4L0ZB

Crystal structure of runx1 and ets1 bound to tcr alpha promoter (crystal form 2)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
101
structure length
101
Chain Sequence
SGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
publication title Structural basis of Ets1 activation by Runx1.
pubmed doi rcsb
source organism Mus musculus
total genus 33
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l0zB00
1HKQA 2CG4A 2IVMA 2K02A 1GHCA 2PMHA 5FD6A 2KRFA 3KP5A 4I02A 3J80K 1MJAA 2IA0A 1PP8F 1XMAA 1DPRA 4UVBA 2G7UA 1R22A 1HBXG 3MFKA 1P2FA 3V7SA 3KZZA 3L09A 5E8IA 2YSRA 4U7BA 1ODDA 1ZARA 2B0LA 2LSOA 2JPCA 5D8LB 1HSTA 3GYHX 1YQAA 4AVPA 3KP3A 2ISYA 4KICA 3HRTA 3T5XA 1U3EM 2WTEA 2ESNA 3BY6A 5CVVA 2P5KA 1F9NA 1B6AA 2ZNYA 2PI0A 3O3KA 3DPTA 2QUFA 5DD4A 4F7ZA 2GZWA 5LRSA 4RB3C 4Q48A 4A5NA 5E17F 1CF7A 5ICGA 5ICFA 3DP7A 4I01A 5LEJA 1S7OA 2V6CA 5F6FA 1OKRA 4YFXF 5FGMA 1BJAA 4CDGA 4A12A 1ON2A 1SFUA 2Z9OA 4LG0B 3BJAA 1TNSA 3E5QA 3M1EA 2Z5UA 4ESFA 2P5LC 4AWXB 3U1DA 3FF5A 1XSVA 3WGGA 4GO1A 4WXCA 5F1RA 5D8KB 2IT0A 1U6GA 4Q4ZF 3WTUC 3GO5A 1F5TA 3KEQA 1HW1A 4KNYA 3RKWA 4JBAA 5IT9Z 1W7PA 3ABUA 5DCMA 5CJ9A 1BC8C 3K69A 1SD4A 4P96A 2EFOA 2L4MA 4HX4A 1IXCA 1XCVA 2ELHA 2BEOA 4A5MA 1YYVA 1YIOA 1U5TC 2STTA 5E18F 4G7HF 3Q9SA 1WRJA 2DO7A 1S29A 4I0AA 2JTVA 5DV5A 3CJNA 2NNNA 2QENA 1FT9A 2OAZA 5DUIA 3E6DA 5EEGA 3VEPA 4CHUA 2XIGA 4AIKA 2R3SA 5D5WB 5HLHA 2VONA 3FZVA 1J0RA 3W6KB 3V7RA 2QQAA 4YFKF 4HAMA 2QLZA 2V1UA 5JI6A 3HRUA 2VT3A 3KCCA 2GXGA 2EV6A 2PN6A 3CO6C 4OINF 1KU3A 5IT3A 4FT8A 4HOBA 4L0ZB 4UV9A 2EB7A 2M5WA 4IRIA 3HIFA 1BI1A 3HSFA 2JRTA 1ZGAA 3V7CA 3E3VA 1T38A 1SMYF 1MGTA 1WI9A 2RV8A 1O3QA 4HLYA 2FBKA 4L9VA 3LA2A 2HTJA 2LNBA 1ZG1A 3ZPLA 2DQRA 5DD8A 1AOYA 5LGTA 2GA2A 3HTSB 3RPQA 1R5HA 3R0JA 3F6VA 5DYMA 1UB9A 3KLOA 2FRHA 4UNOA 4MEXF 2R7FA 1IN7A 1O3TA 1R36A 2Q0OA 2HQNA 4HZFA 1ZRFA 4IHTA 1C0WA 4EV0A 3IRQA 2YU3A 3CUOA 3E5UA 3GZ6A 2VOOA 2ETHA 1HQCA 1IRGA 5BS6A 1W7PD 3FXUA 3CO7C 5D5UB 2RVCA 1CF7B 1BIAA 4WF2A 4EM2A 1K78A 1T98A 2ZBKA 1T39A 4CZZA 4XBFA 3HUGA 2Y75A 1XB4A 1R7JA 2FQ3A 1W4MA 2PQ8A 1O7LA 1SD5A 3RDIA 4BAYA 1TQPA 4GCVA 2HS5A 3F8CA 1V3FA 2VBZA 2QWWA 3B02A 2RQPA 3REOA 4WK8F 4ESJA 2VE8A 4YIIA 1MDMA 3GUDA 1LJ9A 2XUBA 5J6XA 2H6BA 3RKXA 3AAFA 5BPDA 2F5DA 5CVIA 1VTNC 2MH9A 3S2WA 4BNCA 3ZMTA 1ZH5A 2DK8A 4OOIA 3P9IA 5KVRA 1P92A 3HSEA 2CO5A 1J75A 4U88A 2PEXA 5E1ZB 4BQAA 2OU2A 4KIBA 1LNWA 1KGSA 4HF1A 1ZREA 4HF2A 3ECHA 3LA7A 3M8FA 1SMTA 3BWGA 4YFNF 5E20A 1QPMA 4L9TA 2MD5A 2EFWA 4JK1X 1KQ0A 1RZ4A 4LGWA 1ZHFA 1LVAA 1OYWA 4IVNA 1UFMA 5FD5A 4MEYF 3SQNA 4ESBA 5JFRA 1A04A 1OMIA 2ZCWA 1HXDA 4BHBA 2W24A 3ZP5A 1ZRDA 2PMUA 4M9XA 3I64A 2EK5A 4ASNA 1BOAA 2XVCA 5DEQA 1WKMA 3SZPA 3R61A 1FNNA 3TO9A 4EM0B 1H9TA 3HTUA 2V1XA 3Q9VA 2VN2A 2O6GE 4R79A 4L5JA 4RAYA 1FX7A 3RIRA 2PJPA 4L5IA 1S7AA 3U2RA 2CGPA 1FYMA 2MC3A 1XGMA 4LG0A 4OU0A 2IA1A 2RN7A 1XGOA 1PUEE 2HGCA 1OYIA 1IRFA 1RUOA 3P9KA 3T0YA 1FPQA 3I53A 2VBWA 3SHFA 4HYEA 4H0EA 2D1VA 4QLCU 3SFZA 5CLSA 1DP7P 3KEOA 3LSTA 1MJBA 4G8XA 1D5VA 5D5XB 3BZ6A 3B73A 2A61A 3LWFA 4MQVA 4HDVA 3GVAA 3JAMZ 3J81Z 2RNJA 2IRFG 4YG2F 1IZ1A 2DAOA 1HSJA 2LF8A 3GFIA 2UXXA 1I6XA 3G73A 4U7DA 4AIJA 1K78B 2GQQA 4G7ZF 1FY7A 1JE8A 3HRSA 1FSHA 3GEZA 3KP4A 2KIMA 2L4AA 5DDGA 4EM1A 3K1PA 2HOEA 5HVQC 4KT5C 3TDZC 2DU9A 2OZUA 5FLXZ 1JXSA 2O8XA 3IWZA 3K1NA 3K9TA 4MQ9F 3C18A 3IL2A 3ZN0A 3MQ0A 3Q5FA 3KZYA 2VBXA 4M71A 4KUMA 2MLKA 4R1HA 2W25A 2EA4A 3OV8A 3FMQA 3TDUC 2H94A 4BH9A 4MGRA 4HX8A 3F8BA 3ABTA 3MWMA 5LRRA 3PQJA 3TOAA 4AIHA 1YO5C 1K79A 4I98B 5LHGA 1U78A 3QOPA 1R1UA 1QO0D 1TQMA 4P9UA 4EGZA 1J59A 4LJZF 1MD0A 3VODA 2W85A 1L3LA 4WXDA 2IP2A 3FXQA 4PGHA 3I4PA 3EYIA 1J2XA 3MAJA 1EV7A 5L3EA 2VODA 1B4AA 1X3UA 2GA1A 4ETSA 3FXRA 3WG9A 4RGRA 3PQKA 4XRFA 2P6TA 1QBJA 1REPC 2VC0A 3H3UA 4LMYA 2OQGA 4XSXF 1R58A 2FMLA 4WCGA 2XKOA 3TQNA 2WWYA 4B09A 2E1CA 4EJWA 5HDNA 3M7GA 4I7HA 5JVTA 5CVUA 4LK0F 1YG2A 2J5PA 4ZYDA 1Z6TA 1UCRA 1FLIA 1LDDA 4L18B 1P4WA 1YTYA 2JPBA 4RGUA 1USSA 1WQ2A 1IN4A 1I1SA 3KE2A 5F64A 4IRGA 3L9FA 4BYYA 5FLXK 4ENMA 4ZZLA 3GWZA 1XSXA 4KN7X 1J9IA 5CYVA 2VOPA 1G3YA 4D0PA 1HW2A 4LK1F 1GXQA 2K86A 1SFEA 5A2QZ 4BHCA 3JTHA 4EJTA 1IXRC 1MZBA 4LLGF 4U0WA 5ED4A 1HKSA 2ZXJA 3HOTA 5BPIA 1K6OA 1CGPA 5E1WA 1YS7A 2CQKA 4M72A 3VFZA 3LAJA 3CLOA 4FX4A 1ZLJA 1G3TA 1G3SA 1XGNA 1BC7C 1XDUA 2V9VA 3RKYA 5D4RA 5K5QA 1UHWA 5HLGA 2QQ9A 4KMUX 4RB0A 2A68F 2V1DA 2XHKA 3V8LA 5H20A 1KYZA 4S05A 3QAHA 3FWEA 2FXAA 3HHGA 3RJPA 2M8EA 4Y13A 4KIGA 1SD7A 1G4DA 2K27A 4I0BA 3F8NA 3F6OA 1LEBA 4Y15A 3QPTA 1KU2A 2EFNA 2L02A 2P5VA 1XGSA 2UXNA 3FX3A 3KLNA 3J7AO 3C1DA 4U0YA 4OIRF 5L3CA 1F1ZA 1ONVA 1KA8A 1W5TA 2QBYB 3IKVA 4TV7A 3TGNA 4S04A 5K5OA 2COMA 2M30A 2BYVE 5J8FA 3MCZA 5IT9K 3GF2A 1FC3A 1U2WA 2DTRA 1G6NA 2FU4A 2FF4A 2EWNA 2DQLA 2MBFA 4O6JA 5ILVA 1P6RA 2RKHA 4MTDA 1S6LA 1TW2A 2HKXA 1EH8A 3WTZA 3LA3A 3GFLA 2HYFA 2M45A 2HYGD 5H6RA 3F3XA 3FMRA 3I59B 3JSOA 1XMKA 4IRHA 3WGHA 1XN7A 1BM9A 4OMZA 1YFHA 2FMYA 1IXSB 2XASA 3K1MA 3R6SA 4CYDA 1SAXA 3SXYA 1IN6A 5H6QA 3N97A 3U9GA 4KDPA 2STWA 2PBIA 3DV8A 1I27A 4CICA 3WE3A 4L9NA 4XLNF 1YW8A 1R23A 4G6DA 1EH6A 3HRMA 2FBHA 2FOKA 2GIVA 4RGXA 4ENJA 2Y0MA 1PDNC 1MJ9A 1AWCA 2KIFA 2CYYA 1H0MA 2RDPA 2ACJA 1J5YA 4R8HA 4ZYHA 1OPCA 4EJVA 1T6SA 2A07F 4A6DA 4IXAA 2RGVA 4PZJA 2BE5F 3I58A 1J7KA 3L7WA 2UWMA 1BI2A 3RPUA 5AONA 3E97A 2QM3A 1TQIA 3TKYA 2FE3A 3WE2A 4O3MA 2XV4S 1B1BA 1LDKB 1E2XA 1FZPB 2A69F 1FYLA 4M6YA 3DEUA 2UZKA 3EETA 4L0YB 4K2EA 3H3ZA 2L01A 3GFMA 2IPQX 2DLLA 2FSWA 2QQBA 2IA2A 3K2ZA 1RI7A 1ZAOA 1PP7U 4G94A 4UVCA 1KU9A 2O61A 4A0YA 2P8TA 5HOOA 4E70A 1ZG3A 3ERED 3D0SA 2MA3A 2ZJ2A 2CW0F 1QNTA 1ZLKA 2EJRA 1P4XA 2F5FA 1O3SA 5HDGA 3K0LA 3QU6A 5FFZA 3RI4A 1D8KA 3WU0A 5CVJA 2P7VB 2DPDA 5LHIA 1XD7A 4LB6B 3BJOA 4Z2YA 5LHHA 3V4GA 2DPUA 1FOKA 3WU1B 2VT2A 3BPXA 3F21A 5L3DA 1TW3A 4KA4A 4CO8A 4N9HA 2ZNZA 1QZZA 3IHUA 5CVRA 2HFHA 2Q8KA 4P55A 3V8JA 2BV6A 4P9FA 1FBSA 2DT5A 2X0LA 5DCFA 1U5TA 3V8KA 3M9AA 4DNCA 2KJCA 4WXHA 3WGIA 1R1TA 1BBYA 4EGYA 2ESHA 5LGNA 3MZYA 2HKOA 1FYKA 3KP2A 5ICEA 2PG4A 5HS9A 2VE9A 4ZYGA 5DUKA 4MHGA 3VOEA 4U0VA 2C6YA 4DQ2A 5LBQA 1UHMA 1ULYA 1XSDA 4O5VA 2HWVA 2XRNA 1Z9CA 4EJOA 4G7OF 3C7JA 1XCBA 4RB1A 1BIBA 2XKPA 1O3RA 1FBUA 1R1VA 1I1GA 2L3DA 3DKWA 4HQEA 1IF1A 1QQIA 2A6HF 3P9CA 3GW2A 3WTYC 4Q47A 4EMSA 3WODF 3ZQ7A 2NRAC 3I5UA 1RNLA 3E6CC 5BOXA 4Y17A 4KN4X 4EVIA 3RYPA 2QBYA 2P6SA 2OBPA 1G3WA 3OOPA 3N4MA 2H09A 1KYWA 2VXZA 3GFJA 4WX9A 2WV0A 3NEUA 2Z3YA 3FM5A 2RC4A 3SZTA 3O6BB 2EV0A 2PFBA 3QRFF 4HBLA 4A2UA 3JAMK 1W5SA 3J81K 4JQFA 1JHFA 2CSOA 4IPAA 4PCQA 3ISPA 5TRDA 2G9WA 1T0FA 4IF4A 6PAXA 2O0YA 3T8TA 4ZYEA 1I5ZA 1QZYA 3RYRA 1USTA 5AIQA 3ECOA 3HYIA 3GX4X 3M8EA 2J5OA 4EJUA 4XLPF 5K5RA 3MEXA 3LFKA 1T2KA 3I59A 2HZTA 3MZHA 3LQRA 3E6BA 1ZG5A 1L0OC 2A6EF 4UVAA 3HOSA 2XAFA 2GAUA 3ZMZA 5L3GA 4M74A 2EA2A 1MKMA 4XSZF 4UUVA 2QZ8A 2LKPA 3H92A 4KFCA 4M9SA 3TO6A 2ZMEB 2OA4A 2BGCA 4HX7A 1TLHB 4B8XA 5LGUA 1ON1A 3EQLF 2AXLA 1LDJA 4NQWA 3DPLC 2OZ6A 3TO7A 1IW7F 4OIPF 1RUNA 1DUXC 4BHPA 2FEZA 4KMFA 1EH7A 2KIUA 2WC2A 3ZMUA 3BROA 1OR7A 4RAZA 1FBQA 1Z05A 5ILSA 5TJJA 3ROUA 1ZYRF 3DFGA 5D6EA 1RIOH 1U5TB 2DI3A 1Z6RA 3BDDA 2XROA 2HTSA 4RS8A 1E17A 2DBBA 3E5XA 4HA8A 3ZMSA 3R60A 2W57A 3KP6A 1LB2A 3WTTC 3ULQB 5HS8A 2HR3A 2XAGA 4UHTA 3WTWC 1S8NA 2JSCA 2NYXA 1FSEA 1R5GA 2FBIA 2ZFWA 3ML6A 3NRVA 1R00A 2XAQA 4PGGA 2NS0A 1KU7A 3R0AA 1XDSA 3L2CA 2L54A 3I0TA 1S3JA 4HW0A 4CGZA 1WWXA 1YLFA 5JHUA 1D8JA 2E7WA 5ILUA 2X4HA 1GXPA 2ZO4A 1KQ9A 2ADUA 3BOQA 2A3SA 3QPHA 2LDUA 2XAHA 4FHTA 4M6XA 3EUHA 1LQ1A 1SFXA 2HQRA 4UXNA 5L3FA 4FX0A 3DQVC 3I54A 5L3BA 1K7AA 5K1YA 4BXUA 2QYOA 3WTSC 3EDPA 2H6CA 4RGSA 5BQTA 2AS5F 5A2QK 4LD5A 4ZZDA 2F5CA 4AD9A 3JW4A 3QP5A 1U8RA 4IHSA 2F2EA 4LLLA 2YX4A 4N0BA 4WWCA 1SD6A 1STZA 3I71A 4M73A 4PDKA 5ICCA 2KKOA 4ON0A 4I2OA 4HDUA 5JR3A 3RTRA 4GYIA 2NNYA 3FM3A 2A5YB 2Q2EA 1Z7UA 4M9ZA 4UV8A 2K4BA 3LQQA 2JT1A 3CUQA 2BBYA 3PFIA 1TTYA 2Z99A 3HSRA 2NAZA 2ISZA 4MTEA 5BMZA 1IN8A 3VB2A 3KP7A 4CXFA 5E8GA 2ZKZA 3TOBA 2CFXA 4A6EA 4L9JA 2V79A 1W7PB 5DCMB 2O3FA 2DW4A 1WSUA 4HQMA 2G7HA 3P7NA 2JZYA 5D6FA 5FB2A 2YX7A 4I09A 1IN5A 3GLXA 3FHZA 1B9MA 1DDNA 1JGSA 1BI0A 1IUYA 4IJAA 3LAPA 2E1NA 2FNAA 2IJLA 1YW9A 5HS7A 4LFUA 3JTGA 4KYWA 1Q1HA 2P7CB 5E1XA 5ERIA 5D5VB 5LLQA 1YS6A 2R7DA 3FMSA 3F8MA 2TDXA 1O57A 5FO5A 2GWRA 2YPRA 2W84A 3BJ6A 2FNPA 2O03A 3DXJF 3E6MA 2D1HA 4LLNA 2K4JA 1V4RA 3D5LA 4OIQF 2OD5A 3ZMVA 2OQRA 2XGXA 4GGGA 3QP6A 4ENKA 4HLXA 1P4AA 2VBYA 3IC7A 4G6QA 3J80Z 4ENNA 1B59A 4NHJA 3ZMDA 2HDCA 4ZH4F 5KK1A 1ZN2A 1JHHA 4GYGA 4YIFA 4G9YA 4KIFA 4HV5A 3IKTA 3CDHA 2KJBA 1Z1DA 1Y0UA 4QWQA 1DPUA 3CTAA 1ZGJA 4HV6A 1ZRCA 4LB5A 1IAWA 2GXBA 4A0XA 2H27A 4OMYA 3KETA 3DF8A 5J8CA 4EQQA 2Y48A 5D4SA 2PLYA 2P4WA 2MH2A 1BN5A 2ZMEA 3T8RA 2EFQA 4NB5A 4N9IA 1LEAA 3JSPA 2QVOA 2E7XA 4P5OA 2LF7A 5LEKA 1O7FA 3ELKA 3O2PE 3QU3A 5HDKA 1BI3A 2HEOA 1NHAA 2YR2A 3W6JB 3ZN1A 2EFPA 3GXOA 1H9GA 2DFIA 2D2WA 3F8FA 3F23A 2DK5A 3BPVA 5FFXA 3T1BA 2Z33A 3BP8A 4MNUA 2F5EA 1TNTA 1FWZA 4OIOF 3G3ZA 3R4KA 3CUQC 3L00A 2XAJA 1TBXA 2IW5A 1Z91A 2CWEA 5EEHA 3C3WA 4GXOA 5AIPA 3IRRA 5HLIA 3KFWX 3WTXC 1HW5A 3F72A 4RB2C 1D3YA 3WTVC 3CUQB 1KQ8A 2VC1A 2D45A 4Q5SF 2K7LA 1FP2A 1B9NA 1OYYA 1YW7A 1GVJA 2MLGA 4A0ZA 2FA5A 4HF0A 3NQOA 3COAC 2M87A 1FP1D 2EV5A 3IWFA 1MDMB 1HKTA 1F4KA 3F22A 1QGPA 3HHHA 2M1BA 3EYYA 3GZ5A
chains in the Genus database with same CATH superfamily
1HKQA 1BW5A 2CG4A 2IVMA 5IP7J 4BJ6C 1E3PA 2K02A 1GHCA 3CMMA 2LY9A 2PMHA 2XPWA 3CJRB 5FD6A 1WZ2A 2WA0A 2OTLI 1JGGA 2KRFA 5IYDJ 2V1NA 5JLWA 1FOYA 3KP5A 3BTJA 1LFBA 4I02A 3J80K 3QODA 3MKZA 3L2RA 1MJAA 2BVLA 3K4JA 2IA0A 4KISA 3HKZN 1PP8F 1XMAA 1DPRA 3ABLH 4B1RA 1DQUA 4UVBA 3SFIA 2G7UA 1IJWC 1R22A 1HBXG 3MFKA 1P2FA 3V7SA 2E71A 1VQKI 4ZDPA 5F0CA 3KZZA 3L1PA 3L09A 4OWRB 5E8IA 2YSRA 4U7BA 1ODDA 1ZARA 2B0LA 2E19A 2LSOA 3C2BA 2JPCA 2W4SA 1HSTA 2ME0A 5D8LB 3GYHX 1YQAA 1U0JA 4AVPA 2EINH 3KP3A 1QVUA 3OS2A 1OCTC 2VQCA 2ISYA 1ZR4A 1P9QC 4KICA 3HRTA 3T5XA 1U3EM 2WTEA 3HGGA 2WY7Q 4BE0A 1ERDA 2XB0X 1NK3P 3OYNA 2ESNA 2VUMJ 3BY6A 5CVVA 1K4TA 2P5KA 1F9NA 1APLC 5FLMJ 1B6AA 2ZNYA 2PI0A 3O3KA 3A01B 3DPTA 2QUFA 3BTLA 3JCUC 5DD4A 4CCJA 1AKHB 4F7ZA 2GZWA 3DKXA 2F4IA 5LRSA 4RB3C 4Q48A 3FXJA 4A5NA 2A6TA 5E17F 1MMDA 1CF7A 5ICGA 5ICFA 3DP7A 1R71A 4I01A 1UG0A 3KIOA 2DA4A 4AIDA 2MYSA 5LEJA 3HXLA 1S7OA 4HEA2 1SC7A 2V6CA 5F6FA 2B9SA 2IXSA 1OKRA 4YFXF 4N4NB 1WJ5A 5M5YJ 1LKXA 5FGMA 1BJAA 4CDGA 3BT9A 1T56A 4A12A 3OYLA 1ON2A 1SFUA 2Z9OA 4LG0B 3BJAA 4PJJA 3IV5A 1V54H 2ZMEC 1TNSA 3OWTA 2ZXHA 1T08B 3W6VA 1VQ5I 4BJTA 4J19A 2DFFA 1ZELA 3E5QA 3M1EA 4BEHA 1TWCJ 5KNLA 2Z5UA 3FIWA 1O4XA 2CMPA 2VJIA 4ESFA 2WV1A 3DEWA 2P5LC 4AWXB 3U1DA 3FF5A 4KJZA 1XSVA 2R7UA 3WGGA 1VQNI 4GO1A 4WXCA 5F1RA 5D8KB 1MMNA 2IS2A 3C2HA 2IT0A 1SFOJ 1U6GA 2HYJA 4Q4ZF 2OCEA 4GRIA 5FLVA 3WTUC 3GO5A 1G59A 1F5TA 3KEQA 1HW1A 2LVSA 4KNYA 3RKWA 4JBAA 5IT9Z 1ENHA 2JSPA 2MW8A 3ABMH 1W7PA 4C3IJ 4IHXA 3ABUA 5DCMA 5CJ9A 3PM1A 3L2VA 1BC8C 3U1KA 3K69A 1SD4A 4P96A 2EFOA 2L4MA 4HX4A 1IXCA 1XCVA 2ELHA 3VWBA 2BEOA 2CH0A 4A5MA 1YYVA 3UNGC 1YIOA 1U5TC 2STTA 2LBFB 2GOXB 1LPQA 5E18F 1S5LC 4A3CJ 4G7HF 2HQAA 5KAIC 4A93J 3PO3J 3Q9SA 1WRJA 2EZKA 2DO7A 1S29A 4I0AA 2E36A 2JTVA 5DV5A 3CQZJ 5HLTA 3CJNA 2NNNA 3K4LA 2WB1N 4BGDA 2QENA 5HODA 3JRDA 4NC6A 2KRCA 1FT9A 1Y56A 2OAZA 2ZC2A 3TL4X 4V2FA 5DUIA 3E6DA 3HG9A 1OFCX 5EEGA 3VEPA 3S16J 1JTYA 4CHUA 1LE8B 2XIGA 4AIKA 2R3SA 5D5WB 5HLHA 2VONA 1IDZA 5KHDA 3FZVA 1J0RA 3TBIA 1JUPA 3W6KB 3V7RA 2QQAA 3NARA 4H4KC 4YFKF 5EZHA 4HAMA 3O8HA 1W0TA 2QLZA 2V1UA 4A3LJ 1Y0NA 5JI6A 3HRUA 2VT3A 3KCCA 2GXGA 2EV6A 4II2A 2PN6A 3CO6C 2WAQN 4OINF 1KU3A 5IT3A 