2FBKA

The crystal structure of hucr from deinococcus radiodurans
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
172
structure length
156
Chain Sequence
DTAALLERIRSDWARLNHGPSAGPMLTLLLLERLHAALGREIERTYAASGLNAAGWDLLLTLYRSAPPEGLRPTELSALAAISGPSTSNRIVRLLEKGLIERREASIRLTPQGRALVTHLLPAHLATTQRVLAPLSAQEQRTLEELAGRMLAGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Transcriptional Regulator HucR from Deinococcus radiodurans Reveals a Repressor Preconfigured for DNA Binding.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Transcription
molecule keywords transcriptional regulator, MarR family
total genus 52
structure length 156
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fbkA00
2ESNA 2FXAA 2DAOA 1U2WA 3BJ6A 1XCBA 5D6FA 4YIIA 3JSOA 4HDUA 4WXDA 3B73A 3LA3A 1LNWA 4CO8A 5D4RA 1IN4A 1WKMA 3KLNA 2A6EF 1OR7A 2MBFA 1D5VA 2EJRA 1ZN2A 2Z3YA 1R00A 3GX4X 3GEZA 1HKQA 4RAZA 1ZRFA 3KETA 2MH2A 3T1BA 1WWXA 2IW5A 2VONA 4Q48A 5L3GA 1P6RA 2JZYA 3KP3A 1F9NA 4HF0A 2ZNYA 1BI1A 4OMYA 1J2XA 4ZZLA 2ZKZA 2FOKA 3CTAA 3TQNA 3TO7A 3FMSA 4G7HF 2EFWA 2RC4A 1YW8A 2D45A 5E18F 5EEHA 1HXDA 5BPDA 1J75A 1HKTA 1FPQA 4U7DA 1R5HA 1O3RA 1K78A 2EV5A 3REOA 5LHGA 1K79A 4MQVA 2NYXA 2W84A 4FX0A 3F21A 3COAC 1IN5A 2FNPA 3GUDA 4KMUX 1DDNA 2PI0A 2Y0MA 3L2CA 3RKXA 1KQ8A 2RVCA 5LRRA 3I54A 1UB9A 1T2KA 2ZCWA 1DPUA 1SD4A 3G3ZA 4L5IA 1GXPA 3TKYA 4IRIA 4BHPA 3HRSA 2Y48A 4CDGA 2GAUA 4N9IA 4GCVA 4N0BA 2STTA 1FBUA 2DW4A 1YIOA 2IA0A 3E6CC 2QQBA 1SD5A 1ZHFA 3KEQA 1MJ9A 4O3MA 3PFIA 1IZ1A 4LB5A 5L3BA 3FXRA 3TOAA 1T39A 1R58A 3CUQA 4IJAA 2M87A 4KA4A 2F5CA 1BN5A 3IWZA 1TQMA 1BI2A 2HZTA 3FM3A 5DUKA 4LLLA 1IAWA 1G3SA 5DEQA 4P9FA 2WTEA 1SAXA 3MEXA 3HIFA 2QM3A 3FMQA 1P4XA 1WRJA 2CWEA 1LEBA 2HFHA 3WE2A 2EA4A 5HLIA 3VFZA 3HSFA 3FWEA 3J80K 1XSDA 4IPAA 3LAPA 1RZ4A 2W85A 2E7WA 4KN4X 1UHWA 1PP8F 2Q8KA 5CVUA 1FYMA 5H20A 3CO7C 2FMLA 1FLIA 4CZZA 5F6FA 3ZN1A 2XKOA 4RAYA 3KEOA 5CJ9A 1R5GA 3QP6A 4L5JA 3RDIA 1X3UA 5FD5A 2DK8A 5E1WA 5HLGA 1JE8A 1R1UA 1TNTA 5LGTA 3ZQ7A 1NHAA 5DD4A 2EV6A 2E1CA 1S29A 2MC3A 4UVCA 5DV5A 1Z6RA 1J59A 2FRHA 2W24A 2VODA 2VXZA 4UV9A 3SQNA 4O5VA 2AXLA 3MAJA 3FX3A 3ELKA 2IA2A 4XRFA 1MZBA 3LSTA 4QWQA 2V79A 5F64A 3BJAA 5F1RA 4UXNA 5D8LB 1Z7UA 1MD0A 4OOIA 4L18B 3T5XA 4P5OA 4G7ZF 3IRQA 3RTRA 2OQGA 4EV0A 2FMYA 4G9YA 3I53A 3I59B 3RKYA 3K0LA 5BMZA 3GLXA 2H94A 2VOPA 2QBYB 3O6BB 3WGIA 1XCVA 5A2QK 4Q47A 3I71A 1FY7A 1ODDA 3HYIA 3ZMZA 2F2EA 2HR3A 1IN6A 2K02A 1IRGA 4LLGF 3MFKA 5BPIA 2OU2A 1IRFA 2M45A 4FX4A 1LEAA 3R4KA 2XROA 2L02A 5H6RA 5K1YA 2BV6A 5E17F 4I0BA 2O8XA 5JHUA 3C7JA 2XAJA 2EK5A 5LEKA 1HBXG 4KDPA 3N97A 3SZTA 1H0MA 2A07F 4ENNA 1HW2A 1LJ9A 3B02A 2X4HA 3CJNA 4BNCA 4UVAA 4YG2F 1RUOA 1O7LA 3K2ZA 1BIBA 1U78A 4MHGA 1ZG5A 1BIAA 2H6CA 3ZMSA 5AIQA 4R8HA 1QBJA 1EH8A 1HKSA 5D5VB 2ACJA 4BH9A 2R7DA 3OV8A 1SFUA 3LA2A 1JHFA 5LHHA 3J81Z 4UNOA 1OMIA 2LSOA 5LLQA 2ELHA 3LQRA 4A5MA 2OA4A 1T98A 2FEZA 3S2WA 2KKOA 4WX9A 2JTVA 2B0LA 1YFHA 2CW0F 2X0LA 1L3LA 1K78B 3JAMZ 2PG4A 2JPBA 1CF7A 2DPDA 2P5LC 4EVIA 2PJPA 4EM2A 1P4WA 4ETSA 2IRFG 3GWZA 3Q5FA 4A6DA 2XV4S 4E70A 4ZYDA 4A12A 5E8IA 3E5UA 2HYFA 3TGNA 3DF8A 4M73A 2VOOA 2XHKA 2FQ3A 4M9XA 1HSJA 2EFNA 3E5QA 3O2PE 4HYEA 5FB2A 2J5PA 3HTSB 1EH6A 1MKMA 5ICFA 3P7NA 1KQ0A 2W57A 3E3VA 4HX7A 1ZH5A 1O3SA 4G6QA 3L9FA 4BHCA 2P5KA 3HHGA 2P7CB 3DPTA 1XGMA 2XAQA 3EYYA 4HV5A 3KP5A 1XSXA 2MLKA 4AWXB 1AWCA 4KUMA 2FBIA 1QQIA 2FU4A 5AIPA 3W6JB 2XIGA 2O6GE 2WC2A 4RGRA 1P2FA 4EJWA 3KP2A 3HUGA 3FF5A 2HGCA 2H27A 3QPHA 2CSOA 3BWGA 4I2OA 1PP7U 2FBHA 3K1NA 4B8XA 5DYMA 4OIQF 5HDNA 1HW5A 3I0TA 4M72A 2WV0A 1R22A 1I1SA 3BPVA 1D8KA 3IL2A 1JHHA 3ZMUA 2LNBA 1IN7A 2J5OA 1RIOH 3LFKA 2ZMEA 3RYRA 3E6BA 3TOBA 2A6HF 3SHFA 1ULYA 6PAXA 4WWCA 3C3WA 1B4AA 2GA1A 5FFZA 3M8EA 1U8RA 1GVJA 2RV8A 1MJBA 1YS6A 1SFXA 5ICGA 2KIUA 1V3FA 3GZ5A 3FMRA 2PQ8A 1G4DA 1ZRDA 5LBQA 1PDNC 2L54A 2FSWA 2M30A 4WXHA 5KVRA 4ZH4F 3Q9VA 3ABUA 5E20A 2D1HA 2ZO4A 1HQCA 1IUYA 3E6MA 2HWVA 1FBQA 3PQKA 2R3SA 2RDPA 1Z6TA 4HBLA 5JR3A 4DQ2A 3WTUC 1O57A 3IRRA 1AOYA 1DPRA 4KN7X 3WU0A 3JW4A 1OYYA 3KP4A 3KZZA 2YU3A 3LQQA 3HTUA 4ESJA 1FSHA 4XLNF 4A0XA 3HOTA 5TJJA 4WK8F 2CO5A 1I27A 1IN8A 1KU9A 4L9NA 1YQAA 1GHCA 4UHTA 3F8BA 4F7ZA 4Q4ZF 1B6AA 1T0FA 1G3TA 1FP1D 1B1BA 3C18A 3HSRA 2GA2A 1P4AA 4KYWA 4IF4A 3W6KB 4KICA 4D0PA 4ZYEA 5DDGA 2YPRA 2YX7A 2RQPA 1SMTA 4S05A 2GIVA 2PMUA 3F6VA 2XUBA 5FO5A 2GWRA 4M9ZA 1QO0D 4LG0A 3L00A 3GFIA 1QPMA 3WU1B 2HTSA 1STZA 1YS7A 1ZLKA 5CVIA 3WODF 2DLLA 3NRVA 4L9VA 1S3JA 3BOQA 3ECHA 4AD9A 3GYHX 1UFMA 3WTVC 3RYPA 1O7FA 5JI6A 4KIBA 3ROUA 4U0YA 2Z9OA 3F23A 2P6SA 1EH7A 3R60A 2C6YA 3BP8A 3U9GA 5BS6A 1BC8C 1WSUA 2CG4A 2OD5A 5D8KB 5ICCA 3IC7A 1XD7A 2ETHA 4LFUA 1Z05A 4BYYA 4FT8A 1W4MA 3RI4A 2BE5F 2HQNA 5L3DA 2AS5F 2G9WA 1RI7A 3KP6A 1T38A 5HS9A 2QQ9A 1TW3A 2K86A 3DP7A 3SZPA 1PUEE 5HS8A 1CF7B 3P9IA 2DQLA 2UZKA 3GFLA 1FNNA 1DUXC 4A0ZA 4LD5A 2ZFWA 3G73A 4YFNF 2M1BA 4G8XA 1I5ZA 3HRMA 1LB2A 2QENA 2A3SA 1ZG1A 4BQAA 4EJOA 1KU2A 1TTYA 1XMAA 1Y0UA 4UVBA 1BC7C 2GQQA 2HOEA 3GW2A 3VEPA 4Z2YA 4I7HA 2GXBA 4Q5SF 1S7OA 1J9IA 3RKWA 3KFWX 4K2EA 3MCZA 2LKPA 4G94A 2DFIA 3ECOA 4RB1A 2D2WA 1XDSA 5IT9K 3ML6A 5FD6A 1E17A 3I58A 3WE3A 2F5EA 5HVQC 1G3WA 2Z99A 3C1DA 4PCQA 5CYVA 3HRTA 3ISPA 1FT9A 1KYWA 3DQVC 3KCCA 1J5YA 1H9TA 1L0OC 2KJBA 3E5XA 3QRFF 1R23A 3QPTA 1V4RA 4GYGA 1HSTA 4HOBA 2CFXA 4UUVA 4CXFA 2RNJA 2JPCA 2EV0A 5ERIA 2ZBKA 2W25A 3TO9A 2HKOA 1YW7A 3GXOA 1G6NA 1B59A 2QUFA 3OOPA 5TRDA 3T0YA 1U5TC 5LGUA 2K7LA 5H6QA 1MJAA 2HEOA 2DO7A 3F8CA 3DV8A 2ZNZA 3GVAA 2PMHA 2YSRA 3M7GA 1W5SA 4G6DA 1FBSA 3WTXC 1BI3A 2CQKA 3HHHA 4I01A 1LDDA 3JTGA 1T6SA 3RPUA 5FLXK 2CYYA 3Q9SA 1KYZA 2K4BA 4PDKA 1R36A 1MDMA 2IVMA 1O3QA 3D5LA 5IT3A 4EM0B 1BJAA 4IRGA 3T8RA 3FM5A 2IJLA 1QGPA 2NNNA 1BI0A 1R1VA 4B09A 4XLPF 2ISZA 2FF4A 2A68F 1I6XA 2VT3A 1USSA 4HQEA 4ENKA 1FC3A 3CLOA 3EETA 2VBXA 3BZ6A 5LEJA 2V6CA 4MTDA 3V4GA 3BPXA 4OIRF 5J8FA 3WTZA 2CGPA 2HDCA 3TDUC 3GO5A 1KQ9A 4KT5C 1USTA 1YG2A 2XAHA 2E7XA 1RNLA 3I59A 4HV6A 3N4MA 2IP2A 1UCRA 5DCMB 3J7AO 1IF1A 4BXUA 3KP7A 4NB5A 5K5RA 3M1EA 5DD8A 1FYLA 4LJZF 5LRSA 1K6OA 4WXCA 4EJVA 3IWFA 5J8CA 1IW7F 5BQTA 4I09A 1BM9A 3WTYC 5L3EA 5KK1A 2QYOA 3E6DA 4L9TA 5CVVA 4IXAA 4R79A 3VOEA 2XAGA 3GF2A 2V1XA 2FA5A 2VBYA 2P8TA 4OU0A 4HZFA 2JSCA 4YFXF 1H9GA 1Z9CA 1JGSA 2P5VA 1WI9A 3FXQA 4CHUA 2ISYA 3ZPLA 4ENJA 1A04A 4IRHA 3WGHA 5E1ZB 3R0AA 5D5WB 1SD6A 3D0SA 4KIFA 3ABTA 3F72A 2HKXA 2VE8A 2UXNA 2PFBA 4ZZDA 1E2XA 5HDGA 3FZVA 3MZHA 1IXRC 3CUQC 4HA8A 4GGGA 2QWWA 1ZYRF 1U3EM 1JXSA 3PQJA 2V1UA 3CUOA 2VBZA 2LF7A 4YIFA 3RPQA 3V8JA 1W7PB 2P4WA 4LK0F 4HX4A 1KGSA 3QOPA 4FHTA 3JSPA 4RB0A 1D8JA 1ON1A 5L3CA 2OAZA 3O3KA 1ZAOA 5LGNA 4EGYA 2HTJA 4HF2A 1W7PD 4M6XA 2COMA 4A5NA 1CGPA 5D5UB 4Y17A 1BBYA 2TDXA 5D6EA 1REPC 1Q1HA 2DU9A 1I1GA 2IA1A 2K27A 3MQ0A 3BY6A 1VTNC 1XGSA 5LHIA 3GFMA 1KU7A 3JAMK 1B9MA 4WF2A 2O0YA 4HLXA 2EFPA 4L0YB 5K5OA 3I64A 4U88A 3F22A 2L01A 2M8EA 4BHBA 1LQ1A 4BAYA 1FP2A 2F5FA 1XGNA 2BBYA 4Y13A 4U7BA 2A5YB 3ULQB 5JFRA 1TQPA 4MEYF 4MGRA 4I0AA 3V8LA 3V7CA 2MA3A 2L3DA 2M5WA 2YX4A 4NHJA 2Q0OA 2DBBA 4U0WA 4AIKA 2OBPA 5FLXZ 4KIGA 5DCMA 2EB7A 2BEOA 4H0EA 3TO6A 1ON2A 3FHZA 3GZ6A 2XAFA 2DQRA 4XSZF 4HLYA 4UV8A 1FSEA 1LVAA 5AONA 5DCFA 1Z91A 5ED4A 1O3TA 2BGCA 2JT1A 4RS8A 4PGGA 2FBKA 3MZYA 1U6GA 3KZYA 2L4MA 4Y15A 3LAJA 1R7JA 5FGMA 1J7KA 3R0JA 1TLHB 2F5DA 5E1XA 4KNYA 3ZMTA 1KA8A 5CVRA 5ICEA 4XSXF 2KJCA 4RB2C 1S6LA 2ZMEB 5CVJA 2DK5A 4LB6B 4EQQA 2NS0A 1OYIA 2HQRA 1TW2A 1P92A 2H09A 3WTWC 3SFZA 2NAZA 3WG9A 2FNAA 3F6OA 2VT2A 5HOOA 5IT9Z 1WQ2A 5HDKA 1U5TA 3M9AA 4M74A 3DPLC 2VN2A 3HSEA 5D5XB 4MQ9F 4RGXA 3SXYA 2MH9A 1YLFA 1XGOA 4HQMA 1F4KA 3QU3A 3F8NA 2QBYA 3KLOA 1W7PA 2O3FA 5J6XA 2Z5UA 4A2UA 2XGXA 4JK1X 3FXUA 2A61A 4GYIA 3VODA 4ZYHA 3HOSA 4L0ZB 3E97A 4N9HA 3U2RA 2HS5A 1J0RA 5HS7A 1IXSB 4A6EA 3LA7A 4ENMA 4IHTA 4GO1A 4M6YA 4OMZA 2MD5A 3EYIA 1XSVA 3H3UA 5D4SA 1F5TA 2EA2A 4MTEA 3BDDA 2ZXJA 1ZRCA 2IPQX 5HLHA 1TQIA 2Q2EA 2XASA 3ZMVA 1W5TA 4CGZA 3P9CA 4I02A 2Z33A 1Z1DA 1SD7A 4M71A 4O6JA 1YO5C 2EFOA 5L3FA 2GXGA 3EQLF 5DUIA 2G7UA 5CLSA 4MEXF 3AAFA 1FWZA 3V7RA 2KRFA 1LDJA 2V9VA 3NQOA 4I98B 4EM1A 4EJTA 3LWFA 1YW9A 1IXCA 3R6SA 1RUNA 4WCGA 1TBXA 3V7SA 2PEXA 2OQRA 4LLNA 3H3ZA 3L09A 2FE3A 3T8TA 4P9UA 1XN7A 4OIOF 4HDVA 5BOXA 3MWMA 2HYGD 2VC0A 3DKWA 3WGGA 2LDUA 2PLYA 2VBWA 5A2QZ 4RB3C 2ADUA 1FX7A 5ILSA 3CDHA 3HRUA 2VC1A 4HAMA 2XRNA 4OIPF 2DTRA 1HW1A 1FZPB 4PGHA 4HW0A 5ILVA 1R1TA 3DXJF 1S8NA 4HF1A 1C0WA 4A0YA 4PZJA 3BROA 4CYDA 3TDZC 3IKTA 1BOAA 2UXXA 3JTHA 4RGSA 1ZG3A 3F8FA 2BYVE 2PN6A 4EGZA 3J80Z 1ZLJA 2NRAC 2R7FA 3EDPA 3IKVA 4LGWA 4AVPA 3RJPA 1OPCA 4YFKF 1ZREA 2E1NA 3H92A 4ESFA 5JVTA 3K1MA 2JRTA 4M9SA 2P7VB 1SFEA 3IHUA 1OYWA 4S04A 2QQAA 2O03A 4ON0A 1D3YA 1YTYA 2PBIA 1QZZA 2QLZA 4KMFA 1KU3A 3U1DA 4TV7A 2DT5A 4R1HA 1G3YA 2OZUA 2Y75A 3L7WA 3DFGA 1QNTA 3QAHA 5E8GA 5K5QA 4AIHA 2RN7A 4RGUA 4ZYGA 4P96A 3DEUA 4G7OF 1EV7A 2OZ6A 2KIMA 1ONVA 2QVOA 1DP7P 2LF8A 1QZYA 3K1PA 3CO6C 3WTSC 2H6BA 2ZJ2A 3I4PA 1XB4A 4EJUA 4IHSA 2P6TA 3F3XA 3ZN0A 4LG0B 1XMKA 4EMSA 1MGTA 4XBFA 2STWA 5EEGA 3F8MA 4OINF 1ZGAA 2RGVA 3V8KA 2RKHA 3K9TA 2KIFA 3KE2A 1FOKA 3P9KA 4JQFA 4QLCU 3RIRA 1GXQA 3WTTC 4NQWA 4CICA 2A69F 4HX8A 2XKPA 2XVCA 2VE9A 3K69A 2V1DA 3I5UA 4LMYA 3M8FA 5ILUA 1ZGJA 4JBAA 3CUQB 3QU6A 1K7AA 2YR2A 3VB2A 3R61A 1F1ZA 3EUHA 4ESBA 2K4JA 2QZ8A 2NNYA 3GFJA 1UHMA 4GXOA 1OKRA 2DI3A 1B9NA 2DPUA 5FFXA 2EFQA 1MDMB 2O61A 3NEUA 3QP5A 1SMYF 1YYVA 3ZMDA 4L9JA 2G7HA 1U5TB 1ZARA 2L4AA 4MNUA 2WWYA 1TNSA 3BJOA 3ZP5A 1S7AA 2D1VA 4LK1F 4IVNA 4P55A 2ESHA 4KFCA 1FYKA 1XDUA 4U0VA 4AIJA 2GZWA 2IT0A 4DNCA 2EWNA 3ERED 4ASNA 3J81K 2UWMA 2MLGA 1LDKB
chains in the Genus database with same CATH superfamily
4I76A 2RQQA 1RKTA 2ESNA 2FXAA 2DAOA 1U2WA 4C3IJ 3BJ6A 1XCBA 2DMNA 2ZMEC 5D6FA 4YIIA 3JSOA 1SVOA 3CCMI 4HDUA 4WXDA 3JREA 3HZJA 3B73A 1NTCA 3PNYA 4E7HA 1OISA 2DCEA 3LA3A 1G2HA 1LNWA 4CO8A 2GOXB 4AU7A 2V6EA 5D4RA 1IN4A 1WKMA 3KLNA 3EUKL 1NK2P 2A6EF 1MW7A 1OR7A 2MBFA 1D5VA 3W2WA 2BXZA 2RNGA 4Y3OA 2EJRA 1ZN2A 2Z3YA 1R00A 3GX4X 4ZTJA 1U9NA 1MBGA 3GEZA 2ZXIA 4UB6C 1HKQA 2BXYA 4RAZA 3S1NJ 1ZRFA 3KETA 4BY1J 1U8BA 2MH2A 3T1BA 4F93B 1WWXA 2IW5A 2R5YB 2VONA 1MH4A 4LOCA 4Q48A 5L3GA 1FMVA 1P6RA 2A6TA 2JZYA 3S17J 3KP3A 3PSIA 1F9NA 1ZK8A 1RPWA 2L5QA 4PJMA 4MO7A 1B72B 1MBJA 4HF0A 2ZNYA 2DFFA 3O8HA 3VSLA 2E19A 5B5EC 1MMDA 1MBEA 3OYLA 2OF7A 1BI1A 4OMYA 1J2XA 2CFOA 4ZZLA 1VQ6I 2EZIA 4ZYAA 2ZKZA 2FOKA 3CTAA 3TQNA 3TO7A 3FMSA 5GAHJ 1Z3YA 4G7HF 1QPIA 2EFWA 2RC4A 1YW8A 2E1OA 3DBRB 4NUBA 2D45A 1IUFA 3S16J 2LREA 5E18F 4B3XA 3ZR8X 5EEHA 1HXDA 5BPDA 1J75A 1HKTA 2CUFA 1FPQA 4U7DA 2X51A 3U21A 2LP0A 1R5HA 3CF5F 5JHFA 4QPQA 4J19A 2LLKA 1O3RA 1K78A 2EV5A 3REOA 5LHGA 1K79A 1QVTA 4MQVA 2NYXA 1Z7LA 2W84A 4FX0A 3F21A 1WH7A 3VSKA 1IN5A 1WI3A 1X1AA 3COAC 2FNPA 3RZOJ 1GUUA 3GUDA 4KMUX 1B8IA 2EIJH 1DDNA 2W1OA 3DKYA 2K3PA 2PI0A 1A6IA 2NVXJ 2IGKA 1ZTRA 2Y0MA 3L2CA 1JKPC 2JA7J 3RKXA 1KQ8A 2RVCA 3G1OA 5LRRA 1RKWA 3I54A 1NG7A 1UB9A 5IP7J 5BNGA 3IUOA 4XKWA 1T2KA 3NARA 2ZCWA 1DPUA 1IDZA 1SD4A 3G3ZA 4L5IA 1GXPA 3DPUA 3TKYA 4IRIA 4BHPA 3HRSA 1IV8A 2B7EA 1S7EA 4Y7NJ 3SYTA 3JRIA 2Y48A 3LSGA 4CDGA 5EGOA 1JUMA 3CCEI 2GAUA 4N9IA 4GCVA 2QSFX 4N0BA 2STTA 1FBUA 1D0ZA 4Y4RA 2DW4A 4V19K 1YIOA 2IA0A 1SC7A 2LBFB 3WHCA 5GPAA 1X1PA 2KQRA 2TCTA 3E6CC 1K4SA 2QQBA 2R7XA 1SD5A 1ORKA 1ZHFA 3KEQA 4P1WA 1SEUA 2VPRA 2R7QA 1VQNI 1TWCJ 3HKZA 1I6HJ 1MJ9A 1YIJI 2CU7A 2CQ7A 4O3MA 2MABA 3PFIA 1IZ1A 4LB5A 2VB6A 5L3BA 3FXRA 3EUAA 3TOAA 3ZQGA 4PJ0C 1T39A 1MBKA 1R58A 3CUQA 1V5EA 4IJAA 2VQLA 1LFUP 2M87A 4KA4A 2F5CA 1BN5A 3IWZA 4V2FA 2H8RA 1TQMA 3CLQA 3S93A 1BI2A 3DBLB 1DGWY 2HZTA 4FE7A 3FM3A 5DUKA 3HOXJ 4BDYA 4LLLA 3DEEA 