2D45A

Crystal structure of the meci-meca repressor-operator complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
b'TYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*TP*AP*CP*TP*AP*CP*AP*TP*AP*TP*GP*TP*AP*GP*TP*A)-3'
publication title Structure of the MecI repressor from Staphylococcus aureus in complex with the cognate DNA operator of mec.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
total genus 31
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2d45A01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 2d45A02
4HAMA 3FHZA 2P4WA 1HW2A 1Z1DA 2RVCA 3DXJF 5ICCA 5IT3A 3IC7A 2Z5UA 3BP8A 3HTUA 3QU6A 2XV4S 1WI9A 4M72A 4M6XA 4JQFA 2FBHA 2MA3A 2XHKA 3O3KA 4OMYA 1U5TC 1C0WA 4MTDA 5D4RA 1ZH5A 3GUDA 2Z9OA 4ZYHA 5ILSA 3V4GA 5FLXK 2E7WA 4R8HA 3T1BA 1AOYA 1S7OA 1ZRDA 3V8KA 4M71A 2DQLA 3DEUA 2OZUA 4E70A 1HKTA 3WTWC 2AS5F 2MLKA 3RDIA 1YQAA 1O7LA 2IA2A 4M9ZA 3TO6A 1IXRC 4G7ZF 1I5ZA 4XSZF 2KJCA 5CLSA 2IA1A 4B09A 5IT9K 2OU2A 3BY6A 1Z91A 3QRFF 1XN7A 1D3YA 3ROUA 5FFZA 1R7JA 3F23A 2Q0OA 3J80Z 1DDNA 4HF1A 2LKPA 2RV8A 4I98B 3SZTA 4ESJA 2OAZA 3SXYA 5E8GA 2QQBA 4DNCA 3ZPLA 1ON2A 3I64A 4MEXF 4RGXA 2K27A 1RUNA 1TNSA 4N9IA 2QWWA 1YTYA 1G3SA 2O0YA 3PQKA 4LB6B 2DI3A 2A6HF 2QLZA 1BI3A 1BIAA 2A5YB 2ZCWA 4EMSA 3VFZA 5L3DA 3WTUC 2YX4A 1LDJA 1IN7A 3MWMA 1BN5A 1K6OA 4HW0A 4ENJA 1CGPA 3ABUA 3GFJA 1B6AA 1PP7U 1OYWA 4KT5C 3WG9A 1SD7A 4L5JA 4RGUA 2PI0A 4Q47A 5F6FA 4Q5SF 1TW2A 4IVNA 2DPDA 4S05A 2FE3A 2AXLA 2HTSA 4BAYA 1KA8A 4L5IA 4CO8A 1FSHA 1F1ZA 1PUEE 3P9CA 2YSRA 2HQNA 3KETA 3CUQB 3CO7C 1FC3A 4L9JA 1S3JA 2ESNA 3W6KB 4HV6A 4RB0A 1GXPA 3WTVC 4PDKA 4RGRA 1UHMA 3I71A 3ELKA 2CG4A 1QBJA 1BI2A 2YR2A 4UV9A 1S29A 1RZ4A 2MH9A 2VN2A 2VOOA 4KICA 1J9IA 2JT1A 3KP2A 4KA4A 4YFXF 4ZYGA 5FGMA 2OA4A 3QOPA 2ZMEB 3K1NA 2HR3A 1L3LA 1UB9A 2L4AA 3DKWA 3HHGA 1G3TA 3IL2A 1BC7C 1S8NA 1ZAOA 2JZYA 2FBIA 4N0BA 5HS7A 3I4PA 1H9TA 3CUQA 1ZRCA 4WK8F 1SAXA 2K7LA 3PQJA 1T6SA 4O6JA 2H6BA 3TO7A 3J7AO 3ZMTA 1UHWA 1O3SA 3K1PA 5J8CA 5DYMA 1KU7A 1G4DA 2NRAC 1U3EM 3EYYA 3LA7A 3BPXA 3KE2A 4ENNA 2ZMEA 2G7HA 3U2RA 2EJRA 2FMYA 4RB3C 2MBFA 4HA8A 4EJWA 1Z6TA 2JSCA 3OOPA 3P9IA 1KYWA 3T5XA 3V8JA 2IA0A 4HDUA 3K1MA 4WXCA 2EFNA 3KEQA 3ZMVA 1XGSA 1LJ9A 4NHJA 2PFBA 3GXOA 3I54A 3LA3A 3GEZA 1F5TA 4XLPF 4BYYA 1A04A 4K2EA 3F6VA 1W7PD 4EM0B 2V1DA 5H20A 2GA1A 1K79A 2Y48A 2K4BA 5ILUA 4LMYA 3HYIA 1EH7A 5FD6A 3WU1B 2F5EA 2PG4A 2HYGD 1Z7UA 2CYYA 2F5CA 2F5FA 3FWEA 1AWCA 1F9NA 2M1BA 4YFKF 1FX7A 3HRUA 2HGCA 3M7GA 2PQ8A 1OMIA 1R5HA 3WTXC 3LAPA 4LLNA 5HLIA 4O5VA 1XSVA 4UVAA 3BDDA 2KIFA 4FX4A 3ISPA 3QPTA 3R4KA 1DP7P 3R0AA 3I0TA 5LEKA 2A6EF 3B02A 3GX4X 3GZ6A 1ZN2A 4IRIA 1B9MA 4KIFA 4AD9A 3FMRA 5LRRA 4WF2A 4G6DA 2VBWA 1IN5A 1YG2A 2E1CA 5CVJA 4LFUA 3GLXA 3EYIA 2D1VA 4AWXB 2ELHA 5F1RA 3VODA 2HTJA 2P5LC 1USSA 2W85A 3KLNA 1B59A 5E8IA 2DAOA 2BGCA 1G3WA 4EGYA 2XKPA 1F4KA 4U0YA 1K7AA 2YX7A 1G6NA 2DU9A 1LDKB 1FT9A 1J59A 2L02A 4F7ZA 3EETA 1KQ8A 5CVVA 2V1XA 3R6SA 4LD5A 1Q1HA 1R00A 2VE8A 3ZP5A 2F2EA 3RJPA 5J8FA 2VT3A 3ECOA 1W5TA 1P6RA 4LK0F 2H09A 4ZZDA 5K5QA 1IUYA 1XDSA 1R36A 1YW9A 4P96A 4B8XA 5D5UB 4CICA 4KN4X 2JPCA 2QQ9A 4UXNA 4A5NA 3JAMZ 1TBXA 1D8JA 1T2KA 4L0ZB 3R0JA 4WX9A 3ZMZA 2K02A 5KVRA 1E17A 3SHFA 2KKOA 3D0SA 3RKWA 2QZ8A 3CTAA 5KK1A 1STZA 2FMLA 2V79A 5H6QA 3TDZC 4EVIA 2OBPA 4EJTA 4Z2YA 3E97A 2HKXA 2DO7A 5ICEA 2IRFG 4IXAA 2EV5A 5E20A 3LQQA 3J80K 4UNOA 4DQ2A 3REOA 1FBUA 4XSXF 3IWZA 1TQIA 5BOXA 5HDKA 1P92A 3BROA 4U88A 4L9TA 2BYVE 3SFZA 3IRRA 2IPQX 2FEZA 2DT5A 3F8BA 3F8FA 2JTVA 4ZYDA 4LJZF 5HVQC 1FY7A 3WGIA 2G9WA 2FXAA 2KRFA 6PAXA 1ZG3A 5TJJA 3KP7A 1ZARA 4H0EA 4A0ZA 2ZFWA 1R22A 1GXQA 5BPIA 3IRQA 2H6CA 2HOEA 2MC3A 5FO5A 2FF4A 4EJUA 4KMUX 3SZPA 4OIQF 4U7DA 3IWFA 2CFXA 5L3FA 5L3EA 4WXHA 2K4JA 1HW5A 3L7WA 4IHTA 2W25A 1R1UA 2ZXJA 2CWEA 2EK5A 3DFGA 5JI6A 2P7VB 4IHSA 2DLLA 2QQAA 2LDUA 1SMTA 1XSXA 4U0WA 1J7KA 1OKRA 3U1DA 3LAJA 4OU0A 2FOKA 1YLFA 3KFWX 3HOTA 3ECHA 1B4AA 3ML6A 1R23A 1DPUA 4IRGA 4EM2A 2O3FA 2Y75A 3DF8A 2ISZA 5D5WB 3V8LA 1YW7A 2XVCA 2D1HA 3CJNA 4ON0A 2DK5A 3MCZA 4M6YA 4A6EA 5ICFA 3C3WA 2QM3A 2VOPA 2NYXA 2FNAA 3FMSA 3QU3A 4QLCU 2UXNA 2XKOA 2O6GE 2PJPA 1IF1A 1IW7F 2EV0A 1W7PB 2D2WA 3WGGA 4BHBA 5TRDA 4P9UA 4GO1A 4OIPF 5JFRA 1KGSA 3WGHA 4HX7A 3QP6A 2BEOA 1QZZA 1KU9A 1O3RA 1FP2A 1OPCA 4WCGA 1SMYF 5JR3A 2VT2A 1WSUA 3E6DA 3EUHA 1XDUA 2XUBA 4ESBA 1JE8A 4CXFA 1WRJA 2OD5A 3M1EA 2IVMA 2ZNYA 4HDVA 2HQRA 2IJLA 3O6BB 2G7UA 1SFXA 3GFIA 3FF5A 5DCFA 1W7PA 1YIOA 1MD0A 3K69A 1LVAA 2FBKA 2JPBA 3KZZA 4EM1A 2P6TA 3F8MA 3HHHA 2X4HA 1LNWA 3MZHA 4UVBA 5LHIA 1LDDA 2DTRA 2RQPA 4ASNA 1ZLJA 1T39A 5DD4A 2LF8A 2LF7A 4PCQA 4GXOA 2EWNA 5DEQA 4UUVA 5LGTA 3MAJA 3CUQC 4GGGA 2J5OA 4LLGF 1OR7A 5D8LB 2GZWA 5LGUA 1O3TA 2PLYA 3KP6A 4KUMA 3DPTA 2QYOA 3F3XA 2O8XA 3C7JA 4Y15A 1ZYRF 3GWZA 3F8CA 1QPMA 3OV8A 1XSDA 1Y0UA 2QBYB 1BI0A 1D8KA 4CZZA 2ACJA 4I0BA 5EEGA 1HW1A 2QENA 3RPUA 2BBYA 2RDPA 1P4AA 3IHUA 4YIFA 2D45A 4A5MA 4JBAA 2MLGA 4KNYA 3HIFA 4O3MA 2FQ3A 3O2PE 1EH8A 4EGZA 3QAHA 3IKTA 3E6CC 4ENKA 2QBYA 2DFIA 4MNUA 1JHFA 3KP5A 4BH9A 1B1BA 1U8RA 3AAFA 4KDPA 2VE9A 2FSWA 5AIPA 1CF7B 4AIJA 3MQ0A 4ZYEA 4A0XA 1P4XA 3NRVA 5DUIA 1HSJA 2DW4A 1I27A 1XGOA 5BMZA 3M9AA 4I02A 4HF2A 1R5GA 2GWRA 1JXSA 3QPHA 4HQMA 3FZVA 3DPLC 3M8EA 5DD8A 3B73A 4AVPA 3GVAA 1O57A 2H94A 3LFKA 1BBYA 4A2UA 2ISYA 5F64A 3M8FA 4G9YA 1UCRA 3F72A 2UXXA 4LLLA 1MJAA 2GA2A 3VOEA 3CDHA 5HOOA 5LRSA 2XAJA 3I59B 5E1ZB 1G3YA 2UWMA 3JAMK 3E5QA 2KIMA 1YS6A 4S04A 2DQRA 1BC8C 1SD5A 4PGHA 1HSTA 2HFHA 3RPQA 4L9VA 3TDUC 2GAUA 4LGWA 4WXDA 3JSOA 2E7XA 4G8XA 2E1NA 4JK1X 4LK1F 4KYWA 2VXZA 4L9NA 1QQIA 2F5DA 3D5LA 4KN7X 1HKSA 4ESFA 4IJAA 2XAGA 2ZNZA 4EJVA 2MD5A 5E1XA 3RKYA 1IN8A 2VBYA 2W24A 1J2XA 3I59A 4D0PA 2L3DA 2QUFA 3HOSA 4MGRA 2IP2A 4HV5A 5L3CA 1LQ1A 3ABTA 2VODA 1MZBA 2W84A 4M9SA 3E3VA 2LNBA 3H92A 4M74A 4L18B 3L2CA 2Z33A 2DBBA 1IRGA 4KIGA 3I58A 3TOAA 4NQWA 3KZYA 3T8TA 2H27A 4ZH4F 1FZPB 4QWQA 3JSPA 2GXBA 4BHCA 2O61A 2NNYA 1X3UA 1BOAA 2PN6A 2ADUA 2PMHA 3GZ5A 2XRNA 3N97A 2M8EA 1JHHA 2M45A 3WE2A 3I53A 1V4RA 1S6LA 2YPRA 2ESHA 2HDCA 1WWXA 1R58A 3C1DA 1QGPA 5L3BA 4G6QA 3H3ZA 1BM9A 4I09A 4MEYF 2CQKA 4OMZA 1OYIA 2YU3A 2XGXA 4L0YB 3RYRA 2DPUA 3BJAA 3L9FA 3CUOA 3Q9SA 1FNNA 5DDGA 1IZ1A 2L54A 2TDXA 4RS8A 3ZN1A 1USTA 1XMAA 3COAC 4I01A 3EDPA 4I0AA 2OZ6A 2ZBKA 5CVIA 4FHTA 5HS9A 1LEAA 1O3QA 2A69F 4M73A 4IPAA 1YW8A 1V3FA 4OIRF 1XD7A 5FD5A 4YFNF 2RC4A 2A61A 5CVUA 2XROA 1ZLKA 3KP4A 2NAZA 2X0LA 1FSEA 4UV8A 3BJOA 3HTSB 5H6RA 3ZN0A 1TLHB 1MGTA 4A12A 2PEXA 3K2ZA 2KIUA 3LSTA 3ZQ7A 1KQ0A 2L4MA 2VBXA 3G73A 5LHHA 4G7OF 3K0LA 1FBQA 2XAHA 1OYYA 4GYIA 4G94A 5A2QK 2R3SA 2EFQA 2HYFA 2K86A 4AIHA 3GO5A 1HQCA 3TKYA 3E6MA 3BPVA 1XMKA 2CSOA 2ZO4A 2QVOA 3GF2A 2HS5A 3JTHA 2ZKZA 4U7BA 3H3UA 1U78A 5AONA 1IRFA 2COMA 4HLYA 1U5TB 4R79A 2MH2A 4HF0A 4EQQA 3LA2A 3MFKA 1GHCA 1TNTA 2FA5A 4NB5A 1ODDA 2FNPA 1BI1A 2W57A 3LWFA 3BOQA 3KP3A 1HBXG 4A0YA 1W4MA 3KEOA 1SD6A 1WQ2A 3WTZA 3NEUA 5D6FA 5ILVA 2HEOA 2OQRA 3DV8A 2EB7A 3T0YA 3F8NA 1QNTA 3ULQB 4XLNF 4MQVA 1U5TA 3U9GA 3R61A 1BJAA 3E5XA 2STTA 4MHGA 2EFOA 2J5PA 3MEXA 1T98A 5HDGA 3ZMUA 1TQMA 4OINF 1TQPA 4XRFA 4UVCA 5ERIA 2GIVA 1H0MA 3RTRA 1LB2A 1FWZA 2VBZA 3ZMSA 3I5UA 1XCVA 2R7DA 3E6BA 3VB2A 3Q5FA 2FRHA 1ULYA 1HXDA 2UZKA 4RB1A 4BQAA 2NNNA 1YO5C 1FP1D 1TTYA 5A2QZ 1ZG5A 4IRHA 1VTNC 3J81K 2XAQA 2M5WA 2ETHA 5K1YA 4HLXA 3MZYA 5E18F 2WWYA 1FLIA 1P2FA 4LB5A 1FYLA 3RI4A 3CO6C 2GQQA 2ZJ2A 3LQRA 3Q9VA 1K78B 1IXCA 2C6YA 3WU0A 4HX8A 3V7RA 3KLOA 1KU2A 3SQNA 4MTEA 2Z3YA 3NQOA 2VC1A 5DV5A 2VONA 4MQ9F 2RNJA 4GCVA 2P5VA 2Q2EA 5FLXZ 4FT8A 1P4WA 1FOKA 3GFMA 1RI7A 2XAFA 3WTYC 4RGSA 3P9KA 1ONVA 3C18A 1NHAA 1QZYA 1K78A 2EA4A 2M87A 4PGGA 5FB2A 4Q4ZF 4LG0B 3FXUA 2IW5A 5CJ9A 3BZ6A 5IT9Z 1RIOH 3QP5A 3WTTC 1I1SA 2HWVA 4M9XA 1Z9CA 2CO5A 5E1WA 5L3GA 4AIKA 2A07F 4KMFA 4CYDA 2EFWA 5HS8A 5D8KB 3HSEA 3FX3A 4Q48A 4N9HA 3RYPA 3GFLA 4ZZLA 1L0OC 2XIGA 2FU4A 4I2OA 4CGZA 1MJBA 2V9VA 5K5RA 1B9NA 5D5VB 1S7AA 3J81Z 4KFCA 1SFEA 2EV6A 3FXRA 4LG0A 1PP8F 4BXUA 1XCBA 3L00A 1FBSA 5LBQA 5ICGA 1PDNC 1RNLA 2PBIA 3HRTA 2M30A 3K9TA 1T38A 2BV6A 2CGPA 5CVRA 1FYMA 2L01A 1WKMA 1ZGJA 5EEHA 4HZFA 3HUGA 4Y17A 3ZMDA 3RIRA 5K5OA 4CDGA 3HRSA 3PFIA 1RUOA 4RB2C 1R1TA 1IAWA 3FXQA 2P6SA 1KYZA 1Z05A 2V6CA 2HZTA 3V7CA 3G3ZA 3VEPA 4P55A 2WC2A 2P7CB 3BJ6A 2Y0MA 1E2XA 3DQVC 1MJ9A 1J75A 4PZJA 5J6XA 2OQGA 4HOBA 1TW3A 3TQNA 1HKQA 4IF4A 1CF7A 2CW0F 4YIIA 2LSOA 1KQ9A 3BWGA 2BE5F 4UHTA 5D6EA 2WTEA 1EV7A 4G7HF 2V1UA 3TGNA 1JGSA 2R7FA 5ED4A 1ZRFA 1ZG1A 3S2WA 3IKVA 1I6XA 2NS0A 2A68F 3GW2A 3TOBA 1LEBA 2DK8A 1IN4A 1J0RA 4EV0A 1XGNA 1H9GA 1XGMA 3DP7A 4Y13A 4A6DA 5DUKA 2RN7A 5JHUA 1XB4A 3E5UA 1IN6A 3N4MA 5DCMB 1T0FA 1YFHA 3WODF 1QO0D 4P5OA 4I7HA 4RAYA 5LEJA 1YS7A 3HRMA 1J5YA 4EJOA 2RKHA 1YYVA 1ZGAA 2B0LA 2RGVA 3R60A 1ON1A 4BNCA 2JRTA 3F21A 2A3SA 5BQTA 4GYGA 3WE3A 5BS6A 1U2WA 4HX4A 1FYKA 1R1VA 1D5VA 3F6OA 5DCMA 3ERED 2EA2A 4OOIA 1Z6RA 4R1HA 2HKOA 1FPQA 3JTGA 3WTSC 1ZHFA 2KJBA 2PMUA 1U6GA 5LLQA 1ZREA 4TV7A 1DUXC 4HQEA 3CLOA 5AIQA 2GXGA 3FMQA 1UFMA 1IXSB 2EFPA 3JW4A 3KCCA 5LGNA 3HSFA 4CHUA 3HSRA 4HBLA 5FFXA 1SD4A 1EH6A 3V7SA 4XBFA 3RKXA 4OIOF 1SFUA 1MKMA 4YG2F 3GYHX 3FM3A 4WWCA 4RAZA 5JVTA 1O7FA 2STWA 1REPC 2IT0A 2VC0A 3FM5A 1W5SA 5D5XB 2WV0A 5HLGA 2Q8KA 1BIBA 3F22A 1GVJA 3EQLF 4P9FA 3W6JB 3TO9A 5HLHA 3L09A 1DPRA 4U0VA 2Z99A 5HDNA 1MDMB 2P5KA 5CYVA 2XASA 5LHGA 4HYEA 5D4SA 1I1GA 2O03A 5BPDA 5E17F 3P7NA 1KU3A 4ETSA 4FX0A 2P8TA 3T8RA 4BHPA 4KIBA 4ENMA 1MDMA
chains in the Genus database with same CATH superfamily
3DTEA 4HAMA 2DMTA 3OYBA 4XKVA 3FHZA 1JUMA 2P4WA 1HW2A 2KLOA 1Z1DA 2RVCA 3DXJF 5ICCA 3ERMA 2BVMA 5IT3A 1Q1VA 3IC7A 2Z5UA 3BP8A 3HTUA 3QU6A 3J7YJ 4ZDPA 1OCRH 2XV4S 3X2QH 1RKWA 1WI9A 4M72A 5FKLA 4M6XA 4JQFA 2R5ZB 2FBHA 5C44J 3V42A 2MA3A 2XHKA 3O3KA 2H8WA 4OMYA 3JRCA 3PNYA 1U5TC 1C0WA 2NVXJ 4MTDA 5D4RA 1GLNA 3BR6A 2AO9A 1ZH5A 3JRGA 3S3OA 3GUDA 2Z9OA 2WY8Q 2EZLA 4ZYHA 1QHGA 2LH9A 5ILSA 3V4GA 2HVRA 5FLXK 2E7WA 3Q3SA 5IYBJ 4DYCA 4R8HA 4F93B 5JLWA 3T1BA 2AQEA 2HU9A 2LC2A 3BTCA 4XOPA 4I6ZA 1AOYA 1S7OA 1ZRDA 3V8KA 4QIWN 4M71A 2DQLA 3DEUA 3SFIA 2OZUA 4E70A 1YRNB 1HKTA 3WTWC 3GCMA 5EDNA 2OV7A 2AS5F 2JA5J 4A3BJ 3NWSA 4JP0A 4KISA 2MLKA 3RDIA 2DN0A 3HGGA 1YQAA 4D7MA 1O7LA 1ZK8A 2IA2A 4M9ZA 1SFKA 2R5ZA 3TO6A 2RAEA 1IXRC 5F1JA 3KIOA 4G7ZF 2GOMA 2E5NA 2IBDA 3CCUI 3VPRA 1I5ZA 4XSZF 2KJCA 1Y0NA 1UAAA 2ZB9A 4AC0A 5CLSA 2IA1A 3MMYB 4B09A 1I6HJ 1LKXA 1UHSA 5IT9K 1OQYA 2VQHA 2OU2A 3BY6A 1Z91A 3QRFF 1XN7A 1H89C 2XSJC 1D3YA 3ROUA 5M5YJ 5FFZA 1R7JA 3F23A 2Q0OA 4N4OB 3J80Z 1MW7A 3OIOA 2R7VA 4A3DJ 1VFCA 1DDNA 3PJRA 4HF1A 1R6RA 2LKPA 2ELKA 2P81A 2V1NA 3RZOJ 3CCJI 2RV8A 4I98B 3SZTA 4ESJA 1YRNA 3C2HA 2OAZA 4P1WA 2E1MB 1ENHA 1N75A 2VPLA 2KDOA 1N25A 3SXYA 5E8GA 4B4CA 1MMNA 3CQZJ 2QQBA 4DNCA 2FD5A 1YJ9I 3ZPLA 1IRXA 1ON2A 2QQ8A 2ECBA 3I64A 5EZHA 4MEXF 1VQKI 4RGXA 2K27A 1RUNA 9ANTA 3S1QJ 1TNSA 4N9IA 4IZZA 2QWWA 2VQCA 1YTYA 1G3SA 2O0YA 1R5ID 3PQKA 3K4JA 1UMQA 2BY0A 4LB6B 2DI3A 2XB0X 3S16J 2ME6A 3ABLH 2A6HF 1PUFB 2QLZA 4XN0A 1BI3A 3H3VK 1BIAA 1WGXA 2XC7A 2VLAA 2A5YB 2ZCWA 4CZCA 4IOAF 4EMSA 5KAFC 2F5VA 3VFZA 4AYBA 5L3DA 3WTUC 2YX4A 1LDJA 4XIDA 3OYEA 3CF5F 3F0CA 1IN7A 1X1BA 1A31A 3AG3H 3HJEA 1TZLA 3MWMA 3F9KA 1BN5A 1HF0A 3J7AY 4XM3A 1K6OA 1XX5A 1WJ5A 2LP0A 4HW0A 4ENJA 4V19K 1CGPA 3ABUA 3GFJA 3H5RA 3OYNA 1B6AA 1W1WE 1PP7U 3K4NA 4UUSB 1OYWA 4KT5C 3WG9A 3I3LA 3CC4I 1X4OA 1SD7A 4L5JA 4RGUA 1BJZA 2PI0A 2DOFA 3U21A 1IV6A 4Q47A 5F6FA 4Q5SF 1TW2A 4IVNA 2DPDA 1VZ0A 4S05A 1QPIA 1PUFA 4ZTJA 2FE3A 3FKJA 2AXLA 2KQRA 3M07A 2HTSA 4ANJA 4BAYA 1KA8A 4L5IA 4PJNA 2L9SA 4CO8A 3CESA 1FSHA 1F1ZA 4F91B 1PUEE 2KP6A 3P9CA 2YSRA 