4L0ZB

Crystal structure of runx1 and ets1 bound to tcr alpha promoter (crystal form 2)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
101
structure length
101
Chain Sequence
SGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of Ets1 activation by Runx1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 33
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l0zB00
1TLHB 3V8LA 2P7VB 2NRAC 5IT9Z 4U0WA 2K7LA 2IA0A 4ENMA 3P9KA 1LEBA 3BZ6A 1NHAA 3LSTA 1V3FA 3GEZA 3WU0A 3KE2A 2Q2EA 5H6QA 1P4AA 3KP2A 1AWCA 3GVAA 1OYIA 5E1XA 2FXAA 1K79A 3GZ6A 4HLYA 4MTDA 2STTA 1OYYA 3CO7C 1DPUA 4YFXF 2YPRA 4N9IA 4LJZF 2O6GE 2NS0A 3D0SA 2NYXA 1IRGA 5AONA 4FHTA 1PP7U 5HLIA 2IA1A 4GYGA 2ZBKA 2CO5A 4WXDA 1SMTA 4HV6A 1SD4A 4A6DA 2HZTA 2HQRA 1ULYA 2OQRA 3WTWC 4HA8A 1G3SA 1YW9A 4GGGA 5ICFA 2FMLA 3KEQA 5ERIA 1P92A 2A61A 3RPUA 3VFZA 3M8FA 2JPBA 2ZCWA 1WKMA 3FXRA 3RTRA 2IT0A 1R36A 4LG0A 5CLSA 2L4AA 4IRHA 3T5XA 1S3JA 1PP8F 4Z2YA 5IT3A 4P9FA 1U3EM 1USTA 1ZH5A 1D8KA 2QQBA 4JK1X 3DPLC 2Z9OA 2NAZA 4G8XA 1TQMA 1YQAA 1F4KA 2STWA 5L3FA 1S7OA 5H20A 1YW7A 1IN6A 4LGWA 3ROUA 1EV7A 2XRNA 3SZTA 1A04A 3RYPA 4YG2F 2IP2A 5ILSA 5HS9A 1B9MA 4RB0A 1FP1D 2B0LA 2EV5A 2RGVA 3SXYA 4UXNA 4GO1A 4R1HA 2RDPA 4KIFA 3IC7A 5DCMB 2PI0A 3ZMDA 3LAJA 4G6QA 5CJ9A 5CVVA 1R1TA 1JHHA 2OAZA 2FU4A 2VT2A 1J59A 1Z6TA 3ELKA 4PDKA 5CVRA 3DFGA 5LBQA 4EGZA 1QBJA 4O3MA 2M45A 1HKTA 1WWXA 2FBIA 3FXUA 4HDVA 4S04A 5ICGA 1FC3A 2PEXA 2VE9A 4CDGA 3TQNA 2E7WA 2HTSA 3R0JA 1I5ZA 4LLGF 2XAJA 3R6SA 1O57A 2IRFG 3KP7A 1SMYF 5FGMA 2EFWA 1FLIA 4IHSA 3KP4A 2XKPA 3EETA 2DPDA 3HSEA 4I2OA 4L0ZB 5K5QA 2KIFA 2M5WA 1YIOA 1RZ4A 3KFWX 3QOPA 1FBSA 3BY6A 5HLHA 1B59A 1HQCA 1RNLA 4KN7X 4D0PA 1HW1A 4EJWA 4PCQA 1XMAA 1QGPA 2HDCA 1W4MA 3FM5A 5E1ZB 1G3YA 1FNNA 1YS6A 2QM3A 4BYYA 1LDKB 1SFUA 3LA2A 4HAMA 4A5NA 1OKRA 3HTUA 5JI6A 1R5GA 4U88A 2EFPA 1BIBA 4HOBA 3F8MA 4KICA 1PDNC 2WV0A 1UFMA 1ON1A 5L3EA 1FPQA 3KP5A 2FBHA 3WTYC 1ZLKA 3GFIA 2VE8A 3E5QA 1IAWA 1O3TA 2H6CA 1FWZA 3CJNA 3L7WA 3DKWA 1GXPA 4BNCA 1QNTA 1T38A 4RGXA 2ELHA 1Z05A 2KRFA 3G73A 3IWFA 1FOKA 4A6EA 1IW7F 4U7DA 2EB7A 1YW8A 4YFKF 2A68F 3FMRA 2HS5A 1BBYA 1BIAA 3BP8A 5FFZA 4RS8A 3LFKA 2PBIA 5DCMA 2VONA 2PJPA 4EJUA 2IVMA 3QU6A 2RQPA 2X4HA 4CHUA 2IJLA 3WU1B 3N97A 1LDDA 1IXRC 2Y75A 3E6MA 4ENNA 3E6CC 4KMFA 2A6EF 2VN2A 3EYIA 1ZGAA 1XGOA 4XSZF 2K02A 3GFJA 5JR3A 5EEHA 2RVCA 1I6XA 3MZYA 5EEGA 2XIGA 2D1HA 2EA4A 3DP7A 3GO5A 1O7FA 1F9NA 2F5CA 1CF7A 1QZZA 2DQRA 2HKOA 1JXSA 4FT8A 3BDDA 2G7UA 1H9GA 2L01A 1HXDA 4EV0A 1SD7A 2EJRA 4HF1A 4A0ZA 1T39A 2MD5A 5FB2A 3T1BA 1X3UA 2Z33A 2X0LA 4HYEA 3WGIA 3EUHA 1UCRA 2OA4A 3WE3A 1RIOH 2LF8A 2F5DA 3F72A 3TDZC 1UHMA 4PZJA 3ULQB 3TOBA 4LG0B 3TGNA 5BPIA 2K4JA 2LDUA 3HHHA 4UVAA 1KA8A 4ESJA 3E97A 4CXFA 1BC8C 3P9IA 1UB9A 2CSOA 2CFXA 3IL2A 2D2WA 2P4WA 3WODF 4HLXA 2W24A 2HQNA 1O3QA 1P4WA 2CWEA 2P5VA 3V7SA 2J5PA 2GWRA 5D4RA 4UV8A 1KQ9A 2ZMEA 4MQ9F 1R1VA 4EVIA 5HLGA 1XGNA 4HBLA 1SD6A 1LB2A 2QQAA 3K1NA 2F2EA 3ISPA 3HYIA 3DXJF 1XGSA 3C7JA 4XSXF 3JTHA 4LK0F 4EM0B 5ICCA 2R3SA 4RGUA 4AIJA 4E70A 5D8LB 1S29A 1LDJA 3QU3A 2V1UA 3KETA 1MJBA 2HWVA 2RN7A 3J81K 3F3XA 5ILVA 4M71A 1LNWA 1TNTA 3EDPA 3ZN1A 4I01A 1U2WA 3RKXA 4ZH4F 3J80K 2AS5F 1IZ1A 2KIMA 4NB5A 5L3BA 5HDNA 2DFIA 5LHGA 4M6YA 4ZYHA 1FBQA 3NRVA 3E6BA 1HSTA 2XAGA 2GAUA 2VC1A 1J9IA 1G3TA 1C0WA 1XDUA 1LJ9A 4OIOF 3WGHA 5A2QK 5DV5A 1G4DA 1GXQA 2FE3A 2YU3A 4EGYA 5HOOA 3LA7A 4MHGA 4IJAA 3JAMK 2V1XA 5DUKA 2GA2A 4RB1A 3ECOA 1ON2A 5DDGA 3O2PE 4U0YA 4KN4X 1J75A 4Q48A 3ECHA 2ZO4A 4WCGA 5E17F 3I4PA 1YLFA 4L5IA 4XLPF 2DK5A 3CTAA 3W6KB 5A2QZ 2F5EA 4L9JA 2BE5F 1ZHFA 4HF2A 4RAZA 4M9ZA 4UVCA 2O0YA 3GUDA 3L9FA 3BWGA 2MBFA 3BPXA 3PFIA 5LEKA 4UNOA 4LLLA 1R58A 2BYVE 1T0FA 2VOPA 4G6DA 2P8TA 3WTSC 2DQLA 4XBFA 1Z9CA 4S05A 2ISYA 3R61A 1XSDA 1RI7A 1FX7A 3ABUA 2HYGD 3QPHA 3COAC 3FM3A 2XUBA 4BQAA 4OIQF 2EA2A 3TO9A 1QO0D 2IA2A 2MLGA 1OR7A 4P9UA 3GFMA 1IRFA 3I53A 5LHIA 3FF5A 1DDNA 4WF2A 2EFOA 4KT5C 5D8KB 3RKYA 1SD5A 2EK5A 2CYYA 3GW2A 4QWQA 1FSHA 4GYIA 2XV4S 4RB3C 4U0VA 1YG2A 1FYMA 2ZNYA 1YTYA 2Q8KA 3V4GA 1T6SA 2OU2A 4XLNF 1QZYA 4LLNA 3HSFA 1CF7B 2J5OA 4EJOA 3IKTA 2ESNA 1XSXA 3V7CA 3G3ZA 1F1ZA 2KKOA 1XSVA 2VXZA 3VEPA 4KUMA 3QRFF 4KA4A 4P5OA 4IRGA 3KLNA 1B6AA 5ICEA 2M30A 3GWZA 4CYDA 4KNYA 1GHCA 4CZZA 4O6JA 1J0RA 5CYVA 2OQGA 3JAMZ 4I0BA 1ODDA 2O3FA 4KIGA 3SQNA 3IKVA 5E1WA 1BI1A 2PN6A 2COMA 2L4MA 3IHUA 4ENKA 2HKXA 2L3DA 1BC7C 5E8GA 2QENA 3H3UA 3O3KA 3LQRA 4LB6B 2YR2A 2RNJA 3ZMUA 4WX9A 1XGMA 4M72A 3QAHA 2K4BA 2ZMEB 3SZPA 3R4KA 3RKWA 2NNNA 2PFBA 2XAQA 4IF4A 3RI4A 3FWEA 3LA3A 3BJOA 4ASNA 3J81Z 5J6XA 1KU3A 5E8IA 3TKYA 3BJAA 3N4MA 1YFHA 5DCFA 4KMUX 5E20A 3T0YA 3IRQA 5TRDA 2VBWA 3ZMZA 2ESHA 3VB2A 4HX7A 4HQEA 4AIKA 4G7OF 2O61A 2XAHA 2UWMA 3U2RA 4BHCA 1REPC 1MDMA 1WRJA 1FZPB 4WXCA 4UUVA 3QP5A 4IPAA 2JTVA 2LKPA 1J7KA 4OINF 2KJCA 4MTEA 1JHFA 1QQIA 1U5TB 4MGRA 1Z6RA 4BHPA 1G6NA 1AOYA 2AXLA 3ABTA 5CVJA 2XVCA 1WSUA 1U78A 4G7ZF 4L18B 3MFKA 1KU9A 1STZA 5J8FA 2QVOA 1E17A 1WI9A 2FF4A 2IPQX 5ED4A 1U6GA 3IWZA 1KYWA 2FMYA 4MQVA 1FT9A 1HKSA 1O3RA 3B02A 2OD5A 2P7CB 3ZMSA 3K0LA 2FEZA 1H0MA 3KP3A 1I27A 3TOAA 5BOXA 3H3ZA 4XRFA 1W7PA 1XB4A 1ZRCA 4OU0A 5F64A 2RKHA 3FX3A 2IW5A 4KDPA 4H0EA 1R00A 4GCVA 2K27A 2QQ9A 5HVQC 4YIFA 2MH2A 2WC2A 1MJ9A 3I59A 3DV8A 1IN8A 4TV7A 1B1BA 1VTNC 3F8CA 2KIUA 4A5MA 2Y0MA 4HX4A 5HDKA 4M73A 1D3YA 1SFEA 1EH7A 2ZFWA 3I54A 4I02A 5DD8A 3KP6A 2EV6A 2UXXA 4P55A 5L3DA 5D5VB 1KU7A 3KZZA 5D5XB 4ENJA 2VBZA 3GX4X 1H9TA 3ZMVA 5HS7A 2KJBA 4CGZA 4Y17A 4I0AA 1DUXC 1IXCA 1DPRA 2EWNA 4EMSA 1ZG5A 1K78A 1ZRDA 2RV8A 2DT5A 5TJJA 1ZREA 3HRMA 3WG9A 1TQPA 1IF1A 1FP2A 2M1BA 3VODA 1P2FA 3MWMA 1TW2A 2VBXA 3K9TA 3Q9VA 2VODA 2P5LC 1YYVA 4EQQA 4HW0A 1U5TA 2W84A 3MQ0A 1W7PD 2W57A 1BI0A 4ZYGA 2A6HF 4FX4A 3WGGA 1ZLJA 3I58A 1B9NA 2LNBA 4ESBA 1T2KA 1BI3A 5HS8A 4KIBA 4M9SA 1ZGJA 4UVBA 2UXNA 5J8CA 4G94A 1USSA 2MC3A 3C18A 3F6OA 3FXQA 1K6OA 1BJAA 2V1DA 4WXHA 2BV6A 5LEJA 2ZNZA 3J80Z 1SAXA 2FA5A 5HDGA 1SFXA 2ZJ2A 2NNYA 3LWFA 2MLKA 1XD7A 4LK1F 3CUQA 1BOAA 1W5SA 4Q47A 4R79A 3HSRA 2OBPA 2TDXA 5L3CA 3V8KA 5AIPA 2DK8A 1ZARA 4G9YA 1R23A 2DU9A 2P5KA 1FY7A 3EYYA 5DYMA 3L00A 4QLCU 3V7RA 1HSJA 3R0AA 3HOSA 1I1GA 1WQ2A 4YFNF 2H94A 1XN7A 3BOQA 1ZN2A 2QBYA 3TDUC 4B09A 5L3GA 2XHKA 1GVJA 5LGNA 2PLYA 3I59B 1R7JA 4L0YB 1U8RA 2CQKA 3JW4A 4A12A 2W85A 2O03A 3E6DA 3QPTA 3Q9SA 2PG4A 3LQQA 2Z3YA 4IRIA 3T8TA 5F6FA 4N0BA 4AD9A 1OPCA 3CO6C 3KZYA 4BHBA 2GZWA 1V4RA 1PUEE 2E1CA 3IRRA 2MH9A 5AIQA 4MEXF 1IN4A 1F5TA 2O8XA 2V79A 3BPVA 4M6XA 3L09A 2VC0A 2HFHA 1K78B 1Z91A 4KYWA 4A2UA 1MDMB 3B73A 3JSPA 4IHTA 3F21A 2L54A 4RGSA 3RPQA 1BM9A 2A5YB 3DEUA 1Y0UA 3RIRA 1L3LA 4HDUA 1R5HA 1HKQA 2MA3A 3MCZA 3E5XA 4AIHA 4IXAA 1XCVA 2DW4A 1ONVA 1T98A 4EM2A 4NHJA 2QLZA 2WWYA 3F8FA 4L9NA 2VBYA 2DPUA 5D6EA 2JSCA 4CICA 3JTGA 1P4XA 1BN5A 1I1SA 5D5WB 5H6RA 1ZRFA 2GXGA 5FO5A 4Y15A 3K69A 1MD0A 5LRRA 3T8RA 3K1PA 4HZFA 2P6SA 4LMYA 3FMQA 3M1EA 4KFCA 3CUQB 5ILUA 3HHGA 2H09A 2LF7A 3ZPLA 1L0OC 1JE8A 6PAXA 2RC4A 1W7PB 3KLOA 3GXOA 5FD5A 3HRTA 4Y13A 5D4SA 2JRTA 4UV9A 4OOIA 4MEYF 4ON0A 3F6VA 3MZHA 4ETSA 2H27A 1IN7A 3MEXA 4P96A 1D8JA 2QBYB 4OIRF 2M87A 4WK8F 4O5VA 2G9WA 4HQMA 2GA1A 3CUQC 2LSOA 3V8JA 3EQLF 1FYKA 4M74A 1CGPA 1TBXA 5LRSA 5BS6A 1MZBA 4RB2C 1RUOA 4MNUA 3SHFA 1KQ8A 3LAPA 2FOKA 4K2EA 1YS7A 3K2ZA 4G7HF 3BJ6A 2W25A 3WTUC 1XCBA 2EFQA 2FQ3A 2QZ8A 4JBAA 5LHHA 3PQJA 5D5UB 3HRUA 3I64A 1J2XA 4OMZA 2V9VA 2P6TA 4CO8A 1S6LA 5LGUA 1U5TC 3I0TA 2XROA 2DTRA 4LD5A 2R7DA 5LGTA 5FLXZ 3M8EA 4L9VA 2XGXA 2FRHA 4ZZLA 3GF2A 4OIPF 1B4AA 3WTVC 5E18F 4L9TA 1TW3A 3NEUA 2BGCA 3E5UA 3ZN0A 5F1RA 5K5OA 2BBYA 2GIVA 5DD4A 3GYHX 1QPMA 1E2XA 2E7XA 1O3SA 5CVUA 4FX0A 2VOOA 2HTJA 3Q5FA 4EJTA 2VT3A 2HYFA 1S8NA 1ZG3A 1HW2A 2A69F 3F23A 2V6CA 2PMHA 1TNSA 1KU2A 1R22A 4OMYA 3ZMTA 5BMZA 1KQ0A 3DPTA 4A0YA 4BXUA 3TO7A 1OMIA 1ZG1A 3ZP5A 1FBUA 2DO7A 3QP6A 2PMUA 4RGRA 2D45A 2A3SA 2OZ6A 1KGSA 3RDIA 4A0XA 3RJPA 1TTYA 1JGSA 3ML6A 4DQ2A 2G7HA 3F22A 2FBKA 1HW5A 5CVIA 2ZKZA 2XASA 4GXOA 3J7AO 2R7FA 2HR3A 2PQ8A 3H92A 3ZQ7A 3ERED 3C3WA 3O6BB 1RUNA 1R1UA 1HBXG 2DAOA 4UHTA 2DBBA 4BAYA 1K7AA 1G3WA 4LFUA 3AAFA 2QUFA 4R8HA 3P9CA 2EV0A 1EH8A 2ZXJA 2CG4A 1IUYA 1UHWA 3OV8A 1IN5A 3JSOA 3BROA 4EJVA 3WE2A 3HTSB 4IVNA 4F7ZA 2WTEA 4NQWA 1J5YA 3D5LA 2JT1A 2GQQA 4HF0A 5JVTA 4U7BA 1IXSB 5LLQA 3HUGA 4I7HA 5FLXK 4WWCA 1P6RA 5JHUA 3CDHA 3KCCA 3NQOA 3HRSA 3U9GA 5BPDA 3WTXC 4AWXB 1O7LA 2Z5UA 3M7GA 2GXBA 3FZVA 2Y48A 4JQFA 1TQIA 4ZYEA 2EFNA 1XDSA 3I5UA 3K1MA 1YO5C 2HEOA 2E1NA 1KYZA 1EH6A 1ZAOA 1LVAA 4M9XA 3TO6A 3WTTC 4Q4ZF 2ISZA 5IT9K 1OYWA 3REOA 4BH9A 5D6FA 4Q5SF 4DNCA 3W6JB 3VOEA 2HOEA 3WTZA 5KVRA 5FFXA 2A07F 2JPCA 3FMSA 5DUIA 1LQ1A 1FSEA 3F8BA 4ZYDA 5K5RA 5JFRA 2ETHA 3M9AA 4EM1A 2CW0F 3I71A 1LEAA 2YX7A 3P7NA 3GFLA 4PGGA 1Q1HA 2FSWA 3HOTA 2FNPA 2K86A 2Z99A 4HV5A 4L5JA 3CUOA 5K1YA 4LB5A 2Q0OA 3FHZA 2FNAA 3OOPA 5DEQA 2UZKA 4RAYA 1W5TA 3R60A 3L2CA 3KEOA 4I09A 2DI3A 2F5FA 4ZZDA 1Z7UA 1D5VA 1MKMA 3F8NA 5KK1A 3HIFA 5BQTA 1FYLA 2ADUA 1S7AA 4AVPA 4ESFA 2XKOA 2H6BA 3E3VA 1XMKA 2QYOA 2ACJA 2JZYA 2BEOA 1DP7P 3DF8A 3PQKA 4B8XA 1BI2A 3CLOA 3S2WA 4N9HA 2CGPA 2YSRA 2M8EA 1Z1DA 3C1DA 3SFZA 5FD6A 2C6YA 4YIIA 3DQVC 1ZYRF 3U1DA 2OZUA 3GLXA 1MGTA 2XAFA 1MJAA 4I98B 3MAJA 2L02A 2YX4A 2QWWA 2HGCA 3RYRA 2D1VA 4HX8A 3GZ5A 2DLLA 4PGHA
chains in the Genus database with same CATH superfamily
1TLHB 1IUFA 3J7AY 3V8LA 2P7VB 2NRAC 1X1PA 5IT9Z 4U0WA 2K7LA 1ETYA 4BY7J 2IA0A 2NOGA 4ENMA 3P9KA 1LEBA 3S1NJ 3BZ6A 1NHAA 3LSTA 3SYTA 1V3FA 3GEZA 3WU0A 1YIJI 3KE2A 2Q2EA 3FXKA 5H6QA 1P4AA 3KP2A 1AWCA 4IQ4A 5F0FA 3GVAA 3QYBA 4XKBA 1OYIA 5E1XA 2FXAA 5IP6A 2JA7J 4CGZA 3AKZA 1K79A 3GZ6A 2WB1A 4MTDA 4HLYA 2STTA 1F36A 4H4KC 3FKJA 1OYYA 3CO7C 1DPUA 2AHQA 1Y56A 3QYFA 4YFXF 2YPRA 4N9IA 4LJZF 2O6GE 4PFOA 2NS0A 3D0SA 2NYXA 3JRBA 1IRGA 5AONA 2JN6A 4D9JA 4BACA 4FHTA 1PP7U 5HLIA 2E19A 2IA1A 2JMWA 4GYGA 1RETA 3NAUA 2H8WA 2ZBKA 2CO5A 2DMPA 2R7VA 1XG1A 4WXDA 4NC7A 2LMDA 1SMTA 2CQ7A 4HV6A 1SD4A 1SEUA 4A6DA 3VSKA 2HZTA 1VZ0A 2HQRA 1ULYA 3AG3H 2OQRA 1Y0NA 3WTWC 2R7WA 3QYEA 4HA8A 1G3SA 3OYKA 1YW9A 2EPFA 4AIDA 5J4VA 1W36D 1MNMC 2XC7A 3U1KA 4GGGA 5ICFA 3M4OJ 3TW6A 2FMLA 2WV1A 3LMMA 4RM2A 3KEQA 1YOVB 1EJ9A 2VKEA 3C2GA 5ERIA 1P92A 2A61A 2CQQA 1BR1A 2JA5J 3RPUA 3VFZA 2LREA 5F04A 3M8FA 1YRNB 2JPBA 2ZCWA 1UG2A 1WKMA 3FXRA 3RTRA 2IT0A 1R36A 5CLSA 4LG0A 2L4AA 4IRHA 3T5XA 1S3JA 1PP8F 4HG2A 4Z2YA 2LVSA 1B72A 5IT3A 4NDLA 3K4JA 4P9FA 1U3EM 1USTA 4C2MJ 1ZH5A 2R5YA 1D8KA 3ABLH 1WVRA 2V26A 2Y31A 4F52A 1ERDA 2QQBA 1YJNI 3OYJA 3A01B 4JK1X 4A3LJ 3DPLC 2Z9OA 3PIOF 2NAZA 4G8XA 1TQMA 3JR9A 2KQRA 1YQAA 1F4KA 2STWA 5L3FA 1PUFB 1APLC 3DCFA 1S7OA 5IYBJ 1WJBA 2HXOA 2EIJH 2OCCH 3CF2A 3JRIA 5H20A 1YW7A 1U8BA 1IN6A 4JX4A 2KPMA 4LGWA 2PJRA 3CDIA 4X0GA 5FKOA 3ROUA 1EV7A 2G0EA 2DJIA 2XRNA 2DN0A 3SZTA 1A04A 1MNDA 4OAZA 3CCUI 3RYPA 4YG2F 1JTXA 1PVEA 2IP2A 5ILSA 4CA0A 5K7HA 5HS9A 1HC8A 3FXJA 1B9MA 5JHFA 3C2HA 4RB0A 4XONA 1FP1D 5IPAA 2B0LA 3OS1A 4GFBA 2EV5A 2RGVA 4DZPA 3SXYA 4HNTA 4UXNA 4BDZA 4GO1A 2GOMA 2DMTA 4R1HA 3S32A 2RDPA 3CC7I 4KIFA 3IC7A 5DCMB 2PI0A 3ZMDA 1UMQA 3S16J 1VI0A 5B1BH 1YJ9I 1JJ8C 3LAJA 4G6QA 5CJ9A 5CVVA 4C9YA 4JOMA 1LFBA 3WHCA 1R1TA 1JHHA 2OAZA 1X3WB 2FU4A 2VT2A 1Z6TA 2I5UA 3ELKA 4PDKA 1J59A 5CVRA 3DFGA 4B43A 5LBQA 4EGZA 4CCOA 1IDZA 1DU0A 3WHBA 2L7KA 1QBJA 4O3MA 1VQPI 4FASD 1IGNA 2M45A 1HKTA 1WWXA 2FBIA 3FXUA 3PO2J 2NVTJ 3OYBA 2NS8A 3TBIA 4HDVA 3VYTB 4S04A 2CJJA 3JRDA 3OYMA 1KZHA 2LRDA 5ICGA 2ZMEC 1FC3A 3I3LA 3CJQB 2PEXA 2VE9A 4CDGA 1SVMA 2L5QA 3TQNA 3HGGA 2E7WA 2HTSA 5CKTA 2CUZA 3RCOA 4I6ZA 3R0JA 2MD0A 5KAFC 1I5ZA 3D5SC 4LLGF 2XAJA 2JA6J 1Y8QB 3R6SA 