3L2CA

Crystal structure of the dna binding domain of foxo4 bound to dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
85
structure length
85
Chain Sequence
RRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords FOXO consensus binding sequence, plus strand
publication title Structure of the human FOXO4-DBD-DNA complex at 1.9 A resolution reveals new details of FOXO binding to the DNA
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2009-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l2cA00
1K7AA 2M5WA 3K1PA 1BI0A 2Q8KA 2Y75A 1KU7A 1OPCA 1DUXC 2HDCA 1J2XA 1B59A 2QENA 5HS8A 2D1HA 2ESHA 5HS7A 4PZJA 3H3ZA 3E6MA 4AIHA 2A3SA 2EA4A 5D5XB 5BPIA 1ZREA 4KN4X 2V9VA 3QAHA 1J9IA 5K5RA 1U2WA 1ZYRF 4G9YA 3FXUA 4LK0F 2L01A 3WTYC 1S8NA 2JPBA 4HQEA 1ZLKA 2CW0F 2KJCA 4ZYEA 1B9MA 5DCMB 2FBKA 1Z05A 4P9UA 4K2EA 5D4RA 3T0YA 1CF7A 1FZPB 4CZZA 2CYYA 4S05A 5L3GA 3IRRA 3E6BA 3SHFA 2GA1A 3HTSB 1T6SA 1S29A 3I4PA 1SMTA 2GAUA 4EM1A 3V8JA 2OAZA 1T39A 1XSDA 2CGPA 1F4KA 3KEQA 4JK1X 2DPDA 1REPC 1TQIA 3HUGA 3I59A 4IPAA 1UCRA 5K5QA 3RIRA 2XAJA 3GZ6A 1W5TA 3L2CA 3WTWC 5HLHA 3O3KA 3R0AA 3ERED 3TKYA 2V6CA 1TW2A 3IKTA 3DQVC 4ZH4F 1JGSA 3WG9A 1J75A 4LJZF 2ELHA 4M72A 1ODDA 1QO0D 4KDPA 4I2OA 1SFXA 1HW2A 1RI7A 4G7ZF 2XKPA 3J81K 4G7HF 2FNPA 2ZXJA 4U0VA 1GHCA 1P92A 1U3EM 2RVCA 4UV9A 4YIFA 4CDGA 1O3SA 4CXFA 4MQVA 3LAJA 2EWNA 2PBIA 1BM9A 1ZRDA 3DF8A 5L3CA 5H20A 1LNWA 3QRFF 3F6OA 1FOKA 2YX7A 2EV0A 1DPUA 3WE2A 5DUKA 4G8XA 3B73A 2FBHA 2DW4A 3GFLA 2L4MA 1HSTA 3DP7A 4I09A 4WX9A 4P5OA 2DU9A 2NS0A 3V4GA 1G3SA 1MDMB 1ON1A 4PGGA 4XSXF 5CVIA 1G3WA 3EQLF 4JBAA 2QBYB 4KICA 4GCVA 2FXAA 4YFXF 2XIGA 3HOSA 1KYWA 4O3MA 1YW8A 2LKPA 3GFMA 2X4HA 2P6TA 1QGPA 3J80K 1ZARA 1XN7A 4M71A 2HEOA 2F5EA 4I0AA 2KKOA 3IRQA 2GXGA 4F7ZA 3MWMA 1W7PB 1A04A 2HQNA 4HX4A 3P9KA 3GUDA 4MTDA 1HW1A 2HQRA 4MTEA 3M7GA 1XGOA 5D5UB 4DQ2A 1U5TB 2P4WA 2W24A 4IF4A 1DPRA 1J7KA 5HS9A 1BC8C 3O2PE 1G3YA 2KIFA 3E5XA 5HOOA 1EH8A 1RZ4A 3DKWA 1T0FA 3MZYA 5J8CA 4Q5SF 2EV5A 5TRDA 1XSXA 5HLIA 3ML6A 2EFNA 4P55A 2RNJA 4WK8F 3RI4A 2DO7A 2C6YA 2H09A 4G94A 2R7DA 3CUQC 4HLYA 3ZQ7A 1BIBA 2STTA 1U8RA 3T8RA 1JE8A 5A2QZ 3KLOA 1V4RA 4U88A 4RGUA 3I53A 3QPTA 5LRSA 3K9TA 2PJPA 5JR3A 3KE2A 3GW2A 4XLPF 1MDMA 4KYWA 1E17A 4XSZF 4LLNA 3M9AA 1MKMA 4RAYA 1ZG1A 5E1ZB 2VONA 2JTVA 1FX7A 4HOBA 3K1NA 1K79A 4A5MA 4IXAA 2A68F 2COMA 1IN5A 2EK5A 4OMYA 4FT8A 3DXJF 1IXCA 1YW7A 1K78B 2HWVA 2XAQA 3EUHA 1KQ8A 3HRMA 2HGCA 1PP8F 3K69A 4GO1A 3NEUA 2PN6A 3PQJA 3LQQA 1V3FA 4BHCA 1LQ1A 4ETSA 2BE5F 2DFIA 4BQAA 3FXRA 2M8EA 1LEAA 4Y13A 2O8XA 2HTJA 3IKVA 1UFMA 1YO5C 1U5TA 1P4AA 1MJAA 1ZG3A 1IN7A 2Y0MA 4FHTA 2A5YB 3HYIA 1FC3A 5E8GA 2X0LA 1QZYA 2Z3YA 1VTNC 2DPUA 4LGWA 1TNTA 5BPDA 2H27A 4M74A 2XHKA 3LAPA 4Y15A 2JT1A 4H0EA 3IWFA 1I6XA 1SD7A 3VFZA 2P8TA 5KK1A 3J7AO 1I27A 2FNAA 3VEPA 2K4BA 2EB7A 3ZP5A 4ENNA 4YFNF 3C1DA 2ZNYA 3RYPA 5E20A 2JPCA 3FX3A 1WRJA 1ONVA 5DUIA 4EM0B 4MNUA 2CG4A 4IHTA 3BJ6A 2IVMA 1XMKA 3C7JA 3RPUA 4KMFA 2R3SA 2P5LC 3D0SA 5BS6A 3GO5A 2Z9OA 1SMYF 5DD8A 4LK1F 2FMYA 5HDKA 1Z6TA 2F5DA 1TW3A 5J8FA 3DFGA 4KT5C 3E6DA 2XASA 2H6BA 2BYVE 4N9HA 2E7WA 2LSOA 2O3FA 1GXPA 2GIVA 2L54A 3R6SA 4AD9A 2VXZA 3RTRA 4EJTA 1O3TA 1W7PD 2RC4A 3DEUA 3IHUA 4NHJA 2A61A 4BNCA 2XAFA 2IP2A 2MA3A 1CF7B 4LG0A 4ENMA 3F8MA 1ZGAA 3GXOA 3ZMZA 4HBLA 2K7LA 3BP8A 1QQIA 4O5VA 4PCQA 4HX8A 5CVRA 3RPQA 2O61A 1R23A 1I1GA 2HR3A 1ZLJA 2HFHA 4ASNA 4UHTA 1HQCA 4AIKA 3FHZA 4S04A 2VBZA 1IRFA 4AIJA 3MCZA 5K5OA 1IXSB 1T2KA 3F3XA 1FSHA 1QPMA 5FD6A 3BROA 2GWRA 3V8KA 4HF1A 1YQAA 2GZWA 4KIGA 5E18F 1H0MA 3G73A 2VBYA 1KQ9A 3V8LA 3Q9VA 1FYKA 3WU1B 3L00A 3ZMDA 4OINF 2RKHA 4YFKF 1KYZA 3JAMZ 3BPXA 3WGHA 2G9WA 5CVJA 2OZ6A 4EV0A 1JXSA 4KIBA 4P9FA 2FQ3A 3ZN1A 4ON0A 1BC7C 1QZZA 3KP3A 1YS7A 3MQ0A 2DI3A 5ICGA 3F6VA 1O3QA 5KVRA 3T8TA 1XB4A 1W5SA 3KP4A 1E2XA 2XAHA 2NRAC 4P96A 3CJNA 2JSCA 3P9CA 4WXCA 3GX4X 2RQPA 3KP7A 1BI1A 4HW0A 3M8EA 2IW5A 5ILUA 1CGPA 4HQMA 5IT9Z 5LEKA 1B9NA 4MHGA 2K86A 2QUFA 4U7BA 5LGNA 5IT3A 1IN8A 1R22A 3T1BA 3V7CA 2QQAA 4RB3C 3TOBA 5ILSA 3ZN0A 2DT5A 1O57A 4R8HA 3R60A 2F2EA 3KP2A 3HSRA 1HXDA 2CSOA 5EEHA 5A2QK 3KEOA 1BOAA 4XLNF 4CGZA 1FT9A 4EM2A 1OYIA 1P2FA 2Z5UA 1YW9A 2PMHA 1G6NA 2MH9A 2FEZA 5BMZA 3L09A 3TO9A 2P5KA 2XAGA 4HZFA 2ISZA 1P4WA 4PGHA 4YIIA 1IAWA 4Q47A 2ZJ2A 1HKSA 4A6DA 1IN4A 1L3LA 2V1UA 4Q4ZF 5FO5A 5J6XA 2FU4A 3RKYA 2MLKA 3I64A 4HA8A 3IWZA 1PUEE 2A07F 2GXBA 1IZ1A 1LDJA 5L3DA 1YTYA 2MD5A 4XBFA 3QP6A 4LLGF 2HYFA 3LFKA 5ED4A 2UWMA 2QYOA 1TTYA 1R36A 4EJWA 3P9IA 1C0WA 1U6GA 3CUQA 1MJBA 1ZAOA 5HVQC 1ZRFA 2HS5A 4I7HA 3D5LA 1F1ZA 3LWFA 3FM5A 5HLGA 4BHPA 2RDPA 3BJOA 4UNOA 1IF1A 2EA2A 4A5NA 2VT3A 2FOKA 3WU0A 1JHHA 4IRGA 4HV6A 4EMSA 2R7FA 2M1BA 2K27A 3QP5A 4GXOA 3F8FA 1AWCA 3E5UA 1EH6A 1QNTA 2EFPA 4HYEA 3CTAA 3HSFA 1TQMA 3V7RA 3GZ5A 2FMLA 1S6LA 1R1TA 4ZYGA 5LHGA 3WTTC 3U9GA 4OIPF 2W57A 3ECHA 1L0OC 2F5CA 1Z6RA 2G7HA 2WTEA 2GQQA 2VOPA 4RAZA 3MFKA 1OYYA 4U0WA 5D6FA 2EJRA 3JSOA 1B4AA 4RGSA 3FMSA 3AAFA 1J5YA 3FZVA 4ENKA 4LMYA 2QQ9A 4I01A 2DLLA 2BBYA 2IA0A 4G6DA 5ILVA 3TO7A 1NHAA 1XGNA 1XGMA 2ZMEA 1ZH5A 1S3JA 4I0BA 3GEZA 3NQOA 4ESJA 2IPQX 4RGXA 4L0YB 4UV8A 5AONA 5E1WA 2EV6A 2V1XA 2H6CA 3ISPA 3S2WA 5ICFA 4A2UA 3WODF 3VB2A 2VN2A 3E3VA 1P4XA 2E1CA 2IA2A 3QU6A 4M6YA 1O3RA 4FX0A 3BOQA 3KZYA 1RNLA 2ZKZA 1GVJA 3GVAA 2KIMA 3CO6C 1F5TA 2QM3A 3IC7A 3F23A 2DAOA 4UVBA 2IJLA 1ZRCA 4MQ9F 2QZ8A 5F6FA 4CYDA 4LG0B 3MEXA 4EVIA 3TDUC 3RYRA 1XMAA 3CLOA 3F8BA 4HV5A 1IRGA 3HIFA 5FFZA 2VE8A 1RUOA 3GLXA 3JAMK 2O0YA 2CQKA 3BZ6A 1F9NA 2VC0A 1D8JA 2UXNA 1XCVA 2Y48A 2A6EF 1G3TA 3I71A 4LB6B 3TO6A 1R1VA 1D5VA 1XSVA 3RKXA 1BN5A 2VT2A 1KU9A 5DEQA 3EYYA 2YX4A 3BDDA 3WTSC 2M87A 4HF2A 1HBXG 5FGMA 5IT9K 3QPHA 4KFCA 5D8KB 2P5VA 5LRRA 4L9TA 4L9VA 2L02A 3ROUA 3FXQA 5CLSA 2P7CB 1J0RA 4KA4A 2O03A 1B6AA 2DTRA 1FSEA 2QWWA 1IUYA 1I1SA 1SD4A 4I02A 1UHWA 5CYVA 1BI3A 1FP2A 4NQWA 2DQRA 3SXYA 5BOXA 1USTA 1R5HA 3OOPA 3SZPA 4IRHA 3GFIA 5D4SA 4L9JA 3RKWA 3R0JA 2WWYA 4EGYA 1MZBA 3C3WA 5BQTA 4L5IA 3ZMVA 1PP7U 5E8IA 1HW5A 3M1EA 3LA3A 2XV4S 3I54A 2A6HF 2HOEA 5CVVA 3NRVA 1OMIA 1IXRC 3LA7A 5HDNA 1XCBA 4IRIA 3ELKA 3FMQA 2OA4A 3E97A 1HSJA 1HKQA 4EJVA 4RB0A 3BWGA 3EDPA 4A0ZA 2W85A 1FP1D 1FBUA 1J59A 3T5XA 1Q1HA 1SAXA 2DK5A 4OIQF 5D5WB 4UUVA 5LGTA 2L3DA 1I5ZA 4HLXA 2V79A 3F8NA 2RN7A 1WKMA 3KLNA 5L3FA 2D2WA 5LBQA 4IHSA 2ADUA 1RIOH 3KP6A 5L3BA 1BI2A 3PQKA 3RJPA 2VE9A 1AOYA 1EH7A 1SFEA 4A12A 1WQ2A 4KN7X 2BGCA 5TJJA 5LHIA 4KMUX 1FNNA 4LB5A 1H9GA 3F22A 3EYIA 1W4MA 2EFWA 2M45A 1FWZA 3FWEA 2ZNZA 2FRHA 5JHUA 2W84A 4GYIA 1FPQA 1XDSA 1YYVA 3DPLC 3U1DA 3WTZA 4RS8A 1FYMA 3CUQB 4BXUA 5DDGA 4KUMA 5LEJA 3H3UA 4BYYA 4M9ZA 2YPRA 1UHMA 4WCGA 3FMRA 1EV7A 5F64A 2STWA 2H94A 1D8KA 5FLXZ 4LD5A 4IJAA 2BV6A 3ABUA 5LHHA 3BJAA 3BPVA 2PLYA 5H6QA 1KA8A 1KGSA 2YSRA 4EJUA 2PI0A 2UZKA 4GYGA 1OKRA 4EGZA 4MEXF 4ZZLA 1DP7P 3B02A 3O6BB 2HYGD 4OMZA 4RGRA 4NB5A 2VC1A 4OOIA 2VBXA 3GWZA 1FY7A 5AIPA 2P6SA 3I0TA 1OR7A 3GFJA 2KRFA 4I98B 3REOA 3HOTA 3WTXC 4CHUA 4HX7A 2B0LA 4O6JA 4WXDA 1YLFA 3HHGA 1P6RA 2PG4A 1MJ9A 2DQLA 4XRFA 1Z1DA 4L0ZB 2JZYA 4TV7A 2Z99A 2PQ8A 2QVOA 4M73A 2DBBA 2FA5A 2Q0OA 5DD4A 1R5GA 4HF0A 5E17F 3H92A 2XRNA 2FE3A 2ZCWA 3HRSA 4B09A 4CICA 5FFXA 2K02A 4YG2F 3ABTA 3R61A 3VODA 2CFXA 1U78A 2LNBA 1TNSA 4KIFA 2ZMEB 1ZHFA 1FBQA 2Q2EA 3ECOA 5F1RA 1UB9A 1YFHA 2FBIA 2VODA 3KZZA 1S7AA 4G6QA 2ZO4A 1T98A 4WF2A 3WTVC 1G4DA 5ICCA 5FD5A 2IT0A 3N97A 4M9SA 1BIAA 1ON2A 4N0BA 2MC3A 2XGXA 4ESBA 3WGGA 5DCMA 4BAYA 5JI6A 2JRTA 2XROA 4GGGA 2D45A 3GYHX 1ZG5A 4AVPA 1RUNA 3E5QA 4U7DA 3P7NA 4Q48A 1Z91A 3JW4A 1BJAA 2ZBKA 3JTGA 1IN6A 1Y0UA 1FLIA 2RGVA 5K1YA 1YIOA 3SZTA 5JVTA 2M30A 3M8FA 3ULQB 3K0LA 3MAJA 5LGUA 1FBSA 1OYWA 3F8CA 3HTUA 2J5PA 3HRUA 3SQNA 2NNNA 2MLGA 1WSUA 2ETHA 4ZYHA 3W6JB 5ICEA 4Y17A 3WE3A 4UXNA 1STZA 2CO5A 2AS5F 2OQGA 4DNCA 4OIRF 4PDKA 1K6OA 3HSEA 4RB1A 2EFQA 3ZMSA 1H9TA 3F72A 4M6XA 4ZZDA 3COAC 2IRFG 3PFIA 3F21A 5D8LB 2VBWA 1TQPA 3I5UA 3TDZC 2UXXA 2LF8A 4QLCU 2F5FA 2PEXA 1LVAA 1GXQA 3IL2A 3KETA 3E6CC 1WWXA 2KJBA 3LA2A 3N4MA 2E1NA 2RV8A 3K1MA 2XVCA 3G3ZA 2LF7A 4WWCA 4MEYF 4A0XA 4LFUA 2OU2A 2EFOA 3HRTA 4A0YA 4OU0A 4ESFA 3RDIA 2HZTA 2XUBA 1T38A 4BHBA 3TGNA 3WGIA 4RB2C 3W6KB 4L18B 1USSA 4BH9A 4HDVA 1HKTA 1SD6A 3TQNA 4ENJA 4QWQA 2BEOA 2QBYA 1YS6A 1R58A 5EEGA 3I58A 2GA2A 3J81Z 2VOOA 2MH2A 2AXLA 3QOPA 5ERIA 2KIUA 3CUOA 2OZUA 5CJ9A 1KQ0A 3SFZA 1JHFA 4MGRA 2XKOA 3QU3A 3ZPLA 1W7PA 3ZMUA 2QQBA 3K2ZA 2TDXA 2WC2A 1IW7F 4IVNA 2P7VB 2D1VA 2NYXA 4OIOF 1KU3A 4G7OF 3Q5FA 3L7WA 2O6GE 5AIQA 4ZYDA 4A6EA 3C18A 1KU2A 4R1HA 3Q9SA 3V7SA 3KFWX 3ZMTA 4EQQA 1YG2A 4WXHA 5E1XA 4M9XA 1BBYA 2YR2A 3HHHA 1R7JA 3J80Z 2CWEA 1TLHB 5D6EA 5FLXK 1O7LA 3U2RA 4UVAA 1FYLA 2DK8A 5FB2A 3CDHA 1LDDA 1S7OA 3WTUC 1TBXA 4CO8A 4LLLA 1B1BA 1X3UA 2FSWA 2ISYA 2E7XA 2YU3A 1SFUA 3FF5A 1QBJA 4B8XA 3GF2A 4EJOA 4N9IA 1R1UA 2OBPA 2HKXA 2ESNA 1MGTA 1O7FA 5H6RA 3DPTA 1PDNC 2IA1A 1MD0A 2V1DA 3MZHA 3FM3A 1ZGJA 4KNYA 5JFRA 5D5VB 1K78A 4E70A 2OQRA 1U5TC 1ULYA 3BY6A 1XDUA 2Z33A 4L5JA 1XGSA 4Z2YA 2LDUA 3DV8A 1SD5A 3KP5A 3KCCA 2QLZA 4UVCA 2W25A 2NAZA 1XD7A 2G7UA 1LJ9A 1DDNA 2WV0A 5L3EA 4HDUA 1ZN2A 4AWXB 1LDKB 4JQFA 2PMUA 3LSTA 4U0YA 5HDGA 4HAMA 2ACJA 4FX4A 3TOAA 4D0PA 3CO7C 2OD5A 1Z9CA 1D3YA 1LB2A 6PAXA 5DV5A 2MBFA 2HKOA 2HTSA 1Z7UA 3I59B 5DCFA 3VOEA 3R4KA 5LLQA 2A69F 2ZFWA 2K4JA 3EETA 4R79A 1WI9A 1LEBA 3LQRA 3L9FA 3JSPA 2J5OA 2L4AA 3OV8A 5CVUA 2PFBA 3JTHA 2NNYA 2FF4A 1R00A 4L9NA 5DYMA
chains in the Genus database with same CATH superfamily
3QQAA 3F9KA 1K7AA 2M5WA 3K1PA 1BI0A 2Q8KA 1D5YA 2R5ZB 2L7FP 2ZJRF 3OSGA 4B3XA 2Y75A 2LP0A 1KU7A 1OPCA 2DCEA 3G71I 3FXKA 1HOMA 1DUXC 2HDCA 2Q2EB 1WGXA 3N05A 2FD5A 1J2XA 2EIMH 2HDDA 3GTLJ 1KONA 3H9GA 2IBDA 3W6VA 1B59A 2ZXWH 2QENA 5HS8A 1UELB 2D1HA 2ESHA 5HS7A 4PZJA 3FXLA 4A3FJ 3H3ZA 3E6MA 4AIHA 3MKYB 3O8GA 3JR9A 2A3SA 4U87A 2EA4A 2E35A 4Y3OA 4F92B 5D5XB 5B1BH 1XMXA 1WPKA 5BPIA 4AM3A 2V9PA 1JKPC 1ZREA 4KN4X 2E36A 1E3OC 3OYNA 2V9VA 3QAHA 3HC7A 1J9IA 5K5RA 1U2WA 1ZYRF 3IAS2 4G9YA 3FXUA 4LK0F 2L01A 3WTYC 1S8NA 2JPBA 3HOWJ 4HQEA 4ZTFA 1ZLKA 5B3SH 2CW0F 2KJCA 1IV8A 4ZYEA 1B9MA 5DCMB 3RSNA 1Y1WJ 2FBKA 5J40A 2F4OB 1W5CC 2GIZA 1Z05A 4P9UA 3UKGA 3OIOA 4K2EA 5D4RA 1VQLI 3T0YA 1CF7A 1FZPB 4CZZA 3TP0A 2CYYA 4S05A 3QWLA 3BLYA 2CQ7A 5L3GA 5FKKA 3IRRA 4YEJA 3E6BA 1TT0A 2GA1A 3SHFA 2VJ4A 3HTSB 1X4OA 1T6SA 4XLEA 1S29A 3I4PA 1SMTA 1ETYA 2KIQA 2GAUA 4BJ5C 1ZKGA 4EM1A 3V8JA 2OAZA 1MW7A 1T39A 1XSDA 5GADJ 2XDVA 2CGPA 1F4KA 3A4CA 3GLLA 3KEQA 3CQZJ 4JK1X 4AIDA 4JX4A 2DPDA 1DP3A 1SVLA 1REPC 1ITYA 1QA6A 1TQIA 1BL0A 4PFPA 3HUGA 2KL4A 2LBFA 3HBLA 4BE1A 3I59A 4IPAA 2B9SA 1UCRA 5K5QA 3RIRA 3ZQLA 2XAJA 3GZ6A 4M3GA 1W5TA 3L2CA 3WTWC 1GLNA 1A6IA 5HLHA 3BG9A 3K6GA 3O3KA 3R0AA 2BOLA 2ICWG 3TKYA 4YELA 3ERED 2V6CA 5F08A 1TW2A 3IKTA 2OJED 3DQVC 2OCEA 4ZH4F 1JGSA 3WG9A 1J75A 4LJZF 3LSPA 2ELHA 4EEFG 3H5RA 2L9NA 4M72A 1MBEA 1ODDA 1QO0D 4KDPA 4I2OA 1V5GA 1SFXA 4G12A 1HW2A 3CP8A 1ETQA 1TZLA 1RI7A 2CMPA 2OTJI 4G7ZF 2PX9A 2XKPA 2VASA 5HODA 3J81K 4G7HF 2FNPA 5FJ8J 2KRCA 1IO2A 2ZXJA 4U0VA 1GHCA 1P92A 1U3EM 4DYQA 3I55I 2RVCA 4UV9A 4YIFA 4CDGA 3AG3H 1O3SA 2DOFA 2MC4A 4CXFA 4MQVA 2KZVA 2EWNA 3LAJA 1V55H 2PBIA 1BM9A 1ZRDA 3DF8A 2X1EA 5L3CA 2Z16A 2CH0A 5H20A 1LNWA 3QRFF 3F6OA 1FOKA 5F1JA 2YX7A 1TWAJ 2EV0A 1DPUA 3WE2A 1JKRC 5DUKA 4G8XA 3B73A 2FBHA 2DW4A 3GFLA 5JLWA 2L4MA 1ENHA 1HSTA 3JCUC 5M3FJ 3DP7A 4I09A 3K10A 4WX9A 4P5OA 2DU9A 2NS0A 3IP4B 3KIOA 2LR8A 3C2HA 1IG7A 5FRNA 3EUAA 1K4SA 2KMUA 3V4GA 1G3SA 1MDMB 2M0MA 4F52A 3S3OA 1ON1A 4X6AJ 2R7WA 4PGGA 4XSXF 5CVIA 5FLMJ 1G3WA 3IH3A 2JQ7A 2NVYJ 3EQLF 2AO9A 1D1BA 3W2VA 4JBAA 4S0HB 2I5UA 1WJDA 3VWBA 3S14J 