3WTUC

Crystal structure of the complex comprised of ets1 (v170a), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 40
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtuC00
2HZTA 4B8XA 2ZBKA 2QLZA 1IN4A 2Z5UA 3GO5A 4MEYF 3G3ZA 1WSUA 2BE5F 3M8FA 3J81K 3DEUA 2H6BA 5L3GA 5AIQA 3CUOA 1X3UA 2P4WA 5D6EA 5K5QA 3WTXC 3GZ6A 3HSFA 2MD5A 4L9VA 3F3XA 3WTSC 2HTSA 2P6TA 4ESBA 1P2FA 1OKRA 2O3FA 2CFXA 5DD8A 2P7CB 2Z99A 3EYYA 1WKMA 4MQVA 3K1MA 4G7HF 2HGCA 4LB6B 1UHMA 5FD6A 2F5CA 1W7PD 2FNAA 1HXDA 3IWFA 1LJ9A 2VBWA 2VBZA 4OOIA 4IHTA 5L3DA 2A68F 4OMZA 2XAGA 5FO5A 3SFZA 2L01A 3WTUC 2MH9A 4OU0A 2AS5F 5JR3A 4BHPA 2RGVA 1V3FA 3GFMA 4M71A 5E1WA 2EFOA 4G7OF 4PGGA 3BDDA 5JI6A 1SFEA 2LF7A 1G6NA 2OQRA 1YS7A 3KZYA 2K86A 3TOAA 1K7AA 1LNWA 1ZRDA 4IF4A 1ZRFA 2B0LA 1DDNA 1JHFA 1P6RA 5E17F 1W7PA 3D5LA 2FOKA 4OIRF 1LEAA 2IA0A 3T5XA 1FP2A 2FU4A 2HKOA 4BH9A 3GWZA 1SD6A 5LGNA 3QRFF 2GXGA 4IPAA 2IP2A 4K2EA 5H6QA 2WTEA 3RJPA 3GVAA 1TQMA 5L3CA 3QPHA 1HSJA 1FT9A 5AONA 1U5TC 4NHJA 2EV6A 2NAZA 5BPDA 1XSDA 1S6LA 1XSXA 4UNOA 2ELHA 1LDKB 4GGGA 1AOYA 4G9YA 2R3SA 2FE3A 3KP5A 1ON2A 5HS9A 3LFKA 4L9NA 5ILSA 3I59B 3F6OA 2HEOA 5J8FA 1B9MA 2V1DA 4UXNA 4HF0A 1Z6TA 2MC3A 3MWMA 1YW8A 3GW2A 4BAYA 5JVTA 4RB3C 3CO6C 1IXRC 4AVPA 1E2XA 2FF4A 4FX0A 1ZG5A 3U9GA 4AIJA 2FNPA 3MEXA 4WXDA 3N97A 3O3KA 3O6BB 1HW1A 4LFUA 1U3EM 3RYPA 1UHWA 4ENJA 1IUYA 2R7DA 1ZH5A 1S3JA 2QBYB 1SD7A 4IVNA 1IRFA 2XKPA 3WODF 2E1NA 1EH7A 3VFZA 5D5XB 2A6EF 4CZZA 3ZMVA 3BY6A 3ELKA 3LA3A 2CQKA 1BIAA 1XCBA 5DD4A 3WTYC 1ZLJA 2Z33A 2FBHA 3REOA 1D8JA 3PQKA 2O03A 1OYWA 1I1SA 1KQ8A 4LD5A 2VT2A 1MZBA 1OR7A 3BJOA 4EJWA 2ZJ2A 5E1XA 4OMYA 2IA1A 1KU9A 2A3SA 3RYRA 3I4PA 4F7ZA 3T1BA 3CJNA 3TKYA 1CF7B 3IHUA 3HHHA 1QQIA 1Z6RA 2STTA 3E97A 5A2QK 1LDJA 2K27A 2FEZA 2FMYA 2GXBA 3Q9SA 4NQWA 3KP6A 2MLKA 4LG0A 2FBKA 1P4WA 2Z9OA 4HLYA 1IAWA 2IW5A 3VOEA 4IHSA 3F8MA 1HKSA 2LNBA 4XSXF 4HOBA 4KIGA 2HYFA 1SFUA 4EM0B 1ZYRF 4JK1X 2QENA 4KMUX 4KT5C 5FLXZ 2HWVA 4JBAA 5D4RA 4UHTA 1L0OC 2V9VA 2VC1A 3P9IA 2STWA 2DFIA 4KN4X 2P6SA 4QWQA 1XGOA 3D0SA 3F6VA 1KYZA 1K79A 3RKYA 4CICA 3R0AA 1S29A 2L4MA 4XBFA 2COMA 2D1VA 4KICA 3EYIA 1HKTA 3I71A 2FBIA 5CVUA 1I5ZA 4KIFA 1FC3A 3E5UA 4WXCA 1FSEA 5CVRA 2ZFWA 3NQOA 5LEKA 1HSTA 4M6YA 4KDPA 3LWFA 2E7WA 3G73A 2ETHA 2EFQA 4IRIA 4KNYA 2RVCA 1PDNC 3M9AA 3LQQA 1R22A 3L9FA 5DYMA 4L0YB 1MGTA 4MQ9F 2ACJA 2P5KA 5EEGA 2WC2A 1XCVA 4DQ2A 4RB1A 3FXUA 2V1UA 4HLXA 3BWGA 2XROA 4LK0F 2EV5A 1R5GA 1IXSB 4HDVA 5ICEA 3GFIA 4A2UA 4JQFA 1RNLA 3ZPLA 1KU2A 2ZMEA 2Y0MA 3QU6A 3ISPA 2EV0A 4HV5A 1FBSA 3R0JA 3JTHA 1FWZA 5DEQA 2OAZA 4FX4A 2ADUA 4NB5A 1FYMA 1T2KA 4CXFA 1IN5A 1D3YA 4PGHA 5D4SA 2X0LA 3JAMZ 2XAQA 2RDPA 2ISZA 5E20A 3U1DA 3ML6A 2YSRA 4L9JA 2F5DA 4GCVA 3HSEA 4P9UA 1XMAA 3DKWA 3H3ZA 1R23A 4N9IA 2BEOA 5FFXA 2AXLA 1XGNA 3KFWX 3K1NA 3B73A 4Q48A 4LLNA 3F21A 3F8FA 1KA8A 4YIFA 2WWYA 1Z91A 3J80K 1KQ9A 2VE9A 2HFHA 3DPTA 2XAFA 1FPQA 4KN7X 2Q2EA 1WQ2A 4Z2YA 3HRTA 5EEHA 3LAPA 4RGSA 4U7DA 2DLLA 4ESFA 1MKMA 2Y75A 5DCFA 4RGXA 3QOPA 5F1RA 1W5TA 3K1PA 5CVIA 4N0BA 3GF2A 3QP5A 3H92A 4R1HA 1WWXA 5ED4A 4S05A 2DPDA 4M74A 2PN6A 5D5VB 5BOXA 4EMSA 4Q47A 1G3WA 5HDKA 2BBYA 5K1YA 5BPIA 3U2RA 2Q8KA 4U0WA 4D0PA 4WCGA 1T6SA 4EGYA 1JGSA 2ZNZA 4I2OA 2Q0OA 3N4MA 1TNSA 2P5VA 4IRGA 3IKTA 1F4KA 2PG4A 3NEUA 2DK5A 2KKOA 2KJCA 4Q5SF 1QBJA 1B1BA 1GHCA 2LSOA 3JW4A 3BPVA 4PCQA 2H27A 3V8KA 2LKPA 1O7LA 3IWZA 5HDNA 4CGZA 3HOTA 3WGHA 1YW7A 3IC7A 5HOOA 2GQQA 4G6QA 2QYOA 3GFJA 1H9TA 4LG0B 2PEXA 2HR3A 5D8KB 3RIRA 2CWEA 1FY7A 4HAMA 1SD4A 5TRDA 3JAMK 2XAHA 1TBXA 3ZMZA 3E6CC 1R1TA 1TTYA 5D6FA 2H6CA 1O57A 2H09A 3EQLF 4BYYA 4PZJA 2HOEA 4QLCU 1O3TA 4UV8A 2XAJA 1R58A 2J5OA 2JPCA 5LHGA 1F5TA 3KLNA 4XLNF 1K78A 2EJRA 3FZVA 3EUHA 5D5WB 3V7RA 4RS8A 3K0LA 1J9IA 3P9KA 2DI3A 3NRVA 2RNJA 4OIOF 2O61A 3PQJA 4ZH4F 2YU3A 3RPQA 3QAHA 5HS8A 5HS7A 4A12A 1STZA 4HX7A 5LGTA 1T0FA 5CYVA 2IPQX 5FD5A 4MTEA 1Z1DA 4HZFA 1QZZA 1LB2A 3KLOA 3DV8A 3E5QA 1YLFA 2CSOA 2MBFA 4UVCA 3SZPA 2VXZA 4U7BA 1GXPA 1T39A 4O6JA 1PP7U 3TO7A 5HDGA 2UWMA 1YS6A 2M30A 2DQLA 1Y0UA 3FXRA 1IN6A 4HF1A 3TDZC 2YR2A 6PAXA 1ZLKA 4BQAA 4P5OA 4WF2A 4RB0A 2XASA 4LLLA 1S7AA 3IL2A 2OBPA 4ZYHA 2PI0A 1XD7A 2F5EA 5BQTA 3LA2A 3HSRA 4O5VA 2BYVE 2CYYA 3ECOA 3F8CA 1KYWA 2GA2A 2XUBA 2UXNA 1H0MA 1J7KA 2ZMEB 1O7FA 3FMQA 1BIBA 2JZYA 1OMIA 3LSTA 2L54A 5ICCA 1MDMB 3LA7A 4I0BA 3OV8A 3ZQ7A 2MH2A 2M1BA 2HS5A 3IRRA 3DF8A 1BN5A 1XN7A 2XIGA 4RGUA 3QPTA 4Q4ZF 2XGXA 4KA4A 3C7JA 4A0ZA 5ICFA 3RKWA 3HRUA 2L02A 1BI2A 2JSCA 3CTAA 5K5RA 4EJUA 3TO9A 3MAJA 1B6AA 2ESNA 4G8XA 2JRTA 2W25A 4CDGA 2OQGA 3CLOA 2EA4A 5TJJA 3IRQA 1U5TA 2XRNA 2OD5A 2M45A 1FNNA 4I98B 3WU0A 1C0WA 1XSVA 4I7HA 2HDCA 3S2WA 2FSWA 3DXJF 4LMYA 4UV9A 2VT3A 4L9TA 4DNCA 1SMTA 2W84A 4MNUA 2OU2A 5FGMA 4PDKA 4HBLA 2NNNA 1ZG3A 4HDUA 3L7WA 3I53A 1BBYA 3WTTC 2NS0A 1YQAA 4ON0A 2RQPA 2PLYA 1FSHA 2RKHA 3E3VA 3ZN0A 1O3SA 4IXAA 3GXOA 3ABUA 4HQEA 4HW0A 1G3YA 3QP6A 4MHGA 1YTYA 4BXUA 1ODDA 3RDIA 1OYYA 3HOSA 1BI0A 3FF5A 5FFZA 3FWEA 4G94A 4RB2C 1T38A 3O2PE 3SQNA 3H3UA 3MZHA 4P55A 4HYEA 3SZTA 1LQ1A 2K4JA 4KYWA 5LHIA 1HW5A 1LEBA 1YIOA 2HYGD 3TO6A 2K02A 2UZKA 5DCMA 3WTZA 2A07F 1JHHA 2Y48A 4G6DA 3FM5A 4EJTA 1XB4A 4RAZA 3COAC 2LF8A 2BV6A 2PJPA 2X4HA 3HUGA 2JTVA 1DUXC 5JHUA 3CUQA 2KJBA 4Y13A 2IT0A 3TDUC 4L0ZB 4KUMA 5D5UB 5J6XA 4HX8A 2YX7A 1FYKA 2QQAA 4KIBA 3V8LA 2IA2A 2EFPA 1F1ZA 4U0YA 3JSPA 1QZYA 4L5IA 5LRSA 3ZP5A 2PFBA 2K4BA 2H94A 3PFIA 1R00A 2GWRA 2FRHA 4EVIA 3J81Z 1K6OA 4M9XA 5IT9Z 1AWCA 2W85A 1BC7C 1QPMA 5CJ9A 1J5YA 1FBQA 1K78B 1TW2A 4CO8A 2FMLA 3I58A 2O0YA 4I01A 4YFKF 2DBBA 1MD0A 1BOAA 2FQ3A 5CLSA 3I64A 2GZWA 4M72A 3L09A 5ILVA 1MDMA 1L3LA 1GVJA 1ONVA 5ILUA 1SFXA 5LHHA 3ECHA 4ETSA 4Y15A 2XVCA 4GXOA 4ENNA 3RKXA 2QWWA 1ON1A 2G7UA 3L2CA 3HRSA 1WRJA 2G7HA 2QZ8A 4AIKA 1DPUA 3I54A 5E1ZB 2ZCWA 1P4XA 4Y17A 4CHUA 5IT3A 3B02A 5FLXK 1MJAA 5LRRA 4CYDA 1KGSA 2L3DA 3OOPA 2WV0A 4EGZA 4IJAA 5F6FA 4L5JA 4ENMA 2VONA 2LDUA 1J59A 2ZNYA 1G3TA 1XGSA 1ZG1A 3T8TA 5AIPA 2CO5A 5E8IA 3R4KA 1BM9A 2MLGA 1JXSA 4R79A 2DU9A 3I5UA 4HX4A 2A61A 4MEXF 3GEZA 1B9NA 2O6GE 3RPUA 3RTRA 4UVBA 3WE3A 3KCCA 2ESHA 3JSOA 2V1XA 1RZ4A 1RIOH 2PMHA 1U8RA 2G9WA 4I0AA 3VEPA 2TDXA 3L00A 4A6DA 5D8LB 4P96A 2P7VB 4EJOA 1YFHA 3M7GA 1V4RA 2BGCA 1VTNC 1R5HA 1IF1A 3BOQA 4YFXF 5IT9K 2Z3YA 4XRFA 3RI4A 5LLQA 2OZ6A 3WTVC 1IN7A 3HIFA 2PQ8A 3DP7A 1G4DA 1Q1HA 3M1EA 1MJBA 1BC8C 1U5TB 4IRHA 2QVOA 1A04A 4AWXB 3GLXA 1OYIA 3I0TA 2OA4A 3T8RA 1CGPA 3KE2A 4WWCA 3AAFA 4I09A 2EB7A 2JPBA 2D45A 3TOBA 4WXHA 2ZO4A 1SAXA 3BROA 5JFRA 3KEOA 1XDSA 3ABTA 3W6KB 1O3QA 1IXCA 1GXQA 2D2WA 1IW7F 4M9ZA 3TGNA 1DPRA 1QGPA 4N9HA 4A0XA 1J0RA 4ZZLA 1E17A 3ULQB 4BHCA 5DUIA 1S7OA 2M8EA 5HLGA 1QO0D 1TQIA 4HV6A 1ZREA 4G7ZF 1TW3A 3EETA 2KIUA 4RGRA 5DDGA 3WTWC 3FM3A 4WX9A 3WGIA 1HW2A 5LGUA 4XLPF 1ZAOA 4HQMA 3ZMDA 4ESJA 4EV0A 4A5NA 5A2QZ 1FYLA 5DCMB 2DQRA 4ZYEA 2DT5A 5FB2A 1R36A 2L4AA 2NRAC 3IKVA 1JE8A 2A69F 2RN7A 1YW9A 4YFNF 4OIPF 2YPRA 3F22A 4UUVA 3MQ0A 4ASNA 2ZXJA 3C18A 3CUQB 3KZZA 3KP2A 1RI7A 3EDPA 4RAYA 2KRFA 1PUEE 4A0YA 1B59A 1SD5A 1KU3A 5LEJA 4A6EA 1NHAA 1ZGAA 1FZPB 3R61A 2M5WA 1I6XA 2W57A 2QQ9A 2NNYA 2YX4A 3FX3A 1FX7A 1ZHFA 1I27A 2KIMA 1KQ0A 2UXXA 2V6CA 1J2XA 4HA8A 1EH6A 1YO5C 5H20A 5KK1A 3VODA 4O3MA 1BI1A 4YIIA 4HF2A 5DV5A 3Q5FA 3KETA 1IRGA 1R1VA 3C1DA 4UVAA 2HTJA 1UB9A 4BNCA 2P8TA 3MZYA 2DK8A 2F2EA 3K69A 3WU1B 5CVJA 2CW0F 5BMZA 5KVRA 2XHKA 2IJLA 3K9TA 2MA3A 1O3RA 1ZGJA 3GYHX 3FMSA 4GYGA 1XGMA 2IVMA 1BJAA 3W6JB 2C6YA 4M9SA 1G3SA 5L3FA 2O8XA 2GA1A 2M87A 1HBXG 1REPC 2EFNA 3E6MA 3KP7A 1U2WA 1D8KA 1U78A 1P92A 2QQBA 2A5YB 1UFMA 2E7XA 5H6RA 1HKQA 3CUQC 3HTUA 5F64A 4GYIA 4ENKA 1YYVA 5HLIA 3HRMA 4GO1A 4S04A 3E6BA 4EJVA 3JTGA 4OIQF 3WGGA 2PBIA 2HQRA 2VOOA 2KIFA 3F8BA 1ULYA 3LAJA 5ICGA 4EM2A 2EK5A 2A6HF 1QNTA 1W4MA 1USTA 5HLHA 1TNTA 2FA5A 2CGPA 1TLHB 1LVAA 2DO7A 3C3WA 1ZARA 3SHFA 3E6DA 2VBXA 4ZZDA 5HVQC 4ZYDA 4YG2F 2FXAA 3BP8A 1OPCA 2F5FA 2K7LA 3R60A 3M8EA 4I02A 4BHBA 3CDHA 3F72A 3T0YA 4TV7A 2VN2A 1FOKA 3Q9VA 3DFGA 5L3EA 1MJ9A 1RUOA 4AD9A 4FT8A 5CVVA 3LQRA 5ERIA 3V8JA 1F9NA 4U88A 3WG9A 1DP7P 1USSA 3F23A 1XMKA 2XV4S 1BI3A 3BPXA 4B09A 3V4GA 1KU7A 4H0EA 3J80Z 1ZN2A 3DQVC 3QU3A 3VB2A 1S8NA 4MTDA 3V7CA 1D5VA 2VBYA 2RV8A 3ZMUA 1J75A 1UCRA 4M73A 2EFWA 4U0VA 3MFKA 3DPLC 2QM3A 2IRFG 3HTSB 4L18B 1FLIA 2NYXA 4WK8F 2VC0A 2JT1A 2GAUA 4LJZF 4MGRA 2CG4A 1RUNA 3R6SA 3GZ5A 3HHGA 2P5LC 3K2ZA 4XSZF 2ZKZA 3E5XA 3WE2A 2VE8A 2QUFA 2DPUA 4LLGF 3I59A 1PP8F 3GFLA 3CO7C 3GUDA 3MCZA 4KFCA 2V79A 3FMRA 1R7JA 2DW4A 1Z9CA 2ISYA 1IN8A 3ZN1A 3ZMTA 1WI9A 4KMFA 1YG2A 2D1HA 3BJ6A 2VOPA 4M6XA 3P7NA 5L3BA 2HQNA 5J8CA 1XDUA 1FP1D 2RC4A 3FHZA 1H9GA 1W7PB 3FXQA 3V7SA 4LB5A 2QBYA 3GX4X 4A5MA 1TQPA 3BZ6A 5E18F 1Z7UA 2XKOA 1ZRCA 2OZUA 4LK1F 2DAOA 3SXYA 4FHTA 2J5PA 2PMUA 5BS6A 5LBQA 4E70A 1HQCA 3KP3A 3KEQA 1I1GA 3ROUA 4EM1A 2EA2A 1EV7A 3BJAA 1Z05A 3HYIA 1R1UA 1P4AA 3KP4A 2R7FA 4LGWA 3ZMSA 2E1CA 4OINF 2HKXA 1CF7A 4AIHA 2W24A 5E8GA 1FBUA 3J7AO 1B4AA 1EH8A 1U6GA 1LDDA 4EQQA 1SMYF 4R8HA 1T98A 3P9CA 5DUKA 3ERED 2EWNA 2VODA 2GIVA 3F8NA 2DTRA 3TQNA 4ZYGA 1IZ1A 1W5SA 5K5OA 4P9FA
chains in the Genus database with same CATH superfamily
2HZTA 4B8XA 3OIPA 4QPQA 1T0FC 2ZBKA 2QLZA 3PNVA 2X51A 3DTKA 3B6AA 4XN3A 1IN4A 2PMZN 2Z5UA 3A2KA 1A5JA 3BR1A 3GO5A 3MKLA 2ID3A 4MEYF 1MBKA 1IG7A 3G3ZA 1WSUA 5C44J 1ZK8A 2BE5F 3M8FA 3J81K 3LL7A 2HVQA 3DEUA 2R7QA 2H6BA 5L3GA 4E6KG 5AIQA 3Q3SA 4XKBA 4BEHB 3CUOA 1X3UA 2P4WA 4A3FJ 3CC4I 5D6EA 4M3GA 5K5QA 1H8AC 1I3QJ 3Q0UA 3WTXC 3CJRB 1K4SA 3GZ6A 1M1EB 3HSFA 2MD5A 4L9VA 2JN6A 4IHYA 3F3XA 2P81A 2X6OA 3WTSC 2HTSA 2P6TA 1UZCA 4ESBA 1P2FA 1OKRA 2O3FA 3CMYA 2CFXA 5DD8A 2P7CB 1NG6A 3CCVI 1IRXA 2Z99A 3EYYA 1WKMA 3GTLJ 4MQVA 3K1MA 4G7HF 3CC2I 2HGCA 3G1LA 5FRNA 4LB6B 2EZLA 1UHMA 5FD6A 1BOBA 2F5CA 3CP2A 1NH3A 5E79C 1W7PD 2FNAA 1K61A 2VLAA 1HXDA 4IO9F 3IWFA 1DU6A 4A3DJ 3O8GA 1LJ9A 1X1CA 2VBWA 2VBZA 3D5SC 4OOIA 1HOMA 2EIKH 4XICA 4IHTA 2KQRA 5L3DA 3W2VA 2A68F 4OMZA 2JUGA 3CJQB 5GAGJ 4E7LA 1HC8A 2XAGA 2DA3A 2CV2A 4A3MJ 5FO5A 3SFZA 2L01A 4RMNA 3I4NJ 3WTUC 2MYSA 2ECCA 2MH9A 4OU0A 3LSHA 2AS5F 5JR3A 4BHPA 3LSRA 2Y0SN 2RGVA 1V3FA 2E1MB 3GFMA 1SVMA 4X1EA 1WJFA 4M71A 3K2AA 5E1WA 2EFOA 3G4SI 4EEFG 4PGGA 4G7OF 2K85A 3BDDA 2BXYA 2GOMA 3O8HA 5JI6A 4XIDA 2DA2A 1SFEA 2HOAA 3K7AJ 2LF7A 1BR4A 1S72I 2HOTA 4AC0A 2H8RA 1G6NA 2OQRA 4FISA 3TL4X 1YS7A 2WB1N 3KZYA 2K86A 3TOAA 3PL8A 3NARA 1LE8B 2LH9A 2WAQN 2OTJI 1K7AA 1LNWA 5F27A 1ZRDA 3V42A 1R71A 4IF4A 2VKHA 1ZRFA 2MW8A 3LSKA 2B0LA 1VQKI 4M6VA 3BR0A 2X6XA 1DDNA 3FBIB 1JHFA 1P6RA 1JUMA 3VYUB 5E17F 1W7PA 3D5LA 2FOKA 1Y8RB 5IP6A 2HVRA 4OIRF 1LEAA 2IA0A 2HQ5A 4HNVA 1U9NA 2K3FA 3NWSA 1WPKA 3T5XA 3TMOA 4V19K 1FP2A 3D1NI 2FU4A 1P9QC 2HKOA 4BH9A 3GWZA 1SD6A 5LGNA 3QRFF 4I76A 1PVEA 2GXGA 4IPAA 3S17J 4YRVA 1OQYA 3S3NA 1RPWA 2IP2A 4K2EA 5H6QA 2WTEA 3RJPA 3GVAA 2W82A 1TQMA 4IHVA 5L3CA 4BU2A 1VQPI 2HVSA 3QPHA 1A36A 1HSJA 2JSPA 1FT9A 4NNJA 5AONA 1U5TC 2YS9A 4LG3A 4NHJA 1PYVA 2BW3B 2EV6A 4RM2A 2QKMB 1XPXA 2NAZA 5BPDA 1XSDA 1S6LA 1JI8A 1XSXA 2Q1ZB 4UNOA 2ELHA 1LDKB 4GGGA 2LBFA 3HXLA 1AOYA 1E3PA 4G9YA 4BQOA 3OYIA 1B8IB 1YI2I 2CW8A 2R3SA 2F4OB 4Y4RA 2FE3A 3KP5A 1ON2A 2JVGA 4JX5A 5HS9A 3LFKA 4L9NA 4B3AA 5ILSA 3I59B 3JCUC 3F6OA 2G0EA 3OL3A 2HEOA 2NVTJ 5J8FA 3JRAA 3BC8A 2R92J 1B9MA 4AIDA 1XC5A 2V1DA 1Y6IA 4UXNA 4HF0A 1Z6TA 2MC3A 3MWMA 5JHFA 2WA0A 4ABZA 1YW8A 3DBHB 3GW2A 4BE2A 4BAYA 5JVTA 4RB3C 3CO6C 3SZGA 3BLYA 2DMTA 1LUJB 1IXRC 4HSTA 4AVPA 1E2XA 2W00A 2FF4A 4FX0A 1ZG5A 3U9GA 4AIJA 2FNPA 2XGCA 4DBRA 2WBMA 3MEXA 4UUTA 4WXDA 3OYJA 3KYDB 3N97A 2Z16A 3O3KA 1S9HA 3O6BB 3FXJA 1HW1A 4LFUA 1MH4A 