3WTUC

Crystal structure of the complex comprised of ets1 (v170a), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtuC00
1S8NA 3ZMDA 1L0OC 4EJUA 4AIJA 2A68F 4A0XA 1EH6A 1JHHA 4LK1F 1HSTA 2M1BA 2RNJA 4RGSA 3TDZC 5HLHA 4DNCA 1YO5C 3B73A 2BGCA 3CTAA 4AWXB 5ED4A 3GFIA 2XASA 2P4WA 1G3SA 5ICEA 1CF7A 4EQQA 1QZYA 1TNSA 1FBUA 4EM0B 4WWCA 1FT9A 2PMHA 2X4HA 3RI4A 3JSOA 1L3LA 2E1CA 3REOA 3GWZA 1B1BA 2NNYA 3WGIA 2ESHA 1Z1DA 2L02A 3W6KB 2M8EA 3BJOA 5H6QA 3KLNA 3IWFA 1ONVA 3RIRA 4HYEA 1ODDA 5JI6A 3QRFF 1FNNA 1S3JA 2QBYA 1IXSB 3F8MA 1OYIA 3BY6A 5HDKA 1SFUA 2IJLA 1SFEA 2ZMEA 6PAXA 4UNOA 5FD5A 1BI0A 1K6OA 2EK5A 1K78B 2V9VA 1XGOA 2RKHA 2FBKA 1EH8A 2K27A 1A04A 1SD5A 1UFMA 4A6DA 5BS6A 2NNNA 4MGRA 3T1BA 5FGMA 4A0ZA 2FSWA 1P92A 5L3DA 4EJOA 3QP5A 1KU7A 4CHUA 4RAZA 2VBWA 1SD7A 5FLXZ 4XSZF 4ZYHA 4HF2A 1YS6A 3V7RA 3R61A 2GWRA 3EQLF 1D5VA 1G6NA 1YG2A 3L7WA 4RGRA 4ENJA 5FLXK 1STZA 2DQLA 1P4AA 3BJ6A 5HDGA 1H0MA 3JTHA 4BYYA 3QAHA 5D5WB 4I7HA 4OIOF 1W7PA 3DPLC 3V7CA 4RB2C 2HOEA 5FFXA 3JAMZ 2UZKA 4EJTA 4P96A 3ZP5A 5D5VB 5FFZA 1WI9A 2KIMA 4RB0A 4HX7A 4LB6B 1LEBA 1IW7F 5HDNA 2QLZA 3JAMK 3L00A 2ZJ2A 3BPXA 3WE2A 3BP8A 4LK0F 3E6DA 5E1WA 1OYYA 2ZBKA 3MZYA 4RGUA 4KIFA 4JQFA 5DCMB 4KMFA 3IHUA 1GHCA 3K1MA 5CVRA 1ON1A 2Z5UA 4ESFA 2FNAA 1ZN2A 4UHTA 2D2WA 1QO0D 3GXOA 4YIIA 4IRHA 3HIFA 2EA4A 2OQRA 5FD6A 1YIOA 1XCBA 2EV0A 3SQNA 1R1TA 1KA8A 2GA2A 1IAWA 4ENKA 4MTEA 1LDDA 1R58A 1BC7C 2IVMA 3I5UA 1J7KA 3NEUA 3MAJA 1IF1A 1GVJA 4BH9A 3WTYC 1UCRA 3MCZA 3RKYA 3R0AA 1FBSA 2VONA 4HF0A 4A0YA 2PQ8A 5D4RA 2O03A 2QYOA 5LGNA 4M9ZA 4GYIA 4LMYA 2VBYA 4NHJA 2KJBA 3BDDA 3LA7A 3E6CC 2IA2A 2V79A 4EVIA 1QGPA 3BJAA 4M72A 4OOIA 3HRMA 5J8FA 1CF7B 1ZRCA 4F7ZA 3BOQA 2XAFA 2QVOA 3EYIA 3J81K 2PLYA 2HYGD 2EFPA 1YW9A 4P9UA 3IL2A 1USTA 3MZHA 1PP7U 1T2KA 3PFIA 5KVRA 1Q1HA 3ZMVA 1I1SA 2XKPA 4LD5A 3I54A 2PI0A 4KIGA 3C7JA 1T98A 2QBYB 1ON2A 2OBPA 1XDUA 4ESBA 4M71A 4P5OA 2VT2A 5ERIA 2FEZA 4RB1A 2VBXA 2NYXA 4M74A 5DD8A 2DPDA 3V4GA 3ZPLA 2FQ3A 4M73A 3F8FA 3EDPA 3RTRA 1I6XA 2DT5A 4KICA 3N97A 2QQBA 2JSCA 2HDCA 4EGYA 4BXUA 1R5GA 5ICCA 4ZYGA 2CGPA 1U6GA 3ROUA 5H20A 1OKRA 1TQIA 3CUQC 2ZCWA 1K78A 1Z91A 3FX3A 1QPMA 1BIAA 4P9FA 3E5XA 3RYRA 1QNTA 2LF8A 3RPQA 2NRAC 3F8CA 3TGNA 4BHPA 3WTTC 2EFWA 2P5VA 1YW7A 4AD9A 1TTYA 4Q4ZF 1HQCA 4Q5SF 1XGMA 1B9NA 2DI3A 1GXPA 2QENA 1W4MA 3ERED 1W7PB 1LJ9A 4IF4A 1D8JA 3LSTA 5IT9Z 5EEHA 3EUHA 4UXNA 1BI1A 2VT3A 5EEGA 1YLFA 1O3RA 3BWGA 1SMTA 1KU9A 4O6JA 5IT9K 3IC7A 1YTYA 2Q8KA 4GCVA 1OPCA 1BN5A 4WF2A 2F5FA 2J5PA 1TQMA 4I0AA 2HS5A 2DPUA 1IZ1A 2RC4A 5DEQA 1FP2A 1ZGJA 4KT5C 4I2OA 3WGHA 2MBFA 5K5QA 3U1DA 1X3UA 2ZXJA 3RYPA 2XROA 5D8LB 1U2WA 3VEPA 4E70A 1YQAA 3HSFA 1J59A 5DUIA 2IPQX 3VODA 3IRQA 1TW3A 3ZMTA 1IRFA 3HRSA 1V3FA 5DCMA 2VE9A 4BNCA 1IXCA 1HKSA 1ZREA 2GA1A 4BHBA 4O5VA 2ZNYA 3GX4X 3K69A 5ICFA 3ZN1A 3DF8A 2EWNA 2VODA 1FC3A 2UWMA 4DQ2A 4B8XA 1KU2A 3KP4A 1HXDA 4XLPF 2CQKA 2CYYA 2ETHA 4BAYA 4AIHA 2HZTA 1KQ9A 2H27A 1BC8C 3B02A 1RNLA 1LVAA 3S2WA 1T0FA 4LLLA 2EFNA 2A5YB 1O7FA 2PJPA 3KP6A 4KDPA 3L09A 1F4KA 3P9CA 5DUKA 2G7HA 3V8LA 3F8NA 3M1EA 1W5SA 2VC0A 2O6GE 3RKWA 4HQMA 1O3TA 5CVUA 3GFLA 4A6EA 1FZPB 2EV5A 3JW4A 3VOEA 4U0WA 1KQ8A 3CLOA 2PFBA 2W84A 1HW5A 4LG0B 2HR3A 2G7UA 4MEYF 3RJPA 2Y0MA 3E6MA 1W7PD 4RAYA 3FXUA 4I09A 4KFCA 3GF2A 1K7AA 1U8RA 3AAFA 5AONA 5DDGA 2VOPA 3ULQB 2BYVE 1BIBA 4XLNF 3ML6A 3GZ6A 2A69F 3LA3A 3ZMSA 2TDXA 3WTSC 3MQ0A 5ILSA 3WTXC 1DP7P 4UVCA 1I5ZA 1LQ1A 4EM1A 2Z9OA 2HQNA 1U5TC 1NHAA 1WQ2A 2XV4S 3HUGA 2VN2A 1JXSA 1U78A 2P6TA 4EJWA 4G7OF 4WXCA 1H9GA 4EV0A 4ZZDA 5KK1A 1J5YA 1G3YA 4B09A 2ZFWA 1TW2A 5D6EA 5LRSA 4ENNA 2JT1A 1HW1A 2ADUA 2XAQA 3O3KA 1E2XA 3V8KA 2B0LA 3WTUC 4XRFA 1MGTA 3GFJA 3KLOA 2H6CA 4OU0A 1IN6A 3CUOA 1REPC 2LSOA 4H0EA 2M5WA 4HBLA 1USSA 3HTSB 2MLGA 3BPVA 5JHUA 4ETSA 1FYKA 2GQQA 1ZRDA 2DTRA 2OZUA 3MFKA 3HOSA 1S6LA 1E17A 2HQRA 1MD0A 4HX4A 1F9NA 4G6QA 5TJJA 5LHGA 1ZG3A 4A5NA 2A6HF 5HS7A 4A12A 3LAJA 1AWCA 4UVBA 2FMLA 4M6XA 1FP1D 2XVCA 1RZ4A 4U7BA 1BM9A 2Y75A 1YW8A 5IT3A 2V1DA 1K79A 2VBZA 1I27A 3GVAA 1O7LA 1R23A 4Y13A 2V6CA 3HTUA 3FZVA 4N0BA 5D5UB 3T8TA 1WKMA 4HV5A 1FSEA 3KP2A 1MKMA 1B9MA 1T6SA 4MEXF 3GLXA 4HDUA 3CJNA 2JTVA 5F6FA 2CWEA 5E20A 1G3TA 2KKOA 4R8HA 2ZO4A 3TO7A 2YX7A 4Q48A 1SFXA 2GXGA 2OZ6A 2FU4A 3HHGA 4IHTA 4IHSA 1FX7A 4CDGA 1SD4A 1ZG1A 2P7CB 2L3DA 3PQKA 4KA4A 4WXDA 2BV6A 1LNWA 3KEOA 5AIQA 2EB7A 3HSEA 3SFZA 2JPBA 3CO6C 4L9JA 2BBYA 2RDPA 3EYYA 2XUBA 3C18A 2IT0A 5ICGA 2XIGA 1U5TA 4HV6A 2NS0A 1FY7A 4L9VA 5LRRA 1XGSA 2G9WA 5E1XA 1J0RA 2RVCA 1S29A 2IP2A 2FMYA 1KU3A 1R1UA 5L3CA 3MWMA 4L5JA 1O3QA 4UVAA 4CO8A 1S7OA 5E8GA 3CUQB 4GO1A 2EFOA 3CO7C 1DDNA 3Q9SA 2VOOA 3K2ZA 5A2QZ 2H94A 1IRGA 3SZPA 4L0YB 2PBIA 5A2QK 4AVPA 3WTWC 4OIRF 2DW4A 4EGZA 2Z33A 2O61A 2UXXA 1XSDA 4LG0A 3IKVA 5D5XB 4I0BA 4M6YA 2FRHA 1FSHA 1PP8F 3TOBA 1R22A 3O6BB 3D0SA 2DO7A 1H9TA 4FX0A 1DPRA 3Q9VA 2ISYA 4EJVA 2HKXA 2MC3A 1Z05A 2PG4A 2GIVA 3NQOA 1P2FA 1P6RA 1LDKB 3WU0A 2E7XA 3H92A 3ZMUA 1Z7UA 2Q2EA 3GZ5A 3LQRA 2IW5A 1KQ0A 2BEOA 1TLHB 5HLIA 3ZN0A 2P6SA 5HS8A 2K02A 3QP6A 1BI2A 1QZZA 4FHTA 3U2RA 2OA4A 3M9AA 3QU6A 1DUXC 1MJ9A 2ELHA 5DYMA 2CW0F 2MA3A 1RUNA 3F6OA 4HDVA 1XN7A 3FMSA 2NAZA 2M87A 2LKPA 3TOAA 2O3FA 2L4MA 1XSXA 5FO5A 4HW0A 2IA0A 3M8FA 2IRFG 3WODF 5FB2A 5BMZA 2RN7A 1DPUA 3GFMA 4CXFA 2WV0A 4RGXA 3IWZA 5E18F 3GW2A 4U88A 2DQRA 4HLYA 2L54A 4WXHA 2MH2A 1G4DA 3KZZA 4R1HA 1Y0UA 1J2XA 2EFQA 3I4PA 3DPTA 2YU3A 5E8IA 3DP7A 2XKOA 4Z2YA 3FF5A 1XGNA 4OMYA 2D1HA 2PN6A 3L9FA 2CO5A 1C0WA 5LBQA 5L3GA 2FA5A 2HTSA 4U0YA 1IUYA 1R7JA 1TQPA 1IN4A 3V8JA 1EV7A 3LWFA 4I98B 5H6RA 4WK8F 1SMYF 1AOYA 3KE2A 3ECOA 2QQAA 4M9SA 3L2CA 1QBJA 4PGHA 1WRJA 2QQ9A 2P5LC 2YSRA 4A5MA 2DU9A 2A07F 4HLXA 5BOXA 4KNYA 2H6BA 2DFIA 3ABTA 2ISZA 4WCGA 4JBAA 3F21A 1B4AA 5K5OA 2M45A 4IRIA 1FBQA 3C3WA 1U5TB 2JRTA 1Z6RA 5CLSA 3WE3A 5CJ9A 4QWQA 4CZZA 3D5LA 4KIBA 3BZ6A 3W6JB 4ENMA 1LDJA 2W25A 5HVQC 2XGXA 5DD4A 3P7NA 2IA1A 4A2UA 4IXAA 2F5EA 3KP3A 1JGSA 1BJAA 1KYWA 3SHFA 3LA2A 5E17F 2QUFA 4YFNF 4HQEA 4NQWA 4YFKF 4ZH4F 4CGZA 5D6FA 1XSVA 1F5TA 3DQVC 3I64A 4U0VA 1O57A 3F3XA 3FHZA 3HSRA 1SAXA 3DV8A 4PDKA 3CUQA 3EETA 1R1VA 2OU2A 1TNTA 2FF4A 1KGSA 3QOPA 1R36A 4BQAA 2FE3A 3SZTA 1XB4A 5AIPA 3QPHA 3COAC 5E1ZB 1MZBA 2STWA 2PMUA 2WC2A 3WGGA 1XD7A 1T39A 2FXAA 4MHGA 1UHMA 4LJZF 4N9IA 1YYVA 1WSUA 1XMAA 4KN4X 2ZNZA 3I0TA 3HRUA 4CYDA 1HKTA 5LEJA 3K0LA 2D45A 2GAUA 4AIKA 4G9YA 2L01A 2AS5F 3JSPA 2ESNA 4OIQF 3BROA 2CFXA 3GUDA 2XRNA 5TRDA 4ZYDA 2K4JA 4UUVA 4R79A 5F64A 4P55A 2V1XA 3TO6A 4EMSA 2F2EA 3R0JA 3HHHA 3KETA 5JR3A 3R60A 5HLGA 4PGGA 1V4RA 4KYWA 3R6SA 4G7HF 1UHWA 2VC1A 3F22A 3FM3A 1Z6TA 1XMKA 1LB2A 1ZYRF 3F23A 1ZLKA 3RPUA 1MDMA 3QPTA 1D8KA 1B6AA 2A6EF 3CDHA 3E5QA 2DLLA 2YX4A 2ZKZA 3K1NA 2W85A 3IRRA 3V7SA 5CVJA 1TBXA 2W57A 2GXBA 4CICA 3WU1B 2AXLA 5LHIA 2YPRA 3FM5A 1OYWA 2DAOA 4BHCA 1VTNC 4IJAA 2WWYA 4GYGA 3E97A 3Q5FA 1P4WA 1WWXA 2GZWA 5LGUA 3RDIA 3I59B 2XAHA 2A3SA 4QLCU 5K1YA 4M9XA 1ZHFA 2OAZA 4U7DA 2R7FA 2P5KA 3TQNA 5F1RA 2WTEA 2RQPA 2RV8A 4O3MA 2ACJA 1XDSA 1U3EM 4N9HA 1CGPA 4LLGF 5CYVA 4EM2A 1RI7A 2W24A 4MNUA 4G8XA 4XSXF 2K4BA 3IKTA 3O2PE 3ZQ7A 3K9TA 4PCQA 5L3BA 4HZFA 3TO9A 4G94A 3F8BA 1HKQA 4LGWA 4I02A 5K5RA 2R7DA 5L3FA 2EV6A 1F1ZA 4S04A 1IN7A 1BI3A 1J9IA 2LDUA 1IN5A 4OINF 3ECHA 1ZH5A 2V1UA 1MJAA 2JPCA 2FBIA 3WTZA 3DEUA 2DK8A 2MH9A 3H3UA 3KEQA 5BPDA 1SD6A 4L0ZB 3ABUA 4ZZLA 1JHFA 4RB3C 4YIFA 3G73A 1W5TA 4ON0A 3R4KA 1ZGAA 3I58A 1ZG5A 1XCVA 1ZRFA 2CSOA 2DBBA 3FMQA 1FYMA 1RUOA 1FYLA 1FPQA 4KMUX 2HEOA 2PEXA 4FX4A 4FT8A 4G6DA 3FWEA 4HF1A 1ZAOA 3C1DA 2JZYA 3WG9A 4Q47A 1O3SA 2HYFA 4MTDA 3RKXA 3LQQA 2F5CA 1MJBA 2O8XA 3KP7A 3LFKA 1T38A 2Y48A 3PQJA 5HOOA 3F72A 1EH7A 5LLQA 2P7VB 2XHKA 4IRGA 2EA2A 5BQTA 5JFRA 5LEKA 3J81Z 3QU3A 1LEAA 4NB5A 4L9TA 4L18B 5D4SA 1QQIA 2E7WA 1RIOH 1UB9A 2VE8A 4K2EA 1GXQA 4GXOA 2YR2A 2K86A 4HA8A 2HTJA 3JTGA 4GGGA 3MEXA 1Z9CA 4WX9A 1FWZA 3KP5A 2QWWA 4LLNA 5J6XA 4PZJA 1JE8A 3N4MA 5ILUA 2J5OA 2Z99A 4G7ZF 3KFWX 3P9KA 2KRFA 5HS9A 3E5UA 2HWVA 3OOPA 4XBFA 2L4AA 2ZMEB 4Y17A 3TKYA 2Z3YA 1G3WA 4HOBA 4TV7A 4MQVA 2BE5F 2XAGA 4LFUA 1MDMB 2MLKA 4L9NA 3HYIA 1PUEE 2FNPA 5DV5A 2A61A 3FXRA 5CVIA 2LNBA 1B59A 3M7GA 2O0YA 3DFGA 3OV8A 1I1GA 2KIFA 2OD5A 2FOKA 5JVTA 2DK5A 1R00A 3J80Z 3GEZA 3SXYA 3H3ZA 5L3EA 2KIUA 2CG4A 4LB5A 2XAJA 3NRVA 1ZLJA 3ISPA 1KYZA 3LAPA 3J80K 2K7LA 2E1NA 4ASNA 2LF7A 2QZ8A 3G3ZA 3K1PA 4D0PA 4YG2F 2OQGA 5LGTA 4UV9A 2D1VA 1FOKA 1BBYA 2STTA 3I59A 1HW2A 3T0YA 3E6BA 3VFZA 2QM3A 1HSJA 3DXJF 2RGVA 3I53A 3ZMZA 3FXQA 1P4XA 2H09A 4KN7X 4L5IA 4RS8A 3ELKA 3FMRA 4UV8A 2UXNA 5BPIA 1YFHA 4IPAA 3GYHX 1YS7A 2COMA 3TDUC 2C6YA 5J8CA 1FLIA 3GO5A 3WTVC 1IN8A 3KCCA 4Y15A 3DKWA 4JK1X 2R3SA 1PDNC 1ULYA 3KZYA 1D3YA 2VXZA 2Q0OA 3F6VA 4YFXF 3VB2A 1BOAA 3E3VA 1R5HA 5LHHA 4KUMA 2FBHA 4ESJA 2EJRA 2F5DA 2X0LA 3I71A 4I01A 4HAMA 5CVVA 3HRTA 3P9IA 2HFHA 5D8KB 2P8TA 3M8EA 4IVNA 1J75A 2M30A 5ILVA 4OIPF 1IXRC 4HX8A 4MQ9F 1OMIA 1OR7A 4ZYEA 2MD5A 3T8RA 3U9GA 2HKOA 3T5XA 4S05A 2KJCA 1S7AA 1HBXG 4OMZA 2HGCA 3J7AO 5DCFA 3HOTA 1ZARA
chains in the Genus database with same CATH superfamily
1S8NA 3ZMDA 1L0OC 1SVMA 4EJUA 1IC8A 4AIJA 2A68F 2AXTC 3WHCA 3CLQA 4C2UA 2ICWG 4A0XA 2R7WA 1EH6A 4BQQA 1JHHA 2VUMJ 3LL7A 4LK1F 1HSTA 2DOAA 2FOWA 3BTLA 4DZJA 3A01B 1WPKA 2M1BA 4XORA 2RNJA 1IGNA 1W36D 4NUBA 1Y0NA 4RGSA 3TDZC 5HLHA 4DNCA 1YO5C 1T95A 3B73A 2BGCA 4A3CJ 4PSWA 1R4MB 3CTAA 1NK3P 3DKXA 4ITVA 4AWXB 5ED4A 3OIQA 3GFIA 5B3SH 2XASA 2P4WA 3H5RA 1G3SA 3B6CA 3G71I 1LKXA 2H1LA 5ICEA 1CF7A 2KHMA 1QZYA 4EQQA 1TNSA 4XLAA 1FBUA 2CJJA 4EM0B 4M3BA 2F5VA 2R93J 4WWCA 2GM4A 3CESA 2XPWA 1FT9A 2PMHA 1WI3A 2X4HA 3RI4A 1PVEA 3JSOA 4E7JA 1L3LA 2E1CA 3REOA 3GWZA 1B1BA 2NNYA 2OTJI 5EG0B 4A3KJ 3WGIA 4FE4A 2ESHA 4D9JA 1Z1DA 2L02A 4ZJZA 2XGCA 3W6KB 3CCYA 2ID3A 1OCRH 2M8EA 3BJOA 3I4NJ 5H6QA 2HPMA 3SEQA 2BY1A 3KLNA 3IWFA 4Y33A 1DU6A 1ONVA 3RIRA 3OYEA 1FOXA 4HYEA 1ODDA 2Y31A 5JI6A 1FNNA 1S3JA 3QRFF 2QBYA 1IXSB 4PUSA 4A3BJ 4F91B 3F8MA 2VJ4A 3ZQHA 1OYIA 3BY6A 4A3EJ 3K4LA 5HDKA 2IJLA 3JRCA 1SFUA 1SFEA 2ZMEA 3PFYA 6PAXA 4UNOA 2CU7A 2LFBA 5FD5A 1BI0A 4RDUA 3VYTB 2F4OB 2W00A 3BG6A 1K6OA 3HOXJ 1BR2A 2GOXB 2EK5A 2LY9A 1K78B 2V9VA 1XGOA 1MMNA 2RKHA 2FBKA 1EH8A 2K27A 1A04A 3OIPA 2VIXA 2EZHA 1SD5A 1UFMA 4A6DA 5BS6A 2NNNA 4MGRA 3T1BA 4GRIA 5FGMA 1YE9A 4A0ZA 1JKRC 1UELB 2FSWA 1P92A 2XF6A 1HCRA 2EZKA 3CP8A 2AQEA 5L3DA 1UZCA 2QGUA 3L2VA 4UB6C 4EJOA 4B47A 1D0ZA 1Y8QB 5C3EJ 5FROA 3QP5A 3OIOA 1KU7A 4CHUA 4RAZA 4QPOA 2JVGA 4ZDPA 2E34A 2VBWA 1SD7A 2XC7A 5FLXZ 2LD5A 1S72I 1M1EB 3H5NA 2CV0A 2FUG2 4XSZF 3MN2A 3GTGJ 2LKXA 3CF5F 4ZYHA 2MGQA 1XTAA 4HF2A 2I5UA 1YS6A 2Y0SA 3V7RA 2Z2SB 1R49A 2ZSHB 3R61A 2GWRA 3EQLF 1D5VA 1G6NA 1YG2A 4NNJA 4DIQA 1UJ8A 3L7WA 4RGRA 4C3IJ 4ENJA 3CMMA 5FLXK 1STZA 2R0QC 2DQLA 4MLOA 1P4AA 3OOUA 1N25A 1XG1A 5E3MA 3G2BA 3BJ6A 3SJMA 5HDGA 4ZTFA 3OS2A 4V19K 3L2WA 5KNLA 3AL0B 4F52A 1D5YA 1H0MA 1X1CA 3JTHA 5FLVA 2JA7J 4BYYA 2VL8A 3QAHA 5D5WB 4I7HA 4OIOF 1W7PA 3DPLC 3V7CA 4RB2C 3VPRA 2M8GX 2HOEA 5FFXA 3JAMZ 2UZKA 5IP9J 1A5JA 4EJTA 4P96A 3ZP5A 3RKQA 3BZCA 1JI8A 5D5VB 2HZDA 5FFZA 1WI9A 2O8KA 2Q1ZB 4U87A 3NARA 2BVLA 2JQ7A 2KIMA 1J09A 1R4NB 4HX7A 4RB0A 4LB6B 1LEBA 1IW7F 1S7EA 5HDNA 2QLZA 3G1OA 3L00A 2ZJ2A 3JAMK 2HVQA 3BPXA 1XX5A 3GTKJ 3WE2A 5DTDA 2L9NA 2LBFA 1E0EA 3BP8A 4LK0F 3E6DA 4E7HA 2X9DA 5E1WA 1OYYA 2ZBKA 3MZYA 4RGUA 1NH3A 3H9JA 1Z3YA 3PNVA 4KIFA 2VPRA 4JQFA 5DCMB 4KMFA 3IHUA 1GHCA 2DFHA 4AUXA 3H5AA 3K1MA 3IH3A 2CRGA 5CVRA 5J47A 1ON1A 1OCOH 2Z5UA 3CDLA 3MD2A 4ESFA 2IS2A 2FNAA 4DYRA 1LE8A 1ZN2A 3FKJA 2D2WA 4UHTA 1QO0D 2QF7A 2VB6A 3GXOA 1G8XA 4YIIA 2E2HJ 5KHDA 