1O57A 1K6YA 1RR7A 2IRFG 4BQQA 3O8HA 4NC8A 3KP7A 1HF0A 4PJLA 3TL4X 5B3SH 1SMYF 2NVUB 3CQZJ 2O7OA 5FGMA 2EFWA 1FLIA 4IHSA 3KP4A 2XKPA 3EETA 2DPDA 3BTIA 3HSEA 2CS3A 3G2BA 4I2OA 4N4OB 4L0ZB 4NNJA 5K5QA 3OIPA 2K5CA 2KIFA 2M5WA 1FIPA 1YIOA 2R5ZA 1RZ4A 3KFWX 3QOPA 4A3CJ 2EILH 1FBSA 3BY6A 5HLHA 1B59A 1HQCA 1Y8RB 2X6YA 4XN3A 1RNLA 1I3QJ 4KN7X 4D0PA 1H8AC 1HW1A 4EJWA 1QRYA 2LBFA 3CJTB 4PCQA 1XMAA 4FETA 3SFIA 1QGPA 2XGCA 1Y39A 3L2UA 3H9QA 2HDCA 1W4MA 3OR1C 3FM5A 2IS1A 5E1ZB 1G3YA 1FNNA 1YS6A 2QM3A 1Z3XA 2HYJA 4BYYA 2TRTA 4QSHA 3OYHA 1LDKB 4JX6A 1SFUA 2E5ZA 1X3ZB 4DJAA 1VQ5I 1TZLA 5CQEA 2IS6A 3H35A 3LA2A 4HAMA 4A5NA 1OKRA 3HTUA 5JI6A 1R5GA 4B3XA 4U88A 3LOCA 2R7QA 2WAEA 3CMYA 3W2AA 4AUXA 4QPQA 2EFPA 1BIBA 5BNGA 4HOBA 3F8MA 4KICA 2P81A 5H2FC 2WV0A 1PDNC 2OTJI 1UFMA 3NWTA 1TP4A 1ON1A 1GDTA 5L3EA 4XLCA 1FPQA 3FBNB 3PUBA 3W2WA 4U87A 3KP5A 2FBHA 1I50J 3AG1H 3WTYC 4B48A 1FJLA 2IAIA 1ITYA 1ZLKA 3OSFA 3K7AJ 3GFIA 5KNLA 2A5WA 2VE8A 3E5QA 1IAWA 1N75A 2LR8A 3BLYA 1O3TA 2H6CA 1FWZA 4OAYA 3CJNA 3L7WA 4CSWA 3DKWA 1GXPA 4BNCA 1QNTA 3H5RA 2L9SA 2ZFUA 1QPIA 1T38A 1YHQI 4RGXA 2ELHA 3W3CA 1Z05A 3HM5A 2KRFA 3G73A 4A3EJ 2CV0A 1MBHA 2L2OA 2XPUA 3IWFA 5GPAA 4A6EA 1FOKA 1IW7F 4U7DA 3MKLA 2EB7A 3DBLB 1YW8A 2EIMH 2WAQA 4YFKF 3QQAA 4FQGA 2CFOA 2A68F 3FMRA 2HS5A 3PNTA 1WJCA 1YX5A 3RQ4A 1BBYA 3CCLI 5DM7F 1BIAA 3BP8A 4AYBN 5FFZA 4RS8A 3LFKA 2PBIA 5DCMA 2VONA 4A3JJ 4ZYAA 2BOLA 2E71A 2PJPA 4EJUA 2IVMA 2NVQJ 3QU6A 4MO7A 2RQPA 2X4HA 1ETWA 1Y6IA 2IJLA 4D1QA 4CHUA 3WU1B 4ZJZA 1AKHB 3N97A 1W1WE 4IOCF 5IYCJ 1LDDA 1IXRC 1MMSA 2Y75A 3E6MA 2L0KA 4PUSA 2BW3B 2HPMA 4ENNA 3E6CC 1JTYA 2A6EF 4KMFA 2VN2A 3EYIA 1ZGAA 1XGOA 3BG3A 4XSZF 2K02A 4BDYA 3GFJA 5JR3A 2JVGA 5EEHA 4JX5A 2YU9J 4XR6A 4P1WA 2RVCA 1I6XA 3MZYA 3CJRB 4B1RA 5EEGA 3UR3C 1K4SA 1VQ9I 2XIGA 2D1HA 1UAAA 2EA4A 3DP7A 3GO5A 1O7FA 1F9NA 2F5CA 4M3EA 1CF7A 1QZZA 2DQRA 2HKOA 5JLWA 1JXSA 1ORKA 3BDDA 4FT8A 5KHDA 2G7UA 1H9GA 3K2AA 3DU6A 3S1MJ 2L01A 2LFBA 1HXDA 4EV0A 1X1DA 1SD7A 2EJRA 4J00A 4HF1A 4HNUA 4A0ZA 1T39A 1V5EA 2MD5A 2ECCA 5FB2A 1N78A 3T1BA 1X2NA 1X3UA 2Z33A 4BU2A 3GTGJ 3JRHA 2DMUA 1KONA 2X0LA 4HYEA 3WGIA 1Z77A 3EUHA 1RRJA 1SC7A 1UCRA 2OA4A 3WE3A 2QA4I 1RIOH 3CP2A 1MMNA 2K3FA 2LF8A 4BJ5C 3S3MA 2BXZA 2F5DA 3DTKA 5DS9A 3F72A 3TDZC 1UHMA 2QKLB 5IP9J 4PZJA 5J1YA 2A05A 3ULQB 1H88C 3TOBA 5GAEJ 2JUGA 4LG0B 3TGNA 5BPIA 2KHMA 4IHVA 2K4JA 2HVRA 1DGRM 2LDUA 3HHHA 2YS9A 3BR0A 4UVAA 4AC0A 4XL9A 1KA8A 4ESJA 1XX5A 3E97A 2HDDA 1FTTA 2X48A 3O8GA 4CXFA 1BC8C 3P9IA 2Y9YA 2YUSA 1UB9A 2CSOA 3ZRGA 4RLQA 2CFXA 3A01A 3IL2A 2D2WA 2P4WA 1DGWY 3WODF 5E3MA 1WJFA 2W1OA 3M3YJ 2M7BA 4BEHA 2ME0A 4HLXA 1JKPC 2W24A 5J47A 5C44J 2HQNA 4V2FA 2V1NA 1O3QA 4KT6A 4X6AJ 2AQFA 1P4WA 2CWEA 2P5VA 3V7SA 2J5PA 2PJRB 2GWRA 5D4RA 4LG3A 1SFKA 4UV8A 2L7MP 5LFAA 1KQ9A 2ZMEA 4MQ9F 1R1VA 4EVIA 5HLGA 1XGNA 2VXDA 4HBLA 4F93B 3A0HC 1SD6A 3LSPA 5F1JA 4IX7A 3DEWA 1LB2A 3TMOA 1IG7A 1IRZA 2QQAA 2IGNA 4NBQA 5HODA 5M5WJ 3K1NA 4B3AA 2F2EA 2RQQA 3AL0C 4QPOA 1D1BA 3ISPA 3MKYB 3PO3J 2E1OA 1YI2I 3D5RC 3HYIA 3DXJF 1XGSA 3AG2H 3C7JA 4XSXF 4A3IJ 1SFOJ 3JTHA 4IZZA 4IQJA 4LK0F 4EM0B 5FKMA 3HDDA 5ICCA 3GTKJ 1XC5A 2R3SA 4RGUA 4AIJA 4E70A 5D8LB 1S29A 1LDJA 4DYQA 3QU3A 1XS9A 3HGYA 2V1UA 3CCEI 1X2MA 3DBRB 5HLTA 2IXSA 3KETA 1VQKI 4RAGA 5F0CA 5F08A 1MJBA 1R6RA 2HWVA 3LSKA 2RN7A 4RLFA 3J81K 3F3XA 3S2DJ 5ILVA 4M71A 2BW3A 1IJWC 1LNWA 3EDPA 1TNTA 3ZN1A 4I01A 1U2WA 3RKXA 3G1LA 4ZH4F 2LY9A 2NXNB 1PYVA 2ID6A 2M9HA 3J80K 1H89C 1IZ1A 1AU7A 5J40A 2AS5F 2KIMA 2DMNA 4ZTFA 4NB5A 5L3BA 1WH7A 5HDNA 2DFIA 2M4KA 5LHGA 3PJRA 4M6YA 9ANTA 4G6TB 4ZYHA 1FBQA 3NRVA 3E6BA 4XM3A 2F4MB 1VFCA 4DBQA 1HSTA 2XAGA 1POGA 1TT5B 2GAUA 2VC1A 4IHYA 1J9IA 2EIKH 2OJED 1G3TA 2GM4A 1B8IA 5JVGF 3LSIA 2FJ1A 2R93J 1C0WA 1XDUA 4FCYA 1LJ9A 3PSIA 3WGHA 4OIOF 5A2QK 2F4IA 1FIAA 5DV5A 1G4DA 1GXQA 5FKLA 2FE3A 2YU3A 4EGYA 3BR6A 3CCMI 3FKIJ 2HOTA 1MBKA 5HOOA 3LA7A 1WJAA 1E3OC 1RKTA 4MHGA 4IJAA 1HDPA 3JAMK 5J1RA 2V1XA 5M3FJ 2P0WA 5K7FA 5DUKA 2GA2A 2M7AA 4RB1A 2XF6A 3ECOA 1ON2A 5DDGA 3O2PE 5CPRB 4U0YA 4KN4X 4F92B 1J75A 5FJ8J 4Q48A 3ECHA 5GPCA 2W7NA 2W82A 2ZO4A 2ZSIB 4WCGA 2AXTC 5E17F 3IH4A 3I4PA 3OL4A 1YLFA 4L5IA 2BXYA 2DK5A 4XLPF 1QVUA 3CTAA 2OPTA 3W6KB 1SVLA 5A2QZ 2F5EA 3NARA 1TL8A 4L9JA 2BE5F 4D5CA 2VKHA 3CMMA 5CQGA 1ZHFA 4HF2A 2NVYJ 2LYCA 2CV1A 4RAZA 4M9ZA 4UVCA 5JLXA 2O0YA 1NG7A 3GUDA 1AA7A 2GLOA 2K9MA 3L9FA 3DU5A 2HOAA 3BWGA 2MBFA 3BPXA 3PFIA 2V9PA 2XRLA 3K4KA 5LEKA 5EG0A 3HOZJ 4UNOA 1ETQA 2M34A 4BL0B 4LLLA 2W00A 1R58A 4PFPA 2BYVE 2F4OB 1T0FA 2JA2A 2VOPA 4G6DA 2P8TA 3WTSC 4IHXA 3U21A 2HQAA 3PL8A 5FRNA 2CW7A 4XKWA 2DQLA 1T56A 1JUSA 2M8GX 4XBFA 3RZOJ 1Z9CA 4AYBA 4S05A 2ISYA 1N25A 3R61A 1XSDA 1RI7A 1FX7A 3ABUA 4C3JJ 2HYGD 3FK6A 3S14J 3BG5A 3Q3SA 3QPSA 3QPHA 1BOBA 1HA8A 2JWTA 1JUPA 4FTHA 2R4GA 3COAC 3FM3A 2XUBA 4BQAA 4OIQF 2EA2A 2CV2A 3TO9A 4CCLA 4PJJA 1QO0D 2IA2A 2MLGA 1OR7A 4P9UA 3GFMA 3JREA 3HBLA 1IRFA 2M0CA 4B4CA 2GOXB 3I53A 3KX2A 5LHIA 3FF5A 2BY0A 4EATA 1DDNA 3VDXA 2WB1N 1AKHA 1GV2A 4WF2A 2CQXA 2DT6A 2B9SA 4IOAF 4DYRA 1XPXA 1OFCX 2EFOA 4KT5C 5D8KB 3Q0VA 1BW6A 5B1AH 3PSFA 3RKYA 1SD5A 5FLVA 2HVQA 4UUSA 3CMEI 3DKYA 2EK5A 3ZQLA 4ZDOA 3ZGKA 2CYYA 3GW2A 4QWQA 3CCRI 1FSHA 3H9JA 4GYIA 2XV4S 4RB3C 1NK2P 4E6KG 4U0VA 1I6HJ 3LSMA 1A6IA 1YG2A 1A36A 4PSWA 1FYMA 3JRFA 3J7ZI 2ZNYA 3H0DA 1YTYA 2Q8KA 3V4GA 1T6SA 1WJDA 2OU2A 2ELKA 2QSGX 4XLNF 1QZYA 4LLNA 3ZXSA 3HSFA 1NTCA 1CF7B 2DODA 2KZGA 1A6QA 2OCEA 2J5OA 4EJOA 2X6XA 3BR3A 2Z1DA 2AQEA 3IKTA 3OSGA 1CQTA 1RR8C 2ESNA 1XSXA 3V7CA 2FUG2 4C3IJ 3G3ZA 1YX3A 1F1ZA 4B44A 2Q1ZB 2KKOA 4Z6YA 2K40A 1XSVA 3ZQGA 3A2KA 2VXZA 2NOJB 3VEPA 3BCAA 1FEXA 1QU3A 1BA5A 4KUMA 1MH4A 2RNGA 2EZIA 3QRFF 1ZR4A 4KA4A 4P5OA 4IRGA 3KLNA 1B6AA 5ICEA 1OCOH 2M30A 1FOXA 4PJ0C 4PK4A 3VYUB 4E7IA 3GWZA 2JQ7A 4CYDA 2HVSA 3A0BC 1MMDA 4KNYA 1GHCA 2X1DA 4DBRA 4CZZA 4O6JA 1J0RA 5CYVA 2XGEA 2OQGA 2QCOA 3JAMZ 4I0BA 1ODDA 1NK3P 4IL6C 2O3FA 2DDAA 4KIGA 3IKVA 3SQNA 1IV6A 2HDWA 5E1WA 1TWCJ 1BI1A 2PN6A 2XAUA 4W1UA 2E5NA 1XTAA 4Y52J 2Z16A 2RAEA 2COMA 1W5CC 2L4MA 3ABKH 1X1CA 4G12A 3BTLA 2KLOA 3IHUA 4ENKA 2HKXA 2L3DA 3HB9A 3RZDJ 1BC7C 2A6TA 5E8GA 4BEHB 3FIWA 2QENA 3H3UA 3O3KA 3LQRA 4LB6B 2YR2A 2UV1A 2RNJA 1OCTC 3ZMUA 1ZK8A 4WX9A 2JA8J 4A3GJ 3M1CA 1XGMA 2K85A 2EBIA 4M72A 3QAHA 2K4BA 3IP4B 4PSXA 2ZMEB 1IDYA 3SZPA 3R4KA 2ME6A 5EG0B 1K61A 4QIWN 1MBJA 3RKWA 2NNNA 5IYDJ 3TP0A 1LFPA 5GAHJ 4XRSG 2PFBA 4Y3OA 3B6AA 1Z0XA 3PUFA 4ABZA 3I4MJ 2XAQA 4IF4A 3RI4A 3BC8A 3FWEA 3LA3A 3BJOA 4ASNA 3J81Z 2W4SA 3K4NA 5J6XA 3A02A 3LSGA 3HOYJ 1KU3A 5E8IA 2E2HJ 3WG7H 4IHWA 1E3PA 3TKYA 3BJAA 3L2QA 3N4MA 5DCFA 3S3NA 1YFHA 3SEZA 4KMUX 5E20A 3T0YA 3IRQA 3H5NA 3HG9A 2DMQA 3PNVA 5EGOA 2VBWA 5TRDA 3ZMZA 5E79C 2ESHA 2L7FP 2BVMA 4M3GA 4QTRA 1LE8A 3VB2A 2DFHA 2Y0SN 2VKVA 4HX7A 4HQEA 4AIKA 2QSHX 2LY2A 4G7OF 2O61A 1D1CA 2XAHA 2UWMA 4M3DA 2L9VA 3U2RA 4BHCA 1G8XA 1REPC 1MDMA 3Q0UA 1WRJA 2DTZA 2ZJPF 3ZCOA 4WXCA 1FZPB 2XPWA 4UUVA 3QP5A 3OYCA 1FMVA 4IPAA 3ESWB 4HNVA 1DP3A 1RESA 2IGOA 2K9QA 2JTVA 2LKPA 3K70D 1J7KA 1WI3A 4UUSB 4C3HJ 4M6VA 1E0EA 4OINF 2KJCA 4MTEA 1JHFA 1QQIA 4E7HA 1U5TB 3K4CA 3GTPJ 2WAQN 4MGRA 2XB0X 1Z6RA 4BHPA 1G6NA 2IEKA 2K9NA 2ZXIA 2MC4A 1AOYA 3QODA 2AXLA 3ABTA 4BQOA 3DTEA 5CVJA 1T08B 2XVCA 3FHNA 1WSUA 3JCUC 1U78A 4G7ZF 4L18B 5B66C 4E7JA 1B8IB 3MFKA 3A1YA 1JKOC 2CQNA 1KU9A 1STZA 1JGGA 4A3KJ 5J8FA 2QVOA 4CH7A 1K83J 1E17A 1MMAA 1WI9A 3I9V2 2FF4A 2ZB9A 2IPQX 3K4BA 3ASOH 2R7SA 3BZKA 1WPKA 3M8JA 2CMPA 1TWFJ 4E4HA 5ED4A 2CU7A 3GBGA 3UKGA 1U6GA 5IOZA 3IWZA 1KYWA 3H0GJ 2GXAA 2VIXA 4PJMA 2DCEA 2FMYA 2R92J 3BTCA 5KAIC 4C2TA 4MQVA 4FISA 1BR2A 2R7TA 1FT9A 1HKSA 3KEYA 1W0UA 1O3RA 3B02A 2OD5A 3DBHB 3ZMSA 1UHSA 5HNHA 3K0LA 1VQ4I 2P7CB 2FEZA 1H0MA 2M4GA 3K4MA 2LC2A 3HC7A 3KP3A 1I27A 3TOAA 2RREA 1TC3C 5BOXA 2ICWG 3MKWB 2KDOA 3H3ZA 1MBFA 2XF7A 4XRFA 4JYKA 1X19A 2L7ZA 4XNFA 1TT0A 1W7PA 3KPHA 1XB4A 2DDBA 2GIZA 2QQ8A 4OU0A 4RMNA 1ZRCA 5F64A 2RKHA 3BQZA 1TWHJ 4HSRA 3FX3A 1MW7A 2IW5A 4KDPA 1EF4A 4H0EA 2JUCA 3IH2A 1R00A 1R5ID 2E2IJ 4GCVA 2K27A 4CCMA 2QQ9A 2OTLI 5HVQC 1V5FA 4FE7A 3DPUA 2VQLA 4YIFA 2MH2A 2WC2A 1MJ9A 1X4PA 3I59A 3DV8A 3CESA 1IN8A 4TV7A 1B1BA 1VTNC 4BKXA 2DOAA 3L2RA 2DOFA 3F8CA 2KIUA 4A5MA 1D0YA 2Y0MA 4HX4A 5HDKA 4M73A 1D3YA 1SFEA 1EH7A 2KZVA 2XSJC 2ZFWA 3I54A 4I02A 2R7ZJ 1YITI 3BTJA 2DA2A 5DD8A 3KP6A 1OCRH 2EV6A 2UXXA 4P55A 5L3DA 3VSLA 5D5VB 1KU7A 3KZZA 3AFHA 5D5XB 4ENJA 3HL2A 2MABA 3Q0WA 2VBZA 4N4NB 3GX4X 5FKNA 1H9TA 4E7ZA 4V2GA 1X1BA 4BE2A 4BXFA 3ZMVA 1M1EB 2KJBA 2WBMA 4LITA 4LIVA 4Y17A 4I0AA 5HS7A 3EPZA 3VYRB 3S15J 1DU6A 3FBIB 1DUXC 1WHUA 4PJNA 1IXCA 2IS2A 1EKEA 1DPRA 1ENHA 5EGOB 2KDZA 3GLLA 4UY8I 2EWNA 4EMSA 2QSFX 3HKZN 2VJ4A 1ZG5A 5EZGA 1K78A 1MMGA 1ZRDA 2JRMA 2RV8A 2DT5A 3VYSB 3CCQI 5TJJA 3C2BA 1ZREA 3OYNA 3HRMA 3WG9A 1TQPA 1IF1A 3CC4I 3WU2C 1VQMI 2HU9A 1FP2A 2BVLA 2M1BA 4M3FA 4A3DJ 3VODA 2OC6A 3ZQFA 1P2FA 5FROA 1MSFC 5M5YJ 3FXMA 2DXIA 4II3A 3MWMA 4E7LA 1TW2A 2IS4A 2VBXA 3K9TA 2IGMA 4MLOA 3Q9VA 2VODA 3OS0A 2P5LC 1YYVA 1RC9A 4Y33A 1JT6A 3BCBA 4HW0A 1U5TA 2KRHA 2W84A 1R4NB 2X1CA 3KYCB 1T0FC 1W7PD 2W57A 3MQ0A 1BI0A 3NWSA 2A6HF 4ZYGA 1K4TA 4FX4A 2XF5A 3WGGA 1ZLJA 3I58A 1B9NA 2LNBA 1YE9A 2M3AA 3DLLF 4ESBA 2MYSA 3OS2A 3H9GA 1BI3A 2ECBA 1T2KA 5HS8A 2COBA 2Y2ZA 3CZ6A 3FXOA 3BG7A 4KIBA 3OYLA 4M9SA 1JT0A 1ZGJA 4UVBA 1P7JA 2WY7Q 2X6WA 2UXNA 5J8CA 3LNQA 1UG0A 2EZKA 4G94A 2GBYA 2VASA 2E35A 1USSA 2MC3A 2PMZA 3C18A 2XDVA 3FXQA 3F6OA 1K6OA 1BJAA 2V1DA 2EZLA 2IGKA 4MFDA 4WXHA 1WCMJ 3EUAA 4BUPA 2BV6A 5LEJA 2ZNZA 1ETVA 4AU7A 3J80Z 5EDNA 1SAXA 1UELB 2OUMA 5FRMA 2FA5A 5HDGA 3ZOBA 1DQUA 2I8DA 4XOTA 4KJZA 1SFXA 3G4SI 2ZJ2A 3L1PA 2NNYA 3LWFA 2M0MA 3ASNH 2MLKA 1XD7A 4CCKA 4LK1F 2IBDA 3JRAA 3CUQA 5IY5H 1BOAA 3E7LA 5GTHC 4Y4RA 1W5SA 4Q47A 4R79A 3CCYA 2OBPA 3HSRA 2TDXA 5L3CA 3CMAI 1I3AA 1GT0C 3V8KA 5AIPA 2R0QC 2DK8A 2JVHA 1ZARA 2DA7A 3ZQHA 4G9YA 3RKQA 1OLTA 1R23A 1A5JA 2AO9A 2DU9A 4W97A 2P5KA 1FY7A 3EYYA 2LG4A 5DYMA 4MIMA 3S1RJ 3L00A 4QLCU 3ZQCA 3V7RA 1HSJA 3R0AA 3HOSA 1I1GA 1WQ2A 4YFNF 5EEAA 3JRCA 2H94A 3MZ8A 1XN7A 1J09A 1I39A 1WH5A 3BOQA 1ZN2A 1QZEA 3TDUC 3RSNA 4B09A 5L3GA 2QBYA 1VF9A 4BGDA 2XHKA 1GVJA 5LGNA 2F6CA 4S0HB 2PLYA 3I59B 3IV5A 1R7JA 4L0YB 3MN2A 1U8RA 1IV8A 5F0HA 2CQKA 3JW4A 4A12A 2W85A 4BXXJ 2O03A 3E6DA 3QPLA 3QPTA 3Q9SA 5FLMJ 2PG4A 3LQQA 2Z3YA 4IRIA 3T8TA 2KFDA 2HI3A 2QGUA 1IC8A 5F6FA 4RM3A 4N0BA 4AD9A 1U0JA 2VJIA 1OPCA 3CO6C 3KZYA 3CCSI 4HPQA 3HJEA 4BHBA 1VQNI 2GZWA 1V4RA 1W36C 1PUEE 2E1CA 3ZQQA 2H1LA 3LSRA 3IRRA 2MH9A 5AIQA 4MEXF 3F9KA 1IN4A 4UB8C 3MKZA 2HNHA 2O8XA 1F5TA 2LD5A 1S9HA 4ZC3A 2V79A 3BPVA 2LOOA 4M6XA 2N8GA 3L09A 3HXLA 1QHHD 3G1OA 3UNGC 1LE8B 4AM3A 2VC0A 3VPRA 2HFHA 1K78B 1Z91A 4KYWA 2MSYA 4A2UA 1MDMB 3B73A 3JSPA 4IHTA 4FE4A 3F21A 4XLAA 2LP0A 2L54A 4RGSA 1BW5A 3RPQA 1BM9A 2A5YB 3DEUA 1Y0UA 2O9LA 3PFYA 3RIRA 2NVXJ 1D0XA 1UZCA 3ABMH 3SDBA 4HDUA 2FD5A 2ZJQF 1IRXA 1L3LA 1LVKA 4DYCA 2MW8A 1R5HA 1HKQA 2MA3A 1D0ZA 2KT0A 2TCTA 5B5EC 3MCZA 3E0JB 3E5XA 5DM6F 4AIHA 1UJ8A 4CYCA 2LTPA 1Y1VJ 1XCVA 2KISA 2VQHA 2HZDA 4IXAA 2DW4A 4J01A 1ONVA 2KL4A 5IP7J 2LKSA 3SZGA 4ZTJA 1T98A 4EM2A 4NHJA 2LH9A 1ETKA 2W48A 2BY1A 2QLZA 3S2HJ 3CP8A 2K9LA 2WWYA 3MMYB 3F8FA 4L9NA 2VBYA 1Q1VA 1WFXA 2DPUA 5D6EA 1SAUA 4M3BA 3GTOJ 2JSCA 4CICA 2LY1A 4BBRJ 1Z21A 1ETXA 2V9KA 1X4OA 3JTGA 1P4XA 1BN5A 3W6VA 1S7EA 3SJMA 1I1SA 5D5WB 4JP0A 5H6RA 1ZRFA 4EEFG 1Z67A 2GXGA 3K70C 5FO5A 1A31A 4Y15A 3CF5F 4V19K 3K69A 3L2WA 1MD0A 5LRRA 4J19A 4BY1J 3T8RA 3KZIC 4YEJA 3K1PA 4HZFA 2P6SA 4LMYA 3FMQA 2DA6A 2FX0A 3L2VA 4C2UA 3M1EA 3DWLE 4XRSA 1JUMA 1T95A 2QF7A 3MD2A 3CUQB 4DW6A 4KFCA 1RKWA 5ILUA 1T8IA 1X1AA 