2FBKA

The crystal structure of hucr from deinococcus radiodurans
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
172
structure length
156
Chain Sequence
DTAALLERIRSDWARLNHGPSAGPMLTLLLLERLHAALGREIERTYAASGLNAAGWDLLLTLYRSAPPEGLRPTELSALAAISGPSTSNRIVRLLEKGLIERREASIRLTPQGRALVTHLLPAHLATTQRVLAPLSAQEQRTLEELAGRMLAGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Transcriptional Regulator HucR from Deinococcus radiodurans Reveals a Repressor Preconfigured for DNA Binding.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Transcription
molecule keywords transcriptional regulator, MarR family
total genus 52
structure length 156
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fbkA00
4ZZLA 4HF1A 3GEZA 1KQ8A 3W6JB 2DO7A 3KLNA 4HYEA 1ZN2A 4BXUA 1FSEA 2VT2A 3DV8A 4MEXF 2KRFA 2F2EA 3U2RA 3QPTA 1B59A 2YSRA 4YIFA 5TRDA 3QU6A 2ZXJA 2MH2A 4LB6B 1MJBA 2HQNA 5A2QZ 4CHUA 5HOOA 4KIBA 2DPDA 2BV6A 2ZMEB 1BM9A 3ISPA 4P9UA 1I1GA 2IPQX 3QAHA 1I27A 1O7LA 1FYLA 4A12A 2MLKA 3ULQB 2FNAA 2VN2A 3EYYA 3GFIA 1ZG1A 2KIMA 5LEJA 2IP2A 1RUOA 3OV8A 2UXNA 2E1NA 1ODDA 1J0RA 3I53A 1YYVA 3RIRA 1HSTA 5HVQC 1RUNA 1G3WA 1SMTA 3Q9SA 4NQWA 3JW4A 5K1YA 3J81K 2KJBA 2Z3YA 4LJZF 1R1VA 1YLFA 4CICA 4Q47A 1G3SA 1W7PD 1BI0A 3V8KA 3MFKA 1XMKA 3AAFA 2W57A 2LSOA 4HLXA 4JBAA 4KFCA 1YQAA 3MZHA 2BYVE 3ZMUA 4XRFA 4LB5A 1MGTA 3FXRA 4A2UA 2J5PA 4IXAA 2PI0A 2IJLA 1ZGJA 5F6FA 1IAWA 3I64A 2QVOA 1R5GA 2DU9A 4O5VA 4RB3C 3ERED 2OAZA 3QRFF 4CZZA 1HXDA 2P5LC 1GXPA 3WU1B 2QLZA 1UFMA 2FBIA 2O0YA 3WGHA 3BOQA 2A6HF 1KU9A 4YFXF 3ZQ7A 1RI7A 3KE2A 4KIGA 1T2KA 5HS7A 5ILUA 4U0YA 3KEOA 2EFNA 2QQAA 2OZ6A 5L3GA 4YFKF 3F8FA 5L3FA 5E1WA 1LNWA 2FE3A 5LGNA 2Q2EA 3G73A 1RNLA 4UVCA 3RKWA 1BJAA 5J8FA 4UVBA 5DDGA 5KVRA 3GVAA 2PN6A 5LRSA 4U88A 5IT3A 1PP8F 2PBIA 5FD5A 1YW8A 3B02A 2JZYA 1YS7A 3JAMZ 1W5TA 3WE3A 3I54A 4ENNA 3RI4A 2LNBA 2H27A 3DEUA 3HTUA 4ESBA 1ZH5A 4P55A 4BYYA 4UNOA 1NHAA 2XAFA 4E70A 2XRNA 2EA2A 3I71A 3LSTA 4GO1A 4YFNF 4KDPA 2FU4A 4OIOF 5E8IA 4NB5A 1IRFA 1YFHA 3WTXC 5D5XB 2VT3A 3KLOA 2QZ8A 2ESNA 3H92A 3HHHA 3FZVA 2MH9A 3I59B 2P7CB 3CLOA 2KKOA 1T6SA 1B1BA 2XAJA 3MCZA 3E5UA 3ELKA 5FGMA 4KNYA 2M1BA 3WG9A 1Z9CA 2DFIA 3LWFA 2XAQA 3GFJA 3WTVC 3RPUA 2YX7A 2HQRA 3QP6A 3V7CA 4BNCA 3QU3A 3SZTA 1I1SA 5HLIA 4L0ZB 1TQPA 2FF4A 4U0WA 1LJ9A 1MD0A 3BDDA 5D8LB 1BC7C 1LDKB 2XGXA 3M1EA 1FYKA 3TDZC 4RS8A 3P7NA 4B8XA 1TLHB 3SHFA 3O2PE 3F22A 3CUQC 1QBJA 1MJ9A 3CO6C 3BWGA 2FSWA 5CVJA 4L0YB 1HW1A 3E97A 3J7AO 5FD6A 3HSEA 5LRRA 3VB2A 3WODF 3BZ6A 2HTJA 3U1DA 4GGGA 3R0JA 3K1MA 5D8KB 3ROUA 5ILSA 3SFZA 3EQLF 3V4GA 3GF2A 1R7JA 3P9KA 5DUKA 5HS8A 1LEBA 2L54A 3HSFA 3N4MA 2NRAC 4FHTA 3V7SA 4Q5SF 1U8RA 4L9VA 3F8MA 4AWXB 1OKRA 2KIFA 3FM5A 4KICA 3VFZA 4WK8F 5BPIA 4HQEA 2EV6A 4HLYA 3FMRA 5H6RA 5EEHA 3KP4A 2PFBA 4PDKA 3RTRA 2COMA 4GYIA 1TBXA 1BI3A 2FQ3A 2LF7A 1ZYRF 2NYXA 1GVJA 4M9ZA 2MD5A 1R5HA 2VC1A 4N9IA 5BMZA 1SD4A 1D3YA 3DP7A 3CUOA 5FFXA 2EJRA 5J8CA 1JE8A 2QBYB 1H9TA 1E17A 3K9TA 4EJUA 3F23A 4OIRF 4N9HA 1CF7B 1JHHA 3E6DA 2A5YB 3GLXA 1R58A 2P6TA 4PGHA 3MAJA 4KMUX 4M9SA 4IRHA 2Y48A 1DPUA 4RB0A 4ZH4F 3F3XA 2GWRA 5ICFA 1D8KA 5AIPA 3ZMVA 4FT8A 1I5ZA 4XBFA 2BE5F 1IN5A 4YIIA 2W24A 5CLSA 4I7HA 2ISZA 4WWCA 2OD5A 4U0VA 3SXYA 1XCVA 3I59A 2ISYA 1BOAA 3FX3A 1J2XA 4KUMA 1JXSA 2V9VA 1KU3A 3WTYC 2E7XA 3V8JA 5LLQA 1Z91A 1QZZA 1FC3A 2HDCA 4ENJA 1U5TA 2EFPA 1ZRCA 4LMYA 1EH8A 2L4AA 3GZ6A 1LDJA 6PAXA 2RGVA 2D2WA 4N0BA 4JK1X 4R8HA 2FBKA 3BJ6A 3LA2A 3IKVA 2HKXA 3WTTC 3FXQA 1USSA 4HW0A 3EDPA 3HIFA 3Q9VA 3CO7C 4KN7X 1HBXG 4OINF 4HOBA 5ICGA 2MA3A 3T0YA 3HOSA 3IRQA 2F5FA 1UHMA 2A6EF 1XGMA 2DLLA 3C7JA 3HRTA 4EVIA 2PEXA 3BROA 3V8LA 1IXRC 4HF2A 3EYIA 4G6QA 5F1RA 2DPUA 3E3VA 1H9GA 3WTWC 1XDUA 2ADUA 4RGUA 1J75A 3GWZA 1F1ZA 2K7LA 4I2OA 1IN8A 2K02A 3L09A 4ZYDA 5AIQA 4ENMA 5LGTA 1ZG3A 1ULYA 3PQKA 2HFHA 1B6AA 2LKPA 4PZJA 1MJAA 5D5VB 1ON1A 3BJAA 2X4HA 1TQMA 4HX8A 3LAJA 3FWEA 4HV6A 1YW9A 3ZMTA 3R60A 5E8GA 1R36A 2VC0A 3KP6A 4L18B 4HBLA 1Z6RA 4WXHA 1IN7A 1XGSA 4RGXA 2FNPA 2UZKA 2EFQA 1X3UA 5DCMA 2VOPA 2MC3A 2JSCA 2VXZA 3KZYA 1D8JA 4EJVA 5FB2A 2GAUA 1HKTA 3MZYA 1Z05A 2IA1A 2HOEA 2FRHA 4RGRA 1J7KA 4M72A 1U5TC 4LFUA 3RYRA 4GCVA 2L02A 3GYHX 3GXOA 4M9XA 3ZMZA 5FLXK 3DXJF 1TNSA 1BBYA 5E18F 1TQIA 2WWYA 3KZZA 5H20A 2QYOA 2QQ9A 4K2EA 2OQGA 2YPRA 1W4MA 2PLYA 1FP2A 2XVCA 1KU7A 5FO5A 4G7ZF 1UHWA 1HKQA 4EM2A 5E1ZB 3F72A 1U5TB 2A69F 2W85A 2OQRA 4KYWA 3T1BA 4HAMA 1L3LA 5DYMA 1WRJA 5DV5A 2V1XA 3BP8A 4EM0B 3L7WA 4EGYA 4FX4A 3C3WA 2XKPA 2YU3A 1WI9A 2XAGA 5LHGA 1U6GA 5EEGA 1B9NA 4M74A 5ICEA 3F8BA 4CDGA 4AVPA 1K6OA 2LDUA 3K0LA 3GO5A 2WV0A 4NHJA 1T39A 4OMZA 4WF2A 5K5QA 1ON2A 1LEAA 3SZPA 5IT9Z 4ASNA 3FMQA 1P4AA 3PFIA 2VBYA 4XSXF 4LK0F 1K7AA 1OPCA 3CDHA 2M8EA 2H6CA 2VBZA 2GZWA 4Y13A 2H6BA 2EV0A 5DD4A 4H0EA 2DI3A 1FNNA 1R1TA 2DTRA 1S6LA 4OOIA 3I0TA 4EJOA 3F6VA 2OU2A 2DK8A 2RV8A 4EM1A 1PUEE 2ZJ2A 1FLIA 2W84A 2HZTA 3NRVA 1O3SA 2BBYA 2E1CA 4O6JA 2ESHA 1KQ0A 1WSUA 2R7FA 4Q48A 1OMIA 4DQ2A 5JHUA 5CYVA 1XMAA 3QP5A 4CXFA 3JSOA 3DQVC 3QOPA 2P5KA 2Z33A 3L00A 3J81Z 3ZPLA 3CTAA 4JQFA 1U78A 2CWEA 5FLXZ 2GXGA 2CGPA 3RKYA 4LLNA 3BY6A 1P4XA 5CVUA 3ECHA 4YG2F 2L4MA 3S2WA 4KN4X 2F5DA 5L3EA 3PQJA 5D4SA 4M6YA 4WCGA 1EH6A 5LHHA 3VEPA 1K78B 2M5WA 2RVCA 2M45A 3G3ZA 1UCRA 2XAHA 3HSRA 4DNCA 5DEQA 1W7PB 4UVAA 4RB2C 2TDXA 3ABUA 5LBQA 1SD5A 3IHUA 4LLLA 2Y75A 3RJPA 2GA1A 2OA4A 3RPQA 3RKXA 4UV8A 1KYWA 3EETA 4FX0A 1EV7A 4OU0A 2Q8KA 1EH7A 4U7BA 1HW2A 3KETA 2EFWA 4HZFA 3TKYA 5JR3A 3R4KA 5D6EA 4BQAA 1TTYA 2IT0A 1P2FA 2ZBKA 3GFLA 2FMYA 5D4RA 1XSXA 1A04A 2HS5A 3L2CA 1FOKA 3MEXA 3HYIA 1SFXA 2HYGD 1HQCA 3R6SA 4TV7A 1IZ1A 1Y0UA 2EA4A 5TJJA 2JPBA 1XGNA 4HX4A 4P96A 1TNTA 1XSDA 1IN6A 3I4PA 4OIPF 4ESFA 5JI6A 2V6CA 2PMHA 1WWXA 2PQ8A 4XLPF 2ZNZA 3M8FA 5L3DA 2VODA 5E1XA 2C6YA 2XROA 2NNNA 1HKSA 2CO5A 3R0AA 1F5TA 3FXUA 1FPQA 3TGNA 1KGSA 1SD7A 4KIFA 1RIOH 4GYGA 1XN7A 4GXOA 2A07F 2IRFG 5HLHA 1F4KA 3TO6A 1IXCA 2A68F 3C18A 1P4WA 3HRMA 4U7DA 5D6FA 3KP2A 1LVAA 1DP7P 3WGIA 2AS5F 4CGZA 1ONVA 3T5XA 2G7UA 3LQRA 1AOYA 1P6RA 1SFEA 5BPDA 2EB7A 2MLGA 3VODA 3WGGA 4A6DA 2GA2A 3FMSA 2IW5A 2QWWA 2CSOA 1G3YA 1KYZA 2F5EA 2FBHA 3WTUC 2D1HA 1YTYA 4P9FA 1IXSB 3ZMSA 4RAZA 5D5WB 3B73A 2IA0A 4MHGA 1O3RA 4R1HA 2HGCA 4XLNF 3T8RA 1IUYA 4AIHA 2DAOA 5LHIA 2D45A 2YX4A 4G94A 4L9TA 3R61A 3O3KA 3DPTA 2BGCA 2JRTA 3IKTA 2ELHA 4G6DA 2O8XA 4LG0B 3FF5A 3SQNA 3KCCA 1MKMA 2XIGA 1TW3A 2FOKA 1B9MA 2P8TA 2H09A 3IRRA 1Z6TA 4IJAA 2DW4A 2DK5A 4QWQA 4LK1F 2R7DA 2VOOA 1ZGAA 4BHPA 4R79A 1J9IA 4LLGF 4ZYEA 2G7HA 4I0BA 1O3TA 1MDMB 2P6SA 1S7AA 1CGPA 3ECOA 4Y15A 3ZMDA 4AIJA 4A6EA 1YS6A 3TOBA 4A0XA 1DUXC 1S3JA 4WXDA 1S29A 4UHTA 4EQQA 3ZN1A 3JAMK 1OR7A 2ZO4A 1FT9A 4ON0A 2O03A 5ICCA 1FSHA 2EV5A 1SFUA 1LQ1A 1UB9A 1QGPA 3KFWX 4A0YA 4S05A 3GX4X 5FFZA 4BAYA 5KK1A 2UXXA 2HYFA 2E7WA 4I0AA 3D5LA 1S7OA 4HX7A 3E6BA 4G7HF 2A3SA 2Z5UA 1ZAOA 3K1NA 3N97A 2DQLA 3MQ0A 3K69A 2QBYA 4BHBA 3V7RA 1K79A 1S8NA 3EUHA 1RZ4A 2CG4A 3ZP5A 2JPCA 2RNJA 1HSJA 4UUVA 4A5NA 4IF4A 5BOXA 1BIBA 5L3CA 1B4AA 4EJWA 3CUQB 4I98B 2WTEA 1KA8A 3GFMA 3W6KB 2VONA 1C0WA 3T8TA 1XDSA 4ESJA 3DFGA 1O7FA 5LEKA 4MEYF 3E5XA 2ETHA 2XV4S 4MTEA 5L3BA 2A61A 2PJPA 3J80K 3KP7A 5A2QK 4LD5A 3JSPA 3MWMA 2QENA 4S04A 1E2XA 2RKHA 1P92A 2R3SA 2GXBA 3WTSC 1QZYA 1ZG5A 2BEOA 4A0ZA 2RC4A 3CUQA 4IRGA 3WTZA 3BPXA 1J5YA 3VOEA 3KEQA 2VBXA 3QPHA 2STTA 1MZBA 2J5OA 1ZREA 4M71A 2HTSA 5ERIA 4MNUA 1ZARA 4L5JA 1SMYF 1R00A 3C1DA 5CVIA 1XCBA 1FBUA 1W5SA 3FM3A 2ZMEA 1CF7A 1STZA 2XASA 1BI2A 2AXLA 1PP7U 1G4DA 4MTDA 5DD8A 2PG4A 5BQTA 3RYPA 4PGGA 1USTA 2L01A 4ETSA 3ZN0A 1FBSA 3IWFA 5JFRA 3TQNA 3M7GA 4B09A 5H6QA 3GW2A 1O3QA 1U2WA 3TDUC 4LGWA 3P9CA 3ML6A 2YR2A 2KJCA 4P5OA 3COAC 1BC8C 4KMFA 4EGZA 2CYYA 4HV5A 2RN7A 1R22A 4EMSA 1XB4A 1BI1A 3DF8A 4OIQF 5JVTA 5CVVA 2Q0OA 4A5MA 1SAXA 1YO5C 2OZUA 1H0MA 3K1PA 1XSVA 1MDMA 5DCFA 2GQQA 2K86A 4IVNA 4OMYA 1DDNA 1ZLKA 1R23A 3KP5A 2L3DA 3KP3A 2QUFA 3E5QA 2O61A 1IW7F 3LA7A 4MQVA 4UV9A 2Y0MA 1V4RA 4XSZF 2M87A 5LGUA 3BPVA 3IWZA 2P5VA 3M8EA 1IF1A 3HTSB 4L9JA 4ZYGA 1G6NA 1GHCA 4QLCU 1ZHFA 3RDIA 5HLGA 5CJ9A 2P7VB 2DQRA 1J59A 1VTNC 2K4BA 4G7OF 3TOAA 2XKOA 3GZ5A 1AWCA 2JT1A 1Q1HA 2WC2A 3IC7A 3TO7A 1QO0D 3HRUA 2VE8A 4HQMA 1FBQA 2RQPA 3Q5FA 5CVRA 1YW7A 2HEOA 2K27A 1QNTA 4L5IA 3REOA 5ILVA 1U3EM 4KT5C 2NNYA 3D0SA 3DPLC 1QQIA 5HDKA 4KA4A 4WXCA 2IA2A 4CYDA 4ZYHA 1WKMA 2ZKZA 1O57A 2EWNA 3H3ZA 2V1UA 4L9NA 3F8NA 3NQOA 2D1VA 3HUGA 1FP1D 2GIVA 3F21A 1REPC 3LQQA 3U9GA 3ABTA 2FEZA 1D5VA 1ZRFA 2P4WA 3OOPA 2NS0A 1SD6A 2Z99A 2FMLA 3WU0A 1F9NA 1DPRA 4HF0A 4BH9A 3JTHA 3HOTA 2IVMA 3BJOA 2JTVA 3CJNA 5F64A 3E6MA 2UWMA 1GXQA 4Y17A 5AONA 3H3UA 1OYIA 5K5OA 4I09A 2G9WA 4HDUA 3M9AA 5BS6A 1I6XA 2XUBA 4HDVA 5E20A 2DBBA 1FYMA 2MBFA 5K5RA 5D5UB 3HHGA 2CQKA 2DT5A 2F5CA 2NAZA 2V1DA 2OBPA 1JGSA 2KIUA 4I01A 2ZCWA 2EK5A 2XHKA 4HA8A 4M6XA 2H94A 4AD9A 2QQBA 4WX9A 1T38A 1XD7A 4PCQA 2VE9A 3GUDA 3FHZA 2Z9OA 2FXAA 2ZFWA 4IHTA 1BIAA 1FZPB 1PDNC 2HKOA 2W25A 4I02A 3TO9A 5ED4A 3WE2A 2B0LA 4ZZDA 1FY7A 1XGOA 1FX7A 4G9YA 2V79A 4Q4ZF 2PMUA 3LFKA 1IRGA 2FA5A 1ZRDA 1T98A 1HW5A 4UXNA 3E6CC 2M30A 1G3TA 4MQ9F 2K4JA 3IL2A 3I5UA 1Z1DA 3LAPA 1YIOA 4EV0A 1K78A 1LDDA 3K2ZA 4Z2YA 1TW2A 1IN4A 2CW0F 2LF8A 5E17F 3L9FA 1W7PA 4IPAA 1T0FA 3HRSA 1QPMA 4MGRA 1Z7UA 1LB2A 2EFOA 3F6OA 1OYYA 3J80Z 3NEUA 4F7ZA 3JTGA 1R1UA 3LA3A 1KU2A 1OYWA 4G8XA 1BN5A 2HR3A 3P9IA 5HS9A 2ZNYA 5DCMB 5HDGA 5HDNA 1ZLJA 5IT9K 3F8CA 1L0OC 4BHCA 4RGSA 4O3MA 2ACJA 4D0PA 5DUIA 3O6BB 2HWVA 4IRIA 2X0LA 2QM3A 2STWA 1V3FA 3DKWA 4AIKA 1FWZA 4ENKA 4LG0A 2VBWA 2O3FA 3I58A 4M73A 4RB1A 1WQ2A 2O6GE 2RDPA 1JHFA 4RAYA 5J6XA 4EJTA 4IHSA 4CO8A 1YG2A 1KQ9A 2CFXA
chains in the Genus database with same CATH superfamily
1EA3A 4ZZLA 1OCTC 4HF1A 3GEZA 4XICA 1KQ8A 3W6JB 3CC4I 2DO7A 3KLNA 4HYEA 1ZN2A 4BXUA 1FSEA 3DPUA 2VT2A 3W2WA 4XRSG 3CMAI 1D5YA 3DV8A 3FHNA 4MEXF 2BHYA 2X85A 3BZKA 2KRFA 4M3EA 4N4NB 2F2EA 5EJCA 3U2RA 3QPTA 1B8IB 1B59A 3QOEA 4BXFA 2YSRA 1WH7A 4YIFA 2JRMA 4PJJA 2VUMJ 2WBMA 4XK4A 1X1BA 5TRDA 3CCVI 2JA2A 3QU6A 2ZXJA 2KISA 1WVRA 5JHFA 2MH2A 1RKTA 4ZC3A 4LB6B 1MJBA 2HQNA 5A2QZ 3DEEA 4CHUA 2I5UA 5HOOA 1BR2A 2DOEA 4KIBA 3CMMA 2R7SA 1VQPI 3PO2J 2DPDA 2BV6A 2ZMEB 1BM9A 3HC7A 3ISPA 1VQ8I 4P9UA 2R7UA 1I1GA 5F0FA 4X6AJ 1AA7A 3H3VK 2W00A 3L1PA 2IPQX 3QAHA 4M6VA 3NAUA 4HNUA 1I27A 1O7LA 1FYLA 2QA4I 1QVUA 4NC6A 4U87A 1QPIA 4A12A 5FKOA 2MLKA 3H5AA 1SAUA 3ULQB 2FNAA 1JKRC 4BQNA 4BE2A 1HCRA 3L2UA 4BEHA 3OS1A 2VN2A 3EYYA 5FLMJ 3OS0A 3DLAA 3GFIA 1ZG1A 2KIMA 2VQGA 5LEJA 2XB5A 2IP2A 2WB1N 1RUOA 3LFUA 3OV8A 1VFCA 3FKIJ 4HPQA 2UXNA 4YRVA 1DU0A 2E1NA 1ODDA 3S3MA 2DA5A 1J0RA 3I53A 1YYVA 3S2DJ 4NNJA 3RIRA 5FJ8J 1HSTA 2JUGA 2DMUA 2GOXB 5HVQC 1RUNA 1G3WA 1SMTA 3Q9SA 5TGTA 4NQWA 2BY1A 3JW4A 5K1YA 3J81K 3FBIB 4HEA2 3BG6A 1FMWA 2KJBA 2Z3YA 4LJZF 1R1VA 3NARA 1YLFA 1WJDA 3LSJA 4NDLA 4CICA 4Q47A 1G3SA 1W7PD 1BI0A 2R7VA 3V8KA 4GRIA 3MFKA 1XMKA 2R7XA 2IBDA 3AAFA 2W57A 2LSOA 4HLXA 2NOJB 3MKWB 1YRNB 1I39A 3BCAA 4IZZA 4JBAA 4KFCA 1YQAA 1N78A 3MZHA 2BYVE 2BW3A 5C4JJ 3L2QA 2X6WA 2JK3A 3ZMUA 4XRFA 4NBQA 3CCYA 1LE8A 3DBHB 4YIRX 3VDXA 4LB5A 1MGTA 3FXRA 4A2UA 1RC9A 3QYFA 1HOMA 1D1AA 5KCMA 2J5PA 4IXAA 3G4SI 2VASA 3HL2A 2PI0A 2IJLA 1ZGJA 4GFBA 2IGMA 4H4KC 1YJNI 1LKXA 2K5CA 5F6FA 2IGOA 2IEKA 4PFOA 1IAWA 3SEQA 3I64A 2QVOA 2LBFB 1R5GA 4DW6A 2TRTA 1VQ9I 4XR6A 2DU9A 4O5VA 3CJTB 4RB3C 3ERED 2OAZA 2HPIA 3WU2C 2VKEA 3QRFF 4CZZA 3EUKL 1HXDA 4XQFA 2P5LC 1GXPA 3WU1B 2QLZA 2B9SA 1UFMA 2FBIA 2O0YA 3WGHA 3DLLF 4ITVA 5J1YA 3OIQA 3HKZN 3BOQA 4EATA 2A6HF 1KU9A 4YFXF 2HYJA 4E7JA 3ZQ7A 3K70C 2AHQA 1RI7A 4ZDPA 2CFOA 2OJED 3KE2A 4BE1A 4KIGA 1T2KA 5HS7A 5ILUA 3EUAA 4U0YA 2F6CA 3KEOA 2QSGX 2EFNA 2QQAA 2OZ6A 