3GTMJ 1U9OA 2CV2A 2VQGA 4IRHA 3S14J 3HIFA 1K61A 2MD0A 1VQLI 2EA4A 2OQRA 1YX5A 5FD6A 1YIOA 4QPQA 1XCBA 2EV0A 3CCQI 1ETWA 2LH9A 3IV5A 3GTJJ 3HEFA 3SQNA 5M5YJ 3OSGA 1R1TA 1KA8A 2GA2A 3EUHC 5IOYA 4ENKA 1IAWA 4MTEA 3I56I 2VI6A 4Y4RA 1LDDA 1R58A 1BC7C 4DGWB 1OISA 4IX7A 2IVMA 3HL2A 1DQUA 3AG3H 3I5UA 1J7KA 3CCEI 3NEUA 1VQ6I 2GXAA 2FD5A 3W2WA 3MAJA 3O8GA 1IF1A 1GVJA 4BH9A 3WTYC 3SDBA 1UCRA 3S2HJ 2MG4A 2XGEA 3MCZA 1VQKI 3RKYA 2L7KA 3R0AA 4C30A 1FBSA 1VQ9I 4BKXA 3QODA 4BE1A 2KFDA 2LY2A 2UUZA 1WZ2A 2EZLA 4B1RA 2VONA 2AO9A 4HF0A 5J4VA 4DOZA 4A0YA 2PQ8A 3HDDA 2VKEA 4A3MJ 5D4RA 4BE2A 4QIWN 2HQ5A 2O03A 2QYOA 5LGNA 4M9ZA 4GYIA 4RAFA 2O7OA 2M2EA 4EEFG 4LMYA 2VBYA 4AC0A 4NHJA 2KJBA 3HOWJ 3BDDA 3LA7A 4EATA 4F3QA 4XOPA 3E6CC 2IA2A 3HKZN 3S1RJ 2V79A 1K83J 4JX5A 4EVIA 1QGPA 3BJAA 2KP6A 4M72A 3X2QH 5GTIC 4OOIA 3J7YJ 3HRMA 4IQJA 1P7JA 2UV1A 5J8FA 1DU0A 1UG0A 1CF7B 1ZRCA 4F7ZA 3BOQA 2XAFA 2QVOA 3EYIA 3BR3A 1R71A 3J81K 2PLYA 3A01A 2HYGD 2EFPA 1YW9A 2QSGX 3G4SI 4P9UA 3IL2A 3A0BC 1USTA 2OF7A 4BJ5C 3MZHA 1PP7U 3FXMA 1T2KA 3PFIA 5KVRA 1Q1HA 3ZMVA 1I1SA 2XKPA 2EILH 3B6AA 3QYFA 4QSHA 1FMWA 2NS8A 3LSRA 1VQ8I 1IRXA 4LD5A 3I54A 3HUGB 1I39A 2PI0A 4KIGA 3HOZJ 3C7JA 1T98A 4N4NB 2QBYB 2JA2A 1Z0XA 1ON2A 4XLEA 1EKEA 3HXLA 2OBPA 1XDUA 1UMQA 3IAS2 4ESBA 3MKWB 2ECCA 3CCRI 2PJRB 4M71A 4P5OA 2VT2A 5ERIA 2FEZA 1DGWY 1LVKA 4DYQA 4RB1A 1H8AC 3GTOJ 1FOWA 1YIJI 2VBXA 4DBRA 1T0FC 2NYXA 2HPIA 2DA4A 4M74A 5DD8A 3V4GA 2DPDA 3ZPLA 2O5RA 4IKFA 2FQ3A 4M73A 3F8FA 3EDPA 1X1AA 3RTRA 1I6XA 1Y56A 2DT5A 4KICA 3N97A 2QQBA 1H89C 2FQ4A 2JSCA 2M34A 2HDCA 4EGYA 4BXUA 1YRNA 1POGA 1E3HA 2KRHA 5TGTA 3S15J 1ETQA 5B1AH 1R5GA 5ICCA 3H1CA 1VQMI 4ZYGA 2CGPA 4I6ZA 2YU9J 1U6GA 3ROUA 5H20A 1OKRA 3CCMI 1TQIA 3CUQC 5EZHA 2ZCWA 3UNGC 1K78A 2XF7A 4FETA 4PJLA 2R5YA 4XRSG 2E1OA 1Z91A 3FX3A 4IOAF 1QPMA 1RPWA 5M3MJ 3ZOBA 1BIAA 4P9FA 3E5XA 3RYRA 4BE0A 1QNTA 4PJJA 3OYLA 1T56A 4FQGA 3TP0A 3S1QJ 2LF8A 4RM2A 2K9MA 3LNQA 3EUAA 3RPQA 2NRAC 3S3OA 1ETVA 3CCVI 3F8CA 1N77A 3TGNA 2X6YA 1Y1VJ 4BHPA 3WTTC 2I8DA 2PMZA 4FISA 5LFAA 2EFWA 2P5VA 5C4JJ 1YW7A 3SZGA 4QTRA 4AD9A 5J1UA 1TTYA 5EF6A 3L2RA 3W6VA 2W7NA 4Q4ZF 1HQCA 1FMVA 2R92J 1XGMA 2WB1A 4Q5SF 3QYEA 1B9NA 2DI3A 1GXPA 2QENA 3S2DJ 2COBA 1W4MA 3ERED 1W7PB 5KCMA 4XN0A 3GTQJ 1LJ9A 1SANA 4IF4A 1MBFA 1D8JA 5TISC 2IXSA 1LFPA 3Q0UA 2LP0A 4HNUA 3LSTA 5IT9Z 3CC4I 3VSLA 5EEHA 3EUHA 4UXNA 2LG4A 1ZK8A 1BI1A 2VT3A 3DCFA 5EEGA 4IL6C 3KYLA 1YLFA 1O3RA 3BWGA 3QOEA 1SMTA 2V9KA 1OFCX 1KU9A 5FJ8J 4O6JA 2K3FA 3ZQQA 5IT9K 2DJNA 3IC7A 1YTYA 2Q8KA 4GCVA 2M7BA 1OPCA 4CZCA 1DGRM 2ELKA 2QKLB 3K10A 1JJ6C 1BN5A 4WF2A 2F5FA 2J5PA 1TQMA 4I0AA 2HS5A 2MYSA 2DPUA 1IZ1A 2RC4A 4D5CA 5DEQA 1MMGA 2IGNA 3FDYA 1FP2A 1ZGJA 3AFHA 3DBRB 4KT5C 4I2OA 2HDDA 3WGHA 4AYBN 2LTPA 4I99C 2MBFA 5K5QA 3U1DA 1RETA 2IS1A 1X3UA 2P0WA 2ZXJA 3RYPA 1CQTA 2XROA 5D8LB 1U2WA 3VEPA 1ZTRA 4E70A 1YQAA 2XPUA 2DN0A 2ZXHA 4A3JJ 3HSFA 1J59A 5DUIA 2IPQX 3VODA 3IRQA 1TW3A 2DA6A 3ZMTA 1IRFA 4AM3A 3HRSA 5F27A 1V3FA 5DCMA 2BXYA 1XPXA 2VE9A 4BNCA 1IXCA 3DBLB 4E6KG 4ZYAA 1HKSA 1ERDA 2DOEA 3MKLA 2DYSH 2GA1A 1ZREA 2E19A 4XLCA 4BHBA 1HDDC 4O5VA 2ZNYA 5IPAA 3GX4X 2TCTA 3K69A 5ICFA 2LVSA 3ZN1A 1QHHD 2HOSA 3JR9A 3DF8A 2EWNA 2VODA 3KIOA 1FC3A 1PJRA 2R7ZJ 2UWMA 4DQ2A 5EEAA 5E3LA 3OS0A 4IOCF 1EF4A 2ELJA 4B8XA 4JOMA 2R7RA 1KU2A 3KP4A 1HXDA 1T08B 4XLPF 2CQKA 2CYYA 1DP3A 2PMZN 4X0GA 2ETHA 1WVRA 4BAYA 4L5EA 4AIHA 2OJED 1W36C 2HZTA 4DJAA 3BR5A 1A35A 1KQ9A 4M3EA 3FK7A 2H27A 2L5QA 1OCCH 1BC8C 2WADA 3B02A 1RNLA 3K6GA 4PJMA 4I76A 1LVAA 3S2WA 1T0FA 4LLLA 1UAAA 2EFNA 1K6YA 1SVOA 2A5YB 2NVTJ 5K7FA 2W4SA 1O7FA 2PJPA 3KP6A 4KDPA 1WJAA 5FRNA 3L09A 1F4KA 4F55A 3CCSI 3P9CA 5DUKA 2G7HA 3V8LA 3JRGA 2O9LA 3F8NA 2CMPA 2K40A 5JHFA 3A2KA 3M1EA 1W5SA 2VC0A 2O6GE 3RKWA 4HQMA 1O3TA 5CVUA 3GFLA 4A6EA 1FZPB 2EV5A 1JJ8C 5K7HA 4HNVA 3JW4A 3C2GA 1TWHJ 1WJ5A 1W0UA 4BXFA 1UHSA 3VOEA 4U0WA 1KQ8A 2N8GA 2XDVA 3HOVJ 2YUSA 3CLOA 3K4CA 3A03A 3S1NJ 5IYBJ 3EUKL 2PFBA 2W84A 2CQQA 1HW5A 4LG0B 3KX2A 1V54H 2HR3A 3ASNH 1GT0C 2G7UA 3GBGA 2M9HA 1E3PA 4IEJA 1TC3C 4MEYF 2DMUA 4XOTA 1WHUA 3BG9A 2R7TA 3RJPA 3CZ6A 2Y0MA 4C2MJ 3A02A 1A6IA 1W7PD 1WJDA 3E6MA 3DTKA 3OYDA 4RAYA 1BJZA 3FBIB 1WJBA 3FXUA 3PL8A 4I09A 4KFCA 2R7QA 3GF2A 1LUJB 1K7AA 4IHXA 1U8RA 3AAFA 5AONA 5DDGA 1QA6A 1TP4A 2VOPA 2CW8A 4FE7A 4E7LA 3ULQB 2BYVE 1BIBA 4XLNF 3ML6A 3GZ6A 2A69F 3RQ4A 3LA3A 3A0HC 4XKBA 3ZMSA 2TDXA 3MQ0A 3WTSC 1HA8A 5ILSA 1Y1WJ 2Z16A 2IGMA 3WTXC 1DP7P 4UVCA 3FBNB 1I3AA 1I5ZA 1LQ1A 2K9LA 4EM1A 2Z9OA 2HQNA 1U5TC 1NHAA 2GBYA 1WQ2A 3O8HA 4J19A 3L1PA 2XV4S 1VFCA 3HUGA 3ABKH 2VN2A 3PM1A 3DU6A 2RAEA 3ABMH 3FK6A 4ZDLA 3JRDA 2IEKA 1JKQC 3OYHA 1JXSA 1YRNB 4MO7A 1U78A 2P6TA 4EJWA 4G7OF 4BACA 5E79C 4WXCA 1H9GA 2PJRA 2IBDA 4BGDA 1Z3XA 2E5ZA 3LSHA 4EV0A 4ZZDA 5KK1A 1J5YA 5CQEA 4CCLA 1G3YA 1JKOC 2R7VA 3MZ8A 1YOVB 5IYDJ 1FOYA 2ZFWA 4B09A 4CCOA 1TW2A 5D6EA 4HRIA 5EYRA 5LRSA 4ENNA 2WAQA 2JT1A 3VYSB 1KONA 1HW1A 2DJIA 2R5YB 4XN3A 2ADUA 2XAQA 3SYTA 3TBIA 3O3KA 1E2XA 1HOMA 3V8KA 2B0LA 5JLWA 3LSMA 3WTUC 4XRFA 5GTHC 4CH7A 1MGTA 3GFJA 3KLOA 2H6CA 5EGOA 4OU0A 1IN6A 3OL4A 2ECBA 2RREA 3CUOA 2ZXIA 1REPC 2V9PA 2LSOA 5IY5H 4H0EA 2M5WA 4HBLA 2NXNB 1USSA 4BS9A 3HTSB 2MLGA 4B48A 3TEDA 3BPVA 3UR3C 5JHUA 1K4TA 4ETSA 1FYKA 2GQQA 1APLC 1ZRDA 2DTRA 4J01A 2EH3A 1SFOJ 2XSJC 2OZUA 3S3NA 2QKMB 3MFKA 5F0FA 3TMOA 3HOSA 2DXIA 2JJ7A 1S6LA 1E17A 2HQRA 1Z67A 1P9QC 4BQOA 1MD0A 1TWFJ 3VYUB 1PUFB 4CSWA 3N05A 2DA1A 4HX4A 1F9NA 2GLOA 4G6QA 4XRSA 5TJJA 2W48A 3ZQGA 5LHGA 2DA3A 1ZG3A 2Z1DA 4A5NA 2A6HF 5J1RA 5HS7A 2GIZA 4A12A 3LAJA 4A3LJ 1R9TJ 4XNFA 1AWCA 3BG3A 4UVBA 3G1LA 2FMLA 3OYFA 4M6XA 1FP1D 2XVCA 2MSYA 1RZ4A 4MIMA 2R7XA 4U7BA 1BM9A 5IP7J 2Y75A 2QEXI 1YW8A 2AHQA 1TT5B 5IT3A 2DDBA 3KYCB 2V1DA 1K79A 3DLAA 2VBZA 5CKTA 1ZQ3P 1MNDA 1I27A 3GVAA 3GZNB 1O7LA 2LY1A 1B8IA 5JLXA 1U9NA 2MABA 3U1KA 1R23A 4Y13A 2V6CA 1YJ9I 3TP3A 3LOCA 3HTUA 2NVQJ 2EPFA 5M5XJ 3BG5A 2VQLA 2DT6A 1UG2A 3FZVA 1QVTA 4N0BA 5D5UB 2HXOA 3T8TA 1WKMA 4HV5A 1FSEA 1TL8A 2HDWA 3KP2A 2LMDA 1MKMA 4HPQA 3W2AA 2A5WA 2Y30A 1B9MA 3Q0VA 1T6SA 1RR8C 2KZGA 3RQIA 4MEXF 4ABZA 2XB5A 3GLXA 2QSFX 3L2QA 4HDUA 3CJNA 2JTVA 5F6FA 4JP0A 3ZXSA 2CWEA 5E20A 1G3TA 3RCOA 2LKSA 1LFUP 2KKOA 1R6RA 4R8HA 2ZO4A 3BR0A 5FKNA 4FCYA 1AU7A 3SEZA 2F48A 4F93B 4ZDOA 2ZB9A 3TO7A 1MH4A 2YX7A 4Q48A 2KT0A 1SFXA 2GXGA 2IGKA 4A3IJ 2OZ6A 1TZLA 2DMNA 3DLLF 1IDZA 2DMTA 4X6AJ 2FU4A 3HHGA 3OS1A 4IHTA 4IHSA 5HNFA 1FX7A 2I10A 2DDAA 3PNTA 4CDGA 4HEA2 2EINH 1SD4A 1ZG1A 3G1MA 1NTCA 2JWTA 2P7CB 1OLTA 5EDNA 4MFEA 2L3DA 3PQKA 4W97A 4KA4A 4LIVA 5CQGA 4WXDA 1RESA 2BV6A 1LNWA 2HNHA 3KEOA 4OWRB 2VJJA 5AIQA 2EB7A 3HSEA 2M7AA 4BY7J 2JPBA 3SFZA 4OAYA 5B1BH 3CO6C 4L9JA 2BBYA 2RDPA 3EYYA 2XUBA 4C3HJ 3C18A 2IT0A 5ICGA 4A3FJ 5GPCA 2XIGA 1U5TA 2Y0SN 3PIPF 4HV6A 2HQAA 2NS0A 1FY7A 2OUMA 4L9VA 5LRRA 1XGSA 2G9WA 5E1XA 2BHYA 1J0RA 4CUGA 2RVCA 1LFBA 1S29A 2H8RA 2X6WA 4NQWB 2F4MB 5KAIC 2IP2A 2FMYA 3HG9A 1KU3A 1R1UA 2LREA 5L3CA 3I4MJ 3MWMA 5GPAA 4L5JA 1O3QA 4UVAA 4CO8A 1S7OA 5E8GA 3CUQB 4GO1A 2CH0A 1HDPA 2EFOA 2DT7B 3CO7C 1DDNA 3Q9SA 2IS4A 2VOOA 3K2ZA 5A2QZ 2H94A 1BL0A 2CUZA 4IQ4A 3CJQB 1WGXA 3ZQFA 2VXDA 3PO3J 3RZDJ 1IRGA 4CYCB 2M0MA 2K85A 3Q3SA 2X1DA 3SZPA 4L0YB 3W2VA 2PBIA 5LD2C 1ZKGA 5J3LA 5A2QK 4AVPA 2DMPA 3WTWC 3QPSA 4OIRF 2DW4A 4EGZA 2Z33A 4RBOA 2O61A 2UXXA 1ETOA 3J7ZI 1XSDA 2K5CA 4LG0A 3FISA 2ZXWH 3IKVA 1WCMJ 3KPHA 5D5XB 5DM6F 3FKIJ 2K9NA 4II3A 1VF9A 4I0BA 2CUFA 4M6YA 2R7OA 1VQPI 1ETYA 1YJWI 5F1JA 2ZC2A 2CS3A 2FRHA 2HVSA 4FASD 1FSHA 2KLOA 3H36A 2CV1A 4NC8A 1GLNA 1PP8F 3TOBA 1R22A 3O6BB 3S8PA 1IV6A 3D0SA 5H2FC 1SVLA 2DO7A 3HM5A 3E7LA 2HVRA 1H9TA 1MBHA 3SDGA 4BXXJ 4FX0A 1DPRA 5F0CA 2QSHX 4P1WA 1XC5A 3Q9VA 2ISYA 1W5CC 4EJVA 2HKXA 2MC3A 1Z05A 2PG4A 2GIVA 3NQOA 1N75A 1P2FA 1P6RA 5C44J 1LDKB 2B7EA 3P5JA 3WU0A 1T33A 2R7UA 1S9HA 2E7XA 1JKPC 1D0YA 3H92A 1GV5A 3ZMUA 2DA5A 1Z7UA 2Q2EA 3GZ5A 3TL4X 3LQRA 2IW5A 1GDTA 1KQ0A 2BEOA 1TLHB 3DPUA 5HLIA 3ZN0A 2P6SA 2E36A 5HS8A 3IH4A 2K02A 3QP6A 2ZJQF 1BI2A 3ZGKA 4D5FA 5EGOB 3A4CA 2BY2A 3NWTA 1QZZA 2LOOA 2E1MC 2ZJRF 4FHTA 3U2RA 1G59A 2OA4A 3M9AA 2BVMA 2CW7A 3S93A 3QU6A 1DUXC 1JUSA 3BG7A 1MJ9A 3J7AY 3M4OJ 3S17J 2ELHA 5DYMA 2QCOA 2V6EA 2CW0F 2MA3A 1RUNA 3F6OA 4HDVA 3I9V2 2M4GA 1XN7A 3IH2A 3FXLA 3FMSA 4DZPA 2NAZA 2M87A 5GAGJ 1ZGWA 1LPQA 1FTZA 4CCKA 1X58A 2NVXJ 2CQXA 4GDFA 1HC8A 2LKPA 5FKKA 3LSIA 1IUFA 2EIKH 3TOAA 2VLAA 2O3FA 2L4MA 1W1WE 2LYCA 1XSXA 4HSRA 5FO5A 4HW0A 2IA0A 3M8FA 1SAUA 3WODF 5FB2A 5BMZA 2IRFG 2RN7A 1DPUA 1FIAA 3GFMA 3FIWA 1SEUA 4CXFA 3RSNA 3BCAA 4Y3OA 2WV0A 4RGXA 3IWZA 4DBQA 1JTXA 5E18F 3AG2H 3GW2A 4U88A 2DQRA 4HLYA 2KQRA 2L54A 2X6OA 4WXHA 2MH2A 1G4DA 3JRHA 3BTIA 1X19A 3OWTA 1Y8RB 2MW8A 2ME0A 1IJWC 4M3FA 3KZZA 4BL0B 4CA0A 1YJNI 4R1HA 1Y0UA 3ONQA 3D1NI 1J2XA 2EFQA 2A05A 4BEHB 1WH7A 3E0JB 3I4PA 3DPTA 1PUFA 2KZVA 2YU3A 1NK2P 1A6QA 3FHNA 3K7AJ 4B3XA 5E8IA 1B8IB 3DP7A 3MVPA 2XKOA 3DBHB 3OSFA 4Z2YA 4LITA 3FF5A 1VQOI 1MH3A 1XGNA 4IO9F 4OMYA 2D1HA 2PN6A 3L9FA 2CO5A 1C0WA 4E7IA 5LBQA 5L3GA 1XMXA 2FA5A 3BR2A 3HBLA 1Z77A 1GV2A 3DTIA 2HTSA 4U0YA 2DODA 3PSIA 2ZMEC 1IUYA 1R7JA 1TQPA 1BR1A 2CQ7A 1T8IA 1B72B 5HLTA 4E7SA 1IN4A 3V8JA 3BQZA 2GOMA 5HNHA 1EV7A 4AU7A 2JA8J 3LWFA 1X1PA 4I98B 5H6RA 4WK8F 2L7ZA 1JUPA 1SMYF 1AOYA 3KE2A 3ECOA 2QQAA 3S16J 2ME6A 1WJFA 2W82A 4M9SA 5F08A 3L2CA 1QBJA 2LRDA 4PGHA 1WRJA 2QQ9A 2BY3A 4X1EA 2P5LC 2YSRA 3ZRGA 4A5MA 1NG6A 3MMYB 3EPZA 2WBMA 2DU9A 4II2A 3CCJI 2A07F 4UY8I 3VYRB 4HLXA 5BOXA 4KNYA 3HGYA 2H6BA 2L2OA 2DFIA 2WAFA 3ABTA 3BCBA 5DS9A 2ISZA 5BNGA 4WCGA 4JBAA 1F36A 2V4JC 3F21A 1IV8A 1B4AA 2X51A 5K5OA 3OR2C 1ETKA 3ESWB 2M45A 3OYIA 4IRIA 1FBQA 3C3WA 1U5TB 2BZTA 2JRTA 3H9QA 2OTLI 3HZJA 1BOBA 1Z6RA 2L9SA 5CLSA 1X4PA 1MBEA 3WE3A 2HOAA 4UUSA 5B5EC 5CJ9A 3GLLA 4QWQA 4CZZA 3D5LA 4KIBA 1IDYA 3BZ6A 3QWLA 3ZQCA 3OMYA 1ORKA 3W6JB 4ENMA 1LDJA 2W25A 5HVQC 4A3GJ 2WB1N 2XGXA 5DD4A 1Z21A 3K4BA 3DKYA 4JX4A 3P7NA 3OYNA 2IA1A 4XR6A 4A2UA 2EBIA 1RKTA 2VASA 4IXAA 2F5EA 5IYCJ 4GFBA 3TW7A 3KP3A 3OYBA 1JGSA 1BJAA 1KYWA 3SHFA 3LA2A 4D7MA 5E17F 1D1AA 2EIJH 2OC6A 2QUFA 2XB0X 4HNTA 4YFNF 4PSXA 4HQEA 4NQWA 4YFKF 4ZH4F 4CGZA 3VDXA 3GCMA 4N4OB 2R5ZB 5D6FA 1XSVA 1F5TA 3D5SC 3DQVC 4E4HA 3I64A 4U0VA 4D1QA 1O57A 3F3XA 3FHZA 1FTTA 2F6CA 5F0HA 2VPLA 3K4MA 2A6TA 3HSRA 5B66C 1SAXA 2L0KA 3DEEA 1X2NA 3DV8A 3CMAI 2ZJPF 1Y39A 4KITB 4PDKA 2IGOA 3CUQA 3EETA 2DA7A 1R1VA 3K70D 2OU2A 3PSFA 1TNTA 1V5FA 4YIRX 2FF4A 1D1BA 1KGSA 3QOPA 1R36A 3M07A 1OQYA 4CYCA 3FXKA 4BQAA 4B43A 2FE3A 3SZTA 2VQHA 2JRMA 2DYRH 1XB4A 5AIPA 3QPHA 3COAC 5E1ZB 1MZBA 2STWA 3M1CA 4AIDA 2PMUA 2WC2A 3WGGA 2XPVA 4A93J 3H35A 1QU3A 1XD7A 3BC8A 4BBRJ 4F92B 2JK3A 2CQNA 2KDZA 1T39A 2FXAA 2E2IJ 3ASOH 2KISA 2KMUA 4MHGA 1UHMA 1TWAJ 4LJZF 4N9IA 2E71A 2XAUA 3PJRA 4KISA 1YYVA 1WSUA 3C2HA 1XMAA 4KN4X 4XQFA 2ZNZA 3I0TA 3E1SA 3HRUA 4CYDA 1HKTA 2H1KA 5LEJA 3VWBA 3K0LA 2D45A 2GAUA 4AIKA 3HOUJ 2VKDA 3OR1C 4G9YA 2L01A 3L2UA 2AS5F 2Q2EB 3JSPA 2ESNA 4JYKA 4OIQF 3BROA 2CFXA 3GUDA 2ZFUA 1ZR4A 4NC6A 2XRNA 5TRDA 4BY1J 4ZYDA 2K4JA 4UUVA 4R79A 5F64A 4P55A 2W1OA 2V1XA 3TO6A 1FIPA 1NG7A 4EMSA 3WG7H 2F2EA 3R0JA 3HHHA 3LMMA 5FKLA 1QRYA 3KETA 5JR3A 4BDYA 3R60A 3H3VK 5HLGA 4PGGA 2RNGA 2DFEA 1VZ0A 5GADJ 1V4RA 3ZQIA 2LK2A 3BTJA 4KYWA 1RRJA 4S0HB 2CUJA 3R6SA 5M3FJ 5HODA 4G7HF 2K9SA 2WY8Q 5JVGF 1MNMC 1UHWA 2V1NA 2VC1A 3F22A 4C2TA 5KAFC 2VJ5A 2V7FA 1D1CA 3FM3A 4XK4A 4BQNA 3JRAA 1ACIA 1Z6TA 1QZEA 3CMYA 1TWGJ 1XMKA 1IRZA 3OYJA 4RLQA 1LB2A 1ITYA 3CF2A 1ZYRF 3F23A 1ZLKA 5J1YA 3RPUA 1MDMA 3QPTA 1D8KA 1B6AA 5M5WJ 2HI3A 2A6EF 3CDHA 3E5QA 2M0CA 4RLFA 2DLLA 2YX4A 4E7ZA 2ZKZA 