3WTUC

Crystal structure of the complex comprised of ets1 (v170a), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 40
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtuC00
2ZO4A 1YYVA 1D8KA 3V8LA 4XSZF 1ZG5A 2V9VA 2RVCA 1B9NA 4MNUA 4LMYA 4KN7X 1HKSA 3P9CA 3NQOA 2JPCA 2L54A 1R5GA 1QZYA 1KU9A 2ZNYA 1RZ4A 2XAJA 2ISZA 4CGZA 2FRHA 1XGSA 5KVRA 2EFPA 3VFZA 1GXQA 4M9ZA 1YS6A 1HKTA 4OIOF 1ZYRF 2G9WA 4RGRA 5FB2A 3C7JA 4I2OA 1ZGJA 2K27A 2VONA 1P6RA 5ILVA 2GQQA 2P6SA 5L3EA 4LK0F 3RKXA 4RB1A 1BC8C 4PZJA 1MDMA 3VB2A 1KU2A 2HGCA 4KFCA 1Z9CA 1IF1A 3E6DA 2FEZA 2DK8A 1BN5A 1OYWA 4GYIA 4CZZA 3N4MA 5CYVA 1KGSA 4RB3C 3LA7A 5DCMA 5ICEA 3WTXC 1J75A 4KIBA 1STZA 3NRVA 2H27A 4PCQA 1W7PB 1ZRDA 5IT3A 3TDZC 1V4RA 2ZMEA 1R00A 2BYVE 3SZPA 1CF7B 1DPRA 3BJ6A 2HTSA 4ZH4F 2HS5A 3JAMZ 1UCRA 2VC1A 2DT5A 4EM2A 4Y13A 3RPQA 2JRTA 2GWRA 3F72A 4DNCA 1WI9A 5D5VB 1K79A 4KIFA 3I64A 4LLGF 1PDNC 4L5IA 2E7XA 2J5PA 3JW4A 3E6CC 5BPIA 1ZLJA 1FT9A 5CVUA 3MZHA 3F8NA 1KQ8A 1F4KA 2MA3A 3MAJA 1D8JA 3I59B 1OMIA 2LNBA 1QQIA 1R23A 2QQBA 4ESJA 3DPTA 1KU3A 3LSTA 1R1UA 1S7OA 5DCFA 1R5HA 4B8XA 2XHKA 2IRFG 3L7WA 4KNYA 4ZYHA 1IW7F 4A5NA 1XSXA 3I0TA 1I27A 1XGOA 2ESNA 3VODA 3IC7A 1XMAA 1C0WA 2GA2A 3BJAA 3F22A 2A3SA 1L3LA 1J7KA 1ZN2A 3I53A 1BC7C 2DU9A 4G6QA 5F6FA 4E70A 3M1EA 4UXNA 4UVCA 3ZMUA 2DW4A 2ZNZA 4KT5C 3PQJA 3U9GA 3GW2A 5D4SA 4Q48A 3F8MA 5E17F 1PUEE 2A6HF 1YW7A 1CGPA 2RKHA 4G94A 5LGTA 3HTUA 4A6DA 3IRQA 4A0XA 3ABUA 3WE2A 2C6YA 2PLYA 4WF2A 1HW1A 1HQCA 2OQRA 4HOBA 2YSRA 4DQ2A 1H9GA 2K7LA 1FP2A 2NS0A 2GA1A 5L3DA 3Q5FA 1KU7A 3V8KA 1O3SA 5D4RA 1D5VA 1XCBA 2IVMA 1LDKB 2K86A 1G3WA 4JQFA 4RB2C 1BBYA 4CICA 2XAHA 4M6XA 3MWMA 1PP8F 1SFUA 1E17A 5HDGA 4AIJA 1ZG3A 2MH9A 5L3FA 4P5OA 1ODDA 4AD9A 5LRRA 4HQMA 2QYOA 3PQKA 2XAFA 1QNTA 2FSWA 3F21A 3RPUA 4KDPA 5JR3A 1XMKA 2HOEA 1SAXA 4AIKA 3ERED 4HW0A 1U2WA 4XSXF 1WQ2A 3REOA 3O2PE 3ZMZA 2YX4A 1WSUA 2IT0A 1O7LA 1ON2A 2X4HA 4UNOA 2L4MA 3QP6A 2W25A 4ENNA 2MBFA 2KRFA 2M30A 2YX7A 3NEUA 2Z33A 3RTRA 2VOOA 1YS7A 4G8XA 2M45A 4LGWA 3TKYA 3IL2A 4RB0A 4MHGA 2CGPA 4PGHA 1ZGAA 1S3JA 1YO5C 1Z6RA 1JE8A 4LG0B 4LB6B 2HKXA 5ILSA 4KN4X 5CJ9A 4Z2YA 2W85A 2V6CA 1BM9A 3HSRA 5KK1A 4G7ZF 1AWCA 2E1CA 3F23A 3E6MA 1QGPA 3QOPA 1EH7A 5K5OA 4PGGA 4D0PA 3GZ5A 3IKVA 5LEKA 1I5ZA 3GVAA 2DO7A 2XUBA 3HYIA 2G7UA 3MFKA 4HX4A 3HOSA 4RGXA 3WTVC 1IUYA 3CJNA 2EV6A 4MEYF 2DQRA 4EV0A 4MEXF 1Z1DA 3B02A 1K7AA 3GFLA 4BHBA 3ZMVA 5LHHA 3LAJA 4ASNA 4OINF 3R0AA 5DD8A 2PG4A 5CLSA 3DXJF 5ERIA 1O3QA 2EFNA 2IPQX 2QBYB 3WE3A 1LJ9A 4OIQF 6PAXA 2CSOA 4HBLA 1P4XA 1R22A 3FZVA 1EH6A 3L9FA 2P7CB 3H92A 3E5QA 5BPDA 5D5UB 2L02A 5FLXZ 2QVOA 4BAYA 1B59A 2ESHA 2UXXA 2D1VA 3F8BA 4BYYA 4UUVA 4KICA 4IJAA 1ZHFA 4L9NA 3L2CA 4LJZF 4OIRF 4UV8A 2XROA 1RUNA 5BQTA 4UV9A 1ZLKA 2XAQA 2D2WA 5H20A 1T39A 3LA2A 2ZMEB 3WGHA 1UHMA 1XB4A 3H3ZA 2EB7A 2Z5UA 3DQVC 5AONA 4ZZLA 4QWQA 1W5SA 1S7AA 5LBQA 2OD5A 1P4AA 2HWVA 4RS8A 2KIUA 3KP6A 3RYPA 1USTA 3P9IA 4ENKA 2IW5A 2ZFWA 3KZZA 3HHGA 2OZUA 4R8HA 4LG0A 3FMQA 1W4MA 1FWZA 5CVRA 3V8JA 1LVAA 1BI1A 3FX3A 2IJLA 4A5MA 1XDUA 4JK1X 5L3CA 1IN5A 2NYXA 3WTTC 3EYIA 4ZYGA 5DD4A 4WXDA 3TGNA 3I54A 1RUOA 2BV6A 4MTEA 5AIQA 2YR2A 1NHAA 2BGCA 2H09A 2PBIA 1AOYA 4GXOA 2DPUA 4I09A 3LA3A 3GF2A 4EVIA 5BOXA 3ISPA 3SQNA 2HZTA 3C3WA 3J81K 3O6BB 4O3MA 3N97A 2CG4A 3QAHA 1T0FA 2E7WA 1LDJA 3ZQ7A 3MZYA 3F8FA 2H94A 4HF2A 2IA2A 5DEQA 5LEJA 4ENJA 3EUHA 1F5TA 1R58A 2XV4S 2QBYA 2RDPA 4KA4A 2DFIA 1FOKA 1HXDA 4A0YA 4I02A 5A2QK 5JFRA 4Q4ZF 2Q2EA 1HBXG 5K1YA 5JHUA 1FNNA 2K4JA 3M8EA 4WK8F 4EJUA 1FP1D 2M8EA 2K02A 4I0BA 3WTYC 3GFMA 1YW8A 1USSA 1TQMA 3RKWA 4BH9A 3DV8A 1QO0D 3J81Z 2XASA 3M7GA 4U0VA 3TQNA 5JVTA 3F8CA 2CW0F 4LK1F 1WWXA 2XIGA 1IN8A 4GYGA 2P5KA 3S2WA 3WGIA 5HLGA 3BJOA 4ZZDA 2A69F 4P96A 4IRIA 1E2XA 1YG2A 2LSOA 3FXRA 5LHIA 1IN4A 2MC3A 3FMSA 5A2QZ 1P2FA 1B6AA 1FC3A 4A12A 5FD5A 3OOPA 2KIMA 1ZRFA 2JZYA 2KIFA 4S05A 1KQ0A 3PFIA 2HTJA 1X3UA 3CO7C 4ESFA 4YIIA 4LLLA 2VXZA 4EGYA 1I1GA 2CYYA 3I58A 2RN7A 1GVJA 3DEUA 4H0EA 3V7SA 1P92A 3BWGA 2ZCWA 4L5JA 2QM3A 3F6OA 3WTWC 5HLIA 5EEGA 4GO1A 1WRJA 1RI7A 2VODA 2F2EA 4KYWA 5D5WB 4FHTA 1QBJA 2FBKA 1U8RA 3E5UA 1XSDA 3IWZA 1FLIA 3WTUC 3R0JA 4M71A 1UFMA 2BEOA 3KP2A 2DI3A 4M9SA 4HX7A 4CHUA 2ELHA 4BXUA 1FY7A 5ILUA 2O8XA 4HZFA 4YIFA 4BQAA 4M73A 2LF8A 4XLPF 3I4PA 3CDHA 3IHUA 4HYEA 4L9JA 2ZKZA 4RAZA 1Z6TA 1TQIA 2XVCA 3WGGA 2MH2A 3IKTA 1IXCA 2VE8A 1UB9A 4B09A 5HOOA 4YFKF 4EJOA 2EJRA 1FBQA 2EWNA 4S04A 3T0YA 1Z05A 4NHJA 3R6SA 1HSTA 3Q9VA 5J8FA 1R7JA 1SMYF 5E8GA 4WCGA 4QLCU 4IRGA 2HEOA 3CUQA 2WTEA 1O3TA 1U6GA 2ADUA 1BI3A 3WTZA 1HW5A 3KP5A 1DDNA 3ECHA 1MJBA 5E18F 3KZYA 2W57A 1BI2A 2FBHA 3ML6A 3F3XA 5BS6A 5LHGA 3TO7A 1BI0A 3ZMSA 1LQ1A 4L18B 5BMZA 4MGRA 2QZ8A 4FX4A 5E8IA 1R36A 1DP7P 4RAYA 4XBFA 2JPBA 4A2UA 1G3TA 2NAZA 2GAUA 2NNNA 4WWCA 1TLHB 4K2EA 1LEBA 2D45A 2PEXA 4WXHA 2ZBKA 2QQ9A 2HR3A 4G6DA 3LAPA 2HKOA 3K0LA 2V1DA 4I7HA 3DKWA 2FE3A 4FX0A 4UVBA 3LQQA 5LRSA 3K69A 4JBAA 3U1DA 2F5FA 2BE5F 4BHPA 3QU3A 3E97A 3ZPLA 4BHCA 1J59A 1PP7U 5F1RA 2O6GE 2QENA 2FNPA 3LWFA 2PI0A 1I1SA 1XSVA 4HX8A 1EH8A 2F5EA 1G6NA 1U5TC 1IN6A 1U5TB 4YFNF 4HLYA 2FA5A 4EQQA 4P9UA 3HSEA 5D6EA 4AWXB 3JTGA 1FPQA 5ED4A 3HUGA 2A07F 1OPCA 5DDGA 3FF5A 1W7PD 3I71A 2XAGA 1TNTA 3WU0A 4P55A 4ON0A 2MD5A 3FMRA 4Q5SF 1G4DA 3H3UA 3V7CA 4G7HF 3ECOA 1KYZA 1SD5A 4EMSA 5JI6A 1OR7A 3TOAA 3TO9A 1FYKA 2DK5A 5D5XB 1IXRC 4GGGA 1SFEA 2EV5A 1ZG1A 4MQVA 1JHFA 1SD4A 3T8RA 2EV0A 5DUKA 4F7ZA 2STTA 3QPHA 1ON1A 4M74A 4XLNF 1J2XA 2HFHA 3KE2A 3HHHA 3HRMA 1U78A 1J9IA 3O3KA 2G7HA 1TTYA 2IA0A 3BOQA 3RI4A 1B4AA 1FSHA 2DAOA 1YTYA 1O7FA 2HQRA 4KMFA 4YFXF 1FBSA 1IRGA 3HRTA 3GUDA 3G73A 1LB2A 2FF4A 1QPMA 4CYDA 3TOBA 4Y15A 3JTHA 1D3YA 1VTNC 2V1XA 5E20A 4HA8A 3ULQB 2ETHA 5CVVA 3HSFA 3EETA 1U3EM 4IHSA 1KQ9A 2LKPA 2GXBA 2Y75A 2OA4A 3Q9SA 1G3YA 3E3VA 2E1NA 2CQKA 4HDVA 2R7DA 2UZKA 1IXSB 1OKRA 2M87A 5FGMA 2X0LA 2CFXA 4U7DA 4NQWA 5D8KB 3CO6C 1K78B 2QWWA 2A68F 1Z91A 3TDUC 3GLXA 1U5TA 3SHFA 1TW2A 2UWMA 3GFIA 5CVJA 3HRUA 2UXNA 1OYYA 5FFZA 5HS8A 5TJJA 2D1HA 1FYLA 4MQ9F 2P6TA 2CWEA 5HS7A 5K5QA 2BBYA 2KJCA 5E1ZB 1G3SA 3ZN0A 2RGVA 3P9KA 1ZRCA 2VT2A 3E5XA 1IZ1A 1BIBA 4EM1A 4N9HA 2OAZA 2WC2A 1R1TA 3KLOA 1IRFA 2H6BA 3OV8A 4M72A 2Q0OA 3KETA 3KEOA 5E1XA 1MD0A 3L00A 2YU3A 1P4WA 1H9TA 1RNLA 1A04A 2OU2A 1SD6A 2Z3YA 3KP3A 3LQRA 1J5YA 4HF1A 1BIAA 3WODF 1BJAA 3QRFF 3J80K 1F1ZA 2J5OA 1FYMA 2GIVA 5HDKA 1GXPA 3ZP5A 2A5YB 1MZBA 4NB5A 4PDKA 5K5RA 5TRDA 3JAMK 2R7FA 4LLNA 4N9IA 3JSPA 2STWA 1S29A 2KJBA 3IWFA 3U2RA 2HDCA 3T8TA 4UVAA 2EA4A 3KP7A 3HOTA 1Z7UA 2LDUA 3R60A 2DTRA 3QPTA 2EFWA 4CO8A 3ZMDA 3TO6A 3KCCA 4L9TA 3CTAA 4KMUX 5J6XA 2L3DA 4WXCA 3GEZA 2RC4A 2AS5F 5DV5A 4M9XA 3DFGA 3QU6A 1LNWA 1TQPA 2K4BA 2FXAA 3CUQC 3GWZA 3CUQB 4R79A 2V1UA 3J80Z 2JSCA 1K78A 1IN7A 4OOIA 4AIHA 3KP4A 1ZAOA 5IT9K 4LD5A 4EJTA 4EGZA 3ABTA 2P8TA 1K6OA 2MLKA 4Y17A 4I98B 2JTVA 5HDNA 2O61A 2P5LC 2VBXA 3GYHX 1YIOA 1XN7A 2A6EF 5ICGA 2MLGA 4HAMA 4L9VA 2ACJA 3MQ0A 4OMZA 4U88A 2B0LA 4HLXA 2EA2A 5E1WA 2RQPA 2GXGA 1GHCA 4AVPA 2EFOA 1XDSA 4OIPF 3DPLC 5FD6A 4HQEA 2TDXA 4HF0A 1XCVA 1J0RA 2ISYA 2FNAA 3K2ZA 2O3FA 2HYFA 1ZREA 1DPUA 3VOEA 3WTSC 1FBUA 5IT9Z 4L0YB 4GCVA 3BY6A 2EK5A 4HDUA 4TV7A 3SZTA 3HTSB 4RGSA 4I0AA 1REPC 4O5VA 1V3FA 5CVIA 3RDIA 4G7OF 1LEAA 2EFQA 4KUMA 1YW9A 3C1DA 2V79A 4ZYDA 2FOKA 3V7RA 3G3ZA 1HKQA 1QZZA 5D6FA 4ENMA 2VE9A 1W5TA 3ZMTA 3ELKA 1TNSA 4I01A 2FU4A 4IHTA 3L09A 4IXAA 2VBZA 4KIGA 3BP8A 3EDPA 3HIFA 5FFXA 1R1VA 2OZ6A 2DPDA 2HYGD 2PFBA 3K9TA 2CO5A 3K1NA 1W7PA 4CDGA 2WV0A 2Z99A 3M9AA 3WU1B 1F9NA 4WX9A 1TBXA 5HVQC 4XRFA 3SFZA 1OYIA 3RYRA 2P5VA 1IAWA 1CF7A 4LFUA 1MJ9A 4A0ZA 3T5XA 2PMUA 3SXYA 1RIOH 1S8NA 3BPVA 1FX7A 3F6VA 3GFJA 1SD7A 1JHHA 2OBPA 4R1HA 2RNJA 3KEQA 4U0WA 2Y0MA 5HS9A 3E6BA 2COMA 3BPXA 3P7NA 3BROA 3QP5A 1BOAA 5L3GA 1MKMA 2RV8A 2PMHA 1MJAA 3FM3A 3J7AO 1MGTA 1YQAA 1Y0UA 3DP7A 3FWEA 1ONVA 4EM0B 4UHTA 2VT3A 5LGNA 1O3RA 3I59A 3CLOA 2IP2A 2W24A 3FXQA 5DYMA 2XKOA 3ROUA 3EYYA 5EEHA 5L3BA 2XKPA 4U7BA 3M8FA 2NNYA 2R3SA 1UHWA 1HSJA 3MCZA 2DLLA 1KYWA 1T98A 1JXSA 4M6YA 4G9YA 3GO5A 1XD7A 5J8CA 1XGMA 4IRHA 3FXUA 3W6JB 1LDDA 1B9MA 3GXOA 2PN6A 3RJPA 3AAFA 4N0BA 1SFXA 1WKMA 4IVNA 2W84A 3CUOA 2DQLA 2DBBA 1ZH5A 4EJVA 1Q1HA 3EQLF 3JSOA 3V4GA 2XRNA 3K1PA 2FMLA 2VOPA 2FMYA 4LB5A 4IF4A 5DUIA 2QQAA 1FSEA 2YPRA 1L0OC 3FM5A 2P7VB 2HQNA 3LFKA 4FT8A 5F64A 2M5WA 2F5CA 1B1BA 3IRRA 5FLXK 3D5LA 2ZJ2A 4YG2F 3COAC 2VC0A 3RKYA 3I5UA 3KFWX 2PJPA 1HW2A 2FBIA 1T38A 5ICFA 1ZARA 4U0YA 2P4WA 3BDDA 1T2KA 3RIRA 2F5DA 1TW3A 4OU0A 2Q8KA 3T1BA 3HRSA 1O57A 1YLFA 2WWYA 2O03A 1SMTA 2IA1A 4Q47A 4O6JA 2OQGA 4ZYEA 2VBWA 3DF8A 3K1MA 1MDMB 2PQ8A 1JGSA 4P9FA 1H0MA 3B73A 1I6XA 1DUXC 2M1BA 1YFHA 5LLQA 2FQ3A 4ETSA 3FHZA 5DCMB 2L01A 1ULYA 1EV7A 2NRAC 2ZXJA 4OMYA 4ESBA 4CXFA 2VN2A 2A61A 3KLNA 3R61A 4HV6A 4IPAA 2AXLA 2GZWA 3W6KB 2JT1A 4A6EA 4MTDA 3GX4X 1FZPB 2VBYA 4EJWA 2QLZA 5AIPA 3C18A 2Y48A 2H6CA 2KKOA 2L4AA 5HLHA 5LGUA 3WG9A 5H6RA 5D8LB 1S6LA 5H6QA 2Z9OA 2XGXA 3ZN1A 4L0ZB 3MEXA 2QUFA 4HV5A 1KA8A 4RGUA 3D0SA 3BZ6A 4BNCA 3R4KA 1T6SA 3GZ6A 2LF7A 5ICCA 2O0YA 3VEPA 1XGNA 5FO5A
chains in the Genus database with same CATH superfamily
2ZO4A 1YYVA 3DBHB 1R4NB 1D8KA 1JT6A 3V8LA 4XSZF 4J19A 3HKZA 3W2VA 1ZG5A 2W48A 1EJ9A 2R7ZJ 1WVRA 2V9VA 2RVCA 2GOXB 2BY2A 1B9NA 4MNUA 2CQQA 4LMYA 4KN7X 3W6VA 1HKSA 2ZC2A 2FUG2 3P9CA 3NQOA 2JPCA 4ZJZA 2L54A 1R5GA 2DA1A 1QZYA 2BY3A 3BLYA 2VQLA 1KU9A 2ZNYA 1RZ4A 2XAJA 3JRHA 1FEXA 2ISZA 4CGZA 2R92J 2WBMA 5C4XJ 1TC3C 1Z3YA 2FRHA 1XGSA 1ZELA 3KX2A 5KVRA 4CSWA 2EFPA 3VFZA 3QYEA 4B3XA 4BUPA 4RLFA 1ETXA 1V55H 1IC8A 4BXXJ 1GXQA 4M9ZA 2X6XA 1YS6A 1IV6A 4OIOF 4C2UA 1HKTA 1ZYRF 3PIOF 4MIMA 2F4OB 3SJMA 2G9WA 4RGRA 4X1EA 5FB2A 3C7JA 4I2OA 1ZGJA 2K27A 2VONA 2QSFX 1P6RA 2HVSA 5ILVA 3M4OJ 2GQQA 2P6SA 5L3EA 4LK0F 3RKXA 4RB1A 2LR8A 1BC8C 4PZJA 3I55I 1WFXA 1MDMA 3VB2A 1XMXA 1KU2A 2HGCA 4KFCA 2WY7Q 1Z9CA 2W1OA 1IF1A 3AL0C 3E6DA 2FEZA 3AL0B 2DK8A 4OAZA 2GBYA 1BN5A 1OYWA 1RR7A 4GYIA 4CZZA 2IEKA 3N4MA 5CYVA 1KGSA 3Q3SA 1MNDA 4RB3C 3LA7A 5DCMA 4KJZA 2IXSA 5ICEA 3WTXC 2L5QA 3OYBA 3H9JA 1QVTA 1J75A 4FISA 4IX7A 3HKZN 2ZXWH 1ORKA 4BL0B 4KIBA 1N75A 1FTZA 2EZKA 4ZC3A 1IV8A 3G2BA 1STZA 3NRVA 4HEA2 2H27A 1RESA 2B7EA 4CCLA 4PCQA 1VQLI 1W7PB 1ZRDA 4XKCA 4B4CA 3LSKA 5IT3A 3JRFA 3TDZC 1V4RA 2ZMEA 2V9KA 1R00A 3DTEA 2LH9A 2BYVE 3SZPA 1W36D 4GRIA 2E36A 2E19A 3PNYA 1CF7B 1DPRA 3BJ6A 2HTSA 5GPCA 2DOEA 4ZH4F 5H2FC 2XSDC 2HS5A 1IRZA 1APLC 2ZJQF 3JAMZ 3NAUA 1KONA 3BCAA 4NBQA 2M2EA 1UCRA 2VC1A 2DT5A 2Z1DA 4EM2A 5DTDA 4Y13A 1VQKI 3RPQA 2JRTA 2GWRA 3PIPF 3F72A 4DNCA 1WI9A 5D5VB 2K3PA 1K79A 2ZXIA 4KIFA 3MMYB 2BXYA 3LSPA 1EA3A 3D5RC 3I64A 4LLGF 5KAFC 1PDNC 2A6TA 2F4IA 4L5IA 2E7XA 4LG3A 4FTHA 2J5PA 4OWRB 3JW4A 1IGNA 1ZKGA 1YRNB 3E6CC 2K9SA 5BPIA 3S32A 3BTIA 1ZLJA 3S8PA 3LSJA 3OYNA 1FT9A 5CVUA 2BVMA 3MZHA 3F8NA 1KQ8A 3OSGA 1F4KA 2MA3A 4G12A 3MAJA 3OYLA 2LRDA 3K70C 1D8JA 3I59B 1OMIA 2LNBA 1QQIA 1R23A 1ENHA 2QQBA 4ESJA 1WZ2A 3DPTA 3L2WA 1KU3A 2E1MC 2E1MB 3LSTA 3QOEA 1R1UA 1S7OA 1DQUA 1JJ8C 1T33A 3RZDJ 5DCFA 1R5HA 3G1MA 2Y69H 2ZJRF 2F5VA 4B8XA 2XHKA 2IRFG 2OCEA 3L7WA 4KNYA 1IDZA 4ZYHA 1IW7F 3DU6A 3WU2C 4A5NA 1XSXA 1UZCA 3I0TA 1I27A 1XGOA 1F36A 4B47A 2ESNA 4GDFA 1MSFC 3VODA 2NS8A 3IC7A 2BY0A 1XMAA 4ZTFA 1IG7A 5GAGJ 1VQ8I 4XONA 1C0WA 3BR0A 1T08B 2Y31A 1WHUA 2GA2A 3DTIA 3VYSB 3BJAA 1NK2P 3J7ZI 3F22A 2A3SA 1YE9A 4DOZA 1L3LA 1J7KA 1X4OA 1ZN2A 3H5RA 3I53A 1BC7C 4BE1A 2DU9A 1GV5A 3RQIA 3CCSI 1TT5B 4G6QA 5F6FA 3SDGA 4E70A 3M1EA 4XKWA 2JA5J 1ZTRA 4UXNA 3KPHA 4N4NB 4UVCA 3I3LA 3H5AA 1RC9A 3CF2A 1TP4A 3ZMUA 4DZJA 2DW4A 2JSPA 4ANJA 2LK2A 2ZNZA 