4IX7A

Crystal structure of the insv-ben domain complexed to its dna target site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
114
structure length
114
Chain Sequence
DNVMVSIGPNNTCVPASVFENINWSVCSLATRKLLVTIFDRETLATHSVTGKPSPAFKDQDKPLKRMLDPGKIQDIIFAVTHKCNASEKEVRNAITTKCADENKMMKIQNVKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*TP*TP*CP*CP*AP*AP*TP*TP*GP*GP*AP*A)-3'
publication title The BEN domain is a novel sequence-specific DNA-binding domain conserved in neural transcriptional repressors.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 36
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10523 BEN BEN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ix7A00
4IX7A 4X0GA
chains in the Genus database with same CATH superfamily
3ISPA 1KU9A 3V8JA 4QPOA 2R5ZB 3PM1A 1VFCA 1MMNA 4EM0B 4D1QA 2CQXA 1ZQ3P 3U9GA 3RJPA 3CP2A 2Z2SB 4YIFA 2CU7A 2XGDA 3H36A 1ZK8A 2W24A 3ABLH 2KRCA 2X51A 3LL7A 3L7WA 4E70A 1WJDA 3QU3A 5J40A 3K70D 2V4JC 2MW8A 4XLNF 3HKZA 4KITB 1R71A 5DYMA 1RESA 4A3FJ 1ERDA 3G1MA 5K7HA 4JQFA 1OCOH 3H5RA 5FFXA 4PUSA 4DZJA 1APLC 3GTJJ 2QSHX 1BI1A 2QBYB 4DOZA 2WA0A 3JAMK 4B47A 3HEFA 2XKOA 3JCUC 3DTEA 4OOIA 2XGXA 4CDGA 1HKTA 4P5OA 4E7JA 1JKQC 5DD4A 3V42A 2DCEA 3DEUA 1X1PA 1W7PD 1IN5A 1T6SA 3OYEA 2BE5F 4S0HB 3ZQIA 4HRIA 1MBKA 2GOXB 3M4OJ 2HPIA 4XBFA 3GTKJ 1A6QA 3ZMVA 4HF1A 2VLAA 3FXOA 1MIJA 3BR1A 4O3MA 3GTGJ 1U5TB 2IBDA 1Q1VA 2KIMA 3K4KA 4A3BJ 2LY1A 3I54A 3CCJI 4BQAA 2XB0X 1H9TA 1LNWA 5ILUA 4HEA2 2VQLA 2XAJA 3J7YJ 3WE2A 1YE9A 2YX4A 2EZLA 3HIFA 5FKKA 2FNPA 4PGGA 3I4MJ 3FMSA 5IP6A 4BQQA 1WWXA 3FXQA 5KVRA 2VJ4A 3ZMDA 1ZLJA 3E6CC 3D0SA 1ZLKA 2F4IA 3OYFA 3HOSA 5DUIA 5E20A 4LG3A 2P81A 4AWXB 3TEDA 2DODA 2KZVA 5C4JJ 1YW8A 1XCVA 1ETYA 2ME6A 5IY5H 3A01A 4NC8A 1W36C 2HOAA 2JK3A 5D8LB 1HBXG 3FZVA 5EZHA 1JKPC 2MABA 4XONA 3SZTA 2BEOA 2VPRA 3FK6A 3IAS2 3RIRA 3U2RA 2EFPA 3LSPA 1TWAJ 2X6OA 1FOYA 3DV8A 3F8MA 3H3ZA 3SQNA 1R6RA 1O4XA 2M4GA 3I5UA 5CVUA 3BG3A 2R7WA 3MVPA 1VQ8I 3I59B 2V6CA 4JYKA 5EGOA 2QA4I 2JWTA 5K5OA 2XGCA 1QZEA 4A0ZA 2IGNA 4I01A 4L0YB 4FHTA 1I3QJ 4NC6A 5F1JA 4Y15A 1TLHB 4AC0A 1T39A 4HX8A 4MLOA 2BGCA 1I3AA 1Z6TA 3O8HA 1MZBA 4OIRF 5M5YJ 2Y2ZA 4RDUA 2H94A 1NK3P 4OIOF 3OYDA 3ABTA 4WWCA 2QZ8A 1GV2A 2BVMA 3GEZA 5GAGJ 2LF7A 1QQIA 3M7GA 3A2KA 1MW7A 2EIKH 2XDVA 3CMEI 1Q1HA 1GUUA 5LEKA 2VKVA 5AIQA 3FWEA 1ZARA 5JVGF 4B3XA 1B8IA 2JA2A 3OS1A 2LDUA 4AIDA 3KYLA 3KIOA 4PFOA 3J7AY 1J5YA 3HSEA 2DMQA 5H6QA 2EH3A 3GTMJ 1SMTA 2JTVA 2NS0A 2DT7B 3KPHA 1JE8A 4V2FA 4IX7A 5BMZA 1VQKI 5L3BA 1VQ4I 1FOKA 1H88C 1X2NA 3PO3J 4OWRB 5HVQC 3S1NJ 2ZKZA 5GAHJ 1FBQA 5CKTA 2VJ5A 3PFYA 2M4KA 3AG3H 1MNEA 4MGRA 1XGOA 2QVOA 5GP9A 3S1MJ 3HRTA 2HOTA 1VTNC 1Z21A 1FBUA 1P7JA 1DUXC 1UZCA 2MA3A 4OU0A 3LFKA 1KQ0A 3DFGA 3GO5A 5TJJA 2UXNA 2DI3A 1B4AA 1FT9A 3FISA 4J19A 2NVXJ 4I99C 5TGTA 2RGVA 5E1WA 5HNFA 2QSFX 1PJRA 3OSFA 4PSWA 1KU2A 1WJCA 2F5CA 4ZYEA 3ZMUA 3OOPA 3MZ8A 4AVPA 2LBFA 2MBFA 3MKZA 1R36A 3K2AA 1GHCA 1JUMA 1ZRFA 2W4SA 2VQGA 1R1VA 2MH9A 1R22A 2DOFA 3AKZA 2R92J 1XGMA 1UJ8A 4FTHA 2JRMA 2WAQA 4M3BA 1D8JA 4GCVA 4CO8A 4CYCB 4CGZA 2VQCA 4I98B 1SAUA 1YG2A 3CCEI 3B73A 2M8EA 2LY2A 3HUGB 5E8GA 2FJ1A 2ME0A 3OL3A 2FBIA 2OD5A 3KP4A 1X4PA 4XMYA 4BHPA 3A0BC 5L3FA 5DCFA 3CMYA 4HSRA 4CCMA 1IGNA 2W00A 3IAM2 1U9NA 3OYIA 5FKMA 2UXXA 3MZHA 1HCRA 1J7KA 2BY0A 5FLVA 2K86A 2Y0SN 4P9UA 2HYFA 1BOAA 1H0MA 5KAIC 2YS9A 3VSKA 2VOOA 3JRGA 4RS8A 3J80K 2VPLA 2LREA 2M0CA 2VASA 3OY9A 3O6BB 2PEXA 2L7ZA 3KP5A 2H6BA 1UG2A 3K7AJ 4U7DA 2VN2A 4Q5SF 3K70C 2N8GA 3OYNA 3ONQA 1LKXA 3RZDJ 2HOSA 3S14J 1LEAA 1T0FA 1OKRA 1B1BA 3K9TA 3CDIA 1YIOA 1YOVB 4KJZA 3UNGC 3WG9A 4AUXA 3OS2A 3IH3A 2CV0A 5B3SH 4O5VA 3S17J 5L3GA 2QLZA 1I1GA 1S6LA 5KAFC 4RAFA 2LVSA 4U0VA 2EWNA 3K6GA 4ANJA 2BV6A 2VC0A 1Z91A 2Q0OA 5CYVA 3SZGA 2ICWG 3NARA 1ON1A 2DJIA 2E1CA 1QPMA 2XAFA 4M71A 5CQGA 3TO7A 4OIPF 2IRFG 4LG0B 4BS9A 2R5YB 5FLXK 3LSTA 1UFMA 2LF8A 2A05A 4HSTA 1P4AA 3LSJA 5LGNA 2UZKA 1W5CC 4HAMA 1SD5A 2CRGA 3E6BA 5CVIA 3CCLI 2HPMA 1LB2A 2FRHA 4B3AA 5M5WJ 1XSDA 3JRFA 4DGWB 2HDWA 4A3CJ 2HKXA 3DBHB 1O3RA 2EFNA 5DCMB 2HZTA 3CUQB 2FMLA 2QEXI 3BG9A 4XICA 2FA5A 4A5NA 1BIAA 1N78A 5F1RA 2UWMA 3QP6A 1RR7A 4MEXF 3A0HC 3KCCA 2DOEA 2XV4S 4QPQA 1MJAA 1USSA 1ZKGA 3S93A 3SDGA 4F3QA 2XIGA 3OV8A 2NVQJ 4K2EA 2GBYA 2HZDA 1JJ6C 2CV2A 3TO6A 4XLFA 2ZMEC 1QPIA 1WFXA 2IT0A 5F6FA 3DKWA 3HRUA 4EATA 4UY8I 2R7XA 3I0TA 2K9LA 1BR2A 1TT5B 2JVGA 3GBGA 3OIQA 3E6MA 2W7NA 1OYWA 1W7PA 3O8GA 1G3YA 2Q2EB 3WU2C 4ZDLA 3GVAA 1FEXA 1XMAA 3HPHA 1WI3A 1GLNA 1R5HA 5H2FC 5GADJ 1ZRDA 1RR8C 4HV6A 3QOEA 3B6CA 3QOPA 2NS8A 1G59A 4HYEA 5K5RA 3TOAA 2CSOA 2L9RA 1J9IA 2DA1A 4IXAA 2OV7A 1XS9A 2CQ7A 4CZZA 1D1BA 1YYVA 4HF2A 2M2EA 2DA4A 1VQ6I 3ABMH 4YRVA 1NH3A 2RAEA 4ZDPA 1K78B 1ORKA 1LE8A 2KL4A 3BJ6A 4BEHA 3SZPA 4BBRJ 2L9SA 3F0CA 1EA3A 4N0BA 1MH4A 5FLMJ 5F08A 5EG0B 4RM2A 1VQ9I 3OMYA 1WH7A 1HW2A 3A03A 2NVUB 3G4SI 4EGZA 4GO1A 5E79C 1Y1WJ 4A6DA 1O7LA 2X6WA 3DBLB 3O2PE 4C3HJ 3P5JA 3H3UA 4YG2F 1T2KA 1YS6A 4G12A 1BIBA 4M3EA 4NC7A 4E7KA 3LWFA 2VQHA 3M8EA 2VKHA 2JPCA 4CCOA 2FX0A 2HYGD 4LJZF 2BW3B 1DGWY 3OYMA 2DTZA 1F36A 5HLIA 4IPAA 4PJJA 2EPFA 4AD9A 4DYQA 3OYBA 2AQFA 3GZNB 3KZIC 1MDMB 1B72A 4C3JJ 4Y52J 1IXCA 2V1UA 2BBYA 1MMDA 1RUOA 5HLHA 1ITYA 4JOMA 2CYYA 4ESFA 2L54A 3CJNA 3TBIA 2CQNA 2D1VA 4UUSB 4UB8C 3WTUC 1F5TA 1EF4A 4IHWA 3ERED 2GAUA 3B02A 3RKWA 4FASD 3RI4A 1R4NB 4FETA 4M6VA 4J01A 1IN7A 4L9TA 1XD7A 3C2BA 3F8NA 3ZMZA 2EFWA 4KNYA 1Z9CA 3QQAA 5DV5A 4OIQF 2QQ8A 3SEQA 1LDJA 5LRSA 5FFZA 4BJTA 2HTSA 5DDGA 2MD0A 2NOGA 1WZ2A 1GV5A 2FBHA 2W57A 2ZJ2A 3TW6A 3ZQGA 4BE2A 2B9SA 4U7BA 1U78A 4E6KG 3NQOA 1YW7A 4P96A 4KIFA 5L3EA 4M6YA 4FX0A 4A5MA 1C0WA 1O3QA 1UELB 2GA2A 2COMA 1BC7C 2DYRH 2VOPA 4WXDA 1OYYA 2JPBA 4HBLA 4XLAA 2DBBA 2KIFA 2XHKA 4IEJA 1E17A 2DPDA 5CPRB 2PMZA 3COAC 3HBLA 3K4JA 4CA0A 2X9DA 3BOQA 3HRMA 2VONA 2OF7A 1Y0NA 2E2IJ 3CF5F 2QWWA 5IT9K 2VUMJ 2FEZA 2QKLB 3I58A 3IP4B 5CQEA 2K7LA 1TL8A 3WTTC 2X6XA 2BZTA 3CC7I 3KP6A 3DBRB 2R7RA 1BM9A 1Z05A 2QCOA 4IOCF 1K7AA 3RPQA 1F9NA 1AA7A 4OMYA 2VC1A 3IKVA 3GZ6A 1OCRH 1TNTA 2XB5A 3IUOA 1AHDP 3W2AA 1ACIA 3X2QH 3P9KA 2VKDA 1X4OA 3V7SA 2A3SA 2FE3A 2LNBA 2CWEA 3DP7A 2UUZA 3QPSA 1W0UA 3ABKH 5IYCJ 1AKHB 4A3DJ 2Y69H 4I09A 4C2TA 1BR1A 2WV0A 2EZKA 4A93J 4G6QA 1LFPA 1HKQA 4IF4A 2WWYA 2M7BA 2DT6A 2CJJA 3I9V2 1IAWA 1BN5A 4JX5A 3VDXA 1WVRA 5D6EA 3AG2H 5LHIA 2JSPA 3KX2A 3PL8A 4ZZLA 4QLCU 1VQ7I 1B9NA 2V1XA 4D5CA 3K2ZA 3E6DA 2LH9A 4GXOA 5F64A 3RCOA 1Z6RA 3VYTB 3WTZA 4E4HA 4D7MA 3ZMSA 3AG4H 1XTAA 3L2RA 3GMEA 3I64A 3F3XA 1BI0A 4BGDA 1IUYA 1TNSA 2A68F 1W0TA 4HLYA 1UHSA 2CUJA 2L3DA 4BQOA 2WAFA 3KEOA 4Y3OA 4XLEA 2RN7A 3ZMTA 1U6GA 5FRNA 3FKJA 3DLAA 4CCJA 2FOKA 3N97A 4ZH4F 1TWHJ 4M6XA 2DFFA 3AL0C 4U0WA 3OOUA 1GXPA 2HTJA 1ZRCA 3C1DA 4R1HA 4RB1A 1OCPA 3SJMA 5M3MJ 2MLKA 3HGYA 5D6FA 2M3AA 5FGMA 4CHUA 1VNDA 2HXOA 3FHZA 1WJFA 4MEYF 4EJVA 2DFEA 1XPXA 1HW5A 1AWCA 3ZPLA 2WB1A 2W25A 3IRRA 4NNJA 2DA6A 1EJ9A 3MKWB 1WH5A 5HLTA 4Q47A 2MH2A 5EZGA 4XORA 2A61A 2F6CA 4BXUA 3T0YA 3C18A 1OPCA 1OCTC 1FTZA 1VQOI 1YLFA 2L7MP 4BKXA 5J8CA 1SFUA 2HS5A 1N75A 4G94A 3RKQA 5BQTA 5GTIC 2FU4A 3Q0UA 5LLQA 2VXDA 1E3PA 3MKLA 4NQWA 1EH6A 1GT0C 3CF2A 1RPWA 2V9KA 3M3YJ 4BH9A 1E3OC 2GWRA 3D5SC 1Z3XA 2M34A 2CS3A 4I76A 3GTOJ 3H0GJ 2GIZA 2XC7A 3K0LA 3OSGA 1ZREA 4LLGF 3GFJA 1MNDA 3CDLA 4WCGA 3R61A 2R7ZJ 1RIOH 3PSFA 1TW3A 4F7ZA 2CUZA 4XOTA 5IOZA 1L3LA 1JT0A 1V4RA 1MKMA 2VIXA 5J6XA 1A35A 4BYYA 3EPZA 2YSRA 2ZFWA 1LPQA 