4L0ZB

Crystal structure of runx1 and ets1 bound to tcr alpha promoter (crystal form 2)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
101
structure length
101
Chain Sequence
SGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Runt-related transcription factor 1
publication title Structural basis of Ets1 activation by Runx1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 33
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l0zB00
4LB6B 1PUEE 3WODF 2DU9A 2VT2A 2P5VA 3K0LA 4CO8A 2W25A 2D1VA 4N9IA 1BJAA 1LDDA 3ROUA 3HSRA 2GXBA 5HDKA 4R1HA 2DAOA 3JSPA 3BROA 1ULYA 3ZN1A 1XSXA 3TDUC 4ZZDA 2F5EA 1FZPB 2FEZA 1ZAOA 1ON2A 2IP2A 2KRFA 3C18A 4P96A 5HLIA 2ELHA 5HOOA 4IF4A 4BYYA 2XVCA 2HTJA 2AXLA 3N97A 2Z99A 3JAMZ 5BOXA 4LK1F 1IN7A 3KP7A 3K1NA 4RAZA 1MGTA 4EM1A 5K5RA 1Z05A 4RGSA 4EGZA 1QGPA 2Q0OA 2XIGA 5E8IA 1K7AA 1LEAA 1O3TA 2TDXA 3F23A 2ZMEB 3WU1B 3CO6C 5BMZA 3KP4A 4ZZLA 2ESNA 4UNOA 1AOYA 1PDNC 5ILVA 3KCCA 5IT9Z 4LLLA 3R60A 2MD5A 2FF4A 2EFOA 3ZMVA 3WE2A 4FT8A 1RUOA 3R4KA 4L18B 4OMYA 1FC3A 4CHUA 4A5MA 2GA2A 3KEQA 1JHHA 2QENA 3KP3A 1G3SA 3EYYA 4ENMA 4Y15A 2HTSA 4LGWA 5JFRA 1MJBA 1JGSA 5D6FA 3WTWC 4U7DA 2BYVE 3E6CC 3EDPA 2KIMA 1TW3A 2IJLA 2QLZA 3EQLF 3I54A 2IA0A 2L02A 4G7OF 2L3DA 2OZ6A 3CDHA 3F6OA 2E1NA 3ABUA 4G6DA 5E1ZB 1FP2A 1TNTA 2FBHA 2NRAC 2ZXJA 3DFGA 4LB5A 2Y75A 3HOSA 3Q9SA 3WE3A 3GVAA 2KIFA 4LMYA 2VE8A 5DEQA 1J0RA 4YIIA 4LFUA 1E17A 2OU2A 3GFJA 4PGGA 2RV8A 1SD5A 3WTZA 2FNAA 3GZ6A 3IHUA 3GXOA 1R22A 4JK1X 1FP1D 4LG0A 1BI2A 3ZMTA 2V1XA 4M74A 3MEXA 5KVRA 4I01A 4HQEA 1YTYA 1R58A 4HAMA 1B9NA 2JT1A 3EETA 1YQAA 3Q9VA 5HS8A 4G9YA 4ON0A 1P2FA 2ZCWA 1IAWA 1P4XA 2E1CA 1JHFA 4G8XA 4KMFA 2WWYA 4TV7A 2STTA 2Z3YA 3GWZA 4KNYA 4OIQF 2BBYA 4M73A 4HDUA 1VTNC 2M87A 1DDNA 3FHZA 1UHWA 4UVCA 3F21A 1ZRDA 1OPCA 5H20A 2IRFG 3HTUA 5FD5A 5CVRA 2ZKZA 3LAPA 1T0FA 2LSOA 4OIPF 3PFIA 4AD9A 3DPLC 4EJOA 1A04A 3I4PA 1SMTA 1W7PD 1JE8A 1V3FA 4KIBA 1LJ9A 2G7UA 2YPRA 1HSJA 5CVIA 2PI0A 2W24A 1R1TA 3EUHA 5LGTA 4ESFA 1SAXA 4AVPA 1EH8A 5TRDA 1WKMA 3M7GA 2ZJ2A 1BIBA 3I53A 1TNSA 4YFXF 1I1GA 4CDGA 2WV0A 4P9UA 1HSTA 2YX4A 2JTVA 5FO5A 3MCZA 1XCVA 2JRTA 4EJTA 5E20A 4N0BA 3HUGA 4S05A 4BNCA 4L5JA 2GZWA 4GYIA 2EFPA 3TOAA 4RGXA 4A5NA 1J2XA 3RKYA 4A0ZA 2ZMEA 1SFXA 4RAYA 2UZKA 1B9MA 2Y0MA 3REOA 3U1DA 2O8XA 3VB2A 2F5DA 4Q4ZF 2M30A 1Q1HA 1R1VA 3L7WA 3B73A 3E6DA 3KLOA 4OMZA 1IN6A 3I59B 1XCBA 3ZMSA 3L00A 4CICA 5A2QZ 3D5LA 1BI1A 4A0YA 4G7ZF 3PQKA 4HA8A 5HS7A 3HRSA 4OIOF 3P9KA 3RKWA 4Y17A 2A5YB 1HW5A 2P5LC 2O6GE 3O3KA 4KFCA 3WGGA 4R79A 3WTYC 2X4HA 4KYWA 3TO9A 1D5VA 4ESJA 2ADUA 4P9FA 4KA4A 4Q48A 4O3MA 2DT5A 3V8JA 2HS5A 2CFXA 3HTSB 5E1WA 3ML6A 4Z2YA 3B02A 4L5IA 4L9VA 2MBFA 3IKVA 3HIFA 3JTHA 4YFNF 3M8FA 2VBYA 3FF5A 2WC2A 2OQRA 1RUNA 3D0SA 3BWGA 2YR2A 4B8XA 2EV0A 1ZLKA 2EA2A 4I09A 4ZH4F 1LVAA 3F72A 3E5QA 3ABTA 2ZNYA 2H94A 1IN8A 5EEHA 3WU0A 3DQVC 2NNYA 5DCMB 3U2RA 5L3CA 1P4AA 1U6GA 3OOPA 3ULQB 3NQOA 1R23A 5F1RA 1USTA 2DK8A 1W7PA 5AONA 1WSUA 5IT3A 5D8KB 4MNUA 3I5UA 2RQPA 1IW7F 1B6AA 3FX3A 4M71A 1KGSA 3VODA 4YFKF 4I7HA 1FYMA 3QP5A 1XDSA 3DEUA 3HRUA 1ZLJA 3T5XA 2HWVA 3LAJA 2OD5A 2P6TA 3MZYA 4U7BA 1UFMA 3I71A 4M9SA 2QYOA 5BQTA 1QZYA 1GVJA 4BAYA 1W5TA 1H0MA 5E17F 1OYIA 4PCQA 2GIVA 1ON1A 3F8CA 2H27A 2L01A 1XMAA 2RGVA 1F1ZA 2EFWA 4EGYA 1ZG3A 1ZN2A 3ZPLA 3DPTA 4MTEA 2IA2A 4K2EA 2MC3A 4KIGA 1U5TC 2PQ8A 1Y0UA 4MEYF 4CGZA 2IT0A 4F7ZA 3KZYA 2HQNA 1G6NA 2RKHA 3FM5A 4IXAA 2FE3A 3J80Z 4BHBA 1QO0D 2AS5F 2YU3A 2PMHA 3BZ6A 3TGNA 3QP6A 1S3JA 2K4JA 4D0PA 1YS6A 1BI3A 4GXOA 2XROA 3HSFA 5FLXZ 2M8EA 3V4GA 4EJUA 3FXQA 1IN5A 1UB9A 2EB7A 2OBPA 4HBLA 1BC7C 1FX7A 1KQ0A 2K02A 4AIJA 1T6SA 3LA2A 4BH9A 5LHHA 4LD5A 2VBZA 4MGRA 2V79A 1P92A 1LDKB 1FBQA 2XGXA 3ISPA 3DKWA 5D4RA 3FWEA 1ZGAA 5FFXA 5D5XB 4Q47A 2FMLA 3RPQA 3CUQA 3O6BB 2CWEA 4EM2A 1ODDA 3MAJA 1G3TA 4WWCA 1S29A 4HOBA 2V1DA 3IRRA 4LLNA 4QLCU 3C7JA 1U2WA 3KFWX 2P6SA 2BE5F 1ZARA 2EFQA 5TJJA 2GWRA 3IRQA 1B4AA 5L3EA 1B1BA 3I59A 4YIFA 5ICFA 1ZGJA 5DUKA 5K5OA 4ZYDA 3FMQA 3CLOA 3ZQ7A 1H9GA 2QVOA 3COAC 2STWA 3EYIA 2O03A 3QPTA 4HZFA 1MD0A 2M45A 3CUOA 2VODA 3HSEA 3RKXA 4BHCA 3LQQA 3V7RA 3AAFA 4AIKA 2ZO4A 4QWQA 1FOKA 1R00A 1Z6TA 3HHHA 1TW2A 4L9NA 2MLGA 3VOEA 5ICGA 5DD4A 3TOBA 2VC1A 2K7LA 4P5OA 2H6BA 5D6EA 5E1XA 4OIRF 4EJWA 5FD6A 2QBYB 2VOOA 1QPMA 1KU7A 1MZBA 1BM9A 3GW2A 4NHJA 2XUBA 2QQAA 2F2EA 5DD8A 3W6KB 5LEKA 4EJVA 1IXSB 1K78B 1WI9A 2P5KA 5BPDA 3RYPA 2A3SA 2CW0F 5BPIA 4BHPA 5E8GA 4ZYEA 2OAZA 3BJAA 4KMUX 2V6CA 1ZG1A 2GAUA 1TQIA 2EA4A 1I27A 4L9TA 1DPUA 4IJAA 3WTVC 2XAQA 3E6MA 4A2UA 2PN6A 3K2ZA 1TQMA 4CXFA 3DP7A 1U5TB 2XKOA 3E5XA 2ISZA 3C3WA 2V9VA 3F8BA 3SXYA 4XSXF 3S2WA 5LRRA 2DPUA 1LEBA 4WX9A 1R5GA 5ILSA 3HRMA 4GGGA 2OQGA 3V8LA 1T2KA 5L3BA 3L9FA 4IPAA 3E97A 4G6QA 2P8TA 1FT9A 3KZZA 3F8FA 4WXDA 1YO5C 3E3VA 3J80K 5LEJA 2W85A 4WCGA 3FZVA 3SHFA 2D1HA 2FQ3A 4L0YB 5HS9A 2PFBA 3WG9A 2KJBA 3R61A 2DW4A 5KK1A 4EQQA 1OYWA 5FLXK 3RYRA 2LDUA 1XSVA 2HFHA 5H6RA 2PEXA 3J81Z 3BDDA 1YS7A 3ZP5A 2HYFA 1KA8A 1OMIA 2HOEA 5CLSA 3JAMK 2XRNA 3SZPA 2W57A 1NHAA 2XV4S 1G3WA 1HQCA 1GXPA 3H92A 4ESBA 1P6RA 3H3UA 2ZBKA 1OYYA 4MQVA 3TO7A 2VBWA 4WF2A 1HBXG 2JPBA 2V1UA 3IL2A 2HKXA 2VOPA 2Y48A 1KU2A 4OOIA 4O5VA 1Z91A 3W6JB 1KYWA 2IA1A 3WGHA 4IHSA 2ZFWA 4U0VA 5ICCA 3F22A 2FOKA 1X3UA 2VXZA 4MTDA 5IT9K 1XSDA 4BXUA 3GZ5A 4ENKA 1XMKA 5H6QA 5HDGA 2DQLA 2HEOA 3I58A 3F8MA 1T38A 1YLFA 1R5HA 3FMSA 2LF8A 2JZYA 2A68F 1J75A 3KETA 4KIFA 3Q5FA 3RPUA 3GX4X 3R0JA 1IF1A 2CQKA 2UWMA 1MJAA 1REPC 4IHTA 1FYKA 1SD7A 4HLYA 1FBUA 1YW8A 1XDUA 4B09A 4KUMA 2BEOA 1G3YA 2IPQX 3R0AA 4KT5C 4PGHA 4RB1A 1H9TA 1TBXA 3P9CA 4EVIA 1D8KA 4UV9A 4JBAA 1BBYA 1QQIA 3HYIA 2DLLA 1O7LA 2DK5A 5DYMA 2FA5A 1QBJA 2NS0A 4YG2F 3QU3A 3BY6A 4UXNA 4RGRA 4HV6A 1FSEA 3BJ6A 2XASA 3QPHA 4R8HA 5D5WB 2R7FA 1Z7UA 3GFMA 1XD7A 1YIOA 3KP2A 4LJZF 1K78A 1I1SA 4ZYGA 2KJCA 2EWNA 2MH9A 2OA4A 4G94A 4L0ZB 2K27A 3ZMUA 1XB4A 4PZJA 4HF2A 2RN7A 1XGOA 1SD4A 3IC7A 1SFUA 4P55A 3PQJA 4UVBA 4IVNA 1YYVA 1UCRA 1Z1DA 2IW5A 5FGMA 2C6YA 4LLGF 4RGUA 4U0WA 3SFZA 1TTYA 1CF7B 2ISYA 2XAGA 1MDMB 2XAJA 2JSCA 2RDPA 3KEOA 4BQAA 2HZTA 3ZMDA 2P4WA 4M72A 2Z33A 2CSOA 4U0YA 2EJRA 3BPXA 3M1EA 4S04A 4EM0B 1XGNA 3G73A 2MLKA 4KN7X 2MA3A 1RNLA 3HRTA 5JI6A 1Z6RA 5ERIA 2VE9A 1FY7A 4WXCA 2G7HA 1ZRCA 5HDNA 3WTSC 4GCVA 2UXXA 2R7DA 2XAFA 4Y13A 4KN4X 3TKYA 1W4MA 1FWZA 4RB3C 1IUYA 4HDVA 4RB2C 2ESHA 1U78A 5DCFA 3IKTA 5ED4A 4G7HF 3CTAA 5AIPA 1FPQA 2OZUA 2XKPA 1YG2A 1IRGA 3K1PA 4N9HA 1B59A 1R7JA 3CJNA 5LRSA 1WWXA 3WGIA 1FBSA 5LLQA 2BV6A 1E2XA 1S6LA 3T1BA 5DDGA 1RZ4A 2HR3A 3T0YA 1FYLA 2H6CA 3F3XA 5HLHA 4IRIA 4ZYHA 2KIUA 3DXJF 2ACJA 3FXRA 5HVQC 5E18F 3V7CA 1G4DA 3R6SA 3BP8A 1J7KA 3KP6A 5F64A 5F6FA 1ONVA 2KKOA 1PP7U 4XLNF 1QNTA 1ZREA 1ZH5A 2LF7A 2NAZA 4FX0A 2DFIA 3BJOA 3QU6A 2PBIA 3C1DA 1F4KA 4M9ZA 3LQRA 1S7OA 4AWXB 3GEZA 5A2QK 2EV5A 2DO7A 3WTTC 5JHUA 3F8NA 1YFHA 3TO6A 1U8RA 1XN7A 5J8CA 4KICA 3BPVA 3MWMA 1GHCA 3LA3A 2E7XA 2L54A 4JQFA 2QQ9A 1HW1A 4NB5A 2P7VB 1HKTA 3KLNA 3WTXC 2HQRA 2D45A 4HX4A 3CUQC 3QAHA 3BOQA 3SZTA 4MEXF 4WK8F 2A6EF 2FMYA 2P7CB 1USSA 2WTEA 2YX7A 1KQ8A 3RI4A 1O3RA 1ZYRF 1LQ1A 5JVTA 3RDIA 1O3SA 2HKOA 1J59A 4HF0A 5ICEA 4IRGA 3H3ZA 4HW0A 3N4MA 2NYXA 1YW7A 2VT3A 2K86A 3OV8A 2L4MA 5DV5A 2MH2A 1SD6A 3VEPA 4I0AA 3ELKA 3L2CA 4DNCA 3I0TA 4FHTA 2A07F 3DF8A 2F5FA 2IVMA 1KU9A 3MQ0A 3K69A 5DCMA 4XBFA 2DI3A 1IXCA 2M1BA 1OR7A 3GUDA 2Z9OA 2ZNZA 5K1YA 1K79A 2K4BA 4HF1A 1BI0A 3M8EA 1T39A 3MZHA 1HKQA 1LDJA 4A6EA 1DP7P 1HW2A 4CYDA 3IWFA 1CF7A 1W7PB 4HX7A 2D2WA 1MDMA 5CVUA 2CG4A 2L4AA 1WRJA 4I02A 1U3EM 3LWFA 4UUVA 1EH6A 2A69F 2GXGA 1R1UA 3GLXA 4WXHA 2QZ8A 4L9JA 2PJPA 1J9IA 1I6XA 5FB2A 1R36A 3E5UA 4GYGA 3P9IA 2GQQA 4ETSA 1MJ9A 1BC8C 1V4RA 1F9NA 5L3GA 2R3SA 3T8RA 3LFKA 4UHTA 3ZN0A 2FXAA 4M6YA 1S8NA 2EK5A 5LBQA 5LGUA 3RIRA 4EV0A 4ENJA 2HYGD 5J8FA 1UHMA 3WTUC 5D4SA 2PLYA 3GF2A 1FLIA 1XGSA 1KQ9A 1FNNA 3U9GA 1RI7A 4A6DA 1D3YA 3DV8A 5J6XA 2W84A 1P4WA 3JW4A 3JSOA 1ZHFA 2VC0A 1OKRA 2UXNA 4U88A 2F5CA 4RB0A 3HHGA 4I2OA 1I5ZA 1BN5A 2HGCA 4ASNA 2VN2A 1L3LA 5D5VB 2EV6A 2J5PA 1DPRA 3O2PE 2FSWA 1AWCA 3P7NA 4HLXA 2Q2EA 1SMYF 4ENNA 5FFZA 3ECHA 2QWWA 5D5UB 3CO7C 3RTRA 1IXRC 4MHGA 5EEGA 4HQMA 1ZG5A 1K6OA 4I98B 2O3FA 2Q8KA 5CYVA 5LHIA 3FM3A 4EMSA 1D8JA 4XLPF 3RJPA 1PP8F 3ERED 2CYYA 3LA7A 1SFEA 2JPCA 3KP5A 1BOAA 4OINF 5L3FA 3TQNA 2CO5A 2QQBA 3CUQB 4LK0F 2XHKA 3QOPA 4KDPA 4FX4A 4CZZA 1L0OC 2M5WA 4UVAA 1TLHB 2ETHA 1O57A 4OU0A 1HKSA 1XGMA 3FMRA 2LKPA 6PAXA 1HXDA 2O61A 1Z9CA 1W5SA 2FBKA 2RC4A 3ZMZA 1DUXC 1KU3A 2FU4A 1J5YA 3L09A 1T98A 2G9WA 3IWZA 3GFIA 4H0EA 1QZZA 4HYEA 1IN4A 3NRVA 1YW9A 4M6XA 5L3DA 1S7AA 1O7FA 2H09A 2X0LA 2VBXA 2E7WA 2DBBA 3E6BA 1ZRFA 1GXQA 3GFLA 1STZA 5JR3A 1JXSA 5BS6A 2QBYA 4GO1A 2EFNA 4Q5SF 4IRHA 2PMUA 4MQ9F 1IZ1A 5LGNA 1C0WA 4PDKA 4HV5A 1CGPA 5LHGA 2FNPA 2QUFA 2O0YA 5D8LB 1F5TA 2LNBA 1TQPA 1EV7A 3K1MA 3K9TA 3LSTA 3J7AO 2COMA 3GYHX 3I64A 3GO5A 1MKMA 2BGCA 2A6HF 3G3ZA 5DUIA 2RVCA 3NEUA 3HOTA 3ECOA 1LB2A 4XRFA 2QM3A 3V7SA 3FXUA 4UV8A 2PG4A 3VFZA 2DTRA 4DQ2A 5AIQA 2DPDA 1WQ2A 3SQNA 1U5TA 4LG0B 2B0LA 1FSHA 1IRFA 3V8KA 4HX8A 4RS8A 1RIOH 3TDZC 5HLGA 4A0XA 3M9AA 1O3QA 1EH7A 5CJ9A 3JTGA 4O6JA 5ILUA 2HDCA 4AIHA 1BIAA 4I0BA 4NQWA 2XAHA 2FBIA 2VONA 2A61A 2FRHA 2GA1A 2J5OA 2YSRA 2NNNA 2DQRA 2CGPA 3T8TA 3F6VA 3QRFF 5CVJA 2RNJA 4M9XA 3J81K 4A12A 5K5QA 3KE2A 1KYZA 5CVVA 4XSZF 1LNWA 4E70A 2Z5UA 3MFKA
chains in the Genus database with same CATH superfamily
3DKXA 3DU5A 3PM1A 2DMUA 2KIQA 2VQLA 3JREA 2EQRA 2M34A 4LB6B 3WODF 1PUEE 1BA5A 2DU9A 2VT2A 3UKGA 1W0TA 4A3BJ 2Z2SB 4JX6A 2P5VA 1YRNA 3K0LA 4CO8A 5B1AH 1SFKA 2LP0A 4Y4RA 2W25A 2D1VA 4N9IA 2NVYJ 1BJAA 1BR2A 1LDDA 4DZJA 3ROUA 2OUMA 3HSRA 2KRCA 2WAQN 2GXBA 5HDKA 4R1HA 3CQZJ 2HI3A 4M6VA 2DAOA 1B8IA 4CH7A 2LY1A 3JSPA 3A03A 3BROA 3PUBA 1ULYA 4XLCA 3ZN1A 1XSXA 3TDUC 4ZZDA 2F5EA 1FZPB 2FEZA 3OYFA 1ZAOA 1ON2A 2BZTA 2IP2A 2KRFA 3C18A 3K4MA 2VPLA 4P96A 3OR2C 4H4KC 1MBFA 5J1YA 4JP0A 3FBIB 5HLIA 2ELHA 3ZRGA 5HOOA 3I3LA 4IF4A 4BYYA 2XF7A 3IUOA 1XC5A 2XVCA 2X6OA 4IZZA 3VYUB 2HTJA 3HKZA 2AXLA 4BQNA 2CQXA 3ASNH 3K7AJ 3N97A 3BR0A 1QHGA 2Z99A 3JAMZ 5BOXA 4LK1F 3ABLH 5C4JJ 2G0EA 5IP6A 1IN7A 3CCQI 3KP7A 3K1NA 2K9QA 4RAZA 1MGTA 2MC4A 3KZIC 2LG4A 3GTPJ 4RM2A 3OWTA 4EM1A 5K5RA 1Z05A 1EKEA 4RGSA 3K4CA 1VQNI 4EGZA 3H0GJ 3MKZA 4X0GA 1QVUA 3CCYA 1QGPA 2Q0OA 2X6YA 2XIGA 3HUGB 5E8IA 2VQHA 1K7AA 2DFEA 3FXLA 1LEAA 3A2KA 1O3TA 1D0ZA 1UELB 2TDXA 1X2NA 3F23A 2ZMEB 1QA6A 1D1AA 1N25A 2XPWA 5FRMA 2I10A 5HNHA 3WU1B 3CO6C 1P9QC 3K10A 2E71A 4CCNA 4DYQA 5BMZA 3H1CA 3KP4A 4ZZLA 2ZJPF 2ESNA 3FHNA 2ZJRF 4UNOA 3CCEI 1FMWA 1AOYA 2KP6A 3WU2C 5ILVA 2LKXA 1PDNC 3KCCA 4D9JA 1VQLI 2JA7J 5IT9Z 4LLLA 1M1EB 3R60A 2MD5A 4D1QA 2FF4A 2EFOA 3CF5F 1ZGWA 2ZSIB 3ZMVA 3WE2A 4FT8A 4Z6YA 1RUOA 3R4KA 4L18B 4OMYA 1OCTC 1FC3A 4I76A 2CU7A 2EINH 3LMMA 4BJTA 2DJNA 4CHUA 4A5MA 2KPMA 5F04A 2GA2A 3EPZA 2E34A 3A01B 3KEQA 4B3AA 1JHHA 4PFPA 2QENA 1WCMJ 3MD2A 4M3DA 3KP3A 1G3SA 3EYYA 1WZ2A 4JX4A 2P0WA 3DLLF 2LLKA 2NOJB 3OIPA 4ENMA 2E60A 3QQAA 2DA7A 4Y15A 2Y0SN 3SJMA 2HTSA 1PUFB 4LGWA 1KONA 3ZGKA 3OIQA 1OISA 5K7FA 2M4GA 3DEEA 3I56I 5JFRA 2MSYA 1MJBA 1JGSA 5D6FA 5DM7F 3WTWC 4U7DA 2BYVE 1Y1WJ 3E6CC 3EDPA 2KIMA 3E1SA 1TW3A 1SFOJ 3ZQLA 2IJLA 2QLZA 3EQLF 3OYEA 3QPSA 1OFCX 3I54A 2IA0A 4Y7NJ 2L02A 4G7OF 2L3DA 1JUPA 2OZ6A 3CDHA 4M3BA 3VYTB 4BGDA 3OYHA 3F6OA 3CC7I 2E1NA 3GTMJ 3ABUA 1QZEA 4Y33A 4G6DA 5E1ZB 1FP2A 4F52A 1JKPC 1TNTA 5EG0A 2FBHA 3CLQA 1T8IA 2NRAC 2ZXJA 3DFGA 2NOGA 4XN0A 4LB5A 1BOBA 1NK2P 2Y75A 3HOSA 3Q9SA 2HVQA 2DOEA 3WE3A 1JTYA 3GVAA 5IOZA 2L9NA 2KIFA 4LMYA 2VE8A 5DEQA 2FQ4A 1J0RA 4YIIA 2LTPA 4LFUA 2R7UA 3PNTA 2OU2A 1VQ5I 