4IX7A

Crystal structure of the insv-ben domain complexed to its dna target site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
114
structure length
114
Chain Sequence
DNVMVSIGPNNTCVPASVFENINWSVCSLATRKLLVTIFDRETLATHSVTGKPSPAFKDQDKPLKRMLDPGKIQDIIFAVTHKCNASEKEVRNAITTKCADENKMMKIQNVKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*GP*TP*TP*CP*CP*AP*AP*TP*TP*GP*GP*AP*A)-3'
publication title The BEN domain is a novel sequence-specific DNA-binding domain conserved in neural transcriptional repressors.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein/dna
total genus 36
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10523 BEN BEN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ix7A00
4IX7A 4X0GA
chains in the Genus database with same CATH superfamily
3LA7A 5BNGA 2VKHA 3HSFA 1SC7A 4LD5A 3S1NJ 4B3AA 2VQHA 2VKDA 5ICFA 5E1WA 1FTTA 1T39A 2R5YB 3R4KA 5DCMA 2BVLA 1IRXA 4ESFA 3I59A 3CF2A 3BR1A 2YSRA 3FK7A 3KEYA 4BL0B 1SD5A 1A5JA 1OKRA 2DMTA 4U0VA 4CCOA 3RKYA 4KMFA 3WTSC 3WGIA 1HOMA 2V26A 4H0EA 4ETSA 1MNMC 2IEKA 5CVRA 2WAQA 3KFWX 1RIOH 3KLNA 3OL4A 2R7FA 2NVTJ 3ZQGA 5D8LB 2E1NA 4BJ5C 1IN4A 1Z3YA 1IN8A 2ZB9A 3FMQA 3OYEA 5C3EJ 4L5JA 3D5RC 1Z1DA 4Y52J 1DP3A 1QU3A 3AG3H 3MCZA 2OA4A 3ECHA 3S14J 1GXQA 2F48A 5DD8A 2Q8KA 2BW3A 3C2HA 2CYYA 2Z5UA 3DBHB 4MNUA 1D5VA 1XDUA 3ABLH 4M6VA 4YEJA 1W4MA 1W5CC 3PL8A 4EQQA 4JX6A 1SVLA 4NNJA 4PFOA 3LAJA 2ZO4A 2KMUA 2XVCA 4PK4A 3J7ZI 4UUSA 2DFEA 3U1DA 2RREA 3OYFA 4BDZA 2ADUA 2PMUA 4NC6A 3HM5A 1POGA 2XASA 2A68F 1MMDA 5C44J 1MSFC 1BIAA 2PG4A 2R5YA 4EVIA 4IVNA 2KIQA 4D5CA 1Y1VJ 1ONVA 5F0HA 4CSWA 2RV8A 2R0QC 3QPTA 5CVIA 4G7HF 1FP2A 2X85A 3KCCA 3Q0VA 1BOAA 2XHKA 2P5VA 3JCUC 3FMSA 3BTIA 3C2BA 2CQKA 3IL2A 3CC7I 2E1MC 2GXGA 4H4KC 5ED4A 2WADA 3ZMUA 1XGSA 4CUGA 1ZREA 1ZH5A 2VBZA 1L3LA 3G73A 3NQOA 5FD5A 3RJPA 4RAFA 3HOVJ 3FXLA 2E35A 1ERDA 2RDPA 1DDNA 3HGGA 3LSHA 3AG1H 5E3MA 1TP4A 5DS9A 3O8HA 4R79A 3ZQFA 5J1RA 1RR7A 4RB1A 1XMXA 3K1MA 2VUMJ 1FIAA 3SZGA 1OCPA 3SFIA 4EJWA 4HX4A 3UKGA 1A36A 1HLVA 4XSZF 4BHCA 2X48A 2BBYA 3PO2J 2WWYA 4G94A 3E7LA 1ZGWA 1YX5A 2FBHA 1P9QC 4KT6A 4IHTA 4FE4A 2I5UA 3FDYA 4BS9A 2K3PA 3KEOA 2XROA 4LG3A 2V1UA 4RS8A 4RA2A 2EA4A 3G2BA 2VN2A 4CH7A 2WY8Q 3J81K 1UHMA 4P96A 4CYCB 3CCRI 4KUMA 2R7VA 3I56I 3PO3J 1ORKA 4Y7NJ 2DA5A 5J40A 1SD6A 1X1PA 2R7DA 4NUBA 3ZQCA 2OF7A 3D5LA 4IL6C 4E70A 2HU9A 1IW7F 1VQPI 5F27A 1ZGJA 1PDNC 3K6GA 4AWXB 5DEQA 2CU7A 5LHGA 3Q3SA 1Z9CA 3QYBA 1JT0A 3C2GA 4CCMA 4QTRA 2DQLA 4EATA 5HS7A 2E7WA 1WJBA 3H9GA 4KT5C 4Y4RA 1Z91A 5FFXA 3DP7A 5FKLA 4BE0A 1Y8RB 3FWEA 1ON2A 4HAMA 1H88C 3RCOA 1YOVB 2OJED 1LDJA 3ZQLA 4ZTFA 4PJNA 4A2UA 3I4MJ 1MBJA 1QZZA 3U9GA 3JR9A 1QHGA 3IKVA 2GWRA 2LP0A 3LSJA 3ZMZA 3JRCA 1PUFB 2D2WA 3CJRB 4L9JA 1VQ4I 1IG7A 5EDNA 2E7XA 2NS7A 3TMOA 1W0TA 3MZ8A 3R0JA 1GVJA 2VQLA 3IWZA 3BJAA 2MD0A 2CSOA 4YIIA 2ZKZA 5HDKA 1ON1A 3HG9A 4FX0A 4CICA 4BE1A 3RKXA 2FMLA 4I02A 1FMVA 1HSJA 4CYCA 1Z6TA 2DMNA 1XN7A 4Q47A 3HHGA 4B3XA 3LQQA 1XCBA 1ETKA 2HQ5A 4II3A 1ZTRA 3U1KA 1KGSA 3LSPA 3BG7A 4CCKA 1EV7A 3OYBA 4A3DJ 4C2MJ 2DU9A 3FM5A 3FK6A 2CRGA 4UV9A 4ZH4F 1W36D 3X2QH 2OC6A 2M4GA 3Q9SA 2IT0A 2M34A 1P6RA 3FBIB 5F6FA 2EV5A 2CQQA 3JRFA 3W6KB 1UHSA 1VZ0A 1R4NB 2EBIA 3L9FA 4BDYA 4XLNF 3TKYA 3V8KA 4DZJA 4XMYA 4PFPA 5GADJ 4EJVA 3ECOA 2EIKH 1ULYA 2HYJA 3T0YA 5LD2C 4M9XA 2FQ3A 3CCMI 3WG9A 1VQNI 3BTCA 1FPQA 3WTTC 2WY7Q 4HYEA 4UY8I 2NOJB 4BHPA 1M1EB 1I6XA 1MIJA 1HDDC 3I4NJ 1S7EA 1Z7UA 2DA6A 4BXFA 2UUZA 5K7ZA 2QBYB 3QYEA 2V9VA 1AWCA 1FOXA 3RKQA 3GLXA 2E2JJ 3HSRA 3BPXA 1HSTA 4Y17A 1XGMA 1UMQA 4U88A 3K9TA 5J4VA 3JRGA 2BY1A 3RIRA 1TNTA 4OMZA 3L2QA 1J7KA 3DKWA 1XD7A 4A3KJ 2LY2A 1VFCA 3FXOA 2QQ9A 3HTSB 2K27A 5J8FA 4CZZA 1UG2A 2ZBKA 1XSXA 2WV0A 3HOSA 1U5TB 4CGZA 3CO7C 3D1NI 1E0EA 3KP5A 2NS8A 3T5XA 4WWCA 1AOYA 1LFPA 2OU2A 4BKXA 2E1CA 4N9IA 1MMGA 3FXMA 1RNLA 5JFRA 2HDWA 2KIUA 3BROA 4PZJA 1VF9A 3S17J 1Q1VA 2KL4A 4KDPA 1LFBA 3L2UA 2FOWA 4GFBA 5K1YA 2NVUB 5EF6A 1NHAA 2OZ6A 2JWTA 4IQ4A 2PFBA 3Q0WA 4YRVA 4ZZLA 3PIOF 2WV1A 4E7ZA 1NG6A 3FXUA 1FY7A 1X1DA 5IP9J 4L5IA 4BBRJ 2ME0A 3WTWC 1FSHA 2H09A 2QBYA 3GXOA 2ZJ2A 3F8BA 3MN2A 1RKTA 4X0GA 1C0WA 2KT0A 3DQVC 1ZG5A 3RZOJ 2QYOA 4OU0A 1G59A 4LOCA 2ZMEA 2ZSIB 1BR4A 3QU3A 3GFMA 1BI0A 2HVQA 1JGSA 4MHGA 3OYLA 4IHWA 4RB0A 1K6OA 3AG2H 4OIPF 1YRNB 3PNYA 1P4AA 3K70D 4E7HA 2X1CA 4E4HA 2G9WA 3GBGA 4BXUA 3JREA 4ZYAA 1U5TA 2VBWA 3K4KA 4LG0A 1KA8A 3CDHA 1HKQA 4LFUA 2IA2A 3DBLB 2M2EA 3PSIA 2EK5A 2L02A 3GWZA 3VYRB 4CA0A 2X1EA 5B1BH 3EYYA 3VFZA 1JI8A 1VQMI 1WI3A 3TP0A 1J09A 2VKVA 2FF4A 4GGGA 5AONA 5E8IA 1SAUA 3G1LA 2DMUA 1FT9A 2KJBA 3QP5A 2DA1A 3MKWB 2M87A 1V54H 1UELB 2V1XA 3TO9A 1Z21A 2R93J 5FROA 4LITA 1FOWA 3M1CA 2HOTA 3OYCA 1Y6IA 5F1JA 4X6AJ 1U6GA 2ZJQF 4FCYA 4M71A 2FEZA 6PAXA 2OCEA 2WBMA 1YW9A 1TT5B 3PSFA 2QZ8A 2X51A 3E6CC 3GTJJ 3GZ6A 1EH7A 1YE9A 2TDXA 3MWMA 1QNTA 4FQGA 4V19K 1X3ZB 2LK2A 2P0WA 4JQFA 1YRNA 3S3OA 3DEUA 1LEAA 4E7KA 2BXZA 4XRMA 2IA1A 4WXCA 4EM0B 4OIQF 2OAZA 2LOOA 4ZTJA 2COBA 2WC2A 1LEBA 2MLKA 3DCFA 2DA3A 3ABKH 3DBRB 2QKLB 4DYQA 2IAIA 4IOAF 2VASA 3VODA 4RMNA 5EGOA 1IF1A 5IP6A 3R60A 2W24A 2GIZA 3FXKA 2VOPA 3M8FA 3BJOA 4HX7A 1BC7C 2ESNA 1B8IB 4FT8A 4AIHA 2X6WA 3WE2A 2W57A 1JGGA 3V7SA 4M9SA 4A3CJ 4IQJA 1G3SA 1JKRC 2K7LA 3WTZA 2TRTA 1W0UA 2M7AA 4RGXA 4XRFA 3KEQA 1ODDA 5F0CA 4BQOA 1LKXA 1MDMB 1VNDA 1LE8B 2L5QA 2MBFA 2RQQA 3HJEA 2ID6A 2CMPA 2MW8A 3QPLA 4IRHA 2JVGA 4KIGA 5FFZA 4HSRA 1TQIA 3GEZA 2DPDA 2K4JA 3COAC 3ZQHA 1XCVA 3M8JA 1PYVA 4O3MA 2ACJA 3GFLA 4RAGA 2IGKA 1WCMJ 3MKLA 5JLXA 2J5OA 1MJBA 1G8XA 1UCRA 4QIWN 1Z3XA 2DBBA 3M7GA 1CQTA 3AFHA 2HNHA 1IXRC 1EJ9A 4IF4A 3E0JB 3CCVI 3BP8A 4OWRB 3UR3C 5DM7F 2KFDA 2PN6A 3JRIA 1AKHB 1KZHA 4HRIA 3C3WA 3HOXJ 4RAZA 1QHHD 3SEQA 3MAJA 1U5TC 3V4GA 2OPTA 1LUJB 5BMZA 3OYIA 2FXAA 2H1LA 3RQIA 1HW1A 3HOZJ 2DJIA 3NAUA 3QODA 3VYSB 3HEFA 1B8IA 2VJJA 2F5CA 2PMHA 1VQKI 4XOTA 3SDBA 4IHSA 2R7TA 4E7JA 3H92A 2VE8A 3DLAA 4G6DA 1D5YA 2BZTA 2M1BA 1D3YA 4PDKA 1BI1A 1NTCA 1QVUA 3F8FA 3TO6A 3CQZJ 3ZMSA 2IPQX 2IS2A 3K69A 3BG5A 4Y33A 1MDMA 1K4SA 1LE8A 3E97A 4AC0A 2LVSA 4WCGA 4XLCA 1PP7U 3JAMK 2A05A 4S04A 1VQOI 2V6EA 2KZVA 1F36A 2XGCA 5DDGA 2BY3A 2BE5F 4P9FA 4ANJA 2ZFUA 3T8RA 4M3GA 1WI9A 3DXJF 3LA2A 2EA2A 4EJUA 1RRJA 2H94A 1QBJA 2HFHA 3F6VA 2QQBA 2W82A 2XGEA 1WJAA 1LVKA 3DU6A 2OZUA 3FISA 1R6RA 4LK1F 3BWGA 1JUPA 1HKSA 1FMWA 1U8RA 3W6VA 4G7OF 4HQEA 2LFBA 1TLHB 1LNWA 1MBKA 2JRMA 1FYMA 2KKOA 1OYYA 1B59A 3EQLF 2CW7A 3KETA 1X58A 4IOCF 1D1AA 2VIXA 1PJRA 4BQAA 4RB2C 3J80K 3I53A 2DFFA 4EJOA 3G1OA 1LJ9A 1H89C 4NHJA 5FO5A 4G12A 4XK4A 2KHMA 1OPCA 2LKXA 3SXYA 1TBXA 4HW0A 1R23A 2FJ1A 1I3AA 4LMYA 3SEZA 1S5LC 1FBSA 3BC8A 2M0MA 4BQQA 1KQ0A 3MZHA 1UHWA 4B47A 4D1QA 2UZKA 3K1PA 1XX5A 3KYCB 2GXAA 1UG0A 2VJ4A 3DFGA 4FTHA 2DA7A 2KQRA 4AUXA 1SVOA 1P4XA 3ZR8X 1DPRA 4P1WA 2Q1ZB 3HL2A 4IO9F 4BJTA 2ISZA 4XIDA 3IKTA 3PFYA 3UNGC 3ZMVA 3VWBA 1UZCA 5CJ9A 2B0LA 2DFHA 4LIUA 3OSGA 5J6XA 1OLTA 2M4KA 1RI7A 3RTRA 1V5FA 2O8KA 1V5EA 1B1BA 1R4MB 2FA5A 3CDLA 1G2HA 4XKBA 2R3SA 2V6CA 4A3MJ 2UV1A 1TT0A 2X6XA 4S05A 3OMYA 2LF8A 1EKEA 5LRRA 5H6QA 4M3FA 5BPDA 2IGNA 1R49A 4PUSA 4L0ZB 1MMSA 2LTPA 4RDUA 3VSLA 2DK8A 5JI6A 3VPRA 4YG2F 1HQCA 3KPHA 3BPVA 2XAHA 2G7HA 3HOWJ 1J59A 2GOMA 2QLZA 3FXQA 2JZYA 2K5CA 1TWCJ 2JVHA 3CCEI 1W7PD 1WKMA 5F0FA 3EYIA 4F93B 1QO0D 5D5UB 2EJRA 3KZYA 1OQYA 2GBYA 4OAYA 3BCAA 2Y75A 3KYLA 3C1DA 4A3EJ 3K7AJ 5GTHC 1R9TJ 1O3RA 1SFXA 2ECBA 3BTLA 3M1EA 2E36A 4BY7J 3CCJI 3GTLJ 2GAUA 