2PJPA 1FX7A 2M1BA 2M5WA 2HEOA 1ZH5A 3GWZA 3L00A 4I02A 2QBYA 2O3FA 2L9VA 4GYGA 2ZB9A 2IA2A 4LB5A 4B44A 2CQKA 3ABUA 3W6VA 3H9QA 5H6RA 2RREA 2A6HF 2QM3A 3RYRA 4XIDA 3HHHA 2V7FA 1T08B 2RVCA 1IN6A 3P9CA 3QYBA 1K4SA 4II2A 2P7CB 2L2OA 4D9JA 4G7HF 4JBAA 5TISC 4OAYA 3P9IA 2JA7J 1S7AA 3D5LA 1U5TA 2A5YB 2HQRA 2IA1A 2F48A 2VL8A 1IG7A 3HKZN 3T8TA 3F6OA 2DK8A 3ZQCA 4M72A 2RDPA 1LEBA 3BR3A 1IRZA 1HSTA 1PYVA 1XDUA 3KZYA 4N4NB 1TTYA 2QYOA 4KN7X 4EMSA 3M8JA 2CW8A 3CD6I 1T8IA 2CW0F 3CLQA 3PNVA 3CZ6A 1G3WA 1R58A 4A0YA 4HF0A 4S04A 2PX9A 4MHGA 3L2QA 3V4GA 2GA1A 1D0ZA 3BR6A 3BC8A 1EKEA 2X6YA 3S2WA 3GLXA 1SMYF 1ZGAA 3K4CA 1MMGA 4W1UA 4S05A 2ID6A 3WU0A 2HGCA 2R4GA 2V1DA 3GTPJ 3WHCA 3IKTA 3BCBA 3TOBA 1V5GA 4D5FA 3E0JB 3CCMI 3EYYA 3HTUA 3WHBA 2AS5F 5FB2A 3KYDB 1R1UA 3I59A 5HS9A 1UAAA 4ENKA 3RQ4A 1JHFA 1H9GA 2E1NA 1RKTA 3H9GA 2NRAC 2L7KA 2WY7Q 3KYCB 4LMYA 4XR6A 2R7VA 4NBQA 1BW5A 4G8XA 4PFPA 3BZKA 1KZHA 2ZXHA 4B1RA 1X3UA 5KNLA 3PNYA 2DMTA 2VXZA 5AONA 5E3OA 3S32A 1E2XA 1FOWA 4M9ZA 1S72I 1FTTA 2RKHA 4A3MJ 4M73A 4LLLA 2AXTC 2DA5A 4HZFA 2WV1A 1Z7LA 2FBKA 1I6HJ 3RYPA 2CG4A 5D5XB 3AAFA 2FQ4A 4IHXA 2E5NA 1WSUA 4HQMA 1WI9A 1A04A 5K5QA 3UR3C 3KLOA 4F92B 1KGSA 1D0XA 4O6JA 2LD5A 1KU7A 1DP7P 2H1KA 1R5GA 2OTLI 2O0YA 3V7CA 1YFHA 3WTVC 4JX6A 2IGMA 2AO9A 5JHUA 3S3MA 2PG4A 2KDZA 1ON2A 2EBIA 2FNAA 1BJZA 2JN6A 3EQLF 1EV7A 3QAHA 1VQMI 4X1EA 2CFOA 4B8XA 3H1CA 1RRJA 2GXBA 5DUKA 3HOTA 5A2QK 1REPC 3K4MA 3IC7A 4HX4A 5ICEA 3F6VA 1VQPI 1G4DA 1TWGJ 1WGXA 1WCMJ 2BY3A 1MBJA 3E3VA 3P7NA 5BS6A 3LSHA 2QGUA 3TP0A 2Y9ZA 2EILH 3WGGA 3CC4I 4KYWA 3KFWX 1JGGA 4BXFA 3TKYA 5ED4A 1T0FC 1X1DA 2Z9OA 2Z5UA 1Z1DA 1ETOA 3DXJF 3SFIA 2LC2A 2M8GX 5F0HA 4P55A 4MTDA 2HWVA 1IV6A 2STWA 4KMUX 3BJAA 1S29A 2HXIA 2ZXJA 2ETHA 4IQ4A 1DPUA 3ZN1A 4WXCA 1D0YA 1GXQA 1XSXA 3GLLA 3DPTA 3J7ZI 4BBSJ 1R00A 3K4LA 2R3SA 5EEHA 4UHTA 2IGKA 3HC7A 5F0CA 3RDIA 2B63J 2Z1DA 4HNVA 4A2UA 2Y0SA 1LDDA 4CYCA 2H1LA 4XLCA 1P92A 5CVVA 3CCQI 2M9HA 3HUGA 3CO6C 2R7TA 5ICGA 1G2HA 3MEXA 1VF9A 3M9AA 2CQQA 4M9SA 3REOA 2IW5A 5EF6A 1Y6IA 1B6AA 4M74A 5E8IA 5C4XJ 5GTHC 2W1OA 2XF5A 4IKFA 3ZXSA 2HI3A 1HKSA 4ENJA 3CCVI 2HKOA 5KHDA 2COBA 4NB5A 2X85A 4Z6YA 3HOUJ 1Z67A 3ULQB 2CFXA 2VT2A 2W82A 2OU2A 4PDKA 5BNGA 3LOCA 5ERIA 5F04A 1VZ0A 4RB3C 1SAXA 2QQAA 2O6GE 2LK2A 3TMOA 1V5FA 4RB0A 1MMSA 2KDOA 2PMUA 3TO9A 3GTQJ 1T98A 4BL0B 5ICCA 2I10A 5FD6A 2WC2A 3QODA 3HOVJ 4RLFA 4GDFA 1HC8A 2EINH 5E1ZB 1SANA 3BT9A 4XKCA 5J4VA 3PO2J 3DKYA 3WTYC 1TP4A 2OZUA 4R8HA 4XSXF 3IRQA 3BY6A 3G3ZA 3FM3A 2KIQA 1MGTA 3OIOA 2RNGA 3MCZA 4YELA 1XX5A 4ENNA 3NEUA 4UVAA 3ZR8X 2M30A 3F8FA 3H9JA 3JR9A 2H8WA 1MNMC 1YIJI 1YW9A 4HQEA 4JX4A 1BI3A 2G0EA 2EJRA 2K85A 4AIKA 2EIJH 3QPHA 2EIMH 2OQGA 4P1WA 3E5QA 4MFDA 3CLOA 3EUAA 1HQCA 2A69F 3I55I 4LG0A 2DFHA 1ZYRF 1VI0A 3A4CA 5D4RA 2E19A 2E1MC 2YUSA 4DNCA 2HVRA 4I2OA 1B9MA 4UV9A 1LVAA 1MMAA 4DBRA 2K4JA 2VB6A 3LA3A 1WHUA 2F5DA 2EZIA 2GM4A 2Z33A 1FP2A 2HQNA 2XROA 5DCMA 3S2HJ 3CUQA 3CCRI 1QBJA 2PJRB 5CVRA 4C9YA 5K7ZA 1DU6A 3VODA 3V8KA 4I6ZA 1I50J 3DKXA 1N25A 3Q3SA 3K4BA 2LFBA 1N77A 1HDDC 4MQ9F 5HS8A 5D5WB 3QPLA 3M1CA 2M7AA 2OCEA 1B59A 2JUGA 3PIPF 2DMUA 2P5VA 2XF7A 4RMNA 4RB2C 1S5LC 2PQ8A 1IRFA 3OYHA 3BZ6A 2IS4A 2CUFA 3LSMA 1ZTRA 1IXSB 1JGSA 1T95A 3F72A 2E36A 2A6EF 2DK5A 3WODF 2OPTA 3CESA 2ACJA 4CZCA 1M1EB 2H8RA 4YFKF 4G9YA 2V9VA 4BACA 1DU0A 1YJWI 1CF7B 2VE8A 2Q2EA 1IC8A 4KIBA 2NS7A 2X4HA 1XMXA 5B66C 1KU3A 1FLIA 3RTRA 2DA7A 3BCAA 2DLLA 4HV5A 2HYJA 2O8KA 5LHGA 3S3NA 1MD0A 3KEYA 3FXKA 4OMZA 3OL4A 2Y75A 3O3KA 3PIOF 3BLYA 4CUGA 3HB9A 2ISYA 1OQYA 4MFEA 1IN8A 2DJNA 1U9OA 3VOEA 1K78A 2JMWA 2KIUA 2LR8A 4I0AA 3T8RA 3J80Z 4WX9A 1A36A 2I8DA 3S8PA 1GVDA 5EG0A 2JUCA 2R7FA 1UB9A 3IHUA 2PMHA 1SD7A 2RNJA 3EUKL 5C3EJ 1ZG1A 1Z0XA 1ZG5A 4IO9F 3HSRA 4XRFA 2E35A 3KETA 4GRIA 1K61A 5D4SA 2C6YA 1QA6A 3I56I 1S7EA 3Q0VA 4BEHB 5L3CA 1FJLA 5LD2C 4XSZF 2BW3A 3I3LA 3HG9A 3GX4X 4UVCA 2E34A 4DYRA 1JTXA 4LIUA 1I39A 5HODA 3LSIA 3VYSB 1MDMA 1Z3YA 4AU7A 1G3TA 4XK4A 2OBPA 3TW7A 3ZCOA 1IRXA 2P5KA 3ECHA 1IDYA 3S15J 5E18F 3TGNA 3JTHA 2VT3A 1HF0A 2NXNB 2IP2A 4JK1X 4UUSA 1YJNI 2CGPA 1BW6A 5HDNA 2VODA 3G6EI 2ZJRF 2D1HA 4AM3A 5DM7F 4HOBA 3A02A 2AXLA 3CCYA 3TQNA 1IF1A 4AYBA 4UUTA 2JRTA 2ZMEB 3AFHA 3JRBA 3ZGKA 2P5LC 4B09A 2OTJI 2R7OA 3LAPA 2KRFA 1LVKA 1SD6A 2J5OA 3FK7A 4BHCA 3FMQA 1K4TA 2LP0A 3HHGA 2L4AA 2KZGA 4IRGA 2MFZA 1R9TJ 3L2VA 3W6KB 3HZJA 3HGGA 2F4OB 2OUMA 2TRTA 3HM5A 1WJ5A 4WK8F 3MZYA 1Z7UA 4CCLA 1NG6A 5KK1A 4LK1F 3BG5A 3WE3A 4GFBA 1RNLA 2DDBA 2ZCWA 3FXJA 3S1RJ 3M07A 4XKWA 4BY1J 3J81Z 2E7WA 4CXFA 1KONA 2ZO4A 2ZBKA 2B0LA 4LLNA 2XRLA 1WJEA 2ECBA 2ESHA 5FD5A 1P4XA 3T5XA 3KEQA 1FNNA 4IJAA 3D1NI 4KT5C 2ZSIB 4ESBA 5LRRA 2R7UA 1YS7A 2YR2A 3BR5A 4P9FA 4YFXF 4KA4A 3PSIA 2F2EA 1YRNB 1I1SA 2K27A 3EUHA 2IJLA 3S1QJ 2G7HA 3MQ0A 2NVTJ 4U88A 3F23A 1KQ9A 3OIPA 4XRSG 3G71I 1BA5A 1XCBA 3QYFA 3FXUA 3QRFF 3HDDA 1AKHA 1S9HA 3GFLA 2LG4A 4QIWN 3FMRA 3ZQFA 5J1RA 4WXHA 2HOEA 3BZCA 4PSXA 4EJWA 1YQAA 3QP5A 3NWSA 4WF2A 4IHTA 2KHMA 1FY7A 2O61A 4OINF 4A3KJ 2KP6A 2XPUA 2VBYA 5IYBJ 3V8LA 2X1EA 2HU9A 2R93J 3IV5A 3RZOJ 3CCSI 4XKVA 5D5VB 1D8KA 3VEPA 1U2WA 2MC3A 3LSGA 1HLVA 1O7FA 3E5UA 3HYIA 3Q0WA 4L9VA 2VJJA 3N05A 5K1YA 2V6EA 3MAJA 1FMWA 2Y30A 4HDUA 2K3PA 3PQKA 4LFUA 1JKRC 1TBXA 2QUFA 4XN0A 5D8KB 3E5XA 3IWFA 1A31A 3QWLA 5LGTA 1Y0UA 5DD8A 3I4PA 4ZJZA 2E2HJ 4J00A 3S16J 3VSLA 2UV1A 2DTRA 4HLXA 3GW2A 1ETXA 3K1PA 1HOMA 1TC3C 5TRDA 3SEZA 1YJ9I 3BTLA 2VI6A 2F5VA 2Z99A 2ELJA 2PBIA 3CC2I 1JI8A 1V3FA 4EM2A 3F21A 4PK4A 3BPVA 2WY8Q 3FF5A 3GFMA 4ASNA 2F5EA 2QQBA 1FC3A 1WRJA 4BQNA 1NTCA 5L3DA 4Q48A 4YIIA 4KIGA 1PUEE 1QRYA 3RKYA 2ZJQF 1IDZA 9ANTA 3CJRB 2ADUA 4ZYGA 4BJ6C 2MLGA 5JLWA 1Y1VJ 2HDCA 1OMIA 1U0JA 1FOXA 4PJMA 2ESNA 1LJ9A 1SVMA 5FKLA 3ECOA 3GUDA 2HNHA 3ZOBA 1U5TC 1MSFC 2CUEA 4Y13A 5D5UB 4A69C 3VYRB 1TZLA 1MJ9A 4B48A 3OYAA 2WBMA 4M3GA 2STTA 1QZYA 1QGPA 1TWCJ 2DN0A 3U1DA 2BHZA 2X0LA 5E3LA 3HTSB 2NNNA 1JUPA 3FX3A 1YTYA 4M9XA 5JI6A 2MG4A 1JUSA 1X19A 2Y0MA 2R5ZA 2K02A 3ELKA 5IT9Z 1QZZA 2WB1N 2O5RA 4EM1A 1P7IA 1I6XA 1TWFJ 4F93B 1QVTA 3EDPA 2HVSA 1HW1A 2GIVA 3KE2A 1R23A 1PUFB 5F0FA 2L4MA 3BP8A 2L7FP 3ROUA 4BJ5C 3H5NA 1QHGA 3BPXA 3DPUA 1S8NA 4FISA 1FIPA 4FE7A 1HDPA 3ML6A 1H8AC 3RSNA 3JRIA 1X3WB 3GF2A 4RGUA 1RC9A 4LK0F 4LITA 1BOBA 4RAYA 2XPVA 2JA5J 3E97A 2TDXA 2XGEA 3R0JA 2E5ZA 2MD5A 3AL0B 3GFIA 3BTIA 1SEUA 2EFQA 1KYZA 3U21A 1ZAOA 2LKSA 4A0XA 3RQIA 2XVCA 3BR0A 1BL0A 4IZZA 4UVBA 3ASOH 5EYRA 4B43A 3FDYA 4Z2YA 1XG1A 3PNTA 1OR7A 1IXRC 2KJBA 1O57A 2QQ9A 5BOXA 2JJ7A 1V5EA 2BYVE 1AU7A 2OQRA 5GAEJ 4HX7A 5FO5A 1K79A 4L0ZB 4W97A 3VWBA 3MN2A 1Y39A 1VQNI 4EV0A 3IH4A 3S3OA 4EQQA 4XLHA 3MFKA 5J47A 4Y4RA 4L18B 3CCUI 3WTWC 1SFXA 4C3IJ 1TQIA 3HL2A 4I0BA 1FYKA 3C7JA 1CGPA 3DEWA 1YO5C 4XOPA 5GPCA 4FT8A 4PZJA 2IS2A 1TT0A 5E3MA 4HDVA 1IN4A 3CJTB 1T33A 4XM3A 1PVEA 3W2VA 1P2FA 4U0YA 1GVJA 2DDAA 4B4CA 5J3LA 2EB7A 2O7OA 4RGRA 3LAJA 3N4MA 2Q8KA 3K1MA 1R4MB 3OYGA 3WTSC 4KISA 4D7NA 1AOYA 3LA7A 1X3ZB 3L2WA 1YITI 5FRMA 4ON0A 1FBSA 3A01B 2ZNYA 1D5VA 3LQQA 3MMYB 4XRMA 3DLLF 5EJCA 3T1BA 1R7JA 3MWMA 3H0DA 4ZTFA 4AIHA 1RZ4A 3VFZA 2DU9A 3A1YA 2PN6A 5AIPA 1OCCH 3LSRA 3TP3A 1TQMA 4MO7A 1UCRA 1QU3A 1W4MA 1USTA 1O3SA 2Z3YA 4IRHA 1DP3A 1RETA 3CMAI 2Y9YA 2IS6A 5EGOB 2MC4A 1FYMA 1LQ1A 4QWQA 1XGNA 2ID3A 2FD5A 4C30A 3S2DJ 2LTPA 1G3SA 3F9KA 3LMMA 2M45A 3R4KA 1QNTA 2XAGA 4LGWA 4EVIA 5FJ8J 5FROA 1EH8A 1R1TA 2KKOA 4CSWA 3TL4X 2IXSA 1D3YA 2BVLA 1IO2A 3JSOA 1ETKA 1SFEA 1IJWC 2FF4A 2DA2A 