3S93A 1U3EM 3RYPA 1UHWA 4ENJA 2RREA 1IUYA 2R7DA 3H5NA 2HXOA 4C2TA 1ZH5A 2ID6A 1SFOJ 1S3JA 2QBYB 1SD7A 4IVNA 1VNDA 1IRFA 1DQUA 2XKPA 3WODF 2E1NA 1EH7A 3PSIA 3VFZA 2R5YB 5D5XB 2A6EF 2OF7A 1HCRA 5IYBJ 3J7AY 2X48A 4CZZA 3ZMVA 3BY6A 2BY3A 3ELKA 1MBHA 3LA3A 4D1QA 5B1AH 2CQKA 4IOAF 3VYSB 1BIAA 1XCBA 5DD4A 3WTYC 1ZLJA 2W48A 5CKTA 5EEAA 2Z33A 2FBHA 3REOA 1D8JA 3PQKA 2X6WA 2O03A 1OYWA 4D5CA 2VJ5A 1I1SA 1KQ8A 4LD5A 2VT2A 2Y31A 1MZBA 1OR7A 2KZVA 1X3WB 3BJOA 4EJWA 2ZJ2A 2DFHA 2M7BA 5E1XA 1D1AA 4OMYA 5H2FC 2XAUA 2IA1A 1KU9A 2A3SA 4DOZA 1Y8QB 3RYRA 3I4PA 1FIPA 4F7ZA 3T1BA 3TBIA 3CJNA 1A31A 4B43A 3TKYA 1GV2A 1CF7B 2GIZA 5B66C 3IHUA 1O4XA 3HHHA 4I99C 2X1CA 1QQIA 1Z6RA 2LKSA 1QPIA 2STTA 4RLQA 3E97A 1MMDA 3AFHA 4PJJA 1LDJA 5A2QK 2K27A 4XRMA 4AYBA 4DZPA 3S2HJ 2FEZA 2FMYA 2GXBA 3Q9SA 3IH2A 1JKOC 4U87A 4Y7NJ 1MNEA 2Y9YA 1N75A 4P1WA 2VJIA 4NQWA 4XORA 4A3JJ 2EZKA 1ZTRA 2VIXA 2FQ4A 3KP6A 1RKWA 2KFDA 2CUJA 2MLKA 3OIOA 4LG0A 3W6VA 2FBKA 3OYFA 2OCCH 4FCYA 5K7HA 4DZJA 3DEEA 3BG6A 2MFZA 5B1BH 1P4WA 1WGXA 2Z9OA 3BG7A 5B3SH 1QHHD 3OY9A 2V9KA 4I6ZA 4HLYA 2ZFUA 2IW5A 1IAWA 3VOEA 3BTJA 2QSFX 3DCFA 3CDIA 2OTLI 2HQAA 4HG2A 4IHSA 2EIJH 1XS9A 3F8MA 1I6HJ 1HKSA 5GPCA 2LNBA 4XSXF 1MNMC 4HOBA 3PM1A 4KIGA 2HYFA 1SFUA 4EM0B 1W36C 1ZYRF 4JK1X 2QENA 1WI3A 4KMUX 3ABMH 4KT5C 1RR8C 1GT0C 2OPTA 1WZ2A 1EKEA 1WH5A 3HPGA 5FLXZ 2HWVA 2NVQJ 4JBAA 5D4RA 4UHTA 1L0OC 2V9VA 3BQYA 4RM3A 5EYRA 3SEQA 3TEDA 3A1YA 1WHUA 4CSWA 2VC1A 3P9IA 2STWA 1OCOH 3GCMA 4C30A 1WVRA 2DFIA 4KN4X 1ERDA 2P6SA 5FKMA 5IY5H 2K9SA 4QWQA 1XGOA 3D0SA 5EZHA 3F6VA 2XPWA 1KYZA 3HKZA 1A6QA 1K79A 5J47A 4RAFA 2QA4I 2HYJA 3RKYA 4CICA 3M07A 3R0AA 1S29A 1GLNA 2L4MA 4XBFA 2COMA 4W97A 2D1VA 4KICA 2BY2A 3EYIA 4XKWA 3LSMA 2WY8Q 4NC6A 4E7HA 5GADJ 1TWHJ 4PSWA 1JUSA 2KPMA 3FXLA 1HKTA 3I71A 2FBIA 1VI0A 3HOWJ 2WAFA 2ZJRF 5CVUA 4MIMA 1I5ZA 3H0GJ 4KIFA 3OYMA 2HZDA 3BZKA 2D5VA 3JRCA 3PUBA 1FC3A 2FJ1A 3HBLA 3E5UA 2L9SA 4WXCA 2H1LA 1FSEA 5CVRA 3RCOA 2ZFWA 3NQOA 4V2FA 1S5LC 5LEKA 5E3NA 3CMEI 1HSTA 4M6YA 4KDPA 1ZGWA 1XG1A 4UY8I 3LWFA 5GTIC 2E7WA 4Y33A 5F0FA 1MBEA 3HGGA 3JR9A 3G73A 2ETHA 2EFQA 2L7KA 1YITI 4IRIA 4KNYA 2RVCA 1PDNC 4D9JA 3M9AA 3LQQA 3I4MJ 1R22A 3L9FA 3NWTA 5DYMA 2K5CA 3A4CA 4L0YB 1MGTA 1FMWA 2BVMA 3ASOH 4MQ9F 2XGEA 1EA3A 2ACJA 2P5KA 4II2A 5EEGA 2WC2A 1XCVA 2ZC2A 4DQ2A 4II3A 4RB1A 5J1YA 1QZEA 5C4XJ 3FXUA 5M5XJ 1AKHA 2EIMH 2V1UA 4HLXA 3BWGA 2XROA 3PFYA 2XGDA 4LK0F 1WJDA 2HDWA 2NS8A 2EV5A 1R5GA 2QKLB 5J1RA 1IXSB 4HDVA 5ICEA 4QTRA 2E5ZA 3GFIA 3MZ8A 4A2UA 4JQFA 3BCBA 1RNLA 1YE9A 2ELJA 1KU2A 3ZPLA 1FJLA 1W0UA 2ZMEA 2Y0MA 3QU6A 2JMWA 3ISPA 2LG4A 2EV0A 4HV5A 1FBSA 2V26A 3R0JA 1N77A 3JTHA 1FWZA 2XRLA 5DEQA 2BXZA 2OAZA 4FE7A 4FX4A 2ADUA 4NB5A 1FYMA 1T2KA 4DYCA 2ME0A 3FXOA 4CXFA 2F4MB 1X3ZB 1IN5A 1D3YA 1W5CC 4PGHA 2NXNB 5D4SA 2X0LA 3JAMZ 2R7RA 2XAQA 2RDPA 1FOXA 1QVTA 3UNGC 2ISZA 2R7SA 5E20A 3U1DA 3ML6A 3CCSI 2YSRA 3G2BA 4IOCF 4NC8A 4LITA 4L9JA 2F5DA 3BR2A 4GCVA 2LBFB 3HSEA 3A02A 4P9UA 3AG2H 1XMAA 2K9MA 3ZQGA 2KHMA 3DKWA 3H3ZA 3B6CA 1R23A 3VPRA 3CCUI 4N9IA 1FOYA 3OOUA 2BEOA 5FFXA 2AXLA 1XGNA 5HNFA 3A01A 4RAGA 5M5WJ 2JA2A 2R7UA 3KFWX 3K1NA 3B73A 4Q48A 4LLNA 4BGDA 3F21A 3BR5A 1KA8A 3F8FA 4YIFA 2WWYA 5E3OA 1Z91A 2ICWG 1MH3A 3J80K 4G6TB 4FTHA 1KQ9A 2RQQA 4HSRA 1VQ9I 3S1MJ 1FTTA 2VE9A 3CCQI 2HFHA 5BNGA 3DPTA 3L2VA 3A0HC 2XAFA 3PNYA 4ZYAA 5EF6A 3AL0B 1FPQA 4KN7X 2Q2EA 1WQ2A 2BHZA 4Z2YA 3HRTA 5EEHA 3LAPA 4RGSA 4U7DA 4A3IJ 2DLLA 2CQQA 1VQ6I 3SYTA 4ESFA 1MKMA 2Y75A 5DCFA 4RGXA 3QOPA 2OUMA 5J4VA 1UMQA 5F1RA 1ETOA 2N8GA 1W5TA 4CYCA 3K1PA 5CVIA 4BACA 4M3FA 3GF2A 4N0BA 2B63J 3QP5A 3H92A 2DDBA 4XKVA 4R1HA 3BG3A 2E5NA 1WWXA 4UUSA 4YEJA 2M34A 2JRMA 5J1UA 5ED4A 4S05A 9ANTA 1NG7A 2DPDA 2GOXB 4M74A 2PN6A 5D5VB 5BOXA 4EMSA 4ZJZA 2FD5A 4Q47A 1G3WA 3X2QH 2CQNA 5HDKA 2BBYA 2BVLA 1SC7A 5K1YA 5BPIA 1BR1A 3U2RA 2Q8KA 4U0WA 4BBRJ 4D0PA 1DU0A 2ZXWH 4D7MA 2IS2A 5KCMA 4YELA 2DYSH 3QYBA 4WCGA 1T6SA 1VQNI 4N4OB 1JGSA 3SFIA 4EGYA 2ZNZA 1YJ9I 4I2OA 2Q0OA 3N4MA 4M3EA 3PO3J 1TNSA 2K9LA 2P5VA 4IRGA 2A05A 2DOFA 2CQ7A 4XQFA 3IKTA 1F4KA 2PG4A 3NEUA 1IGNA 2JA8J 3DBRB 4F93B 2DK5A 2IS4A 2KKOA 2HU9A 2KJCA 2ZSIB 4Q5SF 1XX5A 1QBJA 1B1BA 3WU2C 2QSGX 1GHCA 2LOOA 2LSOA 3JW4A 3BPVA 4PCQA 2H27A 1QHGA 3ZQHA 2OCEA 3V8KA 2LKPA 4A3LJ 1YX3A 1O7LA 3IWZA 3Q0WA 3P5JA 3QYFA 5HDNA 1R5ID 4CGZA 2VXDA 1UJ8A 5EDNA 2ZXHA 2XF7A 2X9DA 3HOTA 3W2AA 3WGHA 2LR8A 1H89C 1UELB 2L0KA 4E7ZA 4BS9A 3F0CA 1LFBA 1YW7A 2QSHX 3IC7A 1F43A 1NTCA 2R7WA 2X1EA 4QSHA 1MSEC 1T56A 5HOOA 2GQQA 4G6QA 4W1UA 3CP8A 5GTHC 3KIOA 4NQWB 2QYOA 3GFJA 2FX0A 1OCPA 4S0HB 2AQFA 1DGRM 4LOCA 4CZCA 1H9TA 4LG0B 2FOWA 4BE0A 1WFXA 4XOTA 2JWTA 2PEXA 2HR3A 5D8KB 3RIRA 2VASA 2CWEA 1FY7A 3BT9A 3KYLA 3L2UA 4IZZA 1T95A 2EQRA 2KDOA 4HAMA 4GDFA 4J01A 1SD4A 5TRDA 3K4BA 3JAMK 3S8PA 2XAHA 1TBXA 3ZMZA 3E6CC 1R1TA 1TTYA 2ZB9A 2NVUB 3CMMA 5D6FA 2H6CA 3BQZA 3SEZA 3DU6A 1O57A 2H09A 3EQLF 2QF7A 1MBGA 4BYYA 2E2IJ 4PZJA 2HOEA 4QLCU 1O3TA 2QGUA 4UV8A 4HNUA 2XAJA 3DU5A 1LKXA 1R58A 5M3MJ 4UB8C 2J5OA 2M4KA 2JPCA 3U1KA 2CH0A 5LHGA 1F5TA 3KLNA 4XLNF 4A3BJ 2OJED 1K78A 1BW6A 2EJRA 3FZVA 3BG5A 3EUHA 3FHNA 5D5WB 3KZIC 3V7RA 4RS8A 1DGWY 3K0LA 1J9IA 2E1OA 3AG4H 3P9KA 3HOYJ 3S1QJ 3ZQLA 2DI3A 4E7IA 2UV1A 3NRVA 2RNJA 4OIOF 2O61A 1YX5A 1POGA 2LC2A 3PQJA 2ME6A 4ZH4F 3DTEA 5DM6F 4DIQA 3G1OA 1G8XA 3AKZA 1B72A 4A3CJ 1I50J 2YU3A 3HPHA 3RPQA 5F04A 3QAHA 4CCKA 5HS8A 2O5RA 4RLFA 1ETYA 5HS7A 4A12A 1STZA 2QCOA 4HX7A 5LGTA 1T0FA 5CYVA 2EH3A 4MFDA 3VYRB 2IPQX 1ZKGA 3GBGA 5FD5A 4MTEA 1Z1DA 2DA4A 3C2GA 3E0JB 1BR2A 4HZFA 1LFUP 5CQEA 5E3MA 1QZZA 1LB2A 3KLOA 3DV8A 3FK6A 4J19A 3E5QA 3PIPF 1YLFA 2CSOA 1CQTA 3HUGB 3IAM2 4HNTA 4XM3A 4PUSA 4ZTJA 2HPIA 5IP7J 2LYCA 2MBFA 3BTCA 5HLTA 1JKPC 4UVCA 2DT7B 2IGMA 3FISA 1Y0NA 3SZPA 2VXZA 3ZQQA 4CUGA 4U7BA 1GXPA 2VUMJ 1T39A 2DT6A 4O6JA 2DYRH 1PP7U 4BQNA 3TO7A 4H4KC 5FLMJ 5EJCA 5CQGA 3OYNA 1K4TA 5HDGA 2UWMA 1YS6A 2M30A 5FRMA 5DTDA 2DQLA 1Y0UA 3FIWA 3FXRA 3HB9A 1IN6A 4HF1A 2V7FA 3H9QA 3HC7A 2YR2A 3TDZC 3HL2A 2E1MC 2EINH 2PMZA 6PAXA 1ZLKA 4BQAA 4P5OA 4WF2A 4RB0A 2XASA 4LLLA 1S7AA 3IL2A 4AM3A 2OBPA 3OR2C 3QWLA 3A0BC 4IL6C 4ZYHA 2PI0A 1AKHB 1XD7A 2LK2A 2F5EA 5BQTA 3LA2A 3CJTB 3H1CA 3HSRA 3JRGA 1FOWA 4O5VA 2BYVE 2CJJA 2F6CA 2DDAA 4BJ5C 2CYYA 3ECOA 3F8CA 2BY1A 1KYWA 2GA2A 2XUBA 2UXNA 2R7XA 1H0MA 1J7KA 2ZMEB 4A3KJ 1O7FA 3FMQA 1BIBA 2JZYA 3OYKA 2V6EA 1OMIA 2H8WA 3LSTA 1D1CA 1X4OA 2L54A 5M3FJ 3GTMJ 2JUCA 5ICCA 1MDMB 3KYCB 3LA7A 4I0BA 1ETQA 3OV8A 3ZQ7A 3DLAA 4MO7A 5KNLA 2MH2A 2M1BA 1F36A 2DA5A 3GTGJ 2HS5A 3CF5F 3IRRA 1TWCJ 3ZGKA 1V55H 3DF8A 1BN5A 1XN7A 1MMGA 2XB5A 2XIGA 4RGUA 4XN0A 3FBNB 3QPTA 4Q4ZF 2XGXA 4KA4A 3C7JA 2ZSHB 2LD5A 1SANA 4HRIA 1IDZA 2KP6A 3BR3A 4A0ZA 2I10A 5ICFA 3RKWA 3PJRA 3I3LA 2R5ZA 4L5EA 4FE4A 4XLFA 1N78A 2KDZA 3HZJA 3HRUA 2L02A 3S3MA 2L7ZA 4XMYA 2NOGA 5FROA 1BI2A 2JSCA 2W4SA 3RZOJ 3CTAA 5K5RA 4EJUA 2KISA 3A01B 3VSLA 3TO9A 2WB1A 3MAJA 1B6AA 2GBYA 2VJ4A 3FXKA 2LLKA 2ESNA 4G8XA 2JRTA 4LIUA 2W25A 2Y2ZA 5M5YJ 2HDDA 2NVXJ 1APLC 2WAQA 4CDGA 2OQGA 3CLOA 4BJ6C 3OSFA 5F0CA 2HOSA 2EA4A 3K6GA 5TJJA 3IRQA 5GPAA 1VQ4I 1U5TA 2XRNA 3DBLB 3UR3C 4D7NA 2BHYA 2M0MA 2L2OA 2M45A 2OD5A 1X19A 3IP4B 1FNNA 4I98B 3WU0A 1JGGA 1C0WA 3OL4A 4B1RA 1XSVA 3RQ4A 4I7HA 2Q2EB 4DYQA 4RBOA 2VQGA 4ZC3A 4NDLA 4XRSA 3G71I 2E2JJ 3S2WA 2HDCA 4IQJA 1LFPA 2FSWA 3DXJF 4LMYA 4UV9A 1R9TJ 2VT3A 3I9V2 4L9TA 2IBDA 3H35A 4DNCA 1SMTA 1D5YA 2W84A 4MNUA 2VPRA 2OU2A 5FGMA 4CYCB 1YJWI 5F1JA 4PDKA 4HBLA 2NNNA 1ZG3A 3WHBA 4HDUA 2O9LA 4ZDOA 2O7OA 3L7WA 3C2BA 3TW7A 1VZ0A 3I53A 3CLQA 4UUSB 1HDPA 1BBYA 3WTTC 2NS0A 1YQAA 4ON0A 2K9NA 2RQPA 2V1NA 2PLYA 2M4GA 1FSHA 2RKHA 3E3VA 3ZN0A 1O3SA 4IXAA 3GXOA 3ABUA 4HQEA 1A6IA 4HW0A 4BDZA 1G3YA 3W3CA 3QPLA 3QP6A 1QVUA 4MHGA 4BXFA 5JVGF 1GDTA 1YTYA 2X6YA 1ODDA 1WJAA 3RDIA 4BXUA 1OYYA 2WADA 2V9PA 3HOSA 5K7FA 1BI0A 2Z1DA 5FKKA 3ZR8X 3OYHA 3G6EI 3ZXSA 3FF5A 2K3PA 3FWEA 4G94A 5FFZA 4RB2C 1T38A 1FMVA 3O2PE 3SQNA 4FETA 3H3UA 5IP9J 3MZHA 1WH7A 3DLLF 3CF2A 4P55A 4HYEA 3SZTA 2HPMA 4OAYA 1LQ1A 2K4JA 4KYWA 5LHIA 3CMAI 1HW5A 3J7ZI 1MMAA 1TWFJ 1YIOA 3MKYB 3VWBA 1LEBA 2KL4A 3E7LA 2HYGD 3TO6A 2B9SA 1OCCH 2K02A 2PX9A 2MD0A 3FKJA 1JKQC 2L9RA 1TWGJ 2E19A 2UZKA 2CV1A 1VQ5I 2CQXA 5DCMA 3WTZA 2A07F 1JHHA 2Y48A 4G6DA 3FM5A 4EJTA 1XB4A 4RAZA 3COAC 2CUEA 2LF8A 2EBIA 1T33A 2RAEA 2BV6A 3CC7I 2PJPA 2VL8A 2CS3A 2VPLA 1TWAJ 3K4NA 2X4HA 3HUGA 3ZOBA 3H5AA 2A5WA 2JTVA 1DUXC 5JHUA 3GTKJ 3QOEA 3CUQA 2QQ8A 2LREA 2KJBA 4Y13A 2IT0A 3TDUC 3JRBA 4FQGA 4L0ZB 4KUMA 5D5UB 1W36D 1VQ8I 5J6XA 4HX8A 2YX7A 1FYKA 2QQAA 4KIBA 1T8IA 2JA5J 4IX7A 3V8LA 2IA2A 3HEFA 1OISA 3KX2A 1SVLA 2EFPA 2F48A 3JRDA 1F1ZA 2MABA 4U0YA 2TCTA 3JSPA 1QZYA 4L5IA 4IHXA 5LRSA 3ZP5A 2PFBA 2K4BA 4HEA2 1LVKA 2H94A 3PFIA 1R00A 4Z6YA 2GWRA 1W0TA 1R6RA 2FRHA 2H1KA 1RESA 4EVIA 1JUPA 4AUXA 3J81Z 1K6OA 4M9XA 3F9KA 5IT9Z 2DMUA 1AWCA 2W85A 1BC7C 2X1DA 1QPMA 3K4LA 4XR6A 5CJ9A 1J5YA 1FBQA 1YJNI 1K78B 2E35A 1TW2A 2NS7A 2AO9A 4CO8A 3H3VK 2ELKA 1TT5B 3A03A 2FMLA 2COBA 3I58A 2O0YA 1U0JA 3AG3H 4I01A 4YFKF 3Q0VA 4EATA 2DBBA 1MD0A 3TP0A 3K70D 1BOAA 3S32A 2R0QC 2FQ3A 5CLSA 2R7ZJ 2DMPA 2GM4A 3I64A 4JOMA 2XF5A 2GZWA 3W2WA 4B47A 1B72B 2AQEA 4M72A 4F3QA 3L09A 4IKFA 4XL9A 5ILVA 3ASNH 3OS1A 1MDMA 1X1AA 1L3LA 1GVJA 3LOCA 2E60A 3S3OA 1ONVA 5ILUA 1SFXA 2W1OA 3QQAA 4PSXA 1RRJA 2DOEA 1MNDA 5LHHA 2P0WA 4JYKA 3ECHA 4ETSA 4Y15A 2XVCA 2LFBA 2VJJA 4GXOA 4B3XA 2DA1A 2LRDA 4ENNA 3RKXA 2DMNA 2QWWA 2QEXI 1ON1A 2F5VA 2G7UA 3IH4A 3HRSA 1WRJA 2G7HA 3VYTB 2QZ8A 3L2CA 4AIKA 3HOUJ 3RPUD 1DPUA 3C2HA 3I54A 2EZIA 1ETKA 4PJNA 5E1ZB 1IUFA 5DS9A 1HDDC 2ZCWA 3CZ6A 1IO2A 4JX4A 1P4XA 2R7OA 4D5FA 4Y17A 4CHUA 1ZELA 5IT3A 1G2HA 3CCRI 3B02A 5FLXK 1X1PA 1MJAA 1OFCX 5LRRA 4CYDA 1KGSA 2L3DA 1X2MA 3OOPA 2WV0A 4EGZA 1VFCA 5KAFC 1R4MB 4PJ0C 4IJAA 3MD2A 4V2GA 4L5JA 5F6FA 3PUFA 4ENMA 5FJ8J 2VONA 3MN2A 2LDUA 4RA2A 1J59A 1I39A 4F92B 2ZNYA 1G3TA 1Y1VJ 2KZGA 1XGSA 2KLOA 1ZG1A 3T8TA 2JK3A 3ABLH 5AIPA 1SFKA 3DPUA 2CO5A 5E8IA 1T08B 3R4KA 3MVPA 1BM9A 2MLGA 3PNTA 4R79A 1D1BA 4ZDPA 1JXSA 1XMXA 1IJWC 2DU9A 4HPQA 2XPVA 3I5UA 3L2WA 4HX4A 1LPQA 2A61A 4MEXF 4CCJA 3DTIA 2MGQA 3GEZA 1MMSA 1B9NA 3RQIA 3RPUA 2O6GE 4ZTFA 3RTRA 4UVBA 3WE3A 3KCCA 3WHCA 2R7TA 1Z3XA 2ESHA 1X58A 2V1XA 2Y30A 4Y3OA 3JSOA 1RZ4A 4NC7A 2JJ7A 1RIOH 2ZJPF 4A69C 2PMHA 3BCAA 4XRSG 4JX6A 1U8RA 2G9WA 2XB0X 3H9JA 4I0AA 3VEPA 2TDXA 3S1RJ 3L00A 4A6DA 1DP3A 5D8LB 1EJ9A 2VQLA 4P96A 3CCYA 2P7VB 4EJOA 4BDYA 2ZJQF 2LY1A 1YFHA 1U8BA 3M7GA 1I3AA 1V4RA 3GLLA 4CA0A 1E3OC 2BGCA 1VTNC 1X4PA 3OS0A 1R5HA 2A6TA 2CRGA 4AVZA 3BOQA 3K4MA 2R5ZB 1IF1A 2HI3A 3CQZJ 4YFXF 3L2QA 1EF4A 4F52A 3BTLA 3AG1H 1GV5A 2LKXA 5IT9K 2Z3YA 4XRFA 2IXSA 4YIRX 4AU7A 3RI4A 5CPRB 5LLQA 2OZ6A 3WTVC 2OV7A 3PO2J 3IV5A 1IN7A 3HIFA 2PQ8A 3DP7A 5GAHJ 3JRHA 1G4DA 3GMEA 1Q1HA 3M1EA 1ITYA 5EG0A 1Y56A 3OYEA 1A35A 1MJBA 3QODA 1TP4A 3ONQA 5FLVA 1BC8C 1U5TB 2V4JC 1YRNA 4IRHA 3HJEA 2QVOA 1MBJA 1A04A 3OYAA 5EGOB 5IPAA 4AWXB 3RSNA 3S2DJ 2LY2A 4GFBA 3GLXA 1OYIA 3I0TA 1WJBA 2DN0A 2E2HJ 2OA4A 3T8RA 1CGPA 4BL0B 3VDXA 1ZR4A 1FIAA 3KE2A 4WWCA 3AAFA 4I09A 2EB7A 1RR7A 2JPBA 2D45A 3TOBA 1WJEA 2RNGA 4WXHA 2KIQA 3LFUA 3AL0C 2ZO4A 1SAXA 3OYGA 3BROA 3FK7A 5JFRA 3KEOA 1ETXA 1XDSA 3ABTA 4KT6A 3W6KB 1O3QA 1IXCA 1GXQA 1ZR2A 2BY0A 1SEUA 1IW7F 2D2WA 2YUSA 4M9ZA 3TGNA 2EZHA 1DPRA 1QGPA 4N9HA 4A0XA 1J0RA 2XPUA 4ZZLA 1E17A 3S15J 4PJLA 3ULQB 4BHCA 5DUIA 1S7OA 3KPHA 2M3AA 2DTZA 2CMPA 1BA5A 2M8EA 1KZHA 3OS2A 4FASD 2DA6A 2ECBA 5HLGA 1QO0D 1TQIA 4HV6A 1IV8A 1UG2A 2IGOA 4G7ZF 1ZREA 2W7NA 1MBFA 1TW3A 3EETA 2KIUA 1BW5A 5C3EJ 4RGRA 5DDGA 3WTWC 1ACIA 3HM5A 2VKDA 4AYBN 1HF0A 3GTOJ 