1E17A 3GFJA 2OTJI 4PGGA 2RV8A 2R7XA 2XRLA 1SD5A 4XICA 3SDGA 3WTZA 1T08B 2FNAA 4NC6A 4XKWA 3TP0A 4E6KG 3GZ6A 3IHUA 5EZHA 3GXOA 4ZTJA 1Y6IA 2W4SA 1R22A 4JK1X 1FP1D 4LG0A 1BI2A 3ZMTA 2V1XA 4M74A 3MEXA 4BS9A 3H5NA 2CUFA 2VUMJ 5KVRA 4I01A 4HQEA 1YTYA 1R58A 1IO2A 4HAMA 1B9NA 2JT1A 3HL2A 3EETA 2K5CA 3OS1A 4J01A 3H5RA 3HZJA 1YQAA 3Q9VA 5HS8A 4G9YA 4ON0A 2HVRA 4CYCB 2KDOA 4F92B 3IH4A 2V9PA 1P7JA 1P2FA 1VQ4I 2ZCWA 3CDIA 1IAWA 3AL0C 2VL8A 1P4XA 5M5YJ 2E1CA 4HSTA 3C2GA 4ZC3A 3HBLA 1JHFA 1Y8QB 3LSHA 4QPOA 4G8XA 2FOWA 2BW3A 5EGOA 4KMFA 1H88C 3L2UA 1V5FA 4XK4A 2EBIA 2WWYA 1FOYA 4TV7A 2STTA 2Z3YA 3GWZA 1UG0A 3LSMA 4KNYA 1OR7C 4OIQF 2BBYA 1SAUA 4M73A 1FEXA 2E19A 4HDUA 1VTNC 5JLXA 1GV2A 2M87A 1DDNA 2QKMB 3CESA 4S0HB 3FHZA 1UHWA 4MFDA 2DCEA 4UVCA 3F21A 4BU2A 1ZRDA 1OPCA 1X1AA 3RZOJ 2I5UA 5H20A 2IRFG 1ERDA 3HTUA 5FD5A 2VXDA 3JRGA 5CVRA 2ZKZA 1VQ8I 4ITVA 1GUUA 3LAPA 1T0FA 2LSOA 2KLOA 1ZR4A 3BT9A 3JCUC 4OIPF 3PFIA 4AD9A 3BR6A 3DPLC 2JA2A 4EJOA 2HDDA 3ERMA 4BXFA 1A04A 2K9LA 3I4PA 1SMTA 4M3EA 1W7PD 5F27A 5GPCA 1JE8A 1V3FA 2VIXA 4KIBA 1LJ9A 4IHYA 2G7UA 2JRMA 2YPRA 1HSJA 2Y9YA 5CVIA 1IV8A 4AVZA 2PI0A 2W24A 2M9HA 4XN3A 1R1TA 1LKXA 3EUHA 4OAYA 5LGTA 2NS7A 4ESFA 4D5CA 1RR7A 2JVGA 5JLWA 3BQYA 1SAXA 4AVPA 1EH8A 5TRDA 1WKMA 3DKYA 2ZJ2A 3M7GA 1BIBA 3I53A 1TNSA 4B44A 4YFXF 5DM6F 3TP3A 2L9SA 1I1GA 4CDGA 5E3LA 1PYVA 2WV0A 2ZFUA 1HSTA 3SEQA 4P9UA 2YX4A 4IOAF 2JTVA 3PSIA 5FO5A 3MCZA 2R4GA 5J3LA 1XCVA 2MD0A 2JRTA 2Y69H 4B47A 3P5JA 3ZCOA 4BDYA 4EJTA 5E20A 2IEKA 5J47A 4N0BA 3OYJA 3HUGA 4XLAA 3BG3A 4S05A 4BNCA 1ITYA 4L5JA 2GZWA 4GYIA 1DP3A 2ICWG 2EFPA 3TOAA 2E1OA 4RGXA 1LPQA 4A5NA 5EYRA 5C4XJ 1J2XA 3RKYA 1MH4A 4XQFA 4A0ZA 1MH3A 2ZMEA 4AM3A 1SFXA 3GBGA 2Y31A 3PNYA 4RAYA 1B9MA 2UZKA 2Y0MA 3REOA 4C3JJ 3U1DA 5C44J 2O8XA 2WADA 1QPIA 2XSDC 3VB2A 3AKZA 1A35A 2F5DA 4Q4ZF 2M30A 2LD5A 1Q1HA 1MNEA 4UB8C 1DGRM 4B1RA 1R1VA 5B1BH 3L7WA 3B73A 3E6DA 3CP8A 2HQAA 1RC9A 3KLOA 4OMZA 1IN6A 3I59B 4F91B 1XCBA 3ZMSA 4C2UA 3L00A 4CICA 4NNJA 1E0EA 1FIAA 5A2QZ 4BACA 1JKOC 3D5LA 3ZOBA 1BI1A 4A0YA 4G7ZF 2GIZA 2BVMA 3PQKA 4A3DJ 2VJJA 1LFBA 2VB6A 2LC2A 4E7SA 4HA8A 5HS7A 3HRSA 4OIOF 5EEAA 2CV1A 3P9KA 4OWRB 3RKWA 4Y17A 3BR5A 2A5YB 1HW5A 2P5LC 3H5AA 2O6GE 3S16J 3O3KA 4KFCA 3WGGA 1VQMI 3QYFA 4R79A 1YITI 3WTYC 3MN2A 2M0CA 2M3AA 2WV1A 2X4HA 4F55A 4KYWA 4AUXA 1ZQ3P 1PUFA 5KCMA 3TO9A 4ESJA 2ADUA 1D5VA 4P9FA 4KA4A 2E36A 4Q48A 4O3MA 1ZELA 2DT5A 3DWLE 4B48A 2EZHA 4HNTA 3V8JA 5GAHJ 2QGUA 4I99C 2HS5A 2CFXA 3HTSB 1QU3A 5E1WA 1Z3YA 3ML6A 1LVKA 4Z2YA 1CQTA 1AA7A 4BEHA 3V42A 2MYSA 3B02A 5FLMJ 4L5IA 2L7KA 2PJRA 2EH3A 2FUG2 3QODA 3BCAA 4L9VA 2MBFA 3IKVA 3HIFA 3JTHA 3OS0A 4YFNF 3M8FA 2VBYA 3FF5A 1ETYA 3G1LA 4BXXJ 2WC2A 3TL4X 2OQRA 4IOCF 1RUNA 2O8KA 3D0SA 3BWGA 3GTJJ 2YR2A 2H1KA 4B8XA 2EV0A 1ZLKA 1UZCA 2EA2A 2X1EA 4I09A 4ZH4F 1LVAA 3EUAA 1SANA 2V4JC 3F72A 3E5QA 1WJCA 4A3JJ 1Y0NA 3ABTA 3CF2A 4HSRA 1ETXA 2NVUB 2ZNYA 3BR1A 3CCUI 1QRYA 3HM5A 1WPKA 2H94A 1JJ6C 1XG1A 1IN8A 5EEHA 1IC8A 3WU0A 3DQVC 1HCRA 1LE8B 2NNYA 4E7IA 5DCMB 2VQGA 3CP2A 3U2RA 5L3CA 3J7YJ 3TBIA 1P4AA 1U6GA 1HF0A 3OOPA 3ULQB 3OYNA 3NQOA 1R23A 1LUJB 5F1RA 1USTA 5CQEA 3FKJA 2A6TA 2DK8A 1W7PA 5AONA 2B7EA 1WSUA 5IT3A 1TL8A 5D8KB 4MNUA 2MFZA 3I5UA 3H3VK 2DA4A 2JWTA 2RQPA 1IW7F 1B6AA 4XKCA 3S3NA 4XORA 4KT6A 3FX3A 3FXJA 4M71A 1WVRA 4BE0A 1KGSA 3VODA 4YFKF 1W0UA 4PSWA 4GFBA 4I7HA 1FYMA 4CYCA 2BHZA 3QP5A 4RAFA 3I55I 1XDSA 3DEUA 3HRUA 3O8GA 1ZLJA 2JJ7A 1R9TJ 3T5XA 1HOMA 2HWVA 1X4OA 3LOCA 4PFOA 4RBOA 3LAJA 1VNDA 2OD5A 2P6TA 2RQQA 3MZYA 4U7BA 1UFMA 3I71A 3BZCA 4M9SA 4RM3A 2QYOA 3DCFA 1QZYA 5BQTA 1ZTRA 4BJ5C 5CQGA 1GVJA 4BAYA 1W5TA 3OYIA 3RKQA 1ETVA 1H0MA 5E17F 3ABKH 1OYIA 2IGNA 4PCQA 4II3A 1ZKGA 5KAIC 2GIVA 1ON1A 3F8CA 4ZTFA 2H27A 2L01A 1XMAA 2RGVA 1F1ZA 2EFWA 4EGYA 1ZG3A 4M3FA 1I3QJ 5IYBJ 3H0DA 1ZN2A 3ZPLA 3DPTA 4MTEA 2IA2A 4K2EA 2M0MA 2MC3A 2XB0X 4KIGA 2LMDA 4NUBA 2V9KA 2E35A 1U5TC 2PQ8A 2L7FP 1Y0UA 1W36C 4MEYF 4KJZA 4CGZA 2IT0A 1X2MA 4BUPA 5K7HA 4F7ZA 3KZYA 2HQNA 3DTEA 1G6NA 3CCJI 2RKHA 2VKDA 3FM5A 4PJ0C 4IXAA 2FE3A 3J80Z 4BHBA 1QO0D 2AS5F 2CMPA 2YU3A 4C9YA 1S5LC 2PMHA 1GLNA 3BZ6A 3TGNA 3QP6A 1S3JA 2R93J 2HOSA 2K4JA 1NTCA 4D0PA 1YS6A 1BI3A 1BJZA 4GXOA 2XROA 1TWGJ 2KT0A 4C30A 2CS3A 3HSFA 5FLXZ 4A3LJ 5C3EJ 4UUSB 2W82A 2M8EA 1YHQI 4PJJA 4GRIA 3V4GA 2MGQA 4EJUA 4A3GJ 3FXQA 1IN5A 1P7IA 1SVMA 1UB9A 2EB7A 2OBPA 4HBLA 3RZDJ 4BBRJ 1BC7C 5GP9A 1FX7A 1KQ0A 3PO2J 2K02A 2ME0A 2XAUA 3NWSA 4AIJA 1T6SA 3LA2A 4BH9A 2HPMA 3QOEA 1JUSA 5LHHA 4LD5A 3KYCB 2VBZA 4MGRA 2AHQA 3ZXSA 3C2HA 2V79A 1P92A 2F6CA 1LDKB 1FBQA 2XGXA 3HGYA 3ISPA 3ONQA 5IP9J 3DKWA 3CC4I 1OCCH 5D4RA 3FWEA 2QCOA 1ZGAA 2GOXB 3OYMA 5FFXA 2Q2EB 4HRIA 5D5XB 3BTJA 5FKLA 1IV6A 1E3HA 3GTOJ 2BY3A 4Q47A 2FMLA 4FETA 3RPQA 3G2BA 1XS9A 1D1CA 3CUQA 3O6BB 2CWEA 1VI0A 1WGXA 4CCOA 2JVHA 2JK3A 4BL0B 4EM2A 1ODDA 3MAJA 2JN6A 1G3TA 4WWCA 2OCEA 1B72B 1S29A 4HOBA 2V1DA 3BR2A 3IRRA 4A3EJ 4LLNA 4QLCU 3C7JA 2LRDA 1MSFC 4XM3A 1U2WA 4XR6A 1HLVA 3KFWX 2ECBA 2P6SA 5HNFA 2BE5F 1IUFA 1ZARA 2EFQA 5TJJA 2GWRA 3IRQA 1B4AA 2VQCA 2ELJA 2UV1A 2JSPA 4BQOA 4FE4A 1NG6A 3BTIA 5L3EA 1B1BA 3I59A 1HDPA 4A69C 2CQ7A 2R7QA 4YIFA 5ICFA 1ZGJA 5E3OA 3MKLA 3K4JA 2L5QA 3CJQB 5DUKA 1EA3A 5K5OA 1FTTA 3X2QH 4ZYDA 1YJWI 3FMQA 4XKVA 3CLOA 3ZQ7A 2R7OA 1H9GA 2QVOA 3COAC 2AQEA 2STWA 3EYIA 2O03A 3QPTA 2YU9J 2CH0A 4HZFA 2WAEA 3E7LA 1R4NB 1DGWY 1MD0A 2K9NA 2QF7A 1DU6A 2KHMA 1MMGA 2M45A 3CUOA 1JT0A 3K70D 2EPFA 2VODA 1RKTA 1VQ9I 4QIWN 3HSEA 3RKXA 3CJTB 4BHCA 4X1EA 3LQQA 3V7RA 3AAFA 3CMYA 4AIKA 1VFCA 2ZO4A 4QWQA 1FOKA 1R00A 4IL6C 1Z6TA 3HHHA 1TW2A 3VSLA 1ENHA 4L9NA 3CJRB 2MLGA 3ZQFA 3VOEA 2XF5A 2FX0A 1E3OC 4RAGA 1Q1VA 4XOTA 2CQQA 5ICGA 5J4VA 5DD4A 3TOBA 1YX5A 2VC1A 2MG4A 2K7LA 4P5OA 2H6BA 2L7MP 5D6EA 5E1XA 4OIRF 1EJ9A 3SZGA 4EJWA 5FD6A 1TWFJ 4IEJA 4DW6A 2QBYB 3OYGA 2VOOA 1QPMA 4CZCA 3OMYA 1KU7A 1MMSA 1MZBA 1BM9A 2R7WA 2E2IJ 3GW2A 2LBFB 4NHJA 1FJLA 3DTKA 2XUBA 2QQAA 1LFPA 2F2EA 5DD8A 3W6KB 5LEKA 3L2RA 2HOTA 4V2FA 2R5YB 3CMMA 2DT6A 1IXSB 4EJVA 1K78B 1WI9A 2P5KA 5BPDA 3MMYB 3RYPA 1HDDC 2A3SA 2CW0F 5BPIA 4BHPA 1TC3C 4XLEA 3CCMI 2QSFX 4UUTA 4PSXA 5E8GA 3ZQQA 4ZYEA 3OIOA 3B6AA 1G8XA 2R5ZB 2QSHX 4AYBA 2CJJA 2OAZA 3BJAA 4KMUX 2V6CA 4UB6C 3JRAA 1ZG1A 1YI2I 2GAUA 1IG7A 1TQIA 2EA4A 1I27A 3BQZA 4L9TA 2R0QC 1YX3A 2OPTA 2X1DA 2W7NA 1DPUA 3RPUD 4W1UA 3BLYA 2JA6J 4IJAA 1YJNI 3WTVC 5F0FA 2XAQA 3E6MA 4A2UA 2PN6A 3K2ZA 1TQMA 2VKEA 4CXFA 3DP7A 2LY2A 1U5TB 2XKOA 3E5XA 1K83J 3O8HA 1U9NA 4BJ6C 2ISZA 2Y9ZA 4CUGA 3C3WA 2V9VA 2K3PA 3F8BA 3ASOH 3GLLA 5FLVA 4PJMA 3SXYA 4XSXF 1ETWA 3S2WA 3ZQHA 5LRRA 4J00A 2DPUA 4WX9A 1LEBA 1ORKA 2LK2A 1R5GA 5FKOA 5ILSA 1T95A 3CDLA 3HRMA 4GGGA 2OQGA 3CCLI 3V8LA 1T2KA 5L3BA 3H9JA 1Z67A 4C2MJ 3L9FA 4IPAA 2LR8A 4M3GA 3E97A 4ZDLA 2PMZA 3GZNB 1WJBA 4G6QA 2P8TA 5FROA 3VYRB 1FT9A 3KZZA 3IH2A 3F8FA 1JJ8C 4WXDA 2H8RA 4NBQA 2CV2A 2YUSA 2W48A 2COBA 2X6WA 5J1UA 4F3QA 2B9SA 1YO5C 1PJRA 3VPRA 3E3VA 5IOYA 3S14J 4QSHA 3J80K 3UR3C 2W85A 5LEJA 4LG3A 3FZVA 3SHFA 4WCGA 3JRCA 3M8JA 2D1HA 2FQ3A 4NDLA 4L0YB 5HS9A 2K9MA 2PFBA 3WG9A 3LSRA 2KJBA 3R61A 4RLFA 4BE2A 5EJCA 2F4MB 2DW4A 2VLAA 1MNDA 4E7HA 1SC7A 5KK1A 4EQQA 1OYWA 5FLXK 3RYRA 2LDUA 2PX9A 3H9GA 1XSVA 2HFHA 5H6RA 2PEXA 4EATA 3S15J 3J81Z 3BDDA 1G59A 3LL7A 3PSFA 2BOLA 1YS7A 3ZP5A 1MNMC 2XSJC 2IGOA 4B4CA 2HYFA 5B66C 1KA8A 1OQYA 4UUSA 4XRSG 4XRMA 1YRNB 2VASA 2WY8Q 1OMIA 3M07A 2HOEA 5CLSA 1S7EA 4A3KJ 2I8DA 2R92J 3JAMK 2XRNA 2EZLA 3SZPA 4IQ4A 1B8IB 2W57A 2L2OA 1NHAA 3KX2A 4D7MA 2LVSA 3HG9A 1J09A 2XV4S 3L1PA 1POGA 1G3WA 1TZLA 1R6RA 5M3FJ 1I6HJ 1HQCA 2E1MC 3DPUA 1GXPA 3HB9A 2Z1DA 3H92A 4ESBA 1VF9A 1P6RA 4XLHA 3H3UA 2ZBKA 1OYYA 2GXAA 2WB1A 2LFBA 4MQVA 1JI8A 2OTLI 3TO7A 2VBWA 4WF2A 1HBXG 5B3SH 3HOUJ 4N4OB 2JPBA 5EDNA 2NS8A 2V1UA 4RDUA 4DYCA 3IL2A 2XPVA 2HKXA 4E4HA 2VOPA 2Y48A 1KU2A 4OOIA 4O5VA 1Z91A 3CMAI 1T0FC 3W6JB 2QQ8A 3CCRI 1KYWA 5M3MJ 2IA1A 3WGHA 4IHSA 2ZFWA 4U0VA 5ICCA 3F22A 2FOKA 1X3UA 2VXZA 3S3OA 4MTDA 5IT9K 1XSDA 2WA0A 4BXUA 2DN0A 2X1CA 3PNVA 1X58A 3NAUA 3GZ5A 4ENKA 3HXLA 1XMKA 5H6QA 5HDGA 4FQGA 1K4TA 2ZSHB 2Q1ZB 2DQLA 3KEYA 3ZQCA 3EUHC 2HEOA 2DA1A 2ZB9A 3I58A 1I39A 3OOUA 3F8MA 1MBEA 2DMTA 1R5ID 3Q0VA 3ZQGA 1T38A 4ZJZA 1YLFA 1R5HA 3AG4H 3FMSA 2LF8A 3PL8A 3UNGC 4FTHA 2X9DA 5HLTA 4UY8I 2JZYA 2A68F 1J75A 1BW5A 2VJ5A 3KETA 4KIFA 3Q5FA 3RPUA 1YE9A 3GX4X 1VQ7I 3R0JA 1IF1A 1R49A 1VZ0A 2CQKA 2UWMA 1MJAA 1REPC 4CCKA 4DBRA 2CW8A 4IHTA 1FYKA 1SD7A 4HLYA 1FBUA 3A01A 1YW8A 1RESA 3BC8A 1XDUA 2O7OA 3E0JB 4B09A 4KUMA 2BEOA 1G3YA 2DXIA 2IPQX 4XRSA 3R0AA 4KT5C 4XIDA 4PGHA 1V55H 3ESWB 3PIOF 2E5NA 1NG7A 4RB1A 1H9TA 2KRHA 1Z7LA 1R4MB 1TBXA 2M4KA 3BR3A 3P9CA 1KZHA 4EVIA 2HU9A 1D8KA 2DDBA 1OCZH 4UV9A 4JBAA 1BBYA 3AG3H 1QQIA 3HYIA 4D5FA 3QWLA 1Z21A 2ZMEC 2DLLA 3W2VA 1H89C 3H36A 2AXTC 1O7LA 2DK5A 5DYMA 1SVOA 1A31A 2FA5A 2NXNB 1QBJA 3HEFA 1S72I 2NS0A 3S32A 2DYSH 2H8WA 4G12A 4YG2F 3LSGA 3QU3A 4L5EA 4MIMA 3BY6A 1IDYA 4UXNA 4RGRA 4HV6A 3I4NJ 3RQIA 1FSEA 3CD6I 3BJ6A 2XASA 4E7LA 3QPHA 2TCTA 4R8HA 3JRFA 4RA2A 3L2WA 3G4SI 2NVTJ 2ME6A 5D5WB 2R7FA 5LFAA 5BNGA 3IV5A 4I6ZA 2X51A 1Z7UA 3GFMA 1TWCJ 1XD7A 1YIOA 1BL0A 5M5WJ 3KP2A 3LNQA 4LJZF 1FIPA 2R5YA 1K78A 3AL0B 1I1SA 4ZYGA 2KJCA 2EWNA 2MH9A 2OA4A 3GCMA 4G94A 1DU0A 4L0ZB 2K27A 3A0BC 3ZMUA 1XB4A 1E3PA 1D0YA 2KISA 4PZJA 5EG0B 2DFHA 2OF7A 1X1PA 2RN7A 4HF2A 1OCPA 1XGOA 1SD4A 2WY7Q 3IC7A 2R5ZA 1V5GA 1X1DA 1SFUA 4C2TA 4P55A 3LSPA 4BBSJ 1PVEA 3K4BA 3PQJA 4UVBA 4IVNA 2KDZA 3FXKA 3LSKA 1YYVA 1UCRA 5GADJ 1WJDA 1Z1DA 2IW5A 1RKWA 5JVGF 3S1MJ 1X1CA 5FGMA 2C6YA 4LLGF 4RGUA 4U0WA 3BG9A 2HDWA 3SFZA 3IH3A 4AYBN 1TTYA 4CCMA 1CF7B 2ISYA 2XAGA 5E3NA 1MDMB 2XAJA 2JSCA 2V1NA 2RDPA 1BR1A 4CCLA 4A93J 2ZXIA 3D5SC 4DOZA 2IGMA 4JX5A 3F9KA 2VKVA 5GAGJ 3KEOA 2HYJA 2ZXHA 5FJ8J 4BQAA 2HZTA 5FKKA 3ZMDA 2P4WA 4M72A 2Z33A 2CSOA 4PK4A 4U0YA 2EJRA 3BPXA 3U1KA 3M1EA 1V5EA 4S04A 3JRIA 5TGTA 1JKQC 4EM0B 1XGNA 3SDBA 1X3ZB 3G73A 3S2HJ 2XDVA 4QPQA 1RRJA 2MLKA 3I4MJ 3PFYA 4KN7X 2MA3A 1RNLA 1WH5A 3HRTA 5JI6A 1Z6RA 1NK3P 2F48A 3DU6A 2BW3B 5EGOB 3KYLA 3J7AY 2HVSA 3AG2H 1QVTA 3OL4A 5ERIA 1FY7A 4WXCA 5J1RA 2VE9A 2G7HA 3WG7H 4IO9F 4FCYA 1WJFA 2E2JJ 4LITA 2PMZN 1ZRCA 2OC6A 5HDNA 3WTSC 3MVPA 1GDTA 4GCVA 2E1MB 4QTRA 1IRXA 2UXXA 2R7DA 2XAFA 4Y13A 4KN4X 4GDFA 1FOXA 3PJRA 3TKYA 1W4MA 4DIQA 2X48A 1FWZA 4RB3C 3K4KA 5EF6A 1IUYA 4XONA 4HDVA 1U8BA 4RB2C 2ESHA 1APLC 1WJAA 1U78A 5F0CA 2QKLB 1T56A 3B6CA 1FTZA 2M2EA 5DCFA 2XGEA 3IKTA 5ED4A 1YIJI 5FKMA 3K2AA 2GLOA 2BXYA 4G7HF 2DOAA 2XPUA 3CTAA 4JYKA 5AIPA 4XNFA 3OYDA 4FE7A 1FPQA 2OZUA 3M3YJ 1NH3A 2XKPA 2NVQJ 1YG2A 1W1WE 1WJEA 2M7BA 1IRGA 3K1PA 4N9HA 1B59A 1R7JA 3CJNA 5LRSA 1WWXA 3WGIA 4EEFG 3CZ6A 1FBSA 5LLQA 2BV6A 1E2XA 1S6LA 2EZIA 2HXIA 3T1BA 5DDGA 1RZ4A 2HR3A 2BY1A 3T0YA 2BHYA 1FYLA 2H6CA 3A4CA 3F3XA 5IY5H 5HLHA 2DYRH 2E2HJ 5E79C 3Q0WA 4IRIA 4P1WA 4ZYHA 4X6AJ 2KIUA 3DXJF 3VSKA 3OSGA 2ACJA 3FXRA 5HVQC 4PJLA 5E18F 2Y30A 2Z16A 1I50J 3V7CA 3JR9A 1G4DA 3R6SA 4IHWA 2VPRA 4HEA2 3BP8A 2WB1N 4BE1A 1J7KA 3QYEA 3KP6A 5F64A 5F6FA 1ONVA 2M8GX 2KKOA 2LREA 1PP7U 4XLNF 5DTDA 1QNTA 2HOAA 5KHDA 2VJIA 4XL9A 1ZREA 3OYCA 1ZH5A 2CV0A 2IAIA 2LF7A 2NAZA 4FX0A 2DFIA 2R7RA 3BJOA 2L9RA 1D0XA 3QU6A 2EIJH 2PBIA 3C1DA 1F4KA 4M9ZA 1MIJA 1S7OA 3LQRA 4AWXB 4KISA 9ANTA 3GEZA 2FD5A 3HPHA 5A2QK 1MW7A 4V19K 2EV5A 2HQ5A 2HNHA 1FOWA 4LIVA 4F93B 2DO7A 3WTTC 5JHUA 2DDAA 3F8NA 4IHXA 1YFHA 3TO6A 1U8RA 1XN7A 5J8CA 1TP4A 3FXMA 1MMNA 4KICA 2X85A 3BPVA 2K40A 3MWMA 3LFUA 1GHCA 3LA3A 2GOMA 3ZQIA 2E7XA 2L54A 2V7FA 2QQ9A 4JQFA 1HW1A 4NB5A 4PUSA 2P7VB 3CMEI 1UG2A 1HKTA 4BY7J 1MBJA 3BCBA 1UAAA 4ZYAA 1R71A 3KLNA 3HC7A 2EIMH 3WTXC 1K4SA 2F4IA 4BDZA 3M4OJ 