4X1EA 2QBYB 2LRDA 4KICA 4GCVA 1TL8A 1GVDA 2FXAA 4YFXF 2WY8Q 2X6YA 2KLOA 4QPOA 2XIGA 3HOSA 3HOVJ 1KYWA 5E3NA 4O3MA 1YW8A 1Q1VA 2LKPA 3GFMA 3OY9A 2X4HA 2X6OA 1X3WB 2P6TA 1QGPA 2DA3A 3FK6A 3ZXSA 4RDUA 3HKZN 2PJRB 3J80K 1ZARA 1XN7A 4M71A 2HEOA 2F5EA 4I0AA 2K9MA 2KHMA 2KKOA 3J7ZI 3IRQA 2AQEA 1OCZH 1WJCA 4IQ4A 2DFEA 2XAUA 4FQGA 2GXGA 1E3HA 4F7ZA 2BY3A 2HU9A 4HRIA 3MWMA 1MSEC 1W7PB 1A04A 3A02A 1ETKA 1Z3YA 3OIQA 2HQNA 4HX4A 3P9KA 3PNVA 3GUDA 4MTDA 1HW1A 4AC0A 2HQRA 3FIWA 1FIAA 2L7MP 4II2A 4MTEA 3M7GA 2JA2A 4PJNA 4AYBN 1XGOA 2CW7A 5D5UB 3GTOJ 1K4TA 4DQ2A 1I50J 1U5TB 1MNEA 2P4WA 2W24A 4IF4A 2QA4I 1DPRA 3OYMA 1J7KA 2N8GA 5HS9A 3O2PE 1BC8C 4A3EJ 2JSPA 1G3YA 2VJJA 1RC9A 2W1OA 3OIPA 2R93J 2KIFA 3E5XA 5HOOA 1EH8A 1RZ4A 3MZ8A 1TWFJ 1T0FA 3DKWA 3MZYA 3ASNH 2M4GA 5CQGA 5J8CA 1X19A 1GUUA 4Q5SF 2EV5A 4A3JJ 2DJIA 1VZ0A 2K5CA 2VQLA 2JK3A 5TRDA 4M6VA 1XSXA 5HLIA 1ZR2A 2K9NA 5FKNA 1JGGA 2VQCA 5C44J 3JRAA 3QYBA 4AVZA 2ELJA 2K85A 3E7LA 3ML6A 2EFNA 4P55A 2RNJA 4WK8F 3RI4A 2DO7A 3A01B 2C6YA 2Z1DA 3DTKA 2H09A 4G94A 3OWTA 2VKEA 3TL4X 2R7DA 2JUGA 3CUQC 4HLYA 3ZQ7A 4G6TB 2OTLI 1BIBA 2FX0A 2STTA 2DMNA 1N78A 1WJFA 2DODA 3OYKA 1U8RA 3VYRB 3T8RA 1JE8A 1OISA 2MSYA 5A2QZ 3PIOF 3KLOA 3SYTA 1V4RA 2DYSH 3K4MA 4U88A 2E1OA 2E34A 2LY9A 2FUG2 1IDZA 4KISA 4RGUA 3I53A 3QPTA 2I10A 5LRSA 3K9TA 2PJPA 5JR3A 3KE2A 3GW2A 1FMWA 4XLPF 1MDMA 3BTCA 4KYWA 1E17A 4XSZF 3DU5A 2VUMJ 4LLNA 5BNGA 4CYCB 3M9AA 3DKYA 3CDIA 4B4CA 1MKMA 2UV1A 4RAYA 2LVSA 1ZG1A 1SFKA 4QTRA 5E1ZB 2VONA 2JTVA 1FX7A 1J09A 4HOBA 3HL2A 2EINH 3K1NA 4DOZA 3K4BA 1MBJA 2TRTA 2DYRH 4HPQA 4A5MA 1K79A 4IXAA 2E2IJ 3JRIA 2A68F 2COMA 3LMMA 1IN5A 1WJBA 3BG6A 2NS8A 1I39A 2EK5A 4OMYA 4FT8A 2XB5A 3DXJF 4BXXJ 1IXCA 1YW7A 4DBRA 1K78B 1BR2A 2X6WA 2XSDC 2HWVA 2XAQA 2XPUA 1IGNA 3EUHA 1LPQA 4BY7J 1KQ8A 4NNJA 4ZJZA 2VL8A 2HGCA 3HRMA 3K69A 1PP8F 1Y56A 4GO1A 3NEUA 2DMPA 2PN6A 3B6AA 3PQJA 4QIWN 3LQQA 3G1MA 5EZGA 1V3FA 4BHCA 1K61A 1LQ1A 4ETSA 5HNFA 2BE5F 2DDBA 4NC7A 3AL0C 4I76A 2DFIA 1LUJB 4BQAA 3FXRA 2M8EA 1LEAA 4Y4RA 4Y13A 2O8XA 3L2UA 2HTJA 4J01A 3IKVA 3VYUB 1UFMA 3FXMA 1YO5C 1OFCX 1U5TA 1P4AA 1MJAA 1ZG3A 2JJ7A 3W2AA 1IN7A 3DEWA 2Y0MA 4FHTA 2A5YB 3F0CA 1WZ2A 2BXYA 2Z2SB 3H36A 3HYIA 2QGUA 1MBFA 1FC3A 1P7JA 5E8GA 2X0LA 1QZYA 3K2AA 2Z3YA 3GMEA 1VTNC 2DPUA 1P7IA 4BDZA 3QODA 2OUMA 4LGWA 1OJLA 1TNTA 5BPDA 2XGEA 5HNHA 2XC7A 2EBIA 2GOXB 2H27A 4M74A 5F04A 2XHKA 4BEHB 3LAPA 4Y15A 2JT1A 1TP4A 4H0EA 4LG3A 3IWFA 4UUTA 1I6XA 2XPWA 3A0HC 1BJZA 2MW8A 1SD7A 1QVTA 1MIJA 2H8WA 5CQEA 3VFZA 2P8TA 5KK1A 3J7AO 1I27A 2FNAA 2XGCA 3HJEA 2JUCA 3VEPA 2K4BA 2EB7A 3ZP5A 2X48A 3H5AA 4ENNA 4C3JJ 4YFNF 3C1DA 2ZNYA 3M8JA 2R7TA 3RYPA 5E20A 2JPCA 3FX3A 1WRJA 1FOWA 1SEUA 2WAQA 5K7ZA 1ONVA 3EUKL 3CF5F 2A5WA 5DUIA 1UHSA 1R71A 2JVHA 3PL8A 4BU2A 4EM0B 3C2GA 2CG4A 4MNUA 4IHTA 4V19K 3BJ6A 2IVMA 1XMKA 3C7JA 3RZOJ 2B63J 1D0XA 3RPUA 4KMFA 2OV7A 4A3CJ 2R3SA 3SZGA 2P5LC 3D0SA 2RNGA 1WH7A 2VB6A 5BS6A 4QPQA 3GO5A 4PJJA 2Z9OA 1SMYF 1E0EA 2KFDA 3RKQA 1JTXA 2RREA 5DD8A 1LVKA 4LK1F 2FMYA 5HDKA 2JMWA 1Z6TA 2F5DA 2CV0A 1TW3A 2E5ZA 3DFGA 4KT5C 5J8FA 3E6DA 2KP6A 2XASA 4OAZA 2H6BA 2BYVE 4N9HA 3OYJA 2E7WA 2PMZA 4D5FA 2LSOA 3CC7I 2O3FA 4IOAF 1GXPA 4MFEA 2GIVA 2L54A 3R6SA 4AD9A 2VXZA 3RTRA 4AUXA 1X1DA 4EJTA 1O3TA 4HG2A 3IH2A 3EPZA 3S1RJ 1W7PD 4XRSA 3CMEI 2RC4A 3DEUA 3HB9A 3OMYA 3IH4A 1OLTA 3BTJA 3IHUA 1W36C 3MD2A 5C3EJ 1YITI 1OCCH 4NHJA 1NTCA 2A61A 4XKCA 4BNCA 2XAFA 2IP2A 2MA3A 1CF7B 1R4NB 4LG0A 2QQ8A 4ENMA 3F8MA 1ZGAA 3GXOA 3ZMZA 2CV1A 1K83J 3BG5A 4HBLA 2K7LA 4DBQA 3S1MJ 1ERDA 3BP8A 1QQIA 2R4GA 4O5VA 4PCQA 4HX8A 3L2WA 5CVRA 3RPQA 3BR3A 2O61A 4OWRB 2DT7B 1QPIA 1R23A 1I1GA 2HR3A 2NXNB 3BR6A 1ZLJA 3CCQI 1X1AA 2HFHA 4ASNA 3ABLH 3CDLA 4UHTA 1HQCA 4AIKA 2F4MB 4LITA 2VQHA 3FHZA 4A3IJ 3OS2A 4I6ZA 4S04A 4FASD 2VBZA 4BEHA 1NG6A 2Q1ZB 1IRFA 4AIJA 3O8HA 5J1UA 3CZ6A 1ZQ3P 3MCZA 5K5OA 2LBFB 5F0FA 1U0JA 1IXSB 1T2KA 3F3XA 2DA7A 1FSHA 3OYAA 1QPMA 5FD6A 3BROA 1VQ8I 2GWRA 2QSHX 2CUEA 3V8KA 4HF1A 1YQAA 2GZWA 4KIGA 4D5CA 1N75A 1V5EA 5E18F 4KT6A 3D5RC 1H0MA 1HLVA 2GOMA 3G73A 2DMUA 2VBYA 1KQ9A 3V8LA 4CCKA 3Q9VA 4W97A 5KNLA 3WU1B 4E7KA 3L00A 1FYKA 3ZMDA 1BA5A 4OINF 5H2FC 2RKHA 4YFKF 2DA5A 4Z6YA 2M9HA 1KYZA 3JAMZ 4PUSA 2HDWA 3BPXA 3WGHA 2G9WA 4F55A 3I4MJ 2O8KA 5CVJA 5FKOA 1G2HA 2AXTC 2OZ6A 4C2TA 4EV0A 1JXSA 4D1QA 1VQ4I 1Z77A 4XNFA 1IDYA 4KIBA 4P9FA 5GTIC 4H4KC 2FQ3A 3BT9A 3ZN1A 3JRBA 1I3AA 4ON0A 5E3MA 1JUMA 3G4SI 3KYLA 1BC7C 2DT6A 3JRCA 1QZZA 1SC7A 3KP3A 1Z67A 1YS7A 3MQ0A 2DI3A 5ICGA 3RQIA 3MKZA 3F6VA 3VSKA 1O3QA 5KVRA 3T8TA 1VQOI 4A3LJ 2IS2A 3SJMA 1XB4A 4NC6A 1DQUA 3C2BA 3HPHA 1HCRA 3KYDB 1W5SA 5B66C 1ETOA 3OR2C 1UG0A 3KP4A 1E2XA 3LOCA 4RAGA 4XLHA 1DGWY 5B1AH 2XGDA 3G2BA 5JLXA 4MFDA 2XAHA 2NRAC 4P96A 1A36A 3P5JA 3CJNA 2JSCA 3P9CA 4WXCA 3GX4X 2QEXI 3JRDA 4C3IJ 2RQPA 3KP7A 1BI1A 4HW0A 2XF5A 2LKXA 3M8EA 2IW5A 4JOMA 5ILUA 1CGPA 1HF0A 3CCVI 1P9QC 4HQMA 3I3LA 1TWHJ 5M3MJ 3OYHA 5LEKA 5IT9Z 1B9NA 4MHGA 2K86A 2ZC2A 3FKJA 3IUOA 2QUFA 4MIMA 3MN2A 5EG0B 4U7BA 5LGNA 2V26A 2IGNA 4E7SA 5IT3A 1HDDC 3KZIC 4BE2A 1IN8A 1R22A 3T1BA 2GLOA 3V7CA 4B1RA 5GTHC 2QQAA 4RB3C 5J1YA 3TOBA 1X58A 2M0CA 2AHQA 2K9SA 5ILSA 1QHHD 2RQQA 2WBMA 1VQPI 4LOCA 3ZN0A 4M3DA 2DT5A 1O57A 4R8HA 2H1KA 3R60A 2F2EA 3KP2A 3HSRA 1HXDA 2CSOA 1VNDA 5EEHA 1I6HJ 5A2QK 3KEOA 4GFBA 2DMQA 1BOAA 4XLNF 2H8RA 1FT9A 4CGZA 4EM2A 1OYIA 2NVTJ 1UJ8A 1Z3XA 1P2FA 4IHXA 2Z5UA 1YW9A 3MKLA 4RM3A 4ITVA 2DJNA 2PMHA 1G6NA 4C2MJ 1JUPA 3OYLA 2MH9A 4PFOA 2VQGA 2FEZA 3JRGA 4M3FA 5BMZA 3L09A 3TO9A 2P5KA 4IOCF 2XAGA 3S1QJ 1YX3A 5M5XJ 3Q0VA 4FE7A 4HZFA 2ISZA 4XMYA 1P4WA 4PGHA 4YIIA 4XQFA 4Q47A 1IAWA 2ZJ2A 4C2UA 1HKSA 3Q0WA 3ESWB 4A6DA 1IN4A 1L3LA 5TISC 2P81A 5GPAA 1IJWC 4Q4ZF 2V1UA 2GBYA 5FO5A 5J6XA 2FU4A 3RKYA 2MLKA 1RKWA 3I64A 4HA8A 3CC2I 4BXFA 3IWZA 1PUEE 1R49A 1PJRA 1T33A 2A07F 1RR8C 2E2JJ 3PUFA 3S93A 2GXBA 3HM5A 1IZ1A 1LDJA 5L3DA 1YTYA 2MD5A 2LLKA 2W82A 4XBFA 1D1AA 3QP6A 2LYCA 4LLGF 2R7ZJ 2HYFA 1YE9A 2XSJC 3LFKA 3DTIA 2YU9J 1YRNA 3BG3A 3VYSB 5ED4A 2IXSA 2UWMA 2QYOA 4A3MJ 1Y39A 1TTYA 2OC6A 2EH3A 2K3PA 2AQFA 1BR4A 1R36A 4PJ0C 4EJWA 2TCTA 3P9IA 1C0WA 1U6GA 3CUQA 1MJBA 1ZAOA 5HVQC 1ZRFA 2HS5A 2KPMA 4I7HA 4BQOA 3D5LA 1F1ZA 3LWFA 3FM5A 5HLGA 4BHPA 2RDPA 3BJOA 1WH5A 2MG4A 5K7FA 4XIDA 5K7HA 3OYDA 4UNOA 4DYCA 2EA2A 5EG0A 1IF1A 4A5NA 2VT3A 2FOKA 3H9QA 3WU0A 2HXIA 3Q0UA 2LY1A 1JHHA 4IRGA 2EZLA 4HV6A 4EMSA 2R7FA 2M1BA 3H0DA 2K27A 3K4NA 3K70C 1JJ8C 3QP5A 4GXOA 3F8FA 1AWCA 3E5UA 1EH6A 1OQYA 1EKEA 2O7OA 1QNTA 2EIJH 2EFPA 1RKTA 4HYEA 3CTAA 1MNDA 3HSFA 1VF9A 2COBA 3CESA 4C9YA 1DGRM 3BZCA 2Y9ZA 4D7NA 1TQMA 3V7RA 4XLCA 3GZ5A 2NOGA 3DTEA 4RLFA 1W1WE 2HOAA 1X1BA 3GBGA 2FMLA 1H88C 3LSIA 2K40A 2HOTA 1VQ6I 1QU3A 2R5YA 1S6LA 1R1TA 1GV2A 4ZYGA 5LHGA 3CD6I 2DA1A 1TC3C 3WTTC 2E60A 4HSTA 4NDLA 3JRFA 5J47A 3KYCB 3U9GA 2NVUB 4OIPF 2W57A 2WAEA 3ECHA 5FKMA 5DM6F 4IEJA 1PVEA 3TW7A 4IHWA 1L0OC 2F5CA 1Z6RA 2G7HA 1ETXA 2WTEA 2GQQA 2VOPA 5FKLA 4RAZA 4V2GA 3MFKA 1OYYA 5GP9A 1NG7A 4U0WA 5IP9J 5D6FA 2HXOA 2EJRA 3MVPA 3BR2A 3JSOA 1B4AA 3QYFA 2FQ4A 1YJWI 4RGSA 3FMSA 3AAFA 1J5YA 3FZVA 2NOJB 4XR6A 4ENKA 4LMYA 3OL4A 5EEAA 4PK4A 2QQ9A 3Q3SA 4I01A 2DLLA 2BBYA 2IA0A 2Y30A 2HVRA 4G6DA 5ILVA 3TO7A 1NHAA 2JN6A 1XS9A 1XGNA 4A3GJ 2DDAA 4BBSJ 1XGMA 2NS7A 2YUSA 4IQJA 5FRMA 2ZXHA 2ZMEA 1ZH5A 4YRVA 1S3JA 5IYDJ 4I0BA 1PYVA 3HOXJ 3GEZA 3NQOA 4ESJA 2IPQX 4RGXA 4L0YB 4UV8A 5IOYA 5AONA 2OCCH 5E1WA 2MABA 5J1RA 3WHCA 2EV6A 2VKVA 3HG9A 2V1XA 1T95A 2H6CA 1GT0C 3ISPA 3S2WA 3S15J 5ICFA 2JWTA 2X1CA 3WODF 4A2UA 3VB2A 4MO7A 3DLAA 1XC5A 4F91B 2WV1A 3FKIJ 2VN2A 3E3VA 1MBKA 2F4IA 1P4XA 2E1CA 4KJZA 2IA2A 3QU6A 4M6YA 1O3RA 1DU0A 4FETA 1JJ6C 4FX0A 2JA5J 3BOQA 4XKWA 3KZYA 2X6XA 1SAUA 2BY1A 3M4OJ 1RNLA 2ZKZA 1GVJA 1X4PA 4B43A 3I4NJ 3GVAA 2MFZA 3AG4H 2KIMA 3MKWB 3CO6C 5IYBJ 1F5TA 3LSGA 1AA7A 4UB8C 2QM3A 2Y69H 3IC7A 3F23A 4BJ6C 2DAOA 1RETA 4UVBA 1BW6A 2IJLA 4II3A 3ZRGA 2M4KA 3JREA 1ZRCA 2ZJQF 1JT6A 2WAQN 4MQ9F 1CQTA 2QZ8A 1V54H 3LSRA 2V6EA 3GTMJ 4DW6A 1X2NA 4PSXA 3BTIA 1FMVA 4CSWA 1X1CA 5F6FA 4CYDA 4LG0B 5J3LA 1IRXA 1WVRA 1YOVB 3MEXA 3RYRA 3TDUC 4XK4A 4EVIA 4FTHA 1XMAA 3CLOA 3F8BA 3FXOA 3QPSA 4E7JA 2LTPA 4HV5A 2Y9YA 1IV6A 2O9LA 1IRGA 3OYIA 1WHUA 3HIFA 2L9SA 2VE8A 5FFZA 1RUOA 2ZSIB 3GLXA 3JAMK 1R5ID 2O0YA 4FISA 1SFOJ 2VJIA 2CQKA 3BZ6A 1F9NA 1Z0XA 2VC0A 3PSIA 1D8JA 2UXNA 1XCVA 3K4LA 3H3VK 2Y48A 1AKHA 1OCPA 2A6EF 3M07A 1G3TA 2HNHA 4FE4A 2PMZN 3H5NA 3I71A 2M7AA 3AFHA 3FXJA 4LB6B 1AHDP 3TO6A 2Y31A 4CCJA 4EATA 2ZMEC 1R1VA 2HPIA 3TP3A 1D5VA 3OYFA 2JA7J 1XSVA 3RKXA 1BN5A 1TWGJ 3CCSI 2VT2A 1KU9A 3OL3A 1YJ9I 5DEQA 3EYYA 2YX4A 3BR1A 3BDDA 1S9HA 3WTSC 2WY7Q 1S72I 3PO2J 2M87A 4HF2A 4JP0A 5KAFC 1HBXG 5FGMA 5IT9K 3QPHA 3DKXA 4KFCA 5E3LA 1U9OA 1X1PA 2P5VA 5D8KB 4BY1J 5LRRA 4L9TA 5CPRB 4L9VA 4AU7A 2L02A 3HPGA 3ROUA 3FXQA 5CLSA 2P7CB 2G0EA 1J0RA 1T8IA 4KA4A 4C30A 2O03A 1B6AA 2DTRA 1FSEA 2QWWA 3CF2A 1IUYA 1I1SA 1SD4A 4I02A 1UHWA 2HVQA 5CYVA 1BI3A 2M8GX 1FP2A 4NQWA 4RLQA 4BACA 3CJTB 2DQRA 1FEXA 3PFYA 3SXYA 2CUFA 2DOAA 5BOXA 2NVXJ 1LKXA 3CJQB 1USTA 3S3NA 1ETWA 3CCJI 1R5HA 1R9TJ 3VSLA 3OOPA 5F27A 3SZPA 3DBLB 4IRHA 4B44A 3GFIA 3K4JA 3E1SA 3QPLA 5D4SA 4L9JA 3RKWA 3SFIA 3CCEI 3R0JA 2WWYA 4EGYA 1JI8A 1MZBA 2DOEA 4CCLA 2BHZA 3C3WA 5DS9A 2V1NA 3H9JA 5BQTA 4PSWA 4L5IA 4XLFA 3ZMVA 5JVGF 1PP7U 3OYBA 5E8IA 1HW5A 3M1EA 2M2EA 2QSGX 3LA3A 4E7LA 2WADA 1OCRH 2X51A 1IUFA 3CC4I 2K3FA 1Y1VJ 2XV4S 3I54A 2A6HF 3M1CA 2IS4A 2CUJA 2HOEA 2IS1A 5CVVA 3BR5A 3BTLA 2W48A 1MMSA 3NRVA 3S8PA 4F93B 5IPAA 3PO3J 2JRMA 1BW5A 1OMIA 1IXRC 3LA7A 1PUFA 2LG4A 4BBRJ 5HDNA 3H0GJ 1XCBA 3WG7H 1G59A 3CCMI 4IRIA 3ELKA 4GRIA 4HSRA 3DWLE 1X2MA 3FMQA 5M5WJ 4NC8A 1W0UA 4IX7A 1VQKI 2KQRA 3U21A 2OA4A 2HQAA 3E97A 1S5LC 5LD2C 4BQNA 1HSJA 1NK2P 1B72A 1HKQA 4EJVA 3LSJA 1APLC 1N25A 2A6TA 1RESA 4RB0A 5IOZA 2EZIA 3BWGA 3EDPA 3GTPJ 4A0ZA 2W85A 1FP1D 1FBUA 1J59A 3T5XA 1Q1HA 3A1YA 1LE8A 5F0CA 1SAXA 3SDGA 1Y6IA 1MH4A 4UUSB 1O4XA 2DK5A 4UB6C 4DGWB 4OIQF 3L2RA 5D5WB 4UUVA 5LFAA 5LGTA 2L3DA 3SEZA 1I5ZA 4IZZA 3H35A 4HLXA 1D0ZA 1SVOA 2A05A 2V79A 2IGOA 1WJAA 3F8NA 5IP6A 2RN7A 1RR7A 1WKMA 2IEKA 2VLAA 2KZGA 3KLNA 5L3FA 4DZPA 2Y0SA 3JRHA 2D2WA 1IRZA 5LBQA 4IHSA 2ADUA 4QSHA 1RIOH 3KP6A 2B7EA 5L3BA 4L5EA 2R92J 1BI2A 3RPUD 3GTQJ 3PQKA 3RJPA 2VE9A 1FOXA 1AOYA 3ZQGA 3D1NI 1EH7A 1SFEA 4A12A 1WQ2A 2CUZA 4A3KJ 5IYCJ 1Y8QB 2E1MC 4KN7X 2BGCA 2JA8J 1G8XA 1H89C 3AG2H 5TJJA 2ME0A 5LHIA 3DU6A 3V42A 4KMUX 2R7QA 3PSFA 1FIPA 4JX5A 3CCRI 3HOYJ 1FNNA 4LB5A 2MYSA 2F48A 1H9GA 3NAUA 1LFBA 3F22A 3EYIA 4IO9F 4ZDPA 3CCUI 3BR0A 4LIVA 1W4MA 1ZTRA 2EFWA 2M45A 1MMGA 1FWZA 3FWEA 1YRNB 2IGKA 2ZNZA 2FRHA 1VQ5I 5JHUA 1JTYA 4BGDA 4GDFA 2W84A 3OR1C 3ONQA 4GYIA 4ABZA 1FPQA 3GCMA 4BKXA 5GPCA 1XDSA 1YYVA 1FOYA 3DPLC 3CCYA 4XL9A 3U1DA 4ZTJA 1XX5A 3WTZA 3WHBA 5E79C 4RS8A 1OCTC 4D7MA 1FYMA 3CUQB 2W00A 2V9KA 4BXUA 4KUMA 4ZDLA 5DDGA 1U8BA 1VFCA 1VQ7I 5LEJA 3H3UA 5J4VA 1X3ZB 3DBRB 4XONA 4BYYA 3CMYA 4M9ZA 1NK3P 2YPRA 3X2QH 1UHMA 1A5JA 1XTAA 4WCGA 3FMRA 1N77A 1EV7A 5FLVA 3B6CA 5F64A 1R6RA 2ECBA 2STWA 4Y33A 2H94A 1D8KA 5FLXZ 4LD5A 4IJAA 2BV6A 2GM4A 1ZK8A 3ABUA 5LHHA 1W0TA 4BS9A 1VI0A 3BJAA 3BPVA 1XPXA 2PLYA 5H6QA 1KA8A 1KGSA 2QCOA 2YSRA 4B47A 1UZCA 4EJUA 2PI0A 2UZKA 4XICA 4GYGA 1D0YA 2K9QA 4DZJA 1OKRA 4EGZA 4MEXF 1E3PA 2EZKA 4ZZLA 2FJ1A 1DP7P 3B02A 3O6BB 4IKFA 2HYGD 4OMZA 4RGRA 4HNTA 4I99C 5F0HA 4P1WA 1QVUA 4NB5A 1ZR4A 2VC1A 4OOIA 1TT5B 4F3QA 2VBXA 3GWZA 1FY7A 5AIPA 2P6SA 4BUPA 3ABMH 2R5YB 3I0TA 5B5EC 5CKTA 1OR7A 2DFHA 3HOUJ 3GFJA 2KRFA 4I98B 1FTZA 4C3HJ 3REOA 4UUSA 3AKZA 2P0WA 3HOTA 3PJRA 4RBOA 3WTXC 4CHUA 4HX7A 2B0LA 4O6JA 4WXDA 1YLFA 1XG1A 3HHGA 3I56I 1P6RA 5EDNA 4UY8I 