3FM3A 4WX9A 3WGIA 1HW2A 1Z3YA 1TT0A 5LGUA 2WY7Q 3PIOF 4BBSJ 4XLPF 1ZAOA 3D5RC 2FUG2 1V5GA 4HQMA 4KITB 1TL8A 3ZMDA 1V5FA 4ESJA 1OR7C 4EV0A 4A5NA 4F55A 5A2QZ 3RKQA 1FYLA 2DCEA 5DCMB 2DQRA 1IC8A 4ZYEA 2DT5A 4B44A 5FB2A 1R36A 2L4AA 3VSKA 3IUOA 3ESWB 3HDDA 1QU3A 2KT0A 2NRAC 3IKVA 5KAIC 1JE8A 2A69F 1WCMJ 2RN7A 4E4HA 1YW9A 2B7EA 4YFNF 4OIPF 2YPRA 3F22A 1YIJI 2ZXIA 4UUVA 2VQHA 3MQ0A 4ASNA 2ZXJA 2DMQA 2E71A 3C18A 3CUQB 3KZZA 1BL0A 2GXAA 3KP2A 1ETWA 4BJTA 1RI7A 3EDPA 4RAYA 2KRFA 1GVDA 1PUFA 3K4KA 3OYLA 1PUEE 4A0YA 2E36A 1B59A 1TC3C 1SD5A 1KU3A 5LEJA 1W1WE 4A6EA 1AU7A 1NHAA 4PFOA 1ZGAA 1FZPB 4JP0A 3R61A 2WAEA 2LMDA 2M5WA 3PSFA 3S14J 1I6XA 1BJZA 2W57A 4CCOA 3ZQCA 2QQ9A 2NNYA 3GTJJ 2YX4A 3FX3A 1YHQI 1FX7A 1ZHFA 5B5EC 1I27A 3HKZN 2CV0A 3GTQJ 2KIMA 1KQ0A 4A93J 3OMYA 3LMMA 2UXXA 2DA7A 2V6CA 1J2XA 4HA8A 3M8JA 1EH6A 2L9NA 4B4CA 1YO5C 2DOAA 1Z7LA 5H20A 2VKVA 5KK1A 4DBQA 3VODA 4O3MA 4BKXA 1BI1A 4YIIA 4BXXJ 3SDBA 4HF2A 4G12A 5DV5A 3Q5FA 1JJ6C 4XLHA 3KETA 1IRGA 3LNQA 3BZCA 1R1VA 3SJMA 3FDYA 3C1DA 4UVAA 1Y1WJ 3LSIA 2HTJA 2K40A 4X6AJ 2K9QA 3FKIJ 2XSDC 1UB9A 5E3LA 4BNCA 2P8TA 1ZQ3P 2I5UA 4ZDLA 5J3LA 3MZYA 2DK8A 2PJRA 2F2EA 3CDLA 3K69A 3CD6I 2R7VA 3WU1B 1ORKA 5CVJA 4B48A 2CW0F 5C4JJ 5BMZA 5KVRA 2XHKA 2IJLA 3K4CA 2L7MP 3K9TA 1P7JA 2MA3A 2GLOA 1AA7A 1O3RA 1Z21A 4XLAA 2JA6J 1ZGJA 2JVHA 3GYHX 4XK4A 3FMSA 4GYGA 4DYRA 3K10A 1XGMA 2IVMA 1BJAA 3W6JB 1OLTA 4BE1A 2Y0SA 2C6YA 4M9SA 1G3SA 2LTPA 5L3FA 1QA6A 2O8XA 4NUBA 2GA1A 3N05A 2M87A 4KJZA 1HBXG 3BR6A 1REPC 5FKLA 2EFNA 3E6MA 1HA8A 3KP7A 1Z77A 1U2WA 1D8KA 2XSJC 1U78A 1N25A 1P92A 2QQBA 4BEHA 3HG9A 1G59A 1ETVA 3QYEA 3MKZA 2A5YB 1UFMA 2E7XA 5H6RA 3JRIA 1HKQA 3CUQC 3H9GA 2X85A 3HTUA 5F64A 4GYIA 1WJ5A 3CCLI 4XNFA 4ENKA 1YYVA 5HLIA 3HRMA 4GO1A 4E7JA 4S04A 2CW7A 3E6BA 4EJVA 3JTGA 4OIQF 3WGGA 5HNHA 2PBIA 4C2MJ 5EGOA 3L1PA 1JTXA 2HQRA 1D0XA 2YU9J 3S1NJ 2KRHA 2VOOA 3ZQFA 2KIFA 1OCRH 3F8BA 1ULYA 5TGTA 3LAJA 5ICGA 4MFEA 4EM2A 2EK5A 1XTAA 2A6HF 3BG9A 1QNTA 1W4MA 1USTA 4QPOA 3OYBA 5HLHA 1R4NB 1TNTA 2FA5A 3OYDA 5LD2C 2CGPA 3HOXJ 2EPFA 1WJCA 1TLHB 5IYCJ 3M4OJ 1LVAA 2DO7A 3C3WA 1ZARA 2L7FP 4UB6C 4F91B 3SHFA 3M1CA 4CH7A 3E6DA 3LSPA 2IEKA 1E0EA 4X0GA 2VBXA 4N4NB 1HLVA 1OJLA 4XOPA 4ZZDA 5HVQC 3ERMA 4ZYDA 4YG2F 2FXAA 2CUZA 3BP8A 1OPCA 2WV1A 5FKOA 2F5FA 2K7LA 2MSYA 3R60A 3M8EA 4I02A 1K6YA 3CDHA 3NAUA 4BHBA 3F72A 2JA7J 3T0YA 3FXMA 4TV7A 1VF9A 2ZMEC 5JLWA 2VN2A 3OR1C 4PFPA 3MKWB 2AHQA 1FOKA 5J4YA 3Q9VA 2F4IA 3LSGA 3DFGA 1LE8A 5K7ZA 1H88C 1SAUA 2M9HA 5L3EA 1MJ9A 2DFEA 2CU7A 3DEWA 1RUOA 4A3GJ 5LFAA 1Z0XA 4J00A 4AD9A 1D0ZA 2OC6A 4FT8A 5CVVA 4CCNA 3LQRA 5ERIA 3V8JA 4NBQA 2E34A 1F9NA 3EPZA 5GAEJ 3E1SA 2BOLA 3JREA 4U88A 3DKXA 3WG9A 1DP7P 1USSA 3F23A 1XMKA 1MSFC 2XV4S 4E7SA 4KISA 1K83J 4DW6A 1BI3A 3BTIA 3OWTA 2KRCA 1X1BA 2AXTC 3BPXA 4B09A 3V4GA 1X2NA 5TISC 1KU7A 1MW7A 1ENHA 2HNHA 4H0EA 2VB6A 1X1DA 3J80Z 3CCEI 3H0DA 1ZN2A 3DQVC 3QU3A 3VB2A 5EG0B 1S8NA 4MTDA 3V7CA 1KONA 1OCTC 4XLEA 1YRNB 5KHDA 2HXIA 1D5VA 2VBYA 3I55I 4C9YA 2DFFA 2RV8A 2KMUA 3CCJI 3OYCA 4CCLA 3ZMUA 3L2RA 5F0HA 1J75A 1UCRA 4IQ4A 4M73A 2DODA 4XONA 1UG0A 2EFWA 4U0VA 3K70C 3ABKH 3MFKA 3DPLC 2QM3A 2IRFG 2Z2SB 3HTSB 2BW3A 4L18B 1FLIA 2NYXA 4WK8F 3KEYA 2VC0A 5J40A 2JT1A 2GAUA 4LJZF 4C3JJ 1JT0A 1U9OA 2IS6A 1S7EA 4MGRA 2IGNA 5DM7F 2CG4A 2NVYJ 3R6SA 3MMYB 1RUNA 3GZ5A 3HHGA 1JKRC 2LY9A 2P5LC 1RETA 3K2ZA 1B8IA 4XSZF 2ZKZA 3E5XA 3DKYA 3WE2A 4OAZA 4BY7J 2LP0A 2NOJB 3H5RA 2VE8A 4DGWB 2QUFA 4GRIA 2DPUA 4LLGF 1Z67A 3DWLE 2L5QA 3I59A 1J09A 5GP9A 3GFLA 1PP8F 4BY1J 2M7AA 3CO7C 4IEJA 3GUDA 5FKNA 2R4GA 5EZGA 3CESA 1Q1VA 3MCZA 4KFCA 1IRZA 2V79A 3FMRA 1R7JA 2DW4A 1P7IA 1Z9CA 3OIQA 2ISYA 1IN8A 3ZN1A 3I56I 2XF6A 1WI9A 3ZMTA 4KMFA 1IDYA 5IOYA 1VQ7I 4PJMA 1YG2A 4E7KA 4PK4A 2D1HA 3BJ6A 2VOPA 4M6XA 3P7NA 5L3BA 3G1MA 4IHWA 3ZCOA 2DXIA 2LVSA 2HQNA 4C3IJ 5J8CA 1XDUA 2CFOA 1NK3P 1FP1D 2RC4A 3FHZA 4DJAA 1H9GA 1W7PB 3FXQA 1RC9A 5IYDJ 5HODA 3V7SA 2VKEA 4LB5A 2QBYA 2Y69H 1PJRA 3GX4X 4A5MA 4ANJA 1TQPA 1GUUA 2R5YA 4CCMA 3BZ6A 5E18F 3HOVJ 3TW6A 2EILH 3CCMI 2UUZA 3HOZJ 1Z7UA 3IH3A 4C3HJ 2XKOA 3U21A 4QIWN 2OZUA 4LK1F 1ZRCA 2DAOA 3HGYA 3SXYA 4FHTA 1R49A 2VQCA 2J5PA 2M0CA 4Y52J 3SDGA 1IV6A 2VI6A 2PMUA 1JT6A 1YOVB 1PUFB 1UHSA 5BS6A 2MC4A 4XLCA 4A3EJ 5LBQA 1FTZA 1VQLI 2I8DA 4RDUA 4E70A 3GZNB 1HQCA 3KP3A 3KEQA 1OCZH 1I1GA 3ROUA 3JRFA 4EM1A 2EA2A 3ZQIA 1JTYA 1QRYA 1EV7A 3BJAA 3H36A 3EUAA 1VQMI 1Y39A 1Z05A 3HYIA 1R1UA 1P4AA 3KP4A 5F08A 2R7FA 4LGWA 3ZMSA 4OWRB 2E1CA 4OINF 2HKXA 4ITVA 1CF7A 1TZLA 4AIHA 2MG4A 2O8KA 2CUFA 2W24A 3EUKL 5E8GA 1JJ8C 1FBUA 3J7AO 1B4AA 3M3YJ 3S16J 1FEXA 1MIJA 1EH8A 1UAAA 2IS1A 3K4JA 1D0YA 1U6GA 1LDDA 4EQQA 1V54H 1SMYF 2BZTA 2M8GX 4R8HA 3WG7H 1T98A 5IOZA 1VQOI 1E3HA 3P9CA 5JLXA 4MLOA 2R93J 3ZRGA 4BQQA 2M2EA 5DUKA 4LIVA 3ERED 2EWNA 2L9VA 2DJNA 4M3DA 4C2UA 3EUHC 3OSGA 2VODA 2GIVA 2IGKA 3F8NA 2DTRA 1SVOA 4XKCA 4M3BA 1AHDP 3TP3A 1RKTA 2JQ7A 3TQNA 2XC7A 2PJRB 4ZYGA 1IZ1A 1W5SA 3IAS2 3GTPJ 5K5OA 2XDVA 2IAIA 1MMNA 4P9FA 3LSJA 4BUPA 3J7YJ 1V5EA 1NK2P 3QPSA 2Y9ZA 2DJIA 3UKGA 3RZDJ 2TRTA
chains in the Genus database with same CATH topology
2HZTA 4B8XA 2ZBKA 2QLZA 1IN4A 2Z5UA 3GO5A 4MEYF 3G3ZA 1WSUA 2BE5F 3M8FA 3J81K 3DEUA 2H6BA 5L3GA 5AIQA 3CUOA 1X3UA 2P4WA 5D6EA 5K5QA 3WTXC 3GZ6A 3HSFA 2MD5A 4L9VA 3F3XA 3WTSC 2HTSA 2P6TA 4ESBA 1P2FA 1OKRA 2O3FA 2CFXA 5DD8A 2P7CB 2Z99A 3EYYA 1WKMA 4MQVA 3K1MA 4G7HF 2HGCA 4LB6B 1UHMA 5FD6A 2F5CA 1W7PD 2FNAA 1HXDA 3IWFA 1LJ9A 2VBWA 2VBZA 4OOIA 4IHTA 5L3DA 2A68F 4OMZA 2XAGA 5FO5A 3SFZA 2L01A 3WTUC 2MH9A 4OU0A 2AS5F 5JR3A 4BHPA 2RGVA 1V3FA 3GFMA 4M71A 5E1WA 2EFOA 4G7OF 4PGGA 3BDDA 5JI6A 1SFEA 2LF7A 1G6NA 2OQRA 1YS7A 3KZYA 2K86A 3TOAA 1K7AA 1LNWA 1ZRDA 4IF4A 1ZRFA 2B0LA 1DDNA 1JHFA 1P6RA 5E17F 1W7PA 3D5LA 2FOKA 4OIRF 1LEAA 2IA0A 3T5XA 1FP2A 2FU4A 2HKOA 4BH9A 3GWZA 1SD6A 5LGNA 3QRFF 2GXGA 4IPAA 2IP2A 4K2EA 5H6QA 2WTEA 3RJPA 3GVAA 1TQMA 5L3CA 3QPHA 1HSJA 1FT9A 5AONA 1U5TC 4NHJA 2EV6A 2NAZA 5BPDA 1XSDA 1S6LA 1XSXA 4UNOA 2ELHA 1LDKB 4GGGA 1AOYA 4G9YA 2R3SA 2FE3A 3KP5A 1ON2A 5HS9A 3LFKA 4L9NA 5ILSA 3I59B 3F6OA 2HEOA 5J8FA 1B9MA 2V1DA 4UXNA 4HF0A 1Z6TA 2MC3A 3MWMA 1YW8A 3GW2A 4BAYA 5JVTA 4RB3C 3CO6C 1IXRC 4AVPA 1E2XA 2FF4A 4FX0A 1ZG5A 3U9GA 4AIJA 2FNPA 3MEXA 4WXDA 3N97A 3O3KA 3O6BB 1HW1A 4LFUA 1U3EM 3RYPA 1UHWA 4ENJA 1IUYA 2R7DA 1ZH5A 1S3JA 2QBYB 1SD7A 4IVNA 1IRFA 2XKPA 3WODF 2E1NA 1EH7A 3VFZA 5D5XB 2A6EF 4CZZA 3ZMVA 3BY6A 3ELKA 3LA3A 2CQKA 1BIAA 1XCBA 5DD4A 3WTYC 1ZLJA 2Z33A 2FBHA 3REOA 1D8JA 3PQKA 2O03A 1OYWA 1I1SA 1KQ8A 4LD5A 2VT2A 1MZBA 1OR7A 3BJOA 4EJWA 2ZJ2A 5E1XA 4OMYA 2IA1A 1KU9A 2A3SA 3RYRA 3I4PA 4F7ZA 3T1BA 3CJNA 3TKYA 1CF7B 3IHUA 3HHHA 1QQIA 1Z6RA 2STTA 3E97A 5A2QK 1LDJA 2K27A 2FEZA 2FMYA 2GXBA 3Q9SA 4NQWA 3KP6A 2MLKA 4LG0A 2FBKA 1P4WA 2Z9OA 4HLYA 1IAWA 2IW5A 3VOEA 4IHSA 3F8MA 1HKSA 2LNBA 4XSXF 4HOBA 4KIGA 2HYFA 1SFUA 4EM0B 1ZYRF 4JK1X 2QENA 4KMUX 4KT5C 5FLXZ 2HWVA 4JBAA 5D4RA 4UHTA 1L0OC 2V9VA 2VC1A 3P9IA 2STWA 2DFIA 4KN4X 2P6SA 4QWQA 1XGOA 3D0SA 3F6VA 1KYZA 1K79A 3RKYA 4CICA 3R0AA 1S29A 2L4MA 4XBFA 2COMA 2D1VA 4KICA 3EYIA 1HKTA 3I71A 2FBIA 5CVUA 1I5ZA 4KIFA 1FC3A 3E5UA 4WXCA 1FSEA 5CVRA 2ZFWA 3NQOA 5LEKA 1HSTA 4M6YA 4KDPA 3LWFA 2E7WA 3G73A 2ETHA 2EFQA 4IRIA 4KNYA 2RVCA 1PDNC 3M9AA 3LQQA 1R22A 3L9FA 5DYMA 4L0YB 1MGTA 4MQ9F 2ACJA 2P5KA 5EEGA 2WC2A 1XCVA 4DQ2A 4RB1A 3FXUA 2V1UA 4HLXA 3BWGA 2XROA 4LK0F 2EV5A 1R5GA 1IXSB 4HDVA 5ICEA 3GFIA 4A2UA 4JQFA 1RNLA 3ZPLA 1KU2A 2ZMEA 2Y0MA 3QU6A 3ISPA 2EV0A 4HV5A 1FBSA 3R0JA 3JTHA 1FWZA 5DEQA 2OAZA 4FX4A 2ADUA 4NB5A 1FYMA 1T2KA 4CXFA 1IN5A 1D3YA 4PGHA 5D4SA 2X0LA 3JAMZ 2XAQA 2RDPA 2ISZA 5E20A 3U1DA 3ML6A 2YSRA 4L9JA 2F5DA 4GCVA 3HSEA 4P9UA 1XMAA 3DKWA 3H3ZA 1R23A 4N9IA 2BEOA 5FFXA 2AXLA 1XGNA 3KFWX 3K1NA 3B73A 4Q48A 4LLNA 3F21A 3F8FA 1KA8A 4YIFA 2WWYA 1Z91A 3J80K 1KQ9A 2VE9A 2HFHA 3DPTA 2XAFA 1FPQA 4KN7X 2Q2EA 1WQ2A 4Z2YA 3HRTA 5EEHA 3LAPA 4RGSA 4U7DA 2DLLA 4ESFA 1MKMA 2Y75A 5DCFA 4RGXA 3QOPA 5F1RA 1W5TA 3K1PA 5CVIA 4N0BA 3GF2A 3QP5A 3H92A 4R1HA 1WWXA 5ED4A 4S05A 2DPDA 4M74A 2PN6A 5D5VB 5BOXA 4EMSA 4Q47A 1G3WA 5HDKA 2BBYA 5K1YA 5BPIA 3U2RA 2Q8KA 4U0WA 4D0PA 4WCGA 1T6SA 4EGYA 1JGSA 2ZNZA 4I2OA 2Q0OA 3N4MA 1TNSA 2P5VA 4IRGA 3IKTA 1F4KA 2PG4A 3NEUA 2DK5A 2KKOA 2KJCA 4Q5SF 1QBJA 1B1BA 1GHCA 2LSOA 3JW4A 3BPVA 4PCQA 2H27A 3V8KA 2LKPA 1O7LA 3IWZA 5HDNA 4CGZA 3HOTA 3WGHA 1YW7A 3IC7A 5HOOA 2GQQA 4G6QA 2QYOA 3GFJA 1H9TA 4LG0B 2PEXA 2HR3A 5D8KB 3RIRA 2CWEA 1FY7A 4HAMA 1SD4A 5TRDA 3JAMK 2XAHA 1TBXA 3ZMZA 3E6CC 1R1TA 1TTYA 5D6FA 2H6CA 1O57A 2H09A 3EQLF 4BYYA 4PZJA 2HOEA 4QLCU 1O3TA 4UV8A 2XAJA 1R58A 2J5OA 2JPCA 5LHGA 1F5TA 3KLNA 4XLNF 1K78A 2EJRA 3FZVA 3EUHA 5D5WB 3V7RA 4RS8A 3K0LA 1J9IA 3P9KA 2DI3A 3NRVA 2RNJA 4OIOF 2O61A 3PQJA 4ZH4F 2YU3A 3RPQA 3QAHA 5HS8A 5HS7A 4A12A 1STZA 4HX7A 5LGTA 1T0FA 5CYVA 2IPQX 5FD5A 4MTEA 1Z1DA 4HZFA 1QZZA 1LB2A 3KLOA 3DV8A 3E5QA 1YLFA 2CSOA 2MBFA 4UVCA 3SZPA 2VXZA 4U7BA 1GXPA 1T39A 4O6JA 1PP7U 3TO7A 5HDGA 2UWMA 1YS6A 2M30A 2DQLA 1Y0UA 3FXRA 1IN6A 4HF1A 3TDZC 2YR2A 6PAXA 1ZLKA 4BQAA 4P5OA 4WF2A 4RB0A 2XASA 4LLLA 1S7AA 3IL2A 2OBPA 4ZYHA 2PI0A 1XD7A 2F5EA 5BQTA 3LA2A 3HSRA 4O5VA 2BYVE 2CYYA 3ECOA 3F8CA 1KYWA 2GA2A 2XUBA 2UXNA 1H0MA 1J7KA 2ZMEB 1O7FA 3FMQA 1BIBA 2JZYA 1OMIA 3LSTA 2L54A 5ICCA 1MDMB 3LA7A 4I0BA 3OV8A 3ZQ7A 2MH2A 2M1BA 2HS5A 3IRRA 3DF8A 1BN5A 1XN7A 2XIGA 4RGUA 3QPTA 4Q4ZF 2XGXA 4KA4A 3C7JA 4A0ZA 5ICFA 3RKWA 3HRUA 2L02A 1BI2A 2JSCA 3CTAA 5K5RA 4EJUA 3TO9A 3MAJA 1B6AA 2ESNA 4G8XA 2JRTA 2W25A 4CDGA 2OQGA 3CLOA 2EA4A 5TJJA 3IRQA 1U5TA 2XRNA 2OD5A 2M45A 1FNNA 4I98B 3WU0A 1C0WA 1XSVA 4I7HA 2HDCA 3S2WA 2FSWA 3DXJF 4LMYA 4UV9A 2VT3A 4L9TA 4DNCA 1SMTA 2W84A 4MNUA 2OU2A 5FGMA 4PDKA 4HBLA 2NNNA 1ZG3A 4HDUA 3L7WA 3I53A 1BBYA 3WTTC 2NS0A 1YQAA 4ON0A 2RQPA 2PLYA 1FSHA 2RKHA 3E3VA 3ZN0A 1O3SA 4IXAA 3GXOA 3ABUA 4HQEA 4HW0A 1G3YA 3QP6A 4MHGA 1YTYA 4BXUA 1ODDA 3RDIA 1OYYA 3HOSA 1BI0A 3FF5A 5FFZA 3FWEA 4G94A 4RB2C 1T38A 3O2PE 3SQNA 3H3UA 3MZHA 4P55A 4HYEA 3SZTA 1LQ1A 2K4JA 4KYWA 5LHIA 1HW5A 1LEBA 1YIOA 2HYGD 3TO6A 2K02A 2UZKA 5DCMA 3WTZA 2A07F 1JHHA 2Y48A 4G6DA 3FM5A 4EJTA 1XB4A 4RAZA 3COAC 2LF8A 2BV6A 2PJPA 2X4HA 3HUGA 2JTVA 1DUXC 5JHUA 3CUQA 2KJBA 4Y13A 2IT0A 3TDUC 4L0ZB 4KUMA 5D5UB 5J6XA 4HX8A 2YX7A 1FYKA 2QQAA 4KIBA 3V8LA 2IA2A 2EFPA 1F1ZA 4U0YA 3JSPA 1QZYA 4L5IA 5LRSA 3ZP5A 2PFBA 2K4BA 2H94A 3PFIA 1R00A 2GWRA 2FRHA 4EVIA 3J81Z 1K6OA 4M9XA 5IT9Z 1AWCA 2W85A 1BC7C 1QPMA 5CJ9A 1J5YA 1FBQA 1K78B 1TW2A 4CO8A 2FMLA 3I58A 2O0YA 4I01A 4YFKF 2DBBA 1MD0A 1BOAA 2FQ3A 5CLSA 3I64A 2GZWA 4M72A 3L09A 5ILVA 1MDMA 1L3LA 1GVJA 1ONVA 5ILUA 1SFXA 5LHHA 3ECHA 4ETSA 4Y15A 2XVCA 4GXOA 4ENNA 3RKXA 2QWWA 1ON1A 2G7UA 3L2CA 3HRSA 1WRJA 2G7HA 2QZ8A 4AIKA 1DPUA 3I54A 5E1ZB 2ZCWA 1P4XA 4Y17A 4CHUA 5IT3A 3B02A 5FLXK 1MJAA 5LRRA 4CYDA 1KGSA 2L3DA 3OOPA 2WV0A 4EGZA 4IJAA 5F6FA 4L5JA 4ENMA 2VONA 2LDUA 1J59A 2ZNYA 1G3TA 1XGSA 1ZG1A 3T8TA 5AIPA 2CO5A 5E8IA 3R4KA 1BM9A 2MLGA 1JXSA 4R79A 2DU9A 3I5UA 4HX4A 2A61A 4MEXF 3GEZA 1B9NA 2O6GE 3RPUA 3RTRA 4UVBA 3WE3A 3KCCA 2ESHA 3JSOA 2V1XA 1RZ4A 1RIOH 2PMHA 1U8RA 2G9WA 4I0AA 3VEPA 2TDXA 3L00A 4A6DA 5D8LB 4P96A 2P7VB 4EJOA 1YFHA 3M7GA 1V4RA 2BGCA 1VTNC 1R5HA 1IF1A 3BOQA 4YFXF 5IT9K 2Z3YA 4XRFA 3RI4A 5LLQA 2OZ6A 3WTVC 1IN7A 3HIFA 2PQ8A 3DP7A 1G4DA 1Q1HA 3M1EA 1MJBA 1BC8C 1U5TB 4IRHA 2QVOA 1A04A 4AWXB 3GLXA 1OYIA 3I0TA 2OA4A 3T8RA 1CGPA 3KE2A 4WWCA 3AAFA 4I09A 2EB7A 2JPBA 2D45A 3TOBA 4WXHA 2ZO4A 1SAXA 3BROA 5JFRA 3KEOA 1XDSA 3ABTA 3W6KB 1O3QA 1IXCA 1GXQA 2D2WA 1IW7F 4M9ZA 3TGNA 1DPRA 1QGPA 4N9HA 4A0XA 1J0RA 4ZZLA 1E17A 3ULQB 4BHCA 5DUIA 1S7OA 2M8EA 