2D45A

Crystal structure of the meci-meca repressor-operator complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
TYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(P*TP*AP*CP*TP*AP*CP*AP*TP*AP*TP*GP*TP*AP*GP*TP*A)-3'
publication title Structure of the MecI repressor from Staphylococcus aureus in complex with the cognate DNA operator of mec.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 31
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2d45A01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 2d45A02
1S7OA 3VFZA 2R7DA 1BN5A 3W6JB 2VODA 2IA1A 1XMKA 4LJZF 2G9WA 1TNSA 2KIFA 1T39A 5L3CA 1FSHA 3ZPLA 3WTSC 2L4AA 2G7UA 2E7XA 4PDKA 3TDZC 1C0WA 2VBZA 2MC3A 4JQFA 3WODF 2XGXA 4EQQA 4O6JA 1REPC 3E6DA 1HSTA 2F2EA 1LJ9A 4CYDA 1KYWA 5DYMA 5ILSA 4UV8A 2IA2A 2P7CB 1R1VA 3PQKA 2HR3A 5CYVA 3R6SA 4A12A 1WSUA 4ZZDA 2P8TA 3K69A 1FP2A 1FX7A 1P2FA 2XKOA 2P6TA 4U7BA 2UZKA 2D1VA 2XHKA 2DLLA 1DUXC 3S2WA 4WCGA 4MGRA 4M72A 4BHBA 1V4RA 5IT9K 4NQWA 1SD5A 5L3DA 3HTSB 2XKPA 5CVIA 3GFJA 2RKHA 2IW5A 1BIAA 5F1RA 1DDNA 4Q4ZF 4P9UA 1XDSA 4IJAA 1R58A 1Y0UA 3O2PE 4UNOA 2BYVE 1SD7A 4LG0A 1J5YA 1ZH5A 1R1TA 5JR3A 3RI4A 5LRSA 3E3VA 2ZNZA 4PGHA 2H27A 2PQ8A 3U9GA 2PFBA 3M8FA 1GXPA 3JTGA 2EV5A 3NEUA 3FXQA 1ZGAA 2RQPA 3KLOA 4RB2C 3RPQA 2QZ8A 4XBFA 4ON0A 1W7PD 2ESHA 3ISPA 3MZHA 2RV8A 1A04A 3KE2A 4U0VA 5L3FA 1IAWA 2O61A 4OIQF 2FF4A 4P55A 2ETHA 3EDPA 2WV0A 2VC1A 3HRUA 1ZRFA 2ZO4A 4YFNF 1DPRA 5CVJA 1I1GA 2HFHA 2ISZA 2EFPA 4RGRA 6PAXA 1USSA 1MJ9A 3C3WA 4BH9A 3K1MA 2P5VA 3OV8A 4JK1X 2KJBA 2ELHA 5CLSA 2MBFA 3IL2A 2OA4A 2BEOA 2Z5UA 4EJUA 1Z91A 2QQBA 3AAFA 4EJTA 3ECHA 2D45A 2K86A 4FX0A 3IHUA 4ZZLA 4RGXA 2CSOA 4A5NA 2A6EF 2CFXA 2LF7A 1GHCA 4CDGA 2PI0A 1D5VA 3BPXA 1XSVA 1FC3A 1ON1A 1XB4A 2QLZA 1YS6A 2FBHA 2A69F 2OD5A 4N9HA 5E1WA 1SAXA 4EV0A 4U7DA 1XGSA 3EQLF 5FGMA 4Z2YA 2ZMEB 2FXAA 3GZ6A 1OR7A 2LKPA 4MQ9F 4RGSA 1BIBA 4UHTA 2FNAA 1QO0D 2KIUA 4OU0A 4RGUA 3ML6A 2Y48A 2DPDA 1HKQA 2J5OA 4HF1A 4Q47A 1GVJA 4KN4X 2A61A 4ENNA 2ZBKA 3WTTC 3WGHA 4GCVA 4LD5A 3BOQA 5DUIA 4I09A 4IHTA 1XCBA 1RI7A 1XMAA 3ABUA 2FA5A 1U8RA 4KUMA 4EJVA 2Z3YA 1FBUA 1QQIA 1DP7P 4LLLA 2CQKA 2GA1A 3W6KB 4ZYEA 2Z33A 4L9TA 2K4BA 1T98A 4RB0A 5DDGA 3R61A 4L0ZB 5HDKA 3M1EA 3PQJA 1EH8A 3JSOA 3H3ZA 1I6XA 1PP8F 3IC7A 1OYYA 1IF1A 1OYIA 1VTNC 2XAGA 3I0TA 4Q48A 3TDUC 4AVPA 4O3MA 2L54A 4O5VA 1G3SA 4OMZA 3SQNA 3T8RA 3JW4A 2XVCA 5CVVA 3FM5A 4F7ZA 2QVOA 3DP7A 5ICFA 4PCQA 4B09A 5HS9A 3U2RA 2XROA 3WTYC 4G6DA 4BXUA 1FSEA 4HZFA 5AIQA 2CWEA 5L3EA 5ERIA 2OBPA 3GWZA 1TTYA 5LGTA 1G6NA 3T0YA 3KLNA 3ZMTA 2XV4S 1XGNA 1R22A 4WXHA 3F6VA 4EM1A 2V1XA 2LDUA 2H6BA 5BPIA 1IN4A 3N97A 2DTRA 3IRQA 5JHUA 5IT9Z 4I0AA 2YX4A 3LQQA 1HXDA 4TV7A 3J81K 1UHMA 1FWZA 1O7FA 5FO5A 1K6OA 3CUQB 2HDCA 2M45A 1D8KA 5IT3A 1FYLA 4LGWA 1SD4A 3J7AO 1QZYA 2H94A 5TJJA 1KA8A 1YW8A 3VOEA 2RVCA 1TW2A 4HQEA 2DFIA 3G73A 3LA3A 2DO7A 5ILUA 1FLIA 2RN7A 3WGGA 4EM2A 3ZQ7A 3E5QA 5LBQA 4Q5SF 5DUKA 1V3FA 2D1HA 3E97A 2IA0A 2Q8KA 4EVIA 2Q2EA 3LAPA 3Q9VA 5FD5A 4P5OA 1MDMB 2RC4A 2NAZA 1ULYA 3ZMSA 3I4PA 4CO8A 1G3WA 2W25A 1S3JA 1STZA 1NHAA 2DQLA 1FYKA 2PMHA 5LHIA 4G8XA 3DQVC 1SFEA 3HHGA 2JPBA 3DV8A 1PP7U 2Y0MA 2PG4A 1Z6RA 2XAHA 1B59A 1UFMA 1IRGA 2LNBA 4G6QA 3U1DA 4AIKA 3N4MA 4S05A 2OU2A 1HKSA 2E1NA 2QWWA 2QENA 2DK8A 1Z6TA 2EJRA 2QQAA 5EEHA 2EWNA 3WGIA 2XAQA 3CO6C 4UVAA 3DKWA 3TGNA 4XSXF 1ZG1A 3O6BB 2DQRA 3CO7C 3HUGA 3JTHA 3QP5A 2V79A 4FHTA 1JHFA 2OZ6A 3FXUA 4Y17A 2ISYA 4BYYA 4KA4A 5D5WB 4HLYA 2IT0A 4BNCA 4B8XA 1W5SA 1BI3A 1YFHA 4KIFA 1IN7A 3LAJA 5DD8A 4DQ2A 4BHCA 4OINF 1I5ZA 2HOEA 2GWRA 3HSEA 4LFUA 1FOKA 2COMA 4M9ZA 4ETSA 3E6BA 2MH9A 3EUHA 1D3YA 3EETA 2L01A 2VN2A 4OOIA 3ABTA 2X4HA 5E8IA 3WTZA 2M8EA 3R4KA 3BY6A 1JXSA 5DCFA 3T1BA 5FB2A 3WTXC 2BBYA 4N0BA 2DI3A 3KEOA 1P6RA 1BC7C 1BI0A 2JT1A 2NNNA 4NHJA 1H0MA 5E1ZB 1BJAA 2RNJA 2VOPA 3V8KA 4LG0B 3NRVA 3WE3A 5FFZA 2F5EA 2EFQA 3F8NA 5D5XB 2VBXA 4PGGA 2ZXJA 3K1NA 2GZWA 3JAMK 3L9FA 3EYIA 2J5PA 1HQCA 1CGPA 2UXNA 4KYWA 3SXYA 1KU7A 2R7FA 3RKWA 3BWGA 2QUFA 2YR2A 3KP5A 4RAYA 3FWEA 1E17A 2W24A 4G7OF 4XSZF 4I7HA 5HLIA 2Y75A 2UWMA 1KGSA 1CF7A 4RAZA 4UVCA 1EH6A 1TQMA 2HQNA 5LHGA 1QNTA 3J81Z 1MD0A 5E20A 3ZMUA 5H6RA 3F8FA 5L3GA 2ZNYA 2P5LC 5H6QA 2EA2A 5LEKA 1YO5C 2VT3A 2RDPA 4JBAA 3MAJA 1XSXA 4YFKF 1Z9CA 1B9NA 1ODDA 3QRFF 1IN6A 2M5WA 3HSRA 4KIBA 2ZCWA 4GO1A 1FNNA 2P6SA 1LNWA 2NRAC 2BE5F 2B0LA 1TLHB 4R8HA 3HSFA 4HW0A 3IWZA 4RB1A 1U5TA 2QM3A 1QBJA 3TOBA 4KNYA 3B73A 1F5TA 3OOPA 2HQRA 2XASA 3JSPA 4U88A 1PUEE 1YG2A 2TDXA 3FMRA 5K1YA 4A5MA 1KU9A 3MEXA 2HYGD 4EGZA 5CJ9A 5A2QZ 4ZYHA 3QU6A 4BQAA 1XD7A 1XCVA 3KP6A 3DPTA 5JFRA 1JHHA 1RUOA 3I54A 1ZYRF 2DK5A 4U0YA 1U5TC 3KETA 3F8MA 4A6DA 1K79A 1S29A 1TQPA 4LB6B 2E7WA 4ESBA 4IVNA 4I0BA 3MZYA 5ICEA 1RNLA 4AIHA 5E17F 2Z99A 3RKXA 1T38A 2GAUA 1JE8A 2KRFA 2IP2A 1ZG3A 1ON2A 4ZH4F 3C18A 3I64A 3KP4A 3C7JA 3LA7A 5AIPA 4MEYF 5BS6A 5LLQA 3R60A 2EFNA 3FHZA 4WX9A 1HSJA 5ED4A 2FNPA 4AD9A 4CZZA 5D8KB 4I01A 3B02A 5J8CA 5HS7A 3BZ6A 3HRMA 5E18F 2C6YA 4GXOA 2ZJ2A 1YIOA 2RGVA 1KQ0A 1ZLKA 1K78B 5FLXK 1BI2A 1U3EM 3E6CC 1JGSA 1ONVA 3I59B 2DPUA 2EV6A 4OIOF 5F6FA 5LEJA 5DCMA 4HX7A 5DEQA 3GX4X 2M30A 1L3LA 2DT5A 4EJWA 4HQMA 4DNCA 4HAMA 3H3UA 2PLYA 1WI9A 3TOAA 3QPHA 2CYYA 1HW5A 2O8XA 2LF8A 2HKXA 4L5JA 1WQ2A 2MD5A 1PDNC 1DPUA 1W7PA 1S8NA 3I71A 4LK0F 4LK1F 4FT8A 3Q9SA 1QGPA 2MLKA 5J6XA 1IUYA 3V8LA 1CF7B 4MQVA 3BJAA 3JAMZ 1BM9A 3F8BA 1YQAA 2VE8A 2MH2A 3HTUA 4EM0B 1GXQA 3G3ZA 4ZYGA 2G7HA 3VB2A 1IN8A 2FMYA 1BBYA 3F72A 3I5UA 2V1UA 3PFIA 3GFIA 1R7JA 4BAYA 1HBXG 2L02A 3F23A 4HV5A 1MJBA 5HDGA 3HHHA 4LLGF 4LLNA 2HKOA 3F3XA 2MLGA 1EH7A 4ENKA 1G3TA 1B6AA 2QQ9A 2XIGA 1FZPB 1XGMA 3KP7A 3BJOA 3ECOA 1U78A 1O3TA 2AS5F 1R23A 4KMFA 1U2WA 1H9GA 4IXAA 4XLNF 2V1DA 2KKOA 3IKTA 1J2XA 4M9XA 5BQTA 1ZAOA 3ZMZA 4M9SA 1TNTA 3L09A 1YW9A 1ZREA 3CDHA 5D6EA 1Q1HA 3L7WA 4NB5A 1XSDA 2FE3A 3HIFA 2X0LA 5A2QK 5ICCA 4L9JA 4LMYA 2ZFWA 1HW2A 1B4AA 3DF8A 4CICA 1UHWA 2PBIA 4ESJA 3R0JA 5ILVA 3CUQA 2K7LA 4A0XA 3IRRA 1BC8C 2PEXA 4G94A 1FYMA 2K02A 3TQNA 4E70A 2IRFG 1HKTA 1XDUA 2CW0F 1U6GA 2QBYA 3BDDA 4P96A 4CHUA 2ZKZA 3MCZA 3MQ0A 5D5UB 4G9YA 1SFXA 5K5RA 2HYFA 3CUOA 1FT9A 4HX4A 3CUQC 5KK1A 2VC0A 1T0FA 2GXBA 2O6GE 3BROA 1IN5A 2FMLA 1K7AA 1RUNA 5D8LB 5L3BA 1J9IA 2L4MA 5K5QA 5FLXZ 3RTRA 3WU0A 3H92A 1ZRCA 2WC2A 4LB5A 2QYOA 3QPTA 4IRGA 3KP2A 4OIRF 1YLFA 1YS7A 4U0WA 2ADUA 3GZ5A 1J59A 3HRSA 1EV7A 4R1HA 2IPQX 2OAZA 3SFZA 4K2EA 4L9VA 1TQIA 1LEBA 1AWCA 4L18B 2F5CA 2DAOA 1F9NA 3M9AA 1Z7UA 3V7SA 2JZYA 4QWQA 2FBIA 4CXFA 2CO5A 2YPRA 3L2CA 1F4KA 3BJ6A 5LGUA 2STTA 2D2WA 1UCRA 1B9MA 3KZYA 2O0YA 3HYIA 1IRFA 3WTWC 2XUBA 3WTVC 2JRTA 4M6YA 3GO5A 3GUDA 3FXRA 4XLPF 3O3KA 3FM3A 5FFXA 1LDJA 4WF2A 3CTAA 2BGCA 3QU3A 2Z9OA 3GF2A 3L00A 4GGGA 4RS8A 5CVUA 4GYIA 3FMSA 3LWFA 2JTVA 3RPUA 1YTYA 2XAJA 4I98B 4UXNA 2K27A 1R1UA 3QAHA 2FU4A 2IVMA 1U5TB 1FPQA 3HOSA 3V8JA 4BHPA 1TBXA 2XAFA 3NQOA 3LA2A 3TO6A 3ZMDA 3HOTA 3P7NA 3LFKA 3F8CA 4M74A 2AXLA 4S04A 1QPMA 3RYPA 3GLXA 5HLGA 1ZARA 5D5VB 3WG9A 2HWVA 1W5TA 4WK8F 2OQRA 1SFUA 2JPCA 4MHGA 4L0YB 1LDKB 3C1DA 1S6LA 2V6CA 5D4RA 2YU3A 1MKMA 3IKVA 2YX7A 4HDVA 2VOOA 2EK5A 2F5FA 4D0PA 3R0AA 2KIMA 4ESFA 1Z05A 2A68F 1S7AA 2HTSA 5DD4A 3E6MA 3ROUA 2E1CA 1O57A 3KFWX 3DXJF 2EFOA 2HS5A 2FBKA 4A6EA 4IRIA 4MTEA 1IXRC 5F64A 5HOOA 4KN7X 2HEOA 3GW2A 3K9TA 1RZ4A 2GXGA 1J7KA 1ZHFA 4R79A 3IWFA 3M7GA 1MZBA 2GA2A 1FP1D 2H6CA 3F6OA 2VONA 3T5XA 3KEQA 3RIRA 1SMYF 2P7VB 1O3SA 2FQ3A 2ESNA 4ZYDA 3FX3A 3SHFA 2HZTA 5JVTA 4WXDA 4RB3C 3COAC 1FBQA 3GFLA 5DCMB 2P5KA 3LQRA 4Y13A 4KDPA 4IRHA 3ZN1A 2LSOA 3V7RA 5HLHA 2PMUA 2V9VA 1L0OC 3ZN0A 1KYZA 4KFCA 4YG2F 3GEZA 3J80Z 1FBSA 2K4JA 4HX8A 2GIVA 4KMUX 1O3RA 4YIIA 1W7PB 5FD6A 1IW7F 1LDDA 4EMSA 4AIJA 3BP8A 3WTUC 3M8EA 3MWMA 3F22A 5AONA 4IHSA 4HOBA 4I2OA 1P4XA 3GVAA 2L3DA 4A0ZA 5BPDA 1O3QA 2M1BA 2EB7A 3VEPA 1LB2A 2O3FA 5LGNA 1KU3A 2P4WA 4FX4A 3V7CA 5HDNA 2VBWA 2WWYA 1G3YA 1O7LA 1TW3A 4KICA 3RYRA 2YSRA 1G4DA 2KJCA 3RDIA 1OYWA 1XGOA 3KCCA 3FZVA 1R5HA 1QZZA 1USTA 1YW7A 3P9CA 2H09A 3QP6A 2NS0A 4PZJA 1ZLJA 2ZMEA 1W4MA 3TO7A 1H9TA 1RIOH 1IXSB 1WKMA 5HVQC 1F1ZA 3GFMA 1YYVA 1IXCA 4HYEA 1B1BA 3K2ZA 4HBLA 2PN6A 5JI6A 2M87A 1R5GA 3ZP5A 3E5UA 1K78A 2HGCA 4UV9A 3P9IA 2A5YB 2Q0OA 4G7ZF 3I59A 4IF4A 2IJLA 1T6SA 4G7HF 1I27A 2VT2A 3V4GA 1KQ8A 4WWCA 2A3SA 4XRFA 1ZRDA 2WTEA 4AWXB 2UXXA 1LVAA 1FY7A 3TKYA 2VBYA 5DV5A 5H20A 1R36A 2NNYA 1XN7A 3ELKA 5ICGA 3E5XA 3LSTA 1ZG5A 4UVBA 4IPAA 3EYYA 3T8TA 2HTJA 2CGPA 3DFGA 2A6HF 4YIFA 3I58A 4M6XA 3F21A 1ZGJA 2EA4A 4CGZA 2NYXA 4OMYA 3HRTA 1D8JA 2W85A 5BOXA 3K0LA 2STWA 1SMTA 4HA8A 4OIPF 4A0YA 1J75A 1MGTA 3D5LA 1E2XA 2XRNA 1P4AA 4YFXF 1T2KA 4KT5C 2QBYB 1WWXA 2ACJA 5J8FA 1BOAA 5D6FA 4L5IA 5EEGA 1WRJA 5D4SA 1OKRA 3K1PA 4EGYA 2O03A 1LEAA 4GYGA 3TO9A 4N9IA 3QOPA 2FOKA 1P4WA 1MJAA 1R00A 4ENJA 1I1SA 1UB9A 4WXCA 2JSCA 5TRDA 2BV6A 3SZPA 3CJNA 2CG4A 5K5OA 3D0SA 3KP3A 2W84A 1Z1DA 5CVRA 3FMQA 3VODA 2A07F 4A2UA 1ZN2A 2FSWA 2OZUA 4ASNA 4H0EA 4Y15A 4M71A 1HW1A 2OQGA 3WU1B 3RJPA 1OMIA 4QLCU 1X3UA 2R3SA 1P92A 3ERED 1LQ1A 2PJPA 3ZMVA 1BI1A 4HLXA 2DU9A 3CLOA 2F5DA 4HF2A 3P9KA 4P9FA 5E1XA 4MNUA 2FEZA 5LRRA 2EFWA 2VE9A 4M73A 5KVRA 4ENMA 5LHHA 3I53A 3DEUA 3J80K 5HS8A 3KZZA 1IZ1A 2DBBA 4KIGA 1MDMA 4L9NA 3WE2A 4HF0A 1AOYA 3BPVA 2VXZA 3MFKA 2FRHA 3FF5A 3RKYA 4HV6A 5E8GA 4MTDA 1SD6A 4UUVA 3GXOA 1KU2A 4HDUA 2W57A 3REOA 2EV0A 4EJOA 2GQQA 4MEXF 2DW4A 1KQ9A 3DPLC 1OPCA 5BMZA 3SZTA 3Q5FA 1J0RA 3ULQB 2MA3A 4I02A 3GYHX
chains in the Genus database with same CATH superfamily
1S7OA 3CCLI 3VFZA 1K83J 2R7DA 3NARA 1BN5A 3W6JB 2VODA 2IA1A 2KZVA 1XMKA 4LJZF 2G9WA 3CD6I 3OYDA 1TNSA 2KIFA 5JVGF 4GDFA 3B6CA 1SFOJ 1T39A 5L3CA 1FSHA 3SYTA 2NS7A 2A5WA 5IOYA 4XRSA 3JRFA 3ZPLA 2KRCA 3WTSC 2L4AA 2G7UA 2Y9YA 2E7XA 5M3MJ 1V54H 2X1DA 4PDKA 3TDZC 4BDYA 1C0WA 1FOYA 2VBZA 3LSGA 2MC3A 2CU7A 4JQFA 2X85A 3WODF 2XGXA 3BC8A 4EQQA 4O6JA 1REPC 3E6DA 1HSTA 1X1PA 3OIOA 3AG2H 2F2EA 1LJ9A 2NOJB 4CYDA 1KYWA 5DYMA 3DEWA 2QGUA 5ILSA 4F55A 2HXOA 2KPMA 3NWSA 4UV8A 2DA2A 2IA2A 1D1BA 2P7CB 2OTJI 2M2EA 1R1VA 3PQKA 3K6GA 2HR3A 5CYVA 3R6SA 4A12A 1WSUA 4ZZDA 2P8TA 3K69A 1FP2A 1FX7A 2BHZA 1P2FA 2XKOA 2P6TA 4U7BA 3A01B 4A3MJ 2UZKA 3S1NJ 5GPAA 2D1VA 2XHKA 1O4XA 1M1EB 2DLLA 2UV1A 1DUXC 3S2WA 4WCGA 4MGRA 4M72A 4BHBA 3M3YJ 1V4RA 2DMUA 2JWTA 4IO9F 2GOXB 5IT9K 4NQWA 3CJRB 4DYRA 3S3NA 2E60A 1TWHJ 1SD5A 2E5NA 4LG3A 5L3DA 3HTSB 2XKPA 2IAIA 2Y0SN 3GFJA 2RKHA 5CVIA 3OYBA 5GP9A 2IW5A 1BIAA 2E34A 5F1RA 1DDNA 4Q4ZF 4P9UA 1XDSA 4XQFA 4IJAA 4N4NB 4E7ZA 2K5CA 1R58A 1Y0UA 3O2PE 4UNOA 2VUMJ 2BYVE 2KMUA 3N05A 1SD7A 4LG0A 4NBQA 2WAQA 5CKTA 1J5YA 1ZH5A 3S16J 3PIOF 1Z67A 1R1TA 4X1EA 4ZDLA 4EEFG 5JR3A 3RI4A 5LRSA 3E3VA 4CCLA 2ZNZA 4HSTA 4PGHA 2H27A 3W2VA 2PQ8A 3U9GA 4J19A 2PFBA 3M8FA 1GXPA 3JTGA 1T8IA 3BG5A 4CCOA 2EV5A 3WHBA 2HU9A 3NEUA 1UJ8A 3FXQA 5EF6A 1ZGAA 2F48A 3TP3A 3Q0WA 1QVTA 2RQPA 3KLOA 4AYBA 3ZGKA 1MSEC 2LC2A 2LOOA 4RB2C 3RPQA 1VQ8I 1JKRC 4AVZA 4F3QA 2QZ8A 2MW8A 3HC7A 4XBFA 4ON0A 1W7PD 2ESHA 3ISPA 3MZHA 2RV8A 3S17J 1A04A 5B5EC 1FMWA 3KE2A 4PUSA 4U0VA 5FKMA 5L3FA 1IAWA 2JA6J 4OIQF 2O61A 5F0CA 2FF4A 1SVLA 1MBGA 2CW7A 4IOCF 4P55A 4B3XA 2AO9A 5GAHJ 2ETHA 3EDPA 4CA0A 2WV0A 2F4MB 2WB1N 3ZQQA 2VC1A 5K7ZA 1IUFA 3HRUA 2XC7A 2R5ZA 1ZRFA 2ZO4A 4ZTJA 2NOGA 3DU5A 4YFNF 1DPRA 2QEXI 5CVJA 1I1GA 2HFHA 2ISZA 3OYIA 2EFPA 1HC8A 2BHYA 3PSFA 4RGRA 2L9SA 1OCTC 2CQ7A 1U8BA 6PAXA 3A4CA 1USSA 1MJ9A 3C3WA 4BH9A 2PJRA 2VLAA 3K1MA 1EA3A 3PUBA 2Y30A 2P5VA 3OV8A 2KT0A 2KJBA 2QF7A 4JK1X 4J01A 5J47A 2ELHA 3D5RC 5CLSA 2MBFA 2Y31A 3IL2A 2OA4A 2BEOA 2Z5UA 4EJUA 1Z91A 2QQBA 3AAFA 4EJTA 3ECHA 4XONA 2M0CA 4Z6YA 2E2JJ 2D45A 2K86A 4FX0A 3IHUA 