4CDG A;  2DYR H;  3W6J B;  2IGM A;  1ZHF A;  1JJ8 C;  2DCE A;  4A6D A;  1QBJ A;  3CCJ I;  1KU3 A;  2VL8 A;  4C3I J;  3HOU J;  3JSO A;  3BG6 A;  5TRD A;  2PJR A;  2JRT A;  3P5J A;  1JT6 A;  5DD4 A;  2I10 A;  4BJ5 C;  5FFZ A;  1TT0 A;  3OYC A;  4XMY A;  4GYI A;  2D1H A;  1T95 A;  3DBL B;  3PSI A;  2MC4 A;  1P7J A;  4NNJ A;  3MZY A;  1P9Q C;  2P5L C;  2LH9 A;  2EPF A;  3TOB A;  1O3Q A;  3CDI A;  2HOT A;  2HVR A;  2ZJR F;  1B4A A;  3ZQC A;  1BC7 C;  2C6Y A;  3K4M A;  3CF2 A;  3I55 I;  1FPQ A;  1QPI A;  2JVH A;  2ZNY A;  4A3K J;  2E7W A;  1WJE A;  4PZJ A;  3DPL C;  4P5O A;  3U1K A;  2E19 A;  3RKW A;  4A0Z A;  3QOP A;  3NAU A;  4GXO A;  5HS7 A;  2DA5 A;  1LDD A;  1W4M A;  3GTM J;  3L2R A;  1P4X A;  3GVA A;  1BW6 A;  5D8K B;  2X9D A;  3JRA A;  3F8B A;  1GT0 C;  2E2I J;  2CFX A;  5GTI C;  4N0B A;  4A3E J;  4C2U A;  5LHG A;  2R92 J;  3S1R J;  3FXQ A;  5J8C A;  1BOA A;  4BS9 A;  1PVE A;  1Y0N A;  2YR2 A;  1NHA A;  2CYY A;  3TOA A;  3VOE A;  1KQ8 A;  2NYX A;  3SQN A;  3ZRG A;  3ERE D;  2VJJ A;  2R5Z B;  4L0Z B;  3RZO J;  2QGU A;  4RGS A;  5IOY A;  4HST A;  2NS0 A;  1RZ4 A;  3LA3 A;  4BEH A;  1A36 A;  3J80 K;  4CXF A;  1IN4 A;  2EZI A;  4WXC A;  1W1W E;  4HV5 A;  2ZB9 A;  5GPC A;  1T8I A;  3KEO A;  1PYV A;  1BJA A;  3ONQ A;  3HZJ A;  3ZQG A;  2VPR A;  4AYB A;  3OYM A;  1KU9 A;  4IOA F;  2MYS A;  4N4N B;  1SFX A;  2VQH A;  2VXD A;  4BE1 A;  2CUZ A;  3N05 A;  3DBR B;  4LIU A;  3GX4 X;  2LR8 A;  3GTG J;  1GVJ A;  5J3L A;  2L9S A;  1DU0 A;  2XKP A;  1FP2 A;  2ZXW H;  2LY2 A;  3R61 A;  2QQB A;  2FUG 2;  1A6Q A;  2WV1 A;  3WOD F;  2DAO A;  4UUV A;  4BU2 A;  4I6Z A;  2DOA A;  1ZGW A;  3ZN0 A;  3NRV A;  3E5X A;  3U21 A;  1D0Z A;  2JMW A;  5HLG A;  3DTK A;  5K5R A;  4CZZ A;  2M3A A;  3QWL A;  4ENM A;  2EB7 A;  2LF8 A;  5F27 A;  4RGR A;  4DZJ A;  4LJZ F;  2M34 A;  3AG1 H;  2Y48 A;  1JJ6 C;  1AOY A;  2KRH A;  2X6O A;  1XN7 A;  1J7K A;  2CWE A;  2Z33 A;  2YS9 A;  2HFH A;  1RPW A;  3KLO A;  3M8F A;  2JA5 J;  5F08 A;  2EIJ H;  3DKX A;  1O57 A;  3HSR A;  4HLX A;  4ETS A;  4U0Y A;  3A01 A;  3S2D J;  4A3D J;  2DFF A;  2ZSH B;  2LNB A;  2E1C A;  2OBP A;  3G1O A;  1FX7 A;  2M0M A;  2WWY A;  1LVA A;  1WJD A;  2BHZ A;  1MW7 A;  1E3H A;  3K7A J;  3VFZ A;  4LGW A;  4M3G A;  5IP9 J;  3MKZ A;  1MBE A;  4M71 A;  4DW6 A;  3F6O A;  3CCR I;  4E7S A;  1JHH A;  4XOP A;  3EET A;  2HNH A;  2WB1 N;  1FIA A;  2EH3 A;  4S0H B;  4ZJZ A;  1K4S A;  5M3F J;  1IV6 A;  2Z99 A;  1ZAR A;  4LB5 A;  3H5N A;  2GWR A;  3T0Y A;  1P2F A;  2CRG A;  3C2H A;  3CCQ I;  2QKM B;  1QRY A;  2N8G A;  1W7P A;  1FMW A;  3V7S A;  2QEX I;  1BJZ A;  2HKO A;  4N4O B;  4HA8 A;  3FXR A;  5F04 A;  1HST A;  1KGS A;  1U5T A;  4AM3 A;  2JZY A;  2W85 A;  3RI4 A;  3BTL A;  1G3W A;  2XF7 A;  3OYH A;  3KET A;  1SVO A;  4R79 A;  4BQO A;  2XV4 S;  3BR1 A;  2AO9 A;  3BJO A;  1SAU A;  5EJC A;  3OS0 A;  2E2H J;  3CUQ C;  3U9G A;  