1IAWA 1G3SA 2BW3A 5DEQA 1ERDA 2CUZA 4P9FA 2H1LA 2WTEA 1SAXA 3OYBA 4FCYA 3MEXA 4HNUA 2DYRH 3BLYA 3HIFA 3OYEA 2QM3A 3FMQA 3ZQHA 1P4XA 4IL6C 2QQ8A 1WRJA 2CWEA 1SVLA 1F36A 1LEBA 4L5EA 5EDNA 3CDIA 4E7KA 2HFHA 3WE2A 3OIPA 2EA4A 5HLIA 3VFZA 2JRMA 3HSFA 1D0XA 3FWEA 1UJ8A 3J80K 2RREA 1XSDA 4IPAA 1E0EA 3LAPA 4DBQA 2L9NA 5EYRA 1RZ4A 2W85A 2ID6A 2VASA 2LG4A 3DWLE 5C4XJ 2E7WA 4KN4X 2Y0SN 3ZQLA 1UHWA 1PP8F 2Q8KA 4FE4A 5CVUA 3TP0A 3DTKA 1FYMA 1RR7A 5H20A 2QCOA 3CP2A 4BE1A 3CO7C 2FMLA 4F92B 1OCPA 2KZGA 1FLIA 3H5NA 4CZZA 5F6FA 3ZN1A 2XKOA 3LSIA 4RAYA 3D1NI 3KEOA 1V55H 3W6VA 1VQLI 3LMMA 5CJ9A 1R5GA 3BC8A 3QP6A 4L5JA 3RDIA 1X3UA 3JRDA 5FD5A 3H0GJ 3OYIA 3GTOJ 3L2VA 2DK8A 4W97A 5E1WA 3BZKA 1VFCA 3DBHB 3K6GA 4HSTA 3EPZA 1TZLA 2V9PA 1QU3A 3HPGA 5HLGA 5IPAA 2PJRB 1RRJA 1JE8A 1R1UA 1TNTA 2A05A 5LGTA 3QPSA 4XOTA 3ZQ7A 2CW7A 1NHAA 2F4IA 5FKOA 5DD4A 1VQKI 3G1LA 2EV6A 2E1CA 1S29A 2MC3A 3HJEA 3MZ8A 4JP0A 5E3NA 1DQUA 4IOAF 4JX4A 2NOGA 5KNLA 2HXIA 4UVCA 5DV5A 1Z6RA 2P81A 1J59A 1WHUA 2FRHA 2W24A 2I10A 2VODA 2VXZA 4UV9A 1YI2I 3SQNA 3CCSI 1IV6A 4O5VA 1WJCA 2VLAA 2R7ZJ 5B1AH 2AXLA 3MAJA 3FX3A 3X2QH 3ELKA 2IA2A 4XRFA 2YS9A 3CC4I 1X4OA 2JA2A 1MZBA 2CV2A 3LSTA 4QWQA 2V79A 1A35A 5F64A 3BJAA 2ZC2A 1K6YA 5F1RA 4UXNA 5D8LB 1Z7UA 3O8GA 2F48A 4RMNA 1MD0A 4OOIA 4L18B 4IQ4A 2DYSH 2MW8A 1ZELA 3T5XA 3S2DJ 3CCUI 4J01A 2V4JC 3F9KA 4P5OA 1WJFA 1E3OC 4G7ZF 4BU2A 4B43A 3IRQA 3RTRA 2OQGA 4M6VA 4DZJA 4EV0A 2WAQA 3DU5A 2NXNB 3AL0C 2M2EA 4E7IA 4BJ5C 5GTHC 4BEHB 5M3MJ 1SANA 3VPRA 2FMYA 2QA4I 1U9OA 3OY9A 4G9YA 2BY0A 3CCVI 1X4PA 3I53A 3I59B 3RKYA 3K0LA 5BMZA 3H9JA 3GLXA 2H94A 3HL2A 2VOPA 4UY8I 2QBYB 3Q3SA 4M3GA 3O6BB 3WGIA 1XCVA 2DMUA 4Q47A 2L0KA 3I71A 4QSHA 5IP9J 5A2QK 1FY7A 1T33A 1ODDA 4BE2A 3HYIA 2XC7A 5HLTA 3JRGA 3HOYJ 3ZMZA 1QZEA 2F2EA 2LBFA 2HR3A 4B44A 1IN6A 2K02A 1MMGA 5TISC 1IRGA 2X1DA 4LLGF 3MFKA 5BPIA 4GRIA 2OU2A 2FUG2 1IRFA 1BJZA 2M45A 4FX4A 1LEAA 4E7LA 3R4KA 1S9HA 2XROA 2L02A 5H6RA 4LITA 2CW8A 5K1YA 2LMDA 1WJDA 2BV6A 1FTZA 5E17F 1I3AA 4I0BA 3RCOA 1X3WB 2O8XA 5JHUA 1MMNA 3C7JA 2XAJA 2EK5A 5LEKA 1HBXG 2CV1A 4KDPA 2E2IJ 3HPHA 3N97A 3SZTA 1H0MA 2WB1N 2A07F 2CQXA 4ENNA 5FROA 1HW2A 1LJ9A 3B02A 2X4HA 3CJNA 1TP4A 4RA2A 3VYSB 4BNCA 3BG6A 4UVAA 4YG2F 1RUOA 1O7LA 3K4CA 3K2ZA 1BIBA 1O4XA 1WVRA 1U78A 5M5YJ 4MHGA 3H1CA 1ZG5A 2FQ4A 1W1WE 3IV5A 1BIAA 2H6CA 3BTCA 3ZMSA 5AIQA 1IC8A 1Y6IA 1IO2A 4R8HA 1EJ9A 3PNVA 1QBJA 4BBRJ 3OMYA 4EEFG 2E2JJ 1UG0A 1EA3A 4ITVA 1HCRA 1Z77A 3TBIA 3G2BA 1EH8A 1HKSA 5D5VB 2ACJA 3DTIA 1VNDA 4BH9A 2R7DA 3PFYA 3OV8A 3GBGA 4ABZA 2M0MA 3LA2A 2WY7Q 1SFUA 5FJ8J 3M4OJ 1JHFA 5LHHA 3J81Z 4UNOA 4KT6A 2DT6A 1OMIA 2LSOA 3OL4A 1NK3P 5LLQA 4D5CA 2ELHA 1TC3C 2CUJA 4XRSG 2KL4A 1TWAJ 3LQRA 2MC4A 2VQCA 5CPRB 4A5MA 4JYKA 2OA4A 1T98A 2FEZA 2NVUB 5J4YA 4OWRB 3ASNH 5DM7F 3S2WA 1MNEA 2KKOA 4XL9A 4WX9A 4LG3A 2JTVA 4CA0A 2B0LA 2VJ4A 1YFHA 2CW0F 2K40A 3CP8A 2X0LA 1L3LA 2WADA 5HNFA 1VZ0A 1K78B 3JAMZ 2PG4A 2JPBA 1CF7A 2DPDA 2P5LC 2PX9A 1OR7C 4EVIA 5E79C 2HDDA 4EM2A 2PJPA 3ZXSA 1P4WA 4ETSA 2IRFG 3GWZA 4KJZA 1JKQC 2O9LA 2XPWA 2HQAA 3Q5FA 4A6DA 1V54H 3LSMA 4DJAA 3JRCA 3K4NA 1W36D 1RESA 2KRCA 2LYCA 2XV4S 5CQEA 4E70A 4ZYDA 2X85A 5K7HA 2H1KA 3OYHA 4A12A 5E8IA 2OTLI 3KYLA 1VQPI 3E5UA 2HYFA 1ZKGA 2EIKH 3TGNA 2XF7A 5F04A 2L9VA 1TT0A 3DF8A 3A01B 4MLOA 4M73A 2VOOA 2HXOA 2XHKA 2FQ3A 4M9XA 1TL8A 1HSJA 3BQZA 2EFNA 3E5QA 3FK7A 3O2PE 2LY9A 2OV7A 4CZCA 3W3CA 4HYEA 5FB2A 2J5PA 3BG9A 3C2GA 3ZRGA 4D7NA 3HTSB 1ETXA 3G71I 1TT5B 4F55A 3QWLA 1EH6A 3K4LA 3MKLA 4C3JJ 1MKMA 2DA5A 1MBFA 3OL3A 5ICFA 5LD2C 3P7NA 1KQ0A 2W57A 2K85A 1WH5A 2JN6A 3L2RA 3E3VA 3BR3A 4HX7A 1ZH5A 3DTEA 2HOSA 2DA1A 1O3SA 4G6QA 3L9FA 3NWSA 4BHCA 2P5KA 2VKEA 3HHGA 3JRAA 2P7CB 3DPTA 1GV2A 1POGA 2XSJC 3IH2A 3A4CA 1XGMA 4II3A 2XAQA 4M3EA 4F52A 1QA6A 3EYYA 4HV5A 4C2TA 3KP5A 2E34A 4XKVA 2DJIA 2P0WA 1XSXA 2MLKA 4AWXB 1AWCA 1WJBA 2FBIA 4KUMA 4DIQA 1QQIA 4PFOA 1OCTC 2FU4A 5AIPA 4F3QA 3W6JB 2ELJA 2XIGA 2VI6A 3H36A 2O6GE 2WC2A 4RGRA 1P2FA 2AO9A 4EJWA 2RAEA 3HUGA 3KP2A 5IY5H 2NOJB 1IJWC 3AG4H 3FF5A 2HGCA 2H27A 3HKZN 3UKGA 3HG9A 3QPHA 4F91B 2CSOA 3BWGA 5HODA 4I2OA 1PP7U 3BQYA 2VL8A 2FBHA 3TMOA 3K1NA 4DW6A 4B8XA 4AM3A 5E3LA 1Y8QB 2KFDA 1TWFJ 1YX5A 5DYMA 4OIQF 5HDNA 1HW5A 3I0TA 4M72A 1ETQA 2WV0A 2VXDA 2JVGA 4G12A 1R22A 5IYBJ 1I1SA 3BPVA 1DU0A 1XX5A 1D8KA 2E5ZA 1NH3A 3IL2A 1JHHA 3A0BC 2K9MA 1WJ5A 3ZMUA 1T0FC 2LNBA 4E4HA 3FXLA 4MIMA 2OC6A 1IN7A 2F4MB 2J5OA 1RIOH 2F5VA 3LFKA 1GT0C 2ZMEA 4BDZA 3RYRA 5E3MA 4UUTA 3E6BA 4RM3A 4A3JJ 3TOBA 2A6HF 3SHFA 2M4GA 1ULYA 6PAXA 4WWCA 3C3WA 2XGDA 1AHDP 4E6KG 1B4AA 2GA1A 5FFZA 3E7LA 3FKIJ 3M8EA 3K4BA 3CCQI 2L9RA 4RM2A 1U8RA 1GVJA 2RV8A 3GTJJ 1W36C 1JI8A 3ZQCA 4AUXA 1MJBA 4BS9A 1YS6A 1SFXA 5ICGA 2KIUA 1V3FA 3GZ5A 4V2GA 3FMRA 2PQ8A 1G8XA 1G4DA 1ZRDA 5LBQA 1XG1A 1PDNC 2MSYA 2L54A 2EQRA 3L2QA 2FSWA 1T56A 2M30A 4XMYA 4QIWN 4WXHA 4RBOA 3PM1A 5KVRA 4ZH4F 1LPQA 5GADJ 3Q9VA 4DOZA 3DLLF 1LE8A 1MIJA 2E35A 3ABUA 1YRNA 2GXAA 3EUHC 4XR6A 5E20A 3BZCA 3JRFA 3K70C 2D1HA 2ZO4A 1HQCA 2V7FA 1JT0A 1IUYA 2KRHA 1HDDC 3E6MA 2HWVA 4A3MJ 2L7FP 1FBQA 2KISA 3CDLA 3MVPA 1APLC 3PQKA 2R3SA 2RDPA 1Z6TA 4HNVA 2KDZA 2GOMA 3OR2C 4HBLA 5JR3A 3K7AJ 2QEXI 3I4NJ 4DQ2A 3WTUC 5CKTA 2V9KA 3OIOA 4CYCB 2ZSHB 2GM4A 1NG6A 3LNQA 3IH3A 1O57A 1ETWA 1J09A 3IRRA 3VYTB 3CMMA 2M3AA 5J40A 1AOYA 1DPRA 4KN7X 3WU0A 2GLOA 3JW4A 3ZQFA 1OYYA 2M7AA 1DGRM 3KP4A 5GPCA 3W2AA 3KZZA 5FKNA 2YU3A 2Y0SA 2B9SA 4XLEA 2UV1A 3LQQA 1ZGWA 2ECCA 3HTUA 4ESJA 2DA2A 1FSHA 3S3NA 1X3ZB 3VYUB 4XRSA 4XLNF 1R49A 4E7ZA 4HPQA 3CJQB 2D5VA 4A0XA 3HOTA 3QYEA 4JOMA 2HPMA 3LSRA 5TJJA 3S15J 2BZTA 4WK8F 2CO5A 1I27A 1IN8A 1KU9A 1HLVA 2VJJA 4NC8A 2XDVA 4IHVA 4L9NA 1YQAA 1GHCA 2K9SA 2N8GA 4UHTA 2R7UA 2JA6J 1KONA 3F8BA 2W48A 4F7ZA 4Q4ZF 2CQNA 3ABLH 3FDYA 1FOXA 1T0FA 1B6AA 1G3TA 1B1BA 1FP1D 3C18A 3HSRA 2GA2A 1P4AA 4KYWA 3KEYA 4IF4A 3JCUC 3W6KB 2X1CA 3M8JA 4KICA 3Q0WA 1D0YA 4D0PA 2QF7A 3UR3C 2YPRA 4ZYEA 5DDGA 3Q0VA 1I3QJ 3CZ6A 4UUSA 2YX7A 2LVSA 1H8AC 1UELB 2RQPA 1QHGA 1SMTA 4S05A 2GIVA 2L7MP 1AU7A 4NC6A 2PMUA 3QYBA 3F6VA 4GFBA 2XUBA 5EJCA 5FO5A 3CD6I 1ENHA 3HBLA 2WBMA 2GWRA 4FETA 3UNGC 4M9ZA 1QO0D 2EZHA 4HG2A 3FHNA 4RAFA 3B6AA 4LG0A 3L00A 3GTQJ 1ETOA 3GFIA 2L7KA 1K83J 2KZVA 4A3KJ 3CC2I 3JRHA 1T8IA 3CMAI 1QPMA 4PK4A 3TP3A 2HTSA 2XB5A 2DA7A 3WU1B 3W2VA 1STZA 1OLTA 1YS7A 2ELKA 4BXXJ 1ZLKA 5CVIA 2GIZA 2Y31A 3WODF 2DLLA 3GZNB 2I5UA 3NRVA 4AYBN 4L9VA 1S3JA 1XPXA 3BOQA 3ECHA 4YEJA 2DN0A 4AD9A 3GYHX 1UFMA 3WU2C 3GTLJ 2L2OA 3WTVC 4PJNA 3RYPA 2NS7A 1O7FA 3KZIC 5JI6A 4KIBA 3D5SC 3ROUA 3OWTA 4U0YA 1Z67A 5JVGF 1ETKA 2Z9OA 3F23A 2EINH 2P6SA 4IHYA 1EH7A 3R60A 2C6YA 4G6TB 3BP8A 3U9GA 3MKYB 5BS6A 1BC8C 2B63J 4Y52J 2WAFA 3QYFA 2AQFA 1WSUA 3Q0UA 2CG4A 2OD5A 1JUPA 2X6XA 5D8KB 5ICCA 1K61A 2M34A 3IC7A 1OFCX 3RKQA 1UG2A 1XD7A 2VJIA 2ETHA 4YRVA 3ONQA 2DDAA 4LFUA 2HVSA 1I50J 4PUSA 1PUFA 1TWGJ 4KISA 2IAIA 2EPFA 4BGDA 1Z05A 4BYYA 1GLNA 4D5FA 4FT8A 1W4MA 2TRTA 1UHSA 5GP9A 3RI4A 2YUSA 2BHYA 3BCAA 2BE5F 4CSWA 5GAEJ 2HQNA 5L3DA 2AS5F 2G9WA 1RI7A 1YX3A 1R9TJ 2KPMA 3KP6A 2JMWA 1T38A 5HS9A 2QQ9A 2K5CA 3H35A 1TW3A 2K86A 3DP7A 3SZPA 1SFOJ 1PUEE 1OCRH 1Y1VJ 5HS8A 3OOUA 2OCCH 1CF7B 3PIPF 1XTAA 2DQLA 3P9IA 3JRBA 2XAUA 5EG0A 3GFLA 2UZKA 1AKHB 4AYBA 2HPIA 4OAYA 5FKLA 1FNNA 1N77A 5FRNA 1DUXC 4A0ZA 4LD5A 2WV1A 3WHBA 3CCRI 2ZFWA 3G73A 1UAAA 4YFNF 2M1BA 5JLXA 3GMEA 4G8XA 4XM3A 1I5ZA 3HRMA 2ZJPF 1LB2A 2QENA 1IG7A 1VI0A 1FTTA 2A3SA 1ZG1A 4BQAA 3S14J 4CCKA 2O8KA 4EJOA 1YOVB 4YELA 3IAS2 1KU2A 1TTYA 2FOWA 4X0GA 2BVLA 1XMAA 1Y0UA 2DJNA 4UVBA 3LL7A 1BC7C 1Y1WJ 2ZB9A 1ITYA 4E7JA 1A6QA 2GQQA 5FRMA 2BW3B 2EZLA 2HOEA 2VQGA 3GW2A 4JX6A 3VEPA 1MSFC 4Z2YA 2XGCA 1YHQI 1OCZH 3MN2A 4I7HA 2GXBA 3DU6A 4Q5SF 5DS9A 1S7OA 2OPTA 3FKJA 3KYDB 1J9IA 3RKWA 3KFWX 2X6WA 3CCLI 4K2EA 3MCZA 5C44J 2MGQA 4BL0B 2LKPA 4G94A 2DFIA 3FBNB 3ECOA 4IZZA 4RB1A 2D2WA 3PO3J 1XDSA 5IT9K 1Y56A 3ML6A 4B48A 5FD6A 4II2A 3HOZJ 1BA5A 4CCOA 1E17A 4I6ZA 2DTZA 3I58A 4B1RA 4C2UA 3OIQA 3WE3A 2F5EA 1N78A 4UB8C 5HVQC 1ETVA 2X48A 3C2HA 1B72A 3FXOA 1DP3A 1G3WA 2Z99A 2VQHA 3C1DA 3RZDJ 4PCQA 1G59A 5CYVA 2R5YA 3HRTA 4X6AJ 3ISPA 5B1BH 3S1QJ 1FT9A 1KYWA 2DA3A 3DQVC 1D1CA 3CESA 3LSPA 3KCCA 1J5YA 1H9TA 1WCMJ 2MG4A 1CQTA 1L0OC 2KJBA 3E5XA 3QRFF 1R23A 3QPTA 3GTKJ 1N25A 1V4RA 1Y39A 4GYGA 3GTGJ 1HSTA 4HOBA 2CFXA 2ECBA 4MFEA 4CXFA 4UUVA 3I55I 2RNJA 2JPCA 2EV0A 2LKSA 5ERIA 3H5RA 2ZBKA 3OYFA 1PJRA 2W25A 3TO9A 4RAGA 2HKOA 1YW7A 3GXOA 1G6NA 1B59A 2QUFA 3OOPA 3GTPJ 1P9QC 2OUMA 1D1AA 1EKEA 5TRDA 1P7IA 4BACA 3T0YA 3CF2A 1U5TC 2CH0A 2JSPA 5LGUA 2K7LA 1BW5A 5H6QA 1MJAA 2HI3A 2HEOA 2DO7A 3F8CA 3DV8A 2ZNZA 3GVAA 2PMHA 2YSRA 3DKXA 3FXJA 3M7GA 3HOUJ 3BTLA 1B8IB 1W5SA 3A0HC 4G6DA 1FBSA 2KLOA 3WTXC 1BI3A 3K70D 1WJEA 2CQKA 3HHHA 1RC9A 4IQJA 4I01A 1MH3A 1LDDA 1T6SA 3RPUA 3JTGA 2I8DA 5FLXK 2IS6A 2CYYA 3Q9SA 1KYZA 2K4BA 5F1JA 4PDKA 1R36A 4X1EA 5IOYA 1GV5A 1MDMA 2IVMA 5JLWA 1O3QA 3D5LA 5IT3A 4XN3A 1BR1A 4EM0B 3ZQQA 1WZ2A 2LY1A 1BJAA 4IRGA 4KITB 4RLQA 5HNHA 3T8RA 3FM5A 2IJLA 1QGPA 2NNNA 2Q1ZB 1FEXA 1BI0A 1R1VA 3E0JB 4B09A 4XLPF 4A3DJ 5M5WJ 2ISZA 2FF4A 2A68F 1I6XA 2VT3A 3K10A 2Z1DA 3BR0A 3FISA 1USSA 5F08A 4BXFA 4HQEA 4ENKA 4IKFA 1FC3A 3CLOA 2NVTJ 3EETA 1JTXA 2VBXA 2HDWA 3BZ6A 5C4JJ 3I4MJ 2IS4A 3QQAA 5FKMA 2F6CA 5LEJA 4DGWB 5J1RA 2V6CA 3MMYB 4MTDA 3V4GA 3BPXA 2BOLA 4OIRF 4HEA2 1S5LC 5J8FA 2HZDA 4D9JA 3WTZA 1LE8B 2CGPA 5IYCJ 1R4NB 2HDCA 3OYAA 3TDUC 3AFHA 3GO5A 1KQ9A 2VUMJ 4KT5C 3ASOH 4BUPA 1USTA 1YG2A 3QPLA 5K7ZA 3PJRA 2XAHA 4LIVA 2E7XA 2VJ5A 3F0CA 4BBSJ 1RNLA 3I59A 2JUGA 1WGXA 3DCFA 2R92J 4HV6A 4FASD 2HYJA 2Q2EB 2Z16A 3N4MA 2IP2A 2NVQJ 1UCRA 3FK6A 5DCMB 3J7AO 1HDPA 1IF1A 4BXUA 3KP7A 1U0JA 3FIWA 1WPKA 4NB5A 5K5RA 2R7TA 3M1EA 1MNMC 1UZCA 1R6RA 2IXSA 4U87A 5DD8A 1FYLA 4LJZF 1X2NA 5IOZA 3D5RC 4ZC3A 5LRSA 1K6OA 2R93J 4WXCA 4EJVA 2K9LA 3IWFA 2BVMA 5J8CA 3HEFA 1IW7F 5BQTA 4I09A 1BM9A 2NVYJ 2ZSIB 5L3EA 3WTYC 2EIMH 4LIUA 5KK1A 2QYOA 3E6DA 4L9TA 2X6YA 5CQGA 5CVVA 3NAUA 1ZR4A 4IXAA 2DOEA 4R79A 2O5RA 2QKLB 3VOEA 2WAQN 2XAGA 3GF2A 5FLMJ 2MFZA 1Y0NA 2E1MB 2M7BA 1Q1VA 2LK2A 1JJ8C 2V1XA 2DOFA 4C2MJ 3BTIA 3RPUD 5B3SH 2FA5A 2VBYA 2P8TA 1VQ5I 4HRIA 4OU0A 2ME6A 1QHHD 4HZFA 1TWHJ 2JSCA 3HXLA 4YFXF 1H9GA 1Z9CA 4IX7A 1BOBA 1JGSA 1MMAA 3DEWA 3PSFA 2DMQA 3QOEA 2P5VA 3OYGA 1WI9A 3FXQA 4CHUA 4A3EJ 2ISYA 4XIDA 3ZPLA 2W00A 3OR1C 4ENJA 2IGNA 2E5NA 4XRMA 2DFEA 2JUCA 2XB0X 1A04A 1FIPA 4IRHA 3WGHA 2IEKA 5E1ZB 3R0AA 5D5WB 1SD6A 3D0SA 4KIFA 3OS2A 3ABTA 3F72A 2HKXA 2VE8A 2HNHA 1BR2A 1OCCH 2UXNA 1ACIA 2PFBA 4ZZDA 1E2XA 2DOAA 5HDGA 3FZVA 1FIAA 3MZHA 3S3OA 1D5YA 3K4KA 2VKVA 2W82A 1IXRC 3BR1A 4FTHA 3CUQC 4HA8A 4GGGA 2QWWA 2PJRA 1ZYRF 4PSWA 3SDBA 4FQGA 3FXMA 1U3EM 1JXSA 3BTJA 1X2MA 3PQJA 2V1UA 3CUOA 1VQ4I 3B6CA 2VBZA 2LF7A 4YIFA 3RPQA 1YJWI 2LC2A 1JKOC 5EGOB 1JUSA 3V8JA 3A1YA 3I9V2 1W7PB 1FOYA 3AL0B 4AIDA 2P4WA 4LK0F 4HX4A 3KYCB 1KGSA 2LH9A 4PJLA 3E1SA 3QOPA 4FHTA 3JSPA 4RB0A 5M3FJ 2JA8J 4Y33A 1D8JA 2XF5A 1JT6A 1ON1A 5L3CA 2OAZA 3O3KA 3PUFA 1ZAOA 2MYSA 3AKZA 5LGNA 2CS3A 2HOTA 4EGYA 3RSNA 2CV0A 2DA4A 2HTJA 4HF2A 1W7PD 1LFPA 4M6XA 1FMWA 3A03A 2COMA 5GTIC 3S1MJ 2XPVA 1X1CA 3J7ZI 4A5NA 1Z21A 3SJMA 2OCEA 5J4VA 5D5UB 1CGPA 4PJJA 4HNTA 3CMYA 2DA6A 4Y17A 1BBYA 2TDXA 5D6EA 3H0DA 1REPC 5M5XJ 1Q1HA 3OS0A 2DU9A 3HM5A 1I1GA 2IA1A 2VKDA 2IS2A 2K27A 2CUEA 1I39A 3MQ0A 1A31A 3BY6A 1Y8RB 3I3LA 3GTMJ 1VTNC 4DBRA 1XGSA 4XLAA 4XLHA 5LHIA 4BEHA 2JQ7A 3GFMA 1PYVA 4QPOA 1KU7A 3JAMK 1B9MA 3A01A 1WJAA 1VQOI 4WF2A 2O0YA 2X6OA 2BHZA 4HLXA 3TW6A 2EFPA 1HA8A 4L0YB 1YE9A 5K5OA 3RQ4A 3I64A 4U88A 3F22A 3H5AA 4IO9F 3KIOA 2L01A 2M8EA 4BHBA 1LQ1A 2LY2A 1IDYA 4BAYA 1FP2A 3TEDA 2AQEA 2F5FA 1XGNA 2BBYA 4Y13A 3L1PA 4A3CJ 