2PG4A 3ZQHA 1MBGA 3A2KA 1MJ9A 2DQLA 4XRFA 1Z1DA 4L0ZB 2L7KA 2M34A 3AL0B 1I3QJ 2KISA 2JZYA 4TV7A 3HOZJ 2Z99A 2PQ8A 2QVOA 4RAFA 3GTGJ 3BZKA 4B3AA 4M73A 2DBBA 2FA5A 2Q0OA 5DD4A 1R5GA 4HF0A 5E17F 3H92A 2XRNA 2FE3A 5EYRA 3H1CA 3S2DJ 2L2OA 2ZCWA 4DJAA 2IS6A 5E3OA 3HRSA 4RM2A 4B09A 3S16J 4CICA 3J7AY 1Z7LA 2EPFA 4DIQA 3BG7A 5FFXA 1MBHA 2K02A 4YG2F 2KT0A 4CA0A 1A31A 3PIPF 3ABTA 3R61A 3BC8A 3VODA 2ZXIA 2CFXA 1U78A 1MSFC 2LNBA 1TNSA 2R5ZA 4KIFA 2ZMEB 2E2HJ 1GDTA 1ZHFA 1FBQA 4XN0A 5IY5H 2Q2EA 2BW3B 3ECOA 3W2WA 3PUBA 5F1RA 1Z21A 1UB9A 1YFHA 2FBIA 4PJMA 2VODA 3KZZA 1S7AA 4G6QA 1A6QA 1ZGWA 2ZO4A 1T98A 1MH3A 4WF2A 3HEFA 3WTVC 1G4DA 4D9JA 2CU7A 2QSFX 5ICCA 5FD5A 2IT0A 3OYGA 3FBIB 4E6KG 3HXLA 3N97A 1T56A 4KITB 4M9SA 5GAHJ 1ACIA 1TWCJ 3FDYA 4M3BA 5EGOB 3S2HJ 1BIAA 1ON2A 1WCMJ 1Y0NA 2R7RA 2LREA 4N4NB 4XRSG 3G6EI 3ABKH 4N0BA 2MC3A 2XGXA 4XLAA 2UUZA 4ESBA 5JHFA 3DLLF 3WGGA 1MMDA 5DCMA 4BAYA 2E71A 4X0GA 2LKSA 1ETVA 1OR7C 1Y8RB 3KPHA 1RPWA 5JI6A 2F6CA 2JRTA 4XKVA 2XROA 4GGGA 2D45A 4A3DJ 3GYHX 1F36A 1ZG5A 3M3YJ 4J00A 1M1EB 3ZQQA 1WI3A 4AVPA 2R0QC 1RUNA 3E5QA 3IV5A 4U7DA 3P7NA 5EZHA 4Q48A 1Z91A 3JW4A 1BJAA 2ZBKA 1KZHA 3JTGA 1NH3A 1IN6A 3ZCOA 2GXAA 4JYKA 3TW6A 1Y0UA 1FLIA 3SDBA 2RGVA 1QRYA 4YIRX 3K70D 5K1YA 3PNTA 1YIOA 3SZTA 3QOEA 2CQXA 5JVTA 2M30A 4XKBA 2HQ5A 4IHYA 3M8FA 2ID3A 3ULQB 3ZQCA 3K0LA 3MAJA 5LGUA 2HVSA 2NVQJ 2VKHA 1FBSA 1OYWA 3F8CA 3HTUA 2J5PA 3HRUA 3SQNA 5DM7F 1LFPA 2NNNA 2MLGA 1WSUA 2ETHA 2LY2A 4ZYHA 3W6JB 3OS0A 5ICEA 2BVLA 2X85A 4Y17A 3WE3A 3GTKJ 1AKHB 3CLQA 4UXNA 1STZA 2CO5A 2AS5F 2OQGA 4DNCA 4OIRF 4PDKA 1K6OA 3HSEA 1EA3A 2VIXA 4MLOA 4RB1A 2EFQA 3ZMSA 1H9TA 2DA2A 3F72A 3CJRB 2OPTA 2QKLB 4M6XA 5EF6A 2LH9A 4ZZDA 3COAC 4E4HA 3PFIA 3F21A 2CV2A 2IRFG 9ANTA 5D8LB 3NARA 2VBWA 1TQPA 4E7HA 3I5UA 3PM1A 2Y2ZA 3TDZC 2UXXA 2LF8A 4QLCU 2F5FA 2OF7A 2PEXA 1FJLA 1LVAA 2HYJA 1GXQA 2MGQA 3IL2A 3RCOA 3LFUA 3KETA 3E6CC 1WWXA 2KJBA 3LA2A 3N4MA 5GAGJ 1F43A 2E1NA 2QKMB 1MNMC 2RV8A 5C4JJ 1HA8A 3K1MA 4W1UA 2XVCA 3G3ZA 4JX6A 3VDXA 2KDZA 3LL7A 2LF7A 1BR1A 2L9VA 4WWCA 3GZNB 4MEYF 4LFUA 2BW3A 4N4OB 2VXDA 5FROA 1V5FA 3HKZA 2XF6A 4HNVA 3CCLI 2OU2A 2HZDA 3FHNA 2BVMA 2ZSHB 4ANJA 2EFOA 3HRTA 4A0YA 4OU0A 2R7SA 1VQMI 4M3EA 2DA6A 4ESFA 3RDIA 2XRLA 2HZTA 3FK7A 4A0XA 4XORA 2XUBA 4BJTA 3OSFA 2L0KA 3E0JB 1T38A 4BHBA 3TGNA 3WGIA 1QHGA 5EGOA 2O5RA 2W4SA 3DBHB 2IGMA 3S3MA 4RB2C 4NQWB 3UNGC 3W6KB 4L18B 3ZR8X 1USSA 4BH9A 2KDOA 3S17J 4HDVA 3DCFA 4CH7A 1HKTA 2X9DA 1SD6A 4AYBA 3BQZA 3ERMA 3G1OA 3TQNA 4XRMA 4A93J 5M5YJ 4ENJA 4QWQA 2BEOA 2V4JC 2VI6A 2QBYA 1YS6A 2LC2A 1AU7A 1R58A 2E1MB 2K9LA 5EEGA 4BL0B 3I58A 4DYRA 2ELKA 2GA2A 3J81Z 2BY2A 2VOOA 4IL6C 3A03A 3PNYA 2MH2A 2LOOA 3CP2A 3S32A 2AXLA 2RAEA 2WB1N 3QOPA 5ERIA 2KIUA 4IHVA 4A3BJ 2E5NA 3CUOA 2PJRA 2OZUA 5CJ9A 2VPLA 2VKDA 1KQ0A 3SFZA 1SVMA 3VYTB 1JHFA 2ZB9A 3ZQIA 4MGRA 2XKOA 3U1KA 3ZQFA 2XPVA 2MD0A 3QU3A 4CZCA 3ZPLA 2BY0A 4CUGA 1POGA 1W7PA 3ZMUA 4HNUA 2DMTA 3K4KA 2ZFUA 2QQBA 3K2ZA 1T0FC 2TDXA 2W7NA 1FTTA 5DTDA 2BHYA 1PUFB 2WC2A 1UG2A 5IP7J 1IW7F 5C4XJ 5KCMA 4IVNA 2V7FA 2P7VB 2D1VA 2JA6J 1JUSA 5KHDA 3DEEA 2NYXA 4CCNA 1B72B 1B8IB 4OIOF 1KU3A 4G7OF 3Q5FA 1U9NA 2KRHA 2WA0A 2XF7A 3L7WA 1JKOC 2O6GE 5AIQA 4ZYDA 4A6EA 3TEDA 3C18A 1KU2A 4OAYA 4XN3A 3L2QA 3SEQA 5KAIC 4R1HA 2LFBA 1LE8B 3HDDA 4XOTA 4ZC3A 3Q9SA 3V7SA 3G1LA 3KFWX 3ZMTA 4EQQA 2CJJA 2CQQA 1JKQC 1HC8A 4A69C 1YG2A 4M9XA 1MMNA 4WXHA 1BBYA 2ID6A 2YR2A 3HHHA 5E1XA 3RZDJ 1R7JA 3J80Z 1WJEA 1WJ5A 2EQRA 2CWEA 1TLHB 1GV5A 2R7OA 1OCOH 5D6EA 3A01A 2VPRA 3OYEA 1O7LA 3U2RA 3LNQA 5FLXK 4UVAA 1FYLA 2FOWA 3UR3C 1SANA 2DK8A 2WB1A 5FB2A 2DN0A 3NWSA 3CDHA 4NUBA 2CRGA 1S7EA 4RA2A 4XM3A 1WFXA 1LDDA 2CFOA 1IC8A 1EF4A 3VPRA 1S7OA 3WTUC 1TBXA 2E19A 1QZEA 3I9V2 4BDYA 4E7ZA 4CO8A 4LLLA 1B1BA 1X3UA 2FSWA 3OOUA 2DXIA 1RRJA 2F5VA 2ISYA 2BXZA 3BQYA 2E7XA 1BOBA 4XOPA 2YU3A 1DU6A 3ZOBA 3GTJJ 3S1NJ 2DFFA 1YHQI 1SFUA 3FF5A 1QBJA 4B8XA 3GF2A 3LSKA 5J4YA 1H8AC 4EJOA 4N9IA 3QYEA 1R1UA 4CYCA 2XB0X 3HGGA 2OBPA 1MMAA 2HKXA 3EUHC 3KX2A 3NWTA 3L2VA 2ESNA 1MGTA 1O7FA 1YI2I 5HLTA 5H6RA 1LFUP 2QF7A 2DA4A 3DPTA 3FISA 3RQ4A 1PDNC 1EJ9A 3HGYA 2IA1A 4Y7NJ 4ZDOA 1MD0A 4PJLA 2V1DA 3MZHA 2EZHA 3FM3A 1ZGJA 3OYCA 4FCYA 4KNYA 5TGTA 4CCMA 1VQNI 5JFRA 3DPUA 1JT0A 1UAAA 2Y0SN 2X1DA 1ZELA 5D5VB 2WAFA 2R7VA 3J7YJ 2L5QA 1K78A 4E70A 2OQRA 3D5SC 3K4CA 1U5TC 1ULYA 3BY6A 1XDUA 2Z33A 4L5JA 5EJCA 1XGSA 2CS3A 4Z2YA 2ZJPF 2HOSA 1D1CA 2LDUA 2EILH 2DTZA 3DV8A 1SD5A 4E7IA 3KP5A 3KCCA 2QLZA 3BCAA 2LMDA 2W25A 4UVCA 4ZYAA 3TBIA 2ECCA 2NAZA 2EIKH 1XD7A 3IAM2 3TMOA 3W3CA 1W36D 1YX5A 2G7UA 1LJ9A 1DDNA 5GAEJ 2L7ZA 2I8DA 2WV0A 3ASOH 1YIJI 4Y52J 5L3EA 2M7BA 3MMYB 1ORKA 4HDUA 1ZN2A 4AWXB 1B8IA 1LDKB 4BE0A 2H1LA 4JQFA 2PMUA 3LSTA 1YJNI 2CW8A 1UMQA 4U0YA 2YS9A 5HDGA 4HAMA 1T08B 2ACJA 3HZJA 4J19A 2D5VA 3L1PA 3KEYA 3CMAI 4FX4A 3TOAA 2LK2A 4D0PA 3CO7C 2OD5A 4LIUA 1Z9CA 1D3YA 1LB2A 3BCBA 2R7XA 3OS1A 2JVGA 6PAXA 5DV5A 1K6YA 2MBFA 2VJ5A 2HKOA 3FBNB 1R4MB 4V2FA 3HUGB 2CQNA 2HTSA 1Z7UA 3I59B 4HEA2 5DCFA 2M3AA 2HI3A 3VOEA 3R4KA 5LLQA 4BQQA 2A69F 1VQ9I 2BZTA 2ZFWA 2K4JA 2R7UA 2ME6A 3EETA 4R79A 1WI9A 4NBQA 2HPMA 1LEBA 2LD5A 3LQRA 3L9FA 3ZGKA 3JSPA 2J5OA 2L4AA 1A35A 3LSMA 4RMNA 3OV8A 3WU2C 3LSHA 2IAIA 5CVUA 4B48A 3AG1H 3K7AJ 2PFBA 3JTHA 2NNYA 2L9RA 2FF4A 1R00A 3CMMA 4CCOA 4L9NA 1HDPA 3A0BC 5DYMA
chains in the Genus database with same CATH topology
1K7AA 2M5WA 3K1PA 1BI0A 2Q8KA 2Y75A 1KU7A 1OPCA 1DUXC 2HDCA 1J2XA 1B59A 2QENA 5HS8A 2D1HA 2ESHA 5HS7A 4PZJA 3H3ZA 3E6MA 4AIHA 2A3SA 2EA4A 5D5XB 5BPIA 1ZREA 4KN4X 2V9VA 3QAHA 1J9IA 5K5RA 1U2WA 1ZYRF 4G9YA 3FXUA 4LK0F 2L01A 3WTYC 1S8NA 2JPBA 4HQEA 1ZLKA 2CW0F 2KJCA 4ZYEA 1B9MA 5DCMB 2FBKA 1Z05A 4P9UA 4K2EA 5D4RA 3T0YA 1CF7A 1FZPB 4CZZA 2CYYA 4S05A 5L3GA 3IRRA 3E6BA 3SHFA 2GA1A 3HTSB 1T6SA 1S29A 3I4PA 1SMTA 2GAUA 4EM1A 3V8JA 2OAZA 1T39A 1XSDA 2CGPA 1F4KA 3KEQA 4JK1X 2DPDA 1REPC 1TQIA 3HUGA 3I59A 4IPAA 1UCRA 5K5QA 3RIRA 2XAJA 3GZ6A 1W5TA 3L2CA 3WTWC 5HLHA 3O3KA 3R0AA 3ERED 3TKYA 2V6CA 1TW2A 3IKTA 3DQVC 4ZH4F 1JGSA 3WG9A 1J75A 4LJZF 2ELHA 4M72A 1ODDA 1QO0D 4KDPA 4I2OA 1SFXA 1HW2A 1RI7A 4G7ZF 2XKPA 3J81K 4G7HF 2FNPA 2ZXJA 4U0VA 1GHCA 1P92A 1U3EM 2RVCA 4UV9A 4YIFA 4CDGA 1O3SA 4CXFA 4MQVA 3LAJA 2EWNA 2PBIA 1BM9A 1ZRDA 3DF8A 5L3CA 5H20A 1LNWA 3QRFF 3F6OA 1FOKA 2YX7A 2EV0A 1DPUA 3WE2A 5DUKA 4G8XA 3B73A 2FBHA 2DW4A 3GFLA 2L4MA 1HSTA 3DP7A 4I09A 4WX9A 4P5OA 2DU9A 2NS0A 3V4GA 1G3SA 1MDMB 1ON1A 4PGGA 4XSXF 5CVIA 1G3WA 3EQLF 4JBAA 2QBYB 4KICA 4GCVA 2FXAA 4YFXF 2XIGA 3HOSA 1KYWA 4O3MA 1YW8A 2LKPA 3GFMA 2X4HA 2P6TA 1QGPA 3J80K 1ZARA 1XN7A 4M71A 2HEOA 2F5EA 4I0AA 2KKOA 3IRQA 2GXGA 4F7ZA 3MWMA 1W7PB 1A04A 2HQNA 4HX4A 3P9KA 3GUDA 4MTDA 1HW1A 2HQRA 4MTEA 3M7GA 1XGOA 5D5UB 4DQ2A 1U5TB 2P4WA 2W24A 4IF4A 1DPRA 1J7KA 5HS9A 1BC8C 3O2PE 1G3YA 2KIFA 3E5XA 5HOOA 1EH8A 1RZ4A 3DKWA 1T0FA 3MZYA 5J8CA 4Q5SF 2EV5A 5TRDA 1XSXA 5HLIA 3ML6A 2EFNA 4P55A 2RNJA 4WK8F 3RI4A 2DO7A 2C6YA 2H09A 4G94A 2R7DA 3CUQC 4HLYA 3ZQ7A 1BIBA 2STTA 1U8RA 3T8RA 1JE8A 5A2QZ 3KLOA 1V4RA 4U88A 4RGUA 3I53A 3QPTA 5LRSA 3K9TA 2PJPA 5JR3A 3KE2A 3GW2A 4XLPF 1MDMA 4KYWA 1E17A 4XSZF 4LLNA 3M9AA 1MKMA 4RAYA 1ZG1A 5E1ZB 2VONA 2JTVA 1FX7A 4HOBA 3K1NA 1K79A 4A5MA 4IXAA 2A68F 2COMA 1IN5A 2EK5A 4OMYA 4FT8A 3DXJF 1IXCA 1YW7A 1K78B 2HWVA 2XAQA 3EUHA 1KQ8A 3HRMA 2HGCA 1PP8F 3K69A 4GO1A 3NEUA 2PN6A 3PQJA 3LQQA 1V3FA 4BHCA 1LQ1A 4ETSA 2BE5F 2DFIA 4BQAA 3FXRA 2M8EA 1LEAA 4Y13A 2O8XA 2HTJA 3IKVA 1UFMA 1YO5C 1U5TA 1P4AA 1MJAA 1ZG3A 1IN7A 2Y0MA 4FHTA 2A5YB 3HYIA 1FC3A 5E8GA 2X0LA 1QZYA 2Z3YA 1VTNC 2DPUA 4LGWA 1TNTA 5BPDA 2H27A 4M74A 2XHKA 3LAPA 4Y15A 2JT1A 4H0EA 3IWFA 1I6XA 1SD7A 3VFZA 2P8TA 5KK1A 3J7AO 1I27A 2FNAA 3VEPA 2K4BA 2EB7A 3ZP5A 4ENNA 4YFNF 3C1DA 2ZNYA 3RYPA 5E20A 2JPCA 3FX3A 1WRJA 1ONVA 5DUIA 4EM0B 4MNUA 2CG4A 4IHTA 3BJ6A 2IVMA 1XMKA 3C7JA 3RPUA 4KMFA 2R3SA 2P5LC 3D0SA 5BS6A 3GO5A 2Z9OA 1SMYF 5DD8A 4LK1F 2FMYA 5HDKA 1Z6TA 2F5DA 1TW3A 5J8FA 3DFGA 4KT5C 3E6DA 2XASA 2H6BA 2BYVE 4N9HA 2E7WA 2LSOA 2O3FA 1GXPA 2GIVA 2L54A 3R6SA 4AD9A 2VXZA 3RTRA 4EJTA 1O3TA 1W7PD 2RC4A 3DEUA 3IHUA 4NHJA 2A61A 4BNCA 2XAFA 2IP2A 2MA3A 1CF7B 4LG0A 4ENMA 3F8MA 1ZGAA 3GXOA 3ZMZA 4HBLA 2K7LA 3BP8A 1QQIA 4O5VA 4PCQA 4HX8A 5CVRA 3RPQA 2O61A 1R23A 1I1GA 2HR3A 1ZLJA 2HFHA 4ASNA 4UHTA 1HQCA 4AIKA 3FHZA 4S04A 2VBZA 1IRFA 4AIJA 3MCZA 5K5OA 1IXSB 1T2KA 3F3XA 1FSHA 1QPMA 5FD6A 3BROA 2GWRA 3V8KA 4HF1A 1YQAA 2GZWA 4KIGA 5E18F 1H0MA 3G73A 2VBYA 1KQ9A 3V8LA 3Q9VA 1FYKA 3WU1B 3L00A 3ZMDA 4OINF 2RKHA 4YFKF 1KYZA 3JAMZ 3BPXA 3WGHA 2G9WA 5CVJA 2OZ6A 4EV0A 1JXSA 4KIBA 4P9FA 2FQ3A 3ZN1A 4ON0A 1BC7C 1QZZA 3KP3A 1YS7A 3MQ0A 2DI3A 5ICGA 3F6VA 1O3QA 5KVRA 3T8TA 1XB4A 1W5SA 3KP4A 1E2XA 2XAHA 2NRAC 4P96A 3CJNA 2JSCA 3P9CA 4WXCA 3GX4X 2RQPA 3KP7A 1BI1A 4HW0A 3M8EA 2IW5A 5ILUA 1CGPA 4HQMA 5IT9Z 5LEKA 1B9NA 4MHGA 2K86A 2QUFA 4U7BA 5LGNA 5IT3A 1IN8A 1R22A 3T1BA 3V7CA 2QQAA 4RB3C 3TOBA 5ILSA 3ZN0A 2DT5A 1O57A 4R8HA 3R60A 2F2EA 3KP2A 3HSRA 1HXDA 2CSOA 5EEHA 5A2QK 3KEOA 1BOAA 4XLNF 4CGZA 1FT9A 4EM2A 1OYIA 1P2FA 2Z5UA 1YW9A 2PMHA 1G6NA 2MH9A 2FEZA 5BMZA 3L09A 3TO9A 2P5KA 2XAGA 4HZFA 2ISZA 1P4WA 4PGHA 4YIIA 1IAWA 4Q47A 2ZJ2A 1HKSA 4A6DA 1IN4A 1L3LA 2V1UA 4Q4ZF 5FO5A 5J6XA 2FU4A 3RKYA 2MLKA 3I64A 4HA8A 3IWZA 1PUEE 2A07F 2GXBA 1IZ1A 1LDJA 5L3DA 1YTYA 2MD5A 4XBFA 3QP6A 4LLGF 2HYFA 3LFKA 5ED4A 2UWMA 2QYOA 1TTYA 1R36A 4EJWA 3P9IA 1C0WA 1U6GA 3CUQA 1MJBA 1ZAOA 5HVQC 1ZRFA 2HS5A 4I7HA 3D5LA 1F1ZA 3LWFA 3FM5A 5HLGA 4BHPA 2RDPA 3BJOA 4UNOA 1IF1A 2EA2A 4A5NA 2VT3A 2FOKA 3WU0A 1JHHA 4IRGA 4HV6A 4EMSA 2R7FA 2M1BA 2K27A 3QP5A 4GXOA 3F8FA 1AWCA 3E5UA 1EH6A 1QNTA 2EFPA 4HYEA 3CTAA 3HSFA 1TQMA 3V7RA 3GZ5A 2FMLA 1S6LA 1R1TA 4ZYGA 5LHGA 3WTTC 3U9GA 4OIPF 2W57A 3ECHA 1L0OC 2F5CA 1Z6RA 2G7HA 2WTEA 2GQQA 2VOPA 4RAZA 3MFKA 1OYYA 4U0WA 5D6FA 2EJRA 3JSOA 1B4AA 4RGSA 3FMSA 3AAFA 1J5YA 3FZVA 4ENKA 4LMYA 2QQ9A 4I01A 2DLLA 2BBYA 2IA0A 4G6DA 5ILVA 3TO7A 1NHAA 1XGNA 1XGMA 2ZMEA 1ZH5A 1S3JA 4I0BA 3GEZA 3NQOA 4ESJA 2IPQX 4RGXA 4L0YB 4UV8A 5AONA 5E1WA 2EV6A 2V1XA 2H6CA 3ISPA 3S2WA 5ICFA 4A2UA 3WODF 3VB2A 2VN2A 3E3VA 1P4XA 2E1CA 2IA2A 3QU6A 4M6YA 1O3RA 4FX0A 3BOQA 3KZYA 1RNLA 2ZKZA 1GVJA 3GVAA 2KIMA 3CO6C 1F5TA 2QM3A 3IC7A 3F23A 2DAOA 4UVBA 2IJLA 1ZRCA 4MQ9F 2QZ8A 5F6FA 4CYDA 4LG0B 3MEXA 4EVIA 3TDUC 3RYRA 1XMAA 3CLOA 3F8BA 4HV5A 1IRGA 3HIFA 5FFZA 2VE8A 1RUOA 3GLXA 3JAMK 2O0YA 2CQKA 3BZ6A 1F9NA 2VC0A 1D8JA 2UXNA 1XCVA 2Y48A 2A6EF 1G3TA 3I71A 4LB6B 3TO6A 1R1VA 1D5VA 1XSVA 3RKXA 1BN5A 2VT2A 1KU9A 5DEQA 3EYYA 2YX4A 3BDDA 3WTSC 2M87A 4HF2A 1HBXG 5FGMA 5IT9K 3QPHA 4KFCA 5D8KB 2P5VA 5LRRA 4L9TA 4L9VA 2L02A 3ROUA 3FXQA 5CLSA 2P7CB 1J0RA 4KA4A 2O03A 1B6AA 2DTRA 1FSEA 2QWWA 1IUYA 1I1SA 1SD4A 4I02A 1UHWA 5CYVA 1BI3A 1FP2A 4NQWA 2DQRA 3SXYA 5BOXA 1USTA 1R5HA 3OOPA 3SZPA 4IRHA 3GFIA 5D4SA 4L9JA 3RKWA 3R0JA 2WWYA 4EGYA 1MZBA 3C3WA 5BQTA 4L5IA 3ZMVA 1PP7U 5E8IA 1HW5A 3M1EA 3LA3A 2XV4S 3I54A 2A6HF 2HOEA 5CVVA 3NRVA 1OMIA 1IXRC 3LA7A 5HDNA 1XCBA 4IRIA 3ELKA 3FMQA 2OA4A 3E97A 1HSJA 1HKQA 4EJVA 4RB0A 3BWGA 3EDPA 4A0ZA 2W85A 1FP1D 1FBUA 1J59A 3T5XA 1Q1HA 1SAXA 2DK5A 4OIQF 5D5WB 4UUVA 5LGTA 2L3DA 1I5ZA 4HLXA 2V79A 3F8NA 2RN7A 1WKMA 3KLNA 5L3FA 2D2WA 5LBQA 4IHSA 2ADUA 1RIOH 3KP6A 5L3BA 1BI2A 3PQKA 3RJPA 2VE9A 1AOYA 1EH7A 1SFEA 4A12A 1WQ2A 4KN7X 2BGCA 5TJJA 5LHIA 4KMUX 1FNNA 4LB5A 1H9GA 3F22A 3EYIA 1W4MA 2EFWA 2M45A 1FWZA 3FWEA 2ZNZA 2FRHA 5JHUA 2W84A 4GYIA 1FPQA 1XDSA 1YYVA 3DPLC 3U1DA 3WTZA 4RS8A 1FYMA 3CUQB 4BXUA 5DDGA 4KUMA 5LEJA 3H3UA 4BYYA 4M9ZA 2YPRA 1UHMA 4WCGA 3FMRA 1EV7A 5F64A 2STWA 2H94A 1D8KA 5FLXZ 4LD5A 4IJAA 2BV6A 3ABUA 5LHHA 3BJAA 3BPVA 2PLYA 5H6QA 1KA8A 1KGSA 2YSRA 