3L2CA

Crystal structure of the dna binding domain of foxo4 bound to dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
85
structure length
85
Chain Sequence
RRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOXO consensus binding sequence, plus strand
publication title Structure of the human FOXO4-DBD-DNA complex at 1.9 A resolution reveals new details of FOXO binding to the DNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 22
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2009-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l2cA00
2JT1A 2P5KA 5L3GA 1D3YA 2COMA 1FBQA 4PDKA 2OQRA 4KA4A 4ZZDA 1C0WA 3ZPLA 4R1HA 4KIBA 3G3ZA 3ELKA 1KQ0A 1Z7UA 2KIMA 3CJNA 5LHHA 3E3VA 2IVMA 2V79A 3K69A 3R4KA 3R0JA 1BM9A 2XKPA 1U2WA 4LLLA 1EH8A 2GA1A 3LQQA 3ZN1A 1KYWA 2GZWA 4G7OF 2HKOA 2WC2A 1UB9A 1P4WA 3DF8A 1TNTA 1CF7A 4WCGA 4UHTA 3Q9VA 2XRNA 3HIFA 1H9TA 3RPQA 3GO5A 1R00A 4RGSA 3RKWA 3EQLF 2QYOA 3TO7A 4Y13A 5DCMB 5BMZA 2PFBA 3CUOA 3HTUA 2LF7A 1QBJA 3LWFA 1SD4A 2FMLA 2DK8A 3K1MA 3C7JA 4HAMA 3I4PA 2O0YA 2E1NA 5HS9A 1G3SA 2VN2A 5L3BA 2ETHA 3WG9A 2DW4A 4ZYGA 3MQ0A 2YX4A 1TLHB 4A2UA 1CGPA 2HR3A 2H6CA 1A04A 4XRFA 2ZXJA 2L02A 2JTVA 3R6SA 1RZ4A 3L09A 3F8BA 4OMZA 3KZYA 3QOPA 1DUXC 1YIOA 3KFWX 3WODF 3F72A 3LA3A 2V1XA 4HBLA 3FXQA 1YTYA 1D8KA 4UV8A 2QWWA 3T1BA 1Z91A 4GYGA 5LBQA 5HLHA 3IKVA 1JGSA 2E1CA 4L0ZB 1W7PB 1FSHA 3WTVC 2H09A 2GQQA 3VFZA 4HLXA 1XSDA 2Q8KA 3KP3A 1WKMA 3MCZA 1YLFA 1LDKB 5DD4A 2DAOA 4KT5C 5E8GA 3KP7A 1ZN2A 2DU9A 2HYFA 2Z5UA 2FA5A 4WX9A 4CZZA 3RTRA 1IAWA 4O6JA 1H0MA 4N0BA 3ZMDA 1S29A 2RN7A 4LFUA 2A6HF 3DFGA 1Z6RA 2HZTA 4BH9A 5LHGA 1HSJA 1R58A 3ISPA 3WGHA 4M6XA 1QZYA 4NQWA 5LEJA 5HS7A 2FOKA 2M8EA 3KZZA 2CW0F 4DQ2A 1OKRA 2BEOA 2CQKA 1YQAA 4LGWA 3ECHA 2VXZA 4LB6B 1DPUA 3I53A 3C1DA 2OBPA 3BY6A 4ENNA 1LEAA 5ICEA 3KP4A 2B0LA 4N9IA 2MH2A 4WF2A 4A12A 1ZLJA 1TBXA 3FM5A 2FNAA 3BP8A 1O57A 1S7AA 1P4AA 4PGHA 4M9XA 4H0EA 3L2CA 2V1DA 5JR3A 4Q47A 5L3EA 4MTDA 1H9GA 4LD5A 1ZRFA 1TQPA 3TO6A 4LG0B 1XMAA 4HX8A 5HDKA 3COAC 1T38A 1QZZA 4EVIA 2NAZA 4EM0B 2OZUA 4LB5A 4I0AA 1XGSA 2A61A 4ENMA 3RDIA 3O2PE 2R7DA 1ODDA 3WGGA 3ROUA 2ISYA 2CSOA 3PQJA 3RYPA 3GVAA 3JTHA 3O3KA 2D1VA 1J5YA 1OMIA 1R7JA 5DCFA 4A6EA 1FYKA 1SD5A 2WV0A 2ZCWA 3I54A 1R1UA 1D5VA 2DI3A 1FZPB 2UWMA 2HS5A 3Q5FA 4ZZLA 1ZYRF 1UHMA 5D5UB 3LAPA 4HF2A 3V4GA 4FHTA 5BS6A 4GGGA 4EGYA 3HRSA 3U2RA 4CICA 1QQIA 3TOBA 5CVIA 4RGXA 1FPQA 3MZYA 5E18F 5ERIA 4LK0F 1RIOH 1BI3A 5HS8A 3V7SA 2HEOA 2X0LA 2Z99A 3T8TA 4BXUA 4M72A 3FHZA 3W6JB 3LAJA 4OINF 3K2ZA 2QBYB 3DPTA 4OIPF 5LGNA 5E1ZB 1GVJA 3F22A 4MEXF 3QP5A 4M9ZA 1F4KA 2PMUA 1O7FA 3BROA 4LLNA 1GXPA 3F8FA 1LB2A 3I59A 2NRAC 1R22A 1EH7A 4MEYF 3EETA 2G7UA 2XASA 1FBSA 2RVCA 5CLSA 4RAZA 2ZNZA 1ZAOA 1TW2A 5HVQC 4ESBA 2MBFA 2ZFWA 1OYWA 2Y75A 2MD5A 1T0FA 1Z1DA 1ZARA 1IN7A 2JPBA 3HOTA 3VB2A 1KQ9A 3JAMK 5K5RA 3BWGA 4HV6A 4EQQA 3LA2A 4IHSA 5J8FA 3P9IA 2ZMEB 3SQNA 5IT3A 1E2XA 1XSXA 2O6GE 5AONA 4CXFA 2IA0A 2EA4A 3ZMUA 3SZPA 1W7PD 1XD7A 4FX4A 2AXLA 3KLNA 3RYRA 4IRIA 1XGOA 5LEKA 3EYIA 1G6NA 2P4WA 3IWFA 4G8XA 4G9YA 2CWEA 3GX4X 2FBKA 1I1GA 1BIAA 1YS7A 4YG2F 1U6GA 3REOA 3IRQA 5AIPA 2V1UA 2IT0A 3RPUA 5E20A 2C6YA 2GIVA 1HKQA 2DK5A 2W84A 4M74A 4P5OA 2KKOA 3E5UA 3V8KA 3MAJA 3F23A 4UVAA 1U5TB 4B09A 4BHBA 4OIQF 2L54A 3H92A 5L3CA 5LRSA 3BJ6A 5KVRA 2XAGA 3KEOA 3VEPA 3N4MA 2FF4A 2PQ8A 3HOSA 4ENKA 4L9JA 2PI0A 2A5YB 4XBFA 3HSRA 4R79A 4U7DA 3G73A 2W25A 3F8CA 2DTRA 1P4XA 3DP7A 3FWEA 4YIFA 3WE3A 5KK1A 3P7NA 5JHUA 5D5VB 1TW3A 2XKOA 3D0SA 2PEXA 1QPMA 4GCVA 3ULQB 5D5WB 2BE5F 3NRVA 4WXCA 4MTEA 3TDUC 2GAUA 2M45A 5K5OA 2WTEA 1IXCA 2XVCA 5K1YA 4CGZA 3RIRA 1TQMA 5K5QA 1O3SA 3FZVA 2VT3A 4XSXF 4RS8A 1HKTA 3E5XA 5FB2A 4HDVA 1T98A 4M9SA 4EJOA 3KE2A 1ZGJA 1YW8A 2O3FA 1EH6A 2OD5A 4Y17A 1ZH5A 4EJVA 1YW7A 3I71A 1HKSA 1Z05A 5DCMA 4BHPA 1IW7F 5EEGA 1F5TA 4BYYA 4XLPF 3GXOA 4N9HA 1SFXA 4UVCA 1G3TA 4M71A 1ZG3A 1IN4A 3M9AA 1PDNC 2FNPA 5DV5A 4B8XA 3F6VA 3K0LA 5CJ9A 2Z3YA 3V8LA 1Q1HA 3WTUC 1O3QA 2PMHA 3ZMTA 4WWCA 1WSUA 3FXRA 1G3WA 2P6TA 1TNSA 3B73A 1HSTA 4A5MA 2IW5A 1P2FA 2HQRA 4MQVA 2YR2A 5JI6A 2D2WA 4AWXB 2LNBA 5CVRA 4KNYA 3MWMA 2JRTA 3TO9A 2VT2A 4OMYA 3HHHA 4QLCU 3BDDA 1YO5C 4L0YB 1I27A 2EV0A 1LDJA 2QENA 4L5JA 3E6CC 2IPQX 1EV7A 2PBIA 2K4JA 1ZRDA 2A3SA 3SXYA 4IHTA 2OU2A 5D8KB 1L0OC 2L01A 3NQOA 2GXBA 1KU3A 1JHFA 2V9VA 3LA7A 1XMKA 4WXHA 1FP1D 1S6LA 3BJAA 5CVVA 4MNUA 1AWCA 3IKTA 4ESFA 4MQ9F 1GHCA 1O7LA 4UVBA 1Z6TA 4RAYA 4JBAA 2V6CA 1B1BA 2QZ8A 2ZNYA 2EFPA 1T2KA 1XB4A 4EM2A 2W85A 3GZ6A 3CO7C 2VE8A 4G6QA 4L9VA 2P6SA 1K78A 1OPCA 3S2WA 1I6XA 5LRRA 2NNYA 4F7ZA 1MJ9A 3ZP5A 2EV5A 1FBUA 2FSWA 1BC8C 1ONVA 2XUBA 5HOOA 1ZGAA 4Z2YA 3WE2A 5BQTA 5A2QK 1DP7P 3T8RA 1IRFA 2LKPA 2JZYA 2XAQA 2EV6A 3QU3A 3GWZA 2EJRA 1LNWA 3EDPA 3V7CA 3VOEA 4MGRA 1T39A 1PP7U 2QVOA 1SD7A 1U3EM 1WI9A 4L18B 2AS5F 1R36A 1WWXA 4BHCA 5E1WA 4KYWA 4CDGA 2VC1A 3W6KB 4KIFA 1YFHA 4I98B 3HTSB 3BJOA 4IXAA 1BJAA 2P5VA 4HW0A 2Z33A 1V4RA 1BOAA 5E8IA 4I7HA 3ECOA 2FBHA 5ICGA 4LLGF 1R23A 2K4BA 3KCCA 5A2QZ 2HGCA 1XSVA 3F6OA 2RNJA 1XCVA 2QM3A 4OIOF 4ZYEA 3FF5A 1U8RA 1XCBA 2QQAA 1LQ1A 1W4MA 1PUEE 4ZYHA 2Z9OA 4BNCA 2M30A 1JHHA 2OA4A 2HTJA 4D0PA 2CG4A 3GLXA 2RGVA 1FYMA 3F21A 1SMTA 1NHAA 3Q9SA 4HF1A 1BI1A 2CYYA 3P9KA 2Q0OA 4WK8F 4A5NA 5HLIA 5F6FA 3EYYA 1R5GA 3GEZA 2F2EA 2GA2A 2KIUA 1IN5A 5CVJA 4IPAA 1D8JA 1FLIA 1IXSB 1S8NA 5ILUA 2BGCA 3HYIA 3QP6A 5H6QA 1P92A 1ON1A 4KMUX 1I5ZA 2FMYA 4S04A 3BZ6A 3FM3A 3I59B 3QRFF 2HTSA 2P7VB 2QQBA 3CLOA 4HX4A 4NHJA 2LDUA 2YSRA 2EFOA 1OR7A 3IWZA 1ZHFA 2YPRA 2H6BA 4GXOA 3BPXA 1E17A 1MD0A 3CDHA 1P6RA 3HUGA 3LQRA 4KDPA 3QPHA 2HWVA 3KP6A 3ZQ7A 2DT5A 1S3JA 2Q2EA 2ZMEA 2R3SA 1IRGA 3FMRA 3MZHA 1B59A 3K1NA 5H20A 2K27A 3I0TA 4HA8A 5L3DA 5DUIA 4I09A 3CO6C 1L3LA 3R60A 2JPCA 1W5TA 2D45A 2ADUA 2M1BA 2ZJ2A 4A0YA 2DFIA 3HSFA 2O03A 1J0RA 1V3FA 1MJAA 1ULYA 2A68F 3TGNA 3ZMSA 3DXJF 1MDMB 4RB1A 1STZA 4Q5SF 4EV0A 3WTWC 2P5LC 1YYVA 2ZBKA 1T6SA 4Q4ZF 5L3FA 5DD8A 3CUQA 3FXUA 1U5TA 4FT8A 4IVNA 2MLGA 5FD6A 4L5IA 3I64A 3VODA 4XSZF 1IUYA 1FNNA 3HRMA 1ZG1A 3F8MA 1SAXA 2XAJA 1ZG5A 1QO0D 3ERED 4P55A 1IN8A 3WTSC 2A07F 3IHUA 1RUOA 3F3XA 3T5XA 2VBYA 2Y48A 3NEUA 2NNNA 2HQNA 4QWQA 2VE9A 2XAFA 4L9TA 3CTAA 5ILSA 3JSPA 1IF1A 5BOXA 2VODA 1ZLKA 2DQRA 2UXXA 5LHIA 1SFEA 2MLKA 3JSOA 4ESJA 3DQVC 1O3TA 2VBZA 2XAHA 4NB5A 3GF2A 2VOOA 2D1HA 5E1XA 2KJCA 3E6MA 4IRGA 4YIIA 1MKMA 4IJAA 3I58A 4S05A 2P7CB 1W5SA 3U9GA 5ILVA 2GXGA 4PZJA 3MEXA 3V7RA 1KU9A 3I5UA 3WTTC 3LFKA 2DO7A 1Z9CA 4ETSA 4GYIA 1LEBA 3GW2A 1Y0UA 4ZYDA 4OIRF 4AVPA 4U7BA 3SZTA 1LVAA 1SMYF 5DDGA 4HYEA 3WGIA 1J75A 3J81K 3B02A 3E5QA 4M73A 4CO8A 3FX3A 2IA1A 4YFKF 3OOPA 1CF7B 1UHWA 4O3MA 4IRHA 2MC3A 1USSA 3HSEA 3HRUA 1QGPA 5DYMA 4P9UA 3WU1B 2VBWA 3TDZC 4AIKA 4IF4A 4I0BA 2HFHA 2YU3A 2J5OA 2FRHA 4HF0A 2XGXA 4UV9A 4E70A 4GO1A 3M8EA 1S7OA 2M87A 5HDNA 3QU6A 2EA2A 2L4MA 1WQ2A 1X3UA 3K1PA 1B9NA 1SD6A 1O3RA 2QUFA 1ZRCA 5IT9K 1HBXG 5FLXK 1IZ1A 4KUMA 3EUHA 2HYGD 1W7PA 1ZREA 1JE8A 2L4AA 3TOAA 3KLOA 4EJWA 1USTA 3J81Z 1YW9A 1F9NA 2K7LA 2PJPA 4O5VA 2FQ3A 5AIQA 2FU4A 2FE3A 3R61A 4HOBA 1BI0A 5JFRA 3TQNA 3HRTA 2FXAA 4HX7A 1XN7A 2NS0A 4UXNA 2O8XA 5CVUA 3WU0A 4DNCA 4HLYA 1OYYA 4EJUA 1UFMA 5BPIA 1BI2A 5CYVA 3ZN0A 4Y15A 1RUNA 1R1TA 2MA3A 3BOQA 4RB3C 4AD9A 3LSTA 4LJZF 2G7HA 3FMQA 3V8JA 3C3WA 5IT9Z 3GZ5A 2BV6A 5FLXZ 3PFIA 2RC4A 1XGMA 3WTYC 3DKWA 2VC0A 3AAFA 1HW2A 5FO5A 3KEQA 2STWA 3E6DA 5FFZA 3ABTA 4KN7X 5D8LB 2GWRA 4U0WA 4XLNF 6PAXA 4HQEA 2J5PA 1LJ9A 1MGTA 4U88A 1G4DA 2CO5A 2KJBA 2R7FA 1K7AA 1HW1A 2IJLA 2LSOA 3IC7A 5TRDA 1K78B 5F1RA 3U1DA 1MJBA 2YX7A 4HV5A 2L3DA 2CFXA 1HW5A 5F64A 4TV7A 2KRFA 4JK1X 3GFMA 2ZO4A 1FSEA 2EFWA 1HXDA 1FOKA 4LG0A 4EMSA 2XROA 4KFCA 1PP8F 2LF8A 3E6BA 2K02A 1K6OA 4A6DA 3DV8A 2ESNA 3WTXC 4CYDA 2HKXA 1TQIA 3DEUA 3KP5A 2PN6A 5D5XB 3TKYA 3P9CA 3H3ZA 2F5EA 2QLZA 5LGUA 2W57A 4RB2C 2STTA 1R1VA 2E7WA 3GYHX 2OAZA 4A0ZA 2QQ9A 4G7ZF 4EGZA 4ZH4F 5D6EA 2IRFG 3N97A 3F8NA 1LDDA 3M7GA 4M6YA 4ASNA 2M5WA 2W24A 4RB0A 4HZFA 4P96A 2BYVE 1BN5A 2EFNA 3GFJA 4AIHA 1FC3A 2F5CA 4OOIA 2FEZA 3L9FA 4YFXF 2WWYA 2IA2A 2XHKA 1B9MA 2Y0MA 5D4SA 4HQMA 4A0XA 3KETA 2XIGA 3L7WA 1REPC 3CUQC 1U5TC 3M1EA 2UXNA 5EEHA 4UNOA 2IP2A 4G94A 5ED4A 1KU2A 1R5HA 3J80K 1I1SA 2E7XA 3O6BB 2QBYA 1KGSA 5LLQA 4MHGA 5ICCA 5H6RA 2VONA 4I2OA 2JSCA 1IN6A 4CHUA 2F5DA 3JW4A 1FWZA 3J7AO 3HHGA 4Q48A 2EB7A 5D6FA 1TTYA 3T0YA 3ZMVA 3H3UA 1BBYA 4I02A 4EJTA 1J7KA 3D5LA 3QAHA 1YG2A 2KIFA 4ENJA 1B6AA 3R0AA 1BIBA 3WTZA 3IRRA 5E17F 4UUVA 1FT9A 4FX0A 2DBBA 3RKXA 4ON0A 1J9IA 1K79A 4RGRA 4AIJA 1XDUA 1OYIA 2ACJA 2F5FA 2EK5A 2BBYA 3GUDA 2RV8A 3GFIA 5HDGA 1FX7A 1UCRA 4U0YA 1KA8A 4KICA 3J80Z 3K9TA 3RKYA 2NYXA 2ESHA 1VTNC 1FP2A 1ON2A 1SFUA 1BC7C 3C18A 4U0VA 1GXQA 2EWNA 1YS6A 4L9NA 1G3YA 3ML6A 5LGTA 1WRJA 4JQFA 5FD5A 1J2XA 3MFKA 1FY7A 1RI7A 4OU0A 3ABUA 5J8CA 5FGMA 3PQKA 1FYLA 5HLGA 1DDNA 2ISZA 2TDXA 2HDCA 1DPRA 2HOEA 1F1ZA 1HQCA 2ZKZA 2PLYA 4LK1F 4KN4X 2EFQA 3BPVA 1MDMA 5DUKA 2G9WA 2OQGA 4RGUA 2PG4A 1QNTA 1KU7A 1B4AA 2A69F 3L00A 4P9FA 3IL2A 2DPDA 4PCQA 4R8HA 5TJJA 1RNLA 2OZ6A 5J6XA 2H27A 5JVTA 1IXRC 2X4HA 2H94A 2A6EF 3OV8A 1XDSA 3SHFA 5BPDA 4G7HF 4YFNF 4HDUA 2UZKA 1AOYA 3JAMZ 1J59A 4WXDA 2ELHA 3DPLC 2RDPA 3QPTA 5ICFA 3CUQB 4KIGA 3KP2A 2FBIA 3M8FA 1XGNA 3RI4A 4K2EA 4I01A 3RJPA 2RQPA 2VBXA 2XV4S 1MZBA 4BAYA 3FMSA 4BQAA 3SFZA 2RKHA 4LMYA 5DEQA 2P8TA 2VOPA 5FFXA 4PGGA 4G6DA 3GFLA 1KYZA 3E97A 4KMFA 3ZMZA 2DQLA 2K86A 4EM1A 1JXSA 5D4RA 2CGPA 2DLLA 2DPUA 2O61A 1U78A 2MH9A 3JTGA 1KQ8A
chains in the Genus database with same CATH superfamily
1QRYA 2JT1A 1A6QA 2P5KA 5FKMA 5L3GA 1D3YA 2BVLA 2COMA 1FBQA 3HB9A 1NH3A 3ABMH 4I76A 3BQYA 2EZHA 1S7EA 4PDKA 2OQRA 4KA4A 4ZZDA 1C0WA 3ZPLA 2VQLA 3FXLA 4R1HA 4KIBA 3MMYB 1RRJA 3G3ZA 3QPSA 1XTAA 3ELKA 1VZ0A 1KQ0A 1Z7UA 2KIMA 3CJNA 5LHHA 2WV1A 3DTKA 2CS3A 3E3VA 2NVTJ 1MNDA 2IVMA 2V79A 3K69A 3R4KA 3R0JA 1BM9A 2H1LA 1AA7A 3OWTA 4XONA 2XKPA 1U2WA 4LLLA 4Y52J 1EH8A 3O8HA 2GA1A 3LQQA 3ZN1A 3I55I 3GTLJ 2CU7A 1JKOC 1XMXA 1DP3A 1KYWA 2GZWA 4G7OF 3HEFA 2HKOA 2WC2A 1UB9A 2LBFB 3OYMA 1R71A 5LFAA 1P4WA 2V9KA 2MGQA 3DF8A 1TNTA 1CF7A 4WCGA 4UHTA 3Q9VA 1R4MB 5K7ZA 4UUSB 3OIPA 2XRNA 3HIFA 1WJFA 1H9TA 3RPQA 3GO5A 1R00A 4HNUA 5DM6F 2OC6A 2DOAA 4RGSA 1Z7LA 3RKWA 3EQLF 2QYOA 3TO7A 1P9QC 4Y13A 2W7NA 5DCMB 5BMZA 3UKGA 2PFBA 1PJRA 3CUOA 1W36C 3EUKL 3HTUA 2OTJI 2LF7A 4XR6A 1QBJA 3LWFA 3OYKA 2MW8A 5H2FC 1SD4A 1WHUA 2ZFUA 2FMLA 3ZQFA 2DK8A 2V9PA 1RKTA 2MG4A 3K1MA 4CSWA 2VUMJ 3VYTB 1G2HA 3C7JA 4HAMA 3IAS2 2X1DA 3I4PA 2HOSA 3JRGA 2O0YA 3H9JA 2XC7A 5KAIC 2E1NA 4XOPA 1ZKGA 2XGEA 1G3SA 5HS9A 1ZELA 2VN2A 3SDBA 3TBIA 3H0DA 5L3BA 1ITYA 3FBNB 2ETHA 2ELJA 1SANA 3HXLA 1V5EA 3WG9A 2K85A 3GTMJ 1WVRA 2DW4A 4ZYGA 3MQ0A 2YX4A 1TLHB 4BDYA 1DGWY 3PNTA 4A2UA 4B47A 1CGPA 1UJ8A 4BQOA 2HR3A 3CMAI 4RLFA 3DEEA 4N4NB 2IS4A 4II3A 2H6CA 1A04A 4CCOA 3LMMA 4XRFA 2HI3A 2ZXJA 2L02A 2JTVA 3R6SA 1RZ4A 2G0EA 3F8BA 3L09A 3KZIC 4B48A 1LE8B 5M3FJ 4OMZA 1H8AC 3KZYA 2O7OA 3QOPA 1DUXC 1YIOA 2BVMA 2XSJC 4A3JJ 3KFWX 4FQGA 3WODF 3F72A 3LA3A 2V1XA 4HBLA 3FXQA 5B5EC 3G71I 1YTYA 1D8KA 4UV8A 3RZOJ 2QWWA 3T1BA 3V42A 3ZQHA 4F92B 1Z91A 4GYGA 5FLVA 5FKOA 5LBQA 5HLHA 3IKVA 1JGSA 2E1CA 2M7BA 1QVUA 2H1KA 4IKFA 1W5CC 4L0ZB 1XG1A 1W7PB 1FSHA 3WTVC 2OCEA 4E7ZA 2H09A 2LFBA 2DFEA 4M3EA 5EG0A 5J1YA 1Z21A 2W4SA 2GQQA 3VFZA 4HLXA 3L2VA 1VI0A 5E3MA 1XSDA 2DOEA 2IEKA 2Q8KA 3KP3A 5IP6A 1E3PA 1X2MA 2V1NA 1WKMA 3MCZA 4XRMA 4OAYA 2CFOA 3ZQIA 1QHGA 1YLFA 1LDKB 1FOYA 3G1LA 2GBYA 1HDDC 5DD4A 2DAOA 4KT5C 3CQZJ 5E8GA 3KP7A 1FTZA 1ZN2A 2TCTA 2DU9A 2HYFA 2LKXA 2Z5UA 2M0MA 2NS7A 2FA5A 4WX9A 3BZKA 2JSPA 4CZZA 3RTRA 1IAWA 4O6JA 1H0MA 2XSDC 2XF7A 4N0BA 3ZMDA 