3K4LA 4ZZLA 2QKMB 4E7SA 4RGXA 4QPOA 2CSOA 2IS1A 3H35A 4A5NA 2V1NA 2A6EF 2VASA 4EATA 2IGNA 2OF7A 2CFXA 2LF7A 1GHCA 4CDGA 2PI0A 3CMEI 3BPXA 1D5VA 1XSVA 2QCOA 1FC3A 2R7ZJ 2PMZN 4W97A 3BCBA 1ON1A 1XB4A 2XAUA 2QLZA 1YS6A 2KDOA 2MD0A 3OYCA 2OPTA 1R49A 3BG6A 2FBHA 3H1CA 2A69F 3BR2A 2EILH 4FISA 1WJFA 2OD5A 4N9HA 3CF2A 4II2A 4RAGA 5E1WA 5IY5H 9ANTA 2AQEA 1UG0A 5DTDA 3DBRB 5HODA 4X0GA 1SAXA 3IH3A 4EV0A 4U7DA 1XGSA 2X6YA 3EQLF 5FGMA 4Z2YA 5KNLA 4U87A 3S15J 2DMQA 2ZMEB 2IBDA 2FXAA 3GZ6A 1OR7A 2LKPA 3GTMJ 1MW7A 1HCRA 2XB5A 4MQ9F 2Y0SA 4RGSA 1BIBA 4UHTA 1BL0A 2HPIA 2LKXA 4QPQA 2FNAA 4JX4A 2OJED 1QO0D 2KIUA 4OU0A 4RGUA 3ML6A 2Y48A 1VF9A 2DPDA 3CQZJ 4A93J 1U9NA 2HYJA 1HKQA 3LFUA 2VJJA 2J5OA 4HF1A 1QVUA 1RC9A 1GVJA 4KN4X 4Q47A 1W36D 2A61A 1PUFB 3H9QA 4XOTA 4ENNA 2ZBKA 2DA4A 3WTTC 1YJ9I 3WGHA 4GCVA 2M9HA 4LD5A 3BOQA 3L1PA 3GYHX 5DUIA 4I09A 4BJ5C 3TBIA 1XMXA 4IHTA 1XCBA 1RI7A 1XMAA 3K4NA 3ABUA 2FA5A 2IGOA 1U8RA 1OR7C 3SZGA 4BBRJ 3H36A 4KUMA 2Z3YA 4EJVA 1FBUA 1QQIA 2JJ7A 1MMDA 1DP7P 2HNHA 3JRIA 4FCYA 4LLLA 2CQKA 2GA1A 1MH4A 3W6KB 4ZYEA 1WPKA 2Z33A 2LY9A 4L9TA 5CPRB 2K4BA 2VQGA 1T98A 1MNEA 4RB0A 1HOMA 4KISA 4MLOA 2O7OA 4F91B 3L2WA 5DDGA 3CCQI 2I5UA 3R61A 5C4JJ 4L0ZB 1D0YA 5HDKA 2CV1A 3M1EA 2W82A 4A3CJ 3PQJA 4A3DJ 3OOUA 1EH8A 4CYCB 3JSOA 3H3ZA 4C2MJ 1I6XA 2CUFA 1PP8F 3IC7A 1K4SA 1OYYA 3JRDA 2R7SA 1IF1A 3LSMA 1OYIA 2KHMA 1VTNC 5KAFC 2XAGA 1VFCA 2M34A 3J7AY 3I0TA 2WB1A 4Q48A 4IX7A 2ECCA 3TDUC 1ETKA 4AVPA 4O3MA 3HDDA 2L54A 4O5VA 3SDGA 4P1WA 1GV5A 3PUFA 1G3SA 3A1YA 4BXXJ 4OMZA 2E1MB 3WHCA 3SQNA 3PNTA 3T8RA 2IS4A 4PK4A 2LH9A 3JW4A 2XVCA 1OCOH 4PFOA 5CVVA 3FM5A 2R7QA 4UY8I 1SEUA 4F7ZA 2M7AA 3KX2A 2QVOA 3DP7A 5FKNA 1A6IA 1ZQ3P 4Y3OA 3ZQGA 5ICFA 4BY1J 4PCQA 1FIAA 4FETA 4B09A 4HNTA 5HS9A 4A3IJ 2HPMA 3U2RA 2XROA 2B7EA 3WTYC 2HI3A 4G6DA 2GXAA 2MG4A 5EYRA 4BXUA 3OYKA 1ETVA 1GDTA 4IQJA 1FSEA 4HZFA 1OCRH 3GLLA 5AIQA 2CWEA 5L3EA 1X4OA 5ERIA 4XR6A 1YRNA 1S7EA 2OBPA 3CMMA 1TTYA 3GWZA 1G6NA 3NWTA 3Q0UA 3T0YA 2P81A 5LGTA 3KLNA 3ZMTA 3K4JA 2XV4S 1XGNA 1R22A 4WXHA 3FISA 3F6VA 4EM1A 5KHDA 2V1XA 2LDUA 1Y1VJ 2H6BA 3OR2C 1D5YA 3FXLA 1H88C 4RM3A 4UB8C 1JTYA 4XKCA 2DA3A 5BPIA 1IN4A 1A36A 3N97A 4M3EA 3BCAA 2DTRA 3IRQA 4Y52J 5JHUA 5IT9Z 2PMZA 2F4OB 1RPWA 2YU9J 4B43A 3K70D 4I0AA 2YX4A 3LQQA 1HXDA 4TV7A 4BUPA 2M8GX 3J81K 1PJRA 1UHMA 4CCMA 1TZLA 2XPUA 2CV2A 1FWZA 5CQGA 1O7FA 5FO5A 1LE8A 4DJAA 3TL4X 1K6OA 2ECBA 3CUQB 4CCKA 2HDCA 2M45A 4CCNA 1D8KA 5IT3A 1FYLA 4LGWA 1SD4A 1WJDA 3BR0A 2K3FA 3J7AO 1NG7A 4H4KC 5EGOB 3GZNB 1QZYA 2H94A 4QIWN 3JRHA 1I3AA 1F36A 3M4OJ 5M5XJ 3VPRA 5TJJA 2XF7A 1KA8A 2VJ5A 4LIVA 4C3IJ 3RQIA 3UR3C 1YW8A 4Y4RA 3VOEA 3FXJA 3K4CA 3LSIA 2F6CA 4F52A 2RVCA 1OCZH 1TW2A 2XGDA 5J1RA 4HQEA 4NNJA 2DFIA 3G73A 2DYRH 2Z2SB 3LA3A 3I56I 1JTXA 2DO7A 3ZR8X 5ILUA 1FLIA 4E4HA 4B3AA 2EH3A 2XF6A 2RN7A 2LMDA 3WGGA 4EM2A 2MFZA 3ZQ7A 3E5QA 2HZDA 2BXYA 5LBQA 4Q5SF 5DUKA 4A3GJ 1V3FA 2D1HA 3E97A 2IA0A 2Q8KA 2LG4A 4EVIA 2Q2EA 2DA5A 3LAPA 1VQMI 3Q9VA 5FD5A 4P5OA 1MDMB 2CH0A 2RC4A 2NAZA 3CJQB 1GVDA 1ULYA 2EIKH 3S32A 3ZMSA 4Y7NJ 3I4PA 3QWLA 4CO8A 4IZZA 1G3WA 3FIWA 2W25A 1S3JA 2BY0A 4YIRX 1QRYA 1STZA 2VJIA 1NHAA 4XICA 4FTHA 2DQLA 1FYKA 1Z7LA 2PMHA 3AFHA 5LHIA 4G8XA 3W3CA 3DQVC 1D0XA 3PO3J 1GUUA 5EJCA 1SFEA 3IAS2 3HHGA 2JPBA 1APLC 3DV8A 4XK4A 1PP7U 1P9QC 2Y0MA 2PG4A 3HGYA 2N8GA 1Z6RA 1YHQI 2XAHA 1B59A 4DOZA 1UFMA 1VQ9I 1IRGA 2LNBA 4G6QA 3U1DA 3MKLA 5GTIC 4AIKA 3I9V2 4S05A 3N4MA 2OU2A 1YJWI 3FHNA 1ZR2A 2LK2A 1WJBA 1HKSA 4CSWA 4NC7A 2E1NA 1E3HA 3BTCA 2QWWA 3DBLB 5IYDJ 2JVHA 1TWCJ 2QENA 2DK8A 1Z6TA 2EJRA 2QQAA 3AG1H 3BZCA 5EEHA 5FLVA 4PJNA 2EWNA 3C2BA 3ZRGA 3WGIA 2XAQA 4ZYAA 3CO6C 2VKHA 4UVAA 5LFAA 3DKWA 3TGNA 4XSXF 1ZG1A 3O6BB 2DQRA 4D9JA 4A3BJ 3CO7C 1RR8C 3BTLA 3HUGA 1V5GA 3FK7A 3JTHA 3QP5A 2V79A 4FHTA 1JHFA 2OZ6A 3FXUA 3D5SC 3BQYA 1VNDA 4XORA 2Y9ZA 1X1BA 2BVMA 4Y17A 2ISYA 3AL0B 4BYYA 4J00A 4KA4A 4XRMA 5D5WB 4HLYA 2BW3B 1Y39A 1B72A 4B8XA 4V2FA 1W5SA 2IT0A 4PSWA 3CCJI 4BNCA 5DM6F 1BI3A 2HDDA 3B6AA 4XLHA 4BL0B 1YFHA 2KL4A 1YOVB 4KIFA 1IN7A 3LAJA 4C30A 2CQQA 3CCUI 5DD8A 4DQ2A 1X58A 1WH5A 2ME6A 4FASD 4BHCA 3HG9A 4A3FJ 4IHXA 1ERDA 4OINF 5J4VA 4DBRA 1I5ZA 5B1BH 1FOXA 2BVLA 2HOEA 2GWRA 3HSEA 4AUXA 4LFUA 5IP9J 1FOKA 1U0JA 2COMA 1YX5A 4M9ZA 2R7VA 4FE4A 3PSIA 1X1CA 4ETSA 5C3EJ 1J09A 2MH9A 3E6BA 2ZJRF 1MMNA 3EUHA 2IXSA 2ZB9A 2DDAA 4RLQA 5GAGJ 3PJRA 3TMOA 4XN3A 1D3YA 4IQ4A 3EETA 2L01A 2VN2A 5B3SH 4OOIA 4BQNA 3ABTA 4D5CA 2X4HA 5E8IA 3WTZA 4N4OB 2CFOA 2M8EA 3QOEA 3BY6A 3R4KA 1WI3A 4X6AJ 4JYKA 1MMGA 2MABA 2DXIA 1DP3A 5DCFA 1JXSA 5H2FC 3T1BA 4I6ZA 2WADA 5FB2A 3WTXC 2BBYA 5HNFA 4NQWB 1P7JA 2JUCA 4N0BA 2X1CA 5HNHA 2DI3A 3KEOA 3V42A 4NDLA 1DQUA 1P6RA 2BXZA 2JRMA 1GV2A 3K70C 1IC8A 1BC7C 1BI0A 2JT1A 2NNNA 4B1RA 1H0MA 4NHJA 2K9LA 4XL9A 4A3EJ 5E1ZB 2EPFA 3P5JA 1K4TA 1BJAA 3EUHC 2RNJA 2VOPA 3I4MJ 3QPLA 3IV5A 2YUSA 2NVUB 5J4YA 2MYSA 1LVKA 3V8KA 4W1UA 4LG0B 1HA8A 2K40A 3NRVA 3WE3A 4HNUA 1FIPA 1TT0A 1ZK8A 5FFZA 2F5EA 2EFQA 3F8NA 1UMQA 1LFPA 2VBXA 4PGGA 5D5XB 1JUMA 2LBFB 1XC5A 2ZXJA 2R0QC 2X1EA 2DA6A 3K1NA 2GZWA 2V4JC 2ZFUA 3JAMK 3L9FA 2HVRA 3EYIA 3OYGA 2J5PA 1WCMJ 4E7JA 2LREA 4BBSJ 1HQCA 1CGPA 1IG7A 2UXNA 5BNGA 1IV6A 1OLTA 1U9OA 2XB0X 4LOCA 4KYWA 3AG3H 3SXYA 1KU7A 2R7FA 3RKWA 3BWGA 2KP6A 4V19K 2QUFA 1BR4A 2YR2A 3KP5A 4RAYA 1W1WE 3FWEA 2M3AA 1E17A 3SDBA 2W24A 2O9LA 4G7OF 2W48A 1RRJA 4XSZF 3IAM2 3FBNB 4I7HA 1X3ZB 3O8HA 3OYMA 5HLIA 2JVGA 2Y75A 1N77A 2KLOA 2UWMA 1KGSA 4BACA 1CF7A 2W1OA 3F0CA 2X6XA 3S93A 5FKOA 2Z1DA 4RAZA 4UVCA 1EH6A 4CUGA 1HF0A 2XRLA 3OSFA 2R5ZB 3G1LA 1MIJA 1TQMA 2HQNA 5LHGA 1QNTA 2GOMA 3J81Z 1MD0A 5E20A 5DS9A 3ZMUA 5H6RA 1VZ0A 2F5VA 2M4GA 2X48A 3F8FA 5L3GA 2JSPA 2PJRB 2ZNYA 2P5LC 5H6QA 1Y56A 1G2HA 2K85A 1I50J 5EZGA 2EA2A 3W2WA 3ZCOA 5LEKA 2B9SA 1YO5C 3EUKL 1BJZA 2VT3A 3CC2I 2RDPA 4JBAA 3MAJA 2R7UA 1XSXA 4YFKF 3KPHA 1Z9CA 1B9NA 1VI0A 1ODDA 1VQKI 1ENHA 2EIJH 1VQPI 2A6TA 3QRFF 1IN6A 1GLNA 2M5WA 3HSRA 4KIBA 5M5YJ 2ZCWA 2QQ8A 2NVYJ 4BGDA 2W7NA 3TEDA 3HOVJ 3ABLH 2FUG2 4GO1A 2E71A 1FNNA 1A6QA 2P6SA 4G6TB 1LNWA 2NRAC 2TRTA 3VSKA 2BE5F 2ICWG 2B0LA 1TLHB 4M3DA 4R8HA 3QYFA 1X4PA 3HSFA 4XRSG 4HW0A 3IWZA 3TW6A 4RB1A 1U5TA 2QM3A 1QBJA 1QZEA 2QSGX 3K2AA 3TOBA 4KNYA 3B73A 2Y69H 1F5TA 2LKSA 3OOPA 2H1LA 2HQRA 2XASA 3JSPA 4U88A 3S1RJ 1PUEE 3CF5F 1YG2A 3LSKA 2L9VA 3PNVA 2TDXA 3FMRA 1SVOA 4A5MA 4RMNA 1KU9A 5K1YA 3MEXA 2HYGD 4EGZA 5CJ9A 5A2QZ 3PFYA 2ME0A 4ZYHA 3QU6A 3TP0A 4RBOA 1A31A 3CC4I 3I55I 4BQAA 1JGGA 1XD7A 1W0UA 3RKQA 5JLWA 1XCVA 3KP6A 3DPTA 1T95A 5JFRA 1JHHA 1RUOA 2F4IA 3I54A 1ZYRF 2DK5A 2E35A 3DEEA 4U0YA 1U5TC 1R5ID 2L2OA 3KETA 2Y2ZA 3F8MA 4A6DA 5LD2C 1OISA 1K79A 1S29A 4AM3A 1TQPA 3CCYA 2XGEA 2WV1A 5IP6A 5IYCJ 4M3FA 4LB6B 2E7WA 4ESBA 3J7ZI 3KYLA 4IVNA 4I0BA 1TT5B 3MZYA 2RREA 2KIQA 4MFEA 5ICEA 1RNLA 4AIHA 5E17F 2Z99A 3RKXA 1MBKA 1T38A 2GAUA 4IL6C 1JE8A 2KRFA 2IP2A 1ZG3A 1ON2A 1JKQC 1YIJI 2V6EA 1OFCX 5F08A 4IOAF 1LFBA 3LSPA 3QPSA 1AKHB 4ZH4F 2FQ4A 3C18A 3I64A 3KP4A 3C7JA 3LA7A 1BR1A 2XPWA 3CJTB 5AIPA 2L7FP 4RDUA 1XS9A 1WHUA 3MVPA 1OJLA 2OUMA 4MEYF 4CH7A 5BS6A 3R60A 2EFNA 5LLQA 3G4SI 1TC3C 1IO2A 3CCSI 3S2HJ 2GLOA 2KISA 5M3FJ 2NVQJ 3FHZA 4BKXA 4WX9A 1MNMC 1HSJA 5ED4A 1Z3XA 2FNPA 4LITA 3ZOBA 2IEKA 4AD9A 2VJ4A 1V5FA 4GRIA 4JP0A 1E0EA 1TL8A 4CZZA 4B44A 5D8KB 4I01A 5FKLA 3HOXJ 2EZIA 3H9GA 2K3PA 3KEYA 3B02A 5J8CA 5HS7A 3BZ6A 2OTLI 3HRMA 2E2IJ 5E18F 2C6YA 4GXOA 2ZJ2A 1YIOA 2RGVA 1KQ0A 1ZLKA 1K78B 5FLXK 3GBGA 1BI2A 3HKZN 5C44J 3EUAA 3OYFA 1U3EM 2VKDA 3E6CC 1JGSA 3CDIA 1ONVA 1IJWC 2KRHA 3I59B 2DPUA 3E1SA 1E3PA 2EV6A 4RLFA 2LD5A 3G2BA 4E6KG 4PJJA 1HLVA 1Z77A 1MBFA 4OIOF 5F6FA 1HDDC 5LEJA 5DCMA 4HX7A 2WAEA 1JKOC 5DEQA 4M6VA 1BA5A 2P0WA 2M30A 3BR5A 3FKIJ 3OIQA 3GX4X 2CV0A 1L3LA 1LPQA 3IP4B 4UUSB 2DT5A 3GCMA 5KCMA 4EJWA 2VPLA 2B63J 4HQMA 4DNCA 4HAMA 3DWLE 3H3UA 2PLYA 1WVRA 2DN0A 5E3OA 3A02A 1G8XA 3MKZA 3S1MJ 1WI9A 1H89C 1Y8RB 3H5RA 4IKFA 1FTTA 2JA2A 3TOAA 5E3NA 4XLCA 2KQRA 3QPHA 2CYYA 2VKEA 4BY7J 1HW5A 3U1KA 3FBIB 2O8XA 2LF8A 3OS0A 3VWBA 2DODA 2HKXA 4L5JA 1WQ2A 2QA4I 1OQYA 1VQLI 2MD5A 3JRGA 1LE8B 1PDNC 1DPUA 1W7PA 1D1CA 3G6EI 4BJTA 1S8NA 2COBA 3I71A 4LK0F 4LK1F 2K9QA 3S14J 3GTJJ 4FT8A 1X2MA 3Q9SA 3RSNA 1QGPA 2VL8A 1JJ8C 3CZ6A 2MLKA 1BW6A 5FROA 4AU7A 5J6XA 1IUYA 3DKXA 3V8LA 1CF7B 3PIPF 4MQVA 3MMYB 3BJAA 3JAMZ 1BM9A 4BU2A 3F8BA 4CZCA 2ZJPF 1WGXA 5B1AH 1YQAA 1VQ4I 2VE8A 2MH2A 3HTUA 1TWGJ 3DU6A 4EM0B 3DTKA 1PUFA 1GXQA 3G3ZA 5EDNA 4ZYGA 4M3GA 3HM5A 1WJCA 3QQAA 2G7HA 3A0HC 3VB2A 1IN8A 3H5NA 2XF5A 1ORKA 2ZMEC 2DT6A 1JI8A 2FMYA 2MC4A 2Q2EB 1BBYA 3F72A 3I5UA 2V1UA 4D7MA 2TCTA 2NVTJ 2IGMA 4LIUA 3PFIA 3GFIA 1GT0C 1R7JA 2VQHA 2R7RA 4BAYA 1IRXA 2GBYA 3L2QA 1N25A 2LYCA 3LNQA 3BQZA 3BG9A 1HBXG 1K6YA 2JK3A 3ERMA 3OWTA 2L02A 3F23A 2JA8J 3BR1A 3RCOA 3OS2A 3RZDJ 4HV5A 1MJBA 4IEJA 5HDGA 3HHHA 1YITI 2DJNA 4LLGF 2R93J 4ZDPA 3CCEI 4LLNA 2HKOA 3F3XA 2MLGA 1EH7A 4S0HB 2I8DA 4ENKA 2XSDC 1G3TA 1B6AA 2BZTA 2QQ9A 2XIGA 1FZPB 4II3A 1XGMA 3KP7A 3HGGA 3BJOA 3ECOA 2QKLB 2GIZA 1Y8QB 3QODA 1U78A 1O3TA 4HEA2 2AS5F 1R23A 3HKZA 2Q1ZB 4XN0A 2EZLA 4DYCA 4KMFA 1JJ6C 2EZKA 4A3KJ 1U2WA 5J40A 1H9GA 2VIXA 4IXAA 4XLNF 2V1DA 5M5WJ 3U21A 2KKOA 1NTCA 2I10A 3IKTA 5C4XJ 1J2XA 5IYBJ 4BXFA 2WAFA 3ZQIA 4M9XA 3UKGA 5BQTA 3S2DJ 1ZAOA 3ZMZA 4M9SA 1TNTA 3L09A 4XIDA 1YW9A 1ZREA 2CS3A 4BEHA 3CDHA 1JUSA 1X19A 1Q1HA 5D6EA 1G59A 3L7WA 4B47A 5F0HA 2CUZA 4NB5A 2BY2A 1XSDA 2E1OA 2FE3A 3BR3A 2OCCH 3HUGB 5IOZA 3HIFA 4E7KA 4ZTFA 2KZGA 2X0LA 5A2QK 5ICCA 3GMEA 2EQRA 3RPUD 1CQTA 4L9JA 4LMYA 2ZFWA 4PJMA 1S72I 1B72B 4XKWA 2WY7Q 3H5AA 1RKTA 1HW2A 1B4AA 1X2NA 3W6VA 3JRAA 3UNGC 3DF8A 4CICA 1UHWA 2PBIA 4ESJA 3R0JA 1W36C 5F04A 1UELB 2VB6A 5ILVA 5GPCA 4D1QA 3SJMA 3CUQA 1B8IB 2K7LA 3CLQA 2BY3A 3HEFA 4A0XA 2MGQA 3IRRA 1BC8C 2PEXA 3RQ4A 4G94A 5EGOA 1FYMA 2K02A 2LFBA 3TQNA 2DYSH 2MSYA 3G1OA 3E7LA 3H0DA 4E70A 5IPAA 2IRFG 2KFDA 3GTGJ 3HJEA 1XDUA 2CW0F 1HKTA 1U6GA 2HQ5A 2L0KA 3H3VK 3A0BC 2QBYA 3BDDA 1D0ZA 4P96A 3C2GA 4CHUA 4NC6A 3ZQFA 2ZKZA 3MCZA 1UZCA 3MQ0A 5D5UB 2X9DA 4G9YA 1SFXA 2V26A 3DTEA 5K5RA 4A3JJ 2HYFA 3CUOA 1IDYA 2H1KA 1FT9A 4HPQA 4HX4A 2DOAA 3CUQC 1X1AA 3H0GJ 5KK1A 3ZXSA 2VC0A 1T0FA 2V7FA 1ZTRA 2GXBA 3GTQJ 3OYLA 2O6GE 4XLAA 3E0JB 4YELA 2XGCA 1VQNI 3BROA 2CQNA 1IN5A 3OL3A 2FMLA 3K10A 3ZQLA 1K7AA 1RUNA 2VKVA 1DU0A 3S3MA 4KT6A 5JHFA 2DT7B 3OS1A 1ETWA 4DW6A 5D8LB 2L9RA 1ZR4A 5L3BA 1J9IA 1OCCH 2NVXJ 1UHSA 2L4MA 5K5QA 5FLXZ 3RTRA 4HRIA 3WU0A 3H92A 1KZHA 1ZRCA 2WC2A 4LB5A 2QYOA 5FJ8J 3QPTA 4IRGA 2XSJC 3KP2A 2XPVA 4OIRF 5JLXA 1T08B 1T0FC 1YLFA 1YS7A 4U0WA 4BE2A 1R4MB 2ADUA 3GZ5A 3CCRI 3OYJA 1QPIA 2R5YA 1J59A 5E79C 5E3MA 3HRSA 1EV7A 4R1HA 3CESA 3H9JA 2IPQX 2OAZA 3SFZA 4K2EA 1ETOA 4FQGA 3OYNA 4L9VA 3ABMH 1TQIA 3LL7A 4Y33A 1AWCA 4L18B 1LEBA 2F5CA 1XPXA 2DAOA 3GTPJ 1F9NA 3M9AA 1Z7UA 3V7SA 1FJLA 5K7FA 3HL2A 2V9KA 3G1MA 4BS9A 2ID6A 2JZYA 1MBEA 3HOZJ 1JT0A 2R7OA 4B48A 5GTHC 3FDYA 4QWQA 2FBIA 4CXFA 2CO5A 3DLLF 1QHGA 2YPRA 3MD2A 2VPRA 3L2CA 5EG0A 5J1UA 1F4KA 1ZGWA 3BJ6A 1V5EA 5LGUA 4HG2A 2STTA 3ZQHA 2D2WA 1UCRA 1JUPA 1B9MA 2DFEA 3KZYA 2O0YA 4OAYA 3GTOJ 3HYIA 1IRFA 3WTWC 2XUBA 3WTVC 2JRTA 3HXLA 4M6YA 3GO5A 3GUDA 4E7LA 3CMAI 3FXRA 4XLPF 5HLTA 1Z21A 2BW3A 4G12A 3G71I 3O3KA 3FM3A 5FFXA 3JCUC 1LDJA 4XLFA 3WG7H 1JKPC 3DKYA 3LSHA 4WF2A 2HDWA 4CCJA 5K7HA 2X6WA 3CTAA 1ITYA 2BGCA 3QU3A 2Z9OA 3GF2A 2VI6A 1R4NB 3L00A 4GGGA 4RS8A 4L5EA 3M1CA 5CVUA 4D5FA 4GYIA 5GAEJ 3FMSA 3LWFA 3ASOH 2JTVA 3RPUA 1YTYA 2XAJA 4I98B 2LP0A 4UXNA 2K27A 4BJ6C 1VQ6I 1R1UA 3QAHA 3TW7A 3KYDB 2FU4A 3JRBA 2IVMA 1I39A 1U5TB 1FPQA 3PL8A 3BT9A 3Q0VA 3HOSA 3V8JA 3AL0C 4BHPA 1YE9A 1TBXA 3HZJA 5CQEA 2XAFA 2LRDA 3NQOA 4C2TA 1RKWA 2CRGA 