1JI8A 2BY3A 2O8KA 3HHGA 4RA2A 2H09A 2LF7A 3BR5A 3EUHC 1VQLI 3ZPLA 1L0OC 1JE8A 6PAXA 1GUUA 3K10A 2RC4A 1W7PB 2CUJA 4Y7NJ 3KLOA 3GXOA 5FD5A 3HRTA 3S1QJ 5E3LA 4Y13A 2Y69H 2NS7A 5D4SA 3H3VK 2JRTA 3PM1A 3CD6I 1GV5A 4E7SA 3ONQA 4UV9A 4DIQA 3S17J 4OOIA 3OR2C 2DYSH 2BZTA 3ZR8X 4MEYF 4ON0A 3F6VA 3MZHA 3PIPF 4ETSA 2H27A 1IN7A 3MEXA 4P96A 1D8JA 3F0CA 4D5FA 1R49A 2QBYB 1TWGJ 4OIRF 1HLVA 3D1NI 2KP6A 2M87A 1WJ5A 4II2A 2VPLA 3H36A 4WK8F 3OY9A 2CUFA 3HPHA 2MFZA 4O5VA 2G9WA 2JJ7A 3FISA 4GDFA 2K3PA 1WZ2A 2ZJRF 2R7XA 2E34A 2UUZA 4HQMA 2VQCA 2GA1A 3CUQC 2Y9ZA 4BE0A 5GAGJ 4X1EA 2LSOA 3BR1A 4C30A 3V8JA 1BJZA 3EQLF 2WAFA 1HCRA 2V6EA 3X2QH 4M74A 1FYKA 1CGPA 1TBXA 3V42A 2BHYA 2QEXI 5LRSA 5BS6A 1MZBA 5TISC 4RB2C 2CRGA 1N77A 1RUOA 1R4MB 4MNUA 1U9OA 2XPVA 3BR2A 5HNFA 2X51A 2DYRH 1FOYA 3HOVJ 3BT9A 4ANJA 2HOSA 3SHFA 1KQ8A 3LAPA 2FOKA 4K2EA 1YS7A 3K2ZA 4G7HF 3IAM2 2HQ5A 3BJ6A 2CUEA 2LLKA 2W25A 2X1EA 1ZGWA 2R7OA 1OCZH 3WTUC 1XCBA 2EFQA 4CCNA 2FQ3A 2QZ8A 4JBAA 5LHHA 1A35A 2H1KA 3PQJA 4DGWB 5D5UB 3HRUA 3I64A 4CCJA 1J2XA 4OMZA 3AG4H 2V9VA 2F48A 4A69C 2L9RA 1PJRA 1OCPA 3FXLA 2P6TA 1ZR2A 4CO8A 1S6LA 3HEFA 2B7EA 2ZSHB 3OYGA 4F91B 5LGUA 1U5TC 1ZELA 3I0TA 2XROA 2B63J 2DTRA 4LD5A 1F43A 3HUGB 3TEDA 2R7DA 5LGTA 5FLXZ 3M8EA 4L9VA 1VQ6I 4LOCA 3A03A 5DTDA 1VQ7I 4XORA 1OJLA 2XGXA 2DOEA 1BL0A 2FRHA 1QVTA 1MNEA 4ZZLA 3GF2A 1QA6A 1B4AA 5EJCA 4OIPF 3WTVC 5E18F 4L9TA 1TW3A 3SDGA 1V54H 3NEUA 2BGCA 1V55H 3QOEA 3E5UA 4OWRB 4EQQA 3I4NJ 3ZN0A 4HRIA 3I56I 3HOXJ 5F1RA 5K5OA 1MH3A 1R9TJ 1G2HA 5EZHA 1JKRC 2BBYA 2FOWA 2WADA 3SEQA 2GIVA 5DD4A 3GYHX 1SANA 4XLHA 2DA5A 1QPMA 1E2XA 2ZC2A 2E7XA 1O3SA 5CVUA 3CDLA 4FX0A 1G59A 2VOOA 2HTJA 4AVZA 3Q5FA 4EJTA 2VT3A 2HYFA 2DA3A 1S8NA 1FTZA 4XMYA 1ZG3A 1HW2A 2VQGA 3HOUJ 2A69F 3F23A 2V6CA 2PMHA 1TNSA 4DZJA 3HOWJ 1KU2A 1Z7LA 2VPRA 1E3HA 1R22A 2QKMB 4OMYA 3GZNB 3ZMTA 5BMZA 1KQ0A 3HKZA 3CC2I 4BQNA 1FMWA 5M3MJ 3DPTA 3ZQIA 4A0YA 4BXUA 2X9DA 3TO7A 3HPGA 4XKCA 1VQ8I 1OMIA 2PMZN 4IO9F 1ZG1A 3ZP5A 3OYAA 1OCCH 2XGDA 4ZDPA 1LUJB 1FBUA 4F3QA 2DO7A 4GRIA 2E1MB 3QP6A 4XLFA 2PMUA 4RGRA 2D45A 3GTJJ 1WGXA 2A3SA 2OZ6A 3IH3A 4XN0A 1KGSA 3RDIA 3CCJI 2F5VA 4A0XA 5GADJ 3RJPA 5E3NA 3GMEA 1TTYA 4HSTA 1JGSA 4NC6A 4XKVA 3ML6A 1LPQA 4DQ2A 2G7HA 3CLQA 4KITB 2FBKA 3F22A 1NH3A 1HW5A 2JSPA 5CVIA 5FKKA 2ZKZA 3S93A 3S3OA 2Z2SB 2XASA 4BBSJ 3GCMA 4GXOA 4XLEA 1VQOI 3J7AO 1AHDP 2R7FA 2HR3A 2MGQA 2PQ8A 3H92A 4KISA 1T33A 3ZQ7A 3E1SA 3ERED 2E36A 4B47A 3C3WA 4XQFA 1HDDC 3GTQJ 5EYRA 3O6BB 4XRMA 1RUNA 3OIOA 1P7IA 1ZKGA 3TP3A 1R1UA 3GTLJ 1HBXG 5LD2C 2DAOA 4UHTA 2DBBA 3DLAA 4BE1A 4BAYA 4DOZA 1K7AA 1G3WA 1TWAJ 2EZHA 4LFUA 2ID3A 3AAFA 4BJTA 3FK7A 2QUFA 2VKDA 1Z3YA 5J3LA 4R8HA 4XK4A 3P9CA 4MFEA 2EV0A 1EH8A 2ZXJA 2MG4A 2CG4A 1Y1WJ 3W2VA 2R5YB 1IUYA 2CW8A 1UHWA 3OV8A 1IN5A 4NUBA 1MBGA 3JSOA 3K4LA 3ERMA 3OYFA 3BROA 2M2EA 4EJVA 3WE2A 3H1CA 3HTSB 4IVNA 4F7ZA 2WTEA 1NG6A 3G1MA 4NQWA 1J5YA 3D5LA 2JT1A 5C4XJ 2VB6A 2GQQA 4HF0A 5JVTA 4U7BA 1IXSB 5LLQA 2OV7A 1O4XA 4CZCA 1HOMA 2O5RA 3HUGA 4I7HA 4CYCB 2JK3A 4WWCA 1P6RA 5FLXK 5JHUA 3CDHA 4D7MA 3KCCA 1BR4A 1U9NA 1R71A 2DFFA 5M5XJ 3NQOA 1ZTRA 3HRSA 1VNDA 2LKXA 3U9GA 3BG9A 5BPDA 3WTXC 1P9QC 3LSJA 3OL3A 4AWXB 2PX9A 1O7LA 2Z5UA 2XSDC 4LIUA 3M7GA 4BJ6C 2GXBA 2VUMJ 3RQIA 1MIJA 2VLAA 1LFUP 2D5VA 3FZVA 2Y48A 4JQFA 3I55I 1X58A 1TQIA 4RAFA 2Y30A 3OOUA 3FDYA 1GVDA 2DA1A 4ZYEA 1IO2A 2DFEA 2EFNA 4I76A 3OYEA 3S8PA 2VL8A 1XDSA 3I5UA 1S72I 1XMXA 3K1MA 1YO5C 2HEOA 1W0TA 2E1NA 1KYZA 1EH6A 1S5LC 5E3OA 3OYDA 1ZAOA 1JKQC 4UB6C 1LVAA 4M9XA 5GTIC 3M07A 4XOPA 3TO6A 3WTTC 2WY8Q 2Q2EB 2WA0A 4Q4ZF 2ISZA 5IT9K 1D1AA 1OYWA 3REOA 2K9SA 2VJ5A 3KYLA 2KRCA 4BH9A 2XB5A 3LL7A 5D6FA 3IAS2 4Q5SF 4DNCA 1MBEA 3W6JB 3VOEA 2HOEA 3WTZA 5KVRA 5FFXA 2A07F 2EH3A 2JPCA 3FMSA 3MVPA 4A3BJ 4IKFA 5DUIA 3QWLA 4XIDA 2DT7B 4L5EA 1LQ1A 4RDUA 1FSEA 3EUKL 4ITVA 5C4JJ 3F8BA 4ZYDA 3CCVI 3OYIA 5K5RA 2HPIA 1ACIA 5JFRA 2ETHA 3M9AA 3BZCA 4ZDLA 3K6GA 4XICA 1QHGA 2X6OA 2LK2A 3OMYA 4EM1A 4IEJA 2CW0F 3KIOA 3I71A 1LEAA 2YX7A 5KCMA 1OISA 3BQYA 2CH0A 2R5ZB 3P7NA 3GFLA 5EF6A 4PGGA 2E1MC 1Q1HA 2FSWA 3HOTA 3TW7A 2FNPA 2K86A 1SVOA 2Z99A 2ZXHA 4HV5A 3IUOA 4L5JA 3CUOA 5K1YA 2Y0SA 2LBFB 4LB5A 3G6EI 2E60A 2BHZA 2EINH 2Q0OA 3FHZA 2FNAA 3OOPA 1YRNA 5C3EJ 2ZXWH 5DEQA 4I99C 2UZKA 3N05A 4RAYA 1W5TA 3R60A 3L2CA 2R7UA 3KEOA 4I09A 3J7YJ 1ZQ3P 4D7NA 4HEA2 2DI3A 5TGTA 1B72B 2F5FA 4F55A 5K7ZA 4ZZDA 1Z7UA 1EA3A 3DTIA 1D5VA 4A3MJ 1MKMA 3F8NA 5KK1A 2VI6A 4BS9A 3HIFA 5BQTA 1FYLA 2ADUA 1GLNA 1S7AA 4AVPA 3B6CA 3H5AA 3P5JA 3KYDB 2BY2A 4ESFA 2XKOA 2H6BA 3E3VA 1XMKA 2HXIA 1MSEC 2QYOA 2ACJA 3LFUA 3A4CA 1WJEA 2JZYA 2BEOA 2V7FA 1DP7P 3DF8A 1PUFA 3PQKA 4B8XA 2ELJA 3G71I 2OF7A 2H8RA 1BI2A 3CLOA 3S2WA 4N9HA 4RBOA 1D5YA 2CGPA 3GTMJ 2E2JJ 2YSRA 4NQWB 1V5GA 5F27A 2M8EA 3DEEA 5J4YA 4A93J 1Z1DA 5GP9A 3C1DA 3SFZA 5FD6A 2FQ4A 2C6YA 3VWBA 1JJ6C 1FOWA 4YIIA 1LKXA 3LSHA 3DQVC 3OWTA 3BG6A 2DA4A 4E7KA 1ZYRF 3U1DA 5J1UA 2OZUA 3GLXA 3DKXA 1MGTA 2L9NA 1OQYA 4YRVA 2XAFA 2KMUA 4YELA 3OIQA 1MJAA 4I98B 4UUTA 3MAJA 3HZJA 2L02A 3RPUD 2R7RA 2KIQA 2DJNA 3PNYA 1OR7C 4YIRX 2YX4A 1YJWI 2EQRA 2QWWA 2VJJA 4A3FJ 2HGCA 5IOYA 4CUGA 3RYRA 2X85A 2D1VA 1ETOA 4HX8A 3GZ5A 1RPWA 2DLLA 2I10A 2V4JC 4PGHA 3JRGA 3AL0B
chains in the Genus database with same CATH topology
1TLHB 3V8LA 2P7VB 2NRAC 5IT9Z 4U0WA 2K7LA 2IA0A 4ENMA 3P9KA 1LEBA 3BZ6A 1NHAA 3LSTA 1V3FA 3GEZA 3WU0A 3KE2A 2Q2EA 5H6QA 1P4AA 3KP2A 1AWCA 3GVAA 1OYIA 5E1XA 2FXAA 1K79A 3GZ6A 4HLYA 4MTDA 2STTA 1OYYA 3CO7C 1DPUA 4YFXF 2YPRA 4N9IA 4LJZF 2O6GE 2NS0A 3D0SA 2NYXA 1IRGA 5AONA 4FHTA 1PP7U 5HLIA 2IA1A 4GYGA 2ZBKA 2CO5A 4WXDA 1SMTA 4HV6A 1SD4A 4A6DA 2HZTA 2HQRA 1ULYA 2OQRA 3WTWC 4HA8A 1G3SA 1YW9A 4GGGA 5ICFA 2FMLA 3KEQA 5ERIA 1P92A 2A61A 3RPUA 3VFZA 3M8FA 2JPBA 2ZCWA 1WKMA 3FXRA 3RTRA 2IT0A 1R36A 4LG0A 5CLSA 2L4AA 4IRHA 3T5XA 1S3JA 1PP8F 4Z2YA 5IT3A 4P9FA 1U3EM 1USTA 1ZH5A 1D8KA 2QQBA 4JK1X 3DPLC 2Z9OA 2NAZA 4G8XA 1TQMA 1YQAA 1F4KA 2STWA 5L3FA 1S7OA 5H20A 1YW7A 1IN6A 4LGWA 3ROUA 1EV7A 2XRNA 3SZTA 1A04A 3RYPA 4YG2F 2IP2A 5ILSA 5HS9A 1B9MA 4RB0A 1FP1D 2B0LA 2EV5A 2RGVA 3SXYA 4UXNA 4GO1A 4R1HA 2RDPA 4KIFA 3IC7A 5DCMB 2PI0A 3ZMDA 3LAJA 4G6QA 5CJ9A 5CVVA 1R1TA 1JHHA 2OAZA 2FU4A 2VT2A 1J59A 1Z6TA 3ELKA 4PDKA 5CVRA 3DFGA 5LBQA 4EGZA 1QBJA 4O3MA 2M45A 1HKTA 1WWXA 2FBIA 3FXUA 4HDVA 4S04A 5ICGA 1FC3A 2PEXA 2VE9A 4CDGA 3TQNA 2E7WA 2HTSA 3R0JA 1I5ZA 4LLGF 2XAJA 3R6SA 1O57A 2IRFG 3KP7A 1SMYF 5FGMA 2EFWA 1FLIA 4IHSA 3KP4A 2XKPA 3EETA 2DPDA 3HSEA 4I2OA 4L0ZB 5K5QA 2KIFA 2M5WA 1YIOA 1RZ4A 3KFWX 3QOPA 1FBSA 3BY6A 5HLHA 1B59A 1HQCA 1RNLA 4KN7X 4D0PA 1HW1A 4EJWA 4PCQA 1XMAA 1QGPA 2HDCA 1W4MA 3FM5A 5E1ZB 1G3YA 1FNNA 1YS6A 2QM3A 4BYYA 1LDKB 1SFUA 3LA2A 4HAMA 4A5NA 1OKRA 3HTUA 5JI6A 1R5GA 4U88A 2EFPA 1BIBA 4HOBA 3F8MA 4KICA 1PDNC 2WV0A 1UFMA 1ON1A 5L3EA 1FPQA 3KP5A 2FBHA 3WTYC 1ZLKA 3GFIA 2VE8A 3E5QA 1IAWA 1O3TA 2H6CA 1FWZA 3CJNA 3L7WA 3DKWA 1GXPA 4BNCA 1QNTA 1T38A 4RGXA 2ELHA 1Z05A 2KRFA 3G73A 3IWFA 1FOKA 4A6EA 1IW7F 4U7DA 2EB7A 1YW8A 4YFKF 2A68F 3FMRA 2HS5A 1BBYA 1BIAA 3BP8A 5FFZA 4RS8A 3LFKA 2PBIA 5DCMA 2VONA 2PJPA 4EJUA 2IVMA 3QU6A 2RQPA 2X4HA 4CHUA 2IJLA 3WU1B 3N97A 1LDDA 1IXRC 2Y75A 3E6MA 4ENNA 3E6CC 4KMFA 2A6EF 2VN2A 3EYIA 1ZGAA 1XGOA 4XSZF 2K02A 3GFJA 5JR3A 5EEHA 2RVCA 1I6XA 3MZYA 5EEGA 2XIGA 2D1HA 2EA4A 3DP7A 3GO5A 1O7FA 1F9NA 2F5CA 1CF7A 1QZZA 2DQRA 2HKOA 1JXSA 4FT8A 3BDDA 2G7UA 1H9GA 2L01A 1HXDA 4EV0A 1SD7A 2EJRA 4HF1A 4A0ZA 1T39A 2MD5A 5FB2A 3T1BA 1X3UA 2Z33A 2X0LA 4HYEA 3WGIA 3EUHA 1UCRA 2OA4A 3WE3A 1RIOH 2LF8A 2F5DA 3F72A 3TDZC 1UHMA 4PZJA 3ULQB 3TOBA 4LG0B 3TGNA 5BPIA 2K4JA 2LDUA 3HHHA 4UVAA 1KA8A 4ESJA 3E97A 4CXFA 1BC8C 3P9IA 1UB9A 2CSOA 2CFXA 3IL2A 2D2WA 2P4WA 3WODF 4HLXA 2W24A 2HQNA 1O3QA 1P4WA 2CWEA 2P5VA 3V7SA 2J5PA 2GWRA 5D4RA 4UV8A 1KQ9A 2ZMEA 4MQ9F 1R1VA 4EVIA 5HLGA 1XGNA 4HBLA 1SD6A 1LB2A 2QQAA 3K1NA 2F2EA 3ISPA 3HYIA 3DXJF 1XGSA 3C7JA 4XSXF 3JTHA 4LK0F 4EM0B 5ICCA 2R3SA 4RGUA 4AIJA 4E70A 5D8LB 1S29A 1LDJA 3QU3A 2V1UA 3KETA 1MJBA 2HWVA 2RN7A 3J81K 3F3XA 5ILVA 4M71A 1LNWA 1TNTA 3EDPA 3ZN1A 4I01A 1U2WA 3RKXA 4ZH4F 3J80K 2AS5F 1IZ1A 2KIMA 4NB5A 5L3BA 5HDNA 2DFIA 5LHGA 4M6YA 4ZYHA 1FBQA 3NRVA 3E6BA 1HSTA 2XAGA 2GAUA 2VC1A 1J9IA 1G3TA 1C0WA 1XDUA 1LJ9A 4OIOF 3WGHA 5A2QK 5DV5A 1G4DA 1GXQA 2FE3A 2YU3A 4EGYA 5HOOA 3LA7A 4MHGA 4IJAA 3JAMK 2V1XA 5DUKA 2GA2A 4RB1A 3ECOA 1ON2A 5DDGA 3O2PE 4U0YA 4KN4X 1J75A 4Q48A 3ECHA 2ZO4A 4WCGA 5E17F 3I4PA 1YLFA 4L5IA 4XLPF 2DK5A 3CTAA 3W6KB 5A2QZ 2F5EA 4L9JA 2BE5F 1ZHFA 4HF2A 4RAZA 4M9ZA 4UVCA 2O0YA 3GUDA 3L9FA 3BWGA 2MBFA 3BPXA 3PFIA 5LEKA 4UNOA 4LLLA 1R58A 2BYVE 1T0FA 2VOPA 4G6DA 2P8TA 3WTSC 2DQLA 4XBFA 1Z9CA 4S05A 2ISYA 3R61A 1XSDA 1RI7A 1FX7A 3ABUA 2HYGD 3QPHA 3COAC 3FM3A 2XUBA 4BQAA 4OIQF 2EA2A 3TO9A 1QO0D 2IA2A 2MLGA 1OR7A 4P9UA 3GFMA 1IRFA 3I53A 5LHIA 3FF5A 1DDNA 4WF2A 2EFOA 4KT5C 5D8KB 3RKYA 1SD5A 2EK5A 2CYYA 3GW2A 4QWQA 1FSHA 4GYIA 2XV4S 4RB3C 4U0VA 1YG2A 1FYMA 2ZNYA 1YTYA 2Q8KA 3V4GA 1T6SA 2OU2A 4XLNF 1QZYA 4LLNA 3HSFA 1CF7B 2J5OA 4EJOA 3IKTA 2ESNA 1XSXA 3V7CA 3G3ZA 1F1ZA 2KKOA 1XSVA 2VXZA 3VEPA 4KUMA 3QRFF 4KA4A 4P5OA 4IRGA 3KLNA 1B6AA 5ICEA 2M30A 3GWZA 4CYDA 4KNYA 1GHCA 4CZZA 4O6JA 1J0RA 5CYVA 2OQGA 3JAMZ 4I0BA 1ODDA 2O3FA 4KIGA 3SQNA 3IKVA 5E1WA 1BI1A 2PN6A 2COMA 2L4MA 3IHUA 4ENKA 2HKXA 2L3DA 1BC7C 5E8GA 2QENA 3H3UA 3O3KA 3LQRA 4LB6B 2YR2A 2RNJA 3ZMUA 4WX9A 1XGMA 4M72A 3QAHA 2K4BA 2ZMEB 3SZPA 3R4KA 3RKWA 2NNNA 2PFBA 2XAQA 4IF4A 3RI4A 3FWEA 3LA3A 3BJOA 4ASNA 3J81Z 5J6XA 1KU3A 5E8IA 3TKYA 3BJAA 3N4MA 1YFHA 5DCFA 4KMUX 5E20A 3T0YA 3IRQA 5TRDA 2VBWA 3ZMZA 2ESHA 3VB2A 4HX7A 4HQEA 4AIKA 4G7OF 2O61A 2XAHA 2UWMA 3U2RA 4BHCA 1REPC 1MDMA 1WRJA 1FZPB 4WXCA 4UUVA 3QP5A 4IPAA 2JTVA 2LKPA 1J7KA 4OINF 2KJCA 4MTEA 1JHFA 1QQIA 1U5TB 4MGRA 1Z6RA 4BHPA 1G6NA 1AOYA 2AXLA 3ABTA 5CVJA 2XVCA 1WSUA 1U78A 4G7ZF 4L18B 3MFKA 1KU9A 1STZA 5J8FA 2QVOA 1E17A 1WI9A 2FF4A 2IPQX 5ED4A 1U6GA 3IWZA 1KYWA 2FMYA 4MQVA 1FT9A 1HKSA 1O3RA 3B02A 2OD5A 2P7CB 3ZMSA 3K0LA 2FEZA 1H0MA 3KP3A 1I27A 3TOAA 5BOXA 3H3ZA 4XRFA 1W7PA 1XB4A 1ZRCA 4OU0A 5F64A 2RKHA 3FX3A 2IW5A 4KDPA 4H0EA 1R00A 4GCVA 2K27A 2QQ9A 5HVQC 4YIFA 2MH2A 2WC2A 1MJ9A 3I59A 3DV8A 1IN8A 4TV7A 1B1BA 1VTNC 3F8CA 2KIUA 4A5MA 2Y0MA 4HX4A 5HDKA 4M73A 1D3YA 1SFEA 1EH7A 2ZFWA 3I54A 4I02A 5DD8A 3KP6A 2EV6A 2UXXA 4P55A 5L3DA 5D5VB 1KU7A 3KZZA 5D5XB 4ENJA 2VBZA 3GX4X 1H9TA 3ZMVA 5HS7A 2KJBA 4CGZA 4Y17A 4I0AA 1DUXC 1IXCA 1DPRA 2EWNA 4EMSA 1ZG5A 1K78A 1ZRDA 2RV8A 2DT5A 5TJJA 1ZREA 3HRMA 3WG9A 1TQPA 1IF1A 1FP2A 2M1BA 3VODA 1P2FA 3MWMA 1TW2A 2VBXA 3K9TA 3Q9VA 2VODA 2P5LC 1YYVA 4EQQA 4HW0A 1U5TA 2W84A 3MQ0A 1W7PD 2W57A 1BI0A 4ZYGA 2A6HF 4FX4A 3WGGA 1ZLJA 3I58A 1B9NA 2LNBA 4ESBA 1T2KA 1BI3A 5HS8A 4KIBA 4M9SA 1ZGJA 4UVBA 2UXNA 5J8CA 4G94A 1USSA 2MC3A 3C18A 3F6OA 3FXQA 1K6OA 1BJAA 2V1DA 4WXHA 2BV6A 5LEJA 2ZNZA 3J80Z 1SAXA 2FA5A 5HDGA 1SFXA 2ZJ2A 2NNYA 3LWFA 2MLKA 1XD7A 4LK1F 3CUQA 1BOAA 1W5SA 4Q47A 4R79A 3HSRA 2OBPA 2TDXA 5L3CA 3V8KA 5AIPA 2DK8A 1ZARA 4G9YA 1R23A 2DU9A 2P5KA 1FY7A 3EYYA 5DYMA 3L00A 4QLCU 3V7RA 1HSJA 3R0AA 3HOSA 1I1GA 1WQ2A 4YFNF 2H94A 1XN7A 3BOQA 1ZN2A 2QBYA 3TDUC 4B09A 5L3GA 2XHKA 1GVJA 5LGNA 2PLYA 3I59B 1R7JA 4L0YB 1U8RA 2CQKA 3JW4A 4A12A 2W85A 2O03A 3E6DA 3QPTA 3Q9SA 2PG4A 3LQQA 2Z3YA 4IRIA 3T8TA 5F6FA 4N0BA 4AD9A 1OPCA 3CO6C 3KZYA 4BHBA 2GZWA 1V4RA 1PUEE 2E1CA 3IRRA 2MH9A 5AIQA 4MEXF 1IN4A 1F5TA 2O8XA 2V79A 3BPVA 4M6XA 3L09A 2VC0A 2HFHA 1K78B 1Z91A 4KYWA 4A2UA 1MDMB 3B73A 3JSPA 4IHTA 3F21A 2L54A 4RGSA 3RPQA 1BM9A 2A5YB 3DEUA 1Y0UA 3RIRA 1L3LA 4HDUA 1R5HA 1HKQA 2MA3A 3MCZA 3E5XA 4AIHA 4IXAA 1XCVA 2DW4A 1ONVA 1T98A 4EM2A 4NHJA 