5L3GA 4YFKF 1K4TA 2E34A 2CMPA 3F8FA 5L3FA 4CCMA 5E1WA 1LNWA 3VYTB 4CCOA 2FE3A 5LGNA 3H9QA 1AU7A 2Q2EA 3BR0A 3G73A 2E19A 1RNLA 2KLOA 2V4JC 4UVCA 3RKWA 1BJAA 2LK2A 5J8FA 1LVKA 1GV5A 2VIXA 3S17J 2JMWA 4UVBA 1JUSA 5DDGA 2WB1A 5KVRA 3GVAA 2KDZA 1LFPA 2HOTA 1XX5A 2PN6A 2EZLA 5LRSA 4U88A 4JX6A 5IT3A 1PP8F 4D5CA 2DA1A 1PVEA 3HZJA 3DU5A 4M3BA 4IOCF 2PBIA 5FD5A 1YW8A 1X3ZB 2VPLA 2ME0A 3B02A 4JYKA 2JZYA 1YS7A 3JAMZ 1W5TA 4HSTA 3WE3A 2DMNA 4LOCA 3I54A 2DXIA 3BC8A 1V5FA 4ENNA 3RI4A 2LNBA 2H27A 3KZIC 4B47A 3DEUA 3HTUA 2VKHA 2L2OA 4ESBA 1ZH5A 3LSKA 4GDFA 4P55A 4BYYA 3BLYA 4UNOA 1NHAA 2XAFA 4E70A 2XRNA 2EA2A 3ZQLA 3I71A 3LSTA 2L9RA 1WJBA 1JTYA 4GO1A 4YFNF 2ID3A 4KDPA 2FU4A 4OIOF 2L0KA 2M2EA 3F0CA 2JQ7A 5E8IA 4NB5A 1IRFA 1ACIA 2ZFUA 2XB0X 3WTXC 1YFHA 5D5XB 2VT3A 3KLOA 2QZ8A 5DM6F 2CU7A 2I10A 2BOLA 2CS3A 4XLAA 2ESNA 3H92A 2BY3A 5GADJ 4BBSJ 4Y4RA 3HHHA 2IS2A 3FZVA 2MH9A 3I59B 1SFOJ 1J09A 2CV0A 2P7CB 4KT6A 4BGDA 2E2IJ 1DQUA 3CLOA 2BVMA 3SEZA 1KZHA 2KKOA 5KAIC 3G6EI 1T6SA 1B1BA 5EEAA 1V5GA 2XAJA 3CQZJ 3MCZA 5IP7J 1A35A 4KISA 3E5UA 3ELKA 1Y0NA 4CUGA 1QVTA 2HVQA 2KPMA 5FGMA 4KNYA 2M1BA 3WG7H 3WG9A 1ETOA 4FE7A 5FRNA 1E3HA 4LG3A 4M3DA 1VNDA 2DFIA 1Z9CA 3ZGKA 2E36A 1P7JA 3LWFA 2ID6A 2XAQA 3GFJA 1BW5A 3WTVC 3K6GA 5IY5H 3RPUA 2L7KA 2CUEA 2P0WA 2YX7A 2HQRA 3QP6A 1IUFA 3V7CA 4BNCA 3QU3A 3CCUI 3E7LA 3SZTA 1I1SA 5HLIA 2E1OA 1TQPA 2FF4A 4L0ZB 2VLAA 2FUG2 4U0WA 2MGQA 1LJ9A 1MD0A 3BDDA 5D8LB 3M4OJ 4ZTFA 2JA6J 3FIWA 1LDKB 1BC7C 2XGXA 3LSHA 3RKQA 2DA6A 2F5VA 3M1EA 1FYKA 3TDZC 5DTDA 4RS8A 3P7NA 1YHQI 4JX4A 4M3FA 4B8XA 3OYDA 1TLHB 2LG4A 2QKLB 3SHFA 3A01A 3O2PE 2L5QA 3F22A 3CUQC 1QBJA 1MJ9A 4D7NA 3GTMJ 3CO6C 3BWGA 2FSWA 1XMXA 5CVJA 2K40A 2VQLA 1W36C 2DYRH 4L0YB 1HW1A 3E97A 3J7AO 5FD6A 3HSEA 4PJMA 5LRRA 3VB2A 3WODF 3BZ6A 1IC8A 2HTJA 3U1DA 3W2AA 4GGGA 3R0JA 3K1MA 4G12A 5D8KB 3ROUA 1UG2A 1ERDA 2Y0SA 2FOWA 3PSIA 5FKLA 5ILSA 3SFZA 3EQLF 5BNGA 2CQQA 3V4GA 1T56A 4A3CJ 2GM4A 4I76A 3IAM2 3GF2A 5IP9J 4DOZA 4DBRA 2XF7A 1R7JA 3P9KA 5DUKA 5HS8A 1LEBA 2L54A 4XOPA 1R4MB 4MLOA 3HSFA 3N4MA 2NRAC 2CRGA 2MG4A 3H36A 2ZC2A 2GOMA 4FHTA 2JVHA 4UUSB 2L7MP 4V2GA 1JUMA 3V7SA 4Q5SF 4UB8C 3OYJA 1U8RA 3GTLJ 3HOXJ 4L9VA 1MBKA 3F8MA 3PM1A 2VJIA 2BY0A 1H89C 4AWXB 4D1QA 1W36D 1OKRA 5CQGA 4S0HB 2KIFA 1X1DA 2H1KA 3FM5A 2BVLA 4KICA 5HLTA 3VFZA 2Q2EB 4WK8F 5BPIA 4HQEA 3K7AJ 3ESWB 2EV6A 4HLYA 1JI8A 1Y56A 3LL7A 4CYCB 3FMRA 4E7LA 5H6RA 5FKNA 3RSNA 5EEHA 2IGKA 2KZGA 2MC4A 3HUGB 3KP4A 3A1YA 1G8XA 1E3OC 2PFBA 4PDKA 1ETQA 3RTRA 4IHWA 2COMA 4GYIA 1TBXA 3X2QH 4XKVA 1BI3A 2FQ3A 2LF7A 1ZYRF 3K4MA 1T95A 2NYXA 2KP6A 3CCSI 2M8GX 1GVJA 4M9ZA 2MD5A 2P81A 2M4GA 1R5HA 1ETWA 2VC1A 4N9IA 5BMZA 4DYCA 1SD4A 3IH4A 1D3YA 4A69C 2RREA 1LUJB 3DP7A 3CUOA 5FFXA 1UZCA 2EJRA 4C3IJ 5J8CA 3DTIA 1JE8A 4YELA 5J47A 4F91B 3PUFA 1P7IA 2QBYB 1H9TA 2GLOA 3ZOBA 1E17A 1Y8RB 2MFZA 1MH3A 2LVSA 3K9TA 4OIRF 4EJUA 1WJ5A 3F23A 1TWGJ 4N9HA 4XORA 2NVYJ 3DKYA 1CF7B 1MMNA 1JHHA 3SFIA 3E6DA 4ZYAA 2A5YB 3GLXA 1WI3A 3RZOJ 1R58A 2P6TA 2WAQA 4PGHA 1HA8A 3VSKA 2R5YA 3MAJA 2QSFX 4A3IJ 4KMUX 4M9SA 2E2HJ 4IRHA 3FK6A 2Y48A 2PMZA 1DPUA 4RB0A 5EF6A 2K9SA 4ZH4F 1ITYA 3DKXA 2R7OA 3JREA 3F3XA 4HRIA 2GWRA 4II3A 5FLVA 2FJ1A 5ICFA 1D8KA 2JA7J 3CZ6A 5AIPA 2JWTA 4XLHA 1JUPA 2NOGA 4QTRA 4BY7J 3ZMVA 4FT8A 1I5ZA 2DMPA 2VQHA 4F3QA 2LKSA 4XBFA 2DODA 2BE5F 1IN5A 3MN2A 2KFDA 3ERMA 4YIIA 3S1RJ 5F27A 2W24A 5CLSA 1ZKGA 4I7HA 2NS7A 2ISZA 3GCMA 4WWCA 2OD5A 1OCZH 2NVQJ 2E2JJ 9ANTA 3CF5F 3KYLA 4U0VA 2VL8A 4QSHA 3SXYA 1XCVA 1AKHB 4BACA 2L9NA 3I59A 2ISYA 1BOAA 3U1KA 1Y6IA 3FX3A 1J2XA 4KUMA 1JXSA 2KRCA 2V9VA 2XPUA 5C3EJ 1KU3A 3WTYC 2E7XA 3CCQI 1T08B 1QA6A 2YU9J 1YOVB 1RESA 3QYBA 3V8JA 5LLQA 1Z91A 2LLKA 1QZZA 1FC3A 5LFAA 3LSPA 1JGGA 1GLNA 2HDCA 4ENJA 4QPOA 3MKYB 1U5TA 4F55A 1X58A 4CH7A 2EFPA 3BQYA 3EUHC 4W1UA 1ZRCA 4LMYA 3SJMA 2VJ4A 1EH8A 3Q3SA 2L4AA 5DM7F 3GZ6A 1LDJA 1LPQA 4XN3A 4HNTA 1FMVA 3C2HA 5LD2C 4RMNA 2RGVA 2D2WA 6PAXA 3S16J 4N0BA 5EZGA 4JK1X 4R8HA 1SVOA 2FBKA 2COBA 3BJ6A 3MMYB 4NQWB 3CCEI 2IXSA 3LA2A 3IKVA 2HKXA 3WTTC 3FKJA 1WPKA 2VB6A 4UUTA 3FXQA 2ZXIA 1USSA 4HW0A 3EDPA 3W2VA 2WADA 3HIFA 3Q9VA 3CO7C 4KN7X 3CJQB 2DA4A 4E7HA 3ZQCA 1HBXG 5DS9A 3K10A 4OINF 3OY9A 3CMEI 4HOBA 5ICGA 2MA3A 3T0YA 4QPQA 3Q0WA 5CQEA 3HOSA 3I9V2 5K7FA 3S3OA 3IRQA 2F5FA 2X51A 3BG5A 1UHMA 3SZGA 2A5WA 3BTJA 4JP0A 2CUJA 3HGYA 3RCOA 2A6EF 1XGMA 2BXZA 2EIMH 4XOTA 2DLLA 3C7JA 3HRTA 2IS1A 2OPTA 5TISC 4EVIA 3S1NJ 4RAFA 2PEXA 2VKDA 3BROA 2ZXWH 2Q1ZB 3V8LA 2WAQN 2O5RA 3RPUD 1IXRC 3JCUC 4HF2A 4A3MJ 3BG3A 3DEWA 3EYIA 5IYCJ 4G6QA 5J1RA 5F1RA 2DPUA 3E3VA 4BJ6C 1FIPA 2O8KA 2CQNA 1H9GA 3WHCA 3WTWC 1XDUA 2Z1DA 3OYIA 4AYBN 2ADUA 4RGUA 2CJJA 1J75A 3GWZA 1F1ZA 2K7LA 4XONA 1S7EA 4I2OA 1IN8A 2K02A 3L09A 4ZYDA 5AIQA 3HEFA 3TL4X 5F0HA 4ENMA 2HPMA 5LGTA 3GZNB 2HDWA 3PO3J 4EEFG 3BR6A 4KJZA 1ZG3A 1ULYA 3PQKA 2HFHA 1B6AA 2LKPA 3O8HA 4PZJA 3ABKH 2Y9ZA 1JT6A 2HI3A 3JRGA 1MJAA 5D5VB 4M3GA 1ON1A 2Y9YA 2K3FA 3BJAA 3L2VA 2X4HA 1BR1A 3A02A 1TQMA 2ZSIB 1FEXA 4HX8A 3QYEA 2H8RA 3LAJA 3FWEA 5GPAA 2EPFA 4HV6A 1YW9A 3ZMTA 2VXDA 1YX5A 3R60A 5E8GA 4C3HJ 3S15J 5FKKA 1R36A 4NC7A 4IQ4A 2VC0A 3KP6A 1FOXA 4L18B 2K3PA 4HBLA 3CC2I 3Q0UA 1Z6RA 4IO9F 4RBOA 4A3LJ 4WXHA 2ECCA 2LMDA 1RPWA 1VZ0A 1F43A 5J40A 1MSFC 2IAIA 2HDDA 1IN7A 2XC7A 1XGSA 2HVSA 4RGXA 1VQ6I 2FNPA 3W3CA 2UZKA 4BDZA 2EFQA 3VPRA 1R4NB 3ZQHA 1X3UA 4QIWN 3JRFA 1KONA 5DCMA 2VOPA 2MC3A 2JSCA 2R7RA 2VXZA 3KZYA 2M0MA 2L7FP 1UAAA 2CUFA 4A3BJ 1D8JA 4EJVA 5B3SH 5FB2A 2PJRB 1XTAA 4PJNA 4FISA 2GAUA 5E3LA 1BJZA 1HKTA 2R0QC 4HNVA 3GTGJ 3MZYA 1Z05A 1MNMC 4FETA 4A3GJ 3FXJA 1TC3C 2L9SA 1M1EB 2IA1A 2HOEA 2M9HA 2FRHA 4RGRA 3SDBA 2XAUA 1GT0C 1J7KA 4M72A 5B66C 3CCMI 1U5TC 4IQJA 4II2A 4YEJA 4LFUA 1ZGWA 3RYRA 2W48A 2XPVA 3HPGA 2F4OB 3E0JB 4G6TB 3IV5A 4GCVA 3OOUA 3ZXSA 2L02A 3I56I 5GAEJ 3GYHX 3GXOA 5B5EC 1A36A 4M9XA 3ZMZA 2X1DA 5FLXK 1BA5A 3DXJF 1TNSA 1Z67A 1BBYA 4IKFA 4X0GA 5E18F 1TQIA 3CDLA 5C44J 3KZZA 5H20A 2WWYA 2QYOA 4XLFA 2VJ5A 2QQ9A 4XLEA 2QEXI 1PYVA 4K2EA 2ZMEC 2ELJA 2OQGA 2W7NA 2QKMB 3BG9A 2YPRA 1OCCH 1W4MA 3OL4A 4N4OB 4E7IA 5J1UA 2V1NA 2PLYA 1FP2A 3PL8A 2O9LA 1OQYA 2CUZA 2XVCA 1ETVA 1KU7A 3BTLA 3FXOA 5FO5A 3S93A 3K4BA 4G7ZF 5JLWA 1UHWA 1V5EA 2FX0A 3ZQIA 1VF9A 1JJ8C 1HKQA 4EM2A 3AFHA 3F72A 5E1ZB 1U5TB 2A69F 2DCEA 2W85A 2OQRA 3A03A 3T1BA 4HAMA 4KYWA 1L3LA 5DYMA 1WRJA 5DV5A 4BJTA 2V1XA 1VQ5I 3I3LA 1FJLA 3BP8A 1ETKA 4C30A 4XRSA 2V9KA 3FDYA 4EM0B 2L9VA 3L7WA 4AM3A 5HNFA 4EGYA 4FX4A 3C3WA 1N77A 2XKPA 1DGWY 2MYSA 4BL0B 4L5EA 4D7MA 4ZJZA 3AG3H 2YU3A 5J3LA 4RDUA 3GBGA 3L2WA 1WI9A 3C2BA 2ECBA 2XAGA 5LHGA 1U6GA 4BUPA 2ZJPF 5EEGA 2Y2ZA 1B9NA 4M74A 2G0EA 5ICEA 1OJLA 3S14J 1ZQ3P 3F8BA 1VQNI 1YX3A 4CDGA 3MD2A 4UUSA 1D0ZA 1Q1VA 3U21A 2ZB9A 4AC0A 4AVPA 1YJ9I 3DBRB 3BR2A 5FRMA 4CSWA 1K6OA 1JTXA 2AO9A 2LDUA 3K0LA 1BL0A 2XRLA 3GO5A 2WV0A 4NHJA 1T39A 1W5CC 4OMZA 4WF2A 5K5QA 1RRJA 4P1WA 1ON2A 4D9JA 1MBEA 3M3YJ 3HPHA 1LEAA 2B7EA 1I50J 3CESA 3SZPA 5HNHA 4CYCA 5IT9Z 3RQIA 4ASNA 1MMDA 3FMQA 2L7ZA 3B6CA 2ZJQF 2E5NA 1P4AA 2AXTC 3PFIA 2FD5A 3AKZA 3GLLA 2VBYA 4XSXF 4LK0F 1K7AA 1OPCA 2E1MB 2R4GA 4RM3A 1GUUA 3CDHA 2M8EA 3M8JA 1X1PA 2H6CA 2VBZA 1K4SA 2HXIA 2MD0A 3PNVA 4BQOA 4MO7A 2GZWA 4Y13A 2H6BA 2EIJH 3K4CA 2F48A 1Z7LA 2EV0A 5DD4A 3OSFA 1VQ4I 2JSPA 2DI3A 1FNNA 4H0EA 1R1TA 2DTRA 1S6LA 4OOIA 2CW8A 2A05A 3I0TA 5B1BH 4EJOA 1MMGA 3F6VA 2M0CA 2OU2A 2DK8A 3N05A 2RV8A 4EM1A 1PUEE 4BQQA 3LNQA 4XKCA 2ZJ2A 1FLIA 2LR8A 2W84A 2HZTA 3NRVA 2DA7A 1AKHA 1W0TA 1Z3XA 1O3SA 2BBYA 2E1CA 2RQQA 4JOMA 1X4OA 4O6JA 2ESHA 1KQ0A 1WSUA 2R7FA 3ZR8X 1HLVA 4Q48A 2DDBA 1XG1A 1OMIA 1Z0XA 4DQ2A 5IOYA 5JHUA 5CYVA 1W1WE 4RLQA 3OIPA 3D1NI 1XMAA 2PMZN 3QP5A 4MIMA 3HOVJ 1IDYA 4CXFA 3JSOA 3DQVC 3QOPA 3OL3A 2P5KA 2Z33A 3D5RC 3L00A 2LTPA 3J81Z 3ZPLA 2CW7A 1A31A 2D5VA 1OLTA 3CTAA 1MH4A 3PNTA 4JQFA 1U78A 2CWEA 5FLXZ 2GXGA 2CGPA 1WHUA 3AG2H 5F08A 3RKYA 4LLNA 2JA8J 2M3AA 3BY6A 1P4XA 1X2MA 5CVUA 3ECHA 1S72I 4YG2F 4B4CA 1Y1WJ 2H8WA 3FXMA 4XM3A 2L4MA 4CCJA 3S2WA 2RNGA 3PUBA 4KN4X 2F5DA 2R7ZJ 5L3EA 3PQJA 3K4JA 4M6YA 5D4SA 4WCGA 2JN6A 3OYBA 1EH6A 5LHHA 3VEPA 1K78B 2M5WA 2RVCA 3KIOA 2DT6A 1QHHD 2M45A 3G3ZA 2R93J 1UCRA 2XAHA 3HSRA 1APLC 3L2RA 4DNCA 5DEQA 1W7PB 3HXLA 4PSXA 4XLCA 4UVAA 3OYNA 4RB2C 3CCLI 1WJFA 4LITA 2OTLI 2TDXA 5F04A 2XGDA 1ETYA 3ABUA 5K7HA 5LBQA 2JA5J 1SD5A 4ZDLA 3HB9A 4C3JJ 3IHUA 4LLLA 1XS9A 2Y75A 3RJPA 2GA1A 5EDNA 2H1LA 3D5SC 2OA4A 3RPQA 4CCLA 3RKXA 5GAGJ 4UV8A 3G1LA 4XL9A 2DJIA 1KYWA 3EETA 4FX0A 4A3EJ 1EV7A 5GTIC 4BXXJ 4OU0A 2DFEA 2Q8KA 3DTKA 5FKMA 3TBIA 1EH7A 4U7BA 1HW2A 1WJCA 2W82A 3KETA 1TT0A 2EFWA 4HZFA 1N75A 3TKYA 1HC8A 5D6EA 3R4KA 5JR3A 4BQAA 1TTYA 2IT0A 2ICWG 1NTCA 5E3MA 1P2FA 3A01B 4DZJA 5M5YJ 1PUFA 4UY8I 4A3JJ 2E60A 2E71A 2ZBKA 4NC8A 4IEJA 1E0EA 3GFLA 2FMYA 5D4RA 3DTEA 1XSXA 2PX9A 1A04A 1JJ6C 2LY9A 2HS5A 2DJNA 5K7ZA 3L2CA 3V42A 3J7YJ 1FOKA 3MEXA 3HYIA 1SFXA 2WA0A 4DIQA 1IV6A 1ZTRA 1HDPA 2HYGD 1YRNA 3GTPJ 1HQCA 3R6SA 4TV7A 1IZ1A 1Y0UA 1NK3P 2EA4A 1OCRH 1T8IA 2XGCA 5TJJA 2JPBA 4IL6C 2NVUB 1XGNA 4HX4A 2VJJA 4P96A 1TNTA 1XSDA 1IN6A 2QSHX 3I4PA 1ENHA 1K6YA 4OIPF 4ESFA 1R5ID 5JI6A 3BTCA 2V6CA 2PMHA 2X1EA 2AQEA 1WWXA 2PQ8A 4XLPF 3NWSA 4CA0A 2ZNZA 4FASD 2WAEA 3M8FA 5L3DA 2KIQA 2VODA 1VQ7I 5E1XA 1JKOC 2C6YA 2XROA 2NNNA 3RZDJ 1HKSA 2CO5A 2JUCA 3R0AA 3CCJI 3OIOA 1F5TA 1ETXA 3FXUA 2EILH 4XRMA 2DA2A 1FPQA 3CD6I 3TGNA 1OFCX 3MKLA 5J4VA 1KGSA 1SD7A 4KIFA 1RIOH 1MBFA 2TCTA 2X6YA 4GYGA 1XN7A 4GXOA 4RAGA 2A07F 5HLHA 2DT7B 2IRFG 1F4KA 5J4YA 1R6RA 3TO6A 3LSRA 1UMQA 1E3PA 2WAFA 4IOAF 3ONQA 3BCBA 3CDIA 1IXCA 2A68F 4HG2A 3K70D 3G2BA 5H2FC 2HVRA 2CV2A 3C18A 1P4WA 3HRMA 4BU2A 4U7DA 1Z3YA 5D6FA 1LFBA 1FTZA 2KT0A 3KP2A 1LVAA 1DP7P 3H0DA 4Y3OA 4MFEA 1B8IA 3WGIA 3GTOJ 3OYMA 2ZSHB 3I4NJ 2AS5F 4CGZA 1ONVA 3T5XA 4OAYA 2G7UA 3FK7A 3LQRA 3JRCA 4BKXA 1AOYA 1P6RA 1SFEA 5BPDA 2EB7A 2R7TA 4AUXA 2MLGA 1LFUP 5GP9A 3VODA 3WGGA 4A6DA 2GA2A 3FMSA 2EQRA 2IW5A 2QWWA 1X2NA 1OR7C 3O8GA 2CSOA 4FCYA 1G3YA 2DMQA 1KYZA 2F5EA 2FBHA 2LBFA 3OYLA 2OF7A 3WTUC 2D1HA 1YTYA 4P9FA 1IXSB 3ZMSA 4RAZA 5GPCA 5D5WB 2K85A 1F36A 2ELKA 3ABMH 3B73A 2IA0A 4MHGA 1O3RA 1S5LC 1JT0A 4R1HA 3UNGC 2HGCA 2HQ5A 3OYKA 3BR3A 1Y8QB 4XLNF 2MW8A 4BJ5C 4IX7A 4BDYA 3T8RA 1PUFB 4C2TA 3HKZA 1IUYA 4AIHA 4V2FA 2DAOA 5LHIA 2D45A 2YX4A 4G94A 2UV1A 3IUOA 4L9TA 2V7FA 3R61A 3QPLA 3O3KA 1BW6A 1MBHA 3DPTA 2BGCA 2JRTA 4Y7NJ 3S8PA 5IPAA 1QZEA 4AIDA 5KAFC 3IKTA 3MVPA 2ELHA 4G6DA 1WJAA 3OYEA 3VYSB 3OS2A 1WH5A 2O8XA 4LG0B 3FF5A 2EIKH 4C9YA 3SQNA 3IH2A 3KCCA 3W6VA 1MKMA 2XIGA 3SYTA 5KHDA 3OSGA 1TW3A 2FOKA 1B9MA 2P8TA 2H09A 3IRRA 1Z6TA 3VSLA 4IJAA 2K9QA 3M1CA 3JRAA 3H9GA 3HOYJ 1RR8C 2OCEA 2DW4A 2DK5A 2LD5A 4QWQA 4AVZA 4LK1F 2R7DA 2VOOA 3ABLH 2V26A 1ZGAA 4C2UA 4BHPA 1XC5A 4R79A 1J9IA 3HOZJ 4LLGF 4ZYEA 4E4HA 2G7HA 4I0BA 2OC6A 1D0XA 1O3TA 1MDMB 2P6SA 1S7AA 1CGPA 3ECOA 1WFXA 4Y15A 1G2HA 2DOFA 4PJLA 3FXKA 3ZMDA 4AIJA 3OWTA 1QHGA 4A6EA 2DDAA 3DCFA 1WCMJ 3BR1A 4HSRA 1YS6A 3TOBA 4A0XA 4A3DJ 1DUXC 1S3JA 4J01A 4WXDA 4Y52J 1IRXA 1S29A 3K4KA 4UHTA 4EQQA 4KITB 3ZN1A 4F93B 3ZRGA 3JAMK 2E35A 1OR7A 2ZO4A 2QQ8A 1MSEC 1FT9A 2LOOA 4ON0A 1YIJI 1UELB 2O03A 3ZCOA 5ICCA 2M7BA 1T0FC 3I4MJ 2OTJI 1FSHA 3AG4H 4PFPA 4B48A 2EV5A 4PUSA 1MIJA 1SFUA 1LQ1A 1UB9A 1QGPA 3KFWX 4A0YA 4NUBA 4S05A 3GX4X 2R7WA 1WGXA 1B72B 1N25A 2CQXA 5FFZA 4BAYA 5KK1A 2UXXA 2HYFA 2E7WA 4I0AA 3D5LA 2HOAA 1MBGA 1S7OA 3MZ8A 4HX7A 2WV1A 4Y33A 3E6BA 4G7HF 2A3SA 2Z5UA 1ZAOA 3K1NA 3OR1C 3N97A 2DQLA 3MQ0A 3CJRB 3HG9A 1MW7A 3K69A 2QBYA 3S1MJ 4BHBA 3LSMA 3V7RA 1K79A 1WJEA 1QRYA 3K2AA 1S8NA 3EUHA 1RZ4A 2CG4A 2BHZA 3ZP5A 2JPCA 1RETA 2RNJA 1TWCJ 3J7AY 1TL8A 5GAHJ 1HSJA 2BZTA 4UUVA 1B72A 1TT5B 2KZVA 4MFDA 4A5NA 4IF4A 