1VQKI 4ZYAA 1JT0A 2R7TA 1S29A 2RN7A 4LFUA 3QPLA 1P7IA 2A6HF 2MFZA 3DFGA 1Z6RA 2BY2A 5E3LA 2E35A 2KRHA 2X48A 2HZTA 4BH9A 5LHGA 1HSJA 1D0ZA 1R58A 4J00A 1WGXA 1X4PA 2R5YA 3ISPA 3WGHA 4M6XA 4A3EJ 2JA5J 1OCRH 1QZYA 2XAUA 4NQWA 2DCEA 5LEJA 5EDNA 2X51A 5HS7A 4Y33A 1XC5A 2FOKA 3FISA 2M8EA 4YRVA 3KZZA 2L7KA 4FTHA 2CW0F 4DQ2A 3QQAA 1OKRA 1X1DA 4KISA 2BEOA 2CQKA 2VQHA 3OYNA 1YQAA 3W3CA 1QHHD 3JRIA 4OWRB 1LKXA 2EIMH 3ECHA 2VXZA 4LGWA 2HVRA 4LB6B 2UV1A 1E3HA 3HKZA 1DPUA 3ONQA 5CQEA 2WADA 3C1DA 2IXSA 3I53A 2OBPA 2BZTA 3BY6A 2LG4A 4ENNA 2XPUA 2JVGA 4BL0B 1LEAA 5ICEA 1TL8A 1X1CA 2L9SA 5K7HA 3KP4A 4PSXA 2B0LA 3CCSI 4N9IA 3OL3A 1LUJB 1OCCH 3C2HA 4PJJA 4LG3A 3UR3C 4IHXA 3LSIA 2MH2A 4WF2A 4A12A 2R7QA 1ZLJA 5EF6A 1TBXA 3CP2A 3FM5A 5J4YA 1YRNA 2FNAA 2XPVA 3BP8A 3OS1A 5FJ8J 1O57A 2AXTC 2I10A 5JVGF 1S7AA 3ZXSA 1P4AA 2HVQA 4PGHA 4M9XA 4H0EA 1X58A 3L2CA 2V1DA 5JR3A 1A31A 4Q47A 5L3EA 4MTDA 1DGRM 5GTHC 1H9GA 4LD5A 1ZRFA 1OCTC 2BY3A 1TQPA 3S3NA 3TO6A 4LG0B 1XMAA 4HX8A 5HDKA 3COAC 5GPAA 1OCZH 1T38A 3S32A 1QZZA 2HPMA 5GAEJ 4EVIA 2NAZA 4G12A 2OZUA 4EM0B 4I99C 4LB5A 4NC7A 1R9TJ 1ACIA 3K4BA 1Y0NA 4I0AA 2R7XA 1XGSA 2A61A 2L7FP 4ENMA 3RDIA 3O2PE 5FKNA 2R7DA 3OOUA 1B72B 1FIPA 1ODDA 3WGGA 2DMUA 3TW7A 2WBMA 3ROUA 2ISYA 2PMZA 4BDZA 2CSOA 3PQJA 3CESA 3RYPA 3GVAA 3JTHA 3O3KA 1F43A 2D1VA 1J5YA 2EH3A 2BOLA 4PFPA 1VQPI 1APLC 2PMZN 5C3EJ 1OMIA 1R7JA 5DCFA 4A6EA 1FYKA 1TWGJ 1SD5A 2WV0A 2ZCWA 3I54A 1R1UA 1D5VA 2DI3A 1IRXA 1FZPB 4YIRX 2UWMA 3BT9A 3HJEA 1UELB 2HS5A 2ME0A 2X1EA 3Q5FA 2HOAA 2QF7A 4ZZLA 1ZYRF 1UHMA 4AM3A 5D5UB 5F04A 2VKEA 3OYJA 3LAPA 4BEHA 4HF2A 3V4GA 1V54H 3L2QA 4FHTA 5BS6A 2VKVA 2VJIA 4G6TB 4GGGA 4EGYA 3S1QJ 1GV2A 1ETWA 3HRSA 2XDVA 1YHQI 3U2RA 4CICA 1QQIA 2GIZA 3TOBA 2K9SA 5CVIA 4BE1A 4RGXA 2EZIA 1FPQA 2ECBA 9ANTA 3MZ8A 4IEJA 3MZYA 5E18F 3HBLA 2ICWG 4C3IJ 4XOTA 5ERIA 4LK0F 1RIOH 4JYKA 4IZZA 1BI3A 2JA8J 5HS8A 3V7SA 2HEOA 2X0LA 2Z99A 3AG1H 3S17J 3T8TA 2E5NA 3G1OA 1PUFB 1WJBA 3ZCOA 4BXUA 3K4CA 2DXIA 1WI3A 4M72A 3FHZA 5B1AH 2E34A 3W6JB 3OYBA 3LAJA 1JT6A 4OINF 3K2ZA 2QBYB 3DPTA 3N05A 4OIPF 5LGNA 2LD5A 4BXXJ 2JUCA 5E1ZB 1GVJA 3F22A 4MEXF 3HZJA 2GXAA 3QP5A 4M9ZA 4DJAA 4XRSA 1F4KA 2F4MB 2PMUA 1O7FA 3BROA 4LLNA 1GXPA 3HGGA 3F8FA 1WH5A 1LB2A 3I59A 4H4KC 2CQNA 1FMWA 1Y56A 5IYDJ 3TW6A 1D1AA 2W1OA 1GLNA 3HOXJ 2NRAC 1YJWI 1R22A 4F55A 1EH7A 4MEYF 3J7YJ 4FCYA 3EETA 2QSFX 2G7UA 2WB1A 1I3AA 3L2UA 2XASA 3FXOA 1FBSA 1MSFC 2RVCA 5CLSA 3DTEA 1MMGA 4N4OB 4RAZA 2ZNZA 2WB1N 1ZAOA 3CC7I 1TW2A 2K9LA 5HVQC 4BE0A 5EGOA 4ESBA 2MBFA 3ABLH 5TISC 2ZFWA 1OYWA 2Y75A 2K9NA 2MD5A 3IH2A 1T0FA 1Z1DA 1ZARA 3CCEI 3FXJA 1IN7A 2JPBA 3HOTA 4QPOA 3ABKH 3VB2A 1KQ9A 1I3QJ 4EATA 3JAMK 2DT6A 2KP6A 4XIDA 1MMSA 4CH7A 1HC8A 3FBIB 3PJRA 5K5RA 3BWGA 3DBRB 3CCJI 2LY2A 4HV6A 4A93J 5EJCA 4UY8I 1UAAA 1R5ID 3LSJA 3HOUJ 2H8RA 2R7VA 3HUGB 4PK4A 4EQQA 3LA2A 4IHSA 5J8FA 3P9IA 2JUGA 4HNTA 4Y4RA 2ZMEB 3SQNA 3ERMA 5IT3A 1E2XA 1XSXA 4XLCA 1Y39A 2O6GE 3SJMA 5AONA 3DTIA 4CXFA 3MVPA 1IDZA 5F0FA 4M3FA 5B1BH 4NUBA 5IP7J 2IA0A 1KONA 2EA4A 3ZMUA 3SZPA 3GLLA 1W7PD 1XD7A 5C4XJ 3U21A 4FX4A 3OSGA 2AXLA 3KLNA 3CC4I 3RYRA 4IRIA 1XGOA 5LEKA 3HPHA 2CQXA 2DJIA 3NWSA 1XS9A 3EYIA 2W82A 1HOMA 1G6NA 2P4WA 3IWFA 4G8XA 3K70D 4RLQA 2DOFA 1FMVA 4G9YA 3SYTA 5DS9A 2CWEA 3GX4X 2JA7J 2FBKA 1I1GA 1BIAA 1YS7A 4YG2F 1U6GA 3REOA 3IRQA 5AIPA 5GPCA 2V1UA 2IT0A 3RPUA 3BR3A 4E7IA 5E20A 1WJAA 2C6YA 3PSIA 2QGUA 5HNFA 2GIVA 3Q0UA 2XPWA 1HKQA 5GADJ 2DK5A 1V55H 2W84A 4M74A 4P5OA 2KKOA 3S2DJ 2O9LA 1MMAA 3E5UA 4DZPA 3OYIA 3H1CA 3LNQA 3V8KA 1OLTA 3MAJA 4V19K 1IO2A 4BJ5C 3F23A 4UVAA 1U5TB 4B09A 3D1NI 4XM3A 4BHBA 2R7SA 4B44A 2Z2SB 2DMTA 1FJLA 4OIQF 2L54A 2VPRA 3JREA 1ZQ3P 2E36A 2YS9A 3S15J 3CDLA 2Y9ZA 2X9DA 3H92A 5L3CA 2LYCA 3W2VA 2V26A 5LRSA 3BJ6A 2VL8A 1FIAA 5KVRA 2XAGA 3ASNH 3KEOA 3VEPA 1SFKA 2HXIA 3FK7A 3N4MA 2NOJB 2FF4A 2PQ8A 3HOSA 2Z1DA 4ENKA 4L9JA 4XN0A 3SEZA 2PI0A 2A5YB 2LR8A 4XBFA 3HSRA 1A35A 4DYCA 4R79A 2ZB9A 4U7DA 3G73A 2W25A 4CYCA 5CKTA 3F8CA 2DTRA 1TZLA 2AQFA 4D5FA 1P4XA 2LK2A 1J09A 4X6AJ 3DP7A 1FOWA 1MH3A 3FWEA 4YIFA 3WE3A 5KK1A 3P7NA 5JHUA 1IDYA 5D5VB 1TW3A 4C2MJ 1WJEA 4XMYA 4NC8A 1MBEA 4RAGA 2XKOA 4XKBA 3D0SA 3FHNA 2PEXA 3IH4A 1QPMA 4GCVA 5JHFA 3WG7H 3ULQB 2KZGA 2LTPA 5D5WB 2FD5A 3VYRB 1U9OA 2ECCA 2BE5F 3BR2A 1VQ5I 3NRVA 2KDZA 3PIOF 4WXCA 4MTEA 3TDUC 2GAUA 2M45A 2CW8A 5K5OA 2P0WA 2WTEA 1HCRA 1IXCA 2XVCA 1UHSA 3B6AA 3BG7A 5K1YA 4IQJA 5E3NA 4HNVA 5E79C 1W36D 4CGZA 2OF7A 1IJWC 3RIRA 1TQMA 5K5QA 1O3SA 3FZVA 2JWTA 2VT3A 2IBDA 4XSXF 4HG2A 4A3GJ 4RS8A 1HKTA 4FISA 4E7KA 3E5XA 5FB2A 4A69C 4HDVA 1T98A 2JN6A 3B6CA 4M9SA 4EJOA 1BR2A 3KE2A 3K4NA 1ZGJA 1YW8A 2ZXIA 2M9HA 4FETA 4E4HA 5HODA 2K3FA 3DBHB 2O3FA 1EH6A 2OD5A 1AU7A 3FIWA 4Y17A 4D1QA 1ZH5A 1TC3C 4EJVA 1YW7A 3I71A 3LSMA 1HKSA 2DTZA 1Z05A 5DCMA 4BHPA 3CDIA 1IW7F 5EEGA 1F5TA 4BYYA 4FE7A 1X3WB 2E5ZA 5J1RA 4XLPF 3GXOA 3OYLA 4N9HA 1MNEA 1SFXA 1YOVB 4UVCA 4S0HB 1G3TA 1EKEA 1ZG3A 4M71A 2E2IJ 1IN4A 3PSFA 3M9AA 3A0HC 2CQ7A 1PDNC 4YELA 3LL7A 4DYRA 3AG4H 2FNPA 5DV5A 4B8XA 1TT5B 3F6VA 5FRNA 2K40A 2DA2A 1NG7A 5J3LA 3K0LA 5CJ9A 2Z3YA 3V8LA 2WA0A 1Q1HA 4A3BJ 3CJTB 3WTUC 1O3QA 2W00A 2HVSA 2PMHA 3S14J 1SAUA 3ZMTA 4WWCA 1MW7A 1WSUA 2L2OA 3FXRA 1G3WA 2ID3A 3BR5A 1LVKA 2K9QA 3PIPF 3G6EI 2P6TA 4F93B 1TNSA 1BOBA 3C2GA 1FEXA 3B73A 1MBHA 4XKCA 2LLKA 4B3XA 5FKKA 1UG2A 1HSTA 3IAM2 2NVUB 2DT7B 3LSKA 4A5MA 2IW5A 1P2FA 3DEWA 4RMNA 1RPWA 2HQRA 2E19A 4MQVA 2JA6J 3M4OJ 3QYEA 4XORA 2YR2A 5JI6A 3OIOA 1ORKA 2D2WA 5F0CA 4BBSJ 4AWXB 2LNBA 5CVRA 4MLOA 4B1RA 2VIXA 4KNYA 3MWMA 2JRTA 3TO9A 3CCRI 2VT2A 4OMYA 3HHHA 4QLCU 3BDDA 2R93J 4HSRA 4ITVA 2JQ7A 3KEYA 5HNHA 5F08A 1HA8A 2R0QC 4BACA 4MFEA 1YO5C 2V6EA 4XL9A 4L0YB 3J7AY 1I27A 2EV0A 2NOGA 2KRCA 5CQGA 2CUEA 1LDJA 3CCYA 2QENA 4L5JA 3E6CC 2IPQX 1EV7A 2PBIA 2K4JA 2VQCA 2X6WA 1ZRDA 4B3AA 2X6OA 2A6TA 2A3SA 3SXYA 4IHTA 2OU2A 1TT0A 1L0OC 5D8KB 3G4SI 2E1OA 2L01A 1JTYA 1MBJA 3NQOA 1K4TA 2E71A 2CV0A 4BUPA 2GXBA 1KU3A 1BW6A 4BQQA 3GTKJ 3PFYA 3HL2A 5EG0B 1IGNA 1JHFA 2NXNB 3SZGA 2V9VA 4D5CA 3LA7A 3GTQJ 1XMKA 4WXHA 1FP1D 1S6LA 3BJAA 1AHDP 1Z3YA 5CVVA 4KT6A 4MNUA 1AWCA 4XQFA 4LITA 3IKTA 4PJLA 4ESFA 3HPGA 4MQ9F 1GHCA 5F27A 3BG6A 1O7LA 4UVBA 1Z6TA 1B8IA 3PNYA 4A3DJ 1QZEA 3BTCA 1VQMI 4RAYA 4JBAA 1WCMJ 1ETQA 2V6CA 1B1BA 2QZ8A 2ZNYA 1ZGWA 2EFPA 4NBQA 2GOXB 3AL0C 4AU7A 1T2KA 1XB4A 1JGGA 4EM2A 1JKPC 2D5VA 2W85A 3GZ6A 3CO7C 2KT0A 2VE8A 4G6QA 4L9VA 2P6SA 1K78A 3LSPA 1OPCA 3S2WA 3AKZA 3S1RJ 3A02A 1I6XA 2E1MC 1VQNI 5LRRA 4M3BA 2NNYA 4ANJA 3I4MJ 3UNGC 4E7JA 2DDBA 4F7ZA 2M4GA 2DA7A 1MJ9A 3ZP5A 2EV5A 1FBUA 2FSWA 1BC8C 4YEJA 1ONVA 2XUBA 2BW3A 2EILH 2B63J 1N75A 5HOOA 2OTLI 1ZGAA 4RM3A 4Z2YA 4RM2A 4PUSA 2ZSHB 3WE2A 3FKJA 5BQTA 5A2QK 1DP7P 2Q1ZB 2X1CA 1T0FC 3T8RA 2K3PA 1LPQA 1IRFA 2O5RA 2LKPA 2JZYA 1S5LC 2XAQA 2L0KA 2EV6A 2ZXHA 3QU3A 3KYLA 2VJ5A 1VF9A 1V5FA 3GWZA 2FQ4A 2EJRA 1LNWA 3TMOA 3EDPA 4FASD 1P7JA 3KYDB 2KL4A 3EUAA 1DU6A 1YRNB 2EQRA 2N8GA 3V7CA 3VOEA 1JTXA 4MGRA 3CMEI 1T39A 1PP7U 2QVOA 1SD7A 1U3EM 1WI9A 1G59A 4L18B 2AS5F 1PVEA 4W1UA 1R36A 2VKDA 1WWXA 1RETA 4BHCA 4J19A 4XLHA 5E1WA 3GCMA 4KYWA 5IY5H 1DQUA 2CUJA 4CDGA 3MKZA 2DA6A 2WY8Q 3HG9A 2VC1A 3W6KB 5FLMJ 4IHWA 4KIFA 1YFHA 1WZ2A 4I98B 3HTSB 3BJOA 2JK3A 4IXAA 1BJAA 2E60A 2P5VA 4HW0A 2Z33A 1JUSA 1V4RA 1BOAA 2MYSA 5E8IA 4D7MA 3DPUA 4I7HA 3ECOA 2FBHA 5ICGA 4V2FA 2XF5A 3K4LA 3DU6A 4LLGF 1LFUP 4PJMA 1R23A 3RQ4A 4XKVA 2K4BA 3KCCA 2PJRA 5A2QZ 2HGCA 3U1KA 3Q3SA 1XSVA 2M0CA 4KJZA 4BS9A 3F6OA 2FX0A 2RNJA 1XCVA 2QM3A 4OIOF 2BY0A 2F6CA 4ZYEA 4GRIA 3FF5A 2MABA 1U8RA 1XCBA 2IS1A 2F48A 2QQAA 1LQ1A 2NVYJ 1W4MA 3FKIJ 1PUEE 4ZYHA 1MNMC 4A3MJ 1BL0A 1K61A 1MH4A 2Z9OA 3ZQCA 3JTGA 4BNCA 2M30A 1JHHA 2OA4A 1PUFA 1M1EB 2HTJA 1A6IA 1OCOH 4C9YA 4BEHB 4E6KG 4D0PA 2CG4A 2CUZA 3GLXA 3K4JA 3S1MJ 3E0JB 5M5WJ 3W6VA 2Y30A 2RGVA 1FYMA 1TWAJ 2M8GX 3F21A 1QA6A 3S8PA 3FDYA 5B66C 5C4JJ 5GAHJ 1SMTA 3Q0WA 1NHAA 3Q9SA 4HF1A 4C3HJ 3PM1A 1BI1A 4GDFA 2CYYA 4ZDLA 3P9KA 2R5ZB 2Q0OA 4WK8F 4ZDOA 4A5NA 3CD6I 3H3VK 5HLIA 1GVDA 3LSRA 3D5SC 5FKLA 1Y1VJ 2LY9A 3MKWB 5F6FA 2CRGA 3EYYA 1R5GA 3GEZA 4LIUA 1VQOI 1WJDA 2F2EA 2GA2A 2KIUA 1R49A 1IN5A 2XB5A 2JA2A 3RSNA 5KCMA 5CVJA 4IPAA 1D8JA 3OS2A 1FLIA 1IXSB 1S8NA 5ILUA 2BGCA 3HYIA 4XKWA 3QP6A 3LOCA 5H6QA 1P92A 1MMDA 3AL0B 2R7UA 1JJ6C 4LIVA 5GTIC 2H8WA 2KMUA 1ON1A 3LFUA 5EZHA 3OYCA 2HZDA 4KMUX 1JJ8C 1I5ZA 2FMYA 4S04A 3HOZJ 3JRFA 3BZ6A 3FM3A 3I59B 2QSGX 2VASA 4D9JA 3QRFF 2A05A 4E7SA 3S16J 4AYBA 3OYGA 3W2WA 4BU2A 2E1MB 2HQAA 1N78A 2HTSA 2P7VB 2QQBA 2L9RA 4CCNA 2VJ4A 3CLOA 1VQ9I 4HX4A 2EZLA 2Y69H 4NHJA 2LDUA 2YSRA 3K10A 2VLAA 3QOEA 3M1CA 3RZDJ 2EFOA 1PYVA 4AYBN 1OR7A 3G2BA 3IWZA 1ZHFA 2UUZA 1YJ9I 2YPRA 1Z3XA 2H6BA 4GXOA 1IRZA 2X85A 4PFOA 3BPXA 1E17A 1MD0A 3CDHA 3HDDA 1P6RA 3HUGA 5K7FA 3LQRA 4KDPA 1UG0A 3QPHA 2IGKA 3KYCB 3CJQB 5EGOB 1ERDA 2HWVA 3KP6A 2IS6A 2BHZA 2DT5A 3ZQ7A 4MIMA 1S3JA 2Q2EA 2ZMEA 2WAFA 2R3SA 3H5AA 4DIQA 2LKSA 1IRGA 3FMRA 3MZHA 4XLAA 1B59A 5IYCJ 5DM7F 3K1NA 5H20A 5M3MJ 2K27A 3OSFA 2DMQA 1N77A 3I0TA 4HA8A 1Y1WJ 4L5EA 1RR8C 5L3DA 3SFIA 5DUIA 4NNJA 4I09A 3CO6C 4X1EA 2VJJA 3DKXA 4ZTFA 3H5RA 1L3LA 3R60A 1D0YA 2JPCA 1WPKA 1Y8QB 1W5TA 3A2KA 3LSGA 4BXFA 2D45A 2ADUA 3BQZA 2I5UA 1ETKA 2M1BA 1SEUA 2GLOA 2ZJ2A 2M2EA 2M34A 4A0YA 2DFIA 3HSFA 2O03A 1J0RA 3L1PA 1X4OA 3S2HJ 1V3FA 1MJAA 1ETVA 1ULYA 2ID6A 2CW7A 2A68F 2IAIA 1IUFA 3TGNA 3ESWB 3RKQA 3ZMSA 3DXJF 3A01B 1MDMB 4RB1A 1STZA 2RNGA 5E3OA 3PUFA 2K9MA 4Q5SF 2OUMA 2HNHA 3DLLF 4EV0A 3WTWC 2P5LC 3BTLA 1YYVA 2ZBKA 3W2AA 1T6SA 3JCUC 3GBGA 3TL4X 4Q4ZF 1WH7A 5DD8A 5L3FA 3CUQA 3FXUA 1U5TA 4FT8A 2OV7A 4IVNA 4ZDPA 2MLGA 3BZCA 5FD6A 1ETYA 5EZGA 2ME6A 1GDTA 1JUMA 3CP8A 4L5IA 1MIJA 3I64A 4GFBA 1OJLA 3VSLA 1T08B 1D1BA 4PJ0C 3VODA 1JI8A 2IGOA 4XSZF 1IUYA 4FE4A 1FNNA 3HRMA 1ZG1A 3K7AJ 3F8MA 1SAXA 2RREA 2XAJA 4I6ZA 2LREA 4A3IJ 1ZG5A 1SC7A 1QO0D 2KZVA 3ERED 3HOYJ 3OIQA 4P55A 1IN8A 3CLQA 3WTSC 1H89C 3IHUA 2A07F 1RUOA 4QIWN 2NVQJ 2YUSA 4JX5A 3F3XA 1KZHA 3T5XA 4A3LJ 3S3MA 2KDOA 1AKHA 2BXZA 3NARA 2VBYA 2Y48A 1MBGA 2RAEA 3NEUA 2VPLA 2NNNA 3NAUA 3H9GA 2HQNA 4QWQA 4ZC3A 2VE9A 2XAFA 3BG3A 4L9TA 3CTAA 5ILSA 1E3OC 3JSPA 1IF1A 5BOXA 2VODA 1ZLKA 2DQRA 1I50J 2F5VA 2UXXA 4XRSG 5LHIA 3M8JA 1SFEA 2MLKA 3JSOA 2L7ZA 4ESJA 4BBRJ 2AHQA 5J47A 4UB6C 3DQVC 5IYBJ 1O3TA 2ELKA 4CYCB 2VBZA 3PUBA 4V2GA 3QYBA 2XAHA 4NB5A 2XB0X 3GF2A 1VQ8I 2VOOA 4CUGA 2D1HA 5E1XA 5HLTA 1OCPA 1YI2I 1ZR2A 4UUTA 1A36A 2KJCA 3E6MA 1BR4A 3L2WA 5B3SH 4IRGA 4YIIA 1MKMA 4IJAA 3GTJJ 3I58A 5IOZA 4S05A 2P7CB 1W5SA 3U9GA 2HPIA 5ILVA 5KAFC 2GXGA 2QKLB 4AVZA 3P5JA 4PZJA 3MEXA 3VYUB 1IV8A 3V7RA 2HU9A 1KU9A 3I5UA 3WTTC 1SFOJ 3LFKA 2B9SA 2DO7A 1Z9CA 3CCMI 4ETSA 4GYIA 5FROA 2LBFA 4DOZA 1MBFA 4PJNA 1LEBA 5GP9A 3GW2A 3BG5A 4UUSA 2WY7Q 1RC9A 1Y0UA 2IS2A 1X1PA 4ZYDA 3JRBA 4OIRF 4AC0A 4AVPA 4U7BA 3SZTA 1LVAA 1SMYF 2AO9A 5DDGA 2DMNA 2BY1A 2LMDA 1QU3A 4HYEA 5JLWA 3WGIA 1J75A 3DLAA 2R92J 3ZR8X 4B4CA 3J81K 3B02A 3E5QA 2JMWA 4M73A 2RQQA 2NVXJ 4RA2A 3K4MA 4CO8A 3QYFA 4BJTA 3FX3A 2OJED 4LOCA 2IA1A 4YFKF 3M07A 1TWFJ 3OOPA 3CF2A 1CF7B 4Y7NJ 3PL8A 1BJZA 1UHWA 3BTIA 4IRHA 4O3MA 2MC3A 1USSA 3HSEA 2FOWA 4IHVA 3HRUA 1QGPA 5DYMA 4P9UA 3WU1B 4E7HA 2VBWA 3TDZC 4AIKA 4IF4A 4I0BA 2HFHA 2YU3A 2J5OA 2FRHA 4HF0A 4HEA2 4EEFG 2XGXA 4UV9A 4CA0A 4E70A 4MO7A 1I39A 2TRTA 3M8EA 1S7OA 4GO1A 2M87A 4HRIA 2VKHA 5HDNA 1U0JA 3OYDA 3QU6A 2EA2A 1D0XA 1Y8RB 2P81A 2QCOA 3S1NJ 2L4MA 1LE8A 1WQ2A 2EPFA 3QODA 1YIJI 1S72I 2KIQA 4J01A 1X3UA 4QPQA 3K1PA 1B9NA 2Z16A 3HM5A 3ZQLA 3J7ZI 1SD6A 1O3RA 2QUFA 1ZRCA 5IT9K 1HBXG 5FLXK 1POGA 3E1SA 1IZ1A 4KUMA 4C2TA 1U8BA 4IO9F 2KFDA 3EUHA 2HYGD 4PSWA 3A4CA 2LP0A 1A5JA 1Q1VA 2DA5A 2LOOA 3HOWJ 1BA5A 