3PL8A 2MD0A 1KZHA 4JX5A 4U7BA 1GDTA 3MD2A 2A5YB 3ULQB 5JFRA 1TQPA 4MEYF 3OYKA 4MGRA 4I0AA 2WB1A 3BG3A 2HU9A 3V8LA 5J3LA 4XLCA 1A36A 3V7CA 2MA3A 2L3DA 2JVHA 2M5WA 1JJ6C 1A5JA 2YX4A 3IP4B 4NHJA 2Q0OA 2DBBA 4U0WA 2E71A 4AIKA 2KP6A 2OBPA 2JWTA 5FLXZ 4KIGA 5DCMA 2EB7A 2BEOA 2BY1A 3I56I 2CQQA 1LKXA 3MKZA 4XKBA 4H0EA 2IGOA 3TO6A 2V1NA 2ZFUA 1ON2A 3HUGB 1OJLA 2R5ZA 2E1MC 3FHZA 2XAFA 3GZ6A 4Z6YA 1FOWA 2DQRA 1W5CC 4XSZF 2VPLA 2Y9ZA 4HLYA 4UV8A 4A3FJ 1FSEA 1LVAA 2E36A 5AONA 1K4TA 3ESWB 4DZPA 5DCFA 1Z91A 2F4OB 4W1UA 2A5WA 5ED4A 3SEQA 1O3TA 2BGCA 4DYCA 2M4KA 3ZOBA 2JT1A 4RS8A 4PGGA 2FBKA 3MZYA 1U6GA 3KZYA 2L4MA 4Y15A 3SZGA 3LAJA 4IEJA 4A93J 1R7JA 3FBIB 5FGMA 1J7KA 3MKWB 3G1MA 3R0JA 1TLHB 2F5DA 2LOOA 5E1XA 3K4JA 2XSDC 4KNYA 2QSHX 3AG2H 4BQNA 3ZMTA 2DT7B 1KA8A 3BR6A 5CVRA 1XMXA 4AC0A 3SDGA 5ICEA 3H9QA 3LSJA 4XSXF 2KJCA 1SFKA 4RB2C 2R7RA 4XORA 3OSFA 1S6LA 2KT0A 2ZMEB 4GDFA 5CVJA 2DK5A 1MSEC 3DLAA 4LB6B 4EQQA 2NS0A 1OYIA 2HQRA 2X1EA 1TW2A 1HF0A 3H9GA 2QSGX 1P92A 2H09A 3WTWC 3SFZA 2NAZA 3WG9A 2FNAA 3F6OA 3S3MA 2VT2A 5HOOA 5IT9Z 1WQ2A 3M07A 5KCMA 5HDKA 1U5TA 3M9AA 2Y30A 2L7ZA 2YU9J 1RR8C 4M74A 1N75A 2Y9YA 3DPLC 4XONA 3ABKH 2VN2A 3HSEA 1W0TA 5D5XB 4MQ9F 4RGXA 5E3OA 3SXYA 2MH9A 1BR4A 3CMEI 1YLFA 1XGOA 4HQMA 4PSXA 1F4KA 3QU3A 3PNTA 3F8NA 2QBYA 2XRLA 4B3AA 3KLOA 2ZJRF 1W7PA 2O3FA 3BCBA 5J6XA 4QTRA 1YRNB 1H89C 2Z5UA 4BKXA 1LUJB 2XGXA 3NWTA 4A2UA 3S2HJ 2R7OA 1AA7A 3HB9A 4JK1X 2DDBA 3FXUA 4XOPA 1T95A 3L2UA 2A61A 4GYIA 4IHWA 5H2FC 1X58A 3L2WA 2AHQA 3VODA 4ZYHA 4NDLA 3HOSA 4L0ZB 2IS1A 2HOAA 5J1UA 4ANJA 3E97A 4N9HA 5FKKA 3PO2J 1F43A 1LFBA 3U2RA 2HS5A 3V42A 3OYDA 4RLFA 4CYCA 1J0RA 3LSHA 4CUGA 3M3YJ 1X19A 5HS7A 3IH4A 2R7WA 1HOMA 1IXSB 4A6EA 3LA7A 2HVQA 4D1QA 4ENMA 2VIXA 4IHTA 4GO1A 4M6YA 4OMZA 2MD5A 3CC7I 3H3VK 4BE0A 3EYIA 3ZCOA 3BR2A 1XSVA 5FLVA 3H3UA 4HSRA 5D4SA 1F5TA 2EILH 1SVMA 3J7AY 2EA2A 4IOCF 4CCNA 4MTEA 3BDDA 2X9DA 2ZXJA 1OCOH 1ZRCA 2E2HJ 2IPQX 5K7FA 5HLHA 4YIRX 4M3DA 1R71A 1TQIA 2Q2EA 2XASA 3ZMVA 1W5TA 4CGZA 2LR8A 3P9CA 4I02A 4CCLA 2Z33A 3BG7A 1Z1DA 1LVKA 1XC5A 3FXKA 5EEAA 2Z2SB 4OAZA 1R5ID 1SD7A 4DYQA 4M71A 2R0QC 4O6JA 1YO5C 2EFOA 4C9YA 5L3FA 2PMZA 2GXGA 3EQLF 5LFAA 2LKXA 3BR5A 5DUIA 2G7UA 5CLSA 3WG7H 3N05A 4MEXF 2Y2ZA 1XS9A 4N4OB 1FWZA 2CMPA 3V7RA 3AAFA 1MNDA 1X1BA 2COBA 2KRFA 1S72I 1LDJA 2V9VA 1IRXA 2FX0A 3K2AA 3NQOA 3S1RJ 4I98B 3BG5A 3HOVJ 4NQWB 4EM1A 3CQZJ 4XICA 1YITI 3BT9A 4EJTA 4BQOA 4AVZA 3LWFA 1YW9A 1IXCA 2DXIA 2W4SA 3R6SA 1RUNA 4WCGA 4CCJA 5KAFC 1TBXA 3V7SA 3S32A 2M8GX 2PEXA 1E3HA 2OQRA 4LLNA 3H3ZA 2XPUA 2WA0A 2AXTC 3L09A 2FE3A 3T8TA 4P9UA 1XN7A 4OIOF 3A02A 5DM6F 4HDVA 5BOXA 2EH3A 4S0HB 1MMSA 3MWMA 2HYGD 4M3FA 2VC0A 3DKWA 3WGGA 2LDUA 2PLYA 2VBWA 5A2QZ 5IYDJ 2OTJI 4RB3C 2ADUA 1FX7A 1JTYA 5ILSA 3CDHA 3HRUA 4IHXA 3OSGA 2ME0A 2VC1A 3OYMA 4HAMA 2XRNA 3ERMA 4DYRA 2KHMA 1IRZA 3CCJI 5F27A 4OIPF 2DTRA 2NS8A 2M9HA 1HW1A 3K4MA 1FZPB 4EATA 2KIQA 4ZDOA 3LFUA 4PGHA 4HW0A 1WFXA 5ILVA 1R1TA 3DXJF 1S8NA 4HF1A 2QKMB 3U1KA 1C0WA 4A0YA 3SEZA 4PZJA 1EF4A 3BROA 1Z0XA 4CYDA 3TDZC 3IKTA 1PVEA 1BOAA 3OYJA 4ZJZA 3OYCA 2UXXA 3JTHA 4A3IJ 1FJLA 3P5JA 4RGSA 1ZG3A 3F8FA 2BYVE 2OJED 3CCYA 2PN6A 2FD5A 2DODA 2G0EA 3GLLA 4EGZA 3J80Z 1T08B 2ZXHA 4N4NB 2W7NA 1ZLJA 3LSKA 2JA5J 4A3LJ 2NRAC 2R7FA 4FISA 3EDPA 3IKVA 4J00A 5F0CA 1M1EB 4LGWA 1BL0A 4AVPA 1RETA 1V5FA 3A2KA 3RJPA 1OPCA 4YFKF 1ZREA 2E1NA 4C30A 3H92A 4ESFA 1VQMI 2CJJA 1JGGA 2IBDA 2VKHA 2M0CA 5JVTA 4NBQA 3GCMA 4I99C 3K1MA 2JRTA 1MBHA 4A69C 4M9SA 3J7YJ 2P7VB 4CCMA 3JR9A 1SFEA 2PMZN 3SFIA 1X1DA 3IHUA 3TL4X 2DFHA 1OYWA 3QODA 4S04A 2QQAA 3ZQIA 2O03A 2HVRA 1OQYA 4ON0A 1VQ8I 2XGEA 4RDUA 5EZGA 1D3YA 2LTPA 1YTYA 2PBIA 5J1YA 2FJ1A 3TW7A 1QZZA 2WAEA 1V5GA 2QLZA 4KMFA 2KMUA 1KU3A 2LFBA 4XKCA 2XF6A 3VYRB 3U1DA 4TV7A 2R7SA 2HQ5A 2DT5A 2R4GA 4R1HA 3OS1A 1SAUA 1G3YA 3KPHA 1IGNA 2OZUA 5J47A 4ZTFA 2Y75A 3L7WA 3DFGA 3IAM2 1QNTA 1ETYA 2JK3A 2EBIA 3QAHA 5EZHA 2Y69H 5E8GA 3M1CA 5K5QA 3PUBA 3G4SI 4AIHA 1UMQA 2RN7A 5GAGJ 3AG1H 4RGUA 4ZYGA 4P96A 1VF9A 3DEUA 4G7OF 1EV7A 2IGMA 2OZ6A 5KHDA 2KIMA 1ONVA 2QVOA 3HDDA 4UUSB 2L9SA 2CRGA 2LF8A 1DP7P 1QZYA 2LD5A 3K1PA 3CO6C 1QRYA 3WTSC 4E7SA 2H6BA 2ZJ2A 3I4PA 1XB4A 4EJUA 4IHSA 2P6TA 5TGTA 4XQFA 3F3XA 3HOWJ 4ZDLA 3ZN0A 2K9NA 4D7MA 4LG0B 1XMKA 4EMSA 1MGTA 2GBYA 3PIOF 3G6EI 4XBFA 1E3PA 2STWA 2R5ZB 5EEGA 3F8MA 4OINF 1ZGAA 5IP6A 2RGVA 4A3GJ 4B4CA 3V8KA 2RKHA 3K9TA 3HGYA 2KIFA 5F0HA 3HGGA 3KE2A 1FOKA 3CJTB 3P9KA 4JQFA 4BJTA 4QLCU 3RIRA 1DU6A 1GXQA 2ZJQF 1H88C 3WTTC 1VQ7I 3VWBA 2K9QA 4NQWA 3LOCA 3KX2A 4NC7A 4CICA 2A69F 4HX8A 2XKPA 2XVCA 2VE9A 3K69A 1JKRC 1D1BA 4BY7J 2UUZA 1PUFB 2BY3A 4XNFA 2V1DA 3I5UA 5EF6A 4LMYA 3M8FA 5ILUA 2ZXWH 2H8WA 2V26A 1ZGJA 3ZGKA 1BW6A 4JBAA 3CJRB 3S8PA 3CUQB 3QU6A 3OYNA 1K7AA 2YR2A 4CH7A 3VB2A 2JJ7A 3VDXA 3R61A 2K3FA 2R7VA 1F1ZA 3EUHA 2O7OA 1P7JA 4H4KC 5KAIC 1GVDA 2ID3A 4ESBA 3C2BA 2K4JA 2KDOA 2QZ8A 4B47A 2NNYA 2LRDA 2EZKA 3GFJA 1UHMA 3ABMH 4GXOA 1OKRA 1HC8A 2E60A 2DI3A 1B9NA 1ZQ3P 5DTDA 1R4MB 3RQIA 4C3HJ 2DPUA 5FFXA 2EFQA 1MDMB 4BJ6C 2O61A 3NEUA 3QP5A 2ICWG 4XN0A 5B66C 2QGUA 1SMYF 1YYVA 3ZMDA 4L9JA 2G7HA 4NNJA 2DMPA 1U5TB 4ZDPA 1ZARA 4M3BA 1YJNI 2L4AA 4MNUA 2WWYA 1TNSA 2DMTA 3BJOA 3ZP5A 1YJ9I 1ZR2A 1S7AA 1QVUA 1Z3XA 2D1VA 4LK1F 4IVNA 4MFDA 3AG3H 4P55A 5EG0B 4XK4A 1AKHA 4XLFA 9ANTA 4BQQA 2ESHA 4KFCA 1FYKA 5F0FA 1XDUA 4U0VA 4AIJA 1W0UA 2BY2A 2GZWA 2IT0A 3HC7A 5C3EJ 4PFPA 4DNCA 2EWNA 3ERED 2WY8Q 4ASNA 4A3BJ 3J81K 1VQ9I 2UWMA 2MLGA 1LDKB
chains in the Genus database with same CATH topology
2ESNA 2FXAA 2DAOA 1U2WA 3BJ6A 1XCBA 5D6FA 4YIIA 3JSOA 4HDUA 4WXDA 3B73A 3LA3A 1LNWA 4CO8A 5D4RA 1IN4A 1WKMA 3KLNA 2A6EF 1OR7A 2MBFA 1D5VA 2EJRA 1ZN2A 2Z3YA 1R00A 3GX4X 3GEZA 1HKQA 4RAZA 1ZRFA 3KETA 2MH2A 3T1BA 1WWXA 2IW5A 2VONA 4Q48A 5L3GA 1P6RA 2JZYA 3KP3A 1F9NA 4HF0A 2ZNYA 1BI1A 4OMYA 1J2XA 4ZZLA 2ZKZA 2FOKA 3CTAA 3TQNA 3TO7A 3FMSA 4G7HF 2EFWA 2RC4A 1YW8A 2D45A 5E18F 5EEHA 1HXDA 5BPDA 1J75A 1HKTA 1FPQA 4U7DA 1R5HA 1O3RA 1K78A 2EV5A 3REOA 5LHGA 1K79A 4MQVA 2NYXA 2W84A 4FX0A 3F21A 3COAC 1IN5A 2FNPA 3GUDA 4KMUX 1DDNA 2PI0A 2Y0MA 3L2CA 3RKXA 1KQ8A 2RVCA 5LRRA 3I54A 1UB9A 1T2KA 2ZCWA 1DPUA 1SD4A 3G3ZA 4L5IA 1GXPA 3TKYA 4IRIA 4BHPA 3HRSA 2Y48A 4CDGA 2GAUA 4N9IA 4GCVA 4N0BA 2STTA 1FBUA 2DW4A 1YIOA 2IA0A 3E6CC 2QQBA 1SD5A 1ZHFA 3KEQA 1MJ9A 4O3MA 3PFIA 1IZ1A 4LB5A 5L3BA 3FXRA 3TOAA 1T39A 1R58A 3CUQA 4IJAA 2M87A 4KA4A 2F5CA 1BN5A 3IWZA 1TQMA 1BI2A 2HZTA 3FM3A 5DUKA 4LLLA 1IAWA 1G3SA 5DEQA 4P9FA 2WTEA 1SAXA 3MEXA 3HIFA 2QM3A 3FMQA 1P4XA 1WRJA 2CWEA 1LEBA 2HFHA 3WE2A 2EA4A 5HLIA 3VFZA 3HSFA 3FWEA 3J80K 1XSDA 4IPAA 3LAPA 1RZ4A 2W85A 2E7WA 4KN4X 1UHWA 1PP8F 2Q8KA 5CVUA 1FYMA 5H20A 3CO7C 2FMLA 1FLIA 4CZZA 5F6FA 3ZN1A 2XKOA 4RAYA 3KEOA 5CJ9A 1R5GA 3QP6A 4L5JA 3RDIA 1X3UA 5FD5A 2DK8A 5E1WA 5HLGA 1JE8A 1R1UA 1TNTA 5LGTA 3ZQ7A 1NHAA 5DD4A 2EV6A 2E1CA 1S29A 2MC3A 4UVCA 5DV5A 1Z6RA 1J59A 2FRHA 2W24A 2VODA 2VXZA 4UV9A 3SQNA 4O5VA 2AXLA 3MAJA 3FX3A 3ELKA 2IA2A 4XRFA 1MZBA 3LSTA 4QWQA 2V79A 5F64A 3BJAA 5F1RA 4UXNA 5D8LB 1Z7UA 1MD0A 4OOIA 4L18B 3T5XA 4P5OA 4G7ZF 3IRQA 3RTRA 2OQGA 4EV0A 2FMYA 4G9YA 3I53A 3I59B 3RKYA 3K0LA 5BMZA 3GLXA 2H94A 2VOPA 2QBYB 3O6BB 3WGIA 1XCVA 5A2QK 4Q47A 3I71A 1FY7A 1ODDA 3HYIA 3ZMZA 2F2EA 2HR3A 1IN6A 2K02A 1IRGA 4LLGF 3MFKA 5BPIA 2OU2A 1IRFA 2M45A 4FX4A 1LEAA 3R4KA 2XROA 2L02A 5H6RA 5K1YA 2BV6A 5E17F 4I0BA 2O8XA 5JHUA 3C7JA 2XAJA 2EK5A 5LEKA 1HBXG 4KDPA 3N97A 3SZTA 1H0MA 2A07F 4ENNA 1HW2A 1LJ9A 3B02A 2X4HA 3CJNA 4BNCA 4UVAA 4YG2F 1RUOA 1O7LA 3K2ZA 1BIBA 1U78A 4MHGA 1ZG5A 1BIAA 2H6CA 3ZMSA 5AIQA 4R8HA 1QBJA 1EH8A 1HKSA 5D5VB 2ACJA 4BH9A 2R7DA 3OV8A 1SFUA 3LA2A 1JHFA 5LHHA 3J81Z 4UNOA 1OMIA 2LSOA 5LLQA 2ELHA 3LQRA 4A5MA 2OA4A 1T98A 2FEZA 3S2WA 2KKOA 4WX9A 2JTVA 2B0LA 1YFHA 2CW0F 2X0LA 1L3LA 1K78B 3JAMZ 2PG4A 2JPBA 1CF7A 2DPDA 2P5LC 4EVIA 2PJPA 4EM2A 1P4WA 4ETSA 2IRFG 3GWZA 3Q5FA 4A6DA 2XV4S 4E70A 4ZYDA 4A12A 5E8IA 3E5UA 2HYFA 3TGNA 3DF8A 4M73A 2VOOA 2XHKA 2FQ3A 4M9XA 1HSJA 2EFNA 3E5QA 3O2PE 4HYEA 5FB2A 2J5PA 3HTSB 1EH6A 1MKMA 5ICFA 3P7NA 1KQ0A 2W57A 3E3VA 4HX7A 1ZH5A 1O3SA 4G6QA 3L9FA 4BHCA 2P5KA 3HHGA 2P7CB 3DPTA 1XGMA 2XAQA 3EYYA 4HV5A 3KP5A 1XSXA 2MLKA 4AWXB 1AWCA 4KUMA 2FBIA 1QQIA 2FU4A 5AIPA 3W6JB 2XIGA 2O6GE 2WC2A 4RGRA 1P2FA 4EJWA 3KP2A 3HUGA 3FF5A 2HGCA 2H27A 3QPHA 2CSOA 3BWGA 4I2OA 1PP7U 2FBHA 3K1NA 4B8XA 5DYMA 4OIQF 5HDNA 1HW5A 3I0TA 4M72A 2WV0A 1R22A 1I1SA 3BPVA 1D8KA 3IL2A 1JHHA 3ZMUA 2LNBA 1IN7A 2J5OA 1RIOH 3LFKA 2ZMEA 3RYRA 3E6BA 3TOBA 2A6HF 3SHFA 1ULYA 6PAXA 4WWCA 3C3WA 1B4AA 2GA1A 5FFZA 3M8EA 1U8RA 1GVJA 2RV8A 1MJBA 1YS6A 1SFXA 5ICGA 2KIUA 1V3FA 3GZ5A 3FMRA 2PQ8A 1G4DA 1ZRDA 5LBQA 1PDNC 2L54A 2FSWA 2M30A 4WXHA 5KVRA 4ZH4F 3Q9VA 3ABUA 5E20A 2D1HA 2ZO4A 1HQCA 1IUYA 3E6MA 2HWVA 1FBQA 3PQKA 2R3SA 2RDPA 1Z6TA 4HBLA 5JR3A 4DQ2A 3WTUC 1O57A 3IRRA 1AOYA 1DPRA 4KN7X 3WU0A 3JW4A 1OYYA 3KP4A 3KZZA 2YU3A 3LQQA 3HTUA 4ESJA 1FSHA 4XLNF 4A0XA 3HOTA 5TJJA 4WK8F 2CO5A 1I27A 1IN8A 1KU9A 4L9NA 1YQAA 1GHCA 4UHTA 3F8BA 4F7ZA 4Q4ZF 1B6AA 1T0FA 1G3TA 1FP1D 1B1BA 3C18A 3HSRA 2GA2A 1P4AA 4KYWA 4IF4A 3W6KB 4KICA 4D0PA 4ZYEA 5DDGA 2YPRA 2YX7A 2RQPA 1SMTA 4S05A 2GIVA 2PMUA 3F6VA 2XUBA 5FO5A 2GWRA 4M9ZA 1QO0D 4LG0A 3L00A 3GFIA 1QPMA 3WU1B 2HTSA 1STZA 1YS7A 1ZLKA 5CVIA 3WODF 2DLLA 3NRVA 4L9VA 1S3JA 3BOQA 3ECHA 4AD9A 3GYHX 1UFMA 3WTVC 3RYPA 1O7FA 5JI6A 4KIBA 3ROUA 4U0YA 2Z9OA 3F23A 2P6SA 1EH7A 3R60A 2C6YA 3BP8A 3U9GA 5BS6A 1BC8C 1WSUA 2CG4A 2OD5A 5D8KB 5ICCA 3IC7A 1XD7A 2ETHA 4LFUA 1Z05A 4BYYA 4FT8A 1W4MA 3RI4A 2BE5F 2HQNA 5L3DA 2AS5F 2G9WA 1RI7A 3KP6A 1T38A 5HS9A 2QQ9A 1TW3A 2K86A 3DP7A 3SZPA 1PUEE 5HS8A 1CF7B 3P9IA 2DQLA 2UZKA 3GFLA 1FNNA 1DUXC 4A0ZA 4LD5A 2ZFWA 3G73A 4YFNF 2M1BA 4G8XA 1I5ZA 3HRMA 1LB2A 2QENA 2A3SA 1ZG1A 4BQAA 4EJOA 1KU2A 1TTYA 1XMAA 1Y0UA 4UVBA 1BC7C 2GQQA 2HOEA 3GW2A 3VEPA 4Z2YA 4I7HA 2GXBA 4Q5SF 1S7OA 1J9IA 3RKWA 3KFWX 4K2EA 3MCZA 2LKPA 4G94A 2DFIA 3ECOA 4RB1A 2D2WA 1XDSA 5IT9K 3ML6A 5FD6A 1E17A 3I58A 3WE3A 2F5EA 5HVQC 1G3WA 2Z99A 3C1DA 4PCQA 5CYVA 3HRTA 3ISPA 1FT9A 1KYWA 3DQVC 3KCCA 1J5YA 1H9TA 1L0OC 2KJBA 3E5XA 3QRFF 1R23A 3QPTA 1V4RA 4GYGA 1HSTA 4HOBA 2CFXA 4UUVA 4CXFA 2RNJA 2JPCA 2EV0A 5ERIA 2ZBKA 2W25A 3TO9A 2HKOA 1YW7A 3GXOA 1G6NA 1B59A 2QUFA 3OOPA 5TRDA 3T0YA 1U5TC 5LGUA 2K7LA 5H6QA 1MJAA 2HEOA 2DO7A 3F8CA 3DV8A 2ZNZA 3GVAA 2PMHA 2YSRA 3M7GA 1W5SA 4G6DA 1FBSA 3WTXC 1BI3A 2CQKA 3HHHA 4I01A 1LDDA 3JTGA 1T6SA 3RPUA 5FLXK 2CYYA 3Q9SA 1KYZA 2K4BA 4PDKA 1R36A 1MDMA 2IVMA 1O3QA 3D5LA 5IT3A 4EM0B 1BJAA 4IRGA 3T8RA 3FM5A 2IJLA 1QGPA 2NNNA 1BI0A 1R1VA 4B09A 4XLPF 2ISZA 2FF4A 2A68F 1I6XA 2VT3A 1USSA 4HQEA 4ENKA 1FC3A 3CLOA 3EETA 2VBXA 3BZ6A 5LEJA 2V6CA 4MTDA 3V4GA 3BPXA 4OIRF 5J8FA 3WTZA 2CGPA 2HDCA 3TDUC 3GO5A 1KQ9A 4KT5C 1USTA 1YG2A 2XAHA 2E7XA 1RNLA 3I59A 4HV6A 3N4MA 2IP2A 1UCRA 5DCMB 3J7AO 1IF1A 4BXUA 3KP7A 4NB5A 5K5RA 3M1EA 5DD8A 1FYLA 4LJZF 5LRSA 1K6OA 4WXCA 4EJVA 3IWFA 5J8CA 1IW7F 5BQTA 4I09A 1BM9A 3WTYC 5L3EA 5KK1A 2QYOA 3E6DA 4L9TA 5CVVA 4IXAA 4R79A 3VOEA 2XAGA 3GF2A 2V1XA 2FA5A 2VBYA 2P8TA 4OU0A 4HZFA 2JSCA 4YFXF 1H9GA 1Z9CA 1JGSA 2P5VA 1WI9A 3FXQA 4CHUA 2ISYA 3ZPLA 4ENJA 1A04A 4IRHA 3WGHA 5E1ZB 3R0AA 5D5WB 1SD6A 3D0SA 4KIFA 3ABTA 3F72A 2HKXA 2VE8A 2UXNA 2PFBA 4ZZDA 1E2XA 5HDGA 3FZVA 3MZHA 1IXRC 3CUQC 4HA8A 4GGGA 2QWWA 1ZYRF 1U3EM 1JXSA 3PQJA 2V1UA 3CUOA 2VBZA 2LF7A 4YIFA 3RPQA 3V8JA 1W7PB 2P4WA 4LK0F 4HX4A 1KGSA 3QOPA 4FHTA 3JSPA 4RB0A 1D8JA 1ON1A 5L3CA 2OAZA 3O3KA 1ZAOA 5LGNA 4EGYA 2HTJA 4HF2A 1W7PD 4M6XA 2COMA 4A5NA 1CGPA 5D5UB 4Y17A 1BBYA 2TDXA 5D6EA 1REPC 1Q1HA 2DU9A 1I1GA 2IA1A 2K27A 3MQ0A 3BY6A 1VTNC 1XGSA 5LHIA 3GFMA 1KU7A 3JAMK 1B9MA 4WF2A 2O0YA 4HLXA 2EFPA 