2HQNA 3KETA 3CUQB 3CO7C 3CCLI 1FC3A 3LMMA 1VQ5I 1WHUA 3OY9A 2K9MA 4L9JA 2ZFUA 1S3JA 3W3CA 2ESNA 2A05A 1ZELA 3W6KB 2WY7Q 4HV6A 1GDTA 5J1YA 4RB0A 1GXPA 3WTVC 4PDKA 4RGRA 1UHMA 1WZ2A 3I71A 3ELKA 2ZXWH 5J3LA 2CG4A 3DU5A 4KITB 1H88C 1QBJA 1BI2A 2YR2A 4JX6A 4UV9A 1S29A 1RZ4A 2MH9A 2VN2A 1TWGJ 2VOOA 2Z16A 4UUSA 4BEHA 1WJDA 3MKLA 4KICA 1J9IA 1MNEA 2JT1A 3KP2A 3SDGA 3L1PA 1X3ZB 2GIZA 3VYTB 3BG6A 4YFXF 4KA4A 4C2UA 3S1NJ 1MBFA 4ZYGA 5FGMA 2OA4A 2MG4A 3QOPA 1EJ9A 2ZMEB 3GLLA 3K1NA 2HR3A 1L3LA 1UB9A 2L4AA 3DKWA 3HHGA 1G3TA 3IL2A 1Y56A 1BC7C 1QU3A 4XLFA 1S8NA 1ZAOA 2JZYA 2FBIA 4N0BA 4Y3OA 5HS7A 5C4XJ 3I4PA 4Y52J 2KZGA 1H9TA 3CUQA 4BBSJ 1ZRCA 4WK8F 2O9LA 4MFEA 4BGDA 1SAXA 4LITA 2K7LA 1DQUA 4QSHA 3PQJA 1T6SA 4O6JA 1FOWA 2H6BA 3TO7A 3S2HJ 3J7AO 3L2WA 2L7ZA 3ZMTA 4J01A 4A3FJ 1UHWA 1O3SA 3VWBA 1ETOA 1MBEA 3K1PA 3RKQA 4B3AA 3JRDA 5J8CA 1LE8B 3HDDA 1FOXA 5DYMA 2KDZA 2Y0SA 1KU7A 3TBIA 3GTPJ 2Y0SN 2R7SA 5B1AH 1G4DA 5KAIC 1KONA 2NRAC 1U3EM 3EYYA 3LA7A 3BPXA 3G1MA 3KE2A 4ENNA 2ZMEA 2G7HA 3U2RA 2GBYA 1K6YA 2EJRA 2FMYA 4RB3C 3LOCA 2MBFA 4HA8A 2BHYA 4EJWA 1Z6TA 2JSCA 3OOPA 3P9IA 1KYWA 2L9RA 2WADA 3T5XA 3V8JA 2IA0A 1HC8A 1P9QC 4HDUA 3K1MA 4WXCA 2EFNA 3KEQA 3SEQA 3ZMVA 3HL2A 1XGSA 4D5CA 5TGTA 4L5EA 1LJ9A 2H1LA 4RLFA 4NHJA 3S2DJ 3VYSB 2PFBA 3MN2A 3GXOA 4HSRA 3I54A 3LA3A 1LE8A 2IXSA 5KCMA 4BXFA 2NOGA 3GEZA 1F5TA 4FQGA 4XLPF 2R92J 4BYYA 2TRTA 3ZQCA 1A04A 4K2EA 2F4OB 1DU6A 3K4BA 3F6VA 2HQ5A 1W7PD 3LNQA 3HGYA 4MLOA 4E6KG 4EM0B 2V1DA 5H20A 1SAUA 3GTQJ 3E0JB 4XLHA 5LD2C 1ETVA 4IHYA 2GA1A 4DJAA 5FJ8J 1K79A 2Y48A 3FBNB 2CW8A 2K4BA 5IPAA 3GTLJ 2NVQJ 5F04A 3OSFA 3S3NA 4RA2A 4RM2A 5ILUA 1MIJA 1S72I 4LMYA 2CU7A 3HYIA 2EBIA 2MGQA 1T0FC 1EH7A 1KZHA 5FD6A 3WU1B 2F5EA 2PG4A 1E3HA 5IYDJ 2LG4A 2HYGD 1QVTA 4XLEA 2KT0A 1Z7UA 2CYYA 2F5CA 4B1RA 4DBRA 2F5FA 3FWEA 1AWCA 1F9NA 2IS4A 2M1BA 1T8IA 4BE1A 3A01B 4YFKF 1JT6A 1FX7A 3HRUA 2HGCA 3M7GA 2PQ8A 4E4HA 1OMIA 3QWLA 1R5HA 3WTXC 3LAPA 4LLNA 5HLIA 4GDFA 4O5VA 1XSVA 4UVAA 1A6QA 3BDDA 4G12A 3PNVA 3K70D 2KIFA 4FX4A 3ISPA 3QPTA 4ZC3A 3GMEA 4A3GJ 5FLMJ 2Y69H 3R4KA 1DP7P 3R0AA 1W5CC 2VASA 3I0TA 2MW8A 1HA8A 1MSFC 2EINH 5LEKA 2A6EF 3B02A 3GX4X 3GZ6A 4JOMA 4BE2A 3DPUA 4H4KC 1VQ8I 1ZN2A 3FXMA 4CCLA 4IRIA 1B9MA 2CQ7A 4KIFA 1MBHA 4CCMA 1YX3A 4AD9A 2GLOA 3FMRA 5LRRA 4WF2A 2DDAA 4G6DA 2VBWA 3A01A 1IN5A 3RPUD 2EQRA 1YG2A 4XL9A 1FIAA 2E1CA 5CVJA 4LFUA 2DJIA 3GLXA 4FISA 3EYIA 5GADJ 2D1VA 4EEFG 4AWXB 2ELHA 2X85A 3DEWA 5F1RA 3VODA 1K4SA 2HTJA 1AU7A 2P5LC 1USSA 2W85A 2WAQA 3KLNA 3KYLA 3QPLA 1B59A 2I10A 2WAQN 5E8IA 4DW6A 4NC7A 3S17J 3M3YJ 4IHWA 2JUCA 2DAOA 2BGCA 1ZR4A 3JR9A 1G3WA 4EGYA 3I9V2 2XKPA 2ID6A 2BZTA 3CF2A 3PM1A 1WJEA 1F4KA 4U0YA 1K7AA 2K40A 2VKEA 2YX7A 2K9SA 1YJNI 1YI2I 1G6NA 2DU9A 1UJ8A 1LDKB 3S3MA 2CUZA 3H0GJ 4NDLA 1FT9A 2BY2A 1J59A 1R49A 2L02A 3OYJA 1RESA 4F7ZA 3EETA 1JI8A 2W7NA 1KQ8A 4Y33A 2WBMA 3PSFA 5CVVA 2I5UA 1TT0A 2V1XA 3GTJJ 3R6SA 4LD5A 1Q1HA 1R00A 3BG9A 3W2AA 2VE8A 3ZP5A 2F2EA 3RJPA 5J8FA 2VT3A 3ECOA 1W5TA 1JJ8C 2JQ7A 1P6RA 4LK0F 4BBRJ 1NG7A 2H09A 3KPHA 5K7FA 2BW3B 4ZZDA 4M3DA 5K5QA 1IUYA 2HPMA 1XDSA 1DGRM 3HZJA 4BE0A 3A0BC 2YU9J 5FKNA 1R36A 2DMPA 4XORA 1YW9A 4P96A 4B8XA 5D5UB 4CICA 4KN4X 2JPCA 2QQ9A 3PIOF 4UXNA 1MNDA 4OAYA 4A5NA 3JAMZ 1TBXA 1WJAA 2F4MB 1D8JA 3S8PA 1T2KA 4A69C 4L0ZB 2CS3A 3R0JA 3ZMZA 4WX9A 2K02A 5CPRB 5KVRA 2Y9ZA 1E17A 5GAEJ 3IUOA 2UV1A 3SHFA 1BA5A 5J40A 2VI6A 3ZQIA 2KKOA 3D0SA 5HNHA 3RKWA 2L2OA 3ZQGA 1Z67A 2QF7A 2QZ8A 3CTAA 5KK1A 4J19A 1DP3A 5F08A 3Q0UA 1ETYA 1STZA 1ETXA 3DEEA 1IDYA 2IS6A 2XF7A 1Y1VJ 2FMLA 2V79A 5H6QA 3TDZC 4EATA 4EVIA 5JLXA 2OBPA 2DCEA 4CCOA 4EJTA 4Z2YA 3E97A 2ZXIA 2HKXA 2DO7A 5ICEA 5IY5H 2JWTA 2IRFG 4IXAA 2HXIA 2EV5A 5E20A 3LQQA 1ZKGA 3J80K 4UNOA 4DQ2A 3REOA 3QOEA 3NWTA 1FBUA 4G6TB 4XSXF 4RBOA 2FUG2 3IWZA 1XG1A 1W0TA 2DTZA 1TQIA 3OYCA 1BL0A 5BOXA 2ZJQF 5HDKA 3BG3A 2N8GA 2NVUB 1P92A 2E35A 3BROA 4U88A 4L9TA 2BYVE 2ICWG 4UUTA 3SFZA 3J7ZI 2IPQX 3IRRA 2FEZA 2DT5A 1W36D 1UZCA 2L9VA 3L2RA 1JUSA 3F8BA 1U9NA 3F8FA 2JTVA 5J1RA 4FASD 1N77A 4BJTA 3IH2A 4ZYDA 4LJZF 4HSTA 5HVQC 1FY7A 2ZXHA 3WGIA 1JKOC 2G9WA 3AG1H 3CMEI 3SJMA 2FXAA 4LG3A 4CH7A 2R7WA 5FKKA 2JK3A 1P7JA 2KRFA 6PAXA 1ZG3A 4CCKA 3O8HA 5TJJA 3KP7A 1ZARA 3DU6A 3LSHA 1JGGA 4H0EA 4A0ZA 2JSPA 3VSLA 4F3QA 4A3KJ 2ZFWA 3LSGA 1R22A 4PUSA 1GXQA 1MMGA 4NC8A 1U9OA 3WHCA 5BPIA 3IRQA 2H6CA 3DTKA 4XQFA 3G71I 2HOEA 2W82A 4B3XA 2MC3A 2V26A 4YRVA 2XPUA 1FMWA 5FO5A 2FF4A 3JRIA 4EJUA 4KMUX 3QYFA 1TWFJ 3SZPA 4OIQF 1K4TA 3P5JA 4U7DA 2W4SA 3OSGA 3IWFA 2CFXA 5L3FA 5L3EA 4YELA 3B6AA 3A02A 2IGMA 4WXHA 2K4JA 1HW5A 3HOZJ 1LUJB 3L7WA 2DJNA 4XR6A 1B8IB 4IHTA 2W25A 1R1UA 2ZXJA 1GV5A 3IH4A 2LVSA 2CWEA 1TC3C 3N05A 2EK5A 3DFGA 1TWAJ 5JI6A 2CMPA 2P7VB 4IHSA 1ZGWA 3HC7A 4NBQA 2DLLA 3OYDA 2QQAA 2CUJA 4DBQA 2LRDA 2LDUA 5GAHJ 1SMTA 1XSXA 4U0WA 1J7KA 1OKRA 2LY2A 3U1DA 3LAJA 1IRZA 4OU0A 3RSNA 3ZR8X 2FOKA 1YLFA 4BACA 1SVLA 3OWTA 5GAGJ 3KFWX 5FKMA 3HOTA 3ECHA 1D0ZA 1PYVA 2EZKA 1TT5B 1B4AA 4D7NA 3H0DA 3ML6A 1R23A 1DPUA 4IRGA 1APLC 3FDYA 3KZIC 3PUFA 2EIKH 2O3FA 3BQYA 4EM2A 2FJ1A 2Y75A 3DF8A 2ECCA 2IAIA 3OOUA 2ISZA 3E7LA 5D5WB 3DLAA 1YW7A 3V8LA 2XVCA 1UG2A 5IOZA 2QEXI 1B8IA 2X6OA 2D1HA 3CJNA 4ON0A 2DK5A 3MCZA 4ZJZA 3HBLA 3FIWA 4M6YA 3EPZA 4A6EA 5F0FA 5ICFA 4F55A 4M3GA 3C3WA 1LFPA 2QM3A 1N78A 1VQOI 2WAEA 2VOPA 1WPKA 4X6AJ 2NYXA 2FNAA 2XPWA 3FMSA 3HG9A 2X6XA 2LBFB 1BR1A 2BY3A 3QU3A 5DM6F 3EUKL 4QLCU 2UXNA 2XKOA 3GZNB 3WU2C 1I50J 2G0EA 3CCVI 2E1MC 2XB5A 1ETQA 2O6GE 2PJPA 3K4CA 1IF1A 1IW7F 1RPWA 1W7PB 2EV0A 2D2WA 3WGGA 4BHBA 1GV2A 5TRDA 3GTKJ 4P9UA 2GOXB 4GO1A 4OIPF 2LTPA 5JFRA 1SC7A 3CLQA 1KGSA 3WGHA 2X48A 2A6TA 2E5ZA 4HX7A 3AL0C 3QP6A 2VKVA 3Q0WA 5C4JJ 2BEOA 4HPQA 1QZZA 1KU9A 1O3RA 3IAM2 1FP2A 1OPCA 3WG7H 3G1OA 4YIRX 4N4NB 4WCGA 4A93J 4B47A 1WFXA 1I39A 1SMYF 2VJ5A 2VT2A 3E6DA 5JR3A 1WSUA 2KHMA 3EUHA 1XDUA 2E1OA 2XUBA 3K10A 2HOAA 4ESBA 1JE8A 2PMZA 2OPTA 1WRJA 3CJQB 3CP8A 4CXFA 2OD5A 4AYBN 3M1EA 3FBIB 5GPAA 2IVMA 3DLLF 2VKDA 2ZNYA 4HDVA 2M0MA 2MABA 2HQRA 3HXLA 2IJLA 3O6BB 4C3IJ 4QTRA 4IX7A 2G7UA 1SFXA 1X2NA 5IP9J 3AKZA 3GFIA 1XPXA 3FF5A 5DCFA 1W7PA 2F6CA 3S93A 1YIOA 1MD0A 3K69A 3TW6A 2WA0A 1EF4A 2B63J 1LVAA 2FBKA 3H9GA 2JPBA 1QA6A 3KZZA 5HODA 1JKRC 4EM1A 2P6TA 3F8MA 3HHHA 3W2WA 3CCMI 2X4HA 1LNWA 2DFEA 2L9NA 3MZHA 4UVBA 1YX5A 5LHIA 1LDDA 3HOXJ 1G8XA 2DTRA 2DMUA 2RQPA 4ASNA 1ZLJA 1T39A 2R5YB 3BR2A 5DD4A 3K4KA 5EG0B 4DGWB 1MH4A 1LVKA 2COBA 4E7SA 3TW7A 1IG7A 1IGNA 1OISA 1X1PA 2HI3A 2LF7A 2LF8A 3G4SI 4PCQA 4GXOA 2EWNA 5C3EJ 2I8DA 5DEQA 4UUVA 3TP0A 4M6VA 5LGTA 5M5WJ 3MAJA 1ETKA 3SDBA 3CUQC 4GGGA 4B44A 3W2VA 2J5OA 2GXAA 4LLGF 4BY1J 1TWCJ 1OR7A 5D8LB 3CMMA 2GZWA 2L7KA 2X1EA 1G59A 5LGUA 1O3TA 2PLYA 3KP6A 2ZSIB 4E7IA 4KUMA 3PO2J 1IO2A 1JKPC 1IV8A 1A5JA 3DPTA 2QYOA 3F3XA 3NARA 1OCTC 4A3LJ 2O8XA 4U87A 3C7JA 4CCNA 4Y15A 2WV1A 2CQQA 3SEZA 2JA7J 1ZYRF 3GWZA 1YITI 4CUGA 4GFBA 4Y7NJ 3F8CA 1BOBA 1QPMA 3OYMA 2TCTA 3OV8A 2R5YA 1Z77A 2OUMA 2XF5A 5EEAA 1XSDA 1Z7LA 1Y0UA 5EG0A 2QBYB 3ESWB 2V9PA 1BI0A 1D8KA 4CZZA 2ACJA 4I0BA 5EEGA 4BQQA 5EJCA 1MBGA 2VXDA 3QYEA 1Y6IA 1HW1A 3ZQFA 3CP2A 3QQAA 2X9DA 1ACIA 3CCEI 2QENA 3U1KA 1Y39A 4IOCF 3RPUA 2D5VA 3BR1A 3HPHA 4ZTFA 3CDLA 2BBYA 2QGUA 3VDXA 2RDPA 1JUPA 3TP3A 1P4AA 2NOJB 3IHUA 1I3QJ 4YIFA 3IP4B 2D45A 4A5MA 4JBAA 2MLGA 4KNYA 3HIFA 3B6CA 2OC6A 4O3MA 2MC4A 2FQ3A 3O2PE 2L0KA 1EH8A 2FQ4A 4EGZA 3QAHA 3IKTA 3E6CC 2BVLA 3OIQA 4ENKA 4PJMA 3I55I 1D0XA 1RR7A 3H36A 2PJRB 2QBYA 2DFIA 1Z3XA 2M7AA 1BW6A 1JHFA 4MNUA 5DM7F 5JVGF 3KP5A 4J00A 3AFHA 4BH9A 1SANA 3LSPA 1B1BA 2WAFA 1U8RA 4BJ6C 4M3FA 3AAFA 4KDPA 4A3EJ 2VE9A 2KPMA 2FSWA 5AIPA 1CF7B 3MKZA 4AIJA 3MQ0A 3UKGA 3KX2A 2LKXA 4ZYEA 3L2VA 3BTLA 4A0XA 2QCOA 1P4XA 2VJ4A 2KMUA 2K3PA 3NRVA 5DUIA 1HSJA 3I4NJ 2DW4A 1I27A 1XGOA 5BMZA 2AQFA 5J4VA 3M9AA 5E79C 5CQGA 4I02A 1OCCH 3OYKA 1E3PA 4HF2A 3H35A 1VF9A 1R5GA 2GWRA 1JXSA 2LKSA 3BG7A 3QPHA 4E7JA 3ZQQA 5KHDA 2DA5A 4HQMA 3FZVA 3DPLC 1QZEA 5E3MA 3M8EA 2PJRA 1QRYA 5DD8A 2CQXA 3B73A 1PVEA 1VQPI 4AVPA 4PK4A 2LREA 1D1AA 4AUXA 3LFUA 3GVAA 2VL8A 5HNFA 1O57A 2H94A 3PNTA 3LFKA 5EGOB 2LD5A 3EUAA 3CMYA 1BBYA 4A2UA 4XOTA 2ISYA 5F64A 3M8FA 4G9YA 2V7FA 3RQIA 2M4GA 2VQLA 4B48A 2L7FP 1UCRA 2DT6A 3DBRB 1MNMC 4FETA 3F72A 2UXXA 2B7EA 4LLLA 1MJAA 2GA2A 1XS9A 3DKXA 3BR0A 3VOEA 1S9HA 3CDHA 5HOOA 3H5AA 5LRSA 2XAJA 1JTYA 2A5WA 3LSRA 3I59B 4HEA2 5E1ZB 1G3YA 3ZGKA 3HOWJ 3JAMK 3K4LA 2UWMA 3E5QA 1V5EA 4X0GA 2KIMA 4D9JA 3FKIJ 2JN6A 3A2KA 1YOVB 1YS6A 4S04A 2DQRA 1BC8C 1SD5A 1JTXA 3E1SA 4PGHA 2R7XA 1HSTA 5EGOA 5HLTA 2HFHA 3RPQA 2NVTJ 2O7OA 4L9VA 2R7TA 3TDUC 2GAUA 4LGWA 4WXDA 3JSOA 2E7XA 2X6WA 4G8XA 2HVQA 2E1NA 2IEKA 4JK1X 4NQWB 4LK1F 4KYWA 2VXZA 4BY7J 3HKZA 4DIQA 5F0HA 4L9NA 1QQIA 2E60A 2F5DA 3D5LA 3D1NI 2L5QA 4KN7X 5GP9A 4LIVA 1HKSA 2JJ7A 1I3AA 4ESFA 4IJAA 3H1CA 2XAGA 2ZNZA 4EJVA 1YHQI 2MD5A 5E1XA 3RKYA 1IN8A 4S0HB 5DS9A 1XTAA 2FOWA 2VBYA 2P0WA 2W24A 2KRCA 1J2XA 3I59A 4YEJA 1DU0A 4D0PA 4ZYAA 5B5EC 5K7HA 2L3DA 2QUFA 2R7UA 3K2AA 3HOSA 4MGRA 2IP2A 4HV5A 5L3CA 1LQ1A 3ABTA 1MMDA 2VODA 1MZBA 2LYCA 2W84A 5FKOA 5TISC 1FIPA 4M9SA 3MKWB 2DA2A 2VQGA 2LNBA 3E3VA 3H92A 2DT7B 4M74A 2QKMB 5J1UA 4L18B 3L2CA 3OS1A 4UY8I 2Z33A 1E3OC 3SZGA 1R71A 2DBBA 1U0JA 3ZCOA 1IRGA 4KIGA 3I58A 3TOAA 3MVPA 3K6GA 4NQWA 3KZYA 2FX0A 3VYRB 3T8TA 3IH3A 2H27A 4ZH4F 1FZPB 4QWQA 1WI3A 1NH3A 3JSPA 2GXBA 2Y30A 4BHCA 3QPSA 2O61A 2NNYA 1NK3P 1Z0XA 2CRGA 1X3UA 1BOAA 2PN6A 1AKHB 2ADUA 1X3WB 2PMHA 1Z21A 3GZ5A 2XRNA 1VI0A 3OYLA 3TL4X 2M3AA 2DFHA 3N97A 2OCCH 2M8EA 1JHHA 2RNGA 2X1CA 4C2TA 3M8JA 2M45A 3WE2A 1NG6A 2XDVA 2E2HJ 2EIJH 3I53A 1V4RA 5F0CA 1HCRA 2Y31A 1S6LA 1ERDA 2DA7A 2YPRA 1YJWI 2ESHA 2HDCA 1WWXA 4C2MJ 1R58A 3C1DA 4FE7A 2WB1A 2BXZA 4DOZA 2QA4I 4E7HA 4XN3A 1ZQ3P 3GTGJ 1AA7A 3G2BA 4XONA 1OCOH 3OR2C 3BTJA 1IJWC 1ORKA 1XMXA 1GVDA 1QGPA 5L3BA 2CUEA 4G6QA 3H3ZA 1BM9A 4I09A 4DYRA 2JA6J 4MEYF 2CQKA 2OCEA 2V4JC 5H2FC 4OMZA 2R0QC 3OYIA 1OYIA 2PX9A 1AKHA 2YU3A 2XGXA 4L0YB 1SVMA 3RYRA 2DPUA 3BJAA 3OR1C 2QKLB 1VQLI 3L9FA 3CUOA 3PFYA 3D5RC 4ZDLA 2R93J 1Y8RB 2CV0A 3Q9SA 1IUFA 1FNNA 5DDGA 1IZ1A 2L54A 2XRLA 3JREA 2BW3A 2TDXA 2KL4A 1VQ4I 3M4OJ 4RS8A 3CD6I 1WJBA 1JJ6C 3ZN1A 3HM5A 1OJLA 3QYBA 1USTA 1XMAA 1S5LC 3COAC 1NTCA 2E71A 2HOTA 4QPOA 1SEUA 2EIMH 2Z2SB 4I01A 3BG5A 1HOMA 3EDPA 4I0AA 2OTLI 4IKFA 2OZ6A 1TWHJ 2ZBKA 2HPIA 1R4MB 5CVIA 4FHTA 2EZHA 5HS9A 1LEAA 2JVHA 1Z3YA 3JCUC 1O3QA 2A69F 4M73A 2HXOA 2CUFA 4IPAA 1YW8A 1V3FA 4OIRF 1XD7A 5FD5A 4YFNF 2RC4A 2A61A 4XLAA 5CVUA 2XROA 1F43A 3NAUA 3CC7I 1ZLKA 3KP4A 4C9YA 2NAZA 2X0LA 2DMQA 1FSEA 4UV8A 3BJOA 4RDUA 3HTSB 1E0EA 3A03A 3CJRB 5H6RA 3ZN0A 2IS2A 1TLHB 1MGTA 3CMAI 2NS7A 2IGNA 4A12A 2PEXA 3K2ZA 2KIUA 3LSTA 5B1BH 1KQ0A 2L4MA 4FE4A 3ZQ7A 2VBXA 3G73A 2E36A 3HOVJ 2X51A 5LHHA 4G7OF 3K0LA 1FJLA 1FBQA 3AG2H 2XAHA 1MBKA 1M1EB 1OYYA 4GYIA 4G94A 5EYRA 3AG4H 4IHXA 2R7ZJ 1R9TJ 2DXIA 5A2QK 2R3SA 2EFQA 2RREA 5M5XJ 2HYFA 2OF7A 2K86A 4AIHA 3ZXSA 5F27A 3GO5A 5B66C 4HNTA 1HQCA 4QPQA 3TKYA 3E6MA 1OCZH 3BPVA 4MIMA 3DCFA 4W1UA 3FXJA 4UB8C 2XAUA 2HYJA 2KZVA 1RETA 4BS9A 1XMKA 2CSOA 2ZO4A 1D1CA 2QVOA 3GF2A 4XRSG 1WCMJ 2HS5A 3JTHA 2QSHX 2ZKZA 3A0HC 4U7BA 3H3UA 1U78A 5AONA 1IRFA 3ZQHA 2COMA 3FHNA 4HLYA 1U5TB 2LY1A 4R79A 2MH2A 3UR3C 5FROA 4HF0A 4EQQA 3LA2A 1X1CA 3MFKA 3S15J 2DA1A 1GHCA 1TNTA 2FA5A 4NB5A 1ODDA 2FNPA 4AVZA 3MKYB 1U8BA 3OYAA 4NUBA 1BI1A 2W57A 4NC6A 3LWFA 4B43A 3BOQA 3KP3A 1HBXG 3W6VA 1W4MA 3KEOA 1SD6A 1WQ2A 4A0YA 3WTZA 3NEUA 5D6FA 5ILVA 3L2UA 5IP6A 2HEOA 2O8KA 4JX5A 2OQRA 1X1AA 3DV8A 2EB7A 2R7OA 3H9JA 3T0YA 2CW7A 3DWLE 3I4MJ 3F8NA 1QNTA 1B72B 3ULQB 4XLNF 4MQVA 4BU2A 3OS2A 1VQ6I 1VQNI 1U5TA 3LSMA 3U9GA 3R61A 1V55H 1BJAA 3RZDJ 