5HLGA 1QO0D 1TQIA 4HV6A 1ZREA 4G7ZF 1TW3A 3EETA 2KIUA 4RGRA 5DDGA 3WTWC 3FM3A 4WX9A 3WGIA 1HW2A 5LGUA 4XLPF 1ZAOA 4HQMA 3ZMDA 4ESJA 4EV0A 4A5NA 5A2QZ 1FYLA 5DCMB 2DQRA 4ZYEA 2DT5A 5FB2A 1R36A 2L4AA 2NRAC 3IKVA 1JE8A 2A69F 2RN7A 1YW9A 4YFNF 4OIPF 2YPRA 3F22A 4UUVA 3MQ0A 4ASNA 2ZXJA 3C18A 3CUQB 3KZZA 3KP2A 1RI7A 3EDPA 4RAYA 2KRFA 1PUEE 4A0YA 1B59A 1SD5A 1KU3A 5LEJA 4A6EA 1NHAA 1ZGAA 1FZPB 3R61A 2M5WA 1I6XA 2W57A 2QQ9A 2NNYA 2YX4A 3FX3A 1FX7A 1ZHFA 1I27A 2KIMA 1KQ0A 2UXXA 2V6CA 1J2XA 4HA8A 1EH6A 1YO5C 5H20A 5KK1A 3VODA 4O3MA 1BI1A 4YIIA 4HF2A 5DV5A 3Q5FA 3KETA 1IRGA 1R1VA 3C1DA 4UVAA 2HTJA 1UB9A 4BNCA 2P8TA 3MZYA 2DK8A 2F2EA 3K69A 3WU1B 5CVJA 2CW0F 5BMZA 5KVRA 2XHKA 2IJLA 3K9TA 2MA3A 1O3RA 1ZGJA 3GYHX 3FMSA 4GYGA 1XGMA 2IVMA 1BJAA 3W6JB 2C6YA 4M9SA 1G3SA 5L3FA 2O8XA 2GA1A 2M87A 1HBXG 1REPC 2EFNA 3E6MA 3KP7A 1U2WA 1D8KA 1U78A 1P92A 2QQBA 2A5YB 1UFMA 2E7XA 5H6RA 1HKQA 3CUQC 3HTUA 5F64A 4GYIA 4ENKA 1YYVA 5HLIA 3HRMA 4GO1A 4S04A 3E6BA 4EJVA 3JTGA 4OIQF 3WGGA 2PBIA 2HQRA 2VOOA 2KIFA 3F8BA 1ULYA 3LAJA 5ICGA 4EM2A 2EK5A 2A6HF 1QNTA 1W4MA 1USTA 5HLHA 1TNTA 2FA5A 2CGPA 1TLHB 1LVAA 2DO7A 3C3WA 1ZARA 3SHFA 3E6DA 2VBXA 4ZZDA 5HVQC 4ZYDA 4YG2F 2FXAA 3BP8A 1OPCA 2F5FA 2K7LA 3R60A 3M8EA 4I02A 4BHBA 3CDHA 3F72A 3T0YA 4TV7A 2VN2A 1FOKA 3Q9VA 3DFGA 5L3EA 1MJ9A 1RUOA 4AD9A 4FT8A 5CVVA 3LQRA 5ERIA 3V8JA 1F9NA 4U88A 3WG9A 1DP7P 1USSA 3F23A 1XMKA 2XV4S 1BI3A 3BPXA 4B09A 3V4GA 1KU7A 4H0EA 3J80Z 1ZN2A 3DQVC 3QU3A 3VB2A 1S8NA 4MTDA 3V7CA 1D5VA 2VBYA 2RV8A 3ZMUA 1J75A 1UCRA 4M73A 2EFWA 4U0VA 3MFKA 3DPLC 2QM3A 2IRFG 3HTSB 4L18B 1FLIA 2NYXA 4WK8F 2VC0A 2JT1A 2GAUA 4LJZF 4MGRA 2CG4A 1RUNA 3R6SA 3GZ5A 3HHGA 2P5LC 3K2ZA 4XSZF 2ZKZA 3E5XA 3WE2A 2VE8A 2QUFA 2DPUA 4LLGF 3I59A 1PP8F 3GFLA 3CO7C 3GUDA 3MCZA 4KFCA 2V79A 3FMRA 1R7JA 2DW4A 1Z9CA 2ISYA 1IN8A 3ZN1A 3ZMTA 1WI9A 4KMFA 1YG2A 2D1HA 3BJ6A 2VOPA 4M6XA 3P7NA 5L3BA 2HQNA 5J8CA 1XDUA 1FP1D 2RC4A 3FHZA 1H9GA 1W7PB 3FXQA 3V7SA 4LB5A 2QBYA 3GX4X 4A5MA 1TQPA 3BZ6A 5E18F 1Z7UA 2XKOA 1ZRCA 2OZUA 4LK1F 2DAOA 3SXYA 4FHTA 2J5PA 2PMUA 5BS6A 5LBQA 4E70A 1HQCA 3KP3A 3KEQA 1I1GA 3ROUA 4EM1A 2EA2A 1EV7A 3BJAA 1Z05A 3HYIA 1R1UA 1P4AA 3KP4A 2R7FA 4LGWA 3ZMSA 2E1CA 4OINF 2HKXA 1CF7A 4AIHA 2W24A 5E8GA 1FBUA 3J7AO 1B4AA 1EH8A 1U6GA 1LDDA 4EQQA 1SMYF 4R8HA 1T98A 3P9CA 5DUKA 3ERED 2EWNA 2VODA 2GIVA 3F8NA 2DTRA 3TQNA 4ZYGA 1IZ1A 1W5SA 5K5OA 4P9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZT A;  4B8X A;  2ZBK A;  2QLZ A;  1IN4 A;  2Z5U A;  3GO5 A;  4MEY F;  3G3Z A;  1WSU A;  2BE5 F;  3M8F A;  3J81 K;  3DEU A;  2H6B A;  5L3G A;  5AIQ A;  3CUO A;  1X3U A;  2P4W A;  5D6E A;  5K5Q A;  3WTX C;  3GZ6 A;  3HSF A;  2MD5 A;  4L9V A;  3F3X A;  3WTS C;  2HTS A;  2P6T A;  4ESB A;  1P2F A;  1OKR A;  2O3F A;  2CFX A;  5DD8 A;  2P7C B;  2Z99 A;  3EYY A;  1WKM A;  4MQV A;  3K1M A;  4G7H F;  2HGC A;  4LB6 B;  1UHM A;  5FD6 A;  2F5C A;  1W7P D;  2FNA A;  1HXD A;  3IWF A;  1LJ9 A;  2VBW A;  2VBZ A;  4OOI A;  4IHT A;  5L3D A;  2A68 F;  4OMZ A;  2XAG A;  5FO5 A;  3SFZ A;  2L01 A;  3WTU C;  2MH9 A;  4OU0 A;  2AS5 F;  5JR3 A;  4BHP A;  2RGV A;  1V3F A;  3GFM A;  4M71 A;  5E1W A;  2EFO A;  4G7O F;  4PGG A;  3BDD A;  5JI6 A;  1SFE A;  2LF7 A;  1G6N A;  2OQR A;  1YS7 A;  3KZY A;  2K86 A;  3TOA A;  1K7A A;  1LNW A;  1ZRD A;  4IF4 A;  1ZRF A;  2B0L A;  1DDN A;  1JHF A;  1P6R A;  5E17 F;  1W7P A;  3D5L A;  2FOK A;  4OIR F;  1LEA A;  2IA0 A;  3T5X A;  1FP2 A;  2FU4 A;  2HKO A;  4BH9 A;  3GWZ A;  1SD6 A;  5LGN A;  3QRF F;  2GXG A;  4IPA A;  2IP2 A;  4K2E A;  5H6Q A;  2WTE A;  3RJP A;  3GVA A;  1TQM A;  5L3C A;  3QPH A;  1HSJ A;  1FT9 A;  5AON A;  1U5T C;  4NHJ A;  2EV6 A;  2NAZ A;  5BPD A;  1XSD A;  1S6L A;  1XSX A;  4UNO A;  2ELH A;  1LDK B;  4GGG A;  1AOY A;  4G9Y A;  2R3S A;  2FE3 A;  3KP5 A;  1ON2 A;  5HS9 A;  3LFK A;  4L9N A;  5ILS A;  3I59 B;  3F6O A;  2HEO A;  5J8F A;  1B9M A;  2V1D A;  4UXN A;  4HF0 A;  1Z6T A;  2MC3 A;  3MWM A;  1YW8 A;  3GW2 A;  4BAY A;  5JVT A;  4RB3 C;  3CO6 C;  1IXR C;  4AVP A;  1E2X A;  2FF4 A;  4FX0 A;  1ZG5 A;  3U9G A;  4AIJ A;  2FNP A;  3MEX A;  4WXD A;  3N97 A;  3O3K A;  3O6B B;  1HW1 A;  4LFU A;  1U3E M;  3RYP A;  1UHW A;  4ENJ A;  1IUY A;  2R7D A;  1ZH5 A;  1S3J A;  2QBY B;  1SD7 A;  4IVN A;  1IRF A;  2XKP A;  3WOD F;  2E1N A;  1EH7 A;  3VFZ A;  5D5X B;  2A6E F;  4CZZ A;  3ZMV A;  3BY6 A;  3ELK A;  3LA3 A;  2CQK A;  1BIA A;  1XCB A;  5DD4 A;  3WTY C;  1ZLJ A;  2Z33 A;  2FBH A;  3REO A;  1D8J A;  3PQK A;  2O03 A;  1OYW A;  1I1S A;  1KQ8 A;  4LD5 A;  2VT2 A;  1MZB A;  1OR7 A;  3BJO A;  4EJW A;  2ZJ2 A;  5E1X A;  4OMY A;  2IA1 A;  1KU9 A;  2A3S A;  3RYR A;  3I4P A;  4F7Z A;  3T1B A;  3CJN A;  3TKY A;  1CF7 B;  3IHU A;  3HHH A;  1QQI A;  1Z6R A;  2STT A;  3E97 A;  5A2Q K;  1LDJ A;  2K27 A;  2FEZ A;  2FMY A;  2GXB A;  3Q9S A;  4NQW A;  3KP6 A;  2MLK A;  4LG0 A;  2FBK A;  1P4W A;  2Z9O A;  4HLY A;  1IAW A;  2IW5 A;  3VOE A;  4IHS A;  3F8M A;  1HKS A;  2LNB A;  4XSX F;  4HOB A;  4KIG A;  2HYF A;  1SFU A;  4EM0 B;  1ZYR F;  4JK1 X;  2QEN A;  4KMU X;  4KT5 C;  5FLX Z;  2HWV A;  4JBA A;  5D4R A;  4UHT A;  1L0O C;  2V9V A;  2VC1 A;  3P9I A;  2STW A;  2DFI A;  4KN4 X;  2P6S A;  4QWQ A;  1XGO A;  3D0S A;  3F6V A;  1KYZ A;  1K79 A;  3RKY A;  4CIC A;  3R0A A;  1S29 A;  2L4M A;  4XBF A;  2COM A;  2D1V A;  4KIC A;  3EYI A;  1HKT A;  3I71 A;  2FBI A;  5CVU A;  1I5Z A;  4KIF A;  1FC3 A;  3E5U A;  4WXC A;  1FSE A;  5CVR A;  2ZFW A;  3NQO A;  5LEK A;  1HST A;  4M6Y A;  4KDP A;  3LWF A;  2E7W A;  3G73 A;  2ETH A;  2EFQ A;  4IRI A;  4KNY A;  2RVC A;  1PDN C;  3M9A A;  3LQQ A;  1R22 A;  3L9F A;  5DYM A;  4L0Y B;  1MGT A;  4MQ9 F;  2ACJ A;  2P5K A;  5EEG A;  2WC2 A;  1XCV A;  4DQ2 A;  4RB1 A;  3FXU A;  2V1U A;  4HLX A;  3BWG A;  2XRO A;  4LK0 F;  2EV5 A;  1R5G A;  1IXS B;  4HDV A;  5ICE A;  3GFI A;  4A2U A;  4JQF A;  1RNL A;  3ZPL A;  1KU2 A;  2ZME A;  2Y0M A;  3QU6 A;  3ISP A;  2EV0 A;  4HV5 A;  1FBS A;  3R0J A;  3JTH A;  1FWZ A;  5DEQ A;  2OAZ A;  4FX4 A;  2ADU A;  4NB5 A;  1FYM A;  1T2K A;  4CXF A;  1IN5 A;  1D3Y A;  4PGH A;  5D4S A;  2X0L A;  3JAM Z;  2XAQ A;  2RDP A;  2ISZ A;  5E20 A;  3U1D A;  3ML6 A;  2YSR A;  4L9J A;  2F5D A;  4GCV A;  3HSE A;  4P9U A;  1XMA A;  3DKW A;  3H3Z A;  1R23 A;  4N9I A;  2BEO A;  5FFX A;  2AXL A;  1XGN A;  3KFW X;  3K1N A;  3B73 A;  4Q48 A;  4LLN A;  3F21 A;  3F8F A;  1KA8 A;  4YIF A;  2WWY A;  1Z91 A;  3J80 K;  1KQ9 A;  2VE9 A;  2HFH A;  3DPT A;  2XAF A;  1FPQ A;  4KN7 X;  2Q2E A;  1WQ2 A;  4Z2Y A;  3HRT A;  5EEH A;  3LAP A;  4RGS A;  4U7D A;  2DLL A;  4ESF A;  1MKM A;  2Y75 A;  5DCF A;  4RGX A;  3QOP A;  5F1R A;  1W5T A;  3K1P A;  5CVI A;  4N0B A;  3GF2 A;  3QP5 A;  3H92 A;  4R1H A;  1WWX A;  5ED4 A;  4S05 A;  2DPD A;  4M74 A;  2PN6 A;  5D5V B;  5BOX A;  4EMS A;  4Q47 A;  1G3W A;  5HDK A;  2BBY A;  5K1Y A;  5BPI A;  3U2R A;  2Q8K A;  4U0W A;  4D0P A;  4WCG A;  1T6S A;  4EGY A;  1JGS A;  2ZNZ A;  4I2O A;  2Q0O A;  3N4M A;  1TNS A;  2P5V A;  4IRG A;  3IKT A;  1F4K A;  2PG4 A;  3NEU A;  2DK5 A;  2KKO A;  2KJC A;  4Q5S F;  1QBJ A;  1B1B A;  1GHC A;  2LSO A;  3JW4 A;  3BPV A;  4PCQ A;  2H27 A;  3V8K A;  2LKP A;  1O7L A;  3IWZ A;  5HDN A;  4CGZ A;  3HOT A;  3WGH A;  1YW7 A;  3IC7 A;  5HOO A;  2GQQ A;  4G6Q A;  2QYO A;  3GFJ A;  1H9T A;  4LG0 B;  2PEX A;  2HR3 A;  5D8K B;  3RIR A;  2CWE A;  1FY7 A;  4HAM A;  1SD4 A;  5TRD A;  3JAM K;  2XAH A;  1TBX A;  3ZMZ A;  3E6C C;  1R1T A;  1TTY A;  5D6F A;  2H6C A;  1O57 A;  2H09 A;  3EQL F;  4BYY A;  4PZJ A;  2HOE A;  4QLC U;  1O3T A;  4UV8 A;  2XAJ A;  1R58 A;  2J5O A;  2JPC A;  5LHG A;  1F5T A;  3KLN A;  4XLN F;  1K78 A;  2EJR A;  3FZV A;  3EUH A;  5D5W B;  3V7R A;  4RS8 A;  3K0L A;  1J9I A;  3P9K A;  2DI3 A;  3NRV A;  2RNJ A;  4OIO F;  2O61 A;  3PQJ A;  4ZH4 F;  2YU3 A;  3RPQ A;  3QAH A;  5HS8 A;  5HS7 A;  4A12 A;  1STZ A;  4HX7 A;  5LGT A;  1T0F A;  5CYV A;  2IPQ X;  5FD5 A;  4MTE A;  1Z1D A;  4HZF A;  1QZZ A;  1LB2 A;  3KLO A;  3DV8 A;  3E5Q A;  1YLF A;  2CSO A;  2MBF A;  4UVC A;  3SZP A;  2VXZ A;  4U7B A;  1GXP A;  1T39 A;  4O6J A;  1PP7 U;  3TO7 A;  5HDG A;  2UWM A;  1YS6 A;  2M30 A;  2DQL A;  1Y0U A;  3FXR A;  1IN6 A;  4HF1 A;  3TDZ C;  2YR2 A;  6PAX A;  1ZLK A;  4BQA A;  4P5O A;  4WF2 A;  4RB0 A;  2XAS A;  4LLL A;  1S7A A;  3IL2 A;  2OBP A;  4ZYH A;  2PI0 A;  1XD7 A;  2F5E A;  5BQT A;  3LA2 A;  3HSR A;  4O5V A;  2BYV E;  2CYY A;  3ECO A;  3F8C A;  1KYW A;  2GA2 A;  2XUB A;  2UXN A;  1H0M A;  1J7K A;  2ZME B;  1O7F A;  3FMQ A;  1BIB A;  2JZY A;  1OMI A;  3LST A;  2L54 A;  5ICC A;  1MDM B;  3LA7 A;  4I0B A;  3OV8 A;  3ZQ7 A;  2MH2 A;  2M1B A;  2HS5 A;  3IRR A;  3DF8 A;  1BN5 A;  1XN7 A;  2XIG A;  4RGU A;  3QPT A;  4Q4Z F;  2XGX A;  4KA4 A;  3C7J A;  4A0Z A;  5ICF A;  3RKW A;  3HRU A;  2L02 A;  1BI2 A;  2JSC A;  3CTA A;  5K5R A;  4EJU A;  3TO9 A;  3MAJ A;  1B6A A;  2ESN A;  4G8X A;  2JRT A;  2W25 A;  4CDG A;  2OQG A;  3CLO A;  2EA4 A;  5TJJ A;  3IRQ A;  1U5T A;  2XRN A;  2OD5 A;  2M45 A;  1FNN A;  4I98 B;  3WU0 A;  1C0W A;  1XSV A;  4I7H A;  2HDC A;  3S2W A;  2FSW A;  3DXJ F;  4LMY A;  4UV9 A;  2VT3 A;  4L9T A;  4DNC A;  1SMT A;  2W84 A;  4MNU A;  2OU2 A;  5FGM A;  4PDK A;  4HBL A;  2NNN A;  1ZG3 A;  4HDU A;  3L7W A;  3I53 A;  1BBY A;  3WTT C;  2NS0 A;  1YQA A;  4ON0 A;  2RQP A;  2PLY A;  1FSH A;  2RKH A;  3E3V A;  3ZN0 A;  1O3S A;  4IXA A;  3GXO A;  3ABU A;  4HQE A;  4HW0 A;  1G3Y A;  3QP6 A;  4MHG A;  1YTY A;  4BXU A;  1ODD A;  3RDI A;  1OYY A;  3HOS A;  1BI0 A;  3FF5 A;  5FFZ A;  3FWE A;  4G94 A;  4RB2 C;  1T38 A;  3O2P E;  3SQN A;  3H3U A;  3MZH A;  4P55 A;  4HYE A;  3SZT A;  1LQ1 A;  2K4J A;  4KYW A;  5LHI A;  1HW5 A;  1LEB A;  1YIO A;  2HYG D;  3TO6 A;  2K02 A;  2UZK A;  5DCM A;  3WTZ A;  2A07 F;  1JHH A;  2Y48 A;  4G6D A;  3FM5 A;  4EJT A;  1XB4 A;  4RAZ A;  3COA C;  2LF8 A;  2BV6 A;  2PJP A;  2X4H A;  3HUG A;  2JTV A;  1DUX C;  5JHU A;  3CUQ A;  2KJB A;  4Y13 A;  2IT0 A;  3TDU C;  4L0Z B;  4KUM A;  5D5U B;  5J6X A;  4HX8 A;  2YX7 A;  1FYK A;  2QQA A;  4KIB A;  3V8L A;  2IA2 A;  2EFP A;  1F1Z A;  4U0Y A;  3JSP A;  1QZY A;  4L5I A;  5LRS A;  3ZP5 A;  2PFB A;  2K4B A;  2H94 A;  3PFI A;  1R00 A;  2GWR A;  2FRH A;  4EVI A;  3J81 Z;  1K6O A;  4M9X A;  5IT9 Z;  1AWC A;  2W85 A;  1BC7 C;  1QPM A;  5CJ9 A;  1J5Y A;  1FBQ A;  1K78 B;  1TW2 A;  4CO8 A;  2FML A;  3I58 A;  2O0Y A;  4I01 A;  4YFK F;  2DBB A;  1MD0 A;  1BOA A;  2FQ3 A;  5CLS A;  3I64 A;  2GZW A;  4M72 A;  3L09 A;  5ILV A;  1MDM A;  1L3L A;  1GVJ A;  1ONV A;  5ILU A;  1SFX A;  5LHH A;  3ECH A;  4ETS A;  4Y15 A;  2XVC A;  4GXO A;  4ENN A;  3RKX A;  2QWW A;  1ON1 A;  2G7U A;  3L2C A;  3HRS A;  1WRJ A;  2G7H A;  2QZ8 A;  4AIK A;  1DPU A;  3I54 A;  5E1Z B;  2ZCW A;  1P4X A;  4Y17 A;  4CHU A;  5IT3 A;  3B02 A;  5FLX K;  1MJA A;  5LRR A;  4CYD A;  1KGS A;  2L3D A;  3OOP A;  2WV0 A;  4EGZ A;  4IJA A;  5F6F A;  4L5J A;  4ENM A;  2VON A;  2LDU A;  1J59 A;  2ZNY A;  1G3T A;  1XGS A;  1ZG1 A;  3T8T A;  5AIP A;  2CO5 A;  5E8I A;  3R4K A;  1BM9 A;  2MLG A;  1JXS A;  4R79 A;  2DU9 A;  3I5U A;  4HX4 A;  2A61 A;  4MEX F;  3GEZ A;  1B9N A;  2O6G E;  3RPU A;  3RTR A;  4UVB A;  3WE3 A;  3KCC A;  2ESH A;  3JSO A;  2V1X A;  1RZ4 A;  1RIO H;  2PMH A;  1U8R A;  2G9W A;  4I0A A;  3VEP A;  2TDX A;  3L00 A;  4A6D A;  5D8L B;  4P96 A;  2P7V B;  4EJO A;  1YFH A;  3M7G A;  1V4R A;  2BGC A;  1VTN C;  1R5H A;  1IF1 A;  3BOQ A;  4YFX F;  5IT9 K;  2Z3Y A;  