4L0YB 5K5OA 3I64A 4U88A 3F22A 2L01A 2M8EA 4BHBA 1LQ1A 4BAYA 1FP2A 2F5FA 1XGNA 2BBYA 4Y13A 4U7BA 2A5YB 3ULQB 5JFRA 1TQPA 4MEYF 4MGRA 4I0AA 3V8LA 3V7CA 2MA3A 2L3DA 2M5WA 2YX4A 4NHJA 2Q0OA 2DBBA 4U0WA 4AIKA 2OBPA 5FLXZ 4KIGA 5DCMA 2EB7A 2BEOA 4H0EA 3TO6A 1ON2A 3FHZA 3GZ6A 2XAFA 2DQRA 4XSZF 4HLYA 4UV8A 1FSEA 1LVAA 5AONA 5DCFA 1Z91A 5ED4A 1O3TA 2BGCA 2JT1A 4RS8A 4PGGA 2FBKA 3MZYA 1U6GA 3KZYA 2L4MA 4Y15A 3LAJA 1R7JA 5FGMA 1J7KA 3R0JA 1TLHB 2F5DA 5E1XA 4KNYA 3ZMTA 1KA8A 5CVRA 5ICEA 4XSXF 2KJCA 4RB2C 1S6LA 2ZMEB 5CVJA 2DK5A 4LB6B 4EQQA 2NS0A 1OYIA 2HQRA 1TW2A 1P92A 2H09A 3WTWC 3SFZA 2NAZA 3WG9A 2FNAA 3F6OA 2VT2A 5HOOA 5IT9Z 1WQ2A 5HDKA 1U5TA 3M9AA 4M74A 3DPLC 2VN2A 3HSEA 5D5XB 4MQ9F 4RGXA 3SXYA 2MH9A 1YLFA 1XGOA 4HQMA 1F4KA 3QU3A 3F8NA 2QBYA 3KLOA 1W7PA 2O3FA 5J6XA 2Z5UA 4A2UA 2XGXA 4JK1X 3FXUA 2A61A 4GYIA 3VODA 4ZYHA 3HOSA 4L0ZB 3E97A 4N9HA 3U2RA 2HS5A 1J0RA 5HS7A 1IXSB 4A6EA 3LA7A 4ENMA 4IHTA 4GO1A 4M6YA 4OMZA 2MD5A 3EYIA 1XSVA 3H3UA 5D4SA 1F5TA 2EA2A 4MTEA 3BDDA 2ZXJA 1ZRCA 2IPQX 5HLHA 1TQIA 2Q2EA 2XASA 3ZMVA 1W5TA 4CGZA 3P9CA 4I02A 2Z33A 1Z1DA 1SD7A 4M71A 4O6JA 1YO5C 2EFOA 5L3FA 2GXGA 3EQLF 5DUIA 2G7UA 5CLSA 4MEXF 3AAFA 1FWZA 3V7RA 2KRFA 1LDJA 2V9VA 3NQOA 4I98B 4EM1A 4EJTA 3LWFA 1YW9A 1IXCA 3R6SA 1RUNA 4WCGA 1TBXA 3V7SA 2PEXA 2OQRA 4LLNA 3H3ZA 3L09A 2FE3A 3T8TA 4P9UA 1XN7A 4OIOF 4HDVA 5BOXA 3MWMA 2HYGD 2VC0A 3DKWA 3WGGA 2LDUA 2PLYA 2VBWA 5A2QZ 4RB3C 2ADUA 1FX7A 5ILSA 3CDHA 3HRUA 2VC1A 4HAMA 2XRNA 4OIPF 2DTRA 1HW1A 1FZPB 4PGHA 4HW0A 5ILVA 1R1TA 3DXJF 1S8NA 4HF1A 1C0WA 4A0YA 4PZJA 3BROA 4CYDA 3TDZC 3IKTA 1BOAA 2UXXA 3JTHA 4RGSA 1ZG3A 3F8FA 2BYVE 2PN6A 4EGZA 3J80Z 1ZLJA 2NRAC 2R7FA 3EDPA 3IKVA 4LGWA 4AVPA 3RJPA 1OPCA 4YFKF 1ZREA 2E1NA 3H92A 4ESFA 5JVTA 3K1MA 2JRTA 4M9SA 2P7VB 1SFEA 3IHUA 1OYWA 4S04A 2QQAA 2O03A 4ON0A 1D3YA 1YTYA 2PBIA 1QZZA 2QLZA 4KMFA 1KU3A 3U1DA 4TV7A 2DT5A 4R1HA 1G3YA 2OZUA 2Y75A 3L7WA 3DFGA 1QNTA 3QAHA 5E8GA 5K5QA 4AIHA 2RN7A 4RGUA 4ZYGA 4P96A 3DEUA 4G7OF 1EV7A 2OZ6A 2KIMA 1ONVA 2QVOA 1DP7P 2LF8A 1QZYA 3K1PA 3CO6C 3WTSC 2H6BA 2ZJ2A 3I4PA 1XB4A 4EJUA 4IHSA 2P6TA 3F3XA 3ZN0A 4LG0B 1XMKA 4EMSA 1MGTA 4XBFA 2STWA 5EEGA 3F8MA 4OINF 1ZGAA 2RGVA 3V8KA 2RKHA 3K9TA 2KIFA 3KE2A 1FOKA 3P9KA 4JQFA 4QLCU 3RIRA 1GXQA 3WTTC 4NQWA 4CICA 2A69F 4HX8A 2XKPA 2XVCA 2VE9A 3K69A 2V1DA 3I5UA 4LMYA 3M8FA 5ILUA 1ZGJA 4JBAA 3CUQB 3QU6A 1K7AA 2YR2A 3VB2A 3R61A 1F1ZA 3EUHA 4ESBA 2K4JA 2QZ8A 2NNYA 3GFJA 1UHMA 4GXOA 1OKRA 2DI3A 1B9NA 2DPUA 5FFXA 2EFQA 1MDMB 2O61A 3NEUA 3QP5A 1SMYF 1YYVA 3ZMDA 4L9JA 2G7HA 1U5TB 1ZARA 2L4AA 4MNUA 2WWYA 1TNSA 3BJOA 3ZP5A 1S7AA 2D1VA 4LK1F 4IVNA 4P55A 2ESHA 4KFCA 1FYKA 1XDUA 4U0VA 4AIJA 2GZWA 2IT0A 4DNCA 2EWNA 3ERED 4ASNA 3J81K 2UWMA 2MLGA 1LDKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESN A;  2FXA A;  2DAO A;  1U2W A;  3BJ6 A;  1XCB A;  5D6F A;  4YII A;  3JSO A;  4HDU A;  4WXD A;  3B73 A;  3LA3 A;  1LNW A;  4CO8 A;  5D4R A;  1IN4 A;  1WKM A;  3KLN A;  2A6E F;  1OR7 A;  2MBF A;  1D5V A;  2EJR A;  1ZN2 A;  2Z3Y A;  1R00 A;  3GX4 X;  3GEZ A;  1HKQ A;  4RAZ A;  1ZRF A;  3KET A;  2MH2 A;  3T1B A;  1WWX A;  2IW5 A;  2VON A;  4Q48 A;  5L3G A;  1P6R A;  2JZY A;  3KP3 A;  1F9N A;  4HF0 A;  2ZNY A;  1BI1 A;  4OMY A;  1J2X A;  4ZZL A;  2ZKZ A;  2FOK A;  3CTA A;  3TQN A;  3TO7 A;  3FMS A;  4G7H F;  2EFW A;  2RC4 A;  1YW8 A;  2D45 A;  5E18 F;  5EEH A;  1HXD A;  5BPD A;  1J75 A;  1HKT A;  1FPQ A;  4U7D A;  1R5H A;  1O3R A;  1K78 A;  2EV5 A;  3REO A;  5LHG A;  1K79 A;  4MQV A;  2NYX A;  2W84 A;  4FX0 A;  3F21 A;  3COA C;  1IN5 A;  2FNP A;  3GUD A;  4KMU X;  1DDN A;  2PI0 A;  2Y0M A;  3L2C A;  3RKX A;  1KQ8 A;  2RVC A;  5LRR A;  3I54 A;  1UB9 A;  1T2K A;  2ZCW A;  1DPU A;  1SD4 A;  3G3Z A;  4L5I A;  1GXP A;  3TKY A;  4IRI A;  4BHP A;  3HRS A;  2Y48 A;  4CDG A;  2GAU A;  4N9I A;  4GCV A;  4N0B A;  2STT A;  1FBU A;  2DW4 A;  1YIO A;  2IA0 A;  3E6C C;  2QQB A;  1SD5 A;  1ZHF A;  3KEQ A;  1MJ9 A;  4O3M A;  3PFI A;  1IZ1 A;  4LB5 A;  5L3B A;  3FXR A;  3TOA A;  1T39 A;  1R58 A;  3CUQ A;  4IJA A;  2M87 A;  4KA4 A;  2F5C A;  1BN5 A;  3IWZ A;  1TQM A;  1BI2 A;  2HZT A;  3FM3 A;  5DUK A;  4LLL A;  1IAW A;  1G3S A;  5DEQ A;  4P9F A;  2WTE A;  1SAX A;  3MEX A;  3HIF A;  2QM3 A;  3FMQ A;  1P4X A;  1WRJ A;  2CWE A;  1LEB A;  2HFH A;  3WE2 A;  2EA4 A;  5HLI A;  3VFZ A;  3HSF A;  3FWE A;  3J80 K;  1XSD A;  4IPA A;  3LAP A;  1RZ4 A;  2W85 A;  2E7W A;  4KN4 X;  1UHW A;  1PP8 F;  2Q8K A;  5CVU A;  1FYM A;  5H20 A;  3CO7 C;  2FML A;  1FLI A;  4CZZ A;  5F6F A;  3ZN1 A;  2XKO A;  4RAY A;  3KEO A;  5CJ9 A;  1R5G A;  3QP6 A;  4L5J A;  3RDI A;  1X3U A;  5FD5 A;  2DK8 A;  5E1W A;  5HLG A;  1JE8 A;  1R1U A;  1TNT A;  5LGT A;  3ZQ7 A;  1NHA A;  5DD4 A;  2EV6 A;  2E1C A;  1S29 A;  2MC3 A;  4UVC A;  5DV5 A;  1Z6R A;  1J59 A;  2FRH A;  2W24 A;  2VOD A;  2VXZ A;  4UV9 A;  3SQN A;  4O5V A;  2AXL A;  3MAJ A;  3FX3 A;  3ELK A;  2IA2 A;  4XRF A;  1MZB A;  3LST A;  4QWQ A;  2V79 A;  5F64 A;  3BJA A;  5F1R A;  4UXN A;  5D8L B;  1Z7U A;  1MD0 A;  4OOI A;  4L18 B;  3T5X A;  4P5O A;  4G7Z F;  3IRQ A;  3RTR A;  2OQG A;  4EV0 A;  2FMY A;  4G9Y A;  3I53 A;  3I59 B;  3RKY A;  3K0L A;  5BMZ A;  3GLX A;  2H94 A;  2VOP A;  2QBY B;  3O6B B;  3WGI A;  1XCV A;  5A2Q K;  4Q47 A;  3I71 A;  1FY7 A;  1ODD A;  3HYI A;  3ZMZ A;  2F2E A;  2HR3 A;  1IN6 A;  2K02 A;  1IRG A;  4LLG F;  3MFK A;  5BPI A;  2OU2 A;  1IRF A;  2M45 A;  4FX4 A;  1LEA A;  3R4K A;  2XRO A;  2L02 A;  5H6R A;  5K1Y A;  2BV6 A;  5E17 F;  4I0B A;  2O8X A;  5JHU A;  3C7J A;  2XAJ A;  2EK5 A;  5LEK A;  1HBX G;  4KDP A;  3N97 A;  3SZT A;  1H0M A;  2A07 F;  4ENN A;  1HW2 A;  1LJ9 A;  3B02 A;  2X4H A;  3CJN A;  4BNC A;  4UVA A;  4YG2 F;  1RUO A;  1O7L A;  3K2Z A;  1BIB A;  1U78 A;  4MHG A;  1ZG5 A;  1BIA A;  2H6C A;  3ZMS A;  5AIQ A;  4R8H A;  1QBJ A;  1EH8 A;  1HKS A;  5D5V B;  2ACJ A;  4BH9 A;  2R7D A;  3OV8 A;  1SFU A;  3LA2 A;  1JHF A;  5LHH A;  3J81 Z;  4UNO A;  1OMI A;  2LSO A;  5LLQ A;  2ELH A;  3LQR A;  4A5M A;  2OA4 A;  1T98 A;  2FEZ A;  3S2W A;  2KKO A;  4WX9 A;  2JTV A;  2B0L A;  1YFH A;  2CW0 F;  2X0L A;  1L3L A;  1K78 B;  3JAM Z;  2PG4 A;  2JPB A;  1CF7 A;  2DPD A;  2P5L C;  4EVI A;  2PJP A;  4EM2 A;  1P4W A;  4ETS A;  2IRF G;  3GWZ A;  3Q5F A;  4A6D A;  2XV4 S;  4E70 A;  4ZYD A;  4A12 A;  5E8I A;  3E5U A;  2HYF A;  3TGN A;  3DF8 A;  4M73 A;  2VOO A;  2XHK A;  2FQ3 A;  4M9X A;  1HSJ A;  2EFN A;  3E5Q A;  3O2P E;  4HYE A;  5FB2 A;  2J5P A;  3HTS B;  1EH6 A;  1MKM A;  5ICF A;  3P7N A;  1KQ0 A;  2W57 A;  3E3V A;  4HX7 A;  1ZH5 A;  1O3S A;  4G6Q A;  3L9F A;  4BHC A;  2P5K A;  3HHG A;  2P7C B;  3DPT A;  1XGM A;  2XAQ A;  3EYY A;  4HV5 A;  3KP5 A;  1XSX A;  2MLK A;  4AWX B;  1AWC A;  4KUM A;  2FBI A;  1QQI A;  2FU4 A;  5AIP A;  3W6J B;  2XIG A;  2O6G E;  2WC2 A;  4RGR A;  1P2F A;  4EJW A;  3KP2 A;  3HUG A;  3FF5 A;  2HGC A;  2H27 A;  3QPH A;  2CSO A;  3BWG A;  4I2O A;  1PP7 U;  2FBH A;  3K1N A;  4B8X A;  5DYM A;  4OIQ F;  5HDN A;  1HW5 A;  3I0T A;  4M72 A;  2WV0 A;  1R22 A;  1I1S A;  3BPV A;  1D8K A;  3IL2 A;  1JHH A;  3ZMU A;  2LNB A;  1IN7 A;  2J5O A;  1RIO H;  3LFK A;  2ZME A;  3RYR A;  3E6B A;  3TOB A;  2A6H F;  3SHF A;  1ULY A;  6PAX A;  4WWC A;  3C3W A;  1B4A A;  2GA1 A;  5FFZ A;  3M8E A;  1U8R A;  1GVJ A;  2RV8 A;  1MJB A;  1YS6 A;  1SFX A;  5ICG A;  2KIU A;  1V3F A;  3GZ5 A;  3FMR A;  2PQ8 A;  1G4D A;  1ZRD A;  5LBQ A;  1PDN C;  2L54 A;  2FSW A;  2M30 A;  4WXH A;  5KVR A;  4ZH4 F;  3Q9V A;  3ABU A;  5E20 A;  2D1H A;  2ZO4 A;  1HQC A;  1IUY A;  3E6M A;  2HWV A;  1FBQ A;  3PQK A;  2R3S A;  2RDP A;  1Z6T A;  4HBL A;  5JR3 A;  4DQ2 A;  3WTU C;  1O57 A;  3IRR A;  1AOY A;  1DPR A;  4KN7 X;  3WU0 A;  3JW4 A;  1OYY A;  3KP4 A;  3KZZ A;  2YU3 A;  3LQQ A;  3HTU A;  4ESJ A;  1FSH A;  4XLN F;  4A0X A;  3HOT A;  5TJJ A;  4WK8 F;  2CO5 A;  1I27 A;  1IN8 A;  1KU9 A;  4L9N A;  1YQA A;  1GHC A;  4UHT A;  3F8B A;  4F7Z A;  4Q4Z F;  1B6A A;  1T0F A;  1G3T A;  1FP1 D;  1B1B A;  3C18 A;  3HSR A;  2GA2 A;  1P4A A;  4KYW A;  4IF4 A;  3W6K B;  4KIC A;  4D0P A;  4ZYE A;  5DDG A;  2YPR A;  2YX7 A;  2RQP A;  1SMT A;  4S05 A;  2GIV A;  2PMU A;  3F6V A;  2XUB A;  5FO5 A;  2GWR A;  4M9Z A;  1QO0 D;  4LG0 A;  3L00 A;  3GFI A;  1QPM A;  3WU1 B;  2HTS A;  1STZ A;  1YS7 A;  1ZLK A;  5CVI A;  3WOD F;  2DLL A;  3NRV A;  4L9V A;  1S3J A;  3BOQ A;  3ECH A;  4AD9 A;  3GYH X;  1UFM A;  3WTV C;  3RYP A;  1O7F A;  5JI6 A;  4KIB A;  3ROU A;  4U0Y A;  2Z9O A;  3F23 A;  2P6S A;  1EH7 A;  3R60 A;  2C6Y A;  3BP8 A;  3U9G A;  5BS6 A;  1BC8 C;  1WSU A;  2CG4 A;  2OD5 A;  5D8K B;  5ICC A;  3IC7 A;  1XD7 A;  2ETH A;  4LFU A;  1Z05 A;  4BYY A;  4FT8 A;  1W4M A;  3RI4 A;  2BE5 F;  2HQN A;  5L3D A;  2AS5 F;  2G9W A;  1RI7 A;  3KP6 A;  1T38 A;  5HS9 A;  2QQ9 A;  1TW3 A;  2K86 A;  3DP7 A;  3SZP A;  1PUE E;  5HS8 A;  1CF7 B;  3P9I A;  2DQL A;  2UZK A;  3GFL A;  1FNN A;  1DUX C;  4A0Z A;  4LD5 A;  2ZFW A;  3G73 A;  4YFN F;  2M1B A;  4G8X A;  1I5Z A;  3HRM A;  1LB2 A;  2QEN A;  2A3S A;  1ZG1 A;  4BQA A;  4EJO A;  1KU2 A;  1TTY A;  1XMA A;  1Y0U A;  4UVB A;  1BC7 C;  2GQQ A;  2HOE A;  3GW2 A;  3VEP A;  4Z2Y A;  4I7H A;  2GXB A;  4Q5S F;  1S7O A;  1J9I A;  3RKW A;  3KFW X;  4K2E A;  3MCZ A;  2LKP A;  4G94 A;  2DFI A;  3ECO A;  4RB1 A;  2D2W A;  1XDS A;  5IT9 K;  3ML6 A;  5FD6 A;  1E17 A;  3I58 A;  3WE3 A;  2F5E A;  5HVQ C;  1G3W A;  2Z99 A;  3C1D A;  4PCQ A;  5CYV A;  3HRT A;  3ISP A;  1FT9 A;  1KYW A;  3DQV C;  3KCC A;  1J5Y A;  1H9T A;  1L0O C;  2KJB A;  3E5X A;  3QRF F;  1R23 A;  3QPT A;  1V4R A;  4GYG A;  1HST A;  4HOB A;  2CFX A;  4UUV A;  4CXF A;  2RNJ A;  2JPC A;  2EV0 A;  5ERI A;  2ZBK A;  2W25 A;  3TO9 A;  2HKO A;  1YW7 A;  3GXO A;  1G6N A;  1B59 A;  2QUF A;  3OOP A;  5TRD A;  3T0Y A;  1U5T C;  5LGU A;  2K7L A;  5H6Q A;  1MJA A;  2HEO A;  2DO7 A;  3F8C A;  3DV8 A;  2ZNZ A;  3GVA A;  2PMH A;  2YSR A;  3M7G A;  1W5S A;  4G6D A;  1FBS A;  3WTX C;  1BI3 A;  2CQK A;  3HHH A;  4I01 A;  1LDD A;  3JTG A;  1T6S A;  3RPU A;  5FLX K;  2CYY A;  3Q9S A;  1KYZ A;  2K4B A;  4PDK A;  1R36 A;  1MDM A;  2IVM A;  1O3Q A;  3D5L A;  5IT3 A;  4EM0 B;  1BJA A;  4IRG A;  3T8R A;  3FM5 A;  2IJL A;  1QGP A;  2NNN A;  1BI0 A;  1R1V A;  4B09 A;  4XLP F;  2ISZ A;  2FF4 A;  2A68 F;  1I6X A;  2VT3 A;  1USS A;  4HQE A;  4ENK A;  1FC3 A;  3CLO A;  3EET A;  2VBX A;  3BZ6 A;  5LEJ A;  2V6C A;  4MTD A;  3V4G A;  3BPX A;  4OIR F;  5J8F A;  3WTZ A;  2CGP A;  2HDC A;  3TDU C;  3GO5 A;  1KQ9 A;  4KT5 C;  1UST A;  1YG2 A;  2XAH A;  2E7X A;  1RNL A;  3I59 A;  4HV6 A;  3N4M A;  2IP2 A;  1UCR A;  5DCM B;  3J7A O;  1IF1 A;  4BXU A;  3KP7 A;  4NB5 A;  5K5R A;  3M1E A;  5DD8 A;  1FYL A;  4LJZ F;  5LRS A;  1K6O A;  4WXC A;  4EJV A;  3IWF A;  5J8C A;  1IW7 F;  5BQT A;  4I09 A;  1BM9 A;  3WTY C;  5L3E A;  5KK1 A;  2QYO A;  3E6D A;  4L9T A;  5CVV A;  4IXA A;  4R79 A;  3VOE A;  2XAG A;  3GF2 A;  2V1X A;  2FA5 A;  2VBY A;  2P8T A;  4OU0 A;  4HZF A;  2JSC A;  4YFX F;  1H9G A;  1Z9C A;  1JGS A;  2P5V A;  1WI9 A;  3FXQ A;  4CHU A;  2ISY A;  3ZPL A;  4ENJ A;  1A04 A;  4IRH A;  3WGH A;  5E1Z B;  3R0A A;  5D5W B;  1SD6 A;  3D0S A;  4KIF A;  3ABT A;  3F72 A;  2HKX A;  2VE8 A;  2UXN A;  2PFB A;  4ZZD A;  1E2X A;  5HDG A;  3FZV A;  3MZH A;  1IXR C;  3CUQ C;  4HA8 A;  4GGG A;  2QWW A;  1ZYR F;  1U3E M;  1JXS A;  3PQJ A;  2V1U A;  3CUO A;  2VBZ A;  2LF7 A;  4YIF A;  3RPQ A;  3V8J A;  1W7P B;  2P4W A;  4LK0 F;  4HX4 A;  1KGS A;  3QOP A;  4FHT A;  3JSP A;  4RB0 A;  1D8J A;  1ON1 A;  5L3C A;  