2FBKA

The crystal structure of hucr from deinococcus radiodurans
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
172
structure length
156
Chain Sequence
DTAALLERIRSDWARLNHGPSAGPMLTLLLLERLHAALGREIERTYAASGLNAAGWDLLLTLYRSAPPEGLRPTELSALAAISGPSTSNRIVRLLEKGLIERREASIRLTPQGRALVTHLLPAHLATTQRVLAPLSAQEQRTLEELAGRMLAGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords transcriptional regulator, MarR family
publication title The Crystal Structure of the Transcriptional Regulator HucR from Deinococcus radiodurans Reveals a Repressor Preconfigured for DNA Binding.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 52
structure length 156
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fbkA00
3TO7A 1ON1A 2LSOA 4U0VA 2HTJA 2ZNYA 5BMZA 2DFIA 5E18F 4GGGA 2GWRA 2RN7A 2HZTA 2DW4A 3O2PE 5CVVA 5KVRA 3V8JA 1IZ1A 1KYWA 2DLLA 4RB3C 3DEUA 1U2WA 2EV5A 3WODF 2H27A 2X4HA 3TKYA 3H3ZA 4EJVA 4Q4ZF 3VODA 3O6BB 5HVQC 2PLYA 2QWWA 3EQLF 2A6EF 2COMA 5E1XA 1FP2A 4XRFA 5DD8A 2HKXA 4A0YA 1I27A 3FXQA 3SQNA 5HDKA 4NHJA 1FBSA 4B09A 5L3EA 3V7CA 2D2WA 4UXNA 2AS5F 3KZZA 2RQPA 2STTA 2Z3YA 3DF8A 1Z7UA 5E20A 2XAGA 3BJAA 1XN7A 2JT1A 4HV6A 4BHBA 2G9WA 1H0MA 3RKYA 4LG0A 1G4DA 3BP8A 4EMSA 2Y48A 2VE9A 2O6GE 1Z6TA 1R7JA 3QAHA 2MH2A 5ILUA 4ZYDA 3LAJA 4HX7A 5LHHA 1QZYA 5H6QA 4BQAA 3CUOA 2PQ8A 3BJ6A 5A2QK 4EJOA 3CUQA 2J5OA 3R60A 3GUDA 5BPDA 1ZG3A 3M7GA 1SFUA 1HBXG 2EV6A 2GAUA 5F6FA 1W7PB 4EJUA 1U78A 3GXOA 5LBQA 3U1DA 1T2KA 2FMYA 4A6EA 1ZRDA 3K9TA 5FLXK 4O5VA 3KLOA 4OU0A 1HSTA 3R0JA 1U5TB 4LK0F 2JSCA 3TOAA 3F8MA 4I01A 2HOEA 3SFZA 5HS8A 1KQ8A 5D5VB 1I6XA 1ZN2A 2Y75A 2HYGD 4A5MA 2EFPA 5ED4A 1XCVA 5AONA 1MDMA 2IPQX 3VOEA 5ICEA 3G3ZA 3O3KA 4PDKA 4M9ZA 4RAZA 4EM1A 2V1UA 1FSEA 3KP3A 4RB1A 4KUMA 1F1ZA 2R7DA 3JTGA 2V79A 2XRNA 2OZUA 2RC4A 3EYYA 1FLIA 1IN8A 2A6HF 2VC1A 2QZ8A 5H6RA 3V8LA 4AIKA 4U0YA 3LQQA 2Z9OA 2VT2A 4ESJA 2FMLA 1XDUA 4WCGA 1Q1HA 1TBXA 4BYYA 5CVJA 3HOTA 1NHAA 1OPCA 3GZ5A 4OINF 2MBFA 3F23A 2IVMA 4P9FA 2Q8KA 2GXBA 1BM9A 4Y17A 1D5VA 4S05A 2WWYA 5J8CA 1ZRFA 2D1VA 1SAXA 1PP8F 3FM3A 3QP5A 1RI7A 2LDUA 2PG4A 5H20A 1Y0UA 4IRGA 3ABUA 3VEPA 1QZZA 3LSTA 1HKSA 3QU6A 4IHTA 1O3QA 2GA1A 1YW7A 5IT3A 3JAMZ 3JTHA 1XGSA 1J9IA 2HR3A 3K1PA 3RPQA 4KA4A 1JE8A 1S3JA 4MNUA 1ZAOA 4CDGA 2H6CA 4Q47A 4GYGA 2M8EA 1A04A 3RKXA 1T0FA 3KP4A 2GZWA 4N9IA 1LJ9A 5D8LB 4BXUA 3P9KA 1X3UA 4CO8A 3Q9SA 1T98A 4HQMA 3F22A 4YIIA 5FGMA 4ENJA 3FWEA 1YS7A 1WSUA 2L4AA 2UZKA 3KFWX 4GXOA 4IJAA 3MAJA 4IRIA 2Z99A 1K79A 2XIGA 1XSDA 4IPAA 1IXCA 3J80Z 3E5QA 2IT0A 1ZLKA 4P96A 4L9TA 4B8XA 4K2EA 4XLNF 1ZLJA 4KDPA 5CYVA 3BOQA 3L09A 2GA2A 1LDDA 1IAWA 4HV5A 3FHZA 2BYVE 1KYZA 5L3FA 3I59A 2FOKA 2ZXJA 1K6OA 2VBWA 2FU4A 3QPHA 3RYRA 1Z1DA 1FPQA 4G94A 3GF2A 2M5WA 3BDDA 3E97A 4L5IA 1IRFA 1TNSA 2ZBKA 3HTSB 2OA4A 2DI3A 1R5HA 3GZ6A 4L9NA 5KK1A 2GQQA 4EQQA 4S04A 4Y15A 1J75A 2UXXA 2L01A 4ASNA 5CLSA 2HWVA 3J81Z 1FYMA 1EH8A 1JGSA 2MC3A 3LFKA 3OV8A 4P5OA 3ECOA 2KKOA 4L0ZB 1BIBA 1DDNA 3T8TA 3IWFA 3R0AA 4FHTA 6PAXA 1IF1A 3MEXA 2QM3A 1XGMA 3IHUA 1K7AA 4N0BA 3CO7C 1FOKA 1L3LA 5FD6A 3GFLA 3REOA 2RGVA 3I0TA 1U6GA 3P7NA 5JR3A 4IHSA 2KIUA 2GXGA 2EWNA 5LGUA 2JRTA 4EM2A 1K78B 3M8EA 3Q9VA 5K5OA 1Z05A 5JHUA 5HDNA 4I09A 4FX0A 1HKQA 5BPIA 3F6VA 1KA8A 4ZYHA 2VBXA 3IWZA 3GW2A 3WTWC 2A69F 2QENA 1B1BA 2P8TA 3QRFF 4HF2A 1ZARA 1KGSA 4HX4A 2RVCA 5D5UB 4JBAA 3EUHA 1D8JA 4F7ZA 4EJWA 3V7SA 4OOIA 3ELKA 2BEOA 1YW9A 3E6MA 3WTZA 1R1TA 3JAMK 5K5QA 3IL2A 3WU1B 1S7OA 4LJZF 3N4MA 1PUEE 3HYIA 1BC8C 3DKWA 3TDUC 2EJRA 3GWZA 5JVTA 1F4KA 1FC3A 2ADUA 2YU3A 4CICA 2XUBA 2CGPA 1FX7A 3F3XA 1W5SA 2RV8A 5AIQA 4WF2A 5DUKA 3GYHX 5D6FA 2YSRA 5DDGA 3K1MA 2O8XA 5ILSA 3LA7A 5K5RA 2FA5A 4RS8A 4I2OA 4YFXF 2M30A 4MQ9F 2GIVA 3FXUA 1KU3A 3DV8A 2K7LA 5DYMA 4HBLA 5E8GA 2P6TA 2F5EA 1F9NA 4HOBA 3WTTC 2ZFWA 5LGNA 3GFJA 4EGZA 1DPRA 2IP2A 3MFKA 4TV7A 1ODDA 1XSXA 1H9TA 4EJTA 4HZFA 4OMZA 4CXFA 4DQ2A 2ISZA 2ESHA 2XKOA 4MEYF 2CQKA 2P5LC 2PI0A 4U88A 4U7DA 2QQBA 3F8FA 1QNTA 1YTYA 3EDPA 2P7VB 1J0RA 3ZMDA 4H0EA 2XKPA 4Z2YA 2LNBA 3T0YA 2M45A 3C18A 2PN6A 2HKOA 2HS5A 4LFUA 1IW7F 1MZBA 2EK5A 3WTSC 1USTA 3TO9A 3QP6A 3DPLC 4ZZLA 4ZYEA 2B0LA 2HTSA 1D3YA 2FNPA 2RDPA 3HHHA 2KRFA 5HS9A 1RNLA 4MEXF 1D8KA 3MZHA 5EEHA 3HSRA 3WE3A 1TQPA 1FZPB 3SZPA 4UHTA 2H94A 1W4MA 5HLHA 1WWXA 3N97A 3G73A 1G3SA 5ICCA 3I53A 2VBYA 2XAHA 1LEBA 3KETA 3PQJA 2ZKZA 2VE8A 1V4RA 5LEJA 1ZREA 2LF8A 3K1NA 4KYWA 2DBBA 4HX8A 1IN7A 3VB2A 3FZVA 3GLXA 3ZQ7A 2QBYA 2CSOA 2H09A 2DTRA 1XB4A 1IUYA 1KQ0A 1GVJA 2VXZA 1R00A 5JFRA 4GO1A 1I1GA 3EETA 2OU2A 1RZ4A 1DUXC 4GYIA 3ZPLA 5DCFA 3RTRA 1DP7P 1XD7A 3HSEA 1RIOH 1QQIA 2JZYA 3CO6C 3KLNA 4LLNA 4M6XA 3CJNA 1FYKA 2STWA 2MH9A 4OIPF 1U3EM 1XMKA 3MZYA 1YW8A 1SD6A 4HAMA 3BPXA 1P2FA 3DXJF 3HHGA 3P9CA 4I98B 3WG9A 3KEQA 1ZGAA 2F5CA 2LF7A 1FSHA 1U5TC 2EA2A 3AAFA 4OMYA 5D6EA 4RB0A 2M87A 3ZMSA 2O0YA 2HFHA 4M74A 3TOBA 2DT5A 3ZMTA 1KQ9A 1B59A 3IC7A 3BPVA 1HW2A 3V8KA 2VONA 1BI1A 3WTXC 1FBUA 2H6BA 2FNAA 1FYLA 2G7UA 4NQWA 3V4GA 4KIGA 1L0OC 3KP7A 1J7KA 4LG0B 2OBPA 3ERED 3WU0A 3D5LA 4Y13A 4D0PA 5L3DA 3WTYC 3E5XA 2QQ9A 3PFIA 3RDIA 2IJLA 3KCCA 2K02A 1XGNA 5E1WA 1P92A 2W85A 1KU9A 2ZJ2A 3F72A 5TJJA 2VN2A 4IVNA 4LLLA 2BBYA 2JTVA 3ISPA 1P4XA 3CUQB 2CO5A 3L9FA 2A61A 5LRSA 5DEQA 5L3CA 2X0LA 2M1BA 2E7XA 4L18B 4WXHA 1R22A 1S6LA 1YO5C 4ETSA 3W6JB 3HUGA 2FBHA 2V9VA 1HW5A 4ESFA 3KZYA 1BBYA 4HLYA 2A5YB 2QUFA 4XBFA 4HQEA 5DD4A 3HOSA 1KU2A 2A07F 1FBQA 2IA0A 1MDMB 1JHFA 2AXLA 2O3FA 4LGWA 1HKTA 5HLGA 4RAYA 2K4JA 3S2WA 1SD7A 2HYFA 2J5PA 3M8FA 2XASA 1SD5A 4HF0A 3HIFA 2P7CB 5TRDA 5D4RA 1CF7A 3ZN1A 4KFCA 4G6DA 3WGGA 1LNWA 4BHCA 4CZZA 1QO0D 2MA3A 3IRQA 4LK1F 3FM5A 2TDXA 3I64A 3GO5A 3WE2A 2UXNA 4Q5SF 4A0ZA 4OIOF 2XHKA 5F1RA 2EFOA 1IN4A 1XSVA 1OYIA 5ICFA 1SMYF 3FMQA 4KIFA 3VFZA 1HQCA 4QWQA 2NYXA 1I5ZA 1UHWA 4A5NA 4BHPA 4AD9A 4BAYA 5LEKA 3TQNA 1O7FA 3HRUA 1YLFA 3T1BA 1G3YA 5FD5A 1S29A 3DPTA 1FT9A 5A2QZ 4UUVA 5EEGA 1XDSA 3DP7A 4MHGA 2D45A 1SFEA 3QU3A 1EV7A 4G8XA 4HDUA 1IXSB 1S8NA 3IKVA 3M9AA 1ZH5A 2QYOA 1JHHA 5HDGA 4HA8A 5FLXZ 2KIFA 3JSOA 5CVUA 4OIRF 1W7PD 2NNYA 1CGPA 1BC7C 1AWCA 4KN7X 4A12A 4YG2F 3ZMUA 4DNCA 4G7HF 2L02A 3E6CC 1U8RA 4KT5C 3WTUC 2K4BA 3F8NA 2QQAA 4HF1A 1YIOA 2NS0A 2PMUA 3TO6A 4M71A 3I5UA 1EH6A 3SHFA 1FNNA 3KP6A 2FBKA 1G3TA 4PGGA 2V1XA 2V1DA 4ENMA 4IF4A 4QLCU 3J7AO 1W7PA 1IN6A 2QLZA 1OYWA 4PZJA 4CGZA 3R6SA 3NQOA 5HS7A 4EVIA 1F5TA 1U5TA 2Z33A 1B9MA 3ABTA 2OD5A 4YFNF 2OZ6A 5FFXA 2HQNA 2W25A 3ZP5A 3D0SA 4L9VA 4AWXB 3TDZC 1MJBA 2A3SA 2D1HA 4LD5A 2DPDA 4A6DA 4ZYGA 5D4SA 5LHGA 4HLXA 3FMRA 4HYEA 4HDVA 2Q2EA 3T5XA 3I59B 1LVAA 2CW0F 2BGCA 1WKMA 1WI9A 2FQ3A 5E17F 4G9YA 3HSFA 2Q0OA 3CLOA 1CF7B 2C6YA 3GVAA 1TNTA 3SZTA 4I0BA 3BZ6A 3JW4A 3WTVC 2O03A 4ESBA 1WQ2A 4AIJA 2P4WA 3J80K 1P4WA 3LWFA 2RKHA 1OKRA 2DAOA 2IA1A 2K27A 4LMYA 3ZMVA 1TW2A 2O61A 3CDHA 1USSA 1B6AA 3DFGA 1HW1A 2P5VA 4WXCA 2XAQA 2MD5A 1T6SA 4A0XA 1C0WA 5CVRA 3E5UA 2KIMA 3F8BA 5LGTA 1B9NA 5J8FA 1MGTA 2R7FA 1EH7A 4AVPA 1BI0A 3HRSA 4M72A 5L3BA 4JQFA 3WGHA 4HW0A 1R1UA 4OIQF 4U0WA 1R1VA 3NEUA 1IN5A 3COAC 1MJ9A 3J81K 4XSZF 5FB2A 1S7AA 2IW5A 1R58A 3R61A 4PCQA 4PGHA 2PFBA 1B4AA 3C3WA 3ROUA 5ILVA 3I54A 2NNNA 5CJ9A 4FX4A 3E3VA 2BE5F 1LDKB 5E1ZB 4L9JA 4P55A 3H92A 3K69A 2DK5A 4E70A 2V6CA 3GEZA 5D8KB 1MKMA 1OR7A 4KICA 1I1SA 5CVIA 2YR2A 2VOPA 5LLQA 2RNJA 5D5WB 2VODA 1TLHB 4WXDA 2EFNA 1GXQA 2G7HA 3I58A 1YFHA 3E6DA 3QOPA 3C1DA 3R4KA 1AOYA 2E7WA 4LB6B 2E1CA 2P6SA 2CFXA 2FE3A 5K1YA 3KP5A 1MJAA 4KN4X 1ZRCA 4WX9A 4EGYA 1J2XA 1T38A 2ISYA 1VTNC 3JSPA 3C7JA 2XV4S 2A68F 4NB5A 1J59A 2FF4A 3KP2A 5IT9Z 3LAPA 2ZMEA 1UHMA 4UV9A 5BOXA 3U9GA 1SD4A 1FY7A 4MQVA 4M73A 1BI2A 1HXDA 3WGIA 2EB7A 2Y0MA 1PP7U 4P9UA 2KJCA 3NRVA 2JPCA 2XAFA 4RGSA 1UCRA 1O57A 5BQTA 2P5KA 5L3GA 3LQRA 5LRRA 4WWCA 2DQRA 2F5DA 3P9IA 3IRRA 3ZN0A 3F6OA 4YFKF 4RGRA 3ZMZA 1W5TA 1SMTA 1KU7A 1Z91A 5DCMA 2ZCWA 2PEXA 3M1EA 5HLIA 3TGNA 2W57A 3BJOA 3K2ZA 3LA2A 3T8RA 3L2CA 2OAZA 2ESNA 2L3DA 2QVOA 3F8CA 1REPC 4RGXA 1ZG1A 5ICGA 4N9HA 3OOPA 1ZYRF 4ENKA 3FX3A 4CHUA 4M9SA 1T39A 3BROA 2E1NA 2R3SA 5D5XB 3RI4A 4YIFA 2DK8A 1ZHFA 2W84A 3KE2A 5F64A 4I02A 2PMHA 1ZG5A 2XGXA 2FXAA 3E6BA 3MWMA 1FP1D 3SXYA 1YYVA 4GCVA 1K78A 3IKTA 4KMFA 2JPBA 2LKPA 2W24A 1IRGA 2DU9A 1O3SA 1YG2A 2K86A 1R23A 2ACJA 1J5YA 1R5GA 4EV0A 1RUOA 1FWZA 2XROA 1RUNA 4I0AA 2FBIA 4IRHA 3HRTA 1G6NA 3KEOA 2VOOA 3CTAA 2YPRA 4G6QA 3H3UA 4XLPF 1QPMA 3I71A 2EV0A 2IRFG 4G7ZF 1BOAA 2DPUA 2FEZA 2PBIA 2MLGA 3HRMA 2KJBA 1SFXA 2CG4A 3Q5FA 1WRJA 3RKWA 4L5JA 2ZO4A 1UFMA 4UNOA 5FO5A 3W6KB 1O3RA 2BV6A 2OQRA 3ECHA 1TW3A 1OMIA 5FFZA 3GFIA 2HQRA 4U7BA 3FF5A 1GHCA 1YS6A 4Q48A 3RJPA 2EA4A 3BWGA 4FT8A 2F5FA 3V7RA 2WV0A 1YQAA 3ULQB 4O3MA 2QBYB 1ONVA 4L0YB 3GFMA 2ZMEB 1MD0A 1TQMA 4LB5A 2NAZA 1DPUA 5J6XA 4MTEA 4RGUA 3CUQC 2WTEA 3F21A 3PQKA 3BY6A 2ZNZA 2YX7A 1BI3A 2FRHA 3EYIA 1LQ1A 2XVCA 4UVAA 1O3TA 3QPTA 3I4PA 4R8HA 3B02A 3K0LA 3B73A 4UV8A 5DCMB 1OYYA 4KMUX 4CYDA 2HDCA 5IT9K 4ZZDA 3HTUA 5HOOA 1BIAA 2Z5UA 1R36A 4EM0B 3FMSA 2NRAC 5E8IA 4O6JA 4UVCA 5LHIA 1P6RA 1H9GA 4BH9A 1XGOA 3GX4X 1QGPA 1V3FA 1JXSA 1ON2A 4A2UA 4R1HA 2EFWA 1LB2A 2DO7A 1HSJA 2VT3A 3MCZA 5DV5A 3L7WA 3DQVC 1LEAA 1STZA 2L54A 1XCBA 2FSWA 4G7OF 4R79A 1E17A 4LLGF 3RPUA 1ULYA 1BN5A 2UWMA 2HEOA 1QBJA 2YX4A 1P4AA 2XAJA 4AIHA 2CYYA 4M6YA 4XSXF 5ERIA 1GXPA 1PDNC 1Z6RA 1BJAA 2WC2A 2MLKA 1TQIA 1O7LA 3RYPA 4ZH4F 5BS6A 3ML6A 4WK8F 5AIPA 4MTDA 1XMAA 1TTYA 1ZGJA 2PJPA 2VC0A 4RB2C 1G3WA 4JK1X 4KNYA 4IXAA 2DQLA 4BNCA 1UB9A 4KIBA 4ENNA 4MGRA 4UVBA 4ON0A 5JI6A 3FXRA 3RIRA 1LDJA 2EFQA 4M9XA 5DUIA 2HGCA 2VBZA 2ELHA 3MQ0A 3LA3A 2F2EA 2ETHA 2IA2A 2OQGA 2CWEA 3U2RA 3L00A 1Z9CA 1IXRC 2L4MA 4I7HA 1E2XA
chains in the Genus database with same CATH superfamily
3H0DA 5FRNA 3TO7A 1ON1A 2LSOA 1FMWA 3DWLE 4U0VA 3G6EI 1HLVA 2HTJA 4A69C 1FOWA 2PX9A 2ZNYA 5BMZA 2DFIA 4XORA 3LNQA 3WG7H 5E18F 4GGGA 2GWRA 3JR9A 2RN7A 5GAGJ 2HZTA 2DW4A 3O2PE 2H8WA 3S93A 3VSKA 2DODA 2JVGA 5CVVA 5KVRA 3LSMA 1ETOA 3H5AA 5E3LA 1ETWA 3V8JA 1IZ1A 1KYWA 2DLLA 5B3SH 4RB3C 3DEUA 1U2WA 2EV5A 3OWTA 3WODF 2H27A 3H9GA 3PUBA 2X4HA 2JMWA 2KZVA 3HG9A 1NH3A 3TKYA 2DFEA 3H3ZA 3OIQA 2GBYA 4EJVA 3K7AJ 1LFBA 1DU6A 1R9TJ 3KZIC 2ECBA 4Q4ZF 3BR5A 4N4OB 3VODA 3O6BB 3SJMA 5HVQC 2COBA 1Q1VA 2PLYA 4RLQA 2NOJB 2QWWA 3EQLF 2A6EF 2COMA 5E1XA 3QWLA 2DT7B 1ETVA 1FP2A 3ZQCA 1QA6A 3RKQA 1MMNA 2DXIA 4XRFA 5DD8A 4C3IJ 1P9QC 2HKXA 5F0HA 3QPSA 1D0ZA 2OF7A 3DBRB 4A0YA 3ZQFA 1AKHA 1X3ZB 1I27A 3FXQA 3X2QH 3SQNA 5J47A 5HDKA 4NHJA 1FBSA 3KYCB 3K4NA 4B09A 5L3EA 5J1YA 3V7CA 2O7OA 5J4YA 2D2WA 1OCOH 4BXXJ 4UXNA 2AS5F 3KZZA 3NWSA 2RQPA 4A3EJ 2STTA 2NVTJ 2Z3YA 3DF8A 1Z7UA 1R49A 3GMEA 5E20A 3BCAA 5FKOA 3PNTA 2R92J 2V9PA 2XSJC 2AQFA 2XAGA 2EPFA 1MIJA 3FHNA 3BJAA 5M3FJ 2HOAA 2V4JC 1XN7A 2JT1A 4HV6A 4BHBA 2G9WA 1H0MA 2RNGA 3RKYA 3H1CA 4F93B 1WZ2A 4LG0A 1G4DA 2Y0SA 2Y2ZA 4IOCF 3JRAA 3I56I 3BP8A 1Z77A 4EMSA 2Y48A 2VE9A 1RRJA 2O6GE 4MLOA 1Z6TA 1R7JA 4CH7A 2ELJA 4HG2A 3QAHA 4UUSB 2MH2A 5LD2C 2DA2A 2I8DA 3DKYA 5JLXA 3M3YJ 5ILUA 3PSFA 4ZYDA 3LAJA 2PJRB 1UZCA 1QPIA 4HX7A 3VYUB 5LHHA 4C3HJ 4ANJA 1QZYA 5H6QA 1JT0A 3G2BA 5GTHC 4BQAA 3CUOA 2L7MP 2PQ8A 3BJ6A 3ZQHA 5A2QK 4EJOA 3CUQA 3BG7A 2J5OA 1MSFC 1I3QJ 2KZGA 1B8IA 2DYRH 5C3EJ 3R60A 3GUDA 5BPDA 2VQCA 1ZG3A 3M7GA 1SFUA 2I5UA 3CP2A 5J1UA 2QF7A 3OYFA 1HBXG 3ASNH 2EV6A 1YRNA 2YS9A 1MH4A 3OYBA 2GAUA 1P7IA 2WY8Q 5F6FA 1W7PB 4EJUA 3M4OJ 1U78A 3GXOA 2CUJA 3K70C 4RAFA 1ORKA 1Y1VJ 2W00A 5LBQA 3U1DA 1T2KA 2FMYA 4A6EA 1ZRDA 3K9TA 5FLXK 4O5VA 3KLOA 2JA2A 4OU0A 5BNGA 4RM3A 1HSTA 3R0JA 1U5TB 4LK0F 2JSCA 3TOAA 3F8MA 2VKDA 4I01A 2HOEA 3SFZA 5HS8A 3CMAI 3CC7I 1E3HA 1KQ8A 5D5VB 1I6XA 1ZN2A 2AXTC 4GRIA 3CMYA 2Y75A 3OY9A 2HYGD 2ZSHB 2FUG2 3CCYA 