3WTUC

Crystal structure of the complex comprised of ets1 (v170a), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 40
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtuC00
4MQ9F 1IN6A 1B1BA 1J5YA 1Z6TA 1K79A 2MH9A 3R0AA 1EH6A 3WTVC 2XROA 1J59A 1RI7A 3KP2A 1P2FA 4JK1X 4KICA 1U78A 3R0JA 4BNCA 3M8FA 2V1XA 4M9XA 1TNTA 3F3XA 4OMYA 1D5VA 2LKPA 3FM5A 2DTRA 2V9VA 1KU9A 1IXSB 2LF7A 4XSZF 5E17F 1MZBA 4KIGA 1IF1A 4AWXB 4L18B 1XGOA 1MDMA 1W7PA 4ZYDA 3MQ0A 5L3GA 2UXNA 4B8XA 2ADUA 2PMUA 4UVCA 1TNSA 2FXAA 2ESNA 2CG4A 2A3SA 1FZPB 2RN7A 3BDDA 1FC3A 2V79A 1XDSA 2DK5A 3WU0A 3WGIA 2FMLA 1B59A 2Q0OA 4R1HA 2FE3A 3H3UA 3TDUC 4A6DA 1STZA 5LBQA 1USTA 3VB2A 1ONVA 5E1XA 2ZXJA 1LDKB 4M71A 1YG2A 2QBYB 3IWFA 2Y0MA 4M6YA 1S7AA 2ZBKA 2EJRA 4N0BA 2CWEA 1YW8A 1TBXA 1ZRCA 3GFIA 5LGUA 5HOOA 1QGPA 4WXCA 4IXAA 4HV5A 2QENA 4N9HA 2KIFA 2P6TA 1Z1DA 3QAHA 2Y75A 3BJOA 1FPQA 2YX7A 2YX4A 4GCVA 4GYIA 3HYIA 4MEYF 2JTVA 2QLZA 3T1BA 3GWZA 2O3FA 5DCMB 4OIOF 1PP8F 3FMSA 1ZH5A 4RB2C 2PI0A 1K78B 5CVVA 2GQQA 2P8TA 1D8KA 2DO7A 2FF4A 5CLSA 1IN8A 2KRFA 2E7WA 2L54A 3LQRA 1XSXA 2ZFWA 4HX8A 3G3ZA 2QUFA 4DNCA 5ICEA 1O57A 1GXPA 1BIAA 1JHFA 3CUQC 4I2OA 3DEUA 5LRRA 2WV0A 3WODF 1RZ4A 3V8LA 2RV8A 2A61A 2A6EF 4UHTA 2AS5F 3ZMTA 4CZZA 2HQNA 3E6DA 3MAJA 4L0ZB 5HS9A 2A07F 1SD4A 3V4GA 1KQ9A 1FY7A 2HKOA 1FOKA 4LG0A 3KP5A 4R8HA 1CGPA 2P6SA 4EJOA 3FF5A 2EFWA 2TDXA 2XASA 4AD9A 4BHCA 2ETHA 2D45A 4UV8A 3GUDA 2CFXA 3HRTA 2P4WA 4HQEA 3SHFA 5LGTA 2F5FA 4MGRA 4KDPA 4HF1A 5E20A 2GAUA 2EWNA 2EK5A 2CW0F 3E6CC 4FX0A 1ZRDA 3HSRA 3MFKA 2IP2A 3CDHA 3I59B 2V1UA 5F1RA 2K02A 3IRRA 3RKYA 5LRSA 1ZGJA 4ESFA 1KU2A 3V8KA 5D8LB 3QRFF 3VEPA 1P4WA 2HOEA 1JGSA 3HUGA 1P6RA 1YTYA 3JAMZ 4YFXF 2DFIA 3DF8A 3FXUA 2VE9A 1WSUA 1DPUA 3PFIA 3RKWA 2YR2A 2EV0A 2HR3A 1G3TA 3K1PA 2ISZA 1Z6RA 4OU0A 2AXLA 4HZFA 5D6FA 2NS0A 2JT1A 1S29A 1Y0UA 4L9JA 2LSOA 1CF7B 2V6CA 2MLGA 3E5QA 1QQIA 1TLHB 3M9AA 5LEJA 2UXXA 2QM3A 2M87A 4MEXF 2ZJ2A 2LF8A 1FYKA 3BY6A 4HF2A 5H6RA 1FYMA 4L0YB 3BPVA 5CVIA 3CUQA 2CSOA 3AAFA 2BE5F 5ILVA 4AVPA 1OPCA 3DV8A 3ISPA 3FMRA 2F5DA 3P9IA 3RYPA 1U5TB 4ZH4F 5F6FA 2IW5A 1OYIA 3Q9SA 4BAYA 4LMYA 3E3VA 2M45A 1NHAA 3NQOA 2E7XA 1S7OA 2P5KA 1I5ZA 5FD5A 2L4AA 5D5VB 4YFNF 3R60A 5D4SA 2JPCA 1ULYA 1ZG5A 4ETSA 5HLIA 1HXDA 3IL2A 1RIOH 5DUIA 4ZZDA 3RIRA 1SFUA 1IAWA 4OMZA 4RGXA 2ZMEB 4L9TA 5TRDA 2LNBA 4PGHA 3D5LA 3QPHA 1J2XA 3F8CA 1F4KA 4I09A 1UFMA 2HKXA 5JI6A 1U5TC 3N97A 1B6AA 4M74A 4LLLA 2A68F 2IT0A 5HDGA 4P9FA 3RDIA 1Z9CA 1I1GA 3HSEA 2XRNA 5ERIA 3RPQA 1L0OC 4U88A 4Y15A 3JTGA 1BBYA 1SMYF 2JPBA 1RUNA 1PP7U 2PMHA 1W5SA 2GXBA 2QWWA 3JSOA 1IZ1A 1FT9A 2MD5A 1K78A 2MC3A 5E8GA 5DD8A 2VC0A 4ENMA 2M30A 3KETA 2OD5A 3IHUA 2FEZA 3TOBA 3KP7A 5IT3A 2ZNZA 3ECHA 3I0TA 2QQAA 2FRHA 5FFXA 2PBIA 5HS7A 3ZQ7A 1MDMB 3I53A 3HIFA 5JHUA 4KA4A 5LGNA 4I01A 5HDKA 5DCFA 3V7SA 2IA2A 4A6EA 3DPTA 2OZUA 2H6CA 4P55A 4FHTA 1QZYA 2Y48A 4AIHA 2NNNA 1ODDA 4LK0F 3ZMVA 1O7FA 3IC7A 4CDGA 2XVCA 1RNLA 3F8MA 4IRIA 3WTXC 5AIQA 5BS6A 1SD5A 3HRSA 2GA2A 1R22A 2QQ9A 5DYMA 3RJPA 3CTAA 3NEUA 4KIBA 3EQLF 3GW2A 2DBBA 2OBPA 2DU9A 1BI0A 2MBFA 2VXZA 2XV4S 2DPUA 1BI2A 3MZHA 3RYRA 3ERED 1DPRA 3VODA 5L3DA 3LA3A 3QOPA 1KU3A 1MJAA 3M1EA 4ESBA 3F23A 1HSJA 4B09A 3GLXA 3O3KA 2EA2A 5DCMA 1QO0D 1BC7C 4L5IA 2GWRA 1FX7A 2HEOA 5LHHA 3LQQA 4LFUA 1MKMA 2D1VA 2FA5A 2P5VA 3DKWA 5ED4A 4GO1A 2VONA 4G6DA 2MLKA 3MEXA 1MGTA 2D1HA 5H6QA 2J5PA 3TOAA 3E6BA 3T8TA 1PDNC 3COAC 4ZZLA 2W85A 1F1ZA 2HTJA 2VT2A 5AONA 1EH7A 3ZMDA 3ECOA 1W7PD 3I54A 4KMUX 2XAQA 1SD6A 1HQCA 3KZYA 1IN5A 4S05A 2VBZA 1YQAA 4G7ZF 2H27A 2NRAC 3CUQB 1BOAA 3MCZA 3M8EA 2H09A 3FHZA 4UNOA 4ZYGA 2VOPA 4DQ2A 2IPQX 3L00A 1R1UA 2ZCWA 4LLGF 4GYGA 4YFKF 3U9GA 4KN4X 2Q8KA 1XDUA 5CJ9A 1G3WA 4BYYA 2K4BA 4RAZA 5FD6A 1ON1A 3T8RA 1REPC 1GHCA 2EFOA 5LLQA 1B4AA 2DLLA 5CVJA 4D0PA 3J81K 3K9TA 1TQIA 3WE3A 1WWXA 3WTYC 4I98B 4XBFA 3VFZA 4PGGA 4Q4ZF 2J5OA 3WTTC 4Q48A 4ENNA 4OINF 5EEHA 2VN2A 2W24A 2HS5A 1T39A 1IRFA 4IF4A 1FSHA 4G9YA 1Q1HA 2RVCA 4EJUA 3M7GA 2STTA 3EYIA 4AIJA 1BC8C 1OKRA 3EDPA 1AOYA 1WRJA 5J6XA 2HFHA 4HYEA 2M5WA 1F9NA 2LDUA 4LB5A 2FOKA 3Q9VA 3J81Z 1MJ9A 2XAHA 2Q2EA 3KE2A 1WI9A 2HZTA 5K5QA 2IA0A 3E6MA 3Q5FA 4RGUA 4LLNA 2NYXA 4P5OA 1A04A 1SFEA 3LAPA 2KJCA 4G6QA 4LB6B 3HTSB 4KUMA 4FX4A 4EVIA 1XMKA 1J0RA 1FSEA 3GF2A 3QU3A 2XAGA 3ZMUA 2A69F 4KMFA 3FM3A 4WK8F 6PAXA 5BPDA 3TKYA 3GZ6A 4CXFA 2XIGA 3V7CA 1DUXC 4A12A 3KEOA 2BV6A 4HLXA 2XKOA 1H9TA 3L7WA 1O7LA 5D6EA 2PLYA 3I71A 5EEGA 1G6NA 3D0SA 3H92A 1U5TA 2OA4A 3SXYA 1BI1A 3J7AO 1XSVA 2EV5A 4OIRF 3C7JA 4Q5SF 4QLCU 4WWCA 4HBLA 3F8BA 1JXSA 2G7UA 3QU6A 1ZRFA 3GFMA 4G7HF 4MTEA 2QBYA 4HW0A 3QP5A 1QNTA 4GGGA 1HW1A 1H9GA 1ON2A 4P9UA 1KQ0A 5DUKA 1LB2A 2EA4A 3LWFA 4IPAA 2KIMA 3MZYA 1P4AA 1XGMA 5E18F 3LAJA 4WXHA 4L5JA 3DQVC 1DP7P 2NNYA 4M9ZA 3F72A 3E5UA 4UUVA 2EB7A 4A2UA 2XUBA 4MTDA 4LJZF 3R6SA 1ZREA 4MNUA 4OIPF 1DDNA 4M72A 1ZLJA 3KP3A 1LVAA 1TQPA 2YSRA 4RB1A 1H0MA 1YFHA 5D5UB 3TO9A 2GZWA 3W6KB 3KCCA 5KVRA 2Z5UA 3C3WA 3HOSA 3BPXA 4KNYA 3KZZA 3J80K 1YS7A 1K6OA 2V1DA 4RGRA 2RNJA 1UHMA 3L09A 2M1BA 3DFGA 2PEXA 3F6VA 4AIKA 2FBKA 4JQFA 3HRMA 4MHGA 3TO7A 1HKSA 3I5UA 2W84A 3OV8A 4G7OF 4LG0B 3GFJA 3WTUC 1XMAA 1TW3A 3HSFA 3FXRA 5DV5A 2BYVE 2OAZA 1GXQA 1YIOA 1TQMA 4EM2A 5D5XB 1I6XA 2FBIA 3C1DA 3VOEA 1FBUA 1IN7A 3ELKA 4M73A 3T0YA 2FMYA 4QWQA 2HGCA 2HTSA 2QYOA 4RAYA 5TJJA 4EJWA 4Z2YA 2VBXA 1YYVA 1E17A 4IHTA 1W5TA 2XKPA 4G8XA 4IRHA 3HRUA 3OOPA 4ENJA 2O6GE 3JAMK 3PQJA 4WXDA 3DP7A 3K1MA 1I27A 5DEQA 1LEAA 1ZG3A 5JR3A 3ZPLA 4HDVA 5D4RA 4EJVA 2FBHA 4KYWA 2VC1A 4BH9A 1JE8A 5LHIA 3FMQA 1BJAA 3F8NA 2QQBA 3KEQA 4CO8A 2BGCA 4PCQA 4UXNA 1B9MA 2XHKA 3IRQA 4ZYEA 2RDPA 5F64A 2ZNYA 4HOBA 2HYGD 1O3SA 1U2WA 1USSA 1FBQA 3QP6A 4U7BA 4IHSA 1V3FA 2OQRA 3RPUA 3JW4A 2L02A 2G9WA 1KYZA 2JSCA 4K2EA 1LQ1A 1ZN2A 4UVBA 2M8EA 5A2QK 1B9NA 4HF0A 3QPTA 1HW5A 1YS6A 1SD7A 3WG9A 4ESJA 4KT5C 4F7ZA 3KLOA 1HKQA 1SFXA 3DPLC 3H3ZA 5IT9K 4NB5A 4M6XA 4A0YA 5JVTA 4HA8A 3DXJF 3SQNA 4WCGA 1XD7A 3FWEA 4IVNA 1BIBA 2FNPA 5ICGA 4BHPA 1KYWA 5JFRA 2DQRA 5L3BA 1EH8A 5AIPA 1C0WA 1OR7A 3S2WA 3W6JB 5K1YA 1IUYA 1R23A 4S04A 3P7NA 5DD4A 1T6SA 3L9FA 3ROUA 1J7KA 4YG2F 2UWMA 2YPRA 4CHUA 3F8FA 1IXCA 3HHHA 2C6YA 4ENKA 3BROA 1ZGAA 2CQKA 3GYHX 1YW9A 4O6JA 2R3SA 1V4RA 1UHWA 1HKTA 2XAFA 2W25A 4Q47A 5ILSA 4EM1A 3HOTA 2HDCA 1UCRA 2JRTA 3U1DA 1OYWA 2H94A 4LGWA 5HVQC 4EQQA 1ZG1A 2JZYA 2P7VB 2CGPA 1FBSA 5FO5A 3E5XA 2HQRA 2ESHA 5ILUA 4A0XA 3TGNA 2WTEA 5A2QZ 1R1VA 1J9IA 1YLFA 2L4MA 2O03A 2VOOA 1XN7A 1VTNC 2HYFA 4XRFA 1HBXG 1S6LA 1YO5C 3I64A 2ZO4A 4HLYA 1KGSA 3GZ5A 3HTUA 3V7RA 3FZVA 2R7FA 3L2CA 5LHGA 3RKXA 2KKOA 2OU2A 2O8XA 3KLNA 1E2XA 1ZAOA 4Y17A 2STWA 4U0WA 3CO6C 5L3EA 1LEBA 1F5TA 5CYVA 3N4MA 2GXGA 3IKTA 4OOIA 2DPDA 4XSXF 3NRVA 2BEOA 3SZTA 3CLOA 4HV6A 5HLHA 2XAJA 1U3EM 4EGZA 5BOXA 4PDKA 4RB0A 3SFZA 3T5XA 2OQGA 3P9KA 4A5MA 1R7JA 3ABUA 4I0BA 5K5OA 2F2EA 3EUHA 2EFQA 3JSPA 4EV0A 2MA3A 5IT9Z 5ICCA 1EV7A 1IN4A 3WGGA 4KN7X 5HS8A 1L3LA 1IW7F 2PJPA 1Z91A 1LNWA 3BJ6A 1ZYRF 5CVRA 3CJNA 3WE2A 2NAZA 3ZN1A 2GIVA 1FP2A 4IRGA 1FWZA 2Z99A 1RUOA 3ZN0A 1J75A 1O3RA 4G94A 2CO5A 3REOA 1FYLA 2X0LA 3TDZC 3LA2A 1S3JA 5E1ZB 3J80Z 4EJTA 2G7HA 1P92A 2DK8A 3WTWC 1FP1D 1WQ2A 2KIUA 4CYDA 1QPMA 4UVAA 3FX3A 4YIFA 4NQWA 4FT8A 4U0VA 5L3FA 3WTSC 4KFCA 3WU1B 1UB9A 2VBWA 4RGSA 2DW4A 1K7AA 1IRGA 1BI3A 5K5RA 5HDNA 2K86A 1QZZA 2FNAA 3LA7A 2F5CA 2ZMEA 2RGVA 3BOQA 1XCBA 2IJLA 1FNNA 4UV9A 1ZARA 2MH2A 2DQLA 3ZMSA 5BQTA 1HSTA 3C18A 3R61A 2F5EA 1XGNA 3R4KA 3WTZA 3O6BB 4U7DA 1KA8A 3HHGA 3CO7C 1G4DA 4GXOA 1KQ8A 1O3QA 2FQ3A 1SAXA 2IRFG 1HW2A 1WKMA 1R5GA 3K0LA 2Z33A 4LD5A 5FFZA 2YU3A 2QVOA 4Y13A 1U6GA 4ZYHA 1W4MA 4O3MA 1T38A 3FXQA 4RB3C 4IJAA 1W7PB 1KU7A 3BZ6A 4BQAA 3GXOA 1GVJA 5BMZA 1YW7A 3WGHA 2KJBA 3B73A 4EMSA 4BXUA 3ZP5A 3KFWX 2IVMA 2D2WA 2PFBA 2PQ8A 5HLGA 3ULQB 4XLNF 3ZMZA 4H0EA 1X3UA 3KP4A 2GA1A 3IWZA 5E8IA 1LJ9A 2RQPA 4WF2A 4HX7A 1R00A 5KK1A 4E70A 1QBJA 2K27A 4HAMA 4OIQF 3TO6A 4U0YA 5E1WA 2B0LA 1D8JA 4LK1F 3G73A 1AWCA 3IKVA 2WWYA 1R5HA 3K2ZA 3SZPA 3TQNA 2QZ8A 3GVAA 1R36A 4O5VA 2RKHA 1G3SA 3EETA 5D5WB 3I4PA 2COMA 5DDGA 1OYYA 3BP8A 5L3CA 1TTYA 2W57A 1OMIA 5H20A 1XB4A 4EGYA 1FLIA 2O61A 2DAOA 2EFNA 4HDUA 3ABTA 2FSWA 1SMTA 3RI4A 1D3YA 3LSTA 2X4HA 1R1TA 4WX9A 4XLPF 2K7LA 1TW2A 5ICFA 1T98A 2FU4A 3LFKA 2XGXA 1PUEE 4A0ZA 2PG4A 1CF7A 1R58A 1LDJA 4MQVA 4NHJA 3F6OA 1G3YA 3F22A 1ZLKA 2ACJA 3P9CA 4P96A 3MWMA 4PZJA 1XCVA 4HX4A 1XGSA 2CYYA 2HWVA 1BM9A 1XSDA 1Z05A 2DT5A 4HQMA 4I0AA 3BJAA 3CUOA 1JHHA 1ZHFA 3ML6A 2ZKZA 3K69A 4RS8A 4N9IA 1P4XA 5LEKA 3GFLA 1U8RA 2VBYA 1IXRC 2BBYA 3B02A 2R7DA 3F21A 2A5YB 3GEZA 1I1SA 1T2KA 5BPIA 2P7CB 4I7HA 3PQKA 3O2PE 4I02A 5CVUA 3RTRA 4L9VA 3GO5A 1MD0A 5J8FA 2L01A 3E97A 5FLXK 2OZ6A 5FLXZ 1Z7UA 4BHBA 2VE8A 3EYYA 3V8JA 2K4JA 2ISYA 4L9NA 5D8KB 4YIIA 3I59A 2PN6A 3K1NA 4ON0A 2P5LC 2E1CA 2DI3A 4EM0B 1LDDA 2EFPA 2VT3A 2WC2A 4A5NA 2E1NA 3U2RA 2EV6A 2IA1A 2A6HF 4JBAA 2RC4A 4KIFA 2Z3YA 3GX4X 4R79A 2L3DA 3KP6A 1O3TA 2UZKA 3BWGA 2ELHA 4CICA 1S8NA 2VODA 1BN5A 2H6BA 2Z9OA 5J8CA 1T0FA 5FB2A 4TV7A 3JTHA 1MJBA 4CGZA 3I58A 2O0YA 4ASNA 4M9SA 5FGMA
chains in the Genus database with same CATH superfamily
4MQ9F 3OYBA 1XX5A 3GTPJ 2AO9A 1IN6A 1B1BA 2I5UA 2ID3A 1J5YA 1Z6TA 1K79A 2MH9A 5HNFA 4XR6A 3R0AA 2XF7A 2CUEA 1EH6A 3WTVC 1WGXA 2XROA 1ETOA 4CZCA 2K9SA 1SAUA 2DT7B 1RI7A 3KP2A 1J59A 1P2FA 4JK1X 2HPIA 4KICA 4I76A 1U78A 3R0JA 4BDZA 4A3KJ 4BNCA 3OIOA 1T56A 5FROA 3M8FA 4QTRA 3CC2I 2R92J 2V1XA 1CQTA 4M9XA 2GBYA 1TNTA 4RLQA 1WJ5A 3F3XA 4OMYA 3PO3J 1D5VA 2LKPA 3FM5A 2DTRA 2JK3A 2V9VA 1KU9A 2EQRA 2FD5A 2V9PA 1IXSB 4ZC3A 2LF7A 2ICWG 4XSZF 3SZGA 2LMDA 1PYVA 5E17F 1MZBA 4KIGA 3JR9A 1Y8QB 1IF1A 4AWXB 1I3QJ 1XGOA 4L18B 1MDMA 1AU7A 1W5CC 2Y30A 1W7PA 4ZYDA 1Z77A 3MQ0A 2ECCA 3FXOA 2DFEA 2F5VA 5L3GA 2DMQA 2UXNA 4B8XA 2BVMA 2ADUA 5M3FJ 4YIRX 3I4MJ 1VQ6I 2PMUA 5GPCA 5FRNA 1D5YA 3W2VA 2WY8Q 3CJTB 3IAS2 3DEEA 4UVCA 1TNSA 2FXAA 4E7ZA 5FKMA 2ESNA 2K9QA 5CKTA 2CG4A 2A3SA 2ZB9A 4FQGA 2LD5A 3PUFA 1FZPB 2RN7A 4J00A 3BDDA 2GLOA 1FMWA 1TT5B 1WH7A 1FC3A 1HDPA 2V79A 4RM3A 1XDSA 2VKEA 2DK5A 3WU0A 3WGIA 2KMUA 2LH9A 4DZJA 2FMLA 1B59A 2R93J 2Q0OA 4IL6C 4A3GJ 4R1HA 2FE3A 3H3UA 1TWGJ 3TDUC 3SDBA 4A6DA 1STZA 3BTLA 1HLVA 1K61A 5LBQA 2Z16A 1USTA 2I10A 3VB2A 3CDLA 1ONVA 5E1XA 2ZXJA 4HNVA 1LDKB 2JSPA 1TL8A 4M71A 1YG2A 2RQQA 2XB0X 5EDNA 2QBYB 3IWFA 1DGWY 1E0EA 2Y0MA 4M6YA 2K9NA 2KQRA 2QSFX 1B72B 1W1WE 3PM1A 1S7AA 3H9JA 2ZBKA 2EJRA 4N0BA 4XOTA 2CWEA 1ITYA 3C2HA 3BTJA 1E3HA 1YW8A 1TBXA 1ZRCA 4V19K 3GFIA 2F4MB 5LGUA 5HOOA 1QGPA 2LKXA 1V54H 4WXCA 4IXAA 3M3YJ 1LKXA 3OS2A 4HV5A 1FTTA 2QENA 4N9HA 2KIFA 3QPLA 4CSWA 2P6TA 4B44A 1Z1DA 2NXNB 3GTKJ 2JMWA 3QAHA 2Y75A 3EUKL 2E2HJ 3BJOA 1FPQA 3W2AA 2YX7A 3JRIA 3A2KA 2YX4A 4GCVA 5TGTA 4GYIA 3HYIA 2JJ7A 4MEYF 3IUOA 3G1LA 4PSXA 2EIJH 2JTVA 4CYCA 2QLZA 2HU9A 3H3VK 3T1BA 2LY9A 3GWZA 3HL2A 3L2RA 2O3FA 5DCMB 2QEXI 4OIOF 1IRZA 1PP8F 1UMQA 3H5NA 1A5JA 3K4CA 1WJDA 3FMSA 1ZH5A 2BW3B 4RB2C 2PI0A 1K78B 5CVVA 2M34A 1TWHJ 2GQQA 3PSIA 2P8TA 1D8KA 2DO7A 3MZ8A 2CW7A 2FF4A 5CLSA 3CD6I 2RNGA 1IN8A 2CH0A 3IAM2 2X1CA 2KRFA 2E7WA 1BL0A 2KT0A 2L54A 1XSXA 1IUFA 3LQRA 2KHMA 2ZFWA 4HX8A 1GVDA 2LTPA 3G3ZA 2QUFA 3J7YJ 4DNCA 5ICEA 1O57A 1GXPA 4PJJA 4ITVA 3Q0VA 1BIAA 2Y31A 2JA5J 1JHFA 3CUQC 9ANTA 4I2OA 1NG6A 3DEUA 5LRRA 1K83J 4NDLA 2WV0A 2E19A 3WODF 2HYJA 1RZ4A 3V8LA 2RV8A 5IOYA 2E1MC 2A61A 2A6EF 3BCBA 4UHTA 2AS5F 3ZMTA 4CZZA 5EF6A 3UNGC 3S3OA 2HQNA 3E6DA 4MIMA 3VYTB 4A69C 1D0YA 2DYSH 1MSFC 3GZNB 4DJAA 3MAJA 4L0ZB 3PNYA 5HS9A 2A07F 3H0DA 2WBMA 3CC4I 5J1YA 1SD4A 3V4GA 3S2DJ 1KQ9A 1FY7A 3BQZA 2HKOA 1FOKA 2JUGA 4LG0A 