5IOZA 1E0EA 3CDLA 1JTYA 5B66C 4IHYA 4KT5C 2X6WA 4RMNA 3PQJA 4G6TB 3U9GA 3GW2A 1PUFB 4XNFA 5D4SA 4Q48A 4CUGA 4CYCB 1MNEA 2IS6A 4E7ZA 1JKPC 1W0UA 2XGEA 2V7FA 3F8MA 5E17F 1PUEE 4Y7NJ 2DFHA 2A6HF 4QIWN 1YW7A 5F0FA 1PYVA 3HOVJ 4HSRA 2RKHA 4G94A 5EJCA 5J47A 1CGPA 4IKFA 1K6YA 3K4LA 5LGTA 2KPMA 2XPUA 4C2MJ 3HTUA 4A6DA 3IRQA 4A0XA 2DFEA 3ABUA 3WE2A 2C6YA 5GP9A 2PLYA 2WAFA 1BW6A 4WF2A 1HW1A 1HQCA 2OQRA 1SFKA 1GDTA 1E3HA 4HOBA 2YSRA 4DQ2A 3OYMA 1H9GA 4M3DA 2K7LA 1FP2A 3KEYA 4BXFA 2FOWA 1JKRC 2NS0A 4A3EJ 3F0CA 4XLHA 2GA1A 4PJLA 4A3CJ 3M3YJ 5L3DA 3Q5FA 1KU7A 3V8KA 1O3SA 4LIUA 5D4RA 3OL3A 1D5VA 1XCBA 3WHCA 2IVMA 1VQMI 5BNGA 4PJJA 3JRIA 1LDKB 2K86A 1G3WA 4IEJA 1MIJA 3EUAA 3BR5A 4ZTJA 4JQFA 4RB2C 4BY1J 1BBYA 4CICA 2IGKA 2IGNA 2XAHA 4M6XA 5J4YA 1FOYA 3MWMA 1OQYA 1PP8F 2HNHA 4EEFG 1SFUA 2NVUB 1E17A 3S3OA 1OCRH 5HDGA 3FK6A 2CH0A 2KRHA 3HPHA 4AIJA 1OCCH 4BQNA 1YRNA 1ZG3A 2OUMA 2MH9A 1MBGA 4A3IJ 5L3FA 4P5OA 1ODDA 4AD9A 2XAUA 1J09A 5LRRA 4HQMA 2QYOA 3PQKA 2DYSH 4X0GA 2XAFA 2YU9J 4F52A 1QNTA 2FSWA 2DMNA 3F21A 3RPUA 5EGOB 1SVOA 4BDYA 4KDPA 5JR3A 3PO3J 1XMKA 2HOEA 1SAXA 4AIKA 2DOAA 3W3CA 4HW0A 1OCZH 1U2WA 3ERED 4IQ4A 4XSXF 1WQ2A 3AFHA 2W7NA 3REOA 3O2PE 3ZMZA 2YX4A 3SFIA 1WSUA 2Y9ZA 4A3BJ 2KFDA 2M8GX 3PJRA 4ZYAA 2DMTA 1X1CA 2I10A 2IT0A 1O7LA 4HPQA 3PUFA 4ZDOA 1ON2A 2VJIA 2X4HA 1JI8A 4AU7A 1LVKA 4FETA 4UNOA 2L4MA 3IH3A 2GIZA 3QP6A 4CH7A 3E0JB 2KISA 2W25A 3DCFA 4ENNA 5FKOA 4A3GJ 2MBFA 3ZQCA 2KRFA 2M30A 2YX7A 3NEUA 3OWTA 1VNDA 3PFYA 2Z33A 2O9LA 2K9NA 2X1DA 2YUSA 1VQOI 2V4JC 4XMYA 1JTXA 3RTRA 3OYHA 1AKHB 2VOOA 4XOTA 1YS7A 2FQ4A 4BS9A 4G8XA 2VJ5A 2M45A 4LGWA 3S3NA 1ETWA 3V42A 2O8KA 3K4BA 3TKYA 3L2VA 3CC2I 1B72B 3IL2A 1PVEA 1K4TA 2LFBA 3ZQHA 4RB0A 4MHGA 1UAAA 4JX5A 3BTLA 2CGPA 5B3SH 2GOMA 4PGHA 1ZGAA 1DGWY 1S3JA 3AG2H 5KHDA 4A3JJ 2R7WA 2VPLA 4DIQA 1YO5C 1YJNI 1Z6RA 1JE8A 4LG0B 4LB6B 4V19K 4CYCA 2HKXA 2TCTA 5ILSA 2VIXA 4KN4X 5CJ9A 4Z2YA 2W85A 2V6CA 2OTLI 1BM9A 3HSRA 1LFUP 1XG1A 1B8IB 5KK1A 4G7ZF 1AWCA 2E1CA 2LREA 4RM2A 3E6MA 3F23A 3RKQA 1QGPA 1DU0A 1S9HA 5F08A 2DJIA 3QOPA 1EH7A 3LNQA 5K5OA 4PGGA 4D0PA 2XSJC 3GZ5A 2N8GA 3IKVA 5LEKA 1I5ZA 3GVAA 2DTZA 3I4NJ 2DO7A 2XUBA 3HYIA 2G7UA 3MFKA 4HX4A 3HOSA 4RGXA 3F9KA 3DBLB 2B63J 3WTVC 1YJWI 1IUYA 3CJNA 1ETQA 3IUOA 2EV6A 4MEYF 4XRSG 3ZRGA 2DQRA 3ERMA 1G59A 2L9VA 4EV0A 5FROA 5IOYA 4MEXF 1T0FC 1Z1DA 3OIOA 4NUBA 2P81A 3B02A 1K7AA 2X6OA 3GFLA 4BHBA 3ZMVA 2XDVA 2ZSIB 5LHHA 3LAJA 2E71A 1HLVA 3DEWA 4ASNA 2R93J 4OINF 3R0AA 4XL9A 5DD8A 3BQZA 4E7HA 2PG4A 3FKIJ 5CLSA 3OYGA 3DXJF 5ERIA 1M1EB 1O3QA 2M34A 1XTAA 2EFNA 2IPQX 2QBYB 2VL8A 3Q0UA 1LJ9A 5EZGA 3WE3A 2VLAA 3CCJI 4OIQF 6PAXA 2CSOA 1D0XA 2LY1A 3A2KA 4XORA 2M9HA 4HBLA 1P4XA 1R22A 3A03A 1F43A 3FZVA 1EH6A 2OTJI 3L9FA 2KDZA 1OISA 2P7CB 3GCMA 3H92A 3E5QA 5BPDA 4S0HB 2NXNB 1D1BA 3ABLH 5D5UB 2L02A 5FLXZ 2QVOA 4BAYA 4A3LJ 1B59A 2ID3A 2LKSA 1MBHA 4E7SA 2XF6A 2ESHA 2OV7A 5K7HA 2CV2A 2UXXA 5DM6F 2IAIA 1D1AA 2ECCA 2MFZA 1Y6IA 2D1VA 3F8BA 4BYYA 4UUVA 3IH4A 3OR1C 4KICA 4IJAA 4XLEA 1ZHFA 1ETKA 4L9NA 5K7ZA 3L2CA 4LJZF 1I3QJ 4OIRF 5HNFA 2MC4A 3JRCA 1H8AC 4AYBA 2R7VA 2VUMJ 4UV8A 2R0QC 2DA4A 2XROA 1RUNA 5KAIC 5BQTA 5J1YA 4UV9A 2K9LA 1A6QA 1ZLKA 2XAQA 2D2WA 5H20A 1T39A 3LA2A 2ZMEC 3HEFA 2ZMEB 1XS9A 1JUPA 3WGHA 1QZEA 1UHMA 2JA7J 1XB4A 1V54H 3H3ZA 2EB7A 2A05A 4FE7A 2Z5UA 3DQVC 3ZQIA 5AONA 2HVQA 5DM7F 1WJFA 3HL2A 1AKHA 1Z0XA 3A0HC 4ZZLA 5IYCJ 2HXIA 3HPGA 4QWQA 1W5SA 1S7AA 1VZ0A 2LP0A 5LBQA 1BOBA 2OD5A 4RM3A 3GTJJ 1P4AA 3ONQA 5FKKA 2Y0SA 4PUSA 2HWVA 4RS8A 2KIUA 3KP6A 3CC4I 3FXKA 3RYPA 3OYCA 5E3NA 1IO2A 1USTA 2ICWG 2BHZA 3S14J 3P9IA 4RAFA 2IW5A 4ENKA 2ZFWA 3KZZA 3HHGA 1ZR2A 2DA2A 2OZUA 2O7OA 4R8HA 4LG0A 3FMQA 1W4MA 1FWZA 3BC8A 2JA6J 5CVRA 3V8JA 3IAS2 1LVAA 1RKWA 1BI1A 3FX3A 2IJLA 4A5MA 1XDUA 4B48A 2QCOA 4JK1X 2EQRA 1TZLA 4AIDA 5L3CA 1DU6A 1B8IA 1IN5A 4CCNA 4CA0A 2NYXA 4BJ6C 3WTTC 3OYKA 2ME0A 3EYIA 2DDBA 4ZYGA 5GPAA 1MBFA 3H0DA 1A36A 5DD4A 4WXDA 3TGNA 3I54A 3TP3A 1RUOA 2BV6A 2LYCA 4MTEA 3S1QJ 5AIQA 2L0KA 1IRXA 2YR2A 4IHXA 1NHAA 3J7YJ 2LC2A 2W4SA 2BGCA 2H09A 2PBIA 1AOYA 4GXOA 2DPUA 4AYBN 4DBQA 3O8GA 5M5WJ 3C2HA 4BQQA 1MMDA 1MSEC 4C9YA 3DKXA 3D5SC 4I09A 5C4JJ 3TW7A 3LA3A 3GF2A 2JJ7A 4EVIA 5BOXA 3ISPA 2Y9YA 3SQNA 3MKZA 2HZTA 3C3WA 3J81K 2CS3A 3O6BB 4O3MA 3N97A 2CG4A 3QAHA 5JVGF 1WJDA 1T0FA 3CF5F 3P5JA 2E7WA 3B6AA 1LDJA 3FXJA 3ZQ7A 3MZYA 1MH4A 2H94A 3F8FA 4HF2A 2COBA 4E7IA 2IA2A 5DEQA 3H9GA 5LEJA 1XX5A 4ENJA 3GTMJ 1PJRA 2Z2SB 3EUHA 2R4GA 1F5TA 1R58A 2BW3B 2XV4S 4JOMA 2RNGA 1R9TJ 1LUJB 2QBYA 1UHSA 4Z6YA 1VF9A 1Z21A 4E7JA 2RDPA 4KA4A 2DFIA 1FOKA 1HXDA 4C30A 2QF7A 4A0YA 1EF4A 4I02A 5A2QK 2VPRA 2R5ZA 5JFRA 1H88C 2I5UA 4Q4ZF 2VQGA 3FDYA 3IP4B 2Q2EA 1MH3A 1HBXG 2VQCA 5K1YA 1HA8A 3MD2A 5JHUA 1FNNA 2K4JA 3M8EA 4WK8F 4RBOA 4EJUA 4F92B 5F04A 4RA2A 2A5WA 2NVTJ 4B3AA 2E5ZA 1QU3A 1QHGA 1FP1D 2VJ4A 3CMYA 2M8EA 2K02A 4I0BA 3WTYC 2R5YA 2F48A 1R49A 1JUMA 2X51A 3GFMA 1YW8A 1USSA 2DMQA 2KZVA 1TQMA 3RKWA 4BH9A 3DV8A 3L2QA 2ECBA 1QO0D 3J81Z 3DLLF 2XASA 3CCRI 1W1WE 2V9PA 4B44A 3M7GA 4U0VA 3BG6A 2QSGX 3TQNA 5JVTA 3F8CA 5HLTA 4XKVA 2CW0F 4LK1F 1WWXA 2XIGA 4IO9F 1IN8A 1WPKA 2E1OA 4GYGA 4J01A 2LLKA 2P5KA 3FISA 3S2WA 3Q0VA 3WGIA 1MNMC 5HLGA 3BJOA 4ZZDA 2A69F 4P96A 3OS2A 4IRIA 4NC8A 1E2XA 1YG2A 2LSOA 3FXRA 3H9QA 5KCMA 3OY9A 5LHIA 1IN4A 2MC3A 4BJTA 4DBRA 3FMSA 3VSLA 3QYFA 5A2QZ 3VPRA 3H1CA 1P2FA 1B6AA 1FC3A 3MKWB 2EZHA 4A12A 1VQ4I 5FD5A 3BZKA 5E3LA 1YJ9I 3CP8A 3OOPA 2KIMA 3ZCOA 1ZRFA 2JZYA 4YRVA 2KIFA 4U87A 3BR2A 4S05A 1KQ0A 4NDLA 3PFIA 2HTJA 4IOCF 1X3UA 4BQOA 3CO7C 4ESFA 2D5VA 4YIIA 1A6IA 4LLLA 2VXZA 4DYRA 3GTLJ 4EGYA 1I1GA 2CYYA 5JHFA 5EDNA 1Y8RB 3I58A 3TEDA 1AU7A 2RN7A 1GVJA 3LSRA 3DEUA 4H0EA 1BA5A 2XF5A 1P92A 2EINH 3V7SA 3WHBA 4Y4RA 3LSIA 3BWGA 2ZCWA 4L5JA 1WJCA 4KT6A 2QM3A 1EKEA 4D5FA 4BJ5C 4UB8C 4I76A 1UG0A 2H8WA 3F6OA 2QKLB 1OJLA 4XIDA 5HLIA 3BR3A 1RETA 3WTWC 2WY8Q 1XPXA 1LPQA 5EEGA 4GO1A 1WRJA 1X1BA 5FJ8J 1RI7A 1OCTC 4UB6C 2KT0A 2VODA 1NG7A 3FIWA 1YHQI 4IHWA 2F2EA 1NK3P 3JR9A 4KYWA 5D5WB 4FHTA 1VQ6I 4XLFA 2XB5A 4ZDLA 1QBJA 2FBKA 2BXZA 1I50J 1LFPA 1U8RA 3E5UA 1XSDA 2EIMH 3IWZA 3JRAA 4BDZA 1FLIA 2K3FA 1LE8B 5J1UA 4FE4A 3WTUC 3R0JA 4M71A 1UFMA 2BEOA 3KP2A 2DI3A 4M9SA 4HX7A 1HDPA 3M07A 5M5YJ 4CHUA 2ELHA 4BXUA 2BW3A 2DJNA 1FY7A 5ILUA 2O8XA 2CW8A 4HZFA 4YIFA 3X2QH 2E2JJ 3BT9A 1S72I 4BQAA 4M73A 4A3FJ 2OJED 1BW5A 2LF8A 1GVDA 4XLPF 5J4VA 1FMWA 5FO5A 2HPMA 3I4PA 3CDHA 1X1DA 4DYCA 3IHUA 4HYEA 2EILH 3OYAA 4L9JA 4XRMA 3S2DJ 2DFFA 2ZKZA 4RAZA 1Z6TA 1TQIA 2R7XA 2XVCA 4M3GA 3WGGA 5M3MJ 3DU5A 3PSFA 2MH2A 3IKTA 1IXCA 4UUSA 3HDDA 1Y56A 2VE8A 1UB9A 4B09A 4D5CA 2JVGA 4QPQA 5J40A 5HOOA 4YFKF 1A5JA 3PNTA 4E4HA 3UR3C 3N05A 4EJOA 2EJRA 3WG7H 3SYTA 1SAUA 4C3HJ 1FBQA 3LMMA 2EWNA 2LG4A 4S04A 4F55A 3CCYA 1A35A 3T0YA 1Z05A 4NHJA 2Y30A 3R6SA 1HSTA 2PMZA 2GXAA 2JWTA 3BG7A 3Q9VA 3B6CA 5J8FA 1R7JA 1SMYF 3FXLA 2VXDA 3TP0A 1FOWA 5E8GA 4WCGA 4QLCU 4IRGA 2HEOA 3K10A 3CUQA 3ZQGA 2WTEA 3MN2A 4XR6A 1O3TA 2KDOA 1U6GA 2B9SA 2ADUA 2RAEA 2CU7A 1BI3A 3WTZA 1HW5A 3KP5A 3K4CA 4BEHB 3ECHA 1MJBA 4BGDA 5E18F 1DDNA 3CC7I 3KZYA 2W57A 5IP7J 1BI2A 3CP2A 5GAEJ 3HOZJ 2FBHA 3ML6A 3F3XA 1W0TA 5BS6A 3VDXA 5LHGA 3TO7A 1BI0A 2QA4I 2E2IJ 2HDDA 3LSHA 3ZMSA 3DBRB 1LQ1A 4L18B 5BMZA 4MGRA 5C44J 2ZJPF 2QZ8A 4IHVA 4FX4A 5E8IA 1R36A 1DP7P 1Q1VA 2E60A 4RAYA 4XBFA 1GUUA 2JPBA 4A2UA 1G3TA 2NAZA 2VKHA 2GAUA 1V5EA 2NNNA 4WWCA 1TLHB 4K2EA 1LEBA 2ZB9A 2D45A 2PEXA 4WXHA 1JKOC 2ZBKA 2QQ9A 2HR3A 4G6DA 3VSKA 3LAPA 2HKOA 5TGTA 3K0LA 2V1DA 2NS7A 4I7HA 2XGCA 2DT7B 1ERDA 2MYSA 1U9OA 3DKWA 3GLLA 2FE3A 4FX0A 2HZDA 4UVBA 3UKGA 4II2A 3CDIA 4F91B 1NTCA 3LQQA 4PK4A 1FIPA 5LRSA 2LD5A 3K69A 4JBAA 5GAHJ 3KYDB 5FKNA 3IV5A 3U1DA 4XN3A 2F5FA 2BE5F 4BHPA 3QU3A 1K4SA 1AA7A 3E97A 2OC6A 4BHCA 4CCJA 3ZPLA 2H1LA 1J59A 4BE2A 1PP7U 5CKTA 1LE8A 1BR1A 5F1RA 2O6GE 2QENA 3H5NA 2Q1ZB 1E3OC 2FNPA 3ESWB 3LWFA 2PI0A 1YOVB 2DXIA 4AM3A 3HM5A 1I1SA 9ANTA 3IH2A 4M3FA 1XSVA 4MFDA 4NQWB 2WA0A 2XC7A 2MG4A 1Z3XA 4HX8A 1NG6A 3K6GA 4D1QA 1EH8A 3HC7A 1KZHA 4ZDPA 4AUXA 2WV1A 3A01B 1X1PA 4D7MA 2E34A 1R5ID 2F5EA 5E79C 4NC7A 5EYRA 1G6NA 3CCUI 1U5TC 1IN6A 1U5TB 3SEZA 4II3A 4YFNF 4HLYA 1IJWC 3LL7A 3I56I 2FA5A 4EQQA 4DYQA 2VI6A 1W36C 4OAYA 2CUZA 4P9UA 3HSEA 5D6EA 4AWXB 2ELJA 1FPQA 2VKDA 3HUGA 4PSXA 5IY5H 4JX6A 5ED4A 2A07F 1OPCA 4KISA 2KQRA 1TWHJ 2WB1A 5DDGA 3FF5A 1W7PD 3DLAA 2XAGA 3I71A 1TNTA 2FX0A 3WU0A 1ETVA 2NOGA 1DGRM 4P55A 4ON0A 2MD5A 1ETYA 1W5CC 3FMRA 3ZR8X 3G71I 4H4KC 1MBJA 1BR2A 3JCUC 4Q5SF 1LFBA 2HXOA 2LVSA 1G4DA 3H3UA 3V7CA 4G7HF 4CCMA 3ECOA 2X48A 4C2TA 1KYZA 1SD5A 4EMSA 1OR7A 5JI6A 3TOAA 3TO9A 4D7NA 1FYKA 2DK5A 5D5XB 5KNLA 3E7LA 1IXRC 4GGGA 5EF6A 1SFEA 1SC7A 2EV5A 3G1OA 1ZG1A 4MQVA 4XM3A 1U8BA 1JHFA 1SD4A 3T8RA 2EV0A 3HBLA 1Y1VJ 5DUKA 2CMPA 2QSHX 4F7ZA 2MD0A 2STTA 3QPHA 1ON1A 5LD2C 1FIAA 2DA5A 4M74A 4XLNF 1J2XA 5FLMJ 2AQEA 3FBNB 2HFHA 3KE2A 3ZGKA 3HHHA 3HRMA 3S1NJ 4B1RA 3HOYJ 1VFCA 3LSGA 2WAQA 1U78A 4HNTA 1J9IA 1WCMJ 3A02A 3EUHC 3O3KA 2QQ8A 2G7HA 1TTYA 2IA0A 4BEHA 3BOQA 2XPVA 3RI4A 3CCVI 3BR6A 1HOMA 1B4AA 1FSHA 2DAOA 1YTYA 1O7FA 2PX9A 2HQRA 4KMFA 4YFXF 1FBSA 1YX3A 2LTPA 2DCEA 3C2GA 4JP0A 3K70D 4P1WA 4XRSA 1IRGA 2R5ZB 3JRBA 3HRTA 3BTCA 1RR8C 2CQNA 4FQGA 3FK7A 2Q2EB 4DZPA 3OYEA 3MVPA 4IZZA 3GUDA 4M6VA 3HOWJ 2L9NA 3G73A 5CPRB 3CMEI 3AG4H 2Y2ZA 1LB2A 2FF4A 3NWTA 1QPMA 4CYDA 2ZFUA 2ZXHA 2HPIA 2XGDA 3TOBA 3FHNA 3E1SA 4Y15A 3JTHA 1QPIA 2R7RA 2R5YB 1D3YA 4PJ0C 3W2WA 1VTNC 2V1XA 5E20A 4HA8A 3ULQB 2ETHA 5CVVA 3SEQA 3HSFA 3EETA 4M3BA 1U3EM 1MMGA 4F3QA 5CQEA 5IYBJ 4IHSA 1KQ9A 2IBDA 1X1AA 2LKPA 2GXBA 2Y75A 2OA4A 2L7ZA 2R7SA 3Q9SA 2CW7A 1G3YA 3E3VA 2E1NA 2NVYJ 5IP6A 2HOTA 3CLQA 2CQKA 4HDVA 1R6RA 1D1CA 2R7DA 1RRJA 2LY9A 2UZKA 1IXSB 1R71A 1OKRA 2UV1A 2M87A 1X2MA 3HB9A 1N77A 5FGMA 2QGUA 3HGYA 3BG3A 3MKLA 3PL8A 2HDWA 3C2BA 2X0LA 3QPSA 2CFXA 3OYJA 2BOLA 4U7DA 3G1LA 4QSHA 4NQWA 5D8KB 1ZR4A 2M4KA 2VQHA 3CO6C 2JA8J 5CQGA 1K78B 2Z16A 1MMAA 2QWWA 4LOCA 2A68F 1Z91A 3DTKA 2LBFB 3A01A 1K83J 2R7TA 1OCOH 3TDUC 3GLXA 2X6YA 1U5TA 1WJAA 2E2HJ 2R7UA 3SHFA 1TW2A 2MABA 3UNGC 2UWMA 3GFIA 1FTTA 5CVJA 4HNVA 2OPTA 5M5XJ 5HODA 3QYBA 3HRUA 2R7QA 2UXNA 1VQ5I 1OYYA 3GTPJ 5FFZA 5HS8A 5TJJA 2D1HA 1FYLA 4MQ9F 2P6TA 1MBKA 1SANA 2K9MA 2CWEA 1YIJI 5HS7A 4YEJA 5K5QA 3DWLE 2BBYA 2KJCA 5E1ZB 1G3SA 3I9V2 5DS9A 2DN0A 3ZN0A 2RGVA 5K7FA 4HNUA 3P9KA 2M3AA 1ZRCA 2VT2A 2KP6A 4MO7A 3ZQQA 3E5XA 1JT0A 2F4MB 1IZ1A 3ZQFA 2IGMA 2MW8A 1YI2I 1BIBA 5JLWA 4EM1A 1Z77A 2CRGA 4IQJA 4N9HA 3S1RJ 3PO2J 3G6EI 1R4MB 2OAZA 4HSTA 2WC2A 3CMAI 1R1TA 3KLOA 5FLVA 1IRFA 2H6BA 3OV8A 4M72A 2DYRH 4NNJA 1Y1WJ 2LMDA 2Q0OA 3KETA 3KEOA 5E1XA 1QVUA 4V2GA 2VASA 1MD0A 4BBRJ 1NH3A 4X6AJ 3L00A 1I39A 2YU3A 2AO9A 1P4WA 3KYCB 1H89C 2CV1A 2V6EA 2FJ1A 1H9TA 1RNLA 1A04A 2Y0SN 2OU2A 1SD6A 2Z3YA 1CQTA 4A93J 3L2UA 3KP3A 1D0YA 4A69C 3LQRA 1J5YA 4HF1A 5J1RA 1BIAA 2JRMA 5LFAA 2XRLA 3WODF 1BJAA 3JTGA 3QRFF 3J80K 3L2RA 2RQQA 1F1ZA 2J5OA 3Q0WA 3OS0A 5EZHA 3CCMI 1FYMA 2GIVA 2KHMA 4F93B 5HDKA 1GXPA 3ZP5A 2A5YB 2XPWA 1MZBA 2ZSHB 2CUEA 2KL4A 4NB5A 4PDKA 5K5RA 1G2HA 5TRDA 3JAMK 2DA7A 2R7FA 4LLNA 2IS4A 1BJZA 4N9IA 4RAGA 2IGOA 3QODA 3JSPA 2STWA 1S29A 2NVXJ 4BE0A 2KJBA 3IWFA 3U2RA 2HDCA 2M0MA 2AQFA 3T8TA 3DKYA 3H35A 4UVAA 3CCQI 1G8XA 4UUSB 2EA4A 2M4GA 3KP7A 5B1AH 1FOXA 1WJ5A 4DGWB 3HOTA 1Z7UA 2LDUA 2DDAA 3R60A 2HQAA 3S15J 2DTRA 2ELKA 1D0ZA 2LKXA 3QPTA 2EFWA 3GTOJ 4CO8A 3ZMDA 3TO6A 3KCCA 4L9TA 3CTAA 4KMUX 1VQ9I 5J6XA 2L3DA 4WXCA 3OYFA 3GEZA 3OSFA 1JKQC 2RC4A 4XLAA 2AS5F 5DV5A 4HG2A 2LY2A 4M9XA 3DFGA 3D1NI 3QU6A 4A3MJ 2PJRA 4AVZA 4I99C 2QEXI 5GTIC 4YIRX 3H3VK 1MW7A 1N25A 1VQ7I 1LNWA 