5L3GA 4QPQA 4EMSA 3B6AA 1EH8A 3L09A 2COMA 5JHUA 4ENKA 2WAQN 5AIQA 2IS1A 3LSMA 2NAZA 4A3FJ 5IOZA 2XGDA 4F55A 3M4OJ 1ZARA 1QA6A 2IJLA 1D0XA 3CCYA 5FLXZ 1F43A 1BR2A 3A01B 2HVSA 3BLYA 3S3NA 3R61A 2X1DA 2Y48A 3IHUA 3G1MA 2CUEA 3RKWA 4M6YA 1S7OA 3BOQA 3GFIA 3LSRA 1N78A 2PX9A 1KU9A 3LSGA 4A69C 1DPUA 1MMAA 3HRMA 4DW6A 3CD6I 3BZCA 3SZTA 3RPUA 1TQMA 3E5XA 4KNYA 1T95A 5JVGF 1MGTA 2P6SA 3P9IA 4BBSJ 2JA6J 3HYIA 3CO6C 5J47A 1HA8A 4L0YB 1U3EM 2MSYA 1Y0NA 4BNCA 1Z05A 5BQTA 5B66C 1QVTA 1X3WB 5LHHA 2KDOA 1P7IA 2L7KA 4L9NA 1LB2A 2QVOA 2D1HA 2OTJI 3F21A 1CF7B 2JSPA 2HOAA 2YX7A 3LSKA 2Y9YA 5D8KB 1X3UA 3PNVA 1IDZA 4IZZA 2GLOA 2VE9A 4R8HA 4GO1A 3BZ6A 4N9HA 1D0YA 1OYIA 3V7RA 2YS9A 4FETA 4ZZDA 1S6LA 5LFAA 4DYCA 3F8MA 2R7SA 4I2OA 2JPBA 2M5WA 5GAHJ 2K9MA 4OOIA 2VQGA 4KA4A 4XRSG 3E3VA 3RYPA 3NRVA 1ZRDA 5FKMA 1RC9A 4ABZA 2GIVA 2YUSA 2DA2A 2XSJC 4MO7A 1F9NA 2DFIA 1ZLJA 2EIMH 3B6CA 3HUGB 1JUSA 1J5YA 2F5VA 3ZXSA 2MFZA 3WODF 1ZK8A 3F9KA 3BT9A 2I10A 4A12A 4XONA 1KU2A 4I0BA 4WK8F 4KFCA 2R7WA 5D4RA 4B1RA 2Y9ZA 2YR2A 4UUVA 1IRZA 2OUMA 1HKTA 1T56A 3TDZC 3T8TA 4D0PA 4CXFA 5TJJA 5JHFA 3WU0A 2CFOA 1PUEE 3KP7A 1REPC 4RLFA 4KN4X 2XAQA 2VL8A 4LB6B 3JSPA 1WHUA 4GRIA 2CGPA 1ZG3A 2A07F 5J4YA 3CZ6A 1WRJA 2DQRA 2AXTC 5F1RA 2K3FA 3IP4B 1YIJI 3BQYA 3WHBA 3EUKL 3K70C 1K61A 2C6YA 1BC8C 3A03A 2PJPA 3KE2A 2CW0F 3F22A 4IJAA 4BQNA 1YX3A 5D5XB 5H6RA 5D5VB 1WH5A 3GLLA 3VYUB 1BR1A 1YLFA 2HGCA 3K1NA 1K83J 1R71A 2JRTA 1S8NA 2RC4A 1ZRCA 3HUGA 3LFUA 3FHNA 2MD5A 3GZ5A 1YS6A 1G3TA 3TQNA 2AXLA 2H6BA 4U0WA 4M72A 2PJRB 4EEFG 3PM1A 2CUJA 3K0LA 3MQ0A 1WVRA 4PJJA 3S1QJ 2M0CA 5LLQA 3W3CA 1YFHA 3CLOA 1LDKB 1T8IA 3OYDA 1T0FA 5H20A 1FIPA 5F64A 5DUIA 5ICCA 4YFXF 1QZYA 2CFXA 1MKMA 5L3DA 3H5AA 4RAYA 5M5XJ 4E7LA 2BHYA 5A2QZ 2X4HA 1FWZA 1WWXA 3ZCOA 1OFCX 2JJ7A 3IAM2 4A0YA 1YIOA 5J8CA 2DT7B 2CG4A 1LFUP 2K40A 4XNFA 4XLFA 2Y0SA 3IRRA 4IRIA 3BZKA 3KIOA 2DODA 3OIPA 2O61A 5B5EC 3CMAI 2VPRA 2R7XA 2E2IJ 4GYIA 1YJWI 2ZXJA 5BPIA 1IGNA 3CMEI 4HLYA 4IXAA 4I0AA 3FM3A 3S2HJ 4K2EA 1KONA 4HV6A 1SFOJ 2ESHA 1IV8A 3DKYA 2DYSH 3SHFA 4BHBA 2HTJA 2NVQJ 1H9TA 4B09A 1PUFA 1U9NA 2NYXA 1I1SA 2X6YA 1XB4A 2PJRA 3KZIC 2V1DA 3I55I 4FX4A 4F92B 4I98B 4LB5A 1X2NA 1CGPA 2CJJA 4KJZA 3MMYB 3K2ZA 4LJZF 3A0BC 1N77A 2DMQA 4U7BA 4E6KG 2FSWA 1T08B 1WH7A 2CQ7A 2AS5F 2QF7A 5IT9K 3PJRA 2EWNA 3ZQQA 4B4CA 4C3JJ 2DLLA 2CV0A 3F6OA 1NH3A 2W4SA 2EFOA 1K78B 5HNHA 2A5YB 4DZPA 5E1XA 5K7FA 4TV7A 1XPXA 2RAEA 4QWQA 5E79C 3JRAA 2VC0A 4HQMA 2NNYA 2W48A 3MFKA 2JA5J 2ID3A 2P5KA 2Q2EB 3V42A 4JP0A 5CVUA 4UHTA 3NEUA 5E8GA 3LFKA 2Z1DA 4CDGA 3JTGA 2AQEA 4MTEA 1BW5A 3MZYA 2F4MB 1TW2A 4ZYHA 5IYDJ 2Z3YA 4HF0A 4G6QA 4HF2A 2XKOA 1U78A 4I76A 4DBRA 4MTDA 3NWSA 1IO2A 4AYBA 4ENJA 2L9VA 3L2RA 4PSXA 4AYBN 2DMPA 4ITVA 4Q48A 3F23A 1WZ2A 2IS6A 3ZN1A 5CKTA 3QOPA 2A69F 1JT6A 3DV8A 3OYGA 1TWGJ 1MBGA 5HDGA 4UUTA 2JA2A 5HOOA 2FQ4A 1IXSB 2E19A 4LK0F 4PSWA 2W7NA 2P81A 3BQZA 2JA7J 1Y0UA 2L0KA 4M3BA 4IKFA 2L2OA 1QPMA 1T0FC 1JKOC 4YIRX 4MFDA 3EETA 1F5TA 4ENMA 3BR6A 3ZQ7A 2XAJA 3AAFA 2EINH 5DCFA 1XDSA 1V55H 3BY6A 1K78A 2JTVA 3O8GA 3OS0A 4HX8A 1V3FA 4BUPA 4U0YA 3E6BA 5HLGA 4XLEA 3FXRA 2LDUA 2UXNA 1D8KA 3L7WA 1GDTA 1MD0A 4C3HJ 1U2WA 2Q2EA 2ZSHB 2DCEA 4FE7A 2HDDA 3H5NA 3L2CA 4PGHA 2BEOA 1ZKGA 1TTYA 2K9SA 2O0YA 2DYRH 1NK2P 1KYWA 2EFQA 2PBIA 5CYVA 1KQ9A 2VT3A 3IC7A 5K5OA 2LY9A 5CPRB 4CZCA 4LIVA 1UAAA 1BBYA 1MZBA 3CUQB 4JX4A 3S32A 4AM3A 4J01A 4DOZA 3P5JA 3G71I 5FB2A 4F3QA 1LDDA 3OSFA 2IA0A 2OD5A 2JUGA 1HDPA 1FX7A 4DQ2A 4ZDOA 2FNAA 3E5UA 1D1CA 3GVAA 5FJ8J 3J81Z 4J19A 3OYMA 2JUCA 3I54A 1DU0A 3IRQA 2BGCA 3LL7A 5E3OA 3HGYA 2STWA 2ZJRF 3RSNA 5L3EA 3A0HC 2F2EA 3CESA 2VBXA 1W1WE 4ZYEA 3D0SA 3WGGA 5CVVA 1T6SA 3IUOA 3G3ZA 1O7LA 3TGNA 5HS9A 1PP8F 4EM2A 1QQIA 2K9NA 1IRFA 1HW5A 2GQQA 4FISA 1WFXA 4NB5A 2LC2A 2X9DA 2M7BA 1ITYA 3OR1C 1Z0XA 2M8GX 3GTMJ 4PJMA 1MBEA 2LNBA 1Y56A 1AHDP 3FF5A 4XSXF 4DJAA 2BV6A 3ERED 2XAUA 3LQRA 2VC1A 4NQWB 4C3IJ 4BE2A 5FKNA 5AIPA 1Z6RA 2VONA 3CCLI 1BA5A 4LLNA 4G6TB 3O2PE 4G9YA 2L4MA 2H8RA 1X4OA 3VYTB 1D1BA 3CDIA 3CUQA 5E17F 5M3FJ 1OCTC 2KJCA 4DYRA 3SFZA 3VSKA 4DIQA 3M07A 3TP3A 1OCRH 1BI2A 1R00A 1TNSA 4MQVA 3OIQA 3DEEA 5KCMA 3H0GJ 3GW2A 1DP7P 2RN7A 3G4SI 1FBQA 3A1YA 2K02A 2LR8A 3DU5A 1VQ5I 2W85A 2LSOA 4X1EA 1Z77A 1TWAJ 5EZHA 3OS2A 3H9QA 4NC8A 5J1UA 3PUFA 3WG7H 4W97A 2HOEA 1SFEA 3F8CA 4RM2A 4BACA 2DOFA 2HKOA 2DDBA 3B73A 3BR0A 2A6TA 4KMUX 3A2KA 2IGOA 3I58A 1Y39A 2KRHA 2F5DA 1MNDA 3FKJA 3WGHA 3N05A 1U0JA 4ENNA 3WTUC 2EZIA 4HLXA 4HA8A 4N4OB 4PCQA 2DOEA 2LF7A 2K85A 4GYGA 1R1TA 2EFNA 2A6HF 4BU2A 1FBUA 4NQWA 2IS4A 2F5FA 3HZJA 2LRDA 3WU1B 2BVMA 1OYWA 4LLLA 3FX3A 1WSUA 2LKPA 2DA4A 5GAEJ 4HDVA 4RM3A 2XSDC 1A6QA 3ABMH 2E34A 3W2AA 4QSHA 3KYDB 4I6ZA 1X1CA 3I64A 1XS9A 2W1OA 2OTLI 1TQPA 1WPKA 2R7UA 1SAXA 4BGDA 1FLIA 4A3IJ 3NWTA 4HPQA 4XM3A 2LMDA 2A61A 2JT1A 2FUG2 1IUFA 1SANA 4ESBA 1FSEA 5ERIA 2P7CB 1TWHJ 2ELJA 1EH6A 3A4CA 4KISA 4YFNF 3S15J 2ZC2A 1J75A 2NS0A 2QUFA 4IEJA 3ASOH 4PJ0C 1H9GA 5CVJA 2CUZA 3K2AA 5CQEA 3NARA 4A93J 4KIBA 1OMIA 1TL8A 4AVZA 1MBHA 4UNOA 3CJNA 4L9VA 2HEOA 1APLC 3RQ4A 3RI4A 1NK3P 1MH3A 5EEAA 3OS1A 1B72B 4C9YA 4QPOA 2P6TA 5DTDA 2E5ZA 5C4JJ 3TEDA 3HHHA 4BEHB 4OMYA 4MQ9F 3I0TA 1AKHA 2BY2A 1P92A 1WGXA 1V5GA 2W00A 4OAZA 1P7JA 2QSFX 4JX5A 2XC7A 3MVPA 2VJIA 4EGYA 1WQ2A 4ASNA 2V1NA 2LY1A 4V2GA 2HYFA 1R1VA 5KVRA 1YS7A 2G0EA 2HQNA 4Y3OA 3BR3A 4M3DA 4MGRA 3DWLE 5M5YJ 2QA4I 5TRDA 1T38A 5EYRA 2ZXWH 1XMKA 2QEXI 1HXDA 4U7DA 2VJ5A 3L00A 2CV2A 3VOEA 4NDLA 3LWFA 1IAWA 4DBQA 2VI6A 3CUQC 1V4RA 1DUXC 5GPCA 1UJ8A 3I9V2 2HTSA 4RGSA 1UFMA 5ICGA 2L01A 2KRCA 2YU9J 4Z6YA 1FC3A 1FEXA 4HBLA 2IW5A 3S93A 2XF7A 2DN0A 1YG2A 2DXIA 1OCOH 2LG4A 3ZOBA 3S3MA 2M9HA 2KP6A 5HS8A 1ZLKA 2AHQA 5E18F 1VQ9I 1BM9A 2GA1A 3IWFA 1ZAOA 1I1GA 3F0CA 4HEA2 4M73A 4XORA 4XKWA 4Y13A 3JRDA 2RKHA 1FZPB 1D0ZA 5F04A 3GFJA 3KLOA 3WE3A 2BHZA 1JKQC 3CC2I 1YYVA 5EZGA 1B72A 3KX2A 1P2FA 1Q1HA 2HXOA 1G4DA 5L3BA 1A04A 1MMNA 5L3CA 1RKWA 4BEHA 1R7JA 1O57A 3OWTA 1AU7A 4IHYA 1FOKA 5JR3A 2I8DA 3P9CA 4GCVA 2V79A 3S8PA 2VXDA 5FLMJ 3OY9A 3SQNA 3REOA 2F6CA 2XIGA 1S3JA 3CP2A 1B9NA 1OCZH 1X19A 4WXHA 1U8BA 1W5SA 1JKPC 3I71A 3EUAA 2MH2A 4MLOA 5KK1A 2Z99A 4HNTA 3LNQA 1IDYA 1VQ7I 3JSOA 2DI3A 1O4XA 3GX4X 5LGUA 3IV5A 1IXCA 3TOBA 2KLOA 1MJAA 3Q9VA 2ZNYA 4A3JJ 4W1UA 2R5ZB 1BJAA 4XN0A 2FX0A 3K4BA 5FRNA 1ZGAA 4V2FA 2MLGA 3GCMA 4FASD 5B1AH 2V7FA 2HQAA 3J7YJ 2L3DA 3FMRA 5BOXA 2RGVA 4ON0A 3VB2A 2QCOA 4GXOA 4DGWB 3L2VA 1G3YA 4AU7A 2ZJPF 1W36C 3CJQB 1XTAA 2FD5A 5DM6F 1JHHA 1Z7LA 2H1KA 2FMYA 1JHFA 2MABA 2JN6A 4UVCA 2NNNA 5E3LA 4ZDLA 2A6EF 4ZC3A 5LHIA 2MC3A 2L7MP 3QYFA 4IX7A 4E7IA 1EA3A 2E5NA 3L1PA 1X4PA 4HOBA 3ZN0A 5GP9A 3ML6A 3OYHA 1HF0A 4WXDA 1BI3A 3I5UA 5TGTA 3BCBA 2KPMA 1STZA 2UXXA 3KP3A 5CQGA 5D6EA 4S0HB 3Q5FA 5IY5H 1SEUA 1JJ6C 5ICEA 1HW2A 2JSCA 4O5VA 2VOOA 3A02A 4I7HA 3MEXA 2GM4A 1IN7A 5H2FC 5ILUA 1ZR4A 1K4TA 5KNLA 2DT5A 5HVQC 4P9UA 2STTA 2B63J 5IYBJ 1GV5A 4EV0A 2O5RA 2CH0A 3LSIA 2EQRA 2R5ZA 4B43A 2RQPA 1ZR2A 2NXNB 2QGUA 1IJWC 4XOPA 4DNCA 2IP2A 4PJLA 2PEXA 3BDDA 3S2WA 3GTPJ 4ZYGA 2HPIA 5IYCJ 1FTZA 3Q0UA 2DJNA 2PQ8A 4HNVA 2L9NA 1RUOA 1ZELA 2MGQA 4XICA 3GMEA 1OJLA 3A01A 2A5WA 5ILVA 1I27A 1GLNA 4YELA 3W6JB 1FP1D 4AD9A 2DK5A 3I4PA 3KZZA 3OYJA 1X2MA 2BOLA 1W5TA 3ZMTA 5EJCA 3RYRA 1N75A 3HKZA 2ZCWA 5ILSA 3HKZN 2DW4A 1GVDA 3PUBA 4M74A 5E20A 3OIOA 1MW7A 5FKOA 3HRUA 3DPLC 5FGMA 4D9JA 1WJFA 2FBIA 1RESA 2QKMB 4I99C 2L7FP 5LGTA 1IUYA 5CLSA 3OR2C 2VODA 1FYLA 2K86A 4RGRA 1KU3A 