1R9TJ 2NVUB 3KP5A 4R8HA 3LOCA 1CGPA 3CMEI 4C2TA 2X6OA 3CC7I 2P6SA 4EJOA 3DKXA 1X1CA 3FF5A 3K4NA 2B7EA 2EFWA 3BG6A 2TDXA 5GTHC 5K7FA 4M3BA 2M4KA 2XASA 4AD9A 4BHCA 2ETHA 4Y7NJ 3BG9A 5KNLA 2NS7A 2D45A 4UV8A 5K7ZA 3GUDA 4CCLA 3K70C 4UY8I 4CCKA 3JRFA 2IXSA 1DU0A 2CFXA 3HRTA 2P4WA 2R5YA 4HQEA 4B43A 5B1BH 2NVYJ 1WPKA 3SHFA 1W0UA 2X6WA 4FE7A 5LGTA 2F5FA 3F0CA 4MGRA 4A3MJ 4HF1A 4KDPA 5E20A 2GAUA 2EWNA 3S93A 5J1RA 2EK5A 2CW0F 4HRIA 2DXIA 3E6CC 2LC2A 4FX0A 1ZRDA 3HSRA 3MFKA 3S3NA 2IP2A 3CDHA 3FXJA 3I59B 3Q3SA 2CQNA 2V1UA 3J7ZI 2DMTA 1MBJA 2WAEA 1WCMJ 3QOEA 5F1RA 1SC7A 1JUSA 2K02A 3IRRA 4LIUA 3C2GA 2O5RA 1YOVB 2VPRA 1LE8B 1WH5A 3RKYA 5LRSA 1ZGJA 4ESFA 1KU2A 5DM7F 3CCJI 2R4GA 3V8KA 3S1MJ 1E3PA 2X48A 5D8LB 2L7FP 4E7LA 3QRFF 4MLOA 3VEPA 1P4WA 2HOEA 1JGSA 5KAFC 2LK2A 3OR2C 3HUGA 4BS9A 1P6RA 1X1PA 4ANJA 3H35A 2CW8A 1YTYA 2KPMA 1R5ID 3JAMZ 4NNJA 4YFXF 2DFIA 3DF8A 1PUFA 1TZLA 3FXUA 4DYRA 2Y9ZA 4PSWA 2VE9A 1WSUA 1DPUA 3PFIA 2VKDA 3RKWA 2A05A 3AG4H 2YR2A 2EV0A 2HR3A 4XQFA 5EGOA 1LFBA 1G3TA 1K6YA 3JREA 3K1PA 1Z6RA 4IO9F 3FDYA 2AXLA 4OU0A 2ISZA 4HZFA 5D6FA 2NS0A 2Y9YA 1V55H 2JT1A 2MG4A 2NOGA 1S29A 1UHSA 3BR5A 3VYSB 1Y0UA 1BR1A 4L9JA 3G2BA 2W7NA 4II3A 2LSOA 4XIDA 4BBSJ 3CF2A 1CF7B 2V6CA 4DZPA 2IS2A 2MLGA 3E5QA 2VUMJ 1QQIA 4D5CA 1TLHB 2VPLA 3M9AA 5LEJA 2CS3A 2UXXA 2QM3A 5F0FA 4NUBA 5EZGA 2M87A 4KITB 5CQGA 4MEXF 2ZJ2A 2LF8A 1GT0C 3OS0A 1FYKA 1SANA 2X1DA 1VFCA 3BY6A 4HF2A 2QF7A 2VQCA 3G71I 2FUG2 5H6RA 1Z3YA 4DBRA 2B63J 1FYMA 3B6AA 4L0YB 1FOWA 2YU9J 3BPVA 5CVIA 3VSLA 3CCLI 3CUQA 3HJEA 2LBFA 1BR4A 1O4XA 3ESWB 1ZQ3P 2CSOA 3BTCA 3TP0A 3QQAA 3AAFA 5F08A 2BE5F 5ILVA 4AVPA 3K10A 1OPCA 1ZR2A 3DV8A 3ISPA 3FMRA 3S16J 3CJQB 2F5DA 4BE1A 1HCRA 3CCVI 4HG2A 5IYCJ 4PFPA 3OYIA 3P9IA 2CJJA 1ETXA 3RYPA 1V5FA 1U5TB 3X2QH 1T8IA 4ZH4F 5F6FA 2CRGA 1JUPA 1MH4A 2IW5A 1RRJA 3HOWJ 1OYIA 3Q9SA 4IOCF 1Y39A 4PK4A 4BAYA 3BR1A 4LMYA 3E3VA 1QU3A 2M45A 1NHAA 3NQOA 2E7XA 1S7OA 3F9KA 4RA2A 1D1AA 2P5KA 1I5ZA 5EZHA 5DTDA 4KJZA 4H4KC 5FD5A 2DA2A 2L4AA 2VIXA 5D5VB 4NC8A 2FX0A 2X51A 4YFNF 4A3IJ 1VQ8I 3NWTA 1QA6A 3R60A 2DA6A 2DT6A 5D4SA 5M5WJ 2XGDA 5F04A 2JPCA 1IGNA 1ULYA 1ZG5A 1JKRC 2VQLA 2ZJPF 4BDYA 4ETSA 4F3QA 5HLIA 1HXDA 5GAHJ 3BG5A 4BY1J 3IL2A 1X58A 1RIOH 5DUIA 3FBIB 2M7AA 1TWAJ 4ZZDA 3RIRA 1SFUA 1NK2P 1X1DA 1IAWA 3CF5F 1B72A 3TW7A 4OMZA 4RGXA 2ZMEB 1HDDC 4L9TA 1VQ4I 4BUPA 5C3EJ 3PIPF 1QVUA 5TRDA 4C2UA 4C3HJ 3HOYJ 2LNBA 4PGHA 3D5LA 4XLAA 2F48A 3QPHA 2L2OA 5B1AH 2I8DA 1J2XA 3F8CA 1F4KA 2R7VA 4I09A 1UFMA 2Y0SA 2HKXA 5JI6A 2CQQA 1U5TC 2L9NA 3N97A 1B6AA 5J4YA 2KZGA 4M74A 4LLLA 2A68F 1JJ6C 1SVLA 2IT0A 5HDGA 1V5GA 2RREA 4P9FA 3RDIA 1D1BA 1Z9CA 2BXYA 1I1GA 3HSEA 2XRNA 4HSTA 3NWSA 1L0OC 3ABLH 4U88A 4Y15A 5ERIA 3RPQA 3KYLA 2M7BA 3JTGA 1BBYA 2Q2EB 4XOPA 4RDUA 1SMYF 2JPBA 2PMZA 1RUNA 4HSRA 1PP7U 2VASA 3JRDA 1XS9A 4F52A 2PMHA 1W5SA 2GXBA 4IZZA 2QWWA 3VYRB 3JSOA 1IZ1A 1AKHB 1FT9A 3VWBA 2MD5A 1K78A 3A1YA 2BXZA 5EG0A 3DCFA 4M3DA 3DTIA 2MC3A 5E8GA 4PFOA 2Y2ZA 2LYCA 4YEJA 5DD8A 2VC0A 3RCOA 4ENMA 2M30A 3KETA 2OD5A 3IHUA 4RAFA 1B8IA 5H2FC 5EGOB 5IY5H 3QYEA 3IH3A 3HM5A 2E1OA 2X6YA 2FEZA 4M6VA 3LSGA 3HC7A 3TOBA 1OCOH 3L2WA 2QCOA 3KP7A 2LLKA 4XNFA 4JP0A 3CLQA 4M3FA 3QYFA 5IT3A 3IP4B 2ZNZA 3ECHA 3I0TA 1XPXA 2QQAA 2LOOA 1X3ZB 2FRHA 4D9JA 2K3FA 2ZFUA 5FFXA 2PBIA 5HS7A 3ZQ7A 1MDMB 1LFPA 3I53A 4BJ5C 3HIFA 5JHUA 1HA8A 4KA4A 3BR6A 4J19A 2OJED 2KLOA 3M8JA 3M1CA 2EZKA 5LGNA 3HPGA 4PJNA 2DA7A 4I01A 2L9VA 4QSHA 5DCFA 4DW6A 5HDKA 3V7SA 2IA2A 1RR7A 4E7SA 1SVOA 4DOZA 5E3MA 4A6EA 1P7IA 3DPTA 2OZUA 3LSJA 2H6CA 1PJRA 4P55A 4FHTA 4A3FJ 1QZYA 4HPQA 2Y48A 2NVQJ 4FASD 3JRGA 2Q1ZB 4AIHA 2NNNA 2IEKA 1ODDA 1EKEA 4LK0F 3ZMVA 1T33A 1O7FA 3IC7A 1N77A 2E60A 4CDGA 2ECBA 3HOXJ 3RKQA 2XVCA 4J01A 1RNLA 3F8MA 4IRIA 3FKIJ 3WTXC 5AIQA 1HOMA 2R5ZA 5BS6A 1FEXA 2M2EA 2VKHA 3MD2A 2H1KA 5F27A 1SD5A 2CFOA 3GTLJ 3HRSA 2KDZA 3CMYA 2GA2A 5C4JJ 4KT6A 1R22A 2QQ9A 5DYMA 3RJPA 3CTAA 4B3AA 3NEUA 5DM6F 4KIBA 3EQLF 1FIAA 3GW2A 4MO7A 2DTZA 2DBBA 4N4OB 4IHWA 1S72I 2OBPA 2DU9A 3DTEA 4AU7A 1BI0A 3OYFA 2MBFA 2ZJRF 3BT9A 1LE8A 1D0XA 2VXZA 2XV4S 2DPUA 1BI2A 3MZHA 3RYRA 3ERED 1MIJA 3K4JA 2HXOA 3OSFA 1LPQA 1ENHA 1DPRA 2ZXIA 3VODA 3HUGB 5L3DA 3LA3A 4IHVA 1QPIA 1T95A 3QOPA 1KU3A 1MJAA 3M1EA 4ESBA 3FXMA 1MSEC 1PVEA 4B48A 4BQQA 3F23A 2X1EA 1HSJA 3QODA 4B09A 4XLCA 3GLXA 3O3KA 2E1MB 2EA2A 5DCMA 2TCTA 1QO0D 1BC7C 4BE2A 1IDZA 4L5IA 3FK7A 2GWRA 1FX7A 2VQHA 5LHHA 2HEOA 2XSDC 3LQQA 2YS9A 4LFUA 4BKXA 3AG2H 4JOMA 3OYGA 1MKMA 2D1VA 3DKWA 2FA5A 2P5VA 5ED4A 3HOUJ 3ZOBA 3H5RA 4G6TB 4GO1A 4M3GA 2VONA 4G6DA 2MLKA 3MEXA 1MGTA 1T0FC 3OYJA 2BY3A 2D1HA 5H6QA 2J5PA 3TOAA 3E6BA 4FISA 3T8TA 3I56I 1PDNC 2ID6A 2KFDA 2HDWA 3COAC 4BGDA 2W85A 4D7NA 1F1ZA 4ZZLA 2XDVA 2HTJA 2PJRB 2VT2A 4OAZA 1QHHD 4BJTA 5AONA 2E5ZA 1YI2I 1EH7A 3ZMDA 4UUSB 2E5NA 3ECOA 1W7PD 2W00A 1VQPI 3I54A 4KMUX 2XAQA 1SD6A 1HQCA 3KZYA 1TWFJ 1IN5A 1N75A 4S05A 2W4SA 1X2NA 3WU2C 2LP0A 2VBZA 5FLMJ 2LR8A 1YQAA 3BZCA 3K4LA 4G7ZF 1B8IB 2H27A 5CPRB 1IDYA 2NRAC 2E36A 1JGGA 3CUQB 1BOAA 2LBFB 3MCZA 2V9KA 1MMSA 3M8EA 2EZLA 2H09A 3FHZA 3QPSA 1M1EB 4UNOA 4ZYGA 2VOPA 4DQ2A 3TL4X 4GRIA 3H1CA 2IPQX 3L00A 1R1UA 2ZCWA 4LLGF 2LY1A 3VDXA 2CQ7A 3IV5A 4GYGA 4YFKF 2ZSHB 1WJAA 3U9GA 2X6XA 1YX5A 1BJZA 1JKPC 4KN4X 2Q8KA 1YRNA 4LG3A 1UAAA 1XDUA 2NOJB 2HQ5A 4XL9A 5CJ9A 1G3WA 3MKLA 4BYYA 3ASOH 2K4BA 3FBNB 4RAZA 5FD6A 1JKOC 1ON1A 2MABA 3T8RA 1REPC 1I3AA 4AM3A 1GHCA 1SFOJ 1NTCA 2CUFA 2JQ7A 2EFOA 3OL3A 1B4AA 2DLLA 5LLQA 5CVJA 4CCMA 4D0PA 3IH2A 4XN3A 2ZC2A 2VJIA 2LRDA 3J81K 3K9TA 1MNEA 1IO2A 1TQIA 5JLXA 1S9HA 4ZYAA 2DJNA 2IAIA 4XKBA 3WE3A 1WWXA 3WTYC 4I98B 4XBFA 3CP8A 3TEDA 3CCUI 2WAFA 3VFZA 3DLLF 4PGGA 4XONA 4Q4ZF 2J5OA 3WTTC 4Q48A 4ENNA 4OINF 5EEHA 3D1NI 2VN2A 2W24A 1P9QC 2IS1A 2HS5A 1T39A 1MMAA 2MYSA 5J4VA 5E3NA 1IRFA 4Y52J 4IF4A 5HODA 1FSHA 4G9YA 2HZDA 1Q1HA 1FTZA 2HDDA 2RVCA 4EJUA 1FOXA 3M7GA 2STTA 4PUSA 3EYIA 1JUMA 4AIJA 1RC9A 4E4HA 1VF9A 1X2MA 4BXXJ 4EEFG 3FISA 1BC8C 1OKRA 4LIVA 3EDPA 2QKMB 2CQXA 1AOYA 1WRJA 5J6XA 4B1RA 5IYDJ 2K3PA 1EF4A 2HFHA 4HYEA 2M5WA 1F9NA 2LDUA 4LB5A 2FOKA 3Q9VA 3J81Z 1MJ9A 2KISA 5F0CA 2XAHA 2Q2EA 3KE2A 1WI9A 3HKZA 2HZTA 5K5QA 2IA0A 2X85A 4IKFA 3PO2J 3TBIA 3E6MA 3Q5FA 2XC7A 4XORA 5IP6A 4RGUA 4LLNA 2NYXA 2XGEA 2XGCA 4P5OA 1QHGA 1LUJB 1A04A 1SFEA 3LAPA 5EG0B 2JA2A 4LITA 4Y3OA 2KJCA 4G6QA 4LB6B 4AYBA 4HNUA 2MGQA 3HTSB 4KUMA 4FX4A 1DU6A 4EVIA 4XM3A 1XMKA 2HOSA 1TC3C 3LL7A 3A0BC 3WHBA 1J0RA 1FSEA 3GF2A 3CMAI 3QU3A 2XAGA 3ZMUA 5KAIC 2M0MA 2A69F 4KMFA 1VQKI 3FM3A 4WK8F 4E7JA 6PAXA 5BPDA 3TKYA 3GZ6A 3BZKA 4CXFA 3GTGJ 2XIGA 3V7CA 2R7RA 3OSGA 2HXIA 4OAYA 1ETWA 1DUXC 3JRCA 2EH3A 1WJFA 4A12A 3KEOA 2BV6A 4HLXA 2PJRA 2TRTA 4C9YA 3S1NJ 2XKOA 2JWTA 4NC6A 3OL4A 5IP9J 2WAQN 2Z2SB 1H9TA 2BZTA 2HVQA 2MD0A 3L7WA 1O7LA 5D6EA 1YITI 2PLYA 1N78A 1U0JA 3I71A 5EEGA 1G6NA 3D0SA 3H92A 2ME6A 3OYEA 1U5TA 2OA4A 4AIDA 3SXYA 2AQEA 1BI1A 3OS1A 3J7AO 1XSVA 2EV5A 1DP3A 3OOUA 4OIRF 3C7JA 2BY0A 1I6HJ 3VSKA 4Q5SF 4QLCU 2AQFA 3OR1C 4MFEA 4WWCA 4IOAF 4HBLA 3F8BA 4IHXA 3S32A 1TT0A 4IX7A 2D5VA 2G7UA 1JXSA 3QU6A 1ZRFA 3KZIC 2HNHA 3GFMA 3LSIA 4G7HF 4MTEA 2QBYA 4HW0A 4JX6A 3QP5A 1QNTA 4GGGA 1VQ5I 1HW1A 1H9GA 1ON2A 4FE4A 4P9UA 1KQ0A 5DUKA 1LB2A 1YX3A 4BU2A 2EA4A 1X1BA 3LWFA 4IPAA 3GTOJ 3PSFA 2KIMA 3MZYA 1P4AA 3UKGA 2DYRH 1XGMA 5E18F 2JVHA 3LAJA 4C2MJ 1OFCX 4WXHA 2ELKA 3TP3A 2R7WA 4L5JA 4G12A 1P7JA 3DQVC 1DP7P 2FJ1A 3U21A 2NNYA 1ZELA 2JUCA 4M9ZA 2M4GA 1IV8A 3F72A 3E5UA 4UUVA 2EB7A 3BTIA 3DPUA 1VQNI 4A2UA 1R71A 2XUBA 2HI3A 3G1OA 1WJCA 4LJZF 3NAUA 4MTDA 2EZIA 3R6SA 3ZCOA 1GV2A 1ZREA 2BW3A 4MNUA 4OIPF 1DDNA 4M72A 1ZLJA 4QPOA 3CCSI 3KP3A 3CJRB 1LVAA 5FRMA 3VYUB 1TQPA 2YSRA 2WV1A 1R49A 1OR7C 1FIPA 3Q0WA 4BQNA 4V2GA 4RB1A 1H0MA 1ZR4A 2EBIA 1YFHA 3OIQA 1Q1VA 3RPUD 4CH7A 5D5UB 3TO9A 2GZWA 3W6KB 3KCCA 4UB6C 5KVRA 2ZSIB 2Z5UA 2GXAA 2JA8J 2L7KA 2WADA 4E6KG 4C3JJ 3C3WA 1EA3A 3HOSA 1FOYA 3EUAA 1W36C 2V6EA 1MBGA 2EPFA 3SYTA 3BPXA 4KNYA 3KZZA 3J80K 2AHQA 3TMOA 3CCEI 1YS7A 1UJ8A 1TP4A 2V1DA 1MBHA 4RGRA 1K6OA 2RNJA 5GAGJ 1UHMA 3L09A 4PJLA 2CUZA 1BA5A 2M1BA 3DFGA 2PEXA 3F6VA 3U1KA 5F1JA 1R6RA 1YHQI 2K85A 4UUSA 1NK3P 4AIKA 2FBKA 4JQFA 3HRMA 4MHGA 4F91B 3TO7A 1HKSA 3I5UA 3C2BA 3S3MA 2W84A 5HLTA 3DBRB 3OV8A 4G7OF 4LG0B 3K70D 3GFJA 3WTUC 3OYCA 1XMAA 1TW3A 3HSFA 3FXRA 5DV5A 4RLFA 2BYVE 2OAZA 3OYHA 5E3LA 1GXQA 1YIOA 1TQMA 1GV5A 4EM2A 1BOBA 1JTYA 4FTHA 1A36A 3E7LA 5D5XB 3SJMA 3P5JA 1I6XA 2FBIA 3CZ6A 3C1DA 1WFXA 2LVSA 1NH3A 4M3EA 3VOEA 1A31A 3A03A 1FBUA 3RZOJ 1IN7A 4XK4A 3ELKA 2G0EA 3CDIA 4M73A 3H0GJ 3T0YA 4D5FA 2FMYA 3SEQA 4QWQA 1S7EA 1YJWI 4IEJA 2HGCA 2HTSA 3ABKH 2QYOA 1YRNB 4RAYA 5TJJA 1D1CA 4EJWA 2VL8A 2ZXHA 4Z2YA 2CV1A 2DA3A 5BNGA 3MMYB 3OYDA 2QGUA 3JCUC 1Y8RB 2VBXA 1YYVA 3LMMA 1E17A 4IHTA 1OCPA 1W5TA 3HZJA 2XKPA 4AYBN 4G8XA 4IRHA 3HRUA 4L5EA 4X1EA 3OOPA 5B5EC 3KPHA 4ENJA 2HVSA 2O6GE 3JAMK 3OYAA 3PQJA 4WXDA 3DP7A 3K1MA 2BHZA 1I27A 5DEQA 1LEAA 1ZG3A 5JR3A 3FIWA 4XRMA 4HDVA 2HPMA 3ZPLA 5D4RA 1E3OC 3CQZJ 5J40A 4EJVA 3S14J 2FBHA 3BR2A 4KYWA 1ETYA 2VC1A 2RAEA 4BH9A 5IOZA 3RSNA 1JE8A 3I9V2 5LHIA 3FMQA 3JRBA 1BJAA 3F8NA 2QQBA 3KEQA 4CO8A 2BGCA 4PCQA 4UXNA 1B9MA 2XHKA 4NC7A 2R7UA 3IRQA 4ZYEA 2E35A 2L9RA 2RDPA 1OCCH 1VQMI 5F64A 3IH4A 5FKOA 2ZNYA 4A3BJ 2O9LA 3MKZA 2KP6A 1LVKA 4HOBA 2HYGD 5M5XJ 2COBA 4F93B 2CMPA 1O3SA 2A6TA 1U2WA 4PJ0C 1USSA 1FBQA 3QP6A 2QKLB 4U7BA 4IHSA 1W0TA 1V3FA 1MMNA 2OQRA 2XSJC 3RPUA 3JW4A 2L02A 2QSHX 1KYZA 2G9WA 2WAQA 3DKYA 2JSCA 1VI0A 4K2EA 1UZCA 3AG3H 1ZN2A 2R0QC 1LQ1A 4UVBA 2M8EA 1MMDA 5A2QK 1B9NA 4HF0A 1QVTA 1D0ZA 3QPTA 1HW5A 1YS6A 4A3LJ 1SD7A 4N4NB 2MW8A 3A01B 3WG9A 4ESJA 4KT5C 4F7ZA 3KEYA 3KLOA 1HKQA 3D5SC 1SFXA 3N05A 3FKJA 3DPLC 4IHYA 3H3ZA 4A3CJ 2DFFA 5IT9K 3RZDJ 1KONA 2Y0SN 4NB5A 4M6XA 1FMVA 1VQLI 4A0YA 2CUJA 5JVTA 2VI6A 2IGKA 4HA8A 2K9MA 2GIZA 3DXJF 1OCTC 3SQNA 3CESA 3A4CA 3HOZJ 4WCGA 1XD7A 1U9NA 3LSHA 3FWEA 1BW5A 2BHYA 4IVNA 1F36A 2R7ZJ 2K40A 1BIBA 2O8KA 2FNPA 3GTJJ 1QZEA 2LFBA 5ICGA 4BHPA 1KYWA 3G4SI 5JFRA 2NVTJ 1X4PA 2DQRA 1A35A 5L3BA 1EH8A 3FHNA 5AIPA 1C0WA 1OR7A 3S2WA 3W6JB 5K1YA 1IUYA 1R23A 3BQYA 4C30A 5B66C 5LFAA 2DCEA 4S04A 2KRCA 3P7NA 4DIQA 1S5LC 4LOCA 1A6IA 5DD4A 4UUTA 4W97A 1T6SA 1GDTA 1XG1A 1OISA 3L9FA 3LSKA 3ROUA 1XMXA 2L7ZA 2P0WA 4QPQA 1J7KA 4YG2F 2L0KA 3S8PA 2OC6A 3S15J 2UWMA 5JLWA 1R4NB 3I55I 1VNDA 2BOLA 2YPRA 4CHUA 1MBFA 3F8FA 3ZXSA 1IXCA 3HHHA 2C6YA 1MNDA 2R7TA 4ZTFA 1OJLA 3BROA 1ZGAA 4ENKA 1LFUP 5F0HA 1OCZH 3ZQGA 2CQKA 3GYHX 2PX9A 1YW9A 4O6JA 1F43A 2R3SA 3OYLA 1V4RA 2XPVA 1UHWA 1HKTA 2VLAA 2XAFA 2W25A 4Q47A 5ILSA 1RKWA 1WHUA 3FK6A 4NQWB 4I6ZA 4EM1A 3HOTA 4A3EJ 3DWLE 3EUHC 2HDCA 1ZGWA 1UCRA 2JRTA 3U1DA 1OYWA 3EPZA 2H94A 3HG9A 3ZQFA 4A3JJ 1YJNI 1ETQA 4LGWA 5HVQC 4XLEA 1MBKA 3Q0UA 1JI8A 4EQQA 1ZG1A 2JZYA 2P7VB 2CGPA 2K9LA 1FBSA 2JVGA 5FO5A 5J1UA 2QSGX 3ASNH 3E5XA 2HQRA 2ESHA 5FKNA 5ILUA 3ABMH 4A0XA 3TGNA 4AUXA 4X6AJ 1G2HA 1UELB 1I50J 2WTEA 3MVPA 1R1VA 5A2QZ 2HOTA 3DTKA 1J9IA 2K5CA 2AXTC 1YLFA 1G59A 2L4MA 1MBEA 2UUZA 3OWTA 2E71A 2O03A 2VOOA 4YRVA 1XN7A 1VTNC 2DMPA 2HYFA 1Z0XA 2XRLA 3SEZA 4XRFA 4XICA 2QQ8A 1HBXG 1AKHA 3GTQJ 1S6LA 1YO5C 3ZRGA 2L9SA 3BG3A 3I64A 4IQJA 2IBDA 4NBQA 2ZO4A 4HLYA 1KGSA 3G6EI 3GZ5A 3HTUA 5C4XJ 5GADJ 3PJRA 3V7RA 3FZVA 1YE9A 3A0HC 1OQYA 1SFKA 4I99C 2R7FA 3L2CA 2V1NA 5LHGA 3RKXA 1W36D 3E0JB 2KKOA 2OU2A 2O8XA 4YELA 3BG7A 3AFHA 3KLNA 4XLFA 1E2XA 1ZAOA 4Y17A 1DGRM 2STWA 4U0WA 3CO6C 5L3EA 1LEBA 1F5TA 5CYVA 3N4MA 3HGYA 4BJ6C 2GXGA 2NVXJ 3IKTA 2OCEA 4OOIA 1WI3A 2DPDA 2Z1DA 4XSXF 3NRVA 2BEOA 3SZTA 3W3CA 3CLOA 4HV6A 1Y6IA 3OMYA 5HLHA 4XRSA 1ACIA 4BE0A 3S1QJ 2XAJA 2HOAA 1U3EM 