2D45A

Crystal structure of the meci-meca repressor-operator complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
TYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*TP*AP*CP*TP*AP*CP*AP*TP*AP*TP*GP*TP*AP*GP*TP*A)-3'
publication title Structure of the MecI repressor from Staphylococcus aureus in complex with the cognate DNA operator of mec.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
total genus 31
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2d45A01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 2d45A02
4ZZLA 1KQ8A 1WI9A 4G6DA 3Q9SA 4UNOA 3V7SA 1UCRA 3IWFA 2KRFA 3TO6A 1KU3A 2XV4S 4M9ZA 1Z6TA 2FF4A 5LLQA 2ZFWA 2E7XA 2VBXA 1S3JA 2HS5A 1ZGAA 1P4WA 3TKYA 4L18B 2VXZA 1Z7UA 4I02A 3C3WA 2R3SA 1HSTA 1USTA 1EV7A 1W5SA 2F2EA 3LA7A 3LA3A 1F1ZA 4I0BA 2VOOA 1SMTA 2O6GE 2CYYA 4Q4ZF 4DNCA 4S05A 3E3VA 4MGRA 3EETA 1BM9A 3HSEA 1J0RA 1ZYRF 2K7LA 3RKYA 1L0OC 3CUQC 1XD7A 5LHHA 3E97A 2P6SA 4M74A 3KEQA 4PGGA 3J80Z 1BC7C 2YX7A 2CO5A 5DYMA 3M1EA 1P4AA 1JHFA 1R00A 3ISPA 4M9XA 1OR7A 3V8JA 1O57A 2G9WA 2QLZA 2ZNYA 3ZPLA 3K69A 3T5XA 4BHCA 3QU6A 1LDDA 3F8MA 4B09A 1MZBA 3WTUC 3MQ0A 4UVCA 1T98A 1GHCA 2XROA 5DCFA 4P55A 2A69F 1S7OA 3QOPA 1BC8C 3WTXC 2BE5F 4FT8A 4HQEA 1LJ9A 5F64A 4RB1A 1DP7P 4Q48A 1MJBA 4M73A 4CO8A 2GXGA 4A5NA 5E18F 3WGHA 4KT5C 1YG2A 3BOQA 4WCGA 1LNWA 3DF8A 5CVRA 4EGZA 2OZ6A 3RDIA 2QYOA 2L4AA 1JHHA 3RPQA 1W7PB 4GCVA 1U5TA 3P9IA 2FNAA 2FMYA 2WWYA 2G7UA 2FXAA 2LNBA 2K02A 2K86A 4LG0B 2FQ3A 4BNCA 2COMA 3DPTA 4JBAA 6PAXA 4PDKA 1QQIA 1UFMA 2NNNA 5DUIA 2IRFG 2L3DA 4KMFA 3ABUA 4FX0A 3QPHA 1MJAA 2IA2A 1R7JA 4WXCA 2DLLA 3U1DA 4RB2C 1H9TA 2GAUA 2F5DA 1IF1A 2FE3A 2IPQX 4M71A 1QBJA 5HS8A 3KEOA 4IRGA 5ED4A 2ZMEA 2CW0F 3BWGA 2O03A 3RJPA 3L00A 1FPQA 1NHAA 2O0YA 3HSFA 2E1CA 1B4AA 4A5MA 5A2QK 4GO1A 1AWCA 1U5TC 4LD5A 4EMSA 1FBUA 1T6SA 3HHHA 3F8FA 5BS6A 1K6OA 4XSXF 4HDUA 1Z6RA 1TW3A 3HYIA 1ZREA 3KE2A 4N9HA 4G6QA 4XLPF 3CJNA 3F21A 1SFXA 3GXOA 3FM5A 5E1WA 5LEKA 3QP5A 1HKQA 4HZFA 1PP8F 3K1MA 2HR3A 2W24A 4RGXA 4U7BA 2CGPA 1J2XA 2DPDA 3QAHA 3ZMDA 1QZYA 2A5YB 3PQKA 4M72A 4BXUA 3SXYA 2HQRA 2Y75A 1GXQA 1STZA 2QUFA 3R4KA 4KIFA 1B1BA 1FP1D 2GIVA 3F23A 1ZLKA 2XIGA 4UUVA 3V8LA 2AXLA 5ILUA 1KU9A 4LGWA 5H6RA 4U0YA 1VTNC 1SD4A 3HRMA 3IHUA 1RUOA 2HQNA 1R58A 4IRHA 1WSUA 5LGTA 3L7WA 4HLYA 3BROA 3FMRA 3ZN1A 3I59B 4JQFA 1BI1A 3IC7A 1R5HA 2GA1A 2XAGA 1YLFA 2HKOA 5KK1A 3HOSA 3WU0A 2HTSA 3RYRA 2IT0A 1OPCA 3FMQA 1YW8A 2NRAC 2IVMA 2RC4A 3GF2A 4LLGF 4GGGA 3FXQA 2VE9A 1A04A 4OMYA 1RIOH 1YW9A 4HYEA 5HDKA 2OQRA 5ICCA 4KNYA 3DEUA 5HVQC 3FZVA 2KIFA 3KP2A 3I64A 4R79A 2UWMA 2STWA 5IT3A 2A61A 2HWVA 2Y48A 4LB6B 3IRRA 1IZ1A 4ENJA 1QNTA 2RQPA 3LSTA 5BPIA 3KCCA 2BYVE 3GO5A 1FC3A 3T8TA 3L9FA 3ZMTA 3M8EA 1MJ9A 1RNLA 3BJAA 4KFCA 3KLOA 4OIQF 2HTJA 3MZYA 1ZG3A 2MA3A 4KICA 3IRQA 2FSWA 1IRGA 3FHZA 1LQ1A 3BJOA 2VBZA 4BYYA 3I58A 3VFZA 2W85A 5AONA 5HLIA 2XRNA 4D0PA 1P6RA 3T0YA 1BBYA 3K1PA 1SD5A 1U2WA 3MEXA 1OYIA 2M1BA 4EM0B 4LFUA 4A0YA 1CGPA 2Q8KA 2P5LC 3VB2A 3E6BA 5LHGA 2F5FA 2P4WA 3JAMK 1RUNA 1BOAA 2RKHA 5DV5A 2PMHA 5D5VB 2D45A 2Q2EA 2KIUA 1R1TA 1OKRA 1I27A 1S29A 1HW5A 2PG4A 5LEJA 5LHIA 1T39A 4P5OA 3BPXA 3L2CA 2P5VA 3KLNA 2FNPA 5CVVA 3CDHA 2MLGA 3P7NA 3V7RA 1OMIA 1I5ZA 4OIRF 4L0YB 5IT9Z 2D2WA 2XGXA 1ZG5A 5HDGA 3K1NA 4E70A 4OU0A 4Q47A 4WXDA 3VOEA 1LDKB 4HF0A 4ASNA 2V1UA 4RGSA 1HW2A 3P9KA 4EJWA 2MBFA 1BIBA 4HOBA 4RB3C 5L3BA 4FHTA 2YX4A 3EUHA 4HLXA 2DBBA 4LLLA 4Y17A 2JTVA 3DQVC 3TQNA 4JK1X 2XAHA 1HBXG 5K5OA 2IJLA 4Z2YA 4EQQA 2GZWA 3ULQB 5K5RA 2L02A 4RAZA 4B8XA 3VEPA 1SD7A 2JSCA 2ELHA 3CUQA 4UXNA 5F1RA 5CYVA 4ZH4F 3WU1B 3J7AO 1C0WA 4PCQA 2LDUA 3ML6A 4RGRA 4R1HA 5J6XA 1EH7A 1MKMA 3MZHA 1J75A 1ZRCA 1BIAA 2GA2A 4ETSA 1LDJA 4MQ9F 3WTTC 1SFUA 4P9FA 3FWEA 2UZKA 4MNUA 4WWCA 2G7HA 3R0AA 1BI0A 2QENA 4K2EA 3RPUA 2XHKA 3F72A 1U5TB 1QGPA 2FBIA 1S6LA 3FX3A 3T8RA 1ON1A 2R7DA 3WE2A 3GX4X 5AIQA 2V79A 4IHTA 3I5UA 4MTDA 3GWZA 5HDNA 1HW1A 2F5EA 2VT2A 1FY7A 2GQQA 1Z1DA 3WGIA 4NHJA 1FBSA 2EJRA 2OD5A 1XSXA 3HRTA 1KU2A 5KVRA 4AVPA 1K79A 2YR2A 4Y13A 2ZMEB 1FX7A 1HKSA 1TNSA 2RNJA 4CYDA 4IF4A 3I0TA 1G3SA 1SFEA 5FO5A 1FYKA 4CZZA 3E6CC 4HQMA 2HFHA 4LK0F 5ILVA 3JW4A 5D4SA 3I54A 1LB2A 3CO6C 2XASA 1Z9CA 4UVAA 2NAZA 1B59A 1MDMA 4BHBA 2L54A 3J81K 3T1BA 2X4HA 1W5TA 4OOIA 3E6MA 4YIIA 1TBXA 1ON2A 1WWXA 3CUOA 3KETA 5DCMA 4EJUA 4P9UA 5EEGA 4KUMA 4LJZF 3IL2A 2IW5A 2FU4A 1IN5A 2BV6A 2VC0A 1KQ0A 3SZPA 1KYZA 1U6GA 1XSDA 4IJAA 5CVIA 3F8NA 2ZCWA 3VODA 2KJBA 5FLXZ 3GLXA 4U0WA 4L9JA 5D8KB 2CWEA 4ZYEA 1SD6A 1O3TA 3CLOA 2UXNA 4KN4X 2MD5A 4I09A 2P7VB 3JTGA 3O2PE 4IXAA 1IXRC 1U78A 1R22A 1DDNA 5L3GA 1Q1HA 1P92A 1B9MA 1KQ9A 2OBPA 4UV8A 4IPAA 5DDGA 3U9GA 4MEYF 3BP8A 3I71A 3H92A 5E1XA 4ZZDA 2M30A 4HF1A 2QZ8A 2IP2A 1ZN2A 2EWNA 2NS0A 1T38A 4A6EA 2FBKA 4IVNA 3REOA 2CQKA 4M6YA 4O3MA 3W6JB 4EV0A 2IA0A 2OAZA 3RTRA 4U88A 1Z91A 3IWZA 1ZGJA 4HW0A 4G7OF 5TRDA 2GWRA 1O3SA 4AIKA 4WK8F 4HA8A 5H20A 4G9YA 1X3UA 4ESBA 2A68F 2A3SA 2MH2A 1J59A 4RS8A 1YS6A 4LK1F 1ODDA 1S7AA 2X0LA 2M8EA 1I1GA 4XLNF 2V9VA 3J80K 4TV7A 4WXHA 4A6DA 1U8RA 3WTWC 2JPBA 3GYHX 5ICGA 1R5GA 4BH9A 2PFBA 3WODF 3P9CA 1YIOA 3MFKA 2RVCA 3COAC 4I98B 5BQTA 5K1YA 4YFNF 5ICEA 3LQRA 1FSEA 3LA2A 1KU7A 4EGYA 2EFNA 1HSJA 1XCVA 5BMZA 3IKVA 3DP7A 1ULYA 1IW7F 4HV6A 5FGMA 1IUYA 1D3YA 3HHGA 2Z5UA 4O5VA 5LRSA 4Y15A 2HZTA 2STTA 4YIFA 2PI0A 2ISZA 1IN4A 4F7ZA 3TO7A 2P7CB 3ZN0A 3SQNA 1ONVA 3CTAA 3RI4A 3H3ZA 3QU3A 3G73A 5HS9A 2D1HA 4KIGA 2QQBA 2M45A 5FFXA 1ZRFA 1YTYA 2KJCA 1T0FA 2P5KA 2JT1A 5EEHA 4MEXF 2QBYA 5BOXA 3NRVA 3M8FA 1SAXA 2EA2A 3SHFA 2ISYA 5D6EA 4AWXB 1F5TA 2H6BA 5HS7A 1YQAA 4L9VA 5CLSA 2YSRA 3FXUA 3WG9A 4KYWA 3ZQ7A 2DTRA 2ZXJA 1TW2A 5JVTA 2RN7A 3V8KA 3NQOA 4BHPA 2MC3A 2DQRA 1FOKA 3N97A 4CHUA 2A6EF 3WTZA 1JE8A 2ACJA 3HRUA 2MLKA 1ZG1A 4L0ZB 2NYXA 5E8GA 3ERED 4XBFA 2DI3A 3TOAA 2YPRA 2FA5A 2PJPA 1FSHA 5HOOA 4BAYA 3I53A 3C1DA 5L3CA 5LBQA 3HOTA 3BZ6A 1YYVA 4HDVA 2ZJ2A 1J5YA 3O3KA 1IXSB 3ZMSA 2WTEA 4EM1A 4GYGA 2HEOA 1YO5C 3CUQB 5K5QA 2XKPA 3B73A 2L4MA 5LGNA 4AD9A 3EQLF 3WTYC 5DEQA 2B0LA 5JI6A 1FNNA 3HRSA 3ECHA 2FRHA 3CO7C 3E6DA 1XGMA 2BBYA 3BY6A 2K27A 4GYIA 2YU3A 1Y0UA 1CF7A 4IRIA 5E1ZB 2VOPA 5JR3A 2OZUA 1O3QA 3RYPA 5E17F 4I7HA 1QO0D 1K78A 1P4XA 2V1DA 4ON0A 4HAMA 3TGNA 1FT9A 4UV9A 1XDUA 3JTHA 1OYWA 3MCZA 3W6KB 3FMSA 2LF7A 3L09A 2LKPA 2HYFA 2L01A 1TQIA 2DK8A 4L9NA 1ZARA 3GZ5A 4PZJA 2XVCA 1TQPA 2FMLA 1TLHB 5CVJA 1F4KA 2HGCA 1RZ4A 2TDXA 2ESNA 3O6BB 5D5XB 1AOYA 5F6FA 3M7GA 4MQVA 2R7FA 4XRFA 2LSOA 2HOEA 3KFWX 3KZYA 1D8JA 2EV6A 5AIPA 4QLCU 3ZMZA 1G6NA 3TDZC 1TQMA 2UXXA 5FD5A 3R61A 3H3UA 2XAJA 2EFWA 2Z33A 1LEAA 4QWQA 3BJ6A 1P2FA 2H09A 2O61A 1MDMB 1KGSA 2DFIA 2DO7A 3ZP5A 1S8NA 2E7WA 4PGHA 4KIBA 5JFRA 4WX9A 3WE3A 3F8CA 1K7AA 5A2QZ 5DD4A 3F22A 4A0XA 4ESJA 1ZH5A 3N4MA 4KMUX 2VBWA 1DPRA 2O3FA 5DCMB 1FLIA 4A0ZA 2K4BA 5L3FA 1GVJA 3GZ6A 3ZMVA 4CDGA 3MWMA 2P6TA 3DXJF 4HV5A 4G7ZF 4HX8A 1BI2A 4YG2F 1IN8A 1G3WA 2ESHA 2DU9A 2M5WA 2EV0A 4HX7A 5J8FA 4EM2A 5TJJA 2EB7A 1FBQA 1PP7U 4A12A 4Q5SF 2VODA 3G3ZA 2W57A 1DPUA 1IN7A 2IA1A 2PQ8A 2OA4A 3E5QA 4EJVA 2DPUA 4HBLA 4H0EA 3EDPA 2XKOA 1XB4A 1XSVA 1T2KA 4BQAA 4LB5A 2VE8A 2FEZA 3HTUA 2HYGD 3RKWA 3GFJA 1E17A 3HSRA 3C7JA 2EFPA 3GFMA 1WQ2A 4IHSA 2JZYA 3M9AA 4KA4A 1FWZA 4RB0A 2ETHA 3F3XA 5IT9K 3JSPA 2V1XA 1UB9A 3LAJA 4AIHA 3GVAA 2J5PA 1LEBA 2BGCA 2EFQA 2JRTA 3FF5A 4U7DA 3DV8A 4ZYHA 3KZZA 2ZNZA 1KYWA 5HLHA 4ESFA 4CXFA 3BDDA 2W25A 1BJAA 3LAPA 3OV8A 3DFGA 3K2ZA 3F8BA 1V3FA 3R60A 5D6FA 3K9TA 4EVIA 3WTSC 5L3DA 4KN7X 1I1SA 1TTYA 2H94A 1IN6A 4OIPF 2EA4A 5D8LB 4N0BA 3ROUA 1H0MA 2WV0A 2HKXA 1B6AA 3HTSB 3LFKA 4XSZF 4DQ2A 1XGOA 2FBHA 2P8TA 4LMYA 2PN6A 1UHMA 3K0LA 3S2WA 1D8KA 1J7KA 3ECOA 2QWWA 2LF8A 2XUBA 2QQ9A 2RDPA 5H6QA 2EFOA 1FP2A 3KP4A 3V7CA 3R6SA 4M6XA 1USSA 2FOKA 4G8XA 1XMKA 4L5IA 2KKOA 5ICFA 4ENMA 1MD0A 2DQLA 2E1NA 2J5OA 3QP6A 2VONA 3JAMZ 3SZTA 2RGVA 1D5VA 5FFZA 4L9TA 3JSOA 4I2OA 3B02A 2A07F 2QBYB 1EH6A 4R8HA 2Y0MA 4RAYA 2QVOA 3E5XA 1XN7A 2M87A 3Q9VA 4YFXF 1W7PA 5D5UB 1ZRDA 4HF2A 4NB5A 2H27A 3DKWA 4LG0A 2OQGA 1U3EM 2Z3YA 1G4DA 3FXRA 1EH8A 1O3RA 1TNTA 2DAOA 1Z05A 1QZZA 4I0AA 2EV5A 2WC2A 2H6CA 4UVBA 3MAJA 2DW4A 2EK5A 3QRFF 4UHTA 3DPLC 1L3LA 1RI7A 2ZBKA 3I4PA 3R0JA 2OU2A 4L5JA 4M9SA 5E8IA 1LVAA 3E5UA 3GFIA 1XGSA 1H9GA 3KP3A 2VN2A 3U2RA 4ZYGA 2O8XA 2Q0OA 5CJ9A 2VT3A 1J9IA 3HIFA 2ZO4A 4LLNA 3FM3A 5LGUA 3F6OA 4ENNA 4G94A 4FX4A 2PBIA 2DK5A 3QPTA 3WGGA 2RV8A 2XAFA 1XDSA 3PFIA 1PDNC 4HX4A 5FLXK 4EJTA 4ZYDA 1W7PD 1CF7B 1FYLA 3D5LA 2K4JA 2DT5A 2V6CA 3GFLA 4N9IA 2F5CA 3F6VA 5D4RA 1K78B 1REPC 3BPVA 4CICA 1XCBA 1PUEE 3EYIA 1IAWA 1F9NA 5ILSA 2D1VA 3HUGA 3RKXA 5J8CA 2ZKZA 1HQCA 3WTVC 3PQJA 3V4GA 1G3TA 2Z9OA 2A6HF 3C18A 2QQAA 3GW2A 2CFXA 5FB2A 1ZAOA 4OMZA 1GXPA 2AS5F 5DD8A 1FZPB 3TOBA 1YS7A 5JHUA 2Z99A 2PEXA 5ERIA 1E2XA 2C6YA 4S04A 1HXDA 1R23A 4AIJA 3SFZA 1B9NA 5L3EA 1IXCA 1YFHA 2QM3A 2PMUA 4ENKA 3I59A 1MGTA 3D0SA 4G7HF 3KP5A 4O6JA 3ABTA 1JGSA 1SMYF 1V4RA 5FD6A 1O7FA 1DUXC 4RGUA 2CG4A 1ZHFA 4U0VA 4WF2A 5E20A 2GXBA 4P96A 4MHGA 2VC1A 1BI3A 2HDCA 4NQWA 1WRJA 1YW7A 4OINF 1IRFA 4CGZA 3GUDA 2KIMA 3J81Z 2VBYA 2BEOA 3GEZA 3LWFA 5HLGA 3ELKA 3EYYA 3KP6A 3TDUC 2ADUA 3ZMUA 1HKTA 5CVUA 1ZLJA 4GXOA 2JPCA 5D5WB 2NNYA 1G3YA 4OIOF 3KP7A 1XGNA 1KA8A 1R36A 2PLYA 5LRRA 3LQQA 3NEUA 1I6XA 3RIRA 4I01A 4EJOA 3TO9A 4A2UA 1UHWA 3Q5FA 1R1UA 1JXSA 1O7LA 1BN5A 1QPMA 4MTEA 4KDPA 3OOPA 2W84A 1W4MA 3IKTA 2XAQA 1XMAA 5DUKA 1WKMA 1FYMA 1R1VA 5BPDA 3AAFA 2MH9A 4YFKF 2CSOA 1OYYA
chains in the Genus database with same CATH superfamily
2KDOA 4ZZLA 1S7EA 1KQ8A 1WI9A 4LIUA 4RLQA 3G71I 4G6DA 1X2MA 2ZJQF 2M2EA 3Q9SA 3TEDA 1XPXA 4UNOA 3V7SA 1UCRA 5KAIC 3IWFA 2KRFA 2LKXA 3TO6A 3PIPF 2PMZN 3DU5A 1KU3A 1HCRA 1SC7A 1JT6A 3M1CA 1Q1VA 2XV4S 4M9ZA 3BZCA 2Q1ZB 3W2AA 1Z6TA 2FF4A 5LLQA 1JJ8C 3H3VK 2ZFWA 2LD5A 4XLHA 2KRCA 4NC6A 2E7XA 2VBXA 1S3JA 2HS5A 5J47A 1ZGAA 3TBIA 2WA0A 1P4WA 2DA1A 2M4GA 3TKYA 3MKYB 4L18B 3SJMA 1A6IA 2VXZA 2JRMA 1JUPA 4ZDLA 1Z7UA 4I02A 1YX5A 3KYLA 2E71A 3C3WA 3PSFA 2R3SA 1TWHJ 4F52A 1HSTA 1USTA 1EV7A 1W5SA 2F2EA 3LA7A 3LA3A 1RR8C 1F1ZA 4I0BA 1NK3P 1HLVA 2K85A 1SMTA 2NXNB 3EUHC 2X1DA 2VOOA 2RNGA 3HB9A 2O6GE 1K83J 2CYYA 4Q4ZF 4DNCA 4S05A 1Z7LA 3E3VA 3EETA 4MGRA 3JRDA 1BM9A 2X1EA 4BY7J 5E3OA 3HSEA 4ZTFA 1WJ5A 1HF0A 1J0RA 1VFCA 2A5WA 1BA5A 3H9QA 1ZYRF 2K7LA 2LY9A 3CCYA 3RKYA 2R7RA 3MMYB 1T08B 3HOZJ 3M3YJ 2WAFA 1I3QJ 1L0OC 1D1CA 3BLYA 3GLLA 3QYBA 3CUQC 1XD7A 5M5YJ 2OTLI 4AYBN 5LHHA 3E97A 2HYJA 3OYGA 2P6SA 2E5ZA 1PUFA 1D1BA 3KEQA 4M74A 4PGGA 3J80Z 2ZJPF 3S15J 1BC7C 2QCOA 2CQ7A 4JX6A 1D0XA 2YX7A 3QYFA 2CO5A 2MYSA 2DT7B 2V26A 2RREA 5DYMA 3M1EA 1TWCJ 3UR3C 2R0QC 1VQPI 1P4AA 4CH7A 4AM3A 1JHFA 1R00A 2ICWG 5M5XJ 3HL2A 3ISPA 4M9XA 1M1EB 1OR7A 1VNDA 1X3ZB 3HZJA 3V8JA 1Z0XA 1O57A 2G9WA 3HKZA 2QLZA 4UY8I 1YX3A 4EATA 2ZNYA 4BDZA 3ZPLA 2K40A 3K69A 3T5XA 4BHCA 3QU6A 1LDDA 2DDAA 3F8MA 4B09A 1GDTA 1MZBA 3G2BA 3I9V2 1W36D 5F0HA 3WTUC 3MQ0A 4UVCA 4IHXA 1T98A 1GHCA 2K9SA 2XROA 3FBIB 1WFXA 2NOGA 5DCFA 1AKHB 4P55A 1MMGA 2A69F 2BXZA 3ZQHA 1S7OA 3QOPA 1BC8C 2VKVA 3WTXC 4E7KA 5EDNA 1R71A 2BE5F 5EGOA 4FT8A 2XF5A 4MIMA 4HQEA 1LJ9A 5F64A 4ABZA 5GTIC 4RB1A 1DP7P 2XC7A 3A01A 4Q48A 1MJBA 2IBDA 1R4NB 3AG3H 1Z3YA 4M73A 4CO8A 1XS9A 1T56A 2GXGA 3VYTB 4A5NA 4XKWA 5E18F 3WGHA 4BJ6C 4KT5C 1YG2A 3BOQA 4WCGA 1LNWA 3H1CA 1DU0A 3I3LA 3DF8A 5CVRA 3BR1A 2JUCA 4EGZA 2O8KA 2GOMA 2OZ6A 4BXFA 1OFCX 3FIWA 3RDIA 2LBFA 2QYOA 2L4AA 1JHHA 3RPQA 3LNQA 1YJ9I 4A3KJ 1IGNA 1W7PB 4GCVA 2JUGA 1U5TA 4BACA 3P9IA 2FNAA 2FMYA 2WWYA 2G7UA 2HVQA 2Z16A 2FXAA 2LNBA 2K02A 2K86A 2XAUA 3QQAA 4LG0B 2FQ3A 2X48A 4BNCA 2JA5J 2GM4A 2COMA 3JRAA 5FLMJ 1P7JA 3DPTA 4JBAA 6PAXA 