2K40A 1TQPA 2K4BA 2FXAA 4C3JJ 3CUQC 3GWZA 3CUQB 4I6ZA 1SFOJ 3A0BC 4PFPA 4R79A 4MFEA 2V1UA 3J80Z 2JSCA 3S93A 4BKXA 1MBEA 3FKJA 3KIOA 1IN7A 4ABZA 1K78A 1JGGA 2LBFA 2RREA 2JK3A 4OOIA 3VYUB 4AIHA 5E3OA 2QKMB 2XB0X 3KP4A 1ZAOA 5HNHA 5IT9K 4LD5A 4EJTA 4EGZA 4CCOA 3ABTA 2P8TA 1K6OA 2MLKA 4Y17A 2V1NA 4I98B 3DEEA 1ITYA 2JTVA 1HDDC 2BZTA 5IPAA 5HDNA 2KLOA 3JRGA 5F1JA 2DODA 1AHDP 2JUCA 2O61A 2P5LC 2VBXA 3BG9A 3GYHX 1YIOA 2HU9A 1XN7A 1WJBA 2A6EF 3LOCA 5ICGA 3SDBA 2MLGA 4HAMA 5JLXA 1GV2A 4L9VA 3KYLA 2JUGA 2ACJA 3W2AA 3MQ0A 4OMZA 4U88A 4XQFA 2B0LA 4HLXA 5J3LA 3JRDA 3K7AJ 3FXMA 2EA2A 3AKZA 5E1WA 3CD6I 2RQPA 2GXGA 2CQXA 2CUJA 5B5EC 3K4MA 2HQ5A 4JX4A 1BL0A 1GHCA 3LSMA 4AVPA 3JREA 2EFOA 1XDSA 1S5LC 4OIPF 3DPLC 5FD6A 4PFOA 2XF7A 2BY1A 2TDXA 4HQEA 4HF0A 1XCVA 1J0RA 2ISYA 4DJAA 2FNAA 3K2ZA 2O3FA 1TWCJ 2HYFA 3GBGA 1E3PA 1ZREA 3CJQB 3K4KA 1DPUA 1GT0C 3VOEA 3WTSC 1FBUA 1TWAJ 5IT9Z 1ACIA 4L0YB 4GCVA 1V5FA 3BY6A 2EK5A 4XN0A 5F27A 4IL6C 5E3MA 1I6HJ 2CJJA 2EH3A 4HDUA 1IUFA 4TV7A 3CMMA 2I8DA 3SZTA 3HTSB 4RGSA 4I0AA 1REPC 1VI0A 3ABKH 1X3WB 4O5VA 5F0CA 1V3FA 5CVIA 3RDIA 1FJLA 1WJEA 4G7OF 1YX5A 1LEAA 3HUGB 2EFQA 2IS2A 4J00A 2AHQA 2GM4A 1P7IA 2L7FP 4KUMA 2ID6A 1YW9A 4FASD 3C1DA 3TW6A 1QA6A 4N4OB 2V79A 4ZYDA 2FOKA 3V7RA 3G3ZA 2OCCH 1U9NA 1HKQA 1QZZA 1JUSA 2VKEA 2MSYA 4Y33A 1OR7C 5D6FA 4ENMA 4Y3OA 2VE9A 1W5TA 3ZMTA 3ELKA 1TNSA 4LITA 3K4JA 4I01A 2FU4A 4QPOA 1V5GA 4ITVA 4IHTA 3L09A 1TWGJ 2VBZA 4IXAA 4KIGA 3BP8A 3RZOJ 3LFUA 3EDPA 2KRCA 3HIFA 5FFXA 3CCEI 1R1VA 3NARA 2OZ6A 3AG3H 2E35A 1Y8QB 2DPDA 3EUKL 2HYGD 2PFBA 1OFCX 2DMUA 3K9TA 2CO5A 3ABMH 3CESA 4BBSJ 3K1NA 1W7PA 2BVLA 2K5CA 4CDGA 2L2OA 1HC8A 2WV0A 2Z99A 3AG1H 3M9AA 3QQAA 3WU1B 1F9NA 4WX9A 3GTKJ 2BHYA 3U21A 1T8IA 1TBXA 2EZIA 2L9RA 5HVQC 4XRFA 3SFZA 1OYIA 3RYRA 2P5VA 1IAWA 1CF7A 4JYKA 4A3KJ 1QHHD 2VKVA 3G4SI 1VQNI 3OL4A 3HJEA 2HOSA 4LFUA 1MJ9A 3HOUJ 5GTHC 3PUBA 4A0ZA 3T5XA 2PMUA 2GLOA 4CCKA 3BZCA 1Z67A 3SXYA 1RIOH 1S8NA 2DMPA 3BPVA 1FX7A 1SVMA 1TT0A 3F6VA 3GFJA 1SD7A 1JHHA 4CZCA 2OBPA 4R1HA 4DW6A 1OLTA 3ZOBA 1IDYA 5EEAA 3HXLA 2RNJA 4HRIA 1TWFJ 3KEQA 2L7KA 5EG0B 4U0WA 2DOFA 2Y0MA 5HS9A 4MLOA 4B43A 3E6BA 3PM1A 2COMA 3BPXA 3P7NA 5GADJ 1O4XA 1LKXA 2KMUA 1T56A 3BROA 3QP5A 2DA6A 3OYIA 1UG2A 3GTGJ 4E7KA 1BOAA 5L3GA 2R7OA 1ZGWA 2JQ7A 1MKMA 4Y52J 4BU2A 4BY7J 4E7LA 3BCBA 2RV8A 2PMHA 3VWBA 1MJAA 3CJTB 3FM3A 3J7AO 1MGTA 1YQAA 3GZNB 1UELB 1Y0UA 3DP7A 2AXTC 3FWEA 3SZGA 1ONVA 4EM0B 2IS1A 4UHTA 2O5RA 2VT3A 2VB6A 1I3AA 1FMVA 3H36A 5LGNA 3I59A 1O3RA 3CLOA 2IP2A 2W24A 3FXQA 5DYMA 4LIVA 2PMZN 1XC5A 2XKOA 3ROUA 1K61A 3EYYA 2JVHA 5EEHA 5L3BA 2XKPA 4U7BA 1D5YA 3M8FA 2NNYA 2R3SA 1UHWA 1HSJA 2DLLA 1KYWA 1T98A 3PNVA 1U0JA 3S16J 1JXSA 4M6YA 4G9YA 2L7MP 3GO5A 1XD7A 5J8CA 5C3EJ 2E5NA 1XGMA 4IRHA 3FXUA 2TRTA 1WGXA 3W6JB 4BACA 2WADA 2H1KA 3NWSA 2OF7A 1BR4A 1LDDA 4YELA 5F0HA 2WAEA 3S3MA 4L5EA 2K85A 2CV0A 1B9MA 3FBIB 3GXOA 1UJ8A 2PN6A 3RJPA 3AAFA 4N0BA 1SFXA 1WKMA 4UY8I 2L9SA 2M7BA 4IVNA 2W84A 1SEUA 2EZLA 3I4MJ 1X58A 4PJMA 3U1KA 3CUOA 2DQLA 2DBBA 1ZH5A 4XLCA 1DP3A 3OMYA 1Q1HA 3EQLF 4W97A 4EJVA 4A3DJ 3JSOA 4XOPA 3M8JA 3BQYA 3V4GA 2XRNA 3PSIA 3K1PA 1PUFA 2FMLA 3GMEA 2VOPA 2FMYA 2HOAA 4LB5A 4IF4A 5DUIA 2QQAA 2ME6A 1FSEA 2YPRA 1L0OC 3FM5A 1QRYA 2P7VB 2JA2A 5FKLA 2HQNA 3LFKA 4PJNA 2NOJB 4FT8A 5F64A 4IOAF 3OYDA 2M5WA 3K2AA 4UUTA 1MMSA 3BTJA 2F5CA 3H0GJ 1B1BA 3IRRA 4E6KG 5FLXK 4EATA 5FRNA 4GFBA 2DT6A 3D5LA 2ZJ2A 4YG2F 3COAC 3J7AY 2VC0A 3ZXSA 4XK4A 3RKYA 2X85A 3I5UA 3KFWX 2HVRA 2PJPA 3ASNH 1HW2A 2FBIA 1T38A 2VJJA 4RDUA 3DPUA 5ICFA 2KZGA 1HCRA 1ZARA 5FRMA 2CQ7A 1MMNA 2P4WA 3BDDA 1X19A 4U0YA 3BG5A 1Y0NA 3CCLI 1T2KA 4W1UA 3HGGA 3FXOA 3RIRA 2F5DA 3OIQA 1TW3A 4OU0A 1SVLA 2Q8KA 3K4NA 5M3FJ 3T1BA 3HRSA 3IAM2 1O57A 1X4PA 1YLFA 3EPZA 3RPUD 3BR1A 3OR2C 1JJ6C 2NVQJ 3VYTB 1P7JA 2WWYA 2O03A 4D9JA 1SMTA 2IA1A 3HOXJ 4Q47A 4O6JA 2OQGA 2HI3A 4ZYEA 2LOOA 2X1CA 3MKYB 2CUFA 2X9DA 5EG0A 2JMWA 4AC0A 1UMQA 3OOUA 2VBWA 3HG9A 3CJRB 4KITB 2FD5A 3OS1A 2WB1N 3DF8A 3K1MA 2EIJH 3A1YA 1MDMB 1ETOA 4QTRA 3VYRB 2PQ8A 1JGSA 4P9FA 4FCYA 2K9QA 2JN6A 2X1EA 1H0MA 2EIKH 4C3IJ 5TISC 3B73A 2YS9A 3CZ6A 1P9QC 2UUZA 1I6XA 5EGOA 1DUXC 2M1BA 3TBIA 1YFHA 5LLQA 2FQ3A 4ETSA 1WH5A 1A31A 3TL4X 3FHZA 5DCMB 2L01A 1ULYA 1WH7A 2F6CA 1N78A 3HZJA 3L1PA 1EV7A 2M0CA 2NRAC 2HYJA 1S7EA 2PJRB 2ZXJA 4OMYA 4ESBA 4CXFA 2VN2A 3QPLA 1POGA 3ASOH 2A61A 1GLNA 1Y39A 3KZIC 3MZ8A 1T95A 4RLQA 3KLNA 2M7AA 3R61A 4HV6A 2EBIA 2WAQN 4IPAA 3QWLA 1YITI 2AXLA 3RQ4A 3RCOA 5IYDJ 2GZWA 3W6KB 2G0EA 2V26A 1X3ZB 2JT1A 4A6EA 1HF0A 4MTDA 1OCPA 1ZQ3P 3GX4X 1FZPB 2VBYA 1RKTA 2W82A 4PSWA 4EJWA 5B1BH 2DA3A 2QLZA 4XICA 3S17J 5AIPA 3C18A 2EPFA 3OIPA 2Y48A 2H6CA 2KKOA 2L4AA 5HLHA 2H8RA 5LGUA 4V2FA 2W00A 3WG9A 1B72A 2MGQA 5H6RA 5D8LB 1S6LA 5H6QA 2Z9OA 2XGXA 3ZN1A 3RSNA 4L0ZB 3MEXA 4XKBA 4M3EA 2QUFA 1WI3A 3TMOA 1TL8A 3CQZJ 4HV5A 3GTQJ 1KA8A 1ZK8A 1Z7LA 4RGUA 5FKMA 3D0SA 3BZ6A 4BNCA 3S1MJ 1RPWA 3S2HJ 2KIQA 1VQPI 3R4KA 3ZQLA 1T6SA 3GZ6A 2LF7A 4NC6A 5ICCA 3O8HA 3M1CA 3A4CA 2O0YA 3VEPA 5IP9J 2CFOA 1XGNA 1X2NA 3MCZA 2P0WA
chains in the Genus database with same CATH topology
2ZO4A 1YYVA 1D8KA 3V8LA 4XSZF 1ZG5A 2V9VA 2RVCA 1B9NA 4MNUA 4LMYA 4KN7X 1HKSA 3P9CA 3NQOA 2JPCA 2L54A 1R5GA 1QZYA 1KU9A 2ZNYA 1RZ4A 2XAJA 2ISZA 4CGZA 2FRHA 1XGSA 5KVRA 2EFPA 3VFZA 1GXQA 4M9ZA 1YS6A 1HKTA 4OIOF 1ZYRF 2G9WA 4RGRA 5FB2A 3C7JA 4I2OA 1ZGJA 2K27A 2VONA 1P6RA 5ILVA 2GQQA 2P6SA 5L3EA 4LK0F 3RKXA 4RB1A 1BC8C 4PZJA 1MDMA 3VB2A 1KU2A 2HGCA 4KFCA 1Z9CA 1IF1A 3E6DA 2FEZA 2DK8A 1BN5A 1OYWA 4GYIA 4CZZA 3N4MA 5CYVA 1KGSA 4RB3C 3LA7A 5DCMA 5ICEA 3WTXC 1J75A 4KIBA 1STZA 3NRVA 2H27A 4PCQA 1W7PB 1ZRDA 5IT3A 3TDZC 1V4RA 2ZMEA 1R00A 2BYVE 3SZPA 1CF7B 1DPRA 3BJ6A 2HTSA 4ZH4F 2HS5A 3JAMZ 1UCRA 2VC1A 2DT5A 4EM2A 4Y13A 3RPQA 2JRTA 2GWRA 3F72A 4DNCA 1WI9A 5D5VB 1K79A 4KIFA 3I64A 4LLGF 1PDNC 4L5IA 2E7XA 2J5PA 3JW4A 3E6CC 5BPIA 1ZLJA 1FT9A 5CVUA 3MZHA 3F8NA 1KQ8A 1F4KA 2MA3A 3MAJA 1D8JA 3I59B 1OMIA 2LNBA 1QQIA 1R23A 2QQBA 4ESJA 3DPTA 1KU3A 3LSTA 1R1UA 1S7OA 5DCFA 1R5HA 4B8XA 2XHKA 2IRFG 3L7WA 4KNYA 4ZYHA 1IW7F 4A5NA 1XSXA 3I0TA 1I27A 1XGOA 2ESNA 3VODA 3IC7A 1XMAA 1C0WA 2GA2A 3BJAA 3F22A 2A3SA 1L3LA 1J7KA 1ZN2A 3I53A 1BC7C 2DU9A 4G6QA 5F6FA 4E70A 3M1EA 4UXNA 4UVCA 3ZMUA 2DW4A 2ZNZA 4KT5C 3PQJA 3U9GA 3GW2A 5D4SA 4Q48A 3F8MA 5E17F 1PUEE 2A6HF 1YW7A 1CGPA 2RKHA 4G94A 5LGTA 3HTUA 4A6DA 3IRQA 4A0XA 3ABUA 3WE2A 2C6YA 2PLYA 4WF2A 1HW1A 1HQCA 2OQRA 4HOBA 2YSRA 4DQ2A 1H9GA 2K7LA 1FP2A 2NS0A 2GA1A 5L3DA 3Q5FA 1KU7A 3V8KA 1O3SA 5D4RA 1D5VA 1XCBA 2IVMA 1LDKB 2K86A 1G3WA 4JQFA 4RB2C 1BBYA 4CICA 2XAHA 4M6XA 3MWMA 1PP8F 1SFUA 1E17A 5HDGA 4AIJA 1ZG3A 2MH9A 5L3FA 4P5OA 1ODDA 4AD9A 5LRRA 4HQMA 2QYOA 3PQKA 2XAFA 1QNTA 2FSWA 3F21A 3RPUA 4KDPA 5JR3A 1XMKA 2HOEA 1SAXA 4AIKA 3ERED 4HW0A 1U2WA 4XSXF 1WQ2A 3REOA 3O2PE 3ZMZA 2YX4A 1WSUA 2IT0A 1O7LA 1ON2A 2X4HA 4UNOA 2L4MA 3QP6A 2W25A 4ENNA 2MBFA 2KRFA 2M30A 2YX7A 3NEUA 2Z33A 3RTRA 2VOOA 1YS7A 4G8XA 2M45A 4LGWA 3TKYA 3IL2A 4RB0A 4MHGA 2CGPA 4PGHA 1ZGAA 1S3JA 1YO5C 1Z6RA 1JE8A 4LG0B 4LB6B 2HKXA 5ILSA 4KN4X 5CJ9A 4Z2YA 2W85A 2V6CA 1BM9A 3HSRA 5KK1A 4G7ZF 1AWCA 2E1CA 3F23A 3E6MA 1QGPA 3QOPA 1EH7A 5K5OA 4PGGA 4D0PA 3GZ5A 3IKVA 5LEKA 1I5ZA 3GVAA 2DO7A 2XUBA 3HYIA 2G7UA 3MFKA 4HX4A 3HOSA 4RGXA 3WTVC 1IUYA 3CJNA 2EV6A 4MEYF 2DQRA 4EV0A 4MEXF 1Z1DA 3B02A 1K7AA 3GFLA 4BHBA 3ZMVA 5LHHA 3LAJA 4ASNA 4OINF 3R0AA 5DD8A 2PG4A 5CLSA 3DXJF 5ERIA 1O3QA 2EFNA 2IPQX 2QBYB 3WE3A 1LJ9A 4OIQF 6PAXA 2CSOA 4HBLA 1P4XA 1R22A 3FZVA 1EH6A 3L9FA 2P7CB 3H92A 3E5QA 5BPDA 5D5UB 2L02A 5FLXZ 2QVOA 4BAYA 1B59A 2ESHA 2UXXA 2D1VA 3F8BA 4BYYA 4UUVA 4KICA 4IJAA 1ZHFA 4L9NA 3L2CA 4LJZF 4OIRF 4UV8A 2XROA 1RUNA 5BQTA 4UV9A 1ZLKA 2XAQA 2D2WA 5H20A 1T39A 3LA2A 2ZMEB 3WGHA 1UHMA 1XB4A 3H3ZA 2EB7A 2Z5UA 3DQVC 5AONA 4ZZLA 4QWQA 1W5SA 1S7AA 5LBQA 2OD5A 1P4AA 2HWVA 4RS8A 2KIUA 3KP6A 3RYPA 1USTA 3P9IA 4ENKA 2IW5A 2ZFWA 3KZZA 3HHGA 2OZUA 4R8HA 4LG0A 3FMQA 1W4MA 1FWZA 5CVRA 3V8JA 1LVAA 1BI1A 3FX3A 2IJLA 4A5MA 1XDUA 4JK1X 5L3CA 1IN5A 2NYXA 3WTTC 3EYIA 4ZYGA 5DD4A 4WXDA 3TGNA 3I54A 1RUOA 2BV6A 4MTEA 5AIQA 2YR2A 1NHAA 2BGCA 2H09A 2PBIA 1AOYA 4GXOA 2DPUA 4I09A 3LA3A 3GF2A 4EVIA 5BOXA 3ISPA 3SQNA 2HZTA 3C3WA 3J81K 3O6BB 4O3MA 3N97A 2CG4A 3QAHA 1T0FA 2E7WA 1LDJA 3ZQ7A 3MZYA 3F8FA 2H94A 4HF2A 2IA2A 5DEQA 5LEJA 4ENJA 3EUHA 1F5TA 1R58A 2XV4S 2QBYA 2RDPA 4KA4A 2DFIA 1FOKA 1HXDA 4A0YA 4I02A 5A2QK 5JFRA 4Q4ZF 2Q2EA 1HBXG 5K1YA 5JHUA 1FNNA 2K4JA 3M8EA 4WK8F 4EJUA 1FP1D 2M8EA 2K02A 4I0BA 3WTYC 3GFMA 1YW8A 1USSA 1TQMA 3RKWA 4BH9A 3DV8A 1QO0D 3J81Z 2XASA 3M7GA 4U0VA 3TQNA 5JVTA 3F8CA 2CW0F 4LK1F 1WWXA 2XIGA 1IN8A 4GYGA 2P5KA 3S2WA 3WGIA 5HLGA 3BJOA 4ZZDA 2A69F 4P96A 4IRIA 1E2XA 1YG2A 2LSOA 3FXRA 5LHIA 1IN4A 2MC3A 3FMSA 5A2QZ 1P2FA 1B6AA 1FC3A 4A12A 5FD5A 3OOPA 2KIMA 1ZRFA 2JZYA 2KIFA 4S05A 1KQ0A 3PFIA 2HTJA 1X3UA 3CO7C 4ESFA 4YIIA 4LLLA 2VXZA 4EGYA 1I1GA 2CYYA 3I58A 2RN7A 1GVJA 3DEUA 4H0EA 3V7SA 1P92A 3BWGA 2ZCWA 4L5JA 2QM3A 3F6OA 3WTWC 5HLIA 5EEGA 4GO1A 1WRJA 1RI7A 2VODA 2F2EA 4KYWA 5D5WB 4FHTA 1QBJA 2FBKA 1U8RA 3E5UA 1XSDA 3IWZA 1FLIA 3WTUC 3R0JA 4M71A 1UFMA 2BEOA 3KP2A 2DI3A 4M9SA 4HX7A 4CHUA 2ELHA 4BXUA 1FY7A 5ILUA 2O8XA 4HZFA 4YIFA 4BQAA 4M73A 2LF8A 4XLPF 3I4PA 3CDHA 3IHUA 4HYEA 4L9JA 2ZKZA 4RAZA 1Z6TA 1TQIA 2XVCA 3WGGA 2MH2A 3IKTA 1IXCA 2VE8A 1UB9A 4B09A 5HOOA 4YFKF 4EJOA 2EJRA 1FBQA 2EWNA 4S04A 3T0YA 1Z05A 4NHJA 3R6SA 1HSTA 3Q9VA 5J8FA 1R7JA 1SMYF 5E8GA 4WCGA 4QLCU 4IRGA 2HEOA 3CUQA 2WTEA 1O3TA 1U6GA 2ADUA 1BI3A 3WTZA 1HW5A 3KP5A 1DDNA 3ECHA 1MJBA 5E18F 3KZYA 2W57A 1BI2A 2FBHA 3ML6A 3F3XA 5BS6A 5LHGA 3TO7A 1BI0A 3ZMSA 1LQ1A 4L18B 5BMZA 4MGRA 2QZ8A 4FX4A 5E8IA 1R36A 1DP7P 4RAYA 4XBFA 2JPBA 4A2UA 1G3TA 2NAZA 2GAUA 2NNNA 4WWCA 1TLHB 4K2EA 1LEBA 2D45A 2PEXA 4WXHA 2ZBKA 2QQ9A 2HR3A 4G6DA 3LAPA 2HKOA 3K0LA 2V1DA 4I7HA 3DKWA 2FE3A 4FX0A 4UVBA 3LQQA 5LRSA 3K69A 4JBAA 3U1DA 2F5FA 2BE5F 4BHPA 3QU3A 3E97A 3ZPLA 4BHCA 1J59A 1PP7U 5F1RA 2O6GE 2QENA 2FNPA 3LWFA 2PI0A 1I1SA 1XSVA 4HX8A 1EH8A 2F5EA 1G6NA 1U5TC 1IN6A 1U5TB 4YFNF 4HLYA 2FA5A 4EQQA 4P9UA 3HSEA 5D6EA 4AWXB 3JTGA 1FPQA 5ED4A 3HUGA 2A07F 1OPCA 5DDGA 3FF5A 1W7PD 3I71A 2XAGA 1TNTA 3WU0A 4P55A 4ON0A 2MD5A 3FMRA 4Q5SF 1G4DA 3H3UA 3V7CA 4G7HF 3ECOA 1KYZA 1SD5A 4EMSA 5JI6A 1OR7A 3TOAA 3TO9A 1FYKA 2DK5A 5D5XB 1IXRC 4GGGA 1SFEA 2EV5A 1ZG1A 4MQVA 1JHFA 1SD4A 3T8RA 2EV0A 5DUKA 4F7ZA 2STTA 3QPHA 1ON1A 4M74A 4XLNF 1J2XA 2HFHA 3KE2A 3HHHA 3HRMA 1U78A 1J9IA 3O3KA 2G7HA 1TTYA 2IA0A 3BOQA 3RI4A 1B4AA 1FSHA 2DAOA 1YTYA 1O7FA 2HQRA 4KMFA 4YFXF 1FBSA 1IRGA 3HRTA 3GUDA 3G73A 1LB2A 2FF4A 1QPMA 4CYDA 3TOBA 4Y15A 3JTHA 1D3YA 1VTNC 2V1XA 5E20A 4HA8A 3ULQB 2ETHA 5CVVA 3HSFA 3EETA 1U3EM 4IHSA 1KQ9A 2LKPA 2GXBA 2Y75A 2OA4A 3Q9SA 1G3YA 3E3VA 2E1NA 2CQKA 4HDVA 2R7DA 2UZKA 1IXSB 1OKRA 2M87A 5FGMA 2X0LA 2CFXA 4U7DA 4NQWA 5D8KB 3CO6C 1K78B 2QWWA 2A68F 1Z91A 3TDUC 3GLXA 1U5TA 3SHFA 1TW2A 2UWMA 3GFIA 5CVJA 3HRUA 2UXNA 1OYYA 5FFZA 5HS8A 5TJJA 2D1HA 1FYLA 4MQ9F 2P6TA 2CWEA 5HS7A 5K5QA 2BBYA 2KJCA 5E1ZB 1G3SA 3ZN0A 2RGVA 3P9KA 1ZRCA 2VT2A 3E5XA 1IZ1A 1BIBA 4EM1A 4N9HA 2OAZA 2WC2A 1R1TA 3KLOA 1IRFA 2H6BA 3OV8A 4M72A 2Q0OA 3KETA 3KEOA 5E1XA 1MD0A 3L00A 2YU3A 1P4WA 1H9TA 1RNLA 1A04A 2OU2A 1SD6A 2Z3YA 3KP3A 3LQRA 1J5YA 4HF1A 1BIAA 3WODF 1BJAA 3QRFF 3J80K 1F1ZA 2J5OA 1FYMA 2GIVA 5HDKA 1GXPA 3ZP5A 2A5YB 1MZBA 4NB5A 4PDKA 5K5RA 5TRDA 3JAMK 2R7FA 4LLNA 4N9IA 3JSPA 2STWA 1S29A 2KJBA 3IWFA 3U2RA 2HDCA 3T8TA 4UVAA 2EA4A 3KP7A 3HOTA 1Z7UA 2LDUA 3R60A 2DTRA 3QPTA 2EFWA 4CO8A 3ZMDA 3TO6A 3KCCA 4L9TA 3CTAA 4KMUX 5J6XA 2L3DA 4WXCA 3GEZA 2RC4A 2AS5F 5DV5A 