4ZC3A 3LA2A 2ZXWH 3K4KA 4XNFA 3TO6A 1QU3A 3ZMDA 1NK3P 1R6RA 2KDZA 4BE1A 3HOTA 3PNYA 2L7ZA 2EBIA 2X6OA 3P7NA 3LFKA 2NXNB 3F8CA 1QA6A 4BDZA 4RAFA 4M3BA 4M74A 1VQ7I 2AXLA 4S04A 2DJIA 1QPMA 3RYPA 3GLXA 5HLGA 1ZARA 2GM4A 1WJEA 5D5VB 1ZELA 3S3OA 1DGRM 3WG9A 4AC0A 4PFPA 1BOBA 2HWVA 1W5TA 3VSLA 2K9NA 4WK8F 3Q3SA 2OQRA 4RM2A 4C9YA 4XOPA 1W0TA 2LY2A 1SFUA 2R92J 3BR6A 2JPCA 4MHGA 4L0YB 2LY1A 1LDKB 2OCEA 1S6LA 2V6CA 3C1DA 5D4RA 1R71A 2YU3A 4C3JJ 1MKMA 1POGA 4DYQA 3IH2A 2HXIA 3IKVA 2LBFA 2YX7A 4HDVA 3BG7A 2VOOA 1HDPA 2EK5A 2F5FA 4D0PA 3CP2A 3R0AA 2KIMA 2X51A 4ESFA 4ZDOA 1Z05A 2A68F 3CP8A 1S7AA 1WFXA 2HTSA 4UB6C 5DD4A 3E6MA 3ROUA 2E1CA 1FEXA 2XDVA 3LMMA 3K4MA 1O57A 1TWAJ 3LOCA 1MBJA 3DXJF 3KFWX 3MKWB 2EFOA 3SEQA 2HS5A 4BQOA 2RNGA 2FBKA 3A03A 4F93B 3A01A 1UAAA 1DU6A 1PVEA 4I99C 4A6EA 4MTEA 4IRIA 1H8AC 3S1QJ 1XG1A 1IXRC 1YX3A 2OC6A 3I3LA 5F64A 3VYTB 1A35A 3MN2A 5HOOA 4KN7X 3I4NJ 1MBHA 2FJ1A 2HEOA 3GW2A 2E19A 1EKEA 3QYEA 3K9TA 1RZ4A 2GXGA 1RESA 1J7KA 1ZHFA 3ESWB 4NUBA 1MMAA 4R79A 3IWFA 3M7GA 4DGWB 1MZBA 2GA2A 1FP1D 2H6CA 3BZKA 3F6OA 3LSJA 1T33A 3VYRB 3T5XA 2VONA 4IHYA 3KEQA 3RIRA 1FTZA 1SMYF 2P7VB 1O3SA 1K61A 2DOEA 2BY1A 2FQ3A 2ESNA 2CMPA 4ZYDA 3FX3A 3SHFA 1SVMA 2HZTA 5JVTA 4WXDA 4RB3C 1NH3A 3COAC 1ETQA 2CQXA 2HQAA 2ZXIA 2HOSA 1FBQA 1RR7A 1Y6IA 3GFLA 5DCMB 1XX5A 2P5KA 1EJ9A 3LQRA 4Y13A 4UUTA 4KDPA 3JREA 1JT6A 2FOWA 2E2HJ 2L5QA 4IRHA 3ZN1A 2LSOA 1Y0NA 2ID3A 3OY9A 3SFIA 5EEAA 3V7RA 3F9KA 4QTRA 1AU7A 5HLHA 2PMUA 5J1YA 3D1NI 2L7MP 4E7HA 3VYSB 1IDZA 2LLKA 2V9VA 2AQFA 3HPGA 1L0OC 3WU2C 2FD5A 4GFBA 1WH7A 4F92B 3ZN0A 3FXMA 1KYZA 4KFCA 4YG2F 3GEZA 3J80Z 1FBSA 1TP4A 2DOFA 2K4JA 4HX8A 4XKBA 2GIVA 4KMUX 5IP7J 4D7NA 1T56A 3O8GA 3CMYA 1O3RA 4YIIA 4MFDA 1W7PB 2UUZA 2O8KA 1AA7A 1MH3A 3K4BA 5FD6A 1IW7F 1LDDA 3FXOA 3KZIC 4C3HJ 3X2QH 4EMSA 4AIJA 2EZHA 3BP8A 1MSFC 3MZ8A 3WTUC 3HOYJ 2JQ7A 2ZSHB 3M8EA 2DCEA 2HOTA 1Y1WJ 3BG3A 3MWMA 3F22A 3HB9A 5AONA 2RAEA 3L2UA 2E5ZA 1SFKA 4IHSA 4FE7A 4HOBA 4I2OA 5FLMJ 1P4XA 3GVAA 2JUGA 2DA7A 1YRNB 2L3DA 4A0ZA 3EPZA 2HVQA 5F0FA 5BPDA 3CC7I 1O3QA 3AKZA 2CUEA 4KITB 2M1BA 2EB7A 4RA2A 3VEPA 1LB2A 2O3FA 5LGNA 1KU3A 1OCPA 2AXTC 2P4WA 4FX4A 3V7CA 5HDNA 2VBWA 2WWYA 1G3YA 1O7LA 1TW3A 4KICA 3RYRA 4C2UA 2ZXHA 2YSRA 3BLYA 1G4DA 3W2AA 3VYUB 1ACIA 2KJCA 3OR1C 3JRCA 3RDIA 3DLAA 1OYWA 1XGOA 3KCCA 1YI2I 3FZVA 3DCFA 2DMPA 2M7BA 1R5HA 1R9TJ 1QZZA 1USTA 1YW7A 1AKHA 2V9PA 2ZC2A 3P9CA 1Z0XA 2H09A 2ZSIB 3QP6A 4JOMA 2NS0A 3OL4A 4PZJA 3HBLA 3GTKJ 1ZLJA 3L2VA 4ITVA 2ZMEA 1W4MA 1AHDP 3TO7A 1H9TA 1RIOH 1IXSB 1WKMA 5HVQC 1F1ZA 3GFMA 1E3OC 1S5LC 1WJ5A 1YYVA 1IXCA 2G0EA 1SANA 4HYEA 4DZPA 2LTPA 1Q1VA 1B1BA 4YEJA 3MKYB 3DPUA 4MIMA 2K9SA 3K2ZA 2JMWA 4HBLA 1V55H 2ELJA 1D1AA 2PN6A 3M8JA 3OMYA 4XKVA 5JI6A 2M87A 2E36A 1R5GA 2DTZA 3ZP5A 3E5UA 2W4SA 4JX5A 2HGCA 1K78A 4UV9A 1DGWY 3P9IA 2A5YB 2CUJA 5TISC 4ABZA 4A69C 3HOUJ 2Q0OA 2Z16A 1VQ5I 2VQLA 2R7TA 4G7ZF 3I59A 4IF4A 3K7AJ 4KJZA 3IH4A 4E7IA 2IJLA 1T6SA 1SAUA 4XMYA 4G7HF 1I27A 2VT2A 3PM1A 3V4GA 1KQ8A 2LR8A 4HNVA 4WWCA 2A3SA 4XRFA 1ZRDA 2WTEA 4AWXB 4BEHB 2UXXA 1LVAA 2JN6A 2NS8A 1FY7A 3TKYA 2VBYA 5DV5A 2WA0A 4UUSA 5H20A 1R36A 2NNYA 1IGNA 4A3LJ 1XN7A 2L9NA 3J7YJ 5F27A 2JA7J 2YS9A 1N75A 3ELKA 5ICGA 4CYCA 3OSGA 3E5XA 3LSTA 3ZQCA 1ZG5A 4UVBA 2H8WA 4IPAA 1FOWA 2R7WA 2PX9A 2WBMA 3ONQA 3EYYA 3T8TA 2HTJA 3OIPA 2CGPA 5DM7F 3DFGA 2A6HF 4YIFA 2FX0A 4PJ0C 2HVSA 3I58A 2QSFX 3BTIA 1WJAA 4M6XA 3F21A 1FMVA 3RZOJ 1IV8A 1X1DA 1ZGJA 2EA4A 4CGZA 2NYXA 4OMYA 3IUOA 5GADJ 2IS2A 3HRTA 1VQOI 4XLEA 1D8JA 3KIOA 4QSHA 2W85A 5BOXA 4HSRA 3K0LA 2VXDA 2STWA 3FKJA 1SMTA 4HA8A 4OIPF 4YRVA 4A0YA 1J75A 1MGTA 3D5LA 1E2XA 2XRNA 1P4AA 4YFXF 1T2KA 5J3LA 3OYAA 4KT5C 3PO2J 2QBYB 1WWXA 2ACJA 5TGTA 4V2GA 5J8FA 1UG2A 1BOAA 5D6FA 4L5IA 3GTLJ 2AHQA 5EEGA 5B66C 1WRJA 5D4SA 1BW5A 1OKRA 5FRMA 3K1PA 5E3LA 2W00A 4OAZA 3KYCB 4EGYA 2O03A 1IRZA 2E1MC 3ABKH 1LEAA 3HPHA 4GYGA 3TO9A 4MO7A 1LFUP 2M0MA 3OYEA 1KONA 4N9IA 3QOPA 2FOKA 2DA1A 1P4WA 1MJAA 2RQQA 1R00A 4I76A 4ENJA 1I1SA 2DMTA 1UB9A 4WXCA 1MNDA 5EZHA 2JSCA 5TRDA 1MMSA 1PYVA 5FRNA 3ASNH 2BV6A 3SZPA 2A05A 3BTJA 3CJNA 1W5CC 2CG4A 5K5OA 2BOLA 3D0SA 4DZJA 3KP3A 2W84A 1Z1DA 5CVRA 3FMQA 4ZJZA 2O5RA 3VODA 2HOAA 1ETYA 3OYHA 2ZJQF 2A07F 4A2UA 1ZN2A 2FSWA 4OWRB 2OZUA 4ASNA 4NC8A 4H0EA 4Y15A 4PJLA 2R5YB 1N78A 2DFFA 4DBQA 4M71A 1HW1A 2EINH 2OQGA 2M4KA 2D5VA 3WU1B 3RJPA 1I6HJ 1OMIA 4QLCU 1P7IA 1X3UA 3S8PA 2R3SA 1P92A 3FK6A 1LKXA 3ERED 3DBHB 1TWFJ 1LQ1A 2PJPA 2OV7A 3ZMVA 1BI1A 3CDLA 4HLXA 2DU9A 3CCMI 3QYBA 3CLOA 2LVSA 3SEZA 3M07A 2F5DA 1QHHD 4HF2A 3P9KA 4P9FA 5E1XA 4MNUA 2FEZA 5KAIC 3C2HA 5LRRA 3L2RA 2CW8A 3HOWJ 4JX6A 4DIQA 2EFWA 2VE9A 4M73A 5KVRA 4ENMA 5LHHA 2JA5J 2CJJA 2R4GA 3I53A 2DMNA 3DEUA 3J80K 5EG0B 5HS8A 1A5JA 4BQQA 3KZZA 1BR2A 1IZ1A 2ELKA 4AIDA 2DBBA 4KIGA 1MDMA 5F1JA 2WY8Q 1NK2P 1I3QJ 3DTIA 4L9NA 2H8RA 1WZ2A 3WE2A 4HF0A 2L7KA 3LSRA 1AOYA 3JR9A 3NAUA 4XM3A 1SC7A 2WAQN 3BPVA 4B4CA 2VXZA 3MFKA 2FRHA 3FF5A 4IHWA 2QSHX 2IGKA 1ZKGA 3RKYA 1YJNI 1EF4A 4HV6A 1F43A 5E8GA 4MTDA 1SD6A 1S9HA 3VDXA 4ANJA 4UUVA 1XTAA 3GXOA 1KU2A 1ETXA 4HDUA 4BE0A 1RETA 2W57A 1X3WB 4IHVA 2VQCA 1B8IA 1LUJB 2EV0A 3REOA 4EJOA 3A2KA 2K9MA 4AYBN 2IS6A 1Z3YA 2GQQA 4MEXF 2DW4A 1KQ9A 2DFHA 3DPLC 1OPCA 4PSXA 5BMZA 3SZTA 2R7XA 3Q5FA 3CCVI 1J0RA 2EIMH 3ULQB 3FXKA 2MA3A 4I02A 3AG4H 1NG6A 2DDBA 5FKKA
chains in the Genus database with same CATH topology
1S7OA 3VFZA 2R7DA 1BN5A 3W6JB 2VODA 2IA1A 1XMKA 4LJZF 2G9WA 1TNSA 2KIFA 1T39A 5L3CA 1FSHA 3ZPLA 3WTSC 2L4AA 2G7UA 2E7XA 4PDKA 3TDZC 1C0WA 2VBZA 2MC3A 4JQFA 3WODF 2XGXA 4EQQA 4O6JA 1REPC 3E6DA 1HSTA 2F2EA 1LJ9A 4CYDA 1KYWA 5DYMA 5ILSA 4UV8A 2IA2A 2P7CB 1R1VA 3PQKA 2HR3A 5CYVA 3R6SA 4A12A 1WSUA 4ZZDA 2P8TA 3K69A 1FP2A 1FX7A 1P2FA 2XKOA 2P6TA 4U7BA 2UZKA 2D1VA 2XHKA 2DLLA 1DUXC 3S2WA 4WCGA 4MGRA 4M72A 4BHBA 1V4RA 5IT9K 4NQWA 1SD5A 5L3DA 3HTSB 2XKPA 5CVIA 3GFJA 2RKHA 2IW5A 1BIAA 5F1RA 1DDNA 4Q4ZF 4P9UA 1XDSA 4IJAA 1R58A 1Y0UA 3O2PE 4UNOA 2BYVE 1SD7A 4LG0A 1J5YA 1ZH5A 1R1TA 5JR3A 3RI4A 5LRSA 3E3VA 2ZNZA 4PGHA 2H27A 2PQ8A 3U9GA 2PFBA 3M8FA 1GXPA 3JTGA 2EV5A 3NEUA 3FXQA 1ZGAA 2RQPA 3KLOA 4RB2C 3RPQA 2QZ8A 4XBFA 4ON0A 1W7PD 2ESHA 3ISPA 3MZHA 2RV8A 1A04A 3KE2A 4U0VA 5L3FA 1IAWA 2O61A 4OIQF 2FF4A 4P55A 2ETHA 3EDPA 2WV0A 2VC1A 3HRUA 1ZRFA 2ZO4A 4YFNF 1DPRA 5CVJA 1I1GA 2HFHA 2ISZA 2EFPA 4RGRA 6PAXA 1USSA 1MJ9A 3C3WA 4BH9A 3K1MA 2P5VA 3OV8A 4JK1X 2KJBA 2ELHA 5CLSA 2MBFA 3IL2A 2OA4A 2BEOA 2Z5UA 4EJUA 1Z91A 2QQBA 3AAFA 4EJTA 3ECHA 2D45A 2K86A 4FX0A 3IHUA 4ZZLA 4RGXA 2CSOA 4A5NA 2A6EF 2CFXA 2LF7A 1GHCA 4CDGA 2PI0A 1D5VA 3BPXA 1XSVA 1FC3A 1ON1A 1XB4A 2QLZA 1YS6A 2FBHA 2A69F 2OD5A 4N9HA 5E1WA 1SAXA 4EV0A 4U7DA 1XGSA 3EQLF 5FGMA 4Z2YA 2ZMEB 2FXAA 3GZ6A 1OR7A 2LKPA 4MQ9F 4RGSA 1BIBA 4UHTA 2FNAA 1QO0D 2KIUA 4OU0A 4RGUA 3ML6A 2Y48A 2DPDA 1HKQA 2J5OA 4HF1A 4Q47A 1GVJA 4KN4X 2A61A 4ENNA 2ZBKA 3WTTC 3WGHA 4GCVA 4LD5A 3BOQA 5DUIA 4I09A 4IHTA 1XCBA 1RI7A 1XMAA 3ABUA 2FA5A 1U8RA 4KUMA 4EJVA 2Z3YA 1FBUA 1QQIA 1DP7P 4LLLA 2CQKA 2GA1A 3W6KB 4ZYEA 2Z33A 4L9TA 2K4BA 1T98A 4RB0A 5DDGA 3R61A 4L0ZB 5HDKA 3M1EA 3PQJA 1EH8A 3JSOA 3H3ZA 1I6XA 1PP8F 3IC7A 1OYYA 1IF1A 1OYIA 1VTNC 2XAGA 3I0TA 4Q48A 3TDUC 4AVPA 4O3MA 2L54A 4O5VA 1G3SA 4OMZA 3SQNA 3T8RA 3JW4A 2XVCA 5CVVA 3FM5A 4F7ZA 2QVOA 3DP7A 5ICFA 4PCQA 4B09A 5HS9A 3U2RA 2XROA 3WTYC 4G6DA 4BXUA 1FSEA 4HZFA 5AIQA 2CWEA 5L3EA 5ERIA 2OBPA 3GWZA 1TTYA 5LGTA 1G6NA 3T0YA 3KLNA 3ZMTA 2XV4S 1XGNA 1R22A 4WXHA 3F6VA 4EM1A 2V1XA 2LDUA 2H6BA 5BPIA 1IN4A 3N97A 2DTRA 3IRQA 5JHUA 5IT9Z 4I0AA 2YX4A 3LQQA 1HXDA 4TV7A 3J81K 1UHMA 1FWZA 1O7FA 5FO5A 1K6OA 3CUQB 2HDCA 2M45A 1D8KA 5IT3A 1FYLA 4LGWA 1SD4A 3J7AO 1QZYA 2H94A 5TJJA 1KA8A 1YW8A 3VOEA 2RVCA 1TW2A 4HQEA 2DFIA 3G73A 3LA3A 2DO7A 5ILUA 1FLIA 2RN7A 3WGGA 4EM2A 3ZQ7A 3E5QA 5LBQA 4Q5SF 5DUKA 1V3FA 2D1HA 3E97A 2IA0A 2Q8KA 4EVIA 2Q2EA 3LAPA 3Q9VA 5FD5A 4P5OA 1MDMB 2RC4A 2NAZA 1ULYA 3ZMSA 3I4PA 4CO8A 1G3WA 2W25A 1S3JA 1STZA 1NHAA 2DQLA 1FYKA 2PMHA 5LHIA 4G8XA 3DQVC 1SFEA 3HHGA 2JPBA 3DV8A 1PP7U 2Y0MA 2PG4A 1Z6RA 2XAHA 1B59A 1UFMA 1IRGA 2LNBA 4G6QA 3U1DA 4AIKA 3N4MA 4S05A 2OU2A 1HKSA 2E1NA 2QWWA 2QENA 2DK8A 1Z6TA 2EJRA 2QQAA 5EEHA 2EWNA 3WGIA 2XAQA 3CO6C 4UVAA 3DKWA 3TGNA 4XSXF 1ZG1A 3O6BB 2DQRA 3CO7C 3HUGA 3JTHA 3QP5A 2V79A 4FHTA 1JHFA 2OZ6A 3FXUA 4Y17A 2ISYA 4BYYA 4KA4A 5D5WB 4HLYA 2IT0A 4BNCA 4B8XA 1W5SA 1BI3A 1YFHA 4KIFA 1IN7A 3LAJA 5DD8A 4DQ2A 4BHCA 4OINF 1I5ZA 2HOEA 2GWRA 3HSEA 4LFUA 1FOKA 2COMA 4M9ZA 4ETSA 3E6BA 2MH9A 3EUHA 1D3YA 3EETA 2L01A 2VN2A 4OOIA 3ABTA 2X4HA 5E8IA 3WTZA 2M8EA 3R4KA 3BY6A 1JXSA 5DCFA 3T1BA 5FB2A 3WTXC 2BBYA 4N0BA 2DI3A 3KEOA 1P6RA 1BC7C 1BI0A 2JT1A 2NNNA 4NHJA 1H0MA 5E1ZB 1BJAA 2RNJA 2VOPA 3V8KA 4LG0B 3NRVA 3WE3A 5FFZA 2F5EA 2EFQA 3F8NA 5D5XB 2VBXA 4PGGA 2ZXJA 3K1NA 2GZWA 3JAMK 3L9FA 3EYIA 2J5PA 1HQCA 1CGPA 2UXNA 4KYWA 3SXYA 1KU7A 2R7FA 3RKWA 3BWGA 2QUFA 2YR2A 3KP5A 4RAYA 3FWEA 1E17A 2W24A 4G7OF 4XSZF 4I7HA 5HLIA 2Y75A 2UWMA 1KGSA 1CF7A 4RAZA 4UVCA 1EH6A 1TQMA 2HQNA 5LHGA 1QNTA 3J81Z 1MD0A 5E20A 3ZMUA 5H6RA 3F8FA 5L3GA 2ZNYA 2P5LC 5H6QA 2EA2A 5LEKA 1YO5C 2VT3A 2RDPA 4JBAA 3MAJA 1XSXA 4YFKF 1Z9CA 1B9NA 1ODDA 3QRFF 1IN6A 2M5WA 3HSRA 4KIBA 2ZCWA 4GO1A 1FNNA 2P6SA 1LNWA 2NRAC 2BE5F 2B0LA 1TLHB 4R8HA 3HSFA 4HW0A 3IWZA 4RB1A 1U5TA 2QM3A 1QBJA 3TOBA 4KNYA 3B73A 1F5TA 3OOPA 2HQRA 2XASA 3JSPA 4U88A 1PUEE 1YG2A 2TDXA 3FMRA 5K1YA 4A5MA 1KU9A 3MEXA 2HYGD 4EGZA 5CJ9A 5A2QZ 4ZYHA 3QU6A 4BQAA 1XD7A 1XCVA 3KP6A 3DPTA 5JFRA 1JHHA 1RUOA 3I54A 1ZYRF 2DK5A 4U0YA 1U5TC 3KETA 3F8MA 4A6DA 1K79A 1S29A 1TQPA 4LB6B 2E7WA 4ESBA 4IVNA 4I0BA 3MZYA 5ICEA 1RNLA 4AIHA 5E17F 2Z99A 3RKXA 1T38A 2GAUA 1JE8A 2KRFA 2IP2A 1ZG3A 1ON2A 4ZH4F 3C18A 3I64A 3KP4A 3C7JA 3LA7A 5AIPA 4MEYF 5BS6A 5LLQA 3R60A 2EFNA 3FHZA 4WX9A 1HSJA 5ED4A 2FNPA 4AD9A 4CZZA 5D8KB 4I01A 3B02A 5J8CA 5HS7A 3BZ6A 3HRMA 5E18F 2C6YA 4GXOA 2ZJ2A 1YIOA 2RGVA 1KQ0A 1ZLKA 1K78B 5FLXK 1BI2A 1U3EM 3E6CC 1JGSA 1ONVA 3I59B 2DPUA 2EV6A 4OIOF 5F6FA 5LEJA 5DCMA 4HX7A 5DEQA 3GX4X 2M30A 1L3LA 2DT5A 4EJWA 4HQMA 4DNCA 4HAMA 3H3UA 2PLYA 1WI9A 3TOAA 3QPHA 2CYYA 1HW5A 2O8XA 2LF8A 2HKXA 4L5JA 1WQ2A 2MD5A 1PDNC 1DPUA 1W7PA 1S8NA 3I71A 4LK0F 4LK1F 4FT8A 3Q9SA 1QGPA 2MLKA 5J6XA 1IUYA 3V8LA 1CF7B 4MQVA 3BJAA 3JAMZ 1BM9A 3F8BA 1YQAA 2VE8A 2MH2A 3HTUA 4EM0B 1GXQA 3G3ZA 4ZYGA 2G7HA 3VB2A 1IN8A 2FMYA 1BBYA 3F72A 3I5UA 2V1UA 3PFIA 3GFIA 1R7JA 4BAYA 1HBXG 2L02A 3F23A 4HV5A 1MJBA 5HDGA 3HHHA 4LLGF 4LLNA 2HKOA 3F3XA 2MLGA 1EH7A 4ENKA 1G3TA 1B6AA 2QQ9A 2XIGA 1FZPB 1XGMA 3KP7A 3BJOA 3ECOA 1U78A 1O3TA 2AS5F 1R23A 4KMFA 1U2WA 1H9GA 4IXAA 4XLNF 2V1DA 2KKOA 3IKTA 1J2XA 4M9XA 5BQTA 1ZAOA 3ZMZA 4M9SA 1TNTA 3L09A 1YW9A 1ZREA 3CDHA 5D6EA 1Q1HA 3L7WA 4NB5A 1XSDA 2FE3A 3HIFA 2X0LA 5A2QK 5ICCA 4L9JA 4LMYA 2ZFWA 1HW2A 1B4AA 3DF8A 4CICA 1UHWA 2PBIA 4ESJA 3R0JA 5ILVA 3CUQA 2K7LA 4A0XA 3IRRA 1BC8C 2PEXA 4G94A 1FYMA 2K02A 3TQNA 4E70A 2IRFG 1HKTA 1XDUA 2CW0F 1U6GA 2QBYA 3BDDA 4P96A 4CHUA 2ZKZA 3MCZA 3MQ0A 5D5UB 4G9YA 1SFXA 5K5RA 2HYFA 3CUOA 1FT9A 4HX4A 3CUQC 5KK1A 2VC0A 1T0FA 2GXBA 2O6GE 3BROA 1IN5A 2FMLA 1K7AA 1RUNA 5D8LB 5L3BA 1J9IA 2L4MA 5K5QA 5FLXZ 3RTRA 3WU0A 3H92A 1ZRCA 2WC2A 4LB5A 2QYOA 3QPTA 4IRGA 3KP2A 4OIRF 1YLFA 1YS7A 4U0WA 2ADUA 3GZ5A 1J59A 3HRSA 1EV7A 4R1HA 2IPQX 2OAZA 3SFZA 4K2EA 4L9VA 1TQIA 1LEBA 1AWCA 4L18B 2F5CA 2DAOA 1F9NA 3M9AA 1Z7UA 3V7SA 2JZYA 4QWQA 2FBIA 4CXFA 2CO5A 2YPRA 3L2CA 1F4KA 3BJ6A 5LGUA 2STTA 2D2WA 1UCRA 1B9MA 3KZYA 2O0YA 3HYIA 1IRFA 3WTWC 2XUBA 3WTVC 2JRTA 4M6YA 3GO5A 3GUDA 3FXRA 4XLPF 3O3KA 3FM3A 5FFXA 1LDJA 4WF2A 3CTAA 2BGCA 3QU3A 2Z9OA 3GF2A 3L00A 4GGGA 4RS8A 5CVUA 4GYIA 3FMSA 3LWFA 2JTVA 3RPUA 1YTYA 