3J7Y J;  2VE9 A;  2OV7 A;  1MH3 A;  4JX6 A;  3OWT A;  3W2A A;  4I76 A;  2KHM A;  2O8X A;  2P6T A;  3W2V A;  2ZNZ A;  2MBF A;  3VYR B;  1SVM A;  2CH0 A;  4BKX A;  1UZC A;  2LVS A;  3RCO A;  4HSR A;  4L18 B;  4BNC A;  2XC7 A;  3FM3 A;  3RYR A;  4WWC A;  4PGG A;  4ESF A;  3OYE A;  1JGS A;  1RKT A;  2J5O A;  4XM3 A;  1BC8 C;  4UVC A;  3Q9V A;  1XPX A;  3BR0 A;  3LSP A;  3GUD A;  4BUP A;  1T33 A;  4L9V A;  3T8R A;  4XQF A;  3A1Y A;  4XKV A;  1DP7 P;  2VQG A;  1LFP A;  1YQA A;  1GUU A;  1ZK8 A;  5IYB J;  2IGO A;  1XMX A;  4DYR A;  3OYJ A;  1Y8Q B;  3BQZ A;  4IHW A;  1YS6 A;  2R7Z J;  1SMT A;  3PNV A;  4HEA 2;  2DFH A;  2UV1 A;  3L7W A;  1QHG A;  4MEY F;  4XRS G;  3FMQ A;  4E7K A;  1MNE A;  2KL4 A;  3KX2 A;  4GCV A;  1FSE A;  3ZMS A;  1HF0 A;  2ZME C;  3JRI A;  2J5P A;  2G7U A;  2WY8 Q;  1OPC A;  4IRI A;  4A5N A;  4XSZ F;  4JYK A;  3V8L A;  4WK8 F;  3BQY A;  3OYA A;  2DA1 A;  3CMY A;  2IEK A;  1T0F C;  2FX0 A;  2XB5 A;  2VQC A;  3J7Z I;  1TNT A;  2NAZ A;  2FBH A;  3CCS I;  1FOY A;  3W6V A;  3CUO A;  1U9O A;  1T38 A;  4PJL A;  4JK1 X;  2L02 A;  3PL8 A;  3H9Q A;  4BY7 J;  2R7T A;  5C4X J;  1EJ9 A;  1YW7 A;  5IYD J;  4HZF A;  2W7N A;  3KYD B;  1IO2 A;  5CPR B;  3BG3 A;  3VOD A;  3I0T A;  1IUF A;  4XLH A;  4DOZ A;  4DYQ A;  4BE0 A;  4IKF A;  2Y75 A;  5JVG F;  1YO5 C;  3SJM A;  4PSW A;  5KAI C;  4P9U A;  1H9G A;  3KCC A;  1DDN A;  5ILU A;  3H5R A;  4RM2 A;  1TQP A;  2FBI A;  2X1D A;  3L09 A;  4S05 A;  3MKY B;  2M0C A;  2PMZ A;  5H2F C;  4CSW A;  3RPU D;  2O8K A;  4O5V A;  4IHV A;  3EYY A;  3SFI A;  2IBD A;  5J1Y A;  4UUS A;  3HTU A;  1K61 A;  1D5Y A;  3SEQ A;  3QU3 A;  1B72 A;  3RSN A;  4UNO A;  1HDD C;  1LE8 B;  4U88 A;  3FBI B;  2XUB A;  1PUF B;  4RBO A;  2NNY A;  1Z7U A;  1TC3 C;  3J80 Z;  1NTC A;  1MMN A;  1S8N A;  3VSK A;  4RB1 A;  1B59 A;  2ZJQ F;  3PIP F;  4ON0 A;  1D1C A;  2VT3 A;  1B8I B;  4AU7 A;  1T56 A;  3TO6 A;  1X1D A;  3MCZ A;  4EM2 A;  4YFN F;  4F92 B;  5JI6 A;  3B6C A;  4M73 A;  2DMT A;  2DT6 A;  1U9N A;  3M1E A;  3CUQ A;  2IRF G;  3WG9 A;  3R60 A;  2W4S A;  5LEJ A;  5FLV A;  1KYW A;  1TTY A;  4M3F A;  2HI3 A;  3PSF A;  3F21 A;  4JOM A;  4AID A;  4XKB A;  1CF7 B;  3I53 A;  4M3D A;  3TBI A;  3FZV A;  1ZR4 A;  2P4W A;  1OJL A;  2IW5 A;  1QZE A;  4WXH A;  4FE4 A;  5E8I A;  4Q48 A;  1K78 B;  3QPT A;  1J9I A;  2F4M B;  9ANT A;  3HXL A;  2R5Y A;  1VQ5 I;  1VQ9 I;  1TT5 B;  3AG4 H;  1E2X A;  2VKE A;  2BW3 B;  3HOZ J;  1F1Z A;  4A6E A;  3R0J A;  2BXY A;  1ZEL A;  3V8J A;  4FTH A;  1T6S A;  2XDV A;  4N9H A;  5FD6 A;  3GTQ J;  1J75 A;  2W24 A;  2HGC A;  2HS5 A;  1ETQ A;  2Z1D A;  1BOB A;  3E6M A;  4G9Y A;  5KAF C;  1IRX A;  4LB6 B;  3D1N I;  2KT0 A;  2EIN H;  3I59 B;  2M4K A;  3K0L A;  3ZMT A;  2LDU A;  1RKW A;  2WAE A;  3VSL A;  4W97 A;  3OSF A;  3G3Z A;  4IEJ A;  2R4G A;  2CUJ A;  1MSF C;  4NHJ A;  3FHN A;  2ZME A;  4PDK A;  1VQM I;  4GGG A;  1ETO