2H8RA 4RB0A 4PDKA 4EGZA 5BOXA 3SFZA 4CCOA 3T5XA 4RAGA 4DBQA 1FJLA 2OQGA 3P9KA 4BEHA 3J7AY 4A5MA 2R7XA 4CCJA 1OLTA 2F4IA 2DN0A 1Z7LA 1R7JA 2E34A 3ABUA 4I0BA 4XRSG 3GCMA 4ABZA 5K5OA 2M9HA 1U9OA 2F2EA 3EUHA 4DGWB 3BR3A 4RMNA 1BR2A 3ZR8X 2EFQA 3JRHA 4HNTA 3JSPA 4EV0A 2MA3A 3L1PA 3PNVA 3ZQCA 3HBLA 2O7OA 5IT9Z 5ICCA 3CCMI 3SFIA 1Y56A 3AKZA 1EV7A 1IN4A 2CU7A 3WGGA 1WJBA 2F4OB 4KN7X 2GM4A 2A5WA 5EJCA 5HS8A 1L3LA 4CA0A 1IW7F 2PJPA 2DFHA 1Z91A 4B4CA 5IPAA 1LNWA 3BJ6A 1ZYRF 3A02A 5CVRA 4EATA 3MKWB 2MFZA 3H9QA 3CJNA 4X0GA 3WE2A 2NAZA 2BY2A 2LY2A 3H36A 2GIVA 3ZN1A 1FP2A 4IRGA 1FWZA 2Z99A 1RUOA 3ZN0A 2DA5A 1J75A 1O3RA 1VQ7I 4G94A 4QIWN 2X9DA 3H9GA 1H8AC 1X4OA 3L2UA 1POGA 2VJJA 5M5YJ 2CO5A 3REOA 2VJ4A 3FXKA 1FYLA 1RR8C 1ZKGA 2X0LA 3TDZC 1DQUA 3OYMA 3LA2A 1S3JA 2VQGA 5E1ZB 3J80Z 4EJTA 3HOVJ 2G7HA 4ZJZA 2EIMH 2UV1A 1P92A 1XTAA 2IGNA 2DK8A 3WTWC 1FP1D 2IS4A 1WQ2A 1GUUA 2KIUA 4CYDA 1QPMA 4UVAA 5FKLA 2DA4A 4E7IA 5EEAA 4U87A 3FX3A 1VQ9I 4YIFA 1WVRA 4NQWA 3ERMA 2ME0A 3BR0A 4FT8A 4U0VA 5L3FA 3WTSC 4KFCA 3BCAA 3WU1B 2XPUA 1K4SA 1UB9A 2ZJQF 4F55A 2VBWA 1UG0A 4RGSA 2DW4A 1K7AA 1IRGA 1T08B 3LNQA 3K4MA 3CCQI 3ZQLA 1BI3A 2F6CA 5K5RA 5HDNA 2K86A 3OY9A 2DMUA 1QZZA 5J47A 2FNAA 3LA7A 2F5CA 2ZMEA 2RGVA 3BOQA 1XCBA 2OPTA 2GOXB 2IJLA 4ZDLA 1FNNA 4UV9A 1KZHA 1ZARA 2MH2A 5LD2C 2DQLA 3K7AJ 4AVZA 4FETA 4W1UA 3SDGA 2DOFA 3ZMSA 5BQTA 1HSTA 2QA4I 3GTMJ 3HKZN 1ERDA 3C18A 5FLVA 3R61A 2F5EA 3VPRA 3RQIA 1XGNA 3R4KA 1YJ9I 3WTZA 3DBLB 4C3IJ 3O6BB 2ZXWH 4U7DA 2HQAA 3S2HJ 3O8HA 1KA8A 1JT0A 3LSMA 3HHGA 2XF5A 4Y4RA 3CO7C 1G4DA 3AG1H 4GXOA 1KQ8A 5E79C 1O3QA 1Y0NA 2FQ3A 3HPHA 2IGOA 4JX5A 3HB9A 3H5AA 4ZDPA 1SAXA 4CUGA 4II2A 2IRFG 2WA0A 1EJ9A 1RKTA 2OV7A 1HW2A 3CP2A 1WKMA 1R5GA 3K0LA 2Z33A 1TWCJ 4LD5A 3TW6A 2WB1N 5FFZA 2KIQA 2YU3A 3UR3C 2QVOA 4Y13A 3HDDA 1U6GA 1V5EA 4ZYHA 1YIJI 2PMZN 1W4MA 4O3MA 1T38A 5GP9A 5C44J 3OYNA 3FXQA 4RBOA 2W1OA 4RB3C 1X19A 2ELJA 3HXLA 2JA7J 1XC5A 4IJAA 2ZMEC 2OTLI 1VQOI 4P1WA 5DS9A 4Y33A 2N8GA 1W7PB 1KU7A 2BVLA 4BEHB 1H88C 3S17J 3BZ6A 3S1RJ 4BQAA 3GXOA 5TISC 3O8GA 1GVJA 2KDOA 1GLNA 5BMZA 1YW7A 2MSYA 3GLLA 2M3AA 3BLYA 5J3LA 3WGHA 2KJBA 5IYBJ 3JRAA 3B73A 4EMSA 4BXUA 2BY1A 2DA1A 3ZP5A 1IC8A 3KFWX 3KIOA 1X1AA 2IVMA 2D2WA 2PFBA 2PQ8A 5HLGA 4Z6YA 5K7HA 3L2VA 3DU5A 3ULQB 2LREA 4XLNF 3ZMZA 3HEFA 3ONQA 4XKWA 4XLHA 4H0EA 1X3UA 3KP4A 4HEA2 1IRXA 1J09A 3PNTA 3BC8A 2EZHA 2VB6A 5KCMA 2GA1A 1RETA 2R5YB 3IWZA 5E8IA 1IJWC 1LJ9A 2RQPA 3W2WA 1Z67A 4UB8C 4WF2A 2WY7Q 4HX7A 1R00A 3LSRA 2B9SA 5KK1A 3G1MA 4E70A 1QBJA 4B3XA 2K27A 1HC8A 4HAMA 2DJIA 3KX2A 5GTIC 4OIQF 2JA6J 3TO6A 4U0YA 5IP7J 5E1WA 4KISA 2B0LA 2LG4A 2XAUA 3E1SA 1D8JA 3WHCA 3K2AA 4LK1F 4XN0A 3G73A 3IKVA 1AWCA 2WWYA 1R5HA 3K2ZA 3SZPA 3PUBA 3TQNA 2QZ8A 3GVAA 1R36A 1ZTRA 2L5QA 4S0HB 4O5VA 3ZGKA 1I39A 2RKHA 2DDAA 4F92B 3WG7H 1G3SA 5GAEJ 1HF0A 3EETA 2R5ZB 5D5WB 3GBGA 4BBRJ 3ZQHA 2JN6A 3I4PA 2COMA 5DDGA 1OYYA 3BP8A 3I4NJ 5L3CA 2XPWA 1IG7A 1TTYA 3LSPA 3FXLA 5JHFA 2DODA 2W57A 2IGMA 4MFDA 1R4MB 1OMIA 5H20A 1XB4A 1MNMC 3M4OJ 3K4KA 4FCYA 4EGYA 1FLIA 3MN2A 3PIOF 2O61A 4ZDOA 1SEUA 3DEWA 2DAOA 2EFNA 4HDUA 3ABTA 2FSWA 1SMTA 3CCRI 3RI4A 1D3YA 4CYCB 3LSTA 1MMGA 4XMYA 3QYBA 1ETKA 3HGGA 2X4HA 1R1TA 4AC0A 4WX9A 4XLPF 4GFBA 2K7LA 3A01A 1TW2A 2FQ4A 5ICFA 2JRMA 2R7QA 1T98A 2H1LA 3NARA 2FU4A 3LFKA 3AL0C 2LKSA 2KZVA 2XGXA 4BY7J 5HNHA 1ETVA 2VJ5A 2WB1A 1RESA 4RM2A 1PUEE 4A0ZA 3DBHB 4BACA 4A93J 2PG4A 1UG2A 2W48A 1CF7A 1R58A 1LDJA 4A3DJ 1Y1WJ 4MQVA 4NHJA 5KHDA 3F6OA 1G3YA 3F22A 1ZLKA 3K4BA 2ACJA 4ZTJA 1RPWA 3P9CA 4P96A 3MWMA 4PZJA 2H8WA 2XF6A 1XCVA 4HX4A 1XGSA 2V7FA 1MW7A 2CYYA 2HWVA 3MKYB 1BM9A 1XSDA 2VXDA 1ZK8A 1Z05A 4B47A 4BXFA 2DT5A 4HQMA 4JX4A 4I0AA 3BJAA 2GOMA 3L2QA 3CUOA 1JHHA 2E2JJ 1ZHFA 3ML6A 2NS8A 1ORKA 3PFYA 2ZKZA 1Z21A 2V4JC 3K69A 4RS8A 2EILH 3K6GA 4N9IA 4BL0B 1QRYA 3RQ4A 5E3OA 1P4XA 5LEKA 3GFLA 1U8RA 2OCCH 2VKVA 4DYCA 2VBYA 1AA7A 2EIKH 3CCYA 3QWLA 2FOWA 1IXRC 2BBYA 3B02A 4D1QA 3OIPA 4E7KA 2OUMA 1WJEA 3GMEA 4XKCA 2R7DA 2XB5A 3KYDB 2HVRA 3I3LA 3F21A 2A5YB 1NG7A 4PJMA 3GEZA 5M3MJ 3DU6A 1I1SA 1T2KA 5BPIA 3OYKA 2P7CB 4I7HA 3PQKA 2DOEA 3O2PE 4I02A 5CVUA 3RTRA 1JT6A 4L9VA 3GO5A 1MD0A 5J8FA 2L01A 3E97A 2OTJI 1JJ8C 4DYQA 4GDFA 3B6CA 4CCNA 2YUSA 5FLXK 2M8GX 2OZ6A 2CV0A 5FLXZ 5FKKA 1Z7UA 4IQ4A 4BHBA 2VE8A 3EYYA 3KYCB 5B3SH 1H89C 3M07A 3V8JA 2K4JA 2ISYA 2EINH 4L9NA 5D8KB 2E2IJ 1BW6A 4YIIA 3I59A 3ZQQA 1WZ2A 1A6QA 2PN6A 1K4TA 3K1NA 2DMNA 4ON0A 2P5LC 2E1CA 2KRHA 2IS6A 2DI3A 4EM0B 1Z3XA 1SVMA 2KL4A 5JVGF 4OWRB 3AL0B 4BQOA 2MC4A 3ZQIA 1LDDA 1IV6A 1Y1VJ 2DDBA 2EFPA 2VT3A 2WC2A 2R7OA 3D5RC 4A5NA 2E1NA 1G8XA 5GPAA 2EV6A 2IA1A 4JBAA 2A6HF 3U2RA 3DLAA 2RC4A 4KIFA 2Z3YA 3LFUA 3GX4X 4V2FA 4XKVA 1JKQC 4R79A 2L3DA 3KP6A 5EYRA 1AHDP 2L7MP 1O3TA 2W82A 4D7MA 2UZKA 3BWGA 2P81A 2ELHA 1PUFB 4CICA 1JTXA 1S8NA 2Y69H 2DOAA 1U8BA 2VODA 1BN5A 2H6BA 2Z9OA 5J8CA 1MH3A 1T0FA 5FB2A 5CQEA 3W6VA 4TV7A 2R7SA 2V26A 3JTHA 1MJBA 2CV2A 4E7HA 1OCRH 2OF7A 4CGZA 3CMMA 1X3WB 3I58A 2O0YA 4ASNA 4JYKA 2M0CA 4M9SA 3V42A 1APLC 5FGMA 5FJ8J 1N25A 3PL8A 1VZ0A
chains in the Genus database with same CATH topology
4MQ9F 1IN6A 1B1BA 1J5YA 1Z6TA 1K79A 2MH9A 3R0AA 1EH6A 3WTVC 2XROA 1J59A 1RI7A 3KP2A 1P2FA 4JK1X 4KICA 1U78A 3R0JA 4BNCA 3M8FA 2V1XA 4M9XA 1TNTA 3F3XA 4OMYA 1D5VA 2LKPA 3FM5A 2DTRA 2V9VA 1KU9A 1IXSB 2LF7A 4XSZF 5E17F 1MZBA 4KIGA 1IF1A 4AWXB 4L18B 1XGOA 1MDMA 1W7PA 4ZYDA 3MQ0A 5L3GA 2UXNA 4B8XA 2ADUA 2PMUA 4UVCA 1TNSA 2FXAA 2ESNA 2CG4A 2A3SA 1FZPB 2RN7A 3BDDA 1FC3A 2V79A 1XDSA 2DK5A 3WU0A 3WGIA 2FMLA 1B59A 2Q0OA 4R1HA 2FE3A 3H3UA 3TDUC 4A6DA 1STZA 5LBQA 1USTA 3VB2A 1ONVA 5E1XA 2ZXJA 1LDKB 4M71A 1YG2A 2QBYB 3IWFA 2Y0MA 4M6YA 1S7AA 2ZBKA 2EJRA 4N0BA 2CWEA 1YW8A 1TBXA 1ZRCA 3GFIA 5LGUA 5HOOA 1QGPA 4WXCA 4IXAA 4HV5A 2QENA 4N9HA 2KIFA 2P6TA 1Z1DA 3QAHA 2Y75A 3BJOA 1FPQA 2YX7A 2YX4A 4GCVA 4GYIA 3HYIA 4MEYF 2JTVA 2QLZA 3T1BA 3GWZA 2O3FA 5DCMB 4OIOF 1PP8F 3FMSA 1ZH5A 4RB2C 2PI0A 1K78B 5CVVA 2GQQA 2P8TA 1D8KA 2DO7A 2FF4A 5CLSA 1IN8A 2KRFA 2E7WA 2L54A 3LQRA 1XSXA 2ZFWA 4HX8A 3G3ZA 2QUFA 4DNCA 5ICEA 1O57A 1GXPA 1BIAA 1JHFA 3CUQC 4I2OA 3DEUA 5LRRA 2WV0A 3WODF 1RZ4A 3V8LA 2RV8A 2A61A 2A6EF 4UHTA 2AS5F 3ZMTA 4CZZA 2HQNA 3E6DA 3MAJA 4L0ZB 5HS9A 2A07F 1SD4A 3V4GA 1KQ9A 1FY7A 2HKOA 1FOKA 4LG0A 3KP5A 4R8HA 1CGPA 2P6SA 4EJOA 3FF5A 2EFWA 2TDXA 2XASA 4AD9A 4BHCA 2ETHA 2D45A 4UV8A 3GUDA 2CFXA 3HRTA 2P4WA 4HQEA 3SHFA 5LGTA 2F5FA 4MGRA 4KDPA 4HF1A 5E20A 2GAUA 2EWNA 2EK5A 2CW0F 3E6CC 4FX0A 1ZRDA 3HSRA 3MFKA 2IP2A 3CDHA 3I59B 2V1UA 5F1RA 2K02A 3IRRA 3RKYA 5LRSA 1ZGJA 4ESFA 1KU2A 3V8KA 5D8LB 3QRFF 3VEPA 1P4WA 2HOEA 1JGSA 3HUGA 1P6RA 1YTYA 3JAMZ 4YFXF 2DFIA 3DF8A 3FXUA 2VE9A 1WSUA 1DPUA 3PFIA 3RKWA 2YR2A 2EV0A 2HR3A 1G3TA 3K1PA 2ISZA 1Z6RA 4OU0A 2AXLA 4HZFA 5D6FA 2NS0A 2JT1A 1S29A 1Y0UA 4L9JA 2LSOA 1CF7B 2V6CA 2MLGA 3E5QA 1QQIA 1TLHB 3M9AA 5LEJA 2UXXA 2QM3A 2M87A 4MEXF 2ZJ2A 2LF8A 1FYKA 3BY6A 4HF2A 5H6RA 1FYMA 4L0YB 3BPVA 5CVIA 3CUQA 2CSOA 3AAFA 2BE5F 5ILVA 4AVPA 1OPCA 3DV8A 3ISPA 3FMRA 2F5DA 3P9IA 3RYPA 1U5TB 4ZH4F 5F6FA 2IW5A 1OYIA 3Q9SA 4BAYA 4LMYA 3E3VA 2M45A 1NHAA 3NQOA 2E7XA 1S7OA 2P5KA 1I5ZA 5FD5A 2L4AA 5D5VB 4YFNF 3R60A 5D4SA 2JPCA 1ULYA 1ZG5A 4ETSA 5HLIA 1HXDA 3IL2A 1RIOH 5DUIA 4ZZDA 3RIRA 1SFUA 1IAWA 4OMZA 4RGXA 2ZMEB 4L9TA 5TRDA 2LNBA 4PGHA 3D5LA 3QPHA 1J2XA 3F8CA 1F4KA 4I09A 1UFMA 2HKXA 5JI6A 1U5TC 3N97A 1B6AA 4M74A 4LLLA 2A68F 2IT0A 5HDGA 4P9FA 3RDIA 1Z9CA 1I1GA 3HSEA 2XRNA 5ERIA 3RPQA 1L0OC 4U88A 4Y15A 3JTGA 1BBYA 1SMYF 2JPBA 1RUNA 1PP7U 2PMHA 1W5SA 2GXBA 2QWWA 3JSOA 1IZ1A 1FT9A 2MD5A 1K78A 2MC3A 5E8GA 5DD8A 2VC0A 4ENMA 2M30A 3KETA 2OD5A 3IHUA 2FEZA 3TOBA 3KP7A 5IT3A 2ZNZA 3ECHA 3I0TA 2QQAA 2FRHA 5FFXA 2PBIA 5HS7A 3ZQ7A 1MDMB 3I53A 3HIFA 5JHUA 4KA4A 5LGNA 4I01A 5HDKA 5DCFA 3V7SA 2IA2A 4A6EA 3DPTA 2OZUA 2H6CA 4P55A 4FHTA 1QZYA 2Y48A 4AIHA 2NNNA 1ODDA 4LK0F 3ZMVA 1O7FA 3IC7A 4CDGA 2XVCA 1RNLA 3F8MA 4IRIA 3WTXC 5AIQA 5BS6A 1SD5A 3HRSA 2GA2A 1R22A 2QQ9A 5DYMA 3RJPA 3CTAA 3NEUA 4KIBA 3EQLF 3GW2A 2DBBA 2OBPA 2DU9A 1BI0A 2MBFA 2VXZA 2XV4S 2DPUA 1BI2A 3MZHA 3RYRA 3ERED 1DPRA 3VODA 5L3DA 3LA3A 3QOPA 1KU3A 1MJAA 3M1EA 4ESBA 3F23A 1HSJA 4B09A 3GLXA 3O3KA 2EA2A 5DCMA 1QO0D 1BC7C 4L5IA 2GWRA 1FX7A 2HEOA 5LHHA 3LQQA 4LFUA 1MKMA 2D1VA 2FA5A 2P5VA 3DKWA 5ED4A 4GO1A 2VONA 4G6DA 2MLKA 3MEXA 1MGTA 2D1HA 5H6QA 2J5PA 3TOAA 3E6BA 3T8TA 1PDNC 3COAC 4ZZLA 2W85A 1F1ZA 2HTJA 2VT2A 5AONA 1EH7A 3ZMDA 3ECOA 1W7PD 3I54A 4KMUX 2XAQA 1SD6A 1HQCA 3KZYA 1IN5A 4S05A 2VBZA 1YQAA 4G7ZF 2H27A 2NRAC 3CUQB 1BOAA 3MCZA 3M8EA 2H09A 3FHZA 4UNOA 4ZYGA 2VOPA 4DQ2A 2IPQX 3L00A 1R1UA 2ZCWA 4LLGF 4GYGA 4YFKF 3U9GA 4KN4X 2Q8KA 1XDUA 5CJ9A 1G3WA 4BYYA 2K4BA 4RAZA 5FD6A 1ON1A 3T8RA 1REPC 1GHCA 2EFOA 5LLQA 1B4AA 2DLLA 5CVJA 4D0PA 3J81K 3K9TA 1TQIA 3WE3A 1WWXA 3WTYC 4I98B 4XBFA 3VFZA 4PGGA 4Q4ZF 2J5OA 3WTTC 4Q48A 4ENNA 4OINF 5EEHA 2VN2A 2W24A 2HS5A 1T39A 1IRFA 4IF4A 1FSHA 4G9YA 1Q1HA 2RVCA 4EJUA 3M7GA 2STTA 3EYIA 4AIJA 1BC8C 1OKRA 3EDPA 1AOYA 1WRJA 5J6XA 2HFHA 4HYEA 2M5WA 1F9NA 2LDUA 4LB5A 2FOKA 3Q9VA 3J81Z 1MJ9A 2XAHA 2Q2EA 3KE2A 1WI9A 2HZTA 5K5QA 2IA0A 3E6MA 3Q5FA 4RGUA 4LLNA 2NYXA 4P5OA 1A04A 1SFEA 3LAPA 2KJCA 4G6QA 4LB6B 3HTSB 4KUMA 4FX4A 4EVIA 1XMKA 1J0RA 1FSEA 3GF2A 3QU3A 2XAGA 3ZMUA 2A69F 4KMFA 3FM3A 4WK8F 6PAXA 5BPDA 3TKYA 3GZ6A 4CXFA 2XIGA 3V7CA 1DUXC 4A12A 3KEOA 2BV6A 4HLXA 2XKOA 1H9TA 3L7WA 1O7LA 5D6EA 2PLYA 3I71A 5EEGA 1G6NA 3D0SA 3H92A 1U5TA 2OA4A 3SXYA 1BI1A 3J7AO 1XSVA 2EV5A 4OIRF 3C7JA 4Q5SF 4QLCU 4WWCA 4HBLA 3F8BA 1JXSA 2G7UA 3QU6A 1ZRFA 3GFMA 4G7HF 4MTEA 2QBYA 4HW0A 3QP5A 1QNTA 4GGGA 1HW1A 1H9GA 1ON2A 4P9UA 1KQ0A 5DUKA 1LB2A 2EA4A 3LWFA 4IPAA 2KIMA 3MZYA 1P4AA 1XGMA 5E18F 3LAJA 4WXHA 4L5JA 3DQVC 1DP7P 2NNYA 4M9ZA 3F72A 3E5UA 4UUVA 2EB7A 4A2UA 2XUBA 4MTDA 4LJZF 3R6SA 1ZREA 4MNUA 4OIPF 1DDNA 4M72A 1ZLJA 3KP3A 1LVAA 1TQPA 2YSRA 4RB1A 1H0MA 1YFHA 5D5UB 3TO9A 2GZWA 3W6KB 3KCCA 5KVRA 2Z5UA 3C3WA 3HOSA 3BPXA 4KNYA 3KZZA 3J80K 1YS7A 1K6OA 2V1DA 4RGRA 2RNJA 1UHMA 3L09A 2M1BA 3DFGA 2PEXA 3F6VA 4AIKA 2FBKA 4JQFA 3HRMA 4MHGA 3TO7A 1HKSA 3I5UA 2W84A 3OV8A 4G7OF 4LG0B 3GFJA 3WTUC 1XMAA 1TW3A 3HSFA 3FXRA 5DV5A 2BYVE 2OAZA 1GXQA 1YIOA 1TQMA 4EM2A 5D5XB 1I6XA 2FBIA 3C1DA 3VOEA 1FBUA 1IN7A 3ELKA 4M73A 3T0YA 2FMYA 4QWQA 2HGCA 2HTSA 2QYOA 4RAYA 5TJJA 4EJWA 4Z2YA 2VBXA 1YYVA 1E17A 4IHTA 1W5TA 2XKPA 4G8XA 4IRHA 3HRUA 3OOPA 4ENJA 2O6GE 3JAMK 3PQJA 4WXDA 3DP7A 3K1MA 1I27A 5DEQA 1LEAA 1ZG3A 5JR3A 3ZPLA 4HDVA 5D4RA 4EJVA 2FBHA 4KYWA 2VC1A 4BH9A 1JE8A 5LHIA 3FMQA 1BJAA 3F8NA 2QQBA 3KEQA 4CO8A 2BGCA 4PCQA 4UXNA 1B9MA 2XHKA 3IRQA 4ZYEA 2RDPA 5F64A 2ZNYA 4HOBA 2HYGD 1O3SA 1U2WA 1USSA 1FBQA 3QP6A 4U7BA 4IHSA 1V3FA 2OQRA 3RPUA 3JW4A 2L02A 2G9WA 1KYZA 2JSCA 4K2EA 1LQ1A 1ZN2A 4UVBA 2M8EA 5A2QK 1B9NA 4HF0A 3QPTA 1HW5A 1YS6A 1SD7A 3WG9A 4ESJA 4KT5C 4F7ZA 3KLOA 1HKQA 1SFXA 3DPLC 3H3ZA 5IT9K 4NB5A 4M6XA 4A0YA 5JVTA 4HA8A 3DXJF 3SQNA 4WCGA 1XD7A 3FWEA 4IVNA 1BIBA 2FNPA 5ICGA 4BHPA 1KYWA 5JFRA 2DQRA 5L3BA 1EH8A 5AIPA 1C0WA 1OR7A 3S2WA 3W6JB 5K1YA 1IUYA 1R23A 4S04A 3P7NA 5DD4A 1T6SA 3L9FA 3ROUA 1J7KA 4YG2F 2UWMA 2YPRA 4CHUA 3F8FA 1IXCA 3HHHA 2C6YA 4ENKA 3BROA 1ZGAA 2CQKA 3GYHX 1YW9A 4O6JA 2R3SA 1V4RA 1UHWA 1HKTA 2XAFA 2W25A 4Q47A 5ILSA 4EM1A 3HOTA 2HDCA 1UCRA 2JRTA 3U1DA 1OYWA 2H94A 4LGWA 5HVQC 4EQQA 1ZG1A 2JZYA 2P7VB 2CGPA 1FBSA 5FO5A 3E5XA 2HQRA 2ESHA 5ILUA 4A0XA 3TGNA 2WTEA 5A2QZ 1R1VA 1J9IA 1YLFA 2L4MA 2O03A 2VOOA 1XN7A 1VTNC 2HYFA 4XRFA 1HBXG 1S6LA 1YO5C 3I64A 2ZO4A 4HLYA 1KGSA 3GZ5A 3HTUA 3V7RA 3FZVA 2R7FA 3L2CA 5LHGA 3RKXA 2KKOA 2OU2A 2O8XA 3KLNA 1E2XA 1ZAOA 4Y17A 2STWA 4U0WA 3CO6C 