2DFIA 1ZGWA 4GGGA 1T38A 2OJED 1SFKA 2DXIA 5LFAA 2YU9J 1A5JA 1XGSA 4RM3A 3DEEA 1HXDA 3L2CA 1LFUP 1B8IB 5HS7A 3JAMZ 3HOWJ 2E60A 5KCMA 1X1AA 2FSWA 4KUMA 5ILSA 1FSHA 2MSYA 2GQQA 2HFHA 2EK5A 2ZFUA 1ODDA 1KQ8A 1KYWA 1DPRA 2PLYA 1MBEA 1WKMA 2EA2A 4DBQA 1G8XA 3CP8A 3E7LA 2O8XA 3GZ5A 4F91B 5F27A 2L0KA 2KISA 4RGSA 5EEAA 1GDTA 4F55A 5HDKA 4DW6A 3GXOA 1UMQA 2DQLA 4N4OB 3BG6A 2X1DA 4U87A 1H89C 1ONVA 4DQ2A 2AQEA 1JT6A 2KJCA 2FQ3A 2RQPA 4G6DA 2E1OA 3LQRA 4MNUA 4RAZA 4BUPA 4A3GJ 1CQTA 2X1CA 1OJLA 2WADA 4DYCA 5LGUA 2VJIA 2JZYA 2DQRA 4L5IA 3RPUA 1NG7A 1YI2I 4HPQA 2Y31A 2R7SA 3FBIB 4XLPF 2IEKA 2P8TA 4IHYA 1D1AA 2HVQA 5EEGA 5JLXA 4TV7A 3HPGA 5IT3A 4XL9A 5JHFA 2HQ5A 2MYSA 5HLGA 2LBFB 4ETSA 2JVHA 4A3LJ 2HDDA 3M1EA 5IP9J 3PUBA 1XMKA 2K9SA 3KP2A 1BBYA 5CLSA 2IVMA 2KMUA 4LB6B 5C44J 2DYSH 1FIAA 1STZA 2FUG2 1MBGA 1ZR4A 2XASA 1Y56A 4L5EA 2Z16A 2NAZA 3DU5A 4CH7A 1ZELA 3W3CA 2VBZA 4CCNA 4YIRX 1UHMA 2E2JJ 3FHNA 4FQGA 1ZG3A 3CUQC 3JRDA 1JTYA 1JHHA 2OC6A 1HSJA 2EFOA 4A6EA 4FCYA 1P4WA 1WJAA 2TCTA 5IYDJ 2J5PA 4ZDOA 2WAQN 2LLKA 3M8FA 3W6JB 1U8RA 3QPTA 4KFCA 2RQQA 1XSVA 3NAUA 2PI0A 1D1CA 2GOMA 4RAGA 4ENMA 4XNFA 3HXLA 1SVOA 3L2UA 2ELKA 2EA4A 1R49A 1J2XA 4PJNA 3KLNA 4NHJA 4MQVA 4XKBA 1E3HA 4CYDA 3FKIJ 3BTJA 2XUBA 2XAHA 2V79A 3BR2A 4RBOA 1ENHA 2XAQA 1FPQA 1F43A 5CJ9A 1V55H 1BR4A 4DJAA 1OFCX 1SD4A 2K9QA 2FMYA 2FOWA 1MBFA 1OYIA 1RI7A 4M3DA 3H35A 4KDPA 3Q9VA 4RLQA 3DU6A 1E0EA 1J75A 3MKYB 3D5RC 4UB6C 4PJLA 2R5YA 3L09A 4UXNA 3KP7A 3ESWB 3I53A 4C2UA 1IRGA 3WU1B 1FMVA 5A2QZ 3LNQA 5IP7J 2DW4A 1W5SA 4LD5A 4QTRA 4X0GA 3HOYJ 2DAOA 3L1PA 5BPIA 4N9IA 2ZXIA 1RUNA 1LDKB 2CW7A 1FWZA 3CDHA 2KPMA 1ETVA 3H92A 3CUOA 2B7EA 2Q1ZB 1YX5A 3JREA 2K40A 1HA8A 2M0MA 3BROA 4ZTJA 2DMNA 2PJRA 4F52A 2GLOA 3GTLJ 4KICA 2K4BA 4A3IJ 3HJEA 2W84A 2IGOA 4YEJA 4R79A 4GYIA 2VE9A 3CJQB 2H6CA 4HW0A 4PJ0C 2EZHA 2NNYA 1DGRM 1J59A 4OAZA 4NUBA 2WAEA 2GXAA 3W2WA 1J09A 1MJBA 1MH3A 4E7IA 2LRDA 2YPRA 1FZPB 2V9PA 3BQZA 1WPKA 4AIJA 3H5AA 3DPLC 5H20A 5LHHA 2MGQA 4E7SA 3UKGA 4BNCA 4ZYAA 2IAIA 1X2MA 2CO5A 1QHHD 1ZGJA 3R60A 3SYTA 4XN3A 1PP8F 2FXAA 2QF7A 4BU2A 2VBXA 2VKEA 1NK2P 3F8BA 2OA4A 3J81K 1CF7A 2PFBA 1U3EM 5E1XA 3RKXA 2KQRA 2Y48A 3VPRA 2M87A 3ZQHA 5IOYA 2JQ7A 4ESJA 2JA6J 2IS1A 1BI2A 3G73A 1G6NA 3NRVA 3K10A 5LEJA 2DOAA 3IWZA 1JKOC 3E1SA 5JR3A 1KA8A 2DO7A 4G7ZF 5J1UA 2QKMB 1W7PB 3DF8A 4L9NA 3ZP5A 1FP1D 1XB4A 2YX7A 2XSDC 3DTIA 2H27A 4L5JA 4EEFG 4LOCA 4RA2A 1OISA 2L9NA 2EV6A 3G1LA 3VB2A 2BHYA 2JA8J 2WTEA 4X6AJ 3JRHA 1Z77A 3IH2A 3K69A 2E1MB 3AG1H 4A3EJ 1ULYA 2P4WA 2BOLA 2VBWA 4M3FA 1LE8B 2A07F 1QO0D 3FXLA 4IL6C 3JRAA 2QENA 3DQVC 1NHAA 5HDGA 3GYHX 1S7OA 5HOOA 4Q4ZF 5IPAA 3J7AO 3WG7H 1TQPA 3ERMA 3FIWA 4Y17A 4HNTA 1RKWA 4G6TB 3HRSA 3EUHC 1X58A 2KFDA 1XDSA 1ZHFA 4II3A 2W48A 1T56A 3BDDA 3FM5A 5K7FA 1D5YA 3BQYA 4ABZA 3K1NA 2GZWA 2BY2A 2V26A 3F8CA 1IUFA 4IOAF 4BDZA 3WTXC 1B72B 4D0PA 5FLXZ 3R6SA 2DMPA 2ZMEA 4PGHA 2BXYA 4EJTA 4IHSA 4NDLA 2R0QC 1ETWA 2E7XA 3C2HA 1FSEA 2F4MB 2KT0A 3LSKA 6PAXA 1BJAA 1L0OC 1XN7A 4ZC3A 3VYUB 2LY9A 5B5EC 4FX4A 1DDNA 2CV1A 5B1AH 2JT1A 4BE0A 4HG2A 5FKOA 4BHBA 1SVLA 2XKPA 2D5VA 3KP3A 2OCCH 3FXMA 1YHQI 1W5TA 3IL2A 2R7DA 2ZC2A 4EGYA 3JSPA 4IHVA 2H09A 2K5CA 2P6TA 2L01A 2K9NA 2HQAA 2P7VB 3EETA 2DA3A 2L02A 4LIVA 1K6YA 2X48A 1ZN2A 1YX3A 2P0WA 2KRHA 3BTCA 3L9FA 4N9HA 1J0RA 3B6AA 5ILVA 3BWGA 2E71A 5B1BH 1U8BA 2HR3A 2I5UA 1Y8QB 2RC4A 4AYBN 1X1BA 2D2WA 1O3TA 1F4KA 4QSHA 4BDYA 3BG7A 3FXRA 2LKPA 1P6RA 2OZ6A 1S3JA 5FKNA 1W36D 3R0AA 5DTDA 3K4NA 3DTKA 3BJOA 5DS9A 3Q9SA 4ZYHA 1YRNA 2YU3A 1BC8C 2AHQA 4UV8A 3JTGA 1DQUA 1IZ1A 3TDUC 1VQ5I 5J1YA 3SFZA 3OYCA 4UNOA 2IA0A 3H3VK 5DEQA 5E3NA 4XQFA 1Y8RB 3SHFA 3OR1C 3LFUA 1SC7A 4DZPA 5E17F 1OCZH 1ETQA 1R5ID 4ZYDA 3QYEA 3OS0A 3RPUD 1JXSA 3OYKA 4L9JA 2PMZN 2DT5A 4ZZDA 3OYLA 3JW4A 1POGA 5EDNA 4G7OF 2ECCA 2CH0A 2KLOA 2LKXA 1UHWA 2ZXWH 1MBHA 3I4NJ 2QSGX 3CO7C 3FBNB 4C2MJ 4Y7NJ 2EV5A 2O9LA 3C2GA 3OR2C 3CTAA 3SDBA 2LMDA 3U1KA 4A12A 2K3FA 3WGHA 4HA8A 3Q5FA 2JSCA 4E7HA 3HOXJ 2A6TA 1TW2A 1A6IA 4BE1A 2ELHA 1W1WE 3G1OA 4V19K 2XPWA 3ZN0A 5J4YA 2GXGA 4FE4A 1X1CA 2EV0A 5M5XJ 3V7RA 4XRSA 2P6SA 1I5ZA 4YFNF 4E7LA 1WQ2A 2R7QA 3MD2A 4IQJA 1WJBA 4BY7J 2ZNZA 4CICA 3HSFA 2V1NA 3DCFA 3PQJA 3PUFA 3SXYA 1LUJB 2O03A 2ZJPF 4IRIA 4A3JJ 4EJUA 4HNUA 2LSOA 3C3WA 4MTEA 1LFBA 1PP7U 3PFIA 1K83J 2BY1A 3JRCA 1P9QC 5ICFA 1EH7A 3CMMA 3LA2A 2L5QA 4E7ZA 1F1ZA 5LBQA 3HOZJ 2BXZA 2ISZA 1ZR2A 2CMPA 2XAUA 1VQLI 3ZQLA 2RV8A 2NOJB 2OAZA 4I7HA 5M3FJ 3ASNH 4BXXJ 2LOOA 4DIQA 1XC5A 2XRNA 5J8FA 3G2BA 5CVJA 4RGXA 1IV8A 1PDNC 3DWLE 3OYJA 4AVZA 2W85A 4PCQA 1MSEC 4KMFA 2IPQX 1OR7C 4H0EA 4BAYA 5HNHA 4IVNA 3WGIA 1OLTA 1I27A 3TDZC 2D45A 4JP0A 1V54H 4UUVA 2F5FA 4MIMA 3QU6A 1JJ8C 5JFRA 5DM6F 4KN4X 2LYCA 3PJRA 1UG0A 2DPUA 3NWTA 2NVYJ 3KZZA 3F22A 1K6OA 1SFOJ 3OWTA 4H4KC 2EQRA 3GCMA 5JVTA 2G7UA 5GPAA 1FYLA 2XF6A 2G9WA 4V2GA 2XSJC 3ZRGA 4ITVA 5BPDA 3EYIA 4EJOA 1IW7F 2A5WA 3ZQQA 3ZQ7A 4NQWB 1PUFA 4CCKA 2ZSHB 3I71A 4KT6A 4Y33A 3CQZJ 2NYXA 2K9MA 1QVUA
chains in the Genus database with same CATH topology
2E60A 5KCMA 1UELB 4QPOA 1MMNA 4D1QA 2PJRB 4C9YA 1X1AA 4XLAA 3CP2A 2Z2SB 3DKXA 5CPRB 2PMZA 3K4BA 3K4JA 4CA0A 1N77A 2ZFUA 2KRCA 2QKLB 2X51A 3IP4B 3LL7A 3M1CA 2M7AA 1WJDA 5CQEA 2JUGA 4DBQA 3K70D 2V4JC 1G8XA 2XF7A 3CP8A 4F91B 3HKZA 4RMNA 4KITB 3OYHA 2IS4A 4F55A 2X6XA 3LSMA 2R7RA 1ERDA 4JQFA 3H5RA 1T95A 4PUSA 4N4OB 3BG6A 4DOZA 2X1DA 4U87A 2WA0A 1AA7A 3CESA 4B47A 4CZCA 2AQEA 3DTEA 3IUOA 4BUPA 4P5OA 4BACA 3W2AA 4E7JA 2VKDA 1X4OA 2X1CA 3V42A 2DCEA 2WADA 2UUZA 2VJIA 3OYEA 2R7SA 1NG7A 4HPQA 3RTRA 3BCAA 3FBIB 4C2TA 1BR1A 4HRIA 2GOXB 2HPIA 1D1AA 2HVQA 1LFPA 3S3NA 2VLAA 3HPGA 3KEYA 4XL9A 5JHFA 2MYSA 3OL4A 2LBFB 2JVHA 3K4KA 2M7BA 2DT6A 3BLYA 4CUGA 3I9V2 2LY1A 3PUBA 3VDXA 4HEA2 2VQLA 1YE9A 2JSPA 2KMUA 3KX2A 3PL8A 2FUG2 2I8DA 1Y56A 3S8PA 2Z16A 3DU5A 2LH9A 3RCOA 3VYTB 1ZELA 3W3CA 4BQQA 4CH7A 4E4HA 4CCNA 3L2RA 2VJ4A 3FHNA 2F4IA 3EUKL 3OYFA 3HOSA 4BGDA 4LG3A 2OC6A 2CUJA 2KZVA 4BQOA 4GRIA 1WJAA 2WAFA 4Y3OA 4XLEA 4ZDOA 4BEHB 5FRNA 3FKJA 3DLAA 4CCJA 4NC8A 5LD2C 1W36C 2BW3A 3I3LA 3HG9A 2RQQA 3AL0C 2MABA 3OOUA 4XONA 4LIUA 3LSIA 3VYSB 1D1CA 1Z3YA 3IAS2 4AU7A 2GOMA 4XNFA 3HXLA 1IRXA 3ZCOA 3L2UA 2M3AA 1R6RA 2M4GA 4PJNA 2R7WA 4XKBA 1WJFA 2WB1A 4NNJA 2IGNA 3MKWB 4AYBA 5HLTA 1BR4A 4DJAA 3AFHA 3ZGKA 4XORA 2R7OA 3H35A 2F6CA 1LVKA 4RLQA 4MLOA 3DU6A 1E0EA 3MKYB 3D5RC 4PJLA 3OYDA 4C2UA 2MFZA 1FMVA 2BVMA 3L2VA 1N75A 4X0GA 2OUMA 3A2KA 1MW7A 1WJ5A 2XDVA 2VXDA 2ZXIA 1LDKB 2CW7A 4CCLA 1NG6A 4B3XA 2KPMA 3CF2A 2JA2A 2V9KA 3OS1A 2Q1ZB 3KYLA 3D5SC 1Z3XA 1YX5A 2CS3A 4PFOA 1HA8A 4XKWA 2M0MA 3J7AY 4ZTJA 2PJRA 4F52A 2XC7A 1KONA 1MNDA 2DT7B 1WJEA 2IGOA 4YEJA 4IX7A 4R79A 3PSFA 2CUZA 4XOTA 3CJQB 2VIXA 2ZSIB 1DGRM 3EPZA 4OWRB 5HVQC 4OAZA 4NUBA 2WAEA 2R7UA 3W2WA 1J09A 5CKTA 4E7IA 2VJ5A 2LRDA 2M4KA 3PFYA 1MNEA 3PSIA 3H5AA 3DPLC 4E7SA 1Z21A 4ZYAA 3OIPA 4B44A 1QHHD 3SYTA 4XN3A 3H9QA 4BU2A 3QYFA 2RREA 2V7FA 2KQRA 5TGTA 1S9HA 2IS1A 2LG4A 5HNFA 3QYBA 4PSXA 4II2A 1PJRA 2L2OA 3NWSA 4PSWA 3K10A 1WJCA 2DOAA 2KHMA 4D9JA 3E1SA 2LBFA 4OAYA 3MKZA 2QKMB 2KP6A 3D5LA 2X1EA 2HU9A 2W4SA 2VL8A 2VQGA 4XKVA 3AKZA 3DTIA 3LSGA 2WAQA 2L9NA 2V6EA 1PYVA 2VJJA 3N05A 4N4NB 2VQCA 1SAUA 1FMWA 2K3PA 3M8JA 2CW8A 2LY2A 3HUGB 3PNVA 4XN0A 3CZ6A 3OL3A 2E1MB 4XMYA 1X4PA 4ZJZA 3L2QA 4J00A 1D0ZA 2UV1A 3VSLA 2BOLA 3BC8A 4HSRA 4CCMA 2X6YA 2W00A 3IAM2 3OYIA 3SEZA 3DQVC 3K4CA 1MMGA 2F5VA 2ELJA 1JI8A 2R4GA 5HOOA 3BCBA 4PK4A 2WY8Q 