A;  3AG2 H;  1K7A A;  1AKH B;  2QYO A;  2ELH A;  3HRU A;  3K70 C;  3IRR A;  1T0F A;  4PCQ A;  5L3E A;  4DIQ A;  1PDN C;  4KIB A;  4MO7 A;  1H8A C;  2TCT A;  3ZCO A;  1V5G A;  3CTA A;  1LQ1 A;  2JWT A;  4Y3O A;  5IP7 J;  4CYD A;  2LSO A;  1JKP C;  3OL4 A;  4UV9 A;  2VPL A;  1MIJ A;  2ZXH A;  3HPG A;  5B3S H;  3COA C;  1X3Z B;  3DFG A;  3KE2 A;  4CUG A;  2OD5 A;  2D2W A;  2RN7 A;  1HKQ A;  2IS2 A;  4LOC A;  2QUF A;  1YE9 A;  2H27 A;  4MIM A;  3HGY A;  2DPU A;  1WVR A;  2CW7 A;  3HRM A;  5EEG A;  2HYG D;  1UHM A;  2RGV A;  4HPQ A;  1VFC A;  4DQ2 A;  3O3K A;  1ZYR F;  5LGN A;  2JPB A;  2F4I A;  3IKV A;  2R7R A;  3S32 A;  4B4C A;  2LRD A;  4B47 A;  1U3E M;  4HF2 A;  5EEA A;  3UKG A;  3C7J A;  3BCB A;  4ZZL A;  3DLA A;  1Y6I A;  2DLL A;  4IX7 A;  3OSG A;  3F3X A;  3S3O A;  3CZ6 A;  4ZYD A;  2NVU B;  2V1N A;  3FMS A;  1VQ6 I;  2VKH A;  1A6I A;  4FCY A;  2OQR A;  2E34 A;  4ENN A;  3E6D A;  5CKT A;  1OCR H;  2JA7 J;  3QPH A;  4MLO A;  2LC2 A;  2CGP A;  4GO1 A;  2IJL A;  1XC5 A;  2D5V A;  4PK4 A;  2XAJ A;  1MMG A;  1MBF A;  1Z77 A;  5F6F A;  2QCO A;  5C4J J;  4E7J A;  1YIT I;  3JCU C;  1WPK A;  4UY8 I;  2WAF A;  3H3Z A;  3ELK A;  2OPT A;  2XF6 A;  2XPW A;  5BMZ A;  3HC7 A;  4RLQ A;  4L0Y B;  4P96 A;  2K40 A;  4M9X A;  1IG7 A;  2JA6 J;  2R7W A;  4RAF A;  2VKD A;  5FB2 A;  3A4C A;  2Y30 A;  2NNN A;  3TQN A;  1VQK I;  3SZT A;  2VE8 A;  1D1A A;  1H9T A;  5AIP A;  2IPQ X;  3K4C A;  1XG1 A;  1H89 C;  3I64 A;  3MAJ A;  3N97 A;  5CVR A;  1SFK A;  2FBK A;  5IPA A;  2CG4 A;  1IUY A;  2XGD A;  4PSX A;  1A5J A;  2MH2 A;  3OOP A;  1I3Q J;  2LKX A;  1FT9 A;  2HQN A;  3P7N A;  3CP2 A;  2IGN A;  3AL0 B;  1U2W A;  2Q2E B;  1APL C;  3L2U A;  3HB9 A;  1XGO A;  3DXJ F;  2DT5 A;  1GLN A;  2VC0 A;  1OYY A;  4YFX F;  2CV2 A;  4E6K G;  5K7Z A;  2AHQ A;  1Y39 A;  2O6G E;  2WB1 A;  2VBZ A;  4DYC A;  1V5F A;  5FKO A;  1TZL A;  1VQN I;  1KU2 A;  1F36 A;  3WTV C;  1E3O C;  1HBX G;  3DEW A;  5DM6 F;  3RTR A;  2LY9 A;  1LNW A;  4ZDO A;  3FXK A;  2KJB A;  3K6G A;  2A61 A;  4XKC A;  2VQL A;  1OR7 C;  4HOB A;  3K4J A;  4KN7 X;  5K5O A;  4JQF A;  3F8C A;  1WRJ A;  3EUA A;  2KP6 A;  2O9L A;  3ABK H;  4KT6 A;  5DUI A;  1YRN B;  3DPU A;  3V7R A;  3GFL A;  1IF1 A;  4X1E A;  3LAP A;  1X2N A;  2CUF A;  4HAM A;  2QA4 I;  2HOA A;  3WTW C;  5J4V A;  2G7H A;  3S17 J;  3JRD A;  3DKW A;  5D4S A;  3PFI A;  1ETY A;  4XID A;  3QOE A;  2KIS A;  1ZLJ A;  3KP4 A;  1JKO C;  2XGX A;  2CQX A;  4DGW B;  4BBR J;  1WI3 A;  1LEB A;  5AON A;  3V42 A;  3M3Y J;  2WAD A;  2AQE A;  5EG0 A;  2IA0 A;  5FO5 A;  2PX9 A;  3WHB A;  1D3Y A;  1UG0 A;  2X1C A;  3PIO F;  2JT1 A;  2QQ9 A;  2RNJ A;  1LDK B;  3O8H A;  3TO9 A;  4PUS A;  3BCA A;  4RAG A;  5IY5 H;  1Z9C A;  1F9N A;  1U0J A;  3D5S C;  1IXS B;  4CCO A;  4E7I A;  2O0Y A;  2GA1 A;  1G3S A;  1QQI A;  2Z5U A;  3LNQ A;  3GCM A;  2VBW A;  3TO7 A;  1YI2 I;  2BBY A;  3OYD