5L3EA 1LEBA 1F5TA 5CYVA 3N4MA 2GXGA 3IKTA 4OOIA 2DPDA 4XSXF 3NRVA 2BEOA 3SZTA 3CLOA 4HV6A 5HLHA 2XAJA 1U3EM 4EGZA 5BOXA 4PDKA 4RB0A 3SFZA 3T5XA 2OQGA 3P9KA 4A5MA 1R7JA 3ABUA 4I0BA 5K5OA 2F2EA 3EUHA 2EFQA 3JSPA 4EV0A 2MA3A 5IT9Z 5ICCA 1EV7A 1IN4A 3WGGA 4KN7X 5HS8A 1L3LA 1IW7F 2PJPA 1Z91A 1LNWA 3BJ6A 1ZYRF 5CVRA 3CJNA 3WE2A 2NAZA 3ZN1A 2GIVA 1FP2A 4IRGA 1FWZA 2Z99A 1RUOA 3ZN0A 1J75A 1O3RA 4G94A 2CO5A 3REOA 1FYLA 2X0LA 3TDZC 3LA2A 1S3JA 5E1ZB 3J80Z 4EJTA 2G7HA 1P92A 2DK8A 3WTWC 1FP1D 1WQ2A 2KIUA 4CYDA 1QPMA 4UVAA 3FX3A 4YIFA 4NQWA 4FT8A 4U0VA 5L3FA 3WTSC 4KFCA 3WU1B 1UB9A 2VBWA 4RGSA 2DW4A 1K7AA 1IRGA 1BI3A 5K5RA 5HDNA 2K86A 1QZZA 2FNAA 3LA7A 2F5CA 2ZMEA 2RGVA 3BOQA 1XCBA 2IJLA 1FNNA 4UV9A 1ZARA 2MH2A 2DQLA 3ZMSA 5BQTA 1HSTA 3C18A 3R61A 2F5EA 1XGNA 3R4KA 3WTZA 3O6BB 4U7DA 1KA8A 3HHGA 3CO7C 1G4DA 4GXOA 1KQ8A 1O3QA 2FQ3A 1SAXA 2IRFG 1HW2A 1WKMA 1R5GA 3K0LA 2Z33A 4LD5A 5FFZA 2YU3A 2QVOA 4Y13A 1U6GA 4ZYHA 1W4MA 4O3MA 1T38A 3FXQA 4RB3C 4IJAA 1W7PB 1KU7A 3BZ6A 4BQAA 3GXOA 1GVJA 5BMZA 1YW7A 3WGHA 2KJBA 3B73A 4EMSA 4BXUA 3ZP5A 3KFWX 2IVMA 2D2WA 2PFBA 2PQ8A 5HLGA 3ULQB 4XLNF 3ZMZA 4H0EA 1X3UA 3KP4A 2GA1A 3IWZA 5E8IA 1LJ9A 2RQPA 4WF2A 4HX7A 1R00A 5KK1A 4E70A 1QBJA 2K27A 4HAMA 4OIQF 3TO6A 4U0YA 5E1WA 2B0LA 1D8JA 4LK1F 3G73A 1AWCA 3IKVA 2WWYA 1R5HA 3K2ZA 3SZPA 3TQNA 2QZ8A 3GVAA 1R36A 4O5VA 2RKHA 1G3SA 3EETA 5D5WB 3I4PA 2COMA 5DDGA 1OYYA 3BP8A 5L3CA 1TTYA 2W57A 1OMIA 5H20A 1XB4A 4EGYA 1FLIA 2O61A 2DAOA 2EFNA 4HDUA 3ABTA 2FSWA 1SMTA 3RI4A 1D3YA 3LSTA 2X4HA 1R1TA 4WX9A 4XLPF 2K7LA 1TW2A 5ICFA 1T98A 2FU4A 3LFKA 2XGXA 1PUEE 4A0ZA 2PG4A 1CF7A 1R58A 1LDJA 4MQVA 4NHJA 3F6OA 1G3YA 3F22A 1ZLKA 2ACJA 3P9CA 4P96A 3MWMA 4PZJA 1XCVA 4HX4A 1XGSA 2CYYA 2HWVA 1BM9A 1XSDA 1Z05A 2DT5A 4HQMA 4I0AA 3BJAA 3CUOA 1JHHA 1ZHFA 3ML6A 2ZKZA 3K69A 4RS8A 4N9IA 1P4XA 5LEKA 3GFLA 1U8RA 2VBYA 1IXRC 2BBYA 3B02A 2R7DA 3F21A 2A5YB 3GEZA 1I1SA 1T2KA 5BPIA 2P7CB 4I7HA 3PQKA 3O2PE 4I02A 5CVUA 3RTRA 4L9VA 3GO5A 1MD0A 5J8FA 2L01A 3E97A 5FLXK 2OZ6A 5FLXZ 1Z7UA 4BHBA 2VE8A 3EYYA 3V8JA 2K4JA 2ISYA 4L9NA 5D8KB 4YIIA 3I59A 2PN6A 3K1NA 4ON0A 2P5LC 2E1CA 2DI3A 4EM0B 1LDDA 2EFPA 2VT3A 2WC2A 4A5NA 2E1NA 3U2RA 2EV6A 2IA1A 2A6HF 4JBAA 2RC4A 4KIFA 2Z3YA 3GX4X 4R79A 2L3DA 3KP6A 1O3TA 2UZKA 3BWGA 2ELHA 4CICA 1S8NA 2VODA 1BN5A 2H6BA 2Z9OA 5J8CA 1T0FA 5FB2A 4TV7A 3JTHA 1MJBA 4CGZA 3I58A 2O0YA 4ASNA 4M9SA 5FGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MQ9 F;  1IN6 A;  1B1B A;  1J5Y A;  1Z6T A;  1K79 A;  2MH9 A;  3R0A A;  1EH6 A;  3WTV C;  2XRO A;  1J59 A;  1RI7 A;  3KP2 A;  1P2F A;  4JK1 X;  4KIC A;  1U78 A;  3R0J A;  4BNC A;  3M8F A;  2V1X A;  4M9X A;  1TNT A;  3F3X A;  4OMY A;  1D5V A;  2LKP A;  3FM5 A;  2DTR A;  2V9V A;  1KU9 A;  1IXS B;  2LF7 A;  4XSZ F;  5E17 F;  1MZB A;  4KIG A;  1IF1 A;  4AWX B;  4L18 B;  1XGO A;  1MDM A;  1W7P A;  4ZYD A;  3MQ0 A;  5L3G A;  2UXN A;  4B8X A;  2ADU A;  2PMU A;  4UVC A;  1TNS A;  2FXA A;  2ESN A;  2CG4 A;  2A3S A;  1FZP B;  2RN7 A;  3BDD A;  1FC3 A;  2V79 A;  1XDS A;  2DK5 A;  3WU0 A;  3WGI A;  2FML A;  1B59 A;  2Q0O A;  4R1H A;  2FE3 A;  3H3U A;  3TDU C;  4A6D A;  1STZ A;  5LBQ A;  1UST A;  3VB2 A;  1ONV A;  5E1X A;  2ZXJ A;  1LDK B;  4M71 A;  1YG2 A;  2QBY B;  3IWF A;  2Y0M A;  4M6Y A;  1S7A A;  2ZBK A;  2EJR A;  4N0B A;  2CWE A;  1YW8 A;  1TBX A;  1ZRC A;  3GFI A;  5LGU A;  5HOO A;  1QGP A;  4WXC A;  4IXA A;  4HV5 A;  2QEN A;  4N9H A;  2KIF A;  2P6T A;  1Z1D A;  3QAH A;  2Y75 A;  3BJO A;  1FPQ A;  2YX7 A;  2YX4 A;  4GCV A;  4GYI A;  3HYI A;  4MEY F;  2JTV A;  2QLZ A;  3T1B A;  3GWZ A;  2O3F A;  5DCM B;  4OIO F;  1PP8 F;  3FMS A;  1ZH5 A;  4RB2 C;  2PI0 A;  1K78 B;  5CVV A;  2GQQ A;  2P8T A;  1D8K A;  2DO7 A;  2FF4 A;  5CLS A;  1IN8 A;  2KRF A;  2E7W A;  2L54 A;  3LQR A;  1XSX A;  2ZFW A;  4HX8 A;  3G3Z A;  2QUF A;  4DNC A;  5ICE A;  1O57 A;  1GXP A;  1BIA A;  1JHF A;  3CUQ C;  4I2O A;  3DEU A;  5LRR A;  2WV0 A;  3WOD F;  1RZ4 A;  3V8L A;  2RV8 A;  2A61 A;  2A6E F;  4UHT A;  2AS5 F;  3ZMT A;  4CZZ A;  2HQN A;  3E6D A;  3MAJ A;  4L0Z B;  5HS9 A;  2A07 F;  1SD4 A;  3V4G A;  1KQ9 A;  1FY7 A;  2HKO A;  1FOK A;  4LG0 A;  3KP5 A;  4R8H A;  1CGP A;  2P6S A;  4EJO A;  3FF5 A;  2EFW A;  2TDX A;  2XAS A;  4AD9 A;  4BHC A;  2ETH A;  2D45 A;  4UV8 A;  3GUD A;  2CFX A;  3HRT A;  2P4W A;  4HQE A;  3SHF A;  5LGT A;  2F5F A;  4MGR A;  4KDP A;  4HF1 A;  5E20 A;  2GAU A;  2EWN A;  2EK5 A;  2CW0 F;  3E6C C;  4FX0 A;  1ZRD A;  3HSR A;  3MFK A;  2IP2 A;  3CDH A;  3I59 B;  2V1U A;  5F1R A;  2K02 A;  3IRR A;  3RKY A;  5LRS A;  1ZGJ A;  4ESF A;  1KU2 A;  3V8K A;  5D8L B;  3QRF F;  3VEP A;  1P4W A;  2HOE A;  1JGS A;  3HUG A;  1P6R A;  1YTY A;  3JAM Z;  4YFX F;  2DFI A;  3DF8 A;  3FXU A;  2VE9 A;  1WSU A;  1DPU A;  3PFI A;  3RKW A;  2YR2 A;  2EV0 A;  2HR3 A;  1G3T A;  3K1P A;  2ISZ A;  1Z6R A;  4OU0 A;  2AXL A;  4HZF A;  5D6F A;  2NS0 A;  2JT1 A;  1S29 A;  1Y0U A;  4L9J A;  2LSO A;  1CF7 B;  2V6C A;  2MLG A;  3E5Q A;  1QQI A;  1TLH B;  3M9A A;  5LEJ A;  2UXX A;  2QM3 A;  2M87 A;  4MEX F;  2ZJ2 A;  2LF8 A;  1FYK A;  3BY6 A;  4HF2 A;  5H6R A;  1FYM A;  4L0Y B;  3BPV A;  5CVI A;  3CUQ A;  2CSO A;  3AAF A;  2BE5 F;  5ILV A;  4AVP A;  1OPC A;  3DV8 A;  3ISP A;  3FMR A;  2F5D A;  3P9I A;  3RYP A;  1U5T B;  4ZH4 F;  5F6F A;  2IW5 A;  1OYI A;  3Q9S A;  4BAY A;  4LMY A;  3E3V A;  2M45 A;  1NHA A;  3NQO A;  2E7X A;  1S7O A;  2P5K A;  1I5Z A;  5FD5 A;  2L4A A;  5D5V B;  4YFN F;  3R60 A;  5D4S A;  2JPC A;  1ULY A;  1ZG5 A;  4ETS A;  5HLI A;  1HXD A;  3IL2 A;  1RIO H;  5DUI A;  4ZZD A;  3RIR A;  1SFU A;  1IAW A;  4OMZ A;  4RGX A;  2ZME B;  4L9T A;  5TRD A;  2LNB A;  4PGH A;  3D5L A;  3QPH A;  1J2X A;  3F8C A;  1F4K A;  4I09 A;  1UFM A;  2HKX A;  5JI6 A;  1U5T C;  3N97 A;  1B6A A;  4M74 A;  4LLL A;  2A68 F;  2IT0 A;  5HDG A;  4P9F A;  3RDI A;  1Z9C A;  1I1G A;  3HSE A;  2XRN A;  5ERI A;  3RPQ A;  1L0O C;  4U88 A;  4Y15 A;  3JTG A;  1BBY A;  1SMY F;  2JPB A;  1RUN A;  1PP7 U;  2PMH A;  1W5S A;  2GXB A;  2QWW A;  3JSO A;  1IZ1 A;  1FT9 A;  2MD5 A;  1K78 A;  2MC3 A;  5E8G A;  5DD8 A;  2VC0 A;  4ENM A;  2M30 A;  3KET A;  2OD5 A;  3IHU A;  2FEZ A;  3TOB A;  3KP7 A;  5IT3 A;  2ZNZ A;  3ECH A;  3I0T A;  2QQA A;  2FRH A;  5FFX A;  2PBI A;  5HS7 A;  3ZQ7 A;  1MDM B;  3I53 A;  3HIF A;  5JHU A;  4KA4 A;  5LGN A;  4I01 A;  5HDK A;  5DCF A;  3V7S A;  2IA2 A;  4A6E A;  3DPT A;  2OZU A;  2H6C A;  4P55 A;  4FHT A;  1QZY A;  2Y48 A;  4AIH A;  2NNN A;  1ODD A;  4LK0 F;  3ZMV A;  1O7F A;  3IC7 A;  4CDG A;  2XVC A;  1RNL A;  3F8M A;  4IRI A;  3WTX C;  5AIQ A;  5BS6 A;  1SD5 A;  3HRS A;  2GA2 A;  1R22 A;  2QQ9 A;  5DYM A;  3RJP A;  3CTA A;  3NEU A;  4KIB A;  3EQL F;  3GW2 A;  2DBB A;  2OBP A;  2DU9 A;  1BI0 A;  2MBF A;  2VXZ A;  2XV4 S;  2DPU A;  1BI2 A;  3MZH A;  3RYR A;  3ERE D;  1DPR A;  3VOD A;  5L3D A;  3LA3 A;  3QOP A;  1KU3 A;  1MJA A;  3M1E A;  4ESB A;  3F23 A;  1HSJ A;  4B09 A;  3GLX A;  3O3K A;  2EA2 A;  5DCM A;  1QO0 D;  1BC7 C;  4L5I A;  2GWR A;  1FX7 A;  2HEO A;  5LHH A;  3LQQ A;  4LFU A;  1MKM A;  2D1V A;  2FA5 A;  2P5V A;  3DKW A;  5ED4 A;  4GO1 A;  2VON A;  4G6D A;  2MLK A;  3MEX A;  1MGT A;  2D1H A;  5H6Q A;  2J5P A;  3TOA A;  3E6B A;  3T8T A;  1PDN C;  3COA C;  4ZZL A;  2W85 A;  1F1Z A;  2HTJ A;  2VT2 A;  5AON A;  1EH7 A;  3ZMD A;  3ECO A;  1W7P D;  3I54 A;  4KMU X;  2XAQ A;  1SD6 A;  1HQC A;  3KZY A;  1IN5 A;  4S05 A;  2VBZ A;  1YQA A;  4G7Z F;  2H27 A;  2NRA C;  3CUQ B;  1BOA A;  3MCZ A;  3M8E A;  2H09 A;  3FHZ A;  4UNO A;  4ZYG A;  2VOP A;  4DQ2 A;  2IPQ X;  3L00 A;  1R1U A;  2ZCW A;  4LLG F;  4GYG A;  4YFK F;  3U9G A;  4KN4 X;  2Q8K A;  1XDU A;  5CJ9 A;  1G3W A;  4BYY A;  2K4B A;  4RAZ A;  5FD6 A;  1ON1 A;  3T8R A;  1REP C;  1GHC A;  2EFO A;  5LLQ A;  1B4A A;  2DLL A;  5CVJ A;  4D0P A;  3J81 K;  3K9T A;  1TQI A;  3WE3 A;  1WWX A;  3WTY C;  4I98 B;  4XBF A;  3VFZ A;  4PGG A;  4Q4Z F;  2J5O A;  3WTT C;  4Q48 A;  4ENN A;  4OIN F;  5EEH A;  2VN2 A;  2W24 A;  2HS5 A;  1T39 A;  1IRF A;  4IF4 A;  1FSH A;  4G9Y A;  1Q1H A;  2RVC A;  4EJU A;  3M7G A;  2STT A;  3EYI A;  4AIJ A;  1BC8 C;  1OKR A;  3EDP A;  1AOY A;  1WRJ A;  5J6X A;  2HFH A;  4HYE A;  2M5W A;  1F9N A;  2LDU A;  4LB5 A;  2FOK A;  3Q9V A;  3J81 Z;  1MJ9 A;  2XAH A;  2Q2E A;  3KE2 A;  1WI9 A;  2HZT A;  5K5Q A;  2IA0 A;  3E6M A;  3Q5F A;  4RGU A;  4LLN A;  2NYX A;  4P5O A;  1A04 A;  1SFE A;  3LAP A;  2KJC A;  4G6Q A;  4LB6 B;  3HTS B;  4KUM A;  4FX4 A;  4EVI A;  1XMK A;  1J0R A;  1FSE A;  3GF2 A;  3QU3 A;  2XAG A;  3ZMU A;  2A69 F;  4KMF A;  3FM3 A;  4WK8 F;  6PAX A;  5BPD A;  3TKY A;  3GZ6 A;  4CXF A;  2XIG A;  3V7C A;  1DUX C;  4A12 A;  3KEO A;  2BV6 A;  4HLX A;  2XKO A;  1H9T A;  3L7W A;  1O7L A;  5D6E A;  2PLY A;  3I71 A;  5EEG A;  1G6N A;  3D0S A;  3H92 A;  1U5T A;  2OA4 A;  3SXY A;  1BI1 A;  3J7A O;  1XSV A;  2EV5 A;  4OIR F;  3C7J A;  4Q5S F;  4QLC U;  4WWC A;  4HBL A;  3F8B A;  1JXS A;  2G7U A;  3QU6 A;  1ZRF A;  3GFM A;  4G7H F;  4MTE A;  2QBY A;  4HW0 A;  3QP5 A;  1QNT A;  4GGG A;  1HW1 A;  1H9G A;  1ON2 A;  4P9U A;  1KQ0 A;  5DUK A;  1LB2 A;  2EA4 A;  3LWF A;  4IPA A;  2KIM A;  3MZY A;  1P4A A;  1XGM A;  5E18 F;  3LAJ A;  4WXH A;  4L5J A;  3DQV C;  1DP7 P;  2NNY A;  4M9Z A;  3F72 A;  3E5U A;  4UUV A;  2EB7 A;  4A2U A;  2XUB A;  4MTD A;  4LJZ F;  3R6S A;  1ZRE A;  4MNU A;  4OIP F;  1DDN A;  4M72 A;  1ZLJ A;  3KP3 A;  1LVA A;  1TQP A;  2YSR A;  4RB1 A;  1H0M A;  1YFH A;  5D5U B;  3TO9 A;  2GZW A;  3W6K B;  3KCC A;  5KVR A;  2Z5U A;  3C3W A;  3HOS A;  3BPX A;  4KNY A;  3KZZ A;  3J80 K;  1YS7 A;  1K6O A;  2V1D A;  4RGR A;  2RNJ A;  1UHM A;  3L09 A;  2M1B A;  3DFG A;  2PEX A;  3F6V A;  4AIK A;  2FBK A;  4JQF A;  3HRM A;  4MHG A;  3TO7 A;  1HKS A;  3I5U A;  2W84 A;  3OV8 A;  4G7O F;  4LG0 B;  3GFJ A;  3WTU C;  1XMA A;  1TW3 A;  3HSF A;  3FXR A;  5DV5 A;  2BYV E;  2OAZ A;  1GXQ A;  1YIO A;  1TQM A;  4EM2 A;  5D5X B;  1I6X A;  2FBI A;  3C1D A;  3VOE A;  1FBU A;  1IN7 A;  3ELK A;  4M73 A;  3T0Y A;  2FMY A;  4QWQ A;  2HGC A;  2HTS A;  2QYO A;  4RAY A;  5TJJ A;  4EJW A;  4Z2Y A;  2VBX A;  1YYV A;  1E17 A;  4IHT A;  1W5T A;  2XKP A;  4G8X A;  4IRH A;  3HRU A;  3OOP A;  4ENJ A;  2O6G E;  3JAM K;  3PQJ A;  4WXD A;  3DP7 A;  3K1M A;  1I27 A;  5DEQ A;  1LEA A;  1ZG3 A;  5JR3 A;  3ZPL A;  4HDV A;  5D4R A;  4EJV A;  2FBH A;  4KYW A;  2VC1 A;  4BH9 A;  1JE8 A;  5LHI A;  3FMQ A;  1BJA A;  3F8N A;  2QQB A;  3KEQ A;  4CO8 A;  2BGC A;  4PCQ A;  4UXN A;  1B9M A;  2XHK A;  3IRQ A;  4ZYE A;  2RDP A;  5F64 A;  2ZNY A;  4HOB A;  2HYG D;  1O3S A;  1U2W A;  1USS A;  1FBQ A;  3QP6 A;  4U7B A;  4IHS A;  1V3F A;  2OQR A;  3RPU A;  3JW4 A;  2L02 A;  2G9W A;  1KYZ A;  2JSC A;  4K2E A;  1LQ1 A;  1ZN2 A;  4UVB A;  2M8E A;  5A2Q K;  1B9N A;  4HF0 A;  3QPT A;  1HW5 A;  1YS6 A;  1SD7 A;  3WG9 A;  4ESJ A;  4KT5 C;  4F7Z A;  3KLO A;  1HKQ A;  1SFX A;  3DPL C;  3H3Z A;  5IT9 K;  4NB5 A;  4M6X A;  4A0Y A;  5JVT A;  4HA8 A;  3DXJ F;  3SQN A;  4WCG A;  1XD7 A;  3FWE A;  4IVN A;  1BIB A;  2FNP A;  5ICG A;  4BHP A;  1KYW A;  5JFR A;  2DQR A;  5L3B A;  1EH8 A;  5AIP A;  1C0W A;  1OR7 A;  3S2W A;  3W6J B;  5K1Y A;  1IUY A;  1R23 A;  4S04 A;  3P7N A;  5DD4 A;  1T6S A;  3L9F A;  3ROU A;  1J7K A;  4YG2 F;  2UWM A;  2YPR A;  4CHU A;  3F8F A;  1IXC A;  3HHH A;  2C6Y A;  4ENK A;  3BRO A;  1ZGA A;  2CQK A;  3GYH X;  1YW9 A;  4O6J A;  2R3S A;  1V4R A;  1UHW A;  1HKT A;  2XAF A;  2W25 A;  4Q47 A;  5ILS A;  4EM1 A;  3HOT A;  2HDC A;  1UCR A;  2JRT A;  3U1D A;  1OYW A;  2H94 A;  4LGW A;  5HVQ C;  4EQQ A;  1ZG1 A;  2JZY A;  2P7V B;  2CGP A;  1FBS A;  5FO5 A;  3E5X A;  2HQR A;  2ESH A;  5ILU A;  4A0X A;  3TGN A;  2WTE A;  5A2Q Z;  1R1V A;  1J9I A;  1YLF A;  2L4M A;  2O03 A;  2VOO A;  1XN7 A;  1VTN C;  2HYF A;  4XRF A;  1HBX G;  1S6L A;  1YO5 C;  3I64 A;  2ZO4 A;  4HLY A;  1KGS A;  3GZ5 A;  3HTU A;  3V7R A;  3FZV A;  2R7F A;  3L2C A;  5LHG A;  3RKX A;  2KKO A;  2OU2 A;  2O8X A;  3KLN A;  1E2X A;  1ZAO A;  4Y17 A;  2STW A;  4U0W A;  3CO6 C;  5L3E A;  1LEB A;  1F5T A;  5CYV A;  3N4M A;  2GXG A;  3IKT A;  4OOI A;  2DPD A;  4XSX F;  3NRV A;  2BEO A;  3SZT A;  3CLO A;  4HV6 A;  5HLH A;  2XAJ A;  1U3E M;  4EGZ A;  5BOX A;  4PDK A;  4RB0 A;  3SFZ A;  3T5X A;  2OQG A;  3P9K A;  4A5M A;  1R7J A;  3ABU A;  4I0B A;  5K5O A;  2F2E A;  3EUH A;  2EFQ A;  3JSP A;  4EV0 A;  2MA3 A;  5IT9 Z;  5ICC A;  1EV7 A;  1IN4 A;  3WGG A;  4KN7 X;  5HS8 A;  1L3L A;  1IW7 F;  2PJP A;  1Z91 A;  1LNW A;  3BJ6 A;  1ZYR F;  5CVR A;  3CJN A;  3WE2 A;  2NAZ A;  3ZN1 A;  2GIV A;  1FP2 A;  4IRG A;  1FWZ A;  2Z99 A;  1RUO A;  3ZN0 A;  1J75 A;  1O3R A;  4G94 A;  2CO5 A;  3REO A;  1FYL A;  2X0L A;  3TDZ C;  3LA2 A;  1S3J A;  5E1Z B;  3J80 Z;  4EJT A;  2G7H A;  1P92 A;  2DK8 A;  3WTW C;  1FP1 D;  1WQ2 A;  2KIU A;  4CYD A;  1QPM A;  4UVA A;  3FX3 A;  4YIF A;  4NQW A;  4FT8 A;  4U0V A;  5L3F A;  3WTS C;  4KFC A;  3WU1 B;  1UB9 A;  2VBW A;  4RGS A;  2DW4 A;  1K7A A;  1IRG A;  1BI3 A;  5K5R A;  5HDN A;  2K86 A;  1QZZ A;  2FNA A;  3LA7 A;  2F5C A;  2ZME A;  2RGV A;  3BOQ A;  1XCB A;  2IJL A;  1FNN A;  4UV9 A;  1ZAR A;  2MH2 A;  2DQL A;  3ZMS A;  5BQT A;  1HST A;  3C18 A;  3R61 A;  2F5E A;  1XGN A;  3R4K A;  3WTZ A;  3O6B B;  4U7D A;  1KA8 A;  3HHG A;  3CO7 C;  1G4D A;  4GXO A;  1KQ8 A;  1O3Q A;  2FQ3 A;  1SAX A;  2IRF G;  1HW2 A;  1WKM A;  1R5G A;  3K0L A;  2Z33 A;  4LD5 A;  5FFZ A;  2YU3 A;  2QVO A;  4Y13 A;  1U6G A;  4ZYH A;  1W4M A;  4O3M A;  1T38 A;  3FXQ A;  4RB3 C;  4IJA A;  1W7P B;  1KU7 A;  3BZ6 A;  4BQA A;  3GXO A;  1GVJ A;  5BMZ A;  1YW7 A;  3WGH A;  2KJB A;  3B73 A;  4EMS A;  4BXU A;  3ZP5 A;  3KFW X;  2IVM A;  2D2W A;  2PFB A;  2PQ8 A;  5HLG A;  3ULQ B;  4XLN F;  3ZMZ A;  4H0E A;  1X3U A;  3KP4 A;  2GA1 A;  3IWZ A;  5E8I A;  1LJ9 A;  2RQP A;  4WF2 A;  4HX7 A;  1R00 A;  5KK1 A;  4E70 A;  1QBJ A;  2K27 A;  4HAM A;  4OIQ F;  3TO6 A;  4U0Y A;  5E1W A;  2B0L A;  1D8J A;  4LK1 F;  3G73 A;  1AWC A;  3IKV A;  2WWY A;  1R5H A;  3K2Z A;  3SZP A;  3TQN A;  2QZ8 A;  3GVA A;  1R36 A;  4O5V A;  2RKH A;  1G3S A;  3EET A;  5D5W B;  3I4P A;  2COM A;  5DDG A;  1OYY A;  3BP8 A;  5L3C A;  1TTY A;  2W57 A;  1OMI A;  5H20 A;  1XB4 A;  4EGY A;  1FLI A;  2O61 A;  2DAO A;  2EFN A;  4HDU A;  3ABT A;  2FSW A;  1SMT A;  3RI4 A;  1D3Y A;  3LST A;  2X4H A;  1R1T A;  4WX9 A;  4XLP F;  2K7L A;  1TW2 A;  5ICF A;  1T98 A;  2FU4 A;  3LFK A;  2XGX A;  1PUE E;  4A0Z A;  2PG4 A;  1CF7 A;  1R58 A;  1LDJ A;  4MQV A;  4NHJ A;  3F6O A;  1G3Y A;  3F22 A;  1ZLK A;  2ACJ A;  3P9C A;  4P96 A;  3MWM A;  4PZJ A;  1XCV A;  4HX4 A;  1XGS A;  2CYY A;  2HWV A;  1BM9 A;  1XSD A;  1Z05 A;  2DT5 A;  4HQM A;  4I0A A;  3BJA A;  3CUO A;  1JHH A;  1ZHF A;  3ML6 A;  2ZKZ A;  3K69 A;  4RS8 A;  4N9I A;  1P4X A;  5LEK A;  3GFL A;  1U8R A;  2VBY A;  1IXR C;  2BBY A;  3B02 A;  2R7D A;  3F21 A;  2A5Y B;  3GEZ A;  1I1S A;  1T2K A;  5BPI A;  2P7C B;  4I7H A;  3PQK A;  3O2P E;  4I02 A;  5CVU A;  3RTR A;  4L9V A;  3GO5 A;  1MD0 A;  5J8F A;  2L01 A;  3E97 A;  5FLX K;  2OZ6 A;  5FLX Z;  1Z7U A;  4BHB A;  2VE8 A;  3EYY A;  3V8J A;  2K4J A;  2ISY A;  4L9N A;  5D8K B;  4YII A;  3I59 A;  2PN6 A;  3K1N A;  4ON0 A;  2P5L C;  2E1C A;  2DI3 A;  4EM0 B;  1LDD A;  2EFP A;  2VT3 A;  2WC2 A;  4A5N A;  2E1N A;  3U2R A;  2EV6 A;  2IA1 A;  2A6H F;  4JBA A;  2RC4 A;  4KIF A;  2Z3Y A;  3GX4 X;  4R79 A;  2L3D A;  3KP6 A;  1O3T A;  2UZK A;  3BWG A;  2ELH A;  4CIC A;  1S8N A;  2VOD A;  1BN5 A;  2H6B A;  2Z9O A;  5J8C A;  1T0F A;  5FB2 A;  4TV7 A;  3JTH A;  1MJB A;  4CGZ A;  3I58 A;  2O0Y A;  4ASN A;  4M9S A;  5FGM A; 
#chains in the Genus database with same CATH topology
 4MQ9 F;  3OYB A;  1XX5 A;  3GTP J;  2AO9 A;  1IN6 A;  1B1B A;  2I5U A;  2ID3 A;  1J5Y A;  1Z6T A;  1K79 A;  2MH9 A;  5HNF A;  4XR6 A;  3R0A A;  2XF7 A;  2CUE A;  1EH6 A;  3WTV C;  1WGX A;  2XRO A;  1ETO A;  4CZC A;  2K9S A;  1SAU A;  2DT7 B;  1RI7 A;  3KP2 A;  1J59 A;  1P2F A;  4JK1 X;  2HPI A;  4KIC A;  4I76 A;  1U78 A;  3R0J A;  4BDZ A;  4A3K J;  4BNC A;  3OIO A;  1T56 A;  5FRO A;  3M8F A;  4QTR A;  3CC2 I;  2R92 J;  2V1X A;  1CQT A;  4M9X A;  2GBY A;  1TNT A;  4RLQ A;  1WJ5 A;  3F3X A;  4OMY A;  3PO3 J;  1D5V A;  2LKP A;  3FM5 A;  2DTR A;  2JK3 A;  2V9V A;  1KU9 A;  2EQR A;  2FD5 A;  2V9P A;  1IXS B;  4ZC3 A;  2LF7 A;  2ICW G;  4XSZ F;  3SZG A;  2LMD A;  1PYV A;  5E17 F;  1MZB A;  4KIG A;  3JR9 A;  1Y8Q B;  1IF1 A;  4AWX B;  1I3Q J;  1XGO A;  4L18 B;  1MDM A;  1AU7 A;  1W5C C;  2Y30 A;  1W7P A;  4ZYD A;  1Z77 A;  3MQ0 A;  2ECC A;  3FXO A;  2DFE A;  2F5V A;  5L3G A;  2DMQ A;  2UXN A;  4B8X A;  2BVM A;  2ADU A;  5M3F J;  4YIR X;  3I4M J;  1VQ6 I;  2PMU A;  5GPC A;  5FRN A;  1D5Y A;  3W2V A;  2WY8 Q;  3CJT B;  3IAS 2;  3DEE A;  4UVC A;  1TNS A;  2FXA A;  4E7Z A;  5FKM A;  2ESN A;  2K9Q A;  5CKT A;  2CG4 A;  2A3S A;  2ZB9 A;  4FQG A;  2LD5 A;  3PUF A;  1FZP B;  2RN7 A;  4J00 A;  3BDD A;  2GLO A;  1FMW A;  1TT5 B;  1WH7 A;  1FC3 A;  1HDP A;  2V79 A;  4RM3 A;  1XDS A;  2VKE A;  2DK5 A;  3WU0 A;  3WGI A;  2KMU A;  2LH9 A;  4DZJ A;  2FML A;  1B59 A;  2R93 J;  2Q0O A;  4IL6 C;  4A3G J;  4R1H A;  2FE3 A;  3H3U A;  1TWG J;  3TDU C;  3SDB A;  4A6D A;  1STZ A;  3BTL A;  1HLV A;  1K61 A;  5LBQ A;  2Z16 A;  1UST A;  2I10 A;  3VB2 A;  3CDL A;  1ONV A;  5E1X A;  2ZXJ A;  4HNV A;  1LDK B;  2JSP A;  1TL8 A;  4M71 A;  1YG2 A;  2RQQ A;  2XB0 X;  5EDN A;  2QBY B;  3IWF A;  1DGW Y;  1E0E A;  2Y0M A;  4M6Y A;  2K9N A;  2KQR A;  2QSF X;  1B72 B;  1W1W E;  3PM1 A;  1S7A A;  3H9J A;  2ZBK A;  2EJR A;  4N0B A;  4XOT A;  2CWE A;  1ITY A;  3C2H A;  3BTJ A;  1E3H A;  1YW8 A;  1TBX A;  1ZRC A;  4V19 K;  3GFI A;  2F4M B;  5LGU A;  5HOO A;  1QGP A;  2LKX A;  1V54 H;  4WXC A;  4IXA A;  3M3Y J;  1LKX A;  3OS2 A;  4HV5 A;  1FTT A;  2QEN A;  4N9H A;  2KIF A;  3QPL A;  4CSW A;  2P6T A;  4B44 A;  1Z1D A;  2NXN B;  3GTK J;  2JMW A;  3QAH A;  2Y75 A;  3EUK L;  2E2H J;  3BJO A;  1FPQ A;  3W2A A;  2YX7 A;  3JRI A;  3A2K A;  2YX4 A;  4GCV A;  5TGT A;  4GYI A;  3HYI A;  2JJ7 A;  4MEY F;  3IUO A;  3G1L A;  4PSX A;  2EIJ H;  2JTV A;  4CYC A;  2QLZ A;  2HU9 A;  3H3V K;  3T1B A;  2LY9 A;  3GWZ A;  3HL2 A;  3L2R A;  2O3F A;  5DCM B;  2QEX I;  4OIO F;  1IRZ A;  1PP8 F;  1UMQ A;  3H5N A;  1A5J A;  3K4C A;  1WJD A;  3FMS A;  1ZH5 A;  2BW3 B;  4RB2 C;  2PI0 A;  1K78 B;  5CVV A;  2M34 A;  1TWH J;  2GQQ A;  3PSI A;  2P8T A;  1D8K A;  2DO7 A;  3MZ8 A;  2CW7 A;  2FF4 A;  5CLS A;  3CD6 I;  2RNG A;  1IN8 A;  2CH0 A;  3IAM 2;  2X1C A;  2KRF A;  2E7W A;  1BL0 A;  2KT0 A;  2L54 A;  1XSX A;  1IUF A;  3LQR A;  2KHM A;  2ZFW A;  4HX8 A;  1GVD A;  2LTP A;  3G3Z A;  2QUF A;  3J7Y J;  4DNC A;  5ICE A;  1O57 A;  1GXP A;  4PJJ A;  4ITV A;  3Q0V A;  1BIA A;  2Y31 A;  2JA5 J;  1JHF A;  3CUQ C;  9ANT A;  4I2O A;  1NG6 A;  3DEU A;  5LRR A;  1K83 J;  4NDL A;  2WV0 A;  2E19 A;  3WOD F;  2HYJ A;  1RZ4 A;  3V8L A;  2RV8 A;  5IOY A;  2E1M C;  2A61 A;  2A6E F;  3BCB A;  4UHT A;  2AS5 F;  3ZMT A;  4CZZ A;  5EF6 A;  3UNG C;  3S3O A;  2HQN A;  3E6D A;  4MIM A;  3VYT B;  4A69 C;  1D0Y A;  2DYS H;  1MSF C;  3GZN B;  4DJA A;  3MAJ A;  4L0Z B;  3PNY A;  5HS9 A;  2A07 F;  3H0D A;  2WBM A;  3CC4 I;  5J1Y A;  1SD4 A;  3V4G A;  3S2D J;  1KQ9 A;  1FY7 A;  3BQZ A;  2HKO A;  1FOK A;  2JUG A;  4LG0 A;  1R9T J;  2NVU B;  3KP5 A;  4R8H A;  3LOC A;  1CGP A;  3CME I;  4C2T A;  2X6O A;  3CC7 I;  2P6S A;  4EJO A;  3DKX A;  1X1C A;  3FF5 A;  3K4N A;  2B7E A;  2EFW A;  3BG6 A;  2TDX A;  5GTH C;  5K7F A;  4M3B A;  2M4K A;  2XAS A;  4AD9 A;  4BHC A;  2ETH A;  4Y7N J;  3BG9 A;  5KNL A;  2NS7 A;  2D45 A;  4UV8 A;  5K7Z A;  3GUD A;  4CCL A;  3K70 C;  4UY8 I;  4CCK A;  3JRF A;  2IXS A;  1DU0 A;  2CFX A;  3HRT A;  2P4W A;  2R5Y A;  4HQE A;  4B43 A;  5B1B H;  2NVY J;  1WPK A;  3SHF A;  1W0U A;  2X6W A;  4FE7 A;  5LGT A;  2F5F A;  3F0C A;  4MGR A;  4A3M J;  4HF1 A;  4KDP A;  5E20 A;  2GAU A;  2EWN A;  3S93 A;  5J1R A;  2EK5 A;  2CW0 F;  4HRI A;  2DXI A;  3E6C C;  2LC2 A;  4FX0 A;  1ZRD A;  3HSR A;  3MFK A;  3S3N A;  2IP2 A;  3CDH A;  3FXJ A;  3I59 B;  3Q3S A;  2CQN A;  2V1U A;  3J7Z I;  2DMT A;  1MBJ A;  2WAE A;  1WCM J;  3QOE A;  5F1R A;  1SC7 A;  1JUS A;  2K02 A;  3IRR A;  4LIU A;  3C2G A;  2O5R A;  1YOV B;  2VPR A;  1LE8 B;  1WH5 A;  3RKY A;  5LRS A;  1ZGJ A;  4ESF A;  1KU2 A;  5DM7 F;  3CCJ I;  2R4G A;  3V8K A;  3S1M J;  1E3P A;  2X48 A;  5D8L B;  2L7F P;  4E7L A;  3QRF F;  4MLO A;  3VEP A;  1P4W A;  2HOE A;  1JGS A;  5KAF C;  2LK2 A;  3OR2 C;  3HUG A;  4BS9 A;  1P6R A;  1X1P A;  4ANJ A;  3H35 A;  2CW8 A;  1YTY A;  2KPM A;  1R5I D;  3JAM Z;  4NNJ A;  4YFX F;  2DFI A;  3DF8 A;  1PUF A;  1TZL A;  3FXU A;  4DYR A;  2Y9Z A;  4PSW A;  2VE9 A;  1WSU A;  1DPU A;  3PFI A;  2VKD A;  3RKW A;  2A05 A;  3AG4 H;  2YR2 A;  2EV0 A;  2HR3 A;  4XQF A;  5EGO A;  1LFB A;  1G3T A;  1K6Y A;  3JRE A;  3K1P A;  1Z6R A;  4IO9 F;  3FDY A;  2AXL A;  4OU0 A;  2ISZ A;  4HZF A;  5D6F A;  2NS0 A;  2Y9Y A;  1V55 H;  2JT1 A;  2MG4 A;  2NOG A;  1S29 A;  1UHS A;  3BR5 A;  3VYS B;  1Y0U A;  1BR1 A;  4L9J A;  3G2B A;  2W7N A;  4II3 A;  2LSO A;  4XID A;  4BBS J;  3CF2 A;  1CF7 B;  2V6C A;  4DZP A;  2IS2 A;  2MLG A;  3E5Q A;  2VUM J;  1QQI A;  4D5C A;  1TLH B;  2VPL A;  3M9A A;  5LEJ A;  2CS3 A;  2UXX A;  2QM3 A;  5F0F A;  4NUB A;  5EZG A;  2M87 A;  4KIT B;  5CQG A;  4MEX F;  2ZJ2 A;  2LF8 A;  1GT0 C;  3OS0 A;  1FYK A;  1SAN A;  2X1D A;  1VFC A;  3BY6 A;  4HF2 A;  2QF7 A;  2VQC A;  3G71 I;  2FUG 2;  5H6R A;  1Z3Y A;  4DBR A;  2B63 J;  1FYM A;  3B6A A;  4L0Y B;  1FOW A;  2YU9 J;  3BPV A;  5CVI A;  3VSL A;  3CCL I;  3CUQ A;  3HJE A;  2LBF A;  1BR4 A;  1O4X A;  3ESW B;  1ZQ3 P;  2CSO A;  3BTC A;  3TP0 A;  3QQA A;  3AAF A;  5F08 A;  2BE5 F;  5ILV A;  4AVP A;  3K10 A;  1OPC A;  1ZR2 A;  3DV8 A;  3ISP A;  3FMR A;  3S16 J;  3CJQ B;  2F5D A;  4BE1 A;  1HCR A;  3CCV I;  4HG2 A;  5IYC J;  4PFP A;  3OYI A;  3P9I A;  2CJJ A;  1ETX A;  3RYP A;  1V5F A;  1U5T B;  3X2Q H;  1T8I A;  4ZH4 F;  5F6F A;  2CRG A;  1JUP A;  1MH4 A;  2IW5 A;  1RRJ A;  3HOW J;  1OYI A;  3Q9S A;  4IOC F;  1Y39 A;  4PK4 A;  4BAY A;  3BR1 A;  4LMY A;  3E3V A;  1QU3 A;  2M45 A;  1NHA A;  3NQO A;  2E7X A;  1S7O A;  3F9K A;  4RA2 A;  1D1A A;  2P5K A;  1I5Z A;  5EZH A;  5DTD A;  4KJZ A;  4H4K C;  5FD5 A;  2DA2 A;  2L4A A;  2VIX A;  5D5V B;  4NC8 A;  2FX0 A;  2X51 A;  4YFN F;  4A3I J;  1VQ8 I;  3NWT A;  1QA6 A;  3R60 A;  2DA6 A;  2DT6 A;  5D4S A;  5M5W J;  2XGD A;  5F04 A;  2JPC A;  1IGN A;  1ULY A;  1ZG5 A;  1JKR C;  2VQL A;  2ZJP F;  4BDY A;  4ETS A;  4F3Q A;  5HLI A;  1HXD A;  5GAH J;  3BG5 A;  4BY1 J;  3IL2 A;  1X58 A;  1RIO H;  5DUI A;  3FBI B;  2M7A A;  1TWA J;  4ZZD A;  3RIR A;  1SFU A;  1NK2 P;  1X1D A;  1IAW A;  3CF5 F;  1B72 A;  3TW7 A;  4OMZ A;  4RGX A;  2ZME B;  1HDD C;  4L9T A;  1VQ4 I;  4BUP A;  5C3E J;  3PIP F;  1QVU A;  5TRD A;  4C2U A;  4C3H J;  3HOY J;  2LNB A;  4PGH