2KRHA 3PIPF 3E5XA 4PSXA 1ETWA 2E2JJ 2STTA 4MHGA 2EFOA 4RLQA 2J5PA 5E3OA 3MEXA 3EUHC 2VPRA 1T98A 5HDGA 3ZMUA 1TQMA 4XKWA 4OINF 3CDIA 1T08B 2EH3A 2M34A 1TQPA 4E7ZA 4XRFA 4IEJA 4UVCA 5ERIA 2GIVA 1H0MA 4CSWA 2MD0A 1RRJA 3RTRA 2ZJRF 2DOEA 2UUZA 1LB2A 2V6EA 3OIPA 3PL8A 1X58A 3C2GA 1FWZA 2VBZA 3ZMSA 2DDBA 1XCVA 2KISA 3I5UA 4RAFA 1POGA 2R7DA 2M7BA 3E6BA 3ABMH 4C3HJ 2BOLA 3VB2A 3Q5FA 2FRHA 1B72A 1YE9A 1ULYA 4XMYA 5IYCJ 1HXDA 2UZKA 4RB1A 4BQAA 1VQ7I 2NNNA 4PFPA 4A3CJ 1YO5C 2LR8A 1FP1D 1TTYA 5A2QZ 1ZG5A 3DTIA 2Q2EB 3SYTA 4IRHA 1VTNC 1ZR2A 3OYFA 5FRNA 3J81K 2K9NA 2XAQA 4M3EA 3AL0B 3H9QA 2DFFA 2M5WA 1JKQC 2DYSH 2NVYJ 2ETHA 1IDZA 5K1YA 3OYHA 2K9LA 4HLXA 2PMZN 3K7AJ 4XICA 3MZYA 1S7EA 5E18F 2WWYA 4PFOA 1FLIA 2LBFA 5E3LA 1DGWY 4HG2A 1GUUA 1P2FA 4V2GA 2F48A 4LB5A 2LOOA 3OMYA 1FYLA 3RI4A 3HPGA 5M3MJ 3CO6C 2GQQA 2ME0A 2ZJ2A 3LQRA 3Q9VA 1K78B 1IXCA 2C6YA 2M8GX 3WU0A 4HX8A 1EKEA 2O5RA 1OR7C 2LLKA 4M3BA 4PSWA 3V7RA 3G1LA 2XGEA 3KLOA 1KU2A 2E34A 3DBHB 3SQNA 4MTEA 2Z3YA 2X6YA 3NQOA 4IO9F 4C30A 2VC1A 1WH5A 5DV5A 4A3JJ 2VONA 4MQ9F 2RNJA 4GCVA 3CCYA 2LK2A 2P5VA 2Q2EA 5FLXZ 3OS0A 2R7QA 4FT8A 3K70C 3BR5A 1P4WA 3S1MJ 3Q0VA 1FOKA 3GFMA 1A36A 3BC8A 1RI7A 1RC9A 4LOCA 3S32A 2XAFA 2Q1ZB 4RGSA 4BEHB 3WTYC 4XLCA 3P9KA 4XKCA 1ONVA 2OJED 3C18A 4RM3A 1NHAA 3CCQI 1QZYA 1ITYA 1K78A 1HLVA 2EA4A 2W48A 1D5YA 5GPCA 2M87A 2AHQA 4PGGA 1WJFA 5FB2A 1QVUA 3D5SC 4Q4ZF 1FEXA 1Y8QB 1FTTA 3FXOA 4LG0B 2B9SA 3FXUA 2IW5A 2BHZA 5CJ9A 3BZ6A 5IT9Z 1RIOH 2DYRH 4PJLA 3QP5A 2ELJA 3WTTC 1I1SA 2HWVA 4ZDOA 4BQOA 2HOSA 1V5FA 4M9XA 2KFDA 4HNUA 2CO5A 1Z9CA 5E1WA 2JMWA 4NNJA 3DBLB 2E2IJ 5L3GA 4AIKA 4W97A 1A35A 2A07F 1T33A 3BZKA 4OWRB 4KMFA 2EPFA 4CYDA 3G6EI 1V54H 2EFWA 1BW5A 2ZMEC 5D8KB 3HSEA 5HS8A 2XGCA 1FOYA 2QSFX 2DA4A 3FX3A 3BZCA 4Q48A 3IV5A 4N9HA 3RYPA 3QODA 2IS1A 3GFLA 3A4CA 3A1YA 3HUGB 4ZZLA 1FMVA 1L0OC 1V5GA 2XIGA 2FU4A 3GBGA 4I2OA 4CGZA 1MJBA 2V9VA 5K5RA 3FXKA 1VNDA 2EZIA 3OL3A 1B9NA 5D5VB 1S7AA 3J81Z 4KFCA 1SFEA 4XRSA 2CFOA 2BXYA 2EV6A 2XPVA 2E19A 4BJ5C 3FXRA 1YIJI 4LG0A 1PP8F 4BXUA 1XCBA 3L00A 1FBSA 5LBQA 2VIXA 5ICGA 3BCAA 1OLTA 1PDNC 1RNLA 2PBIA 1UELB 3WHBA 3JRBA 2JRMA 2JUGA 2VJJA 3HEFA 2XF6A 5CKTA 3HRTA 2M30A 3JRAA 3FK6A 3K9TA 1T38A 2BV6A 4FTHA 2CGPA 5CVRA 3MZ8A 2R4GA 4BL0B 1FYMA 2L01A 1WKMA 4RMNA 1ZGJA 2ZC2A 5FRMA 2NS8A 2VB6A 1F36A 5EEHA 1K61A 4HZFA 3HUGA 5EZGA 4Y17A 3ZMDA 4HNVA 5GTHC 4FCYA 1SFOJ 1LFUP 2DA6A 4BKXA 5LFAA 3JRFA 3RIRA 5K5OA 2Y9YA 4CDGA 1XC5A 3HRSA 3PFIA 1RUOA 4RB2C 1R1TA 2AXTC 1IAWA 1FTZA 5CQEA 3FXQA 3H5NA 4DZPA 2P6SA 4A3MJ 4AU7A 4Z6YA 1KYZA 1Z05A 1IC8A 2V6CA 2JA8J 2VUMJ 2HZTA 4GRIA 3V7CA 2W1OA 2M2EA 3G3ZA 3OYGA 3VEPA 3GTMJ 2V9KA 3FK7A 4P55A 4D5FA 1T95A 2WC2A 2P7CB 1D0YA 3BJ6A 4DZJA 1WJCA 2IGKA 3PSIA 2Y0MA 1E2XA 1RR8C 3DQVC 3JRHA 2HDDA 2MYSA 5IP7J 1MJ9A 1J75A 1HDDC 4PZJA 1WH7A 2HVSA 3TEDA 5J6XA 2OQGA 3CCSI 1OCPA 1VQMI 1UG0A 2R7RA 4HOBA 4D1QA 2QSGX 1TW3A 4AIDA 3TQNA 3ZQLA 2MSYA 4LIUA 1D1BA 1J09A 1HKQA 4OAZA 5EF6A 2KIQA 2ZJPF 4IF4A 2DODA 4XK4A 1CF7A 1K83J 2CW0F 2OTJI 3M1CA 4YIIA 2LSOA 1KQ9A 3BWGA 3LL7A 2BE5F 1W36C 4UHTA 4XNFA 5D6EA 2WTEA 1EV7A 4G7HF 2V1UA 3TGNA 3MD2A 1JGSA 2DA3A 2R7FA 5ED4A 1ZRFA 1ZG1A 1P7IA 1X2MA 1MBJA 1T56A 4BUPA 3S2WA 3IAS2 3IKVA 2CV2A 1I6XA 2NS0A 4X1EA 2A68F 3GW2A 5JHFA 3TOBA 1LEBA 5B3SH 4C3JJ 4DYQA 2DK8A 1IN4A 2JVGA 2K3FA 4I99C 1J0RA 4KT6A 2EILH 1WVRA 3O8GA 1MSEC 3HOUJ 4EV0A 1XGNA 2CJJA 4JYKA 3C2BA 1H9GA 1XGMA 1MH3A 3DP7A 4Y13A 3BR3A 4UB6C 4A6DA 5DUKA 2F4IA 2RN7A 4E7KA 2HNHA 1X1DA 5JHUA 4CYCB 1XB4A 4PJJA 5GTIC 3E5UA 1IN6A 3N4MA 3I56I 4E7LA 5DCMB 1SVOA 1T0FA 1YFHA 1BR2A 1OFCX 4ABZA 3WODF 1QO0D 3HKZN 4P5OA 2X1DA 3CC2I 1H8AC 4Y4RA 4I76A 2YUSA 1PJRA 4I7HA 4MO7A 4RAYA 3L2QA 3ASNH 5LEJA 1YS7A 3HRMA 1J5YA 3FISA 3DKYA 4EJOA 2RKHA 1YYVA 1ZGAA 3PO3J 2B0LA 2JA2A 5E3NA 2RGVA 3KEYA 3R60A 4BXXJ 4CCJA 1ON1A 5J47A 4BNCA 4IHVA 2CQNA 2JRTA 3F21A 2YS9A 2A3SA 5BQTA 4GYGA 3WE3A 5BS6A 1ZTRA 1NK2P 2K5CA 2ZSHB 2CV1A 3UNGC 2LFBA 4II2A 1U2WA 4HX4A 4CYCA 1FYKA 1R1VA 1D5VA 2NXNB 3S14J 2BY1A 2W00A 3F6OA 5DCMA 3ERED 3LSKA 4BDYA 2EA2A 4OOIA 1Z6RA 2VJIA 4R1HA 2HKOA 4AM3A 1FPQA 2HQAA 3JTGA 3WTSC 1O4XA 1JT0A 4F92B 1ZHFA 2KJBA 2PMUA 1U6GA 2K9QA 5LLQA 5KNLA 1ZREA 4TV7A 1DUXC 4HQEA 3ONQA 4V2FA 1GT0C 3CLOA 1TL8A 5AIQA 3GTOJ 2GXGA 4BDZA 1BR4A 3FMQA 1UFMA 1IXSB 3CJTB 3K4MA 2EFPA 2DOAA 3JW4A 3KCCA 5LGNA 3ASOH 3HSFA 4F52A 4CHUA 3HSRA 4HBLA 2WB1N 3BCBA 2H1KA 5FFXA 2LY9A 1SD4A 3PUBA 3VSKA 5M3FJ 1EH6A 3V7SA 4XBFA 3RKXA 4OIOF 2HZDA 4MFDA 3VYUB 1MKMA 1SFUA 4YG2F 3GYHX 3FM3A 4WWCA 1LPQA 4IL6C 2ID3A 4RAZA 5JVTA 2DMNA 2L7MP 1HDPA 1O7FA 2STWA 3HB9A 1REPC 3ABKH 2IT0A 3KYDB 2VC0A 3FM5A 3RCOA 1EA3A 1R4NB 1W5SA 2K85A 2WV0A 2Z1DA 5D5XB 5HLGA 3BTIA 4JX4A 2Q8KA 1BIBA 3BLYA 1GVJA 3KYCB 4BQNA 3F22A 1Y1WJ 3BT9A 3EQLF 4A3IJ 1X4PA 2MFZA 2GM4A 4RAGA 4P9FA 4PJ0C 5J4YA 2Y2ZA 3W6JB 3TO9A 2RQQA 4CA0A 3L09A 5HLHA 2M4KA 2VKHA 1DPRA 4U0VA 2Z99A 5HDNA 3BQZA 2P5KA 5CYVA 1MDMB 4IQ4A 2XASA 5FLVA 1AHDP 5LHGA 4HYEA 2H8RA 5IOYA 5D4SA 3FXLA 1TP4A 1I1GA 1MMAA 2O03A 5DTDA 5BPDA 3S1RJ 1MMSA 3CCRI 2XSDC 5E17F 3P7NA 5BNGA 1QHHD 4KJZA 3ZOBA 5K7ZA 1KU3A 4IQJA 2HDWA 2IGOA 1G2HA 1CQTA 4ETSA 4FX0A 4II3A 3ZRGA 4HRIA 4ITVA 2P8TA 2M9HA 4XRMA 3T8RA 1W0UA 3CZ6A 1LFBA 2LMDA 3HOYJ 3LSIA 1VQ9I 3TMOA 4BHPA 3LSJA 2CH0A 1X19A 2XGDA 4KIBA 4XKBA 3RQ4A 1A6IA 4ENMA 1MDMA 3OL4A 2M0CA 1RKTA
chains in the Genus database with same CATH topology
4HAMA 3FHZA 2P4WA 1HW2A 1Z1DA 2RVCA 3DXJF 5ICCA 5IT3A 3IC7A 2Z5UA 3BP8A 3HTUA 3QU6A 2XV4S 1WI9A 4M72A 4M6XA 4JQFA 2FBHA 2MA3A 2XHKA 3O3KA 4OMYA 1U5TC 1C0WA 4MTDA 5D4RA 1ZH5A 3GUDA 2Z9OA 4ZYHA 5ILSA 3V4GA 5FLXK 2E7WA 4R8HA 3T1BA 1AOYA 1S7OA 1ZRDA 3V8KA 4M71A 2DQLA 3DEUA 2OZUA 4E70A 1HKTA 3WTWC 2AS5F 2MLKA 3RDIA 1YQAA 1O7LA 2IA2A 4M9ZA 3TO6A 1IXRC 4G7ZF 1I5ZA 4XSZF 2KJCA 5CLSA 2IA1A 4B09A 5IT9K 2OU2A 3BY6A 1Z91A 3QRFF 1XN7A 1D3YA 3ROUA 5FFZA 1R7JA 3F23A 2Q0OA 3J80Z 1DDNA 4HF1A 2LKPA 2RV8A 4I98B 3SZTA 4ESJA 2OAZA 3SXYA 5E8GA 2QQBA 4DNCA 3ZPLA 1ON2A 3I64A 4MEXF 4RGXA 2K27A 1RUNA 1TNSA 4N9IA 2QWWA 1YTYA 1G3SA 2O0YA 3PQKA 4LB6B 2DI3A 2A6HF 2QLZA 1BI3A 1BIAA 2A5YB 2ZCWA 4EMSA 3VFZA 5L3DA 3WTUC 2YX4A 1LDJA 1IN7A 3MWMA 1BN5A 1K6OA 4HW0A 4ENJA 1CGPA 3ABUA 3GFJA 1B6AA 1PP7U 1OYWA 4KT5C 3WG9A 1SD7A 4L5JA 4RGUA 2PI0A 4Q47A 5F6FA 4Q5SF 1TW2A 4IVNA 2DPDA 4S05A 2FE3A 2AXLA 2HTSA 4BAYA 1KA8A 4L5IA 4CO8A 1FSHA 1F1ZA 1PUEE 3P9CA 2YSRA 2HQNA 3KETA 3CUQB 3CO7C 1FC3A 4L9JA 1S3JA 2ESNA 3W6KB 4HV6A 4RB0A 1GXPA 3WTVC 4PDKA 4RGRA 1UHMA 3I71A 3ELKA 2CG4A 1QBJA 1BI2A 2YR2A 4UV9A 1S29A 1RZ4A 2MH9A 2VN2A 2VOOA 4KICA 1J9IA 2JT1A 3KP2A 4KA4A 4YFXF 4ZYGA 5FGMA 2OA4A 3QOPA 2ZMEB 3K1NA 2HR3A 1L3LA 1UB9A 2L4AA 3DKWA 3HHGA 1G3TA 3IL2A 1BC7C 1S8NA 1ZAOA 2JZYA 2FBIA 4N0BA 5HS7A 3I4PA 1H9TA 3CUQA 1ZRCA 4WK8F 1SAXA 2K7LA 3PQJA 1T6SA 4O6JA 2H6BA 3TO7A 3J7AO 3ZMTA 1UHWA 1O3SA 3K1PA 5J8CA 5DYMA 1KU7A 1G4DA 2NRAC 1U3EM 3EYYA 3LA7A 3BPXA 3KE2A 4ENNA 2ZMEA 2G7HA 3U2RA 2EJRA 2FMYA 4RB3C 2MBFA 4HA8A 4EJWA 1Z6TA 2JSCA 3OOPA 3P9IA 1KYWA 3T5XA 3V8JA 2IA0A 4HDUA 3K1MA 4WXCA 2EFNA 3KEQA 3ZMVA 1XGSA 1LJ9A 4NHJA 2PFBA 3GXOA 3I54A 3LA3A 3GEZA 1F5TA 4XLPF 4BYYA 1A04A 4K2EA 3F6VA 1W7PD 4EM0B 2V1DA 5H20A 2GA1A 1K79A 2Y48A 2K4BA 5ILUA 4LMYA 3HYIA 1EH7A 5FD6A 3WU1B 2F5EA 2PG4A 2HYGD 1Z7UA 2CYYA 2F5CA 2F5FA 3FWEA 1AWCA 1F9NA 2M1BA 4YFKF 1FX7A 3HRUA 2HGCA 3M7GA 2PQ8A 1OMIA 1R5HA 3WTXC 3LAPA 4LLNA 5HLIA 4O5VA 1XSVA 4UVAA 3BDDA 2KIFA 4FX4A 3ISPA 3QPTA 3R4KA 1DP7P 3R0AA 3I0TA 5LEKA 2A6EF 3B02A 3GX4X 3GZ6A 1ZN2A 4IRIA 1B9MA 4KIFA 4AD9A 3FMRA 5LRRA 4WF2A 4G6DA 2VBWA 1IN5A 1YG2A 2E1CA 5CVJA 4LFUA 3GLXA 3EYIA 2D1VA 4AWXB 2ELHA 5F1RA 3VODA 2HTJA 2P5LC 1USSA 2W85A 3KLNA 1B59A 5E8IA 2DAOA 2BGCA 1G3WA 4EGYA 2XKPA 1F4KA 4U0YA 1K7AA 2YX7A 1G6NA 2DU9A 1LDKB 1FT9A 1J59A 2L02A 4F7ZA 3EETA 1KQ8A 5CVVA 2V1XA 3R6SA 4LD5A 1Q1HA 1R00A 2VE8A 3ZP5A 2F2EA 3RJPA 5J8FA 2VT3A 3ECOA 1W5TA 1P6RA 4LK0F 2H09A 4ZZDA 5K5QA 1IUYA 1XDSA 1R36A 1YW9A 4P96A 4B8XA 5D5UB 4CICA 4KN4X 2JPCA 2QQ9A 4UXNA 4A5NA 3JAMZ 1TBXA 1D8JA 1T2KA 4L0ZB 3R0JA 4WX9A 3ZMZA 2K02A 5KVRA 1E17A 3SHFA 2KKOA 3D0SA 3RKWA 2QZ8A 3CTAA 5KK1A 1STZA 2FMLA 2V79A 5H6QA 3TDZC 4EVIA 2OBPA 4EJTA 4Z2YA 3E97A 2HKXA 2DO7A 5ICEA 2IRFG 4IXAA 2EV5A 5E20A 3LQQA 3J80K 4UNOA 4DQ2A 3REOA 1FBUA 4XSXF 3IWZA 1TQIA 5BOXA 5HDKA 1P92A 3BROA 4U88A 4L9TA 2BYVE 3SFZA 3IRRA 2IPQX 2FEZA 2DT5A 3F8BA 3F8FA 2JTVA 4ZYDA 4LJZF 5HVQC 1FY7A 3WGIA 2G9WA 2FXAA 2KRFA 6PAXA 1ZG3A 5TJJA 3KP7A 1ZARA 4H0EA 4A0ZA 2ZFWA 1R22A 1GXQA 5BPIA 3IRQA 2H6CA 2HOEA 2MC3A 5FO5A 2FF4A 4EJUA 4KMUX 3SZPA 4OIQF 4U7DA 3IWFA 2CFXA 5L3FA 5L3EA 4WXHA 2K4JA 1HW5A 3L7WA 4IHTA 2W25A 1R1UA 2ZXJA 2CWEA 2EK5A 3DFGA 5JI6A 2P7VB 4IHSA 2DLLA 2QQAA 2LDUA 1SMTA 1XSXA 4U0WA 1J7KA 1OKRA 3U1DA 3LAJA 4OU0A 2FOKA 1YLFA 3KFWX 3HOTA 3ECHA 1B4AA 3ML6A 1R23A 1DPUA 4IRGA 4EM2A 2O3FA 2Y75A 3DF8A 2ISZA 5D5WB 3V8LA 1YW7A 2XVCA 2D1HA 3CJNA 4ON0A 2DK5A 3MCZA 4M6YA 4A6EA 5ICFA 3C3WA 2QM3A 2VOPA 2NYXA 2FNAA 3FMSA 3QU3A 4QLCU 2UXNA 2XKOA 2O6GE 2PJPA 1IF1A 1IW7F 2EV0A 1W7PB 2D2WA 3WGGA 4BHBA 5TRDA 4P9UA 4GO1A 4OIPF 5JFRA 1KGSA 3WGHA 4HX7A 3QP6A 2BEOA 1QZZA 1KU9A 1O3RA 1FP2A 1OPCA 4WCGA 1SMYF 5JR3A 2VT2A 1WSUA 3E6DA 3EUHA 1XDUA 2XUBA 4ESBA 1JE8A 4CXFA 1WRJA 2OD5A 3M1EA 2IVMA 2ZNYA 4HDVA 2HQRA 2IJLA 3O6BB 2G7UA 1SFXA 3GFIA 3FF5A 5DCFA 1W7PA 1YIOA 1MD0A 3K69A 1LVAA 2FBKA 2JPBA 3KZZA 4EM1A 2P6TA 3F8MA 3HHHA 2X4HA 1LNWA 3MZHA 4UVBA 5LHIA 1LDDA 2DTRA 2RQPA 4ASNA 1ZLJA 1T39A 5DD4A 2LF8A 2LF7A 4PCQA 4GXOA 2EWNA 5DEQA 4UUVA 5LGTA 3MAJA 3CUQC 4GGGA 2J5OA 4LLGF 1OR7A 5D8LB 2GZWA 5LGUA 1O3TA 2PLYA 3KP6A 4KUMA 3DPTA 2QYOA 3F3XA 2O8XA 3C7JA 4Y15A 1ZYRF 3GWZA 3F8CA 1QPMA 3OV8A 1XSDA 1Y0UA 2QBYB 1BI0A 1D8KA 4CZZA 2ACJA 4I0BA 5EEGA 1HW1A 2QENA 3RPUA 2BBYA 2RDPA 1P4AA 3IHUA 4YIFA 2D45A 4A5MA 4JBAA 2MLGA 4KNYA 3HIFA 4O3MA 2FQ3A 3O2PE 1EH8A 4EGZA 3QAHA 3IKTA 3E6CC 4ENKA 2QBYA 2DFIA 4MNUA 1JHFA 3KP5A 4BH9A 1B1BA 1U8RA 3AAFA 4KDPA 2VE9A 2FSWA 5AIPA 1CF7B 4AIJA 3MQ0A 4ZYEA 4A0XA 1P4XA 3NRVA 5DUIA 1HSJA 2DW4A 1I27A 1XGOA 5BMZA 3M9AA 4I02A 4HF2A 1R5GA 2GWRA 1JXSA 3QPHA 4HQMA 3FZVA 3DPLC 3M8EA 5DD8A 3B73A 4AVPA 3GVAA 1O57A 2H94A 3LFKA 1BBYA 4A2UA 2ISYA 5F64A 3M8FA 4G9YA 1UCRA 3F72A 2UXXA 4LLLA 1MJAA 2GA2A 3VOEA 3CDHA 5HOOA 5LRSA 2XAJA 3I59B 5E1ZB 1G3YA 2UWMA 3JAMK 3E5QA 2KIMA 1YS6A 4S04A 2DQRA 1BC8C 1SD5A 4PGHA 1HSTA 2HFHA 3RPQA 4L9VA 3TDUC 2GAUA 4LGWA 4WXDA 3JSOA 2E7XA 4G8XA 2E1NA 4JK1X 4LK1F 4KYWA 2VXZA 4L9NA 1QQIA 2F5DA 3D5LA 4KN7X 1HKSA 4ESFA 4IJAA 2XAGA 2ZNZA 4EJVA 2MD5A 5E1XA 3RKYA 1IN8A 2VBYA 2W24A 1J2XA 3I59A 4D0PA 2L3DA 2QUFA 3HOSA 4MGRA 2IP2A 4HV5A 5L3CA 1LQ1A 3ABTA 2VODA 1MZBA 2W84A 4M9SA 3E3VA 2LNBA 3H92A 4M74A 4L18B 3L2CA 2Z33A 2DBBA 1IRGA 4KIGA 3I58A 3TOAA 4NQWA 3KZYA 3T8TA 2H27A 4ZH4F 1FZPB 4QWQA 3JSPA 2GXBA 4BHCA 2O61A 2NNYA 1X3UA 1BOAA 2PN6A 2ADUA 2PMHA 3GZ5A 2XRNA 3N97A 2M8EA 1JHHA 2M45A 3WE2A 3I53A 1V4RA 1S6LA 2YPRA 2ESHA 2HDCA 1WWXA 1R58A 3C1DA 1QGPA 5L3BA 4G6QA 3H3ZA 1BM9A 4I09A 4MEYF 2CQKA 4OMZA 1OYIA 2YU3A 2XGXA 4L0YB 3RYRA 2DPUA 3BJAA 3L9FA 3CUOA 3Q9SA 1FNNA 5DDGA 1IZ1A 2L54A 2TDXA 4RS8A 3ZN1A 1USTA 1XMAA 3COAC 4I01A 3EDPA 4I0AA 2OZ6A 2ZBKA 5CVIA 4FHTA 5HS9A 1LEAA 1O3QA 2A69F 4M73A 4IPAA 1YW8A 1V3FA 4OIRF 1XD7A 5FD5A 4YFNF 2RC4A 2A61A 5CVUA 2XROA 1ZLKA 3KP4A 2NAZA 2X0LA 1FSEA 4UV8A 3BJOA 3HTSB 5H6RA 3ZN0A 1TLHB 1MGTA 4A12A 2PEXA 3K2ZA 2KIUA 3LSTA 3ZQ7A 1KQ0A 2L4MA 2VBXA 3G73A 5LHHA 4G7OF 3K0LA 1FBQA 2XAHA 1OYYA 4GYIA 4G94A 5A2QK 2R3SA 2EFQA 2HYFA 2K86A 4AIHA 3GO5A 1HQCA 3TKYA 3E6MA 3BPVA 1XMKA 2CSOA 2ZO4A 2QVOA 3GF2A 2HS5A 3JTHA 2ZKZA 4U7BA 3H3UA 1U78A 5AONA 1IRFA 2COMA 4HLYA 1U5TB 4R79A 2MH2A 4HF0A 