4L0ZB

Crystal structure of runx1 and ets1 bound to tcr alpha promoter (crystal form 2)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
101
structure length
101
Chain Sequence
SGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of Ets1 activation by Runx1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 33
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l0zB00
2UWMA 1O57A 3O2PE 1MZBA 4BHCA 2PEXA 4S05A 4I09A 4HF2A 1R23A 3J81Z 3I5UA 5K5QA 1DUXC 4EM0B 3HRSA 2FNPA 1KGSA 2HQNA 2IVMA 4L5IA 3B73A 4O5VA 3RPQA 3KE2A 3EYIA 3COAC 1WRJA 1BJAA 2A07F 2O8XA 2P6TA 1ZRCA 3MAJA 2GAUA 1R58A 2O6GE 1HSJA 1Q1HA 3ZMVA 2HYGD 3KZZA 4ETSA 1Z9CA 1YFHA 5JR3A 3WE3A 1QO0D 3OOPA 1HW5A 3ZMUA 1WI9A 2V79A 3ERED 2FOKA 2W25A 4IPAA 4CHUA 5DUKA 2GQQA 1IF1A 2JPBA 2DPUA 5LRSA 3U9GA 2F5DA 3H92A 4N9HA 2QLZA 3EDPA 4IHTA 3F8NA 1GXPA 1ZLKA 3VFZA 1YS6A 2WTEA 2CSOA 4M71A 3LA2A 1LDDA 2NNYA 2XAHA 4NB5A 4BH9A 5LEJA 4ZYHA 1KU7A 2CYYA 2QBYB 2OAZA 2ADUA 3I59B 3BP8A 2WC2A 1SMTA 5A2QK 2L3DA 2Z33A 3BDDA 5J8FA 4KIFA 2HWVA 1YTYA 3J80K 2GA1A 5IT9Z 2FEZA 1D8KA 4RAYA 1O3RA 4U0VA 2EFWA 3LA3A 4UHTA 2DPDA 3Q5FA 4HA8A 1R1TA 1JGSA 1P4WA 2H94A 1J5YA 1ZAOA 4K2EA 4L18B 2FBIA 3WTXC 5EEHA 4ASNA 4KN7X 1KQ8A 1W7PD 2P6SA 1FSEA 2EV6A 4EJTA 4NHJA 4RAZA 2PLYA 3MFKA 3GW2A 1BIAA 3C3WA 1KQ9A 2RVCA 1IUYA 2DFIA 3FM5A 4A12A 3TO7A 3V7CA 4FHTA 4EGYA 2HGCA 1FZPB 3H3UA 2W85A 3DPLC 1XN7A 3OV8A 4PGHA 1J59A 5E1ZB 2BYVE 4F7ZA 2ACJA 1J2XA 2VC0A 2ZMEB 4EM2A 3V8LA 1LJ9A 4G94A 1T2KA 5HLHA 4LMYA 3KETA 3G73A 1WWXA 4MEYF 5K5RA 2WV0A 5H6RA 2NS0A 5CVJA 4UVCA 2W24A 4G7HF 4IRGA 3TGNA 1MDMA 3U2RA 3L9FA 5HDKA 3O6BB 5ILSA 2YSRA 4CO8A 3BPXA 3RI4A 1G6NA 1AWCA 4WXDA 4XSZF 3V7SA 2GA2A 2VONA 4LK0F 1MKMA 4KT5C 2RQPA 3ABTA 1LDJA 1Z7UA 2W57A 3S2WA 4UVBA 3FF5A 3DP7A 4BXUA 4IHSA 3HSRA 4XLPF 4HV5A 2K86A 3KP5A 4M74A 2OQRA 3D5LA 3IWFA 4PGGA 2XROA 1V3FA 2FSWA 1XGOA 3MZHA 3F8MA 3BJAA 4HDUA 1B9NA 3FX3A 1IRGA 5ERIA 2XUBA 2L4MA 2V9VA 4AWXB 3QRFF 1HKTA 2DAOA 5TRDA 1W7PA 4IF4A 1FBSA 2FA5A 3QU6A 3T8RA 2IJLA 2VC1A 1SFUA 3GVAA 1NHAA 4JK1X 3DEUA 4Q4ZF 3WU0A 5KK1A 1SFEA 2L54A 4A0YA 5BMZA 2XGXA 5FFZA 4ZYEA 4DNCA 4L0YB 2KJBA 3T1BA 4CGZA 2CQKA 3F8CA 2PI0A 2QVOA 2E7WA 3HTUA 4KA4A 2JT1A 4JQFA 2ESHA 5DCMA 3F8FA 4AD9A 3LQQA 1QNTA 3NEUA 3E5XA 4ESFA 1OYYA 4M73A 4E70A 4LB5A 1R22A 4FX0A 4D0PA 4UV8A 5ED4A 1Y0UA 1D5VA 1ZRDA 5D4RA 1HSTA 3KLNA 2GXBA 2EFQA 3PQKA 4CICA 2ZJ2A 4OMYA 3C1DA 2MLGA 2W84A 5HDNA 2L4AA 1TNTA 1I1GA 3O3KA 1PUEE 1F4KA 5LLQA 3FMRA 1BN5A 2MLKA 1H0MA 4CZZA 4EGZA 4OIOF 4U0WA 4BHBA 2EV0A 5D8KB 2QQAA 1FWZA 2VN2A 5FFXA 3ZN1A 4KFCA 1XMAA 1C0WA 1B6AA 3CUOA 4YIFA 3GX4X 4GO1A 1QBJA 4LJZF 1SD5A 1BC7C 2H09A 5CYVA 1S8NA 4L9JA 1K7AA 1FY7A 3ELKA 4FT8A 2LKPA 2D45A 4YFNF 3IHUA 4RGRA 1TBXA 5ILUA 4IRIA 4ENMA 4P96A 3ROUA 5FB2A 1IAWA 3RKXA 3LSTA 3VODA 2FQ3A 3E6DA 4M9SA 4WCGA 2QWWA 5BS6A 2RN7A 2O3FA 3HUGA 3RYRA 2EB7A 1ZYRF 2MC3A 1IW7F 1REPC 1RIOH 4OIRF 2ISYA 2D2WA 2X0LA 2VBWA 3G3ZA 3T0YA 5ICFA 2IW5A 3HOSA 3JSPA 5CVVA 3SZTA 2VODA 3EQLF 2OZUA 2PMHA 3F6OA 4HX4A 4HYEA 1ZHFA 1FYMA 1S7OA 2Q8KA 1U5TC 4MQ9F 1I6XA 1USTA 1YLFA 4PDKA 5HS8A 2Z99A 1FT9A 1PDNC 4P9FA 1U2WA 3EETA 2HS5A 2G9WA 1HBXG 2IA0A 5LHIA 2IT0A 2H27A 1ZARA 2K27A 5LBQA 1E2XA 2P5KA 1KQ0A 2XAGA 3I4PA 2EJRA 2QYOA 4M9XA 1LNWA 3GEZA 4A2UA 4GYGA 5E20A 3AAFA 1GVJA 4U0YA 5BPIA 2Y75A 5J8CA 5D5VB 2DI3A 3GZ5A 3FXRA 4Y17A 3I64A 2VBZA 4IVNA 3HHGA 1Z05A 4LLNA 1USSA 5DCMB 4EM1A 3E5QA 4CYDA 3TKYA 1UHMA 1G4DA 1OYWA 3DQVC 3QOPA 1FLIA 5BQTA 4LLLA 1B4AA 2V6CA 1HKQA 2QBYA 1ZN2A 2IP2A 4L5JA 1IN7A 2FMYA 1R5HA 4O3MA 4MNUA 4L9TA 1I1SA 2KKOA 3MWMA 2EV5A 2XKOA 3IC7A 4I0AA 2LNBA 2XVCA 3GFIA 2J5PA 4BHPA 2CO5A 3C18A 1FNNA 4HAMA 5D6EA 1IZ1A 1XSVA 2GWRA 1BI1A 2FMLA 1UFMA 2EK5A 4RS8A 1FPQA 1IXRC 4ENKA 3QU3A 2M30A 3IRRA 2L01A 1HW1A 5D4SA 6PAXA 2EWNA 3RJPA 1OMIA 1FC3A 2IRFG 1BIBA 3FMSA 3JW4A 4FX4A 2K4BA 1B9MA 3VB2A 3M7GA 4PZJA 1H9TA 2VT3A 3DPTA 2BEOA 3F23A 5DD8A 2OQGA 3I58A 1Z91A 1K78A 2R7DA 5CVRA 3ZMZA 5AIPA 3I71A 1R00A 4L0ZB 2P4WA 3L00A 1MGTA 1JHHA 2E1NA 4A0XA 5JI6A 5CVIA 2VOOA 2DT5A 3KP4A 5A2QZ 4G7ZF 4OOIA 2Y0MA 2XAFA 4M6XA 3CO6C 1LVAA 1J7KA 3KLOA 1XGMA 1MD0A 2RGVA 2F5FA 3BY6A 3RIRA 1XCVA 5D6FA 5LHGA 1W5TA 4WWCA 5ICCA 5E17F 2DTRA 2XASA 1OPCA 3KP7A 4TV7A 3BJOA 3MCZA 2JZYA 2XAQA 2O0YA 3K0LA 3Q9SA 2CG4A 2XV4S 3WGIA 4I2OA 2YX4A 2EA2A 5CVUA 4Z2YA 1OR7A 2FXAA 3LQRA 4G7OF 4HF0A 4MGRA 4PCQA 2QM3A 1LB2A 2LF7A 4IXAA 1YW8A 3RPUA 3P9IA 2DU9A 4UVAA 5HLGA 2RDPA 2DLLA 1T0FA 1W7PB 2STWA 1UHWA 1RI7A 2J5OA 1A04A 2PFBA 1D3YA 1YW9A 3HRMA 3WTWC 5J6XA 1SMYF 1BOAA 1FP2A 3SZPA 3HSFA 3SFZA 3I54A 5HS9A 3KZYA 1I27A 4RB2C 2PBIA 3J7AO 3CJNA 4A5MA 2FBKA 1YG2A 3M1EA 4LB6B 2IPQX 4WX9A 2ETHA 1BM9A 4KN4X 3T8TA 3ZPLA 4QWQA 2Y48A 1LDKB 1STZA 1JE8A 2FRHA 5ICGA 1GHCA 4HX7A 5JFRA 5LRRA 2ZNYA 3U1DA 2R3SA 5ILVA 2E7XA 5E1WA 3KP6A 2UZKA 4EVIA 1P4AA 2M87A 2LF8A 4DQ2A 2EFPA 1DPRA 5JVTA 2A3SA 3CUQB 5L3CA 4HOBA 1XGSA 2M8EA 5L3EA 4P55A 3R6SA 1E17A 3P9KA 2FNAA 2YU3A 4P5OA 3ULQB 4WF2A 3WG9A 1B59A 3K2ZA 2YR2A 3KFWX 1R5GA 1ZG1A 4RB0A 1FBUA 1WSUA 4EJOA 4WK8F 1LQ1A 3FHZA 3WTUC 2JTVA 1KU2A 2UXXA 1TLHB 3F3XA 4UXNA 1JHFA 3K1MA 3WGGA 5DYMA 2NRAC 4YFXF 3SHFA 4OMZA 1OYIA 1LEBA 4R79A 2V1UA 2K4JA 4AVPA 1T38A 5H6QA 4ENNA 2QENA 5IT3A 1BI2A 1O3QA 3BROA 2XKPA 2KJCA 4EJVA 3SQNA 4LGWA 1XDUA 2FBHA 4YG2F 1QQIA 3ECHA 4EQQA 1ON2A 1MDMB 1O3SA 1SAXA 3IL2A 4RB1A 4I0BA 3ZMDA 1T98A 1TTYA 5LHHA 2QZ8A 2EFOA 2HKOA 1ONVA 3TDUC 3TOAA 3WTYC 4XBFA 1QGPA 1U78A 2G7UA 5LGUA 4MTDA 1HXDA 3BOQA 3HRTA 1IN4A 3BZ6A 2NNNA 2A6HF 3L2CA 1O7FA 1J0RA 1K6OA 1YS7A 1YW7A 3E97A 4HLXA 4KUMA 4ON0A 3GXOA 4OIQF 4P9UA 4I98B 4EV0A 1HQCA 1XGNA 3CLOA 2PG4A 4U7DA 3GFJA 3GF2A 2PN6A 1CF7A 1ZRFA 1KYWA 1FOKA 3T5XA 5E18F 4CXFA 1B1BA 2A61A 1BI0A 3QAHA 4HV6A 1O3TA 4EJWA 5F1RA 5K1YA 2P7CB 1YIOA 2BV6A 3NQOA 1RNLA 1K79A 2P7VB 2QQBA 1QZYA 3TQNA 1SD7A 2V1XA 3QP5A 5DDGA 4EJUA 3J80Z 1MJBA 3M8FA 2MBFA 3E3VA 2ZBKA 4HLYA 1L0OC 3CUQC 2F5EA 3ZP5A 4I01A 5FLXZ 2P8TA 3CUQA 3R4KA 2OZ6A 1RUNA 1VTNC 1T39A 1KYZA 1XD7A 4HX8A 4XRFA 5D5XB 2O03A 4G6QA 3GZ6A 1MJ9A 2L02A 1FX7A 1SFXA 2ZMEA 4L9NA 4RGSA 3MZYA 1ODDA 3GFLA 1FP1D 3WE2A 2EFNA 3QPHA 5D5WB 1KU3A 4ENJA 5FO5A 1KU9A 2DQRA 2OA4A 2BBYA 2K02A 2EA4A 3CO7C 4A0ZA 2HFHA 3DF8A 3L7WA 2F2EA 2A68F 1EH6A 1QPMA 2A6EF 4XSXF 1JXSA 4AIKA 1R1UA 1D8JA 1IN6A 2Q0OA 3ZN0A 1T6SA 3FM3A 3IKVA 1ZH5A 2LSOA 2XAJA 3P9CA 4A5NA 3ISPA 2D1VA 5L3BA 3HIFA 3JTHA 1G3YA 4I02A 4ESJA 3GWZA 4MHGA 2YPRA 1IN5A 1YQAA 4QLCU 5LGTA 2RKHA 2VBXA 2STTA 3MEXA 1ZGJA 2GXGA 3L09A 1BBYA 3BJ6A 3R0AA 2CWEA 1IXSB 1ZREA 4HZFA 5L3GA 3M9AA 1HW2A 3WTZA 3MQ0A 3V4GA 2CW0F 4RB3C 2ELHA 4YIIA 2CGPA 3GLXA 1IN8A 2VE9A 3D0SA 1U8RA 2K7LA 3V8KA 4Q48A 5FD5A 3PFIA 3LA7A 2HTSA 2BGCA 4IRHA 5L3FA 1ZG3A 4UV9A 1ON1A 2ISZA 4MQVA 4UNOA 5KVRA 2HYFA 2ZCWA 4I7HA 3E6MA 2XRNA 3Q9VA 3GFMA 3W6JB 3W6KB 2H6BA 5DEQA 5LEKA 2YX7A 4NQWA 2MH9A 1F1ZA 1WKMA 3ZMSA 3B02A 3FMQA 1XB4A 5HVQC 3R60A 5L3DA 3WTSC 1AOYA 1HKSA 1W4MA 4BNCA 2DO7A 2ZKZA 2R7FA 1V4RA 1O7LA 2FF4A 3ZMTA 3GO5A 3C7JA 4LG0B 3RTRA 5TJJA 4A6EA 4B09A 3WTTC 4RGUA 1TW3A 3ECOA 2DW4A 3HYIA 3WGHA 1YYVA 4AIJA 3RYPA 4GGGA 3LAPA 5HLIA 5ICEA 1WQ2A 2RC4A 1P2FA 4GYIA 4Q47A 2IA2A 1G3SA 4HF1A 3LFKA 2ZNZA 2ZXJA 4IJAA 3I53A 5E8GA 4UUVA 3KP3A 4ESBA 3ABUA 1DP7P 4LG0A 3K9TA 1R1VA 2ESNA 5IT9K 2HOEA 2HKXA 2KIMA 1K78B 1L3LA 2KRFA 1BC8C 5D8LB 4R8HA 1ZG5A 2OD5A 4HW0A 5E1XA 3REOA 1TQMA 4N0BA 3DXJF 1U5TA 2DQLA 3HOTA 3PQJA 4KIGA 5LGNA 4B8XA 2NAZA 4WXHA 2GZWA 4ZYGA 4YFKF 1XSXA 1H9GA 2WWYA 4M6YA 2PQ8A 5DD4A 4OINF 4ZYDA 2OU2A 5HS7A 1U6GA 2F5CA 1OKRA 1F9NA 2KIUA 5F6FA 1X3UA 3IWZA 4O6JA 5AIQA 1RZ4A 4GCVA 3VEPA 3KEOA 2FE3A 3J81K 1RUOA 3R0JA 4XLNF 3K1NA 1Z6TA 1W5SA 2MA3A 2O61A 2M5WA 1U3EM 2AS5F 1ZLJA 2MD5A 3GUDA 1U5TB 5BOXA 1SD4A 2VOPA 4G6DA 1QZZA 2COMA 5HDGA 4ZZDA 1FYLA 4R1HA 2UXNA 1TW2A 3IKTA 1BI3A 2VT2A 4Y13A 1ZGAA 4BYYA 5JHUA 1UB9A 1R36A 3E6CC 4MEXF 5H20A 2XIGA 3QPTA 4KDPA 3LWFA 5F64A 3TO9A 2OBPA 3TDZC 4N9IA 4BQAA 5DV5A 5EEGA 2JRTA 3IRQA 3CTAA 1KA8A 1F5TA 3HRUA 4U7BA 3VOEA 3F72A 2AXLA 2E1CA 1G3TA 2HR3A 1S6LA 5AONA 5CLSA 3DKWA 4JBAA 3FZVA 5HOOA 2HDCA 4OIPF 1FYKA 2ZFWA 3EYYA 3BPVA 3H3ZA 4KICA 4U88A 4WXCA 3BWGA 2HEOA 2IA1A 5FD6A 1S7AA 4LFUA 2HTJA 3DV8A 3QP6A 3TO6A 4KMUX 2DK8A 4G9YA 1XDSA 2DBBA 4ZZLA 2X4HA 1PP7U 3HHHA 3V8JA 3V7RA 3R61A 1SD6A 1J9IA 2DK5A 1P6RA 2MH2A 1G3WA 1P4XA 2V1DA 3RKWA 5FLXK 3JAMZ 4LK1F 1CF7B 2TDXA 1LEAA 3HTSB 2ZO4A 2D1HA 4EMSA 4BAYA 3F6VA 4L9VA 5BPDA 5FGMA 4HDVA 3E6BA 1EV7A 2JSCA 4Q5SF 2PJPA 2P5LC 3ML6A 3WTVC 2GIVA 2Z9OA 3KP2A 2P5VA 3M8EA 3GYHX 1TQPA 4KIBA 5E8IA 3N4MA 2Z3YA 1FSHA 4H0EA 2B0LA 2XHKA 1FBQA 4CDGA 3WU1B 2G7HA 3SXYA 4ZH4F 1UCRA 2VXZA 1GXQA 1R7JA 1S3JA 1MJAA 3K69A 3JTGA 2QUFA 2VBYA 3TOBA 2RNJA 4RGXA 3NRVA 4Y15A 2CFXA 2QQ9A 4HBLA 3F8BA 3P7NA 4HQMA 4M9ZA 3I59A 1IRFA 3KCCA 3E5UA 3HSEA 4KMFA 1S29A 2HZTA 4S04A 3EUHA 1PP8F 1DPUA 4M72A 4MTEA 4KNYA 2Z5UA 3KEQA 5K5OA 1ULYA 3CDHA 1XMKA 3ZQ7A 2M45A 2KIFA 3F21A 3K1PA 3DFGA 4LLGF 4HQEA 5DCFA 1TNSA 3JSOA 1XSDA 1XCBA 4A6DA 1CGPA 4OU0A 2BE5F 1DDNA 1I5ZA 3F22A 2RV8A 2HQRA 2LDUA 1Z1DA 2H6CA 1TQIA 2C6YA 3I0TA 1IXCA 4AIHA 1EH7A 2A5YB 3RDIA 3FXUA 1J75A 4LD5A 2M1BA 3N97A 2JPCA 4G8XA 1Z6RA 2PMUA 2NYXA 1YO5C 5DUIA 2A69F 2FU4A 5CJ9A 4GXOA 1P92A 3FXQA 3JAMK 5D5UB 4KYWA 2VE8A 3RKYA 1EH8A 3WODF 3LAJA 3FWEA 2Q2EA
chains in the Genus database with same CATH superfamily
3WHCA 3RSNA 2UWMA 1O57A 3O2PE 1MZBA 4B1RA 4BHCA 2PEXA 4S05A 4I09A 4HF2A 2D5VA 3S2DJ 1FEXA 1R23A 4FETA 3J81Z 3I5UA 5K5QA 3JREA 1V54H 1DUXC 1SVOA 4EM0B 4JP0A 4P1WA 1IDYA 3HRSA 2FNPA 2KPMA 1KGSA 3GCMA 4XKBA 5E3MA 2HPMA 2HQNA 3DBLB 2IVMA 4L5IA 3B73A 4O5VA 1IUFA 2M3AA 3RPQA 4BJ6C 3I4NJ 1LKXA 2Y0SA 3KE2A 3EYIA 3COAC 4V2GA 1E3OC 1X4PA 1UELB 1ETVA 1WRJA 1BJAA 2A07F 2O8XA 2L9VA 2Y30A 2P6TA 1ZRCA 3MAJA 4FE4A 1LPQA 2GAUA 3ZQIA 3J7YJ 3HOVJ 1R58A 2O6GE 1HSJA 1Q1HA 2OV7A 2HYGD 2I5UA 1YX5A 3KZZA 3OIQA 3ABLH 3ZMVA 3S17J 2LKSA 4ETSA 1Z9CA 1G8XA 5JR3A 3DWLE 2NOJB 1YFHA 3PM1A 1JUSA 1QO0D 3OOPA 3W2WA 3WE3A 2KISA 1HW5A 2HZDA 3ZMUA 1WI9A 3V42A 2V79A 3IH3A 2DYRH 4N4NB 3ERED 2QKMB 1D0ZA 3OYEA 1VQOI 1M1EB 2FOKA 2W25A 2PX9A 4IPAA 4CHUA 1U9NA 3SEQA 3FBIB 5DUKA 1LFPA 2GQQA 1TWGJ 3HC7A 5FKLA 2DFFA 3A4CA 1IF1A 3OL3A 3OL4A 4BEHB 2JPBA 2DPUA 5LRSA 2DOAA 4BU2A 5KCMA 3U9GA 2F5DA 3BG6A 3H92A 4II3A 4N9HA 4CUGA 2E2IJ 4BXFA 2QLZA 1D1CA 3EDPA 4IHTA 2ZB9A 3F8NA 1GXPA 1ZLKA 2YU9J 4FCYA 1ZK8A 3VFZA 1P9QC 1YS6A 4J00A 2VJJA 3OIOA 3S16J 2DT6A 2L0KA 2WTEA 2CSOA 4M71A 3LA2A 3ZR8X 4NDLA 1LDDA 2NNYA 2XAHA 4NB5A 3VYRB 4BH9A 5LEJA 2XC7A 4ZYHA 1EJ9A 2PMZA 1KU7A 2CYYA 4BBRJ 3SDGA 2QF7A 2QBYB 4LIVA 2OAZA 2ADUA 3I59B 2R5YB 3BP8A 2XSDC 2CV0A 2QQ8A 2WC2A 1SMTA 3B6CA 3H5AA 1OCCH 5A2QK 2L3DA 2Z33A 3SEZA 3BDDA 3OYNA 3QYBA 2HOSA 5J8FA 1VNDA 4KIFA 2WY8Q 2E5NA 2HWVA 1QHHD 1YTYA 3J80K 3TMOA 2FQ4A 2GA1A 5IT9Z 2F4MB 1D8KA 2FEZA 4RAYA 5GADJ 1O3RA 2EZHA 2XSJC 4U0VA 2EFWA 2K3PA 5J1YA 3LA3A 2RNGA 4UHTA 2DPDA 2XGDA 4MO7A 3VYUB 3Q5FA 2DFHA 4NNJA 5GPAA 4HA8A 4FQGA 4IOAF 2KLOA 1R1TA 4U87A 1JGSA 5EJCA 1P4WA 3Q0VA 4Y52J 2H94A 2DTZA 1J5YA 1ZAOA 4K2EA 3BR0A 2LVSA 4L18B 2FBIA 3WTXC 4BBSJ 1GDTA 1ZTRA 5EEHA 4ASNA 4KN7X 3BTJA 1DU0A 1KQ8A 2CV1A 2VPLA 2R7WA 2ECBA 2MC4A 4M3GA 1W7PD 2P6SA 1FSEA 2BVMA 2EV6A 4ZC3A 4EJTA 4FASD 2R5ZA 4XONA 4IQ4A 3AG1H 4LIUA 2EBIA 4RAZA 2PLYA 4NHJA 3A2KA 3K4NA 3MFKA 3OYBA 1P7JA 3GW2A 2LD5A 1BIAA 3HOWJ 2LR8A 3C3WA 1KQ9A 2RVCA 1IUYA 2DFIA 3CCYA 3FM5A 4A12A 3TO7A 4XORA 3V7CA 4FHTA 4EGYA 2HGCA 1FZPB 5B66C 2MD0A 3H3UA 1A31A 1ZQ3P 4ZJZA 2W85A 3DPLC 1MNEA 1XN7A 3OV8A 2K9QA 4PGHA 4XOTA 1J59A 5E1ZB 2BYVE 4F7ZA 2ACJA 3CCUI 1J2XA 3BZCA 2VC0A 1W1WE 2L7ZA 2B7EA 2ZMEB 4EM2A 3HDDA 