4PDKA 4H4KC 4A69C 4E7HA 1QQIA 1MBKA 4V19K 2BHYA 5C4JJ 2LC2A 2PJRB 1UFMA 2NNNA 5K7FA 5DUIA 2IRFG 2L3DA 5IOYA 4IOAF 1OCCH 4KMFA 3ABUA 1OCZH 4FX0A 3QPHA 1MJAA 2EBIA 5C44J 2IA2A 1R7JA 3GZNB 1HA8A 4WXCA 2DLLA 3U1DA 4RB2C 1H9TA 2GAUA 3VSLA 2F5DA 1IF1A 2FE3A 2IPQX 3BZKA 2MABA 4M71A 5HS8A 3H5AA 3KEOA 4IRGA 5ED4A 1QBJA 2ZMEA 1PYVA 2ID3A 2CW0F 2L7MP 3FBNB 1VQ5I 2ELKA 3BWGA 2O03A 3RJPA 5IY5H 3H0DA 3L00A 1FPQA 2KISA 1NHAA 2VLAA 2O0YA 4XLCA 3HSFA 3F0CA 2DDBA 4XKCA 2E1CA 1B4AA 3CESA 1G59A 2LLKA 5TGTA 3ZQGA 4A5MA 5A2QK 3RCOA 4GO1A 1AWCA 1XC5A 1U5TC 1R49A 2M0MA 3HOUJ 4LD5A 3LSJA 1FMVA 4EMSA 2XDVA 1MNDA 2EPFA 1Z3XA 1UHSA 1FBUA 1T6SA 3ASNH 3HHHA 3F8FA 4PJJA 5BS6A 5KNLA 2YS9A 1K6OA 1E3HA 2DA2A 3DPUA 4XSXF 4HDUA 1Z6RA 5EYRA 2BY2A 1TW3A 1TT5B 3HYIA 2R5YB 1ZREA 4PSWA 1F43A 3KE2A 4N9HA 4RLFA 2XSDC 9ANTA 4IHVA 4BJTA 3SDGA 2V7FA 4G6QA 4XLPF 3CJNA 1UELB 3F21A 1SFXA 2HOAA 4BGDA 4BS9A 3GXOA 3FM5A 5E1WA 5LEKA 4F3QA 2OJED 3QP5A 1W5CC 2BHZA 1A5JA 3K10A 3Q3SA 1HKQA 4HZFA 1PP8F 4PJMA 3K1MA 2HR3A 2W24A 5EEAA 4RGXA 4U7BA 1LUJB 2CGPA 1J2XA 2DPDA 4CCNA 3QAHA 3ZMDA 2B7EA 1QZYA 4UUSA 2A5YB 3PQKA 2IEKA 5HNHA 1TL8A 4G6TB 4M72A 1I39A 4BXUA 3SXYA 5FLVA 2HQRA 2Y75A 3HUGB 3C2BA 3FXLA 2QUFA 1GXQA 1STZA 2CW7A 2DA3A 3Q0VA 3R4KA 2HPMA 2QF7A 4KIFA 2DA7A 1B1BA 1FP1D 2GIVA 3F23A 3C2GA 4OAYA 3IAM2 3S8PA 1QHHD 1ZLKA 2XIGA 4BEHA 2OTJI 4UUVA 3N05A 3V8LA 1JI8A 2WADA 2ECCA 2LH9A 2AXLA 5ILUA 1KU9A 4LGWA 5H6RA 4U0YA 1VTNC 3RQIA 3CJTB 1SD4A 3HRMA 4J00A 5FRNA 2RAEA 3IHUA 2DFHA 1RUOA 1V5EA 2HQNA 1R58A 4IRHA 2HVSA 2X6YA 1WSUA 1X4PA 3H35A 5LGTA 2VQCA 5F0CA 3FKIJ 3QWLA 3D1NI 3L7WA 4HLYA 3BROA 3FMRA 5B3SH 3ZN1A 3I59B 1QZEA 4JQFA 4XM3A 1A35A 3OYNA 1BI1A 1SFKA 3IC7A 1R5HA 3HKZN 4LIVA 2GXAA 2GA1A 3FK6A 2XAGA 2ELJA 1YLFA 2HKOA 5J40A 5KK1A 3WU0A 1F36A 4C3JJ 2CFOA 3HOSA 2CV0A 1HC8A 2HTSA 3RYRA 5GPAA 1N25A 2IT0A 1Z21A 1OPCA 3FMQA 4CYCB 1YW8A 2VB6A 2TCTA 4BDYA 2NRAC 2IVMA 2R93J 4A3CJ 2RC4A 3GF2A 3QODA 3ZXSA 4LLGF 4F92B 1RRJA 4GGGA 3FXQA 2HDWA 2VE9A 1R4MB 2EINH 2NVUB 4AC0A 1A04A 2WY8Q 2R7WA 4OMYA 3S1QJ 1X1BA 4LITA 4NQWB 3K6GA 1RIOH 1YW9A 1N75A 4BXXJ 2DJNA 3FKJA 4YEJA 4DIQA 2CH0A 3OYCA 4HYEA 2BVLA 5HDKA 2OQRA 4JYKA 4M3FA 5ICCA 5HLTA 4KNYA 5B5EC 5IYCJ 1JUMA 3DEUA 5HVQC 3RKQA 4HSRA 3FZVA 1ETOA 2KIFA 3KP2A 3I64A 4R79A 1LFUP 5CKTA 3HPHA 2W1OA 2UWMA 3H9GA 1HDPA 4DGWB 4DBRA 2STWA 5IT3A 2A61A 2HWVA 2Y48A 4LB6B 2MSYA 4N4NB 5KAFC 3IRRA 1IZ1A 4ENJA 1MW7A 2VJ5A 1QNTA 4IKFA 2LYCA 2RQPA 3LSTA 1ACIA 5BPIA 3KCCA 2BYVE 3GO5A 1FC3A 1MIJA 3T8TA 3L9FA 3ZMTA 4HRIA 1X1DA 1QRYA 1ETWA 3M8EA 1RNLA 1MJ9A 1BJZA 2KHMA 4UB6C 4XLFA 3BJAA 4JOMA 1FTZA 4KFCA 2M7BA 3KLOA 2MC4A 3DEWA 2L0KA 3J7ZI 4OIQF 1UG2A 3SEQA 2HTJA 3S1RJ 3MZYA 1ZG3A 4KJZA 2MA3A 4KICA 3IRQA 2FSWA 1RKTA 4FETA 1ETXA 4XKVA 3CQZJ 1IRGA 1EJ9A 2B63J 3FHZA 1QVUA 3FXJA 1LQ1A 3BQZA 3L2UA 3BJOA 1YRNA 2VBZA 2WAQN 4BYYA 3SYTA 3I58A 3VFZA 2W85A 3PL8A 3ESWB 5AONA 5HLIA 2XRNA 1FMWA 3G1OA 4D0PA 4A3GJ 3CCMI 1P6RA 3HPGA 2H1LA 3T0YA 1BBYA 2K5CA 4QIWN 3K1PA 1SD5A 1U2WA 3A0BC 3MEXA 3OYBA 3AG4H 1OYIA 2M1BA 4EM0B 4LFUA 3H9JA 4A0YA 5IP9J 2AHQA 1CGPA 2Q8KA 2P5LC 1GT0C 3VB2A 3E6BA 3MKZA 5LHGA 2F5FA 2P4WA 1MMAA 3JAMK 1RUNA 3KIOA 1BOAA 2W82A 3C2HA 3L2VA 2DA4A 2RKHA 2ZSIB 5DV5A 2CRGA 2PMHA 5D5VB 5M5WJ 1W0TA 5LFAA 2M4KA 4V2GA 3OYEA 1MBJA 3OL3A 2D45A 2Q2EA 4IHYA 2EZLA 3CCSI 3K4KA 2KIUA 1R1TA 1OKRA 1I27A 2FOWA 2HPIA 1S29A 4XMYA 1HW5A 5CPRB 2PG4A 3HXLA 2WY7Q 5LEJA 5H2FC 3JRHA 2JA7J 1MSEC 3IP4B 2JN6A 2OCEA 5LHIA 3OIPA 5B1BH 2CV2A 2P81A 1T39A 4XN3A 4P5OA 3BPXA 4A3IJ 3L2CA 2P5VA 3KLNA 1RC9A 1J09A 2FNPA 4CCMA 1YIJI 3HOWJ 5CVVA 3CDHA 4QSHA 3GTJJ 2LRDA 2MLGA 2XSJC 3P7NA 4QPQA 3V7RA 1OMIA 1I5ZA 1RR7A 4IEJA 4Y33A 4OIRF 4L0YB 3OYJA 5IT9Z 2D2WA 2XGXA 1B72A 1ZG5A 2QSGX 4XRSG 5HDGA 2F48A 3CP8A 4N4OB 5M3MJ 2K9NA 3CCLI 3K1NA 4E70A 4OU0A 4Q47A 4WXDA 4GFBA 2Y31A 1SFOJ 4HNVA 3UKGA 1WZ2A 3CCUI 4HNUA 2L7KA 3K4JA 2DOAA 3S3NA 2Y9ZA 3IUOA 2EZHA 2QKMB 3VOEA 1LDKB 4HF0A 3L2RA 1S5LC 4ASNA 1JKOC 1ZR4A 2V1UA 4RGSA 1HW2A 3P9KA 1ETKA 4OAZA 3RSNA 4EJWA 2MBFA 2K9MA 4FASD 1APLC 3D5SC 3HJEA 1BIBA 4HOBA 4XRSA 2H8WA 2HDDA 4RB3C 1PUFB 2DYRH 1QPIA 1IC8A 1IG7A 2O7OA 3BR0A 4AVZA 5L3BA 1ETYA 2VL8A 4F55A 4NUBA 4PK4A 3HC7A 4BE1A 4II2A 4FHTA 2YX4A 3EUHA 3S3OA 2R7SA 5C3EJ 4HLXA 2DBBA 4LLLA 1ENHA 4PSXA 4DJAA 1OISA 2EIJH 3AL0C 4Y17A 2JTVA 3DQVC 3TQNA 3S3MA 2E2JJ 4JK1X 2XAHA 2Y69H 1HBXG 5K5OA 2IJLA 3BTIA 4Z2YA 4EQQA 5GPCA 4A3DJ 3CJRB 2GZWA 3K70C 1N78A 3ULQB 5K5RA 2L02A 4RAZA 4B8XA 3NAUA 3NARA 3VEPA 1SD7A 2JSCA 2ELHA 4B1RA 4DBQA 3CUQA 1OCRH 5EGOB 4UXNA 5F1RA 5CYVA 4Y52J 3LSKA 2DXIA 5F08A 2OC6A 4ZH4F 4XORA 1ZKGA 2JSPA 3WU1B 3A01B 1LE8A 3J7AO 1C0WA 3J7AY 1W1WE 2I10A 4PCQA 2LDUA 3ML6A 4RGRA 1WI3A 4R1HA 5J6XA 1EH7A 5FKKA 2LFBA 1MKMA 2TRTA 4Y4RA 3MZHA 1J75A 1ZRCA 1ETVA 1BIAA 2GA2A 3QOEA 4ETSA 1LDJA 4MQ9F 3WTTC 2X6XA 3ERMA 1SFUA 2V4JC 2XF6A 1ERDA 4P9FA 4XL9A 3FWEA 2H8RA 4C2TA 2UZKA 3PNYA 1GV5A 4MNUA 4WWCA 3L2WA 2G7HA 3R0AA 2LBFB 1BI0A 2QENA 1U9NA 2O5RA 4K2EA 3CDIA 3RPUA 1ETQA 1Y56A 2XHKA 3F72A 4DZPA 3GTQJ 1E0EA 1U5TB 3H0GJ 2X85A 1A6QA 1QGPA 2FBIA 3OWTA 3WG7H 1S6LA 3FX3A 4X6AJ 2Y0SA 3T8RA 1ON1A 2R7DA 5FKOA 3DTEA 3WE2A 3GX4X 5AIQA 5K7HA 1KZHA 2MW8A 2V79A 2VJIA 4BQNA 4IHTA 3I5UA 4MTDA 3GWZA 2QSFX 5EG0A 5HODA 1XTAA 3I4MJ 5J1YA 5HDNA 1UG0A 4C2MJ 1UAAA 2VT2A 1HW1A 2E60A 2F5EA 1FY7A 2BXYA 4C2UA 2GQQA 2WB1A 1Z1DA 3WGIA 2GLOA 1VQ8I 1FBSA 2EJRA 4PFPA 1BL0A 2OD5A 4NHJA 1XSXA 3D5RC 1B8IA 4M3DA 3RZDJ 3HRTA 3G4SI 1KU2A 5KVRA 3GBGA 4AVPA 3OOUA 4AU7A 3VSKA 4ZDPA 1K79A 2YR2A 4BKXA 4Y13A 2HI3A 2ZMEB 1FX7A 1HKSA 3AKZA 2VPLA 1TNSA 2RNJA 5J4VA 3K2AA 4CYDA 4IF4A 1UJ8A 3I0TA 2ZXHA 1G3SA 1YI2I 1PVEA 1DQUA 1SFEA 4JX4A 5FO5A 2RQQA 1ORKA 1X2NA 3HGYA 4CZZA 1FYKA 2KIQA 4HQMA 2HFHA 4LK0F 5ILVA 3E6CC 1X1AA 2KL4A 2NVYJ 3JW4A 4XLEA 1POGA 5IYBJ 5D4SA 3I54A 1LB2A 3CO6C 2XASA 1Z9CA 4UVAA 2NAZA 1B59A 1MDMA 4BHBA 1LPQA 2L54A 3OIOA 1YE9A 3J81K 2B9SA 3DBHB 2W4SA 3S1MJ 3T1BA 1TZLA 5M3FJ 1Y1VJ 2X4HA 3CMEI 1W5TA 2E1MC 4OOIA 2D5VA 3E6MA 2DFFA 5C4XJ 3BG9A 4YIIA 2IS4A 2HZDA 1BR2A 4RMNA 1WH5A 1TBXA 1ON2A 3PJRA 2E35A 1X58A 3OYDA 1WWXA 3CUOA 5GP9A 3KETA 4FISA 2FD5A 5DCMA 4EJUA 4P9UA 5EEGA 4KUMA 4LJZF 3IL2A 4I76A 2W48A 2ECBA 4XONA 4DYRA 2IW5A 1P9QC 4BBSJ 2XRLA 3RPUD 2FU4A 4B3XA 3CMAI 1IN5A 2QGUA 3G1LA 2BV6A 4E7LA 1SAUA 2VC0A 2F4MB 2V9KA 2E1OA 1KQ0A 3SEZA 3SZPA 1KYZA 3A1YA 2CQXA 1MBFA 1AA7A 3AG2H 1U6GA 1XSDA 4IJAA 1QVTA 5CVIA 2EIMH 3F8NA 2ZCWA 3VODA 4UUSB 3MKLA 3P5JA 3ZOBA 3H5RA 2KJBA 5FLXZ 1H89C 1FEXA 2E36A 3GLXA 2ZB9A 4U0WA 4L9JA 3QPLA 5D8KB 2CWEA 4ZYEA 1SD6A 1O3TA 3CLOA 2UXNA 3A02A 1HDDC 1Z67A 2MD5A 4KN4X 4I09A 3NWSA 5B66C 2P7VB 3EUKL 3JTGA 2V9PA 4BEHB 3O2PE 4AUXA 4IX7A 3BG7A 4IXAA 1IXRC 1BOBA 1VQMI 2KZGA 2EIKH 1U78A 1R22A 1DDNA 5L3GA 1Q1HA 1Y6IA 2OBPA 1P92A 1B9MA 1KQ9A 5FKMA 4UV8A 3OYIA 4IPAA 1MBHA 2LOOA 3U9GA 5DDGA 4MEYF 4ZTJA 4KT6A 1WCMJ 1WJCA 1IRZA 3BP8A 4RDUA 3I71A 2F4IA 3WHBA 3H92A 5E1XA 4E6KG 4ZZDA 2M30A 1U9OA 4D1QA 4HF1A 2OUMA 3J7YJ 4W97A 2QZ8A 3MN2A 4HNTA 2IP2A 1ZN2A 4NC8A 4ZDOA 3JREA 2EWNA 3E7LA 2NS0A 3JRCA 3LMMA 3HOYJ 1T38A 4A6EA 4XOTA 2FBKA 2XPVA 4IVNA 1VQKI 3REOA 2CQKA 4M6YA 1YHQI 3I55I 4O3MA 3W6JB 2IGNA 4EV0A 2IA0A 2OAZA 3RTRA 2UV1A 5F1JA 3E0JB 3CD6I 3DTKA 4U88A 1Z91A 3IWZA 1ZGJA 2DA6A 4HW0A 4G7OF 1RPWA 5TRDA 2XPUA 2GWRA 3A2KA 4W1UA 3CP2A 3M07A 1TWGJ 3BG6A 3OSFA 1O3SA 4AIKA 5CQEA 3VYRB 4WK8F 2LTPA 4HA8A 2VXDA 5H20A 1BW5A 3ABLH 4G9YA 1OLTA 1X3UA 2MGQA 4ESBA 2A68F 2A3SA 4A3LJ 2MH2A 3DBRB 1JT0A 1J59A 4RS8A 5FRMA 3BQYA 4E7IA 1YS6A 4IO9F 4LK1F 1ODDA 2QSHX 1WJEA 1S7AA 2X0LA 2M8EA 3S93A 1I1GA 4XLNF 2V9VA 1FIPA 2HXIA 4PJLA 2R5ZA 4DYCA 4QTRA 3J80K 4IZZA 4TV7A 4I6ZA 2EQRA 4WXHA 4A6DA 1U8RA 1LFPA 1T8IA 2Y0SN 3WTWC 2JPBA 2AXTC 3GYHX 4CCOA 5ICGA 1R5GA 4Z6YA 1S72I 3PUFA 4XN0A 4BH9A 4CUGA 2PFBA 3TP0A 3WODF 2AO9A 3P9CA 1N77A 2LY1A 3DBLB 1YIOA 1SVLA 2RVCA 3MFKA 2JA8J 4X0GA 3COAC 4I98B 5BQTA 3GCMA 1NK2P 5FKNA 5K1YA 4XNFA 5JHFA 4YFNF 5ICEA 2IGKA 1WVRA 3LQRA 1FSEA 2CUFA 3LA2A 1KU7A 4EGYA 2EFNA 4J19A 1HSJA 1X1CA 1YRNB 2L9NA 1XCVA 1D0YA 1FOYA 3W2WA 5BMZA 2E2HJ 1YOVB 5IOZA 3IKVA 2O9LA 3DP7A 1ULYA 2AQFA 1IW7F 4UUTA 1TP4A 4HV6A 2Y9YA 5J3LA 2PX9A 4HEA2 1TC3C 5FGMA 2VJ4A 3OS2A 1IUYA 1IO2A 1D3YA 3HHGA 2ME0A 2K9QA 3K4MA 3JRGA 2Z5UA 4FE4A 3ZQQA 5TISC 4O5VA 5LRSA 2JA6J 3FXMA 5FJ8J 5E3LA 3EPZA 2BW3A 3HM5A 3OSGA 4Y15A 2HZTA 2STTA 4AIDA 4YIFA 2PI0A 2ISZA 1IN4A 4F7ZA 3TO7A 2P7CB 2W7NA 3ZN0A 3SQNA 2JQ7A 1ONVA 3BR2A 2G0EA 2Q2EB 4E7JA 3CTAA 1IUFA 3RI4A 2LREA 2BY1A 3H3ZA 2PMZA 3QU3A 3G73A 5HS9A 3M4OJ 2D1HA 4KIGA 4G12A 2QQBA 2M45A 2HQ5A 5FFXA 1ZRFA 3CC2I 5IPAA 3OIQA 4UB8C 5EJCA 5DTDA 3OY9A 1YTYA 2KJCA 3DTIA 1T0FA 2P5KA 3PFYA 4MFEA 5E3NA 2JT1A 1RETA 2H1KA 3FHNA 3CCRI 5EEHA 2VKHA 3K4NA 4MEXF 2QBYA 5BOXA 3LSIA 1ZQ3P 3NRVA 3M8FA 1SAXA 4LG3A 1QHGA 4XIDA 2R7XA 2EA2A 3SHFA 1I50J 2KDZA 2ISYA 2WBMA 5D6EA 2QKLB 5EZGA 4AWXB 1F5TA 2H6BA 2L9SA 2GBYA 3JCUC 5HS7A 1K6YA 1YQAA 1IDZA 2R7VA 3G1MA 2VI6A 4L9VA 3IH3A 4D5CA 1B72B 5CLSA 2YSRA 3FXUA 3WG9A 4KYWA 3ZQ7A 4X1EA 2DTRA 2ZXJA 1TW2A 3BR3A 1E3OC 2ZFUA 5JVTA 4BU2A 2RN7A 3AFHA 1TT0A 3V8KA 3NQOA 4BHPA 1IV6A 2MC3A 2DQRA 1FOKA 2IS1A 2NS7A 3N97A 3PNTA 4CHUA 2A6EF 3WTZA 1JE8A 4JP0A 2OCCH 2ACJA 2R7ZJ 3HRUA 2HXOA 4BJ5C 2MLKA 3IAS2 3KEYA 4V2FA 5DM6F 4IQJA 1ZG1A 4L0ZB 2NYXA 1D0ZA 5E8GA 2JA2A 4XBFA 3OYLA 2DI3A 3TOAA 3ERED 3I56I 2YPRA 1BR1A 4IQ4A 3TW6A 2MFZA 3RZOJ 5KCMA 5DM7F 3SFIA 2FA5A 2PJPA 1FSHA 5HOOA 1T0FC 1WH7A 4BAYA 3I53A 3C1DA 3GMEA 1IJWC 3HOXJ 4A3BJ 5L3CA 5LBQA 3HOTA 3RQ4A 1MH4A 3BZ6A 1YYVA 4M3GA 4NNJA 4HDVA 2V1NA 2ZJ2A 1J5YA 3O3KA 1IXSB 1PJRA 2EILH 1OCOH 3OYHA 3ZMSA 5JVGF 3SZGA 3KYCB 3H36A 1VZ0A 2WTEA 3TP3A 4ANJA 4EM1A 4GYGA 2LMDA 3H5NA 4A3EJ 2HOSA 2HEOA 4II3A 1YO5C 1MSFC 5EZHA 5EF6A 3MZ8A 3HGGA 3CUQB 5K5QA 2XKPA 3B73A 1QA6A 2L4MA 1K4SA 1LFBA 1I6HJ 2IS6A 5LGNA 4AD9A 2ME6A 1RKWA 2BVMA 2LY2A 3EQLF 2X6OA 3HOVJ 3WTYC 3U1KA 5DEQA 1H88C 2B0LA 5IP6A 1LE8B 5JI6A 2YUSA 1FNNA 3HRSA 2KLOA 3PSIA 3ECHA 2FRHA 2HOTA 3CO7C 3E6DA 4RAGA 3BT9A 4D7MA 1XGMA 2BBYA 3BY6A 4FTHA 2K27A 2NVTJ 4GYIA 2YU3A 1Y0UA 1CF7A 4IRIA 5E1ZB 2VOPA 2IGMA 5JR3A 2OZUA 3OS0A 5K7ZA 1O3QA 1D1AA 3PIOF 3RYPA 2NVQJ 2VIXA 2XB0X 4I7HA 5E17F 2M34A 1P7IA 2I8DA 2M9HA 1QO0D 1MBEA 1K78A 1P4XA 2V1DA 4ON0A 2YU9J 4HAMA 3TGNA 1FT9A 2HQAA 2DA5A 4UV9A 1XDUA 3JTHA 1TWAJ 3LSHA 1OYWA 2IXSA 3MCZA 3W6KB 1ZR2A 3FMSA 4JX5A 2LF7A 3ASOH 4A93J 2HU9A 2CW8A 3L09A 4XQFA 2LKPA 1XMXA 2HYFA 2E5NA 2E1MB 2L01A 1TQIA 2DK8A 4L9NA 1BR4A 1ZARA 3GZ5A 1JKQC 3KZIC 4PZJA 5EG0B 2XVCA 1TQPA 2FMLA 1TLHB 3OS1A 5CVJA 1LVKA 2HGCA 1RZ4A 2TDXA 4YIRX 1F4KA 2MG4A 4ZC3A 2ESNA 2VJJA 2WAEA 3CMMA 3EUAA 3O6BB 5D5XB 1AU7A 1AOYA 3K4LA 2P0WA 1B8IB 1OQYA 5F6FA 3M7GA 4LOCA 1JGGA 4MQVA 2R7FA 4XRFA 2DN0A 2LSOA 3JR9A 3VDXA 2HOEA 2DYSH 3KFWX 2DOFA 3KZYA 2Y2ZA 4CSWA 3BTLA 2FJ1A 4IHWA 3DWLE 1D8JA 2EV6A 5AIPA 4QLCU 3LFUA 1NG7A 2X9DA 3ZMZA 1G6NA 3O8GA 3TDZC 1TQMA 4DOZA 2UXXA 4B3AA 1R9TJ 5FD5A 4DYQA 4BUPA 3R61A 3H3UA 2XAJA 2EFWA 2Z33A 1LEAA 4QWQA 3BJ6A 3LOCA 1P2FA 1FOXA 1V55H 2H09A 4A3MJ 3S1NJ 2O61A 1MDMB 1KGSA 2DFIA 3CF2A 2FUG2 4GRIA 2DO7A 3ZP5A 1S8NA 2E7WA 1MNEA 2F6CA 4PGHA 4KIBA 5JFRA 4WX9A 2ZXWH 3WE3A 3F8CA 1U0JA 1Y0NA 1VF9A 1K4TA 3PO3J 1R5ID 1SVMA 2LKSA 4PUSA 2A05A 1K7AA 4B47A 1X4OA 2X51A 1YITI 5A2QZ 5DD4A 3F22A 4A0XA 4ESJA 1ZH5A 3N4MA 3BG3A 4KMUX 4BQOA 2VBWA 1DPRA 2O3FA 5DCMB 3K70D 1VQNI 4A0ZA 1FLIA 3OR1C 2K4BA 1WJBA 5L3FA 1GVJA 2KQRA 3GZ6A 3ZMVA 2DTZA 4CDGA 3CCEI 3NWTA 1YJNI 3MD2A 4XRMA 3MWMA 4FE7A 4IL6C 4B44A 4M6VA 2P6TA 1XG1A 3DXJF 3Q0WA 3DKYA 1Z77A 3AG1H 4HV5A 4HX8A 1BI2A 2R7OA 4YG2F 3BR6A 4G7ZF 1SEUA 5F0FA 3VYUB 1IN8A 1G3WA 2ESHA 2DU9A 2M5WA 1GVDA 2KP6A 