2QLZA 2WWYA 3F8FA 4L9NA 2VBYA 2DPUA 5D6EA 2JSCA 4CICA 3JTGA 1P4XA 1BN5A 1I1SA 5D5WB 5H6RA 1ZRFA 2GXGA 5FO5A 4Y15A 3K69A 1MD0A 5LRRA 3T8RA 3K1PA 4HZFA 2P6SA 4LMYA 3FMQA 3M1EA 4KFCA 3CUQB 5ILUA 3HHGA 2H09A 2LF7A 3ZPLA 1L0OC 1JE8A 6PAXA 2RC4A 1W7PB 3KLOA 3GXOA 5FD5A 3HRTA 4Y13A 5D4SA 2JRTA 4UV9A 4OOIA 4MEYF 4ON0A 3F6VA 3MZHA 4ETSA 2H27A 1IN7A 3MEXA 4P96A 1D8JA 2QBYB 4OIRF 2M87A 4WK8F 4O5VA 2G9WA 4HQMA 2GA1A 3CUQC 2LSOA 3V8JA 3EQLF 1FYKA 4M74A 1CGPA 1TBXA 5LRSA 5BS6A 1MZBA 4RB2C 1RUOA 4MNUA 3SHFA 1KQ8A 3LAPA 2FOKA 4K2EA 1YS7A 3K2ZA 4G7HF 3BJ6A 2W25A 3WTUC 1XCBA 2EFQA 2FQ3A 2QZ8A 4JBAA 5LHHA 3PQJA 5D5UB 3HRUA 3I64A 1J2XA 4OMZA 2V9VA 2P6TA 4CO8A 1S6LA 5LGUA 1U5TC 3I0TA 2XROA 2DTRA 4LD5A 2R7DA 5LGTA 5FLXZ 3M8EA 4L9VA 2XGXA 2FRHA 4ZZLA 3GF2A 4OIPF 1B4AA 3WTVC 5E18F 4L9TA 1TW3A 3NEUA 2BGCA 3E5UA 3ZN0A 5F1RA 5K5OA 2BBYA 2GIVA 5DD4A 3GYHX 1QPMA 1E2XA 2E7XA 1O3SA 5CVUA 4FX0A 2VOOA 2HTJA 3Q5FA 4EJTA 2VT3A 2HYFA 1S8NA 1ZG3A 1HW2A 2A69F 3F23A 2V6CA 2PMHA 1TNSA 1KU2A 1R22A 4OMYA 3ZMTA 5BMZA 1KQ0A 3DPTA 4A0YA 4BXUA 3TO7A 1OMIA 1ZG1A 3ZP5A 1FBUA 2DO7A 3QP6A 2PMUA 4RGRA 2D45A 2A3SA 2OZ6A 1KGSA 3RDIA 4A0XA 3RJPA 1TTYA 1JGSA 3ML6A 4DQ2A 2G7HA 3F22A 2FBKA 1HW5A 5CVIA 2ZKZA 2XASA 4GXOA 3J7AO 2R7FA 2HR3A 2PQ8A 3H92A 3ZQ7A 3ERED 3C3WA 3O6BB 1RUNA 1R1UA 1HBXG 2DAOA 4UHTA 2DBBA 4BAYA 1K7AA 1G3WA 4LFUA 3AAFA 2QUFA 4R8HA 3P9CA 2EV0A 1EH8A 2ZXJA 2CG4A 1IUYA 1UHWA 3OV8A 1IN5A 3JSOA 3BROA 4EJVA 3WE2A 3HTSB 4IVNA 4F7ZA 2WTEA 4NQWA 1J5YA 3D5LA 2JT1A 2GQQA 4HF0A 5JVTA 4U7BA 1IXSB 5LLQA 3HUGA 4I7HA 5FLXK 4WWCA 1P6RA 5JHUA 3CDHA 3KCCA 3NQOA 3HRSA 3U9GA 5BPDA 3WTXC 4AWXB 1O7LA 2Z5UA 3M7GA 2GXBA 3FZVA 2Y48A 4JQFA 1TQIA 4ZYEA 2EFNA 1XDSA 3I5UA 3K1MA 1YO5C 2HEOA 2E1NA 1KYZA 1EH6A 1ZAOA 1LVAA 4M9XA 3TO6A 3WTTC 4Q4ZF 2ISZA 5IT9K 1OYWA 3REOA 4BH9A 5D6FA 4Q5SF 4DNCA 3W6JB 3VOEA 2HOEA 3WTZA 5KVRA 5FFXA 2A07F 2JPCA 3FMSA 5DUIA 1LQ1A 1FSEA 3F8BA 4ZYDA 5K5RA 5JFRA 2ETHA 3M9AA 4EM1A 2CW0F 3I71A 1LEAA 2YX7A 3P7NA 3GFLA 4PGGA 1Q1HA 2FSWA 3HOTA 2FNPA 2K86A 2Z99A 4HV5A 4L5JA 3CUOA 5K1YA 4LB5A 2Q0OA 3FHZA 2FNAA 3OOPA 5DEQA 2UZKA 4RAYA 1W5TA 3R60A 3L2CA 3KEOA 4I09A 2DI3A 2F5FA 4ZZDA 1Z7UA 1D5VA 1MKMA 3F8NA 5KK1A 3HIFA 5BQTA 1FYLA 2ADUA 1S7AA 4AVPA 4ESFA 2XKOA 2H6BA 3E3VA 1XMKA 2QYOA 2ACJA 2JZYA 2BEOA 1DP7P 3DF8A 3PQKA 4B8XA 1BI2A 3CLOA 3S2WA 4N9HA 2CGPA 2YSRA 2M8EA 1Z1DA 3C1DA 3SFZA 5FD6A 2C6YA 4YIIA 3DQVC 1ZYRF 3U1DA 2OZUA 3GLXA 1MGTA 2XAFA 1MJAA 4I98B 3MAJA 2L02A 2YX4A 2QWWA 2HGCA 3RYRA 2D1VA 4HX8A 3GZ5A 2DLLA 4PGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TLH B;  3V8L A;  2P7V B;  2NRA C;  5IT9 Z;  4U0W A;  2K7L A;  2IA0 A;  4ENM A;  3P9K A;  1LEB A;  3BZ6 A;  1NHA A;  3LST A;  1V3F A;  3GEZ A;  3WU0 A;  3KE2 A;  2Q2E A;  5H6Q A;  1P4A A;  3KP2 A;  1AWC A;  3GVA A;  1OYI A;  5E1X A;  2FXA A;  1K79 A;  3GZ6 A;  4HLY A;  4MTD A;  2STT A;  1OYY A;  3CO7 C;  1DPU A;  4YFX F;  2YPR A;  4N9I A;  4LJZ F;  2O6G E;  2NS0 A;  3D0S A;  2NYX A;  1IRG A;  5AON A;  4FHT A;  1PP7 U;  5HLI A;  2IA1 A;  4GYG A;  2ZBK A;  2CO5 A;  4WXD A;  1SMT A;  4HV6 A;  1SD4 A;  4A6D A;  2HZT A;  2HQR A;  1ULY A;  2OQR A;  3WTW C;  4HA8 A;  1G3S A;  1YW9 A;  4GGG A;  5ICF A;  2FML A;  3KEQ A;  5ERI A;  1P92 A;  2A61 A;  3RPU A;  3VFZ A;  3M8F A;  2JPB A;  2ZCW A;  1WKM A;  3FXR A;  3RTR A;  2IT0 A;  1R36 A;  4LG0 A;  5CLS A;  2L4A A;  4IRH A;  3T5X A;  1S3J A;  1PP8 F;  4Z2Y A;  5IT3 A;  4P9F A;  1U3E M;  1UST A;  1ZH5 A;  1D8K A;  2QQB A;  4JK1 X;  3DPL C;  2Z9O A;  2NAZ A;  4G8X A;  1TQM A;  1YQA A;  1F4K A;  2STW A;  5L3F A;  1S7O A;  5H20 A;  1YW7 A;  1IN6 A;  4LGW A;  3ROU A;  1EV7 A;  2XRN A;  3SZT A;  1A04 A;  3RYP A;  4YG2 F;  2IP2 A;  5ILS A;  5HS9 A;  1B9M A;  4RB0 A;  1FP1 D;  2B0L A;  2EV5 A;  2RGV A;  3SXY A;  4UXN A;  4GO1 A;  4R1H A;  2RDP A;  4KIF A;  3IC7 A;  5DCM B;  2PI0 A;  3ZMD A;  3LAJ A;  4G6Q A;  5CJ9 A;  5CVV A;  1R1T A;  1JHH A;  2OAZ A;  2FU4 A;  2VT2 A;  1J59 A;  1Z6T A;  3ELK A;  4PDK A;  5CVR A;  3DFG A;  5LBQ A;  4EGZ A;  1QBJ A;  4O3M A;  2M45 A;  1HKT A;  1WWX A;  2FBI A;  3FXU A;  4HDV A;  4S04 A;  5ICG A;  1FC3 A;  2PEX A;  2VE9 A;  4CDG A;  3TQN A;  2E7W A;  2HTS A;  3R0J A;  1I5Z A;  4LLG F;  2XAJ A;  3R6S A;  1O57 A;  2IRF G;  3KP7 A;  1SMY F;  5FGM A;  2EFW A;  1FLI A;  4IHS A;  3KP4 A;  2XKP A;  3EET A;  2DPD A;  3HSE A;  4I2O A;  4L0Z B;  5K5Q A;  2KIF A;  2M5W A;  1YIO A;  1RZ4 A;  3KFW X;  3QOP A;  1FBS A;  3BY6 A;  5HLH A;  1B59 A;  1HQC A;  1RNL A;  4KN7 X;  4D0P A;  1HW1 A;  4EJW A;  4PCQ A;  1XMA A;  1QGP A;  2HDC A;  1W4M A;  3FM5 A;  5E1Z B;  1G3Y A;  1FNN A;  1YS6 A;  2QM3 A;  4BYY A;  1LDK B;  1SFU A;  3LA2 A;  4HAM A;  4A5N A;  1OKR A;  3HTU A;  5JI6 A;  1R5G A;  4U88 A;  2EFP A;  1BIB A;  4HOB A;  3F8M A;  4KIC A;  1PDN C;  2WV0 A;  1UFM A;  1ON1 A;  5L3E A;  1FPQ A;  3KP5 A;  2FBH A;  3WTY C;  1ZLK A;  3GFI A;  2VE8 A;  3E5Q A;  1IAW A;  1O3T A;  2H6C A;  1FWZ A;  3CJN A;  3L7W A;  3DKW A;  1GXP A;  4BNC A;  1QNT A;  1T38 A;  4RGX A;  2ELH A;  1Z05 A;  2KRF A;  3G73 A;  3IWF A;  1FOK A;  4A6E A;  1IW7 F;  4U7D A;  2EB7 A;  1YW8 A;  4YFK F;  2A68 F;  3FMR A;  2HS5 A;  1BBY A;  1BIA A;  3BP8 A;  5FFZ A;  4RS8 A;  3LFK A;  2PBI A;  5DCM A;  2VON A;  2PJP A;  4EJU A;  2IVM A;  3QU6 A;  2RQP A;  2X4H A;  4CHU A;  2IJL A;  3WU1 B;  3N97 A;  1LDD A;  1IXR C;  2Y75 A;  3E6M A;  4ENN A;  3E6C C;  4KMF A;  2A6E F;  2VN2 A;  3EYI A;  1ZGA A;  1XGO A;  4XSZ F;  2K02 A;  3GFJ A;  5JR3 A;  5EEH A;  2RVC A;  1I6X A;  3MZY A;  5EEG A;  2XIG A;  2D1H A;  2EA4 A;  3DP7 A;  3GO5 A;  1O7F A;  1F9N A;  2F5C A;  1CF7 A;  1QZZ A;  2DQR A;  2HKO A;  1JXS A;  4FT8 A;  3BDD A;  2G7U A;  1H9G A;  2L01 A;  1HXD A;  4EV0 A;  1SD7 A;  2EJR A;  4HF1 A;  4A0Z A;  1T39 A;  2MD5 A;  5FB2 A;  3T1B A;  1X3U A;  2Z33 A;  2X0L A;  4HYE A;  3WGI A;  3EUH A;  1UCR A;  2OA4 A;  3WE3 A;  1RIO H;  2LF8 A;  2F5D A;  3F72 A;  3TDZ C;  1UHM A;  4PZJ A;  3ULQ B;  3TOB A;  4LG0 B;  3TGN A;  5BPI A;  2K4J A;  2LDU A;  3HHH A;  4UVA A;  1KA8 A;  4ESJ A;  3E97 A;  4CXF A;  1BC8 C;  3P9I A;  1UB9 A;  2CSO A;  2CFX A;  3IL2 A;  2D2W A;  2P4W A;  3WOD F;  4HLX A;  2W24 A;  2HQN A;  1O3Q A;  1P4W A;  2CWE A;  2P5V A;  3V7S A;  2J5P A;  2GWR A;  5D4R A;  4UV8 A;  1KQ9 A;  2ZME A;  4MQ9 F;  1R1V A;  4EVI A;  5HLG A;  1XGN A;  4HBL A;  1SD6 A;  1LB2 A;  2QQA A;  3K1N A;  2F2E A;  3ISP A;  3HYI A;  3DXJ F;  1XGS A;  3C7J A;  4XSX F;  3JTH A;  4LK0 F;  4EM0 B;  5ICC A;  2R3S A;  4RGU A;  4AIJ A;  4E70 A;  5D8L B;  1S29 A;  1LDJ A;  3QU3 A;  2V1U A;  3KET A;  1MJB A;  2HWV A;  2RN7 A;  3J81 K;  3F3X A;  5ILV A;  4M71 A;  1LNW A;  1TNT A;  3EDP A;  3ZN1 A;  4I01 A;  1U2W A;  3RKX A;  4ZH4 F;  3J80 K;  2AS5 F;  1IZ1 A;  2KIM A;  4NB5 A;  5L3B A;  5HDN A;  2DFI A;  5LHG A;  4M6Y A;  4ZYH A;  1FBQ A;  3NRV A;  3E6B A;  1HST A;  2XAG A;  2GAU A;  2VC1 A;  1J9I A;  1G3T A;  1C0W A;  1XDU A;  1LJ9 A;  4OIO F;  3WGH A;  5A2Q K;  5DV5 A;  1G4D A;  1GXQ A;  2FE3 A;  2YU3 A;  4EGY A;  5HOO A;  3LA7 A;  4MHG A;  4IJA A;  3JAM K;  2V1X A;  5DUK A;  2GA2 A;  4RB1 A;  3ECO A;  1ON2 A;  5DDG A;  3O2P E;  4U0Y A;  4KN4 X;  1J75 A;  4Q48 A;  3ECH A;  2ZO4 A;  4WCG A;  5E17 F;  3I4P A;  1YLF A;  4L5I A;  4XLP F;  2DK5 A;  3CTA A;  3W6K B;  5A2Q Z;  2F5E A;  4L9J A;  2BE5 F;  1ZHF A;  4HF2 A;  4RAZ A;  4M9Z A;  4UVC A;  2O0Y A;  3GUD A;  3L9F A;  3BWG A;  2MBF A;  3BPX A;  3PFI A;  5LEK A;  4UNO A;  4LLL A;  1R58 A;  2BYV E;  1T0F A;  2VOP A;  4G6D A;  2P8T A;  3WTS C;  2DQL A;  4XBF A;  1Z9C A;  4S05 A;  2ISY A;  3R61 A;  1XSD A;  1RI7 A;  1FX7 A;  3ABU A;  2HYG D;  3QPH A;  3COA C;  3FM3 A;  2XUB A;  4BQA A;  4OIQ F;  2EA2 A;  3TO9 A;  1QO0 D;  2IA2 A;  2MLG A;  1OR7 A;  4P9U A;  3GFM A;  1IRF A;  3I53 A;  5LHI A;  3FF5 A;  1DDN A;  4WF2 A;  2EFO A;  4KT5 C;  5D8K B;  3RKY A;  1SD5 A;  2EK5 A;  2CYY A;  3GW2 A;  4QWQ A;  1FSH A;  4GYI A;  2XV4 S;  4RB3 C;  4U0V A;  1YG2 A;  1FYM A;  2ZNY A;  1YTY A;  2Q8K A;  3V4G A;  1T6S A;  2OU2 A;  4XLN F;  1QZY A;  4LLN A;  3HSF A;  1CF7 B;  2J5O A;  4EJO A;  3IKT A;  2ESN A;  1XSX A;  3V7C A;  3G3Z A;  1F1Z A;  2KKO A;  1XSV A;  2VXZ A;  3VEP A;  4KUM A;  3QRF F;  4KA4 A;  4P5O A;  4IRG A;  3KLN A;  1B6A A;  5ICE A;  2M30 A;  3GWZ A;  4CYD A;  4KNY A;  1GHC A;  4CZZ A;  4O6J A;  1J0R A;  5CYV A;  2OQG A;  3JAM Z;  4I0B A;  1ODD A;  2O3F A;  4KIG A;  3SQN A;  3IKV A;  5E1W A;  1BI1 A;  2PN6 A;  2COM A;  2L4M A;  3IHU A;  4ENK A;  2HKX A;  2L3D A;  1BC7 C;  5E8G A;  2QEN A;  3H3U A;  3O3K A;  3LQR A;  4LB6 B;  2YR2 A;  2RNJ A;  3ZMU A;  4WX9 A;  1XGM A;  4M72 A;  3QAH A;  2K4B A;  2ZME B;  3SZP A;  3R4K A;  3RKW A;  2NNN A;  2PFB A;  2XAQ A;  4IF4 A;  3RI4 A;  3FWE A;  3LA3 A;  3BJO A;  4ASN A;  3J81 Z;  5J6X A;  1KU3 A;  5E8I A;  3TKY A;  3BJA A;  3N4M A;  1YFH A;  5DCF A;  4KMU X;  5E20 A;  3T0Y A;  3IRQ A;  5TRD A;  2VBW A;  3ZMZ A;  2ESH A;  3VB2 A;  4HX7 A;  4HQE A;  4AIK A;  4G7O F;  2O61 A;  2XAH A;  2UWM A;  3U2R A;  4BHC A;  1REP C;  1MDM A;  1WRJ A;  1FZP B;  4WXC A;  4UUV A;  3QP5 A;  4IPA A;  2JTV A;  2LKP A;  1J7K A;  4OIN F;  2KJC A;  4MTE A;  1JHF A;  1QQI A;  1U5T B;  4MGR A;  1Z6R A;  4BHP A;  1G6N A;  1AOY A;  2AXL A;  3ABT A;  5CVJ A;  2XVC A;  1WSU A;  1U78 A;  4G7Z F;  4L18 B;  3MFK A;  1KU9 A;  1STZ A;  5J8F A;  2QVO A;  1E17 A;  1WI9 A;  2FF4 A;  2IPQ X;  5ED4 A;  1U6G A;  3IWZ A;  1KYW A;  2FMY A;  4MQV A;  1FT9 A;  1HKS A;  1O3R A;  3B02 A;  2OD5 A;  2P7C B;  3ZMS A;  3K0L A;  2FEZ A;  1H0M A;  3KP3 A;  1I27 A;  3TOA A;  5BOX A;  3H3Z A;  4XRF A;  1W7P A;  1XB4 A;  1ZRC A;  4OU0 A;  5F64 A;  2RKH A;  3FX3 A;  2IW5 A;  4KDP A;  4H0E A;  1R00 A;  4GCV A;  2K27 A;  2QQ9 A;  5HVQ C;  4YIF A;  2MH2 A;  2WC2 A;  1MJ9 A;  3I59 A;  3DV8 A;  1IN8 A;  4TV7 A;  1B1B A;  1VTN C;  3F8C A;  2KIU A;  4A5M A;  2Y0M A;  4HX4 A;  5HDK A;  4M73 A;  1D3Y A;  1SFE A;  1EH7 A;  2ZFW A;  3I54 A;  4I02 A;  5DD8 A;  3KP6 A;  2EV6 A;  2UXX A;  4P55 A;  5L3D A;  5D5V B;  1KU7 A;  3KZZ A;  5D5X B;  4ENJ A;  2VBZ A;  3GX4 X;  1H9T A;  3ZMV A;  5HS7 A;  2KJB A;  4CGZ A;  4Y17 A;  4I0A A;  1DUX C;  1IXC A;  1DPR A;  2EWN A;  4EMS A;  1ZG5 A;  1K78 A;  1ZRD A;  2RV8 A;  2DT5 A;  5TJJ A;  1ZRE A;  3HRM A;  3WG9 A;  1TQP A;  1IF1 A;  1FP2 A;  2M1B A;  3VOD A;  1P2F A;  3MWM A;  1TW2 A;  2VBX A;  3K9T A;  3Q9V A;  2VOD A;  2P5L C;  1YYV A;  4EQQ A;  4HW0 A;  1U5T A;  2W84 A;  3MQ0 A;  1W7P D;  2W57 A;  1BI0 A;  4ZYG A;  2A6H F;  4FX4 A;  3WGG A;  1ZLJ A;  3I58 A;  1B9N A;  2LNB A;  4ESB A;  1T2K A;  1BI3 A;  5HS8 A;  4KIB A;  4M9S A;  1ZGJ A;  4UVB A;  2UXN A;  5J8C A;  4G94 A;  1USS A;  2MC3 A;  3C18 A;  3F6O A;  3FXQ A;  1K6O A;  1BJA A;  2V1D A;  4WXH A;  2BV6 A;  5LEJ A;  2ZNZ A;  3J80 Z;  1SAX A;  2FA5 A;  5HDG A;  1SFX A;  2ZJ2 A;  2NNY A;  3LWF A;  2MLK A;  1XD7 A;  4LK1 F;  3CUQ A;  1BOA A;  1W5S A;  4Q47 A;  4R79 A;  3HSR A;  2OBP A;  2TDX A;  5L3C A;  3V8K A;  5AIP A;  2DK8 A;  1ZAR A;  4G9Y A;  1R23 A;  2DU9 A;  2P5K A;  1FY7 A;  3EYY A;  5DYM A;  3L00 A;  4QLC U;  3V7R A;  1HSJ A;  3R0A A;  3HOS A;  1I1G A;  1WQ2 A;  4YFN F;  2H94 A;  1XN7 A;  3BOQ A;  1ZN2 A;  2QBY A;  3TDU C;  4B09 A;  5L3G A;  2XHK A;  1GVJ A;  5LGN A;  2PLY A;  3I59 B;  1R7J A;  4L0Y B;  1U8R A;  2CQK A;  3JW4 A;  4A12 A;  2W85 A;  2O03 A;  3E6D A;  3QPT A;  3Q9S A;  2PG4 A;  3LQQ A;  2Z3Y A;  4IRI A;  3T8T A;  5F6F A;  4N0B A;  4AD9 A;  1OPC A;  3CO6 C;  