2FBKA

The crystal structure of hucr from deinococcus radiodurans
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
172
structure length
156
Chain Sequence
DTAALLERIRSDWARLNHGPSAGPMLTLLLLERLHAALGREIERTYAASGLNAAGWDLLLTLYRSAPPEGLRPTELSALAAISGPSTSNRIVRLLEKGLIERREASIRLTPQGRALVTHLLPAHLATTQRVLAPLSAQEQRTLEELAGRMLAGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator, MarR family
publication title The Crystal Structure of the Transcriptional Regulator HucR from Deinococcus radiodurans Reveals a Repressor Preconfigured for DNA Binding.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Transcription
total genus 52
structure length 156
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fbkA00
3J81K 4CDGA 4ASNA 4HX8A 3KP3A 1XSDA 4EM0B 2EV6A 2DI3A 2B0LA 1TW2A 3QU3A 1JE8A 4N9IA 3V8LA 5DUIA 5H6QA 3G3ZA 1QNTA 2X4HA 4WF2A 4O5VA 4ENJA 1ZLJA 2ZO4A 3E97A 1S7AA 3LQQA 3C1DA 3QAHA 5DCMA 2F2EA 4A0YA 2GAUA 3V7CA 3BPVA 5LEJA 1H9TA 3V7RA 1E2XA 1QZYA 3RYPA 5D5VB 2FBHA 1H9GA 4I01A 5JR3A 3TDUC 2RC4A 2JPCA 4L0ZB 5HLGA 3DXJF 5E1XA 3E6CC 1IRFA 3VODA 2W24A 2CG4A 5ILSA 3QOPA 1T6SA 2ZNYA 4BHPA 3HSFA 1QPMA 3S2WA 2EFOA 1KGSA 4I2OA 2MD5A 5L3FA 3LAJA 2NS0A 2L4AA 2V9VA 2L02A 3ZP5A 1OYIA 4QWQA 1TNSA 2EFQA 4RAZA 4A12A 1HKQA 4CXFA 1PDNC 3CTAA 3MZHA 2P8TA 1BC8C 2DBBA 3WODF 1FYKA 4AD9A 3HHGA 2DTRA 2CFXA 4N0BA 3T5XA 1KQ8A 1BI0A 1OYYA 3IC7A 3WTWC 4P55A 2PLYA 2K27A 5DD4A 3E3VA 5LLQA 2EV5A 4XLPF 3F72A 4G94A 1Y0UA 4KN4X 1IAWA 3FXQA 3KEOA 1OPCA 4MTEA 1USSA 4P96A 2VONA 4EGYA 2QQBA 4ENNA 4D0PA 3F22A 2PJPA 3P9KA 4Q48A 4I02A 5LGUA 3J7AO 5LGTA 3F8CA 2RVCA 1G3TA 2WC2A 1IZ1A 4G6DA 5HS8A 2HDCA 4KMFA 1Z6RA 3MWMA 4HDUA 5BPIA 2LDUA 2VE9A 4L0YB 1R5HA 3HRMA 3BJOA 1U2WA 2XAJA 1YG2A 4BAYA 1B1BA 4BHBA 4G6QA 3K1PA 4OIQF 2HTSA 1HSTA 2ADUA 3RPQA 2XKPA 1ZHFA 4B8XA 3WGIA 5DV5A 5CVVA 2Z33A 4IPAA 1ZN2A 1UB9A 2HFHA 5CVRA 3QU6A 5ILUA 4LG0B 2PMUA 4P5OA 1FOKA 1RUOA 1P4AA 2MA3A 5LGNA 2PG4A 3SZTA 2FE3A 1PP7U 4KT5C 5FLXK 3DP7A 1EH7A 4Z2YA 4HX7A 1AOYA 3TO9A 3KP4A 4L9JA 1EH6A 5E8GA 2KRFA 4U0YA 1U5TA 4M74A 2MLGA 2XAGA 2HTJA 2DW4A 4IHSA 2A61A 4UUVA 4MQVA 5D5WB 3SZPA 1BI1A 2WTEA 3TO7A 2ESHA 3ZPLA 2VBWA 2O61A 1YW8A 4GYGA 4OINF 1R36A 3HRUA 1YIOA 5LBQA 3F8FA 3JAMK 3E6MA 4JBAA 1MDMB 3U1DA 5L3BA 1QO0D 4HAMA 4ON0A 4LK1F 2H27A 3HYIA 5BMZA 2YPRA 1FSEA 2DK5A 2MBFA 2GZWA 2ZBKA 2P5VA 1EV7A 1FNNA 5TRDA 2VOOA 4AVPA 3M8FA 4BYYA 2XRNA 2J5PA 2L4MA 2FOKA 4EJTA 3HIFA 1LEAA 2IA2A 3EYYA 5F1RA 2KIUA 3R61A 4S05A 2EFWA 3J80Z 2FBIA 2STWA 1BN5A 4E70A 2ESNA 3I59A 3K2ZA 5FD6A 3V4GA 3IKVA 5ED4A 1CF7B 1P4WA 2XKOA 2OAZA 1FPQA 1FLIA 2F5EA 5CVUA 5DUKA 3I58A 4U7DA 3R4KA 1O3TA 1IXSB 1YFHA 3D5LA 1QZZA 2RKHA 1QBJA 4RGSA 4JQFA 3F23A 1BC7C 5D4SA 1GHCA 1USTA 2XROA 3FMQA 2YR2A 1I6XA 4LLGF 1ZREA 3TDZC 3KZYA 4KIBA 2OU2A 3FM3A 4ZZDA 4MQ9F 2IVMA 2F5FA 2Z9OA 4U0VA 1W7PB 3SHFA 2FBKA 3KCCA 2K7LA 4RGXA 3KP6A 2FSWA 2O3FA 1MJAA 1XMKA 2GA1A 3EQLF 2RQPA 4PGHA 3L2CA 4ESFA 5E20A 2P5KA 2VT2A 2QQAA 1T98A 1RIOH 3I0TA 2HQRA 2ZMEB 1SFEA 3DFGA 5DCFA 2JZYA 2OQRA 4M73A 5DEQA 3FXUA 2RDPA 4HDVA 2ZXJA 3I54A 3WTSC 1P2FA 3FX3A 3GX4X 3HSEA 5HDKA 3QP6A 4Q4ZF 1IN6A 2KIFA 2HS5A 1RI7A 3GEZA 3VOEA 3B02A 1FBUA 5KK1A 3IWZA 2IJLA 4ZYHA 3LA2A 2O03A 2KJCA 2W85A 1IRGA 4BHCA 4LB5A 3N4MA 4I09A 3FMRA 4G8XA 3FWEA 2EA2A 2DU9A 1TNTA 4WCGA 2Z5UA 2YSRA 3DF8A 3ZMVA 4ZZLA 2Z99A 3F8BA 1I27A 2Z3YA 3P9IA 2P6TA 2MH2A 4FT8A 3ZMDA 4EM1A 1HKTA 2V79A 3VEPA 3REOA 3BPXA 3ZMUA 3HRSA 3M9AA 2QM3A 1B9MA 1SD6A 5CLSA 2RN7A 4QLCU 5LHHA 1T39A 1GXQA 2DQLA 2W84A 4Y13A 5JHUA 2MC3A 1ZG3A 3ABTA 2H09A 2XGXA 4KFCA 1TW3A 2E1NA 3DKWA 4HQEA 2XHKA 1IXCA 1G3SA 2FA5A 2ZNZA 1GVJA 1FT9A 1FBQA 3IKTA 3P7NA 2R3SA 3FF5A 3WU0A 1ZLKA 2R7DA 3F6VA 2VOPA 1IF1A 5E17F 2JPBA 5D6FA 3CUOA 1KYZA 3E6DA 2LF7A 1JHHA 1JGSA 3DEUA 1R1TA 4CGZA 1R5GA 2DK8A 4O3MA 1ZGJA 5H20A 3MQ0A 5IT9K 2JT1A 2VODA 2VN2A 2QBYA 4NHJA 4LG0A 3BP8A 4O6JA 1V4RA 1HSJA 2FMLA 1XSVA 4HF1A 1BOAA 3GZ6A 1TQIA 1P92A 4XBFA 1O57A 4GO1A 4IF4A 4EJOA 4GXOA 1U5TC 2CGPA 1DP7P 2DQRA 1XDUA 4UHTA 1O3QA 4HLXA 4PCQA 3K69A 5L3GA 2QWWA 4HBLA 2CYYA 2XIGA 4Q5SF 4HX4A 2GQQA 3WTZA 3NQOA 5LRSA 2EFPA 1WQ2A 1LDJA 4N9HA 4XSZF 3IRQA 2O8XA 4WXDA 2JSCA 3GW2A 3KP5A 3TGNA 4GGGA 2A07F 3RIRA 4OIRF 2HR3A 1MDMA 1XD7A 3ISPA 1J9IA 4OOIA 4KA4A 1YO5C 1YW7A 5ICCA 1KQ9A 4ENMA 1BIBA 3KFWX 4A6DA 2QZ8A 3WE3A 3ZMZA 1SD4A 4KN7X 3ZN1A 3LFKA 2L01A 2L3DA 3JW4A 3GYHX 2CSOA 2CQKA 1SFUA 4ZH4F 3KE2A 2IA0A 4EJUA 3K1NA 4L9VA 1R7JA 5ICFA 4OMYA 1S3JA 2IT0A 4RB2C 4A5NA 1KQ0A 2OZUA 3L7WA 3WE2A 2QYOA 3R0JA 2PBIA 3ERED 1F1ZA 1Z7UA 1T38A 1O7FA 1RNLA 1OR7A 4EJVA 4GCVA 1Q1HA 4UXNA 5J8CA 1BI3A 3Q9SA 3GZ5A 1KA8A 1XGSA 3GFIA 2ZKZA 1LNWA 4OU0A 3MEXA 4ESBA 2HQNA 1Z6TA 1LDKB 1FSHA 2PMHA 4WXCA 1K78B 1IXRC 3V8JA 3TO6A 1DUXC 5LEKA 1GXPA 3HOSA 5EEGA 2W57A 2IW5A 1A04A 3SQNA 4YG2F 2BE5F 2V1XA 1D3YA 1F5TA 1W7PA 2G7UA 4HV6A 4DQ2A 1XB4A 3N97A 2BYVE 2Q8KA 4UV9A 1YQAA 3L9FA 2ETHA 5K5QA 2Y75A 5CVIA 3L09A 1IN8A 1XCVA 3O2PE 1LEBA 3K0LA 1ZAOA 4G7OF 1SD5A 2FXAA 3B73A 2IA1A 2ZMEA 4UV8A 2A3SA 1YW9A 2RGVA 1XCBA 5BS6A 4WX9A 3IRRA 1OMIA 3EETA 4UNOA 2HEOA 2DT5A 4LJZF 3ZQ7A 5E8IA 3GFMA 3RYRA 4PGGA 2QENA 5FFXA 2F5DA 1J0RA 4BQAA 1S6LA 2F5CA 5HS7A 4AIJA 4I7HA 5E1WA 2V1UA 1ZARA 3QPTA 2YX4A 3FZVA 2Y0MA 2FQ3A 4WXHA 3ELKA 1B9NA 2O0YA 2UXXA 3QPHA 1XGOA 2ZJ2A 4IJAA 1B59A 1ON1A 2DLLA 2TDXA 2WV0A 1XN7A 3O3KA 3RPUA 3AAFA 3GXOA 2Y48A 3CUQA 3CO6C 2NRAC 1MGTA 2NAZA 1B4AA 4LLNA 2ISYA 1T2KA 1KU2A 1IN5A 5F6FA 5H6RA 4I98B 1JHFA 2PI0A 2DFIA 2HWVA 2DO7A 1J5YA 4A2UA 3RTRA 1UHMA 4MHGA 2DPDA 1LVAA 2OA4A 2COMA 3F6OA 3GFJA 3GF2A 2VBXA 2YU3A 2YX7A 5HVQC 3T8RA 3R60A 5FB2A 2M45A 3ECHA 2QVOA 5FD5A 2K86A 4EMSA 1I5ZA 1F9NA 3BY6A 3FHZA 1CGPA 1TBXA 5CVJA 3BJ6A 4LB6B 1FC3A 1B6AA 4Q47A 4A0ZA 3WGHA 3PQJA 4EJWA 4NQWA 5J8FA 1KU9A 2ISZA 3DQVC 1ZRCA 2FU4A 2VXZA 2PN6A 2MLKA 4KYWA 4KMUX 5TJJA 2EJRA 2P5LC 2QLZA 1TQPA 1BBYA 3V8KA 3F8NA 1K7AA 4AIHA 1ZGAA 2W25A 3CO7C 1R1VA 4A0XA 3QRFF 3LQRA 4RGUA 3F8MA 3ECOA 1D8JA 1IW7F 1REPC 1K6OA 1UHWA 4P9FA 4MEXF 1XGNA 2HYFA 5CJ9A 4HF2A 1TTYA 3VB2A 1NHAA 2XAFA 3LSTA 3LAPA 1ON2A 4OMZA 1LB2A 4HQMA 2IP2A 3G73A 1J2XA 3E6BA 4OIOF 1G4DA 2QUFA 3BDDA 1K79A 2IRFG 4CICA 3R6SA 3V7SA 1F4KA 5D5UB 4MEYF 1WSUA 5F64A 4UVAA 2JTVA 1IN4A 2HGCA 3E5QA 3WTTC 1HW2A 3ML6A 5D6EA 4ZYEA 3DV8A 2R7FA 1O7LA 4KIFA 1OYWA 1U8RA 1DDNA 2DPUA 5HDNA 1OKRA 3SXYA 2FMYA 3HSRA 2M30A 2HKOA 1HBXG 4YFXF 3U2RA 3K1MA 2A68F 2JRTA 4M9XA 2LF8A 2DAOA 2C6YA 3C18A 1I1GA 4KICA 3WTYC 3ZN0A 4FHTA 1UFMA 2LNBA 5BPDA 3C7JA 3H92A 2X0LA 4XLNF 3LWFA 1QQIA 3RDIA 1ZH5A 3T8TA 1FZPB 1YLFA 3KLOA 4Y17A 3H3UA 5JI6A 3FXRA 1JXSA 2PFBA 4AWXB 3WTXC 5K5OA 4HA8A 4GYIA 5A2QZ 3IL2A 5AIQA 1ZG1A 3QP5A 3HTSB 1FY7A 3FM5A 4ZYGA 4B09A 3BROA 1WWXA 2ACJA 4S04A 2K4JA 2L54A 4KUMA 1BI2A 3HTUA 3ZMSA 3M1EA 4A5MA 1E17A 1U3EM 1KU7A 4M9ZA 1ZG5A 4KIGA 1I1SA 3BOQA 2P7CB 4Y15A 1R00A 2CWEA 1K78A 4NB5A 3KLNA 1KYWA 4UVCA 4HV5A 3W6JB 3MAJA 1KU3A 1FWZA 4L5JA 3I64A 1FYMA 3EUHA 1AWCA 2H6CA 4LLLA 2IPQX 2VBZA 1MD0A 2Q2EA 3WGGA 5HLHA 1R22A 4ESJA 4LFUA 3L00A 4UVBA 3EDPA 4HLYA 4RB1A 4LMYA 5CYVA 3PFIA 4L18B 2OZ6A 1WI9A 4RAYA 2NNNA 3BZ6A 1Z9CA 2UXNA 2P7VB 4U0WA 2HOEA 2RNJA 1T0FA 3GUDA 4LGWA 4R8HA 2KKOA 2HKXA 2J5OA 2STTA 1TLHB 1FP2A 1YTYA 1YS6A 2G7HA 1D8KA 2K02A 4BH9A 3GWZA 4ZYDA 4M6YA 3E5XA 3GO5A 3CUQC 3NRVA 3MCZA 1R1UA 5E1ZB 1SFXA 4I0BA 2GIVA 3KETA 1FYLA 5L3DA 2BV6A 3I4PA 5D5XB 5ICGA 4KDPA 1RZ4A 2XVCA 3J81Z 4HOBA 3HOTA 4IHTA 2VBYA 4IRIA 2LSOA 4OIPF 3I53A 1ULYA 5ERIA 5LRRA 5JFRA 4IXAA 1CF7A 3D0SA 4RGRA 3C3WA 3KZZA 2EV0A 3J80K 1W4MA 1G3YA 3GFLA 4R1HA 3Q5FA 4MGRA 1PP8F 1U6GA 3KP2A 4IRGA 3OOPA 3TKYA 3ABUA 4BXUA 4G7ZF 2XV4S 3LA7A 5L3CA 2A6EF 5BOXA 3CDHA 2QQ9A 3SFZA 3MFKA 3RI4A 2VC1A 1L3LA 4AIKA 1Z91A 5KVRA 1BIAA 1C0WA 4LD5A 5IT3A 3JTGA 5K1YA 3RKXA 5IT9Z 5DCMB 5E18F 3T0YA 1XMAA 1YYVA 4I0AA 4RB0A 1J7KA 3T1BA 2HZTA 1J59A 3F21A 1Z05A 2KIMA 4MNUA 3U9GA 2OQGA 4R79A 2HYGD 4CHUA 1H0MA 1ZRFA 2QBYB 5D8LB 2V1DA 1HW5A 2ELHA 2ZCWA 5HS9A 4L9NA 4EM2A 2P4WA 3ROUA 5K5RA 5D4RA 2BEOA 2G9WA 1MJ9A 5LHIA 3IWFA 2GA2A 2XASA 4EQQA 1R58A 1WKMA 2E7WA 2P6SA 2OD5A 2BBYA 3JTHA 5FO5A 1LQ1A 2GXGA 4FX4A 5DDGA 2PEXA 4XSXF 2D1HA 1RUNA 4XRFA 3FMSA 1R23A 2NYXA 1W7PD 1HW1A 4K2EA 4RS8A 4EVIA 1Z1DA 3CLOA 3RJPA 4TV7A 5BQTA 5D8KB 3WG9A 5HDGA 4WWCA 2H6BA 5HOOA 2FNPA 1J75A 3HHHA 2EFNA 4A6EA 3WTVC 3JSOA 3M7GA 2XUBA 5L3EA 3I71A 2UWMA 2EWNA 1S29A 2D2WA 2WWYA 3OV8A 4IRHA 3GVAA 3BWGA 4PDKA 4YIIA 5DD8A 3NEUA 3RKYA 3KP7A 4H0EA 4JK1X 4MTDA 1G6NA 2EK5A 4ENKA 1O3RA 3I5UA 4CZZA 3LA3A 1HXDA 1STZA 3K9TA 1O3SA 4BNCA 1ODDA 2A69F 4FX0A 4EGZA 1SMYF 1UCRA 2EB7A 2FRHA 1S8NA 1YS7A 1S7OA 3TQNA 1DPUA 1EH8A 2MH9A 2O6GE 5FGMA 1XGMA 1BM9A 1IN7A 3ZMTA 2GWRA 2M87A 1X3UA 4IVNA 4PZJA 3P9CA 5AONA 2VT3A 2VC0A 3GLXA 2BGCA 3TOAA 1P4XA 3HUGA 6PAXA 2K4BA 2M5WA 2FNAA 5ILVA 4DNCA 5FFZA 4YFKF 3TOBA 5FLXZ 2E7XA 5LHGA 5DYMA 5A2QK 4P9UA 2ZFWA 2M1BA 2NNYA 3KEQA 2A5YB 1FX7A 1HKSA 4G9YA 3O6BB 4M71A 1XSXA 1ZYRF 1DPRA 3DPTA 1MJBA 4M6XA 3M8EA 1BJAA 3E5UA 1U5TB 4M72A 1TQMA 3ULQB 3JAMZ 1G3WA 3COAC 1LDDA 2D45A 2FEZA 2Q0OA 2XAHA 1FP1D 1U78A 3PQKA 4CO8A 5ICEA 5JVTA 2A6HF 2AXLA 2UZKA 3H3ZA 5EEHA 2CW0F 3W6KB 3Q9VA 1MKMA 3WTUC 4KNYA 1QGPA 1P6RA 5J6XA 2E1CA 1SD7A 1W5TA 4HW0A 4HZFA 1PUEE 2GXBA 2D1VA 4L5IA 2XAQA 4M9SA 4LK0F 4WK8F 1LJ9A 4F7ZA 2AS5F 2V6CA 4HF0A 4HYEA 3F3XA 1HQCA 3MZYA 3IHUA 1L0OC 4U7BA 1IUYA 2VE8A 3CUQB 3HRTA 3WU1B 2PQ8A 4EV0A 4YIFA 4U88A 4L9TA 1FBSA 1XDSA 4G7HF 1D5VA 2H94A 3I59B 4RB3C 2M8EA 2RV8A 3CJNA 1WRJA 1VTNC 1SAXA 2CO5A 3BJAA 3R0AA 1ONVA 3RKWA 4CYDA 3DPLC 3EYIA 2FF4A 2LKPA 1MZBA 4YFNF 1SMTA 2OBPA 5AIPA 3JSPA 1ZRDA 2EA4A 2KJBA 1V3FA 4ETSA 1W5SA 3VFZA 5HLIA
chains in the Genus database with same CATH superfamily
3DU5A 3J81K 1OCPA 3TEDA 3C2BA 5KAIC 4ZDPA 4CDGA 4ASNA 3WHCA 1AKHA 2DFEA 2KL4A 4HX8A 3KP3A 1XSDA 4EM0B 2EV6A 2DI3A 1WZ2A 2B0LA 5DM6F 3H35A 1TW2A 1HDPA 3TMOA 3MD2A 3QU3A 1A6QA 5IOYA 1JE8A 4N9IA 1WGXA 3V8LA 5DUIA 1WCMJ 1MW7A 1X4OA 5H6QA 3G3ZA 1QNTA 2X4HA 4X1EA 1BJZA 4LG3A 4G12A 4WF2A 2DN0A 1JT0A 1UELB 4O5VA 4ENJA 1ZLJA 2ZO4A 1H89C 5FLMJ 1MSFC 3E97A 1I6HJ 1S7AA 3HZJA 3K4MA 1LVKA 2JK3A 1LFPA 3LQQA 3LSMA 3C1DA 2K85A 3MMYB 3QAHA 5C3EJ 5DCMA 2LYCA 2VASA 2F2EA 1Z3XA 3FXOA 4A0YA 3S16J 2GAUA 3V7CA 2VUMJ 2IGNA 4F3QA 3BPVA 5LEJA 1H9TA 3V7RA 1FOWA 4RA2A 1ACIA 4E6KG 3CCVI 4CCKA 1E2XA 1QZYA 2IEKA 3RYPA 2ZSIB 5D5VB 4V2GA 2FBHA 1H9GA 4I01A 2P0WA 2TCTA 4BUPA 3H9QA 3TDUC 2RC4A 5JR3A 3SDGA 3S15J 1ETWA 1LPQA 2JPCA 2ELKA 1SFKA 4L0ZB 4XR6A 5HLGA 5IP7J 3DXJF 5E1XA 5FKLA 2R5YA 3E6CC 1IRFA 3VODA 1TP4A 2CG4A 2W24A 3QQAA 4DZPA 5ILSA 3QOPA 1T6SA 2ZNYA 2LOOA 1JKRC 4BHPA 3HSFA 4QPOA 1QPMA 3S2WA 1Q1VA 2EFOA 3Q0WA 1NH3A 1KGSA 4I2OA 1Y8QB 2MD5A 4BS9A 5L3FA 3LAJA 1V5FA 2NS0A 2L4AA 2V9VA 2KT0A 2L02A 1A5JA 2VJ5A 3OYBA 1OYIA 3ZP5A 2PMZN 4QWQA 1HDDC 1MMSA 2BXZA 1TNSA 4UB8C 2EFQA 4RAZA 2HYJA 1WJ5A 4BGDA 4BY1J 2CUZA 4A12A 1YIJI 1HKQA 3FK6A 4M3BA 4OAZA 3DPUA 4XRSA 3SYTA 2R5ZA 4CXFA 1PDNC 3CTAA 3MZHA 5EYRA 3M8JA 2P8TA 4NC7A 4XKCA 4DBQA 1BC8C 2DBBA 1R5ID 3UNGC 3WODF 4F92B 1FYKA 1R4NB 4AD9A 1ZR4A 3HHGA 2DTRA 1Y8RB 2CFXA 3IP4B 2KIQA 4N0BA 2OCCH 3T5XA 1KQ8A 1BI0A 4Y3OA 3JRAA 4RMNA 1W0UA 2VKDA 5EGOA 1OYYA 3IC7A 3K7AJ 3LSPA 3WTWC 2K9NA 1UG2A 4P55A 2PLYA 2K27A 5DD4A 1X1BA 2L7ZA 3E3VA 5LLQA 1GV5A 2EV5A 4FE7A 2VB6A 3F72A 4G94A 4XLPF 1WI3A 3GTMJ 1Y0UA 1VQ7I 4KN4X 1IAWA 2HDWA 1WHUA 3DTIA 4DOZA 3S8PA 1ZELA 2DA3A 4CCJA 4XMYA 3OR2C 2NVXJ 3FXQA 3KEOA 1OPCA 2QSGX 2EZHA 2I8DA 4MTEA 1USSA 4P96A 1VFCA 2VONA 1ORKA 3VYRB 3V42A 3BG7A 4EGYA 2QQBA 1Z0XA 4ENNA 3HG9A 4D0PA 3F22A 2PJPA 3P9KA 4Q48A 1Y1VJ 2DT7B 3KX2A 4KJZA 4I02A 5LGUA 3J7AO 5LGTA 3FXMA 3B6AA 5EJCA 3F8CA 4XKVA 5HNHA 2RVCA 1G3TA 2WC2A 