4EJUA 2PI0A 2UZKA 4GYGA 1OKRA 4EGZA 4MEXF 4ZZLA 1DP7P 3B02A 3O6BB 2HYGD 4OMZA 4RGRA 4NB5A 2VC1A 4OOIA 2VBXA 3GWZA 1FY7A 5AIPA 2P6SA 3I0TA 1OR7A 3GFJA 2KRFA 4I98B 3REOA 3HOTA 3WTXC 4CHUA 4HX7A 2B0LA 4O6JA 4WXDA 1YLFA 3HHGA 1P6RA 2PG4A 1MJ9A 2DQLA 4XRFA 1Z1DA 4L0ZB 2JZYA 4TV7A 2Z99A 2PQ8A 2QVOA 4M73A 2DBBA 2FA5A 2Q0OA 5DD4A 1R5GA 4HF0A 5E17F 3H92A 2XRNA 2FE3A 2ZCWA 3HRSA 4B09A 4CICA 5FFXA 2K02A 4YG2F 3ABTA 3R61A 3VODA 2CFXA 1U78A 2LNBA 1TNSA 4KIFA 2ZMEB 1ZHFA 1FBQA 2Q2EA 3ECOA 5F1RA 1UB9A 1YFHA 2FBIA 2VODA 3KZZA 1S7AA 4G6QA 2ZO4A 1T98A 4WF2A 3WTVC 1G4DA 5ICCA 5FD5A 2IT0A 3N97A 4M9SA 1BIAA 1ON2A 4N0BA 2MC3A 2XGXA 4ESBA 3WGGA 5DCMA 4BAYA 5JI6A 2JRTA 2XROA 4GGGA 2D45A 3GYHX 1ZG5A 4AVPA 1RUNA 3E5QA 4U7DA 3P7NA 4Q48A 1Z91A 3JW4A 1BJAA 2ZBKA 3JTGA 1IN6A 1Y0UA 1FLIA 2RGVA 5K1YA 1YIOA 3SZTA 5JVTA 2M30A 3M8FA 3ULQB 3K0LA 3MAJA 5LGUA 1FBSA 1OYWA 3F8CA 3HTUA 2J5PA 3HRUA 3SQNA 2NNNA 2MLGA 1WSUA 2ETHA 4ZYHA 3W6JB 5ICEA 4Y17A 3WE3A 4UXNA 1STZA 2CO5A 2AS5F 2OQGA 4DNCA 4OIRF 4PDKA 1K6OA 3HSEA 4RB1A 2EFQA 3ZMSA 1H9TA 3F72A 4M6XA 4ZZDA 3COAC 2IRFG 3PFIA 3F21A 5D8LB 2VBWA 1TQPA 3I5UA 3TDZC 2UXXA 2LF8A 4QLCU 2F5FA 2PEXA 1LVAA 1GXQA 3IL2A 3KETA 3E6CC 1WWXA 2KJBA 3LA2A 3N4MA 2E1NA 2RV8A 3K1MA 2XVCA 3G3ZA 2LF7A 4WWCA 4MEYF 4A0XA 4LFUA 2OU2A 2EFOA 3HRTA 4A0YA 4OU0A 4ESFA 3RDIA 2HZTA 2XUBA 1T38A 4BHBA 3TGNA 3WGIA 4RB2C 3W6KB 4L18B 1USSA 4BH9A 4HDVA 1HKTA 1SD6A 3TQNA 4ENJA 4QWQA 2BEOA 2QBYA 1YS6A 1R58A 5EEGA 3I58A 2GA2A 3J81Z 2VOOA 2MH2A 2AXLA 3QOPA 5ERIA 2KIUA 3CUOA 2OZUA 5CJ9A 1KQ0A 3SFZA 1JHFA 4MGRA 2XKOA 3QU3A 3ZPLA 1W7PA 3ZMUA 2QQBA 3K2ZA 2TDXA 2WC2A 1IW7F 4IVNA 2P7VB 2D1VA 2NYXA 4OIOF 1KU3A 4G7OF 3Q5FA 3L7WA 2O6GE 5AIQA 4ZYDA 4A6EA 3C18A 1KU2A 4R1HA 3Q9SA 3V7SA 3KFWX 3ZMTA 4EQQA 1YG2A 4WXHA 5E1XA 4M9XA 1BBYA 2YR2A 3HHHA 1R7JA 3J80Z 2CWEA 1TLHB 5D6EA 5FLXK 1O7LA 3U2RA 4UVAA 1FYLA 2DK8A 5FB2A 3CDHA 1LDDA 1S7OA 3WTUC 1TBXA 4CO8A 4LLLA 1B1BA 1X3UA 2FSWA 2ISYA 2E7XA 2YU3A 1SFUA 3FF5A 1QBJA 4B8XA 3GF2A 4EJOA 4N9IA 1R1UA 2OBPA 2HKXA 2ESNA 1MGTA 1O7FA 5H6RA 3DPTA 1PDNC 2IA1A 1MD0A 2V1DA 3MZHA 3FM3A 1ZGJA 4KNYA 5JFRA 5D5VB 1K78A 4E70A 2OQRA 1U5TC 1ULYA 3BY6A 1XDUA 2Z33A 4L5JA 1XGSA 4Z2YA 2LDUA 3DV8A 1SD5A 3KP5A 3KCCA 2QLZA 4UVCA 2W25A 2NAZA 1XD7A 2G7UA 1LJ9A 1DDNA 2WV0A 5L3EA 4HDUA 1ZN2A 4AWXB 1LDKB 4JQFA 2PMUA 3LSTA 4U0YA 5HDGA 4HAMA 2ACJA 4FX4A 3TOAA 4D0PA 3CO7C 2OD5A 1Z9CA 1D3YA 1LB2A 6PAXA 5DV5A 2MBFA 2HKOA 2HTSA 1Z7UA 3I59B 5DCFA 3VOEA 3R4KA 5LLQA 2A69F 2ZFWA 2K4JA 3EETA 4R79A 1WI9A 1LEBA 3LQRA 3L9FA 3JSPA 2J5OA 2L4AA 3OV8A 5CVUA 2PFBA 3JTHA 2NNYA 2FF4A 1R00A 4L9NA 5DYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K7A A;  2M5W A;  3K1P A;  1BI0 A;  2Q8K A;  2Y75 A;  1KU7 A;  1OPC A;  1DUX C;  2HDC A;  1J2X A;  1B59 A;  2QEN A;  5HS8 A;  2D1H A;  2ESH A;  5HS7 A;  4PZJ A;  3H3Z A;  3E6M A;  4AIH A;  2A3S A;  2EA4 A;  5D5X B;  5BPI A;  1ZRE A;  4KN4 X;  2V9V A;  3QAH A;  1J9I A;  5K5R A;  1U2W A;  1ZYR F;  4G9Y A;  3FXU A;  4LK0 F;  2L01 A;  3WTY C;  1S8N A;  2JPB A;  4HQE A;  1ZLK A;  2CW0 F;  2KJC A;  4ZYE A;  1B9M A;  5DCM B;  2FBK A;  1Z05 A;  4P9U A;  4K2E A;  5D4R A;  3T0Y A;  1CF7 A;  1FZP B;  4CZZ A;  2CYY A;  4S05 A;  5L3G A;  3IRR A;  3E6B A;  3SHF A;  2GA1 A;  3HTS B;  1T6S A;  1S29 A;  3I4P A;  1SMT A;  2GAU A;  4EM1 A;  3V8J A;  2OAZ A;  1T39 A;  1XSD A;  2CGP A;  1F4K A;  3KEQ A;  4JK1 X;  2DPD A;  1REP C;  1TQI A;  3HUG A;  3I59 A;  4IPA A;  1UCR A;  5K5Q A;  3RIR A;  2XAJ A;  3GZ6 A;  1W5T A;  3L2C A;  3WTW C;  5HLH A;  3O3K A;  3R0A A;  3ERE D;  3TKY A;  2V6C A;  1TW2 A;  3IKT A;  3DQV C;  4ZH4 F;  1JGS A;  3WG9 A;  1J75 A;  4LJZ F;  2ELH A;  4M72 A;  1ODD A;  1QO0 D;  4KDP A;  4I2O A;  1SFX A;  1HW2 A;  1RI7 A;  4G7Z F;  2XKP A;  3J81 K;  4G7H F;  2FNP A;  2ZXJ A;  4U0V A;  1GHC A;  1P92 A;  1U3E M;  2RVC A;  4UV9 A;  4YIF A;  4CDG A;  1O3S A;  4CXF A;  4MQV A;  3LAJ A;  2EWN A;  2PBI A;  1BM9 A;  1ZRD A;  3DF8 A;  5L3C A;  5H20 A;  1LNW A;  3QRF F;  3F6O A;  1FOK A;  2YX7 A;  2EV0 A;  1DPU A;  3WE2 A;  5DUK A;  4G8X A;  3B73 A;  2FBH A;  2DW4 A;  3GFL A;  2L4M A;  1HST A;  3DP7 A;  4I09 A;  4WX9 A;  4P5O A;  2DU9 A;  2NS0 A;  3V4G A;  1G3S A;  1MDM B;  1ON1 A;  4PGG A;  4XSX F;  5CVI A;  1G3W A;  3EQL F;  4JBA A;  2QBY B;  4KIC A;  4GCV A;  2FXA A;  4YFX F;  2XIG A;  3HOS A;  1KYW A;  4O3M A;  1YW8 A;  2LKP A;  3GFM A;  2X4H A;  2P6T A;  1QGP A;  3J80 K;  1ZAR A;  1XN7 A;  4M71 A;  2HEO A;  2F5E A;  4I0A A;  2KKO A;  3IRQ A;  2GXG A;  4F7Z A;  3MWM A;  1W7P B;  1A04 A;  2HQN A;  4HX4 A;  3P9K A;  3GUD A;  4MTD A;  1HW1 A;  2HQR A;  4MTE A;  3M7G A;  1XGO A;  5D5U B;  4DQ2 A;  1U5T B;  2P4W A;  2W24 A;  4IF4 A;  1DPR A;  1J7K A;  5HS9 A;  1BC8 C;  3O2P E;  1G3Y A;  2KIF A;  3E5X A;  5HOO A;  1EH8 A;  1RZ4 A;  3DKW A;  1T0F A;  3MZY A;  5J8C A;  4Q5S F;  2EV5 A;  5TRD A;  1XSX A;  5HLI A;  3ML6 A;  2EFN A;  4P55 A;  2RNJ A;  4WK8 F;  3RI4 A;  2DO7 A;  2C6Y A;  2H09 A;  4G94 A;  2R7D A;  3CUQ C;  4HLY A;  3ZQ7 A;  1BIB A;  2STT A;  1U8R A;  3T8R A;  1JE8 A;  5A2Q Z;  3KLO A;  1V4R A;  4U88 A;  4RGU A;  3I53 A;  3QPT A;  5LRS A;  3K9T A;  2PJP A;  5JR3 A;  3KE2 A;  3GW2 A;  4XLP F;  1MDM A;  4KYW A;  1E17 A;  4XSZ F;  4LLN A;  3M9A A;  1MKM A;  4RAY A;  1ZG1 A;  5E1Z B;  2VON A;  2JTV A;  1FX7 A;  4HOB A;  3K1N A;  1K79 A;  4A5M A;  4IXA A;  2A68 F;  2COM A;  1IN5 A;  2EK5 A;  4OMY A;  4FT8 A;  3DXJ F;  1IXC A;  1YW7 A;  1K78 B;  2HWV A;  2XAQ A;  3EUH A;  1KQ8 A;  3HRM A;  2HGC A;  1PP8 F;  3K69 A;  4GO1 A;  3NEU A;  2PN6 A;  3PQJ A;  3LQQ A;  1V3F A;  4BHC A;  1LQ1 A;  4ETS A;  2BE5 F;  2DFI A;  4BQA A;  3FXR A;  2M8E A;  1LEA A;  4Y13 A;  2O8X A;  2HTJ A;  3IKV A;  1UFM A;  1YO5 C;  1U5T A;  1P4A A;  1MJA A;  1ZG3 A;  1IN7 A;  2Y0M A;  4FHT A;  2A5Y B;  3HYI A;  1FC3 A;  5E8G A;  2X0L A;  1QZY A;  2Z3Y A;  1VTN C;  2DPU A;  4LGW A;  1TNT A;  5BPD A;  2H27 A;  4M74 A;  2XHK A;  3LAP A;  4Y15 A;  2JT1 A;  4H0E A;  3IWF A;  1I6X A;  1SD7 A;  3VFZ A;  2P8T A;  5KK1 A;  3J7A O;  1I27 A;  2FNA A;  3VEP A;  2K4B A;  2EB7 A;  3ZP5 A;  4ENN A;  4YFN F;  3C1D A;  2ZNY A;  3RYP A;  5E20 A;  2JPC A;  3FX3 A;  1WRJ A;  1ONV A;  5DUI A;  4EM0 B;  4MNU A;  2CG4 A;  4IHT A;  3BJ6 A;  2IVM A;  1XMK A;  3C7J A;  3RPU A;  4KMF A;  2R3S A;  2P5L C;  3D0S A;  5BS6 A;  3GO5 A;  2Z9O A;  1SMY F;  5DD8 A;  4LK1 F;  2FMY A;  5HDK A;  1Z6T A;  2F5D A;  1TW3 A;  5J8F A;  3DFG A;  4KT5 C;  3E6D A;  2XAS A;  2H6B A;  2BYV E;  4N9H A;  2E7W A;  2LSO A;  2O3F A;  1GXP A;  2GIV A;  2L54 A;  3R6S A;  4AD9 A;  2VXZ A;  3RTR A;  4EJT A;  1O3T A;  1W7P D;  2RC4 A;  3DEU A;  3IHU A;  4NHJ A;  2A61 A;  4BNC A;  2XAF A;  2IP2 A;  2MA3 A;  1CF7 B;  4LG0 A;  4ENM A;  3F8M A;  1ZGA A;  3GXO A;  3ZMZ A;  4HBL A;  2K7L A;  3BP8 A;  1QQI A;  4O5V A;  4PCQ A;  4HX8 A;  5CVR A;  3RPQ A;  2O61 A;  1R23 A;  1I1G A;  2HR3 A;  1ZLJ A;  2HFH A;  4ASN A;  4UHT A;  1HQC A;  4AIK A;  3FHZ A;  4S04 A;  2VBZ A;  1IRF A;  4AIJ A;  3MCZ A;  5K5O A;  1IXS B;  1T2K A;  3F3X A;  1FSH A;  1QPM A;  5FD6 A;  3BRO A;  2GWR A;  3V8K A;  4HF1 A;  1YQA A;  2GZW A;  4KIG A;  5E18 F;  1H0M A;  3G73 A;  2VBY A;  1KQ9 A;  3V8L A;  3Q9V A;  1FYK A;  3WU1 B;  3L00 A;  3ZMD A;  4OIN F;  2RKH A;  4YFK F;  1KYZ A;  3JAM Z;  3BPX A;  3WGH A;  2G9W A;  5CVJ A;  2OZ6 A;  4EV0 A;  1JXS A;  4KIB A;  4P9F A;  2FQ3 A;  3ZN1 A;  4ON0 A;  1BC7 C;  1QZZ A;  3KP3 A;  1YS7 A;  3MQ0 A;  2DI3 A;  5ICG A;  3F6V A;  1O3Q A;  5KVR A;  3T8T A;  1XB4 A;  1W5S A;  3KP4 A;  1E2X A;  2XAH A;  2NRA C;  4P96 A;  3CJN A;  2JSC A;  3P9C A;  4WXC A;  3GX4 X;  2RQP A;  3KP7 A;  1BI1 A;  4HW0 A;  3M8E A;  2IW5 A;  5ILU A;  1CGP A;  4HQM A;  5IT9 Z;  5LEK A;  1B9N A;  4MHG A;  2K86 A;  2QUF A;  4U7B A;  5LGN A;  5IT3 A;  1IN8 A;  1R22 A;  3T1B A;  3V7C A;  2QQA A;  4RB3 C;  3TOB A;  5ILS A;  3ZN0 A;  2DT5 A;  1O57 A;  4R8H A;  3R60 A;  2F2E A;  3KP2 A;  3HSR A;  1HXD A;  2CSO A;  5EEH A;  5A2Q K;  3KEO A;  1BOA A;  4XLN F;  4CGZ A;  1FT9 A;  4EM2 A;  1OYI A;  1P2F A;  2Z5U A;  1YW9 A;  2PMH A;  1G6N A;  2MH9 A;  2FEZ A;  5BMZ A;  3L09 A;  3TO9 A;  2P5K A;  2XAG A;  4HZF A;  2ISZ A;  1P4W A;  4PGH A;  4YII A;  1IAW A;  4Q47 A;  2ZJ2 A;  1HKS A;  4A6D A;  1IN4 A;  1L3L A;  2V1U A;  4Q4Z F;  5FO5 A;  5J6X A;  2FU4 A;  3RKY A;  2MLK A;  3I64 A;  4HA8 A;  3IWZ A;  1PUE E;  2A07 F;  2GXB A;  1IZ1 A;  1LDJ A;  5L3D A;  1YTY A;  2MD5 A;  4XBF A;  3QP6 A;  4LLG F;  2HYF A;  3LFK A;  5ED4 A;  2UWM A;  2QYO A;  1TTY A;  1R36 A;  4EJW A;  3P9I A;  1C0W A;  1U6G A;  3CUQ A;  1MJB A;  1ZAO A;  5HVQ C;  1ZRF A;  2HS5 A;  4I7H A;  3D5L A;  1F1Z A;  3LWF A;  3FM5 A;  5HLG A;  4BHP A;  2RDP A;  3BJO A;  4UNO A;  1IF1 A;  2EA2 A;  4A5N A;  2VT3 A;  2FOK A;  3WU0 A;  1JHH A;  4IRG A;  4HV6 A;  4EMS A;  2R7F A;  2M1B A;  2K27 A;  3QP5 A;  4GXO A;  3F8F A;  1AWC A;  3E5U A;  1EH6 A;  1QNT A;  2EFP A;  4HYE A;  3CTA A;  3HSF A;  1TQM A;  3V7R A;  3GZ5 A;  2FML A;  1S6L A;  1R1T A;  4ZYG A;  5LHG A;  3WTT C;  3U9G A;  4OIP F;  2W57 A;  3ECH A;  1L0O C;  2F5C A;  1Z6R A;  2G7H A;  2WTE A;  2GQQ A;  2VOP A;  4RAZ A;  3MFK A;  1OYY A;  4U0W A;  5D6F A;  2EJR A;  3JSO A;  1B4A A;  4RGS A;  3FMS A;  3AAF A;  1J5Y A;  3FZV A;  4ENK A;  4LMY A;  2QQ9 A;  4I01 A;  2DLL A;  2BBY A;  2IA0 A;  4G6D A;  5ILV A;  3TO7 A;  1NHA A;  1XGN A;  1XGM A;  2ZME A;  1ZH5 A;  1S3J A;  4I0B A;  3GEZ A;  3NQO A;  4ESJ A;  2IPQ X;  4RGX A;  4L0Y B;  4UV8 A;  5AON A;  5E1W A;  2EV6 A;  2V1X A;  2H6C A;  3ISP A;  3S2W A;  5ICF A;  4A2U A;  3WOD F;  3VB2 A;  2VN2 A;  3E3V A;  1P4X A;  2E1C A;  2IA2 A;  3QU6 A;  4M6Y A;  1O3R A;  4FX0 A;  3BOQ A;  3KZY A;  1RNL A;  2ZKZ A;  1GVJ A;  3GVA A;  2KIM A;  3CO6 C;  1F5T A;  2QM3 A;  3IC7 A;  3F23 A;  2DAO A;  4UVB A;  2IJL A;  1ZRC A;  4MQ9 F;  2QZ8 A;  5F6F A;  4CYD A;  4LG0 B;  3MEX A;  4EVI A;  3TDU C;  3RYR A;  1XMA A;  3CLO A;  3F8B A;  4HV5 A;  1IRG A;  3HIF A;  5FFZ A;  2VE8 A;  1RUO A;  3GLX A;  3JAM K;  2O0Y A;  2CQK A;  3BZ6 A;  1F9N A;  2VC0 A;  1D8J A;  2UXN A;  1XCV A;  2Y48 A;  2A6E F;  1G3T A;  3I71 A;  4LB6 B;  3TO6 A;  1R1V A;  1D5V A;  1XSV A;  3RKX A;  1BN5 A;  2VT2 A;  1KU9 A;  5DEQ A;  3EYY A;  2YX4 A;  3BDD A;  3WTS C;  2M87 A;  4HF2 A;  1HBX G;  5FGM A;  5IT9 K;  3QPH A;  4KFC A;  5D8K B;  2P5V A;  5LRR A;  4L9T A;  4L9V A;  2L02 A;  3ROU A;  3FXQ A;  5CLS A;  2P7C B;  1J0R A;  4KA4 A;  2O03 A;  1B6A A;  2DTR A;  1FSE A;  2QWW A;  1IUY A;  1I1S A;  1SD4 A;  4I02 A;  1UHW A;  5CYV A;  1BI3 A;  1FP2 A;  4NQW A;  2DQR A;  3SXY A;  5BOX A;  1UST A;  1R5H A;  3OOP A;  3SZP A;  4IRH A;  3GFI A;  5D4S A;  4L9J A;  3RKW A;  3R0J A;  2WWY A;  4EGY A;  1MZB A;  3C3W A;  5BQT A;  4L5I A;  3ZMV A;  1PP7 U;  5E8I A;  1HW5 A;  3M1E A;  3LA3 A;  2XV4 S;  3I54 A;  2A6H F;  2HOE A;  5CVV A;  3NRV A;  1OMI A;  1IXR C;  3LA7 A;  5HDN A;  1XCB A;  4IRI A;  3ELK A;  3FMQ A;  2OA4 A;  3E97 A;  1HSJ A;  1HKQ A;  4EJV A;  4RB0 A;  3BWG A;  3EDP A;  4A0Z A;  2W85 A;  1FP1 D;  1FBU A;  1J59 A;  3T5X A;  1Q1H A;  1SAX A;  2DK5 A;  4OIQ F;  5D5W B;  4UUV A;  5LGT A;  2L3D A;  1I5Z A;  4HLX A;  2V79 A;  3F8N A;  2RN7 A;  1WKM A;  3KLN A;  5L3F A;  2D2W A;  5LBQ A;  4IHS A;  2ADU A;  1RIO H;  3KP6 A;  5L3B A;  1BI2 A;  3PQK A;  3RJP A;  2VE9 A;  1AOY A;  1EH7 A;  1SFE A;  4A12 A;  1WQ2 A;  4KN7 X;  2BGC A;  5TJJ A;  5LHI A;  4KMU X;  1FNN A;  4LB5 A;  1H9G A;  3F22 A;  3EYI A;  1W4M A;  2EFW A;  2M45 A;  1FWZ A;  3FWE A;  2ZNZ A;  2FRH A;  5JHU A;  2W84 A;  4GYI A;  1FPQ A;  1XDS A;  1YYV A;  3DPL C;  3U1D A;  3WTZ A;  4RS8 A;  1FYM A;  3CUQ B;  4BXU A;  5DDG A;  4KUM A;  5LEJ A;  3H3U A;  4BYY A;  4M9Z A;  2YPR A;  1UHM A;  4WCG A;  3FMR A;  1EV7 A;  5F64 A;  2STW A;  2H94 A;  1D8K A;  5FLX Z;  4LD5 A;  4IJA A;  2BV6 A;  3ABU A;  5LHH A;  3BJA A;  3BPV A;  2PLY A;  5H6Q A;  1KA8 A;  1KGS A;  2YSR A;  4EJU A;  2PI0 A;  2UZK A;  4GYG A;  1OKR A;  4EGZ A;  4MEX F;  4ZZL A;  1DP7 P;  3B02 A;  3O6B B;  2HYG D;  4OMZ A;  4RGR A;  4NB5 A;  2VC1 A;  4OOI A;  2VBX A;  3GWZ A;  1FY7 A;  5AIP A;  2P6S A;  3I0T A;  1OR7 A;  3GFJ A;  2KRF A;  4I98 B;  3REO A;  3HOT A;  3WTX C;  4CHU A;  4HX7 A;  2B0L A;  4O6J A;  4WXD A;  1YLF A;  3HHG A;  1P6R A;  2PG4 A;  1MJ9 A;  2DQL A;  4XRF A;  1Z1D A;  4L0Z B;  2JZY A;  4TV7 A;  2Z99 A;  2PQ8 A;  2QVO A;  4M73 A;  2DBB A;  2FA5 A;  2Q0O A;  5DD4 A;  1R5G A;  4HF0 A;  5E17 F;  3H92 A;  2XRN A;  2FE3 A;  2ZCW A;  3HRS A;  4B09 A;  4CIC A;  5FFX A;  2K02 A;  4YG2 F;  3ABT A;  3R61 A;  3VOD A;  2CFX A;  1U78 A;  2LNB A;  1TNS A;  4KIF A;  2ZME B;  1ZHF A;  1FBQ A;  2Q2E A;  3ECO A;  5F1R A;  1UB9 A;  1YFH A;  2FBI A;  2VOD A;  3KZZ A;  1S7A A;  4G6Q A;  2ZO4 A;  1T98 A;  4WF2 A;  3WTV C;  1G4D A;  5ICC A;  5FD5 A;  2IT0 A;  3N97 A;  4M9S A;  1BIA A;  1ON2 A;  4N0B A;  2MC3 A;  2XGX A;  4ESB A;  3WGG A;  5DCM A;  4BAY A;  5JI6 A;  2JRT A;  2XRO A;  4GGG A;  2D45 A;  3GYH X;  1ZG5 A;  4AVP A;  1RUN A;  3E5Q A;  4U7D A;  3P7N A;  4Q48 A;  1Z91 A;  3JW4 A;  1BJA A;  2ZBK A;  3JTG A;  1IN6 A;  1Y0U A;  1FLI A;  2RGV A;  5K1Y A;  1YIO A;  3SZT A;  5JVT A;  2M30 A;  3M8F A;  3ULQ B;  3K0L A;  3MAJ A;  5LGU A;  1FBS A;  1OYW A;  3F8C A;  3HTU A;  2J5P A;  3HRU A;  3SQN A;  2NNN A;  2MLG A;  1WSU A;  2ETH A;  4ZYH A;  3W6J B;  5ICE A;  4Y17 A;  3WE3 A;  4UXN A;  1STZ A;  2CO5 A;  2AS5 F;  2OQG A;  4DNC A;  4OIR F;  4PDK A;  1K6O A;  3HSE A;  4RB1 A;  2EFQ A;  3ZMS A;  1H9T A;  3F72 A;  4M6X A;  4ZZD A;  3COA C;  2IRF G;  3PFI A;  3F21 A;  5D8L B;  2VBW A;  1TQP A;  3I5U A;  3TDZ C;  2UXX A;  2LF8 A;  4QLC U;  2F5F A;  2PEX A;  1LVA A;  1GXQ A;  3IL2 A;  3KET A;  3E6C C;  1WWX A;  2KJB A;  3LA2 A;  3N4M A;  2E1N A;  2RV8 A;  3K1M A;  2XVC A;  3G3Z A;  2LF7 A;  4WWC A;  4MEY F;  4A0X A;  4LFU A;  2OU2 A;  2EFO A;  3HRT A;  4A0Y A;  4OU0 A;  4ESF A;  3RDI A;  2HZT A;  2XUB A;  1T38 A;  4BHB A;  3TGN A;  3WGI A;  4RB2 C;  3W6K B;  4L18 B;  1USS A;  4BH9 A;  4HDV A;  1HKT A;  1SD6 A;  3TQN A;  4ENJ A;  4QWQ A;  2BEO A;  2QBY A;  1YS6 A;  1R58 A;  5EEG A;  3I58 A;  2GA2 A;  3J81 Z;  2VOO A;  2MH2 A;  2AXL A;  3QOP A;  5ERI A;  2KIU A;  3CUO A;  2OZU A;  5CJ9 A;  1KQ0 A;  3SFZ A;  1JHF A;  4MGR A;  2XKO A;  3QU3 A;  3ZPL A;  1W7P A;  3ZMU A;  2QQB A;  3K2Z A;  2TDX A;  2WC2 A;  1IW7 F;  4IVN A;  2P7V B;  2D1V A;  2NYX A;  4OIO F;  1KU3 A;  4G7O F;  3Q5F A;  3L7W A;  2O6G E;  5AIQ A;  4ZYD A;  4A6E A;  3C18 A;  1KU2 A;  4R1H A;  3Q9S A;  3V7S A;  3KFW X;  3ZMT A;  4EQQ A;  1YG2 A;  4WXH A;  5E1X A;  4M9X A;  1BBY A;  2YR2 A;  3HHH A;  1R7J A;  3J80 Z;  2CWE A;  1TLH B;  5D6E A;  5FLX K;  1O7L A;  3U2R A;  4UVA A;  1FYL A;  2DK8 A;  5FB2 A;  3CDH A;  1LDD A;  1S7O A;  3WTU C;  1TBX A;  4CO8 A;  4LLL A;  1B1B A;  1X3U A;  2FSW A;  2ISY A;  2E7X A;  2YU3 A;  1SFU A;  3FF5 A;  1QBJ A;  4B8X A;  3GF2 A;  4EJO A;  4N9I A;  1R1U A;  2OBP A;  2HKX A;  2ESN A;  1MGT A;  1O7F A;  5H6R A;  3DPT A;  1PDN C;  2IA1 A;  1MD0 A;  2V1D A;  3MZH A;  3FM3 A;  1ZGJ A;  4KNY A;  5JFR A;  5D5V B;  1K78 A;  4E70 A;  2OQR A;  1U5T C;  1ULY A;  3BY6 A;  1XDU A;  2Z33 A;  4L5J A;  1XGS A;  4Z2Y A;  2LDU A;  3DV8 A;  1SD5 A;  3KP5 A;  3KCC A;  2QLZ A;  4UVC A;  2W25 A;  2NAZ A;  1XD7 A;  2G7U A;  1LJ9 A;  1DDN A;  2WV0 A;  5L3E A;  4HDU A;  1ZN2 A;  4AWX B;  1LDK B;  4JQF A;  2PMU A;  3LST A;  4U0Y A;  5HDG A;  4HAM A;  2ACJ A;  4FX4 A;  3TOA A;  4D0P A;  3CO7 C;  2OD5 A;  1Z9C A;  1D3Y A;  1LB2 A;  6PAX A;  5DV5 A;  2MBF A;  2HKO A;  2HTS A;  1Z7U A;  3I59 B;  5DCF A;  3VOE A;  3R4K A;  5LLQ A;  2A69 F;  2ZFW A;  2K4J A;  3EET A;  4R79 A;  1WI9 A;  1LEB A;  3LQR A;  3L9F A;  3JSP A;  2J5O A;  2L4A A;  3OV8 A;  5CVU A;  2PFB A;  3JTH A;  2NNY A;  2FF4 A;  1R00 A;  4L9N A;  5DYM A; 
#chains in the Genus database with same CATH topology
 3QQA A;  3F9K A;  1K7A A;  2M5W A;  3K1P A;  1BI0 A;  2Q8K A;  1D5Y A;  2R5Z B;  2L7F P;  2ZJR F;  3OSG A;  4B3X A;  2Y75 A;  2LP0 A;  1KU7 A;  1OPC A;  2DCE A;  3G71 I;  3FXK A;  1HOM A;  1DUX C;  2HDC A;  2Q2E B;  1WGX A;  3N05 A;  2FD5 A;  1J2X A;  2EIM H;  2HDD A;  3GTL J;  1KON A;  3H9G A;  2IBD A;  3W6V A;  1B59 A;  2ZXW H;  2QEN A;  5HS8 A;  1UEL B;  2D1H A;  2ESH A;  5HS7 A;  4PZJ A;  3FXL A;  4A3F J;  3H3Z A;  3E6M A;  4AIH A;  3MKY B;  3O8G A;  3JR9 A;  2A3S A;  4U87 A;  2EA4 A;  2E35 A;  4Y3O A;  4F92 B;  5D5X B;  5B1B H;  1XMX A;  1WPK A;  5BPI A;  4AM3 A;  2V9P A;  1JKP C;  1ZRE A;  4KN4 X;  2E36 A;  1E3O C;  3OYN A;  2V9V A;  3QAH A;  3HC7 A;  1J9I A;  5K5R A;  1U2W A;  1ZYR F;  3IAS 2;  4G9Y A;  3FXU A;  4LK0 F;  2L01 A;  3WTY C;  1S8N A;  2JPB A;  3HOW J;  4HQE A;  4ZTF A;  1ZLK A;  5B3S H;  2CW0 F;  2KJC A;  1IV8 A;  4ZYE A;  1B9M A;  5DCM B;  3RSN A;  1Y1W J;  2FBK A;  5J40 A;  2F4O B;  1W5C C;  2GIZ A;  1Z05 A;  4P9U A;  3UKG A;  3OIO A;  4K2E A;  5D4R A;  1VQL I;  3T0Y A;  1CF7 A;  1FZP B;  4CZZ A;  3TP0 A;  2CYY A;  4S05 A;  3QWL A;  3BLY A;  2CQ7 A;  5L3G A;  5FKK A;  3IRR A;  4YEJ A;  3E6B A;  1TT0 A;  2GA1 A;  3SHF A;  2VJ4 A;  3HTS B;  1X4O A;  1T6S A;  4XLE A;  1S29 A;  3I4P A;  1SMT A;  1ETY A;  2KIQ A;  2GAU A;  4BJ5 C;  1ZKG A;  4EM1 A;  3V8J A;  2OAZ A;  1MW7 A;  1T39 A;  1XSD A;  5GAD J;  2XDV A;  2CGP A;  1F4K A;  3A4C A;  3GLL A;  3KEQ A;  3CQZ J;  4JK1 X;  4AID A;  4JX4 A;  2DPD A;  1DP3 A;  1SVL A;  1REP C;  1ITY A;  1QA6 A;  1TQI A;  1BL0 A;  4PFP A;  3HUG A;  2KL4 A;  2LBF A;  3HBL A;  4BE1 A;  3I59 A;  4IPA A;  2B9S A;  1UCR A;  5K5Q A;  3RIR A;  3ZQL A;  2XAJ A;  3GZ6 A;  4M3G A;  1W5T A;  3L2C A;  3WTW C;  1GLN A;  1A6I A;  5HLH A;  3BG9 A;  3K6G A;  3O3K A;  3R0A A;  2BOL A;  2ICW G;  3TKY A;  4YEL A;  3ERE D;  2V6C A;  5F08 A;  1TW2 A;  3IKT A;  2OJE D;  3DQV C;  2OCE A;  4ZH4 F;  1JGS A;  3WG9 A;  1J75 A;  4LJZ F;  3LSP A;  2ELH A;  4EEF G;  3H5R A;  2L9N A;  4M72 A;  1MBE A;  1ODD A;  1QO0 D;  4KDP A;  4I2O A;  1V5G A;  1SFX A;  4G12 A;  1HW2 A;  3CP8 A;  1ETQ A;  1TZL A;  1RI7 A;  2CMP A;  2OTJ I;  4G7Z F;  2PX9 A;  2XKP A;  2VAS A;  5HOD A;  3J81 K;  4G7H F;  2FNP A;  5FJ8 J;  2KRC A;  1IO2 A;  2ZXJ A;  4U0V A;  1GHC A;  1P92 A;  1U3E M;  4DYQ A;  3I55 I;  2RVC A;  4UV9 A;  4YIF A;  4CDG A;  3AG3 H;  1O3S A;  2DOF A;  2MC4 A;  4CXF A;  4MQV A;  2KZV A;  2EWN A;  3LAJ A;  1V55 H;  2PBI A;  1BM9 A;  1ZRD A;  3DF8 A;  2X1E A;  5L3C A;  2Z16 A;  2CH0 A;  5H20 A;  1LNW A;  3QRF F;  3F6O A;  1FOK A;  5F1J A;  2YX7 A;  1TWA J;  2EV0 A;  1DPU A;  3WE2 A;  1JKR C;  5DUK A;  4G8X A;  3B73 A;  2FBH A;  2DW4 A;  3GFL A;  5JLW A;  2L4M A;  1ENH A;  1HST A;  3JCU C;  5M3F J;  3DP7 A;  4I09 A;  3K10 A;  4WX9 A;  4P5O A;  2DU9 A;  2NS0 A;  3IP4 B;  3KIO A;  2LR8 A;  3C2H A;  1IG7 A;  5FRN A;  3EUA A;  1K4S A;  2KMU A;  3V4G A;  1G3S A;  1MDM B;  2M0M A;  4F52 A;  3S3O A;  1ON1 A;  4X6A J;  2R7W A;  4PGG A;  4XSX F;  5CVI A;  5FLM J;  1G3W A;  3IH3 A;  2JQ7 A;  2NVY J;  3EQL F;  2AO9 A;  1D1B A;  3W2V A;  4JBA A;  4S0H B;  2I5U A;  1WJD A;  3VWB A;  3S14 J;  4X1E A;  2QBY B;  2LRD A;  4KIC A;  4GCV A;  1TL8 A;  1GVD A;  2FXA A;  4YFX F;  2WY8 Q;  2X6Y A;  2KLO A;  4QPO A;  2XIG A;  3HOS A;  3HOV J;  1KYW A;  5E3N A;  4O3M A;  1YW8 A;  1Q1V A;  2LKP A;  3GFM A;  3OY9 A;  2X4H A;  2X6O A;  1X3W B;  2P6T A;  1QGP A;  2DA3 A;  3FK6 A;  3ZXS A;  4RDU A;  3HKZ N;  2PJR B;  3J80 K;  1ZAR A;  1XN7 A;  4M71 A;  2HEO A;  2F5E A;  4I0A A;  2K9M A;  2KHM A;  2KKO A;  3J7Z I;  3IRQ A;  2AQE A;  1OCZ H;  1WJC A;  4IQ4 A;  2DFE A;  2XAU A;  4FQG A;  2GXG A;  1E3H A;  4F7Z A;  2BY3 A;  2HU9 A;  4HRI A;  3MWM A;  1MSE C;  1W7P B;  1A04 A;  3A02 A;  1ETK A;  1Z3Y A;  3OIQ A;  2HQN A;  4HX4 A;  3P9K A;  3PNV A;  3GUD A;  4MTD A;  1HW1 A;  4AC0 A;  2HQR A;  3FIW A;  1FIA A;  2L7M P;  4II2 A;  4MTE A;  3M7G A;  2JA2 A;  4PJN A;  4AYB N;  1XGO A;  2CW7 A;  5D5U B;  3GTO J;  1K4T A;  4DQ2 A;  1I50 J;  1U5T B;  1MNE A;  2P4W A;  2W24 A;  4IF4 A;  2QA4 I;  1DPR A;  3OYM A;  1J7K A;  2N8G A;  5HS9 A;  3O2P E;  1BC8 C;  4A3E J;  2JSP A;  1G3Y A;  2VJJ A;  1RC9 A;  2W1O A;  3OIP A;  2R93 J;  2KIF A;  3E5X A;  5HOO A;  1EH8 A;  1RZ4 A;  3MZ8 A;  1TWF J;  1T0F A;  3DKW A;  3MZY A;  3ASN H;  2M4G A;  5CQG A;  5J8C A;  1X19 A;  1GUU A;  4Q5S F;  2EV5 A;  4A3J J;  2DJI A;  1VZ0 A;  2K5C A;  2VQL A;  2JK3 A;  5TRD A;  4M6V A;  1XSX A;  5HLI A;  1ZR2 A;  2K9N A;  5FKN A;  1JGG A;  2VQC A;  5C44 J;  3JRA A;  3QYB A;  4AVZ A;  2ELJ A;  2K85 A;  3E7L A;  3ML6 A;  2EFN A;  4P55 A;  2RNJ A;  4WK8 F;  3RI4 A;  2DO7 A;  3A01 B;  2C6Y A;  2Z1D A;  3DTK A;  2H09 A;  4G94 A;  3OWT A;  2VKE A;  3TL4 X;  2R7D A;  2JUG A;  3CUQ C;  4HLY A;  3ZQ7 A;  4G6T B;  2OTL I;  1BIB A;  2FX0 A;  2STT A;  2DMN A;  1N78 A;  1WJF A;  2DOD A;  3OYK A;  1U8R A;  3VYR B;  3T8R A;  1JE8 A;  1OIS A;  2MSY A;  5A2Q Z;  3PIO F;  3KLO A;  3SYT A;  1V4R A;  2DYS H;  3K4M A;  4U88 A;  2E1O A;  2E34 A;  2LY9 A;  2FUG 2;  1IDZ A;  4KIS A;  4RGU A;  3I53 A;  3QPT A;  2I10 A;  5LRS A;  3K9T A;  2PJP A;  5JR3 A;  3KE2 A;  3GW2 A;  1FMW A;  4XLP F;  1MDM A;  3BTC A;  4KYW A;  1E17 A;  4XSZ F;  3DU5 A;  2VUM J;  4LLN A;  5BNG A;  4CYC B;  3M9A A;  3DKY A;  3CDI A;  4B4C A;  1MKM A;  2UV1 A;  4RAY A;  2LVS A;  1ZG1 A;  1SFK A;  4QTR A;  5E1Z B;  2VON A;  2JTV A;  1FX7 A;  1J09 A;  4HOB A;  3HL2 A;  2EIN H;  3K1N A;  4DOZ A;  3K4B A;  1MBJ A;  2TRT A;  2DYR H;  4HPQ A;  4A5M A;  1K79 A;  4IXA A;  2E2I J;  3JRI A;  2A68 F;  2COM A;  3LMM A;  1IN5 A;  1WJB A;  3BG6 A;  2NS8 A;  1I39 A;  2EK5 A;  4OMY A;  4FT8 A;  2XB5 A;  3DXJ F;  4BXX J;  1IXC A;  1YW7 A;  4DBR A;  1K78 B;  1BR2 A;  2X6W A;  2XSD C;  2HWV A;  2XAQ A;  2XPU A;  1IGN A;  3EUH A;  1LPQ A;  4BY7 J;  1KQ8 A;  4NNJ A;  4ZJZ A;  2VL8 A;  2HGC A;  3HRM A;  3K69 A;  1PP8 F;  1Y56 A;  4GO1 A;  3NEU A;  2DMP A;  2PN6 A;  3B6A A;  3PQJ A;  4QIW N;  3LQQ A;  3G1M A;  5EZG A;  1V3F A;  4BHC A;  1K61 A;  1LQ1 A;  4ETS A;  5HNF A;  2BE5 F;  2DDB A;  4NC7 A;  3AL0 C;  4I76 A;  2DFI A;  1LUJ B;  4BQA A;  3FXR A;  2M8E A;  1LEA A;  4Y4R A;  4Y13 A;  2O8X A;  3L2U A;  2HTJ A;  4J01 A;  3IKV A;  3VYU B;  1UFM A;  3FXM A;  1YO5 C;  1OFC X;  1U5T A;  1P4A A;  1MJA A;  1ZG3 A;  2JJ7 A;  3W2A A;  1IN7 A;  3DEW A;  2Y0M A;  4FHT A;  2A5Y B;  3F0C A;  1WZ2 A;  2BXY A;  2Z2S B;  3H36 A;  3HYI A;  2QGU A;  1MBF A;  1FC3 A;  1P7J A;  5E8G A;  2X0L A;  1QZY A;  3K2A A;  2Z3Y A;  3GME A;  1VTN C;  2DPU A;  1P7I A;  4BDZ A;  3QOD A;  2OUM A;  4LGW A;  1OJL A;  1TNT A;  5BPD A;  2XGE A;  5HNH A;  2XC7 A;  2EBI A;  2GOX B;  2H27 A;  4M74 A;  5F04 A;  2XHK A;  4BEH B;  3LAP A;  4Y15 A;  2JT1 A;  1TP4 A;  4H0E A;  4LG3 A;  3IWF A;  4UUT A;  1I6X A;  2XPW A;  3A0H C;  1BJZ A;  2MW8 A;  1SD7 A;  1QVT A;  1MIJ A;  2H8W A;  5CQE A;  3VFZ A;  2P8T A;  5KK1 A;  3J7A O;  1I27 A;  2FNA A;  2XGC A;  3HJE A;  2JUC A;  3VEP A;  2K4B A;  2EB7 A;  3ZP5 A;  2X48 A;  3H5A A;  4ENN A;  4C3J J;  4YFN F;  3C1D