4EQQA 3LA2A 3MFKA 1GHCA 1TNTA 2FA5A 4NB5A 1ODDA 2FNPA 1BI1A 2W57A 3LWFA 3BOQA 3KP3A 1HBXG 4A0YA 1W4MA 3KEOA 1SD6A 1WQ2A 3WTZA 3NEUA 5D6FA 5ILVA 2HEOA 2OQRA 3DV8A 2EB7A 3T0YA 3F8NA 1QNTA 3ULQB 4XLNF 4MQVA 1U5TA 3U9GA 3R61A 1BJAA 3E5XA 2STTA 4MHGA 2EFOA 2J5PA 3MEXA 1T98A 5HDGA 3ZMUA 1TQMA 4OINF 1TQPA 4XRFA 4UVCA 5ERIA 2GIVA 1H0MA 3RTRA 1LB2A 1FWZA 2VBZA 3ZMSA 3I5UA 1XCVA 2R7DA 3E6BA 3VB2A 3Q5FA 2FRHA 1ULYA 1HXDA 2UZKA 4RB1A 4BQAA 2NNNA 1YO5C 1FP1D 1TTYA 5A2QZ 1ZG5A 4IRHA 1VTNC 3J81K 2XAQA 2M5WA 2ETHA 5K1YA 4HLXA 3MZYA 5E18F 2WWYA 1FLIA 1P2FA 4LB5A 1FYLA 3RI4A 3CO6C 2GQQA 2ZJ2A 3LQRA 3Q9VA 1K78B 1IXCA 2C6YA 3WU0A 4HX8A 3V7RA 3KLOA 1KU2A 3SQNA 4MTEA 2Z3YA 3NQOA 2VC1A 5DV5A 2VONA 4MQ9F 2RNJA 4GCVA 2P5VA 2Q2EA 5FLXZ 4FT8A 1P4WA 1FOKA 3GFMA 1RI7A 2XAFA 3WTYC 4RGSA 3P9KA 1ONVA 3C18A 1NHAA 1QZYA 1K78A 2EA4A 2M87A 4PGGA 5FB2A 4Q4ZF 4LG0B 3FXUA 2IW5A 5CJ9A 3BZ6A 5IT9Z 1RIOH 3QP5A 3WTTC 1I1SA 2HWVA 4M9XA 1Z9CA 2CO5A 5E1WA 5L3GA 4AIKA 2A07F 4KMFA 4CYDA 2EFWA 5HS8A 5D8KB 3HSEA 3FX3A 4Q48A 4N9HA 3RYPA 3GFLA 4ZZLA 1L0OC 2XIGA 2FU4A 4I2OA 4CGZA 1MJBA 2V9VA 5K5RA 1B9NA 5D5VB 1S7AA 3J81Z 4KFCA 1SFEA 2EV6A 3FXRA 4LG0A 1PP8F 4BXUA 1XCBA 3L00A 1FBSA 5LBQA 5ICGA 1PDNC 1RNLA 2PBIA 3HRTA 2M30A 3K9TA 1T38A 2BV6A 2CGPA 5CVRA 1FYMA 2L01A 1WKMA 1ZGJA 5EEHA 4HZFA 3HUGA 4Y17A 3ZMDA 3RIRA 5K5OA 4CDGA 3HRSA 3PFIA 1RUOA 4RB2C 1R1TA 1IAWA 3FXQA 2P6SA 1KYZA 1Z05A 2V6CA 2HZTA 3V7CA 3G3ZA 3VEPA 4P55A 2WC2A 2P7CB 3BJ6A 2Y0MA 1E2XA 3DQVC 1MJ9A 1J75A 4PZJA 5J6XA 2OQGA 4HOBA 1TW3A 3TQNA 1HKQA 4IF4A 1CF7A 2CW0F 4YIIA 2LSOA 1KQ9A 3BWGA 2BE5F 4UHTA 5D6EA 2WTEA 1EV7A 4G7HF 2V1UA 3TGNA 1JGSA 2R7FA 5ED4A 1ZRFA 1ZG1A 3S2WA 3IKVA 1I6XA 2NS0A 2A68F 3GW2A 3TOBA 1LEBA 2DK8A 1IN4A 1J0RA 4EV0A 1XGNA 1H9GA 1XGMA 3DP7A 4Y13A 4A6DA 5DUKA 2RN7A 5JHUA 1XB4A 3E5UA 1IN6A 3N4MA 5DCMB 1T0FA 1YFHA 3WODF 1QO0D 4P5OA 4I7HA 4RAYA 5LEJA 1YS7A 3HRMA 1J5YA 4EJOA 2RKHA 1YYVA 1ZGAA 2B0LA 2RGVA 3R60A 1ON1A 4BNCA 2JRTA 3F21A 2A3SA 5BQTA 4GYGA 3WE3A 5BS6A 1U2WA 4HX4A 1FYKA 1R1VA 1D5VA 3F6OA 5DCMA 3ERED 2EA2A 4OOIA 1Z6RA 4R1HA 2HKOA 1FPQA 3JTGA 3WTSC 1ZHFA 2KJBA 2PMUA 1U6GA 5LLQA 1ZREA 4TV7A 1DUXC 4HQEA 3CLOA 5AIQA 2GXGA 3FMQA 1UFMA 1IXSB 2EFPA 3JW4A 3KCCA 5LGNA 3HSFA 4CHUA 3HSRA 4HBLA 5FFXA 1SD4A 1EH6A 3V7SA 4XBFA 3RKXA 4OIOF 1SFUA 1MKMA 4YG2F 3GYHX 3FM3A 4WWCA 4RAZA 5JVTA 1O7FA 2STWA 1REPC 2IT0A 2VC0A 3FM5A 1W5SA 5D5XB 2WV0A 5HLGA 2Q8KA 1BIBA 3F22A 1GVJA 3EQLF 4P9FA 3W6JB 3TO9A 5HLHA 3L09A 1DPRA 4U0VA 2Z99A 5HDNA 1MDMB 2P5KA 5CYVA 2XASA 5LHGA 4HYEA 5D4SA 1I1GA 2O03A 5BPDA 5E17F 3P7NA 1KU3A 4ETSA 4FX0A 2P8TA 3T8RA 4BHPA 4KIBA 4ENMA 1MDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAM A;  3FHZ A;  2P4W A;  1HW2 A;  1Z1D A;  2RVC A;  3DXJ F;  5ICC A;  5IT3 A;  3IC7 A;  2Z5U A;  3BP8 A;  3HTU A;  3QU6 A;  2XV4 S;  1WI9 A;  4M72 A;  4M6X A;  4JQF A;  2FBH A;  2MA3 A;  2XHK A;  3O3K A;  4OMY A;  1U5T C;  1C0W A;  4MTD A;  5D4R A;  1ZH5 A;  3GUD A;  2Z9O A;  4ZYH A;  5ILS A;  3V4G A;  5FLX K;  2E7W A;  4R8H A;  3T1B A;  1AOY A;  1S7O A;  1ZRD A;  3V8K A;  4M71 A;  2DQL A;  3DEU A;  2OZU A;  4E70 A;  1HKT A;  3WTW C;  2AS5 F;  2MLK A;  3RDI A;  1YQA A;  1O7L A;  2IA2 A;  4M9Z A;  3TO6 A;  1IXR C;  4G7Z F;  1I5Z A;  4XSZ F;  2KJC A;  5CLS A;  2IA1 A;  4B09 A;  5IT9 K;  2OU2 A;  3BY6 A;  1Z91 A;  3QRF F;  1XN7 A;  1D3Y A;  3ROU A;  5FFZ A;  1R7J A;  3F23 A;  2Q0O A;  3J80 Z;  1DDN A;  4HF1 A;  2LKP A;  2RV8 A;  4I98 B;  3SZT A;  4ESJ A;  2OAZ A;  3SXY A;  5E8G A;  2QQB A;  4DNC A;  3ZPL A;  1ON2 A;  3I64 A;  4MEX F;  4RGX A;  2K27 A;  1RUN A;  1TNS A;  4N9I A;  2QWW A;  1YTY A;  1G3S A;  2O0Y A;  3PQK A;  4LB6 B;  2DI3 A;  2A6H F;  2QLZ A;  1BI3 A;  1BIA A;  2A5Y B;  2ZCW A;  4EMS A;  3VFZ A;  5L3D A;  3WTU C;  2YX4 A;  1LDJ A;  1IN7 A;  3MWM A;  1BN5 A;  1K6O A;  4HW0 A;  4ENJ A;  1CGP A;  3ABU A;  3GFJ A;  1B6A A;  1PP7 U;  1OYW A;  4KT5 C;  3WG9 A;  1SD7 A;  4L5J A;  4RGU A;  2PI0 A;  4Q47 A;  5F6F A;  4Q5S F;  1TW2 A;  4IVN A;  2DPD A;  4S05 A;  2FE3 A;  2AXL A;  2HTS A;  4BAY A;  1KA8 A;  4L5I A;  4CO8 A;  1FSH A;  1F1Z A;  1PUE E;  3P9C A;  2YSR A;  2HQN A;  3KET A;  3CUQ B;  3CO7 C;  1FC3 A;  4L9J A;  1S3J A;  2ESN A;  3W6K B;  4HV6 A;  4RB0 A;  1GXP A;  3WTV C;  4PDK A;  4RGR A;  1UHM A;  3I71 A;  3ELK A;  2CG4 A;  1QBJ A;  1BI2 A;  2YR2 A;  4UV9 A;  1S29 A;  1RZ4 A;  2MH9 A;  2VN2 A;  2VOO A;  4KIC A;  1J9I A;  2JT1 A;  3KP2 A;  4KA4 A;  4YFX F;  4ZYG A;  5FGM A;  2OA4 A;  3QOP A;  2ZME B;  3K1N A;  2HR3 A;  1L3L A;  1UB9 A;  2L4A A;  3DKW A;  3HHG A;  1G3T A;  3IL2 A;  1BC7 C;  1S8N A;  1ZAO A;  2JZY A;  2FBI A;  4N0B A;  5HS7 A;  3I4P A;  1H9T A;  3CUQ A;  1ZRC A;  4WK8 F;  1SAX A;  2K7L A;  3PQJ A;  1T6S A;  4O6J A;  2H6B A;  3TO7 A;  3J7A O;  3ZMT A;  1UHW A;  1O3S A;  3K1P A;  5J8C A;  5DYM A;  1KU7 A;  1G4D A;  2NRA C;  1U3E M;  3EYY A;  3LA7 A;  3BPX A;  3KE2 A;  4ENN A;  2ZME A;  2G7H A;  3U2R A;  2EJR A;  2FMY A;  4RB3 C;  2MBF A;  4HA8 A;  4EJW A;  1Z6T A;  2JSC A;  3OOP A;  3P9I A;  1KYW A;  3T5X A;  3V8J A;  2IA0 A;  4HDU A;  3K1M A;  4WXC A;  2EFN A;  3KEQ A;  3ZMV A;  1XGS A;  1LJ9 A;  4NHJ A;  2PFB A;  3GXO A;  3I54 A;  3LA3 A;  3GEZ A;  1F5T A;  4XLP F;  4BYY A;  1A04 A;  4K2E A;  3F6V A;  1W7P D;  4EM0 B;  2V1D A;  5H20 A;  2GA1 A;  1K79 A;  2Y48 A;  2K4B A;  5ILU A;  4LMY A;  3HYI A;  1EH7 A;  5FD6 A;  3WU1 B;  2F5E A;  2PG4 A;  2HYG D;  1Z7U A;  2CYY A;  2F5C A;  2F5F A;  3FWE A;  1AWC A;  1F9N A;  2M1B A;  4YFK F;  1FX7 A;  3HRU A;  2HGC A;  3M7G A;  2PQ8 A;  1OMI A;  1R5H A;  3WTX C;  3LAP A;  4LLN A;  5HLI A;  4O5V A;  1XSV A;  4UVA A;  3BDD A;  2KIF A;  4FX4 A;  3ISP A;  3QPT A;  3R4K A;  1DP7 P;  3R0A A;  3I0T A;  5LEK A;  2A6E F;  3B02 A;  3GX4 X;  3GZ6 A;  1ZN2 A;  4IRI A;  1B9M A;  4KIF A;  4AD9 A;  3FMR A;  5LRR A;  4WF2 A;  4G6D A;  2VBW A;  1IN5 A;  1YG2 A;  2E1C A;  5CVJ A;  4LFU A;  3GLX A;  3EYI A;  2D1V A;  4AWX B;  2ELH A;  5F1R A;  3VOD A;  2HTJ A;  2P5L C;  1USS A;  2W85 A;  3KLN A;  1B59 A;  5E8I A;  2DAO A;  2BGC A;  1G3W A;  4EGY A;  2XKP A;  1F4K A;  4U0Y A;  1K7A A;  2YX7 A;  1G6N A;  2DU9 A;  1LDK B;  1FT9 A;  1J59 A;  2L02 A;  4F7Z A;  3EET A;  1KQ8 A;  5CVV A;  2V1X A;  3R6S A;  4LD5 A;  1Q1H A;  1R00 A;  2VE8 A;  3ZP5 A;  2F2E A;  3RJP A;  5J8F A;  2VT3 A;  3ECO A;  1W5T A;  1P6R A;  4LK0 F;  2H09 A;  4ZZD A;  5K5Q A;  1IUY A;  1XDS A;  1R36 A;  1YW9 A;  4P96 A;  4B8X A;  5D5U B;  4CIC A;  4KN4 X;  2JPC A;  2QQ9 A;  4UXN A;  4A5N A;  3JAM Z;  1TBX A;  1D8J A;  1T2K A;  4L0Z B;  3R0J A;  4WX9 A;  3ZMZ A;  2K02 A;  5KVR A;  1E17 A;  3SHF A;  2KKO A;  3D0S A;  3RKW A;  2QZ8 A;  3CTA A;  5KK1 A;  1STZ A;  2FML A;  2V79 A;  5H6Q A;  3TDZ C;  4EVI A;  2OBP A;  4EJT A;  4Z2Y A;  3E97 A;  2HKX A;  2DO7 A;  5ICE A;  2IRF G;  4IXA A;  2EV5 A;  5E20 A;  3LQQ A;  3J80 K;  4UNO A;  4DQ2 A;  3REO A;  1FBU A;  4XSX F;  3IWZ A;  1TQI A;  5BOX A;  5HDK A;  1P92 A;  3BRO A;  4U88 A;  4L9T A;  2BYV E;  3SFZ A;  3IRR A;  2IPQ X;  2FEZ A;  2DT5 A;  3F8B A;  3F8F A;  2JTV A;  4ZYD A;  4LJZ F;  5HVQ C;  1FY7 A;  3WGI A;  2G9W A;  2FXA A;  2KRF A;  6PAX A;  1ZG3 A;  5TJJ A;  3KP7 A;  1ZAR A;  4H0E A;  4A0Z A;  2ZFW A;  1R22 A;  1GXQ A;  5BPI A;  3IRQ A;  2H6C A;  2HOE A;  2MC3 A;  5FO5 A;  2FF4 A;  4EJU A;  4KMU X;  3SZP A;  4OIQ F;  4U7D A;  3IWF A;  2CFX A;  5L3F A;  5L3E A;  4WXH A;  2K4J A;  1HW5 A;  3L7W A;  4IHT A;  2W25 A;  1R1U A;  2ZXJ A;  2CWE A;  2EK5 A;  3DFG A;  5JI6 A;  2P7V B;  4IHS A;  2DLL A;  2QQA A;  2LDU A;  1SMT A;  1XSX A;  4U0W A;  1J7K A;  1OKR A;  3U1D A;  3LAJ A;  4OU0 A;  2FOK A;  1YLF A;  3KFW X;  3HOT A;  3ECH A;  1B4A A;  3ML6 A;  1R23 A;  1DPU A;  4IRG A;  4EM2 A;  2O3F A;  2Y75 A;  3DF8 A;  2ISZ A;  5D5W B;  3V8L A;  1YW7 A;  2XVC A;  2D1H A;  3CJN A;  4ON0 A;  2DK5 A;  3MCZ A;  4M6Y A;  4A6E A;  5ICF A;  3C3W A;  2QM3 A;  2VOP A;  2NYX A;  2FNA A;  3FMS A;  3QU3 A;  4QLC U;  2UXN A;  2XKO A;  2O6G E;  2PJP A;  1IF1 A;  1IW7 F;  2EV0 A;  1W7P B;  2D2W A;  3WGG A;  4BHB A;  5TRD A;  4P9U A;  4GO1 A;  4OIP F;  5JFR A;  1KGS A;  3WGH A;  4HX7 A;  3QP6 A;  2BEO A;  1QZZ A;  1KU9 A;  1O3R A;  1FP2 A;  1OPC A;  4WCG A;  1SMY F;  5JR3 A;  2VT2 A;  1WSU A;  3E6D A;  3EUH A;  1XDU A;  2XUB A;  4ESB A;  1JE8 A;  4CXF A;  1WRJ A;  2OD5 A;  3M1E A;  2IVM A;  2ZNY A;  4HDV A;  2HQR A;  2IJL A;  3O6B B;  2G7U A;  1SFX A;  3GFI A;  3FF5 A;  5DCF A;  1W7P A;  1YIO A;  1MD0 A;  3K69 A;  1LVA A;  2FBK A;  2JPB A;  3KZZ A;  4EM1 A;  2P6T A;  3F8M A;  3HHH A;  2X4H A;  1LNW A;  3MZH A;  4UVB A;  5LHI A;  1LDD A;  2DTR A;  2RQP A;  4ASN A;  1ZLJ A;  1T39 A;  5DD4 A;  2LF8 A;  2LF7 A;  4PCQ A;  4GXO A;  2EWN A;  5DEQ A;  4UUV A;  5LGT A;  3MAJ A;  3CUQ C;  4GGG A;  2J5O A;  4LLG F;  1OR7 A;  5D8L B;  2GZW A;  5LGU A;  1O3T A;  2PLY A;  3KP6 A;  4KUM A;  3DPT A;  2QYO A;  3F3X A;  2O8X A;  3C7J A;  4Y15 A;  1ZYR F;  3GWZ A;  3F8C A;  1QPM A;  3OV8 A;  1XSD A;  1Y0U A;  2QBY B;  1BI0 A;  1D8K A;  4CZZ A;  2ACJ A;  4I0B A;  5EEG A;  1HW1 A;  2QEN A;  3RPU A;  2BBY A;  2RDP A;  1P4A A;  3IHU A;  4YIF A;  2D45 A;  4A5M A;  4JBA A;  2MLG A;  4KNY A;  3HIF A;  4O3M A;  2FQ3 A;  3O2P E;  1EH8 A;  4EGZ A;  3QAH A;  3IKT A;  3E6C C;  4ENK A;  2QBY A;  2DFI A;  4MNU A;  1JHF A;  3KP5 A;  4BH9 A;  1B1B A;  1U8R A;  3AAF A;  4KDP A;  2VE9 A;  2FSW A;  5AIP A;  1CF7 B;  4AIJ A;  3MQ0 A;  4ZYE A;  4A0X A;  1P4X A;  3NRV A;  5DUI A;  1HSJ A;  2DW4 A;  1I27 A;  1XGO A;  5BMZ A;  3M9A A;  4I02 A;  4HF2 A;  1R5G A;  2GWR A;  1JXS A;  3QPH A;  4HQM A;  3FZV A;  3DPL C;  3M8E A;  5DD8 A;  3B73 A;  4AVP A;  3GVA A;  1O57 A;  2H94 A;  3LFK A;  1BBY A;  4A2U A;  2ISY A;  5F64 A;  3M8F A;  4G9Y A;  1UCR A;  3F72 A;  2UXX A;  4LLL A;  1MJA A;  2GA2 A;  3VOE A;  3CDH A;  5HOO A;  5LRS A;  2XAJ A;  3I59 B;  5E1Z B;  1G3Y A;  2UWM A;  3JAM K;  3E5Q A;  2KIM A;  1YS6 A;  4S04 A;  2DQR A;  1BC8 C;  1SD5 A;  4PGH A;  1HST A;  2HFH A;  3RPQ A;  4L9V A;  3TDU C;  2GAU A;  4LGW A;  4WXD A;  3JSO A;  2E7X A;  4G8X A;  2E1N A;  4JK1 X;  4LK1 F;  4KYW A;  2VXZ A;  4L9N A;  1QQI A;  2F5D A;  3D5L A;  4KN7 X;  1HKS A;  4ESF A;  4IJA A;  2XAG A;  2ZNZ A;  4EJV A;  2MD5 A;  5E1X A;  3RKY A;  1IN8 A;  2VBY A;  2W24 A;  1J2X A;  3I59 A;  4D0P A;  2L3D A;  2QUF A;  3HOS A;  4MGR A;  2IP2 A;  4HV5 A;  5L3C A;  1LQ1 A;  3ABT A;  2VOD A;  1MZB A;  2W84 A;  4M9S A;  3E3V A;  2LNB A;  3H92 A;  4M74 A;  4L18 B;  3L2C A;  2Z33 A;  2DBB A;  1IRG A;  4KIG A;  3I58 A;  3TOA A;  4NQW A;  3KZY A;  3T8T A;  2H27 A;  4ZH4 F;  1FZP B;  4QWQ A;  3JSP A;  2GXB A;  4BHC A;  2O61 A;  2NNY A;  1X3U A;  1BOA A;  2PN6 A;  2ADU A;  2PMH A;  3GZ5 A;  2XRN A;  3N97 A;  2M8E A;  1JHH A;  2M45 A;  3WE2 A;  3I53 A;  1V4R A;  1S6L A;  2YPR A;  2ESH A;  2HDC A;  1WWX A;  1R58 A;  3C1D A;  1QGP A;  5L3B A;  4G6Q A;  3H3Z A;  1BM9 A;  4I09 A;  4MEY F;  2CQK A;  4OMZ A;  1OYI A;  2YU3 A;  2XGX A;  4L0Y B;  3RYR A;  2DPU A;  3BJA A;  3L9F A;  3CUO A;  3Q9S A;  1FNN A;  5DDG A;  1IZ1 A;  2L54 A;  2TDX A;  4RS8 A;  3ZN1 A;  1UST A;  1XMA A;  3COA C;  4I01 A;  3EDP A;  4I0A A;  2OZ6 A;  2ZBK A;  5CVI A;  4FHT A;  5HS9 A;  1LEA A;  1O3Q A;  2A69 F;  4M73 A;  4IPA A;  1YW8 A;  1V3F A;  4OIR F;  1XD7 A;  5FD5 A;  4YFN F;  2RC4 A;  2A61 A;  5CVU A;  2XRO A;  1ZLK A;  3KP4 A;  2NAZ A;  2X0L A;  1FSE A;  4UV8 A;  3BJO A;  3HTS B;  5H6R A;  3ZN0 A;  1TLH B;  1MGT A;  4A12 A;  2PEX A;  3K2Z A;  2KIU A;  3LST