3L2CA

Crystal structure of the dna binding domain of foxo4 bound to dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
85
structure length
85
Chain Sequence
RRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the human FOXO4-DBD-DNA complex at 1.9 A resolution reveals new details of FOXO binding to the DNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords FOXO consensus binding sequence, plus strand
total genus 22
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2009-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l2cA00
4UV9A 4HQMA 2MC3A 2H27A 2Y75A 4G9YA 1RUNA 4OMYA 3E5QA 2EA2A 4L0YB 2F5DA 5LHIA 1K78B 1P6RA 2DPDA 3RYRA 4ON0A 1A04A 1TNTA 4AIKA 3IHUA 2X4HA 3QU3A 1JXSA 1Z05A 2UXNA 2PMHA 1KQ9A 4MNUA 2EV6A 4HOBA 3JTHA 3DPLC 1ZLKA 4HF2A 2A6HF 2W85A 2ZMEA 1IXRC 4EM0B 1HKTA 2P7VB 2ZBKA 5ILSA 2GXGA 4RGXA 2OAZA 4GYIA 3L00A 4PCQA 4N9HA 4BAYA 3F8NA 4EM2A 5A2QK 3V8JA 1F9NA 2FBHA 3PQJA 2IW5A 4WF2A 1Z91A 2OA4A 2XV4S 1ON2A 5ILUA 2NNYA 3TQNA 3M7GA 1I6XA 3WGIA 4JK1X 1ZGAA 1R58A 3JW4A 2CFXA 3R4KA 2JZYA 3HTSB 5E8GA 1E2XA 4HQEA 2X0LA 4Y17A 5ICFA 3GX4X 2HFHA 2UXXA 3W6JB 3ECOA 5D4RA 1MKMA 4HA8A 1T38A 3LAPA 1F1ZA 3E3VA 4KNYA 3R60A 4HZFA 4YIIA 5DV5A 1ZARA 1D3YA 2J5OA 1T2KA 4KUMA 2F5EA 2C6YA 3SXYA 5D4SA 1D5VA 3E5UA 4YFNF 2P4WA 2FBKA 1XMAA 3FMQA 2Z99A 2F2EA 3QU6A 2DU9A 4TV7A 5L3BA 5FB2A 4P55A 3KEOA 1D8JA 4B8XA 3OV8A 1R22A 2BEOA 4QWQA 1FPQA 1XB4A 2XAGA 1BM9A 4EVIA 2VT3A 3KETA 2FU4A 2XAHA 2GA2A 4EJUA 3KP5A 4U88A 4KDPA 1SD4A 4EQQA 5K5RA 2A61A 2H09A 5E17F 1TQPA 4LMYA 3HSRA 2FQ3A 3FMRA 2FNAA 1I1SA 1JHHA 2H94A 1H9TA 4BNCA 3IWZA 3WODF 5ILVA 3G3ZA 5K1YA 1WKMA 1BIBA 2ISZA 1LDKB 1XSXA 1FSHA 2STTA 3VB2A 4AWXB 1OPCA 2ZNZA 2EFWA 2IRFG 2WWYA 2QZ8A 2EFOA 2KKOA 2PFBA 1IZ1A 5ICGA 3FXQA 3FM3A 4AIJA 4ZYDA 1P4AA 1SAXA 2OBPA 1XGNA 3IWFA 4L9VA 3KE2A 4Z2YA 1XGOA 2MBFA 1ULYA 3JTGA 1XMKA 1LJ9A 2VBZA 3DEUA 1AWCA 1BI2A 2FEZA 4H0EA 4MTEA 1XCVA 4M6YA 2Y48A 2VBXA 4KA4A 4UHTA 1KQ0A 5J8CA 5AIPA 1FYLA 1KYZA 5BQTA 1U6GA 1K79A 2G9WA 1HXDA 1OMIA 4P96A 3VEPA 4ZYHA 3P9IA 1R1TA 2BGCA 3LA3A 4ESFA 3BJAA 2Z3YA 4P5OA 2Q0OA 2KIFA 1ZREA 1ZHFA 2H6BA 1BI0A 2PJPA 2VE9A 3K9TA 4LLNA 1RUOA 2XHKA 1U8RA 2HKOA 4HBLA 5FGMA 1HKSA 2EWNA 3HUGA 2HKXA 2KIUA 3BDDA 6PAXA 1FLIA 1ZRDA 2O03A 5ERIA 3MZHA 4A5MA 1XSDA 4RAYA 1U78A 2CQKA 3GVAA 2W25A 2KIMA 2COMA 1ZG5A 1R1VA 3KCCA 2DFIA 1YLFA 5D5UB 3HRTA 3ZMVA 2OZ6A 3EYYA 4Q4ZF 4L9TA 3WG9A 4MQ9F 3CO6C 3RYPA 4ENKA 3H3UA 2VOOA 5ICEA 2A69F 3MCZA 2ZMEB 4I09A 2RNJA 4PDKA 1J59A 5DCMB 2VXZA 3W6KB 3BJ6A 3F8MA 1RZ4A 4IRHA 2D45A 3I58A 2VE8A 5DD4A 3RPUA 1EH7A 1MDMB 1FYMA 4KFCA 3S2WA 5L3EA 2RDPA 4FT8A 4S04A 1FY7A 5TJJA 1K7AA 5A2QZ 2IP2A 3BOQA 3I54A 2M30A 1PP8F 5LGUA 4BYYA 3VOEA 3T1BA 5LRRA 2E1CA 3RJPA 5E1WA 2FXAA 3ECHA 1B6AA 3F21A 4OINF 5CVRA 2UZKA 1MZBA 3K69A 2IVMA 5D5VB 4YG2F 3V8KA 3JAMZ 2ZCWA 5H20A 1ODDA 3GZ5A 1SFXA 3BJOA 4EGZA 2A07F 4EJTA 1C0WA 4LG0B 5BPIA 4GO1A 2HTJA 2HQNA 2XRNA 3HSEA 5HLHA 3LQQA 2NS0A 1YTYA 4CZZA 4PGGA 1IRFA 4ESBA 2LF7A 2RGVA 3VODA 3KZYA 4YFXF 3F6VA 2ZKZA 2G7HA 1IF1A 3E6DA 3F8CA 4CHUA 4WCGA 3C18A 1XSVA 1DUXC 4P9UA 2JSCA 3O2PE 1O3TA 3LWFA 1P2FA 2PN6A 1QQIA 4WXDA 2FE3A 1LDDA 3GFJA 2RV8A 4L9NA 2L54A 5ED4A 3I59A 2OQGA 1YW8A 1CF7B 2GZWA 1K78A 3F22A 4HLYA 5BOXA 2RVCA 2BE5F 1B59A 3E5XA 4UVBA 1E17A 5H6RA 4ENNA 3JAMK 2HZTA 4MEXF 1I27A 3KP6A 4G6DA 1G3YA 1GXQA 2A6EF 4MTDA 3V8LA 3GUDA 2STWA 4WX9A 4RB1A 1KA8A 2QVOA 3WTTC 4KIBA 3BROA 2VOPA 1UHMA 5D6FA 4O6JA 4UXNA 4IHSA 4HF0A 1EH8A 1IXCA 2W84A 3M9AA 1XGSA 2IJLA 1S6LA 3CUQA 3H3ZA 1YIOA 2V1XA 2ZFWA 4LFUA 3FWEA 3RKWA 5E1XA 5F1RA 1Z1DA 2K7LA 5L3FA 3SQNA 5F64A 3MEXA 2E1NA 5HDGA 3R0JA 3WTXC 2O61A 1S7OA 5LHGA 4LLLA 1LNWA 1HW1A 4A12A 4IPAA 3K1PA 1W7PA 3ZMTA 1XGMA 4ZYEA 4LJZF 3R6SA 4U0VA 2CYYA 1P92A 1BI3A 1QZZA 1UCRA 2CSOA 4A5NA 5LLQA 2UWMA 2NYXA 4L9JA 2DLLA 3ML6A 1GVJA 1OKRA 5DCFA 3U9GA 1TTYA 3KP7A 1YFHA 1GXPA 2P5LC 3HHGA 4OMZA 4LG0A 1YS7A 4RAZA 2O8XA 5CLSA 4HF1A 2GAUA 2DK8A 3HOSA 2OQRA 3ZMSA 1IUYA 4K2EA 3B02A 4WXCA 1QBJA 1BBYA 3FXUA 3MAJA 3E6BA 3QP5A 3GFLA 1BIAA 1KYWA 3NEUA 1ZRCA 2QYOA 5AIQA 4JBAA 5JHUA 2D2WA 4HLXA 3LFKA 4WK8F 3IL2A 1IW7F 4IJAA 1NHAA 3B73A 4UNOA 1YG2A 1UB9A 4IF4A 2FF4A 3EETA 2VONA 2PLYA 2FA5A 2DO7A 4ZYGA 3KFWX 2Z5UA 5FLXK 5KVRA 4QLCU 3I64A 1LEBA 2JPBA 2K27A 1OR7A 5HS9A 5D5WB 1ZGJA 4CDGA 2OZUA 2V1UA 4GCVA 3WGHA 2XAFA 4OOIA 2QWWA 4CYDA 1EH6A 3E6CC 2K02A 1U5TB 2XASA 4HV6A 4G6QA 1Q1HA 3CDHA 5J8FA 1FOKA 3J7AO 2DBBA 3HIFA 2HTSA 1YS6A 3I4PA 4UVCA 2EJRA 1USTA 2NRAC 4HAMA 4A2UA 2L3DA 3ZMZA 1O3SA 3TDUC 5LEKA 2XROA 3RKXA 1TNSA 3N97A 2QBYB 2PMUA 1X3UA 4M73A 1RNLA 5HLIA 3FXRA 1FBQA 2MA3A 4I0BA 1FC3A 3BZ6A 5DD8A 1I1GA 3PFIA 2PI0A 5LHHA 2V79A 1AOYA 1ZH5A 3CUQC 3U2RA 4LLGF 3WTVC 4O5VA 4AVPA 2DT5A 2Z33A 2QM3A 5CVUA 2HWVA 3C1DA 3QRFF 4UVAA 4XRFA 3J80Z 5LGNA 2QBYA 4KIGA 4G8XA 1Z9CA 2HDCA 2P6SA 1R00A 5IT9Z 1LB2A 2V6CA 1SD6A 4M9ZA 3KLNA 5EEGA 1GHCA 2GXBA 2QLZA 3OOPA 1KGSA 1IN6A 4FX0A 2HQRA 5CVJA 2JT1A 1IAWA 2P5KA 4YIFA 2B0LA 2FMYA 4S05A 3DFGA 4KMFA 4F7ZA 1PDNC 1BC8C 1UHWA 3P9KA 3ELKA 4GXOA 4DQ2A 3C3WA 5FLXZ 2W57A 3WE3A 3RTRA 1YQAA 1B1BA 2DK5A 4ASNA 1DPUA 5E1ZB 1U5TC 4M71A 1HKQA 4RGRA 3I0TA 3EQLF 5F6FA 3JSOA 3T0YA 3CLOA 3GW2A 2A5YB 4XBFA 1H9GA 2P6TA 4P9FA 2ELHA 1O7LA 1HW5A 1WWXA 1HQCA 4IRIA 1JGSA 3R0AA 1SD7A 2HOEA 2EFNA 2DW4A 4I98B 1R7JA 4G94A 3F8BA 1P4XA 2ZO4A 2BBYA 1KU9A 4A0YA 4D0PA 3M1EA 4WWCA 1B9MA 5JFRA 3J81K 2CGPA 1FP2A 3ABUA 5KK1A 3K1NA 1L3LA 3P9CA 2WC2A 5E18F 1J0RA 1SMYF 1O3RA 4LD5A 4EM1A 2MD5A 4JQFA 5DYMA 4EV0A 5DDGA 3HTUA 1I5ZA 2EV5A 5K5QA 2MH2A 4M74A 3LA2A 1MDMA 3DP7A 3LSTA 1ZAOA 3I71A 3F72A 4ENMA 3FX3A 5IT3A 5E8IA 2Z9OA 1ZN2A 3COAC 4RS8A 4U0WA 1YYVA 3NRVA 2O3FA 1HSTA 2DTRA 1Z6RA 3HRUA 4N9IA 4HDUA 4HV5A 4PZJA 3WTZA 4KIFA 2GWRA 1ZG1A 3T8TA 4M9XA 4OIQF 1IN4A 1VTNC 4LB6B 1Y0UA 2FNPA 1U3EM 3NQOA 2L02A 3GF2A 4Q5SF 5D8LB 2HYFA 4L5JA 1EV7A 3P7NA 3LA7A 3FHZA 1DDNA 1F5TA 1WI9A 1F4KA 3GFMA 4MGRA 1FX7A 3EUHA 5BS6A 2P8TA 2R3SA 2HGCA 5JR3A 2MLGA 3FZVA 1G3TA 2EV0A 3FM5A 4G7HF 1BN5A 2XVCA 2Y0MA 4RB3C 3L09A 1OYWA 3AAFA 3KZZA 2OD5A 1S3JA 3BP8A 4EGYA 3MWMA 3MQ0A 1HBXG 3HOTA 1T6SA 1IN7A 3GWZA 3Q9VA 1JHFA 3TGNA 2V1DA 1W4MA 1U2WA 3GXOA 1FBSA 4BQAA 2R7FA 3TOBA 4R1HA 1KU2A 4LK1F 1Z7UA 4Q48A 1W5TA 1FWZA 2RC4A 2QENA 2AXLA 4HW0A 4AD9A 4MEYF 1QO0D 5AONA 1MJ9A 1IN8A 4KT5C 4EJWA 3WU1B 1UFMA 5DUKA 2RQPA 1FNNA 3PQKA 2DI3A 2XAJA 4G7OF 1LEAA 3RDIA 5CVVA 2QQ9A 3CTAA 4U7DA 3E6MA 1ZG3A 2E7XA 3ZN1A 4FX4A 4CGZA 4BXUA 4O3MA 3QPTA 1J7KA 5BPDA 2O6GE 3M8EA 2ESNA 3I5UA 1TLHB 3CJNA 1MD0A 1R5HA 2M87A 2VT2A 5L3GA 1W7PB 3BPXA 2Q8KA 1TQMA 2MLKA 1IRGA 1T98A 3O6BB 1D8KA 3TO9A 5JI6A 4CICA 2FBIA 1OYYA 5HDKA 3K1MA 1B4AA 2Q2EA 1W5SA 2MH9A 3ZN0A 2ETHA 5HVQC 1QNTA 3DF8A 2J5PA 1S7AA 4E70A 2R7DA 4OU0A 2ESHA 2M5WA 3V7RA 3TO7A 1SFEA 4Q47A 4IRGA 2XUBA 2K4BA 1V3FA 2FMLA 5CYVA 1TBXA 3I59B 4IVNA 2LDUA 5HDNA 3FF5A 2IT0A 4BHBA 1BOAA 1RIOH 4I0AA 1R23A 3LAJA 3DQVC 1YW7A 1USSA 3O3KA 1FT9A 1R36A 1DPRA 3Q5FA 3RPQA 1V4RA 2L01A 1JE8A 3ZPLA 3L2CA 3K2ZA 3IRQA 1FYKA 2XAQA 5E20A 3M8FA 2XIGA 2VC1A 3HSFA 5IT9K 1J9IA 2JPCA 3ULQB 1SD5A 3F23A 4M9SA 3TDZC 4NB5A 1B9NA 4CO8A 1G3WA 2YU3A 3SZTA 3DXJF 1QGPA 2FOKA 1BJAA 1ONVA 1WSUA 1QPMA 1MJBA 4AIHA 2P7CB 4KYWA 1LDJA 2HS5A 2BYVE 3F8FA 4I2OA 1O57A 3QAHA 2VBYA 4GYGA 5FD5A 1ZYRF 5HOOA 4XLNF 2PBIA 1XDSA 4MHGA 2D1HA 1KU7A 2IA0A 2EB7A 2BV6A 2P5VA 3F6OA 5LBQA 1BC7C 2DAOA 1P4WA 5EEHA 1G3SA 2EFPA 3BY6A 1R1UA 4A0XA 2IA2A 2PQ8A 3CUOA 2E7WA 4Y15A 1K6OA 3MZYA 2ZJ2A 5LGTA 1XN7A 3FMSA 4A0ZA 2JTVA 2ADUA 5FD6A 2AS5F 2VODA 2YPRA 1FZPB 1J5YA 2ACJA 1STZA 2IPQX 1FP1D 5HLGA 1IN5A 2GA1A 4N0BA 3IRRA 4LGWA 2L4AA 5D8KB 2GIVA 3VFZA 1WQ2A 1KU3A 3WTSC 4OIOF 1LQ1A 5J6XA 3WTUC 1O3QA 4BHCA 4L5IA 5LEJA 3IC7A 1CF7A 1S29A 2H6CA 3SHFA 3TKYA 4KN4X 3HRMA 4IXAA 2EA4A 4HX7A 3SZPA 2FSWA 2KJCA 4KMUX 4RB2C 4WXHA 4KICA 4RB0A 5HS7A 4FHTA 4LK0F 1XD7A 3R61A 1XCBA 4I02A 4R8HA 3ZMUA 4UV8A 3WTWC 2QUFA 4UUVA 1Z6TA 1FBUA 2CW0F 1OYIA 5H6QA 5FFXA 3F3XA 4HX4A 2O0YA 5L3DA 3U1DA 4HX8A 1BI1A 5BMZA 4XSXF 2LNBA 2RN7A 3ZQ7A 5ICCA 1U5TA 2EK5A 4EJOA 4IHTA 1WRJA 1MJAA 1TW3A 4I01A 4NHJA 2HR3A 2CG4A 3L9FA 1W7PD 4HYEA 1ON1A 2OU2A 2PG4A 2V9VA 3GO5A 3EDPA 2DQRA 3JSPA 1T0FA 1SMTA 3J81Z 3KP4A 1T39A 2PEXA 3ROUA 4XLPF 2W24A 3DPTA 1HW2A 4M6XA 5DUIA 1SFUA 1HSJA 3Q9SA 3BWGA 4BH9A 1S8NA 1R5GA 3C7JA 2HEOA 1J2XA 1FSEA 2K86A 2M45A 2K4JA 5DEQA 5D5XB 3L7WA 3IKTA 1G4DA 1XDUA 1PUEE 3DKWA 4LB5A 1TW2A 3HHHA 3KP2A 3GEZA 3QOPA 2ZNYA 1DP7P 1KQ8A 4ZZDA 4Y13A 4MQVA 3WE2A 2XGXA 3D5LA 3WU0A 3V7SA 2XKOA 4HDVA 3D0SA 3ERED 3BPVA 5FFZA 2CO5A 2ISYA 4I7HA 3RIRA 4OIRF 3ZP5A 5K5OA 1O7FA 2YX4A 1ZRFA 2F5FA 3G73A 2NAZA 3RKYA 1CGPA 4R79A 1LVAA 4ENJA 4OIPF 1QZYA 4YFKF 4ETSA 3J80K 4ESJA 3KEQA 3MFKA 4RGSA 3REOA 5CVIA 4EMSA 4RGUA 4A6DA 2VC0A 3TOAA 4G7ZF 4L18B 2WV0A 2VBWA 4ZH4F 2EFQA 3WGGA 3QPHA 3SFZA 4EJVA 3CUQB 3EYIA 5DCMA 2L4MA 3GZ6A 3H92A 2CWEA 1IXSB 1TQIA 2QQAA 3GLXA 2WTEA 4DNCA 2F5CA 5JVTA 1YO5C 4U7BA 2YR2A 5L3CA 2RKHA 5LRSA 4PGHA 4XSZF 5TRDA 3T8RA 1J75A 3KLOA 2DQLA 3N4MA 4M72A 2M1BA 3RI4A 2TDXA 2XKPA 3KP3A 1H0MA 1YW9A 1REPC 2KJBA 4GGGA 4A6EA 2G7UA 2ZXJA 3GFIA 3ISPA 2YSRA 3V7CA 4L0ZB 3TO6A 3WTYC 3IKVA 2QQBA 1RI7A 5D6EA 2YX7A 1G6NA 3HRSA 3K0LA 5HS8A 1ZLJA 3LQRA 3GYHX 3CO7C 3DV8A 3T5XA 2GQQA 4ZZLA 2LSOA 2LKPA 4NQWA 5CJ9A 1L0OC 4U0YA 2D1VA 1MGTA 3V4GA 2LF8A 2JRTA 2FRHA 3E97A 2HYGD 2M8EA 2NNNA 2IA1A 4CXFA 3I53A 3QP6A 3ZMDA 2DPUA 2A68F 4B09A 3HYIA 3ABTA 2VN2A 2KRFA 1PP7U 4KN7X 5FO5A 4BHPA 2A3SA
chains in the Genus database with same CATH superfamily
4UV9A 5JLXA 3ABMH 4IZZA 4RM3A 4HQMA 2MC3A 2H27A 2Y75A 2XPWA 3GTOJ 4G9YA 4BJ6C 1RUNA 3SEZA 2Q2EB 2F4OB 4OMYA 2IS2A 3KPHA 3IUOA 5GAEJ 3E5QA 1G8XA 2EA2A 3O8HA 4ZTFA 4L0YB 1WHUA 2F5DA 5LHIA 3HL2A 1K78B 1P6RA 1U8BA 2DPDA 4RLQA 3RYRA 4MIMA 4ON0A 3K7AJ 1VQ8I 1A04A 1IJWC 4BEHB 1TNTA 3GBGA 5IOZA 4AIKA 2ECBA 2X4HA 3IHUA 1IRZA 1KONA 3QU3A 2BXYA 1JXSA 4DGWB 1Z05A 2VPLA 3ZGKA 9ANTA 2UXNA 2PMHA 3PL8A 1KQ9A 1X3ZB 4MNUA 1LFUP 2EV6A 2R7SA 3G6EI 4HOBA 5EG0A 3DLAA 3JTHA 1MMNA 1RESA 2UUZA 5K7HA 3HB9A 3DPLC 1ZLKA 4HF2A 2A6HF 2JUGA 1MW7A 1A6QA 3ZQIA 1VQPI 2W85A 2K3FA 2LR8A 1PJRA 2ZMEA 1IXRC 4EM0B 1SC7A 2DA5A 4ZDPA 1T0FC 1HKTA 4XIDA 4Y4RA 1ETVA 3BTCA 3S16J 2P7VB 2ZBKA 2Y9YA 5ILSA 3OYGA 3FXKA 1UZCA 2K40A 1BA5A 2LBFA 2GXGA 3KEYA 1ZELA 1G59A 5C44J 5CKTA 1X1PA 4RGXA 3CQZJ 2OAZA 3E1SA 4HSRA 4GYIA 3L00A 4PCQA 4Y33A 4N9HA 4BAYA 2V9KA 2M3AA 2XSJC 3F8NA 4EM2A 1R71A 3CD6I 4GFBA 2JJ7A 3SFIA 5A2QK 3V8JA 1W0TA 3VSKA 1F9NA 2FBHA 3PQJA 4BE2A 1LFPA 2IW5A 4BBSJ 4WF2A 1Z91A 3DTEA 2OA4A 2X6OA 2XV4S 5J3LA 3LSKA 2KIQA 5GP9A 2OCCH 1ON2A 1W5CC 5ILUA 1XS9A 1LE8B 1S9HA 4KT6A 2NNYA 3TQNA 3M7GA 1MBEA 1I6XA 2LBFB 3WGIA 2Y2ZA 4JK1X 1ZGAA 1APLC 3F9KA 1R58A 2E1MB 3JW4A 1POGA 2CFXA 3R4KA 2JZYA 1ETYA 3HTSB 3HGYA 5E8GA 4PJJA 1E2XA 4HQEA 1QPIA 2MYSA 2OC6A 2VQHA 2X0LA 3BG7A 4Y17A 5ICFA 3GX4X 2HFHA 3A03A 3IV5A 2UXXA 3W6JB 2EH3A 1Z3YA 2WAFA 3A0HC 5J4YA 3ABKH 5FJ8J 3GTJJ 3KIOA 2M7BA 3HGGA 3ECOA 2VQCA 3FXOA 1MKMA 5D4RA 4HA8A 4AVZA 1T38A 3LAPA 1YIJI 3BR1A 3MKZA 3L2WA 2LMDA 1IO2A 1F1ZA 3E3VA 3GZNB 1OCPA 3R60A 4HZFA 4YIIA 4XICA 3OYFA 1R4NB 5DV5A 3JRCA 1ZARA 1D3YA 1N25A 2L7ZA 2JRMA 2J5OA 1T2KA 4KUMA 2F5EA 2C6YA 2EZLA 3SXYA 1A5JA 5D4SA 3QQAA 1D5VA 4IHYA 2MGQA 3E5UA 4YFNF 2P4WA 2IGKA 5K7FA 2I5UA 4XRSA 1TT0A 2FBKA 4IEJA 1XMAA 1FEXA 3FMQA 5KAFC 2Z99A 2HPMA 2F2EA 3QU6A 2DODA 2KT0A 3S17J 2CFOA 1J09A 2DU9A 4TV7A 5L3BA 4P55A 5FB2A 3KEOA 2Z1DA 1A6IA 4HRIA 5FLVA 1D8JA 4B8XA 2LOOA 2VB6A 3OV8A 1R22A 2BEOA 4FETA 4B43A 3PSFA 2ME6A 1A35A 4QWQA 1FPQA 1XB4A 2DMUA 3L2UA 2OTJI 3ZQCA 2HOAA 2XAGA 1BM9A 1VQMI 1ACIA 3OYHA 4BQNA 5JVGF 4F55A 2Y31A 4EVIA 