1IZ1A 4LIVA 2CQNA 4G6DA 5HS8A 2CJJA 3I9V2 3KYDB 1R9TJ 3CC4I 2QSHX 5CPRB 2IBDA 2HDCA 4KMFA 1Z6RA 4B48A 3MWMA 1SVLA 3JRIA 4HDUA 5BPIA 2LDUA 3O8GA 2VE9A 1X3WB 1IC8A 3OOUA 1RPWA 4L0YB 1R5HA 3PNTA 5M5YJ 3HRMA 3OS1A 2XPUA 3BJOA 1WJFA 2E2JJ 1U2WA 4BU2A 3VSLA 3UKGA 3SJMA 2XAJA 1YG2A 4BAYA 1X3ZB 1B1BA 2QKMB 5FKKA 1XC5A 4BHBA 3HOUJ 2JRMA 1UMQA 4G6QA 1OJLA 1I3QJ 3CCRI 2E36A 2DA2A 3K1PA 4OIQF 5LD2C 2KHMA 2HTSA 1HSTA 5E79C 2K9MA 2ADUA 3RPQA 2XKPA 1ZHFA 4B8XA 3VYUB 2WAQA 3HEFA 5DV5A 3WGIA 5CVVA 2Z33A 2WAFA 4IPAA 5GTHC 1F43A 1ZN2A 1UB9A 2O7OA 4HEA2 2HFHA 4B3AA 5CVRA 3QU6A 4HNTA 3JRBA 5ILUA 2Y2ZA 4LG0B 2PMUA 4P5OA 1GDTA 1FOKA 1RUOA 5EEAA 1R71A 1P4AA 5FJ8J 2MA3A 3JRDA 3QPLA 5LGNA 2PG4A 1X2MA 2AHQA 2F6CA 5F08A 2FJ1A 3SZTA 1TC3C 2FE3A 3FBNB 1PP7U 2LMDA 3W2VA 4E7SA 4KT5C 5FLXK 3DP7A 1EH7A 2EZIA 4Z2YA 4HX7A 1AOYA 3TO9A 3KP4A 4L9JA 1EH6A 5E8GA 2KRFA 4U0YA 1U5TA 4M74A 2MLGA 2XAGA 2HTJA 2DW4A 4D7MA 4IHSA 2A61A 1D5YA 4UUVA 3CF5F 4MQVA 3HGYA 1MMAA 3ASNH 3F9KA 3BQYA 1BI1A 2WTEA 3SZPA 5D5WB 3TO7A 2ESHA 3ZPLA 4GDFA 2W1OA 2KZVA 1WJAA 5F27A 2VBWA 2O61A 2DA4A 2Z2SB 1YW8A 3NARA 2LVSA 4GYGA 4OINF 5GAGJ 2EZKA 1Y6IA 1R36A 1IGNA 3HRUA 2BXYA 1YIOA 4ITVA 5LBQA 3F8FA 2Z16A 2HVRA 3JAMK 5EF6A 3E6MA 2CMPA 4JBAA 1MDMB 1YJWI 2JUCA 4MLOA 4CYCB 3U1DA 5L3BA 1QO0D 3PNYA 4HAMA 4ON0A 3K4KA 5GTIC 4LK1F 3K2AA 2H27A 1Z7LA 3HYIA 5BMZA 2HDDA 1VQ8I 2YPRA 3QYFA 4MFDA 1W36C 1FSEA 2DK5A 3MZ8A 3CESA 4XLEA 1HC8A 2MBFA 2DT6A 2GZWA 4AYBA 1B72A 2ZBKA 3BCBA 2P5VA 5F04A 3DLAA 1EV7A 1EF4A 3BLYA 1FNNA 5TRDA 3BR5A 1BR1A 4IL6C 4AVPA 2VOOA 3M8FA 1B8IB 3CC7I 4BYYA 3KZIC 2XRNA 1T08B 2CQQA 2J5PA 2L4MA 4C2MJ 3ABLH 2FOKA 2EIJH 2GBYA 3HIFA 1SFOJ 4EJTA 4ZC3A 1E3HA 1LEAA 2IA2A 3EYYA 5F1RA 4BXFA 1YE9A 2KIUA 3R61A 2HXOA 4ZDLA 3M1CA 1G2HA 4D9JA 3VSKA 4S05A 2EFWA 2ELJA 3HOYJ 4L5EA 3J80Z 1GUUA 2FBIA 1MBJA 3FXJA 1BN5A 4E70A 4X0GA 3A01B 2STWA 1VQ4I 2FUG2 2ESNA 3CCLI 3I59A 3K2ZA 5FD6A 3V4GA 3IKVA 2VQGA 1GT0C 1UHSA 5ED4A 1VQKI 4DYCA 1CF7B 1P4WA 5J1RA 2XKOA 2OAZA 1FPQA 2E2IJ 4V2FA 2M7AA 3LMMA 1FLIA 2F5EA 2CRGA 2XDVA 5CVUA 4CCLA 1TT0A 3A0BC 2MSYA 5DUKA 3MKZA 2ZFUA 3I58A 2LBFB 4U7DA 2VIXA 3R4KA 3S3OA 1O3TA 4ZYAA 2KMUA 1IXSB 4F52A 1HCRA 3GMEA 1YFHA 1R4MB 3D5LA 4II3A 2Y0SA 1QZZA 2RKHA 1QBJA 4RGSA 4JQFA 3F23A 1BC7C 2BHYA 5D4SA 1GHCA 1USTA 2XROA 2XPVA 3FMQA 2LTPA 2YR2A 1I6XA 2IGOA 3B6CA 3TP3A 4ABZA 5J40A 4LLGF 1ZREA 1UJ8A 3TDZC 2OV7A 3KZYA 4A3KJ 4KIBA 3LOCA 2OU2A 4PSXA 2ECBA 2FQ4A 1HOMA 3FM3A 4ZZDA 4MQ9F 2ECCA 2IVMA 2F5FA 2CUEA 1V5EA 2Z9OA 4U0VA 1I3AA 2P81A 1W7PB 2FBKA 3SHFA 1X58A 3EUAA 2K7LA 3KCCA 3OYDA 4RGXA 2L9VA 3KP6A 2FSWA 4RDUA 2O3FA 1MJAA 1XMKA 2GA1A 3EQLF 4IEJA 4MO7A 3OR1C 2HNHA 2RQPA 4PGHA 3L2CA 4ESFA 3OYMA 5F0CA 1ZK8A 5E20A 2P5KA 2VT2A 2QQAA 1T98A 3M07A 1RIOH 2DDAA 3HOVJ 3I0TA 3GBGA 3ERMA 2HQRA 4RAFA 1ETXA 2ZMEB 3SZGA 1SFEA 3DFGA 5DCFA 2JZYA 4B3XA 2M2EA 3HKZA 2HQAA 5JLXA 2OQRA 2DMTA 3ZR8X 4M73A 1D1BA 5DEQA 3BG3A 3FXUA 1KONA 2RDPA 4XLAA 4HDVA 4XK4A 3OIOA 2ZXJA 2DA7A 3I54A 3WTSC 1WPKA 5FROA 1P2FA 3FX3A 3G1MA 2GXAA 3PM1A 3GX4X 1FOXA 2VI6A 3HSEA 1YI2I 2X1EA 5HDKA 2MD0A 4Y33A 2MFZA 2M7BA 3QP6A 4Q4ZF 1IN6A 1PYVA 4II2A 2KIFA 2HS5A 1RI7A 2EBIA 3ZOBA 1YX5A 5B66C 3GEZA 2KP6A 3VOEA 4HRIA 3BTLA 3KEYA 1BL0A 3BTJA 3B02A 2W48A 1FBUA 5KK1A 2JMWA 3IWZA 1SVOA 2IJLA 3AG4H 3W6VA 2B9SA 4ZYHA 3LA2A 1XMXA 2O03A 2KJCA 2W85A 1IRGA 4BHCA 3LSKA 3N4MA 4LB5A 4LIUA 4BJTA 4I09A 3FMRA 1E3OC 2HZDA 4G8XA 3FWEA 3Q0UA 2EA2A 2DU9A 4QSHA 1QRYA 1TNTA 2COBA 3C2GA 4WCGA 1JUSA 4XLFA 2MYSA 3W3CA 4YELA 2JA6J 1MBEA 2YSRA 2Z5UA 3DF8A 2PJRB 5KCMA 3ZMVA 4IHXA 4ZZLA 2Z99A 3F8BA 3AG3H 1I27A 2Z3YA 3P9IA 3OYKA 1JJ8C 4M6VA 3LFUA 2P6TA 2ZB9A 3E1SA 2H1KA 2MH2A 4FT8A 4IOAF 1SC7A 3ZMDA 4EM1A 1HKTA 2V79A 3VEPA 3REOA 3BPXA 5E3LA 4B44A 2DYRH 3ZMUA 3PIOF 3LSRA 3HRSA 1IV6A 3CCQI 3DEWA 1YITI 1W5CC 3M9AA 2EPFA 1B9MA 2QM3A 1JKOC 2CW8A 1SD6A 1QU3A 1Z67A 5CLSA 5DM7F 3OYNA 2RN7A 4QLCU 5LHHA 5E3MA 1T39A 1GXQA 2DQLA 2W84A 5GAEJ 1JKQC 3A02A 3CMYA 4Y13A 5JHUA 1W36D 2E34A 2MC3A 1ZG3A 3CD6I 3JRHA 1WJEA 3ABTA 2H09A 2XGXA 4KFCA 1GVDA 1TW3A 2E1NA 4XNFA 1BA5A 3DKWA 1I50J 4HQEA 2XHKA 1IXCA 5JVGF 1G3SA 2FA5A 3TL4X 4NQWB 2HOTA 3NWTA 2CU7A 2ZNZA 1UG0A 1GVJA 1A31A 1GV2A 2K40A 2OUMA 1FT9A 1FBQA 3CMAI 1JTYA 2G0EA 3IKTA 3P7NA 2R3SA 3FF5A 4XLHA 3WU0A 3PIPF 1ZLKA 1K6YA 1IRXA 2R7DA 3F6VA 5J47A 2VOPA 3I56I 2HVSA 1IF1A 3OL3A 5DS9A 5E17F 2JPBA 1RC9A 5LFAA 3KPHA 5D6FA 4RM3A 4I76A 2CV1A 3CUOA 2OC6A 2CV2A 2B63J 4XOPA 1KYZA 3WU2C 3EUKL 3E6DA 2LF7A 1JHHA 1FOYA 3RQIA 3HJEA 1JGSA 3DEUA 3PUBA 1R1TA 4CGZA 1R5GA 2DK8A 3IH3A 3HB9A 2NOJB 4O3MA 1QHHD 3H3VK 2M4KA 1ZGJA 5H20A 3TW6A 3MQ0A 2DOFA 1Z77A 2HU9A 1ZGWA 5IT9K 3BR1A 2JT1A 2VJIA 3FBIB 2VODA 5KAFC 2VN2A 2QBYA 4NHJA 4LG0A 3BP8A 4O6JA 1VQMI 4QIWN 3Q0VA 1WH7A 1QZEA 4FTHA 1V4RA 1HSJA 2HPIA 4BKXA 2FMLA 2ZC2A 1XSVA 3RCOA 4DZJA 4HF1A 1BOAA 3BG6A 2L7KA 3GZ6A 2LKXA 1TQIA 1P92A 4XBFA 3TBIA 5C4XJ 1O57A 4GO1A 2DMQA 2WB1A 4IF4A 4DBRA 2VQCA 5FRMA 4PSWA 2NXNB 4EJOA 4GXOA 1U5TC 2E19A 2CGPA 1DP7P 2DQRA 1IG7A 1XDUA 4UHTA 4BDZA 1O3QA 4HLXA 4PCQA 3M4OJ 4BACA 3K69A 1IDYA 5L3GA 2QWWA 4HBLA 2A6TA 4H4KC 2CYYA 3MVPA 2XIGA 1YHQI 2KPMA 4Q5SF 4HX4A 3CP8A 2GQQA 3WTZA 1PUFB 3NQOA 5LRSA 1RR7A 1S5LC 1WQ2A 1ENHA 2EFPA 4XRSG 1LDJA 4N9HA 4XSZF 3IRQA 2O8XA 2Y31A 4WXDA 1PJRA 2LFBA 2JSCA 3GW2A 3KP5A 3TGNA 4GGGA 2IXSA 2A07F 3I3LA 2PX9A 1RR8C 3RIRA 4OIRF 2HR3A 1MDMA 4CYCA 1XD7A 3ISPA 3QWLA 1J9IA 4OOIA 2O9LA 2WADA 4KA4A 1YO5C 1YW7A 4HSRA 3ZRGA 5ICCA 2Y9ZA 3H0DA 5J4VA 1KQ9A 4ENMA 1BIBA 4HG2A 2M3AA 3KFWX 2K9LA 4A6DA 3DCFA 2QZ8A 4BJ6C 1JKPC 3WE3A 3ZMZA 2WY8Q 1SD4A 4KN7X 3ZN1A 2NS8A 2GIZA 3H1CA 1EKEA 3LFKA 3BR6A 4E7LA 2L01A 2L3DA 3JW4A 3GYHX 2CSOA 2CQKA 3CDIA 5IYDJ 3ZQCA 1SFUA 1B8IA 2X1CA 4ZH4F 3A2KA 3GTGJ 2Q1ZB 3KE2A 2IA0A 4M3FA 4EJUA 1IRZA 2DTZA 3K1NA 4L9VA 2L9NA 1X1DA 3S1QJ 2BY1A 1JGGA 1R7JA 5ICFA 2RQQA 4OMYA 3H5RA 3CP2A 1FMVA 1S3JA 3O8HA 1X1PA 2IT0A 4RB2C 3E0JB 3MKYB 2JA7J 3A01A 4A5NA 1KQ0A 1G59A 2OZUA 3L7WA 3WE2A 2QYOA 3R0JA 2PBIA 2R7TA 1S7EA 3BR2A 3SFIA 2FD5A 2YU9J 4I99C 2JA2A 3ERED 1BR4A 1ITYA 1F1ZA 1U9OA 4NDLA 3DBRB 2KISA 2NVUB 3ZQFA 1Z7UA 4A3GJ 2LG4A 1T38A 1O7FA 1IDZA 1RNLA 1OR7A 1HA8A 1NG7A 3PJRA 4B4CA 1K61A 4EJVA 3S1RJ 1X1AA 4GCVA 1Q1HA 4UXNA 5J8CA 3K4CA 2KQRA 1BI3A 2LBFA 4AM3A 1X2NA 3Q9SA 3LNQA 3GZ5A 1KA8A 1RESA 2EINH 3SDBA 1MSEC 3JRGA 2L9SA 5C44J 1XGSA 3LSHA 4C2UA 3GTPJ 3GFIA 2ZKZA 1LNWA 4OU0A 4I6ZA 3ASOH 2LD5A 1N78A 2E5NA 1T95A 3BC8A 3BR0A 3MEXA 3CMMA 3NWSA 4ESBA 2HQNA 3IH4A 1Z6TA 2CQ7A 1LDKB 2X1DA 1MBFA 3DEEA 1FSHA 2PMHA 4WXCA 1K78B 1IXRC 3V8JA 3TO6A 1DUXC 3H5NA 1SANA 5LEKA 1GXPA 3HOSA 5EEGA 2W57A 2IW5A 1A04A 1RKWA 3SQNA 4CCNA 4YG2F 4AIDA 2JA5J 3QYEA 5KNLA 1WVRA 2BE5F 4EEFG 1VQ6I 2V1XA 1DGWY 4AUXA 5IY5H 1D3YA 2X51A 3L2WA 1F5TA 5M3MJ 1EA3A 1W7PA 2DODA 5IP9J 2G7UA 4HV6A 2AQEA 5J3LA 2R93J 2DDBA 4DQ2A 1XB4A 3N97A 2NVTJ 3PL8A 2BYVE 2ZSHB 2R7QA 2Q8KA 1YX3A 2JVHA 3X2QH 4UV9A 1YQAA 3L9FA 2ETHA 5K5QA 2Y75A 3ESWB 2Q2EB 5CVIA 1N75A 3L09A 1IN8A 1XCVA 4C3JJ 4BDYA 3O2PE 1APLC 2GOMA 3K0LA 1LEBA 1NTCA 1ZAOA 4G7OF 2GLOA 2E71A 4V19K 3HL2A 3AG1H 1SD5A 2FXAA 3B73A 2IA1A 3BG5A 2ZMEA 4UV8A 3OY9A 2A3SA 1YW9A 1OCTC 1LFBA 2HXIA 2RGVA 4PJLA 4BQOA 1MBHA 1XCBA 3L2VA 5BS6A 1SVMA 1D0XA 4WX9A 3IRRA 1OMIA 4XQFA 1YOVB 3GCMA 3EETA 4UNOA 4CCMA 2HEOA 3MKWB 2DT5A 3MN2A 4LJZF 3ZQ7A 5E8IA 3GFMA 3RYRA 4PGGA 2QENA 1PVEA 2F5VA 5FFXA 2F5DA 2M9HA 2Z1DA 1J0RA 4BQAA 1JUPA 5EG0B 1S6LA 3J7ZI 2F5CA 3AKZA 3ZQQA 2EIMH 5HS7A 1K83J 2BY3A 4AIJA 4I7HA 4XORA 5E1WA 1VQ9I 2V1UA 1VI0A 4IQ4A 3DWLE 3BG9A 3S1MJ 1ETYA 1ZARA 3QPTA 4CCOA 2YX4A 5JLWA 3FZVA 2Y0MA 4AC0A 2FQ3A 4D5FA 4WXHA 3ELKA 2JWTA 1B9NA 2O0YA 4LOCA 2DA1A 2JJ7A 2UXXA 2WAQN 3QPHA 1XGOA 2L5QA 2ZJ2A 4IJAA 5GPAA 4ZTFA 1B59A 1ON1A 1Y0NA 2OTJI 2DMNA 2V9KA 2X48A 3VDXA 3HDDA 1QVTA 2X6OA 2DLLA 2TDXA 2EILH 2WV0A 2DXIA 2W00A 1XN7A 2YUSA 5DTDA 3O3KA 3RPUA 3AAFA 3BR3A 3GXOA 2A5WA 2Y48A 4A3JJ 2X6XA 3CUQA 3OYEA 3CO6C 2F48A 2NRAC 2HOSA 1MGTA 2DYSH 2NAZA 1B4AA 2WAEA 2M34A 1HF0A 1MH3A 4LLNA 2ISYA 4UUSB 1T2KA 4IKFA 1KU2A 1IN5A 4YEJA 5F6FA 2L7MP 5H6RA 1DP3A 1D0ZA 4I98B 4A69C 4BE1A 1JHFA 2PI0A 5KHDA 1H88C 2R0QC 2DFIA 3K4BA 1EJ9A 4F93B 2HWVA 2DO7A 1J5YA 1M1EB 3FIWA 4BXXJ 4A2UA 1E3PA 1H8AC 3RTRA 4FCYA 1UHMA 4MHGA 4Y7NJ 5IYCJ 1LVAA 2DPDA 2OA4A 3PNVA 5E3NA 2COMA 4KITB 3F6OA 3GLLA 3GFJA 3GF2A 4NNJA 2VBXA 3AFHA 2YU3A 2YX7A 3T8RA 5HVQC 2QA4I 3R60A 4DYRA 1ETQA 1QPIA 1XX5A 2KRHA 1FEXA 1V5GA 3LSGA 5FB2A 2AXTC 3H9GA 1FTZA 2M45A 3ECHA 2QVOA 5FD5A 2K86A 4EMSA 1G8XA 1I5ZA 1F9NA 2I10A 3BY6A 3PFYA 3FHZA 1AU7A 1CGPA 4ZDOA 1TBXA 5CVJA 3BJ6A 4BBRJ 2E1MC 3HXLA 4LB6B 1FC3A 1B6AA 4Q47A 3CC2I 2H8RA 4A0ZA 5HNFA 2XAUA 3WGHA 3PQJA 4EJWA 1MIJA 3DBLB 2JQ7A 4NQWA 2K9SA 2BVMA 3DTEA 3K70C 2XGEA 5J8FA 1XPXA 1KU9A 2ISZA 3E7LA 2BHZA 2TRTA 3DQVC 4AYBN 1ZRCA 2FU4A 2NOGA 1YJNI 2IS4A 2VXZA 4G6TB 4BE2A 3S3MA 2M4GA 2PN6A 2MLKA 3IH2A 3G4SI 3KYLA 3H0GJ 4KYWA 1V54H 2LC2A 4KMUX 1LE8B 4U87A 3JRCA 5TJJA 1K4SA 2EJRA 3RQ4A 2CH0A 1T8IA 2P5LC 5J1YA 2QLZA 1TWAJ 1TQPA 3DBHB 1D0YA 2HI3A 1BBYA 3V8KA 3F8NA 3VYTB 1K7AA 4FQGA 4AIHA 1ZGAA 4C30A 2W25A 4A3FJ 3CO7C 3ZGKA 4JP0A 3FDYA 1R1VA 2E35A 4IOCF 4A0XA 3QRFF 3LQRA 4RGUA 3F8MA 3ECOA 4Y52J 2VJJA 1D8JA 3U21A 1IW7F 1REPC 2R92J 1K6OA 1UHWA 1Y1WJ 2QF7A 4P9FA 4MEXF 2LH9A 5EZGA 4PFOA 1XGNA 3GTLJ 1TWHJ 2HYFA 5CJ9A 4E7KA 2B7EA 3L2QA 4FASD 1F36A 4HF2A 4Y4RA 1TTYA 1OQYA 3VB2A 1NHAA 2XF5A 2XAFA 3LSTA 3LAPA 1ON2A 4OMZA 3OYJA 2M0MA 3BTIA 1LB2A 3TP0A 4HQMA 4DGWB 2IP2A 3JREA 4J00A 2LKSA 3G73A 3G1OA 3CJTB 1J2XA 2ID3A 3E6BA 4OIOF 2V4JC 1G4DA 2Y0SN 4N4OB 2QUFA 3BDDA 2KFDA 4EATA 2R7SA 1K79A 4M3GA 2IRFG 4CICA 3R6SA 3V7SA 1PUFA 1F4KA 5GADJ 3BQZA 1SAUA 5D5UB 4MEYF 1WSUA 1JI8A 5F64A 4UVAA 3DU6A 4PK4A 1S72I 2JTVA 4NBQA 1IN4A 2FOWA 1BW5A 1JT6A 4FE4A 1OCCH 4RAGA 2HGCA 1VQPI 3E5QA 5B1BH 1BOBA 3WTTC 1HW2A 4NC6A 2XRLA 3ML6A 4E7HA 2XF6A 5D6EA 2AO9A 4ZYEA 1WJDA 3DV8A 1TWCJ 2R7FA 2VKVA 3AG2H 1O7LA 2O5RA 4KIFA 1OYWA 3FK7A 1TWFJ 3KIOA 1A6IA 4JX5A 1WH5A 4A3LJ 1U8RA 1DDNA 3GZNB 3SEQA 2XSJC 2DPUA 5HDNA 2H8WA 5B1AH 4F91B 1OKRA 1D1CA 3SXYA 4GRIA 2FMYA 3HSRA 2M30A 2HKOA 3D5SC 2RREA 3QYBA 1HBXG 4YFXF 4FETA 3U2RA 3K1MA 2A68F 1VQ5I 2JRTA 2MABA 3TW7A 2IS1A 4M9XA 2LF8A 2QSFX 2DAOA 2C6YA 3C18A 1I1GA 3AL0C 4GFBA 4KICA 3I55I 3WTYC 3ZN0A 4FHTA 4OAYA 1UFMA 3HKZN 1OCRH 5B3SH 2LNBA 3HOWJ 2WY7Q 5BPDA 3C7JA 3H92A 1T33A 2X0LA 4QTRA 3DLLF 1CQTA 4XLNF 2VL8A 3OS2A 4JX6A 4M3DA 4JOMA 3LWFA 1QQIA 3RDIA 1N77A 4J01A 3OYIA 3K4JA 2X85A 2GOXB 1ZH5A 4PFPA 3T8TA 1MNEA 1FZPB 2UV1A 4RM2A 4A3DJ 1YLFA 1AA7A 1Y39A 3NAUA 3KLOA 4BE0A 9ANTA 1OR7C 4Y17A 5FKOA 3H3UA 5JI6A 3FXRA 2PMZA 3OIQA 2VKEA 1JXSA 5CQGA 1MNDA 3ZQIA 2PFBA 5FKNA 4AWXB 3WTXC 3CCEI 4XKBA 2KDZA 3HM5A 5K5OA 5IPAA 3OWTA 4E7IA 4HA8A 3S3NA 4GYIA 4BJ5C 5A2QZ 3IL2A 2R7RA 2OTLI 5AIQA 2JSPA 1ZG1A 3QP5A 2W82A 1Y56A 3HUGB 3HTSB 4NUBA 1FY7A 3FM5A 3FHNA 3A0HC 4ZYGA 4B09A 3BROA 1TZLA 1WWXA 2QQ8A 2BW3B 2ACJA 4S04A 2K4JA 2L54A 1V55H 4KUMA 5EDNA 1BI2A 1ETOA 3HTUA 3ZMSA 3M1EA 4A5MA 1E17A 1U3EM 1KU7A 4M9ZA 1ZG5A 3D1NI 5IYBJ 3OYGA 4KIGA 3ABKH 3I4MJ 3KYCB 1I1SA 3BOQA 5F0HA 2P7CB 3S1NJ 4Y15A 1R00A 3K10A 5M5WJ 2CWEA 1K78A 2M0CA 5GP9A 5IOZA 3A1YA 4NB5A 1R6RA 3CCUI 3KLNA 4B47A 3BZKA 2QEXI 1KYWA 2IAIA 4UVCA 3G6EI 1U0JA 2V7FA 4HV5A 3W6JB 3PO2J 3MAJA 1KU3A 1FWZA 3IV5A 3I4NJ 1ZR2A 2JA8J 2Y30A 4L5JA 1VQNI 3I64A 1RRJA 1FYMA 2LY2A 1W1WE 3EUHA 2W4SA 1DU0A 1P7IA 2MG4A 1AWCA 2H6CA 4LLLA 4AVZA 3G71I 2IPQX 3S17J 5GAHJ 3OYCA 2V1NA 2NS7A 2VBZA 4BEHB 1MD0A 4KT6A 3LL7A 2ZMEC 2Q2EA 3WGGA 2DMUA 2OCEA 4ZJZA 3W2WA 4XICA 5HLHA 3K70D 1R22A 4B43A 4XN3A 4ESJA 3G1LA 4LFUA 3L00A 4UVBA 5FRNA 3EDPA 4E7JA 4A3CJ 3OS0A 4HLYA 4RB1A 4LMYA 4CH7A 5CYVA 3PFIA 1ERDA 