3EPZA 1W7PA 4IQ4A 5IP9J 1ZREA 1JE8A 1ZK8A 2L4AA 4A3KJ 3GZNB 2DA3A 3TOAA 3KPHA 3KLOA 3SDGA 4RDUA 4EJWA 5BNGA 4IX7A 1USTA 3PO2J 3IH3A 4ZTJA 3S93A 3J81Z 3MKLA 1YE9A 1YW9A 2R7WA 3CMYA 1F9NA 1W1WE 2K7LA 2PJPA 1X19A 4F52A 3Q0VA 2CJJA 1T33A 4O5VA 4C30A 3BCAA 1MMNA 2XRLA 2DA4A 2FQ3A 2FU4A 2FE3A 2FUG2 4NC6A 5AIQA 4XICA 1XPXA 3R61A 4HOBA 4CCMA 3GTOJ 3CJRB 1BI0A 4BE2A 1NK3P 3ZGKA 3TQNA 5JFRA 4DGWB 3HGYA 3HRTA 2QQ8A 3OL4A 2FXAA 5M5YJ 4HX7A 1GV5A 1XN7A 2NS0A 3K4KA 4UXNA 1ETXA 2O8XA 5CVUA 3OR2C 2LY1A 1W0UA 3TP0A 3WU0A 4DNCA 4HLYA 1OYYA 2KLOA 1R4NB 4EJUA 5KNLA 1UFMA 5BPIA 1BI2A 5CYVA 2VXDA 2EIKH 2V7FA 3ZN0A 4Y15A 1RUNA 1EA3A 2EIJH 4KITB 1R1TA 2MA3A 2YU9J 2X6XA 2ZSIB 3BOQA 4RB3C 4AD9A 2BXYA 2KQRA 1XX5A 2V4JC 4W97A 3LSTA 4LJZF 2MD0A 3FXKA 3GTGJ 4IL6C 3DCFA 2G7HA 3FMQA 3V8JA 2E2JJ 3C3WA 5IT9Z 2OCCH 3GZ5A 2BV6A 5FLXZ 3PFIA 2RC4A 1XGMA 3WTYC 1X1BA 5J1UA 1O4XA 3I3LA 1ETOA 4JX4A 3CZ6A 3M3YJ 3OY9A 5IPAA 1MSEC 3DKWA 2VC0A 3AAFA 5JLXA 1HW2A 5FO5A 3KEQA 2CUFA 2ZJQF 3E6DA 2STWA 5FFZA 1DU0A 3ABTA 3VPRA 3X2QH 4KN7X 5D8LB 2GWRA 3IV5A 4U0WA 3AG3H 4C3JJ 4Y3OA 2R5YB 2MC4A 2R7ZJ 3H9QA 2R7RA 1B8IB 4XLNF 6PAXA 2HOTA 2B7EA 4JOMA 4NQWB 2DFFA 4HQEA 2J5PA 2KISA 1SVOA 2QEXI 1BR1A 5LD2C 3OR1C 1LJ9A 1MGTA 4U88A 4DW6A 1G4DA 2DYRH 2CO5A 3I56I 2KJBA 2R7FA 4JX6A 1K7AA 3WHBA 2EINH 1HW1A 2IJLA 2LSOA 3IC7A 4BJ6C 5TRDA 1K78B 5F1RA 3A03A 3U1DA 1MJBA 2OPTA 1D5YA 3K2AA 2YX7A 2ZC2A 3MD2A 3HKZN 4HV5A 2L3DA 2CFXA 2IGMA 1HW5A 5F64A 5EYRA 4TV7A 4HSTA 2KRFA 4JK1X 1I6HJ 3GFMA 2F4IA 4QTRA 2ZO4A 4AUXA 1OR7C 1FSEA 2EFWA 1HXDA 4OAZA 1FOKA 4LG0A 4EMSA 1HDPA 2XROA 4Z6YA 4KFCA 1PP8F 3ZQQA 2BW3B 2LF8A 3VWBA 3E6BA 2K02A 4IOCF 1K6OA 4A6DA 3DV8A 2ESNA 3ZRGA 1RESA 2ZMEC 1WJCA 3MN2A 3RPUD 3WTXC 2O8KA 1FOXA 2L7MP 4CYDA 4M6VA 2HKXA 1TWHJ 1TQIA 2M7AA 3DEUA 2MSYA 3KP5A 2PN6A 3OMYA 5D5XB 1EF4A 3RCOA 3FK6A 1QPIA 2DYSH 2NS8A 3TKYA 5C44J 3S3OA 1B72A 3P9CA 3H3ZA 2F5EA 3CCQI 1FTTA 2QLZA 2ZXWH 5LGUA 2W57A 4RB2C 2STTA 3I9V2 1JKRC 1R1VA 2E7WA 3SEQA 3ZQGA 3GYHX 2OAZA 4A0ZA 2QQ9A 3OS0A 2E2HJ 3VSKA 4G7ZF 4EGZA 4ZH4F 2BHYA 5D6EA 2IRFG 5IOYA 2DA1A 3F8NA 1LDDA 3N97A 3M7GA 4M6YA 4ASNA 3BLYA 2M5WA 2W24A 5FRMA 4RB0A 1E0EA 4HZFA 4ABZA 4P96A 2KPMA 2BYVE 2DJNA 1BN5A 5J4VA 2EFNA 3GFJA 3NWTA 4AIHA 1FC3A 2F5CA 4OOIA 2FEZA 2VI6A 4BY7J 4DYQA 3L9FA 4YFXF 2WWYA 5CPRB 2IA2A 3H0GJ 2PX9A 1NTCA 2CQQA 4CZCA 2XHKA 1B9MA 2GOMA 2Y0MA 3OYHA 5D4SA 1U9NA 3PO3J 4HQMA 4A0XA 2CV1A 3KETA 2XIGA 1RKWA 3L7WA 3OYAA 1REPC 3CUQC 1U5TC 3M1EA 2CH0A 2UXNA 5EEHA 3ZOBA 4UNOA 1X3ZB 2IP2A 1HLVA 2PJRB 4G94A 3BC8A 5ED4A 1KU2A 1EJ9A 1R5HA 2WAEA 4DZJA 4X0GA 3J80K 1I1SA 2E7XA 2Y31A 3O6BB 2QBYA 2XGCA 1KGSA 2L9VA 5LLQA 3JRHA 1R6RA 1Z77A 4MHGA 3VYSB 1IV6A 2ZJRF 5ICCA 5H6RA 1BW5A 2VONA 3CF5F 2HYJA 4I2OA 2JSCA 1IN6A 4CHUA 3L2RA 2F5DA 3JW4A 2R5ZA 1FWZA 3J7AO 2WAQA 3HHGA 1K83J 5EEAA 4BGDA 4JP0A 4Q48A 4B43A 2GM4A 1X1AA 2EB7A 5D6FA 3K6GA 1TTYA 1UMQA 3T0YA 3OYFA 4RAFA 3ZMVA 3JRAA 4C2UA 4F91B 2WAQN 2AQEA 1G8XA 3H3UA 1BBYA 4I02A 4EJTA 3AFHA 1J7KA 2L9NA 2X6YA 3D5LA 3PNVA 3QAHA 3D5RC 2DODA 1YG2A 2DN0A 2Y9YA 2Y0SA 3DKYA 2KIFA 3AG2H 4ENJA 1VQ4I 3DBLB 1B6AA 3R0AA 1BIBA 3WTZA 4D7NA 3OYEA 3IRRA 5E17F 2DDAA 4UUVA 2F4OB 1FT9A 4F3QA 3JRDA 2HDDA 4FX0A 2DBBA 3RKXA 1W0TA 2Y0SN 4ON0A 1V5GA 1ZTRA 2M3AA 3JR9A 1J9IA 1RR7A 1K79A 3A1YA 3GTPJ 4RGRA 2HQ5A 3DU5A 4AIJA 2QSHX 1ENHA 1XDUA 1OYIA 2ACJA 2R4GA 2F5FA 2EK5A 1WFXA 2BBYA 3GUDA 2RV8A 3GFIA 2JJ7A 5HDGA 1FX7A 1UCRA 4CCLA 1NG6A 4U0YA 3BR6A 3HC7A 1KA8A 4KICA 1LFBA 3J80Z 3K9TA 3RQIA 3RKYA 2NYXA 3FXMA 2ESHA 2KHMA 1VTNC 3JRCA 1FP2A 1ON2A 3C2BA 1SFUA 1BC7C 3TP3A 3C18A 4U0VA 1GXQA 1GUUA 2EWNA 1YS6A 2L5QA 1IG7A 3G1MA 2LRDA 4M3DA 2XF6A 1YITI 4L9NA 1G3YA 4BQNA 3ML6A 4II2A 1QVTA 2I8DA 5LGTA 3KX2A 2EZKA 1WRJA 1Z0XA 4JQFA 2JVHA 5FD5A 1J2XA 1JUPA 3MFKA 1FY7A 1RI7A 4IOAF 4OU0A 4XNFA 3ABUA 3BR1A 2HXOA 5J8CA 5FGMA 3PQKA 4M3GA 1FYLA 4CCJA 2Q2EB 5HLGA 1DDNA 2ISZA 3TEDA 3KIOA 1VQ6I 1SVMA 2TDXA 2HDCA 1DPRA 2HOEA 1F1ZA 2ZJPF 3CC2I 5DTDA 5KHDA 1HQCA 2ZKZA 3LSHA 2PLYA 2LC2A 4LK1F 4KN4X 3A01A 1VQLI 3CCUI 2EFQA 3BPVA 1MDMA 5DUKA 4RBOA 2G9WA 2OQGA 4RGUA 2PG4A 4P1WA 1QNTA 1KU7A 1B4AA 2A69F 3L00A 1UZCA 3MKYB 4P9FA 3IL2A 4A3FJ 1T8IA 2DPDA 4PCQA 3A0BC 4R8HA 1VFCA 1CQTA 5F1JA 2QA4I 4U87A 4NDLA 5TJJA 1RNLA 4MFDA 2OZ6A 5J6XA 4IHYA 2H27A 1YX3A 1YX5A 5JVTA 1H88C 1IXRC 2X4HA 2H94A 1JKQC 3BG9A 2A6EF 1HF0A 2COBA 3OV8A 3CMMA 2LH9A 1XDSA 2CV2A 3SHFA 1VNDA 1K6YA 5BPDA 1X2NA 1Y6IA 1T56A 4G7HF 2Y2ZA 3I4NJ 4YFNF 2M4KA 3H36A 4HDUA 1Z67A 2UZKA 1AOYA 1OQYA 3O8GA 3JAMZ 3EUHC 3ASOH 3H35A 2CMPA 1J59A 2A5WA 2DFHA 4XK4A 4WXDA 2ELHA 2FJ1A 3DPLC 2RDPA 2LVSA 1T95A 4E7LA 1NK2P 1VQ7I 3QPTA 5ICFA 1N25A 5TGTA 3CUQB 4DBRA 4KIGA 3KP2A 4XLFA 2FBIA 2XGDA 3M8FA 1XGNA 1KQ8A 2JRMA 5M5XJ 3K70C 3RI4A 4K2EA 3WHCA 4BY1J 4I01A 4UB8C 3BR0A 2HDWA 1TWCJ 1F36A 2RQPA 3RJPA 1YJNI 2VBXA 4AIDA 5J40A 4BKXA 3BTJA 2W48A 4ZJZA 1OFCX 1GT0C 1WJ5A 1S9HA 1MBKA 2VB6A 3HOVJ 2XV4S 1MZBA 4BAYA 3FMSA 3VDXA 4BQAA 1OISA 3SFZA 1LFPA 2RKHA 3WU2C 4LMYA 4XN3A 5DEQA 2P8TA 1D1CA 3BCBA 2VOPA 5FFXA 4A3CJ 1TP4A 2IGNA 4PGGA 1ZR4A 3F0CA 4G6DA 3GFLA 1KYZA 2EBIA 3F9KA 3E97A 4KMFA 3ZMZA 2DMPA 2DQLA 1AKHB 3QWLA 1SVLA 3GMEA 2K86A 5GAGJ 4EM1A 1K4SA 2R7OA 3H5NA 3IP4B 4QSHA 1JXSA 2VQGA 3DWLE 3E7LA 5D4RA 3CCLI 2CGPA 2DLLA 4XLEA 2DPUA 2O61A 4CCKA 3CCVI 4DBQA 3IUOA 5F0HA 1U78A 4HPQA 2MH9A 2QKMB 1IC8A 2K5CA
chains in the Genus database with same CATH topology
2JT1A 2P5KA 5L3GA 1D3YA 2COMA 1FBQA 4PDKA 2OQRA 4KA4A 4ZZDA 1C0WA 3ZPLA 4R1HA 4KIBA 3G3ZA 3ELKA 1KQ0A 1Z7UA 2KIMA 3CJNA 5LHHA 3E3VA 2IVMA 2V79A 3K69A 3R4KA 3R0JA 1BM9A 2XKPA 1U2WA 4LLLA 1EH8A 2GA1A 3LQQA 3ZN1A 1KYWA 2GZWA 4G7OF 2HKOA 2WC2A 1UB9A 1P4WA 3DF8A 1TNTA 1CF7A 4WCGA 4UHTA 3Q9VA 2XRNA 3HIFA 1H9TA 3RPQA 3GO5A 1R00A 4RGSA 3RKWA 3EQLF 2QYOA 3TO7A 4Y13A 5DCMB 5BMZA 2PFBA 3CUOA 3HTUA 2LF7A 1QBJA 3LWFA 1SD4A 2FMLA 2DK8A 3K1MA 3C7JA 4HAMA 3I4PA 2O0YA 2E1NA 5HS9A 1G3SA 2VN2A 5L3BA 2ETHA 3WG9A 2DW4A 4ZYGA 3MQ0A 2YX4A 1TLHB 4A2UA 1CGPA 2HR3A 2H6CA 1A04A 4XRFA 2ZXJA 2L02A 2JTVA 3R6SA 1RZ4A 3L09A 3F8BA 4OMZA 3KZYA 3QOPA 1DUXC 1YIOA 3KFWX 3WODF 3F72A 3LA3A 2V1XA 4HBLA 3FXQA 1YTYA 1D8KA 4UV8A 2QWWA 3T1BA 1Z91A 4GYGA 5LBQA 5HLHA 3IKVA 1JGSA 2E1CA 4L0ZB 1W7PB 1FSHA 3WTVC 2H09A 2GQQA 3VFZA 4HLXA 1XSDA 2Q8KA 3KP3A 1WKMA 3MCZA 1YLFA 1LDKB 5DD4A 2DAOA 4KT5C 5E8GA 3KP7A 1ZN2A 2DU9A 2HYFA 2Z5UA 2FA5A 4WX9A 4CZZA 3RTRA 1IAWA 4O6JA 1H0MA 4N0BA 3ZMDA 1S29A 2RN7A 4LFUA 2A6HF 3DFGA 1Z6RA 2HZTA 4BH9A 5LHGA 1HSJA 1R58A 3ISPA 3WGHA 4M6XA 1QZYA 4NQWA 5LEJA 5HS7A 2FOKA 2M8EA 3KZZA 2CW0F 4DQ2A 1OKRA 2BEOA 2CQKA 1YQAA 4LGWA 3ECHA 2VXZA 4LB6B 1DPUA 3I53A 3C1DA 2OBPA 3BY6A 4ENNA 1LEAA 5ICEA 3KP4A 2B0LA 4N9IA 2MH2A 4WF2A 4A12A 1ZLJA 1TBXA 3FM5A 2FNAA 3BP8A 1O57A 1S7AA 1P4AA 4PGHA 4M9XA 4H0EA 3L2CA 2V1DA 5JR3A 4Q47A 5L3EA 4MTDA 1H9GA 4LD5A 1ZRFA 1TQPA 3TO6A 4LG0B 1XMAA 4HX8A 5HDKA 3COAC 1T38A 1QZZA 4EVIA 2NAZA 4EM0B 2OZUA 4LB5A 4I0AA 1XGSA 2A61A 4ENMA 3RDIA 3O2PE 2R7DA 1ODDA 3WGGA 3ROUA 2ISYA 2CSOA 3PQJA 3RYPA 3GVAA 3JTHA 3O3KA 2D1VA 1J5YA 1OMIA 1R7JA 5DCFA 4A6EA 1FYKA 1SD5A 2WV0A 2ZCWA 3I54A 1R1UA 1D5VA 2DI3A 1FZPB 2UWMA 2HS5A 3Q5FA 4ZZLA 1ZYRF 1UHMA 5D5UB 3LAPA 4HF2A 3V4GA 4FHTA 5BS6A 4GGGA 4EGYA 3HRSA 3U2RA 4CICA 1QQIA 3TOBA 5CVIA 4RGXA 1FPQA 3MZYA 5E18F 5ERIA 4LK0F 1RIOH 1BI3A 5HS8A 3V7SA 2HEOA 2X0LA 2Z99A 3T8TA 4BXUA 4M72A 3FHZA 3W6JB 3LAJA 4OINF 3K2ZA 2QBYB 3DPTA 4OIPF 5LGNA 5E1ZB 1GVJA 3F22A 4MEXF 3QP5A 4M9ZA 1F4KA 2PMUA 1O7FA 3BROA 4LLNA 1GXPA 3F8FA 1LB2A 3I59A 2NRAC 1R22A 1EH7A 4MEYF 3EETA 2G7UA 2XASA 1FBSA 2RVCA 5CLSA 4RAZA 2ZNZA 1ZAOA 1TW2A 5HVQC 4ESBA 2MBFA 2ZFWA 1OYWA 2Y75A 2MD5A 1T0FA 1Z1DA 1ZARA 1IN7A 2JPBA 3HOTA 3VB2A 1KQ9A 3JAMK 5K5RA 3BWGA 4HV6A 4EQQA 3LA2A 4IHSA 5J8FA 3P9IA 2ZMEB 3SQNA 5IT3A 1E2XA 1XSXA 2O6GE 5AONA 4CXFA 2IA0A 2EA4A 3ZMUA 3SZPA 1W7PD 1XD7A 4FX4A 2AXLA 3KLNA 3RYRA 4IRIA 1XGOA 5LEKA 3EYIA 1G6NA 2P4WA 3IWFA 4G8XA 4G9YA 2CWEA 3GX4X 2FBKA 1I1GA 1BIAA 1YS7A 4YG2F 1U6GA 3REOA 3IRQA 5AIPA 2V1UA 2IT0A 3RPUA 5E20A 2C6YA 2GIVA 1HKQA 2DK5A 2W84A 4M74A 4P5OA 2KKOA 3E5UA 3V8KA 3MAJA 3F23A 4UVAA 1U5TB 4B09A 4BHBA 4OIQF 2L54A 3H92A 5L3CA 5LRSA 3BJ6A 5KVRA 2XAGA 3KEOA 3VEPA 3N4MA 2FF4A 2PQ8A 3HOSA 4ENKA 4L9JA 2PI0A 2A5YB 4XBFA 3HSRA 4R79A 4U7DA 3G73A 2W25A 3F8CA 2DTRA 1P4XA 3DP7A 3FWEA 4YIFA 3WE3A 5KK1A 3P7NA 5JHUA 5D5VB 1TW3A 2XKOA 3D0SA 2PEXA 1QPMA 4GCVA 3ULQB 5D5WB 2BE5F 3NRVA 4WXCA 4MTEA 3TDUC 2GAUA 2M45A 5K5OA 2WTEA 1IXCA 2XVCA 5K1YA 4CGZA 3RIRA 1TQMA 5K5QA 1O3SA 3FZVA 2VT3A 4XSXF 4RS8A 1HKTA 3E5XA 5FB2A 4HDVA 1T98A 4M9SA 4EJOA 3KE2A 1ZGJA 1YW8A 2O3FA 1EH6A 2OD5A 4Y17A 1ZH5A 4EJVA 1YW7A 3I71A 1HKSA 1Z05A 5DCMA 4BHPA 1IW7F 5EEGA 1F5TA 4BYYA 4XLPF 3GXOA 4N9HA 1SFXA 4UVCA 1G3TA 4M71A 1ZG3A 1IN4A 3M9AA 1PDNC 2FNPA 5DV5A 4B8XA 3F6VA 3K0LA 5CJ9A 2Z3YA 3V8LA 1Q1HA 3WTUC 1O3QA 2PMHA 3ZMTA 4WWCA 1WSUA 3FXRA 1G3WA 2P6TA 1TNSA 3B73A 1HSTA 4A5MA 2IW5A 1P2FA 2HQRA 4MQVA 2YR2A 5JI6A 2D2WA 4AWXB 2LNBA 5CVRA 4KNYA 3MWMA 2JRTA 3TO9A 2VT2A 4OMYA 3HHHA 4QLCU 3BDDA 1YO5C 4L0YB 1I27A 2EV0A 1LDJA 2QENA 4L5JA 3E6CC 2IPQX 1EV7A 2PBIA 2K4JA 1ZRDA 2A3SA 3SXYA 4IHTA 2OU2A 5D8KB 1L0OC 2L01A 3NQOA 2GXBA 1KU3A 1JHFA 2V9VA 3LA7A 1XMKA 4WXHA 1FP1D 1S6LA 3BJAA 5CVVA 4MNUA 1AWCA 3IKTA 4ESFA 4MQ9F 1GHCA 1O7LA 4UVBA 1Z6TA 4RAYA 4JBAA 2V6CA 1B1BA 2QZ8A 2ZNYA 2EFPA 1T2KA 1XB4A 4EM2A 2W85A 3GZ6A 3CO7C 2VE8A 4G6QA 4L9VA 2P6SA 1K78A 1OPCA 3S2WA 1I6XA 5LRRA 2NNYA 4F7ZA 1MJ9A 3ZP5A 2EV5A 1FBUA 2FSWA 1BC8C 1ONVA 2XUBA 5HOOA 1ZGAA 4Z2YA 3WE2A 5BQTA 5A2QK 1DP7P 3T8RA 1IRFA 2LKPA 2JZYA 2XAQA 2EV6A 3QU3A 3GWZA 2EJRA 1LNWA 3EDPA 3V7CA 3VOEA 4MGRA 1T39A 1PP7U 2QVOA 1SD7A 1U3EM 1WI9A 4L18B 2AS5F 1R36A 1WWXA 4BHCA 5E1WA 4KYWA 4CDGA 2VC1A 3W6KB 4KIFA 1YFHA 4I98B 3HTSB 3BJOA 4IXAA 1BJAA 2P5VA 4HW0A 2Z33A 1V4RA 1BOAA 5E8IA 4I7HA 3ECOA 2FBHA 5ICGA 4LLGF 1R23A 2K4BA 3KCCA 5A2QZ 2HGCA 1XSVA 3F6OA 2RNJA 1XCVA 2QM3A 4OIOF 4ZYEA 3FF5A 1U8RA 1XCBA 2QQAA 1LQ1A 1W4MA 1PUEE 4ZYHA 2Z9OA 4BNCA 2M30A 1JHHA 2OA4A 2HTJA 4D0PA 2CG4A 3GLXA 2RGVA 1FYMA 3F21A 1SMTA 1NHAA 3Q9SA 4HF1A 1BI1A 2CYYA 3P9KA 2Q0OA 4WK8F 4A5NA 5HLIA 5F6FA 3EYYA 1R5GA 3GEZA 2F2EA 2GA2A 2KIUA 1IN5A 5CVJA 4IPAA 1D8JA 1FLIA 1IXSB 1S8NA 5ILUA 2BGCA 3HYIA 3QP6A 5H6QA 1P92A 1ON1A 4KMUX 1I5ZA 2FMYA 4S04A 3BZ6A 3FM3A 3I59B 3QRFF 2HTSA 2P7VB 2QQBA 3CLOA 4HX4A 4NHJA 2LDUA 2YSRA 2EFOA 1OR7A 3IWZA 1ZHFA 2YPRA 2H6BA 4GXOA 3BPXA 1E17A 1MD0A 3CDHA 1P6RA 3HUGA 3LQRA 4KDPA 3QPHA 2HWVA 3KP6A 3ZQ7A 2DT5A 1S3JA 2Q2EA 2ZMEA 2R3SA 1IRGA 3FMRA 3MZHA 1B59A 3K1NA 5H20A 2K27A 3I0TA 4HA8A 5L3DA 5DUIA 4I09A 3CO6C 1L3LA 3R60A 2JPCA 1W5TA 2D45A 2ADUA 2M1BA 2ZJ2A 4A0YA 2DFIA 3HSFA 2O03A 1J0RA 1V3FA 1MJAA 1ULYA 2A68F 3TGNA 3ZMSA 3DXJF 1MDMB 4RB1A 1STZA 4Q5SF 4EV0A 3WTWC 2P5LC 1YYVA 2ZBKA 1T6SA 4Q4ZF 5L3FA 5DD8A 3CUQA 3FXUA 1U5TA 4FT8A 4IVNA 2MLGA 5FD6A 4L5IA 3I64A 3VODA 4XSZF 1IUYA 1FNNA 3HRMA 1ZG1A 3F8MA 1SAXA 2XAJA 1ZG5A 1QO0D 3ERED 4P55A 1IN8A 3WTSC 2A07F 3IHUA 1RUOA 3F3XA 3T5XA 2VBYA 2Y48A 3NEUA 2NNNA 2HQNA 4QWQA 2VE9A 2XAFA 4L9TA 3CTAA 5ILSA 3JSPA 1IF1A 5BOXA 2VODA 1ZLKA 2DQRA 2UXXA 5LHIA 1SFEA 2MLKA 3JSOA 4ESJA 3DQVC 1O3TA 2VBZA 2XAHA 4NB5A 3GF2A 2VOOA 2D1HA 5E1XA 2KJCA 3E6MA 4IRGA 4YIIA 1MKMA 4IJAA 3I58A 4S05A 2P7CB 1W5SA 3U9GA 5ILVA 2GXGA 4PZJA 3MEXA 3V7RA 1KU9A 3I5UA 3WTTC 3LFKA 2DO7A 1Z9CA 4ETSA 4GYIA 1LEBA 3GW2A 1Y0UA 4ZYDA 4OIRF 4AVPA 4U7BA 3SZTA 1LVAA 1SMYF 5DDGA 4HYEA 3WGIA 1J75A 3J81K 3B02A 3E5QA 4M73A 4CO8A 3FX3A 2IA1A 4YFKF 3OOPA 1CF7B 1UHWA 4O3MA 4IRHA 2MC3A 1USSA 3HSEA 3HRUA 1QGPA 5DYMA 4P9UA 3WU1B 2VBWA 3TDZC 4AIKA 4IF4A 4I0BA 2HFHA 2YU3A 2J5OA 2FRHA 4HF0A 2XGXA 4UV9A 4E70A 4GO1A 