3KZY A;  4BHB A;  2GZW A;  1V4R A;  1PUE E;  2E1C A;  3IRR A;  2MH9 A;  5AIQ A;  4MEX F;  1IN4 A;  1F5T A;  2O8X A;  2V79 A;  3BPV A;  4M6X A;  3L09 A;  2VC0 A;  2HFH A;  1K78 B;  1Z91 A;  4KYW A;  4A2U A;  1MDM B;  3B73 A;  3JSP A;  4IHT A;  3F21 A;  2L54 A;  4RGS A;  3RPQ A;  1BM9 A;  2A5Y B;  3DEU A;  1Y0U A;  3RIR A;  1L3L A;  4HDU A;  1R5H A;  1HKQ A;  2MA3 A;  3MCZ A;  3E5X A;  4AIH A;  4IXA A;  1XCV A;  2DW4 A;  1ONV A;  1T98 A;  4EM2 A;  4NHJ A;  2QLZ A;  2WWY A;  3F8F A;  4L9N A;  2VBY A;  2DPU A;  5D6E A;  2JSC A;  4CIC A;  3JTG A;  1P4X A;  1BN5 A;  1I1S A;  5D5W B;  5H6R A;  1ZRF A;  2GXG A;  5FO5 A;  4Y15 A;  3K69 A;  1MD0 A;  5LRR A;  3T8R A;  3K1P A;  4HZF A;  2P6S A;  4LMY A;  3FMQ A;  3M1E A;  4KFC A;  3CUQ B;  5ILU A;  3HHG A;  2H09 A;  2LF7 A;  3ZPL A;  1L0O C;  1JE8 A;  6PAX A;  2RC4 A;  1W7P B;  3KLO A;  3GXO A;  5FD5 A;  3HRT A;  4Y13 A;  5D4S A;  2JRT A;  4UV9 A;  4OOI A;  4MEY F;  4ON0 A;  3F6V A;  3MZH A;  4ETS A;  2H27 A;  1IN7 A;  3MEX A;  4P96 A;  1D8J A;  2QBY B;  4OIR F;  2M87 A;  4WK8 F;  4O5V A;  2G9W A;  4HQM A;  2GA1 A;  3CUQ C;  2LSO A;  3V8J A;  3EQL F;  1FYK A;  4M74 A;  1CGP A;  1TBX A;  5LRS A;  5BS6 A;  1MZB A;  4RB2 C;  1RUO A;  4MNU A;  3SHF A;  1KQ8 A;  3LAP A;  2FOK A;  4K2E A;  1YS7 A;  3K2Z A;  4G7H F;  3BJ6 A;  2W25 A;  3WTU C;  1XCB A;  2EFQ A;  2FQ3 A;  2QZ8 A;  4JBA A;  5LHH A;  3PQJ A;  5D5U B;  3HRU A;  3I64 A;  1J2X A;  4OMZ A;  2V9V A;  2P6T A;  4CO8 A;  1S6L A;  5LGU A;  1U5T C;  3I0T A;  2XRO A;  2DTR A;  4LD5 A;  2R7D A;  5LGT A;  5FLX Z;  3M8E A;  4L9V A;  2XGX A;  2FRH A;  4ZZL A;  3GF2 A;  4OIP F;  1B4A A;  3WTV C;  5E18 F;  4L9T A;  1TW3 A;  3NEU A;  2BGC A;  3E5U A;  3ZN0 A;  5F1R A;  5K5O A;  2BBY A;  2GIV A;  5DD4 A;  3GYH X;  1QPM A;  1E2X A;  2E7X A;  1O3S A;  5CVU A;  4FX0 A;  2VOO A;  2HTJ A;  3Q5F A;  4EJT A;  2VT3 A;  2HYF A;  1S8N A;  1ZG3 A;  1HW2 A;  2A69 F;  3F23 A;  2V6C A;  2PMH A;  1TNS A;  1KU2 A;  1R22 A;  4OMY A;  3ZMT A;  5BMZ A;  1KQ0 A;  3DPT A;  4A0Y A;  4BXU A;  3TO7 A;  1OMI A;  1ZG1 A;  3ZP5 A;  1FBU A;  2DO7 A;  3QP6 A;  2PMU A;  4RGR A;  2D45 A;  2A3S A;  2OZ6 A;  1KGS A;  3RDI A;  4A0X A;  3RJP A;  1TTY A;  1JGS A;  3ML6 A;  4DQ2 A;  2G7H A;  3F22 A;  2FBK A;  1HW5 A;  5CVI A;  2ZKZ A;  2XAS A;  4GXO A;  3J7A O;  2R7F A;  2HR3 A;  2PQ8 A;  3H92 A;  3ZQ7 A;  3ERE D;  3C3W A;  3O6B B;  1RUN A;  1R1U A;  1HBX G;  2DAO A;  4UHT A;  2DBB A;  4BAY A;  1K7A A;  1G3W A;  4LFU A;  3AAF A;  2QUF A;  4R8H A;  3P9C A;  2EV0 A;  1EH8 A;  2ZXJ A;  2CG4 A;  1IUY A;  1UHW A;  3OV8 A;  1IN5 A;  3JSO A;  3BRO A;  4EJV A;  3WE2 A;  3HTS B;  4IVN A;  4F7Z A;  2WTE A;  4NQW A;  1J5Y A;  3D5L A;  2JT1 A;  2GQQ A;  4HF0 A;  5JVT A;  4U7B A;  1IXS B;  5LLQ A;  3HUG A;  4I7H A;  5FLX K;  4WWC A;  1P6R A;  5JHU A;  3CDH A;  3KCC A;  3NQO A;  3HRS A;  3U9G A;  5BPD A;  3WTX C;  4AWX B;  1O7L A;  2Z5U A;  3M7G A;  2GXB A;  3FZV A;  2Y48 A;  4JQF A;  1TQI A;  4ZYE A;  2EFN A;  1XDS A;  3I5U A;  3K1M A;  1YO5 C;  2HEO A;  2E1N A;  1KYZ A;  1EH6 A;  1ZAO A;  1LVA A;  4M9X A;  3TO6 A;  3WTT C;  4Q4Z F;  2ISZ A;  5IT9 K;  1OYW A;  3REO A;  4BH9 A;  5D6F A;  4Q5S F;  4DNC A;  3W6J B;  3VOE A;  2HOE A;  3WTZ A;  5KVR A;  5FFX A;  2A07 F;  2JPC A;  3FMS A;  5DUI A;  1LQ1 A;  1FSE A;  3F8B A;  4ZYD A;  5K5R A;  5JFR A;  2ETH A;  3M9A A;  4EM1 A;  2CW0 F;  3I71 A;  1LEA A;  2YX7 A;  3P7N A;  3GFL A;  4PGG A;  1Q1H A;  2FSW A;  3HOT A;  2FNP A;  2K86 A;  2Z99 A;  4HV5 A;  4L5J A;  3CUO A;  5K1Y A;  4LB5 A;  2Q0O A;  3FHZ A;  2FNA A;  3OOP A;  5DEQ A;  2UZK A;  4RAY A;  1W5T A;  3R60 A;  3L2C A;  3KEO A;  4I09 A;  2DI3 A;  2F5F A;  4ZZD A;  1Z7U A;  1D5V A;  1MKM A;  3F8N A;  5KK1 A;  3HIF A;  5BQT A;  1FYL A;  2ADU A;  1S7A A;  4AVP A;  4ESF A;  2XKO A;  2H6B A;  3E3V A;  1XMK A;  2QYO A;  2ACJ A;  2JZY A;  2BEO A;  1DP7 P;  3DF8 A;  3PQK A;  4B8X A;  1BI2 A;  3CLO A;  3S2W A;  4N9H A;  2CGP A;  2YSR A;  2M8E A;  1Z1D A;  3C1D A;  3SFZ A;  5FD6 A;  2C6Y A;  4YII A;  3DQV C;  1ZYR F;  3U1D A;  2OZU A;  3GLX A;  1MGT A;  2XAF A;  1MJA A;  4I98 B;  3MAJ A;  2L02 A;  2YX4 A;  2QWW A;  2HGC A;  3RYR A;  2D1V A;  4HX8 A;  3GZ5 A;  2DLL A;  4PGH A; 
#chains in the Genus database with same CATH topology
 1TLH B;  1IUF A;  3J7A Y;  3V8L A;  2P7V B;  2NRA C;  1X1P A;  5IT9 Z;  4U0W A;  2K7L A;  1ETY A;  4BY7 J;  2IA0 A;  2NOG A;  4ENM A;  3P9K A;  1LEB A;  3S1N J;  3BZ6 A;  1NHA A;  3LST A;  3SYT A;  1V3F A;  3GEZ A;  3WU0 A;  1YIJ I;  3KE2 A;  2Q2E A;  3FXK A;  5H6Q A;  1P4A A;  3KP2 A;  1AWC A;  4IQ4 A;  5F0F A;  3GVA A;  3QYB A;  4XKB A;  1OYI A;  5E1X A;  2FXA A;  5IP6 A;  2JA7 J;  4CGZ A;  3AKZ A;  1K79 A;  3GZ6 A;  2WB1 A;  4MTD A;  4HLY A;  2STT A;  1F36 A;  4H4K C;  3FKJ A;  1OYY A;  3CO7 C;  1DPU A;  2AHQ A;  1Y56 A;  3QYF A;  4YFX F;  2YPR A;  4N9I A;  4LJZ F;  2O6G E;  4PFO A;  2NS0 A;  3D0S A;  2NYX A;  3JRB A;  1IRG A;  5AON A;  2JN6 A;  4D9J A;  4BAC A;  4FHT A;  1PP7 U;  5HLI A;  2E19 A;  2IA1 A;  2JMW A;  4GYG A;  1RET A;  3NAU A;  2H8W A;  2ZBK A;  2CO5 A;  2DMP A;  2R7V A;  1XG1 A;  4WXD A;  4NC7 A;  2LMD A;  1SMT A;  2CQ7 A;  4HV6 A;  1SD4 A;  1SEU A;  4A6D A;  3VSK A;  2HZT A;  1VZ0 A;  2HQR A;  1ULY A;  3AG3 H;  2OQR A;  1Y0N A;  3WTW C;  2R7W A;  3QYE A;  4HA8 A;  1G3S A;  3OYK A;  1YW9 A;  2EPF A;  4AID A;  5J4V A;  1W36 D;  1MNM C;  2XC7 A;  3U1K A;  4GGG A;  5ICF A;  3M4O J;  3TW6 A;  2FML A;  2WV1 A;  3LMM A;  4RM2 A;  3KEQ A;  1YOV B;  1EJ9 A;  2VKE A;  3C2G A;  5ERI A;  1P92 A;  2A61 A;  2CQQ A;  1BR1 A;  2JA5 J;  3RPU A;  3VFZ A;  2LRE A;  5F04 A;  3M8F A;  1YRN B;  2JPB A;  2ZCW A;  1UG2 A;  1WKM A;  3FXR A;  3RTR A;  2IT0 A;  1R36 A;  5CLS A;  4LG0 A;  2L4A A;  4IRH A;  3T5X A;  1S3J A;  1PP8 F;  4HG2 A;  4Z2Y A;  2LVS A;  1B72 A;  5IT3 A;  4NDL A;  3K4J A;  4P9F A;  1U3E M;  1UST A;  4C2M J;  1ZH5 A;  2R5Y A;  1D8K A;  3ABL H;  1WVR A;  2V26 A;  2Y31 A;  4F52 A;  1ERD A;  2QQB A;  1YJN I;  3OYJ A;  3A01 B;  4JK1 X;  4A3L J;  3DPL C;  2Z9O A;  3PIO F;  2NAZ A;  4G8X A;  1TQM A;  3JR9 A;  2KQR A;  1YQA A;  1F4K A;  2STW A;  5L3F A;  1PUF B;  1APL C;  3DCF A;  1S7O A;  5IYB J;  1WJB A;  2HXO A;  2EIJ H;  2OCC H;  3CF2 A;  3JRI A;  5H20 A;  1YW7 A;  1U8B A;  1IN6 A;  4JX4 A;  2KPM A;  4LGW A;  2PJR A;  3CDI A;  4X0G A;  5FKO A;  3ROU A;  1EV7 A;  2G0E A;  2DJI A;  2XRN A;  2DN0 A;  3SZT A;  1A04 A;  1MND A;  4OAZ A;  3CCU I;  3RYP A;  4YG2 F;  1JTX A;  1PVE A;  2IP2 A;  5ILS A;  4CA0 A;  5K7H A;  5HS9 A;  1HC8 A;  3FXJ A;  1B9M A;  5JHF A;  3C2H A;  4RB0 A;  4XON A;  1FP1 D;  5IPA A;  2B0L A;  3OS1 A;  4GFB A;  2EV5 A;  2RGV A;  4DZP A;  3SXY A;  4HNT A;  4UXN A;  4BDZ A;  4GO1 A;  2GOM A;  2DMT A;  4R1H A;  3S32 A;  2RDP A;  3CC7 I;  4KIF A;  3IC7 A;  5DCM B;  2PI0 A;  3ZMD A;  1UMQ A;  3S16 J;  1VI0 A;  5B1B H;  1YJ9 I;  1JJ8 C;  3LAJ A;  4G6Q A;  5CJ9 A;  5CVV A;  4C9Y A;  4JOM A;  1LFB A;  3WHC A;  1R1T A;  1JHH A;  2OAZ A;  1X3W B;  2FU4 A;  2VT2 A;  1Z6T A;  2I5U A;  3ELK A;  4PDK A;  1J59 A;  5CVR A;  3DFG A;  4B43 A;  5LBQ A;  4EGZ A;  4CCO A;  1IDZ A;  1DU0 A;  3WHB A;  2L7K A;  1QBJ A;  4O3M A;  1VQP I;  4FAS D;  1IGN A;  2M45 A;  1HKT A;  1WWX A;  2FBI A;  3FXU A;  3PO2 J;  2NVT J;  3OYB A;  2NS8 A;  3TBI A;  4HDV A;  3VYT B;  4S04 A;  2CJJ A;  3JRD A;  3OYM A;  1KZH A;  2LRD A;  5ICG A;  2ZME C;  1FC3 A;  3I3L A;  3CJQ B;  2PEX A;  2VE9 A;  4CDG A;  1SVM A;  2L5Q A;  3TQN A;  3HGG A;  2E7W A;  2HTS A;  5CKT A;  2CUZ A;  3RCO A;  4I6Z A;  3R0J A;  2MD0 A;  5KAF C;  1I5Z A;  3D5S C;  4LLG F;  2XAJ A;  2JA6 J;  1Y8Q B;  3R6S A;  1O57 A;  1K6Y A;  1RR7 A;  2IRF G;  4BQQ A;  3O8H A;  4NC8 A;  3KP7 A;  1HF0 A;  4PJL A;  3TL4 X;  5B3S H;  1SMY F;  2NVU B;  3CQZ J;  2O7O A;  5FGM A;  2EFW A;  1FLI A;  4IHS A;  3KP4 A;  2XKP A;  3EET A;  2DPD A;  3BTI A;  3HSE A;  2CS3 A;  3G2B A;  4I2O A;  4N4O B;  4L0Z B;  4NNJ A;  5K5Q A;  3OIP A;  2K5C A;  2KIF A;  2M5W A;  1FIP A;  1YIO A;  2R5Z A;  1RZ4 A;  3KFW X;  3QOP A;  4A3C J;  2EIL H;  1FBS A;  3BY6 A;  5HLH A;  1B59 A;  1HQC A;  1Y8R B;  2X6Y A;  4XN3 A;  1RNL A;  1I3Q J;  4KN7 X;  4D0P A;  1H8A C;  1HW1 A;  4EJW A;  1QRY A;  2LBF A;  3CJT B;  4PCQ A;  1XMA A;  4FET A;  3SFI A;  1QGP A;  2XGC A;  1Y39 A;  3L2U A;  3H9Q A;  2HDC A;  1W4M A;  3OR1 C;  3FM5 A;  2IS1 A;  5E1Z B;  1G3Y A;  1FNN A;  1YS6 A;  2QM3 A;  1Z3X A;  2HYJ A;  4BYY A;  2TRT A;  4QSH A;  3OYH A;  1LDK B;  4JX6 A;  1SFU A;  2E5Z A;  1X3Z B;  4DJA A;  1VQ5 I;  1TZL A;  5CQE A;  2IS6 A;  3H35 A;  3LA2 A;  4HAM A;  4A5N A;  1OKR A;  3HTU A;  5JI6 A;  1R5G A;  4B3X A;  4U88 A;  3LOC A;  2R7Q A;  2WAE A;  3CMY A;  3W2A A;  4AUX A;  4QPQ A;  2EFP A;  1BIB A;  5BNG A;  4HOB A;  3F8M A;  4KIC A;  2P81 A;  5H2F C;  2WV0 A;  1PDN C;  2OTJ I;  1UFM A;  3NWT A;  1TP4 A;  1ON1 A;  1GDT A;  5L3E A;  4XLC A;  1FPQ A;  3FBN B;  3PUB A;  3W2W A;  4U87 A;  3KP5 A;  2FBH A;  1I50 J;  3AG1 H;  3WTY C;  4B48 A;  1FJL A;  2IAI A;  1ITY A;  1ZLK A;  3OSF A;  3K7A J;  3GFI A;  5KNL A;  2A5W A;  2VE8 A;  3E5Q A;  1IAW A;  1N75 A;  2LR8 A;  3BLY A;  1O3T A;  2H6C A;  1FWZ A;  4OAY A;  3CJN A;  3L7W A;  4CSW A;  3DKW A;  1GXP A;  4BNC A;  1QNT A;  3H5R A;  2L9S A;  2ZFU A;  1QPI A;  1T38 A;  1YHQ I;  4RGX A;  2ELH A;  3W3C A;  1Z05 A;  3HM5 A;  2KRF A;  3G73 A;  4A3E J;  2CV0 A;  1MBH A;  2L2O A;  2XPU A;  3IWF A;  5GPA A;  4A6E A;  1FOK A;  1IW7 F;  4U7D A;  3MKL A;  2EB7 A;  3DBL B;  1YW8 A;  2EIM H;  2WAQ A;  4YFK F;  3QQA A;  4FQG A;  2CFO A;  2A68 F;  3FMR A;  2HS5 A;  3PNT A;  1WJC A;  1YX5 A;  3RQ4 A;  1BBY A;  3CCL I;  5DM7 F;  1BIA A;  3BP8 A;  4AYB N;  5FFZ A;  4RS8 A;  3LFK A;  2PBI A;  5DCM A;  2VON A;  4A3J J;  4ZYA A;  2BOL A;  2E71 A;  2PJP A;  4EJU A;  2IVM A;  2NVQ J;  3QU6 A;  4MO7 A;  2RQP A;  2X4H A;  1ETW A;  1Y6I A;  2IJL A;  4D1Q A;  4CHU A;  3WU1 B;  4ZJZ A;  1AKH B;  3N97 A;  1W1W E;  4IOC F;  5IYC J;  1LDD A;  1IXR C;  1MMS A;  2Y75 A;  3E6M A;  2L0K A;  4PUS A;  2BW3 B;  2HPM A;  4ENN A;  3E6C C;  1JTY A;  2A6E F;  4KMF A;  2VN2 A;  3EYI A;  1ZGA A;  1XGO A;  3BG3 A;  4XSZ F;  2K02 A;  4BDY A;  3GFJ A;  5JR3 A;  2JVG A;  5EEH A;  4JX5 A;  2YU9 J;  4XR6 A;  4P1W A;  2RVC A;  1I6X A;  3MZY A;  3CJR B;  4B1R A;  5EEG A;  3UR3 C;  1K4S A;  1VQ9 I;  2XIG A;  2D1H A;  1UAA A;  2EA4 A;  3DP7 A;  3GO5 A;  1O7F A;  1F9N A;  2F5C A;  4M3E A;  1CF7 A;  1QZZ A;  2DQR A;  2HKO A;  5JLW A;  1JXS A;  1ORK A;  3BDD A;  4FT8 A;  5KHD A;  2G7U A;  1H9G A;  3K2A A;  3DU6 A;  3S1M J;  2L01 A;  2LFB A;  1HXD A;  4EV0 A;  1X1D A;  1SD7 A;  2EJR A;  4J00 A;  4HF1 A;  4HNU A;  4A0Z A;  1T39 A;  1V5E A;  2MD5 A;  2ECC A;  5FB2 A;  1N78 A;  3T1B A;  1X2N A;  1X3U A;  2Z33 A;  4BU2 A;  3GTG J;  3JRH A;  2DMU A;  1KON A;  2X0L A;  4HYE A;  3WGI A;  1Z77 A;  3EUH A;  1RRJ A;  1SC7 A;  1UCR A;  2OA4 A;  3WE3 A;  2QA4 I;  1RIO H;  3CP2 A;  1MMN A;  2K3F A;  2LF8 A;  4BJ5 C;  3S3M A;  2BXZ A;  2F5D A;  3DTK A;  5DS9 A;  3F72 A;  3TDZ C;  1UHM A;  2QKL B;  5IP9 J;  4PZJ A;  5J1Y A;  2A05 A;  3ULQ B;  1H88 C;  3TOB A;  5GAE J;  2JUG A;  4LG0 B;  3TGN A;  5BPI A;  2KHM A;  4IHV A;  2K4J A;  2HVR A;  1DGR M;  2LDU A;  3HHH A;  2YS9 A;  3BR0 A;  4UVA A;  4AC0 A;  4XL9 A;  1KA8 A;  4ESJ A;  1XX5 A;  3E97 A;  2HDD A;  1FTT A;  2X48 A;  3O8G A;  4CXF A;  1BC8 C;  3P9I A;  2Y9Y A;  2YUS A;  1UB9 A;  2CSO A;  3ZRG A;  