3L2RA 2W7NA 4N4NB 4L18B 2H1LA 2ID6A 2OZ6A 1WI9A 4RAYA 2K3FA 2MW8A 2NNNA 4QPQA 3BZ6A 2ICWG 1Z9CA 2XPWA 2UXNA 2P7VB 3OSGA 4U0WA 2HOEA 2F4OB 1XS9A 4BL0B 2RNJA 5EG0A 2XB0X 4IO9F 3CQZJ 2QKLB 1QA6A 1T0FA 3GUDA 4LGWA 1WJCA 4R8HA 3UR3C 2KKOA 4XOTA 1MMGA 1ZTRA 2MGQA 2X9DA 2HKXA 2J5OA 4XKWA 4B1RA 2STTA 1TLHB 1FP2A 1YTYA 1I39A 2CUJA 1YS6A 3IAM2 2G7HA 1D8KA 3C2HA 1MBGA 3WHBA 2K02A 3ABMH 3FXLA 2IGMA 4BH9A 4PJMA 3GWZA 4M6YA 3E5XA 4ZYDA 2R7VA 4D5CA 3GO5A 3CUQC 2GM4A 3NRVA 2E2HJ 4DYQA 3MCZA 1R1UA 1UZCA 3BZCA 5E1ZB 3OYLA 1LFUP 1SFXA 3HC7A 2Y69H 4I0BA 1VQLI 1IJWC 2NVYJ 2GIVA 3KETA 2DFHA 2OF7A 1BR2A 1MMNA 4RLQA 3CMEI 3CJRB 1VNDA 5L3DA 2BV6A 1FYLA 3I4PA 5D5XB 5ICGA 4KDPA 1QVUA 1RZ4A 3P5JA 4UUSA 2XVCA 3J81Z 2X6YA 3S2HJ 2WB1N 4HOBA 1MNMC 3HOTA 1YRNB 4IHTA 2VBYA 4IRIA 2LSOA 4OIPF 4LITA 3I53A 1ULYA 5ERIA 5LRRA 1XG1A 5JFRA 4IXAA 1CF7A 1YJ9I 3D0SA 4RGRA 4W1UA 5F1JA 3C3WA 3KZZA 4IHWA 4A93J 4C2TA 2EV0A 2QCOA 4XL9A 2NVQJ 2RNGA 4S0HB 3J80K 1W4MA 1G3YA 3GFLA 4R1HA 3Q5FA 4MGRA 1OISA 1PP8F 1U6GA 1QHGA 2O8KA 1AKHB 2OJED 3KP2A 4IRGA 3OOPA 3TKYA 3SEZA 2BOLA 3ABUA 3FXKA 4JX4A 1X19A 4BXUA 2ZXHA 2HVQA 2BZTA 1N25A 4G7ZF 2XV4S 3LA7A 2E1MB 5TISC 5L3CA 2A6EF 5BOXA 2CFOA 2ZJRF 3CDHA 2HOAA 2BVLA 2QQ9A 3SFZA 3MFKA 3RI4A 2VC1A 1L3LA 4AIKA 1Z91A 1MH4A 3ZXSA 5KVRA 1BIAA 2DOAA 1MMDA 2EQRA 5JHFA 1C0WA 1LUJB 3JCUC 3OL4A 4LD5A 5IT3A 3JTGA 5K1YA 3RKXA 5IT9Z 5DCMB 5E18F 3T0YA 2AQFA 3DKYA 1ZKGA 1XMAA 1YYVA 4I0AA 4E4HA 4RB0A 1J7KA 3T1BA 2HZTA 2DA6A 1J59A 1GLNA 3F21A 1Z05A 2LP0A 2KIMA 4MNUA 3U9GA 3S14J 3GTOJ 2OQGA 1LE8A 4R79A 4DJAA 2HYGD 4CHUA 3RSNA 4XM3A 1O4XA 1H0MA 1NK2P 5C4JJ 1ZRFA 3J7AY 2QBYB 1WFXA 5D8LB 2V1DA 1HW5A 2ELHA 2ZCWA 3N05A 3VYSB 5HS9A 2R5YB 4L9NA 3WG7H 4EM2A 2P4WA 1S9HA 3ROUA 5K5RA 5D4RA 2L9RA 4W97A 2BEOA 1RETA 5CKTA 3L1PA 3RKQA 1DU6A 2G9WA 1MJ9A 2VKHA 5LHIA 4Z6YA 1UAAA 3IWFA 1OLTA 3CF2A 2GA2A 2XASA 4EQQA 2VLAA 3HPHA 4OWRB 1R58A 1NG6A 1WKMA 2E7WA 3FISA 2P6SA 2DJNA 2OD5A 2DA5A 4MIMA 2BBYA 1R49A 1P7JA 1A36A 4PJ0C 3JTHA 4DIQA 5M5XJ 1OFCX 2R5ZB 4IQJA 1VF9A 2X6WA 3QOEA 2ZXWH 5FO5A 1LQ1A 2GXGA 1WJBA 5DDGA 2PEXA 4XSXF 4FX4A 4A3EJ 2D1HA 1RUNA 2LR8A 3FMSA 4XRFA 3H36A 1U8BA 4IHVA 2EZLA 4UUTA 4JYKA 2XGCA 2JN6A 4HSTA 3S32A 1R23A 1FIPA 2NYXA 1W7PD 1HW1A 2RAEA 4K2EA 5TGTA 3ZCOA 4RS8A 4KISA 1P9QC 4EVIA 1Z1DA 2K9QA 3CLOA 3RJPA 2CS3A 4MFEA 2BY0A 4TV7A 5EGOB 5BQTA 1Z3YA 5D8KB 2VQHA 1X1CA 3WG9A 5HDGA 2F4MB 2FX0A 2ZJPF 4WWCA 2H6BA 4D7NA 5HOOA 2FNPA 2D5VA 1J75A 3HHHA 2EFNA 2KRCA 3VPRA 4A6EA 3WTVC 2DCEA 3JSOA 3M7GA 3J7YJ 2XUBA 3K4LA 3H5AA 5L3EA 2DJIA 3I71A 2UWMA 2EWNA 4AU7A 2LK2A 4BBSJ 4FISA 1S29A 2D2WA 2L7FP 3PUFA 5H2FC 2WWYA 4CUGA 2R7UA 3OV8A 4IRHA 5F0FA 1XTAA 5BNGA 2CQXA 3GVAA 3HPGA 3BWGA 4PDKA 4YIIA 5DD8A 3K6GA 3NEUA 3G2BA 2R7OA 3RKYA 2PJRA 2WA0A 4HNUA 2L2OA 2OPTA 3KP7A 1DQUA 4H0EA 4JK1X 2IS2A 1ETKA 4MTDA 1G6NA 3U1KA 5FLVA 2EK5A 2XB5A 4ENKA 1O3RA 4YRVA 3I5UA 3Q3SA 4CZZA 1JUMA 3LA3A 1HXDA 1ZQ3P 3AL0B 1STZA 1T56A 3K9TA 2R7WA 2MC4A 1O3SA 4BNCA 2UUZA 1ODDA 5GPCA 4RLFA 2A69F 4C3IJ 4FX0A 2YS9A 5E3OA 4EGZA 1SMYF 1UCRA 2EB7A 2FRHA 3EPZA 1S8NA 1YS7A 5K7ZA 3CCSI 2CV0A 1S7OA 3BT9A 3TQNA 2V6EA 2KLOA 4E7ZA 3OIPA 4XIDA 1DGRM 5J1UA 1DPUA 1EH8A 1OCZH 2LREA 3RZOJ 3S93A 2MH9A 2O6GE 5FGMA 3PO3J 2VJ4A 1XGMA 1BM9A 3OMYA 3CZ6A 5HLTA 1IN7A 3OSFA 2IS6A 3ZMTA 3RZDJ 1FIAA 2GWRA 4CZCA 3HBLA 2M87A 2M8GX 3IAS2 1X3UA 3RPUD 3ONQA 1FMWA 4IVNA 2ME6A 2K3PA 4PZJA 3P9CA 5AONA 4A3IJ 2VT3A 1FJLA 4XONA 2VC0A 2HQ5A 2ZXIA 2ZJQF 1K4TA 3GLXA 2BGCA 1NK3P 3TOAA 2R7XA 1P4XA 3HUGA 1ETVA 6PAXA 2K4BA 2M5WA 2BY2A 1SEUA 2BW3A 2FNAA 1A35A 2A05A 5ILVA 4C9YA 4DNCA 4BY7J 5FFZA 4YFKF 3TOBA 2CUFA 1VZ0A 4A3MJ 5FLXZ 2VXDA 3F0CA 4BQQA 1RKTA 2E7XA 2E1OA 4ZTJA 3LSIA 5LHGA 1HLVA 5DYMA 5A2QK 2WV1A 3M3YJ 2ZFWA 4P9UA 3PSIA 2M1BA 2XGDA 1IUFA 4RBOA 1MBKA 2NNYA 4X6AJ 3W2AA 2EIKH 3KEQA 2A5YB 1FX7A 1LKXA 2XF7A 3OYHA 1HKSA 4G9YA 3GTQJ 5IP6A 5K7HA 3S2DJ 1J09A 3OYAA 3O6BB 2V9PA 4PJNA 4M71A 3ZQGA 1XSXA 3GTJJ 1ZYRF 4J19A 3EUHC 3BTCA 1DPRA 1OCOH 3DPTA 2HPMA 1MJBA 4M6XA 3M8EA 1BJAA 2VPLA 2DOEA 3E5UA 4PUSA 1U5TB 4M72A 4DW6A 1TQMA 3ULQB 3JAMZ 2DMPA 3K4NA 3A03A 3CJQB 1G3WA 3COAC 2LY1A 1LDDA 2D45A 2FEZA 3GTKJ 2Q0OA 3BCAA 2E5ZA 4BEHA 4XRMA 2XAHA 1FP1D 1U78A 3PQKA 2Y9YA 4CO8A 5ICEA 5JVTA 2A6HF 2AXLA 3H9JA 2UZKA 3CCMI 1TWGJ 5B5EC 2E60A 1BW6A 3H3ZA 4NC8A 5EEHA 2CW0F 4IX7A 1Z21A 4C3HJ 3W6KB 5HODA 4UY8I 3Q9VA 3FKJA 2L0KA 1MKMA 2VQLA 3WTUC 5J4YA 3L2UA 4KNYA 1QGPA 1P6RA 3DKXA 5J6XA 2E1CA 1SD7A 4IZZA 1W5TA 4HW0A 4HZFA 1PUEE 1AHDP 3JR9A 1JTXA 1KZHA 3PSFA 2GXBA 2D1VA 4CSWA 4L5IA 2XAQA 3VWBA 2N8GA 1T0FC 4M9SA 2R4GA 4LK0F 1B72B 1TT5B 1VQOI 5EZHA 4WK8F 1IO2A 2EH3A 4XLCA 1TL8A 1LJ9A 4PJJA 1E0EA 4F7ZA 2AS5F 2V6CA 4HF0A 4HYEA 3CLQA 3F3XA 1U9NA 2JUGA 2I5UA 1HQCA 3MZYA 3DTKA 1JJ6C 2LY9A 3LSJA 3HOXJ 3IHUA 3HOZJ 1L0OC 4U7BA 4D1QA 1IUYA 2VE8A 2WBMA 3CUQB 3HRTA 3WU1B 2CW7A 3QPSA 2XSDC 2PQ8A 2QGUA 2VPRA 4EV0A 4YIFA 2V26A 2LRDA 4U88A 5CQEA 4L9TA 3CCJI 1FBSA 1XDSA 3A4CA 4BQNA 4M3EA 4G7HF 3FKIJ 2H94A 2LLKA 3I59B 4IHYA 3CDLA 1D5VA 4RB3C 5K7FA 3JRFA 2K5CA 3MKLA 2M8EA 2RV8A 3ZQHA 4HNVA 3ZQLA 5FKMA 3CJNA 1WRJA 2R7ZJ 1VTNC 2DFFA 2IGKA 1SAXA 4F55A 4YIRX 2CO5A 3BJAA 3D5RC 3R0AA 3HGGA 2ME0A 5M3FJ 1ONVA 3OYFA 1D1AA 2F4IA 3RKWA 4CYDA 2XC7A 4HPQA 3DPLC 1W0TA 3EYIA 2FF4A 1YRNA 2KDOA 1POGA 2LKPA 2KZGA 1MZBA 4YFNF 4A3BJ 4ANJA 1X4PA 1SMTA 2OBPA 5AIPA 3JSPA 1ZRDA 2EA4A 1FTTA 3CCYA 4P1WA 4XN0A 4UB6C 2KJBA 3QODA 3IUOA 1V3FA 2JVGA 4ETSA 1W5SA 3VFZA 4CA0A 1IV8A 5HLIA
chains in the Genus database with same CATH topology
3J81K 4CDGA 4ASNA 4HX8A 3KP3A 1XSDA 4EM0B 2EV6A 2DI3A 2B0LA 1TW2A 3QU3A 1JE8A 4N9IA 3V8LA 5DUIA 5H6QA 3G3ZA 1QNTA 2X4HA 4WF2A 4O5VA 4ENJA 1ZLJA 2ZO4A 3E97A 1S7AA 3LQQA 3C1DA 3QAHA 5DCMA 2F2EA 4A0YA 2GAUA 3V7CA 3BPVA 5LEJA 1H9TA 3V7RA 1E2XA 1QZYA 3RYPA 5D5VB 2FBHA 1H9GA 4I01A 5JR3A 3TDUC 2RC4A 2JPCA 4L0ZB 5HLGA 3DXJF 5E1XA 3E6CC 1IRFA 3VODA 2W24A 2CG4A 5ILSA 3QOPA 1T6SA 2ZNYA 4BHPA 3HSFA 1QPMA 3S2WA 2EFOA 1KGSA 4I2OA 2MD5A 5L3FA 3LAJA 2NS0A 2L4AA 2V9VA 2L02A 3ZP5A 1OYIA 4QWQA 1TNSA 2EFQA 4RAZA 4A12A 1HKQA 4CXFA 1PDNC 3CTAA 3MZHA 2P8TA 1BC8C 2DBBA 3WODF 1FYKA 4AD9A 3HHGA 2DTRA 2CFXA 4N0BA 3T5XA 1KQ8A 1BI0A 1OYYA 3IC7A 3WTWC 4P55A 2PLYA 2K27A 5DD4A 3E3VA 5LLQA 2EV5A 4XLPF 3F72A 4G94A 1Y0UA 4KN4X 1IAWA 3FXQA 3KEOA 1OPCA 4MTEA 1USSA 4P96A 2VONA 4EGYA 2QQBA 4ENNA 4D0PA 3F22A 2PJPA 3P9KA 4Q48A 4I02A 5LGUA 3J7AO 5LGTA 3F8CA 2RVCA 1G3TA 2WC2A 1IZ1A 4G6DA 5HS8A 2HDCA 4KMFA 1Z6RA 3MWMA 4HDUA 5BPIA 2LDUA 2VE9A 4L0YB 1R5HA 3HRMA 3BJOA 1U2WA 2XAJA 1YG2A 4BAYA 1B1BA 4BHBA 4G6QA 3K1PA 4OIQF 2HTSA 1HSTA 2ADUA 3RPQA 2XKPA 1ZHFA 4B8XA 3WGIA 5DV5A 5CVVA 2Z33A 4IPAA 1ZN2A 1UB9A 2HFHA 5CVRA 3QU6A 5ILUA 4LG0B 2PMUA 4P5OA 1FOKA 1RUOA 1P4AA 2MA3A 5LGNA 2PG4A 3SZTA 2FE3A 1PP7U 4KT5C 5FLXK 3DP7A 1EH7A 4Z2YA 4HX7A 1AOYA 3TO9A 3KP4A 4L9JA 1EH6A 5E8GA 2KRFA 4U0YA 1U5TA 4M74A 2MLGA 2XAGA 2HTJA 2DW4A 4IHSA 2A61A 4UUVA 4MQVA 5D5WB 3SZPA 1BI1A 2WTEA 3TO7A 2ESHA 3ZPLA 2VBWA 2O61A 1YW8A 4GYGA 4OINF 1R36A 3HRUA 1YIOA 5LBQA 3F8FA 3JAMK 3E6MA 4JBAA 1MDMB 3U1DA 5L3BA 1QO0D 4HAMA 4ON0A 4LK1F 2H27A 3HYIA 5BMZA 2YPRA 1FSEA 2DK5A 2MBFA 2GZWA 2ZBKA 2P5VA 1EV7A 1FNNA 5TRDA 2VOOA 4AVPA 3M8FA 4BYYA 2XRNA 2J5PA 2L4MA 2FOKA 4EJTA 3HIFA 1LEAA 2IA2A 3EYYA 5F1RA 2KIUA 3R61A 4S05A 2EFWA 3J80Z 2FBIA 2STWA 1BN5A 4E70A 2ESNA 3I59A 3K2ZA 5FD6A 3V4GA 3IKVA 5ED4A 1CF7B 1P4WA 2XKOA 2OAZA 1FPQA 1FLIA 2F5EA 5CVUA 5DUKA 3I58A 4U7DA 3R4KA 1O3TA 1IXSB 1YFHA 3D5LA 1QZZA 2RKHA 1QBJA 4RGSA 4JQFA 3F23A 1BC7C 5D4SA 1GHCA 1USTA 2XROA 3FMQA 2YR2A 1I6XA 4LLGF 1ZREA 3TDZC 3KZYA 4KIBA 2OU2A 3FM3A 4ZZDA 4MQ9F 2IVMA 2F5FA 2Z9OA 4U0VA 1W7PB 3SHFA 2FBKA 3KCCA 2K7LA 4RGXA 3KP6A 2FSWA 2O3FA 1MJAA 1XMKA 2GA1A 3EQLF 2RQPA 4PGHA 3L2CA 4ESFA 5E20A 2P5KA 2VT2A 2QQAA 1T98A 1RIOH 3I0TA 2HQRA 2ZMEB 1SFEA 3DFGA 5DCFA 2JZYA 2OQRA 4M73A 5DEQA 3FXUA 2RDPA 4HDVA 2ZXJA 3I54A 3WTSC 1P2FA 3FX3A 3GX4X 3HSEA 5HDKA 3QP6A 4Q4ZF 1IN6A 2KIFA 2HS5A 1RI7A 3GEZA 3VOEA 3B02A 1FBUA 5KK1A 3IWZA 2IJLA 4ZYHA 3LA2A 2O03A 2KJCA 2W85A 1IRGA 4BHCA 4LB5A 3N4MA 4I09A 3FMRA 4G8XA 3FWEA 2EA2A 2DU9A 1TNTA 4WCGA 2Z5UA 2YSRA 3DF8A 3ZMVA 4ZZLA 2Z99A 3F8BA 1I27A 2Z3YA 3P9IA 2P6TA 2MH2A 4FT8A 3ZMDA 4EM1A 1HKTA 2V79A 3VEPA 3REOA 3BPXA 3ZMUA 3HRSA 3M9AA 2QM3A 1B9MA 1SD6A 5CLSA 2RN7A 4QLCU 5LHHA 1T39A 1GXQA 2DQLA 2W84A 4Y13A 5JHUA 2MC3A 1ZG3A 3ABTA 2H09A 2XGXA 4KFCA 1TW3A 2E1NA 3DKWA 4HQEA 2XHKA 1IXCA 1G3SA 2FA5A 2ZNZA 1GVJA 1FT9A 1FBQA 3IKTA 3P7NA 2R3SA 3FF5A 3WU0A 1ZLKA 2R7DA 3F6VA 2VOPA 1IF1A 5E17F 2JPBA 5D6FA 3CUOA 1KYZA 3E6DA 2LF7A 1JHHA 1JGSA 3DEUA 1R1TA 4CGZA 1R5GA 2DK8A 4O3MA 1ZGJA 5H20A 3MQ0A 5IT9K 2JT1A 2VODA 2VN2A 2QBYA 4NHJA 4LG0A 3BP8A 4O6JA 1V4RA 1HSJA 2FMLA 1XSVA 4HF1A 1BOAA 3GZ6A 1TQIA 1P92A 4XBFA 1O57A 4GO1A 4IF4A 4EJOA 4GXOA 1U5TC 2CGPA 1DP7P 2DQRA 1XDUA 4UHTA 1O3QA 4HLXA 4PCQA 3K69A 5L3GA 2QWWA 4HBLA 2CYYA 2XIGA 4Q5SF 4HX4A 2GQQA 3WTZA 3NQOA 5LRSA 2EFPA 1WQ2A 1LDJA 4N9HA 4XSZF 3IRQA 2O8XA 4WXDA 2JSCA 3GW2A 3KP5A 3TGNA 4GGGA 2A07F 3RIRA 4OIRF 2HR3A 1MDMA 1XD7A 3ISPA 1J9IA 4OOIA 4KA4A 1YO5C 1YW7A 5ICCA 1KQ9A 4ENMA 1BIBA 3KFWX 4A6DA 2QZ8A 3WE3A 3ZMZA 1SD4A 4KN7X 3ZN1A 3LFKA 2L01A 2L3DA 3JW4A 3GYHX 2CSOA 2CQKA 1SFUA 4ZH4F 3KE2A 2IA0A 4EJUA 3K1NA 4L9VA 1R7JA 5ICFA 4OMYA 1S3JA 2IT0A 4RB2C 4A5NA 1KQ0A 2OZUA 3L7WA 3WE2A 2QYOA 3R0JA 2PBIA 3ERED 1F1ZA 1Z7UA 1T38A 1O7FA 1RNLA 1OR7A 4EJVA 4GCVA 1Q1HA 4UXNA 5J8CA 1BI3A 3Q9SA 3GZ5A 1KA8A 1XGSA 3GFIA 2ZKZA 1LNWA 4OU0A 3MEXA 4ESBA 2HQNA 1Z6TA 1LDKB 1FSHA 2PMHA 4WXCA 1K78B 1IXRC 3V8JA 3TO6A 1DUXC 5LEKA 1GXPA 3HOSA 5EEGA 2W57A 2IW5A 1A04A 3SQNA 4YG2F 2BE5F 2V1XA 1D3YA 1F5TA 1W7PA 2G7UA 4HV6A 4DQ2A 1XB4A 3N97A 2BYVE 2Q8KA 4UV9A 1YQAA 3L9FA 2ETHA 5K5QA 2Y75A 5CVIA 3L09A 1IN8A 1XCVA 3O2PE 1LEBA 3K0LA 1ZAOA 4G7OF 1SD5A 2FXAA 3B73A 2IA1A 2ZMEA 4UV8A 2A3SA 1YW9A 2RGVA 1XCBA 5BS6A 4WX9A 3IRRA 1OMIA 3EETA 4UNOA 2HEOA 2DT5A 4LJZF 3ZQ7A 5E8IA 3GFMA 3RYRA 4PGGA 2QENA 5FFXA 2F5DA 1J0RA 4BQAA 1S6LA 2F5CA 5HS7A 4AIJA 4I7HA 5E1WA 2V1UA 1ZARA 3QPTA 2YX4A 3FZVA 2Y0MA 2FQ3A 4WXHA 3ELKA 1B9NA 2O0YA 2UXXA 3QPHA 1XGOA 2ZJ2A 4IJAA 1B59A 1ON1A 2DLLA 2TDXA 2WV0A 1XN7A 3O3KA 3RPUA 3AAFA 3GXOA 2Y48A 3CUQA 3CO6C 2NRAC 1MGTA 2NAZA 1B4AA 4LLNA 2ISYA 1T2KA 1KU2A 1IN5A 5F6FA 5H6RA 4I98B 1JHFA 2PI0A 2DFIA 2HWVA 2DO7A 1J5YA 4A2UA 3RTRA 1UHMA 4MHGA 2DPDA 1LVAA 2OA4A 2COMA 3F6OA 3GFJA 3GF2A 2VBXA 2YU3A 2YX7A 5HVQC 3T8RA 3R60A 5FB2A 2M45A 3ECHA 2QVOA 5FD5A 2K86A 4EMSA 1I5ZA 1F9NA 3BY6A 3FHZA 1CGPA 1TBXA 5CVJA 3BJ6A 4LB6B 1FC3A 1B6AA 4Q47A 4A0ZA 3WGHA 3PQJA 4EJWA 4NQWA 5J8FA 1KU9A 2ISZA 3DQVC 1ZRCA 2FU4A 2VXZA 2PN6A 2MLKA 4KYWA 4KMUX 5TJJA 2EJRA 2P5LC 2QLZA 1TQPA 1BBYA 3V8KA 3F8NA 1K7AA 4AIHA 1ZGAA 2W25A 3CO7C 1R1VA 4A0XA 3QRFF 3LQRA 4RGUA 3F8MA 3ECOA 1D8JA 1IW7F 1REPC 1K6OA 1UHWA 4P9FA 4MEXF 1XGNA 2HYFA 5CJ9A 4HF2A 1TTYA 3VB2A 1NHAA 2XAFA 3LSTA 3LAPA 1ON2A 4OMZA 1LB2A 4HQMA 2IP2A 3G73A 1J2XA 3E6BA 4OIOF 1G4DA 2QUFA 3BDDA 1K79A 2IRFG 4CICA 3R6SA 3V7SA 1F4KA 5D5UB 4MEYF 1WSUA 5F64A 4UVAA 2JTVA 1IN4A 2HGCA 3E5QA 3WTTC 1HW2A 3ML6A 5D6EA 4ZYEA 3DV8A 2R7FA 1O7LA 4KIFA 1OYWA 1U8RA 1DDNA 2DPUA 5HDNA 1OKRA 3SXYA 2FMYA 3HSRA 2M30A 2HKOA 1HBXG 4YFXF 3U2RA 3K1MA 2A68F 2JRTA 4M9XA 2LF8A 2DAOA 2C6YA 3C18A 1I1GA 4KICA 3WTYC 3ZN0A 4FHTA 1UFMA 2LNBA 5BPDA 3C7JA 3H92A 2X0LA 4XLNF 3LWFA 1QQIA 3RDIA 1ZH5A 3T8TA 1FZPB 1YLFA 3KLOA 4Y17A 3H3UA 5JI6A 3FXRA 1JXSA 2PFBA 4AWXB 3WTXC 5K5OA 4HA8A 4GYIA 5A2QZ 3IL2A 5AIQA 1ZG1A 3QP5A 3HTSB 1FY7A 3FM5A 4ZYGA 4B09A 3BROA 1WWXA 2ACJA 4S04A 2K4JA 2L54A 4KUMA 1BI2A 3HTUA 3ZMSA 3M1EA 4A5MA 1E17A 1U3EM 1KU7A 4M9ZA 1ZG5A 4KIGA 1I1SA 3BOQA 2P7CB 4Y15A 1R00A 2CWEA 1K78A 4NB5A 