3HOZJ 4A5MA 2EFPA 5ED4A 1XCVA 1OLTA 3EUKL 5AONA 1OQYA 1MDMA 2IPQX 2Q2EB 3VOEA 5ICEA 3G3ZA 3HKZA 4RAGA 4BQNA 3DKXA 3O3KA 3L2QA 2KFDA 4PDKA 4A3KJ 4M9ZA 2BHYA 4RAZA 4EM1A 2V1UA 1FSEA 3KP3A 3BR0A 4RB1A 2VB6A 1MMGA 4KUMA 1F1ZA 4PSWA 2R7DA 3U1KA 4HSTA 3JTGA 2V79A 3CC4I 2XRNA 2OZUA 2XB0X 1W1WE 2RC4A 3ASOH 3EYYA 3FXJA 1WJEA 5F08A 4XKBA 1OISA 3S1NJ 1FLIA 1IN8A 3PFYA 2A6HF 1BR4A 2VC1A 4X0GA 2Y9YA 3EUHC 2QZ8A 5H6RA 3V8LA 4AIKA 5CQEA 2DFHA 4U0YA 3LQQA 2Z9OA 2VT2A 4FETA 4ESJA 2FMLA 3FXMA 2IGOA 3HOYJ 1XDUA 2VLAA 4WCGA 1YE9A 5EGOA 1ZR2A 1JKQC 1Q1HA 4XICA 1TBXA 2M7AA 4BYYA 2NS8A 2CUZA 2LY2A 3HGGA 5CVJA 3HOTA 1NHAA 1XPXA 4JYKA 1UG0A 1OPCA 4C9YA 3GZ5A 4OINF 2MBFA 4YRVA 2DA3A 3F23A 5IOZA 3BZCA 2IVMA 4P9FA 2GOXB 4XOTA 2Q8KA 2GXBA 1BM9A 4V2FA 2L7ZA 4Y17A 1YI2I 3PSIA 2IS2A 1D5VA 4B43A 4S05A 2WWYA 3UNGC 4HSRA 5HLTA 5J8CA 2CQNA 1H89C 1ZRFA 2GLOA 2D1VA 3A02A 1SAXA 2FQ4A 3FM3A 5HODA 4I6ZA 1PP8F 3QP5A 3HC7A 1RI7A 2LDUA 2PG4A 1AKHB 5H20A 1Y0UA 4IRGA 2ZB9A 3ABUA 2L2OA 3VEPA 1QZZA 4BGDA 2VKEA 4XOPA 3LSTA 1HKSA 3QU6A 4IHTA 1O3QA 3CJTB 4IL6C 2M7BA 2GA1A 1UMQA 1YW7A 5IT3A 3JAMZ 3QQAA 3JTHA 1XGSA 4DJAA 2W82A 1J9IA 2HR3A 3K1PA 3TP0A 1YX3A 3RPQA 3G4SI 1WFXA 4KA4A 1JE8A 1S3JA 4MNUA 1ZAOA 4CDGA 1PUFA 1QVTA 4LITA 2DMTA 2H6CA 3UKGA 5LFAA 3KX2A 3DTKA 4UUTA 4Q47A 1TWGJ 3RZOJ 2QQ8A 2VIXA 3DU6A 4W97A 3QODA 1HF0A 4GYGA 1NG6A 2M8EA 2GM4A 5FLVA 1PJRA 4JX5A 1A04A 5EZHA 1IG7A 2BXYA 3AKZA 3RKXA 3CCSI 4U87A 5FRMA 4KT6A 3SDBA 4F92B 1T0FA 2MABA 1MBEA 3KP4A 4BE1A 2HDDA 4ABZA 4I99C 2GZWA 4N9IA 1LJ9A 2VJ5A 4RBOA 5D8LB 4BXUA 5IYBJ 4BE2A 2HDWA 3P9KA 3MN2A 1X3UA 4CO8A 2Y30A 4IZZA 2CMPA 2I10A 3Q9SA 1T98A 4HQMA 3F22A 4XN0A 4DZJA 4YIIA 5FGMA 1YJ9I 4DOZA 3RCOA 1I3AA 1MBHA 4ENJA 3FWEA 2LY9A 1Y8RB 1YS7A 1WSUA 1SFOJ 2L4AA 4BQOA 2UZKA 1S9HA 3GTJJ 5FKMA 2WAEA 3KFWX 1OCPA 4QIWN 4IO9F 4GXOA 3HB9A 4IJAA 4CCJA 3K4JA 3TW6A 3M8JA 2X6XA 3MAJA 4IRIA 2Z99A 1K79A 3TP3A 1TP4A 1ZGWA 1X1AA 3VSLA 2XIGA 3LL7A 1XSDA 4IPAA 1IXCA 1HC8A 3J80Z 4BU2A 3JRDA 3MKZA 3E5QA 4BDZA 3L2RA 2IT0A 3GCMA 1ZLKA 4P96A 4L9TA 4B8XA 3BTCA 4K2EA 3JRHA 2WBMA 4XLNF 3OR2C 3FK6A 1ZLJA 2ZXHA 3GTMJ 4KDPA 5CYVA 3GLLA 2VQLA 3BOQA 3L09A 2GA2A 4V19K 1LDDA 1IAWA 1ZK8A 4HV5A 1BR2A 3FHZA 2BYVE 1KYZA 4AU7A 5L3FA 3I59A 2FOKA 2ZXJA 1K6OA 2VBWA 2FU4A 2LP0A 3QPHA 3RYRA 4UY8I 2IS4A 1Z1DA 4DW6A 2NVXJ 1FPQA 2Z1DA 2K9LA 4G94A 4XQFA 2ECCA 3GF2A 2M5WA 3BDDA 3P5JA 4DBRA 2E1MC 3FBNB 1TL8A 3E97A 4QTRA 4L5IA 2CH0A 4NC6A 1IRFA 2BW3A 1TNSA 2ZBKA 3QYBA 2R5ZA 2HYJA 2XC7A 2OA4A 3K10A 3HTSB 2O9LA 2DI3A 1LE8A 1U9OA 4Z6YA 1VQLI 4CCKA 2HZDA 1R5HA 3B6AA 3GZ6A 4L9NA 2V7FA 5KK1A 2GQQA 3H3VK 4EQQA 4S04A 4Y15A 1J75A 2PMZN 2B63J 2UXXA 2L01A 1IUFA 4PJJA 4ASNA 5CLSA 2JRMA 1LUJB 2L9NA 2HWVA 2E2JJ 3BR3A 3J81Z 1FYMA 4BBRJ 1EH8A 5HNHA 1JGSA 2DDBA 2JJ7A 2MC3A 3LFKA 5GADJ 3OV8A 3JRIA 4P5OA 3ECOA 2KKOA 2OCCH 3S8PA 4L0ZB 3Q3SA 1BIBA 5FKKA 1DDNA 3T8TA 1R4NB 4D7NA 5F0CA 1V5FA 3IWFA 4FCYA 4XKVA 2IS6A 3R0AA 4FHTA 6PAXA 1IF1A 3MEXA 3RSNA 2WB1N 2QM3A 1XGMA 2VJ4A 3IHUA 2AHQA 3H0GJ 3MKYB 1K7AA 4N0BA 3HOWJ 3LSPA 3CO7C 1FEXA 1RR8C 1HDDC 1OCZH 3EUAA 3G1LA 1FOKA 1L3LA 5FD6A 4A3MJ 3S1MJ 2FX0A 3GFLA 2B7EA 1HCRA 2VJJA 3Q0VA 3REOA 2RGVA 3I0TA 1U6GA 3K4MA 3P7NA 5JR3A 4IHSA 2KIUA 2GXGA 2Z16A 2WY7Q 2EWNA 5LGUA 2ZMEC 2JRTA 1ERDA 4EM2A 1K78B 3M8EA 3Q9VA 4A93J 3SEQA 5K5OA 2B9SA 1NK3P 1JTXA 1Z05A 2JUGA 5JHUA 5HDNA 4CYCB 4I09A 4PJNA 4FX0A 1HKQA 4P1WA 4KITB 2LTPA 5BPIA 2R7WA 3F6VA 2FJ1A 1KA8A 4CA0A 4ZYHA 3D5SC 2LBFA 4XNFA 2VBXA 3IWZA 3GW2A 3WTWC 2A69F 4OAZA 2R7XA 2R7OA 1WJDA 2QENA 2OC6A 2JQ7A 1B1BA 2P8TA 3LSRA 3QRFF 4M3EA 2WA0A 4HF2A 2UV1A 1ZARA 1KGSA 4HX4A 3PNVA 1M1EB 2RVCA 3HZJA 5D5UB 4Y3OA 4JBAA 4MO7A 3EUHA 2XDVA 1D8JA 4F7ZA 4EJWA 2LOOA 5IY5H 3V7SA 4OOIA 3ELKA 5KAIC 3LSGA 2BEOA 3AL0C 1YW9A 3E6MA 3WTZA 1R1TA 3AFHA 3HJEA 3G71I 3OSGA 3JRGA 4BS9A 3K4BA 3JAMK 5K5QA 3IL2A 1VQ6I 3WU1B 4JX6A 1S7OA 4LJZF 1FIPA 3N4MA 3ZCOA 1PUEE 3HYIA 1BC8C 1QHGA 3DKWA 3TDUC 4RDUA 1A6IA 3ESWB 5E3MA 2EJRA 3GWZA 2QCOA 5JVTA 3AG1H 5E79C 3H5NA 1SC7A 3A01A 1F4KA 3GZNB 4BE0A 4GFBA 1FC3A 2ADUA 2YU3A 4CICA 2EBIA 1WJ5A 2XUBA 2CGPA 1FX7A 3F3XA 1D0YA 3U21A 5GPCA 1W5SA 3SDGA 4E7KA 3DTIA 4ZC3A 2RV8A 5AIQA 4DIQA 4WF2A 3S3NA 2RREA 5DUKA 3GYHX 5D6FA 2YSRA 5DDGA 3BR6A 2IBDA 2V9KA 3DBHB 3K1MA 2O8XA 5ILSA 3LA7A 3N05A 5K5RA 2FA5A 2XGCA 5M5WJ 3CCRI 1BR1A 2CS3A 1X4OA 4RS8A 4I2OA 2M30A 4YFXF 3GTQJ 4MQ9F 2GIVA 3FXUA 1KU3A 3M1CA 2X6WA 3DV8A 4PFPA 2K7LA 5DYMA 4II2A 3W2WA 4HBLA 5E8GA 2P6TA 3ZOBA 3L2WA 1TWHJ 1T56A 1MMAA 2F5EA 3QYFA 1F9NA 4HOBA 1AA7A 4FQGA 3WTTC 2ZFWA 5LGNA 3W3CA 1H88C 2DA1A 3GFJA 3PO2J 3FBIB 4RLFA 4E7SA 5GAHJ 4EGZA 1DPRA 2IP2A 3MFKA 3CQZJ 4TV7A 3OL3A 1H8AC 2KHMA 3MD2A 1ODDA 3K6GA 1XSXA 4HNUA 3OOUA 3HBLA 1H9TA 3FDYA 3B6CA 4EJTA 3MVPA 4HZFA 1K6YA 2GIZA 3NAUA 4OMZA 3ZR8X 1ETXA 2BVMA 2R7QA 4DQ2A 4CXFA 2ISZA 4AM3A 4F52A 3E7LA 2ESHA 2XKOA 1MBKA 4MEYF 2NVUB 4G6TB 2CQKA 1OCTC 9ANTA 2P5LC 2QKMB 2PI0A 3FKIJ 4U88A 3IAM2 4U7DA 1JUMA 3BTIA 5J40A 3BG5A 2QQBA 3F8FA 5F27A 1QNTA 3Q0UA 1YTYA 1ITYA 3EDPA 3OIOA 3OL4A 2OPTA 2P7VB 3CD6I 4HPQA 5C4XJ 2IGMA 2E2IJ 1J0RA 1A5JA 4XKCA 1YHQI 3ZMDA 1X2NA 2IGKA 4BEHA 4IEJA 4W1UA 3L2UA 1GV5A 1UHSA 4H0EA 4B48A 2JA6J 2XKPA 4Z2YA 2LNBA 3T0YA 4C3JJ 2M45A 2E19A 3C18A 3S2DJ 4AUXA 1RC9A 2PN6A 3AG3H 3H9JA 2HKOA 2HS5A 1GLNA 2CUFA 4X6AJ 3UR3C 2QSFX 4LFUA 1IW7F 1B72B 1MZBA 2EK5A 3WTSC 1USTA 3IH3A 2K40A 3TO9A 1J09A 4A3FJ 4XLAA 3WHBA 4IHXA 3HGYA 2M2EA 3QP6A 2MSYA 1GDTA 2NVQJ 1RKTA 3AG2H 3DPLC 2LBFB 4J00A 3C2BA 4ZZLA 2XF5A 4ZYEA 2B0LA 2HTSA 3BQZA 1AU7A 4YIRX 1D3YA 1IO2A 2FNPA 2RDPA 3HHHA 2VL8A 2KRFA 5HS9A 1RNLA 4MEXF 1D8KA 3MZHA 4XRSA 3BC8A 2HVQA 5EEHA 3HSRA 2BOLA 5CKTA 2AO9A 4JP0A 3WE3A 3H36A 4F55A 1IDYA 1TQPA 2VASA 4XL9A 2ID3A 4E4HA 1FZPB 1ETQA 2XGDA 4NUBA 3A2KA 3SZPA 4FE4A 1GUUA 4BKXA 5DS9A 2ZXWH 1X2MA 4B4CA 4UHTA 3S1RJ 2H94A 1W4MA 5HLHA 1WWXA 3N97A 3G73A 1G3SA 5EZGA 1I6HJ 5ICCA 2HQAA 3I53A 2VBYA 1VQKI 3DBLB 2XAHA 2DA6A 3SEZA 3DLAA 3I3LA 2R7VA 1LEBA 3JRCA 1RR7A 5FKNA 1BL0A 1SVOA 3E0JB 3A01B 3KETA 3OYIA 1F36A 2NVYJ 1OJLA 3PQJA 2ZKZA 2VE8A 2VQGA 1V4RA 4IHVA 4M3FA 5LEJA 1ZREA 2HOSA 2LF8A 3OS0A 2YU9J 3K1NA 4KYWA 4LIVA 2DBBA 3S3OA 1W0TA 1E3PA 5CPRB 4HX8A 2QSHX 4N4NB 4XK4A 1IN7A 4F91B 2E5ZA 2E34A 3VB2A 3FZVA 3GLXA 1S72I 3ZQ7A 2QBYA 2CSOA 3GBGA 2H09A 2DTRA 4V2GA 1XB4A 3HPGA 1IUYA 4L5EA 1KQ0A 2K9MA 1GVJA 2VXZA 4BY1J 2JUCA 1R00A 1WPKA 5JFRA 4GO1A 1I1GA 2CJJA 4FASD 1RKWA 3EPZA 3EETA 2OU2A 1RZ4A 2DFFA 5M3MJ 1DUXC 3OYCA 4GYIA 2WAFA 3ZPLA 5DCFA 3RTRA 1DP7P 1XD7A 2F4OB 3W2VA 3HSEA 1RIOH 1QQIA 2JZYA 3QYEA 3CO6C 3KLNA 4LLNA 1K61A 4M6XA 3CJNA 5K7HA 2D5VA 1FYKA 2STWA 2MH9A 3CCMI 4OIPF 1U3EM 1XMKA 3FKJA 4IHYA 3MZYA 1YW8A 1NTCA 2HNHA 4DYQA 1SD6A 4PJLA 3GTPJ 4HAMA 1WJFA 1T8IA 3BPXA 3J7YJ 1P2FA 3DXJF 3HHGA 3P9CA 4I98B 3WG9A 3KEQA 1ZGAA 2F5CA 2LF7A 2JA7J 1FSHA 1VQ5I 1XX5A 2JA8J 1U5TC 5GP9A 2R7UA 2EA2A 1JI8A 3AAFA 4JX4A 4OMYA 5D6EA 4RB0A 2M87A 3ZMSA 4XRMA 2O0YA 3ERMA 1IDZA 4D5CA 2LKXA 2HFHA 4M74A 1Z3YA 3TOBA 2DT5A 1JT6A 3ZMTA 3OYKA 1D0XA 1KQ9A 1B59A 2KRCA 3IC7A 3BPVA 1YJNI 1ZKGA 1HDPA 1HW2A 2E2HJ 3V8KA 1Z0XA 2VONA 1BI1A 3WTXC 1FBUA 2LH9A 2H6BA 2FNAA 2OV7A 1FYLA 1U9NA 2L9SA 2G7UA 4NQWA 3AG4H 1EF4A 3FIWA 3V4GA 5C4JJ 3FXLA 5CQGA 2X6OA 1YITI 4KIGA 1L0OC 3KP7A 2XF7A 1J7KA 4B1RA 4AC0A 4LG0B 2OBPA 2KRHA 3ERED 2HXOA 3WU0A 3PO3J 3RQIA 2ELKA 3D5LA 2R7RA 4Y13A 4D0PA 1IV8A 5L3DA 2M9HA 3WTYC 3E5XA 2GXAA 5TISC 4GDFA 3I4MJ 2QQ9A 3BTLA 5J1RA 3L2VA 3PFIA 3RDIA 3NWTA 2CV1A 2CV2A 2BHZA 2IJLA 1SVLA 3C2GA 1XG1A 3HOUJ 3KCCA 2K02A 1XGNA 3ZQQA 5E1WA 1EKEA 4BL0B 1ETKA 1P92A 2W85A 1V54H 3CMEI 1KU9A 2ZJ2A 2LD5A 3F72A 2ZSIB 5TJJA 3OYJA 2WB1A 3DPUA 1VFCA 2VN2A 4IVNA 5M5XJ 4E7HA 4LLLA 1JKOC 2BBYA 2JTVA 3ISPA 4E7IA 1FJLA 2VQHA 1P4XA 3CUQB 3K4KA 1LKXA 2E1MB 2DYSH 3LSIA 2CQ7A 2HPMA 4ZDPA 1B8IB 2G0EA 2CO5A 1MBFA 4UB6C 5TGTA 3CZ6A 3L9FA 3VYSB 1QZEA 4NDLA 1G2HA 2A61A 3DCFA 5LRSA 2W48A 1TZLA 2OUMA 4HNTA 5DEQA 1YRNB 2LVSA 2MW8A 2V26A 5L3CA 2DDAA 3OSFA 2X0LA 2M1BA 1V55H 3DU5A 2VUMJ 2E7XA 3ONQA 4E7ZA 3LOCA 1R22A 1S6LA 2Y69H 4WXHA 1YO5C 4L18B 4ETSA 1QHHD 3W6JB 3IP4B 3ZRGA 4PUSA 3HUGA 2FBHA 2V9VA 4M3GA 3S2HJ 2GOMA 1HW5A 4ESFA 1XC5A 3KZYA 1BBYA 1G8XA 2WAQA 3LSKA 1BW6A 4HLYA 2VKVA 2A5YB 5C44J 2QUFA 4XBFA 2L9VA 5DD4A 4HQEA 4ZTJA 4NBQA 2F5VA 3HOSA 1KU2A 2A07F 1FBQA 2Y9ZA 3A1YA 5IP7J 1U8BA 2EIJH 2R0QC 1MMSA 2IA0A 1MDMB 1JHFA 2AXLA 3JCUC 2O3FA 4LGWA 1HKTA 5HLGA 1U0JA 4RAYA 2EZIA 1IJWC 1Y8QB 2JK3A 2NS7A 5IP6A 1QRYA 2K4JA 3S2WA 1SD7A 1CQTA 2HYFA 3CCEI 2J5PA 3M8FA 5GPAA 2XASA 1SD5A 2ZJRF 1MNEA 2IXSA 2RQQA 3VYRB 4HF0A 3HIFA 4DGWB 4D7MA 4CCLA 2P7CB 2F4IA 2QEXI 5TRDA 4A3JJ 3PIPF 3KPHA 4II3A 5D4RA 1CF7A 4BJ5C 3ZN1A 4KFCA 4G6DA 2IEKA 2CFOA 3WGGA 1LNWA 3CLQA 3H5RA 3K4LA 4BHCA 4CZZA 1KZHA 1QO0D 3BQYA 2MA3A 3IRQA 4XONA 4LK1F 3TMOA 3SFIA 3FM5A 2TDXA 3I64A 2WV1A 3GO5A 3WE2A 2UXNA 1RESA 4Q5SF 1TWAJ 4A0ZA 1WJAA 3H35A 2XHKA 4OIOF 1TT0A 2F4MB 5F1RA 4BACA 1K4SA 2EFOA 2E35A 5EGOB 1IN4A 2DMUA 3BG3A 1OR7C 2ZFUA 1XSVA 1OYIA 5HNFA 2DTZA 1ZELA 5ICFA 1WGXA 1SMYF 3FMQA 1LPQA 4KIFA 3VFZA 2F6CA 2R5YA 2HVRA 1HQCA 4QWQA 3S16J 4NNJA 2NYXA 3OYLA 4ZDOA 1I5ZA 1UHWA 1JKRC 4A5NA 3KYDB 3A4CA 4BHPA 4AD9A 4BAYA 4A3LJ 1BJZA 3KEYA 5LEKA 3TQNA 1O7FA 1E3OC 5E3OA 1JUSA 1N25A 1Y6IA 3HRUA 1YLFA 4OAYA 1MSEC 3BT9A 3T1BA 3CJRB 2CW8A 2M34A 1G3YA 1A35A 2KPMA 5FD5A 2MD0A 1N77A 4IKFA 1S29A 2A5WA 1WJCA 2K9QA 4QPOA 3DPTA 1FT9A 5A2QZ 4UUVA 4C30A 4D9JA 2KIQA 5EEGA 1XDSA 3DP7A 3VDXA 4XRSG 4MHGA 1X1DA 2D45A 1SFEA 3JREA 2XF6A 1S5LC 3QU3A 1EV7A 2HQ5A 5B66C 4G8XA 1MMDA 4HDUA 1IXSB 2FOWA 2V6EA 1VNDA 1S8NA 2X51A 3IKVA 3BR2A 3M9AA 3OYAA 5JLWA 2QYOA 1YIJI 2UUZA 1PUFB 1ZH5A 1AHDP 1HA8A 1JHHA 5HDGA 2KL4A 4HA8A 5FLXZ 2KIFA 3JSOA 4HEA2 5CVUA 4OIRF 3Q0WA 3FISA 1W7PD 2NNYA 1CGPA 4XM3A 1BC7C 3W2AA 4M6VA 4MIMA 1AWCA 4BUPA 4KN7X 1SAUA 4A12A 4YG2F 5EDNA 3ZMUA 4DNCA 4G7HF 2LKSA 2L02A 3E6CC 1U8RA 2XRLA 4KT5C 3BG9A 3TEDA 4Y7NJ 3WTUC 2E60A 3I9V2 4CCOA 2K4BA 3F8NA 1EA3A 1Y56A 2QQAA 3CF5F 5KHDA 2PJRA 1D1BA 5F04A 4XLHA 4HF1A 1YIOA 3MKWB 2NS0A 2PMUA 3MKLA 3HM5A 3TO6A 4M71A 5FLMJ 4H4KC 3I5UA 2HOTA 1PYVA 1EH6A 3SHFA 4AYBN 1FNNA 2NXNB 1IGNA 3ZGKA 2KT0A 4XIDA 3OYGA 1FOYA 3KP6A 1I39A 3CMMA 4J01A 2FBKA 1G3TA 4PGGA 4A3DJ 2V1XA 2V1DA 4ENMA 3OMYA 4IF4A 4QLCU 4PFOA 2HXIA 3S32A 3J7AO 1MBGA 3IV5A 1W7PA 2DMQA 4DZPA 4FE7A 2KQRA 3BLYA 3F0CA 3CCLI 1IN6A 2QLZA 2JSPA 1LFPA 1OYWA 4PZJA 4CGZA 3R6SA 5IYCJ 3NQOA 5HS7A 4EVIA 1F5TA 3O8GA 4E7JA 1U5TA 2Q1ZB 2Z33A 1B9MA 3ABTA 2BY0A 2OD5A 2X48A 4YFNF 2OZ6A 1W5CC 5EEAA 5FFXA 2HQNA 3HPHA 2W25A 3CESA 3ZP5A 1TC3C 3D0SA 2LR8A 4L9VA 4AWXB 1MNMC 1WJBA 3DTEA 3TDZC 1MJBA 2A3SA 2D1HA 4LD5A 3CCJI 1DGWY 5IOYA 2CQQA 2V1NA 4MFDA 2DPDA 4A6DA 4ZYGA 3LFUA 5D4SA 5LHGA 4HLXA 3FMRA 4HYEA 3KIOA 1Z21A 2EZKA 4HDVA 2Q2EA 3T5XA 3I59B 2BY3A 2FD5A 1LVAA 2CW0F 2BGCA 1WKMA 1WI9A 2Z2SB 2CW7A 2FQ3A 3S17J 1Y39A 5E17F 2HU9A 3DLLF 4G9YA 4BDYA 3PL8A 3HSFA 2R93J 2Q0OA 3CLOA 1CF7B 2C6YA 1T0FC 2BW3B 3GVAA 1TNTA 3SZTA 4I0BA 5EYRA 3BZ6A 2BVLA 2R5ZB 3PJRA 5H2FC 3JW4A 3WTVC 2O03A 4ESBA 1WQ2A 4YEJA 4AIJA 3OYEA 2P4WA 2VPRA 1LE8B 5EF6A 2EIKH 1D5YA 3J80K 2VPLA 4JOMA 3S15J 1P4WA 3LWFA 2RKHA 1OKRA 1TWCJ 4OWRB 4RM2A 2KLOA 2DAOA 2IA1A 2XB5A 2K27A 3A0BC 4LMYA 1VQ9I 4IQJA 1MBJA 2CUEA 5DTDA 3ZMVA 1TW2A 2XPVA 1W36D 2O61A 3OS1A 2R5YB 1OFCX 3HXLA 4XR6A 2BXZA 3CDHA 1USSA 1B6AA 3DFGA 2R7ZJ 1UAAA 1HW1A 2P5VA 3IAS2 4WXCA 1DQUA 2XAQA 3W6VA 3IH4A 2MD5A 4B44A 1T6SA 4A0XA 3BG6A 1C0WA 5CVRA 3E5UA 2KIMA 5JVGF 2R7TA 3F8BA 1V5EA 2KDZA 5LGTA 3J7AY 3IH2A 1B9NA 5J8FA 1VQPI 1MGTA 4LIUA 4IX7A 3OYDA 2R7FA 1FOXA 1EH7A 2DJIA 1BI0A 4AVPA 4BXFA 4QSHA 2M0MA 4XKWA 3HRSA 4M72A 5L3BA 1Z67A 4JQFA 3WGHA 2M4KA 4HW0A 3HEFA 1R1UA 