A;  3ZQ7 A;  1KQ0 A;  2L4M A;  2VBX A;  3G73 A;  5LHH A;  4G7O F;  3K0L A;  1FBQ A;  2XAH A;  1OYY A;  4GYI A;  4G94 A;  5A2Q K;  2R3S A;  2EFQ A;  2HYF A;  2K86 A;  4AIH A;  3GO5 A;  1HQC A;  3TKY A;  3E6M A;  3BPV A;  1XMK A;  2CSO A;  2ZO4 A;  2QVO A;  3GF2 A;  2HS5 A;  3JTH A;  2ZKZ A;  4U7B A;  3H3U A;  1U78 A;  5AON A;  1IRF A;  2COM A;  4HLY A;  1U5T B;  4R79 A;  2MH2 A;  4HF0 A;  4EQQ A;  3LA2 A;  3MFK A;  1GHC A;  1TNT A;  2FA5 A;  4NB5 A;  1ODD A;  2FNP A;  1BI1 A;  2W57 A;  3LWF A;  3BOQ A;  3KP3 A;  1HBX G;  4A0Y A;  1W4M A;  3KEO A;  1SD6 A;  1WQ2 A;  3WTZ A;  3NEU A;  5D6F A;  5ILV A;  2HEO A;  2OQR A;  3DV8 A;  2EB7 A;  3T0Y A;  3F8N A;  1QNT A;  3ULQ B;  4XLN F;  4MQV A;  1U5T A;  3U9G A;  3R61 A;  1BJA A;  3E5X A;  2STT A;  4MHG A;  2EFO A;  2J5P A;  3MEX A;  1T98 A;  5HDG A;  3ZMU A;  1TQM A;  4OIN F;  1TQP A;  4XRF A;  4UVC A;  5ERI A;  2GIV A;  1H0M A;  3RTR A;  1LB2 A;  1FWZ A;  2VBZ A;  3ZMS A;  3I5U A;  1XCV A;  2R7D A;  3E6B A;  3VB2 A;  3Q5F A;  2FRH A;  1ULY A;  1HXD A;  2UZK A;  4RB1 A;  4BQA A;  2NNN A;  1YO5 C;  1FP1 D;  1TTY A;  5A2Q Z;  1ZG5 A;  4IRH A;  1VTN C;  3J81 K;  2XAQ A;  2M5W A;  2ETH A;  5K1Y A;  4HLX A;  3MZY A;  5E18 F;  2WWY A;  1FLI A;  1P2F A;  4LB5 A;  1FYL A;  3RI4 A;  3CO6 C;  2GQQ A;  2ZJ2 A;  3LQR A;  3Q9V A;  1K78 B;  1IXC A;  2C6Y A;  3WU0 A;  4HX8 A;  3V7R A;  3KLO A;  1KU2 A;  3SQN A;  4MTE A;  2Z3Y A;  3NQO A;  2VC1 A;  5DV5 A;  2VON A;  4MQ9 F;  2RNJ A;  4GCV A;  2P5V A;  2Q2E A;  5FLX Z;  4FT8 A;  1P4W A;  1FOK A;  3GFM A;  1RI7 A;  2XAF A;  3WTY C;  4RGS A;  3P9K A;  1ONV A;  3C18 A;  1NHA A;  1QZY A;  1K78 A;  2EA4 A;  2M87 A;  4PGG A;  5FB2 A;  4Q4Z F;  4LG0 B;  3FXU A;  2IW5 A;  5CJ9 A;  3BZ6 A;  5IT9 Z;  1RIO H;  3QP5 A;  3WTT C;  1I1S A;  2HWV A;  4M9X A;  1Z9C A;  2CO5 A;  5E1W A;  5L3G A;  4AIK A;  2A07 F;  4KMF A;  4CYD A;  2EFW A;  5HS8 A;  5D8K B;  3HSE A;  3FX3 A;  4Q48 A;  4N9H A;  3RYP A;  3GFL A;  4ZZL A;  1L0O C;  2XIG A;  2FU4 A;  4I2O A;  4CGZ A;  1MJB A;  2V9V A;  5K5R A;  1B9N A;  5D5V B;  1S7A A;  3J81 Z;  4KFC A;  1SFE A;  2EV6 A;  3FXR A;  4LG0 A;  1PP8 F;  4BXU A;  1XCB A;  3L00 A;  1FBS A;  5LBQ A;  5ICG A;  1PDN C;  1RNL A;  2PBI A;  3HRT A;  2M30 A;  3K9T A;  1T38 A;  2BV6 A;  2CGP A;  5CVR A;  1FYM A;  2L01 A;  1WKM A;  1ZGJ A;  5EEH A;  4HZF A;  3HUG A;  4Y17 A;  3ZMD A;  3RIR A;  5K5O A;  4CDG A;  3HRS A;  3PFI A;  1RUO A;  4RB2 C;  1R1T A;  1IAW A;  3FXQ A;  2P6S A;  1KYZ A;  1Z05 A;  2V6C A;  2HZT A;  3V7C A;  3G3Z A;  3VEP A;  4P55 A;  2WC2 A;  2P7C B;  3BJ6 A;  2Y0M A;  1E2X A;  3DQV C;  1MJ9 A;  1J75 A;  4PZJ A;  5J6X A;  2OQG A;  4HOB A;  1TW3 A;  3TQN A;  1HKQ A;  4IF4 A;  1CF7 A;  2CW0 F;  4YII A;  2LSO A;  1KQ9 A;  3BWG A;  2BE5 F;  4UHT A;  5D6E A;  2WTE A;  1EV7 A;  4G7H F;  2V1U A;  3TGN A;  1JGS A;  2R7F A;  5ED4 A;  1ZRF A;  1ZG1 A;  3S2W A;  3IKV A;  1I6X A;  2NS0 A;  2A68 F;  3GW2 A;  3TOB A;  1LEB A;  2DK8 A;  1IN4 A;  1J0R A;  4EV0 A;  1XGN A;  1H9G A;  1XGM A;  3DP7 A;  4Y13 A;  4A6D A;  5DUK A;  2RN7 A;  5JHU A;  1XB4 A;  3E5U A;  1IN6 A;  3N4M A;  5DCM B;  1T0F A;  1YFH A;  3WOD F;  1QO0 D;  4P5O A;  4I7H A;  4RAY A;  5LEJ A;  1YS7 A;  3HRM A;  1J5Y A;  4EJO A;  2RKH A;  1YYV A;  1ZGA A;  2B0L A;  2RGV A;  3R60 A;  1ON1 A;  4BNC A;  2JRT A;  3F21 A;  2A3S A;  5BQT A;  4GYG A;  3WE3 A;  5BS6 A;  1U2W A;  4HX4 A;  1FYK A;  1R1V A;  1D5V A;  3F6O A;  5DCM A;  3ERE D;  2EA2 A;  4OOI A;  1Z6R A;  4R1H A;  2HKO A;  1FPQ A;  3JTG A;  3WTS C;  1ZHF A;  2KJB A;  2PMU A;  1U6G A;  5LLQ A;  1ZRE A;  4TV7 A;  1DUX C;  4HQE A;  3CLO A;  5AIQ A;  2GXG A;  3FMQ A;  1UFM A;  1IXS B;  2EFP A;  3JW4 A;  3KCC A;  5LGN A;  3HSF A;  4CHU A;  3HSR A;  4HBL A;  5FFX A;  1SD4 A;  1EH6 A;  3V7S A;  4XBF A;  3RKX A;  4OIO F;  1SFU A;  1MKM A;  4YG2 F;  3GYH X;  3FM3 A;  4WWC A;  4RAZ A;  5JVT A;  1O7F A;  2STW A;  1REP C;  2IT0 A;  2VC0 A;  3FM5 A;  1W5S A;  5D5X B;  2WV0 A;  5HLG A;  2Q8K A;  1BIB A;  3F22 A;  1GVJ A;  3EQL F;  4P9F A;  3W6J B;  3TO9 A;  5HLH A;  3L09 A;  1DPR A;  4U0V A;  2Z99 A;  5HDN A;  1MDM B;  2P5K A;  5CYV A;  2XAS A;  5LHG A;  4HYE A;  5D4S A;  1I1G A;  2O03 A;  5BPD A;  5E17 F;  3P7N A;  1KU3 A;  4ETS A;  4FX0 A;  2P8T A;  3T8R A;  4BHP A;  4KIB A;  4ENM A;  1MDM A; 
#chains in the Genus database with same CATH topology
 3DTE A;  4HAM A;  2DMT A;  3OYB A;  4XKV A;  3FHZ A;  1JUM A;  2P4W A;  1HW2 A;  2KLO A;  1Z1D A;  2RVC A;  3DXJ F;  5ICC A;  3ERM A;  2BVM A;  5IT3 A;  1Q1V A;  3IC7 A;  2Z5U A;  3BP8 A;  3HTU A;  3QU6 A;  3J7Y J;  4ZDP A;  1OCR H;  2XV4 S;  3X2Q H;  1RKW A;  1WI9 A;  4M72 A;  5FKL A;  4M6X A;  4JQF A;  2R5Z B;  2FBH A;  5C44 J;  3V42 A;  2MA3 A;  2XHK A;  3O3K A;  2H8W A;  4OMY A;  3JRC A;  3PNY A;  1U5T C;  1C0W A;  2NVX J;  4MTD A;  5D4R A;  1GLN A;  3BR6 A;  2AO9 A;  1ZH5 A;  3JRG A;  3S3O A;  3GUD A;  2Z9O A;  2WY8 Q;  2EZL A;  4ZYH A;  1QHG A;  2LH9 A;  5ILS A;  3V4G A;  2HVR A;  5FLX K;  2E7W A;  3Q3S A;  5IYB J;  4DYC A;  4R8H A;  4F93 B;  5JLW A;  3T1B A;  2AQE A;  2HU9 A;  2LC2 A;  3BTC A;  4XOP A;  4I6Z A;  1AOY A;  1S7O A;  1ZRD A;  3V8K A;  4QIW N;  4M71 A;  2DQL A;  3DEU A;  3SFI A;  2OZU A;  4E70 A;  1YRN B;  1HKT A;  3WTW C;  3GCM A;  5EDN A;  2OV7 A;  2AS5 F;  2JA5 J;  4A3B J;  3NWS A;  4JP0 A;  4KIS A;  2MLK A;  3RDI A;  2DN0 A;  3HGG A;  1YQA A;  4D7M A;  1O7L A;  1ZK8 A;  2IA2 A;  4M9Z A;  1SFK A;  2R5Z A;  3TO6 A;  2RAE A;  1IXR C;  5F1J A;  3KIO A;  4G7Z F;  2GOM A;  2E5N A;  2IBD A;  3CCU I;  3VPR A;  1I5Z A;  4XSZ F;  2KJC A;  1Y0N A;  1UAA A;  2ZB9 A;  4AC0 A;  5CLS A;  2IA1 A;  3MMY B;  4B09 A;  1I6H J;  1LKX A;  1UHS A;  5IT9 K;  1OQY A;  2VQH A;  2OU2 A;  3BY6 A;  1Z91 A;  3QRF F;  1XN7 A;  1H89 C;  2XSJ C;  1D3Y A;  3ROU A;  5M5Y J;  5FFZ A;  1R7J A;  3F23 A;  2Q0O A;  4N4O B;  3J80 Z;  1MW7 A;  3OIO A;  2R7V A;  4A3D J;  1VFC A;  1DDN A;  3PJR A;  4HF1 A;  1R6R A;  2LKP A;  2ELK A;  2P81 A;  2V1N A;  3RZO J;  3CCJ I;  2RV8 A;  4I98 B;  3SZT A;  4ESJ A;  1YRN A;  3C2H A;  2OAZ A;  4P1W A;  2E1M B;  1ENH A;  1N75 A;  2VPL A;  2KDO A;  1N25 A;  3SXY A;  5E8G A;  4B4C A;  1MMN A;  3CQZ J;  2QQB A;  4DNC A;  2FD5 A;  1YJ9 I;  3ZPL A;  1IRX A;  1ON2 A;  2QQ8 A;  2ECB A;  3I64 A;  5EZH A;  4MEX F;  1VQK I;  4RGX A;  2K27 A;  1RUN A;  9ANT A;  3S1Q J;  1TNS A;  4N9I A;  4IZZ A;  2QWW A;  2VQC A;  1YTY A;  1G3S A;  2O0Y A;  1R5I D;  3PQK A;  3K4J A;  1UMQ A;  2BY0 A;  4LB6 B;  2DI3 A;  2XB0 X;  3S16 J;  2ME6 A;  3ABL H;  2A6H F;  1PUF B;  2QLZ A;  4XN0 A;  1BI3 A;  3H3V K;  1BIA A;  1WGX A;  2XC7 A;  2VLA A;  2A5Y B;  2ZCW A;  4CZC A;  4IOA F;  4EMS A;  5KAF C;  2F5V A;  3VFZ A;  4AYB A;  5L3D A;  3WTU C;  2YX4 A;  1LDJ A;  4XID A;  3OYE A;  3CF5 F;  3F0C A;  1IN7 A;  1X1B A;  1A31 A;  3AG3 H;  3HJE A;  1TZL A;  3MWM A;  3F9K A;  1BN5 A;  1HF0 A;  3J7A Y;  4XM3 A;  1K6O A;  1XX5 A;  1WJ5 A;  2LP0 A;  4HW0 A;  4ENJ A;  4V19 K;  1CGP A;  3ABU A;  3GFJ A;  3H5R A;  3OYN A;  1B6A A;  1W1W E;  1PP7 U;  3K4N A;  4UUS B;  1OYW A;  4KT5 C;  3WG9 A;  3I3L A;  3CC4 I;  1X4O A;  1SD7 A;  4L5J A;  4RGU A;  1BJZ A;  2PI0 A;  2DOF A;  3U21 A;  1IV6 A;  4Q47 A;  5F6F A;  4Q5S F;  1TW2 A;  4IVN A;  2DPD A;  1VZ0 A;  4S05 A;  1QPI A;  1PUF A;  4ZTJ A;  2FE3 A;  3FKJ A;  2AXL A;  2KQR A;  3M07 A;  2HTS A;  4ANJ A;  4BAY A;  1KA8 A;  4L5I A;  4PJN A;  2L9S A;  4CO8 A;  3CES A;  1FSH A;  1F1Z A;  4F91 B;  1PUE E;  2KP6 A;  3P9C A;  2YSR A;  2HQN A;  3KET A;  3CUQ B;  3CO7 C;  3CCL I;  1FC3 A;  3LMM A;  1VQ5 I;  1WHU A;  3OY9 A;  2K9M A;  4L9J A;  2ZFU A;  1S3J A;  3W3C A;  2ESN A;  2A05 A;  1ZEL A;  3W6K B;  2WY7 Q;  4HV6 A;  1GDT A;  5J1Y A;  4RB0 A;  1GXP A;  3WTV C;  4PDK A;  4RGR A;  1UHM A;  1WZ2 A;  3I71 A;  3ELK A;  2ZXW H;  5J3L A;  2CG4 A;  3DU5 A;  4KIT B;  1H88 C;  1QBJ A;  1BI2 A;  2YR2 A;  4JX6 A;  4UV9 A;  1S29 A;  1RZ4 A;  2MH9 A;  2VN2 A;  1TWG J;  2VOO A;  2Z16 A;  4UUS A;  4BEH A;  1WJD A;  3MKL A;  4KIC A;  1J9I A;  1MNE A;  2JT1 A;  3KP2 A;  3SDG A;  3L1P A;  1X3Z B;  2GIZ A;  3VYT B;  3BG6 A;  4YFX F;  4KA4 A;  4C2U A;  3S1N J;  1MBF A;  4ZYG A;  5FGM A;  2OA4 A;  2MG4 A;  3QOP A;  1EJ9 A;  2ZME B;  3GLL A;  3K1N A;  2HR3 A;  1L3L A;  1UB9 A;  2L4A A;  3DKW A;  3HHG A;  1G3T A;  3IL2 A;  1Y56 A;  1BC7 C;  1QU3 A;  4XLF A;  1S8N A;  1ZAO A;  2JZY A;  2FBI A;  4N0B A;  4Y3O A;  5HS7 A;  5C4X J;  3I4P A;  4Y52 J;  2KZG A;  1H9T A;  3CUQ A;  4BBS J;  1ZRC A;  4WK8 F;  2O9L A;  4MFE A;  4BGD A;  1SAX A;  4LIT A;  2K7L A;  1DQU A;  4QSH A;  3PQJ A;  1T6S A;  4O6J A;  1FOW A;  2H6B A;  3TO7 A;  3S2H J;  3J7A O;  3L2W A;  2L7Z A;  3ZMT A;  4J01 A;  4A3F J;  1UHW A;  1O3S A;  3VWB A;  1ETO A;  1MBE A;  3K1P A;  3RKQ A;  4B3A A;  3JRD A;  5J8C A;  1LE8 B;  3HDD A;  1FOX A;  5DYM A;  2KDZ A;  2Y0S A;  1KU7 A;  3TBI A;  3GTP J;  2Y0S N;  2R7S A;  5B1A H;  1G4D A;  5KAI C;  1KON A;  2NRA C;  1U3E M;  3EYY A;  3LA7 A;  3BPX A;  3G1M A;  3KE2 A;  4ENN A;  2ZME A;  2G7H A;  3U2R A;  2GBY A;  1K6Y A;  2EJR A;  2FMY A;  4RB3 C;  3LOC A;  2MBF A;  4HA8 A;  2BHY A;  4EJW A;  1Z6T A;  2JSC A;  3OOP A;  3P9I A;  1KYW A;  2L9R A;  2WAD A;  3T5X A;  3V8J A;  2IA0 A;  1HC8 A;  1P9Q C;  4HDU A;  3K1M A;  4WXC A;  2EFN A;  3KEQ A;  3SEQ A;  3ZMV A;  3HL2 A;  1XGS A;  4D5C A;  5TGT A;  4L5E A;  1LJ9 A;  2H1L A;  4RLF A;  4NHJ A;  3S2D J;  3VYS B;  2PFB A;  3MN2 A;  3GXO A;  4HSR A;  3I54 A;  3LA3 A;  1LE8 A;  2IXS A;  5KCM A;  4BXF A;  2NOG A;  3GEZ A;  1F5T A;  4FQG A;  4XLP F;  2R92 J;  4BYY A;  2TRT A;  3ZQC A;  1A04 A;  4K2E A;  2F4O B;  1DU6 A;  3K4B A;  3F6V A;  2HQ5 A;  1W7P D;  3LNQ A;  3HGY A;  4MLO A;  4E6K G;  4EM0 B;  2V1D A;  5H20 A;  1SAU A;  3GTQ J;  3E0J B;  4XLH A;  5LD2 C;  1ETV A;  4IHY A;  2GA1 A;  4DJA A;  5FJ8 J;  1K79 A;  2Y48 A;  3FBN B;  2CW8 A;  2K4B A;  5IPA A;  3GTL J;  2NVQ J;  5F04 A;  3OSF A;  3S3N A;  4RA2 A;  4RM2 A;  5ILU A;  1MIJ A;  1S72 I;  4LMY A;  2CU7 A;  3HYI A;  2EBI A;  2MGQ A;  1T0F C;  1EH7 A;  1KZH A;  5FD6 A;  3WU1 B;  2F5E A;  2PG4 A;  1E3H A;  5IYD J;  2LG4 A;  2HYG D;  1QVT A;  4XLE A;  2KT0 A;  1Z7U A;  2CYY A;  2F5C A;  4B1R A;  4DBR A;  2F5F A;  3FWE A;  1AWC A;  1F9N A;  2IS4 A;  2M1B A;  1T8I A;  4BE1 A;  3A01 B;  4YFK F;  1JT6 A;  1FX7 A;  3HRU A;  2HGC A;  3M7G A;  2PQ8 A;  4E4H A;  1OMI A;  3QWL A;  1R5H A;  3WTX C;  3LAP A;  4LLN A;  5HLI A;  4GDF A;  4O5V A;  1XSV A;  4UVA A;  1A6Q A;  3BDD A;  4G12 A;  3PNV A;  3K70 D;  2KIF A;  4FX4 A;  3ISP A;  3QPT A;  4ZC3 A;  3GME A;  4A3G J;  5FLM J;  2Y69 H;  3R4K A;  1DP7 P;  3R0A A;  1W5C C;  2VAS A;  3I0T A;  2MW8 A;  1HA8 A;  1MSF C;  2EIN H;  5LEK A;  2A6E F;  3B02 A;  3GX4 X;  3GZ6 A;  4JOM A;  4BE2 A;  3DPU A;  4H4K C;  1VQ8 I;  1ZN2 A;  3FXM A;  4CCL A;  4IRI A;  1B9M A;  2CQ7 A;  4KIF A;  1MBH A;  4CCM A;  1YX3 A;  4AD9 A;  2GLO A;  3FMR A;  5LRR A;  4WF2 A;  2DDA A;  4G6D A;  2VBW A;  3A01 A;  1IN5 A;  3RPU D;  2EQR A;  1YG2 A;  4XL9 A;  1FIA A;  2E1C A;  5CVJ A;  4LFU A;  2DJI A;  3GLX A;  4FIS A;  3EYI A;  5GAD J;  2D1V A;  4EEF G;  4AWX B;  2ELH A;  2X85 A;  3DEW A;  5F1R A;  3VOD A;  1K4S A;  2HTJ A;  1AU7 A;  2P5L C;  1USS A;  2W85 A;  2WAQ A;  3KLN A;  3KYL A;  3QPL A;  1B59 A;  2I10 A;  2WAQ N;  5E8I A;  4DW6 A;  4NC7 A;  3S17 J;  3M3Y J;  4IHW A;  2JUC A;  2DAO A;  2BGC A;  1ZR4 A;  3JR9 A;  1G3W A;  4EGY A;  3I9V 2;  2XKP A;  2ID6 A;  2BZT A;  3CF2 