4FT8A 4ITVA 1X58A 3RSNA 4HOBA 4L0ZB 4UV9A 2EB7A 2M5WA 3QPSA 3RKQA 4IRIA 3HIFA 1AA7A 1BI1A 1WH5A 3CCYA 3HSFA 2JRTA 1ZGAA 5IY5H 3V7CA 3OYGA 4RLQA 1JKQC 2XRLA 3E3VA 3LNQA 1T38A 4FETA 1SMYF 2DA7A 3OMYA 3ASOH 1MGTA 1WI9A 2F6CA 2KMUA 2RV8A 1O3QA 3OOUA 4HLYA 1QHGA 1D1AA 3BG9A 2FBKA 4L9VA 3LA2A 2HTJA 2LNBA 1ZG1A 3ZPLA 5IPAA 4BE2A 2DQRA 5DD8A 1AOYA 2V7FA 4B3AA 4ZDOA 1IDYA 5LGTA 2GA2A 3SZGA 1ETXA 1V5GA 4FE4A 2QGUA 3RPQA 1R5HA 3R0JA 3HTSB 1XG1A 3F6VA 2E35A 5DYMA 5C4JJ 1UB9A 3KLOA 2ZSHB 2FRHA 4UNOA 1ZK8A 4BQNA 1YJ9I 4DYCA 4BU2A 2CW8A 4MEXF 2R7FA 2CQXA 1NK2P 3ABKH 1IN7A 3LSGA 1O3TA 2NVTJ 3TW6A 2ID3A 1D0XA 2BY1A 3H3VK 1F43A 1R36A 2Q0OA 1GLNA 1YX5A 1SVMA 4XRSG 2HQNA 4HZFA 1LVKA 1ZRFA 4IHTA 3I4NJ 1C0WA 1QVTA 4EV0A 3IRQA 2MG4A 4F92B 2YU3A 5M5WJ 3PSIA 1SANA 1MSEC 3CUOA 2JVHA 3E5UA 2ZJQF 3GZ6A 3DPUA 3HOWJ 2VOOA 5F0HA 2R7WA 1UZCA 3A2KA 2ETHA 1HQCA 1ETQA 2H1KA 1IRGA 3PNTA 5BS6A 1A35A 1YE9A 1W7PD 2KLOA 1MMSA 2HXIA 1H89C 3FXUA 3CO7C 4IX7A 5D5UB 2F4MB 1WJAA 1WJCA 2RVCA 3ZQFA 4ZJZA 1R5ID 1CF7B 2R7TA 1XMXA 1BIAA 4BACA 1WGXA 3DLLF 3K4KA 4V2GA 2DN0A 4WF2A 4HNUA 4EM2A 1K78A 1VQ9I 1T98A 2ZBKA 3CMAI 2M8GX 1T39A 4CZZA 4XBFA 3B6AA 4X1EA 3BR3A 3HUGA 3W2VA 5H2FC 2Y75A 3LSRA 2M7AA 3KX2A 2HOTA 1MBGA 1QU3A 1XB4A 1UMQA 2VB6A 1R7JA 2QA4I 2FQ3A 1W4MA 4FTHA 2KRHA 2M3AA 3M07A 4BEHB 2PQ8A 1O7LA 1SD5A 3QWLA 3RDIA 2DXIA 1BA5A 1J09A 1ETWA 4BAYA 1TQPA 4GCVA 2HS5A 3F8CA 1V3FA 2VBZA 2O5RA 2QWWA 3B02A 1HF0A 3H5NA 4QPOA 2DMQA 2RQPA 1JTXA 3REOA 1Y1VJ 4WK8F 3Q3SA 4ESJA 2VE8A 2XGEA 4YIIA 4DYQA 2R7SA 4XQFA 4C2TA 1MDMA 3ZOBA 5E3NA 1A31A 2IEKA 3ZQQA 2M7BA 3GUDA 2VASA 4Y52J 1LJ9A 2XUBA 5J6XA 2O7OA 2LREA 1UG2A 2H6BA 3RKXA 2EIKH 3AAFA 5BPDA 2F5DA 5CVIA 1VTNC 2Y0SA 2L7MP 3AL0C 3AFHA 1JT0A 3BR1A 2MH9A 3S2WA 4BNCA 3ZMTA 4M6VA 4C30A 3VPRA 3ZCOA 3QQAA 1ZH5A 2DK8A 1TWFJ 4OOIA 3P9IA 5KVRA 1P92A 4E7ZA 3HSEA 1BR4A 2CO5A 1J75A 4U88A 3I56I 2PEXA 4OAYA 5E1ZB 4BQAA 2OU2A 4KIBA 1LNWA 1KGSA 2BZTA 4IQ4A 4HF1A 1ZREA 1D1CA 2VQHA 4HF2A 3ECHA 2R7OA 3LA7A 4D1QA 3M8FA 1SMTA 2L9NA 3BWGA 4YFNF 4AYBN 2R7VA 3CC2I 2LY1A 3SEQA 1WPKA 4J01A 5E20A 3S8PA 1QPMA 4L9TA 2MD5A 2EFWA 4JK1X 1KQ0A 1RZ4A 1W5CC 4LGWA 3UKGA 1ZHFA 4B43A 1LVAA 1OYWA 3BG7A 4IVNA 2K9LA 4A3EJ 2WY8Q 1UFMA 5FD5A 4MEYF 3MN2A 3SQNA 3CLQA 3VSKA 5IOZA 2K9MA 4ESBA 5JFRA 1A04A 1YOVB 1POGA 1OMIA 1S72I 2ZCWA 1HXDA 3TP0A 1YHQI 4BHBA 2HNHA 3FDYA 2W24A 2X48A 3ZP5A 1ZRDA 2DMUA 2QSGX 2PMUA 4M9XA 2IGNA 3I64A 2EK5A 4ASNA 1BOAA 4F52A 1VFCA 3GTPJ 1MBJA 2XGDA 1VQLI 2XVCA 1D0ZA 3I55I 5FJ8J 4CUGA 3ZQLA 5DEQA 1AKHA 1WKMA 3SZPA 4HNVA 3R61A 1FNNA 5J1UA 3TO9A 1IRXA 2WBMA 4EM0B 1H9TA 3HTUA 2V1XA 1SAUA 3Q9VA 5IOYA 2VN2A 2O6GE 2A05A 1U8BA 3S1NJ 4R79A 4L5JA 4RAYA 1SVLA 2PMZA 1FX7A 3GTMJ 3RIRA 2PJPA 3K4CA 4L5IA 1S7AA 3U2RA 2CGPA 5IP9J 4RA2A 1FYMA 2MC3A 1XGMA 4LG0A 2NOGA 4OU0A 2IA1A 2RN7A 3SDBA 1JKRC 4NUBA 1XGOA 1PUEE 1FMWA 2HGCA 3FK6A 5J1RA 1OYIA 1IRFA 1RUOA 2OC6A 5C3EJ 3P9KA 3FXLA 3T0YA 3CESA 1FPQA 3I53A 2VBWA 1KZHA 3SHFA 2NOJB 4I99C 2VQGA 2BY3A 5B1BH 2LR8A 2A5WA 4HYEA 2O9LA 1P7IA 2X6OA 1YIJI 4H0EA 2D1VA 1ITYA 4QLCU 3SFZA 5CLSA 2VJ5A 2MGQA 1IO2A 1DP7P 3H1CA 3KEOA 3G4SI 3LSTA 1MJBA 4G8XA 2X1EA 1D5VA 5D5XB 1QRYA 1S9HA 3BZ6A 3B73A 2A61A 3DKYA 3LWFA 4MQVA 4HDVA 3GVAA 3JAMZ 3LFUA 3J81Z 1Z0XA 2RNJA 2IRFG 4F91B 4YG2F 5GAGJ 1IZ1A 4HG2A 2WAFA 2DAOA 1HSJA 2LF8A 2VQLA 3G71I 4DBRA 3GFIA 1VQ8I 1LUJB 2UXXA 1X4OA 1I6XA 3G73A 4U7DA 4AIJA 1K78B 1WFXA 2GQQA 4XKCA 4G7ZF 3OYIA 1EF4A 1FY7A 4MIMA 3PFYA 3ZRGA 3JRAA 1JE8A 1VNDA 4CCNA 4D5FA 3HRSA 1FSHA 3FXOA 3GEZA 3IH3A 4A3KJ 2V9PA 2HDDA 3KP4A 2KIMA 2L4AA 5DDGA 1RC9A 2BXZA 2MC4A 4EM1A 3K1PA 2COBA 2HOEA 5HVQC 4KT5C 2L7FP 2DU9A 4ZDLA 4NC7A 3TDZC 4B3XA 1LFUP 2DA2A 1I3QJ 2OZUA 4UB6C 1PVEA 3CMYA 4LOCA 5FLXZ 1JXSA 3GMEA 2O8XA 4M3EA 3IWZA 3FXKA 4YELA 2R92J 3K1NA 2JA5J 1JJ8C 3K9TA 3H9GA 3PJRA 4MQ9F 3C18A 3IL2A 3ZN0A 3CP8A 3MQ0A 2K5CA 4E7KA 3Q5FA 4PFOA 3KZYA 2VBXA 1Z67A 4M71A 3MZ8A 1TC3C 2BVMA 2MLKA 4KUMA 4R1HA 2W00A 3LMMA 2W25A 4BY7J 2EA4A 2DYRH 3OV8A 2MD0A 3FMQA 3TDUC 2H94A 4BH9A 4MGRA 4QTRA 4HX8A 4CZCA 4DOZA 3F8BA 4BS9A 3ABTA 3MWMA 5LRRA 3CCJI 1RR7A 4AU7A 4BY1J 4BXXJ 3CCLI 3PQJA 3TOAA 4AIHA 1YO5C 1K79A 3A02A 4I98B 4F93B 5LHGA 3OY9A 4I6ZA 1U78A 3A0HC 2DOFA 3QOPA 1R1UA 1VQMI 3BQZA 3VDXA 2LG4A 5GP9A 3JRHA 1QO0D 1TQMA 1R49A 1ETYA 2IGKA 2IGMA 4P9UA 2TRTA 4EGZA 3S14J 1J59A 4LJZF 4IOAF 1MD0A 2XC7A 3HGYA 3VODA 2W85A 4MLOA 1L3LA 4WXDA 2IP2A 3QOEA 4XN3A 3FXQA 4PUSA 2CU7A 3DCFA 3VSLA 4F3QA 1I39A 4PGHA 3I4PA 2WB1A 3EYIA 1UJ8A 2QQ8A 3CC4I 1MMGA 1J2XA 3MAJA 1EV7A 5L3EA 2VODA 1MBEA 3N05A 2E5NA 5F0FA 5FKMA 2DFEA 5EDNA 1VZ0A 1B4AA 3IAS2 4XR6A 1X3UA 2GA1A 4ETSA 3FXRA 2LK2A 3WG9A 2H8WA 2NS7A 4RGRA 1IV6A 1JJ6C 3SJMA 3PQKA 2R7RA 1X3ZB 4XRFA 2P6TA 1QBJA 1REPC 2VC0A 3H3UA 4LMYA 2BY2A 5GPAA 2OQGA 4YRVA 4XSXF 1R58A 4XKVA 4CH7A 2FMLA 4WCGA 2XKOA 3TQNA 4KITB 4B09A 2WWYA 2EBIA 2GXAA 2VLAA 2E1CA 2QF7A 4EJWA 1WCMJ 5GPCA 3FXMA 5HDNA 2JA2A 3M7GA 2CV2A 4I7HA 4A3FJ 5JVTA 3CP2A 2VXDA 5CVUA 5EF6A 4LK0F 2VKVA 3DBRB 3BTIA 1YG2A 3OYHA 2J5PA 1WHUA 4ZYDA 1GUUA 1Z6TA 4BJ5C 4XLFA 2NS8A 1UCRA 1FLIA 4B44A 1LDDA 3MKWB 4L18B 2DT6A 1P4WA 4CCOA 1YTYA 1VF9A 2JPBA 2K85A 4RGUA 1IRZA 1USSA 1WQ2A 1IN4A 5CQGA 1I1SA 4UB8C 2MSYA 1OJLA 3KE2A 5F64A 4IRGA 1HC8A 3DTKA 3L9FA 1YRNB 2JK3A 4BYYA 3OYBA 3O8GA 2B7EA 2OF7A 3OYDA 4ENMA 5FLXK 4ZZLA 3GWZA 1XSXA 4KN7X 1J9IA 3SDGA 3QPLA 5CYVA 3VYUB 2VOPA 1G3YA 4D0PA 1HW2A 4LK1F 4BBRJ 1GXQA 2K86A 1Y1WJ 1SFEA 5A2QZ 4D9JA 4BHCA 1FIAA 2R93J 1DP3A 4YIRX 2ZXIA 3DBLB 3JTHA 2DMPA 4EJTA 3M8JA 5FKOA 2ID6A 4XNFA 1IXRC 5EG0A 1MZBA 2LC2A 3KYDB 2CQ7A 3J7YJ 1QA6A 4LLGF 2JA6J 2H8RA 4U0WA 2CV1A 5ED4A 5E3MA 2X9DA 1HKSA 2ZXJA 3HOTA 5BPIA 1K6OA 3PNYA 5E1WA 1OLTA 1YS7A 2CQKA 4E4HA 1CGPA 2FX0A 3CF2A 3DEEA 4M72A 3VFZA 3LAJA 2W48A 3CD6I 3K4BA 4B4CA 1SEUA 2HI3A 3CLOA 4FX4A 2OUMA 2BW3A 1ZLJA 1G3TA 2OCCH 3ZR8X 1TWGJ 1G3SA 4DYRA 1XGNA 4L5EA 1BC7C 1CQTA 1XDUA 2V9VA 3RKYA 5D4RA 3LOCA 5K5QA 4IKFA 2L9VA 2P81A 1UHWA 5HLGA 2QQ9A 1B72B 3J7AY 1G8XA 3OYCA 3F9KA 3ZQHA 2ELKA 4KMUX 1X1BA 4XKWA 4GDFA 4RB0A 5DS9A 3I3LA 2CUJA 2A68F 2V1DA 2W1OA 2XHKA 1X2MA 1GV5A 3V42A 3V8LA 2VJ4A 1ETVA 1WJBA 5H20A 1KYZA 3ZQCA 2LP0A 1U9OA 3RCOA 9ANTA 1OCOH 2JA8J 3BG5A 1RESA 4S05A 4JX4A 3HDDA 2L0KA 3QAHA 2CUZA 3FWEA 3Q0UA 5B5EC 2FXAA 3DTEA 1MMAA 3HHGA 2Y31A 3RJPA 2M8EA 4Y13A 2KZGA 4KIGA 1SD7A 5J4VA 3DBHB 2DA5A 3VYSB 1G4DA 2K27A 2L7ZA 4I0BA 1MBHA 1WJFA 3F8NA 3BZKA 3F6OA 2V4JC 1LEBA 1R4NB 4ZYAA 1MBFA 3DU6A 2DJIA 2QSFX 4Y15A 3QPTA 1KU2A 2ECCA 3L2QA 3HJEA 2EFNA 2L02A 2E1MC 2P5VA 2RREA 1XGSA 2UXNA 3FX3A 2E1OA 3D5RC 3KLNA 3QYBA 3J7AO 3C1DA 1HCRA 4U0YA 4OIRF 1K83J 1B8IB 5L3CA 2DCEA 2JUGA 1F1ZA 1ONVA 1KA8A 2WAEA 1W5TA 2E1MB 2KISA 2QBYB 3E1SA 3X2QH 3IKVA 4XRMA 4TV7A 3TGNA 2VKDA 4S04A 1E3OC 3BG6A 5K5OA 3H9JA 2COMA 2M30A 2BYVE 5J8FA 3MCZA 5IT9K 3GF2A 1FC3A 2DTRA 1U2WA 3BR0A 2Y2ZA 1MIJA 4IEJA 2DJNA 5EGOA 1V5EA 1G6NA 2FQ4A 2FU4A 2FF4A 2EWNA 4A3DJ 3HZJA 2DQLA 2AQEA 4NC8A 2MBFA 4O6JA 5ILVA 1P6RA 4Y3OA 4BXFA 3VYRB 3CDIA 2R5YB 2RKHA 1WH7A 1X4PA 4MTDA 1S6LA 1TW2A 1JUMA 2HKXA 3BLYA 1EH8A 3CZ6A 4ABZA 3WTZA 3LA3A 3GFLA 2HYFA 1UELB 3HPGA 4UUSA 1A6IA 2M45A 5LD2C 3BC8A 3LSKA 2HYGD 4BDZA 2E5ZA 2UV1A 4AVZA 3AG4H 5H6RA 5K7HA 5HNFA 2KP6A 4DGWB 3RZOJ 3OYAA 3F3XA 3FMRA 1RKTA 3EPZA 1MSFC 3A03A 3I59B 2UUZA 2V9KA 3JSOA 1ZQ3P 2CJJA 1XMKA 2VKHA 4IRHA 2XB5A 4XONA 1MNEA 3CMEI 3WGHA 3S17J 1XN7A 1BM9A 4OMZA 1YFHA 2FMYA 1IXSB 3NAUA 2BHZA 2XASA 5EZGA 3K1MA 2GOMA 3CCUI 3R6SA 1W36D 1IC8A 4PJMA 4CYDA 1SAXA 4PSWA 3SXYA 1IN6A 1T33A 4EEFG 5H6QA 4PK4A 4XLEA 3OL4A 4FQGA 5TGTA 3N97A 2HXOA 1M1EB 3U9GA 3RQIA 2STWA 4KDPA 5GAHJ 2PBIA 3DV8A 2JA7J 1I27A 4CICA 3OR2C 1DGRM 3OIQA 2F5VA 3WE3A 4L9NA 1X1AA 4XLNF 2XPVA 3ASNH 3S2DJ 1YW8A 1R23A 4G6DA 1EH6A 4XICA 1WJEA 3ZQIA 3HRMA 4QIWN 5EG0B 2O8KA 2XPUA 3FKJA 5JLXA 4HSRA 3JR9A 2FBHA 2FOKA 2GIVA 5FKNA 4FE7A 4RGXA 2CUEA 5KCMA 4ENJA 1BJZA 2M0CA 2Y0MA 2HPMA 1PDNC 1MJ9A 1AWCA 5IYCJ 2KIFA 3DTIA 2CYYA 5DTDA 1H0MA 1PJRA 2KQRA 4NBQA 2RDPA 3HL2A 2ACJA 2W7NA 2BOLA 1J5YA 3MVPA 4R8HA 4ZYHA 2X51A 1OPCA 4EJVA 2X6WA 3S1RJ 2FD5A 2X1CA 1T6SA 2A07F 4PJNA 4A6DA 2XSJC 5J47A 2BW3B 4J00A 5FRMA 4IXAA 4MFEA 2RGVA 4PZJA 3K10A 3U21A 2BE5F 3I58A 3NWSA 5FKKA 1J7KA 3L7WA 2UWMA 1BI2A 3Q0WA 1W36C 3RPUA 4IOCF 5AONA 2R0QC 1HDDC 4I76A 3E97A 2QM3A 2RNGA 1TQIA 3TKYA 3OYJA 1GDTA 2FE3A 3WE2A 3BR2A 4O3MA 2XV4S 1B1BA 1LDKB 1E2XA 1Y8RB 1FZPB 2A69F 4V19K 2DA1A 4M6YA 4M3GA 5J1YA 1FYLA 2CRGA 1I3AA 3DEUA 3LSPA 1PUFB 1FEXA 2UZKA 3EETA 4L0YB 4K2EA 4IQJA 3K6GA 3H3ZA 2CFOA 2L01A 3GFMA 4BUPA 2ICWG 2IPQX 2VJJA 2DLLA 5C4XJ 2FSWA 4RM3A 2QQBA 2IA2A 3K2ZA 1RI7A 1ZAOA 1PP7U 4G94A 4UVCA 2Z2SB 3PNVA 1KU9A 3CJTB 4CA0A 2O61A 4A0YA 2P8TA 1RR8C 5HOOA 4E70A 3CCMI 1ZG3A 2BY0A 4XK4A 1TL8A 3ERED 1TZLA 4XMYA 3K70D 3D0SA 3ZGKA 3JRGA 1RETA 2MA3A 2ZJ2A 2R5ZB 2CW0F 3M1CA 3FISA 1QNTA 1ZLKA 3HOXJ 3OSFA 2RQQA 4BQQA 2G0EA 2EJRA 4C9YA 1P4XA 2F5FA 1O3SA 2EZLA 1OQYA 3ERMA 3S3OA 5HDGA 2HDWA 3K0LA 3HKZA 3QU6A 5FFZA 3RI4A 1BW6A 1D8KA 1Z21A 3ESWB 2H1LA 2R7QA 5EJCA 3WU0A 2BHYA 5CVJA 5IP6A 2P7VB 1OCCH 1YRNA 2DPDA 3AKZA 5LHIA 1XD7A 4LB6B 3BJOA 2V6EA 4RDUA 1ACIA 4XORA 4M3FA 3KYLA 4AUXA 4Z2YA 5LHHA 1EJ9A 2Y0SN 3RZDJ 3V4GA 4HRIA 3JRBA 3MD2A 3E0JB 2WADA 2XGCA 3TW7A 2DPUA 1FOKA 3WU1B 2VT2A 3BPXA 4PSXA 3F21A 3K2AA 1FTTA 5L3DA 1TW3A 5EGOB 3H5RA 1E0EA 4XRSA 4KA4A 4HPQA 2OV7A 2DMTA 4CO8A 4N9HA 1IG7A 2ZNZA 4NDLA 3TMOA 1QZZA 3K70C 3IHUA 3H35A 5C44J 2B63J 3M4OJ 1X19A 5CVRA 2HFHA 3WG7H 2HU9A 2MABA 1UAAA 2IAIA 2Q8KA 4UUSB 3CCRI 4P55A 3V8JA 2K40A 2BV6A 4P9FA 1FBSA 2E2JJ 2DT5A 2X0LA 2DA6A 4PFPA 5DCFA 2JN6A 5F08A 1U5TA 3V8KA 3M9AA 4DNCA 2AO9A 4QPQA 3RPUD 1F36A 2KJCA 2LLKA 4WXHA 3CCVI 4XLHA 3WGIA 3GTQJ 4HSTA 3GBGA 3TP3A 1R1TA 1KONA 4G12A 1BBYA 1B72A 2LH9A 4EGYA 2CQQA 5M5XJ 3H0DA 2QKMB 2ESHA 1A36A 5LGNA 3MZYA 2HKOA 1VI0A 4XLAA 3GTOJ 1FJLA 2DDBA 1FYKA 5GTIC 2LTPA 1VQ6I 3LL7A 3KP2A 1NG6A 5ICEA 2PG4A 2KDZA 5HS9A 2DT7B 4ZYGA 2VE9A 4RMNA 2ZFUA 5DUKA 4MHGA 3VOEA 2Y30A 4Y4RA 4A3MJ 2XF7A 4U0VA 4A3BJ 2C6YA 3LSMA 4DQ2A 5LBQA 1UHMA 3PSFA 1ULYA 1XSDA 4O5VA 2PMZN 2HWVA 2LRDA 3S3MA 4GFBA 1UHSA 2L9RA 4A3IJ 3D1NI 1QZEA 2XRNA 1Z9CA 3BR5A 4EJOA 3PO2J 4G7OF 3C7JA 4LG3A 1XCBA 4RB1A 1BIBA 2EPFA 2OTJI 5HNHA 1AU7A 2XKPA 4EATA 3FBNB 1O3RA 3NWTA 3G6EI 1FBUA 1FTZA 4M3BA 1R1VA 1I1GA 2L3DA 1BR1A 3ZXSA 3DKWA 4HQEA 1IF1A 1QQIA 2A6HF 3S15J 3P9CA 3DWLE 4B48A 4NNJA 1MH4A 2F48A 3EUAA 2EIMH 3GW2A 3S93A 3WTYC 2OPTA 5J4YA 2JUCA 2QKLB 2HVRA 1R6RA 4X0GA 1X2NA 4PJ0C 4Q47A 4EMSA 1MBKA 3WODF 3ZQ7A 2NRAC 3I5UA 1RNLA 1BOBA 2EZHA 1D1BA 3E6CC 1X1DA 5BOXA 1B8IA 2D5VA 4Y17A 4KN4X 4EVIA 3RYPA 3AG1H 3MKYB 2QBYA 5BNGA 2KL4A 2P6SA 2OBPA 1G3WA 2NXNB 3OOPA 3N4MA 4XKBA 2H09A 2QCOA 1KYWA 2VXZA 1XTAA 3GFJA 4WX9A 4CYCB 5M3MJ 2CUFA 5B3SH 2WV0A 3NEUA 2Z3YA 3FM5A 4HNTA 2EZIA 3FK7A 2WAQA 2RC4A 3SZTA 3D5SC 3O6BB 2EV0A 2PFBA 1Z3XA 2HVQA 1IUFA 2Z16A 4HBLA 3QRFF 4A2UA 3JAMK 1W5SA 3K7AJ 3J81K 1VQ7I 4JQFA 1JHFA 4N4OB 2CSOA 5JVGF 4IPAA 4PCQA 2R5YA 3ISPA 5FKLA 1QHHD 5TRDA 3OSGA 4XLCA 2G9WA 1MNDA 1T0FA 1TWAJ 4IF4A 4G6TB 6PAXA 1OCRH 2DA3A 4F55A 2EIJH 3BR6A 2O0YA 2VI6A 3T8TA 4ZYEA 1I5ZA 2K3FA 1YI2I 1QZYA 3RYRA 2ELJA 3BCAA 1USTA 1Y39A 1RKWA 2HZDA 3OYEA 5AIQA 3ECOA 4IHWA 3HYIA 3GX4X 1DU0A 1YJNI 5K7ZA 3M8EA 2J5OA 5E3OA 4EJUA 4XLPF 5K5RA 3MEXA 3LFKA 1T2KA 3I59A 2HZTA 3MZHA 3LQRA 4ZC3A 3HB9A 3E6BA 1ZG5A 3W2WA 1L0OC 2A6EF 1W0UA 4XM3A 2PJRB 2CW7A 4UVAA 2XAFA 3HOSA 4XIDA 3CDLA 5M3FJ 2GAUA 3ZMZA 5L3GA 4M74A 3FKIJ 2EA2A 1MKMA 4XSZF 3IH4A 4UUVA 1V5FA 2QZ8A 2LKPA 4CCLA 3H92A 5EYRA 2EH3A 4B47A 4KFCA 4M9SA 3TO6A 3W2AA 2ZMEB 1K4SA 2OA4A 1Y6IA 1ETKA 2BGCA 2M34A 4HX7A 1TLHB 4B8XA 1EKEA 5LGUA 