3M8EA 1S7OA 2M87A 5HDNA 3QU6A 2EA2A 2L4MA 1WQ2A 1X3UA 3K1PA 1B9NA 1SD6A 1O3RA 2QUFA 1ZRCA 5IT9K 1HBXG 5FLXK 1IZ1A 4KUMA 3EUHA 2HYGD 1W7PA 1ZREA 1JE8A 2L4AA 3TOAA 3KLOA 4EJWA 1USTA 3J81Z 1YW9A 1F9NA 2K7LA 2PJPA 4O5VA 2FQ3A 5AIQA 2FU4A 2FE3A 3R61A 4HOBA 1BI0A 5JFRA 3TQNA 3HRTA 2FXAA 4HX7A 1XN7A 2NS0A 4UXNA 2O8XA 5CVUA 3WU0A 4DNCA 4HLYA 1OYYA 4EJUA 1UFMA 5BPIA 1BI2A 5CYVA 3ZN0A 4Y15A 1RUNA 1R1TA 2MA3A 3BOQA 4RB3C 4AD9A 3LSTA 4LJZF 2G7HA 3FMQA 3V8JA 3C3WA 5IT9Z 3GZ5A 2BV6A 5FLXZ 3PFIA 2RC4A 1XGMA 3WTYC 3DKWA 2VC0A 3AAFA 1HW2A 5FO5A 3KEQA 2STWA 3E6DA 5FFZA 3ABTA 4KN7X 5D8LB 2GWRA 4U0WA 4XLNF 6PAXA 4HQEA 2J5PA 1LJ9A 1MGTA 4U88A 1G4DA 2CO5A 2KJBA 2R7FA 1K7AA 1HW1A 2IJLA 2LSOA 3IC7A 5TRDA 1K78B 5F1RA 3U1DA 1MJBA 2YX7A 4HV5A 2L3DA 2CFXA 1HW5A 5F64A 4TV7A 2KRFA 4JK1X 3GFMA 2ZO4A 1FSEA 2EFWA 1HXDA 1FOKA 4LG0A 4EMSA 2XROA 4KFCA 1PP8F 2LF8A 3E6BA 2K02A 1K6OA 4A6DA 3DV8A 2ESNA 3WTXC 4CYDA 2HKXA 1TQIA 3DEUA 3KP5A 2PN6A 5D5XB 3TKYA 3P9CA 3H3ZA 2F5EA 2QLZA 5LGUA 2W57A 4RB2C 2STTA 1R1VA 2E7WA 3GYHX 2OAZA 4A0ZA 2QQ9A 4G7ZF 4EGZA 4ZH4F 5D6EA 2IRFG 3N97A 3F8NA 1LDDA 3M7GA 4M6YA 4ASNA 2M5WA 2W24A 4RB0A 4HZFA 4P96A 2BYVE 1BN5A 2EFNA 3GFJA 4AIHA 1FC3A 2F5CA 4OOIA 2FEZA 3L9FA 4YFXF 2WWYA 2IA2A 2XHKA 1B9MA 2Y0MA 5D4SA 4HQMA 4A0XA 3KETA 2XIGA 3L7WA 1REPC 3CUQC 1U5TC 3M1EA 2UXNA 5EEHA 4UNOA 2IP2A 4G94A 5ED4A 1KU2A 1R5HA 3J80K 1I1SA 2E7XA 3O6BB 2QBYA 1KGSA 5LLQA 4MHGA 5ICCA 5H6RA 2VONA 4I2OA 2JSCA 1IN6A 4CHUA 2F5DA 3JW4A 1FWZA 3J7AO 3HHGA 4Q48A 2EB7A 5D6FA 1TTYA 3T0YA 3ZMVA 3H3UA 1BBYA 4I02A 4EJTA 1J7KA 3D5LA 3QAHA 1YG2A 2KIFA 4ENJA 1B6AA 3R0AA 1BIBA 3WTZA 3IRRA 5E17F 4UUVA 1FT9A 4FX0A 2DBBA 3RKXA 4ON0A 1J9IA 1K79A 4RGRA 4AIJA 1XDUA 1OYIA 2ACJA 2F5FA 2EK5A 2BBYA 3GUDA 2RV8A 3GFIA 5HDGA 1FX7A 1UCRA 4U0YA 1KA8A 4KICA 3J80Z 3K9TA 3RKYA 2NYXA 2ESHA 1VTNC 1FP2A 1ON2A 1SFUA 1BC7C 3C18A 4U0VA 1GXQA 2EWNA 1YS6A 4L9NA 1G3YA 3ML6A 5LGTA 1WRJA 4JQFA 5FD5A 1J2XA 3MFKA 1FY7A 1RI7A 4OU0A 3ABUA 5J8CA 5FGMA 3PQKA 1FYLA 5HLGA 1DDNA 2ISZA 2TDXA 2HDCA 1DPRA 2HOEA 1F1ZA 1HQCA 2ZKZA 2PLYA 4LK1F 4KN4X 2EFQA 3BPVA 1MDMA 5DUKA 2G9WA 2OQGA 4RGUA 2PG4A 1QNTA 1KU7A 1B4AA 2A69F 3L00A 4P9FA 3IL2A 2DPDA 4PCQA 4R8HA 5TJJA 1RNLA 2OZ6A 5J6XA 2H27A 5JVTA 1IXRC 2X4HA 2H94A 2A6EF 3OV8A 1XDSA 3SHFA 5BPDA 4G7HF 4YFNF 4HDUA 2UZKA 1AOYA 3JAMZ 1J59A 4WXDA 2ELHA 3DPLC 2RDPA 3QPTA 5ICFA 3CUQB 4KIGA 3KP2A 2FBIA 3M8FA 1XGNA 3RI4A 4K2EA 4I01A 3RJPA 2RQPA 2VBXA 2XV4S 1MZBA 4BAYA 3FMSA 4BQAA 3SFZA 2RKHA 4LMYA 5DEQA 2P8TA 2VOPA 5FFXA 4PGGA 4G6DA 3GFLA 1KYZA 3E97A 4KMFA 3ZMZA 2DQLA 2K86A 4EM1A 1JXSA 5D4RA 2CGPA 2DLLA 2DPUA 2O61A 1U78A 2MH9A 3JTGA 1KQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JT1 A;  2P5K A;  5L3G A;  1D3Y A;  2COM A;  1FBQ A;  4PDK A;  2OQR A;  4KA4 A;  4ZZD A;  1C0W A;  3ZPL A;  4R1H A;  4KIB A;  3G3Z A;  3ELK A;  1KQ0 A;  1Z7U A;  2KIM A;  3CJN A;  5LHH A;  3E3V A;  2IVM A;  2V79 A;  3K69 A;  3R4K A;  3R0J A;  1BM9 A;  2XKP A;  1U2W A;  4LLL A;  1EH8 A;  2GA1 A;  3LQQ A;  3ZN1 A;  1KYW A;  2GZW A;  4G7O F;  2HKO A;  2WC2 A;  1UB9 A;  1P4W A;  3DF8 A;  1TNT A;  1CF7 A;  4WCG A;  4UHT A;  3Q9V A;  2XRN A;  3HIF A;  1H9T A;  3RPQ A;  3GO5 A;  1R00 A;  4RGS A;  3RKW A;  3EQL F;  2QYO A;  3TO7 A;  4Y13 A;  5DCM B;  5BMZ A;  2PFB A;  3CUO A;  3HTU A;  2LF7 A;  1QBJ A;  3LWF A;  1SD4 A;  2FML A;  2DK8 A;  3K1M A;  3C7J A;  4HAM A;  3I4P A;  2O0Y A;  2E1N A;  5HS9 A;  1G3S A;  2VN2 A;  5L3B A;  2ETH A;  3WG9 A;  2DW4 A;  4ZYG A;  3MQ0 A;  2YX4 A;  1TLH B;  4A2U A;  1CGP A;  2HR3 A;  2H6C A;  1A04 A;  4XRF A;  2ZXJ A;  2L02 A;  2JTV A;  3R6S A;  1RZ4 A;  3L09 A;  3F8B A;  4OMZ A;  3KZY A;  3QOP A;  1DUX C;  1YIO A;  3KFW X;  3WOD F;  3F72 A;  3LA3 A;  2V1X A;  4HBL A;  3FXQ A;  1YTY A;  1D8K A;  4UV8 A;  2QWW A;  3T1B A;  1Z91 A;  4GYG A;  5LBQ A;  5HLH A;  3IKV A;  1JGS A;  2E1C A;  4L0Z B;  1W7P B;  1FSH A;  3WTV C;  2H09 A;  2GQQ A;  3VFZ A;  4HLX A;  1XSD A;  2Q8K A;  3KP3 A;  1WKM A;  3MCZ A;  1YLF A;  1LDK B;  5DD4 A;  2DAO A;  4KT5 C;  5E8G A;  3KP7 A;  1ZN2 A;  2DU9 A;  2HYF A;  2Z5U A;  2FA5 A;  4WX9 A;  4CZZ A;  3RTR A;  1IAW A;  4O6J A;  1H0M A;  4N0B A;  3ZMD A;  1S29 A;  2RN7 A;  4LFU A;  2A6H F;  3DFG A;  1Z6R A;  2HZT A;  4BH9 A;  5LHG A;  1HSJ A;  1R58 A;  3ISP A;  3WGH A;  4M6X A;  1QZY A;  4NQW A;  5LEJ A;  5HS7 A;  2FOK A;  2M8E A;  3KZZ A;  2CW0 F;  4DQ2 A;  1OKR A;  2BEO A;  2CQK A;  1YQA A;  4LGW A;  3ECH A;  2VXZ A;  4LB6 B;  1DPU A;  3I53 A;  3C1D A;  2OBP A;  3BY6 A;  4ENN A;  1LEA A;  5ICE A;  3KP4 A;  2B0L A;  4N9I A;  2MH2 A;  4WF2 A;  4A12 A;  1ZLJ A;  1TBX A;  3FM5 A;  2FNA A;  3BP8 A;  1O57 A;  1S7A A;  1P4A A;  4PGH A;  4M9X A;  4H0E A;  3L2C A;  2V1D A;  5JR3 A;  4Q47 A;  5L3E A;  4MTD A;  1H9G A;  4LD5 A;  1ZRF A;  1TQP A;  3TO6 A;  4LG0 B;  1XMA A;  4HX8 A;  5HDK A;  3COA C;  1T38 A;  1QZZ A;  4EVI A;  2NAZ A;  4EM0 B;  2OZU A;  4LB5 A;  4I0A A;  1XGS A;  2A61 A;  4ENM A;  3RDI A;  3O2P E;  2R7D A;  1ODD A;  3WGG A;  3ROU A;  2ISY A;  2CSO A;  3PQJ A;  3RYP A;  3GVA A;  3JTH A;  3O3K A;  2D1V A;  1J5Y A;  1OMI A;  1R7J A;  5DCF A;  4A6E A;  1FYK A;  1SD5 A;  2WV0 A;  2ZCW A;  3I54 A;  1R1U A;  1D5V A;  2DI3 A;  1FZP B;  2UWM A;  2HS5 A;  3Q5F A;  4ZZL A;  1ZYR F;  1UHM A;  5D5U B;  3LAP A;  4HF2 A;  3V4G A;  4FHT A;  5BS6 A;  4GGG A;  4EGY A;  3HRS A;  3U2R A;  4CIC A;  1QQI A;  3TOB A;  5CVI A;  4RGX A;  1FPQ A;  3MZY A;  5E18 F;  5ERI A;  4LK0 F;  1RIO H;  1BI3 A;  5HS8 A;  3V7S A;  2HEO A;  2X0L A;  2Z99 A;  3T8T A;  4BXU A;  4M72 A;  3FHZ A;  3W6J B;  3LAJ A;  4OIN F;  3K2Z A;  2QBY B;  3DPT A;  4OIP F;  5LGN A;  5E1Z B;  1GVJ A;  3F22 A;  4MEX F;  3QP5 A;  4M9Z A;  1F4K A;  2PMU A;  1O7F A;  3BRO A;  4LLN A;  1GXP A;  3F8F A;  1LB2 A;  3I59 A;  2NRA C;  1R22 A;  1EH7 A;  4MEY F;  3EET A;  2G7U A;  2XAS A;  1FBS A;  2RVC A;  5CLS A;  4RAZ A;  2ZNZ A;  1ZAO A;  1TW2 A;  5HVQ C;  4ESB A;  2MBF A;  2ZFW A;  1OYW A;  2Y75 A;  2MD5 A;  1T0F A;  1Z1D A;  1ZAR A;  1IN7 A;  2JPB A;  3HOT A;  3VB2 A;  1KQ9 A;  3JAM K;  5K5R A;  3BWG A;  4HV6 A;  4EQQ A;  3LA2 A;  4IHS A;  5J8F A;  3P9I A;  2ZME B;  3SQN A;  5IT3 A;  1E2X A;  1XSX A;  2O6G E;  5AON A;  4CXF A;  2IA0 A;  2EA4 A;  3ZMU A;  3SZP A;  1W7P D;  1XD7 A;  4FX4 A;  2AXL A;  3KLN A;  3RYR A;  4IRI A;  1XGO A;  5LEK A;  3EYI A;  1G6N A;  2P4W A;  3IWF A;  4G8X A;  4G9Y A;  2CWE A;  3GX4 X;  2FBK A;  1I1G A;  1BIA A;  1YS7 A;  4YG2 F;  1U6G A;  3REO A;  3IRQ A;  5AIP A;  2V1U A;  2IT0 A;  3RPU A;  5E20 A;  2C6Y A;  2GIV A;  1HKQ A;  2DK5 A;  2W84 A;  4M74 A;  4P5O A;  2KKO A;  3E5U A;  3V8K A;  3MAJ A;  3F23 A;  4UVA A;  1U5T B;  4B09 A;  4BHB A;  4OIQ F;  2L54 A;  3H92 A;  5L3C A;  5LRS A;  3BJ6 A;  5KVR A;  2XAG A;  3KEO A;  3VEP A;  3N4M A;  2FF4 A;  2PQ8 A;  3HOS A;  4ENK A;  4L9J A;  2PI0 A;  2A5Y B;  4XBF A;  3HSR A;  4R79 A;  4U7D A;  3G73 A;  2W25 A;  3F8C A;  2DTR A;  1P4X A;  3DP7 A;  3FWE A;  4YIF A;  3WE3 A;  5KK1 A;  3P7N A;  5JHU A;  5D5V B;  1TW3 A;  2XKO A;  3D0S A;  2PEX A;  1QPM A;  4GCV A;  3ULQ B;  5D5W B;  2BE5 F;  3NRV A;  4WXC A;  4MTE A;  3TDU C;  2GAU A;  2M45 A;  5K5O A;  2WTE A;  1IXC A;  2XVC A;  5K1Y A;  4CGZ A;  3RIR A;  1TQM A;  5K5Q A;  1O3S A;  3FZV A;  2VT3 A;  4XSX F;  4RS8 A;  1HKT A;  3E5X A;  5FB2 A;  4HDV A;  1T98 A;  4M9S A;  4EJO A;  3KE2 A;  1ZGJ A;  1YW8 A;  2O3F A;  1EH6 A;  2OD5 A;  4Y17 A;  1ZH5 A;  4EJV A;  1YW7 A;  3I71 A;  1HKS A;  1Z05 A;  5DCM A;  4BHP A;  1IW7 F;  5EEG A;  1F5T A;  4BYY A;  4XLP F;  3GXO A;  4N9H A;  1SFX A;  4UVC A;  1G3T A;  4M71 A;  1ZG3 A;  1IN4 A;  3M9A A;  1PDN C;  2FNP A;  5DV5 A;  4B8X A;  3F6V A;  3K0L A;  5CJ9 A;  2Z3Y A;  3V8L A;  1Q1H A;  3WTU C;  1O3Q A;  2PMH A;  3ZMT A;  4WWC A;  1WSU A;  3FXR A;  1G3W A;  2P6T A;  1TNS A;  3B73 A;  1HST A;  4A5M A;  2IW5 A;  1P2F A;  2HQR A;  4MQV A;  2YR2 A;  5JI6 A;  2D2W A;  4AWX B;  2LNB A;  5CVR A;  4KNY A;  3MWM A;  2JRT A;  3TO9 A;  2VT2 A;  4OMY A;  3HHH A;  4QLC U;  3BDD A;  1YO5 C;  4L0Y B;  1I27 A;  2EV0 A;  1LDJ A;  2QEN A;  4L5J A;  3E6C C;  2IPQ X;  1EV7 A;  2PBI A;  2K4J A;  1ZRD A;  2A3S A;  3SXY A;  4IHT A;  2OU2 A;  5D8K B;  1L0O C;  2L01 A;  3NQO A;  2GXB A;  1KU3 A;  1JHF A;  2V9V A;  3LA7 A;  1XMK A;  4WXH A;  1FP1 D;  1S6L A;  3BJA A;  5CVV A;  4MNU A;  1AWC A;  3IKT A;  4ESF A;  4MQ9 F;  1GHC A;  1O7L A;  4UVB A;  1Z6T A;  4RAY A;  4JBA A;  2V6C A;  1B1B A;  2QZ8 A;  2ZNY A;  2EFP A;  1T2K A;  1XB4 A;  4EM2 A;  2W85 A;  3GZ6 A;  3CO7 C;  2VE8 A;  4G6Q A;  4L9V A;  2P6S A;  1K78 A;  1OPC A;  3S2W A;  1I6X A;  5LRR A;  2NNY A;  4F7Z A;  1MJ9 A;  3ZP5 A;  2EV5 A;  1FBU A;  2FSW A;  1BC8 C;  1ONV A;  2XUB A;  5HOO A;  1ZGA A;  4Z2Y A;  3WE2 A;  5BQT A;  5A2Q K;  1DP7 P;  3T8R A;  1IRF A;  2LKP A;  2JZY A;  2XAQ A;  2EV6 A;  3QU3 A;  3GWZ A;  2EJR A;  1LNW A;  3EDP A;  3V7C A;  3VOE A;  4MGR A;  1T39 A;  1PP7 U;  2QVO A;  1SD7 A;  1U3E M;  1WI9 A;  4L18 B;  2AS5 F;  1R36 A;  1WWX A;  4BHC A;  5E1W A;  4KYW A;  4CDG A;  2VC1 A;  3W6K B;  4KIF A;  1YFH A;  4I98 B;  3HTS B;  3BJO A;  4IXA A;  1BJA A;  2P5V A;  4HW0 A;  2Z33 A;  1V4R A;  1BOA A;  5E8I A;  4I7H A;  3ECO A;  2FBH A;  5ICG A;  4LLG F;  1R23 A;  2K4B A;  3KCC A;  5A2Q Z;  2HGC A;  1XSV A;  3F6O A;  2RNJ A;  1XCV A;  2QM3 A;  4OIO F;  4ZYE A;  3FF5 A;  1U8R A;  1XCB A;  2QQA A;  1LQ1 A;  1W4M A;  1PUE E;  4ZYH A;  2Z9O A;  4BNC A;  2M30 A;  1JHH A;  2OA4 A;  2HTJ A;  4D0P A;  2CG4 A;  3GLX A;  2RGV A;  1FYM A;  3F21 A;  1SMT A;  1NHA A;  3Q9S A;  4HF1 A;  1BI1 A;  2CYY A;  3P9K A;  2Q0O A;  4WK8 F;  4A5N A;  5HLI A;  5F6F A;  3EYY A;  1R5G A;  3GEZ A;  2F2E A;  2GA2 A;  2KIU A;  1IN5 A;  5CVJ A;  4IPA A;  1D8J A;  1FLI A;  1IXS B;  1S8N A;  5ILU A;  2BGC A;  3HYI A;  3QP6 A;  5H6Q A;  1P92 A;  1ON1 A;  4KMU X;  1I5Z A;  2FMY A;  4S04 A;  3BZ6 A;  3FM3 A;  3I59 B;  3QRF F;  2HTS A;  2P7V B;  2QQB A;  3CLO A;  4HX4 A;  4NHJ A;  2LDU A;  2YSR A;  2EFO A;  1OR7 A;  3IWZ A;  1ZHF A;  2YPR A;  2H6B A;  4GXO A;  3BPX A;  1E17 A;  1MD0 A;  3CDH A;  1P6R A;  3HUG A;  3LQR A;  4KDP A;  3QPH A;  2HWV A;  3KP6 A;  3ZQ7 A;  2DT5 A;  1S3J A;  2Q2E A;  2ZME A;  2R3S A;  1IRG A;  3FMR A;  3MZH A;  1B59 A;  3K1N A;  5H20 A;  2K27 A;  3I0T A;  4HA8 A;  5L3D A;  5DUI A;  4I09 A;  3CO6 C;  1L3L A;  3R60 A;  2JPC A;  1W5T A;  2D45 A;  2ADU A;  2M1B A;  2ZJ2 A;  4A0Y A;  2DFI A;  3HSF A;  2O03 A;  1J0R A;  1V3F A;  1MJA A;  1ULY A;  2A68 F;  3TGN A;  3ZMS A;  3DXJ F;  1MDM B;  4RB1 A;  1STZ A;  4Q5S F;  4EV0 A;  3WTW C;  2P5L C;  1YYV A;  2ZBK A;  1T6S A;  4Q4Z F;  5L3F A;  5DD8 A;  3CUQ A;  3FXU A;  1U5T A;  4FT8 A;  4IVN A;  2MLG A;  5FD6 A;  4L5I A;  3I64 A;  3VOD A;  4XSZ F;  1IUY A;  1FNN A;  3HRM A;  1ZG1 A;  3F8M A;  1SAX A;  2XAJ A;  1ZG5 A;  1QO0 D;  3ERE D;  4P55 A;  1IN8 A;  3WTS C;  2A07 F;  3IHU A;  1RUO A;  3F3X A;  3T5X A;  2VBY A;  2Y48 A;  3NEU A;  2NNN A;  2HQN A;  4QWQ A;  2VE9 A;  2XAF A;  4L9T A;  3CTA A;  5ILS A;  3JSP A;  1IF1 A;  5BOX A;  2VOD A;  1ZLK A;  2DQR A;  2UXX A;  5LHI A;  1SFE A;  2MLK A;  3JSO A;  4ESJ A;  3DQV C;  1O3T A;  2VBZ A;  2XAH A;  4NB5 A;  3GF2 A;  2VOO A;  2D1H A;  5E1X A;  2KJC A;  3E6M A;  4IRG A;  4YII A;  1MKM A;  4IJA A;  3I58 A;  4S05 A;  2P7C B;  1W5S A;  3U9G A;  5ILV A;  2GXG A;  4PZJ A;  3MEX A;  3V7R A;  1KU9 A;  3I5U A;  3WTT C;  3LFK A;  2DO7 A;  1Z9C A;  4ETS A;  4GYI A;  1LEB A;  3GW2 A;  1Y0U A;  4ZYD A;  4OIR F;  4AVP A;  4U7B