3V8LA 1LJ9A 4G94A 1Z3XA 1YIJI 3KEYA 4PJJA 2O9LA 1T2KA 1F36A 2E34A 1FOYA 4BQOA 2CU7A 3HZJA 3BTCA 5HLHA 1JT0A 3I9V2 1YE9A 4LMYA 5C4XJ 3KETA 4BS9A 2HVSA 3G73A 1WWXA 4MEYF 2A6TA 4Y33A 5K5RA 4D7NA 2WV0A 5H6RA 2NS0A 5CVJA 4UVCA 2W24A 4G7HF 2JQ7A 4IRGA 3TGNA 1MDMA 3U2RA 3OYFA 4XKWA 1N75A 3L9FA 2XRLA 5HDKA 3O6BB 5ILSA 2YSRA 4CO8A 1B8IB 3D1NI 3BPXA 4KT6A 3RI4A 3OWTA 1G6NA 1AWCA 2EIMH 1QU3A 4KJZA 1OLTA 4WXDA 3FKIJ 4XSZF 1U8BA 2JMWA 2Q1ZB 3V7SA 3HL2A 2GA2A 2VONA 2HI3A 1MKMA 4LK0F 4KT5C 3JRAA 2RQPA 3ABTA 3L1PA 3Q0WA 1LDJA 1VQ9I 1Z7UA 2K85A 2W57A 2HOAA 3GTKJ 1ETYA 3S2WA 4UVBA 5GTHC 3FF5A 4UUTA 2DMQA 3DP7A 4BXUA 3S1NJ 2DA6A 4IHSA 2UUZA 1X2MA 1X2NA 3HSRA 3PUFA 4XLAA 4BGDA 4XLPF 4HV5A 5GAEJ 2K86A 4AUXA 3KP5A 4M74A 1R4NB 3DBHB 4W1UA 3PIPF 2OQRA 3D5LA 3HKZN 2R4GA 3IWFA 4BQNA 2F6CA 3CMMA 4PGGA 1ITYA 2XROA 1V3FA 2FSWA 1FOWA 1XGOA 3ZQQA 3MZHA 3F8MA 3BJAA 5IYDJ 4HDUA 1GV2A 1B9NA 2IGMA 3FX3A 1IRGA 2R7VA 5ERIA 3ZQLA 1JKQC 4ITVA 2XUBA 2L4MA 2V9VA 4BE0A 4AWXB 3QRFF 1HKTA 2DAOA 2QA4I 2EZKA 1QA6A 3CC2I 5TRDA 1W7PA 4IF4A 1FBSA 2FA5A 3QU6A 3T8RA 2IJLA 2VC1A 1SFUA 3GVAA 1NHAA 4JK1X 3DEUA 3VPRA 4Q4ZF 3CCSI 3WU0A 3G4SI 3OYIA 5KK1A 3VDXA 1Z0XA 1SFEA 2L54A 3PUBA 4A0YA 5HLTA 5BMZA 2XGXA 5FFZA 2CMPA 3CMAI 4ZYEA 4DNCA 4L0YB 3UNGC 1PYVA 2KJBA 3OSGA 3T1BA 2XGCA 4CGZA 2CQKA 3F8CA 4J19A 2PI0A 2QVOA 2E7WA 3D5SC 4GFBA 1VQ7I 2BZTA 3HTUA 4KA4A 1D5YA 2JT1A 1YRNB 1OCPA 4JQFA 2ESHA 3BG3A 2NVXJ 5DCMA 5IP6A 2JA8J 1MBKA 1MH3A 3F8FA 4IZZA 2LY2A 1ENHA 4AD9A 5F27A 3LQQA 1B72A 3AG2H 1QNTA 1LFBA 3NEUA 2BHYA 3E5XA 3G1OA 4DYQA 4ESFA 1OYYA 2PMZN 4M73A 4E4HA 3CJRB 3M3YJ 5EDNA 4XNFA 4E70A 4LB5A 1R22A 5FKKA 4FX0A 4D0PA 4UV8A 3S1MJ 5BNGA 5ED4A 4B48A 1ZR2A 1Y0UA 3O8HA 1R49A 1MBJA 1D5VA 1ZRDA 5D4RA 1HSTA 1W0TA 3KLNA 2GXBA 2EFQA 3PQKA 4CICA 2ZJ2A 4OMYA 1RPWA 3C1DA 2VQLA 4ZDPA 2MLGA 1IDZA 3F0CA 1TL8A 2W84A 4Y3OA 3JCUC 3OMYA 5HDNA 1VQ4I 4A3IJ 3HBLA 1AHDP 2L4AA 1TWHJ 1TNTA 1K6YA 3BT9A 4AM3A 1I1GA 3O3KA 1PUEE 1F4KA 4QIWN 5LLQA 2CUJA 4F91B 3FMRA 2Y9YA 1BN5A 2NXNB 2MLKA 2MG4A 3VSLA 1H0MA 3G6EI 2DXIA 2VPRA 1JT6A 3CP2A 2R7XA 1H89C 4CZZA 4EGZA 4OIOF 4U0WA 3AKZA 2LKXA 2KMUA 4BHBA 2EV0A 5D8KB 1BL0A 2VB6A 4HSTA 2GLOA 2BY1A 3LSMA 2QQAA 2HQ5A 1FWZA 4MFDA 2VN2A 2X6XA 5FFXA 1WCMJ 3ZN1A 4KFCA 4C30A 1XMAA 1C0WA 1B6AA 2W48A 3CUOA 4YIFA 3GX4X 5KAIC 4GO1A 1QBJA 4LJZF 1SD5A 2H09A 2VQCA 4B4CA 2EZLA 5CYVA 1JKOC 1BC7C 1S8NA 4DGWB 3JRHA 4L9JA 3FXLA 1K7AA 1MMAA 2PJRB 2IS1A 4XL9A 1FY7A 3ELKA 5K7FA 4FT8A 2LKPA 2D45A 4XRMA 5IOZA 4AYBA 3A01A 4YFNF 3BC8A 3IHUA 4II2A 4RGRA 1RKWA 5FKOA 5GAHJ 3DBRB 2JJ7A 4BEHA 1TBXA 5ILUA 4IRIA 2L9SA 4ENMA 4P96A 3M07A 3ROUA 5J4YA 5FB2A 1IAWA 2O7OA 2FD5A 3RKXA 3H0DA 3LSTA 3AG3H 3VODA 2FQ3A 2XF6A 3E6DA 4M9SA 4WCGA 2QWWA 3FIWA 5BS6A 2RN7A 2O3FA 3HUGA 3RYRA 1UJ8A 1JKPC 2EB7A 3KZIC 1ZYRF 1Y0NA 2MC3A 1IW7F 4C3IJ 1REPC 1RIOH 1VQ5I 2EPFA 2ECCA 2BW3A 1BW5A 1ZGWA 1RESA 5FKNA 4OIRF 4X0GA 3K70C 2ISYA 5DS9A 2D2WA 4BE1A 2X0LA 5M3FJ 4B44A 2CUZA 2VBWA 2VI6A 4XKCA 3G3ZA 3T0YA 2OJED 5ICFA 2IW5A 1Y56A 2O8KA 3HOSA 3JSPA 2H1KA 4RAGA 5CVVA 3SZTA 2WAQN 2KL4A 1Y1WJ 2VODA 2E1MC 1N77A 2M0CA 3EQLF 4EEFG 2M9HA 1W36D 4C2UA 3W3CA 3MKWB 3HB9A 3EUHC 2OZUA 2PMHA 3F6OA 4HX4A 1QVUA 4HYEA 2GOXB 1ZHFA 2Z16A 1FYMA 1S7OA 1D1BA 4UUSA 2Y31A 2Q8KA 4PFPA 1U5TC 4MQ9F 1TC3C 1I6XA 1PUFB 3MZ8A 1MSFC 1USTA 1YLFA 4PDKA 5HS8A 2Z99A 2YS9A 3BQYA 1FT9A 3ZQCA 1PDNC 4P9FA 1U2WA 3EETA 2IAIA 2HS5A 1YJWI 3L2QA 2G9WA 1HBXG 2DT7B 3E7LA 2JSPA 4YEJA 5K7ZA 2IA0A 5EYRA 1VQ6I 1FTZA 5LHIA 2R92J 1QHGA 2IT0A 2H27A 1ZARA 2K27A 5LBQA 4AIDA 1TWCJ 2AQFA 2Y2ZA 4BDYA 1E2XA 2P5KA 2P81A 4E7ZA 1KQ0A 2XAGA 3I4PA 4A3CJ 2V4JC 4BDZA 4J01A 2HNHA 1OFCX 2EJRA 3HPHA 1OCTC 4KISA 1Z3YA 2QYOA 4M9XA 1LNWA 3GEZA 4A2UA 4GYGA 3MD2A 5E20A 3ZQHA 3AAFA 1WGXA 1GVJA 3H5NA 2XF7A 4U0YA 5BPIA 1A6QA 3DKXA 2KRHA 2Y75A 2OCCH 5J8CA 5D5VB 2DI3A 3GZ5A 3FXRA 4Y17A 3HEFA 3I64A 3TW6A 2VBZA 4IVNA 1T56A 4CCNA 3S3MA 3WHBA 4MFEA 3HHGA 3TP3A 1Z05A 1XMXA 2MYSA 2K9MA 4LLNA 1X1AA 1K61A 5FLVA 1O4XA 1USSA 1IO2A 2CUFA 5DCMB 4EM1A 1FOXA 3E5QA 3H5RA 4CYDA 1VFCA 3RZOJ 1ERDA 4ZDOA 3TKYA 5GPCA 1UHMA 3HGYA 1G4DA 1OYWA 2ME6A 1WPKA 1Z21A 3DQVC 3QOPA 1FLIA 3DU6A 2E2JJ 5BQTA 4LLLA 1APLC 3BG5A 1B4AA 2V6CA 2DMPA 1IC8A 1MIJA 1HKQA 5EG0A 2QBYA 1ZN2A 2IP2A 5J40A 3P5JA 4PSWA 4Y4RA 3M4OJ 1LFUP 4L5JA 3QYEA 3OYCA 3HKZA 2JA2A 4M3FA 1IN7A 1WI3A 4A3JJ 2FMYA 1R5HA 3FISA 4D5FA 4MNUA 4O3MA 3U1KA 2LH9A 4RA2A 4L9TA 3N05A 1I1SA 5CQEA 2KKOA 3MWMA 4E7LA 2EV5A 2KQRA 2XKOA 3BCAA 3IC7A 4I0AA 2LNBA 2XVCA 4RMNA 3DEEA 2VQHA 3GFIA 2J5PA 2ME0A 1UMQA 4BHPA 3OYHA 5H2FC 2CO5A 1X4OA 1LUJB 3C18A 1FNNA 3K4CA 2IS4A 1DQUA 4HAMA 4H4KC 3Q3SA 5D6EA 2KDOA 1EKEA 3K4MA 1IZ1A 1XSVA 4XOPA 5KNLA 2GWRA 3BG7A 2LTPA 4IOCF 2DCEA 1AU7A 5CKTA 1BOBA 2HXOA 2CS3A 3LL7A 2CRGA 1BI1A 4F55A 1UFMA 2FMLA 1HDPA 4GDFA 2EK5A 3CF2A 4RS8A 1FPQA 2UV1A 2VXDA 5EGOB 1IXRC 2M4GA 4BY1J 4ENKA 3QU3A 1RKTA 2L9RA 1HOMA 2M30A 2N8GA 3IRRA 1ETQA 2V6EA 1IRXA 3PNYA 2L7MP 3TL4X 2L7KA 2L01A 1HW1A 5D4SA 2AXTC 2LYCA 3AL0C 4B47A 6PAXA 1QVTA 2EWNA 4E6KG 3K4BA 3LFUA 3S1QJ 4IL6C 1OMIA 3RJPA 3JR9A 2CFOA 1FC3A 3FMSA 1BIBA 3SJMA 3JW4A 4FX4A 1BR1A 2IRFG 2K4BA 3PO3J 2WV1A 1B9MA 3HM5A 3VB2A 3M7GA 4PZJA 1H9TA 2VT3A 3DPTA 2BEOA 2M4KA 1NTCA 3BR1A 3F23A 3L2WA 5DD8A 2B9SA 4X6AJ 1T08B 5F1JA 4DYRA 2ELJA 4OAYA 2BOLA 2OQGA 3I58A 4BKXA 3MVPA 9ANTA 3A0BC 4PJMA 1Z91A 1K78A 1RR8C 2W4SA 2R7DA 5CVRA 3ZMZA 2IGNA 1JJ6C 3LSHA 5F0FA 3U21A 5AIPA 2DYSH 3I71A 2R93J 1R00A 2M8GX 4L0ZB 3BCBA 4EATA 2P4WA 2LG4A 4PJNA 3L00A 1MGTA 1JHHA 2IS6A 2E1NA 4A0XA 4A3BJ 1ZELA 5JI6A 5CVIA 1U9OA 2DT5A 2VOOA 3KP4A 5A2QZ 4G7ZF 4OOIA 1ETOA 2Y0MA 4PUSA 2XAFA 4M6XA 2FJ1A 2CQQA 3CO6C 5EGOA 1LVAA 1J7KA 3KIOA 1N78A 3KLOA 1XGMA 1MD0A 3K6GA 2RGVA 4XN0A 2F5FA 1WH5A 3BY6A 3RIRA 2VASA 1XCVA 2JUCA 4M3EA 1VF9A 5D6FA 3C2BA 2BY3A 5LHGA 1W5TA 4WWCA 1LE8A 2LY9A 2ID6A 5ICCA 5DM6F 5E17F 2BXZA 2H8WA 1XG1A 2DTRA 4YELA 2XASA 3RKQA 1OPCA 3KP7A 2OPTA 1HF0A 3G1MA 4TV7A 3ABMH 3BJOA 1WJCA 2JUGA 3MCZA 4B43A 4N4OB 2JZYA 4OWRB 2XAQA 2O0YA 3K0LA 3Q9SA 2CG4A 1YJNI 1TZLA 1NH3A 2XV4S 2R7ZJ 3WGIA 4I2OA 2YX4A 4KITB 4XKVA 2R7QA 3BZKA 2EA2A 3A02A 4E7SA 5E3OA 5CVUA 4Z2YA 1OR7A 2FXAA 3LQRA 4NC7A 1B8IA 4G7OF 2NVQJ 2Z2SB 4HF0A 5C3EJ 4MGRA 3JRGA 4PCQA 3GTPJ 2IXSA 2QM3A 2LLKA 2E5ZA 1MNMC 1LB2A 2LF7A 4IXAA 5B3SH 1YW8A 2EZIA 3PJRA 1X3ZB 2XB5A 3RPUA 3P9IA 2IS2A 2DU9A 4UVAA 5HLGA 5EF6A 1V5EA 2RDPA 1MBFA 1NK2P 4NBQA 2DLLA 3RZDJ 3HXLA 2ICWG 1T0FA 1YX3A 2W00A 3C2HA 2E1MB 1W7PB 2STWA 1UHWA 1YOVB 2WADA 1RI7A 2WB1A 3S3NA 2OTJI 2E36A 4E7IA 3A01B 1HDDC 2J5OA 2VKVA 4I76A 1A04A 4JYKA 2PFBA 1D3YA 1YW9A 3HRMA 5B1BH 3WTWC 1N25A 5J6XA 1SMYF 1BOAA 1S9HA 1FP2A 2F4OB 3SZPA 3HSFA 2L2OA 4ZYAA 3SFZA 3QOEA 3I54A 5HS9A 5J3LA 2OTLI 3KZYA 3S2HJ 3NWTA 2MW8A 2VJIA 1HC8A 2EH3A 1I27A 4RB2C 2WAQA 2PBIA 3J7AO 3W6VA 3CJNA 3OYAA 4A5MA 4AU7A 2FBKA 5J1UA 4HRIA 1YG2A 3M1EA 4LB6B 2IPQX 4WX9A 2ETHA 3E1SA 3L2VA 1SVLA 1BM9A 3BTLA 4KN4X 4MLOA 4QPQA 2V9PA 4LITA 3T8TA 3MKZA 3ZPLA 2DN0A 4QWQA 4XLFA 2Y48A 2R5ZB 1LDKB 1STZA 2MABA 2P0WA 3H36A 3S32A 3H9GA 5F04A 2XDVA 2JWTA 2NS7A 3FXOA 1JE8A 1J09A 2FRHA 5ICGA 1GHCA 1B72B 4HX7A 5E79C 5JFRA 5LRRA 2ZNYA 3U1DA 2X48A 4QSHA 5FLMJ 2R3SA 5ILVA 2E7XA 5E1WA 5KAFC 3KP6A 2UZKA 3HOZJ 4EVIA 1P4AA 2M87A 2LF8A 2NVTJ 4DQ2A 4ANJA 2EFPA 5J1RA 3OYDA 4XLEA 1DPRA 5JVTA 3ASNH 2A3SA 3CUQB 5L3CA 4HOBA 1XGSA 2RREA 5IP9J 2M8EA 3K70D 3RQ4A 4F92B 2LFBA 2CW8A 2XPWA 5L3EA 2QEXI 4P55A 3R6SA 1E17A 1Z7LA 2YUSA 2DOFA 3P9KA 3PNTA 3RPUD 1HLVA 2FNAA 2YU3A 5B1AH 3J7AY 2HVRA 4P5OA 3ULQB 3A1YA 1JKRC 2QGUA 4WF2A 3WG9A 1B59A 3K2ZA 2YR2A 4A3FJ 3KFWX 2XF5A 1R5GA 1ZG1A 2BXYA 4RB0A 1FBUA 1WSUA 4EJOA 4WK8F 1WJFA 1LQ1A 5M3MJ 4UB8C 3FHZA 3WTUC 2JTVA 3ZOBA 1KU2A 2UXXA 1TLHB 2HPIA 2NVUB 3F3XA 2WAFA 2VKDA 2QCOA 3QYFA 4UXNA 3TBIA 3LMMA 1JHFA 3K1MA 3ZRGA 5EG0B 3WGGA 2MSYA 5DYMA 5KHDA 2NRAC 4YFXF 3SHFA 3W2VA 1SVMA 4OMZA 1JGGA 5HNFA 1OYIA 1NG7A 1LEBA 4IHYA 4R79A 1IRZA 3DTIA 4BE2A 2V1UA 2K4JA 1GLNA 4CCJA 4AVPA 1X1DA 1T38A 3HOUJ 5H6QA 4ENNA 2K3FA 2M34A 2QENA 2I10A 1VQ8I 5IT3A 1Z67A 1BI2A 1O3QA 4I99C 3WG7H 2JN6A 3G2BA 3BROA 1E0EA 1UG2A 1BJZA 2XKPA 2KJCA 1I50J 1RRJA 4EJVA 2AHQA 5M5YJ 1I39A 2NOGA 3SQNA 3LSJA 4LGWA 3S93A 1XPXA 1XDUA 2MFZA 2FBHA 4YG2F 3BQZA 1QQIA 3ECHA 4EQQA 1ON2A 2HVQA 1ETWA 1O3SA 4BJ5C 1MDMB 2JVGA 2XB0X 3IL2A 2ZJQF 4RB1A 1SAXA 2RQQA 4I0BA 3ZMDA 1T98A 1TTYA 2K9NA 4IHWA 5LHHA 2QZ8A 3BR2A 3BR5A 2EFOA 3DKYA 2HKOA 5DTDA 3X2QH 1ONVA 2ZXWH 3TDUC 3TOAA 2E19A 5CQGA 1DGRM 4G12A 5JVGF 4A3GJ 3OS1A 3WTYC 4XBFA 1QGPA 1U78A 4DIQA 1JTXA 1JTYA 2DA5A 2E60A 2G7UA 5LGUA 2CV2A 2JA7J 1JUMA 2DMNA 5IY5H 3OOUA 4MTDA 1HXDA 2WY7Q 3RCOA 1FMVA 3BOQA 4XLCA 1DP3A 3C2GA 4CH7A 5K7HA 3HRTA 5E3NA 1IN4A 3QPSA 1A5JA 3BZ6A 2NNNA 2A6HF 4HPQA 4C9YA 2FOWA 3L2CA 2HU9A 1O7FA 2ZSHB 3KPHA 3FDYA 4IO9F 2F48A 1J0RA 1K6OA 2VQGA 4XR6A 1YS7A 3ABKH 4ABZA 1YW7A 3E97A 4HLXA 2LMDA 4UUSB 3UR3C 4F93B 4V2FA 4KUMA 4ON0A 1S7EA 3GXOA 4OIQF 2KZVA 3CCEI 2HYJA 1MBEA 3ASOH 1WJ5A 2JRMA 4P9UA 4I98B 1SEUA 4EV0A 5FJ8J 3H3VK 2W7NA 1HQCA 1OR7C 1XGNA 4L5EA 2VJ4A 2X51A 5C4JJ 1MBHA 3CLOA 3LSGA 4A3LJ 4PK4A 1OCRH 2PG4A 5E3LA 3FHNA 1JJ8C 2GIZA 4U7DA 3GFJA 2IEKA 3GF2A 2PN6A 3O8GA 2R7UA 2KFDA 1ZR4A 1CF7A 2R7OA 2LK2A 4C3JJ 3OY9A 1ZRFA 3FBNB 1KYWA 1FOKA 1T33A 3A03A 3T5XA 2ZXIA 1YITI 5E18F 4CXFA 3OYGA 1AA7A 3ZXSA 1B1BA 3AG4H 3IP4B 1XC5A 2A61A 1BI0A 2ZXHA 5M5XJ 3QAHA 3FXKA 4HV6A 3CMEI 1DGWY 5TISC 3PIOF 1O3TA 4EJWA 5F1RA 2ELKA 1FJLA 5K1YA 2P7CB 1YIOA 3CESA 3A0HC 2BV6A 3JRIA 2LREA 3CLQA 2K9LA 3NQOA 3I4MJ 4AC0A 1RNLA 1K79A 1SFKA 3H9QA 4YRVA 3J7ZI 2P7VB 4XM3A 2QQBA 4AYBN 3H1CA 2E2HJ 1QZYA 3TQNA 1SD7A 2XGEA 2XAUA 2V1XA 3QP5A 2X1EA 5DDGA 1GT0C 4EJUA 3J80Z 1D0XA 1MJBA 3M8FA 2MBFA 4NC6A 3E3VA 1IGNA 1WFXA 2A05A 2DFEA 2ZBKA 4HLYA 1Q1VA 1L0OC 3GTOJ 3CUQC 1OQYA 2X6WA 2F5EA 1WJDA 3ZP5A 3M1CA 1OCZH 2LY1A 4I01A 1YRNA 3K7AJ 3GLLA 5FLXZ 2P8TA 3Q0UA 3CUQA 3HOXJ 3R4KA 3VYSB 2OZ6A 1RUNA 1G59A 1VTNC 1T39A 1KYZA 2IGOA 2CQXA 1XD7A 4HG2A 4HX8A 4IKFA 4XRFA 5D5XB 5M5WJ 3PSFA 4Z6YA 1KONA 2VKHA 2O03A 4G6QA 4DZJA 3GZ6A 2H8RA 1MJ9A 2NS8A 2R7TA 3EUAA 4PSXA 2V26A 4DJAA 4CYCB 2L02A 4E7JA 1FX7A 2JK3A 1SFXA 2ZMEA 4L9NA 1WJBA 3CF5F 4RGSA 4IHXA 2IBDA 3MZYA 4DOZA 1ODDA 3GFLA 1FP1D 5JHFA 3WE2A 5B5EC 2EFNA 3SFIA 3QPHA 4PJLA 3LSRA 2Y9ZA 3GBGA 1K4TA 5D5WB 3AL0B 1KU3A 4ENJA 2LP0A 3S14J 3NARA 5FO5A 1KU9A 2DQRA 1V55H 2HQAA 1H88C 2OA4A 2BBYA 2DA7A 2ID3A 2K02A 3MMYB 3OYJA 2DMUA 2EA4A 3OS0A 2WBMA 3CO7C 3CCJI 4A0ZA 1JUPA 1IG7A 4A3KJ 2HFHA 4DYCA 1R6RA 3DF8A 1X1BA 2LRDA 3L7WA 2F2EA 3FXJA 2A68F 3LSIA 4XN3A 3IV5A 1EH6A 1QPMA 3GZNB 3ERMA 2L9NA 2DA4A 3JRFA 3K4LA 3LSKA 2A6EF 4XSXF 1JXSA 4AIKA 4DW6A 1R1UA 1D8JA 1IN6A 2Q0OA 3PNVA 2CW7A 3ZN0A 1T6SA 1EA3A 5EZGA 3I3LA 3FM3A 2EIJH 1UAAA 1P7IA 3IKVA 1ZH5A 5DM7F 3DTKA 1AKHB 3H9JA 2LSOA 2XAJA 4C3HJ 2R0QC 3P9CA 4A5NA 1ORKA 4BY7J 3ISPA 2D1VA 5L3BA 1VI0A 2OCEA 3D5RC 2V9KA 3HIFA 5EEAA 1VQNI 5IOYA 3JTHA 1G3YA 4I02A 1WJAA 3KYCB 4ESJA 2Q2EB 3GWZA 2YPRA 4MHGA 2HOTA 1IN5A 1YQAA 4QLCU 5LGTA 2X1CA 2KRCA 1RR7A 2RKHA 2VBXA 1V5GA 3GTLJ 4FTHA 2STTA 2L7FP 5IP7J 3OS2A 3MEXA 2KHMA 1ZGJA 2GXGA 3L09A 4V19K 1BBYA 3BJ6A 3R0AA 5J47A 2CWEA 1K4SA 1X3WB 4YIRX 2FUG2 2Y0SN 1IXSB 2DA2A 4HZFA 1ZREA 2A5WA 5L3GA 3M9AA 1HW2A 1E3PA 1WJEA 3AFHA 3WTZA 2M0MA 3MQ0A 3V4GA 2CW0F 4A93J 4RB3C 2M7AA 1OJLA 2ELHA 4YIIA 5HODA 5F08A 3GLXA 2CGPA 3GTQJ 2BHZA 1IN8A 2VE9A 1MBGA 1DU6A 2WA0A 3D0SA 1U8RA 1YI2I 1OISA 2QSHX 2K7LA 3V8KA 3BTIA 3KX2A 2GBYA 4IEJA 4I6ZA 4Y7NJ 1Z77A 4Q48A 5FD5A 2DDBA 3BR3A 3PFIA 4XMYA 3LA7A 2HTSA 2V7FA 1A6IA 2EQRA 3CC7I 2BGCA 2K5CA 4IRHA 5FRMA 5L3FA 3DLLF 1SFOJ 1ZG3A 4UV9A 1ON1A 3CQZJ 2ISZA 4MQVA 4CA0A 