4OIQF 4U0WA 1R1VA 1QU3A 1WVRA 2W4SA 3NEUA 1IN5A 1GT0C 3COAC 1OCRH 2BY2A 1MW7A 1S7EA 1NG7A 1MJ9A 3OIPA 4PSXA 1SANA 3J81K 2L9RA 4XLFA 4XSZF 3J7ZI 3PUFA 2K3FA 5FB2A 1FMVA 2DMNA 1WI3A 5E3NA 3SZGA 5K7ZA 1S7AA 2QGUA 2IW5A 1R58A 3FXOA 4NC8A 3R61A 4PCQA 4UB8C 4M3BA 5IYDJ 4PGHA 2PFBA 2P0WA 1B4AA 1R6RA 3C3WA 3ROUA 5B1AH 5ILVA 3I54A 1XS9A 1JJ8C 2M0CA 2DT6A 1VQNI 2NNNA 2XGEA 5CJ9A 3BZKA 3E3VA 3K4CA 2X1CA 4FX4A 1IRZA 2BE5F 1LDKB 1QVUA 2VXDA 5E1ZB 4L9JA 4P55A 3NARA 3H92A 3K69A 1X3WB 2DK5A 4E70A 3JRBA 2V6CA 3GEZA 2W1OA 2XPUA 5D8KB 5FJ8J 2E36A 1MKMA 2M4GA 2LG4A 2XPWA 1OR7A 1SEUA 4KICA 5EG0A 1I1SA 5CVIA 2YR2A 1VQOI 2HVSA 5LLQA 2RNJA 2VOPA 4CCNA 5D5WB 2VODA 1TLHB 3IUOA 2QA4I 2KP6A 1VQ7I 2OTLI 4WXDA 1T08B 1GXQA 2EFNA 2G7HA 3G1OA 3I58A 1YFHA 4CZCA 1O4XA 3E6DA 4A3CJ 3QOPA 3C1DA 5KCMA 3R4KA 4EEFG 3GTOJ 4IQ4A 1AOYA 2LREA 2E7WA 4LB6B 2E1CA 3LMMA 2P6SA 2TRTA 4A3BJ 1Z3XA 2CFXA 2FE3A 1TWFJ 3QOEA 5K1YA 3KP5A 3S1QJ 1MJAA 4KN4X 1ZRCA 1K83J 4WX9A 4EGYA 1JUPA 1J2XA 4XLCA 1T38A 1KONA 1PVEA 3GTLJ 3LSJA 1UG2A 2ISYA 1DGRM 1IV6A 3CCUI 1VTNC 4ZTFA 1POGA 3JSPA 3C7JA 2XV4S 2A68F 3HL2A 4NB5A 1GVDA 1J59A 2FF4A 1XMXA 3KP2A 5IT9Z 3LAPA 2L7KA 3OS2A 2ZMEA 1UHMA 1VQ4I 4UV9A 1VI0A 5F1JA 5BOXA 3D5RC 2ME6A 3U9GA 1SD4A 3HOXJ 2K9SA 1FY7A 4MQVA 4M73A 1BI2A 1HXDA 3WGIA 2EB7A 2Y0MA 1PP7U 2H8RA 5J3LA 3BR1A 3I4NJ 4P9UA 4AIDA 2KJCA 3NRVA 2JPCA 2XAFA 2BZTA 2MC4A 4RGSA 1UCRA 3H9QA 3M07A 1O57A 5BQTA 3KYLA 2P5KA 5L3GA 3LQRA 5LRRA 4WWCA 2DQRA 2E71A 2F5DA 1D1AA 2E1OA 3P9IA 1WH7A 3HOVJ 3WU2C 3IRRA 3ZN0A 2XAUA 2KDOA 3F6OA 4YFKF 3S3MA 2Y0SN 1APLC 3S14J 4RGRA 1VZ0A 3LSHA 1W5TA 3QPLA 3ZMZA 1SMTA 1KU7A 4Y52J 2YUSA 1W0UA 1SFKA 1Z91A 5DCMA 3G1MA 2ZCWA 2PEXA 3M1EA 2M3AA 5HLIA 3TGNA 2MGQA 2W57A 2ME0A 3F9KA 3BJOA 3K2ZA 3LA2A 2EZLA 3CC2I 3HDDA 3T8RA 3L2CA 1R71A 2OAZA 2ESNA 2L3DA 2QVOA 2W7NA 3F8CA 1Y1WJ 3ZQIA 4PJMA 2X1DA 1REPC 4RGXA 2CV0A 1ZG1A 5ICGA 4N9HA 3OOPA 1ZYRF 3CJQB 4ENKA 1X4PA 3FX3A 2CRGA 4ZJZA 4CHUA 3SYTA 2A6TA 4M9SA 2O5RA 1NK2P 1T39A 4E7LA 3BROA 1WCMJ 2MG4A 3BCBA 1LFUP 2QSGX 2E1NA 4CSWA 2ZXIA 2F48A 3A0HC 4Y4RA 2R3SA 3VPRA 2OCEA 5D5XB 3RI4A 1FTZA 2PMZA 2DJNA 2DK8A 1R5ID 4YIFA 1ZHFA 2W84A 3KE2A 5IP9J 5F64A 1K4TA 4I02A 2PMHA 1ZG5A 2XGXA 2FXAA 4DBQA 2JVHA 3E6BA 4BEHB 3MWMA 4YELA 2KMUA 1JJ6C 3RZDJ 1FP1D 2L0KA 4FISA 3SXYA 1GV2A 1YYVA 1XTAA 4GCVA 1K78A 3IKTA 4KMFA 2JPBA 4DYRA 3DEEA 2LKPA 2W24A 1SVMA 5DM7F 3CDIA 1IRGA 2EINH 4CYCA 2DU9A 1O3SA 1YG2A 2K86A 4BJ6C 1R23A 1ETYA 2K9NA 2ACJA 2X6YA 2DOFA 2WADA 5EJCA 1J5YA 5GAEJ 3JRFA 2X85A 4LOCA 1R5GA 4EV0A 2H1KA 1N78A 2LYCA 1RUOA 1FWZA 2K85A 4QPQA 2XROA 4BBSJ 1RUNA 4I0AA 2FBIA 3GTGJ 3ABMH 4IRHA 1WH5A 3HRTA 3HKZN 1G6NA 3KEOA 2VOOA 3CTAA 2YPRA 4G6QA 3I55I 4ZYAA 3GTKJ 2IGNA 3H3UA 4XLPF 3A03A 1QPMA 3I71A 1DU0A 2EV0A 1TT5B 1D1CA 2K3PA 2VI6A 2L5QA 1FIAA 2LFBA 5EG0B 2IRFG 5B1BH 3L1PA 3BTJA 4G7ZF 2EH3A 1BOAA 5FKLA 2DPUA 2FEZA 2PBIA 2MLGA 2AQEA 3HRMA 1WHUA 2KJBA 5IPAA 3CCVI 1BOBA 4I76A 1SFXA 2H1LA 2CG4A 2DOEA 3Q5FA 1WRJA 3ZQLA 2LLKA 3RKWA 4L5JA 4C2UA 1EJ9A 2ZO4A 1W36C 2EILH 3CP8A 1UFMA 4UNOA 5FO5A 2CU7A 3W6KB 1O3RA 2BV6A 2OQRA 4RMNA 5KNLA 4Y33A 3ECHA 1TW3A 1OMIA 3TL4X 3MMYB 4PJ0C 5FFZA 3GFIA 2HQRA 4U7BA 2X1EA 3FF5A 1ZQ3P 1GHCA 1YS6A 4Q48A 4C2TA 3RJPA 1ENHA 4M3DA 2M8GX 2EA4A 4MFEA 3BWGA 4XN3A 4FT8A 2F5FA 3V7RA 3VWBA 2LK2A 2WV0A 1YQAA 3ULQB 3K2AA 4O3MA 2QBYB 3CF2A 4AYBA 1G59A 1RETA 4KJZA 2LMDA 2X9DA 3V42A 1ONVA 4L0YB 3GFMA 4ITVA 4RA2A 2ZMEB 5F0FA 1MD0A 1TQMA 4LB5A 4NC7A 3WHCA 2NAZA 4IHWA 1DPUA 5J6XA 1JTYA 1ZR4A 4G12A 4BJTA 2HPIA 4MTEA 4RGUA 3CUQC 2WTEA 4DYCA 3F21A 2MYSA 2VKHA 3PQKA 4A3IJ 2EIMH 2O8KA 3CCQI 3BY6A 2ZNZA 2YX7A 3RQ4A 1BI3A 2FRHA 3K70D 3EYIA 2ID6A 2QKLB 5B5EC 2DOAA 4D1QA 2JWTA 1LQ1A 2XVCA 4UVAA 4B47A 1VQMI 2IAIA 1A31A 1JKPC 1X19A 1BA5A 1O3TA 3QPTA 3I4PA 1X1BA 1YOVB 4R8HA 3OYNA 1IRXA 4IOAF 1LVKA 1UJ8A 2ICWG 4HRIA 3B02A 4ZDLA 4S0HB 3K0LA 3B73A 4UV8A 3D1NI 5GTIC 3OR1C 3PNYA 3AL0B 2VJIA 2DMPA 5DCMB 2OTJI 2P81A 4AVZA 1OYYA 4CUGA 1R4MB 4KMUX 4CYDA 2HDCA 2DA7A 4XMYA 4EATA 2LY1A 5IT9K 1N75A 4ZZDA 5JHFA 5M5YJ 1F43A 3HTUA 5HOOA 3RPUD 4BQQA 1BIAA 3O8HA 2Z5UA 1R36A 2KISA 3FMSA 4EM0B 2NRAC 1RPWA 1X1PA 2DA5A 5E8IA 4O6JA 2L7FP 4NQWB 3DEWA 5FROA 4UVCA 3CDLA 4B3AA 5LHIA 3C2HA 3TW7A 3OYHA 1P6RA 4PK4A 3OYMA 1H9GA 4BH9A 1XGOA 3TBIA 3GX4X 1QGPA 2Y31A 1MH3A 1V3FA 1JXSA 2OJED 1ON2A 4A2UA 2JN6A 2HI3A 2EQRA 4R1HA 5K7FA 5DM6F 2EFWA 4FTHA 4X1EA 1LB2A 2DA4A 2DO7A 2E5NA 4XLEA 2NOGA 1HSJA 2VT3A 3MCZA 5DV5A 3ABKH 2R4GA 3DQVC 1LEAA 1STZA 3L7WA 4UUSA 2L54A 1XCBA 1UELB 2FSWA 1MNDA 4BY7J 1X1CA 4J19A 1JGGA 4G7OF 4R79A 2WAQN 1E17A 4LLGF 3RPUA 2ZJQF 1B72A 1ULYA 1BN5A 2MFZA 2UWMA 3VYTB 1VQ8I 2HEOA 4B3XA 4C2MJ 1QBJA 2YX4A 1P4AA 1E0EA 1OCCH 3MZ8A 2XAJA 4D5FA 1A36A 4AIHA 1DP3A 2CYYA 4M6YA 4XSXF 5ERIA 5KAFC 1GXPA 1PDNC 1T95A 1YX5A 1Z6RA 1HOMA 1BJAA 4CCMA 2WC2A 2MLKA 2ZC2A 3ZXSA 2DCEA 4A3GJ 1TQIA 4F3QA 2JA5J 1X58A 2TCTA 1O7LA 3RYPA 4ZH4F 2ZJPF 5BS6A 3ML6A 3HUGB 1IC8A 4WK8F 2IS1A 2N8GA 1P7JA 5AIPA 4MTDA 1ACIA 1XMAA 3E1SA 4HNVA 1TTYA 1ZGJA 2PJPA 3ZQGA 1A6QA 3FK7A 2LC2A 3ABLH 2VC0A 4RB2C 2A05A 2CQXA 2R7SA 1G3WA 1V5GA 4LG3A 2DN0A 4JK1X 2RAEA 4KISA 4KNYA 4IXAA 2DQLA 4BNCA 1UB9A 3FXKA 4KIBA 4ENNA 4MGRA 4UVBA 4ON0A 5JI6A 3FXRA 2K5CA 3RIRA 1VF9A 1LDJA 2EZHA 1YJWI 1T33A 2EFQA 1I50J 4M9XA 1ZTRA 5DUIA 2HGCA 2VBZA 2ELHA 3PM1A 5J4VA 1BW5A 2LRDA 3MQ0A 3LA3A 2F2EA 1Y0NA 2ETHA 3PIOF 1FTTA 2IA2A 2OQGA 2XSDC 2BY1A 2CWEA 3U2RA 1Z7LA 3L00A 1Z9CA 4E6KG 1IXRC 2L4MA 4I7HA 1E2XA
chains in the Genus database with same CATH topology
3TO7A 1ON1A 2LSOA 4U0VA 2HTJA 2ZNYA 5BMZA 2DFIA 5E18F 4GGGA 2GWRA 2RN7A 2HZTA 2DW4A 3O2PE 5CVVA 5KVRA 3V8JA 1IZ1A 1KYWA 2DLLA 4RB3C 3DEUA 1U2WA 2EV5A 3WODF 2H27A 2X4HA 3TKYA 3H3ZA 4EJVA 4Q4ZF 3VODA 3O6BB 5HVQC 2PLYA 2QWWA 3EQLF 2A6EF 2COMA 5E1XA 1FP2A 4XRFA 5DD8A 2HKXA 4A0YA 1I27A 3FXQA 3SQNA 5HDKA 4NHJA 1FBSA 4B09A 5L3EA 3V7CA 2D2WA 4UXNA 2AS5F 3KZZA 2RQPA 2STTA 2Z3YA 3DF8A 1Z7UA 5E20A 2XAGA 3BJAA 1XN7A 2JT1A 4HV6A 4BHBA 2G9WA 1H0MA 3RKYA 4LG0A 1G4DA 3BP8A 4EMSA 2Y48A 2VE9A 2O6GE 1Z6TA 1R7JA 3QAHA 2MH2A 5ILUA 4ZYDA 3LAJA 4HX7A 5LHHA 1QZYA 5H6QA 4BQAA 3CUOA 2PQ8A 3BJ6A 5A2QK 4EJOA 3CUQA 2J5OA 3R60A 3GUDA 5BPDA 1ZG3A 3M7GA 1SFUA 1HBXG 2EV6A 2GAUA 5F6FA 1W7PB 4EJUA 1U78A 3GXOA 5LBQA 3U1DA 1T2KA 2FMYA 4A6EA 1ZRDA 3K9TA 5FLXK 4O5VA 3KLOA 4OU0A 1HSTA 3R0JA 1U5TB 4LK0F 2JSCA 3TOAA 3F8MA 4I01A 2HOEA 3SFZA 5HS8A 1KQ8A 5D5VB 1I6XA 1ZN2A 2Y75A 2HYGD 4A5MA 2EFPA 5ED4A 1XCVA 5AONA 1MDMA 2IPQX 3VOEA 5ICEA 3G3ZA 3O3KA 4PDKA 4M9ZA 4RAZA 4EM1A 2V1UA 1FSEA 3KP3A 4RB1A 4KUMA 1F1ZA 2R7DA 3JTGA 2V79A 2XRNA 2OZUA 2RC4A 3EYYA 1FLIA 1IN8A 2A6HF 2VC1A 2QZ8A 5H6RA 3V8LA 4AIKA 4U0YA 3LQQA 2Z9OA 2VT2A 4ESJA 2FMLA 1XDUA 4WCGA 1Q1HA 1TBXA 4BYYA 5CVJA 3HOTA 1NHAA 1OPCA 3GZ5A 4OINF 2MBFA 3F23A 2IVMA 4P9FA 2Q8KA 2GXBA 1BM9A 4Y17A 1D5VA 4S05A 2WWYA 5J8CA 1ZRFA 2D1VA 1SAXA 1PP8F 3FM3A 3QP5A 1RI7A 2LDUA 2PG4A 5H20A 1Y0UA 4IRGA 3ABUA 3VEPA 1QZZA 3LSTA 1HKSA 3QU6A 4IHTA 1O3QA 2GA1A 1YW7A 5IT3A 3JAMZ 3JTHA 1XGSA 1J9IA 2HR3A 3K1PA 3RPQA 4KA4A 1JE8A 1S3JA 4MNUA 1ZAOA 4CDGA 2H6CA 4Q47A 4GYGA 2M8EA 1A04A 3RKXA 1T0FA 3KP4A 2GZWA 4N9IA 1LJ9A 5D8LB 4BXUA 3P9KA 1X3UA 4CO8A 3Q9SA 1T98A 4HQMA 3F22A 4YIIA 5FGMA 4ENJA 3FWEA 1YS7A 1WSUA 2L4AA 2UZKA 3KFWX 4GXOA 4IJAA 3MAJA 4IRIA 2Z99A 1K79A 2XIGA 1XSDA 4IPAA 1IXCA 3J80Z 3E5QA 2IT0A 1ZLKA 4P96A 4L9TA 4B8XA 4K2EA 4XLNF 1ZLJA 4KDPA 5CYVA 3BOQA 3L09A 2GA2A 1LDDA 1IAWA 4HV5A 3FHZA 2BYVE 1KYZA 5L3FA 3I59A 2FOKA 2ZXJA 1K6OA 2VBWA 2FU4A 3QPHA 3RYRA 1Z1DA 1FPQA 4G94A 3GF2A 2M5WA 3BDDA 3E97A 4L5IA 1IRFA 1TNSA 2ZBKA 3HTSB 2OA4A 2DI3A 1R5HA 3GZ6A 4L9NA 5KK1A 2GQQA 4EQQA 4S04A 4Y15A 1J75A 2UXXA 2L01A 4ASNA 5CLSA 2HWVA 3J81Z 1FYMA 1EH8A 1JGSA 2MC3A 3LFKA 3OV8A 4P5OA 3ECOA 2KKOA 4L0ZB 1BIBA 1DDNA 3T8TA 3IWFA 3R0AA 4FHTA 6PAXA 1IF1A 3MEXA 2QM3A 1XGMA 3IHUA 1K7AA 4N0BA 3CO7C 1FOKA 1L3LA 5FD6A 3GFLA 3REOA 2RGVA 3I0TA 1U6GA 3P7NA 5JR3A 4IHSA 2KIUA 2GXGA 2EWNA 5LGUA 2JRTA 4EM2A 1K78B 3M8EA 3Q9VA 5K5OA 1Z05A 5JHUA 5HDNA 4I09A 4FX0A 1HKQA 5BPIA 3F6VA 1KA8A 4ZYHA 2VBXA 3IWZA 3GW2A 3WTWC 2A69F 2QENA 1B1BA 2P8TA 3QRFF 4HF2A 1ZARA 1KGSA 4HX4A 2RVCA 5D5UB 4JBAA 3EUHA 1D8JA 4F7ZA 4EJWA 3V7SA 4OOIA 3ELKA 2BEOA 1YW9A 3E6MA 3WTZA 1R1TA 3JAMK 5K5QA 3IL2A 3WU1B 1S7OA 4LJZF 3N4MA 1PUEE 3HYIA 1BC8C 3DKWA 3TDUC 2EJRA 3GWZA 5JVTA 1F4KA 1FC3A 2ADUA 2YU3A 4CICA 2XUBA 2CGPA 1FX7A 3F3XA 1W5SA 2RV8A 5AIQA 4WF2A 5DUKA 3GYHX 5D6FA 2YSRA 5DDGA 3K1MA 2O8XA 5ILSA 3LA7A 5K5RA 2FA5A 4RS8A 4I2OA 4YFXF 2M30A 4MQ9F 2GIVA 3FXUA 1KU3A 3DV8A 2K7LA 5DYMA 4HBLA 5E8GA 2P6TA 2F5EA 1F9NA 4HOBA 3WTTC 2ZFWA 5LGNA 3GFJA 4EGZA 1DPRA 2IP2A 3MFKA 4TV7A 1ODDA 1XSXA 1H9TA 4EJTA 4HZFA 4OMZA 4CXFA 4DQ2A 2ISZA 2ESHA 2XKOA 4MEYF 2CQKA 2P5LC 2PI0A 4U88A 4U7DA 2QQBA 3F8FA 1QNTA 1YTYA 3EDPA 2P7VB 1J0RA 3ZMDA 4H0EA 2XKPA 4Z2YA 2LNBA 3T0YA 2M45A 3C18A 2PN6A 2HKOA 2HS5A 4LFUA 1IW7F 1MZBA 2EK5A 3WTSC 1USTA 3TO9A 3QP6A 3DPLC 4ZZLA 4ZYEA 2B0LA 2HTSA 1D3YA 2FNPA 2RDPA 3HHHA 2KRFA 5HS9A 1RNLA 4MEXF 1D8KA 3MZHA 5EEHA 3HSRA 3WE3A 1TQPA 1FZPB 3SZPA 4UHTA 2H94A 1W4MA 5HLHA 1WWXA 3N97A 3G73A 1G3SA 5ICCA 3I53A 2VBYA 2XAHA 1LEBA 3KETA 3PQJA 2ZKZA 2VE8A 1V4RA 5LEJA 1ZREA 2LF8A 3K1NA 4KYWA 2DBBA 4HX8A 1IN7A 3VB2A 3FZVA 3GLXA 3ZQ7A 2QBYA 2CSOA 2H09A 2DTRA 1XB4A 1IUYA 1KQ0A 1GVJA 2VXZA 1R00A 5JFRA 4GO1A 1I1GA 3EETA 2OU2A 1RZ4A 1DUXC 4GYIA 3ZPLA 5DCFA 3RTRA 1DP7P 1XD7A 3HSEA 1RIOH 1QQIA 2JZYA 3CO6C 3KLNA 4LLNA 4M6XA 3CJNA 1FYKA 2STWA 2MH9A 4OIPF 1U3EM 1XMKA 3MZYA 1YW8A 1SD6A 4HAMA 3BPXA 1P2FA 3DXJF 3HHGA 3P9CA 4I98B 3WG9A 3KEQA 1ZGAA 2F5CA 2LF7A 1FSHA 1U5TC 2EA2A 3AAFA 4OMYA 5D6EA 4RB0A 2M87A 3ZMSA 2O0YA 2HFHA 4M74A 3TOBA 2DT5A 3ZMTA 1KQ9A 1B59A 3IC7A 3BPVA 1HW2A 3V8KA 2VONA 1BI1A 3WTXC 1FBUA 2H6BA 2FNAA 1FYLA 2G7UA 4NQWA 3V4GA 4KIGA 1L0OC 3KP7A 1J7KA 4LG0B 2OBPA 3ERED 3WU0A 3D5LA 4Y13A 4D0PA 5L3DA 3WTYC 3E5XA 2QQ9A 3PFIA 3RDIA 2IJLA 3KCCA 2K02A 1XGNA 5E1WA 1P92A 2W85A 1KU9A 2ZJ2A 3F72A 5TJJA 2VN2A 4IVNA 4LLLA 2BBYA 2JTVA 3ISPA 1P4XA 3CUQB 2CO5A 3L9FA 2A61A 5LRSA 5DEQA 5L3CA 2X0LA 2M1BA 2E7XA 4L18B 4WXHA 1R22A 1S6LA 1YO5C 4ETSA 3W6JB 3HUGA 2FBHA 2V9VA 1HW5A 4ESFA 3KZYA 1BBYA 4HLYA 2A5YB 2QUFA 4XBFA 4HQEA 5DD4A 3HOSA 1KU2A 2A07F 1FBQA 2IA0A 1MDMB 1JHFA 2AXLA 2O3FA 4LGWA 1HKTA 5HLGA 4RAYA 2K4JA 3S2WA 1SD7A 2HYFA 2J5PA 3M8FA 2XASA 1SD5A 4HF0A 3HIFA 2P7CB 5TRDA 5D4RA 1CF7A 3ZN1A 4KFCA 4G6DA 3WGGA 1LNWA 4BHCA 4CZZA 1QO0D 2MA3A 3IRQA 4LK1F 3FM5A 2TDXA 3I64A 3GO5A 3WE2A 2UXNA 4Q5SF 4A0ZA 4OIOF 2XHKA 5F1RA 2EFOA 1IN4A 1XSVA 1OYIA 5ICFA 1SMYF 3FMQA 4KIFA 3VFZA 1HQCA 4QWQA 2NYXA 1I5ZA 1UHWA 4A5NA 4BHPA 4AD9A 4BAYA 5LEKA 3TQNA 1O7FA 3HRUA 1YLFA 3T1BA 1G3YA 5FD5A 1S29A 3DPTA 1FT9A 5A2QZ 4UUVA 5EEGA 1XDSA 3DP7A 4MHGA 2D45A 1SFEA 3QU3A 1EV7A 4G8XA 4HDUA 1IXSB 1S8NA 3IKVA 3M9AA 1ZH5A 2QYOA 1JHHA 5HDGA 4HA8A 5FLXZ 2KIFA 3JSOA 5CVUA 4OIRF 1W7PD 2NNYA 1CGPA 1BC7C 1AWCA 4KN7X 4A12A 4YG2F 3ZMUA 4DNCA 4G7HF 2L02A 3E6CC 1U8RA 4KT5C 3WTUC 2K4BA 3F8NA 2QQAA 4HF1A 1YIOA 2NS0A 2PMUA 3TO6A 4M71A 3I5UA 1EH6A 3SHFA 1FNNA 3KP6A 2FBKA 1G3TA 4PGGA 2V1XA 2V1DA 4ENMA 4IF4A 4QLCU 3J7AO 1W7PA 1IN6A 2QLZA 1OYWA 4PZJA 4CGZA 3R6SA 3NQOA 5HS7A 4EVIA 1F5TA 1U5TA 2Z33A 1B9MA 3ABTA 2OD5A 4YFNF 2OZ6A 5FFXA 2HQNA 2W25A 3ZP5A 3D0SA 4L9VA 4AWXB 3TDZC 1MJBA 2A3SA 2D1HA 4LD5A 2DPDA 4A6DA 4ZYGA 5D4SA 5LHGA 4HLXA 3FMRA 4HYEA 4HDVA 2Q2EA 3T5XA 3I59B 1LVAA 2CW0F 2BGCA 1WKMA 1WI9A 2FQ3A 5E17F 4G9YA 3HSFA 2Q0OA 3CLOA 1CF7B 2C6YA 3GVAA 1TNTA 3SZTA 4I0BA 3BZ6A 3JW4A 3WTVC 2O03A 4ESBA 1WQ2A 4AIJA 2P4WA 3J80K 1P4WA 3LWFA 2RKHA 1OKRA 2DAOA 2IA1A 2K27A 4LMYA 3ZMVA 1TW2A 2O61A 3CDHA 1USSA 1B6AA 3DFGA 1HW1A 2P5VA 4WXCA 2XAQA 2MD5A 