3K1NA 4RM3A 2W85A 3NWSA 3IRRA 2NOJB 1ZELA 1TBXA 2DMQA 3Q0WA 4LIUA 5CVJA 3V7SA 3PIOF 4Z6YA 4DYCA 1MMSA 2W57A 4XKVA 2GXBA 4CICA 4YRVA 2B9SA 3WU1B 2AXLA 5LHIA 3GTPJ 4PJ0C 2YPRA 2X6XA 3FM5A 1ENHA 1OJLA 1OYWA 1X4OA 2DAOA 4BHCA 4CCMA 3G6EI 3CCLI 1VTNC 1X1BA 1MSEC 3LSKA 4IJAA 2BW3B 2WWYA 3BQYA 4GYGA 3E97A 3Q5FA 3CJRB 5CPRB 2QA4I 4YELA 2CFOA 3IUOA 3HC7A 1P4WA 1WWXA 2GZWA 1YI2I 5LGUA 1JT6A 2JA6J 3RDIA 3I59B 2XAHA 2A3SA 4QLCU 4NC7A 5K1YA 3OYGA 4BU2A 4M9XA 1ZHFA 2OAZA 4UUTA 2KPMA 2X1EA 2DTZA 4U7DA 1A36A 2R7FA 2PX9A 3CDIA 2P5KA 3K2AA 1X3WB 3TQNA 5F1RA 1BR4A 3CCUI 2WTEA 2RQPA 2RV8A 4BEHA 4O3MA 4V2FA 2R7SA 1N78A 3U21A 1PYVA 2NS7A 4KJZA 2ACJA 3CP2A 4CCNA 1XDSA 2WAEA 1U3EM 4N9HA 1CGPA 1JT0A 4LLGF 5CYVA 4BBSJ 3BR6A 4EM2A 1A31A 1RI7A 2W24A 4MNUA 5F04A 3QPLA 2CUEA 1VQNI 4G8XA 4RAGA 4XSXF 2K4BA 1BW5A 3IKTA 2E2JJ 3HKZA 3O2PE 4HG2A 3ZQ7A 3K9TA 4PCQA 5L3BA 4HZFA 4B44A 1OCTC 2OPTA 3TO9A 4D7NA 4G94A 4B4CA 3F8BA 2EZIA 1HKQA 4LGWA 1HLVA 1B72A 4I02A 5K5RA 3JREA 4G6TB 4DW6A 2L7FP 2R7DA 2WAQN 3HGGA 1VQ7I 3QYBA 1MNEA 4H4KC 5L3FA 2JN6A 2EV6A 1U8BA 5FKMA 5J40A 2WV1A 2NVUB 1ZR2A 1F1ZA 4S04A 1IN7A 1BI3A 1J9IA 1RKWA 2LDUA 1IN5A 1BA5A 2OCCH 1RR7A 4OINF 2XRLA 3ECHA 1ZH5A 2V1UA 1MJAA 2JUGA 2JPCA 1X1DA 2FBIA 3WTZA 3DEUA 2DK8A 1D0XA 2MH9A 3H3UA 3KEQA 3PUFA 5BPDA 1K4SA 4UUSB 1EA3A 2YS9A 1SD6A 4G12A 3ABUA 4ZZLA 1JHFA 4RB3C 4L0ZB 4YIFA 3IP4B 3G73A 3A1YA 1W5TA 4ON0A 3R4KA 2AQFA 1ZGAA 1AA7A 2ZSIB 3D5RC 2MFZA 3I58A 1ZG5A 1XCVA 2HXIA 1SC7A 2IS6A 1ZRFA 4M3GA 3MKYB 3CMEI 1WH5A 2CSOA 4PFPA 4NBQA 3TW6A 2DBBA 3ZCOA 3FMQA 4MFDA 1FYMA 2V26A 4OAZA 1AKHB 2IAIA 1RUOA 1VNDA 1MIJA 1FYLA 2DOFA 1YHQI 1FPQA 4KMUX 2HEOA 2PEXA 1U0JA 2QQ8A 1YX3A 3UKGA 1P7IA 4FX4A 4FT8A 2VKHA 2Y69H 4G6DA 3QQAA 3FWEA 4RA2A 4HF1A 3KYDB 3GTLJ 1ZAOA 3DU5A 4ANJA 3C1DA 1AHDP 3HPGA 3AG1H 3AL0C 2KDOA 2G0EA 2E1MB 4HSTA 1IO2A 2JZYA 2HU9A 2E5NA 3F0CA 3NAUA 3H0DA 2F4IA 3WG9A 4FTHA 4Q47A 1O3SA 2HYFA 1OCZH 4MTDA 1QVUA 3OYKA 3RKXA 3LQQA 2F5CA 1MJBA 2BXZA 2O8XA 3LSJA 3KP7A 3LFKA 3LFUA 1GUUA 1T38A 2Y48A 3PQJA 3PUBA 5HOOA 3GMEA 2R5ZA 1MBGA 3F72A 2XSDC 1EH7A 5LLQA 2P7VB 3CJTB 4XRMA 2XHKA 4IRGA 1QPIA 1FEXA 4XLHA 2WY7Q 2EA2A 4IZZA 5BQTA 2KRCA 2X85A 5JFRA 5LEKA 3J81Z 2JA5J 3QU3A 1LEAA 4NB5A 4PJNA 4L9TA 4L18B 5D4SA 2LC2A 4RMNA 1QQIA 2E7WA 1KZHA 2RQQA 1UB9A 2VE8A 1RIOH 4K2EA 1G2HA 4YEJA 1GXQA 2HYJA 4GXOA 3CC7I 2YR2A 2K86A 4HA8A 2HTJA 3PNYA 3JTGA 3VSKA 1JUMA 3ZR8X 5FLMJ 4GGGA 4V2GA 3C2BA 3MKZA 3MEXA 1Z9CA 2OV7A 1W0TA 4WX9A 1FWZA 2DFFA 3KP5A 2QWWA 4LLNA 3OYCA 5J6XA 4PZJA 1JE8A 5E3OA 4ZC3A 3N4MA 4KT6A 3JRFA 1I3QJ 5ILUA 2OCEA 4ZTJA 2J5OA 1EJ9A 2Z99A 2BOLA 4G7ZF 4M3DA 3KFWX 5EZGA 3P9KA 1E3OC 1VQ4I 1OR7C 1WFXA 2KRFA 5HS9A 3E5UA 2HWVA 5IOZA 3LSPA 5EJCA 3OOPA 4XBFA 1X2MA 5EG0A 2L4AA 2ZMEB 4Y17A 3TKYA 3HB9A 2H8WA 5IP6A 2Z3YA 3S1MJ 1G3WA 3I3LA 3K4KA 4HOBA 4TV7A 4IHVA 3F9KA 4XLFA 3CQZJ 2XGDA 4MQVA 2X48A 2BE5F 4M6VA 4AYBA 2XAGA 4LFUA 3I55I 2NVYJ 1MDMB 1BW6A 2MLKA 4L9NA 3HYIA 4C3JJ 1PUEE 2FNPA 2NOGA 3H9GA 5DV5A 2A61A 3FXRA 5CVIA 1YITI 2LNBA 1B59A 3M7GA 4NDLA 4E7KA 2JMWA 3BT9A 3CD6I 3V42A 2M4KA 1V55H 1MSFC 3BR1A 2O0YA 4XKCA 3DFGA 2LLKA 3OV8A 3HJEA 1I1GA 1VI0A 1RC9A 3HPHA 2KIFA 2OD5A 4XM3A 2FJ1A 2FOKA 4XL9A 3W3CA 5JVTA 2DK5A 4BJ6C 3HOYJ 1R00A 3J80Z 3DTEA 2FX0A 3GEZA 4Y7NJ 3BLYA 3S3MA 3JRBA 3SXYA 3H3ZA 3IAM2 3AKZA 5L3EA 2KIUA 2CG4A 5FKOA 4LB5A 2XAJA 3NRVA 1ZLJA 3FXJA 2XF5A 1MW7A 3S32A 3ISPA 1KYZA 3LAPA 1VQ5I 3M8JA 3J80K 4J00A 2Y9YA 9ANTA 2TRTA 4IHYA 2K7LA 2E1NA 2LF7A 2QZ8A 3BTCA 2LR8A 3G3ZA 3K1PA 3KEYA 1MMDA 4ASNA 1TT0A 4D0PA 4YG2F 5E3NA 5J4YA 2BW3A 3ABLH 1WJEA 1XS9A 2OQGA 1I6HJ 5LGTA 1TWCJ 2VJIA 4UV9A 2L7MP 2D1VA 1WJCA 1Z7LA 1FOKA 1SFKA 2DA2A 1BBYA 1FJLA 3KZIC 4AVZA 2STTA 2L9VA 2JUCA 3DEWA 3ERMA 3I59A 1HW2A 2K3PA 3T0YA 2BHZA 4C9YA 3JCUC 1S5LC 3E6BA 5GP9A 3VFZA 2QM3A 3H0GJ 4LG3A 1V5GA 1HSJA 3DXJF 2RGVA 3I53A 4UB8C 1H88C 3ZMZA 1OCPA 2B63J 3FXQA 3DWLE 4BUPA 1X3ZB 1P4XA 2H09A 2VQCA 4KN7X 2JVHA 3OL3A 4B3AA 3OYMA 4L5IA 4RS8A 1Q1VA 3ELKA 3FMRA 5K7ZA 4UV8A 4PK4A 2LBFB 2UXNA 5BPIA 1YFHA 2ID6A 3JRIA 4IPAA 3GYHX 1YS7A 2COMA 1MBKA 3TDUC 5GAHJ 2M3AA 2C6YA 5J8CA 3BZKA 2D5VA 1ETXA 2R4GA 4XICA 1FLIA 3WU2C 1MMAA 2L9RA 2KL4A 3GO5A 3OYAA 4XIDA 3WTVC 1IN8A 3KCCA 4Y15A 3DKWA 3OY9A 4JK1X 2R3SA 4IHWA 2VKVA 5GAEJ 1PDNC 1JGGA 4XKWA 3AG4H 1R5ID 1ULYA 3KZYA 1LE8B 2HOTA 3M3YJ 2P81A 1D3YA 2VXZA 2Q0OA 3F6VA 1IG7A 4YFXF 3VB2A 4BJTA 4A69C 2WA0A 1HF0A 1BOAA 5C4XJ 3E3VA 1R5HA 5LHHA 2E35A 4KUMA 2FBHA 2KIQA 4ESJA 2EJRA 2F5DA 4XMYA 4CCJA 2X0LA 3I71A 2BY0A 3LSGA 4I01A 2JSPA 1GVDA 2DCEA 3PO2J 4HAMA 3CC2I 5CVVA 4BDZA 3HRTA 3K70C 3P9IA 4W1UA 2HFHA 5D8KB 1JTYA 4Y52J 2P8TA 2MC4A 3K4JA 3M8EA 2EIMH 3K4NA 4IVNA 3RPUD 3FXOA 5DM7F 1J75A 2M30A 2K9QA 4XONA 1AKHA 5ILVA 1I50J 4OIPF 1V5EA 3SFIA 1IXRC 4HX8A 4MQ9F 4JX6A 1OMIA 2X1CA 1OR7A 4ZYEA 2Y9ZA 2MD5A 1F43A 3T8RA 3U9GA 1MBJA 4PFOA 2HKOA 3T5XA 3ZQLA 2EQRA 4S05A 2KJCA 1S7AA 4LOCA 3RZOJ 1Y6IA 1HBXG 1QHGA 1O4XA 4OMZA 2Y2ZA 3WHBA 5FRMA 2HGCA 3J7AO 4A3DJ 5DCFA 3HOTA 2E60A 1ZARA
chains in the Genus database with same CATH topology
1S8NA 3ZMDA 1L0OC 4EJUA 4AIJA 2A68F 4A0XA 1EH6A 1JHHA 4LK1F 1HSTA 2M1BA 2RNJA 4RGSA 3TDZC 5HLHA 4DNCA 1YO5C 3B73A 2BGCA 3CTAA 4AWXB 5ED4A 3GFIA 2XASA 2P4WA 1G3SA 5ICEA 1CF7A 4EQQA 1QZYA 1TNSA 1FBUA 4EM0B 4WWCA 1FT9A 2PMHA 2X4HA 3RI4A 3JSOA 1L3LA 2E1CA 3REOA 3GWZA 1B1BA 2NNYA 3WGIA 2ESHA 1Z1DA 2L02A 3W6KB 2M8EA 3BJOA 5H6QA 3KLNA 3IWFA 1ONVA 3RIRA 4HYEA 1ODDA 5JI6A 3QRFF 1FNNA 1S3JA 2QBYA 1IXSB 3F8MA 1OYIA 3BY6A 5HDKA 1SFUA 2IJLA 1SFEA 2ZMEA 6PAXA 4UNOA 5FD5A 1BI0A 1K6OA 2EK5A 1K78B 2V9VA 1XGOA 2RKHA 2FBKA 1EH8A 2K27A 1A04A 1SD5A 1UFMA 4A6DA 5BS6A 2NNNA 4MGRA 3T1BA 5FGMA 4A0ZA 2FSWA 1P92A 5L3DA 4EJOA 3QP5A 1KU7A 4CHUA 4RAZA 2VBWA 1SD7A 5FLXZ 4XSZF 4ZYHA 4HF2A 1YS6A 3V7RA 3R61A 2GWRA 3EQLF 1D5VA 1G6NA 1YG2A 3L7WA 4RGRA 4ENJA 5FLXK 1STZA 2DQLA 1P4AA 3BJ6A 5HDGA 1H0MA 3JTHA 4BYYA 3QAHA 5D5WB 4I7HA 4OIOF 1W7PA 3DPLC 3V7CA 4RB2C 2HOEA 5FFXA 3JAMZ 2UZKA 4EJTA 4P96A 3ZP5A 5D5VB 5FFZA 1WI9A 2KIMA 4RB0A 4HX7A 4LB6B 1LEBA 1IW7F 5HDNA 2QLZA 3JAMK 3L00A 2ZJ2A 3BPXA 3WE2A 3BP8A 4LK0F 3E6DA 5E1WA 1OYYA 2ZBKA 3MZYA 4RGUA 4KIFA 4JQFA 5DCMB 4KMFA 3IHUA 1GHCA 3K1MA 5CVRA 1ON1A 2Z5UA 4ESFA 2FNAA 1ZN2A 4UHTA 2D2WA 1QO0D 3GXOA 4YIIA 4IRHA 3HIFA 2EA4A 2OQRA 5FD6A 1YIOA 1XCBA 2EV0A 3SQNA 1R1TA 1KA8A 2GA2A 1IAWA 4ENKA 4MTEA 1LDDA 1R58A 1BC7C 2IVMA 3I5UA 1J7KA 3NEUA 3MAJA 1IF1A 1GVJA 4BH9A 3WTYC 1UCRA 3MCZA 3RKYA 3R0AA 1FBSA 2VONA 4HF0A 4A0YA 2PQ8A 5D4RA 2O03A 2QYOA 5LGNA 4M9ZA 4GYIA 4LMYA 2VBYA 4NHJA 2KJBA 3BDDA 3LA7A 3E6CC 2IA2A 2V79A 4EVIA 1QGPA 3BJAA 4M72A 4OOIA 3HRMA 5J8FA 1CF7B 1ZRCA 4F7ZA 3BOQA 2XAFA 2QVOA 3EYIA 3J81K 2PLYA 2HYGD 2EFPA 1YW9A 4P9UA 3IL2A 1USTA 3MZHA 1PP7U 1T2KA 3PFIA 5KVRA 1Q1HA 3ZMVA 1I1SA 2XKPA 4LD5A 3I54A 2PI0A 4KIGA 3C7JA 1T98A 2QBYB 1ON2A 2OBPA 1XDUA 4ESBA 4M71A 4P5OA 2VT2A 5ERIA 2FEZA 4RB1A 2VBXA 2NYXA 4M74A 5DD8A 2DPDA 3V4GA 3ZPLA 2FQ3A 4M73A 3F8FA 3EDPA 3RTRA 1I6XA 2DT5A 4KICA 3N97A 2QQBA 2JSCA 2HDCA 4EGYA 4BXUA 1R5GA 5ICCA 4ZYGA 2CGPA 1U6GA 3ROUA 5H20A 1OKRA 1TQIA 3CUQC 2ZCWA 1K78A 1Z91A 3FX3A 1QPMA 1BIAA 4P9FA 3E5XA 3RYRA 1QNTA 2LF8A 3RPQA 2NRAC 3F8CA 3TGNA 4BHPA 3WTTC 2EFWA 2P5VA 1YW7A 4AD9A 1TTYA 4Q4ZF 1HQCA 4Q5SF 1XGMA 1B9NA 2DI3A 1GXPA 2QENA 1W4MA 3ERED 1W7PB 1LJ9A 4IF4A 1D8JA 3LSTA 5IT9Z 5EEHA 3EUHA 4UXNA 1BI1A 2VT3A 5EEGA 1YLFA 1O3RA 3BWGA 1SMTA 1KU9A 4O6JA 5IT9K 3IC7A 1YTYA 2Q8KA 4GCVA 1OPCA 1BN5A 4WF2A 2F5FA 2J5PA 1TQMA 4I0AA 2HS5A 2DPUA 1IZ1A 2RC4A 5DEQA 1FP2A 1ZGJA 4KT5C 4I2OA 3WGHA 2MBFA 5K5QA 3U1DA 1X3UA 2ZXJA 3RYPA 2XROA 5D8LB 1U2WA 3VEPA 4E70A 1YQAA 3HSFA 1J59A 5DUIA 2IPQX 3VODA 3IRQA 1TW3A 3ZMTA 1IRFA 3HRSA 1V3FA 5DCMA 2VE9A 4BNCA 1IXCA 1HKSA 1ZREA 2GA1A 4BHBA 4O5VA 2ZNYA 3GX4X 3K69A 5ICFA 3ZN1A 3DF8A 2EWNA 2VODA 1FC3A 2UWMA 4DQ2A 4B8XA 1KU2A 3KP4A 1HXDA 4XLPF 2CQKA 2CYYA 2ETHA 4BAYA 4AIHA 2HZTA 1KQ9A 2H27A 1BC8C 3B02A 1RNLA 1LVAA 3S2WA 1T0FA 4LLLA 2EFNA 2A5YB 1O7FA 2PJPA 3KP6A 4KDPA 3L09A 1F4KA 3P9CA 5DUKA 2G7HA 3V8LA 3F8NA 3M1EA 1W5SA 2VC0A 2O6GE 3RKWA 4HQMA 1O3TA 5CVUA 3GFLA 4A6EA 1FZPB 2EV5A 3JW4A 3VOEA 4U0WA 1KQ8A 3CLOA 2PFBA 2W84A 1HW5A 4LG0B 2HR3A 2G7UA 4MEYF 3RJPA 2Y0MA 3E6MA 1W7PD 4RAYA 3FXUA 4I09A 4KFCA 3GF2A 1K7AA 1U8RA 3AAFA 5AONA 5DDGA 2VOPA 3ULQB 2BYVE 1BIBA 4XLNF 3ML6A 3GZ6A 2A69F 3LA3A 3ZMSA 2TDXA 3WTSC 3MQ0A 5ILSA 3WTXC 1DP7P 4UVCA 1I5ZA 1LQ1A 4EM1A 2Z9OA 2HQNA 1U5TC 1NHAA 1WQ2A 2XV4S 3HUGA 2VN2A 1JXSA 1U78A 2P6TA 4EJWA 4G7OF 4WXCA 1H9GA 4EV0A 4ZZDA 5KK1A 1J5YA 1G3YA 4B09A 2ZFWA 1TW2A 5D6EA 5LRSA 4ENNA 2JT1A 1HW1A 2ADUA 2XAQA 3O3KA 1E2XA 3V8KA 2B0LA 3WTUC 4XRFA 1MGTA 3GFJA 3KLOA 2H6CA 4OU0A 1IN6A 3CUOA 1REPC 2LSOA 4H0EA 2M5WA 4HBLA 1USSA 3HTSB 2MLGA 3BPVA 5JHUA 4ETSA 1FYKA 2GQQA 1ZRDA 2DTRA 2OZUA 3MFKA 3HOSA 1S6LA 1E17A 2HQRA 1MD0A 4HX4A 1F9NA 4G6QA 5TJJA 5LHGA 1ZG3A 4A5NA 2A6HF 5HS7A 4A12A 3LAJA 1AWCA 4UVBA 2FMLA 4M6XA 1FP1D 2XVCA 1RZ4A 4U7BA 1BM9A 2Y75A 1YW8A 5IT3A 2V1DA 1K79A 2VBZA 1I27A 3GVAA 1O7LA 1R23A 4Y13A 2V6CA 3HTUA 3FZVA 4N0BA 5D5UB 3T8TA 1WKMA 4HV5A 1FSEA 3KP2A 1MKMA 1B9MA 1T6SA 4MEXF 3GLXA 4HDUA 3CJNA 2JTVA 5F6FA 2CWEA 5E20A 1G3TA 2KKOA 4R8HA 2ZO4A 3TO7A 2YX7A 4Q48A 1SFXA 2GXGA 2OZ6A 2FU4A 3HHGA 4IHTA 4IHSA 1FX7A 4CDGA 1SD4A 1ZG1A 2P7CB 2L3DA 3PQKA 4KA4A 4WXDA 2BV6A 1LNWA 3KEOA 5AIQA 2EB7A 3HSEA 3SFZA 2JPBA 3CO6C 4L9JA 2BBYA 2RDPA 3EYYA 2XUBA 3C18A 2IT0A 5ICGA 2XIGA 1U5TA 4HV6A 2NS0A 1FY7A 4L9VA 5LRRA 1XGSA 2G9WA 5E1XA 1J0RA 2RVCA 1S29A 2IP2A 2FMYA 1KU3A 1R1UA 5L3CA 3MWMA 4L5JA 1O3QA 4UVAA 4CO8A 1S7OA 5E8GA 3CUQB 4GO1A 2EFOA 3CO7C 1DDNA 3Q9SA 2VOOA 3K2ZA 5A2QZ 2H94A 1IRGA 3SZPA 4L0YB 2PBIA 5A2QK 4AVPA 3WTWC 4OIRF 2DW4A 4EGZA 2Z33A 2O61A 2UXXA 1XSDA 4LG0A 3IKVA 5D5XB 4I0BA 4M6YA 2FRHA 1FSHA 1PP8F 3TOBA 1R22A 3O6BB 3D0SA 2DO7A 1H9TA 4FX0A 1DPRA 3Q9VA 2ISYA 4EJVA 2HKXA 2MC3A 1Z05A 2PG4A 2GIVA 3NQOA 1P2FA 1P6RA 1LDKB 3WU0A 2E7XA 3H92A 3ZMUA 1Z7UA 2Q2EA 3GZ5A 3LQRA 2IW5A 1KQ0A 2BEOA 1TLHB 5HLIA 3ZN0A 2P6SA 5HS8A 2K02A 3QP6A 1BI2A 1QZZA 4FHTA 3U2RA 2OA4A 3M9AA 3QU6A 1DUXC 1MJ9A 2ELHA 5DYMA 2CW0F 2MA3A 1RUNA 3F6OA 4HDVA 1XN7A 3FMSA 2NAZA 2M87A 2LKPA 3TOAA 2O3FA 2L4MA 1XSXA 5FO5A 4HW0A 2IA0A 3M8FA 2IRFG 3WODF 5FB2A 5BMZA 2RN7A 1DPUA 3GFMA 4CXFA 2WV0A 4RGXA 3IWZA 5E18F 3GW2A 4U88A 2DQRA 4HLYA 2L54A 4WXHA 2MH2A 1G4DA 3KZZA 4R1HA 1Y0UA 1J2XA 2EFQA 3I4PA 3DPTA 2YU3A 5E8IA 3DP7A 2XKOA 4Z2YA 3FF5A 1XGNA 4OMYA 2D1HA 2PN6A 3L9FA 2CO5A 1C0WA 5LBQA 5L3GA 2FA5A 2HTSA 4U0YA 1IUYA 1R7JA 1TQPA 1IN4A 3V8JA 1EV7A 3LWFA 4I98B 5H6RA 4WK8F 1SMYF 1AOYA 3KE2A 3ECOA 2QQAA 4M9SA 3L2CA 1QBJA 4PGHA 1WRJA 2QQ9A 2P5LC 2YSRA 4A5MA 2DU9A 2A07F 4HLXA 5BOXA 4KNYA 2H6BA 2DFIA 3ABTA 2ISZA 4WCGA 4JBAA 3F21A 1B4AA 5K5OA 2M45A 4IRIA 1FBQA 3C3WA 1U5TB 2JRTA 1Z6RA 5CLSA 3WE3A 5CJ9A 4QWQA 4CZZA 3D5LA 4KIBA 3BZ6A 3W6JB 4ENMA 1LDJA 2W25A 5HVQC 2XGXA 5DD4A 3P7NA 2IA1A 4A2UA 4IXAA 2F5EA 3KP3A 1JGSA 1BJAA 1KYWA 3SHFA 3LA2A 5E17F 2QUFA 4YFNF 4HQEA 4NQWA 4YFKF 4ZH4F 4CGZA 5D6FA 1XSVA 1F5TA 3DQVC 3I64A 4U0VA 1O57A 3F3XA 3FHZA 3HSRA 1SAXA 3DV8A 4PDKA 3CUQA 3EETA 1R1VA 2OU2A 1TNTA 2FF4A 1KGSA 3QOPA 1R36A 4BQAA 2FE3A 3SZTA 1XB4A 5AIPA 3QPHA 3COAC 5E1ZB 1MZBA 2STWA 2PMUA 2WC2A 3WGGA 1XD7A 1T39A 2FXAA 4MHGA 1UHMA 4LJZF 4N9IA 1YYVA 1WSUA 1XMAA 4KN4X 2ZNZA 3I0TA 3HRUA 4CYDA 1HKTA 5LEJA 3K0LA 2D45A 2GAUA 4AIKA 4G9YA 2L01A 2AS5F 3JSPA 2ESNA 4OIQF 3BROA 2CFXA 3GUDA 2XRNA 5TRDA 4ZYDA 2K4JA 4UUVA 4R79A 5F64A 4P55A 2V1XA 3TO6A 4EMSA 2F2EA 3R0JA 3HHHA 3KETA 5JR3A 3R60A 5HLGA 4PGGA 1V4RA 4KYWA 3R6SA 4G7HF 1UHWA 2VC1A 3F22A 3FM3A 1Z6TA 1XMKA 1LB2A 1ZYRF 