2OAZ A;  3O3K A;  1ZAO A;  5LGN A;  4EGY A;  2HTJ A;  4HF2 A;  1W7P D;  4M6X A;  2COM A;  4A5N A;  1CGP A;  5D5U B;  4Y17 A;  1BBY A;  2TDX A;  5D6E A;  1REP C;  1Q1H A;  2DU9 A;  1I1G A;  2IA1 A;  2K27 A;  3MQ0 A;  3BY6 A;  1VTN C;  1XGS A;  5LHI A;  3GFM A;  1KU7 A;  3JAM K;  1B9M A;  4WF2 A;  2O0Y A;  4HLX A;  2EFP A;  4L0Y B;  5K5O A;  3I64 A;  4U88 A;  3F22 A;  2L01 A;  2M8E A;  4BHB A;  1LQ1 A;  4BAY A;  1FP2 A;  2F5F A;  1XGN A;  2BBY A;  4Y13 A;  4U7B A;  2A5Y B;  3ULQ B;  5JFR A;  1TQP A;  4MEY F;  4MGR A;  4I0A A;  3V8L A;  3V7C A;  2MA3 A;  2L3D A;  2M5W A;  2YX4 A;  4NHJ A;  2Q0O A;  2DBB A;  4U0W A;  4AIK A;  2OBP A;  5FLX Z;  4KIG A;  5DCM A;  2EB7 A;  2BEO A;  4H0E A;  3TO6 A;  1ON2 A;  3FHZ A;  3GZ6 A;  2XAF A;  2DQR A;  4XSZ F;  4HLY A;  4UV8 A;  1FSE A;  1LVA A;  5AON A;  5DCF A;  1Z91 A;  5ED4 A;  1O3T A;  2BGC A;  2JT1 A;  4RS8 A;  4PGG A;  2FBK A;  3MZY A;  1U6G A;  3KZY A;  2L4M A;  4Y15 A;  3LAJ A;  1R7J A;  5FGM A;  1J7K A;  3R0J A;  1TLH B;  2F5D A;  5E1X A;  4KNY A;  3ZMT A;  1KA8 A;  5CVR A;  5ICE A;  4XSX F;  2KJC A;  4RB2 C;  1S6L A;  2ZME B;  5CVJ A;  2DK5 A;  4LB6 B;  4EQQ A;  2NS0 A;  1OYI A;  2HQR A;  1TW2 A;  1P92 A;  2H09 A;  3WTW C;  3SFZ A;  2NAZ A;  3WG9 A;  2FNA A;  3F6O A;  2VT2 A;  5HOO A;  5IT9 Z;  1WQ2 A;  5HDK A;  1U5T A;  3M9A A;  4M74 A;  3DPL C;  2VN2 A;  3HSE A;  5D5X B;  4MQ9 F;  4RGX A;  3SXY A;  2MH9 A;  1YLF A;  1XGO A;  4HQM A;  1F4K A;  3QU3 A;  3F8N A;  2QBY A;  3KLO A;  1W7P A;  2O3F A;  5J6X A;  2Z5U A;  4A2U A;  2XGX A;  4JK1 X;  3FXU A;  2A61 A;  4GYI A;  3VOD A;  4ZYH A;  3HOS A;  4L0Z B;  3E97 A;  4N9H A;  3U2R A;  2HS5 A;  1J0R A;  5HS7 A;  1IXS B;  4A6E A;  3LA7 A;  4ENM A;  4IHT A;  4GO1 A;  4M6Y A;  4OMZ A;  2MD5 A;  3EYI A;  1XSV A;  3H3U A;  5D4S A;  1F5T A;  2EA2 A;  4MTE A;  3BDD A;  2ZXJ A;  1ZRC A;  2IPQ X;  5HLH A;  1TQI A;  2Q2E A;  2XAS A;  3ZMV A;  1W5T A;  4CGZ A;  3P9C A;  4I02 A;  2Z33 A;  1Z1D A;  1SD7 A;  4M71 A;  4O6J A;  1YO5 C;  2EFO A;  5L3F A;  2GXG A;  3EQL F;  5DUI A;  2G7U A;  5CLS A;  4MEX F;  3AAF A;  1FWZ A;  3V7R A;  2KRF A;  1LDJ A;  2V9V A;  3NQO A;  4I98 B;  4EM1 A;  4EJT A;  3LWF A;  1YW9 A;  1IXC A;  3R6S A;  1RUN A;  4WCG A;  1TBX A;  3V7S A;  2PEX A;  2OQR A;  4LLN A;  3H3Z A;  3L09 A;  2FE3 A;  3T8T A;  4P9U A;  1XN7 A;  4OIO F;  4HDV A;  5BOX A;  3MWM A;  2HYG D;  2VC0 A;  3DKW A;  3WGG A;  2LDU A;  2PLY A;  2VBW A;  5A2Q Z;  4RB3 C;  2ADU A;  1FX7 A;  5ILS A;  3CDH A;  3HRU A;  2VC1 A;  4HAM A;  2XRN A;  4OIP F;  2DTR A;  1HW1 A;  1FZP B;  4PGH A;  4HW0 A;  5ILV A;  1R1T A;  3DXJ F;  1S8N A;  4HF1 A;  1C0W A;  4A0Y A;  4PZJ A;  3BRO A;  4CYD A;  3TDZ C;  3IKT A;  1BOA A;  2UXX A;  3JTH A;  4RGS A;  1ZG3 A;  3F8F A;  2BYV E;  2PN6 A;  4EGZ A;  3J80 Z;  1ZLJ A;  2NRA C;  2R7F A;  3EDP A;  3IKV A;  4LGW A;  4AVP A;  3RJP A;  1OPC A;  4YFK F;  1ZRE A;  2E1N A;  3H92 A;  4ESF A;  5JVT A;  3K1M A;  2JRT A;  4M9S A;  2P7V B;  1SFE A;  3IHU A;  1OYW A;  4S04 A;  2QQA A;  2O03 A;  4ON0 A;  1D3Y A;  1YTY A;  2PBI A;  1QZZ A;  2QLZ A;  4KMF A;  1KU3 A;  3U1D A;  4TV7 A;  2DT5 A;  4R1H A;  1G3Y A;  2OZU A;  2Y75 A;  3L7W A;  3DFG A;  1QNT A;  3QAH A;  5E8G A;  5K5Q A;  4AIH A;  2RN7 A;  4RGU A;  4ZYG A;  4P96 A;  3DEU A;  4G7O F;  1EV7 A;  2OZ6 A;  2KIM A;  1ONV A;  2QVO A;  1DP7 P;  2LF8 A;  1QZY A;  3K1P A;  3CO6 C;  3WTS C;  2H6B A;  2ZJ2 A;  3I4P A;  1XB4 A;  4EJU A;  4IHS A;  2P6T A;  3F3X A;  3ZN0 A;  4LG0 B;  1XMK A;  4EMS A;  1MGT A;  4XBF A;  2STW A;  5EEG A;  3F8M A;  4OIN F;  1ZGA A;  2RGV A;  3V8K A;  2RKH A;  3K9T A;  2KIF A;  3KE2 A;  1FOK A;  3P9K A;  4JQF A;  4QLC U;  3RIR A;  1GXQ A;  3WTT C;  4NQW A;  4CIC A;  2A69 F;  4HX8 A;  2XKP A;  2XVC A;  2VE9 A;  3K69 A;  2V1D A;  3I5U A;  4LMY A;  3M8F A;  5ILU A;  1ZGJ A;  4JBA A;  3CUQ B;  3QU6 A;  1K7A A;  2YR2 A;  3VB2 A;  3R61 A;  1F1Z A;  3EUH A;  4ESB A;  2K4J A;  2QZ8 A;  2NNY A;  3GFJ A;  1UHM A;  4GXO A;  1OKR A;  2DI3 A;  1B9N A;  2DPU A;  5FFX A;  2EFQ A;  1MDM B;  2O61 A;  3NEU A;  3QP5 A;  1SMY F;  1YYV A;  3ZMD A;  4L9J A;  2G7H A;  1U5T B;  1ZAR A;  2L4A A;  4MNU A;  2WWY A;  1TNS A;  3BJO A;  3ZP5 A;  1S7A A;  2D1V A;  4LK1 F;  4IVN A;  4P55 A;  2ESH A;  4KFC A;  1FYK A;  1XDU A;  4U0V A;  4AIJ A;  2GZW A;  2IT0 A;  4DNC A;  2EWN A;  3ERE D;  4ASN A;  3J81 K;  2UWM A;  2MLG A;  1LDK B; 
#chains in the Genus database with same CATH topology
 4I76 A;  2RQQ A;  1RKT A;  2ESN A;  2FXA A;  2DAO A;  1U2W A;  4C3I J;  3BJ6 A;  1XCB A;  2DMN A;  2ZME C;  5D6F A;  4YII A;  3JSO A;  1SVO A;  3CCM I;  4HDU A;  4WXD A;  3JRE A;  3HZJ A;  3B73 A;  1NTC A;  3PNY A;  4E7H A;  1OIS A;  2DCE A;  3LA3 A;  1G2H A;  1LNW A;  4CO8 A;  2GOX B;  4AU7 A;  2V6E A;  5D4R A;  1IN4 A;  1WKM A;  3KLN A;  3EUK L;  1NK2 P;  2A6E F;  1MW7 A;  1OR7 A;  2MBF A;  1D5V A;  3W2W A;  2BXZ A;  2RNG A;  4Y3O A;  2EJR A;  1ZN2 A;  2Z3Y A;  1R00 A;  3GX4 X;  4ZTJ A;  1U9N A;  1MBG A;  3GEZ A;  2ZXI A;  4UB6 C;  1HKQ A;  2BXY A;  4RAZ A;  3S1N J;  1ZRF A;  3KET A;  4BY1 J;  1U8B A;  2MH2 A;  3T1B A;  4F93 B;  1WWX A;  2IW5 A;  2R5Y B;  2VON A;  1MH4 A;  4LOC A;  4Q48 A;  5L3G A;  1FMV A;  1P6R A;  2A6T A;  2JZY A;  3S17 J;  3KP3 A;  3PSI A;  1F9N A;  1ZK8 A;  1RPW A;  2L5Q A;  4PJM A;  4MO7 A;  1B72 B;  1MBJ A;  4HF0 A;  2ZNY A;  2DFF A;  3O8H A;  3VSL A;  2E19 A;  5B5E C;  1MMD A;  1MBE A;  3OYL A;  2OF7 A;  1BI1 A;  4OMY A;  1J2X A;  2CFO A;  4ZZL A;  1VQ6 I;  2EZI A;  4ZYA A;  2ZKZ A;  2FOK A;  3CTA A;  3TQN A;  3TO7 A;  3FMS A;  5GAH J;  1Z3Y A;  4G7H F;  1QPI A;  2EFW A;  2RC4 A;  1YW8 A;  2E1O A;  3DBR B;  4NUB A;  2D45 A;  1IUF A;  3S16 J;  2LRE A;  5E18 F;  4B3X A;  3ZR8 X;  5EEH A;  1HXD A;  5BPD A;  1J75 A;  1HKT A;  2CUF A;  1FPQ A;  4U7D A;  2X51 A;  3U21 A;  2LP0 A;  1R5H A;  3CF5 F;  5JHF A;  4QPQ A;  4J19 A;  2LLK A;  1O3R A;  1K78 A;  2EV5 A;  3REO A;  5LHG A;  1K79 A;  1QVT A;  4MQV A;  2NYX A;  1Z7L A;  2W84 A;  4FX0 A;  3F21 A;  1WH7 A;  3VSK A;  1IN5 A;  1WI3 A;  1X1A A;  3COA C;  2FNP A;  3RZO J;  1GUU A;  3GUD A;  4KMU X;  1B8I A;  2EIJ H;  1DDN A;  2W1O A;  3DKY A;  2K3P A;  2PI0 A;  1A6I A;  2NVX J;  2IGK A;  1ZTR A;  2Y0M A;  3L2C A;  1JKP C;  2JA7 J;  3RKX A;  1KQ8 A;  2RVC A;  3G1O A;  5LRR A;  1RKW A;  3I54 A;  1NG7 A;  1UB9 A;  5IP7 J;  5BNG A;  3IUO A;  4XKW A;  1T2K A;  3NAR A;  2ZCW A;  1DPU A;  1IDZ A;  1SD4 A;  3G3Z A;  4L5I A;  1GXP A;  3DPU A;  3TKY A;  4IRI A;  4BHP A;  3HRS A;  1IV8 A;  2B7E A;  1S7E A;  4Y7N J;  3SYT A;  3JRI A;  2Y48 A;  3LSG A;  4CDG A;  5EGO A;  1JUM A;  3CCE I;  2GAU A;  4N9I A;  4GCV A;  2QSF X;  4N0B A;  2STT A;  1FBU A;  1D0Z A;  4Y4R A;  2DW4 A;  4V19 K;  1YIO A;  2IA0 A;  1SC7 A;  2LBF B;  3WHC A;  5GPA A;  1X1P A;  2KQR A;  2TCT A;  3E6C C;  1K4S A;  2QQB A;  2R7X A;  1SD5 A;  1ORK A;  1ZHF A;  3KEQ A;  4P1W A;  1SEU A;  2VPR A;  2R7Q A;  1VQN I;  1TWC J;  3HKZ A;  1I6H J;  1MJ9 A;  1YIJ I;  2CU7 A;  2CQ7 A;  4O3M A;  2MAB A;  3PFI A;  1IZ1 A;  4LB5 A;  2VB6 A;  5L3B A;  3FXR A;  3EUA A;  3TOA A;  3ZQG A;  4PJ0 C;  1T39 A;  1MBK A;  1R58 A;  3CUQ A;  1V5E A;  4IJA A;  2VQL A;  1LFU P;  2M87 A;  4KA4 A;  2F5C A;  1BN5 A;  3IWZ A;  4V2F A;  2H8R A;  1TQM A;  3CLQ A;  3S93 A;  1BI2 A;  3DBL B;  1DGW Y;  2HZT A;  4FE7 A;  3FM3 A;  5DUK A;  3HOX J;  4BDY A;  4LLL A;  3DEE A;  1IAW A;  1G3S A;  2BW3 A;  5DEQ A;  1ERD A;  2CUZ A;  4P9F A;  2H1L A;  2WTE A;  1SAX A;  3OYB A;  4FCY A;  3MEX A;  4HNU A;  2DYR H;  3BLY A;  3HIF A;  3OYE A;  2QM3 A;  3FMQ A;  3ZQH A;  1P4X A;  4IL6 C;  2QQ8 A;  1WRJ A;  2CWE A;  1SVL A;  1F36 A;  1LEB A;  4L5E A;  5EDN A;  3CDI A;  4E7K A;  2HFH A;  3WE2 A;  3OIP A;  2EA4 A;  5HLI A;  3VFZ A;  2JRM A;  3HSF A;  1D0X A;  3FWE A;  1UJ8 A;  3J80 K;  2RRE A;  1XSD A;  4IPA A;  1E0E A;  3LAP A;  4DBQ A;  2L9N A;  5EYR A;  1RZ4 A;  2W85 A;  2ID6 A;  2VAS A;  2LG4 A;  3DWL E;  5C4X J;  2E7W A;  4KN4 X;  2Y0S N;  3ZQL A;  1UHW A;  1PP8 F;  2Q8K A;  4FE4 A;  5CVU A;  3TP0 A;  3DTK A;  1FYM A;  1RR7 A;  5H20 A;  2QCO A;  3CP2 A;  4BE1 A;  3CO7 C;  2FML A;  4F92 B;  1OCP A;  2KZG A;  1FLI A;  3H5N A;  4CZZ A;  5F6F A;  3ZN1 A;  2XKO A;  3LSI A;  4RAY A;  3D1N I;  3KEO A;  1V55 H;  3W6V A;  1VQL I;  3LMM A;  5CJ9 A;  1R5G A;  3BC8 A;  3QP6 A;  4L5J A;  3RDI A;  1X3U A;  3JRD A;  5FD5 A;  3H0G J;  3OYI A;  3GTO J;  3L2V A;  2DK8 A;  4W97 A;  5E1W A;  3BZK A;  1VFC A;  3DBH B;  3K6G A;  4HST A;  3EPZ A;  1TZL A;  2V9P A;  1QU3 A;  3HPG A;  5HLG A;  5IPA A;  2PJR B;  1RRJ A;  1JE8 A;  1R1U A;  1TNT A;  2A05 A;  5LGT A;  3QPS A;  4XOT A;  3ZQ7 A;  2CW7 A;  1NHA A;  2F4I A;  5FKO A;  5DD4 A;  1VQK I;  3G1L A;  2EV6 A;  2E1C A;  1S29 A;  2MC3 A;  3HJE A;  3MZ8 A;  4JP0 A;  5E3N A;  1DQU A;  4IOA F;  4JX4 A;  2NOG A;  5KNL A;  2HXI A;  4UVC A;  5DV5 A;  1Z6R A;  2P81 A;  1J59 A;  1WHU A;  2FRH A;  2W24 A;  2I10 A;  2VOD A;  2VXZ A;  4UV9 A;  1YI2 I;  3SQN A;  3CCS I;  1IV6 A;  4O5V A;  1WJC A;  2VLA A;  2R7Z J;  5B1A H;  2AXL A;  3MAJ A;  3FX3 A;  3X2Q H;  3ELK A;  2IA2 A;  4XRF A;  2YS9 A;  3CC4 I;  1X4O A;  2JA2 A;  1MZB A;  2CV2 A;  3LST A;  4QWQ A;  2V79 A;  1A35 A;  5F64 A;  3BJA A;  2ZC2 A;  1K6Y A;  5F1R A;  4UXN A;  5D8L B;  1Z7U A;  3O8G A;  2F48 A;  4RMN A;  1MD0 A;  4OOI A;  4L18 B;  4IQ4 A;  2DYS H;  2MW8 A;  1ZEL A;  3T5X A;  3S2D J;  3CCU I;  4J01 A;  2V4J C;  3F9K A;  4P5O A;  1WJF A;  1E3O C;  4G7Z F;  4BU2 A;  4B43 A;  3IRQ A;  3RTR A;  2OQG A;  4M6V A;  4DZJ A;  4EV0 A;  2WAQ A;  3DU5 A;  2NXN B;  3AL0 C;  2M2E A;  4E7I A;  4BJ5 C;  5GTH C;  4BEH B;  5M3M J;  1SAN A;  3VPR A;  2FMY A;  2QA4 I;  1U9O A;  3OY9 A;  4G9Y A;  2BY0 A;  3CCV I;  1X4P A;  3I53 A;  3I59 B;  3RKY A;  3K0L A;  5BMZ A;  3H9J A;  3GLX A;  2H94 A;  3HL2 A;  2VOP A;  4UY8 I;  2QBY B;  3Q3S A;  4M3G A;  3O6B B;  3WGI A;  1XCV A;  2DMU A;  4Q47 A;  2L0K A;  3I71 A;  4QSH A;  5IP9 J;  5A2Q K;  1FY7 A;  1T33 A;  1ODD A;  4BE2 A;  3HYI A;  2XC7 A;  5HLT A;  3JRG A;  3HOY J;  3ZMZ A;  1QZE A;  2F2E A;  2LBF A;  2HR3 A;  4B44 A;  1IN6 A;  2K02 A;  1MMG A;  5TIS C;  1IRG A;  2X1D A;  4LLG F;  3MFK A;  5BPI A;  4GRI A;  2OU2 A;  2FUG 2;  1IRF A;  1BJZ A;  2M45 A;  4FX4 A;  1LEA A;  4E7L A;  3R4K A;  1S9H A;  2XRO A;  2L02 A;  5H6R A;  4LIT A;  2CW8 A;  5K1Y A;  2LMD A;  1WJD A;  2BV6 A;  1FTZ A;  5E17 F;  1I3A A;  4I0B A;  3RCO A;  1X3W B;  2O8X A;  5JHU A;  1MMN A;  3C7J A;  2XAJ A;  2EK5 A;  5LEK A;  1HBX G;  2CV1 A;  4KDP A;  2E2I J;  3HPH A;  3N97 A;  3SZT A;  1H0M A;  2WB1 N;  2A07 F;  2CQX A;  4ENN A;  5FRO A;  1HW2 A;  1LJ9 A;  3B02 A;  2X4H A;  3CJN A;  1TP4 A;  4RA2 A;  3VYS B;  4BNC A;  3BG6 A;  4UVA A;  4YG2 F;  1RUO A;  1O7L A;  3K4C A;  3K2Z A;  1BIB A;  1O4X A;  1WVR A;  1U78 A;  5M5Y J;  4MHG A;  3H1C A;  1ZG5 A;  2FQ4 A;  1W1W E;  3IV5 A;  1BIA A;  2H6C A;  3BTC A;  3ZMS A;  5AIQ A;  1IC8 A;  1Y6I A;  1IO2 A;  4R8H A;  1EJ9 A;  3PNV A;  1QBJ A;  4BBR J;  3OMY A;  4EEF G;  2E2J J;  1UG0 A;  1EA3 A;  4ITV A;  1HCR A;  1Z77 A;  3TBI A;  3G2B A;  1EH8 A;  1HKS A;  5D5V B;  2ACJ A;  3DTI A;  1VND A;  4BH9 A;  2R7D A;  3PFY A;  3OV8 A;  3GBG A;  4ABZ A;  2M0M A;  3LA2 A;  2WY7 Q;  1SFU A;  5FJ8 J;  3M4O J;  1JHF A;  5LHH A;  3J81 Z;  4UNO A;  4KT6 A;  2DT6 A;  1OMI A;  2LSO A;  3OL4 A;  1NK3 P;  5LLQ A;  4D5C A;  2ELH A;  1TC3 C;  2CUJ A;  4XRS G;  2KL4 A;  1TWA J;  3LQR A;  2MC4 A;  2VQC A;  5CPR B;  4A5M A;  4JYK A;  2OA4 A;  