1T6SA 4A0XA 1C0WA 5CVRA 3E5UA 2KIMA 3F8BA 5LGTA 1B9NA 5J8FA 1MGTA 2R7FA 1EH7A 4AVPA 1BI0A 3HRSA 4M72A 5L3BA 4JQFA 3WGHA 4HW0A 1R1UA 4OIQF 4U0WA 1R1VA 3NEUA 1IN5A 3COAC 1MJ9A 3J81K 4XSZF 5FB2A 1S7AA 2IW5A 1R58A 3R61A 4PCQA 4PGHA 2PFBA 1B4AA 3C3WA 3ROUA 5ILVA 3I54A 2NNNA 5CJ9A 4FX4A 3E3VA 2BE5F 1LDKB 5E1ZB 4L9JA 4P55A 3H92A 3K69A 2DK5A 4E70A 2V6CA 3GEZA 5D8KB 1MKMA 1OR7A 4KICA 1I1SA 5CVIA 2YR2A 2VOPA 5LLQA 2RNJA 5D5WB 2VODA 1TLHB 4WXDA 2EFNA 1GXQA 2G7HA 3I58A 1YFHA 3E6DA 3QOPA 3C1DA 3R4KA 1AOYA 2E7WA 4LB6B 2E1CA 2P6SA 2CFXA 2FE3A 5K1YA 3KP5A 1MJAA 4KN4X 1ZRCA 4WX9A 4EGYA 1J2XA 1T38A 2ISYA 1VTNC 3JSPA 3C7JA 2XV4S 2A68F 4NB5A 1J59A 2FF4A 3KP2A 5IT9Z 3LAPA 2ZMEA 1UHMA 4UV9A 5BOXA 3U9GA 1SD4A 1FY7A 4MQVA 4M73A 1BI2A 1HXDA 3WGIA 2EB7A 2Y0MA 1PP7U 4P9UA 2KJCA 3NRVA 2JPCA 2XAFA 4RGSA 1UCRA 1O57A 5BQTA 2P5KA 5L3GA 3LQRA 5LRRA 4WWCA 2DQRA 2F5DA 3P9IA 3IRRA 3ZN0A 3F6OA 4YFKF 4RGRA 3ZMZA 1W5TA 1SMTA 1KU7A 1Z91A 5DCMA 2ZCWA 2PEXA 3M1EA 5HLIA 3TGNA 2W57A 3BJOA 3K2ZA 3LA2A 3T8RA 3L2CA 2OAZA 2ESNA 2L3DA 2QVOA 3F8CA 1REPC 4RGXA 1ZG1A 5ICGA 4N9HA 3OOPA 1ZYRF 4ENKA 3FX3A 4CHUA 4M9SA 1T39A 3BROA 2E1NA 2R3SA 5D5XB 3RI4A 4YIFA 2DK8A 1ZHFA 2W84A 3KE2A 5F64A 4I02A 2PMHA 1ZG5A 2XGXA 2FXAA 3E6BA 3MWMA 1FP1D 3SXYA 1YYVA 4GCVA 1K78A 3IKTA 4KMFA 2JPBA 2LKPA 2W24A 1IRGA 2DU9A 1O3SA 1YG2A 2K86A 1R23A 2ACJA 1J5YA 1R5GA 4EV0A 1RUOA 1FWZA 2XROA 1RUNA 4I0AA 2FBIA 4IRHA 3HRTA 1G6NA 3KEOA 2VOOA 3CTAA 2YPRA 4G6QA 3H3UA 4XLPF 1QPMA 3I71A 2EV0A 2IRFG 4G7ZF 1BOAA 2DPUA 2FEZA 2PBIA 2MLGA 3HRMA 2KJBA 1SFXA 2CG4A 3Q5FA 1WRJA 3RKWA 4L5JA 2ZO4A 1UFMA 4UNOA 5FO5A 3W6KB 1O3RA 2BV6A 2OQRA 3ECHA 1TW3A 1OMIA 5FFZA 3GFIA 2HQRA 4U7BA 3FF5A 1GHCA 1YS6A 4Q48A 3RJPA 2EA4A 3BWGA 4FT8A 2F5FA 3V7RA 2WV0A 1YQAA 3ULQB 4O3MA 2QBYB 1ONVA 4L0YB 3GFMA 2ZMEB 1MD0A 1TQMA 4LB5A 2NAZA 1DPUA 5J6XA 4MTEA 4RGUA 3CUQC 2WTEA 3F21A 3PQKA 3BY6A 2ZNZA 2YX7A 1BI3A 2FRHA 3EYIA 1LQ1A 2XVCA 4UVAA 1O3TA 3QPTA 3I4PA 4R8HA 3B02A 3K0LA 3B73A 4UV8A 5DCMB 1OYYA 4KMUX 4CYDA 2HDCA 5IT9K 4ZZDA 3HTUA 5HOOA 1BIAA 2Z5UA 1R36A 4EM0B 3FMSA 2NRAC 5E8IA 4O6JA 4UVCA 5LHIA 1P6RA 1H9GA 4BH9A 1XGOA 3GX4X 1QGPA 1V3FA 1JXSA 1ON2A 4A2UA 4R1HA 2EFWA 1LB2A 2DO7A 1HSJA 2VT3A 3MCZA 5DV5A 3L7WA 3DQVC 1LEAA 1STZA 2L54A 1XCBA 2FSWA 4G7OF 4R79A 1E17A 4LLGF 3RPUA 1ULYA 1BN5A 2UWMA 2HEOA 1QBJA 2YX4A 1P4AA 2XAJA 4AIHA 2CYYA 4M6YA 4XSXF 5ERIA 1GXPA 1PDNC 1Z6RA 1BJAA 2WC2A 2MLKA 1TQIA 1O7LA 3RYPA 4ZH4F 5BS6A 3ML6A 4WK8F 5AIPA 4MTDA 1XMAA 1TTYA 1ZGJA 2PJPA 2VC0A 4RB2C 1G3WA 4JK1X 4KNYA 4IXAA 2DQLA 4BNCA 1UB9A 4KIBA 4ENNA 4MGRA 4UVBA 4ON0A 5JI6A 3FXRA 3RIRA 1LDJA 2EFQA 4M9XA 5DUIA 2HGCA 2VBZA 2ELHA 3MQ0A 3LA3A 2F2EA 2ETHA 2IA2A 2OQGA 2CWEA 3U2RA 3L00A 1Z9CA 1IXRC 2L4MA 4I7HA 1E2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TO7 A;  1ON1 A;  2LSO A;  4U0V A;  2HTJ A;  2ZNY A;  5BMZ A;  2DFI A;  5E18 F;  4GGG A;  2GWR A;  2RN7 A;  2HZT A;  2DW4 A;  3O2P E;  5CVV A;  5KVR A;  3V8J A;  1IZ1 A;  1KYW A;  2DLL A;  4RB3 C;  3DEU A;  1U2W A;  2EV5 A;  3WOD F;  2H27 A;  2X4H A;  3TKY A;  3H3Z A;  4EJV A;  4Q4Z F;  3VOD A;  3O6B B;  5HVQ C;  2PLY A;  2QWW A;  3EQL F;  2A6E F;  2COM A;  5E1X A;  1FP2 A;  4XRF A;  5DD8 A;  2HKX A;  4A0Y A;  1I27 A;  3FXQ A;  3SQN A;  5HDK A;  4NHJ A;  1FBS A;  4B09 A;  5L3E A;  3V7C A;  2D2W A;  4UXN A;  2AS5 F;  3KZZ A;  2RQP A;  2STT A;  2Z3Y A;  3DF8 A;  1Z7U A;  5E20 A;  2XAG A;  3BJA A;  1XN7 A;  2JT1 A;  4HV6 A;  4BHB A;  2G9W A;  1H0M A;  3RKY A;  4LG0 A;  1G4D A;  3BP8 A;  4EMS A;  2Y48 A;  2VE9 A;  2O6G E;  1Z6T A;  1R7J A;  3QAH A;  2MH2 A;  5ILU A;  4ZYD A;  3LAJ A;  4HX7 A;  5LHH A;  1QZY A;  5H6Q A;  4BQA A;  3CUO A;  2PQ8 A;  3BJ6 A;  5A2Q K;  4EJO A;  3CUQ A;  2J5O A;  3R60 A;  3GUD A;  5BPD A;  1ZG3 A;  3M7G A;  1SFU A;  1HBX G;  2EV6 A;  2GAU A;  5F6F A;  1W7P B;  4EJU A;  1U78 A;  3GXO A;  5LBQ A;  3U1D A;  1T2K A;  2FMY A;  4A6E A;  1ZRD A;  3K9T A;  5FLX K;  4O5V A;  3KLO A;  4OU0 A;  1HST A;  3R0J A;  1U5T B;  4LK0 F;  2JSC A;  3TOA A;  3F8M A;  4I01 A;  2HOE A;  3SFZ A;  5HS8 A;  1KQ8 A;  5D5V B;  1I6X A;  1ZN2 A;  2Y75 A;  2HYG D;  4A5M A;  2EFP A;  5ED4 A;  1XCV A;  5AON A;  1MDM A;  2IPQ X;  3VOE A;  5ICE A;  3G3Z A;  3O3K A;  4PDK A;  4M9Z A;  4RAZ A;  4EM1 A;  2V1U A;  1FSE A;  3KP3 A;  4RB1 A;  4KUM A;  1F1Z A;  2R7D A;  3JTG A;  2V79 A;  2XRN A;  2OZU A;  2RC4 A;  3EYY A;  1FLI A;  1IN8 A;  2A6H F;  2VC1 A;  2QZ8 A;  5H6R A;  3V8L A;  4AIK A;  4U0Y A;  3LQQ A;  2Z9O A;  2VT2 A;  4ESJ A;  2FML A;  1XDU A;  4WCG A;  1Q1H A;  1TBX A;  4BYY A;  5CVJ A;  3HOT A;  1NHA A;  1OPC A;  3GZ5 A;  4OIN F;  2MBF A;  3F23 A;  2IVM A;  4P9F A;  2Q8K A;  2GXB A;  1BM9 A;  4Y17 A;  1D5V A;  4S05 A;  2WWY A;  5J8C A;  1ZRF A;  2D1V A;  1SAX A;  1PP8 F;  3FM3 A;  3QP5 A;  1RI7 A;  2LDU A;  2PG4 A;  5H20 A;  1Y0U A;  4IRG A;  3ABU A;  3VEP A;  1QZZ A;  3LST A;  1HKS A;  3QU6 A;  4IHT A;  1O3Q A;  2GA1 A;  1YW7 A;  5IT3 A;  3JAM Z;  3JTH A;  1XGS A;  1J9I A;  2HR3 A;  3K1P A;  3RPQ A;  4KA4 A;  1JE8 A;  1S3J A;  4MNU A;  1ZAO A;  4CDG A;  2H6C A;  4Q47 A;  4GYG A;  2M8E A;  1A04 A;  3RKX A;  1T0F A;  3KP4 A;  2GZW A;  4N9I A;  1LJ9 A;  5D8L B;  4BXU A;  3P9K A;  1X3U A;  4CO8 A;  3Q9S A;  1T98 A;  4HQM A;  3F22 A;  4YII A;  5FGM A;  4ENJ A;  3FWE A;  1YS7 A;  1WSU A;  2L4A A;  2UZK A;  3KFW X;  4GXO A;  4IJA A;  3MAJ A;  4IRI A;  2Z99 A;  1K79 A;  2XIG A;  1XSD A;  4IPA A;  1IXC A;  3J80 Z;  3E5Q A;  2IT0 A;  1ZLK A;  4P96 A;  4L9T A;  4B8X A;  4K2E A;  4XLN F;  1ZLJ A;  4KDP A;  5CYV A;  3BOQ A;  3L09 A;  2GA2 A;  1LDD A;  1IAW A;  4HV5 A;  3FHZ A;  2BYV E;  1KYZ A;  5L3F A;  3I59 A;  2FOK A;  2ZXJ A;  1K6O A;  2VBW A;  2FU4 A;  3QPH A;  3RYR A;  1Z1D A;  1FPQ A;  4G94 A;  3GF2 A;  2M5W A;  3BDD A;  3E97 A;  4L5I A;  1IRF A;  1TNS A;  2ZBK A;  3HTS B;  2OA4 A;  2DI3 A;  1R5H A;  3GZ6 A;  4L9N A;  5KK1 A;  2GQQ A;  4EQQ A;  4S04 A;  4Y15 A;  1J75 A;  2UXX A;  2L01 A;  4ASN A;  5CLS A;  2HWV A;  3J81 Z;  1FYM A;  1EH8 A;  1JGS A;  2MC3 A;  3LFK A;  3OV8 A;  4P5O A;  3ECO A;  2KKO A;  4L0Z B;  1BIB A;  1DDN A;  3T8T A;  3IWF A;  3R0A A;  4FHT A;  6PAX A;  1IF1 A;  3MEX A;  2QM3 A;  1XGM A;  3IHU A;  1K7A A;  4N0B A;  3CO7 C;  1FOK A;  1L3L A;  5FD6 A;  3GFL A;  3REO A;  2RGV A;  3I0T A;  1U6G A;  3P7N A;  5JR3 A;  4IHS A;  2KIU A;  2GXG A;  2EWN A;  5LGU A;  2JRT A;  4EM2 A;  1K78 B;  3M8E A;  3Q9V A;  5K5O A;  1Z05 A;  5JHU A;  5HDN A;  4I09 A;  4FX0 A;  1HKQ A;  5BPI A;  3F6V A;  1KA8 A;  4ZYH A;  2VBX A;  3IWZ A;  3GW2 A;  3WTW C;  2A69 F;  2QEN A;  1B1B A;  2P8T A;  3QRF F;  4HF2 A;  1ZAR A;  1KGS A;  4HX4 A;  2RVC A;  5D5U B;  4JBA A;  3EUH A;  1D8J A;  4F7Z A;  4EJW A;  3V7S A;  4OOI A;  3ELK A;  2BEO A;  1YW9 A;  3E6M A;  3WTZ A;  1R1T A;  3JAM K;  5K5Q A;  3IL2 A;  3WU1 B;  1S7O A;  4LJZ F;  3N4M A;  1PUE E;  3HYI A;  1BC8 C;  3DKW A;  3TDU C;  2EJR A;  3GWZ A;  5JVT A;  1F4K A;  1FC3 A;  2ADU A;  2YU3 A;  4CIC A;  2XUB A;  2CGP A;  1FX7 A;  3F3X A;  1W5S A;  2RV8 A;  5AIQ A;  4WF2 A;  5DUK A;  3GYH X;  5D6F A;  2YSR A;  5DDG A;  3K1M A;  2O8X A;  5ILS A;  3LA7 A;  5K5R A;  2FA5 A;  4RS8 A;  4I2O A;  4YFX F;  2M30 A;  4MQ9 F;  2GIV A;  3FXU A;  1KU3 A;  3DV8 A;  2K7L A;  5DYM A;  4HBL A;  5E8G A;  2P6T A;  2F5E A;  1F9N A;  4HOB A;  3WTT C;  2ZFW A;  5LGN A;  3GFJ A;  4EGZ A;  1DPR A;  2IP2 A;  3MFK A;  4TV7 A;  1ODD A;  1XSX A;  1H9T A;  4EJT A;  4HZF A;  4OMZ A;  4CXF A;  4DQ2 A;  2ISZ A;  2ESH A;  2XKO A;  4MEY F;  2CQK A;  2P5L C;  2PI0 A;  4U88 A;  4U7D A;  2QQB A;  3F8F A;  1QNT A;  1YTY A;  3EDP A;  2P7V B;  1J0R A;  3ZMD A;  4H0E A;  2XKP A;  4Z2Y A;  2LNB A;  3T0Y A;  2M45 A;  3C18 A;  2PN6 A;  2HKO A;  2HS5 A;  4LFU A;  1IW7 F;  1MZB A;  2EK5 A;  3WTS C;  1UST A;  3TO9 A;  3QP6 A;  3DPL C;  4ZZL A;  4ZYE A;  2B0L A;  2HTS A;  1D3Y A;  2FNP A;  2RDP A;  3HHH A;  2KRF A;  5HS9 A;  1RNL A;  4MEX F;  1D8K A;  3MZH A;  5EEH A;  3HSR A;  3WE3 A;  1TQP A;  1FZP B;  3SZP A;  4UHT A;  2H94 A;  1W4M A;  5HLH A;  1WWX A;  3N97 A;  3G73 A;  1G3S A;  5ICC A;  3I53 A;  2VBY A;  2XAH A;  1LEB A;  3KET A;  3PQJ A;  2ZKZ A;  2VE8 A;  1V4R A;  5LEJ A;  1ZRE A;  2LF8 A;  3K1N A;  4KYW A;  2DBB A;  4HX8 A;  1IN7 A;  3VB2 A;  3FZV A;  3GLX A;  3ZQ7 A;  2QBY A;  2CSO A;  2H09 A;  2DTR A;  1XB4 A;  1IUY A;  1KQ0 A;  1GVJ A;  2VXZ A;  1R00 A;  5JFR A;  4GO1 A;  1I1G A;  3EET A;  2OU2 A;  1RZ4 A;  1DUX C;  4GYI A;  3ZPL A;  5DCF A;  3RTR A;  1DP7 P;  1XD7 A;  3HSE A;  1RIO H;  1QQI A;  2JZY A;  3CO6 C;  3KLN A;  4LLN A;  4M6X A;  3CJN A;  1FYK A;  2STW A;  2MH9 A;  4OIP F;  1U3E M;  1XMK A;  3MZY A;  1YW8 A;  1SD6 A;  4HAM A;  3BPX A;  1P2F A;  3DXJ F;  3HHG A;  3P9C A;  4I98 B;  3WG9 A;  3KEQ A;  1ZGA A;  2F5C A;  2LF7 A;  1FSH A;  1U5T C;  2EA2 A;  3AAF A;  4OMY A;  5D6E A;  4RB0 A;  2M87 A;  3ZMS A;  2O0Y A;  2HFH A;  4M74 A;  3TOB A;  2DT5 A;  3ZMT A;  1KQ9 A;  1B59 A;  3IC7 A;  3BPV A;  1HW2 A;  3V8K A;  2VON A;  1BI1 A;  3WTX C;  1FBU A;  2H6B A;  2FNA A;  1FYL A;  2G7U A;  4NQW A;  3V4G A;  4KIG A;  1L0O C;  3KP7 A;  1J7K A;  4LG0 B;  2OBP A;  3ERE D;  3WU0 A;  3D5L A;  4Y13 A;  4D0P A;  5L3D A;  3WTY C;  3E5X A;  2QQ9 A;  3PFI A;  3RDI A;  2IJL A;  3KCC A;  2K02 A;  1XGN A;  5E1W A;  1P92 A;  2W85 A;  1KU9 A;  2ZJ2 A;  3F72 A;  5TJJ A;  2VN2 A;  4IVN A;  4LLL A;  2BBY A;  2JTV A;  3ISP A;  1P4X A;  3CUQ B;  2CO5 A;  3L9F A;  2A61 A;  5LRS A;  5DEQ A;  5L3C A;  2X0L A;  2M1B A;  2E7X A;  4L18 B;  4WXH A;  1R22 A;  1S6L A;  1YO5 C;  4ETS A;  3W6J B;  3HUG A;  2FBH A;  2V9V A;  1HW5 A;  4ESF A;  3KZY A;  1BBY A;  4HLY A;  2A5Y B;  2QUF A;  4XBF A;  4HQE A;  5DD4 A;  3HOS A;  1KU2 A;  2A07 F;  1FBQ A;  2IA0 A;  1MDM B;  1JHF A;  2AXL A;  2O3F A;  4LGW A;  1HKT A;  5HLG A;  4RAY A;  2K4J A;  3S2W A;  1SD7 A;  2HYF A;  2J5P A;  3M8F A;  2XAS A;  1SD5 A;  4HF0 A;  3HIF A;  2P7C B;  5TRD A;  5D4R A;  1CF7 A;  3ZN1 A;  4KFC A;  4G6D A;  3WGG A;  1LNW A;  4BHC A;  4CZZ A;  1QO0 D;  2MA3 A;  3IRQ A;  4LK1 F;  3FM5 A;  2TDX A;  3I64 A;  3GO5 A;  3WE2 A;  2UXN A;  4Q5S F;  4A0Z A;  4OIO F;  2XHK A;  5F1R A;  2EFO A;  1IN4 A;  1XSV A;  1OYI A;  5ICF A;  1SMY F;  3FMQ A;  4KIF A;  3VFZ A;  1HQC A;  4QWQ A;  2NYX A;  1I5Z A;  1UHW A;  4A5N A;  4BHP A;  4AD9 A;  4BAY A;  5LEK A;  3TQN A;  1O7F A;  3HRU A;  1YLF A;  3T1B A;  1G3Y A;  5FD5 A;  1S29 A;  3DPT A;  1FT9 A;  5A2Q Z;  4UUV A;  5EEG A;  1XDS A;  3DP7 A;  4MHG A;  2D45 A;  1SFE A;  3QU3 A;  1EV7 A;  4G8X A;  4HDU A;  1IXS B;  1S8N A;  3IKV A;  3M9A A;  1ZH5 A;  2QYO A;  1JHH A;  5HDG A;  4HA8 A;  5FLX Z;  2KIF A;  3JSO A;  5CVU A;  4OIR F;  1W7P D;  2NNY A;  1CGP A;  1BC7 C;  1AWC A;  4KN7 X;  4A12 A;  4YG2 F;  3ZMU A;  4DNC A;  4G7H F;  2L02 A;  3E6C C;  1U8R A;  4KT5 C;  3WTU C;  2K4B A;  3F8N A;  2QQA A;  4HF1 A;  1YIO A;  2NS0 A;  2PMU A;  3TO6 A;  4M71 A;  3I5U A;  1EH6 A;  3SHF A;  1FNN A;  3KP6 A;  2FBK A;  1G3T A;  4PGG A;  2V1X A;  2V1D A;  4ENM A;  4IF4 A;  4QLC U;  3J7A O;  1W7P A;  1IN6 A;  2QLZ A;  1OYW A;  4PZJ A;  4CGZ A;  3R6S A;  3NQO A;  5HS7 A;  4EVI A;  1F5T A;  1U5T A;  2Z33 A;  1B9M A;  3ABT A;  2OD5 A;  4YFN F;  2OZ6 A;  5FFX A;  2HQN A;  2W25 A;  3ZP5 A;  3D0S A;  4L9V A;  4AWX B;  3TDZ C;  1MJB A;  2A3S A;  2D1H A;  4LD5 A;  2DPD A;  4A6D A;  4ZYG A;  5D4S A;  5LHG A;  4HLX A;  3FMR A;  4HYE A;  4HDV A;  2Q2E A;  3T5X A;  3I59 B;  1LVA A;  2CW0 F;  2BGC A;  1WKM A;  1WI9 A;  2FQ3 A;  5E17 F;  4G9Y A;  3HSF A;  2Q0O A;  3CLO