4RLQ A;  2CFX A;  3A01 A;  3IL2 A;  2D2W A;  2P4W A;  1DGW Y;  3WOD F;  5E3M A;  1WJF A;  2W1O A;  3M3Y J;  2M7B A;  4BEH A;  2ME0 A;  4HLX A;  1JKP C;  2W24 A;  5J47 A;  5C44 J;  2HQN A;  4V2F A;  2V1N A;  1O3Q A;  4KT6 A;  4X6A J;  2AQF A;  1P4W A;  2CWE A;  2P5V A;  3V7S A;  2J5P A;  2PJR B;  2GWR A;  5D4R A;  4LG3 A;  1SFK A;  4UV8 A;  2L7M P;  5LFA A;  1KQ9 A;  2ZME A;  4MQ9 F;  1R1V A;  4EVI A;  5HLG A;  1XGN A;  2VXD A;  4HBL A;  4F93 B;  3A0H C;  1SD6 A;  3LSP A;  5F1J A;  4IX7 A;  3DEW A;  1LB2 A;  3TMO A;  1IG7 A;  1IRZ A;  2QQA A;  2IGN A;  4NBQ A;  5HOD A;  5M5W J;  3K1N A;  4B3A A;  2F2E A;  2RQQ A;  3AL0 C;  4QPO A;  1D1B A;  3ISP A;  3MKY B;  3PO3 J;  2E1O A;  1YI2 I;  3D5R C;  3HYI A;  3DXJ F;  1XGS A;  3AG2 H;  3C7J A;  4XSX F;  4A3I J;  1SFO J;  3JTH A;  4IZZ A;  4IQJ A;  4LK0 F;  4EM0 B;  5FKM A;  3HDD A;  5ICC A;  3GTK J;  1XC5 A;  2R3S A;  4RGU A;  4AIJ A;  4E70 A;  5D8L B;  1S29 A;  1LDJ A;  4DYQ A;  3QU3 A;  1XS9 A;  3HGY A;  2V1U A;  3CCE I;  1X2M A;  3DBR B;  5HLT A;  2IXS A;  3KET A;  1VQK I;  4RAG A;  5F0C A;  5F08 A;  1MJB A;  1R6R A;  2HWV A;  3LSK A;  2RN7 A;  4RLF A;  3J81 K;  3F3X A;  3S2D J;  5ILV A;  4M71 A;  2BW3 A;  1IJW C;  1LNW A;  3EDP A;  1TNT A;  3ZN1 A;  4I01 A;  1U2W A;  3RKX A;  3G1L A;  4ZH4 F;  2LY9 A;  2NXN B;  1PYV A;  2ID6 A;  2M9H A;  3J80 K;  1H89 C;  1IZ1 A;  1AU7 A;  5J40 A;  2AS5 F;  2KIM A;  2DMN A;  4ZTF A;  4NB5 A;  5L3B A;  1WH7 A;  5HDN A;  2DFI A;  2M4K A;  5LHG A;  3PJR A;  4M6Y A;  9ANT A;  4G6T B;  4ZYH A;  1FBQ A;  3NRV A;  3E6B A;  4XM3 A;  2F4M B;  1VFC A;  4DBQ A;  1HST A;  2XAG A;  1POG A;  1TT5 B;  2GAU A;  2VC1 A;  4IHY A;  1J9I A;  2EIK H;  2OJE D;  1G3T A;  2GM4 A;  1B8I A;  5JVG F;  3LSI A;  2FJ1 A;  2R93 J;  1C0W A;  1XDU A;  4FCY A;  1LJ9 A;  3PSI A;  3WGH A;  4OIO F;  5A2Q K;  2F4I A;  1FIA A;  5DV5 A;  1G4D A;  1GXQ A;  5FKL A;  2FE3 A;  2YU3 A;  4EGY A;  3BR6 A;  3CCM I;  3FKI J;  2HOT A;  1MBK A;  5HOO A;  3LA7 A;  1WJA A;  1E3O C;  1RKT A;  4MHG A;  4IJA A;  1HDP A;  3JAM K;  5J1R A;  2V1X A;  5M3F J;  2P0W A;  5K7F A;  5DUK A;  2GA2 A;  2M7A A;  4RB1 A;  2XF6 A;  3ECO A;  1ON2 A;  5DDG A;  3O2P E;  5CPR B;  4U0Y A;  4KN4 X;  4F92 B;  1J75 A;  5FJ8 J;  4Q48 A;  3ECH A;  5GPC A;  2W7N A;  2W82 A;  2ZO4 A;  2ZSI B;  4WCG A;  2AXT C;  5E17 F;  3IH4 A;  3I4P A;  3OL4 A;  1YLF A;  4L5I A;  2BXY A;  2DK5 A;  4XLP F;  1QVU A;  3CTA A;  2OPT A;  3W6K B;  1SVL A;  5A2Q Z;  2F5E A;  3NAR A;  1TL8 A;  4L9J A;  2BE5 F;  4D5C A;  2VKH A;  3CMM A;  5CQG A;  1ZHF A;  4HF2 A;  2NVY J;  2LYC A;  2CV1 A;  4RAZ A;  4M9Z A;  4UVC A;  5JLX A;  2O0Y A;  1NG7 A;  3GUD A;  1AA7 A;  2GLO A;  2K9M A;  3L9F A;  3DU5 A;  2HOA A;  3BWG A;  2MBF A;  3BPX A;  3PFI A;  2V9P A;  2XRL A;  3K4K A;  5LEK A;  5EG0 A;  3HOZ J;  4UNO A;  1ETQ A;  2M34 A;  4BL0 B;  4LLL A;  2W00 A;  1R58 A;  4PFP A;  2BYV E;  2F4O B;  1T0F A;  2JA2 A;  2VOP A;  4G6D A;  2P8T A;  3WTS C;  4IHX A;  3U21 A;  2HQA A;  3PL8 A;  5FRN A;  2CW7 A;  4XKW A;  2DQL A;  1T56 A;  1JUS A;  2M8G X;  4XBF A;  3RZO J;  1Z9C A;  4AYB A;  4S05 A;  2ISY A;  1N25 A;  3R61 A;  1XSD A;  1RI7 A;  1FX7 A;  3ABU A;  4C3J J;  2HYG D;  3FK6 A;  3S14 J;  3BG5 A;  3Q3S A;  3QPS A;  3QPH A;  1BOB A;  1HA8 A;  2JWT A;  1JUP A;  4FTH A;  2R4G A;  3COA C;  3FM3 A;  2XUB A;  4BQA A;  4OIQ F;  2EA2 A;  2CV2 A;  3TO9 A;  4CCL A;  4PJJ A;  1QO0 D;  2IA2 A;  2MLG A;  1OR7 A;  4P9U A;  3GFM A;  3JRE A;  3HBL A;  1IRF A;  2M0C A;  4B4C A;  2GOX B;  3I53 A;  3KX2 A;  5LHI A;  3FF5 A;  2BY0 A;  4EAT A;  1DDN A;  3VDX A;  2WB1 N;  1AKH A;  1GV2 A;  4WF2 A;  2CQX A;  2DT6 A;  2B9S A;  4IOA F;  4DYR A;  1XPX A;  1OFC X;  2EFO A;  4KT5 C;  5D8K B;  3Q0V A;  1BW6 A;  5B1A H;  3PSF A;  3RKY A;  1SD5 A;  5FLV A;  2HVQ A;  4UUS A;  3CME I;  3DKY A;  2EK5 A;  3ZQL A;  4ZDO A;  3ZGK A;  2CYY A;  3GW2 A;  4QWQ A;  3CCR I;  1FSH A;  3H9J A;  4GYI A;  2XV4 S;  4RB3 C;  1NK2 P;  4E6K G;  4U0V A;  1I6H J;  3LSM A;  1A6I A;  1YG2 A;  1A36 A;  4PSW A;  1FYM A;  3JRF A;  3J7Z I;  2ZNY A;  3H0D A;  1YTY A;  2Q8K A;  3V4G A;  1T6S A;  1WJD A;  2OU2 A;  2ELK A;  2QSG X;  4XLN F;  1QZY A;  4LLN A;  3ZXS A;  3HSF A;  1NTC A;  1CF7 B;  2DOD A;  2KZG A;  1A6Q A;  2OCE A;  2J5O A;  4EJO A;  2X6X A;  3BR3 A;  2Z1D A;  2AQE A;  3IKT A;  3OSG A;  1CQT A;  1RR8 C;  2ESN A;  1XSX A;  3V7C A;  2FUG 2;  4C3I J;  3G3Z A;  1YX3 A;  1F1Z A;  4B44 A;  2Q1Z B;  2KKO A;  4Z6Y A;  2K40 A;  1XSV A;  3ZQG A;  3A2K A;  2VXZ A;  2NOJ B;  3VEP A;  3BCA A;  1FEX A;  1QU3 A;  1BA5 A;  4KUM A;  1MH4 A;  2RNG A;  2EZI A;  3QRF F;  1ZR4 A;  4KA4 A;  4P5O A;  4IRG A;  3KLN A;  1B6A A;  5ICE A;  1OCO H;  2M30 A;  1FOX A;  4PJ0 C;  4PK4 A;  3VYU B;  4E7I A;  3GWZ A;  2JQ7 A;  4CYD A;  2HVS A;  3A0B C;  1MMD A;  4KNY A;  1GHC A;  2X1D A;  4DBR A;  4CZZ A;  4O6J A;  1J0R A;  5CYV A;  2XGE A;  2OQG A;  2QCO A;  3JAM Z;  4I0B A;  1ODD A;  1NK3 P;  4IL6 C;  2O3F A;  2DDA A;  4KIG A;  3IKV A;  3SQN A;  1IV6 A;  2HDW A;  5E1W A;  1TWC J;  1BI1 A;  2PN6 A;  2XAU A;  4W1U A;  2E5N A;  1XTA A;  4Y52 J;  2Z16 A;  2RAE A;  2COM A;  1W5C C;  2L4M A;  3ABK H;  1X1C A;  4G12 A;  3BTL A;  2KLO A;  3IHU A;  4ENK A;  2HKX A;  2L3D A;  3HB9 A;  3RZD J;  1BC7 C;  2A6T A;  5E8G A;  4BEH B;  3FIW A;  2QEN A;  3H3U A;  3O3K A;  3LQR A;  4LB6 B;  2YR2 A;  2UV1 A;  2RNJ A;  1OCT C;  3ZMU A;  1ZK8 A;  4WX9 A;  2JA8 J;  4A3G J;  3M1C A;  1XGM A;  2K85 A;  2EBI A;  4M72 A;  3QAH A;  2K4B A;  3IP4 B;  4PSX A;  2ZME B;  1IDY A;  3SZP A;  3R4K A;  2ME6 A;  5EG0 B;  1K61 A;  4QIW N;  1MBJ A;  3RKW A;  2NNN A;  5IYD J;  3TP0 A;  1LFP A;  5GAH J;  4XRS G;  2PFB A;  4Y3O A;  3B6A A;  1Z0X A;  3PUF A;  4ABZ A;  3I4M J;  2XAQ A;  4IF4 A;  3RI4 A;  3BC8 A;  3FWE A;  3LA3 A;  3BJO A;  4ASN A;  3J81 Z;  2W4S A;  3K4N A;  5J6X A;  3A02 A;  3LSG A;  3HOY J;  1KU3 A;  5E8I A;  2E2H J;  3WG7 H;  4IHW A;  1E3P A;  3TKY A;  3BJA A;  3L2Q A;  3N4M A;  5DCF A;  3S3N A;  1YFH A;  3SEZ A;  4KMU X;  5E20 A;  3T0Y A;  3IRQ A;  3H5N A;  3HG9 A;  2DMQ A;  3PNV A;  5EGO A;  2VBW A;  5TRD A;  3ZMZ A;  5E79 C;  2ESH A;  2L7F P;  2BVM A;  4M3G A;  4QTR A;  1LE8 A;  3VB2 A;  2DFH A;  2Y0S N;  2VKV A;  4HX7 A;  4HQE A;  4AIK A;  2QSH X;  2LY2 A;  4G7O F;  2O61 A;  1D1C A;  2XAH A;  2UWM A;  4M3D A;  2L9V A;  3U2R A;  4BHC A;  1G8X A;  1REP C;  1MDM A;  3Q0U A;  1WRJ A;  2DTZ A;  2ZJP F;  3ZCO A;  4WXC A;  1FZP B;  2XPW A;  4UUV A;  3QP5 A;  3OYC A;  1FMV A;  4IPA A;  3ESW B;  4HNV A;  1DP3 A;  1RES A;  2IGO A;  2K9Q A;  2JTV A;  2LKP A;  3K70 D;  1J7K A;  1WI3 A;  4UUS B;  4C3H J;  4M6V A;  1E0E A;  4OIN F;  2KJC A;  4MTE A;  1JHF A;  1QQI A;  4E7H A;  1U5T B;  3K4C A;  3GTP J;  2WAQ N;  4MGR A;  2XB0 X;  1Z6R A;  4BHP A;  1G6N A;  2IEK A;  2K9N A;  2ZXI A;  2MC4 A;  1AOY A;  3QOD A;  2AXL A;  3ABT A;  4BQO A;  3DTE A;  5CVJ A;  1T08 B;  2XVC A;  3FHN A;  1WSU A;  3JCU C;  1U78 A;  4G7Z F;  4L18 B;  5B66 C;  4E7J A;  1B8I B;  3MFK A;  3A1Y A;  1JKO C;  2CQN A;  1KU9 A;  1STZ A;  1JGG A;  4A3K J;  5J8F A;  2QVO A;  4CH7 A;  1K83 J;  1E17 A;  1MMA A;  1WI9 A;  3I9V 2;  2FF4 A;  2ZB9 A;  2IPQ X;  3K4B A;  3ASO H;  2R7S A;  3BZK A;  1WPK A;  3M8J A;  2CMP A;  1TWF J;  4E4H A;  5ED4 A;  2CU7 A;  3GBG A;  3UKG A;  1U6G A;  5IOZ A;  3IWZ A;  1KYW A;  3H0G J;  2GXA A;  2VIX A;  4PJM A;  2DCE A;  2FMY A;  2R92 J;  3BTC A;  5KAI C;  4C2T A;  4MQV A;  4FIS A;  1BR2 A;  2R7T A;  1FT9 A;  1HKS A;  3KEY A;  1W0U A;  1O3R A;  3B02 A;  2OD5 A;  3DBH B;  3ZMS A;  1UHS A;  5HNH A;  3K0L A;  1VQ4 I;  2P7C B;  2FEZ A;  1H0M A;  2M4G A;  3K4M A;  2LC2 A;  3HC7 A;  3KP3 A;  1I27 A;  3TOA A;  2RRE A;  1TC3 C;  5BOX A;  2ICW G;  3MKW B;  2KDO A;  3H3Z A;  1MBF A;  2XF7 A;  4XRF A;  4JYK A;  1X19 A;  2L7Z A;  4XNF A;  1TT0 A;  1W7P A;  3KPH A;  1XB4 A;  2DDB A;  2GIZ A;  2QQ8 A;  4OU0 A;  4RMN A;  1ZRC A;  5F64 A;  2RKH A;  3BQZ A;  1TWH J;  4HSR A;  3FX3 A;  1MW7 A;  2IW5 A;  4KDP A;  1EF4 A;  4H0E A;  2JUC A;  3IH2 A;  1R00 A;  1R5I D;  2E2I J;  4GCV A;  2K27 A;  4CCM A;  2QQ9 A;  2OTL I;  5HVQ C;  1V5F A;  4FE7 A;  3DPU A;  2VQL A;  4YIF A;  2MH2 A;  2WC2 A;  1MJ9 A;  1X4P A;  3I59 A;  3DV8 A;  3CES A;  1IN8 A;  4TV7 A;  1B1B A;  1VTN C;  4BKX A;  2DOA A;  3L2R A;  2DOF A;  3F8C A;  2KIU A;  4A5M A;  1D0Y A;  2Y0M A;  4HX4 A;  5HDK A;  4M73 A;  1D3Y A;  1SFE A;  1EH7 A;  2KZV A;  2XSJ C;  2ZFW A;  3I54 A;  4I02 A;  2R7Z J;  1YIT I;  3BTJ A;  2DA2 A;  5DD8 A;  3KP6 A;  1OCR H;  2EV6 A;  2UXX A;  4P55 A;  5L3D A;  3VSL A;  5D5V B;  1KU7 A;  3KZZ A;  3AFH A;  5D5X B;  4ENJ A;  3HL2 A;  2MAB A;  3Q0W A;  2VBZ A;  4N4N B;  3GX4 X;  5FKN A;  1H9T A;  4E7Z A;  4V2G A;  1X1B A;  4BE2 A;  4BXF A;  3ZMV A;  1M1E B;  2KJB A;  2WBM A;  4LIT A;  4LIV A;  4Y17 A;  4I0A A;  5HS7 A;  3EPZ A;  3VYR B;  3S15 J;  1DU6 A;  3FBI B;  1DUX C;  1WHU A;  4PJN A;  1IXC A;  2IS2 A;  1EKE A;  1DPR A;  1ENH A;  5EGO B;  2KDZ A;  3GLL A;  4UY8 I;  2EWN A;  4EMS A;  2QSF X;  3HKZ N;  2VJ4 A;  1ZG5 A;  5EZG A;  1K78 A;  1MMG A;  1ZRD A;  2JRM A;  2RV8 A;  2DT5 A;  3VYS B;  3CCQ I;  5TJJ A;  3C2B A;  1ZRE A;  3OYN A;  3HRM A;  3WG9 A;  1TQP A;  1IF1 A;  3CC4 I;  3WU2 C;  1VQM I;  2HU9 A;  1FP2 A;  2BVL A;  2M1B A;  4M3F A;  4A3D J;  3VOD A;  2OC6 A;  3ZQF A;  1P2F A;  5FRO A;  1MSF C;  5M5Y J;  3FXM A;  2DXI A;  4II3 A;  3MWM A;  4E7L A;  1TW2 A;  2IS4 A;  2VBX A;  3K9T A;  2IGM A;  4MLO A;  3Q9V A;  2VOD A;  3OS0 A;  2P5L C;  1YYV A;  1RC9 A;  4Y33 A;  1JT6 A;  3BCB A;  4HW0 A;  1U5T A;  2KRH A;  2W84 A;  1R4N B;  2X1C A;  3KYC B;  1T0F C;  1W7P D;  2W57 A;  3MQ0 A;  1BI0 A;  3NWS A;  2A6H F;  4ZYG A;  1K4T A;  4FX4 A;  2XF5 A;  3WGG A;  1ZLJ A;  3I58 A;  1B9N A;  2LNB A;  1YE9 A;  2M3A A;  3DLL F;  4ESB A;  2MYS A;  3OS2 A;  3H9G A;  1BI3 A;  2ECB A;  1T2K A;  5HS8 A;  2COB A;  2Y2Z A;  3CZ6 A;  3FXO A;  3BG7 A;  4KIB A;  3OYL A;  4M9S A;  1JT0 A;  1ZGJ A;  4UVB A;  1P7J A;  2WY7 Q;  2X6W A;  2UXN A;  5J8C A;  3LNQ A;  1UG0 A;  2EZK A;  4G94 A;  2GBY A;  2VAS A;  2E35 A;  1USS A;  2MC3 A;  2PMZ A;  3C18 A;  2XDV A;  3FXQ A;  3F6O A;  1K6O A;  1BJA A;  2V1D A;  2EZL A;  2IGK A;  4MFD A;  4WXH A;  1WCM J;  3EUA A;  4BUP A;  2BV6 A;  5LEJ A;  2ZNZ A;  1ETV A;  4AU7 A;  3J80 Z;  5EDN A;  1SAX A;  1UEL B;  2OUM A;  5FRM A;  2FA5 A;  5HDG A;  3ZOB A;  1DQU A;  2I8D A;  4XOT A;  4KJZ A;  1SFX A;  3G4S I;  2ZJ2 A;  3L1P A;  2NNY A;  3LWF A;  2M0M A;  3ASN H;  2MLK A;  1XD7 A;  4CCK A;  4LK1 F;  2IBD A;  3JRA A;  3CUQ A;  5IY5 H;  1BOA A;  3E7L A;  5GTH C;  4Y4R A;  1W5S A;  4Q47 A;  4R79 A;  3CCY A;  2OBP A;  3HSR A;  2TDX A;  5L3C A;  3CMA I;  1I3A A;  1GT0 C;  3V8K A;  5AIP A;  2R0Q C;  2DK8 A;  2JVH A;  1ZAR A;  2DA7 A;  3ZQH A;  4G9Y A;  3RKQ A;  1OLT A;  1R23 A;  1A5J A;  2AO9 A;  2DU9 A;  4W97 A;  2P5K A;  1FY7 A;  3EYY A;  2LG4 A;  5DYM A;  4MIM A;  3S1R J;  3L00 A;  4QLC U;  3ZQC A;  3V7R A;  1HSJ A;  3R0A A;  3HOS A;  1I1G A;  1WQ2 A;  4YFN F;  5EEA A;  3JRC A;  2H94 A;  3MZ8 A;  1XN7 A;  1J09 A;  1I39 A;  1WH5 A;  3BOQ A;  1ZN2 A;  1QZE A;  3TDU C;  3RSN A;  4B09 A;  5L3G A;  2QBY A;  1VF9 A;  4BGD A;  2XHK A;  1GVJ A;  5LGN A;  2F6C A;  4S0H B;  2PLY A;  3I59 B;  3IV5 A;  1R7J A;  4L0Y B;  3MN2 A;  1U8R A;  1IV8 A;  5F0H A;  2CQK A;  3JW4 A;  4A12 A;  2W85 A;  4BXX J;  2O03 A;  3E6D A;  3QPL A;  3QPT A;  3Q9S A;  5FLM J;  2PG4 A;  3LQQ A;  2Z3Y