3KLNA 1KYWA 4UVCA 4HV5A 3W6JB 3MAJA 1KU3A 1FWZA 4L5JA 3I64A 1FYMA 3EUHA 1AWCA 2H6CA 4LLLA 2IPQX 2VBZA 1MD0A 2Q2EA 3WGGA 5HLHA 1R22A 4ESJA 4LFUA 3L00A 4UVBA 3EDPA 4HLYA 4RB1A 4LMYA 5CYVA 3PFIA 4L18B 2OZ6A 1WI9A 4RAYA 2NNNA 3BZ6A 1Z9CA 2UXNA 2P7VB 4U0WA 2HOEA 2RNJA 1T0FA 3GUDA 4LGWA 4R8HA 2KKOA 2HKXA 2J5OA 2STTA 1TLHB 1FP2A 1YTYA 1YS6A 2G7HA 1D8KA 2K02A 4BH9A 3GWZA 4ZYDA 4M6YA 3E5XA 3GO5A 3CUQC 3NRVA 3MCZA 1R1UA 5E1ZB 1SFXA 4I0BA 2GIVA 3KETA 1FYLA 5L3DA 2BV6A 3I4PA 5D5XB 5ICGA 4KDPA 1RZ4A 2XVCA 3J81Z 4HOBA 3HOTA 4IHTA 2VBYA 4IRIA 2LSOA 4OIPF 3I53A 1ULYA 5ERIA 5LRRA 5JFRA 4IXAA 1CF7A 3D0SA 4RGRA 3C3WA 3KZZA 2EV0A 3J80K 1W4MA 1G3YA 3GFLA 4R1HA 3Q5FA 4MGRA 1PP8F 1U6GA 3KP2A 4IRGA 3OOPA 3TKYA 3ABUA 4BXUA 4G7ZF 2XV4S 3LA7A 5L3CA 2A6EF 5BOXA 3CDHA 2QQ9A 3SFZA 3MFKA 3RI4A 2VC1A 1L3LA 4AIKA 1Z91A 5KVRA 1BIAA 1C0WA 4LD5A 5IT3A 3JTGA 5K1YA 3RKXA 5IT9Z 5DCMB 5E18F 3T0YA 1XMAA 1YYVA 4I0AA 4RB0A 1J7KA 3T1BA 2HZTA 1J59A 3F21A 1Z05A 2KIMA 4MNUA 3U9GA 2OQGA 4R79A 2HYGD 4CHUA 1H0MA 1ZRFA 2QBYB 5D8LB 2V1DA 1HW5A 2ELHA 2ZCWA 5HS9A 4L9NA 4EM2A 2P4WA 3ROUA 5K5RA 5D4RA 2BEOA 2G9WA 1MJ9A 5LHIA 3IWFA 2GA2A 2XASA 4EQQA 1R58A 1WKMA 2E7WA 2P6SA 2OD5A 2BBYA 3JTHA 5FO5A 1LQ1A 2GXGA 4FX4A 5DDGA 2PEXA 4XSXF 2D1HA 1RUNA 4XRFA 3FMSA 1R23A 2NYXA 1W7PD 1HW1A 4K2EA 4RS8A 4EVIA 1Z1DA 3CLOA 3RJPA 4TV7A 5BQTA 5D8KB 3WG9A 5HDGA 4WWCA 2H6BA 5HOOA 2FNPA 1J75A 3HHHA 2EFNA 4A6EA 3WTVC 3JSOA 3M7GA 2XUBA 5L3EA 3I71A 2UWMA 2EWNA 1S29A 2D2WA 2WWYA 3OV8A 4IRHA 3GVAA 3BWGA 4PDKA 4YIIA 5DD8A 3NEUA 3RKYA 3KP7A 4H0EA 4JK1X 4MTDA 1G6NA 2EK5A 4ENKA 1O3RA 3I5UA 4CZZA 3LA3A 1HXDA 1STZA 3K9TA 1O3SA 4BNCA 1ODDA 2A69F 4FX0A 4EGZA 1SMYF 1UCRA 2EB7A 2FRHA 1S8NA 1YS7A 1S7OA 3TQNA 1DPUA 1EH8A 2MH9A 2O6GE 5FGMA 1XGMA 1BM9A 1IN7A 3ZMTA 2GWRA 2M87A 1X3UA 4IVNA 4PZJA 3P9CA 5AONA 2VT3A 2VC0A 3GLXA 2BGCA 3TOAA 1P4XA 3HUGA 6PAXA 2K4BA 2M5WA 2FNAA 5ILVA 4DNCA 5FFZA 4YFKF 3TOBA 5FLXZ 2E7XA 5LHGA 5DYMA 5A2QK 4P9UA 2ZFWA 2M1BA 2NNYA 3KEQA 2A5YB 1FX7A 1HKSA 4G9YA 3O6BB 4M71A 1XSXA 1ZYRF 1DPRA 3DPTA 1MJBA 4M6XA 3M8EA 1BJAA 3E5UA 1U5TB 4M72A 1TQMA 3ULQB 3JAMZ 1G3WA 3COAC 1LDDA 2D45A 2FEZA 2Q0OA 2XAHA 1FP1D 1U78A 3PQKA 4CO8A 5ICEA 5JVTA 2A6HF 2AXLA 2UZKA 3H3ZA 5EEHA 2CW0F 3W6KB 3Q9VA 1MKMA 3WTUC 4KNYA 1QGPA 1P6RA 5J6XA 2E1CA 1SD7A 1W5TA 4HW0A 4HZFA 1PUEE 2GXBA 2D1VA 4L5IA 2XAQA 4M9SA 4LK0F 4WK8F 1LJ9A 4F7ZA 2AS5F 2V6CA 4HF0A 4HYEA 3F3XA 1HQCA 3MZYA 3IHUA 1L0OC 4U7BA 1IUYA 2VE8A 3CUQB 3HRTA 3WU1B 2PQ8A 4EV0A 4YIFA 4U88A 4L9TA 1FBSA 1XDSA 4G7HF 1D5VA 2H94A 3I59B 4RB3C 2M8EA 2RV8A 3CJNA 1WRJA 1VTNC 1SAXA 2CO5A 3BJAA 3R0AA 1ONVA 3RKWA 4CYDA 3DPLC 3EYIA 2FF4A 2LKPA 1MZBA 4YFNF 1SMTA 2OBPA 5AIPA 3JSPA 1ZRDA 2EA4A 2KJBA 1V3FA 4ETSA 1W5SA 3VFZA 5HLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 K;  4CDG A;  4ASN A;  4HX8 A;  3KP3 A;  1XSD A;  4EM0 B;  2EV6 A;  2DI3 A;  2B0L A;  1TW2 A;  3QU3 A;  1JE8 A;  4N9I A;  3V8L A;  5DUI A;  5H6Q A;  3G3Z A;  1QNT A;  2X4H A;  4WF2 A;  4O5V A;  4ENJ A;  1ZLJ A;  2ZO4 A;  3E97 A;  1S7A A;  3LQQ A;  3C1D A;  3QAH A;  5DCM A;  2F2E A;  4A0Y A;  2GAU A;  3V7C A;  3BPV A;  5LEJ A;  1H9T A;  3V7R A;  1E2X A;  1QZY A;  3RYP A;  5D5V B;  2FBH A;  1H9G A;  4I01 A;  5JR3 A;  3TDU C;  2RC4 A;  2JPC A;  4L0Z B;  5HLG A;  3DXJ F;  5E1X A;  3E6C C;  1IRF A;  3VOD A;  2W24 A;  2CG4 A;  5ILS A;  3QOP A;  1T6S A;  2ZNY A;  4BHP A;  3HSF A;  1QPM A;  3S2W A;  2EFO A;  1KGS A;  4I2O A;  2MD5 A;  5L3F A;  3LAJ A;  2NS0 A;  2L4A A;  2V9V A;  2L02 A;  3ZP5 A;  1OYI A;  4QWQ A;  1TNS A;  2EFQ A;  4RAZ A;  4A12 A;  1HKQ A;  4CXF A;  1PDN C;  3CTA A;  3MZH A;  2P8T A;  1BC8 C;  2DBB A;  3WOD F;  1FYK A;  4AD9 A;  3HHG A;  2DTR A;  2CFX A;  4N0B A;  3T5X A;  1KQ8 A;  1BI0 A;  1OYY A;  3IC7 A;  3WTW C;  4P55 A;  2PLY A;  2K27 A;  5DD4 A;  3E3V A;  5LLQ A;  2EV5 A;  4XLP F;  3F72 A;  4G94 A;  1Y0U A;  4KN4 X;  1IAW A;  3FXQ A;  3KEO A;  1OPC A;  4MTE A;  1USS A;  4P96 A;  2VON A;  4EGY A;  2QQB A;  4ENN A;  4D0P A;  3F22 A;  2PJP A;  3P9K A;  4Q48 A;  4I02 A;  5LGU A;  3J7A O;  5LGT A;  3F8C A;  2RVC A;  1G3T A;  2WC2 A;  1IZ1 A;  4G6D A;  5HS8 A;  2HDC A;  4KMF A;  1Z6R A;  3MWM A;  4HDU A;  5BPI A;  2LDU A;  2VE9 A;  4L0Y B;  1R5H A;  3HRM A;  3BJO A;  1U2W A;  2XAJ A;  1YG2 A;  4BAY A;  1B1B A;  4BHB A;  4G6Q A;  3K1P A;  4OIQ F;  2HTS A;  1HST A;  2ADU A;  3RPQ A;  2XKP A;  1ZHF A;  4B8X A;  3WGI A;  5DV5 A;  5CVV A;  2Z33 A;  4IPA A;  1ZN2 A;  1UB9 A;  2HFH A;  5CVR A;  3QU6 A;  5ILU A;  4LG0 B;  2PMU A;  4P5O A;  1FOK A;  1RUO A;  1P4A A;  2MA3 A;  5LGN A;  2PG4 A;  3SZT A;  2FE3 A;  1PP7 U;  4KT5 C;  5FLX K;  3DP7 A;  1EH7 A;  4Z2Y A;  4HX7 A;  1AOY A;  3TO9 A;  3KP4 A;  4L9J A;  1EH6 A;  5E8G A;  2KRF A;  4U0Y A;  1U5T A;  4M74 A;  2MLG A;  2XAG A;  2HTJ A;  2DW4 A;  4IHS A;  2A61 A;  4UUV A;  4MQV A;  5D5W B;  3SZP A;  1BI1 A;  2WTE A;  3TO7 A;  2ESH A;  3ZPL A;  2VBW A;  2O61 A;  1YW8 A;  4GYG A;  4OIN F;  1R36 A;  3HRU A;  1YIO A;  5LBQ A;  3F8F A;  3JAM K;  3E6M A;  4JBA A;  1MDM B;  3U1D A;  5L3B A;  1QO0 D;  4HAM A;  4ON0 A;  4LK1 F;  2H27 A;  3HYI A;  5BMZ A;  2YPR A;  1FSE A;  2DK5 A;  2MBF A;  2GZW A;  2ZBK A;  2P5V A;  1EV7 A;  1FNN A;  5TRD A;  2VOO A;  4AVP A;  3M8F A;  4BYY A;  2XRN A;  2J5P A;  2L4M A;  2FOK A;  4EJT A;  3HIF A;  1LEA A;  2IA2 A;  3EYY A;  5F1R A;  2KIU A;  3R61 A;  4S05 A;  2EFW A;  3J80 Z;  2FBI A;  2STW A;  1BN5 A;  4E70 A;  2ESN A;  3I59 A;  3K2Z A;  5FD6 A;  3V4G A;  3IKV A;  5ED4 A;  1CF7 B;  1P4W A;  2XKO A;  2OAZ A;  1FPQ A;  1FLI A;  2F5E A;  5CVU A;  5DUK A;  3I58 A;  4U7D A;  3R4K A;  1O3T A;  1IXS B;  1YFH A;  3D5L A;  1QZZ A;  2RKH A;  1QBJ A;  4RGS A;  4JQF A;  3F23 A;  1BC7 C;  5D4S A;  1GHC A;  1UST A;  2XRO A;  3FMQ A;  2YR2 A;  1I6X A;  4LLG F;  1ZRE A;  3TDZ C;  3KZY A;  4KIB A;  2OU2 A;  3FM3 A;  4ZZD A;  4MQ9 F;  2IVM A;  2F5F A;  2Z9O A;  4U0V A;  1W7P B;  3SHF A;  2FBK A;  3KCC A;  2K7L A;  4RGX A;  3KP6 A;  2FSW A;  2O3F A;  1MJA A;  1XMK A;  2GA1 A;  3EQL F;  2RQP A;  4PGH A;  3L2C A;  4ESF A;  5E20 A;  2P5K A;  2VT2 A;  2QQA A;  1T98 A;  1RIO H;  3I0T A;  2HQR A;  2ZME B;  1SFE A;  3DFG A;  5DCF A;  2JZY A;  2OQR A;  4M73 A;  5DEQ A;  3FXU A;  2RDP A;  4HDV A;  2ZXJ A;  3I54 A;  3WTS C;  1P2F A;  3FX3 A;  3GX4 X;  3HSE A;  5HDK A;  3QP6 A;  4Q4Z F;  1IN6 A;  2KIF A;  2HS5 A;  1RI7 A;  3GEZ A;  3VOE A;  3B02 A;  1FBU A;  5KK1 A;  3IWZ A;  2IJL A;  4ZYH A;  3LA2 A;  2O03 A;  2KJC A;  2W85 A;  1IRG A;  4BHC A;  4LB5 A;  3N4M A;  4I09 A;  3FMR A;  4G8X A;  3FWE A;  2EA2 A;  2DU9 A;  1TNT A;  4WCG A;  2Z5U A;  2YSR A;  3DF8 A;  3ZMV A;  4ZZL A;  2Z99 A;  3F8B A;  1I27 A;  2Z3Y A;  3P9I A;  2P6T A;  2MH2 A;  4FT8 A;  3ZMD A;  4EM1 A;  1HKT A;  2V79 A;  3VEP A;  3REO A;  3BPX A;  3ZMU A;  3HRS A;  3M9A A;  2QM3 A;  1B9M A;  1SD6 A;  5CLS A;  2RN7 A;  4QLC U;  5LHH A;  1T39 A;  1GXQ A;  2DQL A;  2W84 A;  4Y13 A;  5JHU A;  2MC3 A;  1ZG3 A;  3ABT A;  2H09 A;  2XGX A;  4KFC A;  1TW3 A;  2E1N A;  3DKW A;  4HQE A;  2XHK A;  1IXC A;  1G3S A;  2FA5 A;  2ZNZ A;  1GVJ A;  1FT9 A;  1FBQ A;  3IKT A;  3P7N A;  2R3S A;  3FF5 A;  3WU0 A;  1ZLK A;  2R7D A;  3F6V A;  2VOP A;  1IF1 A;  5E17 F;  2JPB A;  5D6F A;  3CUO A;  1KYZ A;  3E6D A;  2LF7 A;  1JHH A;  1JGS A;  3DEU A;  1R1T A;  4CGZ A;  1R5G A;  2DK8 A;  4O3M A;  1ZGJ A;  5H20 A;  3MQ0 A;  5IT9 K;  2JT1 A;  2VOD A;  2VN2 A;  2QBY A;  4NHJ A;  4LG0 A;  3BP8 A;  4O6J A;  1V4R A;  1HSJ A;  2FML A;  1XSV A;  4HF1 A;  1BOA A;  3GZ6 A;  1TQI A;  1P92 A;  4XBF A;  1O57 A;  4GO1 A;  4IF4 A;  4EJO A;  4GXO A;  1U5T C;  2CGP A;  1DP7 P;  2DQR A;  1XDU A;  4UHT A;  1O3Q A;  4HLX A;  4PCQ A;  3K69 A;  5L3G A;  2QWW A;  4HBL A;  2CYY A;  2XIG A;  4Q5S F;  4HX4 A;  2GQQ A;  3WTZ A;  3NQO A;  5LRS A;  2EFP A;  1WQ2 A;  1LDJ A;  4N9H A;  4XSZ F;  3IRQ A;  2O8X A;  4WXD A;  2JSC A;  3GW2 A;  3KP5 A;  3TGN A;  4GGG A;  2A07 F;  3RIR A;  4OIR F;  2HR3 A;  1MDM A;  1XD7 A;  3ISP A;  1J9I A;  4OOI A;  4KA4 A;  1YO5 C;  1YW7 A;  5ICC A;  1KQ9 A;  4ENM A;  1BIB A;  3KFW X;  4A6D A;  2QZ8 A;  3WE3 A;  3ZMZ A;  1SD4 A;  4KN7 X;  3ZN1 A;  3LFK A;  2L01 A;  2L3D A;  3JW4 A;  3GYH X;  2CSO A;  2CQK A;  1SFU A;  4ZH4 F;  3KE2 A;  2IA0 A;  4EJU A;  3K1N A;  4L9V A;  1R7J A;  5ICF A;  4OMY A;  1S3J A;  2IT0 A;  4RB2 C;  4A5N A;  1KQ0 A;  2OZU A;  3L7W A;  3WE2 A;  2QYO A;  3R0J A;  2PBI A;  3ERE D;  1F1Z A;  1Z7U A;  1T38 A;  1O7F A;  1RNL A;  1OR7 A;  4EJV A;  4GCV A;  1Q1H A;  4UXN A;  5J8C A;  1BI3 A;  3Q9S A;  3GZ5 A;  1KA8 A;  1XGS A;  3GFI A;  2ZKZ A;  1LNW A;  4OU0 A;  3MEX A;  4ESB A;  2HQN A;  1Z6T A;  1LDK B;  1FSH A;  2PMH A;  4WXC A;  1K78 B;  1IXR C;  3V8J A;  3TO6 A;  1DUX C;  5LEK A;  1GXP A;  3HOS A;  5EEG A;  2W57 A;  2IW5 A;  1A04 A;  3SQN A;  4YG2 F;  2BE5 F;  2V1X A;  1D3Y A;  1F5T A;  1W7P A;  2G7U A;  4HV6 A;  4DQ2 A;  1XB4 A;  3N97 A;  2BYV E;  2Q8K A;  4UV9 A;  1YQA A;  3L9F A;  2ETH A;  5K5Q A;  2Y75 A;  5CVI A;  3L09 A;  1IN8 A;  1XCV A;  3O2P E;  1LEB A;  3K0L A;  1ZAO A;  4G7O F;  1SD5 A;  2FXA A;  3B73 A;  2IA1 A;  2ZME A;  4UV8 A;  2A3S A;  1YW9 A;  2RGV A;  1XCB A;  5BS6 A;  4WX9 A;  3IRR A;  1OMI A;  3EET A;  4UNO A;  2HEO A;  2DT5 A;  4LJZ F;  3ZQ7 A;  5E8I A;  3GFM A;  3RYR A;  4PGG A;  2QEN A;  5FFX A;  2F5D A;  1J0R A;  4BQA A;  1S6L A;  2F5C A;  5HS7 A;  4AIJ A;  4I7H A;  5E1W A;  2V1U A;  1ZAR A;  3QPT A;  2YX4 A;  3FZV A;  2Y0M A;  2FQ3 A;  4WXH A;  3ELK A;  1B9N A;  2O0Y A;  2UXX A;  3QPH A;  1XGO A;  2ZJ2 A;  4IJA A;  1B59 A;  1ON1 A;  2DLL A;  2TDX A;  2WV0 A;  1XN7 A;  3O3K A;  3RPU A;  3AAF A;  3GXO A;  2Y48 A;  3CUQ A;  3CO6 C;  2NRA C;  1MGT A;  2NAZ A;  1B4A A;  4LLN A;  2ISY A;  1T2K A;  1KU2 A;  1IN5 A;  5F6F A;  5H6R A;  4I98 B;  1JHF A;  2PI0 A;  2DFI A;  2HWV A;  2DO7 A;  1J5Y A;  4A2U A;  3RTR A;  1UHM A;  4MHG A;  2DPD A;  1LVA A;  2OA4 A;  2COM A;  3F6O A;  3GFJ A;  3GF2 A;  2VBX A;  2YU3 A;  2YX7 A;  5HVQ C;  3T8R A;  3R60 A;  5FB2 A;  2M45 A;  3ECH A;  2QVO A;  5FD5 A;  2K86 A;  4EMS A;  1I5Z A;  1F9N A;  3BY6 A;  3FHZ A;  1CGP A;  1TBX A;  5CVJ A;  3BJ6 A;  4LB6 B;  1FC3 A;  1B6A A;  4Q47 A;  4A0Z A;  3WGH A;  3PQJ A;  4EJW A;  4NQW A;  5J8F A;  1KU9 A;  2ISZ A;  3DQV C;  1ZRC A;  2FU4 A;  2VXZ A;  2PN6 A;  2MLK A;  4KYW A;  4KMU X;  5TJJ A;  2EJR A;  2P5L C;  2QLZ A;  1TQP A;  1BBY A;  3V8K A;  3F8N A;  1K7A A;  4AIH A;  1ZGA A;  2W25 A;  3CO7 C;  1R1V A;  4A0X A;  3QRF F;  3LQR A;  4RGU A;  3F8M A;  3ECO A;  1D8J A;  1IW7 F;  1REP C;  1K6O A;  1UHW A;  4P9F A;  4MEX F;  1XGN A;  2HYF A;  5CJ9 A;  4HF2 A;  1TTY A;  3VB2 A;  1NHA A;  2XAF A;  3LST A;  3LAP A;  1ON2 A;  4OMZ A;  1LB2 A;  4HQM A;  2IP2 A;  3G73 A;  1J2X A;  3E6B A;  4OIO F;  1G4D A;  2QUF A;  3BDD A;  1K79 A;  2IRF G;  4CIC A;  3R6S A;  3V7S A;  1F4K A;  5D5U B;  4MEY F;  1WSU A;  5F64 A;  4UVA A;  2JTV A;  1IN4 A;  2HGC A;  3E5Q A;  3WTT C;  1HW2 A;  3ML6 A;  5D6E A;  4ZYE A;  3DV8 A;  2R7F A;  1O7L A;  4KIF A;  1OYW A;  1U8R A;  1DDN A;  2DPU A;  5HDN A;  1OKR A;  3SXY A;  2FMY A;  3HSR A;  2M30 A;  2HKO A;  1HBX G;  4YFX F;  3U2R A;  3K1M A;  2A68 F;  2JRT A;  4M9X A;  2LF8 A;  2DAO A;  2C6Y A;  3C18 A;  1I1G A;  4KIC A;  3WTY C;  3ZN0 A;  4FHT A;  1UFM A;  2LNB A;  5BPD A;  3C7J A;  3H92 A;  2X0L A;  4XLN F;  3LWF A;  1QQI A;  3RDI A;  1ZH5 A;  3T8T A;  1FZP B;  1YLF A;  3KLO A;  4Y17 A;  3H3U A;  5JI6 A;  3FXR A;  1JXS A;  2PFB A;  4AWX B;  3WTX C;  5K5O A;  4HA8 A;  4GYI A;  5A2Q Z;  