2BYVE 2NRAC 4JOMA 2DTZA 2GOXB 4MIMA 1JE8A 4AIDA 1A31A 2DPUA 1CF7A 2CQNA 2QQAA 1BOBA 3JAMZ 3R6SA 1O3QA 1VQLI 3AL0C 5KHDA 3DEWA 3H35A 3ZRGA 3SDGA 3O3KA 2IBDA 2JK3A 2PMZA 2WTEA 1TWFJ 2HI3A 5BS6A 2PMZN 2W25A 1JUMA 1Y8QB 3LA3A 2BY0A 4L18B 4B44A 4J00A 2KIFA 3LMMA 4KN7X 3U2RA 4HF1A 3CJTB 3DLLF 3WTXC 3F8NA 4XL9A 4BYYA 1R36A 3J80Z 4D7MA 3HOYJ 5EEGA 3LSTA 3HSEA 4Y15A 4BAYA 3CCUI 1WJEA 1J2XA 2KRFA 3FKIJ 3N97A 4EM1A 3KP6A 2O7OA 5FD6A 1G6NA 3RDIA 4U87A 1LVAA 4I09A 2ZNZA 3CLQA 1GT0C 3K4LA 5EEHA 4XKCA 3WTYC 1VQ6I 5D6FA 3B02A 2R7ZJ 4QLCU 4G8XA 3FZVA 1MH4A 2HWVA 2OCCH 1KYZA 4XLHA 3PIPF 3GTQJ 1VI0A 2CWEA 4JK1X 1DQUA 1R5ID 3OYNA 1E3PA 2IVMA 3VDXA 2CV1A 4B8XA 3F3XA 1I6HJ 3PQKA 2EILH 1QZEA 2F4IA 4A5MA 4A0ZA 2L9RA 2QWWA 4XQFA 2V9PA 3CMMA 1K7AA 1EF4A 2QQ8A 3EPZA 1G3WA 2ETHA 3HDDA 1GHCA 5K5RA 4WF2A 2Y0SN 2ELHA 2HXIA 2RNGA 2J5PA 2O6GE 2IGMA 4XKVA 1IN6A 1HBXG 1SMTA 2HOSA 5JLWA 3HRTA 2FOKA 2ZXIA 2QENA 2DTRA 2R7QA 3QQAA 3BG3A 4UB8C 1E2XA 4YFKF 5HLIA 1YO5C 4CO8A 2YPRA 5IT3A 3OV8A 1RZ4A 2E71A 3U21A 1W7PB 3K4JA 3J7AY 1YQAA 1HCRA 4ZJZA 2EB7A 2O3FA 3M8EA 2BXYA 3H3ZA 3WTVC 3ULQB 1ETVA 1XC5A 1BW6A 2D1VA 2EIJH 5FKKA 3DPUA 2DOAA 3E6MA 2KIMA 1MJ9A 1KQ8A 2NVYJ 3GZNB 2M8EA 3PQJA 3CCQI 2L7ZA 4A5NA 2JA8J 3GTOJ 2XV4S 1MNEA 3ERMA 1ZN2A 2R7OA 2VLAA 2K4BA 2QM3A 5EG0B 1IV6A 4C2UA 4UVAA 2XPVA 2JPCA 3M3YJ 3H1CA 4IPAA 3R0AA 1LPQA 2VT2A 4R1HA 2ELKA 2WB1A 3M9AA 5IP7J 2WB1N 3SJMA 1RUNA 3DKXA 4P55A 2LKSA 3HOUJ 2HDCA 1ZRFA 5D4SA 4D7NA 5IOYA 4NC7A 2Z2SB 2MYSA 3C18A 3SZPA 5HNFA 1XSDA 2O03A 2FE3A 2B9SA 2ZMEB 3ZP5A 1BJZA 3D5SC 2R4GA 2R7RA 2XPUA 2F4OB 1OISA 4KITB 3HC7A 1W7PA 4HSTA 1GV2A 1U9OA 2ME6A 3C7JA 2CS3A 1SD7A 1BN5A 2ZXHA 1JTYA 3KP2A 4OINF 2AQFA 4UXNA 3MKZA 1YTYA 4LG0B 3VEPA 1SMYF 4CCJA 4A6EA 1ETOA 2LH9A 3K4MA 1JXSA 2HPMA 5GTIC 1QRYA 1N25A 4YIFA 3H9JA 5J1YA 2HYGD 2WA0A 3TW6A 5HODA 1LQ1A 4M6XA 4P5OA 3EUHA 3RPQA 5EG0A 2XDVA 1ETYA 1USSA 2TCTA 4RLQA 4BXXJ 4F91B 1B9MA 3JRHA 4BY1J 3JRBA 1YW8A 2N8GA 3QU6A 1VTNC 1JJ8C 1FNNA 2GXBA 1ACIA 2K9QA 2ICWG 4OIOF 3ABTA 2MC4A 5M5WJ 1S9HA 2Y69H 1WJDA 2QSHX 3E6DA 1NG7A 4L9TA 2CO5A 3ZQIA 5L3FA 1OCCH 1TW3A 2X6OA 4BH9A 4LGWA 3P7NA 3HTUA 2VBYA 3OYKA 5DUKA 3E5QA 2XB0X 3WHCA 4E7SA 3TBIA 4EGZA 2FBKA 2XF6A 3CF5F 2HZTA 5HDNA 4XBFA 1IZ1A 1XSVA 2PLYA 3DF8A 1R5GA 3QPSA 5DV5A 3HB9A 2XKPA 4XLAA 1GUUA 4I01A 4Q4ZF 4FHTA 3W2WA 2L9SA 3PNTA 1WJ5A 4M9ZA 1A35A 5EGOB 2HS5A 1RETA 3BTJA 4II2A 1J0RA 1I3QJ 2EV6A 3CTAA 1YHQI 4GDFA 1IN5A 3IAS2 1F1ZA 2D45A 2VQCA 4KICA 1E3OC 3ZMDA 3S2DJ 4M3EA 3GF2A 4ZDPA 2ISYA 3ASNH 3RPUD 3TW7A 3GTKJ 3QOEA 4XN3A 4A6DA 2JQ7A 1I50J 3HPGA 1D8JA 3OYAA 3J7AO 2H27A 4AVPA 1K79A 3BR5A 1SD4A 2WAEA 5GAGJ 1RR8C 2P5LC 3BJ6A 4Z2YA 4C30A 4CYDA 2HKXA 2EFWA 1Z67A 4AIJA 2CUFA 5D5WB 2FU4A 4JBAA 1TZLA 3HOTA 4O6JA 5LEKA 2HR3A 5DYMA 1OR7A 1X1AA 3SYTA 4B48A 2X0LA 3W2VA 1USTA 3QRFF 5FLXK 3H0DA 4ESJA 1VQ8I 2VKEA 4MEYF 2UWMA 1J9IA 2R92J 1MBFA 2Q0OA 4AIKA 3QAHA 2VPLA 3DTEA 2LLKA 4NBQA 3HBLA 5DD4A 2JMWA 1S7AA 5E3NA 1JTXA 2OBPA 2NVXJ 3IH2A 4A3BJ 5KAIC 5HLHA 3N4MA 1KU7A 2LD5A 1ZHFA 2PI0A 2GA2A 1F4KA 4RGUA 4WX9A 2M30A 2O8XA 3OOPA 1SFKA 1B6AA 1R1UA 1DGWY 5F08A 1ZYRF 3ZGKA 3I3LA 3BG6A 3FXJA 1L0OC 4A3LJ 2Y2ZA 3ABUA 3JTHA 1ZQ3P 1YJNI 3ROUA 3EUHC 1FOYA 4IRGA 5IPAA 2P7VB 3H36A 4D5FA 1XGNA 3CCSI 3BG9A 4IHXA 2DT6A 5J3LA 1T2KA 3CUOA 2QSGX 4L5EA 2IRFG 3AG4H 2LREA 3CC4I 1DU6A 1I39A 3ISPA 3DTIA 3PFIA 1UB9A 2Y0MA 4C2TA 3RZDJ 2Z16A 2MH9A 3H3UA 3V7CA 2YU3A 2EPFA 1O7FA 2XAFA 3KP4A 1ETWA 3H5RA 2YX4A 4EJTA 2HZDA 2AO9A 2EFPA 1BL0A 1SVMA 2FRHA 1I5ZA 1YJ9I 1H8AC 2ZMEC 1ETQA 3DPTA 2CQXA 3TOAA 1YITI 4UV8A 2IXSA 3HRSA 1R22A 4UVBA 2GZWA 1S29A 1RPWA 3OOUA 2CW8A 3EDPA 5B3SH 2HVRA 4IHVA 1R58A 2V4JC 5LEJA 1YI2I 1TC3C 2K9LA 1B4AA 1DGRM 3FBNB 3BR2A 2VXZA 3CP8A 3OL3A 2D5VA 4Q5SF 3GUDA 4CCNA 2KDZA 2OQRA 5IT9Z 2LBFB 2KISA 4F7ZA 4JYKA 5C4XJ 3QP6A 1IRGA 2B7EA 2E1MB 3ONQA 3AKZA 2XAGA 2XB5A 3HXLA 2H8WA 2EZHA 2Y31A 1WJCA 1XMAA 2XUBA 3TO7A 2Z33A 1FJLA 5HLTA 4XR6A 4PGGA 1PVEA 2EZLA 3T1BA 2DO7A 1X1BA 3QWLA 5FRMA 2O9LA 2DAOA 2XGXA 1E17A 3ESWB 3GO5A 4HDUA 4BJ6C 2XPWA 4XLPF 3WU2C 3V8JA 2M3AA 2FNPA 1R5HA 3DTKA 2E60A 1QGPA 3FIWA 4F52A 1OR7C 5LBQA 3O6BB 2F5EA 2KZGA 1K6YA 3FHZA 2EZKA 3IH4A 3H3VK 1T98A 1P4WA 3ZPLA 2XRNA 5LRSA 1T33A 4XRSA 3AL0B 2MG4A 2ECCA 2EV0A 2OQGA 3HPHA 3GYHX 3V8LA 2VB6A 2XF5A 1O3SA 3ELKA 2DDAA 5M3MJ 1GXPA 3S1RJ 4HG2A 2L54A 2A3SA 5DCMB 2NOGA 2W84A 2ZFWA 1A6IA 2LBFA 3CMYA 2OV7A 2RNJA 4RBOA 3P9KA 1ZG1A 3L2WA 3I59B 5E1ZB 1XGOA 4HNUA 2EH3A 3K10A 3QPHA 4A3GJ 2HQRA 4N0BA 3LOCA 3MKYB 1XG1A 4KYWA 2P8TA 1QPIA 5FLVA 1O3TA 4RB3C 4G7ZF 5A2QK 4KIFA 2G7UA 2H6CA 5TISC 5GPAA 5JVTA 1FYKA 2V9KA 4N4NB 2E2HJ 2WAFA 4CCLA 3GTGJ 3G6EI 2P4WA 2Z9OA 4ZYDA 4UB6C 4OIRF 3HIFA 5LGNA 4CHUA 3S1MJ 1HC8A 3E1SA 1MSEC 2XRLA 3JW4A 3K4NA 2E1OA 1H0MA 2MA3A 4HV5A 2Y30A 2LYCA 3S16J 1SFUA 5K5QA 4A0XA 2BW3B 1ENHA 5KAFC 1Y1WJ 9ANTA 3MD2A 1ETXA 4LLGF 3TDUC 3IH3A 1E3HA 3K4CA 4MFEA 5K7HA 2L4AA 4HZFA 3LAPA 4MEXF 1S72I 1IC8A 2M45A 4UUSB 3F72A 1AA7A 1BIBA 2RVCA 1YW7A 3TL4X
chains in the Genus database with same CATH topology
1G8XA 3LMMA 3OYGA 2VKHA 1Z3XA 3AFHA 2JA2A 5HOOA 2VQHA 2HNHA 2VKDA 2W7NA 4PSWA 4XL9A 3E0JB 2BVLA 1IRXA 4IKFA 2L2OA 1T0FC 4OWRB 3UR3C 3CF2A 1WJEA 3KEYA 4BL0B 4HRIA 4CCOA 4U87A 1QHHD 3SEQA 3OS0A 3K4LA 4XKCA 2V26A 3OYIA 4BUPA 4XLHA 4XLEA 2DJIA 2WAQA 3QODA 3VYSB 3OL4A 2VJJA 1DQUA 3OYNA 2ZSHB 3VDXA 4BJ5C 1Z3YA 4XOTA 2DCEA 3SDBA 3OYEA 4E7JA 2CV1A 3DLAA 3H5NA 2R7TA 3D5RC 2F4IA 1QU3A 2IS2A 4XQFA 3CMMA 4Y33A 3EPZA 4XLCA 2BW3A 3C2HA 5CPRB 2V6EA 4YEJA 2KZVA 2RNGA 3PL8A 4LIVA 4NNJA 4PFOA 4CZCA 1UAAA 3S32A 2IGMA 2KMUA 4PK4A 2ZFUA 4ANJA 4XKVA 4J01A 4DOZA 4F3QA 2RREA 3OYFA 4BDZA 2ZXIA 2W82A 2JUGA 2R7QA 1WJAA 4ZDOA 1LVKA 1MMDA 3DU6A 1R6RA 1D1CA 3U21A 1FMWA 3K4JA 3J7AY 4ZJZA 3OYMA 4CSWA 2CW7A 3LL7A 1D1AA 2VIXA 1PJRA 3RSNA 2X85A 3CESA 3DPUA 2DOAA 3IUOA 2E1MC 2KHMA 4H4KC 2WADA 4CUGA 1WFXA 3SEZA 2LC2A 1MNEA 2M7BA 3OR1C 3BC8A 2M0MA 2R7OA 4PJMA 4BQQA 2VLAA 1Y56A 1ERDA 4B47A 4D1QA 4C2UA 3LSHA 4DJAA 1UG0A 2VJ4A 2XAUA 4R79A 2WB1A 4NQWB 2KQRA 4BE2A 3ZR8X 4P1WA 2Q1ZB 3DKXA 3HL2A 4G6TB 3SZGA 4BJTA 3PFYA 1X4OA 4NC7A 3UNGC 3VWBA 2Z2SB 2MYSA 4LIUA 3VYTB 1D1BA 5HNFA 1OLTA 2M4KA 3VSKA 3D5SC 3RTRA 1V5FA 4DIQA 1V5EA 1YX5A 1P9QC 2R4GA 3OIQA 4KT6A 3DEEA 2R7RA 4XKBA 5KCMA 3FDYA 4BS9A 2K3PA 2UV1A 1TT0A 4KITB 2X6XA 3HC7A 4LG3A 4HSTA 3OMYA 3A1YA 3G2BA 4CH7A 2WY8Q 3DU5A 2CS3A 2ZXHA 2IGNA 2R7VA 4PUSA 2AQFA 3OS2A 3MKZA 3H9QA 4NC8A 3VSLA 4CCJA 2LH9A 3K4MA 4NUBA 2HPMA 3D5LA 2HU9A 4RM2A 4BACA 2GOMA 3H9JA 3K6GA 2WA0A 2A6TA 2K5CA 3A2KA 2JVHA 2IGOA 3QYBA 2KRHA 4P5OA 1MNDA 3C2GA 4F93B 2XDVA 3FKJA 4CCMA 3N05A 1U0JA 4EATA 4OAYA 1WJBA 3BCAA 3H9GA 4N4OB 4RLQA 4Y4RA 4F91B 3KYLA 4BE0A 4BU2A 2IS4A 3RCOA 2LRDA 4QPQA 4ZTFA 2BVMA 4PJNA 2MC4A 4RM3A 1QHGA 2IS1A 3LSMA 3W2AA 1S9HA 3CJRB 4F55A 1X1CA 1WJDA 1NG7A 2W1OA 2R7UA 3TMOA 4BGDA 1D0XA 3NWTA 4HPQA 4XM3A 1BR2A 2HVSA 2FUG2 2VQLA 3OYKA 3BLYA 3S3NA 4E7SA 2X1DA 2MD0A 2ELJA 3TBIA 2XF6A 3A4CA 3HG9A 4KISA 4BE1A 1N78A 3LSGA 1FMVA 1MMAA 4XLAA 2CUZA 5CQEA 3W2WA 2L9SA 4B3XA 4AVZA 3PNTA 1T95A 4II3A 1WJ5A 3RQ4A 3BG7A 4CCKA 3OS1A 4II2A 1HA8A 4C9YA 3OYBA 4QPOA 3IAS2 2E5ZA 2VQCA 4BEHB 4ZDPA 2W00A 4OAZA 1W36D 1V5GA 3RPUD 2OC6A 2M4GA 2KDOA 2XC7A 3QOEA 2L7KA 4XN3A 3FBIB 2VJIA 4BDYA 3HPGA 1VZ0A 3OYAA 2V1NA 2LY1A 2JSPA 3LSKA 4XMYA 2WAEA 3PNVA 4IZZA 4Y3OA 4PFPA 4C30A 3DWLE 1D0YA 4FETA 5LD2C 1TZLA 5LFAA 3HOTA 2VJ5A 2CV2A 2R7SA 4DBQA 1X1AA 2K9MA 2WY7Q 3I9V2 