2CMPA 4OAZA 2VT3A 3BR6A 3KETA 1GUUA 4NC8A 2DOFA 3OIQA 3ZCOA 4KISA 3NWSA 2FU4A 1MSFC 3GTMJ 3CMYA 4LITA 2XAHA 3I4MJ 4ZJZA 2GA2A 4EJUA 1D1CA 2E60A 3TMOA 4PJNA 3KP5A 4U88A 4KDPA 3ONQA 1QHGA 2VKHA 1MBJA 1SD4A 4EQQA 4ZDOA 5K5RA 4X1EA 2A61A 2H09A 4XK4A 5E17F 1TQPA 2P0WA 4LMYA 2BVLA 4Y3OA 3HSRA 2W7NA 4D5FA 3CJQB 2DT6A 1PUFB 2FQ3A 1NTCA 3FMRA 3CF5F 5TGTA 2FNAA 1S7EA 4IQJA 3SYTA 5F0CA 5KNLA 1I1SA 1JHHA 2H94A 1F43A 1H9TA 1B72A 3Q3SA 1E3HA 4BNCA 4NBQA 2DT7B 3IWZA 3HKZA 1EKEA 3UNGC 2PMZN 5J40A 5EZGA 3WODF 2EQRA 1OLTA 5ILVA 3G3ZA 5FLMJ 5K1YA 2IXSA 3QPLA 1WKMA 1BIBA 2CS3A 1LDKB 2ISZA 4M3EA 2ID3A 1XSXA 1FSHA 1LUJB 3OS0A 2STTA 3VB2A 1K61A 3L1PA 2DN0A 3K2AA 4AWXB 1UG2A 3K4JA 1R5ID 1OPCA 2ZNZA 3HKZN 2VKDA 2EFWA 3HDDA 2IRFG 2WWYA 5GPCA 2QZ8A 1XC5A 2EFOA 3W6VA 2KISA 2NOGA 2KKOA 2PFBA 1VQ9I 1E3OC 1IZ1A 4XORA 5GTIC 5ICGA 2FJ1A 3DTKA 1RETA 3FXQA 1XX5A 3FM3A 4C2MJ 4AIJA 2ZB9A 5LD2C 3EUAA 4XONA 2CJJA 3CJRB 1EJ9A 2QKMB 4ZYDA 1P4AA 1Y56A 4CYCB 4XM3A 1SAXA 3FKJA 5B5EC 5E3NA 2OBPA 1XGNA 2X1DA 3RCOA 3TP3A 1FOXA 3IWFA 1S5LC 3KYDB 3DEEA 2KZGA 1K6YA 3AG2H 1WH5A 5IY5H 3HOWJ 4L9VA 3KE2A 4Z2YA 1XGOA 2MBFA 2Y0SA 1ULYA 2OJED 3JTGA 1JUMA 1XMKA 1LJ9A 2CUEA 1SAUA 3BT9A 1VZ0A 2VBZA 3DEUA 1AWCA 1WJEA 2JVGA 1IUFA 1BI2A 2W00A 2FEZA 2XAUA 4H0EA 4MTEA 1D5YA 3WG7H 1XCVA 2M2EA 3I9V2 4G6TB 3BC8A 4M6YA 2Y48A 3PSIA 2VBXA 4AU7A 4PJMA 4KA4A 4B3XA 4UHTA 1D1AA 2ZC2A 1KQ0A 5J8CA 5AIPA 1FYLA 1KYZA 2DMPA 5BQTA 3S3OA 3ABLH 1U6GA 1K79A 2G9WA 1HXDA 1OMIA 3JRGA 4P96A 1GV2A 3VEPA 3ZQHA 3S1RJ 4ZYHA 3P9IA 5GTHC 1HCRA 4UUSA 3G71I 1R1TA 3FK6A 2BGCA 3AL0B 2XDVA 3LA3A 1K4TA 1R9TJ 4ESFA 4RDUA 4LOCA 3BJAA 2Z3YA 3DCFA 3SDBA 4P5OA 2Q0OA 2KIFA 1FIAA 4RLFA 2NVUB 1ZQ3P 1E0EA 1ZREA 1ZHFA 3AG4H 2H6BA 1BI0A 4XQFA 2PJPA 2VE9A 3K9TA 4LLNA 3OL4A 1VQKI 1Y1WJ 1RUOA 2XHKA 1MBHA 5EGOB 1U8RA 2HKOA 4HBLA 5FGMA 3BG6A 3ZQQA 1YJWI 1HKSA 2EWNA 4A3KJ 3H0GJ 5FKLA 3ASNH 3A01B 1MMGA 1HDDC 1UJ8A 3HUGA 3QPSA 1UG0A 1PYVA 2HKXA 2L7KA 2KIUA 3BDDA 3CJTB 3CMMA 6PAXA 1WI3A 4IHVA 2IS6A 1MMAA 1FLIA 1ZRDA 3LSHA 1KZHA 2PJRA 1IDZA 2D5VA 2O03A 5ERIA 3MZHA 4A5MA 1XSDA 4RAYA 1U78A 2CQKA 3GVAA 4XMYA 2LK2A 3U1KA 2W25A 3HOUJ 2KIMA 2COMA 3GTPJ 3M3YJ 1ZG5A 2LRDA 1R1VA 3KCCA 4XKWA 2DFIA 1IV6A 1YLFA 5FROA 5D5UB 3IP4B 1H89C 4PJLA 3B6CA 1WGXA 2DOEA 3K10A 3K70D 3HRTA 1Y0NA 3ZMVA 2OZ6A 4D9JA 5GAHJ 3EYYA 1WJBA 2L7MP 4M3DA 4Q4ZF 3Q0WA 4L9TA 3WG9A 4MQ9F 3CO6C 2E19A 5LFAA 2E2HJ 3RYPA 4ENKA 1VQ7I 3K4NA 3H3UA 2VOOA 5ICEA 2BZTA 2A69F 1X1BA 3MCZA 1UAAA 2R93J 2ZMEB 2M34A 4I09A 2RNJA 2HXOA 1SVOA 2DOAA 4PDKA 2VL8A 3LL7A 1J59A 5DCMB 2VXZA 4F93B 3W6KB 3HZJA 3BJ6A 3ZR8X 3F8MA 3OYAA 1RZ4A 2EIJH 4IRHA 4OWRB 3W3CA 2D45A 1QHHD 3I58A 2CQXA 2VE8A 5DD4A 2KHMA 3RPUA 4BDZA 1EH7A 1MDMB 4BY1J 1FYMA 4KFCA 3S2WA 5L3EA 1VNDA 3AG3H 2RDPA 4FT8A 4S04A 1FY7A 5TJJA 1K7AA 5A2QZ 1Y1VJ 4BQOA 2IP2A 4IX7A 2L5QA 3BOQA 3I54A 4II3A 4QSHA 2M30A 1PP8F 5LGUA 4IHWA 2IGNA 4BYYA 3VOEA 2VLAA 4I76A 3T1BA 5LRRA 3RKQA 4BBRJ 1JGGA 2E1CA 3RJPA 5E1WA 1WJCA 3F0CA 2FXAA 2WY7Q 3ECHA 1B6AA 3F21A 2JA2A 4OINF 5FKKA 5CVRA 3LSJA 4CSWA 2UZKA 1MZBA 4ZC3A 4HPQA 3FISA 1RPWA 2F4IA 4RM2A 3CCSI 3K69A 2IVMA 5GPAA 2Z2SB 5D5VB 2OCEA 4YG2F 2BW3B 3V8KA 1ERDA 2YUSA 3JAMZ 2ZCWA 5H20A 1ODDA 3GZ5A 1SFXA 3BJOA 4OAYA 4ZYAA 3ZRGA 4XR6A 4EGZA 2A07F 1C0WA 4EJTA 4LG0B 4E7SA 1N75A 5BPIA 4GO1A 1WH7A 2VQGA 1X4PA 1X2MA 2HQNA 2HTJA 2HVSA 2XRNA 3HSEA 5HLHA 3LQQA 2NS0A 1JTYA 1YTYA 4CZZA 4PGGA 3CCJI 1IRFA 1D0XA 1RR7A 1BR2A 4ESBA 5FKMA 2LF7A 2EPFA 2RGVA 3FK7A 2XB0X 4NUBA 3VODA 2YU9J 3S3NA 1EF4A 2ELKA 3KZYA 4UB6C 2W4SA 3S2DJ 4YFXF 3ZQFA 1DGWY 3F6VA 2IGMA 2ZKZA 5HODA 2G7HA 1IF1A 2FOWA 2CQNA 3E6DA 3F8CA 4CCOA 1SFOJ 4N4NB 1YHQI 4CHUA 3WU2C 4WCGA 4AM3A 2OF7A 3C18A 1XSVA 1DUXC 1TWHJ 4P9UA 3CLQA 2JSPA 5J1RA 3AKZA 2JSCA 3O2PE 3DBHB 1O3TA 3LWFA 2KP6A 4PJ0C 1P2FA 4LG3A 3BCAA 2PN6A 1D1BA 1QQIA 3H0DA 2WBMA 4WXDA 1IG7A 2FE3A 1LDDA 3GFJA 2RV8A 4XKVA 3K6GA 4L9NA 3DEWA 2L54A 5ED4A 3I59A 2OQGA 1YW8A 2X1EA 3OYDA 1CF7B 2V1NA 2PMZA 2GZWA 5C4JJ 1K78A 3F22A 4HLYA 5BOXA 2X85A 3SJMA 2RVCA 3RSNA 2BE5F 1VQ6I 1B59A 2W1OA 3BR5A 3E5XA 2B63J 4UVBA 3VPRA 1E17A 5H6RA 3JAMK 4ENNA 3IH4A 2HZTA 4MEXF 4BGDA 1I27A 3KP6A 4H4KC 3NARA 4G6DA 1G3YA 2LD5A 1GXQA 2A6EF 4MTDA 1MBKA 3V8LA 1QA6A 5J4VA 3GUDA 2STWA 3ESWB 1RR8C 4WX9A 4RB1A 2ZJPF 1KA8A 2QVOA 3WTTC 2BY3A 4KIBA 3BROA 2VOPA 1UHMA 5D6FA 1R6RA 4DJAA 4O6JA 4UXNA 4IHSA 4HF0A 3H1CA 1EH8A 1IXCA 2W84A 3M9AA 5C3EJ 2VJIA 2R0QC 1XGSA 2IJLA 1S6LA 3CUQA 2R7WA 3H3ZA 1YIOA 2V1XA 1BR1A 2ZFWA 4JX5A 4LFUA 4RAFA 3FWEA 3OIOA 1W0UA 3RKWA 1GVDA 3KX2A 5E1XA 2VASA 5EZHA 5F1RA 1Z1DA 3DU5A 1EA3A 2K7LA 5L3FA 4DYCA 3H5RA 2E34A 1K4SA 1OCOH 1X2NA 3SQNA 5IYCJ 1SEUA 2EZKA 2XGCA 5F64A 3MEXA 2E1NA 5HDGA 5M5XJ 3R0JA 5DM6F 5IP7J 3K4MA 2E71A 3WTXC 2O61A 1S7OA 5LHGA 4LLLA 4B1RA 2NS7A 1LNWA 3VYUB 1HW1A 2H8WA 4A12A 1TWGJ 4IPAA 2Y30A 3OYBA 3H9GA 3K1PA 1W7PA 3MD2A 1XGMA 3ZMTA 4ZYEA 4LJZF 3R6SA 1B8IB 3BZKA 2JN6A 3BTIA 4U0VA 2F5VA 2CYYA 2WY8Q 3C2HA 3CCYA 5DTDA 1P92A 2E5ZA 2DTZA 2XGDA 1Y6IA 1BI3A 4W97A 1AKHA 1QZZA 3PNVA 2XSDC 2IS4A 1UCRA 2CSOA 2LKSA 2LY2A 1QVTA 4A5NA 5LLQA 1I3QJ 4CCNA 4D7MA 4J00A 2UWMA 3HG9A 4KJZA 2NYXA 4A3GJ 4L9JA 3HOVJ 1ZK8A 2YS9A 2DLLA 3ML6A 2XF7A 2A05A 1GVJA 1OKRA 5DCFA 3U9GA 1TTYA 3KP7A 1YFHA 1NK2P 3OYLA 4NNJA 1TC3C 3BR0A 1GXPA 2BVMA 2P5LC 5CQEA 3HHGA 5F27A 4OMZA 2XC7A 1MBGA 3C2BA 4LG0A 1YS7A 4RAZA 2O8XA 5CLSA 5E3OA 4HF1A 4ZTJA 2GAUA 3DKXA 2DK8A 3K4BA 5B66C 3HOSA 2QSFX 2OQRA 3ZMSA 1YX5A 1IUYA 2OUMA 4K2EA 3B02A 4WXCA 3RQ4A 1QBJA 3LOCA 1AKHB 1BBYA 3FXUA 3MAJA 3E6BA 2RNGA 2DA6A 3CZ6A 3QP5A 3GFLA 2R7TA 1BIAA 2ELJA 4IKFA 1KYWA 3FXJA 3NEUA 4AIDA 1ZRCA 2QYOA 3MMYB 5AIQA 3G4SI 4ITVA 2KDZA 4NDLA 4JBAA 4A3DJ 5JHUA 1V5FA 4RBOA 2D2WA 4XLEA 4FE7A 4HLXA 2N8GA 1TL8A 1JKPC 2HOTA 3LFKA 4WK8F 2NVQJ 1JUSA 1MNEA 2OTLI 2HOSA 4HNTA 2EZIA 2DYSH 4BL0B 3IL2A 1IW7F 4IJAA 3DKYA 1FMWA 1NHAA 3B73A 4UNOA 3MVPA 1YG2A 4QPOA 2DCEA 2IS1A 1UB9A 1A31A 4IF4A 3FDYA 1GDTA 2FF4A 3EETA 1YITI 3G1OA 5FRNA 3LMMA 2VONA 1LVKA 2DXIA 3HOZJ 2LY1A 3TW7A 2LC2A 3PUBA 2PLYA 2FA5A 2H1LA 5J47A 1BW6A 1UHSA 2DO7A 3M8JA 3BCBA 3KFWX 4ZYGA 1VF9A 2E1OA 2Z5UA 5FLXK 2CU7A 3OMYA 5KVRA 1I50J 3I64A 4QLCU 4M3FA 1JKOC 1LEBA 2JPBA 3J7YJ 1D0ZA 3SEQA 2K27A 2HXIA 1O4XA 1OR7A 5HS9A 3S14J 5D5WB 1ZGJA 4CDGA 3OYCA 3RZOJ 2OZUA 4GRIA 2V1UA 3VYSB 1TWAJ 3FKIJ 4GCVA 3WGHA 2VXDA 2XAFA 4OOIA 4HNVA 2GXAA 2QWWA 4CYDA 3CP2A 1EH6A 2E5NA 3SDGA 4FCYA 3E6CC 2GLOA 2K02A 2JA5J 1U5TB 2XASA 1DU6A 4HV6A 1V54H 3EPZA 4G6QA 1Y39A 1Q1HA 3HPGA 1LFBA 4AC0A 2R5YA 1V5GA 2VIXA 3CDHA 5J8FA 1FTTA 1FOKA 3J7AO 2DBBA 3HIFA 2HTSA 1YS6A 3I4PA 4UVCA 1CQTA 1X58A 3CC4I 2KLOA 2R5ZB 2EJRA 1USTA 4Y7NJ 2NRAC 4HAMA 4A2UA 2L3DA 2A5WA 4MO7A 3ZMZA 3MZ8A 1O3SA 2X6XA 4CCLA 3GTKJ 3TDUC 1TWCJ 5LEKA 5M3FJ 2K5CA 3H35A 2XROA 2L9NA 3RKXA 3I3LA 1TNSA 3N97A 2JMWA 2QBYB 1WJFA 1AHDP 2XB5A 1Y8RB 2WB1A 2PMUA 4QPQA 1X3UA 2BHYA 4M73A 1RNLA 3A2KA 5HLIA 2AQFA 3FXRA 2DDBA 1FBQA 1OISA 1LPQA 2MA3A 1F36A 4I0BA 5HLTA 1FC3A 1U9OA 5B3SH 3BZ6A 3CP8A 5DD8A 1I1GA 1OCZH 3D5RC 3JRHA 3PFIA 2PI0A 2KRHA 5LHHA 5C4XJ 2V79A 5FKOA 2HNHA 3FBIB 2LKXA 2R5ZA 4XN3A 1AOYA 1IDYA 4ABZA 3S1NJ 1ZH5A 2DA7A 1ZR4A 3CUQC 5E3MA 3S93A 1ENHA 3U2RA 4LLGF 3WTVC 1RKWA 4O5VA 2PX9A 4AVPA 2DT5A 2Z33A 2QM3A 4L5EA 5CVUA 2HWVA 1BOBA 3C1DA 3QRFF 4UVAA 4X0GA 4XRFA 1FOYA 3J80Z 5LGNA 2QBYA 4KIGA 2AXTC 4G8XA 1Z9CA 2HDCA 2P6SA 1R00A 5IT9Z 2DA1A 3FHNA 1LB2A 2V6CA 4ANJA 4M3BA 1SD6A 1SFKA 4FTHA 3UKGA 1VQNI 3H9JA 4M9ZA 4QIWN 1JJ8C 3KLNA 1PVEA 1ZKGA 5EEGA 1GHCA 2GXBA 3LNQA 2QLZA 3OOPA 4W1UA 1KGSA 1IN6A 4FX0A 1I6HJ 2HQRA 5CVJA 3LSMA 4C30A 3KYCB 2JT1A 1IAWA 1Z3XA 2QEXI 2GBYA 2P5KA 4YIFA 4JX4A 2NVYJ 2EIKH 2B0LA 4DOZA 2BY1A 2FMYA 4S05A 3DFGA 4KMFA 4F7ZA 1PDNC 1BC8C 1UHWA 2L9RA 2DYRH 3P9KA 3ELKA 4GXOA 3QOEA 3C3WA 4DQ2A 5FLXZ 2W57A 3WE3A 4BQQA 3BTLA 4HNUA 3RTRA 1YQAA 4KITB 4A93J 1B1BA 4A3JJ 2LY9A 2DK5A 4ASNA 1DPUA 2LVSA 1AA7A 5E1ZB 3HXLA 2ID6A 3H3VK 1U5TC 1FJLA 2VJ5A 2X6YA 3CCLI 4M71A 4RA2A 1TZLA 1HKQA 4RGRA 3I0TA 3EQLF 5F6FA 3FXLA 3JSOA 2JQ7A 3T0YA 4U87A 2O8KA 3CLOA 3GW2A 3H9QA 4IO9F 2A5YB 4XBFA 1H9GA 1OFCX 2V9PA 2P6TA 4P9FA 2ELHA 2RQQA 1O7LA 1HW5A 3PM1A 1WWXA 1HQCA 4IRIA 1MH4A 1JGSA 3R0AA 1Z67A 1SD7A 2MD0A 2HOEA 2JUCA 2EFNA 1YRNA 1B72B 2DW4A 3AFHA 4I98B 1R7JA 4G94A 4DBRA 3F8BA 3OYNA 1P4XA 2ZO4A 4XOTA 4A69C 2MC4A 2BBYA 3OSGA 1KU9A 4A0YA 2QSHX 4D0PA 3M1EA 4WWCA 1B9MA 5JFRA 1MMSA 3J81K 2CGPA 1FP2A 3ABUA 2FX0A 5KK1A 3K1NA 1L3LA 2XPUA 3P9CA 2WC2A 1ETQA 5E18F 1J0RA 4M3GA 2V26A 1SMYF 3IH2A 1O3RA 4LD5A 1IGNA 2ZMEC 4N4OB 4EM1A 4DZPA 2MD5A 4JQFA 5DYMA 3I55I 1MNDA 3CF2A 4EV0A 5DDGA 3HTUA 1I5ZA 3DTIA 1LE8A 1HC8A 2EV5A 2HDDA 5K5QA 1GLNA 1RC9A 1U9NA 2MH2A 3CCRI 4M74A 1FTZA 3LA2A 4EATA 2CV0A 1QZEA 1MDMA 4DIQA 3DP7A 1T56A 3LSTA 1ZAOA 3I71A 5F0HA 1MH3A 3F72A 1JT0A 4IQ4A 1TT5B 4ENMA 4IOCF 3TW6A 3OYIA 3FX3A 3LSIA 5IT3A 5E8IA 3HEFA 4YELA 2Z9OA 1ZN2A 3COAC 1Z21A 3BR3A 4RS8A 5FKNA 1VQ5I 2E36A 4BKXA 4EEFG 3OR2C 5EF6A 3HM5A 1YX3A 2O7OA 1U0JA 1I39A 2P81A 2DA2A 3DWLE 1HF0A 4U0WA 4C2UA 1QU3A 1YYVA 3NRVA 1SVLA 2DMTA 5KHDA 2ZXHA 3OSFA 1YI2I 2O3FA 1HSTA 2DA3A 2DTRA 1Z6RA 1FOWA 3PNYA 4NC6A 2KPMA 2Q1ZB 3HRUA 5IP9J 4N9IA 2NOJB 4B48A 3DPUA 5K7ZA 4HDUA 3AL0C 3TEDA 4HV5A 3GMEA 4B4CA 1R4MB 4PZJA 3WTZA 4KIFA 2EILH 2R7QA 2QCOA 2GWRA 1ZG1A 3T8TA 4M9XA 3WHCA 4OIQF 1IN4A 2DDAA 1VTNC 4LB6B 4E7ZA 4DZJA 3K4KA 1HOMA 2CUJA 3PO2J 4IL6C 1Y0UA 2FNPA 1U3EM 2ECCA 3NQOA 2L02A 2XF6A 5BNGA 3GF2A 5DS9A 4Q5SF 3PFYA 5D8LB 2HYFA 4L5JA 1R49A 1K83J 5H2FC 3MKWB 2WADA 1EV7A 3DBRB 3P7NA 3LA7A 3FHZA 4A3FJ 1DDNA 1F5TA 1A36A 2E1MC 3GCMA 4XNFA 1WI9A 1F4KA 3H5NA 1W36D 2FUG2 2LREA 3GFMA 1DGRM 4MGRA 1DU0A 1FX7A 3EUHA 5BS6A 2K9NA 2P8TA 3VYRB 3CMAI 4BEHA 2R3SA 2HGCA 3O8GA 3TP0A 5JR3A 1P7IA 2QSGX 3ZQLA 4XLAA 2MLGA 3VDXA 3FZVA 4CH7A 2JA6J 1GV5A 4JOMA 3BG3A 2VPRA 2ZSIB 3HUGB 1G3TA 3QODA 2M9HA 2EV0A 3RZDJ 1X1DA 3K4LA 3FM5A 1FIPA 4G7HF 1BN5A 2XVCA 2Y0MA 4RB3C 3L09A 5IPAA 1Y8QB 5M3MJ 1OCRH 1BL0A 1OCTC 4HEA2 1OYWA 3AAFA 4FQGA 1WJ5A 2RREA 3KZZA 2OD5A 1S3JA 3BP8A 3M1CA 4EGYA 1HLVA 3MWMA 3MQ0A 2AQEA 4LIUA 3HOTA 1HBXG 2DFHA 1T6SA 1IN7A 1D0YA 3QWLA 3GWZA 2M7AA 2V7FA 3Q9VA 4E7HA 2I10A 5JLWA 1JHFA 5E3LA 3TGNA 2V1DA 3JCUC 3MN2A 1W4MA 1W1WE 1U2WA 3PUFA 5M5WJ 3MKYB 3GXOA 1FBSA 3VYTB 4BQAA 3WHBA 2R7FA 3TOBA 4C3JJ 2Z16A 1KU2A 4LK1F 4R1HA 1Z7UA 4Q48A 2VUMJ 1W5TA 1FWZA 2Y9ZA 2RC4A 2QENA 2AXLA 4CUGA 4HW0A 2BY2A 4AD9A 2BOLA 2KQRA 4MEYF 1QO0D 3S3MA 2B7EA 2DJIA 5AONA 4BE0A 1MJ9A 4V2GA 1LKXA 1TP4A 1IN8A 3FIWA 4KT5C 4EJWA 3BR2A 1ZGWA 3WU1B 3L2RA 2ZXIA 1UFMA 2MABA 2GM4A 5IOYA 2NXNB 5DUKA 4ZDLA 3ERMA 2MW8A 2RQPA 2CUZA 1FNNA 3BTJA 3PQKA 4DW6A 2TCTA 2DI3A 4B44A 2XAJA 2G0EA 4CCJA 2WAEA 4G7OF 1LEAA 2DFEA 3LFUA 3E7LA 4E7IA 2JK3A 3RDIA 2KFDA 5CVVA 3BZCA 2QQ9A 3CTAA 2IBDA 4XRMA 1Z77A 4U7DA 3E6MA 1ZG3A 2E7XA 3A1YA 2F4MB 3ZN1A 4FX4A 4E7JA 1MMDA 2F6CA 2CV2A 1OQYA 4CGZA 2MG4A 3OOUA 4BXUA 2I8DA 2LH9A 4O3MA 3QPTA 1J7KA 5BPDA 2O6GE 1RKTA 2DMNA 3M8EA 2ESNA 3I5UA 1TLHB 4D1QA 1T08B 3HJEA 3JRFA 1NG6A 3CJNA 1MD0A 2E2JJ 1R5HA 4NQWB 2R7ZJ 2M87A 2VT2A 4PFOA 5M5YJ 5L3GA 2JA7J 1IC8A 2V6EA 1W7PB 4F3QA 3RPUD 4LIVA 3BG5A 4BJ5C 3BPXA 2Q8KA 1TQMA 2MLKA 1S72I 4NC7A 1IRGA 1T98A 3O6BB 4RMNA 4G12A 1D8KA 3A0BC 3TO9A 3QYFA 3BQZA 2X48A 5JI6A 4CICA 3OYJA 1OCCH 2CUFA 2FBIA 1NK3P 2EINH 1OYYA 5F04A 4XRSG 5HDKA 2HQ5A 4A3EJ 3CMEI 3K1MA 1B4AA 3BLYA 2BY0A 3PIOF 2E2IJ 4UUSB 2Q2EA 1W5SA 5KCMA 3OWTA 3X2QH 2MH9A 2VKVA 3ZN0A 2DMQA 2M8GX 2IAIA 4BXFA 5CPRB 3W2WA 2X6WA 3CCEI 2ETHA 3A02A 5HVQC 1QNTA 3DF8A 2J5PA 1S7AA 3D1NI 4E70A 4YRVA 3DLLF 2R7DA 4OU0A 2ESHA 2M5WA 4UUTA 3V7RA 3G1LA 4CZCA 3TO7A 1JUPA 1SFEA 4Q47A 4IRGA 2XUBA 2K4BA 2HVRA 1PUFA 1V3FA 1M1EB 2L2OA 