2HQRA 1YJ9I 2XB5A 2D45A 4HX4A 3HJEA 3K4LA 3CUQC 3QAHA 3BOQA 3SZTA 1F36A 4Y3OA 4MEXF 2A05A 2IBDA 4WK8F 2A6EF 2LKSA 5J4YA 2FMYA 2P7CB 1GV5A 1USSA 2DODA 1UHSA 5KNLA 4FASD 4U87A 5HODA 4HG2A 2L9VA 3S8PA 1BR4A 2X6XA 3HOVJ 2WTEA 2YX7A 4Y52J 3Q0UA 3WHCA 4IX7A 1KQ8A 3RI4A 4A3IJ 1ZYRF 1O3RA 1LQ1A 4BY1J 3MZ8A 2CQNA 5JVTA 3RDIA 1O3SA 2HKOA 2BXZA 3FK6A 3OYBA 1J59A 4HF0A 5ICEA 4IRGA 3H3ZA 4BEHB 2DMNA 3DBHB 4HW0A 1N75A 3N4MA 2NYXA 2PJRB 3AFHA 1YW7A 2V26A 2VT3A 2K86A 2ID3A 3OV8A 2L4MA 1WJ5A 5DV5A 2MH2A 1SD6A 2K3FA 3VEPA 1S9HA 1VQ6I 4I0AA 3ELKA 2NVXJ 1IJWC 3L2CA 2EILH 4IQJA 3GMEA 1X19A 3HOZJ 3S1NJ 4DNCA 3I0TA 4FHTA 2A07F 4G6TB 3HOYJ 1ETKA 1VQOI 3DF8A 2F5FA 3FISA 2IVMA 2JA5J 3RQ4A 1KU9A 3MQ0A 3SYTA 1LE8A 3K69A 5DCMA 1MBGA 4XBFA 2A5WA 2DA3A 2DI3A 2KMUA 5IYCJ 1WFXA 1MBKA 1IXCA 2M1BA 1OR7A 3OSFA 3OY9A 1N77A 3GUDA 2Z9OA 2ZNZA 5K1YA 1K79A 4NC7A 2K4BA 4HF1A 1F43A 2O9LA 1BI0A 1RR8C 3LSIA 3M8EA 1T39A 5IP7J 3MZHA 3CCVI 1HKQA 1LDJA 4A6EA 2WBMA 1DP7P 2CUJA 4FISA 1HW2A 3S3MA 4CYDA 3IWFA 2ZC2A 1CF7A 1W7PB 3G1OA 4HX7A 3J7ZI 2D2WA 1MDMA 5CVUA 1EF4A 5GPAA 4PJNA 3RSNA 1HC8A 2CG4A 1MMDA 4BKXA 2L4AA 3H35A 1WRJA 2CRGA 1Y56A 4I02A 1U3EM 1JT6A 1AKHB 1U9OA 2LYCA 3LWFA 4UUVA 5CPRB 2KFDA 3SFIA 1EH6A 2A69F 2GXGA 1R1UA 1X4PA 1X1BA 3GLXA 4WXHA 2QZ8A 4L9JA 5F0HA 3OYKA 3TEDA 2PJPA 2IS4A 1J9IA 1I6XA 4CCJA 1JKRC 1D5YA 2LY9A 4NQWB 4C3IJ 1R36A 5FB2A 3E5UA 1QHHD 4RMNA 4GYGA 3P9IA 5JHFA 2GQQA 4ETSA 2QA4I 2OJED 1MJ9A 3FDYA 4ZDPA 4E7JA 4MLOA 1BC8C 1V4RA 1ETQA 1F9NA 4XKBA 5L3GA 2R3SA 3K6GA 3T8RA 3LFKA 4UHTA 1D1BA 2N8GA 3ZN0A 2FXAA 4M6YA 1S8NA 2VKHA 2RREA 2EK5A 2R7TA 1ACIA 5LBQA 1RPWA 5LGUA 2BY0A 3DBRB 1LFUP 3RIRA 4EV0A 1BW6A 4ENJA 3S1RJ 1H8AC 3OYLA 2HYGD 2XGDA 3QPLA 4JOMA 5J8FA 2DFFA 1UHMA 3MKWB 2M7AA 4D7NA 2XGCA 3WTUC 5D4SA 4DJAA 2PLYA 1Z77A 3GF2A 1Y39A 1FLIA 4A3MJ 2ELKA 2B63J 1XGSA 2WAQA 1KQ9A 2JA8J 1FNNA 3U9GA 1RI7A 2IS1A 4A6DA 1AU7A 2VI6A 1OJLA 3AG1H 3G1MA 3K4NA 1D3YA 3DV8A 5J6XA 2W84A 1P4WA 4KITB 1JUMA 5B5EC 4XOPA 2OCCH 1RETA 1UMQA 3ZR8X 3JW4A 3JSOA 1ZHFA 1U0JA 1XX5A 2VC0A 1OKRA 1O4XA 2UXNA 3S2DJ 2GBYA 3PO3J 4U88A 2F5CA 4RB0A 3HHGA 3TW6A 1W36D 4I2OA 1I5ZA 1BN5A 2AO9A 2HGCA 4ASNA 2EIKH 3JRHA 2VN2A 5FRNA 2CUZA 4XLFA 3TMOA 1L3LA 5D5VB 2L7ZA 4N4NB 2EV6A 5EZGA 4A3CJ 2DMQA 4YRVA 4IKFA 2J5PA 1DPRA 3O2PE 3HPGA 3JRDA 2FSWA 3DLAA 1AWCA 2DA6A 3U21A 3MKYB 3G6EI 3P7NA 4YEJA 4HLXA 1K61A 1XMXA 2Q2EA 1SMYF 3W2WA 4ENNA 1ETOA 5FFZA 3ECHA 3VDXA 2F4OB 2QWWA 5D5UB 3CO7C 3RTRA 1IXRC 4MHGA 2DJIA 3F0CA 1Z0XA 5EEGA 4HQMA 2F5VA 5IYDJ 1I3AA 1ZG5A 2BY2A 2XF6A 3H9QA 1K6OA 1WH7A 3N05A 3CCSI 2K9SA 4I98B 2O3FA 2Q8KA 5CYVA 3A02A 5LHIA 2R7ZJ 3FM3A 4EMSA 1D8JA 1MBHA 4XLPF 1V54H 3HKZN 4BQQA 3RCOA 3RJPA 2CYYA 3LA7A 1SFEA 3ERED 1PP8F 2JPCA 3KP5A 1BOAA 2YS9A 4HPQA 4W97A 2ID6A 4OINF 5L3FA 1AHDP 1B72A 3D1NI 3TQNA 2CO5A 2QQBA 3CUQB 4LK0F 2DTZA 2XHKA 3IAS2 2IGKA 2HZDA 2MABA 2JUGA 3QOPA 4KDPA 4II2A 4FX4A 3DTIA 4LOCA 2KZVA 4B3XA 4MO7A 3A1YA 4CZZA 1L0OC 3FXOA 2HXOA 2M5WA 4E7KA 2QSGX 1Z3XA 4UVAA 1TLHB 2ETHA 3K70C 2DT7B 1O57A 4OU0A 4AU7A 1HKSA 1XGMA 2RNGA 3D5RC 3JRBA 3IP4B 3FMRA 2LKPA 6PAXA 2DA2A 1HXDA 2O61A 1DQUA 1Z9CA 1W5SA 4E7ZA 2IS2A 3FIWA 2FBKA 2RC4A 3ZMZA 1DUXC 3G71I 1WHUA 1KU3A 2FU4A 1J5YA 2KQRA 3KPHA 4HNUA 2P81A 2AQFA 3M1CA 3L09A 2LOOA 1T98A 2DOFA 4B43A 1Y1VJ 2FJ1A 2GM4A 2G9WA 3LSJA 4RLQA 3FBNB 3IWZA 2CUEA 3GFIA 4H0EA 1T33A 2Y0SA 1QZZA 4HYEA 1GT0C 1IRZA 1TT0A 2WAFA 1IN4A 4ABZA 5K7ZA 3HOXJ 3NRVA 2UUZA 1YW9A 4M6XA 3L2VA 5L3DA 1S7AA 5CKTA 1VQKI 1O7FA 2HPIA 1HA8A 2JMWA 4ZDOA 3PIPF 2H09A 2X0LA 1ZR2A 2EZKA 2VBXA 3VYSB 2IXSA 4DYRA 2OV7A 4ANJA 1MMAA 5GAEJ 3NWTA 4CA0A 3C2BA 2E7WA 2RAEA 4LIUA 1OCOH 1G2HA 3S17J 2KZGA 2DBBA 2E5ZA 3E6BA 3WHBA 1ZRFA 3BTLA 4J19A 5J40A 2IS6A 1GXQA 3GFLA 4DBQA 3IAM2 1STZA 3BG6A 5JR3A 1JXSA 2CFOA 5E3MA 2JUCA 4YELA 5GTIC 1TT5B 1SVLA 1TWAJ 5BS6A 2QBYA 2QEXI 4GO1A 2EFNA 3BTCA 2V6EA 4Q5SF 4IRHA 2PMUA 4MQ9F 4XMYA 1IZ1A 3A0HC 1OLTA 5LD2C 2LBFA 1XTAA 5LGNA 1UJ8A 3BG5A 4CSWA 1C0WA 2ZJQF 4PDKA 3GTLJ 4HV5A 5F1JA 4A3FJ 1CGPA 2ZXWH 5LHGA 3GTGJ 2FNPA 2QUFA 1XPXA 2O0YA 5D8LB 1F5TA 4IHVA 2DMPA 5DS9A 2CW7A 2LNBA 4V2GA 1TQPA 1EV7A 3EUKL 3FK7A 3K1MA 3K9TA 3PUFA 1N78A 5M5XJ 3S93A 3LSTA 2D5VA 3J7AO 3NARA 4DGWB 3DBLB 2COMA 3GYHX 3I64A 3GO5A 4AIDA 1MKMA 2H1LA 4C3HJ 3KIOA 3OR1C 3GTQJ 2BGCA 2A6HF 3G3ZA 5DUIA 1A6QA 2RVCA 1VQPI 1IDZA 1K6YA 1WI3A 3NEUA 1YOVB 3OL3A 3HOTA 3ECOA 1LB2A 4XRFA 2QM3A 3V7SA 3FXUA 5H2FC 4YIRX 4UV8A 1A6IA 2PG4A 3DEWA 3VFZA 2JQ7A 2DTRA 4DQ2A 5AIQA 3HOWJ 1JTXA 1ZK8A 3BG7A 3VWBA 2DPDA 1WQ2A 3SQNA 1U5TA 4LG0B 2ECCA 1A36A 3Q3SA 3W6VA 4NC8A 2B0LA 1FSHA 3S1QJ 1IRFA 2TRTA 3V8KA 3L2QA 3KYDB 1JGGA 1TWHJ 2R7SA 4HX8A 4RS8A 3OYAA 2MW8A 2DA5A 2KL4A 1RIOH 3TDZC 1W5CC 4AC0A 1AKHA 5HLGA 3TW7A 1FMVA 4A0XA 2LH9A 3I9V2 3M9AA 3GTKJ 2O5RA 2W1OA 4OAZA 4HNVA 1O3QA 1EH7A 3BZKA 2K85A 5CJ9A 5GTHC 1OCRH 3JTGA 3CC2I 1SEUA 1X3WB 3QYBA 4O6JA 5ILUA 2HDCA 1IGNA 5IPAA 5FKNA 4AIHA 2R7VA 1BIAA 4I0BA 5KAFC 4NQWA 2XAHA 3W3CA 1GVDA 2FBIA 2VONA 5F08A 2A61A 1A5JA 3FKIJ 2FRHA 2GA1A 2J5OA 2YSRA 2NNNA 3HGGA 2DQRA 2CGPA 3SEZA 2BVLA 4MFEA 3T8TA 1Y8RB 3F6VA 2Y2ZA 3QRFF 5CVJA 4DZPA 3ABMH 3HDDA 2RNJA 2XC7A 4M9XA 1MSEC 3J81K 2W00A 2L0KA 3OS2A 4A12A 5K5QA 3KE2A 2VJ4A 5TISC 1KYZA 5CVVA 3W2AA 4XSZF 1LNWA 4E70A 2Z5UA 3MFKA
chains in the Genus database with same CATH topology
4LB6B 1PUEE 3WODF 2DU9A 2VT2A 2P5VA 3K0LA 4CO8A 2W25A 2D1VA 4N9IA 1BJAA 1LDDA 3ROUA 3HSRA 2GXBA 5HDKA 4R1HA 2DAOA 3JSPA 3BROA 1ULYA 3ZN1A 1XSXA 3TDUC 4ZZDA 2F5EA 1FZPB 2FEZA 1ZAOA 1ON2A 2IP2A 2KRFA 3C18A 4P96A 5HLIA 2ELHA 5HOOA 4IF4A 4BYYA 2XVCA 2HTJA 2AXLA 3N97A 2Z99A 3JAMZ 5BOXA 4LK1F 1IN7A 3KP7A 3K1NA 4RAZA 1MGTA 4EM1A 5K5RA 1Z05A 4RGSA 4EGZA 1QGPA 2Q0OA 2XIGA 5E8IA 1K7AA 1LEAA 1O3TA 2TDXA 3F23A 2ZMEB 3WU1B 3CO6C 5BMZA 3KP4A 4ZZLA 2ESNA 4UNOA 1AOYA 1PDNC 5ILVA 3KCCA 5IT9Z 4LLLA 3R60A 2MD5A 2FF4A 2EFOA 3ZMVA 3WE2A 4FT8A 1RUOA 3R4KA 4L18B 4OMYA 1FC3A 4CHUA 4A5MA 2GA2A 3KEQA 1JHHA 2QENA 3KP3A 1G3SA 3EYYA 4ENMA 4Y15A 2HTSA 4LGWA 5JFRA 1MJBA 1JGSA 5D6FA 3WTWC 4U7DA 2BYVE 3E6CC 3EDPA 2KIMA 1TW3A 2IJLA 2QLZA 3EQLF 3I54A 2IA0A 2L02A 4G7OF 2L3DA 2OZ6A 3CDHA 3F6OA 2E1NA 3ABUA 4G6DA 5E1ZB 1FP2A 1TNTA 2FBHA 2NRAC 2ZXJA 3DFGA 4LB5A 2Y75A 3HOSA 3Q9SA 3WE3A 3GVAA 2KIFA 4LMYA 2VE8A 5DEQA 1J0RA 4YIIA 4LFUA 1E17A 2OU2A 3GFJA 4PGGA 2RV8A 1SD5A 3WTZA 2FNAA 3GZ6A 3IHUA 3GXOA 1R22A 4JK1X 1FP1D 4LG0A 1BI2A 3ZMTA 2V1XA 4M74A 3MEXA 5KVRA 4I01A 4HQEA 1YTYA 1R58A 4HAMA 1B9NA 2JT1A 3EETA 1YQAA 3Q9VA 5HS8A 4G9YA 4ON0A 1P2FA 2ZCWA 1IAWA 1P4XA 2E1CA 1JHFA 4G8XA 4KMFA 2WWYA 4TV7A 2STTA 2Z3YA 3GWZA 4KNYA 4OIQF 2BBYA 4M73A 4HDUA 1VTNC 2M87A 1DDNA 3FHZA 1UHWA 4UVCA 3F21A 1ZRDA 1OPCA 5H20A 2IRFG 3HTUA 5FD5A 5CVRA 2ZKZA 3LAPA 1T0FA 2LSOA 4OIPF 3PFIA 4AD9A 3DPLC 4EJOA 1A04A 3I4PA 1SMTA 1W7PD 1JE8A 1V3FA 4KIBA 1LJ9A 2G7UA 2YPRA 1HSJA 5CVIA 2PI0A 2W24A 1R1TA 3EUHA 5LGTA 4ESFA 1SAXA 4AVPA 1EH8A 5TRDA 1WKMA 3M7GA 2ZJ2A 1BIBA 3I53A 1TNSA 4YFXF 1I1GA 4CDGA 2WV0A 4P9UA 1HSTA 2YX4A 2JTVA 5FO5A 3MCZA 1XCVA 2JRTA 4EJTA 5E20A 4N0BA 3HUGA 4S05A 4BNCA 4L5JA 2GZWA 4GYIA 2EFPA 3TOAA 4RGXA 4A5NA 1J2XA 3RKYA 4A0ZA 2ZMEA 1SFXA 4RAYA 2UZKA 1B9MA 2Y0MA 3REOA 3U1DA 2O8XA 3VB2A 2F5DA 4Q4ZF 2M30A 1Q1HA 1R1VA 3L7WA 3B73A 3E6DA 3KLOA 4OMZA 1IN6A 3I59B 1XCBA 3ZMSA 3L00A 4CICA 5A2QZ 3D5LA 1BI1A 4A0YA 4G7ZF 3PQKA 4HA8A 5HS7A 3HRSA 4OIOF 3P9KA 3RKWA 4Y17A 2A5YB 1HW5A 2P5LC 2O6GE 3O3KA 4KFCA 3WGGA 4R79A 3WTYC 2X4HA 4KYWA 3TO9A 1D5VA 4ESJA 2ADUA 4P9FA 4KA4A 4Q48A 4O3MA 2DT5A 3V8JA 2HS5A 2CFXA 3HTSB 5E1WA 3ML6A 4Z2YA 3B02A 4L5IA 4L9VA 2MBFA 3IKVA 3HIFA 3JTHA 4YFNF 3M8FA 2VBYA 3FF5A 2WC2A 2OQRA 1RUNA 3D0SA 3BWGA 2YR2A 4B8XA 2EV0A 1ZLKA 2EA2A 4I09A 4ZH4F 1LVAA 3F72A 3E5QA 3ABTA 2ZNYA 2H94A 1IN8A 5EEHA 3WU0A 3DQVC 2NNYA 5DCMB 3U2RA 5L3CA 1P4AA 1U6GA 3OOPA 3ULQB 3NQOA 1R23A 5F1RA 1USTA 2DK8A 1W7PA 5AONA 1WSUA 5IT3A 5D8KB 4MNUA 3I5UA 2RQPA 1IW7F 1B6AA 3FX3A 4M71A 1KGSA 3VODA 4YFKF 4I7HA 1FYMA 3QP5A 1XDSA 3DEUA 3HRUA 1ZLJA 3T5XA 2HWVA 3LAJA 2OD5A 2P6TA 3MZYA 4U7BA 1UFMA 3I71A 4M9SA 2QYOA 5BQTA 1QZYA 1GVJA 4BAYA 1W5TA 1H0MA 5E17F 1OYIA 4PCQA 2GIVA 1ON1A 3F8CA 2H27A 2L01A 1XMAA 2RGVA 1F1ZA 2EFWA 4EGYA 1ZG3A 1ZN2A 3ZPLA 3DPTA 4MTEA 2IA2A 4K2EA 2MC3A 4KIGA 1U5TC 2PQ8A 1Y0UA 4MEYF 4CGZA 2IT0A 4F7ZA 3KZYA 2HQNA 1G6NA 2RKHA 3FM5A 4IXAA 2FE3A 3J80Z 4BHBA 1QO0D 2AS5F 2YU3A 2PMHA 3BZ6A 3TGNA 3QP6A 1S3JA 2K4JA 4D0PA 1YS6A 1BI3A 4GXOA 2XROA 3HSFA 5FLXZ 2M8EA 3V4GA 4EJUA 3FXQA 1IN5A 1UB9A 2EB7A 2OBPA 4HBLA 1BC7C 1FX7A 1KQ0A 2K02A 4AIJA 1T6SA 3LA2A 4BH9A 5LHHA 4LD5A 2VBZA 4MGRA 2V79A 1P92A 1LDKB 1FBQA 2XGXA 3ISPA 3DKWA 5D4RA 3FWEA 1ZGAA 5FFXA 5D5XB 4Q47A 2FMLA 3RPQA 3CUQA 3O6BB 2CWEA 4EM2A 1ODDA 3MAJA 1G3TA 4WWCA 1S29A 4HOBA 2V1DA 3IRRA 4LLNA 4QLCU 3C7JA 1U2WA 3KFWX 2P6SA 2BE5F 1ZARA 2EFQA 5TJJA 2GWRA 3IRQA 1B4AA 5L3EA 1B1BA 3I59A 4YIFA 5ICFA 1ZGJA 5DUKA 5K5OA 4ZYDA 3FMQA 3CLOA 3ZQ7A 1H9GA 2QVOA 3COAC 2STWA 3EYIA 2O03A 3QPTA 4HZFA 1MD0A 2M45A 3CUOA 2VODA 3HSEA 3RKXA 4BHCA 3LQQA 3V7RA 3AAFA 4AIKA 2ZO4A 4QWQA 1FOKA 1R00A 1Z6TA 3HHHA 1TW2A 4L9NA 2MLGA 3VOEA 5ICGA 5DD4A 3TOBA 2VC1A 2K7LA 4P5OA 2H6BA 5D6EA 5E1XA 4OIRF 4EJWA 5FD6A 2QBYB 2VOOA 1QPMA 1KU7A 1MZBA 1BM9A 3GW2A 4NHJA 2XUBA 2QQAA 2F2EA 5DD8A 3W6KB 5LEKA 4EJVA 1IXSB 1K78B 1WI9A 2P5KA 5BPDA 3RYPA 2A3SA 2CW0F 5BPIA 4BHPA 5E8GA 4ZYEA 2OAZA 3BJAA 4KMUX 2V6CA 1ZG1A 2GAUA 1TQIA 2EA4A 1I27A 4L9TA 1DPUA 4IJAA 3WTVC 2XAQA 3E6MA 4A2UA 2PN6A 3K2ZA 1TQMA 4CXFA 3DP7A 1U5TB 2XKOA 3E5XA 2ISZA 3C3WA 2V9VA 3F8BA 3SXYA 4XSXF 3S2WA 5LRRA 2DPUA 1LEBA 4WX9A 1R5GA 5ILSA 3HRMA 4GGGA 2OQGA 3V8LA 1T2KA 5L3BA 3L9FA 4IPAA 3E97A 4G6QA 2P8TA 1FT9A 3KZZA 3F8FA 4WXDA 1YO5C 3E3VA 3J80K 5LEJA 2W85A 4WCGA 3FZVA 3SHFA 2D1HA 2FQ3A 4L0YB 5HS9A 2PFBA 3WG9A 2KJBA 3R61A 2DW4A 5KK1A 4EQQA 1OYWA 5FLXK 3RYRA 2LDUA 1XSVA 2HFHA 5H6RA 2PEXA 3J81Z 3BDDA 1YS7A 3ZP5A 2HYFA 1KA8A 1OMIA 2HOEA 5CLSA 3JAMK 2XRNA 3SZPA 2W57A 1NHAA 2XV4S 1G3WA 1HQCA 1GXPA 3H92A 4ESBA 1P6RA 3H3UA 2ZBKA 1OYYA 4MQVA 3TO7A 2VBWA 4WF2A 1HBXG 2JPBA 2V1UA 3IL2A 2HKXA 2VOPA 2Y48A 1KU2A 4OOIA 4O5VA 1Z91A 3W6JB 1KYWA 2IA1A 3WGHA 4IHSA 2ZFWA 4U0VA 5ICCA 3F22A 2FOKA 1X3UA 2VXZA 4MTDA 5IT9K 1XSDA 4BXUA 3GZ5A 4ENKA 1XMKA 5H6QA 5HDGA 2DQLA 2HEOA 3I58A 3F8MA 1T38A 1YLFA 1R5HA 3FMSA 2LF8A 2JZYA 2A68F 1J75A 3KETA 4KIFA 3Q5FA 3RPUA 3GX4X 3R0JA 1IF1A 2CQKA 2UWMA 1MJAA 1REPC 4IHTA 1FYKA 1SD7A 4HLYA 1FBUA 1YW8A 1XDUA 4B09A 4KUMA 2BEOA 1G3YA 2IPQX 3R0AA 4KT5C 4PGHA 4RB1A 1H9TA 1TBXA 3P9CA 4EVIA 1D8KA 4UV9A 4JBAA 1BBYA 1QQIA 3HYIA 2DLLA 1O7LA 2DK5A 5DYMA 2FA5A 1QBJA 2NS0A 4YG2F 3QU3A 3BY6A 4UXNA 4RGRA 4HV6A 1FSEA 3BJ6A 2XASA 3QPHA 4R8HA 5D5WB 2R7FA 1Z7UA 3GFMA 1XD7A 1YIOA 3KP2A 4LJZF 1K78A 1I1SA 4ZYGA 2KJCA 2EWNA 2MH9A 2OA4A 4G94A 4L0ZB 2K27A 3ZMUA 1XB4A 4PZJA 4HF2A 2RN7A 1XGOA 1SD4A 3IC7A 1SFUA 4P55A 3PQJA 4UVBA 4IVNA 1YYVA 1UCRA 1Z1DA 2IW5A 5FGMA 2C6YA 4LLGF 4RGUA 4U0WA 3SFZA 1TTYA 1CF7B 2ISYA 2XAGA 1MDMB 2XAJA 2JSCA 2RDPA 3KEOA 4BQAA 2HZTA 3ZMDA 2P4WA 4M72A 2Z33A 2CSOA 4U0YA 2EJRA 3BPXA 3M1EA 4S04A 4EM0B 1XGNA 3G73A 2MLKA 4KN7X 2MA3A 1RNLA 3HRTA 5JI6A 1Z6RA 5ERIA 2VE9A 1FY7A 4WXCA 2G7HA 1ZRCA 5HDNA 3WTSC 4GCVA 2UXXA 2R7DA 2XAFA 4Y13A 4KN4X 3TKYA 1W4MA 1FWZA 4RB3C 1IUYA 4HDVA 4RB2C 2ESHA 1U78A 5DCFA 3IKTA 5ED4A 4G7HF 3CTAA 5AIPA 1FPQA 2OZUA 2XKPA 1YG2A 1IRGA 3K1PA 4N9HA 1B59A 1R7JA 3CJNA 5LRSA 1WWXA 3WGIA 1FBSA 5LLQA 2BV6A 1E2XA 1S6LA 3T1BA 5DDGA 1RZ4A 2HR3A 3T0YA 1FYLA 2H6CA 3F3XA 5HLHA 4IRIA 4ZYHA 2KIUA 3DXJF 2ACJA 3FXRA 5HVQC 5E18F 3V7CA 1G4DA 3R6SA 3BP8A 1J7KA 3KP6A 5F64A 5F6FA 1ONVA 2KKOA 1PP7U 4XLNF 1QNTA 1ZREA 1ZH5A 2LF7A 2NAZA 4FX0A 2DFIA 3BJOA 3QU6A 