A;  2RDP A;  1M1E B;  2P8T A;  2VOD A;  1Q1H A;  2I8D A;  1XB4 A;  1Y56 A;  2ZBK A;  4L5E A;  3WU2 C;  3ZMD A;  4XK4 A;  2VOO A;  1FOX A;  3H1C A;  3O8G A;  2H6B A;  4RDU A;  3H36 A;  4Y4R A;  3PJR A;  1R00 A;  3A0B C;  1HW1 A;  2LMD A;  2EIL H;  1XS9 A;  1R9T J;  3WE3 A;  1FIP A;  4FE7 A;  1ZG3 A;  3G4S I;  1OYI A;  2IGK A;  3GEZ A;  3K2A A;  1TWC J;  2HYF A;  5KCM A;  1YG2 A;  2M9H A;  3QYE A;  5HOO A;  3CCV I;  1YIO A;  2NS8 A;  4CCK A;  2HOS A;  4XLN F;  1YIJ I;  3KP3 A;  2XAS A;  5BOX A;  1UJ8 A;  3D5R C;  2E1M B;  2VT2 A;  1JT0 A;  4ESJ A;  2BVM A;  3MEX A;  2DOD A;  2ICW G;  2F5C A;  2OJE D;  2PFB A;  1W36 C;  1KQ9 A;  3FIS A;  2BHY A;  2L54 A;  2GAU A;  1U5T C;  1Z91 A;  4CA0 A;  1TP4 A;  3ULQ B;  2BOL A;  3FXO A;  1TLH B;  1Z1D A;  5K7H A;  2JPC A;  1BL0 A;  2MC3 A;  1IN7 A;  1BR1 A;  1O4X A;  2E36 A;  2VC1 A;  2ID6 A;  1VQ7 I;  2DTZ A;  4A0Y A;  4HX4 A;  4XON A;  3K4L A;  4Y15 A;  2AXT C;  2E1O A;  2MA3 A;  3BT9 A;  4I02 A;  1VZ0 A;  3W3C A;  1YJW I;  5F1R A;  1MD0 A;  1FSH A;  4K2E A;  1R1U A;  4QTR A;  5E20 A;  2ZO4 A;  5E17 F;  2FXA A;  5HDK A;  2DA3 A;  4II3 A;  3CCM I;  4XLP F;  1YFH A;  1WSU A;  5E8G A;  1HA8 A;  3IUO A;  5ERI A;  4IHT A;  5CQG A;  2LOO A;  4CYC A;  1HQC A;  1OR7 A;  1QO0 D;  4OOI A;  2KRC A;  1FTT A;  2VUM J; 
#chains in the Genus database with same CATH homology
 2EJR A;  2EA2 A;  1P92 A;  4CGZ A;  3EYI A;  5ED4 A;  1SFU A;  3CJN A;  3K2Z A;  3E3V A;  4MTE A;  5ILS A;  1USS A;  1R23 A;  1FYK A;  1J5Y A;  2VBX A;  4OIR F;  5H20 A;  3N4M A;  3GWZ A;  2R3S A;  3JSP A;  2ZJ2 A;  4A2U A;  5AIQ A;  4LLL A;  3WGI A;  2HTJ A;  2IVM A;  4CIC A;  5CLS A;  1ULY A;  1Z6R A;  1R5G A;  4LLG F;  2XHK A;  5L3C A;  1Y0U A;  5CYV A;  4LFU A;  4KMU X;  1DPR A;  2A07 F;  2Y0M A;  3TKY A;  3B02 A;  5FLX Z;  2ZCW A;  5L3D A;  2X0L A;  1O3S A;  2HEO A;  1T39 A;  4BXU A;  2DO7 A;  3SFZ A;  1T2K A;  1RIO H;  2V1D A;  2QQA A;  3OV8 A;  1ZAO A;  5H6Q A;  4KN4 X;  1ON1 A;  2DI3 A;  3QAH A;  1GXP A;  2EFO A;  3L2C A;  2BEO A;  3M7G A;  3LST A;  1ZN2 A;  1ON2 A;  2YSR A;  5JHU A;  3E6B A;  2A68 F;  1CGP A;  1XGS A;  3BOQ A;  2K7L A;  1F4K A;  4I2O A;  3F22 A;  3W6K B;  1Z6T A;  5HDG A;  3BPX A;  3DQV C;  3EDP A;  5A2Q Z;  2PMH A;  4XSX F;  1EV7 A;  4ZYG A;  3G73 A;  4OU0 A;  3E5U A;  1R5H A;  2PEX A;  4MQ9 F;  2GZW A;  2LF7 A;  3ZPL A;  3K1M A;  4I09 A;  1AWC A;  2DU9 A;  3WTU C;  3R4K A;  1G3Y A;  5CVI A;  1RUN A;  3S2W A;  3GW2 A;  1SD4 A;  2A3S A;  3LAJ A;  1K6O A;  4EV0 A;  1OYW A;  1P6R A;  1ZRC A;  1Z05 A;  2KRF A;  4XBF A;  2QM3 A;  1STZ A;  4OMY A;  1X3U A;  2W25 A;  2XVC A;  3WTY C;  1I1S A;  4ZH4 F;  1OKR A;  3V7C A;  5JVT A;  3Q5F A;  1UB9 A;  1MJA A;  3RIR A;  3RPQ A;  1O3T A;  4EGZ A;  5ICF A;  3GFM A;  1ZG1 A;  1D5V A;  1FBS A;  4MEX F;  4MNU A;  1MGT A;  2RVC A;  4FX0 A;  1S3J A;  4U0W A;  3F23 A;  3QP6 A;  4M6X A;  4NB5 