A;  2ZNY A;  3M8J A;  2R7T A;  3RYP A;  5E20 A;  2JPC A;  3FX3 A;  1WRJ A;  1FOW A;  1SEU A;  2WAQ A;  5K7Z A;  1ONV A;  3EUK L;  3CF5 F;  2A5W A;  5DUI A;  1UHS A;  1R71 A;  2JVH A;  3PL8 A;  4BU2 A;  4EM0 B;  3C2G A;  2CG4 A;  4MNU A;  4IHT A;  4V19 K;  3BJ6 A;  2IVM A;  1XMK A;  3C7J A;  3RZO J;  2B63 J;  1D0X A;  3RPU A;  4KMF A;  2OV7 A;  4A3C J;  2R3S A;  3SZG A;  2P5L C;  3D0S A;  2RNG A;  1WH7 A;  2VB6 A;  5BS6 A;  4QPQ A;  3GO5 A;  4PJJ A;  2Z9O A;  1SMY F;  1E0E A;  2KFD A;  3RKQ A;  1JTX A;  2RRE A;  5DD8 A;  1LVK A;  4LK1 F;  2FMY A;  5HDK A;  2JMW A;  1Z6T A;  2F5D A;  2CV0 A;  1TW3 A;  2E5Z A;  3DFG A;  4KT5 C;  5J8F A;  3E6D A;  2KP6 A;  2XAS A;  4OAZ A;  2H6B A;  2BYV E;  4N9H A;  3OYJ A;  2E7W A;  2PMZ A;  4D5F A;  2LSO A;  3CC7 I;  2O3F A;  4IOA F;  1GXP A;  4MFE A;  2GIV A;  2L54 A;  3R6S A;  4AD9 A;  2VXZ A;  3RTR A;  4AUX A;  1X1D A;  4EJT A;  1O3T A;  4HG2 A;  3IH2 A;  3EPZ A;  3S1R J;  1W7P D;  4XRS A;  3CME I;  2RC4 A;  3DEU A;  3HB9 A;  3OMY A;  3IH4 A;  1OLT A;  3BTJ A;  3IHU A;  1W36 C;  3MD2 A;  5C3E J;  1YIT I;  1OCC H;  4NHJ A;  1NTC A;  2A61 A;  4XKC A;  4BNC A;  2XAF A;  2IP2 A;  2MA3 A;  1CF7 B;  1R4N B;  4LG0 A;  2QQ8 A;  4ENM A;  3F8M A;  1ZGA A;  3GXO A;  3ZMZ A;  2CV1 A;  1K83 J;  3BG5 A;  4HBL A;  2K7L A;  4DBQ A;  3S1M J;  1ERD A;  3BP8 A;  1QQI A;  2R4G A;  4O5V A;  4PCQ A;  4HX8 A;  3L2W A;  5CVR A;  3RPQ A;  3BR3 A;  2O61 A;  4OWR B;  2DT7 B;  1QPI A;  1R23 A;  1I1G A;  2HR3 A;  2NXN B;  3BR6 A;  1ZLJ A;  3CCQ I;  1X1A A;  2HFH A;  4ASN A;  3ABL H;  3CDL A;  4UHT A;  1HQC A;  4AIK A;  2F4M B;  4LIT A;  2VQH A;  3FHZ A;  4A3I J;  3OS2 A;  4I6Z A;  4S04 A;  4FAS D;  2VBZ A;  4BEH A;  1NG6 A;  2Q1Z B;  1IRF A;  4AIJ A;  3O8H A;  5J1U A;  3CZ6 A;  1ZQ3 P;  3MCZ A;  5K5O A;  2LBF B;  5F0F A;  1U0J A;  1IXS B;  1T2K A;  3F3X A;  2DA7 A;  1FSH A;  3OYA A;  1QPM A;  5FD6 A;  3BRO A;  1VQ8 I;  2GWR A;  2QSH X;  2CUE A;  3V8K A;  4HF1 A;  1YQA A;  2GZW A;  4KIG A;  4D5C A;  1N75 A;  1V5E A;  5E18 F;  4KT6 A;  3D5R C;  1H0M A;  1HLV A;  2GOM A;  3G73 A;  2DMU A;  2VBY A;  1KQ9 A;  3V8L A;  4CCK A;  3Q9V A;  4W97 A;  5KNL A;  3WU1 B;  4E7K A;  3L00 A;  1FYK A;  3ZMD A;  1BA5 A;  4OIN F;  5H2F C;  2RKH A;  4YFK F;  2DA5 A;  4Z6Y A;  2M9H A;  1KYZ A;  3JAM Z;  4PUS A;  2HDW A;  3BPX A;  3WGH A;  2G9W A;  4F55 A;  3I4M J;  2O8K A;  5CVJ A;  5FKO A;  1G2H A;  2AXT C;  2OZ6 A;  4C2T A;  4EV0 A;  1JXS A;  4D1Q A;  1VQ4 I;  1Z77 A;  4XNF A;  1IDY A;  4KIB A;  4P9F A;  5GTI C;  4H4K C;  2FQ3 A;  3BT9 A;  3ZN1 A;  3JRB A;  1I3A A;  4ON0 A;  5E3M A;  1JUM A;  3G4S I;  3KYL A;  1BC7 C;  2DT6 A;  3JRC A;  1QZZ A;  1SC7 A;  3KP3 A;  1Z67 A;  1YS7 A;  3MQ0 A;  2DI3 A;  5ICG A;  3RQI A;  3MKZ A;  3F6V A;  3VSK A;  1O3Q A;  5KVR A;  3T8T A;  1VQO I;  4A3L J;  2IS2 A;  3SJM A;  1XB4 A;  4NC6 A;  1DQU A;  3C2B A;  3HPH A;  1HCR A;  3KYD B;  1W5S A;  5B66 C;  1ETO A;  3OR2 C;  1UG0 A;  3KP4 A;  1E2X A;  3LOC A;  4RAG A;  4XLH A;  1DGW Y;  5B1A H;  2XGD A;  3G2B A;  5JLX A;  4MFD A;  2XAH A;  2NRA C;  4P96 A;  1A36 A;  3P5J A;  3CJN A;  2JSC A;  3P9C A;  4WXC A;  3GX4 X;  2QEX I;  3JRD A;  4C3I J;  2RQP A;  3KP7 A;  1BI1 A;  4HW0 A;  2XF5 A;  2LKX A;  3M8E A;  2IW5 A;  4JOM A;  5ILU A;  1CGP A;  1HF0 A;  3CCV I;  1P9Q C;  4HQM A;  3I3L A;  1TWH J;  5M3M J;  3OYH A;  5LEK A;  5IT9 Z;  1B9N A;  4MHG A;  2K86 A;  2ZC2 A;  3FKJ A;  3IUO A;  2QUF A;  4MIM A;  3MN2 A;  5EG0 B;  4U7B A;  5LGN A;  2V26 A;  2IGN A;  4E7S A;  5IT3 A;  1HDD C;  3KZI C;  4BE2 A;  1IN8 A;  1R22 A;  3T1B A;  2GLO A;  3V7C A;  4B1R A;  5GTH C;  2QQA A;  4RB3 C;  5J1Y A;  3TOB A;  1X58 A;  2M0C A;  2AHQ A;  2K9S A;  5ILS A;  1QHH D;  2RQQ A;  2WBM A;  1VQP I;  4LOC A;  3ZN0 A;  4M3D A;  2DT5 A;  1O57 A;  4R8H A;  2H1K A;  3R60 A;  2F2E A;  3KP2 A;  3HSR A;  1HXD A;  2CSO A;  1VND A;  5EEH A;  1I6H J;  5A2Q K;  3KEO A;  4GFB A;  2DMQ A;  1BOA A;  4XLN F;  2H8R A;  1FT9 A;  4CGZ A;  4EM2 A;  1OYI A;  2NVT J;  1UJ8 A;  1Z3X A;  1P2F A;  4IHX A;  2Z5U A;  1YW9 A;  3MKL A;  4RM3 A;  4ITV A;  2DJN A;  2PMH A;  1G6N A;  4C2M J;  1JUP A;  3OYL A;  2MH9 A;  4PFO A;  2VQG A;  2FEZ A;  3JRG A;  4M3F A;  5BMZ A;  3L09 A;  3TO9 A;  2P5K A;  4IOC F;  2XAG A;  3S1Q J;  1YX3 A;  5M5X J;  3Q0V A;  4FE7 A;  4HZF A;  2ISZ A;  4XMY A;  1P4W A;  4PGH A;  4YII A;  4XQF A;  4Q47 A;  1IAW A;  2ZJ2 A;  4C2U A;  1HKS A;  3Q0W A;  3ESW B;  4A6D A;  1IN4 A;  1L3L A;  5TIS C;  2P81 A;  5GPA A;  1IJW C;  4Q4Z F;  2V1U A;  2GBY A;  5FO5 A;  5J6X A;  2FU4 A;  3RKY A;  2MLK A;  1RKW A;  3I64 A;  4HA8 A;  3CC2 I;  4BXF A;  3IWZ A;  1PUE E;  1R49 A;  1PJR A;  1T33 A;  2A07 F;  1RR8 C;  2E2J J;  3PUF A;  3S93 A;  2GXB A;  3HM5 A;  1IZ1 A;  1LDJ A;  5L3D A;  1YTY A;  2MD5 A;  2LLK A;  2W82 A;  4XBF A;  1D1A A;  3QP6 A;  2LYC A;  4LLG F;  2R7Z J;  2HYF A;  1YE9 A;  2XSJ C;  3LFK A;  3DTI A;  2YU9 J;  1YRN A;  3BG3 A;  3VYS B;  5ED4 A;  2IXS A;  2UWM A;  2QYO A;  4A3M J;  1Y39 A;  1TTY A;  2OC6 A;  2EH3 A;  2K3P A;  2AQF A;  1BR4 A;  1R36 A;  4PJ0 C;  4EJW A;  2TCT A;  3P9I A;  1C0W A;  1U6G A;  3CUQ A;  1MJB A;  1ZAO A;  5HVQ C;  1ZRF A;  2HS5 A;  2KPM A;  4I7H A;  4BQO A;  3D5L A;  1F1Z A;  3LWF A;  3FM5 A;  5HLG A;  4BHP A;  2RDP A;  3BJO A;  1WH5 A;  2MG4 A;  5K7F A;  4XID A;  5K7H A;  3OYD A;  4UNO A;  4DYC A;  2EA2 A;  5EG0 A;  1IF1 A;  4A5N A;  2VT3 A;  2FOK A;  3H9Q A;  3WU0 A;  2HXI A;  3Q0U A;  2LY1 A;  1JHH A;  4IRG A;  2EZL A;  4HV6 A;  4EMS A;  2R7F A;  2M1B A;  3H0D A;  2K27 A;  3K4N A;  3K70 C;  1JJ8 C;  3QP5 A;  4GXO A;  3F8F A;  1AWC A;  3E5U A;  1EH6 A;  1OQY A;  1EKE A;  2O7O A;  1QNT A;  2EIJ H;  2EFP A;  1RKT A;  4HYE A;  3CTA A;  1MND A;  3HSF A;  1VF9 A;  2COB A;  3CES A;  4C9Y A;  1DGR M;  3BZC A;  2Y9Z A;  4D7N A;  1TQM A;  3V7R A;  4XLC A;  3GZ5 A;  2NOG A;  3DTE A;  4RLF A;  1W1W E;  2HOA A;  1X1B A;  3GBG A;  2FML A;  1H88 C;  3LSI A;  2K40 A;  2HOT A;  1VQ6 I;  1QU3 A;  2R5Y A;  1S6L A;  1R1T A;  1GV2 A;  4ZYG A;  5LHG A;  3CD6 I;  2DA1 A;  1TC3 C;  3WTT C;  2E60 A;  4HST A;  4NDL A;  3JRF A;  5J47 A;  3KYC B;  3U9G A;  2NVU B;  4OIP F;  2W57 A;  2WAE A;  3ECH A;  5FKM A;  5DM6 F;  4IEJ A;  1PVE A;  3TW7 A;  4IHW A;  1L0O C;  2F5C A;  1Z6R A;  2G7H A;  1ETX A;  2WTE A;  2GQQ A;  2VOP A;  5FKL A;  4RAZ A;  4V2G A;  3MFK A;  1OYY A;  5GP9 A;  1NG7 A;  4U0W A;  5IP9 J;  5D6F A;  2HXO A;  2EJR A;  3MVP A;  3BR2 A;  3JSO A;  1B4A A;  3QYF A;  2FQ4 A;  1YJW I;  4RGS A;  3FMS A;  3AAF A;  1J5Y A;  3FZV A;  2NOJ B;  4XR6 A;  4ENK A;  4LMY A;  3OL4 A;  5EEA A;  4PK4 A;  2QQ9 A;  3Q3S A;  4I01 A;  2DLL A;  2BBY A;  2IA0 A;  2Y30 A;  2HVR A;  4G6D A;  5ILV A;  3TO7 A;  1NHA A;  2JN6 A;  1XS9 A;  1XGN A;  4A3G J;  2DDA A;  4BBS J;  1XGM A;  2NS7 A;  2YUS A;  4IQJ A;  5FRM A;  2ZXH A;  2ZME A;  1ZH5 A;  4YRV A;  1S3J A;  5IYD J;  4I0B A;  1PYV A;  3HOX J;  3GEZ A;  3NQO A;  4ESJ A;  2IPQ X;  4RGX A;  4L0Y B;  4UV8 A;  5IOY A;  5AON A;  2OCC H;  5E1W A;  2MAB A;  5J1R A;  3WHC A;  2EV6 A;  2VKV A;  3HG9 A;  2V1X A;  1T95 A;  2H6C A;  1GT0 C;  3ISP A;  3S2W A;  3S15 J;  5ICF A;  2JWT A;  2X1C A;  3WOD F;  4A2U A;  3VB2 A;  4MO7 A;  3DLA A;  1XC5 A;  4F91 B;  2WV1 A;  3FKI J;  2VN2 A;  3E3V A;  1MBK A;  2F4I A;  1P4X A;  2E1C A;  4KJZ A;  2IA2 A;  3QU6 A;  4M6Y A;  1O3R A;  1DU0 A;  4FET A;  1JJ6 C;  4FX0 A;  2JA5 J;  3BOQ A;  4XKW A;  3KZY A;  2X6X A;  1SAU A;  2BY1 A;  3M4O J;  1RNL A;  2ZKZ A;  1GVJ A;  1X4P A;  4B43 A;  3I4N J;  3GVA A;  2MFZ A;  3AG4 H;  2KIM A;  3MKW B;  3CO6 C;  5IYB J;  1F5T A;  3LSG A;  1AA7 A;  4UB8 C;  2QM3 A;  2Y69 H;  3IC7 A;  3F23 A;  4BJ6 C;  2DAO A;  1RET A;  4UVB A;  1BW6 A;  2IJL A;  4II3 A;  3ZRG A;  2M4K A;  3JRE A;  1ZRC A;  2ZJQ F;  1JT6 A;  2WAQ N;  4MQ9 F;  1CQT A;  2QZ8 A;  1V54 H;  3LSR A;  2V6E A;  3GTM J;  4DW6 A;  1X2N A;  4PSX A;  3BTI A;  1FMV A;  4CSW A;  1X1C A;  5F6F A;  4CYD A;  4LG0 B;  5J3L A;  1IRX A;  1WVR A;  1YOV B;  3MEX A;  3RYR A;  3TDU C;  4XK4 A;  4EVI A;  4FTH A;  1XMA A;  3CLO A;  3F8B A;  3FXO A;  3QPS A;  4E7J A;  2LTP A;  4HV5 A;  2Y9Y A;  1IV6 A;  2O9L A;  1IRG A;  3OYI A;  1WHU A;  3HIF A;  2L9S A;  2VE8 A;  5FFZ A;  1RUO A;  2ZSI B;  3GLX A;  3JAM K;  1R5I D;  2O0Y A;  4FIS A;  1SFO J;  2VJI A;  2CQK A;  3BZ6 A;  1F9N A;  1Z0X A;  2VC0 A;  3PSI A;  1D8J A;  2UXN A;  1XCV A;  3K4L A;  3H3V K;  2Y48 A;  1AKH A;  1OCP A;  2A6E F;  3M07 A;  1G3T A;  2HNH A;  4FE4 A;  2PMZ N;  3H5N A;  3I71 A;  2M7A A;  3AFH A;  3FXJ A;  4LB6 B;  1AHD P;  3TO6 A;  2Y31 A;  4CCJ A;  4EAT A;  2ZME C;  1R1V A;  2HPI A;  3TP3 A;  1D5V A;  3OYF A;  2JA7 J;  1XSV A;  3RKX A;  1BN5 A;  1TWG J;  3CCS I;  2VT2 A;  1KU9 A;  3OL3 A;  1YJ9 I;  5DEQ A;  3EYY A;  2YX4 A;  3BR1 A;  3BDD A;  1S9H A;  3WTS C;  2WY7 Q;  1S72 I;  3PO2 J;  2M87 A;  4HF2 A;  4JP0 A;  5KAF C;  1HBX G;  5FGM A;  5IT9 K;  3QPH A;  3DKX A;  4KFC A;  5E3L A;  1U9O A;  1X1P A;  2P5V A;  5D8K B;  4BY1 J;  5LRR A;  4L9T A;  5CPR B;  4L9V A;  4AU7 A;  2L02 A;  3HPG A;  3ROU A;  3FXQ A;  5CLS A;  2P7C B;  2G0E A;  1J0R A;  1T8I A;  4KA4 A;  4C30 A;  2O03 A;  1B6A A;  2DTR A;  1FSE A;  2QWW A;  3CF2 A;  1IUY A;  1I1S A;  1SD4 A;  4I02 A;  1UHW A;  2HVQ A;  5CYV A;  1BI3 A;  2M8G X;  1FP2 A;  4NQW A;  4RLQ A;  4BAC A;  3CJT B;  2DQR A;  1FEX A;  3PFY A;  3SXY A;  2CUF A;  2DOA A;  5BOX A;  2NVX J;  1LKX A;  3CJQ B;  1UST A;  3S3N A;  1ETW A;  3CCJ I;  1R5H A;  1R9T J;  3VSL A;  3OOP A;  5F27 A;  3SZP A;  3DBL B;  4IRH A;  4B44 A;  3GFI A;  3K4J A;  3E1S A;  3QPL A;  5D4S A;  4L9J A;  3RKW A;  3SFI A;  3CCE I;  3R0J A;  2WWY A;  4EGY A;  1JI8 A;  1MZB A;  2DOE A;  4CCL A;  2BHZ A;  3C3W A;  5DS9 A;  2V1N A;  3H9J A;  5BQT A;  4PSW A;  4L5I A;  4XLF A;  3ZMV A;  5JVG F;  1PP7 U;  3OYB A;  5E8I A;  1HW5 A;  3M1E A;  2M2E A;  2QSG X;  3LA3 A;  4E7L A;  2WAD A;  1OCR H;  2X51 A;  1IUF A;  3CC4 I;  2K3F A;  1Y1V J;  2XV4 S;  3I54 A;  2A6H F;  3M1C A;  2IS4 A;  2CUJ A;  2HOE A;  2IS1 A;  5CVV A;  3BR5 A;  3BTL A;  2W48 A;  1MMS A;  3NRV A;  3S8P A;  4F93 B;  5IPA A;  3PO3 J;  2JRM A;  1BW5 A;  1OMI A;  1IXR C;  3LA7 A;  1PUF A;  2LG4 A;  4BBR J;  5HDN A;  3H0G J;  1XCB A;  3WG7 H;  1G59 A;  3CCM I;  4IRI A;  3ELK A;  4GRI A;  4HSR A;  3DWL E;  1X2M A;  3FMQ A;  5M5W J;  4NC8 A;  1W0U A;  4IX7 A;  1VQK I;  2KQR A;  3U21 A;  2OA4 A;  2HQA A;  3E97 A;  1S5L C;  5LD2 C;  4BQN A;  1HSJ A;  1NK2 P;  1B72 A;  1HKQ A;  4EJV A;  3LSJ A;  1APL C;  1N25 A;  2A6T A;  1RES A;  4RB0 A;  5IOZ A;  2EZI A;  3BWG A;  3EDP A;  3GTP J;  4A0Z A;  2W85 A;  1FP1 D;  1FBU A;  1J59 A;  3T5X A;  1Q1H A;  3A1Y A;  1LE8 A;  5F0C A;  1SAX A;  3SDG A;  1Y6I A;  1MH4 A;  4UUS B;  1O4X A;  2DK5 A;  4UB6 C;  4DGW B;  4OIQ F;  3L2R A;  5D5W B;  4UUV A;  5LFA A;  5LGT A;  2L3D A;  3SEZ A;  1I5Z A;  4IZZ A;  3H35 A;  4HLX A;  1D0Z A;  1SVO A;  2A05 A;  2V79 A;  2IGO A;  1WJA A;  3F8N A;  5IP6 A;  2RN7 A;  1RR7 A;  1WKM A;  2IEK A;  2VLA A;  2KZG A;  3KLN A;  5L3F A;  4DZP A;  2Y0S A;  3JRH A;  2D2W A;  1IRZ A;  5LBQ A;  4IHS A;  2ADU A;  4QSH A;  1RIO H;  3KP6 A;  2B7E A;  5L3B A;  4L5E A;  2R92 J;  1BI2 A;  3RPU D;  3GTQ J;  3PQK A;  3RJP A;  2VE9 A;  1FOX A;  1AOY A;  3ZQG A;  3D1N I;  1EH7 A;  1SFE A;  4A12 A;  1WQ2 A;  2CUZ A;  4A3K J;  5IYC J;  1Y8Q B;  2E1M C;  4KN7 X;  2BGC A;  2JA8 J;  1G8X A;  1H89 C;  3AG2 H;  5TJJ A;  2ME0 A;  5LHI A;  3DU6 A;  3V42 A;  4KMU X;  