2XAJA 4I98B 4UXNA 2K27A 1R1UA 3QAHA 2FU4A 2IVMA 1U5TB 1FPQA 3HOSA 3V8JA 4BHPA 1TBXA 2XAFA 3NQOA 3LA2A 3TO6A 3ZMDA 3HOTA 3P7NA 3LFKA 3F8CA 4M74A 2AXLA 4S04A 1QPMA 3RYPA 3GLXA 5HLGA 1ZARA 5D5VB 3WG9A 2HWVA 1W5TA 4WK8F 2OQRA 1SFUA 2JPCA 4MHGA 4L0YB 1LDKB 3C1DA 1S6LA 2V6CA 5D4RA 2YU3A 1MKMA 3IKVA 2YX7A 4HDVA 2VOOA 2EK5A 2F5FA 4D0PA 3R0AA 2KIMA 4ESFA 1Z05A 2A68F 1S7AA 2HTSA 5DD4A 3E6MA 3ROUA 2E1CA 1O57A 3KFWX 3DXJF 2EFOA 2HS5A 2FBKA 4A6EA 4IRIA 4MTEA 1IXRC 5F64A 5HOOA 4KN7X 2HEOA 3GW2A 3K9TA 1RZ4A 2GXGA 1J7KA 1ZHFA 4R79A 3IWFA 3M7GA 1MZBA 2GA2A 1FP1D 2H6CA 3F6OA 2VONA 3T5XA 3KEQA 3RIRA 1SMYF 2P7VB 1O3SA 2FQ3A 2ESNA 4ZYDA 3FX3A 3SHFA 2HZTA 5JVTA 4WXDA 4RB3C 3COAC 1FBQA 3GFLA 5DCMB 2P5KA 3LQRA 4Y13A 4KDPA 4IRHA 3ZN1A 2LSOA 3V7RA 5HLHA 2PMUA 2V9VA 1L0OC 3ZN0A 1KYZA 4KFCA 4YG2F 3GEZA 3J80Z 1FBSA 2K4JA 4HX8A 2GIVA 4KMUX 1O3RA 4YIIA 1W7PB 5FD6A 1IW7F 1LDDA 4EMSA 4AIJA 3BP8A 3WTUC 3M8EA 3MWMA 3F22A 5AONA 4IHSA 4HOBA 4I2OA 1P4XA 3GVAA 2L3DA 4A0ZA 5BPDA 1O3QA 2M1BA 2EB7A 3VEPA 1LB2A 2O3FA 5LGNA 1KU3A 2P4WA 4FX4A 3V7CA 5HDNA 2VBWA 2WWYA 1G3YA 1O7LA 1TW3A 4KICA 3RYRA 2YSRA 1G4DA 2KJCA 3RDIA 1OYWA 1XGOA 3KCCA 3FZVA 1R5HA 1QZZA 1USTA 1YW7A 3P9CA 2H09A 3QP6A 2NS0A 4PZJA 1ZLJA 2ZMEA 1W4MA 3TO7A 1H9TA 1RIOH 1IXSB 1WKMA 5HVQC 1F1ZA 3GFMA 1YYVA 1IXCA 4HYEA 1B1BA 3K2ZA 4HBLA 2PN6A 5JI6A 2M87A 1R5GA 3ZP5A 3E5UA 1K78A 2HGCA 4UV9A 3P9IA 2A5YB 2Q0OA 4G7ZF 3I59A 4IF4A 2IJLA 1T6SA 4G7HF 1I27A 2VT2A 3V4GA 1KQ8A 4WWCA 2A3SA 4XRFA 1ZRDA 2WTEA 4AWXB 2UXXA 1LVAA 1FY7A 3TKYA 2VBYA 5DV5A 5H20A 1R36A 2NNYA 1XN7A 3ELKA 5ICGA 3E5XA 3LSTA 1ZG5A 4UVBA 4IPAA 3EYYA 3T8TA 2HTJA 2CGPA 3DFGA 2A6HF 4YIFA 3I58A 4M6XA 3F21A 1ZGJA 2EA4A 4CGZA 2NYXA 4OMYA 3HRTA 1D8JA 2W85A 5BOXA 3K0LA 2STWA 1SMTA 4HA8A 4OIPF 4A0YA 1J75A 1MGTA 3D5LA 1E2XA 2XRNA 1P4AA 4YFXF 1T2KA 4KT5C 2QBYB 1WWXA 2ACJA 5J8FA 1BOAA 5D6FA 4L5IA 5EEGA 1WRJA 5D4SA 1OKRA 3K1PA 4EGYA 2O03A 1LEAA 4GYGA 3TO9A 4N9IA 3QOPA 2FOKA 1P4WA 1MJAA 1R00A 4ENJA 1I1SA 1UB9A 4WXCA 2JSCA 5TRDA 2BV6A 3SZPA 3CJNA 2CG4A 5K5OA 3D0SA 3KP3A 2W84A 1Z1DA 5CVRA 3FMQA 3VODA 2A07F 4A2UA 1ZN2A 2FSWA 2OZUA 4ASNA 4H0EA 4Y15A 4M71A 1HW1A 2OQGA 3WU1B 3RJPA 1OMIA 4QLCU 1X3UA 2R3SA 1P92A 3ERED 1LQ1A 2PJPA 3ZMVA 1BI1A 4HLXA 2DU9A 3CLOA 2F5DA 4HF2A 3P9KA 4P9FA 5E1XA 4MNUA 2FEZA 5LRRA 2EFWA 2VE9A 4M73A 5KVRA 4ENMA 5LHHA 3I53A 3DEUA 3J80K 5HS8A 3KZZA 1IZ1A 2DBBA 4KIGA 1MDMA 4L9NA 3WE2A 4HF0A 1AOYA 3BPVA 2VXZA 3MFKA 2FRHA 3FF5A 3RKYA 4HV6A 5E8GA 4MTDA 1SD6A 4UUVA 3GXOA 1KU2A 4HDUA 2W57A 3REOA 2EV0A 4EJOA 2GQQA 4MEXF 2DW4A 1KQ9A 3DPLC 1OPCA 5BMZA 3SZTA 3Q5FA 1J0RA 3ULQB 2MA3A 4I02A 3GYHX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7O A;  3VFZ A;  2R7D A;  1BN5 A;  3W6J B;  2VOD A;  2IA1 A;  1XMK A;  4LJZ F;  2G9W A;  1TNS A;  2KIF A;  1T39 A;  5L3C A;  1FSH A;  3ZPL A;  3WTS C;  2L4A A;  2G7U A;  2E7X A;  4PDK A;  3TDZ C;  1C0W A;  2VBZ A;  2MC3 A;  4JQF A;  3WOD F;  2XGX A;  4EQQ A;  4O6J A;  1REP C;  3E6D A;  1HST A;  2F2E A;  1LJ9 A;  4CYD A;  1KYW A;  5DYM A;  5ILS A;  4UV8 A;  2IA2 A;  2P7C B;  1R1V A;  3PQK A;  2HR3 A;  5CYV A;  3R6S A;  4A12 A;  1WSU A;  4ZZD A;  2P8T A;  3K69 A;  1FP2 A;  1FX7 A;  1P2F A;  2XKO A;  2P6T A;  4U7B A;  2UZK A;  2D1V A;  2XHK A;  2DLL A;  1DUX C;  3S2W A;  4WCG A;  4MGR A;  4M72 A;  4BHB A;  1V4R A;  5IT9 K;  4NQW A;  1SD5 A;  5L3D A;  3HTS B;  2XKP A;  5CVI A;  3GFJ A;  2RKH A;  2IW5 A;  1BIA A;  5F1R A;  1DDN A;  4Q4Z F;  4P9U A;  1XDS A;  4IJA A;  1R58 A;  1Y0U A;  3O2P E;  4UNO A;  2BYV E;  1SD7 A;  4LG0 A;  1J5Y A;  1ZH5 A;  1R1T A;  5JR3 A;  3RI4 A;  5LRS A;  3E3V A;  2ZNZ A;  4PGH A;  2H27 A;  2PQ8 A;  3U9G A;  2PFB A;  3M8F A;  1GXP A;  3JTG A;  2EV5 A;  3NEU A;  3FXQ A;  1ZGA A;  2RQP A;  3KLO A;  4RB2 C;  3RPQ A;  2QZ8 A;  4XBF A;  4ON0 A;  1W7P D;  2ESH A;  3ISP A;  3MZH A;  2RV8 A;  1A04 A;  3KE2 A;  4U0V A;  5L3F A;  1IAW A;  2O61 A;  4OIQ F;  2FF4 A;  4P55 A;  2ETH A;  3EDP A;  2WV0 A;  2VC1 A;  3HRU A;  1ZRF A;  2ZO4 A;  4YFN F;  1DPR A;  5CVJ A;  1I1G A;  2HFH A;  2ISZ A;  2EFP A;  4RGR A;  6PAX A;  1USS A;  1MJ9 A;  3C3W A;  4BH9 A;  3K1M A;  2P5V A;  3OV8 A;  4JK1 X;  2KJB A;  2ELH A;  5CLS A;  2MBF A;  3IL2 A;  2OA4 A;  2BEO A;  2Z5U A;  4EJU A;  1Z91 A;  2QQB A;  3AAF A;  4EJT A;  3ECH A;  2D45 A;  2K86 A;  4FX0 A;  3IHU A;  4ZZL A;  4RGX A;  2CSO A;  4A5N A;  2A6E F;  2CFX A;  2LF7 A;  1GHC A;  4CDG A;  2PI0 A;  1D5V A;  3BPX A;  1XSV A;  1FC3 A;  1ON1 A;  1XB4 A;  2QLZ A;  1YS6 A;  2FBH A;  2A69 F;  2OD5 A;  4N9H A;  5E1W A;  1SAX A;  4EV0 A;  4U7D A;  1XGS A;  3EQL F;  5FGM A;  4Z2Y A;  2ZME B;  2FXA A;  3GZ6 A;  1OR7 A;  2LKP A;  4MQ9 F;  4RGS A;  1BIB A;  4UHT A;  2FNA A;  1QO0 D;  2KIU A;  4OU0 A;  4RGU A;  3ML6 A;  2Y48 A;  2DPD A;  1HKQ A;  2J5O A;  4HF1 A;  4Q47 A;  1GVJ A;  4KN4 X;  2A61 A;  4ENN A;  2ZBK A;  3WTT C;  3WGH A;  4GCV A;  4LD5 A;  3BOQ A;  5DUI A;  4I09 A;  4IHT A;  1XCB A;  1RI7 A;  1XMA A;  3ABU A;  2FA5 A;  1U8R A;  4KUM A;  4EJV A;  2Z3Y A;  1FBU A;  1QQI A;  1DP7 P;  4LLL A;  2CQK A;  2GA1 A;  3W6K B;  4ZYE A;  2Z33 A;  4L9T A;  2K4B A;  1T98 A;  4RB0 A;  5DDG A;  3R61 A;  4L0Z B;  5HDK A;  3M1E A;  3PQJ A;  1EH8 A;  3JSO A;  3H3Z A;  1I6X A;  1PP8 F;  3IC7 A;  1OYY A;  1IF1 A;  1OYI A;  1VTN C;  2XAG A;  3I0T A;  4Q48 A;  3TDU C;  4AVP A;  4O3M A;  2L54 A;  4O5V A;  1G3S A;  4OMZ A;  3SQN A;  3T8R A;  3JW4 A;  2XVC A;  5CVV A;  3FM5 A;  4F7Z A;  2QVO A;  3DP7 A;  5ICF A;  4PCQ A;  4B09 A;  5HS9 A;  3U2R A;  2XRO A;  3WTY C;  4G6D A;  4BXU A;  1FSE A;  4HZF A;  5AIQ A;  2CWE A;  5L3E A;  5ERI A;  2OBP A;  3GWZ A;  1TTY A;  5LGT A;  1G6N A;  3T0Y A;  3KLN A;  3ZMT A;  2XV4 S;  1XGN A;  1R22 A;  4WXH A;  3F6V A;  4EM1 A;  2V1X A;  2LDU A;  2H6B A;  5BPI A;  1IN4 A;  3N97 A;  2DTR A;  3IRQ A;  5JHU A;  5IT9 Z;  4I0A A;  2YX4 A;  3LQQ A;  1HXD A;  4TV7 A;  3J81 K;  1UHM A;  1FWZ A;  1O7F A;  5FO5 A;  1K6O A;  3CUQ B;  2HDC A;  2M45 A;  1D8K A;  5IT3 A;  1FYL A;  4LGW A;  1SD4 A;  3J7A O;  1QZY A;  2H94 A;  5TJJ A;  1KA8 A;  1YW8 A;  3VOE A;  2RVC A;  1TW2 A;  4HQE A;  2DFI A;  3G73 A;  3LA3 A;  2DO7 A;  5ILU A;  1FLI A;  2RN7 A;  3WGG A;  4EM2 A;  3ZQ7 A;  3E5Q A;  5LBQ A;  4Q5S F;  5DUK A;  1V3F A;  2D1H A;  3E97 A;  2IA0 A;  2Q8K A;  4EVI A;  2Q2E A;  3LAP A;  3Q9V A;  5FD5 A;  4P5O A;  1MDM B;  2RC4 A;  2NAZ A;  1ULY A;  3ZMS A;  3I4P A;  4CO8 A;  1G3W A;  2W25 A;  1S3J A;  1STZ A;  1NHA A;  2DQL A;  1FYK A;  2PMH A;  5LHI A;  4G8X A;  3DQV C;  1SFE A;  3HHG A;  2JPB A;  3DV8 A;  1PP7 U;  2Y0M A;  2PG4 A;  1Z6R A;  2XAH A;  1B59 A;  1UFM A;  1IRG A;  2LNB A;  4G6Q A;  3U1D A;  4AIK A;  3N4M A;  4S05 A;  2OU2 A;  1HKS A;  2E1N A;  2QWW A;  2QEN A;  2DK8 A;  1Z6T A;  2EJR A;  2QQA A;  5EEH A;  2EWN A;  3WGI A;  2XAQ A;  3CO6 C;  4UVA A;  3DKW A;  3TGN A;  4XSX F;  1ZG1 A;  3O6B B;  2DQR A;  3CO7 C;  3HUG A;  3JTH A;  3QP5 A;  2V79 A;  4FHT A;  1JHF A;  2OZ6 A;  3FXU A;  4Y17 A;  2ISY A;  4BYY A;  4KA4 A;  5D5W B;  4HLY A;  2IT0 A;  4BNC A;  4B8X A;  1W5S A;  1BI3 A;  1YFH A;  4KIF A;  1IN7 A;  3LAJ A;  5DD8 A;  4DQ2 A;  4BHC A;  4OIN F;  1I5Z A;  2HOE A;  2GWR A;  3HSE A;  4LFU A;  1FOK A;  2COM A;  4M9Z A;  4ETS A;  3E6B A;  2MH9 A;  3EUH A;  1D3Y A;  3EET A;  2L01 A;  2VN2 A;  4OOI A;  3ABT A;  2X4H A;  5E8I A;  3WTZ A;  2M8E A;  3R4K A;  3BY6 A;  1JXS A;  5DCF A;  3T1B A;  5FB2 A;  3WTX C;  2BBY A;  4N0B A;  2DI3 A;  3KEO A;  1P6R A;  1BC7 C;  1BI0 A;  2JT1 A;  2NNN A;  4NHJ A;  1H0M A;  5E1Z B;  1BJA A;  2RNJ A;  2VOP A;  3V8K A;  4LG0 B;  3NRV A;  3WE3 A;  5FFZ A;  2F5E A;  2EFQ A;  3F8N A;  5D5X B;  2VBX A;  4PGG A;  2ZXJ A;  3K1N A;  2GZW A;  3JAM K;  3L9F A;  3EYI A;  2J5P A;  1HQC A;  1CGP A;  2UXN A;  4KYW A;  3SXY A;  1KU7 A;  2R7F A;  3RKW A;  3BWG A;  2QUF A;  2YR2 A;  3KP5 A;  4RAY A;  3FWE A;  1E17 A;  2W24 A;  4G7O F;  4XSZ F;  4I7H A;  5HLI A;  2Y75 A;  2UWM A;  1KGS A;  1CF7 A;  4RAZ A;  4UVC A;  1EH6 A;  1TQM A;  2HQN A;  5LHG A;  1QNT A;  3J81 Z;  1MD0 A;  5E20 A;  3ZMU A;  5H6R A;  3F8F A;  5L3G A;  2ZNY A;  2P5L C;  5H6Q A;  2EA2 A;  5LEK A;  1YO5 C;  2VT3 A;  2RDP A;  4JBA A;  3MAJ A;  1XSX A;  4YFK F;  1Z9C A;  1B9N A;  1ODD A;  3QRF F;  1IN6 A;  2M5W A;  3HSR A;  4KIB A;  2ZCW A;  4GO1 A;  1FNN A;  2P6S A;  1LNW A;  2NRA C;  2BE5 F;  2B0L A;  1TLH B;  4R8H A;  3HSF A;  4HW0 A;  3IWZ A;  4RB1 A;  1U5T A;  2QM3 A;  1QBJ A;  3TOB A;  4KNY A;  3B73 A;  1F5T A;  3OOP A;  2HQR A;  2XAS A;  3JSP A;  4U88 A;  1PUE E;  1YG2 A;  2TDX A;  3FMR A;  5K1Y A;  4A5M A;  1KU9 A;  3MEX A;  2HYG D;  4EGZ A;  5CJ9 A;  5A2Q Z;  4ZYH A;  3QU6 A;  4BQA A;  1XD7 A;  1XCV A;  3KP6 A;  3DPT A;  5JFR A;  1JHH A;  1RUO A;  3I54 A;  1ZYR F;  2DK5 A;  4U0Y A;  1U5T C;  3KET A;  3F8M A;  4A6D A;  1K79 A;  1S29 A;  1TQP A;  4LB6 B;  2E7W A;  4ESB A;  4IVN A;  4I0B A;  3MZY A;  5ICE A;  1RNL A;  4AIH A;  5E17 F;  2Z99 A;  3RKX A;  1T38 A;  2GAU A;  1JE8 A;  2KRF A;  2IP2 A;  1ZG3 A;  1ON2 A;  4ZH4 F;  3C18 A;  3I64 A;  3KP4 A;  3C7J A;  3LA7 A;  5AIP A;  4MEY F;  5BS6 A;  5LLQ A;  3R60 A;  2EFN A;  3FHZ A;  4WX9 A;  1HSJ A;  5ED4 A;  2FNP A;  4AD9 A;  4CZZ A;  5D8K B;  4I01 A;  3B02 A;  5J8C A;  5HS7 A;  3BZ6 A;  3HRM A;  5E18 F;  2C6Y A;  4GXO A;  2ZJ2 A;  1YIO A;  2RGV A;  1KQ0 A;  1ZLK A;  1K78 B;  5FLX K;  1BI2 A;  1U3E M;  3E6C C;  1JGS A;  1ONV A;  3I59 B;  2DPU A;  2EV6 A;  4OIO F;  5F6F A;  5LEJ A;  5DCM A;  4HX7 A;  5DEQ A;  3GX4 X;  2M30 A;  1L3L A;  2DT5 A;  4EJW A;  4HQM A;  4DNC A;  4HAM A;  3H3U A;  2PLY A;  1WI9 A;  3TOA A;  3QPH A;  2CYY A;  1HW5 A;  2O8X A;  2LF8 A;  2HKX A;  4L5J A;  1WQ2 A;  2MD5 A;  1PDN C;  1DPU A;  1W7P A;  1S8N A;  3I71 A;  4LK0 F;  4LK1 F;  4FT8 A;  3Q9S A;  1QGP A;  2MLK A;  5J6X A;  1IUY A;  3V8L A;  1CF7 B;  4MQV A;  3BJA A;  3JAM Z;  1BM9 A;  3F8B A;  1YQA A;  2VE8 A;  2MH2 A;  3HTU A;  4EM0 B;  1GXQ A;  3G3Z A;  4ZYG A;  2G7H A;  3VB2 A;  1IN8 A;  2FMY A;  1BBY A;  3F72 A;  3I5U A;  2V1U A;  3PFI A;  3GFI A;  1R7J A;  4BAY A;  1HBX G;  2L02 A;  3F23 A;  4HV5 A;  1MJB A;  5HDG A;  3HHH A;  4LLG F;  4LLN A;  2HKO A;  3F3X A;  2MLG A;  1EH7 A;  4ENK A;  1G3T A;  1B6A A;  2QQ9 A;  2XIG A;  1FZP B;  1XGM A;  3KP7 A;  3BJO A;  3ECO A;  1U78 A;  1O3T A;  2AS5 F;  1R23 A;  4KMF A;  1U2W A;  1H9G A;  4IXA A;  4XLN F;  2V1D A;  2KKO A;  3IKT A;  1J2X A;  4M9X A;  5BQT A;  1ZAO A;  3ZMZ A;  4M9S A;  1TNT A;  3L09 A;  1YW9 A;  1ZRE A;  3CDH A;  5D6E A;  1Q1H A;  3L7W A;  4NB5 A;  1XSD A;  2FE3 A;  3HIF A;  2X0L A;  5A2Q K;  5ICC A;  4L9J A;  4LMY A;  2ZFW A;  1HW2 A;  1B4A A;  3DF8 A;  4CIC A;  1UHW A;  2PBI A;  4ESJ A;  3R0J A;  5ILV A;  3CUQ A;  2K7L A;  4A0X A;  3IRR A;  1BC8 C;  2PEX A;  4G94 A;  1FYM A;  2K02 A;  3TQN A;  4E70 A;  2IRF G;  1HKT A;  1XDU A;  2CW0 F;  1U6G A;  2QBY A;  3BDD A;  4P96 A;  4CHU A;  2ZKZ A;  3MCZ A;  3MQ0 A;  5D5U B;  4G9Y A;  1SFX A;  5K5R A;  2HYF A;  3CUO A;  1FT9 A;  4HX4 A;  3CUQ C;  5KK1 A;  2VC0 A;  1T0F A;  2GXB A;  2O6G E;  3BRO A;  1IN5 A;  2FML A;  1K7A A;  1RUN A;  5D8L B;  5L3B A;  1J9I A;  2L4M A;  5K5Q A;  5FLX Z;  3RTR A;  3WU0 A;  3H92 A;  1ZRC A;  2WC2 A;  4LB5 A;  2QYO A;  3QPT A;  4IRG A;  3KP2 A;  4OIR F;  1YLF A;  1YS7 A;  4U0W A;  2ADU A;  3GZ5 A;  1J59 A;  3HRS A;  1EV7 A;  4R1H A;  2IPQ X;  2OAZ A;  3SFZ A;  4K2E A;  4L9V A;  1TQI A;  1LEB A;  1AWC A;  4L18 B;  2F5C A;  2DAO A;  1F9N A;  3M9A A;  1Z7U A;  3V7S A;  2JZY A;  4QWQ A;  2FBI A;  4CXF