4Z6YA 2XGEA 2QA4I 3ASOH 4A3CJ 4B3AA 5J1UA 3P5JA 1WFXA 2FMLA 2HYJA 1XG1A 4HSTA 2VJJA 5CYVA 1ORKA 1QVUA 2CQ7A 1TBXA 3Q0UA 3CESA 3I59B 4IVNA 4F52A 1X3WB 2LLKA 4P1WA 2HQAA 4KNYA 2LDUA 2W48A 5HDNA 3FF5A 2IT0A 4MFEA 1BOAA 4BHBA 1RIOH 1SVMA 1TWFJ 4I0AA 1R23A 3LAJA 3DQVC 1YW7A 2HVQA 1USSA 3O3KA 4D7NA 1ETXA 3OL3A 1FT9A 2AO9A 1R36A 3S15J 1DPRA 3Q5FA 3RPQA 1N77A 1V4RA 3OS1A 2L01A 1JE8A 3ZPLA 3L2CA 3K2ZA 2JWTA 3IRQA 4GDFA 2ZSHB 3IH3A 1FYKA 2XAQA 5E20A 3M8FA 2XIGA 2VC1A 3HSFA 1X19A 2LTPA 2JVHA 4E7KA 5IT9K 1J9IA 4CA0A 1V5EA 2JPCA 5TISC 2MSYA 1GT0C 2WAQA 4CCKA 3ULQB 3K70C 4FISA 1SD5A 3F23A 4M9SA 3TDZC 2Y69H 4NB5A 4PSWA 1VQLI 3VSLA 2HI3A 4C2TA 4DYQA 3H36A 1V55H 1B9NA 4PSXA 4XKBA 5EEAA 5IYDJ 5KAIC 4CO8A 1G3WA 2YU3A 3CCQI 3SZTA 3DXJF 1QGPA 4C3IJ 1JJ6C 3DBLB 2FOKA 2R7VA 1BJAA 1ONVA 1WSUA 2UV1A 1QPMA 4XLCA 1H88C 1WZ2A 1MJBA 5E79C 3CCMI 2KDOA 5F0FA 3G2BA 4AIHA 2P7CB 4KYWA 1LDJA 2HS5A 2OPTA 1X1AA 2CV1A 1T33A 2BYVE 3F8FA 4I2OA 1O57A 3QAHA 2VBYA 4GYGA 4PFPA 5FD5A 2LFBA 2QKLB 1ZYRF 5HOOA 1YE9A 3I56I 2AHQA 3L2QA 4XLNF 2PBIA 2CH0A 1XDSA 2CW8A 2KRCA 4J19A 4MFDA 3RQIA 4MHGA 2BW3A 1YOVB 1YJNI 2D1HA 1KU7A 3GLLA 2IA0A 3HC7A 1B8IA 3B6AA 2EB7A 5F08A 2BV6A 3PO3J 1WVRA 1ITYA 2P5VA 3F6OA 2K9SA 5LBQA 1BC7C 2DAOA 2L9VA 1P4WA 1VQOI 2K3PA 5EEHA 1G3SA 2EFPA 2F48A 1R1UA 3BY6A 1WJDA 2VKEA 4V2FA 2WV1A 2R7OA 4A0XA 2IA2A 2PQ8A 3CUOA 3JRIA 2E7WA 4Y15A 1K6OA 3MZYA 2ZJ2A 1IV8A 2IEKA 2A6TA 2HDWA 1X4OA 2LG4A 1ETKA 5LGTA 3QYBA 2R7RA 2FD5A 1XN7A 3FMSA 2R4GA 2M0CA 4A0ZA 2JTVA 3M07A 3NAUA 4XKCA 2ADUA 4E6KG 2OV7A 5FD6A 3Q0VA 2AS5F 5EGOA 3FXMA 2VODA 2YPRA 1FZPB 3I4NJ 1G2HA 1J5YA 3J7ZI 1JI8A 2ACJA 1STZA 2IPQX 1FP1D 4J01A 2EZHA 3GTLJ 2MFZA 2DFFA 5HLGA 4A3LJ 1IN5A 2GA1A 1VI0A 4N0BA 5EYRA 3IRRA 5IYBJ 4LGWA 5IP6A 2GIZA 2L4AA 3VWBA 5D8KB 3S1MJ 2GIVA 3VFZA 1WQ2A 3BQYA 1KU3A 3WTSC 4DBQA 4OIOF 2O9LA 1LQ1A 5J6XA 3WTUC 1O3QA 2R7UA 4BHCA 5EG0B 3OYEA 4L5IA 1MIJA 4S0HB 5LEJA 3S2HJ 4C9YA 2M4KA 3IC7A 1CF7A 1S29A 1WPKA 2H6CA 3G1MA 2ZJRF 3SHFA 3TKYA 4A3IJ 4KN4X 3HRMA 4IXAA 4BS9A 2CW7A 1H8AC 2EA4A 4HX7A 3SZPA 2FSWA 2KJCA 4BJTA 4D5CA 4KMUX 4FASD 4RB2C 3OYMA 4WXHA 4KICA 4RB0A 5HS7A 4BE1A 2XRLA 4XOPA 4FHTA 3UR3C 1XPXA 3OS2A 4LK0F 5GAGJ 1XD7A 4A3BJ 2VQLA 1DQUA 3R61A 4JP0A 1XCBA 4I02A 3JRBA 4II2A 4R8HA 3ZMUA 3CC7I 3V42A 4UV8A 3WTWC 1ZR2A 2QUFA 4UUVA 1ETOA 1Z6TA 1FBUA 2CW0F 4HG2A 3FBNB 1OYIA 4UY8I 5H6QA 5FFXA 2L7FP 4B47A 1YRNB 2HU9A 5HNFA 3F3XA 2BXZA 4HX4A 2O0YA 2ICWG 5L3DA 1JT6A 3SZGA 3U1DA 3BG9A 3MKLA 4HX8A 3ZXSA 1BI1A 3TL4X 4Y52J 5BMZA 3HBLA 3KZIC 1AU7A 4XSXF 2LNBA 2RN7A 3S8PA 2L0KA 3OIPA 3ZQ7A 5ICCA 4CYCA 1U5TA 2EK5A 3LSGA 2L9SA 1JKRC 4EJOA 4IHTA 3HOYJ 1WRJA 4BY7J 1MJAA 2ZFUA 1TW3A 4XN0A 2R5YB 1YJ9I 2K9MA 4I01A 1WCMJ 2X9DA 4JYKA 4NHJA 3M4OJ 2HR3A 5B1BH 2CG4A 3L9FA 2NVTJ 1W7PD 2GOMA 1MBFA 4HYEA 1ON1A 2OU2A 4I99C 2PG4A 2X1CA 2V9VA 3GO5A 1XMXA 3EDPA 2DQRA 3JSPA 1T0FA 1SMTA 3J81Z 2X51A 3KP4A 2GOXB 3N05A 1T39A 2PEXA 3ROUA 4XLPF 3OY9A 2KL4A 3U21A 2W24A 1BR4A 2M4GA 3DPTA 1HW2A 3GTQJ 3KYLA 4M6XA 2XPVA 5DUIA 4C3HJ 1SFUA 2BHZA 3H5AA 2ZJQF 1HSJA 3Q9SA 3BWGA 2V4JC 2QGUA 2H1KA 4BH9A 5FRMA 1S8NA 2FQ4A 1R5GA 2XF5A 3C7JA 1JKQC 2WA0A 2HEOA 2CRGA 1J2XA 4BACA 1VQ4I 3J7AY 1HDPA 1FSEA 2K86A 2M45A 2K4JA 5DEQA 2LP0A 5D5XB 3L7WA 2WB1N 3IKTA 1G4DA 3GTGJ 1XDUA 1PUEE 3DKWA 4LB5A 1TW2A 2K9LA 1HA8A 3HHHA 4E7LA 2K85A 3KP2A 2LYCA 3GEZA 2NVXJ 4BDYA 3HPHA 3DU6A 3QYEA 1X1CA 3EUKL 3QOPA 2ZNYA 1DP7P 1KQ8A 3CDIA 3A01A 2VI6A 4ZZDA 4Y13A 4MQVA 3WE2A 2XGXA 3D5LA 1MSEC 3WU0A 3V7SA 3EUHC 2EBIA 2XKOA 4HDVA 3D0SA 3ERED 3PJRA 1W36C 1N78A 1NG7A 4A3MJ 3BPVA 5FFZA 2CO5A 2ISYA 3AG1H 3E0JB 2E35A 4I7HA 3LSRA 3L2VA 4PK4A 1Q1VA 3CC2I 3JREA 3RIRA 2PJRB 1OR7C 2CQQA 4OIRF 3JR9A 4BU2A 3ZP5A 5K5OA 1VFCA 2HZDA 2B9SA 1RRJA 1O7FA 2YX4A 1ZRFA 2F5FA 5GADJ 1FMVA 2NAZA 3RKYA 3G73A 1CGPA 4R79A 4BUPA 2O5RA 2WAQN 1LVAA 4ENJA 5B1AH 2KZVA 4OIPF 4X6AJ 4F91B 3JRDA 1QZYA 4YFKF 2HPIA 4AUXA 3D5SC 3S32A 5F1JA 5J1YA 1OJLA 4ETSA 3J80K 3HOXJ 4ESJA 4YEJA 4IHXA 2ZXWH 3KEQA 2TRTA 1T8IA 3MFKA 4RGSA 3REOA 5CVIA 4EMSA 2VJ4A 4RGUA 4A6DA 2VC0A 3TOAA 3K4CA 4G7ZF 4L18B 1NH3A 4AYBN 5EDNA 2WV0A 2VBWA 4ZH4F 2EFQA 3WGGA 3JRAA 3QPHA 1MNMC 3SFZA 4FE4A 4EJVA 2DJNA 3CUQB 3EYIA 5DCMA 2L4MA 1XTAA 3ZQGA 4I6ZA 1ETWA 3GZ6A 3CCVI 3S1QJ 2QQ8A 1DP3A 4YIRX 3W2AA 1UMQA 3H92A 5DM7F 2CWEA 1IXSB 1TQIA 2QQAA 4RAGA 3PIPF 3GLXA 2WTEA 3TBIA 4DNCA 4PUSA 2F5CA 2R7XA 5JVTA 1YO5C 4U7BA 2YR2A 3OR1C 2RKHA 5L3CA 5LRSA 4PGHA 4XSZF 5TRDA 3A4CA 3CCUI 3T8RA 1T95A 1J75A 3IAS2 3KLOA 2DQLA 3N4MA 4M72A 1BJZA 2M1BA 3RI4A 2TDXA 2RAEA 1IRXA 2W82A 2XKPA 3KP3A 1H0MA 1YW9A 1REPC 2KJBA 2EIMH 4M6VA 4GGGA 4A6EA 2G7UA 2ZXJA 4DYRA 1I3AA 3GFIA 3ISPA 1Z7LA 2YSRA 1JTXA 1WJAA 2R92J 3V7CA 5HNHA 4L0ZB 4AYBA 3W2VA 3TO6A 4UB8C 3WTYC 4IOAF 3LSPA 3C2GA 3IKVA 2QQBA 4CCMA 4MLOA 1RI7A 5D6EA 4XLHA 1QRYA 1G6NA 2YX7A 3HRSA 3K0LA 1UELB 5CQGA 2KMUA 5HS8A 1ZLJA 5EJCA 3LQRA 3GYHX 3CO7C 1Z0XA 3DV8A 1E3PA 3CDLA 2Y0SN 3T5XA 2GQQA 4QTRA 3ZOBA 4ZZLA 2IGOA 2LSOA 2LKPA 3OYKA 4NQWA 5CJ9A 2ME0A 1L0OC 4U0YA 2D1VA 3PNTA 3NWTA 2H8RA 4V19K 1MGTA 3V4GA 2QF7A 1BW5A 1SANA 5JHFA 1P7JA 4E4HA 2LF8A 2JRTA 2M0MA 2JA8J 2FRHA 3E97A 2HYGD 2M8EA 2NNNA 4JX6A 2IA1A 4CXFA 3I53A 3QP6A 3ZMDA 2DPUA 2A68F 4B09A 2K9QA 1P9QC 2NS8A 4XL9A 4F92B 3HYIA 3ABTA 2VN2A 2KRFA 1PP7U 3IAM2 4KN7X 5FO5A 4BHPA 2COBA 2A3SA 2DA4A 4BXXJ 1ZTRA 4XLFA
chains in the Genus database with same CATH topology
4UV9A 4HQMA 2MC3A 2H27A 2Y75A 4G9YA 1RUNA 4OMYA 3E5QA 2EA2A 4L0YB 2F5DA 5LHIA 1K78B 1P6RA 2DPDA 3RYRA 4ON0A 1A04A 1TNTA 4AIKA 3IHUA 2X4HA 3QU3A 1JXSA 1Z05A 2UXNA 2PMHA 1KQ9A 4MNUA 2EV6A 4HOBA 3JTHA 3DPLC 1ZLKA 4HF2A 2A6HF 2W85A 2ZMEA 1IXRC 4EM0B 1HKTA 2P7VB 2ZBKA 5ILSA 2GXGA 4RGXA 2OAZA 4GYIA 3L00A 4PCQA 4N9HA 4BAYA 3F8NA 4EM2A 5A2QK 3V8JA 1F9NA 2FBHA 3PQJA 2IW5A 4WF2A 1Z91A 2OA4A 2XV4S 1ON2A 5ILUA 2NNYA 3TQNA 3M7GA 1I6XA 3WGIA 4JK1X 1ZGAA 1R58A 3JW4A 2CFXA 3R4KA 2JZYA 3HTSB 5E8GA 1E2XA 4HQEA 2X0LA 4Y17A 5ICFA 3GX4X 2HFHA 2UXXA 3W6JB 3ECOA 5D4RA 1MKMA 4HA8A 1T38A 3LAPA 1F1ZA 3E3VA 4KNYA 3R60A 4HZFA 4YIIA 5DV5A 1ZARA 1D3YA 2J5OA 1T2KA 4KUMA 2F5EA 2C6YA 3SXYA 5D4SA 1D5VA 3E5UA 4YFNF 2P4WA 2FBKA 1XMAA 3FMQA 2Z99A 2F2EA 3QU6A 2DU9A 4TV7A 5L3BA 5FB2A 4P55A 3KEOA 1D8JA 4B8XA 3OV8A 1R22A 2BEOA 4QWQA 1FPQA 1XB4A 2XAGA 1BM9A 4EVIA 2VT3A 3KETA 2FU4A 2XAHA 2GA2A 4EJUA 3KP5A 4U88A 4KDPA 1SD4A 4EQQA 5K5RA 2A61A 2H09A 5E17F 1TQPA 4LMYA 3HSRA 2FQ3A 3FMRA 2FNAA 1I1SA 1JHHA 2H94A 1H9TA 4BNCA 3IWZA 3WODF 5ILVA 3G3ZA 5K1YA 1WKMA 1BIBA 2ISZA 1LDKB 1XSXA 1FSHA 2STTA 3VB2A 4AWXB 1OPCA 2ZNZA 2EFWA 2IRFG 2WWYA 2QZ8A 2EFOA 2KKOA 2PFBA 1IZ1A 5ICGA 3FXQA 3FM3A 4AIJA 4ZYDA 1P4AA 1SAXA 2OBPA 1XGNA 3IWFA 4L9VA 3KE2A 4Z2YA 1XGOA 2MBFA 1ULYA 3JTGA 1XMKA 1LJ9A 2VBZA 3DEUA 1AWCA 1BI2A 2FEZA 4H0EA 4MTEA 1XCVA 4M6YA 2Y48A 2VBXA 4KA4A 4UHTA 1KQ0A 5J8CA 5AIPA 1FYLA 1KYZA 5BQTA 1U6GA 1K79A 2G9WA 1HXDA 1OMIA 4P96A 3VEPA 4ZYHA 3P9IA 1R1TA 2BGCA 3LA3A 4ESFA 3BJAA 2Z3YA 4P5OA 2Q0OA 2KIFA 1ZREA 1ZHFA 2H6BA 1BI0A 2PJPA 2VE9A 3K9TA 4LLNA 1RUOA 2XHKA 1U8RA 2HKOA 4HBLA 5FGMA 1HKSA 2EWNA 3HUGA 2HKXA 2KIUA 3BDDA 6PAXA 1FLIA 1ZRDA 2O03A 5ERIA 3MZHA 4A5MA 1XSDA 4RAYA 1U78A 2CQKA 3GVAA 2W25A 2KIMA 2COMA 1ZG5A 1R1VA 3KCCA 2DFIA 1YLFA 5D5UB 3HRTA 3ZMVA 2OZ6A 3EYYA 4Q4ZF 4L9TA 3WG9A 4MQ9F 3CO6C 3RYPA 4ENKA 3H3UA 2VOOA 5ICEA 2A69F 3MCZA 2ZMEB 4I09A 2RNJA 4PDKA 1J59A 5DCMB 2VXZA 3W6KB 3BJ6A 3F8MA 1RZ4A 4IRHA 2D45A 3I58A 2VE8A 5DD4A 3RPUA 1EH7A 1MDMB 1FYMA 4KFCA 3S2WA 5L3EA 2RDPA 4FT8A 4S04A 1FY7A 5TJJA 1K7AA 5A2QZ 2IP2A 3BOQA 3I54A 2M30A 1PP8F 5LGUA 4BYYA 3VOEA 3T1BA 5LRRA 2E1CA 3RJPA 5E1WA 2FXAA 3ECHA 1B6AA 3F21A 4OINF 5CVRA 2UZKA 1MZBA 3K69A 2IVMA 5D5VB 4YG2F 3V8KA 3JAMZ 2ZCWA 5H20A 1ODDA 3GZ5A 1SFXA 3BJOA 4EGZA 2A07F 4EJTA 1C0WA 4LG0B 5BPIA 4GO1A 2HTJA 2HQNA 2XRNA 3HSEA 5HLHA 3LQQA 2NS0A 1YTYA 4CZZA 4PGGA 1IRFA 4ESBA 2LF7A 2RGVA 3VODA 3KZYA 4YFXF 3F6VA 2ZKZA 2G7HA 1IF1A 3E6DA 3F8CA 4CHUA 4WCGA 3C18A 1XSVA 1DUXC 4P9UA 2JSCA 3O2PE 1O3TA 3LWFA 1P2FA 2PN6A 1QQIA 4WXDA 2FE3A 1LDDA 3GFJA 2RV8A 4L9NA 2L54A 5ED4A 3I59A 2OQGA 1YW8A 1CF7B 2GZWA 1K78A 3F22A 4HLYA 5BOXA 2RVCA 2BE5F 1B59A 3E5XA 4UVBA 1E17A 5H6RA 4ENNA 3JAMK 2HZTA 4MEXF 1I27A 3KP6A 4G6DA 1G3YA 1GXQA 2A6EF 4MTDA 3V8LA 3GUDA 2STWA 4WX9A 4RB1A 1KA8A 2QVOA 3WTTC 4KIBA 3BROA 2VOPA 1UHMA 5D6FA 4O6JA 4UXNA 4IHSA 4HF0A 1EH8A 1IXCA 2W84A 3M9AA 1XGSA 2IJLA 1S6LA 3CUQA 3H3ZA 1YIOA 2V1XA 2ZFWA 4LFUA 3FWEA 3RKWA 5E1XA 5F1RA 1Z1DA 2K7LA 5L3FA 3SQNA 5F64A 3MEXA 2E1NA 5HDGA 3R0JA 3WTXC 2O61A 1S7OA 5LHGA 4LLLA 1LNWA 1HW1A 4A12A 4IPAA 3K1PA 1W7PA 3ZMTA 1XGMA 4ZYEA 4LJZF 3R6SA 4U0VA 2CYYA 1P92A 1BI3A 1QZZA 1UCRA 2CSOA 4A5NA 5LLQA 2UWMA 2NYXA 4L9JA 2DLLA 3ML6A 1GVJA 1OKRA 5DCFA 3U9GA 1TTYA 3KP7A 1YFHA 1GXPA 2P5LC 3HHGA 4OMZA 4LG0A 1YS7A 4RAZA 2O8XA 5CLSA 4HF1A 2GAUA 2DK8A 3HOSA 2OQRA 3ZMSA 1IUYA 4K2EA 3B02A 4WXCA 1QBJA 1BBYA 3FXUA 3MAJA 3E6BA 3QP5A 3GFLA 1BIAA 1KYWA 3NEUA 1ZRCA 2QYOA 5AIQA 4JBAA 5JHUA 2D2WA 4HLXA 3LFKA 4WK8F 3IL2A 1IW7F 4IJAA 1NHAA 3B73A 4UNOA 1YG2A 1UB9A 4IF4A 2FF4A 3EETA 2VONA 2PLYA 2FA5A 2DO7A 4ZYGA 3KFWX 2Z5UA 5FLXK 5KVRA 4QLCU 3I64A 1LEBA 2JPBA 2K27A 1OR7A 5HS9A 5D5WB 1ZGJA 4CDGA 2OZUA 2V1UA 4GCVA 3WGHA 2XAFA 4OOIA 2QWWA 4CYDA 1EH6A 3E6CC 2K02A 1U5TB 2XASA 4HV6A 4G6QA 1Q1HA 3CDHA 5J8FA 1FOKA 3J7AO 2DBBA 3HIFA 2HTSA 1YS6A 3I4PA 4UVCA 2EJRA 1USTA 2NRAC 4HAMA 4A2UA 2L3DA 3ZMZA 1O3SA 3TDUC 5LEKA 2XROA 3RKXA 1TNSA 3N97A 2QBYB 2PMUA 1X3UA 4M73A 1RNLA 5HLIA 3FXRA 1FBQA 2MA3A 4I0BA 1FC3A 3BZ6A 5DD8A 1I1GA 3PFIA 2PI0A 5LHHA 2V79A 1AOYA 1ZH5A 3CUQC 3U2RA 4LLGF 3WTVC 4O5VA 4AVPA 2DT5A 2Z33A 2QM3A 5CVUA 2HWVA 3C1DA 3QRFF 4UVAA 4XRFA 3J80Z 5LGNA 2QBYA 4KIGA 4G8XA 1Z9CA 2HDCA 2P6SA 1R00A 5IT9Z 1LB2A 2V6CA 1SD6A 4M9ZA 3KLNA 5EEGA 1GHCA 2GXBA 2QLZA 3OOPA 1KGSA 1IN6A 4FX0A 2HQRA 5CVJA 2JT1A 1IAWA 2P5KA 4YIFA 2B0LA 2FMYA 4S05A 3DFGA 4KMFA 4F7ZA 1PDNC 1BC8C 1UHWA 3P9KA 3ELKA 4GXOA 4DQ2A 3C3WA 5FLXZ 2W57A 3WE3A 3RTRA 1YQAA 1B1BA 2DK5A 4ASNA 1DPUA 5E1ZB 1U5TC 4M71A 1HKQA 4RGRA 3I0TA 3EQLF 5F6FA 3JSOA 3T0YA 3CLOA 3GW2A 2A5YB 4XBFA 1H9GA 2P6TA 4P9FA 2ELHA 1O7LA 1HW5A 1WWXA 1HQCA 4IRIA 1JGSA 3R0AA 1SD7A 2HOEA 2EFNA 2DW4A 4I98B 1R7JA 4G94A 3F8BA 1P4XA 2ZO4A 2BBYA 1KU9A 4A0YA 4D0PA 3M1EA 4WWCA 1B9MA 5JFRA 3J81K 2CGPA 1FP2A 3ABUA 5KK1A 3K1NA 1L3LA 3P9CA 2WC2A 5E18F 1J0RA 1SMYF 1O3RA 4LD5A 4EM1A 2MD5A 4JQFA 5DYMA 4EV0A 5DDGA 3HTUA 1I5ZA 2EV5A 5K5QA 2MH2A 4M74A 3LA2A 1MDMA 3DP7A 3LSTA 1ZAOA 3I71A 3F72A 4ENMA 3FX3A 5IT3A 5E8IA 2Z9OA 1ZN2A 3COAC 4RS8A 4U0WA 1YYVA 3NRVA 2O3FA 1HSTA 2DTRA 1Z6RA 3HRUA 4N9IA 4HDUA 4HV5A 4PZJA 3WTZA 4KIFA 2GWRA 1ZG1A 3T8TA 4M9XA 4OIQF 1IN4A 1VTNC 4LB6B 1Y0UA 2FNPA 1U3EM 3NQOA 2L02A 3GF2A 4Q5SF 5D8LB 2HYFA 4L5JA 1EV7A 3P7NA 3LA7A 3FHZA 1DDNA 1F5TA 1WI9A 1F4KA 3GFMA 4MGRA 1FX7A 3EUHA 5BS6A 2P8TA 2R3SA 2HGCA 5JR3A 2MLGA 3FZVA 1G3TA 2EV0A 3FM5A 4G7HF 1BN5A 2XVCA 2Y0MA 4RB3C 3L09A 1OYWA 3AAFA 3KZZA 2OD5A 1S3JA 3BP8A 4EGYA 3MWMA 3MQ0A 1HBXG 3HOTA 1T6SA 1IN7A 3GWZA 3Q9VA 1JHFA 3TGNA 2V1DA 1W4MA 1U2WA 3GXOA 1FBSA 4BQAA 2R7FA 3TOBA 4R1HA 1KU2A 4LK1F 1Z7UA 4Q48A 1W5TA 1FWZA 2RC4A 2QENA 2AXLA 4HW0A 4AD9A 4MEYF 1QO0D 5AONA 1MJ9A 1IN8A 4KT5C 4EJWA 3WU1B 1UFMA 5DUKA 2RQPA 1FNNA 3PQKA 2DI3A 2XAJA 4G7OF 1LEAA 3RDIA 5CVVA 2QQ9A 3CTAA 4U7DA 3E6MA 1ZG3A 2E7XA 3ZN1A 4FX4A 4CGZA 4BXUA 4O3MA 3QPTA 1J7KA 5BPDA 2O6GE 3M8EA 2ESNA 3I5UA 1TLHB 3CJNA 1MD0A 1R5HA 2M87A 2VT2A 5L3GA 1W7PB 3BPXA 2Q8KA 1TQMA 2MLKA 1IRGA 1T98A 3O6BB 1D8KA 3TO9A 5JI6A 4CICA 2FBIA 1OYYA 5HDKA 3K1MA 1B4AA 2Q2EA 1W5SA 2MH9A 3ZN0A 2ETHA 5HVQC 1QNTA 3DF8A 2J5PA 1S7AA 4E70A 2R7DA 4OU0A 2ESHA 2M5WA 3V7RA 3TO7A 1SFEA 4Q47A 4IRGA 