3IL2 A;  5AIQ A;  1ZG1 A;  3QP5 A;  3HTS B;  1FY7 A;  3FM5 A;  4ZYG A;  4B09 A;  3BRO A;  1WWX A;  2ACJ A;  4S04 A;  2K4J A;  2L54 A;  4KUM A;  1BI2 A;  3HTU A;  3ZMS A;  3M1E A;  4A5M A;  1E17 A;  1U3E M;  1KU7 A;  4M9Z A;  1ZG5 A;  4KIG A;  1I1S A;  3BOQ A;  2P7C B;  4Y15 A;  1R00 A;  2CWE A;  1K78 A;  4NB5 A;  3KLN A;  1KYW A;  4UVC A;  4HV5 A;  3W6J B;  3MAJ A;  1KU3 A;  1FWZ A;  4L5J A;  3I64 A;  1FYM A;  3EUH A;  1AWC A;  2H6C A;  4LLL A;  2IPQ X;  2VBZ A;  1MD0 A;  2Q2E A;  3WGG A;  5HLH A;  1R22 A;  4ESJ A;  4LFU A;  3L00 A;  4UVB A;  3EDP A;  4HLY A;  4RB1 A;  4LMY A;  5CYV A;  3PFI A;  4L18 B;  2OZ6 A;  1WI9 A;  4RAY A;  2NNN A;  3BZ6 A;  1Z9C A;  2UXN A;  2P7V B;  4U0W A;  2HOE A;  2RNJ A;  1T0F A;  3GUD A;  4LGW A;  4R8H A;  2KKO A;  2HKX A;  2J5O A;  2STT A;  1TLH B;  1FP2 A;  1YTY A;  1YS6 A;  2G7H A;  1D8K A;  2K02 A;  4BH9 A;  3GWZ A;  4ZYD A;  4M6Y A;  3E5X A;  3GO5 A;  3CUQ C;  3NRV A;  3MCZ A;  1R1U A;  5E1Z B;  1SFX A;  4I0B A;  2GIV A;  3KET A;  1FYL A;  5L3D A;  2BV6 A;  3I4P A;  5D5X B;  5ICG A;  4KDP A;  1RZ4 A;  2XVC A;  3J81 Z;  4HOB A;  3HOT A;  4IHT A;  2VBY A;  4IRI A;  2LSO A;  4OIP F;  3I53 A;  1ULY A;  5ERI A;  5LRR A;  5JFR A;  4IXA A;  1CF7 A;  3D0S A;  4RGR A;  3C3W A;  3KZZ A;  2EV0 A;  3J80 K;  1W4M A;  1G3Y A;  3GFL A;  4R1H A;  3Q5F A;  4MGR A;  1PP8 F;  1U6G A;  3KP2 A;  4IRG A;  3OOP A;  3TKY A;  3ABU A;  4BXU A;  4G7Z F;  2XV4 S;  3LA7 A;  5L3C A;  2A6E F;  5BOX A;  3CDH A;  2QQ9 A;  3SFZ A;  3MFK A;  3RI4 A;  2VC1 A;  1L3L A;  4AIK A;  1Z91 A;  5KVR A;  1BIA A;  1C0W A;  4LD5 A;  5IT3 A;  3JTG A;  5K1Y A;  3RKX A;  5IT9 Z;  5DCM B;  5E18 F;  3T0Y A;  1XMA A;  1YYV A;  4I0A A;  4RB0 A;  1J7K A;  3T1B A;  2HZT A;  1J59 A;  3F21 A;  1Z05 A;  2KIM A;  4MNU A;  3U9G A;  2OQG A;  4R79 A;  2HYG D;  4CHU A;  1H0M A;  1ZRF A;  2QBY B;  5D8L B;  2V1D A;  1HW5 A;  2ELH A;  2ZCW A;  5HS9 A;  4L9N A;  4EM2 A;  2P4W A;  3ROU A;  5K5R A;  5D4R A;  2BEO A;  2G9W A;  1MJ9 A;  5LHI A;  3IWF A;  2GA2 A;  2XAS A;  4EQQ A;  1R58 A;  1WKM A;  2E7W A;  2P6S A;  2OD5 A;  2BBY A;  3JTH A;  5FO5 A;  1LQ1 A;  2GXG A;  4FX4 A;  5DDG A;  2PEX A;  4XSX F;  2D1H A;  1RUN A;  4XRF A;  3FMS A;  1R23 A;  2NYX A;  1W7P D;  1HW1 A;  4K2E A;  4RS8 A;  4EVI A;  1Z1D A;  3CLO A;  3RJP A;  4TV7 A;  5BQT A;  5D8K B;  3WG9 A;  5HDG A;  4WWC A;  2H6B A;  5HOO A;  2FNP A;  1J75 A;  3HHH A;  2EFN A;  4A6E A;  3WTV C;  3JSO A;  3M7G A;  2XUB A;  5L3E A;  3I71 A;  2UWM A;  2EWN A;  1S29 A;  2D2W A;  2WWY A;  3OV8 A;  4IRH A;  3GVA A;  3BWG A;  4PDK A;  4YII A;  5DD8 A;  3NEU A;  3RKY A;  3KP7 A;  4H0E A;  4JK1 X;  4MTD A;  1G6N A;  2EK5 A;  4ENK A;  1O3R A;  3I5U A;  4CZZ A;  3LA3 A;  1HXD A;  1STZ A;  3K9T A;  1O3S A;  4BNC A;  1ODD A;  2A69 F;  4FX0 A;  4EGZ A;  1SMY F;  1UCR A;  2EB7 A;  2FRH A;  1S8N A;  1YS7 A;  1S7O A;  3TQN A;  1DPU A;  1EH8 A;  2MH9 A;  2O6G E;  5FGM A;  1XGM A;  1BM9 A;  1IN7 A;  3ZMT A;  2GWR A;  2M87 A;  1X3U A;  4IVN A;  4PZJ A;  3P9C A;  5AON A;  2VT3 A;  2VC0 A;  3GLX A;  2BGC A;  3TOA A;  1P4X A;  3HUG A;  6PAX A;  2K4B A;  2M5W A;  2FNA A;  5ILV A;  4DNC A;  5FFZ A;  4YFK F;  3TOB A;  5FLX Z;  2E7X A;  5LHG A;  5DYM A;  5A2Q K;  4P9U A;  2ZFW A;  2M1B A;  2NNY A;  3KEQ A;  2A5Y B;  1FX7 A;  1HKS A;  4G9Y A;  3O6B B;  4M71 A;  1XSX A;  1ZYR F;  1DPR A;  3DPT A;  1MJB A;  4M6X A;  3M8E A;  1BJA A;  3E5U A;  1U5T B;  4M72 A;  1TQM A;  3ULQ B;  3JAM Z;  1G3W A;  3COA C;  1LDD A;  2D45 A;  2FEZ A;  2Q0O A;  2XAH A;  1FP1 D;  1U78 A;  3PQK A;  4CO8 A;  5ICE A;  5JVT A;  2A6H F;  2AXL A;  2UZK A;  3H3Z A;  5EEH A;  2CW0 F;  3W6K B;  3Q9V A;  1MKM A;  3WTU C;  4KNY A;  1QGP A;  1P6R A;  5J6X A;  2E1C A;  1SD7 A;  1W5T A;  4HW0 A;  4HZF A;  1PUE E;  2GXB A;  2D1V A;  4L5I A;  2XAQ A;  4M9S A;  4LK0 F;  4WK8 F;  1LJ9 A;  4F7Z A;  2AS5 F;  2V6C A;  4HF0 A;  4HYE A;  3F3X A;  1HQC A;  3MZY A;  3IHU A;  1L0O C;  4U7B A;  1IUY A;  2VE8 A;  3CUQ B;  3HRT A;  3WU1 B;  2PQ8 A;  4EV0 A;  4YIF A;  4U88 A;  4L9T A;  1FBS A;  1XDS A;  4G7H F;  1D5V A;  2H94 A;  3I59 B;  4RB3 C;  2M8E A;  2RV8 A;  3CJN A;  1WRJ A;  1VTN C;  1SAX A;  2CO5 A;  3BJA A;  3R0A A;  1ONV A;  3RKW A;  4CYD A;  3DPL C;  3EYI A;  2FF4 A;  2LKP A;  1MZB A;  4YFN F;  1SMT A;  2OBP A;  5AIP A;  3JSP A;  1ZRD A;  2EA4 A;  2KJB A;  1V3F A;  4ETS A;  1W5S A;  3VFZ A;  5HLI A; 
#chains in the Genus database with same CATH topology
 3DU5 A;  3J81 K;  1OCP A;  3TED A;  3C2B A;  5KAI C;  4ZDP A;  4CDG A;  4ASN A;  3WHC A;  1AKH A;  2DFE A;  2KL4 A;  4HX8 A;  3KP3 A;  1XSD A;  4EM0 B;  2EV6 A;  2DI3 A;  1WZ2 A;  2B0L A;  5DM6 F;  3H35 A;  1TW2 A;  1HDP A;  3TMO A;  3MD2 A;  3QU3 A;  1A6Q A;  5IOY A;  1JE8 A;  4N9I A;  1WGX A;  3V8L A;  5DUI A;  1WCM J;  1MW7 A;  1X4O A;  5H6Q A;  3G3Z A;  1QNT A;  2X4H A;  4X1E A;  1BJZ A;  4LG3 A;  4G12 A;  4WF2 A;  2DN0 A;  1JT0 A;  1UEL B;  4O5V A;  4ENJ A;  1ZLJ A;  2ZO4 A;  1H89 C;  5FLM J;  1MSF C;  3E97 A;  1I6H J;  1S7A A;  3HZJ A;  3K4M A;  1LVK A;  2JK3 A;  1LFP A;  3LQQ A;  3LSM A;  3C1D A;  2K85 A;  3MMY B;  3QAH A;  5C3E J;  5DCM A;  2LYC A;  2VAS A;  2F2E A;  1Z3X A;  3FXO A;  4A0Y A;  3S16 J;  2GAU A;  3V7C A;  2VUM J;  2IGN A;  4F3Q A;  3BPV A;  5LEJ A;  1H9T A;  3V7R A;  1FOW A;  4RA2 A;  1ACI A;  4E6K G;  3CCV I;  4CCK A;  1E2X A;  1QZY A;  2IEK A;  3RYP A;  2ZSI B;  5D5V B;  4V2G A;  2FBH A;  1H9G A;  4I01 A;  2P0W A;  2TCT A;  4BUP A;  3H9Q A;  3TDU C;  2RC4 A;  5JR3 A;  3SDG A;  3S15 J;  1ETW A;  1LPQ A;  2JPC A;  2ELK A;  1SFK A;  4L0Z B;  4XR6 A;  5HLG A;  5IP7 J;  3DXJ F;  5E1X A;  5FKL A;  2R5Y A;  3E6C C;  1IRF A;  3VOD A;  1TP4 A;  2CG4 A;  2W24 A;  3QQA A;  4DZP A;  5ILS A;  3QOP A;  1T6S A;  2ZNY A;  2LOO A;  1JKR C;  4BHP A;  3HSF A;  4QPO A;  1QPM A;  3S2W A;  1Q1V A;  2EFO A;  3Q0W A;  1NH3 A;  1KGS A;  4I2O A;  1Y8Q B;  2MD5 A;  4BS9 A;  5L3F A;  3LAJ A;  1V5F A;  2NS0 A;  2L4A A;  2V9V A;  2KT0 A;  2L02 A;  1A5J A;  2VJ5 A;  3OYB A;  1OYI A;  3ZP5 A;  2PMZ N;  4QWQ A;  1HDD C;  1MMS A;  2BXZ A;  1TNS A;  4UB8 C;  2EFQ A;  4RAZ A;  2HYJ A;  1WJ5 A;  4BGD A;  4BY1 J;  2CUZ A;  4A12 A;  1YIJ I;  1HKQ A;  3FK6 A;  4M3B A;  4OAZ A;  3DPU A;  4XRS A;  3SYT A;  2R5Z A;  4CXF A;  1PDN C;  3CTA A;  3MZH A;  5EYR A;  3M8J A;  2P8T A;  4NC7 A;  4XKC A;  4DBQ A;  1BC8 C;  2DBB A;  1R5I D;  3UNG C;  3WOD F;  4F92 B;  1FYK A;  1R4N B;  4AD9 A;  1ZR4 A;  3HHG A;  2DTR A;  1Y8R B;  2CFX A;  3IP4 B;  2KIQ A;  4N0B A;  2OCC H;  3T5X A;  1KQ8 A;  1BI0 A;  4Y3O A;  3JRA A;  4RMN A;  1W0U A;  2VKD A;  5EGO A;  1OYY A;  3IC7 A;  3K7A J;  3LSP A;  3WTW C;  2K9N A;  1UG2 A;  4P55 A;  2PLY A;  2K27 A;  5DD4 A;  1X1B A;  2L7Z A;  3E3V A;  5LLQ A;  1GV5 A;  2EV5 A;  4FE7 A;  2VB6 A;  3F72 A;  4G94 A;  4XLP F;  1WI3 A;  3GTM J;  1Y0U A;  1VQ7 I;  4KN4 X;  1IAW A;  2HDW A;  1WHU A;  3DTI A;  4DOZ A;  3S8P A;  1ZEL A;  2DA3 A;  4CCJ A;  4XMY A;  3OR2 C;  2NVX J;  3FXQ A;  3KEO A;  1OPC A;  2QSG X;  2EZH A;  2I8D A;  4MTE A;  1USS A;  4P96 A;  1VFC A;  2VON A;  1ORK A;  3VYR B;  3V42 A;  3BG7 A;  4EGY A;  2QQB A;  1Z0X A;  4ENN A;  3HG9 A;  4D0P A;  3F22 A;  2PJP A;  3P9K A;  4Q48 A;  1Y1V J;  2DT7 B;  3KX2 A;  4KJZ A;  4I02 A;  5LGU A;  3J7A O;  5LGT A;  3FXM A;  3B6A A;  5EJC A;  3F8C A;  4XKV A;  5HNH A;  2RVC A;  1G3T A;  2WC2 A;  1IZ1 A;  4LIV A;  2CQN A;  4G6D A;  5HS8 A;  2CJJ A;  3I9V 2;  3KYD B;  1R9T J;  3CC4 I;  2QSH X;  5CPR B;  2IBD A;  2HDC A;  4KMF A;  1Z6R A;  4B48 A;  3MWM A;  1SVL A;  3JRI A;  4HDU A;  5BPI A;  2LDU A;  3O8G A;  2VE9 A;  1X3W B;  1IC8 A;  3OOU A;  1RPW A;  4L0Y B;  1R5H A;  3PNT A;  5M5Y J;  3HRM A;  3OS1 A;  2XPU A;  3BJO A;  1WJF A;  2E2J J;  1U2W A;  4BU2 A;  3VSL A;  3UKG A;  3SJM A;  2XAJ A;  1YG2 A;  4BAY A;  1X3Z B;  1B1B A;  2QKM B;  5FKK A;  1XC5 A;  4BHB A;  3HOU J;  2JRM A;  1UMQ A;  4G6Q A;  1OJL A;  1I3Q J;  3CCR I;  2E36 A;  2DA2 A;  3K1P A;  4OIQ F;  5LD2 C;  2KHM A;  2HTS A;  1HST A;  5E79 C;  2K9M A;  2ADU A;  3RPQ A;  2XKP A;  1ZHF A;  4B8X A;  3VYU B;  2WAQ A;  3HEF A;  5DV5 A;  3WGI A;  5CVV A;  2Z33 A;  2WAF A;  4IPA A;  5GTH C;  1F43 A;  1ZN2 A;  1UB9 A;  2O7O A;  4HEA 2;  2HFH A;  4B3A A;  5CVR A;  3QU6 A;  4HNT A;  3JRB A;  5ILU A;  2Y2Z A;  4LG0 B;  2PMU A;  4P5O A;  1GDT A;  1FOK A;  1RUO A;  5EEA A;  1R71 A;  1P4A A;  5FJ8 J;  2MA3 A;  3JRD A;  3QPL A;  5LGN A;  2PG4 A;  1X2M A;  2AHQ A;  2F6C A;  5F08 A;  2FJ1 A;  3SZT A;  1TC3 C;  2FE3 A;  3FBN B;  1PP7 U;  2LMD A;  3W2V A;  4E7S A;  4KT5 C;  5FLX K;  3DP7 A;  1EH7 A;  2EZI A;  4Z2Y A;  4HX7 A;  1AOY A;  3TO9 A;  3KP4 A;  4L9J A;  1EH6 A;  5E8G A;  2KRF A;  4U0Y A;  1U5T A;  4M74 A;  2MLG A;  2XAG A;  2HTJ A;  2DW4 A;  4D7M A;  4IHS A;  2A61 A;  1D5Y A;  4UUV A;  3CF5 F;  4MQV A;  3HGY A;  1MMA A;  3ASN H;  3F9K A;  3BQY A;  1BI1 A;  2WTE A;  3SZP A;  5D5W B;  3TO7 A;  2ESH A;  3ZPL A;  4GDF A;  2W1O A;  2KZV A;  1WJA A;  5F27 A;  2VBW A;  2O61 A;  2DA4 A;  2Z2S B;  1YW8 A;  3NAR A;  2LVS A;  4GYG A;  4OIN F;  5GAG J;  2EZK A;  1Y6I A;  1R36 A;  1IGN A;  3HRU A;  2BXY A;  1YIO A;  4ITV A;  5LBQ A;  3F8F A;  2Z16 A;  2HVR A;  3JAM K;  5EF6 A;  3E6M A;  2CMP A;  4JBA A;  1MDM B;  1YJW I;  2JUC A;  4MLO A;  4CYC B;  3U1D A;  5L3B A;  1QO0 D;  3PNY A;  4HAM A;  4ON0 A;  3K4K A;  5GTI C;  4LK1 F;  3K2A A;  2H27 A;  1Z7L A;  3HYI A;  5BMZ A;  2HDD A;  1VQ8 I;  2YPR A;  3QYF A;  4MFD A;  1W36 C;  1FSE A;  2DK5 A;  3MZ8 A;  3CES A;  4XLE A;  1HC8 A;  2MBF A;  2DT6 A;  2GZW A;  4AYB A;  1B72 A;  2ZBK A;  3BCB A;  2P5V A;  5F04 A;  3DLA A;  1EV7 A;  1EF4 A;  3BLY A;  1FNN A;  5TRD A;  3BR5 A;  1BR1 A;  4IL6 C;  4AVP A;  2VOO A;  3M8F A;  1B8I B;  3CC7 I;  4BYY A;  3KZI C;  2XRN A;  1T08 B;  2CQQ A;  2J5P A;  2L4M A;  4C2M J;  3ABL H;  2FOK A;  2EIJ H;  2GBY A;  3HIF A;  1SFO J;  4EJT A;  4ZC3 A;  1E3H A;  1LEA A;  2IA2 A;  3EYY A;  5F1R A;  4BXF A;  1YE9 A;  2KIU A;  3R61 A;  2HXO A;  4ZDL A;  3M1C A;  1G2H A;  4D9J A;  3VSK A;  4S05 A;  2EFW A;  2ELJ A;  3HOY J;  4L5E A;  3J80 Z;  1GUU A;  2FBI A;  1MBJ A;  3FXJ A;  1BN5 A;  4E70 A;  4X0G A;  3A01 B;  2STW A;  1VQ4 I;  2FUG 2;  2ESN A;  3CCL I;  3I59 A;  3K2Z A;  5FD6 A;  3V4G A;  3IKV A;  2VQG A;  1GT0 C;  1UHS A;  5ED4 A;  1VQK I;  4DYC A;  1CF7 B;  1P4W A;  5J1R A;  2XKO A;  2OAZ A;  1FPQ A;  2E2I J;  4V2F A;  2M7A A;  3LMM A;  1FLI A;  2F5E A;  2CRG A;  2XDV A;  5CVU A;  4CCL A;  1TT0 A;  3A0B C;  2MSY A;  5DUK A;  3MKZ A;  2ZFU A;  3I58 A;  2LBF B;  4U7D A;  2VIX A;  3R4K A;  3S3O A;  1O3T A;  4ZYA A;  2KMU A;  1IXS B;  4F52 A;  1HCR A;  3GME A;  1YFH A;  1R4M B;  3D5L A;  4II3 A;  2Y0S A;  1QZZ A;  2RKH A;  1QBJ A;  4RGS A;  4JQF A;  3F23 A;  1BC7 C;  2BHY A;  5D4S A;  1GHC A;  1UST A;  2XRO A;  2XPV A;  3FMQ A;  2LTP A;  2YR2 A;  1I6X A;  2IGO A;  3B6C A;  3TP3 A;  4ABZ A;  5J40 A;  4LLG F;  1ZRE A;  1UJ8 A;  3TDZ C;  2OV7 A;  3KZY A;  4A3K J;  4KIB A;  3LOC A;  2OU2 A;  4PSX A;  2ECB A;  2FQ4 A;  1HOM A;  3FM3 A;  4ZZD A;  4MQ9 F;  2ECC A;  2IVM A;  2F5F A;  2CUE A;  1V5E A;  2Z9O A;  4U0V A;  1I3A A;  2P81 A;  1W7P B;  2FBK A;  3SHF A;  1X58 A;  3EUA A;  2K7L A;  3KCC A;  3OYD A;  4RGX A;  2L9V A;  3KP6 A;  2FSW A;  4RDU A;  2O3F A;  1MJA A;  1XMK A;  2GA1 A;  3EQL F;  4IEJ A;  4MO7 A;  3OR1 C;  2HNH A;  2RQP A;  4PGH A;  3L2C A;  4ESF A;  3OYM A;  5F0C A;  1ZK8 A;  5E20 A;  2P5K A;  2VT2 A;  2QQA A;  1T98 A;  3M07 A;  1RIO H;  2DDA A;  