4XRF A;  3RI4 A;  5LLQ A;  2OZ6 A;  3WTV C;  1IN7 A;  3HIF A;  2PQ8 A;  3DP7 A;  1G4D A;  1Q1H A;  3M1E A;  1MJB A;  1BC8 C;  1U5T B;  4IRH A;  2QVO A;  1A04 A;  4AWX B;  3GLX A;  1OYI A;  3I0T A;  2OA4 A;  3T8R A;  1CGP A;  3KE2 A;  4WWC A;  3AAF A;  4I09 A;  2EB7 A;  2JPB A;  2D45 A;  3TOB A;  4WXH A;  2ZO4 A;  1SAX A;  3BRO A;  5JFR A;  3KEO A;  1XDS A;  3ABT A;  3W6K B;  1O3Q A;  1IXC A;  1GXQ A;  2D2W A;  1IW7 F;  4M9Z A;  3TGN A;  1DPR A;  1QGP A;  4N9H A;  4A0X A;  1J0R A;  4ZZL A;  1E17 A;  3ULQ B;  4BHC A;  5DUI A;  1S7O A;  2M8E A;  5HLG A;  1QO0 D;  1TQI A;  4HV6 A;  1ZRE A;  4G7Z F;  1TW3 A;  3EET A;  2KIU A;  4RGR A;  5DDG A;  3WTW C;  3FM3 A;  4WX9 A;  3WGI A;  1HW2 A;  5LGU A;  4XLP F;  1ZAO A;  4HQM A;  3ZMD A;  4ESJ A;  4EV0 A;  4A5N A;  5A2Q Z;  1FYL A;  5DCM B;  2DQR A;  4ZYE A;  2DT5 A;  5FB2 A;  1R36 A;  2L4A A;  2NRA C;  3IKV A;  1JE8 A;  2A69 F;  2RN7 A;  1YW9 A;  4YFN F;  4OIP F;  2YPR A;  3F22 A;  4UUV A;  3MQ0 A;  4ASN A;  2ZXJ A;  3C18 A;  3CUQ B;  3KZZ A;  3KP2 A;  1RI7 A;  3EDP A;  4RAY A;  2KRF A;  1PUE E;  4A0Y A;  1B59 A;  1SD5 A;  1KU3 A;  5LEJ A;  4A6E A;  1NHA A;  1ZGA A;  1FZP B;  3R61 A;  2M5W A;  1I6X A;  2W57 A;  2QQ9 A;  2NNY A;  2YX4 A;  3FX3 A;  1FX7 A;  1ZHF A;  1I27 A;  2KIM A;  1KQ0 A;  2UXX A;  2V6C A;  1J2X A;  4HA8 A;  1EH6 A;  1YO5 C;  5H20 A;  5KK1 A;  3VOD A;  4O3M A;  1BI1 A;  4YII A;  4HF2 A;  5DV5 A;  3Q5F A;  3KET A;  1IRG A;  1R1V A;  3C1D A;  4UVA A;  2HTJ A;  1UB9 A;  4BNC A;  2P8T A;  3MZY A;  2DK8 A;  2F2E A;  3K69 A;  3WU1 B;  5CVJ A;  2CW0 F;  5BMZ A;  5KVR A;  2XHK A;  2IJL A;  3K9T A;  2MA3 A;  1O3R A;  1ZGJ A;  3GYH X;  3FMS A;  4GYG A;  1XGM A;  2IVM A;  1BJA A;  3W6J B;  2C6Y A;  4M9S A;  1G3S A;  5L3F A;  2O8X A;  2GA1 A;  2M87 A;  1HBX G;  1REP C;  2EFN A;  3E6M A;  3KP7 A;  1U2W A;  1D8K A;  1U78 A;  1P92 A;  2QQB A;  2A5Y B;  1UFM A;  2E7X A;  5H6R A;  1HKQ A;  3CUQ C;  3HTU A;  5F64 A;  4GYI A;  4ENK A;  1YYV A;  5HLI A;  3HRM A;  4GO1 A;  4S04 A;  3E6B A;  4EJV A;  3JTG A;  4OIQ F;  3WGG A;  2PBI A;  2HQR A;  2VOO A;  2KIF A;  3F8B A;  1ULY A;  3LAJ A;  5ICG A;  4EM2 A;  2EK5 A;  2A6H F;  1QNT A;  1W4M A;  1UST A;  5HLH A;  1TNT A;  2FA5 A;  2CGP A;  1TLH B;  1LVA A;  2DO7 A;  3C3W A;  1ZAR A;  3SHF A;  3E6D A;  2VBX A;  4ZZD A;  5HVQ C;  4ZYD A;  4YG2 F;  2FXA A;  3BP8 A;  1OPC A;  2F5F A;  2K7L A;  3R60 A;  3M8E A;  4I02 A;  4BHB A;  3CDH A;  3F72 A;  3T0Y A;  4TV7 A;  2VN2 A;  1FOK A;  3Q9V A;  3DFG A;  5L3E A;  1MJ9 A;  1RUO A;  4AD9 A;  4FT8 A;  5CVV A;  3LQR A;  5ERI A;  3V8J A;  1F9N A;  4U88 A;  3WG9 A;  1DP7 P;  1USS A;  3F23 A;  1XMK A;  2XV4 S;  1BI3 A;  3BPX A;  4B09 A;  3V4G A;  1KU7 A;  4H0E A;  3J80 Z;  1ZN2 A;  3DQV C;  3QU3 A;  3VB2 A;  1S8N A;  4MTD A;  3V7C A;  1D5V A;  2VBY A;  2RV8 A;  3ZMU A;  1J75 A;  1UCR A;  4M73 A;  2EFW A;  4U0V A;  3MFK A;  3DPL C;  2QM3 A;  2IRF G;  3HTS B;  4L18 B;  1FLI A;  2NYX A;  4WK8 F;  2VC0 A;  2JT1 A;  2GAU A;  4LJZ F;  4MGR A;  2CG4 A;  1RUN A;  3R6S A;  3GZ5 A;  3HHG A;  2P5L C;  3K2Z A;  4XSZ F;  2ZKZ A;  3E5X A;  3WE2 A;  2VE8 A;  2QUF A;  2DPU A;  4LLG F;  3I59 A;  1PP8 F;  3GFL A;  3CO7 C;  3GUD A;  3MCZ A;  4KFC A;  2V79 A;  3FMR A;  1R7J A;  2DW4 A;  1Z9C A;  2ISY A;  1IN8 A;  3ZN1 A;  3ZMT A;  1WI9 A;  4KMF A;  1YG2 A;  2D1H A;  3BJ6 A;  2VOP A;  4M6X A;  3P7N A;  5L3B A;  2HQN A;  5J8C A;  1XDU A;  1FP1 D;  2RC4 A;  3FHZ A;  1H9G A;  1W7P B;  3FXQ A;  3V7S A;  4LB5 A;  2QBY A;  3GX4 X;  4A5M A;  1TQP A;  3BZ6 A;  5E18 F;  1Z7U A;  2XKO A;  1ZRC A;  2OZU A;  4LK1 F;  2DAO A;  3SXY A;  4FHT A;  2J5P A;  2PMU A;  5BS6 A;  5LBQ A;  4E70 A;  1HQC A;  3KP3 A;  3KEQ A;  1I1G A;  3ROU A;  4EM1 A;  2EA2 A;  1EV7 A;  3BJA A;  1Z05 A;  3HYI A;  1R1U A;  1P4A A;  3KP4 A;  2R7F A;  4LGW A;  3ZMS A;  2E1C A;  4OIN F;  2HKX A;  1CF7 A;  4AIH A;  2W24 A;  5E8G A;  1FBU A;  3J7A O;  1B4A A;  1EH8 A;  1U6G A;  1LDD A;  4EQQ A;  1SMY F;  4R8H A;  1T98 A;  3P9C A;  5DUK A;  3ERE D;  2EWN A;  2VOD A;  2GIV A;  3F8N A;  2DTR A;  3TQN A;  4ZYG A;  1IZ1 A;  1W5S A;  5K5O A;  4P9F A; 
#chains in the Genus database with same CATH topology
 2HZT A;  4B8X A;  3OIP A;  4QPQ A;  1T0F C;  2ZBK A;  2QLZ A;  3PNV A;  2X51 A;  3DTK A;  3B6A A;  4XN3 A;  1IN4 A;  2PMZ N;  2Z5U A;  3A2K A;  1A5J A;  3BR1 A;  3GO5 A;  3MKL A;  2ID3 A;  4MEY F;  1MBK A;  1IG7 A;  3G3Z A;  1WSU A;  5C44 J;  1ZK8 A;  2BE5 F;  3M8F A;  3J81 K;  3LL7 A;  2HVQ A;  3DEU A;  2R7Q A;  2H6B A;  5L3G A;  4E6K G;  5AIQ A;  3Q3S A;  4XKB A;  4BEH B;  3CUO A;  1X3U A;  2P4W A;  4A3F J;  3CC4 I;  5D6E A;  4M3G A;  5K5Q A;  1H8A C;  1I3Q J;  3Q0U A;  3WTX C;  3CJR B;  1K4S A;  3GZ6 A;  1M1E B;  3HSF A;  2MD5 A;  4L9V A;  2JN6 A;  4IHY A;  3F3X A;  2P81 A;  2X6O A;  3WTS C;  2HTS A;  2P6T A;  1UZC A;  4ESB A;  1P2F A;  1OKR A;  2O3F A;  3CMY A;  2CFX A;  5DD8 A;  2P7C B;  1NG6 A;  3CCV I;  1IRX A;  2Z99 A;  3EYY A;  1WKM A;  3GTL J;  4MQV A;  3K1M A;  4G7H F;  3CC2 I;  2HGC A;  3G1L A;  5FRN A;  4LB6 B;  2EZL A;  1UHM A;  5FD6 A;  1BOB A;  2F5C A;  3CP2 A;  1NH3 A;  5E79 C;  1W7P D;  2FNA A;  1K61 A;  2VLA A;  1HXD A;  4IO9 F;  3IWF A;  1DU6 A;  4A3D J;  3O8G A;  1LJ9 A;  1X1C A;  2VBW A;  2VBZ A;  3D5S C;  4OOI A;  1HOM A;  2EIK H;  4XIC A;  4IHT A;  2KQR A;  5L3D A;  3W2V A;  2A68 F;  4OMZ A;  2JUG A;  3CJQ B;  5GAG J;  4E7L A;  1HC8 A;  2XAG A;  2DA3 A;  2CV2 A;  4A3M J;  5FO5 A;  3SFZ A;  2L01 A;  4RMN A;  3I4N J;  3WTU C;  2MYS A;  2ECC A;  2MH9 A;  4OU0 A;  3LSH A;  2AS5 F;  5JR3 A;  4BHP A;  3LSR A;  2Y0S N;  2RGV A;  1V3F A;  2E1M B;  3GFM A;  1SVM A;  4X1E A;  1WJF A;  4M71 A;  3K2A A;  5E1W A;  2EFO A;  3G4S I;  4EEF G;  4PGG A;  4G7O F;  2K85 A;  3BDD A;  2BXY A;  2GOM A;  3O8H A;  5JI6 A;  4XID A;  2DA2 A;  1SFE A;  2HOA A;  3K7A J;  2LF7 A;  1BR4 A;  1S72 I;  2HOT A;  4AC0 A;  2H8R A;  1G6N A;  2OQR A;  4FIS A;  3TL4 X;  1YS7 A;  2WB1 N;  3KZY A;  2K86 A;  3TOA A;  3PL8 A;  3NAR A;  1LE8 B;  2LH9 A;  2WAQ N;  2OTJ I;  1K7A A;  1LNW A;  5F27 A;  1ZRD A;  3V42 A;  1R71 A;  4IF4 A;  2VKH A;  1ZRF A;  2MW8 A;  3LSK A;  2B0L A;  1VQK I;  4M6V A;  3BR0 A;  2X6X A;  1DDN A;  3FBI B;  1JHF A;  1P6R A;  1JUM A;  3VYU B;  5E17 F;  1W7P A;  3D5L A;  2FOK A;  1Y8R B;  5IP6 A;  2HVR A;  4OIR F;  1LEA A;  2IA0 A;  2HQ5 A;  4HNV A;  1U9N A;  2K3F A;  3NWS A;  1WPK A;  3T5X A;  3TMO A;  4V19 K;  1FP2 A;  3D1N I;  2FU4 A;  1P9Q C;  2HKO A;  4BH9 A;  3GWZ A;  1SD6 A;  5LGN A;  3QRF F;  4I76 A;  1PVE A;  2GXG A;  4IPA A;  3S17 J;  4YRV A;  1OQY A;  3S3N A;  1RPW A;  2IP2 A;  4K2E A;  5H6Q A;  2WTE A;  3RJP A;  3GVA A;  2W82 A;  1TQM A;  4IHV A;  5L3C A;  4BU2 A;  1VQP I;  2HVS A;  3QPH A;  1A36 A;  1HSJ A;  2JSP A;  1FT9 A;  4NNJ A;  5AON A;  1U5T C;  2YS9 A;  4LG3 A;  4NHJ A;  1PYV A;  2BW3 B;  2EV6 A;  4RM2 A;  2QKM B;  1XPX A;  2NAZ A;  5BPD A;  1XSD A;  1S6L A;  1JI8 A;  1XSX A;  2Q1Z B;  4UNO A;  2ELH A;  1LDK B;  4GGG A;  2LBF A;  3HXL A;  1AOY A;  1E3P A;  4G9Y A;  4BQO A;  3OYI A;  1B8I B;  1YI2 I;  2CW8 A;  2R3S A;  2F4O B;  4Y4R A;  2FE3 A;  3KP5 A;  1ON2 A;  2JVG A;  4JX5 A;  5HS9 A;  3LFK A;  4L9N A;  4B3A A;  5ILS A;  3I59 B;  3JCU C;  3F6O A;  2G0E A;  3OL3 A;  2HEO A;  2NVT J;  5J8F A;  3JRA A;  3BC8 A;  2R92 J;  1B9M A;  4AID A;  1XC5 A;  2V1D A;  1Y6I A;  4UXN A;  4HF0 A;  1Z6T A;  2MC3 A;  3MWM A;  5JHF A;  2WA0 A;  4ABZ A;  1YW8 A;  3DBH B;  3GW2 A;  4BE2 A;  4BAY A;  5JVT A;  4RB3 C;  3CO6 C;  3SZG A;  3BLY A;  2DMT A;  1LUJ B;  1IXR C;  4HST A;  4AVP A;  1E2X A;  2W00 A;  2FF4 A;  4FX0 A;  1ZG5 A;  3U9G A;  4AIJ A;  2FNP A;  2XGC A;  4DBR A;  2WBM A;  3MEX A;  4UUT A;  4WXD A;  3OYJ A;  3KYD B;  3N97 A;  2Z16 A;  3O3K A;  1S9H A;  3O6B B;  3FXJ A;  1HW1 A;  4LFU A;  1MH4 A;  3S93 A;  1U3E M;  3RYP A;  1UHW A;  4ENJ A;  2RRE A;  1IUY A;  2R7D A;  3H5N A;  2HXO A;  4C2T A;  1ZH5 A;  2ID6 A;  1SFO J;  1S3J A;  2QBY B;  1SD7 A;  4IVN A;  1VND A;  1IRF A;  1DQU A;  2XKP A;  3WOD F;  2E1N A;  1EH7 A;  3PSI A;  3VFZ A;  2R5Y B;  5D5X B;  2A6E F;  2OF7 A;  1HCR A;  5IYB J;  3J7A Y;  2X48 A;  4CZZ A;  3ZMV A;  3BY6 A;  2BY3 A;  3ELK A;  1MBH A;  3LA3 A;  4D1Q A;  5B1A H;  2CQK A;  4IOA F;  3VYS B;  1BIA A;  1XCB A;  5DD4 A;  3WTY C;  1ZLJ A;  2W48 A;  5CKT A;  5EEA A;  2Z33 A;  2FBH A;  3REO A;  1D8J A;  3PQK A;  2X6W A;  2O03 A;  1OYW A;  4D5C A;  2VJ5 A;  1I1S A;  1KQ8 A;  4LD5 A;  2VT2 A;  2Y31 A;  1MZB A;  1OR7 A;  2KZV A;  1X3W B;  3BJO A;  4EJW A;  2ZJ2 A;  2DFH A;  2M7B A;  5E1X A;  1D1A A;  4OMY A;  5H2F C;  2XAU A;  2IA1 A;  1KU9 A;  2A3S A;  4DOZ A;  1Y8Q B;  3RYR A;  3I4P A;  1FIP A;  4F7Z A;  3T1B A;  3TBI A;  3CJN A;  1A31 A;  4B43 A;  3TKY A;  1GV2 A;  1CF7 B;  2GIZ A;  5B66 C;  3IHU A;  1O4X A;  3HHH A;  4I99 C;  2X1C A;  1QQI A;  1Z6R A;  2LKS A;  1QPI A;  2STT A;  4RLQ A;  3E97 A;  1MMD A;  3AFH A;  4PJJ A;  1LDJ A;  5A2Q K;  2K27 A;  4XRM A;  4AYB A;  4DZP A;  3S2H J;  2FEZ A;  2FMY A;  2GXB A;  3Q9S A;  3IH2 A;  1JKO C;  4U87 A;  4Y7N J;  1MNE A;  2Y9Y A;  1N75 A;  4P1W A;  2VJI A;  4NQW A;  4XOR A;  4A3J J;  2EZK A;  1ZTR A;  2VIX A;  2FQ4 A;  3KP6 A;  1RKW A;  2KFD A;  2CUJ A;  2MLK A;  3OIO A;  4LG0 A;  3W6V A;  2FBK A;  3OYF A;  2OCC H;  4FCY A;  5K7H A;  4DZJ A;  3DEE A;  3BG6 A;  2MFZ A;  5B1B H;  1P4W A;  1WGX A;  2Z9O A;  3BG7 A;  5B3S H;  1QHH D;  3OY9 A;  2V9K A;  4I6Z A;  4HLY A;  2ZFU A;  2IW5 A;  1IAW A;  3VOE A;  3BTJ A;  2QSF X;  3DCF A;  3CDI A;  2OTL I;  2HQA A;  4HG2 A;  4IHS A;  2EIJ H;  1XS9 A;  3F8M A;  1I6H J;  1HKS A;  5GPC A;  2LNB A;  4XSX F;  1MNM C;  4HOB A;  3PM1 A;  4KIG A;  2HYF A;  1SFU A;  4EM0 B;  1W36 C;  1ZYR F;  4JK1 X;  2QEN A;  1WI3 A;  4KMU X;  3ABM H;  4KT5 C;  1RR8 C;  1GT0 C;  2OPT A;  1WZ2 A;  1EKE A;  1WH5 A;  3HPG A;  5FLX Z;  2HWV A;  2NVQ J;  4JBA A;  5D4R A;  4UHT A;  1L0O C;  2V9V A;  3BQY A;  4RM3 A;  5EYR A;  3SEQ A;  3TED A;  3A1Y A;  1WHU A;  4CSW A;  2VC1 A;  3P9I A;  2STW A;  1OCO H;  3GCM A;  4C30 A;  1WVR A;  2DFI A;  4KN4 X;  1ERD A;  2P6S A;  5FKM A;  5IY5 H;  2K9S A;  4QWQ A;  1XGO A;  3D0S A;  5EZH A;  3F6V A;  2XPW A;  1KYZ A;  3HKZ A;  1A6Q A;  1K79 A;  5J47 A;  4RAF A;  2QA4 I;  2HYJ A;  3RKY A;  4CIC A;  3M07 A;  3R0A A;  1S29 A;  1GLN A;  2L4M A;  4XBF A;  2COM A;  4W97 A;  2D1V A;  4KIC A;  2BY2 A;  3EYI A;  4XKW A;  3LSM A;  2WY8 Q;  4NC6 A;  4E7H A;  5GAD J;  1TWH J;  4PSW A;  1JUS A;  2KPM A;  3FXL A;  1HKT A;  3I71 A;  2FBI A;  1VI0 A;  3HOW J;  2WAF A;  2ZJR F;  5CVU A;  4MIM A;  1I5Z A;  3H0G J;  4KIF A;  3OYM A;  2HZD A;  3BZK A;  2D5V A;  3JRC A;  3PUB A;  1FC3 A;  2FJ1 A;  3HBL A;  3E5U A;  2L9S A;  4WXC A;  2H1L A;  1FSE A;  5CVR A;  3RCO A;  2ZFW A;  3NQO A;  4V2F A;  1S5L C;  5LEK A;  5E3N A;  3CME I;  1HST A;  4M6Y A;  4KDP A;  1ZGW A;  1XG1 A;  4UY8 I;  3LWF A;  5GTI C;  2E7W A;  4Y33 A;  5F0F A;  1MBE A;  3HGG A;  3JR9 A;  3G73 A;  2ETH A;  2EFQ A;  2L7K A;  1YIT I;  4IRI A;  4KNY A;  2RVC A;  1PDN C;  4D9J A;  3M9A A;  3LQQ A;  3I4M J;  1R22 A;  3L9F A;  3NWT A;  5DYM A;  2K5C A;  3A4C A;  4L0Y B;  1MGT A;  1FMW A;  2BVM A;  3ASO H;  4MQ9 F;  2XGE A;  1EA3 A;  2ACJ A;  2P5K A;  4II2 A;  5EEG A;  2WC2 A;  1XCV A;  2ZC2 A;  4DQ2 A;  4II3 A;  4RB1 A;  5J1Y A;  1QZE A;  5C4X J;  3FXU A;  5M5X J;  1AKH A;  2EIM H;  2V1U A;  4HLX A;  3BWG A;  2XRO A;  3PFY A;  2XGD A;  4LK0 