2PBIA 3C1DA 1F4KA 4M9ZA 3LQRA 1S7OA 4AWXB 3GEZA 5A2QK 2EV5A 2DO7A 3WTTC 5JHUA 3F8NA 1YFHA 3TO6A 1U8RA 1XN7A 5J8CA 4KICA 3BPVA 3MWMA 1GHCA 3LA3A 2E7XA 2L54A 4JQFA 2QQ9A 1HW1A 4NB5A 2P7VB 1HKTA 3KLNA 3WTXC 2HQRA 2D45A 4HX4A 3CUQC 3QAHA 3BOQA 3SZTA 4MEXF 4WK8F 2A6EF 2FMYA 2P7CB 1USSA 2WTEA 2YX7A 1KQ8A 3RI4A 1O3RA 1ZYRF 1LQ1A 5JVTA 3RDIA 1O3SA 2HKOA 1J59A 4HF0A 5ICEA 4IRGA 3H3ZA 4HW0A 3N4MA 2NYXA 1YW7A 2VT3A 2K86A 3OV8A 2L4MA 5DV5A 2MH2A 1SD6A 3VEPA 4I0AA 3ELKA 3L2CA 4DNCA 3I0TA 4FHTA 2A07F 3DF8A 2F5FA 2IVMA 1KU9A 3MQ0A 3K69A 5DCMA 4XBFA 2DI3A 1IXCA 2M1BA 1OR7A 3GUDA 2Z9OA 2ZNZA 5K1YA 1K79A 2K4BA 4HF1A 1BI0A 3M8EA 1T39A 3MZHA 1HKQA 1LDJA 4A6EA 1DP7P 1HW2A 4CYDA 3IWFA 1CF7A 1W7PB 4HX7A 2D2WA 1MDMA 5CVUA 2CG4A 2L4AA 1WRJA 4I02A 1U3EM 3LWFA 4UUVA 1EH6A 2A69F 2GXGA 1R1UA 3GLXA 4WXHA 2QZ8A 4L9JA 2PJPA 1J9IA 1I6XA 5FB2A 1R36A 3E5UA 4GYGA 3P9IA 2GQQA 4ETSA 1MJ9A 1BC8C 1V4RA 1F9NA 5L3GA 2R3SA 3T8RA 3LFKA 4UHTA 3ZN0A 2FXAA 4M6YA 1S8NA 2EK5A 5LBQA 5LGUA 3RIRA 4EV0A 4ENJA 2HYGD 5J8FA 1UHMA 3WTUC 5D4SA 2PLYA 3GF2A 1FLIA 1XGSA 1KQ9A 1FNNA 3U9GA 1RI7A 4A6DA 1D3YA 3DV8A 5J6XA 2W84A 1P4WA 3JW4A 3JSOA 1ZHFA 2VC0A 1OKRA 2UXNA 4U88A 2F5CA 4RB0A 3HHGA 4I2OA 1I5ZA 1BN5A 2HGCA 4ASNA 2VN2A 1L3LA 5D5VB 2EV6A 2J5PA 1DPRA 3O2PE 2FSWA 1AWCA 3P7NA 4HLXA 2Q2EA 1SMYF 4ENNA 5FFZA 3ECHA 2QWWA 5D5UB 3CO7C 3RTRA 1IXRC 4MHGA 5EEGA 4HQMA 1ZG5A 1K6OA 4I98B 2O3FA 2Q8KA 5CYVA 5LHIA 3FM3A 4EMSA 1D8JA 4XLPF 3RJPA 1PP8F 3ERED 2CYYA 3LA7A 1SFEA 2JPCA 3KP5A 1BOAA 4OINF 5L3FA 3TQNA 2CO5A 2QQBA 3CUQB 4LK0F 2XHKA 3QOPA 4KDPA 4FX4A 4CZZA 1L0OC 2M5WA 4UVAA 1TLHB 2ETHA 1O57A 4OU0A 1HKSA 1XGMA 3FMRA 2LKPA 6PAXA 1HXDA 2O61A 1Z9CA 1W5SA 2FBKA 2RC4A 3ZMZA 1DUXC 1KU3A 2FU4A 1J5YA 3L09A 1T98A 2G9WA 3IWZA 3GFIA 4H0EA 1QZZA 4HYEA 1IN4A 3NRVA 1YW9A 4M6XA 5L3DA 1S7AA 1O7FA 2H09A 2X0LA 2VBXA 2E7WA 2DBBA 3E6BA 1ZRFA 1GXQA 3GFLA 1STZA 5JR3A 1JXSA 5BS6A 2QBYA 4GO1A 2EFNA 4Q5SF 4IRHA 2PMUA 4MQ9F 1IZ1A 5LGNA 1C0WA 4PDKA 4HV5A 1CGPA 5LHGA 2FNPA 2QUFA 2O0YA 5D8LB 1F5TA 2LNBA 1TQPA 1EV7A 3K1MA 3K9TA 3LSTA 3J7AO 2COMA 3GYHX 3I64A 3GO5A 1MKMA 2BGCA 2A6HF 3G3ZA 5DUIA 2RVCA 3NEUA 3HOTA 3ECOA 1LB2A 4XRFA 2QM3A 3V7SA 3FXUA 4UV8A 2PG4A 3VFZA 2DTRA 4DQ2A 5AIQA 2DPDA 1WQ2A 3SQNA 1U5TA 4LG0B 2B0LA 1FSHA 1IRFA 3V8KA 4HX8A 4RS8A 1RIOH 3TDZC 5HLGA 4A0XA 3M9AA 1O3QA 1EH7A 5CJ9A 3JTGA 4O6JA 5ILUA 2HDCA 4AIHA 1BIAA 4I0BA 4NQWA 2XAHA 2FBIA 2VONA 2A61A 2FRHA 2GA1A 2J5OA 2YSRA 2NNNA 2DQRA 2CGPA 3T8TA 3F6VA 3QRFF 5CVJA 2RNJA 4M9XA 3J81K 4A12A 5K5QA 3KE2A 1KYZA 5CVVA 4XSZF 1LNWA 4E70A 2Z5UA 3MFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LB6 B;  1PUE E;  3WOD F;  2DU9 A;  2VT2 A;  2P5V A;  3K0L A;  4CO8 A;  2W25 A;  2D1V A;  4N9I A;  1BJA A;  1LDD A;  3ROU A;  3HSR A;  2GXB A;  5HDK A;  4R1H A;  2DAO A;  3JSP A;  3BRO A;  1ULY A;  3ZN1 A;  1XSX A;  3TDU C;  4ZZD A;  2F5E A;  1FZP B;  2FEZ A;  1ZAO A;  1ON2 A;  2IP2 A;  2KRF A;  3C18 A;  4P96 A;  5HLI A;  2ELH A;  5HOO A;  4IF4 A;  4BYY A;  2XVC A;  2HTJ A;  2AXL A;  3N97 A;  2Z99 A;  3JAM Z;  5BOX A;  4LK1 F;  1IN7 A;  3KP7 A;  3K1N A;  4RAZ A;  1MGT A;  4EM1 A;  5K5R A;  1Z05 A;  4RGS A;  4EGZ A;  1QGP A;  2Q0O A;  2XIG A;  5E8I A;  1K7A A;  1LEA A;  1O3T A;  2TDX A;  3F23 A;  2ZME B;  3WU1 B;  3CO6 C;  5BMZ A;  3KP4 A;  4ZZL A;  2ESN A;  4UNO A;  1AOY A;  1PDN C;  5ILV A;  3KCC A;  5IT9 Z;  4LLL A;  3R60 A;  2MD5 A;  2FF4 A;  2EFO A;  3ZMV A;  3WE2 A;  4FT8 A;  1RUO A;  3R4K A;  4L18 B;  4OMY A;  1FC3 A;  4CHU A;  4A5M A;  2GA2 A;  3KEQ A;  1JHH A;  2QEN A;  3KP3 A;  1G3S A;  3EYY A;  4ENM A;  4Y15 A;  2HTS A;  4LGW A;  5JFR A;  1MJB A;  1JGS A;  5D6F A;  3WTW C;  4U7D A;  2BYV E;  3E6C C;  3EDP A;  2KIM A;  1TW3 A;  2IJL A;  2QLZ A;  3EQL F;  3I54 A;  2IA0 A;  2L02 A;  4G7O F;  2L3D A;  2OZ6 A;  3CDH A;  3F6O A;  2E1N A;  3ABU A;  4G6D A;  5E1Z B;  1FP2 A;  1TNT A;  2FBH A;  2NRA C;  2ZXJ A;  3DFG A;  4LB5 A;  2Y75 A;  3HOS A;  3Q9S A;  3WE3 A;  3GVA A;  2KIF A;  4LMY A;  2VE8 A;  5DEQ A;  1J0R A;  4YII A;  4LFU A;  1E17 A;  2OU2 A;  3GFJ A;  4PGG A;  2RV8 A;  1SD5 A;  3WTZ A;  2FNA A;  3GZ6 A;  3IHU A;  3GXO A;  1R22 A;  4JK1 X;  1FP1 D;  4LG0 A;  1BI2 A;  3ZMT A;  2V1X A;  4M74 A;  3MEX A;  5KVR A;  4I01 A;  4HQE A;  1YTY A;  1R58 A;  4HAM A;  1B9N A;  2JT1 A;  3EET A;  1YQA A;  3Q9V A;  5HS8 A;  4G9Y A;  4ON0 A;  1P2F A;  2ZCW A;  1IAW A;  1P4X A;  2E1C A;  1JHF A;  4G8X A;  4KMF A;  2WWY A;  4TV7 A;  2STT A;  2Z3Y A;  3GWZ A;  4KNY A;  4OIQ F;  2BBY A;  4M73 A;  4HDU A;  1VTN C;  2M87 A;  1DDN A;  3FHZ A;  1UHW A;  4UVC A;  3F21 A;  1ZRD A;  1OPC A;  5H20 A;  2IRF G;  3HTU A;  5FD5 A;  5CVR A;  2ZKZ A;  3LAP A;  1T0F A;  2LSO A;  4OIP F;  3PFI A;  4AD9 A;  3DPL C;  4EJO A;  1A04 A;  3I4P A;  1SMT A;  1W7P D;  1JE8 A;  1V3F A;  4KIB A;  1LJ9 A;  2G7U A;  2YPR A;  1HSJ A;  5CVI A;  2PI0 A;  2W24 A;  1R1T A;  3EUH A;  5LGT A;  4ESF A;  1SAX A;  4AVP A;  1EH8 A;  5TRD A;  1WKM A;  3M7G A;  2ZJ2 A;  1BIB A;  3I53 A;  1TNS A;  4YFX F;  1I1G A;  4CDG A;  2WV0 A;  4P9U A;  1HST A;  2YX4 A;  2JTV A;  5FO5 A;  3MCZ A;  1XCV A;  2JRT A;  4EJT A;  5E20 A;  4N0B A;  3HUG A;  4S05 A;  4BNC A;  4L5J A;  2GZW A;  4GYI A;  2EFP A;  3TOA A;  4RGX A;  4A5N A;  1J2X A;  3RKY A;  4A0Z A;  2ZME A;  1SFX A;  4RAY A;  2UZK A;  1B9M A;  2Y0M A;  3REO A;  3U1D A;  2O8X A;  3VB2 A;  2F5D A;  4Q4Z F;  2M30 A;  1Q1H A;  1R1V A;  3L7W A;  3B73 A;  3E6D A;  3KLO A;  4OMZ A;  1IN6 A;  3I59 B;  1XCB A;  3ZMS A;  3L00 A;  4CIC A;  5A2Q Z;  3D5L A;  1BI1 A;  4A0Y A;  4G7Z F;  3PQK A;  4HA8 A;  5HS7 A;  3HRS A;  4OIO F;  3P9K A;  3RKW A;  4Y17 A;  2A5Y B;  1HW5 A;  2P5L C;  2O6G E;  3O3K A;  4KFC A;  3WGG A;  4R79 A;  3WTY C;  2X4H A;  4KYW A;  3TO9 A;  1D5V A;  4ESJ A;  2ADU A;  4P9F A;  4KA4 A;  4Q48 A;  4O3M A;  2DT5 A;  3V8J A;  2HS5 A;  2CFX A;  3HTS B;  5E1W A;  3ML6 A;  4Z2Y A;  3B02 A;  4L5I A;  4L9V A;  2MBF A;  3IKV A;  3HIF A;  3JTH A;  4YFN F;  3M8F A;  2VBY A;  3FF5 A;  2WC2 A;  2OQR A;  1RUN A;  3D0S A;  3BWG A;  2YR2 A;  4B8X A;  2EV0 A;  1ZLK A;  2EA2 A;  4I09 A;  4ZH4 F;  1LVA A;  3F72 A;  3E5Q A;  3ABT A;  2ZNY A;  2H94 A;  1IN8 A;  5EEH A;  3WU0 A;  3DQV C;  2NNY A;  5DCM B;  3U2R A;  5L3C A;  1P4A A;  1U6G A;  3OOP A;  3ULQ B;  3NQO A;  1R23 A;  5F1R A;  1UST A;  2DK8 A;  1W7P A;  5AON A;  1WSU A;  5IT3 A;  5D8K B;  4MNU A;  3I5U A;  2RQP A;  1IW7 F;  1B6A A;  3FX3 A;  4M71 A;  1KGS A;  3VOD A;  4YFK F;  4I7H A;  1FYM A;  3QP5 A;  1XDS A;  3DEU A;  3HRU A;  1ZLJ A;  3T5X A;  2HWV A;  3LAJ A;  2OD5 A;  2P6T A;  3MZY A;  4U7B A;  1UFM A;  3I71 A;  4M9S A;  2QYO A;  5BQT A;  1QZY A;  1GVJ A;  4BAY A;  1W5T A;  1H0M A;  5E17 F;  1OYI A;  4PCQ A;  2GIV A;  1ON1 A;  3F8C A;  2H27 A;  2L01 A;  1XMA A;  2RGV A;  1F1Z A;  2EFW A;  4EGY A;  1ZG3 A;  1ZN2 A;  3ZPL A;  3DPT A;  4MTE A;  2IA2 A;  4K2E A;  2MC3 A;  4KIG A;  1U5T C;  2PQ8 A;  1Y0U A;  4MEY F;  4CGZ A;  2IT0 A;  4F7Z A;  3KZY A;  2HQN A;  1G6N A;  2RKH A;  3FM5 A;  4IXA A;  2FE3 A;  3J80 Z;  4BHB A;  1QO0 D;  2AS5 F;  2YU3 A;  2PMH A;  3BZ6 A;  3TGN A;  3QP6 A;  1S3J A;  2K4J A;  4D0P A;  1YS6 A;  1BI3 A;  4GXO A;  2XRO A;  3HSF A;  5FLX Z;  2M8E A;  3V4G A;  4EJU A;  3FXQ A;  1IN5 A;  1UB9 A;  2EB7 A;  2OBP A;  4HBL A;  1BC7 C;  1FX7 A;  1KQ0 A;  2K02 A;  4AIJ A;  1T6S A;  3LA2 A;  4BH9 A;  5LHH A;  4LD5 A;  2VBZ A;  4MGR A;  2V79 A;  1P92 A;  1LDK B;  1FBQ A;  2XGX A;  3ISP A;  3DKW A;  5D4R A;  3FWE A;  1ZGA A;  5FFX A;  5D5X B;  4Q47 A;  2FML A;  3RPQ A;  3CUQ A;  3O6B B;  2CWE A;  4EM2 A;  1ODD A;  3MAJ A;  1G3T A;  4WWC A;  1S29 A;  4HOB A;  2V1D A;  3IRR A;  4LLN A;  4QLC U;  3C7J A;  1U2W A;  3KFW X;  2P6S A;  2BE5 F;  1ZAR A;  2EFQ A;  5TJJ A;  2GWR A;  3IRQ A;  1B4A A;  5L3E A;  1B1B A;  3I59 A;  4YIF A;  5ICF A;  1ZGJ A;  5DUK A;  5K5O A;  4ZYD A;  3FMQ A;  3CLO A;  3ZQ7 A;  1H9G A;  2QVO A;  3COA C;  2STW A;  3EYI A;  2O03 A;  3QPT A;  4HZF A;  1MD0 A;  2M45 A;  3CUO A;  2VOD A;  3HSE A;  3RKX A;  4BHC A;  3LQQ A;  3V7R A;  3AAF A;  4AIK A;  2ZO4 A;  4QWQ A;  1FOK A;  1R00 A;  1Z6T A;  3HHH A;  1TW2 A;  4L9N A;  2MLG A;  3VOE A;  5ICG A;  5DD4 A;  3TOB A;  2VC1 A;  2K7L A;  4P5O A;  2H6B A;  5D6E A;  5E1X A;  4OIR F;  4EJW A;  5FD6 A;  2QBY B;  2VOO A;  1QPM A;  1KU7 A;  1MZB A;  1BM9 A;  3GW2 A;  4NHJ A;  2XUB A;  2QQA A;  2F2E A;  5DD8 A;  3W6K B;  5LEK A;  4EJV A;  1IXS B;  1K78 B;  1WI9 A;  2P5K A;  5BPD A;  3RYP A;  2A3S A;  2CW0 F;  5BPI A;  4BHP A;  5E8G A;  4ZYE A;  2OAZ A;  3BJA A;  4KMU X;  2V6C A;  1ZG1 A;  2GAU A;  1TQI A;  2EA4 A;  1I27 A;  4L9T A;  1DPU A;  4IJA A;  3WTV C;  2XAQ A;  3E6M A;  4A2U A;  2PN6 A;  3K2Z A;  1TQM A;  4CXF A;  3DP7 A;  1U5T B;  2XKO A;  3E5X A;  2ISZ A;  3C3W A;  2V9V A;  3F8B A;  3SXY A;  4XSX F;  3S2W A;  5LRR A;  2DPU A;  1LEB A;  4WX9 A;  1R5G A;  5ILS A;  3HRM A;  4GGG A;  2OQG A;  3V8L A;  1T2K A;  5L3B A;  3L9F A;  4IPA A;  3E97 A;  4G6Q A;  2P8T A;  1FT9 A;  3KZZ A;  3F8F A;  4WXD A;  1YO5 C;  3E3V A;  3J80 K;  5LEJ A;  2W85 A;  4WCG A;  3FZV A;  3SHF A;  2D1H A;  2FQ3 A;  4L0Y B;  5HS9 A;  2PFB A;  3WG9 A;  2KJB A;  3R61 A;  2DW4 A;  5KK1 A;  4EQQ A;  1OYW A;  5FLX K;  3RYR A;  2LDU A;  1XSV A;  2HFH A;  5H6R A;  2PEX A;  3J81 Z;  3BDD A;  1YS7 A;  3ZP5 A;  2HYF A;  1KA8 A;  1OMI A;  2HOE A;  5CLS A;  3JAM K;  2XRN A;  3SZP A;  2W57 A;  1NHA A;  2XV4 S;  1G3W A;  1HQC A;  1GXP A;  3H92 A;  4ESB A;  1P6R A;  3H3U A;  2ZBK A;  1OYY A;  4MQV A;  3TO7 A;  2VBW A;  4WF2 A;  1HBX G;  2JPB A;  2V1U A;  3IL2 A;  2HKX A;  2VOP A;  2Y48 A;  1KU2 A;  4OOI A;  4O5V A;  1Z91 A;  3W6J B;  1KYW A;  2IA1 A;  3WGH A;  4IHS A;  2ZFW A;  4U0V A;  5ICC A;  3F22 A;  2FOK A;  1X3U A;  2VXZ A;  4MTD A;  5IT9 K;  1XSD A;  4BXU A;  3GZ5 A;  4ENK A;  1XMK A;  5H6Q A;  5HDG A;  2DQL A;  2HEO A;  3I58 A;  3F8M A;  1T38 A;  1YLF A;  1R5H A;  3FMS A;  2LF8 A;  2JZY A;  2A68 F;  1J75 A;  3KET A;  4KIF A;  3Q5F A;  3RPU A;  3GX4 X;  3R0J A;  1IF1 A;  2CQK A;  2UWM A;  1MJA A;  1REP C;  4IHT A;  1FYK A;  1SD7 A;  4HLY A;  1FBU A;  1YW8 A;  1XDU A;  4B09 A;  4KUM A;  2BEO A;  1G3Y A;  2IPQ X;  3R0A A;  4KT5 C;  4PGH A;  4RB1 A;  1H9T A;  1TBX A;  3P9C A;  4EVI A;  1D8K A;  4UV9 A;  4JBA A;  1BBY A;  1QQI A;  3HYI A;  2DLL A;  1O7L A;  2DK5 A;  5DYM A;  2FA5 A;  1QBJ A;  2NS0 A;  4YG2 F;  3QU3 A;  3BY6 A;  4UXN A;  4RGR A;  4HV6 A;  1FSE A;  3BJ6 A;  2XAS A;  3QPH A;  4R8H A;  5D5W B;  2R7F A;  1Z7U A;  3GFM A;  1XD7 A;  1YIO A;  3KP2 A;  4LJZ F;  1K78 A;  1I1S A;  4ZYG A;  2KJC A;  2EWN A;  2MH9 A;  2OA4 A;  4G94 A;  4L0Z B;  2K27 A;  3ZMU A;  1XB4 A;  4PZJ A;  4HF2 A;  2RN7 A;  1XGO A;  1SD4 A;  3IC7 A;  1SFU A;  4P55 A;  3PQJ A;  4UVB A;  4IVN A;  1YYV A;  1UCR A;  1Z1D A;  2IW5 A;  5FGM A;  2C6Y A;  4LLG F;  4RGU A;  4U0W A;  3SFZ A;  1TTY A;  1CF7 B;  2ISY A;  2XAG A;  1MDM B;  2XAJ A;  2JSC A;  2RDP A;  3KEO A;  4BQA A;  2HZT A;  3ZMD A;  2P4W A;  4M72 A;  2Z33 A;  2CSO A;  4U0Y A;  2EJR A;  3BPX A;  3M1E A;  4S04 A;  4EM0 B;  1XGN A;  3G73 A;  2MLK A;  4KN7 X;  2MA3 A;  1RNL A;  3HRT A;  5JI6 A;  1Z6R A;  5ERI A;  2VE9 A;  1FY7 A;  4WXC A;  2G7H A;  1ZRC A;  5HDN A;  3WTS C;  4GCV A;  2UXX A;  2R7D A;  2XAF A;  4Y13 A;  4KN4 X;  3TKY A;  1W4M A;  1FWZ A;  4RB3 C;  1IUY A;  4HDV A;  4RB2 C;  2ESH A;  1U78 A;  5DCF A;  3IKT A;  5ED4 A;  4G7H F;  3CTA A;  5AIP A;  1FPQ A;  2OZU A;  2XKP A;  1YG2 A;  1IRG A;  3K1P A;  4N9H A;  1B59 A;  