A;  2D45 A;  1WQ2 A;  4EJV A;  4RB3 C;  3KP5 A;  5ICC A;  4KYW A;  1DPU A;  2ADU A;  2EA4 A;  2V9V A;  3H92 A;  5ILV A;  3KLN A;  1SMY F;  3LQQ A;  3B73 A;  4RAZ A;  4GYG A;  2XAF A;  4FT8 A;  1YS7 A;  4HQE A;  1MDM A;  3EUH A;  1XMA A;  3IHU A;  3NQO A;  2GA2 A;  3ECH A;  3WTS C;  1SFE A;  4RAY A;  1TNS A;  1OMI A;  5J8F A;  5BQT A;  3M9A A;  1K78 A;  1KQ0 A;  5E1W A;  3BJA A;  3LA7 A;  1LEA A;  1BN5 A;  2FQ3 A;  4L5I A;  5LBQ A;  4JBA A;  2ETH A;  2PLY A;  4G7H F;  1U6G A;  4IRH A;  4OIN F;  4Y13 A;  1QNT A;  2BV6 A;  5D6E A;  5D8L B;  2QBY B;  2QEN A;  4HLY A;  1EH8 A;  2AS5 F;  5LGU A;  5HLI A;  1FYM A;  2TDX A;  1FC3 A;  5D5W B;  2BE5 F;  1UHW A;  2HTS A;  1WI9 A;  1ZRE A;  2F5D A;  2V1X A;  4U7B A;  3TGN A;  3U1D A;  3FM5 A;  2V6C A;  5JFR A;  2WV0 A;  1XCV A;  2DTR A;  1JXS A;  5D5V B;  3K1P A;  2L4A A;  2DQL A;  3WU1 B;  2FOK A;  1IW7 F;  2ZME B;  2DBB A;  1YLF A;  3LQR A;  1R22 A;  5LHI A;  2FF4 A;  4AIH A;  5F64 A;  1J2X A;  2OZU A;  3RPU A;  3IWZ A;  2XAG A;  3K1N A;  4Z2Y A;  4LG0 B;  4WF2 A;  3BP8 A;  1W5S A;  3M8E A;  2W84 A;  5L3F A;  4BAY A;  1IRG A;  1T98 A;  4WXD A;  3F8F A;  4KIF A;  5D6F A;  5DUK A;  3BY6 A;  3ABU A;  4KIC A;  4ESB A;  3WGG A;  3RKX A;  1XGN A;  3HSF A;  1O3R A;  1D8K A;  4ASN A;  1HKS A;  2AXL A;  2FNA A;  4M74 A;  3GZ5 A;  3HRS A;  2DPD A;  3HHH A;  4KIG A;  1IZ1 A;  1G4D A;  2ESN A;  1XGM A;  2R7D A;  3KZY A;  1V4R A;  1XDU A;  3GO5 A;  1UST A;  2KJC A;  4IPA A;  3KEQ A;  3EQL F;  3CO7 C;  5D5U B;  1TQM A;  2R7F A;  2H6C A;  4R8H A;  1TQI A;  5LRS A;  2Q8K A;  3ZMZ A;  4P9F A;  2WTE A;  3P9C A;  3ECO A;  2Q2E A;  1ZGA A;  2P6S A;  4L9T A;  5EEH A;  4FHT A;  2FSW A;  2PJP A;  4BQA A;  4EJW A;  4OIO F;  5E1X A;  2FMY A;  2STW A;  5FFX A;  3HUG A;  3RJP A;  4IVN A;  5FLX K;  1IAW A;  3C1D A;  2D1V A;  3IWF A;  3Q9S A;  2DQR A;  3QU6 A;  5H6R A;  4IF4 A;  4M6Y A;  2IT0 A;  3I5U A;  4G7O F;  4LD5 A;  4RB0 A;  1MZB A;  2ZXJ A;  5DCM B;  4L5J A;  2HOE A;  3GYH X;  2KIF A;  3LA2 A;  2M87 A;  1RI7 A;  3GZ6 A;  4XRF A;  1S6L A;  4UV8 A;  1U8R A;  3F8N A;  5A2Q K;  5BPD A;  4HX8 A;  1HXD A;  4BH9 A;  5E18 F;  1RUO A;  1SD7 A;  4S04 A;  1EH6 A;  5J6X A;  4R1H A;  3GFJ A;  1RNL A;  3HIF A;  3E6C C;  4YIF A;  4WCG A;  4KDP A;  2HWV A;  3SZP A;  5E1Z B;  4G7Z F;  4EQQ A;  4HF0 A;  1ZRF A;  1FP1 D;  4M72 A;  1P4W A;  2XAH A;  3HSE A;  3P9I A;  3TDU C;  2COM A;  3HHG A;  1XSX A;  3SXY A;  4A12 A;  1R7J A;  3F6V A;  3SHF A;  3QRF F;  3HYI A;  4O6J A;  4KT5 C;  1QPM A;  5LHH A;  1FLI A;  2EFQ A;  1ONV A;  4AIJ A;  2O3F A;  3FHZ A;  3KP6 A;  3D0S A;  2W57 A;  4O3M A;  1W7P D;  1U78 A;  4Q5S F;  3KP2 A;  1ZRD A;  1UCR A;  3PQK A;  2UZK A;  3ZN1 A;  3ISP A;  3FX3 A;  1BI0 A;  2BYV E;  1YW9 A;  3T5X A;  3ZQ7 A;  3I54 A;  4HDV A;  1B9N A;  4ZYE A;  4Q4Z F;  3HOT A;  2CO5 A;  2EFW A;  5IT9 K;  3RYP A;  1FBQ A;  3KP7 A;  5HDN A;  