2R7Q A;  3PSF A;  1FIP A;  4JX5 A;  3CCR I;  3HOY J;  1FNN A;  4LB5 A;  2MYS A;  2F48 A;  1H9G A;  3NAU A;  1LFB A;  3F22 A;  3EYI A;  4IO9 F;  4ZDP A;  3CCU I;  3BR0 A;  4LIV A;  1W4M A;  1ZTR A;  2EFW A;  2M45 A;  1MMG A;  1FWZ A;  3FWE A;  1YRN B;  2IGK A;  2ZNZ A;  2FRH A;  1VQ5 I;  5JHU A;  1JTY A;  4BGD A;  4GDF A;  2W84 A;  3OR1 C;  3ONQ A;  4GYI A;  4ABZ A;  1FPQ A;  3GCM A;  4BKX A;  5GPC A;  1XDS A;  1YYV A;  1FOY A;  3DPL C;  3CCY A;  4XL9 A;  3U1D A;  4ZTJ A;  1XX5 A;  3WTZ A;  3WHB A;  5E79 C;  4RS8 A;  1OCT C;  4D7M A;  1FYM A;  3CUQ B;  2W00 A;  2V9K A;  4BXU A;  4KUM A;  4ZDL A;  5DDG A;  1U8B A;  1VFC A;  1VQ7 I;  5LEJ A;  3H3U A;  5J4V A;  1X3Z B;  3DBR B;  4XON A;  4BYY A;  3CMY A;  4M9Z A;  1NK3 P;  2YPR A;  3X2Q H;  1UHM A;  1A5J A;  1XTA A;  4WCG A;  3FMR A;  1N77 A;  1EV7 A;  5FLV A;  3B6C A;  5F64 A;  1R6R A;  2ECB A;  2STW A;  4Y33 A;  2H94 A;  1D8K A;  5FLX Z;  4LD5 A;  4IJA A;  2BV6 A;  2GM4 A;  1ZK8 A;  3ABU A;  5LHH A;  1W0T A;  4BS9 A;  1VI0 A;  3BJA A;  3BPV A;  1XPX A;  2PLY A;  5H6Q A;  1KA8 A;  1KGS A;  2QCO A;  2YSR A;  4B47 A;  1UZC A;  4EJU A;  2PI0 A;  2UZK A;  4XIC A;  4GYG A;  1D0Y A;  2K9Q A;  4DZJ A;  1OKR A;  4EGZ A;  4MEX F;  1E3P A;  2EZK A;  4ZZL A;  2FJ1 A;  1DP7 P;  3B02 A;  3O6B B;  4IKF A;  2HYG D;  4OMZ A;  4RGR A;  4HNT A;  4I99 C;  5F0H A;  4P1W A;  1QVU A;  4NB5 A;  1ZR4 A;  2VC1 A;  4OOI A;  1TT5 B;  4F3Q A;  2VBX A;  3GWZ A;  1FY7 A;  5AIP A;  2P6S A;  4BUP A;  3ABM H;  2R5Y B;  3I0T A;  5B5E C;  5CKT A;  1OR7 A;  2DFH A;  3HOU J;  3GFJ A;  2KRF A;  4I98 B;  1FTZ A;  4C3H J;  3REO A;  4UUS A;  3AKZ A;  2P0W A;  3HOT A;  3PJR A;  4RBO A;  3WTX C;  4CHU A;  4HX7 A;  2B0L A;  4O6J A;  4WXD A;  1YLF A;  1XG1 A;  3HHG A;  3I56 I;  1P6R A;  5EDN A;  4UY8 I;  2PG4 A;  3ZQH A;  1MBG A;  3A2K A;  1MJ9 A;  2DQL A;  4XRF A;  1Z1D A;  4L0Z B;  2L7K A;  2M34 A;  3AL0 B;  1I3Q J;  2KIS A;  2JZY A;  4TV7 A;  3HOZ J;  2Z99 A;  2PQ8 A;  2QVO A;  4RAF A;  3GTG J;  3BZK A;  4B3A A;  4M73 A;  2DBB A;  2FA5 A;  2Q0O A;  5DD4 A;  1R5G A;  4HF0 A;  5E17 F;  3H92 A;  2XRN A;  2FE3 A;  5EYR A;  3H1C A;  3S2D J;  2L2O A;  2ZCW A;  4DJA A;  2IS6 A;  5E3O A;  3HRS A;  4RM2 A;  4B09 A;  3S16 J;  4CIC A;  3J7A Y;  1Z7L A;  2EPF A;  4DIQ A;  3BG7 A;  5FFX A;  1MBH A;  2K02 A;  4YG2 F;  2KT0 A;  4CA0 A;  1A31 A;  3PIP F;  3ABT A;  3R61 A;  3BC8 A;  3VOD A;  2ZXI A;  2CFX A;  1U78 A;  1MSF C;  2LNB A;  1TNS A;  2R5Z A;  4KIF A;  2ZME B;  2E2H J;  1GDT A;  1ZHF A;  1FBQ A;  4XN0 A;  5IY5 H;  2Q2E A;  2BW3 B;  3ECO A;  3W2W A;  3PUB A;  5F1R A;  1Z21 A;  1UB9 A;  1YFH A;  2FBI A;  4PJM A;  2VOD A;  3KZZ A;  1S7A A;  4G6Q A;  1A6Q A;  1ZGW A;  2ZO4 A;  1T98 A;  1MH3 A;  4WF2 A;  3HEF A;  3WTV C;  1G4D A;  4D9J A;  2CU7 A;  2QSF X;  5ICC A;  5FD5 A;  2IT0 A;  3OYG A;  3FBI B;  4E6K G;  3HXL A;  3N97 A;  1T56 A;  4KIT B;  4M9S A;  5GAH J;  1ACI A;  1TWC J;  3FDY A;  4M3B A;  5EGO B;  3S2H J;  1BIA A;  1ON2 A;  1WCM J;  1Y0N A;  2R7R A;  2LRE A;  4N4N B;  4XRS G;  3G6E I;  3ABK H;  4N0B A;  2MC3 A;  2XGX A;  4XLA A;  2UUZ A;  4ESB A;  5JHF A;  3DLL F;  3WGG A;  1MMD A;  5DCM A;  4BAY A;  2E71 A;  4X0G A;  2LKS A;  1ETV A;  1OR7 C;  1Y8R B;  3KPH A;  1RPW A;  5JI6 A;  2F6C A;  2JRT A;  4XKV A;  2XRO A;  4GGG A;  2D45 A;  4A3D J;  3GYH X;  1F36 A;  1ZG5 A;  3M3Y J;  4J00 A;  1M1E B;  3ZQQ A;  1WI3 A;  4AVP A;  2R0Q C;  1RUN A;  3E5Q A;  3IV5 A;  4U7D A;  3P7N A;  5EZH A;  4Q48 A;  1Z91 A;  3JW4 A;  1BJA A;  2ZBK A;  1KZH A;  3JTG A;  1NH3 A;  1IN6 A;  3ZCO A;  2GXA A;  4JYK A;  3TW6 A;  1Y0U A;  1FLI A;  3SDB A;  2RGV A;  1QRY A;  4YIR X;  3K70 D;  5K1Y A;  3PNT A;  1YIO A;  3SZT A;  3QOE A;  2CQX A;  5JVT A;  2M30 A;  4XKB A;  2HQ5 A;  4IHY A;  3M8F A;  2ID3 A;  3ULQ B;  3ZQC A;  3K0L A;  3MAJ A;  5LGU A;  2HVS A;  2NVQ J;  2VKH A;  1FBS A;  1OYW A;  3F8C A;  3HTU A;  2J5P A;  3HRU A;  3SQN A;  5DM7 F;  1LFP A;  2NNN A;  2MLG A;  1WSU A;  2ETH A;  2LY2 A;  4ZYH A;  3W6J B;  3OS0 A;  5ICE A;  2BVL A;  2X85 A;  4Y17 A;  3WE3 A;  3GTK J;  1AKH B;  3CLQ A;  4UXN A;  1STZ A;  2CO5 A;  2AS5 F;  2OQG A;  4DNC A;  4OIR F;  4PDK A;  1K6O A;  3HSE A;  1EA3 A;  2VIX A;  4MLO A;  4RB1 A;  2EFQ A;  3ZMS A;  1H9T A;  2DA2 A;  3F72 A;  3CJR B;  2OPT A;  2QKL B;  4M6X A;  5EF6 A;  2LH9 A;  4ZZD A;  3COA C;  4E4H A;  3PFI A;  3F21 A;  2CV2 A;  2IRF G;  9ANT A;  5D8L B;  3NAR A;  2VBW A;  1TQP A;  4E7H A;  3I5U A;  3PM1 A;  2Y2Z A;  3TDZ C;  2UXX A;  2LF8 A;  4QLC U;  2F5F A;  2OF7 A;  2PEX A;  1FJL A;  1LVA A;  2HYJ A;  1GXQ A;  2MGQ A;  3IL2 A;  3RCO A;  3LFU A;  3KET A;  3E6C C;  1WWX A;  2KJB A;  3LA2 A;  3N4M A;  5GAG J;  1F43 A;  2E1N A;  2QKM B;  1MNM C;  2RV8 A;  5C4J J;  1HA8 A;  3K1M A;  4W1U A;  2XVC A;  3G3Z A;  4JX6 A;  3VDX A;  2KDZ A;  3LL7 A;  2LF7 A;  1BR1 A;  2L9V A;  4WWC A;  3GZN B;  4MEY F;  4LFU A;  2BW3 A;  4N4O B;  2VXD A;  5FRO A;  1V5F A;  3HKZ A;  2XF6 A;  4HNV A;  3CCL I;  2OU2 A;  2HZD A;  3FHN A;  2BVM A;  2ZSH B;  4ANJ A;  2EFO A;  3HRT A;  4A0Y A;  4OU0 A;  2R7S A;  1VQM I;  4M3E A;  2DA6 A;  4ESF A;  3RDI A;  2XRL A;  2HZT A;  3FK7 A;  4A0X A;  4XOR A;  2XUB A;  4BJT A;  3OSF A;  2L0K A;  3E0J B;  1T38 A;  4BHB A;  3TGN A;  3WGI A;  1QHG A;  5EGO A;  2O5R A;  2W4S A;  3DBH B;  2IGM A;  3S3M A;  4RB2 C;  4NQW B;  3UNG C;  3W6K B;  4L18 B;  3ZR8 X;  1USS A;  4BH9 A;  2KDO A;  3S17 J;  4HDV A;  3DCF A;  4CH7 A;  1HKT A;  2X9D A;  1SD6 A;  4AYB A;  3BQZ A;  3ERM A;  3G1O A;  3TQN A;  4XRM A;  4A93 J;  5M5Y J;  4ENJ A;  4QWQ A;  2BEO A;  2V4J C;  2VI6 A;  2QBY A;  1YS6 A;  2LC2 A;  1AU7 A;  1R58 A;  2E1M B;  2K9L A;  5EEG A;  4BL0 B;  3I58 A;  4DYR A;  2ELK A;  2GA2 A;  3J81 Z;  2BY2 A;  2VOO A;  4IL6 C;  3A03 A;  3PNY A;  2MH2 A;  2LOO A;  3CP2 A;  3S32 A;  2AXL A;  2RAE A;  2WB1 N;  3QOP A;  5ERI A;  2KIU A;  4IHV A;  4A3B J;  2E5N A;  3CUO A;  2PJR A;  2OZU A;  5CJ9 A;  2VPL A;  2VKD A;  1KQ0 A;  3SFZ A;  1SVM A;  3VYT B;  1JHF A;  2ZB9 A;  3ZQI A;  4MGR A;  2XKO A;  3U1K A;  3ZQF A;  2XPV A;  2MD0 A;  3QU3 A;  4CZC A;  3ZPL A;  2BY0 A;  4CUG A;  1POG A;  1W7P A;  3ZMU A;  4HNU A;  2DMT A;  3K4K A;  2ZFU A;  2QQB A;  3K2Z A;  1T0F C;  2TDX A;  2W7N A;  1FTT A;  5DTD A;  2BHY A;  1PUF B;  2WC2 A;  1UG2 A;  5IP7 J;  1IW7 F;  5C4X J;  5KCM A;  4IVN A;  2V7F A;  2P7V B;  2D1V A;  2JA6 J;  1JUS A;  5KHD A;  3DEE A;  2NYX A;  4CCN A;  1B72 B;  1B8I B;  4OIO F;  1KU3 A;  4G7O F;  3Q5F A;  1U9N A;  2KRH A;  2WA0 A;  2XF7 A;  3L7W A;  1JKO C;  2O6G E;  5AIQ A;  4ZYD A;  4A6E A;  3TED A;  3C18 A;  1KU2 A;  4OAY A;  4XN3 A;  3L2Q A;  3SEQ A;  5KAI C;  4R1H A;  2LFB A;  1LE8 B;  3HDD A;  4XOT A;  4ZC3 A;  3Q9S A;  3V7S A;  3G1L A;  3KFW X;  3ZMT A;  4EQQ A;  2CJJ A;  2CQQ A;  1JKQ C;  1HC8 A;  4A69 C;  1YG2 A;  4M9X A;  1MMN A;  4WXH A;  1BBY A;  2ID6 A;  2YR2 A;  3HHH A;  5E1X A;  3RZD J;  1R7J A;  3J80 Z;  1WJE A;  1WJ5 A;  2EQR A;  2CWE A;  1TLH B;  1GV5 A;  2R7O A;  1OCO H;  5D6E A;  3A01 A;  2VPR A;  3OYE A;  1O7L A;  3U2R A;  3LNQ A;  5FLX K;  4UVA A;  1FYL A;  2FOW A;  3UR3 C;  1SAN A;  2DK8 A;  2WB1 A;  5FB2 A;  2DN0 A;  3NWS A;  3CDH A;  4NUB A;  2CRG A;  1S7E A;  4RA2 A;  4XM3 A;  1WFX A;  1LDD A;  2CFO A;  1IC8 A;  1EF4 A;  3VPR A;  1S7O A;  3WTU C;  1TBX A;  2E19 A;  1QZE A;  3I9V 2;  4BDY A;  4E7Z A;  4CO8 A;  4LLL A;  1B1B A;  1X3U A;  2FSW A;  3OOU A;  2DXI A;  1RRJ A;  2F5V A;  2ISY A;  2BXZ A;  3BQY A;  2E7X A;  1BOB A;  4XOP A;  2YU3 A;  1DU6 A;  3ZOB A;  3GTJ J;  3S1N J;  2DFF A;  1YHQ I;  1SFU A;  3FF5 A;  1QBJ A;  4B8X A;  3GF2 A;  3LSK A;  5J4Y A;  1H8A C;  4EJO A;  4N9I A;  3QYE A;  1R1U A;  4CYC A;  2XB0 X;  3HGG A;  2OBP A;  1MMA A;  2HKX A;  3EUH C;  3KX2 A;  3NWT A;  3L2V A;  2ESN A;  1MGT A;  1O7F A;  1YI2 I;  5HLT A;  5H6R A;  1LFU P;  2QF7 A;  2DA4 A;  3DPT A;  3FIS A;  3RQ4 A;  1PDN C;  1EJ9 A;  3HGY A;  2IA1 A;  4Y7N J;  4ZDO A;  1MD0 A;  4PJL A;  2V1D A;  3MZH A;  2EZH A;  3FM3 A;  1ZGJ A;  3OYC A;  4FCY A;  4KNY A;  5TGT A;  4CCM A;  1VQN I;  5JFR A;  3DPU A;  1JT0 A;  1UAA A;  2Y0S N;  2X1D A;  1ZEL A;  5D5V B;  2WAF A;  2R7V A;  3J7Y J;  2L5Q A;  1K78 A;  4E70 A;  2OQR A;  3D5S C;  3K4C A;  1U5T C;  1ULY A;  3BY6 A;  1XDU A;  2Z33 A;  4L5J A;  5EJC A;  1XGS A;  2CS3 A;  4Z2Y A;  2ZJP F;  2HOS A;  1D1C A;  2LDU A;  2EIL H;  2DTZ A;  3DV8 A;  1SD5 A;  4E7I A;  3KP5 A;  3KCC A;  2QLZ A;  3BCA A;  2LMD A;  2W25 A;  4UVC A;  4ZYA A;  3TBI A;  2ECC A;  2NAZ A;  2EIK H;  1XD7 A;  3IAM 2;  3TMO A;  3W3C A;  1W36 D;  1YX5 A;  2G7U A;  1LJ9 A;  1DDN A;  5GAE J;  2L7Z A;  2I8D A;  2WV0 A;  3ASO H;  1YIJ I;  4Y52 J;  5L3E A;  2M7B A;  3MMY B;  1ORK A;  4HDU A;  1ZN2 A;  4AWX B;  1B8I A;  1LDK B;  4BE0 A;  2H1L A;  4JQF A;  2PMU A;  3LST A;  1YJN I;  2CW8 A;  1UMQ A;  4U0Y A;  2YS9 A;  5HDG A;  4HAM A;  1T08 B;  2ACJ A;  3HZJ A;  4J19 A;  2D5V A;  3L1P A;  3KEY A;  3CMA I;  4FX4 A;  3TOA A;  2LK2 A;  4D0P A;  3CO7 C;  2OD5 A;  4LIU A;  1Z9C A;  1D3Y A;  1LB2 A;  3BCB A;  2R7X A;  3OS1 A;  2JVG A;  6PAX A;  5DV5 A;  1K6Y A;  2MBF A;  2VJ5 A;  2HKO A;  3FBN B;  1R4M B;  4V2F A;  3HUG B;  2CQN A;  2HTS A;  1Z7U A;  3I59 B;  4HEA 2;  5DCF A;  2M3A A;  2HI3 A;  3VOE A;  3R4K A;  5LLQ A;  4BQQ A;  2A69 F;  1VQ9 I;  2BZT A;  2ZFW A;  2K4J A;  2R7U A;  2ME6 A;  3EET A;  4R79 A;  1WI9 A;  4NBQ A;  2HPM A;  1LEB A;  2LD5 A;  3LQR A;  3L9F A;  3ZGK A;  3JSP A;  2J5O A;  2L4A A;  1A35 A;  3LSM A;  4RMN A;  3OV8 A;  3WU2 C;  3LSH A;  2IAI A;  5CVU A;  4B48 A;  3AG1 H;  3K7A J;  2PFB A;  3JTH A;  2NNY A;  2L9R A;  2FF4 A;  1R00 A;  3CMM A;  4CCO A;  4L9N A;  1HDP A;  3A0B C;  5DYM A; 
#chains in the Genus database with same CATH homology
 1K7A A;  2M5W A;  3K1P A;  1BI0 A;  2Q8K A;  2Y75 A;  1KU7 A;  1OPC A;  1DUX C;  2HDC A;  1J2X A;  1B59 A;  2QEN A;  5HS8 A;  2D1H A;  2ESH A;  5HS7 A;  4PZJ A;  3H3Z A;  3E6M A;  4AIH A;  2A3S A;  2EA4 A;  5D5X B;  5BPI A;  1ZRE A;  4KN4 X;  2V9V A;  3QAH A;  1J9I A;  5K5R A;  1U2W A;  1ZYR F;  4G9Y A;  3FXU A;  4LK0 F;  2L01 A;  3WTY C;  1S8N A;  2JPB A;  4HQE A;  1ZLK A;  2CW0 F;  2KJC A;  4ZYE A;  1B9M A;  5DCM B;  2FBK A;  1Z05 A;  4P9U A;  4K2E A;  5D4R A;  3T0Y A;  1CF7 A;  1FZP B;  4CZZ A;  2CYY A;  4S05 A;  5L3G A;  3IRR A;  3E6B A;  3SHF A;  2GA1 A;  3HTS B;  1T6S A;  1S29 A;  3I4P A;  1SMT A;  2GAU A;  4EM1 A;  3V8J A;  2OAZ A;  1T39 A;  1XSD A;  2CGP A;  1F4K A;  3KEQ A;  4JK1 X;  2DPD A;  1REP C;  1TQI A;  3HUG A;  3I59 A;  4IPA A;  1UCR A;  5K5Q A;  3RIR A;  2XAJ A;  3GZ6 A;  1W5T A;  3L2C A;  3WTW C;  5HLH A;  3O3K A;  3R0A A;  3ERE D;  3TKY A;  2V6C A;  1TW2 A;  3IKT A;  3DQV C;  4ZH4 F;  1JGS A;  3WG9 A;  1J75 A;  4LJZ F;  2ELH A;  4M72 A;  1ODD A;  1QO0 D;  4KDP A;  4I2O A;  1SFX A;  1HW2 A;  1RI7 A;  4G7Z F;  2XKP A;  3J81 K;  4G7H F;  2FNP A;  2ZXJ A;  4U0V A;  1GHC A;  1P92 A;  1U3E M;  2RVC A;  4UV9 A;  4YIF A;  4CDG A;  1O3S A;  4CXF A;  4MQV A;  3LAJ A;  2EWN A;  2PBI A;  1BM9 A;  1ZRD A;  3DF8 A;  5L3C A;  5H20 A;  1LNW A;  3QRF F;  3F6O A;  1FOK A;  2YX7 A;  2EV0 A;  1DPU A;  3WE2 A;  5DUK A;  4G8X A;  3B73 A;  2FBH A;  2DW4 A;  3GFL A;  2L4M A;  1HST A;  3DP7 A;  4I09 A;  4WX9 A;  4P5O A;  2DU9 A;  2NS0 A;  3V4G A;  1G3S A;  1MDM B;  1ON1 A;  4PGG A;  4XSX F;  5CVI A;  1G3W A;  3EQL F;  4JBA A;  2QBY B;  4KIC A;  4GCV A;  2FXA A;  4YFX F;  2XIG A;  3HOS A;  1KYW A;  4O3M A;  1YW8 A;  2LKP A;  