A;  3SZT A;  1LVA A;  1SMY F;  5DDG A;  4HYE A;  3WGI A;  1J75 A;  3J81 K;  3B02 A;  3E5Q A;  4M73 A;  4CO8 A;  3FX3 A;  2IA1 A;  4YFK F;  3OOP A;  1CF7 B;  1UHW A;  4O3M A;  4IRH A;  2MC3 A;  1USS A;  3HSE A;  3HRU A;  1QGP A;  5DYM A;  4P9U A;  3WU1 B;  2VBW A;  3TDZ C;  4AIK A;  4IF4 A;  4I0B A;  2HFH A;  2YU3 A;  2J5O A;  2FRH A;  4HF0 A;  2XGX A;  4UV9 A;  4E70 A;  4GO1 A;  3M8E A;  1S7O A;  2M87 A;  5HDN A;  3QU6 A;  2EA2 A;  2L4M A;  1WQ2 A;  1X3U A;  3K1P A;  1B9N A;  1SD6 A;  1O3R A;  2QUF A;  1ZRC A;  5IT9 K;  1HBX G;  5FLX K;  1IZ1 A;  4KUM A;  3EUH A;  2HYG D;  1W7P A;  1ZRE A;  1JE8 A;  2L4A A;  3TOA A;  3KLO A;  4EJW A;  1UST A;  3J81 Z;  1YW9 A;  1F9N A;  2K7L A;  2PJP A;  4O5V A;  2FQ3 A;  5AIQ A;  2FU4 A;  2FE3 A;  3R61 A;  4HOB A;  1BI0 A;  5JFR A;  3TQN A;  3HRT A;  2FXA A;  4HX7 A;  1XN7 A;  2NS0 A;  4UXN A;  2O8X A;  5CVU A;  3WU0 A;  4DNC A;  4HLY A;  1OYY A;  4EJU A;  1UFM A;  5BPI A;  1BI2 A;  5CYV A;  3ZN0 A;  4Y15 A;  1RUN A;  1R1T A;  2MA3 A;  3BOQ A;  4RB3 C;  4AD9 A;  3LST A;  4LJZ F;  2G7H A;  3FMQ A;  3V8J A;  3C3W A;  5IT9 Z;  3GZ5 A;  2BV6 A;  5FLX Z;  3PFI A;  2RC4 A;  1XGM A;  3WTY C;  3DKW A;  2VC0 A;  3AAF A;  1HW2 A;  5FO5 A;  3KEQ A;  2STW A;  3E6D A;  5FFZ A;  3ABT A;  4KN7 X;  5D8L B;  2GWR A;  4U0W A;  4XLN F;  6PAX A;  4HQE A;  2J5P A;  1LJ9 A;  1MGT A;  4U88 A;  1G4D A;  2CO5 A;  2KJB A;  2R7F A;  1K7A A;  1HW1 A;  2IJL A;  2LSO A;  3IC7 A;  5TRD A;  1K78 B;  5F1R A;  3U1D A;  1MJB A;  2YX7 A;  4HV5 A;  2L3D A;  2CFX A;  1HW5 A;  5F64 A;  4TV7 A;  2KRF A;  4JK1 X;  3GFM A;  2ZO4 A;  1FSE A;  2EFW A;  1HXD A;  1FOK A;  4LG0 A;  4EMS A;  2XRO A;  4KFC A;  1PP8 F;  2LF8 A;  3E6B A;  2K02 A;  1K6O A;  4A6D A;  3DV8 A;  2ESN A;  3WTX C;  4CYD A;  2HKX A;  1TQI A;  3DEU A;  3KP5 A;  2PN6 A;  5D5X B;  3TKY A;  3P9C A;  3H3Z A;  2F5E A;  2QLZ A;  5LGU A;  2W57 A;  4RB2 C;  2STT A;  1R1V A;  2E7W A;  3GYH X;  2OAZ A;  4A0Z A;  2QQ9 A;  4G7Z F;  4EGZ A;  4ZH4 F;  5D6E A;  2IRF G;  3N97 A;  3F8N A;  1LDD A;  3M7G A;  4M6Y A;  4ASN A;  2M5W A;  2W24 A;  4RB0 A;  4HZF A;  4P96 A;  2BYV E;  1BN5 A;  2EFN A;  3GFJ A;  4AIH A;  1FC3 A;  2F5C A;  4OOI A;  2FEZ A;  3L9F A;  4YFX F;  2WWY A;  2IA2 A;  2XHK A;  1B9M A;  2Y0M A;  5D4S A;  4HQM A;  4A0X A;  3KET A;  2XIG A;  3L7W A;  1REP C;  3CUQ C;  1U5T C;  3M1E A;  2UXN A;  5EEH A;  4UNO A;  2IP2 A;  4G94 A;  5ED4 A;  1KU2 A;  1R5H A;  3J80 K;  1I1S A;  2E7X A;  3O6B B;  2QBY A;  1KGS A;  5LLQ A;  4MHG A;  5ICC A;  5H6R A;  2VON A;  4I2O A;  2JSC A;  1IN6 A;  4CHU A;  2F5D A;  3JW4 A;  1FWZ A;  3J7A O;  3HHG A;  4Q48 A;  2EB7 A;  5D6F A;  1TTY A;  3T0Y A;  3ZMV A;  3H3U A;  1BBY A;  4I02 A;  4EJT A;  1J7K A;  3D5L A;  3QAH A;  1YG2 A;  2KIF A;  4ENJ A;  1B6A A;  3R0A A;  1BIB A;  3WTZ A;  3IRR A;  5E17 F;  4UUV A;  1FT9 A;  4FX0 A;  2DBB A;  3RKX A;  4ON0 A;  1J9I A;  1K79 A;  4RGR A;  4AIJ A;  1XDU A;  1OYI A;  2ACJ A;  2F5F A;  2EK5 A;  2BBY A;  3GUD A;  2RV8 A;  3GFI A;  5HDG A;  1FX7 A;  1UCR A;  4U0Y A;  1KA8 A;  4KIC A;  3J80 Z;  3K9T A;  3RKY A;  2NYX A;  2ESH A;  1VTN C;  1FP2 A;  1ON2 A;  1SFU A;  1BC7 C;  3C18 A;  4U0V A;  1GXQ A;  2EWN A;  1YS6 A;  4L9N A;  1G3Y A;  3ML6 A;  5LGT A;  1WRJ A;  4JQF A;  5FD5 A;  1J2X A;  3MFK A;  1FY7 A;  1RI7 A;  4OU0 A;  3ABU A;  5J8C A;  5FGM A;  3PQK A;  1FYL A;  5HLG A;  1DDN A;  2ISZ A;  2TDX A;  2HDC A;  1DPR A;  2HOE A;  1F1Z A;  1HQC A;  2ZKZ A;  2PLY A;  4LK1 F;  4KN4 X;  2EFQ A;  3BPV A;  1MDM A;  5DUK A;  2G9W A;  2OQG A;  4RGU A;  2PG4 A;  1QNT A;  1KU7 A;  1B4A A;  2A69 F;  3L00 A;  4P9F A;  3IL2 A;  2DPD A;  4PCQ A;  4R8H A;  5TJJ A;  1RNL A;  2OZ6 A;  5J6X A;  2H27 A;  5JVT A;  1IXR C;  2X4H A;  2H94 A;  2A6E F;  3OV8 A;  1XDS A;  3SHF A;  5BPD A;  4G7H F;  4YFN F;  4HDU A;  2UZK A;  1AOY A;  3JAM Z;  1J59 A;  4WXD A;  2ELH A;  3DPL C;  2RDP A;  3QPT A;  5ICF A;  3CUQ B;  4KIG A;  3KP2 A;  2FBI A;  3M8F A;  1XGN A;  3RI4 A;  4K2E A;  4I01 A;  3RJP A;  2RQP A;  2VBX A;  2XV4 S;  1MZB A;  4BAY A;  3FMS A;  4BQA A;  3SFZ A;  2RKH A;  4LMY A;  5DEQ A;  2P8T A;  2VOP A;  5FFX A;  4PGG A;  4G6D A;  3GFL A;  1KYZ A;  3E97 A;  4KMF A;  3ZMZ A;  2DQL A;  2K86 A;  4EM1 A;  1JXS A;  5D4R A;  2CGP A;  2DLL A;  2DPU A;  2O61 A;  1U78 A;  2MH9 A;  3JTG A;  1KQ8 A; 
#chains in the Genus database with same CATH topology
 1QRY A;  2JT1 A;  1A6Q A;  2P5K A;  5FKM A;  5L3G A;  1D3Y A;  2BVL A;  2COM A;  1FBQ A;  3HB9 A;  1NH3 A;  3ABM H;  4I76 A;  3BQY A;  2EZH A;  1S7E A;  4PDK A;  2OQR A;  4KA4 A;  4ZZD A;  1C0W A;  3ZPL A;  2VQL A;  3FXL A;  4R1H A;  4KIB A;  3MMY B;  1RRJ A;  3G3Z A;  3QPS A;  1XTA A;  3ELK A;  1VZ0 A;  1KQ0 A;  1Z7U A;  2KIM A;  3CJN A;  5LHH A;  2WV1 A;  3DTK A;  2CS3 A;  3E3V A;  2NVT J;  1MND A;  2IVM A;  2V79 A;  3K69 A;  3R4K A;  3R0J A;  1BM9 A;  2H1L A;  1AA7 A;  3OWT A;  4XON A;  2XKP A;  1U2W A;  4LLL A;  4Y52 J;  1EH8 A;  3O8H A;  2GA1 A;  3LQQ A;  3ZN1 A;  3I55 I;  3GTL J;  2CU7 A;  1JKO C;  1XMX A;  1DP3 A;  1KYW A;  2GZW A;  4G7O F;  3HEF A;  2HKO A;  2WC2 A;  1UB9 A;  2LBF B;  3OYM A;  1R71 A;  5LFA A;  1P4W A;  2V9K A;  2MGQ A;  3DF8 A;  1TNT A;  1CF7 A;  4WCG A;  4UHT A;  3Q9V A;  1R4M B;  5K7Z A;  4UUS B;  3OIP A;  2XRN A;  3HIF A;  1WJF A;  1H9T A;  3RPQ A;  3GO5 A;  1R00 A;  4HNU A;  5DM6 F;  2OC6 A;  2DOA A;  4RGS A;  1Z7L A;  3RKW A;  3EQL F;  2QYO A;  3TO7 A;  1P9Q C;  4Y13 A;  2W7N A;  5DCM B;  5BMZ A;  3UKG A;  2PFB A;  1PJR A;  3CUO A;  1W36 C;  3EUK L;  3HTU A;  2OTJ I;  2LF7 A;  4XR6 A;  1QBJ A;  3LWF A;  3OYK A;  2MW8 A;  5H2F C;  1SD4 A;  1WHU A;  2ZFU A;  2FML A;  3ZQF A;  2DK8 A;  2V9P A;  1RKT A;  2MG4 A;  3K1M A;  4CSW A;  2VUM J;  3VYT B;  1G2H A;  3C7J A;  4HAM A;  3IAS 2;  2X1D A;  3I4P A;  2HOS A;  3JRG A;  2O0Y A;  3H9J A;  2XC7 A;  5KAI C;  2E1N A;  4XOP A;  1ZKG A;  2XGE A;  1G3S A;  5HS9 A;  1ZEL A;  2VN2 A;  3SDB A;  3TBI A;  3H0D A;  5L3B A;  1ITY A;  3FBN B;  2ETH A;  2ELJ A;  1SAN A;  3HXL A;  1V5E A;  3WG9 A;  2K85 A;  3GTM J;  1WVR A;  2DW4 A;  4ZYG A;  3MQ0 A;  2YX4 A;  1TLH B;  4BDY A;  1DGW Y;  3PNT A;  4A2U A;  4B47 A;  1CGP A;  1UJ8 A;  4BQO A;  2HR3 A;  3CMA I;  4RLF A;  3DEE A;  4N4N B;  2IS4 A;  4II3 A;  2H6C A;  1A04 A;  4CCO A;  3LMM A;  4XRF A;  2HI3 A;  2ZXJ A;  2L02 A;  2JTV A;  3R6S A;  1RZ4 A;  2G0E A;  3F8B A;  3L09 A;  3KZI C;  4B48 A;  1LE8 B;  5M3F J;  4OMZ A;  1H8A C;  3KZY A;  2O7O A;  3QOP A;  1DUX C;  1YIO A;  2BVM A;  2XSJ C;  4A3J J;  3KFW X;  4FQG A;  3WOD F;  3F72 A;  3LA3 A;  2V1X A;  4HBL A;  3FXQ A;  5B5E C;  3G71 I;  1YTY A;  1D8K A;  4UV8 A;  3RZO J;  2QWW A;  3T1B A;  3V42 A;  3ZQH A;  4F92 B;  1Z91 A;  4GYG A;  5FLV A;  5FKO A;  5LBQ A;  5HLH A;  3IKV A;  1JGS A;  2E1C A;  2M7B A;  1QVU A;  2H1K A;  4IKF A;  1W5C C;  4L0Z B;  1XG1 A;  1W7P B;  1FSH A;  3WTV C;  2OCE A;  4E7Z A;  2H09 A;  2LFB A;  2DFE A;  4M3E A;  5EG0 A;  5J1Y A;  1Z21 A;  2W4S A;  2GQQ A;  3VFZ A;  4HLX A;  3L2V A;  1VI0 A;  5E3M A;  1XSD A;  2DOE A;  2IEK A;  2Q8K A;  3KP3 A;  5IP6 A;  1E3P A;  1X2M A;  2V1N A;  1WKM A;  3MCZ A;  4XRM A;  4OAY A;  2CFO A;  3ZQI A;  1QHG A;  1YLF A;  1LDK B;  1FOY A;  3G1L A;  2GBY A;  1HDD C;  5DD4 A;  2DAO A;  4KT5 C;  3CQZ J;  5E8G A;  3KP7 A;  1FTZ A;  1ZN2 A;  2TCT A;  2DU9 A;  2HYF A;  2LKX A;  2Z5U A;  2M0M A;  2NS7 A;  2FA5 A;  4WX9 A;  3BZK A;  2JSP A;  4CZZ A;  3RTR A;  1IAW A;  4O6J A;  1H0M A;  2XSD C;  2XF7 A;  4N0B A;  3ZMD A;  1VQK I;  4ZYA A;  1JT0 A;  2R7T A;  1S29 A;  2RN7 A;  4LFU A;  3QPL A;  1P7I A;  2A6H F;  2MFZ A;  3DFG A;  1Z6R A;  2BY2 A;  5E3L A;  2E35 A;  2KRH A;  2X48 A;  2HZT A;  4BH9 A;  5LHG A;  1HSJ A;  1D0Z A;  1R58 A;  4J00 A;  1WGX A;  1X4P A;  2R5Y A;  3ISP A;  3WGH A;  4M6X A;  4A3E J;  2JA5 J;  1OCR H;  1QZY A;  2XAU A;  4NQW A;  2DCE A;  5LEJ A;  5EDN A;  2X51 A;  5HS7 A;  4Y33 A;  1XC5 A;  2FOK A;  3FIS A;  2M8E A;  4YRV A;  3KZZ A;  2L7K A;  4FTH A;  2CW0 F;  4DQ2 A;  3QQA A;  1OKR A;  1X1D A;  4KIS A;  2BEO A;  2CQK A;  2VQH A;  3OYN A;  1YQA A;  3W3C A;  1QHH D;  3JRI A;  4OWR B;  1LKX A;  2EIM H;  3ECH A;  2VXZ A;  4LGW A;  2HVR A;  4LB6 B;  2UV1 A;  1E3H A;  3HKZ A;  1DPU A;  3ONQ A;  5CQE A;  2WAD A;  3C1D A;  2IXS A;  3I53 A;  2OBP A;  2BZT A;  3BY6 A;  2LG4 A;  4ENN A;  2XPU A;  2JVG A;  4BL0 B;  1LEA A;  5ICE A;  1TL8 A;  1X1C A;  2L9S A;  5K7H A;  3KP4 A;  4PSX A;  2B0L A;  3CCS I;  4N9I A;  3OL3 A;  1LUJ B;  1OCC H;  3C2H A;  4PJJ A;  4LG3 A;  3UR3 C;  4IHX A;  3LSI A;  2MH2 A;  4WF2 A;  4A12 A;  2R7Q A;  1ZLJ A;  5EF6 A;  1TBX A;  3CP2 A;  3FM5 A;  5J4Y A;  1YRN A;  2FNA A;  2XPV A;  3BP8 A;  3OS1 A;  5FJ8 J;  1O57 A;  2AXT C;  2I10 A;  5JVG F;  1S7A A;  3ZXS A;  1P4A A;  2HVQ A;  4PGH A;  4M9X A;  4H0E A;  1X58 A;  3L2C A;  2V1D A;  5JR3 A;  1A31 A;  4Q47 A;  5L3E A;  4MTD A;  1DGR M;  5GTH C;  1H9G A;  4LD5 A;  1ZRF A;  1OCT C;  2BY3 A;  1TQP A;  3S3N A;  3TO6 A;  4LG0 B;  1XMA A;  4HX8 A;  5HDK A;  3COA C;  5GPA A;  1OCZ H;  1T38 A;  3S32 A;  1QZZ A;  2HPM A;  5GAE J;  4EVI A;  2NAZ A;  4G12 A;  2OZU A;  4EM0 B;  4I99 C;  4LB5 A;  4NC7 A;  1R9T J;  1ACI A;  3K4B A;  1Y0N A;  4I0A A;  2R7X A;  1XGS A;  2A61 A;  2L7F P;  4ENM A;  3RDI A;  3O2P E;  5FKN A;  2R7D A;  3OOU A;  1B72 B;  1FIP A;  1ODD A;  3WGG A;  2DMU A;  3TW7 A;  2WBM A;  3ROU A;  2ISY A;  2PMZ A;  4BDZ A;  2CSO A;  3PQJ A;  3CES A;  3RYP A;  3GVA A;  3JTH A;  3O3K A;  1F43 A;  2D1V A;  1J5Y A;  2EH3 A;  2BOL A;  4PFP A;  1VQP I;  1APL C;  2PMZ N;  5C3E J;  1OMI A;  1R7J A;  5DCF A;  4A6E A;  1FYK A;  1TWG J;  1SD5 A;  2WV0 A;  2ZCW A;  3I54 A;  1R1U A;  1D5V A;  2DI3 A;  1IRX A;  1FZP B;  4YIR X;  2UWM A;  3BT9 A;  3HJE A;  1UEL B;  2HS5 A;  2ME0 A;  2X1E A;  3Q5F A;  2HOA A;  2QF7 A;  4ZZL A;  1ZYR F;  1UHM A;  4AM3 A;  5D5U B;  5F04 A;  2VKE A;  3OYJ A;  3LAP A;  4BEH A;  4HF2 A;  3V4G A;  1V54 H;  3L2Q A;  4FHT A;  5BS6 A;  2VKV A;  2VJI A;  4G6T B;  4GGG A;  4EGY A;  3S1Q J;  1GV2 A;  1ETW A;  3HRS A;  2XDV A;  1YHQ I;  3U2R A;  4CIC A;  1QQI A;  2GIZ A;  3TOB A;  2K9S A;  5CVI A;  4BE1 A;  4RGX A;  2EZI A;  1FPQ A;  2ECB A;  9ANT A;  3MZ8 A;  4IEJ A;  3MZY A;  5E18 F;  3HBL A;  2ICW G;  4C3I J;  4XOT A;  5ERI A;  4LK0 F;  1RIO H;  4JYK A;  4IZZ A;  1BI3 A;  2JA8 J;  5HS8 A;  3V7S A;  2HEO A;  2X0L A;  2Z99 A;  3AG1 H;  3S17 J;  3T8T A;  2E5N A;  3G1O A;  1PUF B;  1WJB A;  3ZCO A;  4BXU A;  3K4C A;  2DXI A;  1WI3 A;  4M72 A;  3FHZ A;  5B1A H;  2E34 A;  3W6J B;  3OYB A;  3LAJ A;  1JT6 A;  4OIN F;  3K2Z A;  2QBY B;  3DPT A;  3N05 A;  4OIP F;  5LGN A;  2LD5 A;  4BXX J;  2JUC A;  5E1Z B;  1GVJ A;  3F22 A;  4MEX F;  3HZJ A;  2GXA A;  3QP5 A;  4M9Z A;  4DJA A;  4XRS A;  1F4K A;  2F4M B;  2PMU A;  1O7F A;  3BRO A;  4LLN A;  1GXP A;  3HGG A;  3F8F A;  1WH5 A;  1LB2 A;  3I59 A;  4H4K C;  2CQN A;  1FMW A;  1Y56 A;  5IYD J;  3TW6 A;  1D1A A;  2W1O A;  1GLN A;  3HOX J;  2NRA C;  1YJW I;  1R22 A;  4F55 A;  1EH7 A;  4MEY F;  3J7Y J;  4FCY A;  3EET A;  2QSF X;  2G7U A;  2WB1 A;  1I3A A;  3L2U A;  2XAS A;  3FXO A;  1FBS A;  1MSF C;  2RVC A;  5CLS A;  3DTE A;  1MMG A;  4N4O B;  4RAZ A;  2ZNZ A;  2WB1 N;  1ZAO A;  3CC7 I;  1TW2 A;  2K9L A;  5HVQ C;  4BE0 A;  5EGO A;  4ESB A;  2MBF A;  3ABL H;  5TIS C;  2ZFW A;  1OYW A;  2Y75 A;  2K9N A;  2MD5 A;  3IH2 A;  1T0F A;  1Z1D A;  1ZAR A;  3CCE I;  3FXJ A;  1IN7 A;  2JPB A;  3HOT A;  4QPO A;  3ABK H;  3VB2 A;  1KQ9 A;  1I3Q