5ICG A;  1IXR C;  2HKX A;  1FOK A;  4D0P A;  4EMS A;  4HYE A;  1TW3 A;  3LFK A;  1K79 A;  4KNY A;  1W5T A;  2K27 A;  4I0B A;  2DK5 A;  4HBL A;  3HTS B;  5ICE A;  4QLC U;  2M45 A;  1H0M A;  1B6A A;  2MLK A;  2O03 A;  2H94 A;  3ZP5 A;  1BBY A;  4Y17 A;  1QZZ A;  4M9S A;  1HW5 A;  2ZKZ A;  2V1U A;  1D8J A;  5K5Q A;  3RDI A;  4FX4 A;  2VOP A;  3DV8 A;  1BI2 A;  3I4P A;  2X4H A;  1KA8 A;  2XKO A;  5KK1 A;  3J81 K;  2VON A;  1BM9 A;  3PQJ A;  3ABT A;  4OMZ A;  3IRQ A;  1G3T A;  1PP8 F;  2M30 A;  5DYM A;  2HZT A;  5CVV A;  3ROU A;  1ODD A;  5LRR A;  4MQV A;  4CHU A;  4I0A A;  2XAQ A;  4IHS A;  4EGY A;  2FE3 A;  2YU3 A;  2G9W A;  4HDU A;  5D5X B;  2CQK A;  1IN5 A;  2V79 A;  1XD7 A;  1FBU A;  1TW2 A;  3HRT A;  2GIV A;  3V4G A;  4EVI A;  3VB2 A;  4MHG A;  3JTG A;  4AIK A;  2FA5 A;  2MH9 A;  1FWZ A;  1IRF A;  2EFP A;  4ENK A;  2P7V B;  4P55 A;  2A69 F;  1W7P B;  5CJ9 A;  6PAX A;  3MZH A;  2WC2 A;  4RGX A;  1U5T B;  5JR3 A;  1B1B A;  3WE2 A;  4YFK F;  3T8T A;  4LK0 F;  3KFW X;  4LLN A;  1XCB A;  2M5W A;  1YW8 A;  4BHB A;  4E70 A;  5DEQ A;  4MTD A;  2P7C B;  2F5E A;  1PUE E;  4I98 B;  1FNN A;  5DV5 A;  2RKH A;  3R0A A;  3GLX A;  3IKT A;  4UVA A;  2RQP A;  3O6B B;  2ISZ A;  1SAX A;  4Q47 A;  2L4M A;  2H09 A;  1L0O C;  1ZGJ A;  1FY7 A;  1R58 A;  4KFC A;  3KZZ A;  4IRG A;  2KKO A;  3CDH A;  3I71 A;  3TDZ C;  3QP5 A;  1WKM A;  1KU7 A;  1VTN C;  3CLO A;  1XSD A;  4RB2 C;  3BPV A;  3DPT A;  3E5Q A;  1FYL A;  2HQR A;  1IN8 A;  2OA4 A;  2PG4 A;  3MFK A;  3E97 A;  3BZ6 A;  4L9N A;  3WGH A;  1SD5 A;  1WWX A;  3HOS A;  1XSV A;  2A6E F;  2QLZ A;  1P4A A;  3NEU A;  1KYZ A;  1REP C;  4LMY A;  4NQW A;  2E7X A;  1ZH5 A;  4EJT A;  2EK5 A;  3DF8 A;  2ACJ A;  5IT9 Z;  2VXZ A;  1ZG5 A;  5K1Y A;  3FWE A;  3T1B A;  4HX7 A;  4U0V A;  1L3L A;  3D5L A;  4EM0 B;  2L3D A;  3LWF A;  1G6N A;  2GXG A;  1ZLK A;  1HW2 A;  1CF7 A;  3WTX C;  1DUX C;  5LLQ A;  1BI3 A;  2VBY A;  1I5Z A;  5HLH A;  1MDM B;  3C3W A;  1TBX A;  2M8E A;  2F2E A;  1QGP A;  1O7L A;  4G8X A;  2QBY A;  2BGC A;  5HS9 A;  3AAF A;  5HVQ C;  4OIQ F;  3CUQ B;  2EWN A;  4YII A;  3I59 A;  2GXB A;  2EV5 A;  5CVU A;  3J81 Z;  2HDC A;  4AD9 A;  1S7O A;  5LGT A;  4WX9 A;  1LB2 A;  1IN6 A;  4UXN A;  4YG2 F;  2VN2 A;  3RKY A;  3JAM K;  1C0W A;  4B09 A;  3JTH A;  4ZYH A;  1IXC A;  2CW0 F;  3P9K A;  2B0L A;  2A5Y B;  3JW4 A;  3BRO A;  2M1B A;  2DFI A;  1MJ9 A;  4CO8 A;  4HW0 A;  3R6S A;  4QWQ A;  2XRN A;  1A04 A;  3BWG A;  2CSO A;  3I58 A;  1XDS A;  3ZMV A;  1YYV A;  4G6D A;  3FF5 A;  2MD5 A;  2FRH A;  4BHP A;  2EV0 A;  1UFM A;  2YX7 A;  2EFN A;  1E17 A;  2E1N A;  3ML6 A;  4LG0 A;  1J59 A;  2DK8 A;  1BIA A;  1HSJ A;  4PGH A;  4EJU A;  3F8M A;  2XRO A;  2XIG A;  4N9I A;  3BJ6 A;  2DW4 A;  3K9T A;  1S29 A;  1R1V A;  2K4J A;  2Z3Y A;  3REO A;  1I27 A;  4AVP A;  2IP2 A;  3F72 A;  4KUM A;  5FGM A;  1I6X A;  2GQQ A;  3FXU A;  2QVO A;  