4M9XA 3DFGA 3QU6A 1LNWA 1TQPA 2K4BA 2FXAA 3CUQC 3GWZA 3CUQB 4R79A 2V1UA 3J80Z 2JSCA 1K78A 1IN7A 4OOIA 4AIHA 3KP4A 1ZAOA 5IT9K 4LD5A 4EJTA 4EGZA 3ABTA 2P8TA 1K6OA 2MLKA 4Y17A 4I98B 2JTVA 5HDNA 2O61A 2P5LC 2VBXA 3GYHX 1YIOA 1XN7A 2A6EF 5ICGA 2MLGA 4HAMA 4L9VA 2ACJA 3MQ0A 4OMZA 4U88A 2B0LA 4HLXA 2EA2A 5E1WA 2RQPA 2GXGA 1GHCA 4AVPA 2EFOA 1XDSA 4OIPF 3DPLC 5FD6A 4HQEA 2TDXA 4HF0A 1XCVA 1J0RA 2ISYA 2FNAA 3K2ZA 2O3FA 2HYFA 1ZREA 1DPUA 3VOEA 3WTSC 1FBUA 5IT9Z 4L0YB 4GCVA 3BY6A 2EK5A 4HDUA 4TV7A 3SZTA 3HTSB 4RGSA 4I0AA 1REPC 4O5VA 1V3FA 5CVIA 3RDIA 4G7OF 1LEAA 2EFQA 4KUMA 1YW9A 3C1DA 2V79A 4ZYDA 2FOKA 3V7RA 3G3ZA 1HKQA 1QZZA 5D6FA 4ENMA 2VE9A 1W5TA 3ZMTA 3ELKA 1TNSA 4I01A 2FU4A 4IHTA 3L09A 4IXAA 2VBZA 4KIGA 3BP8A 3EDPA 3HIFA 5FFXA 1R1VA 2OZ6A 2DPDA 2HYGD 2PFBA 3K9TA 2CO5A 3K1NA 1W7PA 4CDGA 2WV0A 2Z99A 3M9AA 3WU1B 1F9NA 4WX9A 1TBXA 5HVQC 4XRFA 3SFZA 1OYIA 3RYRA 2P5VA 1IAWA 1CF7A 4LFUA 1MJ9A 4A0ZA 3T5XA 2PMUA 3SXYA 1RIOH 1S8NA 3BPVA 1FX7A 3F6VA 3GFJA 1SD7A 1JHHA 2OBPA 4R1HA 2RNJA 3KEQA 4U0WA 2Y0MA 5HS9A 3E6BA 2COMA 3BPXA 3P7NA 3BROA 3QP5A 1BOAA 5L3GA 1MKMA 2RV8A 2PMHA 1MJAA 3FM3A 3J7AO 1MGTA 1YQAA 1Y0UA 3DP7A 3FWEA 1ONVA 4EM0B 4UHTA 2VT3A 5LGNA 1O3RA 3I59A 3CLOA 2IP2A 2W24A 3FXQA 5DYMA 2XKOA 3ROUA 3EYYA 5EEHA 5L3BA 2XKPA 4U7BA 3M8FA 2NNYA 2R3SA 1UHWA 1HSJA 3MCZA 2DLLA 1KYWA 1T98A 1JXSA 4M6YA 4G9YA 3GO5A 1XD7A 5J8CA 1XGMA 4IRHA 3FXUA 3W6JB 1LDDA 1B9MA 3GXOA 2PN6A 3RJPA 3AAFA 4N0BA 1SFXA 1WKMA 4IVNA 2W84A 3CUOA 2DQLA 2DBBA 1ZH5A 4EJVA 1Q1HA 3EQLF 3JSOA 3V4GA 2XRNA 3K1PA 2FMLA 2VOPA 2FMYA 4LB5A 4IF4A 5DUIA 2QQAA 1FSEA 2YPRA 1L0OC 3FM5A 2P7VB 2HQNA 3LFKA 4FT8A 5F64A 2M5WA 2F5CA 1B1BA 3IRRA 5FLXK 3D5LA 2ZJ2A 4YG2F 3COAC 2VC0A 3RKYA 3I5UA 3KFWX 2PJPA 1HW2A 2FBIA 1T38A 5ICFA 1ZARA 4U0YA 2P4WA 3BDDA 1T2KA 3RIRA 2F5DA 1TW3A 4OU0A 2Q8KA 3T1BA 3HRSA 1O57A 1YLFA 2WWYA 2O03A 1SMTA 2IA1A 4Q47A 4O6JA 2OQGA 4ZYEA 2VBWA 3DF8A 3K1MA 1MDMB 2PQ8A 1JGSA 4P9FA 1H0MA 3B73A 1I6XA 1DUXC 2M1BA 1YFHA 5LLQA 2FQ3A 4ETSA 3FHZA 5DCMB 2L01A 1ULYA 1EV7A 2NRAC 2ZXJA 4OMYA 4ESBA 4CXFA 2VN2A 2A61A 3KLNA 3R61A 4HV6A 4IPAA 2AXLA 2GZWA 3W6KB 2JT1A 4A6EA 4MTDA 3GX4X 1FZPB 2VBYA 4EJWA 2QLZA 5AIPA 3C18A 2Y48A 2H6CA 2KKOA 2L4AA 5HLHA 5LGUA 3WG9A 5H6RA 5D8LB 1S6LA 5H6QA 2Z9OA 2XGXA 3ZN1A 4L0ZB 3MEXA 2QUFA 4HV5A 1KA8A 4RGUA 3D0SA 3BZ6A 4BNCA 3R4KA 1T6SA 3GZ6A 2LF7A 5ICCA 2O0YA 3VEPA 1XGNA 5FO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZO4 A;  1YYV A;  1D8K A;  3V8L A;  4XSZ F;  1ZG5 A;  2V9V A;  2RVC A;  1B9N A;  4MNU A;  4LMY A;  4KN7 X;  1HKS A;  3P9C A;  3NQO A;  2JPC A;  2L54 A;  1R5G A;  1QZY A;  1KU9 A;  2ZNY A;  1RZ4 A;  2XAJ A;  2ISZ A;  4CGZ A;  2FRH A;  1XGS A;  5KVR A;  2EFP A;  3VFZ A;  1GXQ A;  4M9Z A;  1YS6 A;  1HKT A;  4OIO F;  1ZYR F;  2G9W A;  4RGR A;  5FB2 A;  3C7J A;  4I2O A;  1ZGJ A;  2K27 A;  2VON A;  1P6R A;  5ILV A;  2GQQ A;  2P6S A;  5L3E A;  4LK0 F;  3RKX A;  4RB1 A;  1BC8 C;  4PZJ A;  1MDM A;  3VB2 A;  1KU2 A;  2HGC A;  4KFC A;  1Z9C A;  1IF1 A;  3E6D A;  2FEZ A;  2DK8 A;  1BN5 A;  1OYW A;  4GYI A;  4CZZ A;  3N4M A;  5CYV A;  1KGS A;  4RB3 C;  3LA7 A;  5DCM A;  5ICE A;  3WTX C;  1J75 A;  4KIB A;  1STZ A;  3NRV A;  2H27 A;  4PCQ A;  1W7P B;  1ZRD A;  5IT3 A;  3TDZ C;  1V4R A;  2ZME A;  1R00 A;  2BYV E;  3SZP A;  1CF7 B;  1DPR A;  3BJ6 A;  2HTS A;  4ZH4 F;  2HS5 A;  3JAM Z;  1UCR A;  2VC1 A;  2DT5 A;  4EM2 A;  4Y13 A;  3RPQ A;  2JRT A;  2GWR A;  3F72 A;  4DNC A;  1WI9 A;  5D5V B;  1K79 A;  4KIF A;  3I64 A;  4LLG F;  1PDN C;  4L5I A;  2E7X A;  2J5P A;  3JW4 A;  3E6C C;  5BPI A;  1ZLJ A;  1FT9 A;  5CVU A;  3MZH A;  3F8N A;  1KQ8 A;  1F4K A;  2MA3 A;  3MAJ A;  1D8J A;  3I59 B;  1OMI A;  2LNB A;  1QQI A;  1R23 A;  2QQB A;  4ESJ A;  3DPT A;  1KU3 A;  3LST A;  1R1U A;  1S7O A;  5DCF A;  1R5H A;  4B8X A;  2XHK A;  2IRF G;  3L7W A;  4KNY A;  4ZYH A;  1IW7 F;  4A5N A;  1XSX A;  3I0T A;  1I27 A;  1XGO A;  2ESN A;  3VOD A;  3IC7 A;  1XMA A;  1C0W A;  2GA2 A;  3BJA A;  3F22 A;  2A3S A;  1L3L A;  1J7K A;  1ZN2 A;  3I53 A;  1BC7 C;  2DU9 A;  4G6Q A;  5F6F A;  4E70 A;  3M1E A;  4UXN A;  4UVC A;  3ZMU A;  2DW4 A;  2ZNZ A;  4KT5 C;  3PQJ A;  3U9G A;  3GW2 A;  5D4S A;  4Q48 A;  3F8M A;  5E17 F;  1PUE E;  2A6H F;  1YW7 A;  1CGP A;  2RKH A;  4G94 A;  5LGT A;  3HTU A;  4A6D A;  3IRQ A;  4A0X A;  3ABU A;  3WE2 A;  2C6Y A;  2PLY A;  4WF2 A;  1HW1 A;  1HQC A;  2OQR A;  4HOB A;  2YSR A;  4DQ2 A;  1H9G A;  2K7L A;  1FP2 A;  2NS0 A;  2GA1 A;  5L3D A;  3Q5F A;  1KU7 A;  3V8K A;  1O3S A;  5D4R A;  1D5V A;  1XCB A;  2IVM A;  1LDK B;  2K86 A;  1G3W A;  4JQF A;  4RB2 C;  1BBY A;  4CIC A;  2XAH A;  4M6X A;  3MWM A;  1PP8 F;  1SFU A;  1E17 A;  5HDG A;  4AIJ A;  1ZG3 A;  2MH9 A;  5L3F A;  4P5O A;  1ODD A;  4AD9 A;  5LRR A;  4HQM A;  2QYO A;  3PQK A;  2XAF A;  1QNT A;  2FSW A;  3F21 A;  3RPU A;  4KDP A;  5JR3 A;  1XMK A;  2HOE A;  1SAX A;  4AIK A;  3ERE D;  4HW0 A;  1U2W A;  4XSX F;  1WQ2 A;  3REO A;  3O2P E;  3ZMZ A;  2YX4 A;  1WSU A;  2IT0 A;  1O7L A;  1ON2 A;  2X4H A;  4UNO A;  2L4M A;  3QP6 A;  2W25 A;  4ENN A;  2MBF A;  2KRF A;  2M30 A;  2YX7 A;  3NEU A;  2Z33 A;  3RTR A;  2VOO A;  1YS7 A;  4G8X A;  2M45 A;  4LGW A;  3TKY A;  3IL2 A;  4RB0 A;  4MHG A;  2CGP A;  4PGH A;  1ZGA A;  1S3J A;  1YO5 C;  1Z6R A;  1JE8 A;  4LG0 B;  4LB6 B;  2HKX A;  5ILS A;  4KN4 X;  5CJ9 A;  4Z2Y A;  2W85 A;  2V6C A;  1BM9 A;  3HSR A;  5KK1 A;  4G7Z F;  1AWC A;  2E1C A;  3F23 A;  3E6M A;  1QGP A;  3QOP A;  1EH7 A;  5K5O A;  4PGG A;  4D0P A;  3GZ5 A;  3IKV A;  5LEK A;  1I5Z A;  3GVA A;  2DO7 A;  2XUB A;  3HYI A;  2G7U A;  3MFK A;  4HX4 A;  3HOS A;  4RGX A;  3WTV C;  1IUY A;  3CJN A;  2EV6 A;  4MEY F;  2DQR A;  4EV0 A;  4MEX F;  1Z1D A;  3B02 A;  1K7A A;  3GFL A;  4BHB A;  3ZMV A;  5LHH A;  3LAJ A;  4ASN A;  4OIN F;  3R0A A;  5DD8 A;  2PG4 A;  5CLS A;  3DXJ F;  5ERI A;  1O3Q A;  2EFN A;  2IPQ X;  2QBY B;  3WE3 A;  1LJ9 A;  4OIQ F;  6PAX A;  2CSO A;  4HBL A;  1P4X A;  1R22 A;  3FZV A;  1EH6 A;  3L9F A;  2P7C B;  3H92 A;  3E5Q A;  5BPD A;  5D5U B;  2L02 A;  5FLX Z;  2QVO A;  4BAY A;  1B59 A;  2ESH A;  2UXX A;  2D1V A;  3F8B A;  4BYY A;  4UUV A;  4KIC A;  4IJA A;  1ZHF A;  4L9N A;  3L2C A;  4LJZ F;  4OIR F;  4UV8 A;  2XRO A;  1RUN A;  5BQT A;  4UV9 A;  1ZLK A;  2XAQ A;  2D2W A;  5H20 A;  1T39 A;  3LA2 A;  2ZME B;  3WGH A;  1UHM A;  1XB4 A;  3H3Z A;  2EB7 A;  2Z5U A;  3DQV C;  5AON A;  4ZZL A;  4QWQ A;  1W5S A;  1S7A A;  5LBQ A;  2OD5 A;  1P4A A;  2HWV A;  4RS8 A;  2KIU A;  3KP6 A;  3RYP A;  1UST A;  3P9I A;  4ENK A;  2IW5 A;  2ZFW A;  3KZZ A;  3HHG A;  2OZU A;  4R8H A;  4LG0 A;  3FMQ A;  1W4M A;  1FWZ A;  5CVR A;  3V8J A;  1LVA A;  1BI1 A;  3FX3 A;  2IJL A;  4A5M A;  1XDU A;  4JK1 X;  5L3C A;  1IN5 A;  2NYX A;  3WTT C;  3EYI A;  4ZYG A;  5DD4 A;  4WXD A;  3TGN A;  3I54 A;  1RUO A;  2BV6 A;  4MTE A;  5AIQ A;  2YR2 A;  1NHA A;  2BGC A;  2H09 A;  2PBI A;  1AOY A;  4GXO A;  2DPU A;  4I09 A;  3LA3 A;  3GF2 A;  4EVI A;  5BOX A;  3ISP A;  3SQN A;  2HZT A;  3C3W A;  3J81 K;  3O6B B;  4O3M A;  3N97 A;  2CG4 A;  3QAH A;  1T0F A;  2E7W A;  1LDJ A;  3ZQ7 A;  3MZY A;  3F8F A;  2H94 A;  4HF2 A;  2IA2 A;  5DEQ A;  5LEJ A;  4ENJ A;  3EUH A;  1F5T A;  1R58 A;  2XV4 S;  2QBY A;  2RDP A;  4KA4 A;  2DFI A;  1FOK A;  1HXD A;  4A0Y A;  4I02 A;  5A2Q K;  5JFR A;  4Q4Z F;  2Q2E A;  1HBX G;  5K1Y A;  5JHU A;  1FNN A;  2K4J A;  3M8E A;  4WK8 F;  4EJU A;  1FP1 D;  2M8E A;  2K02 A;  4I0B A;  3WTY C;  3GFM A;  1YW8 A;  1USS A;  1TQM A;  3RKW A;  4BH9 A;  3DV8 A;  1QO0 D;  3J81 Z;  2XAS A;  3M7G A;  4U0V A;  3TQN A;  5JVT A;  3F8C A;  2CW0 F;  4LK1 F;  1WWX A;  2XIG A;  1IN8 A;  4GYG A;  2P5K A;  3S2W A;  3WGI A;  5HLG A;  3BJO A;  4ZZD A;  2A69 F;  4P96 A;  4IRI A;  1E2X A;  1YG2 A;  2LSO A;  3FXR A;  5LHI A;  1IN4 A;  2MC3 A;  3FMS A;  5A2Q Z;  1P2F A;  1B6A A;  1FC3 A;  4A12 A;  5FD5 A;  3OOP A;  2KIM A;  1ZRF A;  2JZY A;  2KIF A;  4S05 A;  1KQ0 A;  3PFI A;  2HTJ A;  1X3U A;  3CO7 C;  4ESF A;  4YII A;  4LLL A;  2VXZ A;  4EGY A;  1I1G A;  2CYY A;  3I58 A;  2RN7 A;  1GVJ A;  3DEU A;  4H0E A;  3V7S A;  1P92 A;  3BWG A;  2ZCW A;  4L5J A;  2QM3 A;  3F6O A;  3WTW C;  5HLI A;  5EEG A;  4GO1 A;  1WRJ A;  1RI7 A;  2VOD A;  2F2E A;  4KYW A;  5D5W B;  4FHT A;  1QBJ A;  2FBK A;  1U8R A;  3E5U A;  1XSD A;  3IWZ A;  1FLI A;  3WTU C;  3R0J A;  4M71 A;  1UFM A;  2BEO A;  3KP2 A;  2DI3 A;  4M9S A;  4HX7 A;  4CHU A;  2ELH A;  4BXU A;  1FY7 A;  5ILU A;  2O8X A;  4HZF A;  4YIF A;  4BQA A;  4M73 A;  2LF8 A;  4XLP F;  3I4P A;  3CDH A;  3IHU A;  4HYE A;  4L9J A;  2ZKZ A;  4RAZ A;  1Z6T A;  1TQI A;  2XVC A;  3WGG A;  2MH2 A;  3IKT A;  1IXC A;  2VE8 A;  1UB9 A;  4B09 A;  5HOO A;  4YFK F;  4EJO A;  2EJR A;  1FBQ A;  2EWN A;  4S04 A;  3T0Y A;  1Z05 A;  4NHJ A;  3R6S A;  1HST A;  3Q9V A;  5J8F A;  1R7J A;  1SMY F;  5E8G A;  4WCG A;  4QLC U;  4IRG A;  2HEO A;  3CUQ A;  2WTE A;  1O3T A;  1U6G A;  2ADU A;  1BI3 A;  3WTZ A;  1HW5 A;  3KP5 A;  1DDN A;  3ECH A;  1MJB A;  5E18 F;  3KZY A;  2W57 A;  1BI2 A;  2FBH A;  3ML6 A;  3F3X A;  5BS6 A;  5LHG A;  3TO7 A;  1BI0 A;  3ZMS A;  1LQ1 A;  4L18 B;  5BMZ A;  4MGR A;  2QZ8 A;  4FX4 A;  5E8I A;  1R36 A;  1DP7 P;  4RAY A;  4XBF A;  2JPB A;  4A2U A;  1G3T A;  2NAZ A;  2GAU A;  2NNN A;  4WWC A;  1TLH B;  4K2E A;  1LEB A;  2D45 A;  2PEX A;  4WXH A;  2ZBK A;  2QQ9 A;  2HR3 A;  4G6D A;  3LAP A;  2HKO A;  3K0L A;  2V1D A;  4I7H A;  3DKW A;  2FE3 A;  4FX0 A;  4UVB A;  3LQQ A;  5LRS A;  3K69 A;  4JBA A;  3U1D A;  2F5F A;  2BE5 F;  4BHP A;  3QU3 A;  3E97 A;  3ZPL A;  4BHC A;  1J59 A;  1PP7 U;  5F1R A;  2O6G E;  2QEN A;  2FNP A;  3LWF A;  2PI0 A;  1I1S A;  1XSV A;  4HX8 A;  1EH8 A;  2F5E A;  1G6N A;  1U5T C;  1IN6 A;  1U5T B;  4YFN F;  4HLY A;  2FA5 A;  4EQQ A;  4P9U A;  3HSE A;  5D6E A;  4AWX B;  3JTG A;  1FPQ A;  5ED4 A;  3HUG A;  2A07 F;  1OPC A;  5DDG A;  3FF5 A;  1W7P D;  3I71 A;  2XAG A;  1TNT A;  3WU0 A;  4P55 A;  4ON0 A;  2MD5 A;  3FMR A;  4Q5S F;  1G4D A;  3H3U A;  3V7C A;  4G7H F;  3ECO A;  1KYZ A;  1SD5 A;  4EMS A;  5JI6 A;  1OR7 A;  3TOA A;  3TO9 A;  1FYK A;  2DK5 A;  5D5X B;  1IXR C;  4GGG A;  1SFE A;  2EV5 A;  1ZG1 A;  4MQV A;  1JHF A;  1SD4 A;  3T8R A;  2EV0 A;  5DUK A;  4F7Z A;  2STT A;  3QPH A;  1ON1 A;  4M74 A;  4XLN F;  1J2X A;  2HFH A;  3KE2 A;  3HHH A;  3HRM A;  1U78 A;  1J9I A;  3O3K A;  2G7H A;  1TTY A;  2IA0 A;  3BOQ A;  3RI4 A;  1B4A A;  1FSH A;  2DAO A;  1YTY A;  1O7F A;  2HQR A;  4KMF A;  4YFX F;  1FBS A;  1IRG A;  3HRT A;  3GUD A;  3G73 A;  1LB2 A;  2FF4 A;  1QPM A;  4CYD A;  3TOB A;  4Y15 A;  3JTH A;  1D3Y A;  1VTN C;  2V1X A;  5E20 A;  4HA8 A;  3ULQ B;  2ETH A;  5CVV A;  3HSF A;  3EET A;  1U3E M;  4IHS A;  1KQ9 A;  2LKP A;  2GXB A;  2Y75 A;  2OA4 A;  3Q9S A;  1G3Y A;  3E3V A;  2E1N A;  2CQK A;  4HDV A;  2R7D A;  2UZK A;  1IXS B;  1OKR A;  2M87 A;  5FGM A;  2X0L A;  2CFX A;  4U7D A;  4NQW A;  5D8K B;  3CO6 C;  1K78 B;  2QWW A;  2A68 F;  1Z91 A;  3TDU C;  3GLX A;  1U5T A;  3SHF A;  1TW2 A;  2UWM A;  3GFI A;  5CVJ A;  3HRU A;  2UXN A;  1OYY A;  5FFZ A;  5HS8 A;  5TJJ A;  2D1H A;  1FYL A;  4MQ9 F;  2P6T A;  2CWE A;  5HS7 A;  5K5Q A;  2BBY A;  2KJC A;  5E1Z B;  1G3S A;  3ZN0 A;  2RGV A;  3P9K A;  1ZRC A;  2VT2 A;  3E5X A;  1IZ1 A;  1BIB A;  4EM1 A;  4N9H A;  2OAZ A;  2WC2 A;  1R1T A;  3KLO A;  1IRF A;  2H6B A;  3OV8 A;  4M72 A;  2Q0O A;  3KET A;  3KEO A;  5E1X A;  1MD0 A;  3L00 A;  2YU3 A;  1P4W A;  1H9T A;  1RNL A;  1A04 A;  