J;  4EAT A;  3JAM K;  2DT6 A;  2KP6 A;  4XID A;  1MMS A;  4CH7 A;  1HC8 A;  3FBI B;  3PJR A;  5K5R A;  3BWG A;  3DBR B;  3CCJ I;  2LY2 A;  4HV6 A;  4A93 J;  5EJC A;  4UY8 I;  1UAA A;  1R5I D;  3LSJ A;  3HOU J;  2H8R A;  2R7V A;  3HUG B;  4PK4 A;  4EQQ A;  3LA2 A;  4IHS A;  5J8F A;  3P9I A;  2JUG A;  4HNT A;  4Y4R A;  2ZME B;  3SQN A;  3ERM A;  5IT3 A;  1E2X A;  1XSX A;  4XLC A;  1Y39 A;  2O6G E;  3SJM A;  5AON A;  3DTI A;  4CXF A;  3MVP A;  1IDZ A;  5F0F A;  4M3F A;  5B1B H;  4NUB A;  5IP7 J;  2IA0 A;  1KON A;  2EA4 A;  3ZMU A;  3SZP A;  3GLL A;  1W7P D;  1XD7 A;  5C4X J;  3U21 A;  4FX4 A;  3OSG A;  2AXL A;  3KLN A;  3CC4 I;  3RYR A;  4IRI A;  1XGO A;  5LEK A;  3HPH A;  2CQX A;  2DJI A;  3NWS A;  1XS9 A;  3EYI A;  2W82 A;  1HOM A;  1G6N A;  2P4W A;  3IWF A;  4G8X A;  3K70 D;  4RLQ A;  2DOF A;  1FMV A;  4G9Y A;  3SYT A;  5DS9 A;  2CWE A;  3GX4 X;  2JA7 J;  2FBK A;  1I1G A;  1BIA A;  1YS7 A;  4YG2 F;  1U6G A;  3REO A;  3IRQ A;  5AIP A;  5GPC A;  2V1U A;  2IT0 A;  3RPU A;  3BR3 A;  4E7I A;  5E20 A;  1WJA A;  2C6Y A;  3PSI A;  2QGU A;  5HNF A;  2GIV A;  3Q0U A;  2XPW A;  1HKQ A;  5GAD J;  2DK5 A;  1V55 H;  2W84 A;  4M74 A;  4P5O A;  2KKO A;  3S2D J;  2O9L A;  1MMA A;  3E5U A;  4DZP A;  3OYI A;  3H1C A;  3LNQ A;  3V8K A;  1OLT A;  3MAJ A;  4V19 K;  1IO2 A;  4BJ5 C;  3F23 A;  4UVA A;  1U5T B;  4B09 A;  3D1N I;  4XM3 A;  4BHB A;  2R7S A;  4B44 A;  2Z2S B;  2DMT A;  1FJL A;  4OIQ F;  2L54 A;  2VPR A;  3JRE A;  1ZQ3 P;  2E36 A;  2YS9 A;  3S15 J;  3CDL A;  2Y9Z A;  2X9D A;  3H92 A;  5L3C A;  2LYC A;  3W2V A;  2V26 A;  5LRS A;  3BJ6 A;  2VL8 A;  1FIA A;  5KVR A;  2XAG A;  3ASN H;  3KEO A;  3VEP A;  1SFK A;  2HXI A;  3FK7 A;  3N4M A;  2NOJ B;  2FF4 A;  2PQ8 A;  3HOS A;  2Z1D A;  4ENK A;  4L9J A;  4XN0 A;  3SEZ A;  2PI0 A;  2A5Y B;  2LR8 A;  4XBF A;  3HSR A;  1A35 A;  4DYC A;  4R79 A;  2ZB9 A;  4U7D A;  3G73 A;  2W25 A;  4CYC A;  5CKT A;  3F8C A;  2DTR A;  1TZL A;  2AQF A;  4D5F A;  1P4X A;  2LK2 A;  1J09 A;  4X6A J;  3DP7 A;  1FOW A;  1MH3 A;  3FWE A;  4YIF A;  3WE3 A;  5KK1 A;  3P7N A;  5JHU A;  1IDY A;  5D5V B;  1TW3 A;  4C2M J;  1WJE A;  4XMY A;  4NC8 A;  1MBE A;  4RAG A;  2XKO A;  4XKB A;  3D0S A;  3FHN A;  2PEX A;  3IH4 A;  1QPM A;  4GCV A;  5JHF A;  3WG7 H;  3ULQ B;  2KZG A;  2LTP A;  5D5W B;  2FD5 A;  3VYR B;  1U9O A;  2ECC A;  2BE5 F;  3BR2 A;  1VQ5 I;  3NRV A;  2KDZ A;  3PIO F;  4WXC A;  4MTE A;  3TDU C;  2GAU A;  2M45 A;  2CW8 A;  5K5O A;  2P0W A;  2WTE A;  1HCR A;  1IXC A;  2XVC A;  1UHS A;  3B6A A;  3BG7 A;  5K1Y A;  4IQJ A;  5E3N A;  4HNV A;  5E79 C;  1W36 D;  4CGZ A;  2OF7 A;  1IJW C;  3RIR A;  1TQM A;  5K5Q A;  1O3S A;  3FZV A;  2JWT A;  2VT3 A;  2IBD A;  4XSX F;  4HG2 A;  4A3G J;  4RS8 A;  1HKT A;  4FIS A;  4E7K A;  3E5X A;  5FB2 A;  4A69 C;  4HDV A;  1T98 A;  2JN6 A;  3B6C A;  4M9S A;  4EJO A;  1BR2 A;  3KE2 A;  3K4N A;  1ZGJ A;  1YW8 A;  2ZXI A;  2M9H A;  4FET A;  4E4H A;  5HOD A;  2K3F A;  3DBH B;  2O3F A;  1EH6 A;  2OD5 A;  1AU7 A;  3FIW A;  4Y17 A;  4D1Q A;  1ZH5 A;  1TC3 C;  4EJV A;  1YW7 A;  3I71 A;  3LSM A;  1HKS A;  2DTZ A;  1Z05 A;  5DCM A;  4BHP A;  3CDI A;  1IW7 F;  5EEG A;  1F5T A;  4BYY A;  4FE7 A;  1X3W B;  2E5Z A;  5J1R A;  4XLP F;  3GXO A;  3OYL A;  4N9H A;  1MNE A;  1SFX A;  1YOV B;  4UVC A;  4S0H B;  1G3T A;  1EKE A;  1ZG3 A;  4M71 A;  2E2I J;  1IN4 A;  3PSF A;  3M9A A;  3A0H C;  2CQ7 A;  1PDN C;  4YEL A;  3LL7 A;  4DYR A;  3AG4 H;  2FNP A;  5DV5 A;  4B8X A;  1TT5 B;  3F6V A;  5FRN A;  2K40 A;  2DA2 A;  1NG7 A;  5J3L A;  3K0L A;  5CJ9 A;  2Z3Y A;  3V8L A;  2WA0 A;  1Q1H A;  4A3B J;  3CJT B;  3WTU C;  1O3Q A;  2W00 A;  2HVS A;  2PMH A;  3S14 J;  1SAU A;  3ZMT A;  4WWC A;  1MW7 A;  1WSU A;  2L2O A;  3FXR A;  1G3W A;  2ID3 A;  3BR5 A;  1LVK A;  2K9Q A;  3PIP F;  3G6E I;  2P6T A;  4F93 B;  1TNS A;  1BOB A;  3C2G A;  1FEX A;  3B73 A;  1MBH A;  4XKC A;  2LLK A;  4B3X A;  5FKK A;  1UG2 A;  1HST A;  3IAM 2;  2NVU B;  2DT7 B;  3LSK A;  4A5M A;  2IW5 A;  1P2F A;  3DEW A;  4RMN A;  1RPW A;  2HQR A;  2E19 A;  4MQV A;  2JA6 J;  3M4O J;  3QYE A;  4XOR A;  2YR2 A;  5JI6 A;  3OIO A;  1ORK A;  2D2W A;  5F0C A;  4BBS J;  4AWX B;  2LNB A;  5CVR A;  4MLO A;  4B1R A;  2VIX A;  4KNY A;  3MWM A;  2JRT A;  3TO9 A;  3CCR I;  2VT2 A;  4OMY A;  3HHH A;  4QLC U;  3BDD A;  2R93 J;  4HSR A;  4ITV A;  2JQ7 A;  3KEY A;  5HNH A;  5F08 A;  1HA8 A;  2R0Q C;  4BAC A;  4MFE A;  1YO5 C;  2V6E A;  4XL9 A;  4L0Y B;  3J7A Y;  1I27 A;  2EV0 A;  2NOG A;  2KRC A;  5CQG A;  2CUE A;  1LDJ A;  3CCY A;  2QEN A;  4L5J A;  3E6C C;  2IPQ X;  1EV7 A;  2PBI A;  2K4J A;  2VQC A;  2X6W A;  1ZRD A;  4B3A A;  2X6O A;  2A6T A;  2A3S A;  3SXY A;  4IHT A;  2OU2 A;  1TT0 A;  1L0O C;  5D8K B;  3G4S I;  2E1O A;  2L01 A;  1JTY A;  1MBJ A;  3NQO A;  1K4T A;  2E71 A;  2CV0 A;  4BUP A;  2GXB A;  1KU3 A;  1BW6 A;  4BQQ A;  3GTK J;  3PFY A;  3HL2 A;  5EG0 B;  1IGN A;  1JHF A;  2NXN B;  3SZG A;  2V9V A;  4D5C A;  3LA7 A;  3GTQ J;  1XMK A;  4WXH A;  1FP1 D;  1S6L A;  3BJA A;  1AHD P;  1Z3Y A;  5CVV A;  4KT6 A;  4MNU A;  1AWC A;  4XQF A;  4LIT A;  3IKT A;  4PJL A;  4ESF A;  3HPG A;  4MQ9 F;  1GHC A;  5F27 A;  3BG6 A;  1O7L A;  4UVB A;  1Z6T A;  1B8I A;  3PNY A;  4A3D J;  1QZE A;  3BTC A;  1VQM I;  4RAY A;  4JBA A;  1WCM J;  1ETQ A;  2V6C A;  1B1B A;  2QZ8 A;  2ZNY A;  1ZGW A;  2EFP A;  4NBQ A;  2GOX B;  3AL0 C;  4AU7 A;  1T2K A;  1XB4 A;  1JGG A;  4EM2 A;  1JKP C;  2D5V A;  2W85 A;  3GZ6 A;  3CO7 C;  2KT0 A;  2VE8 A;  4G6Q A;  4L9V A;  2P6S A;  1K78 A;  3LSP A;  1OPC A;  3S2W A;  3AKZ A;  3S1R J;  3A02 A;  1I6X A;  2E1M C;  1VQN I;  5LRR A;  4M3B A;  2NNY A;  4ANJ A;  3I4M J;  3UNG C;  4E7J A;  2DDB A;  4F7Z A;  2M4G A;  2DA7 A;  1MJ9 A;  3ZP5 A;  2EV5 A;  1FBU A;  2FSW A;  1BC8 C;  4YEJ A;  1ONV A;  2XUB A;  2BW3 A;  2EIL H;  2B63 J;  1N75 A;  5HOO A;  2OTL I;  1ZGA A;  4RM3 A;  4Z2Y A;  4RM2 A;  4PUS A;  2ZSH B;  3WE2 A;  3FKJ A;  5BQT A;  5A2Q K;  1DP7 P;  2Q1Z B;  2X1C A;  1T0F C;  3T8R A;  2K3P A;  1LPQ A;  1IRF A;  2O5R A;  2LKP A;  2JZY A;  1S5L C;  2XAQ A;  2L0K A;  2EV6 A;  2ZXH A;  3QU3 A;  3KYL A;  2VJ5 A;  1VF9 A;  1V5F A;  3GWZ A;  2FQ4 A;  2EJR A;  1LNW A;  3TMO A;  3EDP A;  4FAS D;  1P7J A;  3KYD B;  2KL4 A;  3EUA A;  1DU6 A;  1YRN B;  2EQR A;  2N8G A;  3V7C A;  3VOE A;  1JTX A;  4MGR A;  3CME I;  1T39 A;  1PP7 U;  2QVO A;  1SD7 A;  1U3E M;  1WI9 A;  1G59 A;  4L18 B;  2AS5 F;  1PVE A;  4W1U A;  1R36 A;  2VKD A;  1WWX A;  1RET A;  4BHC A;  4J19 A;  4XLH A;  5E1W A;  3GCM A;  4KYW A;  5IY5 H;  1DQU A;  2CUJ A;  4CDG A;  3MKZ A;  2DA6 A;  2WY8 Q;  3HG9 A;  2VC1 A;  3W6K B;  5FLM J;  4IHW A;  4KIF A;  1YFH A;  1WZ2 A;  4I98 B;  3HTS B;  3BJO A;  2JK3 A;  4IXA A;  1BJA A;  2E60 A;  2P5V A;  4HW0 A;  2Z33 A;  1JUS A;  1V4R A;  1BOA A;  2MYS A;  5E8I A;  4D7M A;  3DPU A;  4I7H A;  3ECO A;  2FBH A;  5ICG A;  4V2F A;  2XF5 A;  3K4L A;  3DU6 A;  4LLG F;  1LFU P;  4PJM A;  1R23 A;  3RQ4 A;  4XKV A;  2K4B A;  3KCC A;  2PJR A;  5A2Q Z;  2HGC A;  3U1K A;  3Q3S A;  1XSV A;  2M0C A;  4KJZ A;  4BS9 A;  3F6O A;  2FX0 A;  2RNJ A;  1XCV A;  2QM3 A;  4OIO F;  2BY0 A;  2F6C A;  4ZYE A;  4GRI A;  3FF5 A;  2MAB A;  1U8R A;  1XCB A;  2IS1 A;  2F48 A;  2QQA A;  1LQ1 A;  2NVY J;  1W4M A;  3FKI J;  1PUE E;  4ZYH A;  1MNM C;  4A3M J;  1BL0 A;  1K61 A;  1MH4 A;  2Z9O A;  3ZQC A;  3JTG A;  4BNC A;  2M30 A;  1JHH A;  2OA4 A;  1PUF A;  1M1E B;  2HTJ A;  1A6I A;  1OCO H;  4C9Y A;  4BEH B;  4E6K G;  4D0P A;  2CG4 A;  2CUZ A;  3GLX A;  3K4J A;  3S1M J;  3E0J B;  5M5W J;  3W6V A;  2Y30 A;  2RGV A;  1FYM A;  1TWA J;  2M8G X;  3F21 A;  1QA6 A;  3S8P A;  3FDY A;  5B66 C;  5C4J J;  5GAH J;  1SMT A;  3Q0W A;  1NHA A;  3Q9S A;  4HF1 A;  4C3H J;  3PM1 A;  1BI1 A;  4GDF A;  2CYY A;  4ZDL A;  3P9K A;  2R5Z B;  2Q0O A;  4WK8 F;  4ZDO A;  4A5N A;  3CD6 I;  3H3V K;  5HLI A;  1GVD A;  3LSR A;  3D5S C;  5FKL A;  1Y1V J;  2LY9 A;  3MKW B;  5F6F A;  2CRG A;  3EYY A;  1R5G A;  3GEZ A;  4LIU A;  1VQO I;  1WJD A;  2F2E A;  2GA2 A;  2KIU A;  1R49 A;  1IN5 A;  2XB5 A;  2JA2 A;  3RSN A;  5KCM A;  5CVJ A;  4IPA A;  1D8J A;  3OS2 A;  1FLI A;  1IXS B;  1S8N A;  5ILU A;  2BGC A;  3HYI A;  4XKW A;  3QP6 A;  3LOC A;  5H6Q A;  1P92 A;  1MMD A;  3AL0 B;  2R7U A;  1JJ6 C;  4LIV A;  5GTI C;  2H8W A;  2KMU A;  1ON1 A;  3LFU A;  5EZH A;  3OYC A;  2HZD A;  4KMU X;  1JJ8 C;  1I5Z A;  2FMY A;  4S04 A;  3HOZ J;  3JRF A;  3BZ6 A;  3FM3 A;  3I59 B;  2QSG X;  2VAS A;  4D9J A;  3QRF F;  2A05 A;  4E7S A;  3S16 J;  4AYB A;  3OYG A;  3W2W A;  4BU2 A;  2E1M B;  2HQA A;  1N78 A;  2HTS A;  2P7V B;  2QQB A;  2L9R A;  4CCN A;  2VJ4 A;  3CLO A;  1VQ9 I;  4HX4 A;  2EZL A;  2Y69 H;  4NHJ A;  2LDU A;  2YSR A;  3K10 A;  2VLA A;  3QOE A;  3M1C A;  3RZD J;  2EFO A;  1PYV A;  4AYB N;  1OR7 A;  3G2B A;  3IWZ A;  1ZHF A;  2UUZ A;  1YJ9 I;  2YPR A;  1Z3X A;  2H6B A;  4GXO A;  1IRZ A;  2X85 A;  4PFO A;  3BPX A;  1E17 A;  1MD0 A;  3CDH A;  3HDD A;  1P6R A;  3HUG A;  5K7F A;  3LQR A;  4KDP A;  1UG0 A;  3QPH A;  2IGK A;  3KYC B;  3CJQ B;  5EGO B;  1ERD A;  2HWV A;  3KP6 A;  2IS6 A;  2BHZ A;  2DT5 A;  3ZQ7 A;  4MIM A;  1S3J A;  2Q2E A;  2ZME A;  2WAF A;  2R3S A;  3H5A A;  4DIQ A;  2LKS A;  1IRG A;  3FMR A;  3MZH A;  4XLA A;  1B59 A;  5IYC J;  5DM7 F;  3K1N A;  5H20 A;  5M3M J;  2K27 A;  3OSF A;  2DMQ A;  1N77 A;  3I0T A;  4HA8 A;  1Y1W J;  4L5E A;  1RR8 C;  5L3D A;  3SFI A;  5DUI A;  4NNJ A;  4I09 A;  3CO6 C;  4X1E A;  2VJJ A;  3DKX A;  4ZTF A;  3H5R A;  1L3L A;  3R60 A;  1D0Y A;  2JPC A;  1WPK A;  1Y8Q B;  1W5T A;  3A2K A;  3LSG A;  4BXF A;  2D45 A;  2ADU A;  3BQZ A;  2I5U A;  1ETK A;  2M1B A;  1SEU A;  2GLO A;  2ZJ2 A;  2M2E A;  2M34 A;  4A0Y A;  2DFI A;  3HSF A;  2O03 A;  1J0R A;  3L1P A;  1X4O A;  3S2H J;  1V3F A;  1MJA A;  1ETV A;  1ULY A;  2ID6 A;  2CW7 A;  2A68 F;  2IAI A;  1IUF A;  3TGN A;  3ESW B;  3RKQ A;  3ZMS A;  3DXJ F;  3A01 B;  1MDM B;  4RB1 A;  1STZ A;  2RNG A;  5E3O A;  3PUF A;  2K9M A;  4Q5S F;  2OUM A;  2HNH A;  3DLL F;  4EV0 A;  3WTW C;  2P5L C;  3BTL A;  1YYV A;  2ZBK A;  3W2A A;  1T6S A;  3JCU C;  3GBG A;  3TL4 X;  4Q4Z F;  1WH7 A;  5DD8 A;  5L3F A;  3CUQ A;  3FXU A;  1U5T A;  4FT8 A;  2OV7 A;  4IVN A;  4ZDP A;  2MLG A;  3BZC A;  5FD6 A;  1ETY A;  5EZG A;  2ME6 A;  1GDT A;  1JUM A;  3CP8 A;  4L5I A;  1MIJ A;  3I64 A;  4GFB A;  1OJL A;  3VSL A;  1T08 B;  1D1B A;  4PJ0 C;  3VOD A;  1JI8 A;  2IGO A;  4XSZ F;  1IUY A;  4FE4 A;  1FNN A;  3HRM A;  1ZG1 A;  3K7A J;  3F8M A;  1SAX A;  2RRE A;  2XAJ A;  4I6Z A;  2LRE A;  4A3I J;  1ZG5 A;  1SC7 A;  1QO0 D;  2KZV A;  3ERE D;  3HOY J;  3OIQ A;  4P55 A;  1IN8 A;  3CLQ A;  3WTS C;  1H89 C;  3IHU A;  2A07 F;  1RUO A;  4QIW N;  2NVQ J;  2YUS A;  4JX5 A;  3F3X A;  1KZH A;  3T5X A;  4A3L J;  3S3M A;  2KDO A;  1AKH A;  2BXZ A;  3NAR A;  2VBY A;  2Y48 A;  1MBG A;  2RAE A;  3NEU A;  2VPL A;  2NNN A;  3NAU A;  3H9G A;  2HQN A;  4QWQ A;  4ZC3 A;  2VE9 A;  2XAF A;  3BG3 A;  4L9T A;  3CTA A;  5ILS A;  1E3O C;  3JSP A;  1IF1 A;  5BOX A;  2VOD A;  1ZLK A;  2DQR A;  1I50 J;  2F5V A;  2UXX A;  4XRS G;  5LHI A;  3M8J A;  1SFE A;  2MLK A;  3JSO A;  2L7Z A;  4ESJ A;  4BBR J;  2AHQ A;  5J47 A;  4UB6 C;  3DQV C;  5IYB J;  1O3T A;  2ELK A;  4CYC B;  2VBZ A;  3PUB A;  4V2G A;  3QYB A;  2XAH A;  4NB5 A;  2XB0 X;  3GF2 A;  1VQ8 I;  2VOO A;  4CUG A;  2D1H A;  5E1X A;  5HLT A;  1OCP A;  1YI2 I;  1ZR2 A;  4UUT A;  1A36 A;  2KJC A;  3E6M A;  1BR4 A;  3L2W A;  5B3S H;  4IRG A;  4YII A;  1MKM