1ON1A 3EQLF 1H8AC 4UUTA 2XAUA 2AXLA 1MNMC 1LDJA 1FOXA 2OZ6A 3DPLC 4NQWA 2QSHX 3TO7A 1IW7F 2ZXWH 2JWTA 5JHFA 1LFPA 4OIPF 2DFHA 1RUNA 2N8GA 2CV0A 1DUXC 4BHPA 1XPXA 2IBDA 4CCMA 3KPHA 2FEZA 4ZTJA 4KMFA 1EH7A 2KIUA 1W1WE 3JREA 2WC2A 3ZMUA 4IZZA 3BROA 4BE1A 4E7LA 2EILH 1OR7A 4YEJA 2LKSA 2TCTA 4E7SA 1BR2A 4E7HA 4RAZA 1FBQA 1Z05A 2PX9A 5ILSA 5TJJA 3ROUA 1ZYRF 4IO9F 1HDPA 1HA8A 3HC7A 2KHMA 1TWHJ 3DFGA 4IL6C 5D6EA 3LSIA 1RIOH 1U5TB 2XF5A 2DI3A 1MW7A 3OYFA 1GT0C 1Z6RA 3BDDA 2XROA 2HTSA 1Z3YA 2Y69H 5CQEA 4RS8A 3PUBA 1H88C 2DMNA 3PIPF 1E17A 2DBBA 2Z1DA 3E5XA 2MFZA 4HA8A 3H9QA 3ZMSA 1OCPA 3R60A 2W57A 3ZQGA 3KP6A 1LB2A 3WTTC 3ULQB 5HS8A 4X6AJ 3BCBA 3QYEA 4A3GJ 1X1PA 1TT5B 2VPLA 2HR3A 1PUFA 2K9QA 3AG2H 2XAGA 3DU5A 2M9HA 4UHTA 4D7NA 3WTWC 3S3NA 4MFDA 1S8NA 1OCZH 2JSCA 3JRFA 1G2HA 1XC5A 4M3DA 1RPWA 2NYXA 1FSEA 1R5GA 1V55H 2FBIA 4LIUA 2ZFWA 1DGWY 3ML6A 1FOWA 1NTCA 3NRVA 1R00A 1GVDA 3WU2C 2XAQA 4PGGA 5CKTA 2NS0A 1KU7A 3VYTB 3MKLA 3R0AA 1N77A 1XDSA 3L2CA 2GLOA 4CCKA 2KPMA 2X85A 2M0MA 4RAFA 2L54A 2ZJRF 3I0TA 1S3JA 3ONQA 1HLVA 2DOAA 4HW0A 4CGZA 1WWXA 2R5ZA 1YLFA 1YX3A 5JHUA 1GV2A 3PUFA 1D8JA 2E7WA 5ILUA 3AG3H 4E6KG 3K4NA 2X4HA 1A5JA 1GXPA 2ZO4A 3H5AA 4A3JJ 2YU9J 3S1QJ 4A69C 4RAGA 1K61A 1KQ9A 2R7ZJ 3S1MJ 1ETOA 2ADUA 3BOQA 4E7IA 3JRIA 2A3SA 3KZIC 5CPRB 3QPHA 2LDUA 2XAHA 4FHTA 3OYKA 4JX6A 2YS9A 3J7ZI 3KYCB 4M6XA 2JVGA 3EUHA 4AYBA 5B66C 2JRMA 1LQ1A 1PYVA 1SFXA 3I9V2 2Y9ZA 2HQRA 4UXNA 5L3FA 2GBYA 4FX0A 4OAZA 2VL8A 3DQVC 2I5UA 3G1OA 3I54A 3OIOA 2E34A 2F4OB 5L3BA 1K7AA 5K1YA 5F27A 4BXUA 3CJQB 2QYOA 3WTSC 3EDPA 4II3A 5DM6F 2KZVA 4LITA 2H6CA 1T0FC 5F1JA 4RGSA 3JRCA 2XDVA 1JT6A 3TEDA 1SFKA 3IP4B 5BQTA 2AS5F 5A2QK 4LD5A 4ZZDA 1QPIA 4JX5A 2F5CA 3A0BC 4AD9A 3WHCA 2OJED 3JW4A 1N78A 3QP5A 3GZNB 1U8RA 4W1UA 3PIOF 4IHSA 2L5QA 5DM7F 2F2EA 3G1MA 2I10A 4FCYA 1JKPC 4LLLA 2HOSA 2YX4A 4N0BA 4WWCA 4ANJA 1X3WB 4BL0B 1SD6A 2E2HJ 1STZA 1AHDP 3I71A 2L7KA 4M73A 4PDKA 4JYKA 1Z77A 5ICCA 2KKOA 4ON0A 4I2OA 4DW6A 4HDUA 5JR3A 1SVOA 3H0GJ 3RTRA 4GYIA 3BTCA 3FM3A 2A5YB 2Q2EA 3K4MA 2NNYA 1Z7UA 2IGOA 1DU6A 4CSWA 4XN0A 2VIXA 2LFBA 4M9ZA 4UV8A 1FIPA 3A4CA 4S0HB 2K4BA 4W97A 2IS1A 3LQQA 2JT1A 3CUQA 2BBYA 3CC7I 2KIQA 3PFIA 1TTYA 2KT0A 5J40A 2Z99A 2DTZA 2LY2A 3B6CA 3HBLA 3UR3C 2BXYA 3HPHA 3HSRA 4DBQA 2NAZA 2CS3A 2ISZA 4MTEA 3CF5F 3IH2A 3RQ4A 5BMZA 1IN8A 3VB2A 3KP7A 5GTHC 1BL0A 3WHBA 3M3YJ 4CXFA 2JQ7A 3BZCA 5E8GA 2ZKZA 3TOBA 2CFXA 2KFDA 3LSHA 1T8IA 5E3LA 2FUG2 4A6EA 4NQWB 2L2OA 3HOYJ 1U9NA 4DJAA 3OS0A 4L9JA 5F04A 4DZJA 2I8DA 2V79A 1W7PB 1OR7C 2O3FA 5DCMB 3PL8A 2DW4A 1WSUA 4HQMA 2AXTC 3DLAA 1VQOI 2G7HA 3P7NA 4C3JJ 3GLLA 3P5JA 4Z6YA 4P1WA 5LFAA 2JZYA 2M4GA 4PJLA 4DIQA 3SYTA 5D6FA 5FB2A 2K3PA 2YX7A 5GAEJ 2RAEA 2X6YA 4I09A 1IN5A 3HOVJ 1VQPI 3GLXA 3AL0B 3CCSI 3FHZA 1B9MA 1DDNA 1JGSA 1BI0A 3GTKJ 1IUYA 4IJAA 4XL9A 3LAPA 2AQFA 4QSHA 1ZGWA 3HOUJ 2IS6A 2NVQJ 2E1NA 3G2BA 2M2EA 2FNAA 2IJLA 1WI3A 3OS1A 1YW9A 5HS7A 3C2GA 3A1YA 4LFUA 3JTGA 4KYWA 1Q1HA 4D7MA 1WJDA 2ZJPF 3GTGJ 2NVYJ 2P7CB 5E1XA 5ERIA 5D5VB 5FROA 5LLQA 1YS6A 2R7DA 4D5CA 3FMSA 5J3LA 3BG3A 4FISA 3F8MA 2DOEA 1OISA 2TDXA 2YUSA 5IYBJ 3S32A 3IAM2 1O57A 2JMWA 2GWRA 5FO5A 5EEAA 2YPRA 3KEYA 2W84A 3HOZJ 4E7JA 4CYCA 2GM4A 3BJ6A 2XSDC 2FNPA 2O03A 3DXJF 3E6MA 2D1HA 1ORKA 4XOTA 5E79C 2XF6A 4LLNA 1ZKGA 2K4JA 1V4RA 3D5LA 4RLFA 4OIQF 1ZR2A 2OD5A 2ECBA 4AC0A 3ZMVA 2ZSIB 4DZPA 4UY8I 4U87A 2OQRA 3GTJJ 4FASD 2XGXA 2LYCA 3QP6A 4GGGA 4ENKA 2VKEA 2KDOA 1A6QA 3Q0VA 3L2UA 3I4MJ 4HLXA 3A01A 1P4AA 2VBYA 3IC7A 4G6QA 3J80Z 3HEFA 4ENNA 1B59A 5K7FA 4RM2A 4NHJA 2V26A 3ZMDA 4KT6A 2E2IJ 3CCQI 3FHNA 3GTLJ 2HDCA 4ZH4F 2EQRA 1R9TJ 5KK1A 1ZN2A 1JHHA 2M4KA 4GYGA 1X1CA 2HPIA 3HM5A 1K6YA 4G9YA 4YIFA 3QYFA 4KIFA 4HV5A 3IKTA 3CDHA 1N75A 4Y7NJ 4AM3A 2KJBA 1Z1DA 1Y0UA 4C3HJ 1D5YA 3OYMA 4QWQA 1Z7LA 1DPUA 3CTAA 1ZGJA 3EUHC 4HV6A 1ZRCA 2VPRA 4MO7A 4LB5A 1IAWA 1E3HA 1I6HJ 1EA3A 1JUSA 2GXBA 4A0XA 2H27A 4OMYA 3GCMA 3KETA 2PJRA 3DF8A 5J8CA 3CCEI 4EQQA 2Y48A 1R4MB 2CQNA 5D4SA 2PLYA 2P4WA 2LOOA 3EUKL 1IV8A 2MH2A 1BN5A 2ZMEA 3T8RA 2EFQA 2K9NA 4NB5A 1MH3A 3OIPA 4N9IA 4RBOA 1LEAA 2Q1ZB 2DODA 3JSPA 2QVOA 2E7XA 4ZTFA 4P5OA 2K9SA 1YITI 1XS9A 2LF7A 3G1LA 4LIVA 5LEKA 1O7FA 2HQ5A 2DYSH 3ELKA 3O2PE 3QU3A 5HDKA 1BI3A 2HEOA 3S2HJ 1NHAA 4XOPA 2YR2A 1NG7A 3W6JB 2FOWA 2R4GA 3BQYA 4BBSJ 3W3CA 2P0WA 3ZN1A 2JJ7A 1NH3A 2EFPA 3GXOA 1H9GA 1FMVA 2Y9YA 2DFIA 2D2WA 2E60A 2LBFA 5TISC 3F8FA 2IS4A 1HOMA 3F23A 2DK5A 2ZB9A 3E7LA 1S7EA 3BPVA 3FBIB 1TP4A 2LMDA 1JI8A 5FFXA 2FJ1A 3T1BA 2Z33A 3BP8A 4MNUA 2F5EA 1TNTA 1I50J 1RRJA 2W82A 2NVUB 1D0YA 1FWZA 5GADJ 4OIOF 3OR1C 4IHYA 2R7XA 3G3ZA 3HUGB 3R4KA 1T95A 3MMYB 3CUQC 3L00A 4C2UA 2QEXI 2DDAA 2XAJA 1TBXA 2IW5A 1Z91A 2CWEA 1XX5A 2Q2EB 1Q1VA 2GIZA 3C3WA 3IUOA 4GXOA 5AIPA 5EEHA 3IRRA 5HLIA 1LE8A 3KFWX 3WTXC 1HW5A 3F72A 2ME6A 4RB2C 1D3YA 3WTVC 3CUQB 2AHQA 1WVRA 1YJWI 1VQ4I 1KQ8A 2VC1A 5B1AH 4JP0A 1TT0A 3LSJA 4IHVA 1IGNA 2HVSA 2X6XA 2D45A 2HOAA 3OL3A 4JOMA 1Y8QB 2K7LA 3F0CA 3H36A 3L2WA 4Q5SF 4Y33A 2NVXJ 1FP2A 1B9NA 1OYYA 1YW7A 1GVJA 2MLGA 4A0ZA 3SEZA 2FA5A 4C2MJ 4HF0A 3NQOA 3COAC 2M87A 1FP1D 2LKXA 2EV5A 2X1DA 3IWFA 1MDMB 1JKOC 5FRNA 1P7JA 1ZTRA 4BKXA 4BDYA 1HKTA 1F4KA 3F22A 1QGPA 2LD5A 5KAFC 3HHHA 1N25A 2M1BA 3EYYA 4BQOA 3GZ5A 2L9SA
chains in the Genus database with same CATH topology
1HKQA 2CG4A 2IVMA 2K02A 1GHCA 2PMHA 5FD6A 2KRFA 3KP5A 4I02A 3J80K 1MJAA 2IA0A 1PP8F 1XMAA 1DPRA 4UVBA 2G7UA 1R22A 1HBXG 3MFKA 1P2FA 3V7SA 3KZZA 3L09A 5E8IA 2YSRA 4U7BA 1ODDA 1ZARA 2B0LA 2LSOA 2JPCA 5D8LB 1HSTA 3GYHX 1YQAA 4AVPA 3KP3A 2ISYA 4KICA 3HRTA 3T5XA 1U3EM 2WTEA 2ESNA 3BY6A 5CVVA 2P5KA 1F9NA 1B6AA 2ZNYA 2PI0A 3O3KA 3DPTA 2QUFA 5DD4A 4F7ZA 2GZWA 5LRSA 4RB3C 4Q48A 4A5NA 5E17F 1CF7A 5ICGA 5ICFA 3DP7A 4I01A 5LEJA 1S7OA 2V6CA 5F6FA 1OKRA 4YFXF 5FGMA 1BJAA 4CDGA 4A12A 1ON2A 1SFUA 2Z9OA 4LG0B 3BJAA 1TNSA 3E5QA 3M1EA 2Z5UA 4ESFA 2P5LC 4AWXB 3U1DA 3FF5A 1XSVA 3WGGA 4GO1A 4WXCA 5F1RA 5D8KB 2IT0A 1U6GA 4Q4ZF 3WTUC 3GO5A 1F5TA 3KEQA 1HW1A 4KNYA 3RKWA 4JBAA 5IT9Z 1W7PA 3ABUA 5DCMA 5CJ9A 1BC8C 3K69A 1SD4A 4P96A 2EFOA 2L4MA 4HX4A 1IXCA 1XCVA 2ELHA 2BEOA 4A5MA 1YYVA 1YIOA 1U5TC 2STTA 5E18F 4G7HF 3Q9SA 1WRJA 2DO7A 1S29A 4I0AA 2JTVA 5DV5A 3CJNA 2NNNA 2QENA 1FT9A 2OAZA 5DUIA 3E6DA 5EEGA 3VEPA 4CHUA 2XIGA 4AIKA 2R3SA 5D5WB 5HLHA 2VONA 3FZVA 1J0RA 3W6KB 3V7RA 2QQAA 4YFKF 4HAMA 2QLZA 2V1UA 5JI6A 3HRUA 2VT3A 3KCCA 2GXGA 2EV6A 2PN6A 3CO6C 4OINF 1KU3A 5IT3A 4FT8A 4HOBA 4L0ZB 4UV9A 2EB7A 2M5WA 4IRIA 3HIFA 1BI1A 3HSFA 2JRTA 1ZGAA 3V7CA 3E3VA 1T38A 1SMYF 1MGTA 1WI9A 2RV8A 1O3QA 4HLYA 2FBKA 4L9VA 3LA2A 2HTJA 2LNBA 1ZG1A 3ZPLA 2DQRA 5DD8A 1AOYA 5LGTA 2GA2A 3HTSB 3RPQA 1R5HA 3R0JA 3F6VA 5DYMA 1UB9A 3KLOA 2FRHA 4UNOA 4MEXF 2R7FA 1IN7A 1O3TA 1R36A 2Q0OA 2HQNA 4HZFA 1ZRFA 4IHTA 1C0WA 4EV0A 3IRQA 2YU3A 3CUOA 3E5UA 3GZ6A 2VOOA 2ETHA 1HQCA 1IRGA 5BS6A 1W7PD 3FXUA 3CO7C 5D5UB 2RVCA 1CF7B 1BIAA 4WF2A 4EM2A 1K78A 1T98A 2ZBKA 1T39A 4CZZA 4XBFA 3HUGA 2Y75A 1XB4A 1R7JA 2FQ3A 1W4MA 2PQ8A 1O7LA 1SD5A 3RDIA 4BAYA 1TQPA 4GCVA 2HS5A 3F8CA 1V3FA 2VBZA 2QWWA 3B02A 2RQPA 3REOA 4WK8F 4ESJA 2VE8A 4YIIA 1MDMA 3GUDA 1LJ9A 2XUBA 5J6XA 2H6BA 3RKXA 3AAFA 5BPDA 2F5DA 5CVIA 1VTNC 2MH9A 3S2WA 4BNCA 3ZMTA 1ZH5A 2DK8A 4OOIA 3P9IA 5KVRA 1P92A 3HSEA 2CO5A 1J75A 4U88A 2PEXA 5E1ZB 4BQAA 2OU2A 4KIBA 1LNWA 1KGSA 4HF1A 1ZREA 4HF2A 3ECHA 3LA7A 3M8FA 1SMTA 3BWGA 4YFNF 5E20A 1QPMA 4L9TA 2MD5A 2EFWA 4JK1X 1KQ0A 1RZ4A 4LGWA 1ZHFA 1LVAA 1OYWA 4IVNA 1UFMA 5FD5A 4MEYF 3SQNA 4ESBA 5JFRA 1A04A 1OMIA 2ZCWA 1HXDA 4BHBA 2W24A 3ZP5A 1ZRDA 2PMUA 4M9XA 3I64A 2EK5A 4ASNA 1BOAA 2XVCA 5DEQA 1WKMA 3SZPA 3R61A 1FNNA 3TO9A 4EM0B 1H9TA 3HTUA 2V1XA 3Q9VA 2VN2A 2O6GE 4R79A 4L5JA 4RAYA 1FX7A 3RIRA 2PJPA 4L5IA 1S7AA 3U2RA 2CGPA 1FYMA 2MC3A 1XGMA 4LG0A 4OU0A 2IA1A 2RN7A 1XGOA 1PUEE 2HGCA 1OYIA 1IRFA 1RUOA 3P9KA 3T0YA 1FPQA 3I53A 2VBWA 3SHFA 4HYEA 4H0EA 2D1VA 4QLCU 3SFZA 5CLSA 1DP7P 3KEOA 3LSTA 1MJBA 4G8XA 1D5VA 5D5XB 3BZ6A 3B73A 2A61A 3LWFA 4MQVA 4HDVA 3GVAA 3JAMZ 3J81Z 2RNJA 2IRFG 4YG2F 1IZ1A 2DAOA 1HSJA 2LF8A 3GFIA 2UXXA 1I6XA 3G73A 4U7DA 4AIJA 1K78B 2GQQA 4G7ZF 1FY7A 1JE8A 3HRSA 1FSHA 3GEZA 3KP4A 2KIMA 2L4AA 5DDGA 4EM1A 3K1PA 2HOEA 5HVQC 4KT5C 3TDZC 2DU9A 2OZUA 5FLXZ 1JXSA 2O8XA 3IWZA 3K1NA 3K9TA 4MQ9F 3C18A 3IL2A 3ZN0A 3MQ0A 3Q5FA 3KZYA 2VBXA 4M71A 4KUMA 2MLKA 4R1HA 2W25A 2EA4A 3OV8A 3FMQA 3TDUC 2H94A 4BH9A 4MGRA 4HX8A 3F8BA 3ABTA 3MWMA 5LRRA 3PQJA 3TOAA 4AIHA 1YO5C 1K79A 4I98B 5LHGA 1U78A 3QOPA 1R1UA 1QO0D 1TQMA 4P9UA 4EGZA 1J59A 4LJZF 1MD0A 3VODA 2W85A 1L3LA 4WXDA 2IP2A 3FXQA 4PGHA 3I4PA 3EYIA 1J2XA 3MAJA 1EV7A 5L3EA 2VODA 1B4AA 1X3UA 2GA1A 4ETSA 3FXRA 3WG9A 4RGRA 3PQKA 4XRFA 2P6TA 1QBJA 1REPC 2VC0A 3H3UA 4LMYA 2OQGA 4XSXF 1R58A 2FMLA 4WCGA 2XKOA 3TQNA 2WWYA 4B09A 2E1CA 4EJWA 5HDNA 3M7GA 4I7HA 5JVTA 5CVUA 4LK0F 1YG2A 2J5PA 4ZYDA 1Z6TA 1UCRA 1FLIA 1LDDA 4L18B 1P4WA 1YTYA 2JPBA 4RGUA 1USSA 1WQ2A 1IN4A 1I1SA 3KE2A 5F64A 4IRGA 3L9FA 4BYYA 5FLXK 4ENMA 4ZZLA 3GWZA 1XSXA 4KN7X 1J9IA 5CYVA 2VOPA 1G3YA 4D0PA 1HW2A 4LK1F 1GXQA 2K86A 1SFEA 5A2QZ 4BHCA 3JTHA 4EJTA 1IXRC 1MZBA 4LLGF 4U0WA 5ED4A 1HKSA 2ZXJA 3HOTA 5BPIA 1K6OA 1CGPA 5E1WA 1YS7A 2CQKA 4M72A 3VFZA 3LAJA 3CLOA 4FX4A 1ZLJA 1G3TA 1G3SA 1XGNA 1BC7C 1XDUA 2V9VA 3RKYA 5D4RA 5K5QA 1UHWA 5HLGA 2QQ9A 4KMUX 4RB0A 2A68F 2V1DA 2XHKA 3V8LA 5H20A 1KYZA 4S05A 3QAHA 3FWEA 2FXAA 3HHGA 3RJPA 2M8EA 4Y13A 4KIGA 1SD7A 1G4DA 2K27A 4I0BA 3F8NA 3F6OA 1LEBA 4Y15A 3QPTA 1KU2A 2EFNA 2L02A 2P5VA 1XGSA 2UXNA 3FX3A 3KLNA 3J7AO 3C1DA 4U0YA 4OIRF 5L3CA 1F1ZA 1ONVA 1KA8A 1W5TA 2QBYB 3IKVA 4TV7A 3TGNA 4S04A 5K5OA 2COMA 2M30A 2BYVE 5J8FA 3MCZA 5IT9K 3GF2A 1FC3A 1U2WA 2DTRA 1G6NA 2FU4A 2FF4A 2EWNA 2DQLA 2MBFA 4O6JA 5ILVA 1P6RA 2RKHA 4MTDA 1S6LA 1TW2A 2HKXA 1EH8A 3WTZA 3LA3A 3GFLA 2HYFA 2M45A 2HYGD 5H6RA 3F3XA 3FMRA 3I59B 3JSOA 1XMKA 4IRHA 3WGHA 1XN7A 1BM9A 4OMZA 1YFHA 2FMYA 1IXSB 2XASA 3K1MA 3R6SA 4CYDA 1SAXA 3SXYA 1IN6A 5H6QA 3N97A 3U9GA 4KDPA 2STWA 2PBIA 3DV8A 1I27A 4CICA 3WE3A 4L9NA 4XLNF 1YW8A 1R23A 4G6DA 1EH6A 3HRMA 2FBHA 2FOKA 2GIVA 4RGXA 4ENJA 2Y0MA 1PDNC 1MJ9A 1AWCA 2KIFA 2CYYA 1H0MA 2RDPA 2ACJA 1J5YA 4R8HA 4ZYHA 1OPCA 4EJVA 1T6SA 2A07F 4A6DA 4IXAA 2RGVA 4PZJA 2BE5F 3I58A 1J7KA 3L7WA 2UWMA 1BI2A 3RPUA 5AONA 3E97A 2QM3A 1TQIA 3TKYA 2FE3A 3WE2A 4O3MA 2XV4S 1B1BA 1LDKB 1E2XA 1FZPB 2A69F 1FYLA 4M6YA 3DEUA 2UZKA 3EETA 4L0YB 4K2EA 3H3ZA 2L01A 3GFMA 2IPQX 2DLLA 2FSWA 2QQBA 2IA2A 3K2ZA 1RI7A 1ZAOA 1PP7U 4G94A 4UVCA 1KU9A 2O61A 4A0YA 2P8TA 5HOOA 4E70A 1ZG3A 3ERED 3D0SA 2MA3A 2ZJ2A 2CW0F 1QNTA 1ZLKA 2EJRA 1P4XA 2F5FA 1O3SA 5HDGA 3K0LA 3QU6A 5FFZA 3RI4A 1D8KA 3WU0A 5CVJA 2P7VB 2DPDA 5LHIA 1XD7A 4LB6B 3BJOA 4Z2YA 5LHHA 3V4GA 2DPUA 1FOKA 3WU1B 2VT2A 3BPXA 3F21A 5L3DA 1TW3A 4KA4A 4CO8A 4N9HA 2ZNZA 1QZZA 3IHUA 5CVRA 2HFHA 2Q8KA 4P55A 3V8JA 2BV6A 4P9FA 1FBSA 2DT5A 2X0LA 5DCFA 1U5TA 3V8KA 3M9AA 4DNCA 2KJCA 4WXHA 3WGIA 1R1TA 1BBYA 4EGYA 2ESHA 5LGNA 3MZYA 2HKOA 1FYKA 3KP2A 5ICEA 2PG4A 5HS9A 2VE9A 4ZYGA 5DUKA 4MHGA 3VOEA 4U0VA 2C6YA 4DQ2A 5LBQA 1UHMA 1ULYA 1XSDA 4O5VA 2HWVA 2XRNA 1Z9CA 4EJOA 4G7OF 3C7JA 1XCBA 4RB1A 1BIBA 2XKPA 1O3RA 1FBUA 1R1VA 1I1GA 2L3DA 3DKWA 4HQEA 1IF1A 1QQIA 2A6HF 3P9CA 3GW2A 3WTYC 4Q47A 4EMSA 3WODF 3ZQ7A 2NRAC 3I5UA 1RNLA 3E6CC 5BOXA 4Y17A 4KN4X 4EVIA 3RYPA 2QBYA 2P6SA 2OBPA 1G3WA 3OOPA 3N4MA 2H09A 1KYWA 2VXZA 3GFJA 4WX9A 2WV0A 3NEUA 2Z3YA 3FM5A 2RC4A 3SZTA 3O6BB 2EV0A 2PFBA 3QRFF 4HBLA 4A2UA 3JAMK 1W5SA 3J81K 4JQFA 1JHFA 2CSOA 4IPAA 4PCQA 3ISPA 5TRDA 2G9WA 1T0FA 4IF4A 6PAXA 2O0YA 3T8TA 4ZYEA 1I5ZA 1QZYA 3RYRA 1USTA 5AIQA 3ECOA 3HYIA 3GX4X 3M8EA 2J5OA 4EJUA 4XLPF 5K5RA 3MEXA 3LFKA 1T2KA 3I59A 2HZTA 3MZHA 3LQRA 