2OU2 A;  1SD6 A;  2Z3Y A;  3KP3 A;  3LQR A;  1J5Y A;  4HF1 A;  1BIA A;  3WOD F;  1BJA A;  3QRF F;  3J80 K;  1F1Z A;  2J5O A;  1FYM A;  2GIV A;  5HDK A;  1GXP A;  3ZP5 A;  2A5Y B;  1MZB A;  4NB5 A;  4PDK A;  5K5R A;  5TRD A;  3JAM K;  2R7F A;  4LLN A;  4N9I A;  3JSP A;  2STW A;  1S29 A;  2KJB A;  3IWF A;  3U2R A;  2HDC A;  3T8T A;  4UVA A;  2EA4 A;  3KP7 A;  3HOT A;  1Z7U A;  2LDU A;  3R60 A;  2DTR A;  3QPT A;  2EFW A;  4CO8 A;  3ZMD A;  3TO6 A;  3KCC A;  4L9T A;  3CTA A;  4KMU X;  5J6X A;  2L3D A;  4WXC A;  3GEZ A;  2RC4 A;  2AS5 F;  5DV5 A;  4M9X A;  3DFG A;  3QU6 A;  1LNW A;  1TQP A;  2K4B A;  2FXA A;  3CUQ C;  3GWZ A;  3CUQ B;  4R79 A;  2V1U A;  3J80 Z;  2JSC A;  1K78 A;  1IN7 A;  4OOI A;  4AIH A;  3KP4 A;  1ZAO A;  5IT9 K;  4LD5 A;  4EJT A;  4EGZ A;  3ABT A;  2P8T A;  1K6O A;  2MLK A;  4Y17 A;  4I98 B;  2JTV A;  5HDN A;  2O61 A;  2P5L C;  2VBX A;  3GYH X;  1YIO A;  1XN7 A;  2A6E F;  5ICG A;  2MLG A;  4HAM A;  4L9V A;  2ACJ A;  3MQ0 A;  4OMZ A;  4U88 A;  2B0L A;  4HLX A;  2EA2 A;  5E1W A;  2RQP A;  2GXG A;  1GHC A;  4AVP A;  2EFO A;  1XDS A;  4OIP F;  3DPL C;  5FD6 A;  4HQE A;  2TDX A;  4HF0 A;  1XCV A;  1J0R A;  2ISY A;  2FNA A;  3K2Z A;  2O3F A;  2HYF A;  1ZRE A;  1DPU A;  3VOE A;  3WTS C;  1FBU A;  5IT9 Z;  4L0Y B;  4GCV A;  3BY6 A;  2EK5 A;  4HDU A;  4TV7 A;  3SZT A;  3HTS B;  4RGS A;  4I0A A;  1REP C;  4O5V A;  1V3F A;  5CVI A;  3RDI A;  4G7O F;  1LEA A;  2EFQ A;  4KUM A;  1YW9 A;  3C1D A;  2V79 A;  4ZYD A;  2FOK A;  3V7R A;  3G3Z A;  1HKQ A;  1QZZ A;  5D6F A;  4ENM A;  2VE9 A;  1W5T A;  3ZMT A;  3ELK A;  1TNS A;  4I01 A;  2FU4 A;  4IHT A;  3L09 A;  4IXA A;  2VBZ A;  4KIG A;  3BP8 A;  3EDP A;  3HIF A;  5FFX A;  1R1V A;  2OZ6 A;  2DPD A;  2HYG D;  2PFB A;  3K9T A;  2CO5 A;  3K1N A;  1W7P A;  4CDG A;  2WV0 A;  2Z99 A;  3M9A A;  3WU1 B;  1F9N A;  4WX9 A;  1TBX A;  5HVQ C;  4XRF A;  3SFZ A;  1OYI A;  3RYR A;  2P5V A;  1IAW A;  1CF7 A;  4LFU A;  1MJ9 A;  4A0Z A;  3T5X A;  2PMU A;  3SXY A;  1RIO H;  1S8N A;  3BPV A;  1FX7 A;  3F6V A;  3GFJ A;  1SD7 A;  1JHH A;  2OBP A;  4R1H A;  2RNJ A;  3KEQ A;  4U0W A;  2Y0M A;  5HS9 A;  3E6B A;  2COM A;  3BPX A;  3P7N A;  3BRO A;  3QP5 A;  1BOA A;  5L3G A;  1MKM A;  2RV8 A;  2PMH A;  1MJA A;  3FM3 A;  3J7A O;  1MGT A;  1YQA A;  1Y0U A;  3DP7 A;  3FWE A;  1ONV A;  4EM0 B;  4UHT A;  2VT3 A;  5LGN A;  1O3R A;  3I59 A;  3CLO A;  2IP2 A;  2W24 A;  3FXQ A;  5DYM A;  2XKO A;  3ROU A;  3EYY A;  5EEH A;  5L3B A;  2XKP A;  4U7B A;  3M8F A;  2NNY A;  2R3S A;  1UHW A;  1HSJ A;  3MCZ A;  2DLL A;  1KYW A;  1T98 A;  1JXS A;  4M6Y A;  4G9Y A;  3GO5 A;  1XD7 A;  5J8C A;  1XGM A;  4IRH A;  3FXU A;  3W6J B;  1LDD A;  1B9M A;  3GXO A;  2PN6 A;  3RJP A;  3AAF A;  4N0B A;  1SFX A;  1WKM A;  4IVN A;  2W84 A;  3CUO A;  2DQL A;  2DBB A;  1ZH5 A;  4EJV A;  1Q1H A;  3EQL F;  3JSO A;  3V4G A;  2XRN A;  3K1P A;  2FML A;  2VOP A;  2FMY A;  4LB5 A;  4IF4 A;  5DUI A;  2QQA A;  1FSE A;  2YPR A;  1L0O C;  3FM5 A;  2P7V B;  2HQN A;  3LFK A;  4FT8 A;  5F64 A;  2M5W A;  2F5C A;  1B1B A;  3IRR A;  5FLX K;  3D5L A;  2ZJ2 A;  4YG2 F;  3COA C;  2VC0 A;  3RKY A;  3I5U A;  3KFW X;  2PJP A;  1HW2 A;  2FBI A;  1T38 A;  5ICF A;  1ZAR A;  4U0Y A;  2P4W A;  3BDD A;  1T2K A;  3RIR A;  2F5D A;  1TW3 A;  4OU0 A;  2Q8K A;  3T1B A;  3HRS A;  1O57 A;  1YLF A;  2WWY A;  2O03 A;  1SMT A;  2IA1 A;  4Q47 A;  4O6J A;  2OQG A;  4ZYE A;  2VBW A;  3DF8 A;  3K1M A;  1MDM B;  2PQ8 A;  1JGS A;  4P9F A;  1H0M A;  3B73 A;  1I6X A;  1DUX C;  2M1B A;  1YFH A;  5LLQ A;  2FQ3 A;  4ETS A;  3FHZ A;  5DCM B;  2L01 A;  1ULY A;  1EV7 A;  2NRA C;  2ZXJ A;  4OMY A;  4ESB A;  4CXF A;  2VN2 A;  2A61 A;  3KLN A;  3R61 A;  4HV6 A;  4IPA A;  2AXL A;  2GZW A;  3W6K B;  2JT1 A;  4A6E A;  4MTD A;  3GX4 X;  1FZP B;  2VBY A;  4EJW A;  2QLZ A;  5AIP A;  3C18 A;  2Y48 A;  2H6C A;  2KKO A;  2L4A A;  5HLH A;  5LGU A;  3WG9 A;  5H6R A;  5D8L B;  1S6L A;  5H6Q A;  2Z9O A;  2XGX A;  3ZN1 A;  4L0Z B;  3MEX A;  2QUF A;  4HV5 A;  1KA8 A;  4RGU A;  3D0S A;  3BZ6 A;  4BNC A;  3R4K A;  1T6S A;  3GZ6 A;  2LF7 A;  5ICC A;  2O0Y A;  3VEP A;  1XGN A;  5FO5 A; 
#chains in the Genus database with same CATH topology
 2ZO4 A;  1YYV A;  3DBH B;  1R4N B;  1D8K A;  1JT6 A;  3V8L A;  4XSZ F;  4J19 A;  3HKZ A;  3W2V A;  1ZG5 A;  2W48 A;  1EJ9 A;  2R7Z J;  1WVR A;  2V9V A;  2RVC A;  2GOX B;  2BY2 A;  1B9N A;  4MNU A;  2CQQ A;  4LMY A;  4KN7 X;  3W6V A;  1HKS A;  2ZC2 A;  2FUG 2;  3P9C A;  3NQO A;  2JPC A;  4ZJZ A;  2L54 A;  1R5G A;  2DA1 A;  1QZY A;  2BY3 A;  3BLY A;  2VQL A;  1KU9 A;  2ZNY A;  1RZ4 A;  2XAJ A;  3JRH A;  1FEX A;  2ISZ A;  4CGZ A;  2R92 J;  2WBM A;  5C4X J;  1TC3 C;  1Z3Y A;  2FRH A;  1XGS A;  1ZEL A;  3KX2 A;  5KVR A;  4CSW A;  2EFP A;  3VFZ A;  3QYE A;  4B3X A;  4BUP A;  4RLF A;  1ETX A;  1V55 H;  1IC8 A;  4BXX J;  1GXQ A;  4M9Z A;  2X6X A;  1YS6 A;  1IV6 A;  4OIO F;  4C2U A;  1HKT A;  1ZYR F;  3PIO F;  4MIM A;  2F4O B;  3SJM A;  2G9W A;  4RGR A;  4X1E A;  5FB2 A;  3C7J A;  4I2O A;  1ZGJ A;  2K27 A;  2VON A;  2QSF X;  1P6R A;  2HVS A;  5ILV A;  3M4O J;  2GQQ A;  2P6S A;  5L3E A;  4LK0 F;  3RKX A;  4RB1 A;  2LR8 A;  1BC8 C;  4PZJ A;  3I55 I;  1WFX A;  1MDM A;  3VB2 A;  1XMX A;  1KU2 A;  2HGC A;  4KFC A;  2WY7 Q;  1Z9C A;  2W1O A;  1IF1 A;  3AL0 C;  3E6D A;  2FEZ A;  3AL0 B;  2DK8 A;  4OAZ A;  2GBY A;  1BN5 A;  1OYW A;  1RR7 A;  4GYI A;  4CZZ A;  2IEK A;  3N4M A;  5CYV A;  1KGS A;  3Q3S A;  1MND A;  4RB3 C;  3LA7 A;  5DCM A;  4KJZ A;  2IXS A;  5ICE A;  3WTX C;  2L5Q A;  3OYB A;  3H9J A;  1QVT A;  1J75 A;  4FIS A;  4IX7 A;  3HKZ N;  2ZXW H;  1ORK A;  4BL0 B;  4KIB A;  1N75 A;  1FTZ A;  2EZK A;  4ZC3 A;  1IV8 A;  3G2B A;  1STZ A;  3NRV A;  4HEA 2;  2H27 A;  1RES A;  2B7E A;  4CCL A;  4PCQ A;  1VQL I;  1W7P B;  1ZRD A;  4XKC A;  4B4C A;  3LSK A;  5IT3 A;  3JRF A;  3TDZ C;  1V4R A;  2ZME A;  2V9K A;  1R00 A;  3DTE A;  2LH9 A;  2BYV E;  3SZP A;  1W36 D;  4GRI A;  2E36 A;  2E19 A;  3PNY A;  1CF7 B;  1DPR A;  3BJ6 A;  2HTS A;  5GPC A;  2DOE A;  4ZH4 F;  5H2F C;  2XSD C;  2HS5 A;  1IRZ A;  1APL C;  2ZJQ F;  3JAM Z;  3NAU A;  1KON A;  3BCA A;  4NBQ A;  2M2E A;  1UCR A;  2VC1 A;  2DT5 A;  2Z1D A;  4EM2 A;  5DTD A;  4Y13 A;  1VQK I;  3RPQ A;  2JRT A;  2GWR A;  3PIP F;  3F72 A;  4DNC A;  1WI9 A;  5D5V B;  2K3P A;  1K79 A;  2ZXI A;  4KIF A;  3MMY B;  2BXY A;  3LSP A;  1EA3 A;  3D5R C;  3I64 A;  4LLG F;  5KAF C;  1PDN C;  2A6T A;  2F4I A;  4L5I A;  2E7X A;  4LG3 A;  4FTH A;  2J5P A;  4OWR B;  3JW4 A;  1IGN A;  1ZKG A;  1YRN B;  3E6C C;  2K9S A;  5BPI A;  3S32 A;  3BTI A;  1ZLJ A;  3S8P A;  3LSJ A;  3OYN A;  1FT9 A;  5CVU A;  2BVM A;  3MZH A;  3F8N A;  1KQ8 A;  3OSG A;  1F4K A;  2MA3 A;  4G12 A;  3MAJ A;  3OYL A;  2LRD A;  3K70 C;  1D8J A;  3I59 B;  1OMI A;  2LNB A;  1QQI A;  1R23 A;  1ENH A;  2QQB A;  4ESJ A;  1WZ2 A;  3DPT A;  3L2W A;  1KU3 A;  2E1M C;  2E1M B;  3LST A;  3QOE A;  1R1U A;  1S7O A;  1DQU A;  1JJ8 C;  1T33 A;  3RZD J;  5DCF A;  1R5H A;  3G1M A;  2Y69 H;  2ZJR F;  2F5V A;  4B8X A;  2XHK A;  2IRF G;  2OCE A;  3L7W A;  4KNY A;  1IDZ A;  4ZYH A;  1IW7 F;  3DU6 A;  3WU2 C;  4A5N A;  1XSX A;  1UZC A;  3I0T A;  1I27 A;  1XGO A;  1F36 A;  4B47 A;  2ESN A;  4GDF A;  1MSF C;  3VOD A;  2NS8 A;  3IC7 A;  2BY0 A;  1XMA A;  4ZTF A;  1IG7 A;  5GAG J;  1VQ8 I;  4XON A;  1C0W A;  3BR0 A;  1T08 B;  2Y31 A;  1WHU A;  2GA2 A;  3DTI A;  3VYS B;  3BJA A;  1NK2 P;  3J7Z I;  3F22 A;  2A3S A;  1YE9 A;  4DOZ A;  1L3L A;  1J7K A;  1X4O A;  1ZN2 A;  3H5R A;  3I53 A;  1BC7 C;  4BE1 A;  2DU9 A;  1GV5 A;  3RQI A;  3CCS I;  1TT5 B;  4G6Q A;  5F6F A;  3SDG A;  4E70 A;  3M1E A;  4XKW A;  2JA5 J;  1ZTR A;  4UXN A;  3KPH A;  4N4N B;  4UVC A;  3I3L A;  3H5A A;  1RC9 A;  3CF2 A;  1TP4 A;  3ZMU A;  4DZJ A;  2DW4 A;  2JSP A;  4ANJ A;  2LK2 A;  2ZNZ A;  5IOZ A;  1E0E A;  3CDL A;  1JTY A;  5B66 C;  4IHY A;  4KT5 C;  2X6W A;  4RMN A;  3PQJ A;  4G6T B;  3U9G A;  3GW2 A;  1PUF B;  4XNF A;  5D4S A;  4Q48 A;  4CUG A;  4CYC B;  1MNE A;  2IS6 A;  4E7Z A;  1JKP C;  1W0U A;  2XGE A;  2V7F A;  3F8M A;  5E17 F;  1PUE E;  4Y7N J;  2DFH A;  2A6H F;  4QIW N;  1YW7 A;  5F0F A;  1PYV A;  3HOV J;  4HSR A;  2RKH A;  4G94 A;  5EJC A;  5J47 A;  1CGP A;  4IKF A;  1K6Y A;  3K4L A;  5LGT A;  2KPM A;  2XPU A;  4C2M J;  3HTU A;  4A6D A;  3IRQ A;  4A0X A;  2DFE A;  3ABU A;  3WE2 A;  2C6Y A;  5GP9 A;  2PLY A;  2WAF A;  1BW6 A;  4WF2 A;  1HW1 A;  1HQC A;  2OQR A;  1SFK A;  1GDT A;  1E3H A;  4HOB A;  2YSR A;  4DQ2 A;  3OYM A;  1H9G A;  4M3D A;  2K7L A;  1FP2 A;  3KEY A;  4BXF A;  2FOW A;  1JKR C;  2NS0 A;  4A3E J;  3F0C A;  4XLH A;  2GA1 A;  4PJL A;  4A3C J;  3M3Y J;  5L3D A;  3Q5F A;  1KU7 A;  3V8K A;  1O3S A;  4LIU A;  5D4R A;  3OL3 A;  1D5V A;  1XCB A;  3WHC A;  2IVM A;  1VQM I;  5BNG A;  4PJJ A;  3JRI A;  1LDK B;  2K86 A;  1G3W A;  4IEJ A;  1MIJ A;  3EUA A;  3BR5 A;  4ZTJ A;  4JQF A;  4RB2 C;  4BY1 J;  1BBY A;  4CIC A;  2IGK A;  2IGN A;  2XAH A;  4M6X A;  5J4Y A;  1FOY A;  3MWM A;  1OQY A;  1PP8 F;  2HNH A;  4EEF G;  1SFU A;  2NVU B;  1E17 A;  3S3O A;  1OCR H;  5HDG A;  3FK6 A;  2CH0 A;  2KRH A;  3HPH A;  4AIJ A;  1OCC H;  4BQN A;  1YRN A;  1ZG3 A;  2OUM A;  2MH9 A;  1MBG A;  4A3I J;  5L3F A;  4P5O A;  1ODD A;  4AD9 A;  2XAU A;  1J09 A;  5LRR A;  4HQM A;  2QYO A;  3PQK A;  2DYS H;  4X0G A;  2XAF A;  2YU9 J;  4F52 A;  1QNT A;  2FSW A;  2DMN A;  3F21 A;  3RPU A;  5EGO B;  1SVO A;  4BDY A;  4KDP A;  5JR3 A;  3PO3 J;  1XMK A;  2HOE A;  1SAX A;  4AIK A;  2DOA A;  3W3C A;  4HW0 A;  1OCZ H;  1U2W A;  3ERE D;  4IQ4 A;  4XSX F;  1WQ2 A;  3AFH A;  2W7N A;  3REO A;  3O2P E;  3ZMZ A;  2YX4 A;  3SFI A;  1WSU A;  2Y9Z A;  4A3B J;  2KFD A;  2M8G X;  3PJR A;  4ZYA A;  2DMT A;  1X1C A;  2I10 A;  2IT0 A;  1O7L A;  4HPQ A;  3PUF A;  4ZDO A;  1ON2 A;  2VJI A;  2X4H A;  1JI8 A;  4AU7 A;  1LVK A;  4FET A;  4UNO A;  2L4M A;  3IH3 A;  2GIZ A;  3QP6 A;  4CH7 A;  3E0J B;  2KIS A;  2W25 A;  3DCF A;  4ENN A;  5FKO A;  4A3G J;  2MBF A;  3ZQC A;  2KRF A;  2M30 A;  2YX7 A;  3NEU A;  3OWT A;  1VND A;  3PFY A;  2Z33 A;  2O9L A;  2K9N A;  2X1D A;  2YUS A;  1VQO I;  2V4J C;  4XMY A;  1JTX A;  3RTR A;  3OYH A;  1AKH B;  2VOO A;  4XOT A;  1YS7 A;  2FQ4 A;  4BS9 A;  4G8X A;  2VJ5 A;  2M45 A;  4LGW A;  3S3N A;  1ETW A;  3V42 A;  2O8K A;  3K4B A;  3TKY A;  3L2V A;  3CC2 I;  1B72 B;  3IL2 A;  1PVE A;  1K4T A;  2LFB A;  3ZQH A;  4RB0 A;  4MHG A;  1UAA A;  4JX5 A;  3BTL A;  2CGP A;  5B3S H;  2GOM A;  4PGH A;  1ZGA A;  1DGW Y;  1S3J A;  3AG2 H;  5KHD A;  4A3J J;  2R7W A;  2VPL A;  4DIQ A;  1YO5 C;  1YJN I;  1Z6R A;  1JE8 A;  4LG0 B;  4LB6 B;  4V19 K;  4CYC A;  2HKX A;  2TCT A;  5ILS A;  2VIX A;  4KN4 X;  5CJ9 A;  4Z2Y A;  2W85 A;  2V6C A;  2OTL I;  1BM9 A;  3HSR A;  1LFU P;  1XG1 A;  1B8I B;  5KK1 A;  4G7Z F;  1AWC A;  2E1C A;  2LRE A;  4RM2 A;  3E6M A;  3F23 A;  3RKQ A;  1QGP A;  1DU0 A;  1S9H A;  5F08 A;  2DJI A;  3QOP A;  1EH7 A;  3LNQ A;  5K5O A;  4PGG A;  4D0P A;  2XSJ C;  3GZ5 A;  2N8G A;  3IKV A;  5LEK A;  1I5Z A;  3GVA A;  2DTZ A;  3I4N J;  2DO7 A;  2XUB A;  3HYI A;  2G7U A;  3MFK A;  4HX4 A;  3HOS A;  4RGX A;  3F9K A;  3DBL B;  2B63 J;  3WTV C;  1YJW I;  1IUY A;  3CJN A;  1ETQ A;  3IUO A;  2EV6 A;  4MEY F;  4XRS G;  3ZRG A;  2DQR A;  3ERM A;  1G59 A;  2L9V A;  4EV0 A;  5FRO A;  5IOY A;  4MEX F;  1T0F C;  1Z1D A;  3OIO A;  4NUB A;  2P81 A;  3B02 A;  1K7A A;  2X6O A;  3GFL A;  4BHB A;  3ZMV A;  2XDV