3HOV J;  3I0T A;  3GBG A;  3ERM A;  2HQR A;  4RAF A;  1ETX A;  2ZME B;  3SZG A;  1SFE A;  3DFG A;  5DCF A;  2JZY A;  4B3X A;  2M2E A;  3HKZ A;  2HQA A;  5JLX A;  2OQR A;  2DMT A;  3ZR8 X;  4M73 A;  1D1B A;  5DEQ A;  3BG3 A;  3FXU A;  1KON A;  2RDP A;  4XLA A;  4HDV A;  4XK4 A;  3OIO A;  2ZXJ A;  2DA7 A;  3I54 A;  3WTS C;  1WPK A;  5FRO A;  1P2F A;  3FX3 A;  3G1M A;  2GXA A;  3PM1 A;  3GX4 X;  1FOX A;  2VI6 A;  3HSE A;  1YI2 I;  2X1E A;  5HDK A;  2MD0 A;  4Y33 A;  2MFZ A;  2M7B A;  3QP6 A;  4Q4Z F;  1IN6 A;  1PYV A;  4II2 A;  2KIF A;  2HS5 A;  1RI7 A;  2EBI A;  3ZOB A;  1YX5 A;  5B66 C;  3GEZ A;  2KP6 A;  3VOE A;  4HRI A;  3BTL A;  3KEY A;  1BL0 A;  3BTJ A;  3B02 A;  2W48 A;  1FBU A;  5KK1 A;  2JMW A;  3IWZ A;  1SVO A;  2IJL A;  3AG4 H;  3W6V A;  2B9S A;  4ZYH A;  3LA2 A;  1XMX A;  2O03 A;  2KJC A;  2W85 A;  1IRG A;  4BHC A;  3LSK A;  3N4M A;  4LB5 A;  4LIU A;  4BJT A;  4I09 A;  3FMR A;  1E3O C;  2HZD A;  4G8X A;  3FWE A;  3Q0U A;  2EA2 A;  2DU9 A;  4QSH A;  1QRY A;  1TNT A;  2COB A;  3C2G A;  4WCG A;  1JUS A;  4XLF A;  2MYS A;  3W3C A;  4YEL A;  2JA6 J;  1MBE A;  2YSR A;  2Z5U A;  3DF8 A;  2PJR B;  5KCM A;  3ZMV A;  4IHX A;  4ZZL A;  2Z99 A;  3F8B A;  3AG3 H;  1I27 A;  2Z3Y A;  3P9I A;  3OYK A;  1JJ8 C;  4M6V A;  3LFU A;  2P6T A;  2ZB9 A;  3E1S A;  2H1K A;  2MH2 A;  4FT8 A;  4IOA F;  1SC7 A;  3ZMD A;  4EM1 A;  1HKT A;  2V79 A;  3VEP A;  3REO A;  3BPX A;  5E3L A;  4B44 A;  2DYR H;  3ZMU A;  3PIO F;  3LSR A;  3HRS A;  1IV6 A;  3CCQ I;  3DEW A;  1YIT I;  1W5C C;  3M9A A;  2EPF A;  1B9M A;  2QM3 A;  1JKO C;  2CW8 A;  1SD6 A;  1QU3 A;  1Z67 A;  5CLS A;  5DM7 F;  3OYN A;  2RN7 A;  4QLC U;  5LHH A;  5E3M A;  1T39 A;  1GXQ A;  2DQL A;  2W84 A;  5GAE J;  1JKQ C;  3A02 A;  3CMY A;  4Y13 A;  5JHU A;  1W36 D;  2E34 A;  2MC3 A;  1ZG3 A;  3CD6 I;  3JRH A;  1WJE A;  3ABT A;  2H09 A;  2XGX A;  4KFC A;  1GVD A;  1TW3 A;  2E1N A;  4XNF A;  1BA5 A;  3DKW A;  1I50 J;  4HQE A;  2XHK A;  1IXC A;  5JVG F;  1G3S A;  2FA5 A;  3TL4 X;  4NQW B;  2HOT A;  3NWT A;  2CU7 A;  2ZNZ A;  1UG0 A;  1GVJ A;  1A31 A;  1GV2 A;  2K40 A;  2OUM A;  1FT9 A;  1FBQ A;  3CMA I;  1JTY A;  2G0E A;  3IKT A;  3P7N A;  2R3S A;  3FF5 A;  4XLH A;  3WU0 A;  3PIP F;  1ZLK A;  1K6Y A;  1IRX A;  2R7D A;  3F6V A;  5J47 A;  2VOP A;  3I56 I;  2HVS A;  1IF1 A;  3OL3 A;  5DS9 A;  5E17 F;  2JPB A;  1RC9 A;  5LFA A;  3KPH A;  5D6F A;  4RM3 A;  4I76 A;  2CV1 A;  3CUO A;  2OC6 A;  2CV2 A;  2B63 J;  4XOP A;  1KYZ A;  3WU2 C;  3EUK L;  3E6D A;  2LF7 A;  1JHH A;  1FOY A;  3RQI A;  3HJE A;  1JGS A;  3DEU A;  3PUB A;  1R1T A;  4CGZ A;  1R5G A;  2DK8 A;  3IH3 A;  3HB9 A;  2NOJ B;  4O3M A;  1QHH D;  3H3V K;  2M4K A;  1ZGJ A;  5H20 A;  3TW6 A;  3MQ0 A;  2DOF A;  1Z77 A;  2HU9 A;  1ZGW A;  5IT9 K;  3BR1 A;  2JT1 A;  2VJI A;  3FBI B;  2VOD A;  5KAF C;  2VN2 A;  2QBY A;  4NHJ A;  4LG0 A;  3BP8 A;  4O6J A;  1VQM I;  4QIW N;  3Q0V A;  1WH7 A;  1QZE A;  4FTH A;  1V4R A;  1HSJ A;  2HPI A;  4BKX A;  2FML A;  2ZC2 A;  1XSV A;  3RCO A;  4DZJ A;  4HF1 A;  1BOA A;  3BG6 A;  2L7K A;  3GZ6 A;  2LKX A;  1TQI A;  1P92 A;  4XBF A;  3TBI A;  5C4X J;  1O57 A;  4GO1 A;  2DMQ A;  2WB1 A;  4IF4 A;  4DBR A;  2VQC A;  5FRM A;  4PSW A;  2NXN B;  4EJO A;  4GXO A;  1U5T C;  2E19 A;  2CGP A;  1DP7 P;  2DQR A;  1IG7 A;  1XDU A;  4UHT A;  4BDZ A;  1O3Q A;  4HLX A;  4PCQ A;  3M4O J;  4BAC A;  3K69 A;  1IDY A;  5L3G A;  2QWW A;  4HBL A;  2A6T A;  4H4K C;  2CYY A;  3MVP A;  2XIG A;  1YHQ I;  2KPM A;  4Q5S F;  4HX4 A;  3CP8 A;  2GQQ A;  3WTZ A;  1PUF B;  3NQO A;  5LRS A;  1RR7 A;  1S5L C;  1WQ2 A;  1ENH A;  2EFP A;  4XRS G;  1LDJ A;  4N9H A;  4XSZ F;  3IRQ A;  2O8X A;  2Y31 A;  4WXD A;  1PJR A;  2LFB A;  2JSC A;  3GW2 A;  3KP5 A;  3TGN A;  4GGG A;  2IXS A;  2A07 F;  3I3L A;  2PX9 A;  1RR8 C;  3RIR A;  4OIR F;  2HR3 A;  1MDM A;  4CYC A;  1XD7 A;  3ISP A;  3QWL A;  1J9I A;  4OOI A;  2O9L A;  2WAD A;  4KA4 A;  1YO5 C;  1YW7 A;  4HSR A;  3ZRG A;  5ICC A;  2Y9Z A;  3H0D A;  5J4V A;  1KQ9 A;  4ENM A;  1BIB A;  4HG2 A;  2M3A A;  3KFW X;  2K9L A;  4A6D A;  3DCF A;  2QZ8 A;  4BJ6 C;  1JKP C;  3WE3 A;  3ZMZ A;  2WY8 Q;  1SD4 A;  4KN7 X;  3ZN1 A;  2NS8 A;  2GIZ A;  3H1C A;  1EKE A;  3LFK A;  3BR6 A;  4E7L A;  2L01 A;  2L3D A;  3JW4 A;  3GYH X;  2CSO A;  2CQK A;  3CDI A;  5IYD J;  3ZQC A;  1SFU A;  1B8I A;  2X1C A;  4ZH4 F;  3A2K A;  3GTG J;  2Q1Z B;  3KE2 A;  2IA0 A;  4M3F A;  4EJU A;  1IRZ A;  2DTZ A;  3K1N A;  4L9V A;  2L9N A;  1X1D A;  3S1Q J;  2BY1 A;  1JGG A;  1R7J A;  5ICF A;  2RQQ A;  4OMY A;  3H5R A;  3CP2 A;  1FMV A;  1S3J A;  3O8H A;  1X1P A;  2IT0 A;  4RB2 C;  3E0J B;  3MKY B;  2JA7 J;  3A01 A;  4A5N A;  1KQ0 A;  1G59 A;  2OZU A;  3L7W A;  3WE2 A;  2QYO A;  3R0J A;  2PBI A;  2R7T A;  1S7E A;  3BR2 A;  3SFI A;  2FD5 A;  2YU9 J;  4I99 C;  2JA2 A;  3ERE D;  1BR4 A;  1ITY A;  1F1Z A;  1U9O A;  4NDL A;  3DBR B;  2KIS A;  2NVU B;  3ZQF A;  1Z7U A;  4A3G J;  2LG4 A;  1T38 A;  1O7F A;  1IDZ A;  1RNL A;  1OR7 A;  1HA8 A;  1NG7 A;  3PJR A;  4B4C A;  1K61 A;  4EJV A;  3S1R J;  1X1A A;  4GCV A;  1Q1H A;  4UXN A;  5J8C A;  3K4C A;  2KQR A;  1BI3 A;  2LBF A;  4AM3 A;  1X2N A;  3Q9S A;  3LNQ A;  3GZ5 A;  1KA8 A;  1RES A;  2EIN H;  3SDB A;  1MSE C;  3JRG A;  2L9S A;  5C44 J;  1XGS A;  3LSH A;  4C2U A;  3GTP J;  3GFI A;  2ZKZ A;  1LNW A;  4OU0 A;  4I6Z A;  3ASO H;  2LD5 A;  1N78 A;  2E5N A;  1T95 A;  3BC8 A;  3BR0 A;  3MEX A;  3CMM A;  3NWS A;  4ESB A;  2HQN A;  3IH4 A;  1Z6T A;  2CQ7 A;  1LDK B;  2X1D A;  1MBF A;  3DEE A;  1FSH A;  2PMH A;  4WXC A;  1K78 B;  1IXR C;  3V8J A;  3TO6 A;  1DUX C;  3H5N A;  1SAN A;  5LEK A;  1GXP A;  3HOS A;  5EEG A;  2W57 A;  2IW5 A;  1A04 A;  1RKW A;  3SQN A;  4CCN A;  4YG2 F;  4AID A;  2JA5 J;  3QYE A;  5KNL A;  1WVR A;  2BE5 F;  4EEF G;  1VQ6 I;  2V1X A;  1DGW Y;  4AUX A;  5IY5 H;  1D3Y A;  2X51 A;  3L2W A;  1F5T A;  5M3M J;  1EA3 A;  1W7P A;  2DOD A;  5IP9 J;  2G7U A;  4HV6 A;  2AQE A;  5J3L A;  2R93 J;  2DDB A;  4DQ2 A;  1XB4 A;  3N97 A;  2NVT J;  3PL8 A;  2BYV E;  2ZSH B;  2R7Q A;  2Q8K A;  1YX3 A;  2JVH A;  3X2Q H;  4UV9 A;  1YQA A;  3L9F A;  2ETH A;  5K5Q A;  2Y75 A;  3ESW B;  2Q2E B;  5CVI A;  1N75 A;  3L09 A;  1IN8 A;  1XCV A;  4C3J J;  4BDY A;  3O2P E;  1APL C;  2GOM A;  3K0L A;  1LEB A;  1NTC A;  1ZAO A;  4G7O F;  2GLO A;  2E71 A;  4V19 K;  3HL2 A;  3AG1 H;  1SD5 A;  2FXA A;  3B73 A;  2IA1 A;  3BG5 A;  2ZME A;  4UV8 A;  3OY9 A;  2A3S A;  1YW9 A;  1OCT C;  1LFB A;  2HXI A;  2RGV A;  4PJL A;  4BQO A;  1MBH A;  1XCB A;  3L2V A;  5BS6 A;  1SVM A;  1D0X A;  4WX9 A;  3IRR A;  1OMI A;  4XQF A;  1YOV B;  3GCM A;  3EET A;  4UNO A;  4CCM A;  2HEO A;  3MKW B;  2DT5 A;  3MN2 A;  4LJZ F;  3ZQ7 A;  5E8I A;  3GFM A;  3RYR A;  4PGG A;  2QEN A;  1PVE A;  2F5V A;  5FFX A;  2F5D A;  2M9H A;  2Z1D A;  1J0R A;  4BQA A;  1JUP A;  5EG0 B;  1S6L A;  3J7Z I;  2F5C A;  3AKZ A;  3ZQQ A;  2EIM H;  5HS7 A;  1K83 J;  2BY3 A;  4AIJ A;  4I7H A;  4XOR A;  5E1W A;  1VQ9 I;  2V1U A;  1VI0 A;  4IQ4 A;  3DWL E;  3BG9 A;  3S1M J;  1ETY A;  1ZAR A;  3QPT A;  4CCO A;  2YX4 A;  5JLW A;  3FZV A;  2Y0M A;  4AC0 A;  2FQ3 A;  4D5F A;  4WXH A;  3ELK A;  2JWT A;  1B9N A;  2O0Y A;  4LOC A;  2DA1 A;  2JJ7 A;  2UXX A;  2WAQ N;  3QPH A;  1XGO A;  2L5Q A;  2ZJ2 A;  4IJA A;  5GPA A;  4ZTF A;  1B59 A;  1ON1 A;  1Y0N A;  2OTJ I;  2DMN A;  2V9K A;  2X48 A;  3VDX A;  3HDD A;  1QVT A;  2X6O A;  2DLL A;  2TDX A;  2EIL H;  2WV0 A;  2DXI A;  2W00 A;  1XN7 A;  2YUS A;  5DTD A;  3O3K A;  3RPU A;  3AAF A;  3BR3 A;  3GXO A;  2A5W A;  2Y48 A;  4A3J J;  2X6X A;  3CUQ A;  3OYE A;  3CO6 C;  2F48 A;  2NRA C;  2HOS A;  1MGT A;  2DYS H;  2NAZ A;  1B4A A;  2WAE A;  2M34 A;  1HF0 A;  1MH3 A;  4LLN A;  2ISY A;  4UUS B;  1T2K A;  4IKF A;  1KU2 A;  1IN5 A;  4YEJ A;  5F6F A;  2L7M P;  5H6R A;  1DP3 A;  1D0Z A;  4I98 B;  4A69 C;  4BE1 A;  1JHF A;  2PI0 A;  5KHD A;  1H88 C;  2R0Q C;  2DFI A;  3K4B A;  1EJ9 A;  4F93 B;  2HWV A;  2DO7 A;  1J5Y A;  1M1E B;  3FIW A;  4BXX J;  4A2U A;  1E3P A;  1H8A C;  3RTR A;  4FCY A;  1UHM A;  4MHG A;  4Y7N J;  5IYC J;  1LVA A;  2DPD A;  2OA4 A;  3PNV A;  5E3N A;  2COM A;  4KIT B;  3F6O A;  3GLL A;  3GFJ A;  3GF2 A;  4NNJ A;  2VBX A;  3AFH A;  2YU3 A;  2YX7 A;  3T8R A;  5HVQ C;  2QA4 I;  3R60 A;  4DYR A;  1ETQ A;  1QPI A;  1XX5 A;  2KRH A;  1FEX A;  1V5G A;  3LSG A;  5FB2 A;  2AXT C;  3H9G A;  1FTZ A;  2M45 A;  3ECH A;  2QVO A;  5FD5 A;  2K86 A;  4EMS A;  1G8X A;  1I5Z A;  1F9N A;  2I10 A;  3BY6 A;  3PFY A;  3FHZ A;  1AU7 A;  1CGP A;  4ZDO A;  1TBX A;  5CVJ A;  3BJ6 A;  4BBR J;  2E1M C;  3HXL A;  4LB6 B;  1FC3 A;  1B6A A;  4Q47 A;  3CC2 I;  2H8R A;  4A0Z A;  5HNF A;  2XAU A;  3WGH A;  3PQJ A;  4EJW A;  1MIJ A;  3DBL B;  2JQ7 A;  4NQW A;  2K9S A;  2BVM A;  3DTE A;  3K70 C;  2XGE A;  5J8F A;  1XPX A;  1KU9 A;  2ISZ A;  3E7L A;  2BHZ A;  2TRT A;  3DQV C;  4AYB N;  1ZRC A;  2FU4 A;  2NOG A;  1YJN I;  2IS4 A;  2VXZ A;  4G6T B;  4BE2 A;  3S3M A;  2M4G A;  2PN6 A;  2MLK A;  3IH2 A;  3G4S I;  3KYL A;  3H0G J;  4KYW A;  1V54 H;  2LC2 A;  4KMU X;  1LE8 B;  4U87 A;  3JRC A;  5TJJ A;  1K4S A;  2EJR A;  3RQ4 A;  2CH0 A;  1T8I A;  2P5L C;  5J1Y A;  2QLZ A;  1TWA J;  1TQP A;  3DBH B;  1D0Y A;  2HI3 A;  1BBY A;  3V8K A;  3F8N A;  3VYT B;  1K7A A;  4FQG A;  4AIH A;  1ZGA A;  4C30 A;  2W25 A;  4A3F J;  3CO7 C;  3ZGK A;  4JP0 A;  3FDY A;  1R1V A;  2E35 A;  4IOC F;  4A0X A;  3QRF F;  3LQR A;  4RGU A;  3F8M A;  3ECO A;  4Y52 J;  2VJJ A;  1D8J A;  3U21 A;  1IW7 F;  1REP C;  2R92 J;  1K6O A;  1UHW A;  1Y1W J;  2QF7 A;  4P9F A;  4MEX F;  2LH9 A;  5EZG A;  4PFO A;  1XGN A;  3GTL J;  1TWH J;  2HYF A;  5CJ9 A;  4E7K A;  2B7E A;  3L2Q A;  4FAS D;  1F36 A;  4HF2 A;  4Y4R A;  1TTY A;  1OQY A;  3VB2 A;  1NHA A;  2XF5 A;  2XAF A;  3LST A;  3LAP A;  1ON2 A;  4OMZ A;  3OYJ A;  2M0M A;  3BTI A;  1LB2 A;  3TP0 A;  4HQM A;  4DGW B;  2IP2 A;  3JRE A;  4J00 A;  2LKS A;  3G73 A;  3G1O A;  3CJT B;  1J2X A;  2ID3 A;  3E6B A;  4OIO F;  2V4J C;  1G4D A;  2Y0S N;  4N4O B;  2QUF A;  3BDD A;  2KFD A;  4EAT A;  2R7S A;  1K79 A;  4M3G A;  2IRF G;  4CIC A;  3R6S A;  3V7S A;  1PUF A;  1F4K A;  5GAD J;  3BQZ A;  1SAU A;  5D5U B;  4MEY F;  1WSU A;  1JI8 A;  5F64 A;  4UVA A;  3DU6 A;  4PK4 A;  1S72 I;  2JTV A;  4NBQ A;  1IN4 A;  2FOW A;  1BW5 A;  1JT6 A;  4FE4 A;  1OCC H;  4RAG A;  2HGC A;  1VQP I;  3E5Q A;  5B1B H;  1BOB A;  3WTT C;  1HW2 A;  4NC6 A;  2XRL A;  3ML6 A;  4E7H A;  2XF6 A;  5D6E A;  2AO9 A;  4ZYE A;  1WJD A;  3DV8 A;  1TWC J;  2R7F A;  2VKV A;  3AG2 H;  1O7L A;  2O5R A;  4KIF A;  1OYW A;  3FK7 A;  1TWF J;  3KIO A;  1A6I A;  4JX5 A;  1WH5 A;  4A3L J;  1U8R A;  1DDN A;  3GZN B;  3SEQ A;  2XSJ C;  2DPU A;  5HDN A;  2H8W A;  5B1A H;  4F91 B;  1OKR A;  1D1C A;  3SXY A;  4GRI A;  2FMY A;  3HSR A;  2M30 A;  2HKO A;  3D5S C;  2RRE A;  3QYB A;  1HBX G;  4YFX F;  4FET A;  3U2R A;  3K1M A;  2A68 F;  1VQ5 I;  2JRT A;  2MAB A;  3TW7 A;  2IS1 A;  4M9X A;  2LF8 A;  2QSF X;  2DAO A;  2C6Y A;  3C18 A;  1I1G A;  3AL0 C;  4GFB A;  4KIC A;  3I55 I;  3WTY C;  3ZN0 A;  4FHT A;  4OAY A;  1UFM A;  3HKZ N;  1OCR H;  5B3S H;  2LNB A;  3HOW J;  2WY7 Q;  5BPD A;  3C7J A;  3H92 A;  1T33 A;  2X0L A;  4QTR A;  3DLL F;  1CQT A;  4XLN F;  2VL8 A;  3OS2 A;  4JX6 A;  4M3D A;  4JOM A;  3LWF A;  1QQI A;  3RDI A;  1N77 A;  4J01 A;  3OYI A;  3K4J A;  2X85 A;  2GOX B;  1ZH5 A;  4PFP A;  3T8T A;  1MNE A;  1FZP B;  2UV1 A;  4RM2 A;  4A3D J;  1YLF A;  1AA7 A;  1Y39 A;  3NAU A;  3KLO A;  4BE0 A;  9ANT A;  1OR7 