2XUBA 2K4BA 1V3FA 2FMLA 5CYVA 1TBXA 3I59B 4IVNA 2LDUA 5HDNA 3FF5A 2IT0A 4BHBA 1BOAA 1RIOH 4I0AA 1R23A 3LAJA 3DQVC 1YW7A 1USSA 3O3KA 1FT9A 1R36A 1DPRA 3Q5FA 3RPQA 1V4RA 2L01A 1JE8A 3ZPLA 3L2CA 3K2ZA 3IRQA 1FYKA 2XAQA 5E20A 3M8FA 2XIGA 2VC1A 3HSFA 5IT9K 1J9IA 2JPCA 3ULQB 1SD5A 3F23A 4M9SA 3TDZC 4NB5A 1B9NA 4CO8A 1G3WA 2YU3A 3SZTA 3DXJF 1QGPA 2FOKA 1BJAA 1ONVA 1WSUA 1QPMA 1MJBA 4AIHA 2P7CB 4KYWA 1LDJA 2HS5A 2BYVE 3F8FA 4I2OA 1O57A 3QAHA 2VBYA 4GYGA 5FD5A 1ZYRF 5HOOA 4XLNF 2PBIA 1XDSA 4MHGA 2D1HA 1KU7A 2IA0A 2EB7A 2BV6A 2P5VA 3F6OA 5LBQA 1BC7C 2DAOA 1P4WA 5EEHA 1G3SA 2EFPA 3BY6A 1R1UA 4A0XA 2IA2A 2PQ8A 3CUOA 2E7WA 4Y15A 1K6OA 3MZYA 2ZJ2A 5LGTA 1XN7A 3FMSA 4A0ZA 2JTVA 2ADUA 5FD6A 2AS5F 2VODA 2YPRA 1FZPB 1J5YA 2ACJA 1STZA 2IPQX 1FP1D 5HLGA 1IN5A 2GA1A 4N0BA 3IRRA 4LGWA 2L4AA 5D8KB 2GIVA 3VFZA 1WQ2A 1KU3A 3WTSC 4OIOF 1LQ1A 5J6XA 3WTUC 1O3QA 4BHCA 4L5IA 5LEJA 3IC7A 1CF7A 1S29A 2H6CA 3SHFA 3TKYA 4KN4X 3HRMA 4IXAA 2EA4A 4HX7A 3SZPA 2FSWA 2KJCA 4KMUX 4RB2C 4WXHA 4KICA 4RB0A 5HS7A 4FHTA 4LK0F 1XD7A 3R61A 1XCBA 4I02A 4R8HA 3ZMUA 4UV8A 3WTWC 2QUFA 4UUVA 1Z6TA 1FBUA 2CW0F 1OYIA 5H6QA 5FFXA 3F3XA 4HX4A 2O0YA 5L3DA 3U1DA 4HX8A 1BI1A 5BMZA 4XSXF 2LNBA 2RN7A 3ZQ7A 5ICCA 1U5TA 2EK5A 4EJOA 4IHTA 1WRJA 1MJAA 1TW3A 4I01A 4NHJA 2HR3A 2CG4A 3L9FA 1W7PD 4HYEA 1ON1A 2OU2A 2PG4A 2V9VA 3GO5A 3EDPA 2DQRA 3JSPA 1T0FA 1SMTA 3J81Z 3KP4A 1T39A 2PEXA 3ROUA 4XLPF 2W24A 3DPTA 1HW2A 4M6XA 5DUIA 1SFUA 1HSJA 3Q9SA 3BWGA 4BH9A 1S8NA 1R5GA 3C7JA 2HEOA 1J2XA 1FSEA 2K86A 2M45A 2K4JA 5DEQA 5D5XB 3L7WA 3IKTA 1G4DA 1XDUA 1PUEE 3DKWA 4LB5A 1TW2A 3HHHA 3KP2A 3GEZA 3QOPA 2ZNYA 1DP7P 1KQ8A 4ZZDA 4Y13A 4MQVA 3WE2A 2XGXA 3D5LA 3WU0A 3V7SA 2XKOA 4HDVA 3D0SA 3ERED 3BPVA 5FFZA 2CO5A 2ISYA 4I7HA 3RIRA 4OIRF 3ZP5A 5K5OA 1O7FA 2YX4A 1ZRFA 2F5FA 3G73A 2NAZA 3RKYA 1CGPA 4R79A 1LVAA 4ENJA 4OIPF 1QZYA 4YFKF 4ETSA 3J80K 4ESJA 3KEQA 3MFKA 4RGSA 3REOA 5CVIA 4EMSA 4RGUA 4A6DA 2VC0A 3TOAA 4G7ZF 4L18B 2WV0A 2VBWA 4ZH4F 2EFQA 3WGGA 3QPHA 3SFZA 4EJVA 3CUQB 3EYIA 5DCMA 2L4MA 3GZ6A 3H92A 2CWEA 1IXSB 1TQIA 2QQAA 3GLXA 2WTEA 4DNCA 2F5CA 5JVTA 1YO5C 4U7BA 2YR2A 5L3CA 2RKHA 5LRSA 4PGHA 4XSZF 5TRDA 3T8RA 1J75A 3KLOA 2DQLA 3N4MA 4M72A 2M1BA 3RI4A 2TDXA 2XKPA 3KP3A 1H0MA 1YW9A 1REPC 2KJBA 4GGGA 4A6EA 2G7UA 2ZXJA 3GFIA 3ISPA 2YSRA 3V7CA 4L0ZB 3TO6A 3WTYC 3IKVA 2QQBA 1RI7A 5D6EA 2YX7A 1G6NA 3HRSA 3K0LA 5HS8A 1ZLJA 3LQRA 3GYHX 3CO7C 3DV8A 3T5XA 2GQQA 4ZZLA 2LSOA 2LKPA 4NQWA 5CJ9A 1L0OC 4U0YA 2D1VA 1MGTA 3V4GA 2LF8A 2JRTA 2FRHA 3E97A 2HYGD 2M8EA 2NNNA 2IA1A 4CXFA 3I53A 3QP6A 3ZMDA 2DPUA 2A68F 4B09A 3HYIA 3ABTA 2VN2A 2KRFA 1PP7U 4KN7X 5FO5A 4BHPA 2A3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UV9 A;  4HQM A;  2MC3 A;  2H27 A;  2Y75 A;  4G9Y A;  1RUN A;  4OMY A;  3E5Q A;  2EA2 A;  4L0Y B;  2F5D A;  5LHI A;  1K78 B;  1P6R A;  2DPD A;  3RYR A;  4ON0 A;  1A04 A;  1TNT A;  4AIK A;  3IHU A;  2X4H A;  3QU3 A;  1JXS A;  1Z05 A;  2UXN A;  2PMH A;  1KQ9 A;  4MNU A;  2EV6 A;  4HOB A;  3JTH A;  3DPL C;  1ZLK A;  4HF2 A;  2A6H F;  2W85 A;  2ZME A;  1IXR C;  4EM0 B;  1HKT A;  2P7V B;  2ZBK A;  5ILS A;  2GXG A;  4RGX A;  2OAZ A;  4GYI A;  3L00 A;  4PCQ A;  4N9H A;  4BAY A;  3F8N A;  4EM2 A;  5A2Q K;  3V8J A;  1F9N A;  2FBH A;  3PQJ A;  2IW5 A;  4WF2 A;  1Z91 A;  2OA4 A;  2XV4 S;  1ON2 A;  5ILU A;  2NNY A;  3TQN A;  3M7G A;  1I6X A;  3WGI A;  4JK1 X;  1ZGA A;  1R58 A;  3JW4 A;  2CFX A;  3R4K A;  2JZY A;  3HTS B;  5E8G A;  1E2X A;  4HQE A;  2X0L A;  4Y17 A;  5ICF A;  3GX4 X;  2HFH A;  2UXX A;  3W6J B;  3ECO A;  5D4R A;  1MKM A;  4HA8 A;  1T38 A;  3LAP A;  1F1Z A;  3E3V A;  4KNY A;  3R60 A;  4HZF A;  4YII A;  5DV5 A;  1ZAR A;  1D3Y A;  2J5O A;  1T2K A;  4KUM A;  2F5E A;  2C6Y A;  3SXY A;  5D4S A;  1D5V A;  3E5U A;  4YFN F;  2P4W A;  2FBK A;  1XMA A;  3FMQ A;  2Z99 A;  2F2E A;  3QU6 A;  2DU9 A;  4TV7 A;  5L3B A;  5FB2 A;  4P55 A;  3KEO A;  1D8J A;  4B8X A;  3OV8 A;  1R22 A;  2BEO A;  4QWQ A;  1FPQ A;  1XB4 A;  2XAG A;  1BM9 A;  4EVI A;  2VT3 A;  3KET A;  2FU4 A;  2XAH A;  2GA2 A;  4EJU A;  3KP5 A;  4U88 A;  4KDP A;  1SD4 A;  4EQQ A;  5K5R A;  2A61 A;  2H09 A;  5E17 F;  1TQP A;  4LMY A;  3HSR A;  2FQ3 A;  3FMR A;  2FNA A;  1I1S A;  1JHH A;  2H94 A;  1H9T A;  4BNC A;  3IWZ A;  3WOD F;  5ILV A;  3G3Z A;  5K1Y A;  1WKM A;  1BIB A;  2ISZ A;  1LDK B;  1XSX A;  1FSH A;  2STT A;  3VB2 A;  4AWX B;  1OPC A;  2ZNZ A;  2EFW A;  2IRF G;  2WWY A;  2QZ8 A;  2EFO A;  2KKO A;  2PFB A;  1IZ1 A;  5ICG A;  3FXQ A;  3FM3 A;  4AIJ A;  4ZYD A;  1P4A A;  1SAX A;  2OBP A;  1XGN A;  3IWF A;  4L9V A;  3KE2 A;  4Z2Y A;  1XGO A;  2MBF A;  1ULY A;  3JTG A;  1XMK A;  1LJ9 A;  2VBZ A;  3DEU A;  1AWC A;  1BI2 A;  2FEZ A;  4H0E A;  4MTE A;  1XCV A;  4M6Y A;  2Y48 A;  2VBX A;  4KA4 A;  4UHT A;  1KQ0 A;  5J8C A;  5AIP A;  1FYL A;  1KYZ A;  5BQT A;  1U6G A;  1K79 A;  2G9W A;  1HXD A;  1OMI A;  4P96 A;  3VEP A;  4ZYH A;  3P9I A;  1R1T A;  2BGC A;  3LA3 A;  4ESF A;  3BJA A;  2Z3Y A;  4P5O A;  2Q0O A;  2KIF A;  1ZRE A;  1ZHF A;  2H6B A;  1BI0 A;  2PJP A;  2VE9 A;  3K9T A;  4LLN A;  1RUO A;  2XHK A;  1U8R A;  2HKO A;  4HBL A;  5FGM A;  1HKS A;  2EWN A;  3HUG A;  2HKX A;  2KIU A;  3BDD A;  6PAX A;  1FLI A;  1ZRD A;  2O03 A;  5ERI A;  3MZH A;  4A5M A;  1XSD A;  4RAY A;  1U78 A;  2CQK A;  3GVA A;  2W25 A;  2KIM A;  2COM A;  1ZG5 A;  1R1V A;  3KCC A;  2DFI A;  1YLF A;  5D5U B;  3HRT A;  3ZMV A;  2OZ6 A;  3EYY A;  4Q4Z F;  4L9T A;  3WG9 A;  4MQ9 F;  3CO6 C;  3RYP A;  4ENK A;  3H3U A;  2VOO A;  5ICE A;  2A69 F;  3MCZ A;  2ZME B;  4I09 A;  2RNJ A;  4PDK A;  1J59 A;  5DCM B;  2VXZ A;  3W6K B;  3BJ6 A;  3F8M A;  1RZ4 A;  4IRH A;  2D45 A;  3I58 A;  2VE8 A;  5DD4 A;  3RPU A;  1EH7 A;  1MDM B;  1FYM A;  4KFC A;  3S2W A;  5L3E A;  2RDP A;  4FT8 A;  4S04 A;  1FY7 A;  5TJJ A;  1K7A A;  5A2Q Z;  2IP2 A;  3BOQ A;  3I54 A;  2M30 A;  1PP8 F;  5LGU A;  4BYY A;  3VOE A;  3T1B A;  5LRR A;  2E1C A;  3RJP A;  5E1W A;  2FXA A;  3ECH A;  1B6A A;  3F21 A;  4OIN F;  5CVR A;  2UZK A;  1MZB A;  3K69 A;  2IVM A;  5D5V B;  4YG2 F;  3V8K A;  3JAM Z;  2ZCW A;  5H20 A;  1ODD A;  3GZ5 A;  1SFX A;  3BJO A;  4EGZ A;  2A07 F;  4EJT A;  1C0W A;  4LG0 B;  5BPI A;  4GO1 A;  2HTJ A;  2HQN A;  2XRN A;  3HSE A;  5HLH A;  3LQQ A;  2NS0 A;  1YTY A;  4CZZ A;  4PGG A;  1IRF A;  4ESB A;  2LF7 A;  2RGV A;  3VOD A;  3KZY A;  4YFX F;  3F6V A;  2ZKZ A;  2G7H A;  1IF1 A;  3E6D A;  3F8C A;  4CHU A;  4WCG A;  3C18 A;  1XSV A;  1DUX C;  4P9U A;  2JSC A;  3O2P E;  1O3T A;  3LWF A;  1P2F A;  2PN6 A;  1QQI A;  4WXD A;  2FE3 A;  1LDD A;  3GFJ A;  2RV8 A;  4L9N A;  2L54 A;  5ED4 A;  3I59 A;  2OQG A;  1YW8 A;  1CF7 B;  2GZW A;  1K78 A;  3F22 A;  4HLY A;  5BOX A;  2RVC A;  2BE5 F;  1B59 A;  3E5X A;  4UVB A;  1E17 A;  5H6R A;  4ENN A;  3JAM K;  2HZT A;  4MEX F;  1I27 A;  3KP6 A;  4G6D A;  1G3Y A;  1GXQ A;  2A6E F;  4MTD A;  3V8L A;  3GUD A;  2STW A;  4WX9 A;  4RB1 A;  1KA8 A;  2QVO A;  3WTT C;  4KIB A;  3BRO A;  2VOP A;  1UHM A;  5D6F A;  4O6J A;  4UXN A;  4IHS A;  4HF0 A;  1EH8 A;  1IXC A;  2W84 A;  3M9A A;  1XGS A;  2IJL A;  1S6L A;  3CUQ A;  3H3Z A;  1YIO A;  2V1X A;  2ZFW A;  4LFU A;  3FWE A;  3RKW A;  5E1X A;  5F1R A;  1Z1D A;  2K7L A;  5L3F A;  3SQN A;  5F64 A;  3MEX A;  2E1N A;  5HDG A;  3R0J A;  3WTX C;  2O61 A;  1S7O A;  5LHG A;  4LLL A;  1LNW A;  1HW1 A;  4A12 A;  4IPA A;  3K1P A;  1W7P A;  3ZMT A;  1XGM A;  4ZYE A;  4LJZ F;  3R6S A;  4U0V A;  2CYY A;  1P92 A;  1BI3 A;  1QZZ A;  1UCR A;  2CSO A;  4A5N A;  5LLQ A;  2UWM A;  2NYX A;  4L9J A;  2DLL A;  3ML6 A;  1GVJ A;  1OKR A;  5DCF A;  3U9G A;  1TTY A;  3KP7 A;  1YFH A;  1GXP A;  2P5L C;  3HHG A;  4OMZ A;  4LG0 A;  1YS7 A;  4RAZ A;  2O8X A;  5CLS A;  4HF1 A;  2GAU A;  2DK8 A;  3HOS A;  2OQR A;  3ZMS A;  1IUY A;  4K2E A;  3B02 A;  4WXC A;  1QBJ A;  1BBY A;  3FXU A;  3MAJ A;  3E6B A;  3QP5 A;  3GFL A;  1BIA A;  1KYW A;  3NEU A;  1ZRC A;  2QYO A;  5AIQ A;  4JBA A;  5JHU A;  2D2W A;  4HLX A;  3LFK A;  4WK8 F;  3IL2 A;  1IW7 F;  4IJA A;  1NHA A;  3B73 A;  4UNO A;  1YG2 A;  1UB9 A;  4IF4 A;  2FF4 A;  3EET A;  2VON A;  2PLY A;  2FA5 A;  2DO7 A;  4ZYG A;  3KFW X;  2Z5U A;  5FLX K;  5KVR A;  4QLC U;  3I64 A;  1LEB A;  2JPB A;  2K27 A;  1OR7 A;  5HS9 A;  5D5W B;  1ZGJ A;  4CDG A;  2OZU A;  2V1U A;  4GCV A;  3WGH A;  2XAF A;  4OOI A;  2QWW A;  4CYD A;  1EH6 A;  3E6C C;  2K02 A;  1U5T B;  2XAS A;  4HV6 A;  4G6Q A;  1Q1H A;  3CDH A;  5J8F A;  1FOK A;  3J7A O;  2DBB A;  3HIF A;  2HTS A;  1YS6 A;  3I4P A;  4UVC A;  2EJR A;  1UST A;  2NRA C;  4HAM A;  4A2U A;  2L3D A;  3ZMZ A;  1O3S A;  3TDU C;  5LEK A;  2XRO A;  3RKX A;  1TNS A;  3N97 A;  2QBY B;  2PMU A;  1X3U A;  4M73 A;  1RNL A;  5HLI A;  3FXR A;  1FBQ A;  2MA3 A;  4I0B A;  1FC3 A;  3BZ6 A;  5DD8 A;  1I1G A;  3PFI A;  2PI0 A;  5LHH A;  2V79 A;  1AOY A;  1ZH5 A;  3CUQ C;  3U2R A;  4LLG F;  3WTV C;  4O5V A;  4AVP A;  2DT5 A;  2Z33 A;  2QM3 A;  5CVU A;  2HWV A;  3C1D A;  3QRF F;  4UVA A;  4XRF A;  3J80 Z;  5LGN A;  2QBY A;  4KIG A;  4G8X A;  1Z9C A;  2HDC A;  2P6S A;  1R00 A;  5IT9 Z;  1LB2 A;  2V6C A;  1SD6 A;  4M9Z A;  3KLN A;  5EEG A;  1GHC A;  2GXB A;  2QLZ A;  3OOP A;  1KGS A;  1IN6 A;  4FX0 A;  2HQR A;  5CVJ A;  2JT1 A;  1IAW A;  2P5K A;  4YIF A;  2B0L A;  2FMY A;  4S05 A;  3DFG A;  4KMF A;  4F7Z A;  1PDN C;  1BC8 C;  1UHW A;  3P9K A;  3ELK A;  4GXO A;  4DQ2 A;  3C3W A;  5FLX Z;  2W57 A;  3WE3 A;  3RTR A;  1YQA A;  1B1B A;  2DK5 A;  4ASN A;  1DPU A;  5E1Z B;  1U5T C;  4M71 A;  1HKQ A;  4RGR A;  3I0T A;  3EQL F;  5F6F A;  3JSO A;  3T0Y A;  3CLO A;  3GW2 A;  2A5Y B;  4XBF A;  1H9G A;  2P6T A;  4P9F A;  2ELH A;  1O7L A;  1HW5 A;  1WWX A;  1HQC A;  4IRI A;  1JGS A;  3R0A A;  1SD7 A;  2HOE A;  2EFN A;  2DW4 A;  4I98 B;  1R7J A;  4G94 A;  3F8B A;  1P4X A;  2ZO4 A;  2BBY A;  1KU9 A;  4A0Y A;  4D0P A;  3M1E A;  4WWC A;  1B9M A;  5JFR A;  3J81 K;  2CGP A;  1FP2 A;  3ABU A;  5KK1 A;  3K1N A;  1L3L A;  3P9C A;  2WC2 A;  5E18 F;  1J0R A;  1SMY F;  1O3R A;  4LD5 A;  4EM1 A;  2MD5 A;  4JQF A;  5DYM A;  4EV0 A;  5DDG A;  3HTU A;  1I5Z A;  2EV5 A;  5K5Q A;  2MH2 A;  4M74 A;  3LA2 A;  1MDM A;  3DP7 A;  3LST A;  1ZAO A;  3I71 A;  3F72 A;  4ENM A;  3FX3 A;  5IT3 A;  5E8I A;  2Z9O A;  1ZN2 A;  3COA C;  4RS8 A;  4U0W A;  1YYV A;  3NRV A;  2O3F A;  1HST A;  2DTR A;  1Z6R A;  3HRU A;  4N9I A;  4HDU A;  4HV5 A;  4PZJ A;  3WTZ A;  4KIF A;  2GWR A;  1ZG1 A;  3T8T A;  4M9X A;  4OIQ F;  1IN4 A;  1VTN C;  4LB6 B;  1Y0U A;  2FNP A;  1U3E M;  3NQO A;  2L02 A;  3GF2 A;  4Q5S F;  5D8L B;  2HYF A;  4L5J A;  1EV7 A;  3P7N A;  3LA7 A;  3FHZ A;  1DDN A;  1F5T A;  1WI9 A;  1F4K A;  3GFM A;  4MGR A;  1FX7 A;  3EUH A;  5BS6 A;  2P8T A;  2R3S A;  2HGC A;  5JR3 A;  2MLG A;  3FZV A;  1G3T A;  2EV0 A;  3FM5 A;  4G7H F;  1BN5 A;  2XVC A;  2Y0M A;  4RB3 C;  3L09 A;  1OYW A;  3AAF A;  3KZZ A;  2OD5 A;  1S3J A;  3BP8 A;  4EGY A;  3MWM A;  3MQ0 A;  1HBX G;  3HOT A;  1T6S A;  1IN7 A;  3GWZ A;  3Q9V A;  1JHF A;  3TGN A;  2V1D A;  1W4M A;  1U2W A;  3GXO A;  1FBS A;  4BQA A;  2R7F A;  3TOB A;  4R1H A;  1KU2 A;  4LK1 F;  1Z7U A;  4Q48 A;  1W5T A;  1FWZ A;  2RC4 A;  2QEN A;  2AXL A;  4HW0 A;  4AD9 A;  4MEY F;  1QO0 D;  5AON A;  1MJ9 A;  1IN8 A;  4KT5 C;  4EJW A;  3WU1 B;  1UFM A;  5DUK A;  2RQP A;  1FNN A;  3PQK A;  2DI3 A;  2XAJ A;  4G7O F;  1LEA A;  3RDI A;  5CVV A;  2QQ9 A;  3CTA A;  4U7D A;  3E6M A;  1ZG3 A;  2E7X A;  3ZN1 A;  4FX4 A;  4CGZ A;  4BXU A;  4O3M A;  3QPT A;  1J7K A;  5BPD A;  2O6G E;  3M8E A;  2ESN A;  3I5U A;  1TLH B;  3CJN