3LNQA 4UNOA 1NK3P 5KVRA 1GUUA 4RBOA 2VLAA 2ZJRF 4NC8A 2HYFA 2QSFX 1XX5A 2ZCWA 4I7HA 4ZDLA 3E6MA 5IYCJ 2K40A 3TP0A 2XRNA 3Q9VA 1ETXA 3GFMA 3W6JB 3W6KB 5C44J 2H6BA 1VQLI 2HDDA 5DEQA 5LEKA 2YX7A 4F52A 1XTAA 4NQWA 2MH9A 1F1ZA 1WKMA 3ZMSA 2AO9A 3B02A 3K2AA 3FMQA 3KYDB 3ZQFA 1XB4A 3SDBA 3S8PA 1Y39A 5HVQC 4HNTA 3LOCA 2DA3A 3R60A 5L3DA 3WTSC 1AOYA 1HKSA 1W4MA 4BNCA 2NVYJ 4PJ0C 3CCRI 3CZ6A 2E1OA 1ETKA 2DO7A 2ZKZA 2R7FA 1V4RA 1O7LA 2FF4A 3ZMTA 3DTEA 1QZEA 3OR1C 3PSIA 3GO5A 3C7JA 1PVEA 1TWAJ 3RTRA 4LG0B 5TJJA 3NAUA 4A6EA 4B09A 5HNHA 3WTTC 3IAM2 4A3MJ 2LOOA 4RGUA 1TW3A 4OAZA 3OYMA 3QQAA 3ZQGA 3ECOA 2DW4A 3HYIA 3WGHA 3GTJJ 1YYVA 4AIJA 3RYPA 4IHVA 4GGGA 4HNUA 5HLIA 3LAPA 3CDLA 2CUEA 5ICEA 1WQ2A 2RC4A 1P2FA 4XLHA 1S5LC 4GYIA 4Q47A 1JI8A 2IA2A 1G3SA 1W0UA 2VUMJ 4HF1A 3LFKA 2ZNZA 1LVKA 2ZXJA 4IJAA 3I53A 5E8GA 5FROA 4UUVA 3KP3A 4ESBA 5GAGJ 3ABUA 2TRTA 1DP7P 2DJIA 4RAFA 4LG0A 3K9TA 1R1VA 1XS9A 1G2HA 3ZGKA 3CCQI 5FKMA 1IJWC 2ESNA 3EUKL 5IT9K 2CQ7A 2HDWA 2R7SA 2HOEA 4CCKA 1R4MB 1IV6A 2HKXA 2KIMA 4XQFA 4CZCA 1K78B 1L3LA 2GOMA 1SAUA 2KRFA 3G1LA 2GM4A 4CCMA 1BC8C 5D8LB 4R8HA 3G71I 2R5YA 1ZG5A 2OD5A 4HW0A 4LG3A 1Y1VJ 1MMDA 1A35A 3CDIA 1R5ID 5E1XA 1I6HJ 1YJ9I 3REOA 3HJEA 5JLWA 1FMWA 1TQMA 4N0BA 3S3OA 1WZ2A 3DXJF 1W36C 4M6VA 1U5TA 1QRYA 2AQEA 3CJQB 2DQLA 3HOTA 5CPRB 3PQJA 1SANA 3K4JA 3QWLA 1X1PA 4KIGA 5LGNA 2EINH 4B8XA 3TEDA 2NAZA 4WXHA 2M2EA 2GZWA 4ZYGA 5EZHA 4GRIA 3CD6I 4YFKF 3CJTB 1E3HA 1XSXA 1H9GA 2WWYA 4M6YA 3CCVI 5FRNA 2PQ8A 3OYKA 5DD4A 4XRSA 4OINF 2EIKH 4ZYDA 1WHUA 2OU2A 4W97A 3MKYB 4JX6A 5HS7A 1U6GA 2Y69H 2F5CA 1OKRA 4X1EA 3SZGA 2JVHA 1F9NA 1T95A 3WU2C 1BR4A 2KIUA 5F6FA 3ONQA 1MNDA 4M3DA 1X3UA 3IWZA 1TWFJ 1Y8QB 4O6JA 1BR2A 2LC2A 5AIQA 4LOCA 2M7BA 1RZ4A 4GCVA 3VEPA 3KEOA 2FE3A 4E7HA 3J81K 1RUOA 4MIMA 3RQIA 3R0JA 4XLNF 3K1NA 4IX7A 1Z6TA 4B3XA 1W5SA 2KIQA 2MA3A 2O61A 1IV8A 2M5WA 1U3EM 2AS5F 4NUBA 1K83J 3PFYA 1ZLJA 1X1CA 1I3AA 2MD5A 2XPUA 3GUDA 1U5TB 5BOXA 1SD4A 4D9JA 2VOPA 1RC9A 4G6DA 1QZZA 2COMA 5HDGA 4ZZDA 1FYLA 2BVLA 2L5QA 2UXNA 4R1HA 1TW2A 4AVZA 4DBRA 3I55I 3EPZA 3IKTA 3HG9A 3BG9A 1BI3A 1FIPA 2VT2A 2X85A 4Y13A 1ZGAA 4BYYA 4RM2A 3B6AA 1CQTA 2E71A 1TT5B 5JHUA 1UB9A 4DZPA 3FKJA 3IH2A 1WVRA 1R36A 3E6CC 4C2MJ 4MEXF 4E7KA 2WAEA 5H20A 2XIGA 2V1NA 4A3DJ 1T0FC 3JRBA 4FE7A 3QPTA 4D7MA 1Y6IA 1F43A 3CCLI 3JRCA 1FTTA 5GP9A 3LWFA 5F64A 4KDPA 5GTIC 3TO9A 2KDZA 2OBPA 3TDZC 4N9IA 3JRDA 4BQAA 1V5FA 5DV5A 2O5RA 5EEGA 3KYLA 2JRTA 3IRQA 4ZTFA 4JX4A 3CTAA 1KA8A 2BY0A 4M3BA 1F5TA 3HRUA 3CP8A 5JLXA 4U7BA 4UB6C 3W2AA 3VOEA 3F72A 2AXLA 2Z1DA 2R7RA 2E1CA 2QSGX 3ESWB 1G3TA 2BW3B 2HR3A 1S6LA 5AONA 5CLSA 3DKWA 4JBAA 1EF4A 3FZVA 2BY2A 1HA8A 5HOOA 3DCFA 2HDCA 4OIPF 1FYKA 4C2TA 2ZFWA 1UHSA 2EILH 3FXMA 2IGKA 3H0GJ 1PJRA 4RM3A 3EYYA 4PFOA 3BPVA 3OSFA 3H3ZA 3L2UA 3IH4A 3HPGA 4ZTJA 4RLQA 3GTMJ 2ZSIB 4KICA 2LBFA 3QODA 3F9KA 4U88A 4WXCA 3BWGA 2HEOA 2IA1A 3I56I 3MN2A 5FD6A 5IPAA 1S7AA 4JX5A 4LFUA 1ZKGA 3HGGA 3DEWA 3L2RA 1LE8B 2HTJA 2DOEA 3DV8A 3QP6A 3TO6A 4CCLA 1PUFA 3FK6A 1D0YA 2TCTA 4KMUX 3NWSA 2DA1A 1A36A 3S1RJ 2DK8A 4G9YA 4DBQA 1MW7A 4BUPA 1XDSA 2DBBA 4ZZLA 2X4HA 1PP7U 3HHHA 3V8JA 1I3QJ 3V7RA 3R61A 3CMYA 1SD6A 1J9IA 2DK5A 1GV5A 3HUGB 2VJ5A 4G6TB 4XIDA 1P6RA 2MH2A 1G3WA 1P4XA 2V1DA 3RKWA 1R71A 5FLXK 2LBFB 2KZGA 3FK7A 2CH0A 4A69C 3JAMZ 2W82A 3DPUA 1VQKI 4LK1F 4CCOA 2TDXA 1CF7B 1LEAA 3HTSB 2ZO4A 4D5CA 1VZ0A 2D1HA 2DJNA 4EMSA 2X6YA 4QTRA 3GMEA 2RAEA 4XRSG 4BAYA 2DDAA 3F6VA 4XICA 3K10A 4L9VA 5BPDA 2VIXA 5FGMA 4HDVA 5F0HA 4BQQA 2KP6A 3MKLA 3E6BA 2ZMEC 4CSWA 1EV7A 3HOYJ 3CC4I 1UZCA 4RLFA 2JSCA 1KZHA 4Q5SF 1HCRA 2PJPA 2P5LC 3VWBA 3ML6A 3WTVC 1ACIA 4UY8I 2GIVA 2Z9OA 3KP2A 1D1AA 2P5VA 4BL0B 3M8EA 3LSPA 3GYHX 4IQJA 2X9DA 1TQPA 4KIBA 5E8IA 4NQWB 4D1QA 3N4MA 2Z3YA 1FSHA 2W1OA 2G0EA 2B0LA 4H0EA 2XHKA 4BJTA 1FBQA 1X58A 1MMGA 3K4KA 4CDGA 3WU1B 2G7HA 4CYCA 3SXYA 1T8IA 1AKHA 4ZH4F 4JOMA 1RETA 1UCRA 2VXZA 1GXQA 1R7JA 3PO2J 1S3JA 1MJAA 3K69A 3GTGJ 3JTGA 2QUFA 2VBYA 3TOBA 2F4IA 1R9TJ 1SC7A 2RNJA 4HEA2 3E0JB 3NRVA 2OF7A 4RGXA 4Y15A 2ZFUA 2CFXA 2QQ9A 1U0JA 4HBLA 3SYTA 1QPIA 3DU5A 3F8BA 1MMNA 3P7NA 4HQMA 2OC6A 3I59A 4M9ZA 1IRFA 3KCCA 4BXXJ 2HXIA 4A3EJ 3E5UA 1POGA 2CQNA 3HSEA 4KMFA 4HNVA 1UG0A 1TP4A 4BACA 1S29A 2HZTA 4S04A 3EUHA 1PP8F 2FX0A 4XK4A 3ZCOA 2VL8A 2ZJPF 1DPUA 4M72A 4MTEA 1FIAA 4FISA 1YHQI 5LFAA 4KNYA 2Z5UA 3KEQA 1X19A 5K5OA 1ULYA 1H8AC 1MH4A 2MGQA 3CDHA 1XMKA 2PJRA 3ZQ7A 2M45A 2KIFA 3F21A 3K1PA 2JA5J 2WB1N 2COBA 3DFGA 4LLGF 4HQEA 5DCFA 1TNSA 3JSOA 1XSDA 2F5VA 1GVDA 2CJJA 1XCBA 2VKEA 2DODA 4A6DA 1MSEC 2JA6J 2E35A 4F3QA 3UKGA 1CGPA 4OU0A 2GXAA 3TW7A 1TT0A 2BE5F 2ZC2A 1DDNA 1I5ZA 1WH7A 3OYLA 3F22A 2RV8A 2HQRA 2QKLB 4B3AA 2LDUA 4HSRA 2K9SA 1Z1DA 2H6CA 2XPVA 1TQIA 5TGTA 1BA5A 5J4VA 2C6YA 3BLYA 3I0TA 2OUMA 3M8JA 1IXCA 4AIHA 2KT0A 1EH7A 2A5YB 3PL8A 1NG6A 3RDIA 3CCMI 5LD2C 2X6OA 3DLAA 3BR6A 3IUOA 3FXUA 1S72I 1J75A 4LD5A 3VSKA 2M1BA 3N97A 3VYTB 2JPCA 2I8DA 4G8XA 4RDUA 1Z6RA 1VQPI 3H35A 2PMUA 1VQMI 2NYXA 4S0HB 2H1LA 1YO5C 1OCOH 2DMTA 5DUIA 2A69F 2FU4A 5CJ9A 3OR2C 4QPOA 1BW6A 4GXOA 5F0CA 1MMSA 1P92A 3FXQA 1W5CC 3OIPA 3JAMK 5D5UB 4KYWA 2B63J 1Y8RB 2VE8A 2X1DA 3RKYA 1EH8A 3WODF 3LAJA 3FWEA 3IAS2 5IYBJ 3S15J 3QPLA 2Q2EA
chains in the Genus database with same CATH topology
2UWMA 1O57A 3O2PE 1MZBA 4BHCA 2PEXA 4S05A 4I09A 4HF2A 1R23A 3J81Z 3I5UA 5K5QA 1DUXC 4EM0B 3HRSA 2FNPA 1KGSA 2HQNA 2IVMA 4L5IA 3B73A 4O5VA 3RPQA 3KE2A 3EYIA 3COAC 1WRJA 1BJAA 2A07F 2O8XA 2P6TA 1ZRCA 3MAJA 2GAUA 1R58A 2O6GE 1HSJA 1Q1HA 3ZMVA 2HYGD 3KZZA 4ETSA 1Z9CA 1YFHA 5JR3A 3WE3A 1QO0D 3OOPA 1HW5A 3ZMUA 1WI9A 2V79A 3ERED 2FOKA 2W25A 4IPAA 4CHUA 5DUKA 2GQQA 1IF1A 2JPBA 2DPUA 5LRSA 3U9GA 2F5DA 3H92A 4N9HA 2QLZA 3EDPA 4IHTA 3F8NA 1GXPA 1ZLKA 3VFZA 1YS6A 2WTEA 2CSOA 4M71A 3LA2A 1LDDA 2NNYA 2XAHA 4NB5A 4BH9A 5LEJA 4ZYHA 1KU7A 2CYYA 2QBYB 2OAZA 2ADUA 3I59B 3BP8A 2WC2A 1SMTA 5A2QK 2L3DA 2Z33A 3BDDA 5J8FA 4KIFA 2HWVA 1YTYA 3J80K 2GA1A 5IT9Z 2FEZA 1D8KA 4RAYA 1O3RA 4U0VA 2EFWA 3LA3A 4UHTA 2DPDA 3Q5FA 4HA8A 1R1TA 1JGSA 1P4WA 2H94A 1J5YA 1ZAOA 4K2EA 4L18B 2FBIA 3WTXC 5EEHA 4ASNA 4KN7X 1KQ8A 1W7PD 2P6SA 1FSEA 2EV6A 4EJTA 4NHJA 4RAZA 2PLYA 3MFKA 3GW2A 1BIAA 3C3WA 1KQ9A 2RVCA 1IUYA 2DFIA 3FM5A 4A12A 3TO7A 3V7CA 4FHTA 4EGYA 2HGCA 1FZPB 3H3UA 2W85A 3DPLC 1XN7A 3OV8A 4PGHA 1J59A 5E1ZB 2BYVE 4F7ZA 2ACJA 1J2XA 2VC0A 2ZMEB 4EM2A 3V8LA 1LJ9A 4G94A 1T2KA 5HLHA 4LMYA 3KETA 3G73A 1WWXA 4MEYF 5K5RA 2WV0A 5H6RA 2NS0A 5CVJA 4UVCA 2W24A 4G7HF 4IRGA 3TGNA 1MDMA 3U2RA 3L9FA 5HDKA 3O6BB 5ILSA 2YSRA 4CO8A 3BPXA 3RI4A 1G6NA 1AWCA 4WXDA 4XSZF 3V7SA 2GA2A 2VONA 4LK0F 1MKMA 4KT5C 2RQPA 3ABTA 1LDJA 1Z7UA 2W57A 3S2WA 4UVBA 3FF5A 3DP7A 4BXUA 4IHSA 3HSRA 4XLPF 4HV5A 2K86A 3KP5A 4M74A 2OQRA 3D5LA 3IWFA 4PGGA 2XROA 1V3FA 2FSWA 1XGOA 3MZHA 3F8MA 3BJAA 4HDUA 1B9NA 3FX3A 1IRGA 5ERIA 2XUBA 2L4MA 2V9VA 4AWXB 3QRFF 1HKTA 2DAOA 5TRDA 1W7PA 4IF4A 1FBSA 2FA5A 3QU6A 3T8RA 2IJLA 2VC1A 1SFUA 3GVAA 1NHAA 4JK1X 3DEUA 4Q4ZF 3WU0A 5KK1A 1SFEA 2L54A 4A0YA 5BMZA 2XGXA 5FFZA 4ZYEA 4DNCA 4L0YB 2KJBA 3T1BA 4CGZA 2CQKA 3F8CA 2PI0A 2QVOA 2E7WA 3HTUA 4KA4A 2JT1A 4JQFA 2ESHA 5DCMA 3F8FA 4AD9A 3LQQA 1QNTA 3NEUA 3E5XA 4ESFA 1OYYA 4M73A 4E70A 4LB5A 1R22A 4FX0A 4D0PA 4UV8A 5ED4A 1Y0UA 1D5VA 1ZRDA 5D4RA 1HSTA 3KLNA 2GXBA 2EFQA 3PQKA 4CICA 2ZJ2A 4OMYA 3C1DA 2MLGA 2W84A 5HDNA 2L4AA 1TNTA 1I1GA 3O3KA 1PUEE 1F4KA 5LLQA 3FMRA 1BN5A 2MLKA 1H0MA 4CZZA 4EGZA 4OIOF 4U0WA 4BHBA 2EV0A 5D8KB 2QQAA 1FWZA 2VN2A 5FFXA 3ZN1A 4KFCA 1XMAA 1C0WA 1B6AA 3CUOA 4YIFA 3GX4X 4GO1A 1QBJA 4LJZF 1SD5A 1BC7C 2H09A 5CYVA 1S8NA 4L9JA 1K7AA 1FY7A 3ELKA 4FT8A 2LKPA 2D45A 4YFNF 3IHUA 4RGRA 1TBXA 5ILUA 4IRIA 4ENMA 4P96A 3ROUA 5FB2A 1IAWA 3RKXA 3LSTA 3VODA 2FQ3A 3E6DA 4M9SA 4WCGA 2QWWA 5BS6A 2RN7A 2O3FA 3HUGA 3RYRA 2EB7A 1ZYRF 2MC3A 1IW7F 1REPC 1RIOH 4OIRF 2ISYA 2D2WA 2X0LA 2VBWA 3G3ZA 3T0YA 5ICFA 2IW5A 3HOSA 3JSPA 5CVVA 3SZTA 2VODA 3EQLF 2OZUA 2PMHA 3F6OA 4HX4A 4HYEA 1ZHFA 1FYMA 1S7OA 2Q8KA 1U5TC 4MQ9F 1I6XA 1USTA 1YLFA 4PDKA 5HS8A 2Z99A 1FT9A 1PDNC 4P9FA 1U2WA 3EETA 2HS5A 2G9WA 1HBXG 2IA0A 5LHIA 2IT0A 2H27A 1ZARA 2K27A 5LBQA 1E2XA 2P5KA 1KQ0A 2XAGA 3I4PA 2EJRA 2QYOA 4M9XA 1LNWA 3GEZA 4A2UA 4GYGA 5E20A 3AAFA 1GVJA 4U0YA 5BPIA 2Y75A 5J8CA 5D5VB 2DI3A 3GZ5A 3FXRA 4Y17A 3I64A 2VBZA 4IVNA 3HHGA 1Z05A 4LLNA 1USSA 5DCMB 4EM1A 3E5QA 4CYDA 3TKYA 1UHMA 1G4DA 1OYWA 3DQVC 3QOPA 1FLIA 5BQTA 4LLLA 1B4AA 2V6CA 1HKQA 2QBYA 1ZN2A 2IP2A 4L5JA 1IN7A 2FMYA 1R5HA 4O3MA 4MNUA 4L9TA 1I1SA 2KKOA 3MWMA 2EV5A 2XKOA 3IC7A 4I0AA 2LNBA 2XVCA 3GFIA 2J5PA 4BHPA 2CO5A 3C18A 1FNNA 4HAMA 5D6EA 1IZ1A 1XSVA 2GWRA 1BI1A 2FMLA 1UFMA 2EK5A 4RS8A 1FPQA 1IXRC 4ENKA 3QU3A 2M30A 3IRRA 2L01A 1HW1A 5D4SA 6PAXA 2EWNA 3RJPA 1OMIA 1FC3A 2IRFG 1BIBA 3FMSA 3JW4A 4FX4A 2K4BA 1B9MA 3VB2A 3M7GA 4PZJA 1H9TA 2VT3A 3DPTA 2BEOA 3F23A 5DD8A 2OQGA 3I58A 1Z91A 1K78A 2R7DA 5CVRA 3ZMZA 5AIPA 3I71A 1R00A 4L0ZB 2P4WA 3L00A 1MGTA 1JHHA 2E1NA 4A0XA 5JI6A 5CVIA 2VOOA 2DT5A 3KP4A 5A2QZ 4G7ZF 4OOIA 2Y0MA 2XAFA 4M6XA 3CO6C 1LVAA 1J7KA 3KLOA 1XGMA 1MD0A 2RGVA 2F5FA 3BY6A 3RIRA 1XCVA 5D6FA 5LHGA 1W5TA 4WWCA 5ICCA 5E17F 2DTRA 2XASA 1OPCA 3KP7A 4TV7A 3BJOA 3MCZA 2JZYA 2XAQA 2O0YA 3K0LA 3Q9SA 2CG4A 2XV4S 3WGIA 4I2OA 2YX4A 2EA2A 5CVUA 4Z2YA 1OR7A 2FXAA 3LQRA 4G7OF 4HF0A 4MGRA 4PCQA 2QM3A 1LB2A 2LF7A 4IXAA 1YW8A 3RPUA 3P9IA 2DU9A 4UVAA 5HLGA 2RDPA 2DLLA 1T0FA 1W7PB 2STWA 1UHWA 1RI7A 2J5OA 1A04A 2PFBA 1D3YA 1YW9A 3HRMA 3WTWC 5J6XA 1SMYF 1BOAA 1FP2A 3SZPA 3HSFA 3SFZA 3I54A 5HS9A 3KZYA 1I27A 4RB2C 2PBIA 3J7AO 3CJNA 4A5MA 2FBKA 1YG2A 3M1EA 4LB6B 2IPQX 4WX9A 2ETHA 1BM9A 4KN4X 3T8TA 3ZPLA 4QWQA 2Y48A 1LDKB 1STZA 1JE8A 2FRHA 5ICGA 1GHCA 4HX7A 5JFRA 5LRRA 2ZNYA 3U1DA 2R3SA 5ILVA 2E7XA 5E1WA 3KP6A 2UZKA 4EVIA 1P4AA 2M87A 2LF8A 4DQ2A 2EFPA 1DPRA 5JVTA 2A3SA 3CUQB 5L3CA 4HOBA 1XGSA 2M8EA 5L3EA 4P55A 3R6SA 1E17A 3P9KA 2FNAA 2YU3A 4P5OA 3ULQB 4WF2A 3WG9A 1B59A 3K2ZA 2YR2A 3KFWX 1R5GA 1ZG1A 4RB0A 1FBUA 1WSUA 4EJOA 4WK8F 1LQ1A 3FHZA 3WTUC 2JTVA 1KU2A 2UXXA 1TLHB 3F3XA 4UXNA 1JHFA 3K1MA 3WGGA 5DYMA 2NRAC 4YFXF 3SHFA 4OMZA 1OYIA 1LEBA 4R79A 2V1UA 2K4JA 4AVPA 1T38A 5H6QA 4ENNA 2QENA 5IT3A 1BI2A 1O3QA 3BROA 2XKPA 2KJCA 4EJVA 3SQNA 4LGWA 1XDUA 2FBHA 4YG2F 1QQIA 3ECHA 4EQQA 1ON2A 1MDMB 1O3SA 1SAXA 3IL2A 4RB1A 4I0BA 3ZMDA 1T98A 1TTYA 5LHHA 2QZ8A 2EFOA 2HKOA 1ONVA 3TDUC 3TOAA 3WTYC 4XBFA 1QGPA 1U78A 2G7UA 5LGUA 4MTDA 1HXDA 3BOQA 3HRTA 1IN4A 3BZ6A 2NNNA 2A6HF 3L2CA 1O7FA 1J0RA 1K6OA 1YS7A 1YW7A 3E97A 4HLXA 4KUMA 4ON0A 3GXOA 4OIQF 4P9UA 4I98B 4EV0A 1HQCA 1XGNA 3CLOA 2PG4A 4U7DA 3GFJA 3GF2A 2PN6A 1CF7A 1ZRFA 1KYWA 1FOKA 3T5XA 5E18F 4CXFA 1B1BA 2A61A 1BI0A 3QAHA 4HV6A 1O3TA 4EJWA 5F1RA 5K1YA 2P7CB 1YIOA 2BV6A 3NQOA 1RNLA 1K79A 2P7VB 2QQBA 1QZYA 3TQNA 1SD7A 2V1XA 3QP5A 5DDGA 4EJUA 3J80Z 1MJBA 3M8FA 2MBFA 3E3VA 2ZBKA 4HLYA 1L0OC 3CUQC 2F5EA 3ZP5A 4I01A 5FLXZ 2P8TA 3CUQA 3R4KA 2OZ6A 1RUNA 1VTNC 1T39A 1KYZA 1XD7A 4HX8A 4XRFA 5D5XB 2O03A 4G6QA 3GZ6A 1MJ9A 2L02A 1FX7A 1SFXA 2ZMEA 4L9NA 4RGSA 3MZYA 1ODDA 3GFLA 1FP1D 3WE2A 2EFNA 3QPHA 5D5WB 1KU3A 4ENJA 5FO5A 1KU9A 2DQRA 2OA4A 2BBYA 2K02A 2EA4A 3CO7C 4A0ZA 2HFHA 3DF8A 3L7WA 2F2EA 2A68F 1EH6A 1QPMA 2A6EF 4XSXF 1JXSA 4AIKA 1R1UA 1D8JA 1IN6A 2Q0OA 3ZN0A 1T6SA 3FM3A 3IKVA 1ZH5A 2LSOA 2XAJA 3P9CA 4A5NA 3ISPA 2D1VA 5L3BA 3HIFA 3JTHA 1G3YA 4I02A 4ESJA 3GWZA 4MHGA 2YPRA 1IN5A 1YQAA 4QLCU 5LGTA 2RKHA 2VBXA 2STTA 3MEXA 1ZGJA 2GXGA 3L09A 1BBYA 3BJ6A 3R0AA 2CWEA 1IXSB 1ZREA 4HZFA 5L3GA 3M9AA 1HW2A 3WTZA 3MQ0A 3V4GA 2CW0F 4RB3C 2ELHA 4YIIA 2CGPA 3GLXA 1IN8A 2VE9A 3D0SA 1U8RA 2K7LA 3V8KA 4Q48A 5FD5A 3PFIA 3LA7A 2HTSA 2BGCA 4IRHA 5L3FA 1ZG3A 4UV9A 1ON1A 