3VSKA 1V5GA 4HNTA 3E0JB 2VPLA 4G6TB 2LREA 3EUHC 2VASA 3OY9A 4BQNA 4II3A 3K70C 1UAAA 3CJRB 3RQ4A 4BJ6C 3OYNA 2V26A 3ONQA 3H9GA 1LKXA 2L7KA 2WY7Q 4BDZA 2R7VA 4XR6A 1U0JA 4PFPA 4PJMA 2ZXHA 4KJZA 3UNGC 3C2HA 3OS2A 5KNLA 2CV0A 3PNYA 3LSKA 2HNHA 3VYUB 2VXZA 4ZC3A 2CV1A 3S32A 4BE0A 4HG2A 3VYRB 1TZLA 4B48A 3OYAA 2WBMA 3K6GA 4ANJA 1Z7LA 2K5CA 2E5NA 3SZGA 2HQAA 3UR3C 2DJIA 4LIVA 1K6YA 4F92B 1YX3A 5CQGA 1D0XA 2P0WA 1X19A 2KRHA 4BS9A 2O5RA 2IGMA 4HSTA 4F93B 2HVSA 3S3MA 1X1BA 2HPMA 4BDYA 3BG7A 2CFOA 4DGWB 2HDWA 4BJ5C 3HOTA 3H5NA 1W36D 1QHGA 3K4MA 3K4NA 3DTKA 3DPUA 3RSNA 1N78A 1DQUA 2UWMA 3LSHA 3OYCA 4LITA 1BOBA 4QPQA 3S93A 4F3QA 2E5ZA 4XQFA 3AL0B 4BXFA 2HZDA 2CV2A 3OR1C 3LFUA 4XLFA 1T0FC 1X1DA 3U21A 1WFXA 3QYEA 3OS0A 3RPUD 3OYKA 4EATA 2R7XA 2LC2A 4IZZA 2K9LA 1BR2A 4B43A 3OYLA 3FDYA 2JVGA 3GBGA 3OIQA 4IQ4A 3PNTA 2W7NA 2CH0A 2KLOA 1D0YA 3DPTA 3FBNB 3K4LA 2Q2EB 4ZDLA 1V5EA 3HPHA 2IGKA 3HC7A 1GLNA 3C2GA 3OR2C 3SDBA 3QOEA 3VWBA 2Z1DA 1G59A 3S3OA 2Y0SA 4XLHA 4XLCA 4E7HA 2A6TA 4Y4RA 2R7TA 4BE1A 2OV7A 1D1BA 3HL2A 1X1CA 4YRVA 4ZDPA 4XOPA 2KL4A 2R7QA 4BEHA 3MD2A 4E7LA 1WJBA 1Y6IA 2L9SA 4IQJA 1EA3A 1TT0A 2IS2A 2V1NA 2W1OA 4RM2A 2XF5A 4IKFA 3ZXSA 4HNUA 3OMYA 4XM3A 3W2VA 5KHDA 1P9QC 2X85A 3CMMA 2L5QA 2X6WA 4E7ZA 3OYGA 4NC7A 4E7KA 2W82A 4KISA 2VQHA 3L2WA 2VKHA 5FRMA 4CCOA 2CMPA 2XAUA 1VZ0A 2BW3B 3MMYB 1DGWY 3OYMA 2NOJB 3H0DA 4ZTFA 2LOOA 4DIQA 3A1YA 4PJJA 3TMOA 3OYBA 2AQFA 3G2BA 1V5FA 2KDOA 1MMDA 1QU3A 4BL0B 4JOMA 3DWLE 3QODA 3OYJA 4RLFA 4AVZA 3TBIA 4XKCA 1DP3A 3DKYA 1OR7C 5HNHA 2IS6A 2RNGA 4FASD 1OLTA 4YELA 2MC4A 4FETA 4J01A 4C30A 3ZR8X 3H9JA 3F9KA 3LMMA 2LYCA 4P1WA 3SEQA 1UG0A 5FROA 3NWTA 3TL4X 4CSWA 3PJRA 4BJTA 2IXSA 2BVLA 2MD0A 3EUAA 3OWTA 4H4KC 3A4CA 2XF6A 2E1MC 2HVRA 4BE2A 2XSJC 1SFKA 3ZRGA 5LFAA 4U7BA 4ITVA 1MMAA 4DBRA 2DXIA 4E6KG 2A5WA 3ZQQA 4NQWB 4RM3A 4CCKA 2ZSHB 3DEEA 4KT6A 2VB6A 4Y33A 2K9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IX7 A;  4X0G A; 
#chains in the Genus database with same CATH topology
 3ISP A;  1KU9 A;  3V8J A;  4QPO A;  2R5Z B;  3PM1 A;  1VFC A;  1MMN A;  4EM0 B;  4D1Q A;  2CQX A;  1ZQ3 P;  3U9G A;  3RJP A;  3CP2 A;  2Z2S B;  4YIF A;  2CU7 A;  2XGD A;  3H36 A;  1ZK8 A;  2W24 A;  3ABL H;  2KRC A;  2X51 A;  3LL7 A;  3L7W A;  4E70 A;  1WJD A;  3QU3 A;  5J40 A;  3K70 D;  2V4J C;  2MW8 A;  4XLN F;  3HKZ A;  4KIT B;  1R71 A;  5DYM A;  1RES A;  4A3F J;  1ERD A;  3G1M A;  5K7H A;  4JQF A;  1OCO H;  3H5R A;  5FFX A;  4PUS A;  4DZJ A;  1APL C;  3GTJ J;  2QSH X;  1BI1 A;  2QBY B;  4DOZ A;  2WA0 A;  3JAM K;  4B47 A;  3HEF A;  2XKO A;  3JCU C;  3DTE A;  4OOI A;  2XGX A;  4CDG A;  1HKT A;  4P5O A;  4E7J A;  1JKQ C;  5DD4 A;  3V42 A;  2DCE A;  3DEU A;  1X1P A;  1W7P D;  1IN5 A;  1T6S A;  3OYE A;  2BE5 F;  4S0H B;  3ZQI A;  4HRI A;  1MBK A;  2GOX B;  3M4O J;  2HPI A;  4XBF A;  3GTK J;  1A6Q A;  3ZMV A;  4HF1 A;  2VLA A;  3FXO A;  1MIJ A;  3BR1 A;  4O3M A;  3GTG J;  1U5T B;  2IBD A;  1Q1V A;  2KIM A;  3K4K A;  4A3B J;  2LY1 A;  3I54 A;  3CCJ I;  4BQA A;  2XB0 X;  1H9T A;  1LNW A;  5ILU A;  4HEA 2;  2VQL A;  2XAJ A;  3J7Y J;  3WE2 A;  1YE9 A;  2YX4 A;  2EZL A;  3HIF A;  5FKK A;  2FNP A;  4PGG A;  3I4M J;  3FMS A;  5IP6 A;  4BQQ A;  1WWX A;  3FXQ A;  5KVR A;  2VJ4 A;  3ZMD A;  1ZLJ A;  3E6C C;  3D0S A;  1ZLK A;  2F4I A;  3OYF A;  3HOS A;  5DUI A;  5E20 A;  4LG3 A;  2P81 A;  4AWX B;  3TED A;  2DOD A;  2KZV A;  5C4J J;  1YW8 A;  1XCV A;  1ETY A;  2ME6 A;  5IY5 H;  3A01 A;  4NC8 A;  1W36 C;  2HOA A;  2JK3 A;  5D8L B;  1HBX G;  3FZV A;  5EZH A;  1JKP C;  2MAB A;  4XON A;  3SZT A;  2BEO A;  2VPR A;  3FK6 A;  3IAS 2;  3RIR A;  3U2R A;  2EFP A;  3LSP A;  1TWA J;  2X6O A;  1FOY A;  3DV8 A;  3F8M A;  3H3Z A;  3SQN A;  1R6R A;  1O4X A;  2M4G A;  3I5U A;  5CVU A;  3BG3 A;  2R7W A;  3MVP A;  1VQ8 I;  3I59 B;  2V6C A;  4JYK A;  5EGO A;  2QA4 I;  2JWT A;  5K5O A;  2XGC A;  1QZE A;  4A0Z A;  2IGN A;  4I01 A;  4L0Y B;  4FHT A;  1I3Q J;  4NC6 A;  5F1J A;  4Y15 A;  1TLH B;  4AC0 A;  1T39 A;  4HX8 A;  4MLO A;  2BGC A;  1I3A A;  1Z6T A;  3O8H A;  1MZB A;  4OIR F;  5M5Y J;  2Y2Z A;  4RDU A;  2H94 A;  1NK3 P;  4OIO F;  3OYD A;  3ABT A;  4WWC A;  2QZ8 A;  1GV2 A;  2BVM A;  3GEZ A;  5GAG J;  2LF7 A;  1QQI A;  3M7G A;  3A2K A;  1MW7 A;  2EIK H;  2XDV A;  3CME I;  1Q1H A;  1GUU A;  5LEK A;  2VKV A;  5AIQ A;  3FWE A;  1ZAR A;  5JVG F;  4B3X A;  1B8I A;  2JA2 A;  3OS1 A;  2LDU A;  4AID A;  3KYL A;  3KIO A;  4PFO A;  3J7A Y;  1J5Y A;  3HSE A;  2DMQ A;  5H6Q A;  2EH3 A;  3GTM J;  1SMT A;  2JTV A;  2NS0 A;  2DT7 B;  3KPH A;  1JE8 A;  4V2F A;  4IX7 A;  5BMZ A;  1VQK I;  5L3B A;  1VQ4 I;  1FOK A;  1H88 C;  1X2N A;  3PO3 J;  4OWR B;  5HVQ C;  3S1N J;  2ZKZ A;  5GAH J;  1FBQ A;  5CKT A;  2VJ5 A;  3PFY A;  2M4K A;  3AG3 H;  1MNE A;  4MGR A;  1XGO A;  2QVO A;  5GP9 A;  3S1M J;  3HRT A;  2HOT A;  1VTN C;  1Z21 A;  1FBU A;  1P7J A;  1DUX C;  1UZC A;  2MA3 A;  4OU0 A;  3LFK A;  1KQ0 A;  3DFG A;  3GO5 A;  5TJJ A;  2UXN A;  2DI3 A;  1B4A A;  1FT9 A;  3FIS A;  4J19 A;  2NVX J;  4I99 C;  5TGT A;  2RGV A;  5E1W A;  5HNF A;  2QSF X;  1PJR A;  3OSF A;  4PSW A;  1KU2 A;  1WJC A;  2F5C A;  4ZYE A;  3ZMU A;  3OOP A;  3MZ8 A;  4AVP A;  2LBF A;  2MBF A;  3MKZ A;  1R36 A;  3K2A A;  1GHC A;  1JUM A;  1ZRF A;  2W4S A;  2VQG A;  1R1V A;  2MH9 A;  1R22 A;  2DOF A;  3AKZ A;  2R92 J;  1XGM A;  1UJ8 A;  4FTH A;  2JRM A;  2WAQ A;  4M3B A;  1D8J A;  4GCV A;  4CO8 A;  4CYC B;  4CGZ A;  2VQC A;  4I98 B;  1SAU A;  1YG2 A;  3CCE I;  3B73 A;  2M8E A;  2LY2 A;  3HUG B;  5E8G A;  2FJ1 A;  2ME0 A;  3OL3 A;  2FBI A;  2OD5 A;  3KP4 A;  1X4P A;  4XMY A;  4BHP A;  3A0B C;  5L3F A;  5DCF A;  3CMY A;  4HSR A;  4CCM A;  1IGN A;  2W00 A;  3IAM 2;  1U9N A;  3OYI A;  5FKM A;  2UXX A;  3MZH A;  1HCR A;  1J7K A;  2BY0 A;  5FLV A;  2K86 A;  2Y0S N;  4P9U A;  2HYF A;  1BOA A;  1H0M A;  5KAI C;  2YS9 A;  3VSK A;  2VOO A;  3JRG A;  4RS8 A;  3J80 K;  2VPL A;  2LRE A;  2M0C A;  2VAS A;  3OY9 A;  3O6B B;  2PEX A;  2L7Z A;  3KP5 A;  2H6B A;  1UG2 A;  3K7A J;  4U7D A;  2VN2 A;  4Q5S F;  3K70 C;  2N8G A;  3OYN A;  3ONQ A;  1LKX A;  3RZD J;  2HOS A;  3S14 J;  1LEA A;  1T0F A;  1OKR A;  1B1B A;  3K9T A;  3CDI A;  1YIO A;  1YOV B;  4KJZ A;  3UNG C;  3WG9 A;  4AUX A;  3OS2 A;  3IH3 A;  2CV0 A;  5B3S H;  4O5V A;  3S17 J;  5L3G A;  2QLZ A;  1I1G A;  1S6L A;  5KAF C;  4RAF A;  2LVS A;  4U0V A;  2EWN A;  3K6G A;  4ANJ A;  2BV6 A;  2VC0 A;  1Z91 A;  2Q0O A;  5CYV A;  3SZG A;  2ICW G;  3NAR A;  1ON1 A;  2DJI A;  2E1C A;  1QPM A;  2XAF A;  4M71 A;  5CQG A;  3TO7 A;  4OIP F;  2IRF G;  4LG0 B;  4BS9 A;  2R5Y B;  5FLX K;  3LST A;  1UFM A;  2LF8 A;  2A05 A;  4HST A;  1P4A A;  3LSJ A;  5LGN A;  2UZK A;  1W5C C;  4HAM A;  1SD5 A;  2CRG A;  3E6B A;  5CVI A;  3CCL I;  2HPM A;  1LB2 A;  2FRH A;  4B3A A;  5M5W J;  1XSD A;  3JRF A;  4DGW B;  2HDW A;  4A3C J;  2HKX A;  3DBH B;  1O3R A;  2EFN A;  5DCM B;  2HZT A;  3CUQ B;  2FML A;  2QEX I;  3BG9 A;  4XIC A;  2FA5 A;  4A5N A;  1BIA A;  1N78 A;  5F1R A;  2UWM A;  3QP6 A;  1RR7 A;  4MEX F;  3A0H C;  3KCC A;  2DOE A;  2XV4 S;  4QPQ A;  1MJA A;  1USS A;  1ZKG A;  3S93 A;  3SDG A;  4F3Q A;  2XIG A;  3OV8 A;  2NVQ J;  4K2E A;  2GBY A;  2HZD A;  1JJ6 C;  2CV2 A;  3TO6 A;  4XLF A;  2ZME C;  1QPI A;  1WFX A;  2IT0 A;  5F6F A;  3DKW A;  3HRU A;  4EAT A;  4UY8 I;  2R7X A;  3I0T A;  2K9L A;  1BR2 A;  