A;  1MD0 A;  1R5H A;  2M87 A;  2VT2 A;  5L3G A;  1W7P B;  3BPX A;  2Q8K A;  1TQM A;  2MLK A;  1IRG A;  1T98 A;  3O6B B;  1D8K A;  3TO9 A;  5JI6 A;  4CIC A;  2FBI A;  1OYY A;  5HDK A;  3K1M A;  1B4A A;  2Q2E A;  1W5S A;  2MH9 A;  3ZN0 A;  2ETH A;  5HVQ C;  1QNT A;  3DF8 A;  2J5P A;  1S7A A;  4E70 A;  2R7D A;  4OU0 A;  2ESH A;  2M5W A;  3V7R A;  3TO7 A;  1SFE A;  4Q47 A;  4IRG A;  2XUB A;  2K4B A;  1V3F A;  2FML A;  5CYV A;  1TBX A;  3I59 B;  4IVN A;  2LDU A;  5HDN A;  3FF5 A;  2IT0 A;  4BHB A;  1BOA A;  1RIO H;  4I0A A;  1R23 A;  3LAJ A;  3DQV C;  1YW7 A;  1USS A;  3O3K A;  1FT9 A;  1R36 A;  1DPR A;  3Q5F A;  3RPQ A;  1V4R A;  2L01 A;  1JE8 A;  3ZPL A;  3L2C A;  3K2Z A;  3IRQ A;  1FYK A;  2XAQ A;  5E20 A;  3M8F A;  2XIG A;  2VC1 A;  3HSF A;  5IT9 K;  1J9I A;  2JPC A;  3ULQ B;  1SD5 A;  3F23 A;  4M9S A;  3TDZ C;  4NB5 A;  1B9N A;  4CO8 A;  1G3W A;  2YU3 A;  3SZT A;  3DXJ F;  1QGP A;  2FOK A;  1BJA A;  1ONV A;  1WSU A;  1QPM A;  1MJB A;  4AIH A;  2P7C B;  4KYW A;  1LDJ A;  2HS5 A;  2BYV E;  3F8F A;  4I2O A;  1O57 A;  3QAH A;  2VBY A;  4GYG A;  5FD5 A;  1ZYR F;  5HOO A;  4XLN F;  2PBI A;  1XDS A;  4MHG A;  2D1H A;  1KU7 A;  2IA0 A;  2EB7 A;  2BV6 A;  2P5V A;  3F6O A;  5LBQ A;  1BC7 C;  2DAO A;  1P4W A;  5EEH A;  1G3S A;  2EFP A;  3BY6 A;  1R1U A;  4A0X A;  2IA2 A;  2PQ8 A;  3CUO A;  2E7W A;  4Y15 A;  1K6O A;  3MZY A;  2ZJ2 A;  5LGT A;  1XN7 A;  3FMS A;  4A0Z A;  2JTV A;  2ADU A;  5FD6 A;  2AS5 F;  2VOD A;  2YPR A;  1FZP B;  1J5Y A;  2ACJ A;  1STZ A;  2IPQ X;  1FP1 D;  5HLG A;  1IN5 A;  2GA1 A;  4N0B A;  3IRR A;  4LGW A;  2L4A A;  5D8K B;  2GIV A;  3VFZ A;  1WQ2 A;  1KU3 A;  3WTS C;  4OIO F;  1LQ1 A;  5J6X A;  3WTU C;  1O3Q A;  4BHC A;  4L5I A;  5LEJ A;  3IC7 A;  1CF7 A;  1S29 A;  2H6C A;  3SHF A;  3TKY A;  4KN4 X;  3HRM A;  4IXA A;  2EA4 A;  4HX7 A;  3SZP A;  2FSW A;  2KJC A;  4KMU X;  4RB2 C;  4WXH A;  4KIC A;  4RB0 A;  5HS7 A;  4FHT A;  4LK0 F;  1XD7 A;  3R61 A;  1XCB A;  4I02 A;  4R8H A;  3ZMU A;  4UV8 A;  3WTW C;  2QUF A;  4UUV A;  1Z6T A;  1FBU A;  2CW0 F;  1OYI A;  5H6Q A;  5FFX A;  3F3X A;  4HX4 A;  2O0Y A;  5L3D A;  3U1D A;  4HX8 A;  1BI1 A;  5BMZ A;  4XSX F;  2LNB A;  2RN7 A;  3ZQ7 A;  5ICC A;  1U5T A;  2EK5 A;  4EJO A;  4IHT A;  1WRJ A;  1MJA A;  1TW3 A;  4I01 A;  4NHJ A;  2HR3 A;  2CG4 A;  3L9F A;  1W7P D;  4HYE A;  1ON1 A;  2OU2 A;  2PG4 A;  2V9V A;  3GO5 A;  3EDP A;  2DQR A;  3JSP A;  1T0F A;  1SMT A;  3J81 Z;  3KP4 A;  1T39 A;  2PEX A;  3ROU A;  4XLP F;  2W24 A;  3DPT A;  1HW2 A;  4M6X A;  5DUI A;  1SFU A;  1HSJ A;  3Q9S A;  3BWG A;  4BH9 A;  1S8N A;  1R5G A;  3C7J A;  2HEO A;  1J2X A;  1FSE A;  2K86 A;  2M45 A;  2K4J A;  5DEQ A;  5D5X B;  3L7W A;  3IKT A;  1G4D A;  1XDU A;  1PUE E;  3DKW A;  4LB5 A;  1TW2 A;  3HHH A;  3KP2 A;  3GEZ A;  3QOP A;  2ZNY A;  1DP7 P;  1KQ8 A;  4ZZD A;  4Y13 A;  4MQV A;  3WE2 A;  2XGX A;  3D5L A;  3WU0 A;  3V7S A;  2XKO A;  4HDV A;  3D0S A;  3ERE D;  3BPV A;  5FFZ A;  2CO5 A;  2ISY A;  4I7H A;  3RIR A;  4OIR F;  3ZP5 A;  5K5O A;  1O7F A;  2YX4 A;  1ZRF A;  2F5F A;  3G73 A;  2NAZ A;  3RKY A;  1CGP A;  4R79 A;  1LVA A;  4ENJ A;  4OIP F;  1QZY A;  4YFK F;  4ETS A;  3J80 K;  4ESJ A;  3KEQ A;  3MFK A;  4RGS A;  3REO A;  5CVI A;  4EMS A;  4RGU A;  4A6D A;  2VC0 A;  3TOA A;  4G7Z F;  4L18 B;  2WV0 A;  2VBW A;  4ZH4 F;  2EFQ A;  3WGG A;  3QPH A;  3SFZ A;  4EJV A;  3CUQ B;  3EYI A;  5DCM A;  2L4M A;  3GZ6 A;  3H92 A;  2CWE A;  1IXS B;  1TQI A;  2QQA A;  3GLX A;  2WTE A;  4DNC A;  2F5C A;  5JVT A;  1YO5 C;  4U7B A;  2YR2 A;  5L3C A;  2RKH A;  5LRS A;  4PGH A;  4XSZ F;  5TRD A;  3T8R A;  1J75 A;  3KLO A;  2DQL A;  3N4M A;  4M72 A;  2M1B A;  3RI4 A;  2TDX A;  2XKP A;  3KP3 A;  1H0M A;  1YW9 A;  1REP C;  2KJB A;  4GGG A;  4A6E A;  2G7U A;  2ZXJ A;  3GFI A;  3ISP A;  2YSR A;  3V7C A;  4L0Z B;  3TO6 A;  3WTY C;  3IKV A;  2QQB A;  1RI7 A;  5D6E A;  2YX7 A;  1G6N A;  3HRS A;  3K0L A;  5HS8 A;  1ZLJ A;  3LQR A;  3GYH X;  3CO7 C;  3DV8 A;  3T5X A;  2GQQ A;  4ZZL A;  2LSO A;  2LKP A;  4NQW A;  5CJ9 A;  1L0O C;  4U0Y A;  2D1V A;  1MGT A;  3V4G A;  2LF8 A;  2JRT A;  2FRH A;  3E97 A;  2HYG D;  2M8E A;  2NNN A;  2IA1 A;  4CXF A;  3I53 A;  3QP6 A;  3ZMD A;  2DPU A;  2A68 F;  4B09 A;  3HYI A;  3ABT A;  2VN2 A;  2KRF A;  1PP7 U;  4KN7 X;  5FO5 A;  4BHP A;  2A3S A; 
#chains in the Genus database with same CATH topology
 4UV9 A;  5JLX A;  3ABM H;  4IZZ A;  4RM3 A;  4HQM A;  2MC3 A;  2H27 A;  2Y75 A;  2XPW A;  3GTO J;  4G9Y A;  4BJ6 C;  1RUN A;  3SEZ A;  2Q2E B;  2F4O B;  4OMY A;  2IS2 A;  3KPH A;  3IUO A;  5GAE J;  3E5Q A;  1G8X A;  2EA2 A;  3O8H A;  4ZTF A;  4L0Y B;  1WHU A;  2F5D A;  5LHI A;  3HL2 A;  1K78 B;  1P6R A;  1U8B A;  2DPD A;  4RLQ A;  3RYR A;  4MIM A;  4ON0 A;  3K7A J;  1VQ8 I;  1A04 A;  1IJW C;  4BEH B;  1TNT A;  3GBG A;  5IOZ A;  4AIK A;  2ECB A;  2X4H A;  3IHU A;  1IRZ A;  1KON A;  3QU3 A;  2BXY A;  1JXS A;  4DGW B;  1Z05 A;  2VPL A;  3ZGK A;  9ANT A;  2UXN A;  2PMH A;  3PL8 A;  1KQ9 A;  1X3Z B;  4MNU A;  1LFU P;  2EV6 A;  2R7S A;  3G6E I;  4HOB A;  5EG0 A;  3DLA A;  3JTH A;  1MMN A;  1RES A;  2UUZ A;  5K7H A;  3HB9 A;  3DPL C;  1ZLK A;  4HF2 A;  2A6H F;  2JUG A;  1MW7 A;  1A6Q A;  3ZQI A;  1VQP I;  2W85 A;  2K3F A;  2LR8 A;  1PJR A;  2ZME A;  1IXR C;  4EM0 B;  1SC7 A;  2DA5 A;  4ZDP A;  1T0F C;  1HKT A;  4XID A;  4Y4R A;  1ETV A;  3BTC A;  3S16 J;  2P7V B;  2ZBK A;  2Y9Y A;  5ILS A;  3OYG A;  3FXK A;  1UZC A;  2K40 A;  1BA5 A;  2LBF A;  2GXG A;  3KEY A;  1ZEL A;  1G59 A;  5C44 J;  5CKT A;  1X1P A;  4RGX A;  3CQZ J;  2OAZ A;  3E1S A;  4HSR A;  4GYI A;  3L00 A;  4PCQ A;  4Y33 A;  4N9H A;  4BAY A;  2V9K A;  2M3A A;  2XSJ C;  3F8N A;  4EM2 A;  1R71 A;  3CD6 I;  4GFB A;  2JJ7 A;  3SFI A;  5A2Q K;  3V8J A;  1W0T A;  3VSK A;  1F9N A;  2FBH A;  3PQJ A;  4BE2 A;  1LFP A;  2IW5 A;  4BBS J;  4WF2 A;  1Z91 A;  3DTE A;  2OA4 A;  2X6O A;  2XV4 S;  5J3L A;  3LSK A;  2KIQ A;  5GP9 A;  2OCC H;  1ON2 A;  1W5C C;  5ILU A;  1XS9 A;  1LE8 B;  1S9H A;  4KT6 A;  2NNY A;  3TQN A;  3M7G A;  1MBE A;  1I6X A;  2LBF B;  3WGI A;  2Y2Z A;  4JK1 X;  1ZGA A;  1APL C;  3F9K A;  1R58 A;  2E1M B;  3JW4 A;  1POG A;  2CFX A;  3R4K A;  2JZY A;  1ETY A;  3HTS B;  3HGY A;  5E8G A;  4PJJ A;  1E2X A;  4HQE A;  1QPI A;  2MYS A;  2OC6 A;  2VQH A;  2X0L A;  3BG7 A;  4Y17 A;  5ICF A;  3GX4 X;  2HFH A;  3A03 A;  3IV5 A;  2UXX A;  3W6J B;  2EH3 A;  1Z3Y A;  2WAF A;  3A0H C;  5J4Y A;  3ABK H;  5FJ8 J;  3GTJ J;  3KIO A;  2M7B A;  3HGG A;  3ECO A;  2VQC A;  3FXO A;  1MKM A;  5D4R A;  4HA8 A;  4AVZ A;  1T38 A;  3LAP A;  1YIJ I;  3BR1 A;  3MKZ A;  3L2W A;  2LMD A;  1IO2 A;  1F1Z A;  3E3V A;  3GZN B;  1OCP A;  3R60 A;  4HZF A;  4YII A;  4XIC A;  3OYF A;  1R4N B;  5DV5 A;  3JRC A;  1ZAR A;  1D3Y A;  1N25 A;  2L7Z A;  2JRM A;  2J5O A;  1T2K A;  4KUM A;  2F5E A;  2C6Y A;  2EZL A;  3SXY A;  1A5J A;  5D4S A;  3QQA A;  1D5V A;  4IHY A;  2MGQ A;  3E5U A;  4YFN F;  2P4W A;  2IGK A;  5K7F A;  2I5U A;  4XRS A;  1TT0 A;  2FBK A;  4IEJ A;  1XMA A;  1FEX A;  3FMQ A;  5KAF C;  2Z99 A;  2HPM A;  2F2E A;  3QU6 A;  2DOD A;  2KT0 A;  3S17 J;  2CFO A;  1J09 A;  2DU9 A;  4TV7 A;  5L3B A;  4P55 A;  5FB2 A;  3KEO A;  2Z1D A;  1A6I A;  4HRI A;  5FLV A;  1D8J A;  4B8X A;  2LOO A;  2VB6 A;  3OV8 A;  1R22 A;  2BEO A;  4FET A;  4B43 A;  3PSF A;  2ME6 A;  1A35 A;  4QWQ A;  1FPQ A;  1XB4 A;  2DMU A;  3L2U A;  2OTJ I;  3ZQC A;  2HOA A;  2XAG A;  1BM9 A;  1VQM I;  1ACI A;  3OYH A;  4BQN A;  5JVG F;  4F55 A;  2Y31 A;  4EVI A;  2CMP A;  4OAZ A;  2VT3 A;  3BR6 A;  3KET A;  1GUU A;  4NC8 A;  2DOF A;  3OIQ A;  3ZCO A;  4KIS A;  3NWS A;  2FU4 A;  1MSF C;  3GTM J;  3CMY A;  4LIT A;  2XAH A;  3I4M J;  4ZJZ A;  2GA2 A;  4EJU A;  1D1C A;  2E60 A;  3TMO A;  4PJN A;  3KP5 A;  4U88 A;  4KDP A;  3ONQ A;  1QHG A;  2VKH A;  1MBJ A;  1SD4 A;  4EQQ A;  4ZDO A;  5K5R A;  4X1E A;  2A61 A;  2H09 A;  4XK4 A;  5E17 F;  1TQP A;  2P0W A;  4LMY A;  2BVL A;  4Y3O A;  3HSR A;  2W7N A;  4D5F A;  3CJQ B;  2DT6 A;  1PUF B;  2FQ3 A;  1NTC A;  3FMR A;  3CF5 F;  5TGT A;  2FNA A;  1S7E A;  4IQJ A;  3SYT A;  5F0C A;  5KNL A;  1I1S A;  1JHH A;  2H94 A;  1F43 A;  1H9T A;  1B72 A;  3Q3S A;  1E3H A;  4BNC A;  4NBQ A;  2DT7 B;  3IWZ A;  3HKZ A;  1EKE A;  3UNG C;  2PMZ N;  5J40 A;  5EZG A;  3WOD F;  2EQR A;  1OLT A;  5ILV A;  3G3Z A;  5FLM J;  5K1Y A;  2IXS A;  3QPL A;  1WKM A;  1BIB A;  2CS3 A;  1LDK B;  2ISZ A;  4M3E A;  2ID3 A;  1XSX A;  1FSH A;  1LUJ B;  3OS0 A;  2STT A;  3VB2 A;  1K61 A;  3L1P A;  2DN0 A;  3K2A A;  4AWX B;  1UG2 A;  3K4J A;  1R5I D;  1OPC A;  2ZNZ A;  3HKZ N;  2VKD A;  2EFW A;  3HDD A;  2IRF G;  2WWY A;  5GPC A;  2QZ8 A;  1XC5 A;  2EFO A;  3W6V A;  2KIS A;  2NOG A;  2KKO A;  2PFB A;  1VQ9 I;  1E3O C;  1IZ1 A;  4XOR A;  5GTI C;  5ICG A;  2FJ1 A;  3DTK A;  1RET A;  3FXQ A;  1XX5 A;  3FM3 A;  4C2M J;  4AIJ A;  2ZB9 A;  5LD2 C;  3EUA A;  4XON A;  2CJJ A;  3CJR B;  1EJ9 A;  2QKM B;  4ZYD A;  1P4A A;  1Y56 A;  4CYC B;  4XM3 A;  1SAX A;  3FKJ A;  5B5E C;  5E3N A;  2OBP A;  1XGN A;  2X1D A;  3RCO A;  3TP3 A;  1FOX A;  3IWF A;  1S5L C;  3KYD B;  3DEE A;  2KZG A;  1K6Y A;  3AG2 H;  1WH5 A;  5IY5 H;  3HOW J;  4L9V A;  3KE2 A;  4Z2Y A;  1XGO A;  2MBF A;  2Y0S A;  1ULY A;  2OJE D;  3JTG A;  1JUM A;  1XMK A;  1LJ9 A;  2CUE A;  1SAU A;  3BT9 A;  1VZ0 A;  2VBZ A;  3DEU A;  1AWC A;  1WJE A;  2JVG A;  1IUF A;  1BI2 A;  2W00 A;  2FEZ A;  2XAU A;  4H0E A;  4MTE A;  1D5Y A;  3WG7 H;  1XCV A;  2M2E A;  3I9V 2;  4G6T B;  3BC8 A;  4M6Y A;  2Y48 A;  3PSI A;  2VBX A;  4AU7 A;  4PJM A;  4KA4 A;  4B3X A;  4UHT A;  1D1A A;  2ZC2 A;  1KQ0 A;  5J8C A;  5AIP A;  1FYL A;  1KYZ A;  2DMP A;  5BQT A;  3S3O A;  3ABL H;  1U6G A;  1K79 A;  2G9W A;  1HXD A;  1OMI A;  3JRG A;  4P96 A;  1GV2 A;  3VEP A;  3ZQH A;  3S1R J;  4ZYH A;  3P9I A;  5GTH C;  1HCR A;  4UUS A;  3G71 I;  1R1T A;  3FK6 A;  2BGC A;  3AL0 B;  2XDV A;  3LA3 A;  1K4T A;  1R9T J;  4ESF A;  4RDU A;  4LOC A;  3BJA A;  2Z3Y A;  3DCF A;  3SDB A;  4P5O A;  2Q0O A;  2KIF A;  1FIA A;  4RLF A;  2NVU B;  1ZQ3 P;  1E0E A;  1ZRE A;  1ZHF A;  3AG4 H;  2H6B A;  1BI0 A;  4XQF A;  2PJP A;  2VE9 A;  3K9T A;  4LLN A;  3OL4 A;  1VQK I;  1Y1W J;  1RUO A;  2XHK A;  1MBH A;  5EGO B;  1U8R A;  2HKO A;  4HBL A;  5FGM A;  3BG6 A;  3ZQQ A;  1YJW I;  1HKS A;  2EWN A;  4A3K J;  3H0G J;  5FKL A;  3ASN H;  3A01 B;  1MMG A;  1HDD C;  1UJ8 A;  3HUG A;  3QPS A;  1UG0 A;  1PYV A;  2HKX A;  2L7K A;  2KIU A;  3BDD A;  3CJT B;  3CMM A;  6PAX A;  1WI3 A;  4IHV A;  2IS6 A;  1MMA A;  1FLI A;  1ZRD A;  3LSH A;  1KZH A;  2PJR A;  1IDZ A;  2D5V A;  2O03 A;  5ERI A;  3MZH A;  4A5M A;  1XSD A;  4RAY A;  1U78 A;  2CQK A;  3GVA A;  4XMY A;  2LK2 A;  3U1K A;  2W25 A;  3HOU J;  2KIM A;  2COM A;  3GTP J;  3M3Y J;  1ZG5 A;  2LRD A;  1R1V A;  3KCC A;  4XKW A;  2DFI A;  1IV6 A;  1YLF A;  5FRO A;  5D5U B;  3IP4 B;  1H89 C;  4PJL A;  3B6C A;  1WGX A;  2DOE A;  3K10 A;  3K70 D;  3HRT A;  1Y0N A;  3ZMV A;  2OZ6 A;  4D9J A;  5GAH J;  3EYY A;  1WJB A;  2L7M P;  4M3D A;  4Q4Z F;  3Q0W A;  4L9T A;  3WG9 A;  4MQ9 F;  3CO6 C;  2E19 A;  5LFA A;  2E2H J;  3RYP A;  4ENK A;  1VQ7 I;  3K4N A;  3H3U A;  2VOO A;  5ICE A;  2BZT A;  2A69 F;  1X1B A;  3MCZ A;  1UAA A;  2R93 J;  2ZME B;  2M34 A;  4I09 A;  2RNJ A;  2HXO A;  1SVO A;  2DOA A;  4PDK A;  2VL8 A;  3LL7 A;  1J59 A;  5DCM B;  2VXZ A;  4F93 B;  3W6K B;  3HZJ A;  3BJ6 A;  3ZR8 X;  3F8M A;  3OYA A;  1RZ4 A;  2EIJ H;  4IRH A;  4OWR B;  3W3C A;  2D45 A;  