A;  3D5L A;  4XLA A;  2F48 A;  3QPH A;  2L2O A;  5B1A H;  2I8D A;  1J2X A;  3F8C A;  1F4K A;  2R7V A;  4I09 A;  1UFM A;  2Y0S A;  2HKX A;  5JI6 A;  2CQQ A;  1U5T C;  2L9N A;  3N97 A;  1B6A A;  5J4Y A;  2KZG A;  4M74 A;  4LLL A;  2A68 F;  1JJ6 C;  1SVL A;  2IT0 A;  5HDG A;  1V5G A;  2RRE A;  4P9F A;  3RDI A;  1D1B A;  1Z9C A;  2BXY A;  1I1G A;  3HSE A;  2XRN A;  4HST A;  3NWS A;  1L0O C;  3ABL H;  4U88 A;  4Y15 A;  5ERI A;  3RPQ A;  3KYL A;  2M7B A;  3JTG A;  1BBY A;  2Q2E B;  4XOP A;  4RDU A;  1SMY F;  2JPB A;  2PMZ A;  1RUN A;  4HSR A;  1PP7 U;  2VAS A;  3JRD A;  1XS9 A;  4F52 A;  2PMH A;  1W5S A;  2GXB A;  4IZZ A;  2QWW A;  3VYR B;  3JSO A;  1IZ1 A;  1AKH B;  1FT9 A;  3VWB A;  2MD5 A;  1K78 A;  3A1Y A;  2BXZ A;  5EG0 A;  3DCF A;  4M3D A;  3DTI A;  2MC3 A;  5E8G A;  4PFO A;  2Y2Z A;  2LYC A;  4YEJ A;  5DD8 A;  2VC0 A;  3RCO A;  4ENM A;  2M30 A;  3KET A;  2OD5 A;  3IHU A;  4RAF A;  1B8I A;  5H2F C;  5EGO B;  5IY5 H;  3QYE A;  3IH3 A;  3HM5 A;  2E1O A;  2X6Y A;  2FEZ A;  4M6V A;  3LSG A;  3HC7 A;  3TOB A;  1OCO H;  3L2W A;  2QCO A;  3KP7 A;  2LLK A;  4XNF A;  4JP0 A;  3CLQ A;  4M3F A;  3QYF A;  5IT3 A;  3IP4 B;  2ZNZ A;  3ECH A;  3I0T A;  1XPX A;  2QQA A;  2LOO A;  1X3Z B;  2FRH A;  4D9J A;  2K3F A;  2ZFU A;  5FFX A;  2PBI A;  5HS7 A;  3ZQ7 A;  1MDM B;  1LFP A;  3I53 A;  4BJ5 C;  3HIF A;  5JHU A;  1HA8 A;  4KA4 A;  3BR6 A;  4J19 A;  2OJE D;  2KLO A;  3M8J A;  3M1C A;  2EZK A;  5LGN A;  3HPG A;  4PJN A;  2DA7 A;  4I01 A;  2L9V A;  4QSH A;  5DCF A;  4DW6 A;  5HDK A;  3V7S A;  2IA2 A;  1RR7 A;  4E7S A;  1SVO A;  4DOZ A;  5E3M A;  4A6E A;  1P7I A;  3DPT A;  2OZU A;  3LSJ A;  2H6C A;  1PJR A;  4P55 A;  4FHT A;  4A3F J;  1QZY A;  4HPQ A;  2Y48 A;  2NVQ J;  4FAS D;  3JRG A;  2Q1Z B;  4AIH A;  2NNN A;  2IEK A;  1ODD A;  1EKE A;  4LK0 F;  3ZMV A;  1T33 A;  1O7F A;  3IC7 A;  1N77 A;  2E60 A;  4CDG A;  2ECB A;  3HOX J;  3RKQ A;  2XVC A;  4J01 A;  1RNL A;  3F8M A;  4IRI A;  3FKI J;  3WTX C;  5AIQ A;  1HOM A;  2R5Z A;  5BS6 A;  1FEX A;  2M2E A;  2VKH A;  3MD2 A;  2H1K A;  5F27 A;  1SD5 A;  2CFO A;  3GTL J;  3HRS A;  2KDZ A;  3CMY A;  2GA2 A;  5C4J J;  4KT6 A;  1R22 A;  2QQ9 A;  5DYM A;  3RJP A;  3CTA A;  4B3A A;  3NEU A;  5DM6 F;  4KIB A;  3EQL F;  1FIA A;  3GW2 A;  4MO7 A;  2DTZ A;  2DBB A;  4N4O B;  4IHW A;  1S72 I;  2OBP A;  2DU9 A;  3DTE A;  4AU7 A;  1BI0 A;  3OYF A;  2MBF A;  2ZJR F;  3BT9 A;  1LE8 A;  1D0X A;  2VXZ A;  2XV4 S;  2DPU A;  1BI2 A;  3MZH A;  3RYR A;  3ERE D;  1MIJ A;  3K4J A;  2HXO A;  3OSF A;  1LPQ A;  1ENH A;  1DPR A;  2ZXI A;  3VOD A;  3HUG B;  5L3D A;  3LA3 A;  4IHV A;  1QPI A;  1T95 A;  3QOP A;  1KU3 A;  1MJA A;  3M1E A;  4ESB A;  3FXM A;  1MSE C;  1PVE A;  4B48 A;  4BQQ A;  3F23 A;  2X1E A;  1HSJ A;  3QOD A;  4B09 A;  4XLC A;  3GLX A;  3O3K A;  2E1M B;  2EA2 A;  5DCM A;  2TCT A;  1QO0 D;  1BC7 C;  4BE2 A;  1IDZ A;  4L5I A;  3FK7 A;  2GWR A;  1FX7 A;  2VQH A;  5LHH A;  2HEO A;  2XSD C;  3LQQ A;  2YS9 A;  4LFU A;  4BKX A;  3AG2 H;  4JOM A;  3OYG A;  1MKM A;  2D1V A;  3DKW A;  2FA5 A;  2P5V A;  5ED4 A;  3HOU J;  3ZOB A;  3H5R A;  4G6T B;  4GO1 A;  4M3G A;  2VON A;  4G6D A;  2MLK A;  3MEX A;  1MGT A;  1T0F C;  3OYJ A;  2BY3 A;  2D1H A;  5H6Q A;  2J5P A;  3TOA A;  3E6B A;  4FIS A;  3T8T A;  3I56 I;  1PDN C;  2ID6 A;  2KFD A;  2HDW A;  3COA C;  4BGD A;  2W85 A;  4D7N A;  1F1Z A;  4ZZL A;  2XDV A;  2HTJ A;  2PJR B;  2VT2 A;  4OAZ A;  1QHH D;  4BJT A;  5AON A;  2E5Z A;  1YI2 I;  1EH7 A;  3ZMD A;  4UUS B;  2E5N A;  3ECO A;  1W7P D;  2W00 A;  1VQP I;  3I54 A;  4KMU X;  2XAQ A;  1SD6 A;  1HQC A;  3KZY A;  1TWF J;  1IN5 A;  1N75 A;  4S05 A;  2W4S A;  1X2N A;  3WU2 C;  2LP0 A;  2VBZ A;  5FLM J;  2LR8 A;  1YQA A;  3BZC A;  3K4L A;  4G7Z F;  1B8I B;  2H27 A;  5CPR B;  1IDY A;  2NRA C;  2E36 A;  1JGG A;  3CUQ B;  1BOA A;  2LBF B;  3MCZ A;  2V9K A;  1MMS A;  3M8E A;  2EZL A;  2H09 A;  3FHZ A;  3QPS A;  1M1E B;  4UNO A;  4ZYG A;  2VOP A;  4DQ2 A;  3TL4 X;  4GRI A;  3H1C A;  2IPQ X;  3L00 A;  1R1U A;  2ZCW A;  4LLG F;  2LY1 A;  3VDX A;  2CQ7 A;  3IV5 A;  4GYG A;  4YFK F;  2ZSH B;  1WJA A;  3U9G A;  2X6X A;  1YX5 A;  1BJZ A;  1JKP C;  4KN4 X;  2Q8K A;  1YRN A;  4LG3 A;  1UAA A;  1XDU A;  2NOJ B;  2HQ5 A;  4XL9 A;  5CJ9 A;  1G3W A;  3MKL A;  4BYY A;  3ASO H;  2K4B A;  3FBN B;  4RAZ A;  5FD6 A;  1JKO C;  1ON1 A;  2MAB A;  3T8R A;  1REP C;  1I3A A;  4AM3 A;  1GHC A;  1SFO J;  1NTC A;  2CUF A;  2JQ7 A;  2EFO A;  3OL3 A;  1B4A A;  2DLL A;  5LLQ A;  5CVJ A;  4CCM A;  4D0P A;  3IH2 A;  4XN3 A;  2ZC2 A;  2VJI A;  2LRD A;  3J81 K;  3K9T A;  1MNE A;  1IO2 A;  1TQI A;  5JLX A;  1S9H A;  4ZYA A;  2DJN A;  2IAI A;  4XKB A;  3WE3 A;  1WWX A;  3WTY C;  4I98 B;  4XBF A;  3CP8 A;  3TED A;  3CCU I;  2WAF A;  3VFZ A;  3DLL F;  4PGG A;  4XON A;  4Q4Z F;  2J5O A;  3WTT C;  4Q48 A;  4ENN A;  4OIN F;  5EEH A;  3D1N I;  2VN2 A;  2W24 A;  1P9Q C;  2IS1 A;  2HS5 A;  1T39 A;  1MMA A;  2MYS A;  5J4V A;  5E3N A;  1IRF A;  4Y52 J;  4IF4 A;  5HOD A;  1FSH A;  4G9Y A;  2HZD A;  1Q1H A;  1FTZ A;  2HDD A;  2RVC A;  4EJU A;  1FOX A;  3M7G A;  2STT A;  4PUS A;  3EYI A;  1JUM A;  4AIJ A;  1RC9 A;  4E4H A;  1VF9 A;  1X2M A;  4BXX J;  4EEF G;  3FIS A;  1BC8 C;  1OKR A;  4LIV A;  3EDP A;  2QKM B;  2CQX A;  1AOY A;  1WRJ A;  5J6X A;  4B1R A;  5IYD J;  2K3P A;  1EF4 A;  2HFH A;  4HYE A;  2M5W A;  1F9N A;  2LDU A;  4LB5 A;  2FOK A;  3Q9V A;  3J81 Z;  1MJ9 A;  2KIS A;  5F0C A;  2XAH A;  2Q2E A;  3KE2 A;  1WI9 A;  3HKZ A;  2HZT A;  5K5Q A;  2IA0 A;  2X85 A;  4IKF A;  3PO2 J;  3TBI A;  3E6M A;  3Q5F A;  2XC7 A;  4XOR A;  5IP6 A;  4RGU A;  4LLN A;  2NYX A;  2XGE A;  2XGC A;  4P5O A;  1QHG A;  1LUJ B;  1A04 A;  1SFE A;  3LAP A;  5EG0 B;  2JA2 A;  4LIT A;  4Y3O A;  2KJC A;  4G6Q A;  4LB6 B;  4AYB A;  4HNU A;  2MGQ A;  3HTS B;  4KUM A;  4FX4 A;  1DU6 A;  4EVI A;  4XM3 A;  1XMK A;  2HOS A;  1TC3 C;  3LL7 A;  3A0B C;  3WHB A;  1J0R A;  1FSE A;  3GF2 A;  3CMA I;  3QU3 A;  2XAG A;  3ZMU A;  5KAI C;  2M0M A;  2A69 F;  4KMF A;  1VQK I;  3FM3 A;  4WK8 F;  4E7J A;  6PAX A;  5BPD A;  3TKY A;  3GZ6 A;  3BZK A;  4CXF A;  3GTG J;  2XIG A;  3V7C A;  2R7R A;  3OSG A;  2HXI A;  4OAY A;  1ETW A;  1DUX C;  3JRC A;  2EH3 A;  1WJF A;  4A12 A;  3KEO A;  2BV6 A;  4HLX A;  2PJR A;  2TRT A;  4C9Y A;  3S1N J;  2XKO A;  2JWT A;  4NC6 A;  3OL4 A;  5IP9 J;  2WAQ N;  2Z2S B;  1H9T A;  2BZT A;  2HVQ A;  2MD0 A;  3L7W A;  1O7L A;  5D6E A;  1YIT I;  2PLY A;  1N78 A;  1U0J A;  3I71 A;  5EEG A;  1G6N A;  3D0S A;  3H92 A;  2ME6 A;  3OYE A;  1U5T A;  2OA4 A;  4AID A;  3SXY A;  2AQE A;  1BI1 A;  3OS1 A;  3J7A O;  1XSV A;  2EV5 A;  1DP3 A;  3OOU A;  4OIR F;  3C7J A;  2BY0 A;  1I6H J;  3VSK A;  4Q5S F;  4QLC U;  2AQF A;  3OR1 C;  4MFE A;  4WWC A;  4IOA F;  4HBL A;  3F8B A;  4IHX A;  3S32 A;  1TT0 A;  4IX7 A;  2D5V A;  2G7U A;  1JXS A;  3QU6 A;  1ZRF A;  3KZI C;  2HNH A;  3GFM A;  3LSI A;  4G7H F;  4MTE A;  2QBY A;  4HW0 A;  4JX6 A;  3QP5 A;  1QNT A;  4GGG A;  1VQ5 I;  1HW1 A;  1H9G A;  1ON2 A;  4FE4 A;  4P9U A;  1KQ0 A;  5DUK A;  1LB2 A;  1YX3 A;  4BU2 A;  2EA4 A;  1X1B A;  3LWF A;  4IPA A;  3GTO J;  3PSF A;  2KIM A;  3MZY A;  1P4A A;  3UKG A;  2DYR H;  1XGM A;  5E18 F;  2JVH A;  3LAJ A;  4C2M J;  1OFC X;  4WXH A;  2ELK A;  3TP3 A;  2R7W A;  4L5J A;  4G12 A;  1P7J A;  3DQV C;  1DP7 P;  2FJ1 A;  3U21 A;  2NNY A;  1ZEL A;  2JUC A;  4M9Z A;  2M4G A;  1IV8 A;  3F72 A;  3E5U A;  4UUV A;  2EB7 A;  3BTI A;  3DPU A;  1VQN I;  4A2U A;  1R71 A;  2XUB A;  2HI3 A;  3G1O A;  1WJC A;  4LJZ F;  3NAU A;  4MTD A;  2EZI A;  3R6S A;  3ZCO A;  1GV2 A;  1ZRE A;  2BW3 A;  4MNU A;  4OIP F;  1DDN A;  4M72 A;  1ZLJ A;  4QPO A;  3CCS I;  3KP3 A;  3CJR B;  1LVA A;  5FRM A;  3VYU B;  1TQP A;  2YSR A;  2WV1 A;  1R49 A;  1OR7 C;  1FIP A;  3Q0W A;  4BQN A;  4V2G A;  4RB1 A;  1H0M A;  1ZR4 A;  2EBI A;  1YFH A;  3OIQ A;  1Q1V A;  3RPU D;  4CH7 A;  5D5U B;  3TO9 A;  2GZW A;  3W6K B;  3KCC A;  4UB6 C;  5KVR A;  2ZSI B;  2Z5U A;  2GXA A;  2JA8 J;  2L7K A;  2WAD A;  4E6K G;  4C3J J;  3C3W A;  1EA3 A;  3HOS A;  1FOY A;  3EUA A;  1W36 C;  2V6E A;  1MBG A;  2EPF A;  3SYT A;  3BPX A;  4KNY A;  3KZZ A;  3J80 K;  2AHQ A;  3TMO A;  3CCE I;  1YS7 A;  1UJ8 A;  1TP4 A;  2V1D A;  1MBH A;  4RGR A;  1K6O A;  2RNJ A;  5GAG J;  1UHM A;  3L09 A;  4PJL A;  2CUZ A;  1BA5 A;  2M1B A;  3DFG A;  2PEX A;  3F6V A;  3U1K A;  5F1J A;  1R6R A;  1YHQ I;  2K85 A;  4UUS A;  1NK3 P;  4AIK A;  2FBK A;  4JQF A;  3HRM A;  4MHG A;  4F91 B;  3TO7 A;  1HKS A;  3I5U A;  3C2B A;  3S3M A;  2W84 A;  5HLT A;  3DBR B;  3OV8 A;  4G7O F;  4LG0 B;  3K70 D;  3GFJ A;  3WTU C;  3OYC A;  1XMA A;  1TW3 A;  3HSF A;  3FXR A;  5DV5 A;  4RLF A;  2BYV E;  2OAZ A;  3OYH A;  5E3L A;  1GXQ A;  1YIO A;  1TQM A;  1GV5 A;  4EM2 A;  1BOB A;  1JTY A;  4FTH A;  1A36 A;  3E7L A;  5D5X B;  3SJM A;  3P5J A;  1I6X A;  2FBI A;  3CZ6 A;  3C1D A;  1WFX A;  2LVS A;  1NH3 A;  4M3E A;  3VOE A;  1A31 A;  3A03 A;  1FBU A;  3RZO J;  1IN7 A;  4XK4 A;  3ELK A;  2G0E A;  3CDI A;  4M73 A;  3H0G J;  3T0Y A;  4D5F A;  2FMY A;  3SEQ A;  4QWQ A;  1S7E A;  1YJW I;  4IEJ A;  2HGC A;  2HTS A;  3ABK H;  2QYO A;  1YRN B;  4RAY A;  5TJJ A;  1D1C A;  4EJW A;  2VL8 A;  2ZXH A;  4Z2Y A;  2CV1 A;  2DA3 A;  5BNG A;  3MMY B;  3OYD A;  2QGU A;  3JCU C;  1Y8R B;  2VBX A;  1YYV A;  3LMM A;  1E17 A;  4IHT A;  1OCP A;  1W5T A;  3HZJ A;  2XKP A;  4AYB N;  4G8X A;  4IRH A;  3HRU A;  4L5E A;  4X1E A;  3OOP A;  5B5E C;  3KPH A;  4ENJ A;  2HVS A;  2O6G E;  3JAM K;  3OYA A;  3PQJ A;  4WXD A;  3DP7 A;  3K1M A;  2BHZ A;  1I27 A;  5DEQ A;  1LEA A;  1ZG3 A;  5JR3 A;  3FIW A;  4XRM A;  4HDV A;  2HPM A;  3ZPL A;  5D4R A;  1E3O C;  3CQZ J;  5J40 A;  4EJV A;  3S14 J;  2FBH A;  3BR2 A;  4KYW A;  1ETY A;  2VC1 A;  2RAE A;  4BH9 A;  5IOZ A;  3RSN A;  1JE8 A;  3I9V 2;  5LHI A;  3FMQ A;  3JRB A;  1BJA A;  3F8N A;  2QQB A;  3KEQ A;  4CO8 A;  2BGC A;  4PCQ A;  4UXN A;  1B9M A;  2XHK A;  4NC7 A;  2R7U A;  3IRQ A;  4ZYE A;  2E35 A;  2L9R A;  2RDP A;  1OCC H;  1VQM I;  5F64 A;  3IH4 A;  5FKO A;  2ZNY A;  4A3B J;  2O9L A;  3MKZ A;  2KP6 A;  1LVK A;  4HOB A;  2HYG D;  5M5X J;  2COB A;  4F93 B;  2CMP A;  1O3S A;  2A6T A;  1U2W A;  4PJ0 C;  1USS A;  1FBQ A;  3QP6 A;  2QKL B;  4U7B A;  4IHS A;  1W0T A;  1V3F A;  1MMN A;  2OQR A;  2XSJ C;  3RPU A;  3JW4 A;  2L02 A;  2QSH X;  1KYZ A;  2G9W A;  2WAQ A;  3DKY A;  2JSC A;  1VI0 A;  4K2E A;  1UZC A;  3AG3 H;  1ZN2 A;  2R0Q C;  1LQ1 A;  4UVB A;  2M8E A;  1MMD A;  5A2Q K;  1B9N A;  4HF0 A;  1QVT A;  1D0Z A;  3QPT A;  1HW5 A;  1YS6 A;  4A3L J;  1SD7 A;  4N4N B;  2MW8 A;  3A01 B;  3WG9 A;  4ESJ A;  4KT5 C;  4F7Z A;  3KEY A;  3KLO A;  1HKQ A;  3D5S C;  1SFX A;  3N05 A;  3FKJ A;  3DPL C;  4IHY A;  3H3Z A;  4A3C J;  2DFF A;  5IT9 K;  3RZD J;  1KON A;  2Y0S N;  4NB5 A;  4M6X A;  1FMV A;  1VQL I;  4A0Y A;  2CUJ A;  5JVT A;  2VI6 A;  2IGK A;  4HA8 A;  2K9M A;  2GIZ A;  3DXJ F;  1OCT C;  3SQN A;  3CES A;  3A4C A;  3HOZ J;  4WCG A;  1XD7 A;  1U9N A;  3LSH A;  3FWE A;  1BW5 A;  2BHY A;  4IVN A;  1F36 A;  2R7Z J;  2K40 A;  1BIB A;  2O8K A;  2FNP A;  3GTJ J;  1QZE A;  2LFB A;  5ICG A;  4BHP A;  1KYW A;  3G4S I;  5JFR A;  2NVT J;  1X4P A;  2DQR A;  1A35 A;  5L3B A;  1EH8 A;  3FHN A;  5AIP A;  1C0W A;  1OR7 A;  3S2W A;  3W6J B;  5K1Y A;  1IUY A;  1R23 A;  3BQY A;  4C30 A;  5B66 C;  5LFA A;  2DCE A;  4S04 A;  2KRC A;  3P7N A;  4DIQ A;  1S5L C;  4LOC A;  1A6I A;  5DD4 A;  