1TT5 B;  2JVG A;  3GBG A;  3OIQ A;  3E6M A;  2W7N A;  1OYW A;  1W7P A;  3O8G A;  1G3Y A;  2Q2E B;  3WU2 C;  4ZDL A;  3GVA A;  1FEX A;  1XMA A;  3HPH A;  1WI3 A;  1GLN A;  1R5H A;  5H2F C;  5GAD J;  1ZRD A;  1RR8 C;  4HV6 A;  3QOE A;  3B6C A;  3QOP A;  2NS8 A;  1G59 A;  4HYE A;  5K5R A;  3TOA A;  2CSO A;  2L9R A;  1J9I A;  2DA1 A;  4IXA A;  2OV7 A;  1XS9 A;  2CQ7 A;  4CZZ A;  1D1B A;  1YYV A;  4HF2 A;  2M2E A;  2DA4 A;  1VQ6 I;  3ABM H;  4YRV A;  1NH3 A;  2RAE A;  4ZDP A;  1K78 B;  1ORK A;  1LE8 A;  2KL4 A;  3BJ6 A;  4BEH A;  3SZP A;  4BBR J;  2L9S A;  3F0C A;  1EA3 A;  4N0B A;  1MH4 A;  5FLM J;  5F08 A;  5EG0 B;  4RM2 A;  1VQ9 I;  3OMY A;  1WH7 A;  1HW2 A;  3A03 A;  2NVU B;  3G4S I;  4EGZ A;  4GO1 A;  5E79 C;  1Y1W J;  4A6D A;  1O7L A;  2X6W A;  3DBL B;  3O2P E;  4C3H J;  3P5J A;  3H3U A;  4YG2 F;  1T2K A;  1YS6 A;  4G12 A;  1BIB A;  4M3E A;  4NC7 A;  4E7K A;  3LWF A;  2VQH A;  3M8E A;  2VKH A;  2JPC A;  4CCO A;  2FX0 A;  2HYG D;  4LJZ F;  2BW3 B;  1DGW Y;  3OYM A;  2DTZ A;  1F36 A;  5HLI A;  4IPA A;  4PJJ A;  2EPF A;  4AD9 A;  4DYQ A;  3OYB A;  2AQF A;  3GZN B;  3KZI C;  1MDM B;  1B72 A;  4C3J J;  4Y52 J;  1IXC A;  2V1U A;  2BBY A;  1MMD A;  1RUO A;  5HLH A;  1ITY A;  4JOM A;  2CYY A;  4ESF A;  2L54 A;  3CJN A;  3TBI A;  2CQN A;  2D1V A;  4UUS B;  4UB8 C;  3WTU C;  1F5T A;  1EF4 A;  4IHW A;  3ERE D;  2GAU A;  3B02 A;  3RKW A;  4FAS D;  3RI4 A;  1R4N B;  4FET A;  4M6V A;  4J01 A;  1IN7 A;  4L9T A;  1XD7 A;  3C2B A;  3F8N A;  3ZMZ A;  2EFW A;  4KNY A;  1Z9C A;  3QQA A;  5DV5 A;  4OIQ F;  2QQ8 A;  3SEQ A;  1LDJ A;  5LRS A;  5FFZ A;  4BJT A;  2HTS A;  5DDG A;  2MD0 A;  2NOG A;  1WZ2 A;  1GV5 A;  2FBH A;  2W57 A;  2ZJ2 A;  3TW6 A;  3ZQG A;  4BE2 A;  2B9S A;  4U7B A;  1U78 A;  4E6K G;  3NQO A;  1YW7 A;  4P96 A;  4KIF A;  5L3E A;  4M6Y A;  4FX0 A;  4A5M A;  1C0W A;  1O3Q A;  1UEL B;  2GA2 A;  2COM A;  1BC7 C;  2DYR H;  2VOP A;  4WXD A;  1OYY A;  2JPB A;  4HBL A;  4XLA A;  2DBB A;  2KIF A;  2XHK A;  4IEJ A;  1E17 A;  2DPD A;  5CPR B;  2PMZ A;  3COA C;  3HBL A;  3K4J A;  4CA0 A;  2X9D A;  3BOQ A;  3HRM A;  2VON A;  2OF7 A;  1Y0N A;  2E2I J;  3CF5 F;  2QWW A;  5IT9 K;  2VUM J;  2FEZ A;  2QKL B;  3I58 A;  3IP4 B;  5CQE A;  2K7L A;  1TL8 A;  3WTT C;  2X6X A;  2BZT A;  3CC7 I;  3KP6 A;  3DBR B;  2R7R A;  1BM9 A;  1Z05 A;  2QCO A;  4IOC F;  1K7A A;  3RPQ A;  1F9N A;  1AA7 A;  4OMY A;  2VC1 A;  3IKV A;  3GZ6 A;  1OCR H;  1TNT A;  2XB5 A;  3IUO A;  1AHD P;  3W2A A;  1ACI A;  3X2Q H;  3P9K A;  2VKD A;  1X4O A;  3V7S A;  2A3S A;  2FE3 A;  2LNB A;  2CWE A;  3DP7 A;  2UUZ A;  3QPS A;  1W0U A;  3ABK H;  5IYC J;  1AKH B;  4A3D J;  2Y69 H;  4I09 A;  4C2T A;  1BR1 A;  2WV0 A;  2EZK A;  4A93 J;  4G6Q A;  1LFP A;  1HKQ A;  4IF4 A;  2WWY A;  2M7B A;  2DT6 A;  2CJJ A;  3I9V 2;  1IAW A;  1BN5 A;  4JX5 A;  3VDX A;  1WVR A;  5D6E A;  3AG2 H;  5LHI A;  2JSP A;  3KX2 A;  3PL8 A;  4ZZL A;  4QLC U;  1VQ7 I;  1B9N A;  2V1X A;  4D5C A;  3K2Z A;  3E6D A;  2LH9 A;  4GXO A;  5F64 A;  3RCO A;  1Z6R A;  3VYT B;  3WTZ A;  4E4H A;  4D7M A;  3ZMS A;  3AG4 H;  1XTA A;  3L2R A;  3GME A;  3I64 A;  3F3X A;  1BI0 A;  4BGD A;  1IUY A;  1TNS A;  2A68 F;  1W0T A;  4HLY A;  1UHS A;  2CUJ A;  2L3D A;  4BQO A;  2WAF A;  3KEO A;  4Y3O A;  4XLE A;  2RN7 A;  3ZMT A;  1U6G A;  5FRN A;  3FKJ A;  3DLA A;  4CCJ A;  2FOK A;  3N97 A;  4ZH4 F;  1TWH J;  4M6X A;  2DFF A;  3AL0 C;  4U0W A;  3OOU A;  1GXP A;  2HTJ A;  1ZRC A;  3C1D A;  4R1H A;  4RB1 A;  1OCP A;  3SJM A;  5M3M J;  2MLK A;  3HGY A;  5D6F A;  2M3A A;  5FGM A;  4CHU A;  1VND A;  2HXO A;  3FHZ A;  1WJF A;  4MEY F;  4EJV A;  2DFE A;  1XPX A;  1HW5 A;  1AWC A;  3ZPL A;  2WB1 A;  2W25 A;  3IRR A;  4NNJ A;  2DA6 A;  1EJ9 A;  3MKW B;  1WH5 A;  5HLT A;  4Q47 A;  2MH2 A;  5EZG A;  4XOR A;  2A61 A;  2F6C A;  4BXU A;  3T0Y A;  3C18 A;  1OPC A;  1OCT C;  1FTZ A;  1VQO I;  1YLF A;  2L7M P;  4BKX A;  5J8C A;  1SFU A;  2HS5 A;  1N75 A;  4G94 A;  3RKQ A;  5BQT A;  5GTI C;  2FU4 A;  3Q0U A;  5LLQ A;  2VXD A;  1E3P A;  3MKL A;  4NQW A;  1EH6 A;  1GT0 C;  3CF2 A;  1RPW A;  2V9K A;  3M3Y J;  4BH9 A;  1E3O C;  2GWR A;  3D5S C;  1Z3X A;  2M34 A;  2CS3 A;  4I76 A;  3GTO J;  3H0G J;  2GIZ A;  2XC7 A;  3K0L A;  3OSG A;  1ZRE A;  4LLG F;  3GFJ A;  1MND A;  3CDL A;  4WCG A;  3R61 A;  2R7Z J;  1RIO H;  3PSF A;  1TW3 A;  4F7Z A;  2CUZ A;  4XOT A;  5IOZ A;  1L3L A;  1JT0 A;  1V4R A;  1MKM A;  2VIX A;  5J6X A;  1A35 A;  4BYY A;  3EPZ A;  2YSR A;  2ZFW A;  1LPQ A;  2PJP A;  1FX7 A;  2M1B A;  2M5W A;  2HEO A;  1ZH5 A;  3GWZ A;  3L00 A;  4I02 A;  2QBY A;  2O3F A;  2L9V A;  4GYG A;  2ZB9 A;  2IA2 A;  4LB5 A;  4B44 A;  2CQK A;  3ABU A;  3W6V A;  3H9Q A;  5H6R A;  2RRE A;  2A6H F;  2QM3 A;  3RYR A;  4XID A;  3HHH A;  2V7F A;  1T08 B;  2RVC A;  1IN6 A;  3P9C A;  3QYB A;  1K4S A;  4II2 A;  2P7C B;  2L2O A;  4D9J A;  4G7H F;  4JBA A;  5TIS C;  4OAY A;  3P9I A;  2JA7 J;  1S7A A;  3D5L A;  1U5T A;  2A5Y B;  2HQR A;  2IA1 A;  2F48 A;  2VL8 A;  1IG7 A;  3HKZ N;  3T8T A;  3F6O A;  2DK8 A;  3ZQC A;  4M72 A;  2RDP A;  1LEB A;  3BR3 A;  1IRZ A;  1HST A;  1PYV A;  1XDU A;  3KZY A;  4N4N B;  1TTY A;  2QYO A;  4KN7 X;  4EMS A;  3M8J A;  2CW8 A;  3CD6 I;  1T8I A;  2CW0 F;  3CLQ A;  3PNV A;  3CZ6 A;  1G3W A;  1R58 A;  4A0Y A;  4HF0 A;  4S04 A;  2PX9 A;  4MHG A;  3L2Q A;  3V4G A;  2GA1 A;  1D0Z A;  3BR6 A;  3BC8 A;  1EKE A;  2X6Y A;  3S2W A;  3GLX A;  1SMY F;  1ZGA A;  3K4C A;  1MMG A;  4W1U A;  4S05 A;  2ID6 A;  3WU0 A;  2HGC A;  2R4G A;  2V1D A;  3GTP J;  3WHC A;  3IKT A;  3BCB A;  3TOB A;  1V5G A;  4D5F A;  3E0J B;  3CCM I;  3EYY A;  3HTU A;  3WHB A;  2AS5 F;  5FB2 A;  3KYD B;  1R1U A;  3I59 A;  5HS9 A;  1UAA A;  4ENK A;  3RQ4 A;  1JHF A;  1H9G A;  2E1N A;  1RKT A;  3H9G A;  2NRA C;  2L7K A;  2WY7 Q;  3KYC B;  4LMY A;  4XR6 A;  2R7V A;  4NBQ A;  1BW5 A;  4G8X A;  4PFP A;  3BZK A;  1KZH A;  2ZXH A;  4B1R A;  1X3U A;  5KNL A;  3PNY A;  2DMT A;  2VXZ A;  5AON A;  5E3O A;  3S32 A;  1E2X A;  1FOW A;  4M9Z A;  1S72 I;  1FTT A;  2RKH A;  4A3M J;  4M73 A;  4LLL A;  2AXT C;  2DA5 A;  4HZF A;  2WV1 A;  1Z7L A;  2FBK A;  1I6H J;  3RYP A;  2CG4 A;  5D5X B;  3AAF A;  2FQ4 A;  4IHX A;  2E5N A;  1WSU A;  4HQM A;  1WI9 A;  1A04 A;  5K5Q A;  3UR3 C;  3KLO A;  4F92 B;  1KGS A;  1D0X A;  4O6J A;  2LD5 A;  1KU7 A;  1DP7 P;  2H1K A;  1R5G A;  2OTL I;  2O0Y A;  3V7C A;  1YFH A;  3WTV C;  4JX6 A;  2IGM A;  2AO9 A;  5JHU A;  3S3M A;  2PG4 A;  2KDZ A;  1ON2 A;  2EBI A;  2FNA A;  1BJZ A;  2JN6 A;  3EQL F;  1EV7 A;  3QAH A;  1VQM I;  4X1E A;  2CFO A;  4B8X A;  3H1C A;  1RRJ A;  2GXB A;  5DUK A;  3HOT A;  5A2Q K;  1REP C;  3K4M A;  3IC7 A;  4HX4 A;  5ICE A;  3F6V A;  1VQP I;  1G4D A;  1TWG J;  1WGX A;  1WCM J;  2BY3 A;  1MBJ A;  3E3V A;  3P7N A;  5BS6 A;  3LSH A;  2QGU A;  3TP0 A;  2Y9Z A;  2EIL H;  3WGG A;  3CC4 I;  4KYW A;  3KFW X;  1JGG A;  4BXF A;  3TKY A;  5ED4 A;  1T0F C;  1X1D A;  2Z9O A;  2Z5U A;  1Z1D A;  1ETO A;  3DXJ F;  3SFI A;  2LC2 A;  2M8G X;  5F0H A;  4P55 A;  4MTD A;  2HWV A;  1IV6 A;  2STW A;  4KMU X;  3BJA A;  1S29 A;  2HXI A;  2ZXJ A;  2ETH A;  4IQ4 A;  1DPU A;  3ZN1 A;  4WXC A;  1D0Y A;  1GXQ A;  1XSX A;  3GLL A;  3DPT A;  3J7Z I;  4BBS J;  1R00 A;  3K4L A;  2R3S A;  5EEH A;  4UHT A;  2IGK A;  3HC7 A;  5F0C A;  3RDI A;  2B63 J;  2Z1D A;  4HNV A;  4A2U A;  2Y0S A;  1LDD A;  