C;  4Y17 A;  5FKO A;  3H3U A;  5JI6 A;  3FXR A;  2PMZ A;  3OIQ A;  2VKE A;  1JXS A;  5CQG A;  1MND A;  3ZQI A;  2PFB A;  5FKN A;  4AWX B;  3WTX C;  3CCE I;  4XKB A;  2KDZ A;  3HM5 A;  5K5O A;  5IPA A;  3OWT A;  4E7I A;  4HA8 A;  3S3N A;  4GYI A;  4BJ5 C;  5A2Q Z;  3IL2 A;  2R7R A;  2OTL I;  5AIQ A;  2JSP A;  1ZG1 A;  3QP5 A;  2W82 A;  1Y56 A;  3HUG B;  3HTS B;  4NUB A;  1FY7 A;  3FM5 A;  3FHN A;  3A0H C;  4ZYG A;  4B09 A;  3BRO A;  1TZL A;  1WWX A;  2QQ8 A;  2BW3 B;  2ACJ A;  4S04 A;  2K4J A;  2L54 A;  1V55 H;  4KUM A;  5EDN A;  1BI2 A;  1ETO A;  3HTU A;  3ZMS A;  3M1E A;  4A5M A;  1E17 A;  1U3E M;  1KU7 A;  4M9Z A;  1ZG5 A;  3D1N I;  5IYB J;  3OYG A;  4KIG A;  3ABK H;  3I4M J;  3KYC B;  1I1S A;  3BOQ A;  5F0H A;  2P7C B;  3S1N J;  4Y15 A;  1R00 A;  3K10 A;  5M5W J;  2CWE A;  1K78 A;  2M0C A;  5GP9 A;  5IOZ A;  3A1Y A;  4NB5 A;  1R6R A;  3CCU I;  3KLN A;  4B47 A;  3BZK A;  2QEX I;  1KYW A;  2IAI A;  4UVC A;  3G6E I;  1U0J A;  2V7F A;  4HV5 A;  3W6J B;  3PO2 J;  3MAJ A;  1KU3 A;  1FWZ A;  3IV5 A;  3I4N J;  1ZR2 A;  2JA8 J;  2Y30 A;  4L5J A;  1VQN I;  3I64 A;  1RRJ A;  1FYM A;  2LY2 A;  1W1W E;  3EUH A;  2W4S A;  1DU0 A;  1P7I A;  2MG4 A;  1AWC A;  2H6C A;  4LLL A;  4AVZ A;  3G71 I;  2IPQ X;  3S17 J;  5GAH J;  3OYC A;  2V1N A;  2NS7 A;  2VBZ A;  4BEH B;  1MD0 A;  4KT6 A;  3LL7 A;  2ZME C;  2Q2E A;  3WGG A;  2DMU A;  2OCE A;  4ZJZ A;  3W2W A;  4XIC A;  5HLH A;  3K70 D;  1R22 A;  4B43 A;  4XN3 A;  4ESJ A;  3G1L A;  4LFU A;  3L00 A;  4UVB A;  5FRN A;  3EDP A;  4E7J A;  4A3C J;  3OS0 A;  4HLY A;  4RB1 A;  4LMY A;  4CH7 A;  5CYV A;  3PFI A;  1ERD A;  3L2R A;  2W7N A;  4N4N B;  4L18 B;  2H1L A;  2ID6 A;  2OZ6 A;  1WI9 A;  4RAY A;  2K3F A;  2MW8 A;  2NNN A;  4QPQ A;  3BZ6 A;  2ICW G;  1Z9C A;  2XPW A;  2UXN A;  2P7V B;  3OSG A;  4U0W A;  2HOE A;  2F4O B;  1XS9 A;  4BL0 B;  2RNJ A;  5EG0 A;  2XB0 X;  4IO9 F;  3CQZ J;  2QKL B;  1QA6 A;  1T0F A;  3GUD A;  4LGW A;  1WJC A;  4R8H A;  3UR3 C;  2KKO A;  4XOT A;  1MMG A;  1ZTR A;  2MGQ A;  2X9D A;  2HKX A;  2J5O A;  4XKW A;  4B1R A;  2STT A;  1TLH B;  1FP2 A;  1YTY A;  1I39 A;  2CUJ A;  1YS6 A;  3IAM 2;  2G7H A;  1D8K A;  3C2H A;  1MBG A;  3WHB A;  2K02 A;  3ABM H;  3FXL A;  2IGM A;  4BH9 A;  4PJM A;  3GWZ A;  4M6Y A;  3E5X A;  4ZYD A;  2R7V A;  4D5C A;  3GO5 A;  3CUQ C;  2GM4 A;  3NRV A;  2E2H J;  4DYQ A;  3MCZ A;  1R1U A;  1UZC A;  3BZC A;  5E1Z B;  3OYL A;  1LFU P;  1SFX A;  3HC7 A;  2Y69 H;  4I0B A;  1VQL I;  1IJW C;  2NVY J;  2GIV A;  3KET A;  2DFH A;  2OF7 A;  1BR2 A;  1MMN A;  4RLQ A;  3CME I;  3CJR B;  1VND A;  5L3D A;  2BV6 A;  1FYL A;  3I4P A;  5D5X B;  5ICG A;  4KDP A;  1QVU A;  1RZ4 A;  3P5J A;  4UUS A;  2XVC A;  3J81 Z;  2X6Y A;  3S2H J;  2WB1 N;  4HOB A;  1MNM C;  3HOT A;  1YRN B;  4IHT A;  2VBY A;  4IRI A;  2LSO A;  4OIP F;  4LIT A;  3I53 A;  1ULY A;  5ERI A;  5LRR A;  1XG1 A;  5JFR A;  4IXA A;  1CF7 A;  1YJ9 I;  3D0S A;  4RGR A;  4W1U A;  5F1J A;  3C3W A;  3KZZ A;  4IHW A;  4A93 J;  4C2T A;  2EV0 A;  2QCO A;  4XL9 A;  2NVQ J;  2RNG A;  4S0H B;  3J80 K;  1W4M A;  1G3Y A;  3GFL A;  4R1H A;  3Q5F A;  4MGR A;  1OIS A;  1PP8 F;  1U6G A;  1QHG A;  2O8K A;  1AKH B;  2OJE D;  3KP2 A;  4IRG A;  3OOP A;  3TKY A;  3SEZ A;  2BOL A;  3ABU A;  3FXK A;  4JX4 A;  1X19 A;  4BXU A;  2ZXH A;  2HVQ A;  2BZT A;  1N25 A;  4G7Z F;  2XV4 S;  3LA7 A;  2E1M B;  5TIS C;  5L3C A;  2A6E F;  5BOX A;  2CFO A;  2ZJR F;  3CDH A;  2HOA A;  2BVL A;  2QQ9 A;  3SFZ A;  3MFK A;  3RI4 A;  2VC1 A;  1L3L A;  4AIK A;  1Z91 A;  1MH4 A;  3ZXS A;  5KVR A;  1BIA A;  2DOA A;  1MMD A;  2EQR A;  5JHF A;  1C0W A;  1LUJ B;  3JCU C;  3OL4 A;  4LD5 A;  5IT3 A;  3JTG A;  5K1Y A;  3RKX A;  5IT9 Z;  5DCM B;  5E18 F;  3T0Y A;  2AQF A;  3DKY A;  1ZKG A;  1XMA A;  1YYV A;  4I0A A;  4E4H A;  4RB0 A;  1J7K A;  3T1B A;  2HZT A;  2DA6 A;  1J59 A;  1GLN A;  3F21 A;  1Z05 A;  2LP0 A;  2KIM A;  4MNU A;  3U9G A;  3S14 J;  3GTO J;  2OQG A;  1LE8 A;  4R79 A;  4DJA A;  2HYG D;  4CHU A;  3RSN A;  4XM3 A;  1O4X A;  1H0M A;  1NK2 P;  5C4J J;  1ZRF A;  3J7A Y;  2QBY B;  1WFX A;  5D8L B;  2V1D A;  1HW5 A;  2ELH A;  2ZCW A;  3N05 A;  3VYS B;  5HS9 A;  2R5Y B;  4L9N A;  3WG7 H;  4EM2 A;  2P4W A;  1S9H A;  3ROU A;  5K5R A;  5D4R A;  2L9R A;  4W97 A;  2BEO A;  1RET A;  5CKT A;  3L1P A;  3RKQ A;  1DU6 A;  2G9W A;  1MJ9 A;  2VKH A;  5LHI A;  4Z6Y A;  1UAA A;  3IWF A;  1OLT A;  3CF2 A;  2GA2 A;  2XAS A;  4EQQ A;  2VLA A;  3HPH A;  4OWR B;  1R58 A;  1NG6 A;  1WKM A;  2E7W A;  3FIS A;  2P6S A;  2DJN A;  2OD5 A;  2DA5 A;  4MIM A;  2BBY A;  1R49 A;  1P7J A;  1A36 A;  4PJ0 C;  3JTH A;  4DIQ A;  5M5X J;  1OFC X;  2R5Z B;  4IQJ A;  1VF9 A;  2X6W A;  3QOE A;  2ZXW H;  5FO5 A;  1LQ1 A;  2GXG A;  1WJB A;  5DDG A;  2PEX A;  4XSX F;  4FX4 A;  4A3E J;  2D1H A;  1RUN A;  2LR8 A;  3FMS A;  4XRF A;  3H36 A;  1U8B A;  4IHV A;  2EZL A;  4UUT A;  4JYK A;  2XGC A;  2JN6 A;  4HST A;  3S32 A;  1R23 A;  1FIP A;  2NYX A;  1W7P D;  1HW1 A;  2RAE A;  4K2E A;  5TGT A;  3ZCO A;  4RS8 A;  4KIS A;  1P9Q C;  4EVI A;  1Z1D A;  2K9Q A;  3CLO A;  3RJP A;  2CS3 A;  4MFE A;  2BY0 A;  4TV7 A;  5EGO B;  5BQT A;  1Z3Y A;  5D8K B;  2VQH A;  1X1C A;  3WG9 A;  5HDG A;  2F4M B;  2FX0 A;  2ZJP F;  4WWC A;  2H6B A;  4D7N A;  5HOO A;  2FNP A;  2D5V A;  1J75 A;  3HHH A;  2EFN A;  2KRC A;  3VPR A;  4A6E A;  3WTV C;  2DCE A;  3JSO A;  3M7G A;  3J7Y J;  2XUB A;  3K4L A;  3H5A A;  5L3E A;  2DJI A;  3I71 A;  2UWM A;  2EWN A;  4AU7 A;  2LK2 A;  4BBS J;  4FIS A;  1S29 A;  2D2W A;  2L7F P;  3PUF A;  5H2F C;  2WWY A;  4CUG A;  2R7U A;  3OV8 A;  4IRH A;  5F0F A;  1XTA A;  5BNG A;  2CQX A;  3GVA A;  3HPG A;  3BWG A;  4PDK A;  4YII A;  5DD8 A;  3K6G A;  3NEU A;  3G2B A;  2R7O A;  3RKY A;  2PJR A;  2WA0 A;  4HNU A;  2L2O A;  2OPT A;  3KP7 A;  1DQU A;  4H0E A;  4JK1 X;  2IS2 A;  1ETK A;  4MTD A;  1G6N A;  3U1K A;  5FLV A;  2EK5 A;  2XB5 A;  4ENK A;  1O3R A;  4YRV A;  3I5U A;  3Q3S A;  4CZZ A;  1JUM A;  3LA3 A;  1HXD A;  1ZQ3 P;  3AL0 B;  1STZ A;  1T56 A;  3K9T A;  2R7W A;  2MC4 A;  1O3S A;  4BNC A;  2UUZ A;  1ODD A;  5GPC A;  4RLF A;  2A69 F;  4C3I J;  4FX0 A;  2YS9 A;  5E3O A;  4EGZ A;  1SMY F;  1UCR A;  2EB7 A;  2FRH A;  3EPZ A;  1S8N A;  1YS7 A;  5K7Z A;  3CCS I;  2CV0 A;  1S7O A;  3BT9 A;  3TQN A;  2V6E A;  2KLO A;  4E7Z A;  3OIP A;  4XID A;  1DGR M;  5J1U A;  1DPU A;  1EH8 A;  1OCZ H;  2LRE A;  3RZO J;  3S93 A;  2MH9 A;  2O6G E;  5FGM A;  3PO3 J;  2VJ4 A;  1XGM A;  1BM9 A;  3OMY A;  3CZ6 A;  5HLT A;  1IN7 A;  3OSF A;  2IS6 A;  3ZMT A;  3RZD J;  1FIA A;  2GWR A;  4CZC A;  3HBL A;  2M87 A;  2M8G X;  3IAS 2;  1X3U A;  3RPU D;  3ONQ A;  1FMW A;  4IVN A;  2ME6 A;  2K3P A;  4PZJ A;  3P9C A;  5AON A;  4A3I J;  2VT3 A;  1FJL A;  4XON A;  2VC0 A;  2HQ5 A;  2ZXI A;  2ZJQ F;  1K4T A;  3GLX A;  2BGC A;  1NK3 P;  3TOA A;  2R7X A;  1P4X A;  3HUG A;  1ETV A;  6PAX A;  2K4B A;  2M5W A;  2BY2 A;  1SEU A;  2BW3 A;  2FNA A;  1A35 A;  2A05 A;  5ILV A;  4C9Y A;  4DNC A;  4BY7 J;  5FFZ A;  4YFK F;  3TOB A;  2CUF A;  1VZ0 A;  4A3M J;  5FLX Z;  2VXD A;  3F0C A;  4BQQ A;  1RKT A;  2E7X A;  2E1O A;  4ZTJ A;  3LSI A;  5LHG A;  1HLV A;  5DYM A;  5A2Q K;  2WV1 A;  3M3Y J;  2ZFW A;  4P9U A;  3PSI A;  2M1B A;  2XGD A;  1IUF A;  4RBO A;  1MBK A;  2NNY A;  4X6A J;  3W2A A;  2EIK H;  3KEQ A;  2A5Y B;  1FX7 A;  1LKX A;  2XF7 A;  3OYH A;  1HKS A;  4G9Y A;  3GTQ J;  5IP6 A;  5K7H A;  3S2D J;  1J09 A;  3OYA A;  3O6B B;  2V9P A;  4PJN A;  4M71 A;  3ZQG A;  1XSX A;  3GTJ J;  1ZYR F;  4J19 A;  3EUH C;  3BTC A;  1DPR A;  1OCO H;  3DPT A;  2HPM A;  1MJB A;  4M6X A;  3M8E A;  1BJA A;  2VPL A;  2DOE A;  3E5U A;  4PUS A;  1U5T B;  4M72 A;  4DW6 A;  1TQM A;  3ULQ B;  3JAM Z;  2DMP A;  3K4N A;  3A03 A;  3CJQ B;  1G3W A;  3COA C;  2LY1 A;  1LDD A;  2D45 A;  2FEZ A;  3GTK J;  2Q0O A;  3BCA A;  2E5Z A;  4BEH A;  4XRM A;  2XAH A;  1FP1 D;  1U78 A;  3PQK A;  2Y9Y A;  4CO8 A;  5ICE A;  5JVT A;  2A6H F;  2AXL A;  3H9J A;  2UZK A;  3CCM I;  1TWG J;  5B5E C;  2E60 A;  1BW6 A;  3H3Z A;  4NC8 A;  5EEH A;  2CW0 F;  4IX7 A;  1Z21 A;  4C3H J;  3W6K B;  5HOD A;  4UY8 I;  3Q9V A;  3FKJ A;  2L0K A;  1MKM A;  2VQL A;  3WTU C;  5J4Y A;  3L2U A;  4KNY A;  1QGP A;  1P6R A;  3DKX A;  5J6X A;  2E1C A;  1SD7 A;  4IZZ A;  1W5T A;  4HW0 A;  4HZF A;  1PUE E;  1AHD P;  3JR9 A;  1JTX A;  1KZH A;  3PSF A;  2GXB A;  2D1V A;  4CSW A;  4L5I A;  2XAQ A;  3VWB A;  2N8G A;  1T0F C;  4M9S A;  2R4G A;  4LK0 F;  1B72 B;  1TT5 B;  1VQO I;  5EZH A;  4WK8 F;  1IO2 A;  2EH3 A;  4XLC A;  1TL8 A;  1LJ9 A;  4PJJ A;  1E0E A;  4F7Z A;  2AS5 F;  2V6C A;  4HF0 A;  4HYE A;  3CLQ A;  3F3X A;  1U9N A;  2JUG A;  2I5U A;  1HQC A;  3MZY A;  3DTK A;  1JJ6 C;  2LY9 A;  3LSJ A;  3HOX J;  3IHU A;  3HOZ J;  1L0O C;  4U7B A;  4D1Q A;  1IUY A;  2VE8 A;  2WBM A;  3CUQ B;  3HRT A;  3WU1 B;  2CW7 A;  3QPS A;  2XSD C;  2PQ8 A;  2QGU A;  2VPR A;  4EV0 A;  4YIF A;  2V26 A;  2LRD A;  4U88 A;  5CQE A;  4L9T A;  3CCJ I;  1FBS A;  1XDS A;  3A4C A;  4BQN A;  4M3E A;  4G7H F;  3FKI J;  2H94 A;  2LLK A;  3I59 B;  4IHY A;  3CDL A;  1D5V A;  4RB3 C;  5K7F A;  3JRF A;  2K5C A;  3MKL A;  2M8E A;  2RV8 A;  3ZQH A;  4HNV A;  3ZQL A;  5FKM A;  3CJN A;  1WRJ A;  2R7Z J;  1VTN C;  2DFF A;  2IGK A;  1SAX A;  4F55 A;  4YIR X;  2CO5 A;  3BJA A;  3D5R C;  3R0A A;  3HGG A;  2ME0 A;  5M3F J;  1ONV A;  3OYF A;  1D1A A;  2F4I A;  3RKW A;  4CYD A;  2XC7 A;  4HPQ A;  3DPL C;  1W0T A;  3EYI A;  2FF4 A;  1YRN A;  2KDO A;  1POG A;  2LKP A;  2KZG A;  1MZB A;  4YFN F;  4A3B J;  4ANJ A;  1X4P A;  1SMT A;  2OBP A;  5AIP A;  3JSP A;  1ZRD A;  2EA4 A;  1FTT A;  3CCY A;  4P1W A;  4XN0 A;  4UB6 C;  2KJB A;  3QOD A;  3IUO A;  1V3F A;  2JVG A;  4ETS A;  1W5S A;  3VFZ A;  4CA0 A;  1IV8 A;  5HLI A; 
#chains in the Genus database with same CATH homology