1T98 A;  2FEZ A;  2NVU B;  5J4Y A;  4OWR B;  3ASN H;  5DM7 F;  3S2W A;  1MNE A;  2KKO A;  4XL9 A;  4WX9 A;  4LG3 A;  2JTV A;  4CA0 A;  2B0L A;  2VJ4 A;  1YFH A;  2CW0 F;  2K40 A;  3CP8 A;  2X0L A;  1L3L A;  2WAD A;  5HNF A;  1VZ0 A;  1K78 B;  3JAM Z;  2PG4 A;  2JPB A;  1CF7 A;  2DPD A;  2P5L C;  2PX9 A;  1OR7 C;  4EVI A;  5E79 C;  2HDD A;  4EM2 A;  2PJP A;  3ZXS A;  1P4W A;  4ETS A;  2IRF G;  3GWZ A;  4KJZ A;  1JKQ C;  2O9L A;  2XPW A;  2HQA A;  3Q5F A;  4A6D A;  1V54 H;  3LSM A;  4DJA A;  3JRC A;  3K4N A;  1W36 D;  1RES A;  2KRC A;  2LYC A;  2XV4 S;  5CQE A;  4E70 A;  4ZYD A;  2X85 A;  5K7H A;  2H1K A;  3OYH A;  4A12 A;  5E8I A;  2OTL I;  3KYL A;  1VQP I;  3E5U A;  2HYF A;  1ZKG A;  2EIK H;  3TGN A;  2XF7 A;  5F04 A;  2L9V A;  1TT0 A;  3DF8 A;  3A01 B;  4MLO A;  4M73 A;  2VOO A;  2HXO A;  2XHK A;  2FQ3 A;  4M9X A;  1TL8 A;  1HSJ A;  3BQZ A;  2EFN A;  3E5Q A;  3FK7 A;  3O2P E;  2LY9 A;  2OV7 A;  4CZC A;  3W3C A;  4HYE A;  5FB2 A;  2J5P A;  3BG9 A;  3C2G A;  3ZRG A;  4D7N A;  3HTS B;  1ETX A;  3G71 I;  1TT5 B;  4F55 A;  3QWL A;  1EH6 A;  3K4L A;  3MKL A;  4C3J J;  1MKM A;  2DA5 A;  1MBF A;  3OL3 A;  5ICF A;  5LD2 C;  3P7N A;  1KQ0 A;  2W57 A;  2K85 A;  1WH5 A;  2JN6 A;  3L2R A;  3E3V A;  3BR3 A;  4HX7 A;  1ZH5 A;  3DTE A;  2HOS A;  2DA1 A;  1O3S A;  4G6Q A;  3L9F A;  3NWS A;  4BHC A;  2P5K A;  2VKE A;  3HHG A;  3JRA A;  2P7C B;  3DPT A;  1GV2 A;  1POG A;  2XSJ C;  3IH2 A;  3A4C A;  1XGM A;  4II3 A;  2XAQ A;  4M3E A;  4F52 A;  1QA6 A;  3EYY A;  4HV5 A;  4C2T A;  3KP5 A;  2E34 A;  4XKV A;  2DJI A;  2P0W A;  1XSX A;  2MLK A;  4AWX B;  1AWC A;  1WJB A;  2FBI A;  4KUM A;  4DIQ A;  1QQI A;  4PFO A;  1OCT C;  2FU4 A;  5AIP A;  4F3Q A;  3W6J B;  2ELJ A;  2XIG A;  2VI6 A;  3H36 A;  2O6G E;  2WC2 A;  4RGR A;  1P2F A;  2AO9 A;  4EJW A;  2RAE A;  3HUG A;  3KP2 A;  5IY5 H;  2NOJ B;  1IJW C;  3AG4 H;  3FF5 A;  2HGC A;  2H27 A;  3HKZ N;  3UKG A;  3HG9 A;  3QPH A;  4F91 B;  2CSO A;  3BWG A;  5HOD A;  4I2O A;  1PP7 U;  3BQY A;  2VL8 A;  2FBH A;  3TMO A;  3K1N A;  4DW6 A;  4B8X A;  4AM3 A;  5E3L A;  1Y8Q B;  2KFD A;  1TWF J;  1YX5 A;  5DYM A;  4OIQ F;  5HDN A;  1HW5 A;  3I0T A;  4M72 A;  1ETQ A;  2WV0 A;  2VXD A;  2JVG A;  4G12 A;  1R22 A;  5IYB J;  1I1S A;  3BPV A;  1DU0 A;  1XX5 A;  1D8K A;  2E5Z A;  1NH3 A;  3IL2 A;  1JHH A;  3A0B C;  2K9M A;  1WJ5 A;  3ZMU A;  1T0F C;  2LNB A;  4E4H A;  3FXL A;  4MIM A;  2OC6 A;  1IN7 A;  2F4M B;  2J5O A;  1RIO H;  2F5V A;  3LFK A;  1GT0 C;  2ZME A;  4BDZ A;  3RYR A;  5E3M A;  4UUT A;  3E6B A;  4RM3 A;  4A3J J;  3TOB A;  2A6H F;  3SHF A;  2M4G A;  1ULY A;  6PAX A;  4WWC A;  3C3W A;  2XGD A;  1AHD P;  4E6K G;  1B4A A;  2GA1 A;  5FFZ A;  3E7L A;  3FKI J;  3M8E A;  3K4B A;  3CCQ I;  2L9R A;  4RM2 A;  1U8R A;  1GVJ A;  2RV8 A;  3GTJ J;  1W36 C;  1JI8 A;  3ZQC A;  4AUX A;  1MJB A;  4BS9 A;  1YS6 A;  1SFX A;  5ICG A;  2KIU A;  1V3F A;  3GZ5 A;  4V2G A;  3FMR A;  2PQ8 A;  1G8X A;  1G4D A;  1ZRD A;  5LBQ A;  1XG1 A;  1PDN C;  2MSY A;  2L54 A;  2EQR A;  3L2Q A;  2FSW A;  1T56 A;  2M30 A;  4XMY A;  4QIW N;  4WXH A;  4RBO A;  3PM1 A;  5KVR A;  4ZH4 F;  1LPQ A;  5GAD J;  3Q9V A;  4DOZ A;  3DLL F;  1LE8 A;  1MIJ A;  2E35 A;  3ABU A;  1YRN A;  2GXA A;  3EUH C;  4XR6 A;  5E20 A;  3BZC A;  3JRF A;  3K70 C;  2D1H A;  2ZO4 A;  1HQC A;  2V7F A;  1JT0 A;  1IUY A;  2KRH A;  1HDD C;  3E6M A;  2HWV A;  4A3M J;  2L7F P;  1FBQ A;  2KIS A;  3CDL A;  3MVP A;  1APL C;  3PQK A;  2R3S A;  2RDP A;  1Z6T A;  4HNV A;  2KDZ A;  2GOM A;  3OR2 C;  4HBL A;  5JR3 A;  3K7A J;  2QEX I;  3I4N J;  4DQ2 A;  3WTU C;  5CKT A;  2V9K A;  3OIO A;  4CYC B;  2ZSH B;  2GM4 A;  1NG6 A;  3LNQ A;  3IH3 A;  1O57 A;  1ETW A;  1J09 A;  3IRR A;  3VYT B;  3CMM A;  2M3A A;  5J40 A;  1AOY A;  1DPR A;  4KN7 X;  3WU0 A;  2GLO A;  3JW4 A;  3ZQF A;  1OYY A;  2M7A A;  1DGR M;  3KP4 A;  5GPC A;  3W2A A;  3KZZ A;  5FKN A;  2YU3 A;  2Y0S A;  2B9S A;  4XLE A;  2UV1 A;  3LQQ A;  1ZGW A;  2ECC A;  3HTU A;  4ESJ A;  2DA2 A;  1FSH A;  3S3N A;  1X3Z B;  3VYU B;  4XRS A;  4XLN F;  1R49 A;  4E7Z A;  4HPQ A;  3CJQ B;  2D5V A;  4A0X A;  3HOT A;  3QYE A;  4JOM A;  2HPM A;  3LSR A;  5TJJ A;  3S15 J;  2BZT A;  4WK8 F;  2CO5 A;  1I27 A;  1IN8 A;  1KU9 A;  1HLV A;  2VJJ A;  4NC8 A;  2XDV A;  4IHV A;  4L9N A;  1YQA A;  1GHC A;  2K9S A;  2N8G A;  4UHT A;  2R7U A;  2JA6 J;  1KON A;  3F8B A;  2W48 A;  4F7Z A;  4Q4Z F;  2CQN A;  3ABL H;  3FDY A;  1FOX A;  1T0F A;  1B6A A;  1G3T A;  1B1B A;  1FP1 D;  3C18 A;  3HSR A;  2GA2 A;  1P4A A;  4KYW A;  3KEY A;  4IF4 A;  3JCU C;  3W6K B;  2X1C A;  3M8J A;  4KIC A;  3Q0W A;  1D0Y A;  4D0P A;  2QF7 A;  3UR3 C;  2YPR A;  4ZYE A;  5DDG A;  3Q0V A;  1I3Q J;  3CZ6 A;  4UUS A;  2YX7 A;  2LVS A;  1H8A C;  1UEL B;  2RQP A;  1QHG A;  1SMT A;  4S05 A;  2GIV A;  2L7M P;  1AU7 A;  4NC6 A;  2PMU A;  3QYB A;  3F6V A;  4GFB A;  2XUB A;  5EJC A;  5FO5 A;  3CD6 I;  1ENH A;  3HBL A;  2WBM A;  2GWR A;  4FET A;  3UNG C;  4M9Z A;  1QO0 D;  2EZH A;  4HG2 A;  3FHN A;  4RAF A;  3B6A A;  4LG0 A;  3L00 A;  3GTQ J;  1ETO A;  3GFI A;  2L7K A;  1K83 J;  2KZV A;  4A3K J;  3CC2 I;  3JRH A;  1T8I A;  3CMA I;  1QPM A;  4PK4 A;  3TP3 A;  2HTS A;  2XB5 A;  2DA7 A;  3WU1 B;  3W2V A;  1STZ A;  1OLT A;  1YS7 A;  2ELK A;  4BXX J;  1ZLK A;  5CVI A;  2GIZ A;  2Y31 A;  3WOD F;  2DLL A;  3GZN B;  2I5U A;  3NRV A;  4AYB N;  4L9V A;  1S3J A;  1XPX A;  3BOQ A;  3ECH A;  4YEJ A;  2DN0 A;  4AD9 A;  3GYH X;  1UFM A;  3WU2 C;  3GTL J;  2L2O A;  3WTV C;  4PJN A;  3RYP A;  2NS7 A;  1O7F A;  3KZI C;  5JI6 A;  4KIB A;  3D5S C;  3ROU A;  3OWT A;  4U0Y A;  1Z67 A;  5JVG F;  1ETK A;  2Z9O A;  3F23 A;  2EIN H;  2P6S A;  4IHY A;  1EH7 A;  3R60 A;  2C6Y A;  4G6T B;  3BP8 A;  3U9G A;  3MKY B;  5BS6 A;  1BC8 C;  2B63 J;  4Y52 J;  2WAF A;  3QYF A;  2AQF A;  1WSU A;  3Q0U A;  2CG4 A;  2OD5 A;  1JUP A;  2X6X A;  5D8K B;  5ICC A;  1K61 A;  2M34 A;  3IC7 A;  1OFC X;  3RKQ A;  1UG2 A;  1XD7 A;  2VJI A;  2ETH A;  4YRV A;  3ONQ A;  2DDA A;  4LFU A;  2HVS A;  1I50 J;  4PUS A;  1PUF A;  1TWG J;  4KIS A;  2IAI A;  2EPF A;  4BGD A;  1Z05 A;  4BYY A;  1GLN A;  4D5F A;  4FT8 A;  1W4M A;  2TRT A;  1UHS A;  5GP9 A;  3RI4 A;  2YUS A;  2BHY A;  3BCA A;  2BE5 F;  4CSW A;  5GAE J;  2HQN A;  5L3D A;  2AS5 F;  2G9W A;  1RI7 A;  1YX3 A;  1R9T J;  2KPM A;  3KP6 A;  2JMW A;  1T38 A;  5HS9 A;  2QQ9 A;  2K5C A;  3H35 A;  1TW3 A;  2K86 A;  3DP7 A;  3SZP A;  1SFO J;  1PUE E;  1OCR H;  1Y1V J;  5HS8 A;  3OOU A;  2OCC H;  1CF7 B;  3PIP F;  1XTA A;  2DQL A;  3P9I A;  3JRB A;  2XAU A;  5EG0 A;  3GFL A;  2UZK A;  1AKH B;  4AYB A;  2HPI A;  4OAY A;  5FKL A;  1FNN A;  1N77 A;  5FRN A;  1DUX C;  4A0Z A;  4LD5 A;  2WV1 A;  3WHB A;  3CCR I;  2ZFW A;  3G73 A;  1UAA A;  4YFN F;  2M1B A;  5JLX A;  3GME A;  4G8X A;  4XM3 A;  1I5Z A;  3HRM A;  2ZJP F;  1LB2 A;  2QEN A;  1IG7 A;  1VI0 A;  1FTT A;  2A3S A;  1ZG1 A;  4BQA A;  3S14 J;  4CCK A;  2O8K A;  4EJO A;  1YOV B;  4YEL A;  3IAS 2;  1KU2 A;  1TTY A;  2FOW A;  4X0G A;  2BVL A;  1XMA A;  1Y0U A;  2DJN A;  4UVB A;  3LL7 A;  1BC7 C;  1Y1W J;  2ZB9 A;  1ITY A;  4E7J A;  1A6Q A;  2GQQ A;  5FRM A;  2BW3 B;  2EZL A;  2HOE A;  2VQG A;  3GW2 A;  4JX6 A;  3VEP A;  1MSF C;  4Z2Y A;  2XGC A;  1YHQ I;  1OCZ H;  3MN2 A;  4I7H A;  2GXB A;  3DU6 A;  4Q5S F;  5DS9 A;  1S7O A;  2OPT A;  3FKJ A;  3KYD B;  1J9I A;  3RKW A;  3KFW X;  2X6W A;  3CCL I;  4K2E A;  3MCZ A;  5C44 J;  2MGQ A;  4BL0 B;  2LKP A;  4G94 A;  2DFI A;  3FBN B;  3ECO A;  4IZZ A;  4RB1 A;  2D2W A;  3PO3 J;  1XDS A;  5IT9 K;  1Y56 A;  3ML6 A;  4B48 A;  5FD6 A;  4II2 A;  3HOZ J;  1BA5 A;  4CCO A;  1E17 A;  4I6Z A;  2DTZ A;  3I58 A;  4B1R A;  4C2U A;  3OIQ A;  3WE3 A;  2F5E A;  1N78 A;  4UB8 C;  5HVQ C;  1ETV A;  2X48 A;  3C2H A;  1B72 A;  3FXO A;  1DP3 A;  1G3W A;  2Z99 A;  2VQH A;  3C1D A;  3RZD J;  4PCQ A;  1G59 A;  5CYV A;  2R5Y A;  3HRT A;  4X6A J;  3ISP A;  5B1B H;  3S1Q J;  1FT9 A;  1KYW A;  2DA3 A;  3DQV C;  1D1C A;  3CES A;  3LSP A;  3KCC A;  1J5Y A;  1H9T A;  1WCM J;  2MG4 A;  1CQT A;  1L0O C;  2KJB A;  3E5X A;  3QRF F;  1R23 A;  3QPT A;  3GTK J;  1N25 A;  1V4R A;  1Y39 A;  4GYG A;  3GTG J;  1HST A;  4HOB A;  2CFX A;  2ECB A;  4MFE A;  4CXF A;  4UUV A;  3I55 I;  2RNJ A;  2JPC A;  2EV0 A;  2LKS A;  5ERI A;  3H5R A;  2ZBK A;  3OYF A;  1PJR A;  2W25 A;  3TO9 A;  4RAG A;  2HKO A;  1YW7 A;  3GXO A;  1G6N A;  1B59 A;  2QUF A;  3OOP A;  3GTP J;  1P9Q C;  2OUM A;  1D1A A;  1EKE A;  5TRD A;  1P7I A;  4BAC A;  3T0Y A;  3CF2 A;  1U5T C;  2CH0 A;  2JSP A;  5LGU A;  2K7L A;  1BW5 A;  5H6Q A;  1MJA A;  2HI3 A;  2HEO A;  2DO7 A;  3F8C A;  3DV8 A;  2ZNZ A;  3GVA A;  2PMH A;  2YSR A;  3DKX A;  3FXJ A;  3M7G A;  3HOU J;  3BTL A;  1B8I B;  1W5S A;  3A0H C;  4G6D A;  1FBS A;  2KLO A;  3WTX C;  1BI3 A;  3K70 D;  1WJE A;  2CQK A;  3HHH A;  1RC9 A;  4IQJ A;  4I01 A;  1MH3 A;  1LDD A;  1T6S A;  3RPU A;  3JTG A;  2I8D A;  5FLX K;  2IS6 A;  2CYY A;  3Q9S A;  1KYZ A;  2K4B A;  5F1J A;  4PDK A;  1R36 A;  4X1E A;  5IOY A;  1GV5 A;  1MDM A;  2IVM A;  5JLW A;  1O3Q A;  3D5L A;  5IT3 A;  4XN3 A;  1BR1 A;  4EM0 B;  3ZQQ A;  1WZ2 A;  2LY1 A;  1BJA A;  4IRG A;  4KIT B;  4RLQ A;  5HNH A;  3T8R A;  3FM5 A;  2IJL A;  1QGP A;  2NNN A;  2Q1Z B;  1FEX A;  1BI0 A;  1R1V A;  3E0J B;  4B09 A;  4XLP F;  4A3D J;  5M5W J;  2ISZ A;  2FF4 A;  2A68 F;  1I6X A;  2VT3 A;  3K10 A;  2Z1D A;  3BR0 A;  3FIS A;  1USS A;  5F08 A;  4BXF A;  4HQE A;  4ENK A;  4IKF A;  1FC3 A;  3CLO A;  2NVT J;  3EET A;  1JTX A;  2VBX A;  2HDW A;  3BZ6 A;  5C4J J;  3I4M J;  2IS4 A;  3QQA A;  5FKM A;  2F6C A;  5LEJ A;  4DGW B;  5J1R A;  2V6C A;  3MMY B;  4MTD A;  3V4G A;  3BPX A;  2BOL A;  4OIR F;  4HEA 2;  1S5L C;  5J8F A;  2HZD A;  4D9J A;  3WTZ A;  1LE8 B;  2CGP A;  5IYC J;  1R4N B;  2HDC A;  3OYA A;  3TDU C;  3AFH A;  3GO5 A;  1KQ9 A;  2VUM J;  4KT5 C;  3ASO H;  4BUP A;  1UST A;  1YG2 A;  3QPL A;  5K7Z A;  3PJR A;  2XAH A;  4LIV A;  2E7X A;  2VJ5 A;  3F0C A;  4BBS J;  1RNL A;  3I59 A;  2JUG A;  1WGX A;  3DCF A;  2R92 J;  4HV6 A;  4FAS D;  2HYJ A;  2Q2E B;  2Z16 A;  3N4M A;  2IP2 A;  2NVQ J;  1UCR A;  3FK6 A;  5DCM B;  3J7A O;  1HDP A;  1IF1 A;  4BXU A;  3KP7 A;  1U0J A;  3FIW A;  1WPK A;  4NB5 A;  5K5R A;  2R7T A;  3M1E A;  1MNM C;  1UZC A;  1R6R A;  2IXS A;  4U87 A;  5DD8 A;  1FYL A;  4LJZ F;  1X2N A;  5IOZ A;  3D5R C;  4ZC3 A;  5LRS A;  1K6O A;  2R93 J;  4WXC A;  4EJV A;  2K9L A;  3IWF A;  2BVM A;  5J8C A;  3HEF A;  1IW7 F;  5BQT A;  4I09 A;  1BM9 A;  2NVY J;  2ZSI B;  5L3E A;  3WTY C;  2EIM H;  4LIU A;  5KK1 A;  2QYO A;  3E6D A;  4L9T A;  2X6Y A;  5CQG A;  5CVV A;  3NAU A;  1ZR4 A;  4IXA A;  2DOE A;  4R79 A;  2O5R A;  2QKL B;  3VOE A;  2WAQ N;  2XAG A;  3GF2 A;  5FLM J;  2MFZ A;  1Y0N A;  2E1M B;  2M7B A;  1Q1V A;  2LK2 A;  1JJ8 C;  2V1X A;  2DOF A;  4C2M J;  3BTI A;  3RPU D;  5B3S H;  2FA5 A;  2VBY A;  2P8T A;  1VQ5 I;  4HRI A;  4OU0 A;  2ME6 A;  1QHH D;  4HZF A;  1TWH J;  2JSC A;  3HXL A;  4YFX F;  1H9G A;  1Z9C A;  4IX7 A;  1BOB A;  1JGS A;  1MMA A;  3DEW A;  3PSF A;  2DMQ A;  3QOE A;  2P5V A;  3OYG A;  1WI9 A;  3FXQ A;  4CHU A;  4A3E J;  2ISY A;  4XID A;  3ZPL A;  2W00 A;  3OR1 C;  4ENJ A;  2IGN A;  2E5N A;  4XRM A;  2DFE A;  2JUC A;  2XB0 X;  1A04 A;  1FIP A;  4IRH A;  3WGH A;  2IEK A;  5E1Z B;  3R0A A;  5D5W B;  1SD6 A;  3D0S A;  4KIF A;  3OS2 A;  3ABT A;  3F72 A;  2HKX A;  2VE8 A;  2HNH A;  1BR2 A;  1OCC H;  2UXN A;  1ACI A;  2PFB A;  4ZZD A;  1E2X A;  2DOA A;  5HDG A;  3FZV A;  1FIA A;  3MZH A;  