3F23A 1ZLKA 3RPUA 1MDMA 3QPTA 1D8KA 1B6AA 2A6EF 3CDHA 3E5QA 2DLLA 2YX4A 2ZKZA 3K1NA 2W85A 3IRRA 3V7SA 5CVJA 1TBXA 2W57A 2GXBA 4CICA 3WU1B 2AXLA 5LHIA 2YPRA 3FM5A 1OYWA 2DAOA 4BHCA 1VTNC 4IJAA 2WWYA 4GYGA 3E97A 3Q5FA 1P4WA 1WWXA 2GZWA 5LGUA 3RDIA 3I59B 2XAHA 2A3SA 4QLCU 5K1YA 4M9XA 1ZHFA 2OAZA 4U7DA 2R7FA 2P5KA 3TQNA 5F1RA 2WTEA 2RQPA 2RV8A 4O3MA 2ACJA 1XDSA 1U3EM 4N9HA 1CGPA 4LLGF 5CYVA 4EM2A 1RI7A 2W24A 4MNUA 4G8XA 4XSXF 2K4BA 3IKTA 3O2PE 3ZQ7A 3K9TA 4PCQA 5L3BA 4HZFA 3TO9A 4G94A 3F8BA 1HKQA 4LGWA 4I02A 5K5RA 2R7DA 5L3FA 2EV6A 1F1ZA 4S04A 1IN7A 1BI3A 1J9IA 2LDUA 1IN5A 4OINF 3ECHA 1ZH5A 2V1UA 1MJAA 2JPCA 2FBIA 3WTZA 3DEUA 2DK8A 2MH9A 3H3UA 3KEQA 5BPDA 1SD6A 4L0ZB 3ABUA 4ZZLA 1JHFA 4RB3C 4YIFA 3G73A 1W5TA 4ON0A 3R4KA 1ZGAA 3I58A 1ZG5A 1XCVA 1ZRFA 2CSOA 2DBBA 3FMQA 1FYMA 1RUOA 1FYLA 1FPQA 4KMUX 2HEOA 2PEXA 4FX4A 4FT8A 4G6DA 3FWEA 4HF1A 1ZAOA 3C1DA 2JZYA 3WG9A 4Q47A 1O3SA 2HYFA 4MTDA 3RKXA 3LQQA 2F5CA 1MJBA 2O8XA 3KP7A 3LFKA 1T38A 2Y48A 3PQJA 5HOOA 3F72A 1EH7A 5LLQA 2P7VB 2XHKA 4IRGA 2EA2A 5BQTA 5JFRA 5LEKA 3J81Z 3QU3A 1LEAA 4NB5A 4L9TA 4L18B 5D4SA 1QQIA 2E7WA 1RIOH 1UB9A 2VE8A 4K2EA 1GXQA 4GXOA 2YR2A 2K86A 4HA8A 2HTJA 3JTGA 4GGGA 3MEXA 1Z9CA 4WX9A 1FWZA 3KP5A 2QWWA 4LLNA 5J6XA 4PZJA 1JE8A 3N4MA 5ILUA 2J5OA 2Z99A 4G7ZF 3KFWX 3P9KA 2KRFA 5HS9A 3E5UA 2HWVA 3OOPA 4XBFA 2L4AA 2ZMEB 4Y17A 3TKYA 2Z3YA 1G3WA 4HOBA 4TV7A 4MQVA 2BE5F 2XAGA 4LFUA 1MDMB 2MLKA 4L9NA 3HYIA 1PUEE 2FNPA 5DV5A 2A61A 3FXRA 5CVIA 2LNBA 1B59A 3M7GA 2O0YA 3DFGA 3OV8A 1I1GA 2KIFA 2OD5A 2FOKA 5JVTA 2DK5A 1R00A 3J80Z 3GEZA 3SXYA 3H3ZA 5L3EA 2KIUA 2CG4A 4LB5A 2XAJA 3NRVA 1ZLJA 3ISPA 1KYZA 3LAPA 3J80K 2K7LA 2E1NA 4ASNA 2LF7A 2QZ8A 3G3ZA 3K1PA 4D0PA 4YG2F 2OQGA 5LGTA 4UV9A 2D1VA 1FOKA 1BBYA 2STTA 3I59A 1HW2A 3T0YA 3E6BA 3VFZA 2QM3A 1HSJA 3DXJF 2RGVA 3I53A 3ZMZA 3FXQA 1P4XA 2H09A 4KN7X 4L5IA 4RS8A 3ELKA 3FMRA 4UV8A 2UXNA 5BPIA 1YFHA 4IPAA 3GYHX 1YS7A 2COMA 3TDUC 2C6YA 5J8CA 1FLIA 3GO5A 3WTVC 1IN8A 3KCCA 4Y15A 3DKWA 4JK1X 2R3SA 1PDNC 1ULYA 3KZYA 1D3YA 2VXZA 2Q0OA 3F6VA 4YFXF 3VB2A 1BOAA 3E3VA 1R5HA 5LHHA 4KUMA 2FBHA 4ESJA 2EJRA 2F5DA 2X0LA 3I71A 4I01A 4HAMA 5CVVA 3HRTA 3P9IA 2HFHA 5D8KB 2P8TA 3M8EA 4IVNA 1J75A 2M30A 5ILVA 4OIPF 1IXRC 4HX8A 4MQ9F 1OMIA 1OR7A 4ZYEA 2MD5A 3T8RA 3U9GA 2HKOA 3T5XA 4S05A 2KJCA 1S7AA 1HBXG 4OMZA 2HGCA 3J7AO 5DCFA 3HOTA 1ZARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S8N A;  3ZMD A;  1L0O C;  4EJU A;  4AIJ A;  2A68 F;  4A0X A;  1EH6 A;  1JHH A;  4LK1 F;  1HST A;  2M1B A;  2RNJ A;  4RGS A;  3TDZ C;  5HLH A;  4DNC A;  1YO5 C;  3B73 A;  2BGC A;  3CTA A;  4AWX B;  5ED4 A;  3GFI A;  2XAS A;  2P4W A;  1G3S A;  5ICE A;  1CF7 A;  4EQQ A;  1QZY A;  1TNS A;  1FBU A;  4EM0 B;  4WWC A;  1FT9 A;  2PMH A;  2X4H A;  3RI4 A;  3JSO A;  1L3L A;  2E1C A;  3REO A;  3GWZ A;  1B1B A;  2NNY A;  3WGI A;  2ESH A;  1Z1D A;  2L02 A;  3W6K B;  2M8E A;  3BJO A;  5H6Q A;  3KLN A;  3IWF A;  1ONV A;  3RIR A;  4HYE A;  1ODD A;  5JI6 A;  3QRF F;  1FNN A;  1S3J A;  2QBY A;  1IXS B;  3F8M A;  1OYI A;  3BY6 A;  5HDK A;  1SFU A;  2IJL A;  1SFE A;  2ZME A;  6PAX A;  4UNO A;  5FD5 A;  1BI0 A;  1K6O A;  2EK5 A;  1K78 B;  2V9V A;  1XGO A;  2RKH A;  2FBK A;  1EH8 A;  2K27 A;  1A04 A;  1SD5 A;  1UFM A;  4A6D A;  5BS6 A;  2NNN A;  4MGR A;  3T1B A;  5FGM A;  4A0Z A;  2FSW A;  1P92 A;  5L3D A;  4EJO A;  3QP5 A;  1KU7 A;  4CHU A;  4RAZ A;  2VBW A;  1SD7 A;  5FLX Z;  4XSZ F;  4ZYH A;  4HF2 A;  1YS6 A;  3V7R A;  3R61 A;  2GWR A;  3EQL F;  1D5V A;  1G6N A;  1YG2 A;  3L7W A;  4RGR A;  4ENJ A;  5FLX K;  1STZ A;  2DQL A;  1P4A A;  3BJ6 A;  5HDG A;  1H0M A;  3JTH A;  4BYY A;  3QAH A;  5D5W B;  4I7H A;  4OIO F;  1W7P A;  3DPL C;  3V7C A;  4RB2 C;  2HOE A;  5FFX A;  3JAM Z;  2UZK A;  4EJT A;  4P96 A;  3ZP5 A;  5D5V B;  5FFZ A;  1WI9 A;  2KIM A;  4RB0 A;  4HX7 A;  4LB6 B;  1LEB A;  1IW7 F;  5HDN A;  2QLZ A;  3JAM K;  3L00 A;  2ZJ2 A;  3BPX A;  3WE2 A;  3BP8 A;  4LK0 F;  3E6D A;  5E1W A;  1OYY A;  2ZBK A;  3MZY A;  4RGU A;  4KIF A;  4JQF A;  5DCM B;  4KMF A;  3IHU A;  1GHC A;  3K1M A;  5CVR A;  1ON1 A;  2Z5U A;  4ESF A;  2FNA A;  1ZN2 A;  4UHT A;  2D2W A;  1QO0 D;  3GXO A;  4YII A;  4IRH A;  3HIF A;  2EA4 A;  2OQR A;  5FD6 A;  1YIO A;  1XCB A;  2EV0 A;  3SQN A;  1R1T A;  1KA8 A;  2GA2 A;  1IAW A;  4ENK A;  4MTE A;  1LDD A;  1R58 A;  1BC7 C;  2IVM A;  3I5U A;  1J7K A;  3NEU A;  3MAJ A;  1IF1 A;  1GVJ A;  4BH9 A;  3WTY C;  1UCR A;  3MCZ A;  3RKY A;  3R0A A;  1FBS A;  2VON A;  4HF0 A;  4A0Y A;  2PQ8 A;  5D4R A;  2O03 A;  2QYO A;  5LGN A;  4M9Z A;  4GYI A;  4LMY A;  2VBY A;  4NHJ A;  2KJB A;  3BDD A;  3LA7 A;  3E6C C;  2IA2 A;  2V79 A;  4EVI A;  1QGP A;  3BJA A;  4M72 A;  4OOI A;  3HRM A;  5J8F A;  1CF7 B;  1ZRC A;  4F7Z A;  3BOQ A;  2XAF A;  2QVO A;  3EYI A;  3J81 K;  2PLY A;  2HYG D;  2EFP A;  1YW9 A;  4P9U A;  3IL2 A;  1UST A;  3MZH A;  1PP7 U;  1T2K A;  3PFI A;  5KVR A;  1Q1H A;  3ZMV A;  1I1S A;  2XKP A;  4LD5 A;  3I54 A;  2PI0 A;  4KIG A;  3C7J A;  1T98 A;  2QBY B;  1ON2 A;  2OBP A;  1XDU A;  4ESB A;  4M71 A;  4P5O A;  2VT2 A;  5ERI A;  2FEZ A;  4RB1 A;  2VBX A;  2NYX A;  4M74 A;  5DD8 A;  2DPD A;  3V4G A;  3ZPL A;  2FQ3 A;  4M73 A;  3F8F A;  3EDP A;  3RTR A;  1I6X A;  2DT5 A;  4KIC A;  3N97 A;  2QQB A;  2JSC A;  2HDC A;  4EGY A;  4BXU A;  1R5G A;  5ICC A;  4ZYG A;  2CGP A;  1U6G A;  3ROU A;  5H20 A;  1OKR A;  1TQI A;  3CUQ C;  2ZCW A;  1K78 A;  1Z91 A;  3FX3 A;  1QPM A;  1BIA A;  4P9F A;  3E5X A;  3RYR A;  1QNT A;  2LF8 A;  3RPQ A;  2NRA C;  3F8C A;  3TGN A;  4BHP A;  3WTT C;  2EFW A;  2P5V A;  1YW7 A;  4AD9 A;  1TTY A;  4Q4Z F;  1HQC A;  4Q5S F;  1XGM A;  1B9N A;  2DI3 A;  1GXP A;  2QEN A;  1W4M A;  3ERE D;  1W7P B;  1LJ9 A;  4IF4 A;  1D8J A;  3LST A;  5IT9 Z;  5EEH A;  3EUH A;  4UXN A;  1BI1 A;  2VT3 A;  5EEG A;  1YLF A;  1O3R A;  3BWG A;  1SMT A;  1KU9 A;  4O6J A;  5IT9 K;  3IC7 A;  1YTY A;  2Q8K A;  4GCV A;  1OPC A;  1BN5 A;  4WF2 A;  2F5F A;  2J5P A;  1TQM A;  4I0A A;  2HS5 A;  2DPU A;  1IZ1 A;  2RC4 A;  5DEQ A;  1FP2 A;  1ZGJ A;  4KT5 C;  4I2O A;  3WGH A;  2MBF A;  5K5Q A;  3U1D A;  1X3U A;  2ZXJ A;  3RYP A;  2XRO A;  5D8L B;  1U2W A;  3VEP A;  4E70 A;  1YQA A;  3HSF A;  1J59 A;  5DUI A;  2IPQ X;  3VOD A;  3IRQ A;  1TW3 A;  3ZMT A;  1IRF A;  3HRS A;  1V3F A;  5DCM A;  2VE9 A;  4BNC A;  1IXC A;  1HKS A;  1ZRE A;  2GA1 A;  4BHB A;  4O5V A;  2ZNY A;  3GX4 X;  3K69 A;  5ICF A;  3ZN1 A;  3DF8 A;  2EWN A;  2VOD A;  1FC3 A;  2UWM A;  4DQ2 A;  4B8X A;  1KU2 A;  3KP4 A;  1HXD A;  4XLP F;  2CQK A;  2CYY A;  2ETH A;  4BAY A;  4AIH A;  2HZT A;  1KQ9 A;  2H27 A;  1BC8 C;  3B02 A;  1RNL A;  1LVA A;  3S2W A;  1T0F A;  4LLL A;  2EFN A;  2A5Y B;  1O7F A;  2PJP A;  3KP6 A;  4KDP A;  3L09 A;  1F4K A;  3P9C A;  5DUK A;  2G7H A;  3V8L A;  3F8N A;  3M1E A;  1W5S A;  2VC0 A;  2O6G E;  3RKW A;  4HQM A;  1O3T A;  5CVU A;  3GFL A;  4A6E A;  1FZP B;  2EV5 A;  3JW4 A;  3VOE A;  4U0W A;  1KQ8 A;  3CLO A;  2PFB A;  2W84 A;  1HW5 A;  4LG0 B;  2HR3 A;  2G7U A;  4MEY F;  3RJP A;  2Y0M A;  3E6M A;  1W7P D;  4RAY A;  3FXU A;  4I09 A;  4KFC A;  3GF2 A;  1K7A A;  1U8R A;  3AAF A;  5AON A;  5DDG A;  2VOP A;  3ULQ B;  2BYV E;  1BIB A;  4XLN F;  3ML6 A;  3GZ6 A;  2A69 F;  3LA3 A;  3ZMS A;  2TDX A;  3WTS C;  3MQ0 A;  5ILS A;  3WTX C;  1DP7 P;  4UVC A;  1I5Z A;  1LQ1 A;  4EM1 A;  2Z9O A;  2HQN A;  1U5T C;  1NHA A;  1WQ2 A;  2XV4 S;  3HUG A;  2VN2 A;  1JXS A;  1U78 A;  2P6T A;  4EJW A;  4G7O F;  4WXC A;  1H9G A;  4EV0 A;  4ZZD A;  5KK1 A;  1J5Y A;  1G3Y A;  4B09 A;  2ZFW A;  1TW2 A;  5D6E A;  5LRS A;  4ENN A;  2JT1 A;  1HW1 A;  2ADU A;  2XAQ A;  3O3K A;  1E2X A;  3V8K A;  2B0L A;  3WTU C;  4XRF A;  1MGT A;  3GFJ A;  3KLO A;  2H6C A;  4OU0 A;  1IN6 A;  3CUO A;  1REP C;  2LSO A;  4H0E A;  2M5W A;  4HBL A;  1USS A;  3HTS B;  2MLG A;  3BPV A;  5JHU A;  4ETS A;  1FYK A;  2GQQ A;  1ZRD A;  2DTR A;  2OZU A;  3MFK A;  3HOS A;  1S6L A;  1E17 A;  2HQR A;  1MD0 A;  4HX4 A;  1F9N A;  4G6Q A;  5TJJ A;  5LHG A;  1ZG3 A;  4A5N A;  2A6H F;  5HS7 A;  4A12 A;  3LAJ A;  1AWC A;  4UVB A;  2FML A;  4M6X A;  1FP1 D;  2XVC A;  1RZ4 A;  4U7B A;  1BM9 A;  2Y75 A;  1YW8 A;  5IT3 A;  2V1D A;  1K79 A;  2VBZ A;  1I27 A;  3GVA A;  1O7L A;  1R23 A;  4Y13 A;  2V6C A;  3HTU A;  3FZV A;  4N0B A;  5D5U B;  3T8T A;  1WKM A;  4HV5 A;  1FSE A;  3KP2 A;  1MKM A;  1B9M A;  1T6S A;  4MEX F;  3GLX A;  4HDU A;  3CJN A;  2JTV A;  5F6F A;  2CWE A;  5E20 A;  1G3T A;  2KKO A;  4R8H A;  2ZO4 A;  3TO7 A;  2YX7 A;  4Q48 A;  1SFX A;  2GXG A;  2OZ6 A;  2FU4 A;  3HHG A;  4IHT A;  4IHS A;  1FX7 A;  4CDG A;  1SD4 A;  1ZG1 A;  2P7C B;  2L3D A;  3PQK A;  4KA4 A;  4WXD A;  2BV6 A;  1LNW A;  3KEO A;  5AIQ A;  2EB7 A;  3HSE A;  3SFZ A;  2JPB A;  3CO6 C;  4L9J A;  2BBY A;  2RDP A;  3EYY A;  2XUB A;  3C18 A;  2IT0 A;  5ICG A;  2XIG A;  1U5T A;  4HV6 A;  2NS0 A;  1FY7 A;  4L9V A;  5LRR A;  1XGS A;  2G9W A;  5E1X A;  1J0R A;  2RVC A;  1S29 A;  2IP2 A;  2FMY A;  1KU3 A;  1R1U A;  5L3C A;  3MWM A;  4L5J A;  1O3Q A;  4UVA A;  4CO8 A;  1S7O A;  5E8G A;  3CUQ B;  4GO1 A;  2EFO A;  3CO7 C;  1DDN A;  3Q9S A;  2VOO A;  3K2Z A;  5A2Q Z;  2H94 A;  1IRG A;  3SZP A;  4L0Y B;  2PBI A;  5A2Q K;  4AVP A;  3WTW C;  4OIR F;  2DW4 A;  4EGZ A;  2Z33 A;  2O61 A;  2UXX A;  1XSD A;  4LG0 A;  3IKV A;  5D5X B;  4I0B A;  4M6Y A;  2FRH A;  1FSH A;  1PP8 F;  3TOB A;  1R22 A;  3O6B B;  3D0S A;  2DO7 A;  1H9T A;  4FX0 A;  1DPR A;  3Q9V A;  2ISY A;  4EJV A;  2HKX A;  2MC3 A;  1Z05 A;  2PG4 A;  2GIV A;  3NQO A;  1P2F A;  1P6R A;  1LDK B;  3WU0 A;  2E7X A;  3H92 A;  3ZMU A;  1Z7U A;  2Q2E A;  3GZ5 A;  3LQR A;  2IW5 A;  1KQ0 A;  2BEO A;  1TLH B;  5HLI A;  3ZN0 A;  2P6S A;  5HS8 A;  2K02 A;  3QP6 A;  1BI2 A;  1QZZ A;  4FHT A;  3U2R A;  2OA4 A;  3M9A A;  3QU6 A;  1DUX C;  1MJ9 A;  2ELH A;  5DYM A;  2CW0 F;  2MA3 A;  1RUN A;  3F6O A;  4HDV A;  1XN7 A;  3FMS A;  2NAZ A;  2M87 A;  2LKP A;  3TOA A;  2O3F A;  2L4M A;  1XSX A;  5FO5 A;  4HW0 A;  2IA0 A;  3M8F A;  2IRF G;  3WOD F;  5FB2 A;  5BMZ A;  2RN7 A;  1DPU A;  3GFM A;  4CXF A;  2WV0 A;  4RGX A;  3IWZ A;  5E18 F;  3GW2 A;  4U88 A;  2DQR A;  4HLY A;  2L54 A;  4WXH A;  2MH2 A;  1G4D A;  3KZZ A;  4R1H A;  1Y0U A;  1J2X A;  2EFQ A;  3I4P A;  3DPT A;  2YU3 A;  5E8I A;  3DP7 A;  2XKO A;  4Z2Y A;  3FF5 A;  1XGN A;  4OMY A;  2D1H A;  2PN6 A;  3L9F A;  2CO5 A;  1C0W A;  5LBQ A;  5L3G A;  2FA5 A;  2HTS A;  4U0Y A;  1IUY A;  1R7J A;  1TQP A;  1IN4 A;  3V8J A;  1EV7 A;  3LWF A;  4I98 B;  5H6R A;  4WK8 F;  1SMY F;  1AOY A;  3KE2 A;  3ECO A;  2QQA A;  4M9S A;  3L2C A;  1QBJ A;  4PGH A;  1WRJ A;  2QQ9 A;  2P5L C;  2YSR A;  4A5M A;  2DU9 A;  2A07 F;  4HLX A;  5BOX A;  4KNY A;  2H6B A;  2DFI A;  3ABT A;  2ISZ A;  4WCG A;  4JBA A;  3F21 A;  1B4A A;  5K5O A;  2M45 A;  4IRI A;  1FBQ A;  3C3W A;  1U5T B;  2JRT A;  1Z6R A;  5CLS A;  3WE3 A;  5CJ9 A;  4QWQ A;  4CZZ A;  3D5L A;  4KIB A;  3BZ6 A;  3W6J B;  4ENM A;  1LDJ A;  2W25 A;  5HVQ C;  2XGX A;  5DD4 A;  3P7N A;  2IA1 A;  4A2U A;  4IXA A;  2F5E A;  3KP3 A;  1JGS A;  1BJA A;  1KYW A;  3SHF A;  3LA2 A;  5E17 F;  2QUF A;  4YFN F;  4HQE A;  4NQW A;  4YFK F;  4ZH4 F;  4CGZ A;  5D6F A;  1XSV A;  1F5T A;  3DQV C;  3I64 A;  4U0V A;  1O57 A;  3F3X A;  3FHZ A;  3HSR A;  1SAX A;  3DV8 A;  4PDK A;  3CUQ A;  3EET A;  1R1V A;  2OU2 A;  1TNT A;  2FF4 A;  1KGS A;  3QOP A;  1R36 A;  4BQA A;  2FE3 A;  3SZT A;  1XB4 A;  5AIP A;  3QPH A;  3COA C;  5E1Z B;  1MZB A;  2STW A;  