3E6BA 1ZG5A 1L0OC 2A6EF 4UVAA 3HOSA 2XAFA 2GAUA 3ZMZA 5L3GA 4M74A 2EA2A 1MKMA 4XSZF 4UUVA 2QZ8A 2LKPA 3H92A 4KFCA 4M9SA 3TO6A 2ZMEB 2OA4A 2BGCA 4HX7A 1TLHB 4B8XA 5LGUA 1ON1A 3EQLF 2AXLA 1LDJA 4NQWA 3DPLC 2OZ6A 3TO7A 1IW7F 4OIPF 1RUNA 1DUXC 4BHPA 2FEZA 4KMFA 1EH7A 2KIUA 2WC2A 3ZMUA 3BROA 1OR7A 4RAZA 1FBQA 1Z05A 5ILSA 5TJJA 3ROUA 1ZYRF 3DFGA 5D6EA 1RIOH 1U5TB 2DI3A 1Z6RA 3BDDA 2XROA 2HTSA 4RS8A 1E17A 2DBBA 3E5XA 4HA8A 3ZMSA 3R60A 2W57A 3KP6A 1LB2A 3WTTC 3ULQB 5HS8A 2HR3A 2XAGA 4UHTA 3WTWC 1S8NA 2JSCA 2NYXA 1FSEA 1R5GA 2FBIA 2ZFWA 3ML6A 3NRVA 1R00A 2XAQA 4PGGA 2NS0A 1KU7A 3R0AA 1XDSA 3L2CA 2L54A 3I0TA 1S3JA 4HW0A 4CGZA 1WWXA 1YLFA 5JHUA 1D8JA 2E7WA 5ILUA 2X4HA 1GXPA 2ZO4A 1KQ9A 2ADUA 3BOQA 2A3SA 3QPHA 2LDUA 2XAHA 4FHTA 4M6XA 3EUHA 1LQ1A 1SFXA 2HQRA 4UXNA 5L3FA 4FX0A 3DQVC 3I54A 5L3BA 1K7AA 5K1YA 4BXUA 2QYOA 3WTSC 3EDPA 2H6CA 4RGSA 5BQTA 2AS5F 5A2QK 4LD5A 4ZZDA 2F5CA 4AD9A 3JW4A 3QP5A 1U8RA 4IHSA 2F2EA 4LLLA 2YX4A 4N0BA 4WWCA 1SD6A 1STZA 3I71A 4M73A 4PDKA 5ICCA 2KKOA 4ON0A 4I2OA 4HDUA 5JR3A 3RTRA 4GYIA 2NNYA 3FM3A 2A5YB 2Q2EA 1Z7UA 4M9ZA 4UV8A 2K4BA 3LQQA 2JT1A 3CUQA 2BBYA 3PFIA 1TTYA 2Z99A 3HSRA 2NAZA 2ISZA 4MTEA 5BMZA 1IN8A 3VB2A 3KP7A 4CXFA 5E8GA 2ZKZA 3TOBA 2CFXA 4A6EA 4L9JA 2V79A 1W7PB 5DCMB 2O3FA 2DW4A 1WSUA 4HQMA 2G7HA 3P7NA 2JZYA 5D6FA 5FB2A 2YX7A 4I09A 1IN5A 3GLXA 3FHZA 1B9MA 1DDNA 1JGSA 1BI0A 1IUYA 4IJAA 3LAPA 2E1NA 2FNAA 2IJLA 1YW9A 5HS7A 4LFUA 3JTGA 4KYWA 1Q1HA 2P7CB 5E1XA 5ERIA 5D5VB 5LLQA 1YS6A 2R7DA 3FMSA 3F8MA 2TDXA 1O57A 5FO5A 2GWRA 2YPRA 2W84A 3BJ6A 2FNPA 2O03A 3DXJF 3E6MA 2D1HA 4LLNA 2K4JA 1V4RA 3D5LA 4OIQF 2OD5A 3ZMVA 2OQRA 2XGXA 4GGGA 3QP6A 4ENKA 4HLXA 1P4AA 2VBYA 3IC7A 4G6QA 3J80Z 4ENNA 1B59A 4NHJA 3ZMDA 2HDCA 4ZH4F 5KK1A 1ZN2A 1JHHA 4GYGA 4YIFA 4G9YA 4KIFA 4HV5A 3IKTA 3CDHA 2KJBA 1Z1DA 1Y0UA 4QWQA 1DPUA 3CTAA 1ZGJA 4HV6A 1ZRCA 4LB5A 1IAWA 2GXBA 4A0XA 2H27A 4OMYA 3KETA 3DF8A 5J8CA 4EQQA 2Y48A 5D4SA 2PLYA 2P4WA 2MH2A 1BN5A 2ZMEA 3T8RA 2EFQA 4NB5A 4N9IA 1LEAA 3JSPA 2QVOA 2E7XA 4P5OA 2LF7A 5LEKA 1O7FA 3ELKA 3O2PE 3QU3A 5HDKA 1BI3A 2HEOA 1NHAA 2YR2A 3W6JB 3ZN1A 2EFPA 3GXOA 1H9GA 2DFIA 2D2WA 3F8FA 3F23A 2DK5A 3BPVA 5FFXA 3T1BA 2Z33A 3BP8A 4MNUA 2F5EA 1TNTA 1FWZA 4OIOF 3G3ZA 3R4KA 3CUQC 3L00A 2XAJA 1TBXA 2IW5A 1Z91A 2CWEA 5EEHA 3C3WA 4GXOA 5AIPA 3IRRA 5HLIA 3KFWX 3WTXC 1HW5A 3F72A 4RB2C 1D3YA 3WTVC 3CUQB 1KQ8A 2VC1A 2D45A 4Q5SF 2K7LA 1FP2A 1B9NA 1OYYA 1YW7A 1GVJA 2MLGA 4A0ZA 2FA5A 4HF0A 3NQOA 3COAC 2M87A 1FP1D 2EV5A 3IWFA 1MDMB 1HKTA 1F4KA 3F22A 1QGPA 3HHHA 2M1BA 3EYYA 3GZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HKQ A;  2CG4 A;  2IVM A;  2K02 A;  1GHC A;  2PMH A;  5FD6 A;  2KRF A;  3KP5 A;  4I02 A;  3J80 K;  1MJA A;  2IA0 A;  1PP8 F;  1XMA A;  1DPR A;  4UVB A;  2G7U A;  1R22 A;  1HBX G;  3MFK A;  1P2F A;  3V7S A;  3KZZ A;  3L09 A;  5E8I A;  2YSR A;  4U7B A;  1ODD A;  1ZAR A;  2B0L A;  2LSO A;  2JPC A;  5D8L B;  1HST A;  3GYH X;  1YQA A;  4AVP A;  3KP3 A;  2ISY A;  4KIC A;  3HRT A;  3T5X A;  1U3E M;  2WTE A;  2ESN A;  3BY6 A;  5CVV A;  2P5K A;  1F9N A;  1B6A A;  2ZNY A;  2PI0 A;  3O3K A;  3DPT A;  2QUF A;  5DD4 A;  4F7Z A;  2GZW A;  5LRS A;  4RB3 C;  4Q48 A;  4A5N A;  5E17 F;  1CF7 A;  5ICG A;  5ICF A;  3DP7 A;  4I01 A;  5LEJ A;  1S7O A;  2V6C A;  5F6F A;  1OKR A;  4YFX F;  5FGM A;  1BJA A;  4CDG A;  4A12 A;  1ON2 A;  1SFU A;  2Z9O A;  4LG0 B;  3BJA A;  1TNS A;  3E5Q A;  3M1E A;  2Z5U A;  4ESF A;  2P5L C;  4AWX B;  3U1D A;  3FF5 A;  1XSV A;  3WGG A;  4GO1 A;  4WXC A;  5F1R A;  5D8K B;  2IT0 A;  1U6G A;  4Q4Z F;  3WTU C;  3GO5 A;  1F5T A;  3KEQ A;  1HW1 A;  4KNY A;  3RKW A;  4JBA A;  5IT9 Z;  1W7P A;  3ABU A;  5DCM A;  5CJ9 A;  1BC8 C;  3K69 A;  1SD4 A;  4P96 A;  2EFO A;  2L4M A;  4HX4 A;  1IXC A;  1XCV A;  2ELH A;  2BEO A;  4A5M A;  1YYV A;  1YIO A;  1U5T C;  2STT A;  5E18 F;  4G7H F;  3Q9S A;  1WRJ A;  2DO7 A;  1S29 A;  4I0A A;  2JTV A;  5DV5 A;  3CJN A;  2NNN A;  2QEN A;  1FT9 A;  2OAZ A;  5DUI A;  3E6D A;  5EEG A;  3VEP A;  4CHU A;  2XIG A;  4AIK A;  2R3S A;  5D5W B;  5HLH A;  2VON A;  3FZV A;  1J0R A;  3W6K B;  3V7R A;  2QQA A;  4YFK F;  4HAM A;  2QLZ A;  2V1U A;  5JI6 A;  3HRU A;  2VT3 A;  3KCC A;  2GXG A;  2EV6 A;  2PN6 A;  3CO6 C;  4OIN F;  1KU3 A;  5IT3 A;  4FT8 A;  4HOB A;  4L0Z B;  4UV9 A;  2EB7 A;  2M5W A;  4IRI A;  3HIF A;  1BI1 A;  3HSF A;  2JRT A;  1ZGA A;  3V7C A;  3E3V A;  1T38 A;  1SMY F;  1MGT A;  1WI9 A;  2RV8 A;  1O3Q A;  4HLY A;  2FBK A;  4L9V A;  3LA2 A;  2HTJ A;  2LNB A;  1ZG1 A;  3ZPL A;  2DQR A;  5DD8 A;  1AOY A;  5LGT A;  2GA2 A;  3HTS B;  3RPQ A;  1R5H A;  3R0J A;  3F6V A;  5DYM A;  1UB9 A;  3KLO A;  2FRH A;  4UNO A;  4MEX F;  2R7F A;  1IN7 A;  1O3T A;  1R36 A;  2Q0O A;  2HQN A;  4HZF A;  1ZRF A;  4IHT A;  1C0W A;  4EV0 A;  3IRQ A;  2YU3 A;  3CUO A;  3E5U A;  3GZ6 A;  2VOO A;  2ETH A;  1HQC A;  1IRG A;  5BS6 A;  1W7P D;  3FXU A;  3CO7 C;  5D5U B;  2RVC A;  1CF7 B;  1BIA A;  4WF2 A;  4EM2 A;  1K78 A;  1T98 A;  2ZBK A;  1T39 A;  4CZZ A;  4XBF A;  3HUG A;  2Y75 A;  1XB4 A;  1R7J A;  2FQ3 A;  1W4M A;  2PQ8 A;  1O7L A;  1SD5 A;  3RDI A;  4BAY A;  1TQP A;  4GCV A;  2HS5 A;  3F8C A;  1V3F A;  2VBZ A;  2QWW A;  3B02 A;  2RQP A;  3REO A;  4WK8 F;  4ESJ A;  2VE8 A;  4YII A;  1MDM A;  3GUD A;  1LJ9 A;  2XUB A;  5J6X A;  2H6B A;  3RKX A;  3AAF A;  5BPD A;  2F5D A;  5CVI A;  1VTN C;  2MH9 A;  3S2W A;  4BNC A;  3ZMT A;  1ZH5 A;  2DK8 A;  4OOI A;  3P9I A;  5KVR A;  1P92 A;  3HSE A;  2CO5 A;  1J75 A;  4U88 A;  2PEX A;  5E1Z B;  4BQA A;  2OU2 A;  4KIB A;  1LNW A;  1KGS A;  4HF1 A;  1ZRE A;  4HF2 A;  3ECH A;  3LA7 A;  3M8F A;  1SMT A;  3BWG A;  4YFN F;  5E20 A;  1QPM A;  4L9T A;  2MD5 A;  2EFW A;  4JK1 X;  1KQ0 A;  1RZ4 A;  4LGW A;  1ZHF A;  1LVA A;  1OYW A;  4IVN A;  1UFM A;  5FD5 A;  4MEY F;  3SQN A;  4ESB A;  5JFR A;  1A04 A;  1OMI A;  2ZCW A;  1HXD A;  4BHB A;  2W24 A;  3ZP5 A;  1ZRD A;  2PMU A;  4M9X A;  3I64 A;  2EK5 A;  4ASN A;  1BOA A;  2XVC A;  5DEQ A;  1WKM A;  3SZP A;  3R61 A;  1FNN A;  3TO9 A;  4EM0 B;  1H9T A;  3HTU A;  2V1X A;  3Q9V A;  2VN2 A;  2O6G E;  4R79 A;  4L5J A;  4RAY A;  1FX7 A;  3RIR A;  2PJP A;  4L5I A;  1S7A A;  3U2R A;  2CGP A;  1FYM A;  2MC3 A;  1XGM A;  4LG0 A;  4OU0 A;  2IA1 A;  2RN7 A;  1XGO A;  1PUE E;  2HGC A;  1OYI A;  1IRF A;  1RUO A;  3P9K A;  3T0Y A;  1FPQ A;  3I53 A;  2VBW A;  3SHF A;  4HYE A;  4H0E A;  2D1V A;  4QLC U;  3SFZ A;  5CLS A;  1DP7 P;  3KEO A;  3LST A;  1MJB A;  4G8X A;  1D5V A;  5D5X B;  3BZ6 A;  3B73 A;  2A61 A;  3LWF A;  4MQV A;  4HDV A;  3GVA A;  3JAM Z;  3J81 Z;  2RNJ A;  2IRF G;  4YG2 F;  1IZ1 A;  2DAO A;  1HSJ A;  2LF8 A;  3GFI A;  2UXX A;  1I6X A;  3G73 A;  4U7D A;  4AIJ A;  1K78 B;  2GQQ A;  4G7Z F;  1FY7 A;  1JE8 A;  3HRS A;  1FSH A;  3GEZ A;  3KP4 A;  2KIM A;  2L4A A;  5DDG A;  4EM1 A;  3K1P A;  2HOE A;  5HVQ C;  4KT5 C;  3TDZ C;  2DU9 A;  2OZU A;  5FLX Z;  1JXS A;  2O8X A;  3IWZ A;  3K1N A;  3K9T A;  4MQ9 F;  3C18 A;  3IL2 A;  3ZN0 A;  3MQ0 A;  3Q5F A;  3KZY A;  2VBX A;  4M71 A;  4KUM A;  2MLK A;  4R1H A;  2W25 A;  2EA4 A;  3OV8 A;  3FMQ A;  3TDU C;  2H94 A;  4BH9 A;  4MGR A;  4HX8 A;  3F8B A;  3ABT A;  3MWM A;  5LRR A;  3PQJ A;  3TOA A;  4AIH A;  1YO5 C;  1K79 A;  4I98 B;  5LHG A;  1U78 A;  3QOP A;  1R1U A;  1QO0 D;  1TQM A;  4P9U A;  4EGZ A;  1J59 A;  4LJZ F;  1MD0 A;  3VOD A;  2W85 A;  1L3L A;  4WXD A;  2IP2 A;  3FXQ A;  4PGH A;  3I4P A;  3EYI A;  1J2X A;  3MAJ A;  1EV7 A;  5L3E A;  2VOD A;  1B4A A;  1X3U A;  2GA1 A;  4ETS A;  3FXR A;  3WG9 A;  4RGR A;  3PQK A;  4XRF A;  2P6T A;  1QBJ A;  1REP C;  2VC0 A;  3H3U A;  4LMY A;  2OQG A;  4XSX F;  1R58 A;  2FML A;  4WCG A;  2XKO A;  3TQN A;  2WWY A;  4B09 A;  2E1C A;  4EJW A;  5HDN A;  3M7G A;  4I7H A;  5JVT A;  5CVU A;  4LK0 F;  1YG2 A;  2J5P A;  4ZYD A;  1Z6T A;  1UCR A;  1FLI A;  1LDD A;  4L18 B;  1P4W A;  1YTY A;  2JPB A;  4RGU A;  1USS A;  1WQ2 A;  1IN4 A;  1I1S A;  3KE2 A;  5F64 A;  4IRG A;  3L9F A;  4BYY A;  5FLX K;  4ENM A;  4ZZL A;  3GWZ A;  1XSX A;  4KN7 X;  1J9I A;  5CYV A;  2VOP A;  1G3Y A;  4D0P A;  1HW2 A;  4LK1 F;  1GXQ A;  2K86 A;  1SFE A;  5A2Q Z;  4BHC A;  3JTH A;  4EJT A;  1IXR C;  1MZB A;  4LLG F;  4U0W A;  5ED4 A;  1HKS A;  2ZXJ A;  3HOT A;  5BPI A;  1K6O A;  1CGP A;  5E1W A;  1YS7 A;  2CQK A;  4M72 A;  3VFZ A;  3LAJ A;  3CLO A;  4FX4 A;  1ZLJ A;  1G3T A;  1G3S A;  1XGN A;  1BC7 C;  1XDU A;  2V9V A;  3RKY A;  5D4R A;  5K5Q A;  1UHW A;  5HLG A;  2QQ9 A;  4KMU X;  4RB0 A;  2A68 F;  2V1D A;  2XHK A;  3V8L A;  5H20 A;  1KYZ A;  4S05 A;  3QAH A;  3FWE A;  2FXA A;  3HHG A;  3RJP A;  2M8E A;  4Y13 A;  4KIG A;  1SD7 A;  1G4D A;  2K27 A;  4I0B A;  3F8N A;  3F6O A;  1LEB A;  4Y15 A;  3QPT A;  1KU2 A;  2EFN A;  2L02 A;  2P5V A;  1XGS A;  2UXN A;  3FX3 A;  3KLN A;  3J7A O;  3C1D A;  4U0Y A;  4OIR F;  5L3C A;  1F1Z A;  1ONV A;  1KA8 A;  1W5T A;  2QBY B;  3IKV A;  4TV7 A;  3TGN A;  4S04 A;  5K5O A;  2COM A;  2M30 A;  2BYV E;  5J8F A;  3MCZ A;  5IT9 K;  3GF2 A;  1FC3 A;  1U2W A;  2DTR A;  1G6N A;  2FU4 A;  2FF4 A;  2EWN A;  2DQL A;  2MBF A;  4O6J A;  5ILV A;  1P6R A;  2RKH A;  4MTD A;  1S6L A;  1TW2 A;  2HKX A;  1EH8 A;  3WTZ A;  3LA3 A;  3GFL A;  2HYF A;  2M45 A;  2HYG D;  5H6R A;  3F3X A;  3FMR A;  3I59 B;  3JSO A;  1XMK A;  4IRH A;  3WGH A;  1XN7 A;  1BM9 A;  4OMZ A;  1YFH A;  2FMY A;  1IXS B;  2XAS A;  3K1M A;  3R6S A;  4CYD A;  1SAX A;  3SXY A;  1IN6 A;  5H6Q A;  3N97 A;  3U9G A;  4KDP A;  2STW A;  2PBI A;  3DV8 A;  1I27 A;  4CIC A;  3WE3 A;  4L9N A;  4XLN F;  1YW8 A;  1R23 A;  4G6D A;  1EH6 A;  3HRM A;  2FBH A;  2FOK A;  2GIV A;  4RGX A;  4ENJ A;  2Y0M A;  1PDN C;  1MJ9 A;  1AWC A;  2KIF A;  2CYY A;  1H0M A;  2RDP A;  2ACJ A;  1J5Y A;  4R8H A;  4ZYH A;  1OPC A;  4EJV A;  1T6S A;  2A07 F;  4A6D A;  4IXA A;  2RGV A;  4PZJ A;  2BE5 F;  3I58 A;  1J7K A;  3L7W A;  2UWM A;  1BI2 A;  3RPU A;  5AON A;  3E97 A;  2QM3 A;  1TQI A;  3TKY A;  2FE3 A;  3WE2 A;  4O3M A;  2XV4 S;  1B1B A;  1LDK B;  1E2X A;  1FZP B;  2A69 F;  1FYL A;  4M6Y A;  3DEU A;  2UZK A;  3EET A;  4L0Y B;  4K2E A;  3H3Z A;  2L01 A;  3GFM A;  2IPQ X;  2DLL A;  2FSW A;  2QQB A;  2IA2 A;  3K2Z A;  1RI7 A;  1ZAO A;  1PP7 U;  4G94 A;  4UVC A;  1KU9 A;  2O61 A;  4A0Y A;  2P8T A;  5HOO A;  4E70 A;  1ZG3 A;  3ERE D;  3D0S A;  2MA3 A;  2ZJ2 A;  2CW0 F;  1QNT A;  1ZLK A;  2EJR A;  1P4X A;  2F5F A;  1O3S A;  5HDG A;  3K0L A;  3QU6 A;  5FFZ A;  3RI4 A;  1D8K A;  3WU0 A;  5CVJ A;  2P7V B;  2DPD A;  5LHI A;  1XD7 A;  4LB6 B;  3BJO A;  4Z2Y A;  5LHH A;  3V4G A;  2DPU A;  1FOK A;  3WU1 B;  2VT2 A;  3BPX A;  3F21 A;  5L3D A;  1TW3 A;  4KA4 A;  4CO8 A;  4N9H A;  2ZNZ A;  1QZZ A;  3IHU A;  5CVR A;  2HFH A;  2Q8K A;  4P55 A;  3V8J A;  2BV6 A;  4P9F A;  1FBS A;  2DT5 A;  2X0L A;  5DCF A;  1U5T A;  3V8K A;  3M9A A;  4DNC A;  2KJC A;  4WXH A;  3WGI A;  1R1T A;  1BBY A;  4EGY A;  2ESH A;  5LGN A;  3MZY A;  2HKO A;  1FYK A;  3KP2 A;  5ICE A;  2PG4 A;  5HS9 A;  2VE9 A;  4ZYG A;  5DUK A;  4MHG A;  3VOE A;  4U0V A;  2C6Y A;  4DQ2 A;  5LBQ A;  1UHM A;  1ULY A;  1XSD A;  4O5V A;  2HWV A;  2XRN A;  1Z9C A;  4EJO A;  4G7O F;  3C7J A;  1XCB A;  4RB1 A;  1BIB A;  2XKP A;  1O3R A;  1FBU A;  1R1V A;  1I1G A;  2L3D A;  3DKW A;  4HQE A;  1IF1 A;  1QQI A;  2A6H F;  3P9C A;  3GW2 A;  3WTY C;  4Q47 A;  4EMS A;  3WOD F;  3ZQ7 A;  2NRA C;  3I5U A;  1RNL A;  3E6C C;  5BOX A;  4Y17 A;  4KN4 X;  4EVI A;  3RYP A;  2QBY A;  2P6S A;  2OBP A;  1G3W A;  3OOP A;  3N4M A;  2H09 A;  1KYW A;  2VXZ A;  3GFJ A;  4WX9 