4DNC A;  2O61 A;  4A0X A;  5BPI A;  4BHC A;  1I1G A;  5IT3 A;  2Q0O A;  3BDD A;  3GF2 A;  4IJA A;  2P5V A;  4ENJ A;  2JTV A;  3O2P E;  4AWX B;  4BYY A;  3FMR A;  2STT A;  5LEK A;  4RGU A;  1EH7 A;  2L01 A;  4IXA A;  3IC7 A;  2PQ8 A;  4B8X A;  3MWM A;  2YPR A;  3WU0 A;  3WTZ A;  4KMF A;  5L3B A;  2IA2 A;  1LDJ A;  4LK1 F;  4KA4 A;  5TJJ A;  4ZZD A;  5L3G A;  1XMK A;  3C18 A;  5HS8 A;  4EJO A;  3L00 A;  5DDG A;  1JE8 A;  1PP7 U;  1YTY A;  1SD6 A;  1J0R A;  4H0E A;  2UXN A;  4MGR A;  4HF1 A;  2PBI A;  3IL2 A;  4TV7 A;  3DEU A;  4F7Z A;  2OZ6 A;  2OQG A;  4L9J A;  1GXQ A;  3GXO A;  2HR3 A;  2PMU A;  4HV6 A;  3V8K A;  4A5M A;  4M9Z A;  2UWM A;  4G6Q A;  2K86 A;  1V3F A;  4G94 A;  2A6H F;  1MJB A;  2K4B A;  3GFI A;  5DCM A;  2RV8 A;  2FEZ A;  2YX4 A;  4EM1 A;  5DCF A;  4U7D A;  3DP7 A;  4HQM A;  2ISY A;  1R1T A;  2KIM A;  2FU4 A;  1O7F A;  1LJ9 A;  2QZ8 A;  1S7A A;  2K02 A;  4I7H A;  2LKP A;  1FZP B;  2Z9O A;  2OU2 A;  4I01 A;  3MQ0 A;  2FML A;  3CO6 C;  2KIU A;  2F5F A;  2IA1 A;  3ZMU A;  5KVR A;  1QZY A;  3J7A O;  2P5K A;  2EV6 A;  2NRA C;  2ESH A;  1R36 A;  1HKT A;  2QWW A;  1MKM A;  4UHT A;  5FD5 A;  5DD8 A;  4RS8 A;  3H3U A;  2RC4 A;  2UXX A;  3WTT C;  1B9M A;  4UVB A;  2MLG A;  5CVJ A;  2PI0 A;  3VEP A;  2OAZ A;  3JAM Z;  3K69 A;  1JHF A;  5BS6 A;  5D4R A;  2ZFW A;  4OIP F;  1F5T A;  3L9F A;  2JSC A;  2PN6 A;  1BIB A;  1BI1 A;  3U2R A;  1GHC A;  2FNP A;  4CDG A;  3W6J B;  1ZHF A;  4A6D A;  1QBJ A;  1KU3 A;  3JSO A;  5TRD A;  2JRT A;  5DD4 A;  5FFZ A;  4GYI A;  2D1H A;  3MZY A;  2P5L C;  3TOB A;  1O3Q A;  1B4A A;  1BC7 C;  2C6Y A;  1FPQ A;  2ZNY A;  2E7W A;  4PZJ A;  3DPL C;  4P5O A;  3RKW A;  4A0Z A;  3QOP A;  4GXO A;  5HS7 A;  1LDD A;  1W4M A;  1P4X A;  3GVA A;  5D8K B;  3F8B A;  2CFX A;  4N0B A;  5LHG A;  3FXQ A;  5J8C A;  1BOA A;  2YR2 A;  1NHA A;  2CYY A;  3TOA A;  3VOE A;  1KQ8 A;  2NYX A;  3SQN A;  3ERE D;  4L0Z B;  4RGS A;  2NS0 A;  1RZ4 A;  3LA3 A;  3J80 K;  4CXF A;  1IN4 A;  4WXC A;  4HV5 A;  3KEO A;  1BJA A;  1KU9 A;  1SFX A;  3GX4 X;  1GVJ A;  2XKP A;  1FP2 A;  3R61 A;  2QQB A;  3WOD F;  2DAO A;  4UUV A;  3ZN0 A;  3NRV A;  3E5X A;  5HLG A;  5K5R A;  4CZZ A;  4ENM A;  2EB7 A;  2LF8 A;  4RGR A;  4LJZ F;  2Y48 A;  1AOY A;  1XN7 A;  1J7K A;  2CWE A;  2Z33 A;  2HFH A;  3KLO A;  3M8F A;  1O57 A;  3HSR A;  4HLX A;  4ETS A;  4U0Y A;  2LNB A;  2E1C A;  2OBP A;  1FX7 A;  2WWY A;  1LVA A;  3VFZ A;  4LGW A;  4M71 A;  3F6O A;  1JHH A;  3EET A;  2Z99 A;  1ZAR A;  4LB5 A;  3T0Y A;  2GWR A;  1P2F A;  1W7P A;  3V7S A;  2HKO A;  4HA8 A;  3FXR A;  1HST A;  1KGS A;  1U5T A;  2JZY A;  2W85 A;  3RI4 A;  1G3W A;  3KET A;  4R79 A;  2XV4 S;  3BJO A;  3CUQ C;  3U9G A;  2VE9 A;  2O8X A;  2P6T A;  2ZNZ A;  2MBF A;  4L18 B;  4BNC A;  3FM3 A;  3RYR A;  4WWC A;  4PGG A;  4ESF A;  1JGS A;  2J5O A;  1BC8 C;  4UVC A;  3Q9V A;  3GUD A;  4L9V A;  3T8R A;  1DP7 P;  1YQA