2PMU A;  2WC2 A;  3WGG A;  1XD7 A;  1T39 A;  2FXA A;  4MHG A;  1UHM A;  4LJZ F;  4N9I A;  1YYV A;  1WSU A;  1XMA A;  4KN4 X;  2ZNZ A;  3I0T A;  3HRU A;  4CYD A;  1HKT A;  5LEJ A;  3K0L A;  2D45 A;  2GAU A;  4AIK A;  4G9Y A;  2L01 A;  2AS5 F;  3JSP A;  2ESN A;  4OIQ F;  3BRO A;  2CFX A;  3GUD A;  2XRN A;  5TRD A;  4ZYD A;  2K4J A;  4UUV A;  4R79 A;  5F64 A;  4P55 A;  2V1X A;  3TO6 A;  4EMS A;  2F2E A;  3R0J A;  3HHH A;  3KET A;  5JR3 A;  3R60 A;  5HLG A;  4PGG A;  1V4R A;  4KYW A;  3R6S A;  4G7H F;  1UHW A;  2VC1 A;  3F22 A;  3FM3 A;  1Z6T A;  1XMK A;  1LB2 A;  1ZYR F;  3F23 A;  1ZLK A;  3RPU A;  1MDM A;  3QPT A;  1D8K A;  1B6A A;  2A6E F;  3CDH A;  3E5Q A;  2DLL A;  2YX4 A;  2ZKZ A;  3K1N A;  2W85 A;  3IRR A;  3V7S A;  5CVJ A;  1TBX A;  2W57 A;  2GXB A;  4CIC A;  3WU1 B;  2AXL A;  5LHI A;  2YPR A;  3FM5 A;  1OYW A;  2DAO A;  4BHC A;  1VTN C;  4IJA A;  2WWY A;  4GYG A;  3E97 A;  3Q5F A;  1P4W A;  1WWX A;  2GZW A;  5LGU A;  3RDI A;  3I59 B;  2XAH A;  2A3S A;  4QLC U;  5K1Y A;  4M9X A;  1ZHF A;  2OAZ A;  4U7D A;  2R7F A;  2P5K A;  3TQN A;  5F1R A;  2WTE A;  2RQP A;  2RV8 A;  4O3M A;  2ACJ A;  1XDS A;  1U3E M;  4N9H A;  1CGP A;  4LLG F;  5CYV A;  4EM2 A;  1RI7 A;  2W24 A;  4MNU A;  4G8X A;  4XSX F;  2K4B A;  3IKT A;  3O2P E;  3ZQ7 A;  3K9T A;  4PCQ A;  5L3B A;  4HZF A;  3TO9 A;  4G94 A;  3F8B A;  1HKQ A;  4LGW A;  4I02 A;  5K5R A;  2R7D A;  5L3F A;  2EV6 A;  1F1Z A;  4S04 A;  1IN7 A;  1BI3 A;  1J9I A;  2LDU A;  1IN5 A;  4OIN F;  3ECH A;  1ZH5 A;  2V1U A;  1MJA A;  2JPC A;  2FBI A;  3WTZ A;  3DEU A;  2DK8 A;  2MH9 A;  3H3U A;  3KEQ A;  5BPD A;  1SD6 A;  4L0Z B;  3ABU A;  4ZZL A;  1JHF A;  4RB3 C;  4YIF A;  3G73 A;  1W5T A;  4ON0 A;  3R4K A;  1ZGA A;  3I58 A;  1ZG5 A;  1XCV A;  1ZRF A;  2CSO A;  2DBB A;  3FMQ A;  1FYM A;  1RUO A;  1FYL A;  1FPQ A;  4KMU X;  2HEO A;  2PEX A;  4FX4 A;  4FT8 A;  4G6D A;  3FWE A;  4HF1 A;  1ZAO A;  3C1D A;  2JZY A;  3WG9 A;  4Q47 A;  1O3S A;  2HYF A;  4MTD A;  3RKX A;  3LQQ A;  2F5C A;  1MJB A;  2O8X A;  3KP7 A;  3LFK A;  1T38 A;  2Y48 A;  3PQJ A;  5HOO A;  3F72 A;  1EH7 A;  5LLQ A;  2P7V B;  2XHK A;  4IRG A;  2EA2 A;  5BQT A;  5JFR A;  5LEK A;  3J81 Z;  3QU3 A;  1LEA A;  4NB5 A;  4L9T A;  4L18 B;  5D4S A;  1QQI A;  2E7W A;  1RIO H;  1UB9 A;  2VE8 A;  4K2E A;  1GXQ A;  4GXO A;  2YR2 A;  2K86 A;  4HA8 A;  2HTJ A;  3JTG A;  4GGG A;  3MEX A;  1Z9C A;  4WX9 A;  1FWZ A;  3KP5 A;  2QWW A;  4LLN A;  5J6X A;  4PZJ A;  1JE8 A;  3N4M A;  5ILU A;  2J5O A;  2Z99 A;  4G7Z F;  3KFW X;  3P9K A;  2KRF A;  5HS9 A;  3E5U A;  2HWV A;  3OOP A;  4XBF A;  2L4A A;  2ZME B;  4Y17 A;  3TKY A;  2Z3Y A;  1G3W A;  4HOB A;  4TV7 A;  4MQV A;  2BE5 F;  2XAG A;  4LFU A;  1MDM B;  2MLK A;  4L9N A;  3HYI A;  1PUE E;  2FNP A;  5DV5 A;  2A61 A;  3FXR A;  5CVI A;  2LNB A;  1B59 A;  3M7G A;  2O0Y A;  3DFG A;  3OV8 A;  1I1G A;  2KIF A;  2OD5 A;  2FOK A;  5JVT A;  2DK5 A;  1R00 A;  3J80 Z;  3GEZ A;  3SXY A;  3H3Z A;  5L3E A;  2KIU A;  2CG4 A;  4LB5 A;  2XAJ A;  3NRV A;  1ZLJ A;  3ISP A;  1KYZ A;  3LAP A;  3J80 K;  2K7L A;  2E1N A;  4ASN A;  2LF7 A;  2QZ8 A;  3G3Z A;  3K1P A;  4D0P A;  4YG2 F;  2OQG A;  5LGT A;  4UV9 A;  2D1V A;  1FOK A;  1BBY A;  2STT A;  3I59 A;  1HW2 A;  3T0Y A;  3E6B A;  3VFZ A;  2QM3 A;  1HSJ A;  3DXJ F;  2RGV A;  3I53 A;  3ZMZ A;  3FXQ A;  1P4X A;  2H09 A;  4KN7 X;  4L5I A;  4RS8 A;  3ELK A;  3FMR A;  4UV8 A;  2UXN A;  5BPI A;  1YFH A;  4IPA A;  3GYH X;  1YS7 A;  2COM A;  3TDU C;  2C6Y A;  5J8C A;  1FLI A;  3GO5 A;  3WTV C;  1IN8 A;  3KCC A;  4Y15 A;  3DKW A;  4JK1 X;  2R3S A;  1PDN C;  1ULY A;  3KZY A;  1D3Y A;  2VXZ A;  2Q0O A;  3F6V A;  4YFX F;  3VB2 A;  1BOA A;  3E3V A;  1R5H A;  5LHH A;  4KUM A;  2FBH A;  4ESJ A;  2EJR A;  2F5D A;  2X0L A;  3I71 A;  4I01 A;  4HAM A;  5CVV A;  3HRT A;  3P9I A;  2HFH A;  5D8K B;  2P8T A;  3M8E A;  4IVN A;  1J75 A;  2M30 A;  5ILV A;  4OIP F;  1IXR C;  4HX8 A;  4MQ9 F;  1OMI A;  1OR7 A;  4ZYE A;  2MD5 A;  3T8R A;  3U9G A;  2HKO A;  3T5X A;  4S05 A;  2KJC A;  1S7A A;  1HBX G;  4OMZ A;  2HGC A;  3J7A O;  5DCF A;  3HOT A;  1ZAR A; 
#chains in the Genus database with same CATH topology
 1S8N A;  3ZMD A;  1L0O C;  1SVM A;  4EJU A;  1IC8 A;  4AIJ A;  2A68 F;  2AXT C;  3WHC A;  3CLQ A;  4C2U A;  2ICW G;  4A0X A;  2R7W A;  1EH6 A;  4BQQ A;  1JHH A;  2VUM J;  3LL7 A;  4LK1 F;  1HST A;  2DOA A;  2FOW A;  3BTL A;  4DZJ A;  3A01 B;  1WPK A;  2M1B A;  4XOR A;  2RNJ A;  1IGN A;  1W36 D;  4NUB A;  1Y0N A;  4RGS A;  3TDZ C;  5HLH A;  4DNC A;  1YO5 C;  1T95 A;  3B73 A;  2BGC A;  4A3C J;  4PSW A;  1R4M B;  3CTA A;  1NK3 P;  3DKX A;  4ITV A;  4AWX B;  5ED4 A;  3OIQ A;  3GFI A;  5B3S H;  2XAS A;  2P4W A;  3H5R A;  1G3S A;  3B6C A;  3G71 I;  1LKX A;  2H1L A;  5ICE A;  1CF7 A;  2KHM A;  1QZY A;  4EQQ A;  1TNS A;  4XLA A;  1FBU A;  2CJJ A;  4EM0 B;  4M3B A;  2F5V A;  2R93 J;  4WWC A;  2GM4 A;  3CES A;  2XPW A;  1FT9 A;  2PMH A;  1WI3 A;  2X4H A;  3RI4 A;  1PVE A;  3JSO A;  4E7J A;  1L3L A;  2E1C A;  3REO A;  3GWZ A;  1B1B A;  2NNY A;  2OTJ I;  5EG0 B;  4A3K J;  3WGI A;  4FE4 A;  2ESH A;  4D9J A;  1Z1D A;  2L02 A;  4ZJZ A;  2XGC A;  3W6K B;  3CCY A;  2ID3 A;  1OCR H;  2M8E A;  3BJO A;  3I4N J;  5H6Q A;  2HPM A;  3SEQ A;  2BY1 A;  3KLN A;  3IWF A;  4Y33 A;  1DU6 A;  1ONV A;  3RIR A;  3OYE A;  1FOX A;  4HYE A;  1ODD A;  2Y31 A;  5JI6 A;  1FNN A;  1S3J A;  3QRF F;  2QBY A;  1IXS B;  4PUS A;  4A3B J;  4F91 B;  3F8M A;  2VJ4 A;  3ZQH A;  1OYI A;  3BY6 A;  4A3E J;  3K4L A;  5HDK A;  2IJL A;  3JRC A;  1SFU A;  1SFE A;  2ZME A;  3PFY A;  6PAX A;  4UNO A;  2CU7 A;  2LFB A;  5FD5 A;  1BI0 A;  4RDU A;  3VYT B;  2F4O B;  2W00 A;  3BG6 A;  1K6O A;  3HOX J;  1BR2 A;  2GOX B;  2EK5 A;  2LY9 A;  1K78 B;  2V9V A;  1XGO A;  1MMN A;  2RKH A;  2FBK A;  1EH8 A;  2K27 A;  1A04 A;  3OIP A;  2VIX A;  2EZH A;  1SD5 A;  1UFM A;  4A6D A;  5BS6 A;  2NNN A;  4MGR A;  3T1B A;  4GRI A;  5FGM A;  1YE9 A;  4A0Z A;  1JKR C;  1UEL B;  2FSW A;  1P92 A;  2XF6 A;  1HCR A;  2EZK A;  3CP8 A;  2AQE A;  5L3D A;  1UZC A;  2QGU A;  3L2V A;  4UB6 C;  4EJO A;  4B47 A;  1D0Z A;  1Y8Q B;  5C3E J;  5FRO A;  3QP5 A;  3OIO A;  1KU7 A;  4CHU A;  4RAZ A;  4QPO A;  2JVG A;  4ZDP A;  2E34 A;  2VBW A;  1SD7 A;  2XC7 A;  5FLX Z;  2LD5 A;  1S72 I;  1M1E B;  3H5N A;  2CV0 A;  2FUG 2;  4XSZ F;  3MN2 A;  3GTG J;  2LKX A;  3CF5 F;  4ZYH A;  2MGQ A;  1XTA A;  4HF2 A;  2I5U A;  1YS6 A;  2Y0S A;  3V7R A;  2Z2S B;  1R49 A;  2ZSH B;  3R61 A;  2GWR A;  3EQL F;  1D5V A;  1G6N A;  1YG2 A;  4NNJ A;  4DIQ A;  1UJ8 A;  3L7W A;  4RGR A;  4C3I J;  4ENJ A;  3CMM A;  5FLX K;  1STZ A;  2R0Q C;  2DQL A;  4MLO A;  1P4A A;  3OOU A;  1N25 A;  1XG1 A;  5E3M A;  3G2B A;  3BJ6 A;  3SJM A;  5HDG A;  4ZTF A;  3OS2 A;  4V19 K;  3L2W A;  5KNL A;  3AL0 B;  4F52 A;  1D5Y A;  1H0M A;  1X1C A;  3JTH A;  5FLV A;  2JA7 J;  4BYY A;  2VL8 A;  3QAH A;  5D5W B;  4I7H A;  4OIO F;  1W7P A;  3DPL C;  3V7C A;  4RB2 C;  3VPR A;  2M8G X;  2HOE A;  5FFX A;  3JAM Z;  2UZK A;  5IP9 J;  1A5J A;  4EJT A;  4P96 A;  3ZP5 A;  3RKQ A;  3BZC A;  1JI8 A;  5D5V B;  2HZD A;  5FFZ A;  1WI9 A;  2O8K A;  2Q1Z B;  4U87 A;  3NAR A;  2BVL A;  2JQ7 A;  2KIM A;  1J09 A;  1R4N B;  4HX7 A;  4RB0 A;  4LB6 B;  1LEB A;  1IW7 F;  1S7E A;  5HDN A;  2QLZ A;  3G1O A;  3L00 A;  2ZJ2 A;  3JAM K;  2HVQ A;  3BPX A;  1XX5 A;  3GTK J;  3WE2 A;  5DTD A;  2L9N A;  2LBF A;  1E0E A;  3BP8 A;  4LK0 F;  3E6D A;  4E7H A;  2X9D A;  5E1W A;  1OYY A;  2ZBK A;  3MZY A;  4RGU A;  1NH3 A;  3H9J A;  1Z3Y A;  3PNV A;  4KIF A;  2VPR A;  4JQF A;  5DCM B;  4KMF A;  3IHU A;  1GHC A;  2DFH A;  4AUX A;  3H5A A;  3K1M A;  3IH3 A;  2CRG A;  5CVR A;  5J47 A;  1ON1 A;  1OCO H;  2Z5U A;  3CDL A;  3MD2 A;  4ESF A;  2IS2 A;  2FNA A;  4DYR A;  1LE8 A;  1ZN2 A;  3FKJ A;  2D2W A;  4UHT A;  1QO0 D;  2QF7 A;  2VB6 A;  3GXO A;  1G8X A;  4YII A;  2E2H J;  5KHD A;  3GTM J;  1U9O A;  2CV2 A;  2VQG A;  4IRH A;  3S14 J;  3HIF A;  1K61 A;  2MD0 A;  1VQL I;  2EA4 A;  2OQR A;  1YX5 A;  5FD6 A;  1YIO A;  4QPQ A;  1XCB A;  2EV0 A;  3CCQ I;  1ETW A;  2LH9 A;  3IV5 A;  3GTJ J;  3HEF A;  3SQN A;  5M5Y J;  3OSG A;  1R1T A;  1KA8 A;  2GA2 A;  3EUH C;  5IOY A;  4ENK A;  1IAW A;  4MTE A;  3I56 I;  2VI6 A;  4Y4R A;  1LDD A;  1R58 A;  1BC7 C;  4DGW B;  1OIS A;  4IX7 A;  2IVM A;  3HL2 A;  1DQU A;  3AG3 H;  3I5U A;  1J7K A;  3CCE I;  3NEU A;  1VQ6 I;  2GXA A;  2FD5 A;  3W2W A;  3MAJ A;  3O8G A;  1IF1 A;  1GVJ A;  4BH9 A;  3WTY C;  3SDB A;  1UCR A;  3S2H J;  2MG4 A;  2XGE A;  3MCZ A;  1VQK I;  3RKY A;  2L7K A;  3R0A A;  4C30 A;  1FBS A;  1VQ9 I;  4BKX A;  3QOD A;  4BE1 A;  2KFD A;  2LY2 A;  2UUZ A;  1WZ2 A;  2EZL A;  4B1R A;  2VON A;  2AO9 A;  4HF0 A;  5J4V A;  4DOZ A;  4A0Y A;  2PQ8 A;  3HDD A;  2VKE A;  4A3M J;  5D4R A;  4BE2 A;  4QIW N;  2HQ5 A;  2O03 A;  2QYO A;  5LGN A;  4M9Z A;  4GYI A;  4RAF A;  2O7O A;  2M2E A;  4EEF G;  4LMY A;  2VBY A;  4AC0 A;  4NHJ A;  2KJB A;  3HOW J;  3BDD A;  3LA7 A;  4EAT A;  4F3Q A;  4XOP A;  3E6C C;  2IA2 A;  3HKZ N;  3S1R J;  2V79 A;  1K83 J;  4JX5 A;  4EVI A;  1QGP A;  3BJA A;  2KP6 A;  4M72 A;  3X2Q H;  5GTI C;  4OOI A;  3J7Y J;  3HRM A;  4IQJ A;  1P7J A;  2UV1 A;  5J8F A;  1DU0 A;  1UG0 A;  1CF7 B;  1ZRC A;  4F7Z A;  3BOQ A;  2XAF A;  2QVO A;  3EYI A;  3BR3 A;  1R71 A;  3J81 K;  2PLY A;  3A01 A;  2HYG D;  2EFP A;  1YW9 A;  2QSG X;  3G4S I;  4P9U A;  3IL2 A;  3A0B C;  1UST A;  2OF7 A;  4BJ5 C;  3MZH A;  1PP7 U;  3FXM A;  1T2K A;  3PFI A;  5KVR A;  1Q1H A;  3ZMV A;  1I1S A;  2XKP A;  2EIL H;  3B6A A;  3QYF A;  4QSH A;  1FMW A;  2NS8 A;  3LSR A;  1VQ8 I;  1IRX A;  4LD5 A;  3I54 A;  3HUG B;  1I39 A;  2PI0 A;  4KIG A;  3HOZ J;  3C7J A;  1T98 A;  4N4N B;  2QBY B;  2JA2 A;  1Z0X A;  1ON2 A;  4XLE A;  1EKE A;  3HXL A;  2OBP A;  1XDU A;  1UMQ A;  3IAS 2;  4ESB A;  3MKW B;  2ECC A;  3CCR I;  2PJR B;  4M71 A;  4P5O A;  2VT2 A;  5ERI A;  2FEZ A;  1DGW Y;  1LVK A;  4DYQ A;  4RB1 A;  1H8A C;  3GTO J;  1FOW A;  1YIJ I;  2VBX A;  4DBR A;  1T0F C;  2NYX A;  2HPI A;  2DA4 A;  4M74 A;  5DD8 A;  3V4G A;  2DPD A;  3ZPL A;  2O5R A;  4IKF A;  2FQ3 A;  4M73 A;  3F8F A;  3EDP A;  1X1A A;  3RTR A;  1I6X A;  1Y56 A;  2DT5 A;  4KIC A;  3N97 A;  2QQB A;  1H89 C;  2FQ4 A;  2JSC A;  2M34 A;  2HDC A;  4EGY A;  4BXU A;  1YRN A;  1POG A;  1E3H A;  2KRH A;  5TGT A;  3S15 J;  1ETQ A;  5B1A H;  1R5G A;  5ICC A;  3H1C A;  1VQM I;  4ZYG A;  2CGP A;  4I6Z A;  2YU9 J;  1U6G A;  3ROU A;  5H20 A;  1OKR A;  3CCM I;  1TQI A;  3CUQ C;  5EZH A;  2ZCW A;  3UNG C;  1K78 A;  2XF7 A;  4FET A;  4PJL A;  2R5Y A;  4XRS G;  2E1O A;  1Z91 A;  3FX3 A;  4IOA F;  1QPM A;  1RPW A;  5M3M J;  3ZOB A;  1BIA A;  4P9F A;  3E5X A;  3RYR A;  4BE0 A;  1QNT A;  4PJJ A;  3OYL A;  1T56 A;  4FQG A;  3TP0 A;  3S1Q J;  2LF8 A;  4RM2 A;  2K9M A;  3LNQ A;  3EUA A;  3RPQ A;  2NRA C;  3S3O A;  1ETV A;  3CCV I;  3F8C A;  1N77 A;  3TGN A;  2X6Y A;  1Y1V J;  4BHP A;  3WTT C;  2I8D A;  2PMZ A;  4FIS A;  5LFA A;  2EFW A;  2P5V A;  5C4J J;  1YW7 A;  3SZG A;  4QTR A;  4AD9 A;  5J1U A;  1TTY A;  5EF6 A;  3L2R A;  3W6V A;  2W7N A;  4Q4Z F;  1HQC A;  1FMV A;  2R92 J;  1XGM A;  2WB1 A;  4Q5S F;  3QYE A;  1B9N A;  2DI3 A;  1GXP A;  2QEN A;  3S2D J;  2COB A;  1W4M A;  3ERE D;  1W7P B;  5KCM A;  4XN0 A;  3GTQ J;  1LJ9 A;  1SAN A;  4IF4 A;  1MBF A;  1D8J A;  5TIS C;  2IXS A;  1LFP A;  3Q0U A;  2LP0 A;  4HNU A;  3LST A;  5IT9 Z;  3CC4 I;  3VSL A;  5EEH A;  3EUH A;  