2VQGA 3SYTA 4B48A 2NOJB 3W2VA 2KRCA 3H0DA 2XSJC 4BXFA 2UUZA 2UWMA 3QYEA 3HUGB 3S93A 2VPLA 3DTEA 2XF7A 2DXIA 2F5VA 2LG4A 3ZXSA 3S3MA 2MFZA 2KP6A 3F9KA 3L2QA 4XONA 2R7WA 4HEA2 4XORA 1DP3A 4XKWA 2LY2A 1D0ZA 2OUMA 1SFKA 1DGWY 3ZGKA 3KX2A 3I3LA 3BG6A 5JHFA 2CFOA 1MMNA 3HOSA 4RLFA 4BEHA 2VL8A 3EUHC 3OWTA 2I8DA 1E0EA 3S8PA 2DT6A 4GRIA 2VXDA 1LFPA 3OY9A 1MMGA 3CZ6A 2LREA 2F6CA 3CP2A 2HDWA 3DTIA 3IP4B 1X19A 4C2TA 2Z16A 3EUKL 2KL4A 3K70C 3EUAA 4MLOA 3L2UA 4HNTA 3H5RA 4IQ4A 4BQNA 2HZDA 1YX3A 4YRVA 4E7ZA 1NG6A 3VYUB 1BR1A 2KLOA 3DPTA 1X1DA 4XN0A 2IXSA 3K4BA 4X0GA 3LFUA 3OOUA 3FHNA 5FRNA 2CW8A 4FASD 3DQVC 2V7FA 2HQAA 2HVRA 2PJRB 1G59A 2V4JC 2ZSIB 2CUJA 3L2VA 1BR4A 4DGWB 2K9LA 4PJJA 1DGRM 3FBNB 2HVQA 3W3CA 4AU7A 1W36C 3CJQB 2VXZA 1LDKB 3OYLA 3CP8A 1Z7LA 3OL3A 3OYDA 4CCNA 3PNYA 3K70D 2MABA 4E7HA 2LBFB 2X1CA 4E4HA 3GBGA 4ZDLA 4ZC3A 3H5AA 4E7LA 4ZYAA 2E1MB 3QYFA 3ONQA 3AKZA 4IX7A 4E7IA 1EA3A 2E5NA 3K4KA 1X4PA 3ZCOA 3IAM2 3HXLA 3OYHA 3PSIA 1WJCA 2DT7B 3VYRB 4CA0A 4XR6A 5HLTA 2X1EA 5TGTA 1JI8A 3BCBA 2KPMA 4XNFA 4XLFA 1J09A 1X1BA 2Y0SA 5CQGA 5FRMA 1SAUA 3OIPA 4BJ6C 3MKWB 5KNLA 2R7XA 5HVQC 2M3AA 1UELB 3DTKA 2E60A 1Z21A 2O5RA 4F52A 2CH0A 1OR7C 3LSIA 5FROA 4LITA 4B43A 3M1CA 1K6YA 1KONA 1Y6IA 3OYCA 3DKYA 4XOPA 4PJLA 2WBMA 3PSFA 2X51A 2X6YA 2HPIA 2PJRA 1YE9A 2L9NA 1ZELA 3AL0B 4F92B 2A5WA 3HPHA 2VB6A 2XF5A 4KJZA 3MMYB 1GLNA 1N77A 2P0WA 4JQFA 4HG2A 3S3OA 4YELA 4E7KA 4U7BA 2LBFA 2OV7A 4E6KG 3OYJA 2LOOA 3L2WA 3PJRA 3ZQQA 4ZTJA 2CV0A 2BOLA 4HNUA 3K10A 2W4SA 3MKYB 1N75A 3HKZA 5HNHA 2QKLB 3PUBA 2VASA 2V9KA 4RMNA 4N4NB 1MW7A 2WAFA 4CCLA 3DPLC 4D9JA 1WJFA 2QKMB 2X6WA 3OR2C 3E1SA 2Q2EB 3K4NA 3V42A 4JOMA 4IQJA 2GOXB 2M7AA 2Z1DA 2LYCA 4BQOA 2AQEA 1LKXA 1BOBA 2L5QA 3AL0C 5KHDA 3H35A 2RQQA 3ZRGA 2BW3B 2PMZA 2CMPA 4DBRA 3MD2A 2JVGA 3NWSA 4HSRA 3K4CA 4AYBA 3M8JA 1PYVA 4B44A 3L2RA 4PSXA 4ITVA 2IGKA 2IS6A 1AA7A 5CKTA 4J00A 3TL4X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IX7 A;  4X0G A; 
#chains in the Genus database with same CATH topology
 3LA7 A;  5BNG A;  2VKH A;  3HSF A;  1SC7 A;  4LD5 A;  3S1N J;  4B3A A;  2VQH A;  2VKD A;  5ICF A;  5E1W A;  1FTT A;  1T39 A;  2R5Y B;  3R4K A;  5DCM A;  2BVL A;  1IRX A;  4ESF A;  3I59 A;  3CF2 A;  3BR1 A;  2YSR A;  3FK7 A;  3KEY A;  4BL0 B;  1SD5 A;  1A5J A;  1OKR A;  2DMT A;  4U0V A;  4CCO A;  3RKY A;  4KMF A;  3WTS C;  3WGI A;  1HOM A;  2V26 A;  4H0E A;  4ETS A;  1MNM C;  2IEK A;  5CVR A;  2WAQ A;  3KFW X;  1RIO H;  3KLN A;  3OL4 A;  2R7F A;  2NVT J;  3ZQG A;  5D8L B;  2E1N A;  4BJ5 C;  1IN4 A;  1Z3Y A;  1IN8 A;  2ZB9 A;  3FMQ A;  3OYE A;  5C3E J;  4L5J A;  3D5R C;  1Z1D A;  4Y52 J;  1DP3 A;  1QU3 A;  3AG3 H;  3MCZ A;  2OA4 A;  3ECH A;  3S14 J;  1GXQ A;  2F48 A;  5DD8 A;  2Q8K A;  2BW3 A;  3C2H A;  2CYY A;  2Z5U A;  3DBH B;  4MNU A;  1D5V A;  1XDU A;  3ABL H;  4M6V A;  4YEJ A;  1W4M A;  1W5C C;  3PL8 A;  4EQQ A;  4JX6 A;  1SVL A;  4NNJ A;  4PFO A;  3LAJ A;  2ZO4 A;  2KMU A;  2XVC A;  4PK4 A;  3J7Z I;  4UUS A;  2DFE A;  3U1D A;  2RRE A;  3OYF A;  4BDZ A;  2ADU A;  2PMU A;  4NC6 A;  3HM5 A;  1POG A;  2XAS A;  2A68 F;  1MMD A;  5C44 J;  1MSF C;  1BIA A;  2PG4 A;  2R5Y A;  4EVI A;  4IVN A;  2KIQ A;  4D5C A;  1Y1V J;  1ONV A;  5F0H A;  4CSW A;  2RV8 A;  2R0Q C;  3QPT A;  5CVI A;  4G7H F;  1FP2 A;  2X85 A;  3KCC A;  3Q0V A;  1BOA A;  2XHK A;  2P5V A;  3JCU C;  3FMS A;  3BTI A;  3C2B A;  2CQK A;  3IL2 A;  3CC7 I;  2E1M C;  2GXG A;  4H4K C;  5ED4 A;  2WAD A;  3ZMU A;  1XGS A;  4CUG A;  1ZRE A;  1ZH5 A;  2VBZ A;  1L3L A;  3G73 A;  3NQO A;  5FD5 A;  3RJP A;  4RAF A;  3HOV J;  3FXL A;  2E35 A;  1ERD A;  2RDP A;  1DDN A;  3HGG A;  3LSH A;  3AG1 H;  5E3M A;  1TP4 A;  5DS9 A;  3O8H A;  4R79 A;  3ZQF A;  5J1R A;  1RR7 A;  4RB1 A;  1XMX A;  3K1M A;  2VUM J;  1FIA A;  3SZG A;  1OCP A;  3SFI A;  4EJW A;  4HX4 A;  3UKG A;  1A36 A;  1HLV A;  4XSZ F;  4BHC A;  2X48 A;  2BBY A;  3PO2 J;  2WWY A;  4G94 A;  3E7L A;  1ZGW A;  1YX5 A;  2FBH A;  1P9Q C;  4KT6 A;  4IHT A;  4FE4 A;  2I5U A;  3FDY A;  4BS9 A;  2K3P A;  3KEO A;  2XRO A;  4LG3 A;  2V1U A;  4RS8 A;  4RA2 A;  2EA4 A;  3G2B A;  2VN2 A;  4CH7 A;  2WY8 Q;  3J81 K;  1UHM A;  4P96 A;  4CYC B;  3CCR I;  4KUM A;  2R7V A;  3I56 I;  3PO3 J;  1ORK A;  4Y7N J;  2DA5 A;  5J40 A;  1SD6 A;  1X1P A;  2R7D A;  4NUB A;  3ZQC A;  2OF7 A;  3D5L A;  4IL6 C;  4E70 A;  2HU9 A;  1IW7 F;  1VQP I;  5F27 A;  1ZGJ A;  1PDN C;  3K6G A;  4AWX B;  5DEQ A;  2CU7 A;  5LHG A;  3Q3S A;  1Z9C A;  3QYB A;  1JT0 A;  3C2G A;  4CCM A;  4QTR A;  2DQL A;  4EAT A;  5HS7 A;  2E7W A;  1WJB A;  3H9G A;  4KT5 C;  4Y4R A;  1Z91 A;  5FFX A;  3DP7 A;  5FKL A;  4BE0 A;  1Y8R B;  3FWE A;  1ON2 A;  4HAM A;  1H88 C;  3RCO A;  1YOV B;  2OJE D;  1LDJ A;  3ZQL A;  4ZTF A;  4PJN A;  4A2U A;  3I4M J;  1MBJ A;  1QZZ A;  3U9G A;  3JR9 A;  1QHG A;  3IKV A;  2GWR A;  2LP0 A;  3LSJ A;  3ZMZ A;  3JRC A;  1PUF B;  2D2W A;  3CJR B;  4L9J A;  1VQ4 I;  1IG7 A;  5EDN A;  2E7X A;  2NS7 A;  3TMO A;  1W0T A;  3MZ8 A;  3R0J A;  1GVJ A;  2VQL A;  3IWZ A;  3BJA A;  2MD0 A;  2CSO A;  4YII A;  2ZKZ A;  5HDK A;  1ON1 A;  3HG9 A;  4FX0 A;  4CIC A;  4BE1 A;  3RKX A;  2FML A;  4I02 A;  1FMV A;  1HSJ A;  4CYC A;  1Z6T A;  2DMN A;  1XN7 A;  4Q47 A;  3HHG A;  4B3X A;  3LQQ A;  1XCB A;  1ETK A;  2HQ5 A;  4II3 A;  1ZTR A;  3U1K A;  1KGS A;  3LSP A;  3BG7 A;  4CCK A;  1EV7 A;  3OYB A;  4A3D J;  4C2M J;  2DU9 A;  3FM5 A;  3FK6 A;  2CRG A;  4UV9 A;  4ZH4 F;  1W36 D;  3X2Q H;  2OC6 A;  2M4G A;  3Q9S A;  2IT0 A;  2M34 A;  1P6R A;  3FBI B;  5F6F A;  2EV5 A;  2CQQ A;  3JRF A;  3W6K B;  1UHS A;  1VZ0 A;  1R4N B;  2EBI A;  3L9F A;  4BDY A;  4XLN F;  3TKY A;  3V8K A;  4DZJ A;  4XMY A;  4PFP A;  5GAD J;  4EJV A;  3ECO A;  2EIK H;  1ULY A;  2HYJ A;  3T0Y A;  5LD2 C;  4M9X A;  2FQ3 A;  3CCM I;  3WG9 A;  1VQN I;  3BTC A;  1FPQ A;  3WTT C;  2WY7 Q;  4HYE A;  4UY8 I;  2NOJ B;  4BHP A;  1M1E B;  1I6X A;  1MIJ A;  1HDD C;  3I4N J;  1S7E A;  1Z7U A;  2DA6 A;  4BXF A;  2UUZ A;  5K7Z A;  2QBY B;  3QYE A;  2V9V A;  1AWC A;  1FOX A;  3RKQ A;  3GLX A;  2E2J J;  3HSR A;  3BPX A;  1HST A;  4Y17 A;  1XGM A;  1UMQ A;  4U88 A;  3K9T A;  5J4V A;  3JRG A;  2BY1 A;  3RIR A;  1TNT A;  4OMZ A;  3L2Q A;  1J7K A;  3DKW A;  1XD7 A;  4A3K J;  2LY2 A;  1VFC A;  3FXO A;  2QQ9 A;  3HTS B;  2K27 A;  5J8F A;  4CZZ A;  1UG2 A;  2ZBK A;  1XSX A;  2WV0 A;  3HOS A;  1U5T B;  4CGZ A;  3CO7 C;  3D1N I;  1E0E A;  3KP5 A;  2NS8 A;  3T5X A;  4WWC A;  1AOY A;  1LFP A;  2OU2 A;  4BKX A;  2E1C A;  4N9I A;  1MMG A;  3FXM A;  1RNL A;  5JFR A;  2HDW A;  2KIU A;  3BRO A;  4PZJ A;  1VF9 A;  3S17 J;  1Q1V A;  2KL4 A;  4KDP A;  1LFB A;  3L2U A;  2FOW A;  4GFB A;  5K1Y A;  2NVU B;  5EF6 A;  1NHA A;  2OZ6 A;  2JWT A;  4IQ4 A;  2PFB A;  3Q0W A;  4YRV A;  4ZZL A;  3PIO F;  2WV1 A;  4E7Z A;  1NG6 A;  3FXU A;  1FY7 A;  1X1D A;  5IP9 J;  4L5I A;  4BBR J;  2ME0 A;  3WTW C;  1FSH A;  2H09 A;  2QBY A;  3GXO A;  2ZJ2 A;  3F8B A;  3MN2 A;  1RKT A;  4X0G A;  1C0W A;  2KT0 A;  3DQV C;  1ZG5 A;  3RZO J;  2QYO A;  4OU0 A;  1G59 A;  4LOC A;  2ZME A;  2ZSI B;  1BR4 A;  3QU3 A;  3GFM A;  1BI0 A;  2HVQ A;  1JGS A;  4MHG A;  3OYL A;  4IHW A;  4RB0 A;  1K6O A;  3AG2 H;  4OIP F;  1YRN B;  3PNY A;  1P4A A;  3K70 D;  4E7H A;  2X1C A;  4E4H A;  2G9W A;  3GBG A;  4BXU A;  3JRE A;  4ZYA A;  1U5T A;  2VBW A;  3K4K A;  4LG0 A;  1KA8 A;  3CDH A;  1HKQ A;  4LFU A;  2IA2 A;  3DBL B;  2M2E A;  3PSI A;  2EK5 A;  2L02 A;  3GWZ A;  3VYR B;  4CA0 A;  2X1E A;  5B1B H;  3EYY A;  3VFZ A;  1JI8 A;  1VQM I;  1WI3 A;  3TP0 A;  1J09 A;  2VKV A;  2FF4 A;  4GGG A;  5AON A;  5E8I A;  1SAU A;  3G1L A;  2DMU A;  1FT9 A;  2KJB A;  3QP5 A;  2DA1 A;  3MKW B;  2M87 A;  1V54 H;  1UEL B;  2V1X A;  3TO9 A;  1Z21 A;  2R93 J;  5FRO A;  4LIT A;  1FOW A;  3M1C A;  2HOT A;  3OYC A;  1Y6I A;  5F1J A;  4X6A J;  1U6G A;  2ZJQ F;  4FCY A;  4M71 A;  2FEZ A;  6PAX A;  2OCE A;  2WBM A;  1YW9 A;  1TT5 B;  3PSF A;  2QZ8 A;  2X51 A;  3E6C C;  3GTJ J;  3GZ6 A;  1EH7 A;  1YE9 A;  2TDX A;  3MWM A;  1QNT A;  4FQG A;  4V19 K;  1X3Z B;  2LK2 A;  2P0W A;  4JQF A;  1YRN A;  3S3O A;  3DEU A;  1LEA A;  4E7K A;  2BXZ A;  4XRM A;  2IA1 A;  4WXC A;  4EM0 B;  4OIQ F;  2OAZ A;  2LOO A;  4ZTJ A;  2COB A;  2WC2 A;  1LEB A;  2MLK A;  3DCF A;  2DA3 A;  3ABK H;  3DBR B;  2QKL B;  4DYQ A;  2IAI A;  4IOA F;  2VAS A;  3VOD A;  4RMN A;  5EGO A;  1IF1 A;  5IP6 A;  3R60 A;  2W24 A;  2GIZ A;  3FXK A;  2VOP A;  3M8F A;  3BJO A;  4HX7 A;  1BC7 C;  2ESN A;  1B8I B;  4FT8 A;  4AIH A;  2X6W A;  3WE2 A;  2W57 A;  1JGG A;  3V7S A;  4M9S A;  4A3C J;  4IQJ A;  1G3S A;  1JKR C;  2K7L A;  3WTZ A;  2TRT A;  1W0U A;  2M7A A;  4RGX A;  4XRF A;  3KEQ A;  1ODD A;  5F0C A;  4BQO A;  1LKX A;  1MDM B;  1VND A;  1LE8 B;  2L5Q A;  2MBF A;  2RQQ A;  3HJE A;  2ID6 A;  2CMP A;  2MW8 A;  3QPL A;  4IRH A;  2JVG A;  4KIG A;  5FFZ A;  4HSR A;  1TQI A;  3GEZ A;  2DPD A;  2K4J A;  3COA C;  3ZQH A;  1XCV A;  3M8J A;  1PYV A;  4O3M A;  2ACJ A;  3GFL A;  4RAG A;  2IGK A;  1WCM J;  3MKL A;  5JLX A;  2J5O A;  1MJB A;  1G8X A;  1UCR A;  4QIW N;  1Z3X A;  2DBB A;  3M7G A;  1CQT A;  3AFH A;  2HNH A;  1IXR C;  1EJ9 A;  4IF4 A;  3E0J B;  3CCV I;  3BP8 A;  4OWR B;  3UR3 C;  5DM7 F;  2KFD A;  2PN6 A;  3JRI A;  1AKH B;  1KZH A;  4HRI A;  3C3W A;  3HOX J;  4RAZ A;  1QHH D;  3SEQ A;  3MAJ A;  1U5T C;  3V4G A;  2OPT A;  1LUJ B;  5BMZ A;  3OYI A;  2FXA A;  2H1L A;  3RQI A;  1HW1 A;  3HOZ J;  2DJI A;  3NAU A;  3QOD A;  3VYS B;  3HEF A;  1B8I A;  2VJJ A;  2F5C A;  2PMH A;  1VQK I;  4XOT A;  3SDB A;  4IHS A;  2R7T A;  4E7J A;  3H92 A;  2VE8 A;  3DLA A;  4G6D A;  1D5Y A;  2BZT A;  2M1B A;  1D3Y A;  4PDK A;  1BI1 A;  1NTC A;  1QVU A;  3F8F A;  3TO6 A;  3CQZ J;  3ZMS A;  2IPQ X;  2IS2 A;  3K69 A;  3BG5 A;  4Y33 A;  1MDM A;  1K4S A;  1LE8 A;  3E97 A;  4AC0 A;  2LVS A;  4WCG A;  4XLC A;  1PP7 U;  3JAM K;  2A05 A;  4S04 A;  1VQO I;  2V6E A;  2KZV A;  1F36 A;  2XGC A;  5DDG A;  2BY3 A;  2BE5 F;  4P9F A;  4ANJ A;  2ZFU A;  3T8R A;  4M3G A;  1WI9 A;  3DXJ F;  3LA2 A;  2EA2 A;  4EJU A;  1RRJ A;  2H94 A;  1QBJ A;  2HFH A;  3F6V A;  2QQB A;  2W82 A;  2XGE A;  1WJA A;  1LVK A;  3DU6 A;  2OZU A;  3FIS A;  1R6R A;  4LK1 F;  3BWG A;  1JUP A;  1HKS A;  1FMW A;  1U8R A;  3W6V A;  4G7O F;  4HQE A;  2LFB A;  1TLH B;  1LNW A;  1MBK A;  2JRM A;  1FYM A;  2KKO A;  1OYY A;  1B59 A;  3EQL F;  2CW7 A;  3KET A;  1X58 A;  4IOC F;  1D1A A;  2VIX A;  1PJR A;  4BQA A;  4RB2 C;  3J80 K;  3I53 A;  2DFF A;  4EJO A;  3G1O A;  1LJ9 A;  1H89 C;  4NHJ A;  5FO5 A;  4G12 A;  4XK4 A;  2KHM A;  1OPC A;  2LKX A;  3SXY A;  1TBX A;  4HW0 A;  1R23 A;  2FJ1 A;  1I3A A;  4LMY A;  3SEZ A;  1S5L C;  1FBS A;  3BC8 A;  2M0M A;  4BQQ A;  1KQ0 A;  3MZH A;  1UHW A;  4B47 A;  4D1Q A;  2UZK A;  3K1P A;  1XX5 A;  3KYC B;  2GXA A;  1UG0 A;  2VJ4 A;  3DFG A;  4FTH A;  2DA7 A;  2KQR A;  4AUX A;  1SVO A;  1P4X A;  3ZR8 X;  1DPR A;  4P1W A;  2Q1Z B;  3HL2 A;  4IO9 F;  4BJT A;  2ISZ A;  4XID A;  3IKT A;  3PFY A;  3UNG C;  3ZMV A;  3VWB A;  1UZC A;  5CJ9 A;  2B0L A;  2DFH A;  4LIU A;  3OSG A;  5J6X A;  1OLT A;  2M4K A;  1RI7 A;  3RTR A;  1V5F A;  2O8K A;  1V5E A;  1B1B A;  1R4M B;  2FA5 A;  3CDL A;  1G2H A;  4XKB A;  2R3S A;  2V6C A;  4A3M J;  2UV1 A;  1TT0 A;  2X6X A;  4S05 A;  3OMY A;  2LF8 A;  1EKE A;  5LRR A;  5H6Q A;  4M3F A;  5BPD A;  2IGN A;  1R49 A;  4PUS A;  4L0Z B;  1MMS A;  2LTP A;  4RDU A;  3VSL A;  2DK8 A;  5JI6 A;  3VPR A;  4YG2 F;  1HQC A;  3KPH A;  3BPV A;  2XAH A;  2G7H A;  3HOW J;  1J59 A;  2GOM A;  2QLZ A;  3FXQ A;  2JZY A;  2K5C A;  1TWC J;  2JVH A;  3CCE I;  1W7P D;  1WKM A;  5F0F A;  3EYI A;  4F93 B;  1QO0 D;  5D5U B;  2EJR A;  3KZY A;  1OQY A;  2GBY A;  4OAY A;  3BCA A;  2Y75 A;  3KYL A;  3C1D A;  4A3E J;  3K7A J;  5GTH C;  1R9T J;  1O3R A;  1SFX A;  2ECB A;  3BTL A;  3M1E A;  2E36 A;  4BY7 J;  3CCJ I;  3GTL J;  2GAU A;  5L3G A;  4QPQ A;  4EMS A;  3B6A A;  1EH8 A;  3L09 A;  2COM A;  5JHU A;  4ENK A;  2WAQ N;  5AIQ A;  2IS1 A;  3LSM A;  2NAZ A;  4A3F J;  5IOZ A;  2XGD A;  4F55 A;  3M4O J;  1ZAR A;  1QA6 A;  2IJL A;  1D0X A;  3CCY A;  5FLX Z;  1F43 A;  1BR2 A;  3A01 B;  2HVS A;  3BLY A;  3S3N A;  3R61 A;  2X1D A;  2Y48 A;  3IHU A;  3G1M A;  2CUE A;  3RKW A;  4M6Y A;  1S7O A;  3BOQ A;  3GFI A;  3LSR A;  1N78 A;  2PX9 A;  1KU9 A;  3LSG A;  4A69 C;  1DPU A;  1MMA A;  3HRM A;  4DW6 A;  3CD6 I;  3BZC A;  3SZT A;  3RPU A;  1TQM A;  3E5X A;  4KNY A;  1T95 A;  5JVG F;  1MGT A;  2P6S A;  3P9I A;  4BBS J;  2JA6 J;  3HYI A;  3CO6 C;  5J47 A;  1HA8 A;  4L0Y B;  1U3E M;  2MSY A;  1Y0N A;  4BNC A;  1Z05 A;  5BQT A;  5B66 C;  1QVT A;  1X3W B;  5LHH A;  2KDO A;  1P7I A;  2L7K A;  4L9N A;  1LB2 A;  2QVO A;  2D1H A;  2OTJ I;  3F21 A;  1CF7 B;  2JSP A;  2HOA A;  2YX7 A;  3LSK A;  2Y9Y A;  5D8K B;  1X3U A;  3PNV A;  1IDZ A;  4IZZ A;  2GLO A;  2VE9 A;  4R8H A;  4GO1 A;  3BZ6 A;  4N9H A;  1D0Y A;  1OYI A;  3V7R A;  2YS9 A;  4FET A;  4ZZD A;  1S6L A;  5LFA A;  4DYC A;  3F8M A;  2R7S A;  4I2O A;  2JPB A;  2M5W A;  5GAH J;  2K9M A;  4OOI A;  2VQG A;  4KA4 A;  4XRS G;  3E3V A;  3RYP A;  3NRV A;  1ZRD A;  5FKM A;  1RC9 A;  4ABZ A;  2GIV A;  2YUS A;  2DA2 A;  2XSJ C;  4MO7 A;  1F9N A;  2DFI A;  1ZLJ A;  2EIM H;  3B6C A;  3HUG B;  1JUS A;  1J5Y A;  2F5V A;  3ZXS A;  2MFZ A;  3WOD F;  1ZK8 A;  3F9K A;  3BT9 A;  2I10 A;  4A12 A;  4XON A;  1KU2 A;  4I0B A;  4WK8 F;  4KFC A;  2R7W A;  5D4R A;  4B1R A;  2Y9Z A;  2YR2 A;  4UUV A;  1IRZ A;  2OUM A;  1HKT A;  1T56 A;  3TDZ C;  3T8T A;  4D0P A;  4CXF A;  5TJJ A;  5JHF A;  3WU0 A;  2CFO A;  1PUE E;  3KP7 A;  1REP C;  4RLF A;  4KN4 X;  2XAQ A;  2VL8 A;  4LB6 B;  3JSP A;  1WHU A;  4GRI A;  2CGP A;  1ZG3 A;  2A07 F;  5J4Y A;  3CZ6 A;  1WRJ A;  2DQR A;  2AXT C;  5F1R A;  2K3F A;  3IP4 B;  1YIJ I;  3BQY A;  3WHB A;  3EUK L;  3K70 C;  1K61 A;  2C6Y A;  1BC8 C;  3A03 A;  2PJP A;  3KE2 A;  2CW0 F;  3F22 A;  4IJA A;  4BQN A;  1YX3 A;  5D5X B;  5H6R A;  5D5V B;  1WH5 A;  3GLL A;  3VYU B;  1BR1 A;  1YLF A;  2HGC A;  3K1N A;  1K83 J;  1R71 A;  2JRT A;  1S8N A;  2RC4 A;  1ZRC A;  3HUG A;  3LFU A;  3FHN A;  2MD5 A;  3GZ5 A;  1YS6 A;  1G3T A;  3TQN A;  2AXL A;  2H6B A;  4U0W A;  4M72 A;  2PJR B;  4EEF G;  3PM1 A;  2CUJ A;  3K0L A;  3MQ0 A;  1WVR A;  4PJJ A;  3S1Q J;  2M0C A;  5LLQ A;  3W3C A;  1YFH A;  3CLO A;  1LDK B;  1T8I A;  3OYD A;  1T0F A;  5H20 A;  1FIP A;  5F64 A;  5DUI A;  5ICC A;  4YFX F;  1QZY A;  2CFX A;  1MKM A;  5L3D A;  3H5A A;  4RAY A;  5M5X J;  4E7L A;  2BHY A;  5A2Q Z;  2X4H A;  1FWZ A;  1WWX A;  3ZCO A;  1OFC X;  2JJ7 A;  3IAM 2;  4A0Y A;  1YIO A;  5J8C A;  2DT7 B;  2CG4 A;  1LFU P;  2K40 A;  4XNF A;  4XLF A;  2Y0S A;  3IRR A;  4IRI A;  3BZK A;  3KIO A;  2DOD A;  3OIP A;  2O61 A;  5B5E C;  3CMA I;  2VPR A;  