2EV0A 4HX7A 2JVHA 5J8FA 4EM2A 2KRHA 2XGEA 5TJJA 2EB7A 4DW6A 2QQ8A 3HEFA 3VPRA 1FBQA 1W36C 3ONQA 1PP7U 1LKXA 4A12A 3ZCOA 4Q5SF 2KMUA 2VODA 3G3ZA 2W57A 1JJ6C 3CDLA 3S14J 1DPUA 2FX0A 1IN7A 2FQ4A 3BTCA 2IA1A 2PQ8A 4MLOA 2OA4A 4C3HJ 3E5QA 2XGDA 2M7AA 4M3EA 1ZTRA 4EJVA 2DPUA 4HBLA 2Y30A 4PJ0C 4H0EA 2M3AA 2E2IJ 3EDPA 2XKOA 1XB4A 3ZQLA 1XSVA 2CJJA 2X1CA 1T2KA 3WHCA 3ZQFA 2ID6A 1H8AC 4BQAA 4LB5A 2VE8A 3LSGA 1UMQA 1WGXA 5E79C 3KYDB 2FEZA 3HTUA 2HYGD 2OF7A 4A3FJ 3RKWA 3GFJA 4FQGA 4XR6A 3L1PA 1E17A 2LVSA 3HSRA 1ITYA 3C7JA 2EFPA 1MBGA 3GFMA 1WJFA 1WQ2A 4IHSA 5FROA 4XKBA 2JZYA 3M9AA 4KA4A 2CQQA 1FWZA 1GV2A 3SDBA 4RB0A 1A31A 2ETHA 2MD0A 3F3XA 5IT9K 2KZVA 1R6RA 3KX2A 3IH2A 3VYSB 3JSPA 2V1XA 1UB9A 1FJLA 3LAJA 4DZJA 3W6VA 4AIHA 3GVAA 2J5PA 1LEBA 2BGCA 2V6EA 4YELA 4CZCA 3LSMA 5GAGJ 1DGRM 5HNFA 2L7ZA 2LG4A 2UUZA 2EFQA 4PFOA 2JRTA 3FF5A 4U7DA 3DV8A 1WPKA 4C30A 1ZK8A 4ZYHA 3KZZA 3I4NJ 1MMSA 1MNMC 3HDDA 3S17J 2GIZA 2ZNZA 1KYWA 3DLLF 5HLHA 3ABKH 4ESFA 4CXFA 5GAEJ 3BDDA 1NH3A 2Z1DA 2W25A 1BJAA 3BG5A 3OV8A 5JLWA 3LAPA 3ZQCA 3DFGA 2R5ZB 5F04A 2K3FA 1OR7C 2VQHA 3K2ZA 3F8BA 1V3FA 3CCQI 3JRIA 4CCJA 2F5VA 3R60A 2M0CA 3CMYA 5D6FA 3K9TA 4E4HA 4EVIA 3WTSC 2W00A 2DFEA 1JKRC 3FXOA 5L3DA 4KN7X 1I1SA 2DCEA 1TTYA 2H94A 1IN6A 5BNGA 3B6AA 4OIPF 1V54H 5J1UA 2VUMJ 5IYDJ 1IDYA 1NG6A 5JLXA 2EA4A 5D8LB 4N0BA 3ROUA 1H0MA 3CF5F 4J01A 2WV0A 2HKXA 1B6AA 3HTSB 3LFKA 4XSZF 4DQ2A 2IAIA 2N8GA 2Z2SB 4IOCF 3A0HC 1SVOA 1XGOA 2LP0A 2FBHA 1Y39A 2QEXI 2P8TA 4U87A 3DCFA 2XB5A 3OMYA 2PN6A 4LMYA 1V5GA 2VKDA 1UHMA 3K0LA 2WAQA 2VKEA 3U21A 4C9YA 3S2WA 1D8KA 3BTJA 4RBOA 1BW6A 2KT0A 1J7KA 2E19A 1T95A 3ECOA 2QWWA 2HNHA 2LF8A 2XUBA 2QQ9A 2DMNA 4D9JA 1EKEA 2M8GX 2RDPA 2R92J 5H6QA 2EFOA 1DGWY 1NTCA 3CZ6A 1FP2A 3KP4A 1O4XA 2BW3B 3DU6A 3V7CA 1AKHA 3DKXA 2K9LA 4M6XA 3R6SA 3K7AJ 3GTMJ 1ZELA 4FCYA 4KITB 3KPHA 1USSA 2FOKA 4G8XA 4ITVA 1X3WB 1XMKA 4L5IA 2KKOA 4XK4A 5ICFA 4ENMA 4I99C 2I5UA 3K4BA 1MD0A 3CJQB 2DOEA 3FDYA 3A03A 2DQLA 2OV7A 2E1NA 2J5OA 2F4OB 3QP6A 2XPWA 2VONA 3W3CA 2JK3A 2CUJA 3JAMZ 3SZTA 2RGVA 2JJ7A 4CCLA 5DS9A 3FK7A 1D5VA 5FFZA 4L9TA 5J4YA 4MO7A 3ZRGA 3JSOA 4I2OA 3B02A 2A07F 2QBYB 1G8XA 2NS8A 1EH6A 4R8HA 4Y7NJ 2NVXJ 2Y0MA 4RAYA 4BE0A 3MKWB 2QVOA 3E5XA 4BL0B 3OYFA 1XN7A 1FTTA 2VASA 5CQGA 2ZJRF 2M87A 3Q9VA 4YFXF 1W7PA 2BZTA 2CU7A 4ZYAA 5D5UB 1ZRDA 4HF2A 4NB5A 1KONA 2BOLA 2L9RA 2ZMEC 2H27A 1G2HA 3DKWA 3LL7A 1WJDA 1X1PA 4LG0A 3ZQIA 2OQGA 2XGCA 3CCVI 1VI0A 1CQTA 1GLNA 1VQ9I 2KPMA 2JWTA 1D5YA 1U3EM 1FIAA 3DEEA 2PJRA 2L7FP 2Z3YA 1AHDP 1G4DA 3BCAA 4CCKA 3FXRA 1EH8A 3W2VA 1O3RA 3DLAA 2LK2A 4E7SA 2JMWA 2CMPA 1TNTA 1WHUA 2DAOA 1Z05A 2DMUA 1VQ4I 1QZZA 2WB1N 2R4GA 2EV5A 2WC2A 2H6CA 4I0AA 4UVBA 3LSRA 3MAJA 1VQ7I 2DW4A 3QPSA 3B6CA 3X2QH 3S2HJ 2EK5A 3QRFF 3GTLJ 4UHTA 1JUSA 3DPLC 1VQOI 1L3LA 1OCTC 1RI7A 2ZBKA 2K3PA 3BR5A 3I4PA 4EEFG 1A36A 1QU3A 3JRBA 1RESA 3R0JA 5F27A 2BY3A 2OU2A 4L5JA 4M9SA 5E8IA 1LVAA 3E5UA 3GTOJ 3GFIA 1XGSA 3ZR8X 3E1SA 1H9GA 3KP3A 2VN2A 2CS3A 5J1RA 3U2RA 4ZYGA 2O8XA 1T33A 2Q0OA 5CJ9A 2GOXB 2VT3A 1J9IA 3HIFA 2ZO4A 4LLNA 3IV5A 2R7TA 3FM3A 5LGUA 3OYAA 2AQEA 2CV1A 4D7NA 2A6TA 3FISA 3F6OA 4CA0A 2QA4I 2R7QA 2R5YA 4NBQA 4ENNA 4G94A 4BQQA 4FX4A 2PBIA 2DK5A 3QYEA 3QPTA 3WGGA 4RA2A 1S9HA 2RV8A 1GUUA 2XAFA 4F93B 1I3AA 1XDSA 2E34A 2EZKA 2ZXIA 3PM1A 3AL0B 3BC8A 4NC7A 4L5EA 5E3MA 1U8BA 3PFIA 4C3IJ 4RAFA 1PDNC 4HX4A 2DMTA 5FLXK 4B43A 4EJTA 3K4CA 4ZYDA 1W7PD 1CF7B 1FYLA 3D5LA 1DU6A 2K4JA 1JTXA 2DT5A 1FOWA 2V6CA 3GFLA 4N9IA 2VQLA 1EF4A 2F5CA 3F6VA 5GTHC 5D4RA 3OR2C 3OYKA 1K78B 1REPC 1Y8RB 3S16J 3BPVA 4CICA 1XCBA 1PUEE 2XF7A 4XOPA 3EYIA 2DT6A 1IAWA 4BBRJ 5LD2C 1F9NA 1DP3A 5GAHJ 1OCPA 4XLAA 3G6EI 4HPQA 5ILSA 4ZJZA 2D1VA 3HUGA 3RKXA 3PO2J 2DMPA 5J8CA 2ZKZA 1HQCA 2COBA 3OL4A 3WTVC 3GTPJ 3PQJA 3V4GA 1Y8QB 1G3TA 2Z9OA 2A6HF 3C18A 4AYBA 4Y3OA 2QQAA 3GW2A 4BY1J 3WU2C 4HG2A 2CFXA 4XICA 3GTKJ 3CC7I 5FB2A 4KISA 1YJWI 1ZAOA 4OMZA 1VQLI 1TWFJ 1GXPA 2AS5F 5DD8A 1FZPB 1UZCA 3TOBA 1YS7A 4MFDA 5JHUA 4HSTA 2Z99A 2PEXA 5ERIA 1E2XA 2C6YA 4S04A 1HXDA 1R23A 4E7ZA 4AIJA 3SFZA 1B9NA 5L3EA 1IXCA 2CQNA 1VQ6I 3UNGC 1YFHA 4YRVA 2KFDA 2QM3A 4NDLA 2PMUA 4ENKA 3I59A 1MGTA 3S2DJ 5KHDA 3D0SA 3GTGJ 4G7HF 3A4CA 3KP5A 1X19A 4O6JA 1XX5A 3ABTA 1JGSA 3S32A 1SMYF 1V4RA 5FD6A 1O7FA 1OJLA 2X6WA 4RGUA 4RM2A 1DUXC 2IS2A 2CG4A 3JRFA 3HBLA 2JVGA 4CYCA 1ZHFA 4U0VA 2DODA 1MH3A 4WF2A 1IV8A 2OPTA 5E20A 1Y1WJ 2GXBA 1HOMA 1V5FA 2DJIA 4P96A 1MMDA 4MHGA 2R7UA 5FKLA 2ZC2A 4M3BA 2VC1A 1BI3A 2BY0A 2HDCA 4NQWA 4BE2A 1WRJA 1YW7A 4OINF 4P1WA 1IRFA 4CGZA 2L2OA 1WJAA 3TW7A 3GUDA 3O8HA 3TMOA 3ZGKA 2KIMA 4A3JJ 4S0HB 3J81Z 2EZIA 2VBYA 2BEOA 3IH4A 3GEZA 3V42A 3M8JA 3LWFA 5HLGA 3ELKA 3EYYA 3KP6A 3TDUC 3VWBA 2ADUA 3ZMUA 1HKTA 5CVUA 3TL4X 1ZLJA 4GXOA 2JPCA 5D5WB 2NNYA 3F9KA 1G3YA 4OIOF 1SANA 3KP7A 1XGNA 5B1AH 1KA8A 4B48A 1R36A 4OWRB 2LR8A 2PLYA 2L5QA 2HVRA 2NOJB 2CUEA 5LRRA 3LQQA 3NEUA 3CC4I 2WV1A 1I6XA 3MVPA 2CUZA 2DMQA 3Q0UA 3L2QA 2IGOA 3HG9A 3LSPA 3RIRA 4I01A 4QPOA 1EA3A 4EJOA 3PNVA 4F91B 1ZGWA 3TO9A 2EH3A 3OYMA 4A2UA 1UHWA 3Q5FA 2VPRA 3FXKA 5IP7J 1R1UA 4PJNA 1JTYA 3CCJI 1JXSA 5GADJ 1O7LA 1BN5A 1QPMA 4MTEA 4KDPA 2ZSHB 3OOPA 2W84A 1W4MA 3PUBA 3IKTA 4B4CA 4GDFA 2XAQA 1XMAA 2L9VA 1JKPC 5DUKA 1W0UA 1IRXA 1MMNA 1WKMA 1K61A 1FYMA 1E3PA 3BCBA 1R1VA 4D5FA 5BPDA 3CLQA 3AAFA 3ABMH 2VQGA 2MH9A 4YFKF 4RM3A 2CSOA 1OYYA
chains in the Genus database with same CATH topology
4ZZLA 1KQ8A 1WI9A 4G6DA 3Q9SA 4UNOA 3V7SA 1UCRA 3IWFA 2KRFA 3TO6A 1KU3A 2XV4S 4M9ZA 1Z6TA 2FF4A 5LLQA 2ZFWA 2E7XA 2VBXA 1S3JA 2HS5A 1ZGAA 1P4WA 3TKYA 4L18B 2VXZA 1Z7UA 4I02A 3C3WA 2R3SA 1HSTA 1USTA 1EV7A 1W5SA 2F2EA 3LA7A 3LA3A 1F1ZA 4I0BA 2VOOA 1SMTA 2O6GE 2CYYA 4Q4ZF 4DNCA 4S05A 3E3VA 4MGRA 3EETA 1BM9A 3HSEA 1J0RA 1ZYRF 2K7LA 3RKYA 1L0OC 3CUQC 1XD7A 5LHHA 3E97A 2P6SA 4M74A 3KEQA 4PGGA 3J80Z 1BC7C 2YX7A 2CO5A 5DYMA 3M1EA 1P4AA 1JHFA 1R00A 3ISPA 4M9XA 1OR7A 3V8JA 1O57A 2G9WA 2QLZA 2ZNYA 3ZPLA 3K69A 3T5XA 4BHCA 3QU6A 1LDDA 3F8MA 4B09A 1MZBA 3WTUC 3MQ0A 4UVCA 1T98A 1GHCA 2XROA 5DCFA 4P55A 2A69F 1S7OA 3QOPA 1BC8C 3WTXC 2BE5F 4FT8A 4HQEA 1LJ9A 5F64A 4RB1A 1DP7P 4Q48A 1MJBA 4M73A 4CO8A 2GXGA 4A5NA 5E18F 3WGHA 4KT5C 1YG2A 3BOQA 4WCGA 1LNWA 3DF8A 5CVRA 4EGZA 2OZ6A 3RDIA 2QYOA 2L4AA 1JHHA 3RPQA 1W7PB 4GCVA 1U5TA 3P9IA 2FNAA 2FMYA 2WWYA 2G7UA 2FXAA 2LNBA 2K02A 2K86A 4LG0B 2FQ3A 4BNCA 2COMA 3DPTA 4JBAA 6PAXA 4PDKA 1QQIA 1UFMA 2NNNA 5DUIA 2IRFG 2L3DA 4KMFA 3ABUA 4FX0A 3QPHA 1MJAA 2IA2A 1R7JA 4WXCA 2DLLA 3U1DA 4RB2C 1H9TA 2GAUA 2F5DA 1IF1A 2FE3A 2IPQX 4M71A 1QBJA 5HS8A 3KEOA 4IRGA 5ED4A 2ZMEA 2CW0F 3BWGA 2O03A 3RJPA 3L00A 1FPQA 1NHAA 2O0YA 3HSFA 2E1CA 1B4AA 4A5MA 5A2QK 4GO1A 1AWCA 1U5TC 4LD5A 4EMSA 1FBUA 1T6SA 3HHHA 3F8FA 5BS6A 1K6OA 4XSXF 4HDUA 1Z6RA 1TW3A 3HYIA 1ZREA 3KE2A 4N9HA 4G6QA 4XLPF 3CJNA 3F21A 1SFXA 3GXOA 3FM5A 5E1WA 5LEKA 3QP5A 1HKQA 4HZFA 1PP8F 3K1MA 2HR3A 2W24A 4RGXA 4U7BA 2CGPA 1J2XA 2DPDA 3QAHA 3ZMDA 1QZYA 2A5YB 3PQKA 4M72A 4BXUA 3SXYA 2HQRA 2Y75A 1GXQA 1STZA 2QUFA 3R4KA 4KIFA 1B1BA 1FP1D 2GIVA 3F23A 1ZLKA 2XIGA 4UUVA 3V8LA 2AXLA 5ILUA 1KU9A 4LGWA 5H6RA 4U0YA 1VTNC 1SD4A 3HRMA 3IHUA 1RUOA 2HQNA 1R58A 4IRHA 1WSUA 5LGTA 3L7WA 4HLYA 3BROA 3FMRA 3ZN1A 3I59B 4JQFA 1BI1A 3IC7A 1R5HA 2GA1A 2XAGA 1YLFA 2HKOA 5KK1A 3HOSA 3WU0A 2HTSA 3RYRA 2IT0A 1OPCA 3FMQA 1YW8A 2NRAC 2IVMA 2RC4A 3GF2A 4LLGF 4GGGA 3FXQA 2VE9A 1A04A 4OMYA 1RIOH 1YW9A 4HYEA 5HDKA 2OQRA 5ICCA 4KNYA 3DEUA 5HVQC 3FZVA 2KIFA 3KP2A 3I64A 4R79A 2UWMA 2STWA 5IT3A 2A61A 2HWVA 2Y48A 4LB6B 3IRRA 1IZ1A 4ENJA 1QNTA 2RQPA 3LSTA 5BPIA 3KCCA 2BYVE 3GO5A 1FC3A 3T8TA 3L9FA 3ZMTA 3M8EA 1MJ9A 1RNLA 3BJAA 4KFCA 3KLOA 4OIQF 2HTJA 3MZYA 1ZG3A 2MA3A 4KICA 3IRQA 2FSWA 1IRGA 3FHZA 1LQ1A 3BJOA 2VBZA 4BYYA 3I58A 3VFZA 2W85A 5AONA 5HLIA 2XRNA 4D0PA 1P6RA 3T0YA 1BBYA 3K1PA 1SD5A 1U2WA 3MEXA 1OYIA 2M1BA 4EM0B 4LFUA 4A0YA 1CGPA 2Q8KA 2P5LC 3VB2A 3E6BA 5LHGA 2F5FA 2P4WA 3JAMK 1RUNA 1BOAA 2RKHA 5DV5A 2PMHA 5D5VB 2D45A 2Q2EA 2KIUA 1R1TA 1OKRA 1I27A 1S29A 1HW5A 2PG4A 5LEJA 5LHIA 1T39A 4P5OA 3BPXA 3L2CA 2P5VA 3KLNA 2FNPA 5CVVA 3CDHA 2MLGA 3P7NA 3V7RA 1OMIA 1I5ZA 4OIRF 4L0YB 5IT9Z 2D2WA 2XGXA 1ZG5A 5HDGA 3K1NA 4E70A 4OU0A 4Q47A 4WXDA 3VOEA 1LDKB 4HF0A 4ASNA 2V1UA 4RGSA 1HW2A 3P9KA 4EJWA 2MBFA 1BIBA 4HOBA 4RB3C 5L3BA 4FHTA 2YX4A 3EUHA 4HLXA 2DBBA 4LLLA 4Y17A 2JTVA 3DQVC 3TQNA 4JK1X 2XAHA 1HBXG 5K5OA 2IJLA 4Z2YA 4EQQA 2GZWA 3ULQB 5K5RA 2L02A 4RAZA 4B8XA 3VEPA 1SD7A 2JSCA 2ELHA 3CUQA 4UXNA 5F1RA 5CYVA 4ZH4F 3WU1B 3J7AO 1C0WA 4PCQA 2LDUA 3ML6A 4RGRA 4R1HA 5J6XA 1EH7A 1MKMA 3MZHA 1J75A 1ZRCA 1BIAA 2GA2A 4ETSA 1LDJA 4MQ9F 3WTTC 1SFUA 4P9FA 3FWEA 2UZKA 4MNUA 4WWCA 2G7HA 3R0AA 1BI0A 2QENA 4K2EA 3RPUA 2XHKA 3F72A 1U5TB 1QGPA 2FBIA 1S6LA 3FX3A 3T8RA 1ON1A 2R7DA 3WE2A 3GX4X 5AIQA 2V79A 4IHTA 3I5UA 4MTDA 3GWZA 5HDNA 1HW1A 2F5EA 2VT2A 1FY7A 2GQQA 1Z1DA 3WGIA 4NHJA 1FBSA 2EJRA 2OD5A 1XSXA 3HRTA 1KU2A 5KVRA 4AVPA 1K79A 2YR2A 4Y13A 2ZMEB 1FX7A 1HKSA 1TNSA 2RNJA 4CYDA 4IF4A 3I0TA 1G3SA 1SFEA 5FO5A 1FYKA 4CZZA 3E6CC 4HQMA 2HFHA 4LK0F 5ILVA 3JW4A 5D4SA 3I54A 1LB2A 3CO6C 2XASA 1Z9CA 4UVAA 2NAZA 1B59A 1MDMA 4BHBA 2L54A 3J81K 3T1BA 2X4HA 1W5TA 4OOIA 3E6MA 4YIIA 1TBXA 1ON2A 1WWXA 3CUOA 3KETA 5DCMA 4EJUA 4P9UA 5EEGA 4KUMA 4LJZF 3IL2A 2IW5A 2FU4A 1IN5A 2BV6A 2VC0A 1KQ0A 3SZPA 1KYZA 1U6GA 1XSDA 4IJAA 5CVIA 3F8NA 2ZCWA 3VODA 2KJBA 5FLXZ 3GLXA 4U0WA 4L9JA 5D8KB 2CWEA 4ZYEA 1SD6A 1O3TA 3CLOA 2UXNA 4KN4X 2MD5A 4I09A 2P7VB 3JTGA 3O2PE 4IXAA 1IXRC 1U78A 1R22A 1DDNA 5L3GA 1Q1HA 1P92A 1B9MA 1KQ9A 2OBPA 4UV8A 4IPAA 5DDGA 3U9GA 4MEYF 3BP8A 3I71A 3H92A 5E1XA 4ZZDA 2M30A 4HF1A 2QZ8A 2IP2A 1ZN2A 2EWNA 2NS0A 1T38A 4A6EA 2FBKA 4IVNA 3REOA 2CQKA 4M6YA 4O3MA 3W6JB 4EV0A 2IA0A 2OAZA 3RTRA 4U88A 1Z91A 3IWZA 1ZGJA 4HW0A 4G7OF 5TRDA 2GWRA 1O3SA 4AIKA 4WK8F 4HA8A 5H20A 4G9YA 1X3UA 4ESBA 2A68F 2A3SA 2MH2A 1J59A 4RS8A 1YS6A 4LK1F 1ODDA 1S7AA 2X0LA 2M8EA 1I1GA 4XLNF 2V9VA 3J80K 4TV7A 4WXHA 4A6DA 1U8RA 3WTWC 2JPBA 3GYHX 5ICGA 1R5GA 4BH9A 2PFBA 3WODF 3P9CA 1YIOA 3MFKA 2RVCA 3COAC 4I98B 5BQTA 5K1YA 4YFNF 5ICEA 3LQRA 1FSEA 3LA2A 1KU7A 4EGYA 2EFNA 1HSJA 1XCVA 5BMZA 3IKVA 3DP7A 1ULYA 1IW7F 4HV6A 5FGMA 1IUYA 1D3YA 3HHGA 2Z5UA 4O5VA 5LRSA 4Y15A 2HZTA 2STTA 4YIFA 2PI0A 2ISZA 1IN4A 4F7ZA 3TO7A 2P7CB 3ZN0A 3SQNA 1ONVA 3CTAA 3RI4A 3H3ZA 3QU3A 3G73A 5HS9A 2D1HA 4KIGA 2QQBA 2M45A 5FFXA 1ZRFA 1YTYA 2KJCA 1T0FA 2P5KA 2JT1A 5EEHA 4MEXF 2QBYA 5BOXA 3NRVA 3M8FA 1SAXA 2EA2A 3SHFA 2ISYA 5D6EA 4AWXB 1F5TA 2H6BA 5HS7A 1YQAA 4L9VA 5CLSA 2YSRA 3FXUA 3WG9A 4KYWA 3ZQ7A 2DTRA 2ZXJA 1TW2A 5JVTA 2RN7A 3V8KA 3NQOA 4BHPA 2MC3A 2DQRA 1FOKA 3N97A 4CHUA 2A6EF 3WTZA 1JE8A 2ACJA 3HRUA 2MLKA 1ZG1A 4L0ZB 2NYXA 5E8GA 3ERED 4XBFA 2DI3A 3TOAA 2YPRA 2FA5A 2PJPA 1FSHA 5HOOA 4BAYA 3I53A 3C1DA 5L3CA 5LBQA 3HOTA 3BZ6A 1YYVA 4HDVA 2ZJ2A 1J5YA 3O3KA 1IXSB 3ZMSA 2WTEA 4EM1A 4GYGA 2HEOA 1YO5C 3CUQB 5K5QA 2XKPA 3B73A 2L4MA 5LGNA 4AD9A 3EQLF 3WTYC 5DEQA 2B0LA 5JI6A 1FNNA 3HRSA 3ECHA 2FRHA 3CO7C 3E6DA 1XGMA 2BBYA 3BY6A 2K27A 4GYIA 2YU3A 1Y0UA 1CF7A 4IRIA 5E1ZB 2VOPA 5JR3A 2OZUA 1O3QA 3RYPA 5E17F 4I7HA 1QO0D 1K78A 1P4XA 2V1DA 4ON0A 4HAMA 3TGNA 1FT9A 4UV9A 1XDUA 3JTHA 1OYWA 3MCZA 3W6KB 3FMSA 2LF7A 3L09A 2LKPA 2HYFA 2L01A 1TQIA 2DK8A 4L9NA 1ZARA 3GZ5A 4PZJA 2XVCA 1TQPA 2FMLA 1TLHB 5CVJA 1F4KA 2HGCA 1RZ4A 2TDXA 2ESNA 3O6BB 5D5XB 1AOYA 5F6FA 3M7GA 4MQVA 2R7FA 4XRFA 2LSOA 2HOEA 3KFWX 3KZYA 1D8JA 2EV6A 5AIPA 4QLCU 3ZMZA 1G6NA 3TDZC 1TQMA 2UXXA 5FD5A 3R61A 3H3UA 2XAJA 2EFWA 2Z33A 1LEAA 4QWQA 3BJ6A 1P2FA 2H09A 2O61A 1MDMB 1KGSA 2DFIA 2DO7A 3ZP5A 1S8NA 2E7WA 4PGHA 4KIBA 5JFRA 4WX9A 3WE3A 3F8CA 1K7AA 5A2QZ 5DD4A 3F22A 4A0XA 4ESJA 1ZH5A 3N4MA 4KMUX 2VBWA 1DPRA 2O3FA 