4CYC A;  2H1L A;  4XLC A;  1P92 A;  5CVV A;  3CCQ I;  2M9H A;  3HUG A;  3CO6 C;  2R7T A;  5ICG A;  1G2H A;  3MEX A;  1VF9 A;  3M9A A;  2CQQ A;  4M9S A;  3REO A;  2IW5 A;  5EF6 A;  1Y6I A;  1B6A A;  4M74 A;  5E8I A;  5C4X J;  5GTH C;  2W1O A;  2XF5 A;  4IKF A;  3ZXS A;  2HI3 A;  1HKS A;  4ENJ A;  3CCV I;  2HKO A;  5KHD A;  2COB A;  4NB5 A;  2X85 A;  4Z6Y A;  3HOU J;  1Z67 A;  3ULQ B;  2CFX A;  2VT2 A;  2W82 A;  2OU2 A;  4PDK A;  5BNG A;  3LOC A;  5ERI A;  5F04 A;  1VZ0 A;  4RB3 C;  1SAX A;  2QQA A;  2O6G E;  2LK2 A;  3TMO A;  1V5F A;  4RB0 A;  1MMS A;  2KDO A;  2PMU A;  3TO9 A;  3GTQ J;  1T98 A;  4BL0 B;  5ICC A;  2I10 A;  5FD6 A;  2WC2 A;  3QOD A;  3HOV J;  4RLF A;  4GDF A;  1HC8 A;  2EIN H;  5E1Z B;  1SAN A;  3BT9 A;  4XKC A;  5J4V A;  3PO2 J;  3DKY A;  3WTY C;  1TP4 A;  2OZU A;  4R8H A;  4XSX F;  3IRQ A;  3BY6 A;  3G3Z A;  3FM3 A;  2KIQ A;  1MGT A;  3OIO A;  2RNG A;  3MCZ A;  4YEL A;  1XX5 A;  4ENN A;  3NEU A;  4UVA A;  3ZR8 X;  2M30 A;  3F8F A;  3H9J A;  3JR9 A;  2H8W A;  1MNM C;  1YIJ I;  1YW9 A;  4HQE A;  4JX4 A;  1BI3 A;  2G0E A;  2EJR A;  2K85 A;  4AIK A;  2EIJ H;  3QPH A;  2EIM H;  2OQG A;  4P1W A;  3E5Q A;  4MFD A;  3CLO A;  3EUA A;  1HQC A;  2A69 F;  3I55 I;  4LG0 A;  2DFH A;  1ZYR F;  1VI0 A;  3A4C A;  5D4R A;  2E19 A;  2E1M C;  2YUS A;  4DNC A;  2HVR A;  4I2O A;  1B9M A;  4UV9 A;  1LVA A;  1MMA A;  4DBR A;  2K4J A;  2VB6 A;  3LA3 A;  1WHU A;  2F5D A;  2EZI A;  2GM4 A;  2Z33 A;  1FP2 A;  2HQN A;  2XRO A;  5DCM A;  3S2H J;  3CUQ A;  3CCR I;  1QBJ A;  2PJR B;  5CVR A;  4C9Y A;  5K7Z A;  1DU6 A;  3VOD A;  3V8K A;  4I6Z A;  1I50 J;  3DKX A;  1N25 A;  3Q3S A;  3K4B A;  2LFB A;  1N77 A;  1HDD C;  4MQ9 F;  5HS8 A;  5D5W B;  3QPL A;  3M1C A;  2M7A A;  2OCE A;  1B59 A;  2JUG A;  3PIP F;  2DMU A;  2P5V A;  2XF7 A;  4RMN A;  4RB2 C;  1S5L C;  2PQ8 A;  1IRF A;  3OYH A;  3BZ6 A;  2IS4 A;  2CUF A;  3LSM A;  1ZTR A;  1IXS B;  1JGS A;  1T95 A;  3F72 A;  2E36 A;  2A6E F;  2DK5 A;  3WOD F;  2OPT A;  3CES A;  2ACJ A;  4CZC A;  1M1E B;  2H8R A;  4YFK F;  4G9Y A;  2V9V A;  4BAC A;  1DU0 A;  1YJW I;  1CF7 B;  2VE8 A;  2Q2E A;  1IC8 A;  4KIB A;  2NS7 A;  2X4H A;  1XMX A;  5B66 C;  1KU3 A;  1FLI A;  3RTR A;  2DA7 A;  3BCA A;  2DLL A;  4HV5 A;  2HYJ A;  2O8K A;  5LHG A;  3S3N A;  1MD0 A;  3KEY A;  3FXK A;  4OMZ A;  3OL4 A;  2Y75 A;  3O3K A;  3PIO F;  3BLY A;  4CUG A;  3HB9 A;  2ISY A;  1OQY A;  4MFE A;  1IN8 A;  2DJN A;  1U9O A;  3VOE A;  1K78 A;  2JMW A;  2KIU A;  2LR8 A;  4I0A A;  3T8R A;  3J80 Z;  4WX9 A;  1A36 A;  2I8D A;  3S8P A;  1GVD A;  5EG0 A;  2JUC A;  2R7F A;  1UB9 A;  3IHU A;  2PMH A;  1SD7 A;  2RNJ A;  3EUK L;  5C3E J;  1ZG1 A;  1Z0X A;  1ZG5 A;  4IO9 F;  3HSR A;  4XRF A;  2E35 A;  3KET A;  4GRI A;  1K61 A;  5D4S A;  2C6Y A;  1QA6 A;  3I56 I;  1S7E A;  3Q0V A;  4BEH B;  5L3C A;  1FJL A;  5LD2 C;  4XSZ F;  2BW3 A;  3I3L A;  3HG9 A;  3GX4 X;  4UVC A;  2E34 A;  4DYR A;  1JTX A;  4LIU A;  1I39 A;  5HOD A;  3LSI A;  3VYS B;  1MDM A;  1Z3Y A;  4AU7 A;  1G3T A;  4XK4 A;  2OBP A;  3TW7 A;  3ZCO A;  1IRX A;  2P5K A;  3ECH A;  1IDY A;  3S15 J;  5E18 F;  3TGN A;  3JTH A;  2VT3 A;  1HF0 A;  2NXN B;  2IP2 A;  4JK1 X;  4UUS A;  1YJN I;  2CGP A;  1BW6 A;  5HDN A;  2VOD A;  3G6E I;  2ZJR F;  2D1H A;  4AM3 A;  5DM7 F;  4HOB A;  3A02 A;  2AXL A;  3CCY A;  3TQN A;  1IF1 A;  4AYB A;  4UUT A;  2JRT A;  2ZME B;  3AFH A;  3JRB A;  3ZGK A;  2P5L C;  4B09 A;  2OTJ I;  2R7O A;  3LAP A;  2KRF A;  1LVK A;  1SD6 A;  2J5O A;  3FK7 A;  4BHC A;  3FMQ A;  1K4T A;  2LP0 A;  3HHG A;  2L4A A;  2KZG A;  4IRG A;  2MFZ A;  1R9T J;  3L2V A;  3W6K B;  3HZJ A;  3HGG A;  2F4O B;  2OUM A;  2TRT A;  3HM5 A;  1WJ5 A;  4WK8 F;  3MZY A;  1Z7U A;  4CCL A;  1NG6 A;  5KK1 A;  4LK1 F;  3BG5 A;  3WE3 A;  4GFB A;  1RNL A;  2DDB A;  2ZCW A;  3FXJ A;  3S1R J;  3M07 A;  4XKW A;  4BY1 J;  3J81 Z;  2E7W A;  4CXF A;  1KON A;  2ZO4 A;  2ZBK A;  2B0L A;  4LLN A;  2XRL A;  1WJE A;  2ECB A;  2ESH A;  5FD5 A;  1P4X A;  3T5X A;  3KEQ A;  1FNN A;  4IJA A;  3D1N I;  4KT5 C;  2ZSI B;  4ESB A;  5LRR A;  2R7U A;  1YS7 A;  2YR2 A;  3BR5 A;  4P9F A;  4YFX F;  4KA4 A;  3PSI A;  2F2E A;  1YRN B;  1I1S A;  2K27 A;  3EUH A;  2IJL A;  3S1Q J;  2G7H A;  3MQ0 A;  2NVT J;  4U88 A;  3F23 A;  1KQ9 A;  3OIP A;  4XRS G;  3G71 I;  1BA5 A;  1XCB A;  3QYF A;  3FXU A;  3QRF F;  3HDD A;  1AKH A;  1S9H A;  3GFL A;  2LG4 A;  4QIW N;  3FMR A;  3ZQF A;  5J1R A;  4WXH A;  2HOE A;  3BZC A;  4PSX A;  4EJW A;  1YQA A;  3QP5 A;  3NWS A;  4WF2 A;  4IHT A;  2KHM A;  1FY7 A;  2O61 A;  4OIN F;  4A3K J;  2KP6 A;  2XPU A;  2VBY A;  5IYB J;  3V8L A;  2X1E A;  2HU9 A;  2R93 J;  3IV5 A;  3RZO J;  3CCS I;  4XKV A;  5D5V B;  1D8K A;  3VEP A;  1U2W A;  2MC3 A;  3LSG A;  1HLV A;  1O7F A;  3E5U A;  3HYI A;  3Q0W A;  4L9V A;  2VJJ A;  3N05 A;  5K1Y A;  2V6E A;  3MAJ A;  1FMW A;  2Y30 A;  4HDU A;  2K3P A;  3PQK A;  4LFU A;  1JKR C;  1TBX A;  2QUF A;  4XN0 A;  5D8K B;  3E5X A;  3IWF A;  1A31 A;  3QWL A;  5LGT A;  1Y0U A;  5DD8 A;  3I4P A;  4ZJZ A;  2E2H J;  4J00 A;  3S16 J;  3VSL A;  2UV1 A;  2DTR A;  4HLX A;  3GW2 A;  1ETX A;  3K1P A;  1HOM A;  1TC3 C;  5TRD A;  3SEZ A;  1YJ9 I;  3BTL A;  2VI6 A;  2F5V A;  2Z99 A;  2ELJ A;  2PBI A;  3CC2 I;  1JI8 A;  1V3F A;  4EM2 A;  3F21 A;  4PK4 A;  3BPV A;  2WY8 Q;  3FF5 A;  3GFM A;  4ASN A;  2F5E A;  2QQB A;  1FC3 A;  1WRJ A;  4BQN A;  1NTC A;  5L3D A;  4Q48 A;  4YII A;  4KIG A;  1PUE E;  1QRY A;  3RKY A;  2ZJQ F;  1IDZ A;  9ANT A;  3CJR B;  2ADU A;  4ZYG A;  4BJ6 C;  2MLG A;  5JLW A;  1Y1V J;  2HDC A;  1OMI A;  1U0J A;  1FOX A;  4PJM A;  2ESN A;  1LJ9 A;  1SVM A;  5FKL A;  3ECO A;  3GUD A;  2HNH A;  3ZOB A;  1U5T C;  1MSF C;  2CUE A;  4Y13 A;  5D5U B;  4A69 C;  3VYR B;  1TZL A;  1MJ9 A;  4B48 A;  3OYA A;  2WBM A;  4M3G A;  2STT A;  1QZY A;  1QGP A;  1TWC J;  2DN0 A;  3U1D A;  2BHZ A;  2X0L A;  5E3L A;  3HTS B;  2NNN A;  1JUP A;  3FX3 A;  1YTY A;  4M9X A;  5JI6 A;  2MG4 A;  1JUS A;  1X19 A;  2Y0M A;  2R5Z A;  2K02 A;  3ELK A;  5IT9 Z;  1QZZ A;  2WB1 N;  2O5R A;  4EM1 A;  1P7I A;  1I6X A;  1TWF J;  4F93 B;  1QVT A;  3EDP A;  2HVS A;  1HW1 A;  2GIV A;  3KE2 A;  1R23 A;  1PUF B;  5F0F A;  2L4M A;  3BP8 A;  2L7F P;  3ROU A;  4BJ5 C;  3H5N A;  1QHG A;  3BPX A;  3DPU A;  1S8N A;  4FIS A;  1FIP A;  4FE7 A;  1HDP A;  3ML6 A;  1H8A C;  3RSN A;  3JRI A;  1X3W B;  3GF2 A;  4RGU A;  1RC9 A;  4LK0 F;  4LIT A;  1BOB A;  4RAY A;  2XPV A;  2JA5 J;  3E97 A;  2TDX A;  2XGE A;  3R0J A;  2E5Z A;  2MD5 A;  3AL0 B;  3GFI A;  3BTI A;  1SEU A;  2EFQ A;  1KYZ A;  3U21 A;  1ZAO A;  2LKS A;  4A0X A;  3RQI A;  2XVC A;  3BR0 A;  1BL0 A;  4IZZ A;  4UVB A;  3ASO H;  5EYR A;  4B43 A;  3FDY A;  4Z2Y A;  1XG1 A;  3PNT A;  1OR7 A;  1IXR C;  2KJB A;  1O57 A;  2QQ9 A;  5BOX A;  2JJ7 A;  1V5E A;  2BYV E;  1AU7 A;  2OQR A;  5GAE J;  4HX7 A;  5FO5 A;  1K79 A;  4L0Z B;  4W97 A;  3VWB A;  3MN2 A;  1Y39 A;  1VQN I;  4EV0 A;  3IH4 A;  3S3O A;  4EQQ A;  4XLH A;  3MFK A;  5J47 A;  4Y4R A;  4L18 B;  3CCU I;  3WTW C;  1SFX A;  4C3I J;  1TQI A;  3HL2 A;  4I0B A;  1FYK A;  3C7J A;  1CGP A;  3DEW A;  1YO5 C;  4XOP A;  5GPC A;  4FT8 A;  4PZJ A;  2IS2 A;  1TT0 A;  5E3M A;  4HDV A;  1IN4 A;  3CJT B;  1T33 A;  4XM3 A;  1PVE A;  3W2V A;  1P2F A;  4U0Y A;  1GVJ A;  2DDA A;  4B4C A;  5J3L A;  2EB7 A;  2O7O A;  4RGR A;  3LAJ A;  3N4M A;  2Q8K