A;  4IRI A;  3T8T A;  2KFD A;  2HI3 A;  2QGU A;  1IC8 A;  5F6F A;  4RM3 A;  4N0B A;  4AD9 A;  1U0J A;  2VJI A;  1OPC A;  3CO6 C;  3KZY A;  3CCS I;  4HPQ A;  3HJE A;  4BHB A;  1VQN I;  2GZW A;  1V4R A;  1W36 C;  1PUE E;  2E1C A;  3ZQQ A;  2H1L A;  3LSR A;  3IRR A;  2MH9 A;  5AIQ A;  4MEX F;  3F9K A;  1IN4 A;  4UB8 C;  3MKZ A;  2HNH A;  2O8X A;  1F5T A;  2LD5 A;  1S9H A;  4ZC3 A;  2V79 A;  3BPV A;  2LOO A;  4M6X A;  2N8G A;  3L09 A;  3HXL A;  1QHH D;  3G1O A;  3UNG C;  1LE8 B;  4AM3 A;  2VC0 A;  3VPR A;  2HFH A;  1K78 B;  1Z91 A;  4KYW A;  2MSY A;  4A2U A;  1MDM B;  3B73 A;  3JSP A;  4IHT A;  4FE4 A;  3F21 A;  4XLA A;  2LP0 A;  2L54 A;  4RGS A;  1BW5 A;  3RPQ A;  1BM9 A;  2A5Y B;  3DEU A;  1Y0U A;  2O9L A;  3PFY A;  3RIR A;  2NVX J;  1D0X A;  1UZC A;  3ABM H;  3SDB A;  4HDU A;  2FD5 A;  2ZJQ F;  1IRX A;  1L3L A;  1LVK A;  4DYC A;  2MW8 A;  1R5H A;  1HKQ A;  2MA3 A;  1D0Z A;  2KT0 A;  2TCT A;  5B5E C;  3MCZ A;  3E0J B;  3E5X A;  5DM6 F;  4AIH A;  1UJ8 A;  4CYC A;  2LTP A;  1Y1V J;  1XCV A;  2KIS A;  2VQH A;  2HZD A;  4IXA A;  2DW4 A;  4J01 A;  1ONV A;  2KL4 A;  5IP7 J;  2LKS A;  3SZG A;  4ZTJ A;  1T98 A;  4EM2 A;  4NHJ A;  2LH9 A;  1ETK A;  2W48 A;  2BY1 A;  2QLZ A;  3S2H J;  3CP8 A;  2K9L A;  2WWY A;  3MMY B;  3F8F A;  4L9N A;  2VBY A;  1Q1V A;  1WFX A;  2DPU A;  5D6E A;  1SAU A;  4M3B A;  3GTO J;  2JSC A;  4CIC A;  2LY1 A;  4BBR J;  1Z21 A;  1ETX A;  2V9K A;  1X4O A;  3JTG A;  1P4X A;  1BN5 A;  3W6V A;  1S7E A;  3SJM A;  1I1S A;  5D5W B;  4JP0 A;  5H6R A;  1ZRF A;  4EEF G;  1Z67 A;  2GXG A;  3K70 C;  5FO5 A;  1A31 A;  4Y15 A;  3CF5 F;  4V19 K;  3K69 A;  3L2W A;  1MD0 A;  5LRR A;  4J19 A;  4BY1 J;  3T8R A;  3KZI C;  4YEJ A;  3K1P A;  4HZF A;  2P6S A;  4LMY A;  3FMQ A;  2DA6 A;  2FX0 A;  3L2V A;  4C2U A;  3M1E A;  3DWL E;  4XRS A;  1JUM A;  1T95 A;  2QF7 A;  3MD2 A;  3CUQ B;  4DW6 A;  4KFC A;  1RKW A;  5ILU A;  1T8I A;  1X1A A;  1JI8 A;  2BY3 A;  2O8K A;  3HHG A;  4RA2 A;  2H09 A;  2LF7 A;  3BR5 A;  3EUH C;  1VQL I;  3ZPL A;  1L0O C;  1JE8 A;  6PAX A;  1GUU A;  3K10 A;  2RC4 A;  1W7P B;  2CUJ A;  4Y7N J;  3KLO A;  3GXO A;  5FD5 A;  3HRT A;  3S1Q J;  5E3L A;  4Y13 A;  2Y69 H;  2NS7 A;  5D4S A;  3H3V K;  2JRT A;  3PM1 A;  3CD6 I;  1GV5 A;  4E7S A;  3ONQ A;  4UV9 A;  4DIQ A;  3S17 J;  4OOI A;  3OR2 C;  2DYS H;  2BZT A;  3ZR8 X;  4MEY F;  4ON0 A;  3F6V A;  3MZH A;  3PIP F;  4ETS A;  2H27 A;  1IN7 A;  3MEX A;  4P96 A;  1D8J A;  3F0C A;  4D5F A;  1R49 A;  2QBY B;  1TWG J;  4OIR F;  1HLV A;  3D1N I;  2KP6 A;  2M87 A;  1WJ5 A;  4II2 A;  2VPL A;  3H36 A;  4WK8 F;  3OY9 A;  2CUF A;  3HPH A;  2MFZ A;  4O5V A;  2G9W A;  2JJ7 A;  3FIS A;  4GDF A;  2K3P A;  1WZ2 A;  2ZJR F;  2R7X A;  2E34 A;  2UUZ A;  4HQM A;  2VQC A;  2GA1 A;  3CUQ C;  2Y9Z A;  4BE0 A;  5GAG J;  4X1E A;  2LSO A;  3BR1 A;  4C30 A;  3V8J A;  1BJZ A;  3EQL F;  2WAF A;  1HCR A;  2V6E A;  3X2Q H;  4M74 A;  1FYK A;  1CGP A;  1TBX A;  3V42 A;  2BHY A;  2QEX I;  5LRS A;  5BS6 A;  1MZB A;  5TIS C;  4RB2 C;  2CRG A;  1N77 A;  1RUO A;  1R4M B;  4MNU A;  1U9O A;  2XPV A;  3BR2 A;  5HNF A;  2X51 A;  2DYR H;  1FOY A;  3HOV J;  3BT9 A;  4ANJ A;  2HOS A;  3SHF A;  1KQ8 A;  3LAP A;  2FOK A;  4K2E A;  1YS7 A;  3K2Z A;  4G7H F;  3IAM 2;  2HQ5 A;  3BJ6 A;  2CUE A;  2LLK A;  2W25 A;  2X1E A;  1ZGW A;  2R7O A;  1OCZ H;  3WTU C;  1XCB A;  2EFQ A;  4CCN A;  2FQ3 A;  2QZ8 A;  4JBA A;  5LHH A;  1A35 A;  2H1K A;  3PQJ A;  4DGW B;  5D5U B;  3HRU A;  3I64 A;  4CCJ A;  1J2X A;  4OMZ A;  3AG4 H;  2V9V A;  2F48 A;  4A69 C;  2L9R A;  1PJR A;  1OCP A;  3FXL A;  2P6T A;  1ZR2 A;  4CO8 A;  1S6L A;  3HEF A;  2B7E A;  2ZSH B;  3OYG A;  4F91 B;  5LGU A;  1U5T C;  1ZEL A;  3I0T A;  2XRO A;  2B63 J;  2DTR A;  4LD5 A;  1F43 A;  3HUG B;  3TED A;  2R7D A;  5LGT A;  5FLX Z;  3M8E A;  4L9V A;  1VQ6 I;  4LOC A;  3A03 A;  5DTD A;  1VQ7 I;  4XOR A;  1OJL A;  2XGX A;  2DOE A;  1BL0 A;  2FRH A;  1QVT A;  1MNE A;  4ZZL A;  3GF2 A;  1QA6 A;  1B4A A;  5EJC A;  4OIP F;  3WTV C;  5E18 F;  4L9T A;  1TW3 A;  3SDG A;  1V54 H;  3NEU A;  2BGC A;  1V55 H;  3QOE A;  3E5U A;  4OWR B;  4EQQ A;  3I4N J;  3ZN0 A;  4HRI A;  3I56 I;  3HOX J;  5F1R A;  5K5O A;  1MH3 A;  1R9T J;  1G2H A;  5EZH A;  1JKR C;  2BBY A;  2FOW A;  2WAD A;  3SEQ A;  2GIV A;  5DD4 A;  3GYH X;  1SAN A;  4XLH A;  2DA5 A;  1QPM A;  1E2X A;  2ZC2 A;  2E7X A;  1O3S A;  5CVU A;  3CDL A;  4FX0 A;  1G59 A;  2VOO A;  2HTJ A;  4AVZ A;  3Q5F A;  4EJT A;  2VT3 A;  2HYF A;  2DA3 A;  1S8N A;  1FTZ A;  4XMY A;  1ZG3 A;  1HW2 A;  2VQG A;  3HOU J;  2A69 F;  3F23 A;  2V6C A;  2PMH A;  1TNS A;  4DZJ A;  3HOW J;  1KU2 A;  1Z7L A;  2VPR A;  1E3H A;  1R22 A;  2QKM B;  4OMY A;  3GZN B;  3ZMT A;  5BMZ A;  1KQ0 A;  3HKZ A;  3CC2 I;  4BQN A;  1FMW A;  5M3M J;  3DPT A;  3ZQI A;  4A0Y A;  4BXU A;  2X9D A;  3TO7 A;  3HPG A;  4XKC A;  1VQ8 I;  1OMI A;  2PMZ N;  4IO9 F;  1ZG1 A;  3ZP5 A;  3OYA A;  1OCC H;  2XGD A;  4ZDP A;  1LUJ B;  1FBU A;  4F3Q A;  2DO7 A;  4GRI A;  2E1M B;  3QP6 A;  4XLF A;  2PMU A;  4RGR A;  2D45 A;  3GTJ J;  1WGX A;  2A3S A;  2OZ6 A;  3IH3 A;  4XN0 A;  1KGS A;  3RDI A;  3CCJ I;  2F5V A;  4A0X A;  5GAD J;  3RJP A;  5E3N A;  3GME A;  1TTY A;  4HST A;  1JGS A;  4NC6 A;  4XKV A;  3ML6 A;  1LPQ A;  4DQ2 A;  2G7H A;  3CLQ A;  4KIT B;  2FBK A;  3F22 A;  1NH3 A;  1HW5 A;  2JSP A;  5CVI A;  5FKK A;  2ZKZ A;  3S93 A;  3S3O A;  2Z2S B;  2XAS A;  4BBS J;  3GCM A;  4GXO A;  4XLE A;  1VQO I;  3J7A O;  1AHD P;  2R7F A;  2HR3 A;  2MGQ A;  2PQ8 A;  3H92 A;  4KIS A;  1T33 A;  3ZQ7 A;  3E1S A;  3ERE D;  2E36 A;  4B47 A;  3C3W A;  4XQF A;  1HDD C;  3GTQ J;  5EYR A;  3O6B B;  4XRM A;  1RUN A;  3OIO A;  1P7I A;  1ZKG A;  3TP3 A;  1R1U A;  3GTL J;  1HBX G;  5LD2 C;  2DAO A;  4UHT A;  2DBB A;  3DLA A;  4BE1 A;  4BAY A;  4DOZ A;  1K7A A;  1G3W A;  1TWA J;  2EZH A;  4LFU A;  2ID3 A;  3AAF A;  4BJT A;  3FK7 A;  2QUF A;  2VKD A;  1Z3Y A;  5J3L A;  4R8H A;  4XK4 A;  3P9C A;  4MFE A;  2EV0 A;  1EH8 A;  2ZXJ A;  2MG4 A;  2CG4 A;  1Y1W J;  3W2V A;  2R5Y B;  1IUY A;  2CW8 A;  1UHW A;  3OV8 A;  1IN5 A;  4NUB A;  1MBG A;  3JSO A;  3K4L A;  3ERM A;  3OYF A;  3BRO A;  2M2E A;  4EJV A;  3WE2 A;  3H1C A;  3HTS B;  4IVN A;  4F7Z A;  2WTE A;  1NG6 A;  3G1M A;  4NQW A;  1J5Y A;  3D5L A;  2JT1 A;  5C4X J;  2VB6 A;  2GQQ A;  4HF0 A;  5JVT A;  4U7B A;  1IXS B;  5LLQ A;  2OV7 A;  1O4X A;  4CZC A;  1HOM A;  2O5R A;  3HUG A;  4I7H A;  4CYC B;  2JK3 A;  4WWC A;  1P6R A;  5FLX K;  5JHU A;  3CDH A;  4D7M A;  3KCC A;  1BR4 A;  1U9N A;  1R71 A;  2DFF A;  5M5X J;  3NQO A;  1ZTR A;  3HRS A;  1VND A;  2LKX A;  3U9G A;  3BG9 A;  5BPD A;  3WTX C;  1P9Q C;  3LSJ A;  3OL3 A;  4AWX B;  2PX9 A;  1O7L A;  2Z5U A;  2XSD C;  4LIU A;  3M7G A;  4BJ6 C;  2GXB A;  2VUM J;  3RQI A;  1MIJ A;  2VLA A;  1LFU P;  2D5V A;  3FZV A;  2Y48 A;  4JQF A;  3I55 I;  1X58 A;  1TQI A;  4RAF A;  2Y30 A;  3OOU A;  3FDY A;  1GVD A;  2DA1 A;  4ZYE A;  1IO2 A;  2DFE A;  2EFN A;  4I76 A;  3OYE A;  3S8P A;  2VL8 A;  1XDS A;  3I5U A;  1S72 I;  1XMX A;  3K1M A;  1YO5 C;  2HEO A;  1W0T A;  2E1N A;  1KYZ A;  1EH6 A;  1S5L C;  5E3O A;  3OYD A;  1ZAO A;  1JKQ C;  4UB6 C;  1LVA A;  4M9X A;  5GTI C;  3M07 A;  4XOP A;  3TO6 A;  3WTT C;  2WY8 Q;  2Q2E B;  2WA0 A;  4Q4Z F;  2ISZ A;  5IT9 K;  1D1A A;  1OYW A;  3REO A;  2K9S A;  2VJ5 A;  3KYL A;  2KRC A;  4BH9 A;  2XB5 A;  3LL7 A;  5D6F A;  3IAS 2;  4Q5S F;  4DNC A;  1MBE A;  3W6J B;  3VOE A;  2HOE A;  3WTZ A;  5KVR A;  5FFX A;  2A07 F;  2EH3 A;  2JPC A;  3FMS A;  3MVP A;  4A3B J;  4IKF A;  5DUI A;  3QWL A;  4XID A;  2DT7 B;  4L5E A;  1LQ1 A;  4RDU A;  1FSE A;  3EUK L;  4ITV A;  5C4J J;  3F8B A;  4ZYD A;  3CCV I;  3OYI A;  5K5R A;  2HPI A;  1ACI A;  5JFR A;  2ETH A;  3M9A A;  3BZC A;  4ZDL A;  3K6G A;  4XIC A;  1QHG A;  2X6O A;  2LK2 A;  3OMY A;  4EM1 A;  4IEJ A;  2CW0 F;  3KIO A;  3I71 A;  1LEA A;  2YX7 A;  5KCM A;  1OIS A;  3BQY A;  2CH0 A;  2R5Z B;  3P7N A;  3GFL A;  5EF6 A;  4PGG A;  2E1M C;  1Q1H A;  2FSW A;  3HOT A;  3TW7 A;  2FNP A;  2K86 A;  1SVO A;  2Z99 A;  2ZXH A;  4HV5 A;  3IUO A;  4L5J A;  3CUO A;  5K1Y A;  2Y0S A;  2LBF B;  4LB5 A;  3G6E I;  2E60 A;  2BHZ A;  2EIN H;  2Q0O A;  3FHZ A;  2FNA A;  3OOP A;  1YRN A;  5C3E J;  2ZXW H;  5DEQ A;  4I99 C;  2UZK A;  3N05 A;  4RAY A;  1W5T A;  3R60 A;  3L2C A;  2R7U A;  3KEO A;  4I09 A;  3J7Y J;  1ZQ3 P;  4D7N A;  4HEA 2;  2DI3 A;  5TGT A;  1B72 B;  2F5F A;  4F55 A;  5K7Z A;  4ZZD A;  1Z7U A;  1EA3 A;  3DTI A;  1D5V A;  4A3M J;  1MKM A;  3F8N A;  5KK1 A;  2VI6 A;  4BS9 A;  3HIF A;  5BQT A;  1FYL A;  2ADU A;  1GLN A;  1S7A A;  4AVP A;  3B6C A;  3H5A A;  3P5J A;  3KYD B;  2BY2 A;  4ESF A;  2XKO A;  2H6B A;  3E3V A;  1XMK A;  2HXI A;  1MSE C;  2QYO A;  2ACJ A;  3LFU A;  3A4C A;  1WJE A;  2JZY A;  2BEO A;  2V7F A;  1DP7 P;  3DF8 A;  1PUF A;  3PQK A;  4B8X A;  2ELJ A;  3G71 I;  2OF7 A;  2H8R A;  1BI2 A;  3CLO A;  3S2W A;  4N9H A;  4RBO A;  1D5Y A;  2CGP A;  3GTM J;  2E2J J;  2YSR A;  4NQW B;  1V5G A;  5F27 A;  2M8E A;  3DEE A;  5J4Y A;  4A93 J;  1Z1D A;  5GP9 A;  3C1D A;  3SFZ A;  5FD6 A;  2FQ4 A;  2C6Y A;  3VWB A;  1JJ6 C;  1FOW A;  4YII A;  1LKX A;  3LSH A;  3DQV C;  3OWT A;  3BG6 A;  2DA4 A;  4E7K A;  1ZYR F;  3U1D A;  5J1U A;  2OZU A;  3GLX A;  3DKX A;  1MGT A;  2L9N A;  1OQY A;  4YRV A;  2XAF A;  2KMU A;  4YEL A;  3OIQ A;  1MJA A;  4I98 B;  4UUT A;  3MAJ A;  3HZJ A;  2L02 A;  3RPU D;  2R7R A;  2KIQ A;  2DJN A;  3PNY A;  1OR7 C;  4YIR X;  2YX4 A;  1YJW I;  2EQR A;  2QWW A;  2VJJ A;  4A3F J;  2HGC A;  5IOY A;  4CUG A;  3RYR A;  2X85 A;  2D1V A;  1ETO A;  4HX8 A;  3GZ5 A;  1RPW A;  2DLL A;  2I10 A;  2V4J C;  4PGH A;  3JRG A;  3AL0 B; 
#chains in the Genus database with same CATH homology
 1TLH B;  3V8L A;  2P7V B;  2NRA C;  5IT9 Z;  4U0W A;  2K7L A;  2IA0 A;  4ENM A;  3P9K A;  1LEB A;  3BZ6 A;  1NHA A;  3LST A;  1V3F A;  3GEZ A;  3WU0 A;  3KE2 A;  2Q2E A;  5H6Q A;  1P4A A;  3KP2 A;  1AWC A;  3GVA A;  1OYI A;  5E1X A;  2FXA A;  1K79 A;  3GZ6 A;  4HLY A;  4MTD A;  2STT A;  1OYY A;  3CO7 C;  1DPU A;  4YFX F;  2YPR A;  4N9I A;  4LJZ F;  2O6G E;  2NS0 A;  3D0S A;  2NYX A;  1IRG A;  5AON A;  4FHT A;  1PP7 U;  5HLI A;  2IA1 A;  4GYG A;  2ZBK A;  2CO5 A;  4WXD A;  1SMT A;  4HV6 A;  1SD4 A;  4A6D A;  2HZT A;  2HQR A;  1ULY A;  2OQR A;  3WTW C;  4HA8 A;  1G3S A;  1YW9 A;  4GGG A;  5ICF A;  2FML A;  3KEQ A;  5ERI A;  1P92 A;  2A61 A;  3RPU A;  3VFZ A;  3M8F A;  2JPB A;  2ZCW A;  1WKM A;  3FXR A;  3RTR A;  2IT0 A;  1R36 A;  4LG0 A;  5CLS A;  2L4A A;  4IRH A;  3T5X A;  1S3J A;  1PP8 F;  4Z2Y A;  5IT3 A;  4P9F A;  1U3E M;  1UST A;  1ZH5 A;  1D8K A;  2QQB A;  4JK1 X;  3DPL C;  2Z9O A;  2NAZ A;  4G8X A;  1TQM A;  1YQA A;  1F4K A;  2STW A;  5L3F A;  1S7O A;  5H20 A;  1YW7 A;  1IN6 A;  4LGW A;  3ROU A;  1EV7 A;  2XRN A;  3SZT A;  1A04 A;  3RYP A;  4YG2 F;  2IP2 A;  5ILS A;  5HS9 A;  1B9M A;  4RB0 A;  1FP1 D;  2B0L A;  2EV5 A;  2RGV A;  3SXY A;  4UXN A;  4GO1 A;  4R1H A;  2RDP A;  4KIF A;  3IC7 A;  5DCM B;  2PI0 A;  3ZMD A;  3LAJ A;  4G6Q A;  5CJ9 A;  5CVV A;  1R1T A;  1JHH A;  2OAZ A;  2FU4 A;  2VT2 A;  1J59 A;  1Z6T A;  3ELK A;  4PDK A;  5CVR A;  3DFG A;  5LBQ A;  4EGZ A;  1QBJ A;  4O3M A;  2M45 A;  1HKT A;  1WWX A;  2FBI A;  3FXU A;  4HDV A;  4S04 A;  5ICG A;  1FC3 A;  2PEX A;  2VE9 A;  4CDG A;  3TQN A;  2E7W A;  2HTS A;  3R0J A;  1I5Z A;  4LLG F;  2XAJ A;  3R6S A;  1O57 A;  2IRF G;  3KP7 A;  1SMY F;  5FGM A;  2EFW A;  1FLI A;  4IHS A;  