5DCMB 1FLIA 4A0ZA 2K4BA 5L3FA 1GVJA 3GZ6A 3ZMVA 4CDGA 3MWMA 2P6TA 3DXJF 4HV5A 4G7ZF 4HX8A 1BI2A 4YG2F 1IN8A 1G3WA 2ESHA 2DU9A 2M5WA 2EV0A 4HX7A 5J8FA 4EM2A 5TJJA 2EB7A 1FBQA 1PP7U 4A12A 4Q5SF 2VODA 3G3ZA 2W57A 1DPUA 1IN7A 2IA1A 2PQ8A 2OA4A 3E5QA 4EJVA 2DPUA 4HBLA 4H0EA 3EDPA 2XKOA 1XB4A 1XSVA 1T2KA 4BQAA 4LB5A 2VE8A 2FEZA 3HTUA 2HYGD 3RKWA 3GFJA 1E17A 3HSRA 3C7JA 2EFPA 3GFMA 1WQ2A 4IHSA 2JZYA 3M9AA 4KA4A 1FWZA 4RB0A 2ETHA 3F3XA 5IT9K 3JSPA 2V1XA 1UB9A 3LAJA 4AIHA 3GVAA 2J5PA 1LEBA 2BGCA 2EFQA 2JRTA 3FF5A 4U7DA 3DV8A 4ZYHA 3KZZA 2ZNZA 1KYWA 5HLHA 4ESFA 4CXFA 3BDDA 2W25A 1BJAA 3LAPA 3OV8A 3DFGA 3K2ZA 3F8BA 1V3FA 3R60A 5D6FA 3K9TA 4EVIA 3WTSC 5L3DA 4KN7X 1I1SA 1TTYA 2H94A 1IN6A 4OIPF 2EA4A 5D8LB 4N0BA 3ROUA 1H0MA 2WV0A 2HKXA 1B6AA 3HTSB 3LFKA 4XSZF 4DQ2A 1XGOA 2FBHA 2P8TA 4LMYA 2PN6A 1UHMA 3K0LA 3S2WA 1D8KA 1J7KA 3ECOA 2QWWA 2LF8A 2XUBA 2QQ9A 2RDPA 5H6QA 2EFOA 1FP2A 3KP4A 3V7CA 3R6SA 4M6XA 1USSA 2FOKA 4G8XA 1XMKA 4L5IA 2KKOA 5ICFA 4ENMA 1MD0A 2DQLA 2E1NA 2J5OA 3QP6A 2VONA 3JAMZ 3SZTA 2RGVA 1D5VA 5FFZA 4L9TA 3JSOA 4I2OA 3B02A 2A07F 2QBYB 1EH6A 4R8HA 2Y0MA 4RAYA 2QVOA 3E5XA 1XN7A 2M87A 3Q9VA 4YFXF 1W7PA 5D5UB 1ZRDA 4HF2A 4NB5A 2H27A 3DKWA 4LG0A 2OQGA 1U3EM 2Z3YA 1G4DA 3FXRA 1EH8A 1O3RA 1TNTA 2DAOA 1Z05A 1QZZA 4I0AA 2EV5A 2WC2A 2H6CA 4UVBA 3MAJA 2DW4A 2EK5A 3QRFF 4UHTA 3DPLC 1L3LA 1RI7A 2ZBKA 3I4PA 3R0JA 2OU2A 4L5JA 4M9SA 5E8IA 1LVAA 3E5UA 3GFIA 1XGSA 1H9GA 3KP3A 2VN2A 3U2RA 4ZYGA 2O8XA 2Q0OA 5CJ9A 2VT3A 1J9IA 3HIFA 2ZO4A 4LLNA 3FM3A 5LGUA 3F6OA 4ENNA 4G94A 4FX4A 2PBIA 2DK5A 3QPTA 3WGGA 2RV8A 2XAFA 1XDSA 3PFIA 1PDNC 4HX4A 5FLXK 4EJTA 4ZYDA 1W7PD 1CF7B 1FYLA 3D5LA 2K4JA 2DT5A 2V6CA 3GFLA 4N9IA 2F5CA 3F6VA 5D4RA 1K78B 1REPC 3BPVA 4CICA 1XCBA 1PUEE 3EYIA 1IAWA 1F9NA 5ILSA 2D1VA 3HUGA 3RKXA 5J8CA 2ZKZA 1HQCA 3WTVC 3PQJA 3V4GA 1G3TA 2Z9OA 2A6HF 3C18A 2QQAA 3GW2A 2CFXA 5FB2A 1ZAOA 4OMZA 1GXPA 2AS5F 5DD8A 1FZPB 3TOBA 1YS7A 5JHUA 2Z99A 2PEXA 5ERIA 1E2XA 2C6YA 4S04A 1HXDA 1R23A 4AIJA 3SFZA 1B9NA 5L3EA 1IXCA 1YFHA 2QM3A 2PMUA 4ENKA 3I59A 1MGTA 3D0SA 4G7HF 3KP5A 4O6JA 3ABTA 1JGSA 1SMYF 1V4RA 5FD6A 1O7FA 1DUXC 4RGUA 2CG4A 1ZHFA 4U0VA 4WF2A 5E20A 2GXBA 4P96A 4MHGA 2VC1A 1BI3A 2HDCA 4NQWA 1WRJA 1YW7A 4OINF 1IRFA 4CGZA 3GUDA 2KIMA 3J81Z 2VBYA 2BEOA 3GEZA 3LWFA 5HLGA 3ELKA 3EYYA 3KP6A 3TDUC 2ADUA 3ZMUA 1HKTA 5CVUA 1ZLJA 4GXOA 2JPCA 5D5WB 2NNYA 1G3YA 4OIOF 3KP7A 1XGNA 1KA8A 1R36A 2PLYA 5LRRA 3LQQA 3NEUA 1I6XA 3RIRA 4I01A 4EJOA 3TO9A 4A2UA 1UHWA 3Q5FA 1R1UA 1JXSA 1O7LA 1BN5A 1QPMA 4MTEA 4KDPA 3OOPA 2W84A 1W4MA 3IKTA 2XAQA 1XMAA 5DUKA 1WKMA 1FYMA 1R1VA 5BPDA 3AAFA 2MH9A 4YFKF 2CSOA 1OYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZZL A;  1KQ8 A;  1WI9 A;  4G6D A;  3Q9S A;  4UNO A;  3V7S A;  1UCR A;  3IWF A;  2KRF A;  3TO6 A;  1KU3 A;  2XV4 S;  4M9Z A;  1Z6T A;  2FF4 A;  5LLQ A;  2ZFW A;  2E7X A;  2VBX A;  1S3J A;  2HS5 A;  1ZGA A;  1P4W A;  3TKY A;  4L18 B;  2VXZ A;  1Z7U A;  4I02 A;  3C3W A;  2R3S A;  1HST A;  1UST A;  1EV7 A;  1W5S A;  2F2E A;  3LA7 A;  3LA3 A;  1F1Z A;  4I0B A;  2VOO A;  1SMT A;  2O6G E;  2CYY A;  4Q4Z F;  4DNC A;  4S05 A;  3E3V A;  4MGR A;  3EET A;  1BM9 A;  3HSE A;  1J0R A;  1ZYR F;  2K7L A;  3RKY A;  1L0O C;  3CUQ C;  1XD7 A;  5LHH A;  3E97 A;  2P6S A;  4M74 A;  3KEQ A;  4PGG A;  3J80 Z;  1BC7 C;  2YX7 A;  2CO5 A;  5DYM A;  3M1E A;  1P4A A;  1JHF A;  1R00 A;  3ISP A;  4M9X A;  1OR7 A;  3V8J A;  1O57 A;  2G9W A;  2QLZ A;  2ZNY A;  3ZPL A;  3K69 A;  3T5X A;  4BHC A;  3QU6 A;  1LDD A;  3F8M A;  4B09 A;  1MZB A;  3WTU C;  3MQ0 A;  4UVC A;  1T98 A;  1GHC A;  2XRO A;  5DCF A;  4P55 A;  2A69 F;  1S7O A;  3QOP A;  1BC8 C;  3WTX C;  2BE5 F;  4FT8 A;  4HQE A;  1LJ9 A;  5F64 A;  4RB1 A;  1DP7 P;  4Q48 A;  1MJB A;  4M73 A;  4CO8 A;  2GXG A;  4A5N A;  5E18 F;  3WGH A;  4KT5 C;  1YG2 A;  3BOQ A;  4WCG A;  1LNW A;  3DF8 A;  5CVR A;  4EGZ A;  2OZ6 A;  3RDI A;  2QYO A;  2L4A A;  1JHH A;  3RPQ A;  1W7P B;  4GCV A;  1U5T A;  3P9I A;  2FNA A;  2FMY A;  2WWY A;  2G7U A;  2FXA A;  2LNB A;  2K02 A;  2K86 A;  4LG0 B;  2FQ3 A;  4BNC A;  2COM A;  3DPT A;  4JBA A;  6PAX A;  4PDK A;  1QQI A;  1UFM A;  2NNN A;  5DUI A;  2IRF G;  2L3D A;  4KMF A;  3ABU A;  4FX0 A;  3QPH A;  1MJA A;  2IA2 A;  1R7J A;  4WXC A;  2DLL A;  3U1D A;  4RB2 C;  1H9T A;  2GAU A;  2F5D A;  1IF1 A;  2FE3 A;  2IPQ X;  4M71 A;  1QBJ A;  5HS8 A;  3KEO A;  4IRG A;  5ED4 A;  2ZME A;  2CW0 F;  3BWG A;  2O03 A;  3RJP A;  3L00 A;  1FPQ A;  1NHA A;  2O0Y A;  3HSF A;  2E1C A;  1B4A A;  4A5M A;  5A2Q K;  4GO1 A;  1AWC A;  1U5T C;  4LD5 A;  4EMS A;  1FBU A;  1T6S A;  3HHH A;  3F8F A;  5BS6 A;  1K6O A;  4XSX F;  4HDU A;  1Z6R A;  1TW3 A;  3HYI A;  1ZRE A;  3KE2 A;  4N9H A;  4G6Q A;  4XLP F;  3CJN A;  3F21 A;  1SFX A;  3GXO A;  3FM5 A;  5E1W A;  5LEK A;  3QP5 A;  1HKQ A;  4HZF A;  1PP8 F;  3K1M A;  2HR3 A;  2W24 A;  4RGX A;  4U7B A;  2CGP A;  1J2X A;  2DPD A;  3QAH A;  3ZMD A;  1QZY A;  2A5Y B;  3PQK A;  4M72 A;  4BXU A;  3SXY A;  2HQR A;  2Y75 A;  1GXQ A;  1STZ A;  2QUF A;  3R4K A;  4KIF A;  1B1B A;  1FP1 D;  2GIV A;  3F23 A;  1ZLK A;  2XIG A;  4UUV A;  3V8L A;  2AXL A;  5ILU A;  1KU9 A;  4LGW A;  5H6R A;  4U0Y A;  1VTN C;  1SD4 A;  3HRM A;  3IHU A;  1RUO A;  2HQN A;  1R58 A;  4IRH A;  1WSU A;  5LGT A;  3L7W A;  4HLY A;  3BRO A;  3FMR A;  3ZN1 A;  3I59 B;  4JQF A;  1BI1 A;  3IC7 A;  1R5H A;  2GA1 A;  2XAG A;  1YLF A;  2HKO A;  5KK1 A;  3HOS A;  3WU0 A;  2HTS A;  3RYR A;  2IT0 A;  1OPC A;  3FMQ A;  1YW8 A;  2NRA C;  2IVM A;  2RC4 A;  3GF2 A;  4LLG F;  4GGG A;  3FXQ A;  2VE9 A;  1A04 A;  4OMY A;  1RIO H;  1YW9 A;  4HYE A;  5HDK A;  2OQR A;  5ICC A;  4KNY A;  3DEU A;  5HVQ C;  3FZV A;  2KIF A;  3KP2 A;  3I64 A;  4R79 A;  2UWM A;  2STW A;  5IT3 A;  2A61 A;  2HWV A;  2Y48 A;  4LB6 B;  3IRR A;  1IZ1 A;  4ENJ A;  1QNT A;  2RQP A;  3LST A;  5BPI A;  3KCC A;  2BYV E;  3GO5 A;  1FC3 A;  3T8T A;  3L9F A;  3ZMT A;  3M8E A;  1MJ9 A;  1RNL A;  3BJA A;  4KFC A;  3KLO A;  4OIQ F;  2HTJ A;  3MZY A;  1ZG3 A;  2MA3 A;  4KIC A;  3IRQ A;  2FSW A;  1IRG A;  3FHZ A;  1LQ1 A;  3BJO A;  2VBZ A;  4BYY A;  3I58 A;  3VFZ A;  2W85 A;  5AON A;  5HLI A;  2XRN A;  4D0P A;  1P6R A;  3T0Y A;  1BBY A;  3K1P A;  1SD5 A;  1U2W A;  3MEX A;  1OYI A;  2M1B A;  4EM0 B;  4LFU A;  4A0Y A;  1CGP A;  2Q8K A;  2P5L C;  3VB2 A;  3E6B A;  5LHG A;  2F5F A;  2P4W A;  3JAM K;  1RUN A;  1BOA A;  2RKH A;  5DV5 A;  2PMH A;  5D5V B;  2D45 A;  2Q2E A;  2KIU A;  1R1T A;  1OKR A;  1I27 A;  1S29 A;  1HW5 A;  2PG4 A;  5LEJ A;  5LHI A;  1T39 A;  4P5O A;  3BPX A;  3L2C A;  2P5V A;  3KLN A;  2FNP A;  5CVV A;  3CDH A;  2MLG A;  3P7N A;  3V7R A;  1OMI A;  1I5Z A;  4OIR F;  4L0Y B;  5IT9 Z;  2D2W A;  2XGX A;  1ZG5 A;  5HDG A;  3K1N A;  4E70 A;  4OU0 A;  4Q47 A;  4WXD A;  3VOE A;  1LDK B;  4HF0 A;  4ASN A;  2V1U A;  4RGS A;  1HW2 A;  3P9K A;  4EJW A;  2MBF A;  1BIB A;  4HOB A;  4RB3 C;  5L3B A;  4FHT A;  2YX4 A;  3EUH A;  4HLX A;  2DBB A;  4LLL A;  4Y17 A;  2JTV A;  3DQV C;  3TQN A;  4JK1 X;  2XAH A;  1HBX G;  5K5O A;  2IJL A;  4Z2Y A;  4EQQ A;  2GZW A;  3ULQ B;  5K5R A;  2L02 A;  4RAZ A;  4B8X A;  3VEP A;  1SD7 A;  2JSC A;  2ELH A;  3CUQ A;  4UXN A;  5F1R A;  5CYV A;  4ZH4 F;  3WU1 B;  3J7A O;  1C0W A;  4PCQ A;  2LDU A;  3ML6 A;  4RGR A;  4R1H A;  5J6X A;  1EH7 A;  1MKM A;  3MZH A;  1J75 A;  1ZRC A;  1BIA A;  2GA2 A;  4ETS A;  1LDJ A;  4MQ9 F;  3WTT C;  1SFU A;  4P9F A;  3FWE A;  2UZK A;  4MNU A;  4WWC A;  2G7H A;  3R0A A;  1BI0 A;  2QEN A;  4K2E A;  3RPU A;  2XHK A;  3F72 A;  1U5T B;  1QGP A;  2FBI A;  1S6L A;  3FX3 A;  3T8R A;  1ON1 A;  2R7D A;  3WE2 A;  3GX4 X;  5AIQ A;  2V79 A;  4IHT A;  3I5U A;  4MTD A;  3GWZ A;  5HDN A;  1HW1 A;  2F5E A;  2VT2 A;  1FY7 A;  2GQQ A;  1Z1D A;  3WGI A;  4NHJ A;  1FBS A;  2EJR A;  2OD5 A;  1XSX A;  3HRT A;  1KU2 A;  5KVR A;  4AVP A;  1K79 A;  2YR2 A;  4Y13 A;  2ZME B;  1FX7 A;  1HKS A;  1TNS A;  2RNJ A;  4CYD A;  4IF4 A;  3I0T A;  1G3S A;  1SFE A;  5FO5 A;  1FYK A;  4CZZ A;  3E6C C;  4HQM A;  2HFH A;  4LK0 F;  5ILV A;  3JW4 A;  5D4S A;  3I54 A;  1LB2 A;  3CO6 C;  2XAS A;  1Z9C A;  4UVA A;  2NAZ A;  1B59 A;  1MDM A;  4BHB A;  2L54 A;  3J81 K;  3T1B A;  2X4H A;  1W5T A;  4OOI A;  3E6M A;  4YII A;  1TBX A;  1ON2 A;  1WWX A;  3CUO A;  3KET A;  5DCM A;  4EJU A;  4P9U A;  5EEG A;  4KUM A;  4LJZ F;  3IL2 A;  2IW5 A;  2FU4 A;  1IN5 A;  2BV6 A;  2VC0 A;  1KQ0 A;  3SZP A;  1KYZ A;  1U6G A;  1XSD A;  4IJA A;  5CVI A;  3F8N A;  2ZCW A;  3VOD A;  2KJB A;  5FLX Z;  3GLX A;  4U0W A;  4L9J A;  5D8K B;  2CWE A;  4ZYE A;  1SD6 A;  1O3T A;  3CLO A;  2UXN A;  4KN4 X;  2MD5 A;  4I09 A;  2P7V B;  3JTG A;  3O2P E;  4IXA A;  1IXR C;  1U78 A;  1R22 A;  1DDN A;  5L3G A;  1Q1H A;  1P92 A;  1B9M A;  1KQ9 A;  2OBP A;  4UV8 A;  4IPA A;  5DDG A;  3U9G A;  4MEY F;  3BP8 A;  3I71 A;  3H92 A;  5E1X A;  4ZZD A;  2M30 A;  4HF1 A;  2QZ8 A;  2IP2 A;  1ZN2 A;  2EWN A;  2NS0 A;  1T38 A;  4A6E A;  2FBK A;  4IVN A;  3REO A;  2CQK A;  4M6Y A;  4O3M A;  3W6J B;  4EV0 A;  2IA0 A;  2OAZ A;  3RTR A;  4U88 A;  1Z91 A;  3IWZ A;  1ZGJ A;  4HW0 A;  4G7O F;  5TRD A;  2GWR A;  1O3S A;  4AIK A;  4WK8 F;  4HA8 A;  5H20 A;  4G9Y A;  1X3U A;  4ESB A;  2A68 F;  2A3S A;  2MH2 A;  1J59 A;  4RS8 A;  1YS6 A;  4LK1 F;  1ODD A;  1S7A A;  2X0L A;  2M8E A;  1I1G A;  4XLN F;  2V9V A;  3J80 K;  4TV7 A;  4WXH A;  4A6D A;  1U8R A;  3WTW C;  2JPB A;  3GYH X;  5ICG A;  1R5G A;  4BH9 A;  2PFB A;  3WOD F;  3P9C A;  1YIO A;  3MFK A;  2RVC A;  3COA C;  4I98 B;  5BQT A;  5K1Y A;  4YFN F;  5ICE A;  3LQR A;  1FSE A;  3LA2 A;  1KU7 A;  4EGY A;  2EFN A;  1HSJ A;  1XCV A;  5BMZ A;  3IKV A;  3DP7 A;  1ULY A;  1IW7 F;  4HV6 A;  5FGM A;  1IUY A;  1D3Y A;  3HHG A;  2Z5U A;  4O5V A;  5LRS A;  4Y15 A;  2HZT A;  2STT A;  4YIF A;  2PI0 A;  2ISZ A;  1IN4 A;  4F7Z A;  3TO7 A;  2P7C B;  3ZN0 A;  3SQN A;  1ONV A;  3CTA A;  3RI4 A;  3H3Z A;  3QU3 A;  3G73 A;  5HS9 A;  2D1H A;  4KIG A;  2QQB A;  2M45 A;  5FFX A;  1ZRF A;  1YTY A;  2KJC A;  1T0F A;  2P5K A;  2JT1 A;  5EEH A;  4MEX F;  2QBY A;  5BOX A;  3NRV A;  3M8F A;  1SAX A;  2EA2 A;  3SHF A;  2ISY A;  5D6E A;  4AWX B;  1F5T A;  2H6B A;  5HS7 A;  1YQA A;  4L9V A;  5CLS A;  2YSR A;  3FXU A;  3WG9 A;  4KYW A;  3ZQ7 A;  2DTR A;  2ZXJ A;  1TW2 A;  5JVT A;  2RN7 A;  3V8K A;  3NQO A;  4BHP A;  2MC3 A;  2DQR A;  1FOK A;  3N97 A;  4CHU A;  2A6E F;  3WTZ A;  1JE8 A;  2ACJ A;  3HRU A;  2MLK A;  1ZG1 A;  4L0Z B;  2NYX A;  5E8G A;  3ERE D;  4XBF A;  2DI3 A;  3TOA A;  2YPR A;  2FA5 A;  2PJP A;  1FSH A;  5HOO A;  4BAY A;  3I53 A;  3C1D A;  5L3C A;  5LBQ A;  3HOT A;  3BZ6 A;  1YYV A;  4HDV A;  2ZJ2 A;  1J5Y A;  3O3K A;  1IXS B;  3ZMS A;  2WTE A;  4EM1 A;  4GYG A;  2HEO A;  1YO5 C;  3CUQ B;  5K5Q A;  2XKP A;  3B73 A;  2L4M A;  5LGN A;  4AD9 A;  3EQL F;  3WTY C;  5DEQ A;  2B0L A;  5JI6 A;  1FNN A;  3HRS A;  3ECH A;  2FRH A;  3CO7 C;  3E6D A;  1XGM A;  2BBY A;  3BY6 A;  2K27 A;  4GYI A;  2YU3 A;  1Y0U A;  1CF7 A;  4IRI A;  5E1Z B;  2VOP A;  5JR3 A;  2OZU A;  1O3Q A;  3RYP A;  5E17 F;  4I7H A;  1QO0 D;  1K78 A;  1P4X A;  2V1D A;  4ON0 A;  4HAM A;  3TGN A;  1FT9 A;  4UV9 A;  1XDU A;  3JTH A;  1OYW A;  3MCZ A;  3W6K B;  3FMS A;  2LF7 A;  3L09 A;  2LKP A;  2HYF A;  2L01 A;  1TQI A;  2DK8 A;  4L9N A;  1ZAR A;  3GZ5 A;  4PZJ A;  2XVC A;  1TQP A;  2FML A;  1TLH B;  5CVJ A;  1F4K A;  2HGC A;  1RZ4 A;  2TDX A;  2ESN A;  3O6B B;  5D5X B;  1AOY A;  5F6F A;  3M7G A;  4MQV A;  2R7F A;  4XRF A;  2LSO A;  2HOE A;  3KFW X;  3KZY A;  1D8J A;  2EV6 A;  5AIP