A;  1YS6 A;  1SMT A;  3L7W A;  4MEY F;  3FMQ A;  4GCV A;  1FSE A;  3ZMS A;  2J5P A;  2G7U A;  1OPC A;  4IRI A;  4A5N A;  4XSZ F;  3V8L A;  4WK8 F;  1TNT A;  2NAZ A;  2FBH A;  3CUO A;  1T38 A;  4JK1 X;  2L02 A;  1YW7 A;  4HZF A;  3VOD A;  3I0T A;  2Y75 A;  1YO5 C;  4P9U A;  1H9G A;  3KCC A;  1DDN A;  5ILU A;  1TQP A;  2FBI A;  3L09 A;  4S05 A;  4O5V A;  3EYY A;  3HTU A;  3QU3 A;  4UNO A;  4U88 A;  2XUB A;  2NNY A;  1Z7U A;  3J80 Z;  1S8N A;  4RB1 A;  1B59 A;  4ON0 A;  2VT3 A;  3TO6 A;  4YFN F;  3MCZ A;  4EM2 A;  5JI6 A;  4M73 A;  3M1E A;  2IRF G;  3CUQ A;  3WG9 A;  3R60 A;  5LEJ A;  1KYW A;  1TTY A;  3F21 A;  1CF7 B;  3I53 A;  3FZV A;  2P4W A;  2IW5 A;  4WXH A;  5E8I A;  4Q48 A;  1K78 B;  3QPT A;  1J9I A;  1E2X A;  4A6E A;  1F1Z A;  3R0J A;  3V8J A;  1T6S A;  4N9H A;  5FD6 A;  1J75 A;  2W24 A;  2HGC A;  2HS5 A;  4G9Y A;  3E6M A;  4LB6 B;  3I59 B;  3K0L A;  3ZMT A;  2LDU A;  3G3Z A;  4NHJ A;  2ZME A;  4PDK A;  4GGG A;  1K7A A;  2QYO A;  2ELH A;  3HRU A;  3IRR A;  1T0F A;  4PCQ A;  5L3E A;  1PDN C;  4KIB A;  3CTA A;  1LQ1 A;  4CYD A;  2LSO A;  4UV9 A;  3COA C;  3DFG A;  3KE2 A;  2OD5 A;  2D2W A;  2RN7 A;  1HKQ A;  2QUF A;  2H27 A;  2DPU A;  3HRM A;  5EEG A;  2HYG D;  1UHM A;  2RGV A;  4DQ2 A;  3O3K A;  1ZYR F;  5LGN A;  2JPB A;  3IKV A;  1U3E M;  4HF2 A;  3C7J A;  4ZZL A;  2DLL A;  3F3X A;  4ZYD A;  3FMS A;  2OQR A;  4ENN A;  3E6D A;  3QPH A;  2CGP A;  4GO1 A;  2IJL A;  2XAJ A;  5F6F A;  3H3Z A;  3ELK A;  5BMZ A;  4L0Y B;  4P96 A;  4M9X A;  5FB2 A;  2NNN A;  3TQN A;  3SZT A;  2VE8 A;  1H9T A;  5AIP A;  2IPQ X;  3I64 A;  3MAJ A;  3N97 A;  5CVR A;  2FBK A;  2CG4 A;  1IUY A;  2MH2 A;  3OOP A;  1FT9 A;  2HQN A;  3P7N A;  1U2W A;  1XGO A;  3DXJ F;  2DT5 A;  2VC0 A;  1OYY A;  4YFX F;  2O6G E;  2VBZ A;  1KU2 A;  3WTV C;  1HBX G;  3RTR A;  1LNW A;  2KJB A;  2A61 A;  4HOB A;  5K5O A;  4KN7 X;  4JQF A;  3F8C A;  1WRJ A;  5DUI A;  3V7R A;  3GFL A;  1IF1 A;  3LAP A;  4HAM A;  3WTW C;  2G7H A;  3DKW A;  5D4S A;  3PFI A;  1ZLJ A;  3KP4 A;  2XGX A;  1LEB A;  5AON A;  2IA0 A;  5FO5 A;  1D3Y A;  2JT1 A;  2QQ9 A;  2RNJ A;  1LDK B;  3TO9 A;  1Z9C A;  1F9N A;  1IXS B;  2O0Y A;  2GA1 A;  1G3S A;  1QQI A;  2Z5U A;  2VBW A;  3TO7 A;  2BBY A;  2RDP A;  2P8T A;  2VOD A;  1Q1H A;  2ZBK A;  1XB4 A;  3ZMD A;  2VOO A;  2H6B A;  1R00 A;  1HW1 A;  3WE3 A;  1ZG3 A;  1OYI A;  3GEZ A;  2HYF A;  1YG2 A;  5HOO A;  1YIO A;  4XLN F;  3KP3 A;  2XAS A;  5BOX A;  2VT2 A;  4ESJ A;  3MEX A;  2F5C A;  2PFB A;  1KQ9 A;  2L54 A;  2GAU A;  1U5T C;  1Z91 A;  3ULQ B;  1TLH B;  1Z1D A;  2JPC A;  2MC3 A;  1IN7 A;  2VC1 A;  4A0Y A;  4HX4 A;  4Y15 A;  2MA3 A;  4I02 A;  5F1R A;  1MD0 A;  1FSH A;  4K2E A;  1R1U A;  5E20 A;  2ZO4 A;  5E17 F;  2FXA A;  5HDK A;  4XLP F;  1YFH A;  1WSU A;  5E8G A;  5ERI A;  4IHT A;  1HQC A;  1OR7 A;  1QO0 D;  4OOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...