2ISZA 4MQVA 4UNOA 5KVRA 2HYFA 2ZCWA 4I7HA 3E6MA 2XRNA 3Q9VA 3GFMA 3W6JB 3W6KB 2H6BA 5DEQA 5LEKA 2YX7A 4NQWA 2MH9A 1F1ZA 1WKMA 3ZMSA 3B02A 3FMQA 1XB4A 5HVQC 3R60A 5L3DA 3WTSC 1AOYA 1HKSA 1W4MA 4BNCA 2DO7A 2ZKZA 2R7FA 1V4RA 1O7LA 2FF4A 3ZMTA 3GO5A 3C7JA 4LG0B 3RTRA 5TJJA 4A6EA 4B09A 3WTTC 4RGUA 1TW3A 3ECOA 2DW4A 3HYIA 3WGHA 1YYVA 4AIJA 3RYPA 4GGGA 3LAPA 5HLIA 5ICEA 1WQ2A 2RC4A 1P2FA 4GYIA 4Q47A 2IA2A 1G3SA 4HF1A 3LFKA 2ZNZA 2ZXJA 4IJAA 3I53A 5E8GA 4UUVA 3KP3A 4ESBA 3ABUA 1DP7P 4LG0A 3K9TA 1R1VA 2ESNA 5IT9K 2HOEA 2HKXA 2KIMA 1K78B 1L3LA 2KRFA 1BC8C 5D8LB 4R8HA 1ZG5A 2OD5A 4HW0A 5E1XA 3REOA 1TQMA 4N0BA 3DXJF 1U5TA 2DQLA 3HOTA 3PQJA 4KIGA 5LGNA 4B8XA 2NAZA 4WXHA 2GZWA 4ZYGA 4YFKF 1XSXA 1H9GA 2WWYA 4M6YA 2PQ8A 5DD4A 4OINF 4ZYDA 2OU2A 5HS7A 1U6GA 2F5CA 1OKRA 1F9NA 2KIUA 5F6FA 1X3UA 3IWZA 4O6JA 5AIQA 1RZ4A 4GCVA 3VEPA 3KEOA 2FE3A 3J81K 1RUOA 3R0JA 4XLNF 3K1NA 1Z6TA 1W5SA 2MA3A 2O61A 2M5WA 1U3EM 2AS5F 1ZLJA 2MD5A 3GUDA 1U5TB 5BOXA 1SD4A 2VOPA 4G6DA 1QZZA 2COMA 5HDGA 4ZZDA 1FYLA 4R1HA 2UXNA 1TW2A 3IKTA 1BI3A 2VT2A 4Y13A 1ZGAA 4BYYA 5JHUA 1UB9A 1R36A 3E6CC 4MEXF 5H20A 2XIGA 3QPTA 4KDPA 3LWFA 5F64A 3TO9A 2OBPA 3TDZC 4N9IA 4BQAA 5DV5A 5EEGA 2JRTA 3IRQA 3CTAA 1KA8A 1F5TA 3HRUA 4U7BA 3VOEA 3F72A 2AXLA 2E1CA 1G3TA 2HR3A 1S6LA 5AONA 5CLSA 3DKWA 4JBAA 3FZVA 5HOOA 2HDCA 4OIPF 1FYKA 2ZFWA 3EYYA 3BPVA 3H3ZA 4KICA 4U88A 4WXCA 3BWGA 2HEOA 2IA1A 5FD6A 1S7AA 4LFUA 2HTJA 3DV8A 3QP6A 3TO6A 4KMUX 2DK8A 4G9YA 1XDSA 2DBBA 4ZZLA 2X4HA 1PP7U 3HHHA 3V8JA 3V7RA 3R61A 1SD6A 1J9IA 2DK5A 1P6RA 2MH2A 1G3WA 1P4XA 2V1DA 3RKWA 5FLXK 3JAMZ 4LK1F 1CF7B 2TDXA 1LEAA 3HTSB 2ZO4A 2D1HA 4EMSA 4BAYA 3F6VA 4L9VA 5BPDA 5FGMA 4HDVA 3E6BA 1EV7A 2JSCA 4Q5SF 2PJPA 2P5LC 3ML6A 3WTVC 2GIVA 2Z9OA 3KP2A 2P5VA 3M8EA 3GYHX 1TQPA 4KIBA 5E8IA 3N4MA 2Z3YA 1FSHA 4H0EA 2B0LA 2XHKA 1FBQA 4CDGA 3WU1B 2G7HA 3SXYA 4ZH4F 1UCRA 2VXZA 1GXQA 1R7JA 1S3JA 1MJAA 3K69A 3JTGA 2QUFA 2VBYA 3TOBA 2RNJA 4RGXA 3NRVA 4Y15A 2CFXA 2QQ9A 4HBLA 3F8BA 3P7NA 4HQMA 4M9ZA 3I59A 1IRFA 3KCCA 3E5UA 3HSEA 4KMFA 1S29A 2HZTA 4S04A 3EUHA 1PP8F 1DPUA 4M72A 4MTEA 4KNYA 2Z5UA 3KEQA 5K5OA 1ULYA 3CDHA 1XMKA 3ZQ7A 2M45A 2KIFA 3F21A 3K1PA 3DFGA 4LLGF 4HQEA 5DCFA 1TNSA 3JSOA 1XSDA 1XCBA 4A6DA 1CGPA 4OU0A 2BE5F 1DDNA 1I5ZA 3F22A 2RV8A 2HQRA 2LDUA 1Z1DA 2H6CA 1TQIA 2C6YA 3I0TA 1IXCA 4AIHA 1EH7A 2A5YB 3RDIA 3FXUA 1J75A 4LD5A 2M1BA 3N97A 2JPCA 4G8XA 1Z6RA 2PMUA 2NYXA 1YO5C 5DUIA 2A69F 2FU4A 5CJ9A 4GXOA 1P92A 3FXQA 3JAMK 5D5UB 4KYWA 2VE8A 3RKYA 1EH8A 3WODF 3LAJA 3FWEA 2Q2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWM A;  1O57 A;  3O2P E;  1MZB A;  4BHC A;  2PEX A;  4S05 A;  4I09 A;  4HF2 A;  1R23 A;  3J81 Z;  3I5U A;  5K5Q A;  1DUX C;  4EM0 B;  3HRS A;  2FNP A;  1KGS A;  2HQN A;  2IVM A;  4L5I A;  3B73 A;  4O5V A;  3RPQ A;  3KE2 A;  3EYI A;  3COA C;  1WRJ A;  1BJA A;  2A07 F;  2O8X A;  2P6T A;  1ZRC A;  3MAJ A;  2GAU A;  1R58 A;  2O6G E;  1HSJ A;  1Q1H A;  3ZMV A;  2HYG D;  3KZZ A;  4ETS A;  1Z9C A;  1YFH A;  5JR3 A;  3WE3 A;  1QO0 D;  3OOP A;  1HW5 A;  3ZMU A;  1WI9 A;  2V79 A;  3ERE D;  2FOK A;  2W25 A;  4IPA A;  4CHU A;  5DUK A;  2GQQ A;  1IF1 A;  2JPB A;  2DPU A;  5LRS A;  3U9G A;  2F5D A;  3H92 A;  4N9H A;  2QLZ A;  3EDP A;  4IHT A;  3F8N A;  1GXP A;  1ZLK A;  3VFZ A;  1YS6 A;  2WTE A;  2CSO A;  4M71 A;  3LA2 A;  1LDD A;  2NNY A;  2XAH A;  4NB5 A;  4BH9 A;  5LEJ A;  4ZYH A;  1KU7 A;  2CYY A;  2QBY B;  2OAZ A;  2ADU A;  3I59 B;  3BP8 A;  2WC2 A;  1SMT A;  5A2Q K;  2L3D A;  2Z33 A;  3BDD A;  5J8F A;  4KIF A;  2HWV A;  1YTY A;  3J80 K;  2GA1 A;  5IT9 Z;  2FEZ A;  1D8K A;  4RAY A;  1O3R A;  4U0V A;  2EFW A;  3LA3 A;  4UHT A;  2DPD A;  3Q5F A;  4HA8 A;  1R1T A;  1JGS A;  1P4W A;  2H94 A;  1J5Y A;  1ZAO A;  4K2E A;  4L18 B;  2FBI A;  3WTX C;  5EEH A;  4ASN A;  4KN7 X;  1KQ8 A;  1W7P D;  2P6S A;  1FSE A;  2EV6 A;  4EJT A;  4NHJ A;  4RAZ A;  2PLY A;  3MFK A;  3GW2 A;  1BIA A;  3C3W A;  1KQ9 A;  2RVC A;  1IUY A;  2DFI A;  3FM5 A;  4A12 A;  3TO7 A;  3V7C A;  4FHT A;  4EGY A;  2HGC A;  1FZP B;  3H3U A;  2W85 A;  3DPL C;  1XN7 A;  3OV8 A;  4PGH A;  1J59 A;  5E1Z B;  2BYV E;  4F7Z A;  2ACJ A;  1J2X A;  2VC0 A;  2ZME B;  4EM2 A;  3V8L A;  1LJ9 A;  4G94 A;  1T2K A;  5HLH A;  4LMY A;  3KET A;  3G73 A;  1WWX A;  4MEY F;  5K5R A;  2WV0 A;  5H6R A;  2NS0 A;  5CVJ A;  4UVC A;  2W24 A;  4G7H F;  4IRG A;  3TGN A;  1MDM A;  3U2R A;  3L9F A;  5HDK A;  3O6B B;  5ILS A;  2YSR A;  4CO8 A;  3BPX A;  3RI4 A;  1G6N A;  1AWC A;  4WXD A;  4XSZ F;  3V7S A;  2GA2 A;  2VON A;  4LK0 F;  1MKM A;  4KT5 C;  2RQP A;  3ABT A;  1LDJ A;  1Z7U A;  2W57 A;  3S2W A;  4UVB A;  3FF5 A;  3DP7 A;  4BXU A;  4IHS A;  3HSR A;  4XLP F;  4HV5 A;  2K86 A;  3KP5 A;  4M74 A;  2OQR A;  3D5L A;  3IWF A;  4PGG A;  2XRO A;  1V3F A;  2FSW A;  1XGO A;  3MZH A;  3F8M A;  3BJA A;  4HDU A;  1B9N A;  3FX3 A;  1IRG A;  5ERI A;  2XUB A;  2L4M A;  2V9V A;  4AWX B;  3QRF F;  1HKT A;  2DAO A;  5TRD A;  1W7P A;  4IF4 A;  1FBS A;  2FA5 A;  3QU6 A;  3T8R A;  2IJL A;  2VC1 A;  1SFU A;  3GVA A;  1NHA A;  4JK1 X;  3DEU A;  4Q4Z F;  3WU0 A;  5KK1 A;  1SFE A;  2L54 A;  4A0Y A;  5BMZ A;  2XGX A;  5FFZ A;  4ZYE A;  4DNC A;  4L0Y B;  2KJB A;  3T1B A;  4CGZ A;  2CQK A;  3F8C A;  2PI0 A;  2QVO A;  2E7W A;  3HTU A;  4KA4 A;  2JT1 A;  4JQF A;  2ESH A;  5DCM A;  3F8F A;  4AD9 A;  3LQQ A;  1QNT A;  3NEU A;  3E5X A;  4ESF A;  1OYY A;  4M73 A;  4E70 A;  4LB5 A;  1R22 A;  4FX0 A;  4D0P A;  4UV8 A;  5ED4 A;  1Y0U A;  1D5V A;  1ZRD A;  5D4R A;  1HST A;  3KLN A;  2GXB A;  2EFQ A;  3PQK A;  4CIC A;  2ZJ2 A;  4OMY A;  3C1D A;  2MLG A;  2W84 A;  5HDN A;  2L4A A;  1TNT A;  1I1G A;  3O3K A;  1PUE E;  1F4K A;  5LLQ A;  3FMR A;  1BN5 A;  2MLK A;  1H0M A;  4CZZ A;  4EGZ A;  4OIO F;  4U0W A;  4BHB A;  2EV0 A;  5D8K B;  2QQA A;  1FWZ A;  2VN2 A;  5FFX A;  3ZN1 A;  4KFC A;  1XMA A;  1C0W A;  1B6A A;  3CUO A;  4YIF A;  3GX4 X;  4GO1 A;  1QBJ A;  4LJZ F;  1SD5 A;  1BC7 C;  2H09 A;  5CYV A;  1S8N A;  4L9J A;  1K7A A;  1FY7 A;  3ELK A;  4FT8 A;  2LKP A;  2D45 A;  4YFN F;  3IHU A;  4RGR A;  1TBX A;  5ILU A;  4IRI A;  4ENM A;  4P96 A;  3ROU A;  5FB2 A;  1IAW A;  3RKX A;  3LST A;  3VOD A;  2FQ3 A;  3E6D A;  4M9S A;  4WCG A;  2QWW A;  5BS6 A;  2RN7 A;  2O3F A;  3HUG A;  3RYR A;  2EB7 A;  1ZYR F;  2MC3 A;  1IW7 F;  1REP C;  1RIO H;  4OIR F;  2ISY A;  2D2W A;  2X0L A;  2VBW A;  3G3Z A;  3T0Y A;  5ICF A;  2IW5 A;  3HOS A;  3JSP A;  5CVV A;  3SZT A;  2VOD A;  3EQL F;  2OZU A;  2PMH A;  3F6O A;  4HX4 A;  4HYE A;  1ZHF A;  1FYM A;  1S7O A;  2Q8K A;  1U5T C;  4MQ9 F;  1I6X A;  1UST A;  1YLF A;  4PDK A;  5HS8 A;  2Z99 A;  1FT9 A;  1PDN C;  4P9F A;  1U2W A;  3EET A;  2HS5 A;  2G9W A;  1HBX G;  2IA0 A;  5LHI A;  2IT0 A;  2H27 A;  1ZAR A;  2K27 A;  5LBQ A;  1E2X A;  2P5K A;  1KQ0 A;  2XAG A;  3I4P A;  2EJR A;  2QYO A;  4M9X A;  1LNW A;  3GEZ A;  4A2U A;  4GYG A;  5E20 A;  3AAF A;  1GVJ A;  4U0Y A;  5BPI A;  2Y75 A;  5J8C A;  5D5V B;  2DI3 A;  3GZ5 A;  3FXR A;  4Y17 A;  3I64 A;  2VBZ A;  4IVN A;  3HHG A;  1Z05 A;  4LLN A;  1USS A;  5DCM B;  4EM1 A;  3E5Q A;  4CYD A;  3TKY A;  1UHM A;  1G4D A;  1OYW A;  3DQV C;  3QOP A;  1FLI A;  5BQT A;  4LLL A;  1B4A A;  2V6C A;  1HKQ A;  2QBY A;  1ZN2 A;  2IP2 A;  4L5J A;  1IN7 A;  2FMY A;  1R5H A;  4O3M A;  4MNU A;  4L9T A;  1I1S A;  2KKO A;  3MWM A;  2EV5 A;  2XKO A;  3IC7 A;  4I0A A;  2LNB A;  2XVC A;  3GFI A;  2J5P A;  4BHP A;  2CO5 A;  3C18 A;  1FNN A;  4HAM A;  5D6E A;  1IZ1 A;  1XSV A;  2GWR A;  1BI1 A;  2FML A;  1UFM A;  2EK5 A;  4RS8 A;  1FPQ A;  1IXR C;  4ENK A;  3QU3 A;  2M30 A;  3IRR A;  2L01 A;  1HW1 A;  5D4S A;  6PAX A;  2EWN A;  3RJP A;  1OMI A;  1FC3 A;  2IRF G;  1BIB A;  3FMS A;  3JW4 A;  4FX4 A;  2K4B A;  1B9M A;  3VB2 A;  3M7G A;  4PZJ A;  1H9T A;  2VT3 A;  3DPT A;  2BEO A;  3F23 A;  5DD8 A;  2OQG A;  3I58 A;  1Z91 A;  1K78 A;  2R7D A;  5CVR A;  3ZMZ A;  5AIP A;  3I71 A;  1R00 A;  4L0Z B;  2P4W A;  3L00 A;  1MGT A;  1JHH A;  2E1N A;  4A0X A;  5JI6 A;  5CVI A;  2VOO A;  2DT5 A;  3KP4 A;  5A2Q Z;  4G7Z F;  4OOI A;  2Y0M A;  2XAF A;  4M6X A;  3CO6 C;  1LVA A;  1J7K A;  3KLO A;  1XGM A;  1MD0 A;  2RGV A;  2F5F A;  3BY6 A;  3RIR A;  1XCV A;  5D6F A;  5LHG A;  1W5T A;  4WWC A;  5ICC A;  5E17 F;  2DTR A;  2XAS A;  1OPC A;  3KP7 A;  4TV7 A;  3BJO A;  3MCZ A;  2JZY A;  2XAQ A;  2O0Y A;  3K0L A;  3Q9S A;  2CG4 A;  2XV4 S;  3WGI A;  4I2O A;  2YX4 A;  2EA2 A;  5CVU A;  4Z2Y A;  1OR7 A;  2FXA A;  3LQR A;  4G7O F;  4HF0 A;  4MGR A;  4PCQ A;  2QM3 A;  1LB2 A;  2LF7 A;  4IXA A;  1YW8 A;  3RPU A;  3P9I A;  2DU9 A;  4UVA A;  5HLG A;  2RDP A;  2DLL A;  1T0F A;  1W7P B;  2STW A;  1UHW A;  1RI7 A;  2J5O A;  1A04 A;  2PFB A;  1D3Y A;  1YW9 A;  3HRM A;  3WTW C;  5J6X A;  1SMY F;  1BOA A;  1FP2 A;  3SZP A;  3HSF A;  3SFZ A;  3I54 A;  5HS9 A;  3KZY A;  1I27 A;  4RB2 C;  2PBI A;  3J7A O;  3CJN A;  4A5M A;  2FBK A;  1YG2 A;  3M1E A;  4LB6 B;  2IPQ X;  4WX9 A;  2ETH A;  1BM9 A;  4KN4 X;  3T8T A;  3ZPL A;  4QWQ A;  2Y48 A;  1LDK B;  1STZ A;  1JE8 A;  2FRH A;  5ICG A;  1GHC A;  4HX7 A;  5JFR A;  5LRR A;  2ZNY A;  3U1D A;  2R3S A;  5ILV A;  2E7X A;  5E1W A;  3KP6 A;  2UZK A;  4EVI A;  1P4A A;  2M87 A;  2LF8 A;  4DQ2 A;  2EFP A;  1DPR A;  5JVT A;  2A3S A;  3CUQ B;  5L3C A;  4HOB A;  1XGS A;  2M8E A;  5L3E A;  4P55 A;  3R6S A;  1E17 A;  3P9K A;  2FNA A;  2YU3 A;  4P5O A;  3ULQ B;  4WF2 A;  3WG9 A;  1B59 A;  3K2Z A;  2YR2 A;  3KFW X;  1R5G A;  1ZG1 A;  4RB0 A;  1FBU A;  1WSU A;  4EJO A;  4WK8 F;  1LQ1 A;  3FHZ A;  3WTU C;  2JTV A;  1KU2 A;  2UXX A;  1TLH B;  3F3X A;  4UXN A;  1JHF A;  3K1M A;  3WGG A;  5DYM A;  2NRA C;  4YFX F;  3SHF A;  4OMZ A;  1OYI A;  1LEB A;  4R79 A;  2V1U A;  2K4J A;  4AVP A;  1T38 A;  5H6Q A;  4ENN A;  2QEN A;  5IT3 A;  1BI2 A;  1O3Q A;  3BRO A;  2XKP A;  2KJC A;  4EJV A;  3SQN A;  4LGW A;  1XDU A;  2FBH A;  4YG2 F;  1QQI A;  3ECH A;  4EQQ A;  1ON2 A;  1MDM B;  1O3S A;  1SAX A;  3IL2 A;  4RB1 A;  4I0B A;  3ZMD A;  1T98 A;  1TTY A;  5LHH A;  2QZ8 A;  2EFO A;  2HKO A;  1ONV A;  3TDU C;  3TOA A;  3WTY C;  4XBF A;  1QGP A;  1U78 A;  2G7U A;  5LGU A;  4MTD A;  1HXD A;  3BOQ A;  3HRT A;  1IN4 A;  3BZ6 A;  2NNN A;  2A6H F;  3L2C A;  1O7F A;  1J0R A;  1K6O A;  1YS7 A;  1YW7 A;  3E97 A;  4HLX A;  4KUM A;  4ON0 A;  3GXO A;  4OIQ F;  4P9U A;  4I98 B;  4EV0 A;  1HQC A;  1XGN A;  3CLO A;  2PG4 A;  4U7D A;  3GFJ A;  3GF2 A;  2PN6 A;  1CF7 A;  1ZRF A;  1KYW A;  1FOK A;  3T5X A;  5E18 F;  4CXF A;  1B1B A;  2A61 A;  1BI0 A;  3QAH A;  4HV6 A;  1O3T A;  4EJW A;  5F1R A;  5K1Y A;  2P7C B;  1YIO A;  2BV6 A;  3NQO A;  1RNL A;  1K79 A;  2P7V B;  2QQB A;  1QZY A;  3TQN A;  1SD7 A;  2V1X A;  3QP5 A;  5DDG A;  4EJU A;  3J80 Z;  1MJB A;  3M8F A;  2MBF A;  3E3V A;  2ZBK A;  4HLY A;  1L0O C;  3CUQ C;  2F5E A;  3ZP5 A;  4I01 A;  5FLX Z;  2P8T A;  3CUQ A;  3R4K A;  2OZ6 A;  1RUN A;  1VTN C;  1T39 A;  1KYZ A;  1XD7 A;  4HX8 A;  4XRF A;  5D5X B;  2O03 A;  4G6Q A;  3GZ6 A;  1MJ9 A;  2L02 A;  1FX7 A;  1SFX A;  2ZME A;  4L9N A;  4RGS A;  3MZY A;  1ODD A;  3GFL A;  1FP1 D;  3WE2 A;  2EFN A;  3QPH A;  5D5W B;  1KU3 A;  4ENJ A;  5FO5 A;  1KU9 A;  2DQR A;  2OA4 A;  2BBY A;  2K02 A;  2EA4 A;  3CO7 C;  4A0Z A;  2HFH A;  3DF8 A;  3L7W A;  2F2E A;  2A68 F;  1EH6 A;  1QPM A;  2A6E F;  4XSX F;  1JXS A;  4AIK A;  1R1U A;  1D8J A;  1IN6 A;  2Q0O A;  3ZN0 A;  1T6S A;  3FM3 A;  3IKV A;  1ZH5 A;  2LSO A;  2XAJ A;  3P9C A;  4A5N A;  3ISP A;  2D1V A;  5L3B A;  3HIF A;  3JTH A;  1G3Y A;  4I02 A;  