A;  2CO5 A;  2YPR A;  3L2C A;  1F4K A;  3BJ6 A;  5LGU A;  2STT A;  2D2W A;  1UCR A;  1B9M A;  3KZY A;  2O0Y A;  3HYI A;  1IRF A;  3WTW C;  2XUB A;  3WTV C;  2JRT A;  4M6Y A;  3GO5 A;  3GUD A;  3FXR A;  4XLP F;  3O3K A;  3FM3 A;  5FFX A;  1LDJ A;  4WF2 A;  3CTA A;  2BGC A;  3QU3 A;  2Z9O A;  3GF2 A;  3L00 A;  4GGG A;  4RS8 A;  5CVU A;  4GYI A;  3FMS A;  3LWF A;  2JTV A;  3RPU A;  1YTY A;  2XAJ A;  4I98 B;  4UXN A;  2K27 A;  1R1U A;  3QAH A;  2FU4 A;  2IVM A;  1U5T B;  1FPQ A;  3HOS A;  3V8J A;  4BHP A;  1TBX A;  2XAF A;  3NQO A;  3LA2 A;  3TO6 A;  3ZMD A;  3HOT A;  3P7N A;  3LFK A;  3F8C A;  4M74 A;  2AXL A;  4S04 A;  1QPM A;  3RYP A;  3GLX A;  5HLG A;  1ZAR A;  5D5V B;  3WG9 A;  2HWV A;  1W5T A;  4WK8 F;  2OQR A;  1SFU A;  2JPC A;  4MHG A;  4L0Y B;  1LDK B;  3C1D A;  1S6L A;  2V6C A;  5D4R A;  2YU3 A;  1MKM A;  3IKV A;  2YX7 A;  4HDV A;  2VOO A;  2EK5 A;  2F5F A;  4D0P A;  3R0A A;  2KIM A;  4ESF A;  1Z05 A;  2A68 F;  1S7A A;  2HTS A;  5DD4 A;  3E6M A;  3ROU A;  2E1C A;  1O57 A;  3KFW X;  3DXJ F;  2EFO A;  2HS5 A;  2FBK A;  4A6E A;  4IRI A;  4MTE A;  1IXR C;  5F64 A;  5HOO A;  4KN7 X;  2HEO A;  3GW2 A;  3K9T A;  1RZ4 A;  2GXG A;  1J7K A;  1ZHF A;  4R79 A;  3IWF A;  3M7G A;  1MZB A;  2GA2 A;  1FP1 D;  2H6C A;  3F6O A;  2VON A;  3T5X A;  3KEQ A;  3RIR A;  1SMY F;  2P7V B;  1O3S A;  2FQ3 A;  2ESN A;  4ZYD A;  3FX3 A;  3SHF A;  2HZT A;  5JVT A;  4WXD A;  4RB3 C;  3COA C;  1FBQ A;  3GFL A;  5DCM B;  2P5K A;  3LQR A;  4Y13 A;  4KDP A;  4IRH A;  3ZN1 A;  2LSO A;  3V7R A;  5HLH A;  2PMU A;  2V9V A;  1L0O C;  3ZN0 A;  1KYZ A;  4KFC A;  4YG2 F;  3GEZ A;  3J80 Z;  1FBS A;  2K4J A;  4HX8 A;  2GIV A;  4KMU X;  1O3R A;  4YII A;  1W7P B;  5FD6 A;  1IW7 F;  1LDD A;  4EMS A;  4AIJ A;  3BP8 A;  3WTU C;  3M8E A;  3MWM A;  3F22 A;  5AON A;  4IHS A;  4HOB A;  4I2O A;  1P4X A;  3GVA A;  2L3D A;  4A0Z A;  5BPD A;  1O3Q A;  2M1B A;  2EB7 A;  3VEP A;  1LB2 A;  2O3F A;  5LGN A;  1KU3 A;  2P4W A;  4FX4 A;  3V7C A;  5HDN A;  2VBW A;  2WWY A;  1G3Y A;  1O7L A;  1TW3 A;  4KIC A;  3RYR A;  2YSR A;  1G4D A;  2KJC A;  3RDI A;  1OYW A;  1XGO A;  3KCC A;  3FZV A;  1R5H A;  1QZZ A;  1UST A;  1YW7 A;  3P9C A;  2H09 A;  3QP6 A;  2NS0 A;  4PZJ A;  1ZLJ A;  2ZME A;  1W4M A;  3TO7 A;  1H9T A;  1RIO H;  1IXS B;  1WKM A;  5HVQ C;  1F1Z A;  3GFM A;  1YYV A;  1IXC A;  4HYE A;  1B1B A;  3K2Z A;  4HBL A;  2PN6 A;  5JI6 A;  2M87 A;  1R5G A;  3ZP5 A;  3E5U A;  1K78 A;  2HGC A;  4UV9 A;  3P9I A;  2A5Y B;  2Q0O A;  4G7Z F;  3I59 A;  4IF4 A;  2IJL A;  1T6S A;  4G7H F;  1I27 A;  2VT2 A;  3V4G A;  1KQ8 A;  4WWC A;  2A3S A;  4XRF A;  1ZRD A;  2WTE A;  4AWX B;  2UXX A;  1LVA A;  1FY7 A;  3TKY A;  2VBY A;  5DV5 A;  5H20 A;  1R36 A;  2NNY A;  1XN7 A;  3ELK A;  5ICG A;  3E5X A;  3LST A;  1ZG5 A;  4UVB A;  4IPA A;  3EYY A;  3T8T A;  2HTJ A;  2CGP A;  3DFG A;  2A6H F;  4YIF A;  3I58 A;  4M6X A;  3F21 A;  1ZGJ A;  2EA4 A;  4CGZ A;  2NYX A;  4OMY A;  3HRT A;  1D8J A;  2W85 A;  5BOX A;  3K0L A;  2STW A;  1SMT A;  4HA8 A;  4OIP F;  4A0Y A;  1J75 A;  1MGT A;  3D5L A;  1E2X A;  2XRN A;  1P4A A;  4YFX F;  1T2K A;  4KT5 C;  2QBY B;  1WWX A;  2ACJ A;  5J8F A;  1BOA A;  5D6F A;  4L5I A;  5EEG A;  1WRJ A;  5D4S A;  1OKR A;  3K1P A;  4EGY A;  2O03 A;  1LEA A;  4GYG A;  3TO9 A;  4N9I A;  3QOP A;  2FOK A;  1P4W A;  1MJA A;  1R00 A;  4ENJ A;  1I1S A;  1UB9 A;  4WXC A;  2JSC A;  5TRD A;  2BV6 A;  3SZP A;  3CJN A;  2CG4 A;  5K5O A;  3D0S A;  3KP3 A;  2W84 A;  1Z1D A;  5CVR A;  3FMQ A;  3VOD A;  2A07 F;  4A2U A;  1ZN2 A;  2FSW A;  2OZU A;  4ASN A;  4H0E A;  4Y15 A;  4M71 A;  1HW1 A;  2OQG A;  3WU1 B;  3RJP A;  1OMI A;  4QLC U;  1X3U A;  2R3S A;  1P92 A;  3ERE D;  1LQ1 A;  2PJP A;  3ZMV A;  1BI1 A;  4HLX A;  2DU9 A;  3CLO A;  2F5D A;  4HF2 A;  3P9K A;  4P9F A;  5E1X A;  4MNU A;  2FEZ A;  5LRR A;  2EFW A;  2VE9 A;  4M73 A;  5KVR A;  4ENM A;  5LHH A;  3I53 A;  3DEU A;  3J80 K;  5HS8 A;  3KZZ A;  1IZ1 A;  2DBB A;  4KIG A;  1MDM A;  4L9N A;  3WE2 A;  4HF0 A;  1AOY A;  3BPV A;  2VXZ A;  3MFK A;  2FRH A;  3FF5 A;  3RKY A;  4HV6 A;  5E8G A;  4MTD A;  1SD6 A;  4UUV A;  3GXO A;  1KU2 A;  4HDU A;  2W57 A;  3REO A;  2EV0 A;  4EJO A;  2GQQ A;  4MEX F;  2DW4 A;  1KQ9 A;  3DPL C;  1OPC A;  5BMZ A;  3SZT A;  3Q5F A;  1J0R A;  3ULQ B;  2MA3 A;  4I02 A;  3GYH X; 
#chains in the Genus database with same CATH topology
 1S7O A;  3CCL I;  3VFZ A;  1K83 J;  2R7D A;  3NAR A;  1BN5 A;  3W6J B;  2VOD A;  2IA1 A;  2KZV A;  1XMK A;  4LJZ F;  2G9W A;  3CD6 I;  3OYD A;  1TNS A;  2KIF A;  5JVG F;  4GDF A;  3B6C A;  1SFO J;  1T39 A;  5L3C A;  1FSH A;  3SYT A;  2NS7 A;  2A5W A;  5IOY A;  4XRS A;  3JRF A;  3ZPL A;  2KRC A;  3WTS C;  2L4A A;  2G7U A;  2Y9Y A;  2E7X A;  5M3M J;  1V54 H;  2X1D A;  4PDK A;  3TDZ C;  4BDY A;  1C0W A;  1FOY A;  2VBZ A;  3LSG A;  2MC3 A;  2CU7 A;  4JQF A;  2X85 A;  3WOD F;  2XGX A;  3BC8 A;  4EQQ A;  4O6J A;  1REP C;  3E6D A;  1HST A;  1X1P A;  3OIO A;  3AG2 H;  2F2E A;  1LJ9 A;  2NOJ B;  4CYD A;  1KYW A;  5DYM A;  3DEW A;  2QGU A;  5ILS A;  4F55 A;  2HXO A;  2KPM A;  3NWS A;  4UV8 A;  2DA2 A;  2IA2 A;  1D1B A;  2P7C B;  2OTJ I;  2M2E A;  1R1V A;  3PQK A;  3K6G A;  2HR3 A;  5CYV A;  3R6S A;  4A12 A;  1WSU A;  4ZZD A;  2P8T A;  3K69 A;  1FP2 A;  1FX7 A;  2BHZ A;  1P2F A;  2XKO A;  2P6T A;  4U7B A;  3A01 B;  4A3M J;  2UZK A;  3S1N J;  5GPA A;  2D1V A;  2XHK A;  1O4X A;  1M1E B;  2DLL A;  2UV1 A;  1DUX C;  3S2W A;  4WCG A;  4MGR A;  4M72 A;  4BHB A;  3M3Y J;  1V4R A;  2DMU A;  2JWT A;  4IO9 F;  2GOX B;  5IT9 K;  4NQW A;  3CJR B;  4DYR A;  3S3N A;  2E60 A;  1TWH J;  1SD5 A;  2E5N A;  4LG3 A;  5L3D A;  3HTS B;  2XKP A;  2IAI A;  2Y0S N;  3GFJ A;  2RKH A;  5CVI A;  3OYB A;  5GP9 A;  2IW5 A;  1BIA A;  2E34 A;  5F1R A;  1DDN A;  4Q4Z F;  4P9U A;  1XDS A;  4XQF A;  4IJA A;  4N4N B;  4E7Z A;  2K5C A;  1R58 A;  1Y0U A;  3O2P E;  4UNO A;  2VUM J;  2BYV E;  2KMU A;  3N05 A;  1SD7 A;  4LG0 A;  4NBQ A;  2WAQ A;  5CKT A;  1J5Y A;  1ZH5 A;  3S16 J;  3PIO F;  1Z67 A;  1R1T A;  4X1E A;  4ZDL A;  4EEF G;  5JR3 A;  3RI4 A;  5LRS A;  3E3V A;  4CCL A;  2ZNZ A;  4HST A;  4PGH A;  2H27 A;  3W2V A;  2PQ8 A;  3U9G A;  4J19 A;  2PFB A;  3M8F A;  1GXP A;  3JTG A;  1T8I A;  3BG5 A;  4CCO A;  2EV5 A;  3WHB A;  2HU9 A;  3NEU A;  1UJ8 A;  3FXQ A;  5EF6 A;  1ZGA A;  2F48 A;  3TP3 A;  3Q0W A;  1QVT A;  2RQP A;  3KLO A;  4AYB A;  3ZGK A;  1MSE C;  2LC2 A;  2LOO A;  4RB2 C;  3RPQ A;  1VQ8 I;  1JKR C;  4AVZ A;  4F3Q A;  2QZ8 A;  2MW8 A;  3HC7 A;  4XBF A;  4ON0 A;  1W7P D;  2ESH A;  3ISP A;  3MZH A;  2RV8 A;  3S17 J;  1A04 A;  5B5E C;  1FMW A;  3KE2 A;  4PUS A;  4U0V A;  5FKM A;  5L3F A;  1IAW A;  2JA6 J;  4OIQ F;  2O61 A;  5F0C A;  2FF4 A;  1SVL A;  1MBG A;  2CW7 A;  4IOC F;  4P55 A;  4B3X A;  2AO9 A;  5GAH J;  2ETH A;  3EDP A;  4CA0 A;  2WV0 A;  2F4M B;  2WB1 N;  3ZQQ A;  2VC1 A;  5K7Z A;  1IUF A;  3HRU A;  2XC7 A;  2R5Z A;  1ZRF A;  2ZO4 A;  4ZTJ A;  2NOG A;  3DU5 A;  4YFN F;  1DPR A;  2QEX I;  5CVJ A;  1I1G A;  2HFH A;  2ISZ A;  3OYI A;  2EFP A;  1HC8 A;  2BHY A;  3PSF A;  4RGR A;  2L9S A;  1OCT C;  2CQ7 A;  1U8B A;  6PAX A;  3A4C A;  1USS A;  1MJ9 A;  3C3W A;  4BH9 A;  2PJR A;  2VLA A;  3K1M A;  1EA3 A;  3PUB A;  2Y30 A;  2P5V A;  3OV8 A;  2KT0 A;  2KJB A;  2QF7 A;  4JK1 X;  4J01 A;  5J47 A;  2ELH A;  3D5R C;  5CLS A;  2MBF A;  2Y31 A;  3IL2 A;  2OA4 A;  2BEO A;  2Z5U A;  4EJU A;  1Z91 A;  2QQB A;  3AAF A;  4EJT A;  3ECH A;  4XON A;  2M0C A;  4Z6Y A;  2E2J J;  2D45 A;  2K86 A;  4FX0 A;  3IHU A;  3K4L A;  4ZZL A;  2QKM B;  4E7S A;  4RGX A;  4QPO A;  2CSO A;  2IS1 A;  3H35 A;  4A5N A;  2V1N A;  2A6E F;  2VAS A;  4EAT A;  2IGN A;  2OF7 A;  2CFX A;  2LF7 A;  1GHC A;  4CDG A;  2PI0 A;  3CME I;  3BPX A;  1D5V A;  1XSV A;  2QCO A;  1FC3 A;  2R7Z J;  2PMZ N;  4W97 A;  3BCB A;  1ON1 A;  1XB4 A;  2XAU A;  2QLZ A;  1YS6 A;  2KDO A;  2MD0 A;  3OYC A;  2OPT A;  1R49 A;  3BG6 A;  2FBH A;  3H1C A;  2A69 F;  3BR2 A;  2EIL H;  4FIS A;  1WJF A;  2OD5 A;  4N9H A;  3CF2 A;  4II2 A;  4RAG A;  5E1W A;  5IY5 H;  9ANT A;  2AQE A;  1UG0 A;  5DTD A;  3DBR B;  5HOD A;  4X0G A;  1SAX A;  3IH3 A;  4EV0 A;  4U7D A;  1XGS A;  2X6Y A;  3EQL F;  5FGM A;  4Z2Y A;  5KNL A;  4U87 A;  3S15 J;  2DMQ A;  2ZME B;  2IBD A;  2FXA A;  3GZ6 A;  1OR7 A;  2LKP A;  3GTM J;  1MW7 A;  1HCR A;  2XB5 A;  4MQ9 F;  2Y0S A;  4RGS A;  1BIB A;  4UHT A;  1BL0 A;  2HPI A;  2LKX A;  4QPQ A;  2FNA A;  4JX4 A;  2OJE D;  1QO0 D;  2KIU A;  4OU0 A;  4RGU A;  3ML6 A;  2Y48 A;  1VF9 A;  2DPD A;  3CQZ J;  4A93 J;  1U9N A;  2HYJ A;  1HKQ A;  3LFU A;  2VJJ A;  2J5O A;  4HF1 A;  1QVU A;  1RC9 A;  1GVJ A;  4KN4 X;  4Q47 A;  1W36 D;  2A61 A;  1PUF B;  3H9Q A;  4XOT A;  4ENN A;  2ZBK A;  2DA4 A;  3WTT C;  1YJ9 I;  3WGH A;  4GCV A;  2M9H A;  4LD5 A;  3BOQ A;  3L1P A;  3GYH X;  5DUI A;  4I09 A;  4BJ5 C;  3TBI A;  1XMX A;  4IHT A;  1XCB A;  1RI7 A;  1XMA A;  3K4N A;  3ABU A;  2FA5 A;  2IGO A;  1U8R A;  1OR7 C;  3SZG A;  4BBR J;  3H36 A;  4KUM A;  2Z3Y A;  4EJV A;  1FBU A;  1QQI A;  2JJ7 A;  1MMD A;  1DP7 P;  2HNH A;  3JRI A;  4FCY A;  4LLL A;  2CQK A;  2GA1 A;  1MH4 A;  3W6K B;  4ZYE A;  1WPK A;  2Z33 A;  2LY9 A;  4L9T A;  5CPR B;  2K4B A;  2VQG A;  1T98 A;  1MNE A;  4RB0 A;  1HOM A;  4KIS A;  4MLO A;  2O7O A;  4F91 B;  3L2W A;  5DDG A;  3CCQ I;  2I5U A;  3R61 A;  5C4J J;  4L0Z B;  1D0Y A;  5HDK A;  2CV1 A;  3M1E A;  2W82 A;  4A3C J;  3PQJ A;  4A3D J;  3OOU A;  1EH8 A;  4CYC B;  3JSO A;  3H3Z A;  4C2M J;  1I6X A;  2CUF A;  1PP8 F;  3IC7 A;  1K4S A;  1OYY A;  3JRD A;  2R7S A;  1IF1 A;  3LSM A;  1OYI A;  2KHM A;  1VTN C;  5KAF C;  2XAG A;  1VFC A;  2M34 A;  3J7A Y;  3I0T A;  2WB1 A;  4Q48 A;  4IX7 A;  2ECC A;  3TDU C;  1ETK A;  4AVP A;  4O3M A;  3HDD A;  2L54 A;  4O5V A;  3SDG A;  4P1W A;  1GV5 A;  3PUF A;  1G3S A;  3A1Y A;  4BXX J;  4OMZ A;  2E1M B;  3WHC A;  3SQN A;  3PNT A;  3T8R A;  2IS4 A;  4PK4 A;  2LH9 A;  3JW4 A;  2XVC A;  1OCO H;  4PFO A;  5CVV A;  3FM5 A;  2R7Q A;  4UY8 I;  1SEU A;  4F7Z A;  2M7A A;  3KX2 A;  2QVO A;  3DP7 A;  5FKN A;  1A6I A;  1ZQ3 P;  4Y3O A;  3ZQG A;  5ICF A;  4BY1 J;  4PCQ A;  1FIA A;  4FET A;  4B09 A;  4HNT A;  5HS9 A;  4A3I J;  2HPM A;  3U2R A;  2XRO A;  2B7E A;  3WTY C;  2HI3 A;  4G6D A;  2GXA A;  2MG4 A;  5EYR A;  4BXU A;  3OYK A;  1ETV A;  1GDT A;  4IQJ A;  1FSE A;  4HZF A;  1OCR H;  3GLL A;  5AIQ A;  2CWE A;  5L3E A;  1X4O A;  5ERI A;  4XR6 A;  1YRN A;  1S7E A;  2OBP A;  3CMM A;  1TTY A;  3GWZ A;  1G6N A;  3NWT A;  3Q0U A;  3T0Y A;  2P81 A;  5LGT A;  3KLN A;  3ZMT A;  3K4J A;  2XV4 S;  1XGN A;  1R22 A;  4WXH A;  3FIS A;  3F6V A;  4EM1 A;  5KHD A;  2V1X A;  2LDU A;  1Y1V J;  2H6B A;  3OR2 C;  1D5Y A;  3FXL A;  1H88 C;  4RM3 A;  4UB8 C;  1JTY A;  4XKC A;  2DA3 A;  5BPI A;  1IN4 A;  1A36 A;  3N97 A;  4M3E A;  3BCA A;  2DTR A;  3IRQ A;  4Y52 J;  5JHU A;  5IT9 Z;  2PMZ A;  2F4O B;  1RPW A;  2YU9 J;  4B43 A;  3K70 D;  4I0A A;  2YX4 A;  3LQQ A;  1HXD A;  4TV7 A;  4BUP A;  2M8G X;  3J81 K;  1PJR A;  1UHM A;  4CCM A;  1TZL A;  2XPU A;  2CV2 A;  1FWZ A;  5CQG A;  1O7F A;  5FO5 A;  1LE8 A;  4DJA A;  3TL4 X;  1K6O A;  2ECB A;  3CUQ B;  4CCK A;  2HDC A;  2M45 A;  4CCN A;  1D8K A;  5IT3 A;  1FYL A;  4LGW A;  1SD4 A;  1WJD A;  3BR0 A;  2K3F A;  3J7A O;  1NG7 A;  4H4K C;  5EGO B;  3GZN B;  1QZY A;  2H94 A;  4QIW N;  3JRH A;  1I3A A;  1F36 A;  3M4O J;  5M5X J;  3VPR A;  5TJJ A;  2XF7 A;  1KA8 A;  2VJ5 A;  4LIV A;  4C3I J;  3RQI A;  3UR3 C;  1YW8 A;  4Y4R A;  