3GFM A;  2X4H A;  2P6T A;  1QGP A;  3J80 K;  1ZAR A;  1XN7 A;  4M71 A;  2HEO A;  2F5E A;  4I0A A;  2KKO A;  3IRQ A;  2GXG A;  4F7Z A;  3MWM A;  1W7P B;  1A04 A;  2HQN A;  4HX4 A;  3P9K A;  3GUD A;  4MTD A;  1HW1 A;  2HQR A;  4MTE A;  3M7G A;  1XGO A;  5D5U B;  4DQ2 A;  1U5T B;  2P4W A;  2W24 A;  4IF4 A;  1DPR A;  1J7K A;  5HS9 A;  1BC8 C;  3O2P E;  1G3Y A;  2KIF A;  3E5X A;  5HOO A;  1EH8 A;  1RZ4 A;  3DKW A;  1T0F A;  3MZY A;  5J8C A;  4Q5S F;  2EV5 A;  5TRD A;  1XSX A;  5HLI A;  3ML6 A;  2EFN A;  4P55 A;  2RNJ A;  4WK8 F;  3RI4 A;  2DO7 A;  2C6Y A;  2H09 A;  4G94 A;  2R7D A;  3CUQ C;  4HLY A;  3ZQ7 A;  1BIB A;  2STT A;  1U8R A;  3T8R A;  1JE8 A;  5A2Q Z;  3KLO A;  1V4R A;  4U88 A;  4RGU A;  3I53 A;  3QPT A;  5LRS A;  3K9T A;  2PJP A;  5JR3 A;  3KE2 A;  3GW2 A;  4XLP F;  1MDM A;  4KYW A;  1E17 A;  4XSZ F;  4LLN A;  3M9A A;  1MKM A;  4RAY A;  1ZG1 A;  5E1Z B;  2VON A;  2JTV A;  1FX7 A;  4HOB A;  3K1N A;  1K79 A;  4A5M A;  4IXA A;  2A68 F;  2COM A;  1IN5 A;  2EK5 A;  4OMY A;  4FT8 A;  3DXJ F;  1IXC A;  1YW7 A;  1K78 B;  2HWV A;  2XAQ A;  3EUH A;  1KQ8 A;  3HRM A;  2HGC A;  1PP8 F;  3K69 A;  4GO1 A;  3NEU A;  2PN6 A;  3PQJ A;  3LQQ A;  1V3F A;  4BHC A;  1LQ1 A;  4ETS A;  2BE5 F;  2DFI A;  4BQA A;  3FXR A;  2M8E A;  1LEA A;  4Y13 A;  2O8X A;  2HTJ A;  3IKV A;  1UFM A;  1YO5 C;  1U5T A;  1P4A A;  1MJA A;  1ZG3 A;  1IN7 A;  2Y0M A;  4FHT A;  2A5Y B;  3HYI A;  1FC3 A;  5E8G A;  2X0L A;  1QZY A;  2Z3Y A;  1VTN C;  2DPU A;  4LGW A;  1TNT A;  5BPD A;  2H27 A;  4M74 A;  2XHK A;  3LAP A;  4Y15 A;  2JT1 A;  4H0E A;  3IWF A;  1I6X A;  1SD7 A;  3VFZ A;  2P8T A;  5KK1 A;  3J7A O;  1I27 A;  2FNA A;  3VEP A;  2K4B A;  2EB7 A;  3ZP5 A;  4ENN A;  4YFN F;  3C1D A;  2ZNY A;  3RYP A;  5E20 A;  2JPC A;  3FX3 A;  1WRJ A;  1ONV A;  5DUI A;  4EM0 B;  4MNU A;  2CG4 A;  4IHT A;  3BJ6 A;  2IVM A;  1XMK A;  3C7J A;  3RPU A;  4KMF A;  2R3S A;  2P5L C;  3D0S A;  5BS6 A;  3GO5 A;  2Z9O A;  1SMY F;  5DD8 A;  4LK1 F;  2FMY A;  5HDK A;  1Z6T A;  2F5D A;  1TW3 A;  5J8F A;  3DFG A;  4KT5 C;  3E6D A;  2XAS A;  2H6B A;  2BYV E;  4N9H A;  2E7W A;  2LSO A;  2O3F A;  1GXP A;  2GIV A;  2L54 A;  3R6S A;  4AD9 A;  2VXZ A;  3RTR A;  4EJT A;  1O3T A;  1W7P D;  2RC4 A;  3DEU A;  3IHU A;  4NHJ A;  2A61 A;  4BNC A;  2XAF A;  2IP2 A;  2MA3 A;  1CF7 B;  4LG0 A;  4ENM A;  3F8M A;  1ZGA A;  3GXO A;  3ZMZ A;  4HBL A;  2K7L A;  3BP8 A;  1QQI A;  4O5V A;  4PCQ A;  4HX8 A;  5CVR A;  3RPQ A;  2O61 A;  1R23 A;  1I1G A;  2HR3 A;  1ZLJ A;  2HFH A;  4ASN A;  4UHT A;  1HQC A;  4AIK A;  3FHZ A;  4S04 A;  2VBZ A;  1IRF A;  4AIJ A;  3MCZ A;  5K5O A;  1IXS B;  1T2K A;  3F3X A;  1FSH A;  1QPM A;  5FD6 A;  3BRO A;  2GWR A;  3V8K A;  4HF1 A;  1YQA A;  2GZW A;  4KIG A;  5E18 F;  1H0M A;  3G73 A;  2VBY A;  1KQ9 A;  3V8L A;  3Q9V A;  1FYK A;  3WU1 B;  3L00 A;  3ZMD A;  4OIN F;  2RKH A;  4YFK F;  1KYZ A;  3JAM Z;  3BPX A;  3WGH A;  2G9W A;  5CVJ A;  2OZ6 A;  4EV0 A;  1JXS A;  4KIB A;  4P9F A;  2FQ3 A;  3ZN1 A;  4ON0 A;  1BC7 C;  1QZZ A;  3KP3 A;  1YS7 A;  3MQ0 A;  2DI3 A;  5ICG A;  3F6V A;  1O3Q A;  5KVR A;  3T8T A;  1XB4 A;  1W5S A;  3KP4 A;  1E2X A;  2XAH A;  2NRA C;  4P96 A;  3CJN A;  2JSC A;  3P9C A;  4WXC A;  3GX4 X;  2RQP A;  3KP7 A;  1BI1 A;  4HW0 A;  3M8E A;  2IW5 A;  5ILU A;  1CGP A;  4HQM A;  5IT9 Z;  5LEK A;  1B9N A;  4MHG A;  2K86 A;  2QUF A;  4U7B A;  5LGN A;  5IT3 A;  1IN8 A;  1R22 A;  3T1B A;  3V7C A;  2QQA A;  4RB3 C;  3TOB A;  5ILS A;  3ZN0 A;  2DT5 A;  1O57 A;  4R8H A;  3R60 A;  2F2E A;  3KP2 A;  3HSR A;  1HXD A;  2CSO A;  5EEH A;  5A2Q K;  3KEO A;  1BOA A;  4XLN F;  4CGZ A;  1FT9 A;  4EM2 A;  1OYI A;  1P2F A;  2Z5U A;  1YW9 A;  2PMH A;  1G6N A;  2MH9 A;  2FEZ A;  5BMZ A;  3L09 A;  3TO9 A;  2P5K A;  2XAG A;  4HZF A;  2ISZ A;  1P4W A;  4PGH A;  4YII A;  1IAW A;  4Q47 A;  2ZJ2 A;  1HKS A;  4A6D A;  1IN4 A;  1L3L A;  2V1U A;  4Q4Z F;  5FO5 A;  5J6X A;  2FU4 A;  3RKY A;  2MLK A;  3I64 A;  4HA8 A;  3IWZ A;  1PUE E;  2A07 F;  2GXB A;  1IZ1 A;  1LDJ A;  5L3D A;  1YTY A;  2MD5 A;  4XBF A;  3QP6 A;  4LLG F;  2HYF A;  3LFK A;  5ED4 A;  2UWM A;  2QYO A;  1TTY A;  1R36 A;  4EJW A;  3P9I A;  1C0W A;  1U6G A;  3CUQ A;  1MJB A;  1ZAO A;  5HVQ C;  1ZRF A;  2HS5 A;  4I7H A;  3D5L A;  1F1Z A;  3LWF A;  3FM5 A;  5HLG A;  4BHP A;  2RDP A;  3BJO A;  4UNO A;  1IF1 A;  2EA2 A;  4A5N A;  2VT3 A;  2FOK A;  3WU0 A;  1JHH A;  4IRG A;  4HV6 A;  4EMS A;  2R7F A;  2M1B A;  2K27 A;  3QP5 A;  4GXO A;  3F8F A;  1AWC A;  3E5U A;  1EH6 A;  1QNT A;  2EFP A;  4HYE A;  3CTA A;  3HSF A;  1TQM A;  3V7R A;  3GZ5 A;  2FML A;  1S6L A;  1R1T A;  4ZYG A;  5LHG A;  3WTT C;  3U9G A;  4OIP F;  2W57 A;  3ECH A;  1L0O C;  2F5C A;  1Z6R A;  2G7H A;  2WTE A;  2GQQ A;  2VOP A;  4RAZ A;  3MFK A;  1OYY A;  4U0W A;  5D6F A;  2EJR A;  3JSO A;  1B4A A;  4RGS A;  3FMS A;  3AAF A;  1J5Y A;  3FZV A;  4ENK A;  4LMY A;  2QQ9 A;  4I01 A;  2DLL A;  2BBY A;  2IA0 A;  4G6D A;  5ILV A;  3TO7 A;  1NHA A;  1XGN A;  1XGM A;  2ZME A;  1ZH5 A;  1S3J A;  4I0B A;  3GEZ A;  3NQO A;  4ESJ A;  2IPQ X;  4RGX A;  4L0Y B;  4UV8 A;  5AON A;  5E1W A;  2EV6 A;  2V1X A;  2H6C A;  3ISP A;  3S2W A;  5ICF A;  4A2U A;  3WOD F;  3VB2 A;  2VN2 A;  3E3V A;  1P4X A;  2E1C A;  2IA2 A;  3QU6 A;  4M6Y A;  1O3R A;  4FX0 A;  3BOQ A;  3KZY A;  1RNL A;  2ZKZ A;  1GVJ A;  3GVA A;  2KIM A;  3CO6 C;  1F5T A;  2QM3 A;  3IC7 A;  3F23 A;  2DAO A;  4UVB A;  2IJL A;  1ZRC A;  4MQ9 F;  2QZ8 A;  5F6F A;  4CYD A;  4LG0 B;  3MEX A;  4EVI A;  3TDU C;  3RYR A;  1XMA A;  3CLO A;  3F8B A;  4HV5 A;  1IRG A;  3HIF A;  5FFZ A;  2VE8 A;  1RUO A;  3GLX A;  3JAM K;  2O0Y A;  2CQK A;  3BZ6 A;  1F9N A;  2VC0 A;  1D8J A;  2UXN A;  1XCV A;  2Y48 A;  2A6E F;  1G3T A;  3I71 A;  4LB6 B;  3TO6 A;  1R1V A;  1D5V A;  1XSV A;  3RKX A;  1BN5 A;  2VT2 A;  1KU9 A;  5DEQ A;  3EYY A;  2YX4 A;  3BDD A;  3WTS C;  2M87 A;  4HF2 A;  1HBX G;  5FGM A;  5IT9 K;  3QPH A;  4KFC A;  5D8K B;  2P5V A;  5LRR A;  4L9T A;  4L9V A;  2L02 A;  3ROU A;  3FXQ A;  5CLS A;  2P7C B;  1J0R A;  4KA4 A;  2O03 A;  1B6A A;  2DTR A;  1FSE A;  2QWW A;  1IUY A;  1I1S A;  1SD4 A;  4I02 A;  1UHW A;  5CYV A;  1BI3 A;  1FP2 A;  4NQW A;  2DQR A;  3SXY A;  5BOX A;  1UST A;  1R5H A;  3OOP A;  3SZP A;  4IRH A;  3GFI A;  5D4S A;  4L9J A;  3RKW A;  3R0J A;  2WWY A;  4EGY A;  1MZB A;  3C3W A;  5BQT A;  4L5I A;  3ZMV A;  1PP7 U;  5E8I A;  1HW5 A;  3M1E A;  3LA3 A;  2XV4 S;  3I54 A;  2A6H F;  2HOE A;  5CVV A;  3NRV A;  1OMI A;  1IXR C;  3LA7 A;  5HDN A;  1XCB A;  4IRI A;  3ELK A;  3FMQ A;  2OA4 A;  3E97 A;  1HSJ A;  1HKQ A;  4EJV A;  4RB0 A;  3BWG A;  3EDP A;  4A0Z A;  2W85 A;  1FP1 D;  1FBU A;  1J59 A;  3T5X A;  1Q1H A;  1SAX A;  2DK5 A;  4OIQ F;  5D5W B;  4UUV A;  5LGT A;  2L3D A;  1I5Z A;  4HLX A;  2V79 A;  3F8N A;  2RN7 A;  1WKM A;  3KLN A;  5L3F A;  2D2W A;  5LBQ A;  4IHS A;  2ADU A;  1RIO H;  3KP6 A;  5L3B A;  1BI2 A;  3PQK A;  3RJP A;  2VE9 A;  1AOY A;  1EH7 A;  1SFE A;  4A12 A;  1WQ2 A;  4KN7 X;  2BGC A;  5TJJ A;  5LHI A;  4KMU X;  1FNN A;  4LB5 A;  1H9G A;  3F22 A;  3EYI A;  1W4M A;  2EFW A;  2M45 A;  1FWZ A;  3FWE A;  2ZNZ A;  2FRH A;  5JHU A;  2W84 A;  4GYI A;  1FPQ A;  1XDS A;  1YYV A;  3DPL C;  3U1D A;  3WTZ A;  4RS8 A;  1FYM A;  3CUQ B;  4BXU A;  5DDG A;  4KUM A;  5LEJ A;  3H3U A;  4BYY A;  4M9Z A;  2YPR A;  1UHM A;  4WCG A;  3FMR A;  1EV7 A;  5F64 A;  2STW A;  2H94 A;  1D8K A;  5FLX Z;  4LD5 A;  4IJA A;  2BV6 A;  3ABU A;  5LHH A;  3BJA A;  3BPV A;  2PLY A;  5H6Q A;  1KA8 A;  1KGS A;  2YSR A;  4EJU A;  2PI0 A;  2UZK A;  4GYG A;  1OKR A;  4EGZ A;  4MEX F;  4ZZL A;  1DP7 P;  3B02 A;  3O6B B;  2HYG D;  4OMZ A;  4RGR A;  4NB5 A;  2VC1 A;  4OOI A;  2VBX A;  3GWZ A;  1FY7 A;  5AIP A;  2P6S A;  3I0T A;  1OR7 A;  3GFJ A;  2KRF A;  4I98 B;  3REO A;  3HOT A;  3WTX C;  4CHU A;  4HX7 A;  2B0L A;  4O6J A;  4WXD A;  1YLF A;  3HHG A;  1P6R A;  2PG4 A;  1MJ9 A;  2DQL A;  4XRF A;  1Z1D A;  4L0Z B;  2JZY A;  4TV7 A;  2Z99 A;  2PQ8 A;  2QVO A;  4M73 A;  2DBB A;  2FA5 A;  2Q0O A;  5DD4 A;  1R5G A;  4HF0 A;  5E17 F;  3H92 A;  2XRN A;  2FE3 A;  2ZCW A;  3HRS A;  4B09 A;  4CIC A;  5FFX A;  2K02 A;  4YG2 F;  3ABT A;  3R61 A;  3VOD A;  2CFX A;  1U78 A;  2LNB A;  1TNS A;  4KIF A;  2ZME B;  1ZHF A;  1FBQ A;  2Q2E A;  3ECO A;  5F1R A;  1UB9 A;  1YFH A;  2FBI A;  2VOD A;  3KZZ A;  1S7A A;  4G6Q A;  2ZO4 A;  1T98 A;  4WF2 A;  3WTV C;  1G4D A;  5ICC A;  5FD5 A;  2IT0 A;  3N97 A;  4M9S A;  1BIA A;  1ON2 A;  4N0B A;  2MC3 A;  2XGX A;  4ESB A;  3WGG A;  5DCM A;  4BAY A;  5JI6 A;  2JRT A;  2XRO A;  4GGG A;  2D45 A;  3GYH X;  1ZG5 A;  4AVP A;  1RUN A;  3E5Q A;  4U7D A;  3P7N A;  4Q48 A;  1Z91 A;  3JW4 A;  1BJA A;  2ZBK A;  3JTG A;  1IN6 A;  1Y0U A;  1FLI A;  2RGV A;  5K1Y A;  1YIO A;  3SZT A;  5JVT A;  2M30 A;  3M8F A;  3ULQ B;  3K0L A;  3MAJ A;  5LGU A;  1FBS A;  1OYW A;  3F8C A;  3HTU A;  2J5P A;  3HRU A;  3SQN A;  2NNN A;  2MLG A;  1WSU A;  2ETH A;  4ZYH A;  3W6J B;  5ICE A;  4Y17 A;  3WE3 A;  4UXN A;  1STZ A;  2CO5 A;  2AS5 F;  2OQG A;  4DNC A;  4OIR F;  4PDK A;  1K6O A;  3HSE A;  4RB1 A;  2EFQ A;  3ZMS A;  1H9T A;  3F72 A;  4M6X A;  4ZZD A;  3COA C;  2IRF G;  3PFI A;  3F21 A;  5D8L B;  2VBW A;  1TQP A;  3I5U A;  3TDZ C;  2UXX A;  2LF8 A;  4QLC U;  2F5F A;  2PEX A;  1LVA A;  1GXQ A;  3IL2 A;  3KET A;  3E6C C;  1WWX A;  2KJB A;  3LA2 A;  3N4M A;  2E1N A;  2RV8 A;  3K1M A;  2XVC A;  3G3Z A;  2LF7 A;  4WWC A;  4MEY F;  4A0X A;  4LFU A;  2OU2 A;  2EFO A;  3HRT A;  4A0Y A;  4OU0 A;  4ESF A;  3RDI A;  2HZT A;  2XUB A;  1T38 A;  4BHB A;  3TGN A;  3WGI A;  4RB2 C;  3W6K B;  4L18 B;  1USS A;  4BH9 A;  4HDV A;  1HKT A;  1SD6 A;  3TQN A;  4ENJ A;  4QWQ A;  2BEO A;  2QBY A;  1YS6 A;  1R58 A;  5EEG A;  3I58 A;  2GA2 A;  3J81 Z;  2VOO A;  2MH2 A;  2AXL A;  3QOP A;  5ERI A;  2KIU A;  3CUO A;  2OZU A;  5CJ9 A;  1KQ0 A;  3SFZ A;  1JHF A;  4MGR A;  2XKO A;  3QU3 A;  3ZPL A;  1W7P A;  3ZMU A;  2QQB A;  3K2Z A;  2TDX A;  2WC2 A;  1IW7 F;  4IVN A;  2P7V B;  2D1V A;  2NYX A;  4OIO F;  1KU3 A;  4G7O F;  3Q5F A;  3L7W A;  2O6G E;  5AIQ A;  4ZYD A;  4A6E A;  3C18 A;  1KU2 A;  4R1H A;  3Q9S A;  3V7S A;  3KFW X;  3ZMT A;  4EQQ A;  1YG2 A;  4WXH A;  5E1X A;  4M9X A;  1BBY A;  2YR2 A;  3HHH A;  1R7J A;  3J80 Z;  2CWE A;  1TLH B;  5D6E A;  5FLX K;  1O7L A;  3U2R A;  4UVA A;  1FYL A;  2DK8 A;  5FB2 A;  3CDH A;  1LDD A;  1S7O A;  3WTU C;  1TBX A;  4CO8 A;  4LLL A;  1B1B A;  1X3U A;  2FSW A;  2ISY A;  2E7X A;  2YU3 A;  1SFU A;  3FF5 A;  1QBJ A;  4B8X A;  3GF2 A;  4EJO A;  4N9I A;  1R1U A;  2OBP A;  2HKX A;  2ESN A;  1MGT A;  1O7F A;  5H6R A;  3DPT A;  1PDN C;  2IA1 A;  1MD0 A;  2V1D A;  3MZH A;  3FM3 A;  1ZGJ A;  4KNY A;  5JFR A;  5D5V B;  1K78 A;  4E70 A;  2OQR A;  1U5T C;  1ULY A;  3BY6 A;  1XDU A;  2Z33 A;  4L5J A;  1XGS A;  4Z2Y A;  2LDU A;  3DV8 A;  1SD5 A;  3KP5 A;  3KCC A;  2QLZ A;  4UVC A;  2W25 A;  2NAZ A;  1XD7 A;  2G7U A;  1LJ9 A;  1DDN A;  2WV0 A;  5L3E A;  4HDU A;  1ZN2 A;  4AWX B;  1LDK B;  4JQF A;  2PMU A;  3LST A;  4U0Y A;  5HDG A;  4HAM A;  2ACJ A;  4FX4 A;  3TOA A;  4D0P A;  3CO7 C;  2OD5 A;  1Z9C A;  1D3Y A;  1LB2 A;  6PAX A;  5DV5 A;  2MBF A;  2HKO A;  2HTS A;  1Z7U A;  3I59 B;  5DCF A;  3VOE A;  3R4K A;  5LLQ A;  2A69 F;  2ZFW A;  2K4J A;  3EET A;  4R79 A;  1WI9 A;  1LEB A;  3LQR A;  3L9F A;  3JSP A;  2J5O A;  2L4A A;  3OV8 A;  5CVU A;  2PFB A;  3JTH A;  2NNY A;  2FF4 A;  1R00 A;  4L9N A;  5DYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...