A;  4IJA A;  3GTJ J;  3I58 A;  5IOZ A;  4S05 A;  2P7C B;  1W5S A;  3U9G A;  2HPI A;  5ILV A;  5KAF C;  2GXG A;  2QKL B;  4AVZ A;  3P5J A;  4PZJ A;  3MEX A;  3VYU B;  1IV8 A;  3V7R A;  2HU9 A;  1KU9 A;  3I5U A;  3WTT C;  1SFO J;  3LFK A;  2B9S A;  2DO7 A;  1Z9C A;  3CCM I;  4ETS A;  4GYI A;  5FRO A;  2LBF A;  4DOZ A;  1MBF A;  4PJN A;  1LEB A;  5GP9 A;  3GW2 A;  3BG5 A;  4UUS A;  2WY7 Q;  1RC9 A;  1Y0U A;  2IS2 A;  1X1P A;  4ZYD A;  3JRB A;  4OIR F;  4AC0 A;  4AVP A;  4U7B A;  3SZT A;  1LVA A;  1SMY F;  2AO9 A;  5DDG A;  2DMN A;  2BY1 A;  2LMD A;  1QU3 A;  4HYE A;  5JLW A;  3WGI A;  1J75 A;  3DLA A;  2R92 J;  3ZR8 X;  4B4C A;  3J81 K;  3B02 A;  3E5Q A;  2JMW A;  4M73 A;  2RQQ A;  2NVX J;  4RA2 A;  3K4M A;  4CO8 A;  3QYF A;  4BJT A;  3FX3 A;  2OJE D;  4LOC A;  2IA1 A;  4YFK F;  3M07 A;  1TWF J;  3OOP A;  3CF2 A;  1CF7 B;  4Y7N J;  3PL8 A;  1BJZ A;  1UHW A;  3BTI A;  4IRH A;  4O3M A;  2MC3 A;  1USS A;  3HSE A;  2FOW A;  4IHV A;  3HRU A;  1QGP A;  5DYM A;  4P9U A;  3WU1 B;  4E7H A;  2VBW A;  3TDZ C;  4AIK A;  4IF4 A;  4I0B A;  2HFH A;  2YU3 A;  2J5O A;  2FRH A;  4HF0 A;  4HEA 2;  4EEF G;  2XGX A;  4UV9 A;  4CA0 A;  4E70 A;  4MO7 A;  1I39 A;  2TRT A;  3M8E A;  1S7O A;  4GO1 A;  2M87 A;  4HRI A;  2VKH A;  5HDN A;  1U0J A;  3OYD A;  3QU6 A;  2EA2 A;  1D0X A;  1Y8R B;  2P81 A;  2QCO A;  3S1N J;  2L4M A;  1LE8 A;  1WQ2 A;  2EPF A;  3QOD A;  1YIJ I;  1S72 I;  2KIQ A;  4J01 A;  1X3U A;  4QPQ A;  3K1P A;  1B9N A;  2Z16 A;  3HM5 A;  3ZQL A;  3J7Z I;  1SD6 A;  1O3R A;  2QUF A;  1ZRC A;  5IT9 K;  1HBX G;  5FLX K;  1POG A;  3E1S A;  1IZ1 A;  4KUM A;  4C2T A;  1U8B A;  4IO9 F;  2KFD A;  3EUH A;  2HYG D;  4PSW A;  3A4C A;  2LP0 A;  1A5J A;  1Q1V A;  2DA5 A;  2LOO A;  3HOW J;  1BA5 A;  3EPZ A;  1W7P A;  4IQ4 A;  5IP9 J;  1ZRE A;  1JE8 A;  1ZK8 A;  2L4A A;  4A3K J;  3GZN B;  2DA3 A;  3TOA A;  3KPH A;  3KLO A;  3SDG A;  4RDU A;  4EJW A;  5BNG A;  4IX7 A;  1UST A;  3PO2 J;  3IH3 A;  4ZTJ A;  3S93 A;  3J81 Z;  3MKL A;  1YE9 A;  1YW9 A;  2R7W A;  3CMY A;  1F9N A;  1W1W E;  2K7L A;  2PJP A;  1X19 A;  4F52 A;  3Q0V A;  2CJJ A;  1T33 A;  4O5V A;  4C30 A;  3BCA A;  1MMN A;  2XRL A;  2DA4 A;  2FQ3 A;  2FU4 A;  2FE3 A;  2FUG 2;  4NC6 A;  5AIQ A;  4XIC A;  1XPX A;  3R61 A;  4HOB A;  4CCM A;  3GTO J;  3CJR B;  1BI0 A;  4BE2 A;  1NK3 P;  3ZGK A;  3TQN A;  5JFR A;  4DGW B;  3HGY A;  3HRT A;  2QQ8 A;  3OL4 A;  2FXA A;  5M5Y J;  4HX7 A;  1GV5 A;  1XN7 A;  2NS0 A;  3K4K A;  4UXN A;  1ETX A;  2O8X A;  5CVU A;  3OR2 C;  2LY1 A;  1W0U A;  3TP0 A;  3WU0 A;  4DNC A;  4HLY A;  1OYY A;  2KLO A;  1R4N B;  4EJU A;  5KNL A;  1UFM A;  5BPI A;  1BI2 A;  5CYV A;  2VXD A;  2EIK H;  2V7F A;  3ZN0 A;  4Y15 A;  1RUN A;  1EA3 A;  2EIJ H;  4KIT B;  1R1T A;  2MA3 A;  2YU9 J;  2X6X A;  2ZSI B;  3BOQ A;  4RB3 C;  4AD9 A;  2BXY A;  2KQR A;  1XX5 A;  2V4J C;  4W97 A;  3LST A;  4LJZ F;  2MD0 A;  3FXK A;  3GTG J;  4IL6 C;  3DCF A;  2G7H A;  3FMQ A;  3V8J A;  2E2J J;  3C3W A;  5IT9 Z;  2OCC H;  3GZ5 A;  2BV6 A;  5FLX Z;  3PFI A;  2RC4 A;  1XGM A;  3WTY C;  1X1B A;  5J1U A;  1O4X A;  3I3L A;  1ETO A;  4JX4 A;  3CZ6 A;  3M3Y J;  3OY9 A;  5IPA A;  1MSE C;  3DKW A;  2VC0 A;  3AAF A;  5JLX A;  1HW2 A;  5FO5 A;  3KEQ A;  2CUF A;  2ZJQ F;  3E6D A;  2STW A;  5FFZ A;  1DU0 A;  3ABT A;  3VPR A;  3X2Q H;  4KN7 X;  5D8L B;  2GWR A;  3IV5 A;  4U0W A;  3AG3 H;  4C3J J;  4Y3O A;  2R5Y B;  2MC4 A;  2R7Z J;  3H9Q A;  2R7R A;  1B8I B;  4XLN F;  6PAX A;  2HOT A;  2B7E A;  4JOM A;  4NQW B;  2DFF A;  4HQE A;  2J5P A;  2KIS A;  1SVO A;  2QEX I;  1BR1 A;  5LD2 C;  3OR1 C;  1LJ9 A;  1MGT A;  4U88 A;  4DW6 A;  1G4D A;  2DYR H;  2CO5 A;  3I56 I;  2KJB A;  2R7F A;  4JX6 A;  1K7A A;  3WHB A;  2EIN H;  1HW1 A;  2IJL A;  2LSO A;  3IC7 A;  4BJ6 C;  5TRD A;  1K78 B;  5F1R A;  3A03 A;  3U1D A;  1MJB A;  2OPT A;  1D5Y A;  3K2A A;  2YX7 A;  2ZC2 A;  3MD2 A;  3HKZ N;  4HV5 A;  2L3D A;  2CFX A;  2IGM A;  1HW5 A;  5F64 A;  5EYR A;  4TV7 A;  4HST A;  2KRF A;  4JK1 X;  1I6H J;  3GFM A;  2F4I A;  4QTR A;  2ZO4 A;  4AUX A;  1OR7 C;  1FSE A;  2EFW A;  1HXD A;  4OAZ A;  1FOK A;  4LG0 A;  4EMS A;  1HDP A;  2XRO A;  4Z6Y A;  4KFC A;  1PP8 F;  3ZQQ A;  2BW3 B;  2LF8 A;  3VWB A;  3E6B A;  2K02 A;  4IOC F;  1K6O A;  4A6D A;  3DV8 A;  2ESN A;  3ZRG A;  1RES A;  2ZME C;  1WJC A;  3MN2 A;  3RPU D;  3WTX C;  2O8K A;  1FOX A;  2L7M P;  4CYD A;  4M6V A;  2HKX A;  1TWH J;  1TQI A;  2M7A A;  3DEU A;  2MSY A;  3KP5 A;  2PN6 A;  3OMY A;  5D5X B;  1EF4 A;  3RCO A;  3FK6 A;  1QPI A;  2DYS H;  2NS8 A;  3TKY A;  5C44 J;  3S3O A;  1B72 A;  3P9C A;  3H3Z A;  2F5E A;  3CCQ I;  1FTT A;  2QLZ A;  2ZXW H;  5LGU A;  2W57 A;  4RB2 C;  2STT A;  3I9V 2;  1JKR C;  1R1V A;  2E7W A;  3SEQ A;  3ZQG A;  3GYH X;  2OAZ A;  4A0Z A;  2QQ9 A;  3OS0 A;  2E2H J;  3VSK A;  4G7Z F;  4EGZ A;  4ZH4 F;  2BHY A;  5D6E A;  2IRF G;  5IOY A;  2DA1 A;  3F8N A;  1LDD A;  3N97 A;  3M7G A;  4M6Y A;  4ASN A;  3BLY A;  2M5W A;  2W24 A;  5FRM A;  4RB0 A;  1E0E A;  4HZF A;  4ABZ A;  4P96 A;  2KPM A;  2BYV E;  2DJN A;  1BN5 A;  5J4V A;  2EFN A;  3GFJ A;  3NWT A;  4AIH A;  1FC3 A;  2F5C A;  4OOI A;  2FEZ A;  2VI6 A;  4BY7 J;  4DYQ A;  3L9F A;  4YFX F;  2WWY A;  5CPR B;  2IA2 A;  3H0G J;  2PX9 A;  1NTC A;  2CQQ A;  4CZC A;  2XHK A;  1B9M A;  2GOM A;  2Y0M A;  3OYH A;  5D4S A;  1U9N A;  3PO3 J;  4HQM A;  4A0X A;  2CV1 A;  3KET A;  2XIG A;  1RKW A;  3L7W A;  3OYA A;  1REP C;  3CUQ C;  1U5T C;  3M1E A;  2CH0 A;  2UXN A;  5EEH A;  3ZOB A;  4UNO A;  1X3Z B;  2IP2 A;  1HLV A;  2PJR B;  4G94 A;  3BC8 A;  5ED4 A;  1KU2 A;  1EJ9 A;  1R5H A;  2WAE A;  4DZJ A;  4X0G A;  3J80 K;  1I1S A;  2E7X A;  2Y31 A;  3O6B B;  2QBY A;  2XGC A;  1KGS A;  2L9V A;  5LLQ A;  3JRH A;  1R6R A;  1Z77 A;  4MHG A;  3VYS B;  1IV6 A;  2ZJR F;  5ICC A;  5H6R A;  1BW5 A;  2VON A;  3CF5 F;  2HYJ A;  4I2O A;  2JSC A;  1IN6 A;  4CHU A;  3L2R A;  2F5D A;  3JW4 A;  2R5Z A;  1FWZ A;  3J7A O;  2WAQ A;  3HHG A;  1K83 J;  5EEA A;  4BGD A;  4JP0 A;  4Q48 A;  4B43 A;  2GM4 A;  1X1A A;  2EB7 A;  5D6F A;  3K6G A;  1TTY A;  1UMQ A;  3T0Y A;  3OYF A;  4RAF A;  3ZMV A;  3JRA A;  4C2U A;  4F91 B;  2WAQ N;  2AQE A;  1G8X A;  3H3U A;  1BBY A;  4I02 A;  4EJT A;  3AFH A;  1J7K A;  2L9N A;  2X6Y A;  3D5L A;  3PNV A;  3QAH A;  3D5R C;  2DOD A;  1YG2 A;  2DN0 A;  2Y9Y A;  2Y0S A;  3DKY A;  2KIF A;  3AG2 H;  4ENJ A;  1VQ4 I;  3DBL B;  1B6A A;  3R0A A;  1BIB A;  3WTZ A;  4D7N A;  3OYE A;  3IRR A;  5E17 F;  2DDA A;  4UUV A;  2F4O B;  1FT9 A;  4F3Q A;  3JRD A;  2HDD A;  4FX0 A;  2DBB A;  3RKX A;  1W0T A;  2Y0S N;  4ON0 A;  1V5G A;  1ZTR A;  2M3A A;  3JR9 A;  1J9I A;  1RR7 A;  1K79 A;  3A1Y A;  3GTP J;  4RGR A;  2HQ5 A;  3DU5 A;  4AIJ A;  2QSH X;  1ENH A;  1XDU A;  1OYI A;  2ACJ A;  2R4G A;  2F5F A;  2EK5 A;  1WFX A;  2BBY A;  3GUD A;  2RV8 A;  3GFI A;  2JJ7 A;  5HDG A;  1FX7 A;  1UCR A;  4CCL A;  1NG6 A;  4U0Y A;  3BR6 A;  3HC7 A;  1KA8 A;  4KIC A;  1LFB A;  3J80 Z;  3K9T A;  3RQI A;  3RKY A;  2NYX A;  3FXM A;  2ESH A;  2KHM A;  1VTN C;  3JRC A;  1FP2 A;  1ON2 A;  3C2B A;  1SFU A;  1BC7 C;  3TP3 A;  3C18 A;  4U0V A;  1GXQ A;  1GUU A;  2EWN A;  1YS6 A;  2L5Q A;  1IG7 A;  3G1M A;  2LRD A;  4M3D A;  2XF6 A;  1YIT I;  4L9N A;  1G3Y A;  4BQN A;  3ML6 A;  4II2 A;  1QVT A;  2I8D A;  5LGT A;  3KX2 A;  2EZK A;  1WRJ A;  1Z0X A;  4JQF A;  2JVH A;  5FD5 A;  1J2X A;  1JUP A;  3MFK A;  1FY7 A;  1RI7 A;  4IOA F;  4OU0 A;  4XNF A;  3ABU A;  3BR1 A;  2HXO A;  5J8C A;  5FGM A;  3PQK A;  4M3G A;  1FYL A;  4CCJ A;  2Q2E B;  5HLG A;  1DDN A;  2ISZ A;  3TED A;  3KIO A;  1VQ6 I;  1SVM A;  2TDX A;  2HDC A;  1DPR A;  2HOE A;  1F1Z A;  2ZJP F;  3CC2 I;  5DTD A;  5KHD A;  1HQC A;  2ZKZ A;  3LSH A;  2PLY A;  2LC2 A;  4LK1 F;  4KN4 X;  3A01 A;  1VQL I;  3CCU I;  2EFQ A;  3BPV A;  1MDM A;  5DUK A;  4RBO A;  2G9W A;  2OQG A;  4RGU A;  2PG4 A;  4P1W A;  1QNT A;  1KU7 A;  1B4A A;  2A69 F;  3L00 A;  1UZC A;  3MKY B;  4P9F A;  3IL2 A;  4A3F J;  1T8I A;  2DPD A;  4PCQ A;  3A0B C;  4R8H A;  1VFC A;  1CQT A;  5F1J A;  2QA4 I;  4U87 A;  4NDL A;  5TJJ A;  1RNL A;  4MFD A;  2OZ6 A;  5J6X A;  4IHY A;  2H27 A;  1YX3 A;  1YX5 A;  5JVT A;  1H88 C;  1IXR C;  2X4H A;  2H94 A;  1JKQ C;  3BG9 A;  2A6E F;  1HF0 A;  2COB A;  3OV8 A;  3CMM A;  2LH9 A;  1XDS A;  2CV2 A;  3SHF A;  1VND A;  1K6Y A;  5BPD A;  1X2N A;  1Y6I A;  1T56 A;  4G7H F;  2Y2Z A;  3I4N J;  4YFN F;  2M4K A;  3H36 A;  4HDU A;  1Z67 A;  2UZK A;  1AOY A;  1OQY A;  3O8G A;  3JAM Z;  3EUH C;  3ASO H;  3H35 A;  2CMP A;  1J59 A;  2A5W A;  2DFH A;  4XK4 A;  4WXD A;  2ELH A;  2FJ1 A;  3DPL C;  2RDP A;  2LVS A;  1T95 A;  4E7L A;  1NK2 P;  1VQ7 I;  3QPT A;  5ICF A;  1N25 A;  5TGT A;  3CUQ B;  4DBR A;  4KIG A;  3KP2 A;  4XLF A;  2FBI A;  2XGD A;  3M8F A;  1XGN A;  1KQ8 A;  2JRM A;  5M5X J;  3K70 C;  3RI4 A;  4K2E A;  3WHC A;  4BY1 J;  4I01 A;  4UB8 C;  3BR0 A;  2HDW A;  1TWC J;  1F36 A;  2RQP A;  3RJP A;  1YJN I;  2VBX A;  4AID A;  5J40 A;  4BKX A;  3BTJ A;  2W48 A;  4ZJZ A;  1OFC X;  1GT0 C;  1WJ5 A;  1S9H A;  1MBK A;  2VB6 A;  3HOV J;  2XV4 S;  1MZB A;  4BAY A;  3FMS A;  3VDX A;  4BQA A;  1OIS A;  3SFZ A;  1LFP A;  2RKH A;  3WU2 C;  4LMY A;  4XN3 A;  5DEQ A;  2P8T A;  1D1C A;  3BCB A;  2VOP A;  5FFX A;  4A3C J;  1TP4 A;  2IGN A;  4PGG A;  1ZR4 A;  3F0C A;  4G6D A;  3GFL A;  1KYZ A;  2EBI A;  3F9K A;  3E97 A;  4KMF A;  3ZMZ A;  2DMP A;  2DQL A;  1AKH B;  3QWL A;  1SVL A;  3GME A;  2K86 A;  5GAG J;  4EM1 A;  1K4S A;  2R7O A;  3H5N A;  3IP4 B;  4QSH A;  1JXS A;  2VQG A;  3DWL E;  3E7L A;  5D4R A;  3CCL I;  2CGP A;  2DLL A;  4XLE A;  2DPU A;  2O61 A;  4CCK A;  3CCV I;  4DBQ A;  3IUO A;  5F0H A;  1U78 A;  4HPQ A;  2MH9 A;  2QKM B;  1IC8 A;  2K5C A; 
#chains in the Genus database with same CATH homology