3S3O A;  1D5Y A;  3K4K A;  2VKV A;  2W82 A;  1IXR C;  3BR1 A;  4FTH A;  3CUQ C;  4HA8 A;  4GGG A;  2QWW A;  2PJR A;  1ZYR F;  4PSW A;  3SDB A;  4FQG A;  3FXM A;  1U3E M;  1JXS A;  3BTJ A;  1X2M A;  3PQJ A;  2V1U A;  3CUO A;  1VQ4 I;  3B6C A;  2VBZ A;  2LF7 A;  4YIF A;  3RPQ A;  1YJW I;  2LC2 A;  1JKO C;  5EGO B;  1JUS A;  3V8J A;  3A1Y A;  3I9V 2;  1W7P B;  1FOY A;  3AL0 B;  4AID A;  2P4W A;  4LK0 F;  4HX4 A;  3KYC B;  1KGS A;  2LH9 A;  4PJL A;  3E1S A;  3QOP A;  4FHT A;  3JSP A;  4RB0 A;  5M3F J;  2JA8 J;  4Y33 A;  1D8J A;  2XF5 A;  1JT6 A;  1ON1 A;  5L3C A;  2OAZ A;  3O3K A;  3PUF A;  1ZAO A;  2MYS A;  3AKZ A;  5LGN A;  2CS3 A;  2HOT A;  4EGY A;  3RSN A;  2CV0 A;  2DA4 A;  2HTJ A;  4HF2 A;  1W7P D;  1LFP A;  4M6X A;  1FMW A;  3A03 A;  2COM A;  5GTI C;  3S1M J;  2XPV A;  1X1C A;  3J7Z I;  4A5N A;  1Z21 A;  3SJM A;  2OCE A;  5J4V A;  5D5U B;  1CGP A;  4PJJ A;  4HNT A;  3CMY A;  2DA6 A;  4Y17 A;  1BBY A;  2TDX A;  5D6E A;  3H0D A;  1REP C;  5M5X J;  1Q1H A;  3OS0 A;  2DU9 A;  3HM5 A;  1I1G A;  2IA1 A;  2VKD A;  2IS2 A;  2K27 A;  2CUE A;  1I39 A;  3MQ0 A;  1A31 A;  3BY6 A;  1Y8R B;  3I3L A;  3GTM J;  1VTN C;  4DBR A;  1XGS A;  4XLA A;  4XLH A;  5LHI A;  4BEH A;  2JQ7 A;  3GFM A;  1PYV A;  4QPO A;  1KU7 A;  3JAM K;  1B9M A;  3A01 A;  1WJA A;  1VQO I;  4WF2 A;  2O0Y A;  2X6O A;  2BHZ A;  4HLX A;  3TW6 A;  2EFP A;  1HA8 A;  4L0Y B;  1YE9 A;  5K5O A;  3RQ4 A;  3I64 A;  4U88 A;  3F22 A;  3H5A A;  4IO9 F;  3KIO A;  2L01 A;  2M8E A;  4BHB A;  1LQ1 A;  2LY2 A;  1IDY A;  4BAY A;  1FP2 A;  3TED A;  2AQE A;  2F5F A;  1XGN A;  2BBY A;  4Y13 A;  3L1P A;  4A3C J;  3PL8 A;  2MD0 A;  1KZH A;  4JX5 A;  4U7B A;  1GDT A;  3MD2 A;  2A5Y B;  3ULQ B;  5JFR A;  1TQP A;  4MEY F;  3OYK A;  4MGR A;  4I0A A;  2WB1 A;  3BG3 A;  2HU9 A;  3V8L A;  5J3L A;  4XLC A;  1A36 A;  3V7C A;  2MA3 A;  2L3D A;  2JVH A;  2M5W A;  1JJ6 C;  1A5J A;  2YX4 A;  3IP4 B;  4NHJ A;  2Q0O A;  2DBB A;  4U0W A;  2E71 A;  4AIK A;  2KP6 A;  2OBP A;  2JWT A;  5FLX Z;  4KIG A;  5DCM A;  2EB7 A;  2BEO A;  2BY1 A;  3I56 I;  2CQQ A;  1LKX A;  3MKZ A;  4XKB A;  4H0E A;  2IGO A;  3TO6 A;  2V1N A;  2ZFU A;  1ON2 A;  3HUG B;  1OJL A;  2R5Z A;  2E1M C;  3FHZ A;  2XAF A;  3GZ6 A;  4Z6Y A;  1FOW A;  2DQR A;  1W5C C;  4XSZ F;  2VPL A;  2Y9Z A;  4HLY A;  4UV8 A;  4A3F J;  1FSE A;  1LVA A;  2E36 A;  5AON A;  1K4T A;  3ESW B;  4DZP A;  5DCF A;  1Z91 A;  2F4O B;  4W1U A;  2A5W A;  5ED4 A;  3SEQ A;  1O3T A;  2BGC A;  4DYC A;  2M4K A;  3ZOB A;  2JT1 A;  4RS8 A;  4PGG A;  2FBK A;  3MZY A;  1U6G A;  3KZY A;  2L4M A;  4Y15 A;  3SZG A;  3LAJ A;  4IEJ A;  4A93 J;  1R7J A;  3FBI B;  5FGM A;  1J7K A;  3MKW B;  3G1M A;  3R0J A;  1TLH B;  2F5D A;  2LOO A;  5E1X A;  3K4J A;  2XSD C;  4KNY A;  2QSH X;  3AG2 H;  4BQN A;  3ZMT A;  2DT7 B;  1KA8 A;  3BR6 A;  5CVR A;  1XMX A;  4AC0 A;  3SDG A;  5ICE A;  3H9Q A;  3LSJ A;  4XSX F;  2KJC A;  1SFK A;  4RB2 C;  2R7R A;  4XOR A;  3OSF A;  1S6L A;  2KT0 A;  2ZME B;  4GDF A;  5CVJ A;  2DK5 A;  1MSE C;  3DLA A;  4LB6 B;  4EQQ A;  2NS0 A;  1OYI A;  2HQR A;  2X1E A;  1TW2 A;  1HF0 A;  3H9G A;  2QSG X;  1P92 A;  2H09 A;  3WTW C;  3SFZ A;  2NAZ A;  3WG9 A;  2FNA A;  3F6O A;  3S3M A;  2VT2 A;  5HOO A;  5IT9 Z;  1WQ2 A;  3M07 A;  5KCM A;  5HDK A;  1U5T A;  3M9A A;  2Y30 A;  2L7Z A;  2YU9 J;  1RR8 C;  4M74 A;  1N75 A;  2Y9Y A;  3DPL C;  4XON A;  3ABK H;  2VN2 A;  3HSE A;  1W0T A;  5D5X B;  4MQ9 F;  4RGX A;  5E3O A;  3SXY A;  2MH9 A;  1BR4 A;  3CME I;  1YLF A;  1XGO A;  4HQM A;  4PSX A;  1F4K A;  3QU3 A;  3PNT A;  3F8N A;  2QBY A;  2XRL A;  4B3A A;  3KLO A;  2ZJR F;  1W7P A;  2O3F A;  3BCB A;  5J6X A;  4QTR A;  1YRN B;  1H89 C;  2Z5U A;  4BKX A;  1LUJ B;  2XGX A;  3NWT A;  4A2U A;  3S2H J;  2R7O A;  1AA7 A;  3HB9 A;  4JK1 X;  2DDB A;  3FXU A;  4XOP A;  1T95 A;  3L2U A;  2A61 A;  4GYI A;  4IHW A;  5H2F C;  1X58 A;  3L2W A;  2AHQ A;  3VOD A;  4ZYH A;  4NDL A;  3HOS A;  4L0Z B;  2IS1 A;  2HOA A;  5J1U A;  4ANJ A;  3E97 A;  4N9H A;  5FKK A;  3PO2 J;  1F43 A;  1LFB A;  3U2R A;  2HS5 A;  3V42 A;  3OYD A;  4RLF A;  4CYC A;  1J0R A;  3LSH A;  4CUG A;  3M3Y J;  1X19 A;  5HS7 A;  3IH4 A;  2R7W A;  1HOM A;  1IXS B;  4A6E A;  3LA7 A;  2HVQ A;  4D1Q A;  4ENM A;  2VIX A;  4IHT A;  4GO1 A;  4M6Y A;  4OMZ A;  2MD5 A;  3CC7 I;  3H3V K;  4BE0 A;  3EYI A;  3ZCO A;  3BR2 A;  1XSV A;  5FLV A;  3H3U A;  4HSR A;  5D4S A;  1F5T A;  2EIL H;  1SVM A;  3J7A Y;  2EA2 A;  4IOC F;  4CCN A;  4MTE A;  3BDD A;  2X9D A;  2ZXJ A;  1OCO H;  1ZRC A;  2E2H J;  2IPQ X;  5K7F A;  5HLH A;  4YIR X;  4M3D A;  1R71 A;  1TQI A;  2Q2E A;  2XAS A;  3ZMV A;  1W5T A;  4CGZ A;  2LR8 A;  3P9C A;  4I02 A;  4CCL A;  2Z33 A;  3BG7 A;  1Z1D A;  1LVK A;  1XC5 A;  3FXK A;  5EEA A;  2Z2S B;  4OAZ A;  1R5I D;  1SD7 A;  4DYQ A;  4M71 A;  2R0Q C;  4O6J A;  1YO5 C;  2EFO A;  4C9Y A;  5L3F A;  2PMZ A;  2GXG A;  3EQL F;  5LFA A;  2LKX A;  3BR5 A;  5DUI A;  2G7U A;  5CLS A;  3WG7 H;  3N05 A;  4MEX F;  2Y2Z A;  1XS9 A;  4N4O B;  1FWZ A;  2CMP A;  3V7R A;  3AAF A;  1MND A;  1X1B A;  2COB A;  2KRF A;  1S72 I;  1LDJ A;  2V9V A;  1IRX A;  2FX0 A;  3K2A A;  3NQO A;  3S1R J;  4I98 B;  3BG5 A;  3HOV J;  4NQW B;  4EM1 A;  3CQZ J;  4XIC A;  1YIT I;  3BT9 A;  4EJT A;  4BQO A;  4AVZ A;  3LWF A;  1YW9 A;  1IXC A;  2DXI A;  2W4S A;  3R6S A;  1RUN A;  4WCG A;  4CCJ A;  5KAF C;  1TBX A;  3V7S A;  3S32 A;  2M8G X;  2PEX A;  1E3H A;  2OQR A;  4LLN A;  3H3Z A;  2XPU A;  2WA0 A;  2AXT C;  3L09 A;  2FE3 A;  3T8T A;  4P9U A;  1XN7 A;  4OIO F;  3A02 A;  5DM6 F;  4HDV A;  5BOX A;  2EH3 A;  4S0H B;  1MMS A;  3MWM A;  2HYG D;  4M3F A;  2VC0 A;  3DKW A;  3WGG A;  2LDU A;  2PLY A;  2VBW A;  5A2Q Z;  5IYD J;  2OTJ I;  4RB3 C;  2ADU A;  1FX7 A;  1JTY A;  5ILS A;  3CDH A;  3HRU A;  4IHX A;  3OSG A;  2ME0 A;  2VC1 A;  3OYM A;  4HAM A;  2XRN A;  3ERM A;  4DYR A;  2KHM A;  1IRZ A;  3CCJ I;  5F27 A;  4OIP F;  2DTR A;  2NS8 A;  2M9H A;  1HW1 A;  3K4M A;  1FZP B;  4EAT A;  2KIQ A;  4ZDO A;  3LFU A;  4PGH A;  4HW0 A;  1WFX A;  5ILV A;  1R1T A;  3DXJ F;  1S8N A;  4HF1 A;  2QKM B;  3U1K A;  1C0W A;  4A0Y A;  3SEZ A;  4PZJ A;  1EF4 A;  3BRO A;  1Z0X A;  4CYD A;  3TDZ C;  3IKT A;  1PVE A;  1BOA A;  3OYJ A;  4ZJZ A;  3OYC A;  2UXX A;  3JTH A;  4A3I J;  1FJL A;  3P5J A;  4RGS A;  1ZG3 A;  3F8F A;  2BYV E;  2OJE D;  3CCY A;  2PN6 A;  2FD5 A;  2DOD A;  2G0E A;  3GLL A;  4EGZ A;  3J80 Z;  1T08 B;  2ZXH A;  4N4N B;  2W7N A;  1ZLJ A;  3LSK A;  2JA5 J;  4A3L J;  2NRA C;  2R7F A;  4FIS A;  3EDP A;  3IKV A;  4J00 A;  5F0C A;  1M1E B;  4LGW A;  1BL0 A;  4AVP A;  1RET A;  1V5F A;  3A2K A;  3RJP A;  1OPC A;  4YFK F;  1ZRE A;  2E1N A;  4C30 A;  3H92 A;  4ESF A;  1VQM I;  2CJJ A;  1JGG A;  2IBD A;  2VKH A;  2M0C A;  5JVT A;  4NBQ A;  3GCM A;  4I99 C;  3K1M A;  2JRT A;  1MBH A;  4A69 C;  4M9S A;  3J7Y J;  2P7V B;  4CCM A;  3JR9 A;  1SFE A;  2PMZ N;  3SFI A;  1X1D A;  3IHU A;  3TL4 X;  2DFH A;  1OYW A;  3QOD A;  4S04 A;  2QQA A;  3ZQI A;  2O03 A;  2HVR A;  1OQY A;  4ON0 A;  1VQ8 I;  2XGE A;  4RDU A;  5EZG A;  1D3Y A;  2LTP A;  1YTY A;  2PBI A;  5J1Y A;  2FJ1 A;  3TW7 A;  1QZZ A;  2WAE A;  1V5G A;  2QLZ A;  4KMF A;  2KMU A;  1KU3 A;  2LFB A;  4XKC A;  2XF6 A;  3VYR B;  3U1D A;  4TV7 A;  2R7S A;  2HQ5 A;  2DT5 A;  2R4G A;  4R1H A;  3OS1 A;  1SAU A;  1G3Y A;  3KPH A;  1IGN A;  2OZU A;  5J47 A;  4ZTF A;  2Y75 A;  3L7W A;  3DFG A;  3IAM 2;  1QNT A;  1ETY A;  2JK3 A;  2EBI A;  3QAH A;  5EZH A;  2Y69 H;  5E8G A;  3M1C A;  5K5Q A;  3PUB A;  3G4S I;  4AIH A;  1UMQ A;  2RN7 A;  5GAG J;  3AG1 H;  4RGU A;  4ZYG A;  4P96 A;  1VF9 A;  3DEU A;  4G7O F;  1EV7 A;  2IGM A;  2OZ6 A;  5KHD A;  2KIM A;  1ONV A;  2QVO A;  3HDD A;  4UUS B;  2L9S A;  2CRG A;  2LF8 A;  1DP7 P;  1QZY A;  2LD5 A;  3K1P A;  3CO6 C;  1QRY A;  3WTS C;  4E7S A;  2H6B A;  2ZJ2 A;  3I4P A;  1XB4 A;  4EJU A;  4IHS A;  2P6T A;  5TGT A;  4XQF A;  3F3X A;  3HOW J;  4ZDL A;  3ZN0 A;  2K9N A;  4D7M A;  4LG0 B;  1XMK A;  4EMS A;  1MGT A;  2GBY A;  3PIO F;  3G6E I;  4XBF A;  1E3P A;  2STW A;  2R5Z B;  5EEG A;  3F8M A;  4OIN F;  1ZGA A;  5IP6 A;  2RGV A;  4A3G J;  4B4C A;  3V8K A;  2RKH A;  3K9T A;  3HGY A;  2KIF A;  5F0H A;  3HGG A;  3KE2 A;  1FOK A;  3CJT B;  3P9K A;  4JQF A;  4BJT A;  4QLC U;  3RIR A;  1DU6 A;  1GXQ A;  2ZJQ F;  1H88 C;  3WTT C;  1VQ7 I;  3VWB A;  2K9Q A;  4NQW A;  3LOC A;  3KX2 A;  4NC7 A;  4CIC A;  2A69 F;  4HX8 A;  2XKP A;  2XVC A;  2VE9 A;  3K69 A;  1JKR C;  1D1B A;  4BY7 J;  2UUZ A;  1PUF B;  2BY3 A;  4XNF A;  2V1D A;  3I5U A;  5EF6 A;  4LMY A;  3M8F A;  5ILU A;  2ZXW H;  2H8W A;  2V26 A;  1ZGJ A;  3ZGK A;  1BW6 A;  4JBA A;  3CJR B;  3S8P A;  3CUQ B;  3QU6 A;  3OYN A;  1K7A A;  2YR2 A;  4CH7 A;  3VB2 A;  2JJ7 A;  3VDX A;  3R61 A;  2K3F A;  2R7V A;  1F1Z A;  3EUH A;  2O7O A;  1P7J A;  4H4K C;  5KAI C;  1GVD A;  2ID3 A;  4ESB A;  3C2B A;  2K4J A;  2KDO A;  2QZ8 A;  4B47 A;  2NNY A;  2LRD A;  2EZK A;  3GFJ A;  1UHM A;  3ABM H;  4GXO A;  1OKR A;  1HC8 A;  2E60 A;  2DI3 A;  1B9N A;  1ZQ3 P;  5DTD A;  1R4M B;  3RQI A;  4C3H J;  2DPU A;  5FFX A;  2EFQ A;  1MDM B;  4BJ6 C;  2O61 A;  3NEU A;  3QP5 A;  2ICW G;  4XN0 A;  5B66 C;  2QGU A;  1SMY F;  1YYV A;  3ZMD A;  4L9J A;  2G7H A;  4NNJ A;  2DMP A;  1U5T B;  4ZDP A;  1ZAR A;  4M3B A;  1YJN I;  2L4A A;  4MNU A;  2WWY A;  1TNS A;  2DMT A;  3BJO A;  3ZP5 A;  1YJ9 I;  1ZR2 A;  1S7A A;  1QVU A;  1Z3X A;  2D1V A;  4LK1 F;  4IVN A;  4MFD A;  3AG3 H;  4P55 A;  5EG0 B;  4XK4 A;  1AKH A;  4XLF A;  9ANT A;  4BQQ A;  2ESH A;  4KFC A;  1FYK A;  5F0F A;  1XDU A;  4U0V A;  4AIJ A;  1W0U A;  2BY2 A;  2GZW A;  2IT0 A;  3HC7 A;  5C3E J;  4PFP A;  4DNC A;  2EWN A;  3ERE D;  2WY8 Q;  4ASN A;  4A3B J;  3J81 K;  1VQ9 I;  2UWM A;  2MLG A;  1LDK B; 
#chains in the Genus database with same CATH homology