1QHH D;  3I58 A;  2CQX A;  2VE8 A;  5DD4 A;  2KHM A;  3RPU A;  4BDZ A;  1EH7 A;  1MDM B;  4BY1 J;  1FYM A;  4KFC A;  3S2W A;  5L3E A;  1VND A;  3AG3 H;  2RDP A;  4FT8 A;  4S04 A;  1FY7 A;  5TJJ A;  1K7A A;  5A2Q Z;  1Y1V J;  4BQO A;  2IP2 A;  4IX7 A;  2L5Q A;  3BOQ A;  3I54 A;  4II3 A;  4QSH A;  2M30 A;  1PP8 F;  5LGU A;  4IHW A;  2IGN A;  4BYY A;  3VOE A;  2VLA A;  4I76 A;  3T1B A;  5LRR A;  3RKQ A;  4BBR J;  1JGG A;  2E1C A;  3RJP A;  5E1W A;  1WJC A;  3F0C A;  2FXA A;  2WY7 Q;  3ECH A;  1B6A A;  3F21 A;  2JA2 A;  4OIN F;  5FKK A;  5CVR A;  3LSJ A;  4CSW A;  2UZK A;  1MZB A;  4ZC3 A;  4HPQ A;  3FIS A;  1RPW A;  2F4I A;  4RM2 A;  3CCS I;  3K69 A;  2IVM A;  5GPA A;  2Z2S B;  5D5V B;  2OCE A;  4YG2 F;  2BW3 B;  3V8K A;  1ERD A;  2YUS A;  3JAM Z;  2ZCW A;  5H20 A;  1ODD A;  3GZ5 A;  1SFX A;  3BJO A;  4OAY A;  4ZYA A;  3ZRG A;  4XR6 A;  4EGZ A;  2A07 F;  1C0W A;  4EJT A;  4LG0 B;  4E7S A;  1N75 A;  5BPI A;  4GO1 A;  1WH7 A;  2VQG A;  1X4P A;  1X2M A;  2HQN A;  2HTJ A;  2HVS A;  2XRN A;  3HSE A;  5HLH A;  3LQQ A;  2NS0 A;  1JTY A;  1YTY A;  4CZZ A;  4PGG A;  3CCJ I;  1IRF A;  1D0X A;  1RR7 A;  1BR2 A;  4ESB A;  5FKM A;  2LF7 A;  2EPF A;  2RGV A;  3FK7 A;  2XB0 X;  4NUB A;  3VOD A;  2YU9 J;  3S3N A;  1EF4 A;  2ELK A;  3KZY A;  4UB6 C;  2W4S A;  3S2D J;  4YFX F;  3ZQF A;  1DGW Y;  3F6V A;  2IGM A;  2ZKZ A;  5HOD A;  2G7H A;  1IF1 A;  2FOW A;  2CQN A;  3E6D A;  3F8C A;  4CCO A;  1SFO J;  4N4N B;  1YHQ I;  4CHU A;  3WU2 C;  4WCG A;  4AM3 A;  2OF7 A;  3C18 A;  1XSV A;  1DUX C;  1TWH J;  4P9U A;  3CLQ A;  2JSP A;  5J1R A;  3AKZ A;  2JSC A;  3O2P E;  3DBH B;  1O3T A;  3LWF A;  2KP6 A;  4PJ0 C;  1P2F A;  4LG3 A;  3BCA A;  2PN6 A;  1D1B A;  1QQI A;  3H0D A;  2WBM A;  4WXD A;  1IG7 A;  2FE3 A;  1LDD A;  3GFJ A;  2RV8 A;  4XKV A;  3K6G A;  4L9N A;  3DEW A;  2L54 A;  5ED4 A;  3I59 A;  2OQG A;  1YW8 A;  2X1E A;  3OYD A;  1CF7 B;  2V1N A;  2PMZ A;  2GZW A;  5C4J J;  1K78 A;  3F22 A;  4HLY A;  5BOX A;  2X85 A;  3SJM A;  2RVC A;  3RSN A;  2BE5 F;  1VQ6 I;  1B59 A;  2W1O A;  3BR5 A;  3E5X A;  2B63 J;  4UVB A;  3VPR A;  1E17 A;  5H6R A;  3JAM K;  4ENN A;  3IH4 A;  2HZT A;  4MEX F;  4BGD A;  1I27 A;  3KP6 A;  4H4K C;  3NAR A;  4G6D A;  1G3Y A;  2LD5 A;  1GXQ A;  2A6E F;  4MTD A;  1MBK A;  3V8L A;  1QA6 A;  5J4V A;  3GUD A;  2STW A;  3ESW B;  1RR8 C;  4WX9 A;  4RB1 A;  2ZJP F;  1KA8 A;  2QVO A;  3WTT C;  2BY3 A;  4KIB A;  3BRO A;  2VOP A;  1UHM A;  5D6F A;  1R6R A;  4DJA A;  4O6J A;  4UXN A;  4IHS A;  4HF0 A;  3H1C A;  1EH8 A;  1IXC A;  2W84 A;  3M9A A;  5C3E J;  2VJI A;  2R0Q C;  1XGS A;  2IJL A;  1S6L A;  3CUQ A;  2R7W A;  3H3Z A;  1YIO A;  2V1X A;  1BR1 A;  2ZFW A;  4JX5 A;  4LFU A;  4RAF A;  3FWE A;  3OIO A;  1W0U A;  3RKW A;  1GVD A;  3KX2 A;  5E1X A;  2VAS A;  5EZH A;  5F1R A;  1Z1D A;  3DU5 A;  1EA3 A;  2K7L A;  5L3F A;  4DYC A;  3H5R A;  2E34 A;  1K4S A;  1OCO H;  1X2N A;  3SQN A;  5IYC J;  1SEU A;  2EZK A;  2XGC A;  5F64 A;  3MEX A;  2E1N A;  5HDG A;  5M5X J;  3R0J A;  5DM6 F;  5IP7 J;  3K4M A;  2E71 A;  3WTX C;  2O61 A;  1S7O A;  5LHG A;  4LLL A;  4B1R A;  2NS7 A;  1LNW A;  3VYU B;  1HW1 A;  2H8W A;  4A12 A;  1TWG J;  4IPA A;  2Y30 A;  3OYB A;  3H9G A;  3K1P A;  1W7P A;  3MD2 A;  1XGM A;  3ZMT A;  4ZYE A;  4LJZ F;  3R6S A;  1B8I B;  3BZK A;  2JN6 A;  3BTI A;  4U0V A;  2F5V A;  2CYY A;  2WY8 Q;  3C2H A;  3CCY A;  5DTD A;  1P92 A;  2E5Z A;  2DTZ A;  2XGD A;  1Y6I A;  1BI3 A;  4W97 A;  1AKH A;  1QZZ A;  3PNV A;  2XSD C;  2IS4 A;  1UCR A;  2CSO A;  2LKS A;  2LY2 A;  1QVT A;  4A5N A;  5LLQ A;  1I3Q J;  4CCN A;  4D7M A;  4J00 A;  2UWM A;  3HG9 A;  4KJZ A;  2NYX A;  4A3G J;  4L9J A;  3HOV J;  1ZK8 A;  2YS9 A;  2DLL A;  3ML6 A;  2XF7 A;  2A05 A;  1GVJ A;  1OKR A;  5DCF A;  3U9G A;  1TTY A;  3KP7 A;  1YFH A;  1NK2 P;  3OYL A;  4NNJ A;  1TC3 C;  3BR0 A;  1GXP A;  2BVM A;  2P5L C;  5CQE A;  3HHG A;  5F27 A;  4OMZ A;  2XC7 A;  1MBG A;  3C2B A;  4LG0 A;  1YS7 A;  4RAZ A;  2O8X A;  5CLS A;  5E3O A;  4HF1 A;  4ZTJ A;  2GAU A;  3DKX A;  2DK8 A;  3K4B A;  5B66 C;  3HOS A;  2QSF X;  2OQR A;  3ZMS A;  1YX5 A;  1IUY A;  2OUM A;  4K2E A;  3B02 A;  4WXC A;  3RQ4 A;  1QBJ A;  3LOC A;  1AKH B;  1BBY A;  3FXU A;  3MAJ A;  3E6B A;  2RNG A;  2DA6 A;  3CZ6 A;  3QP5 A;  3GFL A;  2R7T A;  1BIA A;  2ELJ A;  4IKF A;  1KYW A;  3FXJ A;  3NEU A;  4AID A;  1ZRC A;  2QYO A;  3MMY B;  5AIQ A;  3G4S I;  4ITV A;  2KDZ A;  4NDL A;  4JBA A;  4A3D J;  5JHU A;  1V5F A;  4RBO A;  2D2W A;  4XLE A;  4FE7 A;  4HLX A;  2N8G A;  1TL8 A;  1JKP C;  2HOT A;  3LFK A;  4WK8 F;  2NVQ J;  1JUS A;  1MNE A;  2OTL I;  2HOS A;  4HNT A;  2EZI A;  2DYS H;  4BL0 B;  3IL2 A;  1IW7 F;  4IJA A;  3DKY A;  1FMW A;  1NHA A;  3B73 A;  4UNO A;  3MVP A;  1YG2 A;  4QPO A;  2DCE A;  2IS1 A;  1UB9 A;  1A31 A;  4IF4 A;  3FDY A;  1GDT A;  2FF4 A;  3EET A;  1YIT I;  3G1O A;  5FRN A;  3LMM A;  2VON A;  1LVK A;  2DXI A;  3HOZ J;  2LY1 A;  3TW7 A;  2LC2 A;  3PUB A;  2PLY A;  2FA5 A;  2H1L A;  5J47 A;  1BW6 A;  1UHS A;  2DO7 A;  3M8J A;  3BCB A;  3KFW X;  4ZYG A;  1VF9 A;  2E1O A;  2Z5U A;  5FLX K;  2CU7 A;  3OMY A;  5KVR A;  1I50 J;  3I64 A;  4QLC U;  4M3F A;  1JKO C;  1LEB A;  2JPB A;  3J7Y J;  1D0Z A;  3SEQ A;  2K27 A;  2HXI A;  1O4X A;  1OR7 A;  5HS9 A;  3S14 J;  5D5W B;  1ZGJ A;  4CDG A;  3OYC A;  3RZO J;  2OZU A;  4GRI A;  2V1U A;  3VYS B;  1TWA J;  3FKI J;  4GCV A;  3WGH A;  2VXD A;  2XAF A;  4OOI A;  4HNV A;  2GXA A;  2QWW A;  4CYD A;  3CP2 A;  1EH6 A;  2E5N A;  3SDG A;  4FCY A;  3E6C C;  2GLO A;  2K02 A;  2JA5 J;  1U5T B;  2XAS A;  1DU6 A;  4HV6 A;  1V54 H;  3EPZ A;  4G6Q A;  1Y39 A;  1Q1H A;  3HPG A;  1LFB A;  4AC0 A;  2R5Y A;  1V5G A;  2VIX A;  3CDH A;  5J8F A;  1FTT A;  1FOK A;  3J7A O;  2DBB A;  3HIF A;  2HTS A;  1YS6 A;  3I4P A;  4UVC A;  1CQT A;  1X58 A;  3CC4 I;  2KLO A;  2R5Z B;  2EJR A;  1UST A;  4Y7N J;  2NRA C;  4HAM A;  4A2U A;  2L3D A;  2A5W A;  4MO7 A;  3ZMZ A;  3MZ8 A;  1O3S A;  2X6X A;  4CCL A;  3GTK J;  3TDU C;  1TWC J;  5LEK A;  5M3F J;  2K5C A;  3H35 A;  2XRO A;  2L9N A;  3RKX A;  3I3L A;  1TNS A;  3N97 A;  2JMW A;  2QBY B;  1WJF A;  1AHD P;  2XB5 A;  1Y8R B;  2WB1 A;  2PMU A;  4QPQ A;  1X3U A;  2BHY A;  4M73 A;  1RNL A;  3A2K A;  5HLI A;  2AQF A;  3FXR A;  2DDB A;  1FBQ A;  1OIS A;  1LPQ A;  2MA3 A;  1F36 A;  4I0B A;  5HLT A;  1FC3 A;  1U9O A;  5B3S H;  3BZ6 A;  3CP8 A;  5DD8 A;  1I1G A;  1OCZ H;  3D5R C;  3JRH A;  3PFI A;  2PI0 A;  2KRH A;  5LHH A;  5C4X J;  2V79 A;  5FKO A;  2HNH A;  3FBI B;  2LKX A;  2R5Z A;  4XN3 A;  1AOY A;  1IDY A;  4ABZ A;  3S1N J;  1ZH5 A;  2DA7 A;  1ZR4 A;  3CUQ C;  5E3M A;  3S93 A;  1ENH A;  3U2R A;  4LLG F;  3WTV C;  1RKW A;  4O5V A;  2PX9 A;  4AVP A;  2DT5 A;  2Z33 A;  2QM3 A;  4L5E A;  5CVU A;  2HWV A;  1BOB A;  3C1D A;  3QRF F;  4UVA A;  4X0G A;  4XRF A;  1FOY A;  3J80 Z;  5LGN A;  2QBY A;  4KIG A;  2AXT C;  4G8X A;  1Z9C A;  2HDC A;  2P6S A;  1R00 A;  5IT9 Z;  2DA1 A;  3FHN A;  1LB2 A;  2V6C A;  4ANJ A;  4M3B A;  1SD6 A;  1SFK A;  4FTH A;  3UKG A;  1VQN I;  3H9J A;  4M9Z A;  4QIW N;  1JJ8 C;  3KLN A;  1PVE A;  1ZKG A;  5EEG A;  1GHC A;  2GXB A;  3LNQ A;  2QLZ A;  3OOP A;  4W1U A;  1KGS A;  1IN6 A;  4FX0 A;  1I6H J;  2HQR A;  5CVJ A;  3LSM A;  4C30 A;  3KYC B;  2JT1 A;  1IAW A;  1Z3X A;  2QEX I;  2GBY A;  2P5K A;  4YIF A;  4JX4 A;  2NVY J;  2EIK H;  2B0L A;  4DOZ A;  2BY1 A;  2FMY A;  4S05 A;  3DFG A;  4KMF A;  4F7Z A;  1PDN C;  1BC8 C;  1UHW A;  2L9R A;  2DYR H;  3P9K A;  3ELK A;  4GXO A;  3QOE A;  3C3W A;  4DQ2 A;  5FLX Z;  2W57 A;  3WE3 A;  4BQQ A;  3BTL A;  4HNU A;  3RTR A;  1YQA A;  4KIT B;  4A93 J;  1B1B A;  4A3J J;  2LY9 A;  2DK5 A;  4ASN A;  1DPU A;  2LVS A;  1AA7 A;  5E1Z B;  3HXL A;  2ID6 A;  3H3V K;  1U5T C;  1FJL A;  2VJ5 A;  2X6Y A;  3CCL I;  4M71 A;  4RA2 A;  1TZL A;  1HKQ A;  4RGR A;  3I0T A;  3EQL F;  5F6F A;  3FXL A;  3JSO A;  2JQ7 A;  3T0Y A;  4U87 A;  2O8K A;  3CLO A;  3GW2 A;  3H9Q A;  4IO9 F;  2A5Y B;  4XBF A;  1H9G A;  1OFC X;  2V9P A;  2P6T A;  4P9F A;  2ELH A;  2RQQ A;  1O7L A;  1HW5 A;  3PM1 A;  1WWX A;  1HQC A;  4IRI A;  1MH4 A;  1JGS A;  3R0A A;  1Z67 A;  1SD7 A;  2MD0 A;  2HOE A;  2JUC A;  2EFN A;  1YRN A;  1B72 B;  2DW4 A;  3AFH A;  4I98 B;  1R7J A;  4G94 A;  4DBR A;  3F8B A;  3OYN A;  1P4X A;  2ZO4 A;  4XOT A;  4A69 C;  2MC4 A;  2BBY A;  3OSG A;  1KU9 A;  4A0Y A;  2QSH X;  4D0P A;  3M1E A;  4WWC A;  1B9M A;  5JFR A;  1MMS A;  3J81 K;  2CGP A;  1FP2 A;  3ABU A;  2FX0 A;  5KK1 A;  3K1N A;  1L3L A;  2XPU A;  3P9C A;  2WC2 A;  1ETQ A;  5E18 F;  1J0R A;  4M3G A;  2V26 A;  1SMY F;  3IH2 A;  1O3R A;  4LD5 A;  1IGN A;  2ZME C;  4N4O B;  4EM1 A;  4DZP A;  2MD5 A;  4JQF A;  5DYM A;  3I55 I;  1MND A;  3CF2 A;  4EV0 A;  5DDG A;  3HTU A;  1I5Z A;  3DTI A;  1LE8 A;  1HC8 A;  2EV5 A;  2HDD A;  5K5Q A;  1GLN A;  1RC9 A;  1U9N A;  2MH2 A;  3CCR I;  4M74 A;  1FTZ A;  3LA2 A;  4EAT A;  2CV0 A;  1QZE A;  1MDM A;  4DIQ A;  3DP7 A;  1T56 A;  3LST A;  1ZAO A;  3I71 A;  5F0H A;  1MH3 A;  3F72 A;  1JT0 A;  4IQ4 A;  1TT5 B;  4ENM A;  4IOC F;  3TW6 A;  3OYI A;  3FX3 A;  3LSI A;  5IT3 A;  5E8I A;  3HEF A;  4YEL A;  2Z9O A;  1ZN2 A;  3COA C;  1Z21 A;  3BR3 A;  4RS8 A;  5FKN A;  1VQ5 I;  2E36 A;  4BKX A;  4EEF G;  3OR2 C;  5EF6 A;  3HM5 A;  1YX3 A;  2O7O A;  1U0J A;  1I39 A;  2P81 A;  2DA2 A;  3DWL E;  1HF0 A;  4U0W A;  4C2U A;  1QU3 A;  1YYV A;  3NRV A;  1SVL A;  2DMT A;  5KHD A;  2ZXH A;  3OSF A;  1YI2 I;  2O3F A;  1HST A;  2DA3 A;  2DTR A;  1Z6R A;  1FOW A;  3PNY A;  4NC6 A;  2KPM A;  2Q1Z B;  3HRU A;  5IP9 J;  4N9I A;  2NOJ B;  4B48 A;  3DPU A;  5K7Z A;  4HDU A;  3AL0 C;  3TED A;  4HV5 A;  3GME A;  4B4C A;  1R4M B;  4PZJ A;  3WTZ A;  4KIF A;  2EIL H;  2R7Q A;  2QCO A;  2GWR A;  1ZG1 A;  3T8T A;  4M9X A;  3WHC A;  4OIQ F;  1IN4 A;  2DDA A;  1VTN C;  4LB6 B;  4E7Z A;  4DZJ A;  3K4K A;  1HOM A;  2CUJ A;  3PO2 J;  4IL6 C;  1Y0U A;  2FNP A;  1U3E M;  2ECC A;  3NQO A;  2L02 A;  2XF6 A;  5BNG A;  3GF2 A;  5DS9 A;  4Q5S F;  3PFY A;  5D8L B;  2HYF A;  4L5J A;  1R49 A;  1K83 J;  5H2F C;  3MKW B;  2WAD A;  1EV7 A;  3DBR B;  3P7N A;  3LA7 A;  3FHZ A;  4A3F J;  1DDN A;  1F5T A;  1A36 A;  2E1M C;  3GCM A;  4XNF A;  1WI9 A;  1F4K A;  3H5N A;  1W36 D;  2FUG 2;  2LRE A;  3GFM A;  1DGR M;  4MGR A;  1DU0 A;  1FX7 A;  3EUH A;  5BS6 A;  2K9N A;  2P8T A;  3VYR B;  3CMA I;  4BEH A;  2R3S A;  2HGC A;  3O8G A;  3TP0 A;  5JR3 A;  1P7I A;  2QSG X;  3ZQL A;  4XLA A;  2MLG A;  3VDX A;  3FZV A;  4CH7 A;  2JA6 J;  1GV5 A;  4JOM A;  3BG3 A;  2VPR A;  2ZSI B;  3HUG B;  1G3T A;  3QOD A;  2M9H A;  2EV0 A;  3RZD J;  1X1D A;  3K4L A;  3FM5 A;  1FIP A;  4G7H F;  1BN5 A;  2XVC A;  2Y0M A;  4RB3 C;  3L09 A;  5IPA A;  1Y8Q B;  5M3M J;  1OCR H;  1BL0 A;  1OCT C;  4HEA 2;  1OYW A;  3AAF A;  4FQG A;  1WJ5 A;  2RRE A;  3KZZ A;  2OD5 A;  1S3J A;  3BP8 A;  3M1C A;  4EGY A;  1HLV A;  3MWM A;  3MQ0 A;  2AQE A;  4LIU A;  3HOT A;  1HBX G;  2DFH A;  1T6S A;  1IN7 A;  1D0Y A;  3QWL A;  3GWZ A;  2M7A A;  2V7F A;  3Q9V A;  4E7H A;  2I10 A;  5JLW A;  1JHF A;  5E3L A;  3TGN A;  2V1D A;  3JCU C;  3MN2 A;  1W4M A;  1W1W E;  1U2W A;  3PUF A;  5M5W J;  3MKY B;  3GXO A;  1FBS A;  3VYT B;  4BQA A;  3WHB A;  2R7F A;  3TOB A;  4C3J J;  2Z16 A;  1KU2 A;  4LK1 F;  4R1H A;  1Z7U A;  4Q48 A;  2VUM J;  1W5T A;  1FWZ A;  2Y9Z A;  2RC4 A;  2QEN A;  2AXL A;  4CUG A;  4HW0 A;  2BY2 A;  4AD9 A;  2BOL A;  2KQR A;  4MEY F;  1QO0 D;  3S3M A;  2B7E A;  2DJI A;  5AON A;  4BE0 A;  1MJ9 A;  4V2G A;  