 3J81 K;  4CDG A;  4ASN A;  4HX8 A;  3KP3 A;  1XSD A;  4EM0 B;  2EV6 A;  2DI3 A;  2B0L A;  1TW2 A;  3QU3 A;  1JE8 A;  4N9I A;  3V8L A;  5DUI A;  5H6Q A;  3G3Z A;  1QNT A;  2X4H A;  4WF2 A;  4O5V A;  4ENJ A;  1ZLJ A;  2ZO4 A;  3E97 A;  1S7A A;  3LQQ A;  3C1D A;  3QAH A;  5DCM A;  2F2E A;  4A0Y A;  2GAU A;  3V7C A;  3BPV A;  5LEJ A;  1H9T A;  3V7R A;  1E2X A;  1QZY A;  3RYP A;  5D5V B;  2FBH A;  1H9G A;  4I01 A;  5JR3 A;  3TDU C;  2RC4 A;  2JPC A;  4L0Z B;  5HLG A;  3DXJ F;  5E1X A;  3E6C C;  1IRF A;  3VOD A;  2W24 A;  2CG4 A;  5ILS A;  3QOP A;  1T6S A;  2ZNY A;  4BHP A;  3HSF A;  1QPM A;  3S2W A;  2EFO A;  1KGS A;  4I2O A;  2MD5 A;  5L3F A;  3LAJ A;  2NS0 A;  2L4A A;  2V9V A;  2L02 A;  3ZP5 A;  1OYI A;  4QWQ A;  1TNS A;  2EFQ A;  4RAZ A;  4A12 A;  1HKQ A;  4CXF A;  1PDN C;  3CTA A;  3MZH A;  2P8T A;  1BC8 C;  2DBB A;  3WOD F;  1FYK A;  4AD9 A;  3HHG A;  2DTR A;  2CFX A;  4N0B A;  3T5X A;  1KQ8 A;  1BI0 A;  1OYY A;  3IC7 A;  3WTW C;  4P55 A;  2PLY A;  2K27 A;  5DD4 A;  3E3V A;  5LLQ A;  2EV5 A;  4XLP F;  3F72 A;  4G94 A;  1Y0U A;  4KN4 X;  1IAW A;  3FXQ A;  3KEO A;  1OPC A;  4MTE A;  1USS A;  4P96 A;  2VON A;  4EGY A;  2QQB A;  4ENN A;  4D0P A;  3F22 A;  2PJP A;  3P9K A;  4Q48 A;  4I02 A;  5LGU A;  3J7A O;  5LGT A;  3F8C A;  2RVC A;  1G3T A;  2WC2 A;  1IZ1 A;  4G6D A;  5HS8 A;  2HDC A;  4KMF A;  1Z6R A;  3MWM A;  4HDU A;  5BPI A;  2LDU A;  2VE9 A;  4L0Y B;  1R5H A;  3HRM A;  3BJO A;  1U2W A;  2XAJ A;  1YG2 A;  4BAY A;  1B1B A;  4BHB A;  4G6Q A;  3K1P A;  4OIQ F;  2HTS A;  1HST A;  2ADU A;  3RPQ A;  2XKP A;  1ZHF A;  4B8X A;  3WGI A;  5DV5 A;  5CVV A;  2Z33 A;  4IPA A;  1ZN2 A;  1UB9 A;  2HFH A;  5CVR A;  3QU6 A;  5ILU A;  4LG0 B;  2PMU A;  4P5O A;  1FOK A;  1RUO A;  1P4A A;  2MA3 A;  5LGN A;  2PG4 A;  3SZT A;  2FE3 A;  1PP7 U;  4KT5 C;  5FLX K;  3DP7 A;  1EH7 A;  4Z2Y A;  4HX7 A;  1AOY A;  3TO9 A;  3KP4 A;  4L9J A;  1EH6 A;  5E8G A;  2KRF A;  4U0Y A;  1U5T A;  4M74 A;  2MLG A;  2XAG A;  2HTJ A;  2DW4 A;  4IHS A;  2A61 A;  4UUV A;  4MQV A;  5D5W B;  3SZP A;  1BI1 A;  2WTE A;  3TO7 A;  2ESH A;  3ZPL A;  2VBW A;  2O61 A;  1YW8 A;  4GYG A;  4OIN F;  1R36 A;  3HRU A;  1YIO A;  5LBQ A;  3F8F A;  3JAM K;  3E6M A;  4JBA A;  1MDM B;  3U1D A;  5L3B A;  1QO0 D;  4HAM A;  4ON0 A;  4LK1 F;  2H27 A;  3HYI A;  5BMZ A;  2YPR A;  1FSE A;  2DK5 A;  2MBF A;  2GZW A;  2ZBK A;  2P5V A;  1EV7 A;  1FNN A;  5TRD A;  2VOO A;  4AVP A;  3M8F A;  4BYY A;  2XRN A;  2J5P A;  2L4M A;  2FOK A;  4EJT A;  3HIF A;  1LEA A;  2IA2 A;  3EYY A;  5F1R A;  2KIU A;  3R61 A;  4S05 A;  2EFW A;  3J80 Z;  2FBI A;  2STW A;  1BN5 A;  4E70 A;  2ESN A;  3I59 A;  3K2Z A;  5FD6 A;  3V4G A;  3IKV A;  5ED4 A;  1CF7 B;  1P4W A;  2XKO A;  2OAZ A;  1FPQ A;  1FLI A;  2F5E A;  5CVU A;  5DUK A;  3I58 A;  4U7D A;  3R4K A;  1O3T A;  1IXS B;  1YFH A;  3D5L A;  1QZZ A;  2RKH A;  1QBJ A;  4RGS A;  4JQF A;  3F23 A;  1BC7 C;  5D4S A;  1GHC A;  1UST A;  2XRO A;  3FMQ A;  2YR2 A;  1I6X A;  4LLG F;  1ZRE A;  3TDZ C;  3KZY A;  4KIB A;  2OU2 A;  3FM3 A;  4ZZD A;  4MQ9 F;  2IVM A;  2F5F A;  2Z9O A;  4U0V A;  1W7P B;  3SHF A;  2FBK A;  3KCC A;  2K7L A;  4RGX A;  3KP6 A;  2FSW A;  2O3F A;  1MJA A;  1XMK A;  2GA1 A;  3EQL F;  2RQP A;  4PGH A;  3L2C A;  4ESF A;  5E20 A;  2P5K A;  2VT2 A;  2QQA A;  1T98 A;  1RIO H;  3I0T A;  2HQR A;  2ZME B;  1SFE A;  3DFG A;  5DCF A;  2JZY A;  2OQR A;  4M73 A;  5DEQ A;  3FXU A;  2RDP A;  4HDV A;  2ZXJ A;  3I54 A;  3WTS C;  1P2F A;  3FX3 A;  3GX4 X;  3HSE A;  5HDK A;  3QP6 A;  4Q4Z F;  1IN6 A;  2KIF A;  2HS5 A;  1RI7 A;  3GEZ A;  3VOE A;  3B02 A;  1FBU A;  5KK1 A;  3IWZ A;  2IJL A;  4ZYH A;  3LA2 A;  2O03 A;  2KJC A;  2W85 A;  1IRG A;  4BHC A;  4LB5 A;  3N4M A;  4I09 A;  3FMR A;  4G8X A;  3FWE A;  2EA2 A;  2DU9 A;  1TNT A;  4WCG A;  2Z5U A;  2YSR A;  3DF8 A;  3ZMV A;  4ZZL A;  2Z99 A;  3F8B A;  1I27 A;  2Z3Y A;  3P9I A;  2P6T A;  2MH2 A;  4FT8 A;  3ZMD A;  4EM1 A;  1HKT A;  2V79 A;  3VEP A;  3REO A;  3BPX A;  3ZMU A;  3HRS A;  3M9A A;  2QM3 A;  1B9M A;  1SD6 A;  5CLS A;  2RN7 A;  4QLC U;  5LHH A;  1T39 A;  1GXQ A;  2DQL A;  2W84 A;  4Y13 A;  5JHU A;  2MC3 A;  1ZG3 A;  3ABT A;  2H09 A;  2XGX A;  4KFC A;  1TW3 A;  2E1N A;  3DKW A;  4HQE A;  2XHK A;  1IXC A;  1G3S A;  2FA5 A;  2ZNZ A;  1GVJ A;  1FT9 A;  1FBQ A;  3IKT A;  3P7N A;  2R3S A;  3FF5 A;  3WU0 A;  1ZLK A;  2R7D A;  3F6V A;  2VOP A;  1IF1 A;  5E17 F;  2JPB A;  5D6F A;  3CUO A;  1KYZ A;  3E6D A;  2LF7 A;  1JHH A;  1JGS A;  3DEU A;  1R1T A;  4CGZ A;  1R5G A;  2DK8 A;  4O3M A;  1ZGJ A;  5H20 A;  3MQ0 A;  5IT9 K;  2JT1 A;  2VOD A;  2VN2 A;  2QBY A;  4NHJ A;  4LG0 A;  3BP8 A;  4O6J A;  1V4R A;  1HSJ A;  2FML A;  1XSV A;  4HF1 A;  1BOA A;  3GZ6 A;  1TQI A;  1P92 A;  4XBF A;  1O57 A;  4GO1 A;  4IF4 A;  4EJO A;  4GXO A;  1U5T C;  2CGP A;  1DP7 P;  2DQR A;  1XDU A;  4UHT A;  1O3Q A;  4HLX A;  4PCQ A;  3K69 A;  5L3G A;  2QWW A;  4HBL A;  2CYY A;  2XIG A;  4Q5S F;  4HX4 A;  2GQQ A;  3WTZ A;  3NQO A;  5LRS A;  2EFP A;  1WQ2 A;  1LDJ A;  4N9H A;  4XSZ F;  3IRQ A;  2O8X A;  4WXD A;  2JSC A;  3GW2 A;  3KP5 A;  3TGN A;  4GGG A;  2A07 F;  3RIR A;  4OIR F;  2HR3 A;  1MDM A;  1XD7 A;  3ISP A;  1J9I A;  4OOI A;  4KA4 A;  1YO5 C;  1YW7 A;  5ICC A;  1KQ9 A;  4ENM A;  1BIB A;  3KFW X;  4A6D A;  2QZ8 A;  3WE3 A;  3ZMZ A;  1SD4 A;  4KN7 X;  3ZN1 A;  3LFK A;  2L01 A;  2L3D A;  3JW4 A;  3GYH X;  2CSO A;  2CQK A;  1SFU A;  4ZH4 F;  3KE2 A;  2IA0 A;  4EJU A;  3K1N A;  4L9V A;  1R7J A;  5ICF A;  4OMY A;  1S3J A;  2IT0 A;  4RB2 C;  4A5N A;  1KQ0 A;  2OZU A;  3L7W A;  3WE2 A;  2QYO A;  3R0J A;  2PBI A;  3ERE D;  1F1Z A;  1Z7U A;  1T38 A;  1O7F A;  1RNL A;  1OR7 A;  4EJV A;  4GCV A;  1Q1H A;  4UXN A;  5J8C A;  1BI3 A;  3Q9S A;  3GZ5 A;  1KA8 A;  1XGS A;  3GFI A;  2ZKZ A;  1LNW A;  4OU0 A;  3MEX A;  4ESB A;  2HQN A;  1Z6T A;  1LDK B;  1FSH A;  2PMH A;  4WXC A;  1K78 B;  1IXR C;  3V8J A;  3TO6 A;  1DUX C;  5LEK A;  1GXP A;  3HOS A;  5EEG A;  2W57 A;  2IW5 A;  1A04 A;  3SQN A;  4YG2 F;  2BE5 F;  2V1X A;  1D3Y A;  1F5T A;  1W7P A;  2G7U A;  4HV6 A;  4DQ2 A;  1XB4 A;  3N97 A;  2BYV E;  2Q8K A;  4UV9 A;  1YQA A;  3L9F A;  2ETH A;  5K5Q A;  2Y75 A;  5CVI A;  3L09 A;  1IN8 A;  1XCV A;  3O2P E;  1LEB A;  3K0L A;  1ZAO A;  4G7O F;  1SD5 A;  2FXA A;  3B73 A;  2IA1 A;  2ZME A;  4UV8 A;  2A3S A;  1YW9 A;  2RGV A;  1XCB A;  5BS6 A;  4WX9 A;  3IRR A;  1OMI A;  3EET A;  4UNO A;  2HEO A;  2DT5 A;  4LJZ F;  3ZQ7 A;  5E8I A;  3GFM A;  3RYR A;  4PGG A;  2QEN A;  5FFX A;  2F5D A;  1J0R A;  4BQA A;  1S6L A;  2F5C A;  5HS7 A;  4AIJ A;  4I7H A;  5E1W A;  2V1U A;  1ZAR A;  3QPT A;  2YX4 A;  3FZV A;  2Y0M A;  2FQ3 A;  4WXH A;  3ELK A;  1B9N A;  2O0Y A;  2UXX A;  3QPH A;  1XGO A;  2ZJ2 A;  4IJA A;  1B59 A;  1ON1 A;  2DLL A;  2TDX A;  2WV0 A;  1XN7 A;  3O3K A;  3RPU A;  3AAF A;  3GXO A;  2Y48 A;  3CUQ A;  3CO6 C;  2NRA C;  1MGT A;  2NAZ A;  1B4A A;  4LLN A;  2ISY A;  1T2K A;  1KU2 A;  1IN5 A;  5F6F A;  5H6R A;  4I98 B;  1JHF A;  2PI0 A;  2DFI A;  2HWV A;  2DO7 A;  1J5Y A;  4A2U A;  3RTR A;  1UHM A;  4MHG A;  2DPD A;  1LVA A;  2OA4 A;  2COM A;  3F6O A;  3GFJ A;  3GF2 A;  2VBX A;  2YU3 A;  2YX7 A;  5HVQ C;  3T8R A;  3R60 A;  5FB2 A;  2M45 A;  3ECH A;  2QVO A;  5FD5 A;  2K86 A;  4EMS A;  1I5Z A;  1F9N A;  3BY6 A;  3FHZ A;  1CGP A;  1TBX A;  5CVJ A;  3BJ6 A;  4LB6 B;  1FC3 A;  1B6A A;  4Q47 A;  4A0Z A;  3WGH A;  3PQJ A;  4EJW A;  4NQW A;  5J8F A;  1KU9 A;  2ISZ A;  3DQV C;  1ZRC A;  2FU4 A;  2VXZ A;  2PN6 A;  2MLK A;  4KYW A;  4KMU X;  5TJJ A;  2EJR A;  2P5L C;  2QLZ A;  1TQP A;  1BBY A;  3V8K A;  3F8N A;  1K7A A;  4AIH A;  1ZGA A;  2W25 A;  3CO7 C;  1R1V A;  4A0X A;  3QRF F;  3LQR A;  4RGU A;  3F8M A;  3ECO A;  1D8J A;  1IW7 F;  1REP C;  1K6O A;  1UHW A;  4P9F A;  4MEX F;  1XGN A;  2HYF A;  5CJ9 A;  4HF2 A;  1TTY A;  3VB2 A;  1NHA A;  2XAF A;  3LST A;  3LAP A;  1ON2 A;  4OMZ A;  1LB2 A;  4HQM A;  2IP2 A;  3G73 A;  1J2X A;  3E6B A;  4OIO F;  1G4D A;  2QUF A;  3BDD A;  1K79 A;  2IRF G;  4CIC A;  3R6S A;  3V7S A;  1F4K A;  5D5U B;  4MEY F;  1WSU A;  5F64 A;  4UVA A;  2JTV A;  1IN4 A;  2HGC A;  3E5Q A;  3WTT C;  1HW2 A;  3ML6 A;  5D6E A;  4ZYE A;  3DV8 A;  2R7F A;  1O7L A;  4KIF A;  1OYW A;  1U8R A;  1DDN A;  2DPU A;  5HDN A;  1OKR A;  3SXY A;  2FMY A;  3HSR A;  2M30 A;  2HKO A;  1HBX G;  4YFX F;  3U2R A;  3K1M A;  2A68 F;  2JRT A;  4M9X A;  2LF8 A;  2DAO A;  2C6Y A;  3C18 A;  1I1G A;  4KIC A;  3WTY C;  3ZN0 A;  4FHT A;  1UFM A;  2LNB A;  5BPD A;  3C7J A;  3H92 A;  2X0L A;  4XLN F;  3LWF A;  1QQI A;  3RDI A;  1ZH5 A;  3T8T A;  1FZP B;  1YLF A;  3KLO A;  4Y17 A;  3H3U A;  5JI6 A;  3FXR A;  1JXS A;  2PFB A;  4AWX B;  3WTX C;  5K5O A;  4HA8 A;  4GYI A;  5A2Q Z;  3IL2 A;  5AIQ A;  1ZG1 A;  3QP5 A;  3HTS B;  1FY7 A;  3FM5 A;  4ZYG A;  4B09 A;  3BRO A;  1WWX A;  2ACJ A;  4S04 A;  2K4J A;  2L54 A;  4KUM A;  1BI2 A;  3HTU A;  3ZMS A;  3M1E A;  4A5M A;  1E17 A;  1U3E M;  1KU7 A;  4M9Z A;  1ZG5 A;  4KIG A;  1I1S A;  3BOQ A;  2P7C B;  4Y15 A;  1R00 A;  2CWE A;  1K78 A;  4NB5 A;  3KLN A;  1KYW A;  4UVC A;  4HV5 A;  3W6J B;  3MAJ A;  1KU3 A;  1FWZ A;  4L5J A;  3I64 A;  1FYM A;  3EUH A;  1AWC A;  2H6C A;  4LLL A;  2IPQ X;  2VBZ A;  1MD0 A;  2Q2E A;  3WGG A;  5HLH A;  1R22 A;  4ESJ A;  4LFU A;  3L00 A;  4UVB A;  3EDP A;  4HLY A;  4RB1 A;  4LMY A;  5CYV A;  3PFI A;  4L18 B;  2OZ6 A;  1WI9 A;  4RAY A;  2NNN A;  3BZ6 A;  1Z9C A;  2UXN A;  2P7V B;  4U0W A;  2HOE A;  2RNJ A;  1T0F A;  3GUD A;  4LGW A;  4R8H A;  2KKO A;  2HKX A;  2J5O A;  2STT A;  1TLH B;  1FP2 A;  1YTY A;  1YS6 A;  2G7H A;  1D8K A;  2K02 A;  4BH9 A;  3GWZ A;  4ZYD A;  4M6Y A;  3E5X A;  3GO5 A;  3CUQ C;  3NRV A;  3MCZ A;  1R1U A;  5E1Z B;  1SFX A;  4I0B A;  2GIV A;  3KET A;  1FYL A;  5L3D A;  2BV6 A;  3I4P A;  5D5X B;  5ICG A;  4KDP A;  1RZ4 A;  2XVC A;  3J81 Z;  4HOB A;  3HOT A;  4IHT A;  2VBY A;  4IRI A;  2LSO A;  4OIP F;  3I53 A;  1ULY A;  5ERI A;  5LRR A;  5JFR A;  4IXA A;  1CF7 A;  3D0S A;  4RGR A;  3C3W A;  3KZZ A;  2EV0 A;  3J80 K;  1W4M A;  1G3Y A;  3GFL A;  4R1H A;  3Q5F A;  4MGR A;  1PP8 F;  1U6G A;  3KP2 A;  4IRG A;  3OOP A;  3TKY A;  3ABU A;  4BXU A;  4G7Z F;  2XV4 S;  3LA7 A;  5L3C A;  2A6E F;  5BOX A;  3CDH A;  2QQ9 A;  3SFZ A;  3MFK A;  3RI4 A;  2VC1 A;  1L3L A;  4AIK A;  1Z91 A;  5KVR A;  1BIA A;  1C0W A;  4LD5 A;  5IT3 A;  3JTG A;  5K1Y A;  3RKX A;  5IT9 Z;  5DCM B;  5E18 F;  3T0Y A;  1XMA A;  1YYV A;  4I0A A;  4RB0 A;  1J7K A;  3T1B A;  2HZT A;  1J59 A;  3F21 A;  1Z05 A;  2KIM A;  4MNU A;  3U9G A;  2OQG A;  4R79 A;  2HYG D;  4CHU A;  1H0M A;  1ZRF A;  2QBY B;  5D8L B;  2V1D A;  1HW5 A;  2ELH A;  2ZCW A;  5HS9 A;  4L9N A;  4EM2 A;  2P4W A;  3ROU A;  5K5R A;  5D4R A;  2BEO A;  2G9W A;  1MJ9 A;  5LHI A;  3IWF A;  2GA2 A;  2XAS A;  4EQQ A;  1R58 A;  1WKM A;  2E7W A;  2P6S A;  2OD5 A;  2BBY A;  3JTH A;  5FO5 A;  1LQ1 A;  2GXG A;  4FX4 A;  5DDG A;  2PEX A;  4XSX F;  2D1H A;  1RUN A;  4XRF A;  3FMS A;  1R23 A;  2NYX A;  1W7P D;  1HW1 A;  4K2E A;  4RS8 A;  4EVI A;  1Z1D A;  3CLO A;  3RJP A;  4TV7 A;  5BQT A;  5D8K B;  3WG9 A;  5HDG A;  4WWC A;  2H6B A;  5HOO A;  2FNP A;  1J75 A;  3HHH A;  2EFN A;  4A6E A;  3WTV C;  3JSO A;  3M7G A;  2XUB A;  5L3E A;  3I71 A;  2UWM A;  2EWN A;  1S29 A;  2D2W A;  2WWY A;  3OV8 A;  4IRH A;  3GVA A;  3BWG A;  4PDK A;  4YII A;  5DD8 A;  3NEU A;  3RKY A;  3KP7 A;  4H0E A;  4JK1 X;  4MTD A;  1G6N A;  2EK5 A;  4ENK A;  1O3R A;  3I5U A;  4CZZ A;  3LA3 A;  1HXD A;  1STZ A;  3K9T A;  1O3S A;  4BNC A;  1ODD A;  2A69 F;  4FX0 A;  4EGZ A;  1SMY F;  1UCR A;  2EB7 A;  2FRH A;  1S8N A;  1YS7 A;  1S7O A;  3TQN A;  1DPU A;  1EH8 A;  2MH9 A;  2O6G E;  5FGM A;  1XGM A;  1BM9 A;  1IN7 A;  3ZMT A;  2GWR A;  2M87 A;  1X3U A;  4IVN A;  4PZJ A;  3P9C A;  5AON A;  2VT3 A;  2VC0 A;  3GLX A;  2BGC A;  3TOA A;  1P4X A;  3HUG A;  6PAX A;  2K4B A;  2M5W A;  2FNA A;  5ILV A;  4DNC A;  5FFZ A;  4YFK F;  3TOB A;  5FLX Z;  2E7X A;  5LHG A;  5DYM A;  5A2Q K;  4P9U A;  2ZFW A;  2M1B A;  2NNY A;  3KEQ A;  2A5Y B;  1FX7 A;  1HKS A;  4G9Y A;  3O6B B;  4M71 A;  1XSX A;  1ZYR F;  1DPR A;  3DPT A;  1MJB A;  4M6X A;  3M8E A;  1BJA A;  3E5U A;  1U5T B;  4M72 A;  1TQM A;  3ULQ B;  3JAM Z;  1G3W A;  3COA C;  1LDD A;  2D45 A;  2FEZ A;  2Q0O A;  2XAH A;  1FP1 D;  1U78 A;  3PQK A;  4CO8 A;  5ICE A;  5JVT A;  2A6H F;  2AXL A;  2UZK A;  3H3Z A;  5EEH A;  2CW0 F;  3W6K B;  3Q9V A;  1MKM A;  3WTU C;  4KNY A;  1QGP A;  1P6R A;  5J6X A;  2E1C A;  1SD7 A;  1W5T A;  4HW0 A;  4HZF A;  1PUE E;  2GXB A;  2D1V A;  4L5I A;  2XAQ A;  4M9S A;  4LK0 F;  4WK8 F;  1LJ9 A;  4F7Z A;  2AS5 F;  2V6C A;  4HF0 A;  4HYE A;  3F3X A;  1HQC A;  3MZY A;  3IHU A;  1L0O C;  4U7B A;  1IUY A;  2VE8 A;  3CUQ B;  3HRT A;  3WU1 B;  2PQ8 A;  4EV0 A;  4YIF A;  4U88 A;  4L9T A;  1FBS A;  1XDS A;  4G7H F;  1D5V A;  2H94 A;  3I59 B;  4RB3 C;  2M8E A;  2RV8 A;  3CJN A;  1WRJ A;  1VTN C;  1SAX A;  2CO5 A;  3BJA A;  3R0A A;  1ONV A;  3RKW A;  4CYD A;  3DPL C;  3EYI A;  2FF4 A;  2LKP A;  1MZB A;  4YFN F;  1SMT A;  2OBP A;  5AIP A;  3JSP A;  1ZRD A;  2EA4 A;  2KJB A;  1V3F A;  4ETS A;  1W5S A;  3VFZ A;  5HLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...