4UUT A;  4W97 A;  1T6S A;  1GDT A;  1XG1 A;  1OIS A;  3L9F A;  3LSK A;  3ROU A;  1XMX A;  2L7Z A;  2P0W A;  4QPQ A;  1J7K A;  4YG2 F;  2L0K A;  3S8P A;  2OC6 A;  3S15 J;  2UWM A;  5JLW A;  1R4N B;  3I55 I;  1VND A;  2BOL A;  2YPR A;  4CHU A;  1MBF A;  3F8F A;  3ZXS A;  1IXC A;  3HHH A;  2C6Y A;  1MND A;  2R7T A;  4ZTF A;  1OJL A;  3BRO A;  1ZGA A;  4ENK A;  1LFU P;  5F0H A;  1OCZ H;  3ZQG A;  2CQK A;  3GYH X;  2PX9 A;  1YW9 A;  4O6J A;  1F43 A;  2R3S A;  3OYL A;  1V4R A;  2XPV A;  1UHW A;  1HKT A;  2VLA A;  2XAF A;  2W25 A;  4Q47 A;  5ILS A;  1RKW A;  1WHU A;  3FK6 A;  4NQW B;  4I6Z A;  4EM1 A;  3HOT A;  4A3E J;  3DWL E;  3EUH C;  2HDC A;  1ZGW A;  1UCR A;  2JRT A;  3U1D A;  1OYW A;  3EPZ A;  2H94 A;  3HG9 A;  3ZQF A;  4A3J J;  1YJN I;  1ETQ A;  4LGW A;  5HVQ C;  4XLE A;  1MBK A;  3Q0U A;  1JI8 A;  4EQQ A;  1ZG1 A;  2JZY A;  2P7V B;  2CGP A;  2K9L A;  1FBS A;  2JVG A;  5FO5 A;  5J1U A;  2QSG X;  3ASN H;  3E5X A;  2HQR A;  2ESH A;  5FKN A;  5ILU A;  3ABM H;  4A0X A;  3TGN A;  4AUX A;  4X6A J;  1G2H A;  1UEL B;  1I50 J;  2WTE A;  3MVP A;  1R1V A;  5A2Q Z;  2HOT A;  3DTK A;  1J9I A;  2K5C A;  2AXT C;  1YLF A;  1G59 A;  2L4M A;  1MBE A;  2UUZ A;  3OWT A;  2E71 A;  2O03 A;  2VOO A;  4YRV A;  1XN7 A;  1VTN C;  2DMP A;  2HYF A;  1Z0X A;  2XRL A;  3SEZ A;  4XRF A;  4XIC A;  2QQ8 A;  1HBX G;  1AKH A;  3GTQ J;  1S6L A;  1YO5 C;  3ZRG A;  2L9S A;  3BG3 A;  3I64 A;  4IQJ A;  2IBD A;  4NBQ A;  2ZO4 A;  4HLY A;  1KGS A;  3G6E I;  3GZ5 A;  3HTU A;  5C4X J;  5GAD J;  3PJR A;  3V7R A;  3FZV A;  1YE9 A;  3A0H C;  1OQY A;  1SFK A;  4I99 C;  2R7F A;  3L2C A;  2V1N A;  5LHG A;  3RKX A;  1W36 D;  3E0J B;  2KKO A;  2OU2 A;  2O8X A;  4YEL A;  3BG7 A;  3AFH A;  3KLN A;  4XLF A;  1E2X A;  1ZAO A;  4Y17 A;  1DGR M;  2STW A;  4U0W A;  3CO6 C;  5L3E A;  1LEB A;  1F5T A;  5CYV A;  3N4M A;  3HGY A;  4BJ6 C;  2GXG A;  2NVX J;  3IKT A;  2OCE A;  4OOI A;  1WI3 A;  2DPD A;  2Z1D A;  4XSX F;  3NRV A;  2BEO A;  3SZT A;  3W3C A;  3CLO A;  4HV6 A;  1Y6I A;  3OMY A;  5HLH A;  4XRS A;  1ACI A;  4BE0 A;  3S1Q J;  2XAJ A;  2HOA A;  1U3E M;  2H8R A;  4RB0 A;  4PDK A;  4EGZ A;  5BOX A;  3SFZ A;  4CCO A;  3T5X A;  4RAG A;  4DBQ A;  1FJL A;  2OQG A;  3P9K A;  4BEH A;  3J7A Y;  4A5M A;  2R7X A;  4CCJ A;  1OLT A;  2F4I A;  2DN0 A;  1Z7L A;  1R7J A;  2E34 A;  3ABU A;  4I0B A;  4XRS G;  3GCM A;  4ABZ A;  5K5O A;  2M9H A;  1U9O A;  2F2E A;  3EUH A;  4DGW B;  3BR3 A;  4RMN A;  1BR2 A;  3ZR8 X;  2EFQ A;  3JRH A;  4HNT A;  3JSP A;  4EV0 A;  2MA3 A;  3L1P A;  3PNV A;  3ZQC A;  3HBL A;  2O7O A;  5IT9 Z;  5ICC A;  3CCM I;  3SFI A;  1Y56 A;  3AKZ A;  1EV7 A;  1IN4 A;  2CU7 A;  3WGG A;  1WJB A;  2F4O B;  4KN7 X;  2GM4 A;  2A5W A;  5EJC A;  5HS8 A;  1L3L A;  4CA0 A;  1IW7 F;  2PJP A;  2DFH A;  1Z91 A;  4B4C A;  5IPA A;  1LNW A;  3BJ6 A;  1ZYR F;  3A02 A;  5CVR A;  4EAT A;  3MKW B;  2MFZ A;  3H9Q A;  3CJN A;  4X0G A;  3WE2 A;  2NAZ A;  2BY2 A;  2LY2 A;  3H36 A;  2GIV A;  3ZN1 A;  1FP2 A;  4IRG A;  1FWZ A;  2Z99 A;  1RUO A;  3ZN0 A;  2DA5 A;  1J75 A;  1O3R A;  1VQ7 I;  4G94 A;  4QIW N;  2X9D A;  3H9G A;  1H8A C;  1X4O A;  3L2U A;  1POG A;  2VJJ A;  5M5Y J;  2CO5 A;  3REO A;  2VJ4 A;  3FXK A;  1FYL A;  1RR8 C;  1ZKG A;  2X0L A;  3TDZ C;  1DQU A;  3OYM A;  3LA2 A;  1S3J A;  2VQG A;  5E1Z B;  3J80 Z;  4EJT A;  3HOV J;  2G7H A;  4ZJZ A;  2EIM H;  2UV1 A;  1P92 A;  1XTA A;  2IGN A;  2DK8 A;  3WTW C;  1FP1 D;  2IS4 A;  1WQ2 A;  1GUU A;  2KIU A;  4CYD A;  1QPM A;  4UVA A;  5FKL A;  2DA4 A;  4E7I A;  5EEA A;  4U87 A;  3FX3 A;  1VQ9 I;  4YIF A;  1WVR A;  4NQW A;  3ERM A;  2ME0 A;  3BR0 A;  4FT8 A;  4U0V A;  5L3F A;  3WTS C;  4KFC A;  3BCA A;  3WU1 B;  2XPU A;  1K4S A;  1UB9 A;  2ZJQ F;  4F55 A;  2VBW A;  1UG0 A;  4RGS A;  2DW4 A;  1K7A A;  1IRG A;  1T08 B;  3LNQ A;  3K4M A;  3CCQ I;  3ZQL A;  1BI3 A;  2F6C A;  5K5R A;  5HDN A;  2K86 A;  3OY9 A;  2DMU A;  1QZZ A;  5J47 A;  2FNA A;  3LA7 A;  2F5C A;  2ZME A;  2RGV A;  3BOQ A;  1XCB A;  2OPT A;  2GOX B;  2IJL A;  4ZDL A;  1FNN A;  4UV9 A;  1KZH A;  1ZAR A;  2MH2 A;  5LD2 C;  2DQL A;  3K7A J;  4AVZ A;  4FET A;  4W1U A;  3SDG A;  2DOF A;  3ZMS A;  5BQT A;  1HST A;  2QA4 I;  3GTM J;  3HKZ N;  1ERD A;  3C18 A;  5FLV A;  3R61 A;  2F5E A;  3VPR A;  3RQI A;  1XGN A;  3R4K A;  1YJ9 I;  3WTZ A;  3DBL B;  4C3I J;  3O6B B;  2ZXW H;  4U7D A;  2HQA A;  3S2H J;  3O8H A;  1KA8 A;  1JT0 A;  3LSM A;  3HHG A;  2XF5 A;  4Y4R A;  3CO7 C;  1G4D A;  3AG1 H;  4GXO A;  1KQ8 A;  5E79 C;  1O3Q A;  1Y0N A;  2FQ3 A;  3HPH A;  2IGO A;  4JX5 A;  3HB9 A;  3H5A A;  4ZDP A;  1SAX A;  4CUG A;  4II2 A;  2IRF G;  2WA0 A;  1EJ9 A;  1RKT A;  2OV7 A;  1HW2 A;  3CP2 A;  1WKM A;  1R5G A;  3K0L A;  2Z33 A;  1TWC J;  4LD5 A;  3TW6 A;  2WB1 N;  5FFZ A;  2KIQ A;  2YU3 A;  3UR3 C;  2QVO A;  4Y13 A;  3HDD A;  1U6G A;  1V5E A;  4ZYH A;  1YIJ I;  2PMZ N;  1W4M A;  4O3M A;  1T38 A;  5GP9 A;  5C44 J;  3OYN A;  3FXQ A;  4RBO A;  2W1O A;  4RB3 C;  1X19 A;  2ELJ A;  3HXL A;  2JA7 J;  1XC5 A;  4IJA A;  2ZME C;  2OTL I;  1VQO I;  4P1W A;  5DS9 A;  4Y33 A;  2N8G A;  1W7P B;  1KU7 A;  2BVL A;  4BEH B;  1H88 C;  3S17 J;  3BZ6 A;  3S1R J;  4BQA A;  3GXO A;  5TIS C;  3O8G A;  1GVJ A;  2KDO A;  1GLN A;  5BMZ A;  1YW7 A;  2MSY A;  3GLL A;  2M3A A;  3BLY A;  5J3L A;  3WGH A;  2KJB A;  5IYB J;  3JRA A;  3B73 A;  4EMS A;  4BXU A;  2BY1 A;  2DA1 A;  3ZP5 A;  1IC8 A;  3KFW X;  3KIO A;  1X1A A;  2IVM A;  2D2W A;  2PFB A;  2PQ8 A;  5HLG A;  4Z6Y A;  5K7H A;  3L2V A;  3DU5 A;  3ULQ B;  2LRE A;  4XLN F;  3ZMZ A;  3HEF A;  3ONQ A;  4XKW A;  4XLH A;  4H0E A;  1X3U A;  3KP4 A;  4HEA 2;  1IRX A;  1J09 A;  3PNT A;  3BC8 A;  2EZH A;  2VB6 A;  5KCM A;  2GA1 A;  1RET A;  2R5Y B;  3IWZ A;  5E8I A;  1IJW C;  1LJ9 A;  2RQP A;  3W2W A;  1Z67 A;  4UB8 C;  4WF2 A;  2WY7 Q;  4HX7 A;  1R00 A;  3LSR A;  2B9S A;  5KK1 A;  3G1M A;  4E70 A;  1QBJ A;  4B3X A;  2K27 A;  1HC8 A;  4HAM A;  2DJI A;  3KX2 A;  5GTI C;  4OIQ F;  2JA6 J;  3TO6 A;  4U0Y A;  5IP7 J;  5E1W A;  4KIS A;  2B0L A;  2LG4 A;  2XAU A;  3E1S A;  1D8J A;  3WHC A;  3K2A A;  4LK1 F;  4XN0 A;  3G73 A;  3IKV A;  1AWC A;  2WWY A;  1R5H A;  3K2Z A;  3SZP A;  3PUB A;  3TQN A;  2QZ8 A;  3GVA A;  1R36 A;  1ZTR A;  2L5Q A;  4S0H B;  4O5V A;  3ZGK A;  1I39 A;  2RKH A;  2DDA A;  4F92 B;  3WG7 H;  1G3S A;  5GAE J;  1HF0 A;  3EET A;  2R5Z B;  5D5W B;  3GBG A;  4BBR J;  3ZQH A;  2JN6 A;  3I4P A;  2COM A;  5DDG A;  1OYY A;  3BP8 A;  3I4N J;  5L3C A;  2XPW A;  1IG7 A;  1TTY A;  3LSP A;  3FXL A;  5JHF A;  2DOD A;  2W57 A;  2IGM A;  4MFD A;  1R4M B;  1OMI A;  5H20 A;  1XB4 A;  1MNM C;  3M4O J;  3K4K A;  4FCY A;  4EGY A;  1FLI A;  3MN2 A;  3PIO F;  2O61 A;  4ZDO A;  1SEU A;  3DEW A;  2DAO A;  2EFN A;  4HDU A;  3ABT A;  2FSW A;  1SMT A;  3CCR I;  3RI4 A;  1D3Y A;  4CYC B;  3LST A;  1MMG A;  4XMY A;  3QYB A;  1ETK A;  3HGG A;  2X4H A;  1R1T A;  4AC0 A;  4WX9 A;  4XLP F;  4GFB A;  2K7L A;  3A01 A;  1TW2 A;  2FQ4 A;  5ICF A;  2JRM A;  2R7Q A;  1T98 A;  2H1L A;  3NAR A;  2FU4 A;  3LFK A;  3AL0 C;  2LKS A;  2KZV A;  2XGX A;  4BY7 J;  5HNH A;  1ETV A;  2VJ5 A;  2WB1 A;  1RES A;  4RM2 A;  1PUE E;  4A0Z A;  3DBH B;  4BAC A;  4A93 J;  2PG4 A;  1UG2 A;  2W48 A;  1CF7 A;  1R58 A;  1LDJ A;  4A3D J;  1Y1W J;  4MQV A;  4NHJ A;  5KHD A;  3F6O A;  1G3Y A;  3F22 A;  1ZLK A;  3K4B A;  2ACJ A;  4ZTJ A;  1RPW A;  3P9C A;  4P96 A;  3MWM A;  4PZJ A;  2H8W A;  2XF6 A;  1XCV A;  4HX4 A;  1XGS A;  2V7F A;  1MW7 A;  2CYY A;  2HWV A;  3MKY B;  1BM9 A;  1XSD A;  2VXD A;  1ZK8 A;  1Z05 A;  4B47 A;  4BXF A;  2DT5 A;  4HQM A;  4JX4 A;  4I0A A;  3BJA A;  2GOM A;  3L2Q A;  3CUO A;  1JHH A;  2E2J J;  1ZHF A;  3ML6 A;  2NS8 A;  1ORK A;  3PFY A;  2ZKZ A;  1Z21 A;  2V4J C;  3K69 A;  4RS8 A;  2EIL H;  3K6G A;  4N9I A;  4BL0 B;  1QRY A;  3RQ4 A;  5E3O A;  1P4X A;  5LEK A;  3GFL A;  1U8R A;  2OCC H;  2VKV A;  4DYC A;  2VBY A;  1AA7 A;  2EIK H;  3CCY A;  3QWL A;  2FOW A;  1IXR C;  2BBY A;  3B02 A;  4D1Q A;  3OIP A;  4E7K A;  2OUM A;  1WJE A;  3GME A;  4XKC A;  2R7D A;  2XB5 A;  3KYD B;  2HVR A;  3I3L A;  3F21 A;  2A5Y B;  1NG7 A;  4PJM A;  3GEZ A;  5M3M J;  3DU6 A;  1I1S A;  1T2K A;  5BPI A;  3OYK A;  2P7C B;  4I7H A;  3PQK A;  2DOE A;  3O2P E;  4I02 A;  5CVU A;  3RTR A;  1JT6 A;  4L9V A;  3GO5 A;  1MD0 A;  5J8F A;  2L01 A;  3E97 A;  2OTJ I;  1JJ8 C;  4DYQ A;  4GDF A;  3B6C A;  4CCN A;  2YUS A;  5FLX K;  2M8G X;  2OZ6 A;  2CV0 A;  5FLX Z;  5FKK A;  1Z7U A;  4IQ4 A;  4BHB A;  2VE8 A;  3EYY A;  3KYC B;  5B3S H;  1H89 C;  3M07 A;  3V8J A;  2K4J A;  2ISY A;  2EIN H;  4L9N A;  5D8K B;  2E2I J;  1BW6 A;  4YII A;  3I59 A;  3ZQQ A;  1WZ2 A;  1A6Q A;  2PN6 A;  1K4T A;  3K1N A;  2DMN A;  4ON0 A;  2P5L C;  2E1C A;  2KRH A;  2IS6 A;  2DI3 A;  4EM0 B;  1Z3X A;  1SVM A;  2KL4 A;  5JVG F;  4OWR B;  3AL0 B;  4BQO A;  2MC4 A;  3ZQI A;  1LDD A;  1IV6 A;  1Y1V J;  2DDB A;  2EFP A;  2VT3 A;  2WC2 A;  2R7O A;  3D5R C;  4A5N A;  2E1N A;  1G8X A;  5GPA A;  2EV6 A;  2IA1 A;  4JBA A;  2A6H F;  3U2R A;  3DLA A;  2RC4 A;  4KIF A;  2Z3Y A;  3LFU A;  3GX4 X;  4V2F A;  4XKV A;  1JKQ C;  4R79 A;  2L3D A;  3KP6 A;  5EYR A;  1AHD P;  2L7M P;  1O3T A;  2W82 A;  4D7M A;  2UZK A;  3BWG A;  2P81 A;  2ELH A;  1PUF B;  4CIC A;  1JTX A;  1S8N A;  2Y69 H;  2DOA A;  1U8B A;  2VOD A;  1BN5 A;  2H6B A;  2Z9O A;  5J8C A;  1MH3 A;  1T0F A;  5FB2 A;  5CQE A;  3W6V A;  4TV7 A;  2R7S A;  2V26 A;  3JTH A;  1MJB A;  2CV2 A;  4E7H A;  1OCR H;  2OF7 A;  4CGZ A;  3CMM A;  1X3W B;  3I58 A;  2O0Y A;  4ASN A;  4JYK A;  2M0C A;  4M9S A;  3V42 A;  1APL C;  5FGM A;  5FJ8 J;  1N25 A;  3PL8 A;  1VZ0 A; 
#chains in the Genus database with same CATH homology
 4MQ9 F;  1IN6 A;  1B1B A;  1J5Y A;  1Z6T A;  1K79 A;  2MH9 A;  3R0A A;  1EH6 A;  3WTV C;  2XRO A;  1J59 A;  1RI7 A;  3KP2 A;  1P2F A;  4JK1 X;  4KIC A;  1U78 A;  3R0J A;  4BNC A;  3M8F A;  2V1X A;  4M9X A;  1TNT A;  3F3X A;  4OMY A;  1D5V A;  2LKP A;  3FM5 A;  2DTR A;  2V9V A;  1KU9 A;  1IXS B;  2LF7 A;  4XSZ F;  5E17 F;  1MZB A;  4KIG A;  1IF1 A;  4AWX B;  4L18 B;  1XGO A;  1MDM A;  1W7P A;  4ZYD A;  3MQ0 A;  5L3G A;  2UXN A;  4B8X A;  2ADU A;  2PMU A;  4UVC A;  1TNS A;  2FXA A;  2ESN A;  2CG4 A;  2A3S A;  1FZP B;  2RN7 A;  3BDD A;  1FC3 A;  2V79 A;  1XDS A;  2DK5 A;  3WU0 A;  3WGI A;  2FML A;  1B59 A;  2Q0O A;  4R1H A;  2FE3 A;  3H3U A;  3TDU C;  4A6D A;  1STZ A;  5LBQ A;  1UST A;  3VB2 A;  1ONV A;  5E1X A;  2ZXJ A;  1LDK B;  4M71 A;  1YG2 A;  2QBY B;  3IWF A;  2Y0M A;  4M6Y A;  1S7A A;  2ZBK A;  2EJR A;  4N0B A;  2CWE A;  1YW8 A;  1TBX A;  1ZRC A;  3GFI A;  5LGU A;  5HOO A;  1QGP A;  4WXC A;  4IXA A;  4HV5 A;  2QEN A;  4N9H A;  2KIF A;  2P6T A;  1Z1D A;  3QAH A;  2Y75 A;  3BJO A;  1FPQ A;  2YX7 A;  2YX4 A;  4GCV A;  4GYI A;  3HYI A;  4MEY F;  2JTV A;  2QLZ A;  3T1B A;  3GWZ A;  2O3F A;  5DCM B;  4OIO F;  1PP8 F;  3FMS A;  1ZH5 A;  4RB2 C;  2PI0 A;  1K78 B;  5CVV A;  2GQQ A;  2P8T A;  1D8K A;  2DO7 A;  2FF4 A;  5CLS A;  1IN8 A;  2KRF A;  2E7W A;  2L54 A;  3LQR A;  1XSX A;  2ZFW A;  4HX8 A;  3G3Z A;  2QUF A;  4DNC A;  5ICE A;  1O57 A;  1GXP A;  1BIA A;  1JHF A;  3CUQ C;  4I2O A;  3DEU A;  5LRR A;  2WV0 A;  3WOD F;  1RZ4 A;  3V8L A;  2RV8 A;  2A61 A;  2A6E F;  4UHT A;  2AS5 F;  3ZMT A;  4CZZ A;  2HQN A;  3E6D A;  3MAJ A;  4L0Z B;  5HS9 A;  2A07 F;  1SD4 A;  3V4G A;  1KQ9 A;  1FY7 A;  2HKO A;  1FOK A;  4LG0 A;  3KP5 A;  4R8H A;  1CGP A;  2P6S A;  4EJO A;  3FF5 A;  