F;  1WJD A;  2HDW A;  2NS8 A;  2EV5 A;  1R5G A;  2QKL B;  5J1R A;  1IXS B;  4HDV A;  5ICE A;  4QTR A;  2E5Z A;  3GFI A;  3MZ8 A;  4A2U A;  4JQF A;  3BCB A;  1RNL A;  1YE9 A;  2ELJ A;  1KU2 A;  3ZPL A;  1FJL A;  1W0U A;  2ZME A;  2Y0M A;  3QU6 A;  2JMW A;  3ISP A;  2LG4 A;  2EV0 A;  4HV5 A;  1FBS A;  2V26 A;  3R0J A;  1N77 A;  3JTH A;  1FWZ A;  2XRL A;  5DEQ A;  2BXZ A;  2OAZ A;  4FE7 A;  4FX4 A;  2ADU A;  4NB5 A;  1FYM A;  1T2K A;  4DYC A;  2ME0 A;  3FXO A;  4CXF A;  2F4M B;  1X3Z B;  1IN5 A;  1D3Y A;  1W5C C;  4PGH A;  2NXN B;  5D4S A;  2X0L A;  3JAM Z;  2R7R A;  2XAQ A;  2RDP A;  1FOX A;  1QVT A;  3UNG C;  2ISZ A;  2R7S A;  5E20 A;  3U1D A;  3ML6 A;  3CCS I;  2YSR A;  3G2B A;  4IOC F;  4NC8 A;  4LIT A;  4L9J A;  2F5D A;  3BR2 A;  4GCV A;  2LBF B;  3HSE A;  3A02 A;  4P9U A;  3AG2 H;  1XMA A;  2K9M A;  3ZQG A;  2KHM A;  3DKW A;  3H3Z A;  3B6C A;  1R23 A;  3VPR A;  3CCU I;  4N9I A;  1FOY A;  3OOU A;  2BEO A;  5FFX A;  2AXL A;  1XGN A;  5HNF A;  3A01 A;  4RAG A;  5M5W J;  2JA2 A;  2R7U A;  3KFW X;  3K1N A;  3B73 A;  4Q48 A;  4LLN A;  4BGD A;  3F21 A;  3BR5 A;  1KA8 A;  3F8F A;  4YIF A;  2WWY A;  5E3O A;  1Z91 A;  2ICW G;  1MH3 A;  3J80 K;  4G6T B;  4FTH A;  1KQ9 A;  2RQQ A;  4HSR A;  1VQ9 I;  3S1M J;  1FTT A;  2VE9 A;  3CCQ I;  2HFH A;  5BNG A;  3DPT A;  3L2V A;  3A0H C;  2XAF A;  3PNY A;  4ZYA A;  5EF6 A;  3AL0 B;  1FPQ A;  4KN7 X;  2Q2E A;  1WQ2 A;  2BHZ A;  4Z2Y A;  3HRT A;  5EEH A;  3LAP A;  4RGS A;  4U7D A;  4A3I J;  2DLL A;  2CQQ A;  1VQ6 I;  3SYT A;  4ESF A;  1MKM A;  2Y75 A;  5DCF A;  4RGX A;  3QOP A;  2OUM A;  5J4V A;  1UMQ A;  5F1R A;  1ETO A;  2N8G A;  1W5T A;  4CYC A;  3K1P A;  5CVI A;  4BAC A;  4M3F A;  3GF2 A;  4N0B A;  2B63 J;  3QP5 A;  3H92 A;  2DDB A;  4XKV A;  4R1H A;  3BG3 A;  2E5N A;  1WWX A;  4UUS A;  4YEJ A;  2M34 A;  2JRM A;  5J1U A;  5ED4 A;  4S05 A;  9ANT A;  1NG7 A;  2DPD A;  2GOX B;  4M74 A;  2PN6 A;  5D5V B;  5BOX A;  4EMS A;  4ZJZ A;  2FD5 A;  4Q47 A;  1G3W A;  3X2Q H;  2CQN A;  5HDK A;  2BBY A;  2BVL A;  1SC7 A;  5K1Y A;  5BPI A;  1BR1 A;  3U2R A;  2Q8K A;  4U0W A;  4BBR J;  4D0P A;  1DU0 A;  2ZXW H;  4D7M A;  2IS2 A;  5KCM A;  4YEL A;  2DYS H;  3QYB A;  4WCG A;  1T6S A;  1VQN I;  4N4O B;  1JGS A;  3SFI A;  4EGY A;  2ZNZ A;  1YJ9 I;  4I2O A;  2Q0O A;  3N4M A;  4M3E A;  3PO3 J;  1TNS A;  2K9L A;  2P5V A;  4IRG A;  2A05 A;  2DOF A;  2CQ7 A;  4XQF A;  3IKT A;  1F4K A;  2PG4 A;  3NEU A;  1IGN A;  2JA8 J;  3DBR B;  4F93 B;  2DK5 A;  2IS4 A;  2KKO A;  2HU9 A;  2KJC A;  2ZSI B;  4Q5S F;  1XX5 A;  1QBJ A;  1B1B A;  3WU2 C;  2QSG X;  1GHC A;  2LOO A;  2LSO A;  3JW4 A;  3BPV A;  4PCQ A;  2H27 A;  1QHG A;  3ZQH A;  2OCE A;  3V8K A;  2LKP A;  4A3L J;  1YX3 A;  1O7L A;  3IWZ A;  3Q0W A;  3P5J A;  3QYF A;  5HDN A;  1R5I D;  4CGZ A;  2VXD A;  1UJ8 A;  5EDN A;  2ZXH A;  2XF7 A;  2X9D A;  3HOT A;  3W2A A;  3WGH A;  2LR8 A;  1H89 C;  1UEL B;  2L0K A;  4E7Z A;  4BS9 A;  3F0C A;  1LFB A;  1YW7 A;  2QSH X;  3IC7 A;  1F43 A;  1NTC A;  2R7W A;  2X1E A;  4QSH A;  1MSE C;  1T56 A;  5HOO A;  2GQQ A;  4G6Q A;  4W1U A;  3CP8 A;  5GTH C;  3KIO A;  4NQW B;  2QYO A;  3GFJ A;  2FX0 A;  1OCP A;  4S0H B;  2AQF A;  1DGR M;  4LOC A;  4CZC A;  1H9T A;  4LG0 B;  2FOW A;  4BE0 A;  1WFX A;  4XOT A;  2JWT A;  2PEX A;  2HR3 A;  5D8K B;  3RIR A;  2VAS A;  2CWE A;  1FY7 A;  3BT9 A;  3KYL A;  3L2U A;  4IZZ A;  1T95 A;  2EQR A;  2KDO A;  4HAM A;  4GDF A;  4J01 A;  1SD4 A;  5TRD A;  3K4B A;  3JAM K;  3S8P A;  2XAH A;  1TBX A;  3ZMZ A;  3E6C C;  1R1T A;  1TTY A;  2ZB9 A;  2NVU B;  3CMM A;  5D6F A;  2H6C A;  3BQZ A;  3SEZ A;  3DU6 A;  1O57 A;  2H09 A;  3EQL F;  2QF7 A;  1MBG A;  4BYY A;  2E2I J;  4PZJ A;  2HOE A;  4QLC U;  1O3T A;  2QGU A;  4UV8 A;  4HNU A;  2XAJ A;  3DU5 A;  1LKX A;  1R58 A;  5M3M J;  4UB8 C;  2J5O A;  2M4K A;  2JPC A;  3U1K A;  2CH0 A;  5LHG A;  1F5T A;  3KLN A;  4XLN F;  4A3B J;  2OJE D;  1K78 A;  1BW6 A;  2EJR A;  3FZV A;  3BG5 A;  3EUH A;  3FHN A;  5D5W B;  3KZI C;  3V7R A;  4RS8 A;  1DGW Y;  3K0L A;  1J9I A;  2E1O A;  3AG4 H;  3P9K A;  3HOY J;  3S1Q J;  3ZQL A;  2DI3 A;  4E7I A;  2UV1 A;  3NRV A;  2RNJ A;  4OIO F;  2O61 A;  1YX5 A;  1POG A;  2LC2 A;  3PQJ A;  2ME6 A;  4ZH4 F;  3DTE A;  5DM6 F;  4DIQ A;  3G1O A;  1G8X A;  3AKZ A;  1B72 A;  4A3C J;  1I50 J;  2YU3 A;  3HPH A;  3RPQ A;  5F04 A;  3QAH A;  4CCK A;  5HS8 A;  2O5R A;  4RLF A;  1ETY A;  5HS7 A;  4A12 A;  1STZ A;  2QCO A;  4HX7 A;  5LGT A;  1T0F A;  5CYV A;  2EH3 A;  4MFD A;  3VYR B;  2IPQ X;  1ZKG A;  3GBG A;  5FD5 A;  4MTE A;  1Z1D A;  2DA4 A;  3C2G A;  3E0J B;  1BR2 A;  4HZF A;  1LFU P;  5CQE A;  5E3M A;  1QZZ A;  1LB2 A;  3KLO A;  3DV8 A;  3FK6 A;  4J19 A;  3E5Q A;  3PIP F;  1YLF A;  2CSO A;  1CQT A;  3HUG B;  3IAM 2;  4HNT A;  4XM3 A;  4PUS A;  4ZTJ A;  2HPI A;  5IP7 J;  2LYC A;  2MBF A;  3BTC A;  5HLT A;  1JKP C;  4UVC A;  2DT7 B;  2IGM A;  3FIS A;  1Y0N A;  3SZP A;  2VXZ A;  3ZQQ A;  4CUG A;  4U7B A;  1GXP A;  2VUM J;  1T39 A;  2DT6 A;  4O6J A;  2DYR H;  1PP7 U;  4BQN A;  3TO7 A;  4H4K C;  5FLM J;  5EJC A;  5CQG A;  3OYN A;  1K4T A;  5HDG A;  2UWM A;  1YS6 A;  2M30 A;  5FRM A;  5DTD A;  2DQL A;  1Y0U A;  3FIW A;  3FXR A;  3HB9 A;  1IN6 A;  4HF1 A;  2V7F A;  3H9Q A;  3HC7 A;  2YR2 A;  3TDZ C;  3HL2 A;  2E1M C;  2EIN H;  2PMZ A;  6PAX A;  1ZLK A;  4BQA A;  4P5O A;  4WF2 A;  4RB0 A;  2XAS A;  4LLL A;  1S7A A;  3IL2 A;  4AM3 A;  2OBP A;  3OR2 C;  3QWL A;  3A0B C;  4IL6 C;  4ZYH A;  2PI0 A;  1AKH B;  1XD7 A;  2LK2 A;  2F5E A;  5BQT A;  3LA2 A;  3CJT B;  3H1C A;  3HSR A;  3JRG A;  1FOW A;  4O5V A;  2BYV E;  2CJJ A;  2F6C A;  2DDA A;  4BJ5 C;  2CYY A;  3ECO A;  3F8C A;  2BY1 A;  1KYW A;  2GA2 A;  2XUB A;  2UXN A;  2R7X A;  1H0M A;  1J7K A;  2ZME B;  4A3K J;  1O7F A;  3FMQ A;  1BIB A;  2JZY A;  3OYK A;  2V6E A;  1OMI A;  2H8W A;  3LST A;  1D1C A;  1X4O A;  2L54 A;  5M3F J;  3GTM J;  2JUC A;  5ICC A;  1MDM B;  3KYC B;  3LA7 A;  4I0B A;  1ETQ A;  3OV8 A;  3ZQ7 A;  3DLA A;  4MO7 A;  5KNL A;  2MH2 A;  2M1B A;  1F36 A;  2DA5 A;  3GTG J;  2HS5 A;  3CF5 F;  3IRR A;  1TWC J;  3ZGK A;  1V55 H;  3DF8 A;  1BN5 A;  1XN7 A;  1MMG A;  2XB5 A;  2XIG A;  4RGU A;  4XN0 A;  3FBN B;  3QPT A;  4Q4Z F;  2XGX A;  4KA4 A;  3C7J A;  2ZSH B;  2LD5 A;  1SAN A;  4HRI A;  1IDZ A;  2KP6 A;  3BR3 A;  4A0Z A;  2I10 A;  5ICF A;  3RKW A;  3PJR A;  3I3L A;  2R5Z A;  4L5E A;  4FE4 A;  4XLF A;  1N78 A;  2KDZ A;  3HZJ A;  3HRU A;  2L02 A;  3S3M A;  2L7Z A;  4XMY A;  2NOG A;  5FRO A;  1BI2 A;  2JSC A;  2W4S A;  3RZO J;  3CTA A;  5K5R A;  4EJU A;  2KIS A;  3A01 B;  3VSL A;  3TO9 A;  2WB1 A;  3MAJ A;  1B6A A;  2GBY A;  2VJ4 A;  3FXK A;  2LLK A;  2ESN A;  4G8X A;  2JRT A;  4LIU A;  2W25 A;  2Y2Z A;  5M5Y J;  2HDD A;  2NVX J;  1APL C;  2WAQ A;  4CDG A;  2OQG A;  3CLO A;  4BJ6 C;  3OSF A;  5F0C A;  2HOS A;  2EA4 A;  3K6G A;  5TJJ A;  3IRQ A;  5GPA A;  1VQ4 I;  1U5T A;  2XRN A;  3DBL B;  3UR3 C;  4D7N A;  2BHY A;  2M0M A;  2L2O A;  2M45 A;  2OD5 A;  1X19 A;  3IP4 B;  1FNN A;  4I98 B;  3WU0 A;  1JGG A;  1C0W A;  3OL4 A;  4B1R A;  1XSV A;  3RQ4 A;  4I7H A;  2Q2E B;  4DYQ A;  4RBO A;  2VQG A;  4ZC3 A;  4NDL A;  4XRS A;  3G71 I;  2E2J J;  3S2W A;  2HDC A;  4IQJ A;  1LFP A;  2FSW A;  3DXJ F;  4LMY A;  4UV9 A;  1R9T J;  2VT3 A;  3I9V 2;  4L9T A;  2IBD A;  3H35 A;  4DNC A;  1SMT A;  1D5Y A;  2W84 A;  4MNU A;  2VPR A;  2OU2 A;  5FGM A;  4CYC B;  1YJW I;  5F1J A;  4PDK A;  4HBL A;  2NNN A;  1ZG3 A;  3WHB A;  4HDU A;  2O9L A;  4ZDO A;  2O7O A;  3L7W A;  3C2B A;  3TW7 A;  1VZ0 A;  3I53 A;  3CLQ A;  4UUS B;  1HDP A;  1BBY A;  3WTT C;  2NS0 A;  1YQA A;  4ON0 A;  2K9N A;  2RQP A;  2V1N A;  2PLY A;  2M4G A;  1FSH A;  2RKH A;  3E3V A;  3ZN0 A;  1O3S A;  4IXA A;  3GXO A;  3ABU A;  4HQE A;  1A6I A;  4HW0 A;  4BDZ A;  1G3Y A;  3W3C A;  3QPL A;  3QP6 A;  1QVU A;  4MHG A;  4BXF A;  5JVG F;  1GDT A;  1YTY A;  2X6Y A;  1ODD A;  1WJA A;  3RDI A;  4BXU A;  1OYY A;  2WAD A;  2V9P A;  3HOS A;  5K7F A;  1BI0 A;  2Z1D A;  5FKK A;  3ZR8 X;  3OYH A;  3G6E I;  3ZXS A;  3FF5 A;  2K3P A;  3FWE A;  4G94 A;  5FFZ A;  4RB2 C;  1T38 A;  1FMV A;  3O2P E;  3SQN A;  4FET A;  3H3U A;  5IP9 J;  3MZH A;  1WH7 A;  3DLL F;  3CF2 A;  4P55 A;  4HYE A;  3SZT A;  2HPM A;  4OAY A;  1LQ1 A;  2K4J A;  4KYW A;  5LHI A;  3CMA I;  1HW5 A;  3J7Z I;  1MMA A;  1TWF J;  1YIO A;  3MKY B;  3VWB A;  1LEB A;  2KL4 A;  3E7L A;  2HYG D;  3TO6 A;  2B9S A;  1OCC H;  2K02 A;  2PX9 A;  2MD0 A;  3FKJ A;  1JKQ C;  2L9R A;  1TWG J;  2E19 A;  2UZK A;  2CV1 A;  1VQ5 I;  2CQX A;  5DCM A;  3WTZ A;  2A07 F;  1JHH A;  2Y48 A;  4G6D A;  3FM5 A;  4EJT A;  1XB4 A;  4RAZ A;  3COA C;  2CUE A;  2LF8 A;  2EBI A;  1T33 A;  2RAE A;  2BV6 A;  3CC7 I;  2PJP A;  2VL8 A;  2CS3 A;  2VPL A;  1TWA J;  3K4N A;  2X4H A;  3HUG A;  3ZOB A;  3H5A A;  2A5W A;  2JTV A;  1DUX C;  5JHU A;  3GTK J;  3QOE A;  3CUQ A;  2QQ8 A;  2LRE A;  2KJB A;  4Y13 A;  2IT0 A;  3TDU C;  3JRB A;  4FQG A;  4L0Z B;  4KUM A;  5D5U B;  1W36 D;  1VQ8 I;  5J6X A;  4HX8 A;  2YX7 A;  1FYK A;  2QQA A;  4KIB A;  1T8I A;  2JA5 J;  4IX7 A;  3V8L A;  2IA2 A;  3HEF A;  1OIS A;  3KX2 A;  1SVL A;  2EFP A;  2F48 A;  3JRD A;  1F1Z A;  2MAB A;  4U0Y A;  2TCT A;  3JSP A;  1QZY A;  4L5I A;  4IHX A;  5LRS A;  3ZP5 A;  2PFB A;  2K4B A;  4HEA 2;  1LVK A;  2H94 A;  3PFI A;  1R00 A;  4Z6Y A;  2GWR A;  1W0T A;  1R6R A;  2FRH A;  2H1K A;  1RES A;  4EVI A;  1JUP A;  4AUX A;  3J81 Z;  1K6O A;  4M9X A;  3F9K A;  5IT9 Z;  2DMU A;  1AWC A;  2W85 A;  1BC7 C;  2X1D A;  1QPM A;  3K4L A;  4XR6 A;  5CJ9 A;  1J5Y A;  1FBQ A;  1YJN I;  1K78 B;  2E35 A;  1TW2 A;  2NS7 A;  2AO9 A;  4CO8 A;  3H3V K;  2ELK A;  1TT5 B;  3A03 A;  2FML A;  2COB A;  3I58 A;  2O0Y A;  1U0J A;  3AG3 H;  4I01 A;  4YFK F;  3Q0V A;  4EAT A;  2DBB A;  1MD0 A;  3TP0 A;  3K70 D;  1BOA A;  3S32 A;  2R0Q C;  2FQ3 A;  5CLS A;  2R7Z J;  2DMP A;  2GM4 A;  3I64 A;  4JOM A;  2XF5 A;  2GZW A;  3W2W A;  4B47 A;  1B72 B;  2AQE A;  4M72 A;  4F3Q A;  3L09 A;  4IKF A;  4XL9 A;  5ILV A;  3ASN H;  3OS1 A;  1MDM A;  1X1A A;  1L3L A;  1GVJ A;  3LOC A;  2E60 A;  3S3O A;  1ONV A;  5ILU A;  1SFX A;  2W1O A;  3QQA A;  4PSX A;  1RRJ A;  2DOE A;  1MND A;  5LHH A;  2P0W A;  4JYK A;  3ECH A;  4ETS A;  4Y15 A;  2XVC A;  2LFB A;  2VJJ A;  4GXO A;  4B3X A;  2DA1 A;  2LRD A;  4ENN A;  3RKX A;  2DMN A;  2QWW A;  2QEX I;  1ON1 A;  2F5V A;  2G7U A;  3IH4 A;  3HRS A;  1WRJ A;  2G7H A;  3VYT B;  2QZ8 A;  3L2C A;  4AIK A;  3HOU J;  3RPU D;  1DPU A;  3C2H A;  3I54 A;  2EZI A;  1ETK A;  4PJN A;  5E1Z B;  1IUF A;  5DS9 A;  1HDD C;  2ZCW A;  3CZ6 A;  1IO2 A;  4JX4 A;  1P4X A;  2R7O A;  4D5F A;  4Y17 A;  4CHU A;  1ZEL A;  5IT3 A;  1G2H A;  3CCR I;  3B02 A;  5FLX K;  1X1P A;  1MJA A;  1OFC X;  5LRR A;  4CYD A;  1KGS A;  2L3D A;  1X2M A;  3OOP A;  2WV0 A;  4EGZ A;  1VFC A;  5KAF C;  1R4M B;  4PJ0 C;  4IJA A;  3MD2 A;  4V2G A;  4L5J A;  5F6F A;  3PUF A;  4ENM A;  5FJ8 J;  2VON A;  3MN2 A;  2LDU A;  4RA2 A;  1J59 A;  1I39 A;  4F92 B;  2ZNY A;  1G3T A;  1Y1V J;  2KZG A;  1XGS A;  2KLO A;  1ZG1 A;  3T8T A;  2JK3 A;  3ABL H;  5AIP A;  1SFK A;  3DPU A;  2CO5 A;  5E8I A;  1T08 B;  3R4K A;  3MVP A;  1BM9 A;  2MLG A;  3PNT A;  4R79 A;  1D1B A;  4ZDP A;  1JXS A;  1XMX A;  1IJW C;  2DU9 A;  4HPQ A;  2XPV A;  3I5U A;  3L2W A;  4HX4 A;  1LPQ A;  2A61 A;  4MEX F;  4CCJ A;  3DTI A;  2MGQ A;  3GEZ A;  1MMS A;  1B9N A;  3RQI A;  3RPU A;  2O6G E;  4ZTF A;  3RTR A;  4UVB A;  