5BOXA 1BIBA 5L3CA 1B4AA 2GXAA 4EJWA 3CUQB 4I98B 1U9NA 3PIPF 2WTEA 1KA8A 4I99C 3FXLA 3CLQA 3GFMA 3W6KB 3Q0VA 2VONA 3LSGA 1MNEA 2ME6A 1C0WA 4C2MJ 1X19A 3T8TA 3J7ZI 2B63J 3BZCA 1SVMA 1XDSA 2F4MB 4J19A 3TP0A 4ESJA 3DFGA 2DFHA 3JRDA 1TZLA 3VYRB 2HU9A 1O7FA 4XIDA 2X6OA 1RR7A 5KNLA 5LEKA 4DBQA 4MEYF 5JLXA 3E5XA 2ETHA 2XV4S 4MTEA 1MMAA 5L3BA 2A61A 2VPRA 2PJPA 2X48A 2X6XA 3P5JA 5M5XJ 1MNDA 3BT9A 2KQRA 3J80K 3KP7A 5A2QK 1GV2A 3OYAA 4LD5A 3JSPA 3MWMA 2QENA 4S04A 3IAS2 2R5ZA 1E2XA 3VYUB 3JRHA 2RKHA 1IJWC 1P92A 1IV8A 2DN0A 2I8DA 2R3SA 2GXBA 1IG7A 1UHSA 3WTSC 1QZYA 4E7ZA 3S1QJ 2XSJC 2R92J 2A6TA 1ZG5A 2BEOA 4A0ZA 4D5FA 2RC4A 3CUQA 3H9JA 4IRGA 2LC2A 3WTZA 3H0GJ 3K4NA 3BPXA 4V19K 1J5YA 3OYFA 3VOEA 3AL0B 3KEQA 5CPRB 2FQ4A 2VBXA 3QPHA 2STTA 1SC7A 2Y31A 3RQ4A 1VQLI 1MZBA 5EGOA 2J5OA 1ZREA 4M71A 1IRZA 2HTSA 5ERIA 1NH3A 3KX2A 4MNUA 5M5WJ 3KEYA 1ZARA 1AHDP 4XNFA 4L5JA 1SMYF 1H8AC 1R00A 3A4CA 3C1DA 5EG0A 5CVIA 1XCBA 3E1SA 1FBUA 2MSYA 4XMYA 3H1CA 3QODA 1W5SA 3FM3A 2ZMEA 1D1CA 3IP4B 4E6KG 5C4XJ 2LKXA 1CF7A 1TWFJ 1STZA 2XASA 1BI2A 2AXLA 3TMOA 1PP7U 1G4DA 4FE4A 4MTDA 2LP0A 4PK4A 2KDOA 5DD8A 2NVXJ 1IO2A 3GMEA 2PG4A 5BQTA 3RYPA 3BR5A 2LH9A 4PGGA 5IYBJ 3MKZA 3AL0C 1UG0A 1USTA 4X1EA 2L01A 4ETSA 3CP2A 3FBNB 3ZN0A 4CCNA 4Z6YA 3S3NA 4FQGA 3GTKJ 3CC7I 3G1MA 5EYRA 3HJEA 2EH3A 1FBSA 3IWFA 5JFRA 2DYSH 2ZXHA 3TQNA 2E5ZA 3S2HJ 3M7GA 3DWLE 1JKPC 2M7AA 2EBIA 4XN0A 4B09A 5H6QA 1DP3A 3GW2A 1FIAA 2NS8A 1O3QA 4F52A 1JKQC 1I3QJ 1U2WA 3TDUC 4LGWA 2NXNB 3P9CA 2Z16A 4B43A 3ML6A 2R5YB 2YR2A 4PSWA 2KJCA 4P5OA 1SVLA 5M3MJ 3COAC 1BC8C 4KMFA 4EGZA 2CYYA 1QU3A 4F92B 4HV5A 3C2GA 3H35A 2RN7A 1R22A 1V55H 1U0JA 4EMSA 1XB4A 1LE8B 3ZQGA 1BI1A 3DF8A 4B3XA 4OIQF 2XF6A 5JVTA 4IHVA 4W97A 5CVVA 2Q0OA 2KL4A 1R9TJ 4A5MA 2RAEA 1SAXA 5JVGF 1YO5C 2OZUA 4XKWA 1Y1VJ 1H0MA 3K1PA 1XSVA 2PJRA 1ZK8A 4AU7A 1MDMA 1UJ8A 5DCFA 2GQQA 1TWAJ 1OISA 2K86A 2BW3B 4IVNA 4OMYA 1DDNA 1ZLKA 1P9QC 1R23A 5IOZA 1Y39A 4DYQA 3KP5A 1BOBA 2L3DA 2M34A 3KP3A 2QUFA 3E5QA 3TW7A 2O61A 1IW7F 3LA7A 4MQVA 4UV9A 1H88C 3S32A 2HNHA 4XKBA 2Y0MA 1V4RA 4XSZF 1EKEA 2DFFA 2GIZA 2M87A 2UUZA 5LGUA 3HDDA 1I3AA 2HZDA 4ZDOA 4BE0A 3BPVA 3IWZA 2P5VA 4BEHB 3M8EA 1IF1A 3FISA 4L9JA 3CCRI 4ZYGA 3HTSB 1G6NA 1A6IA 4CCKA 1NK2P 1GHCA 2CH0A 4QLCU 3OYHA 1A6QA 2LYCA 4JX5A 1ZHFA 3RDIA 5HLGA 3DU6A 2IGNA 1HDDC 4B44A 5EZHA 3ZQQA 3PNYA 5CJ9A 2OCCH 2P7VB 4AYBA 2DQRA 2XF5A 1J59A 3OYGA 1VTNC 2K4BA 4G7OF 1Z77A 2LFBA 2IS6A 3AG1H 1WZ2A 3ASOH 1X1CA 3TOAA 2XKOA 2CV1A 3DBLB 3GZ5A 1FOYA 1AWCA 2JT1A 3QQAA 1Q1HA 2WC2A 3IC7A 3TO7A 5EG0B 1QO0D 2X1CA 2LREA 1GDTA 4IHYA 2HXOA 3HRUA 2VE8A 4UB6C 4HQMA 1FBQA 2RQPA 3B6AA 3Q5FA 2EINH 2LY2A 5CVRA 2OV7A 2QCOA 3ASNH 4BBRJ 3JRIA 2KRHA 1MBJA 4RLFA 3HM5A 2R7QA 1OCOH 2KHMA 1YW7A 2HEOA 1TWHJ 1OCPA 2K27A 1QNTA 3A0BC 4L5IA 3REOA 2W1OA 3BG7A 5ILVA 1U3EM 4KT5C 1DU6A 2NNYA 3D0SA 3DPLC 1R49A 1QQIA 5HDKA 4KA4A 3BQZA 4WXCA 4A93J 4J00A 2IA2A 4CYDA 3HGGA 4ZYHA 1WKMA 2ZKZA 1O57A 3KYCB 4FTHA 2EWNA 2HQAA 2DMTA 3H3ZA 5E79C 4L9NA 2V1UA 3F8NA 2E1MC 1W0UA 3NQOA 2D1VA 3OMYA 3HUGA 1FP1D 2GIVA 2WY7Q 1YE9A 2K9NA 3F21A 1REPC 4IHXA 1PJRA 3LQQA 3U9GA 3ABTA 2FEZA 1GVDA 1D5VA 1ZRFA 2P4WA 3OOPA 2NS0A 1SD6A 2Z99A 4E7SA 2FMLA 3H5NA 3WU0A 1F9NA 1EJ9A 2LY1A 1DPRA 4HF0A 4BH9A 3HOUJ 3JTHA 3HOTA 2IVMA 3BJOA 2JTVA 3CJNA 5F64A 3E6MA 4RA2A 2KMUA 2V9PA 2UWMA 1GXQA 4Y17A 5AONA 3H3UA 1VQMI 1ORKA 1OYIA 2QGUA 3OR2C 1YJWI 1A5JA 2HOSA 4I6ZA 5K5OA 2X9DA 2WY8Q 3EPZA 4I09A 2BY2A 2VQCA 2G9WA 4HDUA 1VI0A 3M9AA 2R5ZB 2BXYA 5BS6A 2O7OA 2IS4A 5B1AH 1I6XA 3CP8A 3I55I 4LIVA 2XUBA 4HDVA 5E20A 5IP6A 2DBBA 1FYMA 5M3FJ 2MBFA 2DOAA 5K5RA 3HHGA 5D5UB 3CMYA 2CQKA 2DT5A 2VKVA 2F5CA 5IYDJ 2NAZA 3A0HC 4CZCA 3TEDA 2V1DA 2OBPA 1FOWA 4B3AA 1ZR4A 4OAZA 1JGSA 2KIUA 4I01A 3GTQJ 2ZCWA 1ZR2A 2W4SA 2JJ7A 1BR4A 4ABZA 2EK5A 2XHKA 4HA8A 1TP4A 1RKWA 4M6XA 2H94A 4AD9A 5EGOB 1YITI 2QQBA 3HBLA 4WX9A 1T38A 3G1OA 2YS9A 2VI6A 1T33A 1SANA 1DGRM 1XD7A 5FROA 1NG7A 4PCQA 2VE9A 3GUDA 2N8GA 3H5RA 3FHZA 2Z9OA 2FXAA 3TP3A 2ZFWA 4E7KA 4IHTA 1BIAA 3BTIA 1FZPB 1PDNC 2HKOA 3CF2A 2W25A 4I02A 3TO9A 1YI2I 1VQOI 3UKGA 2XSDC 5ED4A 3WE2A 2XPWA 2B0LA 3QWLA 2Y69H 4ZZDA 1FY7A 1IDZA 1XGOA 1FX7A 1XPXA 4G9YA 2V79A 4Q4ZF 2EZKA 2PMUA 3LFKA 2DTZA 5F0CA 3PFYA 4ANJA 1IRGA 2FA5A 1K83J 2Y30A 1ZRDA 2LRDA 3LOCA 5HODA 1POGA 2Z2SB 1T98A 3JR9A 1HW5A 1IGNA 4UXNA 3E6CC 2M30A 1G3TA 4MQ9F 1NG6A 3PJRA 2K4JA 2K9MA 4B1RA 3G71I 3IL2A 3I5UA 4RM2A 1O4XA 1U8BA 1Z1DA 1K61A 3LAPA 1YIOA 1EF4A 4EV0A 4DJAA 5F1JA 1K78A 1LDDA 3K2ZA 5E3OA 4Z2YA 4A3KJ 1SEUA 3OYCA 1X1AA 3ZQFA 1TW2A 1IN4A 2CW0F 2V6EA 4DGWB 2LF8A 3QPSA 5E17F 5E3NA 3LMMA 3L9FA 1W7PA 4IPAA 2QF7A 2CQ7A 1T0FA 3K4LA 3HRSA 1QPMA 4MGRA 1CQTA 1Z7UA 1LB2A 2ZJRF 2EFOA 3F6OA 1OYYA 2XDVA 1S9HA 3PSFA 4A3FJ 3IH3A 3GTJJ 3J80Z 3NEUA 2NVTJ 2F4IA 4F7ZA 3LA3A 1R1UA 3JTGA 1KU2A 1OYWA 4BY1J 2Y0SN 4G8XA 4DZPA 3KYDB 1BN5A 2HR3A 3P9IA 2DA3A 4BS9A 5HS9A 3TW6A 1G59A 1D1BA 2EZIA 1Z21A 3JRBA 2ZNYA 5DCMB 2YUSA 3VWBA 5HDGA 5HDNA 1ZLJA 5IT9K 5CKTA 3F8CA 1L0OC 4BHCA 2M4KA 2OUMA 4RGSA 4O3MA 2ACJA 2EZHA 3HOWJ 4D0PA 1U9OA 1ZELA 1MMSA 5DUIA 3O6BB 2HWVA 4DYRA 4IRIA 1D0YA 3SDGA 1HF0A 1I6HJ 3WHBA 2X0LA 1VQKI 3UR3C 2QM3A 2STWA 1V3FA 3DKWA 3A2KA 1V54H 4AIKA 1FWZA 2XGEA 3F9KA 4ENKA 4LG0A 2VBWA 3KPHA 4OWRB 1X4PA 3M07A 2O3FA 3I58A 4M73A 3NWTA 4RB1A 4PJ0C 1WQ2A 2O6GE 2RDPA 2GBYA 2AQFA 1JHFA 4RAYA 4ZTJA 2MABA 4LIUA 3LSIA 5J6XA 2K9LA 1FTTA 1R71A 2JVGA 1SFKA 4EJTA 4IHSA 5GTHC 1X3WB 4CO8A 1YG2A 1KQ9A 2CFXA 3PIOF
chains in the Genus database with same CATH topology
4ZZLA 4HF1A 3GEZA 1KQ8A 3W6JB 2DO7A 3KLNA 4HYEA 1ZN2A 4BXUA 1FSEA 2VT2A 3DV8A 4MEXF 2KRFA 2F2EA 3U2RA 3QPTA 1B59A 2YSRA 4YIFA 5TRDA 3QU6A 2ZXJA 2MH2A 4LB6B 1MJBA 2HQNA 5A2QZ 4CHUA 5HOOA 4KIBA 2DPDA 2BV6A 2ZMEB 1BM9A 3ISPA 4P9UA 1I1GA 2IPQX 3QAHA 1I27A 1O7LA 1FYLA 4A12A 2MLKA 3ULQB 2FNAA 2VN2A 3EYYA 3GFIA 1ZG1A 2KIMA 5LEJA 2IP2A 1RUOA 3OV8A 2UXNA 2E1NA 1ODDA 1J0RA 3I53A 1YYVA 3RIRA 1HSTA 5HVQC 1RUNA 1G3WA 1SMTA 3Q9SA 4NQWA 3JW4A 5K1YA 3J81K 2KJBA 2Z3YA 4LJZF 1R1VA 1YLFA 4CICA 4Q47A 1G3SA 1W7PD 1BI0A 3V8KA 3MFKA 1XMKA 3AAFA 2W57A 2LSOA 4HLXA 4JBAA 4KFCA 1YQAA 3MZHA 2BYVE 3ZMUA 4XRFA 4LB5A 1MGTA 3FXRA 4A2UA 2J5PA 4IXAA 2PI0A 2IJLA 1ZGJA 5F6FA 1IAWA 3I64A 2QVOA 1R5GA 2DU9A 4O5VA 4RB3C 3ERED 2OAZA 3QRFF 4CZZA 1HXDA 2P5LC 1GXPA 3WU1B 2QLZA 1UFMA 2FBIA 2O0YA 3WGHA 3BOQA 2A6HF 1KU9A 4YFXF 3ZQ7A 1RI7A 3KE2A 4KIGA 1T2KA 5HS7A 5ILUA 4U0YA 3KEOA 2EFNA 2QQAA 2OZ6A 5L3GA 4YFKF 3F8FA 5L3FA 5E1WA 1LNWA 2FE3A 5LGNA 2Q2EA 3G73A 1RNLA 4UVCA 3RKWA 1BJAA 5J8FA 4UVBA 5DDGA 5KVRA 3GVAA 2PN6A 5LRSA 4U88A 5IT3A 1PP8F 2PBIA 5FD5A 1YW8A 3B02A 2JZYA 1YS7A 3JAMZ 1W5TA 3WE3A 3I54A 4ENNA 3RI4A 2LNBA 2H27A 3DEUA 3HTUA 4ESBA 1ZH5A 4P55A 4BYYA 4UNOA 1NHAA 2XAFA 4E70A 2XRNA 2EA2A 3I71A 3LSTA 4GO1A 4YFNF 4KDPA 2FU4A 4OIOF 5E8IA 4NB5A 1IRFA 1YFHA 3WTXC 5D5XB 2VT3A 3KLOA 2QZ8A 2ESNA 3H92A 3HHHA 3FZVA 2MH9A 3I59B 2P7CB 3CLOA 2KKOA 1T6SA 1B1BA 2XAJA 3MCZA 3E5UA 3ELKA 5FGMA 4KNYA 2M1BA 3WG9A 1Z9CA 2DFIA 3LWFA 2XAQA 3GFJA 3WTVC 3RPUA 2YX7A 2HQRA 3QP6A 3V7CA 4BNCA 3QU3A 3SZTA 1I1SA 5HLIA 4L0ZB 1TQPA 2FF4A 4U0WA 1LJ9A 1MD0A 3BDDA 5D8LB 1BC7C 1LDKB 2XGXA 3M1EA 1FYKA 3TDZC 4RS8A 3P7NA 4B8XA 1TLHB 3SHFA 3O2PE 3F22A 3CUQC 1QBJA 1MJ9A 3CO6C 3BWGA 2FSWA 5CVJA 4L0YB 1HW1A 3E97A 3J7AO 5FD6A 3HSEA 5LRRA 3VB2A 3WODF 3BZ6A 2HTJA 3U1DA 4GGGA 3R0JA 3K1MA 5D8KB 3ROUA 5ILSA 3SFZA 3EQLF 3V4GA 3GF2A 1R7JA 3P9KA 5DUKA 5HS8A 1LEBA 2L54A 3HSFA 3N4MA 2NRAC 4FHTA 3V7SA 4Q5SF 1U8RA 4L9VA 3F8MA 4AWXB 1OKRA 2KIFA 3FM5A 4KICA 3VFZA 4WK8F 5BPIA 4HQEA 2EV6A 4HLYA 3FMRA 5H6RA 5EEHA 3KP4A 2PFBA 4PDKA 3RTRA 2COMA 4GYIA 1TBXA 1BI3A 2FQ3A 2LF7A 1ZYRF 2NYXA 1GVJA 4M9ZA 2MD5A 1R5HA 2VC1A 4N9IA 5BMZA 1SD4A 1D3YA 3DP7A 3CUOA 5FFXA 2EJRA 5J8CA 1JE8A 2QBYB 1H9TA 1E17A 3K9TA 4EJUA 3F23A 4OIRF 4N9HA 1CF7B 1JHHA 3E6DA 2A5YB 3GLXA 1R58A 2P6TA 4PGHA 3MAJA 4KMUX 4M9SA 4IRHA 2Y48A 1DPUA 4RB0A 4ZH4F 3F3XA 2GWRA 5ICFA 1D8KA 5AIPA 3ZMVA 4FT8A 1I5ZA 4XBFA 2BE5F 1IN5A 4YIIA 2W24A 5CLSA 4I7HA 2ISZA 4WWCA 2OD5A 4U0VA 3SXYA 1XCVA 3I59A 2ISYA 1BOAA 3FX3A 1J2XA 4KUMA 1JXSA 2V9VA 1KU3A 3WTYC 2E7XA 3V8JA 5LLQA 1Z91A 1QZZA 1FC3A 2HDCA 4ENJA 1U5TA 2EFPA 1ZRCA 4LMYA 1EH8A 2L4AA 3GZ6A 1LDJA 6PAXA 2RGVA 2D2WA 4N0BA 4JK1X 4R8HA 2FBKA 3BJ6A 3LA2A 3IKVA 2HKXA 3WTTC 3FXQA 1USSA 4HW0A 3EDPA 3HIFA 3Q9VA 3CO7C 4KN7X 1HBXG 4OINF 4HOBA 5ICGA 2MA3A 3T0YA 3HOSA 3IRQA 2F5FA 1UHMA 2A6EF 1XGMA 2DLLA 3C7JA 3HRTA 4EVIA 2PEXA 3BROA 3V8LA 1IXRC 4HF2A 3EYIA 4G6QA 5F1RA 2DPUA 3E3VA 1H9GA 3WTWC 1XDUA 2ADUA 4RGUA 1J75A 3GWZA 1F1ZA 2K7LA 4I2OA 1IN8A 2K02A 3L09A 4ZYDA 5AIQA 4ENMA 5LGTA 1ZG3A 1ULYA 3PQKA 2HFHA 1B6AA 2LKPA 4PZJA 1MJAA 5D5VB 1ON1A 3BJAA 2X4HA 1TQMA 4HX8A 3LAJA 3FWEA 4HV6A 1YW9A 3ZMTA 3R60A 5E8GA 1R36A 2VC0A 3KP6A 4L18B 4HBLA 1Z6RA 4WXHA 1IN7A 1XGSA 4RGXA 2FNPA 2UZKA 2EFQA 1X3UA 5DCMA 2VOPA 2MC3A 2JSCA 2VXZA 3KZYA 1D8JA 4EJVA 5FB2A 2GAUA 1HKTA 3MZYA 1Z05A 2IA1A 2HOEA 2FRHA 4RGRA 1J7KA 4M72A 1U5TC 4LFUA 3RYRA 4GCVA 2L02A 3GYHX 3GXOA 4M9XA 3ZMZA 5FLXK 3DXJF 1TNSA 1BBYA 5E18F 1TQIA 2WWYA 3KZZA 5H20A 2QYOA 2QQ9A 4K2EA 2OQGA 2YPRA 1W4MA 2PLYA 1FP2A 2XVCA 1KU7A 5FO5A 4G7ZF 1UHWA 1HKQA 4EM2A 5E1ZB 3F72A 1U5TB 2A69F 2W85A 2OQRA 4KYWA 3T1BA 4HAMA 1L3LA 5DYMA 1WRJA 5DV5A 2V1XA 3BP8A 4EM0B 3L7WA 4EGYA 4FX4A 3C3WA 2XKPA 2YU3A 1WI9A 2XAGA 5LHGA 1U6GA 5EEGA 1B9NA 4M74A 5ICEA 3F8BA 4CDGA 4AVPA 1K6OA 2LDUA 3K0LA 3GO5A 2WV0A 4NHJA 1T39A 4OMZA 4WF2A 5K5QA 1ON2A 1LEAA 3SZPA 5IT9Z 4ASNA 3FMQA 1P4AA 3PFIA 2VBYA 4XSXF 4LK0F 1K7AA 1OPCA 3CDHA 2M8EA 2H6CA 2VBZA 2GZWA 4Y13A 2H6BA 2EV0A 5DD4A 4H0EA 2DI3A 1FNNA 1R1TA 2DTRA 1S6LA 4OOIA 3I0TA 4EJOA 3F6VA 2OU2A 2DK8A 2RV8A 4EM1A 1PUEE 2ZJ2A 1FLIA 2W84A 2HZTA 3NRVA 1O3SA 2BBYA 2E1CA 4O6JA 2ESHA 1KQ0A 1WSUA 2R7FA 4Q48A 1OMIA 4DQ2A 5JHUA 5CYVA 1XMAA 3QP5A 4CXFA 3JSOA 3DQVC 3QOPA 2P5KA 2Z33A 3L00A 3J81Z 3ZPLA 3CTAA 4JQFA 1U78A 2CWEA 5FLXZ 2GXGA 2CGPA 3RKYA 4LLNA 3BY6A 1P4XA 5CVUA 3ECHA 4YG2F 2L4MA 3S2WA 4KN4X 2F5DA 5L3EA 3PQJA 5D4SA 4M6YA 4WCGA 1EH6A 5LHHA 3VEPA 1K78B 2M5WA 2RVCA 2M45A 3G3ZA 1UCRA 2XAHA 3HSRA 4DNCA 5DEQA 1W7PB 4UVAA 4RB2C 2TDXA 3ABUA 5LBQA 1SD5A 3IHUA 4LLLA 2Y75A 3RJPA 2GA1A 2OA4A 3RPQA 3RKXA 4UV8A 1KYWA 3EETA 4FX0A 1EV7A 4OU0A 2Q8KA 1EH7A 4U7BA 1HW2A 3KETA 2EFWA 4HZFA 3TKYA 5JR3A 3R4KA 5D6EA 4BQAA 1TTYA 2IT0A 1P2FA 2ZBKA 3GFLA 2FMYA 5D4RA 1XSXA 1A04A 2HS5A 3L2CA 1FOKA 3MEXA 3HYIA 1SFXA 2HYGD 1HQCA 3R6SA 4TV7A 1IZ1A 1Y0UA 2EA4A 5TJJA 2JPBA 1XGNA 4HX4A 4P96A 1TNTA 1XSDA 1IN6A 3I4PA 4OIPF 4ESFA 5JI6A 2V6CA 2PMHA 1WWXA 2PQ8A 4XLPF 2ZNZA 3M8FA 5L3DA 2VODA 5E1XA 2C6YA 2XROA 2NNNA 1HKSA 2CO5A 3R0AA 1F5TA 3FXUA 1FPQA 3TGNA 1KGSA 1SD7A 4KIFA 1RIOH 4GYGA 1XN7A 4GXOA 2A07F 2IRFG 5HLHA 1F4KA 3TO6A 1IXCA 2A68F 3C18A 1P4WA 3HRMA 4U7DA 5D6FA 3KP2A 1LVAA 1DP7P 3WGIA 2AS5F 4CGZA 1ONVA 3T5XA 2G7UA 3LQRA 1AOYA 1P6RA 1SFEA 5BPDA 2EB7A 2MLGA 3VODA 3WGGA 4A6DA 2GA2A 3FMSA 2IW5A 2QWWA 2CSOA 1G3YA 1KYZA 2F5EA 2FBHA 3WTUC 2D1HA 1YTYA 4P9FA 1IXSB 3ZMSA 4RAZA 5D5WB 3B73A 2IA0A 4MHGA 1O3RA 4R1HA 2HGCA 4XLNF 3T8RA 1IUYA 4AIHA 2DAOA 5LHIA 2D45A 2YX4A 4G94A 4L9TA 3R61A 3O3KA 3DPTA 2BGCA 2JRTA 3IKTA 2ELHA 4G6DA 2O8XA 4LG0B 3FF5A 3SQNA 3KCCA 1MKMA 2XIGA 1TW3A 2FOKA 1B9MA 2P8TA 2H09A 3IRRA 1Z6TA 4IJAA 2DW4A 2DK5A 4QWQA 4LK1F 2R7DA 2VOOA 1ZGAA 4BHPA 4R79A 1J9IA 4LLGF 4ZYEA 2G7HA 4I0BA 1O3TA 1MDMB 2P6SA 1S7AA 1CGPA 3ECOA 4Y15A 3ZMDA 4AIJA 4A6EA 1YS6A 3TOBA 4A0XA 1DUXC 1S3JA 4WXDA 1S29A 4UHTA 4EQQA 3ZN1A 3JAMK 1OR7A 2ZO4A 1FT9A 4ON0A 2O03A 5ICCA 1FSHA 2EV5A 1SFUA 1LQ1A 1UB9A 1QGPA 3KFWX 4A0YA 4S05A 3GX4X 5FFZA 4BAYA 5KK1A 2UXXA 2HYFA 2E7WA 4I0AA 3D5LA 1S7OA 4HX7A 3E6BA 4G7HF 2A3SA 2Z5UA 1ZAOA 3K1NA 3N97A 2DQLA 3MQ0A 3K69A 2QBYA 4BHBA 3V7RA 1K79A 1S8NA 3EUHA 1RZ4A 2CG4A 3ZP5A 2JPCA 2RNJA 1HSJA 4UUVA 4A5NA 4IF4A 5BOXA 1BIBA 5L3CA 1B4AA 4EJWA 3CUQB 4I98B 2WTEA 1KA8A 3GFMA 3W6KB 2VONA 1C0WA 3T8TA 1XDSA 4ESJA 3DFGA 1O7FA 5LEKA 4MEYF 3E5XA 2ETHA 2XV4S 4MTEA 5L3BA 2A61A 2PJPA 3J80K 3KP7A 5A2QK 4LD5A 3JSPA 3MWMA 2QENA 4S04A 1E2XA 2RKHA 1P92A 2R3SA 2GXBA 3WTSC 1QZYA 1ZG5A 2BEOA 4A0ZA 2RC4A 3CUQA 4IRGA 3WTZA 3BPXA 1J5YA 3VOEA 3KEQA 2VBXA 3QPHA 2STTA 1MZBA 2J5OA 1ZREA 4M71A 2HTSA 5ERIA 4MNUA 1ZARA 4L5JA 1SMYF 1R00A 3C1DA 5CVIA 1XCBA 1FBUA 1W5SA 3FM3A 2ZMEA 1CF7A 1STZA 2XASA 1BI2A 2AXLA 1PP7U 1G4DA 4MTDA 5DD8A 2PG4A 5BQTA 3RYPA 4PGGA 1USTA 2L01A 4ETSA 3ZN0A 1FBSA 3IWFA 5JFRA 3TQNA 3M7GA 4B09A 5H6QA 3GW2A 1O3QA 1U2WA 3TDUC 4LGWA 3P9CA 3ML6A 2YR2A 2KJCA 4P5OA 3COAC 1BC8C 4KMFA 4EGZA 2CYYA 4HV5A 2RN7A 1R22A 4EMSA 1XB4A 1BI1A 3DF8A 4OIQF 5JVTA 5CVVA 2Q0OA 4A5MA 1SAXA 1YO5C 2OZUA 1H0MA 3K1PA 1XSVA 1MDMA 5DCFA 2GQQA 2K86A 4IVNA 4OMYA 1DDNA 1ZLKA 1R23A 3KP5A 2L3DA 3KP3A 2QUFA 3E5QA 2O61A 1IW7F 3LA7A 4MQVA 4UV9A 2Y0MA 1V4RA 4XSZF 2M87A 5LGUA 3BPVA 3IWZA 2P5VA 3M8EA 1IF1A 3HTSB 4L9JA 4ZYGA 1G6NA 1GHCA 4QLCU 1ZHFA 3RDIA 5HLGA 5CJ9A 2P7VB 2DQRA 1J59A 1VTNC 2K4BA 4G7OF 3TOAA 2XKOA 3GZ5A 1AWCA 2JT1A 1Q1HA 2WC2A 3IC7A 3TO7A 1QO0D 3HRUA 2VE8A 4HQMA 1FBQA 2RQPA 3Q5FA 5CVRA 1YW7A 2HEOA 2K27A 1QNTA 4L5IA 3REOA 5ILVA 1U3EM 4KT5C 2NNYA 3D0SA 3DPLC 1QQIA 5HDKA 4KA4A 4WXCA 2IA2A 4CYDA 4ZYHA 1WKMA 2ZKZA 1O57A 2EWNA 3H3ZA 2V1UA 4L9NA 3F8NA 3NQOA 2D1VA 3HUGA 1FP1D 2GIVA 3F21A 1REPC 3LQQA 3U9GA 3ABTA 2FEZA 1D5VA 1ZRFA 2P4WA 3OOPA 2NS0A 1SD6A 2Z99A 2FMLA 3WU0A 1F9NA 1DPRA 4HF0A 4BH9A 3JTHA 3HOTA 2IVMA 3BJOA 2JTVA 3CJNA 5F64A 3E6MA 2UWMA 1GXQA 4Y17A 5AONA 3H3UA 1OYIA 5K5OA 4I09A 2G9WA 4HDUA 3M9AA 5BS6A 1I6XA 2XUBA 4HDVA 5E20A 2DBBA 1FYMA 2MBFA 5K5RA 5D5UB 3HHGA 2CQKA 2DT5A 2F5CA 2NAZA 2V1DA 2OBPA 1JGSA 2KIUA 4I01A 2ZCWA 2EK5A 2XHKA 4HA8A 4M6XA 2H94A 4AD9A 2QQBA 4WX9A 1T38A 1XD7A 4PCQA 2VE9A 3GUDA 3FHZA 2Z9OA 2FXAA 2ZFWA 4IHTA 1BIAA 1FZPB 1PDNC 2HKOA 2W25A 4I02A 3TO9A 5ED4A 3WE2A 2B0LA 4ZZDA 1FY7A 1XGOA 1FX7A 4G9YA 2V79A 4Q4ZF 2PMUA 3LFKA 1IRGA 2FA5A 1ZRDA 1T98A 1HW5A 4UXNA 3E6CC 2M30A 1G3TA 4MQ9F 2K4JA 3IL2A 3I5UA 1Z1DA 3LAPA 1YIOA 4EV0A 1K78A 1LDDA 3K2ZA 4Z2YA 1TW2A 1IN4A 2CW0F 2LF8A 5E17F 3L9FA 1W7PA 4IPAA 1T0FA 3HRSA 1QPMA 4MGRA 1Z7UA 1LB2A 2EFOA 3F6OA 1OYYA 3J80Z 3NEUA 4F7ZA 3JTGA 1R1UA 3LA3A 1KU2A 1OYWA 4G8XA 1BN5A 2HR3A 3P9IA 5HS9A 2ZNYA 5DCMB 5HDGA 5HDNA 1ZLJA 5IT9K 3F8CA 1L0OC 4BHCA 4RGSA 4O3MA 2ACJA 4D0PA 5DUIA 3O6BB 2HWVA 4IRIA 2X0LA 2QM3A 2STWA 1V3FA 3DKWA 4AIKA 1FWZA 4ENKA 4LG0A 2VBWA 2O3FA 3I58A 4M73A 4RB1A 1WQ2A 2O6GE 2RDPA 1JHFA 4RAYA 5J6XA 4EJTA 4IHSA 4CO8A 1YG2A 1KQ9A 2CFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZZL A;  4HF1 A;  3GEZ A;  1KQ8 A;  3W6J B;  2DO7 A;  3KLN A;  4HYE A;  1ZN2 A;  4BXU A;  1FSE A;  2VT2 A;  3DV8 A;  4MEX F;  2KRF A;  2F2E A;  3U2R A;  3QPT A;  1B59 A;  2YSR A;  4YIF A;  5TRD A;  3QU6 A;  2ZXJ A;  2MH2 A;  4LB6 B;  1MJB A;  2HQN A;  5A2Q Z;  4CHU A;  5HOO A;  4KIB A;  2DPD A;  2BV6 A;  2ZME B;  1BM9 A;  3ISP A;  4P9U A;  1I1G A;  2IPQ X;  3QAH A;  1I27 A;  1O7L A;  1FYL A;  4A12 A;  2MLK A;  3ULQ B;  2FNA A;  2VN2 A;  3EYY A;  3GFI A;  1ZG1 A;  2KIM A;  5LEJ A;  2IP2 A;  1RUO A;  3OV8 A;  2UXN A;  2E1N A;  1ODD A;  1J0R A;  3I53 A;  1YYV A;  3RIR A;  1HST A;  5HVQ C;  1RUN A;  1G3W A;  1SMT A;  3Q9S A;  4NQW A;  3JW4 A;  5K1Y A;  3J81 K;  2KJB A;  2Z3Y A;  4LJZ F;  1R1V A;  1YLF A;  4CIC A;  4Q47 A;  1G3S A;  1W7P D;  1BI0 A;  3V8K A;  3MFK A;  1XMK A;  3AAF A;  2W57 A;  2LSO A;  4HLX A;  4JBA A;  4KFC A;  1YQA A;  3MZH A;  2BYV E;  3ZMU A;  4XRF A;  4LB5 A;  1MGT A;  3FXR A;  4A2U A;  2J5P A;  4IXA A;  2PI0 A;  2IJL A;  1ZGJ A;  5F6F A;  1IAW A;  3I64 A;  2QVO A;  1R5G A;  2DU9 A;  4O5V A;  4RB3 C;  3ERE D;  2OAZ A;  3QRF F;  4CZZ A;  1HXD A;  2P5L C;  1GXP A;  3WU1 B;  2QLZ A;  1UFM A;  2FBI A;  2O0Y A;  3WGH A;  3BOQ A;  2A6H F;  1KU9 A;  4YFX F;  3ZQ7 A;  1RI7 A;  3KE2 A;  4KIG A;  1T2K A;  5HS7 A;  5ILU A;  4U0Y A;  3KEO A;  2EFN A;  2QQA A;  2OZ6 A;  5L3G A;  4YFK F;  3F8F A;  5L3F A;  5E1W A;  1LNW A;  2FE3 A;  5LGN A;  2Q2E A;  3G73 A;  1RNL A;  4UVC A;  3RKW A;  1BJA A;  5J8F A;  4UVB A;  5DDG A;  5KVR A;  3GVA A;  2PN6 A;  5LRS A;  4U88 A;  5IT3 A;  1PP8 F;  2PBI A;  5FD5 A;  1YW8 A;  3B02 A;  2JZY A;  1YS7 A;  3JAM Z;  1W5T A;  3WE3 A;  3I54 A;  4ENN A;  3RI4 A;  2LNB A;  2H27 A;  3DEU A;  3HTU A;  4ESB A;  1ZH5 A;  4P55 A;  4BYY A;  4UNO A;  1NHA A;  2XAF A;  4E70 A;  2XRN A;  2EA2 A;  3I71 A;  3LST A;  4GO1 A;  4YFN F;  4KDP A;  2FU4 A;  4OIO F;  5E8I A;  4NB5 A;  1IRF A;  1YFH A;  3WTX C;  5D5X B;  2VT3 A;  3KLO A;  2QZ8 A;  2ESN A;  3H92 A;  3HHH A;  3FZV A;  2MH9 A;  3I59 B;  2P7C B;  3CLO A;  2KKO A;  1T6S A;  1B1B A;  2XAJ A;  3MCZ A;  3E5U A;  3ELK A;  5FGM A;  4KNY A;  2M1B A;  3WG9 A;  1Z9C A;  2DFI A;  3LWF A;  2XAQ A;  3GFJ A;  3WTV C;  3RPU A;  2YX7 A;  2HQR A;  3QP6 A;  3V7C A;  4BNC A;  3QU3 A;  3SZT A;  1I1S A;  5HLI A;  4L0Z B;  1TQP A;  2FF4 A;  4U0W A;  1LJ9 A;  1MD0 A;  3BDD A;  5D8L B;  1BC7 C;  1LDK B;  2XGX A;  3M1E A;  1FYK A;  3TDZ C;  4RS8 A;  3P7N A;  4B8X A;  1TLH B;  3SHF A;  3O2P E;  3F22 A;  3CUQ C;  1QBJ A;  1MJ9 A;  3CO6 C;  3BWG A;  2FSW A;  5CVJ A;  4L0Y B;  1HW1 A;  3E97 A;  3J7A O;  5FD6 A;  3HSE A;  5LRR A;  3VB2 A;  3WOD F;  3BZ6 A;  2HTJ A;  3U1D A;  4GGG A;  3R0J A;  3K1M A;  5D8K B;  3ROU A;  5ILS A;  3SFZ A;  3EQL F;  3V4G A;  3GF2 A;  1R7J A;  3P9K A;  5DUK A;  5HS8 A;  1LEB A;  2L54 A;  3HSF A;  3N4M A;  2NRA C;  4FHT A;  3V7S A;  4Q5S F;  1U8R A;  4L9V A;  3F8M A;  4AWX B;  1OKR A;  2KIF A;  3FM5 A;  4KIC A;  3VFZ A;  4WK8 F;  5BPI A;  4HQE A;  2EV6 A;  4HLY A;  3FMR A;  5H6R A;  5EEH A;  3KP4 A;  2PFB A;  4PDK A;  3RTR A;  2COM A;  4GYI A;  1TBX A;  1BI3 A;  2FQ3 A;  2LF7 A;  1ZYR F;  2NYX A;  1GVJ A;  4M9Z A;  2MD5 A;  1R5H A;  2VC1 A;  4N9I A;  5BMZ A;  1SD4 A;  1D3Y A;  3DP7 A;  3CUO A;  5FFX A;  2EJR A;  5J8C A;  1JE8 A;  2QBY B;  1H9T A;  1E17 A;  3K9T A;  4EJU A;  3F23 A;  4OIR F;  4N9H A;  1CF7 B;  1JHH A;  3E6D A;  2A5Y B;  3GLX A;  1R58 A;  2P6T A;  4PGH A;  3MAJ A;  4KMU X;  4M9S A;  4IRH A;  2Y48 A;  1DPU A;  4RB0 A;  4ZH4 F;  3F3X A;  2GWR A;  5ICF A;  1D8K A;  5AIP A;  3ZMV A;  4FT8 A;  1I5Z A;  4XBF A;  2BE5 F;  1IN5 A;  4YII A;  2W24 A;  5CLS A;  4I7H A;  2ISZ A;  4WWC A;  2OD5 A;  4U0V A;  3SXY A;  1XCV A;  3I59 A;  2ISY A;  1BOA A;  3FX3 A;  1J2X A;  4KUM A;  1JXS A;  2V9V A;  1KU3 A;  3WTY C;  2E7X A;  3V8J A;  5LLQ A;  1Z91 A;  1QZZ A;  1FC3 A;  2HDC A;  4ENJ A;  1U5T A;  2EFP A;  1ZRC A;  4LMY A;  1EH8 A;  2L4A A;  3GZ6 A;  1LDJ A;  6PAX A;  2RGV A;  2D2W A;  4N0B A;  4JK1 X;  4R8H A;  2FBK A;  3BJ6 A;  3LA2 A;  3IKV A;  2HKX A;  3WTT C;  3FXQ A;  1USS A;  4HW0 A;  3EDP A;  3HIF A;  3Q9V A;  3CO7 C;  4KN7 X;  1HBX G;  4OIN F;  4HOB A;  5ICG A;  2MA3 A;  3T0Y A;  3HOS A;  3IRQ A;  2F5F A;  1UHM A;  2A6E F;  1XGM A;  2DLL A;  3C7J A;  3HRT A;  4EVI A;  2PEX A;  3BRO A;  3V8L A;  1IXR C;  4HF2 A;  3EYI A;  4G6Q A;  5F1R A;  2DPU A;  3E3V A;  1H9G A;  3WTW C;  1XDU A;  2ADU A;  4RGU A;  1J75 A;  3GWZ A;  1F1Z A;  2K7L A;  4I2O A;  1IN8 A;  2K02 A;  3L09 A;  4ZYD A;  5AIQ A;  4ENM A;  5LGT A;  1ZG3 A;  1ULY A;  3PQK A;  2HFH A;  1B6A A;  2LKP A;  4PZJ A;  1MJA A;  5D5V B;  1ON1 A;  3BJA A;  2X4H A;  1TQM A;  4HX8 A;  3LAJ A;  3FWE A;  4HV6 A;  1YW9 A;  3ZMT A;  3R60 A;  5E8G A;  1R36 A;  2VC0 A;  3KP6 A;  4L18 B;  4HBL A;  1Z6R A;  4WXH A;  1IN7 A;  1XGS A;  4RGX A;  2FNP A;  2UZK A;  2EFQ A;  1X3U A;  5DCM A;  2VOP A;  2MC3 A;  2JSC A;  2VXZ A;  3KZY A;  1D8J A;  4EJV A;  5FB2 A;  2GAU A;  1HKT A;  3MZY A;  1Z05 A;  2IA1 A;  2HOE A;  2FRH A;  4RGR A;  1J7K A;  4M72 A;  1U5T C;  4LFU A;  3RYR A;  4GCV A;  2L02 A;  3GYH X;  3GXO A;  4M9X A;  3ZMZ A;  5FLX K;  3DXJ F;  1TNS A;  1BBY A;  5E18 F;  1TQI A;  2WWY A;  3KZZ A;  5H20 A;  2QYO A;  2QQ9 A;  4K2E A;  2OQG A;  2YPR A;  1W4M A;  2PLY A;  1FP2 A;  2XVC A;  1KU7 A;  5FO5 A;  4G7Z F;  1UHW A;  1HKQ A;  4EM2 A;  5E1Z B;  3F72 A;  1U5T B;  2A69 F;  2W85 A;  2OQR A;  4KYW A;  3T1B A;  4HAM A;  1L3L A;  5DYM A;  1WRJ A;  5DV5 A;  2V1X A;  3BP8 A;  4EM0 B;  3L7W A;  4EGY A;  4FX4 A;  3C3W A;  2XKP A;  2YU3 A;  1WI9 A;  2XAG A;  5LHG A;  1U6G A;  5EEG A;  1B9N A;  4M74 A;  5ICE A;  3F8B A;  4CDG A;  4AVP A;  1K6O A;  2LDU A;  3K0L A;  3GO5 A;  2WV0 A;  4NHJ A;  1T39 A;  4OMZ A;  4WF2 A;  5K5Q A;  1ON2 A;  1LEA A;  3SZP A;  5IT9 Z;  4ASN A;  3FMQ A;  1P4A A;  3PFI A;  2VBY A;  4XSX F;  4LK0 F;  1K7A A;  1OPC A;  3CDH A;  2M8E A;  2H6C A;  2VBZ A;  2GZW A;  4Y13 A;  2H6B A;  2EV0 A;  5DD4 A;  4H0E A;  2DI3 A;  1FNN A;  1R1T A;  2DTR A;  1S6L A;  4OOI A;  3I0T A;  4EJO A;  3F6V A;  2OU2 A;  2DK8 A;  2RV8 A;  4EM1 A;  1PUE E;  2ZJ2 A;  1FLI A;  2W84 A;  2HZT A;  3NRV A;  1O3S A;  2BBY A;  2E1C A;  4O6J A;  2ESH A;  1KQ0 A;  1WSU A;  2R7F A;  4Q48 A;  1OMI A;  4DQ2 A;  5JHU A;  5CYV A;  1XMA A;  3QP5 A;  4CXF A;  3JSO A;  3DQV C;  3QOP A;  2P5K A;  2Z33 A;  3L00 A;  3J81 Z;  3ZPL A;  3CTA A;  4JQF A;  1U78 A;  2CWE A;  5FLX Z;  2GXG A;  2CGP A;  3RKY A;  4LLN A;  3BY6 A;  1P4X A;  5CVU A;  3ECH A;  4YG2 F;  2L4M A;  3S2W A;  4KN4 X;  2F5D A;  5L3E A;  3PQJ A;  5D4S A;  4M6Y A;  4WCG A;  1EH6 A;  5LHH A;  3VEP A;  1K78 B;  2M5W A;  2RVC A;  2M45 A;  3G3Z A;  1UCR A;  2XAH A;  3HSR A;  4DNC A;  5DEQ A;  1W7P B;  4UVA A;  4RB2 C;  2TDX A;  3ABU A;  5LBQ A;  1SD5 A;  3IHU A;  4LLL A;  2Y75 A;  3RJP A;  2GA1 A;  2OA4 A;  3RPQ A;  3RKX A;  4UV8 A;  1KYW A;  3EET A;  4FX0 A;  1EV7 A;  4OU0 A;  2Q8K A;  1EH7 A;  4U7B A;  1HW2 A;  3KET A;  2EFW A;  4HZF A;  3TKY A;  5JR3 A;  3R4K A;  5D6E A;  4BQA A;  1TTY A;  2IT0 A;  1P2F A;  2ZBK A;  3GFL A;  2FMY A;  5D4R A;  1XSX A;  1A04 A;  2HS5 A;  3L2C A;  1FOK A;  3MEX A;  3HYI A;  1SFX A;  2HYG D;  1HQC A;  3R6S A;  4TV7 A;  1IZ1 A;  1Y0U A;  2EA4 A;  5TJJ A;  2JPB A;  1XGN A;  4HX4 A;  4P96 A;  1TNT A;  1XSD A;  1IN6 A;  3I4P A;  4OIP F;  4ESF A;  5JI6 A;  2V6C A;  2PMH A;  1WWX A;  2PQ8 A;  4XLP F;  2ZNZ A;  3M8F A;  5L3D A;  2VOD A;  5E1X A;  2C6Y A;  2XRO A;  2NNN A;  1HKS A;  2CO5 A;  3R0A A;  1F5T A;  3FXU A;  1FPQ A;  3TGN A;  1KGS A;  1SD7 A;  4KIF A;  1RIO H;  4GYG A;  1XN7 A;  4GXO A;  2A07 F;  2IRF G;  5HLH A;  1F4K A;  3TO6 A;  1IXC A;  2A68 F;  3C18 A;  1P4W A;  3HRM A;  4U7D A;  5D6F A;  3KP2 A;  1LVA A;  1DP7 P;  3WGI A;  2AS5 F;  4CGZ A;  1ONV A;  3T5X A;  2G7U A;  3LQR A;  1AOY A;  1P6R A;  1SFE A;  5BPD A;  2EB7 A;  2MLG A;  3VOD A;  3WGG A;  4A6D A;  2GA2 A;  3FMS A;  2IW5 A;  2QWW A;  2CSO A;  1G3Y A;  1KYZ A;  2F5E A;  2FBH A;  3WTU C;  2D1H A;  1YTY A;  4P9F A;  1IXS B;  3ZMS A;  4RAZ A;  5D5W B;  3B73 A;  2IA0 A;  4MHG A;  1O3R A;  4R1H A;  2HGC A;  4XLN F;  3T8R A;  1IUY A;  4AIH A;  2DAO A;  5LHI A;  2D45 A;  2YX4 A;  4G94 A;  4L9T A;  3R61 A;  3O3K A;  3DPT A;  2BGC A;  2JRT A;  3IKT A;  2ELH A;  4G6D A;  2O8X A;  4LG0 B;  3FF5 A;  3SQN A;  3KCC A;  1MKM A;  2XIG A;  1TW3 A;  2FOK A;  1B9M A;  2P8T A;  2H09 A;  3IRR A;  1Z6T A;  4IJA A;  2DW4 A;  2DK5 A;  4QWQ A;  4LK1 F;  2R7D A;  2VOO A;  1ZGA A;  4BHP A;  4R79 A;  1J9I A;  4LLG F;  4ZYE A;  2G7H A;  4I0B A;  1O3T A;  1MDM B;  2P6S A;  1S7A A;  1CGP A;  3ECO A;  4Y15 A;  3ZMD A;  4AIJ A;  4A6E A;  1YS6 A;  3TOB A;  4A0X A;  1DUX C;  1S3J A;  4WXD A;  1S29 A;  