1LKX A;  1TP4 A;  1IN8 A;  3FIW A;  4KT5 C;  4EJW A;  3BR2 A;  1ZGW A;  3WU1 B;  3L2R A;  2ZXI A;  1UFM A;  2MAB A;  2GM4 A;  5IOY A;  2NXN B;  5DUK A;  4ZDL A;  3ERM A;  2MW8 A;  2RQP A;  2CUZ A;  1FNN A;  3BTJ A;  3PQK A;  4DW6 A;  2TCT A;  2DI3 A;  4B44 A;  2XAJ A;  2G0E A;  4CCJ A;  2WAE A;  4G7O F;  1LEA A;  2DFE A;  3LFU A;  3E7L A;  4E7I A;  2JK3 A;  3RDI A;  2KFD A;  5CVV A;  3BZC A;  2QQ9 A;  3CTA A;  2IBD A;  4XRM A;  1Z77 A;  4U7D A;  3E6M A;  1ZG3 A;  2E7X A;  3A1Y A;  2F4M B;  3ZN1 A;  4FX4 A;  4E7J A;  1MMD A;  2F6C A;  2CV2 A;  1OQY A;  4CGZ A;  2MG4 A;  3OOU A;  4BXU A;  2I8D A;  2LH9 A;  4O3M A;  3QPT A;  1J7K A;  5BPD A;  2O6G E;  1RKT A;  2DMN A;  3M8E A;  2ESN A;  3I5U A;  1TLH B;  4D1Q A;  1T08 B;  3HJE A;  3JRF A;  1NG6 A;  3CJN A;  1MD0 A;  2E2J J;  1R5H A;  4NQW B;  2R7Z J;  2M87 A;  2VT2 A;  4PFO A;  5M5Y J;  5L3G A;  2JA7 J;  1IC8 A;  2V6E A;  1W7P B;  4F3Q A;  3RPU D;  4LIV A;  3BG5 A;  4BJ5 C;  3BPX A;  2Q8K A;  1TQM A;  2MLK A;  1S72 I;  4NC7 A;  1IRG A;  1T98 A;  3O6B B;  4RMN A;  4G12 A;  1D8K A;  3A0B C;  3TO9 A;  3QYF A;  3BQZ A;  2X48 A;  5JI6 A;  4CIC A;  3OYJ A;  1OCC H;  2CUF A;  2FBI A;  1NK3 P;  2EIN H;  1OYY A;  5F04 A;  4XRS G;  5HDK A;  2HQ5 A;  4A3E J;  3CME I;  3K1M A;  1B4A A;  3BLY A;  2BY0 A;  3PIO F;  2E2I J;  4UUS B;  2Q2E A;  1W5S A;  5KCM A;  3OWT A;  3X2Q H;  2MH9 A;  2VKV A;  3ZN0 A;  2DMQ A;  2M8G X;  2IAI A;  4BXF A;  5CPR B;  3W2W A;  2X6W A;  3CCE I;  2ETH A;  3A02 A;  5HVQ C;  1QNT A;  3DF8 A;  2J5P A;  1S7A A;  3D1N I;  4E70 A;  4YRV A;  3DLL F;  2R7D A;  4OU0 A;  2ESH A;  2M5W A;  4UUT A;  3V7R A;  3G1L A;  4CZC A;  3TO7 A;  1JUP A;  1SFE A;  4Q47 A;  4IRG A;  2XUB A;  2K4B A;  2HVR A;  1PUF A;  1V3F A;  1M1E B;  2L2O A;  4Z6Y A;  2XGE A;  2QA4 I;  3ASO H;  4A3C J;  4B3A A;  5J1U A;  3P5J A;  1WFX A;  2FML A;  2HYJ A;  1XG1 A;  4HST A;  2VJJ A;  5CYV A;  1ORK A;  1QVU A;  2CQ7 A;  1TBX A;  3Q0U A;  3CES A;  3I59 B;  4IVN A;  4F52 A;  1X3W B;  2LLK A;  4P1W A;  2HQA A;  4KNY A;  2LDU A;  2W48 A;  5HDN A;  3FF5 A;  2IT0 A;  4MFE A;  1BOA A;  4BHB A;  1RIO H;  1SVM A;  1TWF J;  4I0A A;  1R23 A;  3LAJ A;  3DQV C;  1YW7 A;  2HVQ A;  1USS A;  3O3K A;  4D7N A;  1ETX A;  3OL3 A;  1FT9 A;  2AO9 A;  1R36 A;  3S15 J;  1DPR A;  3Q5F A;  3RPQ A;  1N77 A;  1V4R A;  3OS1 A;  2L01 A;  1JE8 A;  3ZPL A;  3L2C A;  3K2Z A;  2JWT A;  3IRQ A;  4GDF A;  2ZSH B;  3IH3 A;  1FYK A;  2XAQ A;  5E20 A;  3M8F A;  2XIG A;  2VC1 A;  3HSF A;  1X19 A;  2LTP A;  2JVH A;  4E7K A;  5IT9 K;  1J9I A;  4CA0 A;  1V5E A;  2JPC A;  5TIS C;  2MSY A;  1GT0 C;  2WAQ A;  4CCK A;  3ULQ B;  3K70 C;  4FIS A;  1SD5 A;  3F23 A;  4M9S A;  3TDZ C;  2Y69 H;  4NB5 A;  4PSW A;  1VQL I;  3VSL A;  2HI3 A;  4C2T A;  4DYQ A;  3H36 A;  1V55 H;  1B9N A;  4PSX A;  4XKB A;  5EEA A;  5IYD J;  5KAI C;  4CO8 A;  1G3W A;  2YU3 A;  3CCQ I;  3SZT A;  3DXJ F;  1QGP A;  4C3I J;  1JJ6 C;  3DBL B;  2FOK A;  2R7V A;  1BJA A;  1ONV A;  1WSU A;  2UV1 A;  1QPM A;  4XLC A;  1H88 C;  1WZ2 A;  1MJB A;  5E79 C;  3CCM I;  2KDO A;  5F0F A;  3G2B A;  4AIH A;  2P7C B;  4KYW A;  1LDJ A;  2HS5 A;  2OPT A;  1X1A A;  2CV1 A;  1T33 A;  2BYV E;  3F8F A;  4I2O A;  1O57 A;  3QAH A;  2VBY A;  4GYG A;  4PFP A;  5FD5 A;  2LFB A;  2QKL B;  1ZYR F;  5HOO A;  1YE9 A;  3I56 I;  2AHQ A;  3L2Q A;  4XLN F;  2PBI A;  2CH0 A;  1XDS A;  2CW8 A;  2KRC A;  4J19 A;  4MFD A;  3RQI A;  4MHG A;  2BW3 A;  1YOV B;  1YJN I;  2D1H A;  1KU7 A;  3GLL A;  2IA0 A;  3HC7 A;  1B8I A;  3B6A A;  2EB7 A;  5F08 A;  2BV6 A;  3PO3 J;  1WVR A;  1ITY A;  2P5V A;  3F6O A;  2K9S A;  5LBQ A;  1BC7 C;  2DAO A;  2L9V A;  1P4W A;  1VQO I;  2K3P A;  5EEH A;  1G3S A;  2EFP A;  2F48 A;  1R1U A;  3BY6 A;  1WJD A;  2VKE A;  4V2F A;  2WV1 A;  2R7O A;  4A0X A;  2IA2 A;  2PQ8 A;  3CUO A;  3JRI A;  2E7W A;  4Y15 A;  1K6O A;  3MZY A;  2ZJ2 A;  1IV8 A;  2IEK A;  2A6T A;  2HDW A;  1X4O A;  2LG4 A;  1ETK A;  5LGT A;  3QYB A;  2R7R A;  2FD5 A;  1XN7 A;  3FMS A;  2R4G A;  2M0C A;  4A0Z A;  2JTV A;  3M07 A;  3NAU A;  4XKC A;  2ADU A;  4E6K G;  2OV7 A;  5FD6 A;  3Q0V A;  2AS5 F;  5EGO A;  3FXM A;  2VOD A;  2YPR A;  1FZP B;  3I4N J;  1G2H A;  1J5Y A;  3J7Z I;  1JI8 A;  2ACJ A;  1STZ A;  2IPQ X;  1FP1 D;  4J01 A;  2EZH A;  3GTL J;  2MFZ A;  2DFF A;  5HLG A;  4A3L J;  1IN5 A;  2GA1 A;  1VI0 A;  4N0B A;  5EYR A;  3IRR A;  5IYB J;  4LGW A;  5IP6 A;  2GIZ A;  2L4A A;  3VWB A;  5D8K B;  3S1M J;  2GIV A;  3VFZ A;  1WQ2 A;  3BQY A;  1KU3 A;  3WTS C;  4DBQ A;  4OIO F;  2O9L A;  1LQ1 A;  5J6X A;  3WTU C;  1O3Q A;  2R7U A;  4BHC A;  5EG0 B;  3OYE A;  4L5I A;  1MIJ A;  4S0H B;  5LEJ A;  3S2H J;  4C9Y A;  2M4K A;  3IC7 A;  1CF7 A;  1S29 A;  1WPK A;  2H6C A;  3G1M A;  2ZJR F;  3SHF A;  3TKY A;  4A3I J;  4KN4 X;  3HRM A;  4IXA A;  4BS9 A;  2CW7 A;  1H8A C;  2EA4 A;  4HX7 A;  3SZP A;  2FSW A;  2KJC A;  4BJT A;  4D5C A;  4KMU X;  4FAS D;  4RB2 C;  3OYM A;  4WXH A;  4KIC A;  4RB0 A;  5HS7 A;  4BE1 A;  2XRL A;  4XOP A;  4FHT A;  3UR3 C;  1XPX A;  3OS2 A;  4LK0 F;  5GAG J;  1XD7 A;  4A3B J;  2VQL A;  1DQU A;  3R61 A;  4JP0 A;  1XCB A;  4I02 A;  3JRB A;  4II2 A;  4R8H A;  3ZMU A;  3CC7 I;  3V42 A;  4UV8 A;  3WTW C;  1ZR2 A;  2QUF A;  4UUV A;  1ETO A;  1Z6T A;  1FBU A;  2CW0 F;  4HG2 A;  3FBN B;  1OYI A;  4UY8 I;  5H6Q A;  5FFX A;  2L7F P;  4B47 A;  1YRN B;  2HU9 A;  5HNF A;  3F3X A;  2BXZ A;  4HX4 A;  2O0Y A;  2ICW G;  5L3D A;  1JT6 A;  3SZG A;  3U1D A;  3BG9 A;  3MKL A;  4HX8 A;  3ZXS A;  1BI1 A;  3TL4 X;  4Y52 J;  5BMZ A;  3HBL A;  3KZI C;  1AU7 A;  4XSX F;  2LNB A;  2RN7 A;  3S8P A;  2L0K A;  3OIP A;  3ZQ7 A;  5ICC A;  4CYC A;  1U5T A;  2EK5 A;  3LSG A;  2L9S A;  1JKR C;  4EJO A;  4IHT A;  3HOY J;  1WRJ A;  4BY7 J;  1MJA A;  2ZFU A;  1TW3 A;  4XN0 A;  2R5Y B;  1YJ9 I;  2K9M A;  4I01 A;  1WCM J;  2X9D A;  4JYK A;  4NHJ A;  3M4O J;  2HR3 A;  5B1B H;  2CG4 A;  3L9F A;  2NVT J;  1W7P D;  2GOM A;  1MBF A;  4HYE A;  1ON1 A;  2OU2 A;  4I99 C;  2PG4 A;  2X1C A;  2V9V A;  3GO5 A;  1XMX A;  3EDP A;  2DQR A;  3JSP A;  1T0F A;  1SMT A;  3J81 Z;  2X51 A;  3KP4 A;  2GOX B;  3N05 A;  1T39 A;  2PEX A;  3ROU A;  4XLP F;  3OY9 A;  2KL4 A;  3U21 A;  2W24 A;  1BR4 A;  2M4G A;  3DPT A;  1HW2 A;  3GTQ J;  3KYL A;  4M6X A;  2XPV A;  5DUI A;  4C3H J;  1SFU A;  2BHZ A;  3H5A A;  2ZJQ F;  1HSJ A;  3Q9S A;  3BWG A;  2V4J C;  2QGU A;  2H1K A;  4BH9 A;  5FRM A;  1S8N A;  2FQ4 A;  1R5G A;  2XF5 A;  3C7J A;  1JKQ C;  2WA0 A;  2HEO A;  2CRG A;  1J2X A;  4BAC A;  1VQ4 I;  3J7A Y;  1HDP A;  1FSE A;  2K86 A;  2M45 A;  2K4J A;  5DEQ A;  2LP0 A;  5D5X B;  3L7W A;  2WB1 N;  3IKT A;  1G4D A;  3GTG J;  1XDU A;  1PUE E;  3DKW A;  4LB5 A;  1TW2 A;  2K9L A;  1HA8 A;  3HHH A;  4E7L A;  2K85 A;  3KP2 A;  2LYC A;  3GEZ A;  2NVX J;  4BDY A;  3HPH A;  3DU6 A;  3QYE A;  1X1C A;  3EUK L;  3QOP A;  2ZNY A;  1DP7 P;  1KQ8 A;  3CDI A;  3A01 A;  2VI6 A;  4ZZD A;  4Y13 A;  4MQV A;  3WE2 A;  2XGX A;  3D5L A;  1MSE C;  3WU0 A;  3V7S A;  3EUH C;  2EBI A;  2XKO A;  4HDV A;  3D0S A;  3ERE D;  3PJR A;  1W36 C;  1N78 A;  1NG7 A;  4A3M J;  3BPV A;  5FFZ A;  2CO5 A;  2ISY A;  3AG1 H;  3E0J B;  2E35 A;  4I7H A;  3LSR A;  3L2V A;  4PK4 A;  1Q1V A;  3CC2 I;  3JRE A;  3RIR A;  2PJR B;  1OR7 C;  2CQQ A;  4OIR F;  3JR9 A;  4BU2 A;  3ZP5 A;  5K5O A;  1VFC A;  2HZD A;  2B9S A;  1RRJ A;  1O7F A;  2YX4 A;  1ZRF A;  2F5F A;  5GAD J;  1FMV A;  2NAZ A;  3RKY A;  3G73 A;  1CGP A;  4R79 A;  4BUP A;  2O5R A;  2WAQ N;  1LVA A;  4ENJ A;  5B1A H;  2KZV A;  4OIP F;  4X6A J;  4F91 B;  3JRD A;  1QZY A;  4YFK F;  2HPI A;  4AUX A;  3D5S C;  3S32 A;  5F1J A;  5J1Y A;  1OJL A;  4ETS A;  3J80 K;  3HOX J;  4ESJ A;  4YEJ A;  4IHX A;  2ZXW H;  3KEQ A;  2TRT A;  1T8I A;  3MFK A;  4RGS A;  3REO A;  5CVI A;  4EMS A;  2VJ4 A;  4RGU A;  4A6D A;  2VC0 A;  3TOA A;  3K4C A;  4G7Z F;  4L18 B;  1NH3 A;  4AYB N;  5EDN A;  2WV0 A;  2VBW A;  4ZH4 F;  2EFQ A;  3WGG A;  3JRA A;  3QPH A;  1MNM C;  3SFZ A;  4FE4 A;  4EJV A;  2DJN A;  3CUQ B;  3EYI A;  5DCM A;  2L4M A;  1XTA A;  3ZQG A;  4I6Z A;  1ETW A;  3GZ6 A;  3CCV I;  3S1Q J;  2QQ8 A;  1DP3 A;  4YIR X;  3W2A A;  1UMQ A;  3H92 A;  5DM7 F;  2CWE A;  1IXS B;  1TQI A;  2QQA A;  4RAG A;  3PIP F;  3GLX A;  2WTE A;  3TBI A;  4DNC A;  4PUS A;  2F5C A;  2R7X A;  5JVT A;  1YO5 C;  4U7B A;  2YR2 A;  3OR1 C;  2RKH A;  5L3C A;  5LRS A;  4PGH A;  4XSZ F;  5TRD A;  3A4C A;  3CCU I;  3T8R A;  1T95 A;  1J75 A;  3IAS 2;  3KLO A;  2DQL A;  3N4M A;  4M72 A;  1BJZ A;  2M1B A;  3RI4 A;  2TDX A;  2RAE A;  1IRX A;  2W82 A;  2XKP A;  3KP3 A;  1H0M A;  1YW9 A;  1REP C;  2KJB A;  2EIM H;  4M6V A;  4GGG A;  4A6E A;  2G7U A;  2ZXJ A;  4DYR A;  1I3A A;  3GFI A;  3ISP A;  1Z7L A;  2YSR A;  1JTX A;  1WJA A;  2R92 J;  3V7C A;  5HNH A;  4L0Z B;  4AYB A;  3W2V A;  3TO6 A;  4UB8 C;  3WTY C;  4IOA F;  3LSP A;  3C2G A;  3IKV A;  2QQB A;  4CCM A;  4MLO A;  1RI7 A;  5D6E A;  4XLH A;  1QRY A;  1G6N A;  2YX7 A;  3HRS A;  3K0L A;  1UEL B;  5CQG A;  2KMU A;  5HS8 A;  1ZLJ A;  5EJC A;  3LQR A;  3GYH X;  3CO7 C;  1Z0X A;  3DV8 A;  1E3P A;  3CDL A;  2Y0S N;  3T5X A;  2GQQ A;  4QTR A;  3ZOB A;  4ZZL A;  2IGO A;  2LSO A;  2LKP A;  3OYK A;  4NQW A;  5CJ9 A;  2ME0 A;  1L0O C;  4U0Y A;  2D1V A;  3PNT A;  3NWT A;  2H8R A;  4V19 K;  1MGT A;  3V4G A;  2QF7 A;  1BW5 A;  1SAN A;  5JHF A;  1P7J A;  4E4H A;  2LF8 A;  2JRT A;  2M0M A;  2JA8 J;  2FRH A;  3E97 A;  2HYG D;  2M8E A;  2NNN A;  4JX6 A;  2IA1 A;  4CXF A;  3I53 A;  3QP6 A;  3ZMD A;  2DPU A;  2A68 F;  4B09 A;  2K9Q A;  1P9Q C;  2NS8 A;  4XL9 A;  4F92 B;  3HYI A;  3ABT A;  2VN2 A;  2KRF A;  1PP7 U;  3IAM 2;  4KN7 X;  5FO5 A;  4BHP A;  2COB A;  2A3S A;  2DA4 A;  4BXX J;  1ZTR A;  4XLF A; 
#chains in the Genus database with same CATH homology