3VOE A;  3FXJ A;  3K4C A;  3LSI A;  2F6C A;  4F52 A;  2RVC A;  1OCZ H;  1TW2 A;  2XGD A;  5J1R A;  4HQE A;  4NNJ A;  2DFI A;  3G73 A;  2DYR H;  2Z2S B;  3LA3 A;  3I56 I;  1JTX A;  2DO7 A;  3ZR8 X;  5ILU A;  1FLI A;  4E4H A;  4B3A A;  2EH3 A;  2XF6 A;  2RN7 A;  2LMD A;  3WGG A;  4EM2 A;  2MFZ A;  3ZQ7 A;  3E5Q A;  2HZD A;  2BXY A;  5LBQ A;  4Q5S F;  5DUK A;  4A3G J;  1V3F A;  2D1H A;  3E97 A;  2IA0 A;  2Q8K A;  2LG4 A;  4EVI A;  2Q2E A;  2DA5 A;  3LAP A;  1VQM I;  3Q9V A;  5FD5 A;  4P5O A;  1MDM B;  2CH0 A;  2RC4 A;  2NAZ A;  3CJQ B;  1GVD A;  1ULY A;  2EIK H;  3S32 A;  3ZMS A;  4Y7N J;  3I4P A;  3QWL A;  4CO8 A;  4IZZ A;  1G3W A;  3FIW A;  2W25 A;  1S3J A;  2BY0 A;  4YIR X;  1QRY A;  1STZ A;  2VJI A;  1NHA A;  4XIC A;  4FTH A;  2DQL A;  1FYK A;  1Z7L A;  2PMH A;  3AFH A;  5LHI A;  4G8X A;  3W3C A;  3DQV C;  1D0X A;  3PO3 J;  1GUU A;  5EJC A;  1SFE A;  3IAS 2;  3HHG A;  2JPB A;  1APL C;  3DV8 A;  4XK4 A;  1PP7 U;  1P9Q C;  2Y0M A;  2PG4 A;  3HGY A;  2N8G A;  1Z6R A;  1YHQ I;  2XAH A;  1B59 A;  4DOZ A;  1UFM A;  1VQ9 I;  1IRG A;  2LNB A;  4G6Q A;  3U1D A;  3MKL A;  5GTI C;  4AIK A;  3I9V 2;  4S05 A;  3N4M A;  2OU2 A;  1YJW I;  3FHN A;  1ZR2 A;  2LK2 A;  1WJB A;  1HKS A;  4CSW A;  4NC7 A;  2E1N A;  1E3H A;  3BTC A;  2QWW A;  3DBL B;  5IYD J;  2JVH A;  1TWC J;  2QEN A;  2DK8 A;  1Z6T A;  2EJR A;  2QQA A;  3AG1 H;  3BZC A;  5EEH A;  5FLV A;  4PJN A;  2EWN A;  3C2B A;  3ZRG A;  3WGI A;  2XAQ A;  4ZYA A;  3CO6 C;  2VKH A;  4UVA A;  5LFA A;  3DKW A;  3TGN A;  4XSX F;  1ZG1 A;  3O6B B;  2DQR A;  4D9J A;  4A3B J;  3CO7 C;  1RR8 C;  3BTL A;  3HUG A;  1V5G A;  3FK7 A;  3JTH A;  3QP5 A;  2V79 A;  4FHT A;  1JHF A;  2OZ6 A;  3FXU A;  3D5S C;  3BQY A;  1VND A;  4XOR A;  2Y9Z A;  1X1B A;  2BVM A;  4Y17 A;  2ISY A;  3AL0 B;  4BYY A;  4J00 A;  4KA4 A;  4XRM A;  5D5W B;  4HLY A;  2BW3 B;  1Y39 A;  1B72 A;  4B8X A;  4V2F A;  1W5S A;  2IT0 A;  4PSW A;  3CCJ I;  4BNC A;  5DM6 F;  1BI3 A;  2HDD A;  3B6A A;  4XLH A;  4BL0 B;  1YFH A;  2KL4 A;  1YOV B;  4KIF A;  1IN7 A;  3LAJ A;  4C30 A;  2CQQ A;  3CCU I;  5DD8 A;  4DQ2 A;  1X58 A;  1WH5 A;  2ME6 A;  4FAS D;  4BHC A;  3HG9 A;  4A3F J;  4IHX A;  1ERD A;  4OIN F;  5J4V A;  4DBR A;  1I5Z A;  5B1B H;  1FOX A;  2BVL A;  2HOE A;  2GWR A;  3HSE A;  4AUX A;  4LFU A;  5IP9 J;  1FOK A;  1U0J A;  2COM A;  1YX5 A;  4M9Z A;  2R7V A;  4FE4 A;  3PSI A;  1X1C A;  4ETS A;  5C3E J;  1J09 A;  2MH9 A;  3E6B A;  2ZJR F;  1MMN A;  3EUH A;  2IXS A;  2ZB9 A;  2DDA A;  4RLQ A;  5GAG J;  3PJR A;  3TMO A;  4XN3 A;  1D3Y A;  4IQ4 A;  3EET A;  2L01 A;  2VN2 A;  5B3S H;  4OOI A;  4BQN A;  3ABT A;  4D5C A;  2X4H A;  5E8I A;  3WTZ A;  4N4O B;  2CFO A;  2M8E A;  3QOE A;  3BY6 A;  3R4K A;  1WI3 A;  4X6A J;  4JYK A;  1MMG A;  2MAB A;  2DXI A;  1DP3 A;  5DCF A;  1JXS A;  5H2F C;  3T1B A;  4I6Z A;  2WAD A;  5FB2 A;  3WTX C;  2BBY A;  5HNF A;  4NQW B;  1P7J A;  2JUC A;  4N0B A;  2X1C A;  5HNH A;  2DI3 A;  3KEO A;  3V42 A;  4NDL A;  1DQU A;  1P6R A;  2BXZ A;  2JRM A;  1GV2 A;  3K70 C;  1IC8 A;  1BC7 C;  1BI0 A;  2JT1 A;  2NNN A;  4B1R A;  1H0M A;  4NHJ A;  2K9L A;  4XL9 A;  4A3E J;  5E1Z B;  2EPF A;  3P5J A;  1K4T A;  1BJA A;  3EUH C;  2RNJ A;  2VOP A;  3I4M J;  3QPL A;  3IV5 A;  2YUS A;  2NVU B;  5J4Y A;  2MYS A;  1LVK A;  3V8K A;  4W1U A;  4LG0 B;  1HA8 A;  2K40 A;  3NRV A;  3WE3 A;  4HNU A;  1FIP A;  1TT0 A;  1ZK8 A;  5FFZ A;  2F5E A;  2EFQ A;  3F8N A;  1UMQ A;  1LFP A;  2VBX A;  4PGG A;  5D5X B;  1JUM A;  2LBF B;  1XC5 A;  2ZXJ A;  2R0Q C;  2X1E A;  2DA6 A;  3K1N A;  2GZW A;  2V4J C;  2ZFU A;  3JAM K;  3L9F A;  2HVR A;  3EYI A;  3OYG A;  2J5P A;  1WCM J;  4E7J A;  2LRE A;  4BBS J;  1HQC A;  1CGP A;  1IG7 A;  2UXN A;  5BNG A;  1IV6 A;  1OLT A;  1U9O A;  2XB0 X;  4LOC A;  4KYW A;  3AG3 H;  3SXY A;  1KU7 A;  2R7F A;  3RKW A;  3BWG A;  2KP6 A;  4V19 K;  2QUF A;  1BR4 A;  2YR2 A;  3KP5 A;  4RAY A;  1W1W E;  3FWE A;  2M3A A;  1E17 A;  3SDB A;  2W24 A;  2O9L A;  4G7O F;  2W48 A;  1RRJ A;  4XSZ F;  3IAM 2;  3FBN B;  4I7H A;  1X3Z B;  3O8H A;  3OYM A;  5HLI A;  2JVG A;  2Y75 A;  1N77 A;  2KLO A;  2UWM A;  1KGS A;  4BAC A;  1CF7 A;  2W1O A;  3F0C A;  2X6X A;  3S93 A;  5FKO A;  2Z1D A;  4RAZ A;  4UVC A;  1EH6 A;  4CUG A;  1HF0 A;  2XRL A;  3OSF A;  2R5Z B;  3G1L A;  1MIJ A;  1TQM A;  2HQN A;  5LHG A;  1QNT A;  2GOM A;  3J81 Z;  1MD0 A;  5E20 A;  5DS9 A;  3ZMU A;  5H6R A;  1VZ0 A;  2F5V A;  2M4G A;  2X48 A;  3F8F A;  5L3G A;  2JSP A;  2PJR B;  2ZNY A;  2P5L C;  5H6Q A;  1Y56 A;  1G2H A;  2K85 A;  1I50 J;  5EZG A;  2EA2 A;  3W2W A;  3ZCO A;  5LEK A;  2B9S A;  1YO5 C;  3EUK L;  1BJZ A;  2VT3 A;  3CC2 I;  2RDP A;  4JBA A;  3MAJ A;  2R7U A;  1XSX A;  4YFK F;  3KPH A;  1Z9C A;  1B9N A;  1VI0 A;  1ODD A;  1VQK I;  1ENH A;  2EIJ H;  1VQP I;  2A6T A;  3QRF F;  1IN6 A;  1GLN A;  2M5W A;  3HSR A;  4KIB A;  5M5Y J;  2ZCW A;  2QQ8 A;  2NVY J;  4BGD A;  2W7N A;  3TED A;  3HOV J;  3ABL H;  2FUG 2;  4GO1 A;  2E71 A;  1FNN A;  1A6Q A;  2P6S A;  4G6T B;  1LNW A;  2NRA C;  2TRT A;  3VSK A;  2BE5 F;  2ICW G;  2B0L A;  1TLH B;  4M3D A;  4R8H A;  3QYF A;  1X4P A;  3HSF A;  4XRS G;  4HW0 A;  3IWZ A;  3TW6 A;  4RB1 A;  1U5T A;  2QM3 A;  1QBJ A;  1QZE A;  2QSG X;  3K2A A;  3TOB A;  4KNY A;  3B73 A;  2Y69 H;  1F5T A;  2LKS A;  3OOP A;  2H1L A;  2HQR A;  2XAS A;  3JSP A;  4U88 A;  3S1R J;  1PUE E;  3CF5 F;  1YG2 A;  3LSK A;  2L9V A;  3PNV A;  2TDX A;  3FMR A;  1SVO A;  4A5M A;  4RMN A;  1KU9 A;  5K1Y A;  3MEX A;  2HYG D;  4EGZ A;  5CJ9 A;  5A2Q Z;  3PFY A;  2ME0 A;  4ZYH A;  3QU6 A;  3TP0 A;  4RBO A;  1A31 A;  3CC4 I;  3I55 I;  4BQA A;  1JGG A;  1XD7 A;  1W0U A;  3RKQ A;  5JLW A;  1XCV A;  3KP6 A;  3DPT A;  1T95 A;  5JFR A;  1JHH A;  1RUO A;  2F4I A;  3I54 A;  1ZYR F;  2DK5 A;  2E35 A;  3DEE A;  4U0Y A;  1U5T C;  1R5I D;  2L2O A;  3KET A;  2Y2Z A;  3F8M A;  4A6D A;  5LD2 C;  1OIS A;  1K79 A;  1S29 A;  4AM3 A;  1TQP A;  3CCY A;  2XGE A;  2WV1 A;  5IP6 A;  5IYC J;  4M3F A;  4LB6 B;  2E7W A;  4ESB A;  3J7Z I;  3KYL A;  4IVN A;  4I0B A;  1TT5 B;  3MZY A;  2RRE A;  2KIQ A;  4MFE A;  5ICE A;  1RNL A;  4AIH A;  5E17 F;  2Z99 A;  3RKX A;  1MBK A;  1T38 A;  2GAU A;  4IL6 C;  1JE8 A;  2KRF A;  2IP2 A;  1ZG3 A;  1ON2 A;  1JKQ C;  1YIJ I;  2V6E A;  1OFC X;  5F08 A;  4IOA F;  1LFB A;  3LSP A;  3QPS A;  1AKH B;  4ZH4 F;  2FQ4 A;  3C18 A;  3I64 A;  3KP4 A;  3C7J A;  3LA7 A;  1BR1 A;  2XPW A;  3CJT B;  5AIP A;  2L7F P;  4RDU A;  1XS9 A;  1WHU A;  3MVP A;  1OJL A;  2OUM A;  4MEY F;  4CH7 A;  5BS6 A;  3R60 A;  2EFN A;  5LLQ A;  3G4S I;  1TC3 C;  1IO2 A;  3CCS I;  3S2H J;  2GLO A;  2KIS A;  5M3F J;  2NVQ J;  3FHZ A;  4BKX A;  4WX9 A;  1MNM C;  1HSJ A;  5ED4 A;  1Z3X A;  2FNP A;  4LIT A;  3ZOB A;  2IEK A;  4AD9 A;  2VJ4 A;  1V5F A;  4GRI A;  4JP0 A;  1E0E A;  1TL8 A;  4CZZ A;  4B44 A;  5D8K B;  4I01 A;  5FKL A;  3HOX J;  2EZI A;  3H9G A;  2K3P A;  3KEY A;  3B02 A;  5J8C A;  5HS7 A;  3BZ6 A;  2OTL I;  3HRM A;  2E2I J;  5E18 F;  2C6Y A;  4GXO A;  2ZJ2 A;  1YIO A;  2RGV A;  1KQ0 A;  1ZLK A;  1K78 B;  5FLX K;  3GBG A;  1BI2 A;  3HKZ N;  5C44 J;  3EUA A;  3OYF A;  1U3E M;  2VKD A;  3E6C C;  1JGS A;  3CDI A;  1ONV A;  1IJW C;  2KRH A;  3I59 B;  2DPU A;  3E1S A;  1E3P A;  2EV6 A;  4RLF A;  2LD5 A;  3G2B A;  4E6K G;  4PJJ A;  1HLV A;  1Z77 A;  1MBF A;  4OIO F;  5F6F A;  1HDD C;  5LEJ A;  5DCM A;  4HX7 A;  2WAE A;  1JKO C;  5DEQ A;  4M6V A;  1BA5 A;  2P0W A;  2M30 A;  3BR5 A;  3FKI J;  3OIQ A;  3GX4 X;  2CV0 A;  1L3L A;  1LPQ A;  3IP4 B;  4UUS B;  2DT5 A;  3GCM A;  5KCM A;  4EJW A;  2VPL A;  2B63 J;  4HQM A;  4DNC A;  4HAM A;  3DWL E;  3H3U A;  2PLY A;  1WVR A;  2DN0 A;  5E3O A;  3A02 A;  1G8X A;  3MKZ A;  3S1M J;  1WI9 A;  1H89 C;  1Y8R B;  3H5R A;  4IKF A;  1FTT A;  2JA2 A;  3TOA A;  5E3N A;  4XLC A;  2KQR A;  3QPH A;  2CYY A;  2VKE A;  4BY7 J;  1HW5 A;  3U1K A;  3FBI B;  2O8X A;  2LF8 A;  3OS0 A;  3VWB A;  2DOD A;  2HKX A;  4L5J A;  1WQ2 A;  2QA4 I;  1OQY A;  1VQL I;  2MD5 A;  3JRG A;  1LE8 B;  1PDN C;  1DPU A;  1W7P A;  1D1C A;  3G6E I;  4BJT A;  1S8N A;  2COB A;  3I71 A;  4LK0 F;  4LK1 F;  2K9Q A;  3S14 J;  3GTJ J;  4FT8 A;  1X2M A;  3Q9S A;  3RSN A;  1QGP A;  2VL8 A;  1JJ8 C;  3CZ6 A;  2MLK A;  1BW6 A;  5FRO A;  4AU7 A;  5J6X A;  1IUY A;  3DKX A;  3V8L A;  1CF7 B;  3PIP F;  4MQV A;  3MMY B;  3BJA A;  3JAM Z;  1BM9 A;  4BU2 A;  3F8B A;  4CZC A;  2ZJP F;  1WGX A;  5B1A H;  1YQA A;  1VQ4 I;  2VE8 A;  2MH2 A;  3HTU A;  1TWG J;  3DU6 A;  4EM0 B;  3DTK A;  1PUF A;  1GXQ A;  3G3Z A;  5EDN A;  4ZYG A;  4M3G A;  3HM5 A;  1WJC A;  3QQA A;  2G7H A;  3A0H C;  3VB2 A;  1IN8 A;  3H5N A;  2XF5 A;  1ORK A;  2ZME C;  2DT6 A;  1JI8 A;  2FMY A;  2MC4 A;  2Q2E B;  1BBY A;  3F72 A;  3I5U A;  2V1U A;  4D7M A;  2TCT A;  2NVT J;  2IGM A;  4LIU A;  3PFI A;  3GFI A;  1GT0 C;  1R7J A;  2VQH A;  2R7R A;  4BAY A;  1IRX A;  2GBY A;  3L2Q A;  1N25 A;  2LYC A;  3LNQ A;  3BQZ A;  3BG9 A;  1HBX G;  1K6Y A;  2JK3 A;  3ERM A;  3OWT A;  2L02 A;  3F23 A;  2JA8 J;  3BR1 A;  3RCO A;  3OS2 A;  3RZD J;  4HV5 A;  1MJB A;  4IEJ A;  5HDG A;  3HHH A;  1YIT I;  2DJN A;  4LLG F;  2R93 J;  4ZDP A;  3CCE I;  4LLN A;  2HKO A;  3F3X A;  2MLG A;  1EH7 A;  4S0H B;  2I8D A;  4ENK A;  2XSD C;  1G3T A;  1B6A A;  2BZT A;  2QQ9 A;  2XIG A;  1FZP B;  4II3 A;  1XGM A;  3KP7 A;  3HGG A;  3BJO A;  3ECO A;  2QKL B;  2GIZ A;  1Y8Q B;  3QOD A;  1U78 A;  1O3T A;  4HEA 2;  2AS5 F;  1R23 A;  3HKZ A;  2Q1Z B;  4XN0 A;  2EZL A;  4DYC A;  4KMF A;  1JJ6 C;  2EZK A;  4A3K J;  1U2W A;  5J40 A;  1H9G A;  2VIX A;  4IXA A;  4XLN F;  2V1D A;  5M5W J;  3U21 A;  2KKO A;  1NTC A;  2I10 A;  3IKT A;  5C4X J;  1J2X A;  5IYB J;  4BXF A;  2WAF A;  3ZQI A;  4M9X A;  3UKG A;  5BQT A;  3S2D J;  1ZAO A;  3ZMZ A;  4M9S A;  1TNT A;  3L09 A;  4XID A;  1YW9 A;  1ZRE A;  2CS3 A;  4BEH A;  3CDH A;  1JUS A;  1X19 A;  1Q1H A;  5D6E A;  1G59 A;  3L7W A;  4B47 A;  5F0H A;  2CUZ A;  4NB5 A;  2BY2 A;  1XSD A;  2E1O A;  2FE3 A;  3BR3 A;  2OCC H;  3HUG B;  5IOZ A;  3HIF A;  4E7K A;  4ZTF A;  2KZG A;  2X0L A;  5A2Q K;  5ICC A;  3GME A;  2EQR A;  3RPU D;  1CQT A;  4L9J A;  4LMY A;  2ZFW A;  4PJM A;  1S72 I;  1B72 B;  4XKW A;  2WY7 Q;  3H5A A;  1RKT A;  1HW2 A;  1B4A A;  1X2N A;  3W6V A;  3JRA A;  3UNG C;  3DF8 A;  4CIC A;  1UHW A;  2PBI A;  4ESJ A;  3R0J A;  1W36 C;  5F04 A;  1UEL B;  2VB6 A;  5ILV A;  5GPC A;  4D1Q A;  3SJM A;  3CUQ A;  1B8I B;  2K7L A;  3CLQ A;  2BY3 A;  3HEF A;  4A0X A;  2MGQ A;  3IRR A;  1BC8 C;  2PEX A;  3RQ4 A;  4G94 A;  5EGO A;  1FYM A;  2K02 A;  2LFB A;  3TQN A;  2DYS H;  2MSY A;  3G1O A;  3E7L A;  3H0D A;  4E70 A;  5IPA A;  2IRF G;  2KFD A;  3GTG J;  3HJE A;  1XDU A;  2CW0 F;  1HKT A;  1U6G A;  2HQ5 A;  2L0K A;  3H3V K;  3A0B C;  2QBY A;  3BDD A;  1D0Z A;  4P96 A;  3C2G A;  4CHU A;  4NC6 A;  3ZQF A;  2ZKZ A;  3MCZ A;  1UZC A;  3MQ0 A;  5D5U B;  2X9D A;  4G9Y A;  1SFX A;  2V26 A;  3DTE A;  5K5R A;  4A3J J;  2HYF A;  3CUO A;  1IDY A;  2H1K A;  1FT9 A;  4HPQ A;  4HX4 A;  2DOA A;  3CUQ C;  1X1A A;  3H0G J;  5KK1 A;  3ZXS A;  2VC0 A;  1T0F A;  2V7F A;  1ZTR A;  2GXB A;  3GTQ J;  3OYL A;  2O6G E;  4XLA A;  3E0J B;  4YEL A;  2XGC A;  1VQN I;  3BRO A;  2CQN A;  1IN5 A;  3OL3 A;  2FML A;  3K10 A;  3ZQL A;  1K7A A;  1RUN A;  2VKV A;  1DU0 A;  3S3M A;  4KT6 A;  5JHF A;  2DT7 B;  3OS1 A;  1ETW A;  4DW6 A;  5D8L B;  2L9R A;  1ZR4 A;  5L3B A;  1J9I A;  1OCC H;  2NVX J;  1UHS A;  2L4M A;  5K5Q A;  5FLX Z;  3RTR A;  4HRI A;  3WU0 A;  3H92 A;  1KZH