4UHT A;  4EQQ A;  3ZN1 A;  3JAM K;  1OR7 A;  2ZO4 A;  1FT9 A;  4ON0 A;  2O03 A;  5ICC A;  1FSH A;  2EV5 A;  1SFU A;  1LQ1 A;  1UB9 A;  1QGP A;  3KFW X;  4A0Y A;  4S05 A;  3GX4 X;  5FFZ A;  4BAY A;  5KK1 A;  2UXX A;  2HYF A;  2E7W A;  4I0A A;  3D5L A;  1S7O A;  4HX7 A;  3E6B A;  4G7H F;  2A3S A;  2Z5U A;  1ZAO A;  3K1N A;  3N97 A;  2DQL A;  3MQ0 A;  3K69 A;  2QBY A;  4BHB A;  3V7R A;  1K79 A;  1S8N A;  3EUH A;  1RZ4 A;  2CG4 A;  3ZP5 A;  2JPC A;  2RNJ A;  1HSJ A;  4UUV A;  4A5N A;  4IF4 A;  5BOX A;  1BIB A;  5L3C A;  1B4A A;  4EJW A;  3CUQ B;  4I98 B;  2WTE A;  1KA8 A;  3GFM A;  3W6K B;  2VON A;  1C0W A;  3T8T A;  1XDS A;  4ESJ A;  3DFG A;  1O7F A;  5LEK A;  4MEY F;  3E5X A;  2ETH A;  2XV4 S;  4MTE A;  5L3B A;  2A61 A;  2PJP A;  3J80 K;  3KP7 A;  5A2Q K;  4LD5 A;  3JSP A;  3MWM A;  2QEN A;  4S04 A;  1E2X A;  2RKH A;  1P92 A;  2R3S A;  2GXB A;  3WTS C;  1QZY A;  1ZG5 A;  2BEO A;  4A0Z A;  2RC4 A;  3CUQ A;  4IRG A;  3WTZ A;  3BPX A;  1J5Y A;  3VOE A;  3KEQ A;  2VBX A;  3QPH A;  2STT A;  1MZB A;  2J5O A;  1ZRE A;  4M71 A;  2HTS A;  5ERI A;  4MNU A;  1ZAR A;  4L5J A;  1SMY F;  1R00 A;  3C1D A;  5CVI A;  1XCB A;  1FBU A;  1W5S A;  3FM3 A;  2ZME A;  1CF7 A;  1STZ A;  2XAS A;  1BI2 A;  2AXL A;  1PP7 U;  1G4D A;  4MTD A;  5DD8 A;  2PG4 A;  5BQT A;  3RYP A;  4PGG A;  1UST A;  2L01 A;  4ETS A;  3ZN0 A;  1FBS A;  3IWF A;  5JFR A;  3TQN A;  3M7G A;  4B09 A;  5H6Q A;  3GW2 A;  1O3Q A;  1U2W A;  3TDU C;  4LGW A;  3P9C A;  3ML6 A;  2YR2 A;  2KJC A;  4P5O A;  3COA C;  1BC8 C;  4KMF A;  4EGZ A;  2CYY A;  4HV5 A;  2RN7 A;  1R22 A;  4EMS A;  1XB4 A;  1BI1 A;  3DF8 A;  4OIQ F;  5JVT A;  5CVV A;  2Q0O A;  4A5M A;  1SAX A;  1YO5 C;  2OZU A;  1H0M A;  3K1P A;  1XSV A;  1MDM A;  5DCF A;  2GQQ A;  2K86 A;  4IVN A;  4OMY A;  1DDN A;  1ZLK A;  1R23 A;  3KP5 A;  2L3D A;  3KP3 A;  2QUF A;  3E5Q A;  2O61 A;  1IW7 F;  3LA7 A;  4MQV A;  4UV9 A;  2Y0M A;  1V4R A;  4XSZ F;  2M87 A;  5LGU A;  3BPV A;  3IWZ A;  2P5V A;  3M8E A;  1IF1 A;  3HTS B;  4L9J A;  4ZYG A;  1G6N A;  1GHC A;  4QLC U;  1ZHF A;  3RDI A;  5HLG A;  5CJ9 A;  2P7V B;  2DQR A;  1J59 A;  1VTN C;  2K4B A;  4G7O F;  3TOA A;  2XKO A;  3GZ5 A;  1AWC A;  2JT1 A;  1Q1H A;  2WC2 A;  3IC7 A;  3TO7 A;  1QO0 D;  3HRU A;  2VE8 A;  4HQM A;  1FBQ A;  2RQP A;  3Q5F A;  5CVR A;  1YW7 A;  2HEO A;  2K27 A;  1QNT A;  4L5I A;  3REO A;  5ILV A;  1U3E M;  4KT5 C;  2NNY A;  3D0S A;  3DPL C;  1QQI A;  5HDK A;  4KA4 A;  4WXC A;  2IA2 A;  4CYD A;  4ZYH A;  1WKM A;  2ZKZ A;  1O57 A;  2EWN A;  3H3Z A;  2V1U A;  4L9N A;  3F8N A;  3NQO A;  2D1V A;  3HUG A;  1FP1 D;  2GIV A;  3F21 A;  1REP C;  3LQQ A;  3U9G A;  3ABT A;  2FEZ A;  1D5V A;  1ZRF A;  2P4W A;  3OOP A;  2NS0 A;  1SD6 A;  2Z99 A;  2FML A;  3WU0 A;  1F9N A;  1DPR A;  4HF0 A;  4BH9 A;  3JTH A;  3HOT A;  2IVM A;  3BJO A;  2JTV A;  3CJN A;  5F64 A;  3E6M A;  2UWM A;  1GXQ A;  4Y17 A;  5AON A;  3H3U A;  1OYI A;  5K5O A;  4I09 A;  2G9W A;  4HDU A;  3M9A A;  5BS6 A;  1I6X A;  2XUB A;  4HDV A;  5E20 A;  2DBB A;  1FYM A;  2MBF A;  5K5R A;  5D5U B;  3HHG A;  2CQK A;  2DT5 A;  2F5C A;  2NAZ A;  2V1D A;  2OBP A;  1JGS A;  2KIU A;  4I01 A;  2ZCW A;  2EK5 A;  2XHK A;  4HA8 A;  4M6X A;  2H94 A;  4AD9 A;  2QQB A;  4WX9 A;  1T38 A;  1XD7 A;  4PCQ A;  2VE9 A;  3GUD A;  3FHZ A;  2Z9O A;  2FXA A;  2ZFW A;  4IHT A;  1BIA A;  1FZP B;  1PDN C;  2HKO A;  2W25 A;  4I02 A;  3TO9 A;  5ED4 A;  3WE2 A;  2B0L A;  4ZZD A;  1FY7 A;  1XGO A;  1FX7 A;  4G9Y A;  2V79 A;  4Q4Z F;  2PMU A;  3LFK A;  1IRG A;  2FA5 A;  1ZRD A;  1T98 A;  1HW5 A;  4UXN A;  3E6C C;  2M30 A;  1G3T A;  4MQ9 F;  2K4J A;  3IL2 A;  3I5U A;  1Z1D A;  3LAP A;  1YIO A;  4EV0 A;  1K78 A;  1LDD A;  3K2Z A;  4Z2Y A;  1TW2 A;  1IN4 A;  2CW0 F;  2LF8 A;  5E17 F;  3L9F A;  1W7P A;  4IPA A;  1T0F A;  3HRS A;  1QPM A;  4MGR A;  1Z7U A;  1LB2 A;  2EFO A;  3F6O A;  1OYY A;  3J80 Z;  3NEU A;  4F7Z A;  3JTG A;  1R1U A;  3LA3 A;  1KU2 A;  1OYW A;  4G8X A;  1BN5 A;  2HR3 A;  3P9I A;  5HS9 A;  2ZNY A;  5DCM B;  5HDG A;  5HDN A;  1ZLJ A;  5IT9 K;  3F8C A;  1L0O C;  4BHC A;  4RGS A;  4O3M A;  2ACJ A;  4D0P A;  5DUI A;  3O6B B;  2HWV A;  4IRI A;  2X0L A;  2QM3 A;  2STW A;  1V3F A;  3DKW A;  4AIK A;  1FWZ A;  4ENK A;  4LG0 A;  2VBW A;  2O3F A;  3I58 A;  4M73 A;  4RB1 A;  1WQ2 A;  2O6G E;  2RDP A;  1JHF A;  4RAY A;  5J6X A;  4EJT A;  4IHS A;  4CO8 A;  1YG2 A;  1KQ9 A;  2CFX A; 
#chains in the Genus database with same CATH topology
 1EA3 A;  4ZZL A;  1OCT C;  4HF1 A;  3GEZ A;  4XIC A;  1KQ8 A;  3W6J B;  3CC4 I;  2DO7 A;  3KLN A;  4HYE A;  1ZN2 A;  4BXU A;  1FSE A;  3DPU A;  2VT2 A;  3W2W A;  4XRS G;  3CMA I;  1D5Y A;  3DV8 A;  3FHN A;  4MEX F;  2BHY A;  2X85 A;  3BZK A;  2KRF A;  4M3E A;  4N4N B;  2F2E A;  5EJC A;  3U2R A;  3QPT A;  1B8I B;  1B59 A;  3QOE A;  4BXF A;  2YSR A;  1WH7 A;  4YIF A;  2JRM A;  4PJJ A;  2VUM J;  2WBM A;  4XK4 A;  1X1B A;  5TRD A;  3CCV I;  2JA2 A;  3QU6 A;  2ZXJ A;  2KIS A;  1WVR A;  5JHF A;  2MH2 A;  1RKT A;  4ZC3 A;  4LB6 B;  1MJB A;  2HQN A;  5A2Q Z;  3DEE A;  4CHU A;  2I5U A;  5HOO A;  1BR2 A;  2DOE A;  4KIB A;  3CMM A;  2R7S A;  1VQP I;  3PO2 J;  2DPD A;  2BV6 A;  2ZME B;  1BM9 A;  3HC7 A;  3ISP A;  1VQ8 I;  4P9U A;  2R7U A;  1I1G A;  5F0F A;  4X6A J;  1AA7 A;  3H3V K;  2W00 A;  3L1P A;  2IPQ X;  3QAH A;  4M6V A;  3NAU A;  4HNU A;  1I27 A;  1O7L A;  1FYL A;  2QA4 I;  1QVU A;  4NC6 A;  4U87 A;  1QPI A;  4A12 A;  5FKO A;  2MLK A;  3H5A A;  1SAU A;  3ULQ B;  2FNA A;  1JKR C;  4BQN A;  4BE2 A;  1HCR A;  3L2U A;  4BEH A;  3OS1 A;  2VN2 A;  3EYY A;  5FLM J;  3OS0 A;  3DLA A;  3GFI A;  1ZG1 A;  2KIM A;  2VQG A;  5LEJ A;  2XB5 A;  2IP2 A;  2WB1 N;  1RUO A;  3LFU A;  3OV8 A;  1VFC A;  3FKI J;  4HPQ A;  2UXN A;  4YRV A;  1DU0 A;  2E1N A;  1ODD A;  3S3M A;  2DA5 A;  1J0R A;  3I53 A;  1YYV A;  3S2D J;  4NNJ A;  3RIR A;  5FJ8 J;  1HST A;  2JUG A;  2DMU A;  2GOX B;  5HVQ C;  1RUN A;  1G3W A;  1SMT A;  3Q9S A;  5TGT A;  4NQW A;  2BY1 A;  3JW4 A;  5K1Y A;  3J81 K;  3FBI B;  4HEA 2;  3BG6 A;  1FMW A;  2KJB A;  2Z3Y A;  4LJZ F;  1R1V A;  3NAR A;  1YLF A;  1WJD A;  3LSJ A;  4NDL A;  4CIC A;  4Q47 A;  1G3S A;  1W7P D;  1BI0 A;  2R7V A;  3V8K A;  4GRI A;  3MFK A;  1XMK A;  2R7X A;  2IBD A;  3AAF A;  2W57 A;  2LSO A;  4HLX A;  2NOJ B;  3MKW B;  1YRN B;  1I39 A;  3BCA A;  4IZZ A;  4JBA A;  4KFC A;  1YQA A;  1N78 A;  3MZH A;  2BYV E;  2BW3 A;  5C4J J;  3L2Q A;  2X6W A;  2JK3 A;  3ZMU A;  4XRF A;  4NBQ A;  3CCY A;  1LE8 A;  3DBH B;  4YIR X;  3VDX A;  4LB5 A;  1MGT A;  3FXR A;  4A2U A;  1RC9 A;  3QYF A;  1HOM A;  1D1A A;  5KCM A;  2J5P A;  4IXA A;  3G4S I;  2VAS A;  3HL2 A;  2PI0 A;  2IJL A;  1ZGJ A;  4GFB A;  2IGM A;  4H4K C;  1YJN I;  1LKX A;  2K5C A;  5F6F A;  2IGO A;  2IEK A;  4PFO A;  1IAW A;  3SEQ A;  3I64 A;  2QVO A;  2LBF B;  1R5G A;  4DW6 A;  2TRT A;  1VQ9 I;  4XR6 A;  2DU9 A;  4O5V A;  3CJT B;  4RB3 C;  3ERE D;  2OAZ A;  2HPI A;  3WU2 C;  2VKE A;  3QRF F;  4CZZ A;  3EUK L;  1HXD A;  4XQF A;  2P5L C;  1GXP A;  3WU1 B;  2QLZ A;  2B9S A;  1UFM A;  2FBI A;  2O0Y A;  3WGH A;  3DLL F;  4ITV A;  5J1Y A;  3OIQ A;  3HKZ N;  3BOQ A;  4EAT A;  2A6H F;  1KU9 A;  4YFX F;  2HYJ A;  4E7J A;  3ZQ7 A;  3K70 C;  2AHQ A;  1RI7 A;  4ZDP A;  2CFO A;  2OJE D;  3KE2 A;  4BE1 A;  4KIG A;  1T2K A;  5HS7 A;  5ILU A;  3EUA A;  4U0Y A;  2F6C A;  3KEO A;  2QSG X;  2EFN A;  2QQA A;  2OZ6 A;  5L3G A;  4YFK F;  1K4T A;  2E34 A;  2CMP A;  3F8F A;  5L3F A;  4CCM A;  5E1W A;  1LNW A;  3VYT B;  4CCO A;  2FE3 A;  5LGN A;  3H9Q A;  1AU7 A;  2Q2E A;  3BR0 A;  3G73 A;  2E19 A;  1RNL A;  2KLO A;  2V4J C;  4UVC A;  3RKW A;  1BJA A;  2LK2 A;  5J8F A;  1LVK A;  1GV5 A;  2VIX A;  3S17 J;  2JMW A;  4UVB A;  1JUS A;  5DDG A;  2WB1 A;  5KVR A;  3GVA A;  2KDZ A;  1LFP A;  2HOT A;  1XX5 A;  2PN6 A;  2EZL A;  5LRS A;  4U88 A;  4JX6 A;  5IT3 A;  1PP8 F;  4D5C A;  2DA1 A;  1PVE A;  3HZJ A;  3DU5 A;  4M3B A;  4IOC F;  2PBI A;  5FD5 A;  1YW8 A;  1X3Z B;  2VPL A;  2ME0 A;  3B02 A;  4JYK A;  2JZY A;  1YS7 A;  3JAM Z;  1W5T A;  4HST A;  3WE3 A;  2DMN A;  4LOC A;  3I54 A;  2DXI A;  3BC8 A;  1V5F A;  4ENN A;  3RI4 A;  2LNB A;  2H27 A;  3KZI C;  4B47 A;  3DEU A;  3HTU A;  2VKH A;  2L2O A;  4ESB A;  1ZH5 A;  3LSK A;  4GDF A;  4P55 A;  4BYY A;  3BLY A;  4UNO A;  1NHA A;  2XAF A;  4E70 A;  2XRN A;  2EA2 A;  3ZQL A;  3I71 A;  3LST A;  2L9R A;  1WJB A;  1JTY A;  4GO1 A;  4YFN F;  2ID3 A;  4KDP A;  2FU4 A;  4OIO F;  2L0K A;  2M2E A;  3F0C A;  2JQ7 A;  5E8I A;  4NB5 A;  1IRF A;  1ACI A;  2ZFU A;  2XB0 X;  3WTX C;  1YFH A;  5D5X B;  2VT3 A;  3KLO A;  2QZ8 A;  5DM6 F;  2CU7 A;  2I10 A;  2BOL A;  2CS3 A;  4XLA A;  2ESN A;  3H92 A;  2BY3 A;  5GAD J;  4BBS J;  4Y4R A;  3HHH A;  2IS2 A;  3FZV A;  2MH9 A;  3I59 B;  1SFO J;  1J09 A;  2CV0 A;  2P7C B;  4KT6 A;  4BGD A;  2E2I J;  1DQU A;  3CLO A;  2BVM A;  3SEZ A;  1KZH A;  2KKO A;  5KAI C;  3G6E I;  1T6S A;  1B1B A;  5EEA A;  1V5G A;  2XAJ A;  3CQZ J;  3MCZ A;  5IP7 J;  1A35 A;  4KIS A;  3E5U A;  3ELK A;  1Y0N A;  4CUG A;  1QVT A;  2HVQ A;  2KPM A;  5FGM A;  4KNY A;  2M1B A;  3WG7 H;  3WG9 A;  1ETO A;  4FE7 A;  5FRN A;  1E3H A;  4LG3 A;  4M3D A;  1VND A;  2DFI A;  1Z9C A;  3ZGK A;  2E36 A;  1P7J A;  3LWF A;  2ID6 A;  2XAQ A;  3GFJ A;  1BW5 A;  3WTV C;  3K6G A;  5IY5 H;  3RPU A;  2L7K A;  2CUE A;  2P0W A;  2YX7 A;  2HQR A;  3QP6 A;  1IUF A;  3V7C A;  4BNC A;  3QU3 A;  3CCU I;  3E7L A;  3SZT A;  1I1S A;  5HLI A;  2E1O A;  1TQP A;  2FF4 A;  4L0Z B;  2VLA A;  2FUG 2;  4U0W A;  2MGQ A;  1LJ9 A;  1MD0 A;  3BDD A;  5D8L B;  3M4O J;  4ZTF A;  2JA6 J;  3FIW A;  1LDK B;  1BC7 C;  2XGX A;  3LSH A;  3RKQ A;  2DA6 A;  2F5V A;  3M1E A;  1FYK A;  3TDZ C;  5DTD A;  4RS8 A;  3P7N A;  1YHQ I;  4JX4 A;  4M3F A;  4B8X A;  3OYD A;  1TLH B;  2LG4 A;  2QKL B;  3SHF A;  3A01 A;  3O2P E;  2L5Q A;  3F22 A;  3CUQ C;  1QBJ A;  1MJ9 A;  4D7N A;  3GTM J;  3CO6 C;  3BWG A;  2FSW A;  1XMX A;  5CVJ A;  2K40 A;  2VQL A;  1W36 C;  2DYR H;  4L0Y B;  1HW1 A;  3E97 A;  3J7A O;  5FD6 A;  3HSE A;  4PJM A;  5LRR A;  3VB2 A;  3WOD F;  3BZ6 A;  1IC8 A;  2HTJ A;  3U1D A;  3W2A A;  4GGG A;  3R0J A;  3K1M A;  4G12 A;  5D8K B;  3ROU A;  1UG2 A;  1ERD A;  2Y0S A;  2FOW A;  3PSI A;  5FKL A;  5ILS A;  3SFZ A;  3EQL F;  5BNG A;  2CQQ A;  3V4G A;  1T56 A;  4A3C J;  2GM4 A;  4I76 A;  3IAM 2;  3GF2 A;  5IP9 J;  4DOZ A;  4DBR A;  2XF7 A;  1R7J A;  3P9K A;  5DUK A;  5HS8 A;  1LEB A;  2L54 A;  4XOP A;  1R4M B;  4MLO A;  3HSF A;  3N4M A;  2NRA C;  2CRG A;  2MG4 A;  3H36 A;  2ZC2 A;  2GOM A;  4FHT A;  2JVH A;  4UUS B;  2L7M P;  4V2G A;  1JUM A;  3V7S A;  4Q5S F;  4UB8 C;  3OYJ A;  1U8R A;  3GTL J;  3HOX J;  4L9V A;  1MBK A;  3F8M A;  3PM1 A;  2VJI A;  2BY0 A;  1H89 C;  4AWX B;  4D1Q A;  1W36 D;  1OKR A;  5CQG A;  4S0H B;  2KIF A;  1X1D A;  2H1K A;  3FM5 A;  2BVL A;  4KIC A;  5HLT A;  3VFZ A;  2Q2E B;  4WK8 F;  5BPI A;  4HQE A;  3K7A J;  3ESW B;  2EV6 A;  4HLY A;  1JI8 A;  1Y56 A;  3LL7 A;  4CYC B;  3FMR A;  4E7L A;  5H6R A;  5FKN A;  3RSN A;  5EEH A;  2IGK A;  2KZG A;  2MC4 A;  3HUG B;  3KP4 A;  3A1Y A;  1G8X A;  1E3O C;  2PFB A;  4PDK A;  1ETQ A;  3RTR A;  4IHW A;  2COM A;  4GYI A;  1TBX A;  3X2Q H;  4XKV A;  1BI3 A;  2FQ3 A;  2LF7 A;  1ZYR F;  3K4M A;  1T95 A;  2NYX A;  2KP6 A;  3CCS I;  2M8G X;  1GVJ A;  4M9Z A;  2MD5 A;  2P81 A;  2M4G A;  1R5H A;  1ETW A;  2VC1 A;  4N9I A;  5BMZ A;  4DYC A;  1SD4 A;  3IH4 A;  1D3Y A;  4A69 C;  2RRE A;  1LUJ B;  3DP7 A;  3CUO A;  5FFX A;  1UZC A;  2EJR A;  4C3I J;  