A;  2WV0 A;  3NEU A;  2Z3Y A;  3FM5 A;  2RC4 A;  3SZT A;  3O6B B;  2EV0 A;  2PFB A;  3QRF F;  4HBL A;  4A2U A;  3JAM K;  1W5S A;  3J81 K;  4JQF A;  1JHF A;  2CSO A;  4IPA A;  4PCQ A;  3ISP A;  5TRD A;  2G9W A;  1T0F A;  4IF4 A;  6PAX A;  2O0Y A;  3T8T A;  4ZYE A;  1I5Z A;  1QZY A;  3RYR A;  1UST A;  5AIQ A;  3ECO A;  3HYI A;  3GX4 X;  3M8E A;  2J5O A;  4EJU A;  4XLP F;  5K5R A;  3MEX A;  3LFK A;  1T2K A;  3I59 A;  2HZT A;  3MZH A;  3LQR A;  3E6B A;  1ZG5 A;  1L0O C;  2A6E F;  4UVA A;  3HOS A;  2XAF A;  2GAU A;  3ZMZ A;  5L3G A;  4M74 A;  2EA2 A;  1MKM A;  4XSZ F;  4UUV A;  2QZ8 A;  2LKP A;  3H92 A;  4KFC A;  4M9S A;  3TO6 A;  2ZME B;  2OA4 A;  2BGC A;  4HX7 A;  1TLH B;  4B8X A;  5LGU A;  1ON1 A;  3EQL F;  2AXL A;  1LDJ A;  4NQW A;  3DPL C;  2OZ6 A;  3TO7 A;  1IW7 F;  4OIP F;  1RUN A;  1DUX C;  4BHP A;  2FEZ A;  4KMF A;  1EH7 A;  2KIU A;  2WC2 A;  3ZMU A;  3BRO A;  1OR7 A;  4RAZ A;  1FBQ A;  1Z05 A;  5ILS A;  5TJJ A;  3ROU A;  1ZYR F;  3DFG A;  5D6E A;  1RIO H;  1U5T B;  2DI3 A;  1Z6R A;  3BDD A;  2XRO A;  2HTS A;  4RS8 A;  1E17 A;  2DBB A;  3E5X A;  4HA8 A;  3ZMS A;  3R60 A;  2W57 A;  3KP6 A;  1LB2 A;  3WTT C;  3ULQ B;  5HS8 A;  2HR3 A;  2XAG A;  4UHT A;  3WTW C;  1S8N A;  2JSC A;  2NYX A;  1FSE A;  1R5G A;  2FBI A;  2ZFW A;  3ML6 A;  3NRV A;  1R00 A;  2XAQ A;  4PGG A;  2NS0 A;  1KU7 A;  3R0A A;  1XDS A;  3L2C A;  2L54 A;  3I0T A;  1S3J A;  4HW0 A;  4CGZ A;  1WWX A;  1YLF A;  5JHU A;  1D8J A;  2E7W A;  5ILU A;  2X4H A;  1GXP A;  2ZO4 A;  1KQ9 A;  2ADU A;  3BOQ A;  2A3S A;  3QPH A;  2LDU A;  2XAH A;  4FHT A;  4M6X A;  3EUH A;  1LQ1 A;  1SFX A;  2HQR A;  4UXN A;  5L3F A;  4FX0 A;  3DQV C;  3I54 A;  5L3B A;  1K7A A;  5K1Y A;  4BXU A;  2QYO A;  3WTS C;  3EDP A;  2H6C A;  4RGS A;  5BQT A;  2AS5 F;  5A2Q K;  4LD5 A;  4ZZD A;  2F5C A;  4AD9 A;  3JW4 A;  3QP5 A;  1U8R A;  4IHS A;  2F2E A;  4LLL A;  2YX4 A;  4N0B A;  4WWC A;  1SD6 A;  1STZ A;  3I71 A;  4M73 A;  4PDK A;  5ICC A;  2KKO A;  4ON0 A;  4I2O A;  4HDU A;  5JR3 A;  3RTR A;  4GYI A;  2NNY A;  3FM3 A;  2A5Y B;  2Q2E A;  1Z7U A;  4M9Z A;  4UV8 A;  2K4B A;  3LQQ A;  2JT1 A;  3CUQ A;  2BBY A;  3PFI A;  1TTY A;  2Z99 A;  3HSR A;  2NAZ A;  2ISZ A;  4MTE A;  5BMZ A;  1IN8 A;  3VB2 A;  3KP7 A;  4CXF A;  5E8G A;  2ZKZ A;  3TOB A;  2CFX A;  4A6E A;  4L9J A;  2V79 A;  1W7P B;  5DCM B;  2O3F A;  2DW4 A;  1WSU A;  4HQM A;  2G7H A;  3P7N A;  2JZY A;  5D6F A;  5FB2 A;  2YX7 A;  4I09 A;  1IN5 A;  3GLX A;  3FHZ A;  1B9M A;  1DDN A;  1JGS A;  1BI0 A;  1IUY A;  4IJA A;  3LAP A;  2E1N A;  2FNA A;  2IJL A;  1YW9 A;  5HS7 A;  4LFU A;  3JTG A;  4KYW A;  1Q1H A;  2P7C B;  5E1X A;  5ERI A;  5D5V B;  5LLQ A;  1YS6 A;  2R7D A;  3FMS A;  3F8M A;  2TDX A;  1O57 A;  5FO5 A;  2GWR A;  2YPR A;  2W84 A;  3BJ6 A;  2FNP A;  2O03 A;  3DXJ F;  3E6M A;  2D1H A;  4LLN A;  2K4J A;  1V4R A;  3D5L A;  4OIQ F;  2OD5 A;  3ZMV A;  2OQR A;  2XGX A;  4GGG A;  3QP6 A;  4ENK A;  4HLX A;  1P4A A;  2VBY A;  3IC7 A;  4G6Q A;  3J80 Z;  4ENN A;  1B59 A;  4NHJ A;  3ZMD A;  2HDC A;  4ZH4 F;  5KK1 A;  1ZN2 A;  1JHH A;  4GYG A;  4YIF A;  4G9Y A;  4KIF A;  4HV5 A;  3IKT A;  3CDH A;  2KJB A;  1Z1D A;  1Y0U A;  4QWQ A;  1DPU A;  3CTA A;  1ZGJ A;  4HV6 A;  1ZRC A;  4LB5 A;  1IAW A;  2GXB A;  4A0X A;  2H27 A;  4OMY A;  3KET A;  3DF8 A;  5J8C A;  4EQQ A;  2Y48 A;  5D4S A;  2PLY A;  2P4W A;  2MH2 A;  1BN5 A;  2ZME A;  3T8R A;  2EFQ A;  4NB5 A;  4N9I A;  1LEA A;  3JSP A;  2QVO A;  2E7X A;  4P5O A;  2LF7 A;  5LEK A;  1O7F A;  3ELK A;  3O2P E;  3QU3 A;  5HDK A;  1BI3 A;  2HEO A;  1NHA A;  2YR2 A;  3W6J B;  3ZN1 A;  2EFP A;  3GXO A;  1H9G A;  2DFI A;  2D2W A;  3F8F A;  3F23 A;  2DK5 A;  3BPV A;  5FFX A;  3T1B A;  2Z33 A;  3BP8 A;  4MNU A;  2F5E A;  1TNT A;  1FWZ A;  4OIO F;  3G3Z A;  3R4K A;  3CUQ C;  3L00 A;  2XAJ A;  1TBX A;  2IW5 A;  1Z91 A;  2CWE A;  5EEH A;  3C3W A;  4GXO A;  5AIP A;  3IRR A;  5HLI A;  3KFW X;  3WTX C;  1HW5 A;  3F72 A;  4RB2 C;  1D3Y A;  3WTV C;  3CUQ B;  1KQ8 A;  2VC1 A;  2D45 A;  4Q5S F;  2K7L A;  1FP2 A;  1B9N A;  1OYY A;  1YW7 A;  1GVJ A;  2MLG A;  4A0Z A;  2FA5 A;  4HF0 A;  3NQO A;  3COA C;  2M87 A;  1FP1 D;  2EV5 A;  3IWF A;  1MDM B;  1HKT A;  1F4K A;  3F22 A;  1QGP A;  3HHH A;  2M1B A;  3EYY A;  3GZ5 A; 
#chains in the Genus database with same CATH topology
 1HKQ A;  1BW5 A;  2CG4 A;  2IVM A;  5IP7 J;  4BJ6 C;  1E3P A;  2K02 A;  1GHC A;  3CMM A;  2LY9 A;  2PMH A;  2XPW A;  3CJR B;  5FD6 A;  1WZ2 A;  2WA0 A;  2OTL I;  1JGG A;  2KRF A;  5IYD J;  2V1N A;  5JLW A;  1FOY A;  3KP5 A;  3BTJ A;  1LFB A;  4I02 A;  3J80 K;  3QOD A;  3MKZ A;  3L2R A;  1MJA A;  2BVL A;  3K4J A;  2IA0 A;  4KIS A;  3HKZ N;  1PP8 F;  1XMA A;  1DPR A;  3ABL H;  4B1R A;  1DQU A;  4UVB A;  3SFI A;  2G7U A;  1IJW C;  1R22 A;  1HBX G;  3MFK A;  1P2F A;  3V7S A;  2E71 A;  1VQK I;  4ZDP A;  5F0C A;  3KZZ A;  3L1P A;  3L09 A;  4OWR B;  5E8I A;  2YSR A;  4U7B A;  1ODD A;  1ZAR A;  2B0L A;  2E19 A;  2LSO A;  3C2B A;  2JPC A;  2W4S A;  1HST A;  2ME0 A;  5D8L B;  3GYH X;  1YQA A;  1U0J A;  4AVP A;  2EIN H;  3KP3 A;  1QVU A;  3OS2 A;  1OCT C;  2VQC A;  2ISY A;  1ZR4 A;  1P9Q C;  4KIC A;  3HRT A;  3T5X A;  1U3E M;  2WTE A;  3HGG A;  2WY7 Q;  4BE0 A;  1ERD A;  2XB0 X;  1NK3 P;  3OYN A;  2ESN A;  2VUM J;  3BY6 A;  5CVV A;  1K4T A;  2P5K A;  1F9N A;  1APL C;  5FLM J;  1B6A A;  2ZNY A;  2PI0 A;  3O3K A;  3A01 B;  3DPT A;  2QUF A;  3BTL A;  3JCU C;  5DD4 A;  4CCJ A;  1AKH B;  4F7Z A;  2GZW A;  3DKX A;  2F4I A;  5LRS A;  4RB3 C;  4Q48 A;  3FXJ A;  4A5N A;  2A6T A;  5E17 F;  1MMD A;  1CF7 A;  5ICG A;  5ICF A;  3DP7 A;  1R71 A;  4I01 A;  1UG0 A;  3KIO A;  2DA4 A;  4AID A;  2MYS A;  5LEJ A;  3HXL A;  1S7O A;  4HEA 2;  1SC7 A;  2V6C A;  5F6F A;  2B9S A;  2IXS A;  1OKR A;  4YFX F;  4N4N B;  1WJ5 A;  5M5Y J;  1LKX A;  5FGM A;  1BJA A;  4CDG A;  3BT9 A;  1T56 A;  4A12 A;  3OYL A;  1ON2 A;  1SFU A;  2Z9O A;  4LG0 B;  3BJA A;  4PJJ A;  3IV5 A;  1V54 H;  2ZME C;  1TNS A;  3OWT A;  2ZXH A;  1T08 B;  3W6V A;  1VQ5 I;  4BJT A;  4J19 A;  2DFF A;  1ZEL A;  3E5Q A;  3M1E A;  4BEH A;  1TWC J;  5KNL A;  2Z5U A;  3FIW A;  1O4X A;  2CMP A;  2VJI A;  4ESF A;  2WV1 A;  3DEW A;  2P5L C;  4AWX B;  3U1D A;  3FF5 A;  4KJZ A;  1XSV A;  2R7U A;  3WGG A;  1VQN I;  4GO1 A;  4WXC A;  5F1R A;  5D8K B;  1MMN A;  2IS2 A;  3C2H A;  2IT0 A;  1SFO J;  1U6G A;  2HYJ A;  4Q4Z F;  2OCE A;  4GRI A;  5FLV A;  3WTU C;  3GO5 A;  1G59 A;  1F5T A;  3KEQ A;  1HW1 A;  2LVS A;  4KNY A;  3RKW A;  4JBA A;  5IT9 Z;  1ENH A;  2JSP A;  2MW8 A;  3ABM H;  1W7P A;  4C3I J;  4IHX A;  3ABU A;  5DCM A;  5CJ9 A;  3PM1 A;  3L2V A;  1BC8 C;  3U1K A;  3K69 A;  1SD4 A;  4P96 A;  2EFO A;  2L4M A;  4HX4 A;  1IXC A;  1XCV A;  2ELH A;  3VWB A;  2BEO A;  2CH0 A;  4A5M A;  1YYV A;  3UNG C;  1YIO A;  1U5T C;  2STT A;  2LBF B;  2GOX B;  1LPQ A;  5E18 F;  1S5L C;  4A3C J;  4G7H F;  2HQA A;  5KAI C;  4A93 J;  3PO3 J;  3Q9S A;  1WRJ A;  2EZK A;  2DO7 A;  1S29 A;  4I0A A;  2E36 A;  2JTV A;  5DV5 A;  3CQZ J;  5HLT A;  3CJN A;  2NNN A;  3K4L A;  2WB1 N;  4BGD A;  2QEN A;  5HOD A;  3JRD A;  4NC6 A;  2KRC A;  1FT9 A;  1Y56 A;  2OAZ A;  2ZC2 A;  3TL4 X;  4V2F A;  5DUI A;  3E6D A;  3HG9 A;  1OFC X;  5EEG A;  3VEP A;  3S16 J;  1JTY A;  4CHU A;  1LE8 B;  2XIG A;  4AIK A;  2R3S A;  5D5W B;  5HLH A;  2VON A;  1IDZ A;  5KHD A;  3FZV A;  1J0R A;  3TBI A;  1JUP A;  3W6K B;  3V7R A;  2QQA A;  3NAR A;  4H4K C;  4YFK F;  5EZH A;  4HAM A;  3O8H A;  1W0T A;  2QLZ A;  2V1U A;  4A3L J;  1Y0N A;  5JI6 A;  3HRU A;  2VT3 A;  3KCC A;  2GXG A;  2EV6 A;  4II2 A;  2PN6 A;  3CO6 C;  2WAQ N;  4OIN F;  1KU3 A;  5IT3 A;  4FT8 A;  4ITV A;  1X58 A;  3RSN A;  4HOB A;  4L0Z B;  4UV9 A;  2EB7 A;  2M5W A;  3QPS A;  3RKQ A;  4IRI A;  3HIF A;  1AA7 A;  1BI1 A;  1WH5 A;  3CCY A;  3HSF A;  2JRT A;  1ZGA A;  5IY5 H;  3V7C A;  3OYG A;  4RLQ A;  1JKQ C;  2XRL A;  3E3V A;  3LNQ A;  1T38 A;  4FET A;  1SMY F;  2DA7 A;  3OMY A;  3ASO H;  1MGT A;  1WI9 A;  2F6C A;  2KMU A;  2RV8 A;  1O3Q A;  3OOU A;  4HLY A;  1QHG A;  1D1A A;  3BG9 A;  2FBK A;  4L9V A;  3LA2 A;  2HTJ A;  2LNB A;  1ZG1 A;  3ZPL A;  5IPA A;  4BE2 A;  2DQR A;  5DD8 A;  1AOY A;  2V7F A;  4B3A A;  4ZDO A;  1IDY A;  5LGT A;  2GA2 A;  3SZG A;  1ETX A;  1V5G A;  4FE4 A;  2QGU A;  3RPQ A;  1R5H A;  3R0J A;  3HTS B;  1XG1 A;  3F6V A;  2E35 A;  5DYM A;  5C4J J;  1UB9 A;  3KLO A;  2ZSH B;  2FRH A;  4UNO A;  1ZK8 A;  4BQN A;  1YJ9 I;  4DYC A;  4BU2 A;  2CW8 A;  4MEX F;  2R7F A;  2CQX A;  1NK2 P;  3ABK H;  1IN7 A;  3LSG A;  1O3T A;  2NVT J;  3TW6 A;  2ID3 A;  1D0X A;  2BY1 A;  3H3V K;  1F43 A;  1R36 A;  2Q0O A;  1GLN A;  1YX5 A;  1SVM A;  4XRS G;  2HQN A;  4HZF A;  1LVK A;  1ZRF A;  4IHT A;  3I4N J;  1C0W A;  1QVT A;  4EV0 A;  3IRQ A;  2MG4 A;  4F92 B;  2YU3 A;  5M5W J;  3PSI A;  1SAN A;  1MSE C;  3CUO A;  2JVH A;  3E5U A;  2ZJQ F;  3GZ6 A;  3DPU A;  3HOW J;  2VOO A;  5F0H A;  2R7W A;  1UZC A;  3A2K A;  2ETH A;  1HQC A;  1ETQ A;  2H1K A;  1IRG A;  3PNT A;  5BS6 A;  1A35 A;  1YE9 A;  1W7P D;  2KLO A;  1MMS A;  2HXI A;  1H89 C;  3FXU A;  3CO7 C;  4IX7 A;  5D5U B;  2F4M B;  1WJA A;  1WJC A;  2RVC A;  3ZQF A;  4ZJZ A;  1R5I D;  1CF7 B;  2R7T A;  1XMX A;  1BIA A;  4BAC A;  1WGX A;  3DLL F;  3K4K A;  4V2G A;  2DN0 A;  4WF2 A;  4HNU A;  4EM2 A;  1K78 A;  1VQ9 I;  1T98 A;  2ZBK A;  3CMA I;  2M8G X;  1T39 A;  4CZZ A;  4XBF A;  3B6A A;  4X1E A;  3BR3 A;  3HUG A;  3W2V A;  5H2F C;  2Y75 A;  3LSR A;  2M7A A;  3KX2 A;  2HOT A;  1MBG A;  1QU3 A;  1XB4 A;  1UMQ A;  2VB6 A;  1R7J A;  2QA4 I;  2FQ3 A;  1W4M A;  4FTH A;  2KRH A;  2M3A A;  3M07 A;  4BEH B;  2PQ8 A;  1O7L A;  1SD5 A;  3QWL A;  3RDI A;  2DXI A;  1BA5 A;  1J09 A;  1ETW A;  4BAY A;  1TQP A;  4GCV A;  2HS5 A;  3F8C A;  1V3F A;  2VBZ A;  2O5R A;  2QWW A;  3B02 A;  1HF0 A;  3H5N A;  4QPO A;  2DMQ A;  2RQP A;  1JTX A;  3REO A;  1Y1V J;  4WK8 F;  3Q3S A;  4ESJ A;  2VE8 A;  2XGE A;  4YII A;  4DYQ A;  2R7S A;  4XQF A;  4C2T A;  1MDM A;  3ZOB A;  5E3N A;  1A31 A;  2IEK A;  3ZQQ A;  2M7B A;  3GUD A;  2VAS A;  4Y52 J;  1LJ9 A;  2XUB A;  5J6X A;  2O7O A;  2LRE A;  1UG2 A;  2H6B A;  3RKX A;  2EIK H;  3AAF A;  5BPD A;  2F5D A;  5CVI A;  1VTN C;  2Y0S A;  2L7M P;  3AL0 C;  3AFH A;  1JT0 A;  3BR1 A;  2MH9 A;  3S2W A;  4BNC A;  3ZMT A;  4M6V A;  4C30 A;  3VPR A;  3ZCO A;  3QQA A;  1ZH5 A;  2DK8 A;  1TWF J;  4OOI A;  3P9I A;  5KVR A;  1P92 A;  4E7Z A;  3HSE A;  1BR4 A;  2CO5 A;  1J75 A;  4U88 A;  3I56 I;  2PEX A;  4OAY A;  5E1Z B;  4BQA A;  2OU2 A;  4KIB A;  1LNW A;  1KGS A;  2BZT A;  4IQ4 A;  4HF1 A;  1ZRE A;  1D1C A;  2VQH A;  4HF2 A;  3ECH A;  2R7O A;  3LA7 A;  4D1Q A;  3M8F A;  1SMT A;  2L9N A;  3BWG A;  4YFN F;  4AYB N;  2R7V A;  3CC2 I;  2LY1 A;  3SEQ A;  1WPK A;  4J01 A;  5E20 A;  3S8P A;  1QPM A;  4L9T A;  2MD5 A;  2EFW A;  4JK1 X;  1KQ0 A;  1RZ4 A;  1W5C C;  4LGW A;  3UKG A;  1ZHF A;  4B43 A;  1LVA A;  1OYW A;  3BG7 A;  4IVN A;  2K9L A;  4A3E J;  2WY8 Q;  1UFM A;  5FD5 A;  4MEY F;  3MN2 A;  3SQN A;  3CLQ A;  3VSK A;  5IOZ A;  2K9M A;  4ESB A;  5JFR A;  1A04 A;  1YOV B;  1POG A;  1OMI A;  1S72 I;  2ZCW A;  1HXD A;  3TP0 A;  1YHQ I;  4BHB A;  2HNH A;  3FDY A;  2W24 A;  2X48 A;  3ZP5 A;  1ZRD A;  2DMU A;  2QSG X;  2PMU A;  4M9X A;  2IGN A;  3I64 A;  2EK5 A;  4ASN A;  1BOA A;  4F52 A;  1VFC A;  3GTP J;  1MBJ A;  2XGD A;  1VQL I;  2XVC A;  1D0Z A;  3I55 I;  5FJ8 J;  4CUG A;  3ZQL A;  5DEQ A;  1AKH A;  1WKM A;  3SZP A;  4HNV A;  3R61 A;  1FNN A;  5J1U