1R7J A;  3CJN A;  5LRS A;  1WWX A;  3WGI A;  1FBS A;  5LLQ A;  2BV6 A;  1E2X A;  1S6L A;  3T1B A;  5DDG A;  1RZ4 A;  2HR3 A;  3T0Y A;  1FYL A;  2H6C A;  3F3X A;  5HLH A;  4IRI A;  4ZYH A;  2KIU A;  3DXJ F;  2ACJ A;  3FXR A;  5HVQ C;  5E18 F;  3V7C A;  1G4D A;  3R6S A;  3BP8 A;  1J7K A;  3KP6 A;  5F64 A;  5F6F A;  1ONV A;  2KKO A;  1PP7 U;  4XLN F;  1QNT A;  1ZRE A;  1ZH5 A;  2LF7 A;  2NAZ A;  4FX0 A;  2DFI A;  3BJO A;  3QU6 A;  2PBI A;  3C1D A;  1F4K A;  4M9Z A;  3LQR A;  1S7O A;  4AWX B;  3GEZ A;  5A2Q K;  2EV5 A;  2DO7 A;  3WTT C;  5JHU A;  3F8N A;  1YFH A;  3TO6 A;  1U8R A;  1XN7 A;  5J8C A;  4KIC A;  3BPV A;  3MWM A;  1GHC A;  3LA3 A;  2E7X A;  2L54 A;  4JQF A;  2QQ9 A;  1HW1 A;  4NB5 A;  2P7V B;  1HKT A;  3KLN A;  3WTX C;  2HQR A;  2D45 A;  4HX4 A;  3CUQ C;  3QAH A;  3BOQ A;  3SZT A;  4MEX F;  4WK8 F;  2A6E F;  2FMY A;  2P7C B;  1USS A;  2WTE A;  2YX7 A;  1KQ8 A;  3RI4 A;  1O3R A;  1ZYR F;  1LQ1 A;  5JVT A;  3RDI A;  1O3S A;  2HKO A;  1J59 A;  4HF0 A;  5ICE A;  4IRG A;  3H3Z A;  4HW0 A;  3N4M A;  2NYX A;  1YW7 A;  2VT3 A;  2K86 A;  3OV8 A;  2L4M A;  5DV5 A;  2MH2 A;  1SD6 A;  3VEP A;  4I0A A;  3ELK A;  3L2C A;  4DNC A;  3I0T A;  4FHT A;  2A07 F;  3DF8 A;  2F5F A;  2IVM A;  1KU9 A;  3MQ0 A;  3K69 A;  5DCM A;  4XBF A;  2DI3 A;  1IXC A;  2M1B A;  1OR7 A;  3GUD A;  2Z9O A;  2ZNZ A;  5K1Y A;  1K79 A;  2K4B A;  4HF1 A;  1BI0 A;  3M8E A;  1T39 A;  3MZH A;  1HKQ A;  1LDJ A;  4A6E A;  1DP7 P;  1HW2 A;  4CYD A;  3IWF A;  1CF7 A;  1W7P B;  4HX7 A;  2D2W A;  1MDM A;  5CVU A;  2CG4 A;  2L4A A;  1WRJ A;  4I02 A;  1U3E M;  3LWF A;  4UUV A;  1EH6 A;  2A69 F;  2GXG A;  1R1U A;  3GLX A;  4WXH A;  2QZ8 A;  4L9J A;  2PJP A;  1J9I A;  1I6X A;  5FB2 A;  1R36 A;  3E5U A;  4GYG A;  3P9I A;  2GQQ A;  4ETS A;  1MJ9 A;  1BC8 C;  1V4R A;  1F9N A;  5L3G A;  2R3S A;  3T8R A;  3LFK A;  4UHT A;  3ZN0 A;  2FXA A;  4M6Y A;  1S8N A;  2EK5 A;  5LBQ A;  5LGU A;  3RIR A;  4EV0 A;  4ENJ A;  2HYG D;  5J8F A;  1UHM A;  3WTU C;  5D4S A;  2PLY A;  3GF2 A;  1FLI A;  1XGS A;  1KQ9 A;  1FNN A;  3U9G A;  1RI7 A;  4A6D A;  1D3Y A;  3DV8 A;  5J6X A;  2W84 A;  1P4W A;  3JW4 A;  3JSO A;  1ZHF A;  2VC0 A;  1OKR A;  2UXN A;  4U88 A;  2F5C A;  4RB0 A;  3HHG A;  4I2O A;  1I5Z A;  1BN5 A;  2HGC A;  4ASN A;  2VN2 A;  1L3L A;  5D5V B;  2EV6 A;  2J5P A;  1DPR A;  3O2P E;  2FSW A;  1AWC A;  3P7N A;  4HLX A;  2Q2E A;  1SMY F;  4ENN A;  5FFZ A;  3ECH A;  2QWW A;  5D5U B;  3CO7 C;  3RTR A;  1IXR C;  4MHG A;  5EEG A;  4HQM A;  1ZG5 A;  1K6O A;  4I98 B;  2O3F A;  2Q8K A;  5CYV A;  5LHI A;  3FM3 A;  4EMS A;  1D8J A;  4XLP F;  3RJP A;  1PP8 F;  3ERE D;  2CYY A;  3LA7 A;  1SFE A;  2JPC A;  3KP5 A;  1BOA A;  4OIN F;  5L3F A;  3TQN A;  2CO5 A;  2QQB A;  3CUQ B;  4LK0 F;  2XHK A;  3QOP A;  4KDP A;  4FX4 A;  4CZZ A;  1L0O C;  2M5W A;  4UVA A;  1TLH B;  2ETH A;  1O57 A;  4OU0 A;  1HKS A;  1XGM A;  3FMR A;  2LKP A;  6PAX A;  1HXD A;  2O61 A;  1Z9C A;  1W5S A;  2FBK A;  2RC4 A;  3ZMZ A;  1DUX C;  1KU3 A;  2FU4 A;  1J5Y A;  3L09 A;  1T98 A;  2G9W A;  3IWZ A;  3GFI A;  4H0E A;  1QZZ A;  4HYE A;  1IN4 A;  3NRV A;  1YW9 A;  4M6X A;  5L3D A;  1S7A A;  1O7F A;  2H09 A;  2X0L A;  2VBX A;  2E7W A;  2DBB A;  3E6B A;  1ZRF A;  1GXQ A;  3GFL A;  1STZ A;  5JR3 A;  1JXS A;  5BS6 A;  2QBY A;  4GO1 A;  2EFN A;  4Q5S F;  4IRH A;  2PMU A;  4MQ9 F;  1IZ1 A;  5LGN A;  1C0W A;  4PDK A;  4HV5 A;  1CGP A;  5LHG A;  2FNP A;  2QUF A;  2O0Y A;  5D8L B;  1F5T A;  2LNB A;  1TQP A;  1EV7 A;  3K1M A;  3K9T A;  3LST A;  3J7A O;  2COM A;  3GYH X;  3I64 A;  3GO5 A;  1MKM A;  2BGC A;  2A6H F;  3G3Z A;  5DUI A;  2RVC A;  3NEU A;  3HOT A;  3ECO A;  1LB2 A;  4XRF A;  2QM3 A;  3V7S A;  3FXU A;  4UV8 A;  2PG4 A;  3VFZ A;  2DTR A;  4DQ2 A;  5AIQ A;  2DPD A;  1WQ2 A;  3SQN A;  1U5T A;  4LG0 B;  2B0L A;  1FSH A;  1IRF A;  3V8K A;  4HX8 A;  4RS8 A;  1RIO H;  3TDZ C;  5HLG A;  4A0X A;  3M9A A;  1O3Q A;  1EH7 A;  5CJ9 A;  3JTG A;  4O6J A;  5ILU A;  2HDC A;  4AIH A;  1BIA A;  4I0B A;  4NQW A;  2XAH A;  2FBI A;  2VON A;  2A61 A;  2FRH A;  2GA1 A;  2J5O A;  2YSR A;  2NNN A;  2DQR A;  2CGP A;  3T8T A;  3F6V A;  3QRF F;  5CVJ A;  2RNJ A;  4M9X A;  3J81 K;  4A12 A;  5K5Q A;  3KE2 A;  1KYZ A;  5CVV A;  4XSZ F;  1LNW A;  4E70 A;  2Z5U A;  3MFK A; 
#chains in the Genus database with same CATH topology
 3DKX A;  3DU5 A;  3PM1 A;  2DMU A;  2KIQ A;  2VQL A;  3JRE A;  2EQR A;  2M34 A;  4LB6 B;  3WOD F;  1PUE E;  1BA5 A;  2DU9 A;  2VT2 A;  3UKG A;  1W0T A;  4A3B J;  2Z2S B;  4JX6 A;  2P5V A;  1YRN A;  3K0L A;  4CO8 A;  5B1A H;  1SFK A;  2LP0 A;  4Y4R A;  2W25 A;  2D1V A;  4N9I A;  2NVY J;  1BJA A;  1BR2 A;  1LDD A;  4DZJ A;  3ROU A;  2OUM A;  3HSR A;  2KRC A;  2WAQ N;  2GXB A;  5HDK A;  4R1H A;  3CQZ J;  2HI3 A;  4M6V A;  2DAO A;  1B8I A;  4CH7 A;  2LY1 A;  3JSP A;  3A03 A;  3BRO A;  3PUB A;  1ULY A;  4XLC A;  3ZN1 A;  1XSX A;  3TDU C;  4ZZD A;  2F5E A;  1FZP B;  2FEZ A;  3OYF A;  1ZAO A;  1ON2 A;  2BZT A;  2IP2 A;  2KRF A;  3C18 A;  3K4M A;  2VPL A;  4P96 A;  3OR2 C;  4H4K C;  1MBF A;  5J1Y A;  4JP0 A;  3FBI B;  5HLI A;  2ELH A;  3ZRG A;  5HOO A;  3I3L A;  4IF4 A;  4BYY A;  2XF7 A;  3IUO A;  1XC5 A;  2XVC A;  2X6O A;  4IZZ A;  3VYU B;  2HTJ A;  3HKZ A;  2AXL A;  4BQN A;  2CQX A;  3ASN H;  3K7A J;  3N97 A;  3BR0 A;  1QHG A;  2Z99 A;  3JAM Z;  5BOX A;  4LK1 F;  3ABL H;  5C4J J;  2G0E A;  5IP6 A;  1IN7 A;  3CCQ I;  3KP7 A;  3K1N A;  2K9Q A;  4RAZ A;  1MGT A;  2MC4 A;  3KZI C;  2LG4 A;  3GTP J;  4RM2 A;  3OWT A;  4EM1 A;  5K5R A;  1Z05 A;  1EKE A;  4RGS A;  3K4C A;  1VQN I;  4EGZ A;  3H0G J;  3MKZ A;  4X0G A;  1QVU A;  3CCY A;  1QGP A;  2Q0O A;  2X6Y A;  2XIG A;  3HUG B;  5E8I A;  2VQH A;  1K7A A;  2DFE A;  3FXL A;  1LEA A;  3A2K A;  1O3T A;  1D0Z A;  1UEL B;  2TDX A;  1X2N A;  3F23 A;  2ZME B;  1QA6 A;  1D1A A;  1N25 A;  2XPW A;  5FRM A;  2I10 A;  5HNH A;  3WU1 B;  3CO6 C;  1P9Q C;  3K10 A;  2E71 A;  4CCN A;  4DYQ A;  5BMZ A;  3H1C A;  3KP4 A;  4ZZL A;  2ZJP F;  2ESN A;  3FHN A;  2ZJR F;  4UNO A;  3CCE I;  1FMW A;  1AOY A;  2KP6 A;  3WU2 C;  5ILV A;  2LKX A;  1PDN C;  3KCC A;  4D9J A;  1VQL I;  2JA7 J;  5IT9 Z;  4LLL A;  1M1E B;  3R60 A;  2MD5 A;  4D1Q A;  2FF4 A;  2EFO A;  3CF5 F;  1ZGW A;  2ZSI B;  3ZMV A;  3WE2 A;  4FT8 A;  4Z6Y A;  1RUO A;  3R4K A;  4L18 B;  4OMY A;  1OCT C;  1FC3 A;  4I76 A;  2CU7 A;  2EIN H;  3LMM A;  4BJT A;  2DJN A;  4CHU A;  4A5M A;  2KPM A;  5F04 A;  2GA2 A;  3EPZ A;  2E34 A;  3A01 B;  3KEQ A;  4B3A A;  1JHH A;  4PFP A;  2QEN A;  1WCM J;  3MD2 A;  4M3D A;  3KP3 A;  1G3S A;  3EYY A;  1WZ2 A;  4JX4 A;  2P0W A;  3DLL F;  2LLK A;  2NOJ B;  3OIP A;  4ENM A;  2E60 A;  3QQA A;  2DA7 A;  4Y15 A;  2Y0S N;  3SJM A;  2HTS A;  1PUF B;  4LGW A;  1KON A;  3ZGK A;  3OIQ A;  1OIS A;  5K7F A;  2M4G A;  3DEE A;  3I56 I;  5JFR A;  2MSY A;  1MJB A;  1JGS A;  5D6F A;  5DM7 F;  3WTW C;  4U7D A;  2BYV E;  1Y1W J;  3E6C C;  3EDP A;  2KIM A;  3E1S A;  1TW3 A;  1SFO J;  3ZQL A;  2IJL A;  2QLZ A;  3EQL F;  3OYE A;  3QPS A;  1OFC X;  3I54 A;  2IA0 A;  4Y7N J;  2L02 A;  4G7O F;  2L3D A;  1JUP A;  2OZ6 A;  3CDH A;  4M3B A;  3VYT B;  4BGD A;  3OYH A;  3F6O A;  3CC7 I;  2E1N A;  3GTM J;  3ABU A;  1QZE A;  4Y33 A;  4G6D A;  5E1Z B;  1FP2 A;  4F52 A;  1JKP C;  1TNT A;  5EG0 A;  2FBH A;  3CLQ A;  1T8I A;  2NRA C;  2ZXJ A;  3DFG A;  2NOG A;  4XN0 A;  4LB5 A;  1BOB A;  1NK2 P;  2Y75 A;  3HOS A;  3Q9S A;  2HVQ A;  2DOE A;  3WE3 A;  1JTY A;  3GVA A;  5IOZ A;  2L9N A;  2KIF A;  4LMY A;  2VE8 A;  5DEQ A;  2FQ4 A;  1J0R A;  4YII A;  2LTP A;  4LFU A;  2R7U A;  3PNT A;  2OU2 A;  1VQ5 I;  1E17 A;  3GFJ A;  2OTJ I;  4PGG A;  2RV8 A;  2R7X A;  2XRL A;  1SD5 A;  4XIC A;  3SDG A;  3WTZ A;  1T08 B;  2FNA A;  4NC6 A;  4XKW A;  3TP0 A;  4E6K G;  3GZ6 A;  3IHU A;  5EZH A;  3GXO A;  4ZTJ A;  1Y6I A;  2W4S A;  1R22 A;  4JK1 X;  1FP1 D;  4LG0 A;  1BI2 A;  3ZMT A;  2V1X A;  4M74 A;  3MEX A;  4BS9 A;  3H5N A;  2CUF A;  2VUM J;  5KVR A;  4I01 A;  4HQE A;  1YTY A;  1R58 A;  1IO2 A;  4HAM A;  1B9N A;  2JT1 A;  3HL2 A;  3EET A;  2K5C A;  3OS1 A;  4J01 A;  3H5R A;  3HZJ A;  1YQA A;  3Q9V A;  5HS8 A;  4G9Y A;  4ON0 A;  2HVR A;  4CYC B;  2KDO A;  4F92 B;  3IH4 A;  2V9P A;  1P7J A;  1P2F A;  1VQ4 I;  2ZCW A;  3CDI A;  1IAW A;  3AL0 C;  2VL8 A;  1P4X A;  5M5Y J;  2E1C A;  4HST A;  3C2G A;  4ZC3 A;  3HBL A;  1JHF A;  1Y8Q B;  3LSH A;  4QPO A;  4G8X A;  2FOW A;  2BW3 A;  5EGO A;  4KMF A;  1H88 C;  3L2U A;  1V5F A;  4XK4 A;  2EBI A;  2WWY A;  1FOY A;  4TV7 A;  2STT A;  2Z3Y A;  3GWZ A;  1UG0 A;  3LSM A;  4KNY A;  1OR7 C;  4OIQ F;  2BBY A;  1SAU A;  4M73 A;  1FEX A;  2E19 A;  4HDU A;  1VTN C;  5JLX A;  1GV2 A;  2M87 A;  1DDN A;  2QKM B;  3CES A;  4S0H B;  3FHZ A;  1UHW A;  4MFD A;  2DCE A;  4UVC A;  3F21 A;  4BU2 A;  1ZRD A;  1OPC A;  1X1A A;  3RZO J;  2I5U A;  5H20 A;  2IRF G;  1ERD A;  3HTU A;  5FD5 A;  2VXD A;  3JRG A;  5CVR A;  2ZKZ A;  1VQ8 I;  4ITV A;  1GUU A;  3LAP A;  1T0F A;  2LSO A;  2KLO A;  1ZR4 A;  3BT9 A;  3JCU C;  4OIP F;  3PFI A;  4AD9 A;  3BR6 A;  3DPL C;  2JA2 A;  4EJO A;  2HDD A;  3ERM A;  4BXF A;  1A04 A;  2K9L A;  3I4P A;  1SMT A;  4M3E A;  1W7P D;  5F27 A;  5GPC A;  1JE8 A;  1V3F A;  2VIX A;  4KIB A;  1LJ9 A;  4IHY A;  2G7U A;  2JRM A;  2YPR A;  1HSJ A;  2Y9Y A;  5CVI A;  1IV8 A;  4AVZ A;  2PI0 A;  2W24 A;  2M9H A;  4XN3 A;  1R1T A;  1LKX A;  3EUH A;  4OAY A;  5LGT A;  2NS7 A;  4ESF A;  4D5C A;  1RR7 A;  2JVG A;  5JLW A;  3BQY A;  1SAX A;  4AVP A;  1EH8 A;  5TRD A;  1WKM A;  3DKY A;  2ZJ2 A;  3M7G A;  1BIB A;  3I53 A;  1TNS A;  4B44 A;  4YFX F;  5DM6 F;  3TP3 A;  2L9S A;  1I1G A;  4CDG A;  5E3L A;  1PYV A;  2WV0 A;  2ZFU A;  1HST A;  3SEQ A;  4P9U A;  2YX4 A;  4IOA F;  2JTV A;  3PSI A;  5FO5 A;  3MCZ A;  2R4G A;  5J3L A;  1XCV A;  2MD0 A;  2JRT A;  2Y69 H;  4B47 A;  3P5J A;  3ZCO A;  4BDY A;  4EJT A;  5E20 A;  2IEK A;  5J47 A;  4N0B A;  3OYJ A;  3HUG A;  4XLA A;  3BG3 A;  4S05 A;  4BNC A;  1ITY A;  4L5J A;  2GZW A;  4GYI A;  1DP3 A;  2ICW G;  2EFP A;  3TOA A;  2E1O A;  4RGX A;  1LPQ A;  4A5N A;  5EYR A;  5C4X J;  1J2X A;  3RKY A;  1MH4 A;  4XQF A;  4A0Z A;  1MH3 A;  2ZME A;  4AM3 A;  1SFX A;  3GBG A;  2Y31 A;  3PNY A;  4RAY A;  1B9M A;  2UZK A;  2Y0M A;  3REO A;  4C3J J;  3U1D A;  5C44 J;  2O8X A;  2WAD A;  1QPI A;  2XSD C;  3VB2 A;  3AKZ A;  1A35 A;  2F5D A;  4Q4Z F;  2M30 A;  2LD5 A;  1Q1H A;  1MNE A;  4UB8 C;  1DGR M;  4B1R A;  1R1V A;  5B1B H;  3L7W A;  3B73 A;  3E6D A;  3CP8 A;  2HQA A;  1RC9 A;  3KLO A;  4OMZ A;  1IN6 A;  3I59 B;  4F91 B;  1XCB A;  3ZMS A;  4C2U A;  3L00 A;  4CIC A;  4NNJ A;  1E0E A;  1FIA A;  5A2Q Z;  4BAC A;  1JKO C;  3D5L A;  3ZOB A;  1BI1 A;  4A0Y A;  4G7Z F;  2GIZ A;  2BVM A;  3PQK A;  4A3D J;  2VJJ A;  1LFB A;  2VB6 A;  2LC2 A;  4E7S A;  4HA8 A;  5HS7 A;  3HRS A;  4OIO F;  5EEA A;  2CV1 A;  3P9K A;  4OWR B;  3RKW A;  4Y17 A;  3BR5 A;  2A5Y B;  1HW5 A;  2P5L C;  3H5A A;  2O6G E;  3S16 J;  3O3K A;  4KFC A;  3WGG A;  1VQM I;  3QYF A;  4R79 A;  1YIT I;  3WTY C;  3MN2 A;  2M0C A;  2M3A A;  2WV1 A;  2X4H A;  4F55 A;  4KYW A;  4AUX A;  1ZQ3 P;  1PUF A;  5KCM A;  3TO9 A;  4ESJ A;  2ADU A;  1D5V A;  4P9F A;  4KA4 A;  2E36 A;  4Q48 A;  4O3M A;  1ZEL A;  2DT5 A;  3DWL E;  4B48 A;  2EZH A;  4HNT A;  3V8J A;  5GAH J;  2QGU A;  4I99 C;  2HS5 A;  2CFX A;  3HTS B;  1QU3 A;  5E1W A;  1Z3Y A;  3ML6 A;  1LVK A;  4Z2Y A;  1CQT A;  1AA7 A;  4BEH A;  3V42 A;  2MYS A;  3B02 A;  5FLM J;  4L5I A;  2L7K A;  2PJR A;  