3WE3 A;  3KCC A;  3WHC A;  2R7T A;  1Z3X A;  2ESH A;  1X58 A;  2V1X A;  2Y30 A;  4Y3O A;  3JSO A;  1RZ4 A;  4NC7 A;  2JJ7 A;  1RIO H;  2ZJP F;  4A69 C;  2PMH A;  3BCA A;  4XRS G;  4JX6 A;  1U8R A;  2G9W A;  2XB0 X;  3H9J A;  4I0A A;  3VEP A;  2TDX A;  3S1R J;  3L00 A;  4A6D A;  1DP3 A;  5D8L B;  1EJ9 A;  2VQL A;  4P96 A;  3CCY A;  2P7V B;  4EJO A;  4BDY A;  2ZJQ F;  2LY1 A;  1YFH A;  1U8B A;  3M7G A;  1I3A A;  1V4R A;  3GLL A;  4CA0 A;  1E3O C;  2BGC A;  1VTN C;  1X4P A;  3OS0 A;  1R5H A;  2A6T A;  2CRG A;  4AVZ A;  3BOQ A;  3K4M A;  2R5Z B;  1IF1 A;  2HI3 A;  3CQZ J;  4YFX F;  3L2Q A;  1EF4 A;  4F52 A;  3BTL A;  3AG1 H;  1GV5 A;  2LKX A;  5IT9 K;  2Z3Y A;  4XRF A;  2IXS A;  4YIR X;  4AU7 A;  3RI4 A;  5CPR B;  5LLQ A;  2OZ6 A;  3WTV C;  2OV7 A;  3PO2 J;  3IV5 A;  1IN7 A;  3HIF A;  2PQ8 A;  3DP7 A;  5GAH J;  3JRH A;  1G4D A;  3GME A;  1Q1H A;  3M1E A;  1ITY A;  5EG0 A;  1Y56 A;  3OYE A;  1A35 A;  1MJB A;  3QOD A;  1TP4 A;  3ONQ A;  5FLV A;  1BC8 C;  1U5T B;  2V4J C;  1YRN A;  4IRH A;  3HJE A;  2QVO A;  1MBJ A;  1A04 A;  3OYA A;  5EGO B;  5IPA A;  4AWX B;  3RSN A;  3S2D J;  2LY2 A;  4GFB A;  3GLX A;  1OYI A;  3I0T A;  1WJB A;  2DN0 A;  2E2H J;  2OA4 A;  3T8R A;  1CGP A;  4BL0 B;  3VDX A;  1ZR4 A;  1FIA A;  3KE2 A;  4WWC A;  3AAF A;  4I09 A;  2EB7 A;  1RR7 A;  2JPB A;  2D45 A;  3TOB A;  1WJE A;  2RNG A;  4WXH A;  2KIQ A;  3LFU A;  3AL0 C;  2ZO4 A;  1SAX A;  3OYG A;  3BRO A;  3FK7 A;  5JFR A;  3KEO A;  1ETX A;  1XDS A;  3ABT A;  4KT6 A;  3W6K B;  1O3Q A;  1IXC A;  1GXQ A;  1ZR2 A;  2BY0 A;  1SEU A;  1IW7 F;  2D2W A;  2YUS A;  4M9Z A;  3TGN A;  2EZH A;  1DPR A;  1QGP A;  4N9H A;  4A0X A;  1J0R A;  2XPU A;  4ZZL A;  1E17 A;  3S15 J;  4PJL A;  3ULQ B;  4BHC A;  5DUI A;  1S7O A;  3KPH A;  2M3A A;  2DTZ A;  2CMP A;  1BA5 A;  2M8E A;  1KZH A;  3OS2 A;  4FAS D;  2DA6 A;  2ECB A;  5HLG A;  1QO0 D;  1TQI A;  4HV6 A;  1IV8 A;  1UG2 A;  2IGO A;  4G7Z F;  1ZRE A;  2W7N A;  1MBF A;  1TW3 A;  3EET A;  2KIU A;  1BW5 A;  5C3E J;  4RGR A;  5DDG A;  3WTW C;  1ACI A;  3HM5 A;  2VKD A;  4AYB N;  1HF0 A;  3GTO J;  3FM3 A;  4WX9 A;  3WGI A;  1HW2 A;  1Z3Y A;  1TT0 A;  5LGU A;  2WY7 Q;  3PIO F;  4BBS J;  4XLP F;  1ZAO A;  3D5R C;  2FUG 2;  1V5G A;  4HQM A;  4KIT B;  1TL8 A;  3ZMD A;  1V5F A;  4ESJ A;  1OR7 C;  4EV0 A;  4A5N A;  4F55 A;  5A2Q Z;  3RKQ A;  1FYL A;  2DCE A;  5DCM B;  2DQR A;  1IC8 A;  4ZYE A;  2DT5 A;  4B44 A;  5FB2 A;  1R36 A;  2L4A A;  3VSK A;  3IUO A;  3ESW B;  3HDD A;  1QU3 A;  2KT0 A;  2NRA C;  3IKV A;  5KAI C;  1JE8 A;  2A69 F;  1WCM J;  2RN7 A;  4E4H A;  1YW9 A;  2B7E A;  4YFN F;  4OIP F;  2YPR A;  3F22 A;  1YIJ I;  2ZXI A;  4UUV A;  2VQH A;  3MQ0 A;  4ASN A;  2ZXJ A;  2DMQ A;  2E71 A;  3C18 A;  3CUQ B;  3KZZ A;  1BL0 A;  2GXA A;  3KP2 A;  1ETW A;  4BJT A;  1RI7 A;  3EDP A;  4RAY A;  2KRF A;  1GVD A;  1PUF A;  3K4K A;  3OYL A;  1PUE E;  4A0Y A;  2E36 A;  1B59 A;  1TC3 C;  1SD5 A;  1KU3 A;  5LEJ A;  1W1W E;  4A6E A;  1AU7 A;  1NHA A;  4PFO A;  1ZGA A;  1FZP B;  4JP0 A;  3R61 A;  2WAE A;  2LMD A;  2M5W A;  3PSF A;  3S14 J;  1I6X A;  1BJZ A;  2W57 A;  4CCO A;  3ZQC A;  2QQ9 A;  2NNY A;  3GTJ J;  2YX4 A;  3FX3 A;  1YHQ I;  1FX7 A;  1ZHF A;  5B5E C;  1I27 A;  3HKZ N;  2CV0 A;  3GTQ J;  2KIM A;  1KQ0 A;  4A93 J;  3OMY A;  3LMM A;  2UXX A;  2DA7 A;  2V6C A;  1J2X A;  4HA8 A;  3M8J A;  1EH6 A;  2L9N A;  4B4C A;  1YO5 C;  2DOA A;  1Z7L A;  5H20 A;  2VKV A;  5KK1 A;  4DBQ A;  3VOD A;  4O3M A;  4BKX A;  1BI1 A;  4YII A;  4BXX J;  3SDB A;  4HF2 A;  4G12 A;  5DV5 A;  3Q5F A;  1JJ6 C;  4XLH A;  3KET A;  1IRG A;  3LNQ A;  3BZC A;  1R1V A;  3SJM A;  3FDY A;  3C1D A;  4UVA A;  1Y1W J;  3LSI A;  2HTJ A;  2K40 A;  4X6A J;  2K9Q A;  3FKI J;  2XSD C;  1UB9 A;  5E3L A;  4BNC A;  2P8T A;  1ZQ3 P;  2I5U A;  4ZDL A;  5J3L A;  3MZY A;  2DK8 A;  2PJR A;  2F2E A;  3CDL A;  3K69 A;  3CD6 I;  2R7V A;  3WU1 B;  1ORK A;  5CVJ A;  4B48 A;  2CW0 F;  5C4J J;  5BMZ A;  5KVR A;  2XHK A;  2IJL A;  3K4C A;  2L7M P;  3K9T A;  1P7J A;  2MA3 A;  2GLO A;  1AA7 A;  1O3R A;  1Z21 A;  4XLA A;  2JA6 J;  1ZGJ A;  2JVH A;  3GYH X;  4XK4 A;  3FMS A;  4GYG A;  4DYR A;  3K10 A;  1XGM A;  2IVM A;  1BJA A;  3W6J B;  1OLT A;  4BE1 A;  2Y0S A;  2C6Y A;  4M9S A;  1G3S A;  2LTP A;  5L3F A;  1QA6 A;  2O8X A;  4NUB A;  2GA1 A;  3N05 A;  2M87 A;  4KJZ A;  1HBX G;  3BR6 A;  1REP C;  5FKL A;  2EFN A;  3E6M A;  1HA8 A;  3KP7 A;  1Z77 A;  1U2W A;  1D8K A;  2XSJ C;  1U78 A;  1N25 A;  1P92 A;  2QQB A;  4BEH A;  3HG9 A;  1G59 A;  1ETV A;  3QYE A;  3MKZ A;  2A5Y B;  1UFM A;  2E7X A;  5H6R A;  3JRI A;  1HKQ A;  3CUQ C;  3H9G A;  2X85 A;  3HTU A;  5F64 A;  4GYI A;  1WJ5 A;  3CCL I;  4XNF A;  4ENK A;  1YYV A;  5HLI A;  3HRM A;  4GO1 A;  4E7J A;  4S04 A;  2CW7 A;  3E6B A;  4EJV A;  3JTG A;  4OIQ F;  3WGG A;  5HNH A;  2PBI A;  4C2M J;  5EGO A;  3L1P A;  1JTX A;  2HQR A;  1D0X A;  2YU9 J;  3S1N J;  2KRH A;  2VOO A;  3ZQF A;  2KIF A;  1OCR H;  3F8B A;  1ULY A;  5TGT A;  3LAJ A;  5ICG A;  4MFE A;  4EM2 A;  2EK5 A;  1XTA A;  2A6H F;  3BG9 A;  1QNT A;  1W4M A;  1UST A;  4QPO A;  3OYB A;  5HLH A;  1R4N B;  1TNT A;  2FA5 A;  3OYD A;  5LD2 C;  2CGP A;  3HOX J;  2EPF A;  1WJC A;  1TLH B;  5IYC J;  3M4O J;  1LVA A;  2DO7 A;  3C3W A;  1ZAR A;  2L7F P;  4UB6 C;  4F91 B;  3SHF A;  3M1C A;  4CH7 A;  3E6D A;  3LSP A;  2IEK A;  1E0E A;  4X0G A;  2VBX A;  4N4N B;  1HLV A;  1OJL A;  4XOP A;  4ZZD A;  5HVQ C;  3ERM A;  4ZYD A;  4YG2 F;  2FXA A;  2CUZ A;  3BP8 A;  1OPC A;  2WV1 A;  5FKO A;  2F5F A;  2K7L A;  2MSY A;  3R60 A;  3M8E A;  4I02 A;  1K6Y A;  3CDH A;  3NAU A;  4BHB A;  3F72 A;  2JA7 J;  3T0Y A;  3FXM A;  4TV7 A;  1VF9 A;  2ZME C;  5JLW A;  2VN2 A;  3OR1 C;  4PFP A;  3MKW B;  2AHQ A;  1FOK A;  5J4Y A;  3Q9V A;  2F4I A;  3LSG A;  3DFG A;  1LE8 A;  5K7Z A;  1H88 C;  1SAU A;  2M9H A;  5L3E A;  1MJ9 A;  2DFE A;  2CU7 A;  3DEW A;  1RUO A;  4A3G J;  5LFA A;  1Z0X A;  4J00 A;  4AD9 A;  1D0Z A;  2OC6 A;  4FT8 A;  5CVV A;  4CCN A;  3LQR A;  5ERI A;  3V8J A;  4NBQ A;  2E34 A;  1F9N A;  3EPZ A;  5GAE J;  3E1S A;  2BOL A;  3JRE A;  4U88 A;  3DKX A;  3WG9 A;  1DP7 P;  1USS A;  3F23 A;  1XMK A;  1MSF C;  2XV4 S;  4E7S A;  4KIS A;  1K83 J;  4DW6 A;  1BI3 A;  3BTI A;  3OWT A;  2KRC A;  1X1B A;  2AXT C;  3BPX A;  4B09 A;  3V4G A;  1X2N A;  5TIS C;  1KU7 A;  1MW7 A;  1ENH A;  2HNH A;  4H0E A;  2VB6 A;  1X1D A;  3J80 Z;  3CCE I;  3H0D A;  1ZN2 A;  3DQV C;  3QU3 A;  3VB2 A;  5EG0 B;  1S8N A;  4MTD A;  3V7C A;  1KON A;  1OCT C;  4XLE A;  1YRN B;  5KHD A;  2HXI A;  1D5V A;  2VBY A;  3I55 I;  4C9Y A;  2DFF A;  2RV8 A;  2KMU A;  3CCJ I;  3OYC A;  4CCL A;  3ZMU A;  3L2R A;  5F0H A;  1J75 A;  1UCR A;  4IQ4 A;  4M73 A;  2DOD A;  4XON A;  1UG0 A;  2EFW A;  4U0V A;  3K70 C;  3ABK H;  3MFK A;  3DPL C;  2QM3 A;  2IRF G;  2Z2S B;  3HTS B;  2BW3 A;  4L18 B;  1FLI A;  2NYX A;  4WK8 F;  3KEY A;  2VC0 A;  5J40 A;  2JT1 A;  2GAU A;  4LJZ F;  4C3J J;  1JT0 A;  1U9O A;  2IS6 A;  1S7E A;  4MGR A;  2IGN A;  5DM7 F;  2CG4 A;  2NVY J;  3R6S A;  3MMY B;  1RUN A;  3GZ5 A;  3HHG A;  1JKR C;  2LY9 A;  2P5L C;  1RET A;  3K2Z A;  1B8I A;  4XSZ F;  2ZKZ A;  3E5X A;  3DKY A;  3WE2 A;  4OAZ A;  4BY7 J;  2LP0 A;  2NOJ B;  3H5R A;  2VE8 A;  4DGW B;  2QUF A;  4GRI A;  2DPU A;  4LLG F;  1Z67 A;  3DWL E;  2L5Q A;  3I59 A;  1J09 A;  5GP9 A;  3GFL A;  1PP8 F;  4BY1 J;  2M7A A;  3CO7 C;  4IEJ A;  3GUD A;  5FKN A;  2R4G A;  5EZG A;  3CES A;  1Q1V A;  3MCZ A;  4KFC A;  1IRZ A;  2V79 A;  3FMR A;  1R7J A;  2DW4 A;  1P7I A;  1Z9C A;  3OIQ A;  2ISY A;  1IN8 A;  3ZN1 A;  3I56 I;  2XF6 A;  1WI9 A;  3ZMT A;  4KMF A;  1IDY A;  5IOY A;  1VQ7 I;  4PJM A;  1YG2 A;  4E7K A;  4PK4 A;  2D1H A;  3BJ6 A;  2VOP A;  4M6X A;  3P7N A;  5L3B A;  3G1M A;  4IHW A;  3ZCO A;  2DXI A;  2LVS A;  2HQN A;  4C3I J;  5J8C A;  1XDU A;  2CFO A;  1NK3 P;  1FP1 D;  2RC4 A;  3FHZ A;  4DJA A;  1H9G A;  1W7P B;  3FXQ A;  1RC9 A;  5IYD J;  5HOD A;  3V7S A;  2VKE A;  4LB5 A;  2QBY A;  2Y69 H;  1PJR A;  3GX4 X;  4A5M A;  4ANJ A;  1TQP A;  1GUU A;  2R5Y A;  4CCM A;  3BZ6 A;  5E18 F;  3HOV J;  3TW6 A;  2EIL H;  3CCM I;  2UUZ A;  3HOZ J;  1Z7U A;  3IH3 A;  4C3H J;  2XKO A;  3U21 A;  4QIW N;  2OZU A;  4LK1 F;  1ZRC A;  2DAO A;  3HGY A;  3SXY A;  4FHT A;  1R49 A;  2VQC A;  2J5P A;  2M0C A;  4Y52 J;  3SDG A;  1IV6 A;  2VI6 A;  2PMU A;  1JT6 A;  1YOV B;  1PUF B;  1UHS A;  5BS6 A;  2MC4 A;  4XLC A;  4A3E J;  5LBQ A;  1FTZ A;  1VQL I;  2I8D A;  4RDU A;  4E70 A;  3GZN B;  1HQC A;  3KP3 A;  3KEQ A;  1OCZ H;  1I1G A;  3ROU A;  3JRF A;  4EM1 A;  2EA2 A;  3ZQI A;  1JTY A;  1QRY A;  1EV7 A;  3BJA A;  3H36 A;  3EUA A;  1VQM I;  1Y39 A;  1Z05 A;  3HYI A;  1R1U A;  1P4A A;  3KP4 A;  5F08 A;  2R7F A;  4LGW A;  3ZMS A;  4OWR B;  2E1C A;  4OIN F;  2HKX A;  4ITV A;  1CF7 A;  1TZL A;  4AIH A;  2MG4 A;  2O8K A;  2CUF A;  2W24 A;  3EUK L;  5E8G A;  1JJ8 C;  1FBU A;  3J7A O;  1B4A A;  3M3Y J;  3S16 J;  1FEX A;  1MIJ A;  1EH8 A;  1UAA A;  2IS1 A;  3K4J A;  1D0Y A;  1U6G A;  1LDD A;  4EQQ A;  1V54 H;  1SMY F;  2BZT A;  2M8G X;  4R8H A;  3WG7 H;  1T98 A;  5IOZ A;  1VQO I;  1E3H A;  3P9C A;  5JLX A;  4MLO A;  2R93 J;  3ZRG A;  4BQQ A;  2M2E A;  5DUK A;  4LIV A;  3ERE D;  2EWN A;  2L9V A;  2DJN A;  4M3D A;  4C2U A;  3EUH C;  3OSG A;  2VOD A;  2GIV A;  2IGK A;  3F8N A;  2DTR A;  1SVO A;  4XKC A;  4M3B A;  1AHD P;  3TP3 A;  1RKT A;  2JQ7 A;  3TQN A;  2XC7 A;  2PJR B;  4ZYG A;  1IZ1 A;  1W5S A;  3IAS 2;  3GTP J;  5K5O A;  2XDV A;  2IAI A;  1MMN A;  4P9F A;  3LSJ A;  4BUP A;  3J7Y J;  1V5E A;  1NK2 P;  3QPS A;  2Y9Z A;  2DJI A;  3UKG A;  3RZD J;  2TRT A; 
#chains in the Genus database with same CATH homology
 2HZT A;  4B8X A;  2ZBK A;  2QLZ A;  1IN4 A;  2Z5U A;  3GO5 A;  4MEY F;  3G3Z A;  1WSU A;  2BE5 F;  3M8F A;  3J81 K;  3DEU A;  2H6B A;  5L3G A;  5AIQ A;  3CUO A;  1X3U A;  2P4W A;  5D6E A;  5K5Q A;  3WTX C;  3GZ6 A;  3HSF A;  2MD5 A;  4L9V A;  3F3X A;  3WTS C;  2HTS A;  2P6T A;  4ESB A;  1P2F A;  1OKR A;  2O3F A;  2CFX A;  5DD8 A;  2P7C B;  2Z99 A;  3EYY A;  1WKM A;  4MQV A;  3K1M A;  4G7H F;  2HGC A;  4LB6 B;  1UHM A;  5FD6 A;  2F5C A;  1W7P D;  2FNA A;  1HXD A;  3IWF A;  1LJ9 A;  2VBW A;  2VBZ A;  4OOI A;  4IHT A;  5L3D A;  2A68 F;  4OMZ A;  2XAG A;  5FO5 A;  3SFZ A;  2L01 A;  3WTU C;  2MH9 A;  4OU0 A;  2AS5 F;  5JR3 A;  4BHP A;  2RGV A;  1V3F A;  3GFM A;  4M71 A;  5E1W A;  2EFO A;  4G7O F;  4PGG A;  3BDD A;  5JI6 A;  1SFE A;  2LF7 A;  1G6N A;  2OQR A;  1YS7 A;  3KZY A;  2K86 A;  3TOA A;  1K7A A;  1LNW A;  1ZRD A;  4IF4 A;  1ZRF A;  2B0L A;  1DDN A;  1JHF A;  1P6R A;  5E17 F;  1W7P A;  3D5L A;  2FOK A;  4OIR F;  1LEA A;  2IA0 A;  3T5X A;  1FP2 A;  2FU4 A;  2HKO A;  4BH9 A;  3GWZ A;  1SD6 A;  5LGN A;  3QRF F;  2GXG A;  4IPA A;  2IP2 A;  4K2E A;  5H6Q A;  2WTE A;  3RJP A;  3GVA A;  1TQM A;  5L3C A;  3QPH A;  1HSJ A;  1FT9 A;  5AON A;  1U5T C;  4NHJ A;  2EV6 A;  2NAZ A;  5BPD A;  1XSD A;  1S6L A;  1XSX A;  4UNO A;  2ELH A;  1LDK B;  4GGG A;  1AOY A;  4G9Y A;  2R3S A;  2FE3 A;  3KP5 A;  1ON2 A;  5HS9 A;  3LFK A;  4L9N A;  5ILS A;  3I59 B;  3F6O A;  2HEO A;  5J8F A;  1B9M A;  2V1D A;  4UXN A;  4HF0 A;  1Z6T A;  2MC3 A;  3MWM A;  1YW8 A;  3GW2 A;  4BAY A;  5JVT A;  4RB3 C;  3CO6 C;  1IXR C;  4AVP A;  1E2X A;  2FF4 A;  4FX0 A;  1ZG5 A;  3U9G A;  4AIJ A;  2FNP A;  3MEX A;  4WXD A;  3N97 A;  3O3K A;  3O6B B;  1HW1 A;  4LFU A;  1U3E M;  3RYP A;  1UHW A;  4ENJ A;  1IUY A;  