A;  3TO9 A;  1IRX A;  2WBM A;  4EM0 B;  1H9T A;  3HTU A;  2V1X A;  1SAU A;  3Q9V A;  5IOY A;  2VN2 A;  2O6G E;  2A05 A;  1U8B A;  3S1N J;  4R79 A;  4L5J A;  4RAY A;  1SVL A;  2PMZ A;  1FX7 A;  3GTM J;  3RIR A;  2PJP A;  3K4C A;  4L5I A;  1S7A A;  3U2R A;  2CGP A;  5IP9 J;  4RA2 A;  1FYM A;  2MC3 A;  1XGM A;  4LG0 A;  2NOG A;  4OU0 A;  2IA1 A;  2RN7 A;  3SDB A;  1JKR C;  4NUB A;  1XGO A;  1PUE E;  1FMW A;  2HGC A;  3FK6 A;  5J1R A;  1OYI A;  1IRF A;  1RUO A;  2OC6 A;  5C3E J;  3P9K A;  3FXL A;  3T0Y A;  3CES A;  1FPQ A;  3I53 A;  2VBW A;  1KZH A;  3SHF A;  2NOJ B;  4I99 C;  2VQG A;  2BY3 A;  5B1B H;  2LR8 A;  2A5W A;  4HYE A;  2O9L A;  1P7I A;  2X6O A;  1YIJ I;  4H0E A;  2D1V A;  1ITY A;  4QLC U;  3SFZ A;  5CLS A;  2VJ5 A;  2MGQ A;  1IO2 A;  1DP7 P;  3H1C A;  3KEO A;  3G4S I;  3LST A;  1MJB A;  4G8X A;  2X1E A;  1D5V A;  5D5X B;  1QRY A;  1S9H A;  3BZ6 A;  3B73 A;  2A61 A;  3DKY A;  3LWF A;  4MQV A;  4HDV A;  3GVA A;  3JAM Z;  3LFU A;  3J81 Z;  1Z0X A;  2RNJ A;  2IRF G;  4F91 B;  4YG2 F;  5GAG J;  1IZ1 A;  4HG2 A;  2WAF A;  2DAO A;  1HSJ A;  2LF8 A;  2VQL A;  3G71 I;  4DBR A;  3GFI A;  1VQ8 I;  1LUJ B;  2UXX A;  1X4O A;  1I6X A;  3G73 A;  4U7D A;  4AIJ A;  1K78 B;  1WFX A;  2GQQ A;  4XKC A;  4G7Z F;  3OYI A;  1EF4 A;  1FY7 A;  4MIM A;  3PFY A;  3ZRG A;  3JRA A;  1JE8 A;  1VND A;  4CCN A;  4D5F A;  3HRS A;  1FSH A;  3FXO A;  3GEZ A;  3IH3 A;  4A3K J;  2V9P A;  2HDD A;  3KP4 A;  2KIM A;  2L4A A;  5DDG A;  1RC9 A;  2BXZ A;  2MC4 A;  4EM1 A;  3K1P A;  2COB A;  2HOE A;  5HVQ C;  4KT5 C;  2L7F P;  2DU9 A;  4ZDL A;  4NC7 A;  3TDZ C;  4B3X A;  1LFU P;  2DA2 A;  1I3Q J;  2OZU A;  4UB6 C;  1PVE A;  3CMY A;  4LOC A;  5FLX Z;  1JXS A;  3GME A;  2O8X A;  4M3E A;  3IWZ A;  3FXK A;  4YEL A;  2R92 J;  3K1N A;  2JA5 J;  1JJ8 C;  3K9T A;  3H9G A;  3PJR A;  4MQ9 F;  3C18 A;  3IL2 A;  3ZN0 A;  3CP8 A;  3MQ0 A;  2K5C A;  4E7K A;  3Q5F A;  4PFO A;  3KZY A;  2VBX A;  1Z67 A;  4M71 A;  3MZ8 A;  1TC3 C;  2BVM A;  2MLK A;  4KUM A;  4R1H A;  2W00 A;  3LMM A;  2W25 A;  4BY7 J;  2EA4 A;  2DYR H;  3OV8 A;  2MD0 A;  3FMQ A;  3TDU C;  2H94 A;  4BH9 A;  4MGR A;  4QTR A;  4HX8 A;  4CZC A;  4DOZ A;  3F8B A;  4BS9 A;  3ABT A;  3MWM A;  5LRR A;  3CCJ I;  1RR7 A;  4AU7 A;  4BY1 J;  4BXX J;  3CCL I;  3PQJ A;  3TOA A;  4AIH A;  1YO5 C;  1K79 A;  3A02 A;  4I98 B;  4F93 B;  5LHG A;  3OY9 A;  4I6Z A;  1U78 A;  3A0H C;  2DOF A;  3QOP A;  1R1U A;  1VQM I;  3BQZ A;  3VDX A;  2LG4 A;  5GP9 A;  3JRH A;  1QO0 D;  1TQM A;  1R49 A;  1ETY A;  2IGK A;  2IGM A;  4P9U A;  2TRT A;  4EGZ A;  3S14 J;  1J59 A;  4LJZ F;  4IOA F;  1MD0 A;  2XC7 A;  3HGY A;  3VOD A;  2W85 A;  4MLO A;  1L3L A;  4WXD A;  2IP2 A;  3QOE A;  4XN3 A;  3FXQ A;  4PUS A;  2CU7 A;  3DCF A;  3VSL A;  4F3Q A;  1I39 A;  4PGH A;  3I4P A;  2WB1 A;  3EYI A;  1UJ8 A;  2QQ8 A;  3CC4 I;  1MMG A;  1J2X A;  3MAJ A;  1EV7 A;  5L3E A;  2VOD A;  1MBE A;  3N05 A;  2E5N A;  5F0F A;  5FKM A;  2DFE A;  5EDN A;  1VZ0 A;  1B4A A;  3IAS 2;  4XR6 A;  1X3U A;  2GA1 A;  4ETS A;  3FXR A;  2LK2 A;  3WG9 A;  2H8W A;  2NS7 A;  4RGR A;  1IV6 A;  1JJ6 C;  3SJM A;  3PQK A;  2R7R A;  1X3Z B;  4XRF A;  2P6T A;  1QBJ A;  1REP C;  2VC0 A;  3H3U A;  4LMY A;  2BY2 A;  5GPA A;  2OQG A;  4YRV A;  4XSX F;  1R58 A;  4XKV A;  4CH7 A;  2FML A;  4WCG A;  2XKO A;  3TQN A;  4KIT B;  4B09 A;  2WWY A;  2EBI A;  2GXA A;  2VLA A;  2E1C A;  2QF7 A;  4EJW A;  1WCM J;  5GPC A;  3FXM A;  5HDN A;  2JA2 A;  3M7G A;  2CV2 A;  4I7H A;  4A3F J;  5JVT A;  3CP2 A;  2VXD A;  5CVU A;  5EF6 A;  4LK0 F;  2VKV A;  3DBR B;  3BTI A;  1YG2 A;  3OYH A;  2J5P A;  1WHU A;  4ZYD A;  1GUU A;  1Z6T A;  4BJ5 C;  4XLF A;  2NS8 A;  1UCR A;  1FLI A;  4B44 A;  1LDD A;  3MKW B;  4L18 B;  2DT6 A;  1P4W A;  4CCO A;  1YTY A;  1VF9 A;  2JPB A;  2K85 A;  4RGU A;  1IRZ A;  1USS A;  1WQ2 A;  1IN4 A;  5CQG A;  1I1S A;  4UB8 C;  2MSY A;  1OJL A;  3KE2 A;  5F64 A;  4IRG A;  1HC8 A;  3DTK A;  3L9F A;  1YRN B;  2JK3 A;  4BYY A;  3OYB A;  3O8G A;  2B7E A;  2OF7 A;  3OYD A;  4ENM A;  5FLX K;  4ZZL A;  3GWZ A;  1XSX A;  4KN7 X;  1J9I A;  3SDG A;  3QPL A;  5CYV A;  3VYU B;  2VOP A;  1G3Y A;  4D0P A;  1HW2 A;  4LK1 F;  4BBR J;  1GXQ A;  2K86 A;  1Y1W J;  1SFE A;  5A2Q Z;  4D9J A;  4BHC A;  1FIA A;  2R93 J;  1DP3 A;  4YIR X;  2ZXI A;  3DBL B;  3JTH A;  2DMP A;  4EJT A;  3M8J A;  5FKO A;  2ID6 A;  4XNF A;  1IXR C;  5EG0 A;  1MZB A;  2LC2 A;  3KYD B;  2CQ7 A;  3J7Y J;  1QA6 A;  4LLG F;  2JA6 J;  2H8R A;  4U0W A;  2CV1 A;  5ED4 A;  5E3M A;  2X9D A;  1HKS A;  2ZXJ A;  3HOT A;  5BPI A;  1K6O A;  3PNY A;  5E1W A;  1OLT A;  1YS7 A;  2CQK A;  4E4H A;  1CGP A;  2FX0 A;  3CF2 A;  3DEE A;  4M72 A;  3VFZ A;  3LAJ A;  2W48 A;  3CD6 I;  3K4B A;  4B4C A;  1SEU A;  2HI3 A;  3CLO A;  4FX4 A;  2OUM A;  2BW3 A;  1ZLJ A;  1G3T A;  2OCC H;  3ZR8 X;  1TWG J;  1G3S A;  4DYR A;  1XGN A;  4L5E A;  1BC7 C;  1CQT A;  1XDU A;  2V9V A;  3RKY A;  5D4R A;  3LOC A;  5K5Q A;  4IKF A;  2L9V A;  2P81 A;  1UHW A;  5HLG A;  2QQ9 A;  1B72 B;  3J7A Y;  1G8X A;  3OYC A;  3F9K A;  3ZQH A;  2ELK A;  4KMU X;  1X1B A;  4XKW A;  4GDF A;  4RB0 A;  5DS9 A;  3I3L A;  2CUJ A;  2A68 F;  2V1D A;  2W1O A;  2XHK A;  1X2M A;  1GV5 A;  3V42 A;  3V8L A;  2VJ4 A;  1ETV A;  1WJB A;  5H20 A;  1KYZ A;  3ZQC A;  2LP0 A;  1U9O A;  3RCO A;  9ANT A;  1OCO H;  2JA8 J;  3BG5 A;  1RES A;  4S05 A;  4JX4 A;  3HDD A;  2L0K A;  3QAH A;  2CUZ A;  3FWE A;  3Q0U A;  5B5E C;  2FXA A;  3DTE A;  1MMA A;  3HHG A;  2Y31 A;  3RJP A;  2M8E A;  4Y13 A;  2KZG A;  4KIG A;  1SD7 A;  5J4V A;  3DBH B;  2DA5 A;  3VYS B;  1G4D A;  2K27 A;  2L7Z A;  4I0B A;  1MBH A;  1WJF A;  3F8N A;  3BZK A;  3F6O A;  2V4J C;  1LEB A;  1R4N B;  4ZYA A;  1MBF A;  3DU6 A;  2DJI A;  2QSF X;  4Y15 A;  3QPT A;  1KU2 A;  2ECC A;  3L2Q A;  3HJE A;  2EFN A;  2L02 A;  2E1M C;  2P5V A;  2RRE A;  1XGS A;  2UXN A;  3FX3 A;  2E1O A;  3D5R C;  3KLN A;  3QYB A;  3J7A O;  3C1D A;  1HCR A;  4U0Y A;  4OIR F;  1K83 J;  1B8I B;  5L3C A;  2DCE A;  2JUG A;  1F1Z A;  1ONV A;  1KA8 A;  2WAE A;  1W5T A;  2E1M B;  2KIS A;  2QBY B;  3E1S A;  3X2Q H;  3IKV A;  4XRM A;  4TV7 A;  3TGN A;  2VKD A;  4S04 A;  1E3O C;  3BG6 A;  5K5O A;  3H9J A;  2COM A;  2M30 A;  2BYV E;  5J8F A;  3MCZ A;  5IT9 K;  3GF2 A;  1FC3 A;  2DTR A;  1U2W A;  3BR0 A;  2Y2Z A;  1MIJ A;  4IEJ A;  2DJN A;  5EGO A;  1V5E A;  1G6N A;  2FQ4 A;  2FU4 A;  2FF4 A;  2EWN A;  4A3D J;  3HZJ A;  2DQL A;  2AQE A;  4NC8 A;  2MBF A;  4O6J A;  5ILV A;  1P6R A;  4Y3O A;  4BXF A;  3VYR B;  3CDI A;  2R5Y B;  2RKH A;  1WH7 A;  1X4P A;  4MTD A;  1S6L A;  1TW2 A;  1JUM A;  2HKX A;  3BLY A;  1EH8 A;  3CZ6 A;  4ABZ A;  3WTZ A;  3LA3 A;  3GFL A;  2HYF A;  1UEL B;  3HPG A;  4UUS A;  1A6I A;  2M45 A;  5LD2 C;  3BC8 A;  3LSK A;  2HYG D;  4BDZ A;  2E5Z A;  2UV1 A;  4AVZ A;  3AG4 H;  5H6R A;  5K7H A;  5HNF A;  2KP6 A;  4DGW B;  3RZO J;  3OYA A;  3F3X A;  3FMR A;  1RKT A;  3EPZ A;  1MSF C;  3A03 A;  3I59 B;  2UUZ A;  2V9K A;  3JSO A;  1ZQ3 P;  2CJJ A;  1XMK A;  2VKH A;  4IRH A;  2XB5 A;  4XON A;  1MNE A;  3CME I;  3WGH A;  3S17 J;  1XN7 A;  1BM9 A;  4OMZ A;  1YFH A;  2FMY A;  1IXS B;  3NAU A;  2BHZ A;  2XAS A;  5EZG A;  3K1M A;  2GOM A;  3CCU I;  3R6S A;  1W36 D;  1IC8 A;  4PJM A;  4CYD A;  1SAX A;  4PSW A;  3SXY A;  1IN6 A;  1T33 A;  4EEF G;  5H6Q A;  4PK4 A;  4XLE A;  3OL4 A;  4FQG A;  5TGT A;  3N97 A;  2HXO A;  1M1E B;  3U9G A;  3RQI A;  2STW A;  4KDP A;  5GAH J;  2PBI A;  3DV8 A;  2JA7 J;  1I27 A;  4CIC A;  3OR2 C;  1DGR M;  3OIQ A;  2F5V A;  3WE3 A;  4L9N A;  1X1A A;  4XLN F;  2XPV A;  3ASN H;  3S2D J;  1YW8 A;  1R23 A;  4G6D A;  1EH6 A;  4XIC A;  1WJE A;  3ZQI A;  3HRM A;  4QIW N;  5EG0 B;  2O8K A;  2XPU A;  3FKJ A;  5JLX A;  4HSR A;  3JR9 A;  2FBH A;  2FOK A;  2GIV A;  5FKN A;  4FE7 A;  4RGX A;  2CUE A;  5KCM A;  4ENJ A;  1BJZ A;  2M0C A;  2Y0M A;  2HPM A;  1PDN C;  1MJ9 A;  1AWC A;  5IYC J;  2KIF A;  3DTI A;  2CYY A;  5DTD A;  1H0M A;  1PJR A;  2KQR A;  4NBQ A;  2RDP A;  3HL2 A;  2ACJ A;  2W7N A;  2BOL A;  1J5Y A;  3MVP A;  4R8H A;  4ZYH A;  2X51 A;  1OPC A;  4EJV A;  2X6W A;  3S1R J;  2FD5 A;  2X1C A;  1T6S A;  2A07 F;  4PJN A;  4A6D A;  2XSJ C;  5J47 A;  2BW3 B;  4J00 A;  5FRM A;  4IXA A;  4MFE A;  2RGV A;  4PZJ A;  3K10 A;  3U21 A;  2BE5 F;  3I58 A;  3NWS A;  5FKK A;  1J7K A;  3L7W A;  2UWM A;  1BI2 A;  3Q0W A;  1W36 C;  3RPU A;  4IOC F;  5AON A;  2R0Q C;  1HDD C;  4I76 A;  3E97 A;  2QM3 A;  2RNG A;  1TQI A;  3TKY A;  3OYJ A;  1GDT A;  2FE3 A;  3WE2 A;  3BR2 A;  4O3M A;  2XV4 S;  1B1B A;  1LDK B;  1E2X A;  1Y8R B;  1FZP B;  2A69 F;  4V19 K;  2DA1 A;  4M6Y A;  4M3G A;  5J1Y A;  1FYL A;  2CRG A;  1I3A A;  3DEU A;  3LSP A;  1PUF B;  1FEX A;  2UZK A;  3EET A;  4L0Y B;  4K2E A;  4IQJ A;  3K6G A;  3H3Z A;  2CFO A;  2L01 A;  3GFM A;  4BUP A;  2ICW G;  2IPQ X;  2VJJ A;  2DLL A;  5C4X J;  2FSW A;  4RM3 A;  2QQB A;  2IA2 A;  3K2Z A;  1RI7 A;  1ZAO A;  1PP7 U;  4G94 A;  4UVC A;  2Z2S B;  3PNV A;  1KU9 A;  3CJT B;  4CA0 A;  2O61 A;  4A0Y A;  2P8T A;  1RR8 C;  5HOO A;  4E70 A;  3CCM I;  1ZG3 A;  2BY0 A;  4XK4 A;  1TL8 A;  3ERE D;  1TZL A;  4XMY A;  3K70 D;  3D0S A;  3ZGK A;  3JRG A;  1RET A;  2MA3 A;  2ZJ2 A;  2R5Z B;  2CW0 F;  3M1C A;  3FIS A;  1QNT A;  1ZLK A;  3HOX J;  3OSF A;  2RQQ A;  4BQQ A;  2G0E A;  2EJR A;  4C9Y A;  1P4X A;  2F5F A;  1O3S A;  2EZL A;  1OQY A;  3ERM A;  3S3O A;  5HDG A;  2HDW A;  3K0L A;  3HKZ A;  3QU6 A;  5FFZ A;  3RI4 A;  1BW6 A;  1D8K A;  1Z21 A;  3ESW B;  2H1L A;  2R7Q A;  5EJC A;  3WU0 A;  2BHY A;  5CVJ A;  5IP6 A;  2P7V B;  1OCC H;  1YRN A;  2DPD A;  3AKZ A;  5LHI A;  1XD7 A;  4LB6 B;  3BJO A;  2V6E A;  4RDU A;  1ACI A;  4XOR A;  4M3F A;  3KYL A;  4AUX A;  4Z2Y A;  5LHH A;  1EJ9 A;  2Y0S N;  3RZD J;  3V4G A;  4HRI A;  3JRB A;  3MD2 A;  3E0J B;  2WAD A;  2XGC A;  3TW7 A;  2DPU A;  1FOK A;  3WU1 B;  2VT2 A;  3BPX A;  4PSX A;  3F21 A;  3K2A A;  1FTT A;  5L3D A;  1TW3 A;  5EGO B;  3H5R A;  1E0E A;  4XRS A;  4KA4 A;  4HPQ A;  2OV7 A;  2DMT A;  4CO8 A;  4N9H A;  1IG7 A;  2ZNZ A;  4NDL A;  3TMO A;  1QZZ A;  3K70 C;  3IHU A;  3H35 A;  5C44 J;  2B63 J;  3M4O J;  1X19 A;  5CVR A;  2HFH A;  3WG7 H;  2HU9 A;  2MAB A;  1UAA A;  2IAI A;  2Q8K A;  4UUS B;  3CCR I;  4P55 A;  3V8J A;  2K40 A;  2BV6 A;  4P9F A;  1FBS A;  2E2J J;  2DT5 A;  2X0L A;  2DA6 A;  4PFP A;  5DCF A;  2JN6 A;  5F08 A;  1U5T A;  3V8K A;  3M9A A;  4DNC A;  2AO9 A;  4QPQ A;  3RPU D;  1F36 A;  2KJC A;  2LLK A;  4WXH A;  3CCV I;  4XLH A;  3WGI A;  3GTQ J;  4HST A;  3GBG A;  3TP3 A;  1R1T A;  1KON A;  4G12 A;  1BBY A;  1B72 A;  2LH9 A;  4EGY A;  2CQQ A;  5M5X J;  3H0D A;  2QKM B;  2ESH A;  1A36 A;  5LGN A;  3MZY A;  2HKO A;  1VI0 A;  4XLA A;  3GTO J;  1FJL A;  2DDB A;  1FYK A;  5GTI C;  2LTP A;  1VQ6 I;  3LL7 A;  3KP2 A;  1NG6 A;  5ICE A;  2PG4 A;  2KDZ A;  5HS9 A;  2DT7 B;  4ZYG A;  2VE9 A;  4RMN A;  2ZFU A;  5DUK A;  4MHG A;  3VOE A;  2Y30 A;  4Y4R A;  4A3M J;  2XF7 A;  4U0V A;  4A3B J;  2C6Y A;  3LSM A;  4DQ2 A;  5LBQ A;  1UHM A;  3PSF A;  1ULY A;  1XSD A;  4O5V A;  2PMZ N;  2HWV A;  2LRD A;  3S3M A;  4GFB A;  1UHS A;  2L9R A;  4A3I J;  3D1N I;  1QZE A;  2XRN A;  1Z9C A;  3BR5 A;  4EJO A;  3PO2 J;  4G7O F;  3C7J A;  4LG3 A;  1XCB A;  4RB1 A;  1BIB A;  2EPF A;  2OTJ I;  5HNH A;  1AU7 A;  2XKP A;  4EAT A;  3FBN B;  1O3R A;  3NWT A;  3G6E I;  1FBU A;  1FTZ A;  4M3B A;  1R1V A;  1I1G A;  2L3D A;  1BR1 A;  3ZXS A;  3DKW A;  4HQE A;  1IF1 A;  1QQI A;  2A6H F;  3S15 J;  3P9C