3KP4 A;  2XKP A;  3EET A;  2DPD A;  3HSE A;  4I2O A;  4L0Z B;  5K5Q A;  2KIF A;  2M5W A;  1YIO A;  1RZ4 A;  3KFW X;  3QOP A;  1FBS A;  3BY6 A;  5HLH A;  1B59 A;  1HQC A;  1RNL A;  4KN7 X;  4D0P A;  1HW1 A;  4EJW A;  4PCQ A;  1XMA A;  1QGP A;  2HDC A;  1W4M A;  3FM5 A;  5E1Z B;  1G3Y A;  1FNN A;  1YS6 A;  2QM3 A;  4BYY A;  1LDK B;  1SFU A;  3LA2 A;  4HAM A;  4A5N A;  1OKR A;  3HTU A;  5JI6 A;  1R5G A;  4U88 A;  2EFP A;  1BIB A;  4HOB A;  3F8M A;  4KIC A;  1PDN C;  2WV0 A;  1UFM A;  1ON1 A;  5L3E A;  1FPQ A;  3KP5 A;  2FBH A;  3WTY C;  1ZLK A;  3GFI A;  2VE8 A;  3E5Q A;  1IAW A;  1O3T A;  2H6C A;  1FWZ A;  3CJN A;  3L7W A;  3DKW A;  1GXP A;  4BNC A;  1QNT A;  1T38 A;  4RGX A;  2ELH A;  1Z05 A;  2KRF A;  3G73 A;  3IWF A;  1FOK A;  4A6E A;  1IW7 F;  4U7D A;  2EB7 A;  1YW8 A;  4YFK F;  2A68 F;  3FMR A;  2HS5 A;  1BBY A;  1BIA A;  3BP8 A;  5FFZ A;  4RS8 A;  3LFK A;  2PBI A;  5DCM A;  2VON A;  2PJP A;  4EJU A;  2IVM A;  3QU6 A;  2RQP A;  2X4H A;  4CHU A;  2IJL A;  3WU1 B;  3N97 A;  1LDD A;  1IXR C;  2Y75 A;  3E6M A;  4ENN A;  3E6C C;  4KMF A;  2A6E F;  2VN2 A;  3EYI A;  1ZGA A;  1XGO A;  4XSZ F;  2K02 A;  3GFJ A;  5JR3 A;  5EEH A;  2RVC A;  1I6X A;  3MZY A;  5EEG A;  2XIG A;  2D1H A;  2EA4 A;  3DP7 A;  3GO5 A;  1O7F A;  1F9N A;  2F5C A;  1CF7 A;  1QZZ A;  2DQR A;  2HKO A;  1JXS A;  4FT8 A;  3BDD A;  2G7U A;  1H9G A;  2L01 A;  1HXD A;  4EV0 A;  1SD7 A;  2EJR A;  4HF1 A;  4A0Z A;  1T39 A;  2MD5 A;  5FB2 A;  3T1B A;  1X3U A;  2Z33 A;  2X0L A;  4HYE A;  3WGI A;  3EUH A;  1UCR A;  2OA4 A;  3WE3 A;  1RIO H;  2LF8 A;  2F5D A;  3F72 A;  3TDZ C;  1UHM A;  4PZJ A;  3ULQ B;  3TOB A;  4LG0 B;  3TGN A;  5BPI A;  2K4J A;  2LDU A;  3HHH A;  4UVA A;  1KA8 A;  4ESJ A;  3E97 A;  4CXF A;  1BC8 C;  3P9I A;  1UB9 A;  2CSO A;  2CFX A;  3IL2 A;  2D2W A;  2P4W A;  3WOD F;  4HLX A;  2W24 A;  2HQN A;  1O3Q A;  1P4W A;  2CWE A;  2P5V A;  3V7S A;  2J5P A;  2GWR A;  5D4R A;  4UV8 A;  1KQ9 A;  2ZME A;  4MQ9 F;  1R1V A;  4EVI A;  5HLG A;  1XGN A;  4HBL A;  1SD6 A;  1LB2 A;  2QQA A;  3K1N A;  2F2E A;  3ISP A;  3HYI A;  3DXJ F;  1XGS A;  3C7J A;  4XSX F;  3JTH A;  4LK0 F;  4EM0 B;  5ICC A;  2R3S A;  4RGU A;  4AIJ A;  4E70 A;  5D8L B;  1S29 A;  1LDJ A;  3QU3 A;  2V1U A;  3KET A;  1MJB A;  2HWV A;  2RN7 A;  3J81 K;  3F3X A;  5ILV A;  4M71 A;  1LNW A;  1TNT A;  3EDP A;  3ZN1 A;  4I01 A;  1U2W A;  3RKX A;  4ZH4 F;  3J80 K;  2AS5 F;  1IZ1 A;  2KIM A;  4NB5 A;  5L3B A;  5HDN A;  2DFI A;  5LHG A;  4M6Y A;  4ZYH A;  1FBQ A;  3NRV A;  3E6B A;  1HST A;  2XAG A;  2GAU A;  2VC1 A;  1J9I A;  1G3T A;  1C0W A;  1XDU A;  1LJ9 A;  4OIO F;  3WGH A;  5A2Q K;  5DV5 A;  1G4D A;  1GXQ A;  2FE3 A;  2YU3 A;  4EGY A;  5HOO A;  3LA7 A;  4MHG A;  4IJA A;  3JAM K;  2V1X A;  5DUK A;  2GA2 A;  4RB1 A;  3ECO A;  1ON2 A;  5DDG A;  3O2P E;  4U0Y A;  4KN4 X;  1J75 A;  4Q48 A;  3ECH A;  2ZO4 A;  4WCG A;  5E17 F;  3I4P A;  1YLF A;  4L5I A;  4XLP F;  2DK5 A;  3CTA A;  3W6K B;  5A2Q Z;  2F5E A;  4L9J A;  2BE5 F;  1ZHF A;  4HF2 A;  4RAZ A;  4M9Z A;  4UVC A;  2O0Y A;  3GUD A;  3L9F A;  3BWG A;  2MBF A;  3BPX A;  3PFI A;  5LEK A;  4UNO A;  4LLL A;  1R58 A;  2BYV E;  1T0F A;  2VOP A;  4G6D A;  2P8T A;  3WTS C;  2DQL A;  4XBF A;  1Z9C A;  4S05 A;  2ISY A;  3R61 A;  1XSD A;  1RI7 A;  1FX7 A;  3ABU A;  2HYG D;  3QPH A;  3COA C;  3FM3 A;  2XUB A;  4BQA A;  4OIQ F;  2EA2 A;  3TO9 A;  1QO0 D;  2IA2 A;  2MLG A;  1OR7 A;  4P9U A;  3GFM A;  1IRF A;  3I53 A;  5LHI A;  3FF5 A;  1DDN A;  4WF2 A;  2EFO A;  4KT5 C;  5D8K B;  3RKY A;  1SD5 A;  2EK5 A;  2CYY A;  3GW2 A;  4QWQ A;  1FSH A;  4GYI A;  2XV4 S;  4RB3 C;  4U0V A;  1YG2 A;  1FYM A;  2ZNY A;  1YTY A;  2Q8K A;  3V4G A;  1T6S A;  2OU2 A;  4XLN F;  1QZY A;  4LLN A;  3HSF A;  1CF7 B;  2J5O A;  4EJO A;  3IKT A;  2ESN A;  1XSX A;  3V7C A;  3G3Z A;  1F1Z A;  2KKO A;  1XSV A;  2VXZ A;  3VEP A;  4KUM A;  3QRF F;  4KA4 A;  4P5O A;  4IRG A;  3KLN A;  1B6A A;  5ICE A;  2M30 A;  3GWZ A;  4CYD A;  4KNY A;  1GHC A;  4CZZ A;  4O6J A;  1J0R A;  5CYV A;  2OQG A;  3JAM Z;  4I0B A;  1ODD A;  2O3F A;  4KIG A;  3SQN A;  3IKV A;  5E1W A;  1BI1 A;  2PN6 A;  2COM A;  2L4M A;  3IHU A;  4ENK A;  2HKX A;  2L3D A;  1BC7 C;  5E8G A;  2QEN A;  3H3U A;  3O3K A;  3LQR A;  4LB6 B;  2YR2 A;  2RNJ A;  3ZMU A;  4WX9 A;  1XGM A;  4M72 A;  3QAH A;  2K4B A;  2ZME B;  3SZP A;  3R4K A;  3RKW A;  2NNN A;  2PFB A;  2XAQ A;  4IF4 A;  3RI4 A;  3FWE A;  3LA3 A;  3BJO A;  4ASN A;  3J81 Z;  5J6X A;  1KU3 A;  5E8I A;  3TKY A;  3BJA A;  3N4M A;  1YFH A;  5DCF A;  4KMU X;  5E20 A;  3T0Y A;  3IRQ A;  5TRD A;  2VBW A;  3ZMZ A;  2ESH A;  3VB2 A;  4HX7 A;  4HQE A;  4AIK A;  4G7O F;  2O61 A;  2XAH A;  2UWM A;  3U2R A;  4BHC A;  1REP C;  1MDM A;  1WRJ A;  1FZP B;  4WXC A;  4UUV A;  3QP5 A;  4IPA A;  2JTV A;  2LKP A;  1J7K A;  4OIN F;  2KJC A;  4MTE A;  1JHF A;  1QQI A;  1U5T B;  4MGR A;  1Z6R A;  4BHP A;  1G6N A;  1AOY A;  2AXL A;  3ABT A;  5CVJ A;  2XVC A;  1WSU A;  1U78 A;  4G7Z F;  4L18 B;  3MFK A;  1KU9 A;  1STZ A;  5J8F A;  2QVO A;  1E17 A;  1WI9 A;  2FF4 A;  2IPQ X;  5ED4 A;  1U6G A;  3IWZ A;  1KYW A;  2FMY A;  4MQV A;  1FT9 A;  1HKS A;  1O3R A;  3B02 A;  2OD5 A;  2P7C B;  3ZMS A;  3K0L A;  2FEZ A;  1H0M A;  3KP3 A;  1I27 A;  3TOA A;  5BOX A;  3H3Z A;  4XRF A;  1W7P A;  1XB4 A;  1ZRC A;  4OU0 A;  5F64 A;  2RKH A;  3FX3 A;  2IW5 A;  4KDP A;  4H0E A;  1R00 A;  4GCV A;  2K27 A;  2QQ9 A;  5HVQ C;  4YIF A;  2MH2 A;  2WC2 A;  1MJ9 A;  3I59 A;  3DV8 A;  1IN8 A;  4TV7 A;  1B1B A;  1VTN C;  3F8C A;  2KIU A;  4A5M A;  2Y0M A;  4HX4 A;  5HDK A;  4M73 A;  1D3Y A;  1SFE A;  1EH7 A;  2ZFW A;  3I54 A;  4I02 A;  5DD8 A;  3KP6 A;  2EV6 A;  2UXX A;  4P55 A;  5L3D A;  5D5V B;  1KU7 A;  3KZZ A;  5D5X B;  4ENJ A;  2VBZ A;  3GX4 X;  1H9T A;  3ZMV A;  5HS7 A;  2KJB A;  4CGZ A;  4Y17 A;  4I0A A;  1DUX C;  1IXC A;  1DPR A;  2EWN A;  4EMS A;  1ZG5 A;  1K78 A;  1ZRD A;  2RV8 A;  2DT5 A;  5TJJ A;  1ZRE A;  3HRM A;  3WG9 A;  1TQP A;  1IF1 A;  1FP2 A;  2M1B A;  3VOD A;  1P2F A;  3MWM A;  1TW2 A;  2VBX A;  3K9T A;  3Q9V A;  2VOD A;  2P5L C;  1YYV A;  4EQQ A;  4HW0 A;  1U5T A;  2W84 A;  3MQ0 A;  1W7P D;  2W57 A;  1BI0 A;  4ZYG A;  2A6H F;  4FX4 A;  3WGG A;  1ZLJ A;  3I58 A;  1B9N A;  2LNB A;  4ESB A;  1T2K A;  1BI3 A;  5HS8 A;  4KIB A;  4M9S A;  1ZGJ A;  4UVB A;  2UXN A;  5J8C A;  4G94 A;  1USS A;  2MC3 A;  3C18 A;  3F6O A;  3FXQ A;  1K6O A;  1BJA A;  2V1D A;  4WXH A;  2BV6 A;  5LEJ A;  2ZNZ A;  3J80 Z;  1SAX A;  2FA5 A;  5HDG A;  1SFX A;  2ZJ2 A;  2NNY A;  3LWF A;  2MLK A;  1XD7 A;  4LK1 F;  3CUQ A;  1BOA A;  1W5S A;  4Q47 A;  4R79 A;  3HSR A;  2OBP A;  2TDX A;  5L3C A;  3V8K A;  5AIP A;  2DK8 A;  1ZAR A;  4G9Y A;  1R23 A;  2DU9 A;  2P5K A;  1FY7 A;  3EYY A;  5DYM A;  3L00 A;  4QLC U;  3V7R A;  1HSJ A;  3R0A A;  3HOS A;  1I1G A;  1WQ2 A;  4YFN F;  2H94 A;  1XN7 A;  3BOQ A;  1ZN2 A;  2QBY A;  3TDU C;  4B09 A;  5L3G A;  2XHK A;  1GVJ A;  5LGN A;  2PLY A;  3I59 B;  1R7J A;  4L0Y B;  1U8R A;  2CQK A;  3JW4 A;  4A12 A;  2W85 A;  2O03 A;  3E6D A;  3QPT A;  3Q9S A;  2PG4 A;  3LQQ A;  2Z3Y A;  4IRI A;  3T8T A;  5F6F A;  4N0B A;  4AD9 A;  1OPC A;  3CO6 C;  3KZY A;  4BHB A;  2GZW A;  1V4R A;  1PUE E;  2E1C A;  3IRR A;  2MH9 A;  5AIQ A;  4MEX F;  1IN4 A;  1F5T A;  2O8X A;  2V79 A;  3BPV A;  4M6X A;  3L09 A;  2VC0 A;  2HFH A;  1K78 B;  1Z91 A;  4KYW A;  4A2U A;  1MDM B;  3B73 A;  3JSP A;  4IHT A;  3F21 A;  2L54 A;  4RGS A;  3RPQ A;  1BM9 A;  2A5Y B;  3DEU A;  1Y0U A;  3RIR A;  1L3L A;  4HDU A;  1R5H A;  1HKQ A;  2MA3 A;  3MCZ A;  3E5X A;  4AIH A;  4IXA A;  1XCV A;  2DW4 A;  1ONV A;  1T98 A;  4EM2 A;  4NHJ A;  2QLZ A;  2WWY A;  3F8F A;  4L9N A;  2VBY A;  2DPU A;  5D6E A;  2JSC A;  4CIC A;  3JTG A;  1P4X A;  1BN5 A;  1I1S A;  5D5W B;  5H6R A;  1ZRF A;  2GXG A;  5FO5 A;  4Y15 A;  3K69 A;  1MD0 A;  5LRR A;  3T8R A;  3K1P A;  4HZF A;  2P6S A;  4LMY A;  3FMQ A;  3M1E A;  4KFC A;  3CUQ B;  5ILU A;  3HHG A;  2H09 A;  2LF7 A;  3ZPL A;  1L0O C;  1JE8 A;  6PAX A;  2RC4 A;  1W7P B;  3KLO A;  3GXO A;  5FD5 A;  3HRT A;  4Y13 A;  5D4S A;  2JRT A;  4UV9 A;  4OOI A;  4MEY F;  4ON0 A;  3F6V A;  3MZH A;  4ETS A;  2H27 A;  1IN7 A;  3MEX A;  4P96 A;  1D8J A;  2QBY B;  4OIR F;  2M87 A;  4WK8 F;  4O5V A;  2G9W A;  4HQM A;  2GA1 A;  3CUQ C;  2LSO A;  3V8J A;  3EQL F;  1FYK A;  4M74 A;  1CGP A;  1TBX A;  5LRS A;  5BS6 A;  1MZB A;  4RB2 C;  1RUO A;  4MNU A;  3SHF A;  1KQ8 A;  3LAP A;  2FOK A;  4K2E A;  1YS7 A;  3K2Z A;  4G7H F;  3BJ6 A;  2W25 A;  3WTU C;  1XCB A;  2EFQ A;  2FQ3 A;  2QZ8 A;  4JBA A;  5LHH A;  3PQJ A;  5D5U B;  3HRU A;  3I64 A;  1J2X A;  4OMZ A;  2V9V A;  2P6T A;  4CO8 A;  1S6L A;  5LGU A;  1U5T C;  3I0T A;  2XRO A;  2DTR A;  4LD5 A;  2R7D A;  5LGT A;  5FLX Z;  3M8E A;  4L9V A;  2XGX A;  2FRH A;  4ZZL A;  3GF2 A;  4OIP F;  1B4A A;  3WTV C;  5E18 F;  4L9T A;  1TW3 A;  3NEU A;  2BGC A;  3E5U A;  3ZN0 A;  5F1R A;  5K5O A;  2BBY A;  2GIV A;  5DD4 A;  3GYH X;  1QPM A;  1E2X A;  2E7X A;  1O3S A;  5CVU A;  4FX0 A;  2VOO A;  2HTJ A;  3Q5F A;  4EJT A;  2VT3 A;  2HYF A;  1S8N A;  1ZG3 A;  1HW2 A;  2A69 F;  3F23 A;  2V6C A;  2PMH A;  1TNS A;  1KU2 A;  1R22 A;  4OMY A;  3ZMT A;  5BMZ A;  1KQ0 A;  3DPT A;  4A0Y A;  4BXU A;  3TO7 A;  1OMI A;  1ZG1 A;  3ZP5 A;  1FBU A;  2DO7 A;  3QP6 A;  2PMU A;  4RGR A;  2D45 A;  2A3S A;  2OZ6 A;  1KGS A;  3RDI A;  4A0X A;  3RJP A;  1TTY A;  1JGS A;  3ML6 A;  4DQ2 A;  2G7H A;  3F22 A;  2FBK A;  1HW5 A;  5CVI A;  2ZKZ A;  2XAS A;  4GXO A;  3J7A O;  2R7F A;  2HR3 A;  2PQ8 A;  3H92 A;  3ZQ7 A;  3ERE D;  3C3W A;  3O6B B;  1RUN A;  1R1U A;  1HBX G;  2DAO A;  4UHT A;  2DBB A;  4BAY A;  1K7A A;  1G3W A;  4LFU A;  3AAF A;  2QUF A;  4R8H A;  3P9C A;  2EV0 A;  1EH8 A;  2ZXJ A;  2CG4 A;  1IUY A;  1UHW A;  3OV8 A;  1IN5 A;  3JSO A;  3BRO A;  4EJV A;  3WE2 A;  3HTS B;  4IVN A;  4F7Z A;  2WTE A;  4NQW A;  1J5Y A;  3D5L A;  2JT1 A;  2GQQ A;  4HF0 A;  5JVT A;  4U7B A;  1IXS B;  5LLQ A;  3HUG A;  4I7H A;  5FLX K;  4WWC A;  1P6R A;  5JHU A;  3CDH A;  3KCC A;  3NQO A;  3HRS A;  3U9G A;  5BPD A;  3WTX C;  4AWX B;  1O7L A;  2Z5U A;  3M7G A;  2GXB A;  3FZV A;  2Y48 A;  4JQF A;  1TQI A;  4ZYE A;  2EFN A;  1XDS A;  3I5U A;  3K1M A;  1YO5 C;  2HEO A;  2E1N A;  1KYZ A;  1EH6 A;  1ZAO A;  1LVA A;  4M9X A;  3TO6 A;  3WTT C;  4Q4Z F;  2ISZ A;  5IT9 K;  1OYW A;  3REO A;  4BH9 A;  5D6F A;  4Q5S F;  4DNC A;  3W6J B;  3VOE A;  2HOE A;  3WTZ A;  5KVR A;  5FFX A;  2A07 F;  2JPC A;  3FMS A;  5DUI A;  1LQ1 A;  1FSE A;  3F8B A;  4ZYD A;  5K5R A;  5JFR A;  2ETH A;  3M9A A;  4EM1 A;  2CW0 F;  3I71 A;  1LEA A;  2YX7 A;  3P7N A;  3GFL A;  4PGG A;  1Q1H A;  2FSW A;  3HOT A;  2FNP A;  2K86 A;  2Z99 A;  4HV5 A;  4L5J A;  3CUO A;  5K1Y A;  4LB5 A;  2Q0O A;  3FHZ A;  2FNA A;  3OOP A;  5DEQ A;  2UZK A;  4RAY A;  1W5T A;  3R60 A;  3L2C A;  3KEO A;  4I09 A;  2DI3 A;  2F5F A;  4ZZD A;  1Z7U A;  1D5V A;  1MKM A;  3F8N A;  5KK1 A;  3HIF A;  5BQT A;  1FYL A;  2ADU A;  1S7A A;  4AVP A;  4ESF A;  2XKO A;  2H6B A;  3E3V A;  1XMK A;  2QYO A;  2ACJ A;  2JZY A;  2BEO A;  1DP7 P;  3DF8 A;  3PQK A;  4B8X A;  1BI2 A;  3CLO A;  3S2W A;  4N9H A;  2CGP A;  2YSR A;  2M8E A;  1Z1D A;  3C1D A;  3SFZ A;  5FD6 A;  2C6Y A;  4YII A;  3DQV C;  1ZYR F;  3U1D A;  2OZU A;  3GLX A;  1MGT A;  2XAF A;  1MJA A;  4I98 B;  3MAJ A;  2L02 A;  2YX4 A;  2QWW A;  2HGC A;  3RYR A;  2D1V A;  4HX8 A;  3GZ5 A;  2DLL A;  4PGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...