A;  3PM1 A;  1WJE A;  1F4K A;  4U0Y A;  1K7A A;  2K40 A;  2VKE A;  2YX7 A;  2K9S A;  1YJN I;  1YI2 I;  1G6N A;  2DU9 A;  1UJ8 A;  1LDK B;  3S3M A;  2CUZ A;  3H0G J;  4NDL A;  1FT9 A;  2BY2 A;  1J59 A;  1R49 A;  2L02 A;  3OYJ A;  1RES A;  4F7Z A;  3EET A;  1JI8 A;  2W7N A;  1KQ8 A;  4Y33 A;  2WBM A;  3PSF A;  5CVV A;  2I5U A;  1TT0 A;  2V1X A;  3GTJ J;  3R6S A;  4LD5 A;  1Q1H A;  1R00 A;  3BG9 A;  3W2A A;  2VE8 A;  3ZP5 A;  2F2E A;  3RJP A;  5J8F A;  2VT3 A;  3ECO A;  1W5T A;  1JJ8 C;  2JQ7 A;  1P6R A;  4LK0 F;  4BBR J;  1NG7 A;  2H09 A;  3KPH A;  5K7F A;  2BW3 B;  4ZZD A;  4M3D A;  5K5Q A;  1IUY A;  2HPM A;  1XDS A;  1DGR M;  3HZJ A;  4BE0 A;  3A0B C;  2YU9 J;  5FKN A;  1R36 A;  2DMP A;  4XOR A;  1YW9 A;  4P96 A;  4B8X A;  5D5U B;  4CIC A;  4KN4 X;  2JPC A;  2QQ9 A;  3PIO F;  4UXN A;  1MND A;  4OAY A;  4A5N A;  3JAM Z;  1TBX A;  1WJA A;  2F4M B;  1D8J A;  3S8P A;  1T2K A;  4A69 C;  4L0Z B;  2CS3 A;  3R0J A;  3ZMZ A;  4WX9 A;  2K02 A;  5CPR B;  5KVR A;  2Y9Z A;  1E17 A;  5GAE J;  3IUO A;  2UV1 A;  3SHF A;  1BA5 A;  5J40 A;  2VI6 A;  3ZQI A;  2KKO A;  3D0S A;  5HNH A;  3RKW A;  2L2O A;  3ZQG A;  1Z67 A;  2QF7 A;  2QZ8 A;  3CTA A;  5KK1 A;  4J19 A;  1DP3 A;  5F08 A;  3Q0U A;  1ETY A;  1STZ A;  1ETX A;  3DEE A;  1IDY A;  2IS6 A;  2XF7 A;  1Y1V J;  2FML A;  2V79 A;  5H6Q A;  3TDZ C;  4EAT A;  4EVI A;  5JLX A;  2OBP A;  2DCE A;  4CCO A;  4EJT A;  4Z2Y A;  3E97 A;  2ZXI A;  2HKX A;  2DO7 A;  5ICE A;  5IY5 H;  2JWT A;  2IRF G;  4IXA A;  2HXI A;  2EV5 A;  5E20 A;  3LQQ A;  1ZKG A;  3J80 K;  4UNO A;  4DQ2 A;  3REO A;  3QOE A;  3NWT A;  1FBU A;  4G6T B;  4XSX F;  4RBO A;  2FUG 2;  3IWZ A;  1XG1 A;  1W0T A;  2DTZ A;  1TQI A;  3OYC A;  1BL0 A;  5BOX A;  2ZJQ F;  5HDK A;  3BG3 A;  2N8G A;  2NVU B;  1P92 A;  2E35 A;  3BRO A;  4U88 A;  4L9T A;  2BYV E;  2ICW G;  4UUT A;  3SFZ A;  3J7Z I;  2IPQ X;  3IRR A;  2FEZ A;  2DT5 A;  1W36 D;  1UZC A;  2L9V A;  3L2R A;  1JUS A;  3F8B A;  1U9N A;  3F8F A;  2JTV A;  5J1R A;  4FAS D;  1N77 A;  4BJT A;  3IH2 A;  4ZYD A;  4LJZ F;  4HST A;  5HVQ C;  1FY7 A;  2ZXH A;  3WGI A;  1JKO C;  2G9W A;  3AG1 H;  3CME I;  3SJM A;  2FXA A;  4LG3 A;  4CH7 A;  2R7W A;  5FKK A;  2JK3 A;  1P7J A;  2KRF A;  6PAX A;  1ZG3 A;  4CCK A;  3O8H A;  5TJJ A;  3KP7 A;  1ZAR A;  3DU6 A;  3LSH A;  1JGG A;  4H0E A;  4A0Z A;  2JSP A;  3VSL A;  4F3Q A;  4A3K J;  2ZFW A;  3LSG A;  1R22 A;  4PUS A;  1GXQ A;  1MMG A;  4NC8 A;  1U9O A;  3WHC A;  5BPI A;  3IRQ A;  2H6C A;  3DTK A;  4XQF A;  3G71 I;  2HOE A;  2W82 A;  4B3X A;  2MC3 A;  2V26 A;  4YRV A;  2XPU A;  1FMW A;  5FO5 A;  2FF4 A;  3JRI A;  4EJU A;  4KMU X;  3QYF A;  1TWF J;  3SZP A;  4OIQ F;  1K4T A;  3P5J A;  4U7D A;  2W4S A;  3OSG A;  3IWF A;  2CFX A;  5L3F A;  5L3E A;  4YEL A;  3B6A A;  3A02 A;  2IGM A;  4WXH A;  2K4J A;  1HW5 A;  3HOZ J;  1LUJ B;  3L7W A;  2DJN A;  4XR6 A;  1B8I B;  4IHT A;  2W25 A;  1R1U A;  2ZXJ A;  1GV5 A;  3IH4 A;  2LVS A;  2CWE A;  1TC3 C;  3N05 A;  2EK5 A;  3DFG A;  1TWA J;  5JI6 A;  2CMP A;  2P7V B;  4IHS A;  1ZGW A;  3HC7 A;  4NBQ A;  2DLL A;  3OYD A;  2QQA A;  2CUJ A;  4DBQ A;  2LRD A;  2LDU A;  5GAH J;  1SMT A;  1XSX A;  4U0W A;  1J7K A;  1OKR A;  2LY2 A;  3U1D A;  3LAJ A;  1IRZ A;  4OU0 A;  3RSN A;  3ZR8 X;  2FOK A;  1YLF A;  4BAC A;  1SVL A;  3OWT A;  5GAG J;  3KFW X;  5FKM A;  3HOT A;  3ECH A;  1D0Z A;  1PYV A;  2EZK A;  1TT5 B;  1B4A A;  4D7N A;  3H0D A;  3ML6 A;  1R23 A;  1DPU A;  4IRG A;  1APL C;  3FDY A;  3KZI C;  3PUF A;  2EIK H;  2O3F A;  3BQY A;  4EM2 A;  2FJ1 A;  2Y75 A;  3DF8 A;  2ECC A;  2IAI A;  3OOU A;  2ISZ A;  3E7L A;  5D5W B;  3DLA A;  1YW7 A;  3V8L A;  2XVC A;  1UG2 A;  5IOZ A;  2QEX I;  1B8I A;  2X6O A;  2D1H A;  3CJN A;  4ON0 A;  2DK5 A;  3MCZ A;  4ZJZ A;  3HBL A;  3FIW A;  4M6Y A;  3EPZ A;  4A6E A;  5F0F A;  5ICF A;  4F55 A;  4M3G A;  3C3W A;  1LFP A;  2QM3 A;  1N78 A;  1VQO I;  2WAE A;  2VOP A;  1WPK A;  4X6A J;  2NYX A;  2FNA A;  2XPW A;  3FMS A;  3HG9 A;  2X6X A;  2LBF B;  1BR1 A;  2BY3 A;  3QU3 A;  5DM6 F;  3EUK L;  4QLC U;  2UXN A;  2XKO A;  3GZN B;  3WU2 C;  1I50 J;  2G0E A;  3CCV I;  2E1M C;  2XB5 A;  1ETQ A;  2O6G E;  2PJP A;  3K4C A;  1IF1 A;  1IW7 F;  1RPW A;  1W7P B;  2EV0 A;  2D2W A;  3WGG A;  4BHB A;  1GV2 A;  5TRD A;  3GTK J;  4P9U A;  2GOX B;  4GO1 A;  4OIP F;  2LTP A;  5JFR A;  1SC7 A;  3CLQ A;  1KGS A;  3WGH A;  2X48 A;  2A6T A;  2E5Z A;  4HX7 A;  3AL0 C;  3QP6 A;  2VKV A;  3Q0W A;  5C4J J;  2BEO A;  4HPQ A;  1QZZ A;  1KU9 A;  1O3R A;  3IAM 2;  1FP2 A;  1OPC A;  3WG7 H;  3G1O A;  4YIR X;  4N4N B;  4WCG A;  4A93 J;  4B47 A;  1WFX A;  1I39 A;  1SMY F;  2VJ5 A;  2VT2 A;  3E6D A;  5JR3 A;  1WSU A;  2KHM A;  3EUH A;  1XDU A;  2E1O A;  2XUB A;  3K10 A;  2HOA A;  4ESB A;  1JE8 A;  2PMZ A;  2OPT A;  1WRJ A;  3CJQ B;  3CP8 A;  4CXF A;  2OD5 A;  4AYB N;  3M1E A;  3FBI B;  5GPA A;  2IVM A;  3DLL F;  2VKD A;  2ZNY A;  4HDV A;  2M0M A;  2MAB A;  2HQR A;  3HXL A;  2IJL A;  3O6B B;  4C3I J;  4QTR A;  4IX7 A;  2G7U A;  1SFX A;  1X2N A;  5IP9 J;  3AKZ A;  3GFI A;  1XPX A;  3FF5 A;  5DCF A;  1W7P A;  2F6C A;  3S93 A;  1YIO A;  1MD0 A;  3K69 A;  3TW6 A;  2WA0 A;  1EF4 A;  2B63 J;  1LVA A;  2FBK A;  3H9G A;  2JPB A;  1QA6 A;  3KZZ A;  5HOD A;  1JKR C;  4EM1 A;  2P6T A;  3F8M A;  3HHH A;  3W2W A;  3CCM I;  2X4H A;  1LNW A;  2DFE A;  2L9N A;  3MZH A;  4UVB A;  1YX5 A;  5LHI A;  1LDD A;  3HOX J;  1G8X A;  2DTR A;  2DMU A;  2RQP A;  4ASN A;  1ZLJ A;  1T39 A;  2R5Y B;  3BR2 A;  5DD4 A;  3K4K A;  5EG0 B;  4DGW B;  1MH4 A;  1LVK A;  2COB A;  4E7S A;  3TW7 A;  1IG7 A;  1IGN A;  1OIS A;  1X1P A;  2HI3 A;  2LF7 A;  2LF8 A;  3G4S I;  4PCQ A;  4GXO A;  2EWN A;  5C3E J;  2I8D A;  5DEQ A;  4UUV A;  3TP0 A;  4M6V A;  5LGT A;  5M5W J;  3MAJ A;  1ETK A;  3SDB A;  3CUQ C;  4GGG A;  4B44 A;  3W2V A;  2J5O A;  2GXA A;  4LLG F;  4BY1 J;  1TWC J;  1OR7 A;  5D8L B;  3CMM A;  2GZW A;  2L7K A;  2X1E A;  1G59 A;  5LGU A;  1O3T A;  2PLY A;  3KP6 A;  2ZSI B;  4E7I A;  4KUM A;  3PO2 J;  1IO2 A;  1JKP C;  1IV8 A;  1A5J A;  3DPT A;  2QYO A;  3F3X A;  3NAR A;  1OCT C;  4A3L J;  2O8X A;  4U87 A;  3C7J A;  4CCN A;  4Y15 A;  2WV1 A;  2CQQ A;  3SEZ A;  2JA7 J;  1ZYR F;  3GWZ A;  1YIT I;  4CUG A;  4GFB A;  4Y7N J;  3F8C A;  1BOB A;  1QPM A;  3OYM A;  2TCT A;  3OV8 A;  2R5Y A;  1Z77 A;  2OUM A;  2XF5 A;  5EEA A;  1XSD A;  1Z7L A;  1Y0U A;  5EG0 A;  2QBY B;  3ESW B;  2V9P A;  1BI0 A;  1D8K A;  4CZZ A;  2ACJ A;  4I0B A;  5EEG A;  4BQQ A;  5EJC A;  1MBG A;  2VXD A;  3QYE A;  1Y6I A;  1HW1 A;  3ZQF A;  3CP2 A;  3QQA A;  2X9D A;  1ACI A;  3CCE I;  2QEN A;  3U1K A;  1Y39 A;  4IOC F;  3RPU A;  2D5V A;  3BR1 A;  3HPH A;  4ZTF A;  3CDL A;  2BBY A;  2QGU A;  3VDX A;  2RDP A;  1JUP A;  3TP3 A;  1P4A A;  2NOJ B;  3IHU A;  1I3Q J;  4YIF A;  3IP4 B;  2D45 A;  4A5M A;  4JBA A;  2MLG A;  4KNY A;  3HIF A;  3B6C A;  2OC6 A;  4O3M A;  2MC4 A;  2FQ3 A;  3O2P E;  2L0K A;  1EH8 A;  2FQ4 A;  4EGZ A;  3QAH A;  3IKT A;  3E6C C;  2BVL A;  3OIQ A;  4ENK A;  4PJM A;  3I55 I;  1D0X A;  1RR7 A;  3H36 A;  2PJR B;  2QBY A;  2DFI A;  1Z3X A;  2M7A A;  1BW6 A;  1JHF A;  4MNU A;  5DM7 F;  5JVG F;  3KP5 A;  4J00 A;  3AFH A;  4BH9 A;  1SAN A;  3LSP A;  1B1B A;  2WAF A;  1U8R A;  4BJ6 C;  4M3F A;  3AAF A;  4KDP A;  4A3E J;  2VE9 A;  2KPM A;  2FSW A;  5AIP A;  1CF7 B;  3MKZ A;  4AIJ A;  3MQ0 A;  3UKG A;  3KX2 A;  2LKX A;  4ZYE A;  3L2V A;  3BTL A;  4A0X A;  2QCO A;  1P4X A;  2VJ4 A;  2KMU A;  2K3P A;  3NRV A;  5DUI A;  1HSJ A;  3I4N J;  2DW4 A;  1I27 A;  1XGO A;  5BMZ A;  2AQF A;  5J4V A;  3M9A A;  5E79 C;  5CQG A;  4I02 A;  1OCC H;  3OYK A;  1E3P A;  4HF2 A;  3H35 A;  1VF9 A;  1R5G A;  2GWR A;  1JXS A;  2LKS A;  3BG7 A;  3QPH A;  4E7J A;  3ZQQ A;  5KHD A;  2DA5 A;  4HQM A;  3FZV A;  3DPL C;  1QZE A;  5E3M A;  3M8E A;  2PJR A;  1QRY A;  5DD8 A;  2CQX A;  3B73 A;  1PVE A;  1VQP I;  4AVP A;  4PK4 A;  2LRE A;  1D1A A;  4AUX A;  3LFU A;  3GVA A;  2VL8 A;  5HNF A;  1O57 A;  2H94 A;  3PNT A;  3LFK A;  5EGO B;  2LD5 A;  3EUA A;  3CMY A;  1BBY A;  4A2U A;  4XOT A;  2ISY A;  5F64 A;  3M8F A;  4G9Y A;  2V7F A;  3RQI A;  2M4G A;  2VQL A;  4B48 A;  2L7F P;  1UCR A;  2DT6 A;  3DBR B;  1MNM C;  4FET A;  3F72 A;  2UXX A;  2B7E A;  4LLL A;  1MJA A;  2GA2 A;  1XS9 A;  3DKX A;  3BR0 A;  3VOE A;  1S9H A;  3CDH A;  5HOO A;  3H5A A;  5LRS A;  2XAJ A;  1JTY A;  2A5W A;  3LSR A;  3I59 B;  4HEA 2;  5E1Z B;  1G3Y A;  3ZGK A;  3HOW J;  3JAM K;  3K4L A;  2UWM A;  3E5Q A;  1V5E A;  4X0G A;  2KIM A;  4D9J A;  3FKI J;  2JN6 A;  3A2K A;  1YOV B;  1YS6 A;  4S04 A;  2DQR A;  1BC8 C;  1SD5 A;  1JTX A;  3E1S A;  4PGH A;  2R7X A;  1HST A;  5EGO A;  5HLT A;  2HFH A;  3RPQ A;  2NVT J;  2O7O A;  4L9V A;  2R7T A;  3TDU C;  2GAU A;  4LGW A;  4WXD A;  3JSO A;  2E7X A;  2X6W A;  4G8X A;  2HVQ A;  2E1N A;  2IEK A;  4JK1 X;  4NQW B;  4LK1 F;  4KYW A;  2VXZ A;  4BY7 J;  3HKZ A;  4DIQ A;  5F0H A;  4L9N A;  1QQI A;  2E60 A;  2F5D A;  3D5L A;  3D1N I;  2L5Q A;  4KN7 X;  5GP9 A;  4LIV A;  1HKS A;  2JJ7 A;  1I3A A;  4ESF A;  4IJA A;  3H1C A;  2XAG A;  2ZNZ A;  4EJV A;  1YHQ I;  2MD5 A;  5E1X A;  3RKY A;  1IN8 A;  4S0H B;  5DS9 A;  1XTA A;  2FOW A;  2VBY A;  2P0W A;  2W24 A;  2KRC A;  1J2X A;  3I59 A;  4YEJ A;  1DU0 A;  4D0P A;  4ZYA A;  5B5E C;  5K7H A;  2L3D A;  2QUF A;  2R7U A;  3K2A A;  3HOS A;  4MGR A;  2IP2 A;  4HV5 A;  5L3C A;  1LQ1 A;  3ABT A;  1MMD A;  2VOD A;  1MZB A;  2LYC A;  2W84 A;  5FKO A;  5TIS C;  1FIP A;  4M9S A;  3MKW B;  2DA2 A;  2VQG A;  2LNB A;  3E3V A;  3H92 A;  2DT7 B;  4M74 A;  2QKM B;  5J1U A;  4L18 B;  3L2C A;  3OS1 A;  4UY8 I;  2Z33 A;  1E3O C;  3SZG A;  1R71 A;  2DBB A;  1U0J A;  3ZCO A;  1IRG A;  4KIG A;  3I58 A;  3TOA A;  3MVP A;  3K6G A;  4NQW A;  3KZY A;  2FX0 A;  3VYR B;  3T8T A;  3IH3 A;  2H27 A;  4ZH4 F;  1FZP B;  4QWQ A;  1WI3 A;  1NH3 A;  3JSP A;  2GXB A;  2Y30 A;  4BHC A;  3QPS A;  2O61 A;  2NNY A;  1NK3 P;  1Z0X A;  2CRG A;  1X3U A;  1BOA A;  2PN6 A;  1AKH B;  2ADU A;  1X3W B;  2PMH A;  1Z21 A;  3GZ5 A;  2XRN A;  1VI0 A;  3OYL A;  3TL4 X;  2M3A A;  2DFH A;  3N97 A;  2OCC H;  2M8E A;  1JHH A;  2RNG A;  2X1C A;  4C2T A;  3M8J A;  2M45 A;  3WE2 A;  1NG6 A;  2XDV A;  2E2H J;  2EIJ H;  3I53 A;  1V4R A;  5F0C A;  1HCR A;  2Y31 A;  1S6L A;  1ERD A;  2DA7 A;  2YPR A;  1YJW I;  2ESH A;  2HDC A;  1WWX A;  4C2M J;  1R58 A;  3C1D A;  4FE7 A;  2WB1 A;  2BXZ A;  4DOZ A;  2QA4 I;  4E7H A;  4XN3 A;  1ZQ3 P;  3GTG J;  1AA7 A;  3G2B A;  4XON A;  1OCO H;  3OR2 C;  3BTJ A;  1IJW C;  1ORK A;  1XMX A;  1GVD A;  1QGP A;  5L3B A;  2CUE A;  4G6Q A;  3H3Z A;  1BM9 A;  4I09 A;  4DYR A;  2JA6 J;  4MEY F;  2CQK A;  2OCE A;  2V4J C;  5H2F C;  4OMZ A;  2R0Q C;  3OYI A;  1OYI A;  2PX9 A;  1AKH A;  2YU3 A;  2XGX A;  4L0Y B;  1SVM A;  3RYR A;  2DPU A;  3BJA A;  3OR1 C;  2QKL B;  1VQL I;  3L9F A;  3CUO A;  3PFY A;  3D5R C;  4ZDL A;  2R93 J;  1Y8R B;  2CV0 A;  3Q9S A;  1IUF A;  1FNN A;  5DDG A;  1IZ1 A;  2L54 A;  2XRL A;  3JRE A;  2BW3 A;  2TDX A;  2KL4 A;  1VQ4 I;  3M4O J;  4RS8 A;  3CD6 I;  1WJB A;  1JJ6 C;  3ZN1 A;  3HM5 A;  1OJL A;  3QYB A;  1UST A;  1XMA A;  1S5L C;  3COA C;  1NTC A;  2E71 A;  2HOT A;  4QPO A;  1SEU A;  2EIM H;  2Z2S B;  4I01 A;  3BG5 A;  1HOM A;  3EDP A;  4I0A A;  2OTL I;  4IKF A;  2OZ6 A;  1TWH J;  2ZBK A;  2HPI A;  1R4M B;  5CVI A;  4FHT A;  2EZH A;  5HS9 A;  1LEA A;  2JVH A;  1Z3Y A;  3JCU C;  1O3Q A;  2A69 F;  4M73 A;  2HXO A;  2CUF A;  4IPA A;  1YW8 A;  1V3F A;  4OIR F;  1XD7 A;  5FD5 A;  