5J8C A;  3DTI A;  1JE8 A;  4YEL A;  5J47 A;  4F91 B;  3PUF A;  1P7I A;  2QBY B;  1H9T A;  2GLO A;  3ZOB A;  1E17 A;  1Y8R B;  2MFZ A;  1MH3 A;  2LVS A;  3K9T A;  4OIR F;  4EJU A;  1WJ5 A;  3F23 A;  1TWG J;  4N9H A;  4XOR A;  2NVY J;  3DKY A;  1CF7 B;  1MMN A;  1JHH A;  3SFI A;  3E6D A;  4ZYA A;  2A5Y B;  3GLX A;  1WI3 A;  3RZO J;  1R58 A;  2P6T A;  2WAQ A;  4PGH A;  1HA8 A;  3VSK A;  2R5Y A;  3MAJ A;  2QSF X;  4A3I J;  4KMU X;  4M9S A;  2E2H J;  4IRH A;  3FK6 A;  2Y48 A;  2PMZ A;  1DPU A;  4RB0 A;  5EF6 A;  2K9S A;  4ZH4 F;  1ITY A;  3DKX A;  2R7O A;  3JRE A;  3F3X A;  4HRI A;  2GWR A;  4II3 A;  5FLV A;  2FJ1 A;  5ICF A;  1D8K A;  2JA7 J;  3CZ6 A;  5AIP A;  2JWT A;  4XLH A;  1JUP A;  2NOG A;  4QTR A;  4BY7 J;  3ZMV A;  4FT8 A;  1I5Z A;  2DMP A;  2VQH A;  4F3Q A;  2LKS A;  4XBF A;  2DOD A;  2BE5 F;  1IN5 A;  3MN2 A;  2KFD A;  3ERM A;  4YII A;  3S1R J;  5F27 A;  2W24 A;  5CLS A;  1ZKG A;  4I7H A;  2NS7 A;  2ISZ A;  3GCM A;  4WWC A;  2OD5 A;  1OCZ H;  2NVQ J;  2E2J J;  9ANT A;  3CF5 F;  3KYL A;  4U0V A;  2VL8 A;  4QSH A;  3SXY A;  1XCV A;  1AKH B;  4BAC A;  2L9N A;  3I59 A;  2ISY A;  1BOA A;  3U1K A;  1Y6I A;  3FX3 A;  1J2X A;  4KUM A;  1JXS A;  2KRC A;  2V9V A;  2XPU A;  5C3E J;  1KU3 A;  3WTY C;  2E7X A;  3CCQ I;  1T08 B;  1QA6 A;  2YU9 J;  1YOV B;  1RES A;  3QYB A;  3V8J A;  5LLQ A;  1Z91 A;  2LLK A;  1QZZ A;  1FC3 A;  5LFA A;  3LSP A;  1JGG A;  1GLN A;  2HDC A;  4ENJ A;  4QPO A;  3MKY B;  1U5T A;  4F55 A;  1X58 A;  4CH7 A;  2EFP A;  3BQY A;  3EUH C;  4W1U A;  1ZRC A;  4LMY A;  3SJM A;  2VJ4 A;  1EH8 A;  3Q3S A;  2L4A A;  5DM7 F;  3GZ6 A;  1LDJ A;  1LPQ A;  4XN3 A;  4HNT A;  1FMV A;  3C2H A;  5LD2 C;  4RMN A;  2RGV A;  2D2W A;  6PAX A;  3S16 J;  4N0B A;  5EZG A;  4JK1 X;  4R8H A;  1SVO A;  2FBK A;  2COB A;  3BJ6 A;  3MMY B;  4NQW B;  3CCE I;  2IXS A;  3LA2 A;  3IKV A;  2HKX A;  3WTT C;  3FKJ A;  1WPK A;  2VB6 A;  4UUT A;  3FXQ A;  2ZXI A;  1USS A;  4HW0 A;  3EDP A;  3W2V A;  2WAD A;  3HIF A;  3Q9V A;  3CO7 C;  4KN7 X;  3CJQ B;  2DA4 A;  4E7H A;  3ZQC A;  1HBX G;  5DS9 A;  3K10 A;  4OIN F;  3OY9 A;  3CME I;  4HOB A;  5ICG A;  2MA3 A;  3T0Y A;  4QPQ A;  3Q0W A;  5CQE A;  3HOS A;  3I9V 2;  5K7F A;  3S3O A;  3IRQ A;  2F5F A;  2X51 A;  3BG5 A;  1UHM A;  3SZG A;  2A5W A;  3BTJ A;  4JP0 A;  2CUJ A;  3HGY A;  3RCO A;  2A6E F;  1XGM A;  2BXZ A;  2EIM H;  4XOT A;  2DLL A;  3C7J A;  3HRT A;  2IS1 A;  2OPT A;  5TIS C;  4EVI A;  3S1N J;  4RAF A;  2PEX A;  2VKD A;  3BRO A;  2ZXW H;  2Q1Z B;  3V8L A;  2WAQ N;  2O5R A;  3RPU D;  1IXR C;  3JCU C;  4HF2 A;  4A3M J;  3BG3 A;  3DEW A;  3EYI A;  5IYC J;  4G6Q A;  5J1R A;  5F1R A;  2DPU A;  3E3V A;  4BJ6 C;  1FIP A;  2O8K A;  2CQN A;  1H9G A;  3WHC A;  3WTW C;  1XDU A;  2Z1D A;  3OYI A;  4AYB N;  2ADU A;  4RGU A;  2CJJ A;  1J75 A;  3GWZ A;  1F1Z A;  2K7L A;  4XON A;  1S7E A;  4I2O A;  1IN8 A;  2K02 A;  3L09 A;  4ZYD A;  5AIQ A;  3HEF A;  3TL4 X;  5F0H A;  4ENM A;  2HPM A;  5LGT A;  3GZN B;  2HDW A;  3PO3 J;  4EEF G;  3BR6 A;  4KJZ A;  1ZG3 A;  1ULY A;  3PQK A;  2HFH A;  1B6A A;  2LKP A;  3O8H A;  4PZJ A;  3ABK H;  2Y9Z A;  1JT6 A;  2HI3 A;  3JRG A;  1MJA A;  5D5V B;  4M3G A;  1ON1 A;  2Y9Y A;  2K3F A;  3BJA A;  3L2V A;  2X4H A;  1BR1 A;  3A02 A;  1TQM A;  2ZSI B;  1FEX A;  4HX8 A;  3QYE A;  2H8R A;  3LAJ A;  3FWE A;  5GPA A;  2EPF A;  4HV6 A;  1YW9 A;  3ZMT A;  2VXD A;  1YX5 A;  3R60 A;  5E8G A;  4C3H J;  3S15 J;  5FKK A;  1R36 A;  4NC7 A;  4IQ4 A;  2VC0 A;  3KP6 A;  1FOX A;  4L18 B;  2K3P A;  4HBL A;  3CC2 I;  3Q0U A;  1Z6R A;  4IO9 F;  4RBO A;  4A3L J;  4WXH A;  2ECC A;  2LMD A;  1RPW A;  1VZ0 A;  1F43 A;  5J40 A;  1MSF C;  2IAI A;  2HDD A;  1IN7 A;  2XC7 A;  1XGS A;  2HVS A;  4RGX A;  1VQ6 I;  2FNP A;  3W3C A;  2UZK A;  4BDZ A;  2EFQ A;  3VPR A;  1R4N B;  3ZQH A;  1X3U A;  4QIW N;  3JRF A;  1KON A;  5DCM A;  2VOP A;  2MC3 A;  2JSC A;  2R7R A;  2VXZ A;  3KZY A;  2M0M A;  2L7F P;  1UAA A;  2CUF A;  4A3B J;  1D8J A;  4EJV A;  5B3S H;  5FB2 A;  2PJR B;  1XTA A;  4PJN A;  4FIS A;  2GAU A;  5E3L A;  1BJZ A;  1HKT A;  2R0Q C;  4HNV A;  3GTG J;  3MZY A;  1Z05 A;  1MNM C;  4FET A;  4A3G J;  3FXJ A;  1TC3 C;  2L9S A;  1M1E B;  2IA1 A;  2HOE A;  2M9H A;  2FRH A;  4RGR A;  3SDB A;  2XAU A;  1GT0 C;  1J7K A;  4M72 A;  5B66 C;  3CCM I;  1U5T C;  4IQJ A;  4II2 A;  4YEJ A;  4LFU A;  1ZGW A;  3RYR A;  2W48 A;  2XPV A;  3HPG A;  2F4O B;  3E0J B;  4G6T B;  3IV5 A;  4GCV A;  3OOU A;  3ZXS A;  2L02 A;  3I56 I;  5GAE J;  3GYH X;  3GXO A;  5B5E C;  1A36 A;  4M9X A;  3ZMZ A;  2X1D A;  5FLX K;  1BA5 A;  3DXJ F;  1TNS A;  1Z67 A;  1BBY A;  4IKF A;  4X0G A;  5E18 F;  1TQI A;  3CDL A;  5C44 J;  3KZZ A;  5H20 A;  2WWY A;  2QYO A;  4XLF A;  2VJ5 A;  2QQ9 A;  4XLE A;  2QEX I;  1PYV A;  4K2E A;  2ZME C;  2ELJ A;  2OQG A;  2W7N A;  2QKM B;  3BG9 A;  2YPR A;  1OCC H;  1W4M A;  3OL4 A;  4N4O B;  4E7I A;  5J1U A;  2V1N A;  2PLY A;  1FP2 A;  3PL8 A;  2O9L A;  1OQY A;  2CUZ A;  2XVC A;  1ETV A;  1KU7 A;  3BTL A;  3FXO A;  5FO5 A;  3S93 A;  3K4B A;  4G7Z F;  5JLW A;  1UHW A;  1V5E A;  2FX0 A;  3ZQI A;  1VF9 A;  1JJ8 C;  1HKQ A;  4EM2 A;  3AFH A;  3F72 A;  5E1Z B;  1U5T B;  2A69 F;  2DCE A;  2W85 A;  2OQR A;  3A03 A;  3T1B A;  4HAM A;  4KYW A;  1L3L A;  5DYM A;  1WRJ A;  5DV5 A;  4BJT A;  2V1X A;  1VQ5 I;  3I3L A;  1FJL A;  3BP8 A;  1ETK A;  4C30 A;  4XRS A;  2V9K A;  3FDY A;  4EM0 B;  2L9V A;  3L7W A;  4AM3 A;  5HNF A;  4EGY A;  4FX4 A;  3C3W A;  1N77 A;  2XKP A;  1DGW Y;  2MYS A;  4BL0 B;  4L5E A;  4D7M A;  4ZJZ A;  3AG3 H;  2YU3 A;  5J3L A;  4RDU A;  3GBG A;  3L2W A;  1WI9 A;  3C2B A;  2ECB A;  2XAG A;  5LHG A;  1U6G A;  4BUP A;  2ZJP F;  5EEG A;  2Y2Z A;  1B9N A;  4M74 A;  2G0E A;  5ICE A;  1OJL A;  3S14 J;  1ZQ3 P;  3F8B A;  1VQN I;  1YX3 A;  4CDG A;  3MD2 A;  4UUS A;  1D0Z A;  1Q1V A;  3U21 A;  2ZB9 A;  4AC0 A;  4AVP A;  1YJ9 I;  3DBR B;  3BR2 A;  5FRM A;  4CSW A;  1K6O A;  1JTX A;  2AO9 A;  2LDU A;  3K0L A;  1BL0 A;  2XRL A;  3GO5 A;  2WV0 A;  4NHJ A;  1T39 A;  1W5C C;  4OMZ A;  4WF2 A;  5K5Q A;  1RRJ A;  4P1W A;  1ON2 A;  4D9J A;  1MBE A;  3M3Y J;  3HPH A;  1LEA A;  2B7E A;  1I50 J;  3CES A;  3SZP A;  5HNH A;  4CYC A;  5IT9 Z;  3RQI A;  4ASN A;  1MMD A;  3FMQ A;  2L7Z A;  3B6C A;  2ZJQ F;  2E5N A;  1P4A A;  2AXT C;  3PFI A;  2FD5 A;  3AKZ A;  3GLL A;  2VBY A;  4XSX F;  4LK0 F;  1K7A A;  1OPC A;  2E1M B;  2R4G A;  4RM3 A;  1GUU A;  3CDH A;  2M8E A;  3M8J A;  1X1P A;  2H6C A;  2VBZ A;  1K4S A;  2HXI A;  2MD0 A;  3PNV A;  4BQO A;  4MO7 A;  2GZW A;  4Y13 A;  2H6B A;  2EIJ H;  3K4C A;  2F48 A;  1Z7L A;  2EV0 A;  5DD4 A;  3OSF A;  1VQ4 I;  2JSP A;  2DI3 A;  1FNN A;  4H0E A;  1R1T A;  2DTR A;  1S6L A;  4OOI A;  2CW8 A;  2A05 A;  3I0T A;  5B1B H;  4EJO A;  1MMG A;  3F6V A;  2M0C A;  2OU2 A;  2DK8 A;  3N05 A;  2RV8 A;  4EM1 A;  1PUE E;  4BQQ A;  3LNQ A;  4XKC A;  2ZJ2 A;  1FLI A;  2LR8 A;  2W84 A;  2HZT A;  3NRV A;  2DA7 A;  1AKH A;  1W0T A;  1Z3X A;  1O3S A;  2BBY A;  2E1C A;  2RQQ A;  4JOM A;  1X4O A;  4O6J A;  2ESH A;  1KQ0 A;  1WSU A;  2R7F A;  3ZR8 X;  1HLV A;  4Q48 A;  2DDB A;  1XG1 A;  1OMI A;  1Z0X A;  4DQ2 A;  5IOY A;  5JHU A;  5CYV A;  1W1W E;  4RLQ A;  3OIP A;  3D1N I;  1XMA A;  2PMZ N;  3QP5 A;  4MIM A;  3HOV J;  1IDY A;  4CXF A;  3JSO A;  3DQV C;  3QOP A;  3OL3 A;  2P5K A;  2Z33 A;  3D5R C;  3L00 A;  2LTP A;  3J81 Z;  3ZPL A;  2CW7 A;  1A31 A;  2D5V A;  1OLT A;  3CTA A;  1MH4 A;  3PNT A;  4JQF A;  1U78 A;  2CWE A;  5FLX Z;  2GXG A;  2CGP A;  1WHU A;  3AG2 H;  5F08 A;  3RKY A;  4LLN A;  2JA8 J;  2M3A A;  3BY6 A;  1P4X A;  1X2M A;  5CVU A;  3ECH A;  1S72 I;  4YG2 F;  4B4C A;  1Y1W J;  2H8W A;  3FXM A;  4XM3 A;  2L4M A;  4CCJ A;  3S2W A;  2RNG A;  3PUB A;  4KN4 X;  2F5D A;  2R7Z J;  5L3E A;  3PQJ A;  3K4J A;  4M6Y A;  5D4S A;  4WCG A;  2JN6 A;  3OYB A;  1EH6 A;  5LHH A;  3VEP A;  1K78 B;  2M5W A;  2RVC A;  3KIO A;  2DT6 A;  1QHH D;  2M45 A;  3G3Z A;  2R93 J;  1UCR A;  2XAH A;  3HSR A;  1APL C;  3L2R A;  4DNC A;  5DEQ A;  1W7P B;  3HXL A;  4PSX A;  4XLC A;  4UVA A;  3OYN A;  4RB2 C;  3CCL I;  1WJF A;  4LIT A;  2OTL I;  2TDX A;  5F04 A;  2XGD A;  1ETY A;  3ABU A;  5K7H A;  5LBQ A;  2JA5 J;  1SD5 A;  4ZDL A;  3HB9 A;  4C3J J;  3IHU A;  4LLL A;  1XS9 A;  2Y75 A;  3RJP A;  2GA1 A;  5EDN A;  2H1L A;  3D5S C;  2OA4 A;  3RPQ A;  4CCL A;  3RKX A;  5GAG J;  4UV8 A;  3G1L A;  4XL9 A;  2DJI A;  1KYW A;  3EET A;  4FX0 A;  4A3E J;  1EV7 A;  5GTI C;  4BXX J;  4OU0 A;  2DFE A;  2Q8K A;  3DTK A;  5FKM A;  3TBI A;  1EH7 A;  4U7B A;  1HW2 A;  1WJC A;  2W82 A;  3KET A;  1TT0 A;  2EFW A;  4HZF A;  1N75 A;  3TKY A;  1HC8 A;  5D6E A;  3R4K A;  5JR3 A;  4BQA A;  1TTY A;  2IT0 A;  2ICW G;  1NTC A;  5E3M A;  1P2F A;  3A01 B;  4DZJ A;  5M5Y J;  1PUF A;  4UY8 I;  4A3J J;  2E60 A;  2E71 A;  2ZBK A;  4NC8 A;  4IEJ A;  1E0E A;  3GFL A;  2FMY A;  5D4R A;  3DTE A;  1XSX A;  2PX9 A;  1A04 A;  1JJ6 C;  2LY9 A;  2HS5 A;  2DJN A;  5K7Z A;  3L2C A;  3V42 A;  3J7Y J;  1FOK A;  3MEX A;  3HYI A;  1SFX A;  2WA0 A;  4DIQ A;  1IV6 A;  1ZTR A;  1HDP A;  2HYG D;  1YRN A;  3GTP J;  1HQC A;  3R6S A;  4TV7 A;  1IZ1 A;  1Y0U A;  1NK3 P;  2EA4 A;  1OCR H;  1T8I A;  2XGC A;  5TJJ A;  2JPB A;  4IL6 C;  2NVU B;  1XGN A;  4HX4 A;  2VJJ A;  4P96 A;  1TNT A;  1XSD A;  1IN6 A;  2QSH X;  3I4P A;  1ENH A;  1K6Y A;  4OIP F;  4ESF A;  1R5I D;  5JI6 A;  3BTC A;  2V6C A;  2PMH A;  2X1E A;  2AQE A;  1WWX A;  2PQ8 A;  4XLP F;  3NWS A;  4CA0 A;  2ZNZ A;  4FAS D;  2WAE A;  3M8F A;  5L3D A;  2KIQ A;  2VOD A;  1VQ7 I;  5E1X A;  1JKO C;  2C6Y A;  2XRO A;  2NNN A;  3RZD J;  1HKS A;  2CO5 A;  2JUC A;  3R0A A;  3CCJ I;  3OIO A;  1F5T A;  1ETX A;  3FXU A;  2EIL H;  4XRM A;  2DA2 A;  1FPQ A;  3CD6 I;  3TGN A;  1OFC X;  3MKL A;  5J4V A;  1KGS A;  1SD7 A;  4KIF A;  1RIO H;  1MBF A;  2TCT A;  2X6Y A;  4GYG A;  1XN7 A;  4GXO A;  4RAG A;  2A07 F;  5HLH A;  2DT7 B;  2IRF G;  1F4K A;  5J4Y A;  1R6R A;  3TO6 A;  3LSR A;  1UMQ A;  1E3P A;  2WAF A;  4IOA F;  3ONQ A;  3BCB A;  3CDI A;  1IXC A;  2A68 F;  4HG2 A;  3K70 D;  3G2B A;  5H2F C;  2HVR A;  2CV2 A;  3C18 A;  1P4W A;  3HRM A;  4BU2 A;  4U7D A;  1Z3Y A;  5D6F A;  1LFB A;  1FTZ A;  2KT0 A;  3KP2 A;  1LVA A;  1DP7 P;  3H0D A;  4Y3O A;  4MFE A;  1B8I A;  3WGI A;  3GTO J;  3OYM A;  2ZSH B;  3I4N J;  2AS5 F;  4CGZ A;  1ONV A;  3T5X A;  4OAY A;  2G7U A;  3FK7 A;  3LQR A;  3JRC A;  4BKX A;  1AOY A;  1P6R A;  1SFE A;  5BPD A;  2EB7 A;  2R7T A;  4AUX A;  2MLG A;  1LFU P;  5GP9 A;  3VOD A;  3WGG A;  4A6D A;  2GA2 A;  3FMS A;  2EQR A;  2IW5 A;  2QWW A;  1X2N A;  1OR7 C;  3O8G A;  2CSO A;  4FCY A;  1G3Y A;  2DMQ A;  1KYZ A;  2F5E A;  2FBH A;  2LBF A;  3OYL A;  2OF7 A;  3WTU C;  2D1H A;  1YTY A;  4P9F A;  1IXS B;  3ZMS A;  4RAZ A;  5GPC A;  5D5W B;  2K85 A;  1F36 A;  2ELK A;  3ABM H;  3B73 A;  2IA0 A;  4MHG A;  1O3R A;  1S5L C;  1JT0 A;  4R1H A;  3UNG C;  2HGC A;  2HQ5 A;  3OYK A;  3BR3 A;  1Y8Q B;  4XLN F;  2MW8 A;  4BJ5 C;  4IX7 A;  4BDY A;  3T8R A;  1PUF B;  4C2T A;  3HKZ A;  1IUY A;  4AIH A;  4V2F A;  2DAO A;  5LHI A;  2D45 A;  2YX4 A;  4G94 A;  2UV1 A;  3IUO A;  4L9T A;  2V7F A;  3R61 A;  3QPL A;  3O3K A;  1BW6 A;  1MBH A;  3DPT A;  2BGC A;  2JRT A;  4Y7N J;  3S8P A;  5IPA A;  1QZE A;  4AID A;  5KAF C;  3IKT A;  3MVP A;  2ELH A;  4G6D A;  1WJA A;  3OYE A;  3VYS B;  3OS2 A;  1WH5 A;  2O8X A;  4LG0 B;  3FF5 A;  2EIK H;  4C9Y A;  3SQN A;  3IH2 A;  3KCC A;  3W6V A;  1MKM A;  2XIG A;  3SYT A;  5KHD A;  3OSG A;  1TW3 A;  2FOK A;  1B9M A;  2P8T A;  