A;  1CF7 B;  2C6Y A;  3GVA A;  1TNT A;  3SZT A;  4I0B A;  3BZ6 A;  3JW4 A;  3WTV C;  2O03 A;  4ESB A;  1WQ2 A;  4AIJ A;  2P4W A;  3J80 K;  1P4W A;  3LWF A;  2RKH A;  1OKR A;  2DAO A;  2IA1 A;  2K27 A;  4LMY A;  3ZMV A;  1TW2 A;  2O61 A;  3CDH A;  1USS A;  1B6A A;  3DFG A;  1HW1 A;  2P5V A;  4WXC A;  2XAQ A;  2MD5 A;  1T6S A;  4A0X A;  1C0W A;  5CVR A;  3E5U A;  2KIM A;  3F8B A;  5LGT A;  1B9N A;  5J8F A;  1MGT A;  2R7F A;  1EH7 A;  4AVP A;  1BI0 A;  3HRS A;  4M72 A;  5L3B A;  4JQF A;  3WGH A;  4HW0 A;  1R1U A;  4OIQ F;  4U0W A;  1R1V A;  3NEU A;  1IN5 A;  3COA C;  1MJ9 A;  3J81 K;  4XSZ F;  5FB2 A;  1S7A A;  2IW5 A;  1R58 A;  3R61 A;  4PCQ A;  4PGH A;  2PFB A;  1B4A A;  3C3W A;  3ROU A;  5ILV A;  3I54 A;  2NNN A;  5CJ9 A;  4FX4 A;  3E3V A;  2BE5 F;  1LDK B;  5E1Z B;  4L9J A;  4P55 A;  3H92 A;  3K69 A;  2DK5 A;  4E70 A;  2V6C A;  3GEZ A;  5D8K B;  1MKM A;  1OR7 A;  4KIC A;  1I1S A;  5CVI A;  2YR2 A;  2VOP A;  5LLQ A;  2RNJ A;  5D5W B;  2VOD A;  1TLH B;  4WXD A;  2EFN A;  1GXQ A;  2G7H A;  3I58 A;  1YFH A;  3E6D A;  3QOP A;  3C1D A;  3R4K A;  1AOY A;  2E7W A;  4LB6 B;  2E1C A;  2P6S A;  2CFX A;  2FE3 A;  5K1Y A;  3KP5 A;  1MJA A;  4KN4 X;  1ZRC A;  4WX9 A;  4EGY A;  1J2X A;  1T38 A;  2ISY A;  1VTN C;  3JSP A;  3C7J A;  2XV4 S;  2A68 F;  4NB5 A;  1J59 A;  2FF4 A;  3KP2 A;  5IT9 Z;  3LAP A;  2ZME A;  1UHM A;  4UV9 A;  5BOX A;  3U9G A;  1SD4 A;  1FY7 A;  4MQV A;  4M73 A;  1BI2 A;  1HXD A;  3WGI A;  2EB7 A;  2Y0M A;  1PP7 U;  4P9U A;  2KJC A;  3NRV A;  2JPC A;  2XAF A;  4RGS A;  1UCR A;  1O57 A;  5BQT A;  2P5K A;  5L3G A;  3LQR A;  5LRR A;  4WWC A;  2DQR A;  2F5D A;  3P9I A;  3IRR A;  3ZN0 A;  3F6O A;  4YFK F;  4RGR A;  3ZMZ A;  1W5T A;  1SMT A;  1KU7 A;  1Z91 A;  5DCM A;  2ZCW A;  2PEX A;  3M1E A;  5HLI A;  3TGN A;  2W57 A;  3BJO A;  3K2Z A;  3LA2 A;  3T8R A;  3L2C A;  2OAZ A;  2ESN A;  2L3D A;  2QVO A;  3F8C A;  1REP C;  4RGX A;  1ZG1 A;  5ICG A;  4N9H A;  3OOP A;  1ZYR F;  4ENK A;  3FX3 A;  4CHU A;  4M9S A;  1T39 A;  3BRO A;  2E1N A;  2R3S A;  5D5X B;  3RI4 A;  4YIF A;  2DK8 A;  1ZHF A;  2W84 A;  3KE2 A;  5F64 A;  4I02 A;  2PMH A;  1ZG5 A;  2XGX A;  2FXA A;  3E6B A;  3MWM A;  1FP1 D;  3SXY A;  1YYV A;  4GCV A;  1K78 A;  3IKT A;  4KMF A;  2JPB A;  2LKP A;  2W24 A;  1IRG A;  2DU9 A;  1O3S A;  1YG2 A;  2K86 A;  1R23 A;  2ACJ A;  1J5Y A;  1R5G A;  4EV0 A;  1RUO A;  1FWZ A;  2XRO A;  1RUN A;  4I0A A;  2FBI A;  4IRH A;  3HRT A;  1G6N A;  3KEO A;  2VOO A;  3CTA A;  2YPR A;  4G6Q A;  3H3U A;  4XLP F;  1QPM A;  3I71 A;  2EV0 A;  2IRF G;  4G7Z F;  1BOA A;  2DPU A;  2FEZ A;  2PBI A;  2MLG A;  3HRM A;  2KJB A;  1SFX A;  2CG4 A;  3Q5F A;  1WRJ A;  3RKW A;  4L5J A;  2ZO4 A;  1UFM A;  4UNO A;  5FO5 A;  3W6K B;  1O3R A;  2BV6 A;  2OQR A;  3ECH A;  1TW3 A;  1OMI A;  5FFZ A;  3GFI A;  2HQR A;  4U7B A;  3FF5 A;  1GHC A;  1YS6 A;  4Q48 A;  3RJP A;  2EA4 A;  3BWG A;  4FT8 A;  2F5F A;  3V7R A;  2WV0 A;  1YQA A;  3ULQ B;  4O3M A;  2QBY B;  1ONV A;  4L0Y B;  3GFM A;  2ZME B;  1MD0 A;  1TQM A;  4LB5 A;  2NAZ A;  1DPU A;  5J6X A;  4MTE A;  4RGU A;  3CUQ C;  2WTE A;  3F21 A;  3PQK A;  3BY6 A;  2ZNZ A;  2YX7 A;  1BI3 A;  2FRH A;  3EYI A;  1LQ1 A;  2XVC A;  4UVA A;  1O3T A;  3QPT A;  3I4P A;  4R8H A;  3B02 A;  3K0L A;  3B73 A;  4UV8 A;  5DCM B;  1OYY A;  4KMU X;  4CYD A;  2HDC A;  5IT9 K;  4ZZD A;  3HTU A;  5HOO A;  1BIA A;  2Z5U A;  1R36 A;  4EM0 B;  3FMS A;  2NRA C;  5E8I A;  4O6J A;  4UVC A;  5LHI A;  1P6R A;  1H9G A;  4BH9 A;  1XGO A;  3GX4 X;  1QGP A;  1V3F A;  1JXS A;  1ON2 A;  4A2U A;  4R1H A;  2EFW A;  1LB2 A;  2DO7 A;  1HSJ A;  2VT3 A;  3MCZ A;  5DV5 A;  3L7W A;  3DQV C;  1LEA A;  1STZ A;  2L54 A;  1XCB A;  2FSW A;  4G7O F;  4R79 A;  1E17 A;  4LLG F;  3RPU A;  1ULY A;  1BN5 A;  2UWM A;  2HEO A;  1QBJ A;  2YX4 A;  1P4A A;  2XAJ A;  4AIH A;  2CYY A;  4M6Y A;  4XSX F;  5ERI A;  1GXP A;  1PDN C;  1Z6R A;  1BJA A;  2WC2 A;  2MLK A;  1TQI A;  1O7L A;  3RYP A;  4ZH4 F;  5BS6 A;  3ML6 A;  4WK8 F;  5AIP A;  4MTD A;  1XMA A;  1TTY A;  1ZGJ A;  2PJP A;  2VC0 A;  4RB2 C;  1G3W A;  4JK1 X;  4KNY A;  4IXA A;  2DQL A;  4BNC A;  1UB9 A;  4KIB A;  4ENN A;  4MGR A;  4UVB A;  4ON0 A;  5JI6 A;  3FXR A;  3RIR A;  1LDJ A;  2EFQ A;  4M9X A;  5DUI A;  2HGC A;  2VBZ A;  2ELH A;  3MQ0 A;  3LA3 A;  2F2E A;  2ETH A;  2IA2 A;  2OQG A;  2CWE A;  3U2R A;  3L00 A;  1Z9C A;  1IXR C;  2L4M A;  4I7H A;  1E2X A; 
#chains in the Genus database with same CATH topology
 3H0D A;  5FRN A;  3TO7 A;  1ON1 A;  2LSO A;  1FMW A;  3DWL E;  4U0V A;  3G6E I;  1HLV A;  2HTJ A;  4A69 C;  1FOW A;  2PX9 A;  2ZNY A;  5BMZ A;  2DFI A;  4XOR A;  3LNQ A;  3WG7 H;  5E18 F;  4GGG A;  2GWR A;  3JR9 A;  2RN7 A;  5GAG J;  2HZT A;  2DW4 A;  3O2P E;  2H8W A;  3S93 A;  3VSK A;  2DOD A;  2JVG A;  5CVV A;  5KVR A;  3LSM A;  1ETO A;  3H5A A;  5E3L A;  1ETW A;  3V8J A;  1IZ1 A;  1KYW A;  2DLL A;  5B3S H;  4RB3 C;  3DEU A;  1U2W A;  2EV5 A;  3OWT A;  3WOD F;  2H27 A;  3H9G A;  3PUB A;  2X4H A;  2JMW A;  2KZV A;  3HG9 A;  1NH3 A;  3TKY A;  2DFE A;  3H3Z A;  3OIQ A;  2GBY A;  4EJV A;  3K7A J;  1LFB A;  1DU6 A;  1R9T J;  3KZI C;  2ECB A;  4Q4Z F;  3BR5 A;  4N4O B;  3VOD A;  3O6B B;  3SJM A;  5HVQ C;  2COB A;  1Q1V A;  2PLY A;  4RLQ A;  2NOJ B;  2QWW A;  3EQL F;  2A6E F;  2COM A;  5E1X A;  3QWL A;  2DT7 B;  1ETV A;  1FP2 A;  3ZQC A;  1QA6 A;  3RKQ A;  1MMN A;  2DXI A;  4XRF A;  5DD8 A;  4C3I J;  1P9Q C;  2HKX A;  5F0H A;  3QPS A;  1D0Z A;  2OF7 A;  3DBR B;  4A0Y A;  3ZQF A;  1AKH A;  1X3Z B;  1I27 A;  3FXQ A;  3X2Q H;  3SQN A;  5J47 A;  5HDK A;  4NHJ A;  1FBS A;  3KYC B;  3K4N A;  4B09 A;  5L3E A;  5J1Y A;  3V7C A;  2O7O A;  5J4Y A;  2D2W A;  1OCO H;  4BXX J;  4UXN A;  2AS5 F;  3KZZ A;  3NWS A;  2RQP A;  4A3E J;  2STT A;  2NVT J;  2Z3Y A;  3DF8 A;  1Z7U A;  1R49 A;  3GME A;  5E20 A;  3BCA A;  5FKO A;  3PNT A;  2R92 J;  2V9P A;  2XSJ C;  2AQF A;  2XAG A;  2EPF A;  1MIJ A;  3FHN A;  3BJA A;  5M3F J;  2HOA A;  2V4J C;  1XN7 A;  2JT1 A;  4HV6 A;  4BHB A;  2G9W A;  1H0M A;  2RNG A;  3RKY A;  3H1C A;  4F93 B;  1WZ2 A;  4LG0 A;  1G4D A;  2Y0S A;  2Y2Z A;  4IOC F;  3JRA A;  3I56 I;  3BP8 A;  1Z77 A;  4EMS A;  2Y48 A;  2VE9 A;  1RRJ A;  2O6G E;  4MLO A;  1Z6T A;  1R7J A;  4CH7 A;  2ELJ A;  4HG2 A;  3QAH A;  4UUS B;  2MH2 A;  5LD2 C;  2DA2 A;  2I8D A;  3DKY A;  5JLX A;  3M3Y J;  5ILU A;  3PSF A;  4ZYD A;  3LAJ A;  2PJR B;  1UZC A;  1QPI A;  4HX7 A;  3VYU B;  5LHH A;  4C3H J;  4ANJ A;  1QZY A;  5H6Q A;  1JT0 A;  3G2B A;  5GTH C;  4BQA A;  3CUO A;  2L7M P;  2PQ8 A;  3BJ6 A;  3ZQH A;  5A2Q K;  4EJO A;  3CUQ A;  3BG7 A;  2J5O A;  1MSF C;  1I3Q J;  2KZG A;  1B8I A;  2DYR H;  5C3E J;  3R60 A;  3GUD A;  5BPD A;  2VQC A;  1ZG3 A;  3M7G A;  1SFU A;  2I5U A;  3CP2 A;  5J1U A;  2QF7 A;  3OYF A;  1HBX G;  3ASN H;  2EV6 A;  1YRN A;  2YS9 A;  1MH4 A;  3OYB A;  2GAU A;  1P7I A;  2WY8 Q;  5F6F A;  1W7P B;  4EJU A;  3M4O J;  1U78 A;  3GXO A;  2CUJ A;  3K70 C;  4RAF A;  1ORK A;  1Y1V J;  2W00 A;  5LBQ A;  3U1D A;  1T2K A;  2FMY A;  4A6E A;  1ZRD A;  3K9T A;  5FLX K;  4O5V A;  3KLO A;  2JA2 A;  4OU0 A;  5BNG A;  4RM3 A;  1HST A;  3R0J A;  1U5T B;  4LK0 F;  2JSC A;  3TOA A;  3F8M A;  2VKD A;  4I01 A;  2HOE A;  3SFZ A;  5HS8 A;  3CMA I;  3CC7 I;  1E3H A;  1KQ8 A;  5D5V B;  1I6X A;  1ZN2 A;  2AXT C;  4GRI A;  3CMY A;  2Y75 A;  3OY9 A;  2HYG D;  2ZSH B;  2FUG 2;  3CCY A;  3HOZ J;  4A5M A;  2EFP A;  5ED4 A;  1XCV A;  1OLT A;  3EUK L;  5AON A;  1OQY A;  1MDM A;  2IPQ X;  2Q2E B;  3VOE A;  5ICE A;  3G3Z A;  3HKZ A;  4RAG A;  4BQN A;  3DKX A;  3O3K A;  3L2Q A;  2KFD A;  4PDK A;  4A3K J;  4M9Z A;  2BHY A;  4RAZ A;  4EM1 A;  2V1U A;  1FSE A;  3KP3 A;  3BR0 A;  4RB1 A;  2VB6 A;  1MMG A;  4KUM A;  1F1Z A;  4PSW A;  2R7D A;  3U1K A;  4HST A;  3JTG A;  2V79 A;  3CC4 I;  2XRN A;  2OZU A;  2XB0 X;  1W1W E;  2RC4 A;  3ASO H;  3EYY A;  3FXJ A;  1WJE A;  5F08 A;  4XKB A;  1OIS A;  3S1N J;  1FLI A;  1IN8 A;  3PFY A;  2A6H F;  1BR4 A;  2VC1 A;  4X0G A;  2Y9Y A;  3EUH C;  2QZ8 A;  5H6R A;  3V8L A;  4AIK A;  5CQE A;  2DFH A;  4U0Y A;  3LQQ A;  2Z9O A;  2VT2 A;  4FET A;  4ESJ A;  2FML A;  3FXM A;  2IGO A;  3HOY J;  1XDU A;  2VLA A;  4WCG A;  1YE9 A;  5EGO A;  1ZR2 A;  1JKQ C;  1Q1H A;  4XIC A;  1TBX A;  2M7A A;  4BYY A;  2NS8 A;  2CUZ A;  2LY2 A;  3HGG A;  5CVJ A;  3HOT A;  1NHA A;  1XPX A;  4JYK A;  1UG0 A;  1OPC A;  4C9Y A;  3GZ5 A;  4OIN F;  2MBF A;  4YRV A;  2DA3 A;  3F23 A;  5IOZ A;  3BZC A;  2IVM A;  4P9F A;  2GOX B;  4XOT A;  2Q8K A;  2GXB A;  1BM9 A;  4V2F A;  2L7Z A;  4Y17 A;  1YI2 I;  3PSI A;  2IS2 A;  1D5V A;  4B43 A;  4S05 A;  2WWY A;  3UNG C;  4HSR A;  5HLT A;  5J8C A;  2CQN A;  1H89 C;  1ZRF A;  2GLO A;  2D1V A;  3A02 A;  1SAX A;  2FQ4 A;  3FM3 A;  5HOD A;  4I6Z A;  1PP8 F;  3QP5 A;  3HC7 A;  1RI7 A;  2LDU A;  2PG4 A;  1AKH B;  5H20 A;  1Y0U A;  4IRG A;  2ZB9 A;  3ABU A;  2L2O A;  3VEP A;  1QZZ A;  4BGD A;  2VKE A;  4XOP A;  3LST A;  1HKS A;  3QU6 A;  4IHT A;  1O3Q A;  3CJT B;  4IL6 C;  2M7B A;  2GA1 A;  1UMQ A;  1YW7 A;  5IT3 A;  3JAM Z;  3QQA A;  3JTH A;  1XGS A;  4DJA A;  2W82 A;  1J9I A;  2HR3 A;  3K1P A;  3TP0 A;  1YX3 A;  3RPQ A;  3G4S I;  1WFX A;  4KA4 A;  1JE8 A;  1S3J A;  4MNU A;  1ZAO A;  4CDG A;  1PUF A;  1QVT A;  4LIT A;  2DMT A;  2H6C A;  3UKG A;  5LFA A;  3KX2 A;  3DTK A;  4UUT A;  4Q47 A;  1TWG J;  3RZO J;  2QQ8 A;  2VIX A;  3DU6 A;  4W97 A;  3QOD A;  1HF0 A;  4GYG A;  1NG6 A;  2M8E A;  2GM4 A;  5FLV A;  1PJR A;  4JX5 A;  1A04 A;  5EZH A;  1IG7 A;  2BXY A;  3AKZ A;  3RKX A;  3CCS I;  4U87 A;  5FRM A;  4KT6 A;  3SDB A;  4F92 B;  1T0F A;  2MAB A;  1MBE A;  3KP4 A;  4BE1 A;  2HDD A;  4ABZ A;  4I99 C;  2GZW A;  4N9I A;  1LJ9 A;  2VJ5 A;  4RBO A;  5D8L B;  4BXU A;  5IYB J;  4BE2 A;  2HDW A;  3P9K A;  3MN2 A;  1X3U A;  4CO8 A;  2Y30 A;  4IZZ A;  2CMP A;  2I10 A;  3Q9S A;  1T98 A;  4HQM A;  3F22 A;  4XN0 A;  4DZJ A;  4YII A;  5FGM A;  1YJ9 I;  4DOZ A;  3RCO A;  1I3A A;  1MBH A;  4ENJ A;  3FWE A;  2LY9 A;  1Y8R B;  1YS7 A;  1WSU A;  1SFO J;  2L4A A;  4BQO A;  2UZK A;  1S9H A;  3GTJ J;  5FKM A;  2WAE A;  3KFW X;  1OCP A;  4QIW N;  4IO9 F;  4GXO A;  3HB9 A;  4IJA A;  4CCJ A;  3K4J A;  3TW6 A;  3M8J A;  2X6X A;  3MAJ A;  4IRI A;  2Z99 A;  1K79 A;  3TP3 A;  1TP4 A;  1ZGW A;  1X1A A;  3VSL A;  2XIG A;  3LL7 A;  1XSD A;  4IPA A;  1IXC A;  1HC8 A;  3J80 Z;  4BU2 A;  3JRD A;  3MKZ A;  3E5Q A;  4BDZ A;  3L2R A;  2IT0 A;  3GCM A;  1ZLK A;  4P96 A;  4L9T A;  4B8X A;  3BTC A;  4K2E A;  3JRH A;  2WBM A;  4XLN F;  3OR2 C;  3FK6 A;  1ZLJ A;  2ZXH A;  3GTM J;  4KDP A;  5CYV A;  3GLL A;  2VQL A;  3BOQ A;  3L09 A;  2GA2 A;  4V19 K;  1LDD A;  1IAW A;  1ZK8 A;  4HV5 A;  1BR2 A;  3FHZ A;  2BYV E;  1KYZ A;  4AU7 A;  5L3F A;  3I59 A;  2FOK A;  2ZXJ A;  1K6O A;  2VBW A;  2FU4 A;  2LP0 A;  3QPH A;  3RYR A;  4UY8 I;  2IS4 A;  1Z1D A;  4DW6 A;  2NVX J;  1FPQ A;  2Z1D A;  2K9L A;  4G94 A;  4XQF A;  2ECC A;  3GF2 A;  2M5W A;  3BDD A;  3P5J A;  4DBR A;  2E1M C;  3FBN B;  1TL8 A;  3E97 A;  4QTR A;  4L5I A;  2CH0 A;  4NC6 A;  1IRF A;  2BW3 A;  1TNS A;  2ZBK A;  3QYB A;  2R5Z A;  2HYJ A;  2XC7 A;  2OA4 A;  3K10 A;  3HTS B;  2O9L A;  2DI3 A;  1LE8 A;  1U9O A;  4Z6Y A;  1VQL I;  4CCK A;  2HZD A;  1R5H A;  3B6A A;  3GZ6 A;  4L9N A;  2V7F A;  5KK1 A;  2GQQ A;  3H3V K;  4EQQ A;  4S04 A;  4Y15 A;  1J75 A;  2PMZ N;  2B63 J;  2UXX A;  2L01 A;  1IUF A;  4PJJ A;  4ASN A;  5CLS A;  2JRM A;  1LUJ B;  2L9N A;  2HWV A;  2E2J J;  3BR3 A;  3J81 Z;  1FYM A;  4BBR J;  1EH8 A;  5HNH