4UXN A;  2LG4 A;  1ZK8 A;  1BI1 A;  2VT3 A;  3DCF A;  5EEG A;  4IL6 C;  3KYL A;  1YLF A;  1O3R A;  3BWG A;  3QOE A;  1SMT A;  2V9K A;  1OFC X;  1KU9 A;  5FJ8 J;  4O6J A;  2K3F A;  3ZQQ A;  5IT9 K;  2DJN A;  3IC7 A;  1YTY A;  2Q8K A;  4GCV A;  2M7B A;  1OPC A;  4CZC A;  1DGR M;  2ELK A;  2QKL B;  3K10 A;  1JJ6 C;  1BN5 A;  4WF2 A;  2F5F A;  2J5P A;  1TQM A;  4I0A A;  2HS5 A;  2MYS A;  2DPU A;  1IZ1 A;  2RC4 A;  4D5C A;  5DEQ A;  1MMG A;  2IGN A;  3FDY A;  1FP2 A;  1ZGJ A;  3AFH A;  3DBR B;  4KT5 C;  4I2O A;  2HDD A;  3WGH A;  4AYB N;  2LTP A;  4I99 C;  2MBF A;  5K5Q A;  3U1D A;  1RET A;  2IS1 A;  1X3U A;  2P0W A;  2ZXJ A;  3RYP A;  1CQT A;  2XRO A;  5D8L B;  1U2W A;  3VEP A;  1ZTR A;  4E70 A;  1YQA A;  2XPU A;  2DN0 A;  2ZXH A;  4A3J J;  3HSF A;  1J59 A;  5DUI A;  2IPQ X;  3VOD A;  3IRQ A;  1TW3 A;  2DA6 A;  3ZMT A;  1IRF A;  4AM3 A;  3HRS A;  5F27 A;  1V3F A;  5DCM A;  2BXY A;  1XPX A;  2VE9 A;  4BNC A;  1IXC A;  3DBL B;  4E6K G;  4ZYA A;  1HKS A;  1ERD A;  2DOE A;  3MKL A;  2DYS H;  2GA1 A;  1ZRE A;  2E19 A;  4XLC A;  4BHB A;  1HDD C;  4O5V A;  2ZNY A;  5IPA A;  3GX4 X;  2TCT A;  3K69 A;  5ICF A;  2LVS A;  3ZN1 A;  1QHH D;  2HOS A;  3JR9 A;  3DF8 A;  2EWN A;  2VOD A;  3KIO A;  1FC3 A;  1PJR A;  2R7Z J;  2UWM A;  4DQ2 A;  5EEA A;  5E3L A;  3OS0 A;  4IOC F;  1EF4 A;  2ELJ A;  4B8X A;  4JOM A;  2R7R A;  1KU2 A;  3KP4 A;  1HXD A;  1T08 B;  4XLP F;  2CQK A;  2CYY A;  1DP3 A;  2PMZ N;  4X0G A;  2ETH A;  1WVR A;  4BAY A;  4L5E A;  4AIH A;  2OJE D;  1W36 C;  2HZT A;  4DJA A;  3BR5 A;  1A35 A;  1KQ9 A;  4M3E A;  3FK7 A;  2H27 A;  2L5Q A;  1OCC H;  1BC8 C;  2WAD A;  3B02 A;  1RNL A;  3K6G A;  4PJM A;  4I76 A;  1LVA A;  3S2W A;  1T0F A;  4LLL A;  1UAA A;  2EFN A;  1K6Y A;  1SVO A;  2A5Y B;  2NVT J;  5K7F A;  2W4S A;  1O7F A;  2PJP A;  3KP6 A;  4KDP A;  1WJA A;  5FRN A;  3L09 A;  1F4K A;  4F55 A;  3CCS I;  3P9C A;  5DUK A;  2G7H A;  3V8L A;  3JRG A;  2O9L A;  3F8N A;  2CMP A;  2K40 A;  5JHF A;  3A2K A;  3M1E A;  1W5S A;  2VC0 A;  2O6G E;  3RKW A;  4HQM A;  1O3T A;  5CVU A;  3GFL A;  4A6E A;  1FZP B;  2EV5 A;  1JJ8 C;  5K7H A;  4HNV A;  3JW4 A;  3C2G A;  1TWH J;  1WJ5 A;  1W0U A;  4BXF A;  1UHS A;  3VOE A;  4U0W A;  1KQ8 A;  2N8G A;  2XDV A;  3HOV J;  2YUS A;  3CLO A;  3K4C A;  3A03 A;  3S1N J;  5IYB J;  3EUK L;  2PFB A;  2W84 A;  2CQQ A;  1HW5 A;  4LG0 B;  3KX2 A;  1V54 H;  2HR3 A;  3ASN H;  1GT0 C;  2G7U A;  3GBG A;  2M9H A;  1E3P A;  4IEJ A;  1TC3 C;  4MEY F;  2DMU A;  4XOT A;  1WHU A;  3BG9 A;  2R7T A;  3RJP A;  3CZ6 A;  2Y0M A;  4C2M J;  3A02 A;  1A6I A;  1W7P D;  1WJD A;  3E6M A;  3DTK A;  3OYD A;  4RAY A;  1BJZ A;  3FBI B;  1WJB A;  3FXU A;  3PL8 A;  4I09 A;  4KFC A;  2R7Q A;  3GF2 A;  1LUJ B;  1K7A A;  4IHX A;  1U8R A;  3AAF A;  5AON A;  5DDG A;  1QA6 A;  1TP4 A;  2VOP A;  2CW8 A;  4FE7 A;  4E7L A;  3ULQ B;  2BYV E;  1BIB A;  4XLN F;  3ML6 A;  3GZ6 A;  2A69 F;  3RQ4 A;  3LA3 A;  3A0H C;  4XKB A;  3ZMS A;  2TDX A;  3MQ0 A;  3WTS C;  1HA8 A;  5ILS A;  1Y1W J;  2Z16 A;  2IGM A;  3WTX C;  1DP7 P;  4UVC A;  3FBN B;  1I3A A;  1I5Z A;  1LQ1 A;  2K9L A;  4EM1 A;  2Z9O A;  2HQN A;  1U5T C;  1NHA A;  2GBY A;  1WQ2 A;  3O8H A;  4J19 A;  3L1P A;  2XV4 S;  1VFC A;  3HUG A;  3ABK H;  2VN2 A;  3PM1 A;  3DU6 A;  2RAE A;  3ABM H;  3FK6 A;  4ZDL A;  3JRD A;  2IEK A;  1JKQ C;  3OYH A;  1JXS A;  1YRN B;  4MO7 A;  1U78 A;  2P6T A;  4EJW A;  4G7O F;  4BAC A;  5E79 C;  4WXC A;  1H9G A;  2PJR A;  2IBD A;  4BGD A;  1Z3X A;  2E5Z A;  3LSH A;  4EV0 A;  4ZZD A;  5KK1 A;  1J5Y A;  5CQE A;  4CCL A;  1G3Y A;  1JKO C;  2R7V A;  3MZ8 A;  1YOV B;  5IYD J;  1FOY A;  2ZFW A;  4B09 A;  4CCO A;  1TW2 A;  5D6E A;  4HRI A;  5EYR A;  5LRS A;  4ENN A;  2WAQ A;  2JT1 A;  3VYS B;  1KON A;  1HW1 A;  2DJI A;  2R5Y B;  4XN3 A;  2ADU A;  2XAQ A;  3SYT A;  3TBI A;  3O3K A;  1E2X A;  1HOM A;  3V8K A;  2B0L A;  5JLW A;  3LSM A;  3WTU C;  4XRF A;  5GTH C;  4CH7 A;  1MGT A;  3GFJ A;  3KLO A;  2H6C A;  5EGO A;  4OU0 A;  1IN6 A;  3OL4 A;  2ECB A;  2RRE A;  3CUO A;  2ZXI A;  1REP C;  2V9P A;  2LSO A;  5IY5 H;  4H0E A;  2M5W A;  4HBL A;  2NXN B;  1USS A;  4BS9 A;  3HTS B;  2MLG A;  4B48 A;  3TED A;  3BPV A;  3UR3 C;  5JHU A;  1K4T A;  4ETS A;  1FYK A;  2GQQ A;  1APL C;  1ZRD A;  2DTR A;  4J01 A;  2EH3 A;  1SFO J;  2XSJ C;  2OZU A;  3S3N A;  2QKM B;  3MFK A;  5F0F A;  3TMO A;  3HOS A;  2DXI A;  2JJ7 A;  1S6L A;  1E17 A;  2HQR A;  1Z67 A;  1P9Q C;  4BQO A;  1MD0 A;  1TWF J;  3VYU B;  1PUF B;  4CSW A;  3N05 A;  2DA1 A;  4HX4 A;  1F9N A;  2GLO A;  4G6Q A;  4XRS A;  5TJJ A;  2W48 A;  3ZQG A;  5LHG A;  2DA3 A;  1ZG3 A;  2Z1D A;  4A5N A;  2A6H F;  5J1R A;  5HS7 A;  2GIZ A;  4A12 A;  3LAJ A;  4A3L J;  1R9T J;  4XNF A;  1AWC A;  3BG3 A;  4UVB A;  3G1L A;  2FML A;  3OYF A;  4M6X A;  1FP1 D;  2XVC A;  2MSY A;  1RZ4 A;  4MIM A;  2R7X A;  4U7B A;  1BM9 A;  5IP7 J;  2Y75 A;  2QEX I;  1YW8 A;  2AHQ A;  1TT5 B;  5IT3 A;  2DDB A;  3KYC B;  2V1D A;  1K79 A;  3DLA A;  2VBZ A;  5CKT A;  1ZQ3 P;  1MND A;  1I27 A;  3GVA A;  3GZN B;  1O7L A;  2LY1 A;  1B8I A;  5JLX A;  1U9N A;  2MAB A;  3U1K A;  1R23 A;  4Y13 A;  2V6C A;  1YJ9 I;  3TP3 A;  3LOC A;  3HTU A;  2NVQ J;  2EPF A;  5M5X J;  3BG5 A;  2VQL A;  2DT6 A;  1UG2 A;  3FZV A;  1QVT A;  4N0B A;  5D5U B;  2HXO A;  3T8T A;  1WKM A;  4HV5 A;  1FSE A;  1TL8 A;  2HDW A;  3KP2 A;  2LMD A;  1MKM A;  4HPQ A;  3W2A A;  2A5W A;  2Y30 A;  1B9M A;  3Q0V A;  1T6S A;  1RR8 C;  2KZG A;  3RQI A;  4MEX F;  4ABZ A;  2XB5 A;  3GLX A;  2QSF X;  3L2Q A;  4HDU A;  3CJN A;  2JTV A;  5F6F A;  4JP0 A;  3ZXS A;  2CWE A;  5E20 A;  1G3T A;  3RCO A;  2LKS A;  1LFU P;  2KKO A;  1R6R A;  4R8H A;  2ZO4 A;  3BR0 A;  5FKN A;  4FCY A;  1AU7 A;  3SEZ A;  2F48 A;  4F93 B;  4ZDO A;  2ZB9 A;  3TO7 A;  1MH4 A;  2YX7 A;  4Q48 A;  2KT0 A;  1SFX A;  2GXG A;  2IGK A;  4A3I J;  2OZ6 A;  1TZL A;  2DMN A;  3DLL F;  1IDZ A;  2DMT A;  4X6A J;  2FU4 A;  3HHG A;  3OS1 A;  4IHT A;  4IHS A;  5HNF A;  1FX7 A;  2I10 A;  2DDA A;  3PNT A;  4CDG A;  4HEA 2;  2EIN H;  1SD4 A;  1ZG1 A;  3G1M A;  1NTC A;  2JWT A;  2P7C B;  1OLT A;  5EDN A;  4MFE A;  2L3D A;  3PQK A;  4W97 A;  4KA4 A;  4LIV A;  5CQG A;  4WXD A;  1RES A;  2BV6 A;  1LNW A;  2HNH A;  3KEO A;  4OWR B;  2VJJ A;  5AIQ A;  2EB7 A;  3HSE A;  2M7A A;  4BY7 J;  2JPB A;  3SFZ A;  4OAY A;  5B1B H;  3CO6 C;  4L9J A;  2BBY A;  2RDP A;  3EYY A;  2XUB A;  4C3H J;  3C18 A;  2IT0 A;  5ICG A;  4A3F J;  5GPC A;  2XIG A;  1U5T A;  2Y0S N;  3PIP F;  4HV6 A;  2HQA A;  2NS0 A;  1FY7 A;  2OUM A;  4L9V A;  5LRR A;  1XGS A;  2G9W A;  5E1X A;  2BHY A;  1J0R A;  4CUG A;  2RVC A;  1LFB A;  1S29 A;  2H8R A;  2X6W A;  4NQW B;  2F4M B;  5KAI C;  2IP2 A;  2FMY A;  3HG9 A;  1KU3 A;  1R1U A;  2LRE A;  5L3C A;  3I4M J;  3MWM A;  5GPA A;  4L5J A;  1O3Q A;  4UVA A;  4CO8 A;  1S7O A;  5E8G A;  3CUQ B;  4GO1 A;  2CH0 A;  1HDP A;  2EFO A;  2DT7 B;  3CO7 C;  1DDN A;  3Q9S A;  2IS4 A;  2VOO A;  3K2Z A;  5A2Q Z;  2H94 A;  1BL0 A;  2CUZ A;  4IQ4 A;  3CJQ B;  1WGX A;  3ZQF A;  2VXD A;  3PO3 J;  3RZD J;  1IRG A;  4CYC B;  2M0M A;  2K85 A;  3Q3S A;  2X1D A;  3SZP A;  4L0Y B;  3W2V A;  2PBI A;  5LD2 C;  1ZKG A;  5J3L A;  5A2Q K;  4AVP A;  2DMP A;  3WTW C;  3QPS A;  4OIR F;  2DW4 A;  4EGZ A;  2Z33 A;  4RBO A;  2O61 A;  2UXX A;  1ETO A;  3J7Z I;  1XSD A;  2K5C A;  4LG0 A;  3FIS A;  2ZXW H;  3IKV A;  1WCM J;  3KPH A;  5D5X B;  5DM6 F;  3FKI J;  2K9N A;  4II3 A;  1VF9 A;  4I0B A;  2CUF A;  4M6Y A;  2R7O A;  1VQP I;  1ETY A;  1YJW I;  5F1J A;  2ZC2 A;  2CS3 A;  2FRH A;  2HVS A;  4FAS D;  1FSH A;  2KLO A;  3H36 A;  2CV1 A;  4NC8 A;  1GLN A;  1PP8 F;  3TOB A;  1R22 A;  3O6B B;  3S8P A;  1IV6 A;  3D0S A;  5H2F C;  1SVL A;  2DO7 A;  3HM5 A;  3E7L A;  2HVR A;  1H9T A;  1MBH A;  3SDG A;  4BXX J;  4FX0 A;  1DPR A;  5F0C A;  2QSH X;  4P1W A;  1XC5 A;  3Q9V A;  2ISY A;  1W5C C;  4EJV A;  2HKX A;  2MC3 A;  1Z05 A;  2PG4 A;  2GIV A;  3NQO A;  1N75 A;  1P2F A;  1P6R A;  5C44 J;  1LDK B;  2B7E A;  3P5J A;  3WU0 A;  1T33 A;  2R7U A;  1S9H A;  2E7X A;  1JKP C;  1D0Y A;  3H92 A;  1GV5 A;  3ZMU A;  2DA5 A;  1Z7U A;  2Q2E A;  3GZ5 A;  3TL4 X;  3LQR A;  2IW5 A;  1GDT A;  1KQ0 A;  2BEO A;  1TLH B;  3DPU A;  5HLI A;  3ZN0 A;  2P6S A;  2E36 A;  5HS8 A;  3IH4 A;  2K02 A;  3QP6 A;  2ZJQ F;  1BI2 A;  3ZGK A;  4D5F A;  5EGO B;  3A4C A;  2BY2 A;  3NWT A;  1QZZ A;  2LOO A;  2E1M C;  2ZJR F;  4FHT A;  3U2R A;  1G59 A;  2OA4 A;  3M9A A;  2BVM A;  2CW7 A;  3S93 A;  3QU6 A;  1DUX C;  1JUS A;  3BG7 A;  1MJ9 A;  3J7A Y;  3M4O J;  3S17 J;  2ELH A;  5DYM A;  2QCO A;  2V6E A;  2CW0 F;  2MA3 A;  1RUN A;  3F6O A;  4HDV A;  3I9V 2;  2M4G A;  1XN7 A;  3IH2 A;  3FXL A;  3FMS A;  4DZP A;  2NAZ A;  2M87 A;  5GAG J;  1ZGW A;  1LPQ A;  1FTZ A;  4CCK A;  1X58 A;  2NVX J;  2CQX A;  4GDF A;  1HC8 A;  2LKP A;  5FKK A;  3LSI A;  1IUF A;  2EIK H;  3TOA A;  2VLA A;  2O3F A;  2L4M A;  1W1W E;  2LYC A;  1XSX A;  4HSR A;  5FO5 A;  4HW0 A;  2IA0 A;  3M8F A;  1SAU A;  3WOD F;  5FB2 A;  5BMZ A;  2IRF G;  2RN7 A;  1DPU A;  1FIA A;  3GFM A;  3FIW A;  1SEU A;  4CXF A;  3RSN A;  3BCA A;  4Y3O A;  2WV0 A;  4RGX A;  3IWZ A;  4DBQ A;  1JTX A;  5E18 F;  3AG2 H;  3GW2 A;  4U88 A;  2DQR A;  4HLY A;  2KQR A;  2L54 A;  2X6O A;  4WXH A;  2MH2 A;  1G4D A;  3JRH A;  3BTI A;  1X19 A;  3OWT A;  1Y8R B;  2MW8 A;  2ME0 A;  1IJW C;  4M3F A;  3KZZ A;  4BL0 B;  4CA0 A;  1YJN I;  4R1H A;  1Y0U A;  3ONQ A;  3D1N I;  1J2X A;  2EFQ A;  2A05 A;  4BEH B;  1WH7 A;  3E0J B;  3I4P A;  3DPT A;  1PUF A;  2KZV A;  2YU3 A;  1NK2 P;  1A6Q A;  3FHN A;  3K7A J;  4B3X A;  5E8I A;  1B8I B;  3DP7 A;  3MVP A;  2XKO A;  3DBH B;  3OSF A;  4Z2Y A;  4LIT A;  3FF5 A;  1VQO I;  1MH3 A;  1XGN A;  4IO9 F;  4OMY A;  2D1H A;  2PN6 A;  3L9F A;  2CO5 A;  1C0W A;  4E7I A;  5LBQ A;  5L3G A;  1XMX A;  2FA5 A;  3BR2 A;  3HBL A;  1Z77 A;  1GV2 A;  3DTI A;  2HTS A;  4U0Y A;  2DOD A;  3PSI A;  2ZME C;  1IUY A;  1R7J A;  1TQP A;  1BR1 A;  2CQ7 A;  1T8I A;  1B72 B;  5HLT A;  4E7S A;  1IN4 A;  3V8J A;  3BQZ A;  2GOM A;  5HNH A;  1EV7 A;  4AU7 A;  2JA8 J;  3LWF A;  1X1P A;  4I98 B;  5H6R A;  4WK8 F;  2L7Z A;  1JUP A;  1SMY F;  1AOY A;  3KE2 A;  3ECO A;  2QQA A;  3S16 J;  2ME6 A;  1WJF A;  2W82 A;  4M9S A;  5F08 A;  3L2C A;  1QBJ A;  2LRD A;  4PGH A;  1WRJ A;  2QQ9 A;  2BY3 A;  4X1E A;  2P5L C;  2YSR A;  3ZRG A;  4A5M A;  1NG6 A;  3MMY B;  3EPZ A;  2WBM A;  2DU9 A;  4II2 A;  3CCJ I;  2A07 F;  4UY8 I;  3VYR B;  4HLX A;  5BOX A;  4KNY A;  3HGY A;  2H6B A;  2L2O A;  2DFI A;  2WAF A;  3ABT A;  3BCB A;  5DS9 A;  2ISZ A;  5BNG A;  4WCG A;  4JBA A;  1F36 A;  2V4J C;  3F21 A;  1IV8 A;  1B4A A;  2X51 A;  5K5O A;  3OR2 C;  1ETK A;  3ESW B;  2M45 A;  3OYI A;  4IRI A;  1FBQ A;  3C3W A;  1U5T B;  2BZT A;  2JRT A;  3H9Q A;  2OTL I;  3HZJ A;  1BOB A;  1Z6R A;  2L9S A;  5CLS A;  1X4P A;  1MBE A;  3WE3 A;  2HOA A;  4UUS A;  5B5E C;  5CJ9 A;  3GLL A;  4QWQ A;  4CZZ A;  3D5L A;  4KIB A;  1IDY A;  3BZ6 A;  3QWL A;  3ZQC A;  3OMY A;  1ORK A;  3W6J B;  4ENM A;  1LDJ A;  2W25 A;  5HVQ C;  4A3G J;  2WB1 N;  2XGX A;  5DD4 A;  1Z21 A;  3K4B A;  3DKY A;  4JX4 A;  3P7N A;  3OYN A;  2IA1 A;  4XR6 A;  4A2U A;  2EBI A;  1RKT A;  2VAS A;  4IXA A;  2F5E A;  5IYC J;  4GFB A;  3TW7 A;  3KP3 A;  3OYB A;  1JGS A;  1BJA A;  1KYW A;  3SHF A;  3LA2 A;  4D7M A;  5E17 F;  1D1A A;  2EIJ H;  2OC6 A;  2QUF A;  2XB0 X;  4HNT A;  4YFN F;  4PSX A;  4HQE A;  4NQW A;  4YFK F;  4ZH4 