2R7X A;  2E2I J;  4GYI A;  1YJW I;  2ZXJ A;  5BPI A;  1IGN A;  3CME I;  4HLY A;  4IXA A;  4I0A A;  3FM3 A;  3S2H J;  4K2E A;  1KON A;  4HV6 A;  1SFO J;  2ESH A;  1IV8 A;  3DKY A;  2DYS H;  3SHF A;  4BHB A;  2HTJ A;  2NVQ J;  1H9T A;  4B09 A;  1PUF A;  1U9N A;  2NYX A;  1I1S A;  2X6Y A;  1XB4 A;  2PJR A;  3KZI C;  2V1D A;  3I55 I;  4FX4 A;  4F92 B;  4I98 B;  4LB5 A;  1X2N A;  1CGP A;  2CJJ A;  4KJZ A;  3MMY B;  3K2Z A;  4LJZ F;  3A0B C;  1N77 A;  2DMQ A;  4U7B A;  4E6K G;  2FSW A;  1T08 B;  1WH7 A;  2CQ7 A;  2AS5 F;  2QF7 A;  5IT9 K;  3PJR A;  2EWN A;  3ZQQ A;  4B4C A;  4C3J J;  2DLL A;  2CV0 A;  3F6O A;  1NH3 A;  2W4S A;  2EFO A;  1K78 B;  5HNH A;  2A5Y B;  4DZP A;  5E1X A;  5K7F A;  4TV7 A;  1XPX A;  2RAE A;  4QWQ A;  5E79 C;  3JRA A;  2VC0 A;  4HQM A;  2NNY A;  2W48 A;  3MFK A;  2JA5 J;  2ID3 A;  2P5K A;  2Q2E B;  3V42 A;  4JP0 A;  5CVU A;  4UHT A;  3NEU A;  5E8G A;  3LFK A;  2Z1D A;  4CDG A;  3JTG A;  2AQE A;  4MTE A;  1BW5 A;  3MZY A;  2F4M B;  1TW2 A;  4ZYH A;  5IYD J;  2Z3Y A;  4HF0 A;  4G6Q A;  4HF2 A;  2XKO A;  1U78 A;  4I76 A;  4DBR A;  4MTD A;  3NWS A;  1IO2 A;  4AYB A;  4ENJ A;  2L9V A;  3L2R A;  4PSX A;  4AYB N;  2DMP A;  4ITV A;  4Q48 A;  3F23 A;  1WZ2 A;  2IS6 A;  3ZN1 A;  5CKT A;  3QOP A;  2A69 F;  1JT6 A;  3DV8 A;  3OYG A;  1TWG J;  1MBG A;  5HDG A;  4UUT A;  2JA2 A;  5HOO A;  2FQ4 A;  1IXS B;  2E19 A;  4LK0 F;  4PSW A;  2W7N A;  2P81 A;  3BQZ A;  2JA7 J;  1Y0U A;  2L0K A;  4M3B A;  4IKF A;  2L2O A;  1QPM A;  1T0F C;  1JKO C;  4YIR X;  4MFD A;  3EET A;  1F5T A;  4ENM A;  3BR6 A;  3ZQ7 A;  2XAJ A;  3AAF A;  2EIN H;  5DCF A;  1XDS A;  1V55 H;  3BY6 A;  1K78 A;  2JTV A;  3O8G A;  3OS0 A;  4HX8 A;  1V3F A;  4BUP A;  4U0Y A;  3E6B A;  5HLG A;  4XLE A;  3FXR A;  2LDU A;  2UXN A;  1D8K A;  3L7W A;  1GDT A;  1MD0 A;  4C3H J;  1U2W A;  2Q2E A;  2ZSH B;  2DCE A;  4FE7 A;  2HDD A;  3H5N A;  3L2C A;  4PGH A;  2BEO A;  1ZKG A;  1TTY A;  2K9S A;  2O0Y A;  2DYR H;  1NK2 P;  1KYW A;  2EFQ A;  2PBI A;  5CYV A;  1KQ9 A;  2VT3 A;  3IC7 A;  5K5O A;  2LY9 A;  5CPR B;  4CZC A;  4LIV A;  1UAA A;  1BBY A;  1MZB A;  3CUQ B;  4JX4 A;  3S32 A;  4AM3 A;  4J01 A;  4DOZ A;  3P5J A;  3G71 I;  5FB2 A;  4F3Q A;  1LDD A;  3OSF A;  2IA0 A;  2OD5 A;  2JUG A;  1HDP A;  1FX7 A;  4DQ2 A;  4ZDO A;  2FNA A;  3E5U A;  1D1C A;  3GVA A;  5FJ8 J;  3J81 Z;  4J19 A;  3OYM A;  2JUC A;  3I54 A;  1DU0 A;  3IRQ A;  2BGC A;  3LL7 A;  5E3O A;  3HGY A;  2STW A;  2ZJR F;  3RSN A;  5L3E A;  3A0H C;  2F2E A;  3CES A;  2VBX A;  1W1W E;  4ZYE A;  3D0S A;  3WGG A;  5CVV A;  1T6S A;  3IUO A;  3G3Z A;  1O7L A;  3TGN A;  5HS9 A;  1PP8 F;  4EM2 A;  1QQI A;  2K9N A;  1IRF A;  1HW5 A;  2GQQ A;  4FIS A;  1WFX A;  4NB5 A;  2LC2 A;  2X9D A;  2M7B A;  1ITY A;  3OR1 C;  1Z0X A;  2M8G X;  3GTM J;  4PJM A;  1MBE A;  2LNB A;  1Y56 A;  1AHD P;  3FF5 A;  4XSX F;  4DJA A;  2BV6 A;  3ERE D;  2XAU A;  3LQR A;  2VC1 A;  4NQW B;  4C3I J;  4BE2 A;  5FKN A;  5AIP A;  1Z6R A;  2VON A;  3CCL I;  1BA5 A;  4LLN A;  4G6T B;  3O2P E;  4G9Y A;  2L4M A;  2H8R A;  1X4O A;  3VYT B;  1D1B A;  3CDI A;  3CUQ A;  5E17 F;  5M3F J;  1OCT C;  2KJC A;  4DYR A;  3SFZ A;  3VSK A;  4DIQ A;  3M07 A;  3TP3 A;  1OCR H;  1BI2 A;  1R00 A;  1TNS A;  4MQV A;  3OIQ A;  3DEE A;  5KCM A;  3H0G J;  3GW2 A;  1DP7 P;  2RN7 A;  3G4S I;  1FBQ A;  3A1Y A;  2K02 A;  2LR8 A;  3DU5 A;  1VQ5 I;  2W85 A;  2LSO A;  4X1E A;  1Z77 A;  1TWA J;  5EZH A;  3OS2 A;  3H9Q A;  4NC8 A;  5J1U A;  3PUF A;  3WG7 H;  4W97 A;  2HOE A;  1SFE A;  3F8C A;  4RM2 A;  4BAC A;  2DOF A;  2HKO A;  2DDB A;  3B73 A;  3BR0 A;  2A6T A;  4KMU X;  3A2K A;  2IGO A;  3I58 A;  1Y39 A;  2KRH A;  2F5D A;  1MND A;  3FKJ A;  3WGH A;  3N05 A;  1U0J A;  4ENN A;  3WTU C;  2EZI A;  4HLX A;  4HA8 A;  4N4O B;  4PCQ A;  2DOE A;  2LF7 A;  2K85 A;  4GYG A;  1R1T A;  2EFN A;  2A6H F;  4BU2 A;  1FBU A;  4NQW A;  2IS4 A;  2F5F A;  3HZJ A;  2LRD A;  3WU1 B;  2BVM A;  1OYW A;  4LLL A;  3FX3 A;  1WSU A;  2LKP A;  2DA4 A;  5GAE J;  4HDV A;  4RM3 A;  2XSD C;  1A6Q A;  3ABM H;  2E34 A;  3W2A A;  4QSH A;  3KYD B;  4I6Z A;  1X1C A;  3I64 A;  1XS9 A;  2W1O A;  2OTL I;  1TQP A;  1WPK A;  2R7U A;  1SAX A;  4BGD A;  1FLI A;  4A3I J;  3NWT A;  4HPQ A;  4XM3 A;  2LMD A;  2A61 A;  2JT1 A;  2FUG 2;  1IUF A;  1SAN A;  4ESB A;  1FSE A;  5ERI A;  2P7C B;  1TWH J;  2ELJ A;  1EH6 A;  3A4C A;  4KIS A;  4YFN F;  3S15 J;  2ZC2 A;  1J75 A;  2NS0 A;  2QUF A;  4IEJ A;  3ASO H;  4PJ0 C;  1H9G A;  5CVJ A;  2CUZ A;  3K2A A;  5CQE A;  3NAR A;  4A93 J;  4KIB A;  1OMI A;  1TL8 A;  4AVZ A;  1MBH A;  4UNO A;  3CJN A;  4L9V A;  2HEO A;  1APL C;  3RQ4 A;  3RI4 A;  1NK3 P;  1MH3 A;  5EEA A;  3OS1 A;  1B72 B;  4C9Y A;  4QPO A;  2P6T A;  5DTD A;  2E5Z A;  5C4J J;  3TED A;  3HHH A;  4BEH B;  4OMY A;  4MQ9 F;  3I0T A;  1AKH A;  2BY2 A;  1P92 A;  1WGX A;  1V5G A;  2W00 A;  4OAZ A;  1P7J A;  2QSF X;  4JX5 A;  2XC7 A;  3MVP A;  2VJI A;  4EGY A;  1WQ2 A;  4ASN A;  2V1N A;  2LY1 A;  4V2G A;  2HYF A;  1R1V A;  5KVR A;  1YS7 A;  2G0E A;  2HQN A;  4Y3O A;  3BR3 A;  4M3D A;  4MGR A;  3DWL E;  5M5Y J;  2QA4 I;  5TRD A;  1T38 A;  5EYR A;  2ZXW H;  1XMK A;  2QEX I;  1HXD A;  4U7D A;  2VJ5 A;  3L00 A;  2CV2 A;  3VOE A;  4NDL A;  3LWF A;  1IAW A;  4DBQ A;  2VI6 A;  3CUQ C;  1V4R A;  1DUX C;  5GPC A;  1UJ8 A;  3I9V 2;  2HTS A;  4RGS A;  1UFM A;  5ICG A;  2L01 A;  2KRC A;  2YU9 J;  4Z6Y A;  1FC3 A;  1FEX A;  4HBL A;  2IW5 A;  3S93 A;  2XF7 A;  2DN0 A;  1YG2 A;  2DXI A;  1OCO H;  2LG4 A;  3ZOB A;  3S3M A;  2M9H A;  2KP6 A;  5HS8 A;  1ZLK A;  2AHQ A;  5E18 F;  1VQ9 I;  1BM9 A;  2GA1 A;  3IWF A;  1ZAO A;  1I1G A;  3F0C A;  4HEA 2;  4M73 A;  4XOR A;  4XKW A;  4Y13 A;  3JRD A;  2RKH A;  1FZP B;  1D0Z A;  5F04 A;  3GFJ A;  3KLO A;  3WE3 A;  2BHZ A;  1JKQ C;  3CC2 I;  1YYV A;  5EZG A;  1B72 A;  3KX2 A;  1P2F A;  1Q1H A;  2HXO A;  1G4D A;  5L3B A;  1A04 A;  1MMN A;  5L3C A;  1RKW A;  4BEH A;  1R7J A;  1O57 A;  3OWT A;  1AU7 A;  4IHY A;  1FOK A;  5JR3 A;  2I8D A;  3P9C A;  4GCV A;  2V79 A;  3S8P A;  2VXD A;  5FLM J;  3OY9 A;  3SQN A;  3REO A;  2F6C A;  2XIG A;  1S3J A;  3CP2 A;  1B9N A;  1OCZ H;  1X19 A;  4WXH A;  1U8B A;  1W5S A;  1JKP C;  3I71 A;  3EUA A;  2MH2 A;  4MLO A;  5KK1 A;  2Z99 A;  4HNT A;  3LNQ A;  1IDY A;  1VQ7 I;  3JSO A;  2DI3 A;  1O4X A;  3GX4 X;  5LGU A;  3IV5 A;  1IXC A;  3TOB A;  2KLO A;  1MJA A;  3Q9V A;  2ZNY A;  4A3J J;  4W1U A;  2R5Z B;  1BJA A;  4XN0 A;  2FX0 A;  3K4B A;  5FRN A;  1ZGA A;  4V2F A;  2MLG A;  3GCM A;  4FAS D;  5B1A H;  2V7F A;  2HQA A;  3J7Y J;  2L3D A;  3FMR A;  5BOX A;  2RGV A;  4ON0 A;  3VB2 A;  2QCO A;  4GXO A;  4DGW B;  3L2V A;  1G3Y A;  4AU7 A;  2ZJP F;  1W36 C;  3CJQ B;  1XTA A;  2FD5 A;  5DM6 F;  1JHH A;  1Z7L A;  2H1K A;  2FMY A;  1JHF A;  2MAB A;  2JN6 A;  4UVC A;  2NNN A;  5E3L A;  4ZDL A;  2A6E F;  4ZC3 A;  5LHI A;  2MC3 A;  2L7M P;  3QYF A;  4IX7 A;  4E7I A;  1EA3 A;  2E5N A;  3L1P A;  1X4P A;  4HOB A;  3ZN0 A;  5GP9 A;  3ML6 A;  3OYH A;  1HF0 A;  4WXD A;  1BI3 A;  3I5U A;  5TGT A;  3BCB A;  2KPM A;  1STZ A;  2UXX A;  3KP3 A;  5CQG A;  5D6E A;  4S0H B;  3Q5F A;  5IY5 H;  1SEU A;  1JJ6 C;  5ICE A;  1HW2 A;  2JSC A;  4O5V A;  2VOO A;  3A02 A;  4I7H A;  3MEX A;  2GM4 A;  1IN7 A;  5H2F C;  5ILU A;  1ZR4 A;  1K4T A;  5KNL A;  2DT5 A;  5HVQ C;  4P9U A;  2STT A;  2B63 J;  5IYB J;  1GV5 A;  