A;  1JGS A;  2DDB A;  2JJ7 A;  2MC3 A;  3LFK A;  5GAD J;  3OV8 A;  3JRI A;  4P5O A;  3ECO A;  2KKO A;  2OCC H;  3S8P A;  4L0Z B;  3Q3S A;  1BIB A;  5FKK A;  1DDN A;  3T8T A;  1R4N B;  4D7N A;  5F0C A;  1V5F A;  3IWF A;  4FCY A;  4XKV A;  2IS6 A;  3R0A A;  4FHT A;  6PAX A;  1IF1 A;  3MEX A;  3RSN A;  2WB1 N;  2QM3 A;  1XGM A;  2VJ4 A;  3IHU A;  2AHQ A;  3H0G J;  3MKY B;  1K7A A;  4N0B A;  3HOW J;  3LSP A;  3CO7 C;  1FEX A;  1RR8 C;  1HDD C;  1OCZ H;  3EUA A;  3G1L A;  1FOK A;  1L3L A;  5FD6 A;  4A3M J;  3S1M J;  2FX0 A;  3GFL A;  2B7E A;  1HCR A;  2VJJ A;  3Q0V A;  3REO A;  2RGV A;  3I0T A;  1U6G A;  3K4M A;  3P7N A;  5JR3 A;  4IHS A;  2KIU A;  2GXG A;  2Z16 A;  2WY7 Q;  2EWN A;  5LGU A;  2ZME C;  2JRT A;  1ERD A;  4EM2 A;  1K78 B;  3M8E A;  3Q9V A;  4A93 J;  3SEQ A;  5K5O A;  2B9S A;  1NK3 P;  1JTX A;  1Z05 A;  2JUG A;  5JHU A;  5HDN A;  4CYC B;  4I09 A;  4PJN A;  4FX0 A;  1HKQ A;  4P1W A;  4KIT B;  2LTP A;  5BPI A;  2R7W A;  3F6V A;  2FJ1 A;  1KA8 A;  4CA0 A;  4ZYH A;  3D5S C;  2LBF A;  4XNF A;  2VBX A;  3IWZ A;  3GW2 A;  3WTW C;  2A69 F;  4OAZ A;  2R7X A;  2R7O A;  1WJD A;  2QEN A;  2OC6 A;  2JQ7 A;  1B1B A;  2P8T A;  3LSR A;  3QRF F;  4M3E A;  2WA0 A;  4HF2 A;  2UV1 A;  1ZAR A;  1KGS A;  4HX4 A;  3PNV A;  1M1E B;  2RVC A;  3HZJ A;  5D5U B;  4Y3O A;  4JBA A;  4MO7 A;  3EUH A;  2XDV A;  1D8J A;  4F7Z A;  4EJW A;  2LOO A;  5IY5 H;  3V7S A;  4OOI A;  3ELK A;  5KAI C;  3LSG A;  2BEO A;  3AL0 C;  1YW9 A;  3E6M A;  3WTZ A;  1R1T A;  3AFH A;  3HJE A;  3G71 I;  3OSG A;  3JRG A;  4BS9 A;  3K4B A;  3JAM K;  5K5Q A;  3IL2 A;  1VQ6 I;  3WU1 B;  4JX6 A;  1S7O A;  4LJZ F;  1FIP A;  3N4M A;  3ZCO A;  1PUE E;  3HYI A;  1BC8 C;  1QHG A;  3DKW A;  3TDU C;  4RDU A;  1A6I A;  3ESW B;  5E3M A;  2EJR A;  3GWZ A;  2QCO A;  5JVT A;  3AG1 H;  5E79 C;  3H5N A;  1SC7 A;  3A01 A;  1F4K A;  3GZN B;  4BE0 A;  4GFB A;  1FC3 A;  2ADU A;  2YU3 A;  4CIC A;  2EBI A;  1WJ5 A;  2XUB A;  2CGP A;  1FX7 A;  3F3X A;  1D0Y A;  3U21 A;  5GPC A;  1W5S A;  3SDG A;  4E7K A;  3DTI A;  4ZC3 A;  2RV8 A;  5AIQ A;  4DIQ A;  4WF2 A;  3S3N A;  2RRE A;  5DUK A;  3GYH X;  5D6F A;  2YSR A;  5DDG A;  3BR6 A;  2IBD A;  2V9K A;  3DBH B;  3K1M A;  2O8X A;  5ILS A;  3LA7 A;  3N05 A;  5K5R A;  2FA5 A;  2XGC A;  5M5W J;  3CCR I;  1BR1 A;  2CS3 A;  1X4O A;  4RS8 A;  4I2O A;  2M30 A;  4YFX F;  3GTQ J;  4MQ9 F;  2GIV A;  3FXU A;  1KU3 A;  3M1C A;  2X6W A;  3DV8 A;  4PFP A;  2K7L A;  5DYM A;  4II2 A;  3W2W A;  4HBL A;  5E8G A;  2P6T A;  3ZOB A;  3L2W A;  1TWH J;  1T56 A;  1MMA A;  2F5E A;  3QYF A;  1F9N A;  4HOB A;  1AA7 A;  4FQG A;  3WTT C;  2ZFW A;  5LGN A;  3W3C A;  1H88 C;  2DA1 A;  3GFJ A;  3PO2 J;  3FBI B;  4RLF A;  4E7S A;  5GAH J;  4EGZ A;  1DPR A;  2IP2 A;  3MFK A;  3CQZ J;  4TV7 A;  3OL3 A;  1H8A C;  2KHM A;  3MD2 A;  1ODD A;  3K6G A;  1XSX A;  4HNU A;  3OOU A;  3HBL A;  1H9T A;  3FDY A;  3B6C A;  4EJT A;  3MVP A;  4HZF A;  1K6Y A;  2GIZ A;  3NAU A;  4OMZ A;  3ZR8 X;  1ETX A;  2BVM A;  2R7Q A;  4DQ2 A;  4CXF A;  2ISZ A;  4AM3 A;  4F52 A;  3E7L A;  2ESH A;  2XKO A;  1MBK A;  4MEY F;  2NVU B;  4G6T B;  2CQK A;  1OCT C;  9ANT A;  2P5L C;  2QKM B;  2PI0 A;  3FKI J;  4U88 A;  3IAM 2;  4U7D A;  1JUM A;  3BTI A;  5J40 A;  3BG5 A;  2QQB A;  3F8F A;  5F27 A;  1QNT A;  3Q0U A;  1YTY A;  1ITY A;  3EDP A;  3OIO A;  3OL4 A;  2OPT A;  2P7V B;  3CD6 I;  4HPQ A;  5C4X J;  2IGM A;  2E2I J;  1J0R A;  1A5J A;  4XKC A;  1YHQ I;  3ZMD A;  1X2N A;  2IGK A;  4BEH A;  4IEJ A;  4W1U A;  3L2U A;  1GV5 A;  1UHS A;  4H0E A;  4B48 A;  2JA6 J;  2XKP A;  4Z2Y A;  2LNB A;  3T0Y A;  4C3J J;  2M45 A;  2E19 A;  3C18 A;  3S2D J;  4AUX A;  1RC9 A;  2PN6 A;  3AG3 H;  3H9J A;  2HKO A;  2HS5 A;  1GLN A;  2CUF A;  4X6A J;  3UR3 C;  2QSF X;  4LFU A;  1IW7 F;  1B72 B;  1MZB A;  2EK5 A;  3WTS C;  1UST A;  3IH3 A;  2K40 A;  3TO9 A;  1J09 A;  4A3F J;  4XLA A;  3WHB A;  4IHX A;  3HGY A;  2M2E A;  3QP6 A;  2MSY A;  1GDT A;  2NVQ J;  1RKT A;  3AG2 H;  3DPL C;  2LBF B;  4J00 A;  3C2B A;  4ZZL A;  2XF5 A;  4ZYE A;  2B0L A;  2HTS A;  3BQZ A;  1AU7 A;  4YIR X;  1D3Y A;  1IO2 A;  2FNP A;  2RDP A;  3HHH A;  2VL8 A;  2KRF A;  5HS9 A;  1RNL A;  4MEX F;  1D8K A;  3MZH A;  4XRS A;  3BC8 A;  2HVQ A;  5EEH A;  3HSR A;  2BOL A;  5CKT A;  2AO9 A;  4JP0 A;  3WE3 A;  3H36 A;  4F55 A;  1IDY A;  1TQP A;  2VAS A;  4XL9 A;  2ID3 A;  4E4H A;  1FZP B;  1ETQ A;  2XGD A;  4NUB A;  3A2K A;  3SZP A;  4FE4 A;  1GUU A;  4BKX A;  5DS9 A;  2ZXW H;  1X2M A;  4B4C A;  4UHT A;  3S1R J;  2H94 A;  1W4M A;  5HLH A;  1WWX A;  3N97 A;  3G73 A;  1G3S A;  5EZG A;  1I6H J;  5ICC A;  2HQA A;  3I53 A;  2VBY A;  1VQK I;  3DBL B;  2XAH A;  2DA6 A;  3SEZ A;  3DLA A;  3I3L A;  2R7V A;  1LEB A;  3JRC A;  1RR7 A;  5FKN A;  1BL0 A;  1SVO A;  3E0J B;  3A01 B;  3KET A;  3OYI A;  1F36 A;  2NVY J;  1OJL A;  3PQJ A;  2ZKZ A;  2VE8 A;  2VQG A;  1V4R A;  4IHV A;  4M3F A;  5LEJ A;  1ZRE A;  2HOS A;  2LF8 A;  3OS0 A;  2YU9 J;  3K1N A;  4KYW A;  4LIV A;  2DBB A;  3S3O A;  1W0T A;  1E3P A;  5CPR B;  4HX8 A;  2QSH X;  4N4N B;  4XK4 A;  1IN7 A;  4F91 B;  2E5Z A;  2E34 A;  3VB2 A;  3FZV A;  3GLX A;  1S72 I;  3ZQ7 A;  2QBY A;  2CSO A;  3GBG A;  2H09 A;  2DTR A;  4V2G A;  1XB4 A;  3HPG A;  1IUY A;  4L5E A;  1KQ0 A;  2K9M A;  1GVJ A;  2VXZ A;  4BY1 J;  2JUC A;  1R00 A;  1WPK A;  5JFR A;  4GO1 A;  1I1G A;  2CJJ A;  4FAS D;  1RKW A;  3EPZ A;  3EET A;  2OU2 A;  1RZ4 A;  2DFF A;  5M3M J;  1DUX C;  3OYC A;  4GYI A;  2WAF A;  3ZPL A;  5DCF A;  3RTR A;  1DP7 P;  1XD7 A;  2F4O B;  3W2V A;  3HSE A;  1RIO H;  1QQI A;  2JZY A;  3QYE A;  3CO6 C;  3KLN A;  4LLN A;  1K61 A;  4M6X A;  3CJN A;  5K7H A;  2D5V A;  1FYK A;  2STW A;  2MH9 A;  3CCM I;  4OIP F;  1U3E M;  1XMK A;  3FKJ A;  4IHY A;  3MZY A;  1YW8 A;  1NTC A;  2HNH A;  4DYQ A;  1SD6 A;  4PJL A;  3GTP J;  4HAM A;  1WJF A;  1T8I A;  3BPX A;  3J7Y J;  1P2F A;  3DXJ F;  3HHG A;  3P9C A;  4I98 B;  3WG9 A;  3KEQ A;  1ZGA A;  2F5C A;  2LF7 A;  2JA7 J;  1FSH A;  1VQ5 I;  1XX5 A;  2JA8 J;  1U5T C;  5GP9 A;  2R7U A;  2EA2 A;  1JI8 A;  3AAF A;  4JX4 A;  4OMY A;  5D6E A;  4RB0 A;  2M87 A;  3ZMS A;  4XRM A;  2O0Y A;  3ERM A;  1IDZ A;  4D5C A;  2LKX A;  2HFH A;  4M74 A;  1Z3Y A;  3TOB A;  2DT5 A;  1JT6 A;  3ZMT A;  3OYK A;  1D0X A;  1KQ9 A;  1B59 A;  2KRC A;  3IC7 A;  3BPV A;  1YJN I;  1ZKG A;  1HDP A;  1HW2 A;  2E2H J;  3V8K A;  1Z0X A;  2VON A;  1BI1 A;  3WTX C;  1FBU A;  2LH9 A;  2H6B A;  2FNA A;  2OV7 A;  1FYL A;  1U9N A;  2L9S A;  2G7U A;  4NQW A;  3AG4 H;  1EF4 A;  3FIW A;  3V4G A;  5C4J J;  3FXL A;  5CQG A;  2X6O A;  1YIT I;  4KIG A;  1L0O C;  3KP7 A;  2XF7 A;  1J7K A;  4B1R A;  4AC0 A;  4LG0 B;  2OBP A;  2KRH A;  3ERE D;  2HXO A;  3WU0 A;  3PO3 J;  3RQI A;  2ELK A;  3D5L A;  2R7R A;  4Y13 A;  4D0P A;  1IV8 A;  5L3D A;  2M9H A;  3WTY C;  3E5X A;  2GXA A;  5TIS C;  4GDF A;  3I4M J;  2QQ9 A;  3BTL A;  5J1R A;  3L2V A;  3PFI A;  3RDI A;  3NWT A;  2CV1 A;  2CV2 A;  2BHZ A;  2IJL A;  1SVL A;  3C2G A;  1XG1 A;  3HOU J;  3KCC A;  2K02 A;  1XGN A;  3ZQQ A;  5E1W A;  1EKE A;  4BL0 B;  1ETK A;  1P92 A;  2W85 A;  1V54 H;  3CME I;  1KU9 A;  2ZJ2 A;  2LD5 A;  3F72 A;  2ZSI B;  5TJJ A;  3OYJ A;  2WB1 A;  3DPU A;  1VFC A;  2VN2 A;  4IVN A;  5M5X J;  4E7H A;  4LLL A;  1JKO C;  2BBY A;  2JTV A;  3ISP A;  4E7I A;  1FJL A;  2VQH A;  1P4X A;  3CUQ B;  3K4K A;  1LKX A;  2E1M B;  2DYS H;  3LSI A;  2CQ7 A;  2HPM A;  4ZDP A;  1B8I B;  2G0E A;  2CO5 A;  1MBF A;  4UB6 C;  5TGT A;  3CZ6 A;  3L9F A;  3VYS B;  1QZE A;  4NDL A;  1G2H A;  2A61 A;  3DCF A;  5LRS A;  2W48 A;  1TZL A;  2OUM A;  4HNT A;  5DEQ A;  1YRN B;  2LVS A;  2MW8 A;  2V26 A;  5L3C A;  2DDA A;  3OSF A;  2X0L A;  2M1B A;  1V55 H;  3DU5 A;  2VUM J;  2E7X A;  3ONQ A;  4E7Z A;  3LOC A;  1R22 A;  1S6L A;  2Y69 H;  4WXH A;  1YO5 C;  4L18 B;  4ETS A;  1QHH D;  3W6J B;  3IP4 B;  3ZRG A;  4PUS A;  3HUG A;  2FBH A;  2V9V A;  4M3G A;  3S2H J;  2GOM A;  1HW5 A;  4ESF A;  1XC5 A;  3KZY A;  1BBY A;  1G8X A;  2WAQ A;  3LSK A;  1BW6 A;  4HLY A;  2VKV A;  2A5Y B;  5C44 J;  2QUF A;  4XBF A;  2L9V A;  5DD4 A;  4HQE A;  4ZTJ A;  4NBQ A;  2F5V A;  3HOS A;  1KU2 A;  2A07 F;  1FBQ A;  2Y9Z A;  3A1Y A;  5IP7 J;  1U8B A;  2EIJ H;  2R0Q C;  1MMS A;  2IA0 A;  1MDM B;  1JHF A;  2AXL A;  3JCU C;  2O3F A;  4LGW A;  1HKT A;  5HLG A;  1U0J A;  4RAY A;  2EZI A;  1IJW C;  1Y8Q B;  2JK3 A;  2NS7 A;  5IP6 A;  1QRY A;  2K4J A;  3S2W A;  1SD7 A;  1CQT A;  2HYF A;  3CCE I;  2J5P A;  3M8F A;  5GPA A;  2XAS A;  1SD5 A;  2ZJR F;  1MNE A;  2IXS A;  2RQQ A;  3VYR B;  4HF0 A;  3HIF A;  4DGW B;  4D7M A;  4CCL A;  2P7C B;  2F4I A;  2QEX I;  5TRD A;  4A3J J;  3PIP F;  3KPH A;  4II3 A;  5D4R A;  1CF7 A;  4BJ5 C;  3ZN1 A;  4KFC A;  4G6D A;  2IEK A;  2CFO A;  3WGG A;  1LNW A;  3CLQ A;  3H5R A;  3K4L A;  4BHC A;  4CZZ A;  1KZH A;  1QO0 D;  3BQY A;  2MA3 A;  3IRQ A;  4XON A;  4LK1 F;  3TMO A;  3SFI A;  3FM5 A;  2TDX A;  3I64 A;  2WV1 A;  3GO5 A;  3WE2 A;  2UXN A;  1RES A;  4Q5S F;  1TWA J;  4A0Z A;  1WJA A;  3H35 A;  2XHK A;  4OIO F;  1TT0 A;  2F4M B;  5F1R A;  4BAC A;  1K4S A;  2EFO A;  2E35 A;  5EGO B;  1IN4 A;  2DMU A;  3BG3 A;  1OR7 C;  2ZFU A;  1XSV A;  1OYI A;  5HNF A;  2DTZ A;  1ZEL A;  5ICF A;  1WGX A;  1SMY F;  3FMQ A;  1LPQ A;  4KIF A;  3VFZ A;  2F6C A;  2R5Y A;  2HVR A;  1HQC A;  4QWQ A;  3S16 J;  4NNJ A;  2NYX A;  3OYL A;  4ZDO A;  1I5Z A;  1UHW A;  1JKR C;  4A5N A;  3KYD B;  3A4C A;  4BHP A;  4AD9 A;  4BAY A;  4A3L J;  1BJZ A;  3KEY A;  5LEK A;  3TQN A;  1O7F A;  1E3O C;  5E3O A;  1JUS A;  1N25 A;  1Y6I A;  3HRU A;  1YLF A;  4OAY A;  1MSE C;  3BT9 A;  3T1B A;  3CJR B;  2CW8 A;  2M34 A;  1G3Y A;  1A35 A;  2KPM A;  5FD5 A;  2MD0 A;  1N77 A;  4IKF A;  1S29 A;  2A5W A;  1WJC A;  2K9Q A;  4QPO A;  3DPT A;  1FT9 A;  5A2Q Z;  4UUV A;  4C30 A;  4D9J A;  2KIQ A;  5EEG A;  1XDS A;  3DP7 A;  3VDX A;  4XRS G;  4MHG A;  1X1D A;  2D45 A;  1SFE A;  3JRE A;  2XF6 A;  1S5L C;  3QU3 A;  1EV7 A;  2HQ5 A;  5B66 C;  4G8X A;  1MMD A;  4HDU A;  1IXS B;  2FOW A;  2V6E A;  1VND A;  1S8N A;  2X51 A;  3IKV A;  3BR2 A;  3M9A A;  3OYA A;  5JLW A;  2QYO A;  1YIJ I;  2UUZ A;  1PUF B;  1ZH5 A;  1AHD P;  1HA8 A;  1JHH A;  5HDG A;  2KL4 A;  4HA8 A;  5FLX Z;  2KIF A;  3JSO A;  4HEA 2;  5CVU A;  4OIR F;  3Q0W A;  3FIS A;  1W7P D;  2NNY A;  1CGP A;  4XM3 A;  1BC7 C;  3W2A A;  4M6V A;  4MIM A;  1AWC A;  4BUP A;  4KN7 X;  1SAU A;  4A12 A;  4YG2 F;  5EDN A;  3ZMU A;  4DNC A;  4G7H F;  2LKS A;  2L02 A;  3E6C C;  1U8R A;  2XRL A;  4KT5 C;  3BG9 A;  3TED A;  4Y7N J;  3WTU C;  2E60 A;  3I9V 2;  4CCO A;  2K4B A;  3F8N A;  1EA3 A;  1Y56 A;  2QQA A;  3CF5 F;  5KHD A;  2PJR A;  1D1B A;  5F04 A;  4XLH A;  4HF1 A;  1YIO A;  3MKW B;  2NS0 A;  2PMU A;  3MKL A;  3HM5 A;  3TO6 A;  4M71 A;  5FLM J;  4H4K C;  3I5U A;  2HOT A;  1PYV A;  1EH6 A;  3SHF A;  4AYB N;  1FNN A;  2NXN B;  1IGN A;  3ZGK A;  2KT0 A;  4XID A;  3OYG A;  1FOY A;  3KP6 A;  1I39 A;  3CMM A;  4J01 A;  2FBK A;  1G3T A;  4PGG A;  4A3D J;  2V1X A;  2V1D A;  4ENM A;  3OMY A;  4IF4 A;  4QLC U;  4PFO A;  2HXI A;  3S32 A;  3J7A O;  1MBG A;  3IV5 A;  1W7P A;  2DMQ A;  4DZP A;  4FE7 A;  2KQR A;  3BLY A;  3F0C A;  3CCL I;  1IN6 A;  2QLZ A;  2JSP A;  1LFP A;  1OYW A;  4PZJ A;  4CGZ A;  3R6S A;  5IYC J;  3NQO A;  5HS7 A;  4EVI A;  1F5T A;  3O8G A;  4E7J A;  1U5T A;  2Q1Z B;  2Z33 A;  1B9M A;  3ABT A;  2BY0 A;  2OD5 A;  2X48 A;  4YFN F;  2OZ6 A;  1W5C C;  5EEA A;  5FFX A;  2HQN A;  3HPH A;  2W25 A;  3CES A;  3ZP5 A;  1TC3 C;  3D0S A;  2LR8 