A;  3DWL E;  4B48 A;  4NNJ A;  1MH4 A;  2F48 A;  3EUA A;  2EIM H;  3GW2 A;  3S93 A;  3WTY C;  2OPT A;  5J4Y A;  2JUC A;  2QKL B;  2HVR A;  1R6R A;  4X0G A;  1X2N A;  4PJ0 C;  4Q47 A;  4EMS A;  1MBK A;  3WOD F;  3ZQ7 A;  2NRA C;  3I5U A;  1RNL A;  1BOB A;  2EZH A;  1D1B A;  3E6C C;  1X1D A;  5BOX A;  1B8I A;  2D5V A;  4Y17 A;  4KN4 X;  4EVI A;  3RYP A;  3AG1 H;  3MKY B;  2QBY A;  5BNG A;  2KL4 A;  2P6S A;  2OBP A;  1G3W A;  2NXN B;  3OOP A;  3N4M A;  4XKB A;  2H09 A;  2QCO A;  1KYW A;  2VXZ A;  1XTA A;  3GFJ A;  4WX9 A;  4CYC B;  5M3M J;  2CUF A;  5B3S H;  2WV0 A;  3NEU A;  2Z3Y A;  3FM5 A;  4HNT A;  2EZI A;  3FK7 A;  2WAQ A;  2RC4 A;  3SZT A;  3D5S C;  3O6B B;  2EV0 A;  2PFB A;  1Z3X A;  2HVQ A;  1IUF A;  2Z16 A;  4HBL A;  3QRF F;  4A2U A;  3JAM K;  1W5S A;  3K7A J;  3J81 K;  1VQ7 I;  4JQF A;  1JHF A;  4N4O B;  2CSO A;  5JVG F;  4IPA A;  4PCQ A;  2R5Y A;  3ISP A;  5FKL A;  1QHH D;  5TRD A;  3OSG A;  4XLC A;  2G9W A;  1MND A;  1T0F A;  1TWA J;  4IF4 A;  4G6T B;  6PAX A;  1OCR H;  2DA3 A;  4F55 A;  2EIJ H;  3BR6 A;  2O0Y A;  2VI6 A;  3T8T A;  4ZYE A;  1I5Z A;  2K3F A;  1YI2 I;  1QZY A;  3RYR A;  2ELJ A;  3BCA A;  1UST A;  1Y39 A;  1RKW A;  2HZD A;  3OYE A;  5AIQ A;  3ECO A;  4IHW A;  3HYI A;  3GX4 X;  1DU0 A;  1YJN I;  5K7Z A;  3M8E A;  2J5O A;  5E3O A;  4EJU A;  4XLP F;  5K5R A;  3MEX A;  3LFK A;  1T2K A;  3I59 A;  2HZT A;  3MZH A;  3LQR A;  4ZC3 A;  3HB9 A;  3E6B A;  1ZG5 A;  3W2W A;  1L0O C;  2A6E F;  1W0U A;  4XM3 A;  2PJR B;  2CW7 A;  4UVA A;  2XAF A;  3HOS A;  4XID A;  3CDL A;  5M3F J;  2GAU A;  3ZMZ A;  5L3G A;  4M74 A;  3FKI J;  2EA2 A;  1MKM A;  4XSZ F;  3IH4 A;  4UUV A;  1V5F A;  2QZ8 A;  2LKP A;  4CCL A;  3H92 A;  5EYR A;  2EH3 A;  4B47 A;  4KFC A;  4M9S A;  3TO6 A;  3W2A A;  2ZME B;  1K4S A;  2OA4 A;  1Y6I A;  1ETK A;  2BGC A;  2M34 A;  4HX7 A;  1TLH B;  4B8X A;  1EKE A;  5LGU A;  1ON1 A;  3EQL F;  1H8A C;  4UUT A;  2XAU A;  2AXL A;  1MNM C;  1LDJ A;  1FOX A;  2OZ6 A;  3DPL C;  4NQW A;  2QSH X;  3TO7 A;  1IW7 F;  2ZXW H;  2JWT A;  5JHF A;  1LFP A;  4OIP F;  2DFH A;  1RUN A;  2N8G A;  2CV0 A;  1DUX C;  4BHP A;  1XPX A;  2IBD A;  4CCM A;  3KPH A;  2FEZ A;  4ZTJ A;  4KMF A;  1EH7 A;  2KIU A;  1W1W E;  3JRE A;  2WC2 A;  3ZMU A;  4IZZ A;  3BRO A;  4BE1 A;  4E7L A;  2EIL H;  1OR7 A;  4YEJ A;  2LKS A;  2TCT A;  4E7S A;  1BR2 A;  4E7H A;  4RAZ A;  1FBQ A;  1Z05 A;  2PX9 A;  5ILS A;  5TJJ A;  3ROU A;  1ZYR F;  4IO9 F;  1HDP A;  1HA8 A;  3HC7 A;  2KHM A;  1TWH J;  3DFG A;  4IL6 C;  5D6E A;  3LSI A;  1RIO H;  1U5T B;  2XF5 A;  2DI3 A;  1MW7 A;  3OYF A;  1GT0 C;  1Z6R A;  3BDD A;  2XRO A;  2HTS A;  1Z3Y A;  2Y69 H;  5CQE A;  4RS8 A;  3PUB A;  1H88 C;  2DMN A;  3PIP F;  1E17 A;  2DBB A;  2Z1D A;  3E5X A;  2MFZ A;  4HA8 A;  3H9Q A;  3ZMS A;  1OCP A;  3R60 A;  2W57 A;  3ZQG A;  3KP6 A;  1LB2 A;  3WTT C;  3ULQ B;  5HS8 A;  4X6A J;  3BCB A;  3QYE A;  4A3G J;  1X1P A;  1TT5 B;  2VPL A;  2HR3 A;  1PUF A;  2K9Q A;  3AG2 H;  2XAG A;  3DU5 A;  2M9H A;  4UHT A;  4D7N A;  3WTW C;  3S3N A;  4MFD A;  1S8N A;  1OCZ H;  2JSC A;  3JRF A;  1G2H A;  1XC5 A;  4M3D A;  1RPW A;  2NYX A;  1FSE A;  1R5G A;  1V55 H;  2FBI A;  4LIU A;  2ZFW A;  1DGW Y;  3ML6 A;  1FOW A;  1NTC A;  3NRV A;  1R00 A;  1GVD A;  3WU2 C;  2XAQ A;  4PGG A;  5CKT A;  2NS0 A;  1KU7 A;  3VYT B;  3MKL A;  3R0A A;  1N77 A;  1XDS A;  3L2C A;  2GLO A;  4CCK A;  2KPM A;  2X85 A;  2M0M A;  4RAF A;  2L54 A;  2ZJR F;  3I0T A;  1S3J A;  3ONQ A;  1HLV A;  2DOA A;  4HW0 A;  4CGZ A;  1WWX A;  2R5Z A;  1YLF A;  1YX3 A;  5JHU A;  1GV2 A;  3PUF A;  1D8J A;  2E7W A;  5ILU A;  3AG3 H;  4E6K G;  3K4N A;  2X4H A;  1A5J A;  1GXP A;  2ZO4 A;  3H5A A;  4A3J J;  2YU9 J;  3S1Q J;  4A69 C;  4RAG A;  1K61 A;  1KQ9 A;  2R7Z J;  3S1M J;  1ETO A;  2ADU A;  3BOQ A;  4E7I A;  3JRI A;  2A3S A;  3KZI C;  5CPR B;  3QPH A;  2LDU A;  2XAH A;  4FHT A;  3OYK A;  4JX6 A;  2YS9 A;  3J7Z I;  3KYC B;  4M6X A;  2JVG A;  3EUH A;  4AYB A;  5B66 C;  2JRM A;  1LQ1 A;  1PYV A;  1SFX A;  3I9V 2;  2Y9Z A;  2HQR A;  4UXN A;  5L3F A;  2GBY A;  4FX0 A;  4OAZ A;  2VL8 A;  3DQV C;  2I5U A;  3G1O A;  3I54 A;  3OIO A;  2E34 A;  2F4O B;  5L3B A;  1K7A A;  5K1Y A;  5F27 A;  4BXU A;  3CJQ B;  2QYO A;  3WTS C;  3EDP A;  4II3 A;  5DM6 F;  2KZV A;  4LIT A;  2H6C A;  1T0F C;  5F1J A;  4RGS A;  3JRC A;  2XDV A;  1JT6 A;  3TED A;  1SFK A;  3IP4 B;  5BQT A;  2AS5 F;  5A2Q K;  4LD5 A;  4ZZD A;  1QPI A;  4JX5 A;  2F5C A;  3A0B C;  4AD9 A;  3WHC A;  2OJE D;  3JW4 A;  1N78 A;  3QP5 A;  3GZN B;  1U8R A;  4W1U A;  3PIO F;  4IHS A;  2L5Q A;  5DM7 F;  2F2E A;  3G1M A;  2I10 A;  4FCY A;  1JKP C;  4LLL A;  2HOS A;  2YX4 A;  4N0B A;  4WWC A;  4ANJ A;  1X3W B;  4BL0 B;  1SD6 A;  2E2H J;  1STZ A;  1AHD P;  3I71 A;  2L7K A;  4M73 A;  4PDK A;  4JYK A;  1Z77 A;  5ICC A;  2KKO A;  4ON0 A;  4I2O A;  4DW6 A;  4HDU A;  5JR3 A;  1SVO A;  3H0G J;  3RTR A;  4GYI A;  3BTC A;  3FM3 A;  2A5Y B;  2Q2E A;  3K4M A;  2NNY A;  1Z7U A;  2IGO A;  1DU6 A;  4CSW A;  4XN0 A;  2VIX A;  2LFB A;  4M9Z A;  4UV8 A;  1FIP A;  3A4C A;  4S0H B;  2K4B A;  4W97 A;  2IS1 A;  3LQQ A;  2JT1 A;  3CUQ A;  2BBY A;  3CC7 I;  2KIQ A;  3PFI A;  1TTY A;  2KT0 A;  5J40 A;  2Z99 A;  2DTZ A;  2LY2 A;  3B6C A;  3HBL A;  3UR3 C;  2BXY A;  3HPH A;  3HSR A;  4DBQ A;  2NAZ A;  2CS3 A;  2ISZ A;  4MTE A;  3CF5 F;  3IH2 A;  3RQ4 A;  5BMZ A;  1IN8 A;  3VB2 A;  3KP7 A;  5GTH C;  1BL0 A;  3WHB A;  3M3Y J;  4CXF A;  2JQ7 A;  3BZC A;  5E8G A;  2ZKZ A;  3TOB A;  2CFX A;  2KFD A;  3LSH A;  1T8I A;  5E3L A;  2FUG 2;  4A6E A;  4NQW B;  2L2O A;  3HOY J;  1U9N A;  4DJA A;  3OS0 A;  4L9J A;  5F04 A;  4DZJ A;  2I8D A;  2V79 A;  1W7P B;  1OR7 C;  2O3F A;  5DCM B;  3PL8 A;  2DW4 A;  1WSU A;  4HQM A;  2AXT C;  3DLA A;  1VQO I;  2G7H A;  3P7N A;  4C3J J;  3GLL A;  3P5J A;  4Z6Y A;  4P1W A;  5LFA A;  2JZY A;  2M4G A;  4PJL A;  4DIQ A;  3SYT A;  5D6F A;  5FB2 A;  2K3P A;  2YX7 A;  5GAE J;  2RAE A;  2X6Y A;  4I09 A;  1IN5 A;  3HOV J;  1VQP I;  3GLX A;  3AL0 B;  3CCS I;  3FHZ A;  1B9M A;  1DDN A;  1JGS A;  1BI0 A;  3GTK J;  1IUY A;  4IJA A;  4XL9 A;  3LAP A;  2AQF A;  4QSH A;  1ZGW A;  3HOU J;  2IS6 A;  2NVQ J;  2E1N A;  3G2B A;  2M2E A;  2FNA A;  2IJL A;  1WI3 A;  3OS1 A;  1YW9 A;  5HS7 A;  3C2G A;  3A1Y A;  4LFU A;  3JTG A;  4KYW A;  1Q1H A;  4D7M A;  1WJD A;  2ZJP F;  3GTG J;  2NVY J;  2P7C B;  5E1X A;  5ERI A;  5D5V B;  5FRO A;  5LLQ A;  1YS6 A;  2R7D A;  4D5C A;  3FMS A;  5J3L A;  3BG3 A;  4FIS A;  3F8M A;  2DOE A;  1OIS A;  2TDX A;  2YUS A;  5IYB J;  3S32 A;  3IAM 2;  1O57 A;  2JMW A;  2GWR A;  5FO5 A;  5EEA A;  2YPR A;  3KEY A;  2W84 A;  3HOZ J;  4E7J A;  4CYC A;  2GM4 A;  3BJ6 A;  2XSD C;  2FNP A;  2O03 A;  3DXJ F;  3E6M A;  2D1H A;  1ORK A;  4XOT A;  5E79 C;  2XF6 A;  4LLN A;  1ZKG A;  2K4J A;  1V4R A;  3D5L A;  4RLF A;  4OIQ F;  1ZR2 A;  2OD5 A;  2ECB A;  4AC0 A;  3ZMV A;  2ZSI B;  4DZP A;  4UY8 I;  4U87 A;  2OQR A;  3GTJ J;  4FAS D;  2XGX A;  2LYC A;  3QP6 A;  4GGG A;  4ENK A;  2VKE A;  2KDO A;  1A6Q A;  3Q0V A;  3L2U A;  3I4M J;  4HLX A;  3A01 A;  1P4A A;  2VBY A;  3IC7 A;  4G6Q A;  3J80 Z;  3HEF A;  4ENN A;  1B59 A;  5K7F A;  4RM2 A;  4NHJ A;  2V26 A;  3ZMD A;  4KT6 A;  2E2I J;  3CCQ I;  3FHN A;  3GTL J;  2HDC A;  4ZH4 F;  2EQR A;  1R9T J;  5KK1 A;  1ZN2 A;  1JHH A;  2M4K A;  4GYG A;  1X1C A;  2HPI A;  3HM5 A;  1K6Y A;  4G9Y A;  4YIF A;  3QYF A;  4KIF A;  4HV5 A;  3IKT A;  3CDH A;  1N75 A;  4Y7N J;  4AM3 A;  2KJB A;  1Z1D A;  1Y0U A;  4C3H J;  1D5Y A;  3OYM A;  4QWQ A;  1Z7L A;  1DPU A;  3CTA A;  1ZGJ A;  3EUH C;  4HV6 A;  1ZRC A;  2VPR A;  4MO7 A;  4LB5 A;  1IAW A;  1E3H A;  1I6H J;  1EA3 A;  1JUS A;  2GXB A;  4A0X A;  2H27 A;  4OMY A;  3GCM A;  3KET A;  2PJR A;  3DF8 A;  5J8C A;  3CCE I;  4EQQ A;  2Y48 A;  1R4M B;  2CQN A;  5D4S A;  2PLY A;  2P4W A;  2LOO A;  3EUK L;  1IV8 A;  2MH2 A;  1BN5 A;  2ZME A;  3T8R A;  2EFQ A;  2K9N A;  4NB5 A;  1MH3 A;  3OIP A;  4N9I A;  4RBO A;  1LEA A;  2Q1Z B;  2DOD A;  3JSP A;  2QVO A;  2E7X A;  4ZTF A;  4P5O A;  2K9S A;  1YIT I;  1XS9 A;  2LF7 A;  3G1L A;  4LIV A;  5LEK A;  1O7F A;  2HQ5 A;  2DYS H;  3ELK A;  3O2P E;  3QU3 A;  5HDK A;  1BI3 A;  2HEO A;  3S2H J;  1NHA A;  4XOP A;  2YR2 A;  1NG7 A;  3W6J B;  2FOW A;  2R4G A;  3BQY A;  4BBS J;  3W3C A;  2P0W A;  3ZN1 A;  2JJ7 A;  1NH3 A;  2EFP A;  3GXO A;  1H9G A;  1FMV A;  2Y9Y A;  2DFI A;  2D2W A;  2E60 A;  2LBF A;  5TIS C;  3F8F A;  2IS4 A;  1HOM A;  3F23 A;  2DK5 A;  2ZB9 A;  3E7L A;  1S7E A;  3BPV A;  3FBI B;  1TP4 A;  2LMD A;  1JI8 A;  5FFX A;  2FJ1 A;  3T1B A;  2Z33 A;  3BP8 A;  4MNU A;  2F5E A;  1TNT A;  1I50 J;  1RRJ A;  2W82 A;  2NVU B;  1D0Y A;  1FWZ A;  5GAD J;  4OIO F;  3OR1 C;  4IHY A;  2R7X A;  3G3Z A;  3HUG B;  3R4K A;  1T95 A;  3MMY B;  3CUQ C;  3L00 A;  4C2U A;  2QEX I;  2DDA A;  2XAJ A;  1TBX A;  2IW5 A;  1Z91 A;  2CWE A;  1XX5 A;  2Q2E B;  1Q1V A;  2GIZ A;  3C3W A;  3IUO A;  4GXO A;  5AIP A;  5EEH A;  3IRR A;  5HLI A;  1LE8 A;  3KFW X;  3WTX C;  1HW5 A;  3F72 A;  2ME6 A;  4RB2 C;  1D3Y A;  3WTV C;  3CUQ B;  2AHQ A;  1WVR A;  1YJW I;  1VQ4 I;  1KQ8 A;  2VC1 A;  5B1A H;  4JP0 A;  1TT0 A;  3LSJ A;  4IHV A;  1IGN A;  2HVS A;  2X6X A;  2D45 A;  2HOA A;  3OL3 A;  4JOM A;  1Y8Q B;  2K7L A;  3F0C A;  3H36 A;  3L2W A;  4Q5S F;  4Y33 A;  2NVX J;  1FP2 A;  1B9N A;  1OYY A;  1YW7 A;  1GVJ A;  2MLG A;  4A0Z A;  3SEZ A;  2FA5 A;  4C2M J;  4HF0 A;  3NQO A;  3COA C;  2M87 A;  1FP1 D;  2LKX A;  2EV5 A;  2X1D A;  3IWF A;  1MDM B;  1JKO C;  5FRN A;  1P7J A;  1ZTR A;  4BKX A;  4BDY A;  1HKT A;  1F4K A;  3F22 A;  1QGP A;  2LD5 A;  5KAF C;  3HHH A;  1N25 A;  2M1B A;  3EYY A;  4BQO A;  3GZ5 A;  2L9S A; 
#chains in the Genus database with same CATH homology
 1HKQ A;  2CG4 A;  2IVM A;  2K02 A;  1GHC A;  2PMH A;  5FD6 A;  2KRF A;  3KP5 A;  4I02 A;  3J80 K;  1MJA A;  2IA0 A;  1PP8 F;  1XMA A;  1DPR A;  4UVB A;  2G7U A;  1R22 A;  1HBX G;  3MFK A;  1P2F A;  3V7S A;  3KZZ A;  3L09 A;  5E8I A;  2YSR A;  4U7B A;  1ODD A;  1ZAR A;  2B0L A;  2LSO A;  2JPC A;  5D8L B;  1HST A;  3GYH X;  1YQA A;  4AVP A;  3KP3 A;  2ISY A;  4KIC A;  3HRT A;  3T5X A;  1U3E M;  2WTE A;  2ESN A;  3BY6 A;  5CVV A;  2P5K A;  1F9N A;  1B6A A;  2ZNY A;  2PI0 A;  3O3K A;  3DPT A;  2QUF A;  5DD4 A;  4F7Z A;  2GZW A;  5LRS A;  4RB3 C;  4Q48 A;  4A5N A;  5E17 F;  1CF7 A;  5ICG A;  5ICF A;  3DP7 A;  4I01 A;  5LEJ A;  1S7O A;  2V6C A;  5F6F A;  1OKR A;  4YFX F;  5FGM A;  1BJA A;  4CDG A;  4A12 A;  1ON2 A;  1SFU A;  2Z9O A;  4LG0 B;  3BJA A;  1TNS A;  3E5Q A;  3M1E A;  2Z5U A;  4ESF A;  2P5L C;  4AWX B;  3U1D A;  3FF5 A;  1XSV A;  3WGG A;  4GO1 A;  4WXC A;  5F1R A;  5D8K B;  2IT0 A;  1U6G A;  4Q4Z F;  3WTU C;  3GO5 A;  1F5T A;  3KEQ A;  1HW1 A;  4KNY A;  3RKW A;  4JBA A;  5IT9 Z;  1W7P A;  3ABU A;  5DCM A;  5CJ9 A;  1BC8 C;  3K69 A;  1SD4 A;  4P96 A;  2EFO A;  2L4M A;  4HX4 A;  1IXC A;  1XCV A;  2ELH A;  2BEO A;  4A5M A;  1YYV A;  1YIO A;  1U5T C;  2STT A;  5E18 F;  4G7H F;  3Q9S A;  1WRJ A;  2DO7 A;  1S29 A;  4I0A A;  2JTV A;  5DV5 A;  3CJN A;  2NNN A;  2QEN A;  1FT9 A;  2OAZ A;  5DUI A;  3E6D A;  5EEG A;  3VEP A;  4CHU A;  2XIG A;  4AIK A;  2R3S A;  5D5W B;  5HLH A;  2VON A;  3FZV A;  1J0R A;  3W6K B;  3V7R A;  2QQA A;  4YFK F;  4HAM A;  2QLZ A;  2V1U A;  5JI6 A;  3HRU A;  2VT3 A;  3KCC A;  2GXG A;  2EV6 A;  2PN6 A;  3CO6 C;  4OIN F;  1KU3 A;  5IT3 A;  4FT8 A;  4HOB A;  4L0Z B;  4UV9 A;  2EB7 A;  2M5W A;  4IRI A;  3HIF A;  1BI1 