A;  2ZSI B;  5LHH A;  3LAJ A;  2E71 A;  1HLV A;  3DEW A;  4ASN A;  2R93 J;  4OIN F;  3R0A A;  4XL9 A;  5DD8 A;  3BQZ A;  4E7H A;  2PG4 A;  3FKI J;  5CLS A;  3OYG A;  3DXJ F;  5ERI A;  1M1E B;  1O3Q A;  2M34 A;  1XTA A;  2EFN A;  2IPQ X;  2QBY B;  2VL8 A;  3Q0U A;  1LJ9 A;  5EZG A;  3WE3 A;  2VLA A;  3CCJ I;  4OIQ F;  6PAX A;  2CSO A;  1D0X A;  2LY1 A;  3A2K A;  4XOR A;  2M9H A;  4HBL A;  1P4X A;  1R22 A;  3A03 A;  1F43 A;  3FZV A;  1EH6 A;  2OTJ I;  3L9F A;  2KDZ A;  1OIS A;  2P7C B;  3GCM A;  3H92 A;  3E5Q A;  5BPD A;  4S0H B;  2NXN B;  1D1B A;  3ABL H;  5D5U B;  2L02 A;  5FLX Z;  2QVO A;  4BAY A;  4A3L J;  1B59 A;  2ID3 A;  2LKS A;  1MBH A;  4E7S A;  2XF6 A;  2ESH A;  2OV7 A;  5K7H A;  2CV2 A;  2UXX A;  5DM6 F;  2IAI A;  1D1A A;  2ECC A;  2MFZ A;  1Y6I A;  2D1V A;  3F8B A;  4BYY A;  4UUV A;  3IH4 A;  3OR1 C;  4KIC A;  4IJA A;  4XLE A;  1ZHF A;  1ETK A;  4L9N A;  5K7Z A;  3L2C A;  4LJZ F;  1I3Q J;  4OIR F;  5HNF A;  2MC4 A;  3JRC A;  1H8A C;  4AYB A;  2R7V A;  2VUM J;  4UV8 A;  2R0Q C;  2DA4 A;  2XRO A;  1RUN A;  5KAI C;  5BQT A;  5J1Y A;  4UV9 A;  2K9L A;  1A6Q A;  1ZLK A;  2XAQ A;  2D2W A;  5H20 A;  1T39 A;  3LA2 A;  2ZME C;  3HEF A;  2ZME B;  1XS9 A;  1JUP A;  3WGH A;  1QZE A;  1UHM A;  2JA7 J;  1XB4 A;  1V54 H;  3H3Z A;  2EB7 A;  2A05 A;  4FE7 A;  2Z5U A;  3DQV C;  3ZQI A;  5AON A;  2HVQ A;  5DM7 F;  1WJF A;  3HL2 A;  1AKH A;  1Z0X A;  3A0H C;  4ZZL A;  5IYC J;  2HXI A;  3HPG A;  4QWQ A;  1W5S A;  1S7A A;  1VZ0 A;  2LP0 A;  5LBQ A;  1BOB A;  2OD5 A;  4RM3 A;  3GTJ J;  1P4A A;  3ONQ A;  5FKK A;  2Y0S A;  4PUS A;  2HWV A;  4RS8 A;  2KIU A;  3KP6 A;  3CC4 I;  3FXK A;  3RYP A;  3OYC A;  5E3N A;  1IO2 A;  1UST A;  2ICW G;  2BHZ A;  3S14 J;  3P9I A;  4RAF A;  2IW5 A;  4ENK A;  2ZFW A;  3KZZ A;  3HHG A;  1ZR2 A;  2DA2 A;  2OZU A;  2O7O A;  4R8H A;  4LG0 A;  3FMQ A;  1W4M A;  1FWZ A;  3BC8 A;  2JA6 J;  5CVR A;  3V8J A;  3IAS 2;  1LVA A;  1RKW A;  1BI1 A;  3FX3 A;  2IJL A;  4A5M A;  1XDU A;  4B48 A;  2QCO A;  4JK1 X;  2EQR A;  1TZL A;  4AID A;  5L3C A;  1DU6 A;  1B8I A;  1IN5 A;  4CCN A;  4CA0 A;  2NYX A;  4BJ6 C;  3WTT C;  3OYK A;  2ME0 A;  3EYI A;  2DDB A;  4ZYG A;  5GPA A;  1MBF A;  3H0D A;  1A36 A;  5DD4 A;  4WXD A;  3TGN A;  3I54 A;  3TP3 A;  1RUO A;  2BV6 A;  2LYC A;  4MTE A;  3S1Q J;  5AIQ A;  2L0K A;  1IRX A;  2YR2 A;  4IHX A;  1NHA A;  3J7Y J;  2LC2 A;  2W4S A;  2BGC A;  2H09 A;  2PBI A;  1AOY A;  4GXO A;  2DPU A;  4AYB N;  4DBQ A;  3O8G A;  5M5W J;  3C2H A;  4BQQ A;  1MMD A;  1MSE C;  4C9Y A;  3DKX A;  3D5S C;  4I09 A;  5C4J J;  3TW7 A;  3LA3 A;  3GF2 A;  2JJ7 A;  4EVI A;  5BOX A;  3ISP A;  2Y9Y A;  3SQN A;  3MKZ A;  2HZT A;  3C3W A;  3J81 K;  2CS3 A;  3O6B B;  4O3M A;  3N97 A;  2CG4 A;  3QAH A;  5JVG F;  1WJD A;  1T0F A;  3CF5 F;  3P5J A;  2E7W A;  3B6A A;  1LDJ A;  3FXJ A;  3ZQ7 A;  3MZY A;  1MH4 A;  2H94 A;  3F8F A;  4HF2 A;  2COB A;  4E7I A;  2IA2 A;  5DEQ A;  3H9G A;  5LEJ A;  1XX5 A;  4ENJ A;  3GTM J;  1PJR A;  2Z2S B;  3EUH A;  2R4G A;  1F5T A;  1R58 A;  2BW3 B;  2XV4 S;  4JOM A;  2RNG A;  1R9T J;  1LUJ B;  2QBY A;  1UHS A;  4Z6Y A;  1VF9 A;  1Z21 A;  4E7J A;  2RDP A;  4KA4 A;  2DFI A;  1FOK A;  1HXD A;  4C30 A;  2QF7 A;  4A0Y A;  1EF4 A;  4I02 A;  5A2Q K;  2VPR A;  2R5Z A;  5JFR A;  1H88 C;  2I5U A;  4Q4Z F;  2VQG A;  3FDY A;  3IP4 B;  2Q2E A;  1MH3 A;  1HBX G;  2VQC A;  5K1Y A;  1HA8 A;  3MD2 A;  5JHU A;  1FNN A;  2K4J A;  3M8E A;  4WK8 F;  4RBO A;  4EJU A;  4F92 B;  5F04 A;  4RA2 A;  2A5W A;  2NVT J;  4B3A A;  2E5Z A;  1QU3 A;  1QHG A;  1FP1 D;  2VJ4 A;  3CMY A;  2M8E A;  2K02 A;  4I0B A;  3WTY C;  2R5Y A;  2F48 A;  1R49 A;  1JUM A;  2X51 A;  3GFM A;  1YW8 A;  1USS A;  2DMQ A;  2KZV A;  1TQM A;  3RKW A;  4BH9 A;  3DV8 A;  3L2Q A;  2ECB A;  1QO0 D;  3J81 Z;  3DLL F;  2XAS A;  3CCR I;  1W1W E;  2V9P A;  4B44 A;  3M7G A;  4U0V A;  3BG6 A;  2QSG X;  3TQN A;  5JVT A;  3F8C A;  5HLT A;  4XKV A;  2CW0 F;  4LK1 F;  1WWX A;  2XIG A;  4IO9 F;  1IN8 A;  1WPK A;  2E1O A;  4GYG A;  4J01 A;  2LLK A;  2P5K A;  3FIS A;  3S2W A;  3Q0V A;  3WGI A;  1MNM C;  5HLG A;  3BJO A;  4ZZD A;  2A69 F;  4P96 A;  3OS2 A;  4IRI A;  4NC8 A;  1E2X A;  1YG2 A;  2LSO A;  3FXR A;  3H9Q A;  5KCM A;  3OY9 A;  5LHI A;  1IN4 A;  2MC3 A;  4BJT A;  4DBR A;  3FMS A;  3VSL A;  3QYF A;  5A2Q Z;  3VPR A;  3H1C A;  1P2F A;  1B6A A;  1FC3 A;  3MKW B;  2EZH A;  4A12 A;  1VQ4 I;  5FD5 A;  3BZK A;  5E3L A;  1YJ9 I;  3CP8 A;  3OOP A;  2KIM A;  3ZCO A;  1ZRF A;  2JZY A;  4YRV A;  2KIF A;  4U87 A;  3BR2 A;  4S05 A;  1KQ0 A;  4NDL A;  3PFI A;  2HTJ A;  4IOC F;  1X3U A;  4BQO A;  3CO7 C;  4ESF A;  2D5V A;  4YII A;  1A6I A;  4LLL A;  2VXZ A;  4DYR A;  3GTL J;  4EGY A;  1I1G A;  2CYY A;  5JHF A;  5EDN A;  1Y8R B;  3I58 A;  3TED A;  1AU7 A;  2RN7 A;  1GVJ A;  3LSR A;  3DEU A;  4H0E A;  1BA5 A;  2XF5 A;  1P92 A;  2EIN H;  3V7S A;  3WHB A;  4Y4R A;  3LSI A;  3BWG A;  2ZCW A;  4L5J A;  1WJC A;  4KT6 A;  2QM3 A;  1EKE A;  4D5F A;  4BJ5 C;  4UB8 C;  4I76 A;  1UG0 A;  2H8W A;  3F6O A;  2QKL B;  1OJL A;  4XID A;  5HLI A;  3BR3 A;  1RET A;  3WTW C;  2WY8 Q;  1XPX A;  1LPQ A;  5EEG A;  4GO1 A;  1WRJ A;  1X1B A;  5FJ8 J;  1RI7 A;  1OCT C;  4UB6 C;  2KT0 A;  2VOD A;  1NG7 A;  3FIW A;  1YHQ I;  4IHW A;  2F2E A;  1NK3 P;  3JR9 A;  4KYW A;  5D5W B;  4FHT A;  1VQ6 I;  4XLF A;  2XB5 A;  4ZDL A;  1QBJ A;  2FBK A;  2BXZ A;  1I50 J;  1LFP A;  1U8R A;  3E5U A;  1XSD A;  2EIM H;  3IWZ A;  3JRA A;  4BDZ A;  1FLI A;  2K3F A;  1LE8 B;  5J1U A;  4FE4 A;  3WTU C;  3R0J A;  4M71 A;  1UFM A;  2BEO A;  3KP2 A;  2DI3 A;  4M9S A;  4HX7 A;  1HDP A;  3M07 A;  5M5Y J;  4CHU A;  2ELH A;  4BXU A;  2BW3 A;  2DJN A;  1FY7 A;  5ILU A;  2O8X A;  2CW8 A;  4HZF A;  4YIF A;  3X2Q H;  2E2J J;  3BT9 A;  1S72 I;  4BQA A;  4M73 A;  4A3F J;  2OJE D;  1BW5 A;  2LF8 A;  1GVD A;  4XLP F;  5J4V A;  1FMW A;  5FO5 A;  2HPM A;  3I4P A;  3CDH A;  1X1D A;  4DYC A;  3IHU A;  4HYE A;  2EIL H;  3OYA A;  4L9J A;  4XRM A;  3S2D J;  2DFF A;  2ZKZ A;  4RAZ A;  1Z6T A;  1TQI A;  2R7X A;  2XVC A;  4M3G A;  3WGG A;  5M3M J;  3DU5 A;  3PSF A;  2MH2 A;  3IKT A;  1IXC A;  4UUS A;  3HDD A;  1Y56 A;  2VE8 A;  1UB9 A;  4B09 A;  4D5C A;  2JVG A;  4QPQ A;  5J40 A;  5HOO A;  4YFK F;  1A5J A;  3PNT A;  4E4H A;  3UR3 C;  3N05 A;  4EJO A;  2EJR A;  3WG7 H;  3SYT A;  1SAU A;  4C3H J;  1FBQ A;  3LMM A;  2EWN A;  2LG4 A;  4S04 A;  4F55 A;  3CCY A;  1A35 A;  3T0Y A;  1Z05 A;  4NHJ A;  2Y30 A;  3R6S A;  1HST A;  2PMZ A;  2GXA A;  2JWT A;  3BG7 A;  3Q9V A;  3B6C A;  5J8F A;  1R7J A;  1SMY F;  3FXL A;  2VXD A;  3TP0 A;  1FOW A;  5E8G A;  4WCG A;  4QLC U;  4IRG A;  2HEO A;  3K10 A;  3CUQ A;  3ZQG A;  2WTE A;  3MN2 A;  4XR6 A;  1O3T A;  2KDO A;  1U6G A;  2B9S A;  2ADU A;  2RAE A;  2CU7 A;  1BI3 A;  3WTZ A;  1HW5 A;  3KP5 A;  3K4C A;  4BEH B;  3ECH A;  1MJB A;  4BGD A;  5E18 F;  1DDN A;  3CC7 I;  3KZY A;  2W57 A;  5IP7 J;  1BI2 A;  3CP2 A;  5GAE J;  3HOZ J;  2FBH A;  3ML6 A;  3F3X A;  1W0T A;  5BS6 A;  3VDX A;  5LHG A;  3TO7 A;  1BI0 A;  2QA4 I;  2E2I J;  2HDD A;  3LSH A;  3ZMS A;  3DBR B;  1LQ1 A;  4L18 B;  5BMZ A;  4MGR A;  5C44 J;  2ZJP F;  2QZ8 A;  4IHV A;  4FX4 A;  5E8I A;  1R36 A;  1DP7 P;  1Q1V A;  2E60 A;  4RAY A;  4XBF A;  1GUU A;  2JPB A;  4A2U A;  1G3T A;  2NAZ A;  2VKH A;  2GAU A;  1V5E A;  2NNN A;  4WWC A;  1TLH B;  4K2E A;  1LEB A;  2ZB9 A;  2D45 A;  2PEX A;  4WXH A;  1JKO C;  2ZBK A;  2QQ9 A;  2HR3 A;  4G6D A;  3VSK A;  3LAP A;  2HKO A;  5TGT A;  3K0L A;  2V1D A;  2NS7 A;  4I7H A;  2XGC A;  2DT7 B;  1ERD A;  2MYS A;  1U9O A;  3DKW A;  3GLL A;  2FE3 A;  4FX0 A;  2HZD A;  4UVB A;  3UKG A;  4II2 A;  3CDI A;  4F91 B;  1NTC A;  3LQQ A;  4PK4 A;  1FIP A;  5LRS A;  2LD5 A;  3K69 A;  4JBA A;  5GAH J;  3KYD B;  5FKN A;  3IV5 A;  3U1D A;  4XN3 A;  2F5F A;  2BE5 F;  4BHP A;  3QU3 A;  1K4S A;  1AA7 A;  3E97 A;  2OC6 A;  4BHC A;  4CCJ A;  3ZPL A;  2H1L A;  1J59 A;  4BE2 A;  1PP7 U;  5CKT A;  1LE8 A;  1BR1 A;  5F1R A;  2O6G E;  2QEN A;  3H5N A;  2Q1Z B;  1E3O C;  2FNP A;  3ESW B;  3LWF A;  2PI0 A;  1YOV B;  2DXI A;  4AM3 A;  3HM5 A;  1I1S A;  9ANT A;  3IH2 A;  4M3F A;  1XSV A;  4MFD A;  4NQW B;  2WA0 A;  2XC7 A;  2MG4 A;  1Z3X A;  4HX8 A;  1NG6 A;  3K6G A;  4D1Q A;  1EH8 A;  3HC7 A;  1KZH A;  4ZDP A;  4AUX A;  2WV1 A;  3A01 B;  1X1P A;  4D7M A;  2E34 A;  1R5I D;  2F5E A;  5E79 C;  4NC7 A;  5EYR A;  1G6N A;  3CCU I;  1U5T C;  1IN6 A;  1U5T B;  3SEZ A;  4II3 A;  4YFN F;  4HLY A;  1IJW C;  3LL7 A;  3I56 I;  2FA5 A;  4EQQ A;  4DYQ A;  2VI6 A;  1W36 C;  4OAY A;  2CUZ A;  4P9U A;  3HSE A;  5D6E A;  4AWX B;  2ELJ A;  1FPQ A;  2VKD A;  3HUG A;  4PSX A;  5IY5 H;  4JX6 A;  5ED4 A;  2A07 F;  1OPC A;  4KIS A;  2KQR A;  1TWH J;  2WB1 A;  5DDG A;  3FF5 A;  1W7P D;  3DLA A;  2XAG A;  3I71 A;  1TNT A;  2FX0 A;  3WU0 A;  1ETV A;  2NOG A;  1DGR M;  4P55 A;  4ON0 A;  2MD5 A;  1ETY A;  1W5C C;  3FMR A;  3ZR8 X;  3G71 I;  4H4K C;  1MBJ A;  1BR2 A;  3JCU C;  4Q5S F;  1LFB A;  2HXO A;  2LVS A;  1G4D A;  3H3U A;  3V7C A;  4G7H F;  4CCM A;  3ECO A;  2X48 A;  4C2T A;  1KYZ A;  1SD5 A;  4EMS A;  1OR7 A;  5JI6 A;  3TOA A;  3TO9 A;  4D7N A;  1FYK A;  2DK5 A;  5D5X B;  5KNL A;  3E7L A;  1IXR C;  4GGG A;  5EF6 A;  1SFE A;  1SC7 A;  2EV5 A;  3G1O A;  1ZG1 A;  4MQV A;  4XM3 A;  1U8B A;  1JHF A;  1SD4 A;  3T8R A;  2EV0 A;  3HBL A;  1Y1V J;  5DUK A;  2CMP A;  2QSH X;  4F7Z A;  2MD0 A;  2STT A;  3QPH A;  1ON1 A;  5LD2 C;  1FIA A;  2DA5 A;  4M74 A;  4XLN F;  1J2X A;  5FLM J;  2AQE A;  3FBN B;  2HFH A;  3KE2 A;  3ZGK A;  3HHH A;  3HRM A;  3S1N J;  4B1R A;  3HOY J;  1VFC A;  3LSG A;  2WAQ A;  1U78 A;  4HNT A;  1J9I A;  1WCM J;  3A02 A;  3EUH C;  3O3K A;  2QQ8 A;  2G7H A;  1TTY A;  2IA0 A;  4BEH A;  3BOQ A;  2XPV A;  3RI4 A;  3CCV I;  3BR6 A;  1HOM A;  1B4A A;  1FSH A;  2DAO A;  1YTY A;  1O7F A;  2PX9 A;  2HQR A;  4KMF A;  4YFX F;  1FBS A;  1YX3 A;  2LTP A;  2DCE A;  3C2G A;  4JP0 A;  3K70 D;  4P1W A;  4XRS A;  1IRG A;  2R5Z B;  3JRB A;  3HRT A;  3BTC A;  1RR8 C;  2CQN A;  4FQG A;  3FK7 A;  2Q2E B;  4DZP A;  3OYE A;  3MVP A;  4IZZ A;  3GUD A;  4M6V A;  3HOW J;  2L9N A;  3G73 A;  5CPR B;  3CME I;  3AG4 H;  2Y2Z A;  1LB2 A;  2FF4 A;  3NWT A;  1QPM A;  4CYD A;  2ZFU A;  2ZXH A;  2HPI A;  2XGD A;  3TOB A;  3FHN A;  3E1S A;  4Y15 A;  3JTH A;  1QPI A;  2R7R A;  2R5Y B;  1D3Y A;  4PJ0 C;  3W2W A;  1VTN C;  2V1X A;  5E20 A;  4HA8 A;  3ULQ B;  2ETH A;  5CVV A;  3SEQ A;  3HSF A;  3EET A;  4M3B A;  1U3E M;  1MMG A;  4F3Q A;  5CQE A;  5IYB J;  4IHS A;  1KQ9 A;  2IBD A;  1X1A A;  2LKP A;  2GXB A;  2Y75 A;  2OA4 A;  2L7Z A;  2R7S A;  3Q9S A;  2CW7 A;  1G3Y A;  3E3V A;  2E1N A;  2NVY J;  5IP6 A;  2HOT A;  3CLQ A;  2CQK A;  4HDV A;  1R6R A;  1D1C A;  2R7D A;  1RRJ A;  2LY9 A;  2UZK A;  1IXS B;  1R71 A;  1OKR A;  2UV1 A;  2M87 A;  1X2M A;  3HB9 A;  1N77 A;  5FGM A;  2QGU A;  3HGY A;  3BG3 A;  3MKL A;  3PL8 A;  2HDW A;  3C2B A;  2X0L A;  3QPS A;  2CFX A;  3OYJ A;  2BOL A;  4U7D A;  3G1L A;  4QSH A;  4NQW A;  5D8K B;  1ZR4 A;  2M4K A;  2VQH A;  3CO6 C;  2JA8 J;  5CQG A;  1K78 B;  2Z16 A;  1MMA A;  2QWW A;  4LOC A;  2A68 F;  1Z91 A;  3DTK A;  2LBF B;  3A01 A;  1K83 J;  2R7T A;  1OCO H;  3TDU C;  3GLX A;  2X6Y A;  1U5T A;  1WJA A;  2E2H J;  2R7U A;  3SHF A;  1TW2 A;  2MAB A;  3UNG C;  2UWM A;  3GFI A;  1FTT A;  5CVJ A;  4HNV A;  2OPT A;  5M5X J;  5HOD A;  3QYB A;  3HRU A;  2R7Q A;  2UXN A;  1VQ5 I;  1OYY A;  3GTP J;  5FFZ A;  