A;  4L9V A;  4AWX B;  1MNM C;  1WJB A;  3DTE A;  3TDZ C;  1MJB A;  2A3S A;  2D1H A;  4LD5 A;  3CCJ I;  1DGW Y;  5IOY A;  2CQQ A;  2V1N A;  4MFD A;  2DPD A;  4A6D A;  4ZYG A;  3LFU A;  5D4S A;  5LHG A;  4HLX A;  3FMR A;  4HYE A;  3KIO A;  1Z21 A;  2EZK A;  4HDV A;  2Q2E A;  3T5X A;  3I59 B;  2BY3 A;  2FD5 A;  1LVA A;  2CW0 F;  2BGC A;  1WKM A;  1WI9 A;  2Z2S B;  2CW7 A;  2FQ3 A;  3S17 J;  1Y39 A;  5E17 F;  2HU9 A;  3DLL F;  4G9Y A;  4BDY A;  3PL8 A;  3HSF A;  2R93 J;  2Q0O A;  3CLO A;  1CF7 B;  2C6Y A;  1T0F C;  2BW3 B;  3GVA A;  1TNT A;  3SZT A;  4I0B A;  5EYR A;  3BZ6 A;  2BVL A;  2R5Z B;  3PJR A;  5H2F C;  3JW4 A;  3WTV C;  2O03 A;  4ESB A;  1WQ2 A;  4YEJ A;  4AIJ A;  3OYE A;  2P4W A;  2VPR A;  1LE8 B;  5EF6 A;  2EIK H;  1D5Y A;  3J80 K;  2VPL A;  4JOM A;  3S15 J;  1P4W A;  3LWF A;  2RKH A;  1OKR A;  1TWC J;  4OWR B;  4RM2 A;  2KLO A;  2DAO A;  2IA1 A;  2XB5 A;  2K27 A;  3A0B C;  4LMY A;  1VQ9 I;  4IQJ A;  1MBJ A;  2CUE A;  5DTD A;  3ZMV A;  1TW2 A;  2XPV A;  1W36 D;  2O61 A;  3OS1 A;  2R5Y B;  1OFC X;  3HXL A;  4XR6 A;  2BXZ A;  3CDH A;  1USS A;  1B6A A;  3DFG A;  2R7Z J;  1UAA A;  1HW1 A;  2P5V A;  3IAS 2;  4WXC A;  1DQU A;  2XAQ A;  3W6V A;  3IH4 A;  2MD5 A;  4B44 A;  1T6S A;  4A0X A;  3BG6 A;  1C0W A;  5CVR A;  3E5U A;  2KIM A;  5JVG F;  2R7T A;  3F8B A;  1V5E A;  2KDZ A;  5LGT A;  3J7A Y;  3IH2 A;  1B9N A;  5J8F A;  1VQP I;  1MGT A;  4LIU A;  4IX7 A;  3OYD A;  2R7F A;  1FOX A;  1EH7 A;  2DJI A;  1BI0 A;  4AVP A;  4BXF A;  4QSH A;  2M0M A;  4XKW A;  3HRS A;  4M72 A;  5L3B A;  1Z67 A;  4JQF A;  3WGH A;  2M4K A;  4HW0 A;  3HEF A;  1R1U A;  4OIQ F;  4U0W A;  1R1V A;  1QU3 A;  1WVR A;  2W4S A;  3NEU A;  1IN5 A;  1GT0 C;  3COA C;  1OCR H;  2BY2 A;  1MW7 A;  1S7E A;  1NG7 A;  1MJ9 A;  3OIP A;  4PSX A;  1SAN A;  3J81 K;  2L9R A;  4XLF A;  4XSZ F;  3J7Z I;  3PUF A;  2K3F A;  5FB2 A;  1FMV A;  2DMN A;  1WI3 A;  5E3N A;  3SZG A;  5K7Z A;  1S7A A;  2QGU A;  2IW5 A;  1R58 A;  3FXO A;  4NC8 A;  3R61 A;  4PCQ A;  4UB8 C;  4M3B A;  5IYD J;  4PGH A;  2PFB A;  2P0W A;  1B4A A;  1R6R A;  3C3W A;  3ROU A;  5B1A H;  5ILV A;  3I54 A;  1XS9 A;  1JJ8 C;  2M0C A;  2DT6 A;  1VQN I;  2NNN A;  2XGE A;  5CJ9 A;  3BZK A;  3E3V A;  3K4C A;  2X1C A;  4FX4 A;  1IRZ A;  2BE5 F;  1LDK B;  1QVU A;  2VXD A;  5E1Z B;  4L9J A;  4P55 A;  3NAR A;  3H92 A;  3K69 A;  1X3W B;  2DK5 A;  4E70 A;  3JRB A;  2V6C A;  3GEZ A;  2W1O A;  2XPU A;  5D8K B;  5FJ8 J;  2E36 A;  1MKM A;  2M4G A;  2LG4 A;  2XPW A;  1OR7 A;  1SEU A;  4KIC A;  5EG0 A;  1I1S A;  5CVI A;  2YR2 A;  1VQO I;  2HVS A;  5LLQ A;  2RNJ A;  2VOP A;  4CCN A;  5D5W B;  2VOD A;  1TLH B;  3IUO A;  2QA4 I;  2KP6 A;  1VQ7 I;  2OTL I;  4WXD A;  1T08 B;  1GXQ A;  2EFN A;  2G7H A;  3G1O A;  3I58 A;  1YFH A;  4CZC A;  1O4X A;  3E6D A;  4A3C J;  3QOP A;  3C1D A;  5KCM A;  3R4K A;  4EEF G;  3GTO J;  4IQ4 A;  1AOY A;  2LRE A;  2E7W A;  4LB6 B;  2E1C A;  3LMM A;  2P6S A;  2TRT A;  4A3B J;  1Z3X A;  2CFX A;  2FE3 A;  1TWF J;  3QOE A;  5K1Y A;  3KP5 A;  3S1Q J;  1MJA A;  4KN4 X;  1ZRC A;  1K83 J;  4WX9 A;  4EGY A;  1JUP A;  1J2X A;  4XLC A;  1T38 A;  1KON A;  1PVE A;  3GTL J;  3LSJ A;  1UG2 A;  2ISY A;  1DGR M;  1IV6 A;  3CCU I;  1VTN C;  4ZTF A;  1POG A;  3JSP A;  3C7J A;  2XV4 S;  2A68 F;  3HL2 A;  4NB5 A;  1GVD A;  1J59 A;  2FF4 A;  1XMX A;  3KP2 A;  5IT9 Z;  3LAP A;  2L7K A;  3OS2 A;  2ZME A;  1UHM A;  1VQ4 I;  4UV9 A;  1VI0 A;  5F1J A;  5BOX A;  3D5R C;  2ME6 A;  3U9G A;  1SD4 A;  3HOX J;  2K9S A;  1FY7 A;  4MQV A;  4M73 A;  1BI2 A;  1HXD A;  3WGI A;  2EB7 A;  2Y0M A;  1PP7 U;  2H8R A;  5J3L A;  3BR1 A;  3I4N J;  4P9U A;  4AID A;  2KJC A;  3NRV A;  2JPC A;  2XAF A;  2BZT A;  2MC4 A;  4RGS A;  1UCR A;  3H9Q A;  3M07 A;  1O57 A;  5BQT A;  3KYL A;  2P5K A;  5L3G A;  3LQR A;  5LRR A;  4WWC A;  2DQR A;  2E71 A;  2F5D A;  1D1A A;  2E1O A;  3P9I A;  1WH7 A;  3HOV J;  3WU2 C;  3IRR A;  3ZN0 A;  2XAU A;  2KDO A;  3F6O A;  4YFK F;  3S3M A;  2Y0S N;  1APL C;  3S14 J;  4RGR A;  1VZ0 A;  3LSH A;  1W5T A;  3QPL A;  3ZMZ A;  1SMT A;  1KU7 A;  4Y52 J;  2YUS A;  1W0U A;  1SFK A;  1Z91 A;  5DCM A;  3G1M A;  2ZCW A;  2PEX A;  3M1E A;  2M3A A;  5HLI A;  3TGN A;  2MGQ A;  2W57 A;  2ME0 A;  3F9K A;  3BJO A;  3K2Z A;  3LA2 A;  2EZL A;  3CC2 I;  3HDD A;  3T8R A;  3L2C A;  1R71 A;  2OAZ A;  2ESN A;  2L3D A;  2QVO A;  2W7N A;  3F8C A;  1Y1W J;  3ZQI A;  4PJM A;  2X1D A;  1REP C;  4RGX A;  2CV0 A;  1ZG1 A;  5ICG A;  4N9H A;  3OOP A;  1ZYR F;  3CJQ B;  4ENK A;  1X4P A;  3FX3 A;  2CRG A;  4ZJZ A;  4CHU A;  3SYT A;  2A6T A;  4M9S A;  2O5R A;  1NK2 P;  1T39 A;  4E7L A;  3BRO A;  1WCM J;  2MG4 A;  3BCB A;  1LFU P;  2QSG X;  2E1N A;  4CSW A;  2ZXI A;  2F48 A;  3A0H C;  4Y4R A;  2R3S A;  3VPR A;  2OCE A;  5D5X B;  3RI4 A;  1FTZ A;  2PMZ A;  2DJN A;  2DK8 A;  1R5I D;  4YIF A;  1ZHF A;  2W84 A;  3KE2 A;  5IP9 J;  5F64 A;  1K4T A;  4I02 A;  2PMH A;  1ZG5 A;  2XGX A;  2FXA A;  4DBQ A;  2JVH A;  3E6B A;  4BEH B;  3MWM A;  4YEL A;  2KMU A;  1JJ6 C;  3RZD J;  1FP1 D;  2L0K A;  4FIS A;  3SXY A;  1GV2 A;  1YYV A;  1XTA A;  4GCV A;  1K78 A;  3IKT A;  4KMF A;  2JPB A;  4DYR A;  3DEE A;  2LKP A;  2W24 A;  1SVM A;  5DM7 F;  3CDI A;  1IRG A;  2EIN H;  4CYC A;  2DU9 A;  1O3S A;  1YG2 A;  2K86 A;  4BJ6 C;  1R23 A;  1ETY A;  2K9N A;  2ACJ A;  2X6Y A;  2DOF A;  2WAD A;  5EJC A;  1J5Y A;  5GAE J;  3JRF A;  2X85 A;  4LOC A;  1R5G A;  4EV0 A;  2H1K A;  1N78 A;  2LYC A;  1RUO A;  1FWZ A;  2K85 A;  4QPQ A;  2XRO A;  4BBS J;  1RUN A;  4I0A A;  2FBI A;  3GTG J;  3ABM H;  4IRH A;  1WH5 A;  3HRT A;  3HKZ N;  1G6N A;  3KEO A;  2VOO A;  3CTA A;  2YPR A;  4G6Q A;  3I55 I;  4ZYA A;  3GTK J;  2IGN A;  3H3U A;  4XLP F;  3A03 A;  1QPM A;  3I71 A;  1DU0 A;  2EV0 A;  1TT5 B;  1D1C A;  2K3P A;  2VI6 A;  2L5Q A;  1FIA A;  2LFB A;  5EG0 B;  2IRF G;  5B1B H;  3L1P A;  3BTJ A;  4G7Z F;  2EH3 A;  1BOA A;  5FKL A;  2DPU A;  2FEZ A;  2PBI A;  2MLG A;  2AQE A;  3HRM A;  1WHU A;  2KJB A;  5IPA A;  3CCV I;  1BOB A;  4I76 A;  1SFX A;  2H1L A;  2CG4 A;  2DOE A;  3Q5F A;  1WRJ A;  3ZQL A;  2LLK A;  3RKW A;  4L5J A;  4C2U A;  1EJ9 A;  2ZO4 A;  1W36 C;  2EIL H;  3CP8 A;  1UFM A;  4UNO A;  5FO5 A;  2CU7 A;  3W6K B;  1O3R A;  2BV6 A;  2OQR A;  4RMN A;  5KNL A;  4Y33 A;  3ECH A;  1TW3 A;  1OMI A;  3TL4 X;  3MMY B;  4PJ0 C;  5FFZ A;  3GFI A;  2HQR A;  4U7B A;  2X1E A;  3FF5 A;  1ZQ3 P;  1GHC A;  1YS6 A;  4Q48 A;  4C2T A;  3RJP A;  1ENH A;  4M3D A;  2M8G X;  2EA4 A;  4MFE A;  3BWG A;  4XN3 A;  4FT8 A;  2F5F A;  3V7R A;  3VWB A;  2LK2 A;  2WV0 A;  1YQA A;  3ULQ B;  3K2A A;  4O3M A;  2QBY B;  3CF2 A;  4AYB A;  1G59 A;  1RET A;  4KJZ A;  2LMD A;  2X9D A;  3V42 A;  1ONV A;  4L0Y B;  3GFM A;  4ITV A;  4RA2 A;  2ZME B;  5F0F A;  1MD0 A;  1TQM A;  4LB5 A;  4NC7 A;  3WHC A;  2NAZ A;  4IHW A;  1DPU A;  5J6X A;  1JTY A;  1ZR4 A;  4G12 A;  4BJT A;  2HPI A;  4MTE A;  4RGU A;  3CUQ C;  2WTE A;  4DYC A;  3F21 A;  2MYS A;  2VKH A;  3PQK A;  4A3I J;  2EIM H;  2O8K A;  3CCQ I;  3BY6 A;  2ZNZ A;  2YX7 A;  3RQ4 A;  1BI3 A;  2FRH A;  3K70 D;  3EYI A;  2ID6 A;  2QKL B;  5B5E C;  2DOA A;  4D1Q A;  2JWT A;  1LQ1 A;  2XVC A;  4UVA A;  4B47 A;  1VQM I;  2IAI A;  1A31 A;  1JKP C;  1X19 A;  1BA5 A;  1O3T A;  3QPT A;  3I4P A;  1X1B A;  1YOV B;  4R8H A;  3OYN A;  1IRX A;  4IOA F;  1LVK A;  1UJ8 A;  2ICW G;  4HRI A;  3B02 A;  4ZDL A;  4S0H B;  3K0L A;  3B73 A;  4UV8 A;  3D1N I;  5GTI C;  3OR1 C;  3PNY A;  3AL0 B;  2VJI A;  2DMP A;  5DCM B;  2OTJ I;  2P81 A;  4AVZ A;  1OYY A;  4CUG A;  1R4M B;  4KMU X;  4CYD A;  2HDC A;  2DA7 A;  4XMY A;  4EAT A;  2LY1 A;  5IT9 K;  1N75 A;  4ZZD A;  5JHF A;  5M5Y J;  1F43 A;  3HTU A;  5HOO A;  3RPU D;  4BQQ A;  1BIA A;  3O8H A;  2Z5U A;  1R36 A;  2KIS A;  3FMS A;  4EM0 B;  2NRA C;  1RPW A;  1X1P A;  2DA5 A;  5E8I A;  4O6J A;  2L7F P;  4NQW B;  3DEW A;  5FRO A;  4UVC A;  3CDL A;  4B3A A;  5LHI A;  3C2H A;  3TW7 A;  3OYH A;  1P6R A;  4PK4 A;  3OYM A;  1H9G A;  4BH9 A;  1XGO A;  3TBI A;  3GX4 X;  1QGP A;  2Y31 A;  1MH3 A;  1V3F A;  1JXS A;  2OJE D;  1ON2 A;  4A2U A;  2JN6 A;  2HI3 A;  2EQR A;  4R1H A;  5K7F A;  5DM6 F;  2EFW A;  4FTH A;  4X1E A;  1LB2 A;  2DA4 A;  2DO7 A;  2E5N A;  4XLE A;  2NOG A;  1HSJ A;  2VT3 A;  3MCZ A;  5DV5 A;  3ABK H;  2R4G A;  3DQV C;  1LEA A;  1STZ A;  3L7W A;  4UUS A;  2L54 A;  1XCB A;  1UEL B;  2FSW A;  1MND A;  4BY7 J;  1X1C A;  4J19 A;  1JGG A;  4G7O F;  4R79 A;  2WAQ N;  1E17 A;  4LLG F;  3RPU A;  2ZJQ F;  1B72 A;  1ULY A;  1BN5 A;  2MFZ A;  2UWM A;  3VYT B;  1VQ8 I;  2HEO A;  4B3X A;  4C2M J;  1QBJ A;  2YX4 A;  1P4A A;  1E0E A;  1OCC H;  3MZ8 A;  2XAJ A;  4D5F A;  1A36 A;  4AIH A;  1DP3 A;  2CYY A;  4M6Y A;  4XSX F;  5ERI A;  5KAF C;  1GXP A;  1PDN C;  1T95 A;  1YX5 A;  1Z6R A;  1HOM A;  1BJA A;  4CCM A;  2WC2 A;  2MLK A;  2ZC2 A;  3ZXS A;  2DCE A;  4A3G J;  1TQI A;  4F3Q A;  2JA5 J;  1X58 A;  2TCT A;  1O7L A;  3RYP A;  4ZH4 F;  2ZJP F;  5BS6 A;  3ML6 A;  3HUG B;  1IC8 A;  4WK8 F;  2IS1 A;  2N8G A;  1P7J A;  5AIP A;  4MTD A;  1ACI A;  1XMA A;  3E1S A;  4HNV A;  1TTY A;  1ZGJ A;  2PJP A;  3ZQG A;  1A6Q A;  3FK7 A;  2LC2 A;  3ABL H;  2VC0 A;  4RB2 C;  2A05 A;  2CQX A;  2R7S A;  1G3W A;  1V5G A;  4LG3 A;  2DN0 A;  4JK1 X;  2RAE A;  4KIS A;  4KNY A;  4IXA A;  2DQL A;  4BNC A;  1UB9 A;  3FXK A;  4KIB A;  4ENN A;  4MGR A;  4UVB A;  4ON0 A;  5JI6 A;  3FXR A;  2K5C A;  3RIR A;  1VF9 A;  1LDJ A;  2EZH A;  1YJW I;  1T33 A;  2EFQ A;  1I50 J;  4M9X A;  1ZTR A;  5DUI A;  2HGC A;  2VBZ A;  2ELH A;  3PM1 A;  5J4V A;  1BW5 A;  2LRD A;  3MQ0 A;  3LA3 A;  2F2E A;  1Y0N A;  2ETH A;  3PIO F;  1FTT A;  2IA2 A;  2OQG A;  2XSD C;  2BY1 A;  2CWE A;  3U2R A;  1Z7L A;  3L00 A;  1Z9C A;  4E6K G;  1IXR C;  2L4M A;  4I7H A;  1E2X A; 
#chains in the Genus database with same CATH homology