 2ESN A;  2FXA A;  2DAO A;  1U2W A;  3BJ6 A;  1XCB A;  5D6F A;  4YII A;  3JSO A;  4HDU A;  4WXD A;  3B73 A;  3LA3 A;  1LNW A;  4CO8 A;  5D4R A;  1IN4 A;  1WKM A;  3KLN A;  2A6E F;  1OR7 A;  2MBF A;  1D5V A;  2EJR A;  1ZN2 A;  2Z3Y A;  1R00 A;  3GX4 X;  3GEZ A;  1HKQ A;  4RAZ A;  1ZRF A;  3KET A;  2MH2 A;  3T1B A;  1WWX A;  2IW5 A;  2VON A;  4Q48 A;  5L3G A;  1P6R A;  2JZY A;  3KP3 A;  1F9N A;  4HF0 A;  2ZNY A;  1BI1 A;  4OMY A;  1J2X A;  4ZZL A;  2ZKZ A;  2FOK A;  3CTA A;  3TQN A;  3TO7 A;  3FMS A;  4G7H F;  2EFW A;  2RC4 A;  1YW8 A;  2D45 A;  5E18 F;  5EEH A;  1HXD A;  5BPD A;  1J75 A;  1HKT A;  1FPQ A;  4U7D A;  1R5H A;  1O3R A;  1K78 A;  2EV5 A;  3REO A;  5LHG A;  1K79 A;  4MQV A;  2NYX A;  2W84 A;  4FX0 A;  3F21 A;  3COA C;  1IN5 A;  2FNP A;  3GUD A;  4KMU X;  1DDN A;  2PI0 A;  2Y0M A;  3L2C A;  3RKX A;  1KQ8 A;  2RVC A;  5LRR A;  3I54 A;  1UB9 A;  1T2K A;  2ZCW A;  1DPU A;  1SD4 A;  3G3Z A;  4L5I A;  1GXP A;  3TKY A;  4IRI A;  4BHP A;  3HRS A;  2Y48 A;  4CDG A;  2GAU A;  4N9I A;  4GCV A;  4N0B A;  2STT A;  1FBU A;  2DW4 A;  1YIO A;  2IA0 A;  3E6C C;  2QQB A;  1SD5 A;  1ZHF A;  3KEQ A;  1MJ9 A;  4O3M A;  3PFI A;  1IZ1 A;  4LB5 A;  5L3B A;  3FXR A;  3TOA A;  1T39 A;  1R58 A;  3CUQ A;  4IJA A;  2M87 A;  4KA4 A;  2F5C A;  1BN5 A;  3IWZ A;  1TQM A;  1BI2 A;  2HZT A;  3FM3 A;  5DUK A;  4LLL A;  1IAW A;  1G3S A;  5DEQ A;  4P9F A;  2WTE A;  1SAX A;  3MEX A;  3HIF A;  2QM3 A;  3FMQ A;  1P4X A;  1WRJ A;  2CWE A;  1LEB A;  2HFH A;  3WE2 A;  2EA4 A;  5HLI A;  3VFZ A;  3HSF A;  3FWE A;  3J80 K;  1XSD A;  4IPA A;  3LAP A;  1RZ4 A;  2W85 A;  2E7W A;  4KN4 X;  1UHW A;  1PP8 F;  2Q8K A;  5CVU A;  1FYM A;  5H20 A;  3CO7 C;  2FML A;  1FLI A;  4CZZ A;  5F6F A;  3ZN1 A;  2XKO A;  4RAY A;  3KEO A;  5CJ9 A;  1R5G A;  3QP6 A;  4L5J A;  3RDI A;  1X3U A;  5FD5 A;  2DK8 A;  5E1W A;  5HLG A;  1JE8 A;  1R1U A;  1TNT A;  5LGT A;  3ZQ7 A;  1NHA A;  5DD4 A;  2EV6 A;  2E1C A;  1S29 A;  2MC3 A;  4UVC A;  5DV5 A;  1Z6R A;  1J59 A;  2FRH A;  2W24 A;  2VOD A;  2VXZ A;  4UV9 A;  3SQN A;  4O5V A;  2AXL A;  3MAJ A;  3FX3 A;  3ELK A;  2IA2 A;  4XRF A;  1MZB A;  3LST A;  4QWQ A;  2V79 A;  5F64 A;  3BJA A;  5F1R A;  4UXN A;  5D8L B;  1Z7U A;  1MD0 A;  4OOI A;  4L18 B;  3T5X A;  4P5O A;  4G7Z F;  3IRQ A;  3RTR A;  2OQG A;  4EV0 A;  2FMY A;  4G9Y A;  3I53 A;  3I59 B;  3RKY A;  3K0L A;  5BMZ A;  3GLX A;  2H94 A;  2VOP A;  2QBY B;  3O6B B;  3WGI A;  1XCV A;  5A2Q K;  4Q47 A;  3I71 A;  1FY7 A;  1ODD A;  3HYI A;  3ZMZ A;  2F2E A;  2HR3 A;  1IN6 A;  2K02 A;  1IRG A;  4LLG F;  3MFK A;  5BPI A;  2OU2 A;  1IRF A;  2M45 A;  4FX4 A;  1LEA A;  3R4K A;  2XRO A;  2L02 A;  5H6R A;  5K1Y A;  2BV6 A;  5E17 F;  4I0B A;  2O8X A;  5JHU A;  3C7J A;  2XAJ A;  2EK5 A;  5LEK A;  1HBX G;  4KDP A;  3N97 A;  3SZT A;  1H0M A;  2A07 F;  4ENN A;  1HW2 A;  1LJ9 A;  3B02 A;  2X4H A;  3CJN A;  4BNC A;  4UVA A;  4YG2 F;  1RUO A;  1O7L A;  3K2Z A;  1BIB A;  1U78 A;  4MHG A;  1ZG5 A;  1BIA A;  2H6C A;  3ZMS A;  5AIQ A;  4R8H A;  1QBJ A;  1EH8 A;  1HKS A;  5D5V B;  2ACJ A;  4BH9 A;  2R7D A;  3OV8 A;  1SFU A;  3LA2 A;  1JHF A;  5LHH A;  3J81 Z;  4UNO A;  1OMI A;  2LSO A;  5LLQ A;  2ELH A;  3LQR A;  4A5M A;  2OA4 A;  1T98 A;  2FEZ A;  3S2W A;  2KKO A;  4WX9 A;  2JTV A;  2B0L A;  1YFH A;  2CW0 F;  2X0L A;  1L3L A;  1K78 B;  3JAM Z;  2PG4 A;  2JPB A;  1CF7 A;  2DPD A;  2P5L C;  4EVI A;  2PJP A;  4EM2 A;  1P4W A;  4ETS A;  2IRF G;  3GWZ A;  3Q5F A;  4A6D A;  2XV4 S;  4E70 A;  4ZYD A;  4A12 A;  5E8I A;  3E5U A;  2HYF A;  3TGN A;  3DF8 A;  4M73 A;  2VOO A;  2XHK A;  2FQ3 A;  4M9X A;  1HSJ A;  2EFN A;  3E5Q A;  3O2P E;  4HYE A;  5FB2 A;  2J5P A;  3HTS B;  1EH6 A;  1MKM A;  5ICF A;  3P7N A;  1KQ0 A;  2W57 A;  3E3V A;  4HX7 A;  1ZH5 A;  1O3S A;  4G6Q A;  3L9F A;  4BHC A;  2P5K A;  3HHG A;  2P7C B;  3DPT A;  1XGM A;  2XAQ A;  3EYY A;  4HV5 A;  3KP5 A;  1XSX A;  2MLK A;  4AWX B;  1AWC A;  4KUM A;  2FBI A;  1QQI A;  2FU4 A;  5AIP A;  3W6J B;  2XIG A;  2O6G E;  2WC2 A;  4RGR A;  1P2F A;  4EJW A;  3KP2 A;  3HUG A;  3FF5 A;  2HGC A;  2H27 A;  3QPH A;  2CSO A;  3BWG A;  4I2O A;  1PP7 U;  2FBH A;  3K1N A;  4B8X A;  5DYM A;  4OIQ F;  5HDN A;  1HW5 A;  3I0T A;  4M72 A;  2WV0 A;  1R22 A;  1I1S A;  3BPV A;  1D8K A;  3IL2 A;  1JHH A;  3ZMU A;  2LNB A;  1IN7 A;  2J5O A;  1RIO H;  3LFK A;  2ZME A;  3RYR A;  3E6B A;  3TOB A;  2A6H F;  3SHF A;  1ULY A;  6PAX A;  4WWC A;  3C3W A;  1B4A A;  2GA1 A;  5FFZ A;  3M8E A;  1U8R A;  1GVJ A;  2RV8 A;  1MJB A;  1YS6 A;  1SFX A;  5ICG A;  2KIU A;  1V3F A;  3GZ5 A;  3FMR A;  2PQ8 A;  1G4D A;  1ZRD A;  5LBQ A;  1PDN C;  2L54 A;  2FSW A;  2M30 A;  4WXH A;  5KVR A;  4ZH4 F;  3Q9V A;  3ABU A;  5E20 A;  2D1H A;  2ZO4 A;  1HQC A;  1IUY A;  3E6M A;  2HWV A;  1FBQ A;  3PQK A;  2R3S A;  2RDP A;  1Z6T A;  4HBL A;  5JR3 A;  4DQ2 A;  3WTU C;  1O57 A;  3IRR A;  1AOY A;  1DPR A;  4KN7 X;  3WU0 A;  3JW4 A;  1OYY A;  3KP4 A;  3KZZ A;  2YU3 A;  3LQQ A;  3HTU A;  4ESJ A;  1FSH A;  4XLN F;  4A0X A;  3HOT A;  5TJJ A;  4WK8 F;  2CO5 A;  1I27 A;  1IN8 A;  1KU9 A;  4L9N A;  1YQA A;  1GHC A;  4UHT A;  3F8B A;  4F7Z A;  4Q4Z F;  1B6A A;  1T0F A;  1G3T A;  1FP1 D;  1B1B A;  3C18 A;  3HSR A;  2GA2 A;  1P4A A;  4KYW A;  4IF4 A;  3W6K B;  4KIC A;  4D0P A;  4ZYE A;  5DDG A;  2YPR A;  2YX7 A;  2RQP A;  1SMT A;  4S05 A;  2GIV A;  2PMU A;  3F6V A;  2XUB A;  5FO5 A;  2GWR A;  4M9Z A;  1QO0 D;  4LG0 A;  3L00 A;  3GFI A;  1QPM A;  3WU1 B;  2HTS A;  1STZ A;  1YS7 A;  1ZLK A;  5CVI A;  3WOD F;  2DLL A;  3NRV A;  4L9V A;  1S3J A;  3BOQ A;  3ECH A;  4AD9 A;  3GYH X;  1UFM A;  3WTV C;  3RYP A;  1O7F A;  5JI6 A;  4KIB A;  3ROU A;  4U0Y A;  2Z9O A;  3F23 A;  2P6S A;  1EH7 A;  3R60 A;  2C6Y A;  3BP8 A;  3U9G A;  5BS6 A;  1BC8 C;  1WSU A;  2CG4 A;  2OD5 A;  5D8K B;  5ICC A;  3IC7 A;  1XD7 A;  2ETH A;  4LFU A;  1Z05 A;  4BYY A;  4FT8 A;  1W4M A;  3RI4 A;  2BE5 F;  2HQN A;  5L3D A;  2AS5 F;  2G9W A;  1RI7 A;  3KP6 A;  1T38 A;  5HS9 A;  2QQ9 A;  1TW3 A;  2K86 A;  3DP7 A;  3SZP A;  1PUE E;  5HS8 A;  1CF7 B;  3P9I A;  2DQL A;  2UZK A;  3GFL A;  1FNN A;  1DUX C;  4A0Z A;  4LD5 A;  2ZFW A;  3G73 A;  4YFN F;  2M1B A;  4G8X A;  1I5Z A;  3HRM A;  1LB2 A;  2QEN A;  2A3S A;  1ZG1 A;  4BQA A;  4EJO A;  1KU2 A;  1TTY A;  1XMA A;  1Y0U A;  4UVB A;  1BC7 C;  2GQQ A;  2HOE A;  3GW2 A;  3VEP A;  4Z2Y A;  4I7H A;  2GXB A;  4Q5S F;  1S7O A;  1J9I A;  3RKW A;  3KFW X;  4K2E A;  3MCZ A;  2LKP A;  4G94 A;  2DFI A;  3ECO A;  4RB1 A;  2D2W A;  1XDS A;  5IT9 K;  3ML6 A;  5FD6 A;  1E17 A;  3I58 A;  3WE3 A;  2F5E A;  5HVQ C;  1G3W A;  2Z99 A;  3C1D A;  4PCQ A;  5CYV A;  3HRT A;  3ISP A;  1FT9 A;  1KYW A;  3DQV C;  3KCC A;  1J5Y A;  1H9T A;  1L0O C;  2KJB A;  3E5X A;  3QRF F;  1R23 A;  3QPT A;  1V4R A;  4GYG A;  1HST A;  4HOB A;  2CFX A;  4UUV A;  4CXF A;  2RNJ A;  2JPC A;  2EV0 A;  5ERI A;  2ZBK A;  2W25 A;  3TO9 A;  2HKO A;  1YW7 A;  3GXO A;  1G6N A;  1B59 A;  2QUF A;  3OOP A;  5TRD A;  3T0Y A;  1U5T C;  5LGU A;  2K7L A;  5H6Q A;  1MJA A;  2HEO A;  2DO7 A;  3F8C A;  3DV8 A;  2ZNZ A;  3GVA A;  2PMH A;  2YSR A;  3M7G A;  1W5S A;  4G6D A;  1FBS A;  3WTX C;  1BI3 A;  2CQK A;  3HHH A;  4I01 A;  1LDD A;  3JTG A;  1T6S A;  3RPU A;  5FLX K;  2CYY A;  3Q9S A;  1KYZ A;  2K4B A;  4PDK A;  1R36 A;  1MDM A;  2IVM A;  1O3Q A;  3D5L A;  5IT3 A;  4EM0 B;  1BJA A;  4IRG A;  3T8R A;  3FM5 A;  2IJL A;  1QGP A;  2NNN A;  1BI0 A;  1R1V A;  4B09 A;  4XLP F;  2ISZ A;  2FF4 A;  2A68 F;  1I6X A;  2VT3 A;  1USS A;  4HQE A;  4ENK A;  1FC3 A;  3CLO A;  3EET A;  2VBX A;  3BZ6 A;  5LEJ A;  2V6C A;  4MTD A;  3V4G A;  3BPX A;  4OIR F;  5J8F A;  3WTZ A;  2CGP A;  2HDC A;  3TDU C;  3GO5 A;  1KQ9 A;  4KT5 C;  1UST A;  1YG2 A;  2XAH A;  2E7X A;  1RNL A;  3I59 A;  4HV6 A;  3N4M A;  2IP2 A;  1UCR A;  5DCM B;  3J7A O;  1IF1 A;  4BXU A;  3KP7 A;  4NB5 A;  5K5R A;  3M1E A;  5DD8 A;  1FYL A;  4LJZ F;  5LRS A;  1K6O A;  4WXC A;  4EJV A;  3IWF A;  5J8C A;  1IW7 F;  5BQT A;  4I09 A;  1BM9 A;  3WTY C;  5L3E A;  5KK1 A;  2QYO A;  3E6D A;  4L9T A;  5CVV A;  4IXA A;  4R79 A;  3VOE A;  2XAG A;  3GF2 A;  2V1X A;  2FA5 A;  2VBY A;  2P8T A;  4OU0 A;  4HZF A;  2JSC A;  4YFX F;  1H9G A;  1Z9C A;  1JGS A;  2P5V A;  1WI9 A;  3FXQ A;  4CHU A;  2ISY A;  3ZPL A;  4ENJ A;  1A04 A;  4IRH A;  3WGH A;  5E1Z B;  3R0A A;  5D5W B;  1SD6 A;  3D0S A;  4KIF A;  3ABT A;  3F72 A;  2HKX A;  2VE8 A;  2UXN A;  2PFB A;  4ZZD A;  1E2X A;  5HDG A;  3FZV A;  3MZH A;  1IXR C;  3CUQ C;  4HA8 A;  4GGG A;  2QWW A;  1ZYR F;  1U3E M;  1JXS A;  3PQJ A;  2V1U A;  3CUO A;  2VBZ A;  2LF7 A;  4YIF A;  3RPQ A;  3V8J A;  1W7P B;  2P4W A;  4LK0 F;  4HX4 A;  1KGS A;  3QOP A;  4FHT A;  3JSP A;  4RB0 A;  1D8J A;  1ON1 A;  5L3C A;  2OAZ A;  3O3K A;  1ZAO A;  5LGN A;  4EGY A;  2HTJ A;  4HF2 A;  1W7P D;  4M6X A;  2COM A;  4A5N A;  1CGP A;  5D5U B;  4Y17 A;  1BBY A;  2TDX A;  5D6E A;  1REP C;  1Q1H A;  2DU9 A;  1I1G A;  2IA1 A;  2K27 A;  3MQ0 A;  3BY6 A;  1VTN C;  1XGS A;  5LHI A;  3GFM A;  1KU7 A;  3JAM K;  1B9M A;  4WF2 A;  2O0Y A;  4HLX A;  2EFP A;  4L0Y B;  5K5O A;  3I64 A;  4U88 A;  3F22 A;  2L01 A;  2M8E A;  4BHB A;  1LQ1 A;  4BAY A;  1FP2 A;  2F5F A;  1XGN A;  2BBY A;  4Y13 A;  4U7B A;  2A5Y B;  3ULQ B;  5JFR A;  1TQP A;  4MEY F;  4MGR A;  4I0A A;  3V8L A;  3V7C A;  2MA3 A;  2L3D A;  2M5W A;  2YX4 A;  4NHJ A;  2Q0O A;  2DBB A;  4U0W A;  4AIK A;  2OBP A;  5FLX Z;  4KIG A;  5DCM A;  2EB7 A;  2BEO A;  4H0E A;  3TO6 A;  1ON2 A;  3FHZ A;  3GZ6 A;  2XAF A;  2DQR A;  4XSZ F;  4HLY A;  4UV8 A;  1FSE A;  1LVA A;  5AON A;  5DCF A;  1Z91 A;  5ED4 A;  1O3T A;  2BGC A;  2JT1 A;  4RS8 A;  4PGG A;  2FBK A;  3MZY A;  1U6G A;  3KZY A;  2L4M A;  4Y15 A;  3LAJ A;  1R7J A;  5FGM A;  1J7K A;  3R0J A;  1TLH B;  2F5D A;  5E1X A;  4KNY A;  3ZMT A;  1KA8 A;  5CVR A;  5ICE A;  4XSX F;  2KJC A;  4RB2 C;  1S6L A;  2ZME B;  5CVJ A;  2DK5 A;  4LB6 B;  4EQQ A;  2NS0 A;  1OYI A;  2HQR A;  1TW2 A;  1P92 A;  2H09 A;  3WTW C;  3SFZ A;  2NAZ A;  3WG9 A;  2FNA A;  3F6O A;  2VT2 A;  5HOO A;  5IT9 Z;  1WQ2 A;  5HDK A;  1U5T A;  3M9A A;  4M74 A;  3DPL C;  2VN2 A;  3HSE A;  5D5X B;  4MQ9 F;  4RGX A;  3SXY A;  2MH9 A;  1YLF A;  1XGO A;  4HQM A;  1F4K A;  3QU3 A;  3F8N A;  2QBY A;  3KLO A;  1W7P A;  2O3F A;  5J6X A;  2Z5U A;  4A2U A;  2XGX A;  4JK1 X;  3FXU A;  2A61 A;  4GYI A;  3VOD A;  4ZYH A;  3HOS A;  4L0Z B;  3E97 A;  4N9H A;  3U2R A;  2HS5 A;  1J0R A;  5HS7 A;  1IXS B;  4A6E A;  3LA7 A;  4ENM A;  4IHT A;  4GO1 A;  4M6Y A;  4OMZ A;  2MD5 A;  3EYI A;  1XSV A;  3H3U A;  5D4S A;  1F5T A;  2EA2 A;  4MTE A;  3BDD A;  2ZXJ A;  1ZRC A;  2IPQ X;  5HLH A;  1TQI A;  2Q2E A;  2XAS A;  3ZMV A;  1W5T A;  4CGZ A;  3P9C A;  4I02 A;  2Z33 A;  1Z1D A;  1SD7 A;  4M71 A;  4O6J A;  1YO5 C;  2EFO A;  5L3F A;  2GXG A;  3EQL F;  5DUI A;  2G7U A;  5CLS A;  4MEX F;  3AAF A;  1FWZ A;  3V7R A;  2KRF A;  1LDJ A;  2V9V A;  3NQO A;  4I98 B;  4EM1 A;  4EJT A;  3LWF A;  1YW9 A;  1IXC A;  3R6S A;  1RUN A;  4WCG A;  1TBX A;  3V7S A;  2PEX A;  2OQR A;  4LLN A;  3H3Z A;  3L09 A;  2FE3 A;  3T8T A;  4P9U A;  1XN7 A;  4OIO F;  4HDV A;  5BOX A;  3MWM A;  2HYG D;  2VC0 A;  3DKW A;  3WGG A;  2LDU A;  2PLY A;  2VBW A;  5A2Q Z;  4RB3 C;  2ADU A;  1FX7 A;  5ILS A;  3CDH A;  3HRU A;  2VC1 A;  4HAM A;  2XRN A;  4OIP F;  2DTR A;  1HW1 A;  1FZP B;  4PGH A;  4HW0 A;  5ILV A;  1R1T A;  3DXJ F;  1S8N A;  4HF1 A;  1C0W A;  4A0Y A;  4PZJ A;  3BRO A;  4CYD A;  3TDZ C;  3IKT A;  1BOA A;  2UXX A;  3JTH A;  4RGS A;  1ZG3 A;  3F8F A;  2BYV E;  2PN6 A;  4EGZ A;  3J80 Z;  1ZLJ A;  2NRA C;  2R7F A;  3EDP A;  3IKV A;  4LGW A;  4AVP A;  3RJP A;  1OPC A;  4YFK F;  1ZRE A;  2E1N A;  3H92 A;  4ESF A;  5JVT A;  3K1M A;  2JRT A;  4M9S A;  2P7V B;  1SFE A;  3IHU A;  1OYW A;  4S04 A;  2QQA A;  2O03 A;  4ON0 A;  1D3Y A;  1YTY A;  2PBI A;  1QZZ A;  2QLZ A;  4KMF A;  1KU3 A;  3U1D A;  4TV7 A;  2DT5 A;  4R1H A;  1G3Y A;  2OZU A;  2Y75 A;  3L7W A;  3DFG A;  1QNT A;  3QAH A;  5E8G A;  5K5Q A;  4AIH A;  2RN7 A;  4RGU A;  4ZYG A;  4P96 A;  3DEU A;  4G7O F;  1EV7 A;  2OZ6 A;  2KIM A;  1ONV A;  2QVO A;  1DP7 P;  2LF8 A;  1QZY A;  3K1P A;  3CO6 C;  3WTS C;  2H6B A;  2ZJ2 A;  3I4P A;  1XB4 A;  4EJU A;  4IHS A;  2P6T A;  3F3X A;  3ZN0 A;  4LG0 B;  1XMK A;  4EMS A;  1MGT A;  4XBF A;  2STW A;  5EEG A;  3F8M A;  4OIN F;  1ZGA A;  2RGV A;  3V8K A;  2RKH A;  3K9T A;  2KIF A;  3KE2 A;  1FOK A;  3P9K A;  4JQF A;  4QLC U;  3RIR A;  1GXQ A;  3WTT C;  4NQW A;  4CIC A;  2A69 F;  4HX8 A;  2XKP A;  2XVC A;  2VE9 A;  3K69 A;  2V1D A;  3I5U A;  4LMY A;  3M8F A;  5ILU A;  1ZGJ A;  4JBA A;  3CUQ B;  3QU6 A;  1K7A A;  2YR2 A;  3VB2 A;  3R61 A;  1F1Z A;  3EUH A;  4ESB A;  2K4J A;  2QZ8 A;  2NNY A;  3GFJ A;  1UHM A;  4GXO A;  1OKR A;  2DI3 A;  1B9N A;  2DPU A;  5FFX A;  2EFQ A;  1MDM B;  2O61 A;  3NEU A;  3QP5 A;  1SMY F;  1YYV A;  3ZMD A;  4L9J A;  2G7H A;  1U5T B;  1ZAR A;  2L4A A;  4MNU A;  2WWY A;  1TNS A;  3BJO A;  3ZP5 A;  1S7A A;  2D1V A;  4LK1 F;  4IVN A;  4P55 A;  2ESH A;  4KFC A;  1FYK A;  1XDU A;  4U0V A;  4AIJ A;  2GZW A;  2IT0 A;  4DNC A;  2EWN A;  3ERE D;  4ASN A;  3J81 K;  2UWM A;  2MLG A;  1LDK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...