A;  1ZRC A;  2WC2 A;  4LB5 A;  2QYO A;  5FJ8 J;  3QPT A;  4IRG A;  2XSJ C;  3KP2 A;  2XPV A;  4OIR F;  5JLX A;  1T08 B;  1T0F C;  1YLF A;  1YS7 A;  4U0W A;  4BE2 A;  1R4M B;  2ADU A;  3GZ5 A;  3CCR I;  3OYJ A;  1QPI A;  2R5Y A;  1J59 A;  5E79 C;  5E3M A;  3HRS A;  1EV7 A;  4R1H A;  3CES A;  3H9J A;  2IPQ X;  2OAZ A;  3SFZ A;  4K2E A;  1ETO A;  4FQG A;  3OYN A;  4L9V A;  3ABM H;  1TQI A;  3LL7 A;  4Y33 A;  1AWC A;  4L18 B;  1LEB A;  2F5C A;  1XPX A;  2DAO A;  3GTP J;  1F9N A;  3M9A A;  1Z7U A;  3V7S A;  1FJL A;  5K7F A;  3HL2 A;  2V9K A;  3G1M A;  4BS9 A;  2ID6 A;  2JZY A;  1MBE A;  3HOZ J;  1JT0 A;  2R7O A;  4B48 A;  5GTH C;  3FDY A;  4QWQ A;  2FBI A;  4CXF A;  2CO5 A;  3DLL F;  1QHG A;  2YPR A;  3MD2 A;  2VPR A;  3L2C A;  5EG0 A;  5J1U A;  1F4K A;  1ZGW A;  3BJ6 A;  1V5E A;  5LGU A;  4HG2 A;  2STT A;  3ZQH A;  2D2W A;  1UCR A;  1JUP A;  1B9M A;  2DFE A;  3KZY A;  2O0Y A;  4OAY A;  3GTO J;  3HYI A;  1IRF A;  3WTW C;  2XUB A;  3WTV C;  2JRT A;  3HXL A;  4M6Y A;  3GO5 A;  3GUD A;  4E7L A;  3CMA I;  3FXR A;  4XLP F;  5HLT A;  1Z21 A;  2BW3 A;  4G12 A;  3G71 I;  3O3K A;  3FM3 A;  5FFX A;  3JCU C;  1LDJ A;  4XLF A;  3WG7 H;  1JKP C;  3DKY A;  3LSH A;  4WF2 A;  2HDW A;  4CCJ A;  5K7H A;  2X6W A;  3CTA A;  1ITY A;  2BGC A;  3QU3 A;  2Z9O A;  3GF2 A;  2VI6 A;  1R4N B;  3L00 A;  4GGG A;  4RS8 A;  4L5E A;  3M1C A;  5CVU A;  4D5F A;  4GYI A;  5GAE J;  3FMS A;  3LWF A;  3ASO H;  2JTV A;  3RPU A;  1YTY A;  2XAJ A;  4I98 B;  2LP0 A;  4UXN A;  2K27 A;  4BJ6 C;  1VQ6 I;  1R1U A;  3QAH A;  3TW7 A;  3KYD B;  2FU4 A;  3JRB A;  2IVM A;  1I39 A;  1U5T B;  1FPQ A;  3PL8 A;  3BT9 A;  3Q0V A;  3HOS A;  3V8J A;  3AL0 C;  4BHP A;  1YE9 A;  1TBX A;  3HZJ A;  5CQE A;  2XAF A;  2LRD A;  3NQO A;  4C2T A;  1RKW A;  2CRG A;  4ZC3 A;  3LA2 A;  2ZXW H;  3K4K A;  4XNF A;  3TO6 A;  1QU3 A;  3ZMD A;  1NK3 P;  1R6R A;  2KDZ A;  4BE1 A;  3HOT A;  3PNY A;  2L7Z A;  2EBI A;  2X6O A;  3P7N A;  3LFK A;  2NXN B;  3F8C A;  1QA6 A;  4BDZ A;  4RAF A;  4M3B A;  4M74 A;  1VQ7 I;  2AXL A;  4S04 A;  2DJI A;  1QPM A;  3RYP A;  3GLX A;  5HLG A;  1ZAR A;  2GM4 A;  1WJE A;  5D5V B;  1ZEL A;  3S3O A;  1DGR M;  3WG9 A;  4AC0 A;  4PFP A;  1BOB A;  2HWV A;  1W5T A;  3VSL A;  2K9N A;  4WK8 F;  3Q3S A;  2OQR A;  4RM2 A;  4C9Y A;  4XOP A;  1W0T A;  2LY2 A;  1SFU A;  2R92 J;  3BR6 A;  2JPC A;  4MHG A;  4L0Y B;  2LY1 A;  1LDK B;  2OCE A;  1S6L A;  2V6C A;  3C1D A;  5D4R A;  1R71 A;  2YU3 A;  4C3J J;  1MKM A;  1POG A;  4DYQ A;  3IH2 A;  2HXI A;  3IKV A;  2LBF A;  2YX7 A;  4HDV A;  3BG7 A;  2VOO A;  1HDP A;  2EK5 A;  2F5F A;  4D0P A;  3CP2 A;  3R0A A;  2KIM A;  2X51 A;  4ESF A;  4ZDO A;  1Z05 A;  2A68 F;  3CP8 A;  1S7A A;  1WFX A;  2HTS A;  4UB6 C;  5DD4 A;  3E6M A;  3ROU A;  2E1C A;  1FEX A;  2XDV A;  3LMM A;  3K4M A;  1O57 A;  1TWA J;  3LOC A;  1MBJ A;  3DXJ F;  3KFW X;  3MKW B;  2EFO A;  3SEQ A;  2HS5 A;  4BQO A;  2RNG A;  2FBK A;  3A03 A;  4F93 B;  3A01 A;  1UAA A;  1DU6 A;  1PVE A;  4I99 C;  4A6E A;  4MTE A;  4IRI A;  1H8A C;  3S1Q J;  1XG1 A;  1IXR C;  1YX3 A;  2OC6 A;  3I3L A;  5F64 A;  3VYT B;  1A35 A;  3MN2 A;  5HOO A;  4KN7 X;  3I4N J;  1MBH A;  2FJ1 A;  2HEO A;  3GW2 A;  2E19 A;  1EKE A;  3QYE A;  3K9T A;  1RZ4 A;  2GXG A;  1RES A;  1J7K A;  1ZHF A;  3ESW B;  4NUB A;  1MMA A;  4R79 A;  3IWF A;  3M7G A;  4DGW B;  1MZB A;  2GA2 A;  1FP1 D;  2H6C A;  3BZK A;  3F6O A;  3LSJ A;  1T33 A;  3VYR B;  3T5X A;  2VON A;  4IHY A;  3KEQ A;  3RIR A;  1FTZ A;  1SMY F;  2P7V B;  1O3S A;  1K61 A;  2DOE A;  2BY1 A;  2FQ3 A;  2ESN A;  2CMP A;  4ZYD A;  3FX3 A;  3SHF A;  1SVM A;  2HZT A;  5JVT A;  4WXD A;  4RB3 C;  1NH3 A;  3COA C;  1ETQ A;  2CQX A;  2HQA A;  2ZXI A;  2HOS A;  1FBQ A;  1RR7 A;  1Y6I A;  3GFL A;  5DCM B;  1XX5 A;  2P5K A;  1EJ9 A;  3LQR A;  4Y13 A;  4UUT A;  4KDP A;  3JRE A;  1JT6 A;  2FOW A;  2E2H J;  2L5Q A;  4IRH A;  3ZN1 A;  2LSO A;  1Y0N A;  2ID3 A;  3OY9 A;  3SFI A;  5EEA A;  3V7R A;  3F9K A;  4QTR A;  1AU7 A;  5HLH A;  2PMU A;  5J1Y A;  3D1N I;  2L7M P;  4E7H A;  3VYS B;  1IDZ A;  2LLK A;  2V9V A;  2AQF A;  3HPG A;  1L0O C;  3WU2 C;  2FD5 A;  4GFB A;  1WH7 A;  4F92 B;  3ZN0 A;  3FXM A;  1KYZ A;  4KFC A;  4YG2 F;  3GEZ A;  3J80 Z;  1FBS A;  1TP4 A;  2DOF A;  2K4J A;  4HX8 A;  4XKB A;  2GIV A;  4KMU X;  5IP7 J;  4D7N A;  1T56 A;  3O8G A;  3CMY A;  1O3R A;  4YII A;  4MFD A;  1W7P B;  2UUZ A;  2O8K A;  1AA7 A;  1MH3 A;  3K4B A;  5FD6 A;  1IW7 F;  1LDD A;  3FXO A;  3KZI C;  4C3H J;  3X2Q H;  4EMS A;  4AIJ A;  2EZH A;  3BP8 A;  1MSF C;  3MZ8 A;  3WTU C;  3HOY J;  2JQ7 A;  2ZSH B;  3M8E A;  2DCE A;  2HOT A;  1Y1W J;  3BG3 A;  3MWM A;  3F22 A;  3HB9 A;  5AON A;  2RAE A;  3L2U A;  2E5Z A;  1SFK A;  4IHS A;  4FE7 A;  4HOB A;  4I2O A;  5FLM J;  1P4X A;  3GVA A;  2JUG A;  2DA7 A;  1YRN B;  2L3D A;  4A0Z A;  3EPZ A;  2HVQ A;  5F0F A;  5BPD A;  3CC7 I;  1O3Q A;  3AKZ A;  2CUE A;  4KIT B;  2M1B A;  2EB7 A;  4RA2 A;  3VEP A;  1LB2 A;  2O3F A;  5LGN A;  1KU3 A;  1OCP A;  2AXT C;  2P4W A;  4FX4 A;  3V7C A;  5HDN A;  2VBW A;  2WWY A;  1G3Y A;  1O7L A;  1TW3 A;  4KIC A;  3RYR A;  4C2U A;  2ZXH A;  2YSR A;  3BLY A;  1G4D A;  3W2A A;  3VYU B;  1ACI A;  2KJC A;  3OR1 C;  3JRC A;  3RDI A;  3DLA A;  1OYW A;  1XGO A;  3KCC A;  1YI2 I;  3FZV A;  3DCF A;  2DMP A;  2M7B A;  1R5H A;  1R9T J;  1QZZ A;  1UST A;  1YW7 A;  1AKH A;  2V9P A;  2ZC2 A;  3P9C A;  1Z0X A;  2H09 A;  2ZSI B;  3QP6 A;  4JOM A;  2NS0 A;  3OL4 A;  4PZJ A;  3HBL A;  3GTK J;  1ZLJ A;  3L2V A;  4ITV A;  2ZME A;  1W4M A;  1AHD P;  3TO7 A;  1H9T A;  1RIO H;  1IXS B;  1WKM A;  5HVQ C;  1F1Z A;  3GFM A;  1E3O C;  1S5L C;  1WJ5 A;  1YYV A;  1IXC A;  2G0E A;  1SAN A;  4HYE A;  4DZP A;  2LTP A;  1Q1V A;  1B1B A;  4YEJ A;  3MKY B;  3DPU A;  4MIM A;  2K9S A;  3K2Z A;  2JMW A;  4HBL A;  1V55 H;  2ELJ A;  1D1A A;  2PN6 A;  3M8J A;  3OMY A;  4XKV A;  5JI6 A;  2M87 A;  2E36 A;  1R5G A;  2DTZ A;  3ZP5 A;  3E5U A;  2W4S A;  4JX5 A;  2HGC A;  1K78 A;  4UV9 A;  1DGW Y;  3P9I A;  2A5Y B;  2CUJ A;  5TIS C;  4ABZ A;  4A69 C;  3HOU J;  2Q0O A;  2Z16 A;  1VQ5 I;  2VQL A;  2R7T A;  4G7Z F;  3I59 A;  4IF4 A;  3K7A J;  4KJZ A;  3IH4 A;  4E7I A;  2IJL A;  1T6S A;  1SAU A;  4XMY A;  4G7H F;  1I27 A;  2VT2 A;  3PM1 A;  3V4G A;  1KQ8 A;  2LR8 A;  4HNV A;  4WWC A;  2A3S A;  4XRF A;  1ZRD A;  2WTE A;  4AWX B;  4BEH B;  2UXX A;  1LVA A;  2JN6 A;  2NS8 A;  1FY7 A;  3TKY A;  2VBY A;  5DV5 A;  2WA0 A;  4UUS A;  5H20 A;  1R36 A;  2NNY A;  1IGN A;  4A3L J;  1XN7 A;  2L9N A;  3J7Y J;  5F27 A;  2JA7 J;  2YS9 A;  1N75 A;  3ELK A;  5ICG A;  4CYC A;  3OSG A;  3E5X A;  3LST A;  3ZQC A;  1ZG5 A;  4UVB A;  2H8W A;  4IPA A;  1FOW A;  2R7W A;  2PX9 A;  2WBM A;  3ONQ A;  3EYY A;  3T8T A;  2HTJ A;  3OIP A;  2CGP A;  5DM7 F;  3DFG A;  2A6H F;  4YIF A;  2FX0 A;  4PJ0 C;  2HVS A;  3I58 A;  2QSF X;  3BTI A;  1WJA A;  4M6X A;  3F21 A;  1FMV A;  3RZO J;  1IV8 A;  1X1D A;  1ZGJ A;  2EA4 A;  4CGZ A;  2NYX A;  4OMY A;  3IUO A;  5GAD J;  2IS2 A;  3HRT A;  1VQO I;  4XLE A;  1D8J A;  3KIO A;  4QSH A;  2W85 A;  5BOX A;  4HSR A;  3K0L A;  2VXD A;  2STW A;  3FKJ A;  1SMT A;  4HA8 A;  4OIP F;  4YRV A;  4A0Y A;  1J75 A;  1MGT A;  3D5L A;  1E2X A;  2XRN A;  1P4A A;  4YFX F;  1T2K A;  5J3L A;  3OYA A;  4KT5 C;  3PO2 J;  2QBY B;  1WWX A;  2ACJ A;  5TGT A;  4V2G A;  5J8F A;  1UG2 A;  1BOA A;  5D6F A;  4L5I A;  3GTL J;  2AHQ A;  5EEG A;  5B66 C;  1WRJ A;  5D4S A;  1BW5 A;  1OKR A;  5FRM A;  3K1P A;  5E3L A;  2W00 A;  4OAZ A;  3KYC B;  4EGY A;  2O03 A;  1IRZ A;  2E1M C;  3ABK H;  1LEA A;  3HPH A;  4GYG A;  3TO9 A;  4MO7 A;  1LFU P;  2M0M A;  3OYE A;  1KON A;  4N9I A;  3QOP A;  2FOK A;  2DA1 A;  1P4W A;  1MJA A;  2RQQ A;  1R00 A;  4I76 A;  4ENJ A;  1I1S A;  2DMT A;  1UB9 A;  4WXC A;  1MND A;  5EZH A;  2JSC A;  5TRD A;  1MMS A;  1PYV A;  5FRN A;  3ASN H;  2BV6 A;  3SZP A;  2A05 A;  3BTJ A;  3CJN A;  1W5C C;  2CG4 A;  5K5O A;  2BOL A;  3D0S A;  4DZJ A;  3KP3 A;  2W84 A;  1Z1D A;  5CVR A;  3FMQ A;  4ZJZ A;  2O5R A;  3VOD A;  2HOA A;  1ETY A;  3OYH A;  2ZJQ F;  2A07 F;  4A2U A;  1ZN2 A;  2FSW A;  4OWR B;  2OZU A;  4ASN A;  4NC8 A;  4H0E A;  4Y15 A;  4PJL A;  2R5Y B;  1N78 A;  2DFF A;  4DBQ A;  4M71 A;  1HW1 A;  2EIN H;  2OQG A;  2M4K A;  2D5V A;  3WU1 B;  3RJP A;  1I6H J;  1OMI A;  4QLC U;  1P7I A;  1X3U A;  3S8P A;  2R3S A;  1P92 A;  3FK6 A;  1LKX A;  3ERE D;  3DBH B;  1TWF J;  1LQ1 A;  2PJP A;  2OV7 A;  3ZMV A;  1BI1 A;  3CDL A;  4HLX A;  2DU9 A;  3CCM I;  3QYB A;  3CLO A;  2LVS A;  3SEZ A;  3M07 A;  2F5D A;  1QHH D;  4HF2 A;  3P9K A;  4P9F A;  5E1X A;  4MNU A;  2FEZ A;  5KAI C;  3C2H A;  5LRR A;  3L2R A;  2CW8 A;  3HOW J;  4JX6 A;  4DIQ A;  2EFW A;  2VE9 A;  4M73 A;  5KVR A;  4ENM A;  5LHH A;  2JA5 J;  2CJJ A;  2R4G A;  3I53 A;  2DMN A;  3DEU A;  3J80 K;  5EG0 B;  5HS8 A;  1A5J A;  4BQQ A;  3KZZ A;  1BR2 A;  1IZ1 A;  2ELK A;  4AID A;  2DBB A;  4KIG A;  1MDM A;  5F1J A;  2WY8 Q;  1NK2 P;  1I3Q J;  3DTI A;  4L9N A;  2H8R A;  1WZ2 A;  3WE2 A;  4HF0 A;  2L7K A;  3LSR A;  1AOY A;  3JR9 A;  3NAU A;  4XM3 A;  1SC7 A;  2WAQ N;  3BPV A;  4B4C A;  2VXZ A;  3MFK A;  2FRH A;  3FF5 A;  4IHW A;  2QSH X;  2IGK A;  1ZKG A;  3RKY A;  1YJN I;  1EF4 A;  4HV6 A;  1F43 A;  5E8G A;  4MTD A;  1SD6 A;  1S9H A;  3VDX A;  4ANJ A;  4UUV A;  1XTA A;  3GXO A;  1KU2 A;  1ETX A;  4HDU A;  4BE0 A;  1RET A;  2W57 A;  1X3W B;  4IHV A;  2VQC A;  1B8I A;  1LUJ B;  2EV0 A;  3REO A;  4EJO A;  3A2K A;  2K9M A;  4AYB N;  2IS6 A;  1Z3Y A;  2GQQ A;  4MEX F;  2DW4 A;  1KQ9 A;  2DFH A;  3DPL C;  1OPC A;  4PSX A;  5BMZ A;  3SZT A;  2R7X A;  3Q5F A;  3CCV I;  1J0R A;  2EIM H;  3ULQ B;  3FXK A;  2MA3 A;  4I02 A;  3AG4 H;  1NG6 A;  2DDB A;  5FKK A; 
#chains in the Genus database with same CATH homology
 1S7O A;  3VFZ A;  2R7D A;  1BN5 A;  3W6J B;  2VOD A;  2IA1 A;  1XMK A;  4LJZ F;  2G9W A;  1TNS A;  2KIF A;  1T39 A;  5L3C A;  1FSH A;  3ZPL A;  3WTS C;  2L4A A;  2G7U A;  2E7X A;  4PDK A;  3TDZ C;  1C0W A;  2VBZ A;  2MC3 A;  4JQF A;  3WOD F;  2XGX A;  4EQQ A;  4O6J A;  1REP C;  3E6D A;  1HST A;  2F2E A;  1LJ9 A;  4CYD A;  1KYW A;  5DYM A;  5ILS A;  4UV8 A;  2IA2 A;  2P7C B;  1R1V A;  3PQK A;  2HR3 A;  5CYV A;  3R6S A;  4A12 A;  1WSU A;  4ZZD A;  2P8T A;  3K69 A;  1FP2 A;  1FX7 A;  1P2F A;  2XKO A;  2P6T A;  4U7B A;  2UZK A;  2D1V A;  2XHK A;  2DLL A;  1DUX C;  3S2W A;  4WCG A;  4MGR A;  4M72 A;  4BHB A;  1V4R A;  5IT9 K;  4NQW A;  1SD5 A;  5L3D A;  3HTS B;  2XKP A;  5CVI A;  3GFJ A;  2RKH A;  2IW5 A;  1BIA A;  5F1R A;  1DDN A;  4Q4Z F;  4P9U A;  1XDS A;  4IJA A;  1R58 A;  1Y0U A;  3O2P E;  4UNO A;  2BYV E;  1SD7 A;  4LG0 A;  1J5Y A;  1ZH5 A;  1R1T A;  5JR3 A;  3RI4 A;  5LRS A;  3E3V A;  2ZNZ A;  4PGH A;  2H27 A;  2PQ8 A;  3U9G A;  2PFB A;  3M8F A;  1GXP A;  3JTG A;  2EV5 A;  3NEU A;  3FXQ A;  1ZGA A;  2RQP A;  3KLO A;  4RB2 C;  3RPQ A;  2QZ8 A;  4XBF A;  4ON0 A;  1W7P D;  2ESH A;  3ISP A;  3MZH A;  2RV8 A;  1A04 A;  3KE2 A;  4U0V A;  5L3F A;  1IAW A;  2O61 A;  4OIQ F;  2FF4 A;  4P55 A;  2ETH A;  3EDP A;  2WV0 A;  2VC1 A;  3HRU A;  1ZRF A;  2ZO4 A;  4YFN F;  1DPR A;  5CVJ A;  1I1G A;  2HFH A;  2ISZ A;  2EFP A;  4RGR A;  6PAX A;  1USS A;  1MJ9 A;  3C3W A;  4BH9 A;  3K1M A;  2P5V A;  3OV8 A;  4JK1 X;  2KJB A;  2ELH A;  5CLS A;  2MBF A;  3IL2 A;  2OA4 A;  2BEO A;  2Z5U A;  4EJU A;  1Z91 A;  2QQB A;  3AAF A;  4EJT A;  3ECH A;  2D45 A;  2K86 A;  4FX0 A;  3IHU A;  4ZZL A;  4RGX A;  2CSO A;  4A5N A;  2A6E F;  2CFX A;  2LF7 A;  