2EH3 A;  2FUG 2;  3QOD A;  3BCA A;  4L9V A;  2MBF A;  3IKV A;  3HIF A;  3JTH A;  3OS0 A;  4YFN F;  3M8F A;  2VBY A;  3FF5 A;  1ETY A;  3G1L A;  4BXX J;  2WC2 A;  3TL4 X;  2OQR A;  4IOC F;  1RUN A;  2O8K A;  3D0S A;  3BWG A;  3GTJ J;  2YR2 A;  2H1K A;  4B8X A;  2EV0 A;  1ZLK A;  1UZC A;  2EA2 A;  2X1E A;  4I09 A;  4ZH4 F;  1LVA A;  3EUA A;  1SAN A;  2V4J C;  3F72 A;  3E5Q A;  1WJC A;  4A3J J;  1Y0N A;  3ABT A;  3CF2 A;  4HSR A;  1ETX A;  2NVU B;  2ZNY A;  3BR1 A;  3CCU I;  1QRY A;  3HM5 A;  1WPK A;  2H94 A;  1JJ6 C;  1XG1 A;  1IN8 A;  5EEH A;  1IC8 A;  3WU0 A;  3DQV C;  1HCR A;  1LE8 B;  2NNY A;  4E7I A;  5DCM B;  2VQG A;  3CP2 A;  3U2R A;  5L3C A;  3J7Y J;  3TBI A;  1P4A A;  1U6G A;  1HF0 A;  3OOP A;  3ULQ B;  3OYN A;  3NQO A;  1R23 A;  1LUJ B;  5F1R A;  1UST A;  5CQE A;  3FKJ A;  2A6T A;  2DK8 A;  1W7P A;  5AON A;  2B7E A;  1WSU A;  5IT3 A;  1TL8 A;  5D8K B;  4MNU A;  2MFZ A;  3I5U A;  3H3V K;  2DA4 A;  2JWT A;  2RQP A;  1IW7 F;  1B6A A;  4XKC A;  3S3N A;  4XOR A;  4KT6 A;  3FX3 A;  3FXJ A;  4M71 A;  1WVR A;  4BE0 A;  1KGS A;  3VOD A;  4YFK F;  1W0U A;  4PSW A;  4GFB A;  4I7H A;  1FYM A;  4CYC A;  2BHZ A;  3QP5 A;  4RAF A;  3I55 I;  1XDS A;  3DEU A;  3HRU A;  3O8G A;  1ZLJ A;  2JJ7 A;  1R9T J;  3T5X A;  1HOM A;  2HWV A;  1X4O A;  3LOC A;  4PFO A;  4RBO A;  3LAJ A;  1VND A;  2OD5 A;  2P6T A;  2RQQ A;  3MZY A;  4U7B A;  1UFM A;  3I71 A;  3BZC A;  4M9S A;  4RM3 A;  2QYO A;  3DCF A;  1QZY A;  5BQT A;  1ZTR A;  4BJ5 C;  5CQG A;  1GVJ A;  4BAY A;  1W5T A;  3OYI A;  3RKQ A;  1ETV A;  1H0M A;  5E17 F;  3ABK H;  1OYI A;  2IGN A;  4PCQ A;  4II3 A;  1ZKG A;  5KAI C;  2GIV A;  1ON1 A;  3F8C A;  4ZTF A;  2H27 A;  2L01 A;  1XMA A;  2RGV A;  1F1Z A;  2EFW A;  4EGY A;  1ZG3 A;  4M3F A;  1I3Q J;  5IYB J;  3H0D A;  1ZN2 A;  3ZPL A;  3DPT A;  4MTE A;  2IA2 A;  4K2E A;  2M0M A;  2MC3 A;  2XB0 X;  4KIG A;  2LMD A;  4NUB A;  2V9K A;  2E35 A;  1U5T C;  2PQ8 A;  2L7F P;  1Y0U A;  1W36 C;  4MEY F;  4KJZ A;  4CGZ A;  2IT0 A;  1X2M A;  4BUP A;  5K7H A;  4F7Z A;  3KZY A;  2HQN A;  3DTE A;  1G6N A;  3CCJ I;  2RKH A;  2VKD A;  3FM5 A;  4PJ0 C;  4IXA A;  2FE3 A;  3J80 Z;  4BHB A;  1QO0 D;  2AS5 F;  2CMP A;  2YU3 A;  4C9Y A;  1S5L C;  2PMH A;  1GLN A;  3BZ6 A;  3TGN A;  3QP6 A;  1S3J A;  2R93 J;  2HOS A;  2K4J A;  1NTC A;  4D0P A;  1YS6 A;  1BI3 A;  1BJZ A;  4GXO A;  2XRO A;  1TWG J;  2KT0 A;  4C30 A;  2CS3 A;  3HSF A;  5FLX Z;  4A3L J;  5C3E J;  4UUS B;  2W82 A;  2M8E A;  1YHQ I;  4PJJ A;  4GRI A;  3V4G A;  2MGQ A;  4EJU A;  4A3G J;  3FXQ A;  1IN5 A;  1P7I A;  1SVM A;  1UB9 A;  2EB7 A;  2OBP A;  4HBL A;  3RZD J;  4BBR J;  1BC7 C;  5GP9 A;  1FX7 A;  1KQ0 A;  3PO2 J;  2K02 A;  2ME0 A;  2XAU A;  3NWS A;  4AIJ A;  1T6S A;  3LA2 A;  4BH9 A;  2HPM A;  3QOE A;  1JUS A;  5LHH A;  4LD5 A;  3KYC B;  2VBZ A;  4MGR A;  2AHQ A;  3ZXS A;  3C2H A;  2V79 A;  1P92 A;  2F6C A;  1LDK B;  1FBQ A;  2XGX A;  3HGY A;  3ISP A;  3ONQ A;  5IP9 J;  3DKW A;  3CC4 I;  1OCC H;  5D4R A;  3FWE A;  2QCO A;  1ZGA A;  2GOX B;  3OYM A;  5FFX A;  2Q2E B;  4HRI A;  5D5X B;  3BTJ A;  5FKL A;  1IV6 A;  1E3H A;  3GTO J;  2BY3 A;  4Q47 A;  2FML A;  4FET A;  3RPQ A;  3G2B A;  1XS9 A;  1D1C A;  3CUQ A;  3O6B B;  2CWE A;  1VI0 A;  1WGX A;  4CCO A;  2JVH A;  2JK3 A;  4BL0 B;  4EM2 A;  1ODD A;  3MAJ A;  2JN6 A;  1G3T A;  4WWC A;  2OCE A;  1B72 B;  1S29 A;  4HOB A;  2V1D A;  3BR2 A;  3IRR A;  4A3E J;  4LLN A;  4QLC U;  3C7J A;  2LRD A;  1MSF C;  4XM3 A;  1U2W A;  4XR6 A;  1HLV A;  3KFW X;  2ECB A;  2P6S A;  5HNF A;  2BE5 F;  1IUF A;  1ZAR A;  2EFQ A;  5TJJ A;  2GWR A;  3IRQ A;  1B4A A;  2VQC A;  2ELJ A;  2UV1 A;  2JSP A;  4BQO A;  4FE4 A;  1NG6 A;  3BTI A;  5L3E A;  1B1B A;  3I59 A;  1HDP A;  4A69 C;  2CQ7 A;  2R7Q A;  4YIF A;  5ICF A;  1ZGJ A;  5E3O A;  3MKL A;  3K4J A;  2L5Q A;  3CJQ B;  5DUK A;  1EA3 A;  5K5O A;  1FTT A;  3X2Q H;  4ZYD A;  1YJW I;  3FMQ A;  4XKV A;  3CLO A;  3ZQ7 A;  2R7O A;  1H9G A;  2QVO A;  3COA C;  2AQE A;  2STW A;  3EYI A;  2O03 A;  3QPT A;  2YU9 J;  2CH0 A;  4HZF A;  2WAE A;  3E7L A;  1R4N B;  1DGW Y;  1MD0 A;  2K9N A;  2QF7 A;  1DU6 A;  2KHM A;  1MMG A;  2M45 A;  3CUO A;  1JT0 A;  3K70 D;  2EPF A;  2VOD A;  1RKT A;  1VQ9 I;  4QIW N;  3HSE A;  3RKX A;  3CJT B;  4BHC A;  4X1E A;  3LQQ A;  3V7R A;  3AAF A;  3CMY A;  4AIK A;  1VFC A;  2ZO4 A;  4QWQ A;  1FOK A;  1R00 A;  4IL6 C;  1Z6T A;  3HHH A;  1TW2 A;  3VSL A;  1ENH A;  4L9N A;  3CJR B;  2MLG A;  3ZQF A;  3VOE A;  2XF5 A;  2FX0 A;  1E3O C;  4RAG A;  1Q1V A;  4XOT A;  2CQQ A;  5ICG A;  5J4V A;  5DD4 A;  3TOB A;  1YX5 A;  2VC1 A;  2MG4 A;  2K7L A;  4P5O A;  2H6B A;  2L7M P;  5D6E A;  5E1X A;  4OIR F;  1EJ9 A;  3SZG A;  4EJW A;  5FD6 A;  1TWF J;  4IEJ A;  4DW6 A;  2QBY B;  3OYG A;  2VOO A;  1QPM A;  4CZC A;  3OMY A;  1KU7 A;  1MMS A;  1MZB A;  1BM9 A;  2R7W A;  2E2I J;  3GW2 A;  2LBF B;  4NHJ A;  1FJL A;  3DTK A;  2XUB A;  2QQA A;  1LFP A;  2F2E A;  5DD8 A;  3W6K B;  5LEK A;  3L2R A;  2HOT A;  4V2F A;  2R5Y B;  3CMM A;  2DT6 A;  1IXS B;  4EJV A;  1K78 B;  1WI9 A;  2P5K A;  5BPD A;  3MMY B;  3RYP A;  1HDD C;  2A3S A;  2CW0 F;  5BPI A;  4BHP A;  1TC3 C;  4XLE A;  3CCM I;  2QSF X;  4UUT A;  4PSX A;  5E8G A;  3ZQQ A;  4ZYE A;  3OIO A;  3B6A A;  1G8X A;  2R5Z B;  2QSH X;  4AYB A;  2CJJ A;  2OAZ A;  3BJA A;  4KMU X;  2V6C A;  4UB6 C;  3JRA A;  1ZG1 A;  1YI2 I;  2GAU A;  1IG7 A;  1TQI A;  2EA4 A;  1I27 A;  3BQZ A;  4L9T A;  2R0Q C;  1YX3 A;  2OPT A;  2X1D A;  2W7N A;  1DPU A;  3RPU D;  4W1U A;  3BLY A;  2JA6 J;  4IJA A;  1YJN I;  3WTV C;  5F0F A;  2XAQ A;  3E6M A;  4A2U A;  2PN6 A;  3K2Z A;  1TQM A;  2VKE A;  4CXF A;  3DP7 A;  2LY2 A;  1U5T B;  2XKO A;  3E5X A;  1K83 J;  3O8H A;  1U9N A;  4BJ6 C;  2ISZ A;  2Y9Z A;  4CUG A;  3C3W A;  2V9V A;  2K3P A;  3F8B A;  3ASO H;  3GLL A;  5FLV A;  4PJM A;  3SXY A;  4XSX F;  1ETW A;  3S2W A;  3ZQH A;  5LRR A;  4J00 A;  2DPU A;  4WX9 A;  1LEB A;  1ORK A;  2LK2 A;  1R5G A;  5FKO A;  5ILS A;  1T95 A;  3CDL A;  3HRM A;  4GGG A;  2OQG A;  3CCL I;  3V8L A;  1T2K A;  5L3B A;  3H9J A;  1Z67 A;  4C2M J;  3L9F A;  4IPA A;  2LR8 A;  4M3G A;  3E97 A;  4ZDL A;  2PMZ A;  3GZN B;  1WJB A;  4G6Q A;  2P8T A;  5FRO A;  3VYR B;  1FT9 A;  3KZZ A;  3IH2 A;  3F8F A;  1JJ8 C;  4WXD A;  2H8R A;  4NBQ A;  2CV2 A;  2YUS A;  2W48 A;  2COB A;  2X6W A;  5J1U A;  4F3Q A;  2B9S A;  1YO5 C;  1PJR A;  3VPR A;  3E3V A;  5IOY A;  3S14 J;  4QSH A;  3J80 K;  3UR3 C;  2W85 A;  5LEJ A;  4LG3 A;  3FZV A;  3SHF A;  4WCG A;  3JRC A;  3M8J A;  2D1H A;  2FQ3 A;  4NDL A;  4L0Y B;  5HS9 A;  2K9M A;  2PFB A;  3WG9 A;  3LSR A;  2KJB A;  3R61 A;  4RLF A;  4BE2 A;  5EJC A;  2F4M B;  2DW4 A;  2VLA A;  1MND A;  4E7H A;  1SC7 A;  5KK1 A;  4EQQ A;  1OYW A;  5FLX K;  3RYR A;  2LDU A;  2PX9 A;  3H9G A;  1XSV A;  2HFH A;  5H6R A;  2PEX A;  4EAT A;  3S15 J;  3J81 Z;  3BDD A;  1G59 A;  3LL7 A;  3PSF A;  2BOL A;  1YS7 A;  3ZP5 A;  1MNM C;  2XSJ C;  2IGO A;  4B4C A;  2HYF A;  5B66 C;  1KA8 A;  1OQY A;  4UUS A;  4XRS G;  4XRM A;  1YRN B;  2VAS A;  2WY8 Q;  1OMI A;  3M07 A;  2HOE A;  5CLS A;  1S7E A;  4A3K J;  2I8D A;  2R92 J;  3JAM K;  2XRN A;  2EZL A;  3SZP A;  4IQ4 A;  1B8I B;  2W57 A;  2L2O A;  1NHA A;  3KX2 A;  4D7M A;  2LVS A;  3HG9 A;  1J09 A;  2XV4 S;  3L1P A;  1POG A;  1G3W A;  1TZL A;  1R6R A;  5M3F J;  1I6H J;  1HQC A;  2E1M C;  3DPU A;  1GXP A;  3HB9 A;  2Z1D A;  3H92 A;  4ESB A;  1VF9 A;  1P6R A;  4XLH A;  3H3U A;  2ZBK A;  1OYY A;  2GXA A;  2WB1 A;  2LFB A;  4MQV A;  1JI8 A;  2OTL I;  3TO7 A;  2VBW A;  4WF2 A;  1HBX G;  5B3S H;  3HOU J;  4N4O B;  2JPB A;  5EDN A;  2NS8 A;  2V1U A;  4RDU A;  4DYC A;  3IL2 A;  2XPV A;  2HKX A;  4E4H A;  2VOP A;  2Y48 A;  1KU2 A;  4OOI A;  4O5V A;  1Z91 A;  3CMA I;  1T0F C;  3W6J B;  2QQ8 A;  3CCR I;  1KYW A;  5M3M J;  2IA1 A;  3WGH A;  4IHS A;  2ZFW A;  4U0V A;  5ICC A;  3F22 A;  2FOK A;  1X3U A;  2VXZ A;  3S3O A;  4MTD A;  5IT9 K;  1XSD A;  2WA0 A;  4BXU A;  2DN0 A;  2X1C A;  3PNV A;  1X58 A;  3NAU A;  3GZ5 A;  4ENK A;  3HXL A;  1XMK A;  5H6Q A;  5HDG A;  4FQG A;  1K4T A;  2ZSH B;  2Q1Z B;  2DQL A;  3KEY A;  3ZQC A;  3EUH C;  2HEO A;  2DA1 A;  2ZB9 A;  3I58 A;  1I39 A;  3OOU A;  3F8M A;  1MBE A;  2DMT A;  1R5I D;  3Q0V A;  3ZQG A;  1T38 A;  4ZJZ A;  1YLF A;  1R5H A;  3AG4 H;  3FMS A;  2LF8 A;  3PL8 A;  3UNG C;  4FTH A;  2X9D A;  5HLT A;  4UY8 I;  2JZY A;  2A68 F;  1J75 A;  1BW5 A;  2VJ5 A;  3KET A;  4KIF A;  3Q5F A;  3RPU A;  1YE9 A;  3GX4 X;  1VQ7 I;  3R0J A;  1IF1 A;  1R49 A;  1VZ0 A;  2CQK A;  2UWM A;  1MJA A;  1REP C;  4CCK A;  4DBR A;  2CW8 A;  4IHT A;  1FYK A;  1SD7 A;  4HLY A;  1FBU A;  3A01 A;  1YW8 A;  1RES A;  3BC8 A;  1XDU A;  2O7O A;  3E0J B;  4B09 A;  4KUM A;  2BEO A;  1G3Y A;  2DXI A;  2IPQ X;  4XRS A;  3R0A A;  4KT5 C;  4XID A;  4PGH A;  1V55 H;  3ESW B;  3PIO F;  2E5N A;  1NG7 A;  4RB1 A;  1H9T A;  2KRH A;  1Z7L A;  1R4M B;  1TBX A;  2M4K A;  3BR3 A;  3P9C A;  1KZH A;  4EVI A;  2HU9 A;  1D8K A;  2DDB A;  1OCZ H;  4UV9 A;  4JBA A;  1BBY A;  3AG3 H;  1QQI A;  3HYI A;  4D5F A;  3QWL A;  1Z21 A;  2ZME C;  2DLL A;  3W2V A;  1H89 C;  3H36 A;  2AXT C;  1O7L A;  2DK5 A;  5DYM A;  1SVO A;  1A31 A;  2FA5 A;  2NXN B;  1QBJ A;  3HEF A;  1S72 I;  2NS0 A;  3S32 A;  2DYS H;  2H8W A;  4G12 A;  4YG2 F;  3LSG A;  3QU3 A;  4L5E A;  4MIM A;  3BY6 A;  1IDY A;  4UXN A;  4RGR A;  4HV6 A;  3I4N J;  3RQI A;  1FSE A;  3CD6 I;  3BJ6 A;  2XAS A;  4E7L A;  3QPH A;  2TCT A;  4R8H A;  3JRF A;  4RA2 A;  3L2W A;  3G4S I;  2NVT J;  2ME6 A;  5D5W B;  2R7F A;  5LFA A;  5BNG A;  3IV5 A;  4I6Z A;  2X51 A;  1Z7U A;  3GFM A;  1TWC J;  1XD7 A;  1YIO A;  1BL0 A;  5M5W J;  3KP2 A;  3LNQ A;  4LJZ F;  1FIP A;  2R5Y A;  1K78 A;  3AL0 B;  1I1S A;  4ZYG A;  2KJC A;  2EWN A;  2MH9 A;  2OA4 A;  3GCM A;  4G94 A;  1DU0 A;  4L0Z B;  2K27 A;  3A0B C;  3ZMU A;  1XB4 A;  1E3P A;  1D0Y A;  2KIS A;  4PZJ A;  5EG0 B;  2DFH A;  2OF7 A;  1X1P A;  2RN7 A;  4HF2 A;  1OCP A;  1XGO A;  1SD4 A;  2WY7 Q;  3IC7 A;  2R5Z A;  1V5G A;  1X1D A;  1SFU A;  4C2T A;  4P55 A;  3LSP A;  4BBS J;  1PVE A;  3K4B A;  3PQJ A;  4UVB A;  4IVN A;  2KDZ A;  3FXK A;  3LSK A;  1YYV A;  1UCR A;  5GAD J;  1WJD A;  1Z1D A;  2IW5 A;  1RKW A;  5JVG F;  3S1M J;  1X1C A;  5FGM A;  2C6Y A;  4LLG F;  4RGU A;  4U0W A;  3BG9 A;  2HDW A;  3SFZ A;  3IH3 A;  4AYB N;  1TTY A;  4CCM A;  1CF7 B;  2ISY A;  2XAG A;  5E3N A;  1MDM B;  2XAJ A;  2JSC A;  2V1N A;  2RDP A;  1BR1 A;  4CCL A;  4A93 J;  2ZXI A;  3D5S C;  4DOZ A;  2IGM A;  4JX5 A;  3F9K A;  2VKV A;  5GAG J;  3KEO A;  2HYJ A;  2ZXH A;  5FJ8 J;  4BQA A;  2HZT A;  5FKK A;  3ZMD A;  2P4W A;  4M72 A;  2Z33 A;  2CSO A;  4PK4 A;  4U0Y A;  2EJR A;  3BPX A;  3U1K A;  3M1E A;  1V5E A;  4S04 A;  3JRI A;  5TGT A;  1JKQ C;  4EM0 B;  1XGN A;  3SDB A;  1X3Z B;  3G73 A;  3S2H J;  2XDV A;  4QPQ A;  1RRJ A;  2MLK A;  3I4M J;  3PFY A;  4KN7 X;  2MA3 A;  1RNL A;  1WH5 A;  3HRT A;  5JI6 A;  1Z6R A;  1NK3 P;  2F48 A;  3DU6 A;  2BW3 B;  5EGO B;  3KYL A;  3J7A Y;  2HVS A;  3AG2 H;  1QVT A;  3OL4 A;  5ERI A;  1FY7 A;  4WXC A;  5J1R A;  2VE9 A;  2G7H A;  3WG7 H;  4IO9 F;  4FCY A;  1WJF A;  2E2J J;  4LIT A;  2PMZ N;  1ZRC A;  2OC6 A;  5HDN A;  3WTS C;  3MVP A;  1GDT A;  4GCV A;  2E1M B;  4QTR A;  1IRX A;  2UXX A;  2R7D A;  2XAF A;  4Y13 A;  4KN4 X;  4GDF A;  1FOX A;  3PJR A;  3TKY A;  1W4M A;  4DIQ A;  2X48 A;  1FWZ A;  4RB3 C;  3K4K A;  5EF6 A;  1IUY A;  4XON A;  4HDV A;  1U8B A;  4RB2 C;  2ESH A;  1APL C;  1WJA A;  1U78 