2H09 A;  3IRR A;  1Z6T A;  3VSL A;  4IJA A;  2K9Q A;  3M1C A;  3JRA A;  3H9G A;  3HOY J;  1RR8 C;  2OCE A;  2DW4 A;  2DK5 A;  2LD5 A;  4QWQ A;  4AVZ A;  4LK1 F;  2R7D A;  2VOO A;  3ABL H;  2V26 A;  1ZGA A;  4C2U A;  4BHP A;  1XC5 A;  4R79 A;  1J9I A;  3HOZ J;  4LLG F;  4ZYE A;  4E4H A;  2G7H A;  4I0B A;  2OC6 A;  1D0X A;  1O3T A;  1MDM B;  2P6S A;  1S7A A;  1CGP A;  3ECO A;  1WFX A;  4Y15 A;  1G2H A;  2DOF A;  4PJL A;  3FXK A;  3ZMD A;  4AIJ A;  3OWT A;  1QHG A;  4A6E A;  2DDA A;  3DCF A;  1WCM J;  3BR1 A;  4HSR A;  1YS6 A;  3TOB A;  4A0X A;  4A3D J;  1DUX C;  1S3J A;  4J01 A;  4WXD A;  4Y52 J;  1IRX A;  1S29 A;  3K4K A;  4UHT A;  4EQQ A;  4KIT B;  3ZN1 A;  4F93 B;  3ZRG A;  3JAM K;  2E35 A;  1OR7 A;  2ZO4 A;  2QQ8 A;  1MSE C;  1FT9 A;  2LOO A;  4ON0 A;  1YIJ I;  1UEL B;  2O03 A;  3ZCO A;  5ICC A;  2M7B A;  1T0F C;  3I4M J;  2OTJ I;  1FSH A;  3AG4 H;  4PFP A;  4B48 A;  2EV5 A;  4PUS A;  1MIJ A;  1SFU A;  1LQ1 A;  1UB9 A;  1QGP A;  3KFW X;  4A0Y A;  4NUB A;  4S05 A;  3GX4 X;  2R7W A;  1WGX A;  1B72 B;  1N25 A;  2CQX A;  5FFZ A;  4BAY A;  5KK1 A;  2UXX A;  2HYF A;  2E7W A;  4I0A A;  3D5L A;  2HOA A;  1MBG A;  1S7O A;  3MZ8 A;  4HX7 A;  2WV1 A;  4Y33 A;  3E6B A;  4G7H F;  2A3S A;  2Z5U A;  1ZAO A;  3K1N A;  3OR1 C;  3N97 A;  2DQL A;  3MQ0 A;  3CJR B;  3HG9 A;  1MW7 A;  3K69 A;  2QBY A;  3S1M J;  4BHB A;  3LSM A;  3V7R A;  1K79 A;  1WJE A;  1QRY A;  3K2A A;  1S8N A;  3EUH A;  1RZ4 A;  2CG4 A;  2BHZ A;  3ZP5 A;  2JPC A;  1RET A;  2RNJ A;  1TWC J;  3J7A Y;  1TL8 A;  5GAH J;  1HSJ A;  2BZT A;  4UUV A;  1B72 A;  1TT5 B;  2KZV A;  4MFD A;  4A5N A;  4IF4 A;  5BOX A;  1BIB A;  5L3C A;  1B4A A;  2GXA A;  4EJW A;  3CUQ B;  4I98 B;  1U9N A;  3PIP F;  2WTE A;  1KA8 A;  4I99 C;  3FXL A;  3CLQ A;  3GFM A;  3W6K B;  3Q0V A;  2VON A;  3LSG A;  1MNE A;  2ME6 A;  1C0W A;  4C2M J;  1X19 A;  3T8T A;  3J7Z I;  2B63 J;  3BZC A;  1SVM A;  1XDS A;  2F4M B;  4J19 A;  3TP0 A;  4ESJ A;  3DFG A;  2DFH A;  3JRD A;  1TZL A;  3VYR B;  2HU9 A;  1O7F A;  4XID A;  2X6O A;  1RR7 A;  5KNL A;  5LEK A;  4DBQ A;  4MEY F;  5JLX A;  3E5X A;  2ETH A;  2XV4 S;  4MTE A;  1MMA A;  5L3B A;  2A61 A;  2VPR A;  2PJP A;  2X48 A;  2X6X A;  3P5J A;  5M5X J;  1MND A;  3BT9 A;  2KQR A;  3J80 K;  3KP7 A;  5A2Q K;  1GV2 A;  3OYA A;  4LD5 A;  3JSP A;  3MWM A;  2QEN A;  4S04 A;  3IAS 2;  2R5Z A;  1E2X A;  3VYU B;  3JRH A;  2RKH A;  1IJW C;  1P92 A;  1IV8 A;  2DN0 A;  2I8D A;  2R3S A;  2GXB A;  1IG7 A;  1UHS A;  3WTS C;  1QZY A;  4E7Z A;  3S1Q J;  2XSJ C;  2R92 J;  2A6T A;  1ZG5 A;  2BEO A;  4A0Z A;  4D5F A;  2RC4 A;  3CUQ A;  3H9J A;  4IRG A;  2LC2 A;  3WTZ A;  3H0G J;  3K4N A;  3BPX A;  4V19 K;  1J5Y A;  3OYF A;  3VOE A;  3AL0 B;  3KEQ A;  5CPR B;  2FQ4 A;  2VBX A;  3QPH A;  2STT A;  1SC7 A;  2Y31 A;  3RQ4 A;  1VQL I;  1MZB A;  5EGO A;  2J5O A;  1ZRE A;  4M71 A;  1IRZ A;  2HTS A;  5ERI A;  1NH3 A;  3KX2 A;  4MNU A;  5M5W J;  3KEY A;  1ZAR A;  1AHD P;  4XNF A;  4L5J A;  1SMY F;  1H8A C;  1R00 A;  3A4C A;  3C1D A;  5EG0 A;  5CVI A;  1XCB A;  3E1S A;  1FBU A;  2MSY A;  4XMY A;  3H1C A;  3QOD A;  1W5S A;  3FM3 A;  2ZME A;  1D1C A;  3IP4 B;  4E6K G;  5C4X J;  2LKX A;  1CF7 A;  1TWF J;  1STZ A;  2XAS A;  1BI2 A;  2AXL A;  3TMO A;  1PP7 U;  1G4D A;  4FE4 A;  4MTD A;  2LP0 A;  4PK4 A;  2KDO A;  5DD8 A;  2NVX J;  1IO2 A;  3GME A;  2PG4 A;  5BQT A;  3RYP A;  3BR5 A;  2LH9 A;  4PGG A;  5IYB J;  3MKZ A;  3AL0 C;  1UG0 A;  1UST A;  4X1E A;  2L01 A;  4ETS A;  3CP2 A;  3FBN B;  3ZN0 A;  4CCN A;  4Z6Y A;  3S3N A;  4FQG A;  3GTK J;  3CC7 I;  3G1M A;  5EYR A;  3HJE A;  2EH3 A;  1FBS A;  3IWF A;  5JFR A;  2DYS H;  2ZXH A;  3TQN A;  2E5Z A;  3S2H J;  3M7G A;  3DWL E;  1JKP C;  2M7A A;  2EBI A;  4XN0 A;  4B09 A;  5H6Q A;  1DP3 A;  3GW2 A;  1FIA A;  2NS8 A;  1O3Q A;  4F52 A;  1JKQ C;  1I3Q J;  1U2W A;  3TDU C;  4LGW A;  2NXN B;  3P9C A;  2Z16 A;  4B43 A;  3ML6 A;  2R5Y B;  2YR2 A;  4PSW A;  2KJC A;  4P5O A;  1SVL A;  5M3M J;  3COA C;  1BC8 C;  4KMF A;  4EGZ A;  2CYY A;  1QU3 A;  4F92 B;  4HV5 A;  3C2G A;  3H35 A;  2RN7 A;  1R22 A;  1V55 H;  1U0J A;  4EMS A;  1XB4 A;  1LE8 B;  3ZQG A;  1BI1 A;  3DF8 A;  4B3X A;  4OIQ F;  2XF6 A;  5JVT A;  4IHV A;  4W97 A;  5CVV A;  2Q0O A;  2KL4 A;  1R9T J;  4A5M A;  2RAE A;  1SAX A;  5JVG F;  1YO5 C;  2OZU A;  4XKW A;  1Y1V J;  1H0M A;  3K1P A;  1XSV A;  2PJR A;  1ZK8 A;  4AU7 A;  1MDM A;  1UJ8 A;  5DCF A;  2GQQ A;  1TWA J;  1OIS A;  2K86 A;  2BW3 B;  4IVN A;  4OMY A;  1DDN A;  1ZLK A;  1P9Q C;  1R23 A;  5IOZ A;  1Y39 A;  4DYQ A;  3KP5 A;  1BOB A;  2L3D A;  2M34 A;  3KP3 A;  2QUF A;  3E5Q A;  3TW7 A;  2O61 A;  1IW7 F;  3LA7 A;  4MQV A;  4UV9 A;  1H88 C;  3S32 A;  2HNH A;  4XKB A;  2Y0M A;  1V4R A;  4XSZ F;  1EKE A;  2DFF A;  2GIZ A;  2M87 A;  2UUZ A;  5LGU A;  3HDD A;  1I3A A;  2HZD A;  4ZDO A;  4BE0 A;  3BPV A;  3IWZ A;  2P5V A;  4BEH B;  3M8E A;  1IF1 A;  3FIS A;  4L9J A;  3CCR I;  4ZYG A;  3HTS B;  1G6N A;  1A6I A;  4CCK A;  1NK2 P;  1GHC A;  2CH0 A;  4QLC U;  3OYH A;  1A6Q A;  2LYC A;  4JX5 A;  1ZHF A;  3RDI A;  5HLG A;  3DU6 A;  2IGN A;  1HDD C;  4B44 A;  5EZH A;  3ZQQ A;  3PNY A;  5CJ9 A;  2OCC H;  2P7V B;  4AYB A;  2DQR A;  2XF5 A;  1J59 A;  3OYG A;  1VTN C;  2K4B A;  4G7O F;  1Z77 A;  2LFB A;  2IS6 A;  3AG1 H;  1WZ2 A;  3ASO H;  1X1C A;  3TOA A;  2XKO A;  2CV1 A;  3DBL B;  3GZ5 A;  1FOY A;  1AWC A;  2JT1 A;  3QQA A;  1Q1H A;  2WC2 A;  3IC7 A;  3TO7 A;  5EG0 B;  1QO0 D;  2X1C A;  2LRE A;  1GDT A;  4IHY A;  2HXO A;  3HRU A;  2VE8 A;  4UB6 C;  4HQM A;  1FBQ A;  2RQP A;  3B6A A;  3Q5F A;  2EIN H;  2LY2 A;  5CVR A;  2OV7 A;  2QCO A;  3ASN H;  4BBR J;  3JRI A;  2KRH A;  1MBJ A;  4RLF A;  3HM5 A;  2R7Q A;  1OCO H;  2KHM A;  1YW7 A;  2HEO A;  1TWH J;  1OCP A;  2K27 A;  1QNT A;  3A0B C;  4L5I A;  3REO A;  2W1O A;  3BG7 A;  5ILV A;  1U3E M;  4KT5 C;  1DU6 A;  2NNY A;  3D0S A;  3DPL C;  1R49 A;  1QQI A;  5HDK A;  4KA4 A;  3BQZ A;  4WXC A;  4A93 J;  4J00 A;  2IA2 A;  4CYD A;  3HGG A;  4ZYH A;  1WKM A;  2ZKZ A;  1O57 A;  3KYC B;  4FTH A;  2EWN A;  2HQA A;  2DMT A;  3H3Z A;  5E79 C;  4L9N A;  2V1U A;  3F8N A;  2E1M C;  1W0U A;  3NQO A;  2D1V A;  3OMY A;  3HUG A;  1FP1 D;  2GIV A;  2WY7 Q;  1YE9 A;  2K9N A;  3F21 A;  1REP C;  4IHX A;  1PJR A;  3LQQ A;  3U9G A;  3ABT A;  2FEZ A;  1GVD A;  1D5V A;  1ZRF A;  2P4W A;  3OOP A;  2NS0 A;  1SD6 A;  2Z99 A;  4E7S A;  2FML A;  3H5N A;  3WU0 A;  1F9N A;  1EJ9 A;  2LY1 A;  1DPR A;  4HF0 A;  4BH9 A;  3HOU J;  3JTH A;  3HOT A;  2IVM A;  3BJO A;  2JTV A;  3CJN A;  5F64 A;  3E6M A;  4RA2 A;  2KMU A;  2V9P A;  2UWM A;  1GXQ A;  4Y17 A;  5AON A;  3H3U A;  1VQM I;  1ORK A;  1OYI A;  2QGU A;  3OR2 C;  1YJW I;  1A5J A;  2HOS A;  4I6Z A;  5K5O A;  2X9D A;  2WY8 Q;  3EPZ A;  4I09 A;  2BY2 A;  2VQC A;  2G9W A;  4HDU A;  1VI0 A;  3M9A A;  2R5Z B;  2BXY A;  5BS6 A;  2O7O A;  2IS4 A;  5B1A H;  1I6X A;  3CP8 A;  3I55 I;  4LIV A;  2XUB A;  4HDV A;  5E20 A;  5IP6 A;  2DBB A;  1FYM A;  5M3F J;  2MBF A;  2DOA A;  5K5R A;  3HHG A;  5D5U B;  3CMY A;  2CQK A;  2DT5 A;  2VKV A;  2F5C A;  5IYD J;  2NAZ A;  3A0H C;  4CZC A;  3TED A;  2V1D A;  2OBP A;  1FOW A;  4B3A A;  1ZR4 A;  4OAZ A;  1JGS A;  2KIU A;  4I01 A;  3GTQ J;  2ZCW A;  1ZR2 A;  2W4S A;  2JJ7 A;  1BR4 A;  4ABZ A;  2EK5 A;  2XHK A;  4HA8 A;  1TP4 A;  1RKW A;  4M6X A;  2H94 A;  4AD9 A;  5EGO B;  1YIT I;  2QQB A;  3HBL A;  4WX9 A;  1T38 A;  3G1O A;  2YS9 A;  2VI6 A;  1T33 A;  1SAN A;  1DGR M;  1XD7 A;  5FRO A;  1NG7 A;  4PCQ A;  2VE9 A;  3GUD A;  2N8G A;  3H5R A;  3FHZ A;  2Z9O A;  2FXA A;  3TP3 A;  2ZFW A;  4E7K A;  4IHT A;  1BIA A;  3BTI A;  1FZP B;  1PDN C;  2HKO A;  3CF2 A;  2W25 A;  4I02 A;  3TO9 A;  1YI2 I;  1VQO I;  3UKG A;  2XSD C;  5ED4 A;  3WE2 A;  2XPW A;  2B0L A;  3QWL A;  2Y69 H;  4ZZD A;  1FY7 A;  1IDZ A;  1XGO A;  1FX7 A;  1XPX A;  4G9Y A;  2V79 A;  4Q4Z F;  2EZK A;  2PMU A;  3LFK A;  2DTZ A;  5F0C A;  3PFY A;  4ANJ A;  1IRG A;  2FA5 A;  1K83 J;  2Y30 A;  1ZRD A;  2LRD A;  3LOC A;  5HOD A;  1POG A;  2Z2S B;  1T98 A;  3JR9 A;  1HW5 A;  1IGN A;  4UXN A;  3E6C C;  2M30 A;  1G3T A;  4MQ9 F;  1NG6 A;  3PJR A;  2K4J A;  2K9M A;  4B1R A;  3G71 I;  3IL2 A;  3I5U A;  4RM2 A;  1O4X A;  1U8B A;  1Z1D A;  1K61 A;  3LAP A;  1YIO A;  1EF4 A;  4EV0 A;  4DJA A;  5F1J A;  1K78 A;  1LDD A;  3K2Z A;  5E3O A;  4Z2Y A;  4A3K J;  1SEU A;  3OYC A;  1X1A A;  3ZQF A;  1TW2 A;  1IN4 A;  2CW0 F;  2V6E A;  4DGW B;  2LF8 A;  3QPS A;  5E17 F;  5E3N A;  3LMM A;  3L9F A;  1W7P A;  4IPA A;  2QF7 A;  2CQ7 A;  1T0F A;  3K4L A;  3HRS A;  1QPM A;  4MGR A;  1CQT A;  1Z7U A;  1LB2 A;  2ZJR F;  2EFO A;  3F6O A;  1OYY A;  2XDV A;  1S9H A;  3PSF A;  4A3F J;  3IH3 A;  3GTJ J;  3J80 Z;  3NEU A;  2NVT J;  2F4I A;  4F7Z A;  3LA3 A;  1R1U A;  3JTG A;  1KU2 A;  1OYW A;  4BY1 J;  2Y0S N;  4G8X A;  4DZP A;  3KYD B;  1BN5 A;  2HR3 A;  3P9I A;  2DA3 A;  4BS9 A;  5HS9 A;  3TW6 A;  1G59 A;  1D1B A;  2EZI A;  1Z21 A;  3JRB A;  2ZNY A;  5DCM B;  2YUS A;  3VWB A;  5HDG A;  5HDN A;  1ZLJ A;  5IT9 K;  5CKT A;  3F8C A;  1L0O C;  4BHC A;  2M4K A;  2OUM A;  4RGS A;  4O3M A;  2ACJ A;  2EZH A;  3HOW J;  4D0P A;  1U9O A;  1ZEL A;  1MMS A;  5DUI A;  3O6B B;  2HWV A;  4DYR A;  4IRI A;  1D0Y A;  3SDG A;  1HF0 A;  1I6H J;  3WHB A;  2X0L A;  1VQK I;  3UR3 C;  2QM3 A;  2STW A;  1V3F A;  3DKW A;  3A2K A;  1V54 H;  4AIK A;  1FWZ A;  2XGE A;  3F9K A;  4ENK A;  4LG0 A;  2VBW A;  3KPH A;  4OWR B;  1X4P A;  3M07 A;  2O3F A;  3I58 A;  4M73 A;  3NWT A;  4RB1 A;  4PJ0 C;  1WQ2 A;  2O6G E;  2RDP A;  2GBY A;  2AQF A;  1JHF A;  4RAY A;  4ZTJ A;  2MAB A;  4LIU A;  3LSI A;  5J6X A;  2K9L A;  1FTT A;  1R71 A;  2JVG A;  1SFK A;  4EJT A;  4IHS A;  5GTH C;  1X3W B;  4CO8 A;  1YG2 A;  1KQ9 A;  2CFX A;  3PIO F; 
#chains in the Genus database with same CATH homology