 4UV9 A;  4HQM A;  2MC3 A;  2H27 A;  2Y75 A;  4G9Y A;  1RUN A;  4OMY A;  3E5Q A;  2EA2 A;  4L0Y B;  2F5D A;  5LHI A;  1K78 B;  1P6R A;  2DPD A;  3RYR A;  4ON0 A;  1A04 A;  1TNT A;  4AIK A;  3IHU A;  2X4H A;  3QU3 A;  1JXS A;  1Z05 A;  2UXN A;  2PMH A;  1KQ9 A;  4MNU A;  2EV6 A;  4HOB A;  3JTH A;  3DPL C;  1ZLK A;  4HF2 A;  2A6H F;  2W85 A;  2ZME A;  1IXR C;  4EM0 B;  1HKT A;  2P7V B;  2ZBK A;  5ILS A;  2GXG A;  4RGX A;  2OAZ A;  4GYI A;  3L00 A;  4PCQ A;  4N9H A;  4BAY A;  3F8N A;  4EM2 A;  5A2Q K;  3V8J A;  1F9N A;  2FBH A;  3PQJ A;  2IW5 A;  4WF2 A;  1Z91 A;  2OA4 A;  2XV4 S;  1ON2 A;  5ILU A;  2NNY A;  3TQN A;  3M7G A;  1I6X A;  3WGI A;  4JK1 X;  1ZGA A;  1R58 A;  3JW4 A;  2CFX A;  3R4K A;  2JZY A;  3HTS B;  5E8G A;  1E2X A;  4HQE A;  2X0L A;  4Y17 A;  5ICF A;  3GX4 X;  2HFH A;  2UXX A;  3W6J B;  3ECO A;  5D4R A;  1MKM A;  4HA8 A;  1T38 A;  3LAP A;  1F1Z A;  3E3V A;  4KNY A;  3R60 A;  4HZF A;  4YII A;  5DV5 A;  1ZAR A;  1D3Y A;  2J5O A;  1T2K A;  4KUM A;  2F5E A;  2C6Y A;  3SXY A;  5D4S A;  1D5V A;  3E5U A;  4YFN F;  2P4W A;  2FBK A;  1XMA A;  3FMQ A;  2Z99 A;  2F2E A;  3QU6 A;  2DU9 A;  4TV7 A;  5L3B A;  5FB2 A;  4P55 A;  3KEO A;  1D8J A;  4B8X A;  3OV8 A;  1R22 A;  2BEO A;  4QWQ A;  1FPQ A;  1XB4 A;  2XAG A;  1BM9 A;  4EVI A;  2VT3 A;  3KET A;  2FU4 A;  2XAH A;  2GA2 A;  4EJU A;  3KP5 A;  4U88 A;  4KDP A;  1SD4 A;  4EQQ A;  5K5R A;  2A61 A;  2H09 A;  5E17 F;  1TQP A;  4LMY A;  3HSR A;  2FQ3 A;  3FMR A;  2FNA A;  1I1S A;  1JHH A;  2H94 A;  1H9T A;  4BNC A;  3IWZ A;  3WOD F;  5ILV A;  3G3Z A;  5K1Y A;  1WKM A;  1BIB A;  2ISZ A;  1LDK B;  1XSX A;  1FSH A;  2STT A;  3VB2 A;  4AWX B;  1OPC A;  2ZNZ A;  2EFW A;  2IRF G;  2WWY A;  2QZ8 A;  2EFO A;  2KKO A;  2PFB A;  1IZ1 A;  5ICG A;  3FXQ A;  3FM3 A;  4AIJ A;  4ZYD A;  1P4A A;  1SAX A;  2OBP A;  1XGN A;  3IWF A;  4L9V A;  3KE2 A;  4Z2Y A;  1XGO A;  2MBF A;  1ULY A;  3JTG A;  1XMK A;  1LJ9 A;  2VBZ A;  3DEU A;  1AWC A;  1BI2 A;  2FEZ A;  4H0E A;  4MTE A;  1XCV A;  4M6Y A;  2Y48 A;  2VBX A;  4KA4 A;  4UHT A;  1KQ0 A;  5J8C A;  5AIP A;  1FYL A;  1KYZ A;  5BQT A;  1U6G A;  1K79 A;  2G9W A;  1HXD A;  1OMI A;  4P96 A;  3VEP A;  4ZYH A;  3P9I A;  1R1T A;  2BGC A;  3LA3 A;  4ESF A;  3BJA A;  2Z3Y A;  4P5O A;  2Q0O A;  2KIF A;  1ZRE A;  1ZHF A;  2H6B A;  1BI0 A;  2PJP A;  2VE9 A;  3K9T A;  4LLN A;  1RUO A;  2XHK A;  1U8R A;  2HKO A;  4HBL A;  5FGM A;  1HKS A;  2EWN A;  3HUG A;  2HKX A;  2KIU A;  3BDD A;  6PAX A;  1FLI A;  1ZRD A;  2O03 A;  5ERI A;  3MZH A;  4A5M A;  1XSD A;  4RAY A;  1U78 A;  2CQK A;  3GVA A;  2W25 A;  2KIM A;  2COM A;  1ZG5 A;  1R1V A;  3KCC A;  2DFI A;  1YLF A;  5D5U B;  3HRT A;  3ZMV A;  2OZ6 A;  3EYY A;  4Q4Z F;  4L9T A;  3WG9 A;  4MQ9 F;  3CO6 C;  3RYP A;  4ENK A;  3H3U A;  2VOO A;  5ICE A;  2A69 F;  3MCZ A;  2ZME B;  4I09 A;  2RNJ A;  4PDK A;  1J59 A;  5DCM B;  2VXZ A;  3W6K B;  3BJ6 A;  3F8M A;  1RZ4 A;  4IRH A;  2D45 A;  3I58 A;  2VE8 A;  5DD4 A;  3RPU A;  1EH7 A;  1MDM B;  1FYM A;  4KFC A;  3S2W A;  5L3E A;  2RDP A;  4FT8 A;  4S04 A;  1FY7 A;  5TJJ A;  1K7A A;  5A2Q Z;  2IP2 A;  3BOQ A;  3I54 A;  2M30 A;  1PP8 F;  5LGU A;  4BYY A;  3VOE A;  3T1B A;  5LRR A;  2E1C A;  3RJP A;  5E1W A;  2FXA A;  3ECH A;  1B6A A;  3F21 A;  4OIN F;  5CVR A;  2UZK A;  1MZB A;  3K69 A;  2IVM A;  5D5V B;  4YG2 F;  3V8K A;  3JAM Z;  2ZCW A;  5H20 A;  1ODD A;  3GZ5 A;  1SFX A;  3BJO A;  4EGZ A;  2A07 F;  4EJT A;  1C0W A;  4LG0 B;  5BPI A;  4GO1 A;  2HTJ A;  2HQN A;  2XRN A;  3HSE A;  5HLH A;  3LQQ A;  2NS0 A;  1YTY A;  4CZZ A;  4PGG A;  1IRF A;  4ESB A;  2LF7 A;  2RGV A;  3VOD A;  3KZY A;  4YFX F;  3F6V A;  2ZKZ A;  2G7H A;  1IF1 A;  3E6D A;  3F8C A;  4CHU A;  4WCG A;  3C18 A;  1XSV A;  1DUX C;  4P9U A;  2JSC A;  3O2P E;  1O3T A;  3LWF A;  1P2F A;  2PN6 A;  1QQI A;  4WXD A;  2FE3 A;  1LDD A;  3GFJ A;  2RV8 A;  4L9N A;  2L54 A;  5ED4 A;  3I59 A;  2OQG A;  1YW8 A;  1CF7 B;  2GZW A;  1K78 A;  3F22 A;  4HLY A;  5BOX A;  2RVC A;  2BE5 F;  1B59 A;  3E5X A;  4UVB A;  1E17 A;  5H6R A;  4ENN A;  3JAM K;  2HZT A;  4MEX F;  1I27 A;  3KP6 A;  4G6D A;  1G3Y A;  1GXQ A;  2A6E F;  4MTD A;  3V8L A;  3GUD A;  2STW A;  4WX9 A;  4RB1 A;  1KA8 A;  2QVO A;  3WTT C;  4KIB A;  3BRO A;  2VOP A;  1UHM A;  5D6F A;  4O6J A;  4UXN A;  4IHS A;  4HF0 A;  1EH8 A;  1IXC A;  2W84 A;  3M9A A;  1XGS A;  2IJL A;  1S6L A;  3CUQ A;  3H3Z A;  1YIO A;  2V1X A;  2ZFW A;  4LFU A;  3FWE A;  3RKW A;  5E1X A;  5F1R A;  1Z1D A;  2K7L A;  5L3F A;  3SQN A;  5F64 A;  3MEX A;  2E1N A;  5HDG A;  3R0J A;  3WTX C;  2O61 A;  1S7O A;  5LHG A;  4LLL A;  1LNW A;  1HW1 A;  4A12 A;  4IPA A;  3K1P A;  1W7P A;  3ZMT A;  1XGM A;  4ZYE A;  4LJZ F;  3R6S A;  4U0V A;  2CYY A;  1P92 A;  1BI3 A;  1QZZ A;  1UCR A;  2CSO A;  4A5N A;  5LLQ A;  2UWM A;  2NYX A;  4L9J A;  2DLL A;  3ML6 A;  1GVJ A;  1OKR A;  5DCF A;  3U9G A;  1TTY A;  3KP7 A;  1YFH A;  1GXP A;  2P5L C;  3HHG A;  4OMZ A;  4LG0 A;  1YS7 A;  4RAZ A;  2O8X A;  5CLS A;  4HF1 A;  2GAU A;  2DK8 A;  3HOS A;  2OQR A;  3ZMS A;  1IUY A;  4K2E A;  3B02 A;  4WXC A;  1QBJ A;  1BBY A;  3FXU A;  3MAJ A;  3E6B A;  3QP5 A;  3GFL A;  1BIA A;  1KYW A;  3NEU A;  1ZRC A;  2QYO A;  5AIQ A;  4JBA A;  5JHU A;  2D2W A;  4HLX A;  3LFK A;  4WK8 F;  3IL2 A;  1IW7 F;  4IJA A;  1NHA A;  3B73 A;  4UNO A;  1YG2 A;  1UB9 A;  4IF4 A;  2FF4 A;  3EET A;  2VON A;  2PLY A;  2FA5 A;  2DO7 A;  4ZYG A;  3KFW X;  2Z5U A;  5FLX K;  5KVR A;  4QLC U;  3I64 A;  1LEB A;  2JPB A;  2K27 A;  1OR7 A;  5HS9 A;  5D5W B;  1ZGJ A;  4CDG A;  2OZU A;  2V1U A;  4GCV A;  3WGH A;  2XAF A;  4OOI A;  2QWW A;  4CYD A;  1EH6 A;  3E6C C;  2K02 A;  1U5T B;  2XAS A;  4HV6 A;  4G6Q A;  1Q1H A;  3CDH A;  5J8F A;  1FOK A;  3J7A O;  2DBB A;  3HIF A;  2HTS A;  1YS6 A;  3I4P A;  4UVC A;  2EJR A;  1UST A;  2NRA C;  4HAM A;  4A2U A;  2L3D A;  3ZMZ A;  1O3S A;  3TDU C;  5LEK A;  2XRO A;  3RKX A;  1TNS A;  3N97 A;  2QBY B;  2PMU A;  1X3U A;  4M73 A;  1RNL A;  5HLI A;  3FXR A;  1FBQ A;  2MA3 A;  4I0B A;  1FC3 A;  3BZ6 A;  5DD8 A;  1I1G A;  3PFI A;  2PI0 A;  5LHH A;  2V79 A;  1AOY A;  1ZH5 A;  3CUQ C;  3U2R A;  4LLG F;  3WTV C;  4O5V A;  4AVP A;  2DT5 A;  2Z33 A;  2QM3 A;  5CVU A;  2HWV A;  3C1D A;  3QRF F;  4UVA A;  4XRF A;  3J80 Z;  5LGN A;  2QBY A;  4KIG A;  4G8X A;  1Z9C A;  2HDC A;  2P6S A;  1R00 A;  5IT9 Z;  1LB2 A;  2V6C A;  1SD6 A;  4M9Z A;  3KLN A;  5EEG A;  1GHC A;  2GXB A;  2QLZ A;  3OOP A;  1KGS A;  1IN6 A;  4FX0 A;  2HQR A;  5CVJ A;  2JT1 A;  1IAW A;  2P5K A;  4YIF A;  2B0L A;  2FMY A;  4S05 A;  3DFG A;  4KMF A;  4F7Z A;  1PDN C;  1BC8 C;  1UHW A;  3P9K A;  3ELK A;  4GXO A;  4DQ2 A;  3C3W A;  5FLX Z;  2W57 A;  3WE3 A;  3RTR A;  1YQA A;  1B1B A;  2DK5 A;  4ASN A;  1DPU A;  5E1Z B;  1U5T C;  4M71 A;  1HKQ A;  4RGR A;  3I0T A;  3EQL F;  5F6F A;  3JSO A;  3T0Y A;  3CLO A;  3GW2 A;  2A5Y B;  4XBF A;  1H9G A;  2P6T A;  4P9F A;  2ELH A;  1O7L A;  1HW5 A;  1WWX A;  1HQC A;  4IRI A;  1JGS A;  3R0A A;  1SD7 A;  2HOE A;  2EFN A;  2DW4 A;  4I98 B;  1R7J A;  4G94 A;  3F8B A;  1P4X A;  2ZO4 A;  2BBY A;  1KU9 A;  4A0Y A;  4D0P A;  3M1E A;  4WWC A;  1B9M A;  5JFR A;  3J81 K;  2CGP A;  1FP2 A;  3ABU A;  5KK1 A;  3K1N A;  1L3L A;  3P9C A;  2WC2 A;  5E18 F;  1J0R A;  1SMY F;  1O3R A;  4LD5 A;  4EM1 A;  2MD5 A;  4JQF A;  5DYM A;  4EV0 A;  5DDG A;  3HTU A;  1I5Z A;  2EV5 A;  5K5Q A;  2MH2 A;  4M74 A;  3LA2 A;  1MDM A;  3DP7 A;  3LST A;  1ZAO A;  3I71 A;  3F72 A;  4ENM A;  3FX3 A;  5IT3 A;  5E8I A;  2Z9O A;  1ZN2 A;  3COA C;  4RS8 A;  4U0W A;  1YYV A;  3NRV A;  2O3F A;  1HST A;  2DTR A;  1Z6R A;  3HRU A;  4N9I A;  4HDU A;  4HV5 A;  4PZJ A;  3WTZ A;  4KIF A;  2GWR A;  1ZG1 A;  3T8T A;  4M9X A;  4OIQ F;  1IN4 A;  1VTN C;  4LB6 B;  1Y0U A;  2FNP A;  1U3E M;  3NQO A;  2L02 A;  3GF2 A;  4Q5S F;  5D8L B;  2HYF A;  4L5J A;  1EV7 A;  3P7N A;  3LA7 A;  3FHZ A;  1DDN A;  1F5T A;  1WI9 A;  1F4K A;  3GFM A;  4MGR A;  1FX7 A;  3EUH A;  5BS6 A;  2P8T A;  2R3S A;  2HGC A;  5JR3 A;  2MLG A;  3FZV A;  1G3T A;  2EV0 A;  3FM5 A;  4G7H F;  1BN5 A;  2XVC A;  2Y0M A;  4RB3 C;  3L09 A;  1OYW A;  3AAF A;  3KZZ A;  2OD5 A;  1S3J A;  3BP8 A;  4EGY A;  3MWM A;  3MQ0 A;  1HBX G;  3HOT A;  1T6S A;  1IN7 A;  3GWZ A;  3Q9V A;  1JHF A;  3TGN A;  2V1D A;  1W4M A;  1U2W A;  3GXO A;  1FBS A;  4BQA A;  2R7F A;  3TOB A;  4R1H A;  1KU2 A;  4LK1 F;  1Z7U A;  4Q48 A;  1W5T A;  1FWZ A;  2RC4 A;  2QEN A;  2AXL A;  4HW0 A;  4AD9 A;  4MEY F;  1QO0 D;  5AON A;  1MJ9 A;  1IN8 A;  4KT5 C;  4EJW A;  3WU1 B;  1UFM A;  5DUK A;  2RQP A;  1FNN A;  3PQK A;  2DI3 A;  2XAJ A;  4G7O F;  1LEA A;  3RDI A;  5CVV A;  2QQ9 A;  3CTA A;  4U7D A;  3E6M A;  1ZG3 A;  2E7X A;  3ZN1 A;  4FX4 A;  4CGZ A;  4BXU A;  4O3M A;  3QPT A;  1J7K A;  5BPD A;  2O6G E;  3M8E A;  2ESN A;  3I5U A;  1TLH B;  3CJN A;  1MD0 A;  1R5H A;  2M87 A;  2VT2 A;  5L3G A;  1W7P B;  3BPX A;  2Q8K A;  1TQM A;  2MLK A;  1IRG A;  1T98 A;  3O6B B;  1D8K A;  3TO9 A;  5JI6 A;  4CIC A;  2FBI A;  1OYY A;  5HDK A;  3K1M A;  1B4A A;  2Q2E A;  1W5S A;  2MH9 A;  3ZN0 A;  2ETH A;  5HVQ C;  1QNT A;  3DF8 A;  2J5P A;  1S7A A;  4E70 A;  2R7D A;  4OU0 A;  2ESH A;  2M5W A;  3V7R A;  3TO7 A;  1SFE A;  4Q47 A;  4IRG A;  2XUB A;  2K4B A;  1V3F A;  2FML A;  5CYV A;  1TBX A;  3I59 B;  4IVN A;  2LDU A;  5HDN A;  3FF5 A;  2IT0 A;  4BHB A;  1BOA A;  1RIO H;  4I0A A;  1R23 A;  3LAJ A;  3DQV C;  1YW7 A;  1USS A;  3O3K A;  1FT9 A;  1R36 A;  1DPR A;  3Q5F A;  3RPQ A;  1V4R A;  2L01 A;  1JE8 A;  3ZPL A;  3L2C A;  3K2Z A;  3IRQ A;  1FYK A;  2XAQ A;  5E20 A;  3M8F A;  2XIG A;  2VC1 A;  3HSF A;  5IT9 K;  1J9I A;  2JPC A;  3ULQ B;  1SD5 A;  3F23 A;  4M9S A;  3TDZ C;  4NB5 A;  1B9N A;  4CO8 A;  1G3W A;  2YU3 A;  3SZT A;  3DXJ F;  1QGP A;  2FOK A;  1BJA A;  1ONV A;  1WSU A;  1QPM A;  1MJB A;  4AIH A;  2P7C B;  4KYW A;  1LDJ A;  2HS5 A;  2BYV E;  3F8F A;  4I2O A;  1O57 A;  3QAH A;  2VBY A;  4GYG A;  5FD5 A;  1ZYR F;  5HOO A;  4XLN F;  2PBI A;  1XDS A;  4MHG A;  2D1H A;  1KU7 A;  2IA0 A;  2EB7 A;  2BV6 A;  2P5V A;  3F6O A;  5LBQ A;  1BC7 C;  2DAO A;  1P4W A;  5EEH A;  1G3S A;  2EFP A;  3BY6 A;  1R1U A;  4A0X A;  2IA2 A;  2PQ8 A;  3CUO A;  2E7W A;  4Y15 A;  1K6O A;  3MZY A;  2ZJ2 A;  5LGT A;  1XN7 A;  3FMS A;  4A0Z A;  2JTV A;  2ADU A;  5FD6 A;  2AS5 F;  2VOD A;  2YPR A;  1FZP B;  1J5Y A;  2ACJ A;  1STZ A;  2IPQ X;  1FP1 D;  5HLG A;  1IN5 A;  2GA1 A;  4N0B A;  3IRR A;  4LGW A;  2L4A A;  5D8K B;  2GIV A;  3VFZ A;  1WQ2 A;  1KU3 A;  3WTS C;  4OIO F;  1LQ1 A;  5J6X A;  3WTU C;  1O3Q A;  4BHC A;  4L5I A;  5LEJ A;  3IC7 A;  1CF7 A;  1S29 A;  2H6C A;  3SHF A;  3TKY A;  4KN4 X;  3HRM A;  4IXA A;  2EA4 A;  4HX7 A;  3SZP A;  2FSW A;  2KJC A;  4KMU X;  4RB2 C;  4WXH A;  4KIC A;  4RB0 A;  5HS7 A;  4FHT A;  4LK0 F;  1XD7 A;  3R61 A;  1XCB A;  4I02 A;  4R8H A;  3ZMU A;  4UV8 A;  3WTW C;  2QUF A;  4UUV A;  1Z6T A;  1FBU A;  2CW0 F;  1OYI A;  5H6Q A;  5FFX A;  3F3X A;  4HX4 A;  2O0Y A;  5L3D A;  3U1D A;  4HX8 A;  1BI1 A;  5BMZ A;  4XSX F;  2LNB A;  2RN7 A;  3ZQ7 A;  5ICC A;  1U5T A;  2EK5 A;  4EJO A;  4IHT A;  1WRJ A;  1MJA A;  1TW3 A;  4I01 A;  4NHJ A;  2HR3 A;  2CG4 A;  3L9F A;  1W7P D;  4HYE A;  1ON1 A;  2OU2 A;  2PG4 A;  2V9V A;  3GO5 A;  3EDP A;  2DQR A;  3JSP A;  1T0F A;  1SMT A;  3J81 Z;  3KP4 A;  1T39 A;  2PEX A;  3ROU A;  4XLP F;  2W24 A;  3DPT A;  1HW2 A;  4M6X A;  5DUI A;  1SFU A;  1HSJ A;  3Q9S A;  3BWG A;  4BH9 A;  1S8N A;  1R5G A;  3C7J A;  2HEO A;  1J2X A;  1FSE A;  2K86 A;  2M45 A;  2K4J A;  5DEQ A;  5D5X B;  3L7W A;  3IKT A;  1G4D A;  1XDU A;  1PUE E;  3DKW A;  4LB5 A;  1TW2 A;  3HHH A;  3KP2 A;  3GEZ A;  3QOP A;  2ZNY A;  1DP7 P;  1KQ8 A;  4ZZD A;  4Y13 A;  4MQV A;  3WE2 A;  2XGX A;  3D5L A;  3WU0 A;  3V7S A;  2XKO A;  4HDV A;  3D0S A;  3ERE D;  3BPV A;  5FFZ A;  2CO5 A;  2ISY A;  4I7H A;  3RIR A;  4OIR F;  3ZP5 A;  5K5O A;  1O7F A;  2YX4 A;  1ZRF A;  2F5F A;  3G73 A;  2NAZ A;  3RKY A;  1CGP A;  4R79 A;  1LVA A;  4ENJ A;  4OIP F;  1QZY A;  4YFK F;  4ETS A;  3J80 K;  4ESJ A;  3KEQ A;  3MFK A;  4RGS A;  3REO A;  5CVI A;  4EMS A;  4RGU A;  4A6D A;  2VC0 A;  3TOA A;  4G7Z F;  4L18 B;  2WV0 A;  2VBW A;  4ZH4 F;  2EFQ A;  3WGG A;  3QPH A;  3SFZ A;  4EJV A;  3CUQ B;  3EYI A;  5DCM A;  2L4M A;  3GZ6 A;  3H92 A;  2CWE A;  1IXS B;  1TQI A;  2QQA A;  3GLX A;  2WTE A;  4DNC A;  2F5C A;  5JVT A;  1YO5 C;  4U7B A;  2YR2 A;  5L3C A;  2RKH A;  5LRS A;  4PGH A;  4XSZ F;  5TRD A;  3T8R A;  1J75 A;  3KLO A;  2DQL A;  3N4M A;  4M72 A;  2M1B A;  3RI4 A;  2TDX A;  2XKP A;  3KP3 A;  1H0M A;  1YW9 A;  1REP C;  2KJB A;  4GGG A;  4A6E A;  2G7U A;  2ZXJ A;  3GFI A;  3ISP A;  2YSR A;  3V7C A;  4L0Z B;  3TO6 A;  3WTY C;  3IKV A;  2QQB A;  1RI7 A;  5D6E A;  2YX7 A;  1G6N A;  3HRS A;  3K0L A;  5HS8 A;  1ZLJ A;  3LQR A;  3GYH X;  3CO7 C;  3DV8 A;  3T5X A;  2GQQ A;  4ZZL A;  2LSO A;  2LKP A;  4NQW A;  5CJ9 A;  1L0O C;  4U0Y A;  2D1V A;  1MGT A;  3V4G A;  2LF8 A;  2JRT A;  2FRH A;  3E97 A;  2HYG D;  2M8E A;  2NNN A;  2IA1 A;  4CXF A;  3I53 A;  3QP6 A;  3ZMD A;  2DPU A;  2A68 F;  4B09 A;  3HYI A;  3ABT A;  2VN2 A;  2KRF A;  1PP7 U;  4KN7 X;  5FO5 A;  4BHP A;  2A3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...