A;  3K1M A;  1R4M B;  3OYG A;  3WTS C;  4KIS A;  4D7N A;  1AOY A;  3LA7 A;  1X3Z B;  3L2W A;  1YIT I;  5FRM A;  4ON0 A;  1FBS A;  3A01 B;  2ZNY A;  1D5V A;  3LQQ A;  3MMY B;  4XRM A;  3DLL F;  5EJC A;  3T1B A;  1R7J A;  3MWM A;  3H0D A;  4ZTF A;  4AIH A;  1RZ4 A;  3VFZ A;  2DU9 A;  3A1Y A;  2PN6 A;  5AIP A;  1OCC H;  3LSR A;  3TP3 A;  1TQM A;  4MO7 A;  1UCR A;  1QU3 A;  1W4M A;  1UST A;  1O3S A;  2Z3Y A;  4IRH A;  1DP3 A;  1RET A;  3CMA I;  2Y9Y A;  2IS6 A;  5EGO B;  2MC4 A;  1FYM A;  1LQ1 A;  4QWQ A;  1XGN A;  2ID3 A;  2FD5 A;  4C30 A;  3S2D J;  2LTP A;  1G3S A;  3F9K A;  3LMM A;  2M45 A;  3R4K A;  1QNT A;  2XAG A;  4LGW A;  4EVI A;  5FJ8 J;  5FRO A;  1EH8 A;  1R1T A;  2KKO A;  4CSW A;  3TL4 X;  2IXS A;  1D3Y A;  2BVL A;  1IO2 A;  3JSO A;  1ETK A;  1SFE A;  1IJW C;  2FF4 A;  2DA2 A;  2DFI A;  1ZGW A;  4GGG A;  1T38 A;  2OJE D;  1SFK A;  2DXI A;  5LFA A;  2YU9 J;  1A5J A;  1XGS A;  4RM3 A;  3DEE A;  1HXD A;  3L2C A;  1LFU P;  1B8I B;  5HS7 A;  3JAM Z;  3HOW J;  2E60 A;  5KCM A;  1X1A A;  2FSW A;  4KUM A;  5ILS A;  1FSH A;  2MSY A;  2GQQ A;  2HFH A;  2EK5 A;  2ZFU A;  1ODD A;  1KQ8 A;  1KYW A;  1DPR A;  2PLY A;  1MBE A;  1WKM A;  2EA2 A;  4DBQ A;  1G8X A;  3CP8 A;  3E7L A;  2O8X A;  3GZ5 A;  4F91 B;  5F27 A;  2L0K A;  2KIS A;  4RGS A;  5EEA A;  1GDT A;  4F55 A;  5HDK A;  4DW6 A;  3GXO A;  1UMQ A;  2DQL A;  4N4O B;  3BG6 A;  2X1D A;  4U87 A;  1H89 C;  1ONV A;  4DQ2 A;  2AQE A;  1JT6 A;  2KJC A;  2FQ3 A;  2RQP A;  4G6D A;  2E1O A;  3LQR A;  4MNU A;  4RAZ A;  4BUP A;  4A3G J;  1CQT A;  2X1C A;  1OJL A;  2WAD A;  4DYC A;  5LGU A;  2VJI A;  2JZY A;  2DQR A;  4L5I A;  3RPU A;  1NG7 A;  1YI2 I;  4HPQ A;  2Y31 A;  2R7S A;  3FBI B;  4XLP F;  2IEK A;  2P8T A;  4IHY A;  1D1A A;  2HVQ A;  5EEG A;  5JLX A;  4TV7 A;  3HPG A;  5IT3 A;  4XL9 A;  5JHF A;  2HQ5 A;  2MYS A;  5HLG A;  2LBF B;  4ETS A;  2JVH A;  4A3L J;  2HDD A;  3M1E A;  5IP9 J;  3PUB A;  1XMK A;  2K9S A;  3KP2 A;  1BBY A;  5CLS A;  2IVM A;  2KMU A;  4LB6 B;  5C44 J;  2DYS H;  1FIA A;  1STZ A;  2FUG 2;  1MBG A;  1ZR4 A;  2XAS A;  1Y56 A;  4L5E A;  2Z16 A;  2NAZ A;  3DU5 A;  4CH7 A;  1ZEL A;  3W3C A;  2VBZ A;  4CCN A;  4YIR X;  1UHM A;  2E2J J;  3FHN A;  4FQG A;  1ZG3 A;  3CUQ C;  3JRD A;  1JTY A;  1JHH A;  2OC6 A;  1HSJ A;  2EFO A;  4A6E A;  4FCY A;  1P4W A;  1WJA A;  2TCT A;  5IYD J;  2J5P A;  4ZDO A;  2WAQ N;  2LLK A;  3M8F A;  3W6J B;  1U8R A;  3QPT A;  4KFC A;  2RQQ A;  1XSV A;  3NAU A;  2PI0 A;  1D1C A;  2GOM A;  4RAG A;  4ENM A;  4XNF A;  3HXL A;  1SVO A;  3L2U A;  2ELK A;  2EA4 A;  1R49 A;  1J2X A;  4PJN A;  3KLN A;  4NHJ A;  4MQV A;  4XKB A;  1E3H A;  4CYD A;  3FKI J;  3BTJ A;  2XUB A;  2XAH A;  2V79 A;  3BR2 A;  4RBO A;  1ENH A;  2XAQ A;  1FPQ A;  1F43 A;  5CJ9 A;  1V55 H;  1BR4 A;  4DJA A;  1OFC X;  1SD4 A;  2K9Q A;  2FMY A;  2FOW A;  1MBF A;  1OYI A;  1RI7 A;  4M3D A;  3H35 A;  4KDP A;  3Q9V A;  4RLQ A;  3DU6 A;  1E0E A;  1J75 A;  3MKY B;  3D5R C;  4UB6 C;  4PJL A;  2R5Y A;  3L09 A;  4UXN A;  3KP7 A;  3ESW B;  3I53 A;  4C2U A;  1IRG A;  3WU1 B;  1FMV A;  5A2Q Z;  3LNQ A;  5IP7 J;  2DW4 A;  1W5S A;  4LD5 A;  4QTR A;  4X0G A;  3HOY J;  2DAO A;  3L1P A;  5BPI A;  4N9I A;  2ZXI A;  1RUN A;  1LDK B;  2CW7 A;  1FWZ A;  3CDH A;  2KPM A;  1ETV A;  3H92 A;  3CUO A;  2B7E A;  2Q1Z B;  1YX5 A;  3JRE A;  2K40 A;  1HA8 A;  2M0M A;  3BRO A;  4ZTJ A;  2DMN A;  2PJR A;  4F52 A;  2GLO A;  3GTL J;  4KIC A;  2K4B A;  4A3I J;  3HJE A;  2W84 A;  2IGO A;  4YEJ A;  4R79 A;  4GYI A;  2VE9 A;  3CJQ B;  2H6C A;  4HW0 A;  4PJ0 C;  2EZH A;  2NNY A;  1DGR M;  1J59 A;  4OAZ A;  4NUB A;  2WAE A;  2GXA A;  3W2W A;  1J09 A;  1MJB A;  1MH3 A;  4E7I A;  2LRD A;  2YPR A;  1FZP B;  2V9P A;  3BQZ A;  1WPK A;  4AIJ A;  3H5A A;  3DPL C;  5H20 A;  5LHH A;  2MGQ A;  4E7S A;  3UKG A;  4BNC A;  4ZYA A;  2IAI A;  1X2M A;  2CO5 A;  1QHH D;  1ZGJ A;  3R60 A;  3SYT A;  4XN3 A;  1PP8 F;  2FXA A;  2QF7 A;  4BU2 A;  2VBX A;  2VKE A;  1NK2 P;  3F8B A;  2OA4 A;  3J81 K;  1CF7 A;  2PFB A;  1U3E M;  5E1X A;  3RKX A;  2KQR A;  2Y48 A;  3VPR A;  2M87 A;  3ZQH A;  5IOY A;  2JQ7 A;  4ESJ A;  2JA6 J;  2IS1 A;  1BI2 A;  3G73 A;  1G6N A;  3NRV A;  3K10 A;  5LEJ A;  2DOA A;  3IWZ A;  1JKO C;  3E1S A;  5JR3 A;  1KA8 A;  2DO7 A;  4G7Z F;  5J1U A;  2QKM B;  1W7P B;  3DF8 A;  4L9N A;  3ZP5 A;  1FP1 D;  1XB4 A;  2YX7 A;  2XSD C;  3DTI A;  2H27 A;  4L5J A;  4EEF G;  4LOC A;  4RA2 A;  1OIS A;  2L9N A;  2EV6 A;  3G1L A;  3VB2 A;  2BHY A;  2JA8 J;  2WTE A;  4X6A J;  3JRH A;  1Z77 A;  3IH2 A;  3K69 A;  2E1M B;  3AG1 H;  4A3E J;  1ULY A;  2P4W A;  2BOL A;  2VBW A;  4M3F A;  1LE8 B;  2A07 F;  1QO0 D;  3FXL A;  4IL6 C;  3JRA A;  2QEN A;  3DQV C;  1NHA A;  5HDG A;  3GYH X;  1S7O A;  5HOO A;  4Q4Z F;  5IPA A;  3J7A O;  3WG7 H;  1TQP A;  3ERM A;  3FIW A;  4Y17 A;  4HNT A;  1RKW A;  4G6T B;  3HRS A;  3EUH C;  1X58 A;  2KFD A;  1XDS A;  1ZHF A;  4II3 A;  2W48 A;  1T56 A;  3BDD A;  3FM5 A;  5K7F A;  1D5Y A;  3BQY A;  4ABZ A;  3K1N A;  2GZW A;  2BY2 A;  2V26 A;  3F8C A;  1IUF A;  4IOA F;  4BDZ A;  3WTX C;  1B72 B;  4D0P A;  5FLX Z;  3R6S A;  2DMP A;  2ZME A;  4PGH A;  2BXY A;  4EJT A;  4IHS A;  4NDL A;  2R0Q C;  1ETW A;  2E7X A;  3C2H A;  1FSE A;  2F4M B;  2KT0 A;  3LSK A;  6PAX A;  1BJA A;  1L0O C;  1XN7 A;  4ZC3 A;  3VYU B;  2LY9 A;  5B5E C;  4FX4 A;  1DDN A;  2CV1 A;  5B1A H;  2JT1 A;  4BE0 A;  4HG2 A;  5FKO A;  4BHB A;  1SVL A;  2XKP A;  2D5V A;  3KP3 A;  2OCC H;  3FXM A;  1YHQ I;  1W5T A;  3IL2 A;  2R7D A;  2ZC2 A;  4EGY A;  3JSP A;  4IHV A;  2H09 A;  2K5C A;  2P6T A;  2L01 A;  2K9N A;  2HQA A;  2P7V B;  3EET A;  2DA3 A;  2L02 A;  4LIV A;  1K6Y A;  2X48 A;  1ZN2 A;  1YX3 A;  2P0W A;  2KRH A;  3BTC A;  3L9F A;  4N9H A;  1J0R A;  3B6A A;  5ILV A;  3BWG A;  2E71 A;  5B1B H;  1U8B A;  2HR3 A;  2I5U A;  1Y8Q B;  2RC4 A;  4AYB N;  1X1B A;  2D2W A;  1O3T A;  1F4K A;  4QSH A;  4BDY A;  3BG7 A;  3FXR A;  2LKP A;  1P6R A;  2OZ6 A;  1S3J A;  5FKN A;  1W36 D;  3R0A A;  5DTD A;  3K4N A;  3DTK A;  3BJO A;  5DS9 A;  3Q9S A;  4ZYH A;  1YRN A;  2YU3 A;  1BC8 C;  2AHQ A;  4UV8 A;  3JTG A;  1DQU A;  1IZ1 A;  3TDU C;  1VQ5 I;  5J1Y A;  3SFZ A;  3OYC A;  4UNO A;  2IA0 A;  3H3V K;  5DEQ A;  5E3N A;  4XQF A;  1Y8R B;  3SHF A;  3OR1 C;  3LFU A;  1SC7 A;  4DZP A;  5E17 F;  1OCZ H;  1ETQ A;  1R5I D;  4ZYD A;  3QYE A;  3OS0 A;  3RPU D;  1JXS A;  3OYK A;  4L9J A;  2PMZ N;  2DT5 A;  4ZZD A;  3OYL A;  3JW4 A;  1POG A;  5EDN A;  4G7O F;  2ECC A;  2CH0 A;  2KLO A;  2LKX A;  1UHW A;  2ZXW H;  1MBH A;  3I4N J;  2QSG X;  3CO7 C;  3FBN B;  4C2M J;  4Y7N J;  2EV5 A;  2O9L A;  3C2G A;  3OR2 C;  3CTA A;  3SDB A;  2LMD A;  3U1K A;  4A12 A;  2K3F A;  3WGH A;  4HA8 A;  3Q5F A;  2JSC A;  4E7H A;  3HOX J;  2A6T A;  1TW2 A;  1A6I A;  4BE1 A;  2ELH A;  1W1W E;  3G1O A;  4V19 K;  2XPW A;  3ZN0 A;  5J4Y A;  2GXG A;  4FE4 A;  1X1C A;  2EV0 A;  5M5X J;  3V7R A;  4XRS A;  2P6S A;  1I5Z A;  4YFN F;  4E7L A;  1WQ2 A;  2R7Q A;  3MD2 A;  4IQJ A;  1WJB A;  4BY7 J;  2ZNZ A;  4CIC A;  3HSF A;  2V1N A;  3DCF A;  3PQJ A;  3PUF A;  3SXY A;  1LUJ B;  2O03 A;  2ZJP F;  4IRI A;  4A3J J;  4EJU A;  4HNU A;  2LSO A;  3C3W A;  4MTE A;  1LFB A;  1PP7 U;  3PFI A;  1K83 J;  2BY1 A;  3JRC A;  1P9Q C;  5ICF A;  1EH7 A;  3CMM A;  3LA2 A;  2L5Q A;  4E7Z A;  1F1Z A;  5LBQ A;  3HOZ J;  2BXZ A;  2ISZ A;  1ZR2 A;  2CMP A;  2XAU A;  1VQL I;  3ZQL A;  2RV8 A;  2NOJ B;  2OAZ A;  4I7H A;  5M3F J;  3ASN H;  4BXX J;  2LOO A;  4DIQ A;  1XC5 A;  2XRN A;  5J8F A;  3G2B A;  5CVJ A;  4RGX A;  1IV8 A;  1PDN C;  3DWL E;  3OYJ A;  4AVZ A;  2W85 A;  4PCQ A;  1MSE C;  4KMF A;  2IPQ X;  1OR7 C;  4H0E A;  4BAY A;  5HNH A;  4IVN A;  3WGI A;  1OLT A;  1I27 A;  3TDZ C;  2D45 A;  4JP0 A;  1V54 H;  4UUV A;  2F5F A;  4MIM A;  3QU6 A;  1JJ8 C;  5JFR A;  5DM6 F;  4KN4 X;  2LYC A;  3PJR A;  1UG0 A;  2DPU A;  3NWT A;  2NVY J;  3KZZ A;  3F22 A;  1K6O A;  1SFO J;  3OWT A;  4H4K C;  2EQR A;  3GCM A;  5JVT A;  2G7U A;  5GPA A;  1FYL A;  2XF6 A;  2G9W A;  4V2G A;  2XSJ C;  3ZRG A;  4ITV A;  5BPD A;  3EYI A;  4EJO A;  1IW7 F;  2A5W A;  3ZQQ A;  3ZQ7 A;  4NQW B;  1PUF A;  4CCK A;  2ZSH B;  3I71 A;  4KT6 A;  4Y33 A;  3CQZ J;  2NYX A;  2K9M A;  1QVU A; 