A;  4QLC U;  3ZMZ A;  1G6N A;  3TDZ C;  1TQM A;  2UXX A;  5FD5 A;  3R61 A;  3H3U A;  2XAJ A;  2EFW A;  2Z33 A;  1LEA A;  4QWQ A;  3BJ6 A;  1P2F A;  2H09 A;  2O61 A;  1MDM B;  1KGS A;  2DFI A;  2DO7 A;  3ZP5 A;  1S8N A;  2E7W A;  4PGH A;  4KIB A;  5JFR A;  4WX9 A;  3WE3 A;  3F8C A;  1K7A A;  5A2Q Z;  5DD4 A;  3F22 A;  4A0X A;  4ESJ A;  1ZH5 A;  3N4M A;  4KMU X;  2VBW A;  1DPR A;  2O3F A;  5DCM B;  1FLI A;  4A0Z A;  2K4B A;  5L3F A;  1GVJ A;  3GZ6 A;  3ZMV A;  4CDG A;  3MWM A;  2P6T A;  3DXJ F;  4HV5 A;  4G7Z F;  4HX8 A;  1BI2 A;  4YG2 F;  1IN8 A;  1G3W A;  2ESH A;  2DU9 A;  2M5W A;  2EV0 A;  4HX7 A;  5J8F A;  4EM2 A;  5TJJ A;  2EB7 A;  1FBQ A;  1PP7 U;  4A12 A;  4Q5S F;  2VOD A;  3G3Z A;  2W57 A;  1DPU A;  1IN7 A;  2IA1 A;  2PQ8 A;  2OA4 A;  3E5Q A;  4EJV A;  2DPU A;  4HBL A;  4H0E A;  3EDP A;  2XKO A;  1XB4 A;  1XSV A;  1T2K A;  4BQA A;  4LB5 A;  2VE8 A;  2FEZ A;  3HTU A;  2HYG D;  3RKW A;  3GFJ A;  1E17 A;  3HSR A;  3C7J A;  2EFP A;  3GFM A;  1WQ2 A;  4IHS A;  2JZY A;  3M9A A;  4KA4 A;  1FWZ A;  4RB0 A;  2ETH A;  3F3X A;  5IT9 K;  3JSP A;  2V1X A;  1UB9 A;  3LAJ A;  4AIH A;  3GVA A;  2J5P A;  1LEB A;  2BGC A;  2EFQ A;  2JRT A;  3FF5 A;  4U7D A;  3DV8 A;  4ZYH A;  3KZZ A;  2ZNZ A;  1KYW A;  5HLH A;  4ESF A;  4CXF A;  3BDD A;  2W25 A;  1BJA A;  3LAP A;  3OV8 A;  3DFG A;  3K2Z A;  3F8B A;  1V3F A;  3R60 A;  5D6F A;  3K9T A;  4EVI A;  3WTS C;  5L3D A;  4KN7 X;  1I1S A;  1TTY A;  2H94 A;  1IN6 A;  4OIP F;  2EA4 A;  5D8L B;  4N0B A;  3ROU A;  1H0M A;  2WV0 A;  2HKX A;  1B6A A;  3HTS B;  3LFK A;  4XSZ F;  4DQ2 A;  1XGO A;  2FBH A;  2P8T A;  4LMY A;  2PN6 A;  1UHM A;  3K0L A;  3S2W A;  1D8K A;  1J7K A;  3ECO A;  2QWW A;  2LF8 A;  2XUB A;  2QQ9 A;  2RDP A;  5H6Q A;  2EFO A;  1FP2 A;  3KP4 A;  3V7C A;  3R6S A;  4M6X A;  1USS A;  2FOK A;  4G8X A;  1XMK A;  4L5I A;  2KKO A;  5ICF A;  4ENM A;  1MD0 A;  2DQL A;  2E1N A;  2J5O A;  3QP6 A;  2VON A;  3JAM Z;  3SZT A;  2RGV A;  1D5V A;  5FFZ A;  4L9T A;  3JSO A;  4I2O A;  3B02 A;  2A07 F;  2QBY B;  1EH6 A;  4R8H A;  2Y0M A;  4RAY A;  2QVO A;  3E5X A;  1XN7 A;  2M87 A;  3Q9V A;  4YFX F;  1W7P A;  5D5U B;  1ZRD A;  4HF2 A;  4NB5 A;  2H27 A;  3DKW A;  4LG0 A;  2OQG A;  1U3E M;  2Z3Y A;  1G4D A;  3FXR A;  1EH8 A;  1O3R A;  1TNT A;  2DAO A;  1Z05 A;  1QZZ A;  4I0A A;  2EV5 A;  2WC2 A;  2H6C A;  4UVB A;  3MAJ A;  2DW4 A;  2EK5 A;  3QRF F;  4UHT A;  3DPL C;  1L3L A;  1RI7 A;  2ZBK A;  3I4P A;  3R0J A;  2OU2 A;  4L5J A;  4M9S A;  5E8I A;  1LVA A;  3E5U A;  3GFI A;  1XGS A;  1H9G A;  3KP3 A;  2VN2 A;  3U2R A;  4ZYG A;  2O8X A;  2Q0O A;  5CJ9 A;  2VT3 A;  1J9I A;  3HIF A;  2ZO4 A;  4LLN A;  3FM3 A;  5LGU A;  3F6O A;  4ENN A;  4G94 A;  4FX4 A;  2PBI A;  2DK5 A;  3QPT A;  3WGG A;  2RV8 A;  2XAF A;  1XDS A;  3PFI A;  1PDN C;  4HX4 A;  5FLX K;  4EJT A;  4ZYD A;  1W7P D;  1CF7 B;  1FYL A;  3D5L A;  2K4J A;  2DT5 A;  2V6C A;  3GFL A;  4N9I A;  2F5C A;  3F6V A;  5D4R A;  1K78 B;  1REP C;  3BPV A;  4CIC A;  1XCB A;  1PUE E;  3EYI A;  1IAW A;  1F9N A;  5ILS A;  2D1V A;  3HUG A;  3RKX A;  5J8C A;  2ZKZ A;  1HQC A;  3WTV C;  3PQJ A;  3V4G A;  1G3T A;  2Z9O A;  2A6H F;  3C18 A;  2QQA A;  3GW2 A;  2CFX A;  5FB2 A;  1ZAO A;  4OMZ A;  1GXP A;  2AS5 F;  5DD8 A;  1FZP B;  3TOB A;  1YS7 A;  5JHU A;  2Z99 A;  2PEX A;  5ERI A;  1E2X A;  2C6Y A;  4S04 A;  1HXD A;  1R23 A;  4AIJ A;  3SFZ A;  1B9N A;  5L3E A;  1IXC A;  1YFH A;  2QM3 A;  2PMU A;  4ENK A;  3I59 A;  1MGT A;  3D0S A;  4G7H F;  3KP5 A;  4O6J A;  3ABT A;  1JGS A;  1SMY F;  1V4R A;  5FD6 A;  1O7F A;  1DUX C;  4RGU A;  2CG4 A;  1ZHF A;  4U0V A;  4WF2 A;  5E20 A;  2GXB A;  4P96 A;  4MHG A;  2VC1 A;  1BI3 A;  2HDC A;  4NQW A;  1WRJ A;  1YW7 A;  4OIN F;  1IRF A;  4CGZ A;  3GUD A;  2KIM A;  3J81 Z;  2VBY A;  2BEO A;  3GEZ A;  3LWF A;  5HLG A;  3ELK A;  3EYY A;  3KP6 A;  3TDU C;  2ADU A;  3ZMU A;  1HKT A;  5CVU A;  1ZLJ A;  4GXO A;  2JPC A;  5D5W B;  2NNY A;  1G3Y A;  4OIO F;  3KP7 A;  1XGN A;  1KA8 A;  1R36 A;  2PLY A;  5LRR A;  3LQQ A;  3NEU A;  1I6X A;  3RIR A;  4I01 A;  4EJO A;  3TO9 A;  4A2U A;  1UHW A;  3Q5F A;  1R1U A;  1JXS A;  1O7L A;  1BN5 A;  1QPM A;  4MTE A;  4KDP A;  3OOP A;  2W84 A;  1W4M A;  3IKT A;  2XAQ A;  1XMA A;  5DUK A;  1WKM A;  1FYM A;  1R1V A;  5BPD A;  3AAF A;  2MH9 A;  4YFK F;  2CSO A;  1OYY A; 
#chains in the Genus database with same CATH topology
 2KDO A;  4ZZL A;  1S7E A;  1KQ8 A;  1WI9 A;  4LIU A;  4RLQ A;  3G71 I;  4G6D A;  1X2M A;  2ZJQ F;  2M2E A;  3Q9S A;  3TED A;  1XPX A;  4UNO A;  3V7S A;  1UCR A;  5KAI C;  3IWF A;  2KRF A;  2LKX A;  3TO6 A;  3PIP F;  2PMZ N;  3DU5 A;  1KU3 A;  1HCR A;  1SC7 A;  1JT6 A;  3M1C A;  1Q1V A;  2XV4 S;  4M9Z A;  3BZC A;  2Q1Z B;  3W2A A;  1Z6T A;  2FF4 A;  5LLQ A;  1JJ8 C;  3H3V K;  2ZFW A;  2LD5 A;  4XLH A;  2KRC A;  4NC6 A;  2E7X A;  2VBX A;  1S3J A;  2HS5 A;  5J47 A;  1ZGA A;  3TBI A;  2WA0 A;  1P4W A;  2DA1 A;  2M4G A;  3TKY A;  3MKY B;  4L18 B;  3SJM A;  1A6I A;  2VXZ A;  2JRM A;  1JUP A;  4ZDL A;  1Z7U A;  4I02 A;  1YX5 A;  3KYL A;  2E71 A;  3C3W A;  3PSF A;  2R3S A;  1TWH J;  4F52 A;  1HST A;  1UST A;  1EV7 A;  1W5S A;  2F2E A;  3LA7 A;  3LA3 A;  1RR8 C;  1F1Z A;  4I0B A;  1NK3 P;  1HLV A;  2K85 A;  1SMT A;  2NXN B;  3EUH C;  2X1D A;  2VOO A;  2RNG A;  3HB9 A;  2O6G E;  1K83 J;  2CYY A;  4Q4Z F;  4DNC A;  4S05 A;  1Z7L A;  3E3V A;  3EET A;  4MGR A;  3JRD A;  1BM9 A;  2X1E A;  4BY7 J;  5E3O A;  3HSE A;  4ZTF A;  1WJ5 A;  1HF0 A;  1J0R A;  1VFC A;  2A5W A;  1BA5 A;  3H9Q A;  1ZYR F;  2K7L A;  2LY9 A;  3CCY A;  3RKY A;  2R7R A;  3MMY B;  1T08 B;  3HOZ J;  3M3Y J;  2WAF A;  1I3Q J;  1L0O C;  1D1C A;  3BLY A;  3GLL A;  3QYB A;  3CUQ C;  1XD7 A;  5M5Y J;  2OTL I;  4AYB N;  5LHH A;  3E97 A;  2HYJ A;  3OYG A;  2P6S A;  2E5Z A;  1PUF A;  1D1B A;  3KEQ A;  4M74 A;  4PGG A;  3J80 Z;  2ZJP F;  3S15 J;  1BC7 C;  2QCO A;  2CQ7 A;  4JX6 A;  1D0X A;  2YX7 A;  3QYF A;  2CO5 A;  2MYS A;  2DT7 B;  2V26 A;  2RRE A;  5DYM A;  3M1E A;  1TWC J;  3UR3 C;  2R0Q C;  1VQP I;  1P4A A;  4CH7 A;  4AM3 A;  1JHF A;  1R00 A;  2ICW G;  5M5X J;  3HL2 A;  3ISP A;  4M9X A;  1M1E B;  1OR7 A;  1VND A;  1X3Z B;  3HZJ A;  3V8J A;  1Z0X A;  1O57 A;  2G9W A;  3HKZ A;  2QLZ A;  4UY8 I;  1YX3 A;  4EAT A;  2ZNY A;  4BDZ A;  3ZPL A;  2K40 A;  3K69 A;  3T5X A;  4BHC A;  3QU6 A;  1LDD A;  2DDA A;  3F8M A;  4B09 A;  1GDT A;  1MZB A;  3G2B A;  3I9V 2;  1W36 D;  5F0H A;  3WTU C;  3MQ0 A;  4UVC A;  4IHX A;  1T98 A;  1GHC A;  2K9S A;  2XRO A;  3FBI B;  1WFX A;  2NOG A;  5DCF A;  1AKH B;  4P55 A;  1MMG A;  2A69 F;  2BXZ A;  3ZQH A;  1S7O A;  3QOP A;  1BC8 C;  2VKV A;  3WTX C;  4E7K A;  5EDN A;  1R71 A;  2BE5 F;  5EGO A;  4FT8 A;  2XF5 A;  4MIM A;  4HQE A;  1LJ9 A;  5F64 A;  4ABZ A;  5GTI C;  4RB1 A;  1DP7 P;  2XC7 A;  3A01 A;  4Q48 A;  1MJB A;  2IBD A;  1R4N B;  3AG3 H;  1Z3Y A;  4M73 A;  4CO8 A;  1XS9 A;  1T56 A;  2GXG A;  3VYT B;  4A5N A;  4XKW A;  5E18 F;  3WGH A;  4BJ6 C;  4KT5 C;  1YG2 A;  3BOQ A;  4WCG A;  1LNW A;  3H1C A;  1DU0 A;  3I3L A;  3DF8 A;  5CVR A;  3BR1 A;  2JUC A;  4EGZ A;  2O8K A;  2GOM A;  2OZ6 A;  4BXF A;  1OFC X;  3FIW A;  3RDI A;  2LBF A;  2QYO A;  2L4A A;  1JHH A;  3RPQ A;  3LNQ A;  1YJ9 I;  4A3K J;  1IGN A;  1W7P B;  4GCV A;  2JUG A;  1U5T A;  4BAC A;  3P9I A;  2FNA A;  2FMY A;  2WWY A;  2G7U A;  2HVQ A;  2Z16 A;  2FXA A;  2LNB A;  2K02 A;  2K86 A;  2XAU A;  3QQA A;  4LG0 B;  2FQ3 A;  2X48 A;  4BNC A;  2JA5 J;  2GM4 A;  2COM A;  3JRA A;  5FLM J;  1P7J A;  3DPT A;  4JBA A;  6PAX A;  4PDK A;  4H4K C;  4A69 C;  4E7H A;  1QQI A;  1MBK A;  4V19 K;  2BHY A;  5C4J J;  2LC2 A;  2PJR B;  1UFM A;  2NNN A;  5K7F A;  5DUI A;  2IRF G;  2L3D A;  5IOY A;  4IOA F;  1OCC H;  4KMF A;  3ABU A;  1OCZ H;  4FX0 A;  3QPH A;  1MJA A;  2EBI A;  5C44 J;  2IA2 A;  1R7J A;  3GZN B;  1HA8 A;  4WXC A;  2DLL A;  3U1D A;  4RB2 C;  1H9T A;  2GAU A;  3VSL A;  2F5D A;  1IF1 A;  2FE3 A;  2IPQ X;  3BZK A;  2MAB A;  4M71 A;  5HS8 A;  3H5A A;  3KEO A;  4IRG A;  5ED4 A;  1QBJ A;  2ZME A;  1PYV A;  2ID3 A;  2CW0 F;  2L7M P;  3FBN B;  1VQ5 I;  2ELK A;  3BWG A;  2O03 A;  3RJP A;  5IY5 H;  3H0D A;  3L00 A;  1FPQ A;  2KIS A;  1NHA A;  2VLA A;  2O0Y A;  4XLC A;  3HSF A;  3F0C A;  2DDB A;  4XKC A;  2E1C A;  1B4A A;  3CES A;  1G59 A;  2LLK A;  5TGT A;  3ZQG A;  4A5M A;  5A2Q K;  3RCO A;  4GO1 A;  1AWC A;  1XC5 A;  1U5T C;  1R49 A;  2M0M A;  3HOU J;  4LD5 A;  3LSJ A;  1FMV A;  4EMS A;  2XDV A;  1MND A;  2EPF A;  1Z3X A;  1UHS A;  1FBU A;  1T6S A;  3ASN H;  3HHH A;  3F8F A;  4PJJ A;  5BS6 A;  5KNL A;  2YS9 A;  1K6O A;  1E3H A;  2DA2 A;  3DPU A;  4XSX F;  4HDU A;  1Z6R A;  5EYR A;  2BY2 A;  1TW3 A;  1TT5 B;  3HYI A;  2R5Y B;  1ZRE A;  4PSW A;  1F43 A;  3KE2 A;  4N9H A;  4RLF A;  2XSD C;  9ANT A;  4IHV A;  4BJT A;  3SDG A;  2V7F A;  4G6Q A;  4XLP F;  3CJN A;  1UEL B;  3F21 A;  1SFX A;  2HOA A;  4BGD A;  4BS9 A;  3GXO A;  3FM5 A;  5E1W A;  5LEK A;  4F3Q A;  2OJE D;  3QP5 A;  1W5C C;  2BHZ A;  1A5J A;  3K10 A;  3Q3S A;  1HKQ A;  4HZF A;  1PP8 F;  4PJM A;  3K1M A;  2HR3 A;  2W24 A;  5EEA A;  4RGX A;  4U7B A;  1LUJ B;  2CGP A;  1J2X A;  2DPD A;  4CCN A;  3QAH A;  3ZMD A;  2B7E A;  1QZY A;  4UUS A;  2A5Y B;  3PQK A;  2IEK A;  5HNH A;  1TL8 A;  4G6T B;  4M72 A;  1I39 A;  4BXU A;  3SXY A;  5FLV A;  2HQR A;  2Y75 A;  3HUG B;  3C2B A;  3FXL A;  2QUF A;  1GXQ A;  1STZ A;  2CW7 A;  2DA3 A;  3Q0V A;  3R4K A;  2HPM A;  2QF7 A;  4KIF A;  2DA7 A;  1B1B A;  1FP1 D;  2GIV A;  3F23 A;  3C2G A;  4OAY A;  3IAM 2;  3S8P A;  1QHH D;  1ZLK A;  2XIG A;  4BEH A;  2OTJ I;  4UUV A;  3N05 A;  3V8L A;  1JI8 A;  2WAD A;  2ECC A;  2LH9 A;  2AXL A;  5ILU A;  1KU9 A;  4LGW A;  5H6R A;  4U0Y A;  1VTN C;  3RQI A;  3CJT B;  1SD4 A;  3HRM A;  4J00 A;  5FRN A;  2RAE A;  3IHU A;  2DFH A;  1RUO A;  1V5E A;  2HQN A;  1R58 A;  4IRH A;  2HVS A;  2X6Y A;  1WSU A;  1X4P A;  3H35 A;  5LGT A;  2VQC A;  5F0C A;  3FKI J;  3QWL A;  3D1N I;  3L7W A;  4HLY A;  3BRO A;  3FMR A;  5B3S H;  3ZN1 A;  3I59 B;  1QZE A;  4JQF A;  4XM3 A;  1A35 A;  3OYN A;  1BI1 A;  1SFK A;  3IC7 A;  1R5H A;  3HKZ N;  4LIV A;  2GXA A;  2GA1 A;  3FK6 A;  2XAG A;  2ELJ A;  1YLF A;  2HKO A;  5J40 A;  5KK1 A;  3WU0 A;  1F36 A;  4C3J J;  2CFO A;  3HOS A;  2CV0 A;  1HC8 A;  2HTS A;  3RYR A;  5GPA A;  1N25 A;  2IT0 A;  1Z21 A;  1OPC A;  3FMQ A;  4CYC B;  1YW8 A;  2VB6 A;  2TCT A;  4BDY A;  2NRA C;  2IVM A;  2R93 J;  4A3C J;  2RC4 A;  3GF2 A;  3QOD A;  3ZXS A;  4LLG F;  4F92 B;  1RRJ A;  4GGG A;  3FXQ A;  2HDW A;  2VE9 A;  1R4M B;  2EIN H;  2NVU B;  4AC0 A;  1A04 A;  2WY8 Q;  2R7W A;  4OMY A;  3S1Q J;  1X1B A;  4LIT A;  4NQW B;  3K6G A;  1RIO H;  1YW9 A;  1N75 A;  4BXX J;  2DJN A;  3FKJ A;  4YEJ A;  4DIQ A;  2CH0 A;  3OYC A;  4HYE A;  2BVL A;  5HDK A;  2OQR A;  4JYK A;  4M3F A;  5ICC A;  5HLT A;  4KNY A;  5B5E C;  5IYC J;  1JUM A;  3DEU A;  5HVQ C;  3RKQ A;  4HSR A;  3FZV A;  1ETO A;  2KIF A;  3KP2 A;  3I64 A;  4R79 A;  1LFU P;  5CKT A;  3HPH A;  2W1O A;  2UWM A;  3H9G A;  1HDP A;  4DGW B;  4DBR A;  2STW A;  5IT3 A;  2A61 A;  2HWV A;  2Y48 A;  4LB6 B;  2MSY A;  4N4N B;  5KAF C;  3IRR A;  1IZ1 A;  4ENJ A;  1MW7 A;  2VJ5 A;  1QNT A;  4IKF A;  2LYC A;  2RQP A;  3LST A;  1ACI A;  5BPI A;  3KCC A;  2BYV E;  3GO5 A;  1FC3 A;  1MIJ A;  3T8T A;  3L9F A;  3ZMT A;  4HRI A;  1X1D A;  1QRY A;  1ETW A;  3M8E A;  1RNL A;  1MJ9 A;  1BJZ A;  2KHM A;  4UB6 C;  4XLF A;  3BJA A;  4JOM A;  1FTZ A;  4KFC A;  2M7B A;  3KLO A;  2MC4 A;  3DEW A;  2L0K