5HS8 A;  5TJJ A;  2D1H A;  1FYL A;  4MQ9 F;  2P6T A;  1MBK A;  1SAN A;  2K9M A;  2CWE A;  1YIJ I;  5HS7 A;  4YEJ A;  5K5Q A;  3DWL E;  2BBY A;  2KJC A;  5E1Z B;  1G3S A;  3I9V 2;  5DS9 A;  2DN0 A;  3ZN0 A;  2RGV A;  5K7F A;  4HNU A;  3P9K A;  2M3A A;  1ZRC A;  2VT2 A;  2KP6 A;  4MO7 A;  3ZQQ A;  3E5X A;  1JT0 A;  2F4M B;  1IZ1 A;  3ZQF A;  2IGM A;  2MW8 A;  1YI2 I;  1BIB A;  5JLW A;  4EM1 A;  1Z77 A;  2CRG A;  4IQJ A;  4N9H A;  3S1R J;  3PO2 J;  3G6E I;  1R4M B;  2OAZ A;  4HST A;  2WC2 A;  3CMA I;  1R1T A;  3KLO A;  5FLV A;  1IRF A;  2H6B A;  3OV8 A;  4M72 A;  2DYR H;  4NNJ A;  1Y1W J;  2LMD A;  2Q0O A;  3KET A;  3KEO A;  5E1X A;  1QVU A;  4V2G A;  2VAS A;  1MD0 A;  4BBR J;  1NH3 A;  4X6A J;  3L00 A;  1I39 A;  2YU3 A;  2AO9 A;  1P4W A;  3KYC B;  1H89 C;  2CV1 A;  2V6E A;  2FJ1 A;  1H9T A;  1RNL A;  1A04 A;  2Y0S N;  2OU2 A;  1SD6 A;  2Z3Y A;  1CQT A;  4A93 J;  3L2U A;  3KP3 A;  1D0Y A;  4A69 C;  3LQR A;  1J5Y A;  4HF1 A;  5J1R A;  1BIA A;  2JRM A;  5LFA A;  2XRL A;  3WOD F;  1BJA A;  3JTG A;  3QRF F;  3J80 K;  3L2R A;  2RQQ A;  1F1Z A;  2J5O A;  3Q0W A;  3OS0 A;  5EZH A;  3CCM I;  1FYM A;  2GIV A;  2KHM A;  4F93 B;  5HDK A;  1GXP A;  3ZP5 A;  2A5Y B;  2XPW A;  1MZB A;  2ZSH B;  2CUE A;  2KL4 A;  4NB5 A;  4PDK A;  5K5R A;  1G2H A;  5TRD A;  3JAM K;  2DA7 A;  2R7F A;  4LLN A;  2IS4 A;  1BJZ A;  4N9I A;  4RAG A;  2IGO A;  3QOD A;  3JSP A;  2STW A;  1S29 A;  2NVX J;  4BE0 A;  2KJB A;  3IWF A;  3U2R A;  2HDC A;  2M0M A;  2AQF A;  3T8T A;  3DKY A;  3H35 A;  4UVA A;  3CCQ I;  1G8X A;  4UUS B;  2EA4 A;  2M4G A;  3KP7 A;  5B1A H;  1FOX A;  1WJ5 A;  4DGW B;  3HOT A;  1Z7U A;  2LDU A;  2DDA A;  3R60 A;  2HQA A;  3S15 J;  2DTR A;  2ELK A;  1D0Z A;  2LKX A;  3QPT A;  2EFW A;  3GTO J;  4CO8 A;  3ZMD A;  3TO6 A;  3KCC A;  4L9T A;  3CTA A;  4KMU X;  1VQ9 I;  5J6X A;  2L3D A;  4WXC A;  3OYF A;  3GEZ A;  3OSF A;  1JKQ C;  2RC4 A;  4XLA A;  2AS5 F;  5DV5 A;  4HG2 A;  2LY2 A;  4M9X A;  3DFG A;  3D1N I;  3QU6 A;  4A3M J;  2PJR A;  4AVZ A;  4I99 C;  2QEX I;  5GTI C;  4YIR X;  3H3V K;  1MW7 A;  1N25 A;  1VQ7 I;  1LNW A;  2K40 A;  1TQP A;  2K4B A;  2FXA A;  4C3J J;  3CUQ C;  3GWZ A;  3CUQ B;  4I6Z A;  1SFO J;  3A0B C;  4PFP A;  4R79 A;  4MFE A;  2V1U A;  3J80 Z;  2JSC A;  3S93 A;  4BKX A;  1MBE A;  3FKJ A;  3KIO A;  1IN7 A;  4ABZ A;  1K78 A;  1JGG A;  2LBF A;  2RRE A;  2JK3 A;  4OOI A;  3VYU B;  4AIH A;  5E3O A;  2QKM B;  2XB0 X;  3KP4 A;  1ZAO A;  5HNH A;  5IT9 K;  4LD5 A;  4EJT A;  4EGZ A;  4CCO A;  3ABT A;  2P8T A;  1K6O A;  2MLK A;  4Y17 A;  2V1N A;  4I98 B;  3DEE A;  1ITY A;  2JTV A;  1HDD C;  2BZT A;  5IPA A;  5HDN A;  2KLO A;  3JRG A;  5F1J A;  2DOD A;  1AHD P;  2JUC A;  2O61 A;  2P5L C;  2VBX A;  3BG9 A;  3GYH X;  1YIO A;  2HU9 A;  1XN7 A;  1WJB A;  2A6E F;  3LOC A;  5ICG A;  3SDB A;  2MLG A;  4HAM A;  5JLX A;  1GV2 A;  4L9V A;  3KYL A;  2JUG A;  2ACJ A;  3W2A A;  3MQ0 A;  4OMZ A;  4U88 A;  4XQF A;  2B0L A;  4HLX A;  5J3L A;  3JRD A;  3K7A J;  3FXM A;  2EA2 A;  3AKZ A;  5E1W A;  3CD6 I;  2RQP A;  2GXG A;  2CQX A;  2CUJ A;  5B5E C;  3K4M A;  2HQ5 A;  4JX4 A;  1BL0 A;  1GHC A;  3LSM A;  4AVP A;  3JRE A;  2EFO A;  1XDS A;  1S5L C;  4OIP F;  3DPL C;  5FD6 A;  4PFO A;  2XF7 A;  2BY1 A;  2TDX A;  4HQE A;  4HF0 A;  1XCV A;  1J0R A;  2ISY A;  4DJA A;  2FNA A;  3K2Z A;  2O3F A;  1TWC J;  2HYF A;  3GBG A;  1E3P A;  1ZRE A;  3CJQ B;  3K4K A;  1DPU A;  1GT0 C;  3VOE A;  3WTS C;  1FBU A;  1TWA J;  5IT9 Z;  1ACI A;  4L0Y B;  4GCV A;  1V5F A;  3BY6 A;  2EK5 A;  4XN0 A;  5F27 A;  4IL6 C;  5E3M A;  1I6H J;  2CJJ A;  2EH3 A;  4HDU A;  1IUF A;  4TV7 A;  3CMM A;  2I8D A;  3SZT A;  3HTS B;  4RGS A;  4I0A A;  1REP C;  1VI0 A;  3ABK H;  1X3W B;  4O5V A;  5F0C A;  1V3F A;  5CVI A;  3RDI A;  1FJL A;  1WJE A;  4G7O F;  1YX5 A;  1LEA A;  3HUG B;  2EFQ A;  2IS2 A;  4J00 A;  2AHQ A;  2GM4 A;  1P7I A;  2L7F P;  4KUM A;  2ID6 A;  1YW9 A;  4FAS D;  3C1D A;  3TW6 A;  1QA6 A;  4N4O B;  2V79 A;  4ZYD A;  2FOK A;  3V7R A;  3G3Z A;  2OCC H;  1U9N A;  1HKQ A;  1QZZ A;  1JUS A;  2VKE A;  2MSY A;  4Y33 A;  1OR7 C;  5D6F A;  4ENM A;  4Y3O A;  2VE9 A;  1W5T A;  3ZMT A;  3ELK A;  1TNS A;  4LIT A;  3K4J A;  4I01 A;  2FU4 A;  4QPO A;  1V5G A;  4ITV A;  4IHT A;  3L09 A;  1TWG J;  2VBZ A;  4IXA A;  4KIG A;  3BP8 A;  3RZO J;  3LFU A;  3EDP A;  2KRC A;  3HIF A;  5FFX A;  3CCE I;  1R1V A;  3NAR A;  2OZ6 A;  3AG3 H;  2E35 A;  1Y8Q B;  2DPD A;  3EUK L;  2HYG D;  2PFB A;  1OFC X;  2DMU A;  3K9T A;  2CO5 A;  3ABM H;  3CES A;  4BBS J;  3K1N A;  1W7P A;  2BVL A;  2K5C A;  4CDG A;  2L2O A;  1HC8 A;  2WV0 A;  2Z99 A;  3AG1 H;  3M9A A;  3QQA A;  3WU1 B;  1F9N A;  4WX9 A;  3GTK J;  2BHY A;  3U21 A;  1T8I A;  1TBX A;  2EZI A;  2L9R A;  5HVQ C;  4XRF A;  3SFZ A;  1OYI A;  3RYR A;  2P5V A;  1IAW A;  1CF7 A;  4JYK A;  4A3K J;  1QHH D;  2VKV A;  3G4S I;  1VQN I;  3OL4 A;  3HJE A;  2HOS A;  4LFU A;  1MJ9 A;  3HOU J;  5GTH C;  3PUB A;  4A0Z A;  3T5X A;  2PMU A;  2GLO A;  4CCK A;  3BZC A;  1Z67 A;  3SXY A;  1RIO H;  1S8N A;  2DMP A;  3BPV A;  1FX7 A;  1SVM A;  1TT0 A;  3F6V A;  3GFJ A;  1SD7 A;  1JHH A;  4CZC A;  2OBP A;  4R1H A;  4DW6 A;  1OLT A;  3ZOB A;  1IDY A;  5EEA A;  3HXL A;  2RNJ A;  4HRI A;  1TWF J;  3KEQ A;  2L7K A;  5EG0 B;  4U0W A;  2DOF A;  2Y0M A;  5HS9 A;  4MLO A;  4B43 A;  3E6B A;  3PM1 A;  2COM A;  3BPX A;  3P7N A;  5GAD J;  1O4X A;  1LKX A;  2KMU A;  1T56 A;  3BRO A;  3QP5 A;  2DA6 A;  3OYI A;  1UG2 A;  3GTG J;  4E7K A;  1BOA A;  5L3G A;  2R7O A;  1ZGW A;  2JQ7 A;  1MKM A;  4Y52 J;  4BU2 A;  4BY7 J;  4E7L A;  3BCB A;  2RV8 A;  2PMH A;  3VWB A;  1MJA A;  3CJT B;  3FM3 A;  3J7A O;  1MGT A;  1YQA A;  3GZN B;  1UEL B;  1Y0U A;  3DP7 A;  2AXT C;  3FWE A;  3SZG A;  1ONV A;  4EM0 B;  2IS1 A;  4UHT A;  2O5R A;  2VT3 A;  2VB6 A;  1I3A A;  1FMV A;  3H36 A;  5LGN A;  3I59 A;  1O3R A;  3CLO A;  2IP2 A;  2W24 A;  3FXQ A;  5DYM A;  4LIV A;  2PMZ N;  1XC5 A;  2XKO A;  3ROU A;  1K61 A;  3EYY A;  2JVH A;  5EEH A;  5L3B A;  2XKP A;  4U7B A;  1D5Y A;  3M8F A;  2NNY A;  2R3S A;  1UHW A;  1HSJ A;  2DLL A;  1KYW A;  1T98 A;  3PNV A;  1U0J A;  3S16 J;  1JXS A;  4M6Y A;  4G9Y A;  2L7M P;  3GO5 A;  1XD7 A;  5J8C A;  5C3E J;  2E5N A;  1XGM A;  4IRH A;  3FXU A;  2TRT A;  1WGX A;  3W6J B;  4BAC A;  2WAD A;  2H1K A;  3NWS A;  2OF7 A;  1BR4 A;  1LDD A;  4YEL A;  5F0H A;  2WAE A;  3S3M A;  4L5E A;  2K85 A;  2CV0 A;  1B9M A;  3FBI B;  3GXO A;  1UJ8 A;  2PN6 A;  3RJP A;  3AAF A;  4N0B A;  1SFX A;  1WKM A;  4UY8 I;  2L9S A;  2M7B A;  4IVN A;  2W84 A;  1SEU A;  2EZL A;  3I4M J;  1X58 A;  4PJM A;  3U1K A;  3CUO A;  2DQL A;  2DBB A;  1ZH5 A;  4XLC A;  1DP3 A;  3OMY A;  1Q1H A;  3EQL F;  4W97 A;  4EJV A;  4A3D J;  3JSO A;  4XOP A;  3M8J A;  3BQY A;  3V4G A;  2XRN A;  3PSI A;  3K1P A;  1PUF A;  2FML A;  3GME A;  2VOP A;  2FMY A;  2HOA A;  4LB5 A;  4IF4 A;  5DUI A;  2QQA A;  2ME6 A;  1FSE A;  2YPR A;  1L0O C;  3FM5 A;  1QRY A;  2P7V B;  2JA2 A;  5FKL A;  2HQN A;  3LFK A;  4PJN A;  2NOJ B;  4FT8 A;  5F64 A;  4IOA F;  3OYD A;  2M5W A;  3K2A A;  4UUT A;  1MMS A;  3BTJ A;  2F5C A;  3H0G J;  1B1B A;  3IRR A;  4E6K G;  5FLX K;  4EAT A;  5FRN A;  4GFB A;  2DT6 A;  3D5L A;  2ZJ2 A;  4YG2 F;  3COA C;  3J7A Y;  2VC0 A;  3ZXS A;  4XK4 A;  3RKY A;  2X85 A;  3I5U A;  3KFW X;  2HVR A;  2PJP A;  3ASN H;  1HW2 A;  2FBI A;  1T38 A;  2VJJ A;  4RDU A;  3DPU A;  5ICF A;  2KZG A;  1HCR A;  1ZAR A;  5FRM A;  2CQ7 A;  1MMN A;  2P4W A;  3BDD A;  1X19 A;  4U0Y A;  3BG5 A;  1Y0N A;  3CCL I;  1T2K A;  4W1U A;  3HGG A;  3FXO A;  3RIR A;  2F5D A;  3OIQ A;  1TW3 A;  4OU0 A;  1SVL A;  2Q8K A;  3K4N A;  5M3F J;  3T1B A;  3HRS A;  3IAM 2;  1O57 A;  1X4P A;  1YLF A;  3EPZ A;  3RPU D;  3BR1 A;  3OR2 C;  1JJ6 C;  2NVQ J;  3VYT B;  1P7J A;  2WWY A;  2O03 A;  4D9J A;  1SMT A;  2IA1 A;  3HOX J;  4Q47 A;  4O6J A;  2OQG A;  2HI3 A;  4ZYE A;  2LOO A;  2X1C A;  3MKY B;  2CUF A;  2X9D A;  5EG0 A;  2JMW A;  4AC0 A;  1UMQ A;  3OOU A;  2VBW A;  3HG9 A;  3CJR B;  4KIT B;  2FD5 A;  3OS1 A;  2WB1 N;  3DF8 A;  3K1M A;  2EIJ H;  3A1Y A;  1MDM B;  1ETO A;  4QTR A;  3VYR B;  2PQ8 A;  1JGS A;  4P9F A;  4FCY A;  2K9Q A;  2JN6 A;  2X1E A;  1H0M A;  2EIK H;  4C3I J;  5TIS C;  3B73 A;  2YS9 A;  3CZ6 A;  1P9Q C;  2UUZ A;  1I6X A;  5EGO A;  1DUX C;  2M1B A;  3TBI A;  1YFH A;  5LLQ A;  2FQ3 A;  4ETS A;  1WH5 A;  1A31 A;  3TL4 X;  3FHZ A;  5DCM B;  2L01 A;  1ULY A;  1WH7 A;  2F6C A;  1N78 A;  3HZJ A;  3L1P A;  1EV7 A;  2M0C A;  2NRA C;  2HYJ A;  1S7E A;  2PJR B;  2ZXJ A;  4OMY A;  4ESB A;  4CXF A;  2VN2 A;  3QPL A;  1POG A;  3ASO H;  2A61 A;  1GLN A;  1Y39 A;  3KZI C;  3MZ8 A;  1T95 A;  4RLQ A;  3KLN A;  2M7A A;  3R61 A;  4HV6 A;  2EBI A;  2WAQ N;  4IPA A;  3QWL A;  1YIT I;  2AXL A;  3RQ4 A;  3RCO A;  5IYD J;  2GZW A;  3W6K B;  2G0E A;  2V26 A;  1X3Z B;  2JT1 A;  4A6E A;  1HF0 A;  4MTD A;  1OCP A;  1ZQ3 P;  3GX4 X;  1FZP B;  2VBY A;  1RKT A;  2W82 A;  4PSW A;  4EJW A;  5B1B H;  2DA3 A;  2QLZ A;  4XIC A;  3S17 J;  5AIP A;  3C18 A;  2EPF A;  3OIP A;  2Y48 A;  2H6C A;  2KKO A;  2L4A A;  5HLH A;  2H8R A;  5LGU A;  4V2F A;  2W00 A;  3WG9 A;  1B72 A;  2MGQ A;  5H6R A;  5D8L B;  1S6L A;  5H6Q A;  2Z9O A;  2XGX A;  3ZN1 A;  3RSN A;  4L0Z B;  3MEX A;  4XKB A;  4M3E A;  2QUF A;  1WI3 A;  3TMO A;  1TL8 A;  3CQZ J;  4HV5 A;  3GTQ J;  1KA8 A;  1ZK8 A;  1Z7L A;  4RGU A;  5FKM A;  3D0S A;  3BZ6 A;  4BNC A;  3S1M J;  1RPW A;  3S2H J;  2KIQ A;  1VQP I;  3R4K A;  3ZQL A;  1T6S A;  3GZ6 A;  2LF7 A;  4NC6 A;  5ICC A;  3O8H A;  3M1C A;  3A4C A;  2O0Y A;  3VEP A;  5IP9 J;  2CFO A;  1XGN A;  1X2N A;  3MCZ A;  2P0W A; 
#chains in the Genus database with same CATH homology
 2ZO4 A;  1YYV A;  1D8K A;  3V8L A;  4XSZ F;  1ZG5 A;  2V9V A;  2RVC A;  1B9N A;  4MNU A;  4LMY A;  4KN7 X;  1HKS A;  3P9C A;  3NQO A;  2JPC A;  2L54 A;  1R5G A;  1QZY A;  1KU9 A;  2ZNY A;  1RZ4 A;  2XAJ A;  2ISZ A;  4CGZ A;  2FRH A;  1XGS A;  5KVR A;  2EFP A;  3VFZ A;  1GXQ A;  4M9Z A;  1YS6 A;  1HKT A;  4OIO F;  1ZYR F;  2G9W A;  4RGR A;  5FB2 A;  3C7J A;  4I2O A;  1ZGJ A;  2K27 A;  2VON A;  1P6R A;  5ILV A;  2GQQ A;  2P6S A;  5L3E A;  4LK0 F;  3RKX A;  4RB1 A;  1BC8 C;  4PZJ A;  1MDM A;  3VB2 A;  1KU2 A;  2HGC A;  4KFC A;  1Z9C A;  1IF1 A;  3E6D A;  2FEZ A;  2DK8 A;  1BN5 A;  1OYW A;  4GYI A;  4CZZ A;  3N4M A;  5CYV A;  1KGS A;  4RB3 C;  3LA7 A;  5DCM A;  5ICE A;  3WTX C;  1J75 A;  4KIB A;  1STZ A;  3NRV A;  2H27 A;  4PCQ A;  1W7P B;  1ZRD A;  5IT3 A;  3TDZ C;  1V4R A;  2ZME A;  1R00 A;  2BYV E;  3SZP A;  1CF7 B;  1DPR A;  3BJ6 A;  2HTS A;  4ZH4 F;  2HS5 A;  3JAM Z;  1UCR A;  2VC1 A;  2DT5 A;  4EM2 A;  4Y13 A;  3RPQ A;  2JRT A;  2GWR A;  3F72 A;  4DNC A;  1WI9 A;  5D5V B;  1K79 A;  4KIF A;  3I64 A;  4LLG F;  1PDN C;  4L5I A;  2E7X A;  2J5P A;  3JW4 A;  3E6C C;  5BPI A;  1ZLJ A;  1FT9 A;  5CVU A;  3MZH A;  3F8N A;  1KQ8 A;  1F4K A;  2MA3 A;  3MAJ A;  1D8J A;  3I59 B;  1OMI A;  2LNB A;  1QQI A;  1R23 A;  2QQB A;  4ESJ A;  3DPT A;  1KU3 A;  3LST A;  1R1U A;  1S7O A;  5DCF A;  1R5H A;  4B8X A;  2XHK A;  2IRF G;  3L7W A;  4KNY A;  4ZYH A;  1IW7 F;  4A5N A;  1XSX A;  3I0T A;  1I27 A;  1XGO A;  2ESN A;  3VOD A;  3IC7 A;  1XMA A;  1C0W A;  2GA2 A;  3BJA A;  3F22 A;  2A3S A;  1L3L A;  1J7K A;  1ZN2 A;  3I53 A;  1BC7 C;  2DU9 A;  4G6Q A;  5F6F A;  4E70 A;  3M1E A;  4UXN A;  4UVC A;  3ZMU A;  2DW4 A;  2ZNZ A;  4KT5 C;  3PQJ A;  3U9G A;  3GW2 A;  5D4S A;  4Q48 A;  3F8M A;  