4YFN F;  2RC4 A;  2A61 A;  4XLA A;  5CVU A;  2XRO A;  1F43 A;  3NAU A;  3CC7 I;  1ZLK A;  3KP4 A;  4C9Y A;  2NAZ A;  2X0L A;  2DMQ A;  1FSE A;  4UV8 A;  3BJO A;  4RDU A;  3HTS B;  1E0E A;  3A03 A;  3CJR B;  5H6R A;  3ZN0 A;  2IS2 A;  1TLH B;  1MGT A;  3CMA I;  2NS7 A;  2IGN A;  4A12 A;  2PEX A;  3K2Z A;  2KIU A;  3LST A;  5B1B H;  1KQ0 A;  2L4M A;  4FE4 A;  3ZQ7 A;  2VBX A;  3G73 A;  2E36 A;  3HOV J;  2X51 A;  5LHH A;  4G7O F;  3K0L A;  1FJL A;  1FBQ A;  3AG2 H;  2XAH A;  1MBK A;  1M1E B;  1OYY A;  4GYI A;  4G94 A;  5EYR A;  3AG4 H;  4IHX A;  2R7Z J;  1R9T J;  2DXI A;  5A2Q K;  2R3S A;  2EFQ A;  2RRE A;  5M5X J;  2HYF A;  2OF7 A;  2K86 A;  4AIH A;  3ZXS A;  5F27 A;  3GO5 A;  5B66 C;  4HNT A;  1HQC A;  4QPQ A;  3TKY A;  3E6M A;  1OCZ H;  3BPV A;  4MIM A;  3DCF A;  4W1U A;  3FXJ A;  4UB8 C;  2XAU A;  2HYJ A;  2KZV A;  1RET A;  4BS9 A;  1XMK A;  2CSO A;  2ZO4 A;  1D1C A;  2QVO A;  3GF2 A;  4XRS G;  1WCM J;  2HS5 A;  3JTH A;  2QSH X;  2ZKZ A;  3A0H C;  4U7B A;  3H3U A;  1U78 A;  5AON A;  1IRF A;  3ZQH A;  2COM A;  3FHN A;  4HLY A;  1U5T B;  2LY1 A;  4R79 A;  2MH2 A;  3UR3 C;  5FRO A;  4HF0 A;  4EQQ A;  3LA2 A;  1X1C A;  3MFK A;  3S15 J;  2DA1 A;  1GHC A;  1TNT A;  2FA5 A;  4NB5 A;  1ODD A;  2FNP A;  4AVZ A;  3MKY B;  1U8B A;  3OYA A;  4NUB A;  1BI1 A;  2W57 A;  4NC6 A;  3LWF A;  4B43 A;  3BOQ A;  3KP3 A;  1HBX G;  3W6V A;  1W4M A;  3KEO A;  1SD6 A;  1WQ2 A;  4A0Y A;  3WTZ A;  3NEU A;  5D6F A;  5ILV A;  3L2U A;  5IP6 A;  2HEO A;  2O8K A;  4JX5 A;  2OQR A;  1X1A A;  3DV8 A;  2EB7 A;  2R7O A;  3H9J A;  3T0Y A;  2CW7 A;  3DWL E;  3I4M J;  3F8N A;  1QNT A;  1B72 B;  3ULQ B;  4XLN F;  4MQV A;  4BU2 A;  3OS2 A;  1VQ6 I;  1VQN I;  1U5T A;  3LSM A;  3U9G A;  3R61 A;  1V55 H;  1BJA A;  3RZD J;  2KRH A;  3PIP F;  3E5X A;  4PSX A;  1ETW A;  2E2J J;  2STT A;  4MHG A;  2EFO A;  4RLQ A;  2J5P A;  5E3O A;  3MEX A;  3EUH C;  2VPR A;  1T98 A;  5HDG A;  3ZMU A;  1TQM A;  4XKW A;  4OIN F;  3CDI A;  1T08 B;  2EH3 A;  2M34 A;  1TQP A;  4E7Z A;  4XRF A;  4IEJ A;  4UVC A;  5ERI A;  2GIV A;  1H0M A;  4CSW A;  2MD0 A;  1RRJ A;  3RTR A;  2ZJR F;  2DOE A;  2UUZ A;  1LB2 A;  2V6E A;  3OIP A;  3PL8 A;  1X58 A;  3C2G A;  1FWZ A;  2VBZ A;  3ZMS A;  2DDB A;  1XCV A;  2KIS A;  3I5U A;  4RAF A;  1POG A;  2R7D A;  2M7B A;  3E6B A;  3ABM H;  4C3H J;  2BOL A;  3VB2 A;  3Q5F A;  2FRH A;  1B72 A;  1YE9 A;  1ULY A;  4XMY A;  5IYC J;  1HXD A;  2UZK A;  4RB1 A;  4BQA A;  1VQ7 I;  2NNN A;  4PFP A;  4A3C J;  1YO5 C;  2LR8 A;  1FP1 D;  1TTY A;  5A2Q Z;  1ZG5 A;  3DTI A;  2Q2E B;  3SYT A;  4IRH A;  1VTN C;  1ZR2 A;  3OYF A;  5FRN A;  3J81 K;  2K9N A;  2XAQ A;  4M3E A;  3AL0 B;  3H9Q A;  2DFF A;  2M5W A;  1JKQ C;  2DYS H;  2NVY J;  2ETH A;  1IDZ A;  5K1Y A;  3OYH A;  2K9L A;  4HLX A;  2PMZ N;  3K7A J;  4XIC A;  3MZY A;  1S7E A;  5E18 F;  2WWY A;  4PFO A;  1FLI A;  2LBF A;  5E3L A;  1DGW Y;  4HG2 A;  1GUU A;  1P2F A;  4V2G A;  2F48 A;  4LB5 A;  2LOO A;  3OMY A;  1FYL A;  3RI4 A;  3HPG A;  5M3M J;  3CO6 C;  2GQQ A;  2ME0 A;  2ZJ2 A;  3LQR A;  3Q9V A;  1K78 B;  1IXC A;  2C6Y A;  2M8G X;  3WU0 A;  4HX8 A;  1EKE A;  2O5R A;  1OR7 C;  2LLK A;  4M3B A;  4PSW A;  3V7R A;  3G1L A;  2XGE A;  3KLO A;  1KU2 A;  2E34 A;  3DBH B;  3SQN A;  4MTE A;  2Z3Y A;  2X6Y A;  3NQO A;  4IO9 F;  4C30 A;  2VC1 A;  1WH5 A;  5DV5 A;  4A3J J;  2VON A;  4MQ9 F;  2RNJ A;  4GCV A;  3CCY A;  2LK2 A;  2P5V A;  2Q2E A;  5FLX Z;  3OS0 A;  2R7Q A;  4FT8 A;  3K70 C;  3BR5 A;  1P4W A;  3S1M J;  3Q0V A;  1FOK A;  3GFM A;  1A36 A;  3BC8 A;  1RI7 A;  1RC9 A;  4LOC A;  3S32 A;  2XAF A;  2Q1Z B;  4RGS A;  4BEH B;  3WTY C;  4XLC A;  3P9K A;  4XKC A;  1ONV A;  2OJE D;  3C18 A;  4RM3 A;  1NHA A;  3CCQ I;  1QZY A;  1ITY A;  1K78 A;  1HLV A;  2EA4 A;  2W48 A;  1D5Y A;  5GPC A;  2M87 A;  2AHQ A;  4PGG A;  1WJF A;  5FB2 A;  1QVU A;  3D5S C;  4Q4Z F;  1FEX A;  1Y8Q B;  1FTT A;  3FXO A;  4LG0 B;  2B9S A;  3FXU A;  2IW5 A;  2BHZ A;  5CJ9 A;  3BZ6 A;  5IT9 Z;  1RIO H;  2DYR H;  4PJL A;  3QP5 A;  2ELJ A;  3WTT C;  1I1S A;  2HWV A;  4ZDO A;  4BQO A;  2HOS A;  1V5F A;  4M9X A;  2KFD A;  4HNU A;  2CO5 A;  1Z9C A;  5E1W A;  2JMW A;  4NNJ A;  3DBL B;  2E2I J;  5L3G A;  4AIK A;  4W97 A;  1A35 A;  2A07 F;  1T33 A;  3BZK A;  4OWR B;  4KMF A;  2EPF A;  4CYD A;  3G6E I;  1V54 H;  2EFW A;  1BW5 A;  2ZME C;  5D8K B;  3HSE A;  5HS8 A;  2XGC A;  1FOY A;  2QSF X;  2DA4 A;  3FX3 A;  3BZC A;  4Q48 A;  3IV5 A;  4N9H A;  3RYP A;  3QOD A;  2IS1 A;  3GFL A;  3A4C A;  3A1Y A;  3HUG B;  4ZZL A;  1FMV A;  1L0O C;  1V5G A;  2XIG A;  2FU4 A;  3GBG A;  4I2O A;  4CGZ A;  1MJB A;  2V9V A;  5K5R A;  3FXK A;  1VND A;  2EZI A;  3OL3 A;  1B9N A;  5D5V B;  1S7A A;  3J81 Z;  4KFC A;  1SFE A;  4XRS A;  2CFO A;  2BXY A;  2EV6 A;  2XPV A;  2E19 A;  4BJ5 C;  3FXR A;  1YIJ I;  4LG0 A;  1PP8 F;  4BXU A;  1XCB A;  3L00 A;  1FBS A;  5LBQ A;  2VIX A;  5ICG A;  3BCA A;  1OLT A;  1PDN C;  1RNL A;  2PBI A;  1UEL B;  3WHB A;  3JRB A;  2JRM A;  2JUG A;  2VJJ A;  3HEF A;  2XF6 A;  5CKT A;  3HRT A;  2M30 A;  3JRA A;  3FK6 A;  3K9T A;  1T38 A;  2BV6 A;  4FTH A;  2CGP A;  5CVR A;  3MZ8 A;  2R4G A;  4BL0 B;  1FYM A;  2L01 A;  1WKM A;  4RMN A;  1ZGJ A;  2ZC2 A;  5FRM A;  2NS8 A;  2VB6 A;  1F36 A;  5EEH A;  1K61 A;  4HZF A;  3HUG A;  5EZG A;  4Y17 A;  3ZMD A;  4HNV A;  5GTH C;  4FCY A;  1SFO J;  1LFU P;  2DA6 A;  4BKX A;  5LFA A;  3JRF A;  3RIR A;  5K5O A;  2Y9Y A;  4CDG A;  1XC5 A;  3HRS A;  3PFI A;  1RUO A;  4RB2 C;  1R1T A;  2AXT C;  1IAW A;  1FTZ A;  5CQE A;  3FXQ A;  3H5N A;  4DZP A;  2P6S A;  4A3M J;  4AU7 A;  4Z6Y A;  1KYZ A;  1Z05 A;  1IC8 A;  2V6C A;  2JA8 J;  2VUM J;  2HZT A;  4GRI A;  3V7C A;  2W1O A;  2M2E A;  3G3Z A;  3OYG A;  3VEP A;  3GTM J;  2V9K A;  3FK7 A;  4P55 A;  4D5F A;  1T95 A;  2WC2 A;  2P7C B;  1D0Y A;  3BJ6 A;  4DZJ A;  1WJC A;  2IGK A;  3PSI A;  2Y0M A;  1E2X A;  1RR8 C;  3DQV C;  3JRH A;  2HDD A;  2MYS A;  5IP7 J;  1MJ9 A;  1J75 A;  1HDD C;  4PZJ A;  1WH7 A;  2HVS A;  3TED A;  5J6X A;  2OQG A;  3CCS I;  1OCP A;  1VQM I;  1UG0 A;  2R7R A;  4HOB A;  4D1Q A;  2QSG X;  1TW3 A;  4AID A;  3TQN A;  3ZQL A;  2MSY A;  4LIU A;  1D1B A;  1J09 A;  1HKQ A;  4OAZ A;  5EF6 A;  2KIQ A;  2ZJP F;  4IF4 A;  2DOD A;  4XK4 A;  1CF7 A;  1K83 J;  2CW0 F;  2OTJ I;  3M1C A;  4YII A;  2LSO A;  1KQ9 A;  3BWG A;  3LL7 A;  2BE5 F;  1W36 C;  4UHT A;  4XNF A;  5D6E A;  2WTE A;  1EV7 A;  4G7H F;  2V1U A;  3TGN A;  3MD2 A;  1JGS A;  2DA3 A;  2R7F A;  5ED4 A;  1ZRF A;  1ZG1 A;  1P7I A;  1X2M A;  1MBJ A;  1T56 A;  4BUP A;  3S2W A;  3IAS 2;  3IKV A;  2CV2 A;  1I6X A;  2NS0 A;  4X1E A;  2A68 F;  3GW2 A;  5JHF A;  3TOB A;  1LEB A;  5B3S H;  4C3J J;  4DYQ A;  2DK8 A;  1IN4 A;  2JVG A;  2K3F A;  4I99 C;  1J0R A;  4KT6 A;  2EIL H;  1WVR A;  3O8G A;  1MSE C;  3HOU J;  4EV0 A;  1XGN A;  2CJJ A;  4JYK A;  3C2B A;  1H9G A;  1XGM A;  1MH3 A;  3DP7 A;  4Y13 A;  3BR3 A;  4UB6 C;  4A6D A;  5DUK A;  2F4I A;  2RN7 A;  4E7K A;  2HNH A;  1X1D A;  5JHU A;  4CYC B;  1XB4 A;  4PJJ A;  5GTI C;  3E5U A;  1IN6 A;  3N4M A;  3I56 I;  4E7L A;  5DCM B;  1SVO A;  1T0F A;  1YFH A;  1BR2 A;  1OFC X;  4ABZ A;  3WOD F;  1QO0 D;  3HKZ N;  4P5O A;  2X1D A;  3CC2 I;  1H8A C;  4Y4R A;  4I76 A;  2YUS A;  1PJR A;  4I7H A;  4MO7 A;  4RAY A;  3L2Q A;  3ASN H;  5LEJ A;  1YS7 A;  3HRM A;  1J5Y A;  3FIS A;  3DKY A;  4EJO A;  2RKH A;  1YYV A;  1ZGA A;  3PO3 J;  2B0L A;  2JA2 A;  5E3N A;  2RGV A;  3KEY A;  3R60 A;  4BXX J;  4CCJ A;  1ON1 A;  5J47 A;  4BNC A;  4IHV A;  2CQN A;  2JRT A;  3F21 A;  2YS9 A;  2A3S A;  5BQT A;  4GYG A;  3WE3 A;  5BS6 A;  1ZTR A;  1NK2 P;  2K5C A;  2ZSH B;  2CV1 A;  3UNG C;  2LFB A;  4II2 A;  1U2W A;  4HX4 A;  4CYC A;  1FYK A;  1R1V A;  1D5V A;  2NXN B;  3S14 J;  2BY1 A;  2W00 A;  3F6O A;  5DCM A;  3ERE D;  3LSK A;  4BDY A;  2EA2 A;  4OOI A;  1Z6R A;  2VJI A;  4R1H A;  2HKO A;  4AM3 A;  1FPQ A;  2HQA A;  3JTG A;  3WTS C;  1O4X A;  1JT0 A;  4F92 B;  1ZHF A;  2KJB A;  2PMU A;  1U6G A;  2K9Q A;  5LLQ A;  5KNL A;  1ZRE A;  4TV7 A;  1DUX C;  4HQE A;  3ONQ A;  4V2F A;  1GT0 C;  3CLO A;  1TL8 A;  5AIQ A;  3GTO J;  2GXG A;  4BDZ A;  1BR4 A;  3FMQ A;  1UFM A;  1IXS B;  3CJT B;  3K4M A;  2EFP A;  2DOA A;  3JW4 A;  3KCC A;  5LGN A;  3ASO H;  3HSF A;  4F52 A;  4CHU A;  3HSR A;  4HBL A;  2WB1 N;  3BCB A;  2H1K A;  5FFX A;  2LY9 A;  1SD4 A;  3PUB A;  3VSK A;  5M3F J;  1EH6 A;  3V7S A;  4XBF A;  3RKX A;  4OIO F;  2HZD A;  4MFD A;  3VYU B;  1MKM A;  1SFU A;  4YG2 F;  3GYH X;  3FM3 A;  4WWC A;  1LPQ A;  4IL6 C;  2ID3 A;  4RAZ A;  5JVT A;  2DMN A;  2L7M P;  1HDP A;  1O7F A;  2STW A;  3HB9 A;  1REP C;  3ABK H;  2IT0 A;  3KYD B;  2VC0 A;  3FM5 A;  3RCO A;  1EA3 A;  1R4N B;  1W5S A;  2K85 A;  2WV0 A;  2Z1D A;  5D5X B;  5HLG A;  3BTI A;  4JX4 A;  2Q8K A;  1BIB A;  3BLY A;  1GVJ A;  3KYC B;  4BQN A;  3F22 A;  1Y1W J;  3BT9 A;  3EQL F;  4A3I J;  1X4P A;  2MFZ A;  2GM4 A;  4RAG A;  4P9F A;  4PJ0 C;  5J4Y A;  2Y2Z A;  3W6J B;  3TO9 A;  2RQQ A;  4CA0 A;  3L09 A;  5HLH A;  2M4K A;  2VKH A;  1DPR A;  4U0V A;  2Z99 A;  5HDN A;  3BQZ A;  2P5K A;  5CYV A;  1MDM B;  4IQ4 A;  2XAS A;  5FLV A;  1AHD P;  5LHG A;  4HYE A;  2H8R A;  5IOY A;  5D4S A;  3FXL A;  1TP4 A;  1I1G A;  1MMA A;  2O03 A;  5DTD A;  5BPD A;  3S1R J;  1MMS A;  3CCR I;  2XSD C;  5E17 F;  3P7N A;  5BNG A;  1QHH D;  4KJZ A;  3ZOB A;  5K7Z A;  1KU3 A;  4IQJ A;  2HDW A;  2IGO A;  1G2H A;  1CQT A;  4ETS A;  4FX0 A;  4II3 A;  3ZRG A;  4HRI A;  4ITV A;  2P8T A;  2M9H A;  4XRM A;  3T8R A;  1W0U A;  3CZ6 A;  1LFB A;  2LMD A;  3HOY J;  3LSI A;  1VQ9 I;  3TMO A;  4BHP A;  3LSJ A;  2CH0 A;  1X19 A;  2XGD A;  4KIB A;  4XKB A;  3RQ4 A;  1A6I A;  4ENM A;  1MDM A;  3OL4 A;  2M0C A;  1RKT A; 
#chains in the Genus database with same CATH homology