A;  3J7Z I;  4OIQ F;  1UG2 A;  3SEQ A;  2HTJ A;  3S1R J;  3MZY A;  1ZG3 A;  4KJZ A;  2MA3 A;  4KIC A;  3IRQ A;  2FSW A;  1RKT A;  4FET A;  1ETX A;  4XKV A;  3CQZ J;  1IRG A;  1EJ9 A;  2B63 J;  3FHZ A;  1QVU A;  3FXJ A;  1LQ1 A;  3BQZ A;  3L2U A;  3BJO A;  1YRN A;  2VBZ A;  2WAQ N;  4BYY A;  3SYT A;  3I58 A;  3VFZ A;  2W85 A;  3PL8 A;  3ESW B;  5AON A;  5HLI A;  2XRN A;  1FMW A;  3G1O A;  4D0P A;  4A3G J;  3CCM I;  1P6R A;  3HPG A;  2H1L A;  3T0Y A;  1BBY A;  2K5C A;  4QIW N;  3K1P A;  1SD5 A;  1U2W A;  3A0B C;  3MEX A;  3OYB A;  3AG4 H;  1OYI A;  2M1B A;  4EM0 B;  4LFU A;  3H9J A;  4A0Y A;  5IP9 J;  2AHQ A;  1CGP A;  2Q8K A;  2P5L C;  1GT0 C;  3VB2 A;  3E6B A;  3MKZ A;  5LHG A;  2F5F A;  2P4W A;  1MMA A;  3JAM K;  1RUN A;  3KIO A;  1BOA A;  2W82 A;  3C2H A;  3L2V A;  2DA4 A;  2RKH A;  2ZSI B;  5DV5 A;  2CRG A;  2PMH A;  5D5V B;  5M5W J;  1W0T A;  5LFA A;  2M4K A;  4V2G A;  3OYE A;  1MBJ A;  3OL3 A;  2D45 A;  2Q2E A;  4IHY A;  2EZL A;  3CCS I;  3K4K A;  2KIU A;  1R1T A;  1OKR A;  1I27 A;  2FOW A;  2HPI A;  1S29 A;  4XMY A;  1HW5 A;  5CPR B;  2PG4 A;  3HXL A;  2WY7 Q;  5LEJ A;  5H2F C;  3JRH A;  2JA7 J;  1MSE C;  3IP4 B;  2JN6 A;  2OCE A;  5LHI A;  3OIP A;  5B1B H;  2CV2 A;  2P81 A;  1T39 A;  4XN3 A;  4P5O A;  3BPX A;  4A3I J;  3L2C A;  2P5V A;  3KLN A;  1RC9 A;  1J09 A;  2FNP A;  4CCM A;  1YIJ I;  3HOW J;  5CVV A;  3CDH A;  4QSH A;  3GTJ J;  2LRD A;  2MLG A;  2XSJ C;  3P7N A;  4QPQ A;  3V7R A;  1OMI A;  1I5Z A;  1RR7 A;  4IEJ A;  4Y33 A;  4OIR F;  4L0Y B;  3OYJ A;  5IT9 Z;  2D2W A;  2XGX A;  1B72 A;  1ZG5 A;  2QSG X;  4XRS G;  5HDG A;  2F48 A;  3CP8 A;  4N4O B;  5M3M J;  2K9N A;  3CCL I;  3K1N A;  4E70 A;  4OU0 A;  4Q47 A;  4WXD A;  4GFB A;  2Y31 A;  1SFO J;  4HNV A;  3UKG A;  1WZ2 A;  3CCU I;  4HNU A;  2L7K A;  3K4J A;  2DOA A;  3S3N A;  2Y9Z A;  3IUO A;  2EZH A;  2QKM B;  3VOE A;  1LDK B;  4HF0 A;  3L2R A;  1S5L C;  4ASN A;  1JKO C;  1ZR4 A;  2V1U A;  4RGS A;  1HW2 A;  3P9K A;  1ETK A;  4OAZ A;  3RSN A;  4EJW A;  2MBF A;  2K9M A;  4FAS D;  1APL C;  3D5S C;  3HJE A;  1BIB A;  4HOB A;  4XRS A;  2H8W A;  2HDD A;  4RB3 C;  1PUF B;  2DYR H;  1QPI A;  1IC8 A;  1IG7 A;  2O7O A;  3BR0 A;  4AVZ A;  5L3B A;  1ETY A;  2VL8 A;  4F55 A;  4NUB A;  4PK4 A;  3HC7 A;  4BE1 A;  4II2 A;  4FHT A;  2YX4 A;  3EUH A;  3S3O A;  2R7S A;  5C3E J;  4HLX A;  2DBB A;  4LLL A;  1ENH A;  4PSX A;  4DJA A;  1OIS A;  2EIJ H;  3AL0 C;  4Y17 A;  2JTV A;  3DQV C;  3TQN A;  3S3M A;  2E2J J;  4JK1 X;  2XAH A;  2Y69 H;  1HBX G;  5K5O A;  2IJL A;  3BTI A;  4Z2Y A;  4EQQ A;  5GPC A;  4A3D J;  3CJR B;  2GZW A;  3K70 C;  1N78 A;  3ULQ B;  5K5R A;  2L02 A;  4RAZ A;  4B8X A;  3NAU A;  3NAR A;  3VEP A;  1SD7 A;  2JSC A;  2ELH A;  4B1R A;  4DBQ A;  3CUQ A;  1OCR H;  5EGO B;  4UXN A;  5F1R A;  5CYV A;  4Y52 J;  3LSK A;  2DXI A;  5F08 A;  2OC6 A;  4ZH4 F;  4XOR A;  1ZKG A;  2JSP A;  3WU1 B;  3A01 B;  1LE8 A;  3J7A O;  1C0W A;  3J7A Y;  1W1W E;  2I10 A;  4PCQ A;  2LDU A;  3ML6 A;  4RGR A;  1WI3 A;  4R1H A;  5J6X A;  1EH7 A;  5FKK A;  2LFB A;  1MKM A;  2TRT A;  4Y4R A;  3MZH A;  1J75 A;  1ZRC A;  1ETV A;  1BIA A;  2GA2 A;  3QOE A;  4ETS A;  1LDJ A;  4MQ9 F;  3WTT C;  2X6X A;  3ERM A;  1SFU A;  2V4J C;  2XF6 A;  1ERD A;  4P9F A;  4XL9 A;  3FWE A;  2H8R A;  4C2T A;  2UZK A;  3PNY A;  1GV5 A;  4MNU A;  4WWC A;  3L2W A;  2G7H A;  3R0A A;  2LBF B;  1BI0 A;  2QEN A;  1U9N A;  2O5R A;  4K2E A;  3CDI A;  3RPU A;  1ETQ A;  1Y56 A;  2XHK A;  3F72 A;  4DZP A;  3GTQ J;  1E0E A;  1U5T B;  3H0G J;  2X85 A;  1A6Q A;  1QGP A;  2FBI A;  3OWT A;  3WG7 H;  1S6L A;  3FX3 A;  4X6A J;  2Y0S A;  3T8R A;  1ON1 A;  2R7D A;  5FKO A;  3DTE A;  3WE2 A;  3GX4 X;  5AIQ A;  5K7H A;  1KZH A;  2MW8 A;  2V79 A;  2VJI A;  4BQN A;  4IHT A;  3I5U A;  4MTD A;  3GWZ A;  2QSF X;  5EG0 A;  5HOD A;  1XTA A;  3I4M J;  5J1Y A;  5HDN A;  1UG0 A;  4C2M J;  1UAA A;  2VT2 A;  1HW1 A;  2E60 A;  2F5E A;  1FY7 A;  2BXY A;  4C2U A;  2GQQ A;  2WB1 A;  1Z1D A;  3WGI A;  2GLO A;  1VQ8 I;  1FBS A;  2EJR A;  4PFP A;  1BL0 A;  2OD5 A;  4NHJ A;  1XSX A;  3D5R C;  1B8I A;  4M3D A;  3RZD J;  3HRT A;  3G4S I;  1KU2 A;  5KVR A;  3GBG A;  4AVP A;  3OOU A;  4AU7 A;  3VSK A;  4ZDP A;  1K79 A;  2YR2 A;  4BKX A;  4Y13 A;  2HI3 A;  2ZME B;  1FX7 A;  1HKS A;  3AKZ A;  2VPL A;  1TNS A;  2RNJ A;  5J4V A;  3K2A A;  4CYD A;  4IF4 A;  1UJ8 A;  3I0T A;  2ZXH A;  1G3S A;  1YI2 I;  1PVE A;  1DQU A;  1SFE A;  4JX4 A;  5FO5 A;  2RQQ A;  1ORK A;  1X2N A;  3HGY A;  4CZZ A;  1FYK A;  2KIQ A;  4HQM A;  2HFH A;  4LK0 F;  5ILV A;  3E6C C;  1X1A A;  2KL4 A;  2NVY J;  3JW4 A;  4XLE A;  1POG A;  5IYB J;  5D4S A;  3I54 A;  1LB2 A;  3CO6 C;  2XAS A;  1Z9C A;  4UVA A;  2NAZ A;  1B59 A;  1MDM A;  4BHB A;  1LPQ A;  2L54 A;  3OIO A;  1YE9 A;  3J81 K;  2B9S A;  3DBH B;  2W4S A;  3S1M J;  3T1B A;  1TZL A;  5M3F J;  1Y1V J;  2X4H A;  3CME I;  1W5T A;  2E1M C;  4OOI A;  2D5V A;  3E6M A;  2DFF A;  5C4X J;  3BG9 A;  4YII A;  2IS4 A;  2HZD A;  1BR2 A;  4RMN A;  1WH5 A;  1TBX A;  1ON2 A;  3PJR A;  2E35 A;  1X58 A;  3OYD A;  1WWX A;  3CUO A;  5GP9 A;  3KET A;  4FIS A;  2FD5 A;  5DCM A;  4EJU A;  4P9U A;  5EEG A;  4KUM A;  4LJZ F;  3IL2 A;  4I76 A;  2W48 A;  2ECB A;  4XON A;  4DYR A;  2IW5 A;  1P9Q C;  4BBS J;  2XRL A;  3RPU D;  2FU4 A;  4B3X A;  3CMA I;  1IN5 A;  2QGU A;  3G1L A;  2BV6 A;  4E7L A;  1SAU A;  2VC0 A;  2F4M B;  2V9K A;  2E1O A;  1KQ0 A;  3SEZ A;  3SZP A;  1KYZ A;  3A1Y A;  2CQX A;  1MBF A;  1AA7 A;  3AG2 H;  1U6G A;  1XSD A;  4IJA A;  1QVT A;  5CVI A;  2EIM H;  3F8N A;  2ZCW A;  3VOD A;  4UUS B;  3MKL A;  3P5J A;  3ZOB A;  3H5R A;  2KJB A;  5FLX Z;  1H89 C;  1FEX A;  2E36 A;  3GLX A;  2ZB9 A;  4U0W A;  4L9J A;  3QPL A;  5D8K B;  2CWE A;  4ZYE A;  1SD6 A;  1O3T A;  3CLO A;  2UXN A;  3A02 A;  1HDD C;  1Z67 A;  2MD5 A;  4KN4 X;  4I09 A;  3NWS A;  5B66 C;  2P7V B;  3EUK L;  3JTG A;  2V9P A;  4BEH B;  3O2P E;  4AUX A;  4IX7 A;  3BG7 A;  4IXA A;  1IXR C;  1BOB A;  1VQM I;  2KZG A;  2EIK H;  1U78 A;  1R22 A;  1DDN A;  5L3G A;  1Q1H A;  1Y6I A;  2OBP A;  1P92 A;  1B9M A;  1KQ9 A;  5FKM A;  4UV8 A;  3OYI A;  4IPA A;  1MBH A;  2LOO A;  3U9G A;  5DDG A;  4MEY F;  4ZTJ A;  4KT6 A;  1WCM J;  1WJC A;  1IRZ A;  3BP8 A;  4RDU A;  3I71 A;  2F4I A;  3WHB A;  3H92 A;  5E1X A;  4E6K G;  4ZZD A;  2M30 A;  1U9O A;  4D1Q A;  4HF1 A;  2OUM A;  3J7Y J;  4W97 A;  2QZ8 A;  3MN2 A;  4HNT A;  2IP2 A;  1ZN2 A;  4NC8 A;  4ZDO A;  3JRE A;  2EWN A;  3E7L A;  2NS0 A;  3JRC A;  3LMM A;  3HOY J;  1T38 A;  4A6E A;  4XOT A;  2FBK A;  2XPV A;  4IVN A;  1VQK I;  3REO A;  2CQK A;  4M6Y A;  1YHQ I;  3I55 I;  4O3M A;  3W6J B;  2IGN A;  4EV0 A;  2IA0 A;  2OAZ A;  3RTR A;  2UV1 A;  5F1J A;  3E0J B;  3CD6 I;  3DTK A;  4U88 A;  1Z91 A;  3IWZ A;  1ZGJ A;  2DA6 A;  4HW0 A;  4G7O F;  1RPW A;  5TRD A;  2XPU A;  2GWR A;  3A2K A;  4W1U A;  3CP2 A;  3M07 A;  1TWG J;  3BG6 A;  3OSF A;  1O3S A;  4AIK A;  5CQE A;  3VYR B;  4WK8 F;  2LTP A;  4HA8 A;  2VXD A;  5H20 A;  1BW5 A;  3ABL H;  4G9Y A;  1OLT A;  1X3U A;  2MGQ A;  4ESB A;  2A68 F;  2A3S A;  4A3L J;  2MH2 A;  3DBR B;  1JT0 A;  1J59 A;  4RS8 A;  5FRM A;  3BQY A;  4E7I A;  1YS6 A;  4IO9 F;  4LK1 F;  1ODD A;  2QSH X;  1WJE A;  1S7A A;  2X0L A;  2M8E A;  3S93 A;  1I1G A;  4XLN F;  2V9V A;  1FIP A;  2HXI A;  4PJL A;  2R5Z A;  4DYC A;  4QTR A;  3J80 K;  4IZZ A;  4TV7 A;  4I6Z A;  2EQR A;  4WXH A;  4A6D A;  1U8R A;  1LFP A;  1T8I A;  2Y0S N;  3WTW C;  2JPB A;  2AXT C;  3GYH X;  4CCO A;  5ICG A;  1R5G A;  4Z6Y A;  1S72 I;  3PUF A;  4XN0 A;  4BH9 A;  4CUG A;  2PFB A;  3TP0 A;  3WOD F;  2AO9 A;  3P9C A;  1N77 A;  2LY1 A;  3DBL B;  1YIO A;  1SVL A;  2RVC A;  3MFK A;  2JA8 J;  4X0G A;  3COA C;  4I98 B;  5BQT A;  3GCM A;  1NK2 P;  5FKN A;  5K1Y A;  4XNF A;  5JHF A;  4YFN F;  5ICE A;  2IGK A;  1WVR A;  3LQR A;  1FSE A;  2CUF A;  3LA2 A;  1KU7 A;  4EGY A;  2EFN A;  4J19 A;  1HSJ A;  1X1C A;  1YRN B;  2L9N A;  1XCV A;  1D0Y A;  1FOY A;  3W2W A;  5BMZ A;  2E2H J;  1YOV B;  5IOZ A;  3IKV A;  2O9L A;  3DP7 A;  1ULY A;  2AQF A;  1IW7 F;  4UUT A;  1TP4 A;  4HV6 A;  2Y9Y A;  5J3L A;  2PX9 A;  4HEA 2;  1TC3 C;  5FGM A;  2VJ4 A;  3OS2 A;  1IUY A;  1IO2 A;  1D3Y A;  3HHG A;  2ME0 A;  2K9Q A;  3K4M A;  3JRG A;  2Z5U A;  4FE4 A;  3ZQQ A;  5TIS C;  4O5V A;  5LRS A;  2JA6 J;  3FXM A;  5FJ8 J;  5E3L A;  3EPZ A;  2BW3 A;  3HM5 A;  3OSG A;  4Y15 A;  2HZT A;  2STT A;  4AID A;  4YIF A;  2PI0 A;  2ISZ A;  1IN4 A;  4F7Z A;  3TO7 A;  2P7C B;  2W7N A;  3ZN0 A;  3SQN A;  2JQ7 A;  1ONV A;  3BR2 A;  2G0E A;  2Q2E B;  4E7J A;  3CTA A;  1IUF A;  3RI4 A;  2LRE A;  2BY1 A;  3H3Z A;  2PMZ A;  3QU3 A;  3G73 A;  5HS9 A;  3M4O J;  2D1H A;  4KIG A;  4G12 A;  2QQB A;  2M45 A;  2HQ5 A;  5FFX A;  1ZRF A;  3CC2 I;  5IPA A;  3OIQ A;  4UB8 C;  5EJC A;  5DTD A;  3OY9 A;  1YTY A;  2KJC A;  3DTI A;  1T0F A;  2P5K A;  3PFY A;  4MFE A;  5E3N A;  2JT1 A;  1RET A;  2H1K A;  3FHN A;  3CCR I;  5EEH A;  2VKH A;  3K4N A;  4MEX F;  2QBY A;  5BOX A;  3LSI A;  1ZQ3 P;  3NRV A;  3M8F A;  1SAX A;  4LG3 A;  1QHG A;  4XID A;  2R7X A;  2EA2 A;  3SHF A;  1I50 J;  2KDZ A;  2ISY A;  2WBM A;  5D6E A;  2QKL B;  5EZG A;  4AWX B;  1F5T A;  2H6B A;  2L9S A;  2GBY A;  3JCU C;  5HS7 A;  1K6Y A;  1YQA A;  1IDZ A;  2R7V A;  3G1M A;  2VI6 A;  4L9V A;  3IH3 A;  4D5C A;  1B72 B;  5CLS A;  2YSR A;  3FXU A;  3WG9 A;  4KYW A;  3ZQ7 A;  4X1E A;  2DTR A;  2ZXJ A;  1TW2 A;  3BR3 A;  1E3O C;  2ZFU A;  5JVT A;  4BU2 A;  2RN7 A;  3AFH A;  1TT0 A;  3V8K A;  3NQO A;  4BHP A;  1IV6 A;  2MC3 A;  2DQR A;  1FOK A;  2IS1 A;  2NS7 A;  3N97 A;  3PNT A;  4CHU A;  2A6E F;  3WTZ A;  1JE8 A;  4JP0 A;  2OCC H;  2ACJ A;  2R7Z J;  3HRU A;  2HXO A;  4BJ5 C;  2MLK A;  3IAS 2;  3KEY A;  4V2F A;  5DM6 F;  4IQJ A;  1ZG1 A;  4L0Z B;  2NYX A;  1D0Z A;  5E8G A;  2JA2 A;  4XBF A;  3OYL A;  2DI3 A;  3TOA A;  3ERE D;  3I56 I;  2YPR A;  1BR1 A;  4IQ4 A;  3TW6 A;  2MFZ A;  3RZO J;  5KCM A;  5DM7 F;  3SFI A;  2FA5 A;  2PJP A;  1FSH A;  5HOO A;  1T0F C;  1WH7 A;  4BAY A;  3I53 A;  3C1D A;  3GME A;  1IJW C;  3HOX J;  4A3B J;  5L3C A;  5LBQ A;  3HOT A;  3RQ4 A;  1MH4 A;  3BZ6 A;  1YYV A;  4M3G A;  4NNJ A;  4HDV A;  2V1N A;  2ZJ2 A;  1J5Y A;  3O3K A;  1IXS B;  1PJR A;  2EIL H;  1OCO H;  3OYH A;  3ZMS A;  5JVG F;  3SZG A;  3KYC B;  3H36 A;  1VZ0 A;  2WTE A;  3TP3 A;  4ANJ A;  4EM1 A;  4GYG A;  2LMD A;  3H5N A;  4A3E J;  2HOS A;  2HEO A;  4II3 A;  1YO5 C;  1MSF C;  5EZH A;  5EF6 A;  3MZ8 A;  3HGG A;  3CUQ B;  5K5Q A;  2XKP A;  3B73 A;  1QA6 A;  2L4M A;  1K4S A;  1LFB A;  1I6H J;  2IS6 A;  5LGN A;  4AD9 A;  2ME6 A;  1RKW A;  2BVM A;  2LY2 A;  3EQL F;  2X6O A;  3HOV J;  3WTY C;  3U1K A;  5DEQ A;  1H88 C;  2B0L A;  5IP6 A;  1LE8 B;  5JI6 A;  2YUS A;  1FNN A;  3HRS A;  2KLO A;  3PSI A;  3ECH A;  2FRH A;  2HOT A;  3CO7 C;  3E6D A;  4RAG A;  3BT9 A;  4D7M A;  1XGM A;  2BBY A;  3BY6 A;  4FTH A;  2K27 A;  2NVT J;  4GYI A;  2YU3 A;  1Y0U A;  1CF7 A;  4IRI A;  5E1Z B;  2VOP A;  2IGM A;  5JR3 A;  2OZU A;  3OS0 A;  5K7Z A;  1O3Q A;  1D1A A;  3PIO F;  3RYP A;  2NVQ J;  2VIX A;  2XB0 X;  4I7H A;  5E17 F;  2M34 A;  1P7I A;  2I8D A;  2M9H A;  1QO0 D;  1MBE A;  1K78 A;  1P4X A;  2V1D A;  4ON0 A;  2YU9 J;  4HAM A;  3TGN A;  1FT9 A;  2HQA A;  2DA5 A;  4UV9 A;  1XDU A;  3JTH A;  1TWA J;  3LSH A;  1OYW A;  2IXS A;  3MCZ A;  3W6K B;  1ZR2 A;  3FMS A;  4JX5 A;  2LF7 A;  3ASO H;  4A93 J;  2HU9 A;  2CW8 A;  3L09 A;  4XQF A;  2LKP A;  1XMX A;  2HYF A;  2E5N A;  2E1M B;  2L01 A;  