1GHC A;  4CDG A;  2PI0 A;  1D5V A;  3BPX A;  1XSV A;  1FC3 A;  1ON1 A;  1XB4 A;  2QLZ A;  1YS6 A;  2FBH A;  2A69 F;  2OD5 A;  4N9H A;  5E1W A;  1SAX A;  4EV0 A;  4U7D A;  1XGS A;  3EQL F;  5FGM A;  4Z2Y A;  2ZME B;  2FXA A;  3GZ6 A;  1OR7 A;  2LKP A;  4MQ9 F;  4RGS A;  1BIB A;  4UHT A;  2FNA A;  1QO0 D;  2KIU A;  4OU0 A;  4RGU A;  3ML6 A;  2Y48 A;  2DPD A;  1HKQ A;  2J5O A;  4HF1 A;  4Q47 A;  1GVJ A;  4KN4 X;  2A61 A;  4ENN A;  2ZBK A;  3WTT C;  3WGH A;  4GCV A;  4LD5 A;  3BOQ A;  5DUI A;  4I09 A;  4IHT A;  1XCB A;  1RI7 A;  1XMA A;  3ABU A;  2FA5 A;  1U8R A;  4KUM A;  4EJV A;  2Z3Y A;  1FBU A;  1QQI A;  1DP7 P;  4LLL A;  2CQK A;  2GA1 A;  3W6K B;  4ZYE A;  2Z33 A;  4L9T A;  2K4B A;  1T98 A;  4RB0 A;  5DDG A;  3R61 A;  4L0Z B;  5HDK A;  3M1E A;  3PQJ A;  1EH8 A;  3JSO A;  3H3Z A;  1I6X A;  1PP8 F;  3IC7 A;  1OYY A;  1IF1 A;  1OYI A;  1VTN C;  2XAG A;  3I0T A;  4Q48 A;  3TDU C;  4AVP A;  4O3M A;  2L54 A;  4O5V A;  1G3S A;  4OMZ A;  3SQN A;  3T8R A;  3JW4 A;  2XVC A;  5CVV A;  3FM5 A;  4F7Z A;  2QVO A;  3DP7 A;  5ICF A;  4PCQ A;  4B09 A;  5HS9 A;  3U2R A;  2XRO A;  3WTY C;  4G6D A;  4BXU A;  1FSE A;  4HZF A;  5AIQ A;  2CWE A;  5L3E A;  5ERI A;  2OBP A;  3GWZ A;  1TTY A;  5LGT A;  1G6N A;  3T0Y A;  3KLN A;  3ZMT A;  2XV4 S;  1XGN A;  1R22 A;  4WXH A;  3F6V A;  4EM1 A;  2V1X A;  2LDU A;  2H6B A;  5BPI A;  1IN4 A;  3N97 A;  2DTR A;  3IRQ A;  5JHU A;  5IT9 Z;  4I0A A;  2YX4 A;  3LQQ A;  1HXD A;  4TV7 A;  3J81 K;  1UHM A;  1FWZ A;  1O7F A;  5FO5 A;  1K6O A;  3CUQ B;  2HDC A;  2M45 A;  1D8K A;  5IT3 A;  1FYL A;  4LGW A;  1SD4 A;  3J7A O;  1QZY A;  2H94 A;  5TJJ A;  1KA8 A;  1YW8 A;  3VOE A;  2RVC A;  1TW2 A;  4HQE A;  2DFI A;  3G73 A;  3LA3 A;  2DO7 A;  5ILU A;  1FLI A;  2RN7 A;  3WGG A;  4EM2 A;  3ZQ7 A;  3E5Q A;  5LBQ A;  4Q5S F;  5DUK A;  1V3F A;  2D1H A;  3E97 A;  2IA0 A;  2Q8K A;  4EVI A;  2Q2E A;  3LAP A;  3Q9V A;  5FD5 A;  4P5O A;  1MDM B;  2RC4 A;  2NAZ A;  1ULY A;  3ZMS A;  3I4P A;  4CO8 A;  1G3W A;  2W25 A;  1S3J A;  1STZ A;  1NHA A;  2DQL A;  1FYK A;  2PMH A;  5LHI A;  4G8X A;  3DQV C;  1SFE A;  3HHG A;  2JPB A;  3DV8 A;  1PP7 U;  2Y0M A;  2PG4 A;  1Z6R A;  2XAH A;  1B59 A;  1UFM A;  1IRG A;  2LNB A;  4G6Q A;  3U1D A;  4AIK A;  3N4M A;  4S05 A;  2OU2 A;  1HKS A;  2E1N A;  2QWW A;  2QEN A;  2DK8 A;  1Z6T A;  2EJR A;  2QQA A;  5EEH A;  2EWN A;  3WGI A;  2XAQ A;  3CO6 C;  4UVA A;  3DKW A;  3TGN A;  4XSX F;  1ZG1 A;  3O6B B;  2DQR A;  3CO7 C;  3HUG A;  3JTH A;  3QP5 A;  2V79 A;  4FHT A;  1JHF A;  2OZ6 A;  3FXU A;  4Y17 A;  2ISY A;  4BYY A;  4KA4 A;  5D5W B;  4HLY A;  2IT0 A;  4BNC A;  4B8X A;  1W5S A;  1BI3 A;  1YFH A;  4KIF A;  1IN7 A;  3LAJ A;  5DD8 A;  4DQ2 A;  4BHC A;  4OIN F;  1I5Z A;  2HOE A;  2GWR A;  3HSE A;  4LFU A;  1FOK A;  2COM A;  4M9Z A;  4ETS A;  3E6B A;  2MH9 A;  3EUH A;  1D3Y A;  3EET A;  2L01 A;  2VN2 A;  4OOI A;  3ABT A;  2X4H A;  5E8I A;  3WTZ A;  2M8E A;  3R4K A;  3BY6 A;  1JXS A;  5DCF A;  3T1B A;  5FB2 A;  3WTX C;  2BBY A;  4N0B A;  2DI3 A;  3KEO A;  1P6R A;  1BC7 C;  1BI0 A;  2JT1 A;  2NNN A;  4NHJ A;  1H0M A;  5E1Z B;  1BJA A;  2RNJ A;  2VOP A;  3V8K A;  4LG0 B;  3NRV A;  3WE3 A;  5FFZ A;  2F5E A;  2EFQ A;  3F8N A;  5D5X B;  2VBX A;  4PGG A;  2ZXJ A;  3K1N A;  2GZW A;  3JAM K;  3L9F A;  3EYI A;  2J5P A;  1HQC A;  1CGP A;  2UXN A;  4KYW A;  3SXY A;  1KU7 A;  2R7F A;  3RKW A;  3BWG A;  2QUF A;  2YR2 A;  3KP5 A;  4RAY A;  3FWE A;  1E17 A;  2W24 A;  4G7O F;  4XSZ F;  4I7H A;  5HLI A;  2Y75 A;  2UWM A;  1KGS A;  1CF7 A;  4RAZ A;  4UVC A;  1EH6 A;  1TQM A;  2HQN A;  5LHG A;  1QNT A;  3J81 Z;  1MD0 A;  5E20 A;  3ZMU A;  5H6R A;  3F8F A;  5L3G A;  2ZNY A;  2P5L C;  5H6Q A;  2EA2 A;  5LEK A;  1YO5 C;  2VT3 A;  2RDP A;  4JBA A;  3MAJ A;  1XSX A;  4YFK F;  1Z9C A;  1B9N A;  1ODD A;  3QRF F;  1IN6 A;  2M5W A;  3HSR A;  4KIB A;  2ZCW A;  4GO1 A;  1FNN A;  2P6S A;  1LNW A;  2NRA C;  2BE5 F;  2B0L A;  1TLH B;  4R8H A;  3HSF A;  4HW0 A;  3IWZ A;  4RB1 A;  1U5T A;  2QM3 A;  1QBJ A;  3TOB A;  4KNY A;  3B73 A;  1F5T A;  3OOP A;  2HQR A;  2XAS A;  3JSP A;  4U88 A;  1PUE E;  1YG2 A;  2TDX A;  3FMR A;  5K1Y A;  4A5M A;  1KU9 A;  3MEX A;  2HYG D;  4EGZ A;  5CJ9 A;  5A2Q Z;  4ZYH A;  3QU6 A;  4BQA A;  1XD7 A;  1XCV A;  3KP6 A;  3DPT A;  5JFR A;  1JHH A;  1RUO A;  3I54 A;  1ZYR F;  2DK5 A;  4U0Y A;  1U5T C;  3KET A;  3F8M A;  4A6D A;  1K79 A;  1S29 A;  1TQP A;  4LB6 B;  2E7W A;  4ESB A;  4IVN A;  4I0B A;  3MZY A;  5ICE A;  1RNL A;  4AIH A;  5E17 F;  2Z99 A;  3RKX A;  1T38 A;  2GAU A;  1JE8 A;  2KRF A;  2IP2 A;  1ZG3 A;  1ON2 A;  4ZH4 F;  3C18 A;  3I64 A;  3KP4 A;  3C7J A;  3LA7 A;  5AIP A;  4MEY F;  5BS6 A;  5LLQ A;  3R60 A;  2EFN A;  3FHZ A;  4WX9 A;  1HSJ A;  5ED4 A;  2FNP A;  4AD9 A;  4CZZ A;  5D8K B;  4I01 A;  3B02 A;  5J8C A;  5HS7 A;  3BZ6 A;  3HRM A;  5E18 F;  2C6Y A;  4GXO A;  2ZJ2 A;  1YIO A;  2RGV A;  1KQ0 A;  1ZLK A;  1K78 B;  5FLX K;  1BI2 A;  1U3E M;  3E6C C;  1JGS A;  1ONV A;  3I59 B;  2DPU A;  2EV6 A;  4OIO F;  5F6F A;  5LEJ A;  5DCM A;  4HX7 A;  5DEQ A;  3GX4 X;  2M30 A;  1L3L A;  2DT5 A;  4EJW A;  4HQM A;  4DNC A;  4HAM A;  3H3U A;  2PLY A;  1WI9 A;  3TOA A;  3QPH A;  2CYY A;  1HW5 A;  2O8X A;  2LF8 A;  2HKX A;  4L5J A;  1WQ2 A;  2MD5 A;  1PDN C;  1DPU A;  1W7P A;  1S8N A;  3I71 A;  4LK0 F;  4LK1 F;  4FT8 A;  3Q9S A;  1QGP A;  2MLK A;  5J6X A;  1IUY A;  3V8L A;  1CF7 B;  4MQV A;  3BJA A;  3JAM Z;  1BM9 A;  3F8B A;  1YQA A;  2VE8 A;  2MH2 A;  3HTU A;  4EM0 B;  1GXQ A;  3G3Z A;  4ZYG A;  2G7H A;  3VB2 A;  1IN8 A;  2FMY A;  1BBY A;  3F72 A;  3I5U A;  2V1U A;  3PFI A;  3GFI A;  1R7J A;  4BAY A;  1HBX G;  2L02 A;  3F23 A;  4HV5 A;  1MJB A;  5HDG A;  3HHH A;  4LLG F;  4LLN A;  2HKO A;  3F3X A;  2MLG A;  1EH7 A;  4ENK A;  1G3T A;  1B6A A;  2QQ9 A;  2XIG A;  1FZP B;  1XGM A;  3KP7 A;  3BJO A;  3ECO A;  1U78 A;  1O3T A;  2AS5 F;  1R23 A;  4KMF A;  1U2W A;  1H9G A;  4IXA A;  4XLN F;  2V1D A;  2KKO A;  3IKT A;  1J2X A;  4M9X A;  5BQT A;  1ZAO A;  3ZMZ A;  4M9S A;  1TNT A;  3L09 A;  1YW9 A;  1ZRE A;  3CDH A;  5D6E A;  1Q1H A;  3L7W A;  4NB5 A;  1XSD A;  2FE3 A;  3HIF A;  2X0L A;  5A2Q K;  5ICC A;  4L9J A;  4LMY A;  2ZFW A;  1HW2 A;  1B4A A;  3DF8 A;  4CIC A;  1UHW A;  2PBI A;  4ESJ A;  3R0J A;  5ILV A;  3CUQ A;  2K7L A;  4A0X A;  3IRR A;  1BC8 C;  2PEX A;  4G94 A;  1FYM A;  2K02 A;  3TQN A;  4E70 A;  2IRF G;  1HKT A;  1XDU A;  2CW0 F;  1U6G A;  2QBY A;  3BDD A;  4P96 A;  4CHU A;  2ZKZ A;  3MCZ A;  3MQ0 A;  5D5U B;  4G9Y A;  1SFX A;  5K5R A;  2HYF A;  3CUO A;  1FT9 A;  4HX4 A;  3CUQ C;  5KK1 A;  2VC0 A;  1T0F A;  2GXB A;  2O6G E;  3BRO A;  1IN5 A;  2FML A;  1K7A A;  1RUN A;  5D8L B;  5L3B A;  1J9I A;  2L4M A;  5K5Q A;  5FLX Z;  3RTR A;  3WU0 A;  3H92 A;  1ZRC A;  2WC2 A;  4LB5 A;  2QYO A;  3QPT A;  4IRG A;  3KP2 A;  4OIR F;  1YLF A;  1YS7 A;  4U0W A;  2ADU A;  3GZ5 A;  1J59 A;  3HRS A;  1EV7 A;  4R1H A;  2IPQ X;  2OAZ A;  3SFZ A;  4K2E A;  4L9V A;  1TQI A;  1LEB A;  1AWC A;  4L18 B;  2F5C A;  2DAO A;  1F9N A;  3M9A A;  1Z7U A;  3V7S A;  2JZY A;  4QWQ A;  2FBI A;  4CXF A;  2CO5 A;  2YPR A;  3L2C A;  1F4K A;  3BJ6 A;  5LGU A;  2STT A;  2D2W A;  1UCR A;  1B9M A;  3KZY A;  2O0Y A;  3HYI A;  1IRF A;  3WTW C;  2XUB A;  3WTV C;  2JRT A;  4M6Y A;  3GO5 A;  3GUD A;  3FXR A;  4XLP F;  3O3K A;  3FM3 A;  5FFX A;  1LDJ A;  4WF2 A;  3CTA A;  2BGC A;  3QU3 A;  2Z9O A;  3GF2 A;  3L00 A;  4GGG A;  4RS8 A;  5CVU A;  4GYI A;  3FMS A;  3LWF A;  2JTV A;  3RPU A;  1YTY A;  2XAJ A;  4I98 B;  4UXN A;  2K27 A;  1R1U A;  3QAH A;  2FU4 A;  2IVM A;  1U5T B;  1FPQ A;  3HOS A;  3V8J A;  4BHP A;  1TBX A;  2XAF A;  3NQO A;  3LA2 A;  3TO6 A;  3ZMD A;  3HOT A;  3P7N A;  3LFK A;  3F8C A;  4M74 A;  2AXL A;  4S04 A;  1QPM A;  3RYP A;  3GLX A;  5HLG A;  1ZAR A;  5D5V B;  3WG9 A;  2HWV A;  1W5T A;  4WK8 F;  2OQR A;  1SFU A;  2JPC A;  4MHG A;  4L0Y B;  1LDK B;  3C1D A;  1S6L A;  2V6C A;  5D4R A;  2YU3 A;  1MKM A;  3IKV A;  2YX7 A;  4HDV A;  2VOO A;  2EK5 A;  2F5F A;  4D0P A;  3R0A A;  2KIM A;  4ESF A;  1Z05 A;  2A68 F;  1S7A A;  2HTS A;  5DD4 A;  3E6M A;  3ROU A;  2E1C A;  1O57 A;  3KFW X;  3DXJ F;  2EFO A;  2HS5 A;  2FBK A;  4A6E A;  4IRI A;  4MTE A;  1IXR C;  5F64 A;  5HOO A;  4KN7 X;  2HEO A;  3GW2 A;  3K9T A;  1RZ4 A;  2GXG A;  1J7K A;  1ZHF A;  4R79 A;  3IWF A;  3M7G A;  1MZB A;  2GA2 A;  1FP1 D;  2H6C A;  3F6O A;  2VON A;  3T5X A;  3KEQ A;  3RIR A;  1SMY F;  2P7V B;  1O3S A;  2FQ3 A;  2ESN A;  4ZYD A;  3FX3 A;  3SHF A;  2HZT A;  5JVT A;  4WXD A;  4RB3 C;  3COA C;  1FBQ A;  3GFL A;  5DCM B;  2P5K A;  3LQR A;  4Y13 A;  4KDP A;  4IRH A;  3ZN1 A;  2LSO A;  3V7R A;  5HLH A;  2PMU A;  2V9V A;  1L0O C;  3ZN0 A;  1KYZ A;  4KFC A;  4YG2 F;  3GEZ A;  3J80 Z;  1FBS A;  2K4J A;  4HX8 A;  2GIV A;  4KMU X;  1O3R A;  4YII A;  1W7P B;  5FD6 A;  1IW7 F;  1LDD A;  4EMS A;  4AIJ A;  3BP8 A;  3WTU C;  3M8E A;  3MWM A;  3F22 A;  5AON A;  4IHS A;  4HOB A;  4I2O A;  1P4X A;  3GVA A;  2L3D A;  4A0Z A;  5BPD A;  1O3Q A;  2M1B A;  2EB7 A;  3VEP A;  1LB2 A;  2O3F A;  5LGN A;  1KU3 A;  2P4W A;  4FX4 A;  3V7C A;  5HDN A;  2VBW A;  2WWY A;  1G3Y A;  1O7L A;  1TW3 A;  4KIC A;  3RYR A;  2YSR A;  1G4D A;  2KJC A;  3RDI A;  1OYW A;  1XGO A;  3KCC A;  3FZV A;  1R5H A;  1QZZ A;  1UST A;  1YW7 A;  3P9C A;  2H09 A;  3QP6 A;  2NS0 A;  4PZJ A;  1ZLJ A;  2ZME A;  1W4M A;  3TO7 A;  1H9T A;  1RIO H;  1IXS B;  1WKM A;  5HVQ C;  1F1Z A;  3GFM A;  1YYV A;  1IXC A;  4HYE A;  1B1B A;  3K2Z A;  4HBL A;  2PN6 A;  5JI6 A;  2M87 A;  1R5G A;  3ZP5 A;  3E5U A;  1K78 A;  2HGC A;  4UV9 A;  3P9I A;  2A5Y B;  2Q0O A;  4G7Z F;  3I59 A;  4IF4 A;  2IJL A;  1T6S A;  4G7H F;  1I27 A;  2VT2 A;  3V4G A;  1KQ8 A;  4WWC A;  2A3S A;  4XRF A;  1ZRD A;  2WTE A;  4AWX B;  2UXX A;  1LVA A;  1FY7 A;  3TKY A;  2VBY A;  5DV5 A;  5H20 A;  1R36 A;  2NNY A;  1XN7 A;  3ELK A;  5ICG A;  3E5X A;  3LST A;  1ZG5 A;  4UVB A;  4IPA A;  3EYY A;  3T8T A;  2HTJ A;  2CGP A;  3DFG A;  2A6H F;  4YIF A;  3I58 A;  4M6X A;  3F21 A;  1ZGJ A;  2EA4 A;  4CGZ A;  2NYX A;  4OMY A;  3HRT A;  1D8J A;  2W85 A;  5BOX A;  3K0L A;  2STW A;  1SMT A;  4HA8 A;  4OIP F;  4A0Y A;  1J75 A;  1MGT A;  3D5L A;  1E2X A;  2XRN A;  1P4A A;  4YFX F;  1T2K A;  4KT5 C;  2QBY B;  1WWX A;  2ACJ A;  5J8F A;  1BOA A;  5D6F A;  4L5I A;  5EEG A;  1WRJ A;  5D4S A;  1OKR A;  3K1P A;  4EGY A;  2O03 A;  1LEA A;  4GYG A;  3TO9 A;  4N9I A;  3QOP A;  2FOK A;  1P4W A;  1MJA A;  1R00 A;  4ENJ A;  1I1S A;  1UB9 A;  4WXC A;  2JSC A;  5TRD A;  2BV6 A;  3SZP A;  3CJN A;  2CG4 A;  5K5O A;  3D0S A;  3KP3 A;  2W84 A;  1Z1D A;  5CVR A;  3FMQ A;  3VOD A;  2A07 F;  4A2U A;  1ZN2 A;  2FSW A;  2OZU A;  4ASN A;  4H0E A;  4Y15 A;  4M71 A;  1HW1 A;  2OQG A;  3WU1 B;  3RJP A;  1OMI A;  4QLC U;  1X3U A;  2R3S A;  1P92 A;  3ERE D;  1LQ1 A;  2PJP A;  3ZMV A;  1BI1 A;  4HLX A;  2DU9 A;  3CLO A;  2F5D A;  4HF2 A;  3P9K A;  4P9F A;  5E1X A;  4MNU A;  2FEZ A;  5LRR A;  2EFW A;  2VE9 A;  4M73 A;  5KVR A;  4ENM A;  5LHH A;  3I53 A;  3DEU A;  3J80 K;  5HS8 A;  3KZZ A;  1IZ1 A;  2DBB A;  4KIG A;  1MDM A;  4L9N A;  3WE2 A;  4HF0 A;  1AOY A;  3BPV A;  2VXZ A;  3MFK A;  2FRH A;  3FF5 A;  3RKY A;  4HV6 A;  5E8G A;  4MTD A;  1SD6 A;  4UUV A;  3GXO A;  1KU2 A;  4HDU A;  2W57 A;  3REO A;  2EV0 A;  4EJO A;  2GQQ A;  4MEX F;  2DW4 A;  1KQ9 A;  3DPL C;  1OPC A;  5BMZ A;  3SZT A;  3Q5F A;  1J0R A;  3ULQ B;  2MA3 A;  4I02 A;  3GYH X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...