4EV0 A;  2O5R A;  2CH0 A;  3LSI A;  2EQR A;  2R5Z A;  4B43 A;  2RQP A;  1ZR2 A;  2NXN B;  2QGU A;  1IJW C;  4XOP A;  4DNC A;  2IP2 A;  4PJL A;  2PEX A;  3BDD A;  3S2W A;  3GTP J;  4ZYG A;  2HPI A;  5IYC J;  1FTZ A;  3Q0U A;  2DJN A;  2PQ8 A;  4HNV A;  2L9N A;  1RUO A;  1ZEL A;  2MGQ A;  4XIC A;  3GME A;  1OJL A;  3A01 A;  2A5W A;  5ILV A;  1I27 A;  1GLN A;  4YEL A;  3W6J B;  1FP1 D;  4AD9 A;  2DK5 A;  3I4P A;  3KZZ A;  3OYJ A;  1X2M A;  2BOL A;  1W5T A;  3ZMT A;  5EJC A;  3RYR A;  1N75 A;  3HKZ A;  2ZCW A;  5ILS A;  3HKZ N;  2DW4 A;  1GVD A;  3PUB A;  4M74 A;  5E20 A;  3OIO A;  1MW7 A;  5FKO A;  3HRU A;  3DPL C;  5FGM A;  4D9J A;  1WJF A;  2FBI A;  1RES A;  2QKM B;  4I99 C;  2L7F P;  5LGT A;  1IUY A;  5CLS A;  3OR2 C;  2VOD A;  1FYL A;  2K86 A;  4RGR A;  1KU3 A;  2BYV E;  2NRA C;  4JOM A;  2DTZ A;  2GOX B;  4MIM A;  1JE8 A;  4AID A;  1A31 A;  2DPU A;  1CF7 A;  2CQN A;  2QQA A;  1BOB A;  3JAM Z;  3R6S A;  1O3Q A;  1VQL I;  3AL0 C;  5KHD A;  3DEW A;  3H35 A;  3ZRG A;  3SDG A;  3O3K A;  2IBD A;  2JK3 A;  2PMZ A;  2WTE A;  1TWF J;  2HI3 A;  5BS6 A;  2PMZ N;  2W25 A;  1JUM A;  1Y8Q B;  3LA3 A;  2BY0 A;  4L18 B;  4B44 A;  4J00 A;  2KIF A;  3LMM A;  4KN7 X;  3U2R A;  4HF1 A;  3CJT B;  3DLL F;  3WTX C;  3F8N A;  4XL9 A;  4BYY A;  1R36 A;  3J80 Z;  4D7M A;  3HOY J;  5EEG A;  3LST A;  3HSE A;  4Y15 A;  4BAY A;  3CCU I;  1WJE A;  1J2X A;  2KRF A;  3FKI J;  3N97 A;  4EM1 A;  3KP6 A;  2O7O A;  5FD6 A;  1G6N A;  3RDI A;  4U87 A;  1LVA A;  4I09 A;  2ZNZ A;  3CLQ A;  1GT0 C;  3K4L A;  5EEH A;  4XKC A;  3WTY C;  1VQ6 I;  5D6F A;  3B02 A;  2R7Z J;  4QLC U;  4G8X A;  3FZV A;  1MH4 A;  2HWV A;  2OCC H;  1KYZ A;  4XLH A;  3PIP F;  3GTQ J;  1VI0 A;  2CWE A;  4JK1 X;  1DQU A;  1R5I D;  3OYN A;  1E3P A;  2IVM A;  3VDX A;  2CV1 A;  4B8X A;  3F3X A;  1I6H J;  3PQK A;  2EIL H;  1QZE A;  2F4I A;  4A5M A;  4A0Z A;  2L9R A;  2QWW A;  4XQF A;  2V9P A;  3CMM A;  1K7A A;  1EF4 A;  2QQ8 A;  3EPZ A;  1G3W A;  2ETH A;  3HDD A;  1GHC A;  5K5R A;  4WF2 A;  2Y0S N;  2ELH A;  2HXI A;  2RNG A;  2J5P A;  2O6G E;  2IGM A;  4XKV A;  1IN6 A;  1HBX G;  1SMT A;  2HOS A;  5JLW A;  3HRT A;  2FOK A;  2ZXI A;  2QEN A;  2DTR A;  2R7Q A;  3QQA A;  3BG3 A;  4UB8 C;  1E2X A;  4YFK F;  5HLI A;  1YO5 C;  4CO8 A;  2YPR A;  5IT3 A;  3OV8 A;  1RZ4 A;  2E71 A;  3U21 A;  1W7P B;  3K4J A;  3J7A Y;  1YQA A;  1HCR A;  4ZJZ A;  2EB7 A;  2O3F A;  3M8E A;  2BXY A;  3H3Z A;  3WTV C;  3ULQ B;  1ETV A;  1XC5 A;  1BW6 A;  2D1V A;  2EIJ H;  5FKK A;  3DPU A;  2DOA A;  3E6M A;  2KIM A;  1MJ9 A;  1KQ8 A;  2NVY J;  3GZN B;  2M8E A;  3PQJ A;  3CCQ I;  2L7Z A;  4A5N A;  2JA8 J;  3GTO J;  2XV4 S;  1MNE A;  3ERM A;  1ZN2 A;  2R7O A;  2VLA A;  2K4B A;  2QM3 A;  5EG0 B;  1IV6 A;  4C2U A;  4UVA A;  2XPV A;  2JPC A;  3M3Y J;  3H1C A;  4IPA A;  3R0A A;  1LPQ A;  2VT2 A;  4R1H A;  2ELK A;  2WB1 A;  3M9A A;  5IP7 J;  2WB1 N;  3SJM A;  1RUN A;  3DKX A;  4P55 A;  2LKS A;  3HOU J;  2HDC A;  1ZRF A;  5D4S A;  4D7N A;  5IOY A;  4NC7 A;  2Z2S B;  2MYS A;  3C18 A;  3SZP A;  5HNF A;  1XSD A;  2O03 A;  2FE3 A;  2B9S A;  2ZME B;  3ZP5 A;  1BJZ A;  3D5S C;  2R4G A;  2R7R A;  2XPU A;  2F4O B;  1OIS A;  4KIT B;  3HC7 A;  1W7P A;  4HST A;  1GV2 A;  1U9O A;  2ME6 A;  3C7J A;  2CS3 A;  1SD7 A;  1BN5 A;  2ZXH A;  1JTY A;  3KP2 A;  4OIN F;  2AQF A;  4UXN A;  3MKZ A;  1YTY A;  4LG0 B;  3VEP A;  1SMY F;  4CCJ A;  4A6E A;  1ETO A;  2LH9 A;  3K4M A;  1JXS A;  2HPM A;  5GTI C;  1QRY A;  1N25 A;  4YIF A;  3H9J A;  5J1Y A;  2HYG D;  2WA0 A;  3TW6 A;  5HOD A;  1LQ1 A;  4M6X A;  4P5O A;  3EUH A;  3RPQ A;  5EG0 A;  2XDV A;  1ETY A;  1USS A;  2TCT A;  4RLQ A;  4BXX J;  4F91 B;  1B9M A;  3JRH A;  4BY1 J;  3JRB A;  1YW8 A;  2N8G A;  3QU6 A;  1VTN C;  1JJ8 C;  1FNN A;  2GXB A;  1ACI A;  2K9Q A;  2ICW G;  4OIO F;  3ABT A;  2MC4 A;  5M5W J;  1S9H A;  2Y69 H;  1WJD A;  2QSH X;  3E6D A;  1NG7 A;  4L9T A;  2CO5 A;  3ZQI A;  5L3F A;  1OCC H;  1TW3 A;  2X6O A;  4BH9 A;  4LGW A;  3P7N A;  3HTU A;  2VBY A;  3OYK A;  5DUK A;  3E5Q A;  2XB0 X;  3WHC A;  4E7S A;  3TBI A;  4EGZ A;  2FBK A;  2XF6 A;  3CF5 F;  2HZT A;  5HDN A;  4XBF A;  1IZ1 A;  1XSV A;  2PLY A;  3DF8 A;  1R5G A;  3QPS A;  5DV5 A;  3HB9 A;  2XKP A;  4XLA A;  1GUU A;  4I01 A;  4Q4Z F;  4FHT A;  3W2W A;  2L9S A;  3PNT A;  1WJ5 A;  4M9Z A;  1A35 A;  5EGO B;  2HS5 A;  1RET A;  3BTJ A;  4II2 A;  1J0R A;  1I3Q J;  2EV6 A;  3CTA A;  1YHQ I;  4GDF A;  1IN5 A;  3IAS 2;  1F1Z A;  2D45 A;  2VQC A;  4KIC A;  1E3O C;  3ZMD A;  3S2D J;  4M3E A;  3GF2 A;  4ZDP A;  2ISY A;  3ASN H;  3RPU D;  3TW7 A;  3GTK J;  3QOE A;  4XN3 A;  4A6D A;  2JQ7 A;  1I50 J;  3HPG A;  1D8J A;  3OYA A;  3J7A O;  2H27 A;  4AVP A;  1K79 A;  3BR5 A;  1SD4 A;  2WAE A;  5GAG J;  1RR8 C;  2P5L C;  3BJ6 A;  4Z2Y A;  4C30 A;  4CYD A;  2HKX A;  2EFW A;  1Z67 A;  4AIJ A;  2CUF A;  5D5W B;  2FU4 A;  4JBA A;  1TZL A;  3HOT A;  4O6J A;  5LEK A;  2HR3 A;  5DYM A;  1OR7 A;  1X1A A;  3SYT A;  4B48 A;  2X0L A;  3W2V A;  1UST A;  3QRF F;  5FLX K;  3H0D A;  4ESJ A;  1VQ8 I;  2VKE A;  4MEY F;  2UWM A;  1J9I A;  2R92 J;  1MBF A;  2Q0O A;  4AIK A;  3QAH A;  2VPL A;  3DTE A;  2LLK A;  4NBQ A;  3HBL A;  5DD4 A;  2JMW A;  1S7A A;  5E3N A;  1JTX A;  2OBP A;  2NVX J;  3IH2 A;  4A3B J;  5KAI C;  5HLH A;  3N4M A;  1KU7 A;  2LD5 A;  1ZHF A;  2PI0 A;  2GA2 A;  1F4K A;  4RGU A;  4WX9 A;  2M30 A;  2O8X A;  3OOP A;  1SFK A;  1B6A A;  1R1U A;  1DGW Y;  5F08 A;  1ZYR F;  3ZGK A;  3I3L A;  3BG6 A;  3FXJ A;  1L0O C;  4A3L J;  2Y2Z A;  3ABU A;  3JTH A;  1ZQ3 P;  1YJN I;  3ROU A;  3EUH C;  1FOY A;  4IRG A;  5IPA A;  2P7V B;  3H36 A;  4D5F A;  1XGN A;  3CCS I;  3BG9 A;  4IHX A;  2DT6 A;  5J3L A;  1T2K A;  3CUO A;  2QSG X;  4L5E A;  2IRF G;  3AG4 H;  2LRE A;  3CC4 I;  1DU6 A;  1I39 A;  3ISP A;  3DTI A;  3PFI A;  1UB9 A;  2Y0M A;  4C2T A;  3RZD J;  2Z16 A;  2MH9 A;  3H3U A;  3V7C A;  2YU3 A;  2EPF A;  1O7F A;  2XAF A;  3KP4 A;  1ETW A;  3H5R A;  2YX4 A;  4EJT A;  2HZD A;  2AO9 A;  2EFP A;  1BL0 A;  1SVM A;  2FRH A;  1I5Z A;  1YJ9 I;  1H8A C;  2ZME C;  1ETQ A;  3DPT A;  2CQX A;  3TOA A;  1YIT I;  4UV8 A;  2IXS A;  3HRS A;  1R22 A;  4UVB A;  2GZW A;  1S29 A;  1RPW A;  3OOU A;  2CW8 A;  3EDP A;  5B3S H;  2HVR A;  4IHV A;  1R58 A;  2V4J C;  5LEJ A;  1YI2 I;  1TC3 C;  2K9L A;  1B4A A;  1DGR M;  3FBN B;  3BR2 A;  2VXZ A;  3CP8 A;  3OL3 A;  2D5V A;  4Q5S F;  3GUD A;  4CCN A;  2KDZ A;  2OQR A;  5IT9 Z;  2LBF B;  2KIS A;  4F7Z A;  4JYK A;  5C4X J;  3QP6 A;  1IRG A;  2B7E A;  2E1M B;  3ONQ A;  3AKZ A;  2XAG A;  2XB5 A;  3HXL A;  2H8W A;  2EZH A;  2Y31 A;  1WJC A;  1XMA A;  2XUB A;  3TO7 A;  2Z33 A;  1FJL A;  5HLT A;  4XR6 A;  4PGG A;  1PVE A;  2EZL A;  3T1B A;  2DO7 A;  1X1B A;  3QWL A;  5FRM A;  2O9L A;  2DAO A;  2XGX A;  1E17 A;  3ESW B;  3GO5 A;  4HDU A;  4BJ6 C;  2XPW A;  4XLP F;  3WU2 C;  3V8J A;  2M3A A;  2FNP A;  1R5H A;  3DTK A;  2E60 A;  1QGP A;  3FIW A;  4F52 A;  1OR7 C;  5LBQ A;  3O6B B;  2F5E A;  2KZG A;  1K6Y A;  3FHZ A;  2EZK A;  3IH4 A;  3H3V K;  1T98 A;  1P4W A;  3ZPL A;  2XRN A;  5LRS A;  1T33 A;  4XRS A;  3AL0 B;  2MG4 A;  2ECC A;  2EV0 A;  2OQG A;  3HPH A;  3GYH X;  3V8L A;  2VB6 A;  2XF5 A;  1O3S A;  3ELK A;  2DDA A;  5M3M J;  1GXP A;  3S1R J;  4HG2 A;  2L54 A;  2A3S A;  5DCM B;  2NOG A;  2W84 A;  2ZFW A;  1A6I A;  2LBF A;  3CMY A;  2OV7 A;  2RNJ A;  4RBO A;  3P9K A;  1ZG1 A;  3L2W A;  3I59 B;  5E1Z B;  1XGO A;  4HNU A;  2EH3 A;  3K10 A;  3QPH A;  4A3G J;  2HQR A;  4N0B A;  3LOC A;  3MKY B;  1XG1 A;  4KYW A;  2P8T A;  1QPI A;  5FLV A;  1O3T A;  4RB3 C;  4G7Z F;  5A2Q K;  4KIF A;  2G7U A;  2H6C A;  5TIS C;  5GPA A;  5JVT A;  1FYK A;  2V9K A;  4N4N B;  2E2H J;  2WAF A;  4CCL A;  3GTG J;  3G6E I;  2P4W A;  2Z9O A;  4ZYD A;  4UB6 C;  4OIR F;  3HIF A;  5LGN A;  4CHU A;  3S1M J;  1HC8 A;  3E1S A;  1MSE C;  2XRL A;  3JW4 A;  3K4N A;  2E1O A;  1H0M A;  2MA3 A;  4HV5 A;  2Y30 A;  2LYC A;  3S16 J;  1SFU A;  5K5Q A;  4A0X A;  2BW3 B;  1ENH A;  5KAF C;  1Y1W J;  9ANT A;  3MD2 A;  1ETX A;  4LLG F;  3TDU C;  3IH3 A;  1E3H A;  3K4C A;  4MFE A;  5K7H A;  2L4A A;  4HZF A;  3LAP A;  4MEX F;  1S72 I;  1IC8 A;  2M45 A;  4UUS B;  3F72 A;  1AA7 A;  1BIB A;  2RVC A;  1YW7 A;  3TL4 X; 