1TQI A;  2DK8 A;  4L9N A;  1BR4 A;  1ZAR A;  3GZ5 A;  1JKQ C;  3KZI C;  4PZJ A;  5EG0 B;  2XVC A;  1TQP A;  2FML A;  1TLH B;  3OS1 A;  5CVJ A;  1LVK A;  2HGC A;  1RZ4 A;  2TDX A;  4YIR X;  1F4K A;  2MG4 A;  4ZC3 A;  2ESN A;  2VJJ A;  2WAE A;  3CMM A;  3EUA A;  3O6B B;  5D5X B;  1AU7 A;  1AOY A;  3K4L A;  2P0W A;  1B8I B;  1OQY A;  5F6F A;  3M7G A;  4LOC A;  1JGG A;  4MQV A;  2R7F A;  4XRF A;  2DN0 A;  2LSO A;  3JR9 A;  3VDX A;  2HOE A;  2DYS H;  3KFW X;  2DOF A;  3KZY A;  2Y2Z A;  4CSW A;  3BTL A;  2FJ1 A;  4IHW A;  3DWL E;  1D8J A;  2EV6 A;  5AIP A;  4QLC U;  3LFU A;  1NG7 A;  2X9D A;  3ZMZ A;  1G6N A;  3O8G A;  3TDZ C;  1TQM A;  4DOZ A;  2UXX A;  4B3A A;  1R9T J;  5FD5 A;  4DYQ A;  4BUP A;  3R61 A;  3H3U A;  2XAJ A;  2EFW A;  2Z33 A;  1LEA A;  4QWQ A;  3BJ6 A;  3LOC A;  1P2F A;  1FOX A;  1V55 H;  2H09 A;  4A3M J;  3S1N J;  2O61 A;  1MDM B;  1KGS A;  2DFI A;  3CF2 A;  2FUG 2;  4GRI A;  2DO7 A;  3ZP5 A;  1S8N A;  2E7W A;  1MNE A;  2F6C A;  4PGH A;  4KIB A;  5JFR A;  4WX9 A;  2ZXW H;  3WE3 A;  3F8C A;  1U0J A;  1Y0N A;  1VF9 A;  1K4T A;  3PO3 J;  1R5I D;  1SVM A;  2LKS A;  4PUS A;  2A05 A;  1K7A A;  4B47 A;  1X4O A;  2X51 A;  1YIT I;  5A2Q Z;  5DD4 A;  3F22 A;  4A0X A;  4ESJ A;  1ZH5 A;  3N4M A;  3BG3 A;  4KMU X;  4BQO A;  2VBW A;  1DPR A;  2O3F A;  5DCM B;  3K70 D;  1VQN I;  4A0Z A;  1FLI A;  3OR1 C;  2K4B A;  1WJB A;  5L3F A;  1GVJ A;  2KQR A;  3GZ6 A;  3ZMV A;  2DTZ A;  4CDG A;  3CCE I;  3NWT A;  1YJN I;  3MD2 A;  4XRM A;  3MWM A;  4FE7 A;  4IL6 C;  4B44 A;  4M6V A;  2P6T A;  1XG1 A;  3DXJ F;  3Q0W A;  3DKY A;  1Z77 A;  3AG1 H;  4HV5 A;  4HX8 A;  1BI2 A;  2R7O A;  4YG2 F;  3BR6 A;  4G7Z F;  1SEU A;  5F0F A;  3VYU B;  1IN8 A;  1G3W A;  2ESH A;  2DU9 A;  2M5W A;  1GVD A;  2KP6 A;  2EV0 A;  4HX7 A;  2JVH A;  5J8F A;  4EM2 A;  2KRH A;  2XGE A;  5TJJ A;  2EB7 A;  4DW6 A;  2QQ8 A;  3HEF A;  3VPR A;  1FBQ A;  1W36 C;  3ONQ A;  1PP7 U;  1LKX A;  4A12 A;  3ZCO A;  4Q5S F;  2KMU A;  2VOD A;  3G3Z A;  2W57 A;  1JJ6 C;  3CDL A;  3S14 J;  1DPU A;  2FX0 A;  1IN7 A;  2FQ4 A;  3BTC A;  2IA1 A;  2PQ8 A;  4MLO A;  2OA4 A;  4C3H J;  3E5Q A;  2XGD A;  2M7A A;  4M3E A;  1ZTR A;  4EJV A;  2DPU A;  4HBL A;  2Y30 A;  4PJ0 C;  4H0E A;  2M3A A;  2E2I J;  3EDP A;  2XKO A;  1XB4 A;  3ZQL A;  1XSV A;  2CJJ A;  2X1C A;  1T2K A;  3WHC A;  3ZQF A;  2ID6 A;  1H8A C;  4BQA A;  4LB5 A;  2VE8 A;  3LSG A;  1UMQ A;  1WGX A;  5E79 C;  3KYD B;  2FEZ A;  3HTU A;  2HYG D;  2OF7 A;  4A3F J;  3RKW A;  3GFJ A;  4FQG A;  4XR6 A;  3L1P A;  1E17 A;  2LVS A;  3HSR A;  1ITY A;  3C7J A;  2EFP A;  1MBG A;  3GFM A;  1WJF A;  1WQ2 A;  4IHS A;  5FRO A;  4XKB A;  2JZY A;  3M9A A;  4KA4 A;  2CQQ A;  1FWZ A;  1GV2 A;  3SDB A;  4RB0 A;  1A31 A;  2ETH A;  2MD0 A;  3F3X A;  5IT9 K;  2KZV A;  1R6R A;  3KX2 A;  3IH2 A;  3VYS B;  3JSP A;  2V1X A;  1UB9 A;  1FJL A;  3LAJ A;  4DZJ A;  3W6V A;  4AIH A;  3GVA A;  2J5P A;  1LEB A;  2BGC A;  2V6E A;  4YEL A;  4CZC A;  3LSM A;  5GAG J;  1DGR M;  5HNF A;  2L7Z A;  2LG4 A;  2UUZ A;  2EFQ A;  4PFO A;  2JRT A;  3FF5 A;  4U7D A;  3DV8 A;  1WPK A;  4C30 A;  1ZK8 A;  4ZYH A;  3KZZ A;  3I4N J;  1MMS A;  1MNM C;  3HDD A;  3S17 J;  2GIZ A;  2ZNZ A;  1KYW A;  3DLL F;  5HLH A;  3ABK H;  4ESF A;  4CXF A;  5GAE J;  3BDD A;  1NH3 A;  2Z1D A;  2W25 A;  1BJA A;  3BG5 A;  3OV8 A;  5JLW A;  3LAP A;  3ZQC A;  3DFG A;  2R5Z B;  5F04 A;  2K3F A;  1OR7 C;  2VQH A;  3K2Z A;  3F8B A;  1V3F A;  3CCQ I;  3JRI A;  4CCJ A;  2F5V A;  3R60 A;  2M0C A;  3CMY A;  5D6F A;  3K9T A;  4E4H A;  4EVI A;  3WTS C;  2W00 A;  2DFE A;  1JKR C;  3FXO A;  5L3D A;  4KN7 X;  1I1S A;  2DCE A;  1TTY A;  2H94 A;  1IN6 A;  5BNG A;  3B6A A;  4OIP F;  1V54 H;  5J1U A;  2VUM J;  5IYD J;  1IDY A;  1NG6 A;  5JLX A;  2EA4 A;  5D8L B;  4N0B A;  3ROU A;  1H0M A;  3CF5 F;  4J01 A;  2WV0 A;  2HKX A;  1B6A A;  3HTS B;  3LFK A;  4XSZ F;  4DQ2 A;  2IAI A;  2N8G A;  2Z2S B;  4IOC F;  3A0H C;  1SVO A;  1XGO A;  2LP0 A;  2FBH A;  1Y39 A;  2QEX I;  2P8T A;  4U87 A;  3DCF A;  2XB5 A;  3OMY A;  2PN6 A;  4LMY A;  1V5G A;  2VKD A;  1UHM A;  3K0L A;  2WAQ A;  2VKE A;  3U21 A;  4C9Y A;  3S2W A;  1D8K A;  3BTJ A;  4RBO A;  1BW6 A;  2KT0 A;  1J7K A;  2E19 A;  1T95 A;  3ECO A;  2QWW A;  2HNH A;  2LF8 A;  2XUB A;  2QQ9 A;  2DMN A;  4D9J A;  1EKE A;  2M8G X;  2RDP A;  2R92 J;  5H6Q A;  2EFO A;  1DGW Y;  1NTC A;  3CZ6 A;  1FP2 A;  3KP4 A;  1O4X A;  2BW3 B;  3DU6 A;  3V7C A;  1AKH A;  3DKX A;  2K9L A;  4M6X A;  3R6S A;  3K7A J;  3GTM J;  1ZEL A;  4FCY A;  4KIT B;  3KPH A;  1USS A;  2FOK A;  4G8X A;  4ITV A;  1X3W B;  1XMK A;  4L5I A;  2KKO A;  4XK4 A;  5ICF A;  4ENM A;  4I99 C;  2I5U A;  3K4B A;  1MD0 A;  3CJQ B;  2DOE A;  3FDY A;  3A03 A;  2DQL A;  2OV7 A;  2E1N A;  2J5O A;  2F4O B;  3QP6 A;  2XPW A;  2VON A;  3W3C A;  2JK3 A;  2CUJ A;  3JAM Z;  3SZT A;  2RGV A;  2JJ7 A;  4CCL A;  5DS9 A;  3FK7 A;  1D5V A;  5FFZ A;  4L9T A;  5J4Y A;  4MO7 A;  3ZRG A;  3JSO A;  4I2O A;  3B02 A;  2A07 F;  2QBY B;  1G8X A;  2NS8 A;  1EH6 A;  4R8H A;  4Y7N J;  2NVX J;  2Y0M A;  4RAY A;  4BE0 A;  3MKW B;  2QVO A;  3E5X A;  4BL0 B;  3OYF A;  1XN7 A;  1FTT A;  2VAS A;  5CQG A;  2ZJR F;  2M87 A;  3Q9V A;  4YFX F;  1W7P A;  2BZT A;  2CU7 A;  4ZYA A;  5D5U B;  1ZRD A;  4HF2 A;  4NB5 A;  1KON A;  2BOL A;  2L9R A;  2ZME C;  2H27 A;  1G2H A;  3DKW A;  3LL7 A;  1WJD A;  1X1P A;  4LG0 A;  3ZQI A;  2OQG A;  2XGC A;  3CCV I;  1VI0 A;  1CQT A;  1GLN A;  1VQ9 I;  2KPM A;  2JWT A;  1D5Y A;  1U3E M;  1FIA A;  3DEE A;  2PJR A;  2L7F P;  2Z3Y A;  1AHD P;  1G4D A;  3BCA A;  4CCK A;  3FXR A;  1EH8 A;  3W2V A;  1O3R A;  3DLA A;  2LK2 A;  4E7S A;  2JMW A;  2CMP A;  1TNT A;  1WHU A;  2DAO A;  1Z05 A;  2DMU A;  1VQ4 I;  1QZZ A;  2WB1 N;  2R4G A;  2EV5 A;  2WC2 A;  2H6C A;  4I0A A;  4UVB A;  3LSR A;  3MAJ A;  1VQ7 I;  2DW4 A;  3QPS A;  3B6C A;  3X2Q H;  3S2H J;  2EK5 A;  3QRF F;  3GTL J;  4UHT A;  1JUS A;  3DPL C;  1VQO I;  1L3L A;  1OCT C;  1RI7 A;  2ZBK A;  2K3P A;  3BR5 A;  3I4P A;  4EEF G;  1A36 A;  1QU3 A;  3JRB A;  1RES A;  3R0J A;  5F27 A;  2BY3 A;  2OU2 A;  4L5J A;  4M9S A;  5E8I A;  1LVA A;  3E5U A;  3GTO J;  3GFI A;  1XGS A;  3ZR8 X;  3E1S A;  1H9G A;  3KP3 A;  2VN2 A;  2CS3 A;  5J1R A;  3U2R A;  4ZYG A;  2O8X A;  1T33 A;  2Q0O A;  5CJ9 A;  2GOX B;  2VT3 A;  1J9I A;  3HIF A;  2ZO4 A;  4LLN A;  3IV5 A;  2R7T A;  3FM3 A;  5LGU A;  3OYA A;  2AQE A;  2CV1 A;  4D7N A;  2A6T A;  3FIS A;  3F6O A;  4CA0 A;  2QA4 I;  2R7Q A;  2R5Y A;  4NBQ A;  4ENN A;  4G94 A;  4BQQ A;  4FX4 A;  2PBI A;  2DK5 A;  3QYE A;  3QPT A;  3WGG A;  4RA2 A;  1S9H A;  2RV8 A;  1GUU A;  2XAF A;  4F93 B;  1I3A A;  1XDS A;  2E34 A;  2EZK A;  2ZXI A;  3PM1 A;  3AL0 B;  3BC8 A;  4NC7 A;  4L5E A;  5E3M A;  1U8B A;  3PFI A;  4C3I J;  4RAF A;  1PDN C;  4HX4 A;  2DMT A;  5FLX K;  4B43 A;  4EJT A;  3K4C A;  4ZYD A;  1W7P D;  1CF7 B;  1FYL A;  3D5L A;  1DU6 A;  2K4J A;  1JTX A;  2DT5 A;  1FOW A;  2V6C A;  3GFL A;  4N9I A;  2VQL A;  1EF4 A;  2F5C A;  3F6V A;  5GTH C;  5D4R A;  3OR2 C;  3OYK A;  1K78 B;  1REP C;  1Y8R B;  3S16 J;  3BPV A;  4CIC A;  1XCB A;  1PUE E;  2XF7 A;  4XOP A;  3EYI A;  2DT6 A;  1IAW A;  4BBR J;  5LD2 C;  1F9N A;  1DP3 A;  5GAH J;  1OCP A;  4XLA A;  3G6E I;  4HPQ A;  5ILS A;  4ZJZ A;  2D1V A;  3HUG A;  3RKX A;  3PO2 J;  2DMP A;  5J8C A;  2ZKZ A;  1HQC A;  2COB A;  3OL4 A;  3WTV C;  3GTP J;  3PQJ A;  3V4G A;  1Y8Q B;  1G3T A;  2Z9O A;  2A6H F;  3C18 A;  4AYB A;  4Y3O A;  2QQA A;  3GW2 A;  4BY1 J;  3WU2 C;  4HG2 A;  2CFX A;  4XIC A;  3GTK J;  3CC7 I;  5FB2 A;  4KIS A;  1YJW I;  1ZAO A;  4OMZ A;  1VQL I;  1TWF J;  1GXP A;  2AS5 F;  5DD8 A;  1FZP B;  1UZC A;  3TOB A;  1YS7 A;  4MFD A;  5JHU A;  4HST A;  2Z99 A;  2PEX A;  5ERI A;  1E2X A;  2C6Y A;  4S04 A;  1HXD A;  1R23 A;  4E7Z A;  4AIJ A;  3SFZ A;  1B9N A;  5L3E A;  1IXC A;  2CQN A;  1VQ6 I;  3UNG C;  1YFH A;  4YRV A;  2KFD A;  2QM3 A;  4NDL A;  2PMU A;  4ENK A;  3I59 A;  1MGT A;  3S2D J;  5KHD A;  3D0S A;  3GTG J;  4G7H F;  3A4C A;  3KP5 A;  1X19 A;  4O6J A;  1XX5 A;  3ABT A;  1JGS A;  3S32 A;  1SMY F;  1V4R A;  5FD6 A;  1O7F A;  1OJL A;  2X6W A;  4RGU A;  4RM2 A;  1DUX C;  2IS2 A;  2CG4 A;  3JRF A;  3HBL A;  2JVG A;  4CYC A;  1ZHF A;  4U0V A;  2DOD A;  1MH3 A;  4WF2 A;  1IV8 A;  2OPT A;  5E20 A;  1Y1W J;  2GXB A;  1HOM A;  1V5F A;  2DJI A;  4P96 A;  1MMD A;  4MHG A;  2R7U A;  5FKL A;  2ZC2 A;  4M3B A;  2VC1 A;  1BI3 A;  2BY0 A;  2HDC A;  4NQW A;  4BE2 A;  1WRJ A;  1YW7 A;  4OIN F;  4P1W A;  1IRF A;  4CGZ A;  2L2O A;  1WJA A;  3TW7 A;  3GUD A;  3O8H A;  3TMO A;  3ZGK A;  2KIM A;  4A3J J;  4S0H B;  3J81 Z;  2EZI A;  2VBY A;  2BEO A;  3IH4 A;  3GEZ A;  3V42 A;  3M8J A;  3LWF A;  5HLG A;  3ELK A;  3EYY A;  3KP6 A;  3TDU C;  3VWB A;  2ADU A;  3ZMU A;  1HKT A;  5CVU A;  3TL4 X;  1ZLJ A;  4GXO A;  2JPC A;  5D5W B;  2NNY A;  3F9K A;  1G3Y A;  4OIO F;  1SAN A;  3KP7 A;  1XGN A;  5B1A H;  1KA8 A;  4B48 A;  1R36 A;  4OWR B;  2LR8 A;  2PLY A;  2L5Q A;  2HVR A;  2NOJ B;  2CUE A;  5LRR A;  3LQQ A;  3NEU A;  3CC4 I;  2WV1 A;  1I6X A;  3MVP A;  2CUZ A;  2DMQ A;  3Q0U A;  3L2Q A;  2IGO A;  3HG9 A;  3LSP A;  3RIR A;  4I01 A;  4QPO A;  1EA3 A;  4EJO A;  3PNV A;  4F91 B;  1ZGW A;  3TO9 A;  2EH3 A;  3OYM A;  4A2U A;  1UHW A;  3Q5F A;  2VPR A;  3FXK A;  5IP7 J;  1R1U A;  4PJN A;  1JTY A;  3CCJ I;  1JXS A;  5GAD J;  1O7L A;  1BN5 A;  1QPM A;  4MTE A;  4KDP A;  2ZSH B;  3OOP A;  2W84 A;  1W4M A;  3PUB A;  3IKT A;  4B4C A;  4GDF A;  2XAQ A;  1XMA A;  2L9V A;  1JKP C;  5DUK A;  1W0U A;  1IRX A;  1MMN A;  1WKM A;  1K61 A;  1FYM A;  1E3P A;  3BCB A;  1R1V A;  4D5F A;  5BPD A;  3CLQ A;  3AAF A;  3ABM H;  2VQG A;  2MH9 A;  4YFK F;  4RM3 A;  2CSO A;  1OYY A; 
#chains in the Genus database with same CATH homology