4ESJ A;  3GWZ A;  4MHG A;  2YPR A;  1IN5 A;  1YQA A;  4QLC U;  5LGT A;  2RKH A;  2VBX A;  2STT A;  3MEX A;  1ZGJ A;  2GXG A;  3L09 A;  1BBY A;  3BJ6 A;  3R0A A;  2CWE A;  1IXS B;  1ZRE A;  4HZF A;  5L3G A;  3M9A A;  1HW2 A;  3WTZ A;  3MQ0 A;  3V4G A;  2CW0 F;  4RB3 C;  2ELH A;  4YII A;  2CGP A;  3GLX A;  1IN8 A;  2VE9 A;  3D0S A;  1U8R A;  2K7L A;  3V8K A;  4Q48 A;  5FD5 A;  3PFI A;  3LA7 A;  2HTS A;  2BGC A;  4IRH A;  5L3F A;  1ZG3 A;  4UV9 A;  1ON1 A;  2ISZ A;  4MQV A;  4UNO A;  5KVR A;  2HYF A;  2ZCW A;  4I7H A;  3E6M A;  2XRN A;  3Q9V A;  3GFM A;  3W6J B;  3W6K B;  2H6B A;  5DEQ A;  5LEK A;  2YX7 A;  4NQW A;  2MH9 A;  1F1Z A;  1WKM A;  3ZMS A;  3B02 A;  3FMQ A;  1XB4 A;  5HVQ C;  3R60 A;  5L3D A;  3WTS C;  1AOY A;  1HKS A;  1W4M A;  4BNC A;  2DO7 A;  2ZKZ A;  2R7F A;  1V4R A;  1O7L A;  2FF4 A;  3ZMT A;  3GO5 A;  3C7J A;  4LG0 B;  3RTR A;  5TJJ A;  4A6E A;  4B09 A;  3WTT C;  4RGU A;  1TW3 A;  3ECO A;  2DW4 A;  3HYI A;  3WGH A;  1YYV A;  4AIJ A;  3RYP A;  4GGG A;  3LAP A;  5HLI A;  5ICE A;  1WQ2 A;  2RC4 A;  1P2F A;  4GYI A;  4Q47 A;  2IA2 A;  1G3S A;  4HF1 A;  3LFK A;  2ZNZ A;  2ZXJ A;  4IJA A;  3I53 A;  5E8G A;  4UUV A;  3KP3 A;  4ESB A;  3ABU A;  1DP7 P;  4LG0 A;  3K9T A;  1R1V A;  2ESN A;  5IT9 K;  2HOE A;  2HKX A;  2KIM A;  1K78 B;  1L3L A;  2KRF A;  1BC8 C;  5D8L B;  4R8H A;  1ZG5 A;  2OD5 A;  4HW0 A;  5E1X A;  3REO A;  1TQM A;  4N0B A;  3DXJ F;  1U5T A;  2DQL A;  3HOT A;  3PQJ A;  4KIG A;  5LGN A;  4B8X A;  2NAZ A;  4WXH A;  2GZW A;  4ZYG A;  4YFK F;  1XSX A;  1H9G A;  2WWY A;  4M6Y A;  2PQ8 A;  5DD4 A;  4OIN F;  4ZYD A;  2OU2 A;  5HS7 A;  1U6G A;  2F5C A;  1OKR A;  1F9N A;  2KIU A;  5F6F A;  1X3U A;  3IWZ A;  4O6J A;  5AIQ A;  1RZ4 A;  4GCV A;  3VEP A;  3KEO A;  2FE3 A;  3J81 K;  1RUO A;  3R0J A;  4XLN F;  3K1N A;  1Z6T A;  1W5S A;  2MA3 A;  2O61 A;  2M5W A;  1U3E M;  2AS5 F;  1ZLJ A;  2MD5 A;  3GUD A;  1U5T B;  5BOX A;  1SD4 A;  2VOP A;  4G6D A;  1QZZ A;  2COM A;  5HDG A;  4ZZD A;  1FYL A;  4R1H A;  2UXN A;  1TW2 A;  3IKT A;  1BI3 A;  2VT2 A;  4Y13 A;  1ZGA A;  4BYY A;  5JHU A;  1UB9 A;  1R36 A;  3E6C C;  4MEX F;  5H20 A;  2XIG A;  3QPT A;  4KDP A;  3LWF A;  5F64 A;  3TO9 A;  2OBP A;  3TDZ C;  4N9I A;  4BQA A;  5DV5 A;  5EEG A;  2JRT A;  3IRQ A;  3CTA A;  1KA8 A;  1F5T A;  3HRU A;  4U7B A;  3VOE A;  3F72 A;  2AXL A;  2E1C A;  1G3T A;  2HR3 A;  1S6L A;  5AON A;  5CLS A;  3DKW A;  4JBA A;  3FZV A;  5HOO A;  2HDC A;  4OIP F;  1FYK A;  2ZFW A;  3EYY A;  3BPV A;  3H3Z A;  4KIC A;  4U88 A;  4WXC A;  3BWG A;  2HEO A;  2IA1 A;  5FD6 A;  1S7A A;  4LFU A;  2HTJ A;  3DV8 A;  3QP6 A;  3TO6 A;  4KMU X;  2DK8 A;  4G9Y A;  1XDS A;  2DBB A;  4ZZL A;  2X4H A;  1PP7 U;  3HHH A;  3V8J A;  3V7R A;  3R61 A;  1SD6 A;  1J9I A;  2DK5 A;  1P6R A;  2MH2 A;  1G3W A;  1P4X A;  2V1D A;  3RKW A;  5FLX K;  3JAM Z;  4LK1 F;  1CF7 B;  2TDX A;  1LEA A;  3HTS B;  2ZO4 A;  2D1H A;  4EMS A;  4BAY A;  3F6V A;  4L9V A;  5BPD A;  5FGM A;  4HDV A;  3E6B A;  1EV7 A;  2JSC A;  4Q5S F;  2PJP A;  2P5L C;  3ML6 A;  3WTV C;  2GIV A;  2Z9O A;  3KP2 A;  2P5V A;  3M8E A;  3GYH X;  1TQP A;  4KIB A;  5E8I A;  3N4M A;  2Z3Y A;  1FSH A;  4H0E A;  2B0L A;  2XHK A;  1FBQ A;  4CDG A;  3WU1 B;  2G7H A;  3SXY A;  4ZH4 F;  1UCR A;  2VXZ A;  1GXQ A;  1R7J A;  1S3J A;  1MJA A;  3K69 A;  3JTG A;  2QUF A;  2VBY A;  3TOB A;  2RNJ A;  4RGX A;  3NRV A;  4Y15 A;  2CFX A;  2QQ9 A;  4HBL A;  3F8B A;  3P7N A;  4HQM A;  4M9Z A;  3I59 A;  1IRF A;  3KCC A;  3E5U A;  3HSE A;  4KMF A;  1S29 A;  2HZT A;  4S04 A;  3EUH A;  1PP8 F;  1DPU A;  4M72 A;  4MTE A;  4KNY A;  2Z5U A;  3KEQ A;  5K5O A;  1ULY A;  3CDH A;  1XMK A;  3ZQ7 A;  2M45 A;  2KIF A;  3F21 A;  3K1P A;  3DFG A;  4LLG F;  4HQE A;  5DCF A;  1TNS A;  3JSO A;  1XSD A;  1XCB A;  4A6D A;  1CGP A;  4OU0 A;  2BE5 F;  1DDN A;  1I5Z A;  3F22 A;  2RV8 A;  2HQR A;  2LDU A;  1Z1D A;  2H6C A;  1TQI A;  2C6Y A;  3I0T A;  1IXC A;  4AIH A;  1EH7 A;  2A5Y B;  3RDI A;  3FXU A;  1J75 A;  4LD5 A;  2M1B A;  3N97 A;  2JPC A;  4G8X A;  1Z6R A;  2PMU A;  2NYX A;  1YO5 C;  5DUI A;  2A69 F;  2FU4 A;  5CJ9 A;  4GXO A;  1P92 A;  3FXQ A;  3JAM K;  5D5U B;  4KYW A;  2VE8 A;  3RKY A;  1EH8 A;  3WOD F;  3LAJ A;  3FWE A;  2Q2E A; 
#chains in the Genus database with same CATH topology
 3WHC A;  3RSN A;  2UWM A;  1O57 A;  3O2P E;  1MZB A;  4B1R A;  4BHC A;  2PEX A;  4S05 A;  4I09 A;  4HF2 A;  2D5V A;  3S2D J;  1FEX A;  1R23 A;  4FET A;  3J81 Z;  3I5U A;  5K5Q A;  3JRE A;  1V54 H;  1DUX C;  1SVO A;  4EM0 B;  4JP0 A;  4P1W A;  1IDY A;  3HRS A;  2FNP A;  2KPM A;  1KGS A;  3GCM A;  4XKB A;  5E3M A;  2HPM A;  2HQN A;  3DBL B;  2IVM A;  4L5I A;  3B73 A;  4O5V A;  1IUF A;  2M3A A;  3RPQ A;  4BJ6 C;  3I4N J;  1LKX A;  2Y0S A;  3KE2 A;  3EYI A;  3COA C;  4V2G A;  1E3O C;  1X4P A;  1UEL B;  1ETV A;  1WRJ A;  1BJA A;  2A07 F;  2O8X A;  2L9V A;  2Y30 A;  2P6T A;  1ZRC A;  3MAJ A;  4FE4 A;  1LPQ A;  2GAU A;  3ZQI A;  3J7Y J;  3HOV J;  1R58 A;  2O6G E;  1HSJ A;  1Q1H A;  2OV7 A;  2HYG D;  2I5U A;  1YX5 A;  3KZZ A;  3OIQ A;  3ABL H;  3ZMV A;  3S17 J;  2LKS A;  4ETS A;  1Z9C A;  1G8X A;  5JR3 A;  3DWL E;  2NOJ B;  1YFH A;  3PM1 A;  1JUS A;  1QO0 D;  3OOP A;  3W2W A;  3WE3 A;  2KIS A;  1HW5 A;  2HZD A;  3ZMU A;  1WI9 A;  3V42 A;  2V79 A;  3IH3 A;  2DYR H;  4N4N B;  3ERE D;  2QKM B;  1D0Z A;  3OYE A;  1VQO I;  1M1E B;  2FOK A;  2W25 A;  2PX9 A;  4IPA A;  4CHU A;  1U9N A;  3SEQ A;  3FBI B;  5DUK A;  1LFP A;  2GQQ A;  1TWG J;  3HC7 A;  5FKL A;  2DFF A;  3A4C A;  1IF1 A;  3OL3 A;  3OL4 A;  4BEH B;  2JPB A;  2DPU A;  5LRS A;  2DOA A;  4BU2 A;  5KCM A;  3U9G A;  2F5D A;  3BG6 A;  3H92 A;  4II3 A;  4N9H A;  4CUG A;  2E2I J;  4BXF A;  2QLZ A;  1D1C A;  3EDP A;  4IHT A;  2ZB9 A;  3F8N A;  1GXP A;  1ZLK A;  2YU9 J;  4FCY A;  1ZK8 A;  3VFZ A;  1P9Q C;  1YS6 A;  4J00 A;  2VJJ A;  3OIO A;  3S16 J;  2DT6 A;  2L0K A;  2WTE A;  2CSO A;  4M71 A;  3LA2 A;  3ZR8 X;  4NDL A;  1LDD A;  2NNY A;  2XAH A;  4NB5 A;  3VYR B;  4BH9 A;  5LEJ A;  2XC7 A;  4ZYH A;  1EJ9 A;  2PMZ A;  1KU7 A;  2CYY A;  4BBR J;  3SDG A;  2QF7 A;  2QBY B;  4LIV A;  2OAZ A;  2ADU A;  3I59 B;  2R5Y B;  3BP8 A;  2XSD C;  2CV0 A;  2QQ8 A;  2WC2 A;  1SMT A;  3B6C A;  3H5A A;  1OCC H;  5A2Q K;  2L3D A;  2Z33 A;  3SEZ A;  3BDD A;  3OYN A;  3QYB A;  2HOS A;  5J8F A;  1VND A;  4KIF A;  2WY8 Q;  2E5N A;  2HWV A;  1QHH D;  1YTY A;  3J80 K;  3TMO A;  2FQ4 A;  2GA1 A;  5IT9 Z;  2F4M B;  1D8K A;  2FEZ A;  4RAY A;  5GAD J;  1O3R A;  2EZH A;  2XSJ C;  4U0V A;  2EFW A;  2K3P A;  5J1Y A;  3LA3 A;  2RNG A;  4UHT A;  2DPD A;  2XGD A;  4MO7 A;  3VYU B;  3Q5F A;  2DFH A;  4NNJ A;  5GPA A;  4HA8 A;  4FQG A;  4IOA F;  2KLO A;  1R1T A;  4U87 A;  1JGS A;  5EJC A;  1P4W A;  3Q0V A;  4Y52 J;  2H94 A;  2DTZ A;  1J5Y A;  1ZAO A;  4K2E A;  3BR0 A;  2LVS A;  4L18 B;  2FBI A;  3WTX C;  4BBS J;  1GDT A;  1ZTR A;  5EEH A;  4ASN A;  4KN7 X;  3BTJ A;  1DU0 A;  1KQ8 A;  2CV1 A;  2VPL A;  2R7W A;  2ECB A;  2MC4 A;  4M3G A;  1W7P D;  2P6S A;  1FSE A;  2BVM A;  2EV6 A;  4ZC3 A;  4EJT A;  4FAS D;  2R5Z A;  4XON A;  4IQ4 A;  3AG1 H;  4LIU A;  2EBI A;  4RAZ A;  2PLY A;  4NHJ A;  3A2K A;  3K4N A;  3MFK A;  3OYB A;  1P7J A;  3GW2 A;  2LD5 A;  1BIA A;  3HOW J;  2LR8 A;  3C3W A;  1KQ9 A;  2RVC A;  1IUY A;  2DFI A;  3CCY A;  3FM5 A;  4A12 A;  3TO7 A;  4XOR A;  3V7C A;  4FHT A;  4EGY A;  2HGC A;  1FZP B;  5B66 C;  2MD0 A;  3H3U A;  1A31 A;  1ZQ3 P;  4ZJZ A;  2W85 A;  3DPL C;  1MNE A;  1XN7 A;  3OV8 A;  2K9Q A;  4PGH A;  4XOT A;  1J59 A;  5E1Z B;  2BYV E;  4F7Z A;  2ACJ A;  3CCU I;  1J2X A;  3BZC A;  2VC0 A;  1W1W E;  2L7Z A;  2B7E A;  2ZME B;  4EM2 A;  3HDD A;  3V8L A;  1LJ9 A;  4G94 A;  1Z3X A;  1YIJ I;  3KEY A;  4PJJ A;  2O9L A;  1T2K A;  1F36 A;  2E34 A;  1FOY A;  4BQO A;  2CU7 A;  3HZJ A;  3BTC A;  5HLH A;  1JT0 A;  3I9V 2;  1YE9 A;  4LMY A;  5C4X J;  3KET A;  4BS9 A;  2HVS A;  3G73 A;  1WWX A;  4MEY F;  2A6T A;  4Y33 A;  5K5R A;  4D7N A;  2WV0 A;  5H6R A;  2NS0 A;  5CVJ A;  4UVC A;  2W24 A;  4G7H F;  2JQ7 A;  4IRG A;  3TGN A;  1MDM A;  3U2R A;  3OYF A;  4XKW A;  1N75 A;  3L9F A;  2XRL A;  5HDK A;  3O6B B;  5ILS A;  2YSR A;  4CO8 A;  1B8I B;  3D1N I;  3BPX A;  4KT6 A;  3RI4 A;  3OWT A;  1G6N A;  1AWC A;  2EIM H;  1QU3 A;  4KJZ A;  1OLT A;  4WXD A;  3FKI J;  4XSZ F;  1U8B A;  2JMW A;  2Q1Z B;  3V7S A;  3HL2 A;  2GA2 A;  2VON A;  2HI3 A;  1MKM A;  4LK0 F;  4KT5 C;  3JRA A;  2RQP A;  3ABT A;  3L1P A;  3Q0W A;  1LDJ A;  1VQ9 I;  1Z7U A;  2K85 A;  2W57 A;  2HOA A;  3GTK J;  1ETY A;  3S2W A;  4UVB A;  5GTH C;  3FF5 A;  4UUT A;  2DMQ A;  3DP7 A;  4BXU A;  3S1N J;  2DA6 A;  4IHS A;  2UUZ A;  1X2M A;  1X2N A;  3HSR A;  3PUF A;  4XLA A;  4BGD A;  4XLP F;  4HV5 A;  5GAE J;  2K86 A;  4AUX A;  3KP5 A;  4M74 A;  1R4N B;  3DBH B;  4W1U A;  3PIP F;  2OQR A;  3D5L A;  3HKZ N;  2R4G A;  3IWF A;  4BQN A;  2F6C A;  3CMM A;  4PGG A;  1ITY A;  2XRO A;  1V3F A;  2FSW A;  1FOW A;  1XGO A;  3ZQQ A;  3MZH A;  3F8M A;  3BJA A;  5IYD J;  4HDU A;  1GV2 A;  1B9N A;  2IGM A;  3FX3 A;  1IRG A;  2R7V A;  5ERI A;  3ZQL A;  1JKQ C;  4ITV A;  2XUB A;  2L4M A;  2V9V A;  4BE0 A;  4AWX B;  3QRF F;  1HKT A;  2DAO A;  2QA4 I;  2EZK A;  1QA6 A;  3CC2 I;  5TRD A;  1W7P A;  4IF4 A;  1FBS A;  2FA5 A;  3QU6 A;  3T8R A;  2IJL A;  2VC1 A;  1SFU A;  3GVA A;  1NHA A;  4JK1 X;  3DEU A;  3VPR A;  4Q4Z F;  3CCS I;  3WU0 A;  3G4S I;  3OYI A;  5KK1 A;  3VDX A;  1Z0X A;  1SFE A;  2L54 A;  3PUB A;  4A0Y A;  5HLT A;  5BMZ A;  2XGX A;  5FFZ A;  2CMP A;  3CMA I;  4ZYE A;  4DNC A;  4L0Y B;  3UNG C;  1PYV A;  2KJB A;  3OSG A;  3T1B A;  2XGC A;  4CGZ A;  2CQK A;  3F8C A;  4J19 A;  2PI0 A;  2QVO A;  2E7W A;  3D5S C;  4GFB A;  1VQ7 I;  2BZT A;  3HTU A;  4KA4 A;  1D5Y A;  2JT1 A;  1YRN B;  1OCP A;  4JQF A;  2ESH A;  3BG3 A;  2NVX J;  5DCM A;  5IP6 A;  2JA8 J;  1MBK A;  1MH3 A;  3F8F A;  4IZZ A;  2LY2 A;  1ENH A;  4AD9 A;  5F27 A;  3LQQ A;  1B72 A;  3AG2 H;  1QNT A;  1LFB A;  3NEU A;  2BHY A;  3E5X A;  3G1O A;  4DYQ A;  4ESF A;  1OYY A;  2PMZ N;  4M73 A;  4E4H A;  3CJR B;  3M3Y J;  5EDN A;  4XNF A;  4E70 A;  4LB5 A;  1R22 A;  5FKK A;  4FX0 A;  4D0P A;  4UV8 A;  3S1M J;  5BNG A;  5ED4 A;  4B48 A;  1ZR2 A;  1Y0U A;  3O8H A;  1R49 A;  1MBJ A;  1D5V A;  1ZRD A;  5D4R A;  1HST A;  1W0T A;  3KLN A;  2GXB A;  2EFQ A;  3PQK A;  4CIC A;  2ZJ2 A;  4OMY A;  1RPW A;  3C1D A;  2VQL A;  4ZDP A;  2MLG A;  1IDZ A;  3F0C A;  1TL8 A;  2W84 A;  4Y3O A;  3JCU C;  3OMY A;  5HDN A;  1VQ4 I;  4A3I J;  3HBL A;  1AHD P;  2L4A A;  1TWH J;  1TNT A;  1K6Y A;  3BT9 A;  4AM3 A;  1I1G A;  3O3K A;  1PUE E;  1F4K A;  4QIW N;  5LLQ A;  2CUJ A;  4F91 B;  3FMR A;  2Y9Y A;  1BN5 A;  2NXN B;  2MLK A;  2MG4 A;  3VSL A;  1H0M A;  3G6E I;  2DXI A;  2VPR A;  1JT6 A;  3CP2 A;  2R7X A;  1H89 C;  4CZZ A;  4EGZ A;  4OIO F;  4U0W A;  3AKZ A;  2LKX A;  2KMU A;  4BHB A;  2EV0 A;  5D8K B;  1BL0 A;  2VB6 A;  4HST A;  2GLO A;  2BY1 A;  3LSM A;  2QQA A;  2HQ5 A;  1FWZ A;  4MFD A;  2VN2 A;  2X6X A;  5FFX A;  1WCM J;  3ZN1 A;  4KFC A;  4C30 A;  1XMA A;  1C0W A;  1B6A A;  2W48 A;  3CUO A;  4YIF A;  3GX4 X;  5KAI C;  4GO1 A;  1QBJ A;  4LJZ F;  1SD5 A;  2H09 A;  2VQC A;  4B4C A;  2EZL A;  5CYV A;  1JKO C;  1BC7 C;  1S8N A;  4DGW B;  3JRH A;  4L9J A;  3FXL A;  1K7A A;  1MMA A;  2PJR B;  2IS1 A;  4XL9 A;  1FY7 A;  3ELK A;  5K7F A;  4FT8 A;  2LKP A;  2D45 A;  4XRM A;  5IOZ A;  4AYB A;  3A01 A;  4YFN F;  3BC8 A;  3IHU A;  4II2 A;  4RGR A;  