#chains in the Genus database with same CATH homology
 1G8X A;  3LMM A;  3OYG A;  2VKH A;  1Z3X A;  3AFH A;  2JA2 A;  5HOO A;  2VQH A;  2HNH A;  2VKD A;  2W7N A;  4PSW A;  4XL9 A;  3E0J B;  2BVL A;  1IRX A;  4IKF A;  2L2O A;  1T0F C;  4OWR B;  3UR3 C;  3CF2 A;  1WJE A;  3KEY A;  4BL0 B;  4HRI A;  4CCO A;  4U87 A;  1QHH D;  3SEQ A;  3OS0 A;  3K4L A;  4XKC A;  2V26 A;  3OYI A;  4BUP A;  4XLH A;  4XLE A;  2DJI A;  2WAQ A;  3QOD A;  3VYS B;  3OL4 A;  2VJJ A;  1DQU A;  3OYN A;  2ZSH B;  3VDX A;  4BJ5 C;  1Z3Y A;  4XOT A;  2DCE A;  3SDB A;  3OYE A;  4E7J A;  2CV1 A;  3DLA A;  3H5N A;  2R7T A;  3D5R C;  2F4I A;  1QU3 A;  2IS2 A;  4XQF A;  3CMM A;  4Y33 A;  3EPZ A;  4XLC A;  2BW3 A;  3C2H A;  5CPR B;  2V6E A;  4YEJ A;  2KZV A;  2RNG A;  3PL8 A;  4LIV A;  4NNJ A;  4PFO A;  4CZC A;  1UAA A;  3S32 A;  2IGM A;  2KMU A;  4PK4 A;  2ZFU A;  4ANJ A;  4XKV A;  4J01 A;  4DOZ A;  4F3Q A;  2RRE A;  3OYF A;  4BDZ A;  2ZXI A;  2W82 A;  2JUG A;  2R7Q A;  1WJA A;  4ZDO A;  1LVK A;  1MMD A;  3DU6 A;  1R6R A;  1D1C A;  3U21 A;  1FMW A;  3K4J A;  3J7A Y;  4ZJZ A;  3OYM A;  4CSW A;  2CW7 A;  3LL7 A;  1D1A A;  2VIX A;  1PJR A;  3RSN A;  2X85 A;  3CES A;  3DPU A;  2DOA A;  3IUO A;  2E1M C;  2KHM A;  4H4K C;  2WAD A;  4CUG A;  1WFX A;  3SEZ A;  2LC2 A;  1MNE A;  2M7B A;  3OR1 C;  3BC8 A;  2M0M A;  2R7O A;  4PJM A;  4BQQ A;  2VLA A;  1Y56 A;  1ERD A;  4B47 A;  4D1Q A;  4C2U A;  3LSH A;  4DJA A;  1UG0 A;  2VJ4 A;  2XAU A;  4R79 A;  2WB1 A;  4NQW B;  2KQR A;  4BE2 A;  3ZR8 X;  4P1W A;  2Q1Z B;  3DKX A;  3HL2 A;  4G6T B;  3SZG A;  4BJT A;  3PFY A;  1X4O A;  4NC7 A;  3UNG C;  3VWB A;  2Z2S B;  2MYS A;  4LIU A;  3VYT B;  1D1B A;  5HNF A;  1OLT A;  2M4K A;  3VSK A;  3D5S C;  3RTR A;  1V5F A;  4DIQ A;  1V5E A;  1YX5 A;  1P9Q C;  2R4G A;  3OIQ A;  4KT6 A;  3DEE A;  2R7R A;  4XKB A;  5KCM A;  3FDY A;  4BS9 A;  2K3P A;  2UV1 A;  1TT0 A;  4KIT B;  2X6X A;  3HC7 A;  4LG3 A;  4HST A;  3OMY A;  3A1Y A;  3G2B A;  4CH7 A;  2WY8 Q;  3DU5 A;  2CS3 A;  2ZXH A;  2IGN A;  2R7V A;  4PUS A;  2AQF A;  3OS2 A;  3MKZ A;  3H9Q A;  4NC8 A;  3VSL A;  4CCJ A;  2LH9 A;  3K4M A;  4NUB A;  2HPM A;  3D5L A;  2HU9 A;  4RM2 A;  4BAC A;  2GOM A;  3H9J A;  3K6G A;  2WA0 A;  2A6T A;  2K5C A;  3A2K A;  2JVH A;  2IGO A;  3QYB A;  2KRH A;  4P5O A;  1MND A;  3C2G A;  4F93 B;  2XDV A;  3FKJ A;  4CCM A;  3N05 A;  1U0J A;  4EAT A;  4OAY A;  1WJB A;  3BCA A;  3H9G A;  4N4O B;  4RLQ A;  4Y4R A;  4F91 B;  3KYL A;  4BE0 A;  4BU2 A;  2IS4 A;  3RCO A;  2LRD A;  4QPQ A;  4ZTF A;  2BVM A;  4PJN A;  2MC4 A;  4RM3 A;  1QHG A;  2IS1 A;  3LSM A;  3W2A A;  1S9H A;  3CJR B;  4F55 A;  1X1C A;  1WJD A;  1NG7 A;  2W1O A;  2R7U A;  3TMO A;  4BGD A;  1D0X A;  3NWT A;  4HPQ A;  4XM3 A;  1BR2 A;  2HVS A;  2FUG 2;  2VQL A;  3OYK A;  3BLY A;  3S3N A;  4E7S A;  2X1D A;  2MD0 A;  2ELJ A;  3TBI A;  2XF6 A;  3A4C A;  3HG9 A;  4KIS A;  4BE1 A;  1N78 A;  3LSG A;  1FMV A;  1MMA A;  4XLA A;  2CUZ A;  5CQE A;  3W2W A;  2L9S A;  4B3X A;  4AVZ A;  3PNT A;  1T95 A;  4II3 A;  1WJ5 A;  3RQ4 A;  3BG7 A;  4CCK A;  3OS1 A;  4II2 A;  1HA8 A;  4C9Y A;  3OYB A;  4QPO A;  3IAS 2;  2E5Z A;  2VQC A;  4BEH B;  4ZDP A;  2W00 A;  4OAZ A;  1W36 D;  1V5G A;  3RPU D;  2OC6 A;  2M4G A;  2KDO A;  2XC7 A;  3QOE A;  2L7K A;  4XN3 A;  3FBI B;  2VJI A;  4BDY A;  3HPG A;  1VZ0 A;  3OYA A;  2V1N A;  2LY1 A;  2JSP A;  3LSK A;  4XMY A;  2WAE A;  3PNV A;  4IZZ A;  4Y3O A;  4PFP A;  4C30 A;  3DWL E;  1D0Y A;  4FET A;  5LD2 C;  1TZL A;  5LFA A;  3HOT A;  2VJ5 A;  2CV2 A;  2R7S A;  4DBQ A;  1X1A A;  2K9M A;  2WY7 Q;  3I9V 2;  2VQG A;  3SYT A;  4B48 A;  2NOJ B;  3W2V A;  2KRC A;  3H0D A;  2XSJ C;  4BXF A;  2UUZ A;  2UWM A;  3QYE A;  3HUG B;  3S93 A;  2VPL A;  3DTE A;  2XF7 A;  2DXI A;  2F5V A;  2LG4 A;  3ZXS A;  3S3M A;  2MFZ A;  2KP6 A;  3F9K A;  3L2Q A;  4XON A;  2R7W A;  4HEA 2;  4XOR A;  1DP3 A;  4XKW A;  2LY2 A;  1D0Z A;  2OUM A;  1SFK A;  1DGW Y;  3ZGK A;  3KX2 A;  3I3L A;  3BG6 A;  5JHF A;  2CFO A;  1MMN A;  3HOS A;  4RLF A;  4BEH A;  2VL8 A;  3EUH C;  3OWT A;  2I8D A;  1E0E A;  3S8P A;  2DT6 A;  4GRI A;  2VXD A;  1LFP A;  3OY9 A;  1MMG A;  3CZ6 A;  2LRE A;  2F6C A;  3CP2 A;  2HDW A;  3DTI A;  3IP4 B;  1X19 A;  4C2T A;  2Z16 A;  3EUK L;  2KL4 A;  3K70 C;  3EUA A;  4MLO A;  3L2U A;  4HNT A;  3H5R A;  4IQ4 A;  4BQN A;  2HZD A;  1YX3 A;  4YRV A;  4E7Z A;  1NG6 A;  3VYU B;  1BR1 A;  2KLO A;  3DPT A;  1X1D A;  4XN0 A;  2IXS A;  3K4B A;  4X0G A;  3LFU A;  3OOU A;  3FHN A;  5FRN A;  2CW8 A;  4FAS D;  3DQV C;  2V7F A;  2HQA A;  2HVR A;  2PJR B;  1G59 A;  2V4J C;  2ZSI B;  2CUJ A;  3L2V A;  1BR4 A;  4DGW B;  2K9L A;  4PJJ A;  1DGR M;  3FBN B;  2HVQ A;  3W3C A;  4AU7 A;  1W36 C;  3CJQ B;  2VXZ A;  1LDK B;  3OYL A;  3CP8 A;  1Z7L A;  3OL3 A;  3OYD A;  4CCN A;  3PNY A;  3K70 D;  2MAB A;  4E7H A;  2LBF B;  2X1C A;  4E4H A;  3GBG A;  4ZDL A;  4ZC3 A;  3H5A A;  4E7L A;  4ZYA A;  2E1M B;  3QYF A;  3ONQ A;  3AKZ A;  4IX7 A;  4E7I A;  1EA3 A;  2E5N A;  3K4K A;  1X4P A;  3ZCO A;  3IAM 2;  3HXL A;  3OYH A;  3PSI A;  1WJC A;  2DT7 B;  3VYR B;  4CA0 A;  4XR6 A;  5HLT A;  2X1E A;  5TGT A;  1JI8 A;  3BCB A;  2KPM A;  4XNF A;  4XLF A;  1J09 A;  1X1B A;  2Y0S A;  5CQG A;  5FRM A;  1SAU A;  3OIP A;  4BJ6 C;  3MKW B;  5KNL A;  2R7X A;  5HVQ C;  2M3A A;  1UEL B;  3DTK A;  2E60 A;  1Z21 A;  2O5R A;  4F52 A;  2CH0 A;  1OR7 C;  3LSI A;  5FRO A;  4LIT A;  4B43 A;  3M1C A;  1K6Y A;  1KON A;  1Y6I A;  3OYC A;  3DKY A;  4XOP A;  4PJL A;  2WBM A;  3PSF A;  2X51 A;  2X6Y A;  2HPI A;  2PJR A;  1YE9 A;  2L9N A;  1ZEL A;  3AL0 B;  4F92 B;  2A5W A;  3HPH A;  2VB6 A;  2XF5 A;  4KJZ A;  3MMY B;  1GLN A;  1N77 A;  2P0W A;  4JQF A;  4HG2 A;  3S3O A;  4YEL A;  4E7K A;  4U7B A;  2LBF A;  2OV7 A;  4E6K G;  3OYJ A;  2LOO A;  3L2W A;  3PJR A;  3ZQQ A;  4ZTJ A;  2CV0 A;  2BOL A;  4HNU A;  3K10 A;  2W4S A;  3MKY B;  1N75 A;  3HKZ A;  5HNH A;  2QKL B;  3PUB A;  2VAS A;  2V9K A;  4RMN A;  4N4N B;  1MW7 A;  2WAF A;  4CCL A;  3DPL C;  4D9J A;  1WJF A;  2QKM B;  2X6W A;  3OR2 C;  3E1S A;  2Q2E B;  3K4N A;  3V42 A;  4JOM A;  4IQJ A;  2GOX B;  2M7A A;  2Z1D A;  2LYC A;  4BQO A;  2AQE A;  1LKX A;  1BOB A;  2L5Q A;  3AL0 C;  5KHD A;  3H35 A;  2RQQ A;  3ZRG A;  2BW3 B;  2PMZ A;  2CMP A;  4DBR A;  3MD2 A;  2JVG A;  3NWS A;  4HSR A;  3K4C A;  4AYB A;  3M8J A;  1PYV A;  4B44 A;  3L2R A;  4PSX A;  4ITV A;  2IGK A;  2IS6 A;  1AA7 A;  5CKT A;  4J00 A;  3TL4 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...