A;  3HSF A;  2JRT A;  1ZGA A;  3V7C A;  3E3V A;  1T38 A;  1SMY F;  1MGT A;  1WI9 A;  2RV8 A;  1O3Q A;  4HLY A;  2FBK A;  4L9V A;  3LA2 A;  2HTJ A;  2LNB A;  1ZG1 A;  3ZPL A;  2DQR A;  5DD8 A;  1AOY A;  5LGT A;  2GA2 A;  3HTS B;  3RPQ A;  1R5H A;  3R0J A;  3F6V A;  5DYM A;  1UB9 A;  3KLO A;  2FRH A;  4UNO A;  4MEX F;  2R7F A;  1IN7 A;  1O3T A;  1R36 A;  2Q0O A;  2HQN A;  4HZF A;  1ZRF A;  4IHT A;  1C0W A;  4EV0 A;  3IRQ A;  2YU3 A;  3CUO A;  3E5U A;  3GZ6 A;  2VOO A;  2ETH A;  1HQC A;  1IRG A;  5BS6 A;  1W7P D;  3FXU A;  3CO7 C;  5D5U B;  2RVC A;  1CF7 B;  1BIA A;  4WF2 A;  4EM2 A;  1K78 A;  1T98 A;  2ZBK A;  1T39 A;  4CZZ A;  4XBF A;  3HUG A;  2Y75 A;  1XB4 A;  1R7J A;  2FQ3 A;  1W4M A;  2PQ8 A;  1O7L A;  1SD5 A;  3RDI A;  4BAY A;  1TQP A;  4GCV A;  2HS5 A;  3F8C A;  1V3F A;  2VBZ A;  2QWW A;  3B02 A;  2RQP A;  3REO A;  4WK8 F;  4ESJ A;  2VE8 A;  4YII A;  1MDM A;  3GUD A;  1LJ9 A;  2XUB A;  5J6X A;  2H6B A;  3RKX A;  3AAF A;  5BPD A;  2F5D A;  5CVI A;  1VTN C;  2MH9 A;  3S2W A;  4BNC A;  3ZMT A;  1ZH5 A;  2DK8 A;  4OOI A;  3P9I A;  5KVR A;  1P92 A;  3HSE A;  2CO5 A;  1J75 A;  4U88 A;  2PEX A;  5E1Z B;  4BQA A;  2OU2 A;  4KIB A;  1LNW A;  1KGS A;  4HF1 A;  1ZRE A;  4HF2 A;  3ECH A;  3LA7 A;  3M8F A;  1SMT A;  3BWG A;  4YFN F;  5E20 A;  1QPM A;  4L9T A;  2MD5 A;  2EFW A;  4JK1 X;  1KQ0 A;  1RZ4 A;  4LGW A;  1ZHF A;  1LVA A;  1OYW A;  4IVN A;  1UFM A;  5FD5 A;  4MEY F;  3SQN A;  4ESB A;  5JFR A;  1A04 A;  1OMI A;  2ZCW A;  1HXD A;  4BHB A;  2W24 A;  3ZP5 A;  1ZRD A;  2PMU A;  4M9X A;  3I64 A;  2EK5 A;  4ASN A;  1BOA A;  2XVC A;  5DEQ A;  1WKM A;  3SZP A;  3R61 A;  1FNN A;  3TO9 A;  4EM0 B;  1H9T A;  3HTU A;  2V1X A;  3Q9V A;  2VN2 A;  2O6G E;  4R79 A;  4L5J A;  4RAY A;  1FX7 A;  3RIR A;  2PJP A;  4L5I A;  1S7A A;  3U2R A;  2CGP A;  1FYM A;  2MC3 A;  1XGM A;  4LG0 A;  4OU0 A;  2IA1 A;  2RN7 A;  1XGO A;  1PUE E;  2HGC A;  1OYI A;  1IRF A;  1RUO A;  3P9K A;  3T0Y A;  1FPQ A;  3I53 A;  2VBW A;  3SHF A;  4HYE A;  4H0E A;  2D1V A;  4QLC U;  3SFZ A;  5CLS A;  1DP7 P;  3KEO A;  3LST A;  1MJB A;  4G8X A;  1D5V A;  5D5X B;  3BZ6 A;  3B73 A;  2A61 A;  3LWF A;  4MQV A;  4HDV A;  3GVA A;  3JAM Z;  3J81 Z;  2RNJ A;  2IRF G;  4YG2 F;  1IZ1 A;  2DAO A;  1HSJ A;  2LF8 A;  3GFI A;  2UXX A;  1I6X A;  3G73 A;  4U7D A;  4AIJ A;  1K78 B;  2GQQ A;  4G7Z F;  1FY7 A;  1JE8 A;  3HRS A;  1FSH A;  3GEZ A;  3KP4 A;  2KIM A;  2L4A A;  5DDG A;  4EM1 A;  3K1P A;  2HOE A;  5HVQ C;  4KT5 C;  3TDZ C;  2DU9 A;  2OZU A;  5FLX Z;  1JXS A;  2O8X A;  3IWZ A;  3K1N A;  3K9T A;  4MQ9 F;  3C18 A;  3IL2 A;  3ZN0 A;  3MQ0 A;  3Q5F A;  3KZY A;  2VBX A;  4M71 A;  4KUM A;  2MLK A;  4R1H A;  2W25 A;  2EA4 A;  3OV8 A;  3FMQ A;  3TDU C;  2H94 A;  4BH9 A;  4MGR A;  4HX8 A;  3F8B A;  3ABT A;  3MWM A;  5LRR A;  3PQJ A;  3TOA A;  4AIH A;  1YO5 C;  1K79 A;  4I98 B;  5LHG A;  1U78 A;  3QOP A;  1R1U A;  1QO0 D;  1TQM A;  4P9U A;  4EGZ A;  1J59 A;  4LJZ F;  1MD0 A;  3VOD A;  2W85 A;  1L3L A;  4WXD A;  2IP2 A;  3FXQ A;  4PGH A;  3I4P A;  3EYI A;  1J2X A;  3MAJ A;  1EV7 A;  5L3E A;  2VOD A;  1B4A A;  1X3U A;  2GA1 A;  4ETS A;  3FXR A;  3WG9 A;  4RGR A;  3PQK A;  4XRF A;  2P6T A;  1QBJ A;  1REP C;  2VC0 A;  3H3U A;  4LMY A;  2OQG A;  4XSX F;  1R58 A;  2FML A;  4WCG A;  2XKO A;  3TQN A;  2WWY A;  4B09 A;  2E1C A;  4EJW A;  5HDN A;  3M7G A;  4I7H A;  5JVT A;  5CVU A;  4LK0 F;  1YG2 A;  2J5P A;  4ZYD A;  1Z6T A;  1UCR A;  1FLI A;  1LDD A;  4L18 B;  1P4W A;  1YTY A;  2JPB A;  4RGU A;  1USS A;  1WQ2 A;  1IN4 A;  1I1S A;  3KE2 A;  5F64 A;  4IRG A;  3L9F A;  4BYY A;  5FLX K;  4ENM A;  4ZZL A;  3GWZ A;  1XSX A;  4KN7 X;  1J9I A;  5CYV A;  2VOP A;  1G3Y A;  4D0P A;  1HW2 A;  4LK1 F;  1GXQ A;  2K86 A;  1SFE A;  5A2Q Z;  4BHC A;  3JTH A;  4EJT A;  1IXR C;  1MZB A;  4LLG F;  4U0W A;  5ED4 A;  1HKS A;  2ZXJ A;  3HOT A;  5BPI A;  1K6O A;  1CGP A;  5E1W A;  1YS7 A;  2CQK A;  4M72 A;  3VFZ A;  3LAJ A;  3CLO A;  4FX4 A;  1ZLJ A;  1G3T A;  1G3S A;  1XGN A;  1BC7 C;  1XDU A;  2V9V A;  3RKY A;  5D4R A;  5K5Q A;  1UHW A;  5HLG A;  2QQ9 A;  4KMU X;  4RB0 A;  2A68 F;  2V1D A;  2XHK A;  3V8L A;  5H20 A;  1KYZ A;  4S05 A;  3QAH A;  3FWE A;  2FXA A;  3HHG A;  3RJP A;  2M8E A;  4Y13 A;  4KIG A;  1SD7 A;  1G4D A;  2K27 A;  4I0B A;  3F8N A;  3F6O A;  1LEB A;  4Y15 A;  3QPT A;  1KU2 A;  2EFN A;  2L02 A;  2P5V A;  1XGS A;  2UXN A;  3FX3 A;  3KLN A;  3J7A O;  3C1D A;  4U0Y A;  4OIR F;  5L3C A;  1F1Z A;  1ONV A;  1KA8 A;  1W5T A;  2QBY B;  3IKV A;  4TV7 A;  3TGN A;  4S04 A;  5K5O A;  2COM A;  2M30 A;  2BYV E;  5J8F A;  3MCZ A;  5IT9 K;  3GF2 A;  1FC3 A;  1U2W A;  2DTR A;  1G6N A;  2FU4 A;  2FF4 A;  2EWN A;  2DQL A;  2MBF A;  4O6J A;  5ILV A;  1P6R A;  2RKH A;  4MTD A;  1S6L A;  1TW2 A;  2HKX A;  1EH8 A;  3WTZ A;  3LA3 A;  3GFL A;  2HYF A;  2M45 A;  2HYG D;  5H6R A;  3F3X A;  3FMR A;  3I59 B;  3JSO A;  1XMK A;  4IRH A;  3WGH A;  1XN7 A;  1BM9 A;  4OMZ A;  1YFH A;  2FMY A;  1IXS B;  2XAS A;  3K1M A;  3R6S A;  4CYD A;  1SAX A;  3SXY A;  1IN6 A;  5H6Q A;  3N97 A;  3U9G A;  4KDP A;  2STW A;  2PBI A;  3DV8 A;  1I27 A;  4CIC A;  3WE3 A;  4L9N A;  4XLN F;  1YW8 A;  1R23 A;  4G6D A;  1EH6 A;  3HRM A;  2FBH A;  2FOK A;  2GIV A;  4RGX A;  4ENJ A;  2Y0M A;  1PDN C;  1MJ9 A;  1AWC A;  2KIF A;  2CYY A;  1H0M A;  2RDP A;  2ACJ A;  1J5Y A;  4R8H A;  4ZYH A;  1OPC A;  4EJV A;  1T6S A;  2A07 F;  4A6D A;  4IXA A;  2RGV A;  4PZJ A;  2BE5 F;  3I58 A;  1J7K A;  3L7W A;  2UWM A;  1BI2 A;  3RPU A;  5AON A;  3E97 A;  2QM3 A;  1TQI A;  3TKY A;  2FE3 A;  3WE2 A;  4O3M A;  2XV4 S;  1B1B A;  1LDK B;  1E2X A;  1FZP B;  2A69 F;  1FYL A;  4M6Y A;  3DEU A;  2UZK A;  3EET A;  4L0Y B;  4K2E A;  3H3Z A;  2L01 A;  3GFM A;  2IPQ X;  2DLL A;  2FSW A;  2QQB A;  2IA2 A;  3K2Z A;  1RI7 A;  1ZAO A;  1PP7 U;  4G94 A;  4UVC A;  1KU9 A;  2O61 A;  4A0Y A;  2P8T A;  5HOO A;  4E70 A;  1ZG3 A;  3ERE D;  3D0S A;  2MA3 A;  2ZJ2 A;  2CW0 F;  1QNT A;  1ZLK A;  2EJR A;  1P4X A;  2F5F A;  1O3S A;  5HDG A;  3K0L A;  3QU6 A;  5FFZ A;  3RI4 A;  1D8K A;  3WU0 A;  5CVJ A;  2P7V B;  2DPD A;  5LHI A;  1XD7 A;  4LB6 B;  3BJO A;  4Z2Y A;  5LHH A;  3V4G A;  2DPU A;  1FOK A;  3WU1 B;  2VT2 A;  3BPX A;  3F21 A;  5L3D A;  1TW3 A;  4KA4 A;  4CO8 A;  4N9H A;  2ZNZ A;  1QZZ A;  3IHU A;  5CVR A;  2HFH A;  2Q8K A;  4P55 A;  3V8J A;  2BV6 A;  4P9F A;  1FBS A;  2DT5 A;  2X0L A;  5DCF A;  1U5T A;  3V8K A;  3M9A A;  4DNC A;  2KJC A;  4WXH A;  3WGI A;  1R1T A;  1BBY A;  4EGY A;  2ESH A;  5LGN A;  3MZY A;  2HKO A;  1FYK A;  3KP2 A;  5ICE A;  2PG4 A;  5HS9 A;  2VE9 A;  4ZYG A;  5DUK A;  4MHG A;  3VOE A;  4U0V A;  2C6Y A;  4DQ2 A;  5LBQ A;  1UHM A;  1ULY A;  1XSD A;  4O5V A;  2HWV A;  2XRN A;  1Z9C A;  4EJO A;  4G7O F;  3C7J A;  1XCB A;  4RB1 A;  1BIB A;  2XKP A;  1O3R A;  1FBU A;  1R1V A;  1I1G A;  2L3D A;  3DKW A;  4HQE A;  1IF1 A;  1QQI A;  2A6H F;  3P9C A;  3GW2 A;  3WTY C;  4Q47 A;  4EMS A;  3WOD F;  3ZQ7 A;  2NRA C;  3I5U A;  1RNL A;  3E6C C;  5BOX A;  4Y17 A;  4KN4 X;  4EVI A;  3RYP A;  2QBY A;  2P6S A;  2OBP A;  1G3W A;  3OOP A;  3N4M A;  2H09 A;  1KYW A;  2VXZ A;  3GFJ A;  4WX9 A;  2WV0 A;  3NEU A;  2Z3Y A;  3FM5 A;  2RC4 A;  3SZT A;  3O6B B;  2EV0 A;  2PFB A;  3QRF F;  4HBL A;  4A2U A;  3JAM K;  1W5S A;  3J81 K;  4JQF A;  1JHF A;  2CSO A;  4IPA A;  4PCQ A;  3ISP A;  5TRD A;  2G9W A;  1T0F A;  4IF4 A;  6PAX A;  2O0Y A;  3T8T A;  4ZYE A;  1I5Z A;  1QZY A;  3RYR A;  1UST A;  5AIQ A;  3ECO A;  3HYI A;  3GX4 X;  3M8E A;  2J5O A;  4EJU A;  4XLP F;  5K5R A;  3MEX A;  3LFK A;  1T2K A;  3I59 A;  2HZT A;  3MZH A;  3LQR A;  3E6B A;  1ZG5 A;  1L0O C;  2A6E F;  4UVA A;  3HOS A;  2XAF A;  2GAU A;  3ZMZ A;  5L3G A;  4M74 A;  2EA2 A;  1MKM A;  4XSZ F;  4UUV A;  2QZ8 A;  2LKP A;  3H92 A;  4KFC A;  4M9S A;  3TO6 A;  2ZME B;  2OA4 A;  2BGC A;  4HX7 A;  1TLH B;  4B8X A;  5LGU A;  1ON1 A;  3EQL F;  2AXL A;  1LDJ A;  4NQW A;  3DPL C;  2OZ6 A;  3TO7 A;  1IW7 F;  4OIP F;  1RUN A;  1DUX C;  4BHP A;  2FEZ A;  4KMF A;  1EH7 A;  2KIU A;  2WC2 A;  3ZMU A;  3BRO A;  1OR7 A;  4RAZ A;  1FBQ A;  1Z05 A;  5ILS A;  5TJJ A;  3ROU A;  1ZYR F;  3DFG A;  5D6E A;  1RIO H;  1U5T B;  2DI3 A;  1Z6R A;  3BDD A;  2XRO A;  2HTS A;  4RS8 A;  1E17 A;  2DBB A;  3E5X A;  4HA8 A;  3ZMS A;  3R60 A;  2W57 A;  3KP6 A;  1LB2 A;  3WTT C;  3ULQ B;  5HS8 A;  2HR3 A;  2XAG A;  4UHT A;  3WTW C;  1S8N A;  2JSC A;  2NYX A;  1FSE A;  1R5G A;  2FBI A;  2ZFW A;  3ML6 A;  3NRV A;  1R00 A;  2XAQ A;  4PGG A;  2NS0 A;  1KU7 A;  3R0A A;  1XDS A;  3L2C A;  2L54 A;  3I0T A;  1S3J A;  4HW0 A;  4CGZ A;  1WWX A;  1YLF A;  5JHU A;  1D8J A;  2E7W A;  5ILU A;  2X4H A;  1GXP A;  2ZO4 A;  1KQ9 A;  2ADU A;  3BOQ A;  2A3S A;  3QPH A;  2LDU A;  2XAH A;  4FHT A;  4M6X A;  3EUH A;  1LQ1 A;  1SFX A;  2HQR A;  4UXN A;  5L3F A;  4FX0 A;  3DQV C;  3I54 A;  5L3B A;  1K7A A;  5K1Y A;  4BXU A;  2QYO A;  3WTS C;  3EDP A;  2H6C A;  4RGS A;  5BQT A;  2AS5 F;  5A2Q K;  4LD5 A;  4ZZD A;  2F5C A;  4AD9 A;  3JW4 A;  3QP5 A;  1U8R A;  4IHS A;  2F2E A;  4LLL A;  2YX4 A;  4N0B A;  4WWC A;  1SD6 A;  1STZ A;  3I71 A;  4M73 A;  4PDK A;  5ICC A;  2KKO A;  4ON0 A;  4I2O A;  4HDU A;  5JR3 A;  3RTR A;  4GYI A;  2NNY A;  3FM3 A;  2A5Y B;  2Q2E A;  1Z7U A;  4M9Z A;  4UV8 A;  2K4B A;  3LQQ A;  2JT1 A;  3CUQ A;  2BBY A;  3PFI A;  1TTY A;  2Z99 A;  3HSR A;  2NAZ A;  2ISZ A;  4MTE A;  5BMZ A;  1IN8 A;  3VB2 A;  3KP7 A;  4CXF A;  5E8G A;  2ZKZ A;  3TOB A;  2CFX A;  4A6E A;  4L9J A;  2V79 A;  1W7P B;  5DCM B;  2O3F A;  2DW4 A;  1WSU A;  4HQM A;  2G7H A;  3P7N A;  2JZY A;  5D6F A;  5FB2 A;  2YX7 A;  4I09 A;  1IN5 A;  3GLX A;  3FHZ A;  1B9M A;  1DDN A;  1JGS A;  1BI0 A;  1IUY A;  4IJA A;  3LAP A;  2E1N A;  2FNA A;  2IJL A;  1YW9 A;  5HS7 A;  4LFU A;  3JTG A;  4KYW A;  1Q1H A;  2P7C B;  5E1X A;  5ERI A;  5D5V B;  5LLQ A;  1YS6 A;  2R7D A;  3FMS A;  3F8M A;  2TDX A;  1O57 A;  5FO5 A;  2GWR A;  2YPR A;  2W84 A;  3BJ6 A;  2FNP A;  2O03 A;  3DXJ F;  3E6M A;  2D1H A;  4LLN A;  2K4J A;  1V4R A;  3D5L A;  4OIQ F;  2OD5 A;  3ZMV A;  2OQR A;  2XGX A;  4GGG A;  3QP6 A;  4ENK A;  4HLX A;  1P4A A;  2VBY A;  3IC7 A;  4G6Q A;  3J80 Z;  4ENN A;  1B59 A;  4NHJ A;  3ZMD A;  2HDC A;  4ZH4 F;  5KK1 A;  1ZN2 A;  1JHH A;  4GYG A;  4YIF A;  4G9Y A;  4KIF A;  4HV5 A;  3IKT A;  3CDH A;  2KJB A;  1Z1D A;  1Y0U A;  4QWQ A;  1DPU A;  3CTA A;  1ZGJ A;  4HV6 A;  1ZRC A;  4LB5 A;  1IAW A;  2GXB A;  4A0X A;  2H27 A;  4OMY A;  3KET A;  3DF8 A;  5J8C A;  4EQQ A;  2Y48 A;  5D4S A;  2PLY A;  2P4W A;  2MH2 A;  1BN5 A;  2ZME A;  3T8R A;  2EFQ A;  4NB5 A;  4N9I A;  1LEA A;  3JSP A;  2QVO A;  2E7X A;  4P5O A;  2LF7 A;  5LEK A;  1O7F A;  3ELK A;  3O2P E;  3QU3 A;  5HDK A;  1BI3 A;  2HEO A;  1NHA A;  2YR2 A;  3W6J B;  3ZN1 A;  2EFP A;  3GXO A;  1H9G A;  2DFI A;  2D2W A;  3F8F A;  3F23 A;  2DK5 A;  3BPV A;  5FFX A;  3T1B A;  2Z33 A;  3BP8 A;  4MNU A;  2F5E A;  1TNT A;  1FWZ A;  4OIO F;  3G3Z A;  3R4K A;  3CUQ C;  3L00 A;  2XAJ A;  1TBX A;  2IW5 A;  1Z91 A;  2CWE A;  5EEH A;  3C3W A;  4GXO A;  5AIP A;  3IRR A;  5HLI A;  3KFW X;  3WTX C;  1HW5 A;  3F72 A;  4RB2 C;  1D3Y A;  3WTV C;  3CUQ B;  1KQ8 A;  2VC1 A;  2D45 A;  4Q5S F;  2K7L A;  1FP2 A;  1B9N A;  1OYY A;  1YW7 A;  1GVJ A;  2MLG A;  4A0Z A;  2FA5 A;  4HF0 A;  3NQO A;  3COA C;  2M87 A;  1FP1 D;  2EV5 A;  3IWF A;  1MDM B;  1HKT A;  1F4K A;  3F22 A;  1QGP A;  3HHH A;  2M1B A;  3EYY A;  3GZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...