#chains in the Genus database with same CATH homology
 2E60 A;  5KCM A;  1UEL B;  4QPO A;  1MMN A;  4D1Q A;  2PJR B;  4C9Y A;  1X1A A;  4XLA A;  3CP2 A;  2Z2S B;  3DKX A;  5CPR B;  2PMZ A;  3K4B A;  3K4J A;  4CA0 A;  1N77 A;  2ZFU A;  2KRC A;  2QKL B;  2X51 A;  3IP4 B;  3LL7 A;  3M1C A;  2M7A A;  1WJD A;  5CQE A;  2JUG A;  4DBQ A;  3K70 D;  2V4J C;  1G8X A;  2XF7 A;  3CP8 A;  4F91 B;  3HKZ A;  4RMN A;  4KIT B;  3OYH A;  2IS4 A;  4F55 A;  2X6X A;  3LSM A;  2R7R A;  1ERD A;  4JQF A;  3H5R A;  1T95 A;  4PUS A;  4N4O B;  3BG6 A;  4DOZ A;  2X1D A;  4U87 A;  2WA0 A;  1AA7 A;  3CES A;  4B47 A;  4CZC A;  2AQE A;  3DTE A;  3IUO A;  4BUP A;  4P5O A;  4BAC A;  3W2A A;  4E7J A;  2VKD A;  1X4O A;  2X1C A;  3V42 A;  2DCE A;  2WAD A;  2UUZ A;  2VJI A;  3OYE A;  2R7S A;  1NG7 A;  4HPQ A;  3RTR A;  3BCA A;  3FBI B;  4C2T A;  1BR1 A;  4HRI A;  2GOX B;  2HPI A;  1D1A A;  2HVQ A;  1LFP A;  3S3N A;  2VLA A;  3HPG A;  3KEY A;  4XL9 A;  5JHF A;  2MYS A;  3OL4 A;  2LBF B;  2JVH A;  3K4K A;  2M7B A;  2DT6 A;  3BLY A;  4CUG A;  3I9V 2;  2LY1 A;  3PUB A;  3VDX A;  4HEA 2;  2VQL A;  1YE9 A;  2JSP A;  2KMU A;  3KX2 A;  3PL8 A;  2FUG 2;  2I8D A;  1Y56 A;  3S8P A;  2Z16 A;  3DU5 A;  2LH9 A;  3RCO A;  3VYT B;  1ZEL A;  3W3C A;  4BQQ A;  4CH7 A;  4E4H A;  4CCN A;  3L2R A;  2VJ4 A;  3FHN A;  2F4I A;  3EUK L;  3OYF A;  3HOS A;  4BGD A;  4LG3 A;  2OC6 A;  2CUJ A;  2KZV A;  4BQO A;  4GRI A;  1WJA A;  2WAF A;  4Y3O A;  4XLE A;  4ZDO A;  4BEH B;  5FRN A;  3FKJ A;  3DLA A;  4CCJ A;  4NC8 A;  5LD2 C;  1W36 C;  2BW3 A;  3I3L A;  3HG9 A;  2RQQ A;  3AL0 C;  2MAB A;  3OOU A;  4XON A;  4LIU A;  3LSI A;  3VYS B;  1D1C A;  1Z3Y A;  3IAS 2;  4AU7 A;  2GOM A;  4XNF A;  3HXL A;  1IRX A;  3ZCO A;  3L2U A;  2M3A A;  1R6R A;  2M4G A;  4PJN A;  2R7W A;  4XKB A;  1WJF A;  2WB1 A;  4NNJ A;  2IGN A;  3MKW B;  4AYB A;  5HLT A;  1BR4 A;  4DJA A;  3AFH A;  3ZGK A;  4XOR A;  2R7O A;  3H35 A;  2F6C A;  1LVK A;  4RLQ A;  4MLO A;  3DU6 A;  1E0E A;  3MKY B;  3D5R C;  4PJL A;  3OYD A;  4C2U A;  2MFZ A;  1FMV A;  2BVM A;  3L2V A;  1N75 A;  4X0G A;  2OUM A;  3A2K A;  1MW7 A;  1WJ5 A;  2XDV A;  2VXD A;  2ZXI A;  1LDK B;  2CW7 A;  4CCL A;  1NG6 A;  4B3X A;  2KPM A;  3CF2 A;  2JA2 A;  2V9K A;  3OS1 A;  2Q1Z B;  3KYL A;  3D5S C;  1Z3X A;  1YX5 A;  2CS3 A;  4PFO A;  1HA8 A;  4XKW A;  2M0M A;  3J7A Y;  4ZTJ A;  2PJR A;  4F52 A;  2XC7 A;  1KON A;  1MND A;  2DT7 B;  1WJE A;  2IGO A;  4YEJ A;  4IX7 A;  4R79 A;  3PSF A;  2CUZ A;  4XOT A;  3CJQ B;  2VIX A;  2ZSI B;  1DGR M;  3EPZ A;  4OWR B;  5HVQ C;  4OAZ A;  4NUB A;  2WAE A;  2R7U A;  3W2W A;  1J09 A;  5CKT A;  4E7I A;  2VJ5 A;  2LRD A;  2M4K A;  3PFY A;  1MNE A;  3PSI A;  3H5A A;  3DPL C;  4E7S A;  1Z21 A;  4ZYA A;  3OIP A;  4B44 A;  1QHH D;  3SYT A;  4XN3 A;  3H9Q A;  4BU2 A;  3QYF A;  2RRE A;  2V7F A;  2KQR A;  5TGT A;  1S9H A;  2IS1 A;  2LG4 A;  5HNF A;  3QYB A;  4PSX A;  4II2 A;  1PJR A;  2L2O A;  3NWS A;  4PSW A;  3K10 A;  1WJC A;  2DOA A;  2KHM A;  4D9J A;  3E1S A;  2LBF A;  4OAY A;  3MKZ A;  2QKM B;  2KP6 A;  3D5L A;  2X1E A;  2HU9 A;  2W4S A;  2VL8 A;  2VQG A;  4XKV A;  3AKZ A;  3DTI A;  3LSG A;  2WAQ A;  2L9N A;  2V6E A;  1PYV A;  2VJJ A;  3N05 A;  4N4N B;  2VQC A;  1SAU A;  1FMW A;  2K3P A;  3M8J A;  2CW8 A;  2LY2 A;  3HUG B;  3PNV A;  4XN0 A;  3CZ6 A;  3OL3 A;  2E1M B;  4XMY A;  1X4P A;  4ZJZ A;  3L2Q A;  4J00 A;  1D0Z A;  2UV1 A;  3VSL A;  2BOL A;  3BC8 A;  4HSR A;  4CCM A;  2X6Y A;  2W00 A;  3IAM 2;  3OYI A;  3SEZ A;  3DQV C;  3K4C A;  1MMG A;  2F5V A;  2ELJ A;  1JI8 A;  2R4G A;  5HOO A;  3BCB A;  4PK4 A;  2WY8 Q;  3VSK A;  1V5G A;  4HNT A;  3E0J B;  2VPL A;  4G6T B;  2LRE A;  3EUH C;  2VAS A;  3OY9 A;  4BQN A;  4II3 A;  3K70 C;  1UAA A;  3CJR B;  3RQ4 A;  4BJ6 C;  3OYN A;  2V26 A;  3ONQ A;  3H9G A;  1LKX A;  2L7K A;  2WY7 Q;  4BDZ A;  2R7V A;  4XR6 A;  1U0J A;  4PFP A;  4PJM A;  2ZXH A;  4KJZ A;  3UNG C;  3C2H A;  3OS2 A;  5KNL A;  2CV0 A;  3PNY A;  3LSK A;  2HNH A;  3VYU B;  2VXZ A;  4ZC3 A;  2CV1 A;  3S32 A;  4BE0 A;  4HG2 A;  3VYR B;  1TZL A;  4B48 A;  3OYA A;  2WBM A;  3K6G A;  4ANJ A;  1Z7L A;  2K5C A;  2E5N A;  3SZG A;  2HQA A;  3UR3 C;  2DJI A;  4LIV A;  1K6Y A;  4F92 B;  1YX3 A;  5CQG A;  1D0X A;  2P0W A;  1X19 A;  2KRH A;  4BS9 A;  2O5R A;  2IGM A;  4HST A;  4F93 B;  2HVS A;  3S3M A;  1X1B A;  2HPM A;  4BDY A;  3BG7 A;  2CFO A;  4DGW B;  2HDW A;  4BJ5 C;  3HOT A;  3H5N A;  1W36 D;  1QHG A;  3K4M A;  3K4N A;  3DTK A;  3DPU A;  3RSN A;  1N78 A;  1DQU A;  2UWM A;  3LSH A;  3OYC A;  4LIT A;  1BOB A;  4QPQ A;  3S93 A;  4F3Q A;  2E5Z A;  4XQF A;  3AL0 B;  4BXF A;  2HZD A;  2CV2 A;  3OR1 C;  3LFU A;  4XLF A;  1T0F C;  1X1D A;  3U21 A;  1WFX A;  3QYE A;  3OS0 A;  3RPU D;  3OYK A;  4EAT A;  2R7X A;  2LC2 A;  4IZZ A;  2K9L A;  1BR2 A;  4B43 A;  3OYL A;  3FDY A;  2JVG A;  3GBG A;  3OIQ A;  4IQ4 A;  3PNT A;  2W7N A;  2CH0 A;  2KLO A;  1D0Y A;  3DPT A;  3FBN B;  3K4L A;  2Q2E B;  4ZDL A;  1V5E A;  3HPH A;  2IGK A;  3HC7 A;  1GLN A;  3C2G A;  3OR2 C;  3SDB A;  3QOE A;  3VWB A;  2Z1D A;  1G59 A;  3S3O A;  2Y0S A;  4XLH A;  4XLC A;  4E7H A;  2A6T A;  4Y4R A;  2R7T A;  4BE1 A;  2OV7 A;  1D1B A;  3HL2 A;  1X1C A;  4YRV A;  4ZDP A;  4XOP A;  2KL4 A;  2R7Q A;  4BEH A;  3MD2 A;  4E7L A;  1WJB A;  1Y6I A;  2L9S A;  4IQJ A;  1EA3 A;  1TT0 A;  2IS2 A;  2V1N A;  2W1O A;  4RM2 A;  2XF5 A;  4IKF A;  3ZXS A;  4HNU A;  3OMY A;  4XM3 A;  3W2V A;  5KHD A;  1P9Q C;  2X85 A;  3CMM A;  2L5Q A;  2X6W A;  4E7Z A;  3OYG A;  4NC7 A;  4E7K A;  2W82 A;  4KIS A;  2VQH A;  3L2W A;  2VKH A;  5FRM A;  4CCO A;  2CMP A;  2XAU A;  1VZ0 A;  2BW3 B;  3MMY B;  1DGW Y;  3OYM A;  2NOJ B;  3H0D A;  4ZTF A;  2LOO A;  4DIQ A;  3A1Y A;  4PJJ A;  3TMO A;  3OYB A;  2AQF A;  3G2B A;  1V5F A;  2KDO A;  1MMD A;  1QU3 A;  4BL0 B;  4JOM A;  3DWL E;  3QOD A;  3OYJ A;  4RLF A;  4AVZ A;  3TBI A;  4XKC A;  1DP3 A;  3DKY A;  1OR7 C;  5HNH A;  2IS6 A;  2RNG A;  4FAS D;  1OLT A;  4YEL A;  2MC4 A;  4FET A;  4J01 A;  4C30 A;  3ZR8 X;  3H9J A;  3F9K A;  3LMM A;  2LYC A;  4P1W A;  3SEQ A;  1UG0 A;  5FRO A;  3NWT A;  3TL4 X;  4CSW A;  3PJR A;  4BJT A;  2IXS A;  2BVL A;  2MD0 A;  3EUA A;  3OWT A;  4H4K C;  3A4C A;  2XF6 A;  2E1M C;  2HVR A;  4BE2 A;  2XSJ C;  1SFK A;  3ZRG A;  5LFA A;  4U7B A;  4ITV A;  1MMA A;  4DBR A;  2DXI A;  4E6K G;  2A5W A;  3ZQQ A;  4NQW B;  4RM3 A;  4CCK A;  2ZSH B;  3DEE A;  4KT6 A;  2VB6 A;  4Y33 A;  2K9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...