 4HAM A;  3FHZ A;  2P4W A;  1HW2 A;  1Z1D A;  2RVC A;  3DXJ F;  5ICC A;  5IT3 A;  3IC7 A;  2Z5U A;  3BP8 A;  3HTU A;  3QU6 A;  2XV4 S;  1WI9 A;  4M72 A;  4M6X A;  4JQF A;  2FBH A;  2MA3 A;  2XHK A;  3O3K A;  4OMY A;  1U5T C;  1C0W A;  4MTD A;  5D4R A;  1ZH5 A;  3GUD A;  2Z9O A;  4ZYH A;  5ILS A;  3V4G A;  5FLX K;  2E7W A;  4R8H A;  3T1B A;  1AOY A;  1S7O A;  1ZRD A;  3V8K A;  4M71 A;  2DQL A;  3DEU A;  2OZU A;  4E70 A;  1HKT A;  3WTW C;  2AS5 F;  2MLK A;  3RDI A;  1YQA A;  1O7L A;  2IA2 A;  4M9Z A;  3TO6 A;  1IXR C;  4G7Z F;  1I5Z A;  4XSZ F;  2KJC A;  5CLS A;  2IA1 A;  4B09 A;  5IT9 K;  2OU2 A;  3BY6 A;  1Z91 A;  3QRF F;  1XN7 A;  1D3Y A;  3ROU A;  5FFZ A;  1R7J A;  3F23 A;  2Q0O A;  3J80 Z;  1DDN A;  4HF1 A;  2LKP A;  2RV8 A;  4I98 B;  3SZT A;  4ESJ A;  2OAZ A;  3SXY A;  5E8G A;  2QQB A;  4DNC A;  3ZPL A;  1ON2 A;  3I64 A;  4MEX F;  4RGX A;  2K27 A;  1RUN A;  1TNS A;  4N9I A;  2QWW A;  1YTY A;  1G3S A;  2O0Y A;  3PQK A;  4LB6 B;  2DI3 A;  2A6H F;  2QLZ A;  1BI3 A;  1BIA A;  2A5Y B;  2ZCW A;  4EMS A;  3VFZ A;  5L3D A;  3WTU C;  2YX4 A;  1LDJ A;  1IN7 A;  3MWM A;  1BN5 A;  1K6O A;  4HW0 A;  4ENJ A;  1CGP A;  3ABU A;  3GFJ A;  1B6A A;  1PP7 U;  1OYW A;  4KT5 C;  3WG9 A;  1SD7 A;  4L5J A;  4RGU A;  2PI0 A;  4Q47 A;  5F6F A;  4Q5S F;  1TW2 A;  4IVN A;  2DPD A;  4S05 A;  2FE3 A;  2AXL A;  2HTS A;  4BAY A;  1KA8 A;  4L5I A;  4CO8 A;  1FSH A;  1F1Z A;  1PUE E;  3P9C A;  2YSR A;  2HQN A;  3KET A;  3CUQ B;  3CO7 C;  1FC3 A;  4L9J A;  1S3J A;  2ESN A;  3W6K B;  4HV6 A;  4RB0 A;  1GXP A;  3WTV C;  4PDK A;  4RGR A;  1UHM A;  3I71 A;  3ELK A;  2CG4 A;  1QBJ A;  1BI2 A;  2YR2 A;  4UV9 A;  1S29 A;  1RZ4 A;  2MH9 A;  2VN2 A;  2VOO A;  4KIC A;  1J9I A;  2JT1 A;  3KP2 A;  4KA4 A;  4YFX F;  4ZYG A;  5FGM A;  2OA4 A;  3QOP A;  2ZME B;  3K1N A;  2HR3 A;  1L3L A;  1UB9 A;  2L4A A;  3DKW A;  3HHG A;  1G3T A;  3IL2 A;  1BC7 C;  1S8N A;  1ZAO A;  2JZY A;  2FBI A;  4N0B A;  5HS7 A;  3I4P A;  1H9T A;  3CUQ A;  1ZRC A;  4WK8 F;  1SAX A;  2K7L A;  3PQJ A;  1T6S A;  4O6J A;  2H6B A;  3TO7 A;  3J7A O;  3ZMT A;  1UHW A;  1O3S A;  3K1P A;  5J8C A;  5DYM A;  1KU7 A;  1G4D A;  2NRA C;  1U3E M;  3EYY A;  3LA7 A;  3BPX A;  3KE2 A;  4ENN A;  2ZME A;  2G7H A;  3U2R A;  2EJR A;  2FMY A;  4RB3 C;  2MBF A;  4HA8 A;  4EJW A;  1Z6T A;  2JSC A;  3OOP A;  3P9I A;  1KYW A;  3T5X A;  3V8J A;  2IA0 A;  4HDU A;  3K1M A;  4WXC A;  2EFN A;  3KEQ A;  3ZMV A;  1XGS A;  1LJ9 A;  4NHJ A;  2PFB A;  3GXO A;  3I54 A;  3LA3 A;  3GEZ A;  1F5T A;  4XLP F;  4BYY A;  1A04 A;  4K2E A;  3F6V A;  1W7P D;  4EM0 B;  2V1D A;  5H20 A;  2GA1 A;  1K79 A;  2Y48 A;  2K4B A;  5ILU A;  4LMY A;  3HYI A;  1EH7 A;  5FD6 A;  3WU1 B;  2F5E A;  2PG4 A;  2HYG D;  1Z7U A;  2CYY A;  2F5C A;  2F5F A;  3FWE A;  1AWC A;  1F9N A;  2M1B A;  4YFK F;  1FX7 A;  3HRU A;  2HGC A;  3M7G A;  2PQ8 A;  1OMI A;  1R5H A;  3WTX C;  3LAP A;  4LLN A;  5HLI A;  4O5V A;  1XSV A;  4UVA A;  3BDD A;  2KIF A;  4FX4 A;  3ISP A;  3QPT A;  3R4K A;  1DP7 P;  3R0A A;  3I0T A;  5LEK A;  2A6E F;  3B02 A;  3GX4 X;  3GZ6 A;  1ZN2 A;  4IRI A;  1B9M A;  4KIF A;  4AD9 A;  3FMR A;  5LRR A;  4WF2 A;  4G6D A;  2VBW A;  1IN5 A;  1YG2 A;  2E1C A;  5CVJ A;  4LFU A;  3GLX A;  3EYI A;  2D1V A;  4AWX B;  2ELH A;  5F1R A;  3VOD A;  2HTJ A;  2P5L C;  1USS A;  2W85 A;  3KLN A;  1B59 A;  5E8I A;  2DAO A;  2BGC A;  1G3W A;  4EGY A;  2XKP A;  1F4K A;  4U0Y A;  1K7A A;  2YX7 A;  1G6N A;  2DU9 A;  1LDK B;  1FT9 A;  1J59 A;  2L02 A;  4F7Z A;  3EET A;  1KQ8 A;  5CVV A;  2V1X A;  3R6S A;  4LD5 A;  1Q1H A;  1R00 A;  2VE8 A;  3ZP5 A;  2F2E A;  3RJP A;  5J8F A;  2VT3 A;  3ECO A;  1W5T A;  1P6R A;  4LK0 F;  2H09 A;  4ZZD A;  5K5Q A;  1IUY A;  1XDS A;  1R36 A;  1YW9 A;  4P96 A;  4B8X A;  5D5U B;  4CIC A;  4KN4 X;  2JPC A;  2QQ9 A;  4UXN A;  4A5N A;  3JAM Z;  1TBX A;  1D8J A;  1T2K A;  4L0Z B;  3R0J A;  4WX9 A;  3ZMZ A;  2K02 A;  5KVR A;  1E17 A;  3SHF A;  2KKO A;  3D0S A;  3RKW A;  2QZ8 A;  3CTA A;  5KK1 A;  1STZ A;  2FML A;  2V79 A;  5H6Q A;  3TDZ C;  4EVI A;  2OBP A;  4EJT A;  4Z2Y A;  3E97 A;  2HKX A;  2DO7 A;  5ICE A;  2IRF G;  4IXA A;  2EV5 A;  5E20 A;  3LQQ A;  3J80 K;  4UNO A;  4DQ2 A;  3REO A;  1FBU A;  4XSX F;  3IWZ A;  1TQI A;  5BOX A;  5HDK A;  1P92 A;  3BRO A;  4U88 A;  4L9T A;  2BYV E;  3SFZ A;  3IRR A;  2IPQ X;  2FEZ A;  2DT5 A;  3F8B A;  3F8F A;  2JTV A;  4ZYD A;  4LJZ F;  5HVQ C;  1FY7 A;  3WGI A;  2G9W A;  2FXA A;  2KRF A;  6PAX A;  1ZG3 A;  5TJJ A;  3KP7 A;  1ZAR A;  4H0E A;  4A0Z A;  2ZFW A;  1R22 A;  1GXQ A;  5BPI A;  3IRQ A;  2H6C A;  2HOE A;  2MC3 A;  5FO5 A;  2FF4 A;  4EJU A;  4KMU X;  3SZP A;  4OIQ F;  4U7D A;  3IWF A;  2CFX A;  5L3F A;  5L3E A;  4WXH A;  2K4J A;  1HW5 A;  3L7W A;  4IHT A;  2W25 A;  1R1U A;  2ZXJ A;  2CWE A;  2EK5 A;  3DFG A;  5JI6 A;  2P7V B;  4IHS A;  2DLL A;  2QQA A;  2LDU A;  1SMT A;  1XSX A;  4U0W A;  1J7K A;  1OKR A;  3U1D A;  3LAJ A;  4OU0 A;  2FOK A;  1YLF A;  3KFW X;  3HOT A;  3ECH A;  1B4A A;  3ML6 A;  1R23 A;  1DPU A;  4IRG A;  4EM2 A;  2O3F A;  2Y75 A;  3DF8 A;  2ISZ A;  5D5W B;  3V8L A;  1YW7 A;  2XVC A;  2D1H A;  3CJN A;  4ON0 A;  2DK5 A;  3MCZ A;  4M6Y A;  4A6E A;  5ICF A;  3C3W A;  2QM3 A;  2VOP A;  2NYX A;  2FNA A;  3FMS A;  3QU3 A;  4QLC U;  2UXN A;  2XKO A;  2O6G E;  2PJP A;  1IF1 A;  1IW7 F;  2EV0 A;  1W7P B;  2D2W A;  3WGG A;  4BHB A;  5TRD A;  4P9U A;  4GO1 A;  4OIP F;  5JFR A;  1KGS A;  3WGH A;  4HX7 A;  3QP6 A;  2BEO A;  1QZZ A;  1KU9 A;  1O3R A;  1FP2 A;  1OPC A;  4WCG A;  1SMY F;  5JR3 A;  2VT2 A;  1WSU A;  3E6D A;  3EUH A;  1XDU A;  2XUB A;  4ESB A;  1JE8 A;  4CXF A;  1WRJ A;  2OD5 A;  3M1E A;  2IVM A;  2ZNY A;  4HDV A;  2HQR A;  2IJL A;  3O6B B;  2G7U A;  1SFX A;  3GFI A;  3FF5 A;  5DCF A;  1W7P A;  1YIO A;  1MD0 A;  3K69 A;  1LVA A;  2FBK A;  2JPB A;  3KZZ A;  4EM1 A;  2P6T A;  3F8M A;  3HHH A;  2X4H A;  1LNW A;  3MZH A;  4UVB A;  5LHI A;  1LDD A;  2DTR A;  2RQP A;  4ASN A;  1ZLJ A;  1T39 A;  5DD4 A;  2LF8 A;  2LF7 A;  4PCQ A;  4GXO A;  2EWN A;  5DEQ A;  4UUV A;  5LGT A;  3MAJ A;  3CUQ C;  4GGG A;  2J5O A;  4LLG F;  1OR7 A;  5D8L B;  2GZW A;  5LGU A;  1O3T A;  2PLY A;  3KP6 A;  4KUM A;  3DPT A;  2QYO A;  3F3X A;  2O8X A;  3C7J A;  4Y15 A;  1ZYR F;  3GWZ A;  3F8C A;  1QPM A;  3OV8 A;  1XSD A;  1Y0U A;  2QBY B;  1BI0 A;  1D8K A;  4CZZ A;  2ACJ A;  4I0B A;  5EEG A;  1HW1 A;  2QEN A;  3RPU A;  2BBY A;  2RDP A;  1P4A A;  3IHU A;  4YIF A;  2D45 A;  4A5M A;  4JBA A;  2MLG A;  4KNY A;  3HIF A;  4O3M A;  2FQ3 A;  3O2P E;  1EH8 A;  4EGZ A;  3QAH A;  3IKT A;  3E6C C;  4ENK A;  2QBY A;  2DFI A;  4MNU A;  1JHF A;  3KP5 A;  4BH9 A;  1B1B A;  1U8R A;  3AAF A;  4KDP A;  2VE9 A;  2FSW A;  5AIP A;  1CF7 B;  4AIJ A;  3MQ0 A;  4ZYE A;  4A0X A;  1P4X A;  3NRV A;  5DUI A;  1HSJ A;  2DW4 A;  1I27 A;  1XGO A;  5BMZ A;  3M9A A;  4I02 A;  4HF2 A;  1R5G A;  2GWR A;  1JXS A;  3QPH A;  4HQM A;  3FZV A;  3DPL C;  3M8E A;  5DD8 A;  3B73 A;  4AVP A;  3GVA A;  1O57 A;  2H94 A;  3LFK A;  1BBY A;  4A2U A;  2ISY A;  5F64 A;  3M8F A;  4G9Y A;  1UCR A;  3F72 A;  2UXX A;  4LLL A;  1MJA A;  2GA2 A;  3VOE A;  3CDH A;  5HOO A;  5LRS A;  2XAJ A;  3I59 B;  5E1Z B;  1G3Y A;  2UWM A;  3JAM K;  3E5Q A;  2KIM A;  1YS6 A;  4S04 A;  2DQR A;  1BC8 C;  1SD5 A;  4PGH A;  1HST A;  2HFH A;  3RPQ A;  4L9V A;  3TDU C;  2GAU A;  4LGW A;  4WXD A;  3JSO A;  2E7X A;  4G8X A;  2E1N A;  4JK1 X;  4LK1 F;  4KYW A;  2VXZ A;  4L9N A;  1QQI A;  2F5D A;  3D5L A;  4KN7 X;  1HKS A;  4ESF A;  4IJA A;  2XAG A;  2ZNZ A;  4EJV A;  2MD5 A;  5E1X A;  3RKY A;  1IN8 A;  2VBY A;  2W24 A;  1J2X A;  3I59 A;  4D0P A;  2L3D A;  2QUF A;  3HOS A;  4MGR A;  2IP2 A;  4HV5 A;  5L3C A;  1LQ1 A;  3ABT A;  2VOD A;  1MZB A;  2W84 A;  4M9S A;  3E3V A;  2LNB A;  3H92 A;  4M74 A;  4L18 B;  3L2C A;  2Z33 A;  2DBB A;  1IRG A;  4KIG A;  3I58 A;  3TOA A;  4NQW A;  3KZY A;  3T8T A;  2H27 A;  4ZH4 F;  1FZP B;  4QWQ A;  3JSP A;  2GXB A;  4BHC A;  2O61 A;  2NNY A;  1X3U A;  1BOA A;  2PN6 A;  2ADU A;  2PMH A;  3GZ5 A;  2XRN A;  3N97 A;  2M8E A;  1JHH A;  2M45 A;  3WE2 A;  3I53 A;  1V4R A;  1S6L A;  2YPR A;  2ESH A;  2HDC A;  1WWX A;  1R58 A;  3C1D A;  1QGP A;  5L3B A;  4G6Q A;  3H3Z A;  1BM9 A;  4I09 A;  4MEY F;  2CQK A;  4OMZ A;  1OYI A;  2YU3 A;  2XGX A;  4L0Y B;  3RYR A;  2DPU A;  3BJA A;  3L9F A;  3CUO A;  3Q9S A;  1FNN A;  5DDG A;  1IZ1 A;  2L54 A;  2TDX A;  4RS8 A;  3ZN1 A;  1UST A;  1XMA A;  3COA C;  4I01 A;  3EDP A;  4I0A A;  2OZ6 A;  2ZBK A;  5CVI A;  4FHT A;  5HS9 A;  1LEA A;  1O3Q A;  2A69 F;  4M73 A;  4IPA A;  1YW8 A;  1V3F A;  4OIR F;  1XD7 A;  5FD5 A;  4YFN F;  2RC4 A;  2A61 A;  5CVU A;  2XRO A;  1ZLK A;  3KP4 A;  2NAZ A;  2X0L A;  1FSE A;  4UV8 A;  3BJO A;  3HTS B;  5H6R A;  3ZN0 A;  1TLH B;  1MGT A;  4A12 A;  2PEX A;  3K2Z A;  2KIU A;  3LST A;  3ZQ7 A;  1KQ0 A;  2L4M A;  2VBX A;  3G73 A;  5LHH A;  4G7O F;  3K0L A;  1FBQ A;  2XAH A;  1OYY A;  4GYI A;  4G94 A;  5A2Q K;  2R3S A;  2EFQ A;  2HYF A;  2K86 A;  4AIH A;  3GO5 A;  1HQC A;  3TKY A;  3E6M A;  3BPV A;  1XMK A;  2CSO A;  2ZO4 A;  2QVO A;  3GF2 A;  2HS5 A;  3JTH A;  2ZKZ A;  4U7B A;  3H3U A;  1U78 A;  5AON A;  1IRF A;  2COM A;  4HLY A;  1U5T B;  4R79 A;  2MH2 A;  4HF0 A;  4EQQ A;  3LA2 A;  3MFK A;  1GHC A;  1TNT A;  2FA5 A;  4NB5 A;  1ODD A;  2FNP A;  1BI1 A;  2W57 A;  3LWF A;  3BOQ A;  3KP3 A;  1HBX G;  4A0Y A;  1W4M A;  3KEO A;  1SD6 A;  1WQ2 A;  3WTZ A;  3NEU A;  5D6F A;  5ILV A;  2HEO A;  2OQR A;  3DV8 A;  2EB7 A;  3T0Y A;  3F8N A;  1QNT A;  3ULQ B;  4XLN F;  4MQV A;  1U5T A;  3U9G A;  3R61 A;  1BJA A;  3E5X A;  2STT A;  4MHG A;  2EFO A;  2J5P A;  3MEX A;  1T98 A;  5HDG A;  3ZMU A;  1TQM A;  4OIN F;  1TQP A;  4XRF A;  4UVC A;  5ERI A;  2GIV A;  1H0M A;  3RTR A;  1LB2 A;  1FWZ A;  2VBZ A;  3ZMS A;  3I5U A;  1XCV A;  2R7D A;  3E6B A;  3VB2 A;  3Q5F A;  2FRH A;  1ULY A;  1HXD A;  2UZK A;  4RB1 A;  4BQA A;  2NNN A;  1YO5 C;  1FP1 D;  1TTY A;  5A2Q Z;  1ZG5 A;  4IRH A;  1VTN C;  3J81 K;  2XAQ A;  2M5W A;  2ETH A;  5K1Y A;  4HLX A;  3MZY A;  5E18 F;  2WWY A;  1FLI A;  1P2F A;  4LB5 A;  1FYL A;  3RI4 A;  3CO6 C;  2GQQ A;  2ZJ2 A;  3LQR A;  3Q9V A;  1K78 B;  1IXC A;  2C6Y A;  3WU0 A;  4HX8 A;  3V7R A;  3KLO A;  1KU2 A;  3SQN A;  4MTE A;  2Z3Y A;  3NQO A;  2VC1 A;  5DV5 A;  2VON A;  4MQ9 F;  2RNJ A;  4GCV A;  2P5V A;  2Q2E A;  5FLX Z;  4FT8 A;  1P4W A;  1FOK A;  3GFM A;  1RI7 A;  2XAF A;  3WTY C;  4RGS A;  3P9K A;  1ONV A;  3C18 A;  1NHA A;  1QZY A;  1K78 A;  2EA4 A;  2M87 A;  4PGG A;  5FB2 A;  4Q4Z F;  4LG0 B;  3FXU A;  2IW5 A;  5CJ9 A;  3BZ6 A;  5IT9 Z;  1RIO H;  3QP5 A;  3WTT C;  1I1S A;  2HWV A;  4M9X A;  1Z9C A;  2CO5 A;  5E1W A;  5L3G A;  4AIK A;  2A07 F;  4KMF A;  4CYD A;  2EFW A;  5HS8 A;  5D8K B;  3HSE A;  3FX3 A;  4Q48 A;  4N9H A;  3RYP A;  3GFL A;  4ZZL A;  1L0O C;  2XIG A;  2FU4 A;  4I2O A;  4CGZ A;  1MJB A;  2V9V A;  5K5R A;  1B9N A;  5D5V B;  1S7A A;  3J81 Z;  4KFC A;  1SFE A;  2EV6 A;  3FXR A;  4LG0 A;  1PP8 F;  4BXU A;  1XCB A;  3L00 A;  1FBS A;  5LBQ A;  5ICG A;  1PDN C;  1RNL A;  2PBI A;  3HRT A;  2M30 A;  3K9T A;  1T38 A;  2BV6 A;  2CGP A;  5CVR A;  1FYM A;  2L01 A;  1WKM A;  1ZGJ A;  5EEH A;  4HZF A;  3HUG A;  4Y17 A;  3ZMD A;  3RIR A;  5K5O A;  4CDG A;  3HRS A;  3PFI A;  1RUO A;  4RB2 C;  1R1T A;  1IAW A;  3FXQ A;  2P6S A;  1KYZ A;  1Z05 A;  2V6C A;  2HZT A;  3V7C A;  3G3Z A;  3VEP A;  4P55 A;  2WC2 A;  2P7C B;  3BJ6 A;  2Y0M A;  1E2X A;  3DQV C;  1MJ9 A;  1J75 A;  4PZJ A;  5J6X A;  2OQG A;  4HOB A;  1TW3 A;  3TQN A;  1HKQ A;  4IF4 A;  1CF7 A;  2CW0 F;  4YII A;  2LSO A;  1KQ9 A;  3BWG A;  2BE5 F;  4UHT A;  5D6E A;  2WTE A;  1EV7 A;  4G7H F;  2V1U A;  3TGN A;  1JGS A;  2R7F A;  5ED4 A;  1ZRF A;  1ZG1 A;  3S2W A;  3IKV A;  1I6X A;  2NS0 A;  2A68 F;  3GW2 A;  3TOB A;  1LEB A;  2DK8 A;  1IN4 A;  1J0R A;  4EV0 A;  1XGN A;  1H9G A;  1XGM A;  3DP7 A;  4Y13 A;  4A6D A;  5DUK A;  2RN7 A;  5JHU A;  1XB4 A;  3E5U A;  1IN6 A;  3N4M A;  5DCM B;  1T0F A;  1YFH A;  3WOD F;  1QO0 D;  4P5O A;  4I7H A;  4RAY A;  5LEJ A;  1YS7 A;  3HRM A;  1J5Y A;  4EJO A;  2RKH A;  1YYV A;  1ZGA A;  2B0L A;  2RGV A;  3R60 A;  1ON1 A;  4BNC A;  2JRT A;  3F21 A;  2A3S A;  5BQT A;  4GYG A;  3WE3 A;  5BS6 A;  1U2W A;  4HX4 A;  1FYK A;  1R1V A;  1D5V A;  3F6O A;  5DCM A;  3ERE D;  2EA2 A;  4OOI A;  1Z6R A;  4R1H A;  2HKO A;  1FPQ A;  3JTG A;  3WTS C;  1ZHF A;  2KJB A;  2PMU A;  1U6G A;  5LLQ A;  1ZRE A;  4TV7 A;  1DUX C;  4HQE A;  3CLO A;  5AIQ A;  2GXG A;  3FMQ A;  1UFM A;  1IXS B;  2EFP A;  3JW4 A;  3KCC A;  5LGN A;  3HSF A;  4CHU A;  3HSR A;  4HBL A;  5FFX A;  1SD4 A;  1EH6 A;  3V7S A;  4XBF A;  3RKX A;  4OIO F;  1SFU A;  1MKM A;  4YG2 F;  3GYH X;  3FM3 A;  4WWC A;  4RAZ A;  5JVT A;  1O7F A;  2STW A;  1REP C;  2IT0 A;  2VC0 A;  3FM5 A;  1W5S A;  5D5X B;  2WV0 A;  5HLG A;  2Q8K A;  1BIB A;  3F22 A;  1GVJ A;  3EQL F;  4P9F A;  3W6J B;  3TO9 A;  5HLH A;  3L09 A;  1DPR A;  4U0V A;  2Z99 A;  5HDN A;  1MDM B;  2P5K A;  5CYV A;  2XAS A;  5LHG A;  4HYE A;  5D4S A;  1I1G A;  2O03 A;  5BPD A;  5E17 F;  3P7N A;  1KU3 A;  4ETS A;  4FX0 A;  2P8T A;  3T8R A;  4BHP A;  4KIB A;  4ENM A;  1MDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...