F;  4CGZ A;  3VDX A;  3GCM A;  4N4O B;  2R5Z B;  5D6F A;  1XSV A;  1F5T A;  3D5S C;  3DQV C;  4E4H A;  3I64 A;  4U0V A;  4D1Q A;  1O57 A;  3F3X A;  3FHZ A;  1FTT A;  2F6C A;  5F0H A;  2VPL A;  3K4M A;  2A6T A;  3HSR A;  5B66 C;  1SAX A;  2L0K A;  3DEE A;  1X2N A;  3DV8 A;  3CMA I;  2ZJP F;  1Y39 A;  4KIT B;  4PDK A;  2IGO A;  3CUQ A;  3EET A;  2DA7 A;  1R1V A;  3K70 D;  2OU2 A;  3PSF A;  1TNT A;  1V5F A;  4YIR X;  2FF4 A;  1D1B A;  1KGS A;  3QOP A;  1R36 A;  3M07 A;  1OQY A;  4CYC A;  3FXK A;  4BQA A;  4B43 A;  2FE3 A;  3SZT A;  2VQH A;  2JRM A;  2DYR H;  1XB4 A;  5AIP A;  3QPH A;  3COA C;  5E1Z B;  1MZB A;  2STW A;  3M1C A;  4AID A;  2PMU A;  2WC2 A;  3WGG A;  2XPV A;  4A93 J;  3H35 A;  1QU3 A;  1XD7 A;  3BC8 A;  4BBR J;  4F92 B;  2JK3 A;  2CQN A;  2KDZ A;  1T39 A;  2FXA A;  2E2I J;  3ASO H;  2KIS A;  2KMU A;  4MHG A;  1UHM A;  1TWA J;  4LJZ F;  4N9I A;  2E71 A;  2XAU A;  3PJR A;  4KIS A;  1YYV A;  1WSU A;  3C2H A;  1XMA A;  4KN4 X;  4XQF A;  2ZNZ A;  3I0T A;  3E1S A;  3HRU A;  4CYD A;  1HKT A;  2H1K A;  5LEJ A;  3VWB A;  3K0L A;  2D45 A;  2GAU A;  4AIK A;  3HOU J;  2VKD A;  3OR1 C;  4G9Y A;  2L01 A;  3L2U A;  2AS5 F;  2Q2E B;  3JSP A;  2ESN A;  4JYK A;  4OIQ F;  3BRO A;  2CFX A;  3GUD A;  2ZFU A;  1ZR4 A;  4NC6 A;  2XRN A;  5TRD A;  4BY1 J;  4ZYD A;  2K4J A;  4UUV A;  4R79 A;  5F64 A;  4P55 A;  2W1O A;  2V1X A;  3TO6 A;  1FIP A;  1NG7 A;  4EMS A;  3WG7 H;  2F2E A;  3R0J A;  3HHH A;  3LMM A;  5FKL A;  1QRY A;  3KET A;  5JR3 A;  4BDY A;  3R60 A;  3H3V K;  5HLG A;  4PGG A;  2RNG A;  2DFE A;  1VZ0 A;  5GAD J;  1V4R A;  3ZQI A;  2LK2 A;  3BTJ A;  4KYW A;  1RRJ A;  4S0H B;  2CUJ A;  3R6S A;  5M3F J;  5HOD A;  4G7H F;  2K9S A;  2WY8 Q;  5JVG F;  1MNM C;  1UHW A;  2V1N A;  2VC1 A;  3F22 A;  4C2T A;  5KAF C;  2VJ5 A;  2V7F A;  1D1C A;  3FM3 A;  4XK4 A;  4BQN A;  3JRA A;  1ACI A;  1Z6T A;  1QZE A;  3CMY A;  1TWG J;  1XMK A;  1IRZ A;  3OYJ A;  4RLQ A;  1LB2 A;  1ITY A;  3CF2 A;  1ZYR F;  3F23 A;  1ZLK A;  5J1Y A;  3RPU A;  1MDM A;  3QPT A;  1D8K A;  1B6A A;  5M5W J;  2HI3 A;  2A6E F;  3CDH A;  3E5Q A;  2M0C A;  4RLF A;  2DLL A;  2YX4 A;  4E7Z A;  2ZKZ A;  3K1N A;  4RM3 A;  2W85 A;  3NWS A;  3IRR A;  2NOJ B;  1ZEL A;  1TBX A;  2DMQ A;  3Q0W A;  4LIU A;  5CVJ A;  3V7S A;  3PIO F;  4Z6Y A;  4DYC A;  1MMS A;  2W57 A;  4XKV A;  2GXB A;  4CIC A;  4YRV A;  2B9S A;  3WU1 B;  2AXL A;  5LHI A;  3GTP J;  4PJ0 C;  2YPR A;  2X6X A;  3FM5 A;  1ENH A;  1OJL A;  1OYW A;  1X4O A;  2DAO A;  4BHC A;  4CCM A;  3G6E I;  3CCL I;  1VTN C;  1X1B A;  1MSE C;  3LSK A;  4IJA A;  2BW3 B;  2WWY A;  3BQY A;  4GYG A;  3E97 A;  3Q5F A;  3CJR B;  5CPR B;  2QA4 I;  4YEL A;  2CFO A;  3IUO A;  3HC7 A;  1P4W A;  1WWX A;  2GZW A;  1YI2 I;  5LGU A;  1JT6 A;  2JA6 J;  3RDI A;  3I59 B;  2XAH A;  2A3S A;  4QLC U;  4NC7 A;  5K1Y A;  3OYG A;  4BU2 A;  4M9X A;  1ZHF A;  2OAZ A;  4UUT A;  2KPM A;  2X1E A;  2DTZ A;  4U7D A;  1A36 A;  2R7F A;  2PX9 A;  3CDI A;  2P5K A;  3K2A A;  1X3W B;  3TQN A;  5F1R A;  1BR4 A;  3CCU I;  2WTE A;  2RQP A;  2RV8 A;  4BEH A;  4O3M A;  4V2F A;  2R7S A;  1N78 A;  3U21 A;  1PYV A;  2NS7 A;  4KJZ A;  2ACJ A;  3CP2 A;  4CCN A;  1XDS A;  2WAE A;  1U3E M;  4N9H A;  1CGP A;  1JT0 A;  4LLG F;  5CYV A;  4BBS J;  3BR6 A;  4EM2 A;  1A31 A;  1RI7 A;  2W24 A;  4MNU A;  5F04 A;  3QPL A;  2CUE A;  1VQN I;  4G8X A;  4RAG A;  4XSX F;  2K4B A;  1BW5 A;  3IKT A;  2E2J J;  3HKZ A;  3O2P E;  4HG2 A;  3ZQ7 A;  3K9T A;  4PCQ A;  5L3B A;  4HZF A;  4B44 A;  1OCT C;  2OPT A;  3TO9 A;  4D7N A;  4G94 A;  4B4C A;  3F8B A;  2EZI A;  1HKQ A;  4LGW A;  1HLV A;  1B72 A;  4I02 A;  5K5R A;  3JRE A;  4G6T B;  4DW6 A;  2L7F P;  2R7D A;  2WAQ N;  3HGG A;  1VQ7 I;  3QYB A;  1MNE A;  4H4K C;  5L3F A;  2JN6 A;  2EV6 A;  1U8B A;  5FKM A;  5J40 A;  2WV1 A;  2NVU B;  1ZR2 A;  1F1Z A;  4S04 A;  1IN7 A;  1BI3 A;  1J9I A;  1RKW A;  2LDU A;  1IN5 A;  1BA5 A;  2OCC H;  1RR7 A;  4OIN F;  2XRL A;  3ECH A;  1ZH5 A;  2V1U A;  1MJA A;  2JUG A;  2JPC A;  1X1D A;  2FBI A;  3WTZ A;  3DEU A;  2DK8 A;  1D0X A;  2MH9 A;  3H3U A;  3KEQ A;  3PUF A;  5BPD A;  1K4S A;  4UUS B;  1EA3 A;  2YS9 A;  1SD6 A;  4G12 A;  3ABU A;  4ZZL A;  1JHF A;  4RB3 C;  4L0Z B;  4YIF A;  3IP4 B;  3G73 A;  3A1Y A;  1W5T A;  4ON0 A;  3R4K A;  2AQF A;  1ZGA A;  1AA7 A;  2ZSI B;  3D5R C;  2MFZ A;  3I58 A;  1ZG5 A;  1XCV A;  2HXI A;  1SC7 A;  2IS6 A;  1ZRF A;  4M3G A;  3MKY B;  3CME I;  1WH5 A;  2CSO A;  4PFP A;  4NBQ A;  3TW6 A;  2DBB A;  3ZCO A;  3FMQ A;  4MFD A;  1FYM A;  2V26 A;  4OAZ A;  1AKH B;  2IAI A;  1RUO A;  1VND A;  1MIJ A;  1FYL A;  2DOF A;  1YHQ I;  1FPQ A;  4KMU X;  2HEO A;  2PEX A;  1U0J A;  2QQ8 A;  1YX3 A;  3UKG A;  1P7I A;  4FX4 A;  4FT8 A;  2VKH A;  2Y69 H;  4G6D A;  3QQA A;  3FWE A;  4RA2 A;  4HF1 A;  3KYD B;  3GTL J;  1ZAO A;  3DU5 A;  4ANJ A;  3C1D A;  1AHD P;  3HPG A;  3AG1 H;  3AL0 C;  2KDO A;  2G0E A;  2E1M B;  4HST A;  1IO2 A;  2JZY A;  2HU9 A;  2E5N A;  3F0C A;  3NAU A;  3H0D A;  2F4I A;  3WG9 A;  4FTH A;  4Q47 A;  1O3S A;  2HYF A;  1OCZ H;  4MTD A;  1QVU A;  3OYK A;  3RKX A;  3LQQ A;  2F5C A;  1MJB A;  2BXZ A;  2O8X A;  3LSJ A;  3KP7 A;  3LFK A;  3LFU A;  1GUU A;  1T38 A;  2Y48 A;  3PQJ A;  3PUB A;  5HOO A;  3GME A;  2R5Z A;  1MBG A;  3F72 A;  2XSD C;  1EH7 A;  5LLQ A;  2P7V B;  3CJT B;  4XRM A;  2XHK A;  4IRG A;  1QPI A;  1FEX A;  4XLH A;  2WY7 Q;  2EA2 A;  4IZZ A;  5BQT A;  2KRC A;  2X85 A;  5JFR A;  5LEK A;  3J81 Z;  2JA5 J;  3QU3 A;  1LEA A;  4NB5 A;  4PJN A;  4L9T A;  4L18 B;  5D4S A;  2LC2 A;  4RMN A;  1QQI A;  2E7W A;  1KZH A;  2RQQ A;  1UB9 A;  2VE8 A;  1RIO H;  4K2E A;  1G2H A;  4YEJ A;  1GXQ A;  2HYJ A;  4GXO A;  3CC7 I;  2YR2 A;  2K86 A;  4HA8 A;  2HTJ A;  3PNY A;  3JTG A;  3VSK A;  1JUM A;  3ZR8 X;  5FLM J;  4GGG A;  4V2G A;  3C2B A;  3MKZ A;  3MEX A;  1Z9C A;  2OV7 A;  1W0T A;  4WX9 A;  1FWZ A;  2DFF A;  3KP5 A;  2QWW A;  4LLN A;  3OYC A;  5J6X A;  4PZJ A;  1JE8 A;  5E3O A;  4ZC3 A;  3N4M A;  4KT6 A;  3JRF A;  1I3Q J;  5ILU A;  2OCE A;  4ZTJ A;  2J5O A;  1EJ9 A;  2Z99 A;  2BOL A;  4G7Z F;  4M3D A;  3KFW X;  5EZG A;  3P9K A;  1E3O C;  1VQ4 I;  1OR7 C;  1WFX A;  2KRF A;  5HS9 A;  3E5U A;  2HWV A;  5IOZ A;  3LSP A;  5EJC A;  3OOP A;  4XBF A;  1X2M A;  5EG0 A;  2L4A A;  2ZME B;  4Y17 A;  3TKY A;  3HB9 A;  2H8W A;  5IP6 A;  2Z3Y A;  3S1M J;  1G3W A;  3I3L A;  3K4K A;  4HOB A;  4TV7 A;  4IHV A;  3F9K A;  4XLF A;  3CQZ J;  2XGD A;  4MQV A;  2X48 A;  2BE5 F;  4M6V A;  4AYB A;  2XAG A;  4LFU A;  3I55 I;  2NVY J;  1MDM B;  1BW6 A;  2MLK A;  4L9N A;  3HYI A;  4C3J J;  1PUE E;  2FNP A;  2NOG A;  3H9G A;  5DV5 A;  2A61 A;  3FXR A;  5CVI A;  1YIT I;  2LNB A;  1B59 A;  3M7G A;  4NDL A;  4E7K A;  2JMW A;  3BT9 A;  3CD6 I;  3V42 A;  2M4K A;  1V55 H;  1MSF C;  3BR1 A;  2O0Y A;  4XKC A;  3DFG A;  2LLK A;  3OV8 A;  3HJE A;  1I1G A;  1VI0 A;  1RC9 A;  3HPH A;  2KIF A;  2OD5 A;  4XM3 A;  2FJ1 A;  2FOK A;  4XL9 A;  3W3C A;  5JVT A;  2DK5 A;  4BJ6 C;  3HOY J;  1R00 A;  3J80 Z;  3DTE A;  2FX0 A;  3GEZ A;  4Y7N J;  3BLY A;  3S3M A;  3JRB A;  3SXY A;  3H3Z A;  3IAM 2;  3AKZ A;  5L3E A;  2KIU A;  2CG4 A;  5FKO A;  4LB5 A;  2XAJ A;  3NRV A;  1ZLJ A;  3FXJ A;  2XF5 A;  1MW7 A;  3S32 A;  3ISP A;  1KYZ A;  3LAP A;  1VQ5 I;  3M8J A;  3J80 K;  4J00 A;  2Y9Y A;  9ANT A;  2TRT A;  4IHY A;  2K7L A;  2E1N A;  2LF7 A;  2QZ8 A;  3BTC A;  2LR8 A;  3G3Z A;  3K1P A;  3KEY A;  1MMD A;  4ASN A;  1TT0 A;  4D0P A;  4YG2 F;  5E3N A;  5J4Y A;  2BW3 A;  3ABL H;  1WJE A;  1XS9 A;  2OQG A;  1I6H J;  5LGT A;  1TWC J;  2VJI A;  4UV9 A;  2L7M P;  2D1V A;  1WJC A;  1Z7L A;  1FOK A;  1SFK A;  2DA2 A;  1BBY A;  1FJL A;  3KZI C;  4AVZ A;  2STT A;  2L9V A;  2JUC A;  3DEW A;  3ERM A;  3I59 A;  1HW2 A;  2K3P A;  3T0Y A;  2BHZ A;  4C9Y A;  3JCU C;  1S5L C;  3E6B A;  5GP9 A;  3VFZ A;  2QM3 A;  3H0G J;  4LG3 A;  1V5G A;  1HSJ A;  3DXJ F;  2RGV A;  3I53 A;  4UB8 C;  1H88 C;  3ZMZ A;  1OCP A;  2B63 J;  3FXQ A;  3DWL E;  4BUP A;  1X3Z B;  1P4X A;  2H09 A;  2VQC A;  4KN7 X;  2JVH A;  3OL3 A;  4B3A A;  3OYM A;  4L5I A;  4RS8 A;  1Q1V A;  3ELK A;  3FMR A;  5K7Z A;  4UV8 A;  4PK4 A;  2LBF B;  2UXN A;  5BPI A;  1YFH A;  2ID6 A;  3JRI A;  4IPA A;  3GYH X;  1YS7 A;  2COM A;  1MBK A;  3TDU C;  5GAH J;  2M3A A;  2C6Y A;  5J8C A;  3BZK A;  2D5V A;  1ETX A;  2R4G A;  4XIC A;  1FLI A;  3WU2 C;  1MMA A;  2L9R A;  2KL4 A;  3GO5 A;  3OYA A;  4XID A;  3WTV C;  1IN8 A;  3KCC A;  4Y15 A;  3DKW A;  3OY9 A;  4JK1 X;  2R3S A;  4IHW A;  2VKV A;  5GAE J;  1PDN C;  1JGG A;  4XKW A;  3AG4 H;  1R5I D;  1ULY A;  3KZY A;  1LE8 B;  2HOT A;  3M3Y J;  2P81 A;  1D3Y A;  2VXZ A;  2Q0O A;  3F6V A;  1IG7 A;  4YFX F;  3VB2 A;  4BJT A;  4A69 C;  2WA0 A;  1HF0 A;  1BOA A;  5C4X J;  3E3V A;  1R5H A;  5LHH A;  2E35 A;  4KUM A;  2FBH A;  2KIQ A;  4ESJ A;  2EJR A;  2F5D A;  4XMY A;  4CCJ A;  2X0L A;  3I71 A;  2BY0 A;  3LSG A;  4I01 A;  2JSP A;  1GVD A;  2DCE A;  3PO2 J;  4HAM A;  3CC2 I;  5CVV A;  4BDZ A;  3HRT A;  3K70 C;  3P9I A;  4W1U A;  2HFH A;  5D8K B;  1JTY A;  4Y52 J;  2P8T A;  2MC4 A;  3K4J A;  3M8E A;  2EIM H;  3K4N A;  4IVN A;  3RPU D;  3FXO A;  5DM7 F;  1J75 A;  2M30 A;  2K9Q A;  4XON A;  1AKH A;  5ILV A;  1I50 J;  4OIP F;  1V5E A;  3SFI A;  1IXR C;  4HX8 A;  4MQ9 F;  4JX6 A;  1OMI A;  2X1C A;  1OR7 A;  4ZYE A;  2Y9Z A;  2MD5 A;  1F43 A;  3T8R A;  3U9G A;  1MBJ A;  4PFO A;  2HKO A;  3T5X A;  3ZQL A;  2EQR A;  4S05 A;  2KJC A;  1S7A A;  4LOC A;  3RZO J;  1Y6I A;  1HBX G;  1QHG A;  1O4X A;  4OMZ A;  2Y2Z A;  3WHB A;  5FRM A;  2HGC A;  3J7A O;  4A3D J;  5DCF A;  3HOT A;  2E60 A;  1ZAR A; 
#chains in the Genus database with same CATH homology
 1S8N A;  3ZMD A;  1L0O C;  4EJU A;  4AIJ A;  2A68 F;  4A0X A;  1EH6 A;  1JHH A;  4LK1 F;  1HST A;  2M1B A;  2RNJ A;  4RGS A;  3TDZ C;  5HLH A;  4DNC A;  1YO5 C;  3B73 A;  2BGC A;  3CTA A;  4AWX B;  5ED4 A;  3GFI A;  2XAS A;  2P4W A;  1G3S A;  5ICE A;  1CF7 A;  4EQQ A;  1QZY A;  1TNS A;  1FBU A;  4EM0 B;  4WWC A;  1FT9 A;  2PMH A;  2X4H A;  3RI4 A;  3JSO A;  1L3L A;  2E1C A;  3REO A;  3GWZ A;  1B1B A;  2NNY A;  3WGI A;  2ESH A;  1Z1D A;  2L02 A;  3W6K B;  2M8E A;  3BJO A;  5H6Q A;  3KLN A;  3IWF A;  1ONV A;  3RIR A;  4HYE A;  1ODD A;  5JI6 A;  3QRF F;  1FNN A;  1S3J A;  2QBY A;  1IXS B;  3F8M A;  1OYI A;  3BY6 A;  5HDK A;  1SFU A;  2IJL A;  1SFE A;  2ZME A;  6PAX A;  4UNO A;  5FD5 A;  1BI0 A;  1K6O A;  2EK5 A;  1K78 B;  2V9V A;  1XGO A;  2RKH A;  2FBK A;  1EH8 A;  2K27 A;  1A04 A;  1SD5 A;  1UFM A;  4A6D A;  5BS6 A;  2NNN A;  4MGR A;  3T1B A;  5FGM A;  4A0Z A;  2FSW A;  1P92 A;  5L3D A;  4EJO A;  3QP5 A;  1KU7 A;  4CHU A;  4RAZ A;  2VBW A;  1SD7 A;  5FLX Z;  4XSZ F;  4ZYH A;  4HF2 A;  1YS6 A;  3V7R A;  3R61 A;  2GWR A;  3EQL F;  1D5V A;  1G6N A;  1YG2 A;  3L7W A;  4RGR A;  4ENJ A;  5FLX K;  1STZ A;  2DQL A;  1P4A A;  3BJ6 A;  5HDG A;  1H0M A;  3JTH A;  4BYY A;  3QAH A;  5D5W B;  4I7H A;  4OIO F;  1W7P A;  3DPL C;  3V7C A;  4RB2 C;  2HOE A;  5FFX A;  3JAM Z;  2UZK A;  4EJT A;  4P96 A;  3ZP5 A;  5D5V B;  5FFZ A;  1WI9 A;  2KIM A;  4RB0 A;  4HX7 A;  4LB6 B;  1LEB A;  1IW7 F;  5HDN A;  2QLZ A;  3JAM K;  3L00 A;  2ZJ2 A;  3BPX A;  3WE2 A;  3BP8 A;  4LK0 F;  3E6D A;  5E1W A;  1OYY A;  2ZBK A;  3MZY A;  4RGU A;  4KIF A;  4JQF A;  5DCM B;  4KMF A;  3IHU A;  1GHC A;  3K1M A;  5CVR A;  1ON1 A;  2Z5U A;  4ESF A;  2FNA A;  1ZN2 A;  4UHT A;  2D2W A;  1QO0 D;  3GXO A;  4YII A;  4IRH