 2JT1 A;  2P5K A;  5L3G A;  1D3Y A;  2COM A;  1FBQ A;  4PDK A;  2OQR A;  4KA4 A;  4ZZD A;  1C0W A;  3ZPL A;  4R1H A;  4KIB A;  3G3Z A;  3ELK A;  1KQ0 A;  1Z7U A;  2KIM A;  3CJN A;  5LHH A;  3E3V A;  2IVM A;  2V79 A;  3K69 A;  3R4K A;  3R0J A;  1BM9 A;  2XKP A;  1U2W A;  4LLL A;  1EH8 A;  2GA1 A;  3LQQ A;  3ZN1 A;  1KYW A;  2GZW A;  4G7O F;  2HKO A;  2WC2 A;  1UB9 A;  1P4W A;  3DF8 A;  1TNT A;  1CF7 A;  4WCG A;  4UHT A;  3Q9V A;  2XRN A;  3HIF A;  1H9T A;  3RPQ A;  3GO5 A;  1R00 A;  4RGS A;  3RKW A;  3EQL F;  2QYO A;  3TO7 A;  4Y13 A;  5DCM B;  5BMZ A;  2PFB A;  3CUO A;  3HTU A;  2LF7 A;  1QBJ A;  3LWF A;  1SD4 A;  2FML A;  2DK8 A;  3K1M A;  3C7J A;  4HAM A;  3I4P A;  2O0Y A;  2E1N A;  5HS9 A;  1G3S A;  2VN2 A;  5L3B A;  2ETH A;  3WG9 A;  2DW4 A;  4ZYG A;  3MQ0 A;  2YX4 A;  1TLH B;  4A2U A;  1CGP A;  2HR3 A;  2H6C A;  1A04 A;  4XRF A;  2ZXJ A;  2L02 A;  2JTV A;  3R6S A;  1RZ4 A;  3L09 A;  3F8B A;  4OMZ A;  3KZY A;  3QOP A;  1DUX C;  1YIO A;  3KFW X;  3WOD F;  3F72 A;  3LA3 A;  2V1X A;  4HBL A;  3FXQ A;  1YTY A;  1D8K A;  4UV8 A;  2QWW A;  3T1B A;  1Z91 A;  4GYG A;  5LBQ A;  5HLH A;  3IKV A;  1JGS A;  2E1C A;  4L0Z B;  1W7P B;  1FSH A;  3WTV C;  2H09 A;  2GQQ A;  3VFZ A;  4HLX A;  1XSD A;  2Q8K A;  3KP3 A;  1WKM A;  3MCZ A;  1YLF A;  1LDK B;  5DD4 A;  2DAO A;  4KT5 C;  5E8G A;  3KP7 A;  1ZN2 A;  2DU9 A;  2HYF A;  2Z5U A;  2FA5 A;  4WX9 A;  4CZZ A;  3RTR A;  1IAW A;  4O6J A;  1H0M A;  4N0B A;  3ZMD A;  1S29 A;  2RN7 A;  4LFU A;  2A6H F;  3DFG A;  1Z6R A;  2HZT A;  4BH9 A;  5LHG A;  1HSJ A;  1R58 A;  3ISP A;  3WGH A;  4M6X A;  1QZY A;  4NQW A;  5LEJ A;  5HS7 A;  2FOK A;  2M8E A;  3KZZ A;  2CW0 F;  4DQ2 A;  1OKR A;  2BEO A;  2CQK A;  1YQA A;  4LGW A;  3ECH A;  2VXZ A;  4LB6 B;  1DPU A;  3I53 A;  3C1D A;  2OBP A;  3BY6 A;  4ENN A;  1LEA A;  5ICE A;  3KP4 A;  2B0L A;  4N9I A;  2MH2 A;  4WF2 A;  4A12 A;  1ZLJ A;  1TBX A;  3FM5 A;  2FNA A;  3BP8 A;  1O57 A;  1S7A A;  1P4A A;  4PGH A;  4M9X A;  4H0E A;  3L2C A;  2V1D A;  5JR3 A;  4Q47 A;  5L3E A;  4MTD A;  1H9G A;  4LD5 A;  1ZRF A;  1TQP A;  3TO6 A;  4LG0 B;  1XMA A;  4HX8 A;  5HDK A;  3COA C;  1T38 A;  1QZZ A;  4EVI A;  2NAZ A;  4EM0 B;  2OZU A;  4LB5 A;  4I0A A;  1XGS A;  2A61 A;  4ENM A;  3RDI A;  3O2P E;  2R7D A;  1ODD A;  3WGG A;  3ROU A;  2ISY A;  2CSO A;  3PQJ A;  3RYP A;  3GVA A;  3JTH A;  3O3K A;  2D1V A;  1J5Y A;  1OMI A;  1R7J A;  5DCF A;  4A6E A;  1FYK A;  1SD5 A;  2WV0 A;  2ZCW A;  3I54 A;  1R1U A;  1D5V A;  2DI3 A;  1FZP B;  2UWM A;  2HS5 A;  3Q5F A;  4ZZL A;  1ZYR F;  1UHM A;  5D5U B;  3LAP A;  4HF2 A;  3V4G A;  4FHT A;  5BS6 A;  4GGG A;  4EGY A;  3HRS A;  3U2R A;  4CIC A;  1QQI A;  3TOB A;  5CVI A;  4RGX A;  1FPQ A;  3MZY A;  5E18 F;  5ERI A;  4LK0 F;  1RIO H;  1BI3 A;  5HS8 A;  3V7S A;  2HEO A;  2X0L A;  2Z99 A;  3T8T A;  4BXU A;  4M72 A;  3FHZ A;  3W6J B;  3LAJ A;  4OIN F;  3K2Z A;  2QBY B;  3DPT A;  4OIP F;  5LGN A;  5E1Z B;  1GVJ A;  3F22 A;  4MEX F;  3QP5 A;  4M9Z A;  1F4K A;  2PMU A;  1O7F A;  3BRO A;  4LLN A;  1GXP A;  3F8F A;  1LB2 A;  3I59 A;  2NRA C;  1R22 A;  1EH7 A;  4MEY F;  3EET A;  2G7U A;  2XAS A;  1FBS A;  2RVC A;  5CLS A;  4RAZ A;  2ZNZ A;  1ZAO A;  1TW2 A;  5HVQ C;  4ESB A;  2MBF A;  2ZFW A;  1OYW A;  2Y75 A;  2MD5 A;  1T0F A;  1Z1D A;  1ZAR A;  1IN7 A;  2JPB A;  3HOT A;  3VB2 A;  1KQ9 A;  3JAM K;  5K5R A;  3BWG A;  4HV6 A;  4EQQ A;  3LA2 A;  4IHS A;  5J8F A;  3P9I A;  2ZME B;  3SQN A;  5IT3 A;  1E2X A;  1XSX A;  2O6G E;  5AON A;  4CXF A;  2IA0 A;  2EA4 A;  3ZMU A;  3SZP A;  1W7P D;  1XD7 A;  4FX4 A;  2AXL A;  3KLN A;  3RYR A;  4IRI A;  1XGO A;  5LEK A;  3EYI A;  1G6N A;  2P4W A;  3IWF A;  4G8X A;  4G9Y A;  2CWE A;  3GX4 X;  2FBK A;  1I1G A;  1BIA A;  1YS7 A;  4YG2 F;  1U6G A;  3REO A;  3IRQ A;  5AIP A;  2V1U A;  2IT0 A;  3RPU A;  5E20 A;  2C6Y A;  2GIV A;  1HKQ A;  2DK5 A;  2W84 A;  4M74 A;  4P5O A;  2KKO A;  3E5U A;  3V8K A;  3MAJ A;  3F23 A;  4UVA A;  1U5T B;  4B09 A;  4BHB A;  4OIQ F;  2L54 A;  3H92 A;  5L3C A;  5LRS A;  3BJ6 A;  5KVR A;  2XAG A;  3KEO A;  3VEP A;  3N4M A;  2FF4 A;  2PQ8 A;  3HOS A;  4ENK A;  4L9J A;  2PI0 A;  2A5Y B;  4XBF A;  3HSR A;  4R79 A;  4U7D A;  3G73 A;  2W25 A;  3F8C A;  2DTR A;  1P4X A;  3DP7 A;  3FWE A;  4YIF A;  3WE3 A;  5KK1 A;  3P7N A;  5JHU A;  5D5V B;  1TW3 A;  2XKO A;  3D0S A;  2PEX A;  1QPM A;  4GCV A;  3ULQ B;  5D5W B;  2BE5 F;  3NRV A;  4WXC A;  4MTE A;  3TDU C;  2GAU A;  2M45 A;  5K5O A;  2WTE A;  1IXC A;  2XVC A;  5K1Y A;  4CGZ A;  3RIR A;  1TQM A;  5K5Q A;  1O3S A;  3FZV A;  2VT3 A;  4XSX F;  4RS8 A;  1HKT A;  3E5X A;  5FB2 A;  4HDV A;  1T98 A;  4M9S A;  4EJO A;  3KE2 A;  1ZGJ A;  1YW8 A;  2O3F A;  1EH6 A;  2OD5 A;  4Y17 A;  1ZH5 A;  4EJV A;  1YW7 A;  3I71 A;  1HKS A;  1Z05 A;  5DCM A;  4BHP A;  1IW7 F;  5EEG A;  1F5T A;  4BYY A;  4XLP F;  3GXO A;  4N9H A;  1SFX A;  4UVC A;  1G3T A;  4M71 A;  1ZG3 A;  1IN4 A;  3M9A A;  1PDN C;  2FNP A;  5DV5 A;  4B8X A;  3F6V A;  3K0L A;  5CJ9 A;  2Z3Y A;  3V8L A;  1Q1H A;  3WTU C;  1O3Q A;  2PMH A;  3ZMT A;  4WWC A;  1WSU A;  3FXR A;  1G3W A;  2P6T A;  1TNS A;  3B73 A;  1HST A;  4A5M A;  2IW5 A;  1P2F A;  2HQR A;  4MQV A;  2YR2 A;  5JI6 A;  2D2W A;  4AWX B;  2LNB A;  5CVR A;  4KNY A;  3MWM A;  2JRT A;  3TO9 A;  2VT2 A;  4OMY A;  3HHH A;  4QLC U;  3BDD A;  1YO5 C;  4L0Y B;  1I27 A;  2EV0 A;  1LDJ A;  2QEN A;  4L5J A;  3E6C C;  2IPQ X;  1EV7 A;  2PBI A;  2K4J A;  1ZRD A;  2A3S A;  3SXY A;  4IHT A;  2OU2 A;  5D8K B;  1L0O C;  2L01 A;  3NQO A;  2GXB A;  1KU3 A;  1JHF A;  2V9V A;  3LA7 A;  1XMK A;  4WXH A;  1FP1 D;  1S6L A;  3BJA A;  5CVV A;  4MNU A;  1AWC A;  3IKT A;  4ESF A;  4MQ9 F;  1GHC A;  1O7L A;  4UVB A;  1Z6T A;  4RAY A;  4JBA A;  2V6C A;  1B1B A;  2QZ8 A;  2ZNY A;  2EFP A;  1T2K A;  1XB4 A;  4EM2 A;  2W85 A;  3GZ6 A;  3CO7 C;  2VE8 A;  4G6Q A;  4L9V A;  2P6S A;  1K78 A;  1OPC A;  3S2W A;  1I6X A;  5LRR A;  2NNY A;  4F7Z A;  1MJ9 A;  3ZP5 A;  2EV5 A;  1FBU A;  2FSW A;  1BC8 C;  1ONV A;  2XUB A;  5HOO A;  1ZGA A;  4Z2Y A;  3WE2 A;  5BQT A;  5A2Q K;  1DP7 P;  3T8R A;  1IRF A;  2LKP A;  2JZY A;  2XAQ A;  2EV6 A;  3QU3 A;  3GWZ A;  2EJR A;  1LNW A;  3EDP A;  3V7C A;  3VOE A;  4MGR A;  1T39 A;  1PP7 U;  2QVO A;  1SD7 A;  1U3E M;  1WI9 A;  4L18 B;  2AS5 F;  1R36 A;  1WWX A;  4BHC A;  5E1W A;  4KYW A;  4CDG A;  2VC1 A;  3W6K B;  4KIF A;  1YFH A;  4I98 B;  3HTS B;  3BJO A;  4IXA A;  1BJA A;  2P5V A;  4HW0 A;  2Z33 A;  1V4R A;  1BOA A;  5E8I A;  4I7H A;  3ECO A;  2FBH A;  5ICG A;  4LLG F;  1R23 A;  2K4B A;  3KCC A;  5A2Q Z;  2HGC A;  1XSV A;  3F6O A;  2RNJ A;  1XCV A;  2QM3 A;  4OIO F;  4ZYE A;  3FF5 A;  1U8R A;  1XCB A;  2QQA A;  1LQ1 A;  1W4M A;  1PUE E;  4ZYH A;  2Z9O A;  4BNC A;  2M30 A;  1JHH A;  2OA4 A;  2HTJ A;  4D0P A;  2CG4 A;  3GLX A;  2RGV A;  1FYM A;  3F21 A;  1SMT A;  1NHA A;  3Q9S A;  4HF1 A;  1BI1 A;  2CYY A;  3P9K A;  2Q0O A;  4WK8 F;  4A5N A;  5HLI A;  5F6F A;  3EYY A;  1R5G A;  3GEZ A;  2F2E A;  2GA2 A;  2KIU A;  1IN5 A;  5CVJ A;  4IPA A;  1D8J A;  1FLI A;  1IXS B;  1S8N A;  5ILU A;  2BGC A;  3HYI A;  3QP6 A;  5H6Q A;  1P92 A;  1ON1 A;  4KMU X;  1I5Z A;  2FMY A;  4S04 A;  3BZ6 A;  3FM3 A;  3I59 B;  3QRF F;  2HTS A;  2P7V B;  2QQB A;  3CLO A;  4HX4 A;  4NHJ A;  2LDU A;  2YSR A;  2EFO A;  1OR7 A;  3IWZ A;  1ZHF A;  2YPR A;  2H6B A;  4GXO A;  3BPX A;  1E17 A;  1MD0 A;  3CDH A;  1P6R A;  3HUG A;  3LQR A;  4KDP A;  3QPH A;  2HWV A;  3KP6 A;  3ZQ7 A;  2DT5 A;  1S3J A;  2Q2E A;  2ZME A;  2R3S A;  1IRG A;  3FMR A;  3MZH A;  1B59 A;  3K1N A;  5H20 A;  2K27 A;  3I0T A;  4HA8 A;  5L3D A;  5DUI A;  4I09 A;  3CO6 C;  1L3L A;  3R60 A;  2JPC A;  1W5T A;  2D45 A;  2ADU A;  2M1B A;  2ZJ2 A;  4A0Y A;  2DFI A;  3HSF A;  2O03 A;  1J0R A;  1V3F A;  1MJA A;  1ULY A;  2A68 F;  3TGN A;  3ZMS A;  3DXJ F;  1MDM B;  4RB1 A;  1STZ A;  4Q5S F;  4EV0 A;  3WTW C;  2P5L C;  1YYV A;  2ZBK A;  1T6S A;  4Q4Z F;  5L3F A;  5DD8 A;  3CUQ A;  3FXU A;  1U5T A;  4FT8 A;  4IVN A;  2MLG A;  5FD6 A;  4L5I A;  3I64 A;  3VOD A;  4XSZ F;  1IUY A;  1FNN A;  3HRM A;  1ZG1 A;  3F8M A;  1SAX A;  2XAJ A;  1ZG5 A;  1QO0 D;  3ERE D;  4P55 A;  1IN8 A;  3WTS C;  2A07 F;  3IHU A;  1RUO A;  3F3X A;  3T5X A;  2VBY A;  2Y48 A;  3NEU A;  2NNN A;  2HQN A;  4QWQ A;  2VE9 A;  2XAF A;  4L9T A;  3CTA A;  5ILS A;  3JSP A;  1IF1 A;  5BOX A;  2VOD A;  1ZLK A;  2DQR A;  2UXX A;  5LHI A;  1SFE A;  2MLK A;  3JSO A;  4ESJ A;  3DQV C;  1O3T A;  2VBZ A;  2XAH A;  4NB5 A;  3GF2 A;  2VOO A;  2D1H A;  5E1X A;  2KJC A;  3E6M A;  4IRG A;  4YII A;  1MKM A;  4IJA A;  3I58 A;  4S05 A;  2P7C B;  1W5S A;  3U9G A;  5ILV A;  2GXG A;  4PZJ A;  3MEX A;  3V7R A;  1KU9 A;  3I5U A;  3WTT C;  3LFK A;  2DO7 A;  1Z9C A;  4ETS A;  4GYI A;  1LEB A;  3GW2 A;  1Y0U A;  4ZYD A;  4OIR F;  4AVP A;  4U7B A;  3SZT A;  1LVA A;  1SMY F;  5DDG A;  4HYE A;  3WGI A;  1J75 A;  3J81 K;  3B02 A;  3E5Q A;  4M73 A;  4CO8 A;  3FX3 A;  2IA1 A;  4YFK F;  3OOP A;  1CF7 B;  1UHW A;  4O3M A;  4IRH A;  2MC3 A;  1USS A;  3HSE A;  3HRU A;  1QGP A;  5DYM A;  4P9U A;  3WU1 B;  2VBW A;  3TDZ C;  4AIK A;  4IF4 A;  4I0B A;  2HFH A;  2YU3 A;  2J5O A;  2FRH A;  4HF0 A;  2XGX A;  4UV9 A;  4E70 A;  4GO1 A;  3M8E A;  1S7O A;  2M87 A;  5HDN A;  3QU6 A;  2EA2 A;  2L4M A;  1WQ2 A;  1X3U A;  3K1P A;  1B9N A;  1SD6 A;  1O3R A;  2QUF A;  1ZRC A;  5IT9 K;  1HBX G;  5FLX K;  1IZ1 A;  4KUM A;  3EUH A;  2HYG D;  1W7P A;  1ZRE A;  1JE8 A;  2L4A A;  3TOA A;  3KLO A;  4EJW A;  1UST A;  3J81 Z;  1YW9 A;  1F9N A;  2K7L A;  2PJP A;  4O5V A;  2FQ3 A;  5AIQ A;  2FU4 A;  2FE3 A;  3R61 A;  4HOB A;  1BI0 A;  5JFR A;  3TQN A;  3HRT A;  2FXA A;  4HX7 A;  1XN7 A;  2NS0 A;  4UXN A;  2O8X A;  5CVU A;  3WU0 A;  4DNC A;  4HLY A;  1OYY A;  4EJU A;  1UFM A;  5BPI A;  1BI2 A;  5CYV A;  3ZN0 A;  4Y15 A;  1RUN A;  1R1T A;  2MA3 A;  3BOQ A;  4RB3 C;  4AD9 A;  3LST A;  4LJZ F;  2G7H A;  3FMQ A;  3V8J A;  3C3W A;  5IT9 Z;  3GZ5 A;  2BV6 A;  5FLX Z;  3PFI A;  2RC4 A;  1XGM A;  3WTY C;  3DKW A;  2VC0 A;  3AAF A;  1HW2 A;  5FO5 A;  3KEQ A;  2STW A;  3E6D A;  5FFZ A;  3ABT A;  4KN7 X;  5D8L B;  2GWR A;  4U0W A;  4XLN F;  6PAX A;  4HQE A;  2J5P A;  1LJ9 A;  1MGT A;  4U88 A;  1G4D A;  2CO5 A;  2KJB A;  2R7F A;  1K7A A;  1HW1 A;  2IJL A;  2LSO A;  3IC7 A;  5TRD A;  1K78 B;  5F1R A;  3U1D A;  1MJB A;  2YX7 A;  4HV5 A;  2L3D A;  2CFX A;  1HW5 A;  5F64 A;  4TV7 A;  2KRF A;  4JK1 X;  3GFM A;  2ZO4 A;  1FSE A;  2EFW A;  1HXD A;  1FOK A;  4LG0 A;  4EMS A;  2XRO A;  4KFC A;  1PP8 F;  2LF8 A;  3E6B A;  2K02 A;  1K6O A;  4A6D A;  3DV8 A;  2ESN A;  3WTX C;  4CYD A;  2HKX A;  1TQI A;  3DEU A;  3KP5 A;  2PN6 A;  5D5X B;  3TKY A;  3P9C A;  3H3Z A;  2F5E A;  2QLZ A;  5LGU A;  2W57 A;  4RB2 C;  2STT A;  1R1V A;  2E7W A;  3GYH X;  2OAZ A;  4A0Z A;  2QQ9 A;  4G7Z F;  4EGZ A;  4ZH4 F;  5D6E A;  2IRF G;  3N97 A;  3F8N A;  1LDD A;  3M7G A;  4M6Y A;  4ASN A;  2M5W A;  2W24 A;  4RB0 A;  4HZF A;  4P96 A;  2BYV E;  1BN5 A;  2EFN A;  3GFJ A;  4AIH A;  1FC3 A;  2F5C A;  4OOI A;  2FEZ A;  3L9F A;  4YFX F;  2WWY A;  2IA2 A;  2XHK A;  1B9M A;  2Y0M A;  5D4S A;  4HQM A;  4A0X A;  3KET A;  2XIG A;  3L7W A;  1REP C;  3CUQ C;  1U5T C;  3M1E A;  2UXN A;  5EEH A;  4UNO A;  2IP2 A;  4G94 A;  5ED4 A;  1KU2 A;  1R5H A;  3J80 K;  1I1S A;  2E7X A;  3O6B B;  2QBY A;  1KGS A;  5LLQ A;  4MHG A;  5ICC A;  5H6R A;  2VON A;  4I2O A;  2JSC A;  1IN6 A;  4CHU A;  2F5D A;  3JW4 A;  1FWZ A;  3J7A O;  3HHG A;  4Q48 A;  2EB7 A;  5D6F A;  1TTY A;  3T0Y A;  3ZMV A;  3H3U A;  1BBY A;  4I02 A;  4EJT A;  1J7K A;  3D5L A;  3QAH A;  1YG2 A;  2KIF A;  4ENJ A;  1B6A A;  3R0A A;  1BIB A;  3WTZ A;  3IRR A;  5E17 F;  4UUV A;  1FT9 A;  4FX0 A;  2DBB A;  3RKX A;  4ON0 A;  1J9I A;  1K79 A;  4RGR A;  4AIJ A;  1XDU A;  1OYI A;  2ACJ A;  2F5F A;  2EK5 A;  2BBY A;  3GUD A;  2RV8 A;  3GFI A;  5HDG A;  1FX7 A;  1UCR A;  4U0Y A;  1KA8 A;  4KIC A;  3J80 Z;  3K9T A;  3RKY A;  2NYX A;  2ESH A;  1VTN C;  1FP2 A;  1ON2 A;  1SFU A;  1BC7 C;  3C18 A;  4U0V A;  1GXQ A;  2EWN A;  1YS6 A;  4L9N A;  1G3Y A;  3ML6 A;  5LGT A;  1WRJ A;  4JQF A;  5FD5 A;  1J2X A;  3MFK A;  1FY7 A;  1RI7 A;  4OU0 A;  3ABU A;  5J8C A;  5FGM A;  3PQK A;  1FYL A;  5HLG A;  1DDN A;  2ISZ A;  2TDX A;  2HDC A;  1DPR A;  2HOE A;  1F1Z A;  1HQC A;  2ZKZ A;  2PLY A;  4LK1 F;  4KN4 X;  2EFQ A;  3BPV A;  1MDM A;  5DUK A;  2G9W A;  2OQG A;  4RGU A;  2PG4 A;  1QNT A;  1KU7 A;  1B4A A;  2A69 F;  3L00 A;  4P9F A;  3IL2 A;  2DPD A;  4PCQ A;  4R8H A;  5TJJ A;  1RNL A;  2OZ6 A;  5J6X A;  2H27 A;  5JVT A;  1IXR C;  2X4H A;  2H94 A;  2A6E F;  3OV8 A;  1XDS A;  3SHF A;  5BPD A;  4G7H F;  4YFN F;  4HDU A;  2UZK A;  1AOY A;  3JAM Z;  1J59 A;  4WXD A;  2ELH A;  3DPL C;  2RDP A;  3QPT A;  5ICF A;  3CUQ B;  4KIG A;  3KP2 A;  2FBI A;  3M8F A;  1XGN A;  3RI4 A;  4K2E A;  4I01 A;  3RJP A;  2RQP A;  2VBX A;  2XV4 S;  1MZB A;  4BAY A;  3FMS A;  4BQA A;  3SFZ A;  2RKH A;  4LMY A;  5DEQ A;  2P8T A;  2VOP A;  5FFX A;  4PGG A;  4G6D A;  3GFL A;  1KYZ A;  3E97 A;  4KMF A;  3ZMZ A;  2DQL A;  2K86 A;  4EM1 A;  1JXS A;  5D4R A;  2CGP A;  2DLL A;  2DPU A;  2O61 A;  1U78 A;  2MH9 A;  3JTG A;  1KQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...