 4ZZL A;  4HF1 A;  3GEZ A;  1KQ8 A;  3W6J B;  2DO7 A;  3KLN A;  4HYE A;  1ZN2 A;  4BXU A;  1FSE A;  2VT2 A;  3DV8 A;  4MEX F;  2KRF A;  2F2E A;  3U2R A;  3QPT A;  1B59 A;  2YSR A;  4YIF A;  5TRD A;  3QU6 A;  2ZXJ A;  2MH2 A;  4LB6 B;  1MJB A;  2HQN A;  5A2Q Z;  4CHU A;  5HOO A;  4KIB A;  2DPD A;  2BV6 A;  2ZME B;  1BM9 A;  3ISP A;  4P9U A;  1I1G A;  2IPQ X;  3QAH A;  1I27 A;  1O7L A;  1FYL A;  4A12 A;  2MLK A;  3ULQ B;  2FNA A;  2VN2 A;  3EYY A;  3GFI A;  1ZG1 A;  2KIM A;  5LEJ A;  2IP2 A;  1RUO A;  3OV8 A;  2UXN A;  2E1N A;  1ODD A;  1J0R A;  3I53 A;  1YYV A;  3RIR A;  1HST A;  5HVQ C;  1RUN A;  1G3W A;  1SMT A;  3Q9S A;  4NQW A;  3JW4 A;  5K1Y A;  3J81 K;  2KJB A;  2Z3Y A;  4LJZ F;  1R1V A;  1YLF A;  4CIC A;  4Q47 A;  1G3S A;  1W7P D;  1BI0 A;  3V8K A;  3MFK A;  1XMK A;  3AAF A;  2W57 A;  2LSO A;  4HLX A;  4JBA A;  4KFC A;  1YQA A;  3MZH A;  2BYV E;  3ZMU A;  4XRF A;  4LB5 A;  1MGT A;  3FXR A;  4A2U A;  2J5P A;  4IXA A;  2PI0 A;  2IJL A;  1ZGJ A;  5F6F A;  1IAW A;  3I64 A;  2QVO A;  1R5G A;  2DU9 A;  4O5V A;  4RB3 C;  3ERE D;  2OAZ A;  3QRF F;  4CZZ A;  1HXD A;  2P5L C;  1GXP A;  3WU1 B;  2QLZ A;  1UFM A;  2FBI A;  2O0Y A;  3WGH A;  3BOQ A;  2A6H F;  1KU9 A;  4YFX F;  3ZQ7 A;  1RI7 A;  3KE2 A;  4KIG A;  1T2K A;  5HS7 A;  5ILU A;  4U0Y A;  3KEO A;  2EFN A;  2QQA A;  2OZ6 A;  5L3G A;  4YFK F;  3F8F A;  5L3F A;  5E1W A;  1LNW A;  2FE3 A;  5LGN A;  2Q2E A;  3G73 A;  1RNL A;  4UVC A;  3RKW A;  1BJA A;  5J8F A;  4UVB A;  5DDG A;  5KVR A;  3GVA A;  2PN6 A;  5LRS A;  4U88 A;  5IT3 A;  1PP8 F;  2PBI A;  5FD5 A;  1YW8 A;  3B02 A;  2JZY A;  1YS7 A;  3JAM Z;  1W5T A;  3WE3 A;  3I54 A;  4ENN A;  3RI4 A;  2LNB A;  2H27 A;  3DEU A;  3HTU A;  4ESB A;  1ZH5 A;  4P55 A;  4BYY A;  4UNO A;  1NHA A;  2XAF A;  4E70 A;  2XRN A;  2EA2 A;  3I71 A;  3LST A;  4GO1 A;  4YFN F;  4KDP A;  2FU4 A;  4OIO F;  5E8I A;  4NB5 A;  1IRF A;  1YFH A;  3WTX C;  5D5X B;  2VT3 A;  3KLO A;  2QZ8 A;  2ESN A;  3H92 A;  3HHH A;  3FZV A;  2MH9 A;  3I59 B;  2P7C B;  3CLO A;  2KKO A;  1T6S A;  1B1B A;  2XAJ A;  3MCZ A;  3E5U A;  3ELK A;  5FGM A;  4KNY A;  2M1B A;  3WG9 A;  1Z9C A;  2DFI A;  3LWF A;  2XAQ A;  3GFJ A;  3WTV C;  3RPU A;  2YX7 A;  2HQR A;  3QP6 A;  3V7C A;  4BNC A;  3QU3 A;  3SZT A;  1I1S A;  5HLI A;  4L0Z B;  1TQP A;  2FF4 A;  4U0W A;  1LJ9 A;  1MD0 A;  3BDD A;  5D8L B;  1BC7 C;  1LDK B;  2XGX A;  3M1E A;  1FYK A;  3TDZ C;  4RS8 A;  3P7N A;  4B8X A;  1TLH B;  3SHF A;  3O2P E;  3F22 A;  3CUQ C;  1QBJ A;  1MJ9 A;  3CO6 C;  3BWG A;  2FSW A;  5CVJ A;  4L0Y B;  1HW1 A;  3E97 A;  3J7A O;  5FD6 A;  3HSE A;  5LRR A;  3VB2 A;  3WOD F;  3BZ6 A;  2HTJ A;  3U1D A;  4GGG A;  3R0J A;  3K1M A;  5D8K B;  3ROU A;  5ILS A;  3SFZ A;  3EQL F;  3V4G A;  3GF2 A;  1R7J A;  3P9K A;  5DUK A;  5HS8 A;  1LEB A;  2L54 A;  3HSF A;  3N4M A;  2NRA C;  4FHT A;  3V7S A;  4Q5S F;  1U8R A;  4L9V A;  3F8M A;  4AWX B;  1OKR A;  2KIF A;  3FM5 A;  4KIC A;  3VFZ A;  4WK8 F;  5BPI A;  4HQE A;  2EV6 A;  4HLY A;  3FMR A;  5H6R A;  5EEH A;  3KP4 A;  2PFB A;  4PDK A;  3RTR A;  2COM A;  4GYI A;  1TBX A;  1BI3 A;  2FQ3 A;  2LF7 A;  1ZYR F;  2NYX A;  1GVJ A;  4M9Z A;  2MD5 A;  1R5H A;  2VC1 A;  4N9I A;  5BMZ A;  1SD4 A;  1D3Y A;  3DP7 A;  3CUO A;  5FFX A;  2EJR A;  5J8C A;  1JE8 A;  2QBY B;  1H9T A;  1E17 A;  3K9T A;  4EJU A;  3F23 A;  4OIR F;  4N9H A;  1CF7 B;  1JHH A;  3E6D A;  2A5Y B;  3GLX A;  1R58 A;  2P6T A;  4PGH A;  3MAJ A;  4KMU X;  4M9S A;  4IRH A;  2Y48 A;  1DPU A;  4RB0 A;  4ZH4 F;  3F3X A;  2GWR A;  5ICF A;  1D8K A;  5AIP A;  3ZMV A;  4FT8 A;  1I5Z A;  4XBF A;  2BE5 F;  1IN5 A;  4YII A;  2W24 A;  5CLS A;  4I7H A;  2ISZ A;  4WWC A;  2OD5 A;  4U0V A;  3SXY A;  1XCV A;  3I59 A;  2ISY A;  1BOA A;  3FX3 A;  1J2X A;  4KUM A;  1JXS A;  2V9V A;  1KU3 A;  3WTY C;  2E7X A;  3V8J A;  5LLQ A;  1Z91 A;  1QZZ A;  1FC3 A;  2HDC A;  4ENJ A;  1U5T A;  2EFP A;  1ZRC A;  4LMY A;  1EH8 A;  2L4A A;  3GZ6 A;  1LDJ A;  6PAX A;  2RGV A;  2D2W A;  4N0B A;  4JK1 X;  4R8H A;  2FBK A;  3BJ6 A;  3LA2 A;  3IKV A;  2HKX A;  3WTT C;  3FXQ A;  1USS A;  4HW0 A;  3EDP A;  3HIF A;  3Q9V A;  3CO7 C;  4KN7 X;  1HBX G;  4OIN F;  4HOB A;  5ICG A;  2MA3 A;  3T0Y A;  3HOS A;  3IRQ A;  2F5F A;  1UHM A;  2A6E F;  1XGM A;  2DLL A;  3C7J A;  3HRT A;  4EVI A;  2PEX A;  3BRO A;  3V8L A;  1IXR C;  4HF2 A;  3EYI A;  4G6Q A;  5F1R A;  2DPU A;  3E3V A;  1H9G A;  3WTW C;  1XDU A;  2ADU A;  4RGU A;  1J75 A;  3GWZ A;  1F1Z A;  2K7L A;  4I2O A;  1IN8 A;  2K02 A;  3L09 A;  4ZYD A;  5AIQ A;  4ENM A;  5LGT A;  1ZG3 A;  1ULY A;  3PQK A;  2HFH A;  1B6A A;  2LKP A;  4PZJ A;  1MJA A;  5D5V B;  1ON1 A;  3BJA A;  2X4H A;  1TQM A;  4HX8 A;  3LAJ A;  3FWE A;  4HV6 A;  1YW9 A;  3ZMT A;  3R60 A;  5E8G A;  1R36 A;  2VC0 A;  3KP6 A;  4L18 B;  4HBL A;  1Z6R A;  4WXH A;  1IN7 A;  1XGS A;  4RGX A;  2FNP A;  2UZK A;  2EFQ A;  1X3U A;  5DCM A;  2VOP A;  2MC3 A;  2JSC A;  2VXZ A;  3KZY A;  1D8J A;  4EJV A;  5FB2 A;  2GAU A;  1HKT A;  3MZY A;  1Z05 A;  2IA1 A;  2HOE A;  2FRH A;  4RGR A;  1J7K A;  4M72 A;  1U5T C;  4LFU A;  3RYR A;  4GCV A;  2L02 A;  3GYH X;  3GXO A;  4M9X A;  3ZMZ A;  5FLX K;  3DXJ F;  1TNS A;  1BBY A;  5E18 F;  1TQI A;  2WWY A;  3KZZ A;  5H20 A;  2QYO A;  2QQ9 A;  4K2E A;  2OQG A;  2YPR A;  1W4M A;  2PLY A;  1FP2 A;  2XVC A;  1KU7 A;  5FO5 A;  4G7Z F;  1UHW A;  1HKQ A;  4EM2 A;  5E1Z B;  3F72 A;  1U5T B;  2A69 F;  2W85 A;  2OQR A;  4KYW A;  3T1B A;  4HAM A;  1L3L A;  5DYM A;  1WRJ A;  5DV5 A;  2V1X A;  3BP8 A;  4EM0 B;  3L7W A;  4EGY A;  4FX4 A;  3C3W A;  2XKP A;  2YU3 A;  1WI9 A;  2XAG A;  5LHG A;  1U6G A;  5EEG A;  1B9N A;  4M74 A;  5ICE A;  3F8B A;  4CDG A;  4AVP A;  1K6O A;  2LDU A;  3K0L A;  3GO5 A;  2WV0 A;  4NHJ A;  1T39 A;  4OMZ A;  4WF2 A;  5K5Q A;  1ON2 A;  1LEA A;  3SZP A;  5IT9 Z;  4ASN A;  3FMQ A;  1P4A A;  3PFI A;  2VBY A;  4XSX F;  4LK0 F;  1K7A A;  1OPC A;  3CDH A;  2M8E A;  2H6C A;  2VBZ A;  2GZW A;  4Y13 A;  2H6B A;  2EV0 A;  5DD4 A;  4H0E A;  2DI3 A;  1FNN A;  1R1T A;  2DTR A;  1S6L A;  4OOI A;  3I0T A;  4EJO A;  3F6V A;  2OU2 A;  2DK8 A;  2RV8 A;  4EM1 A;  1PUE E;  2ZJ2 A;  1FLI A;  2W84 A;  2HZT A;  3NRV A;  1O3S A;  2BBY A;  2E1C A;  4O6J A;  2ESH A;  1KQ0 A;  1WSU A;  2R7F A;  4Q48 A;  1OMI A;  4DQ2 A;  5JHU A;  5CYV A;  1XMA A;  3QP5 A;  4CXF A;  3JSO A;  3DQV C;  3QOP A;  2P5K A;  2Z33 A;  3L00 A;  3J81 Z;  3ZPL A;  3CTA A;  4JQF A;  1U78 A;  2CWE A;  5FLX Z;  2GXG A;  2CGP A;  3RKY A;  4LLN A;  3BY6 A;  1P4X A;  5CVU A;  3ECH A;  4YG2 F;  2L4M A;  3S2W A;  4KN4 X;  2F5D A;  5L3E A;  3PQJ A;  5D4S A;  4M6Y A;  4WCG A;  1EH6 A;  5LHH A;  3VEP A;  1K78 B;  2M5W A;  2RVC A;  2M45 A;  3G3Z A;  1UCR A;  2XAH A;  3HSR A;  4DNC A;  5DEQ A;  1W7P B;  4UVA A;  4RB2 C;  2TDX A;  3ABU A;  5LBQ A;  1SD5 A;  3IHU A;  4LLL A;  2Y75 A;  3RJP A;  2GA1 A;  2OA4 A;  3RPQ A;  3RKX A;  4UV8 A;  1KYW A;  3EET A;  4FX0 A;  1EV7 A;  4OU0 A;  2Q8K A;  1EH7 A;  4U7B A;  1HW2 A;  3KET A;  2EFW A;  4HZF A;  3TKY A;  5JR3 A;  3R4K A;  5D6E A;  4BQA A;  1TTY A;  2IT0 A;  1P2F A;  2ZBK A;  3GFL A;  2FMY A;  5D4R A;  1XSX A;  1A04 A;  2HS5 A;  3L2C A;  1FOK A;  3MEX A;  3HYI A;  1SFX A;  2HYG D;  1HQC A;  3R6S A;  4TV7 A;  1IZ1 A;  1Y0U A;  2EA4 A;  5TJJ A;  2JPB A;  1XGN A;  4HX4 A;  4P96 A;  1TNT A;  1XSD A;  1IN6 A;  3I4P A;  4OIP F;  4ESF A;  5JI6 A;  2V6C A;  2PMH A;  1WWX A;  2PQ8 A;  4XLP F;  2ZNZ A;  3M8F A;  5L3D A;  2VOD A;  5E1X A;  2C6Y A;  2XRO A;  2NNN A;  1HKS A;  2CO5 A;  3R0A A;  1F5T A;  3FXU A;  1FPQ A;  3TGN A;  1KGS A;  1SD7 A;  4KIF A;  1RIO H;  4GYG A;  1XN7 A;  4GXO A;  2A07 F;  2IRF G;  5HLH A;  1F4K A;  3TO6 A;  1IXC A;  2A68 F;  3C18 A;  1P4W A;  3HRM A;  4U7D A;  5D6F A;  3KP2 A;  1LVA A;  1DP7 P;  3WGI A;  2AS5 F;  4CGZ A;  1ONV A;  3T5X A;  2G7U A;  3LQR A;  1AOY A;  1P6R A;  1SFE A;  5BPD A;  2EB7 A;  2MLG A;  3VOD A;  3WGG A;  4A6D A;  2GA2 A;  3FMS A;  2IW5 A;  2QWW A;  2CSO A;  1G3Y A;  1KYZ A;  2F5E A;  2FBH A;  3WTU C;  2D1H A;  1YTY A;  4P9F A;  1IXS B;  3ZMS A;  4RAZ A;  5D5W B;  3B73 A;  2IA0 A;  4MHG A;  1O3R A;  4R1H A;  2HGC A;  4XLN F;  3T8R A;  1IUY A;  4AIH A;  2DAO A;  5LHI A;  2D45 A;  2YX4 A;  4G94 A;  4L9T A;  3R61 A;  3O3K A;  3DPT A;  2BGC A;  2JRT A;  3IKT A;  2ELH A;  4G6D A;  2O8X A;  4LG0 B;  3FF5 A;  3SQN A;  3KCC A;  1MKM A;  2XIG A;  1TW3 A;  2FOK A;  1B9M A;  2P8T A;  2H09 A;  3IRR A;  1Z6T A;  4IJA A;  2DW4 A;  2DK5 A;  4QWQ A;  4LK1 F;  2R7D A;  2VOO A;  1ZGA A;  4BHP A;  4R79 A;  1J9I A;  4LLG F;  4ZYE A;  2G7H A;  4I0B A;  1O3T A;  1MDM B;  2P6S A;  1S7A A;  1CGP A;  3ECO A;  4Y15 A;  3ZMD A;  4AIJ A;  4A6E A;  1YS6 A;  3TOB A;  4A0X A;  1DUX C;  1S3J A;  4WXD A;  1S29 A;  4UHT A;  4EQQ A;  3ZN1 A;  3JAM K;  1OR7 A;  2ZO4 A;  1FT9 A;  4ON0 A;  2O03 A;  5ICC A;  1FSH A;  2EV5 A;  1SFU A;  1LQ1 A;  1UB9 A;  1QGP A;  3KFW X;  4A0Y A;  4S05 A;  3GX4 X;  5FFZ A;  4BAY A;  5KK1 A;  2UXX A;  2HYF A;  2E7W A;  4I0A A;  3D5L A;  1S7O A;  4HX7 A;  3E6B A;  4G7H F;  2A3S A;  2Z5U A;  1ZAO A;  3K1N A;  3N97 A;  2DQL A;  3MQ0 A;  3K69 A;  2QBY A;  4BHB A;  3V7R A;  1K79 A;  1S8N A;  3EUH A;  1RZ4 A;  2CG4 A;  3ZP5 A;  2JPC A;  2RNJ A;  1HSJ A;  4UUV A;  4A5N A;  4IF4 A;  5BOX A;  1BIB A;  5L3C A;  1B4A A;  4EJW A;  3CUQ B;  4I98 B;  2WTE A;  1KA8 A;  3GFM A;  3W6K B;  2VON A;  1C0W A;  3T8T A;  1XDS A;  4ESJ A;  3DFG A;  1O7F A;  5LEK A;  4MEY F;  3E5X A;  2ETH A;  2XV4 S;  4MTE A;  5L3B A;  2A61 A;  2PJP A;  3J80 K;  3KP7 A;  5A2Q K;  4LD5 A;  3JSP A;  3MWM A;  2QEN A;  4S04 A;  1E2X A;  2RKH A;  1P92 A;  2R3S A;  2GXB A;  3WTS C;  1QZY A;  1ZG5 A;  2BEO A;  4A0Z A;  2RC4 A;  3CUQ A;  4IRG A;  3WTZ A;  3BPX A;  1J5Y A;  3VOE A;  3KEQ A;  2VBX A;  3QPH A;  2STT A;  1MZB A;  2J5O A;  1ZRE A;  4M71 A;  2HTS A;  5ERI A;  4MNU A;  1ZAR A;  4L5J A;  1SMY F;  1R00 A;  3C1D A;  5CVI A;  1XCB A;  1FBU A;  1W5S A;  3FM3 A;  2ZME A;  1CF7 A;  1STZ A;  2XAS A;  1BI2 A;  2AXL A;  1PP7 U;  1G4D A;  4MTD A;  5DD8 A;  2PG4 A;  5BQT A;  3RYP A;  4PGG A;  1UST A;  2L01 A;  4ETS A;  3ZN0 A;  1FBS A;  3IWF A;  5JFR A;  3TQN A;  3M7G A;  4B09 A;  5H6Q A;  3GW2 A;  1O3Q A;  1U2W A;  3TDU C;  4LGW A;  3P9C A;  3ML6 A;  2YR2 A;  2KJC A;  4P5O A;  3COA C;  1BC8 C;  4KMF A;  4EGZ A;  2CYY A;  4HV5 A;  2RN7 A;  1R22 A;  4EMS A;  1XB4 A;  1BI1 A;  3DF8 A;  4OIQ F;  5JVT A;  5CVV A;  2Q0O A;  4A5M A;  1SAX A;  1YO5 C;  2OZU A;  1H0M A;  3K1P A;  1XSV A;  1MDM A;  5DCF A;  2GQQ A;  2K86 A;  4IVN A;  4OMY A;  1DDN A;  1ZLK A;  1R23 A;  3KP5 A;  2L3D A;  3KP3 A;  2QUF A;  3E5Q A;  2O61 A;  1IW7 F;  3LA7 A;  4MQV A;  4UV9 A;  2Y0M A;  1V4R A;  4XSZ F;  2M87 A;  5LGU A;  3BPV A;  3IWZ A;  2P5V A;  3M8E A;  1IF1 A;  3HTS B;  4L9J A;  4ZYG A;  1G6N A;  1GHC A;  4QLC U;  1ZHF A;  3RDI A;  5HLG A;  5CJ9 A;  2P7V B;  2DQR A;  1J59 A;  1VTN C;  2K4B A;  4G7O F;  3TOA A;  2XKO A;  3GZ5 A;  1AWC A;  2JT1 A;  1Q1H A;  2WC2 A;  3IC7 A;  3TO7 A;  1QO0 D;  3HRU A;  2VE8 A;  4HQM A;  1FBQ A;  2RQP A;  3Q5F A;  5CVR A;  1YW7 A;  2HEO A;  2K27 A;  1QNT A;  4L5I A;  3REO A;  5ILV A;  1U3E M;  4KT5 C;  2NNY A;  3D0S A;  3DPL C;  1QQI A;  5HDK A;  4KA4 A;  4WXC A;  2IA2 A;  4CYD A;  4ZYH A;  1WKM A;  2ZKZ A;  1O57 A;  2EWN A;  3H3Z A;  2V1U A;  4L9N A;  3F8N A;  3NQO A;  2D1V A;  3HUG A;  1FP1 D;  2GIV A;  3F21 A;  1REP C;  3LQQ A;  3U9G A;  3ABT A;  2FEZ A;  1D5V A;  1ZRF A;  2P4W A;  3OOP A;  2NS0 A;  1SD6 A;  2Z99 A;  2FML A;  3WU0 A;  1F9N A;  1DPR A;  4HF0 A;  4BH9 A;  3JTH A;  3HOT A;  2IVM A;  3BJO A;  2JTV A;  3CJN A;  5F64 A;  3E6M A;  2UWM A;  1GXQ A;  4Y17 A;  5AON A;  3H3U A;  1OYI A;  5K5O A;  4I09 A;  2G9W A;  4HDU A;  3M9A A;  5BS6 A;  1I6X A;  2XUB A;  4HDV A;  5E20 A;  2DBB A;  1FYM A;  2MBF A;  5K5R A;  5D5U B;  3HHG A;  2CQK A;  2DT5 A;  2F5C A;  2NAZ A;  2V1D A;  2OBP A;  1JGS A;  2KIU A;  4I01 A;  2ZCW A;  2EK5 A;  2XHK A;  4HA8 A;  4M6X A;  2H94 A;  4AD9 A;  2QQB A;  4WX9 A;  1T38 A;  1XD7 A;  4PCQ A;  2VE9 A;  3GUD A;  3FHZ A;  2Z9O A;  2FXA A;  2ZFW A;  4IHT A;  1BIA A;  1FZP B;  1PDN C;  2HKO A;  2W25 A;  4I02 A;  3TO9 A;  5ED4 A;  3WE2 A;  2B0L A;  4ZZD A;  1FY7 A;  1XGO A;  1FX7 A;  4G9Y A;  2V79 A;  4Q4Z F;  2PMU A;  3LFK A;  1IRG A;  2FA5 A;  1ZRD A;  1T98 A;  1HW5 A;  4UXN A;  3E6C C;  2M30 A;  1G3T A;  4MQ9 F;  2K4J A;  3IL2 A;  3I5U A;  1Z1D A;  3LAP A;  1YIO A;  4EV0 A;  1K78 A;  1LDD A;  3K2Z A;  4Z2Y A;  1TW2 A;  1IN4 A;  2CW0 F;  2LF8 A;  5E17 F;  3L9F A;  1W7P A;  4IPA A;  1T0F A;  3HRS A;  1QPM A;  4MGR A;  1Z7U A;  1LB2 A;  2EFO A;  3F6O A;  1OYY A;  3J80 Z;  3NEU A;  4F7Z A;  3JTG A;  1R1U A;  3LA3 A;  1KU2 A;  1OYW A;  4G8X A;  1BN5 A;  2HR3 A;  3P9I A;  5HS9 A;  2ZNY A;  5DCM B;  5HDG A;  5HDN A;  1ZLJ A;  5IT9 K;  3F8C A;  1L0O C;  4BHC A;  4RGS A;  4O3M A;  2ACJ A;  4D0P A;  5DUI A;  3O6B B;  2HWV A;  4IRI A;  2X0L A;  2QM3 A;  2STW A;  1V3F A;  3DKW A;  4AIK A;  1FWZ A;  4ENK A;  4LG0 A;  2VBW A;  2O3F A;  3I58 A;  4M73 A;  4RB1 A;  1WQ2 A;  2O6G E;  2RDP A;  1JHF A;  4RAY A;  5J6X A;  4EJT A;  4IHS A;  4CO8 A;  1YG2 A;  1KQ9 A;  2CFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...