 4ZZL A;  1KQ8 A;  1WI9 A;  4G6D A;  3Q9S A;  4UNO A;  3V7S A;  1UCR A;  3IWF A;  2KRF A;  3TO6 A;  1KU3 A;  2XV4 S;  4M9Z A;  1Z6T A;  2FF4 A;  5LLQ A;  2ZFW A;  2E7X A;  2VBX A;  1S3J A;  2HS5 A;  1ZGA A;  1P4W A;  3TKY A;  4L18 B;  2VXZ A;  1Z7U A;  4I02 A;  3C3W A;  2R3S A;  1HST A;  1UST A;  1EV7 A;  1W5S A;  2F2E A;  3LA7 A;  3LA3 A;  1F1Z A;  4I0B A;  2VOO A;  1SMT A;  2O6G E;  2CYY A;  4Q4Z F;  4DNC A;  4S05 A;  3E3V A;  4MGR A;  3EET A;  1BM9 A;  3HSE A;  1J0R A;  1ZYR F;  2K7L A;  3RKY A;  1L0O C;  3CUQ C;  1XD7 A;  5LHH A;  3E97 A;  2P6S A;  4M74 A;  3KEQ A;  4PGG A;  3J80 Z;  1BC7 C;  2YX7 A;  2CO5 A;  5DYM A;  3M1E A;  1P4A A;  1JHF A;  1R00 A;  3ISP A;  4M9X A;  1OR7 A;  3V8J A;  1O57 A;  2G9W A;  2QLZ A;  2ZNY A;  3ZPL A;  3K69 A;  3T5X A;  4BHC A;  3QU6 A;  1LDD A;  3F8M A;  4B09 A;  1MZB A;  3WTU C;  3MQ0 A;  4UVC A;  1T98 A;  1GHC A;  2XRO A;  5DCF A;  4P55 A;  2A69 F;  1S7O A;  3QOP A;  1BC8 C;  3WTX C;  2BE5 F;  4FT8 A;  4HQE A;  1LJ9 A;  5F64 A;  4RB1 A;  1DP7 P;  4Q48 A;  1MJB A;  4M73 A;  4CO8 A;  2GXG A;  4A5N A;  5E18 F;  3WGH A;  4KT5 C;  1YG2 A;  3BOQ A;  4WCG A;  1LNW A;  3DF8 A;  5CVR A;  4EGZ A;  2OZ6 A;  3RDI A;  2QYO A;  2L4A A;  1JHH A;  3RPQ A;  1W7P B;  4GCV A;  1U5T A;  3P9I A;  2FNA A;  2FMY A;  2WWY A;  2G7U A;  2FXA A;  2LNB A;  2K02 A;  2K86 A;  4LG0 B;  2FQ3 A;  4BNC A;  2COM A;  3DPT A;  4JBA A;  6PAX A;  4PDK A;  1QQI A;  1UFM A;  2NNN A;  5DUI A;  2IRF G;  2L3D A;  4KMF A;  3ABU A;  4FX0 A;  3QPH A;  1MJA A;  2IA2 A;  1R7J A;  4WXC A;  2DLL A;  3U1D A;  4RB2 C;  1H9T A;  2GAU A;  2F5D A;  1IF1 A;  2FE3 A;  2IPQ X;  4M71 A;  1QBJ A;  5HS8 A;  3KEO A;  4IRG A;  5ED4 A;  2ZME A;  2CW0 F;  3BWG A;  2O03 A;  3RJP A;  3L00 A;  1FPQ A;  1NHA A;  2O0Y A;  3HSF A;  2E1C A;  1B4A A;  4A5M A;  5A2Q K;  4GO1 A;  1AWC A;  1U5T C;  4LD5 A;  4EMS A;  1FBU A;  1T6S A;  3HHH A;  3F8F A;  5BS6 A;  1K6O A;  4XSX F;  4HDU A;  1Z6R A;  1TW3 A;  3HYI A;  1ZRE A;  3KE2 A;  4N9H A;  4G6Q A;  4XLP F;  3CJN A;  3F21 A;  1SFX A;  3GXO A;  3FM5 A;  5E1W A;  5LEK A;  3QP5 A;  1HKQ A;  4HZF A;  1PP8 F;  3K1M A;  2HR3 A;  2W24 A;  4RGX A;  4U7B A;  2CGP A;  1J2X A;  2DPD A;  3QAH A;  3ZMD A;  1QZY A;  2A5Y B;  3PQK A;  4M72 A;  4BXU A;  3SXY A;  2HQR A;  2Y75 A;  1GXQ A;  1STZ A;  2QUF A;  3R4K A;  4KIF A;  1B1B A;  1FP1 D;  2GIV A;  3F23 A;  1ZLK A;  2XIG A;  4UUV A;  3V8L A;  2AXL A;  5ILU A;  1KU9 A;  4LGW A;  5H6R A;  4U0Y A;  1VTN C;  1SD4 A;  3HRM A;  3IHU A;  1RUO A;  2HQN A;  1R58 A;  4IRH A;  1WSU A;  5LGT A;  3L7W A;  4HLY A;  3BRO A;  3FMR A;  3ZN1 A;  3I59 B;  4JQF A;  1BI1 A;  3IC7 A;  1R5H A;  2GA1 A;  2XAG A;  1YLF A;  2HKO A;  5KK1 A;  3HOS A;  3WU0 A;  2HTS A;  3RYR A;  2IT0 A;  1OPC A;  3FMQ A;  1YW8 A;  2NRA C;  2IVM A;  2RC4 A;  3GF2 A;  4LLG F;  4GGG A;  3FXQ A;  2VE9 A;  1A04 A;  4OMY A;  1RIO H;  1YW9 A;  4HYE A;  5HDK A;  2OQR A;  5ICC A;  4KNY A;  3DEU A;  5HVQ C;  3FZV A;  2KIF A;  3KP2 A;  3I64 A;  4R79 A;  2UWM A;  2STW A;  5IT3 A;  2A61 A;  2HWV A;  2Y48 A;  4LB6 B;  3IRR A;  1IZ1 A;  4ENJ A;  1QNT A;  2RQP A;  3LST A;  5BPI A;  3KCC A;  2BYV E;  3GO5 A;  1FC3 A;  3T8T A;  3L9F A;  3ZMT A;  3M8E A;  1MJ9 A;  1RNL A;  3BJA A;  4KFC A;  3KLO A;  4OIQ F;  2HTJ A;  3MZY A;  1ZG3 A;  2MA3 A;  4KIC A;  3IRQ A;  2FSW A;  1IRG A;  3FHZ A;  1LQ1 A;  3BJO A;  2VBZ A;  4BYY A;  3I58 A;  3VFZ A;  2W85 A;  5AON A;  5HLI A;  2XRN A;  4D0P A;  1P6R A;  3T0Y A;  1BBY A;  3K1P A;  1SD5 A;  1U2W A;  3MEX A;  1OYI A;  2M1B A;  4EM0 B;  4LFU A;  4A0Y A;  1CGP A;  2Q8K A;  2P5L C;  3VB2 A;  3E6B A;  5LHG A;  2F5F A;  2P4W A;  3JAM K;  1RUN A;  1BOA A;  2RKH A;  5DV5 A;  2PMH A;  5D5V B;  2D45 A;  2Q2E A;  2KIU A;  1R1T A;  1OKR A;  1I27 A;  1S29 A;  1HW5 A;  2PG4 A;  5LEJ A;  5LHI A;  1T39 A;  4P5O A;  3BPX A;  3L2C A;  2P5V A;  3KLN A;  2FNP A;  5CVV A;  3CDH A;  2MLG A;  3P7N A;  3V7R A;  1OMI A;  1I5Z A;  4OIR F;  4L0Y B;  5IT9 Z;  2D2W A;  2XGX A;  1ZG5 A;  5HDG A;  3K1N A;  4E70 A;  4OU0 A;  4Q47 A;  4WXD A;  3VOE A;  1LDK B;  4HF0 A;  4ASN A;  2V1U A;  4RGS A;  1HW2 A;  3P9K A;  4EJW A;  2MBF A;  1BIB A;  4HOB A;  4RB3 C;  5L3B A;  4FHT A;  2YX4 A;  3EUH A;  4HLX A;  2DBB A;  4LLL A;  4Y17 A;  2JTV A;  3DQV C;  3TQN A;  4JK1 X;  2XAH A;  1HBX G;  5K5O A;  2IJL A;  4Z2Y A;  4EQQ A;  2GZW A;  3ULQ B;  5K5R A;  2L02 A;  4RAZ A;  4B8X A;  3VEP A;  1SD7 A;  2JSC A;  2ELH A;  3CUQ A;  4UXN A;  5F1R A;  5CYV A;  4ZH4 F;  3WU1 B;  3J7A O;  1C0W A;  4PCQ A;  2LDU A;  3ML6 A;  4RGR A;  4R1H A;  5J6X A;  1EH7 A;  1MKM A;  3MZH A;  1J75 A;  1ZRC A;  1BIA A;  2GA2 A;  4ETS A;  1LDJ A;  4MQ9 F;  3WTT C;  1SFU A;  4P9F A;  3FWE A;  2UZK A;  4MNU A;  4WWC A;  2G7H A;  3R0A A;  1BI0 A;  2QEN A;  4K2E A;  3RPU A;  2XHK A;  3F72 A;  1U5T B;  1QGP A;  2FBI A;  1S6L A;  3FX3 A;  3T8R A;  1ON1 A;  2R7D A;  3WE2 A;  3GX4 X;  5AIQ A;  2V79 A;  4IHT A;  3I5U A;  4MTD A;  3GWZ A;  5HDN A;  1HW1 A;  2F5E A;  2VT2 A;  1FY7 A;  2GQQ A;  1Z1D A;  3WGI A;  4NHJ A;  1FBS A;  2EJR A;  2OD5 A;  1XSX A;  3HRT A;  1KU2 A;  5KVR A;  4AVP A;  1K79 A;  2YR2 A;  4Y13 A;  2ZME B;  1FX7 A;  1HKS A;  1TNS A;  2RNJ A;  4CYD A;  4IF4 A;  3I0T A;  1G3S A;  1SFE A;  5FO5 A;  1FYK A;  4CZZ A;  3E6C C;  4HQM A;  2HFH A;  4LK0 F;  5ILV A;  3JW4 A;  5D4S A;  3I54 A;  1LB2 A;  3CO6 C;  2XAS A;  1Z9C A;  4UVA A;  2NAZ A;  1B59 A;  1MDM A;  4BHB A;  2L54 A;  3J81 K;  3T1B A;  2X4H A;  1W5T A;  4OOI A;  3E6M A;  4YII A;  1TBX A;  1ON2 A;  1WWX A;  3CUO A;  3KET A;  5DCM A;  4EJU A;  4P9U A;  5EEG A;  4KUM A;  4LJZ F;  3IL2 A;  2IW5 A;  2FU4 A;  1IN5 A;  2BV6 A;  2VC0 A;  1KQ0 A;  3SZP A;  1KYZ A;  1U6G A;  1XSD A;  4IJA A;  5CVI A;  3F8N A;  2ZCW A;  3VOD A;  2KJB A;  5FLX Z;  3GLX A;  4U0W A;  4L9J A;  5D8K B;  2CWE A;  4ZYE A;  1SD6 A;  1O3T A;  3CLO A;  2UXN A;  4KN4 X;  2MD5 A;  4I09 A;  2P7V B;  3JTG A;  3O2P E;  4IXA A;  1IXR C;  1U78 A;  1R22 A;  1DDN A;  5L3G A;  1Q1H A;  1P92 A;  1B9M A;  1KQ9 A;  2OBP A;  4UV8 A;  4IPA A;  5DDG A;  3U9G A;  4MEY F;  3BP8 A;  3I71 A;  3H92 A;  5E1X A;  4ZZD A;  2M30 A;  4HF1 A;  2QZ8 A;  2IP2 A;  1ZN2 A;  2EWN A;  2NS0 A;  1T38 A;  4A6E A;  2FBK A;  4IVN A;  3REO A;  2CQK A;  4M6Y A;  4O3M A;  3W6J B;  4EV0 A;  2IA0 A;  2OAZ A;  3RTR A;  4U88 A;  1Z91 A;  3IWZ A;  1ZGJ A;  4HW0 A;  4G7O F;  5TRD A;  2GWR A;  1O3S A;  4AIK A;  4WK8 F;  4HA8 A;  5H20 A;  4G9Y A;  1X3U A;  4ESB A;  2A68 F;  2A3S A;  2MH2 A;  1J59 A;  4RS8 A;  1YS6 A;  4LK1 F;  1ODD A;  1S7A A;  2X0L A;  2M8E A;  1I1G A;  4XLN F;  2V9V A;  3J80 K;  4TV7 A;  4WXH A;  4A6D A;  1U8R A;  3WTW C;  2JPB A;  3GYH X;  5ICG A;  1R5G A;  4BH9 A;  2PFB A;  3WOD F;  3P9C A;  1YIO A;  3MFK A;  2RVC A;  3COA C;  4I98 B;  5BQT A;  5K1Y A;  4YFN F;  5ICE A;  3LQR A;  1FSE A;  3LA2 A;  1KU7 A;  4EGY A;  2EFN A;  1HSJ A;  1XCV A;  5BMZ A;  3IKV A;  3DP7 A;  1ULY A;  1IW7 F;  4HV6 A;  5FGM A;  1IUY A;  1D3Y A;  3HHG A;  2Z5U A;  4O5V A;  5LRS A;  4Y15 A;  2HZT A;  2STT A;  4YIF A;  2PI0 A;  2ISZ A;  1IN4 A;  4F7Z A;  3TO7 A;  2P7C B;  3ZN0 A;  3SQN A;  1ONV A;  3CTA A;  3RI4 A;  3H3Z A;  3QU3 A;  3G73 A;  5HS9 A;  2D1H A;  4KIG A;  2QQB A;  2M45 A;  5FFX A;  1ZRF A;  1YTY A;  2KJC A;  1T0F A;  2P5K A;  2JT1 A;  5EEH A;  4MEX F;  2QBY A;  5BOX A;  3NRV A;  3M8F A;  1SAX A;  2EA2 A;  3SHF A;  2ISY A;  5D6E A;  4AWX B;  1F5T A;  2H6B A;  5HS7 A;  1YQA A;  4L9V A;  5CLS A;  2YSR A;  3FXU A;  3WG9 A;  4KYW A;  3ZQ7 A;  2DTR A;  2ZXJ A;  1TW2 A;  5JVT A;  2RN7 A;  3V8K A;  3NQO A;  4BHP A;  2MC3 A;  2DQR A;  1FOK A;  3N97 A;  4CHU A;  2A6E F;  3WTZ A;  1JE8 A;  2ACJ A;  3HRU A;  2MLK A;  1ZG1 A;  4L0Z B;  2NYX A;  5E8G A;  3ERE D;  4XBF A;  2DI3 A;  3TOA A;  2YPR A;  2FA5 A;  2PJP A;  1FSH A;  5HOO A;  4BAY A;  3I53 A;  3C1D A;  5L3C A;  5LBQ A;  3HOT A;  3BZ6 A;  1YYV A;  4HDV A;  2ZJ2 A;  1J5Y A;  3O3K A;  1IXS B;  3ZMS A;  2WTE A;  4EM1 A;  4GYG A;  2HEO A;  1YO5 C;  3CUQ B;  5K5Q A;  2XKP A;  3B73 A;  2L4M A;  5LGN A;  4AD9 A;  3EQL F;  3WTY C;  5DEQ A;  2B0L A;  5JI6 A;  1FNN A;  3HRS A;  3ECH A;  2FRH A;  3CO7 C;  3E6D A;  1XGM A;  2BBY A;  3BY6 A;  2K27 A;  4GYI A;  2YU3 A;  1Y0U A;  1CF7 A;  4IRI A;  5E1Z B;  2VOP A;  5JR3 A;  2OZU A;  1O3Q A;  3RYP A;  5E17 F;  4I7H A;  1QO0 D;  1K78 A;  1P4X A;  2V1D A;  4ON0 A;  4HAM A;  3TGN A;  1FT9 A;  4UV9 A;  1XDU A;  3JTH A;  1OYW A;  3MCZ A;  3W6K B;  3FMS A;  2LF7 A;  3L09 A;  2LKP A;  2HYF A;  2L01 A;  1TQI A;  2DK8 A;  4L9N A;  1ZAR A;  3GZ5 A;  4PZJ A;  2XVC A;  1TQP A;  2FML A;  1TLH B;  5CVJ A;  1F4K A;  2HGC A;  1RZ4 A;  2TDX A;  2ESN A;  3O6B B;  5D5X B;  1AOY A;  5F6F A;  3M7G A;  4MQV A;  2R7F A;  4XRF A;  2LSO A;  2HOE A;  3KFW X;  3KZY A;  1D8J A;  2EV6 A;  5AIP A;  4QLC U;  3ZMZ A;  1G6N A;  3TDZ C;  1TQM A;  2UXX A;  5FD5 A;  3R61 A;  3H3U A;  2XAJ A;  2EFW A;  2Z33 A;  1LEA A;  4QWQ A;  3BJ6 A;  1P2F A;  2H09 A;  2O61 A;  1MDM B;  1KGS A;  2DFI A;  2DO7 A;  3ZP5 A;  1S8N A;  2E7W A;  4PGH A;  4KIB A;  5JFR A;  4WX9 A;  3WE3 A;  3F8C A;  1K7A A;  5A2Q Z;  5DD4 A;  3F22 A;  4A0X A;  4ESJ A;  1ZH5 A;  3N4M A;  4KMU X;  2VBW A;  1DPR A;  2O3F A;  5DCM B;  1FLI A;  4A0Z A;  2K4B A;  5L3F A;  1GVJ A;  3GZ6 A;  3ZMV A;  4CDG A;  3MWM A;  2P6T A;  3DXJ F;  4HV5 A;  4G7Z F;  4HX8 A;  1BI2 A;  4YG2 F;  1IN8 A;  1G3W A;  2ESH A;  2DU9 A;  2M5W A;  2EV0 A;  4HX7 A;  5J8F A;  4EM2 A;  5TJJ A;  2EB7 A;  1FBQ A;  1PP7 U;  4A12 A;  4Q5S F;  2VOD A;  3G3Z A;  2W57 A;  1DPU A;  1IN7 A;  2IA1 A;  2PQ8 A;  2OA4 A;  3E5Q A;  4EJV A;  2DPU A;  4HBL A;  4H0E A;  3EDP A;  2XKO A;  1XB4 A;  1XSV A;  1T2K A;  4BQA A;  4LB5 A;  2VE8 A;  2FEZ A;  3HTU A;  2HYG D;  3RKW A;  3GFJ A;  1E17 A;  3HSR A;  3C7J A;  2EFP A;  3GFM A;  1WQ2 A;  4IHS A;  2JZY A;  3M9A A;  4KA4 A;  1FWZ A;  4RB0 A;  2ETH A;  3F3X A;  5IT9 K;  3JSP A;  2V1X A;  1UB9 A;  3LAJ A;  4AIH A;  3GVA A;  2J5P A;  1LEB A;  2BGC A;  2EFQ A;  2JRT A;  3FF5 A;  4U7D A;  3DV8 A;  4ZYH A;  3KZZ A;  2ZNZ A;  1KYW A;  5HLH A;  4ESF A;  4CXF A;  3BDD A;  2W25 A;  1BJA A;  3LAP A;  3OV8 A;  3DFG A;  3K2Z A;  3F8B A;  1V3F A;  3R60 A;  5D6F A;  3K9T A;  4EVI A;  3WTS C;  5L3D A;  4KN7 X;  1I1S A;  1TTY A;  2H94 A;  1IN6 A;  4OIP F;  2EA4 A;  5D8L B;  4N0B A;  3ROU A;  1H0M A;  2WV0 A;  2HKX A;  1B6A A;  3HTS B;  3LFK A;  4XSZ F;  4DQ2 A;  1XGO A;  2FBH A;  2P8T A;  4LMY A;  2PN6 A;  1UHM A;  3K0L A;  3S2W A;  1D8K A;  1J7K A;  3ECO A;  2QWW A;  2LF8 A;  2XUB A;  2QQ9 A;  2RDP A;  5H6Q A;  2EFO A;  1FP2 A;  3KP4 A;  3V7C A;  3R6S A;  4M6X A;  1USS A;  2FOK A;  4G8X A;  1XMK A;  4L5I A;  2KKO A;  5ICF A;  4ENM A;  1MD0 A;  2DQL A;  2E1N A;  2J5O A;  3QP6 A;  2VON A;  3JAM Z;  3SZT A;  2RGV A;  1D5V A;  5FFZ A;  4L9T A;  3JSO A;  4I2O A;  3B02 A;  2A07 F;  2QBY B;  1EH6 A;  4R8H A;  2Y0M A;  4RAY A;  2QVO A;  3E5X A;  1XN7 A;  2M87 A;  3Q9V A;  4YFX F;  1W7P A;  5D5U B;  1ZRD A;  4HF2 A;  4NB5 A;  2H27 A;  3DKW A;  4LG0 A;  2OQG A;  1U3E M;  2Z3Y A;  1G4D A;  3FXR A;  1EH8 A;  1O3R A;  1TNT A;  2DAO A;  1Z05 A;  1QZZ A;  4I0A A;  2EV5 A;  2WC2 A;  2H6C A;  4UVB A;  3MAJ A;  2DW4 A;  2EK5 A;  3QRF F;  4UHT A;  3DPL C;  1L3L A;  1RI7 A;  2ZBK A;  3I4P A;  3R0J A;  2OU2 A;  4L5J A;  4M9S A;  5E8I A;  1LVA A;  3E5U A;  3GFI A;  1XGS A;  1H9G A;  3KP3 A;  2VN2 A;  3U2R A;  4ZYG A;  2O8X A;  2Q0O A;  5CJ9 A;  2VT3 A;  1J9I A;  3HIF A;  2ZO4 A;  4LLN A;  3FM3 A;  5LGU A;  3F6O A;  4ENN A;  4G94 A;  4FX4 A;  2PBI A;  2DK5 A;  3QPT A;  3WGG A;  2RV8 A;  2XAF A;  1XDS A;  3PFI A;  1PDN C;  4HX4 A;  5FLX K;  4EJT A;  4ZYD A;  1W7P D;  1CF7 B;  1FYL A;  3D5L A;  2K4J A;  2DT5 A;  2V6C A;  3GFL A;  4N9I A;  2F5C A;  3F6V A;  5D4R A;  1K78 B;  1REP C;  3BPV A;  4CIC A;  1XCB A;  1PUE E;  3EYI A;  1IAW A;  1F9N A;  5ILS A;  2D1V A;  3HUG A;  3RKX A;  5J8C A;  2ZKZ A;  1HQC A;  3WTV C;  3PQJ A;  3V4G A;  1G3T A;  2Z9O A;  2A6H F;  3C18 A;  2QQA A;  3GW2 A;  2CFX A;  5FB2 A;  1ZAO A;  4OMZ A;  1GXP A;  2AS5 F;  5DD8 A;  1FZP B;  3TOB A;  1YS7 A;  5JHU A;  2Z99 A;  2PEX A;  5ERI A;  1E2X A;  2C6Y A;  4S04 A;  1HXD A;  1R23 A;  4AIJ A;  3SFZ A;  1B9N A;  5L3E A;  1IXC A;  1YFH A;  2QM3 A;  2PMU A;  4ENK A;  3I59 A;  1MGT A;  3D0S A;  4G7H F;  3KP5 A;  4O6J A;  3ABT A;  1JGS A;  1SMY F;  1V4R A;  5FD6 A;  1O7F A;  1DUX C;  4RGU A;  2CG4 A;  1ZHF A;  4U0V A;  4WF2 A;  5E20 A;  2GXB A;  4P96 A;  4MHG A;  2VC1 A;  1BI3 A;  2HDC A;  4NQW A;  1WRJ A;  1YW7 A;  4OIN F;  1IRF A;  4CGZ A;  3GUD A;  2KIM A;  3J81 Z;  2VBY A;  2BEO A;  3GEZ A;  3LWF A;  5HLG A;  3ELK A;  3EYY A;  3KP6 A;  3TDU C;  2ADU A;  3ZMU A;  1HKT A;  5CVU A;  1ZLJ A;  4GXO A;  2JPC A;  5D5W B;  2NNY A;  1G3Y A;  4OIO F;  3KP7 A;  1XGN A;  1KA8 A;  1R36 A;  2PLY A;  5LRR A;  3LQQ A;  3NEU A;  1I6X A;  3RIR A;  4I01 A;  4EJO A;  3TO9 A;  4A2U A;  1UHW A;  3Q5F A;  1R1U A;  1JXS A;  1O7L A;  1BN5 A;  1QPM A;  4MTE A;  4KDP A;  3OOP A;  2W84 A;  1W4M A;  3IKT A;  2XAQ A;  1XMA A;  5DUK A;  1WKM A;  1FYM A;  1R1V A;  5BPD A;  3AAF A;  2MH9 A;  4YFK F;  2CSO A;  1OYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...