A;  5F0C A;  2QKL B;  1T56 A;  3B6C A;  1FTZ A;  2M2E A;  5DCF A;  2XGE A;  3IKT A;  5ED4 A;  1YIJ I;  5FKM A;  3K2A A;  2GLO A;  2BXY A;  4G7H F;  2DOA A;  2XPU A;  3CTA A;  4JYK A;  5AIP A;  4XNF A;  3OYD A;  4FE7 A;  1FPQ A;  2OZU A;  3M3Y J;  1NH3 A;  2XKP A;  2NVQ J;  1YG2 A;  1W1W E;  1WJE A;  2M7B A;  1IRG A;  3K1P A;  4N9H A;  1B59 A;  1R7J A;  3CJN A;  5LRS A;  1WWX A;  3WGI A;  4EEF G;  3CZ6 A;  1FBS A;  5LLQ A;  2BV6 A;  1E2X A;  1S6L A;  2EZI A;  2HXI A;  3T1B A;  5DDG A;  1RZ4 A;  2HR3 A;  2BY1 A;  3T0Y A;  2BHY A;  1FYL A;  2H6C A;  3A4C A;  3F3X A;  5IY5 H;  5HLH A;  2DYR H;  2E2H J;  5E79 C;  3Q0W A;  4IRI A;  4P1W A;  4ZYH A;  4X6A J;  2KIU A;  3DXJ F;  3VSK A;  3OSG A;  2ACJ A;  3FXR A;  5HVQ C;  4PJL A;  5E18 F;  2Y30 A;  2Z16 A;  1I50 J;  3V7C A;  3JR9 A;  1G4D A;  3R6S A;  4IHW A;  2VPR A;  4HEA 2;  3BP8 A;  2WB1 N;  4BE1 A;  1J7K A;  3QYE A;  3KP6 A;  5F64 A;  5F6F A;  1ONV A;  2M8G X;  2KKO A;  2LRE A;  1PP7 U;  4XLN F;  5DTD A;  1QNT A;  2HOA A;  5KHD A;  2VJI A;  4XL9 A;  1ZRE A;  3OYC A;  1ZH5 A;  2CV0 A;  2IAI A;  2LF7 A;  2NAZ A;  4FX0 A;  2DFI A;  2R7R A;  3BJO A;  2L9R A;  1D0X A;  3QU6 A;  2EIJ H;  2PBI A;  3C1D A;  1F4K A;  4M9Z A;  1MIJ A;  1S7O A;  3LQR A;  4AWX B;  4KIS A;  9ANT A;  3GEZ A;  2FD5 A;  3HPH A;  5A2Q K;  1MW7 A;  4V19 K;  2EV5 A;  2HQ5 A;  2HNH A;  1FOW A;  4LIV A;  4F93 B;  2DO7 A;  3WTT C;  5JHU A;  2DDA A;  3F8N A;  4IHX A;  1YFH A;  3TO6 A;  1U8R A;  1XN7 A;  5J8C A;  1TP4 A;  3FXM A;  1MMN A;  4KIC A;  2X85 A;  3BPV A;  2K40 A;  3MWM A;  3LFU A;  1GHC A;  3LA3 A;  2GOM A;  3ZQI A;  2E7X A;  2L54 A;  2V7F A;  2QQ9 A;  4JQF A;  1HW1 A;  4NB5 A;  4PUS A;  2P7V B;  3CME I;  1UG2 A;  1HKT A;  4BY7 J;  1MBJ A;  3BCB A;  1UAA A;  4ZYA A;  1R71 A;  3KLN A;  3HC7 A;  2EIM H;  3WTX C;  1K4S A;  2F4I A;  4BDZ A;  3M4O J;  2HQR A;  1YJ9 I;  2XB5 A;  2D45 A;  4HX4 A;  3HJE A;  3K4L A;  3CUQ C;  3QAH A;  3BOQ A;  3SZT A;  1F36 A;  4Y3O A;  4MEX F;  2A05 A;  2IBD A;  4WK8 F;  2A6E F;  2LKS A;  5J4Y A;  2FMY A;  2P7C B;  1GV5 A;  1USS A;  2DOD A;  1UHS A;  5KNL A;  4FAS D;  4U87 A;  5HOD A;  4HG2 A;  2L9V A;  3S8P A;  1BR4 A;  2X6X A;  3HOV J;  2WTE A;  2YX7 A;  4Y52 J;  3Q0U A;  3WHC A;  4IX7 A;  1KQ8 A;  3RI4 A;  4A3I J;  1ZYR F;  1O3R A;  1LQ1 A;  4BY1 J;  3MZ8 A;  2CQN A;  5JVT A;  3RDI A;  1O3S A;  2HKO A;  2BXZ A;  3FK6 A;  3OYB A;  1J59 A;  4HF0 A;  5ICE A;  4IRG A;  3H3Z A;  4BEH B;  2DMN A;  3DBH B;  4HW0 A;  1N75 A;  3N4M A;  2NYX A;  2PJR B;  3AFH A;  1YW7 A;  2V26 A;  2VT3 A;  2K86 A;  2ID3 A;  3OV8 A;  2L4M A;  1WJ5 A;  5DV5 A;  2MH2 A;  1SD6 A;  2K3F A;  3VEP A;  1S9H A;  1VQ6 I;  4I0A A;  3ELK A;  2NVX J;  1IJW C;  3L2C A;  2EIL H;  4IQJ A;  3GME A;  1X19 A;  3HOZ J;  3S1N J;  4DNC A;  3I0T A;  4FHT A;  2A07 F;  4G6T B;  3HOY J;  1ETK A;  1VQO I;  3DF8 A;  2F5F A;  3FIS A;  2IVM A;  2JA5 J;  3RQ4 A;  1KU9 A;  3MQ0 A;  3SYT A;  1LE8 A;  3K69 A;  5DCM A;  1MBG A;  4XBF A;  2A5W A;  2DA3 A;  2DI3 A;  2KMU A;  5IYC J;  1WFX A;  1MBK A;  1IXC A;  2M1B A;  1OR7 A;  3OSF A;  3OY9 A;  1N77 A;  3GUD A;  2Z9O A;  2ZNZ A;  5K1Y A;  1K79 A;  4NC7 A;  2K4B A;  4HF1 A;  1F43 A;  2O9L A;  1BI0 A;  1RR8 C;  3LSI A;  3M8E A;  1T39 A;  5IP7 J;  3MZH A;  3CCV I;  1HKQ A;  1LDJ A;  4A6E A;  2WBM A;  1DP7 P;  2CUJ A;  4FIS A;  1HW2 A;  3S3M A;  4CYD A;  3IWF A;  2ZC2 A;  1CF7 A;  1W7P B;  3G1O A;  4HX7 A;  3J7Z I;  2D2W A;  1MDM A;  5CVU A;  1EF4 A;  5GPA A;  4PJN A;  3RSN A;  1HC8 A;  2CG4 A;  1MMD A;  4BKX A;  2L4A A;  3H35 A;  1WRJ A;  2CRG A;  1Y56 A;  4I02 A;  1U3E M;  1JT6 A;  1AKH B;  1U9O A;  2LYC A;  3LWF A;  4UUV A;  5CPR B;  2KFD A;  3SFI A;  1EH6 A;  2A69 F;  2GXG A;  1R1U A;  1X4P A;  1X1B A;  3GLX A;  4WXH A;  2QZ8 A;  4L9J A;  5F0H A;  3OYK A;  3TED A;  2PJP A;  2IS4 A;  1J9I A;  1I6X A;  4CCJ A;  1JKR C;  1D5Y A;  2LY9 A;  4NQW B;  4C3I J;  1R36 A;  5FB2 A;  3E5U A;  1QHH D;  4RMN A;  4GYG A;  3P9I A;  5JHF A;  2GQQ A;  4ETS A;  2QA4 I;  2OJE D;  1MJ9 A;  3FDY A;  4ZDP A;  4E7J A;  4MLO A;  1BC8 C;  1V4R A;  1ETQ A;  1F9N A;  4XKB A;  5L3G A;  2R3S A;  3K6G A;  3T8R A;  3LFK A;  4UHT A;  1D1B A;  2N8G A;  3ZN0 A;  2FXA A;  4M6Y A;  1S8N A;  2VKH A;  2RRE A;  2EK5 A;  2R7T A;  1ACI A;  5LBQ A;  1RPW A;  5LGU A;  2BY0 A;  3DBR B;  1LFU P;  3RIR A;  4EV0 A;  1BW6 A;  4ENJ A;  3S1R J;  1H8A C;  3OYL A;  2HYG D;  2XGD A;  3QPL A;  4JOM A;  5J8F A;  2DFF A;  1UHM A;  3MKW B;  2M7A A;  4D7N A;  2XGC A;  3WTU C;  5D4S A;  4DJA A;  2PLY A;  1Z77 A;  3GF2 A;  1Y39 A;  1FLI A;  4A3M J;  2ELK A;  2B63 J;  1XGS A;  2WAQ A;  1KQ9 A;  2JA8 J;  1FNN A;  3U9G A;  1RI7 A;  2IS1 A;  4A6D A;  1AU7 A;  2VI6 A;  1OJL A;  3AG1 H;  3G1M A;  3K4N A;  1D3Y A;  3DV8 A;  5J6X A;  2W84 A;  1P4W A;  4KIT B;  1JUM A;  5B5E C;  4XOP A;  2OCC H;  1RET A;  1UMQ A;  3ZR8 X;  3JW4 A;  3JSO A;  1ZHF A;  1U0J A;  1XX5 A;  2VC0 A;  1OKR A;  1O4X A;  2UXN A;  3S2D J;  2GBY A;  3PO3 J;  4U88 A;  2F5C A;  4RB0 A;  3HHG A;  3TW6 A;  1W36 D;  4I2O A;  1I5Z A;  1BN5 A;  2AO9 A;  2HGC A;  4ASN A;  2EIK H;  3JRH A;  2VN2 A;  5FRN A;  2CUZ A;  4XLF A;  3TMO A;  1L3L A;  5D5V B;  2L7Z A;  4N4N B;  2EV6 A;  5EZG A;  4A3C J;  2DMQ A;  4YRV A;  4IKF A;  2J5P A;  1DPR A;  3O2P E;  3HPG A;  3JRD A;  2FSW A;  3DLA A;  1AWC A;  2DA6 A;  3U21 A;  3MKY B;  3G6E I;  3P7N A;  4YEJ A;  4HLX A;  1K61 A;  1XMX A;  2Q2E A;  1SMY F;  3W2W A;  4ENN A;  1ETO A;  5FFZ A;  3ECH A;  3VDX A;  2F4O B;  2QWW A;  5D5U B;  3CO7 C;  3RTR A;  1IXR C;  4MHG A;  2DJI A;  3F0C A;  1Z0X A;  5EEG A;  4HQM A;  2F5V A;  5IYD J;  1I3A A;  1ZG5 A;  2BY2 A;  2XF6 A;  3H9Q A;  1K6O A;  1WH7 A;  3N05 A;  3CCS I;  2K9S A;  4I98 B;  2O3F A;  2Q8K A;  5CYV A;  3A02 A;  5LHI A;  2R7Z J;  3FM3 A;  4EMS A;  1D8J A;  1MBH A;  4XLP F;  1V54 H;  3HKZ N;  4BQQ A;  3RCO A;  3RJP A;  2CYY A;  3LA7 A;  1SFE A;  3ERE D;  1PP8 F;  2JPC A;  3KP5 A;  1BOA A;  2YS9 A;  4HPQ A;  4W97 A;  2ID6 A;  4OIN F;  5L3F A;  1AHD P;  1B72 A;  3D1N I;  3TQN A;  2CO5 A;  2QQB A;  3CUQ B;  4LK0 F;  2DTZ A;  2XHK A;  3IAS 2;  2IGK A;  2HZD A;  2MAB A;  2JUG A;  3QOP A;  4KDP A;  4II2 A;  4FX4 A;  3DTI A;  4LOC A;  2KZV A;  4B3X A;  4MO7 A;  3A1Y A;  4CZZ A;  1L0O C;  3FXO A;  2HXO A;  2M5W A;  4E7K A;  2QSG X;  1Z3X A;  4UVA A;  1TLH B;  2ETH A;  3K70 C;  2DT7 B;  1O57 A;  4OU0 A;  4AU7 A;  1HKS A;  1XGM A;  2RNG A;  3D5R C;  3JRB A;  3IP4 B;  3FMR A;  2LKP A;  6PAX A;  2DA2 A;  1HXD A;  2O61 A;  1DQU A;  1Z9C A;  1W5S A;  4E7Z A;  2IS2 A;  3FIW A;  2FBK A;  2RC4 A;  3ZMZ A;  1DUX C;  3G71 I;  1WHU A;  1KU3 A;  2FU4 A;  1J5Y A;  2KQR A;  3KPH A;  4HNU A;  2P81 A;  2AQF A;  3M1C A;  3L09 A;  2LOO A;  1T98 A;  2DOF A;  4B43 A;  1Y1V J;  2FJ1 A;  2GM4 A;  2G9W A;  3LSJ A;  4RLQ A;  3FBN B;  3IWZ A;  2CUE A;  3GFI A;  4H0E A;  1T33 A;  2Y0S A;  1QZZ A;  4HYE A;  1GT0 C;  1IRZ A;  1TT0 A;  2WAF A;  1IN4 A;  4ABZ A;  5K7Z A;  3HOX J;  3NRV A;  2UUZ A;  1YW9 A;  4M6X A;  3L2V A;  5L3D A;  1S7A A;  5CKT A;  1VQK I;  1O7F A;  2HPI A;  1HA8 A;  2JMW A;  4ZDO A;  3PIP F;  2H09 A;  2X0L A;  1ZR2 A;  2EZK A;  2VBX A;  3VYS B;  2IXS A;  4DYR A;  2OV7 A;  4ANJ A;  1MMA A;  5GAE J;  3NWT A;  4CA0 A;  3C2B A;  2E7W A;  2RAE A;  4LIU A;  1OCO H;  1G2H A;  3S17 J;  2KZG A;  2DBB A;  2E5Z A;  3E6B A;  3WHB A;  1ZRF A;  3BTL A;  4J19 A;  5J40 A;  2IS6 A;  1GXQ A;  3GFL A;  4DBQ A;  3IAM 2;  1STZ A;  3BG6 A;  5JR3 A;  1JXS A;  2CFO A;  5E3M A;  2JUC A;  4YEL A;  5GTI C;  1TT5 B;  1SVL A;  1TWA J;  5BS6 A;  2QBY A;  2QEX I;  4GO1 A;  2EFN A;  3BTC A;  2V6E A;  4Q5S F;  4IRH A;  2PMU A;  4MQ9 F;  4XMY A;  1IZ1 A;  3A0H C;  1OLT A;  5LD2 C;  2LBF A;  1XTA A;  5LGN A;  1UJ8 A;  3BG5 A;  4CSW A;  1C0W A;  2ZJQ F;  4PDK A;  3GTL J;  4HV5 A;  5F1J A;  4A3F J;  1CGP A;  2ZXW H;  5LHG A;  3GTG J;  2FNP A;  2QUF A;  1XPX A;  2O0Y A;  5D8L B;  1F5T A;  4IHV A;  2DMP A;  5DS9 A;  2CW7 A;  2LNB A;  4V2G A;  1TQP A;  1EV7 A;  3EUK L;  3FK7 A;  3K1M A;  3K9T A;  3PUF A;  1N78 A;  5M5X J;  3S93 A;  3LST A;  2D5V A;  3J7A O;  3NAR A;  4DGW B;  3DBL B;  2COM A;  3GYH X;  3I64 A;  3GO5 A;  4AID A;  1MKM A;  2H1L A;  4C3H J;  3KIO A;  3OR1 C;  3GTQ J;  2BGC A;  2A6H F;  3G3Z A;  5DUI A;  1A6Q A;  2RVC A;  1VQP I;  1IDZ A;  1K6Y A;  1WI3 A;  3NEU A;  1YOV B;  3OL3 A;  3HOT A;  3ECO A;  1LB2 A;  4XRF A;  2QM3 A;  3V7S A;  3FXU A;  5H2F C;  4YIR X;  4UV8 A;  1A6I A;  2PG4 A;  3DEW A;  3VFZ A;  2JQ7 A;  2DTR A;  4DQ2 A;  5AIQ A;  3HOW J;  1JTX A;  1ZK8 A;  3BG7 A;  3VWB A;  2DPD A;  1WQ2 A;  3SQN A;  1U5T A;  4LG0 B;  2ECC A;  1A36 A;  3Q3S A;  3W6V A;  4NC8 A;  2B0L A;  1FSH A;  3S1Q J;  1IRF A;  2TRT A;  3V8K A;  3L2Q A;  3KYD B;  1JGG A;  1TWH J;  2R7S A;  4HX8 A;  4RS8 A;  3OYA A;  2MW8 A;  2DA5 A;  2KL4 A;  1RIO H;  3TDZ C;  1W5C C;  4AC0 A;  1AKH A;  5HLG A;  3TW7 A;  1FMV A;  4A0X A;  2LH9 A;  3I9V 2;  3M9A A;  3GTK J;  2O5R A;  2W1O A;  4OAZ A;  4HNV A;  1O3Q A;  1EH7 A;  3BZK A;  2K85 A;  5CJ9 A;  5GTH C;  1OCR H;  3JTG A;  3CC2 I;  1SEU A;  1X3W B;  3QYB A;  4O6J A;  5ILU A;  2HDC A;  1IGN A;  5IPA A;  5FKN A;  4AIH A;  2R7V A;  1BIA A;  4I0B A;  5KAF C;  4NQW A;  2XAH A;  3W3C A;  1GVD A;  2FBI A;  2VON A;  5F08 A;  2A61 A;  1A5J A;  3FKI J;  2FRH A;  2GA1 A;  2J5O A;  2YSR A;  2NNN A;  3HGG A;  2DQR A;  2CGP A;  3SEZ A;  2BVL A;  4MFE A;  3T8T A;  1Y8R B;  3F6V A;  2Y2Z A;  3QRF F;  5CVJ A;  4DZP A;  3ABM H;  3HDD A;  2RNJ A;  2XC7 A;  4M9X A;  1MSE C;  3J81 K;  2W00 A;  2L0K A;  3OS2 A;  4A12 A;  5K5Q A;  3KE2 A;  2VJ4 A;  5TIS C;  1KYZ A;  5CVV A;  3W2A A;  4XSZ F;  1LNW A;  4E70 A;  2Z5U A;  3MFK A; 
#chains in the Genus database with same CATH homology
 4LB6 B;  1PUE E;  3WOD F;  2DU9 A;  2VT2 A;  2P5V A;  3K0L A;  4CO8 A;  2W25 A;  2D1V A;  4N9I A;  1BJA A;  1LDD A;  3ROU A;  3HSR A;  2GXB A;  5HDK A;  4R1H A;  2DAO A;  3JSP A;  3BRO A;  1ULY A;  3ZN1 A;  1XSX A;  3TDU C;  4ZZD A;  2F5E A;  1FZP B;  2FEZ A;  1ZAO A;  1ON2 A;  2IP2 A;  2KRF A;  3C18 A;  4P96 A;  5HLI A;  2ELH A;  5HOO A;  4IF4 A;  4BYY A;  2XVC A;  2HTJ A;  2AXL A;  3N97 A;  2Z99 A;  3JAM Z;  5BOX A;  4LK1 F;  1IN7 A;  3KP7 A;  3K1N A;  4RAZ A;  1MGT A;  4EM1 A;  5K5R A;  1Z05 A;  4RGS A;  4EGZ A;  1QGP A;  2Q0O A;  2XIG A;  5E8I A;  1K7A A;  1LEA A;  1O3T A;  2TDX A;  3F23 A;  2ZME B;  3WU1 B;  3CO6 C;  5BMZ A;  3KP4 A;  4ZZL A;  2ESN A;  4UNO A;  1AOY A;  1PDN C;  5ILV A;  3KCC A;  5IT9 Z;  4LLL A;  3R60 A;  2MD5 A;  2FF4 A;  2EFO A;  3ZMV A;  3WE2 A;  4FT8 A;  1RUO A;  3R4K A;  4L18 B;  4OMY A;  1FC3 A;  4CHU A;  4A5M A;  2GA2 A;  3KEQ A;  1JHH A;  2QEN A;  3KP3 A;  1G3S A;  3EYY A;  4ENM A;  4Y15 A;  2HTS A;  4LGW A;  5JFR A;  1MJB A;  1JGS A;  5D6F A;  3WTW C;  4U7D A;  2BYV E;  3E6C C;  3EDP A;  2KIM A;  1TW3 A;  2IJL A;  2QLZ A;  3EQL F;  3I54 A;  2IA0 A;  2L02 A;  4G7O F;  2L3D A;  2OZ6 A;  3CDH A;  3F6O A;  2E1N A;  3ABU A;  4G6D A;  5E1Z B;  1FP2 A;  1TNT A;  2FBH A;  2NRA C;  2ZXJ A;  3DFG A;  4LB5 A;  2Y75 A;  3HOS A;  3Q9S A;  3WE3 A;  3GVA A;  2KIF A;  4LMY A;  2VE8 A;  5DEQ A;  1J0R A;  4YII A;  4LFU A;  1E17 A;  2OU2 A;  3GFJ A;  4PGG A;  2RV8 A;  1SD5 A;  3WTZ A;  2FNA A;  3GZ6 A;  3IHU A;  3GXO A;  1R22 A;  4JK1 X;  1FP1 D;  4LG0 A;  1BI2 A;  3ZMT A;  2V1X A;  4M74 A;  3MEX A;  5KVR A;  4I01 A;  4HQE A;  1YTY A;  1R58 A;  4HAM A;  1B9N A;  2JT1 A;  3EET A;  1YQA A;  3Q9V A;  5HS8 A;  4G9Y A;  