1RKW A;  5FKO A;  5GAH J;  3DBR B;  2JJ7 A;  4BEH A;  1TBX A;  5ILU A;  4IRI A;  2L9S A;  4ENM A;  4P96 A;  3M07 A;  3ROU A;  5J4Y A;  5FB2 A;  1IAW A;  2O7O A;  2FD5 A;  3RKX A;  3H0D A;  3LST A;  3AG3 H;  3VOD A;  2FQ3 A;  2XF6 A;  3E6D A;  4M9S A;  4WCG A;  2QWW A;  3FIW A;  5BS6 A;  2RN7 A;  2O3F A;  3HUG A;  3RYR A;  1UJ8 A;  1JKP C;  2EB7 A;  3KZI C;  1ZYR F;  1Y0N A;  2MC3 A;  1IW7 F;  4C3I J;  1REP C;  1RIO H;  1VQ5 I;  2EPF A;  2ECC A;  2BW3 A;  1BW5 A;  1ZGW A;  1RES A;  5FKN A;  4OIR F;  4X0G A;  3K70 C;  2ISY A;  5DS9 A;  2D2W A;  4BE1 A;  2X0L A;  5M3F J;  4B44 A;  2CUZ A;  2VBW A;  2VI6 A;  4XKC A;  3G3Z A;  3T0Y A;  2OJE D;  5ICF A;  2IW5 A;  1Y56 A;  2O8K A;  3HOS A;  3JSP A;  2H1K A;  4RAG A;  5CVV A;  3SZT A;  2WAQ N;  2KL4 A;  1Y1W J;  2VOD A;  2E1M C;  1N77 A;  2M0C A;  3EQL F;  4EEF G;  2M9H A;  1W36 D;  4C2U A;  3W3C A;  3MKW B;  3HB9 A;  3EUH C;  2OZU A;  2PMH A;  3F6O A;  4HX4 A;  1QVU A;  4HYE A;  2GOX B;  1ZHF A;  2Z16 A;  1FYM A;  1S7O A;  1D1B A;  4UUS A;  2Y31 A;  2Q8K A;  4PFP A;  1U5T C;  4MQ9 F;  1TC3 C;  1I6X A;  1PUF B;  3MZ8 A;  1MSF C;  1UST A;  1YLF A;  4PDK A;  5HS8 A;  2Z99 A;  2YS9 A;  3BQY A;  1FT9 A;  3ZQC A;  1PDN C;  4P9F A;  1U2W A;  3EET A;  2IAI A;  2HS5 A;  1YJW I;  3L2Q A;  2G9W A;  1HBX G;  2DT7 B;  3E7L A;  2JSP A;  4YEJ A;  5K7Z A;  2IA0 A;  5EYR A;  1VQ6 I;  1FTZ A;  5LHI A;  2R92 J;  1QHG A;  2IT0 A;  2H27 A;  1ZAR A;  2K27 A;  5LBQ A;  4AID A;  1TWC J;  2AQF A;  2Y2Z A;  4BDY A;  1E2X A;  2P5K A;  2P81 A;  4E7Z A;  1KQ0 A;  2XAG A;  3I4P A;  4A3C J;  2V4J C;  4BDZ A;  4J01 A;  2HNH A;  1OFC X;  2EJR A;  3HPH A;  1OCT C;  4KIS A;  1Z3Y A;  2QYO A;  4M9X A;  1LNW A;  3GEZ A;  4A2U A;  4GYG A;  3MD2 A;  5E20 A;  3ZQH A;  3AAF A;  1WGX A;  1GVJ A;  3H5N A;  2XF7 A;  4U0Y A;  5BPI A;  1A6Q A;  3DKX A;  2KRH A;  2Y75 A;  2OCC H;  5J8C A;  5D5V B;  2DI3 A;  3GZ5 A;  3FXR A;  4Y17 A;  3HEF A;  3I64 A;  3TW6 A;  2VBZ A;  4IVN A;  1T56 A;  4CCN A;  3S3M A;  3WHB A;  4MFE A;  3HHG A;  3TP3 A;  1Z05 A;  1XMX A;  2MYS A;  2K9M A;  4LLN A;  1X1A A;  1K61 A;  5FLV A;  1O4X A;  1USS A;  1IO2 A;  2CUF A;  5DCM B;  4EM1 A;  1FOX A;  3E5Q A;  3H5R A;  4CYD A;  1VFC A;  3RZO J;  1ERD A;  4ZDO A;  3TKY A;  5GPC A;  1UHM A;  3HGY A;  1G4D A;  1OYW A;  2ME6 A;  1WPK A;  1Z21 A;  3DQV C;  3QOP A;  1FLI A;  3DU6 A;  2E2J J;  5BQT A;  4LLL A;  1APL C;  3BG5 A;  1B4A A;  2V6C A;  2DMP A;  1IC8 A;  1MIJ A;  1HKQ A;  5EG0 A;  2QBY A;  1ZN2 A;  2IP2 A;  5J40 A;  3P5J A;  4PSW A;  4Y4R A;  3M4O J;  1LFU P;  4L5J A;  3QYE A;  3OYC A;  3HKZ A;  2JA2 A;  4M3F A;  1IN7 A;  1WI3 A;  4A3J J;  2FMY A;  1R5H A;  3FIS A;  4D5F A;  4MNU A;  4O3M A;  3U1K A;  2LH9 A;  4RA2 A;  4L9T A;  3N05 A;  1I1S A;  5CQE A;  2KKO A;  3MWM A;  4E7L A;  2EV5 A;  2KQR A;  2XKO A;  3BCA A;  3IC7 A;  4I0A A;  2LNB A;  2XVC A;  4RMN A;  3DEE A;  2VQH A;  3GFI A;  2J5P A;  2ME0 A;  1UMQ A;  4BHP A;  3OYH A;  5H2F C;  2CO5 A;  1X4O A;  1LUJ B;  3C18 A;  1FNN A;  3K4C A;  2IS4 A;  1DQU A;  4HAM A;  4H4K C;  3Q3S A;  5D6E A;  2KDO A;  1EKE A;  3K4M A;  1IZ1 A;  1XSV A;  4XOP A;  5KNL A;  2GWR A;  3BG7 A;  2LTP A;  4IOC F;  2DCE A;  1AU7 A;  5CKT A;  1BOB A;  2HXO A;  2CS3 A;  3LL7 A;  2CRG A;  1BI1 A;  4F55 A;  1UFM A;  2FML A;  1HDP A;  4GDF A;  2EK5 A;  3CF2 A;  4RS8 A;  1FPQ A;  2UV1 A;  2VXD A;  5EGO B;  1IXR C;  2M4G A;  4BY1 J;  4ENK A;  3QU3 A;  1RKT A;  2L9R A;  1HOM A;  2M30 A;  2N8G A;  3IRR A;  1ETQ A;  2V6E A;  1IRX A;  3PNY A;  2L7M P;  3TL4 X;  2L7K A;  2L01 A;  1HW1 A;  5D4S A;  2AXT C;  2LYC A;  3AL0 C;  4B47 A;  6PAX A;  1QVT A;  2EWN A;  4E6K G;  3K4B A;  3LFU A;  3S1Q J;  4IL6 C;  1OMI A;  3RJP A;  3JR9 A;  2CFO A;  1FC3 A;  3FMS A;  1BIB A;  3SJM A;  3JW4 A;  4FX4 A;  1BR1 A;  2IRF G;  2K4B A;  3PO3 J;  2WV1 A;  1B9M A;  3HM5 A;  3VB2 A;  3M7G A;  4PZJ A;  1H9T A;  2VT3 A;  3DPT A;  2BEO A;  2M4K A;  1NTC A;  3BR1 A;  3F23 A;  3L2W A;  5DD8 A;  2B9S A;  4X6A J;  1T08 B;  5F1J A;  4DYR A;  2ELJ A;  4OAY A;  2BOL A;  2OQG A;  3I58 A;  4BKX A;  3MVP A;  9ANT A;  3A0B C;  4PJM A;  1Z91 A;  1K78 A;  1RR8 C;  2W4S A;  2R7D A;  5CVR A;  3ZMZ A;  2IGN A;  1JJ6 C;  3LSH A;  5F0F A;  3U21 A;  5AIP A;  2DYS H;  3I71 A;  2R93 J;  1R00 A;  2M8G X;  4L0Z B;  3BCB A;  4EAT A;  2P4W A;  2LG4 A;  4PJN A;  3L00 A;  1MGT A;  1JHH A;  2IS6 A;  2E1N A;  4A0X A;  4A3B J;  1ZEL A;  5JI6 A;  5CVI A;  1U9O A;  2DT5 A;  2VOO A;  3KP4 A;  5A2Q Z;  4G7Z F;  4OOI A;  1ETO A;  2Y0M A;  4PUS A;  2XAF A;  4M6X A;  2FJ1 A;  2CQQ A;  3CO6 C;  5EGO A;  1LVA A;  1J7K A;  3KIO A;  1N78 A;  3KLO A;  1XGM A;  1MD0 A;  3K6G A;  2RGV A;  4XN0 A;  2F5F A;  1WH5 A;  3BY6 A;  3RIR A;  2VAS A;  1XCV A;  2JUC A;  4M3E A;  1VF9 A;  5D6F A;  3C2B A;  2BY3 A;  5LHG A;  1W5T A;  4WWC A;  1LE8 A;  2LY9 A;  2ID6 A;  5ICC A;  5DM6 F;  5E17 F;  2BXZ A;  2H8W A;  1XG1 A;  2DTR A;  4YEL A;  2XAS A;  3RKQ A;  1OPC A;  3KP7 A;  2OPT A;  1HF0 A;  3G1M A;  4TV7 A;  3ABM H;  3BJO A;  1WJC A;  2JUG A;  3MCZ A;  4B43 A;  4N4O B;  2JZY A;  4OWR B;  2XAQ A;  2O0Y A;  3K0L A;  3Q9S A;  2CG4 A;  1YJN I;  1TZL A;  1NH3 A;  2XV4 S;  2R7Z J;  3WGI A;  4I2O A;  2YX4 A;  4KIT B;  4XKV A;  2R7Q A;  3BZK A;  2EA2 A;  3A02 A;  4E7S A;  5E3O A;  5CVU A;  4Z2Y A;  1OR7 A;  2FXA A;  3LQR A;  4NC7 A;  1B8I A;  4G7O F;  2NVQ J;  2Z2S B;  4HF0 A;  5C3E J;  4MGR A;  3JRG A;  4PCQ A;  3GTP J;  2IXS A;  2QM3 A;  2LLK A;  2E5Z A;  1MNM C;  1LB2 A;  2LF7 A;  4IXA A;  5B3S H;  1YW8 A;  2EZI A;  3PJR A;  1X3Z B;  2XB5 A;  3RPU A;  3P9I A;  2IS2 A;  2DU9 A;  4UVA A;  5HLG A;  5EF6 A;  1V5E A;  2RDP A;  1MBF A;  1NK2 P;  4NBQ A;  2DLL A;  3RZD J;  3HXL A;  2ICW G;  1T0F A;  1YX3 A;  2W00 A;  3C2H A;  2E1M B;  1W7P B;  2STW A;  1UHW A;  1YOV B;  2WAD A;  1RI7 A;  2WB1 A;  3S3N A;  2OTJ I;  2E36 A;  4E7I A;  3A01 B;  1HDD C;  2J5O A;  2VKV A;  4I76 A;  1A04 A;  4JYK A;  2PFB A;  1D3Y A;  1YW9 A;  3HRM A;  5B1B H;  3WTW C;  1N25 A;  5J6X A;  1SMY F;  1BOA A;  1S9H A;  1FP2 A;  2F4O B;  3SZP A;  3HSF A;  2L2O A;  4ZYA A;  3SFZ A;  3QOE A;  3I54 A;  5HS9 A;  5J3L A;  2OTL I;  3KZY A;  3S2H J;  3NWT A;  2MW8 A;  2VJI A;  1HC8 A;  2EH3 A;  1I27 A;  4RB2 C;  2WAQ A;  2PBI A;  3J7A O;  3W6V A;  3CJN A;  3OYA A;  4A5M A;  4AU7 A;  2FBK A;  5J1U A;  4HRI A;  1YG2 A;  3M1E A;  4LB6 B;  2IPQ X;  4WX9 A;  2ETH A;  3E1S A;  3L2V A;  1SVL A;  1BM9 A;  3BTL A;  4KN4 X;  4MLO A;  4QPQ A;  2V9P A;  4LIT A;  3T8T A;  3MKZ A;  3ZPL A;  2DN0 A;  4QWQ A;  4XLF A;  2Y48 A;  2R5Z B;  1LDK B;  1STZ A;  2MAB A;  2P0W A;  3H36 A;  3S32 A;  3H9G A;  5F04 A;  2XDV A;  2JWT A;  2NS7 A;  3FXO A;  1JE8 A;  1J09 A;  2FRH A;  5ICG A;  1GHC A;  1B72 B;  4HX7 A;  5E79 C;  5JFR A;  5LRR A;  2ZNY A;  3U1D A;  2X48 A;  4QSH A;  5FLM J;  2R3S A;  5ILV A;  2E7X A;  5E1W A;  5KAF C;  3KP6 A;  2UZK A;  3HOZ J;  4EVI A;  1P4A A;  2M87 A;  2LF8 A;  2NVT J;  4DQ2 A;  4ANJ A;  2EFP A;  5J1R A;  3OYD A;  4XLE A;  1DPR A;  5JVT A;  3ASN H;  2A3S A;  3CUQ B;  5L3C A;  4HOB A;  1XGS A;  2RRE A;  5IP9 J;  2M8E A;  3K70 D;  3RQ4 A;  4F92 B;  2LFB A;  2CW8 A;  2XPW A;  5L3E A;  2QEX I;  4P55 A;  3R6S A;  1E17 A;  1Z7L A;  2YUS A;  2DOF A;  3P9K A;  3PNT A;  3RPU D;  1HLV A;  2FNA A;  2YU3 A;  5B1A H;  3J7A Y;  2HVR A;  4P5O A;  3ULQ B;  3A1Y A;  1JKR C;  2QGU A;  4WF2 A;  3WG9 A;  1B59 A;  3K2Z A;  2YR2 A;  4A3F J;  3KFW X;  2XF5 A;  1R5G A;  1ZG1 A;  2BXY A;  4RB0 A;  1FBU A;  1WSU A;  4EJO A;  4WK8 F;  1WJF A;  1LQ1 A;  5M3M J;  4UB8 C;  3FHZ A;  3WTU C;  2JTV A;  3ZOB A;  1KU2 A;  2UXX A;  1TLH B;  2HPI A;  2NVU B;  3F3X A;  2WAF A;  2VKD A;  2QCO A;  3QYF A;  4UXN A;  3TBI A;  3LMM A;  1JHF A;  3K1M A;  3ZRG A;  5EG0 B;  3WGG A;  2MSY A;  5DYM A;  5KHD A;  2NRA C;  4YFX F;  3SHF A;  3W2V A;  1SVM A;  4OMZ A;  1JGG A;  5HNF A;  1OYI A;  1NG7 A;  1LEB A;  4IHY A;  4R79 A;  1IRZ A;  3DTI A;  4BE2 A;  2V1U A;  2K4J A;  1GLN A;  4CCJ A;  4AVP A;  1X1D A;  1T38 A;  3HOU J;  5H6Q A;  4ENN A;  2K3F A;  2M34 A;  2QEN A;  2I10 A;  1VQ8 I;  5IT3 A;  1Z67 A;  1BI2 A;  1O3Q A;  4I99 C;  3WG7 H;  2JN6 A;  3G2B A;  3BRO A;  1E0E A;  1UG2 A;  1BJZ A;  2XKP A;  2KJC A;  1I50 J;  1RRJ A;  4EJV A;  2AHQ A;  5M5Y J;  1I39 A;  2NOG A;  3SQN A;  3LSJ A;  4LGW A;  3S93 A;  1XPX A;  1XDU A;  2MFZ A;  2FBH A;  4YG2 F;  3BQZ A;  1QQI A;  3ECH A;  4EQQ A;  1ON2 A;  2HVQ A;  1ETW A;  1O3S A;  4BJ5 C;  1MDM B;  2JVG A;  2XB0 X;  3IL2 A;  2ZJQ F;  4RB1 A;  1SAX A;  2RQQ A;  4I0B A;  3ZMD A;  1T98 A;  1TTY A;  2K9N A;  4IHW A;  5LHH A;  2QZ8 A;  3BR2 A;  3BR5 A;  2EFO A;  3DKY A;  2HKO A;  5DTD A;  3X2Q H;  1ONV A;  2ZXW H;  3TDU C;  3TOA A;  2E19 A;  5CQG A;  1DGR M;  4G12 A;  5JVG F;  4A3G J;  3OS1 A;  3WTY C;  4XBF A;  1QGP A;  1U78 A;  4DIQ A;  1JTX A;  1JTY A;  2DA5 A;  2E60 A;  2G7U A;  5LGU A;  2CV2 A;  2JA7 J;  1JUM A;  2DMN A;  5IY5 H;  3OOU A;  4MTD A;  1HXD A;  2WY7 Q;  3RCO A;  1FMV A;  3BOQ A;  4XLC A;  1DP3 A;  3C2G A;  4CH7 A;  5K7H A;  3HRT A;  5E3N A;  1IN4 A;  3QPS A;  1A5J A;  3BZ6 A;  2NNN A;  2A6H F;  4HPQ A;  4C9Y A;  2FOW A;  3L2C A;  2HU9 A;  1O7F A;  2ZSH B;  3KPH A;  3FDY A;  4IO9 F;  2F48 A;  1J0R A;  1K6O A;  2VQG A;  4XR6 A;  1YS7 A;  3ABK H;  4ABZ A;  1YW7 A;  3E97 A;  4HLX A;  2LMD A;  4UUS B;  3UR3 C;  4F93 B;  4V2F A;  4KUM A;  4ON0 A;  1S7E A;  3GXO A;  4OIQ F;  2KZV A;  3CCE I;  2HYJ A;  1MBE A;  3ASO H;  1WJ5 A;  2JRM A;  4P9U A;  4I98 B;  1SEU A;  4EV0 A;  5FJ8 J;  3H3V K;  2W7N A;  1HQC A;  1OR7 C;  1XGN A;  4L5E A;  2VJ4 A;  2X51 A;  5C4J J;  1MBH A;  3CLO A;  3LSG A;  4A3L J;  4PK4 A;  1OCR H;  2PG4 A;  5E3L A;  3FHN A;  1JJ8 C;  2GIZ A;  4U7D A;  3GFJ A;  2IEK A;  3GF2 A;  2PN6 A;  3O8G A;  2R7U A;  2KFD A;  1ZR4 A;  1CF7 A;  2R7O A;  2LK2 A;  4C3J J;  3OY9 A;  1ZRF A;  3FBN B;  1KYW A;  1FOK A;  1T33 A;  3A03 A;  3T5X A;  2ZXI A;  1YIT I;  5E18 F;  4CXF A;  3OYG A;  1AA7 A;  3ZXS A;  1B1B A;  3AG4 H;  3IP4 B;  1XC5 A;  2A61 A;  1BI0 A;  2ZXH A;  5M5X J;  3QAH A;  3FXK A;  4HV6 A;  3CME I;  1DGW Y;  5TIS C;  3PIO F;  1O3T A;  4EJW A;  5F1R A;  2ELK A;  1FJL A;  5K1Y A;  2P7C B;  1YIO A;  3CES A;  3A0H C;  2BV6 A;  3JRI A;  2LRE A;  3CLQ A;  2K9L A;  3NQO A;  3I4M J;  4AC0 A;  1RNL A;  1K79 A;  1SFK A;  3H9Q A;  4YRV A;  3J7Z I;  2P7V B;  4XM3 A;  2QQB A;  4AYB N;  3H1C A;  2E2H J;  1QZY A;  3TQN A;  1SD7 A;  2XGE A;  2XAU A;  2V1X A;  3QP5 A;  2X1E A;  5DDG A;  1GT0 C;  4EJU A;  3J80 Z;  1D0X A;  1MJB A;  3M8F A;  2MBF A;  4NC6 A;  3E3V A;  1IGN A;  1WFX A;  2A05 A;  2DFE A;  2ZBK A;  4HLY A;  1Q1V A;  1L0O C;  3GTO J;  3CUQ C;  1OQY A;  2X6W A;  2F5E A;  1WJD A;  3ZP5 A;  3M1C A;  1OCZ H;  2LY1 A;  4I01 A;  1YRN A;  3K7A J;  3GLL A;  5FLX Z;  2P8T A;  3Q0U A;  3CUQ A;  3HOX J;  3R4K A;  3VYS B;  2OZ6 A;  1RUN A;  1G59 A;  1VTN C;  1T39 A;  1KYZ A;  2IGO A;  2CQX A;  1XD7 A;  4HG2 A;  4HX8 A;  4IKF A;  4XRF A;  5D5X B;  5M5W J;  3PSF A;  4Z6Y A;  1KON A;  2VKH A;  2O03 A;  4G6Q A;  4DZJ A;  3GZ6 A;  2H8R A;  1MJ9 A;  2NS8 A;  2R7T A;  3EUA A;  4PSX A;  2V26 A;  4DJA A;  4CYC B;  2L02 A;  4E7J A;  1FX7 A;  2JK3 A;  1SFX A;  2ZME A;  4L9N A;  1WJB A;  3CF5 F;  4RGS A;  4IHX A;  2IBD A;  3MZY A;  4DOZ A;  1ODD A;  3GFL A;  1FP1 D;  5JHF A;  3WE2 A;  5B5E C;  2EFN A;  3SFI A;  3QPH A;  4PJL A;  3LSR A;  2Y9Z A;  3GBG A;  1K4T A;  5D5W B;  3AL0 B;  1KU3 A;  4ENJ A;  2LP0 A;  3S14 J;  3NAR