A;  3HIF A;  2EA4 A;  2OQR A;  5FD6 A;  1YIO A;  1XCB A;  2EV0 A;  3SQN A;  1R1T A;  1KA8 A;  2GA2 A;  1IAW A;  4ENK A;  4MTE A;  1LDD A;  1R58 A;  1BC7 C;  2IVM A;  3I5U A;  1J7K A;  3NEU A;  3MAJ A;  1IF1 A;  1GVJ A;  4BH9 A;  3WTY C;  1UCR A;  3MCZ A;  3RKY A;  3R0A A;  1FBS A;  2VON A;  4HF0 A;  4A0Y A;  2PQ8 A;  5D4R A;  2O03 A;  2QYO A;  5LGN A;  4M9Z A;  4GYI A;  4LMY A;  2VBY A;  4NHJ A;  2KJB A;  3BDD A;  3LA7 A;  3E6C C;  2IA2 A;  2V79 A;  4EVI A;  1QGP A;  3BJA A;  4M72 A;  4OOI A;  3HRM A;  5J8F A;  1CF7 B;  1ZRC A;  4F7Z A;  3BOQ A;  2XAF A;  2QVO A;  3EYI A;  3J81 K;  2PLY A;  2HYG D;  2EFP A;  1YW9 A;  4P9U A;  3IL2 A;  1UST A;  3MZH A;  1PP7 U;  1T2K A;  3PFI A;  5KVR A;  1Q1H A;  3ZMV A;  1I1S A;  2XKP A;  4LD5 A;  3I54 A;  2PI0 A;  4KIG A;  3C7J A;  1T98 A;  2QBY B;  1ON2 A;  2OBP A;  1XDU A;  4ESB A;  4M71 A;  4P5O A;  2VT2 A;  5ERI A;  2FEZ A;  4RB1 A;  2VBX A;  2NYX A;  4M74 A;  5DD8 A;  2DPD A;  3V4G A;  3ZPL A;  2FQ3 A;  4M73 A;  3F8F A;  3EDP A;  3RTR A;  1I6X A;  2DT5 A;  4KIC A;  3N97 A;  2QQB A;  2JSC A;  2HDC A;  4EGY A;  4BXU A;  1R5G A;  5ICC A;  4ZYG A;  2CGP A;  1U6G A;  3ROU A;  5H20 A;  1OKR A;  1TQI A;  3CUQ C;  2ZCW A;  1K78 A;  1Z91 A;  3FX3 A;  1QPM A;  1BIA A;  4P9F A;  3E5X A;  3RYR A;  1QNT A;  2LF8 A;  3RPQ A;  2NRA C;  3F8C A;  3TGN A;  4BHP A;  3WTT C;  2EFW A;  2P5V A;  1YW7 A;  4AD9 A;  1TTY A;  4Q4Z F;  1HQC A;  4Q5S F;  1XGM A;  1B9N A;  2DI3 A;  1GXP A;  2QEN A;  1W4M A;  3ERE D;  1W7P B;  1LJ9 A;  4IF4 A;  1D8J A;  3LST A;  5IT9 Z;  5EEH A;  3EUH A;  4UXN A;  1BI1 A;  2VT3 A;  5EEG A;  1YLF A;  1O3R A;  3BWG A;  1SMT A;  1KU9 A;  4O6J A;  5IT9 K;  3IC7 A;  1YTY A;  2Q8K A;  4GCV A;  1OPC A;  1BN5 A;  4WF2 A;  2F5F A;  2J5P A;  1TQM A;  4I0A A;  2HS5 A;  2DPU A;  1IZ1 A;  2RC4 A;  5DEQ A;  1FP2 A;  1ZGJ A;  4KT5 C;  4I2O A;  3WGH A;  2MBF A;  5K5Q A;  3U1D A;  1X3U A;  2ZXJ A;  3RYP A;  2XRO A;  5D8L B;  1U2W A;  3VEP A;  4E70 A;  1YQA A;  3HSF A;  1J59 A;  5DUI A;  2IPQ X;  3VOD A;  3IRQ A;  1TW3 A;  3ZMT A;  1IRF A;  3HRS A;  1V3F A;  5DCM A;  2VE9 A;  4BNC A;  1IXC A;  1HKS A;  1ZRE A;  2GA1 A;  4BHB A;  4O5V A;  2ZNY A;  3GX4 X;  3K69 A;  5ICF A;  3ZN1 A;  3DF8 A;  2EWN A;  2VOD A;  1FC3 A;  2UWM A;  4DQ2 A;  4B8X A;  1KU2 A;  3KP4 A;  1HXD A;  4XLP F;  2CQK A;  2CYY A;  2ETH A;  4BAY A;  4AIH A;  2HZT A;  1KQ9 A;  2H27 A;  1BC8 C;  3B02 A;  1RNL A;  1LVA A;  3S2W A;  1T0F A;  4LLL A;  2EFN A;  2A5Y B;  1O7F A;  2PJP A;  3KP6 A;  4KDP A;  3L09 A;  1F4K A;  3P9C A;  5DUK A;  2G7H A;  3V8L A;  3F8N A;  3M1E A;  1W5S A;  2VC0 A;  2O6G E;  3RKW A;  4HQM A;  1O3T A;  5CVU A;  3GFL A;  4A6E A;  1FZP B;  2EV5 A;  3JW4 A;  3VOE A;  4U0W A;  1KQ8 A;  3CLO A;  2PFB A;  2W84 A;  1HW5 A;  4LG0 B;  2HR3 A;  2G7U A;  4MEY F;  3RJP A;  2Y0M A;  3E6M A;  1W7P D;  4RAY A;  3FXU A;  4I09 A;  4KFC A;  3GF2 A;  1K7A A;  1U8R A;  3AAF A;  5AON A;  5DDG A;  2VOP A;  3ULQ B;  2BYV E;  1BIB A;  4XLN F;  3ML6 A;  3GZ6 A;  2A69 F;  3LA3 A;  3ZMS A;  2TDX A;  3WTS C;  3MQ0 A;  5ILS A;  3WTX C;  1DP7 P;  4UVC A;  1I5Z A;  1LQ1 A;  4EM1 A;  2Z9O A;  2HQN A;  1U5T C;  1NHA A;  1WQ2 A;  2XV4 S;  3HUG A;  2VN2 A;  1JXS A;  1U78 A;  2P6T A;  4EJW A;  4G7O F;  4WXC A;  1H9G A;  4EV0 A;  4ZZD A;  5KK1 A;  1J5Y A;  1G3Y A;  4B09 A;  2ZFW A;  1TW2 A;  5D6E A;  5LRS A;  4ENN A;  2JT1 A;  1HW1 A;  2ADU A;  2XAQ A;  3O3K A;  1E2X A;  3V8K A;  2B0L A;  3WTU C;  4XRF A;  1MGT A;  3GFJ A;  3KLO A;  2H6C A;  4OU0 A;  1IN6 A;  3CUO A;  1REP C;  2LSO A;  4H0E A;  2M5W A;  4HBL A;  1USS A;  3HTS B;  2MLG A;  3BPV A;  5JHU A;  4ETS A;  1FYK A;  2GQQ A;  1ZRD A;  2DTR A;  2OZU A;  3MFK A;  3HOS A;  1S6L A;  1E17 A;  2HQR A;  1MD0 A;  4HX4 A;  1F9N A;  4G6Q A;  5TJJ A;  5LHG A;  1ZG3 A;  4A5N A;  2A6H F;  5HS7 A;  4A12 A;  3LAJ A;  1AWC A;  4UVB A;  2FML A;  4M6X A;  1FP1 D;  2XVC A;  1RZ4 A;  4U7B A;  1BM9 A;  2Y75 A;  1YW8 A;  5IT3 A;  2V1D A;  1K79 A;  2VBZ A;  1I27 A;  3GVA A;  1O7L A;  1R23 A;  4Y13 A;  2V6C A;  3HTU A;  3FZV A;  4N0B A;  5D5U B;  3T8T A;  1WKM A;  4HV5 A;  1FSE A;  3KP2 A;  1MKM A;  1B9M A;  1T6S A;  4MEX F;  3GLX A;  4HDU A;  3CJN A;  2JTV A;  5F6F A;  2CWE A;  5E20 A;  1G3T A;  2KKO A;  4R8H A;  2ZO4 A;  3TO7 A;  2YX7 A;  4Q48 A;  1SFX A;  2GXG A;  2OZ6 A;  2FU4 A;  3HHG A;  4IHT A;  4IHS A;  1FX7 A;  4CDG A;  1SD4 A;  1ZG1 A;  2P7C B;  2L3D A;  3PQK A;  4KA4 A;  4WXD A;  2BV6 A;  1LNW A;  3KEO A;  5AIQ A;  2EB7 A;  3HSE A;  3SFZ A;  2JPB A;  3CO6 C;  4L9J A;  2BBY A;  2RDP A;  3EYY A;  2XUB A;  3C18 A;  2IT0 A;  5ICG A;  2XIG A;  1U5T A;  4HV6 A;  2NS0 A;  1FY7 A;  4L9V A;  5LRR A;  1XGS A;  2G9W A;  5E1X A;  1J0R A;  2RVC A;  1S29 A;  2IP2 A;  2FMY A;  1KU3 A;  1R1U A;  5L3C A;  3MWM A;  4L5J A;  1O3Q A;  4UVA A;  4CO8 A;  1S7O A;  5E8G A;  3CUQ B;  4GO1 A;  2EFO A;  3CO7 C;  1DDN A;  3Q9S A;  2VOO A;  3K2Z A;  5A2Q Z;  2H94 A;  1IRG A;  3SZP A;  4L0Y B;  2PBI A;  5A2Q K;  4AVP A;  3WTW C;  4OIR F;  2DW4 A;  4EGZ A;  2Z33 A;  2O61 A;  2UXX A;  1XSD A;  4LG0 A;  3IKV A;  5D5X B;  4I0B A;  4M6Y A;  2FRH A;  1FSH A;  1PP8 F;  3TOB A;  1R22 A;  3O6B B;  3D0S A;  2DO7 A;  1H9T A;  4FX0 A;  1DPR A;  3Q9V A;  2ISY A;  4EJV A;  2HKX A;  2MC3 A;  1Z05 A;  2PG4 A;  2GIV A;  3NQO A;  1P2F A;  1P6R A;  1LDK B;  3WU0 A;  2E7X A;  3H92 A;  3ZMU A;  1Z7U A;  2Q2E A;  3GZ5 A;  3LQR A;  2IW5 A;  1KQ0 A;  2BEO A;  1TLH B;  5HLI A;  3ZN0 A;  2P6S A;  5HS8 A;  2K02 A;  3QP6 A;  1BI2 A;  1QZZ A;  4FHT A;  3U2R A;  2OA4 A;  3M9A A;  3QU6 A;  1DUX C;  1MJ9 A;  2ELH A;  5DYM A;  2CW0 F;  2MA3 A;  1RUN A;  3F6O A;  4HDV A;  1XN7 A;  3FMS A;  2NAZ A;  2M87 A;  2LKP A;  3TOA A;  2O3F A;  2L4M A;  1XSX A;  5FO5 A;  4HW0 A;  2IA0 A;  3M8F A;  2IRF G;  3WOD F;  5FB2 A;  5BMZ A;  2RN7 A;  1DPU A;  3GFM A;  4CXF A;  2WV0 A;  4RGX A;  3IWZ A;  5E18 F;  3GW2 A;  4U88 A;  2DQR A;  4HLY A;  2L54 A;  4WXH A;  2MH2 A;  1G4D A;  3KZZ A;  4R1H A;  1Y0U A;  1J2X A;  2EFQ A;  3I4P A;  3DPT A;  2YU3 A;  5E8I A;  3DP7 A;  2XKO A;  4Z2Y A;  3FF5 A;  1XGN A;  4OMY A;  2D1H A;  2PN6 A;  3L9F A;  2CO5 A;  1C0W A;  5LBQ A;  5L3G A;  2FA5 A;  2HTS A;  4U0Y A;  1IUY A;  1R7J A;  1TQP A;  1IN4 A;  3V8J A;  1EV7 A;  3LWF A;  4I98 B;  5H6R A;  4WK8 F;  1SMY F;  1AOY A;  3KE2 A;  3ECO A;  2QQA A;  4M9S A;  3L2C A;  1QBJ A;  4PGH A;  1WRJ A;  2QQ9 A;  2P5L C;  2YSR A;  4A5M A;  2DU9 A;  2A07 F;  4HLX A;  5BOX A;  4KNY A;  2H6B A;  2DFI A;  3ABT A;  2ISZ A;  4WCG A;  4JBA A;  3F21 A;  1B4A A;  5K5O A;  2M45 A;  4IRI A;  1FBQ A;  3C3W A;  1U5T B;  2JRT A;  1Z6R A;  5CLS A;  3WE3 A;  5CJ9 A;  4QWQ A;  4CZZ A;  3D5L A;  4KIB A;  3BZ6 A;  3W6J B;  4ENM A;  1LDJ A;  2W25 A;  5HVQ C;  2XGX A;  5DD4 A;  3P7N A;  2IA1 A;  4A2U A;  4IXA A;  2F5E A;  3KP3 A;  1JGS A;  1BJA A;  1KYW A;  3SHF A;  3LA2 A;  5E17 F;  2QUF A;  4YFN F;  4HQE A;  4NQW A;  4YFK F;  4ZH4 F;  4CGZ A;  5D6F A;  1XSV A;  1F5T A;  3DQV C;  3I64 A;  4U0V A;  1O57 A;  3F3X A;  3FHZ A;  3HSR A;  1SAX A;  3DV8 A;  4PDK A;  3CUQ A;  3EET A;  1R1V A;  2OU2 A;  1TNT A;  2FF4 A;  1KGS A;  3QOP A;  1R36 A;  4BQA A;  2FE3 A;  3SZT A;  1XB4 A;  5AIP A;  3QPH A;  3COA C;  5E1Z B;  1MZB A;  2STW A;  2PMU A;  2WC2 A;  3WGG A;  1XD7 A;  1T39 A;  2FXA A;  4MHG A;  1UHM A;  4LJZ F;  4N9I A;  1YYV A;  1WSU A;  1XMA A;  4KN4 X;  2ZNZ A;  3I0T A;  3HRU A;  4CYD A;  1HKT A;  5LEJ A;  3K0L A;  2D45 A;  2GAU A;  4AIK A;  4G9Y A;  2L01 A;  2AS5 F;  3JSP A;  2ESN A;  4OIQ F;  3BRO A;  2CFX A;  3GUD A;  2XRN A;  5TRD A;  4ZYD A;  2K4J A;  4UUV A;  4R79 A;  5F64 A;  4P55 A;  2V1X A;  3TO6 A;  4EMS A;  2F2E A;  3R0J A;  3HHH A;  3KET A;  5JR3 A;  3R60 A;  5HLG A;  4PGG A;  1V4R A;  4KYW A;  3R6S A;  4G7H F;  1UHW A;  2VC1 A;  3F22 A;  3FM3 A;  1Z6T A;  1XMK A;  1LB2 A;  1ZYR F;  3F23 A;  1ZLK A;  3RPU A;  1MDM A;  3QPT A;  1D8K A;  1B6A A;  2A6E F;  3CDH A;  3E5Q A;  2DLL A;  2YX4 A;  2ZKZ A;  3K1N A;  2W85 A;  3IRR A;  3V7S A;  5CVJ A;  1TBX A;  2W57 A;  2GXB A;  4CIC A;  3WU1 B;  2AXL A;  5LHI A;  2YPR A;  3FM5 A;  1OYW A;  2DAO A;  4BHC A;  1VTN C;  4IJA A;  2WWY A;  4GYG A;  3E97 A;  3Q5F A;  1P4W A;  1WWX A;  2GZW A;  5LGU A;  3RDI A;  3I59 B;  2XAH A;  2A3S A;  4QLC U;  5K1Y A;  4M9X A;  1ZHF A;  2OAZ A;  4U7D A;  2R7F A;  2P5K A;  3TQN A;  5F1R A;  2WTE A;  2RQP A;  2RV8 A;  4O3M A;  2ACJ A;  1XDS A;  1U3E M;  4N9H A;  1CGP A;  4LLG F;  5CYV A;  4EM2 A;  1RI7 A;  2W24 A;  4MNU A;  4G8X A;  4XSX F;  2K4B A;  3IKT A;  3O2P E;  3ZQ7 A;  3K9T A;  4PCQ A;  5L3B A;  4HZF A;  3TO9 A;  4G94 A;  3F8B A;  1HKQ A;  4LGW A;  4I02 A;  5K5R A;  2R7D A;  5L3F A;  2EV6 A;  1F1Z A;  4S04 A;  1IN7 A;  1BI3 A;  1J9I A;  2LDU A;  1IN5 A;  4OIN F;  3ECH A;  1ZH5 A;  2V1U A;  1MJA A;  2JPC A;  2FBI A;  3WTZ A;  3DEU A;  2DK8 A;  2MH9 A;  3H3U A;  3KEQ A;  5BPD A;  1SD6 A;  4L0Z B;  3ABU A;  4ZZL A;  1JHF A;  4RB3 C;  4YIF A;  3G73 A;  1W5T A;  4ON0 A;  3R4K A;  1ZGA A;  3I58 A;  1ZG5 A;  1XCV A;  1ZRF A;  2CSO A;  2DBB A;  3FMQ A;  1FYM A;  1RUO A;  1FYL A;  1FPQ A;  4KMU X;  2HEO A;  2PEX A;  4FX4 A;  4FT8 A;  4G6D A;  3FWE A;  4HF1 A;  1ZAO A;  3C1D A;  2JZY A;  3WG9 A;  4Q47 A;  1O3S A;  2HYF A;  4MTD A;  3RKX A;  3LQQ A;  2F5C A;  1MJB A;  2O8X A;  3KP7 A;  3LFK A;  1T38 A;  2Y48 A;  3PQJ A;  5HOO A;  3F72 A;  1EH7 A;  5LLQ A;  2P7V B;  2XHK A;  4IRG A;  2EA2 A;  5BQT A;  5JFR A;  5LEK A;  3J81 Z;  3QU3 A;  1LEA A;  4NB5 A;  4L9T A;  4L18 B;  5D4S A;  1QQI A;  2E7W A;  1RIO H;  1UB9 A;  2VE8 A;  4K2E A;  1GXQ A;  4GXO A;  2YR2 A;  2K86 A;  4HA8 A;  2HTJ A;  3JTG A;  4GGG A;  3MEX A;  1Z9C A;  4WX9 A;  1FWZ A;  3KP5 A;  2QWW A;  4LLN A;  5J6X A;  4PZJ A;  1JE8 A;  3N4M A;  5ILU A;  2J5O A;  2Z99 A;  4G7Z F;  3KFW X;  3P9K A;  2KRF A;  5HS9 A;  3E5U A;  2HWV A;  3OOP A;  4XBF A;  2L4A A;  2ZME B;  4Y17 A;  3TKY A;  2Z3Y A;  1G3W A;  4HOB A;  4TV7 A;  4MQV A;  2BE5 F;  2XAG A;  4LFU A;  1MDM B;  2MLK A;  4L9N A;  3HYI A;  1PUE E;  2FNP A;  5DV5 A;  2A61 A;  3FXR A;  5CVI A;  2LNB A;  1B59 A;  3M7G A;  2O0Y A;  3DFG A;  3OV8 A;  1I1G A;  2KIF A;  2OD5 A;  2FOK A;  5JVT A;  2DK5 A;  1R00 A;  3J80 Z;  3GEZ A;  3SXY A;  3H3Z A;  5L3E A;  2KIU A;  2CG4 A;  4LB5 A;  2XAJ A;  3NRV A;  1ZLJ A;  3ISP A;  1KYZ A;  3LAP A;  3J80 K;  2K7L A;  2E1N A;  4ASN A;  2LF7 A;  2QZ8 A;  3G3Z A;  3K1P A;  4D0P A;  4YG2 F;  2OQG A;  5LGT A;  4UV9 A;  2D1V A;  1FOK A;  1BBY A;  2STT A;  3I59 A;  1HW2 A;  3T0Y A;  3E6B A;  3VFZ A;  2QM3 A;  1HSJ A;  3DXJ F;  2RGV A;  3I53 A;  3ZMZ A;  3FXQ A;  1P4X A;  2H09 A;  4KN7 X;  4L5I A;  4RS8 A;  3ELK A;  3FMR A;  4UV8 A;  2UXN A;  5BPI A;  1YFH A;  4IPA A;  3GYH X;  1YS7 A;  2COM A;  3TDU C;  2C6Y A;  5J8C A;  1FLI A;  3GO5 A;  3WTV C;  1IN8 A;  3KCC A;  4Y15 A;  3DKW A;  4JK1 X;  2R3S A;  1PDN C;  1ULY A;  3KZY A;  1D3Y A;  2VXZ A;  2Q0O A;  3F6V A;  4YFX F;  3VB2 A;  1BOA A;  3E3V A;  1R5H A;  5LHH A;  4KUM A;  2FBH A;  4ESJ A;  2EJR A;  2F5D A;  2X0L A;  3I71 A;  4I01 A;  4HAM A;  5CVV A;  3HRT A;  3P9I A;  2HFH A;  5D8K B;  2P8T A;  3M8E A;  4IVN A;  1J75 A;  2M30 A;  5ILV A;  4OIP F;  1IXR C;  4HX8 A;  4MQ9 F;  1OMI A;  1OR7 A;  4ZYE A;  2MD5 A;  3T8R A;  3U9G A;  2HKO A;  3T5X A;  4S05 A;  2KJC A;  1S7A A;  1HBX G;  4OMZ A;  2HGC A;  3J7A O;  5DCF A;  3HOT A;  1ZAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...