 3TO7 A;  1ON1 A;  2LSO A;  4U0V A;  2HTJ A;  2ZNY A;  5BMZ A;  2DFI A;  5E18 F;  4GGG A;  2GWR A;  2RN7 A;  2HZT A;  2DW4 A;  3O2P E;  5CVV A;  5KVR A;  3V8J A;  1IZ1 A;  1KYW A;  2DLL A;  4RB3 C;  3DEU A;  1U2W A;  2EV5 A;  3WOD F;  2H27 A;  2X4H A;  3TKY A;  3H3Z A;  4EJV A;  4Q4Z F;  3VOD A;  3O6B B;  5HVQ C;  2PLY A;  2QWW A;  3EQL F;  2A6E F;  2COM A;  5E1X A;  1FP2 A;  4XRF A;  5DD8 A;  2HKX A;  4A0Y A;  1I27 A;  3FXQ A;  3SQN A;  5HDK A;  4NHJ A;  1FBS A;  4B09 A;  5L3E A;  3V7C A;  2D2W A;  4UXN A;  2AS5 F;  3KZZ A;  2RQP A;  2STT A;  2Z3Y A;  3DF8 A;  1Z7U A;  5E20 A;  2XAG A;  3BJA A;  1XN7 A;  2JT1 A;  4HV6 A;  4BHB A;  2G9W A;  1H0M A;  3RKY A;  4LG0 A;  1G4D A;  3BP8 A;  4EMS A;  2Y48 A;  2VE9 A;  2O6G E;  1Z6T A;  1R7J A;  3QAH A;  2MH2 A;  5ILU A;  4ZYD A;  3LAJ A;  4HX7 A;  5LHH A;  1QZY A;  5H6Q A;  4BQA A;  3CUO A;  2PQ8 A;  3BJ6 A;  5A2Q K;  4EJO A;  3CUQ A;  2J5O A;  3R60 A;  3GUD A;  5BPD A;  1ZG3 A;  3M7G A;  1SFU A;  1HBX G;  2EV6 A;  2GAU A;  5F6F A;  1W7P B;  4EJU A;  1U78 A;  3GXO A;  5LBQ A;  3U1D A;  1T2K A;  2FMY A;  4A6E A;  1ZRD A;  3K9T A;  5FLX K;  4O5V A;  3KLO A;  4OU0 A;  1HST A;  3R0J A;  1U5T B;  4LK0 F;  2JSC A;  3TOA A;  3F8M A;  4I01 A;  2HOE A;  3SFZ A;  5HS8 A;  1KQ8 A;  5D5V B;  1I6X A;  1ZN2 A;  2Y75 A;  2HYG D;  4A5M A;  2EFP A;  5ED4 A;  1XCV A;  5AON A;  1MDM A;  2IPQ X;  3VOE A;  5ICE A;  3G3Z A;  3O3K A;  4PDK A;  4M9Z A;  4RAZ A;  4EM1 A;  2V1U A;  1FSE A;  3KP3 A;  4RB1 A;  4KUM A;  1F1Z A;  2R7D A;  3JTG A;  2V79 A;  2XRN A;  2OZU A;  2RC4 A;  3EYY A;  1FLI A;  1IN8 A;  2A6H F;  2VC1 A;  2QZ8 A;  5H6R A;  3V8L A;  4AIK A;  4U0Y A;  3LQQ A;  2Z9O A;  2VT2 A;  4ESJ A;  2FML A;  1XDU A;  4WCG A;  1Q1H A;  1TBX A;  4BYY A;  5CVJ A;  3HOT A;  1NHA A;  1OPC A;  3GZ5 A;  4OIN F;  2MBF A;  3F23 A;  2IVM A;  4P9F A;  2Q8K A;  2GXB A;  1BM9 A;  4Y17 A;  1D5V A;  4S05 A;  2WWY A;  5J8C A;  1ZRF A;  2D1V A;  1SAX A;  1PP8 F;  3FM3 A;  3QP5 A;  1RI7 A;  2LDU A;  2PG4 A;  5H20 A;  1Y0U A;  4IRG A;  3ABU A;  3VEP A;  1QZZ A;  3LST A;  1HKS A;  3QU6 A;  4IHT A;  1O3Q A;  2GA1 A;  1YW7 A;  5IT3 A;  3JAM Z;  3JTH A;  1XGS A;  1J9I A;  2HR3 A;  3K1P A;  3RPQ A;  4KA4 A;  1JE8 A;  1S3J A;  4MNU A;  1ZAO A;  4CDG A;  2H6C A;  4Q47 A;  4GYG A;  2M8E A;  1A04 A;  3RKX A;  1T0F A;  3KP4 A;  2GZW A;  4N9I A;  1LJ9 A;  5D8L B;  4BXU A;  3P9K A;  1X3U A;  4CO8 A;  3Q9S A;  1T98 A;  4HQM A;  3F22 A;  4YII A;  5FGM A;  4ENJ A;  3FWE A;  1YS7 A;  1WSU A;  2L4A A;  2UZK A;  3KFW X;  4GXO A;  4IJA A;  3MAJ A;  4IRI A;  2Z99 A;  1K79 A;  2XIG A;  1XSD A;  4IPA A;  1IXC A;  3J80 Z;  3E5Q A;  2IT0 A;  1ZLK A;  4P96 A;  4L9T A;  4B8X A;  4K2E A;  4XLN F;  1ZLJ A;  4KDP A;  5CYV A;  3BOQ A;  3L09 A;  2GA2 A;  1LDD A;  1IAW A;  4HV5 A;  3FHZ A;  2BYV E;  1KYZ A;  5L3F A;  3I59 A;  2FOK A;  2ZXJ A;  1K6O A;  2VBW A;  2FU4 A;  3QPH A;  3RYR A;  1Z1D A;  1FPQ A;  4G94 A;  3GF2 A;  2M5W A;  3BDD A;  3E97 A;  4L5I A;  1IRF A;  1TNS A;  2ZBK A;  3HTS B;  2OA4 A;  2DI3 A;  1R5H A;  3GZ6 A;  4L9N A;  5KK1 A;  2GQQ A;  4EQQ A;  4S04 A;  4Y15 A;  1J75 A;  2UXX A;  2L01 A;  4ASN A;  5CLS A;  2HWV A;  3J81 Z;  1FYM A;  1EH8 A;  1JGS A;  2MC3 A;  3LFK A;  3OV8 A;  4P5O A;  3ECO A;  2KKO A;  4L0Z B;  1BIB A;  1DDN A;  3T8T A;  3IWF A;  3R0A A;  4FHT A;  6PAX A;  1IF1 A;  3MEX A;  2QM3 A;  1XGM A;  3IHU A;  1K7A A;  4N0B A;  3CO7 C;  1FOK A;  1L3L A;  5FD6 A;  3GFL A;  3REO A;  2RGV A;  3I0T A;  1U6G A;  3P7N A;  5JR3 A;  4IHS A;  2KIU A;  2GXG A;  2EWN A;  5LGU A;  2JRT A;  4EM2 A;  1K78 B;  3M8E A;  3Q9V A;  5K5O A;  1Z05 A;  5JHU A;  5HDN A;  4I09 A;  4FX0 A;  1HKQ A;  5BPI A;  3F6V A;  1KA8 A;  4ZYH A;  2VBX A;  3IWZ A;  3GW2 A;  3WTW C;  2A69 F;  2QEN A;  1B1B A;  2P8T A;  3QRF F;  4HF2 A;  1ZAR A;  1KGS A;  4HX4 A;  2RVC A;  5D5U B;  4JBA A;  3EUH A;  1D8J A;  4F7Z A;  4EJW A;  3V7S A;  4OOI A;  3ELK A;  2BEO A;  1YW9 A;  3E6M A;  3WTZ A;  1R1T A;  3JAM K;  5K5Q A;  3IL2 A;  3WU1 B;  1S7O A;  4LJZ F;  3N4M A;  1PUE E;  3HYI A;  1BC8 C;  3DKW A;  3TDU C;  2EJR A;  3GWZ A;  5JVT A;  1F4K A;  1FC3 A;  2ADU A;  2YU3 A;  4CIC A;  2XUB A;  2CGP A;  1FX7 A;  3F3X A;  1W5S A;  2RV8 A;  5AIQ A;  4WF2 A;  5DUK A;  3GYH X;  5D6F A;  2YSR A;  5DDG A;  3K1M A;  2O8X A;  5ILS A;  3LA7 A;  5K5R A;  2FA5 A;  4RS8 A;  4I2O A;  4YFX F;  2M30 A;  4MQ9 F;  2GIV A;  3FXU A;  1KU3 A;  3DV8 A;  2K7L A;  5DYM A;  4HBL A;  5E8G A;  2P6T A;  2F5E A;  1F9N A;  4HOB A;  3WTT C;  2ZFW A;  5LGN A;  3GFJ A;  4EGZ A;  1DPR A;  2IP2 A;  3MFK A;  4TV7 A;  1ODD A;  1XSX A;  1H9T A;  4EJT A;  4HZF A;  4OMZ A;  4CXF A;  4DQ2 A;  2ISZ A;  2ESH A;  2XKO A;  4MEY F;  2CQK A;  2P5L C;  2PI0 A;  4U88 A;  4U7D A;  2QQB A;  3F8F A;  1QNT A;  1YTY A;  3EDP A;  2P7V B;  1J0R A;  3ZMD A;  4H0E A;  2XKP A;  4Z2Y A;  2LNB A;  3T0Y A;  2M45 A;  3C18 A;  2PN6 A;  2HKO A;  2HS5 A;  4LFU A;  1IW7 F;  1MZB A;  2EK5 A;  3WTS C;  1UST A;  3TO9 A;  3QP6 A;  3DPL C;  4ZZL A;  4ZYE A;  2B0L A;  2HTS A;  1D3Y A;  2FNP A;  2RDP A;  3HHH A;  2KRF A;  5HS9 A;  1RNL A;  4MEX F;  1D8K A;  3MZH A;  5EEH A;  3HSR A;  3WE3 A;  1TQP A;  1FZP B;  3SZP A;  4UHT A;  2H94 A;  1W4M A;  5HLH A;  1WWX A;  3N97 A;  3G73 A;  1G3S A;  5ICC A;  3I53 A;  2VBY A;  2XAH A;  1LEB A;  3KET A;  3PQJ A;  2ZKZ A;  2VE8 A;  1V4R A;  5LEJ A;  1ZRE A;  2LF8 A;  3K1N A;  4KYW A;  2DBB A;  4HX8 A;  1IN7 A;  3VB2 A;  3FZV A;  3GLX A;  3ZQ7 A;  2QBY A;  2CSO A;  2H09 A;  2DTR A;  1XB4 A;  1IUY A;  1KQ0 A;  1GVJ A;  2VXZ A;  1R00 A;  5JFR A;  4GO1 A;  1I1G A;  3EET A;  2OU2 A;  1RZ4 A;  1DUX C;  4GYI A;  3ZPL A;  5DCF A;  3RTR A;  1DP7 P;  1XD7 A;  3HSE A;  1RIO H;  1QQI A;  2JZY A;  3CO6 C;  3KLN A;  4LLN A;  4M6X A;  3CJN A;  1FYK A;  2STW A;  2MH9 A;  4OIP F;  1U3E M;  1XMK A;  3MZY A;  1YW8 A;  1SD6 A;  4HAM A;  3BPX A;  1P2F A;  3DXJ F;  3HHG A;  3P9C A;  4I98 B;  3WG9 A;  3KEQ A;  1ZGA A;  2F5C A;  2LF7 A;  1FSH A;  1U5T C;  2EA2 A;  3AAF A;  4OMY A;  5D6E A;  4RB0 A;  2M87 A;  3ZMS A;  2O0Y A;  2HFH A;  4M74 A;  3TOB A;  2DT5 A;  3ZMT A;  1KQ9 A;  1B59 A;  3IC7 A;  3BPV A;  1HW2 A;  3V8K A;  2VON A;  1BI1 A;  3WTX C;  1FBU A;  2H6B A;  2FNA A;  1FYL A;  2G7U A;  4NQW A;  3V4G A;  4KIG A;  1L0O C;  3KP7 A;  1J7K A;  4LG0 B;  2OBP A;  3ERE D;  3WU0 A;  3D5L A;  4Y13 A;  4D0P A;  5L3D A;  3WTY C;  3E5X A;  2QQ9 A;  3PFI A;  3RDI A;  2IJL A;  3KCC A;  2K02 A;  1XGN A;  5E1W A;  1P92 A;  2W85 A;  1KU9 A;  2ZJ2 A;  3F72 A;  5TJJ A;  2VN2 A;  4IVN A;  4LLL A;  2BBY A;  2JTV A;  3ISP A;  1P4X A;  3CUQ B;  2CO5 A;  3L9F A;  2A61 A;  5LRS A;  5DEQ A;  5L3C A;  2X0L A;  2M1B A;  2E7X A;  4L18 B;  4WXH A;  1R22 A;  1S6L A;  1YO5 C;  4ETS A;  3W6J B;  3HUG A;  2FBH A;  2V9V A;  1HW5 A;  4ESF A;  3KZY A;  1BBY A;  4HLY A;  2A5Y B;  2QUF A;  4XBF A;  4HQE A;  5DD4 A;  3HOS A;  1KU2 A;  2A07 F;  1FBQ A;  2IA0 A;  1MDM B;  1JHF A;  2AXL A;  2O3F A;  4LGW A;  1HKT A;  5HLG A;  4RAY A;  2K4J A;  3S2W A;  1SD7 A;  2HYF A;  2J5P A;  3M8F A;  2XAS A;  1SD5 A;  4HF0 A;  3HIF A;  2P7C B;  5TRD A;  5D4R A;  1CF7 A;  3ZN1 A;  4KFC A;  4G6D A;  3WGG A;  1LNW A;  4BHC A;  4CZZ A;  1QO0 D;  2MA3 A;  3IRQ A;  4LK1 F;  3FM5 A;  2TDX A;  3I64 A;  3GO5 A;  3WE2 A;  2UXN A;  4Q5S F;  4A0Z A;  4OIO F;  2XHK A;  5F1R A;  2EFO A;  1IN4 A;  1XSV A;  1OYI A;  5ICF A;  1SMY F;  3FMQ A;  4KIF A;  3VFZ A;  1HQC A;  4QWQ A;  2NYX A;  1I5Z A;  1UHW A;  4A5N A;  4BHP A;  4AD9 A;  4BAY A;  5LEK A;  3TQN A;  1O7F A;  3HRU A;  1YLF A;  3T1B A;  1G3Y A;  5FD5 A;  1S29 A;  3DPT A;  1FT9 A;  5A2Q Z;  4UUV A;  5EEG A;  1XDS A;  3DP7 A;  4MHG A;  2D45 A;  1SFE A;  3QU3 A;  1EV7 A;  4G8X A;  4HDU A;  1IXS B;  1S8N A;  3IKV A;  3M9A A;  1ZH5 A;  2QYO A;  1JHH A;  5HDG A;  4HA8 A;  5FLX Z;  2KIF A;  3JSO A;  5CVU A;  4OIR F;  1W7P D;  2NNY A;  1CGP A;  1BC7 C;  1AWC A;  4KN7 X;  4A12 A;  4YG2 F;  3ZMU A;  4DNC A;  4G7H F;  2L02 A;  3E6C C;  1U8R A;  4KT5 C;  3WTU C;  2K4B A;  3F8N A;  2QQA A;  4HF1 A;  1YIO A;  2NS0 A;  2PMU A;  3TO6 A;  4M71 A;  3I5U A;  1EH6 A;  3SHF A;  1FNN A;  3KP6 A;  2FBK A;  1G3T A;  4PGG A;  2V1X A;  2V1D A;  4ENM A;  4IF4 A;  4QLC U;  3J7A O;  1W7P A;  1IN6 A;  2QLZ A;  1OYW A;  4PZJ A;  4CGZ A;  3R6S A;  3NQO A;  5HS7 A;  4EVI A;  1F5T A;  1U5T A;  2Z33 A;  1B9M A;  3ABT A;  2OD5 A;  4YFN F;  2OZ6 A;  5FFX A;  2HQN A;  2W25 A;  3ZP5 A;  3D0S A;  4L9V A;  4AWX B;  3TDZ C;  1MJB A;  2A3S A;  2D1H A;  4LD5 A;  2DPD A;  4A6D A;  4ZYG A;  5D4S A;  5LHG A;  4HLX A;  3FMR A;  4HYE A;  4HDV A;  2Q2E A;  3T5X A;  3I59 B;  1LVA A;  2CW0 F;  2BGC A;  1WKM A;  1WI9 A;  2FQ3 A;  5E17 F;  4G9Y A;  3HSF A;  2Q0O A;  3CLO A;  1CF7 B;  2C6Y A;  3GVA A;  1TNT A;  3SZT A;  4I0B A;  3BZ6 A;  3JW4 A;  3WTV C;  2O03 A;  4ESB A;  1WQ2 A;  4AIJ A;  2P4W A;  3J80 K;  1P4W A;  3LWF A;  2RKH A;  1OKR A;  2DAO A;  2IA1 A;  2K27 A;  4LMY A;  3ZMV A;  1TW2 A;  2O61 A;  3CDH A;  1USS A;  1B6A A;  3DFG A;  1HW1 A;  2P5V A;  4WXC A;  2XAQ A;  2MD5 A;  1T6S A;  4A0X A;  1C0W A;  5CVR A;  3E5U A;  2KIM A;  3F8B A;  5LGT A;  1B9N A;  5J8F A;  1MGT A;  2R7F A;  1EH7 A;  4AVP A;  1BI0 A;  3HRS A;  4M72 A;  5L3B A;  4JQF A;  3WGH A;  4HW0 A;  1R1U A;  4OIQ F;  4U0W A;  1R1V A;  3NEU A;  1IN5 A;  3COA C;  1MJ9 A;  3J81 K;  4XSZ F;  5FB2 A;  1S7A A;  2IW5 A;  1R58 A;  3R61 A;  4PCQ A;  4PGH A;  2PFB A;  1B4A A;  3C3W A;  3ROU A;  5ILV A;  3I54 A;  2NNN A;  5CJ9 A;  4FX4 A;  3E3V A;  2BE5 F;  1LDK B;  5E1Z B;  4L9J A;  4P55 A;  3H92 A;  3K69 A;  2DK5 A;  4E70 A;  2V6C A;  3GEZ A;  5D8K B;  1MKM A;  1OR7 A;  4KIC A;  1I1S A;  5CVI A;  2YR2 A;  2VOP A;  5LLQ A;  2RNJ A;  5D5W B;  2VOD A;  1TLH B;  4WXD A;  2EFN A;  1GXQ A;  2G7H A;  3I58 A;  1YFH A;  3E6D A;  3QOP A;  3C1D A;  3R4K A;  1AOY A;  2E7W A;  4LB6 B;  2E1C A;  2P6S A;  2CFX A;  2FE3 A;  5K1Y A;  3KP5 A;  1MJA A;  4KN4 X;  1ZRC A;  4WX9 A;  4EGY A;  1J2X A;  1T38 A;  2ISY A;  1VTN C;  3JSP A;  3C7J A;  2XV4 S;  2A68 F;  4NB5 A;  1J59 A;  2FF4 A;  3KP2 A;  5IT9 Z;  3LAP A;  2ZME A;  1UHM A;  4UV9 A;  5BOX A;  3U9G A;  1SD4 A;  1FY7 A;  4MQV A;  4M73 A;  1BI2 A;  1HXD A;  3WGI A;  2EB7 A;  2Y0M A;  1PP7 U;  4P9U A;  2KJC A;  3NRV A;  2JPC A;  2XAF A;  4RGS A;  1UCR A;  1O57 A;  5BQT A;  2P5K A;  5L3G A;  3LQR A;  5LRR A;  4WWC A;  2DQR A;  2F5D A;  3P9I A;  3IRR A;  3ZN0 A;  3F6O A;  4YFK F;  4RGR A;  3ZMZ A;  1W5T A;  1SMT A;  1KU7 A;  1Z91 A;  5DCM A;  2ZCW A;  2PEX A;  3M1E A;  5HLI A;  3TGN A;  2W57 A;  3BJO A;  3K2Z A;  3LA2 A;  3T8R A;  3L2C A;  2OAZ A;  2ESN A;  2L3D A;  2QVO A;  3F8C A;  1REP C;  4RGX A;  1ZG1 A;  5ICG A;  4N9H A;  3OOP A;  1ZYR F;  4ENK A;  3FX3 A;  4CHU A;  4M9S A;  1T39 A;  3BRO A;  2E1N A;  2R3S A;  5D5X B;  3RI4 A;  4YIF A;  2DK8 A;  1ZHF A;  2W84 A;  3KE2 A;  5F64 A;  4I02 A;  2PMH A;  1ZG5 A;  2XGX A;  2FXA A;  3E6B A;  3MWM A;  1FP1 D;  3SXY A;  1YYV A;  4GCV A;  1K78 A;  3IKT A;  4KMF A;  2JPB A;  2LKP A;  2W24 A;  1IRG A;  2DU9 A;  1O3S A;  1YG2 A;  2K86 A;  1R23 A;  2ACJ A;  1J5Y A;  1R5G A;  4EV0 A;  1RUO A;  1FWZ A;  2XRO A;  1RUN A;  4I0A A;  2FBI A;  4IRH A;  3HRT A;  1G6N A;  3KEO A;  2VOO A;  3CTA A;  2YPR A;  4G6Q A;  3H3U A;  4XLP F;  1QPM A;  3I71 A;  2EV0 A;  2IRF G;  4G7Z F;  1BOA A;  2DPU A;  2FEZ A;  2PBI A;  2MLG A;  3HRM A;  2KJB A;  1SFX A;  2CG4 A;  3Q5F A;  1WRJ A;  3RKW A;  4L5J A;  2ZO4 A;  1UFM A;  4UNO A;  5FO5 A;  3W6K B;  1O3R A;  2BV6 A;  2OQR A;  3ECH A;  1TW3 A;  1OMI A;  5FFZ A;  3GFI A;  2HQR A;  4U7B A;  3FF5 A;  1GHC A;  1YS6 A;  4Q48 A;  3RJP A;  2EA4 A;  3BWG A;  4FT8 A;  2F5F A;  3V7R A;  2WV0 A;  1YQA A;  3ULQ B;  4O3M A;  2QBY B;  1ONV A;  4L0Y B;  3GFM A;  2ZME B;  1MD0 A;  1TQM A;  4LB5 A;  2NAZ A;  1DPU A;  5J6X A;  4MTE A;  4RGU A;  3CUQ C;  2WTE A;  3F21 A;  3PQK A;  3BY6 A;  2ZNZ A;  2YX7 A;  1BI3 A;  2FRH A;  3EYI A;  1LQ1 A;  2XVC A;  4UVA A;  1O3T A;  3QPT A;  3I4P A;  4R8H A;  3B02 A;  3K0L A;  3B73 A;  4UV8 A;  5DCM B;  1OYY A;  4KMU X;  4CYD A;  2HDC A;  5IT9 K;  4ZZD A;  3HTU A;  5HOO A;  1BIA A;  2Z5U A;  1R36 A;  4EM0 B;  3FMS A;  2NRA C;  5E8I A;  4O6J A;  4UVC A;  5LHI A;  1P6R A;  1H9G A;  4BH9 A;  1XGO A;  3GX4 X;  1QGP A;  1V3F A;  1JXS A;  1ON2 A;  4A2U A;  4R1H A;  2EFW A;  1LB2 A;  2DO7 A;  1HSJ A;  2VT3 A;  3MCZ A;  5DV5 A;  3L7W A;  3DQV C;  1LEA A;  1STZ A;  2L54 A;  1XCB A;  2FSW A;  4G7O F;  4R79 A;  1E17 A;  4LLG F;  3RPU A;  1ULY A;  1BN5 A;  2UWM A;  2HEO A;  1QBJ A;  2YX4 A;  1P4A A;  2XAJ A;  4AIH A;  2CYY A;  4M6Y A;  4XSX F;  5ERI A;  1GXP A;  1PDN C;  1Z6R A;  1BJA A;  2WC2 A;  2MLK A;  1TQI A;  1O7L A;  3RYP A;  4ZH4 F;  5BS6 A;  3ML6 A;  4WK8 F;  5AIP A;  4MTD A;  1XMA A;  1TTY A;  1ZGJ A;  2PJP A;  2VC0 A;  4RB2 C;  1G3W A;  4JK1 X;  4KNY A;  4IXA A;  2DQL A;  4BNC A;  1UB9 A;  4KIB A;  4ENN A;  4MGR A;  4UVB A;  4ON0 A;  5JI6 A;  3FXR A;  3RIR A;  1LDJ A;  2EFQ A;  4M9X A;  5DUI A;  2HGC A;  2VBZ A;  2ELH A;  3MQ0 A;  3LA3 A;  2F2E A;  2ETH A;  2IA2 A;  2OQG A;  2CWE A;  3U2R A;  3L00 A;  1Z9C A;  1IXR C;  2L4M A;  4I7H A;  1E2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...