5E17 F;  1PUE E;  2A6H F;  1YW7 A;  1CGP A;  2RKH A;  4G94 A;  5LGT A;  3HTU A;  4A6D A;  3IRQ A;  4A0X A;  3ABU A;  3WE2 A;  2C6Y A;  2PLY A;  4WF2 A;  1HW1 A;  1HQC A;  2OQR A;  4HOB A;  2YSR A;  4DQ2 A;  1H9G A;  2K7L A;  1FP2 A;  2NS0 A;  2GA1 A;  5L3D A;  3Q5F A;  1KU7 A;  3V8K A;  1O3S A;  5D4R A;  1D5V A;  1XCB A;  2IVM A;  1LDK B;  2K86 A;  1G3W A;  4JQF A;  4RB2 C;  1BBY A;  4CIC A;  2XAH A;  4M6X A;  3MWM A;  1PP8 F;  1SFU A;  1E17 A;  5HDG A;  4AIJ A;  1ZG3 A;  2MH9 A;  5L3F A;  4P5O A;  1ODD A;  4AD9 A;  5LRR A;  4HQM A;  2QYO A;  3PQK A;  2XAF A;  1QNT A;  2FSW A;  3F21 A;  3RPU A;  4KDP A;  5JR3 A;  1XMK A;  2HOE A;  1SAX A;  4AIK A;  3ERE D;  4HW0 A;  1U2W A;  4XSX F;  1WQ2 A;  3REO A;  3O2P E;  3ZMZ A;  2YX4 A;  1WSU A;  2IT0 A;  1O7L A;  1ON2 A;  2X4H A;  4UNO A;  2L4M A;  3QP6 A;  2W25 A;  4ENN A;  2MBF A;  2KRF A;  2M30 A;  2YX7 A;  3NEU A;  2Z33 A;  3RTR A;  2VOO A;  1YS7 A;  4G8X A;  2M45 A;  4LGW A;  3TKY A;  3IL2 A;  4RB0 A;  4MHG A;  2CGP A;  4PGH A;  1ZGA A;  1S3J A;  1YO5 C;  1Z6R A;  1JE8 A;  4LG0 B;  4LB6 B;  2HKX A;  5ILS A;  4KN4 X;  5CJ9 A;  4Z2Y A;  2W85 A;  2V6C A;  1BM9 A;  3HSR A;  5KK1 A;  4G7Z F;  1AWC A;  2E1C A;  3F23 A;  3E6M A;  1QGP A;  3QOP A;  1EH7 A;  5K5O A;  4PGG A;  4D0P A;  3GZ5 A;  3IKV A;  5LEK A;  1I5Z A;  3GVA A;  2DO7 A;  2XUB A;  3HYI A;  2G7U A;  3MFK A;  4HX4 A;  3HOS A;  4RGX A;  3WTV C;  1IUY A;  3CJN A;  2EV6 A;  4MEY F;  2DQR A;  4EV0 A;  4MEX F;  1Z1D A;  3B02 A;  1K7A A;  3GFL A;  4BHB A;  3ZMV A;  5LHH A;  3LAJ A;  4ASN A;  4OIN F;  3R0A A;  5DD8 A;  2PG4 A;  5CLS A;  3DXJ F;  5ERI A;  1O3Q A;  2EFN A;  2IPQ X;  2QBY B;  3WE3 A;  1LJ9 A;  4OIQ F;  6PAX A;  2CSO A;  4HBL A;  1P4X A;  1R22 A;  3FZV A;  1EH6 A;  3L9F A;  2P7C B;  3H92 A;  3E5Q A;  5BPD A;  5D5U B;  2L02 A;  5FLX Z;  2QVO A;  4BAY A;  1B59 A;  2ESH A;  2UXX A;  2D1V A;  3F8B A;  4BYY A;  4UUV A;  4KIC A;  4IJA A;  1ZHF A;  4L9N A;  3L2C A;  4LJZ F;  4OIR F;  4UV8 A;  2XRO A;  1RUN A;  5BQT A;  4UV9 A;  1ZLK A;  2XAQ A;  2D2W A;  5H20 A;  1T39 A;  3LA2 A;  2ZME B;  3WGH A;  1UHM A;  1XB4 A;  3H3Z A;  2EB7 A;  2Z5U A;  3DQV C;  5AON A;  4ZZL A;  4QWQ A;  1W5S A;  1S7A A;  5LBQ A;  2OD5 A;  1P4A A;  2HWV A;  4RS8 A;  2KIU A;  3KP6 A;  3RYP A;  1UST A;  3P9I A;  4ENK A;  2IW5 A;  2ZFW A;  3KZZ A;  3HHG A;  2OZU A;  4R8H A;  4LG0 A;  3FMQ A;  1W4M A;  1FWZ A;  5CVR A;  3V8J A;  1LVA A;  1BI1 A;  3FX3 A;  2IJL A;  4A5M A;  1XDU A;  4JK1 X;  5L3C A;  1IN5 A;  2NYX A;  3WTT C;  3EYI A;  4ZYG A;  5DD4 A;  4WXD A;  3TGN A;  3I54 A;  1RUO A;  2BV6 A;  4MTE A;  5AIQ A;  2YR2 A;  1NHA A;  2BGC A;  2H09 A;  2PBI A;  1AOY A;  4GXO A;  2DPU A;  4I09 A;  3LA3 A;  3GF2 A;  4EVI A;  5BOX A;  3ISP A;  3SQN A;  2HZT A;  3C3W A;  3J81 K;  3O6B B;  4O3M A;  3N97 A;  2CG4 A;  3QAH A;  1T0F A;  2E7W A;  1LDJ A;  3ZQ7 A;  3MZY A;  3F8F A;  2H94 A;  4HF2 A;  2IA2 A;  5DEQ A;  5LEJ A;  4ENJ A;  3EUH A;  1F5T A;  1R58 A;  2XV4 S;  2QBY A;  2RDP A;  4KA4 A;  2DFI A;  1FOK A;  1HXD A;  4A0Y A;  4I02 A;  5A2Q K;  5JFR A;  4Q4Z F;  2Q2E A;  1HBX G;  5K1Y A;  5JHU A;  1FNN A;  2K4J A;  3M8E A;  4WK8 F;  4EJU A;  1FP1 D;  2M8E A;  2K02 A;  4I0B A;  3WTY C;  3GFM A;  1YW8 A;  1USS A;  1TQM A;  3RKW A;  4BH9 A;  3DV8 A;  1QO0 D;  3J81 Z;  2XAS A;  3M7G A;  4U0V A;  3TQN A;  5JVT A;  3F8C A;  2CW0 F;  4LK1 F;  1WWX A;  2XIG A;  1IN8 A;  4GYG A;  2P5K A;  3S2W A;  3WGI A;  5HLG A;  3BJO A;  4ZZD A;  2A69 F;  4P96 A;  4IRI A;  1E2X A;  1YG2 A;  2LSO A;  3FXR A;  5LHI A;  1IN4 A;  2MC3 A;  3FMS A;  5A2Q Z;  1P2F A;  1B6A A;  1FC3 A;  4A12 A;  5FD5 A;  3OOP A;  2KIM A;  1ZRF A;  2JZY A;  2KIF A;  4S05 A;  1KQ0 A;  3PFI A;  2HTJ A;  1X3U A;  3CO7 C;  4ESF A;  4YII A;  4LLL A;  2VXZ A;  4EGY A;  1I1G A;  2CYY A;  3I58 A;  2RN7 A;  1GVJ A;  3DEU A;  4H0E A;  3V7S A;  1P92 A;  3BWG A;  2ZCW A;  4L5J A;  2QM3 A;  3F6O A;  3WTW C;  5HLI A;  5EEG A;  4GO1 A;  1WRJ A;  1RI7 A;  2VOD A;  2F2E A;  4KYW A;  5D5W B;  4FHT A;  1QBJ A;  2FBK A;  1U8R A;  3E5U A;  1XSD A;  3IWZ A;  1FLI A;  3WTU C;  3R0J A;  4M71 A;  1UFM A;  2BEO A;  3KP2 A;  2DI3 A;  4M9S A;  4HX7 A;  4CHU A;  2ELH A;  4BXU A;  1FY7 A;  5ILU A;  2O8X A;  4HZF A;  4YIF A;  4BQA A;  4M73 A;  2LF8 A;  4XLP F;  3I4P A;  3CDH A;  3IHU A;  4HYE A;  4L9J A;  2ZKZ A;  4RAZ A;  1Z6T A;  1TQI A;  2XVC A;  3WGG A;  2MH2 A;  3IKT A;  1IXC A;  2VE8 A;  1UB9 A;  4B09 A;  5HOO A;  4YFK F;  4EJO A;  2EJR A;  1FBQ A;  2EWN A;  4S04 A;  3T0Y A;  1Z05 A;  4NHJ A;  3R6S A;  1HST A;  3Q9V A;  5J8F A;  1R7J A;  1SMY F;  5E8G A;  4WCG A;  4QLC U;  4IRG A;  2HEO A;  3CUQ A;  2WTE A;  1O3T A;  1U6G A;  2ADU A;  1BI3 A;  3WTZ A;  1HW5 A;  3KP5 A;  1DDN A;  3ECH A;  1MJB A;  5E18 F;  3KZY A;  2W57 A;  1BI2 A;  2FBH A;  3ML6 A;  3F3X A;  5BS6 A;  5LHG A;  3TO7 A;  1BI0 A;  3ZMS A;  1LQ1 A;  4L18 B;  5BMZ A;  4MGR A;  2QZ8 A;  4FX4 A;  5E8I A;  1R36 A;  1DP7 P;  4RAY A;  4XBF A;  2JPB A;  4A2U A;  1G3T A;  2NAZ A;  2GAU A;  2NNN A;  4WWC A;  1TLH B;  4K2E A;  1LEB A;  2D45 A;  2PEX A;  4WXH A;  2ZBK A;  2QQ9 A;  2HR3 A;  4G6D A;  3LAP A;  2HKO A;  3K0L A;  2V1D A;  4I7H A;  3DKW A;  2FE3 A;  4FX0 A;  4UVB A;  3LQQ A;  5LRS A;  3K69 A;  4JBA A;  3U1D A;  2F5F A;  2BE5 F;  4BHP A;  3QU3 A;  3E97 A;  3ZPL A;  4BHC A;  1J59 A;  1PP7 U;  5F1R A;  2O6G E;  2QEN A;  2FNP A;  3LWF A;  2PI0 A;  1I1S A;  1XSV A;  4HX8 A;  1EH8 A;  2F5E A;  1G6N A;  1U5T C;  1IN6 A;  1U5T B;  4YFN F;  4HLY A;  2FA5 A;  4EQQ A;  4P9U A;  3HSE A;  5D6E A;  4AWX B;  3JTG A;  1FPQ A;  5ED4 A;  3HUG A;  2A07 F;  1OPC A;  5DDG A;  3FF5 A;  1W7P D;  3I71 A;  2XAG A;  1TNT A;  3WU0 A;  4P55 A;  4ON0 A;  2MD5 A;  3FMR A;  4Q5S F;  1G4D A;  3H3U A;  3V7C A;  4G7H F;  3ECO A;  1KYZ A;  1SD5 A;  4EMS A;  5JI6 A;  1OR7 A;  3TOA A;  3TO9 A;  1FYK A;  2DK5 A;  5D5X B;  1IXR C;  4GGG A;  1SFE A;  2EV5 A;  1ZG1 A;  4MQV A;  1JHF A;  1SD4 A;  3T8R A;  2EV0 A;  5DUK A;  4F7Z A;  2STT A;  3QPH A;  1ON1 A;  4M74 A;  4XLN F;  1J2X A;  2HFH A;  3KE2 A;  3HHH A;  3HRM A;  1U78 A;  1J9I A;  3O3K A;  2G7H A;  1TTY A;  2IA0 A;  3BOQ A;  3RI4 A;  1B4A A;  1FSH A;  2DAO A;  1YTY A;  1O7F A;  2HQR A;  4KMF A;  4YFX F;  1FBS A;  1IRG A;  3HRT A;  3GUD A;  3G73 A;  1LB2 A;  2FF4 A;  1QPM A;  4CYD A;  3TOB A;  4Y15 A;  3JTH A;  1D3Y A;  1VTN C;  2V1X A;  5E20 A;  4HA8 A;  3ULQ B;  2ETH A;  5CVV A;  3HSF A;  3EET A;  1U3E M;  4IHS A;  1KQ9 A;  2LKP A;  2GXB A;  2Y75 A;  2OA4 A;  3Q9S A;  1G3Y A;  3E3V A;  2E1N A;  2CQK A;  4HDV A;  2R7D A;  2UZK A;  1IXS B;  1OKR A;  2M87 A;  5FGM A;  2X0L A;  2CFX A;  4U7D A;  4NQW A;  5D8K B;  3CO6 C;  1K78 B;  2QWW A;  2A68 F;  1Z91 A;  3TDU C;  3GLX A;  1U5T A;  3SHF A;  1TW2 A;  2UWM A;  3GFI A;  5CVJ A;  3HRU A;  2UXN A;  1OYY A;  5FFZ A;  5HS8 A;  5TJJ A;  2D1H A;  1FYL A;  4MQ9 F;  2P6T A;  2CWE A;  5HS7 A;  5K5Q A;  2BBY A;  2KJC A;  5E1Z B;  1G3S A;  3ZN0 A;  2RGV A;  3P9K A;  1ZRC A;  2VT2 A;  3E5X A;  1IZ1 A;  1BIB A;  4EM1 A;  4N9H A;  2OAZ A;  2WC2 A;  1R1T A;  3KLO A;  1IRF A;  2H6B A;  3OV8 A;  4M72 A;  2Q0O A;  3KET A;  3KEO A;  5E1X A;  1MD0 A;  3L00 A;  2YU3 A;  1P4W A;  1H9T A;  1RNL A;  1A04 A;  2OU2 A;  1SD6 A;  2Z3Y A;  3KP3 A;  3LQR A;  1J5Y A;  4HF1 A;  1BIA A;  3WOD F;  1BJA A;  3QRF F;  3J80 K;  1F1Z A;  2J5O A;  1FYM A;  2GIV A;  5HDK A;  1GXP A;  3ZP5 A;  2A5Y B;  1MZB A;  4NB5 A;  4PDK A;  5K5R A;  5TRD A;  3JAM K;  2R7F A;  4LLN A;  4N9I A;  3JSP A;  2STW A;  1S29 A;  2KJB A;  3IWF A;  3U2R A;  2HDC A;  3T8T A;  4UVA A;  2EA4 A;  3KP7 A;  3HOT A;  1Z7U A;  2LDU A;  3R60 A;  2DTR A;  3QPT A;  2EFW A;  4CO8 A;  3ZMD A;  3TO6 A;  3KCC A;  4L9T A;  3CTA A;  4KMU X;  5J6X A;  2L3D A;  4WXC A;  3GEZ A;  2RC4 A;  2AS5 F;  5DV5 A;  4M9X A;  3DFG A;  3QU6 A;  1LNW A;  1TQP A;  2K4B A;  2FXA A;  3CUQ C;  3GWZ A;  3CUQ B;  4R79 A;  2V1U A;  3J80 Z;  2JSC A;  1K78 A;  1IN7 A;  4OOI A;  4AIH A;  3KP4 A;  1ZAO A;  5IT9 K;  4LD5 A;  4EJT A;  4EGZ A;  3ABT A;  2P8T A;  1K6O A;  2MLK A;  4Y17 A;  4I98 B;  2JTV A;  5HDN A;  2O61 A;  2P5L C;  2VBX A;  3GYH X;  1YIO A;  1XN7 A;  2A6E F;  5ICG A;  2MLG A;  4HAM A;  4L9V A;  2ACJ A;  3MQ0 A;  4OMZ A;  4U88 A;  2B0L A;  4HLX A;  2EA2 A;  5E1W A;  2RQP A;  2GXG A;  1GHC A;  4AVP A;  2EFO A;  1XDS A;  4OIP F;  3DPL C;  5FD6 A;  4HQE A;  2TDX A;  4HF0 A;  1XCV A;  1J0R A;  2ISY A;  2FNA A;  3K2Z A;  2O3F A;  2HYF A;  1ZRE A;  1DPU A;  3VOE A;  3WTS C;  1FBU A;  5IT9 Z;  4L0Y B;  4GCV A;  3BY6 A;  2EK5 A;  4HDU A;  4TV7 A;  3SZT A;  3HTS B;  4RGS A;  4I0A A;  1REP C;  4O5V A;  1V3F A;  5CVI A;  3RDI A;  4G7O F;  1LEA A;  2EFQ A;  4KUM A;  1YW9 A;  3C1D A;  2V79 A;  4ZYD A;  2FOK A;  3V7R A;  3G3Z A;  1HKQ A;  1QZZ A;  5D6F A;  4ENM A;  2VE9 A;  1W5T A;  3ZMT A;  3ELK A;  1TNS A;  4I01 A;  2FU4 A;  4IHT A;  3L09 A;  4IXA A;  2VBZ A;  4KIG A;  3BP8 A;  3EDP A;  3HIF A;  5FFX A;  1R1V A;  2OZ6 A;  2DPD A;  2HYG D;  2PFB A;  3K9T A;  2CO5 A;  3K1N A;  1W7P A;  4CDG A;  2WV0 A;  2Z99 A;  3M9A A;  3WU1 B;  1F9N A;  4WX9 A;  1TBX A;  5HVQ C;  4XRF A;  3SFZ A;  1OYI A;  3RYR A;  2P5V A;  1IAW A;  1CF7 A;  4LFU A;  1MJ9 A;  4A0Z A;  3T5X A;  2PMU A;  3SXY A;  1RIO H;  1S8N A;  3BPV A;  1FX7 A;  3F6V A;  3GFJ A;  1SD7 A;  1JHH A;  2OBP A;  4R1H A;  2RNJ A;  3KEQ A;  4U0W A;  2Y0M A;  5HS9 A;  3E6B A;  2COM A;  3BPX A;  3P7N A;  3BRO A;  3QP5 A;  1BOA A;  5L3G A;  1MKM A;  2RV8 A;  2PMH A;  1MJA A;  3FM3 A;  3J7A O;  1MGT A;  1YQA A;  1Y0U A;  3DP7 A;  3FWE A;  1ONV A;  4EM0 B;  4UHT A;  2VT3 A;  5LGN A;  1O3R A;  3I59 A;  3CLO A;  2IP2 A;  2W24 A;  3FXQ A;  5DYM A;  2XKO A;  3ROU A;  3EYY A;  5EEH A;  5L3B A;  2XKP A;  4U7B A;  3M8F A;  2NNY A;  2R3S A;  1UHW A;  1HSJ A;  3MCZ A;  2DLL A;  1KYW A;  1T98 A;  1JXS A;  4M6Y A;  4G9Y A;  3GO5 A;  1XD7 A;  5J8C A;  1XGM A;  4IRH A;  3FXU A;  3W6J B;  1LDD A;  1B9M A;  3GXO A;  2PN6 A;  3RJP A;  3AAF A;  4N0B A;  1SFX A;  1WKM A;  4IVN A;  2W84 A;  3CUO A;  2DQL A;  2DBB A;  1ZH5 A;  4EJV A;  1Q1H A;  3EQL F;  3JSO A;  3V4G A;  2XRN A;  3K1P A;  2FML A;  2VOP A;  2FMY A;  4LB5 A;  4IF4 A;  5DUI A;  2QQA A;  1FSE A;  2YPR A;  1L0O C;  3FM5 A;  2P7V B;  2HQN A;  3LFK A;  4FT8 A;  5F64 A;  2M5W A;  2F5C A;  1B1B A;  3IRR A;  5FLX K;  3D5L A;  2ZJ2 A;  4YG2 F;  3COA C;  2VC0 A;  3RKY A;  3I5U A;  3KFW X;  2PJP A;  1HW2 A;  2FBI A;  1T38 A;  5ICF A;  1ZAR A;  4U0Y A;  2P4W A;  3BDD A;  1T2K A;  3RIR A;  2F5D A;  1TW3 A;  4OU0 A;  2Q8K A;  3T1B A;  3HRS A;  1O57 A;  1YLF A;  2WWY A;  2O03 A;  1SMT A;  2IA1 A;  4Q47 A;  4O6J A;  2OQG A;  4ZYE A;  2VBW A;  3DF8 A;  3K1M A;  1MDM B;  2PQ8 A;  1JGS A;  4P9F A;  1H0M A;  3B73 A;  1I6X A;  1DUX C;  2M1B A;  1YFH A;  5LLQ A;  2FQ3 A;  4ETS A;  3FHZ A;  5DCM B;  2L01 A;  1ULY A;  1EV7 A;  2NRA C;  2ZXJ A;  4OMY A;  4ESB A;  4CXF A;  2VN2 A;  2A61 A;  3KLN A;  3R61 A;  4HV6 A;  4IPA A;  2AXL A;  2GZW A;  3W6K B;  2JT1 A;  4A6E A;  4MTD A;  3GX4 X;  1FZP B;  2VBY A;  4EJW A;  2QLZ A;  5AIP A;  3C18 A;  2Y48 A;  2H6C A;  2KKO A;  2L4A A;  5HLH A;  5LGU A;  3WG9 A;  5H6R A;  5D8L B;  1S6L A;  5H6Q A;  2Z9O A;  2XGX A;  3ZN1 A;  4L0Z B;  3MEX A;  2QUF A;  4HV5 A;  1KA8 A;  4RGU A;  3D0S A;  3BZ6 A;  4BNC A;  3R4K A;  1T6S A;  3GZ6 A;  2LF7 A;  5ICC A;  2O0Y A;  3VEP A;  1XGN A;  5FO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...