2EFW A;  2TDX A;  2XAS A;  4AD9 A;  4BHC A;  2ETH A;  2D45 A;  4UV8 A;  3GUD A;  2CFX A;  3HRT A;  2P4W A;  4HQE A;  3SHF A;  5LGT A;  2F5F A;  4MGR A;  4KDP A;  4HF1 A;  5E20 A;  2GAU A;  2EWN A;  2EK5 A;  2CW0 F;  3E6C C;  4FX0 A;  1ZRD A;  3HSR A;  3MFK A;  2IP2 A;  3CDH A;  3I59 B;  2V1U A;  5F1R A;  2K02 A;  3IRR A;  3RKY A;  5LRS A;  1ZGJ A;  4ESF A;  1KU2 A;  3V8K A;  5D8L B;  3QRF F;  3VEP A;  1P4W A;  2HOE A;  1JGS A;  3HUG A;  1P6R A;  1YTY A;  3JAM Z;  4YFX F;  2DFI A;  3DF8 A;  3FXU A;  2VE9 A;  1WSU A;  1DPU A;  3PFI A;  3RKW A;  2YR2 A;  2EV0 A;  2HR3 A;  1G3T A;  3K1P A;  2ISZ A;  1Z6R A;  4OU0 A;  2AXL A;  4HZF A;  5D6F A;  2NS0 A;  2JT1 A;  1S29 A;  1Y0U A;  4L9J A;  2LSO A;  1CF7 B;  2V6C A;  2MLG A;  3E5Q A;  1QQI A;  1TLH B;  3M9A A;  5LEJ A;  2UXX A;  2QM3 A;  2M87 A;  4MEX F;  2ZJ2 A;  2LF8 A;  1FYK A;  3BY6 A;  4HF2 A;  5H6R A;  1FYM A;  4L0Y B;  3BPV A;  5CVI A;  3CUQ A;  2CSO A;  3AAF A;  2BE5 F;  5ILV A;  4AVP A;  1OPC A;  3DV8 A;  3ISP A;  3FMR A;  2F5D A;  3P9I A;  3RYP A;  1U5T B;  4ZH4 F;  5F6F A;  2IW5 A;  1OYI A;  3Q9S A;  4BAY A;  4LMY A;  3E3V A;  2M45 A;  1NHA A;  3NQO A;  2E7X A;  1S7O A;  2P5K A;  1I5Z A;  5FD5 A;  2L4A A;  5D5V B;  4YFN F;  3R60 A;  5D4S A;  2JPC A;  1ULY A;  1ZG5 A;  4ETS A;  5HLI A;  1HXD A;  3IL2 A;  1RIO H;  5DUI A;  4ZZD A;  3RIR A;  1SFU A;  1IAW A;  4OMZ A;  4RGX A;  2ZME B;  4L9T A;  5TRD A;  2LNB A;  4PGH A;  3D5L A;  3QPH A;  1J2X A;  3F8C A;  1F4K A;  4I09 A;  1UFM A;  2HKX A;  5JI6 A;  1U5T C;  3N97 A;  1B6A A;  4M74 A;  4LLL A;  2A68 F;  2IT0 A;  5HDG A;  4P9F A;  3RDI A;  1Z9C A;  1I1G A;  3HSE A;  2XRN A;  5ERI A;  3RPQ A;  1L0O C;  4U88 A;  4Y15 A;  3JTG A;  1BBY A;  1SMY F;  2JPB A;  1RUN A;  1PP7 U;  2PMH A;  1W5S A;  2GXB A;  2QWW A;  3JSO A;  1IZ1 A;  1FT9 A;  2MD5 A;  1K78 A;  2MC3 A;  5E8G A;  5DD8 A;  2VC0 A;  4ENM A;  2M30 A;  3KET A;  2OD5 A;  3IHU A;  2FEZ A;  3TOB A;  3KP7 A;  5IT3 A;  2ZNZ A;  3ECH A;  3I0T A;  2QQA A;  2FRH A;  5FFX A;  2PBI A;  5HS7 A;  3ZQ7 A;  1MDM B;  3I53 A;  3HIF A;  5JHU A;  4KA4 A;  5LGN A;  4I01 A;  5HDK A;  5DCF A;  3V7S A;  2IA2 A;  4A6E A;  3DPT A;  2OZU A;  2H6C A;  4P55 A;  4FHT A;  1QZY A;  2Y48 A;  4AIH A;  2NNN A;  1ODD A;  4LK0 F;  3ZMV A;  1O7F A;  3IC7 A;  4CDG A;  2XVC A;  1RNL A;  3F8M A;  4IRI A;  3WTX C;  5AIQ A;  5BS6 A;  1SD5 A;  3HRS A;  2GA2 A;  1R22 A;  2QQ9 A;  5DYM A;  3RJP A;  3CTA A;  3NEU A;  4KIB A;  3EQL F;  3GW2 A;  2DBB A;  2OBP A;  2DU9 A;  1BI0 A;  2MBF A;  2VXZ A;  2XV4 S;  2DPU A;  1BI2 A;  3MZH A;  3RYR A;  3ERE D;  1DPR A;  3VOD A;  5L3D A;  3LA3 A;  3QOP A;  1KU3 A;  1MJA A;  3M1E A;  4ESB A;  3F23 A;  1HSJ A;  4B09 A;  3GLX A;  3O3K A;  2EA2 A;  5DCM A;  1QO0 D;  1BC7 C;  4L5I A;  2GWR A;  1FX7 A;  2HEO A;  5LHH A;  3LQQ A;  4LFU A;  1MKM A;  2D1V A;  2FA5 A;  2P5V A;  3DKW A;  5ED4 A;  4GO1 A;  2VON A;  4G6D A;  2MLK A;  3MEX A;  1MGT A;  2D1H A;  5H6Q A;  2J5P A;  3TOA A;  3E6B A;  3T8T A;  1PDN C;  3COA C;  4ZZL A;  2W85 A;  1F1Z A;  2HTJ A;  2VT2 A;  5AON A;  1EH7 A;  3ZMD A;  3ECO A;  1W7P D;  3I54 A;  4KMU X;  2XAQ A;  1SD6 A;  1HQC A;  3KZY A;  1IN5 A;  4S05 A;  2VBZ A;  1YQA A;  4G7Z F;  2H27 A;  2NRA C;  3CUQ B;  1BOA A;  3MCZ A;  3M8E A;  2H09 A;  3FHZ A;  4UNO A;  4ZYG A;  2VOP A;  4DQ2 A;  2IPQ X;  3L00 A;  1R1U A;  2ZCW A;  4LLG F;  4GYG A;  4YFK F;  3U9G A;  4KN4 X;  2Q8K A;  1XDU A;  5CJ9 A;  1G3W A;  4BYY A;  2K4B A;  4RAZ A;  5FD6 A;  1ON1 A;  3T8R A;  1REP C;  1GHC A;  2EFO A;  5LLQ A;  1B4A A;  2DLL A;  5CVJ A;  4D0P A;  3J81 K;  3K9T A;  1TQI A;  3WE3 A;  1WWX A;  3WTY C;  4I98 B;  4XBF A;  3VFZ A;  4PGG A;  4Q4Z F;  2J5O A;  3WTT C;  4Q48 A;  4ENN A;  4OIN F;  5EEH A;  2VN2 A;  2W24 A;  2HS5 A;  1T39 A;  1IRF A;  4IF4 A;  1FSH A;  4G9Y A;  1Q1H A;  2RVC A;  4EJU A;  3M7G A;  2STT A;  3EYI A;  4AIJ A;  1BC8 C;  1OKR A;  3EDP A;  1AOY A;  1WRJ A;  5J6X A;  2HFH A;  4HYE A;  2M5W A;  1F9N A;  2LDU A;  4LB5 A;  2FOK A;  3Q9V A;  3J81 Z;  1MJ9 A;  2XAH A;  2Q2E A;  3KE2 A;  1WI9 A;  2HZT A;  5K5Q A;  2IA0 A;  3E6M A;  3Q5F A;  4RGU A;  4LLN A;  2NYX A;  4P5O A;  1A04 A;  1SFE A;  3LAP A;  2KJC A;  4G6Q A;  4LB6 B;  3HTS B;  4KUM A;  4FX4 A;  4EVI A;  1XMK A;  1J0R A;  1FSE A;  3GF2 A;  3QU3 A;  2XAG A;  3ZMU A;  2A69 F;  4KMF A;  3FM3 A;  4WK8 F;  6PAX A;  5BPD A;  3TKY A;  3GZ6 A;  4CXF A;  2XIG A;  3V7C A;  1DUX C;  4A12 A;  3KEO A;  2BV6 A;  4HLX A;  2XKO A;  1H9T A;  3L7W A;  1O7L A;  5D6E A;  2PLY A;  3I71 A;  5EEG A;  1G6N A;  3D0S A;  3H92 A;  1U5T A;  2OA4 A;  3SXY A;  1BI1 A;  3J7A O;  1XSV A;  2EV5 A;  4OIR F;  3C7J A;  4Q5S F;  4QLC U;  4WWC A;  4HBL A;  3F8B A;  1JXS A;  2G7U A;  3QU6 A;  1ZRF A;  3GFM A;  4G7H F;  4MTE A;  2QBY A;  4HW0 A;  3QP5 A;  1QNT A;  4GGG A;  1HW1 A;  1H9G A;  1ON2 A;  4P9U A;  1KQ0 A;  5DUK A;  1LB2 A;  2EA4 A;  3LWF A;  4IPA A;  2KIM A;  3MZY A;  1P4A A;  1XGM A;  5E18 F;  3LAJ A;  4WXH A;  4L5J A;  3DQV C;  1DP7 P;  2NNY A;  4M9Z A;  3F72 A;  3E5U A;  4UUV A;  2EB7 A;  4A2U A;  2XUB A;  4MTD A;  4LJZ F;  3R6S A;  1ZRE A;  4MNU A;  4OIP F;  1DDN A;  4M72 A;  1ZLJ A;  3KP3 A;  1LVA A;  1TQP A;  2YSR A;  4RB1 A;  1H0M A;  1YFH A;  5D5U B;  3TO9 A;  2GZW A;  3W6K B;  3KCC A;  5KVR A;  2Z5U A;  3C3W A;  3HOS A;  3BPX A;  4KNY A;  3KZZ A;  3J80 K;  1YS7 A;  1K6O A;  2V1D A;  4RGR A;  2RNJ A;  1UHM A;  3L09 A;  2M1B A;  3DFG A;  2PEX A;  3F6V A;  4AIK A;  2FBK A;  4JQF A;  3HRM A;  4MHG A;  3TO7 A;  1HKS A;  3I5U A;  2W84 A;  3OV8 A;  4G7O F;  4LG0 B;  3GFJ A;  3WTU C;  1XMA A;  1TW3 A;  3HSF A;  3FXR A;  5DV5 A;  2BYV E;  2OAZ A;  1GXQ A;  1YIO A;  1TQM A;  4EM2 A;  5D5X B;  1I6X A;  2FBI A;  3C1D A;  3VOE A;  1FBU A;  1IN7 A;  3ELK A;  4M73 A;  3T0Y A;  2FMY A;  4QWQ A;  2HGC A;  2HTS A;  2QYO A;  4RAY A;  5TJJ A;  4EJW A;  4Z2Y A;  2VBX A;  1YYV A;  1E17 A;  4IHT A;  1W5T A;  2XKP A;  4G8X A;  4IRH A;  3HRU A;  3OOP A;  4ENJ A;  2O6G E;  3JAM K;  3PQJ A;  4WXD A;  3DP7 A;  3K1M A;  1I27 A;  5DEQ A;  1LEA A;  1ZG3 A;  5JR3 A;  3ZPL A;  4HDV A;  5D4R A;  4EJV A;  2FBH A;  4KYW A;  2VC1 A;  4BH9 A;  1JE8 A;  5LHI A;  3FMQ A;  1BJA A;  3F8N A;  2QQB A;  3KEQ A;  4CO8 A;  2BGC A;  4PCQ A;  4UXN A;  1B9M A;  2XHK A;  3IRQ A;  4ZYE A;  2RDP A;  5F64 A;  2ZNY A;  4HOB A;  2HYG D;  1O3S A;  1U2W A;  1USS A;  1FBQ A;  3QP6 A;  4U7B A;  4IHS A;  1V3F A;  2OQR A;  3RPU A;  3JW4 A;  2L02 A;  2G9W A;  1KYZ A;  2JSC A;  4K2E A;  1LQ1 A;  1ZN2 A;  4UVB A;  2M8E A;  5A2Q K;  1B9N A;  4HF0 A;  3QPT A;  1HW5 A;  1YS6 A;  1SD7 A;  3WG9 A;  4ESJ A;  4KT5 C;  4F7Z A;  3KLO A;  1HKQ A;  1SFX A;  3DPL C;  3H3Z A;  5IT9 K;  4NB5 A;  4M6X A;  4A0Y A;  5JVT A;  4HA8 A;  3DXJ F;  3SQN A;  4WCG A;  1XD7 A;  3FWE A;  4IVN A;  1BIB A;  2FNP A;  5ICG A;  4BHP A;  1KYW A;  5JFR A;  2DQR A;  5L3B A;  1EH8 A;  5AIP A;  1C0W A;  1OR7 A;  3S2W A;  3W6J B;  5K1Y A;  1IUY A;  1R23 A;  4S04 A;  3P7N A;  5DD4 A;  1T6S A;  3L9F A;  3ROU A;  1J7K A;  4YG2 F;  2UWM A;  2YPR A;  4CHU A;  3F8F A;  1IXC A;  3HHH A;  2C6Y A;  4ENK A;  3BRO A;  1ZGA A;  2CQK A;  3GYH X;  1YW9 A;  4O6J A;  2R3S A;  1V4R A;  1UHW A;  1HKT A;  2XAF A;  2W25 A;  4Q47 A;  5ILS A;  4EM1 A;  3HOT A;  2HDC A;  1UCR A;  2JRT A;  3U1D A;  1OYW A;  2H94 A;  4LGW A;  5HVQ C;  4EQQ A;  1ZG1 A;  2JZY A;  2P7V B;  2CGP A;  1FBS A;  5FO5 A;  3E5X A;  2HQR A;  2ESH A;  5ILU A;  4A0X A;  3TGN A;  2WTE A;  5A2Q Z;  1R1V A;  1J9I A;  1YLF A;  2L4M A;  2O03 A;  2VOO A;  1XN7 A;  1VTN C;  2HYF A;  4XRF A;  1HBX G;  1S6L A;  1YO5 C;  3I64 A;  2ZO4 A;  4HLY A;  1KGS A;  3GZ5 A;  3HTU A;  3V7R A;  3FZV A;  2R7F A;  3L2C A;  5LHG A;  3RKX A;  2KKO A;  2OU2 A;  2O8X A;  3KLN A;  1E2X A;  1ZAO A;  4Y17 A;  2STW A;  4U0W A;  3CO6 C;  5L3E A;  1LEB A;  1F5T A;  5CYV A;  3N4M A;  2GXG A;  3IKT A;  4OOI A;  2DPD A;  4XSX F;  3NRV A;  2BEO A;  3SZT A;  3CLO A;  4HV6 A;  5HLH A;  2XAJ A;  1U3E M;  4EGZ A;  5BOX A;  4PDK A;  4RB0 A;  3SFZ A;  3T5X A;  2OQG A;  3P9K A;  4A5M A;  1R7J A;  3ABU A;  4I0B A;  5K5O A;  2F2E A;  3EUH A;  2EFQ A;  3JSP A;  4EV0 A;  2MA3 A;  5IT9 Z;  5ICC A;  1EV7 A;  1IN4 A;  3WGG A;  4KN7 X;  5HS8 A;  1L3L A;  1IW7 F;  2PJP A;  1Z91 A;  1LNW A;  3BJ6 A;  1ZYR F;  5CVR A;  3CJN A;  3WE2 A;  2NAZ A;  3ZN1 A;  2GIV A;  1FP2 A;  4IRG A;  1FWZ A;  2Z99 A;  1RUO A;  3ZN0 A;  1J75 A;  1O3R A;  4G94 A;  2CO5 A;  3REO A;  1FYL A;  2X0L A;  3TDZ C;  3LA2 A;  1S3J A;  5E1Z B;  3J80 Z;  4EJT A;  2G7H A;  1P92 A;  2DK8 A;  3WTW C;  1FP1 D;  1WQ2 A;  2KIU A;  4CYD A;  1QPM A;  4UVA A;  3FX3 A;  4YIF A;  4NQW A;  4FT8 A;  4U0V A;  5L3F A;  3WTS C;  4KFC A;  3WU1 B;  1UB9 A;  2VBW A;  4RGS A;  2DW4 A;  1K7A A;  1IRG A;  1BI3 A;  5K5R A;  5HDN A;  2K86 A;  1QZZ A;  2FNA A;  3LA7 A;  2F5C A;  2ZME A;  2RGV A;  3BOQ A;  1XCB A;  2IJL A;  1FNN A;  4UV9 A;  1ZAR A;  2MH2 A;  2DQL A;  3ZMS A;  5BQT A;  1HST A;  3C18 A;  3R61 A;  2F5E A;  1XGN A;  3R4K A;  3WTZ A;  3O6B B;  4U7D A;  1KA8 A;  3HHG A;  3CO7 C;  1G4D A;  4GXO A;  1KQ8 A;  1O3Q A;  2FQ3 A;  1SAX A;  2IRF G;  1HW2 A;  1WKM A;  1R5G A;  3K0L A;  2Z33 A;  4LD5 A;  5FFZ A;  2YU3 A;  2QVO A;  4Y13 A;  1U6G A;  4ZYH A;  1W4M A;  4O3M A;  1T38 A;  3FXQ A;  4RB3 C;  4IJA A;  1W7P B;  1KU7 A;  3BZ6 A;  4BQA A;  3GXO A;  1GVJ A;  5BMZ A;  1YW7 A;  3WGH A;  2KJB A;  3B73 A;  4EMS A;  4BXU A;  3ZP5 A;  3KFW X;  2IVM A;  2D2W A;  2PFB A;  2PQ8 A;  5HLG A;  3ULQ B;  4XLN F;  3ZMZ A;  4H0E A;  1X3U A;  3KP4 A;  2GA1 A;  3IWZ A;  5E8I A;  1LJ9 A;  2RQP A;  4WF2 A;  4HX7 A;  1R00 A;  5KK1 A;  4E70 A;  1QBJ A;  2K27 A;  4HAM A;  4OIQ F;  3TO6 A;  4U0Y A;  5E1W A;  2B0L A;  1D8J A;  4LK1 F;  3G73 A;  1AWC A;  3IKV A;  2WWY A;  1R5H A;  3K2Z A;  3SZP A;  3TQN A;  2QZ8 A;  3GVA A;  1R36 A;  4O5V A;  2RKH A;  1G3S A;  3EET A;  5D5W B;  3I4P A;  2COM A;  5DDG A;  1OYY A;  3BP8 A;  5L3C A;  1TTY A;  2W57 A;  1OMI A;  5H20 A;  1XB4 A;  4EGY A;  1FLI A;  2O61 A;  2DAO A;  2EFN A;  4HDU A;  3ABT A;  2FSW A;  1SMT A;  3RI4 A;  1D3Y A;  3LST A;  2X4H A;  1R1T A;  4WX9 A;  4XLP F;  2K7L A;  1TW2 A;  5ICF A;  1T98 A;  2FU4 A;  3LFK A;  2XGX A;  1PUE E;  4A0Z A;  2PG4 A;  1CF7 A;  1R58 A;  1LDJ A;  4MQV A;  4NHJ A;  3F6O A;  1G3Y A;  3F22 A;  1ZLK A;  2ACJ A;  3P9C A;  4P96 A;  3MWM A;  4PZJ A;  1XCV A;  4HX4 A;  1XGS A;  2CYY A;  2HWV A;  1BM9 A;  1XSD A;  1Z05 A;  2DT5 A;  4HQM A;  4I0A A;  3BJA A;  3CUO A;  1JHH A;  1ZHF A;  3ML6 A;  2ZKZ A;  3K69 A;  4RS8 A;  4N9I A;  1P4X A;  5LEK A;  3GFL A;  1U8R A;  2VBY A;  1IXR C;  2BBY A;  3B02 A;  2R7D A;  3F21 A;  2A5Y B;  3GEZ A;  1I1S A;  1T2K A;  5BPI A;  2P7C B;  4I7H A;  3PQK A;  3O2P E;  4I02 A;  5CVU A;  3RTR A;  4L9V A;  3GO5 A;  1MD0 A;  5J8F A;  2L01 A;  3E97 A;  5FLX K;  2OZ6 A;  5FLX Z;  1Z7U A;  4BHB A;  2VE8 A;  3EYY A;  3V8J A;  2K4J A;  2ISY A;  4L9N A;  5D8K B;  4YII A;  3I59 A;  2PN6 A;  3K1N A;  4ON0 A;  2P5L C;  2E1C A;  2DI3 A;  4EM0 B;  1LDD A;  2EFP A;  2VT3 A;  2WC2 A;  4A5N A;  2E1N A;  3U2R A;  2EV6 A;  2IA1 A;  2A6H F;  4JBA A;  2RC4 A;  4KIF A;  2Z3Y A;  3GX4 X;  4R79 A;  2L3D A;  3KP6 A;  1O3T A;  2UZK A;  3BWG A;  2ELH A;  4CIC A;  1S8N A;  2VOD A;  1BN5 A;  2H6B A;  2Z9O A;  5J8C A;  1T0F A;  5FB2 A;  4TV7 A;  3JTH A;  1MJB A;  4CGZ A;  3I58 A;  2O0Y A;  4ASN A;  4M9S A;  5FGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...