4ON0 A;  1P2F A;  2ZCW A;  1IAW A;  1P4X A;  2E1C A;  1JHF A;  4G8X A;  4KMF A;  2WWY A;  4TV7 A;  2STT A;  2Z3Y A;  3GWZ A;  4KNY A;  4OIQ F;  2BBY A;  4M73 A;  4HDU A;  1VTN C;  2M87 A;  1DDN A;  3FHZ A;  1UHW A;  4UVC A;  3F21 A;  1ZRD A;  1OPC A;  5H20 A;  2IRF G;  3HTU A;  5FD5 A;  5CVR A;  2ZKZ A;  3LAP A;  1T0F A;  2LSO A;  4OIP F;  3PFI A;  4AD9 A;  3DPL C;  4EJO A;  1A04 A;  3I4P A;  1SMT A;  1W7P D;  1JE8 A;  1V3F A;  4KIB A;  1LJ9 A;  2G7U A;  2YPR A;  1HSJ A;  5CVI A;  2PI0 A;  2W24 A;  1R1T A;  3EUH A;  5LGT A;  4ESF A;  1SAX A;  4AVP A;  1EH8 A;  5TRD A;  1WKM A;  3M7G A;  2ZJ2 A;  1BIB A;  3I53 A;  1TNS A;  4YFX F;  1I1G A;  4CDG A;  2WV0 A;  4P9U A;  1HST A;  2YX4 A;  2JTV A;  5FO5 A;  3MCZ A;  1XCV A;  2JRT A;  4EJT A;  5E20 A;  4N0B A;  3HUG A;  4S05 A;  4BNC A;  4L5J A;  2GZW A;  4GYI A;  2EFP A;  3TOA A;  4RGX A;  4A5N A;  1J2X A;  3RKY A;  4A0Z A;  2ZME A;  1SFX A;  4RAY A;  2UZK A;  1B9M A;  2Y0M A;  3REO A;  3U1D A;  2O8X A;  3VB2 A;  2F5D A;  4Q4Z F;  2M30 A;  1Q1H A;  1R1V A;  3L7W A;  3B73 A;  3E6D A;  3KLO A;  4OMZ A;  1IN6 A;  3I59 B;  1XCB A;  3ZMS A;  3L00 A;  4CIC A;  5A2Q Z;  3D5L A;  1BI1 A;  4A0Y A;  4G7Z F;  3PQK A;  4HA8 A;  5HS7 A;  3HRS A;  4OIO F;  3P9K A;  3RKW A;  4Y17 A;  2A5Y B;  1HW5 A;  2P5L C;  2O6G E;  3O3K A;  4KFC A;  3WGG A;  4R79 A;  3WTY C;  2X4H A;  4KYW A;  3TO9 A;  1D5V A;  4ESJ A;  2ADU A;  4P9F A;  4KA4 A;  4Q48 A;  4O3M A;  2DT5 A;  3V8J A;  2HS5 A;  2CFX A;  3HTS B;  5E1W A;  3ML6 A;  4Z2Y A;  3B02 A;  4L5I A;  4L9V A;  2MBF A;  3IKV A;  3HIF A;  3JTH A;  4YFN F;  3M8F A;  2VBY A;  3FF5 A;  2WC2 A;  2OQR A;  1RUN A;  3D0S A;  3BWG A;  2YR2 A;  4B8X A;  2EV0 A;  1ZLK A;  2EA2 A;  4I09 A;  4ZH4 F;  1LVA A;  3F72 A;  3E5Q A;  3ABT A;  2ZNY A;  2H94 A;  1IN8 A;  5EEH A;  3WU0 A;  3DQV C;  2NNY A;  5DCM B;  3U2R A;  5L3C A;  1P4A A;  1U6G A;  3OOP A;  3ULQ B;  3NQO A;  1R23 A;  5F1R A;  1UST A;  2DK8 A;  1W7P A;  5AON A;  1WSU A;  5IT3 A;  5D8K B;  4MNU A;  3I5U A;  2RQP A;  1IW7 F;  1B6A A;  3FX3 A;  4M71 A;  1KGS A;  3VOD A;  4YFK F;  4I7H A;  1FYM A;  3QP5 A;  1XDS A;  3DEU A;  3HRU A;  1ZLJ A;  3T5X A;  2HWV A;  3LAJ A;  2OD5 A;  2P6T A;  3MZY A;  4U7B A;  1UFM A;  3I71 A;  4M9S A;  2QYO A;  5BQT A;  1QZY A;  1GVJ A;  4BAY A;  1W5T A;  1H0M A;  5E17 F;  1OYI A;  4PCQ A;  2GIV A;  1ON1 A;  3F8C A;  2H27 A;  2L01 A;  1XMA A;  2RGV A;  1F1Z A;  2EFW A;  4EGY A;  1ZG3 A;  1ZN2 A;  3ZPL A;  3DPT A;  4MTE A;  2IA2 A;  4K2E A;  2MC3 A;  4KIG A;  1U5T C;  2PQ8 A;  1Y0U A;  4MEY F;  4CGZ A;  2IT0 A;  4F7Z A;  3KZY A;  2HQN A;  1G6N A;  2RKH A;  3FM5 A;  4IXA A;  2FE3 A;  3J80 Z;  4BHB A;  1QO0 D;  2AS5 F;  2YU3 A;  2PMH A;  3BZ6 A;  3TGN A;  3QP6 A;  1S3J A;  2K4J A;  4D0P A;  1YS6 A;  1BI3 A;  4GXO A;  2XRO A;  3HSF A;  5FLX Z;  2M8E A;  3V4G A;  4EJU A;  3FXQ A;  1IN5 A;  1UB9 A;  2EB7 A;  2OBP A;  4HBL A;  1BC7 C;  1FX7 A;  1KQ0 A;  2K02 A;  4AIJ A;  1T6S A;  3LA2 A;  4BH9 A;  5LHH A;  4LD5 A;  2VBZ A;  4MGR A;  2V79 A;  1P92 A;  1LDK B;  1FBQ A;  2XGX A;  3ISP A;  3DKW A;  5D4R A;  3FWE A;  1ZGA A;  5FFX A;  5D5X B;  4Q47 A;  2FML A;  3RPQ A;  3CUQ A;  3O6B B;  2CWE A;  4EM2 A;  1ODD A;  3MAJ A;  1G3T A;  4WWC A;  1S29 A;  4HOB A;  2V1D A;  3IRR A;  4LLN A;  4QLC U;  3C7J A;  1U2W A;  3KFW X;  2P6S A;  2BE5 F;  1ZAR A;  2EFQ A;  5TJJ A;  2GWR A;  3IRQ A;  1B4A A;  5L3E A;  1B1B A;  3I59 A;  4YIF A;  5ICF A;  1ZGJ A;  5DUK A;  5K5O A;  4ZYD A;  3FMQ A;  3CLO A;  3ZQ7 A;  1H9G A;  2QVO A;  3COA C;  2STW A;  3EYI A;  2O03 A;  3QPT A;  4HZF A;  1MD0 A;  2M45 A;  3CUO A;  2VOD A;  3HSE A;  3RKX A;  4BHC A;  3LQQ A;  3V7R A;  3AAF A;  4AIK A;  2ZO4 A;  4QWQ A;  1FOK A;  1R00 A;  1Z6T A;  3HHH A;  1TW2 A;  4L9N A;  2MLG A;  3VOE A;  5ICG A;  5DD4 A;  3TOB A;  2VC1 A;  2K7L A;  4P5O A;  2H6B A;  5D6E A;  5E1X A;  4OIR F;  4EJW A;  5FD6 A;  2QBY B;  2VOO A;  1QPM A;  1KU7 A;  1MZB A;  1BM9 A;  3GW2 A;  4NHJ A;  2XUB A;  2QQA A;  2F2E A;  5DD8 A;  3W6K B;  5LEK A;  4EJV A;  1IXS B;  1K78 B;  1WI9 A;  2P5K A;  5BPD A;  3RYP A;  2A3S A;  2CW0 F;  5BPI A;  4BHP A;  5E8G A;  4ZYE A;  2OAZ A;  3BJA A;  4KMU X;  2V6C A;  1ZG1 A;  2GAU A;  1TQI A;  2EA4 A;  1I27 A;  4L9T A;  1DPU A;  4IJA A;  3WTV C;  2XAQ A;  3E6M A;  4A2U A;  2PN6 A;  3K2Z A;  1TQM A;  4CXF A;  3DP7 A;  1U5T B;  2XKO A;  3E5X A;  2ISZ A;  3C3W A;  2V9V A;  3F8B A;  3SXY A;  4XSX F;  3S2W A;  5LRR A;  2DPU A;  1LEB A;  4WX9 A;  1R5G A;  5ILS A;  3HRM A;  4GGG A;  2OQG A;  3V8L A;  1T2K A;  5L3B A;  3L9F A;  4IPA A;  3E97 A;  4G6Q A;  2P8T A;  1FT9 A;  3KZZ A;  3F8F A;  4WXD A;  1YO5 C;  3E3V A;  3J80 K;  5LEJ A;  2W85 A;  4WCG A;  3FZV A;  3SHF A;  2D1H A;  2FQ3 A;  4L0Y B;  5HS9 A;  2PFB A;  3WG9 A;  2KJB A;  3R61 A;  2DW4 A;  5KK1 A;  4EQQ A;  1OYW A;  5FLX K;  3RYR A;  2LDU A;  1XSV A;  2HFH A;  5H6R A;  2PEX A;  3J81 Z;  3BDD A;  1YS7 A;  3ZP5 A;  2HYF A;  1KA8 A;  1OMI A;  2HOE A;  5CLS A;  3JAM K;  2XRN A;  3SZP A;  2W57 A;  1NHA A;  2XV4 S;  1G3W A;  1HQC A;  1GXP A;  3H92 A;  4ESB A;  1P6R A;  3H3U A;  2ZBK A;  1OYY A;  4MQV A;  3TO7 A;  2VBW A;  4WF2 A;  1HBX G;  2JPB A;  2V1U A;  3IL2 A;  2HKX A;  2VOP A;  2Y48 A;  1KU2 A;  4OOI A;  4O5V A;  1Z91 A;  3W6J B;  1KYW A;  2IA1 A;  3WGH A;  4IHS A;  2ZFW A;  4U0V A;  5ICC A;  3F22 A;  2FOK A;  1X3U A;  2VXZ A;  4MTD A;  5IT9 K;  1XSD A;  4BXU A;  3GZ5 A;  4ENK A;  1XMK A;  5H6Q A;  5HDG A;  2DQL A;  2HEO A;  3I58 A;  3F8M A;  1T38 A;  1YLF A;  1R5H A;  3FMS A;  2LF8 A;  2JZY A;  2A68 F;  1J75 A;  3KET A;  4KIF A;  3Q5F A;  3RPU A;  3GX4 X;  3R0J A;  1IF1 A;  2CQK A;  2UWM A;  1MJA A;  1REP C;  4IHT A;  1FYK A;  1SD7 A;  4HLY A;  1FBU A;  1YW8 A;  1XDU A;  4B09 A;  4KUM A;  2BEO A;  1G3Y A;  2IPQ X;  3R0A A;  4KT5 C;  4PGH A;  4RB1 A;  1H9T A;  1TBX A;  3P9C A;  4EVI A;  1D8K A;  4UV9 A;  4JBA A;  1BBY A;  1QQI A;  3HYI A;  2DLL A;  1O7L A;  2DK5 A;  5DYM A;  2FA5 A;  1QBJ A;  2NS0 A;  4YG2 F;  3QU3 A;  3BY6 A;  4UXN A;  4RGR A;  4HV6 A;  1FSE A;  3BJ6 A;  2XAS A;  3QPH A;  4R8H A;  5D5W B;  2R7F A;  1Z7U A;  3GFM A;  1XD7 A;  1YIO A;  3KP2 A;  4LJZ F;  1K78 A;  1I1S A;  4ZYG A;  2KJC A;  2EWN A;  2MH9 A;  2OA4 A;  4G94 A;  4L0Z B;  2K27 A;  3ZMU A;  1XB4 A;  4PZJ A;  4HF2 A;  2RN7 A;  1XGO A;  1SD4 A;  3IC7 A;  1SFU A;  4P55 A;  3PQJ A;  4UVB A;  4IVN A;  1YYV A;  1UCR A;  1Z1D A;  2IW5 A;  5FGM A;  2C6Y A;  4LLG F;  4RGU A;  4U0W A;  3SFZ A;  1TTY A;  1CF7 B;  2ISY A;  2XAG A;  1MDM B;  2XAJ A;  2JSC A;  2RDP A;  3KEO A;  4BQA A;  2HZT A;  3ZMD A;  2P4W A;  4M72 A;  2Z33 A;  2CSO A;  4U0Y A;  2EJR A;  3BPX A;  3M1E A;  4S04 A;  4EM0 B;  1XGN A;  3G73 A;  2MLK A;  4KN7 X;  2MA3 A;  1RNL A;  3HRT A;  5JI6 A;  1Z6R A;  5ERI A;  2VE9 A;  1FY7 A;  4WXC A;  2G7H A;  1ZRC A;  5HDN A;  3WTS C;  4GCV A;  2UXX A;  2R7D A;  2XAF A;  4Y13 A;  4KN4 X;  3TKY A;  1W4M A;  1FWZ A;  4RB3 C;  1IUY A;  4HDV A;  4RB2 C;  2ESH A;  1U78 A;  5DCF A;  3IKT A;  5ED4 A;  4G7H F;  3CTA A;  5AIP A;  1FPQ A;  2OZU A;  2XKP A;  1YG2 A;  1IRG A;  3K1P A;  4N9H A;  1B59 A;  1R7J A;  3CJN A;  5LRS A;  1WWX A;  3WGI A;  1FBS A;  5LLQ A;  2BV6 A;  1E2X A;  1S6L A;  3T1B A;  5DDG A;  1RZ4 A;  2HR3 A;  3T0Y A;  1FYL A;  2H6C A;  3F3X A;  5HLH A;  4IRI A;  4ZYH A;  2KIU A;  3DXJ F;  2ACJ A;  3FXR A;  5HVQ C;  5E18 F;  3V7C A;  1G4D A;  3R6S A;  3BP8 A;  1J7K A;  3KP6 A;  5F64 A;  5F6F A;  1ONV A;  2KKO A;  1PP7 U;  4XLN F;  1QNT A;  1ZRE A;  1ZH5 A;  2LF7 A;  2NAZ A;  4FX0 A;  2DFI A;  3BJO A;  3QU6 A;  2PBI A;  3C1D A;  1F4K A;  4M9Z A;  3LQR A;  1S7O A;  4AWX B;  3GEZ A;  5A2Q K;  2EV5 A;  2DO7 A;  3WTT C;  5JHU A;  3F8N A;  1YFH A;  3TO6 A;  1U8R A;  1XN7 A;  5J8C A;  4KIC A;  3BPV A;  3MWM A;  1GHC A;  3LA3 A;  2E7X A;  2L54 A;  4JQF A;  2QQ9 A;  1HW1 A;  4NB5 A;  2P7V B;  1HKT A;  3KLN A;  3WTX C;  2HQR A;  2D45 A;  4HX4 A;  3CUQ C;  3QAH A;  3BOQ A;  3SZT A;  4MEX F;  4WK8 F;  2A6E F;  2FMY A;  2P7C B;  1USS A;  2WTE A;  2YX7 A;  1KQ8 A;  3RI4 A;  1O3R A;  1ZYR F;  1LQ1 A;  5JVT A;  3RDI A;  1O3S A;  2HKO A;  1J59 A;  4HF0 A;  5ICE A;  4IRG A;  3H3Z A;  4HW0 A;  3N4M A;  2NYX A;  1YW7 A;  2VT3 A;  2K86 A;  3OV8 A;  2L4M A;  5DV5 A;  2MH2 A;  1SD6 A;  3VEP A;  4I0A A;  3ELK A;  3L2C A;  4DNC A;  3I0T A;  4FHT A;  2A07 F;  3DF8 A;  2F5F A;  2IVM A;  1KU9 A;  3MQ0 A;  3K69 A;  5DCM A;  4XBF A;  2DI3 A;  1IXC A;  2M1B A;  1OR7 A;  3GUD A;  2Z9O A;  2ZNZ A;  5K1Y A;  1K79 A;  2K4B A;  4HF1 A;  1BI0 A;  3M8E A;  1T39 A;  3MZH A;  1HKQ A;  1LDJ A;  4A6E A;  1DP7 P;  1HW2 A;  4CYD A;  3IWF A;  1CF7 A;  1W7P B;  4HX7 A;  2D2W A;  1MDM A;  5CVU A;  2CG4 A;  2L4A A;  1WRJ A;  4I02 A;  1U3E M;  3LWF A;  4UUV A;  1EH6 A;  2A69 F;  2GXG A;  1R1U A;  3GLX A;  4WXH A;  2QZ8 A;  4L9J A;  2PJP A;  1J9I A;  1I6X A;  5FB2 A;  1R36 A;  3E5U A;  4GYG A;  3P9I A;  2GQQ A;  4ETS A;  1MJ9 A;  1BC8 C;  1V4R A;  1F9N A;  5L3G A;  2R3S A;  3T8R A;  3LFK A;  4UHT A;  3ZN0 A;  2FXA A;  4M6Y A;  1S8N A;  2EK5 A;  5LBQ A;  5LGU A;  3RIR A;  4EV0 A;  4ENJ A;  2HYG D;  5J8F A;  1UHM A;  3WTU C;  5D4S A;  2PLY A;  3GF2 A;  1FLI A;  1XGS A;  1KQ9 A;  1FNN A;  3U9G A;  1RI7 A;  4A6D A;  1D3Y A;  3DV8 A;  5J6X A;  2W84 A;  1P4W A;  3JW4 A;  3JSO A;  1ZHF A;  2VC0 A;  1OKR A;  2UXN A;  4U88 A;  2F5C A;  4RB0 A;  3HHG A;  4I2O A;  1I5Z A;  1BN5 A;  2HGC A;  4ASN A;  2VN2 A;  1L3L A;  5D5V B;  2EV6 A;  2J5P A;  1DPR A;  3O2P E;  2FSW A;  1AWC A;  3P7N A;  4HLX A;  2Q2E A;  1SMY F;  4ENN A;  5FFZ A;  3ECH A;  2QWW A;  5D5U B;  3CO7 C;  3RTR A;  1IXR C;  4MHG A;  5EEG A;  4HQM A;  1ZG5 A;  1K6O A;  4I98 B;  2O3F A;  2Q8K A;  5CYV A;  5LHI A;  3FM3 A;  4EMS A;  1D8J A;  4XLP F;  3RJP A;  1PP8 F;  3ERE D;  2CYY A;  3LA7 A;  1SFE A;  2JPC A;  3KP5 A;  1BOA A;  4OIN F;  5L3F A;  3TQN A;  2CO5 A;  2QQB A;  3CUQ B;  4LK0 F;  2XHK A;  3QOP A;  4KDP A;  4FX4 A;  4CZZ A;  1L0O C;  2M5W A;  4UVA A;  1TLH B;  2ETH A;  1O57 A;  4OU0 A;  1HKS A;  1XGM A;  3FMR A;  2LKP A;  6PAX A;  1HXD A;  2O61 A;  1Z9C A;  1W5S A;  2FBK A;  2RC4 A;  3ZMZ A;  1DUX C;  1KU3 A;  2FU4 A;  1J5Y A;  3L09 A;  1T98 A;  2G9W A;  3IWZ A;  3GFI A;  4H0E A;  1QZZ A;  4HYE A;  1IN4 A;  3NRV A;  1YW9 A;  4M6X A;  5L3D A;  1S7A A;  1O7F A;  2H09 A;  2X0L A;  2VBX A;  2E7W A;  2DBB A;  3E6B A;  1ZRF A;  1GXQ A;  3GFL A;  1STZ A;  5JR3 A;  1JXS A;  5BS6 A;  2QBY A;  4GO1 A;  2EFN A;  4Q5S F;  4IRH A;  2PMU A;  4MQ9 F;  1IZ1 A;  5LGN A;  1C0W A;  4PDK A;  4HV5 A;  1CGP A;  5LHG A;  2FNP A;  2QUF A;  2O0Y A;  5D8L B;  1F5T A;  2LNB A;  1TQP A;  1EV7 A;  3K1M A;  3K9T A;  3LST A;  3J7A O;  2COM A;  3GYH X;  3I64 A;  3GO5 A;  1MKM A;  2BGC A;  2A6H F;  3G3Z A;  5DUI A;  2RVC A;  3NEU A;  3HOT A;  3ECO A;  1LB2 A;  4XRF A;  2QM3 A;  3V7S A;  3FXU A;  4UV8 A;  2PG4 A;  3VFZ A;  2DTR A;  4DQ2 A;  5AIQ A;  2DPD A;  1WQ2 A;  3SQN A;  1U5T A;  4LG0 B;  2B0L A;  1FSH A;  1IRF A;  3V8K A;  4HX8 A;  4RS8 A;  1RIO H;  3TDZ C;  5HLG A;  4A0X A;  3M9A A;  1O3Q A;  1EH7 A;  5CJ9 A;  3JTG A;  4O6J A;  5ILU A;  2HDC A;  4AIH A;  1BIA A;  4I0B A;  4NQW A;  2XAH A;  2FBI A;  2VON A;  2A61 A;  2FRH A;  2GA1 A;  2J5O A;  2YSR A;  2NNN A;  2DQR A;  2CGP A;  3T8T A;  3F6V A;  3QRF F;  5CVJ A;  2RNJ A;  4M9X A;  3J81 K;  4A12 A;  5K5Q A;  3KE2 A;  1KYZ A;  5CVV A;  4XSZ F;  1LNW A;  4E70 A;  2Z5U A;  3MFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...