A;  5FO5 A;  1KU9 A;  2DQR A;  1V55 H;  2HQA A;  1H88 C;  2OA4 A;  2BBY A;  2DA7 A;  2ID3 A;  2K02 A;  3MMY B;  3OYJ A;  2DMU A;  2EA4 A;  3OS0 A;  2WBM A;  3CO7 C;  3CCJ I;  4A0Z A;  1JUP A;  1IG7 A;  4A3K J;  2HFH A;  4DYC A;  1R6R A;  3DF8 A;  1X1B A;  2LRD A;  3L7W A;  2F2E A;  3FXJ A;  2A68 F;  3LSI A;  4XN3 A;  3IV5 A;  1EH6 A;  1QPM A;  3GZN B;  3ERM A;  2L9N A;  2DA4 A;  3JRF A;  3K4L A;  3LSK A;  2A6E F;  4XSX F;  1JXS A;  4AIK A;  4DW6 A;  1R1U A;  1D8J A;  1IN6 A;  2Q0O A;  3PNV A;  2CW7 A;  3ZN0 A;  1T6S A;  1EA3 A;  5EZG A;  3I3L A;  3FM3 A;  2EIJ H;  1UAA A;  1P7I A;  3IKV A;  1ZH5 A;  5DM7 F;  3DTK A;  1AKH B;  3H9J A;  2LSO A;  2XAJ A;  4C3H J;  2R0Q C;  3P9C A;  4A5N A;  1ORK A;  4BY7 J;  3ISP A;  2D1V A;  5L3B A;  1VI0 A;  2OCE A;  3D5R C;  2V9K A;  3HIF A;  5EEA A;  1VQN I;  5IOY A;  3JTH A;  1G3Y A;  4I02 A;  1WJA A;  3KYC B;  4ESJ A;  2Q2E B;  3GWZ A;  2YPR A;  4MHG A;  2HOT A;  1IN5 A;  1YQA A;  4QLC U;  5LGT A;  2X1C A;  2KRC A;  1RR7 A;  2RKH A;  2VBX A;  1V5G A;  3GTL J;  4FTH A;  2STT A;  2L7F P;  5IP7 J;  3OS2 A;  3MEX A;  2KHM A;  1ZGJ A;  2GXG A;  3L09 A;  4V19 K;  1BBY A;  3BJ6 A;  3R0A A;  5J47 A;  2CWE A;  1K4S A;  1X3W B;  4YIR X;  2FUG 2;  2Y0S N;  1IXS B;  2DA2 A;  4HZF A;  1ZRE A;  2A5W A;  5L3G A;  3M9A A;  1HW2 A;  1E3P A;  1WJE A;  3AFH A;  3WTZ A;  2M0M A;  3MQ0 A;  3V4G A;  2CW0 F;  4A93 J;  4RB3 C;  2M7A A;  1OJL A;  2ELH A;  4YII A;  5HOD A;  5F08 A;  3GLX A;  2CGP A;  3GTQ J;  2BHZ A;  1IN8 A;  2VE9 A;  1MBG A;  1DU6 A;  2WA0 A;  3D0S A;  1U8R A;  1YI2 I;  1OIS A;  2QSH X;  2K7L A;  3V8K A;  3BTI A;  3KX2 A;  2GBY A;  4IEJ A;  4I6Z A;  4Y7N J;  1Z77 A;  4Q48 A;  5FD5 A;  2DDB A;  3BR3 A;  3PFI A;  4XMY A;  3LA7 A;  2HTS A;  2V7F A;  1A6I A;  2EQR A;  3CC7 I;  2BGC A;  2K5C A;  4IRH A;  5FRM A;  5L3F A;  3DLL F;  1SFO J;  1ZG3 A;  4UV9 A;  1ON1 A;  3CQZ J;  2ISZ A;  4MQV A;  4CA0 A;  3LNQ A;  4UNO A;  1NK3 P;  5KVR A;  1GUU A;  4RBO A;  2VLA A;  2ZJR F;  4NC8 A;  2HYF A;  2QSF X;  1XX5 A;  2ZCW A;  4I7H A;  4ZDL A;  3E6M A;  5IYC J;  2K40 A;  3TP0 A;  2XRN A;  3Q9V A;  1ETX A;  3GFM A;  3W6J B;  3W6K B;  5C44 J;  2H6B A;  1VQL I;  2HDD A;  5DEQ A;  5LEK A;  2YX7 A;  4F52 A;  1XTA A;  4NQW A;  2MH9 A;  1F1Z A;  1WKM A;  3ZMS A;  2AO9 A;  3B02 A;  3K2A A;  3FMQ A;  3KYD B;  3ZQF A;  1XB4 A;  3SDB A;  3S8P A;  1Y39 A;  5HVQ C;  4HNT A;  3LOC A;  2DA3 A;  3R60 A;  5L3D A;  3WTS C;  1AOY A;  1HKS A;  1W4M A;  4BNC A;  2NVY J;  4PJ0 C;  3CCR I;  3CZ6 A;  2E1O A;  1ETK A;  2DO7 A;  2ZKZ A;  2R7F A;  1V4R A;  1O7L A;  2FF4 A;  3ZMT A;  3DTE A;  1QZE A;  3OR1 C;  3PSI A;  3GO5 A;  3C7J A;  1PVE A;  1TWA J;  3RTR A;  4LG0 B;  5TJJ A;  3NAU A;  4A6E A;  4B09 A;  5HNH A;  3WTT C;  3IAM 2;  4A3M J;  2LOO A;  4RGU A;  1TW3 A;  4OAZ A;  3OYM A;  3QQA A;  3ZQG A;  3ECO A;  2DW4 A;  3HYI A;  3WGH A;  3GTJ J;  1YYV A;  4AIJ A;  3RYP A;  4IHV A;  4GGG A;  4HNU A;  5HLI A;  3LAP A;  3CDL A;  2CUE A;  5ICE A;  1WQ2 A;  2RC4 A;  1P2F A;  4XLH A;  1S5L C;  4GYI A;  4Q47 A;  1JI8 A;  2IA2 A;  1G3S A;  1W0U A;  2VUM J;  4HF1 A;  3LFK A;  2ZNZ A;  1LVK A;  2ZXJ A;  4IJA A;  3I53 A;  5E8G A;  5FRO A;  4UUV A;  3KP3 A;  4ESB A;  5GAG J;  3ABU A;  2TRT A;  1DP7 P;  2DJI A;  4RAF A;  4LG0 A;  3K9T A;  1R1V A;  1XS9 A;  1G2H A;  3ZGK A;  3CCQ I;  5FKM A;  1IJW C;  2ESN A;  3EUK L;  5IT9 K;  2CQ7 A;  2HDW A;  2R7S A;  2HOE A;  4CCK A;  1R4M B;  1IV6 A;  2HKX A;  2KIM A;  4XQF A;  4CZC A;  1K78 B;  1L3L A;  2GOM A;  1SAU A;  2KRF A;  3G1L A;  2GM4 A;  4CCM A;  1BC8 C;  5D8L B;  4R8H A;  3G71 I;  2R5Y A;  1ZG5 A;  2OD5 A;  4HW0 A;  4LG3 A;  1Y1V J;  1MMD A;  1A35 A;  3CDI A;  1R5I D;  5E1X A;  1I6H J;  1YJ9 I;  3REO A;  3HJE A;  5JLW A;  1FMW A;  1TQM A;  4N0B A;  3S3O A;  1WZ2 A;  3DXJ F;  1W36 C;  4M6V A;  1U5T A;  1QRY A;  2AQE A;  3CJQ B;  2DQL A;  3HOT A;  5CPR B;  3PQJ A;  1SAN A;  3K4J A;  3QWL A;  1X1P A;  4KIG A;  5LGN A;  2EIN H;  4B8X A;  3TED A;  2NAZ A;  4WXH A;  2M2E A;  2GZW A;  4ZYG A;  5EZH A;  4GRI A;  3CD6 I;  4YFK F;  3CJT B;  1E3H A;  1XSX A;  1H9G A;  2WWY A;  4M6Y A;  3CCV I;  5FRN A;  2PQ8 A;  3OYK A;  5DD4 A;  4XRS A;  4OIN F;  2EIK H;  4ZYD A;  1WHU A;  2OU2 A;  4W97 A;  3MKY B;  4JX6 A;  5HS7 A;  1U6G A;  2Y69 H;  2F5C A;  1OKR A;  4X1E A;  3SZG A;  2JVH A;  1F9N A;  1T95 A;  3WU2 C;  1BR4 A;  2KIU A;  5F6F A;  3ONQ A;  1MND A;  4M3D A;  1X3U A;  3IWZ A;  1TWF J;  1Y8Q B;  4O6J A;  1BR2 A;  2LC2 A;  5AIQ A;  4LOC A;  2M7B A;  1RZ4 A;  4GCV A;  3VEP A;  3KEO A;  2FE3 A;  4E7H A;  3J81 K;  1RUO A;  4MIM A;  3RQI A;  3R0J A;  4XLN F;  3K1N A;  4IX7 A;  1Z6T A;  4B3X A;  1W5S A;  2KIQ A;  2MA3 A;  2O61 A;  1IV8 A;  2M5W A;  1U3E M;  2AS5 F;  4NUB A;  1K83 J;  3PFY A;  1ZLJ A;  1X1C A;  1I3A A;  2MD5 A;  2XPU A;  3GUD A;  1U5T B;  5BOX A;  1SD4 A;  4D9J A;  2VOP A;  1RC9 A;  4G6D A;  1QZZ A;  2COM A;  5HDG A;  4ZZD A;  1FYL A;  2BVL A;  2L5Q A;  2UXN A;  4R1H A;  1TW2 A;  4AVZ A;  4DBR A;  3I55 I;  3EPZ A;  3IKT A;  3HG9 A;  3BG9 A;  1BI3 A;  1FIP A;  2VT2 A;  2X85 A;  4Y13 A;  1ZGA A;  4BYY A;  4RM2 A;  3B6A A;  1CQT A;  2E71 A;  1TT5 B;  5JHU A;  1UB9 A;  4DZP A;  3FKJ A;  3IH2 A;  1WVR A;  1R36 A;  3E6C C;  4C2M J;  4MEX F;  4E7K A;  2WAE A;  5H20 A;  2XIG A;  2V1N A;  4A3D J;  1T0F C;  3JRB A;  4FE7 A;  3QPT A;  4D7M A;  1Y6I A;  1F43 A;  3CCL I;  3JRC A;  1FTT A;  5GP9 A;  3LWF A;  5F64 A;  4KDP A;  5GTI C;  3TO9 A;  2KDZ A;  2OBP A;  3TDZ C;  4N9I A;  3JRD A;  4BQA A;  1V5F A;  5DV5 A;  2O5R A;  5EEG A;  3KYL A;  2JRT A;  3IRQ A;  4ZTF A;  4JX4 A;  3CTA A;  1KA8 A;  2BY0 A;  4M3B A;  1F5T A;  3HRU A;  3CP8 A;  5JLX A;  4U7B A;  4UB6 C;  3W2A A;  3VOE A;  3F72 A;  2AXL A;  2Z1D A;  2R7R A;  2E1C A;  2QSG X;  3ESW B;  1G3T A;  2BW3 B;  2HR3 A;  1S6L A;  5AON A;  5CLS A;  3DKW A;  4JBA A;  1EF4 A;  3FZV A;  2BY2 A;  1HA8 A;  5HOO A;  3DCF A;  2HDC A;  4OIP F;  1FYK A;  4C2T A;  2ZFW A;  1UHS A;  2EIL H;  3FXM A;  2IGK A;  3H0G J;  1PJR A;  4RM3 A;  3EYY A;  4PFO A;  3BPV A;  3OSF A;  3H3Z A;  3L2U A;  3IH4 A;  3HPG A;  4ZTJ A;  4RLQ A;  3GTM J;  2ZSI B;  4KIC A;  2LBF A;  3QOD A;  3F9K A;  4U88 A;  4WXC A;  3BWG A;  2HEO A;  2IA1 A;  3I56 I;  3MN2 A;  5FD6 A;  5IPA A;  1S7A A;  4JX5 A;  4LFU A;  1ZKG A;  3HGG A;  3DEW A;  3L2R A;  1LE8 B;  2HTJ A;  2DOE A;  3DV8 A;  3QP6 A;  3TO6 A;  4CCL A;  1PUF A;  3FK6 A;  1D0Y A;  2TCT A;  4KMU X;  3NWS A;  2DA1 A;  1A36 A;  3S1R J;  2DK8 A;  4G9Y A;  4DBQ A;  1MW7 A;  4BUP A;  1XDS A;  2DBB A;  4ZZL A;  2X4H A;  1PP7 U;  3HHH A;  3V8J A;  1I3Q J;  3V7R A;  3R61 A;  3CMY A;  1SD6 A;  1J9I A;  2DK5 A;  1GV5 A;  3HUG B;  2VJ5 A;  4G6T B;  4XID A;  1P6R A;  2MH2 A;  1G3W A;  1P4X A;  2V1D A;  3RKW A;  1R71 A;  5FLX K;  2LBF B;  2KZG A;  3FK7 A;  2CH0 A;  4A69 C;  3JAM Z;  2W82 A;  3DPU A;  1VQK I;  4LK1 F;  4CCO A;  2TDX A;  1CF7 B;  1LEA A;  3HTS B;  2ZO4 A;  4D5C A;  1VZ0 A;  2D1H A;  2DJN A;  4EMS A;  2X6Y A;  4QTR A;  3GME A;  2RAE A;  4XRS G;  4BAY A;  2DDA A;  3F6V A;  4XIC A;  3K10 A;  4L9V A;  5BPD A;  2VIX A;  5FGM A;  4HDV A;  5F0H A;  4BQQ A;  2KP6 A;  3MKL A;  3E6B A;  2ZME C;  4CSW A;  1EV7 A;  3HOY J;  3CC4 I;  1UZC A;  4RLF A;  2JSC A;  1KZH A;  4Q5S F;  1HCR A;  2PJP A;  2P5L C;  3VWB A;  3ML6 A;  3WTV C;  1ACI A;  4UY8 I;  2GIV A;  2Z9O A;  3KP2 A;  1D1A A;  2P5V A;  4BL0 B;  3M8E A;  3LSP A;  3GYH X;  4IQJ A;  2X9D A;  1TQP A;  4KIB A;  5E8I A;  4NQW B;  4D1Q A;  3N4M A;  2Z3Y A;  1FSH A;  2W1O A;  2G0E A;  2B0L A;  4H0E A;  2XHK A;  4BJT A;  1FBQ A;  1X58 A;  1MMG A;  3K4K A;  4CDG A;  3WU1 B;  2G7H A;  4CYC A;  3SXY A;  1T8I A;  1AKH A;  4ZH4 F;  4JOM A;  1RET A;  1UCR A;  2VXZ A;  1GXQ A;  1R7J A;  3PO2 J;  1S3J A;  1MJA A;  3K69 A;  3GTG J;  3JTG A;  2QUF A;  2VBY A;  3TOB A;  2F4I A;  1R9T J;  1SC7 A;  2RNJ A;  4HEA 2;  3E0J B;  3NRV A;  2OF7 A;  4RGX A;  4Y15 A;  2ZFU A;  2CFX A;  2QQ9 A;  1U0J A;  4HBL A;  3SYT A;  1QPI A;  3DU5 A;  3F8B A;  1MMN A;  3P7N A;  4HQM A;  2OC6 A;  3I59 A;  4M9Z A;  1IRF A;  3KCC A;  4BXX J;  2HXI A;  4A3E J;  3E5U A;  1POG A;  2CQN A;  3HSE A;  4KMF A;  4HNV A;  1UG0 A;  1TP4 A;  4BAC A;  1S29 A;  2HZT A;  4S04 A;  3EUH A;  1PP8 F;  2FX0 A;  4XK4 A;  3ZCO A;  2VL8 A;  2ZJP F;  1DPU A;  4M72 A;  4MTE A;  1FIA A;  4FIS A;  1YHQ I;  5LFA A;  4KNY A;  2Z5U A;  3KEQ A;  1X19 A;  5K5O A;  1ULY A;  1H8A C;  1MH4 A;  2MGQ A;  3CDH A;  1XMK A;  2PJR A;  3ZQ7 A;  2M45 A;  2KIF A;  3F21 A;  3K1P A;  2JA5 J;  2WB1 N;  2COB A;  3DFG A;  4LLG F;  4HQE A;  5DCF A;  1TNS A;  3JSO A;  1XSD A;  2F5V A;  1GVD A;  2CJJ A;  1XCB A;  2VKE A;  2DOD A;  4A6D A;  1MSE C;  2JA6 J;  2E35 A;  4F3Q A;  3UKG A;  1CGP A;  4OU0 A;  2GXA A;  3TW7 A;  1TT0 A;  2BE5 F;  2ZC2 A;  1DDN A;  1I5Z A;  1WH7 A;  3OYL A;  3F22 A;  2RV8 A;  2HQR A;  2QKL B;  4B3A A;  2LDU A;  4HSR A;  2K9S A;  1Z1D A;  2H6C A;  2XPV A;  1TQI A;  5TGT A;  1BA5 A;  5J4V A;  2C6Y A;  3BLY A;  3I0T A;  2OUM A;  3M8J A;  1IXC A;  4AIH A;  2KT0 A;  1EH7 A;  2A5Y B;  3PL8 A;  1NG6 A;  3RDI A;  3CCM I;  5LD2 C;  2X6O A;  3DLA A;  3BR6 A;  3IUO A;  3FXU A;  1S72 I;  1J75 A;  4LD5 A;  3VSK A;  2M1B A;  3N97 A;  3VYT B;  2JPC A;  2I8D A;  4G8X A;  4RDU A;  1Z6R A;  1VQP I;  3H35 A;  2PMU A;  1VQM I;  2NYX A;  4S0H B;  2H1L A;  1YO5 C;  1OCO H;  2DMT A;  5DUI A;  2A69 F;  2FU4 A;  5CJ9 A;  3OR2 C;  4QPO A;  1BW6 A;  4GXO A;  5F0C A;  1MMS A;  1P92 A;  3FXQ A;  1W5C C;  3OIP A;  3JAM K;  5D5U B;  4KYW A;  2B63 J;  1Y8R B;  2VE8 A;  2X1D A;  3RKY A;  1EH8 A;  3WOD F;  3LAJ A;  3FWE A;  3IAS 2;  5IYB J;  3S15 J;  3QPL A;  2Q2E A; 
#chains in the Genus database with same CATH homology
 2UWM A;  1O57 A;  3O2P E;  1MZB A;  4BHC A;  2PEX A;  4S05 A;  4I09 A;  4HF2 A;  1R23 A;  3J81 Z;  3I5U A;  5K5Q A;  1DUX C;  4EM0 B;  3HRS A;  2FNP A;  1KGS A;  2HQN A;  2IVM A;  4L5I A;  3B73 A;  4O5V A;  3RPQ A;  3KE2 A;  3EYI A;  3COA C;  1WRJ A;  1BJA A;  2A07 F;  2O8X A;  2P6T A;  1ZRC A;  3MAJ A;  2GAU A;  1R58 A;  2O6G E;  1HSJ A;  1Q1H A;  3ZMV A;  2HYG D;  3KZZ A;  4ETS A;  1Z9C A;  1YFH A;  5JR3 A;  3WE3 A;  1QO0 D;  3OOP A;  1HW5 A;  3ZMU A;  1WI9 A;  2V79 A;  3ERE D;  2FOK A;  2W25 A;  4IPA A;  4CHU A;  5DUK A;  2GQQ A;  1IF1 A;  2JPB A;  2DPU A;  5LRS A;  3U9G A;  2F5D A;  3H92 A;  4N9H A;  2QLZ A;  3EDP A;  4IHT A;  3F8N A;  1GXP A;  1ZLK A;  3VFZ A;  1YS6 A;  2WTE A;  2CSO A;  4M71 A;  3LA2 A;  1LDD A;  2NNY A;  2XAH A;  4NB5 A;  4BH9 A;  5LEJ A;  4ZYH A;  1KU7 A;  2CYY A;  2QBY B;  2OAZ A;  2ADU A;  3I59 B;  3BP8 A;  2WC2 A;  1SMT A;  5A2Q K;  2L3D A;  2Z33 A;  3BDD A;  5J8F A;  4KIF A;  2HWV A;  1YTY A;  3J80 K;  2GA1 A;  5IT9 Z;  2FEZ A;  1D8K A;  4RAY A;  1O3R A;  4U0V A;  2EFW A;  3LA3 A;  4UHT A;  2DPD A;  3Q5F A;  4HA8 A;  1R1T A;  1JGS A;  1P4W A;  2H94 A;  1J5Y A;  1ZAO A;  4K2E A;  4L18 B;  2FBI A;  3WTX C;  5EEH A;  4ASN A;  4KN7 X;  1KQ8 A;  1W7P D;  2P6S A;  1FSE A;  2EV6 A;  4EJT A;  4NHJ A;  4RAZ A;  2PLY A;  3MFK A;  3GW2 A;  1BIA A;  3C3W A;  1KQ9 A;  2RVC A;  1IUY A;  2DFI A;  3FM5 A;  4A12 A;  3TO7 A;  3V7C A;  4FHT A;  4EGY A;  2HGC A;  1FZP B;  3H3U A;  2W85 A;  3DPL C;  1XN7 A;  3OV8 A;  4PGH A;  1J59 A;  5E1Z B;  2BYV E;  4F7Z A;  2ACJ A;  1J2X A;  2VC0 A;  2ZME B;  4EM2 A;  3V8L A;  1LJ9 A;  4G94 A;  1T2K A;  5HLH A;  4LMY A;  3KET A;  3G73 A;  1WWX A;  4MEY F;  5K5R A;  2WV0 A;  5H6R A;  2NS0 A;  