2R7D A;  1ZH5 A;  1S3J A;  2QBY B;  1SD7 A;  4IVN A;  1IRF A;  2XKP A;  3WOD F;  2E1N A;  1EH7 A;  3VFZ A;  5D5X B;  2A6E F;  4CZZ A;  3ZMV A;  3BY6 A;  3ELK A;  3LA3 A;  2CQK A;  1BIA A;  1XCB A;  5DD4 A;  3WTY C;  1ZLJ A;  2Z33 A;  2FBH A;  3REO A;  1D8J A;  3PQK A;  2O03 A;  1OYW A;  1I1S A;  1KQ8 A;  4LD5 A;  2VT2 A;  1MZB A;  1OR7 A;  3BJO A;  4EJW A;  2ZJ2 A;  5E1X A;  4OMY A;  2IA1 A;  1KU9 A;  2A3S A;  3RYR A;  3I4P A;  4F7Z A;  3T1B A;  3CJN A;  3TKY A;  1CF7 B;  3IHU A;  3HHH A;  1QQI A;  1Z6R A;  2STT A;  3E97 A;  5A2Q K;  1LDJ A;  2K27 A;  2FEZ A;  2FMY A;  2GXB A;  3Q9S A;  4NQW A;  3KP6 A;  2MLK A;  4LG0 A;  2FBK A;  1P4W A;  2Z9O A;  4HLY A;  1IAW A;  2IW5 A;  3VOE A;  4IHS A;  3F8M A;  1HKS A;  2LNB A;  4XSX F;  4HOB A;  4KIG A;  2HYF A;  1SFU A;  4EM0 B;  1ZYR F;  4JK1 X;  2QEN A;  4KMU X;  4KT5 C;  5FLX Z;  2HWV A;  4JBA A;  5D4R A;  4UHT A;  1L0O C;  2V9V A;  2VC1 A;  3P9I A;  2STW A;  2DFI A;  4KN4 X;  2P6S A;  4QWQ A;  1XGO A;  3D0S A;  3F6V A;  1KYZ A;  1K79 A;  3RKY A;  4CIC A;  3R0A A;  1S29 A;  2L4M A;  4XBF A;  2COM A;  2D1V A;  4KIC A;  3EYI A;  1HKT A;  3I71 A;  2FBI A;  5CVU A;  1I5Z A;  4KIF A;  1FC3 A;  3E5U A;  4WXC A;  1FSE A;  5CVR A;  2ZFW A;  3NQO A;  5LEK A;  1HST A;  4M6Y A;  4KDP A;  3LWF A;  2E7W A;  3G73 A;  2ETH A;  2EFQ A;  4IRI A;  4KNY A;  2RVC A;  1PDN C;  3M9A A;  3LQQ A;  1R22 A;  3L9F A;  5DYM A;  4L0Y B;  1MGT A;  4MQ9 F;  2ACJ A;  2P5K A;  5EEG A;  2WC2 A;  1XCV A;  4DQ2 A;  4RB1 A;  3FXU A;  2V1U A;  4HLX A;  3BWG A;  2XRO A;  4LK0 F;  2EV5 A;  1R5G A;  1IXS B;  4HDV A;  5ICE A;  3GFI A;  4A2U A;  4JQF A;  1RNL A;  3ZPL A;  1KU2 A;  2ZME A;  2Y0M A;  3QU6 A;  3ISP A;  2EV0 A;  4HV5 A;  1FBS A;  3R0J A;  3JTH A;  1FWZ A;  5DEQ A;  2OAZ A;  4FX4 A;  2ADU A;  4NB5 A;  1FYM A;  1T2K A;  4CXF A;  1IN5 A;  1D3Y A;  4PGH A;  5D4S A;  2X0L A;  3JAM Z;  2XAQ A;  2RDP A;  2ISZ A;  5E20 A;  3U1D A;  3ML6 A;  2YSR A;  4L9J A;  2F5D A;  4GCV A;  3HSE A;  4P9U A;  1XMA A;  3DKW A;  3H3Z A;  1R23 A;  4N9I A;  2BEO A;  5FFX A;  2AXL A;  1XGN A;  3KFW X;  3K1N A;  3B73 A;  4Q48 A;  4LLN A;  3F21 A;  3F8F A;  1KA8 A;  4YIF A;  2WWY A;  1Z91 A;  3J80 K;  1KQ9 A;  2VE9 A;  2HFH A;  3DPT A;  2XAF A;  1FPQ A;  4KN7 X;  2Q2E A;  1WQ2 A;  4Z2Y A;  3HRT A;  5EEH A;  3LAP A;  4RGS A;  4U7D A;  2DLL A;  4ESF A;  1MKM A;  2Y75 A;  5DCF A;  4RGX A;  3QOP A;  5F1R A;  1W5T A;  3K1P A;  5CVI A;  4N0B A;  3GF2 A;  3QP5 A;  3H92 A;  4R1H A;  1WWX A;  5ED4 A;  4S05 A;  2DPD A;  4M74 A;  2PN6 A;  5D5V B;  5BOX A;  4EMS A;  4Q47 A;  1G3W A;  5HDK A;  2BBY A;  5K1Y A;  5BPI A;  3U2R A;  2Q8K A;  4U0W A;  4D0P A;  4WCG A;  1T6S A;  4EGY A;  1JGS A;  2ZNZ A;  4I2O A;  2Q0O A;  3N4M A;  1TNS A;  2P5V A;  4IRG A;  3IKT A;  1F4K A;  2PG4 A;  3NEU A;  2DK5 A;  2KKO A;  2KJC A;  4Q5S F;  1QBJ A;  1B1B A;  1GHC A;  2LSO A;  3JW4 A;  3BPV A;  4PCQ A;  2H27 A;  3V8K A;  2LKP A;  1O7L A;  3IWZ A;  5HDN A;  4CGZ A;  3HOT A;  3WGH A;  1YW7 A;  3IC7 A;  5HOO A;  2GQQ A;  4G6Q A;  2QYO A;  3GFJ A;  1H9T A;  4LG0 B;  2PEX A;  2HR3 A;  5D8K B;  3RIR A;  2CWE A;  1FY7 A;  4HAM A;  1SD4 A;  5TRD A;  3JAM K;  2XAH A;  1TBX A;  3ZMZ A;  3E6C C;  1R1T A;  1TTY A;  5D6F A;  2H6C A;  1O57 A;  2H09 A;  3EQL F;  4BYY A;  4PZJ A;  2HOE A;  4QLC U;  1O3T A;  4UV8 A;  2XAJ A;  1R58 A;  2J5O A;  2JPC A;  5LHG A;  1F5T A;  3KLN A;  4XLN F;  1K78 A;  2EJR A;  3FZV A;  3EUH A;  5D5W B;  3V7R A;  4RS8 A;  3K0L A;  1J9I A;  3P9K A;  2DI3 A;  3NRV A;  2RNJ A;  4OIO F;  2O61 A;  3PQJ A;  4ZH4 F;  2YU3 A;  3RPQ A;  3QAH A;  5HS8 A;  5HS7 A;  4A12 A;  1STZ A;  4HX7 A;  5LGT A;  1T0F A;  5CYV A;  2IPQ X;  5FD5 A;  4MTE A;  1Z1D A;  4HZF A;  1QZZ A;  1LB2 A;  3KLO A;  3DV8 A;  3E5Q A;  1YLF A;  2CSO A;  2MBF A;  4UVC A;  3SZP A;  2VXZ A;  4U7B A;  1GXP A;  1T39 A;  4O6J A;  1PP7 U;  3TO7 A;  5HDG A;  2UWM A;  1YS6 A;  2M30 A;  2DQL A;  1Y0U A;  3FXR A;  1IN6 A;  4HF1 A;  3TDZ C;  2YR2 A;  6PAX A;  1ZLK A;  4BQA A;  4P5O A;  4WF2 A;  4RB0 A;  2XAS A;  4LLL A;  1S7A A;  3IL2 A;  2OBP A;  4ZYH A;  2PI0 A;  1XD7 A;  2F5E A;  5BQT A;  3LA2 A;  3HSR A;  4O5V A;  2BYV E;  2CYY A;  3ECO A;  3F8C A;  1KYW A;  2GA2 A;  2XUB A;  2UXN A;  1H0M A;  1J7K A;  2ZME B;  1O7F A;  3FMQ A;  1BIB A;  2JZY A;  1OMI A;  3LST A;  2L54 A;  5ICC A;  1MDM B;  3LA7 A;  4I0B A;  3OV8 A;  3ZQ7 A;  2MH2 A;  2M1B A;  2HS5 A;  3IRR A;  3DF8 A;  1BN5 A;  1XN7 A;  2XIG A;  4RGU A;  3QPT A;  4Q4Z F;  2XGX A;  4KA4 A;  3C7J A;  4A0Z A;  5ICF A;  3RKW A;  3HRU A;  2L02 A;  1BI2 A;  2JSC A;  3CTA A;  5K5R A;  4EJU A;  3TO9 A;  3MAJ A;  1B6A A;  2ESN A;  4G8X A;  2JRT A;  2W25 A;  4CDG A;  2OQG A;  3CLO A;  2EA4 A;  5TJJ A;  3IRQ A;  1U5T A;  2XRN A;  2OD5 A;  2M45 A;  1FNN A;  4I98 B;  3WU0 A;  1C0W A;  1XSV A;  4I7H A;  2HDC A;  3S2W A;  2FSW A;  3DXJ F;  4LMY A;  4UV9 A;  2VT3 A;  4L9T A;  4DNC A;  1SMT A;  2W84 A;  4MNU A;  2OU2 A;  5FGM A;  4PDK A;  4HBL A;  2NNN A;  1ZG3 A;  4HDU A;  3L7W A;  3I53 A;  1BBY A;  3WTT C;  2NS0 A;  1YQA A;  4ON0 A;  2RQP A;  2PLY A;  1FSH A;  2RKH A;  3E3V A;  3ZN0 A;  1O3S A;  4IXA A;  3GXO A;  3ABU A;  4HQE A;  4HW0 A;  1G3Y A;  3QP6 A;  4MHG A;  1YTY A;  4BXU A;  1ODD A;  3RDI A;  1OYY A;  3HOS A;  1BI0 A;  3FF5 A;  5FFZ A;  3FWE A;  4G94 A;  4RB2 C;  1T38 A;  3O2P E;  3SQN A;  3H3U A;  3MZH A;  4P55 A;  4HYE A;  3SZT A;  1LQ1 A;  2K4J A;  4KYW A;  5LHI A;  1HW5 A;  1LEB A;  1YIO A;  2HYG D;  3TO6 A;  2K02 A;  2UZK A;  5DCM A;  3WTZ A;  2A07 F;  1JHH A;  2Y48 A;  4G6D A;  3FM5 A;  4EJT A;  1XB4 A;  4RAZ A;  3COA C;  2LF8 A;  2BV6 A;  2PJP A;  2X4H A;  3HUG A;  2JTV A;  1DUX C;  5JHU A;  3CUQ A;  2KJB A;  4Y13 A;  2IT0 A;  3TDU C;  4L0Z B;  4KUM A;  5D5U B;  5J6X A;  4HX8 A;  2YX7 A;  1FYK A;  2QQA A;  4KIB A;  3V8L A;  2IA2 A;  2EFP A;  1F1Z A;  4U0Y A;  3JSP A;  1QZY A;  4L5I A;  5LRS A;  3ZP5 A;  2PFB A;  2K4B A;  2H94 A;  3PFI A;  1R00 A;  2GWR A;  2FRH A;  4EVI A;  3J81 Z;  1K6O A;  4M9X A;  5IT9 Z;  1AWC A;  2W85 A;  1BC7 C;  1QPM A;  5CJ9 A;  1J5Y A;  1FBQ A;  1K78 B;  1TW2 A;  4CO8 A;  2FML A;  3I58 A;  2O0Y A;  4I01 A;  4YFK F;  2DBB A;  1MD0 A;  1BOA A;  2FQ3 A;  5CLS A;  3I64 A;  2GZW A;  4M72 A;  3L09 A;  5ILV A;  1MDM A;  1L3L A;  1GVJ A;  1ONV A;  5ILU A;  1SFX A;  5LHH A;  3ECH A;  4ETS A;  4Y15 A;  2XVC A;  4GXO A;  4ENN A;  3RKX A;  2QWW A;  1ON1 A;  2G7U A;  3L2C A;  3HRS A;  1WRJ A;  2G7H A;  2QZ8 A;  4AIK A;  1DPU A;  3I54 A;  5E1Z B;  2ZCW A;  1P4X A;  4Y17 A;  4CHU A;  5IT3 A;  3B02 A;  5FLX K;  1MJA A;  5LRR A;  4CYD A;  1KGS A;  2L3D A;  3OOP A;  2WV0 A;  4EGZ A;  4IJA A;  5F6F A;  4L5J A;  4ENM A;  2VON A;  2LDU A;  1J59 A;  2ZNY A;  1G3T A;  1XGS A;  1ZG1 A;  3T8T A;  5AIP A;  2CO5 A;  5E8I A;  3R4K A;  1BM9 A;  2MLG A;  1JXS A;  4R79 A;  2DU9 A;  3I5U A;  4HX4 A;  2A61 A;  4MEX F;  3GEZ A;  1B9N A;  2O6G E;  3RPU A;  3RTR A;  4UVB A;  3WE3 A;  3KCC A;  2ESH A;  3JSO A;  2V1X A;  1RZ4 A;  1RIO H;  2PMH A;  1U8R A;  2G9W A;  4I0A A;  3VEP A;  2TDX A;  3L00 A;  4A6D A;  5D8L B;  4P96 A;  2P7V B;  4EJO A;  1YFH A;  3M7G A;  1V4R A;  2BGC A;  1VTN C;  1R5H A;  1IF1 A;  3BOQ A;  4YFX F;  5IT9 K;  2Z3Y A;  4XRF A;  3RI4 A;  5LLQ A;  2OZ6 A;  3WTV C;  1IN7 A;  3HIF A;  2PQ8 A;  3DP7 A;  1G4D A;  1Q1H A;  3M1E A;  1MJB A;  1BC8 C;  1U5T B;  4IRH A;  2QVO A;  1A04 A;  4AWX B;  3GLX A;  1OYI A;  3I0T A;  2OA4 A;  3T8R A;  1CGP A;  3KE2 A;  4WWC A;  3AAF A;  4I09 A;  2EB7 A;  2JPB A;  2D45 A;  3TOB A;  4WXH A;  2ZO4 A;  1SAX A;  3BRO A;  5JFR A;  3KEO A;  1XDS A;  3ABT A;  3W6K B;  1O3Q A;  1IXC A;  1GXQ A;  2D2W A;  1IW7 F;  4M9Z A;  3TGN A;  1DPR A;  1QGP A;  4N9H A;  4A0X A;  1J0R A;  4ZZL A;  1E17 A;  3ULQ B;  4BHC A;  5DUI A;  1S7O A;  2M8E A;  5HLG A;  1QO0 D;  1TQI A;  4HV6 A;  1ZRE A;  4G7Z F;  1TW3 A;  3EET A;  2KIU A;  4RGR A;  5DDG A;  3WTW C;  3FM3 A;  4WX9 A;  3WGI A;  1HW2 A;  5LGU A;  4XLP F;  1ZAO A;  4HQM A;  3ZMD A;  4ESJ A;  4EV0 A;  4A5N A;  5A2Q Z;  1FYL A;  5DCM B;  2DQR A;  4ZYE A;  2DT5 A;  5FB2 A;  1R36 A;  2L4A A;  2NRA C;  3IKV A;  1JE8 A;  2A69 F;  2RN7 A;  1YW9 A;  4YFN F;  4OIP F;  2YPR A;  3F22 A;  4UUV A;  3MQ0 A;  4ASN A;  2ZXJ A;  3C18 A;  3CUQ B;  3KZZ A;  3KP2 A;  1RI7 A;  3EDP A;  4RAY A;  2KRF A;  1PUE E;  4A0Y A;  1B59 A;  1SD5 A;  1KU3 A;  5LEJ A;  4A6E A;  1NHA A;  1ZGA A;  1FZP B;  3R61 A;  2M5W A;  1I6X A;  2W57 A;  2QQ9 A;  2NNY A;  2YX4 A;  3FX3 A;  1FX7 A;  1ZHF A;  1I27 A;  2KIM A;  1KQ0 A;  2UXX A;  2V6C A;  1J2X A;  4HA8 A;  1EH6 A;  1YO5 C;  5H20 A;  5KK1 A;  3VOD A;  4O3M A;  1BI1 A;  4YII A;  4HF2 A;  5DV5 A;  3Q5F A;  3KET A;  1IRG A;  1R1V A;  3C1D A;  4UVA A;  2HTJ A;  1UB9 A;  4BNC A;  2P8T A;  3MZY A;  2DK8 A;  2F2E A;  3K69 A;  3WU1 B;  5CVJ A;  2CW0 F;  5BMZ A;  5KVR A;  2XHK A;  2IJL A;  3K9T A;  2MA3 A;  1O3R A;  1ZGJ A;  3GYH X;  3FMS A;  4GYG A;  1XGM A;  2IVM A;  1BJA A;  3W6J B;  2C6Y A;  4M9S A;  1G3S A;  5L3F A;  2O8X A;  2GA1 A;  2M87 A;  1HBX G;  1REP C;  2EFN A;  3E6M A;  3KP7 A;  1U2W A;  1D8K A;  1U78 A;  1P92 A;  2QQB A;  2A5Y B;  1UFM A;  2E7X A;  5H6R A;  1HKQ A;  3CUQ C;  3HTU A;  5F64 A;  4GYI A;  4ENK A;  1YYV A;  5HLI A;  3HRM A;  4GO1 A;  4S04 A;  3E6B A;  4EJV A;  3JTG A;  4OIQ F;  3WGG A;  2PBI A;  2HQR A;  2VOO A;  2KIF A;  3F8B A;  1ULY A;  3LAJ A;  5ICG A;  4EM2 A;  2EK5 A;  2A6H F;  1QNT A;  1W4M A;  1UST A;  5HLH A;  1TNT A;  2FA5 A;  2CGP A;  1TLH B;  1LVA A;  2DO7 A;  3C3W A;  1ZAR A;  3SHF A;  3E6D A;  2VBX A;  4ZZD A;  5HVQ C;  4ZYD A;  4YG2 F;  2FXA A;  3BP8 A;  1OPC A;  2F5F A;  2K7L A;  3R60 A;  3M8E A;  4I02 A;  4BHB A;  3CDH A;  3F72 A;  3T0Y A;  4TV7 A;  2VN2 A;  1FOK A;  3Q9V A;  3DFG A;  5L3E A;  1MJ9 A;  1RUO A;  4AD9 A;  4FT8 A;  5CVV A;  3LQR A;  5ERI A;  3V8J A;  1F9N A;  4U88 A;  3WG9 A;  1DP7 P;  1USS A;  3F23 A;  1XMK A;  2XV4 S;  1BI3 A;  3BPX A;  4B09 A;  3V4G A;  1KU7 A;  4H0E A;  3J80 Z;  1ZN2 A;  3DQV C;  3QU3 A;  3VB2 A;  1S8N A;  4MTD A;  3V7C A;  1D5V A;  2VBY A;  2RV8 A;  3ZMU A;  1J75 A;  1UCR A;  4M73 A;  2EFW A;  4U0V A;  3MFK A;  3DPL C;  2QM3 A;  2IRF G;  3HTS B;  4L18 B;  1FLI A;  2NYX A;  4WK8 F;  2VC0 A;  2JT1 A;  2GAU A;  4LJZ F;  4MGR A;  2CG4 A;  1RUN A;  3R6S A;  3GZ5 A;  3HHG A;  2P5L C;  3K2Z A;  4XSZ F;  2ZKZ A;  3E5X A;  3WE2 A;  2VE8 A;  2QUF A;  2DPU A;  4LLG F;  3I59 A;  1PP8 F;  3GFL A;  3CO7 C;  3GUD A;  3MCZ A;  4KFC A;  2V79 A;  3FMR A;  1R7J A;  2DW4 A;  1Z9C A;  2ISY A;  1IN8 A;  3ZN1 A;  3ZMT A;  1WI9 A;  4KMF A;  1YG2 A;  2D1H A;  3BJ6 A;  2VOP A;  4M6X A;  3P7N A;  5L3B A;  2HQN A;  5J8C A;  1XDU A;  1FP1 D;  2RC4 A;  3FHZ A;  1H9G A;  1W7P B;  3FXQ A;  3V7S A;  4LB5 A;  2QBY A;  3GX4 X;  4A5M A;  1TQP A;  3BZ6 A;  5E18 F;  1Z7U A;  2XKO A;  1ZRC A;  2OZU A;  4LK1 F;  2DAO A;  3SXY A;  4FHT A;  2J5P A;  2PMU A;  5BS6 A;  5LBQ A;  4E70 A;  1HQC A;  3KP3 A;  3KEQ A;  1I1G A;  3ROU A;  4EM1 A;  2EA2 A;  1EV7 A;  3BJA A;  1Z05 A;  3HYI A;  1R1U A;  1P4A A;  3KP4 A;  2R7F A;  4LGW A;  3ZMS A;  2E1C A;  4OIN F;  2HKX A;  1CF7 A;  4AIH A;  2W24 A;  5E8G A;  1FBU A;  3J7A O;  1B4A A;  1EH8 A;  1U6G A;  1LDD A;  4EQQ A;  1SMY F;  4R8H A;  1T98 A;  3P9C A;  5DUK A;  3ERE D;  2EWN A;  2VOD A;  2GIV A;  3F8N A;  2DTR A;  3TQN A;  4ZYG A;  1IZ1 A;  1W5S A;  5K5O A;  4P9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...