5CVJ A;  4UVC A;  2W24 A;  4G7H F;  4IRG A;  3TGN A;  1MDM A;  3U2R A;  3L9F A;  5HDK A;  3O6B B;  5ILS A;  2YSR A;  4CO8 A;  3BPX A;  3RI4 A;  1G6N A;  1AWC A;  4WXD A;  4XSZ F;  3V7S A;  2GA2 A;  2VON A;  4LK0 F;  1MKM A;  4KT5 C;  2RQP A;  3ABT A;  1LDJ A;  1Z7U A;  2W57 A;  3S2W A;  4UVB A;  3FF5 A;  3DP7 A;  4BXU A;  4IHS A;  3HSR A;  4XLP F;  4HV5 A;  2K86 A;  3KP5 A;  4M74 A;  2OQR A;  3D5L A;  3IWF A;  4PGG A;  2XRO A;  1V3F A;  2FSW A;  1XGO A;  3MZH A;  3F8M A;  3BJA A;  4HDU A;  1B9N A;  3FX3 A;  1IRG A;  5ERI A;  2XUB A;  2L4M A;  2V9V A;  4AWX B;  3QRF F;  1HKT A;  2DAO A;  5TRD A;  1W7P A;  4IF4 A;  1FBS A;  2FA5 A;  3QU6 A;  3T8R A;  2IJL A;  2VC1 A;  1SFU A;  3GVA A;  1NHA A;  4JK1 X;  3DEU A;  4Q4Z F;  3WU0 A;  5KK1 A;  1SFE A;  2L54 A;  4A0Y A;  5BMZ A;  2XGX A;  5FFZ A;  4ZYE A;  4DNC A;  4L0Y B;  2KJB A;  3T1B A;  4CGZ A;  2CQK A;  3F8C A;  2PI0 A;  2QVO A;  2E7W A;  3HTU A;  4KA4 A;  2JT1 A;  4JQF A;  2ESH A;  5DCM A;  3F8F A;  4AD9 A;  3LQQ A;  1QNT A;  3NEU A;  3E5X A;  4ESF A;  1OYY A;  4M73 A;  4E70 A;  4LB5 A;  1R22 A;  4FX0 A;  4D0P A;  4UV8 A;  5ED4 A;  1Y0U A;  1D5V A;  1ZRD A;  5D4R A;  1HST A;  3KLN A;  2GXB A;  2EFQ A;  3PQK A;  4CIC A;  2ZJ2 A;  4OMY A;  3C1D A;  2MLG A;  2W84 A;  5HDN A;  2L4A A;  1TNT A;  1I1G A;  3O3K A;  1PUE E;  1F4K A;  5LLQ A;  3FMR A;  1BN5 A;  2MLK A;  1H0M A;  4CZZ A;  4EGZ A;  4OIO F;  4U0W A;  4BHB A;  2EV0 A;  5D8K B;  2QQA A;  1FWZ A;  2VN2 A;  5FFX A;  3ZN1 A;  4KFC A;  1XMA A;  1C0W A;  1B6A A;  3CUO A;  4YIF A;  3GX4 X;  4GO1 A;  1QBJ A;  4LJZ F;  1SD5 A;  1BC7 C;  2H09 A;  5CYV A;  1S8N A;  4L9J A;  1K7A A;  1FY7 A;  3ELK A;  4FT8 A;  2LKP A;  2D45 A;  4YFN F;  3IHU A;  4RGR A;  1TBX A;  5ILU A;  4IRI A;  4ENM A;  4P96 A;  3ROU A;  5FB2 A;  1IAW A;  3RKX A;  3LST A;  3VOD A;  2FQ3 A;  3E6D A;  4M9S A;  4WCG A;  2QWW A;  5BS6 A;  2RN7 A;  2O3F A;  3HUG A;  3RYR A;  2EB7 A;  1ZYR F;  2MC3 A;  1IW7 F;  1REP C;  1RIO H;  4OIR F;  2ISY A;  2D2W A;  2X0L A;  2VBW A;  3G3Z A;  3T0Y A;  5ICF A;  2IW5 A;  3HOS A;  3JSP A;  5CVV A;  3SZT A;  2VOD A;  3EQL F;  2OZU A;  2PMH A;  3F6O A;  4HX4 A;  4HYE A;  1ZHF A;  1FYM A;  1S7O A;  2Q8K A;  1U5T C;  4MQ9 F;  1I6X A;  1UST A;  1YLF A;  4PDK A;  5HS8 A;  2Z99 A;  1FT9 A;  1PDN C;  4P9F A;  1U2W A;  3EET A;  2HS5 A;  2G9W A;  1HBX G;  2IA0 A;  5LHI A;  2IT0 A;  2H27 A;  1ZAR A;  2K27 A;  5LBQ A;  1E2X A;  2P5K A;  1KQ0 A;  2XAG A;  3I4P A;  2EJR A;  2QYO A;  4M9X A;  1LNW A;  3GEZ A;  4A2U A;  4GYG A;  5E20 A;  3AAF A;  1GVJ A;  4U0Y A;  5BPI A;  2Y75 A;  5J8C A;  5D5V B;  2DI3 A;  3GZ5 A;  3FXR A;  4Y17 A;  3I64 A;  2VBZ A;  4IVN A;  3HHG A;  1Z05 A;  4LLN A;  1USS A;  5DCM B;  4EM1 A;  3E5Q A;  4CYD A;  3TKY A;  1UHM A;  1G4D A;  1OYW A;  3DQV C;  3QOP A;  1FLI A;  5BQT A;  4LLL A;  1B4A A;  2V6C A;  1HKQ A;  2QBY A;  1ZN2 A;  2IP2 A;  4L5J A;  1IN7 A;  2FMY A;  1R5H A;  4O3M A;  4MNU A;  4L9T A;  1I1S A;  2KKO A;  3MWM A;  2EV5 A;  2XKO A;  3IC7 A;  4I0A A;  2LNB A;  2XVC A;  3GFI A;  2J5P A;  4BHP A;  2CO5 A;  3C18 A;  1FNN A;  4HAM A;  5D6E A;  1IZ1 A;  1XSV A;  2GWR A;  1BI1 A;  2FML A;  1UFM A;  2EK5 A;  4RS8 A;  1FPQ A;  1IXR C;  4ENK A;  3QU3 A;  2M30 A;  3IRR A;  2L01 A;  1HW1 A;  5D4S A;  6PAX A;  2EWN A;  3RJP A;  1OMI A;  1FC3 A;  2IRF G;  1BIB A;  3FMS A;  3JW4 A;  4FX4 A;  2K4B A;  1B9M A;  3VB2 A;  3M7G A;  4PZJ A;  1H9T A;  2VT3 A;  3DPT A;  2BEO A;  3F23 A;  5DD8 A;  2OQG A;  3I58 A;  1Z91 A;  1K78 A;  2R7D A;  5CVR A;  3ZMZ A;  5AIP A;  3I71 A;  1R00 A;  4L0Z B;  2P4W A;  3L00 A;  1MGT A;  1JHH A;  2E1N A;  4A0X A;  5JI6 A;  5CVI A;  2VOO A;  2DT5 A;  3KP4 A;  5A2Q Z;  4G7Z F;  4OOI A;  2Y0M A;  2XAF A;  4M6X A;  3CO6 C;  1LVA A;  1J7K A;  3KLO A;  1XGM A;  1MD0 A;  2RGV A;  2F5F A;  3BY6 A;  3RIR A;  1XCV A;  5D6F A;  5LHG A;  1W5T A;  4WWC A;  5ICC A;  5E17 F;  2DTR A;  2XAS A;  1OPC A;  3KP7 A;  4TV7 A;  3BJO A;  3MCZ A;  2JZY A;  2XAQ A;  2O0Y A;  3K0L A;  3Q9S A;  2CG4 A;  2XV4 S;  3WGI A;  4I2O A;  2YX4 A;  2EA2 A;  5CVU A;  4Z2Y A;  1OR7 A;  2FXA A;  3LQR A;  4G7O F;  4HF0 A;  4MGR A;  4PCQ A;  2QM3 A;  1LB2 A;  2LF7 A;  4IXA A;  1YW8 A;  3RPU A;  3P9I A;  2DU9 A;  4UVA A;  5HLG A;  2RDP A;  2DLL A;  1T0F A;  1W7P B;  2STW A;  1UHW A;  1RI7 A;  2J5O A;  1A04 A;  2PFB A;  1D3Y A;  1YW9 A;  3HRM A;  3WTW C;  5J6X A;  1SMY F;  1BOA A;  1FP2 A;  3SZP A;  3HSF A;  3SFZ A;  3I54 A;  5HS9 A;  3KZY A;  1I27 A;  4RB2 C;  2PBI A;  3J7A O;  3CJN A;  4A5M A;  2FBK A;  1YG2 A;  3M1E A;  4LB6 B;  2IPQ X;  4WX9 A;  2ETH A;  1BM9 A;  4KN4 X;  3T8T A;  3ZPL A;  4QWQ A;  2Y48 A;  1LDK B;  1STZ A;  1JE8 A;  2FRH A;  5ICG A;  1GHC A;  4HX7 A;  5JFR A;  5LRR A;  2ZNY A;  3U1D A;  2R3S A;  5ILV A;  2E7X A;  5E1W A;  3KP6 A;  2UZK A;  4EVI A;  1P4A A;  2M87 A;  2LF8 A;  4DQ2 A;  2EFP A;  1DPR A;  5JVT A;  2A3S A;  3CUQ B;  5L3C A;  4HOB A;  1XGS A;  2M8E A;  5L3E A;  4P55 A;  3R6S A;  1E17 A;  3P9K A;  2FNA A;  2YU3 A;  4P5O A;  3ULQ B;  4WF2 A;  3WG9 A;  1B59 A;  3K2Z A;  2YR2 A;  3KFW X;  1R5G A;  1ZG1 A;  4RB0 A;  1FBU A;  1WSU A;  4EJO A;  4WK8 F;  1LQ1 A;  3FHZ A;  3WTU C;  2JTV A;  1KU2 A;  2UXX A;  1TLH B;  3F3X A;  4UXN A;  1JHF A;  3K1M A;  3WGG A;  5DYM A;  2NRA C;  4YFX F;  3SHF A;  4OMZ A;  1OYI A;  1LEB A;  4R79 A;  2V1U A;  2K4J A;  4AVP A;  1T38 A;  5H6Q A;  4ENN A;  2QEN A;  5IT3 A;  1BI2 A;  1O3Q A;  3BRO A;  2XKP A;  2KJC A;  4EJV A;  3SQN A;  4LGW A;  1XDU A;  2FBH A;  4YG2 F;  1QQI A;  3ECH A;  4EQQ A;  1ON2 A;  1MDM B;  1O3S A;  1SAX A;  3IL2 A;  4RB1 A;  4I0B A;  3ZMD A;  1T98 A;  1TTY A;  5LHH A;  2QZ8 A;  2EFO A;  2HKO A;  1ONV A;  3TDU C;  3TOA A;  3WTY C;  4XBF A;  1QGP A;  1U78 A;  2G7U A;  5LGU A;  4MTD A;  1HXD A;  3BOQ A;  3HRT A;  1IN4 A;  3BZ6 A;  2NNN A;  2A6H F;  3L2C A;  1O7F A;  1J0R A;  1K6O A;  1YS7 A;  1YW7 A;  3E97 A;  4HLX A;  4KUM A;  4ON0 A;  3GXO A;  4OIQ F;  4P9U A;  4I98 B;  4EV0 A;  1HQC A;  1XGN A;  3CLO A;  2PG4 A;  4U7D A;  3GFJ A;  3GF2 A;  2PN6 A;  1CF7 A;  1ZRF A;  1KYW A;  1FOK A;  3T5X A;  5E18 F;  4CXF A;  1B1B A;  2A61 A;  1BI0 A;  3QAH A;  4HV6 A;  1O3T A;  4EJW A;  5F1R A;  5K1Y A;  2P7C B;  1YIO A;  2BV6 A;  3NQO A;  1RNL A;  1K79 A;  2P7V B;  2QQB A;  1QZY A;  3TQN A;  1SD7 A;  2V1X A;  3QP5 A;  5DDG A;  4EJU A;  3J80 Z;  1MJB A;  3M8F A;  2MBF A;  3E3V A;  2ZBK A;  4HLY A;  1L0O C;  3CUQ C;  2F5E A;  3ZP5 A;  4I01 A;  5FLX Z;  2P8T A;  3CUQ A;  3R4K A;  2OZ6 A;  1RUN A;  1VTN C;  1T39 A;  1KYZ A;  1XD7 A;  4HX8 A;  4XRF A;  5D5X B;  2O03 A;  4G6Q A;  3GZ6 A;  1MJ9 A;  2L02 A;  1FX7 A;  1SFX A;  2ZME A;  4L9N A;  4RGS A;  3MZY A;  1ODD A;  3GFL A;  1FP1 D;  3WE2 A;  2EFN A;  3QPH A;  5D5W B;  1KU3 A;  4ENJ A;  5FO5 A;  1KU9 A;  2DQR A;  2OA4 A;  2BBY A;  2K02 A;  2EA4 A;  3CO7 C;  4A0Z A;  2HFH A;  3DF8 A;  3L7W A;  2F2E A;  2A68 F;  1EH6 A;  1QPM A;  2A6E F;  4XSX F;  1JXS A;  4AIK A;  1R1U A;  1D8J A;  1IN6 A;  2Q0O A;  3ZN0 A;  1T6S A;  3FM3 A;  3IKV A;  1ZH5 A;  2LSO A;  2XAJ A;  3P9C A;  4A5N A;  3ISP A;  2D1V A;  5L3B A;  3HIF A;  3JTH A;  1G3Y A;  4I02 A;  4ESJ A;  3GWZ A;  4MHG A;  2YPR A;  1IN5 A;  1YQA A;  4QLC U;  5LGT A;  2RKH A;  2VBX A;  2STT A;  3MEX A;  1ZGJ A;  2GXG A;  3L09 A;  1BBY A;  3BJ6 A;  3R0A A;  2CWE A;  1IXS B;  1ZRE A;  4HZF A;  5L3G A;  3M9A A;  1HW2 A;  3WTZ A;  3MQ0 A;  3V4G A;  2CW0 F;  4RB3 C;  2ELH A;  4YII A;  2CGP A;  3GLX A;  1IN8 A;  2VE9 A;  3D0S A;  1U8R A;  2K7L A;  3V8K A;  4Q48 A;  5FD5 A;  3PFI A;  3LA7 A;  2HTS A;  2BGC A;  4IRH A;  5L3F A;  1ZG3 A;  4UV9 A;  1ON1 A;  2ISZ A;  4MQV A;  4UNO A;  5KVR A;  2HYF A;  2ZCW A;  4I7H A;  3E6M A;  2XRN A;  3Q9V A;  3GFM A;  3W6J B;  3W6K B;  2H6B A;  5DEQ A;  5LEK A;  2YX7 A;  4NQW A;  2MH9 A;  1F1Z A;  1WKM A;  3ZMS A;  3B02 A;  3FMQ A;  1XB4 A;  5HVQ C;  3R60 A;  5L3D A;  3WTS C;  1AOY A;  1HKS A;  1W4M A;  4BNC A;  2DO7 A;  2ZKZ A;  2R7F A;  1V4R A;  1O7L A;  2FF4 A;  3ZMT A;  3GO5 A;  3C7J A;  4LG0 B;  3RTR A;  5TJJ A;  4A6E A;  4B09 A;  3WTT C;  4RGU A;  1TW3 A;  3ECO A;  2DW4 A;  3HYI A;  3WGH A;  1YYV A;  4AIJ A;  3RYP A;  4GGG A;  3LAP A;  5HLI A;  5ICE A;  1WQ2 A;  2RC4 A;  1P2F A;  4GYI A;  4Q47 A;  2IA2 A;  1G3S A;  4HF1 A;  3LFK A;  2ZNZ A;  2ZXJ A;  4IJA A;  3I53 A;  5E8G A;  4UUV A;  3KP3 A;  4ESB A;  3ABU A;  1DP7 P;  4LG0 A;  3K9T A;  1R1V A;  2ESN A;  5IT9 K;  2HOE A;  2HKX A;  2KIM A;  1K78 B;  1L3L A;  2KRF A;  1BC8 C;  5D8L B;  4R8H A;  1ZG5 A;  2OD5 A;  4HW0 A;  5E1X A;  3REO A;  1TQM A;  4N0B A;  3DXJ F;  1U5T A;  2DQL A;  3HOT A;  3PQJ A;  4KIG A;  5LGN A;  4B8X A;  2NAZ A;  4WXH A;  2GZW A;  4ZYG A;  4YFK F;  1XSX A;  1H9G A;  2WWY A;  4M6Y A;  2PQ8 A;  5DD4 A;  4OIN F;  4ZYD A;  2OU2 A;  5HS7 A;  1U6G A;  2F5C A;  1OKR A;  1F9N A;  2KIU A;  5F6F A;  1X3U A;  3IWZ A;  4O6J A;  5AIQ A;  1RZ4 A;  4GCV A;  3VEP A;  3KEO A;  2FE3 A;  3J81 K;  1RUO A;  3R0J A;  4XLN F;  3K1N A;  1Z6T A;  1W5S A;  2MA3 A;  2O61 A;  2M5W A;  1U3E M;  2AS5 F;  1ZLJ A;  2MD5 A;  3GUD A;  1U5T B;  5BOX A;  1SD4 A;  2VOP A;  4G6D A;  1QZZ A;  2COM A;  5HDG A;  4ZZD A;  1FYL A;  4R1H A;  2UXN A;  1TW2 A;  3IKT A;  1BI3 A;  2VT2 A;  4Y13 A;  1ZGA A;  4BYY A;  5JHU A;  1UB9 A;  1R36 A;  3E6C C;  4MEX F;  5H20 A;  2XIG A;  3QPT A;  4KDP A;  3LWF A;  5F64 A;  3TO9 A;  2OBP A;  3TDZ C;  4N9I A;  4BQA A;  5DV5 A;  5EEG A;  2JRT A;  3IRQ A;  3CTA A;  1KA8 A;  1F5T A;  3HRU A;  4U7B A;  3VOE A;  3F72 A;  2AXL A;  2E1C A;  1G3T A;  2HR3 A;  1S6L A;  5AON A;  5CLS A;  3DKW A;  4JBA A;  3FZV A;  5HOO A;  2HDC A;  4OIP F;  1FYK A;  2ZFW A;  3EYY A;  3BPV A;  3H3Z A;  4KIC A;  4U88 A;  4WXC A;  3BWG A;  2HEO A;  2IA1 A;  5FD6 A;  1S7A A;  4LFU A;  2HTJ A;  3DV8 A;  3QP6 A;  3TO6 A;  4KMU X;  2DK8 A;  4G9Y A;  1XDS A;  2DBB A;  4ZZL A;  2X4H A;  1PP7 U;  3HHH A;  3V8J A;  3V7R A;  3R61 A;  1SD6 A;  1J9I A;  2DK5 A;  1P6R A;  2MH2 A;  1G3W A;  1P4X A;  2V1D A;  3RKW A;  5FLX K;  3JAM Z;  4LK1 F;  1CF7 B;  2TDX A;  1LEA A;  3HTS B;  2ZO4 A;  2D1H A;  4EMS A;  4BAY A;  3F6V A;  4L9V A;  5BPD A;  5FGM A;  4HDV A;  3E6B A;  1EV7 A;  2JSC A;  4Q5S F;  2PJP A;  2P5L C;  3ML6 A;  3WTV C;  2GIV A;  2Z9O A;  3KP2 A;  2P5V A;  3M8E A;  3GYH X;  1TQP A;  4KIB A;  5E8I A;  3N4M A;  2Z3Y A;  1FSH A;  4H0E A;  2B0L A;  2XHK A;  1FBQ A;  4CDG A;  3WU1 B;  2G7H A;  3SXY A;  4ZH4 F;  1UCR A;  2VXZ A;  1GXQ A;  1R7J A;  1S3J A;  1MJA A;  3K69 A;  3JTG A;  2QUF A;  2VBY A;  3TOB A;  2RNJ A;  4RGX A;  3NRV A;  4Y15 A;  2CFX A;  2QQ9 A;  4HBL A;  3F8B A;  3P7N A;  4HQM A;  4M9Z A;  3I59 A;  1IRF A;  3KCC A;  3E5U A;  3HSE A;  4KMF A;  1S29 A;  2HZT A;  4S04 A;  3EUH A;  1PP8 F;  1DPU A;  4M72 A;  4MTE A;  4KNY A;  2Z5U A;  3KEQ A;  5K5O A;  1ULY A;  3CDH A;  1XMK A;  3ZQ7 A;  2M45 A;  2KIF A;  3F21 A;  3K1P A;  3DFG A;  4LLG F;  4HQE A;  5DCF A;  1TNS A;  3JSO A;  1XSD A;  1XCB A;  4A6D A;  1CGP A;  4OU0 A;  2BE5 F;  1DDN A;  1I5Z A;  3F22 A;  2RV8 A;  2HQR A;  2LDU A;  1Z1D A;  2H6C A;  1TQI A;  2C6Y A;  3I0T A;  1IXC A;  4AIH A;  1EH7 A;  2A5Y B;  3RDI A;  3FXU A;  1J75 A;  4LD5 A;  2M1B A;  3N97 A;  2JPC A;  4G8X A;  1Z6R A;  2PMU A;  2NYX A;  1YO5 C;  5DUI A;  2A69 F;  2FU4 A;  5CJ9 A;  4GXO A;  1P92 A;  3FXQ A;  3JAM K;  5D5U B;  4KYW A;  2VE8 A;  3RKY A;  1EH8 A;  3WOD F;  3LAJ A;  3FWE A;  2Q2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...